4EM0B

Staphylococcus aureus marr in complex with salicylate and kanamycin
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
175
structure length
150
Chain Sequence
TAAAKFEMLSQEFFNSFITIYRPYLKLTEPILEKHNIYYGQWLILRDIAKHQPTTLIEISHRRAIEKPTARKTLKALIENDLITVENSLEDKRQKFLTLTPKGHELYEIVCLDVQKLQQAVVAKTNISQDQMQETINVMNQIHEILLKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Staphylococcus aureus MarR complexes
rcsb
source organism Staphylococcus aureus
molecule tags Transcription/antibiotic
molecule keywords Uncharacterized HTH-type transcriptional regulator SAR2349
total genus 54
structure length 150
sequence length 175
ec nomenclature
pdb deposition date 2012-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4em0B00
4WCGA 2XKOA 3IKVA 4MQ9F 2O8XA 5BPIA 4HBLA 4R79A 4IVNA 2Z33A 1FLIA 2CW0F 5CVRA 1J5YA 4EM2A 1K78B 3NRVA 4L9TA 5HDKA 1QBJA 2MBFA 2A61A 3I4PA 5H6RA 1SD6A 3Q9VA 3RPQA 2LF7A 5E18F 2XVCA 4A0ZA 2P8TA 2ZKZA 4CZZA 3BOQA 4MGRA 2CGPA 4Y17A 2F5CA 4DQ2A 1V3FA 4KIFA 3H3UA 1MD0A 2QM3A 4OOIA 1ZRFA 4I01A 4MEXF 4L18B 4G94A 2HYGD 1FYMA 3HOSA 1ZRCA 2FF4A 2KIFA 1ZN2A 1XMAA 1BM9A 2G7UA 2LF8A 4RAYA 1SMTA 3E3VA 5D5XB 4AIKA 2QYOA 1FT9A 2A07F 2DK5A 4M9ZA 3GFMA 1P92A 1XGSA 4ENKA 4U0YA 2RGVA 3O3KA 2GQQA 4QWQA 5F6FA 4ZH4F 3FXQA 4HZFA 3ABTA 3U9GA 1ZARA 2RQPA 1RIOH 1T39A 4O3MA 3BY6A 5CYVA 4YIFA 2QBYA 1MDMA 4YFXF 2GA2A 2O03A 1RUOA 5LHIA 3DF8A 2MLKA 4A0YA 5K5OA 2IP2A 2CQKA 3FMQA 4LLNA 1SFEA 4UVBA 3IWFA 3HRTA 1YQAA 3WU0A 3ZN1A 1XGMA 3ZMTA 2P5VA 4BYYA 3CDHA 2QUFA 3L09A 1R1VA 5DYMA 4GXOA 2V1UA 1HQCA 3EYIA 3ECOA 4EVIA 2E7WA 4O6JA 2PN6A 3K2ZA 2XAJA 5D4SA 4BNCA 4LJZF 2BV6A 4BH9A 5CJ9A 3E6MA 4Z2YA 3W6JB 2VODA 1D5VA 2AS5F 4P9UA 2L54A 1TNSA 1R1UA 2EFWA 3ZMDA 5AIQA 1U3EM 1KGSA 4G7OF 5CVUA 2EK5A 3GVAA 4LGWA 3QRFF 3ZMVA 3KFWX 4WWCA 4IJAA 1WWXA 1W7PA 5J8CA 1JE8A 2PJPA 2HOEA 5ILSA 3SXYA 1HW2A 4M72A 3K1NA 3F6VA 1XMKA 5BMZA 2O0YA 1Q1HA 2EFQA 3HOTA 4M6XA 1NHAA 3BPVA 1LDDA 5LGNA 4Q5SF 2KKOA 1I1GA 1R22A 5CLSA 2B0LA 1UB9A 1S8NA 4L5JA 1GXQA 3J81K 2VT2A 1JXSA 1KA8A 2JSCA 4HV6A 3ZMSA 3KP5A 1ZG5A 3KLNA 4L0ZB 1D3YA 2WC2A 4N9IA 3RYRA 2PFBA 3FMSA 1HBXG 5H20A 3HIFA 4RB3C 4Q47A 3M8EA 5HLGA 5J8FA 1O57A 1J75A 1SAXA 1L3LA 1R5HA 1ZYRF 2JT1A 4WXHA 2CG4A 2XAHA 1OMIA 2EFNA 2DI3A 4ENNA 2VN2A 4WK8F 3KE2A 1HKSA 3SFZA 2G7HA 3ERED 1JHHA 1E17A 1BJAA 4EM1A 1BIAA 1S7AA 4RS8A 1T38A 5CVIA 4P5OA 3K9TA 4A0XA 4G6DA 5LRRA 4I2OA 3TDUC 1HSJA 4FT8A 4RAZA 2VBXA 1IN7A 2H09A 1G3WA 3GZ5A 4EJTA 4KN7X 2YPRA 4U88A 3JSPA 1DPUA 5BPDA 3GZ6A 4ESFA 3HRSA 5D5VB 3KZZA 4ZYDA 3IRQA 3I0TA 5IT9K 4GYGA 4PGHA 2NYXA 3I71A 2VE8A 2EFOA 3T8TA 5D6EA 4PCQA 1IW7F 3O6BB 4HX7A 2P4WA 2ACJA 2OU2A 2YU3A 1MJ9A 3U2RA 2DU9A 4OIQF 5ICFA 1H9TA 5JFRA 1P4XA 2M1BA 1O3SA 5DDGA 2NNYA 1DUXC 5HOOA 4GCVA 3CO6C 5E17F 4P96A 2Y75A 1R58A 3G3ZA 5E20A 1HW5A 2BE5F 2Y48A 3R60A 2PG4A 4YFNF 3ZP5A 4UHTA 1HKQA 3EDPA 1O3RA 4LLLA 1U5TC 1XSXA 2A5YB 2YX4A 3V8JA 5E8IA 3SZTA 1USSA 4CYDA 4L9NA 2MH2A 2MC3A 2V1DA 1XDSA 2ZO4A 3CO7C 1R23A 4RGXA 2VE9A 1EH7A 3KETA 2HTJA 2PMHA 5L3EA 1XGOA 3COAC 2J5OA 2XAGA 5JVTA 2ADUA 4OIPF 1TQPA 2IVMA 4HV5A 5L3BA 3OOPA 4AWXB 3GF2A 2LKPA 5L3DA 3KLOA 3MEXA 5DCMB 4AIHA 4H0EA 3P9KA 1UCRA 4G9YA 5KVRA 3L9FA 1DDNA 1OKRA 4ENMA 4LK1F 4S04A 3QU6A 3CUOA 2P5KA 4MTDA 3WODF 5LHHA 3BP8A 3KP2A 5E1WA 2QENA 2ZNYA 4HF2A 3F21A 4XRFA 2QQ9A 4I0BA 3HTSB 4I98B 3HSRA 4BQAA 3LQRA 3CJNA 1T2KA 1IF1A 1BOAA 3MQ0A 2K4BA 2PI0A 3J81Z 1IN5A 3VEPA 1F5TA 4ESBA 3WE2A 5JHUA 2FBHA 3E5UA 4OINF 4IPAA 2W84A 4KYWA 1IXCA 3E5XA 1YTYA 1ONVA 3DEUA 4IF4A 3ZN0A 1QZYA 2ZMEB 2HFHA 4GGGA 2A69F 1BI3A 2ZFWA 4KN4X 3IHUA 2WTEA 1BN5A 1FBUA 3WTSC 3GFJA 4LFUA 2JZYA 2KIUA 2BBYA 3FM3A 3T0YA 3I5UA 4KDPA 4XLNF 1Y0UA 4KT5C 3WG9A 1U78A 1MGTA 5ERIA 2QZ8A 3I59A 2Z99A 3LA3A 1K7AA 2HZTA 5L3FA 1IXSB 4NB5A 3V8KA 3GFIA 1R7JA 1ZHFA 2O61A 2QVOA 4OMYA 3TOBA 3SZPA 1WKMA 4B09A 4HOBA 1FOKA 3RKXA 1S7OA 1OPCA 1T6SA 1VTNC 2HR3A 1ZAOA 2BEOA 3DPLC 2COMA 1FC3A 4EQQA 3KP3A 1OYYA 1Z05A 4GO1A 2E1NA 3FXUA 3WE3A 1ZLJA 2HGCA 1LNWA 1RZ4A 1EH6A 2F5EA 1L0OC 4IHSA 2VOOA 2K86A 2VT3A 1LJ9A 2H94A 3TKYA 1PDNC 1QGPA 4HQEA 4CGZA 3R0AA 3CUQB 3R0JA 1LVAA 2D2WA 3F72A 2MA3A 3N4MA 1FZPB 2DQLA 1YW8A 3VODA 3T1BA 1TNTA 3RTRA 5ICEA 3GX4X 2UXNA 3I53A 1QPMA 1SFXA 4OIRF 5LGUA 1ULYA 4I02A 1KU9A 3DV8A 1CF7B 2JRTA 3P9CA 3T8RA 1O3QA 1HKTA 1YFHA 1B59A 2V1XA 2LNBA 3WTZA 1RUNA 3JTGA 3HUGA 1MDMB 4ZYEA 5HS8A 1H0MA 5FLXK 2GIVA 4HF0A 3K69A 1RI7A 4KNYA 1U5TA 2KJCA 4CO8A 1B1BA 3RKWA 3C18A 3LAPA 2Z5UA 3CUQA 2XAQA 4EMSA 4BHBA 5LRSA 1B9NA 3IC7A 2FOKA 2DPDA 3OV8A 4UUVA 1FNNA 5HLHA 3BZ6A 4MHGA 2M87A 3FHZA 5D4RA 3ZMZA 1R1TA 3WGIA 2ZCWA 2FBKA 1XSVA 2HDCA 4OIOF 2Q0OA 4HLYA 1ODDA 5LHGA 3MZHA 3JTHA 4D0PA 3SQNA 3LA2A 2YR2A 4QLCU 3J80Z 2XKPA 4CICA 4AD9A 3Q9SA 3NQOA 5DD8A 1F1ZA 4IRHA 2ELHA 4HX8A 4NHJA 1I27A 2PQ8A 3D5LA 3BJAA 1XN7A 2P6TA 2RC4A 2K7LA 5FD5A 2BGCA 2L4AA 2PBIA 2DLLA 4ON0A 1GXPA 2OD5A 5AONA 3VB2A 3E6BA 1FX7A 4YG2F 3AAFA 2W24A 3RKYA 3ABUA 1XCBA 2K4JA 4Q48A 3R6SA 4EJUA 1W7PB 3WTYC 3RPUA 3BJOA 1FYLA 4S05A 4WXCA 2NRAC 4OU0A 2H6CA 4AIJA 3DQVC 4LLGF 2CSOA 3KP4A 2R7FA 2L4MA 4HDVA 4OMZA 5TRDA 2WV0A 2FQ3A 2M45A 3T5XA 2Y0MA 1BI2A 1YW7A 3E5QA 2C6YA 2VC0A 3O2PE 1D8KA 3LWFA 3FX3A 2VBYA 1FBSA 4U7DA 1D8JA 3F23A 3HSFA 2RVCA 4ZZLA 3J7AO 4MQVA 3S2WA 2Q2EA 3L7WA 3TGNA 2A6HF 1YO5C 3QP5A 1YIOA 4HQMA 1KU3A 1YYVA 1J7KA 3CTAA 4MEYF 2RDPA 2FMYA 5TJJA 2L01A 3LFKA 1YS7A 4ESJA 1I6XA 4R8HA 2OZ6A 2EFPA 2K27A 2XROA 5HDGA 2UXXA 1Z6TA 5IT9Z 5HLIA 4G8XA 5ICGA 1TW3A 4BAYA 4CDGA 5DUIA 2P7VB 3ROUA 3IKTA 2GZWA 4PGGA 2HQRA 2LSOA 1YG2A 4PZJA 1BI1A 1G3SA 3DP7A 3FF5A 1YLFA 3K1MA 4JQFA 1SFUA 4IRIA 4GYIA 3QPTA 1U6GA 5A2QZ 3QAHA 4L9VA 1IUYA 5L3CA 4LB6B 2ESNA 3MCZA 2DPUA 2DT5A 2RV8A 1R36A 3C7JA 4P9FA 1IAWA 1Z6RA 4UVCA 1B6AA 4LG0A 4RGRA 3F8CA 3WGHA 2P5LC 2D1VA 3H92A 3F22A 4I0AA 2GA1A 3M7GA 3KCCA 3GYHX 4ENJA 1SD5A 1G6NA 3JW4A 2JPBA 4KIBA 3F8MA 2EV6A 2H6BA 4CHUA 1GVJA 2EJRA 1TQMA 2XRNA 1LDKB 4ZYGA 4LMYA 1IN4A 4LK0F 2FE3A 5HS7A 4EGZA 5JI6A 1ZG3A 5D8KB 4KA4A 1STZA 1UFMA 2PMUA 2NAZA 5DCFA 3MZYA 3IL2A 4FX0A 2RKHA 1AOYA 1IXRC 4TV7A 1OR7A 4LG0B 2ESHA 2R3SA 5FGMA 5F1RA 3GXOA 4MNUA 4IHTA 2D45A 1QNTA 4EJOA 2J5PA 4A5MA 1HSTA 3EQLF 4U7BA 2YX7A 3HHGA 4A6DA 4HAMA 3F8FA 5BQTA 3JAMZ 3C1DA 5ICCA 2L02A 3ULQB 3P7NA 3HYIA 4UVAA 3LQQA 2XV4S 2DW4A 1ZREA 4HA8A 1FBQA 4MTEA 3L2CA 5DEQA 4ETSA 5DD4A 2KJBA 2X4HA 3JSOA 3F6OA 2F2EA 1OYIA 4PDKA 6PAXA 5ED4A 5KK1A 4G6QA 4A12A 2W85A 1XCVA 2NS0A 1J0RA 3ZQ7A 3CUQC 2F5FA 4KUMA 4B8XA 3DPTA 2EA4A 2DTRA 5K5RA 2OBPA 1R5GA 1U8RA 2OAZA 3DXJF 1ON1A 3FMRA 4EV0A 3F8NA 1EV7A 1REPC 2JPCA 2V79A 2Z3YA 1UHWA 1FYKA 3HRUA 3V7CA 4L0YB 1OYWA 3PFIA 3V7RA 3Q5FA 1IRGA 1SMYF 3FWEA 4LB5A 2VBWA 3BJ6A 2MD5A 1XSDA 3ZPLA 1UHMA 1QO0D 2CFXA 5LLQA 1X3UA 4A6EA 1K78A 4WF2A 5FFZA 1KYWA 5D6FA 5BOXA 1LDJA 2FA5A 3HRMA 1CGPA 2KIMA 1KQ0A 1B4AA 3MFKA 4LD5A 3I58A 1F4KA 2XHKA 3RIRA 5J6XA 2OZUA 2LDUA 2DO7A 4L5IA 4KICA 4I7HA 2HTSA 4XSZF 1PP8F 3WTWC 1XD7A 4M9SA 2QQBA 3EUHA 1MJAA 1FSHA 3L00A 4O5VA 3BPXA 2RN7A 1MJBA 4FHTA 5D8LB 3GWZA 4I09A 1TW2A 2STWA 3K0LA 2X0LA 3KP6A 4XBFA 4UNOA 3ZMUA 2MH9A 3TOAA 5D5UB 2ISYA 5K5QA 2FU4A 3P9IA 1I5ZA 1KYZA 3KZYA 2XAFA 3MWMA 2IJLA 4UV9A 2FXAA 2CYYA 3RDIA 3JAMK 3IRRA 4BXUA 2IW5A 3F8BA 4KMUX 3TDZC 1J59A 2L3DA 5LEJA 3LSTA 4G7ZF 3GO5A 5IT3A 2FNAA 2HS5A 2JTVA 4KFCA 1ZH5A 3FXRA 1JHFA 3TO9A 2PEXA 1EH8A 1XB4A 4F7ZA 3I64A 1PP7U 2QBYB 2STTA 3WTTC 1ZGAA 3QP6A 1FY7A 3HTUA 1W4MA 1I1SA 2PLYA 5E1XA 2DK8A 4L9JA 4HYEA 2O6GE 4EGYA 3ECHA 2HKXA 1SD7A 1QQIA 3DKWA 2UWMA 4KIGA 2VBZA 1Z91A 1IRFA 2QWWA 5ILVA 1FP2A 1P4AA 2EV0A 2IRFG 3FM5A 4M6YA 4RB0A 2GXBA 2HWVA 2IA1A 1U5TB 4K2EA 4ZYHA 4M74A 3BROA 2D1HA 1SD4A 3H3ZA 2IA2A 3GLXA 3QOPA 4UV8A 2V9VA 1GHCA 3ISPA 1O7FA 2ZBKA 2MLGA 4U0VA 5HDNA 3RJPA 1G3TA 1S3JA 5CVVA 5E8GA 2GXGA 4A5NA 2A68F 3WTXC 4HF1A 1WQ2A 3U1DA 4M73A 5A2QK 4BHPA 2F5DA 1MZBA 3E6DA 1HW1A 3B73A 1K79A 1TLHB 4IRGA 1LEBA 5FB2A 1PUEE 2V6CA 3SHFA 3NEUA 1V4RA 5FD6A 3ML6A 3IWZA 1JGSA 2EB7A 4EM0B 1Z9CA 2W25A 2ZXJA 1S6LA 2ZNZA 1DPRA 1P2FA 2H27A 1T98A 3KEOA 4RB2C 5FFXA 5LBQA 3M9AA 2K02A 1KU7A 3QPHA 5D5WB 1ON2A 2XIGA 1S29A 1J2XA 4HX4A 2P6SA 1R00A 3RYPA 2TDXA 1G3YA 5HVQC 5JR3A 2XUBA 2XASA 3EETA 3LA7A 2CO5A 2YSRA 3V8LA 2DQRA 1ZGJA 2O3FA 1F9NA 1T0FA 1ZRDA 5E1ZB 2P7CB 1YS6A 3V4GA 3GEZA 1TTYA 2HYFA 2OA4A 2GAUA 2M5WA 5LEKA 1H9GA 2ZMEA 3QU3A 2FRHA 2WWYA 1IN8A 1KQ8A 1E2XA 5DUKA 3RI4A 1WRJA 5AIPA 1USTA 3TO6A 1WSUA 1FSEA 1LQ1A 1WI9A 2GWRA 4Y13A 1BI0A 2IPQX 2W57A 3HHHA 1Z1DA 2AXLA 3N97A 2VXZA 4Y15A 2VONA 1MKMA 4CXFA 2DAOA 2Q8KA 2FNPA 2QLZA 3BWGA 1O3TA 3WTVC 1A04A 3PQKA 3LAJA 2R7DA 1FPQA 5K1YA 1DP7P 5LGTA 2KRFA 1TQIA 3WGGA 1BBYA 1P4WA 3VFZA 3M1EA 3J80K 1KU2A 2FEZA 4M9XA 4FX4A 3EYYA 1J9IA 1FWZA 5EEGA 5DV5A 3D0SA 3DFGA 3TQNA 4AVPA 3VOEA 1YW9A 4R1HA 1BC7C 3WU1B 2E7XA 3GUDA 3GFLA 4HLXA 1AWCA 4RGUA 5FO5A 2M8EA 3BDDA 4EJVA 1P6RA 2A3SA 4KMFA 3PQJA 5CVJA 4P55A 3FZVA 4UXNA 1CF7A 2HQNA 1KQ9A 2M30A 5ILUA 2CWEA 2DFIA 2DBBA 2G9WA 1Z7UA 1G4DA 2HEOA 4N9HA 1ZLKA 1IN6A 2EA2A 3K1PA 1BIBA 3V7SA 1W5TA 1K6OA 1XDUA 3GW2A 2UZKA 2FMLA 4EJWA 1LB2A 4U0WA 2IA0A 1FP1D 4JBAA 1ZG1A 3R4KA 2FSWA 5F64A 3WTUC 4M71A 4N0BA 3C3WA 4YFKF 4BHCA 4DNCA 2A6EF 1BC8C 4A2UA 4XLPF 2QQAA 2VC1A 1W5SA 2OQRA 2NNNA 3W6KB 2OQGA 4G7HF 5BS6A 2FBIA 4ASNA 3KEQA 2HKOA 3REOA 2IT0A 2EWNA 3R61A 5L3GA 1C0WA 3TO7A 4IXAA 4HW0A 4YIIA 4XSXF 3MAJA 1XGNA 1QZZA 2RNJA 3F3XA 3E6CC 3CLOA 3I59B 5HS9A 2EV5A 5H6QA 4JK1X 2VOPA 3KP7A 4RGSA 1TBXA 1LEAA 2ZJ2A 4Q4ZF 4WX9A 3B02A 3E97A 4HDUA 1O7LA 3G73A 3ELKA 4WXDA 4E70A 1RNLA 5EEHA 3HSEA 1HXDA 4ZZDA 2XGXA 1IZ1A 5FLXZ 1U2WA 2Z9OA 5DCMA 2E1CA 4RB1A 2ETHA 1W7PD 3M8FA 3I54A 4NQWA 2ISZA 2BYVE 1B9MA
chains in the Genus database with same CATH superfamily
4WCGA 2XKOA 3OIQA 3MKYB 3IKVA 4MQ9F 3N05A 1VFCA 3K2AA 1AA7A 4OAZA 4A3GJ 3OYMA 3BG6A 2KT0A 2O8XA 3OMYA 5BPIA 3O8HA 1A5JA 1X1PA 4HBLA 4R79A 4IVNA 2HVSA 2Z33A 1JI8A 2IAIA 1FLIA 2CW0F 4XL9A 5CVRA 2Z2SB 1J5YA 4EM2A 1ETKA 1K78B 1U0JA 3NRVA 4L9TA 2JWTA 3H5AA 5HDKA 1IG7A 4P1WA 1QBJA 2MBFA 2A61A 4PJLA 3I4PA 5H6RA 1SD6A 3CCUI 2DA4A 4A3KJ 2KQRA 3Q9VA 5B5EC 3RPQA 2LF7A 5E18F 2XVCA 4A0ZA 4BE1A 2P8TA 2ZKZA 4CZZA 2NVTJ 3BOQA 4MGRA 2CGPA 4Y17A 2F5CA 1XMXA 2DFEA 2NVQJ 1T95A 4DQ2A 1V3FA 5M3MJ 4KIFA 3H3UA 4XOTA 1MD0A 4RBOA 2QM3A 4OOIA 1ZRFA 4I01A 3VYRB 4MEXF 2Y0SN 2E2HJ 4L18B 4G94A 2HYGD 1FYMA 2DFHA 4UB6C 3HOSA 1ZRCA 2FF4A 1Y6IA 1MMAA 1XMAA 1ZN2A 2Q2EB 1BM9A 2WAQA 2G7UA 2LF8A 4RAYA 2VASA 1SMTA 3E3VA 2AXTC 2XSDC 3OY9A 5D5XB 2CU7A 4AIKA 1JKRC 2R92J 3DTIA 1JT6A 2QYOA 1FT9A 1WH7A 2DK5A 2A07F 2HNHA 4M9ZA 3VSLA 3WHBA 3GFMA 2ID3A 3J7AY 2NVYJ 1FEXA 1BW5A 1P92A 1XGSA 4ENKA 2QQ8A 4U0YA 5FLMJ 2BY1A 2RGVA 1X2NA 3O3KA 2GQQA 3ASNH 4QWQA 5F6FA 4ZH4F 1A31A 3FXQA 4HZFA 2HDWA 4E7IA 3ABTA 3U9GA 1ZARA 1QVUA 2ZFUA 2DA5A 3OIOA 2RQPA 1RIOH 1T39A 4KT6A 1P7JA 4O3MA 2DA6A 2E71A 3LSGA 3BY6A 5CYVA 2QKLB 3BR1A 3MN2A 1NTCA 4YIFA 2QBYA 1MDMA 4FCYA 2W4SA 4YFXF 2GA2A 2O03A 1RUOA 1N25A 4PK4A 5LHIA 3CC7I 3DF8A 2MLKA 1X58A 4A0YA 5K5OA 3KEYA 2IP2A 3OYDA 2CQKA 1HCRA 2M4GA 3FKJA 3FMQA 3BQZA 1D1AA 4G12A 3DWLE 4LLNA 1SFEA 5F0FA 4UVBA 3IWFA 3HRTA 1YQAA 3WU0A 3ZN1A 2L7KA 1XGMA 3ZMTA 2P5VA 5LD2C 1BL0A 1LE8A 4BYYA 3CDHA 2QUFA 3L09A 4II3A 3IAM2 1R1VA 2L9SA 2VL8A 5DYMA 4GXOA 2V1UA 1HQCA 2BOLA 2R5YA 1E3PA 3EYIA 4MLOA 3ECOA 4YRVA 2HU9A 2HXOA 2ME0A 4EVIA 2E7WA 2XDVA 2PN6A 4O6JA 3CDLA 4JYKA 3CCRI 3K2ZA 2XAJA 1E3HA 3G1LA 1QZEA 5D4SA 4BNCA 4LJZF 2Q1ZB 2BV6A 3I4MJ 1Z21A 2GBYA 4BH9A 5CJ9A 3H3VK 4XLEA 4XLCA 2VJJA 3E6MA 2LFBA 3QPLA 4Z2YA 3W6JB 2VODA 5IP9J 1IRZA 1D5VA 2AS5F 4P9UA 2L54A 1TNSA 2DT6A 1R1UA 2RQQA 3ZMDA 2EFWA 2MYSA 5AIQA 1U3EM 1KGSA 4G7OF 2LK2A 5CVUA 2EK5A 3OWTA 2E19A 5C4XJ 3GVAA 2HXIA 2AO9A 4LGWA 3QRFF 3ZMVA 3KFWX 4PJMA 3DEWA 4WWCA 1T56A 4IJAA 4CA0A 3W2AA 1WWXA 1B8IB 1Z0XA 2VQHA 1W7PA 4F52A 2DMNA 5J8CA 1JE8A 2PJPA 2HOEA 5ILSA 3SXYA 2XF7A 1HW2A 3ZQCA 4M72A 3K1NA 3F6VA 3UKGA 1XMKA 3OYNA 5BMZA 2O0YA 1Q1HA 2EFQA 2X85A 3HOTA 2CQ7A 3OIPA 4M6XA 4AIDA 1NHAA 5KHDA 4XRMA 1QU3A 2E36A 3BPVA 4BU2A 1LDDA 5LGNA 2MGQA 4Q5SF 4LG3A 4N4OB 4ABZA 2KKOA 1VQ9I 1I1GA 1X2MA 5FRNA 1R22A 5CLSA 2B0LA 1HLVA 1UB9A 3JRDA 1S8NA 1MNMC 1GLNA 4L5JA 3L2RA 1GXQA 1ETQA 1VQPI 3J81K 2NOJB 2VT2A 5IP7J 1JXSA 1KA8A 2JSCA 4HV6A 2YUSA 4XN3A 4DW6A 3ZMSA 3HOUJ 3KP5A 1ZG5A 3HKZA 3KLNA 2HDDA 4L0ZB 1D3YA 1WCMJ 2R0QC 2WC2A 3CZ6A 2B63J 2DMQA 3CCYA 2WAFA 2DA7A 4N9IA 1ZR4A 3RYRA 4XKCA 2PFBA 1TT0A 3FMSA 1HBXG 5H20A 1WJFA 3HIFA 4RB3C 1X3ZB 3A2KA 1ETXA 4Q47A 3KPHA 3M8EA 3QPSA 5HLGA 2KDOA 5J8FA 1O57A 4B1RA 1J75A 1SAXA 5EF6A 3GTLJ 1D1BA 1L3LA 1VQKI 1R5HA 1ZYRF 2JT1A 4HNUA 4WXHA 2CG4A 2ELJA 2K9QA 2LP0A 2XAHA 2DJNA 4AU7A 3CMEI 3I55I 1OMIA 1HDDC 1IRXA 2EFNA 2DI3A 3G71I 4ENNA 1TWAJ 2VN2A 1NK2P 3BCAA 3OYKA 1R4NB 3M07A 4WK8F 3KE2A 3AG2H 1AHDP 1XX5A 1HKSA 3SFZA 1PUFA 2R7VA 1K83J 2G7HA 3ERED 2ECBA 2F5VA 1JHHA 1E17A 1BJAA 2P0WA 1BIAA 1S7AA 4EM1A 3GTMJ 1VQ4I 4RS8A 1T38A 5CVIA 4P5OA 4DYCA 3VSKA 4C9YA 3K9TA 4A0XA 2XF5A 4G6DA 4BDZA 3NWSA 2JN6A 5LRRA 1MSFC 3KYLA 1R9TJ 4I2OA 4CYCB 2Y2ZA 3TDUC 1WJAA 1MW7A 1HSJA 4FT8A 4RAZA 2CQQA 2VBXA 1ACIA 4A3CJ 1IN7A 2H09A 1A36A 3FDYA 2CH0A 1G3WA 3GZ5A 4JX5A 4EJTA 4ANJA 4KN7X 5EYRA 2YPRA 1U9NA 4RA2A 1FTTA 1RKWA 1MSEC 2XGCA 4FETA 1WJCA 4U88A 3BR2A 4XQFA 3JSPA 1DPUA 5BPDA 3GZ6A 4ESFA 3HRSA 5D5VB 3KZZA 4ZYDA 3BTCA 2HVQA 3IRQA 4IHXA 2HQ5A 2NS8A 3I0TA 4DOZA 2YU9J 2DDAA 5IT9K 2QCOA 3OYCA 4GYGA 4PGHA 2NYXA 5BNGA 1NK3P 3I71A 1YHQI 4CZCA 2VE8A 2EFOA 4C3HJ 3PSFA 3DEEA 5J4VA 4XM3A 3T8TA 5HNFA 1BR4A 3OYJA 3P5JA 2O8KA 4F55A 1QA6A 1Z3XA 4XICA 5D6EA 2K3FA 2KLOA 4PCQA 2A5WA 4A3EJ 3NARA 1LFUP 5IYBJ 1IW7F 1UAAA 4XK4A 3O6BB 2W1OA 4HX7A 2P4WA 2ACJA 4HNTA 1GT0C 2OU2A 2DCEA 1MJ9A 2YU3A 3LNQA 3K6GA 3U2RA 2DU9A 4OIQF 3BTLA 5ICFA 4CCOA 4IO9F 1H9TA 5JFRA 1X1AA 2L7MP 1P4XA 4EATA 4V19K 4ZYAA 2M1BA 3OYBA 2BXZA 1O3SA 1YIJI 2CV2A 4RMNA 5DDGA 2NNYA 1DUXC 4KITB 5HOOA 3K70C 2BVLA 4GCVA 3CO6C 5E17F 1W36C 4A3MJ 1ERDA 1P7IA 5M5XJ 2E1MB 4P96A 3S3NA 2VKVA 2LREA 2Y75A 1SVMA 2XPWA 1R58A 1MBFA 3G3ZA 3G1MA 2R7UA 3LOCA 5E20A 9ANTA 1HW5A 2BE5F 2Y48A 3R60A 5B1BH 2PG4A 4YFNF 3ZP5A 2PJRA 2K85A 4UHTA 1HKQA 1H8AC 4L5EA 1RR8C 1RPWA 3RZOJ 2BW3A 2JVHA 3EDPA 1O3RA 1OLTA 5K7ZA 4Y52J 4LLLA 1G59A 1U5TC 1XSXA 2A5YB 2DXIA 2OPTA 3AG3H 1GV2A 2YX4A 2F4OB 3V8JA 2JMWA 2M7AA 5E8IA 3SZTA 3WG7H 1USSA 5IY5H 2XF6A 1RRJA 4CYDA 1WGXA 2MH2A 2MC3A 2V1DA 3QOEA 4L9NA 1XDSA 4HSRA 1N75A 2ZO4A 3CO7C 1R23A 4RGXA 2L7ZA 4BS9A 5C44J 2VE9A 1EH7A 3KETA 2E5ZA 2HTJA 2PMHA 4PFOA 5L3EA 1XGOA 3JRIA 1UMQA 3I56I 3COAC 3GTGJ 2J5OA 4BGDA 4IZZA 1MH4A 3BR5A 4CCKA 2XAGA 2AQFA 2ZJQF 5JVTA 2ADUA 4OIPF 1LE8B 1TQPA 2IVMA 2LRDA 4HV5A 5L3BA 2BW3B 3MKLA 1ORKA 3OOPA 1EF4A 4G6TB 1OCPA 2XGDA 4AWXB 2NOGA 3GF2A 3SYTA 2LKPA 2VKHA 4A93J 1UZCA 5L3DA 3KLOA 1I3AA 3MEXA 1R71A 5DCMB 1Y1WJ 1IV8A 4AIHA 1OJLA 4ZDPA 4H0EA 3P9KA 1UCRA 4G9YA 5KVRA 2DFFA 2IS4A 3L9FA 1DDNA 4DGWB 3G1OA 3HPGA 1OKRA 4C2MJ 4ENMA 3S32A 4LK1F 4IKFA 1I39A 2AHQA 4S04A 3QU6A 3CUOA 3CCQI 1EA3A 2HOAA 4Z6YA 1VQOI 2ELKA 2NVUB 1D5YA 2P5KA 2H8WA 4MTDA 3WODF 5LHHA 5F08A 2KIQA 3BP8A 3M8JA 3KP2A 4M3DA 4YEJA 1JKQC 5E1WA 2QENA 4Y7NJ 2ZNYA 4HF2A 2K9NA 3F21A 2DTZA 4C2UA 4F92B 4XRFA 4D5FA 2QQ9A 1Y1VJ 2M0MA 2FUG2 1WJBA 4I0BA 4I98B 3HTSB 1LVKA 3HSRA 2K5CA 3CCSI 4CCJA 4RAFA 3CC2I 2KRCA 4BQAA 3S8PA 3LQRA 3CJNA 2IS6A 1T2KA 1YI2I 1IF1A 1BOAA 1ZGWA 4S0HB 3MQ0A 2K4BA 2VJ4A 3J81Z 2PI0A 3PJRA 4E7HA 1IN5A 1K4SA 3VEPA 4NC8A 4DIQA 1F5TA 2EIKH 4ESBA 1UG0A 3WE2A 5JHUA 2FBHA 3H5RA 4B48A 3E5UA 3OL3A 4OINF 4IPAA 3OYAA 5HODA 5FKNA 2W84A 4KYWA 1VNDA 2CRGA 2R7XA 1IXCA 2GM4A 3K4CA 2OCCH 3E5XA 1YTYA 2QF7A 1ONVA 3DEUA 4IF4A 3ZN0A 1QZYA 2L9RA 2ZMEB 3KIOA 2HFHA 2O7OA 1JKPC 4GGGA 2A69F 1BI3A 3CMMA 2ZFWA 3FXLA 4KN4X 4BQNA 4E7LA 3IHUA 4IQJA 2V9PA 2WTEA 3E7LA 3S3OA 1BN5A 3PSIA 1FBUA 3WTSC 1PVEA 3GFJA 4LFUA 1G2HA 3S1MJ 1X1DA 4ITVA 2JZYA 2KIUA 2BBYA 3FM3A 1ZTRA 3KX2A 3T0YA 3OR1C 5IYCJ 3CJTB 3I5UA 4LITA 4KDPA 4XLNF 1Y0UA 4KT5C 3WG9A 2R5YB 1U78A 3IAS2 3K4BA 2LD5A 4E7ZA 3VYSB 3FXJA 3DBLB 1X4PA 3TBIA 1MGTA 3EPZA 2NS7A 4N4NB 5ERIA 1VQMI 2QZ8A 2XSJC 3I59A 5J4YA 3DBRB 3S93A 4QTRA 2Z99A 3LA3A 3H36A 2HZTA 1K7AA 5L3FA 1IXSB 4GFBA 4NB5A 2WV1A 4HEA2 3V8KA 3GFIA 1R7JA 3TP0A 1ZHFA 2O61A 2QVOA 4OMYA 4E7JA 2VKDA 3TOBA 2I8DA 4OAYA 1T33A 3CDIA 4XR6A 3SZPA 5TGTA 1WI3A 3W3CA 2MW8A 1WKMA 4B09A 4IHWA 1MIJA 3OYEA 4HOBA 1FOKA 3RKXA 4DYQA 1S7OA 2IGKA 4CYCA 1OPCA 3OR2C 4BEHB 1T6SA 1VTNC 1WJDA 2X6OA 2HR3A 1ZAOA 2BEOA 3LMMA 5K7FA 3DPLC 2COMA 1FC3A 4EQQA 3KP3A 1OYYA 2F6CA 1Z05A 4GO1A 2A6TA 2E1NA 3FXUA 3WE3A 2KL4A 3HXLA 1JUPA 4D9JA 1ZLJA 2HGCA 1Y56A 3NAUA 1LNWA 1RZ4A 1EH6A 1MBGA 2F5EA 1L0OC 1OCOH 4HRIA 2V6EA 4IHSA 1I3QJ 2VOOA 3I9V2 2K86A 2DMPA 3C2GA 2CUEA 2VT3A 1Q1VA 3FXMA 5EEAA 1LJ9A 2H94A 3TKYA 1DP3A 1PDNC 1QGPA 4HQEA 2XB5A 2W82A 4CGZA 3R0AA 1HC8A 3CUQB 3R0JA 2LC2A 1LVAA 1BOBA 2D2WA 2MA3A 3F72A 3N4MA 4CCNA 1FZPB 2JA6J 1J09A 3BC8A 2L0KA 2DQLA 1YW8A 3VODA 3L2QA 3BR3A 3T1BA 4IOAF 1TNTA 3RTRA 5ICEA 3VYUB 4PFPA 3GX4X 3ZRGA 2UXNA 3I53A 1QPMA 2DA3A 2HPMA 2YS9A 2CW8A 1JTYA 2VQLA 3MZ8A 3PUBA 1SFXA 1G8XA 4OIRF 3GTQJ 5LGUA 1ULYA 2LY2A 4I02A 1KU9A 5EG0B 2E5NA 3ERMA 4I99C 1S72I 3DV8A 1CF7B 4XORA 2FQ4A 2JRTA 5JHFA 3P9CA 3T8RA 1O3QA 1HKTA 4BY7J 1YFHA 2RNGA 2WA0A 4D5CA 1YJ9I 3PO2J 1B59A 1AU7A 3RCOA 2V1XA 2LNBA 1W0TA 3WTZA 1IGNA 4NC6A 3EUAA 1JT0A 1RUNA 4IEJA 5J1RA 4BKXA 1X19A 2O9LA 3HGYA 3JTGA 4FISA 3HUGA 1O4XA 4DZJA 1MDMB 2LMDA 4ZYEA 5HS8A 1H0MA 5FLXK 4AC0A 2JRMA 2GIVA 4HF0A 1VQNI 3K69A 2V7FA 2KFDA 1V54H 1RI7A 4KNYA 1U5TA 2KJCA 4CO8A 1B1BA 3RKWA 3SDBA 4A3FJ 3C18A 4E7KA 3MVPA 3LAPA 3C2BA 1XPXA 4RLQA 2Z5UA 1S5LC 1BR2A 4PUSA 2L2OA 2FD5A 2CFOA 2E35A 3CUQA 2XAQA 4EMSA 4BHBA 3A01A 3PNVA 2M2EA 2DODA 4FE7A 5LRSA 1B9NA 3D5RC 2H1LA 1YE9A 2FOKA 3IC7A 3OV8A 5DM6F 2DPDA 4UUVA 2LTPA 1FNNA 4D7MA 5HLHA 3BZ6A 1JUSA 1WH5A 4HG2A 4MHGA 5LFAA 3K70D 2M87A 3FHZA 3BLYA 5D4RA 3ZMZA 2CQNA 1K4TA 1R1TA 3WGIA 1DU6A 2ZCWA 2FBKA 2DMUA 4ZJZA 3OYHA 1XSVA 2GXAA 2V26A 2HPIA 1PYVA 2HOSA 2HDCA 4OIOF 3HOXJ 3DKXA 2Q0OA 4RM3A 1SEUA 4HLYA 1ODDA 4YIRX 5LHGA 3MZHA 3RQ4A 2COBA 3JTHA 4D0PA 4A3BJ 4UB8C 3SQNA 1VQ8I 3HEFA 2TRTA 3LA2A 2YR2A 4QLCU 3J80Z 2XKPA 3IUOA 2TCTA 5E79C 2G0EA 4CICA 2QEXI 4AD9A 1ETWA 3DCFA 3Q9SA 3NQOA 3HBLA 5DD8A 1ZQ3P 1F1ZA 2JUGA 3M4OJ 4MIMA 4IRHA 2EQRA 5J3LA 2ELHA 3HOVJ 4PJ0C 2O5RA 4HX8A 4ZDLA 4NHJA 2B9SA 1FOWA 3LFUA 1I27A 1X1CA 2RAEA 4FTHA 2PQ8A 1QVTA 2VPRA 3HOZJ 3D5LA 2BVMA 3BJAA 4PJJA 3HDDA 1XN7A 1TL8A 2P6TA 2RC4A 2K7LA 3PNYA 5FKKA 2R7SA 5FD5A 2BGCA 5GAEJ 4IOCF 3W2VA 2L4AA 2PBIA 2DLLA 1FOYA 1OCTC 5C4JJ 2X9DA 4B47A 4ON0A 1GXPA 2OD5A 5AONA 3VB2A 1UJ8A 3SEZA 3K10A 2QSHX 4XIDA 3E6BA 1FX7A 4YG2F 5DS9A 3AAFA 2KIFA 2W24A 1JJ6C 3RKYA 3ABUA 1XCBA 2K4JA 4Q48A 3R6SA 4EJUA 3OYFA 1W7PB 1SVLA 1XC5A 2KMUA 3WTYC 3RPUA 3BJOA 1AKHB 2OV7A 2VI6A 3M1CA 5HLTA 1FYLA 1NG6A 4DJAA 2CV0A 4S05A 2DA1A 1LFBA 4WXCA 2M4KA 2NRAC 2XB0X 4OU0A 2H6CA 4AIJA 3BG7A 1T0FC 3DQVC 3CMAI 3ZQQA 4BJTA 4QPOA 1F36A 4JOMA 2CSOA 4LLGF 3KP4A 3Q0UA 5B1AH 2R7FA 1IC8A 5CQGA 2L4MA 3ZQLA 5FRMA 4NC7A 4HDVA 2JSPA 2CUZA 4OMZA 1MMNA 5TRDA 4KISA 2WV0A 3JRGA 2JA2A 1IDZA 4CSWA 2FQ3A 2M45A 3T5XA 2Y0MA 3WHCA 1BI2A 2WADA 1YW7A 1SANA 3E5QA 3FHNA 1V5EA 2LY9A 2VC0A 2C6YA 2LKSA 3O2PE 1D8KA 3LWFA 3BQYA 4X0GA 3FX3A 4BE0A 1F43A 2VBYA 1DQUA 1FBSA 3JRBA 4U7DA 1D8JA 4B3XA 1HOMA 3F23A 2LBFB 4ZTJA 5M5WJ 3HSFA 2RVCA 4ZZLA 3J7AO 3A0BC 4ZTFA 2ZSIB 3G2BA 4MQVA 3S2WA 3GTJJ 4QPQA 2K3PA 2Q2EA 3ZQIA 3L7WA 3TGNA 2A6HF 2R93J 1YO5C 3QQAA 3Q0WA 3GTOJ 2IGNA 2N8GA 3K4MA 1A35A 4DZPA 1YIOA 3QP5A 1WJ5A 2BHYA 4HQMA 1KU3A 1YYVA 1J7KA 3PUFA 1VQ5I 3CTAA 2EBIA 4MEYF 3J7YJ 2RDPA 2FMYA 3HKZN 4LIVA 5TJJA 2L01A 3LFKA 1YS7A 4ESJA 1I6XA 4R8HA 2OZ6A 3OSFA 2EFPA 2K27A 1ZK8A 1V5GA 3H5NA 3GTPJ 2XROA 3JRHA 3FISA 5HDGA 2UXXA 4BEHA 1Z6TA 5H2FC 5F0CA 5IT9Z 5HLIA 1GV5A 2KZVA 3LL7A 4G8XA 5ICGA 2BXYA 2R7WA 1TW3A 3HOYJ 5KAIC 4BAYA 4CDGA 5DUIA 2P7VB 3ROUA 3IKTA 2KPMA 2GZWA 5IYDJ 4PGGA 3S15J 1FJLA 2AQEA 3GMEA 2HQRA 2LSOA 5JVGF 1YG2A 2DYRH 3LSIA 4BJ6C 4PZJA 1BI1A 1G3SA 3DP7A 1TWGJ 5JLXA 3FF5A 1YLFA 3K1MA 1VQLI 4JQFA 1Z7LA 4NUBA 4BXFA 4MO7A 1SFUA 1D0YA 4IRIA 4GYIA 1Y8QB 3QPTA 3D5SC 1ETOA 1U6GA 4W1UA 5A2QZ 2Z16A 3QAHA 4L9VA 3MKWB 3TP3A 1ETVA 1IUYA 3JRAA 5L3CA 2R4GA 3G4SI 4LB6B 1K6YA 1TT5B 2ESNA 3MCZA 2DPUA 2KDZA 2DT5A 2RV8A 1R36A 3C7JA 4P9FA 1Z67A 1IAWA 1E0EA 1UHSA 1Z6RA 2VB6A 1BA5A 3CLQA 2HZDA 4UVCA 1B6AA 4LG0A 4RGRA 1ITYA 4XRSG 2XPVA 1X1BA 4W97A 3F8CA 3ZR8X 3WGHA 2P5LC 3DPUA 5FKMA 2HQAA 2D1VA 3A0HC 3H92A 5KCMA 1U8BA 3DLLF 3F22A 4I0AA 2GA1A 3M7GA 4RDUA 1IUFA 5GAGJ 3KCCA 1Z77A 3GYHX 3ABKH 2DA2A 4ENJA 1SD5A 3K4JA 1G6NA 3G6EI 5IP6A 3BG3A 3JW4A 2JPBA 4KIBA 1IV6A 3F8MA 2LKXA 3CD6I 2EV6A 4EEFG 2H6BA 4CHUA 1GVJA 2EJRA 1YJWI 1TQMA 2XRNA 1LDKB 3PIOF 5CKTA 1MMDA 4MFEA 4ZYGA 1WPKA 2V4JC 4LMYA 1IN4A 4LK0F 4RM2A 2VPLA 2FE3A 2EIMH 1JKOC 4H4KC 2Y9YA 1TWFJ 2EZKA 5HS7A 4EGZA 5JI6A 1ZG3A 1ZKGA 1IJWC 3BR6A 2QSGX 4UUTA 4CCMA 5FROA 3TEDA 1FIPA 5D8KB 1STZA 1UFMA 2PMUA 2NAZA 3IP4B 3UNGC 3CMYA 4KA4A 5DCFA 3MZYA 4Y4RA 2M34A 4XMYA 4YELA 5J40A 4BJ5C 3IL2A 4FX0A 3AL0B 1MBJA 2RKHA 5F27A 1AOYA 4M3FA 1IXRC 4RLFA 4M3EA 4TV7A 1OR7A 4LG0B 1T08B 2E1MC 2ESHA 3E1SA 3UR3C 2R3SA 2Y9ZA 4I76A 1R6RA 2MC4A 3NWTA 4NNJA 1MBKA 5FGMA 5F1RA 1VQ6I 2HOTA 2CMPA 3GXOA 4MNUA 2IGMA 4IHTA 2D45A 1QNTA 3OOUA 4EJOA 1RC9A 2J5PA 4A5MA 1HSTA 4D1QA 3EQLF 4U7BA 2CS3A 2YX7A 3HHGA 3HM5A 4A6DA 4HAMA 1TP4A 2EINH 4BE2A 2M8GX 3F8FA 4BL0B 5BQTA 3JAMZ 4II2A 3C1DA 5ICCA 2L02A 3ULQB 4B44A 3ABMH 1NG7A 3P7NA 1HF0A 1GDTA 5EJCA 3HYIA 2VJIA 3LQQA 4UVAA 3RKQA 1H89C 2QGUA 2LH9A 2XV4S 1YX5A 1RESA 2DW4A 2UUZA 1ZREA 1OISA 2EILH 2UV1A 3ZQFA 4HA8A 1FBQA 4MTEA 2GLOA 3L2CA 3H1CA 5DEQA 4ETSA 5DD4A 2KJBA 2X4HA 1WJEA 3JSOA 3F6OA 2F2EA 3PNTA 1OYIA 2XC7A 4PDKA 6PAXA 3H9QA 4E4HA 5EZGA 5ED4A 3QYBA 2X6WA 4G6QA 5KK1A 4A12A 5KNLA 2W85A 5E3MA 5GTHC 3EUKL 1XCVA 2NS0A 4XLAA 3HZJA 1J0RA 4DBRA 4LIUA 3ZQ7A 1SC7A 3CUQC 3FBIB 2F5FA 1TZLA 3RQIA 4KUMA 4B8XA 1FTZA 3DPTA 2EA4A 3DBHB 3SZGA 3S14J 2DTRA 5K5RA 2OBPA 3VWBA 1R5GA 3JRFA 3DTEA 4BXXJ 1U8RA 3ABLH 5GPAA 2OAZA 3CCLI 3DXJF 2VQGA 5J1UA 2ID6A 1ON1A 3FMRA 2WB1N 1M1EB 4ZC3A 3H0DA 4EV0A 1D0XA 3F8NA 4NQWB 2ME6A 1EV7A 1W5CC 1REPC 2JPCA 2V79A 3FK6A 2Z3YA 1UHWA 3F9KA 4GRIA 3S2HJ 1FYKA 1P9QC 3HRUA 5EGOA 3V7CA 3C2HA 5EZHA 4L0YB 1OYWA 3PFIA 3V7RA 3Q5FA 1IRGA 1SMYF 3FWEA 4LB5A 3CCJI 2VBWA 2ZXIA 3BJ6A 3OS0A 2MD5A 1RETA 1XSDA 1BW6A 3ZPLA 1UHMA 2MSYA 4FQGA 4XKWA 2H8RA 1QO0D 4NBQA 2CFXA 5LLQA 5E3OA 1VF9A 2ZJPF 4JP0A 2X1DA 3DU6A 3AL0C 4IHYA 1X3UA 4A6EA 1K78A 4WF2A 2EZIA 4PSXA 4A3DJ 5FFZA 1KYWA 5D6FA 5BOXA 4QSHA 1LDJA 1TWHJ 2PMZA 2KHMA 2FA5A 3DTKA 3OYGA 2BY0A 1EJ9A 4M3GA 1MMGA 3HRMA 1CGPA 2KIMA 1ETYA 1KQ0A 1B4AA 2BHZA 3ZQGA 3MFKA 1W36D 2RREA 4LD5A 4XLHA 4F3QA 3I58A 2IS2A 2IBDA 3ZOBA 1F4KA 2XHKA 1X3WB 3RIRA 5J6XA 2OZUA 1LFPA 2LDUA 2DO7A 4L5IA 2PJRB 2JVGA 4KICA 3LSKA 2HTSA 4I7HA 4XSZF 3A01B 1PP8F 2JA7J 3WTWC 1XD7A 1N78A 1YRNA 2LLKA 2CQXA 4M9SA 2QQBA 3EUHA 2R7RA 1QRYA 1MJAA 2I5UA 1FSHA 4C3JJ 3L00A 4IX7A 4O5VA 5F0HA 3KYCB 3BPXA 4ZDOA 2RN7A 3S1RJ 3BCBA 3MD2A 3ASOH 1MJBA 2X51A 2VLAA 4FHTA 1E3OC 4JX6A 5D8LB 3OYLA 5FLVA 3GWZA 2KISA 4FASD 3DU5A 4I09A 1TW2A 3GZNB 2KRHA 2STWA 4UUSA 4J01A 3K0LA 2X0LA 4BBRJ 1MH3A 3KP6A 1SFOJ 4XBFA 3Q0VA 2ZJRF 4UNOA 3ZMUA 2MH9A 3TOAA 5GADJ 5D5UB 3FBNB 2ISYA 2JK3A 5K5QA 4BQOA 3S2DJ 2FU4A 3JCUC 4XONA 4CUGA 2VJ5A 3P9IA 1SAUA 1FMWA 3ZXSA 1I5ZA 4XKBA 1KYZA 3KZYA 2XAFA 3MWMA 1S9HA 1VQ7I 2IJLA 4UV9A 5CQEA 2FXAA 2CYYA 3L1PA 3HOWJ 3RDIA 2WAEA 3JAMK 4M6VA 3J7ZI 3IRRA 2QSFX 3ZQHA 1LPQA 2M9HA 4Y3OA 4BXUA 2IW5A 2K40A 3PM1A 3F8BA 1MMSA 1FIAA 4FE4A 4KMUX 1MBHA 5KAFC 3H35A 3CJQB 3TDZC 2X48A 3AG1H 1J59A 2L3DA 2JA5J 5GP9A 3K4NA 5LEJA 3FKIJ 3LSTA 4G7ZF 3GO5A 5IT3A 2FNAA 2R7ZJ 2VQCA 2D5VA 2HS5A 2F48A 3CQZJ 5F1JA 4CCLA 2XAUA 1T8IA 1JJ8C 2JTVA 4KFCA 3CF5F 5GPCA 1ZH5A 3FXRA 1JHFA 1AKHA 4B4CA 3QYEA 3TO9A 1IO2A 2MFZA 2CV1A 2PEXA 1EH8A 2WY7Q 3CJRB 2PX9A 1XB4A 4BY1J 4F7ZA 2EZHA 1GUUA 2K9MA 2LY1A 3I64A 1PP7U 2QBYB 4BUPA 2STTA 3WTTC 2VUMJ 1ZGAA 1JTXA 1W1WE 1FY7A 3QP6A 3HTUA 1W4MA 2DN0A 2ZXHA 2ECCA 2BZTA 2PLYA 1I1SA 5E1XA 5EG0A 2DK8A 3VPRA 4PJNA 4A3LJ 4L9JA 2LG4A 4HYEA 3B6CA 2O6GE 4EGYA 3ECHA 2HKXA 1SD7A 3LSRA 1QQIA 3DKWA 2IGOA 2UWMA 3HG9A 2MG4A 4KIGA 2VBZA 1Z91A 1IRFA 2KZGA 2QWWA 5ILVA 1VI0A 1FP2A 1P4AA 2EV0A 3FIWA 2IRFG 4UY8I 1B8IA 3FM5A 4M6YA 1OCZH 2E2IJ 1OCCH 4RB0A 2GXBA 2DDBA 2HWVA 1EKEA 3HGGA 2IA1A 1U5TB 4K2EA 2HI3A 2CW7A 4ZYHA 4CH7A 4M74A 3BROA 1DGWY 5IOZA 2D1HA 3K7AJ 1SD4A 3H3ZA 2IA2A 3A1YA 3GLXA 3QOPA 4UV8A 4D7NA 3PO3J 2FJ1A 3QYFA 2V9VA 1XS9A 3GTKJ 1GHCA 3ISPA 1O7FA 2ZBKA 2MLGA 3LSPA 4J00A 2WB1A 3AG4H 4HSTA 4U0VA 5HDNA 3RJPA 2DOFA 1G3TA 1S3JA 5CVVA 5E8GA 2GXGA 4A5NA 4BBSJ 2ZB9A 2CJJA 2BY2A 2A68F 3WTXC 3S16J 2OTLI 4HF1A 2A05A 1WQ2A 3U1DA 2IEKA 4M73A 5A2QK 2WBMA 4DYRA 4BHPA 2LR8A 4A69C 2F5DA 4J19A 1MZBA 2X6XA 3E6DA 1HW1A 3S1QJ 3B73A 1X4OA 3U21A 4U87A 1K79A 2OJED 1TLHB 4QIWN 4IRGA 1LEBA 2DOAA 1PJRA 5FB2A 2L9NA 1PUEE 2V6CA 3IH3A 4DBQA 1V5FA 3SHFA 3NEUA 1DU0A 1V4RA 5FD6A 3ML6A 3IWZA 3PL8A 2X1CA 1JGSA 1OR7C 1Y39A 2E1OA 2EB7A 2XPUA 4EM0B 1Z9CA 2QKMB 2W25A 5FKLA 2ZXJA 4AUXA 1S6LA 2Y0SA 3ZGKA 2ZNZA 1DPRA 1P2FA 4X6AJ 4E6KG 3W2WA 2H27A 1RR7A 1XG1A 2EPFA 4X1EA 3IV5A 1QPIA 1T98A 3KEOA 4RB2C 5FFXA 3WU2C 2GOMA 1NH3A 3LSJA 5LBQA 3DLAA 2ZSHB 4KJZA 3M9AA 2K02A 2XRLA 1KU7A 5EGOB 3LSMA 3QPHA 5D5WB 3L2UA 1ON2A 2BY3A 1OQYA 1Z3YA 2XIGA 2DYSH 1S29A 3E0JB 3CCMI 3BG5A 1J2XA 1YX3A 4HX4A 2P6SA 1R00A 3SFIA 3RYPA 2EH3A 2TDXA 1G3YA 5JLWA 3S3MA 5HVQC 2DT7B 3CCVI 5JR3A 2OCEA 2XUBA 3X2QH 3H9GA 3QWLA 2XASA 4NDLA 3EETA 3LA7A 2CO5A 3L2WA 3CC4I 3HB9A 3AKZA 1Y0NA 2YSRA 2DQRA 3LSHA 3V8LA 3HPHA 2CUFA 3JR9A 4LOCA 1ZGJA 2VKEA 3OS2A 1R49A 3GLLA 2OF7A 2O3FA 1F9NA 2CUJA 1KZHA 1T0FA 1ZRDA 2W48A 2OUMA 5E1ZB 1BJZA 2P7CB 3JRCA 1YS6A 3V4GA 3GEZA 3ZCOA 5DTDA 5E3NA 1TTYA 2M7BA 2HYFA 2OA4A 2GAUA 2M5WA 3BG9A 2P81A 1R5ID 3HL2A 4BQQA 5LEKA 1H9GA 2L7FP 2ZMEA 2Z1DA 2GOXB 1UELB 4IL6C 4C30A 3QU3A 2FRHA 3I4NJ 2WWYA 3I3LA 1IDYA 5CPRB 4RAGA 4C2TA 3F0CA 1IN8A 3HUGB 1KQ8A 2W00A 1E2XA 2JQ7A 2E2JJ 5DUKA 3RI4A 2IS1A 3CESA 1W0UA 3BZKA 4MFDA 1I6HJ 1WRJA 5AIPA 1USTA 3H9JA 3TO6A 2DMTA 1WSUA 1FSEA 2IXSA 2VIXA 1BR1A 1LQ1A 3FK7A 1WI9A 2GWRA 4Y13A 2VXDA 5GTIC 1BI0A 2IPQX 2W57A 3HHHA 1Z1DA 3SJMA 2K9LA 2M0CA 5FKOA 2AXLA 2QA4I 3N97A 2VXZA 4Y15A 2DJIA 2VONA 1VZ0A 1MKMA 3A02A 2GIZA 4CXFA 3A03A 2DAOA 2Q8KA 3U1KA 3VYTB 4OWRB 5F04A 2FNPA 2QLZA 1POGA 3BWGA 1I50J 4I6ZA 1O3TA 1R4MB 3WTVC 1A04A 3PQKA 3LAJA 3QODA 3ESWB 2R7DA 1FPQA 5K1YA 1DP7P 5LGTA 2KRFA 4XLFA 2W7NA 1TQIA 3PIPF 2X6YA 3WGGA 2PMZN 5FJ8J 1BBYA 1P4WA 3VFZA 1LKXA 2OTJI 1H88C 5C3EJ 5IOYA 3M1EA 3S1NJ 3HC7A 3BTIA 3J80K 1KU2A 2FEZA 4M9XA 4FX4A 1JGGA 1HA8A 3DKYA 4XRSA 2R7QA 2LYCA 3EYYA 2E60A 1J9IA 1FWZA 5TISC 5EEGA 5DV5A 1D1CA 4F91B 3D0SA 3DFGA 3TQNA 4AVPA 2XGEA 4B3AA 5EDNA 3VOEA 1YW9A 4R1HA 2JJ7A 1BC7C 2R5ZB 3WU1B 2E7XA 3GUDA 3GFLA 4HLXA 3S17J 2WAQN 2LOOA 4XNFA 1AWCA 4RGUA 2JA8J 1WFXA 5FO5A 1ZELA 1MBEA 2M3AA 4JX4A 3TL4X 2KP6A 2M8EA 3K4KA 1D0ZA 3EUHC 3BDDA 1APLC 3CP8A 4XKVA 4EJVA 1KONA 1P6RA 2A3SA 1TWCJ 4KMFA 3PQJA 5CVJA 1WHUA 2WY8Q 3OL4A 4P55A 5M5YJ 3TW6A 3FZVA 3V42A 4UXNA 2Y69H 1SVOA 1YITI 1CF7A 1FOXA 2HQNA 1KQ9A 2F4IA 2M30A 5ILUA 5HNHA 3IH2A 2CWEA 3K4LA 2R7TA 3KYDB 3OYIA 2DFIA 2DBBA 2G9WA 3ONQA 3L2VA 4HPQA 3SEQA 1Z7UA 3BTJA 1MNEA 3BR0A 1G4DA 2HVRA 1UG2A 3B6AA 1FMVA 2HEOA 4N9HA 1QHHD 1ZLKA 1IN6A 2EA2A 3K1PA 1BIBA 3V7SA 3GBGA 1W5TA 1U9OA 4HNVA 1K6OA 3PFYA 1XDUA 4AVZA 3D1NI 1XTAA 3GW2A 1QHGA 2UZKA 2FMLA 4EJWA 1ENHA 4U0WA 1LB2A 3GCMA 2HYJA 2IA0A 1FP1D 4JBAA 1PUFB 3HJEA 1ZG1A 1N77A 2ICWG 3CF2A 3RSNA 3R4KA 2NVXJ 1SFKA 3TW7A 3O8GA 2FSWA 5F64A 1S7EA 3WTUC 4BACA 4M71A 4N0BA 3C3WA 4YFKF 3CCEI 4BHCA 3Q3SA 4DNCA 2A6EF 3A4CA 3MMYB 3RZDJ 3JREA 2V1NA 1BC8C 4V2GA 4A2UA 4XLPF 5E3LA 2QQAA 2B7EA 2VC1A 3FXOA 1K61A 2R5ZA 3KZIC 1W5SA 4Y33A 5B3SH 2OQRA 3OS1A 2I10A 5B66C 2NNNA 4PSWA 3W6KB 2OQGA 2ZMEC 4AYBN 5K7HA 4G7HF 1RKTA 3SDGA 2OC6A 4A3IJ 2LBFA 5BS6A 2F4MB 2FBIA 4ASNA 3KEQA 2HKOA 3REOA 1B72B 1Y8RB 1YRNB 2IT0A 1MNDA 1YOVB 2EIJH 2MABA 3BT9A 5M3FJ 2EWNA 2K9SA 2H1KA 3R61A 5L3GA 4M3BA 1C0WA 4F93B 4C3IJ 3TO7A 1V55H 3BZCA 1DGRM 3FXKA 4IXAA 4HW0A 2DOEA 4YIIA 2MD0A 4XSXF 3OSGA 3MAJA 1XGNA 1QZZA 2JUCA 3AFHA 3M3YJ 2EZLA 4UUSB 2RNJA 3F3XA 4XOPA 4GDFA 3W6VA 2Y31A 1LUJB 3CP2A 3E6CC 3CLOA 3I59B 1A6QA 5HS9A 2L9VA 2EV5A 3MKZA 5H6QA 1B72A 1OCRH 4JK1X 5DM7F 2VOPA 4E7SA 3KP7A 3RPUD 4RGSA 5GAHJ 1TBXA 1LEAA 2ZJ2A 2NXNB 1ZR2A 5J47A 4Q4ZF 2ZC2A 1GVDA 3VDXA 2FX0A 4WX9A 1WZ2A 3B02A 3E97A 4HDUA 1O7LA 1JUMA 2L5QA 3G73A 2E34A 3TMOA 1CQTA 3ELKA 4WXDA 2R7OA 1YJNI 1TC3C 4E70A 1RNLA 5J1YA 4AYBA 1HDPA 5EEHA 4BDYA 2X1EA 1WVRA 5IPAA 3HSEA 2V9KA 1HXDA 3H0GJ 4ZZDA 2XGXA 1IZ1A 5FLXZ 3IH4A 4B43A 2ZXWH 1U2WA 2Z9OA 4XN0A 5DCMA 2Y30A 4V2FA 2E1CA 4RB1A 2ETHA 1W7PD 1A6IA 4IHVA 4AM3A 3M8FA 4A3JJ 4IQ4A 3I54A 4NQWA 2FOWA 2LVSA 2ISZA 2BYVE 1OFCX 1B9MA
chains in the Genus database with same CATH topology
4WCGA 2XKOA 3IKVA 4MQ9F 2O8XA 5BPIA 4HBLA 4R79A 4IVNA 2Z33A 1FLIA 2CW0F 5CVRA 1J5YA 4EM2A 1K78B 3NRVA 4L9TA 5HDKA 1QBJA 2MBFA 2A61A 3I4PA 5H6RA 1SD6A 3Q9VA 3RPQA 2LF7A 5E18F 2XVCA 4A0ZA 2P8TA 2ZKZA 4CZZA 3BOQA 4MGRA 2CGPA 4Y17A 2F5CA 4DQ2A 1V3FA 4KIFA 3H3UA 1MD0A 2QM3A 4OOIA 1ZRFA 4I01A 4MEXF 4L18B 4G94A 2HYGD 1FYMA 3HOSA 1ZRCA 2FF4A 2KIFA 1ZN2A 1XMAA 1BM9A 2G7UA 2LF8A 4RAYA 1SMTA 3E3VA 5D5XB 4AIKA 2QYOA 1FT9A 2A07F 2DK5A 4M9ZA 3GFMA 1P92A 1XGSA 4ENKA 4U0YA 2RGVA 3O3KA 2GQQA 4QWQA 5F6FA 4ZH4F 3FXQA 4HZFA 3ABTA 3U9GA 1ZARA 2RQPA 1RIOH 1T39A 4O3MA 3BY6A 5CYVA 4YIFA 2QBYA 1MDMA 4YFXF 2GA2A 2O03A 1RUOA 5LHIA 3DF8A 2MLKA 4A0YA 5K5OA 2IP2A 2CQKA 3FMQA 4LLNA 1SFEA 4UVBA 3IWFA 3HRTA 1YQAA 3WU0A 3ZN1A 1XGMA 3ZMTA 2P5VA 4BYYA 3CDHA 2QUFA 3L09A 1R1VA 5DYMA 4GXOA 2V1UA 1HQCA 3EYIA 3ECOA 4EVIA 2E7WA 4O6JA 2PN6A 3K2ZA 2XAJA 5D4SA 4BNCA 4LJZF 2BV6A 4BH9A 5CJ9A 3E6MA 4Z2YA 3W6JB 2VODA 1D5VA 2AS5F 4P9UA 2L54A 1TNSA 1R1UA 2EFWA 3ZMDA 5AIQA 1U3EM 1KGSA 4G7OF 5CVUA 2EK5A 3GVAA 4LGWA 3QRFF 3ZMVA 3KFWX 4WWCA 4IJAA 1WWXA 1W7PA 5J8CA 1JE8A 2PJPA 2HOEA 5ILSA 3SXYA 1HW2A 4M72A 3K1NA 3F6VA 1XMKA 5BMZA 2O0YA 1Q1HA 2EFQA 3HOTA 4M6XA 1NHAA 3BPVA 1LDDA 5LGNA 4Q5SF 2KKOA 1I1GA 1R22A 5CLSA 2B0LA 1UB9A 1S8NA 4L5JA 1GXQA 3J81K 2VT2A 1JXSA 1KA8A 2JSCA 4HV6A 3ZMSA 3KP5A 1ZG5A 3KLNA 4L0ZB 1D3YA 2WC2A 4N9IA 3RYRA 2PFBA 3FMSA 1HBXG 5H20A 3HIFA 4RB3C 4Q47A 3M8EA 5HLGA 5J8FA 1O57A 1J75A 1SAXA 1L3LA 1R5HA 1ZYRF 2JT1A 4WXHA 2CG4A 2XAHA 1OMIA 2EFNA 2DI3A 4ENNA 2VN2A 4WK8F 3KE2A 1HKSA 3SFZA 2G7HA 3ERED 1JHHA 1E17A 1BJAA 4EM1A 1BIAA 1S7AA 4RS8A 1T38A 5CVIA 4P5OA 3K9TA 4A0XA 4G6DA 5LRRA 4I2OA 3TDUC 1HSJA 4FT8A 4RAZA 2VBXA 1IN7A 2H09A 1G3WA 3GZ5A 4EJTA 4KN7X 2YPRA 4U88A 3JSPA 1DPUA 5BPDA 3GZ6A 4ESFA 3HRSA 5D5VB 3KZZA 4ZYDA 3IRQA 3I0TA 5IT9K 4GYGA 4PGHA 2NYXA 3I71A 2VE8A 2EFOA 3T8TA 5D6EA 4PCQA 1IW7F 3O6BB 4HX7A 2P4WA 2ACJA 2OU2A 2YU3A 1MJ9A 3U2RA 2DU9A 4OIQF 5ICFA 1H9TA 5JFRA 1P4XA 2M1BA 1O3SA 5DDGA 2NNYA 1DUXC 5HOOA 4GCVA 3CO6C 5E17F 4P96A 2Y75A 1R58A 3G3ZA 5E20A 1HW5A 2BE5F 2Y48A 3R60A 2PG4A 4YFNF 3ZP5A 4UHTA 1HKQA 3EDPA 1O3RA 4LLLA 1U5TC 1XSXA 2A5YB 2YX4A 3V8JA 5E8IA 3SZTA 1USSA 4CYDA 4L9NA 2MH2A 2MC3A 2V1DA 1XDSA 2ZO4A 3CO7C 1R23A 4RGXA 2VE9A 1EH7A 3KETA 2HTJA 2PMHA 5L3EA 1XGOA 3COAC 2J5OA 2XAGA 5JVTA 2ADUA 4OIPF 1TQPA 2IVMA 4HV5A 5L3BA 3OOPA 4AWXB 3GF2A 2LKPA 5L3DA 3KLOA 3MEXA 5DCMB 4AIHA 4H0EA 3P9KA 1UCRA 4G9YA 5KVRA 3L9FA 1DDNA 1OKRA 4ENMA 4LK1F 4S04A 3QU6A 3CUOA 2P5KA 4MTDA 3WODF 5LHHA 3BP8A 3KP2A 5E1WA 2QENA 2ZNYA 4HF2A 3F21A 4XRFA 2QQ9A 4I0BA 3HTSB 4I98B 3HSRA 4BQAA 3LQRA 3CJNA 1T2KA 1IF1A 1BOAA 3MQ0A 2K4BA 2PI0A 3J81Z 1IN5A 3VEPA 1F5TA 4ESBA 3WE2A 5JHUA 2FBHA 3E5UA 4OINF 4IPAA 2W84A 4KYWA 1IXCA 3E5XA 1YTYA 1ONVA 3DEUA 4IF4A 3ZN0A 1QZYA 2ZMEB 2HFHA 4GGGA 2A69F 1BI3A 2ZFWA 4KN4X 3IHUA 2WTEA 1BN5A 1FBUA 3WTSC 3GFJA 4LFUA 2JZYA 2KIUA 2BBYA 3FM3A 3T0YA 3I5UA 4KDPA 4XLNF 1Y0UA 4KT5C 3WG9A 1U78A 1MGTA 5ERIA 2QZ8A 3I59A 2Z99A 3LA3A 1K7AA 2HZTA 5L3FA 1IXSB 4NB5A 3V8KA 3GFIA 1R7JA 1ZHFA 2O61A 2QVOA 4OMYA 3TOBA 3SZPA 1WKMA 4B09A 4HOBA 1FOKA 3RKXA 1S7OA 1OPCA 1T6SA 1VTNC 2HR3A 1ZAOA 2BEOA 3DPLC 2COMA 1FC3A 4EQQA 3KP3A 1OYYA 1Z05A 4GO1A 2E1NA 3FXUA 3WE3A 1ZLJA 2HGCA 1LNWA 1RZ4A 1EH6A 2F5EA 1L0OC 4IHSA 2VOOA 2K86A 2VT3A 1LJ9A 2H94A 3TKYA 1PDNC 1QGPA 4HQEA 4CGZA 3R0AA 3CUQB 3R0JA 1LVAA 2D2WA 3F72A 2MA3A 3N4MA 1FZPB 2DQLA 1YW8A 3VODA 3T1BA 1TNTA 3RTRA 5ICEA 3GX4X 2UXNA 3I53A 1QPMA 1SFXA 4OIRF 5LGUA 1ULYA 4I02A 1KU9A 3DV8A 1CF7B 2JRTA 3P9CA 3T8RA 1O3QA 1HKTA 1YFHA 1B59A 2V1XA 2LNBA 3WTZA 1RUNA 3JTGA 3HUGA 1MDMB 4ZYEA 5HS8A 1H0MA 5FLXK 2GIVA 4HF0A 3K69A 1RI7A 4KNYA 1U5TA 2KJCA 4CO8A 1B1BA 3RKWA 3C18A 3LAPA 2Z5UA 3CUQA 2XAQA 4EMSA 4BHBA 5LRSA 1B9NA 3IC7A 2FOKA 2DPDA 3OV8A 4UUVA 1FNNA 5HLHA 3BZ6A 4MHGA 2M87A 3FHZA 5D4RA 3ZMZA 1R1TA 3WGIA 2ZCWA 2FBKA 1XSVA 2HDCA 4OIOF 2Q0OA 4HLYA 1ODDA 5LHGA 3MZHA 3JTHA 4D0PA 3SQNA 3LA2A 2YR2A 4QLCU 3J80Z 2XKPA 4CICA 4AD9A 3Q9SA 3NQOA 5DD8A 1F1ZA 4IRHA 2ELHA 4HX8A 4NHJA 1I27A 2PQ8A 3D5LA 3BJAA 1XN7A 2P6TA 2RC4A 2K7LA 5FD5A 2BGCA 2L4AA 2PBIA 2DLLA 4ON0A 1GXPA 2OD5A 5AONA 3VB2A 3E6BA 1FX7A 4YG2F 3AAFA 2W24A 3RKYA 3ABUA 1XCBA 2K4JA 4Q48A 3R6SA 4EJUA 1W7PB 3WTYC 3RPUA 3BJOA 1FYLA 4S05A 4WXCA 2NRAC 4OU0A 2H6CA 4AIJA 3DQVC 4LLGF 2CSOA 3KP4A 2R7FA 2L4MA 4HDVA 4OMZA 5TRDA 2WV0A 2FQ3A 2M45A 3T5XA 2Y0MA 1BI2A 1YW7A 3E5QA 2C6YA 2VC0A 3O2PE 1D8KA 3LWFA 3FX3A 2VBYA 1FBSA 4U7DA 1D8JA 3F23A 3HSFA 2RVCA 4ZZLA 3J7AO 4MQVA 3S2WA 2Q2EA 3L7WA 3TGNA 2A6HF 1YO5C 3QP5A 1YIOA 4HQMA 1KU3A 1YYVA 1J7KA 3CTAA 4MEYF 2RDPA 2FMYA 5TJJA 2L01A 3LFKA 1YS7A 4ESJA 1I6XA 4R8HA 2OZ6A 2EFPA 2K27A 2XROA 5HDGA 2UXXA 1Z6TA 5IT9Z 5HLIA 4G8XA 5ICGA 1TW3A 4BAYA 4CDGA 5DUIA 2P7VB 3ROUA 3IKTA 2GZWA 4PGGA 2HQRA 2LSOA 1YG2A 4PZJA 1BI1A 1G3SA 3DP7A 3FF5A 1YLFA 3K1MA 4JQFA 1SFUA 4IRIA 4GYIA 3QPTA 1U6GA 5A2QZ 3QAHA 4L9VA 1IUYA 5L3CA 4LB6B 2ESNA 3MCZA 2DPUA 2DT5A 2RV8A 1R36A 3C7JA 4P9FA 1IAWA 1Z6RA 4UVCA 1B6AA 4LG0A 4RGRA 3F8CA 3WGHA 2P5LC 2D1VA 3H92A 3F22A 4I0AA 2GA1A 3M7GA 3KCCA 3GYHX 4ENJA 1SD5A 1G6NA 3JW4A 2JPBA 4KIBA 3F8MA 2EV6A 2H6BA 4CHUA 1GVJA 2EJRA 1TQMA 2XRNA 1LDKB 4ZYGA 4LMYA 1IN4A 4LK0F 2FE3A 5HS7A 4EGZA 5JI6A 1ZG3A 5D8KB 4KA4A 1STZA 1UFMA 2PMUA 2NAZA 5DCFA 3MZYA 3IL2A 4FX0A 2RKHA 1AOYA 1IXRC 4TV7A 1OR7A 4LG0B 2ESHA 2R3SA 5FGMA 5F1RA 3GXOA 4MNUA 4IHTA 2D45A 1QNTA 4EJOA 2J5PA 4A5MA 1HSTA 3EQLF 4U7BA 2YX7A 3HHGA 4A6DA 4HAMA 3F8FA 5BQTA 3JAMZ 3C1DA 5ICCA 2L02A 3ULQB 3P7NA 3HYIA 4UVAA 3LQQA 2XV4S 2DW4A 1ZREA 4HA8A 1FBQA 4MTEA 3L2CA 5DEQA 4ETSA 5DD4A 2KJBA 2X4HA 3JSOA 3F6OA 2F2EA 1OYIA 4PDKA 6PAXA 5ED4A 5KK1A 4G6QA 4A12A 2W85A 1XCVA 2NS0A 1J0RA 3ZQ7A 3CUQC 2F5FA 4KUMA 4B8XA 3DPTA 2EA4A 2DTRA 5K5RA 2OBPA 1R5GA 1U8RA 2OAZA 3DXJF 1ON1A 3FMRA 4EV0A 3F8NA 1EV7A 1REPC 2JPCA 2V79A 2Z3YA 1UHWA 1FYKA 3HRUA 3V7CA 4L0YB 1OYWA 3PFIA 3V7RA 3Q5FA 1IRGA 1SMYF 3FWEA 4LB5A 2VBWA 3BJ6A 2MD5A 1XSDA 3ZPLA 1UHMA 1QO0D 2CFXA 5LLQA 1X3UA 4A6EA 1K78A 4WF2A 5FFZA 1KYWA 5D6FA 5BOXA 1LDJA 2FA5A 3HRMA 1CGPA 2KIMA 1KQ0A 1B4AA 3MFKA 4LD5A 3I58A 1F4KA 2XHKA 3RIRA 5J6XA 2OZUA 2LDUA 2DO7A 4L5IA 4KICA 4I7HA 2HTSA 4XSZF 1PP8F 3WTWC 1XD7A 4M9SA 2QQBA 3EUHA 1MJAA 1FSHA 3L00A 4O5VA 3BPXA 2RN7A 1MJBA 4FHTA 5D8LB 3GWZA 4I09A 1TW2A 2STWA 3K0LA 2X0LA 3KP6A 4XBFA 4UNOA 3ZMUA 2MH9A 3TOAA 5D5UB 2ISYA 5K5QA 2FU4A 3P9IA 1I5ZA 1KYZA 3KZYA 2XAFA 3MWMA 2IJLA 4UV9A 2FXAA 2CYYA 3RDIA 3JAMK 3IRRA 4BXUA 2IW5A 3F8BA 4KMUX 3TDZC 1J59A 2L3DA 5LEJA 3LSTA 4G7ZF 3GO5A 5IT3A 2FNAA 2HS5A 2JTVA 4KFCA 1ZH5A 3FXRA 1JHFA 3TO9A 2PEXA 1EH8A 1XB4A 4F7ZA 3I64A 1PP7U 2QBYB 2STTA 3WTTC 1ZGAA 3QP6A 1FY7A 3HTUA 1W4MA 1I1SA 2PLYA 5E1XA 2DK8A 4L9JA 4HYEA 2O6GE 4EGYA 3ECHA 2HKXA 1SD7A 1QQIA 3DKWA 2UWMA 4KIGA 2VBZA 1Z91A 1IRFA 2QWWA 5ILVA 1FP2A 1P4AA 2EV0A 2IRFG 3FM5A 4M6YA 4RB0A 2GXBA 2HWVA 2IA1A 1U5TB 4K2EA 4ZYHA 4M74A 3BROA 2D1HA 1SD4A 3H3ZA 2IA2A 3GLXA 3QOPA 4UV8A 2V9VA 1GHCA 3ISPA 1O7FA 2ZBKA 2MLGA 4U0VA 5HDNA 3RJPA 1G3TA 1S3JA 5CVVA 5E8GA 2GXGA 4A5NA 2A68F 3WTXC 4HF1A 1WQ2A 3U1DA 4M73A 5A2QK 4BHPA 2F5DA 1MZBA 3E6DA 1HW1A 3B73A 1K79A 1TLHB 4IRGA 1LEBA 5FB2A 1PUEE 2V6CA 3SHFA 3NEUA 1V4RA 5FD6A 3ML6A 3IWZA 1JGSA 2EB7A 4EM0B 1Z9CA 2W25A 2ZXJA 1S6LA 2ZNZA 1DPRA 1P2FA 2H27A 1T98A 3KEOA 4RB2C 5FFXA 5LBQA 3M9AA 2K02A 1KU7A 3QPHA 5D5WB 1ON2A 2XIGA 1S29A 1J2XA 4HX4A 2P6SA 1R00A 3RYPA 2TDXA 1G3YA 5HVQC 5JR3A 2XUBA 2XASA 3EETA 3LA7A 2CO5A 2YSRA 3V8LA 2DQRA 1ZGJA 2O3FA 1F9NA 1T0FA 1ZRDA 5E1ZB 2P7CB 1YS6A 3V4GA 3GEZA 1TTYA 2HYFA 2OA4A 2GAUA 2M5WA 5LEKA 1H9GA 2ZMEA 3QU3A 2FRHA 2WWYA 1IN8A 1KQ8A 1E2XA 5DUKA 3RI4A 1WRJA 5AIPA 1USTA 3TO6A 1WSUA 1FSEA 1LQ1A 1WI9A 2GWRA 4Y13A 1BI0A 2IPQX 2W57A 3HHHA 1Z1DA 2AXLA 3N97A 2VXZA 4Y15A 2VONA 1MKMA 4CXFA 2DAOA 2Q8KA 2FNPA 2QLZA 3BWGA 1O3TA 3WTVC 1A04A 3PQKA 3LAJA 2R7DA 1FPQA 5K1YA 1DP7P 5LGTA 2KRFA 1TQIA 3WGGA 1BBYA 1P4WA 3VFZA 3M1EA 3J80K 1KU2A 2FEZA 4M9XA 4FX4A 3EYYA 1J9IA 1FWZA 5EEGA 5DV5A 3D0SA 3DFGA 3TQNA 4AVPA 3VOEA 1YW9A 4R1HA 1BC7C 3WU1B 2E7XA 3GUDA 3GFLA 4HLXA 1AWCA 4RGUA 5FO5A 2M8EA 3BDDA 4EJVA 1P6RA 2A3SA 4KMFA 3PQJA 5CVJA 4P55A 3FZVA 4UXNA 1CF7A 2HQNA 1KQ9A 2M30A 5ILUA 2CWEA 2DFIA 2DBBA 2G9WA 1Z7UA 1G4DA 2HEOA 4N9HA 1ZLKA 1IN6A 2EA2A 3K1PA 1BIBA 3V7SA 1W5TA 1K6OA 1XDUA 3GW2A 2UZKA 2FMLA 4EJWA 1LB2A 4U0WA 2IA0A 1FP1D 4JBAA 1ZG1A 3R4KA 2FSWA 5F64A 3WTUC 4M71A 4N0BA 3C3WA 4YFKF 4BHCA 4DNCA 2A6EF 1BC8C 4A2UA 4XLPF 2QQAA 2VC1A 1W5SA 2OQRA 2NNNA 3W6KB 2OQGA 4G7HF 5BS6A 2FBIA 4ASNA 3KEQA 2HKOA 3REOA 2IT0A 2EWNA 3R61A 5L3GA 1C0WA 3TO7A 4IXAA 4HW0A 4YIIA 4XSXF 3MAJA 1XGNA 1QZZA 2RNJA 3F3XA 3E6CC 3CLOA 3I59B 5HS9A 2EV5A 5H6QA 4JK1X 2VOPA 3KP7A 4RGSA 1TBXA 1LEAA 2ZJ2A 4Q4ZF 4WX9A 3B02A 3E97A 4HDUA 1O7LA 3G73A 3ELKA 4WXDA 4E70A 1RNLA 5EEHA 3HSEA 1HXDA 4ZZDA 2XGXA 1IZ1A 5FLXZ 1U2WA 2Z9OA 5DCMA 2E1CA 4RB1A 2ETHA 1W7PD 3M8FA 3I54A 4NQWA 2ISZA 2BYVE 1B9MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WCG A;  2XKO A;  3IKV A;  4MQ9 F;  2O8X A;  5BPI A;  4HBL A;  4R79 A;  4IVN A;  2Z33 A;  1FLI A;  2CW0 F;  5CVR A;  1J5Y A;  4EM2 A;  1K78 B;  3NRV A;  4L9T A;  5HDK A;  1QBJ A;  2MBF A;  2A61 A;  3I4P A;  5H6R A;  1SD6 A;  3Q9V A;  3RPQ A;  2LF7 A;  5E18 F;  2XVC A;  4A0Z A;  2P8T A;  2ZKZ A;  4CZZ A;  3BOQ A;  4MGR A;  2CGP A;  4Y17 A;  2F5C A;  4DQ2 A;  1V3F A;  4KIF A;  3H3U A;  1MD0 A;  2QM3 A;  4OOI A;  1ZRF A;  4I01 A;  4MEX F;  4L18 B;  4G94 A;  2HYG D;  1FYM A;  3HOS A;  1ZRC A;  2FF4 A;  2KIF A;  1ZN2 A;  1XMA A;  1BM9 A;  2G7U A;  2LF8 A;  4RAY A;  1SMT A;  3E3V A;  5D5X B;  4AIK A;  2QYO A;  1FT9 A;  2A07 F;  2DK5 A;  4M9Z A;  3GFM A;  1P92 A;  1XGS A;  4ENK A;  4U0Y A;  2RGV A;  3O3K A;  2GQQ A;  4QWQ A;  5F6F A;  4ZH4 F;  3FXQ A;  4HZF A;  3ABT A;  3U9G A;  1ZAR A;  2RQP A;  1RIO H;  1T39 A;  4O3M A;  3BY6 A;  5CYV A;  4YIF A;  2QBY A;  1MDM A;  4YFX F;  2GA2 A;  2O03 A;  1RUO A;  5LHI A;  3DF8 A;  2MLK A;  4A0Y A;  5K5O A;  2IP2 A;  2CQK A;  3FMQ A;  4LLN A;  1SFE A;  4UVB A;  3IWF A;  3HRT A;  1YQA A;  3WU0 A;  3ZN1 A;  1XGM A;  3ZMT A;  2P5V A;  4BYY A;  3CDH A;  2QUF A;  3L09 A;  1R1V A;  5DYM A;  4GXO A;  2V1U A;  1HQC A;  3EYI A;  3ECO A;  4EVI A;  2E7W A;  4O6J A;  2PN6 A;  3K2Z A;  2XAJ A;  5D4S A;  4BNC A;  4LJZ F;  2BV6 A;  4BH9 A;  5CJ9 A;  3E6M A;  4Z2Y A;  3W6J B;  2VOD A;  1D5V A;  2AS5 F;  4P9U A;  2L54 A;  1TNS A;  1R1U A;  2EFW A;  3ZMD A;  5AIQ A;  1U3E M;  1KGS A;  4G7O F;  5CVU A;  2EK5 A;  3GVA A;  4LGW A;  3QRF F;  3ZMV A;  3KFW X;  4WWC A;  4IJA A;  1WWX A;  1W7P A;  5J8C A;  1JE8 A;  2PJP A;  2HOE A;  5ILS A;  3SXY A;  1HW2 A;  4M72 A;  3K1N A;  3F6V A;  1XMK A;  5BMZ A;  2O0Y A;  1Q1H A;  2EFQ A;  3HOT A;  4M6X A;  1NHA A;  3BPV A;  1LDD A;  5LGN A;  4Q5S F;  2KKO A;  1I1G A;  1R22 A;  5CLS A;  2B0L A;  1UB9 A;  1S8N A;  4L5J A;  1GXQ A;  3J81 K;  2VT2 A;  1JXS A;  1KA8 A;  2JSC A;  4HV6 A;  3ZMS A;  3KP5 A;  1ZG5 A;  3KLN A;  4L0Z B;  1D3Y A;  2WC2 A;  4N9I A;  3RYR A;  2PFB A;  3FMS A;  1HBX G;  5H20 A;  3HIF A;  4RB3 C;  4Q47 A;  3M8E A;  5HLG A;  5J8F A;  1O57 A;  1J75 A;  1SAX A;  1L3L A;  1R5H A;  1ZYR F;  2JT1 A;  4WXH A;  2CG4 A;  2XAH A;  1OMI A;  2EFN A;  2DI3 A;  4ENN A;  2VN2 A;  4WK8 F;  3KE2 A;  1HKS A;  3SFZ A;  2G7H A;  3ERE D;  1JHH A;  1E17 A;  1BJA A;  4EM1 A;  1BIA A;  1S7A A;  4RS8 A;  1T38 A;  5CVI A;  4P5O A;  3K9T A;  4A0X A;  4G6D A;  5LRR A;  4I2O A;  3TDU C;  1HSJ A;  4FT8 A;  4RAZ A;  2VBX A;  1IN7 A;  2H09 A;  1G3W A;  3GZ5 A;  4EJT A;  4KN7 X;  2YPR A;  4U88 A;  3JSP A;  1DPU A;  5BPD A;  3GZ6 A;  4ESF A;  3HRS A;  5D5V B;  3KZZ A;  4ZYD A;  3IRQ A;  3I0T A;  5IT9 K;  4GYG A;  4PGH A;  2NYX A;  3I71 A;  2VE8 A;  2EFO A;  3T8T A;  5D6E A;  4PCQ A;  1IW7 F;  3O6B B;  4HX7 A;  2P4W A;  2ACJ A;  2OU2 A;  2YU3 A;  1MJ9 A;  3U2R A;  2DU9 A;  4OIQ F;  5ICF A;  1H9T A;  5JFR A;  1P4X A;  2M1B A;  1O3S A;  5DDG A;  2NNY A;  1DUX C;  5HOO A;  4GCV A;  3CO6 C;  5E17 F;  4P96 A;  2Y75 A;  1R58 A;  3G3Z A;  5E20 A;  1HW5 A;  2BE5 F;  2Y48 A;  3R60 A;  2PG4 A;  4YFN F;  3ZP5 A;  4UHT A;  1HKQ A;  3EDP A;  1O3R A;  4LLL A;  1U5T C;  1XSX A;  2A5Y B;  2YX4 A;  3V8J A;  5E8I A;  3SZT A;  1USS A;  4CYD A;  4L9N A;  2MH2 A;  2MC3 A;  2V1D A;  1XDS A;  2ZO4 A;  3CO7 C;  1R23 A;  4RGX A;  2VE9 A;  1EH7 A;  3KET A;  2HTJ A;  2PMH A;  5L3E A;  1XGO A;  3COA C;  2J5O A;  2XAG A;  5JVT A;  2ADU A;  4OIP F;  1TQP A;  2IVM A;  4HV5 A;  5L3B A;  3OOP A;  4AWX B;  3GF2 A;  2LKP A;  5L3D A;  3KLO A;  3MEX A;  5DCM B;  4AIH A;  4H0E A;  3P9K A;  1UCR A;  4G9Y A;  5KVR A;  3L9F A;  1DDN A;  1OKR A;  4ENM A;  4LK1 F;  4S04 A;  3QU6 A;  3CUO A;  2P5K A;  4MTD A;  3WOD F;  5LHH A;  3BP8 A;  3KP2 A;  5E1W A;  2QEN A;  2ZNY A;  4HF2 A;  3F21 A;  4XRF A;  2QQ9 A;  4I0B A;  3HTS B;  4I98 B;  3HSR A;  4BQA A;  3LQR A;  3CJN A;  1T2K A;  1IF1 A;  1BOA A;  3MQ0 A;  2K4B A;  2PI0 A;  3J81 Z;  1IN5 A;  3VEP A;  1F5T A;  4ESB A;  3WE2 A;  5JHU A;  2FBH A;  3E5U A;  4OIN F;  4IPA A;  2W84 A;  4KYW A;  1IXC A;  3E5X A;  1YTY A;  1ONV A;  3DEU A;  4IF4 A;  3ZN0 A;  1QZY A;  2ZME B;  2HFH A;  4GGG A;  2A69 F;  1BI3 A;  2ZFW A;  4KN4 X;  3IHU A;  2WTE A;  1BN5 A;  1FBU A;  3WTS C;  3GFJ A;  4LFU A;  2JZY A;  2KIU A;  2BBY A;  3FM3 A;  3T0Y A;  3I5U A;  4KDP A;  4XLN F;  1Y0U A;  4KT5 C;  3WG9 A;  1U78 A;  1MGT A;  5ERI A;  2QZ8 A;  3I59 A;  2Z99 A;  3LA3 A;  1K7A A;  2HZT A;  5L3F A;  1IXS B;  4NB5 A;  3V8K A;  3GFI A;  1R7J A;  1ZHF A;  2O61 A;  2QVO A;  4OMY A;  3TOB A;  3SZP A;  1WKM A;  4B09 A;  4HOB A;  1FOK A;  3RKX A;  1S7O A;  1OPC A;  1T6S A;  1VTN C;  2HR3 A;  1ZAO A;  2BEO A;  3DPL C;  2COM A;  1FC3 A;  4EQQ A;  3KP3 A;  1OYY A;  1Z05 A;  4GO1 A;  2E1N A;  3FXU A;  3WE3 A;  1ZLJ A;  2HGC A;  1LNW A;  1RZ4 A;  1EH6 A;  2F5E A;  1L0O C;  4IHS A;  2VOO A;  2K86 A;  2VT3 A;  1LJ9 A;  2H94 A;  3TKY A;  1PDN C;  1QGP A;  4HQE A;  4CGZ A;  3R0A A;  3CUQ B;  3R0J A;  1LVA A;  2D2W A;  3F72 A;  2MA3 A;  3N4M A;  1FZP B;  2DQL A;  1YW8 A;  3VOD A;  3T1B A;  1TNT A;  3RTR A;  5ICE A;  3GX4 X;  2UXN A;  3I53 A;  1QPM A;  1SFX A;  4OIR F;  5LGU A;  1ULY A;  4I02 A;  1KU9 A;  3DV8 A;  1CF7 B;  2JRT A;  3P9C A;  3T8R A;  1O3Q A;  1HKT A;  1YFH A;  1B59 A;  2V1X A;  2LNB A;  3WTZ A;  1RUN A;  3JTG A;  3HUG A;  1MDM B;  4ZYE A;  5HS8 A;  1H0M A;  5FLX K;  2GIV A;  4HF0 A;  3K69 A;  1RI7 A;  4KNY A;  1U5T A;  2KJC A;  4CO8 A;  1B1B A;  3RKW A;  3C18 A;  3LAP A;  2Z5U A;  3CUQ A;  2XAQ A;  4EMS A;  4BHB A;  5LRS A;  1B9N A;  3IC7 A;  2FOK A;  2DPD A;  3OV8 A;  4UUV A;  1FNN A;  5HLH A;  3BZ6 A;  4MHG A;  2M87 A;  3FHZ A;  5D4R A;  3ZMZ A;  1R1T A;  3WGI A;  2ZCW A;  2FBK A;  1XSV A;  2HDC A;  4OIO F;  2Q0O A;  4HLY A;  1ODD A;  5LHG A;  3MZH A;  3JTH A;  4D0P A;  3SQN A;  3LA2 A;  2YR2 A;  4QLC U;  3J80 Z;  2XKP A;  4CIC A;  4AD9 A;  3Q9S A;  3NQO A;  5DD8 A;  1F1Z A;  4IRH A;  2ELH A;  4HX8 A;  4NHJ A;  1I27 A;  2PQ8 A;  3D5L A;  3BJA A;  1XN7 A;  2P6T A;  2RC4 A;  2K7L A;  5FD5 A;  2BGC A;  2L4A A;  2PBI A;  2DLL A;  4ON0 A;  1GXP A;  2OD5 A;  5AON A;  3VB2 A;  3E6B A;  1FX7 A;  4YG2 F;  3AAF A;  2W24 A;  3RKY A;  3ABU A;  1XCB A;  2K4J A;  4Q48 A;  3R6S A;  4EJU A;  1W7P B;  3WTY C;  3RPU A;  3BJO A;  1FYL A;  4S05 A;  4WXC A;  2NRA C;  4OU0 A;  2H6C A;  4AIJ A;  3DQV C;  4LLG F;  2CSO A;  3KP4 A;  2R7F A;  2L4M A;  4HDV A;  4OMZ A;  5TRD A;  2WV0 A;  2FQ3 A;  2M45 A;  3T5X A;  2Y0M A;  1BI2 A;  1YW7 A;  3E5Q A;  2C6Y A;  2VC0 A;  3O2P E;  1D8K A;  3LWF A;  3FX3 A;  2VBY A;  1FBS A;  4U7D A;  1D8J A;  3F23 A;  3HSF A;  2RVC A;  4ZZL A;  3J7A O;  4MQV A;  3S2W A;  2Q2E A;  3L7W A;  3TGN A;  2A6H F;  1YO5 C;  3QP5 A;  1YIO A;  4HQM A;  1KU3 A;  1YYV A;  1J7K A;  3CTA A;  4MEY F;  2RDP A;  2FMY A;  5TJJ A;  2L01 A;  3LFK A;  1YS7 A;  4ESJ A;  1I6X A;  4R8H A;  2OZ6 A;  2EFP A;  2K27 A;  2XRO A;  5HDG A;  2UXX A;  1Z6T A;  5IT9 Z;  5HLI A;  4G8X A;  5ICG A;  1TW3 A;  4BAY A;  4CDG A;  5DUI A;  2P7V B;  3ROU A;  3IKT A;  2GZW A;  4PGG A;  2HQR A;  2LSO A;  1YG2 A;  4PZJ A;  1BI1 A;  1G3S A;  3DP7 A;  3FF5 A;  1YLF A;  3K1M A;  4JQF A;  1SFU A;  4IRI A;  4GYI A;  3QPT A;  1U6G A;  5A2Q Z;  3QAH A;  4L9V A;  1IUY A;  5L3C A;  4LB6 B;  2ESN A;  3MCZ A;  2DPU A;  2DT5 A;  2RV8 A;  1R36 A;  3C7J A;  4P9F A;  1IAW A;  1Z6R A;  4UVC A;  1B6A A;  4LG0 A;  4RGR A;  3F8C A;  3WGH A;  2P5L C;  2D1V A;  3H92 A;  3F22 A;  4I0A A;  2GA1 A;  3M7G A;  3KCC A;  3GYH X;  4ENJ A;  1SD5 A;  1G6N A;  3JW4 A;  2JPB A;  4KIB A;  3F8M A;  2EV6 A;  2H6B A;  4CHU A;  1GVJ A;  2EJR A;  1TQM A;  2XRN A;  1LDK B;  4ZYG A;  4LMY A;  1IN4 A;  4LK0 F;  2FE3 A;  5HS7 A;  4EGZ A;  5JI6 A;  1ZG3 A;  5D8K B;  4KA4 A;  1STZ A;  1UFM A;  2PMU A;  2NAZ A;  5DCF A;  3MZY A;  3IL2 A;  4FX0 A;  2RKH A;  1AOY A;  1IXR C;  4TV7 A;  1OR7 A;  4LG0 B;  2ESH A;  2R3S A;  5FGM A;  5F1R A;  3GXO A;  4MNU A;  4IHT A;  2D45 A;  1QNT A;  4EJO A;  2J5P A;  4A5M A;  1HST A;  3EQL F;  4U7B A;  2YX7 A;  3HHG A;  4A6D A;  4HAM A;  3F8F A;  5BQT A;  3JAM Z;  3C1D A;  5ICC A;  2L02 A;  3ULQ B;  3P7N A;  3HYI A;  4UVA A;  3LQQ A;  2XV4 S;  2DW4 A;  1ZRE A;  4HA8 A;  1FBQ A;  4MTE A;  3L2C A;  5DEQ A;  4ETS A;  5DD4 A;  2KJB A;  2X4H A;  3JSO A;  3F6O A;  2F2E A;  1OYI A;  4PDK A;  6PAX A;  5ED4 A;  5KK1 A;  4G6Q A;  4A12 A;  2W85 A;  1XCV A;  2NS0 A;  1J0R A;  3ZQ7 A;  3CUQ C;  2F5F A;  4KUM A;  4B8X A;  3DPT A;  2EA4 A;  2DTR A;  5K5R A;  2OBP A;  1R5G A;  1U8R A;  2OAZ A;  3DXJ F;  1ON1 A;  3FMR A;  4EV0 A;  3F8N A;  1EV7 A;  1REP C;  2JPC A;  2V79 A;  2Z3Y A;  1UHW A;  1FYK A;  3HRU A;  3V7C A;  4L0Y B;  1OYW A;  3PFI A;  3V7R A;  3Q5F A;  1IRG A;  1SMY F;  3FWE A;  4LB5 A;  2VBW A;  3BJ6 A;  2MD5 A;  1XSD A;  3ZPL A;  1UHM A;  1QO0 D;  2CFX A;  5LLQ A;  1X3U A;  4A6E A;  1K78 A;  4WF2 A;  5FFZ A;  1KYW A;  5D6F A;  5BOX A;  1LDJ A;  2FA5 A;  3HRM A;  1CGP A;  2KIM A;  1KQ0 A;  1B4A A;  3MFK A;  4LD5 A;  3I58 A;  1F4K A;  2XHK A;  3RIR A;  5J6X A;  2OZU A;  2LDU A;  2DO7 A;  4L5I A;  4KIC A;  4I7H A;  2HTS A;  4XSZ F;  1PP8 F;  3WTW C;  1XD7 A;  4M9S A;  2QQB A;  3EUH A;  1MJA A;  1FSH A;  3L00 A;  4O5V A;  3BPX A;  2RN7 A;  1MJB A;  4FHT A;  5D8L B;  3GWZ A;  4I09 A;  1TW2 A;  2STW A;  3K0L A;  2X0L A;  3KP6 A;  4XBF A;  4UNO A;  3ZMU A;  2MH9 A;  3TOA A;  5D5U B;  2ISY A;  5K5Q A;  2FU4 A;  3P9I A;  1I5Z A;  1KYZ A;  3KZY A;  2XAF A;  3MWM A;  2IJL A;  4UV9 A;  2FXA A;  2CYY A;  3RDI A;  3JAM K;  3IRR A;  4BXU A;  2IW5 A;  3F8B A;  4KMU X;  3TDZ C;  1J59 A;  2L3D A;  5LEJ A;  3LST A;  4G7Z F;  3GO5 A;  5IT3 A;  2FNA A;  2HS5 A;  2JTV A;  4KFC A;  1ZH5 A;  3FXR A;  1JHF A;  3TO9 A;  2PEX A;  1EH8 A;  1XB4 A;  4F7Z A;  3I64 A;  1PP7 U;  2QBY B;  2STT A;  3WTT C;  1ZGA A;  3QP6 A;  1FY7 A;  3HTU A;  1W4M A;  1I1S A;  2PLY A;  5E1X A;  2DK8 A;  4L9J A;  4HYE A;  2O6G E;  4EGY A;  3ECH A;  2HKX A;  1SD7 A;  1QQI A;  3DKW A;  2UWM A;  4KIG A;  2VBZ A;  1Z91 A;  1IRF A;  2QWW A;  5ILV A;  1FP2 A;  1P4A A;  2EV0 A;  2IRF G;  3FM5 A;  4M6Y A;  4RB0 A;  2GXB A;  2HWV A;  2IA1 A;  1U5T B;  4K2E A;  4ZYH A;  4M74 A;  3BRO A;  2D1H A;  1SD4 A;  3H3Z A;  2IA2 A;  3GLX A;  3QOP A;  4UV8 A;  2V9V A;  1GHC A;  3ISP A;  1O7F A;  2ZBK A;  2MLG A;  4U0V A;  5HDN A;  3RJP A;  1G3T A;  1S3J A;  5CVV A;  5E8G A;  2GXG A;  4A5N A;  2A68 F;  3WTX C;  4HF1 A;  1WQ2 A;  3U1D A;  4M73 A;  5A2Q K;  4BHP A;  2F5D A;  1MZB A;  3E6D A;  1HW1 A;  3B73 A;  1K79 A;  1TLH B;  4IRG A;  1LEB A;  5FB2 A;  1PUE E;  2V6C A;  3SHF A;  3NEU A;  1V4R A;  5FD6 A;  3ML6 A;  3IWZ A;  1JGS A;  2EB7 A;  4EM0 B;  1Z9C A;  2W25 A;  2ZXJ A;  1S6L A;  2ZNZ A;  1DPR A;  1P2F A;  2H27 A;  1T98 A;  3KEO A;  4RB2 C;  5FFX A;  5LBQ A;  3M9A A;  2K02 A;  1KU7 A;  3QPH A;  5D5W B;  1ON2 A;  2XIG A;  1S29 A;  1J2X A;  4HX4 A;  2P6S A;  1R00 A;  3RYP A;  2TDX A;  1G3Y A;  5HVQ C;  5JR3 A;  2XUB A;  2XAS A;  3EET A;  3LA7 A;  2CO5 A;  2YSR A;  3V8L A;  2DQR A;  1ZGJ A;  2O3F A;  1F9N A;  1T0F A;  1ZRD A;  5E1Z B;  2P7C B;  1YS6 A;  3V4G A;  3GEZ A;  1TTY A;  2HYF A;  2OA4 A;  2GAU A;  2M5W A;  5LEK A;  1H9G A;  2ZME A;  3QU3 A;  2FRH A;  2WWY A;  1IN8 A;  1KQ8 A;  1E2X A;  5DUK A;  3RI4 A;  1WRJ A;  5AIP A;  1UST A;  3TO6 A;  1WSU A;  1FSE A;  1LQ1 A;  1WI9 A;  2GWR A;  4Y13 A;  1BI0 A;  2IPQ X;  2W57 A;  3HHH A;  1Z1D A;  2AXL A;  3N97 A;  2VXZ A;  4Y15 A;  2VON A;  1MKM A;  4CXF A;  2DAO A;  2Q8K A;  2FNP A;  2QLZ A;  3BWG A;  1O3T A;  3WTV C;  1A04 A;  3PQK A;  3LAJ A;  2R7D A;  1FPQ A;  5K1Y A;  1DP7 P;  5LGT A;  2KRF A;  1TQI A;  3WGG A;  1BBY A;  1P4W A;  3VFZ A;  3M1E A;  3J80 K;  1KU2 A;  2FEZ A;  4M9X A;  4FX4 A;  3EYY A;  1J9I A;  1FWZ A;  5EEG A;  5DV5 A;  3D0S A;  3DFG A;  3TQN A;  4AVP A;  3VOE A;  1YW9 A;  4R1H A;  1BC7 C;  3WU1 B;  2E7X A;  3GUD A;  3GFL A;  4HLX A;  1AWC A;  4RGU A;  5FO5 A;  2M8E A;  3BDD A;  4EJV A;  1P6R A;  2A3S A;  4KMF A;  3PQJ A;  5CVJ A;  4P55 A;  3FZV A;  4UXN A;  1CF7 A;  2HQN A;  1KQ9 A;  2M30 A;  5ILU A;  2CWE A;  2DFI A;  2DBB A;  2G9W A;  1Z7U A;  1G4D A;  2HEO A;  4N9H A;  1ZLK A;  1IN6 A;  2EA2 A;  3K1P A;  1BIB A;  3V7S A;  1W5T A;  1K6O A;  1XDU A;  3GW2 A;  2UZK A;  2FML A;  4EJW A;  1LB2 A;  4U0W A;  2IA0 A;  1FP1 D;  4JBA A;  1ZG1 A;  3R4K A;  2FSW A;  5F64 A;  3WTU C;  4M71 A;  4N0B A;  3C3W A;  4YFK F;  4BHC A;  4DNC A;  2A6E F;  1BC8 C;  4A2U A;  4XLP F;  2QQA A;  2VC1 A;  1W5S A;  2OQR A;  2NNN A;  3W6K B;  2OQG A;  4G7H F;  5BS6 A;  2FBI A;  4ASN A;  3KEQ A;  2HKO A;  3REO A;  2IT0 A;  2EWN A;  3R61 A;  5L3G A;  1C0W A;  3TO7 A;  4IXA A;  4HW0 A;  4YII A;  4XSX F;  3MAJ A;  1XGN A;  1QZZ A;  2RNJ A;  3F3X A;  3E6C C;  3CLO A;  3I59 B;  5HS9 A;  2EV5 A;  5H6Q A;  4JK1 X;  2VOP A;  3KP7 A;  4RGS A;  1TBX A;  1LEA A;  2ZJ2 A;  4Q4Z F;  4WX9 A;  3B02 A;  3E97 A;  4HDU A;  1O7L A;  3G73 A;  3ELK A;  4WXD A;  4E70 A;  1RNL A;  5EEH A;  3HSE A;  1HXD A;  4ZZD A;  2XGX A;  1IZ1 A;  5FLX Z;  1U2W A;  2Z9O A;  5DCM A;  2E1C A;  4RB1 A;  2ETH A;  1W7P D;  3M8F A;  3I54 A;  4NQW A;  2ISZ A;  2BYV E;  1B9M A; 
#chains in the Genus database with same CATH topology
 4WCG A;  2XKO A;  3OIQ A;  3MKY B;  3IKV A;  4MQ9 F;  3N05 A;  1VFC A;  3K2A A;  1AA7 A;  4OAZ A;  4A3G J;  3OYM A;  3BG6 A;  2KT0 A;  2O8X A;  3OMY A;  5BPI A;  3O8H A;  1A5J A;  1X1P A;  4HBL A;  4R79 A;  4IVN A;  2HVS A;  2Z33 A;  1JI8 A;  2IAI A;  1FLI A;  2CW0 F;  4XL9 A;  5CVR A;  2Z2S B;  1J5Y A;  4EM2 A;  1ETK A;  1K78 B;  1U0J A;  3NRV A;  4L9T A;  2JWT A;  3H5A A;  5HDK A;  1IG7 A;  4P1W A;  1QBJ A;  2MBF A;  2A61 A;  4PJL A;  3I4P A;  5H6R A;  1SD6 A;  3CCU I;  2DA4 A;  4A3K J;  2KQR A;  3Q9V A;  5B5E C;  3RPQ A;  2LF7 A;  5E18 F;  2XVC A;  4A0Z A;  4BE1 A;  2P8T A;  2ZKZ A;  4CZZ A;  2NVT J;  3BOQ A;  4MGR A;  2CGP A;  4Y17 A;  2F5C A;  1XMX A;  2DFE A;  2NVQ J;  1T95 A;  4DQ2 A;  1V3F A;  5M3M J;  4KIF A;  3H3U A;  4XOT A;  1MD0 A;  4RBO A;  2QM3 A;  4OOI A;  1ZRF A;  4I01 A;  3VYR B;  4MEX F;  2Y0S N;  2E2H J;  4L18 B;  4G94 A;  2HYG D;  1FYM A;  2DFH A;  4UB6 C;  3HOS A;  1ZRC A;  2FF4 A;  1Y6I A;  1MMA A;  1XMA A;  1ZN2 A;  2Q2E B;  1BM9 A;  2WAQ A;  2G7U A;  2LF8 A;  4RAY A;  2VAS A;  1SMT A;  3E3V A;  2AXT C;  2XSD C;  3OY9 A;  5D5X B;  2CU7 A;  4AIK A;  1JKR C;  2R92 J;  3DTI A;  1JT6 A;  2QYO A;  1FT9 A;  1WH7 A;  2DK5 A;  2A07 F;  2HNH A;  4M9Z A;  3VSL A;  3WHB A;  3GFM A;  2ID3 A;  3J7A Y;  2NVY J;  1FEX A;  1BW5 A;  1P92 A;  1XGS A;  4ENK A;  2QQ8 A;  4U0Y A;  5FLM J;  2BY1 A;  2RGV A;  1X2N A;  3O3K A;  2GQQ A;  3ASN H;  4QWQ A;  5F6F A;  4ZH4 F;  1A31 A;  3FXQ A;  4HZF A;  2HDW A;  4E7I A;  3ABT A;  3U9G A;  1ZAR A;  1QVU A;  2ZFU A;  2DA5 A;  3OIO A;  2RQP A;  1RIO H;  1T39 A;  4KT6 A;  1P7J A;  4O3M A;  2DA6 A;  2E71 A;  3LSG A;  3BY6 A;  5CYV A;  2QKL B;  3BR1 A;  3MN2 A;  1NTC A;  4YIF A;  2QBY A;  1MDM A;  4FCY A;  2W4S A;  4YFX F;  2GA2 A;  2O03 A;  1RUO A;  1N25 A;  4PK4 A;  5LHI A;  3CC7 I;  3DF8 A;  2MLK A;  1X58 A;  4A0Y A;  5K5O A;  3KEY A;  2IP2 A;  3OYD A;  2CQK A;  1HCR A;  2M4G A;  3FKJ A;  3FMQ A;  3BQZ A;  1D1A A;  4G12 A;  3DWL E;  4LLN A;  1SFE A;  5F0F A;  4UVB A;  3IWF A;  3HRT A;  1YQA A;  3WU0 A;  3ZN1 A;  2L7K A;  1XGM A;  3ZMT A;  2P5V A;  5LD2 C;  1BL0 A;  1LE8 A;  4BYY A;  3CDH A;  2QUF A;  3L09 A;  4II3 A;  3IAM 2;  1R1V A;  2L9S A;  2VL8 A;  5DYM A;  4GXO A;  2V1U A;  1HQC A;  2BOL A;  2R5Y A;  1E3P A;  3EYI A;  4MLO A;  3ECO A;  4YRV A;  2HU9 A;  2HXO A;  2ME0 A;  4EVI A;  2E7W A;  2XDV A;  2PN6 A;  4O6J A;  3CDL A;  4JYK A;  3CCR I;  3K2Z A;  2XAJ A;  1E3H A;  3G1L A;  1QZE A;  5D4S A;  4BNC A;  4LJZ F;  2Q1Z B;  2BV6 A;  3I4M J;  1Z21 A;  2GBY A;  4BH9 A;  5CJ9 A;  3H3V K;  4XLE A;  4XLC A;  2VJJ A;  3E6M A;  2LFB A;  3QPL A;  4Z2Y A;  3W6J B;  2VOD A;  5IP9 J;  1IRZ A;  1D5V A;  2AS5 F;  4P9U A;  2L54 A;  1TNS A;  2DT6 A;  1R1U A;  2RQQ A;  3ZMD A;  2EFW A;  2MYS A;  5AIQ A;  1U3E M;  1KGS A;  4G7O F;  2LK2 A;  5CVU A;  2EK5 A;  3OWT A;  2E19 A;  5C4X J;  3GVA A;  2HXI A;  2AO9 A;  4LGW A;  3QRF F;  3ZMV A;  3KFW X;  4PJM A;  3DEW A;  4WWC A;  1T56 A;  4IJA A;  4CA0 A;  3W2A A;  1WWX A;  1B8I B;  1Z0X A;  2VQH A;  1W7P A;  4F52 A;  2DMN A;  5J8C A;  1JE8 A;  2PJP A;  2HOE A;  5ILS A;  3SXY A;  2XF7 A;  1HW2 A;  3ZQC A;  4M72 A;  3K1N A;  3F6V A;  3UKG A;  1XMK A;  3OYN A;  5BMZ A;  2O0Y A;  1Q1H A;  2EFQ A;  2X85 A;  3HOT A;  2CQ7 A;  3OIP A;  4M6X A;  4AID A;  1NHA A;  5KHD A;  4XRM A;  1QU3 A;  2E36 A;  3BPV A;  4BU2 A;  1LDD A;  5LGN A;  2MGQ A;  4Q5S F;  4LG3 A;  4N4O B;  4ABZ A;  2KKO A;  1VQ9 I;  1I1G A;  1X2M A;  5FRN A;  1R22 A;  5CLS A;  2B0L A;  1HLV A;  1UB9 A;  3JRD A;  1S8N A;  1MNM C;  1GLN A;  4L5J A;  3L2R A;  1GXQ A;  1ETQ A;  1VQP I;  3J81 K;  2NOJ B;  2VT2 A;  5IP7 J;  1JXS A;  1KA8 A;  2JSC A;  4HV6 A;  2YUS A;  4XN3 A;  4DW6 A;  3ZMS A;  3HOU J;  3KP5 A;  1ZG5 A;  3HKZ A;  3KLN A;  2HDD A;  4L0Z B;  1D3Y A;  1WCM J;  2R0Q C;  2WC2 A;  3CZ6 A;  2B63 J;  2DMQ A;  3CCY A;  2WAF A;  2DA7 A;  4N9I A;  1ZR4 A;  3RYR A;  4XKC A;  2PFB A;  1TT0 A;  3FMS A;  1HBX G;  5H20 A;  1WJF A;  3HIF A;  4RB3 C;  1X3Z B;  3A2K A;  1ETX A;  4Q47 A;  3KPH A;  3M8E A;  3QPS A;  5HLG A;  2KDO A;  5J8F A;  1O57 A;  4B1R A;  1J75 A;  1SAX A;  5EF6 A;  3GTL J;  1D1B A;  1L3L A;  1VQK I;  1R5H A;  1ZYR F;  2JT1 A;  4HNU A;  4WXH A;  2CG4 A;  2ELJ A;  2K9Q A;  2LP0 A;  2XAH A;  2DJN A;  4AU7 A;  3CME I;  3I55 I;  1OMI A;  1HDD C;  1IRX A;  2EFN A;  2DI3 A;  3G71 I;  4ENN A;  1TWA J;  2VN2 A;  1NK2 P;  3BCA A;  3OYK A;  1R4N B;  3M07 A;  4WK8 F;  3KE2 A;  3AG2 H;  1AHD P;  1XX5 A;  1HKS A;  3SFZ A;  1PUF A;  2R7V A;  1K83 J;  2G7H A;  3ERE D;  2ECB A;  2F5V A;  1JHH A;  1E17 A;  1BJA A;  2P0W A;  1BIA A;  1S7A A;  4EM1 A;  3GTM J;  1VQ4 I;  4RS8 A;  1T38 A;  5CVI A;  4P5O A;  4DYC A;  3VSK A;  4C9Y A;  3K9T A;  4A0X A;  2XF5 A;  4G6D A;  4BDZ A;  3NWS A;  2JN6 A;  5LRR A;  1MSF C;  3KYL A;  1R9T J;  4I2O A;  4CYC B;  2Y2Z A;  3TDU C;  1WJA A;  1MW7 A;  1HSJ A;  4FT8 A;  4RAZ A;  2CQQ A;  2VBX A;  1ACI A;  4A3C J;  1IN7 A;  2H09 A;  1A36 A;  3FDY A;  2CH0 A;  1G3W A;  3GZ5 A;  4JX5 A;  4EJT A;  4ANJ A;  4KN7 X;  5EYR A;  2YPR A;  1U9N A;  4RA2 A;  1FTT A;  1RKW A;  1MSE C;  2XGC A;  4FET A;  1WJC A;  4U88 A;  3BR2 A;  4XQF A;  3JSP A;  1DPU A;  5BPD A;  3GZ6 A;  4ESF A;  3HRS A;  5D5V B;  3KZZ A;  4ZYD A;  3BTC A;  2HVQ A;  3IRQ A;  4IHX A;  2HQ5 A;  2NS8 A;  3I0T A;  4DOZ A;  2YU9 J;  2DDA A;  5IT9 K;  2QCO A;  3OYC A;  4GYG A;  4PGH A;  2NYX A;  5BNG A;  1NK3 P;  3I71 A;  1YHQ I;  4CZC A;  2VE8 A;  2EFO A;  4C3H J;  3PSF A;  3DEE A;  5J4V A;  4XM3 A;  3T8T A;  5HNF A;  1BR4 A;  3OYJ A;  3P5J A;  2O8K A;  4F55 A;  1QA6 A;  1Z3X A;  4XIC A;  5D6E A;  2K3F A;  2KLO A;  4PCQ A;  2A5W A;  4A3E J;  3NAR A;  1LFU P;  5IYB J;  1IW7 F;  1UAA A;  4XK4 A;  3O6B B;  2W1O A;  4HX7 A;  2P4W A;  2ACJ A;  4HNT A;  1GT0 C;  2OU2 A;  2DCE A;  1MJ9 A;  2YU3 A;  3LNQ A;  3K6G A;  3U2R A;  2DU9 A;  4OIQ F;  3BTL A;  5ICF A;  4CCO A;  4IO9 F;  1H9T A;  5JFR A;  1X1A A;  2L7M P;  1P4X A;  4EAT A;  4V19 K;  4ZYA A;  2M1B A;  3OYB A;  2BXZ A;  1O3S A;  1YIJ I;  2CV2 A;  4RMN A;  5DDG A;  2NNY A;  1DUX C;  4KIT B;  5HOO A;  3K70 C;  2BVL A;  4GCV A;  3CO6 C;  5E17 F;  1W36 C;  4A3M J;  1ERD A;  1P7I A;  5M5X J;  2E1M B;  4P96 A;  3S3N A;  2VKV A;  2LRE A;  2Y75 A;  1SVM A;  2XPW A;  1R58 A;  1MBF A;  3G3Z A;  3G1M A;  2R7U A;  3LOC A;  5E20 A;  9ANT A;  1HW5 A;  2BE5 F;  2Y48 A;  3R60 A;  5B1B H;  2PG4 A;  4YFN F;  3ZP5 A;  2PJR A;  2K85 A;  4UHT A;  1HKQ A;  1H8A C;  4L5E A;  1RR8 C;  1RPW A;  3RZO J;  2BW3 A;  2JVH A;  3EDP A;  1O3R A;  1OLT A;  5K7Z A;  4Y52 J;  4LLL A;  1G59 A;  1U5T C;  1XSX A;  2A5Y B;  2DXI A;  2OPT A;  3AG3 H;  1GV2 A;  2YX4 A;  2F4O B;  3V8J A;  2JMW A;  2M7A A;  5E8I A;  3SZT A;  3WG7 H;  1USS A;  5IY5 H;  2XF6 A;  1RRJ A;  4CYD A;  1WGX A;  2MH2 A;  2MC3 A;  2V1D A;  3QOE A;  4L9N A;  1XDS A;  4HSR A;  1N75 A;  2ZO4 A;  3CO7 C;  1R23 A;  4RGX A;  2L7Z A;  4BS9 A;  5C44 J;  2VE9 A;  1EH7 A;  3KET A;  2E5Z A;  2HTJ A;  2PMH A;  4PFO A;  5L3E A;  1XGO A;  3JRI A;  1UMQ A;  3I56 I;  3COA C;  3GTG J;  2J5O A;  4BGD A;  4IZZ A;  1MH4 A;  3BR5 A;  4CCK A;  2XAG A;  2AQF A;  2ZJQ F;  5JVT A;  2ADU A;  4OIP F;  1LE8 B;  1TQP A;  2IVM A;  2LRD A;  4HV5 A;  5L3B A;  2BW3 B;  3MKL A;  1ORK A;  3OOP A;  1EF4 A;  4G6T B;  1OCP A;  2XGD A;  4AWX B;  2NOG A;  3GF2 A;  3SYT A;  2LKP A;  2VKH A;  4A93 J;  1UZC A;  5L3D A;  3KLO A;  1I3A A;  3MEX A;  1R71 A;  5DCM B;  1Y1W J;  1IV8 A;  4AIH A;  1OJL A;  4ZDP A;  4H0E A;  3P9K A;  1UCR A;  4G9Y A;  5KVR A;  2DFF A;  2IS4 A;  3L9F A;  1DDN A;  4DGW B;  3G1O A;  3HPG A;  1OKR A;  4C2M J;  4ENM A;  3S32 A;  4LK1 F;  4IKF A;  1I39 A;  2AHQ A;  4S04 A;  3QU6 A;  3CUO A;  3CCQ I;  1EA3 A;  2HOA A;  4Z6Y A;  1VQO I;  2ELK A;  2NVU B;  1D5Y A;  2P5K A;  2H8W A;  4MTD A;  3WOD F;  5LHH A;  5F08 A;  2KIQ A;  3BP8 A;  3M8J A;  3KP2 A;  4M3D A;  4YEJ A;  1JKQ C;  5E1W A;  2QEN A;  4Y7N J;  2ZNY A;  4HF2 A;  2K9N A;  3F21 A;  2DTZ A;  4C2U A;  4F92 B;  4XRF A;  4D5F A;  2QQ9 A;  1Y1V J;  2M0M A;  2FUG 2;  1WJB A;  4I0B A;  4I98 B;  3HTS B;  1LVK A;  3HSR A;  2K5C A;  3CCS I;  4CCJ A;  4RAF A;  3CC2 I;  2KRC A;  4BQA A;  3S8P A;  3LQR A;  3CJN A;  2IS6 A;  1T2K A;  1YI2 I;  1IF1 A;  1BOA A;  1ZGW A;  4S0H B;  3MQ0 A;  2K4B A;  2VJ4 A;  3J81 Z;  2PI0 A;  3PJR A;  4E7H A;  1IN5 A;  1K4S A;  3VEP A;  4NC8 A;  4DIQ A;  1F5T A;  2EIK H;  4ESB A;  1UG0 A;  3WE2 A;  5JHU A;  2FBH A;  3H5R A;  4B48 A;  3E5U A;  3OL3 A;  4OIN F;  4IPA A;  3OYA A;  5HOD A;  5FKN A;  2W84 A;  4KYW A;  1VND A;  2CRG A;  2R7X A;  1IXC A;  2GM4 A;  3K4C A;  2OCC H;  3E5X A;  1YTY A;  2QF7 A;  1ONV A;  3DEU A;  4IF4 A;  3ZN0 A;  1QZY A;  2L9R A;  2ZME B;  3KIO A;  2HFH A;  2O7O A;  1JKP C;  4GGG A;  2A69 F;  1BI3 A;  3CMM A;  2ZFW A;  3FXL A;  4KN4 X;  4BQN A;  4E7L A;  3IHU A;  4IQJ A;  2V9P A;  2WTE A;  3E7L A;  3S3O A;  1BN5 A;  3PSI A;  1FBU A;  3WTS C;  1PVE A;  3GFJ A;  4LFU A;  1G2H A;  3S1M J;  1X1D A;  4ITV A;  2JZY A;  2KIU A;  2BBY A;  3FM3 A;  1ZTR A;  3KX2 A;  3T0Y A;  3OR1 C;  5IYC J;  3CJT B;  3I5U A;  4LIT A;  4KDP A;  4XLN F;  1Y0U A;  4KT5 C;  3WG9 A;  2R5Y B;  1U78 A;  3IAS 2;  3K4B A;  2LD5 A;  4E7Z A;  3VYS B;  3FXJ A;  3DBL B;  1X4P A;  3TBI A;  1MGT A;  3EPZ A;  2NS7 A;  4N4N B;  5ERI A;  1VQM I;  2QZ8 A;  2XSJ C;  3I59 A;  5J4Y A;  3DBR B;  3S93 A;  4QTR A;  2Z99 A;  3LA3 A;  3H36 A;  2HZT A;  1K7A A;  5L3F A;  1IXS B;  4GFB A;  4NB5 A;  2WV1 A;  4HEA 2;  3V8K A;  3GFI A;  1R7J A;  3TP0 A;  1ZHF A;  2O61 A;  2QVO A;  4OMY A;  4E7J A;  2VKD A;  3TOB A;  2I8D A;  4OAY A;  1T33 A;  3CDI A;  4XR6 A;  3SZP A;  5TGT A;  1WI3 A;  3W3C A;  2MW8 A;  1WKM A;  4B09 A;  4IHW A;  1MIJ A;  3OYE A;  4HOB A;  1FOK A;  3RKX A;  4DYQ A;  1S7O A;  2IGK A;  4CYC A;  1OPC A;  3OR2 C;  4BEH B;  1T6S A;  1VTN C;  1WJD A;  2X6O A;  2HR3 A;  1ZAO A;  2BEO A;  3LMM A;  5K7F A;  3DPL C;  2COM A;  1FC3 A;  4EQQ A;  3KP3 A;  1OYY A;  2F6C A;  1Z05 A;  4GO1 A;  2A6T A;  2E1N A;  3FXU A;  3WE3 A;  2KL4 A;  3HXL A;  1JUP A;  4D9J A;  1ZLJ A;  2HGC A;  1Y56 A;  3NAU A;  1LNW A;  1RZ4 A;  1EH6 A;  1MBG A;  2F5E A;  1L0O C;  1OCO H;  4HRI A;  2V6E A;  4IHS A;  1I3Q J;  2VOO A;  3I9V 2;  2K86 A;  2DMP A;  3C2G A;  2CUE A;  2VT3 A;  1Q1V A;  3FXM A;  5EEA A;  1LJ9 A;  2H94 A;  3TKY A;  1DP3 A;  1PDN C;  1QGP A;  4HQE A;  2XB5 A;  2W82 A;  4CGZ A;  3R0A A;  1HC8 A;  3CUQ B;  3R0J A;  2LC2 A;  1LVA A;  1BOB A;  2D2W A;  2MA3 A;  3F72 A;  3N4M A;  4CCN A;  1FZP B;  2JA6 J;  1J09 A;  3BC8 A;  2L0K A;  2DQL A;  1YW8 A;  3VOD A;  3L2Q A;  3BR3 A;  3T1B A;  4IOA F;  1TNT A;  3RTR A;  5ICE A;  3VYU B;  4PFP A;  3GX4 X;  3ZRG A;  2UXN A;  3I53 A;  1QPM A;  2DA3 A;  2HPM A;  2YS9 A;  2CW8 A;  1JTY A;  2VQL A;  3MZ8 A;  3PUB A;  1SFX A;  1G8X A;  4OIR F;  3GTQ J;  5LGU A;  1ULY A;  2LY2 A;  4I02 A;  1KU9 A;  5EG0 B;  2E5N A;  3ERM A;  4I99 C;  1S72 I;  3DV8 A;  1CF7 B;  4XOR A;  2FQ4 A;  2JRT A;  5JHF A;  3P9C A;  3T8R A;  1O3Q A;  1HKT A;  4BY7 J;  1YFH A;  2RNG A;  2WA0 A;  4D5C A;  1YJ9 I;  3PO2 J;  1B59 A;  1AU7 A;  3RCO A;  2V1X A;  2LNB A;  1W0T A;  3WTZ A;  1IGN A;  4NC6 A;  3EUA A;  1JT0 A;  1RUN A;  4IEJ A;  5J1R A;  4BKX A;  1X19 A;  2O9L A;  3HGY A;  3JTG A;  4FIS A;  3HUG A;  1O4X A;  4DZJ A;  1MDM B;  2LMD A;  4ZYE A;  5HS8 A;  1H0M A;  5FLX K;  4AC0 A;  2JRM A;  2GIV A;  4HF0 A;  1VQN I;  3K69 A;  2V7F A;  2KFD A;  1V54 H;  1RI7 A;  4KNY A;  1U5T A;  2KJC A;  4CO8 A;  1B1B A;  3RKW A;  3SDB A;  4A3F J;  3C18 A;  4E7K A;  3MVP A;  3LAP A;  3C2B A;  1XPX A;  4RLQ A;  2Z5U A;  1S5L C;  1BR2 A;  4PUS A;  2L2O A;  2FD5 A;  2CFO A;  2E35 A;  3CUQ A;  2XAQ A;  4EMS A;  4BHB A;  3A01 A;  3PNV A;  2M2E A;  2DOD A;  4FE7 A;  5LRS A;  1B9N A;  3D5R C;  2H1L A;  1YE9 A;  2FOK A;  3IC7 A;  3OV8 A;  5DM6 F;  2DPD A;  4UUV A;  2LTP A;  1FNN A;  4D7M A;  5HLH A;  3BZ6 A;  1JUS A;  1WH5 A;  4HG2 A;  4MHG A;  5LFA A;  3K70 D;  2M87 A;  3FHZ A;  3BLY A;  5D4R A;  3ZMZ A;  2CQN A;  1K4T A;  1R1T A;  3WGI A;  1DU6 A;  2ZCW A;  2FBK A;  2DMU A;  4ZJZ A;  3OYH A;  1XSV A;  2GXA A;  2V26 A;  2HPI A;  1PYV A;  2HOS A;  2HDC A;  4OIO F;  3HOX J;  3DKX A;  2Q0O A;  4RM3 A;  1SEU A;  4HLY A;  1ODD A;  4YIR X;  5LHG A;  3MZH A;  3RQ4 A;  2COB A;  3JTH A;  4D0P A;  4A3B J;  4UB8 C;  3SQN A;  1VQ8 I;  3HEF A;  2TRT A;  3LA2 A;  2YR2 A;  4QLC U;  3J80 Z;  2XKP A;  3IUO A;  2TCT A;  5E79 C;  2G0E A;  4CIC A;  2QEX I;  4AD9 A;  1ETW A;  3DCF A;  3Q9S A;  3NQO A;  3HBL A;  5DD8 A;  1ZQ3 P;  1F1Z A;  2JUG A;  3M4O J;  4MIM A;  4IRH A;  2EQR A;  5J3L A;  2ELH A;  3HOV J;  4PJ0 C;  2O5R A;  4HX8 A;  4ZDL A;  4NHJ A;  2B9S A;  1FOW A;  3LFU A;  1I27 A;  1X1C A;  2RAE A;  4FTH A;  2PQ8 A;  1QVT A;  2VPR A;  3HOZ J;  3D5L A;  2BVM A;  3BJA A;  4PJJ A;  3HDD A;  1XN7 A;  1TL8 A;  2P6T A;  2RC4 A;  2K7L A;  3PNY A;  5FKK A;  2R7S A;  5FD5 A;  2BGC A;  5GAE J;  4IOC F;  3W2V A;  2L4A A;  2PBI A;  2DLL A;  1FOY A;  1OCT C;  5C4J J;  2X9D A;  4B47 A;  4ON0 A;  1GXP A;  2OD5 A;  5AON A;  3VB2 A;  1UJ8 A;  3SEZ A;  3K10 A;  2QSH X;  4XID A;  3E6B A;  1FX7 A;  4YG2 F;  5DS9 A;  3AAF A;  2KIF A;  2W24 A;  1JJ6 C;  3RKY A;  3ABU A;  1XCB A;  2K4J A;  4Q48 A;  3R6S A;  4EJU A;  3OYF A;  1W7P B;  1SVL A;  1XC5 A;  2KMU A;  3WTY C;  3RPU A;  3BJO A;  1AKH B;  2OV7 A;  2VI6 A;  3M1C A;  5HLT A;  1FYL A;  1NG6 A;  4DJA A;  2CV0 A;  4S05 A;  2DA1 A;  1LFB A;  4WXC A;  2M4K A;  2NRA C;  2XB0 X;  4OU0 A;  2H6C A;  4AIJ A;  3BG7 A;  1T0F C;  3DQV C;  3CMA I;  3ZQQ A;  4BJT A;  4QPO A;  1F36 A;  4JOM A;  2CSO A;  4LLG F;  3KP4 A;  3Q0U A;  5B1A H;  2R7F A;  1IC8 A;  5CQG A;  2L4M A;  3ZQL A;  5FRM A;  4NC7 A;  4HDV A;  2JSP A;  2CUZ A;  4OMZ A;  1MMN A;  5TRD A;  4KIS A;  2WV0 A;  3JRG A;  2JA2 A;  1IDZ A;  4CSW A;  2FQ3 A;  2M45 A;  3T5X A;  2Y0M A;  3WHC A;  1BI2 A;  2WAD A;  1YW7 A;  1SAN A;  3E5Q A;  3FHN A;  1V5E A;  2LY9 A;  2VC0 A;  2C6Y A;  2LKS A;  3O2P E;  1D8K A;  3LWF A;  3BQY A;  4X0G A;  3FX3 A;  4BE0 A;  1F43 A;  2VBY A;  1DQU A;  1FBS A;  3JRB A;  4U7D A;  1D8J A;  4B3X A;  1HOM A;  3F23 A;  2LBF B;  4ZTJ A;  5M5W J;  3HSF A;  2RVC A;  4ZZL A;  3J7A O;  3A0B C;  4ZTF A;  2ZSI B;  3G2B A;  4MQV A;  3S2W A;  3GTJ J;  4QPQ A;  2K3P A;  2Q2E A;  3ZQI A;  3L7W A;  3TGN A;  2A6H F;  2R93 J;  1YO5 C;  3QQA A;  3Q0W A;  3GTO J;  2IGN A;  2N8G A;  3K4M A;  1A35 A;  4DZP A;  1YIO A;  3QP5 A;  1WJ5 A;  2BHY A;  4HQM A;  1KU3 A;  1YYV A;  1J7K A;  3PUF A;  1VQ5 I;  3CTA A;  2EBI A;  4MEY F;  3J7Y J;  2RDP A;  2FMY A;  3HKZ N;  4LIV A;  5TJJ A;  2L01 A;  3LFK A;  1YS7 A;  4ESJ A;  1I6X A;  4R8H A;  2OZ6 A;  3OSF A;  2EFP A;  2K27 A;  1ZK8 A;  1V5G A;  3H5N A;  3GTP J;  2XRO A;  3JRH A;  3FIS A;  5HDG A;  2UXX A;  4BEH A;  1Z6T A;  5H2F C;  5F0C A;  5IT9 Z;  5HLI A;  1GV5 A;  2KZV A;  3LL7 A;  4G8X A;  5ICG A;  2BXY A;  2R7W A;  1TW3 A;  3HOY J;  5KAI C;  4BAY A;  4CDG A;  5DUI A;  2P7V B;  3ROU A;  3IKT A;  2KPM A;  2GZW A;  5IYD J;  4PGG A;  3S15 J;  1FJL A;  2AQE A;  3GME A;  2HQR A;  2LSO A;  5JVG F;  1YG2 A;  2DYR H;  3LSI A;  4BJ6 C;  4PZJ A;  1BI1 A;  1G3S A;  3DP7 A;  1TWG J;  5JLX A;  3FF5 A;  1YLF A;  3K1M A;  1VQL I;  4JQF A;  1Z7L A;  4NUB A;  4BXF A;  4MO7 A;  1SFU A;  1D0Y A;  4IRI A;  4GYI A;  1Y8Q B;  3QPT A;  3D5S C;  1ETO A;  1U6G A;  4W1U A;  5A2Q Z;  2Z16 A;  3QAH A;  4L9V A;  3MKW B;  3TP3 A;  1ETV A;  1IUY A;  3JRA A;  5L3C A;  2R4G A;  3G4S I;  4LB6 B;  1K6Y A;  1TT5 B;  2ESN A;  3MCZ A;  2DPU A;  2KDZ A;  2DT5 A;  2RV8 A;  1R36 A;  3C7J A;  4P9F A;  1Z67 A;  1IAW A;  1E0E A;  1UHS A;  1Z6R A;  2VB6 A;  1BA5 A;  3CLQ A;  2HZD A;  4UVC A;  1B6A A;  4LG0 A;  4RGR A;  1ITY A;  4XRS G;  2XPV A;  1X1B A;  4W97 A;  3F8C A;  3ZR8 X;  3WGH A;  2P5L C;  3DPU A;  5FKM A;  2HQA A;  2D1V A;  3A0H C;  3H92 A;  5KCM A;  1U8B A;  3DLL F;  3F22 A;  4I0A A;  2GA1 A;  3M7G A;  4RDU A;  1IUF A;  5GAG J;  3KCC A;  1Z77 A;  3GYH X;  3ABK H;  2DA2 A;  4ENJ A;  1SD5 A;  3K4J A;  1G6N A;  3G6E I;  5IP6 A;  3BG3 A;  3JW4 A;  2JPB A;  4KIB A;  1IV6 A;  3F8M A;  2LKX A;  3CD6 I;  2EV6 A;  4EEF G;  2H6B A;  4CHU A;  1GVJ A;  2EJR A;  1YJW I;  1TQM A;  2XRN A;  1LDK B;  3PIO F;  5CKT A;  1MMD A;  4MFE A;  4ZYG A;  1WPK A;  2V4J C;  4LMY A;  1IN4 A;  4LK0 F;  4RM2 A;  2VPL A;  2FE3 A;  2EIM H;  1JKO C;  4H4K C;  2Y9Y A;  1TWF J;  2EZK A;  5HS7 A;  4EGZ A;  5JI6 A;  1ZG3 A;  1ZKG A;  1IJW C;  3BR6 A;  2QSG X;  4UUT A;  4CCM A;  5FRO A;  3TED A;  1FIP A;  5D8K B;  1STZ A;  1UFM A;  2PMU A;  2NAZ A;  3IP4 B;  3UNG C;  3CMY A;  4KA4 A;  5DCF A;  3MZY A;  4Y4R A;  2M34 A;  4XMY A;  4YEL A;  5J40 A;  4BJ5 C;  3IL2 A;  4FX0 A;  3AL0 B;  1MBJ A;  2RKH A;  5F27 A;  1AOY A;  4M3F A;  1IXR C;  4RLF A;  4M3E A;  4TV7 A;  1OR7 A;  4LG0 B;  1T08 B;  2E1M C;  2ESH A;  3E1S A;  3UR3 C;  2R3S A;  2Y9Z A;  4I76 A;  1R6R A;  2MC4 A;  3NWT A;  4NNJ A;  1MBK A;  5FGM A;  5F1R A;  1VQ6 I;  2HOT A;  2CMP A;  3GXO A;  4MNU A;  2IGM A;  4IHT A;  2D45 A;  1QNT A;  3OOU A;  4EJO A;  1RC9 A;  2J5P A;  4A5M A;  1HST A;  4D1Q A;  3EQL F;  4U7B A;  2CS3 A;  2YX7 A;  3HHG A;  3HM5 A;  4A6D A;  4HAM A;  1TP4 A;  2EIN H;  4BE2 A;  2M8G X;  3F8F A;  4BL0 B;  5BQT A;  3JAM Z;  4II2 A;  3C1D A;  5ICC A;  2L02 A;  3ULQ B;  4B44 A;  3ABM H;  1NG7 A;  3P7N A;  1HF0 A;  1GDT A;  5EJC A;  3HYI A;  2VJI A;  3LQQ A;  4UVA A;  3RKQ A;  1H89 C;  2QGU A;  2LH9 A;  2XV4 S;  1YX5 A;  1RES A;  2DW4 A;  2UUZ A;  1ZRE A;  1OIS A;  2EIL H;  2UV1 A;  3ZQF A;  4HA8 A;  1FBQ A;  4MTE A;  2GLO A;  3L2C A;  3H1C A;  5DEQ A;  4ETS A;  5DD4 A;  2KJB A;  2X4H A;  1WJE A;  3JSO A;  3F6O A;  2F2E A;  3PNT A;  1OYI A;  2XC7 A;  4PDK A;  6PAX A;  3H9Q A;  4E4H A;  5EZG A;  5ED4 A;  3QYB A;  2X6W A;  4G6Q A;  5KK1 A;  4A12 A;  5KNL A;  2W85 A;  5E3M A;  5GTH C;  3EUK L;  1XCV A;  2NS0 A;  4XLA A;  3HZJ A;  1J0R A;  4DBR A;  4LIU A;  3ZQ7 A;  1SC7 A;  3CUQ C;  3FBI B;  2F5F A;  1TZL A;  3RQI A;  4KUM A;  4B8X A;  1FTZ A;  3DPT A;  2EA4 A;  3DBH B;  3SZG A;  3S14 J;  2DTR A;  5K5R A;  2OBP A;  3VWB A;  1R5G A;  3JRF A;  3DTE A;  4BXX J;  1U8R A;  3ABL H;  5GPA A;  2OAZ A;  3CCL I;  3DXJ F;  2VQG A;  5J1U A;  2ID6 A;  1ON1 A;  3FMR A;  2WB1 N;  1M1E B;  4ZC3 A;  3H0D A;  4EV0 A;  1D0X A;  3F8N A;  4NQW B;  2ME6 A;  1EV7 A;  1W5C C;  1REP C;  2JPC A;  2V79 A;  3FK6 A;  2Z3Y A;  1UHW A;  3F9K A;  4GRI A;  3S2H J;  1FYK A;  1P9Q C;  3HRU A;  5EGO A;  3V7C A;  3C2H A;  5EZH A;  4L0Y B;  1OYW A;  3PFI A;  3V7R A;  3Q5F A;  1IRG A;  1SMY F;  3FWE A;  4LB5 A;  3CCJ I;  2VBW A;  2ZXI A;  3BJ6 A;  3OS0 A;  2MD5 A;  1RET A;  1XSD A;  1BW6 A;  3ZPL A;  1UHM A;  2MSY A;  4FQG A;  4XKW A;  2H8R A;  1QO0 D;  4NBQ A;  2CFX A;  5LLQ A;  5E3O A;  1VF9 A;  2ZJP F;  4JP0 A;  2X1D A;  3DU6 A;  3AL0 C;  4IHY A;  1X3U A;  4A6E A;  1K78 A;  4WF2 A;  2EZI A;  4PSX A;  4A3D J;  5FFZ A;  1KYW A;  5D6F A;  5BOX A;  4QSH A;  1LDJ A;  1TWH J;  2PMZ A;  2KHM A;  2FA5 A;  3DTK A;  3OYG A;  2BY0 A;  1EJ9 A;  4M3G A;  1MMG A;  3HRM A;  1CGP A;  2KIM A;  1ETY A;  1KQ0 A;  1B4A A;  2BHZ A;  3ZQG A;  3MFK A;  1W36 D;  2RRE A;  4LD5 A;  4XLH A;  4F3Q A;  3I58 A;  2IS2 A;  2IBD A;  3ZOB A;  1F4K A;  2XHK A;  1X3W B;  3RIR A;  5J6X A;  2OZU A;  1LFP A;  2LDU A;  2DO7 A;  4L5I A;  2PJR B;  2JVG A;  4KIC A;  3LSK A;  2HTS A;  4I7H A;  4XSZ F;  3A01 B;  1PP8 F;  2JA7 J;  3WTW C;  1XD7 A;  1N78 A;  1YRN A;  2LLK A;  2CQX A;  4M9S A;  2QQB A;  3EUH A;  2R7R A;  1QRY A;  1MJA A;  2I5U A;  1FSH A;  4C3J J;  3L00 A;  4IX7 A;  4O5V A;  5F0H A;  3KYC B;  3BPX A;  4ZDO A;  2RN7 A;  3S1R J;  3BCB A;  3MD2 A;  3ASO H;  1MJB A;  2X51 A;  2VLA A;  4FHT A;  1E3O C;  4JX6 A;  5D8L B;  3OYL A;  5FLV A;  3GWZ A;  2KIS A;  4FAS D;  3DU5 A;  4I09 A;  1TW2 A;  3GZN B;  2KRH A;  2STW A;  4UUS A;  4J01 A;  3K0L A;  2X0L A;  4BBR J;  1MH3 A;  3KP6 A;  1SFO J;  4XBF A;  3Q0V A;  2ZJR F;  4UNO A;  3ZMU A;  2MH9 A;  3TOA A;  5GAD J;  5D5U B;  3FBN B;  2ISY A;  2JK3 A;  5K5Q A;  4BQO A;  3S2D J;  2FU4 A;  3JCU C;  4XON A;  4CUG A;  2VJ5 A;  3P9I A;  1SAU A;  1FMW A;  3ZXS A;  1I5Z A;  4XKB A;  1KYZ A;  3KZY A;  2XAF A;  3MWM A;  1S9H A;  1VQ7 I;  2IJL A;  4UV9 A;  5CQE A;  2FXA A;  2CYY A;  3L1P A;  3HOW J;  3RDI A;  2WAE A;  3JAM K;  4M6V A;  3J7Z I;  3IRR A;  2QSF X;  3ZQH A;  1LPQ A;  2M9H A;  4Y3O A;  4BXU A;  2IW5 A;  2K40 A;  3PM1 A;  3F8B A;  1MMS A;  1FIA A;  4FE4 A;  4KMU X;  1MBH A;  5KAF C;  3H35 A;  3CJQ B;  3TDZ C;  2X48 A;  3AG1 H;  1J59 A;  2L3D A;  2JA5 J;  5GP9 A;  3K4N A;  5LEJ A;  3FKI J;  3LST A;  4G7Z F;  3GO5 A;  5IT3 A;  2FNA A;  2R7Z J;  2VQC A;  2D5V A;  2HS5 A;  2F48 A;  3CQZ J;  5F1J A;  4CCL A;  2XAU A;  1T8I A;  1JJ8 C;  2JTV A;  4KFC A;  3CF5 F;  5GPC A;  1ZH5 A;  3FXR A;  1JHF A;  1AKH A;  4B4C A;  3QYE A;  3TO9 A;  1IO2 A;  2MFZ A;  2CV1 A;  2PEX A;  1EH8 A;  2WY7 Q;  3CJR B;  2PX9 A;  1XB4 A;  4BY1 J;  4F7Z A;  2EZH A;  1GUU A;  2K9M A;  2LY1 A;  3I64 A;  1PP7 U;  2QBY B;  4BUP A;  2STT A;  3WTT C;  2VUM J;  1ZGA A;  1JTX A;  1W1W E;  1FY7 A;  3QP6 A;  3HTU A;  1W4M A;  2DN0 A;  2ZXH A;  2ECC A;  2BZT A;  2PLY A;  1I1S A;  5E1X A;  5EG0 A;  2DK8 A;  3VPR A;  4PJN A;  4A3L J;  4L9J A;  2LG4 A;  4HYE A;  3B6C A;  2O6G E;  4EGY A;  3ECH A;  2HKX A;  1SD7 A;  3LSR A;  1QQI A;  3DKW A;  2IGO A;  2UWM A;  3HG9 A;  2MG4 A;  4KIG A;  2VBZ A;  1Z91 A;  1IRF A;  2KZG A;  2QWW A;  5ILV A;  1VI0 A;  1FP2 A;  1P4A A;  2EV0 A;  3FIW A;  2IRF G;  4UY8 I;  1B8I A;  3FM5 A;  4M6Y A;  1OCZ H;  2E2I J;  1OCC H;  4RB0 A;  2GXB A;  2DDB A;  2HWV A;  1EKE A;  3HGG A;  2IA1 A;  1U5T B;  4K2E A;  2HI3 A;  2CW7 A;  4ZYH A;  4CH7 A;  4M74 A;  3BRO A;  1DGW Y;  5IOZ A;  2D1H A;  3K7A J;  1SD4 A;  3H3Z A;  2IA2 A;  3A1Y A;  3GLX A;  3QOP A;  4UV8 A;  4D7N A;  3PO3 J;  2FJ1 A;  3QYF A;  2V9V A;  1XS9 A;  3GTK J;  1GHC A;  3ISP A;  1O7F A;  2ZBK A;  2MLG A;  3LSP A;  4J00 A;  2WB1 A;  3AG4 H;  4HST A;  4U0V A;  5HDN A;  3RJP A;  2DOF A;  1G3T A;  1S3J A;  5CVV A;  5E8G A;  2GXG A;  4A5N A;  4BBS J;  2ZB9 A;  2CJJ A;  2BY2 A;  2A68 F;  3WTX C;  3S16 J;  2OTL I;  4HF1 A;  2A05 A;  1WQ2 A;  3U1D A;  2IEK A;  4M73 A;  5A2Q K;  2WBM A;  4DYR A;  4BHP A;  2LR8 A;  4A69 C;  2F5D A;  4J19 A;  1MZB A;  2X6X A;  3E6D A;  1HW1 A;  3S1Q J;  3B73 A;  1X4O A;  3U21 A;  4U87 A;  1K79 A;  2OJE D;  1TLH B;  4QIW N;  4IRG A;  1LEB A;  2DOA A;  1PJR A;  5FB2 A;  2L9N A;  1PUE E;  2V6C A;  3IH3 A;  4DBQ A;  1V5F A;  3SHF A;  3NEU A;  1DU0 A;  1V4R A;  5FD6 A;  3ML6 A;  3IWZ A;  3PL8 A;  2X1C A;  1JGS A;  1OR7 C;  1Y39 A;  2E1O A;  2EB7 A;  2XPU A;  4EM0 B;  1Z9C A;  2QKM B;  2W25 A;  5FKL A;  2ZXJ A;  4AUX A;  1S6L A;  2Y0S A;  3ZGK A;  2ZNZ A;  1DPR A;  1P2F A;  4X6A J;  4E6K G;  3W2W A;  2H27 A;  1RR7 A;  1XG1 A;  2EPF A;  4X1E A;  3IV5 A;  1QPI A;  1T98 A;  3KEO A;  4RB2 C;  5FFX A;  3WU2 C;  2GOM A;  1NH3 A;  3LSJ A;  5LBQ A;  3DLA A;  2ZSH B;  4KJZ A;  3M9A A;  2K02 A;  2XRL A;  1KU7 A;  5EGO B;  3LSM A;  3QPH A;  5D5W B;  3L2U A;  1ON2 A;  2BY3 A;  1OQY A;  1Z3Y A;  2XIG A;  2DYS H;  1S29 A;  3E0J B;  3CCM I;  3BG5 A;  1J2X A;  1YX3 A;  4HX4 A;  2P6S A;  1R00 A;  3SFI A;  3RYP A;  2EH3 A;  2TDX A;  1G3Y A;  5JLW A;  3S3M A;  5HVQ C;  2DT7 B;  3CCV I;  5JR3 A;  2OCE A;  2XUB A;  3X2Q H;  3H9G A;  3QWL A;  2XAS A;  4NDL A;  3EET A;  3LA7 A;  2CO5 A;  3L2W A;  3CC4 I;  3HB9 A;  3AKZ A;  1Y0N A;  2YSR A;  2DQR A;  3LSH A;  3V8L A;  3HPH A;  2CUF A;  3JR9 A;  4LOC A;  1ZGJ A;  2VKE A;  3OS2 A;  1R49 A;  3GLL A;  2OF7 A;  2O3F A;  1F9N A;  2CUJ A;  1KZH A;  1T0F A;  1ZRD A;  2W48 A;  2OUM A;  5E1Z B;  1BJZ A;  2P7C B;  3JRC A;  1YS6 A;  3V4G A;  3GEZ A;  3ZCO A;  5DTD A;  5E3N A;  1TTY A;  2M7B A;  2HYF A;  2OA4 A;  2GAU A;  2M5W A;  3BG9 A;  2P81 A;  1R5I D;  3HL2 A;  4BQQ A;  5LEK A;  1H9G A;  2L7F P;  2ZME A;  2Z1D A;  2GOX B;  1UEL B;  4IL6 C;  4C30 A;  3QU3 A;  2FRH A;  3I4N J;  2WWY A;  3I3L A;  1IDY A;  5CPR B;  4RAG A;  4C2T A;  3F0C A;  1IN8 A;  3HUG B;  1KQ8 A;  2W00 A;  1E2X A;  2JQ7 A;  2E2J J;  5DUK A;  3RI4 A;  2IS1 A;  3CES A;  1W0U A;  3BZK A;  4MFD A;  1I6H J;  1WRJ A;  5AIP A;  1UST A;  3H9J A;  3TO6 A;  2DMT A;  1WSU A;  1FSE A;  2IXS A;  2VIX A;  1BR1 A;  1LQ1 A;  3FK7 A;  1WI9 A;  2GWR A;  4Y13 A;  2VXD A;  5GTI C;  1BI0 A;  2IPQ X;  2W57 A;  3HHH A;  1Z1D A;  3SJM A;  2K9L A;  2M0C A;  5FKO A;  2AXL A;  2QA4 I;  3N97 A;  2VXZ A;  4Y15 A;  2DJI A;  2VON A;  1VZ0 A;  1MKM A;  3A02 A;  2GIZ A;  4CXF A;  3A03 A;  2DAO A;  2Q8K A;  3U1K A;  3VYT B;  4OWR B;  5F04 A;  2FNP A;  2QLZ A;  1POG A;  3BWG A;  1I50 J;  4I6Z A;  1O3T A;  1R4M B;  3WTV C;  1A04 A;  3PQK A;  3LAJ A;  3QOD A;  3ESW B;  2R7D A;  1FPQ A;  5K1Y A;  1DP7 P;  5LGT A;  2KRF A;  4XLF A;  2W7N A;  1TQI A;  3PIP F;  2X6Y A;  3WGG A;  2PMZ N;  5FJ8 J;  1BBY A;  1P4W A;  3VFZ A;  1LKX A;  2OTJ I;  1H88 C;  5C3E J;  5IOY A;  3M1E A;  3S1N J;  3HC7 A;  3BTI A;  3J80 K;  1KU2 A;  2FEZ A;  4M9X A;  4FX4 A;  1JGG A;  1HA8 A;  3DKY A;  4XRS A;  2R7Q A;  2LYC A;  3EYY A;  2E60 A;  1J9I A;  1FWZ A;  5TIS C;  5EEG A;  5DV5 A;  1D1C A;  4F91 B;  3D0S A;  3DFG A;  3TQN A;  4AVP A;  2XGE A;  4B3A A;  5EDN A;  3VOE A;  1YW9 A;  4R1H A;  2JJ7 A;  1BC7 C;  2R5Z B;  3WU1 B;  2E7X A;  3GUD A;  3GFL A;  4HLX A;  3S17 J;  2WAQ N;  2LOO A;  4XNF A;  1AWC A;  4RGU A;  2JA8 J;  1WFX A;  5FO5 A;  1ZEL A;  1MBE A;  2M3A A;  4JX4 A;  3TL4 X;  2KP6 A;  2M8E A;  3K4K A;  1D0Z A;  3EUH C;  3BDD A;  1APL C;  3CP8 A;  4XKV A;  4EJV A;  1KON A;  1P6R A;  2A3S A;  1TWC J;  4KMF A;  3PQJ A;  5CVJ A;  1WHU A;  2WY8 Q;  3OL4 A;  4P55 A;  5M5Y J;  3TW6 A;  3FZV A;  3V42 A;  4UXN A;  2Y69 H;  1SVO A;  1YIT I;  1CF7 A;  1FOX A;  2HQN A;  1KQ9 A;  2F4I A;  2M30 A;  5ILU A;  5HNH A;  3IH2 A;  2CWE A;  3K4L A;  2R7T A;  3KYD B;  3OYI A;  2DFI A;  2DBB A;  2G9W A;  3ONQ A;  3L2V A;  4HPQ A;  3SEQ A;  1Z7U A;  3BTJ A;  1MNE A;  3BR0 A;  1G4D A;  2HVR A;  1UG2 A;  3B6A A;  1FMV A;  2HEO A;  4N9H A;  1QHH D;  1ZLK A;  1IN6 A;  2EA2 A;  3K1P A;  1BIB A;  3V7S A;  3GBG A;  1W5T A;  1U9O A;  4HNV A;  1K6O A;  3PFY A;  1XDU A;  4AVZ A;  3D1N I;  1XTA A;  3GW2 A;  1QHG A;  2UZK A;  2FML A;  4EJW A;  1ENH A;  4U0W A;  1LB2 A;  3GCM A;  2HYJ A;  2IA0 A;  1FP1 D;  4JBA A;  1PUF B;  3HJE A;  1ZG1 A;  1N77 A;  2ICW G;  3CF2 A;  3RSN A;  3R4K A;  2NVX J;  1SFK A;  3TW7 A;  3O8G A;  2FSW A;  5F64 A;  1S7E A;  3WTU C;  4BAC A;  4M71 A;  4N0B A;  3C3W A;  4YFK F;  3CCE I;  4BHC A;  3Q3S A;  4DNC A;  2A6E F;  3A4C A;  3MMY B;  3RZD J;  3JRE A;  2V1N A;  1BC8 C;  4V2G A;  4A2U A;  4XLP F;  5E3L A;  2QQA A;  2B7E A;  2VC1 A;  3FXO A;  1K61 A;  2R5Z A;  3KZI C;  1W5S A;  4Y33 A;  5B3S H;  2OQR A;  3OS1 A;  2I10 A;  5B66 C;  2NNN A;  4PSW A;  3W6K B;  2OQG A;  2ZME C;  4AYB N;  5K7H A;  4G7H F;  1RKT A;  3SDG A;  2OC6 A;  4A3I J;  2LBF A;  5BS6 A;  2F4M B;  2FBI A;  4ASN A;  3KEQ A;  2HKO A;  3REO A;  1B72 B;  1Y8R B;  1YRN B;  2IT0 A;  1MND A;  1YOV B;  2EIJ H;  2MAB A;  3BT9 A;  5M3F J;  2EWN A;  2K9S A;  2H1K A;  3R61 A;  5L3G A;  4M3B A;  1C0W A;  4F93 B;  4C3I J;  3TO7 A;  1V55 H;  3BZC A;  1DGR M;  3FXK A;  4IXA A;  4HW0 A;  2DOE A;  4YII A;  2MD0 A;  4XSX F;  3OSG A;  3MAJ A;  1XGN A;  1QZZ A;  2JUC A;  3AFH A;  3M3Y J;  2EZL A;  4UUS B;  2RNJ A;  3F3X A;  4XOP A;  4GDF A;  3W6V A;  2Y31 A;  1LUJ B;  3CP2 A;  3E6C C;  3CLO A;  3I59 B;  1A6Q A;  5HS9 A;  2L9V A;  2EV5 A;  3MKZ A;  5H6Q A;  1B72 A;  1OCR H;  4JK1 X;  5DM7 F;  2VOP A;  4E7S A;  3KP7 A;  3RPU D;  4RGS A;  5GAH J;  1TBX A;  1LEA A;  2ZJ2 A;  2NXN B;  1ZR2 A;  5J47 A;  4Q4Z F;  2ZC2 A;  1GVD A;  3VDX A;  2FX0 A;  4WX9 A;  1WZ2 A;  3B02 A;  3E97 A;  4HDU A;  1O7L A;  1JUM A;  2L5Q A;  3G73 A;  2E34 A;  3TMO A;  1CQT A;  3ELK A;  4WXD A;  2R7O A;  1YJN I;  1TC3 C;  4E70 A;  1RNL A;  5J1Y A;  4AYB A;  1HDP A;  5EEH A;  4BDY A;  2X1E A;  1WVR A;  5IPA A;  3HSE A;  2V9K A;  1HXD A;  3H0G J;  4ZZD A;  2XGX A;  1IZ1 A;  5FLX Z;  3IH4 A;  4B43 A;  2ZXW H;  1U2W A;  2Z9O A;  4XN0 A;  5DCM A;  2Y30 A;  4V2F A;  2E1C A;  4RB1 A;  2ETH A;  1W7P D;  1A6I A;  4IHV A;  4AM3 A;  3M8F A;  4A3J J;  4IQ4 A;  3I54 A;  4NQW A;  2FOW A;  2LVS A;  2ISZ A;  2BYV E;  1OFC X;  1B9M A; 
#chains in the Genus database with same CATH homology
 4WCG A;  2XKO A;  3IKV A;  4MQ9 F;  2O8X A;  5BPI A;  4HBL A;  4R79 A;  4IVN A;  2Z33 A;  1FLI A;  2CW0 F;  5CVR A;  1J5Y A;  4EM2 A;  1K78 B;  3NRV A;  4L9T A;  5HDK A;  1QBJ A;  2MBF A;  2A61 A;  3I4P A;  5H6R A;  1SD6 A;  3Q9V A;  3RPQ A;  2LF7 A;  5E18 F;  2XVC A;  4A0Z A;  2P8T A;  2ZKZ A;  4CZZ A;  3BOQ A;  4MGR A;  2CGP A;  4Y17 A;  2F5C A;  4DQ2 A;  1V3F A;  4KIF A;  3H3U A;  1MD0 A;  2QM3 A;  4OOI A;  1ZRF A;  4I01 A;  4MEX F;  4L18 B;  4G94 A;  2HYG D;  1FYM A;  3HOS A;  1ZRC A;  2FF4 A;  2KIF A;  1ZN2 A;  1XMA A;  1BM9 A;  2G7U A;  2LF8 A;  4RAY A;  1SMT A;  3E3V A;  5D5X B;  4AIK A;  2QYO A;  1FT9 A;  2A07 F;  2DK5 A;  4M9Z A;  3GFM A;  1P92 A;  1XGS A;  4ENK A;  4U0Y A;  2RGV A;  3O3K A;  2GQQ A;  4QWQ A;  5F6F A;  4ZH4 F;  3FXQ A;  4HZF A;  3ABT A;  3U9G A;  1ZAR A;  2RQP A;  1RIO H;  1T39 A;  4O3M A;  3BY6 A;  5CYV A;  4YIF A;  2QBY A;  1MDM A;  4YFX F;  2GA2 A;  2O03 A;  1RUO A;  5LHI A;  3DF8 A;  2MLK A;  4A0Y A;  5K5O A;  2IP2 A;  2CQK A;  3FMQ A;  4LLN A;  1SFE A;  4UVB A;  3IWF A;  3HRT A;  1YQA A;  3WU0 A;  3ZN1 A;  1XGM A;  3ZMT A;  2P5V A;  4BYY A;  3CDH A;  2QUF A;  3L09 A;  1R1V A;  5DYM A;  4GXO A;  2V1U A;  1HQC A;  3EYI A;  3ECO A;  4EVI A;  2E7W A;  4O6J A;  2PN6 A;  3K2Z A;  2XAJ A;  5D4S A;  4BNC A;  4LJZ F;  2BV6 A;  4BH9 A;  5CJ9 A;  3E6M A;  4Z2Y A;  3W6J B;  2VOD A;  1D5V A;  2AS5 F;  4P9U A;  2L54 A;  1TNS A;  1R1U A;  2EFW A;  3ZMD A;  5AIQ A;  1U3E M;  1KGS A;  4G7O F;  5CVU A;  2EK5 A;  3GVA A;  4LGW A;  3QRF F;  3ZMV A;  3KFW X;  4WWC A;  4IJA A;  1WWX A;  1W7P A;  5J8C A;  1JE8 A;  2PJP A;  2HOE A;  5ILS A;  3SXY A;  1HW2 A;  4M72 A;  3K1N A;  3F6V A;  1XMK A;  5BMZ A;  2O0Y A;  1Q1H A;  2EFQ A;  3HOT A;  4M6X A;  1NHA A;  3BPV A;  1LDD A;  5LGN A;  4Q5S F;  2KKO A;  1I1G A;  1R22 A;  5CLS A;  2B0L A;  1UB9 A;  1S8N A;  4L5J A;  1GXQ A;  3J81 K;  2VT2 A;  1JXS A;  1KA8 A;  2JSC A;  4HV6 A;  3ZMS A;  3KP5 A;  1ZG5 A;  3KLN A;  4L0Z B;  1D3Y A;  2WC2 A;  4N9I A;  3RYR A;  2PFB A;  3FMS A;  1HBX G;  5H20 A;  3HIF A;  4RB3 C;  4Q47 A;  3M8E A;  5HLG A;  5J8F A;  1O57 A;  1J75 A;  1SAX A;  1L3L A;  1R5H A;  1ZYR F;  2JT1 A;  4WXH A;  2CG4 A;  2XAH A;  1OMI A;  2EFN A;  2DI3 A;  4ENN A;  2VN2 A;  4WK8 F;  3KE2 A;  1HKS A;  3SFZ A;  2G7H A;  3ERE D;  1JHH A;  1E17 A;  1BJA A;  4EM1 A;  1BIA A;  1S7A A;  4RS8 A;  1T38 A;  5CVI A;  4P5O A;  3K9T A;  4A0X A;  4G6D A;  5LRR A;  4I2O A;  3TDU C;  1HSJ A;  4FT8 A;  4RAZ A;  2VBX A;  1IN7 A;  2H09 A;  1G3W A;  3GZ5 A;  4EJT A;  4KN7 X;  2YPR A;  4U88 A;  3JSP A;  1DPU A;  5BPD A;  3GZ6 A;  4ESF A;  3HRS A;  5D5V B;  3KZZ A;  4ZYD A;  3IRQ A;  3I0T A;  5IT9 K;  4GYG A;  4PGH A;  2NYX A;  3I71 A;  2VE8 A;  2EFO A;  3T8T A;  5D6E A;  4PCQ A;  1IW7 F;  3O6B B;  4HX7 A;  2P4W A;  2ACJ A;  2OU2 A;  2YU3 A;  1MJ9 A;  3U2R A;  2DU9 A;  4OIQ F;  5ICF A;  1H9T A;  5JFR A;  1P4X A;  2M1B A;  1O3S A;  5DDG A;  2NNY A;  1DUX C;  5HOO A;  4GCV A;  3CO6 C;  5E17 F;  4P96 A;  2Y75 A;  1R58 A;  3G3Z A;  5E20 A;  1HW5 A;  2BE5 F;  2Y48 A;  3R60 A;  2PG4 A;  4YFN F;  3ZP5 A;  4UHT A;  1HKQ A;  3EDP A;  1O3R A;  4LLL A;  1U5T C;  1XSX A;  2A5Y B;  2YX4 A;  3V8J A;  5E8I A;  3SZT A;  1USS A;  4CYD A;  4L9N A;  2MH2 A;  2MC3 A;  2V1D A;  1XDS A;  2ZO4 A;  3CO7 C;  1R23 A;  4RGX A;  2VE9 A;  1EH7 A;  3KET A;  2HTJ A;  2PMH A;  5L3E A;  1XGO A;  3COA C;  2J5O A;  2XAG A;  5JVT A;  2ADU A;  4OIP F;  1TQP A;  2IVM A;  4HV5 A;  5L3B A;  3OOP A;  4AWX B;  3GF2 A;  2LKP A;  5L3D A;  3KLO A;  3MEX A;  5DCM B;  4AIH A;  4H0E A;  3P9K A;  1UCR A;  4G9Y A;  5KVR A;  3L9F A;  1DDN A;  1OKR A;  4ENM A;  4LK1 F;  4S04 A;  3QU6 A;  3CUO A;  2P5K A;  4MTD A;  3WOD F;  5LHH A;  3BP8 A;  3KP2 A;  5E1W A;  2QEN A;  2ZNY A;  4HF2 A;  3F21 A;  4XRF A;  2QQ9 A;  4I0B A;  3HTS B;  4I98 B;  3HSR A;  4BQA A;  3LQR A;  3CJN A;  1T2K A;  1IF1 A;  1BOA A;  3MQ0 A;  2K4B A;  2PI0 A;  3J81 Z;  1IN5 A;  3VEP A;  1F5T A;  4ESB A;  3WE2 A;  5JHU A;  2FBH A;  3E5U A;  4OIN F;  4IPA A;  2W84 A;  4KYW A;  1IXC A;  3E5X A;  1YTY A;  1ONV A;  3DEU A;  4IF4 A;  3ZN0 A;  1QZY A;  2ZME B;  2HFH A;  4GGG A;  2A69 F;  1BI3 A;  2ZFW A;  4KN4 X;  3IHU A;  2WTE A;  1BN5 A;  1FBU A;  3WTS C;  3GFJ A;  4LFU A;  2JZY A;  2KIU A;  2BBY A;  3FM3 A;  3T0Y A;  3I5U A;  4KDP A;  4XLN F;  1Y0U A;  4KT5 C;  3WG9 A;  1U78 A;  1MGT A;  5ERI A;  2QZ8 A;  3I59 A;  2Z99 A;  3LA3 A;  1K7A A;  2HZT A;  5L3F A;  1IXS B;  4NB5 A;  3V8K A;  3GFI A;  1R7J A;  1ZHF A;  2O61 A;  2QVO A;  4OMY A;  3TOB A;  3SZP A;  1WKM A;  4B09 A;  4HOB A;  1FOK A;  3RKX A;  1S7O A;  1OPC A;  1T6S A;  1VTN C;  2HR3 A;  1ZAO A;  2BEO A;  3DPL C;  2COM A;  1FC3 A;  4EQQ A;  3KP3 A;  1OYY A;  1Z05 A;  4GO1 A;  2E1N A;  3FXU A;  3WE3 A;  1ZLJ A;  2HGC A;  1LNW A;  1RZ4 A;  1EH6 A;  2F5E A;  1L0O C;  4IHS A;  2VOO A;  2K86 A;  2VT3 A;  1LJ9 A;  2H94 A;  3TKY A;  1PDN C;  1QGP A;  4HQE A;  4CGZ A;  3R0A A;  3CUQ B;  3R0J A;  1LVA A;  2D2W A;  3F72 A;  2MA3 A;  3N4M A;  1FZP B;  2DQL A;  1YW8 A;  3VOD A;  3T1B A;  1TNT A;  3RTR A;  5ICE A;  3GX4 X;  2UXN A;  3I53 A;  1QPM A;  1SFX A;  4OIR F;  5LGU A;  1ULY A;  4I02 A;  1KU9 A;  3DV8 A;  1CF7 B;  2JRT A;  3P9C A;  3T8R A;  1O3Q A;  1HKT A;  1YFH A;  1B59 A;  2V1X A;  2LNB A;  3WTZ A;  1RUN A;  3JTG A;  3HUG A;  1MDM B;  4ZYE A;  5HS8 A;  1H0M A;  5FLX K;  2GIV A;  4HF0 A;  3K69 A;  1RI7 A;  4KNY A;  1U5T A;  2KJC A;  4CO8 A;  1B1B A;  3RKW A;  3C18 A;  3LAP A;  2Z5U A;  3CUQ A;  2XAQ A;  4EMS A;  4BHB A;  5LRS A;  1B9N A;  3IC7 A;  2FOK A;  2DPD A;  3OV8 A;  4UUV A;  1FNN A;  5HLH A;  3BZ6 A;  4MHG A;  2M87 A;  3FHZ A;  5D4R A;  3ZMZ A;  1R1T A;  3WGI A;  2ZCW A;  2FBK A;  1XSV A;  2HDC A;  4OIO F;  2Q0O A;  4HLY A;  1ODD A;  5LHG A;  3MZH A;  3JTH A;  4D0P A;  3SQN A;  3LA2 A;  2YR2 A;  4QLC U;  3J80 Z;  2XKP A;  4CIC A;  4AD9 A;  3Q9S A;  3NQO A;  5DD8 A;  1F1Z A;  4IRH A;  2ELH A;  4HX8 A;  4NHJ A;  1I27 A;  2PQ8 A;  3D5L A;  3BJA A;  1XN7 A;  2P6T A;  2RC4 A;  2K7L A;  5FD5 A;  2BGC A;  2L4A A;  2PBI A;  2DLL A;  4ON0 A;  1GXP A;  2OD5 A;  5AON A;  3VB2 A;  3E6B A;  1FX7 A;  4YG2 F;  3AAF A;  2W24 A;  3RKY A;  3ABU A;  1XCB A;  2K4J A;  4Q48 A;  3R6S A;  4EJU A;  1W7P B;  3WTY C;  3RPU A;  3BJO A;  1FYL A;  4S05 A;  4WXC A;  2NRA C;  4OU0 A;  2H6C A;  4AIJ A;  3DQV C;  4LLG F;  2CSO A;  3KP4 A;  2R7F A;  2L4M A;  4HDV A;  4OMZ A;  5TRD A;  2WV0 A;  2FQ3 A;  2M45 A;  3T5X A;  2Y0M A;  1BI2 A;  1YW7 A;  3E5Q A;  2C6Y A;  2VC0 A;  3O2P E;  1D8K A;  3LWF A;  3FX3 A;  2VBY A;  1FBS A;  4U7D A;  1D8J A;  3F23 A;  3HSF A;  2RVC A;  4ZZL A;  3J7A O;  4MQV A;  3S2W A;  2Q2E A;  3L7W A;  3TGN A;  2A6H F;  1YO5 C;  3QP5 A;  1YIO A;  4HQM A;  1KU3 A;  1YYV A;  1J7K A;  3CTA A;  4MEY F;  2RDP A;  2FMY A;  5TJJ A;  2L01 A;  3LFK A;  1YS7 A;  4ESJ A;  1I6X A;  4R8H A;  2OZ6 A;  2EFP A;  2K27 A;  2XRO A;  5HDG A;  2UXX A;  1Z6T A;  5IT9 Z;  5HLI A;  4G8X A;  5ICG A;  1TW3 A;  4BAY A;  4CDG A;  5DUI A;  2P7V B;  3ROU A;  3IKT A;  2GZW A;  4PGG A;  2HQR A;  2LSO A;  1YG2 A;  4PZJ A;  1BI1 A;  1G3S A;  3DP7 A;  3FF5 A;  1YLF A;  3K1M A;  4JQF A;  1SFU A;  4IRI A;  4GYI A;  3QPT A;  1U6G A;  5A2Q Z;  3QAH A;  4L9V A;  1IUY A;  5L3C A;  4LB6 B;  2ESN A;  3MCZ A;  2DPU A;  2DT5 A;  2RV8 A;  1R36 A;  3C7J A;  4P9F A;  1IAW A;  1Z6R A;  4UVC A;  1B6A A;  4LG0 A;  4RGR A;  3F8C A;  3WGH A;  2P5L C;  2D1V A;  3H92 A;  3F22 A;  4I0A A;  2GA1 A;  3M7G A;  3KCC A;  3GYH X;  4ENJ A;  1SD5 A;  1G6N A;  3JW4 A;  2JPB A;  4KIB A;  3F8M A;  2EV6 A;  2H6B A;  4CHU A;  1GVJ A;  2EJR A;  1TQM A;  2XRN A;  1LDK B;  4ZYG A;  4LMY A;  1IN4 A;  4LK0 F;  2FE3 A;  5HS7 A;  4EGZ A;  5JI6 A;  1ZG3 A;  5D8K B;  4KA4 A;  1STZ A;  1UFM A;  2PMU A;  2NAZ A;  5DCF A;  3MZY A;  3IL2 A;  4FX0 A;  2RKH A;  1AOY A;  1IXR C;  4TV7 A;  1OR7 A;  4LG0 B;  2ESH A;  2R3S A;  5FGM A;  5F1R A;  3GXO A;  4MNU A;  4IHT A;  2D45 A;  1QNT A;  4EJO A;  2J5P A;  4A5M A;  1HST A;  3EQL F;  4U7B A;  2YX7 A;  3HHG A;  4A6D A;  4HAM A;  3F8F A;  5BQT A;  3JAM Z;  3C1D A;  5ICC A;  2L02 A;  3ULQ B;  3P7N A;  3HYI A;  4UVA A;  3LQQ A;  2XV4 S;  2DW4 A;  1ZRE A;  4HA8 A;  1FBQ A;  4MTE A;  3L2C A;  5DEQ A;  4ETS A;  5DD4 A;  2KJB A;  2X4H A;  3JSO A;  3F6O A;  2F2E A;  1OYI A;  4PDK A;  6PAX A;  5ED4 A;  5KK1 A;  4G6Q A;  4A12 A;  2W85 A;  1XCV A;  2NS0 A;  1J0R A;  3ZQ7 A;  3CUQ C;  2F5F A;  4KUM A;  4B8X A;  3DPT A;  2EA4 A;  2DTR A;  5K5R A;  2OBP A;  1R5G A;  1U8R A;  2OAZ A;  3DXJ F;  1ON1 A;  3FMR A;  4EV0 A;  3F8N A;  1EV7 A;  1REP C;  2JPC A;  2V79 A;  2Z3Y A;  1UHW A;  1FYK A;  3HRU A;  3V7C A;  4L0Y B;  1OYW A;  3PFI A;  3V7R A;  3Q5F A;  1IRG A;  1SMY F;  3FWE A;  4LB5 A;  2VBW A;  3BJ6 A;  2MD5 A;  1XSD A;  3ZPL A;  1UHM A;  1QO0 D;  2CFX A;  5LLQ A;  1X3U A;  4A6E A;  1K78 A;  4WF2 A;  5FFZ A;  1KYW A;  5D6F A;  5BOX A;  1LDJ A;  2FA5 A;  3HRM A;  1CGP A;  2KIM A;  1KQ0 A;  1B4A A;  3MFK A;  4LD5 A;  3I58 A;  1F4K A;  2XHK A;  3RIR A;  5J6X A;  2OZU A;  2LDU A;  2DO7 A;  4L5I A;  4KIC A;  4I7H A;  2HTS A;  4XSZ F;  1PP8 F;  3WTW C;  1XD7 A;  4M9S A;  2QQB A;  3EUH A;  1MJA A;  1FSH A;  3L00 A;  4O5V A;  3BPX A;  2RN7 A;  1MJB A;  4FHT A;  5D8L B;  3GWZ A;  4I09 A;  1TW2 A;  2STW A;  3K0L A;  2X0L A;  3KP6 A;  4XBF A;  4UNO A;  3ZMU A;  2MH9 A;  3TOA A;  5D5U B;  2ISY A;  5K5Q A;  2FU4 A;  3P9I A;  1I5Z A;  1KYZ A;  3KZY A;  2XAF A;  3MWM A;  2IJL A;  4UV9 A;  2FXA A;  2CYY A;  3RDI A;  3JAM K;  3IRR A;  4BXU A;  2IW5 A;  3F8B A;  4KMU X;  3TDZ C;  1J59 A;  2L3D A;  5LEJ A;  3LST A;  4G7Z F;  3GO5 A;  5IT3 A;  2FNA A;  2HS5 A;  2JTV A;  4KFC A;  1ZH5 A;  3FXR A;  1JHF A;  3TO9 A;  2PEX A;  1EH8 A;  1XB4 A;  4F7Z A;  3I64 A;  1PP7 U;  2QBY B;  2STT A;  3WTT C;  1ZGA A;  3QP6 A;  1FY7 A;  3HTU A;  1W4M A;  1I1S A;  2PLY A;  5E1X A;  2DK8 A;  4L9J A;  4HYE A;  2O6G E;  4EGY A;  3ECH A;  2HKX A;  1SD7 A;  1QQI A;  3DKW A;  2UWM A;  4KIG A;  2VBZ A;  1Z91 A;  1IRF A;  2QWW A;  5ILV A;  1FP2 A;  1P4A A;  2EV0 A;  2IRF G;  3FM5 A;  4M6Y A;  4RB0 A;  2GXB A;  2HWV A;  2IA1 A;  1U5T B;  4K2E A;  4ZYH A;  4M74 A;  3BRO A;  2D1H A;  1SD4 A;  3H3Z A;  2IA2 A;  3GLX A;  3QOP A;  4UV8 A;  2V9V A;  1GHC A;  3ISP A;  1O7F A;  2ZBK A;  2MLG A;  4U0V A;  5HDN A;  3RJP A;  1G3T A;  1S3J A;  5CVV A;  5E8G A;  2GXG A;  4A5N A;  2A68 F;  3WTX C;  4HF1 A;  1WQ2 A;  3U1D A;  4M73 A;  5A2Q K;  4BHP A;  2F5D A;  1MZB A;  3E6D A;  1HW1 A;  3B73 A;  1K79 A;  1TLH B;  4IRG A;  1LEB A;  5FB2 A;  1PUE E;  2V6C A;  3SHF A;  3NEU A;  1V4R A;  5FD6 A;  3ML6 A;  3IWZ A;  1JGS A;  2EB7 A;  4EM0 B;  1Z9C A;  2W25 A;  2ZXJ A;  1S6L A;  2ZNZ A;  1DPR A;  1P2F A;  2H27 A;  1T98 A;  3KEO A;  4RB2 C;  5FFX A;  5LBQ A;  3M9A A;  2K02 A;  1KU7 A;  3QPH A;  5D5W B;  1ON2 A;  2XIG A;  1S29 A;  1J2X A;  4HX4 A;  2P6S A;  1R00 A;  3RYP A;  2TDX A;  1G3Y A;  5HVQ C;  5JR3 A;  2XUB A;  2XAS A;  3EET A;  3LA7 A;  2CO5 A;  2YSR A;  3V8L A;  2DQR A;  1ZGJ A;  2O3F A;  1F9N A;  1T0F A;  1ZRD A;  5E1Z B;  2P7C B;  1YS6 A;  3V4G A;  3GEZ A;  1TTY A;  2HYF A;  2OA4 A;  2GAU A;  2M5W A;  5LEK A;  1H9G A;  2ZME A;  3QU3 A;  2FRH A;  2WWY A;  1IN8 A;  1KQ8 A;  1E2X A;  5DUK A;  3RI4 A;  1WRJ A;  5AIP A;  1UST A;  3TO6 A;  1WSU A;  1FSE A;  1LQ1 A;  1WI9 A;  2GWR A;  4Y13 A;  1BI0 A;  2IPQ X;  2W57 A;  3HHH A;  1Z1D A;  2AXL A;  3N97 A;  2VXZ A;  4Y15 A;  2VON A;  1MKM A;  4CXF A;  2DAO A;  2Q8K A;  2FNP A;  2QLZ A;  3BWG A;  1O3T A;  3WTV C;  1A04 A;  3PQK A;  3LAJ A;  2R7D A;  1FPQ A;  5K1Y A;  1DP7 P;  5LGT A;  2KRF A;  1TQI A;  3WGG A;  1BBY A;  1P4W A;  3VFZ A;  3M1E A;  3J80 K;  1KU2 A;  2FEZ A;  4M9X A;  4FX4 A;  3EYY A;  1J9I A;  1FWZ A;  5EEG A;  5DV5 A;  3D0S A;  3DFG A;  3TQN A;  4AVP A;  3VOE A;  1YW9 A;  4R1H A;  1BC7 C;  3WU1 B;  2E7X A;  3GUD A;  3GFL A;  4HLX A;  1AWC A;  4RGU A;  5FO5 A;  2M8E A;  3BDD A;  4EJV A;  1P6R A;  2A3S A;  4KMF A;  3PQJ A;  5CVJ A;  4P55 A;  3FZV A;  4UXN A;  1CF7 A;  2HQN A;  1KQ9 A;  2M30 A;  5ILU A;  2CWE A;  2DFI A;  2DBB A;  2G9W A;  1Z7U A;  1G4D A;  2HEO A;  4N9H A;  1ZLK A;  1IN6 A;  2EA2 A;  3K1P A;  1BIB A;  3V7S A;  1W5T A;  1K6O A;  1XDU A;  3GW2 A;  2UZK A;  2FML A;  4EJW A;  1LB2 A;  4U0W A;  2IA0 A;  1FP1 D;  4JBA A;  1ZG1 A;  3R4K A;  2FSW A;  5F64 A;  3WTU C;  4M71 A;  4N0B A;  3C3W A;  4YFK F;  4BHC A;  4DNC A;  2A6E F;  1BC8 C;  4A2U A;  4XLP F;  2QQA A;  2VC1 A;  1W5S A;  2OQR A;  2NNN A;  3W6K B;  2OQG A;  4G7H F;  5BS6 A;  2FBI A;  4ASN A;  3KEQ A;  2HKO A;  3REO A;  2IT0 A;  2EWN A;  3R61 A;  5L3G A;  1C0W A;  3TO7 A;  4IXA A;  4HW0 A;  4YII A;  4XSX F;  3MAJ A;  1XGN A;  1QZZ A;  2RNJ A;  3F3X A;  3E6C C;  3CLO A;  3I59 B;  5HS9 A;  2EV5 A;  5H6Q A;  4JK1 X;  2VOP A;  3KP7 A;  4RGS A;  1TBX A;  1LEA A;  2ZJ2 A;  4Q4Z F;  4WX9 A;  3B02 A;  3E97 A;  4HDU A;  1O7L A;  3G73 A;  3ELK A;  4WXD A;  4E70 A;  1RNL A;  5EEH A;  3HSE A;  1HXD A;  4ZZD A;  2XGX A;  1IZ1 A;  5FLX Z;  1U2W A;  2Z9O A;  5DCM A;  2E1C A;  4RB1 A;  2ETH A;  1W7P D;  3M8F A;  3I54 A;  4NQW A;  2ISZ A;  2BYV E;  1B9M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...