4EM0B

Staphylococcus aureus marr in complex with salicylate and kanamycin
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
175
structure length
150
Chain Sequence
TAAAKFEMLSQEFFNSFITIYRPYLKLTEPILEKHNIYYGQWLILRDIAKHQPTTLIEISHRRAIEKPTARKTLKALIENDLITVENSLEDKRQKFLTLTPKGHELYEIVCLDVQKLQQAVVAKTNISQDQMQETINVMNQIHEILLKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized HTH-type transcriptional regulator SAR2349
publication title Staphylococcus aureus MarR complexes
rcsb
source organism Staphylococcus aureus
molecule tags Transcription/antibiotic
total genus 54
structure length 150
sequence length 175
ec nomenclature
pdb deposition date 2012-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4em0B00
1E2XA 3P7NA 1HSJA 1U5TA 4HLXA 2QQAA 1IRGA 1SD7A 5LHGA 3ZMSA 5J6XA 3P9KA 3QRFF 2XAFA 1P6RA 3EQLF 2MC3A 1V4RA 1KU9A 3BY6A 3FXQA 5D5WB 2RGVA 1XDSA 1LDJA 2CG4A 3L00A 3F21A 1Z9CA 1FYKA 1XSVA 1TNSA 5D5VB 3BPVA 5HDNA 1HW1A 5JVTA 3LFKA 3V7SA 2L3DA 4M6XA 2E7WA 1Z91A 3FM3A 2XAQA 1T38A 1BI2A 1KGSA 3GVAA 1MKMA 5L3CA 5CVRA 4LLNA 3T5XA 1WWXA 4OINF 1FT9A 4YIFA 2Z3YA 1O3QA 3GYHX 4JBAA 1SFEA 3I59A 2C6YA 3JSOA 1U5TB 3FXRA 2OQGA 3GWZA 3HHHA 2ZNYA 1ZN2A 5CVVA 1QQIA 4L9JA 1KQ9A 1HW2A 1P4WA 3DEUA 2Q8KA 2V6CA 5LRSA 3ZN0A 4Z2YA 5L3FA 2FBHA 5D8LB 2G7UA 3Q9VA 3CUQC 1ONVA 3B73A 5LGUA 2HEOA 5CVJA 4G7ZF 4WXDA 2A69F 2VE9A 4EM1A 3M8EA 3L09A 2ZO4A 3F8NA 2DI3A 1R22A 5E1ZB 1W4MA 2HR3A 1SMYF 5LEJA 2BV6A 1ZRCA 1FZPB 3U2RA 2CWEA 2J5OA 1QZZA 2W25A 3I59B 3C3WA 3H92A 3ML6A 4CZZA 2LF7A 1WKMA 1BM9A 2GA1A 5A2QK 3OOPA 2GWRA 1S6LA 1R23A 5FFZA 4A6EA 4LK1F 2O3FA 3VEPA 3F8MA 3M9AA 2VXZA 3QP5A 4CO8A 2P5KA 5JHUA 2VT2A 3EYIA 4L9TA 4OIOF 1KQ0A 2HYGD 3P9CA 4R1HA 5FO5A 1IUYA 1LEBA 1KYZA 1QZYA 5LEKA 3RPUA 2GA2A 3I54A 3BJAA 3O3KA 1IF1A 3BWGA 3MCZA 1ZLJA 4LB5A 3IWFA 2V1DA 5E17F 1ZGJA 4M6YA 3N4MA 4L0ZB 2MD5A 2R7FA 5DDGA 2V1UA 2O03A 4P55A 1IXRC 1YYVA 1YTYA 1GHCA 3SQNA 4YFNF 1J59A 3E3VA 3NQOA 5JR3A 1F9NA 3DXJF 1PDNC 1YS6A 2XASA 2Y75A 1XDUA 2JT1A 1ZGAA 2EFNA 3E6CC 3HTSB 2XVCA 4KFCA 2PN6A 3KEQA 4A2UA 3M8FA 3V8JA 3ZN1A 4UHTA 4UVAA 5D8KB 2QBYA 4I0BA 1V3FA 3F22A 3G3ZA 3L9FA 4L9NA 3DPLC 1KU7A 3O6BB 3JAMZ 2L4AA 2BBYA 3TOBA 5FD5A 4BQAA 1FOKA 1T39A 2MH9A 4BAYA 3BROA 3FMRA 3HSFA 3V7RA 4HQEA 4HF0A 3JTGA 2P8TA 1IZ1A 3GLXA 4B8XA 3WTVC 4AD9A 2QZ8A 5DCFA 1LNWA 1YIOA 2STWA 3CJNA 1G6NA 2Z99A 3CTAA 2ETHA 3GUDA 5CYVA 3GZ6A 4P5OA 5EEHA 4ZZLA 1F5TA 5FB2A 3F8BA 4KUMA 4LFUA 4RGSA 2D1HA 3KZYA 3CO7C 3KP4A 4A5MA 2OZUA 3IHUA 2F5FA 4WK8F 4GYGA 2QBYB 4CICA 1HKQA 1ZRDA 3T0YA 3WGHA 1Y0UA 1RZ4A 1B4AA 3LQRA 3ZMTA 4A0XA 3WTZA 1HKSA 4XSXF 3E5UA 4KMFA 1O57A 1FPQA 2QUFA 3J7AO 1TQPA 2A6HF 4M73A 2VOOA 4MNUA 1BIBA 4G7OF 1T2KA 1LB2A 2EK5A 3QPTA 1ZG5A 2FNPA 2JRTA 2VONA 3RIRA 2QVOA 1L3LA 1TBXA 4BYYA 2PEXA 2Y48A 3RYPA 1FP2A 2GQQA 4AIKA 5HOOA 2DU9A 1IXCA 5DUKA 3KEOA 1U5TC 4UV8A 5ERIA 2IPQX 3TO7A 4KT5C 1O3SA 3HTUA 3RYRA 2IJLA 4ZYGA 4XSZF 4S05A 1D5VA 2AXLA 1S29A 2XHKA 1KQ8A 5L3DA 1U2WA 4RGRA 4KMUX 5HS8A 1QGPA 3IWZA 1I27A 1ZG1A 2VBZA 2H6BA 4NB5A 1KU2A 4A6DA 1R36A 3KP2A 2O6GE 2EV0A 5H6RA 3E6MA 4Y15A 3KZZA 1IN6A 2COMA 2GXBA 4M9XA 2J5PA 1FSEA 5AONA 4P96A 2Z9OA 1WI9A 2CQKA 2KRFA 2NAZA 1TLHB 3ABTA 4HX4A 2XAJA 2IW5A 3QOPA 3QAHA 3LWFA 5A2QZ 1SFXA 2PBIA 4UXNA 2QLZA 1FBQA 4ESJA 2RC4A 3WODF 4G7HF 4L5JA 3JTHA 2MLGA 3GZ5A 1USTA 4B09A 2JTVA 5ILVA 3JAMK 4FT8A 2FXAA 2KIMA 4AIJA 3BJ6A 2A68F 4EJUA 3WGGA 1U8RA 2ZNZA 3R0JA 5ICEA 1ZRFA 3DFGA 3GEZA 3BJOA 4PCQA 4HLYA 3CUOA 2ADUA 3MZYA 3VFZA 2MA3A 3TO6A 4MEYF 2P7VB 1JHHA 4MTDA 4EM0B 1YLFA 1P4AA 3P9IA 3ECHA 2FQ3A 2HQRA 3Q9SA 4KIFA 5FLXZ 3WTSC 1R1TA 1ZREA 2F5EA 1E17A 3GX4X 2VC1A 1XCVA 2EFPA 1G3YA 5IT9Z 3L2CA 1DUXC 3WE2A 4OOIA 1HW5A 4L9VA 1XCBA 5IT3A 2IA2A 1DDNA 2A07F 1RI7A 4UVCA 4GCVA 4Q4ZF 2DO7A 2ZXJA 3F6VA 2ISYA 1W5TA 1WQ2A 3U9GA 4N9HA 3H3ZA 2D1VA 1IN7A 4IRHA 4RB0A 2Z5UA 1SD4A 2VC0A 1BI1A 1X3UA 4N9IA 4TV7A 2NNYA 4IRGA 2FBKA 3HRSA 3HOTA 5H6QA 1GVJA 2A61A 4AVPA 4WXCA 5H20A 2ZKZA 1BC7C 5LLQA 3IKTA 2O0YA 2EFWA 2L54A 5LGNA 2GZWA 3WTUC 2CFXA 2YPRA 3KLNA 2GIVA 3HSEA 5E1WA 1Z6TA 2L01A 1BOAA 4JQFA 2IP2A 2XROA 5ILSA 2M30A 1XSDA 3I58A 3QU6A 1TW2A 2Q0OA 2K4BA 1LJ9A 2HFHA 2ELHA 1OR7A 2GXGA 1D3YA 5DUIA 1OKRA 2IT0A 3N97A 5F1RA 4O6JA 1YW7A 5F64A 2V1XA 4UVBA 4Y17A 4P9FA 2V9VA 2UXNA 3ERED 1USSA 4I0AA 5DD8A 4IRIA 3FZVA 3K9TA 2D2WA 4ENJA 2FF4A 2FRHA 5E1XA 2PQ8A 4ESFA 5L3BA 2CW0F 5DEQA 4PGGA 5D4SA 3TGNA 1XD7A 4YFKF 4FX0A 1BJAA 4XLPF 2D45A 1W5SA 4G6DA 1ULYA 4L18B 1MJAA 3HHGA 3E97A 4G6QA 1HXDA 3GF2A 5FD6A 4ZH4F 1O7FA 4Q47A 4HX7A 1IW7F 5BPDA 3RDIA 1FBSA 2WC2A 4YFXF 1MZBA 4D0PA 2OQRA 3EETA 1J5YA 4KA4A 5K5OA 1KU3A 4ZYEA 3O2PE 1K7AA 1LVAA 4RB3C 4KNYA 1TQMA 4ON0A 2BEOA 3R60A 1RUNA 5ED4A 4M9ZA 1R1VA 3PQKA 4UV9A 2MH2A 3MWMA 4HV5A 4MQVA 4G9YA 2VN2A 2K7LA 4EM2A 3ECOA 1FYMA 2EA4A 1Z7UA 2M1BA 5HS7A 1TNTA 3T8RA 3FMQA 3Q5FA 1RUOA 4L0YB 3K2ZA 4I02A 1TTYA 5K1YA 1IN8A 3LAJA 4YG2F 5FLXK 1PP7U 2M87A 4S04A 1C0WA 3K0LA 3T8TA 4IHSA 1AWCA 2QYOA 1H9GA 4FX4A 1XSXA 4HF2A 1SAXA 3GO5A 2UWMA 1HSTA 2YR2A 3V7CA 5IT9K 1BI0A 5HDKA 1J75A 2DPDA 3C1DA 5K5RA 2NRAC 2P6TA 3JW4A 3HSRA 4EJOA 2BE5F 3ZMZA 1S7OA 1DP7P 1Q1HA 3WTTC 1G3SA 5ILUA 4Q5SF 1TQIA 2VBXA 2HGCA 3D5LA 3F8CA 3TDZC 4ZZDA 2ZJ2A 3DF8A 4CHUA 2GAUA 4I98B 2ZMEA 2G9WA 3RI4A 2ACJA 2K02A 1O3RA 1RIOH 3L7WA 3TKYA 5D5UB 2W57A 3SHFA 2JPCA 2VODA 3KCCA 3V8LA 4IJAA 2FBIA 3DV8A 2HS5A 3FHZA 1B59A 4CDGA 3JSPA 4ENNA 1D8JA 1IN4A 5AIPA 1TW3A 4Q48A 2F5CA 1JHFA 3SZPA 5TRDA 3FM5A 5HLIA 4XBFA 4QWQA 1F1ZA 3I0TA 3FF5A 4RGXA 3MZHA 2F5DA 1XMKA 3QPHA 1GXPA 1Z1DA 1FBUA 2XRNA 1BIAA 3CUQB 2RNJA 1B9MA 1MGTA 4CGZA 1YO5C 2NS0A 2DQLA 2A3SA 3J80Z 3IL2A 4UUVA 2EA2A 4M74A 4I2OA 4MTEA 1U6GA 4EJTA 4GXOA 1K79A 5DCMA 4WX9A 3DQVC 2VT3A 5ICFA 3KE2A 6PAXA 4RGUA 2XAGA 2ZMEB 5HVQC 2HTJA 2STTA 4U0VA 5D5XB 1NHAA 4U0WA 4U0YA 4G8XA 1B6AA 4HAMA 2L4MA 1IRFA 1H9TA 4LK0F 3R6SA 1LEAA 3CDHA 1REPC 2RDPA 1I1SA 2JPBA 3RKWA 1G3TA 2HWVA 3SFZA 3F23A 3K1NA 4M9SA 2X4HA 4HA8A 5E8GA 2WWYA 4DQ2A 2P4WA 5LGTA 1J0RA 2IRFG 3EUHA 1YS7A 4OMZA 2ESNA 2EJRA 2OBPA 3ZMDA 3E6BA 1IAWA 1U3EM 5DCMB 1Z05A 3VB2A 4KIBA 1EH6A 1T98A 3KP3A 1D8KA 4GO1A 4EQQA 3IKVA 2PJPA 1JXSA 1UB9A 5CVUA 1R5GA 1EV7A 1ON2A 4HYEA 2ISZA 3RJPA 2B0LA 4A5NA 4PDKA 4R8HA 3ZPLA 3C7JA 4ZYHA 2RV8A 1IN5A 2R7DA 4PZJA 2CGPA 4EVIA 2FU4A 2PMHA 4WCGA 2HYFA 3W6KB 4CXFA 2K4JA 1SMTA 3M7GA 3IC7A 1UFMA 1FP1D 1ZG3A 2HZTA 1FLIA 1QBJA 3MEXA 1JE8A 2XV4S 2A6EF 3HOSA 2RKHA 1K6OA 4E70A 5L3GA 5ICGA 2QQBA 1XGOA 2A5YB 4ETSA 3DPTA 3COAC 2MLKA 3LQQA 2EFOA 4HBLA 2FOKA 1U78A 1P92A 1I5ZA 3HRMA 1T6SA 3J81K 2P7CB 2AS5F 3WE3A 2YU3A 1SD5A 1W7PA 3GFLA 2XGXA 5E8IA 5ICCA 4AWXB 3R4KA 2P5VA 4IVNA 2LDUA 2W84A 3VOEA 3I71A 1QPMA 4OIQF 2O61A 2FMYA 2M5WA 4HQMA 3ISPA 4LLGF 4IF4A 4BH9A 2EFQA 2BYVE 3GW2A 3KP5A 3FXUA 3J80K 2DAOA 1K78A 4KN4X 3PQJA 1UHMA 1LQ1A 4HDUA 4KYWA 4F7ZA 3H3UA 5JFRA 2QENA 1ZH5A 2G7HA 2EWNA 5LRRA 1OYYA 2P6SA 3W6JB 1BC8C 4XLNF 1O3TA 4GYIA 1T0FA 2FE3A 3I4PA 3T1BA 1ZYRF 1RNLA 4A12A 3HRTA 1XN7A 4MGRA 1OMIA 3BZ6A 1W7PB 1P2FA 2LNBA 5BQTA 2OZ6A 3S2WA 2KIFA 2M8EA 4EMSA 3WTXC 2RQPA 5D6FA 2PFBA 2VOPA 2XIGA 3NEUA 2CYYA 5E18F 2Q2EA 3GFJA 2VBWA 4KN7X 4WXHA 3D0SA 1OYIA 2Y0MA 1JGSA 2OAZA 1K78B 5E20A 4IHTA 3SXYA 3ZP5A 1CGPA 2P5LC 3BDDA 3OV8A 3GFIA 2IA0A 2LSOA 1ZAOA 4XRFA 3KP6A 2BGCA 2CO5A 2X0LA 4LLLA 1MD0A 3F6OA 5BPIA 2HTSA 1XGNA 5K5QA 1AOYA 3C18A 2OA4A 4HX8A 3ROUA 3R0AA 1FNNA 1OPCA 2TDXA 2KIUA 4Y13A 1YW9A 4UNOA 1EH7A 2K27A 3FWEA 2HDCA 2ZFWA 5HDGA 2PI0A 3K1MA 5JI6A 3HYIA 1BI3A 1KA8A 4P9UA 3GFMA 3ULQB 2IVMA 3ZQ7A 5HLHA 2RN7A 2DK8A 3DKWA 1SD6A 3KP7A 3K1PA 4ENKA 2OD5A 3E6DA 4PGHA 1FY7A 3F72A 2JSCA 1HBXG 1S8NA 1STZA 1YFHA 1J7KA 2PG4A 3I53A 3MAJA 3TO9A 3U1DA 3MQ0A 2KJBA 1HKTA 2DT5A 4WWCA 3SZTA 4A0YA 2XKOA 1XGMA 1WRJA 2YSRA 4ENMA 4RB1A 2ZCWA 4EGYA 2HOEA 1FC3A 2UZKA 1A04A 1ODDA 4G94A 2R3SA 1ON1A 1S7AA 4BHPA 3QP6A 3ZMUA 4EJVA 3IRRA 3ELKA 5J8CA 4RAZA 5BMZA 4MEXF 3V4GA 1H0MA 2K86A 1J9IA 3EDPA 3NRVA 5BOXA 3B02A 4IPAA 3FX3A 1I1GA 1FSHA 4O3MA 1YQAA 3WTYC 1YG2A 3REOA 1G3WA 5J8FA 4LG0A 3KETA 3EYYA 3CUQA 3KFWX 2EB7A 1HQCA 3RPQA 2UXXA 4BHCA 1XMAA 3BPXA 3FMSA 3R61A 5F6FA 4M72A 1ZLKA 2LF8A 4EGZA 4WF2A 2PMUA 3HRUA 3TQNA 1YW8A 3TDUC 4KDPA 1KYWA 5HLGA 1VTNC 3LA2A 4H0EA 4ASNA 4OIRF 1XB4A 1SFUA 3BOQA 3E5QA 3GXOA 3IRQA 3J81Z 2QQ9A 3ZMVA 3WU1B 3WGIA 4DNCA 3G73A 2DTRA 3PFIA 1R5HA 1MDMA 2ESHA 4LG0B 1DPUA 1IXSB 4LD5A 3VODA 4OIPF 5L3EA 1MJBA 5EEGA 1XGSA 3V8KA 4L5IA 1O7LA 3ABUA 3RKXA 3K69A 3F8FA 1FWZA 4K2EA 4CYDA 3LA3A 3BP8A 1S3JA 2YX7A 2W85A 3F3XA 2F2EA 2H94A 3I5UA 1BBYA 5AIQA 4LB6B 1G4DA 3WU0A 4MQ9F 2XUBA 3QU3A 3E5XA 5FFXA 2DFIA 2WV0A 1MJ9A 4HW0A 3CLOA 1P4XA 1B1BA 1R58A 4OMYA 3RTRA 2Z33A 4BHBA 4FHTA 4I7HA 4I09A 5CJ9A 3LA7A 3TOAA 2LKPA 1MDMB 2W24A 4HF1A 1R00A 2FEZA 2FNAA 4U7DA 1PUEE 3M1EA 2L02A 3MFKA 2H09A 3LAPA 2E7XA 3HIFA 1F4KA 3WG9A 4EJWA 4MHGA 4RS8A 4YIIA 1EH8A 4IXAA 2OU2A 1LDDA 2CSOA 5CLSA 4BNCA 5CVIA 1WSUA 4LMYA 2E1CA 4HDVA 4O5VA 2FSWA 2QM3A 3HUGA 4LJZF 1ZARA 4HZFA 2M45A 1L0OC 1OYWA 5LBQA 2MBFA 5FGMA 2VBYA 3AAFA 2DLLA 4I01A 2HKOA 4JK1X 5HS9A 5D6EA 2ZBKA 4QLCU 4RAYA 4AIHA 1Z6RA 4NQWA 2DW4A 1BN5A 3CO6C 1B9NA 1CF7A 4R79A 4NHJA 2NYXA 2RVCA 3RKYA 2YX4A 2PLYA 3LSTA 2XKPA 1QNTA 4LGWA 1J2XA 1R7JA 2E1NA 5LHIA 2FA5A 1I6XA 2HKXA 5DD4A 4EV0A 5TJJA 2KJCA 2WTEA 4N0BA 2DPUA 2FMLA 1UCRA 2DQRA 4U88A 2DK5A 2IA1A 1DPRA 2NNNA 1R1UA 2H6CA 2XAHA 1GXQA 2EV6A 1PP8F 2KKOA 5D4RA 2JZYA 3DP7A 4ZYDA 2H27A 4M71A 2DBBA 4U7BA 2O8XA 4A0ZA 3I64A 4RB2C 1FYLA 1FX7A 4ESBA 4HV6A 5BS6A 2VE8A 4KIGA 5KVRA 2QWWA 4HOBA 5DV5A 3WTWC 1W7PD 2V79A 3KLOA 4KICA 2HQNA 4GGGA 1LDKB 5LHHA 1QO0D 5DYMA 4OU0A 1CF7B 1UHWA 5KK1A 2EV5A 4BXUA 1ZHFA
chains in the Genus database with same CATH superfamily
1E2XA 2ME0A 3P7NA 1HSJA 3OS0A 5FLMJ 5E3MA 1K4TA 1U5TA 1T08B 4MFEA 4HLXA 1VQPI 4XM3A 2QQAA 1IRGA 5J4VA 1SD7A 5LHGA 3ZMSA 3HPGA 2JUCA 5J6XA 3P9KA 2CUJA 2AQFA 4A3GJ 1W5CC 3SDBA 4PJ0C 3GBGA 2K40A 3QRFF 1G59A 3FIWA 2XAFA 1P6RA 1ORKA 2KISA 2GLOA 1AU7A 3EQLF 2MC3A 1TT5B 2NVYJ 4XKVA 1I3AA 3FKJA 4DZPA 3BZCA 1V4RA 1KU9A 1YX3A 3BG9A 3BY6A 3FXQA 4C2TA 2W48A 2F4OB 5D5WB 2RGVA 1DGRM 1XDSA 1LDJA 2CG4A 3L00A 2VUMJ 3F21A 1Z9CA 2KRCA 1FYKA 1XSVA 1TNSA 5D5VB 3BPVA 5HDNA 2R92J 1HW1A 2R7OA 4D7NA 5JVTA 3LFKA 1QVTA 3V7SA 2L3DA 3CDIA 4M6XA 2E7WA 5TISC 1Z91A 3RZOJ 3JR9A 3MD2A 3FM3A 2XAQA 1T38A 1CQTA 1BI2A 2DA1A 2M34A 3C2HA 4DBQA 4IHWA 3HOZJ 3IUOA 1KGSA 3GVAA 1MKMA 2X6WA 5CVRA 5L3CA 1MBHA 4LLNA 3T5XA 1WWXA 4OINF 4NUBA 2IGOA 1FT9A 4ZDLA 3ASNH 4B1RA 4YIFA 2Z3YA 1VQLI 2I10A 1Y1VJ 4AC0A 2BXYA 3RSNA 3GYHX 1O3QA 1R4NB 5EZHA 4JBAA 2HQAA 1G8XA 4JX4A 1SFEA 4F3QA 3I59A 4CYCA 2C6YA 2R5ZA 3OYEA 1WFXA 1U5TB 3JSOA 1J09A 2DTZA 1H88C 4JX5A 3FXRA 2ZJRF 1ZR4A 2OF7A 2UUZA 3GTMJ 1BW5A 2OQGA 1MMNA 3GWZA 4CH7A 3HHHA 1YOVB 1HC8A 2ZNYA 4C3JJ 1ZN2A 5CVVA 1QQIA 3EPZA 3HOWJ 3FBIB 4L9JA 1SAUA 3NARA 1KQ9A 1HW2A 4AIDA 1OCCH 1P4WA 2L7KA 4Y7NJ 3DEUA 3L2WA 2Q8KA 2V6CA 5B3SH 2EZLA 5LRSA 3ZN0A 5EG0A 4Z2YA 3G71I 5L3FA 5IP7J 2FBHA 3ZQCA 5D8LB 2G7UA 3Q9VA 3CUQC 4XORA 1ONVA 3B73A 5LGUA 1HF0A 1K61A 2HEOA 5CVJA 4G7ZF 4PJJA 4WXDA 1F36A 2OPTA 2A69F 2WBMA 3S3MA 2R7XA 2VE9A 1DP3A 4EM1A 1OISA 1SVLA 3M8EA 3TBIA 4ANJA 3L09A 2ZO4A 3F8NA 2DI3A 3LNQA 4BKXA 4BXFA 1R22A 3DU5A 1ZK8A 2ZSHB 3CP2A 1WGXA 5E1ZB 1W4MA 2Y31A 4XOTA 1BW6A 2HR3A 4UUSA 4BE2A 1NH3A 1X3ZB 3A03A 5DM6F 1HA8A 1SMYF 1OCZH 2BV6A 5LEJA 2GM4A 3BQZA 1MIJA 2ZMEC 1ZRCA 1WH7A 2D5VA 1FZPB 3U2RA 2CWEA 4XRSG 2J5OA 5M3FJ 3K4KA 1QZZA 2W25A 3TL4X 3I59B 4CYCB 2XPVA 4XKWA 2R5ZB 3NWTA 4XRSA 3HM5A 3C3WA 2EIJH 3H92A 3ML6A 3J7YJ 4CZZA 2LF7A 4HNVA 3CD6I 4Y4RA 2HZDA 1WKMA 1BM9A 2GA1A 3BTCA 5A2QK 1WJBA 3OOPA 3QPSA 2GWRA 1S6LA 1RKTA 2XF6A 3G2BA 1R23A 5FFZA 4A6EA 5K7HA 4LK1F 1YJWI 1HCRA 1S5LC 2V7FA 2O3FA 1S7EA 2X48A 1B8IA 3VEPA 2L9VA 3OYNA 3F8MA 2VLAA 3L2UA 1VZ0A 3M9AA 5EG0B 2HVRA 2VXZA 3QP5A 4CO8A 2K9LA 2P5KA 3BR2A 3I9V2 1MNMC 4GFBA 2G0EA 2K9QA 3OYAA 5JHUA 5DM7F 2EBIA 4V19K 2VT2A 3OYLA 3EYIA 4L9TA 4OIOF 1KQ0A 2HYGD 3P9CA 4R1HA 5FO5A 2H8RA 1IUYA 1LEBA 1KYZA 5M5YJ 5M3MJ 1QZYA 2WV1A 5LEKA 5EGOA 3RPUA 2GA2A 2KLOA 3I54A 2VB6A 1VQ7I 4XQFA 3BJAA 9ANTA 2R7ZJ 4KISA 3O3KA 2DFEA 2I5UA 3CJRB 5HODA 3EUKL 2R7QA 1IF1A 4UUSB 1WHUA 3BWGA 3MCZA 2DMQA 4XLCA 5FKLA 1ZLJA 4LB5A 1VI0A 5IOZA 3IWFA 3CCQI 2V1DA 4XONA 5E17F 1ZGJA 1T33A 3TEDA 2HOAA 1FIAA 3PL8A 4M6YA 3N4MA 4C3IJ 1ITYA 2CUEA 2O7OA 3TW6A 3S2DJ 4L0ZB 2HU9A 3JRBA 3K4JA 2MD5A 1F43A 2R7FA 5J1UA 5DDGA 2Z2SB 5E3NA 2JVGA 2V1UA 2O03A 3DTKA 3AL0B 4P55A 1IXRC 2BHZA 1A6QA 1YYVA 3A0BC 1YTYA 1GHCA 3SQNA 3E1SA 2CU7A 4ITVA 4YFNF 3TW7A 1J59A 3E3VA 4BE0A 3NQOA 1XPXA 2LP0A 5JR3A 2LY1A 3VPRA 4QIWN 1F9NA 2CV1A 3DXJF 1YIJI 1PDNC 1YS6A 2XASA 2Y75A 5FKMA 1DU6A 3BR6A 3GCMA 1XDUA 1B8IB 2JT1A 3BC8A 3BT9A 1ZGAA 2EFNA 3E6CC 1XTAA 5J47A 1Y8QB 1EJ9A 4A3DJ 4D1QA 4IQJA 3HTSB 2DT7B 3JRCA 3HXLA 2XVCA 3LSJA 3BG7A 3IAS2 2PN6A 4KFCA 2RREA 3KEQA 4FQGA 5IY5H 4YELA 2IS1A 4A2UA 3M8FA 3SFIA 1D0XA 3V8JA 4DOZA 2WAFA 1FTZA 2L7ZA 5IYCJ 3ZN1A 3CMAI 1SANA 4UHTA 5EGOB 4UVAA 1TWCJ 2R5YB 4Y33A 3W2WA 2OV7A 1V54H 5D8KB 2QBYA 4I99C 1Z67A 3KPHA 3CCEI 3BG6A 3M1CA 4I0BA 3HL2A 1V3FA 3F22A 1GV5A 2L2OA 3G3ZA 3L9FA 4L9NA 3CLQA 2DJIA 3DPLC 4QPQA 1KU7A 3SYTA 3DEWA 2XGDA 3O6BB 3QYEA 3JAMZ 1UELB 2L4AA 2VL8A 2VPRA 2BBYA 3TOBA 5FD5A 4M3GA 4BQAA 1FOKA 4BQOA 3DKXA 1T39A 2MH9A 2XGEA 4BAYA 3BROA 3FMRA 2JMWA 3QOEA 3CCVI 3HSFA 2KDZA 3V7RA 1UAAA 4HQEA 4HF0A 3JTGA 2P8TA 2H1KA 3QPLA 1IZ1A 3GLXA 4B8XA 3WTVC 1SFKA 4AD9A 1VF9A 4F55A 4DYRA 2QZ8A 4XRMA 5DCFA 5E3OA 1LNWA 1YIOA 2STWA 1QRYA 3O8HA 3L2QA 3CJNA 1G6NA 2Z99A 3CTAA 2OTJI 2IS6A 3DPUA 2ETHA 3GUDA 5CYVA 2L5QA 3TP3A 2CS3A 3GZ6A 4X6AJ 3H9JA 2M7AA 4P5OA 4A3BJ 1E3HA 1XC5A 5EEHA 1X3WB 4ZZLA 5FB2A 3OYHA 1F5TA 5B66C 2HOTA 3F8BA 4KUMA 4LFUA 4RGSA 3OYCA 3RKQA 2D1HA 5EEAA 3D5SC 3DU6A 3KZYA 5IYDJ 3CO7C 3KP4A 4A5MA 2WAEA 4I76A 5EZGA 2NVUB 2OZUA 2DOAA 3IHUA 2F5FA 1QZEA 2KZVA 4WK8F 4GYGA 3ZQQA 2XSJC 4IO9F 2QBYB 4CICA 1HKQA 2KRHA 2W1OA 1ZRDA 3T0YA 3KYCB 2EIMH 4E7SA 2MYSA 3WGHA 4YIRX 1Y0UA 4ZTJA 3D1NI 1RZ4A 3FXJA 1B4AA 4XOPA 3LQRA 3ZMTA 4A0XA 1WJDA 3WTZA 1K6YA 1R5ID 1XMXA 1HKSA 1W36C 4XSXF 3E5UA 3I56I 2N8GA 3CCJI 4KMFA 1O57A 4AM3A 1FPQA 4PFPA 2QUFA 3J7AO 3ZR8X 1TQPA 2A6HF 4M73A 2VOOA 2VQCA 3Q0UA 4MNUA 4J00A 1BIBA 4G7OF 1T2KA 1LB2A 2EK5A 2ID6A 2LKXA 3QPTA 1KONA 1ZG5A 2FNPA 2JRTA 4LG3A 3RIRA 2QVOA 1L3LA 2VONA 4XL9A 2ECCA 2BW3A 5J4YA 2VASA 2CQ7A 1TBXA 4BYYA 2PEXA 4L5EA 2Y48A 2QQ8A 4XKBA 3RYPA 1FP2A 1UMQA 2GOMA 2GQQA 2E1MB 5HOOA 4AIKA 2DU9A 3BR3A 3L2VA 1Y1WJ 1IXCA 2CMPA 5DUKA 3DEEA 3KEOA 1U5TC 4UV8A 5ERIA 2EILH 2IPQX 1TL8A 3TO7A 3B6AA 1IDZA 3PNYA 2VQGA 4KT5C 2KHMA 1O3SA 1IO2A 4DBRA 3HTUA 3RYRA 2IJLA 2AQEA 2E19A 2F5VA 4IHYA 2EIKH 3HJEA 3F0CA 4ZYGA 4XSZF 4S05A 2MABA 5M5WJ 3W2VA 4NNJA 3S1NJ 1D5VA 3CJQB 2AXLA 4BS9A 1S29A 2XHKA 4FETA 1KQ8A 5L3DA 1U2WA 1T0FC 3CP8A 2OJED 1B72A 5TGTA 4RGRA 5GPCA 4KMUX 5HS8A 1QGPA 3KX2A 3IWZA 4GRIA 1I27A 4BQQA 1W1WE 1W0TA 2IBDA 5K7ZA 3X2QH 3OYMA 1ZG1A 3VYUB 1PUFA 1ZQ3P 1U9NA 2VBZA 2H6BA 5CPRB 4NB5A 1X2NA 3HKZN 1KU2A 3K4NA 4A6DA 1R36A 3KP2A 3OS1A 1IGNA 2O6GE 5CKTA 2EV0A 5H6RA 3E6MA 5JLXA 4XMYA 3S2HJ 4Y15A 3KZZA 1IN6A 4ZYAA 2COMA 5EYRA 2GXBA 4M9XA 1OFCX 2DCEA 2J5PA 1ZTRA 1FSEA 3K70C 5AONA 4P96A 4PJNA 2Z9OA 1WI9A 2VQHA 3DWLE 5F0CA 2BY0A 1MW7A 2CQKA 3LSGA 3S14J 2KRFA 2BW3B 2NAZA 1TLHB 3ABTA 3A02A 4HX4A 4BJ6C 2XAJA 4UUTA 4F92B 2IW5A 4XNFA 3QOPA 4Y3OA 4E7LA 3QAHA 1U8BA 3LWFA 5A2QZ 1SFXA 2PBIA 4PUSA 4UXNA 2QLZA 1FBQA 3VYTB 4ESJA 4B48A 2RC4A 1YHQI 3PUFA 1GLNA 2JJ7A 3WODF 4G7HF 1VQ8I 4XK4A 4L5JA 3K6GA 1IG7A 4N4NB 3JTHA 2MLGA 3GZ5A 1USTA 4B09A 2X85A 1K4SA 2MD0A 2JTVA 1D1BA 1XX5A 5ILVA 3JAMK 4FT8A 4A3JJ 2FXAA 2DXIA 3FXKA 1W36D 2KIMA 4AIJA 2XF5A 5E79C 2JA7J 4A3CJ 1B72B 2R0QC 3K2AA 3BJ6A 3H9GA 3B6CA 2X6OA 3SZGA 2A68F 4EJUA 1P7JA 4EATA 2HXIA 3UNGC 3WGGA 1U8RA 2ZNZA 3R0JA 2AHQA 2E2IJ 3I4MJ 1D5YA 5ICEA 2BY3A 2L9RA 4IL6C 1PUFB 2V1NA 1ZRFA 3DFGA 3GEZA 3MVPA 2BY1A 3BJOA 4PCQA 4BJTA 3CUOA 4HLYA 2F4MB 4D9JA 2ADUA 1FTTA 3BG3A 4DIQA 3OYJA 3JCUC 3MZYA 1VQ5I 3VFZA 2MA3A 3LSRA 3TO6A 4MEYF 2P7VB 1JHHA 4DGWB 4MTDA 4EM0B 1YLFA 1P4AA 1NG6A 1JJ6C 4W97A 1BOBA 3P9IA 5JVGF 2KDOA 2OCCH 1RR8C 4HSTA 2K3FA 3ECHA 2FQ3A 1U9OA 2HQRA 3Q9SA 2LTPA 5HNFA 2CJJA 2K9NA 1VQ9I 4KIFA 5FLXZ 2GOXB 3WTSC 1QU3A 3AKZA 1HDDC 2WY7Q 1R1TA 1ZREA 2F5EA 4IQ4A 3AL0C 3S16J 1E17A 4M3FA 3GX4X 1JKQC 2VC1A 1XCVA 4ZTFA 2EFPA 1G3YA 5IT9Z 1UG2A 4CCLA 3L2CA 1AA7A 1DUXC 3WE2A 4OOIA 3DBHB 1HW5A 2M0MA 1A36A 1Y56A 4L9VA 1XCBA 4BE1A 3FK6A 5IT3A 1BR2A 3BR5A 2IA2A 1DDNA 2LY2A 2A07F 1TWAJ 1S9HA 1RI7A 2W82A 4UVCA 4GCVA 4Q4ZF 3H5AA 1BJZA 2DO7A 2ZXJA 5GPAA 5J3LA 3A01A 3WU2C 3HDDA 3PSFA 3F6VA 4J01A 2ISYA 3ABMH 1W5TA 1WQ2A 4XIDA 3U9GA 1MH4A 4N9HA 3HGGA 3H3ZA 1MH3A 2IGMA 2D1VA 3K70D 3PO3J 1MBFA 1IN7A 1POGA 4IRHA 4RB0A 2ZJQF 2CUFA 2Z5UA 1SD4A 2VC0A 3FXOA 2HPMA 1BI1A 4BBRJ 3GTKJ 5DTDA 1X3UA 4N9IA 4TV7A 2NNYA 4FTHA 4KT6A 4IRGA 4Y52J 2FBKA 3HRSA 1T95A 4QTRA 1R9TJ 2DMTA 3HOTA 2CV0A 2E2HJ 5H6QA 1GVJA 2A61A 3PM1A 4AVPA 4WXCA 3IH4A 3CJTB 5H20A 2ZKZA 1BC7C 5LLQA 1HDPA 3IKTA 2O0YA 2M7BA 3FISA 2EFWA 2L54A 5LGNA 2GZWA 3WTUC 2CFXA 2YPRA 3KLNA 1NTCA 2GIVA 4U87A 2HPIA 1RKWA 3HSEA 5E1WA 4ZDPA 2V6EA 1Z6TA 2L01A 1BOAA 4JQFA 2IP2A 2XROA 1RPWA 3RCOA 5ILSA 1D1CA 2M30A 1XSDA 3I58A 3QU6A 1TW2A 2Q0OA 2K4BA 3OR2C 5JLWA 1LJ9A 1ACIA 2HFHA 2ELHA 1OR7A 1FOYA 1ETXA 2GXGA 1D3YA 5DUIA 1OKRA 2IT0A 2NXNB 3N97A 5F1RA 4O6JA 1YW7A 3PNVA 2DMUA 2QGUA 5F64A 2V1XA 4UVBA 4Y17A 4P9FA 2V9VA 4NC8A 4BEHA 2UXNA 1EF4A 3ERED 1USSA 4I0AA 5DD8A 4FCYA 4IRIA 2CW7A 3FZVA 3K9TA 2D2WA 2V4JC 4ENJA 2FF4A 4P1WA 4A93J 1JI8A 2FRHA 1TWHJ 2PQ8A 4FE7A 5E1XA 4C2MJ 4EEFG 4ESFA 5L3BA 3A01B 2L7FP 2CW0F 3ABKH 4PGGA 5DEQA 5D4SA 2XAUA 4BGDA 2ZXIA 3TGNA 4JOMA 1XD7A 4YFKF 4FX0A 2ZJPF 2BZTA 1BJAA 1YX5A 3ZCOA 1SEUA 1R71A 4XLPF 1Z77A 2D45A 1W5SA 4G6DA 1ULYA 4L18B 1MJAA 2Q2EB 3HHGA 3E97A 4KITB 1ETKA 5GADJ 4G6QA 1HXDA 4A3KJ 3GF2A 4MIMA 5FD6A 4ZH4F 3JRDA 2BXZA 2L7MP 1O7FA 4Q47A 2ZFUA 4HX7A 1Z0XA 1IW7F 4M6VA 3SJMA 4IHXA 5BPDA 4X0GA 3RDIA 1FBSA 3H1CA 2WC2A 5IPAA 3HEFA 3IH3A 4YFXF 1MZBA 2K9MA 4D0PA 2OQRA 2M3AA 3EETA 1J5YA 1UZCA 3MN2A 4YEJA 4KA4A 4PSXA 5K5OA 1KU3A 4ZYEA 3DTEA 5B1AH 2FD5A 4RM2A 3O2PE 1K7AA 4E7HA 1LVAA 4DW6A 4RB3C 4KNYA 1TQMA 4ON0A 1OCTC 2BEOA 3R60A 1RUNA 4OWRB 2ZB9A 5ED4A 1Y39A 4M9ZA 4V2FA 3M3YJ 1R1VA 1QA6A 3PQKA 3IH2A 4UV9A 5C44J 2E1OA 2MH2A 3BCAA 3RQIA 4UY8I 3MWMA 4HV5A 2B63J 4B44A 4MQVA 4BEHB 5EJCA 3G1LA 4G9YA 2VN2A 2K7LA 1H8AC 2R93J 1DGWY 5C3EJ 4D5FA 2R5YA 4EM2A 3ECOA 1FYMA 2EA4A 3QQAA 2VKVA 1Z7UA 2M1BA 5HS7A 3GLLA 3OS2A 1TNTA 3MKYB 1EA3A 3GTJJ 2RQQA 1RRJA 3T8RA 3BTLA 3NAUA 1ETYA 2E1MC 2VIXA 1SVMA 2HXOA 3QYFA 1H89C 3A0HC 3FMQA 3Q5FA 1FJLA 1RUOA 4L0YB 2COBA 2KL4A 3K2ZA 1VFCA 2V26A 2HI3A 2NS7A 4I02A 2LC2A 1X1CA 1TTYA 3HG9A 3Q3SA 3CCLI 3S1RJ 5K1YA 1IN8A 5F0HA 2KQRA 4E6KG 3LAJA 4HRIA 4YG2F 5FLXK 3FKIJ 1YRNA 1PP7U 3PO2J 2M87A 4E7KA 4II3A 4S04A 3W3CA 1C0WA 1JT0A 4RLQA 3K0LA 1VQ4I 2CQQA 3T8TA 4IHSA 2L9NA 4LIUA 4XKCA 1AWCA 1U0JA 1H9GA 2QYOA 1XSXA 2FJ1A 4FX4A 2M8GX 4HF2A 1SAXA 3GO5A 2UWMA 1HSTA 2YR2A 3V7CA 1JTYA 3BQYA 3HOVJ 3JRGA 3H36A 3HBLA 3GTLJ 1ETVA 5IT9K 1BI0A 3VSKA 1JGGA 5HDKA 1J75A 2E71A 3AG3H 1AHDP 2DPDA 3C1DA 5K5RA 2OC6A 2NRAC 2EINH 2P6TA 3JW4A 3S17J 2AO9A 2ICWG 3HSRA 1OCOH 3G4SI 4EJOA 2BE5F 3ZMZA 1IC8A 3OR1C 1S7OA 3I3LA 1XS9A 1DP7P 3AG4H 2GIZA 1Q1HA 3WTTC 1X58A 2Y30A 3K4MA 1G3SA 5ILUA 4Q5SF 4UB6C 3ABLH 1TQIA 4DYCA 2VBXA 1ZELA 2HGCA 3BG5A 3D5LA 3F8CA 3TDZC 2ZXWH 4IOCF 1APLC 4ZZDA 3CF2A 2ZJ2A 3DF8A 4M3EA 2GAUA 4H4KC 4I98B 4CHUA 4BL0B 2ZMEA 3CMYA 2G9WA 4XLEA 2BY2A 1R6RA 2FUG2 1X1AA 3RI4A 4OAYA 4B3AA 2ACJA 1SFOJ 2K02A 1O3RA 1RIOH 3L7WA 3TKYA 5D5UB 2W57A 3SHFA 2W7NA 2JPCA 2VODA 3KCCA 3F9KA 2CH0A 2HVQA 3DBLB 3V8LA 4IJAA 5B5EC 1K83J 2FBIA 3DV8A 5FJ8J 2HS5A 1ZKGA 3FHZA 4D5CA 1B59A 5LD2C 4BJ5C 4CA0A 3HOYJ 2XF7A 4CDGA 3JSPA 4ENNA 4BACA 1D8JA 1R49A 1IN4A 5AIPA 1TW3A 4Q48A 2F5CA 1JHFA 3SZPA 2DT6A 4FISA 5TRDA 2YS9A 3FM5A 3HB9A 5HLIA 1MNEA 4XBFA 3FBNB 1YRNB 2JN6A 4QWQA 1F1ZA 3I55I 3I0TA 2LH9A 5EF6A 4ZDOA 1RC9A 3FF5A 2R7TA 4RGXA 3MZHA 2F5DA 1XMKA 4NDLA 5J1YA 3QPHA 1GXPA 3HPHA 1Z1DA 1N78A 1FBUA 2XRNA 3DBRB 1BIAA 3CUQB 4PJLA 5LFAA 1TC3C 2RNJA 1B9MA 1MGTA 2JSPA 4CGZA 1YO5C 4LOCA 2NS0A 2DYSH 2VJIA 3BZKA 2DA4A 2LOOA 2LREA 1DQUA 2DQLA 3M07A 2A3SA 3J80Z 3IL2A 4UUVA 4FE4A 3N05A 2EA2A 4M74A 4I2OA 4MTEA 4IOAF 1U6GA 2IAIA 4N4OB 4EJTA 4GXOA 3JREA 1K79A 5DCMA 4WX9A 3DQVC 4PFOA 2VT3A 5ICFA 3KE2A 4RAGA 2OTLI 6PAXA 5BNGA 4BY7J 4RGUA 2XAGA 5E3LA 1BA5A 4IKFA 2ZMEB 4G6TB 5HVQC 2E2JJ 2HTJA 2STTA 2F48A 4U0VA 5D5XB 1QVUA 1NHAA 4U0WA 4U0YA 4G8XA 1B6AA 4HAMA 4IHVA 1D1AA 4BUPA 1Y0NA 4AYBN 2L4MA 1IRFA 1H9TA 4LK0F 3R6SA 1LEAA 3OL3A 3CDHA 1REPC 1D0YA 1YI2I 3M4OJ 2RDPA 1OCRH 1I1SA 2BHYA 2JPBA 2DA5A 3RKWA 4NC6A 1PVEA 1O4XA 4F91B 2KP6A 1G3TA 2HWVA 2OCEA 2NVTJ 3EUAA 3SFZA 3F23A 3K1NA 4E7ZA 2M4KA 4RA2A 4HG2A 4M9SA 4CCOA 5FLVA 2X4HA 4HA8A 5E8GA 2ECBA 2QCOA 2WWYA 4DQ2A 2Y2ZA 2P4WA 4OAZA 2H1LA 5LGTA 3HOXJ 1J0RA 3PUBA 2IRFG 5KAIC 1JUMA 3EUHA 4RAFA 1YS7A 2E60A 2QF7A 2CFOA 5HLTA 1X1PA 4OMZA 2ESNA 2EJRA 2OBPA 1V5FA 3ZMDA 3E6BA 1IAWA 2V9PA 3S93A 3Q0WA 1U3EM 5DCMB 1Z05A 3VYRB 3BLYA 2LLKA 1BR1A 2L0KA 3VB2A 2KFDA 4CCMA 4KIBA 1FOWA 1LFUP 1EH6A 2K3PA 3OYKA 3GTQJ 1LFBA 1T98A 4AYBA 5J1RA 2WADA 3KIOA 3KP3A 4E7IA 2RNGA 1D8KA 2LFBA 3O8GA 4GO1A 2LKSA 4EQQA 3IKVA 1X4OA 2LR8A 3BCBA 2PJPA 1JXSA 1UB9A 5IP9J 2NVXJ 4S0HB 1LE8A 5CVUA 2WY8Q 1R5GA 4RM3A 3ZXSA 1EV7A 2E5NA 1ON2A 4HYEA 2ISZA 3HC7A 4GDFA 3RJPA 2B0LA 2XB0X 4A5NA 1VNDA 2Q1ZB 4PDKA 4R8HA 3A1YA 1V5EA 4JP0A 2HDDA 4MFDA 3S3NA 4JYKA 3ZPLA 1TT0A 2CW8A 3CMEI 3C7JA 4ZYHA 4IZZA 2ME6A 3U1KA 2RV8A 1WJCA 1IN5A 2JQ7A 1VQKI 2R7DA 4PZJA 4XICA 1JUSA 2CGPA 1VQNI 3A2KA 1VQ6I 5HNHA 4EVIA 3CCSI 2FU4A 2QKMB 2VI6A 4CCKA 1PJRA 2CV2A 3LSKA 1SC7A 2HOSA 2PMHA 4WCGA 1E0EA 1FMVA 1JUPA 3CCRI 2O5RA 1JTXA 2EZKA 2LRDA 3L1PA 1HLVA 2HYFA 3W6KB 4CXFA 3OYDA 2K4JA 1SMTA 3M7GA 3IC7A 1UFMA 1FP1D 4HEA2 1ZG3A 3J7ZI 2HYJA 2HZTA 1FLIA 3GTOJ 1A35A 2KZGA 2K9SA 1QBJA 3MEXA 1JE8A 3S1QJ 4M3BA 2XV4S 2A6EF 3HOSA 2RKHA 5FROA 2LD5A 1K6OA 2KPMA 2X1CA 4CSWA 4E70A 5L3GA 2MGQA 5ICGA 1LKXA 2QQBA 3UKGA 1XGOA 3K4CA 4XN0A 2W4SA 1T56A 2A5YB 4ETSA 3DPTA 3OOUA 3COAC 2MLKA 5F08A 2DDAA 3LQQA 1ZR2A 2VKEA 2EFOA 4HBLA 4ZJZA 3DKYA 1MBJA 2FOKA 1U78A 1P92A 3LFUA 2DOEA 1I5ZA 4A3FJ 3CC4I 3W6VA 3KZIC 2MC4A 3HRMA 1T8IA 3OL4A 1X4PA 3OMYA 1YJNI 2BOLA 5IYBJ 1T6SA 3J81K 2JRMA 2P7CB 4RDUA 2AS5F 3S3OA 3WE3A 2YU3A 4IEJA 3UR3C 1LE8B 1YITI 1N25A 1SD5A 3HKZA 2B7EA 1W7PA 3DTIA 3GFLA 2XGXA 3K4LA 5E8IA 5ICCA 4AWXB 3R4KA 3NWSA 2P5VA 4J19A 4IVNA 2LDUA 3JRIA 2W84A 3VOEA 1IDYA 1Q1VA 3I71A 3AG1H 1QPMA 4OIQF 2VQLA 2O61A 4CUGA 2FMYA 2M5WA 1NK2P 4HQMA 3ISPA 2YUSA 4LLGF 3C2GA 3HOUJ 4IF4A 5CQEA 2IEKA 5J40A 2EFQA 4BH9A 2BYVE 3GW2A 4QSHA 3KP5A 1A5JA 3FXUA 4X1EA 3J80K 2DAOA 1K78A 4KN4X 3WHBA 1TZLA 3PQJA 3FDYA 1UHMA 4G12A 2X6XA 4MLOA 3BR1A 2Y0SN 2GXAA 1LQ1A 2DN0A 1VQMI 4HDUA 2VXDA 3H5NA 4KYWA 4F7ZA 3H3UA 1IV8A 5JFRA 2QENA 1GDTA 1S72I 2CQXA 2P81A 3LMMA 1ZH5A 2G7HA 2EWNA 2VPLA 5LRRA 1OYYA 2P6SA 3TMOA 1AKHA 4NC7A 2DFFA 3S15J 4CCNA 2V9KA 3W6JB 2Y69H 3IP4B 5C4JJ 1BC8C 4XLNF 1O3TA 4GYIA 5FKOA 1T0FA 3SDGA 3S8PA 3IAM2 2FE3A 3I4PA 3T1BA 1ZYRF 2LBFA 2WB1N 1RNLA 1LUJB 5GP9A 2DYRH 3OIOA 4A12A 3HRTA 3HZJA 2M9HA 1XN7A 4MGRA 4XLHA 1OMIA 3FXLA 2QKLB 3BZ6A 1W7PB 1P2FA 2LNBA 3KYLA 2KIQA 5BQTA 1MMSA 2OZ6A 3S2WA 2KIFA 2M8EA 4EMSA 3WTXC 2RQPA 5D6FA 1I3QJ 2PFBA 2VOPA 4QPOA 2XIGA 1WCMJ 3OYGA 3D5RC 3LL7A 3ZQGA 3H3VK 2W00A 1YE9A 3NEUA 2CYYA 3FHNA 3G1MA 1YJ9I 5E18F 2YU9J 2XB5A 2DMNA 1A6IA 2Q2EA 3ONQA 3GFJA 5KHDA 2VBWA 4KN7X 2Y0SA 4WXHA 5IP6A 2P0WA 1Z21A 4ABZA 1VQOI 3D0SA 2QSGX 1LVKA 2JA2A 3G6EI 1OYIA 2Y0MA 4ZC3A 3TP0A 4C2UA 1JGSA 2OAZA 4BDZA 2Y9YA 1K78B 2VJ4A 5E20A 1UHSA 1X1DA 4F93B 2QA4I 4IHTA 3SXYA 3ZP5A 1CGPA 2JVHA 2P5LC 5FKKA 4BBSJ 3BDDA 3OV8A 3GFIA 2IA0A 2DOFA 2EH3A 5F1JA 1RETA 1MMDA 4BU2A 2PX9A 1OJLA 1MMGA 2F6CA 2CRGA 5KAFC 2LSOA 1AKHB 2KMUA 2WB1A 3A4CA 1ZAOA 2Z16A 2VKDA 4XRFA 3KP6A 2BGCA 2CO5A 2X0LA 2QSFX 4LLLA 1MD0A 3F6OA 2RAEA 5BPIA 2HTSA 1XGNA 3BR0A 2LBFB 5K5QA 1TWGJ 3BTIA 1AOYA 1WH5A 3C18A 4A3EJ 4LITA 2OA4A 4HX8A 3OSGA 3ROUA 3MMYB 3R0AA 1FNNA 1OPCA 2TDXA 1IUFA 3U21A 2KIUA 4Y13A 1YW9A 5FRMA 2E35A 2JWTA 4UNOA 2IGNA 4A3IJ 1EH7A 1IJWC 2K27A 3FWEA 3BTJA 3GMEA 3H0DA 2HDCA 3H5RA 5IOYA 1QHGA 1OQYA 2DJNA 2ZFWA 5HDGA 2LY9A 2PI0A 3AG2H 2VKHA 3GZNB 2PMZN 3K1MA 4PSWA 2JA8J 2I8DA 5JI6A 3HYIA 1BI3A 1KA8A 4P9UA 2DA7A 5C4XJ 2MFZA 3GFMA 2IVMA 2ZC2A 3ULQB 3ZQ7A 3CDLA 3CCMI 5HLHA 2RN7A 2XSDC 2DK8A 4JX6A 3DKWA 4E7JA 1SD6A 4AUXA 1E3PA 3KP7A 2A6TA 3K1PA 3DLAA 4ENKA 2CUZA 3DLLF 2OD5A 3E6DA 4PGHA 1DU0A 2H8WA 1FY7A 1OCPA 1WJ5A 3F72A 4II2A 2JSCA 2HVSA 3ZGKA 4I6ZA 1HBXG 3CQZJ 4PJMA 1S8NA 1STZA 2FX0A 1J7KA 1YFHA 5FKNA 3MKLA 2PG4A 2EPFA 3I53A 3LSMA 1JT6A 4BXXJ 3MAJA 3TO9A 4PK4A 3U1DA 1X1BA 3MQ0A 2KJBA 2M2EA 1HKTA 2DT5A 3ZQFA 3CMMA 4WWCA 3SZTA 4A0YA 1G2HA 2XKOA 1XGMA 2R4GA 1MBGA 3K4BA 1WRJA 4UB8C 2YSRA 2JA6J 1V55H 3H35A 3ZQHA 4ENMA 3LSIA 1WJFA 2HQ5A 4RB1A 4AU7A 2ZCWA 4EGYA 2HOEA 3CESA 3LSHA 3PIOF 2NVQJ 1FC3A 2UZKA 1A04A 2E34A 3VDXA 4RBOA 1FMWA 1ODDA 1N75A 4G94A 2GBYA 1ON1A 2R3SA 2DA6A 3MKZA 1S7AA 4BHPA 3QP6A 2PMZA 3ZMUA 4EJVA 3IRRA 2X9DA 3ELKA 5J8CA 3J7AY 1FEXA 4RAZA 5BMZA 2IGKA 2X51A 1WZ2A 2M0CA 1WJEA 4MEXF 2CQNA 2XC7A 3V4GA 3RPUD 2JK3A 1H0MA 1I6HJ 4FASD 2K86A 3ERMA 2A5WA 1J9IA 2TRTA 3PJRA 4RLFA 1R4MB 3EDPA 2L9SA 3NRVA 5BOXA 3B02A 1GVDA 4IPAA 3FX3A 3CF5F 4BDYA 4XR6A 1ETQA 1I1GA 1FSHA 4O3MA 1YQAA 1RESA 1IRZA 1JKRC 3WTYC 1YG2A 3REOA 1ENHA 1G3WA 5J8FA 4LG0A 3KETA 1ZGWA 3EYYA 4B4CA 3QWLA 3CUQA 2LG4A 3KFWX 2EB7A 2QEXI 3ESWB 2EQRA 3FK7A 1HQCA 3RPQA 1Z3XA 3JRHA 2UXXA 4CZCA 4BHCA 1PYVA 1XMAA 1NK3P 3GTPJ 3BPXA 2Y9ZA 3FMSA 1UJ8A 4IX7A 3WHCA 5GAGJ 2JA5J 4A3LJ 2ZSIB 3R61A 2NOGA 5F6FA 3OIPA 2M4GA 4M72A 2WAQN 3OYFA 4B43A 1ZLKA 2LF8A 4EGZA 2HNHA 4WF2A 1IV6A 2PMUA 3HRUA 3LOCA 3TQNA 1YW8A 3I4NJ 3TDUC 4KDPA 1LFPA 3KYDB 1KYWA 1IRXA 2R7VA 2FQ4A 2O9LA 3OYIA 5HLGA 3EUHC 1VTNC 4A3MJ 3LA2A 3E7LA 1MSEC 4H0EA 4AVZA 3AFHA 3VSLA 4ASNA 4YRVA 2X1DA 4OIRF 5EDNA 1XB4A 5DS9A 1SFUA 3BOQA 2XRLA 2MSYA 3E5QA 3GXOA 5F0FA 3QODA 3IRQA 2XGCA 3J81Z 1FOXA 2TCTA 3E0JB 2Z1DA 1LPQA 2QQ9A 3G1OA 3ZMVA 3WU1B 3WGIA 4B3XA 3RQ4A 3FXMA 3PNTA 4KJZA 4DNCA 1QPIA 3G73A 2DTRA 3PFIA 1MBEA 1R5HA 1MDMA 2R7SA 2ESHA 4B47A 1HOMA 4LG0B 1WPKA 4XN3A 1DPUA 5CQGA 1IXSB 4LD5A 3VODA 3W2AA 2HDWA 5H2FC 4OIPF 2DFHA 5L3EA 2F4IA 1MJBA 5EEGA 1XGSA 3V8KA 4L5IA 1O7LA 3ABUA 3RKXA 4RMNA 3K69A 1ETWA 2EZIA 3F8FA 1FWZA 4K2EA 1TWFJ 2K85A 4CYDA 3LA3A 2WAQA 3BP8A 3DCFA 1Z7LA 1S3JA 2IS2A 2YX7A 2W85A 3F3XA 2LVSA 2F2EA 2FOWA 2H94A 2XDVA 3I5UA 5F04A 1JKPC 1BBYA 5AIQA 4LB6B 2O8KA 1ETOA 1GV2A 1EKEA 1G4DA 3WU0A 4MQ9F 3LSPA 4V2GA 2XUBA 1MSFC 3QU3A 2X1EA 2LYCA 3E5XA 5FFXA 4DJAA 2OUMA 3IV5A 1P7IA 2DFIA 4HSRA 2WV0A 1MJ9A 2X6YA 5B1BH 4HW0A 1Z3YA 3CLOA 1V5GA 2R7RA 2R7UA 3S32A 2PJRA 5FRNA 1P4XA 1B1BA 3WG7H 4C30A 1GUUA 1R58A 3JRFA 4OMYA 3RTRA 2Z33A 3OWTA 3ZRGA 4CCJA 3M8JA 4BHBA 4FHTA 4Z6YA 3PFYA 4I7HA 1GT0C 1WVRA 4I09A 4HNTA 3OY9A 5CJ9A 1E3OC 3LA7A 3TOAA 2LKPA 2ELJA 1MDMB 3VYSB 3QYBA 3SEQA 2R7WA 3L2RA 2W24A 2IS4A 1X2MA 4HF1A 1R00A 2FEZA 2FNAA 4U7DA 1PUEE 3M1EA 2L02A 3K10A 1W0UA 3MFKA 3SEZA 3P5JA 2ZXHA 2JUGA 1KZHA 2H09A 5KCMA 3ZQIA 3LAPA 2E7XA 2LK2A 1I50J 1Y8RB 4D7MA 3JRAA 2MG4A 3HIFA 1F4KA 2DA3A 3WG9A 5GTHC 1BR4A 2QSHX 5JHFA 4EJWA 4MHGA 4C3HJ 4RS8A 4YIIA 1EH8A 1MMAA 4IXAA 2AXTC 2OU2A 1LDDA 2CSOA 5CLSA 3VWBA 4BNCA 1I39A 5CVIA 4M3DA 1WSUA 4LMYA 1TP4A 2E1CA 4HDVA 4O5VA 2FSWA 2QM3A 3HUGA 4LJZF 1ZARA 4HZFA 3OYBA 2K5CA 1WI3A 2M45A 1WJAA 1L0OC 1OYWA 5LBQA 1MBKA 1A31A 2MBFA 3GTGJ 4BQNA 2EZHA 5FGMA 3RZDJ 2LMDA 2VBYA 3AAFA 2DLLA 2PJRB 4DYQA 4BY1J 4I01A 4XLAA 2HKOA 1JJ8C 3S1MJ 1OLTA 1MNDA 4JK1X 1M1EB 5HS9A 2BVMA 3V42A 3K7AJ 2ZBKA 5D6EA 4E4HA 4QLCU 4RAYA 4AIHA 4XLFA 2BVLA 2KT0A 3ASOH 1BL0A 1Z6RA 4NQWA 3MZ8A 5GAHJ 1X19A 3ZQLA 2DMPA 2DW4A 1BN5A 3CO6C 1B9NA 2E36A 1CF7A 2VJJA 2DODA 4R79A 5KNLA 4NHJA 4W1UA 2NYXA 2DDBA 1RR7A 3H9QA 3ZOBA 1JKOC 4NBQA 2IXSA 2RVCA 3RKYA 2YX4A 3CZ6A 2PLYA 3PSIA 2E5ZA 3LSTA 2XKPA 1QNTA 1NG7A 2MW8A 1J2XA 1R7JA 4LGWA 2E1NA 4MO7A 5LHIA 1ERDA 2VJ5A 3CC7I 3CCYA 2FA5A 1I6XA 2HKXA 3CC2I 5DD4A 4EV0A 5TJJA 4A69C 2KJCA 2WTEA 4N0BA 5GAEJ 2DPUA 2FMLA 1QHHD 1UCRA 2DQRA 4U88A 2DK5A 1FIPA 2IA1A 1DPRA 1D0ZA 4HPQA 2NNNA 1R1UA 1SVOA 4F52A 3HGYA 2ELKA 4LIVA 2XAHA 2H6CA 1GXQA 1UG0A 4HNUA 3MKWB 2EV6A 3KEYA 1PP8F 2KKOA 3HUGB 5D4RA 2JZYA 3DP7A 4ZYDA 2NOJB 4C9YA 2H27A 4M71A 2DBBA 4U7BA 2O8XA 4A0ZA 3I64A 5F27A 2UV1A 3Q0VA 3OIQA 4RB2C 1FYLA 3CCUI 4DZJA 1FX7A 4ESBA 4HV6A 1Y6IA 5BS6A 3PIPF 1N77A 2ID3A 2NS8A 3C2BA 2VE8A 4KIGA 5KVRA 1OR7C 5M5XJ 2QWWA 4HOBA 5DV5A 5GTIC 3WTWC 1W7PD 2V79A 2XPWA 3KLOA 5K7FA 2A05A 2DA2A 4NQWB 2WA0A 4KICA 2HQNA 4GGGA 1LDKB 5LHHA 3H0GJ 1QO0D 5DYMA 3OSFA 4OU0A 1XG1A 1CF7B 1UHWA 5KK1A 1P9QC 2EV5A 2XPUA 4BXUA 1ZHFA 2B9SA
chains in the Genus database with same CATH topology
1E2XA 3P7NA 1HSJA 1U5TA 4HLXA 2QQAA 1IRGA 1SD7A 5LHGA 3ZMSA 5J6XA 3P9KA 3QRFF 2XAFA 1P6RA 3EQLF 2MC3A 1V4RA 1KU9A 3BY6A 3FXQA 5D5WB 2RGVA 1XDSA 1LDJA 2CG4A 3L00A 3F21A 1Z9CA 1FYKA 1XSVA 1TNSA 5D5VB 3BPVA 5HDNA 1HW1A 5JVTA 3LFKA 3V7SA 2L3DA 4M6XA 2E7WA 1Z91A 3FM3A 2XAQA 1T38A 1BI2A 1KGSA 3GVAA 1MKMA 5L3CA 5CVRA 4LLNA 3T5XA 1WWXA 4OINF 1FT9A 4YIFA 2Z3YA 1O3QA 3GYHX 4JBAA 1SFEA 3I59A 2C6YA 3JSOA 1U5TB 3FXRA 2OQGA 3GWZA 3HHHA 2ZNYA 1ZN2A 5CVVA 1QQIA 4L9JA 1KQ9A 1HW2A 1P4WA 3DEUA 2Q8KA 2V6CA 5LRSA 3ZN0A 4Z2YA 5L3FA 2FBHA 5D8LB 2G7UA 3Q9VA 3CUQC 1ONVA 3B73A 5LGUA 2HEOA 5CVJA 4G7ZF 4WXDA 2A69F 2VE9A 4EM1A 3M8EA 3L09A 2ZO4A 3F8NA 2DI3A 1R22A 5E1ZB 1W4MA 2HR3A 1SMYF 5LEJA 2BV6A 1ZRCA 1FZPB 3U2RA 2CWEA 2J5OA 1QZZA 2W25A 3I59B 3C3WA 3H92A 3ML6A 4CZZA 2LF7A 1WKMA 1BM9A 2GA1A 5A2QK 3OOPA 2GWRA 1S6LA 1R23A 5FFZA 4A6EA 4LK1F 2O3FA 3VEPA 3F8MA 3M9AA 2VXZA 3QP5A 4CO8A 2P5KA 5JHUA 2VT2A 3EYIA 4L9TA 4OIOF 1KQ0A 2HYGD 3P9CA 4R1HA 5FO5A 1IUYA 1LEBA 1KYZA 1QZYA 5LEKA 3RPUA 2GA2A 3I54A 3BJAA 3O3KA 1IF1A 3BWGA 3MCZA 1ZLJA 4LB5A 3IWFA 2V1DA 5E17F 1ZGJA 4M6YA 3N4MA 4L0ZB 2MD5A 2R7FA 5DDGA 2V1UA 2O03A 4P55A 1IXRC 1YYVA 1YTYA 1GHCA 3SQNA 4YFNF 1J59A 3E3VA 3NQOA 5JR3A 1F9NA 3DXJF 1PDNC 1YS6A 2XASA 2Y75A 1XDUA 2JT1A 1ZGAA 2EFNA 3E6CC 3HTSB 2XVCA 4KFCA 2PN6A 3KEQA 4A2UA 3M8FA 3V8JA 3ZN1A 4UHTA 4UVAA 5D8KB 2QBYA 4I0BA 1V3FA 3F22A 3G3ZA 3L9FA 4L9NA 3DPLC 1KU7A 3O6BB 3JAMZ 2L4AA 2BBYA 3TOBA 5FD5A 4BQAA 1FOKA 1T39A 2MH9A 4BAYA 3BROA 3FMRA 3HSFA 3V7RA 4HQEA 4HF0A 3JTGA 2P8TA 1IZ1A 3GLXA 4B8XA 3WTVC 4AD9A 2QZ8A 5DCFA 1LNWA 1YIOA 2STWA 3CJNA 1G6NA 2Z99A 3CTAA 2ETHA 3GUDA 5CYVA 3GZ6A 4P5OA 5EEHA 4ZZLA 1F5TA 5FB2A 3F8BA 4KUMA 4LFUA 4RGSA 2D1HA 3KZYA 3CO7C 3KP4A 4A5MA 2OZUA 3IHUA 2F5FA 4WK8F 4GYGA 2QBYB 4CICA 1HKQA 1ZRDA 3T0YA 3WGHA 1Y0UA 1RZ4A 1B4AA 3LQRA 3ZMTA 4A0XA 3WTZA 1HKSA 4XSXF 3E5UA 4KMFA 1O57A 1FPQA 2QUFA 3J7AO 1TQPA 2A6HF 4M73A 2VOOA 4MNUA 1BIBA 4G7OF 1T2KA 1LB2A 2EK5A 3QPTA 1ZG5A 2FNPA 2JRTA 2VONA 3RIRA 2QVOA 1L3LA 1TBXA 4BYYA 2PEXA 2Y48A 3RYPA 1FP2A 2GQQA 4AIKA 5HOOA 2DU9A 1IXCA 5DUKA 3KEOA 1U5TC 4UV8A 5ERIA 2IPQX 3TO7A 4KT5C 1O3SA 3HTUA 3RYRA 2IJLA 4ZYGA 4XSZF 4S05A 1D5VA 2AXLA 1S29A 2XHKA 1KQ8A 5L3DA 1U2WA 4RGRA 4KMUX 5HS8A 1QGPA 3IWZA 1I27A 1ZG1A 2VBZA 2H6BA 4NB5A 1KU2A 4A6DA 1R36A 3KP2A 2O6GE 2EV0A 5H6RA 3E6MA 4Y15A 3KZZA 1IN6A 2COMA 2GXBA 4M9XA 2J5PA 1FSEA 5AONA 4P96A 2Z9OA 1WI9A 2CQKA 2KRFA 2NAZA 1TLHB 3ABTA 4HX4A 2XAJA 2IW5A 3QOPA 3QAHA 3LWFA 5A2QZ 1SFXA 2PBIA 4UXNA 2QLZA 1FBQA 4ESJA 2RC4A 3WODF 4G7HF 4L5JA 3JTHA 2MLGA 3GZ5A 1USTA 4B09A 2JTVA 5ILVA 3JAMK 4FT8A 2FXAA 2KIMA 4AIJA 3BJ6A 2A68F 4EJUA 3WGGA 1U8RA 2ZNZA 3R0JA 5ICEA 1ZRFA 3DFGA 3GEZA 3BJOA 4PCQA 4HLYA 3CUOA 2ADUA 3MZYA 3VFZA 2MA3A 3TO6A 4MEYF 2P7VB 1JHHA 4MTDA 4EM0B 1YLFA 1P4AA 3P9IA 3ECHA 2FQ3A 2HQRA 3Q9SA 4KIFA 5FLXZ 3WTSC 1R1TA 1ZREA 2F5EA 1E17A 3GX4X 2VC1A 1XCVA 2EFPA 1G3YA 5IT9Z 3L2CA 1DUXC 3WE2A 4OOIA 1HW5A 4L9VA 1XCBA 5IT3A 2IA2A 1DDNA 2A07F 1RI7A 4UVCA 4GCVA 4Q4ZF 2DO7A 2ZXJA 3F6VA 2ISYA 1W5TA 1WQ2A 3U9GA 4N9HA 3H3ZA 2D1VA 1IN7A 4IRHA 4RB0A 2Z5UA 1SD4A 2VC0A 1BI1A 1X3UA 4N9IA 4TV7A 2NNYA 4IRGA 2FBKA 3HRSA 3HOTA 5H6QA 1GVJA 2A61A 4AVPA 4WXCA 5H20A 2ZKZA 1BC7C 5LLQA 3IKTA 2O0YA 2EFWA 2L54A 5LGNA 2GZWA 3WTUC 2CFXA 2YPRA 3KLNA 2GIVA 3HSEA 5E1WA 1Z6TA 2L01A 1BOAA 4JQFA 2IP2A 2XROA 5ILSA 2M30A 1XSDA 3I58A 3QU6A 1TW2A 2Q0OA 2K4BA 1LJ9A 2HFHA 2ELHA 1OR7A 2GXGA 1D3YA 5DUIA 1OKRA 2IT0A 3N97A 5F1RA 4O6JA 1YW7A 5F64A 2V1XA 4UVBA 4Y17A 4P9FA 2V9VA 2UXNA 3ERED 1USSA 4I0AA 5DD8A 4IRIA 3FZVA 3K9TA 2D2WA 4ENJA 2FF4A 2FRHA 5E1XA 2PQ8A 4ESFA 5L3BA 2CW0F 5DEQA 4PGGA 5D4SA 3TGNA 1XD7A 4YFKF 4FX0A 1BJAA 4XLPF 2D45A 1W5SA 4G6DA 1ULYA 4L18B 1MJAA 3HHGA 3E97A 4G6QA 1HXDA 3GF2A 5FD6A 4ZH4F 1O7FA 4Q47A 4HX7A 1IW7F 5BPDA 3RDIA 1FBSA 2WC2A 4YFXF 1MZBA 4D0PA 2OQRA 3EETA 1J5YA 4KA4A 5K5OA 1KU3A 4ZYEA 3O2PE 1K7AA 1LVAA 4RB3C 4KNYA 1TQMA 4ON0A 2BEOA 3R60A 1RUNA 5ED4A 4M9ZA 1R1VA 3PQKA 4UV9A 2MH2A 3MWMA 4HV5A 4MQVA 4G9YA 2VN2A 2K7LA 4EM2A 3ECOA 1FYMA 2EA4A 1Z7UA 2M1BA 5HS7A 1TNTA 3T8RA 3FMQA 3Q5FA 1RUOA 4L0YB 3K2ZA 4I02A 1TTYA 5K1YA 1IN8A 3LAJA 4YG2F 5FLXK 1PP7U 2M87A 4S04A 1C0WA 3K0LA 3T8TA 4IHSA 1AWCA 2QYOA 1H9GA 4FX4A 1XSXA 4HF2A 1SAXA 3GO5A 2UWMA 1HSTA 2YR2A 3V7CA 5IT9K 1BI0A 5HDKA 1J75A 2DPDA 3C1DA 5K5RA 2NRAC 2P6TA 3JW4A 3HSRA 4EJOA 2BE5F 3ZMZA 1S7OA 1DP7P 1Q1HA 3WTTC 1G3SA 5ILUA 4Q5SF 1TQIA 2VBXA 2HGCA 3D5LA 3F8CA 3TDZC 4ZZDA 2ZJ2A 3DF8A 4CHUA 2GAUA 4I98B 2ZMEA 2G9WA 3RI4A 2ACJA 2K02A 1O3RA 1RIOH 3L7WA 3TKYA 5D5UB 2W57A 3SHFA 2JPCA 2VODA 3KCCA 3V8LA 4IJAA 2FBIA 3DV8A 2HS5A 3FHZA 1B59A 4CDGA 3JSPA 4ENNA 1D8JA 1IN4A 5AIPA 1TW3A 4Q48A 2F5CA 1JHFA 3SZPA 5TRDA 3FM5A 5HLIA 4XBFA 4QWQA 1F1ZA 3I0TA 3FF5A 4RGXA 3MZHA 2F5DA 1XMKA 3QPHA 1GXPA 1Z1DA 1FBUA 2XRNA 1BIAA 3CUQB 2RNJA 1B9MA 1MGTA 4CGZA 1YO5C 2NS0A 2DQLA 2A3SA 3J80Z 3IL2A 4UUVA 2EA2A 4M74A 4I2OA 4MTEA 1U6GA 4EJTA 4GXOA 1K79A 5DCMA 4WX9A 3DQVC 2VT3A 5ICFA 3KE2A 6PAXA 4RGUA 2XAGA 2ZMEB 5HVQC 2HTJA 2STTA 4U0VA 5D5XB 1NHAA 4U0WA 4U0YA 4G8XA 1B6AA 4HAMA 2L4MA 1IRFA 1H9TA 4LK0F 3R6SA 1LEAA 3CDHA 1REPC 2RDPA 1I1SA 2JPBA 3RKWA 1G3TA 2HWVA 3SFZA 3F23A 3K1NA 4M9SA 2X4HA 4HA8A 5E8GA 2WWYA 4DQ2A 2P4WA 5LGTA 1J0RA 2IRFG 3EUHA 1YS7A 4OMZA 2ESNA 2EJRA 2OBPA 3ZMDA 3E6BA 1IAWA 1U3EM 5DCMB 1Z05A 3VB2A 4KIBA 1EH6A 1T98A 3KP3A 1D8KA 4GO1A 4EQQA 3IKVA 2PJPA 1JXSA 1UB9A 5CVUA 1R5GA 1EV7A 1ON2A 4HYEA 2ISZA 3RJPA 2B0LA 4A5NA 4PDKA 4R8HA 3ZPLA 3C7JA 4ZYHA 2RV8A 1IN5A 2R7DA 4PZJA 2CGPA 4EVIA 2FU4A 2PMHA 4WCGA 2HYFA 3W6KB 4CXFA 2K4JA 1SMTA 3M7GA 3IC7A 1UFMA 1FP1D 1ZG3A 2HZTA 1FLIA 1QBJA 3MEXA 1JE8A 2XV4S 2A6EF 3HOSA 2RKHA 1K6OA 4E70A 5L3GA 5ICGA 2QQBA 1XGOA 2A5YB 4ETSA 3DPTA 3COAC 2MLKA 3LQQA 2EFOA 4HBLA 2FOKA 1U78A 1P92A 1I5ZA 3HRMA 1T6SA 3J81K 2P7CB 2AS5F 3WE3A 2YU3A 1SD5A 1W7PA 3GFLA 2XGXA 5E8IA 5ICCA 4AWXB 3R4KA 2P5VA 4IVNA 2LDUA 2W84A 3VOEA 3I71A 1QPMA 4OIQF 2O61A 2FMYA 2M5WA 4HQMA 3ISPA 4LLGF 4IF4A 4BH9A 2EFQA 2BYVE 3GW2A 3KP5A 3FXUA 3J80K 2DAOA 1K78A 4KN4X 3PQJA 1UHMA 1LQ1A 4HDUA 4KYWA 4F7ZA 3H3UA 5JFRA 2QENA 1ZH5A 2G7HA 2EWNA 5LRRA 1OYYA 2P6SA 3W6JB 1BC8C 4XLNF 1O3TA 4GYIA 1T0FA 2FE3A 3I4PA 3T1BA 1ZYRF 1RNLA 4A12A 3HRTA 1XN7A 4MGRA 1OMIA 3BZ6A 1W7PB 1P2FA 2LNBA 5BQTA 2OZ6A 3S2WA 2KIFA 2M8EA 4EMSA 3WTXC 2RQPA 5D6FA 2PFBA 2VOPA 2XIGA 3NEUA 2CYYA 5E18F 2Q2EA 3GFJA 2VBWA 4KN7X 4WXHA 3D0SA 1OYIA 2Y0MA 1JGSA 2OAZA 1K78B 5E20A 4IHTA 3SXYA 3ZP5A 1CGPA 2P5LC 3BDDA 3OV8A 3GFIA 2IA0A 2LSOA 1ZAOA 4XRFA 3KP6A 2BGCA 2CO5A 2X0LA 4LLLA 1MD0A 3F6OA 5BPIA 2HTSA 1XGNA 5K5QA 1AOYA 3C18A 2OA4A 4HX8A 3ROUA 3R0AA 1FNNA 1OPCA 2TDXA 2KIUA 4Y13A 1YW9A 4UNOA 1EH7A 2K27A 3FWEA 2HDCA 2ZFWA 5HDGA 2PI0A 3K1MA 5JI6A 3HYIA 1BI3A 1KA8A 4P9UA 3GFMA 3ULQB 2IVMA 3ZQ7A 5HLHA 2RN7A 2DK8A 3DKWA 1SD6A 3KP7A 3K1PA 4ENKA 2OD5A 3E6DA 4PGHA 1FY7A 3F72A 2JSCA 1HBXG 1S8NA 1STZA 1YFHA 1J7KA 2PG4A 3I53A 3MAJA 3TO9A 3U1DA 3MQ0A 2KJBA 1HKTA 2DT5A 4WWCA 3SZTA 4A0YA 2XKOA 1XGMA 1WRJA 2YSRA 4ENMA 4RB1A 2ZCWA 4EGYA 2HOEA 1FC3A 2UZKA 1A04A 1ODDA 4G94A 2R3SA 1ON1A 1S7AA 4BHPA 3QP6A 3ZMUA 4EJVA 3IRRA 3ELKA 5J8CA 4RAZA 5BMZA 4MEXF 3V4GA 1H0MA 2K86A 1J9IA 3EDPA 3NRVA 5BOXA 3B02A 4IPAA 3FX3A 1I1GA 1FSHA 4O3MA 1YQAA 3WTYC 1YG2A 3REOA 1G3WA 5J8FA 4LG0A 3KETA 3EYYA 3CUQA 3KFWX 2EB7A 1HQCA 3RPQA 2UXXA 4BHCA 1XMAA 3BPXA 3FMSA 3R61A 5F6FA 4M72A 1ZLKA 2LF8A 4EGZA 4WF2A 2PMUA 3HRUA 3TQNA 1YW8A 3TDUC 4KDPA 1KYWA 5HLGA 1VTNC 3LA2A 4H0EA 4ASNA 4OIRF 1XB4A 1SFUA 3BOQA 3E5QA 3GXOA 3IRQA 3J81Z 2QQ9A 3ZMVA 3WU1B 3WGIA 4DNCA 3G73A 2DTRA 3PFIA 1R5HA 1MDMA 2ESHA 4LG0B 1DPUA 1IXSB 4LD5A 3VODA 4OIPF 5L3EA 1MJBA 5EEGA 1XGSA 3V8KA 4L5IA 1O7LA 3ABUA 3RKXA 3K69A 3F8FA 1FWZA 4K2EA 4CYDA 3LA3A 3BP8A 1S3JA 2YX7A 2W85A 3F3XA 2F2EA 2H94A 3I5UA 1BBYA 5AIQA 4LB6B 1G4DA 3WU0A 4MQ9F 2XUBA 3QU3A 3E5XA 5FFXA 2DFIA 2WV0A 1MJ9A 4HW0A 3CLOA 1P4XA 1B1BA 1R58A 4OMYA 3RTRA 2Z33A 4BHBA 4FHTA 4I7HA 4I09A 5CJ9A 3LA7A 3TOAA 2LKPA 1MDMB 2W24A 4HF1A 1R00A 2FEZA 2FNAA 4U7DA 1PUEE 3M1EA 2L02A 3MFKA 2H09A 3LAPA 2E7XA 3HIFA 1F4KA 3WG9A 4EJWA 4MHGA 4RS8A 4YIIA 1EH8A 4IXAA 2OU2A 1LDDA 2CSOA 5CLSA 4BNCA 5CVIA 1WSUA 4LMYA 2E1CA 4HDVA 4O5VA 2FSWA 2QM3A 3HUGA 4LJZF 1ZARA 4HZFA 2M45A 1L0OC 1OYWA 5LBQA 2MBFA 5FGMA 2VBYA 3AAFA 2DLLA 4I01A 2HKOA 4JK1X 5HS9A 5D6EA 2ZBKA 4QLCU 4RAYA 4AIHA 1Z6RA 4NQWA 2DW4A 1BN5A 3CO6C 1B9NA 1CF7A 4R79A 4NHJA 2NYXA 2RVCA 3RKYA 2YX4A 2PLYA 3LSTA 2XKPA 1QNTA 4LGWA 1J2XA 1R7JA 2E1NA 5LHIA 2FA5A 1I6XA 2HKXA 5DD4A 4EV0A 5TJJA 2KJCA 2WTEA 4N0BA 2DPUA 2FMLA 1UCRA 2DQRA 4U88A 2DK5A 2IA1A 1DPRA 2NNNA 1R1UA 2H6CA 2XAHA 1GXQA 2EV6A 1PP8F 2KKOA 5D4RA 2JZYA 3DP7A 4ZYDA 2H27A 4M71A 2DBBA 4U7BA 2O8XA 4A0ZA 3I64A 4RB2C 1FYLA 1FX7A 4ESBA 4HV6A 5BS6A 2VE8A 4KIGA 5KVRA 2QWWA 4HOBA 5DV5A 3WTWC 1W7PD 2V79A 3KLOA 4KICA 2HQNA 4GGGA 1LDKB 5LHHA 1QO0D 5DYMA 4OU0A 1CF7B 1UHWA 5KK1A 2EV5A 4BXUA 1ZHFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E2X A;  3P7N A;  1HSJ A;  1U5T A;  4HLX A;  2QQA A;  1IRG A;  1SD7 A;  5LHG A;  3ZMS A;  5J6X A;  3P9K A;  3QRF F;  2XAF A;  1P6R A;  3EQL F;  2MC3 A;  1V4R A;  1KU9 A;  3BY6 A;  3FXQ A;  5D5W B;  2RGV A;  1XDS A;  1LDJ A;  2CG4 A;  3L00 A;  3F21 A;  1Z9C A;  1FYK A;  1XSV A;  1TNS A;  5D5V B;  3BPV A;  5HDN A;  1HW1 A;  5JVT A;  3LFK A;  3V7S A;  2L3D A;  4M6X A;  2E7W A;  1Z91 A;  3FM3 A;  2XAQ A;  1T38 A;  1BI2 A;  1KGS A;  3GVA A;  1MKM A;  5L3C A;  5CVR A;  4LLN A;  3T5X A;  1WWX A;  4OIN F;  1FT9 A;  4YIF A;  2Z3Y A;  1O3Q A;  3GYH X;  4JBA A;  1SFE A;  3I59 A;  2C6Y A;  3JSO A;  1U5T B;  3FXR A;  2OQG A;  3GWZ A;  3HHH A;  2ZNY A;  1ZN2 A;  5CVV A;  1QQI A;  4L9J A;  1KQ9 A;  1HW2 A;  1P4W A;  3DEU A;  2Q8K A;  2V6C A;  5LRS A;  3ZN0 A;  4Z2Y A;  5L3F A;  2FBH A;  5D8L B;  2G7U A;  3Q9V A;  3CUQ C;  1ONV A;  3B73 A;  5LGU A;  2HEO A;  5CVJ A;  4G7Z F;  4WXD A;  2A69 F;  2VE9 A;  4EM1 A;  3M8E A;  3L09 A;  2ZO4 A;  3F8N A;  2DI3 A;  1R22 A;  5E1Z B;  1W4M A;  2HR3 A;  1SMY F;  5LEJ A;  2BV6 A;  1ZRC A;  1FZP B;  3U2R A;  2CWE A;  2J5O A;  1QZZ A;  2W25 A;  3I59 B;  3C3W A;  3H92 A;  3ML6 A;  4CZZ A;  2LF7 A;  1WKM A;  1BM9 A;  2GA1 A;  5A2Q K;  3OOP A;  2GWR A;  1S6L A;  1R23 A;  5FFZ A;  4A6E A;  4LK1 F;  2O3F A;  3VEP A;  3F8M A;  3M9A A;  2VXZ A;  3QP5 A;  4CO8 A;  2P5K A;  5JHU A;  2VT2 A;  3EYI A;  4L9T A;  4OIO F;  1KQ0 A;  2HYG D;  3P9C A;  4R1H A;  5FO5 A;  1IUY A;  1LEB A;  1KYZ A;  1QZY A;  5LEK A;  3RPU A;  2GA2 A;  3I54 A;  3BJA A;  3O3K A;  1IF1 A;  3BWG A;  3MCZ A;  1ZLJ A;  4LB5 A;  3IWF A;  2V1D A;  5E17 F;  1ZGJ A;  4M6Y A;  3N4M A;  4L0Z B;  2MD5 A;  2R7F A;  5DDG A;  2V1U A;  2O03 A;  4P55 A;  1IXR C;  1YYV A;  1YTY A;  1GHC A;  3SQN A;  4YFN F;  1J59 A;  3E3V A;  3NQO A;  5JR3 A;  1F9N A;  3DXJ F;  1PDN C;  1YS6 A;  2XAS A;  2Y75 A;  1XDU A;  2JT1 A;  1ZGA A;  2EFN A;  3E6C C;  3HTS B;  2XVC A;  4KFC A;  2PN6 A;  3KEQ A;  4A2U A;  3M8F A;  3V8J A;  3ZN1 A;  4UHT A;  4UVA A;  5D8K B;  2QBY A;  4I0B A;  1V3F A;  3F22 A;  3G3Z A;  3L9F A;  4L9N A;  3DPL C;  1KU7 A;  3O6B B;  3JAM Z;  2L4A A;  2BBY A;  3TOB A;  5FD5 A;  4BQA A;  1FOK A;  1T39 A;  2MH9 A;  4BAY A;  3BRO A;  3FMR A;  3HSF A;  3V7R A;  4HQE A;  4HF0 A;  3JTG A;  2P8T A;  1IZ1 A;  3GLX A;  4B8X A;  3WTV C;  4AD9 A;  2QZ8 A;  5DCF A;  1LNW A;  1YIO A;  2STW A;  3CJN A;  1G6N A;  2Z99 A;  3CTA A;  2ETH A;  3GUD A;  5CYV A;  3GZ6 A;  4P5O A;  5EEH A;  4ZZL A;  1F5T A;  5FB2 A;  3F8B A;  4KUM A;  4LFU A;  4RGS A;  2D1H A;  3KZY A;  3CO7 C;  3KP4 A;  4A5M A;  2OZU A;  3IHU A;  2F5F A;  4WK8 F;  4GYG A;  2QBY B;  4CIC A;  1HKQ A;  1ZRD A;  3T0Y A;  3WGH A;  1Y0U A;  1RZ4 A;  1B4A A;  3LQR A;  3ZMT A;  4A0X A;  3WTZ A;  1HKS A;  4XSX F;  3E5U A;  4KMF A;  1O57 A;  1FPQ A;  2QUF A;  3J7A O;  1TQP A;  2A6H F;  4M73 A;  2VOO A;  4MNU A;  1BIB A;  4G7O F;  1T2K A;  1LB2 A;  2EK5 A;  3QPT A;  1ZG5 A;  2FNP A;  2JRT A;  2VON A;  3RIR A;  2QVO A;  1L3L A;  1TBX A;  4BYY A;  2PEX A;  2Y48 A;  3RYP A;  1FP2 A;  2GQQ A;  4AIK A;  5HOO A;  2DU9 A;  1IXC A;  5DUK A;  3KEO A;  1U5T C;  4UV8 A;  5ERI A;  2IPQ X;  3TO7 A;  4KT5 C;  1O3S A;  3HTU A;  3RYR A;  2IJL A;  4ZYG A;  4XSZ F;  4S05 A;  1D5V A;  2AXL A;  1S29 A;  2XHK A;  1KQ8 A;  5L3D A;  1U2W A;  4RGR A;  4KMU X;  5HS8 A;  1QGP A;  3IWZ A;  1I27 A;  1ZG1 A;  2VBZ A;  2H6B A;  4NB5 A;  1KU2 A;  4A6D A;  1R36 A;  3KP2 A;  2O6G E;  2EV0 A;  5H6R A;  3E6M A;  4Y15 A;  3KZZ A;  1IN6 A;  2COM A;  2GXB A;  4M9X A;  2J5P A;  1FSE A;  5AON A;  4P96 A;  2Z9O A;  1WI9 A;  2CQK A;  2KRF A;  2NAZ A;  1TLH B;  3ABT A;  4HX4 A;  2XAJ A;  2IW5 A;  3QOP A;  3QAH A;  3LWF A;  5A2Q Z;  1SFX A;  2PBI A;  4UXN A;  2QLZ A;  1FBQ A;  4ESJ A;  2RC4 A;  3WOD F;  4G7H F;  4L5J A;  3JTH A;  2MLG A;  3GZ5 A;  1UST A;  4B09 A;  2JTV A;  5ILV A;  3JAM K;  4FT8 A;  2FXA A;  2KIM A;  4AIJ A;  3BJ6 A;  2A68 F;  4EJU A;  3WGG A;  1U8R A;  2ZNZ A;  3R0J A;  5ICE A;  1ZRF A;  3DFG A;  3GEZ A;  3BJO A;  4PCQ A;  4HLY A;  3CUO A;  2ADU A;  3MZY A;  3VFZ A;  2MA3 A;  3TO6 A;  4MEY F;  2P7V B;  1JHH A;  4MTD A;  4EM0 B;  1YLF A;  1P4A A;  3P9I A;  3ECH A;  2FQ3 A;  2HQR A;  3Q9S A;  4KIF A;  5FLX Z;  3WTS C;  1R1T A;  1ZRE A;  2F5E A;  1E17 A;  3GX4 X;  2VC1 A;  1XCV A;  2EFP A;  1G3Y A;  5IT9 Z;  3L2C A;  1DUX C;  3WE2 A;  4OOI A;  1HW5 A;  4L9V A;  1XCB A;  5IT3 A;  2IA2 A;  1DDN A;  2A07 F;  1RI7 A;  4UVC A;  4GCV A;  4Q4Z F;  2DO7 A;  2ZXJ A;  3F6V A;  2ISY A;  1W5T A;  1WQ2 A;  3U9G A;  4N9H A;  3H3Z A;  2D1V A;  1IN7 A;  4IRH A;  4RB0 A;  2Z5U A;  1SD4 A;  2VC0 A;  1BI1 A;  1X3U A;  4N9I A;  4TV7 A;  2NNY A;  4IRG A;  2FBK A;  3HRS A;  3HOT A;  5H6Q A;  1GVJ A;  2A61 A;  4AVP A;  4WXC A;  5H20 A;  2ZKZ A;  1BC7 C;  5LLQ A;  3IKT A;  2O0Y A;  2EFW A;  2L54 A;  5LGN A;  2GZW A;  3WTU C;  2CFX A;  2YPR A;  3KLN A;  2GIV A;  3HSE A;  5E1W A;  1Z6T A;  2L01 A;  1BOA A;  4JQF A;  2IP2 A;  2XRO A;  5ILS A;  2M30 A;  1XSD A;  3I58 A;  3QU6 A;  1TW2 A;  2Q0O A;  2K4B A;  1LJ9 A;  2HFH A;  2ELH A;  1OR7 A;  2GXG A;  1D3Y A;  5DUI A;  1OKR A;  2IT0 A;  3N97 A;  5F1R A;  4O6J A;  1YW7 A;  5F64 A;  2V1X A;  4UVB A;  4Y17 A;  4P9F A;  2V9V A;  2UXN A;  3ERE D;  1USS A;  4I0A A;  5DD8 A;  4IRI A;  3FZV A;  3K9T A;  2D2W A;  4ENJ A;  2FF4 A;  2FRH A;  5E1X A;  2PQ8 A;  4ESF A;  5L3B A;  2CW0 F;  5DEQ A;  4PGG A;  5D4S A;  3TGN A;  1XD7 A;  4YFK F;  4FX0 A;  1BJA A;  4XLP F;  2D45 A;  1W5S A;  4G6D A;  1ULY A;  4L18 B;  1MJA A;  3HHG A;  3E97 A;  4G6Q A;  1HXD A;  3GF2 A;  5FD6 A;  4ZH4 F;  1O7F A;  4Q47 A;  4HX7 A;  1IW7 F;  5BPD A;  3RDI A;  1FBS A;  2WC2 A;  4YFX F;  1MZB A;  4D0P A;  2OQR A;  3EET A;  1J5Y A;  4KA4 A;  5K5O A;  1KU3 A;  4ZYE A;  3O2P E;  1K7A A;  1LVA A;  4RB3 C;  4KNY A;  1TQM A;  4ON0 A;  2BEO A;  3R60 A;  1RUN A;  5ED4 A;  4M9Z A;  1R1V A;  3PQK A;  4UV9 A;  2MH2 A;  3MWM A;  4HV5 A;  4MQV A;  4G9Y A;  2VN2 A;  2K7L A;  4EM2 A;  3ECO A;  1FYM A;  2EA4 A;  1Z7U A;  2M1B A;  5HS7 A;  1TNT A;  3T8R A;  3FMQ A;  3Q5F A;  1RUO A;  4L0Y B;  3K2Z A;  4I02 A;  1TTY A;  5K1Y A;  1IN8 A;  3LAJ A;  4YG2 F;  5FLX K;  1PP7 U;  2M87 A;  4S04 A;  1C0W A;  3K0L A;  3T8T A;  4IHS A;  1AWC A;  2QYO A;  1H9G A;  4FX4 A;  1XSX A;  4HF2 A;  1SAX A;  3GO5 A;  2UWM A;  1HST A;  2YR2 A;  3V7C A;  5IT9 K;  1BI0 A;  5HDK A;  1J75 A;  2DPD A;  3C1D A;  5K5R A;  2NRA C;  2P6T A;  3JW4 A;  3HSR A;  4EJO A;  2BE5 F;  3ZMZ A;  1S7O A;  1DP7 P;  1Q1H A;  3WTT C;  1G3S A;  5ILU A;  4Q5S F;  1TQI A;  2VBX A;  2HGC A;  3D5L A;  3F8C A;  3TDZ C;  4ZZD A;  2ZJ2 A;  3DF8 A;  4CHU A;  2GAU A;  4I98 B;  2ZME A;  2G9W A;  3RI4 A;  2ACJ A;  2K02 A;  1O3R A;  1RIO H;  3L7W A;  3TKY A;  5D5U B;  2W57 A;  3SHF A;  2JPC A;  2VOD A;  3KCC A;  3V8L A;  4IJA A;  2FBI A;  3DV8 A;  2HS5 A;  3FHZ A;  1B59 A;  4CDG A;  3JSP A;  4ENN A;  1D8J A;  1IN4 A;  5AIP A;  1TW3 A;  4Q48 A;  2F5C A;  1JHF A;  3SZP A;  5TRD A;  3FM5 A;  5HLI A;  4XBF A;  4QWQ A;  1F1Z A;  3I0T A;  3FF5 A;  4RGX A;  3MZH A;  2F5D A;  1XMK A;  3QPH A;  1GXP A;  1Z1D A;  1FBU A;  2XRN A;  1BIA A;  3CUQ B;  2RNJ A;  1B9M A;  1MGT A;  4CGZ A;  1YO5 C;  2NS0 A;  2DQL A;  2A3S A;  3J80 Z;  3IL2 A;  4UUV A;  2EA2 A;  4M74 A;  4I2O A;  4MTE A;  1U6G A;  4EJT A;  4GXO A;  1K79 A;  5DCM A;  4WX9 A;  3DQV C;  2VT3 A;  5ICF A;  3KE2 A;  6PAX A;  4RGU A;  2XAG A;  2ZME B;  5HVQ C;  2HTJ A;  2STT A;  4U0V A;  5D5X B;  1NHA A;  4U0W A;  4U0Y A;  4G8X A;  1B6A A;  4HAM A;  2L4M A;  1IRF A;  1H9T A;  4LK0 F;  3R6S A;  1LEA A;  3CDH A;  1REP C;  2RDP A;  1I1S A;  2JPB A;  3RKW A;  1G3T A;  2HWV A;  3SFZ A;  3F23 A;  3K1N A;  4M9S A;  2X4H A;  4HA8 A;  5E8G A;  2WWY A;  4DQ2 A;  2P4W A;  5LGT A;  1J0R A;  2IRF G;  3EUH A;  1YS7 A;  4OMZ A;  2ESN A;  2EJR A;  2OBP A;  3ZMD A;  3E6B A;  1IAW A;  1U3E M;  5DCM B;  1Z05 A;  3VB2 A;  4KIB A;  1EH6 A;  1T98 A;  3KP3 A;  1D8K A;  4GO1 A;  4EQQ A;  3IKV A;  2PJP A;  1JXS A;  1UB9 A;  5CVU A;  1R5G A;  1EV7 A;  1ON2 A;  4HYE A;  2ISZ A;  3RJP A;  2B0L A;  4A5N A;  4PDK A;  4R8H A;  3ZPL A;  3C7J A;  4ZYH A;  2RV8 A;  1IN5 A;  2R7D A;  4PZJ A;  2CGP A;  4EVI A;  2FU4 A;  2PMH A;  4WCG A;  2HYF A;  3W6K B;  4CXF A;  2K4J A;  1SMT A;  3M7G A;  3IC7 A;  1UFM A;  1FP1 D;  1ZG3 A;  2HZT A;  1FLI A;  1QBJ A;  3MEX A;  1JE8 A;  2XV4 S;  2A6E F;  3HOS A;  2RKH A;  1K6O A;  4E70 A;  5L3G A;  5ICG A;  2QQB A;  1XGO A;  2A5Y B;  4ETS A;  3DPT A;  3COA C;  2MLK A;  3LQQ A;  2EFO A;  4HBL A;  2FOK A;  1U78 A;  1P92 A;  1I5Z A;  3HRM A;  1T6S A;  3J81 K;  2P7C B;  2AS5 F;  3WE3 A;  2YU3 A;  1SD5 A;  1W7P A;  3GFL A;  2XGX A;  5E8I A;  5ICC A;  4AWX B;  3R4K A;  2P5V A;  4IVN A;  2LDU A;  2W84 A;  3VOE A;  3I71 A;  1QPM A;  4OIQ F;  2O61 A;  2FMY A;  2M5W A;  4HQM A;  3ISP A;  4LLG F;  4IF4 A;  4BH9 A;  2EFQ A;  2BYV E;  3GW2 A;  3KP5 A;  3FXU A;  3J80 K;  2DAO A;  1K78 A;  4KN4 X;  3PQJ A;  1UHM A;  1LQ1 A;  4HDU A;  4KYW A;  4F7Z A;  3H3U A;  5JFR A;  2QEN A;  1ZH5 A;  2G7H A;  2EWN A;  5LRR A;  1OYY A;  2P6S A;  3W6J B;  1BC8 C;  4XLN F;  1O3T A;  4GYI A;  1T0F A;  2FE3 A;  3I4P A;  3T1B A;  1ZYR F;  1RNL A;  4A12 A;  3HRT A;  1XN7 A;  4MGR A;  1OMI A;  3BZ6 A;  1W7P B;  1P2F A;  2LNB A;  5BQT A;  2OZ6 A;  3S2W A;  2KIF A;  2M8E A;  4EMS A;  3WTX C;  2RQP A;  5D6F A;  2PFB A;  2VOP A;  2XIG A;  3NEU A;  2CYY A;  5E18 F;  2Q2E A;  3GFJ A;  2VBW A;  4KN7 X;  4WXH A;  3D0S A;  1OYI A;  2Y0M A;  1JGS A;  2OAZ A;  1K78 B;  5E20 A;  4IHT A;  3SXY A;  3ZP5 A;  1CGP A;  2P5L C;  3BDD A;  3OV8 A;  3GFI A;  2IA0 A;  2LSO A;  1ZAO A;  4XRF A;  3KP6 A;  2BGC A;  2CO5 A;  2X0L A;  4LLL A;  1MD0 A;  3F6O A;  5BPI A;  2HTS A;  1XGN A;  5K5Q A;  1AOY A;  3C18 A;  2OA4 A;  4HX8 A;  3ROU A;  3R0A A;  1FNN A;  1OPC A;  2TDX A;  2KIU A;  4Y13 A;  1YW9 A;  4UNO A;  1EH7 A;  2K27 A;  3FWE A;  2HDC A;  2ZFW A;  5HDG A;  2PI0 A;  3K1M A;  5JI6 A;  3HYI A;  1BI3 A;  1KA8 A;  4P9U A;  3GFM A;  3ULQ B;  2IVM A;  3ZQ7 A;  5HLH A;  2RN7 A;  2DK8 A;  3DKW A;  1SD6 A;  3KP7 A;  3K1P A;  4ENK A;  2OD5 A;  3E6D A;  4PGH A;  1FY7 A;  3F72 A;  2JSC A;  1HBX G;  1S8N A;  1STZ A;  1YFH A;  1J7K A;  2PG4 A;  3I53 A;  3MAJ A;  3TO9 A;  3U1D A;  3MQ0 A;  2KJB A;  1HKT A;  2DT5 A;  4WWC A;  3SZT A;  4A0Y A;  2XKO A;  1XGM A;  1WRJ A;  2YSR A;  4ENM A;  4RB1 A;  2ZCW A;  4EGY A;  2HOE A;  1FC3 A;  2UZK A;  1A04 A;  1ODD A;  4G94 A;  2R3S A;  1ON1 A;  1S7A A;  4BHP A;  3QP6 A;  3ZMU A;  4EJV A;  3IRR A;  3ELK A;  5J8C A;  4RAZ A;  5BMZ A;  4MEX F;  3V4G A;  1H0M A;  2K86 A;  1J9I A;  3EDP A;  3NRV A;  5BOX A;  3B02 A;  4IPA A;  3FX3 A;  1I1G A;  1FSH A;  4O3M A;  1YQA A;  3WTY C;  1YG2 A;  3REO A;  1G3W A;  5J8F A;  4LG0 A;  3KET A;  3EYY A;  3CUQ A;  3KFW X;  2EB7 A;  1HQC A;  3RPQ A;  2UXX A;  4BHC A;  1XMA A;  3BPX A;  3FMS A;  3R61 A;  5F6F A;  4M72 A;  1ZLK A;  2LF8 A;  4EGZ A;  4WF2 A;  2PMU A;  3HRU A;  3TQN A;  1YW8 A;  3TDU C;  4KDP A;  1KYW A;  5HLG A;  1VTN C;  3LA2 A;  4H0E A;  4ASN A;  4OIR F;  1XB4 A;  1SFU A;  3BOQ A;  3E5Q A;  3GXO A;  3IRQ A;  3J81 Z;  2QQ9 A;  3ZMV A;  3WU1 B;  3WGI A;  4DNC A;  3G73 A;  2DTR A;  3PFI A;  1R5H A;  1MDM A;  2ESH A;  4LG0 B;  1DPU A;  1IXS B;  4LD5 A;  3VOD A;  4OIP F;  5L3E A;  1MJB A;  5EEG A;  1XGS A;  3V8K A;  4L5I A;  1O7L A;  3ABU A;  3RKX A;  3K69 A;  3F8F A;  1FWZ A;  4K2E A;  4CYD A;  3LA3 A;  3BP8 A;  1S3J A;  2YX7 A;  2W85 A;  3F3X A;  2F2E A;  2H94 A;  3I5U A;  1BBY A;  5AIQ A;  4LB6 B;  1G4D A;  3WU0 A;  4MQ9 F;  2XUB A;  3QU3 A;  3E5X A;  5FFX A;  2DFI A;  2WV0 A;  1MJ9 A;  4HW0 A;  3CLO A;  1P4X A;  1B1B A;  1R58 A;  4OMY A;  3RTR A;  2Z33 A;  4BHB A;  4FHT A;  4I7H A;  4I09 A;  5CJ9 A;  3LA7 A;  3TOA A;  2LKP A;  1MDM B;  2W24 A;  4HF1 A;  1R00 A;  2FEZ A;  2FNA A;  4U7D A;  1PUE E;  3M1E A;  2L02 A;  3MFK A;  2H09 A;  3LAP A;  2E7X A;  3HIF A;  1F4K A;  3WG9 A;  4EJW A;  4MHG A;  4RS8 A;  4YII A;  1EH8 A;  4IXA A;  2OU2 A;  1LDD A;  2CSO A;  5CLS A;  4BNC A;  5CVI A;  1WSU A;  4LMY A;  2E1C A;  4HDV A;  4O5V A;  2FSW A;  2QM3 A;  3HUG A;  4LJZ F;  1ZAR A;  4HZF A;  2M45 A;  1L0O C;  1OYW A;  5LBQ A;  2MBF A;  5FGM A;  2VBY A;  3AAF A;  2DLL A;  4I01 A;  2HKO A;  4JK1 X;  5HS9 A;  5D6E A;  2ZBK A;  4QLC U;  4RAY A;  4AIH A;  1Z6R A;  4NQW A;  2DW4 A;  1BN5 A;  3CO6 C;  1B9N A;  1CF7 A;  4R79 A;  4NHJ A;  2NYX A;  2RVC A;  3RKY A;  2YX4 A;  2PLY A;  3LST A;  2XKP A;  1QNT A;  4LGW A;  1J2X A;  1R7J A;  2E1N A;  5LHI A;  2FA5 A;  1I6X A;  2HKX A;  5DD4 A;  4EV0 A;  5TJJ A;  2KJC A;  2WTE A;  4N0B A;  2DPU A;  2FML A;  1UCR A;  2DQR A;  4U88 A;  2DK5 A;  2IA1 A;  1DPR A;  2NNN A;  1R1U A;  2H6C A;  2XAH A;  1GXQ A;  2EV6 A;  1PP8 F;  2KKO A;  5D4R A;  2JZY A;  3DP7 A;  4ZYD A;  2H27 A;  4M71 A;  2DBB A;  4U7B A;  2O8X A;  4A0Z A;  3I64 A;  4RB2 C;  1FYL A;  1FX7 A;  4ESB A;  4HV6 A;  5BS6 A;  2VE8 A;  4KIG A;  5KVR A;  2QWW A;  4HOB A;  5DV5 A;  3WTW C;  1W7P D;  2V79 A;  3KLO A;  4KIC A;  2HQN A;  4GGG A;  1LDK B;  5LHH A;  1QO0 D;  5DYM A;  4OU0 A;  1CF7 B;  1UHW A;  5KK1 A;  2EV5 A;  4BXU A;  1ZHF A; 
#chains in the Genus database with same CATH topology
 1E2X A;  2ME0 A;  3P7N A;  1HSJ A;  3OS0 A;  5FLM J;  5E3M A;  1K4T A;  1U5T A;  1T08 B;  4MFE A;  4HLX A;  1VQP I;  4XM3 A;  2QQA A;  1IRG A;  5J4V A;  1SD7 A;  5LHG A;  3ZMS A;  3HPG A;  2JUC A;  5J6X A;  3P9K A;  2CUJ A;  2AQF A;  4A3G J;  1W5C C;  3SDB A;  4PJ0 C;  3GBG A;  2K40 A;  3QRF F;  1G59 A;  3FIW A;  2XAF A;  1P6R A;  1ORK A;  2KIS A;  2GLO A;  1AU7 A;  3EQL F;  2MC3 A;  1TT5 B;  2NVY J;  4XKV A;  1I3A A;  3FKJ A;  4DZP A;  3BZC A;  1V4R A;  1KU9 A;  1YX3 A;  3BG9 A;  3BY6 A;  3FXQ A;  4C2T A;  2W48 A;  2F4O B;  5D5W B;  2RGV A;  1DGR M;  1XDS A;  1LDJ A;  2CG4 A;  3L00 A;  2VUM J;  3F21 A;  1Z9C A;  2KRC A;  1FYK A;  1XSV A;  1TNS A;  5D5V B;  3BPV A;  5HDN A;  2R92 J;  1HW1 A;  2R7O A;  4D7N A;  5JVT A;  3LFK A;  1QVT A;  3V7S A;  2L3D A;  3CDI A;  4M6X A;  2E7W A;  5TIS C;  1Z91 A;  3RZO J;  3JR9 A;  3MD2 A;  3FM3 A;  2XAQ A;  1T38 A;  1CQT A;  1BI2 A;  2DA1 A;  2M34 A;  3C2H A;  4DBQ A;  4IHW A;  3HOZ J;  3IUO A;  1KGS A;  3GVA A;  1MKM A;  2X6W A;  5CVR A;  5L3C A;  1MBH A;  4LLN A;  3T5X A;  1WWX A;  4OIN F;  4NUB A;  2IGO A;  1FT9 A;  4ZDL A;  3ASN H;  4B1R A;  4YIF A;  2Z3Y A;  1VQL I;  2I10 A;  1Y1V J;  4AC0 A;  2BXY A;  3RSN A;  3GYH X;  1O3Q A;  1R4N B;  5EZH A;  4JBA A;  2HQA A;  1G8X A;  4JX4 A;  1SFE A;  4F3Q A;  3I59 A;  4CYC A;  2C6Y A;  2R5Z A;  3OYE A;  1WFX A;  1U5T B;  3JSO A;  1J09 A;  2DTZ A;  1H88 C;  4JX5 A;  3FXR A;  2ZJR F;  1ZR4 A;  2OF7 A;  2UUZ A;  3GTM J;  1BW5 A;  2OQG A;  1MMN A;  3GWZ A;  4CH7 A;  3HHH A;  1YOV B;  1HC8 A;  2ZNY A;  4C3J J;  1ZN2 A;  5CVV A;  1QQI A;  3EPZ A;  3HOW J;  3FBI B;  4L9J A;  1SAU A;  3NAR A;  1KQ9 A;  1HW2 A;  4AID A;  1OCC H;  1P4W A;  2L7K A;  4Y7N J;  3DEU A;  3L2W A;  2Q8K A;  2V6C A;  5B3S H;  2EZL A;  5LRS A;  3ZN0 A;  5EG0 A;  4Z2Y A;  3G71 I;  5L3F A;  5IP7 J;  2FBH A;  3ZQC A;  5D8L B;  2G7U A;  3Q9V A;  3CUQ C;  4XOR A;  1ONV A;  3B73 A;  5LGU A;  1HF0 A;  1K61 A;  2HEO A;  5CVJ A;  4G7Z F;  4PJJ A;  4WXD A;  1F36 A;  2OPT A;  2A69 F;  2WBM A;  3S3M A;  2R7X A;  2VE9 A;  1DP3 A;  4EM1 A;  1OIS A;  1SVL A;  3M8E A;  3TBI A;  4ANJ A;  3L09 A;  2ZO4 A;  3F8N A;  2DI3 A;  3LNQ A;  4BKX A;  4BXF A;  1R22 A;  3DU5 A;  1ZK8 A;  2ZSH B;  3CP2 A;  1WGX A;  5E1Z B;  1W4M A;  2Y31 A;  4XOT A;  1BW6 A;  2HR3 A;  4UUS A;  4BE2 A;  1NH3 A;  1X3Z B;  3A03 A;  5DM6 F;  1HA8 A;  1SMY F;  1OCZ H;  2BV6 A;  5LEJ A;  2GM4 A;  3BQZ A;  1MIJ A;  2ZME C;  1ZRC A;  1WH7 A;  2D5V A;  1FZP B;  3U2R A;  2CWE A;  4XRS G;  2J5O A;  5M3F J;  3K4K A;  1QZZ A;  2W25 A;  3TL4 X;  3I59 B;  4CYC B;  2XPV A;  4XKW A;  2R5Z B;  3NWT A;  4XRS A;  3HM5 A;  3C3W A;  2EIJ H;  3H92 A;  3ML6 A;  3J7Y J;  4CZZ A;  2LF7 A;  4HNV A;  3CD6 I;  4Y4R A;  2HZD A;  1WKM A;  1BM9 A;  2GA1 A;  3BTC A;  5A2Q K;  1WJB A;  3OOP A;  3QPS A;  2GWR A;  1S6L A;  1RKT A;  2XF6 A;  3G2B A;  1R23 A;  5FFZ A;  4A6E A;  5K7H A;  4LK1 F;  1YJW I;  1HCR A;  1S5L C;  2V7F A;  2O3F A;  1S7E A;  2X48 A;  1B8I A;  3VEP A;  2L9V A;  3OYN A;  3F8M A;  2VLA A;  3L2U A;  1VZ0 A;  3M9A A;  5EG0 B;  2HVR A;  2VXZ A;  3QP5 A;  4CO8 A;  2K9L A;  2P5K A;  3BR2 A;  3I9V 2;  1MNM C;  4GFB A;  2G0E A;  2K9Q A;  3OYA A;  5JHU A;  5DM7 F;  2EBI A;  4V19 K;  2VT2 A;  3OYL A;  3EYI A;  4L9T A;  4OIO F;  1KQ0 A;  2HYG D;  3P9C A;  4R1H A;  5FO5 A;  2H8R A;  1IUY A;  1LEB A;  1KYZ A;  5M5Y J;  5M3M J;  1QZY A;  2WV1 A;  5LEK A;  5EGO A;  3RPU A;  2GA2 A;  2KLO A;  3I54 A;  2VB6 A;  1VQ7 I;  4XQF A;  3BJA A;  9ANT A;  2R7Z J;  4KIS A;  3O3K A;  2DFE A;  2I5U A;  3CJR B;  5HOD A;  3EUK L;  2R7Q A;  1IF1 A;  4UUS B;  1WHU A;  3BWG A;  3MCZ A;  2DMQ A;  4XLC A;  5FKL A;  1ZLJ A;  4LB5 A;  1VI0 A;  5IOZ A;  3IWF A;  3CCQ I;  2V1D A;  4XON A;  5E17 F;  1ZGJ A;  1T33 A;  3TED A;  2HOA A;  1FIA A;  3PL8 A;  4M6Y A;  3N4M A;  4C3I J;  1ITY A;  2CUE A;  2O7O A;  3TW6 A;  3S2D J;  4L0Z B;  2HU9 A;  3JRB A;  3K4J A;  2MD5 A;  1F43 A;  2R7F A;  5J1U A;  5DDG A;  2Z2S B;  5E3N A;  2JVG A;  2V1U A;  2O03 A;  3DTK A;  3AL0 B;  4P55 A;  1IXR C;  2BHZ A;  1A6Q A;  1YYV A;  3A0B C;  1YTY A;  1GHC A;  3SQN A;  3E1S A;  2CU7 A;  4ITV A;  4YFN F;  3TW7 A;  1J59 A;  3E3V A;  4BE0 A;  3NQO A;  1XPX A;  2LP0 A;  5JR3 A;  2LY1 A;  3VPR A;  4QIW N;  1F9N A;  2CV1 A;  3DXJ F;  1YIJ I;  1PDN C;  1YS6 A;  2XAS A;  2Y75 A;  5FKM A;  1DU6 A;  3BR6 A;  3GCM A;  1XDU A;  1B8I B;  2JT1 A;  3BC8 A;  3BT9 A;  1ZGA A;  2EFN A;  3E6C C;  1XTA A;  5J47 A;  1Y8Q B;  1EJ9 A;  4A3D J;  4D1Q A;  4IQJ A;  3HTS B;  2DT7 B;  3JRC A;  3HXL A;  2XVC A;  3LSJ A;  3BG7 A;  3IAS 2;  2PN6 A;  4KFC A;  2RRE A;  3KEQ A;  4FQG A;  5IY5 H;  4YEL A;  2IS1 A;  4A2U A;  3M8F A;  3SFI A;  1D0X A;  3V8J A;  4DOZ A;  2WAF A;  1FTZ A;  2L7Z A;  5IYC J;  3ZN1 A;  3CMA I;  1SAN A;  4UHT A;  5EGO B;  4UVA A;  1TWC J;  2R5Y B;  4Y33 A;  3W2W A;  2OV7 A;  1V54 H;  5D8K B;  2QBY A;  4I99 C;  1Z67 A;  3KPH A;  3CCE I;  3BG6 A;  3M1C A;  4I0B A;  3HL2 A;  1V3F A;  3F22 A;  1GV5 A;  2L2O A;  3G3Z A;  3L9F A;  4L9N A;  3CLQ A;  2DJI A;  3DPL C;  4QPQ A;  1KU7 A;  3SYT A;  3DEW A;  2XGD A;  3O6B B;  3QYE A;  3JAM Z;  1UEL B;  2L4A A;  2VL8 A;  2VPR A;  2BBY A;  3TOB A;  5FD5 A;  4M3G A;  4BQA A;  1FOK A;  4BQO A;  3DKX A;  1T39 A;  2MH9 A;  2XGE A;  4BAY A;  3BRO A;  3FMR A;  2JMW A;  3QOE A;  3CCV I;  3HSF A;  2KDZ A;  3V7R A;  1UAA A;  4HQE A;  4HF0 A;  3JTG A;  2P8T A;  2H1K A;  3QPL A;  1IZ1 A;  3GLX A;  4B8X A;  3WTV C;  1SFK A;  4AD9 A;  1VF9 A;  4F55 A;  4DYR A;  2QZ8 A;  4XRM A;  5DCF A;  5E3O A;  1LNW A;  1YIO A;  2STW A;  1QRY A;  3O8H A;  3L2Q A;  3CJN A;  1G6N A;  2Z99 A;  3CTA A;  2OTJ I;  2IS6 A;  3DPU A;  2ETH A;  3GUD A;  5CYV A;  2L5Q A;  3TP3 A;  2CS3 A;  3GZ6 A;  4X6A J;  3H9J A;  2M7A A;  4P5O A;  4A3B J;  1E3H A;  1XC5 A;  5EEH A;  1X3W B;  4ZZL A;  5FB2 A;  3OYH A;  1F5T A;  5B66 C;  2HOT A;  3F8B A;  4KUM A;  4LFU A;  4RGS A;  3OYC A;  3RKQ A;  2D1H A;  5EEA A;  3D5S C;  3DU6 A;  3KZY A;  5IYD J;  3CO7 C;  3KP4 A;  4A5M A;  2WAE A;  4I76 A;  5EZG A;  2NVU B;  2OZU A;  2DOA A;  3IHU A;  2F5F A;  1QZE A;  2KZV A;  4WK8 F;  4GYG A;  3ZQQ A;  2XSJ C;  4IO9 F;  2QBY B;  4CIC A;  1HKQ A;  2KRH A;  2W1O A;  1ZRD A;  3T0Y A;  3KYC B;  2EIM H;  4E7S A;  2MYS A;  3WGH A;  4YIR X;  1Y0U A;  4ZTJ A;  3D1N I;  1RZ4 A;  3FXJ A;  1B4A A;  4XOP A;  3LQR A;  3ZMT A;  4A0X A;  1WJD A;  3WTZ A;  1K6Y A;  1R5I D;  1XMX A;  1HKS A;  1W36 C;  4XSX F;  3E5U A;  3I56 I;  2N8G A;  3CCJ I;  4KMF A;  1O57 A;  4AM3 A;  1FPQ A;  4PFP A;  2QUF A;  3J7A O;  3ZR8 X;  1TQP A;  2A6H F;  4M73 A;  2VOO A;  2VQC A;  3Q0U A;  4MNU A;  4J00 A;  1BIB A;  4G7O F;  1T2K A;  1LB2 A;  2EK5 A;  2ID6 A;  2LKX A;  3QPT A;  1KON A;  1ZG5 A;  2FNP A;  2JRT A;  4LG3 A;  3RIR A;  2QVO A;  1L3L A;  2VON A;  4XL9 A;  2ECC A;  2BW3 A;  5J4Y A;  2VAS A;  2CQ7 A;  1TBX A;  4BYY A;  2PEX A;  4L5E A;  2Y48 A;  2QQ8 A;  4XKB A;  3RYP A;  1FP2 A;  1UMQ A;  2GOM A;  2GQQ A;  2E1M B;  5HOO A;  4AIK A;  2DU9 A;  3BR3 A;  3L2V A;  1Y1W J;  1IXC A;  2CMP A;  5DUK A;  3DEE A;  3KEO A;  1U5T C;  4UV8 A;  5ERI A;  2EIL H;  2IPQ X;  1TL8 A;  3TO7 A;  3B6A A;  1IDZ A;  3PNY A;  2VQG A;  4KT5 C;  2KHM A;  1O3S A;  1IO2 A;  4DBR A;  3HTU A;  3RYR A;  2IJL A;  2AQE A;  2E19 A;  2F5V A;  4IHY A;  2EIK H;  3HJE A;  3F0C A;  4ZYG A;  4XSZ F;  4S05 A;  2MAB A;  5M5W J;  3W2V A;  4NNJ A;  3S1N J;  1D5V A;  3CJQ B;  2AXL A;  4BS9 A;  1S29 A;  2XHK A;  4FET A;  1KQ8 A;  5L3D A;  1U2W A;  1T0F C;  3CP8 A;  2OJE D;  1B72 A;  5TGT A;  4RGR A;  5GPC A;  4KMU X;  5HS8 A;  1QGP A;  3KX2 A;  3IWZ A;  4GRI A;  1I27 A;  4BQQ A;  1W1W E;  1W0T A;  2IBD A;  5K7Z A;  3X2Q H;  3OYM A;  1ZG1 A;  3VYU B;  1PUF A;  1ZQ3 P;  1U9N A;  2VBZ A;  2H6B A;  5CPR B;  4NB5 A;  1X2N A;  3HKZ N;  1KU2 A;  3K4N A;  4A6D A;  1R36 A;  3KP2 A;  3OS1 A;  1IGN A;  2O6G E;  5CKT A;  2EV0 A;  5H6R A;  3E6M A;  5JLX A;  4XMY A;  3S2H J;  4Y15 A;  3KZZ A;  1IN6 A;  4ZYA A;  2COM A;  5EYR A;  2GXB A;  4M9X A;  1OFC X;  2DCE A;  2J5P A;  1ZTR A;  1FSE A;  3K70 C;  5AON A;  4P96 A;  4PJN A;  2Z9O A;  1WI9 A;  2VQH A;  3DWL E;  5F0C A;  2BY0 A;  1MW7 A;  2CQK A;  3LSG A;  3S14 J;  2KRF A;  2BW3 B;  2NAZ A;  1TLH B;  3ABT A;  3A02 A;  4HX4 A;  4BJ6 C;  2XAJ A;  4UUT A;  4F92 B;  2IW5 A;  4XNF A;  3QOP A;  4Y3O A;  4E7L A;  3QAH A;  1U8B A;  3LWF A;  5A2Q Z;  1SFX A;  2PBI A;  4PUS A;  4UXN A;  2QLZ A;  1FBQ A;  3VYT B;  4ESJ A;  4B48 A;  2RC4 A;  1YHQ I;  3PUF A;  1GLN A;  2JJ7 A;  3WOD F;  4G7H F;  1VQ8 I;  4XK4 A;  4L5J A;  3K6G A;  1IG7 A;  4N4N B;  3JTH A;  2MLG A;  3GZ5 A;  1UST A;  4B09 A;  2X85 A;  1K4S A;  2MD0 A;  2JTV A;  1D1B A;  1XX5 A;  5ILV A;  3JAM K;  4FT8 A;  4A3J J;  2FXA A;  2DXI A;  3FXK A;  1W36 D;  2KIM A;  4AIJ A;  2XF5 A;  5E79 C;  2JA7 J;  4A3C J;  1B72 B;  2R0Q C;  3K2A A;  3BJ6 A;  3H9G A;  3B6C A;  2X6O A;  3SZG A;  2A68 F;  4EJU A;  1P7J A;  4EAT A;  2HXI A;  3UNG C;  3WGG A;  1U8R A;  2ZNZ A;  3R0J A;  2AHQ A;  2E2I J;  3I4M J;  1D5Y A;  5ICE A;  2BY3 A;  2L9R A;  4IL6 C;  1PUF B;  2V1N A;  1ZRF A;  3DFG A;  3GEZ A;  3MVP A;  2BY1 A;  3BJO A;  4PCQ A;  4BJT A;  3CUO A;  4HLY A;  2F4M B;  4D9J A;  2ADU A;  1FTT A;  3BG3 A;  4DIQ A;  3OYJ A;  3JCU C;  3MZY A;  1VQ5 I;  3VFZ A;  2MA3 A;  3LSR A;  3TO6 A;  4MEY F;  2P7V B;  1JHH A;  4DGW B;  4MTD A;  4EM0 B;  1YLF A;  1P4A A;  1NG6 A;  1JJ6 C;  4W97 A;  1BOB A;  3P9I A;  5JVG F;  2KDO A;  2OCC H;  1RR8 C;  4HST A;  2K3F A;  3ECH A;  2FQ3 A;  1U9O A;  2HQR A;  3Q9S A;  2LTP A;  5HNF A;  2CJJ A;  2K9N A;  1VQ9 I;  4KIF A;  5FLX Z;  2GOX B;  3WTS C;  1QU3 A;  3AKZ A;  1HDD C;  2WY7 Q;  1R1T A;  1ZRE A;  2F5E A;  4IQ4 A;  3AL0 C;  3S16 J;  1E17 A;  4M3F A;  3GX4 X;  1JKQ C;  2VC1 A;  1XCV A;  4ZTF A;  2EFP A;  1G3Y A;  5IT9 Z;  1UG2 A;  4CCL A;  3L2C A;  1AA7 A;  1DUX C;  3WE2 A;  4OOI A;  3DBH B;  1HW5 A;  2M0M A;  1A36 A;  1Y56 A;  4L9V A;  1XCB A;  4BE1 A;  3FK6 A;  5IT3 A;  1BR2 A;  3BR5 A;  2IA2 A;  1DDN A;  2LY2 A;  2A07 F;  1TWA J;  1S9H A;  1RI7 A;  2W82 A;  4UVC A;  4GCV A;  4Q4Z F;  3H5A A;  1BJZ A;  2DO7 A;  2ZXJ A;  5GPA A;  5J3L A;  3A01 A;  3WU2 C;  3HDD A;  3PSF A;  3F6V A;  4J01 A;  2ISY A;  3ABM H;  1W5T A;  1WQ2 A;  4XID A;  3U9G A;  1MH4 A;  4N9H A;  3HGG A;  3H3Z A;  1MH3 A;  2IGM A;  2D1V A;  3K70 D;  3PO3 J;  1MBF A;  1IN7 A;  1POG A;  4IRH A;  4RB0 A;  2ZJQ F;  2CUF A;  2Z5U A;  1SD4 A;  2VC0 A;  3FXO A;  2HPM A;  1BI1 A;  4BBR J;  3GTK J;  5DTD A;  1X3U A;  4N9I A;  4TV7 A;  2NNY A;  4FTH A;  4KT6 A;  4IRG A;  4Y52 J;  2FBK A;  3HRS A;  1T95 A;  4QTR A;  1R9T J;  2DMT A;  3HOT A;  2CV0 A;  2E2H J;  5H6Q A;  1GVJ A;  2A61 A;  3PM1 A;  4AVP A;  4WXC A;  3IH4 A;  3CJT B;  5H20 A;  2ZKZ A;  1BC7 C;  5LLQ A;  1HDP A;  3IKT A;  2O0Y A;  2M7B A;  3FIS A;  2EFW A;  2L54 A;  5LGN A;  2GZW A;  3WTU C;  2CFX A;  2YPR A;  3KLN A;  1NTC A;  2GIV A;  4U87 A;  2HPI A;  1RKW A;  3HSE A;  5E1W A;  4ZDP A;  2V6E A;  1Z6T A;  2L01 A;  1BOA A;  4JQF A;  2IP2 A;  2XRO A;  1RPW A;  3RCO A;  5ILS A;  1D1C A;  2M30 A;  1XSD A;  3I58 A;  3QU6 A;  1TW2 A;  2Q0O A;  2K4B A;  3OR2 C;  5JLW A;  1LJ9 A;  1ACI A;  2HFH A;  2ELH A;  1OR7 A;  1FOY A;  1ETX A;  2GXG A;  1D3Y A;  5DUI A;  1OKR A;  2IT0 A;  2NXN B;  3N97 A;  5F1R A;  4O6J A;  1YW7 A;  3PNV A;  2DMU A;  2QGU A;  5F64 A;  2V1X A;  4UVB A;  4Y17 A;  4P9F A;  2V9V A;  4NC8 A;  4BEH A;  2UXN A;  1EF4 A;  3ERE D;  1USS A;  4I0A A;  5DD8 A;  4FCY A;  4IRI A;  2CW7 A;  3FZV A;  3K9T A;  2D2W A;  2V4J C;  4ENJ A;  2FF4 A;  4P1W A;  4A93 J;  1JI8 A;  2FRH A;  1TWH J;  2PQ8 A;  4FE7 A;  5E1X A;  4C2M J;  4EEF G;  4ESF A;  5L3B A;  3A01 B;  2L7F P;  2CW0 F;  3ABK H;  4PGG A;  5DEQ A;  5D4S A;  2XAU A;  4BGD A;  2ZXI A;  3TGN A;  4JOM A;  1XD7 A;  4YFK F;  4FX0 A;  2ZJP F;  2BZT A;  1BJA A;  1YX5 A;  3ZCO A;  1SEU A;  1R71 A;  4XLP F;  1Z77 A;  2D45 A;  1W5S A;  4G6D A;  1ULY A;  4L18 B;  1MJA A;  2Q2E B;  3HHG A;  3E97 A;  4KIT B;  1ETK A;  5GAD J;  4G6Q A;  1HXD A;  4A3K J;  3GF2 A;  4MIM A;  5FD6 A;  4ZH4 F;  3JRD A;  2BXZ A;  2L7M P;  1O7F A;  4Q47 A;  2ZFU A;  4HX7 A;  1Z0X A;  1IW7 F;  4M6V A;  3SJM A;  4IHX A;  5BPD A;  4X0G A;  3RDI A;  1FBS A;  3H1C A;  2WC2 A;  5IPA A;  3HEF A;  3IH3 A;  4YFX F;  1MZB A;  2K9M A;  4D0P A;  2OQR A;  2M3A A;  3EET A;  1J5Y A;  1UZC A;  3MN2 A;  4YEJ A;  4KA4 A;  4PSX A;  5K5O A;  1KU3 A;  4ZYE A;  3DTE A;  5B1A H;  2FD5 A;  4RM2 A;  3O2P E;  1K7A A;  4E7H A;  1LVA A;  4DW6 A;  4RB3 C;  4KNY A;  1TQM A;  4ON0 A;  1OCT C;  2BEO A;  3R60 A;  1RUN A;  4OWR B;  2ZB9 A;  5ED4 A;  1Y39 A;  4M9Z A;  4V2F A;  3M3Y J;  1R1V A;  1QA6 A;  3PQK A;  3IH2 A;  4UV9 A;  5C44 J;  2E1O A;  2MH2 A;  3BCA A;  3RQI A;  4UY8 I;  3MWM A;  4HV5 A;  2B63 J;  4B44 A;  4MQV A;  4BEH B;  5EJC A;  3G1L A;  4G9Y A;  2VN2 A;  2K7L A;  1H8A C;  2R93 J;  1DGW Y;  5C3E J;  4D5F A;  2R5Y A;  4EM2 A;  3ECO A;  1FYM A;  2EA4 A;  3QQA A;  2VKV A;  1Z7U A;  2M1B A;  5HS7 A;  3GLL A;  3OS2 A;  1TNT A;  3MKY B;  1EA3 A;  3GTJ J;  2RQQ A;  1RRJ A;  3T8R A;  3BTL A;  3NAU A;  1ETY A;  2E1M C;  2VIX A;  1SVM A;  2HXO A;  3QYF A;  1H89 C;  3A0H C;  3FMQ A;  3Q5F A;  1FJL A;  1RUO A;  4L0Y B;  2COB A;  2KL4 A;  3K2Z A;  1VFC A;  2V26 A;  2HI3 A;  2NS7 A;  4I02 A;  2LC2 A;  1X1C A;  1TTY A;  3HG9 A;  3Q3S A;  3CCL I;  3S1R J;  5K1Y A;  1IN8 A;  5F0H A;  2KQR A;  4E6K G;  3LAJ A;  4HRI A;  4YG2 F;  5FLX K;  3FKI J;  1YRN A;  1PP7 U;  3PO2 J;  2M87 A;  4E7K A;  4II3 A;  4S04 A;  3W3C A;  1C0W A;  1JT0 A;  4RLQ A;  3K0L A;  1VQ4 I;  2CQQ A;  3T8T A;  4IHS A;  2L9N A;  4LIU A;  4XKC A;  1AWC A;  1U0J A;  1H9G A;  2QYO A;  1XSX A;  2FJ1 A;  4FX4 A;  2M8G X;  4HF2 A;  1SAX A;  3GO5 A;  2UWM A;  1HST A;  2YR2 A;  3V7C A;  1JTY A;  3BQY A;  3HOV J;  3JRG A;  3H36 A;  3HBL A;  3GTL J;  1ETV A;  5IT9 K;  1BI0 A;  3VSK A;  1JGG A;  5HDK A;  1J75 A;  2E71 A;  3AG3 H;  1AHD P;  2DPD A;  3C1D A;  5K5R A;  2OC6 A;  2NRA C;  2EIN H;  2P6T A;  3JW4 A;  3S17 J;  2AO9 A;  2ICW G;  3HSR A;  1OCO H;  3G4S I;  4EJO A;  2BE5 F;  3ZMZ A;  1IC8 A;  3OR1 C;  1S7O A;  3I3L A;  1XS9 A;  1DP7 P;  3AG4 H;  2GIZ A;  1Q1H A;  3WTT C;  1X58 A;  2Y30 A;  3K4M A;  1G3S A;  5ILU A;  4Q5S F;  4UB6 C;  3ABL H;  1TQI A;  4DYC A;  2VBX A;  1ZEL A;  2HGC A;  3BG5 A;  3D5L A;  3F8C A;  3TDZ C;  2ZXW H;  4IOC F;  1APL C;  4ZZD A;  3CF2 A;  2ZJ2 A;  3DF8 A;  4M3E A;  2GAU A;  4H4K C;  4I98 B;  4CHU A;  4BL0 B;  2ZME A;  3CMY A;  2G9W A;  4XLE A;  2BY2 A;  1R6R A;  2FUG 2;  1X1A A;  3RI4 A;  4OAY A;  4B3A A;  2ACJ A;  1SFO J;  2K02 A;  1O3R A;  1RIO H;  3L7W A;  3TKY A;  5D5U B;  2W57 A;  3SHF A;  2W7N A;  2JPC A;  2VOD A;  3KCC A;  3F9K A;  2CH0 A;  2HVQ A;  3DBL B;  3V8L A;  4IJA A;  5B5E C;  1K83 J;  2FBI A;  3DV8 A;  5FJ8 J;  2HS5 A;  1ZKG A;  3FHZ A;  4D5C A;  1B59 A;  5LD2 C;  4BJ5 C;  4CA0 A;  3HOY J;  2XF7 A;  4CDG A;  3JSP A;  4ENN A;  4BAC A;  1D8J A;  1R49 A;  1IN4 A;  5AIP A;  1TW3 A;  4Q48 A;  2F5C A;  1JHF A;  3SZP A;  2DT6 A;  4FIS A;  5TRD A;  2YS9 A;  3FM5 A;  3HB9 A;  5HLI A;  1MNE A;  4XBF A;  3FBN B;  1YRN B;  2JN6 A;  4QWQ A;  1F1Z A;  3I55 I;  3I0T A;  2LH9 A;  5EF6 A;  4ZDO A;  1RC9 A;  3FF5 A;  2R7T A;  4RGX A;  3MZH A;  2F5D A;  1XMK A;  4NDL A;  5J1Y A;  3QPH A;  1GXP A;  3HPH A;  1Z1D A;  1N78 A;  1FBU A;  2XRN A;  3DBR B;  1BIA A;  3CUQ B;  4PJL A;  5LFA A;  1TC3 C;  2RNJ A;  1B9M A;  1MGT A;  2JSP A;  4CGZ A;  1YO5 C;  4LOC A;  2NS0 A;  2DYS H;  2VJI A;  3BZK A;  2DA4 A;  2LOO A;  2LRE A;  1DQU A;  2DQL A;  3M07 A;  2A3S A;  3J80 Z;  3IL2 A;  4UUV A;  4FE4 A;  3N05 A;  2EA2 A;  4M74 A;  4I2O A;  4MTE A;  4IOA F;  1U6G A;  2IAI A;  4N4O B;  4EJT A;  4GXO A;  3JRE A;  1K79 A;  5DCM A;  4WX9 A;  3DQV C;  4PFO A;  2VT3 A;  5ICF A;  3KE2 A;  4RAG A;  2OTL I;  6PAX A;  5BNG A;  4BY7 J;  4RGU A;  2XAG A;  5E3L A;  1BA5 A;  4IKF A;  2ZME B;  4G6T B;  5HVQ C;  2E2J J;  2HTJ A;  2STT A;  2F48 A;  4U0V A;  5D5X B;  1QVU A;  1NHA A;  4U0W A;  4U0Y A;  4G8X A;  1B6A A;  4HAM A;  4IHV A;  1D1A A;  4BUP A;  1Y0N A;  4AYB N;  2L4M A;  1IRF A;  1H9T A;  4LK0 F;  3R6S A;  1LEA A;  3OL3 A;  3CDH A;  1REP C;  1D0Y A;  1YI2 I;  3M4O J;  2RDP A;  1OCR H;  1I1S A;  2BHY A;  2JPB A;  2DA5 A;  3RKW A;  4NC6 A;  1PVE A;  1O4X A;  4F91 B;  2KP6 A;  1G3T A;  2HWV A;  2OCE A;  2NVT J;  3EUA A;  3SFZ A;  3F23 A;  3K1N A;  4E7Z A;  2M4K A;  4RA2 A;  4HG2 A;  4M9S A;  4CCO A;  5FLV A;  2X4H A;  4HA8 A;  5E8G A;  2ECB A;  2QCO A;  2WWY A;  4DQ2 A;  2Y2Z A;  2P4W A;  4OAZ A;  2H1L A;  5LGT A;  3HOX J;  1J0R A;  3PUB A;  2IRF G;  5KAI C;  1JUM A;  3EUH A;  4RAF A;  1YS7 A;  2E60 A;  2QF7 A;  2CFO A;  5HLT A;  1X1P A;  4OMZ A;  2ESN A;  2EJR A;  2OBP A;  1V5F A;  3ZMD A;  3E6B A;  1IAW A;  2V9P A;  3S93 A;  3Q0W A;  1U3E M;  5DCM B;  1Z05 A;  3VYR B;  3BLY A;  2LLK A;  1BR1 A;  2L0K A;  3VB2 A;  2KFD A;  4CCM A;  4KIB A;  1FOW A;  1LFU P;  1EH6 A;  2K3P A;  3OYK A;  3GTQ J;  1LFB A;  1T98 A;  4AYB A;  5J1R A;  2WAD A;  3KIO A;  3KP3 A;  4E7I A;  2RNG A;  1D8K A;  2LFB A;  3O8G A;  4GO1 A;  2LKS A;  4EQQ A;  3IKV A;  1X4O A;  2LR8 A;  3BCB A;  2PJP A;  1JXS A;  1UB9 A;  5IP9 J;  2NVX J;  4S0H B;  1LE8 A;  5CVU A;  2WY8 Q;  1R5G A;  4RM3 A;  3ZXS A;  1EV7 A;  2E5N A;  1ON2 A;  4HYE A;  2ISZ A;  3HC7 A;  4GDF A;  3RJP A;  2B0L A;  2XB0 X;  4A5N A;  1VND A;  2Q1Z B;  4PDK A;  4R8H A;  3A1Y A;  1V5E A;  4JP0 A;  2HDD A;  4MFD A;  3S3N A;  4JYK A;  3ZPL A;  1TT0 A;  2CW8 A;  3CME I;  3C7J A;  4ZYH A;  4IZZ A;  2ME6 A;  3U1K A;  2RV8 A;  1WJC A;  1IN5 A;  2JQ7 A;  1VQK I;  2R7D A;  4PZJ A;  4XIC A;  1JUS A;  2CGP A;  1VQN I;  3A2K A;  1VQ6 I;  5HNH A;  4EVI A;  3CCS I;  2FU4 A;  2QKM B;  2VI6 A;  4CCK A;  1PJR A;  2CV2 A;  3LSK A;  1SC7 A;  2HOS A;  2PMH A;  4WCG A;  1E0E A;  1FMV A;  1JUP A;  3CCR I;  2O5R A;  1JTX A;  2EZK A;  2LRD A;  3L1P A;  1HLV A;  2HYF A;  3W6K B;  4CXF A;  3OYD A;  2K4J A;  1SMT A;  3M7G A;  3IC7 A;  1UFM A;  1FP1 D;  4HEA 2;  1ZG3 A;  3J7Z I;  2HYJ A;  2HZT A;  1FLI A;  3GTO J;  1A35 A;  2KZG A;  2K9S A;  1QBJ A;  3MEX A;  1JE8 A;  3S1Q J;  4M3B A;  2XV4 S;  2A6E F;  3HOS A;  2RKH A;  5FRO A;  2LD5 A;  1K6O A;  2KPM A;  2X1C A;  4CSW A;  4E70 A;  5L3G A;  2MGQ A;  5ICG A;  1LKX A;  2QQB A;  3UKG A;  1XGO A;  3K4C A;  4XN0 A;  2W4S A;  1T56 A;  2A5Y B;  4ETS A;  3DPT A;  3OOU A;  3COA C;  2MLK A;  5F08 A;  2DDA A;  3LQQ A;  1ZR2 A;  2VKE A;  2EFO A;  4HBL A;  4ZJZ A;  3DKY A;  1MBJ A;  2FOK A;  1U78 A;  1P92 A;  3LFU A;  2DOE A;  1I5Z A;  4A3F J;  3CC4 I;  3W6V A;  3KZI C;  2MC4 A;  3HRM A;  1T8I A;  3OL4 A;  1X4P A;  3OMY A;  1YJN I;  2BOL A;  5IYB J;  1T6S A;  3J81 K;  2JRM A;  2P7C B;  4RDU A;  2AS5 F;  3S3O A;  3WE3 A;  2YU3 A;  4IEJ A;  3UR3 C;  1LE8 B;  1YIT I;  1N25 A;  1SD5 A;  3HKZ A;  2B7E A;  1W7P A;  3DTI A;  3GFL A;  2XGX A;  3K4L A;  5E8I A;  5ICC A;  4AWX B;  3R4K A;  3NWS A;  2P5V A;  4J19 A;  4IVN A;  2LDU A;  3JRI A;  2W84 A;  3VOE A;  1IDY A;  1Q1V A;  3I71 A;  3AG1 H;  1QPM A;  4OIQ F;  2VQL A;  2O61 A;  4CUG A;  2FMY A;  2M5W A;  1NK2 P;  4HQM A;  3ISP A;  2YUS A;  4LLG F;  3C2G A;  3HOU J;  4IF4 A;  5CQE A;  2IEK A;  5J40 A;  2EFQ A;  4BH9 A;  2BYV E;  3GW2 A;  4QSH A;  3KP5 A;  1A5J A;  3FXU A;  4X1E A;  3J80 K;  2DAO A;  1K78 A;  4KN4 X;  3WHB A;  1TZL A;  3PQJ A;  3FDY A;  1UHM A;  4G12 A;  2X6X A;  4MLO A;  3BR1 A;  2Y0S N;  2GXA A;  1LQ1 A;  2DN0 A;  1VQM I;  4HDU A;  2VXD A;  3H5N A;  4KYW A;  4F7Z A;  3H3U A;  1IV8 A;  5JFR A;  2QEN A;  1GDT A;  1S72 I;  2CQX A;  2P81 A;  3LMM A;  1ZH5 A;  2G7H A;  2EWN A;  2VPL A;  5LRR A;  1OYY A;  2P6S A;  3TMO A;  1AKH A;  4NC7 A;  2DFF A;  3S15 J;  4CCN A;  2V9K A;  3W6J B;  2Y69 H;  3IP4 B;  5C4J J;  1BC8 C;  4XLN F;  1O3T A;  4GYI A;  5FKO A;  1T0F A;  3SDG A;  3S8P A;  3IAM 2;  2FE3 A;  3I4P A;  3T1B A;  1ZYR F;  2LBF A;  2WB1 N;  1RNL A;  1LUJ B;  5GP9 A;  2DYR H;  3OIO A;  4A12 A;  3HRT A;  3HZJ A;  2M9H A;  1XN7 A;  4MGR A;  4XLH A;  1OMI A;  3FXL A;  2QKL B;  3BZ6 A;  1W7P B;  1P2F A;  2LNB A;  3KYL A;  2KIQ A;  5BQT A;  1MMS A;  2OZ6 A;  3S2W A;  2KIF A;  2M8E A;  4EMS A;  3WTX C;  2RQP A;  5D6F A;  1I3Q J;  2PFB A;  2VOP A;  4QPO A;  2XIG A;  1WCM J;  3OYG A;  3D5R C;  3LL7 A;  3ZQG A;  3H3V K;  2W00 A;  1YE9 A;  3NEU A;  2CYY A;  3FHN A;  3G1M A;  1YJ9 I;  5E18 F;  2YU9 J;  2XB5 A;  2DMN A;  1A6I A;  2Q2E A;  3ONQ A;  3GFJ A;  5KHD A;  2VBW A;  4KN7 X;  2Y0S A;  4WXH A;  5IP6 A;  2P0W A;  1Z21 A;  4ABZ A;  1VQO I;  3D0S A;  2QSG X;  1LVK A;  2JA2 A;  3G6E I;  1OYI A;  2Y0M A;  4ZC3 A;  3TP0 A;  4C2U A;  1JGS A;  2OAZ A;  4BDZ A;  2Y9Y A;  1K78 B;  2VJ4 A;  5E20 A;  1UHS A;  1X1D A;  4F93 B;  2QA4 I;  4IHT A;  3SXY A;  3ZP5 A;  1CGP A;  2JVH A;  2P5L C;  5FKK A;  4BBS J;  3BDD A;  3OV8 A;  3GFI A;  2IA0 A;  2DOF A;  2EH3 A;  5F1J A;  1RET A;  1MMD A;  4BU2 A;  2PX9 A;  1OJL A;  1MMG A;  2F6C A;  2CRG A;  5KAF C;  2LSO A;  1AKH B;  2KMU A;  2WB1 A;  3A4C A;  1ZAO A;  2Z16 A;  2VKD A;  4XRF A;  3KP6 A;  2BGC A;  2CO5 A;  2X0L A;  2QSF X;  4LLL A;  1MD0 A;  3F6O A;  2RAE A;  5BPI A;  2HTS A;  1XGN A;  3BR0 A;  2LBF B;  5K5Q A;  1TWG J;  3BTI A;  1AOY A;  1WH5 A;  3C18 A;  4A3E J;  4LIT A;  2OA4 A;  4HX8 A;  3OSG A;  3ROU A;  3MMY B;  3R0A A;  1FNN A;  1OPC A;  2TDX A;  1IUF A;  3U21 A;  2KIU A;  4Y13 A;  1YW9 A;  5FRM A;  2E35 A;  2JWT A;  4UNO A;  2IGN A;  4A3I J;  1EH7 A;  1IJW C;  2K27 A;  3FWE A;  3BTJ A;  3GME A;  3H0D A;  2HDC A;  3H5R A;  5IOY A;  1QHG A;  1OQY A;  2DJN A;  2ZFW A;  5HDG A;  2LY9 A;  2PI0 A;  3AG2 H;  2VKH A;  3GZN B;  2PMZ N;  3K1M A;  4PSW A;  2JA8 J;  2I8D A;  5JI6 A;  3HYI A;  1BI3 A;  1KA8 A;  4P9U A;  2DA7 A;  5C4X J;  2MFZ A;  3GFM A;  2IVM A;  2ZC2 A;  3ULQ B;  3ZQ7 A;  3CDL A;  3CCM I;  5HLH A;  2RN7 A;  2XSD C;  2DK8 A;  4JX6 A;  3DKW A;  4E7J A;  1SD6 A;  4AUX A;  1E3P A;  3KP7 A;  2A6T A;  3K1P A;  3DLA A;  4ENK A;  2CUZ A;  3DLL F;  2OD5 A;  3E6D A;  4PGH A;  1DU0 A;  2H8W A;  1FY7 A;  1OCP A;  1WJ5 A;  3F72 A;  4II2 A;  2JSC A;  2HVS A;  3ZGK A;  4I6Z A;  1HBX G;  3CQZ J;  4PJM A;  1S8N A;  1STZ A;  2FX0 A;  1J7K A;  1YFH A;  5FKN A;  3MKL A;  2PG4 A;  2EPF A;  3I53 A;  3LSM A;  1JT6 A;  4BXX J;  3MAJ A;  3TO9 A;  4PK4 A;  3U1D A;  1X1B A;  3MQ0 A;  2KJB A;  2M2E A;  1HKT A;  2DT5 A;  3ZQF A;  3CMM A;  4WWC A;  3SZT A;  4A0Y A;  1G2H A;  2XKO A;  1XGM A;  2R4G A;  1MBG A;  3K4B A;  1WRJ A;  4UB8 C;  2YSR A;  2JA6 J;  1V55 H;  3H35 A;  3ZQH A;  4ENM A;  3LSI A;  1WJF A;  2HQ5 A;  4RB1 A;  4AU7 A;  2ZCW A;  4EGY A;  2HOE A;  3CES A;  3LSH A;  3PIO F;  2NVQ J;  1FC3 A;  2UZK A;  1A04 A;  2E34 A;  3VDX A;  4RBO A;  1FMW A;  1ODD A;  1N75 A;  4G94 A;  2GBY A;  1ON1 A;  2R3S A;  2DA6 A;  3MKZ A;  1S7A A;  4BHP A;  3QP6 A;  2PMZ A;  3ZMU A;  4EJV A;  3IRR A;  2X9D A;  3ELK A;  5J8C A;  3J7A Y;  1FEX A;  4RAZ A;  5BMZ A;  2IGK A;  2X51 A;  1WZ2 A;  2M0C A;  1WJE A;  4MEX F;  2CQN A;  2XC7 A;  3V4G A;  3RPU D;  2JK3 A;  1H0M A;  1I6H J;  4FAS D;  2K86 A;  3ERM A;  2A5W A;  1J9I A;  2TRT A;  3PJR A;  4RLF A;  1R4M B;  3EDP A;  2L9S A;  3NRV A;  5BOX A;  3B02 A;  1GVD A;  4IPA A;  3FX3 A;  3CF5 F;  4BDY A;  4XR6 A;  1ETQ A;  1I1G A;  1FSH A;  4O3M A;  1YQA A;  1RES A;  1IRZ A;  1JKR C;  3WTY C;  1YG2 A;  3REO A;  1ENH A;  1G3W A;  5J8F A;  4LG0 A;  3KET A;  1ZGW A;  3EYY A;  4B4C A;  3QWL A;  3CUQ A;  2LG4 A;  3KFW X;  2EB7 A;  2QEX I;  3ESW B;  2EQR A;  3FK7 A;  1HQC A;  3RPQ A;  1Z3X A;  3JRH A;  2UXX A;  4CZC A;  4BHC A;  1PYV A;  1XMA A;  1NK3 P;  3GTP J;  3BPX A;  2Y9Z A;  3FMS A;  1UJ8 A;  4IX7 A;  3WHC A;  5GAG J;  2JA5 J;  4A3L J;  2ZSI B;  3R61 A;  2NOG A;  5F6F A;  3OIP A;  2M4G A;  4M72 A;  2WAQ N;  3OYF A;  4B43 A;  1ZLK A;  2LF8 A;  4EGZ A;  2HNH A;  4WF2 A;  1IV6 A;  2PMU A;  3HRU A;  3LOC A;  3TQN A;  1YW8 A;  3I4N J;  3TDU C;  4KDP A;  1LFP A;  3KYD B;  1KYW A;  1IRX A;  2R7V A;  2FQ4 A;  2O9L A;  3OYI A;  5HLG A;  3EUH C;  1VTN C;  4A3M J;  3LA2 A;  3E7L A;  1MSE C;  4H0E A;  4AVZ A;  3AFH A;  3VSL A;  4ASN A;  4YRV A;  2X1D A;  4OIR F;  5EDN A;  1XB4 A;  5DS9 A;  1SFU A;  3BOQ A;  2XRL A;  2MSY A;  3E5Q A;  3GXO A;  5F0F A;  3QOD A;  3IRQ A;  2XGC A;  3J81 Z;  1FOX A;  2TCT A;  3E0J B;  2Z1D A;  1LPQ A;  2QQ9 A;  3G1O A;  3ZMV A;  3WU1 B;  3WGI A;  4B3X A;  3RQ4 A;  3FXM A;  3PNT A;  4KJZ A;  4DNC A;  1QPI A;  3G73 A;  2DTR A;  3PFI A;  1MBE A;  1R5H A;  1MDM A;  2R7S A;  2ESH A;  4B47 A;  1HOM A;  4LG0 B;  1WPK A;  4XN3 A;  1DPU A;  5CQG A;  1IXS B;  4LD5 A;  3VOD A;  3W2A A;  2HDW A;  5H2F C;  4OIP F;  2DFH A;  5L3E A;  2F4I A;  1MJB A;  5EEG A;  1XGS A;  3V8K A;  4L5I A;  1O7L A;  3ABU A;  3RKX A;  4RMN A;  3K69 A;  1ETW A;  2EZI A;  3F8F A;  1FWZ A;  4K2E A;  1TWF J;  2K85 A;  4CYD A;  3LA3 A;  2WAQ A;  3BP8 A;  3DCF A;  1Z7L A;  1S3J A;  2IS2 A;  2YX7 A;  2W85 A;  3F3X A;  2LVS A;  2F2E A;  2FOW A;  2H94 A;  2XDV A;  3I5U A;  5F04 A;  1JKP C;  1BBY A;  5AIQ A;  4LB6 B;  2O8K A;  1ETO A;  1GV2 A;  1EKE A;  1G4D A;  3WU0 A;  4MQ9 F;  3LSP A;  4V2G A;  2XUB A;  1MSF C;  3QU3 A;  2X1E A;  2LYC A;  3E5X A;  5FFX A;  4DJA A;  2OUM A;  3IV5 A;  1P7I A;  2DFI A;  4HSR A;  2WV0 A;  1MJ9 A;  2X6Y A;  5B1B H;  4HW0 A;  1Z3Y A;  3CLO A;  1V5G A;  2R7R A;  2R7U A;  3S32 A;  2PJR A;  5FRN A;  1P4X A;  1B1B A;  3WG7 H;  4C30 A;  1GUU A;  1R58 A;  3JRF A;  4OMY A;  3RTR A;  2Z33 A;  3OWT A;  3ZRG A;  4CCJ A;  3M8J A;  4BHB A;  4FHT A;  4Z6Y A;  3PFY A;  4I7H A;  1GT0 C;  1WVR A;  4I09 A;  4HNT A;  3OY9 A;  5CJ9 A;  1E3O C;  3LA7 A;  3TOA A;  2LKP A;  2ELJ A;  1MDM B;  3VYS B;  3QYB A;  3SEQ A;  2R7W A;  3L2R A;  2W24 A;  2IS4 A;  1X2M A;  4HF1 A;  1R00 A;  2FEZ A;  2FNA A;  4U7D A;  1PUE E;  3M1E A;  2L02 A;  3K10 A;  1W0U A;  3MFK A;  3SEZ A;  3P5J A;  2ZXH A;  2JUG A;  1KZH A;  2H09 A;  5KCM A;  3ZQI A;  3LAP A;  2E7X A;  2LK2 A;  1I50 J;  1Y8R B;  4D7M A;  3JRA A;  2MG4 A;  3HIF A;  1F4K A;  2DA3 A;  3WG9 A;  5GTH C;  1BR4 A;  2QSH X;  5JHF A;  4EJW A;  4MHG A;  4C3H J;  4RS8 A;  4YII A;  1EH8 A;  1MMA A;  4IXA A;  2AXT C;  2OU2 A;  1LDD A;  2CSO A;  5CLS A;  3VWB A;  4BNC A;  1I39 A;  5CVI A;  4M3D A;  1WSU A;  4LMY A;  1TP4 A;  2E1C A;  4HDV A;  4O5V A;  2FSW A;  2QM3 A;  3HUG A;  4LJZ F;  1ZAR A;  4HZF A;  3OYB A;  2K5C A;  1WI3 A;  2M45 A;  1WJA A;  1L0O C;  1OYW A;  5LBQ A;  1MBK A;  1A31 A;  2MBF A;  3GTG J;  4BQN A;  2EZH A;  5FGM A;  3RZD J;  2LMD A;  2VBY A;  3AAF A;  2DLL A;  2PJR B;  4DYQ A;  4BY1 J;  4I01 A;  4XLA A;  2HKO A;  1JJ8 C;  3S1M J;  1OLT A;  1MND A;  4JK1 X;  1M1E B;  5HS9 A;  2BVM A;  3V42 A;  3K7A J;  2ZBK A;  5D6E A;  4E4H A;  4QLC U;  4RAY A;  4AIH A;  4XLF A;  2BVL A;  2KT0 A;  3ASO H;  1BL0 A;  1Z6R A;  4NQW A;  3MZ8 A;  5GAH J;  1X19 A;  3ZQL A;  2DMP A;  2DW4 A;  1BN5 A;  3CO6 C;  1B9N A;  2E36 A;  1CF7 A;  2VJJ A;  2DOD A;  4R79 A;  5KNL A;  4NHJ A;  4W1U A;  2NYX A;  2DDB A;  1RR7 A;  3H9Q A;  3ZOB A;  1JKO C;  4NBQ A;  2IXS A;  2RVC A;  3RKY A;  2YX4 A;  3CZ6 A;  2PLY A;  3PSI A;  2E5Z A;  3LST A;  2XKP A;  1QNT A;  1NG7 A;  2MW8 A;  1J2X A;  1R7J A;  4LGW A;  2E1N A;  4MO7 A;  5LHI A;  1ERD A;  2VJ5 A;  3CC7 I;  3CCY A;  2FA5 A;  1I6X A;  2HKX A;  3CC2 I;  5DD4 A;  4EV0 A;  5TJJ A;  4A69 C;  2KJC A;  2WTE A;  4N0B A;  5GAE J;  2DPU A;  2FML A;  1QHH D;  1UCR A;  2DQR A;  4U88 A;  2DK5 A;  1FIP A;  2IA1 A;  1DPR A;  1D0Z A;  4HPQ A;  2NNN A;  1R1U A;  1SVO A;  4F52 A;  3HGY A;  2ELK A;  4LIV A;  2XAH A;  2H6C A;  1GXQ A;  1UG0 A;  4HNU A;  3MKW B;  2EV6 A;  3KEY A;  1PP8 F;  2KKO A;  3HUG B;  5D4R A;  2JZY A;  3DP7 A;  4ZYD A;  2NOJ B;  4C9Y A;  2H27 A;  4M71 A;  2DBB A;  4U7B A;  2O8X A;  4A0Z A;  3I64 A;  5F27 A;  2UV1 A;  3Q0V A;  3OIQ A;  4RB2 C;  1FYL A;  3CCU I;  4DZJ A;  1FX7 A;  4ESB A;  4HV6 A;  1Y6I A;  5BS6 A;  3PIP F;  1N77 A;  2ID3 A;  2NS8 A;  3C2B A;  2VE8 A;  4KIG A;  5KVR A;  1OR7 C;  5M5X J;  2QWW A;  4HOB A;  5DV5 A;  5GTI C;  3WTW C;  1W7P D;  2V79 A;  2XPW A;  3KLO A;  5K7F A;  2A05 A;  2DA2 A;  4NQW B;  2WA0 A;  4KIC A;  2HQN A;  4GGG A;  1LDK B;  5LHH A;  3H0G J;  1QO0 D;  5DYM A;  3OSF A;  4OU0 A;  1XG1 A;  1CF7 B;  1UHW A;  5KK1 A;  1P9Q C;  2EV5 A;  2XPU A;  4BXU A;  1ZHF A;  2B9S A; 
#chains in the Genus database with same CATH homology
 1E2X A;  3P7N A;  1HSJ A;  1U5T A;  4HLX A;  2QQA A;  1IRG A;  1SD7 A;  5LHG A;  3ZMS A;  5J6X A;  3P9K A;  3QRF F;  2XAF A;  1P6R A;  3EQL F;  2MC3 A;  1V4R A;  1KU9 A;  3BY6 A;  3FXQ A;  5D5W B;  2RGV A;  1XDS A;  1LDJ A;  2CG4 A;  3L00 A;  3F21 A;  1Z9C A;  1FYK A;  1XSV A;  1TNS A;  5D5V B;  3BPV A;  5HDN A;  1HW1 A;  5JVT A;  3LFK A;  3V7S A;  2L3D A;  4M6X A;  2E7W A;  1Z91 A;  3FM3 A;  2XAQ A;  1T38 A;  1BI2 A;  1KGS A;  3GVA A;  1MKM A;  5L3C A;  5CVR A;  4LLN A;  3T5X A;  1WWX A;  4OIN F;  1FT9 A;  4YIF A;  2Z3Y A;  1O3Q A;  3GYH X;  4JBA A;  1SFE A;  3I59 A;  2C6Y A;  3JSO A;  1U5T B;  3FXR A;  2OQG A;  3GWZ A;  3HHH A;  2ZNY A;  1ZN2 A;  5CVV A;  1QQI A;  4L9J A;  1KQ9 A;  1HW2 A;  1P4W A;  3DEU A;  2Q8K A;  2V6C A;  5LRS A;  3ZN0 A;  4Z2Y A;  5L3F A;  2FBH A;  5D8L B;  2G7U A;  3Q9V A;  3CUQ C;  1ONV A;  3B73 A;  5LGU A;  2HEO A;  5CVJ A;  4G7Z F;  4WXD A;  2A69 F;  2VE9 A;  4EM1 A;  3M8E A;  3L09 A;  2ZO4 A;  3F8N A;  2DI3 A;  1R22 A;  5E1Z B;  1W4M A;  2HR3 A;  1SMY F;  5LEJ A;  2BV6 A;  1ZRC A;  1FZP B;  3U2R A;  2CWE A;  2J5O A;  1QZZ A;  2W25 A;  3I59 B;  3C3W A;  3H92 A;  3ML6 A;  4CZZ A;  2LF7 A;  1WKM A;  1BM9 A;  2GA1 A;  5A2Q K;  3OOP A;  2GWR A;  1S6L A;  1R23 A;  5FFZ A;  4A6E A;  4LK1 F;  2O3F A;  3VEP A;  3F8M A;  3M9A A;  2VXZ A;  3QP5 A;  4CO8 A;  2P5K A;  5JHU A;  2VT2 A;  3EYI A;  4L9T A;  4OIO F;  1KQ0 A;  2HYG D;  3P9C A;  4R1H A;  5FO5 A;  1IUY A;  1LEB A;  1KYZ A;  1QZY A;  5LEK A;  3RPU A;  2GA2 A;  3I54 A;  3BJA A;  3O3K A;  1IF1 A;  3BWG A;  3MCZ A;  1ZLJ A;  4LB5 A;  3IWF A;  2V1D A;  5E17 F;  1ZGJ A;  4M6Y A;  3N4M A;  4L0Z B;  2MD5 A;  2R7F A;  5DDG A;  2V1U A;  2O03 A;  4P55 A;  1IXR C;  1YYV A;  1YTY A;  1GHC A;  3SQN A;  4YFN F;  1J59 A;  3E3V A;  3NQO A;  5JR3 A;  1F9N A;  3DXJ F;  1PDN C;  1YS6 A;  2XAS A;  2Y75 A;  1XDU A;  2JT1 A;  1ZGA A;  2EFN A;  3E6C C;  3HTS B;  2XVC A;  4KFC A;  2PN6 A;  3KEQ A;  4A2U A;  3M8F A;  3V8J A;  3ZN1 A;  4UHT A;  4UVA A;  5D8K B;  2QBY A;  4I0B A;  1V3F A;  3F22 A;  3G3Z A;  3L9F A;  4L9N A;  3DPL C;  1KU7 A;  3O6B B;  3JAM Z;  2L4A A;  2BBY A;  3TOB A;  5FD5 A;  4BQA A;  1FOK A;  1T39 A;  2MH9 A;  4BAY A;  3BRO A;  3FMR A;  3HSF A;  3V7R A;  4HQE A;  4HF0 A;  3JTG A;  2P8T A;  1IZ1 A;  3GLX A;  4B8X A;  3WTV C;  4AD9 A;  2QZ8 A;  5DCF A;  1LNW A;  1YIO A;  2STW A;  3CJN A;  1G6N A;  2Z99 A;  3CTA A;  2ETH A;  3GUD A;  5CYV A;  3GZ6 A;  4P5O A;  5EEH A;  4ZZL A;  1F5T A;  5FB2 A;  3F8B A;  4KUM A;  4LFU A;  4RGS A;  2D1H A;  3KZY A;  3CO7 C;  3KP4 A;  4A5M A;  2OZU A;  3IHU A;  2F5F A;  4WK8 F;  4GYG A;  2QBY B;  4CIC A;  1HKQ A;  1ZRD A;  3T0Y A;  3WGH A;  1Y0U A;  1RZ4 A;  1B4A A;  3LQR A;  3ZMT A;  4A0X A;  3WTZ A;  1HKS A;  4XSX F;  3E5U A;  4KMF A;  1O57 A;  1FPQ A;  2QUF A;  3J7A O;  1TQP A;  2A6H F;  4M73 A;  2VOO A;  4MNU A;  1BIB A;  4G7O F;  1T2K A;  1LB2 A;  2EK5 A;  3QPT A;  1ZG5 A;  2FNP A;  2JRT A;  2VON A;  3RIR A;  2QVO A;  1L3L A;  1TBX A;  4BYY A;  2PEX A;  2Y48 A;  3RYP A;  1FP2 A;  2GQQ A;  4AIK A;  5HOO A;  2DU9 A;  1IXC A;  5DUK A;  3KEO A;  1U5T C;  4UV8 A;  5ERI A;  2IPQ X;  3TO7 A;  4KT5 C;  1O3S A;  3HTU A;  3RYR A;  2IJL A;  4ZYG A;  4XSZ F;  4S05 A;  1D5V A;  2AXL A;  1S29 A;  2XHK A;  1KQ8 A;  5L3D A;  1U2W A;  4RGR A;  4KMU X;  5HS8 A;  1QGP A;  3IWZ A;  1I27 A;  1ZG1 A;  2VBZ A;  2H6B A;  4NB5 A;  1KU2 A;  4A6D A;  1R36 A;  3KP2 A;  2O6G E;  2EV0 A;  5H6R A;  3E6M A;  4Y15 A;  3KZZ A;  1IN6 A;  2COM A;  2GXB A;  4M9X A;  2J5P A;  1FSE A;  5AON A;  4P96 A;  2Z9O A;  1WI9 A;  2CQK A;  2KRF A;  2NAZ A;  1TLH B;  3ABT A;  4HX4 A;  2XAJ A;  2IW5 A;  3QOP A;  3QAH A;  3LWF A;  5A2Q Z;  1SFX A;  2PBI A;  4UXN A;  2QLZ A;  1FBQ A;  4ESJ A;  2RC4 A;  3WOD F;  4G7H F;  4L5J A;  3JTH A;  2MLG A;  3GZ5 A;  1UST A;  4B09 A;  2JTV A;  5ILV A;  3JAM K;  4FT8 A;  2FXA A;  2KIM A;  4AIJ A;  3BJ6 A;  2A68 F;  4EJU A;  3WGG A;  1U8R A;  2ZNZ A;  3R0J A;  5ICE A;  1ZRF A;  3DFG A;  3GEZ A;  3BJO A;  4PCQ A;  4HLY A;  3CUO A;  2ADU A;  3MZY A;  3VFZ A;  2MA3 A;  3TO6 A;  4MEY F;  2P7V B;  1JHH A;  4MTD A;  4EM0 B;  1YLF A;  1P4A A;  3P9I A;  3ECH A;  2FQ3 A;  2HQR A;  3Q9S A;  4KIF A;  5FLX Z;  3WTS C;  1R1T A;  1ZRE A;  2F5E A;  1E17 A;  3GX4 X;  2VC1 A;  1XCV A;  2EFP A;  1G3Y A;  5IT9 Z;  3L2C A;  1DUX C;  3WE2 A;  4OOI A;  1HW5 A;  4L9V A;  1XCB A;  5IT3 A;  2IA2 A;  1DDN A;  2A07 F;  1RI7 A;  4UVC A;  4GCV A;  4Q4Z F;  2DO7 A;  2ZXJ A;  3F6V A;  2ISY A;  1W5T A;  1WQ2 A;  3U9G A;  4N9H A;  3H3Z A;  2D1V A;  1IN7 A;  4IRH A;  4RB0 A;  2Z5U A;  1SD4 A;  2VC0 A;  1BI1 A;  1X3U A;  4N9I A;  4TV7 A;  2NNY A;  4IRG A;  2FBK A;  3HRS A;  3HOT A;  5H6Q A;  1GVJ A;  2A61 A;  4AVP A;  4WXC A;  5H20 A;  2ZKZ A;  1BC7 C;  5LLQ A;  3IKT A;  2O0Y A;  2EFW A;  2L54 A;  5LGN A;  2GZW A;  3WTU C;  2CFX A;  2YPR A;  3KLN A;  2GIV A;  3HSE A;  5E1W A;  1Z6T A;  2L01 A;  1BOA A;  4JQF A;  2IP2 A;  2XRO A;  5ILS A;  2M30 A;  1XSD A;  3I58 A;  3QU6 A;  1TW2 A;  2Q0O A;  2K4B A;  1LJ9 A;  2HFH A;  2ELH A;  1OR7 A;  2GXG A;  1D3Y A;  5DUI A;  1OKR A;  2IT0 A;  3N97 A;  5F1R A;  4O6J A;  1YW7 A;  5F64 A;  2V1X A;  4UVB A;  4Y17 A;  4P9F A;  2V9V A;  2UXN A;  3ERE D;  1USS A;  4I0A A;  5DD8 A;  4IRI A;  3FZV A;  3K9T A;  2D2W A;  4ENJ A;  2FF4 A;  2FRH A;  5E1X A;  2PQ8 A;  4ESF A;  5L3B A;  2CW0 F;  5DEQ A;  4PGG A;  5D4S A;  3TGN A;  1XD7 A;  4YFK F;  4FX0 A;  1BJA A;  4XLP F;  2D45 A;  1W5S A;  4G6D A;  1ULY A;  4L18 B;  1MJA A;  3HHG A;  3E97 A;  4G6Q A;  1HXD A;  3GF2 A;  5FD6 A;  4ZH4 F;  1O7F A;  4Q47 A;  4HX7 A;  1IW7 F;  5BPD A;  3RDI A;  1FBS A;  2WC2 A;  4YFX F;  1MZB A;  4D0P A;  2OQR A;  3EET A;  1J5Y A;  4KA4 A;  5K5O A;  1KU3 A;  4ZYE A;  3O2P E;  1K7A A;  1LVA A;  4RB3 C;  4KNY A;  1TQM A;  4ON0 A;  2BEO A;  3R60 A;  1RUN A;  5ED4 A;  4M9Z A;  1R1V A;  3PQK A;  4UV9 A;  2MH2 A;  3MWM A;  4HV5 A;  4MQV A;  4G9Y A;  2VN2 A;  2K7L A;  4EM2 A;  3ECO A;  1FYM A;  2EA4 A;  1Z7U A;  2M1B A;  5HS7 A;  1TNT A;  3T8R A;  3FMQ A;  3Q5F A;  1RUO A;  4L0Y B;  3K2Z A;  4I02 A;  1TTY A;  5K1Y A;  1IN8 A;  3LAJ A;  4YG2 F;  5FLX K;  1PP7 U;  2M87 A;  4S04 A;  1C0W A;  3K0L A;  3T8T A;  4IHS A;  1AWC A;  2QYO A;  1H9G A;  4FX4 A;  1XSX A;  4HF2 A;  1SAX A;  3GO5 A;  2UWM A;  1HST A;  2YR2 A;  3V7C A;  5IT9 K;  1BI0 A;  5HDK A;  1J75 A;  2DPD A;  3C1D A;  5K5R A;  2NRA C;  2P6T A;  3JW4 A;  3HSR A;  4EJO A;  2BE5 F;  3ZMZ A;  1S7O A;  1DP7 P;  1Q1H A;  3WTT C;  1G3S A;  5ILU A;  4Q5S F;  1TQI A;  2VBX A;  2HGC A;  3D5L A;  3F8C A;  3TDZ C;  4ZZD A;  2ZJ2 A;  3DF8 A;  4CHU A;  2GAU A;  4I98 B;  2ZME A;  2G9W A;  3RI4 A;  2ACJ A;  2K02 A;  1O3R A;  1RIO H;  3L7W A;  3TKY A;  5D5U B;  2W57 A;  3SHF A;  2JPC A;  2VOD A;  3KCC A;  3V8L A;  4IJA A;  2FBI A;  3DV8 A;  2HS5 A;  3FHZ A;  1B59 A;  4CDG A;  3JSP A;  4ENN A;  1D8J A;  1IN4 A;  5AIP A;  1TW3 A;  4Q48 A;  2F5C A;  1JHF A;  3SZP A;  5TRD A;  3FM5 A;  5HLI A;  4XBF A;  4QWQ A;  1F1Z A;  3I0T A;  3FF5 A;  4RGX A;  3MZH A;  2F5D A;  1XMK A;  3QPH A;  1GXP A;  1Z1D A;  1FBU A;  2XRN A;  1BIA A;  3CUQ B;  2RNJ A;  1B9M A;  1MGT A;  4CGZ A;  1YO5 C;  2NS0 A;  2DQL A;  2A3S A;  3J80 Z;  3IL2 A;  4UUV A;  2EA2 A;  4M74 A;  4I2O A;  4MTE A;  1U6G A;  4EJT A;  4GXO A;  1K79 A;  5DCM A;  4WX9 A;  3DQV C;  2VT3 A;  5ICF A;  3KE2 A;  6PAX A;  4RGU A;  2XAG A;  2ZME B;  5HVQ C;  2HTJ A;  2STT A;  4U0V A;  5D5X B;  1NHA A;  4U0W A;  4U0Y A;  4G8X A;  1B6A A;  4HAM A;  2L4M A;  1IRF A;  1H9T A;  4LK0 F;  3R6S A;  1LEA A;  3CDH A;  1REP C;  2RDP A;  1I1S A;  2JPB A;  3RKW A;  1G3T A;  2HWV A;  3SFZ A;  3F23 A;  3K1N A;  4M9S A;  2X4H A;  4HA8 A;  5E8G A;  2WWY A;  4DQ2 A;  2P4W A;  5LGT A;  1J0R A;  2IRF G;  3EUH A;  1YS7 A;  4OMZ A;  2ESN A;  2EJR A;  2OBP A;  3ZMD A;  3E6B A;  1IAW A;  1U3E M;  5DCM B;  1Z05 A;  3VB2 A;  4KIB A;  1EH6 A;  1T98 A;  3KP3 A;  1D8K A;  4GO1 A;  4EQQ A;  3IKV A;  2PJP A;  1JXS A;  1UB9 A;  5CVU A;  1R5G A;  1EV7 A;  1ON2 A;  4HYE A;  2ISZ A;  3RJP A;  2B0L A;  4A5N A;  4PDK A;  4R8H A;  3ZPL A;  3C7J A;  4ZYH A;  2RV8 A;  1IN5 A;  2R7D A;  4PZJ A;  2CGP A;  4EVI A;  2FU4 A;  2PMH A;  4WCG A;  2HYF A;  3W6K B;  4CXF A;  2K4J A;  1SMT A;  3M7G A;  3IC7 A;  1UFM A;  1FP1 D;  1ZG3 A;  2HZT A;  1FLI A;  1QBJ A;  3MEX A;  1JE8 A;  2XV4 S;  2A6E F;  3HOS A;  2RKH A;  1K6O A;  4E70 A;  5L3G A;  5ICG A;  2QQB A;  1XGO A;  2A5Y B;  4ETS A;  3DPT A;  3COA C;  2MLK A;  3LQQ A;  2EFO A;  4HBL A;  2FOK A;  1U78 A;  1P92 A;  1I5Z A;  3HRM A;  1T6S A;  3J81 K;  2P7C B;  2AS5 F;  3WE3 A;  2YU3 A;  1SD5 A;  1W7P A;  3GFL A;  2XGX A;  5E8I A;  5ICC A;  4AWX B;  3R4K A;  2P5V A;  4IVN A;  2LDU A;  2W84 A;  3VOE A;  3I71 A;  1QPM A;  4OIQ F;  2O61 A;  2FMY A;  2M5W A;  4HQM A;  3ISP A;  4LLG F;  4IF4 A;  4BH9 A;  2EFQ A;  2BYV E;  3GW2 A;  3KP5 A;  3FXU A;  3J80 K;  2DAO A;  1K78 A;  4KN4 X;  3PQJ A;  1UHM A;  1LQ1 A;  4HDU A;  4KYW A;  4F7Z A;  3H3U A;  5JFR A;  2QEN A;  1ZH5 A;  2G7H A;  2EWN A;  5LRR A;  1OYY A;  2P6S A;  3W6J B;  1BC8 C;  4XLN F;  1O3T A;  4GYI A;  1T0F A;  2FE3 A;  3I4P A;  3T1B A;  1ZYR F;  1RNL A;  4A12 A;  3HRT A;  1XN7 A;  4MGR A;  1OMI A;  3BZ6 A;  1W7P B;  1P2F A;  2LNB A;  5BQT A;  2OZ6 A;  3S2W A;  2KIF A;  2M8E A;  4EMS A;  3WTX C;  2RQP A;  5D6F A;  2PFB A;  2VOP A;  2XIG A;  3NEU A;  2CYY A;  5E18 F;  2Q2E A;  3GFJ A;  2VBW A;  4KN7 X;  4WXH A;  3D0S A;  1OYI A;  2Y0M A;  1JGS A;  2OAZ A;  1K78 B;  5E20 A;  4IHT A;  3SXY A;  3ZP5 A;  1CGP A;  2P5L C;  3BDD A;  3OV8 A;  3GFI A;  2IA0 A;  2LSO A;  1ZAO A;  4XRF A;  3KP6 A;  2BGC A;  2CO5 A;  2X0L A;  4LLL A;  1MD0 A;  3F6O A;  5BPI A;  2HTS A;  1XGN A;  5K5Q A;  1AOY A;  3C18 A;  2OA4 A;  4HX8 A;  3ROU A;  3R0A A;  1FNN A;  1OPC A;  2TDX A;  2KIU A;  4Y13 A;  1YW9 A;  4UNO A;  1EH7 A;  2K27 A;  3FWE A;  2HDC A;  2ZFW A;  5HDG A;  2PI0 A;  3K1M A;  5JI6 A;  3HYI A;  1BI3 A;  1KA8 A;  4P9U A;  3GFM A;  3ULQ B;  2IVM A;  3ZQ7 A;  5HLH A;  2RN7 A;  2DK8 A;  3DKW A;  1SD6 A;  3KP7 A;  3K1P A;  4ENK A;  2OD5 A;  3E6D A;  4PGH A;  1FY7 A;  3F72 A;  2JSC A;  1HBX G;  1S8N A;  1STZ A;  1YFH A;  1J7K A;  2PG4 A;  3I53 A;  3MAJ A;  3TO9 A;  3U1D A;  3MQ0 A;  2KJB A;  1HKT A;  2DT5 A;  4WWC A;  3SZT A;  4A0Y A;  2XKO A;  1XGM A;  1WRJ A;  2YSR A;  4ENM A;  4RB1 A;  2ZCW A;  4EGY A;  2HOE A;  1FC3 A;  2UZK A;  1A04 A;  1ODD A;  4G94 A;  2R3S A;  1ON1 A;  1S7A A;  4BHP A;  3QP6 A;  3ZMU A;  4EJV A;  3IRR A;  3ELK A;  5J8C A;  4RAZ A;  5BMZ A;  4MEX F;  3V4G A;  1H0M A;  2K86 A;  1J9I A;  3EDP A;  3NRV A;  5BOX A;  3B02 A;  4IPA A;  3FX3 A;  1I1G A;  1FSH A;  4O3M A;  1YQA A;  3WTY C;  1YG2 A;  3REO A;  1G3W A;  5J8F A;  4LG0 A;  3KET A;  3EYY A;  3CUQ A;  3KFW X;  2EB7 A;  1HQC A;  3RPQ A;  2UXX A;  4BHC A;  1XMA A;  3BPX A;  3FMS A;  3R61 A;  5F6F A;  4M72 A;  1ZLK A;  2LF8 A;  4EGZ A;  4WF2 A;  2PMU A;  3HRU A;  3TQN A;  1YW8 A;  3TDU C;  4KDP A;  1KYW A;  5HLG A;  1VTN C;  3LA2 A;  4H0E A;  4ASN A;  4OIR F;  1XB4 A;  1SFU A;  3BOQ A;  3E5Q A;  3GXO A;  3IRQ A;  3J81 Z;  2QQ9 A;  3ZMV A;  3WU1 B;  3WGI A;  4DNC A;  3G73 A;  2DTR A;  3PFI A;  1R5H A;  1MDM A;  2ESH A;  4LG0 B;  1DPU A;  1IXS B;  4LD5 A;  3VOD A;  4OIP F;  5L3E A;  1MJB A;  5EEG A;  1XGS A;  3V8K A;  4L5I A;  1O7L A;  3ABU A;  3RKX A;  3K69 A;  3F8F A;  1FWZ A;  4K2E A;  4CYD A;  3LA3 A;  3BP8 A;  1S3J A;  2YX7 A;  2W85 A;  3F3X A;  2F2E A;  2H94 A;  3I5U A;  1BBY A;  5AIQ A;  4LB6 B;  1G4D A;  3WU0 A;  4MQ9 F;  2XUB A;  3QU3 A;  3E5X A;  5FFX A;  2DFI A;  2WV0 A;  1MJ9 A;  4HW0 A;  3CLO A;  1P4X A;  1B1B A;  1R58 A;  4OMY A;  3RTR A;  2Z33 A;  4BHB A;  4FHT A;  4I7H A;  4I09 A;  5CJ9 A;  3LA7 A;  3TOA A;  2LKP A;  1MDM B;  2W24 A;  4HF1 A;  1R00 A;  2FEZ A;  2FNA A;  4U7D A;  1PUE E;  3M1E A;  2L02 A;  3MFK A;  2H09 A;  3LAP A;  2E7X A;  3HIF A;  1F4K A;  3WG9 A;  4EJW A;  4MHG A;  4RS8 A;  4YII A;  1EH8 A;  4IXA A;  2OU2 A;  1LDD A;  2CSO A;  5CLS A;  4BNC A;  5CVI A;  1WSU A;  4LMY A;  2E1C A;  4HDV A;  4O5V A;  2FSW A;  2QM3 A;  3HUG A;  4LJZ F;  1ZAR A;  4HZF A;  2M45 A;  1L0O C;  1OYW A;  5LBQ A;  2MBF A;  5FGM A;  2VBY A;  3AAF A;  2DLL A;  4I01 A;  2HKO A;  4JK1 X;  5HS9 A;  5D6E A;  2ZBK A;  4QLC U;  4RAY A;  4AIH A;  1Z6R A;  4NQW A;  2DW4 A;  1BN5 A;  3CO6 C;  1B9N A;  1CF7 A;  4R79 A;  4NHJ A;  2NYX A;  2RVC A;  3RKY A;  2YX4 A;  2PLY A;  3LST A;  2XKP A;  1QNT A;  4LGW A;  1J2X A;  1R7J A;  2E1N A;  5LHI A;  2FA5 A;  1I6X A;  2HKX A;  5DD4 A;  4EV0 A;  5TJJ A;  2KJC A;  2WTE A;  4N0B A;  2DPU A;  2FML A;  1UCR A;  2DQR A;  4U88 A;  2DK5 A;  2IA1 A;  1DPR A;  2NNN A;  1R1U A;  2H6C A;  2XAH A;  1GXQ A;  2EV6 A;  1PP8 F;  2KKO A;  5D4R A;  2JZY A;  3DP7 A;  4ZYD A;  2H27 A;  4M71 A;  2DBB A;  4U7B A;  2O8X A;  4A0Z A;  3I64 A;  4RB2 C;  1FYL A;  1FX7 A;  4ESB A;  4HV6 A;  5BS6 A;  2VE8 A;  4KIG A;  5KVR A;  2QWW A;  4HOB A;  5DV5 A;  3WTW C;  1W7P D;  2V79 A;  3KLO A;  4KIC A;  2HQN A;  4GGG A;  1LDK B;  5LHH A;  1QO0 D;  5DYM A;  4OU0 A;  1CF7 B;  1UHW A;  5KK1 A;  2EV5 A;  4BXU A;  1ZHF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...