4EM0B

Staphylococcus aureus marr in complex with salicylate and kanamycin
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
175
structure length
150
Chain Sequence
TAAAKFEMLSQEFFNSFITIYRPYLKLTEPILEKHNIYYGQWLILRDIAKHQPTTLIEISHRRAIEKPTARKTLKALIENDLITVENSLEDKRQKFLTLTPKGHELYEIVCLDVQKLQQAVVAKTNISQDQMQETINVMNQIHEILLKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/antibiotic
molecule keywords Uncharacterized HTH-type transcriptional regulator SAR2349
publication title Staphylococcus aureus MarR complexes
rcsb
source organism Staphylococcus aureus
total genus 54
structure length 150
sequence length 175
ec nomenclature
pdb deposition date 2012-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4em0B00
1FP1D 1FSEA 1ZRFA 3M8FA 2VN2A 4U7BA 5J8CA 1R7JA 1FBQA 2KIMA 2Y48A 1XD7A 2HTSA 3S2WA 3NEUA 1UCRA 2ELHA 5D8LB 3ERED 1MDMA 2M5WA 4I0AA 4KN7X 2WV0A 4BQAA 3V8LA 5HLHA 4G8XA 2CQKA 3M7GA 2DK5A 3J7AO 1IXRC 4JQFA 2P8TA 3EQLF 3KE2A 1U78A 4U0YA 5D5WB 1R58A 2QYOA 6PAXA 4XRFA 2IW5A 2PBIA 2Q0OA 5IT9K 1O3RA 2XRNA 1BIBA 1REPC 2D1VA 3K0LA 3DXJF 3JAMK 4HV5A 5F64A 3F8CA 3IWFA 1B4AA 1LEBA 1V4RA 1YS6A 3GWZA 3KCCA 4IXAA 4A5MA 3M1EA 3DFGA 2VOOA 2XAHA 1MJ9A 4RB1A 3KLNA 2EWNA 4Q5SF 3BOQA 5K5RA 1W5SA 1KA8A 5ILUA 5LGTA 4UVBA 1B9MA 3K1PA 2RV8A 5ICFA 1KU2A 3ML6A 3WE3A 2V79A 2YU3A 2HYGD 4KDPA 1UB9A 1BBYA 3JTGA 5DUIA 1K79A 1K7AA 1U5TA 1XN7A 3F21A 3PQKA 2XAFA 1O57A 1OYYA 5F1RA 3F6OA 5H20A 1W5TA 2WTEA 3D5LA 1QQIA 4JK1X 2L3DA 3HHHA 2RNJA 4L5JA 5E18F 3REOA 1Z91A 1Q1HA 1SAXA 1HBXG 3CUQA 1UFMA 4L0ZB 3I0TA 4RB2C 4PDKA 1SMYF 1MZBA 2X4HA 4FHTA 2VONA 5HOOA 2FE3A 5HS9A 1Z1DA 5CYVA 4HLYA 1TBXA 2FEZA 2QBYB 3N4MA 1IRFA 1R5GA 3RTRA 5J6XA 3I59A 1QZYA 4HQMA 3LFKA 2UXXA 2R7FA 3QOPA 3K1NA 2L4AA 3R6SA 4O6JA 3J81K 3DEUA 3QU3A 2DPUA 1FBSA 2W24A 2VXZA 2ISZA 1TQIA 3H3ZA 4RAYA 1XDSA 2EA2A 5HDKA 1YQAA 2PMUA 2HDCA 2O0YA 3PFIA 1NHAA 4AD9A 4UV8A 3NQOA 5E8IA 1IW7F 3R60A 3OV8A 4Q47A 5LHGA 3IL2A 3V7RA 1ZN2A 4LD5A 3TQNA 4A5NA 4HF2A 1E2XA 3CO7C 1YW9A 4RS8A 1O7FA 1D8KA 2ESNA 1IN8A 2QVOA 2J5PA 2M1BA 5FGMA 3KP7A 5D5XB 1FYMA 5LGNA 2O03A 4HQEA 2W84A 3E97A 3FMQA 2DFIA 1QZZA 3ZN0A 5EEGA 2UZKA 3IWZA 4LG0B 1CGPA 2L02A 2KIUA 2O8XA 4WF2A 1QPMA 1YG2A 5DV5A 2L54A 1H9TA 4RGXA 4KA4A 4HX7A 2XHKA 3LA2A 3RYRA 4CYDA 5D4SA 3RPUA 3QP5A 1XGOA 5TRDA 1O7LA 5D6EA 1DDNA 4ZZDA 2MLKA 4ETSA 4AVPA 3SHFA 1Y0UA 3WGGA 4HDVA 1ODDA 2LF8A 3ULQB 2EV0A 1DPUA 4HAMA 2JRTA 3E6MA 5DEQA 4CDGA 4EJOA 2NAZA 4K2EA 2COMA 4HW0A 4FX4A 2CWEA 4XSZF 3WTYC 3F23A 1PUEE 2ZFWA 4QWQA 2XV4S 2GIVA 4JBAA 1PP8F 4UVAA 4M72A 3DP7A 2LF7A 5DD4A 2E7XA 3EUHA 2P5VA 2X0LA 5D8KB 2HKOA 1JGSA 3WTVC 3BJAA 3OOPA 3MCZA 1ZARA 1S29A 4B09A 5D6FA 2CW0F 5DUKA 1PDNC 4MEYF 4XLPF 3TKYA 1KQ8A 1MD0A 2Z5UA 2GA2A 4NQWA 3RPQA 1BI3A 1G4DA 4OMYA 3HTSB 4NB5A 2V9VA 2FRHA 3DPLC 5FO5A 5BS6A 3IRQA 5ILSA 3MEXA 3CTAA 1O3QA 3BJ6A 2BEOA 2FF4A 3ZN1A 4MQVA 2DW4A 1ZGJA 1E17A 2GXGA 2MH9A 5CJ9A 4IRHA 1QBJA 3P9KA 2EFWA 1KGSA 1HKQA 2K27A 3SXYA 2MC3A 3RJPA 1S3JA 5E20A 2H6BA 1ON2A 5JR3A 1MKMA 2FQ3A 1R1TA 4EM2A 3GZ6A 1YFHA 2PFBA 1IRGA 1B1BA 3RIRA 1ZYRF 2LNBA 3WTZA 4GYGA 5HS8A 3FF5A 4L0YB 4Z2YA 2QUFA 5L3CA 1W7PA 1ONVA 4AWXB 1J59A 4P55A 4CO8A 1EH7A 1RI7A 5LHIA 1RUNA 4U0WA 4BHPA 5E1WA 3L9FA 1T0FA 2DPDA 2A68F 4UHTA 3HRUA 4R8HA 5JHUA 5FD6A 1OPCA 3M8EA 4KMFA 4O3MA 5BQTA 4IF4A 3QRFF 5FLXZ 2F5EA 2DQRA 5LEJA 1Z6TA 4P9UA 1SD6A 2KKOA 4MHGA 1SD5A 2VC0A 3HSEA 3RI4A 3QPHA 4O5VA 2P4WA 4LB6B 4B8XA 2XAGA 2F2EA 5FFZA 4G7HF 4NHJA 4M74A 5DCMB 1WKMA 2DTRA 1T39A 3E5XA 4BH9A 3SQNA 1IZ1A 2XKOA 1ZHFA 2FNPA 1B6AA 3MZYA 2AXLA 3MFKA 1I1SA 3K69A 4LMYA 3EETA 3ZMDA 2FU4A 2FNAA 2A3SA 4GXOA 1P2FA 2DT5A 3BROA 1OR7A 3GVAA 4L9JA 1BIAA 3GF2A 4LGWA 4S04A 1HSTA 3FZVA 4FT8A 4BHCA 4H0EA 1KQ0A 4LLGF 3ZPLA 2CFXA 2EFQA 4EGZA 1SFXA 4ZH4F 2KIFA 4I0BA 2E7WA 3K9TA 5KK1A 2MLGA 2ESHA 3C18A 1P4XA 1S6LA 3U1DA 2XGXA 4KMUX 3RYPA 3EDPA 5LLQA 3KP6A 2BYVE 3WGIA 1UHWA 4EM1A 4RB0A 5L3BA 1XSDA 3T0YA 2MD5A 3QAHA 2XAJA 5D5VB 1CF7A 3I71A 2B0LA 3BPXA 4PCQA 4KIBA 3GO5A 3E6CC 3TOAA 2PMHA 2OD5A 5EEHA 2HS5A 2OU2A 1R00A 4HX8A 5AONA 4RAZA 3ZMTA 2PQ8A 4XBFA 2QWWA 4P96A 1GHCA 1P4WA 2DO7A 4ESFA 1C0WA 2VOPA 5E8GA 3HHGA 3COAC 2ZNZA 2G7UA 2DLLA 2P7VB 3HYIA 4OOIA 1O3TA 1JXSA 3JSOA 1D8JA 3Q9VA 2FA5A 2NYXA 3HRSA 5L3FA 2VBWA 3VODA 1XGMA 1O3SA 4I01A 3R0AA 2L4MA 1R5HA 3I64A 3ISPA 4E70A 4ZYEA 4KN4X 3WTSC 3GLXA 4LFUA 2UWMA 5H6QA 2DU9A 5KVRA 2ISYA 4M9ZA 1XMKA 3TO6A 1RUOA 3QP6A 1ZRCA 3SZTA 2PLYA 3O3KA 5E17F 2FBIA 4A12A 1G6NA 3EYIA 1HSJA 4U88A 1LJ9A 1JHFA 5K1YA 1QO0D 4A6EA 1D5VA 4Y17A 4YG2F 4G7OF 5LGUA 3G73A 2P5KA 1K78B 3E5QA 1R1UA 2KJCA 3V7CA 4LK0F 5CVIA 3DPTA 4KIFA 1SFUA 1EV7A 2VODA 3P9CA 4YFKF 1GVJA 5CVRA 2NNYA 2ZCWA 5FB2A 2A6EF 4G6DA 2HTJA 2M8EA 2RN7A 5CVVA 4IVNA 1LNWA 4P5OA 2CG4A 1U3EM 5L3EA 1F9NA 2EK5A 3HRTA 2IA2A 3N97A 3LWFA 4M73A 4Y15A 5JVTA 2O61A 3V8KA 4M9SA 4ZYHA 2OZUA 3R4KA 4HOBA 2JPBA 1TNSA 2YPRA 2O3FA 2STTA 2DBBA 1HKSA 2ZMEB 2PJPA 5A2QZ 1R22A 2XROA 1FBUA 3WGHA 5E1ZB 3FMSA 2HKXA 3GX4X 4GGGA 5HLIA 1OYWA 3HUGA 5FLXK 2HEOA 2XUBA 4LK1F 5FFXA 1J2XA 3GYHX 1SD7A 4WXDA 1UHMA 1A04A 1OMIA 2D2WA 1ULYA 3HRMA 2Y75A 1Z9CA 1KYZA 2XKPA 5D5UB 4PGGA 5HVQC 3MWMA 2YR2A 4HF1A 1XGSA 4WX9A 1HW5A 2EFPA 3U2RA 1SFEA 3VB2A 2P7CB 2EJRA 5AIQA 4ESBA 4CGZA 2Q8KA 3FXRA 3TDUC 2IRFG 1BN5A 1FSHA 1TQPA 2H94A 4MGRA 4MQ9F 1IN7A 3CLOA 3Q5FA 2E1NA 2W85A 3KP4A 2ZKZA 4TV7A 2QLZA 1I1GA 3I53A 1FLIA 1ZLKA 4RB3C 5JFRA 2Z3YA 3KP2A 4HBLA 3GFIA 1HXDA 4RGUA 3GEZA 5CVJA 3GFMA 3BDDA 4KICA 5H6RA 5L3GA 3L09A 2ACJA 1XCBA 2G9WA 4N9IA 4MTEA 1Z7UA 1FNNA 3ZMUA 1IAWA 1RIOH 3KETA 4IHSA 1D3YA 3VEPA 1P6RA 4BXUA 4EVIA 4WK8F 3FX3A 1U6GA 2JPCA 5DD8A 2JSCA 4ZYGA 1YS7A 3KZZA 4D0PA 3F8NA 1DP7P 1FC3A 5LRSA 1WWXA 2QQAA 1H0MA 2GZWA 3JW4A 3R0JA 3C1DA 4GCVA 1FOKA 4KT5C 4YIFA 1B9NA 1F4KA 1TTYA 2ZJ2A 4N9HA 3LA7A 2D1HA 3DQVC 1V3FA 2F5DA 3SFZA 4Y13A 1BC7C 2STWA 2JTVA 3M9AA 5HLGA 2QENA 2BV6A 4OIPF 2V6CA 4CHUA 3CO6C 3KLOA 4EMSA 2GA1A 3RKWA 2IP2A 3J81Z 1I6XA 3BP8A 3L00A 1R1VA 2HGCA 3ELKA 1AOYA 3BJOA 4I02A 4ASNA 3AAFA 4L9VA 1F1ZA 3LSTA 3H92A 3QPTA 3ZMSA 4G9YA 3KP5A 3V7SA 3MAJA 2Q2EA 4DNCA 1FT9A 1PP7U 3R61A 3GFLA 1XMAA 1J0RA 4YFNF 3I58A 1XSVA 3TO7A 4WXCA 1ZGAA 3HSRA 3HOSA 3ZMZA 3F8MA 1TW2A 2V1UA 1OKRA 1DUXC 1X3UA 1LQ1A 5HDNA 4YFXF 2PEXA 3FWEA 5BPDA 3TOBA 3F3XA 4LJZF 4KFCA 2HOEA 3E5UA 1U2WA 2YSRA 3HOTA 4KIGA 4EQQA 1XDUA 3GFJA 5E1XA 5LBQA 3RKXA 4OIOF 1KQ9A 3BZ6A 1YIOA 1STZA 1ZREA 2H27A 4G6QA 2JZYA 2GAUA 3ZP5A 2BGCA 4RGRA 1P4AA 3MQ0A 1YW8A 4OMZA 2ZO4A 3ABUA 4ON0A 1ZG5A 1IF1A 4MNUA 1MJBA 1W7PB 2P6TA 2BBYA 1L3LA 2O6GE 5FD5A 2F5CA 4OU0A 4GO1A 2A07F 3WTXC 2PG4A 2CGPA 3L7WA 4EJTA 5CVUA 4OIRF 1U8RA 3P7NA 3B73A 3J80Z 4F7ZA 1TQMA 4IJAA 1BM9A 4DQ2A 2FBKA 2HQRA 1OYIA 3RDIA 3C3WA 3E6DA 2XAQA 1T6SA 3V8JA 3FM3A 3G3ZA 4R1HA 4ENMA 1MGTA 2DAOA 2GWRA 3B02A 2WC2A 4A0ZA 2EV5A 2J5OA 1HKTA 2ZXJA 1TW3A 5K5QA 1P92A 4U7DA 1HW1A 1USSA 2VBZA 1LEAA 4P9FA 2BE5F 3ZMVA 4ENNA 2L01A 3IC7A 2RDPA 3V4GA 4A2UA 2FMYA 1ON1A 2DI3A 4G94A 4UNOA 1RNLA 2XASA 5AIPA 3SZPA 3TDZC 3KP3A 4HZFA 1K78A 2K4JA 1FYKA 2EA4A 2E1CA 2FMLA 1KU7A 2QBYA 2IA0A 4L9TA 4HV6A 3W6KB 3IRRA 3DV8A 1WSUA 3WTUC 2AS5F 3KFWX 5IT3A 2PN6A 2XVCA 3O2PE 5D4RA 3PQJA 2YX4A 1K6OA 1LDDA 1YW7A 1BOAA 3Q9SA 2A61A 3GZ5A 2W57A 1MDMB 3MZHA 1IXCA 1XSXA 4OINF 3JSPA 2OQGA 1TLHB 1YLFA 4AIHA 1CF7B 2OAZA 3K1MA 5JI6A 1KU9A 2HZTA 2FXAA 5LEKA 5BMZA 1EH6A 3IKTA 1R23A 2QQ9A 2VBYA 3LQQA 2RKHA 2MBFA 4A0YA 2ZMEA 2MH2A 3FHZA 1S8NA 3JTHA 4FX0A 3RKYA 4ZZLA 4IHTA 4HLXA 4LLNA 1T38A 2LKPA 1SD4A 2ADUA 1BI0A 4AIKA 3VFZA 4LG0A 4HF0A 1H9GA 3FXUA 1T98A 5LHHA 2H09A 3W6JB 2VE8A 4WXHA 1FYLA 4M6YA 2RGVA 2JT1A 2OZ6A 1IN5A 1VTNC 5DCFA 4KNYA 4EJWA 1QGPA 1G3TA 1U5TB 1J9IA 4CICA 2IA1A 4HA8A 1J5YA 1JHHA 3HIFA 5TJJA 4MTDA 2IT0A 1FX7A 2PI0A 1F5TA 1LB2A 2OQRA 2CYYA 3QU6A 2D45A 3BPVA 1IN4A 2QQBA 3WE2A 1L0OC 2FSWA 2EFNA 3GXOA 3I4PA 2V1DA 5CLSA 3F6VA 3H3UA 1FZPB 1RZ4A 4GYIA 3CUQB 5L3DA 4ZYDA 4S05A 2IVMA 2QM3A 1KU3A 4PGHA 5ICCA 2ZNYA 4L18B 1BI2A 3NRVA 3FM5A 3C7JA 2A6HF 2IPQX 1I27A 3ZQ7A 1LVAA 2KJBA 3I59B 2HYFA 3LQRA 1YO5C 3U9GA 4U0VA 5ICEA 3EYYA 1ZG1A 3I54A 1USTA 4N0BA 1GXPA 1WRJA 1AWCA 2K86A 2GXBA 1YYVA 3GUDA 4LB5A 1IXSB 3F8BA 1DPRA 1EH8A 2HQNA 3F22A 4YIIA 1B59A 2VE9A 5IT9Z 1HW2A 2QZ8A 4CZZA 1R36A 1ZRDA 4M9XA 3JAMZ 2F5FA 1FWZA 2HWVA 3TO9A 4IRGA 5F6FA 3J80K 1YTYA 2K7LA 4UVCA 2OA4A 1XCVA 2HFHA 1Z6RA 4L5IA 3ECOA 4UUVA 2C6YA 4G7ZF 2NS0A 4EGYA 4L9NA 2NRAC 4LLLA 1ZAOA 4EJVA 2G7HA 3K2ZA 1T2KA 2ZBKA 4XLNF 4ESJA 2LSOA 4AIJA 2WWYA 4I98B 1IUYA 4WWCA 2M87A 3ECHA 3LA3A 3KZYA 2Y0MA 2LDUA 2A69F 2RQPA 5ERIA 2VC1A 3ABTA 1KYWA 3E6BA 4IRIA 4UV9A 1ZLJA 2V1XA 2EV6A 2VT2A 4M71A 3E3VA 4WCGA 4EV0A 4HX4A 5DYMA 4CXFA 4I09A 4OIQF 2IJLA 1BI1A 2GQQA 1G3SA 3T8RA 3KEQA 2HR3A 2VT3A 1J7KA 3TGNA 3O6BB 4UXNA 2VBXA 4RGSA 2K02A 3VOEA 3P9IA 4I7HA 4A0XA 1Z05A 4KYWA 2EFOA 3I5UA 5DCMA 2H6CA 2FBHA 1ZH5A 3IHUA 1GXQA 4ENJA 3T1BA 2YX7A 1FP2A 1W4MA 3CJNA 3F8FA 3HTUA 2KRFA 4R79A 1SMTA 3L2CA 5HS7A 1BJAA 3LAJA 2NNNA 4ENKA 3WTTC 3F72A 5ED4A 1MJAA 3BWGA 2CSOA 4M6XA 1HQCA 2CO5A 2R3SA 4QLCU 4I2OA 1U5TC 4A6DA 5HDGA 3WU1B 1JE8A 2TDXA 1S7AA 2Z33A 4PZJA 3WTWC 1J75A 3LAPA 3WG9A 3T8TA 4BYYA 3DF8A 3DKWA 1FY7A 1XGNA 4MEXF 1LDKB 3CUQC 4BAYA 3T5XA 1G3WA 2P5LC 3CUOA 1G3YA 5DDGA 2A5YB 4XSXF 2M30A 1BC8C 5BPIA 4HDUA 1WQ2A 3FXQA 2Z99A 4Q4ZF 2RVCA 5LRRA 4EJUA 2DQLA 2RC4A 1TNTA 1I5ZA 3D0SA 3BY6A 3IKVA 2M45A 2P6SA 4Q48A 3CDHA 2Z9OA 2MA3A 5J8FA 3ROUA 5K5OA 5A2QK 2OBPA 1IN6A 2FOKA 1WI9A 5ILVA 4EM0B 3GW2A 5ICGA 1QNTA 4BNCA 2ETHA 1ZG3A 4HYEA 1W7PD 3FMRA 2K4BA 1XB4A 2R7DA 3WODF 1S7OA 3HSFA 3WU0A 1LDJA 2UXNA 2DK8A 1FPQA 3KEOA 2EB7A 4IPAA 2W25A 5BOXA 2XIGA 4KUMA 4BHBA
chains in the Genus database with same CATH superfamily
1FP1D 3JRAA 1D0YA 1B72A 1FSEA 2XF7A 3DWLE 1ZRFA 3M8FA 3HBLA 2VN2A 4U7BA 5J8CA 1R7JA 1FBQA 2KIMA 2Q1ZB 2L7KA 1I6HJ 2Y48A 2OF7A 1XD7A 2HTSA 3S2WA 4A3BJ 3NEUA 1UCRA 2ELHA 3DU6A 5D8LB 3ERED 1MDMA 2DJNA 2M5WA 4I0AA 4KN7X 2LRDA 2WV0A 4RBOA 4BQAA 1FTZA 3V8LA 5HLHA 4G8XA 2QF7A 2CQKA 3M7GA 2DK5A 1MMNA 1VF9A 3J7AO 3M1CA 1IXRC 4JQFA 2P8TA 3EQLF 3KE2A 1U78A 4X1EA 5D5WB 1R58A 2QYOA 4BJTA 4U0YA 6PAXA 2ECCA 4XRFA 2XDVA 2IW5A 2PBIA 5GADJ 2Q0OA 4XK4A 5IT9K 1O3RA 1GLNA 2XRNA 1BIBA 1BJZA 3PNVA 1REPC 1FMWA 1BA5A 4HPQA 2D1VA 3K0LA 3DXJF 4IHYA 4XONA 2ELKA 3JAMK 4HV5A 5F64A 4XLCA 3CCLI 3HB9A 4CCLA 3F8CA 3IWFA 1B4AA 4BL0B 1LEBA 1V4RA 1YS6A 3GWZA 3KCCA 3PM1A 4IXAA 3M1EA 5IYBJ 4A5MA 2R7TA 4I99C 3FBNB 3QYBA 2E2JJ 3DFGA 1Y8QB 2E71A 2VOOA 2XAHA 1MJ9A 4RB1A 2DMPA 3WG7H 3KLNA 3LSPA 1ENHA 2EWNA 4Q5SF 3BTJA 5FKNA 1R71A 2JJ7A 1VQ9I 4YIRX 3BOQA 5K5RA 2L9NA 5J47A 5EEAA 1W5SA 3A03A 1KA8A 1MMAA 5ILUA 1X2MA 2X9DA 4HSTA 2V6EA 3D5SC 5LGTA 4UVBA 4DW6A 1B9MA 3K1PA 1JTYA 2RV8A 5ICFA 1KU2A 2O5RA 3ML6A 3WE3A 1LE8A 2V79A 2YU3A 1MBHA 2LKXA 2KL4A 1I39A 2HYGD 4KDPA 1X4OA 1UB9A 2JQ7A 1BBYA 3JTGA 1RETA 5DUIA 4V2FA 1K79A 2FUG2 1K7AA 1U5TA 2E35A 1XN7A 3F21A 3PQKA 2XAFA 1O57A 1LKXA 1NG7A 2E19A 4MFDA 1OYYA 5F1RA 3F6OA 2X6YA 3CZ6A 5H20A 3OYHA 1W5TA 2WTEA 3FXMA 2XPUA 3BG6A 3D5LA 1QQIA 4JK1X 1RR8C 4YRVA 4F3QA 2L3DA 3KYCB 4DYRA 2VQHA 3Q3SA 3HHHA 1ZGWA 3MZ8A 2RNJA 1T8IA 1HCRA 4L5JA 2B63J 1IC8A 5E18F 4CYCB 3REOA 1Z91A 3W2WA 1Q1HA 1EA3A 1BW6A 1SAXA 1HBXG 3CUQA 3IP4B 1B8IA 1VQ5I 1UFMA 4L0ZB 3LOCA 5C44J 3I0TA 4RB2C 4MIMA 4PDKA 3PNTA 1SMYF 2M0CA 4Y4RA 4CZCA 1MZBA 2NS7A 4OAZA 2X4HA 4FHTA 2VONA 3DTEA 1ZKGA 4DGWB 5HOOA 2FE3A 5HS9A 1Z1DA 5CYVA 4HLYA 3MN2A 5KHDA 1TBXA 5TISC 2FEZA 2QBYB 4P1WA 3RQIA 1HLVA 4AUXA 3N4MA 2ZJRF 3K10A 1R9TJ 1IRFA 1R5GA 3RTRA 5J6XA 2BZTA 3I59A 5IP9J 1Z21A 1QZYA 4B44A 4U87A 4HQMA 2EH3A 3LFKA 2UXXA 2ZC2A 2R7FA 5KAFC 3QOPA 3CMEI 3HGYA 4ITVA 3K1NA 2L4AA 3R6SA 2LKSA 4OWRB 3DTKA 4O6JA 2WA0A 3J81K 3DEUA 1YX5A 1J09A 1A35A 1OCZH 3QU3A 2DPUA 2JA2A 5F04A 1FBSA 2W24A 2D5VA 5J1YA 2VXZA 4KITB 1IV6A 1ORKA 2W00A 2ISZA 2EPFA 1TQIA 3L2WA 3H3ZA 5JVGF 4RAYA 1QZEA 1VQKI 1XDSA 2EA2A 5HDKA 3QYEA 2R7VA 2L7FP 1YQAA 2PMUA 5DTDA 3W3CA 5DM7F 2GBYA 2KPMA 2HDCA 2O0YA 3PFIA 1NHAA 4AD9A 4UV8A 3LSKA 2ZJPF 3NQOA 1VQOI 5E8IA 4J00A 1IW7F 3R60A 2W7NA 3OV8A 3HOVJ 1XPXA 4BKXA 4Q47A 2WADA 1H89C 3VWBA 5LHGA 2IGKA 3IL2A 1TP4A 3V7RA 1ETWA 3K4CA 1ZN2A 4LD5A 3TQNA 1ITYA 4A5NA 2ME0A 3BR0A 4HF2A 3BG7A 1E2XA 3CO7C 3PUFA 1YW9A 1WCMJ 4RS8A 3CESA 1O7FA 1D8KA 1P7JA 2ESNA 1IN8A 1ZK8A 2VPLA 2R4GA 2QVOA 4XOTA 3L1PA 3BCBA 5LFAA 2QQ8A 2AQFA 2J5PA 2M1BA 3A01B 5FGMA 1TWAJ 2EZLA 3KP7A 1K6YA 5D5XB 2KISA 1GUUA 1FYMA 5LGNA 1AKHA 2OC6A 2O03A 4HQEA 2W84A 5E79C 3E97A 3FMQA 5J4VA 4XRSA 4AVZA 2DFIA 1QZZA 3ZN0A 5EEGA 3TP3A 2UZKA 2R92J 1T56A 3IWZA 4LG0B 2KFDA 1CGPA 2DOEA 2L02A 3OS1A 2KIUA 2Y30A 1IG7A 2DODA 5FLVA 3KYLA 1EF4A 2O8XA 5F0CA 3FIWA 4WF2A 4DIQA 4BBSJ 1T0FC 3OYGA 3CMMA 1QPMA 1YG2A 2E5ZA 5DV5A 9ANTA 2R7RA 2L54A 1H9TA 4RGXA 2X1EA 4KA4A 3G4SI 4HX7A 4CA0A 3CLQA 1GDTA 2VASA 2XHKA 3LA2A 1JGGA 1FJLA 3RYRA 4CYDA 2VLAA 3BR2A 4ZDOA 4OAYA 3PJRA 2HDWA 2R7SA 5D4SA 4B48A 3RPUA 1Z3XA 3CCMI 3QP5A 3OL4A 1XGOA 2QEXI 5TRDA 2CV2A 1O7LA 4IKFA 3LSIA 2NVUB 3SYTA 1H88C 1VQ8I 5D6EA 1AA7A 1W36D 1DDNA 4CCMA 4ZZDA 3ABKH 2MLKA 1LFUP 3EUKL 4ETSA 3QYFA 4AVPA 4ZJZA 4NC7A 3EUAA 3SHFA 1Y0UA 3WGGA 4HDVA 1ODDA 2LF8A 3ULQB 1YJ9I 3BG5A 2EV0A 1SFOJ 2LLKA 4HAMA 1DPUA 2JRTA 3E6MA 2KZGA 5DEQA 4C3HJ 4CDGA 4EJOA 2NAZA 4K2EA 4PJMA 2COMA 4HW0A 4FX4A 2CWEA 4XSZF 5F1JA 2KZVA 3G2BA 1V5GA 3WTYC 3F23A 1FOYA 1Y39A 2ZFWA 3RCOA 4QWQA 1PUEE 2XV4S 2GIVA 1LPQA 2BXYA 5J1RA 4JBAA 5J4YA 1ZR4A 1PP8F 4UVAA 2I8DA 3OYIA 2CUEA 2FD5A 4M72A 2HVRA 3DP7A 2LF7A 1K61A 1QVTA 2JA7J 1R5ID 2CQQA 5DD4A 3QPSA 2E7XA 3HGGA 4I76A 3EUHA 2P5VA 2X0LA 5D8KB 2HKOA 4BEHB 1OR7C 1JGSA 3WTVC 2BW3B 3BJAA 4XR6A 2XC7A 3OOPA 3HOXJ 3MCZA 1ZARA 1S29A 4RM2A 1DGWY 3GTKJ 5CQEA 3BT9A 4B09A 3DLLF 3BZCA 2K9NA 5D6FA 1SAUA 2CW0F 4PJJA 5DUKA 1WH5A 1PDNC 1QA6A 1JI8A 2L5QA 3S14J 4MEYF 1XX5A 4XLPF 3H1CA 2CQXA 3DCFA 5B1BH 1OJLA 1ZQ3P 2LBFA 3TKYA 1KQ8A 2VI6A 4XLEA 1MD0A 3CCJI 2Z5UA 1HA8A 2GA2A 4NQWA 3RPQA 1Q1VA 3VYRB 3AFHA 1BI3A 2L0KA 4UB6C 4QIWN 1G4DA 4OMYA 3HTSB 4G6TB 3TMOA 1YI2I 4KT6A 4NB5A 2EBIA 2V9VA 1R4MB 3HG9A 1WGXA 2NVYJ 2OUMA 3CC2I 3ASNH 3K2AA 2FRHA 3DPLC 5FROA 4GRIA 5FO5A 3RPUD 3MEXA 5BS6A 5ILSA 3IRQA 4DZJA 3CTAA 1O3QA 3BJ6A 2WAQN 4XMYA 3S2DJ 2BEOA 3AG3H 2FF4A 3DEEA 4BJ5C 4EATA 3ZN1A 4MQVA 4NC6A 1IDYA 2DW4A 1ZGJA 1E17A 3FK7A 2WB1A 2GXGA 1WJEA 4D5CA 3OIQA 4C2UA 2MH9A 4XLAA 5CJ9A 3OMYA 4IRHA 1QBJA 2NOJB 3P9KA 2EFWA 3Q0WA 3FXKA 5J1UA 1KGSA 1PVEA 2XSJC 1HKQA 1VNDA 2Z16A 2O7OA 2K27A 4XOPA 2EQRA 2BY1A 2CW7A 2QKMB 3SXYA 3PO3J 2MC3A 3RJPA 3JRIA 4BE0A 1S3JA 4J19A 3VPRA 3PIPF 1YE9A 5E20A 2H6BA 1WH7A 2VQLA 1ON2A 5JR3A 2Y0SN 1JUSA 4KISA 1MKMA 2VJJA 1IJWC 3CCRI 2FQ3A 1R1TA 2B7EA 4Z6YA 4EM2A 3OYMA 3GZ6A 5FKOA 2XPVA 3OSFA 1YFHA 2I5UA 2PFBA 1IRGA 3A2KA 2M2EA 2QKLB 1B1BA 4Y7NJ 4PFPA 3RIRA 4JOMA 2COBA 1ZYRF 2LNBA 3WTZA 4PSXA 5GAHJ 4XICA 3QOEA 4GYGA 5GTHC 5H2FC 3FF5A 1RC9A 2KRHA 5HS8A 2HZDA 4Z2YA 4L0YB 5F27A 3I9V2 1T08B 2QUFA 2W1OA 5L3CA 1W7PA 4F93B 1SEUA 2HPMA 1QHHD 1ONVA 4AWXB 4XKCA 2AQEA 1J59A 4P55A 5B5EC 3PL8A 3H5RA 2HXIA 4CO8A 1EH7A 3W6VA 1RI7A 5LHIA 2MFZA 1RUNA 4U0WA 4BHPA 2F48A 2LYCA 5E1WA 3L9FA 1T0FA 1D1CA 1TT0A 4PJNA 2DPDA 2A68F 2E2HJ 4UHTA 3HRUA 2HQ5A 4R8HA 3ZQQA 5JHUA 5FD6A 5B1AH 4HG2A 1OPCA 3M8EA 3K4NA 4KMFA 5EZHA 1JT6A 2BOLA 3G1OA 3BZKA 4ANJA 4O3MA 5BQTA 2VJ4A 4IF4A 3QRFF 5FLXZ 1PJRA 3SDGA 3K4MA 2F5EA 1QHGA 2DQRA 5LEJA 1TC3C 1Z6TA 2O9LA 2EZHA 4P9UA 1SD6A 5E3MA 2KKOA 4LOCA 4MHGA 1SD5A 2VC0A 3HSEA 4MLOA 3RI4A 3QPHA 2R93J 3J7AY 4O5VA 2P4WA 4LB6B 2ICWG 4CSWA 4B8XA 2XAGA 2H8RA 4ZTJA 2F2EA 5FFZA 1N78A 3H3VK 3PSFA 3QODA 4G7HF 4NHJA 4M74A 1JJ6C 5DCMB 1WKMA 2DTRA 1T39A 3ZR8X 3RZDJ 2K9QA 3E5XA 3VSLA 3DPUA 4M3GA 4BH9A 3SQNA 3G71I 5FKLA 1IZ1A 2XKOA 1ZHFA 1GT0C 2FNPA 1B6AA 3MZYA 1SVOA 4JYKA 3CMYA 2AXLA 2B9SA 3MFKA 1ZELA 1I1SA 2BHYA 3K69A 2PX9A 4RA2A 4C9YA 4LMYA 2VB6A 3ZGKA 3H36A 3EETA 1LFBA 3ZMDA 2QGUA 2FU4A 2Q2EB 4RM3A 2FNAA 2A3SA 4GXOA 1Y0NA 1P2FA 1RR7A 2DT5A 4IQJA 3BROA 1OR7A 1FTTA 1WPKA 3GVAA 4L9JA 1BIAA 3GF2A 1DGRM 1I3AA 4LGWA 4S04A 4JX6A 1HSTA 3FZVA 3H5NA 4FT8A 4BHCA 4H0EA 1KQ0A 4LLGF 3ZQCA 3ZPLA 1IRXA 2CFXA 3SDBA 2QSHX 1DQUA 2EFQA 3Q0UA 4EGZA 2K85A 4BY1J 1SFXA 4ZH4F 2KIFA 3SEQA 3ESWB 4I0BA 4M3BA 2E7WA 3K9TA 4IHXA 5KK1A 2MLGA 4BU2A 2RQQA 2ESHA 1ZR2A 2EIKH 3C18A 2WY7Q 3D5RC 4BE1A 4L5EA 1IUFA 4BE2A 1I50J 1P4XA 3NWSA 1S6LA 1YRNB 4M3DA 1MW7A 5J40A 3VYTB 2DTZA 2JN6A 3U1DA 1XS9A 2XGXA 4KMUX 3RYPA 2KHMA 4FTHA 2X6WA 4XRMA 1XG1A 3H5AA 2XB0X 3EDPA 2K3PA 2IGNA 2DA7A 3KP6A 4B1RA 5LLQA 2BYVE 2M4KA 4EM1A 1UHWA 3WGIA 2LY1A 3FKIJ 4PFOA 4M3EA 1YX3A 4HEA2 5HNFA 4RB0A 5L3BA 1XSDA 3T0YA 3X2QH 2MD5A 3HPHA 1VI0A 2V7FA 3QAHA 2XAJA 3MMYB 1BR1A 5JHFA 5D5VB 1CF7A 3I71A 2B0LA 3BPXA 2X51A 3F9KA 4PCQA 4KIBA 3GO5A 3E6CC 3TOAA 2PMHA 5B66C 2IBDA 3CCVI 3E1SA 2OD5A 3DBRB 4CYCA 3CDLA 5EEHA 2HS5A 4E7HA 4V2GA 4GFBA 3K4LA 2ZFUA 2OU2A 1R00A 1WJFA 2CQ7A 3W2AA 2HVQA 3OYBA 4HX8A 4QPQA 5AONA 1POGA 2EIJH 3BR5A 4RAZA 3ZMTA 3TL4X 3GTJJ 2PQ8A 2CUFA 3RZOJ 1WZ2A 4XBFA 1AHDP 1WVRA 2CU7A 4D5FA 2QWWA 4IHWA 3K6GA 4P96A 2BY0A 1GHCA 1P4WA 2DA5A 2DO7A 4ESFA 4RLQA 1G59A 2JA5J 1C0WA 2VOPA 5E8GA 3HHGA 3COAC 2ZNZA 2G7UA 2DLLA 2P7VB 1F36A 2AHQA 3HYIA 2KRCA 3ERMA 1MH4A 4OOIA 3I55I 1O3TA 1JXSA 3JSOA 3J7YJ 1D8JA 4RMNA 3HOWJ 1SVMA 3KYDB 3Q9VA 1MMSA 5GTIC 2HOAA 3JRGA 3QPLA 4A3GJ 2FA5A 2BY2A 2NYXA 3HRSA 5DM6F 5L3FA 2DDBA 2VBWA 3ZOBA 1WJAA 3O8GA 2DFEA 3VODA 1XGMA 1O3SA 4I01A 3R0AA 1WJDA 5EG0B 2L4MA 3AG4H 1R5HA 3I64A 4AIDA 3ISPA 4E70A 4ZYEA 2XF5A 4KN4X 3WTSC 3GLXA 1ETVA 4LFUA 1TWFJ 2UWMA 2RAEA 5H6QA 2OTJI 2DU9A 5KVRA 2ZJQF 4LG3A 2ISYA 4M9ZA 1XMKA 4BACA 2HOTA 3TO6A 1RUOA 3QP6A 1ZRCA 3SZTA 2PLYA 3HM5A 3IAM2 2E5NA 2KDOA 2NOGA 3O3KA 3LSHA 1D1BA 5E17F 4HNUA 2FBIA 4A12A 4BDZA 1N75A 2IGOA 5EDNA 2VPRA 1G6NA 4E7ZA 2RNGA 1TL8A 5IYCJ 3EYIA 1HSJA 4U88A 1ETXA 1LJ9A 1X1PA 1VQ7I 1JHFA 2DMNA 5K1YA 3DTIA 5E3LA 5HLTA 1QO0D 4CCNA 4A6EA 2LP0A 2ECBA 2JK3A 4D9JA 1D5VA 4Y17A 4YG2F 3JCUC 4G7OF 5LGUA 4A69C 1UAAA 1ZTRA 3A01A 3G73A 2P5KA 4E7IA 1K78B 3HKZA 2Y31A 5TGTA 3E5QA 1R1UA 2EZKA 2KJCA 2PJRA 3V7CA 2IS1A 1UG2A 4LK0F 5CVIA 3DPTA 4S0HB 2XGCA 4KIFA 2BVLA 4W1UA 4CCKA 1SFUA 1EV7A 1YHQI 2E60A 2VODA 3P9CA 3AG2H 3AG1H 2V9PA 1BL0A 2V26A 3AKZA 4YFKF 1GVJA 3PNYA 5CVRA 3VDXA 2NNYA 2ZCWA 2JRMA 5FB2A 3B6CA 3KIOA 2A6EF 4G6DA 2HTJA 2M8EA 3P5JA 2RN7A 2XB5A 5CVVA 1FIAA 2W4SA 4IVNA 1LNWA 4ZDPA 2NXNB 1XTAA 4P5OA 2CG4A 1LUJB 1LE8B 1U3EM 2HI3A 5L3EA 1F9NA 5EF6A 2EK5A 2LTPA 2R7OA 3HRTA 2IA2A 4G12A 3N97A 1RRJA 4YELA 4XL9A 3LWFA 4M73A 2Z1DA 1V5FA 4Y15A 5JVTA 3GMEA 3O8HA 3LNQA 2O61A 2EZIA 2IS4A 2M34A 3V8KA 2R7ZJ 2FOWA 4M9SA 2F4MB 4ZYHA 3I4NJ 3CP2A 3OSGA 2OZUA 4Y33A 3R4KA 4HOBA 2JPBA 3W2VA 4F92B 1TNSA 2YPRA 2O3FA 2STTA 2DBBA 1W0UA 1TWCJ 4RAFA 3OOUA 1D0XA 2W48A 3OY9A 1LFPA 1HKSA 2ZMEB 1HDDC 2PJPA 5A2QZ 4A3MJ 1R22A 2XROA 3H0DA 1FBUA 3WGHA 1B8IB 5E1ZB 2MSYA 3FMSA 2HKXA 3ZQHA 1H8AC 1PUFA 4DBRA 3GX4X 3SJMA 3GBGA 2CV1A 4GGGA 5IP6A 5GPAA 5HLIA 5M3FJ 4UUSA 2JUCA 2IGMA 2L2OA 1MIJA 4AU7A 1OYWA 3HUGA 5FLXK 2HEOA 2XUBA 3S1MJ 2EILH 3H9GA 4LK1F 5FFXA 4FCYA 1J2XA 2WAEA 3FBIB 3IH3A 3GYHX 1SD7A 2LOOA 3FXJA 4FISA 4WXDA 1UHMA 1A31A 1A04A 1NG6A 1F43A 1OMIA 1OLTA 2D2WA 1ULYA 3BTLA 1BW5A 3CC4I 4BEHA 3HRMA 2BW3A 3KZIC 3BG9A 1M1EB 2Y75A 2G0EA 3UKGA 1Z9CA 1CQTA 4LIUA 1MSFC 1KYZA 2XKPA 5GP9A 5D5UB 4PGGA 1LVKA 4II2A 5HVQC 3MWMA 2YR2A 4HF1A 1XGSA 4WX9A 1HW5A 2EFPA 4M6VA 5FJ8J 3U2RA 3MKYB 2R5YB 1SC7A 2L9SA 1SFEA 3VB2A 4N4OB 2P7CB 2VQCA 2EJRA 3TW6A 2XPWA 5AIQA 1Y6IA 2GOMA 2JA6J 1D0ZA 4ESBA 5K7FA 4CGZA 2KIQA 2Q8KA 2OCEA 3FXRA 3TDUC 3RSNA 2IRFG 1BN5A 3GLLA 4DYCA 4F91B 2R7QA 1FSHA 1TQPA 2R5ZB 1KONA 1YITI 3LSMA 2XAUA 2H94A 4MGRA 4MQ9F 1IN7A 3CLOA 3K4JA 4NDLA 3Q5FA 2E1NA 2W85A 3KP4A 1JTXA 2XGEA 2ZKZA 4TV7A 2Z2SB 2QLZA 4LIVA 1I1GA 5EZGA 1W0TA 3I53A 4A3CJ 1FLIA 1UMQA 1ZLKA 4RB3C 2ZB9A 4FQGA 4JP0A 5JFRA 4BQNA 2Z3YA 1A36A 1KZHA 2WB1N 2DA2A 4BUPA 1FEXA 3KP2A 4HBLA 4XKVA 3GFIA 4II3A 3BC8A 5EGOB 2V9KA 1IGNA 3OYCA 3L2QA 1HXDA 4RGUA 3GEZA 2OJED 5FRNA 5CVJA 2WV1A 3GFMA 3BDDA 4KICA 1P9QC 4F55A 5H6RA 5L3GA 3L09A 2ACJA 1XCBA 2G9WA 1Z67A 4N9IA 3M8JA 4MTEA 4IX7A 3HEFA 1Z7UA 1FNNA 3ZMUA 1IAWA 1RIOH 5KNLA 3KETA 3QQAA 2DA3A 4IHSA 3S1NJ 1D3YA 3VEPA 1P6RA 4ZDLA 4BXUA 1FMVA 4D7NA 1UJ8A 1EJ9A 1QU3A 4EVIA 4WK8F 3FX3A 5BNGA 3S3MA 3CCYA 1U6GA 2JPCA 1X1CA 3JRHA 1QVUA 4BXXJ 5DD8A 1ACIA 4AM3A 4DYQA 2JSCA 4ZYGA 1YS7A 1W5CC 3JRDA 3MKZA 2LR8A 3KZZA 4NBQA 4D0PA 2A5WA 3F8NA 1DP7P 2HYJA 2JA8J 1FC3A 1AU7A 5LRSA 1WWXA 3MKLA 1YOVB 1ERDA 1S9HA 2QQAA 1H0MA 3GTOJ 3OYFA 2UV1A 1RKWA 2GZWA 3JW4A 3R0JA 3C1DA 4GCVA 2OTLI 4AC0A 2MC4A 3CF5F 2CJJA 4KT5C 4YIFA 1FOKA 3V42A 5F08A 1B9NA 1F4KA 1YJNI 4IZZA 1IDZA 1Y1WJ 1TTYA 1Z0XA 4Y3OA 2ZJ2A 4N9HA 5M5XJ 3I4MJ 2M4GA 3LA7A 4B43A 2D1HA 2BXZA 1VQMI 1A6QA 1YJWI 4E4HA 3DQVC 3HJEA 1V3FA 5FRMA 3HDDA 2F5DA 3OYDA 3SFZA 4Y13A 1BC7C 2STWA 2JTVA 3M9AA 2WBMA 5M3MJ 5HLGA 3H0GJ 2QENA 2BV6A 4OIPF 2V6CA 4CHUA 3ONQA 3CO6C 2K40A 2L7ZA 4E7LA 3KLOA 1YIJI 2GXAA 3PUBA 4EMSA 2GA1A 3U1KA 5K7HA 3RKWA 3CP8A 2IP2A 3CCSI 2H8WA 3J81Z 3UNGC 1I6XA 3BP8A 3L00A 1OCCH 1T33A 5CQGA 3HXLA 1R1VA 3BR3A 2CS3A 4HNTA 2H1LA 2HGCA 3ELKA 1AOYA 4XRSG 4UB8C 4PJ0C 4BBRJ 3BJOA 4I02A 2X1DA 4ASNA 2PMZA 4L9VA 3AAFA 2BVMA 1F1ZA 4XLFA 3LSTA 3H92A 3M4OJ 3QPTA 3ZMSA 4G9YA 3KP5A 3V7SA 3MAJA 2Q2EA 4PSWA 1FT9A 2Y69H 3KPHA 4DNCA 4NQWB 1PP7U 3CD6I 3R61A 2JUGA 2IS2A 2OV7A 3DU5A 3GFLA 1XMAA 2KDZA 3BTCA 2M0MA 1J0RA 4YFNF 1XC5A 2YS9A 4XN3A 1P7IA 1X1BA 2DYSH 1SANA 3I58A 1XSVA 1VQPI 2FJ1A 2E36A 4WXCA 3TO7A 1ZGAA 3HSRA 3HOSA 1IV8A 2BY3A 4W97A 4A3LJ 3ZMZA 4BJ6C 2IXSA 3F8MA 4C30A 1TW2A 5C3EJ 4XNFA 2V1UA 3JR9A 1MMGA 4A3JJ 1OQYA 2A05A 3ZRGA 2DOAA 1OKRA 4V19K 1DUXC 1X3UA 1E3PA 5HDNA 1LQ1A 1HC8A 2QSGX 3HC7A 2W82A 4DOZA 4FE4A 4YFXF 2PEXA 3N05A 1YRNA 3FWEA 5BPDA 1ETYA 2MW8A 3TOBA 3F3XA 4LJZF 4KFCA 2DMTA 2HOEA 2HU9A 3E5UA 3G6EI 3PSIA 1U2WA 2DT7B 2ZMEC 2M7BA 2N8GA 2YSRA 3HOTA 3ZQFA 4DJAA 1JT0A 2CMPA 4BQOA 4KIGA 5KCMA 1UZCA 1XDUA 3GFJA 4XN0A 4EQQA 3ABMH 2VIXA 2VKDA 5E1XA 4D7MA 2L9RA 1X1DA 5LBQA 3RKXA 4OIOF 1KQ9A 3BZ6A 1YIOA 5IOYA 1STZA 1ZREA 2ID3A 2H27A 3JRFA 4G6QA 1D1AA 2E1MB 5EJCA 2DFFA 2JZYA 2VKEA 1E0EA 2CRGA 2GAUA 3ZP5A 4HSRA 2BGCA 3WHCA 2F4IA 4RGRA 1P4AA 4XQFA 4FETA 5HODA 3MQ0A 4RDUA 1YW8A 4N4NB 4OMZA 2NS8A 2ZO4A 3ABUA 4ON0A 2KT0A 4ZC3A 3MKWB 5M5WJ 1ZG5A 1IF1A 4MNUA 3VSKA 3OR1C 1MJBA 1W7PB 2P6TA 3IH2A 2BBYA 1L3LA 2O6GE 5FD5A 4HRIA 2F5CA 2V1NA 4A93J 1HOMA 3B6AA 4OU0A 4GO1A 2A07F 3WTXC 2PG4A 3S16J 2CGPA 3CF2A 1RESA 3L7WA 4EJTA 4FE7A 3K4BA 1JUPA 2KQRA 4XLHA 5CVUA 1OCPA 4OIRF 1U8RA 3P7NA 3B73A 3LSRA 3J80Z 4B4CA 2VKHA 5IY5H 5F0FA 1A5JA 4F7ZA 3CCUI 1TQMA 4IJAA 1BM9A 1WJBA 2FBKA 2HQRA 1OYIA 4DQ2A 4E6KG 3HL2A 3RDIA 1MBEA 2L9VA 1X58A 3C3WA 2V4JC 3C2HA 3E6DA 1X3ZB 2XAQA 4AYBA 2E34A 1T6SA 1U9NA 3V8JA 5LD2C 3FM3A 3G3ZA 3VYSB 5GPCA 4R1HA 4ENMA 2GM4A 1MGTA 2R7WA 2DAOA 5EG0A 2GWRA 3B02A 3TW7A 2WC2A 1ETQA 4A0ZA 2EV5A 2J5OA 4JX4A 2EINH 1HKTA 2ZXJA 1TW3A 4BY7J 3CJTB 5K5QA 2LY9A 1P92A 2HNHA 1HW1A 1USSA 3BR1A 4U7DA 3DLAA 1JUMA 2JWTA 1LEAA 2VBZA 3Q0VA 4P9FA 3A0BC 5GAEJ 4XIDA 1K83J 3OYAA 4XKWA 1NK3P 3AL0B 3MD2A 2R7XA 2BE5F 4X0GA 2L7MP 3ZMVA 3K70C 4ENNA 2L01A 3TBIA 1RKTA 3LL7A 4A3IJ 3IC7A 2X85A 2RDPA 3V4GA 5E3NA 4A2UA 2FMYA 1Y56A 2M3AA 2HOSA 1ON1A 2DI3A 5K7ZA 1SVLA 2EIMH 4G94A 4UNOA 3IH4A 5JLWA 3GTQJ 1RNLA 2XASA 5AIPA 3G1LA 3SZPA 1OISA 4M3FA 3TDZC 3KP3A 4HZFA 3A1YA 1K78A 2K4JA 3HKZN 3K7AJ 2QCOA 1FYKA 2EA4A 2IAIA 2E1CA 5HNHA 2FMLA 1KU7A 2QBYA 2IA0A 3S3OA 3JRBA 2KP6A 2DA4A 4L9TA 4UY8I 3DKYA 1GV2A 4HV6A 5J3LA 1E3OC 3OL3A 3W6KB 3IRRA 3E7LA 2TCTA 3DV8A 2MD0A 1WSUA 4CCOA 2ELJA 3WTUC 2AS5F 1MSEC 1VQ4I 3KFWX 5IT3A 2PN6A 2XVCA 3O2PE 3CQZJ 3GZNB 1B72B 4IOCF 3U21A 5D4RA 3PQJA 1JKQC 2BHZA 2YX4A 1K6OA 1LDDA 1YW7A 1BOAA 3Q9SA 2A61A 3GZ5A 1EKEA 1W1WE 2W57A 2LFBA 1MDMB 3MZHA 1IXCA 3ZQIA 4PUSA 3H9JA 1XSXA 4OINF 3JSPA 2OQGA 1TLHB 1YLFA 1NH3A 4C2MJ 4AIHA 2H1KA 4QSHA 2OPTA 3TEDA 4MFEA 3CC7I 2DMUA 3GTMJ 2ZSHB 2DA6A 1CF7B 2FQ4A 2OAZA 5JLXA 3K1MA 3KEYA 5JI6A 1KU9A 2HZTA 2FXAA 5LEKA 5BMZA 1EH6A 3IKTA 1R23A 2MABA 2QQ9A 2VBYA 3LQQA 2RKHA 4X6AJ 2MBFA 4A0YA 2ZMEA 3D1NI 2DDAA 2MH2A 3EUHC 1S8NA 3JTHA 3FHZA 4FX0A 3RKYA 4ZZLA 1JKRC 1JKOC 4IHTA 4HLXA 4LLNA 1XMXA 3CJQB 2VQGA 1T38A 2LKPA 1SD4A 3NARA 2X1CA 1HF0A 2ADUA 1BI0A 2LC2A 4EEFG 4AIKA 3VFZA 2I10A 4LG0A 1UHSA 3ZQLA 3OYNA 3H35A 1H9GA 4HF0A 2E2IJ 3FXUA 1T98A 5IP7J 2CFOA 5LHHA 2H09A 2E1OA 1V55H 3W6JB 2VE8A 4QTRA 2X6OA 2DFHA 1WJCA 4WXHA 1FYLA 4M6YA 4NC8A 3PFYA 2K9MA 2RGVA 1U9OA 3OS0A 2JT1A 2YU9J 5FKKA 2OZ6A 1IN5A 1VTNC 2DA1A 5DCFA 1OCRH 2QSFX 4KNYA 4EJWA 1QGPA 1G3TA 1U5TB 1J9IA 1V5EA 4CICA 2IA1A 4HA8A 2R5YA 3BQZA 3RQ4A 1J5YA 1JHHA 2VUMJ 3HIFA 5TJJA 2RREA 4DBQA 4MTDA 2IT0A 2ZSIB 2FX0A 5M5YJ 3CCQI 1FX7A 2LG4A 4QPOA 2PI0A 1S72I 1OCOH 2LY2A 1LB2A 1F5TA 2OQRA 2CYYA 3QU6A 2D45A 3BPVA 3IAS2 1IN4A 3OYEA 3L2RA 2QQBA 1Z77A 3WE2A 2P0WA 2DYRH 3M3YJ 1L0OC 5KAIC 2FSWA 1JKPC 2XSDC 2EFNA 1Z7LA 2R5ZA 3G1MA 3GXOA 3I4PA 2V1DA 5CLSA 3F6VA 3H3UA 1FZPB 1RZ4A 4GYIA 1UG0A 3CUQB 3F0CA 5L3DA 4ZYDA 3ZXSA 4S05A 2Y9YA 2IVMA 1Z3YA 2QM3A 1VFCA 2WAFA 1KU3A 4BGDA 2JMWA 4BXFA 3J7ZI 2E1MC 2K5CA 4PGHA 1VQ6I 5IYDJ 5ICCA 4D1QA 2ZNYA 4L18B 1A6IA 4A3FJ 3FISA 5DS9A 1MMDA 1BI2A 3NRVA 3BR6A 1BOBA 3FM5A 5EGOA 4B47A 3C7JA 3OYJA 1OCTC 2PJRB 3FKJA 2A6HF 3SEZA 3C2BA 2P81A 3QWLA 2MYSA 2IPQX 1I27A 4LITA 1QPIA 2GIZA 1LVAA 3ZQ7A 2YUSA 1D5YA 4ABZA 2KJBA 2NVTJ 2M9HA 3I59B 2HYFA 3LQRA 1YO5C 3BQYA 4XM3A 2DOFA 2IEKA 3U9GA 3M07A 4U0VA 5ICEA 2AO9A 3EYYA 2R0QC 1ZG1A 3I54A 3I56I 1MH3A 4C3IJ 4C3JJ 1USTA 4N0BA 1TZLA 1GXPA 1WRJA 1AWCA 2K86A 3VYUB 3NWTA 1YYVA 4BQQA 4IQ4A 2GXBA 3GUDA 2R7UA 2TRTA 4LB5A 4Y52J 2WY8Q 1IXSB 3F8BA 1DPRA 4DZPA 1EH8A 4IO9F 2HQNA 2LMDA 1IO2A 3L2UA 3F22A 4I6ZA 1U8BA 4YIIA 1B59A 1G8XA 2VE9A 5IT9Z 5C4XJ 1HW2A 2QZ8A 4CZZA 1O4XA 5E3OA 1R36A 3DBHB 1ZRDA 1FIPA 4M9XA 3OYLA 2AXTC 3JAMZ 2F5FA 5CPRB 3ZQGA 1FOXA 1FWZA 2HWVA 3S8PA 3JRCA 1MBJA 3TO9A 3HOUJ 5IOZA 4IRGA 5F6FA 3BG3A 2KMUA 3SZGA 3AL0C 3J80K 1YTYA 1TWHJ 3S3NA 1AKHB 2K7LA 4UVCA 1U0JA 1GVDA 1PUFB 2OA4A 1XCVA 3L2VA 4UUSB 2HFHA 1X4PA 1Y1VJ 1Z6RA 4L5IA 2ZXWH 3ECOA 4UUVA 3HUGB 1K4TA 3DKXA 2C6YA 3FK6A 4G7ZF 2NS0A 4EGYA 4L9NA 4IL6C 2NRAC 1WFXA 1X19A 3KX2A 3PO2J 4LLLA 1ZAOA 3A0HC 2G7HA 3K2ZA 4EJVA 1T2KA 2ZBKA 4XLNF 4ESJA 1APLC 1Y8RB 3K70D 2LSOA 3BCAA 4RLFA 1BR4A 4AIJA 1ETOA 3OS2A 1NK2P 2WWYA 2K3FA 4I98B 4NUBA 1IUYA 2LK2A 3S17J 2X6XA 4WWCA 2HQAA 2M87A 3ECHA 3PIOF 3LA3A 3S93A 3KZYA 2DJIA 2Y0MA 2ME6A 2LDUA 3FXLA 3IV5A 1MNMC 4KJZA 2CH0A 4E7JA 2XRLA 2A69F 2RQPA 5ERIA 2K9SA 2MGQA 2VC1A 2PMZN 1K4SA 3ABTA 5FKMA 2HPIA 2NVQJ 1KYWA 3HOZJ 3HZJA 3GTGJ 5IPAA 1VQLI 1R6RA 3E6BA 4IRIA 2XGDA 1NTCA 4UV9A 3OR2C 3HOYJ 3A02A 2F5VA 2NVXJ 1ZLJA 3RKQA 3OIOA 2V1XA 4H4KC 3FHNA 2EV6A 1HDPA 2VT2A 4M71A 4PK4A 3SFIA 1RPWA 3E3VA 4WCGA 2Y9ZA 2LD5A 4EV0A 4HX4A 5DYMA 4CXFA 4I09A 4YEJA 2DCEA 4OIQF 2HVSA 2IJLA 2LVSA 1ETKA 1BI1A 3CDIA 2CW8A 2GQQA 2VXDA 3GCMA 4BS9A 2VJIA 1MBKA 2OCCH 3FXOA 3TP0A 1G3SA 3T8RA 3WU2C 1PYVA 3KEQA 2HR3A 2VT3A 3WHBA 4ZTFA 1J7KA 3BTIA 3TGNA 3O6BB 2QA4I 1JJ8C 4UXNA 2CUZA 2VBXA 2K02A 3I3LA 4RGSA 3S1RJ 3VOEA 4IEJA 3P9IA 4I7HA 4A0XA 1Z05A 4KYWA 3H9QA 4F52A 2ZXIA 2EFOA 2MG4A 3I5UA 2GLOA 5DCMA 3EPZA 4IHVA 2H6CA 2FBHA 3LSGA 1DU0A 1ZH5A 3IHUA 4HNVA 2DT6A 1GXQA 3LFUA 4ENJA 2VKVA 4MO7A 3T1BA 2YX7A 4XORA 1E3HA 1FP2A 3OWTA 1W4MA 1X1AA 1WI3A 3CJNA 1GV5A 3F8FA 3HTUA 2KRFA 4CH7A 3DBLB 4R79A 1MNEA 4A3KJ 1N25A 1BR2A 1SMTA 3L2CA 5HS7A 1BJAA 3LAJA 1QRYA 2A6TA 3MVPA 2LBFB 4A3EJ 2CUJA 2NNNA 4ENKA 3WTTC 5FLMJ 4PJLA 3HPGA 2M8GX 3F72A 5F0HA 5ED4A 2ZXHA 3S1QJ 2VJ5A 1MJAA 1S7EA 5CKTA 3JREA 3BWGA 2CSOA 4M6XA 2VL8A 1HQCA 3S2HJ 2CO5A 2R3SA 4QLCU 4NNJA 4I2OA 1U5TC 4A6DA 4B3AA 5HDGA 3OIPA 4FASD 4B3XA 3WU1B 3S15J 1UELB 1JE8A 2WAQA 4CCJA 2TDXA 1IRZA 1FOWA 1S7AA 3C2GA 1TWGJ 3OYKA 2Z33A 4PZJA 3WTWC 1J75A 4IOAF 3LAPA 2O8KA 2X48A 3WG9A 4RAGA 3T8TA 4BYYA 1DP3A 3DEWA 4ZYAA 4JX5A 3DF8A 2JVHA 3DKWA 2CV0A 4UUTA 3FDYA 1FY7A 3BLYA 1OFCX 1XGNA 4AYBN 4MEXF 1LDKB 1MBFA 1TT5B 3CUQC 4BAYA 2ID6A 3T5XA 1G3WA 1V54H 3S32A 2P5LC 3CUOA 1G3YA 5DDGA 2A5YB 2LREA 4XSXF 2Y0SA 1VQNI 1DU6A 2M30A 1T95A 1BC8C 2KLOA 5BPIA 4HDUA 1WQ2A 3LMMA 5C4JJ 3FXQA 2Z99A 2DMQA 1N77A 4Q4ZF 2RVCA 1VZ0A 5LRRA 2DQLA 2RC4A 4EJUA 4BDYA 1TNTA 1I5ZA 4XKBA 3D0SA 4GDFA 1SFKA 2F4OB 3BY6A 3IKVA 4A3DJ 2M45A 3UR3C 2P6SA 4Q48A 3CCEI 1WHUA 3CDHA 2Z9OA 2MA3A 2LH9A 3ROUA 5J8FA 3GTPJ 2IS6A 5K5OA 4C2TA 2HXOA 1X2NA 3ZCOA 1R4NB 3K4KA 5A2QK 4CUGA 2OBPA 2DN0A 1IN6A 3ABLH 2K9LA 5EYRA 2HDDA 2FOKA 3NAUA 1WI9A 3A4CA 1R49A 2Y2ZA 3GTLJ 2GOXB 5ILVA 2CQNA 1MNDA 4EM0B 2JSPA 1I3QJ 3GW2A 5ICGA 1QNTA 3ASOH 4BNCA 1WJ5A 2UUZA 2ETHA 1ZG3A 4HYEA 1W36C 2F6CA 1W7PD 3FMRA 2K4BA 2M7AA 3E0JB 1XB4A 2R7DA 4E7KA 3WODF 2XF6A 1S7OA 2JVGA 3CJRB 1S5LC 4E7SA 3HSFA 3CMAI 3LSJA 5GAGJ 3IUOA 3WU0A 5B3SH 1LDJA 2UXNA 1X3WB 2DK8A 1FPQA 3KEOA 2EB7A 4IPAA 2W25A 1MBGA 2DXIA 5BOXA 1G2HA 2XIGA 4KUMA 4BHBA 4J01A
chains in the Genus database with same CATH topology
1FP1D 1FSEA 1ZRFA 3M8FA 2VN2A 4U7BA 5J8CA 1R7JA 1FBQA 2KIMA 2Y48A 1XD7A 2HTSA 3S2WA 3NEUA 1UCRA 2ELHA 5D8LB 3ERED 1MDMA 2M5WA 4I0AA 4KN7X 2WV0A 4BQAA 3V8LA 5HLHA 4G8XA 2CQKA 3M7GA 2DK5A 3J7AO 1IXRC 4JQFA 2P8TA 3EQLF 3KE2A 1U78A 4U0YA 5D5WB 1R58A 2QYOA 6PAXA 4XRFA 2IW5A 2PBIA 2Q0OA 5IT9K 1O3RA 2XRNA 1BIBA 1REPC 2D1VA 3K0LA 3DXJF 3JAMK 4HV5A 5F64A 3F8CA 3IWFA 1B4AA 1LEBA 1V4RA 1YS6A 3GWZA 3KCCA 4IXAA 4A5MA 3M1EA 3DFGA 2VOOA 2XAHA 1MJ9A 4RB1A 3KLNA 2EWNA 4Q5SF 3BOQA 5K5RA 1W5SA 1KA8A 5ILUA 5LGTA 4UVBA 1B9MA 3K1PA 2RV8A 5ICFA 1KU2A 3ML6A 3WE3A 2V79A 2YU3A 2HYGD 4KDPA 1UB9A 1BBYA 3JTGA 5DUIA 1K79A 1K7AA 1U5TA 1XN7A 3F21A 3PQKA 2XAFA 1O57A 1OYYA 5F1RA 3F6OA 5H20A 1W5TA 2WTEA 3D5LA 1QQIA 4JK1X 2L3DA 3HHHA 2RNJA 4L5JA 5E18F 3REOA 1Z91A 1Q1HA 1SAXA 1HBXG 3CUQA 1UFMA 4L0ZB 3I0TA 4RB2C 4PDKA 1SMYF 1MZBA 2X4HA 4FHTA 2VONA 5HOOA 2FE3A 5HS9A 1Z1DA 5CYVA 4HLYA 1TBXA 2FEZA 2QBYB 3N4MA 1IRFA 1R5GA 3RTRA 5J6XA 3I59A 1QZYA 4HQMA 3LFKA 2UXXA 2R7FA 3QOPA 3K1NA 2L4AA 3R6SA 4O6JA 3J81K 3DEUA 3QU3A 2DPUA 1FBSA 2W24A 2VXZA 2ISZA 1TQIA 3H3ZA 4RAYA 1XDSA 2EA2A 5HDKA 1YQAA 2PMUA 2HDCA 2O0YA 3PFIA 1NHAA 4AD9A 4UV8A 3NQOA 5E8IA 1IW7F 3R60A 3OV8A 4Q47A 5LHGA 3IL2A 3V7RA 1ZN2A 4LD5A 3TQNA 4A5NA 4HF2A 1E2XA 3CO7C 1YW9A 4RS8A 1O7FA 1D8KA 2ESNA 1IN8A 2QVOA 2J5PA 2M1BA 5FGMA 3KP7A 5D5XB 1FYMA 5LGNA 2O03A 4HQEA 2W84A 3E97A 3FMQA 2DFIA 1QZZA 3ZN0A 5EEGA 2UZKA 3IWZA 4LG0B 1CGPA 2L02A 2KIUA 2O8XA 4WF2A 1QPMA 1YG2A 5DV5A 2L54A 1H9TA 4RGXA 4KA4A 4HX7A 2XHKA 3LA2A 3RYRA 4CYDA 5D4SA 3RPUA 3QP5A 1XGOA 5TRDA 1O7LA 5D6EA 1DDNA 4ZZDA 2MLKA 4ETSA 4AVPA 3SHFA 1Y0UA 3WGGA 4HDVA 1ODDA 2LF8A 3ULQB 2EV0A 1DPUA 4HAMA 2JRTA 3E6MA 5DEQA 4CDGA 4EJOA 2NAZA 4K2EA 2COMA 4HW0A 4FX4A 2CWEA 4XSZF 3WTYC 3F23A 1PUEE 2ZFWA 4QWQA 2XV4S 2GIVA 4JBAA 1PP8F 4UVAA 4M72A 3DP7A 2LF7A 5DD4A 2E7XA 3EUHA 2P5VA 2X0LA 5D8KB 2HKOA 1JGSA 3WTVC 3BJAA 3OOPA 3MCZA 1ZARA 1S29A 4B09A 5D6FA 2CW0F 5DUKA 1PDNC 4MEYF 4XLPF 3TKYA 1KQ8A 1MD0A 2Z5UA 2GA2A 4NQWA 3RPQA 1BI3A 1G4DA 4OMYA 3HTSB 4NB5A 2V9VA 2FRHA 3DPLC 5FO5A 5BS6A 3IRQA 5ILSA 3MEXA 3CTAA 1O3QA 3BJ6A 2BEOA 2FF4A 3ZN1A 4MQVA 2DW4A 1ZGJA 1E17A 2GXGA 2MH9A 5CJ9A 4IRHA 1QBJA 3P9KA 2EFWA 1KGSA 1HKQA 2K27A 3SXYA 2MC3A 3RJPA 1S3JA 5E20A 2H6BA 1ON2A 5JR3A 1MKMA 2FQ3A 1R1TA 4EM2A 3GZ6A 1YFHA 2PFBA 1IRGA 1B1BA 3RIRA 1ZYRF 2LNBA 3WTZA 4GYGA 5HS8A 3FF5A 4L0YB 4Z2YA 2QUFA 5L3CA 1W7PA 1ONVA 4AWXB 1J59A 4P55A 4CO8A 1EH7A 1RI7A 5LHIA 1RUNA 4U0WA 4BHPA 5E1WA 3L9FA 1T0FA 2DPDA 2A68F 4UHTA 3HRUA 4R8HA 5JHUA 5FD6A 1OPCA 3M8EA 4KMFA 4O3MA 5BQTA 4IF4A 3QRFF 5FLXZ 2F5EA 2DQRA 5LEJA 1Z6TA 4P9UA 1SD6A 2KKOA 4MHGA 1SD5A 2VC0A 3HSEA 3RI4A 3QPHA 4O5VA 2P4WA 4LB6B 4B8XA 2XAGA 2F2EA 5FFZA 4G7HF 4NHJA 4M74A 5DCMB 1WKMA 2DTRA 1T39A 3E5XA 4BH9A 3SQNA 1IZ1A 2XKOA 1ZHFA 2FNPA 1B6AA 3MZYA 2AXLA 3MFKA 1I1SA 3K69A 4LMYA 3EETA 3ZMDA 2FU4A 2FNAA 2A3SA 4GXOA 1P2FA 2DT5A 3BROA 1OR7A 3GVAA 4L9JA 1BIAA 3GF2A 4LGWA 4S04A 1HSTA 3FZVA 4FT8A 4BHCA 4H0EA 1KQ0A 4LLGF 3ZPLA 2CFXA 2EFQA 4EGZA 1SFXA 4ZH4F 2KIFA 4I0BA 2E7WA 3K9TA 5KK1A 2MLGA 2ESHA 3C18A 1P4XA 1S6LA 3U1DA 2XGXA 4KMUX 3RYPA 3EDPA 5LLQA 3KP6A 2BYVE 3WGIA 1UHWA 4EM1A 4RB0A 5L3BA 1XSDA 3T0YA 2MD5A 3QAHA 2XAJA 5D5VB 1CF7A 3I71A 2B0LA 3BPXA 4PCQA 4KIBA 3GO5A 3E6CC 3TOAA 2PMHA 2OD5A 5EEHA 2HS5A 2OU2A 1R00A 4HX8A 5AONA 4RAZA 3ZMTA 2PQ8A 4XBFA 2QWWA 4P96A 1GHCA 1P4WA 2DO7A 4ESFA 1C0WA 2VOPA 5E8GA 3HHGA 3COAC 2ZNZA 2G7UA 2DLLA 2P7VB 3HYIA 4OOIA 1O3TA 1JXSA 3JSOA 1D8JA 3Q9VA 2FA5A 2NYXA 3HRSA 5L3FA 2VBWA 3VODA 1XGMA 1O3SA 4I01A 3R0AA 2L4MA 1R5HA 3I64A 3ISPA 4E70A 4ZYEA 4KN4X 3WTSC 3GLXA 4LFUA 2UWMA 5H6QA 2DU9A 5KVRA 2ISYA 4M9ZA 1XMKA 3TO6A 1RUOA 3QP6A 1ZRCA 3SZTA 2PLYA 3O3KA 5E17F 2FBIA 4A12A 1G6NA 3EYIA 1HSJA 4U88A 1LJ9A 1JHFA 5K1YA 1QO0D 4A6EA 1D5VA 4Y17A 4YG2F 4G7OF 5LGUA 3G73A 2P5KA 1K78B 3E5QA 1R1UA 2KJCA 3V7CA 4LK0F 5CVIA 3DPTA 4KIFA 1SFUA 1EV7A 2VODA 3P9CA 4YFKF 1GVJA 5CVRA 2NNYA 2ZCWA 5FB2A 2A6EF 4G6DA 2HTJA 2M8EA 2RN7A 5CVVA 4IVNA 1LNWA 4P5OA 2CG4A 1U3EM 5L3EA 1F9NA 2EK5A 3HRTA 2IA2A 3N97A 3LWFA 4M73A 4Y15A 5JVTA 2O61A 3V8KA 4M9SA 4ZYHA 2OZUA 3R4KA 4HOBA 2JPBA 1TNSA 2YPRA 2O3FA 2STTA 2DBBA 1HKSA 2ZMEB 2PJPA 5A2QZ 1R22A 2XROA 1FBUA 3WGHA 5E1ZB 3FMSA 2HKXA 3GX4X 4GGGA 5HLIA 1OYWA 3HUGA 5FLXK 2HEOA 2XUBA 4LK1F 5FFXA 1J2XA 3GYHX 1SD7A 4WXDA 1UHMA 1A04A 1OMIA 2D2WA 1ULYA 3HRMA 2Y75A 1Z9CA 1KYZA 2XKPA 5D5UB 4PGGA 5HVQC 3MWMA 2YR2A 4HF1A 1XGSA 4WX9A 1HW5A 2EFPA 3U2RA 1SFEA 3VB2A 2P7CB 2EJRA 5AIQA 4ESBA 4CGZA 2Q8KA 3FXRA 3TDUC 2IRFG 1BN5A 1FSHA 1TQPA 2H94A 4MGRA 4MQ9F 1IN7A 3CLOA 3Q5FA 2E1NA 2W85A 3KP4A 2ZKZA 4TV7A 2QLZA 1I1GA 3I53A 1FLIA 1ZLKA 4RB3C 5JFRA 2Z3YA 3KP2A 4HBLA 3GFIA 1HXDA 4RGUA 3GEZA 5CVJA 3GFMA 3BDDA 4KICA 5H6RA 5L3GA 3L09A 2ACJA 1XCBA 2G9WA 4N9IA 4MTEA 1Z7UA 1FNNA 3ZMUA 1IAWA 1RIOH 3KETA 4IHSA 1D3YA 3VEPA 1P6RA 4BXUA 4EVIA 4WK8F 3FX3A 1U6GA 2JPCA 5DD8A 2JSCA 4ZYGA 1YS7A 3KZZA 4D0PA 3F8NA 1DP7P 1FC3A 5LRSA 1WWXA 2QQAA 1H0MA 2GZWA 3JW4A 3R0JA 3C1DA 4GCVA 1FOKA 4KT5C 4YIFA 1B9NA 1F4KA 1TTYA 2ZJ2A 4N9HA 3LA7A 2D1HA 3DQVC 1V3FA 2F5DA 3SFZA 4Y13A 1BC7C 2STWA 2JTVA 3M9AA 5HLGA 2QENA 2BV6A 4OIPF 2V6CA 4CHUA 3CO6C 3KLOA 4EMSA 2GA1A 3RKWA 2IP2A 3J81Z 1I6XA 3BP8A 3L00A 1R1VA 2HGCA 3ELKA 1AOYA 3BJOA 4I02A 4ASNA 3AAFA 4L9VA 1F1ZA 3LSTA 3H92A 3QPTA 3ZMSA 4G9YA 3KP5A 3V7SA 3MAJA 2Q2EA 4DNCA 1FT9A 1PP7U 3R61A 3GFLA 1XMAA 1J0RA 4YFNF 3I58A 1XSVA 3TO7A 4WXCA 1ZGAA 3HSRA 3HOSA 3ZMZA 3F8MA 1TW2A 2V1UA 1OKRA 1DUXC 1X3UA 1LQ1A 5HDNA 4YFXF 2PEXA 3FWEA 5BPDA 3TOBA 3F3XA 4LJZF 4KFCA 2HOEA 3E5UA 1U2WA 2YSRA 3HOTA 4KIGA 4EQQA 1XDUA 3GFJA 5E1XA 5LBQA 3RKXA 4OIOF 1KQ9A 3BZ6A 1YIOA 1STZA 1ZREA 2H27A 4G6QA 2JZYA 2GAUA 3ZP5A 2BGCA 4RGRA 1P4AA 3MQ0A 1YW8A 4OMZA 2ZO4A 3ABUA 4ON0A 1ZG5A 1IF1A 4MNUA 1MJBA 1W7PB 2P6TA 2BBYA 1L3LA 2O6GE 5FD5A 2F5CA 4OU0A 4GO1A 2A07F 3WTXC 2PG4A 2CGPA 3L7WA 4EJTA 5CVUA 4OIRF 1U8RA 3P7NA 3B73A 3J80Z 4F7ZA 1TQMA 4IJAA 1BM9A 4DQ2A 2FBKA 2HQRA 1OYIA 3RDIA 3C3WA 3E6DA 2XAQA 1T6SA 3V8JA 3FM3A 3G3ZA 4R1HA 4ENMA 1MGTA 2DAOA 2GWRA 3B02A 2WC2A 4A0ZA 2EV5A 2J5OA 1HKTA 2ZXJA 1TW3A 5K5QA 1P92A 4U7DA 1HW1A 1USSA 2VBZA 1LEAA 4P9FA 2BE5F 3ZMVA 4ENNA 2L01A 3IC7A 2RDPA 3V4GA 4A2UA 2FMYA 1ON1A 2DI3A 4G94A 4UNOA 1RNLA 2XASA 5AIPA 3SZPA 3TDZC 3KP3A 4HZFA 1K78A 2K4JA 1FYKA 2EA4A 2E1CA 2FMLA 1KU7A 2QBYA 2IA0A 4L9TA 4HV6A 3W6KB 3IRRA 3DV8A 1WSUA 3WTUC 2AS5F 3KFWX 5IT3A 2PN6A 2XVCA 3O2PE 5D4RA 3PQJA 2YX4A 1K6OA 1LDDA 1YW7A 1BOAA 3Q9SA 2A61A 3GZ5A 2W57A 1MDMB 3MZHA 1IXCA 1XSXA 4OINF 3JSPA 2OQGA 1TLHB 1YLFA 4AIHA 1CF7B 2OAZA 3K1MA 5JI6A 1KU9A 2HZTA 2FXAA 5LEKA 5BMZA 1EH6A 3IKTA 1R23A 2QQ9A 2VBYA 3LQQA 2RKHA 2MBFA 4A0YA 2ZMEA 2MH2A 3FHZA 1S8NA 3JTHA 4FX0A 3RKYA 4ZZLA 4IHTA 4HLXA 4LLNA 1T38A 2LKPA 1SD4A 2ADUA 1BI0A 4AIKA 3VFZA 4LG0A 4HF0A 1H9GA 3FXUA 1T98A 5LHHA 2H09A 3W6JB 2VE8A 4WXHA 1FYLA 4M6YA 2RGVA 2JT1A 2OZ6A 1IN5A 1VTNC 5DCFA 4KNYA 4EJWA 1QGPA 1G3TA 1U5TB 1J9IA 4CICA 2IA1A 4HA8A 1J5YA 1JHHA 3HIFA 5TJJA 4MTDA 2IT0A 1FX7A 2PI0A 1F5TA 1LB2A 2OQRA 2CYYA 3QU6A 2D45A 3BPVA 1IN4A 2QQBA 3WE2A 1L0OC 2FSWA 2EFNA 3GXOA 3I4PA 2V1DA 5CLSA 3F6VA 3H3UA 1FZPB 1RZ4A 4GYIA 3CUQB 5L3DA 4ZYDA 4S05A 2IVMA 2QM3A 1KU3A 4PGHA 5ICCA 2ZNYA 4L18B 1BI2A 3NRVA 3FM5A 3C7JA 2A6HF 2IPQX 1I27A 3ZQ7A 1LVAA 2KJBA 3I59B 2HYFA 3LQRA 1YO5C 3U9GA 4U0VA 5ICEA 3EYYA 1ZG1A 3I54A 1USTA 4N0BA 1GXPA 1WRJA 1AWCA 2K86A 2GXBA 1YYVA 3GUDA 4LB5A 1IXSB 3F8BA 1DPRA 1EH8A 2HQNA 3F22A 4YIIA 1B59A 2VE9A 5IT9Z 1HW2A 2QZ8A 4CZZA 1R36A 1ZRDA 4M9XA 3JAMZ 2F5FA 1FWZA 2HWVA 3TO9A 4IRGA 5F6FA 3J80K 1YTYA 2K7LA 4UVCA 2OA4A 1XCVA 2HFHA 1Z6RA 4L5IA 3ECOA 4UUVA 2C6YA 4G7ZF 2NS0A 4EGYA 4L9NA 2NRAC 4LLLA 1ZAOA 4EJVA 2G7HA 3K2ZA 1T2KA 2ZBKA 4XLNF 4ESJA 2LSOA 4AIJA 2WWYA 4I98B 1IUYA 4WWCA 2M87A 3ECHA 3LA3A 3KZYA 2Y0MA 2LDUA 2A69F 2RQPA 5ERIA 2VC1A 3ABTA 1KYWA 3E6BA 4IRIA 4UV9A 1ZLJA 2V1XA 2EV6A 2VT2A 4M71A 3E3VA 4WCGA 4EV0A 4HX4A 5DYMA 4CXFA 4I09A 4OIQF 2IJLA 1BI1A 2GQQA 1G3SA 3T8RA 3KEQA 2HR3A 2VT3A 1J7KA 3TGNA 3O6BB 4UXNA 2VBXA 4RGSA 2K02A 3VOEA 3P9IA 4I7HA 4A0XA 1Z05A 4KYWA 2EFOA 3I5UA 5DCMA 2H6CA 2FBHA 1ZH5A 3IHUA 1GXQA 4ENJA 3T1BA 2YX7A 1FP2A 1W4MA 3CJNA 3F8FA 3HTUA 2KRFA 4R79A 1SMTA 3L2CA 5HS7A 1BJAA 3LAJA 2NNNA 4ENKA 3WTTC 3F72A 5ED4A 1MJAA 3BWGA 2CSOA 4M6XA 1HQCA 2CO5A 2R3SA 4QLCU 4I2OA 1U5TC 4A6DA 5HDGA 3WU1B 1JE8A 2TDXA 1S7AA 2Z33A 4PZJA 3WTWC 1J75A 3LAPA 3WG9A 3T8TA 4BYYA 3DF8A 3DKWA 1FY7A 1XGNA 4MEXF 1LDKB 3CUQC 4BAYA 3T5XA 1G3WA 2P5LC 3CUOA 1G3YA 5DDGA 2A5YB 4XSXF 2M30A 1BC8C 5BPIA 4HDUA 1WQ2A 3FXQA 2Z99A 4Q4ZF 2RVCA 5LRRA 4EJUA 2DQLA 2RC4A 1TNTA 1I5ZA 3D0SA 3BY6A 3IKVA 2M45A 2P6SA 4Q48A 3CDHA 2Z9OA 2MA3A 5J8FA 3ROUA 5K5OA 5A2QK 2OBPA 1IN6A 2FOKA 1WI9A 5ILVA 4EM0B 3GW2A 5ICGA 1QNTA 4BNCA 2ETHA 1ZG3A 4HYEA 1W7PD 3FMRA 2K4BA 1XB4A 2R7DA 3WODF 1S7OA 3HSFA 3WU0A 1LDJA 2UXNA 2DK8A 1FPQA 3KEOA 2EB7A 4IPAA 2W25A 5BOXA 2XIGA 4KUMA 4BHBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FP1 D;  1FSE A;  1ZRF A;  3M8F A;  2VN2 A;  4U7B A;  5J8C A;  1R7J A;  1FBQ A;  2KIM A;  2Y48 A;  1XD7 A;  2HTS A;  3S2W A;  3NEU A;  1UCR A;  2ELH A;  5D8L B;  3ERE D;  1MDM A;  2M5W A;  4I0A A;  4KN7 X;  2WV0 A;  4BQA A;  3V8L A;  5HLH A;  4G8X A;  2CQK A;  3M7G A;  2DK5 A;  3J7A O;  1IXR C;  4JQF A;  2P8T A;  3EQL F;  3KE2 A;  1U78 A;  4U0Y A;  5D5W B;  1R58 A;  2QYO A;  6PAX A;  4XRF A;  2IW5 A;  2PBI A;  2Q0O A;  5IT9 K;  1O3R A;  2XRN A;  1BIB A;  1REP C;  2D1V A;  3K0L A;  3DXJ F;  3JAM K;  4HV5 A;  5F64 A;  3F8C A;  3IWF A;  1B4A A;  1LEB A;  1V4R A;  1YS6 A;  3GWZ A;  3KCC A;  4IXA A;  4A5M A;  3M1E A;  3DFG A;  2VOO A;  2XAH A;  1MJ9 A;  4RB1 A;  3KLN A;  2EWN A;  4Q5S F;  3BOQ A;  5K5R A;  1W5S A;  1KA8 A;  5ILU A;  5LGT A;  4UVB A;  1B9M A;  3K1P A;  2RV8 A;  5ICF A;  1KU2 A;  3ML6 A;  3WE3 A;  2V79 A;  2YU3 A;  2HYG D;  4KDP A;  1UB9 A;  1BBY A;  3JTG A;  5DUI A;  1K79 A;  1K7A A;  1U5T A;  1XN7 A;  3F21 A;  3PQK A;  2XAF A;  1O57 A;  1OYY A;  5F1R A;  3F6O A;  5H20 A;  1W5T A;  2WTE A;  3D5L A;  1QQI A;  4JK1 X;  2L3D A;  3HHH A;  2RNJ A;  4L5J A;  5E18 F;  3REO A;  1Z91 A;  1Q1H A;  1SAX A;  1HBX G;  3CUQ A;  1UFM A;  4L0Z B;  3I0T A;  4RB2 C;  4PDK A;  1SMY F;  1MZB A;  2X4H A;  4FHT A;  2VON A;  5HOO A;  2FE3 A;  5HS9 A;  1Z1D A;  5CYV A;  4HLY A;  1TBX A;  2FEZ A;  2QBY B;  3N4M A;  1IRF A;  1R5G A;  3RTR A;  5J6X A;  3I59 A;  1QZY A;  4HQM A;  3LFK A;  2UXX A;  2R7F A;  3QOP A;  3K1N A;  2L4A A;  3R6S A;  4O6J A;  3J81 K;  3DEU A;  3QU3 A;  2DPU A;  1FBS A;  2W24 A;  2VXZ A;  2ISZ A;  1TQI A;  3H3Z A;  4RAY A;  1XDS A;  2EA2 A;  5HDK A;  1YQA A;  2PMU A;  2HDC A;  2O0Y A;  3PFI A;  1NHA A;  4AD9 A;  4UV8 A;  3NQO A;  5E8I A;  1IW7 F;  3R60 A;  3OV8 A;  4Q47 A;  5LHG A;  3IL2 A;  3V7R A;  1ZN2 A;  4LD5 A;  3TQN A;  4A5N A;  4HF2 A;  1E2X A;  3CO7 C;  1YW9 A;  4RS8 A;  1O7F A;  1D8K A;  2ESN A;  1IN8 A;  2QVO A;  2J5P A;  2M1B A;  5FGM A;  3KP7 A;  5D5X B;  1FYM A;  5LGN A;  2O03 A;  4HQE A;  2W84 A;  3E97 A;  3FMQ A;  2DFI A;  1QZZ A;  3ZN0 A;  5EEG A;  2UZK A;  3IWZ A;  4LG0 B;  1CGP A;  2L02 A;  2KIU A;  2O8X A;  4WF2 A;  1QPM A;  1YG2 A;  5DV5 A;  2L54 A;  1H9T A;  4RGX A;  4KA4 A;  4HX7 A;  2XHK A;  3LA2 A;  3RYR A;  4CYD A;  5D4S A;  3RPU A;  3QP5 A;  1XGO A;  5TRD A;  1O7L A;  5D6E A;  1DDN A;  4ZZD A;  2MLK A;  4ETS A;  4AVP A;  3SHF A;  1Y0U A;  3WGG A;  4HDV A;  1ODD A;  2LF8 A;  3ULQ B;  2EV0 A;  1DPU A;  4HAM A;  2JRT A;  3E6M A;  5DEQ A;  4CDG A;  4EJO A;  2NAZ A;  4K2E A;  2COM A;  4HW0 A;  4FX4 A;  2CWE A;  4XSZ F;  3WTY C;  3F23 A;  1PUE E;  2ZFW A;  4QWQ A;  2XV4 S;  2GIV A;  4JBA A;  1PP8 F;  4UVA A;  4M72 A;  3DP7 A;  2LF7 A;  5DD4 A;  2E7X A;  3EUH A;  2P5V A;  2X0L A;  5D8K B;  2HKO A;  1JGS A;  3WTV C;  3BJA A;  3OOP A;  3MCZ A;  1ZAR A;  1S29 A;  4B09 A;  5D6F A;  2CW0 F;  5DUK A;  1PDN C;  4MEY F;  4XLP F;  3TKY A;  1KQ8 A;  1MD0 A;  2Z5U A;  2GA2 A;  4NQW A;  3RPQ A;  1BI3 A;  1G4D A;  4OMY A;  3HTS B;  4NB5 A;  2V9V A;  2FRH A;  3DPL C;  5FO5 A;  5BS6 A;  3IRQ A;  5ILS A;  3MEX A;  3CTA A;  1O3Q A;  3BJ6 A;  2BEO A;  2FF4 A;  3ZN1 A;  4MQV A;  2DW4 A;  1ZGJ A;  1E17 A;  2GXG A;  2MH9 A;  5CJ9 A;  4IRH A;  1QBJ A;  3P9K A;  2EFW A;  1KGS A;  1HKQ A;  2K27 A;  3SXY A;  2MC3 A;  3RJP A;  1S3J A;  5E20 A;  2H6B A;  1ON2 A;  5JR3 A;  1MKM A;  2FQ3 A;  1R1T A;  4EM2 A;  3GZ6 A;  1YFH A;  2PFB A;  1IRG A;  1B1B A;  3RIR A;  1ZYR F;  2LNB A;  3WTZ A;  4GYG A;  5HS8 A;  3FF5 A;  4L0Y B;  4Z2Y A;  2QUF A;  5L3C A;  1W7P A;  1ONV A;  4AWX B;  1J59 A;  4P55 A;  4CO8 A;  1EH7 A;  1RI7 A;  5LHI A;  1RUN A;  4U0W A;  4BHP A;  5E1W A;  3L9F A;  1T0F A;  2DPD A;  2A68 F;  4UHT A;  3HRU A;  4R8H A;  5JHU A;  5FD6 A;  1OPC A;  3M8E A;  4KMF A;  4O3M A;  5BQT A;  4IF4 A;  3QRF F;  5FLX Z;  2F5E A;  2DQR A;  5LEJ A;  1Z6T A;  4P9U A;  1SD6 A;  2KKO A;  4MHG A;  1SD5 A;  2VC0 A;  3HSE A;  3RI4 A;  3QPH A;  4O5V A;  2P4W A;  4LB6 B;  4B8X A;  2XAG A;  2F2E A;  5FFZ A;  4G7H F;  4NHJ A;  4M74 A;  5DCM B;  1WKM A;  2DTR A;  1T39 A;  3E5X A;  4BH9 A;  3SQN A;  1IZ1 A;  2XKO A;  1ZHF A;  2FNP A;  1B6A A;  3MZY A;  2AXL A;  3MFK A;  1I1S A;  3K69 A;  4LMY A;  3EET A;  3ZMD A;  2FU4 A;  2FNA A;  2A3S A;  4GXO A;  1P2F A;  2DT5 A;  3BRO A;  1OR7 A;  3GVA A;  4L9J A;  1BIA A;  3GF2 A;  4LGW A;  4S04 A;  1HST A;  3FZV A;  4FT8 A;  4BHC A;  4H0E A;  1KQ0 A;  4LLG F;  3ZPL A;  2CFX A;  2EFQ A;  4EGZ A;  1SFX A;  4ZH4 F;  2KIF A;  4I0B A;  2E7W A;  3K9T A;  5KK1 A;  2MLG A;  2ESH A;  3C18 A;  1P4X A;  1S6L A;  3U1D A;  2XGX A;  4KMU X;  3RYP A;  3EDP A;  5LLQ A;  3KP6 A;  2BYV E;  3WGI A;  1UHW A;  4EM1 A;  4RB0 A;  5L3B A;  1XSD A;  3T0Y A;  2MD5 A;  3QAH A;  2XAJ A;  5D5V B;  1CF7 A;  3I71 A;  2B0L A;  3BPX A;  4PCQ A;  4KIB A;  3GO5 A;  3E6C C;  3TOA A;  2PMH A;  2OD5 A;  5EEH A;  2HS5 A;  2OU2 A;  1R00 A;  4HX8 A;  5AON A;  4RAZ A;  3ZMT A;  2PQ8 A;  4XBF A;  2QWW A;  4P96 A;  1GHC A;  1P4W A;  2DO7 A;  4ESF A;  1C0W A;  2VOP A;  5E8G A;  3HHG A;  3COA C;  2ZNZ A;  2G7U A;  2DLL A;  2P7V B;  3HYI A;  4OOI A;  1O3T A;  1JXS A;  3JSO A;  1D8J A;  3Q9V A;  2FA5 A;  2NYX A;  3HRS A;  5L3F A;  2VBW A;  3VOD A;  1XGM A;  1O3S A;  4I01 A;  3R0A A;  2L4M A;  1R5H A;  3I64 A;  3ISP A;  4E70 A;  4ZYE A;  4KN4 X;  3WTS C;  3GLX A;  4LFU A;  2UWM A;  5H6Q A;  2DU9 A;  5KVR A;  2ISY A;  4M9Z A;  1XMK A;  3TO6 A;  1RUO A;  3QP6 A;  1ZRC A;  3SZT A;  2PLY A;  3O3K A;  5E17 F;  2FBI A;  4A12 A;  1G6N A;  3EYI A;  1HSJ A;  4U88 A;  1LJ9 A;  1JHF A;  5K1Y A;  1QO0 D;  4A6E A;  1D5V A;  4Y17 A;  4YG2 F;  4G7O F;  5LGU A;  3G73 A;  2P5K A;  1K78 B;  3E5Q A;  1R1U A;  2KJC A;  3V7C A;  4LK0 F;  5CVI A;  3DPT A;  4KIF A;  1SFU A;  1EV7 A;  2VOD A;  3P9C A;  4YFK F;  1GVJ A;  5CVR A;  2NNY A;  2ZCW A;  5FB2 A;  2A6E F;  4G6D A;  2HTJ A;  2M8E A;  2RN7 A;  5CVV A;  4IVN A;  1LNW A;  4P5O A;  2CG4 A;  1U3E M;  5L3E A;  1F9N A;  2EK5 A;  3HRT A;  2IA2 A;  3N97 A;  3LWF A;  4M73 A;  4Y15 A;  5JVT A;  2O61 A;  3V8K A;  4M9S A;  4ZYH A;  2OZU A;  3R4K A;  4HOB A;  2JPB A;  1TNS A;  2YPR A;  2O3F A;  2STT A;  2DBB A;  1HKS A;  2ZME B;  2PJP A;  5A2Q Z;  1R22 A;  2XRO A;  1FBU A;  3WGH A;  5E1Z B;  3FMS A;  2HKX A;  3GX4 X;  4GGG A;  5HLI A;  1OYW A;  3HUG A;  5FLX K;  2HEO A;  2XUB A;  4LK1 F;  5FFX A;  1J2X A;  3GYH X;  1SD7 A;  4WXD A;  1UHM A;  1A04 A;  1OMI A;  2D2W A;  1ULY A;  3HRM A;  2Y75 A;  1Z9C A;  1KYZ A;  2XKP A;  5D5U B;  4PGG A;  5HVQ C;  3MWM A;  2YR2 A;  4HF1 A;  1XGS A;  4WX9 A;  1HW5 A;  2EFP A;  3U2R A;  1SFE A;  3VB2 A;  2P7C B;  2EJR A;  5AIQ A;  4ESB A;  4CGZ A;  2Q8K A;  3FXR A;  3TDU C;  2IRF G;  1BN5 A;  1FSH A;  1TQP A;  2H94 A;  4MGR A;  4MQ9 F;  1IN7 A;  3CLO A;  3Q5F A;  2E1N A;  2W85 A;  3KP4 A;  2ZKZ A;  4TV7 A;  2QLZ A;  1I1G A;  3I53 A;  1FLI A;  1ZLK A;  4RB3 C;  5JFR A;  2Z3Y A;  3KP2 A;  4HBL A;  3GFI A;  1HXD A;  4RGU A;  3GEZ A;  5CVJ A;  3GFM A;  3BDD A;  4KIC A;  5H6R A;  5L3G A;  3L09 A;  2ACJ A;  1XCB A;  2G9W A;  4N9I A;  4MTE A;  1Z7U A;  1FNN A;  3ZMU A;  1IAW A;  1RIO H;  3KET A;  4IHS A;  1D3Y A;  3VEP A;  1P6R A;  4BXU A;  4EVI A;  4WK8 F;  3FX3 A;  1U6G A;  2JPC A;  5DD8 A;  2JSC A;  4ZYG A;  1YS7 A;  3KZZ A;  4D0P A;  3F8N A;  1DP7 P;  1FC3 A;  5LRS A;  1WWX A;  2QQA A;  1H0M A;  2GZW A;  3JW4 A;  3R0J A;  3C1D A;  4GCV A;  1FOK A;  4KT5 C;  4YIF A;  1B9N A;  1F4K A;  1TTY A;  2ZJ2 A;  4N9H A;  3LA7 A;  2D1H A;  3DQV C;  1V3F A;  2F5D A;  3SFZ A;  4Y13 A;  1BC7 C;  2STW A;  2JTV A;  3M9A A;  5HLG A;  2QEN A;  2BV6 A;  4OIP F;  2V6C A;  4CHU A;  3CO6 C;  3KLO A;  4EMS A;  2GA1 A;  3RKW A;  2IP2 A;  3J81 Z;  1I6X A;  3BP8 A;  3L00 A;  1R1V A;  2HGC A;  3ELK A;  1AOY A;  3BJO A;  4I02 A;  4ASN A;  3AAF A;  4L9V A;  1F1Z A;  3LST A;  3H92 A;  3QPT A;  3ZMS A;  4G9Y A;  3KP5 A;  3V7S A;  3MAJ A;  2Q2E A;  4DNC A;  1FT9 A;  1PP7 U;  3R61 A;  3GFL A;  1XMA A;  1J0R A;  4YFN F;  3I58 A;  1XSV A;  3TO7 A;  4WXC A;  1ZGA A;  3HSR A;  3HOS A;  3ZMZ A;  3F8M A;  1TW2 A;  2V1U A;  1OKR A;  1DUX C;  1X3U A;  1LQ1 A;  5HDN A;  4YFX F;  2PEX A;  3FWE A;  5BPD A;  3TOB A;  3F3X A;  4LJZ F;  4KFC A;  2HOE A;  3E5U A;  1U2W A;  2YSR A;  3HOT A;  4KIG A;  4EQQ A;  1XDU A;  3GFJ A;  5E1X A;  5LBQ A;  3RKX A;  4OIO F;  1KQ9 A;  3BZ6 A;  1YIO A;  1STZ A;  1ZRE A;  2H27 A;  4G6Q A;  2JZY A;  2GAU A;  3ZP5 A;  2BGC A;  4RGR A;  1P4A A;  3MQ0 A;  1YW8 A;  4OMZ A;  2ZO4 A;  3ABU A;  4ON0 A;  1ZG5 A;  1IF1 A;  4MNU A;  1MJB A;  1W7P B;  2P6T A;  2BBY A;  1L3L A;  2O6G E;  5FD5 A;  2F5C A;  4OU0 A;  4GO1 A;  2A07 F;  3WTX C;  2PG4 A;  2CGP A;  3L7W A;  4EJT A;  5CVU A;  4OIR F;  1U8R A;  3P7N A;  3B73 A;  3J80 Z;  4F7Z A;  1TQM A;  4IJA A;  1BM9 A;  4DQ2 A;  2FBK A;  2HQR A;  1OYI A;  3RDI A;  3C3W A;  3E6D A;  2XAQ A;  1T6S A;  3V8J A;  3FM3 A;  3G3Z A;  4R1H A;  4ENM A;  1MGT A;  2DAO A;  2GWR A;  3B02 A;  2WC2 A;  4A0Z A;  2EV5 A;  2J5O A;  1HKT A;  2ZXJ A;  1TW3 A;  5K5Q A;  1P92 A;  4U7D A;  1HW1 A;  1USS A;  2VBZ A;  1LEA A;  4P9F A;  2BE5 F;  3ZMV A;  4ENN A;  2L01 A;  3IC7 A;  2RDP A;  3V4G A;  4A2U A;  2FMY A;  1ON1 A;  2DI3 A;  4G94 A;  4UNO A;  1RNL A;  2XAS A;  5AIP A;  3SZP A;  3TDZ C;  3KP3 A;  4HZF A;  1K78 A;  2K4J A;  1FYK A;  2EA4 A;  2E1C A;  2FML A;  1KU7 A;  2QBY A;  2IA0 A;  4L9T A;  4HV6 A;  3W6K B;  3IRR A;  3DV8 A;  1WSU A;  3WTU C;  2AS5 F;  3KFW X;  5IT3 A;  2PN6 A;  2XVC A;  3O2P E;  5D4R A;  3PQJ A;  2YX4 A;  1K6O A;  1LDD A;  1YW7 A;  1BOA A;  3Q9S A;  2A61 A;  3GZ5 A;  2W57 A;  1MDM B;  3MZH A;  1IXC A;  1XSX A;  4OIN F;  3JSP A;  2OQG A;  1TLH B;  1YLF A;  4AIH A;  1CF7 B;  2OAZ A;  3K1M A;  5JI6 A;  1KU9 A;  2HZT A;  2FXA A;  5LEK A;  5BMZ A;  1EH6 A;  3IKT A;  1R23 A;  2QQ9 A;  2VBY A;  3LQQ A;  2RKH A;  2MBF A;  4A0Y A;  2ZME A;  2MH2 A;  3FHZ A;  1S8N A;  3JTH A;  4FX0 A;  3RKY A;  4ZZL A;  4IHT A;  4HLX A;  4LLN A;  1T38 A;  2LKP A;  1SD4 A;  2ADU A;  1BI0 A;  4AIK A;  3VFZ A;  4LG0 A;  4HF0 A;  1H9G A;  3FXU A;  1T98 A;  5LHH A;  2H09 A;  3W6J B;  2VE8 A;  4WXH A;  1FYL A;  4M6Y A;  2RGV A;  2JT1 A;  2OZ6 A;  1IN5 A;  1VTN C;  5DCF A;  4KNY A;  4EJW A;  1QGP A;  1G3T A;  1U5T B;  1J9I A;  4CIC A;  2IA1 A;  4HA8 A;  1J5Y A;  1JHH A;  3HIF A;  5TJJ A;  4MTD A;  2IT0 A;  1FX7 A;  2PI0 A;  1F5T A;  1LB2 A;  2OQR A;  2CYY A;  3QU6 A;  2D45 A;  3BPV A;  1IN4 A;  2QQB A;  3WE2 A;  1L0O C;  2FSW A;  2EFN A;  3GXO A;  3I4P A;  2V1D A;  5CLS A;  3F6V A;  3H3U A;  1FZP B;  1RZ4 A;  4GYI A;  3CUQ B;  5L3D A;  4ZYD A;  4S05 A;  2IVM A;  2QM3 A;  1KU3 A;  4PGH A;  5ICC A;  2ZNY A;  4L18 B;  1BI2 A;  3NRV A;  3FM5 A;  3C7J A;  2A6H F;  2IPQ X;  1I27 A;  3ZQ7 A;  1LVA A;  2KJB A;  3I59 B;  2HYF A;  3LQR A;  1YO5 C;  3U9G A;  4U0V A;  5ICE A;  3EYY A;  1ZG1 A;  3I54 A;  1UST A;  4N0B A;  1GXP A;  1WRJ A;  1AWC A;  2K86 A;  2GXB A;  1YYV A;  3GUD A;  4LB5 A;  1IXS B;  3F8B A;  1DPR A;  1EH8 A;  2HQN A;  3F22 A;  4YII A;  1B59 A;  2VE9 A;  5IT9 Z;  1HW2 A;  2QZ8 A;  4CZZ A;  1R36 A;  1ZRD A;  4M9X A;  3JAM Z;  2F5F A;  1FWZ A;  2HWV A;  3TO9 A;  4IRG A;  5F6F A;  3J80 K;  1YTY A;  2K7L A;  4UVC A;  2OA4 A;  1XCV A;  2HFH A;  1Z6R A;  4L5I A;  3ECO A;  4UUV A;  2C6Y A;  4G7Z F;  2NS0 A;  4EGY A;  4L9N A;  2NRA C;  4LLL A;  1ZAO A;  4EJV A;  2G7H A;  3K2Z A;  1T2K A;  2ZBK A;  4XLN F;  4ESJ A;  2LSO A;  4AIJ A;  2WWY A;  4I98 B;  1IUY A;  4WWC A;  2M87 A;  3ECH A;  3LA3 A;  3KZY A;  2Y0M A;  2LDU A;  2A69 F;  2RQP A;  5ERI A;  2VC1 A;  3ABT A;  1KYW A;  3E6B A;  4IRI A;  4UV9 A;  1ZLJ A;  2V1X A;  2EV6 A;  2VT2 A;  4M71 A;  3E3V A;  4WCG A;  4EV0 A;  4HX4 A;  5DYM A;  4CXF A;  4I09 A;  4OIQ F;  2IJL A;  1BI1 A;  2GQQ A;  1G3S A;  3T8R A;  3KEQ A;  2HR3 A;  2VT3 A;  1J7K A;  3TGN A;  3O6B B;  4UXN A;  2VBX A;  4RGS A;  2K02 A;  3VOE A;  3P9I A;  4I7H A;  4A0X A;  1Z05 A;  4KYW A;  2EFO A;  3I5U A;  5DCM A;  2H6C A;  2FBH A;  1ZH5 A;  3IHU A;  1GXQ A;  4ENJ A;  3T1B A;  2YX7 A;  1FP2 A;  1W4M A;  3CJN A;  3F8F A;  3HTU A;  2KRF A;  4R79 A;  1SMT A;  3L2C A;  5HS7 A;  1BJA A;  3LAJ A;  2NNN A;  4ENK A;  3WTT C;  3F72 A;  5ED4 A;  1MJA A;  3BWG A;  2CSO A;  4M6X A;  1HQC A;  2CO5 A;  2R3S A;  4QLC U;  4I2O A;  1U5T C;  4A6D A;  5HDG A;  3WU1 B;  1JE8 A;  2TDX A;  1S7A A;  2Z33 A;  4PZJ A;  3WTW C;  1J75 A;  3LAP A;  3WG9 A;  3T8T A;  4BYY A;  3DF8 A;  3DKW A;  1FY7 A;  1XGN A;  4MEX F;  1LDK B;  3CUQ C;  4BAY A;  3T5X A;  1G3W A;  2P5L C;  3CUO A;  1G3Y A;  5DDG A;  2A5Y B;  4XSX F;  2M30 A;  1BC8 C;  5BPI A;  4HDU A;  1WQ2 A;  3FXQ A;  2Z99 A;  4Q4Z F;  2RVC A;  5LRR A;  4EJU A;  2DQL A;  2RC4 A;  1TNT A;  1I5Z A;  3D0S A;  3BY6 A;  3IKV A;  2M45 A;  2P6S A;  4Q48 A;  3CDH A;  2Z9O A;  2MA3 A;  5J8F A;  3ROU A;  5K5O A;  5A2Q K;  2OBP A;  1IN6 A;  2FOK A;  1WI9 A;  5ILV A;  4EM0 B;  3GW2 A;  5ICG A;  1QNT A;  4BNC A;  2ETH A;  1ZG3 A;  4HYE A;  1W7P D;  3FMR A;  2K4B A;  1XB4 A;  2R7D A;  3WOD F;  1S7O A;  3HSF A;  3WU0 A;  1LDJ A;  2UXN A;  2DK8 A;  1FPQ A;  3KEO A;  2EB7 A;  4IPA A;  2W25 A;  5BOX A;  2XIG A;  4KUM A;  4BHB A; 
#chains in the Genus database with same CATH topology
 1FP1 D;  3JRA A;  1D0Y A;  1B72 A;  1FSE A;  2XF7 A;  3DWL E;  1ZRF A;  3M8F A;  3HBL A;  2VN2 A;  4U7B A;  5J8C A;  1R7J A;  1FBQ A;  2KIM A;  2Q1Z B;  2L7K A;  1I6H J;  2Y48 A;  2OF7 A;  1XD7 A;  2HTS A;  3S2W A;  4A3B J;  3NEU A;  1UCR A;  2ELH A;  3DU6 A;  5D8L B;  3ERE D;  1MDM A;  2DJN A;  2M5W A;  4I0A A;  4KN7 X;  2LRD A;  2WV0 A;  4RBO A;  4BQA A;  1FTZ A;  3V8L A;  5HLH A;  4G8X A;  2QF7 A;  2CQK A;  3M7G A;  2DK5 A;  1MMN A;  1VF9 A;  3J7A O;  3M1C A;  1IXR C;  4JQF A;  2P8T A;  3EQL F;  3KE2 A;  1U78 A;  4X1E A;  5D5W B;  1R58 A;  2QYO A;  4BJT A;  4U0Y A;  6PAX A;  2ECC A;  4XRF A;  2XDV A;  2IW5 A;  2PBI A;  5GAD J;  2Q0O A;  4XK4 A;  5IT9 K;  1O3R A;  1GLN A;  2XRN A;  1BIB A;  1BJZ A;  3PNV A;  1REP C;  1FMW A;  1BA5 A;  4HPQ A;  2D1V A;  3K0L A;  3DXJ F;  4IHY A;  4XON A;  2ELK A;  3JAM K;  4HV5 A;  5F64 A;  4XLC A;  3CCL I;  3HB9 A;  4CCL A;  3F8C A;  3IWF A;  1B4A A;  4BL0 B;  1LEB A;  1V4R A;  1YS6 A;  3GWZ A;  3KCC A;  3PM1 A;  4IXA A;  3M1E A;  5IYB J;  4A5M A;  2R7T A;  4I99 C;  3FBN B;  3QYB A;  2E2J J;  3DFG A;  1Y8Q B;  2E71 A;  2VOO A;  2XAH A;  1MJ9 A;  4RB1 A;  2DMP A;  3WG7 H;  3KLN A;  3LSP A;  1ENH A;  2EWN A;  4Q5S F;  3BTJ A;  5FKN A;  1R71 A;  2JJ7 A;  1VQ9 I;  4YIR X;  3BOQ A;  5K5R A;  2L9N A;  5J47 A;  5EEA A;  1W5S A;  3A03 A;  1KA8 A;  1MMA A;  5ILU A;  1X2M A;  2X9D A;  4HST A;  2V6E A;  3D5S C;  5LGT A;  4UVB A;  4DW6 A;  1B9M A;  3K1P A;  1JTY A;  2RV8 A;  5ICF A;  1KU2 A;  2O5R A;  3ML6 A;  3WE3 A;  1LE8 A;  2V79 A;  2YU3 A;  1MBH A;  2LKX A;  2KL4 A;  1I39 A;  2HYG D;  4KDP A;  1X4O A;  1UB9 A;  2JQ7 A;  1BBY A;  3JTG A;  1RET A;  5DUI A;  4V2F A;  1K79 A;  2FUG 2;  1K7A A;  1U5T A;  2E35 A;  1XN7 A;  3F21 A;  3PQK A;  2XAF A;  1O57 A;  1LKX A;  1NG7 A;  2E19 A;  4MFD A;  1OYY A;  5F1R A;  3F6O A;  2X6Y A;  3CZ6 A;  5H20 A;  3OYH A;  1W5T A;  2WTE A;  3FXM A;  2XPU A;  3BG6 A;  3D5L A;  1QQI A;  4JK1 X;  1RR8 C;  4YRV A;  4F3Q A;  2L3D A;  3KYC B;  4DYR A;  2VQH A;  3Q3S A;  3HHH A;  1ZGW A;  3MZ8 A;  2RNJ A;  1T8I A;  1HCR A;  4L5J A;  2B63 J;  1IC8 A;  5E18 F;  4CYC B;  3REO A;  1Z91 A;  3W2W A;  1Q1H A;  1EA3 A;  1BW6 A;  1SAX A;  1HBX G;  3CUQ A;  3IP4 B;  1B8I A;  1VQ5 I;  1UFM A;  4L0Z B;  3LOC A;  5C44 J;  3I0T A;  4RB2 C;  4MIM A;  4PDK A;  3PNT A;  1SMY F;  2M0C A;  4Y4R A;  4CZC A;  1MZB A;  2NS7 A;  4OAZ A;  2X4H A;  4FHT A;  2VON A;  3DTE A;  1ZKG A;  4DGW B;  5HOO A;  2FE3 A;  5HS9 A;  1Z1D A;  5CYV A;  4HLY A;  3MN2 A;  5KHD A;  1TBX A;  5TIS C;  2FEZ A;  2QBY B;  4P1W A;  3RQI A;  1HLV A;  4AUX A;  3N4M A;  2ZJR F;  3K10 A;  1R9T J;  1IRF A;  1R5G A;  3RTR A;  5J6X A;  2BZT A;  3I59 A;  5IP9 J;  1Z21 A;  1QZY A;  4B44 A;  4U87 A;  4HQM A;  2EH3 A;  3LFK A;  2UXX A;  2ZC2 A;  2R7F A;  5KAF C;  3QOP A;  3CME I;  3HGY A;  4ITV A;  3K1N A;  2L4A A;  3R6S A;  2LKS A;  4OWR B;  3DTK A;  4O6J A;  2WA0 A;  3J81 K;  3DEU A;  1YX5 A;  1J09 A;  1A35 A;  1OCZ H;  3QU3 A;  2DPU A;  2JA2 A;  5F04 A;  1FBS A;  2W24 A;  2D5V A;  5J1Y A;  2VXZ A;  4KIT B;  1IV6 A;  1ORK A;  2W00 A;  2ISZ A;  2EPF A;  1TQI A;  3L2W A;  3H3Z A;  5JVG F;  4RAY A;  1QZE A;  1VQK I;  1XDS A;  2EA2 A;  5HDK A;  3QYE A;  2R7V A;  2L7F P;  1YQA A;  2PMU A;  5DTD A;  3W3C A;  5DM7 F;  2GBY A;  2KPM A;  2HDC A;  2O0Y A;  3PFI A;  1NHA A;  4AD9 A;  4UV8 A;  3LSK A;  2ZJP F;  3NQO A;  1VQO I;  5E8I A;  4J00 A;  1IW7 F;  3R60 A;  2W7N A;  3OV8 A;  3HOV J;  1XPX A;  4BKX A;  4Q47 A;  2WAD A;  1H89 C;  3VWB A;  5LHG A;  2IGK A;  3IL2 A;  1TP4 A;  3V7R A;  1ETW A;  3K4C A;  1ZN2 A;  4LD5 A;  3TQN A;  1ITY A;  4A5N A;  2ME0 A;  3BR0 A;  4HF2 A;  3BG7 A;  1E2X A;  3CO7 C;  3PUF A;  1YW9 A;  1WCM J;  4RS8 A;  3CES A;  1O7F A;  1D8K A;  1P7J A;  2ESN A;  1IN8 A;  1ZK8 A;  2VPL A;  2R4G A;  2QVO A;  4XOT A;  3L1P A;  3BCB A;  5LFA A;  2QQ8 A;  2AQF A;  2J5P A;  2M1B A;  3A01 B;  5FGM A;  1TWA J;  2EZL A;  3KP7 A;  1K6Y A;  5D5X B;  2KIS A;  1GUU A;  1FYM A;  5LGN A;  1AKH A;  2OC6 A;  2O03 A;  4HQE A;  2W84 A;  5E79 C;  3E97 A;  3FMQ A;  5J4V A;  4XRS A;  4AVZ A;  2DFI A;  1QZZ A;  3ZN0 A;  5EEG A;  3TP3 A;  2UZK A;  2R92 J;  1T56 A;  3IWZ A;  4LG0 B;  2KFD A;  1CGP A;  2DOE A;  2L02 A;  3OS1 A;  2KIU A;  2Y30 A;  1IG7 A;  2DOD A;  5FLV A;  3KYL A;  1EF4 A;  2O8X A;  5F0C A;  3FIW A;  4WF2 A;  4DIQ A;  4BBS J;  1T0F C;  3OYG A;  3CMM A;  1QPM A;  1YG2 A;  2E5Z A;  5DV5 A;  9ANT A;  2R7R A;  2L54 A;  1H9T A;  4RGX A;  2X1E A;  4KA4 A;  3G4S I;  4HX7 A;  4CA0 A;  3CLQ A;  1GDT A;  2VAS A;  2XHK A;  3LA2 A;  1JGG A;  1FJL A;  3RYR A;  4CYD A;  2VLA A;  3BR2 A;  4ZDO A;  4OAY A;  3PJR A;  2HDW A;  2R7S A;  5D4S A;  4B48 A;  3RPU A;  1Z3X A;  3CCM I;  3QP5 A;  3OL4 A;  1XGO A;  2QEX I;  5TRD A;  2CV2 A;  1O7L A;  4IKF A;  3LSI A;  2NVU B;  3SYT A;  1H88 C;  1VQ8 I;  5D6E A;  1AA7 A;  1W36 D;  1DDN A;  4CCM A;  4ZZD A;  3ABK H;  2MLK A;  1LFU P;  3EUK L;  4ETS A;  3QYF A;  4AVP A;  4ZJZ A;  4NC7 A;  3EUA A;  3SHF A;  1Y0U A;  3WGG A;  4HDV A;  1ODD A;  2LF8 A;  3ULQ B;  1YJ9 I;  3BG5 A;  2EV0 A;  1SFO J;  2LLK A;  4HAM A;  1DPU A;  2JRT A;  3E6M A;  2KZG A;  5DEQ A;  4C3H J;  4CDG A;  4EJO A;  2NAZ A;  4K2E A;  4PJM A;  2COM A;  4HW0 A;  4FX4 A;  2CWE A;  4XSZ F;  5F1J A;  2KZV A;  3G2B A;  1V5G A;  3WTY C;  3F23 A;  1FOY A;  1Y39 A;  2ZFW A;  3RCO A;  4QWQ A;  1PUE E;  2XV4 S;  2GIV A;  1LPQ A;  2BXY A;  5J1R A;  4JBA A;  5J4Y A;  1ZR4 A;  1PP8 F;  4UVA A;  2I8D A;  3OYI A;  2CUE A;  2FD5 A;  4M72 A;  2HVR A;  3DP7 A;  2LF7 A;  1K61 A;  1QVT A;  2JA7 J;  1R5I D;  2CQQ A;  5DD4 A;  3QPS A;  2E7X A;  3HGG A;  4I76 A;  3EUH A;  2P5V A;  2X0L A;  5D8K B;  2HKO A;  4BEH B;  1OR7 C;  1JGS A;  3WTV C;  2BW3 B;  3BJA A;  4XR6 A;  2XC7 A;  3OOP A;  3HOX J;  3MCZ A;  1ZAR A;  1S29 A;  4RM2 A;  1DGW Y;  3GTK J;  5CQE A;  3BT9 A;  4B09 A;  3DLL F;  3BZC A;  2K9N A;  5D6F A;  1SAU A;  2CW0 F;  4PJJ A;  5DUK A;  1WH5 A;  1PDN C;  1QA6 A;  1JI8 A;  2L5Q A;  3S14 J;  4MEY F;  1XX5 A;  4XLP F;  3H1C A;  2CQX A;  3DCF A;  5B1B H;  1OJL A;  1ZQ3 P;  2LBF A;  3TKY A;  1KQ8 A;  2VI6 A;  4XLE A;  1MD0 A;  3CCJ I;  2Z5U A;  1HA8 A;  2GA2 A;  4NQW A;  3RPQ A;  1Q1V A;  3VYR B;  3AFH A;  1BI3 A;  2L0K A;  4UB6 C;  4QIW N;  1G4D A;  4OMY A;  3HTS B;  4G6T B;  3TMO A;  1YI2 I;  4KT6 A;  4NB5 A;  2EBI A;  2V9V A;  1R4M B;  3HG9 A;  1WGX A;  2NVY J;  2OUM A;  3CC2 I;  3ASN H;  3K2A A;  2FRH A;  3DPL C;  5FRO A;  4GRI A;  5FO5 A;  3RPU D;  3MEX A;  5BS6 A;  5ILS A;  3IRQ A;  4DZJ A;  3CTA A;  1O3Q A;  3BJ6 A;  2WAQ N;  4XMY A;  3S2D J;  2BEO A;  3AG3 H;  2FF4 A;  3DEE A;  4BJ5 C;  4EAT A;  3ZN1 A;  4MQV A;  4NC6 A;  1IDY A;  2DW4 A;  1ZGJ A;  1E17 A;  3FK7 A;  2WB1 A;  2GXG A;  1WJE A;  4D5C A;  3OIQ A;  4C2U A;  2MH9 A;  4XLA A;  5CJ9 A;  3OMY A;  4IRH A;  1QBJ A;  2NOJ B;  3P9K A;  2EFW A;  3Q0W A;  3FXK A;  5J1U A;  1KGS A;  1PVE A;  2XSJ C;  1HKQ A;  1VND A;  2Z16 A;  2O7O A;  2K27 A;  4XOP A;  2EQR A;  2BY1 A;  2CW7 A;  2QKM B;  3SXY A;  3PO3 J;  2MC3 A;  3RJP A;  3JRI A;  4BE0 A;  1S3J A;  4J19 A;  3VPR A;  3PIP F;  1YE9 A;  5E20 A;  2H6B A;  1WH7 A;  2VQL A;  1ON2 A;  5JR3 A;  2Y0S N;  1JUS A;  4KIS A;  1MKM A;  2VJJ A;  1IJW C;  3CCR I;  2FQ3 A;  1R1T A;  2B7E A;  4Z6Y A;  4EM2 A;  3OYM A;  3GZ6 A;  5FKO A;  2XPV A;  3OSF A;  1YFH A;  2I5U A;  2PFB A;  1IRG A;  3A2K A;  2M2E A;  2QKL B;  1B1B A;  4Y7N J;  4PFP A;  3RIR A;  4JOM A;  2COB A;  1ZYR F;  2LNB A;  3WTZ A;  4PSX A;  5GAH J;  4XIC A;  3QOE A;  4GYG A;  5GTH C;  5H2F C;  3FF5 A;  1RC9 A;  2KRH A;  5HS8 A;  2HZD A;  4Z2Y A;  4L0Y B;  5F27 A;  3I9V 2;  1T08 B;  2QUF A;  2W1O A;  5L3C A;  1W7P A;  4F93 B;  1SEU A;  2HPM A;  1QHH D;  1ONV A;  4AWX B;  4XKC A;  2AQE A;  1J59 A;  4P55 A;  5B5E C;  3PL8 A;  3H5R A;  2HXI A;  4CO8 A;  1EH7 A;  3W6V A;  1RI7 A;  5LHI A;  2MFZ A;  1RUN A;  4U0W A;  4BHP A;  2F48 A;  2LYC A;  5E1W A;  3L9F A;  1T0F A;  1D1C A;  1TT0 A;  4PJN A;  2DPD A;  2A68 F;  2E2H J;  4UHT A;  3HRU A;  2HQ5 A;  4R8H A;  3ZQQ A;  5JHU A;  5FD6 A;  5B1A H;  4HG2 A;  1OPC A;  3M8E A;  3K4N A;  4KMF A;  5EZH A;  1JT6 A;  2BOL A;  3G1O A;  3BZK A;  4ANJ A;  4O3M A;  5BQT A;  2VJ4 A;  4IF4 A;  3QRF F;  5FLX Z;  1PJR A;  3SDG A;  3K4M A;  2F5E A;  1QHG A;  2DQR A;  5LEJ A;  1TC3 C;  1Z6T A;  2O9L A;  2EZH A;  4P9U A;  1SD6 A;  5E3M A;  2KKO A;  4LOC A;  4MHG A;  1SD5 A;  2VC0 A;  3HSE A;  4MLO A;  3RI4 A;  3QPH A;  2R93 J;  3J7A Y;  4O5V A;  2P4W A;  4LB6 B;  2ICW G;  4CSW A;  4B8X A;  2XAG A;  2H8R A;  4ZTJ A;  2F2E A;  5FFZ A;  1N78 A;  3H3V K;  3PSF A;  3QOD A;  4G7H F;  4NHJ A;  4M74 A;  1JJ6 C;  5DCM B;  1WKM A;  2DTR A;  1T39 A;  3ZR8 X;  3RZD J;  2K9Q A;  3E5X A;  3VSL A;  3DPU A;  4M3G A;  4BH9 A;  3SQN A;  3G71 I;  5FKL A;  1IZ1 A;  2XKO A;  1ZHF A;  1GT0 C;  2FNP A;  1B6A A;  3MZY A;  1SVO A;  4JYK A;  3CMY A;  2AXL A;  2B9S A;  3MFK A;  1ZEL A;  1I1S A;  2BHY A;  3K69 A;  2PX9 A;  4RA2 A;  4C9Y A;  4LMY A;  2VB6 A;  3ZGK A;  3H36 A;  3EET A;  1LFB A;  3ZMD A;  2QGU A;  2FU4 A;  2Q2E B;  4RM3 A;  2FNA A;  2A3S A;  4GXO A;  1Y0N A;  1P2F A;  1RR7 A;  2DT5 A;  4IQJ A;  3BRO A;  1OR7 A;  1FTT A;  1WPK A;  3GVA A;  4L9J A;  1BIA A;  3GF2 A;  1DGR M;  1I3A A;  4LGW A;  4S04 A;  4JX6 A;  1HST A;  3FZV A;  3H5N A;  4FT8 A;  4BHC A;  4H0E A;  1KQ0 A;  4LLG F;  3ZQC A;  3ZPL A;  1IRX A;  2CFX A;  3SDB A;  2QSH X;  1DQU A;  2EFQ A;  3Q0U A;  4EGZ A;  2K85 A;  4BY1 J;  1SFX A;  4ZH4 F;  2KIF A;  3SEQ A;  3ESW B;  4I0B A;  4M3B A;  2E7W A;  3K9T A;  4IHX A;  5KK1 A;  2MLG A;  4BU2 A;  2RQQ A;  2ESH A;  1ZR2 A;  2EIK H;  3C18 A;  2WY7 Q;  3D5R C;  4BE1 A;  4L5E A;  1IUF A;  4BE2 A;  1I50 J;  1P4X A;  3NWS A;  1S6L A;  1YRN B;  4M3D A;  1MW7 A;  5J40 A;  3VYT B;  2DTZ A;  2JN6 A;  3U1D A;  1XS9 A;  2XGX A;  4KMU X;  3RYP A;  2KHM A;  4FTH A;  2X6W A;  4XRM A;  1XG1 A;  3H5A A;  2XB0 X;  3EDP A;  2K3P A;  2IGN A;  2DA7 A;  3KP6 A;  4B1R A;  5LLQ A;  2BYV E;  2M4K A;  4EM1 A;  1UHW A;  3WGI A;  2LY1 A;  3FKI J;  4PFO A;  4M3E A;  1YX3 A;  4HEA 2;  5HNF A;  4RB0 A;  5L3B A;  1XSD A;  3T0Y A;  3X2Q H;  2MD5 A;  3HPH A;  1VI0 A;  2V7F A;  3QAH A;  2XAJ A;  3MMY B;  1BR1 A;  5JHF A;  5D5V B;  1CF7 A;  3I71 A;  2B0L A;  3BPX A;  2X51 A;  3F9K A;  4PCQ A;  4KIB A;  3GO5 A;  3E6C C;  3TOA A;  2PMH A;  5B66 C;  2IBD A;  3CCV I;  3E1S A;  2OD5 A;  3DBR B;  4CYC A;  3CDL A;  5EEH A;  2HS5 A;  4E7H A;  4V2G A;  4GFB A;  3K4L A;  2ZFU A;  2OU2 A;  1R00 A;  1WJF A;  2CQ7 A;  3W2A A;  2HVQ A;  3OYB A;  4HX8 A;  4QPQ A;  5AON A;  1POG A;  2EIJ H;  3BR5 A;  4RAZ A;  3ZMT A;  3TL4 X;  3GTJ J;  2PQ8 A;  2CUF A;  3RZO J;  1WZ2 A;  4XBF A;  1AHD P;  1WVR A;  2CU7 A;  4D5F A;  2QWW A;  4IHW A;  3K6G A;  4P96 A;  2BY0 A;  1GHC A;  1P4W A;  2DA5 A;  2DO7 A;  4ESF A;  4RLQ A;  1G59 A;  2JA5 J;  1C0W A;  2VOP A;  5E8G A;  3HHG A;  3COA C;  2ZNZ A;  2G7U A;  2DLL A;  2P7V B;  1F36 A;  2AHQ A;  3HYI A;  2KRC A;  3ERM A;  1MH4 A;  4OOI A;  3I55 I;  1O3T A;  1JXS A;  3JSO A;  3J7Y J;  1D8J A;  4RMN A;  3HOW J;  1SVM A;  3KYD B;  3Q9V A;  1MMS A;  5GTI C;  2HOA A;  3JRG A;  3QPL A;  4A3G J;  2FA5 A;  2BY2 A;  2NYX A;  3HRS A;  5DM6 F;  5L3F A;  2DDB A;  2VBW A;  3ZOB A;  1WJA A;  3O8G A;  2DFE A;  3VOD A;  1XGM A;  1O3S A;  4I01 A;  3R0A A;  1WJD A;  5EG0 B;  2L4M A;  3AG4 H;  1R5H A;  3I64 A;  4AID A;  3ISP A;  4E70 A;  4ZYE A;  2XF5 A;  4KN4 X;  3WTS C;  3GLX A;  1ETV A;  4LFU A;  1TWF J;  2UWM A;  2RAE A;  5H6Q A;  2OTJ I;  2DU9 A;  5KVR A;  2ZJQ F;  4LG3 A;  2ISY A;  4M9Z A;  1XMK A;  4BAC A;  2HOT A;  3TO6 A;  1RUO A;  3QP6 A;  1ZRC A;  3SZT A;  2PLY A;  3HM5 A;  3IAM 2;  2E5N A;  2KDO A;  2NOG A;  3O3K A;  3LSH A;  1D1B A;  5E17 F;  4HNU A;  2FBI A;  4A12 A;  4BDZ A;  1N75 A;  2IGO A;  5EDN A;  2VPR A;  1G6N A;  4E7Z A;  2RNG A;  1TL8 A;  5IYC J;  3EYI A;  1HSJ A;  4U88 A;  1ETX A;  1LJ9 A;  1X1P A;  1VQ7 I;  1JHF A;  2DMN A;  5K1Y A;  3DTI A;  5E3L A;  5HLT A;  1QO0 D;  4CCN A;  4A6E A;  2LP0 A;  2ECB A;  2JK3 A;  4D9J A;  1D5V A;  4Y17 A;  4YG2 F;  3JCU C;  4G7O F;  5LGU A;  4A69 C;  1UAA A;  1ZTR A;  3A01 A;  3G73 A;  2P5K A;  4E7I A;  1K78 B;  3HKZ A;  2Y31 A;  5TGT A;  3E5Q A;  1R1U A;  2EZK A;  2KJC A;  2PJR A;  3V7C A;  2IS1 A;  1UG2 A;  4LK0 F;  5CVI A;  3DPT A;  4S0H B;  2XGC A;  4KIF A;  2BVL A;  4W1U A;  4CCK A;  1SFU A;  1EV7 A;  1YHQ I;  2E60 A;  2VOD A;  3P9C A;  3AG2 H;  3AG1 H;  2V9P A;  1BL0 A;  2V26 A;  3AKZ A;  4YFK F;  1GVJ A;  3PNY A;  5CVR A;  3VDX A;  2NNY A;  2ZCW A;  2JRM A;  5FB2 A;  3B6C A;  3KIO A;  2A6E F;  4G6D A;  2HTJ A;  2M8E A;  3P5J A;  2RN7 A;  2XB5 A;  5CVV A;  1FIA A;  2W4S A;  4IVN A;  1LNW A;  4ZDP A;  2NXN B;  1XTA A;  4P5O A;  2CG4 A;  1LUJ B;  1LE8 B;  1U3E M;  2HI3 A;  5L3E A;  1F9N A;  5EF6 A;  2EK5 A;  2LTP A;  2R7O A;  3HRT A;  2IA2 A;  4G12 A;  3N97 A;  1RRJ A;  4YEL A;  4XL9 A;  3LWF A;  4M73 A;  2Z1D A;  1V5F A;  4Y15 A;  5JVT A;  3GME A;  3O8H A;  3LNQ A;  2O61 A;  2EZI A;  2IS4 A;  2M34 A;  3V8K A;  2R7Z J;  2FOW A;  4M9S A;  2F4M B;  4ZYH A;  3I4N J;  3CP2 A;  3OSG A;  2OZU A;  4Y33 A;  3R4K A;  4HOB A;  2JPB A;  3W2V A;  4F92 B;  1TNS A;  2YPR A;  2O3F A;  2STT A;  2DBB A;  1W0U A;  1TWC J;  4RAF A;  3OOU A;  1D0X A;  2W48 A;  3OY9 A;  1LFP A;  1HKS A;  2ZME B;  1HDD C;  2PJP A;  5A2Q Z;  4A3M J;  1R22 A;  2XRO A;  3H0D A;  1FBU A;  3WGH A;  1B8I B;  5E1Z B;  2MSY A;  3FMS A;  2HKX A;  3ZQH A;  1H8A C;  1PUF A;  4DBR A;  3GX4 X;  3SJM A;  3GBG A;  2CV1 A;  4GGG A;  5IP6 A;  5GPA A;  5HLI A;  5M3F J;  4UUS A;  2JUC A;  2IGM A;  2L2O A;  1MIJ A;  4AU7 A;  1OYW A;  3HUG A;  5FLX K;  2HEO A;  2XUB A;  3S1M J;  2EIL H;  3H9G A;  4LK1 F;  5FFX A;  4FCY A;  1J2X A;  2WAE A;  3FBI B;  3IH3 A;  3GYH X;  1SD7 A;  2LOO A;  3FXJ A;  4FIS A;  4WXD A;  1UHM A;  1A31 A;  1A04 A;  1NG6 A;  1F43 A;  1OMI A;  1OLT A;  2D2W A;  1ULY A;  3BTL A;  1BW5 A;  3CC4 I;  4BEH A;  3HRM A;  2BW3 A;  3KZI C;  3BG9 A;  1M1E B;  2Y75 A;  2G0E A;  3UKG A;  1Z9C A;  1CQT A;  4LIU A;  1MSF C;  1KYZ A;  2XKP A;  5GP9 A;  5D5U B;  4PGG A;  1LVK A;  4II2 A;  5HVQ C;  3MWM A;  2YR2 A;  4HF1 A;  1XGS A;  4WX9 A;  1HW5 A;  2EFP A;  4M6V A;  5FJ8 J;  3U2R A;  3MKY B;  2R5Y B;  1SC7 A;  2L9S A;  1SFE A;  3VB2 A;  4N4O B;  2P7C B;  2VQC A;  2EJR A;  3TW6 A;  2XPW A;  5AIQ A;  1Y6I A;  2GOM A;  2JA6 J;  1D0Z A;  4ESB A;  5K7F A;  4CGZ A;  2KIQ A;  2Q8K A;  2OCE A;  3FXR A;  3TDU C;  3RSN A;  2IRF G;  1BN5 A;  3GLL A;  4DYC A;  4F91 B;  2R7Q A;  1FSH A;  1TQP A;  2R5Z B;  1KON A;  1YIT I;  3LSM A;  2XAU A;  2H94 A;  4MGR A;  4MQ9 F;  1IN7 A;  3CLO A;  3K4J A;  4NDL A;  3Q5F A;  2E1N A;  2W85 A;  3KP4 A;  1JTX A;  2XGE A;  2ZKZ A;  4TV7 A;  2Z2S B;  2QLZ A;  4LIV A;  1I1G A;  5EZG A;  1W0T A;  3I53 A;  4A3C J;  1FLI A;  1UMQ A;  1ZLK A;  4RB3 C;  2ZB9 A;  4FQG A;  4JP0 A;  5JFR A;  4BQN A;  2Z3Y A;  1A36 A;  1KZH A;  2WB1 N;  2DA2 A;  4BUP A;  1FEX A;  3KP2 A;  4HBL A;  4XKV A;  3GFI A;  4II3 A;  3BC8 A;  5EGO B;  2V9K A;  1IGN A;  3OYC A;  3L2Q A;  1HXD A;  4RGU A;  3GEZ A;  2OJE D;  5FRN A;  5CVJ A;  2WV1 A;  3GFM A;  3BDD A;  4KIC A;  1P9Q C;  4F55 A;  5H6R A;  5L3G A;  3L09 A;  2ACJ A;  1XCB A;  2G9W A;  1Z67 A;  4N9I A;  3M8J A;  4MTE A;  4IX7 A;  3HEF A;  1Z7U A;  1FNN A;  3ZMU A;  1IAW A;  1RIO H;  5KNL A;  3KET A;  3QQA A;  2DA3 A;  4IHS A;  3S1N J;  1D3Y A;  3VEP A;  1P6R A;  4ZDL A;  4BXU A;  1FMV A;  4D7N A;  1UJ8 A;  1EJ9 A;  1QU3 A;  4EVI A;  4WK8 F;  3FX3 A;  5BNG A;  3S3M A;  3CCY A;  1U6G A;  2JPC A;  1X1C A;  3JRH A;  1QVU A;  4BXX J;  5DD8 A;  1ACI A;  4AM3 A;  4DYQ A;  2JSC A;  4ZYG A;  1YS7 A;  1W5C C;  3JRD A;  3MKZ A;  2LR8 A;  3KZZ A;  4NBQ A;  4D0P A;  2A5W A;  3F8N A;  1DP7 P;  2HYJ A;  2JA8 J;  1FC3 A;  1AU7 A;  5LRS A;  1WWX A;  3MKL A;  1YOV B;  1ERD A;  1S9H A;  2QQA A;  1H0M A;  3GTO J;  3OYF A;  2UV1 A;  1RKW A;  2GZW A;  3JW4 A;  3R0J A;  3C1D A;  4GCV A;  2OTL I;  4AC0 A;  2MC4 A;  3CF5 F;  2CJJ A;  4KT5 C;  4YIF A;  1FOK A;  3V42 A;  5F08 A;  1B9N A;  1F4K A;  1YJN I;  4IZZ A;  1IDZ A;  1Y1W J;  1TTY A;  1Z0X A;  4Y3O A;  2ZJ2 A;  4N9H A;  5M5X J;  3I4M J;  2M4G A;  3LA7 A;  4B43 A;  2D1H A;  2BXZ A;  1VQM I;  1A6Q A;  1YJW I;  4E4H A;  3DQV C;  3HJE A;  1V3F A;  5FRM A;  3HDD A;  2F5D A;  3OYD A;  3SFZ A;  4Y13 A;  1BC7 C;  2STW A;  2JTV A;  3M9A A;  2WBM A;  5M3M J;  5HLG A;  3H0G J;  2QEN A;  2BV6 A;  4OIP F;  2V6C A;  4CHU A;  3ONQ A;  3CO6 C;  2K40 A;  2L7Z A;  4E7L A;  3KLO A;  1YIJ I;  2GXA A;  3PUB A;  4EMS A;  2GA1 A;  3U1K A;  5K7H A;  3RKW A;  3CP8 A;  2IP2 A;  3CCS I;  2H8W A;  3J81 Z;  3UNG C;  1I6X A;  3BP8 A;  3L00 A;  1OCC H;  1T33 A;  5CQG A;  3HXL A;  1R1V A;  3BR3 A;  2CS3 A;  4HNT A;  2H1L A;  2HGC A;  3ELK A;  1AOY A;  4XRS G;  4UB8 C;  4PJ0 C;  4BBR J;  3BJO A;  4I02 A;  2X1D A;  4ASN A;  2PMZ A;  4L9V A;  3AAF A;  2BVM A;  1F1Z A;  4XLF A;  3LST A;  3H92 A;  3M4O J;  3QPT A;  3ZMS A;  4G9Y A;  3KP5 A;  3V7S A;  3MAJ A;  2Q2E A;  4PSW A;  1FT9 A;  2Y69 H;  3KPH A;  4DNC A;  4NQW B;  1PP7 U;  3CD6 I;  3R61 A;  2JUG A;  2IS2 A;  2OV7 A;  3DU5 A;  3GFL A;  1XMA A;  2KDZ A;  3BTC A;  2M0M A;  1J0R A;  4YFN F;  1XC5 A;  2YS9 A;  4XN3 A;  1P7I A;  1X1B A;  2DYS H;  1SAN A;  3I58 A;  1XSV A;  1VQP I;  2FJ1 A;  2E36 A;  4WXC A;  3TO7 A;  1ZGA A;  3HSR A;  3HOS A;  1IV8 A;  2BY3 A;  4W97 A;  4A3L J;  3ZMZ A;  4BJ6 C;  2IXS A;  3F8M A;  4C30 A;  1TW2 A;  5C3E J;  4XNF A;  2V1U A;  3JR9 A;  1MMG A;  4A3J J;  1OQY A;  2A05 A;  3ZRG A;  2DOA A;  1OKR A;  4V19 K;  1DUX C;  1X3U A;  1E3P A;  5HDN A;  1LQ1 A;  1HC8 A;  2QSG X;  3HC7 A;  2W82 A;  4DOZ A;  4FE4 A;  4YFX F;  2PEX A;  3N05 A;  1YRN A;  3FWE A;  5BPD A;  1ETY A;  2MW8 A;  3TOB A;  3F3X A;  4LJZ F;  4KFC A;  2DMT A;  2HOE A;  2HU9 A;  3E5U A;  3G6E I;  3PSI A;  1U2W A;  2DT7 B;  2ZME C;  2M7B A;  2N8G A;  2YSR A;  3HOT A;  3ZQF A;  4DJA A;  1JT0 A;  2CMP A;  4BQO A;  4KIG A;  5KCM A;  1UZC A;  1XDU A;  3GFJ A;  4XN0 A;  4EQQ A;  3ABM H;  2VIX A;  2VKD A;  5E1X A;  4D7M A;  2L9R A;  1X1D A;  5LBQ A;  3RKX A;  4OIO F;  1KQ9 A;  3BZ6 A;  1YIO A;  5IOY A;  1STZ A;  1ZRE A;  2ID3 A;  2H27 A;  3JRF A;  4G6Q A;  1D1A A;  2E1M B;  5EJC A;  2DFF A;  2JZY A;  2VKE A;  1E0E A;  2CRG A;  2GAU A;  3ZP5 A;  4HSR A;  2BGC A;  3WHC A;  2F4I A;  4RGR A;  1P4A A;  4XQF A;  4FET A;  5HOD A;  3MQ0 A;  4RDU A;  1YW8 A;  4N4N B;  4OMZ A;  2NS8 A;  2ZO4 A;  3ABU A;  4ON0 A;  2KT0 A;  4ZC3 A;  3MKW B;  5M5W J;  1ZG5 A;  1IF1 A;  4MNU A;  3VSK A;  3OR1 C;  1MJB A;  1W7P B;  2P6T A;  3IH2 A;  2BBY A;  1L3L A;  2O6G E;  5FD5 A;  4HRI A;  2F5C A;  2V1N A;  4A93 J;  1HOM A;  3B6A A;  4OU0 A;  4GO1 A;  2A07 F;  3WTX C;  2PG4 A;  3S16 J;  2CGP A;  3CF2 A;  1RES A;  3L7W A;  4EJT A;  4FE7 A;  3K4B A;  1JUP A;  2KQR A;  4XLH A;  5CVU A;  1OCP A;  4OIR F;  1U8R A;  3P7N A;  3B73 A;  3LSR A;  3J80 Z;  4B4C A;  2VKH A;  5IY5 H;  5F0F A;  1A5J A;  4F7Z A;  3CCU I;  1TQM A;  4IJA A;  1BM9 A;  1WJB A;  2FBK A;  2HQR A;  1OYI A;  4DQ2 A;  4E6K G;  3HL2 A;  3RDI A;  1MBE A;  2L9V A;  1X58 A;  3C3W A;  2V4J C;  3C2H A;  3E6D A;  1X3Z B;  2XAQ A;  4AYB A;  2E34 A;  1T6S A;  1U9N A;  3V8J A;  5LD2 C;  3FM3 A;  3G3Z A;  3VYS B;  5GPC A;  4R1H A;  4ENM A;  2GM4 A;  1MGT A;  2R7W A;  2DAO A;  5EG0 A;  2GWR A;  3B02 A;  3TW7 A;  2WC2 A;  1ETQ A;  4A0Z A;  2EV5 A;  2J5O A;  4JX4 A;  2EIN H;  1HKT A;  2ZXJ A;  1TW3 A;  4BY7 J;  3CJT B;  5K5Q A;  2LY9 A;  1P92 A;  2HNH A;  1HW1 A;  1USS A;  3BR1 A;  4U7D A;  3DLA A;  1JUM A;  2JWT A;  1LEA A;  2VBZ A;  3Q0V A;  4P9F A;  3A0B C;  5GAE J;  4XID A;  1K83 J;  3OYA A;  4XKW A;  1NK3 P;  3AL0 B;  3MD2 A;  2R7X A;  2BE5 F;  4X0G A;  2L7M P;  3ZMV A;  3K70 C;  4ENN A;  2L01 A;  3TBI A;  1RKT A;  3LL7 A;  4A3I J;  3IC7 A;  2X85 A;  2RDP A;  3V4G A;  5E3N A;  4A2U A;  2FMY A;  1Y56 A;  2M3A A;  2HOS A;  1ON1 A;  2DI3 A;  5K7Z A;  1SVL A;  2EIM H;  4G94 A;  4UNO A;  3IH4 A;  5JLW A;  3GTQ J;  1RNL A;  2XAS A;  5AIP A;  3G1L A;  3SZP A;  1OIS A;  4M3F A;  3TDZ C;  3KP3 A;  4HZF A;  3A1Y A;  1K78 A;  2K4J A;  3HKZ N;  3K7A J;  2QCO A;  1FYK A;  2EA4 A;  2IAI A;  2E1C A;  5HNH A;  2FML A;  1KU7 A;  2QBY A;  2IA0 A;  3S3O A;  3JRB A;  2KP6 A;  2DA4 A;  4L9T A;  4UY8 I;  3DKY A;  1GV2 A;  4HV6 A;  5J3L A;  1E3O C;  3OL3 A;  3W6K B;  3IRR A;  3E7L A;  2TCT A;  3DV8 A;  2MD0 A;  1WSU A;  4CCO A;  2ELJ A;  3WTU C;  2AS5 F;  1MSE C;  1VQ4 I;  3KFW X;  5IT3 A;  2PN6 A;  2XVC A;  3O2P E;  3CQZ J;  3GZN B;  1B72 B;  4IOC F;  3U21 A;  5D4R A;  3PQJ A;  1JKQ C;  2BHZ A;  2YX4 A;  1K6O A;  1LDD A;  1YW7 A;  1BOA A;  3Q9S A;  2A61 A;  3GZ5 A;  1EKE A;  1W1W E;  2W57 A;  2LFB A;  1MDM B;  3MZH A;  1IXC A;  3ZQI A;  4PUS A;  3H9J A;  1XSX A;  4OIN F;  3JSP A;  2OQG A;  1TLH B;  1YLF A;  1NH3 A;  4C2M J;  4AIH A;  2H1K A;  4QSH A;  2OPT A;  3TED A;  4MFE A;  3CC7 I;  2DMU A;  3GTM J;  2ZSH B;  2DA6 A;  1CF7 B;  2FQ4 A;  2OAZ A;  5JLX A;  3K1M A;  3KEY A;  5JI6 A;  1KU9 A;  2HZT A;  2FXA A;  5LEK A;  5BMZ A;  1EH6 A;  3IKT A;  1R23 A;  2MAB A;  2QQ9 A;  2VBY A;  3LQQ A;  2RKH A;  4X6A J;  2MBF A;  4A0Y A;  2ZME A;  3D1N I;  2DDA A;  2MH2 A;  3EUH C;  1S8N A;  3JTH A;  3FHZ A;  4FX0 A;  3RKY A;  4ZZL A;  1JKR C;  1JKO C;  4IHT A;  4HLX A;  4LLN A;  1XMX A;  3CJQ B;  2VQG A;  1T38 A;  2LKP A;  1SD4 A;  3NAR A;  2X1C A;  1HF0 A;  2ADU A;  1BI0 A;  2LC2 A;  4EEF G;  4AIK A;  3VFZ A;  2I10 A;  4LG0 A;  1UHS A;  3ZQL A;  3OYN A;  3H35 A;  1H9G A;  4HF0 A;  2E2I J;  3FXU A;  1T98 A;  5IP7 J;  2CFO A;  5LHH A;  2H09 A;  2E1O A;  1V55 H;  3W6J B;  2VE8 A;  4QTR A;  2X6O A;  2DFH A;  1WJC A;  4WXH A;  1FYL A;  4M6Y A;  4NC8 A;  3PFY A;  2K9M A;  2RGV A;  1U9O A;  3OS0 A;  2JT1 A;  2YU9 J;  5FKK A;  2OZ6 A;  1IN5 A;  1VTN C;  2DA1 A;  5DCF A;  1OCR H;  2QSF X;  4KNY A;  4EJW A;  1QGP A;  1G3T A;  1U5T B;  1J9I A;  1V5E A;  4CIC A;  2IA1 A;  4HA8 A;  2R5Y A;  3BQZ A;  3RQ4 A;  1J5Y A;  1JHH A;  2VUM J;  3HIF A;  5TJJ A;  2RRE A;  4DBQ A;  4MTD A;  2IT0 A;  2ZSI B;  2FX0 A;  5M5Y J;  3CCQ I;  1FX7 A;  2LG4 A;  4QPO A;  2PI0 A;  1S72 I;  1OCO H;  2LY2 A;  1LB2 A;  1F5T A;  2OQR A;  2CYY A;  3QU6 A;  2D45 A;  3BPV A;  3IAS 2;  1IN4 A;  3OYE A;  3L2R A;  2QQB A;  1Z77 A;  3WE2 A;  2P0W A;  2DYR H;  3M3Y J;  1L0O C;  5KAI C;  2FSW A;  1JKP C;  2XSD C;  2EFN A;  1Z7L A;  2R5Z A;  3G1M A;  3GXO A;  3I4P A;  2V1D A;  5CLS A;  3F6V A;  3H3U A;  1FZP B;  1RZ4 A;  4GYI A;  1UG0 A;  3CUQ B;  3F0C A;  5L3D A;  4ZYD A;  3ZXS A;  4S05 A;  2Y9Y A;  2IVM A;  1Z3Y A;  2QM3 A;  1VFC A;  2WAF A;  1KU3 A;  4BGD A;  2JMW A;  4BXF A;  3J7Z I;  2E1M C;  2K5C A;  4PGH A;  1VQ6 I;  5IYD J;  5ICC A;  4D1Q A;  2ZNY A;  4L18 B;  1A6I A;  4A3F J;  3FIS A;  5DS9 A;  1MMD A;  1BI2 A;  3NRV A;  3BR6 A;  1BOB A;  3FM5 A;  5EGO A;  4B47 A;  3C7J A;  3OYJ A;  1OCT C;  2PJR B;  3FKJ A;  2A6H F;  3SEZ A;  3C2B A;  2P81 A;  3QWL A;  2MYS A;  2IPQ X;  1I27 A;  4LIT A;  1QPI A;  2GIZ A;  1LVA A;  3ZQ7 A;  2YUS A;  1D5Y A;  4ABZ A;  2KJB A;  2NVT J;  2M9H A;  3I59 B;  2HYF A;  3LQR A;  1YO5 C;  3BQY A;  4XM3 A;  2DOF A;  2IEK A;  3U9G A;  3M07 A;  4U0V A;  5ICE A;  2AO9 A;  3EYY A;  2R0Q C;  1ZG1 A;  3I54 A;  3I56 I;  1MH3 A;  4C3I J;  4C3J J;  1UST A;  4N0B A;  1TZL A;  1GXP A;  1WRJ A;  1AWC A;  2K86 A;  3VYU B;  3NWT A;  1YYV A;  4BQQ A;  4IQ4 A;  2GXB A;  3GUD A;  2R7U A;  2TRT A;  4LB5 A;  4Y52 J;  2WY8 Q;  1IXS B;  3F8B A;  1DPR A;  4DZP A;  1EH8 A;  4IO9 F;  2HQN A;  2LMD A;  1IO2 A;  3L2U A;  3F22 A;  4I6Z A;  1U8B A;  4YII A;  1B59 A;  1G8X A;  2VE9 A;  5IT9 Z;  5C4X J;  1HW2 A;  2QZ8 A;  4CZZ A;  1O4X A;  5E3O A;  1R36 A;  3DBH B;  1ZRD A;  1FIP A;  4M9X A;  3OYL A;  2AXT C;  3JAM Z;  2F5F A;  5CPR B;  3ZQG A;  1FOX A;  1FWZ A;  2HWV A;  3S8P A;  3JRC A;  1MBJ A;  3TO9 A;  3HOU J;  5IOZ A;  4IRG A;  5F6F A;  3BG3 A;  2KMU A;  3SZG A;  3AL0 C;  3J80 K;  1YTY A;  1TWH J;  3S3N A;  1AKH B;  2K7L A;  4UVC A;  1U0J A;  1GVD A;  1PUF B;  2OA4 A;  1XCV A;  3L2V A;  4UUS B;  2HFH A;  1X4P A;  1Y1V J;  1Z6R A;  4L5I A;  2ZXW H;  3ECO A;  4UUV A;  3HUG B;  1K4T A;  3DKX A;  2C6Y A;  3FK6 A;  4G7Z F;  2NS0 A;  4EGY A;  4L9N A;  4IL6 C;  2NRA C;  1WFX A;  1X19 A;  3KX2 A;  3PO2 J;  4LLL A;  1ZAO A;  3A0H C;  2G7H A;  3K2Z A;  4EJV A;  1T2K A;  2ZBK A;  4XLN F;  4ESJ A;  1APL C;  1Y8R B;  3K70 D;  2LSO A;  3BCA A;  4RLF A;  1BR4 A;  4AIJ A;  1ETO A;  3OS2 A;  1NK2 P;  2WWY A;  2K3F A;  4I98 B;  4NUB A;  1IUY A;  2LK2 A;  3S17 J;  2X6X A;  4WWC A;  2HQA A;  2M87 A;  3ECH A;  3PIO F;  3LA3 A;  3S93 A;  3KZY A;  2DJI A;  2Y0M A;  2ME6 A;  2LDU A;  3FXL A;  3IV5 A;  1MNM C;  4KJZ A;  2CH0 A;  4E7J A;  2XRL A;  2A69 F;  2RQP A;  5ERI A;  2K9S A;  2MGQ A;  2VC1 A;  2PMZ N;  1K4S A;  3ABT A;  5FKM A;  2HPI A;  2NVQ J;  1KYW A;  3HOZ J;  3HZJ A;  3GTG J;  5IPA A;  1VQL I;  1R6R A;  3E6B A;  4IRI A;  2XGD A;  1NTC A;  4UV9 A;  3OR2 C;  3HOY J;  3A02 A;  2F5V A;  2NVX J;  1ZLJ A;  3RKQ A;  3OIO A;  2V1X A;  4H4K C;  3FHN A;  2EV6 A;  1HDP A;  2VT2 A;  4M71 A;  4PK4 A;  3SFI A;  1RPW A;  3E3V A;  4WCG A;  2Y9Z A;  2LD5 A;  4EV0 A;  4HX4 A;  5DYM A;  4CXF A;  4I09 A;  4YEJ A;  2DCE A;  4OIQ F;  2HVS A;  2IJL A;  2LVS A;  1ETK A;  1BI1 A;  3CDI A;  2CW8 A;  2GQQ A;  2VXD A;  3GCM A;  4BS9 A;  2VJI A;  1MBK A;  2OCC H;  3FXO A;  3TP0 A;  1G3S A;  3T8R A;  3WU2 C;  1PYV A;  3KEQ A;  2HR3 A;  2VT3 A;  3WHB A;  4ZTF A;  1J7K A;  3BTI A;  3TGN A;  3O6B B;  2QA4 I;  1JJ8 C;  4UXN A;  2CUZ A;  2VBX A;  2K02 A;  3I3L A;  4RGS A;  3S1R J;  3VOE A;  4IEJ A;  3P9I A;  4I7H A;  4A0X A;  1Z05 A;  4KYW A;  3H9Q A;  4F52 A;  2ZXI A;  2EFO A;  2MG4 A;  3I5U A;  2GLO A;  5DCM A;  3EPZ A;  4IHV A;  2H6C A;  2FBH A;  3LSG A;  1DU0 A;  1ZH5 A;  3IHU A;  4HNV A;  2DT6 A;  1GXQ A;  3LFU A;  4ENJ A;  2VKV A;  4MO7 A;  3T1B A;  2YX7 A;  4XOR A;  1E3H A;  1FP2 A;  3OWT A;  1W4M A;  1X1A A;  1WI3 A;  3CJN A;  1GV5 A;  3F8F A;  3HTU A;  2KRF A;  4CH7 A;  3DBL B;  4R79 A;  1MNE A;  4A3K J;  1N25 A;  1BR2 A;  1SMT A;  3L2C A;  5HS7 A;  1BJA A;  3LAJ A;  1QRY A;  2A6T A;  3MVP A;  2LBF B;  4A3E J;  2CUJ A;  2NNN A;  4ENK A;  3WTT C;  5FLM J;  4PJL A;  3HPG A;  2M8G X;  3F72 A;  5F0H A;  5ED4 A;  2ZXH A;  3S1Q J;  2VJ5 A;  1MJA A;  1S7E A;  5CKT A;  3JRE A;  3BWG A;  2CSO A;  4M6X A;  2VL8 A;  1HQC A;  3S2H J;  2CO5 A;  2R3S A;  4QLC U;  4NNJ A;  4I2O A;  1U5T C;  4A6D A;  4B3A A;  5HDG A;  3OIP A;  4FAS D;  4B3X A;  3WU1 B;  3S15 J;  1UEL B;  1JE8 A;  2WAQ A;  4CCJ A;  2TDX A;  1IRZ A;  1FOW A;  1S7A A;  3C2G A;  1TWG J;  3OYK A;  2Z33 A;  4PZJ A;  3WTW C;  1J75 A;  4IOA F;  3LAP A;  2O8K A;  2X48 A;  3WG9 A;  4RAG A;  3T8T A;  4BYY A;  1DP3 A;  3DEW A;  4ZYA A;  4JX5 A;  3DF8 A;  2JVH A;  3DKW A;  2CV0 A;  4UUT A;  3FDY A;  1FY7 A;  3BLY A;  1OFC X;  1XGN A;  4AYB N;  4MEX F;  1LDK B;  1MBF A;  1TT5 B;  3CUQ C;  4BAY A;  2ID6 A;  3T5X A;  1G3W A;  1V54 H;  3S32 A;  2P5L C;  3CUO A;  1G3Y A;  5DDG A;  2A5Y B;  2LRE A;  4XSX F;  2Y0S A;  1VQN I;  1DU6 A;  2M30 A;  1T95 A;  1BC8 C;  2KLO A;  5BPI A;  4HDU A;  1WQ2 A;  3LMM A;  5C4J J;  3FXQ A;  2Z99 A;  2DMQ A;  1N77 A;  4Q4Z F;  2RVC A;  1VZ0 A;  5LRR A;  2DQL A;  2RC4 A;  4EJU A;  4BDY A;  1TNT A;  1I5Z A;  4XKB A;  3D0S A;  4GDF A;  1SFK A;  2F4O B;  3BY6 A;  3IKV A;  4A3D J;  2M45 A;  3UR3 C;  2P6S A;  4Q48 A;  3CCE I;  1WHU A;  3CDH A;  2Z9O A;  2MA3 A;  2LH9 A;  3ROU A;  5J8F A;  3GTP J;  2IS6 A;  5K5O A;  4C2T A;  2HXO A;  1X2N A;  3ZCO A;  1R4N B;  3K4K A;  5A2Q K;  4CUG A;  2OBP A;  2DN0 A;  1IN6 A;  3ABL H;  2K9L A;  5EYR A;  2HDD A;  2FOK A;  3NAU A;  1WI9 A;  3A4C A;  1R49 A;  2Y2Z A;  3GTL J;  2GOX B;  5ILV A;  2CQN A;  1MND A;  4EM0 B;  2JSP A;  1I3Q J;  3GW2 A;  5ICG A;  1QNT A;  3ASO H;  4BNC A;  1WJ5 A;  2UUZ A;  2ETH A;  1ZG3 A;  4HYE A;  1W36 C;  2F6C A;  1W7P D;  3FMR A;  2K4B A;  2M7A A;  3E0J B;  1XB4 A;  2R7D A;  4E7K A;  3WOD F;  2XF6 A;  1S7O A;  2JVG A;  3CJR B;  1S5L C;  4E7S A;  3HSF A;  3CMA I;  3LSJ A;  5GAG J;  3IUO A;  3WU0 A;  5B3S H;  1LDJ A;  2UXN A;  1X3W B;  2DK8 A;  1FPQ A;  3KEO A;  2EB7 A;  4IPA A;  2W25 A;  1MBG A;  2DXI A;  5BOX A;  1G2H A;  2XIG A;  4KUM A;  4BHB A;  4J01 A; 
#chains in the Genus database with same CATH homology
 1FP1 D;  1FSE A;  1ZRF A;  3M8F A;  2VN2 A;  4U7B A;  5J8C A;  1R7J A;  1FBQ A;  2KIM A;  2Y48 A;  1XD7 A;  2HTS A;  3S2W A;  3NEU A;  1UCR A;  2ELH A;  5D8L B;  3ERE D;  1MDM A;  2M5W A;  4I0A A;  4KN7 X;  2WV0 A;  4BQA A;  3V8L A;  5HLH A;  4G8X A;  2CQK A;  3M7G A;  2DK5 A;  3J7A O;  1IXR C;  4JQF A;  2P8T A;  3EQL F;  3KE2 A;  1U78 A;  4U0Y A;  5D5W B;  1R58 A;  2QYO A;  6PAX A;  4XRF A;  2IW5 A;  2PBI A;  2Q0O A;  5IT9 K;  1O3R A;  2XRN A;  1BIB A;  1REP C;  2D1V A;  3K0L A;  3DXJ F;  3JAM K;  4HV5 A;  5F64 A;  3F8C A;  3IWF A;  1B4A A;  1LEB A;  1V4R A;  1YS6 A;  3GWZ A;  3KCC A;  4IXA A;  4A5M A;  3M1E A;  3DFG A;  2VOO A;  2XAH A;  1MJ9 A;  4RB1 A;  3KLN A;  2EWN A;  4Q5S F;  3BOQ A;  5K5R A;  1W5S A;  1KA8 A;  5ILU A;  5LGT A;  4UVB A;  1B9M A;  3K1P A;  2RV8 A;  5ICF A;  1KU2 A;  3ML6 A;  3WE3 A;  2V79 A;  2YU3 A;  2HYG D;  4KDP A;  1UB9 A;  1BBY A;  3JTG A;  5DUI A;  1K79 A;  1K7A A;  1U5T A;  1XN7 A;  3F21 A;  3PQK A;  2XAF A;  1O57 A;  1OYY A;  5F1R A;  3F6O A;  5H20 A;  1W5T A;  2WTE A;  3D5L A;  1QQI A;  4JK1 X;  2L3D A;  3HHH A;  2RNJ A;  4L5J A;  5E18 F;  3REO A;  1Z91 A;  1Q1H A;  1SAX A;  1HBX G;  3CUQ A;  1UFM A;  4L0Z B;  3I0T A;  4RB2 C;  4PDK A;  1SMY F;  1MZB A;  2X4H A;  4FHT A;  2VON A;  5HOO A;  2FE3 A;  5HS9 A;  1Z1D A;  5CYV A;  4HLY A;  1TBX A;  2FEZ A;  2QBY B;  3N4M A;  1IRF A;  1R5G A;  3RTR A;  5J6X A;  3I59 A;  1QZY A;  4HQM A;  3LFK A;  2UXX A;  2R7F A;  3QOP A;  3K1N A;  2L4A A;  3R6S A;  4O6J A;  3J81 K;  3DEU A;  3QU3 A;  2DPU A;  1FBS A;  2W24 A;  2VXZ A;  2ISZ A;  1TQI A;  3H3Z A;  4RAY A;  1XDS A;  2EA2 A;  5HDK A;  1YQA A;  2PMU A;  2HDC A;  2O0Y A;  3PFI A;  1NHA A;  4AD9 A;  4UV8 A;  3NQO A;  5E8I A;  1IW7 F;  3R60 A;  3OV8 A;  4Q47 A;  5LHG A;  3IL2 A;  3V7R A;  1ZN2 A;  4LD5 A;  3TQN A;  4A5N A;  4HF2 A;  1E2X A;  3CO7 C;  1YW9 A;  4RS8 A;  1O7F A;  1D8K A;  2ESN A;  1IN8 A;  2QVO A;  2J5P A;  2M1B A;  5FGM A;  3KP7 A;  5D5X B;  1FYM A;  5LGN A;  2O03 A;  4HQE A;  2W84 A;  3E97 A;  3FMQ A;  2DFI A;  1QZZ A;  3ZN0 A;  5EEG A;  2UZK A;  3IWZ A;  4LG0 B;  1CGP A;  2L02 A;  2KIU A;  2O8X A;  4WF2 A;  1QPM A;  1YG2 A;  5DV5 A;  2L54 A;  1H9T A;  4RGX A;  4KA4 A;  4HX7 A;  2XHK A;  3LA2 A;  3RYR A;  4CYD A;  5D4S A;  3RPU A;  3QP5 A;  1XGO A;  5TRD A;  1O7L A;  5D6E A;  1DDN A;  4ZZD A;  2MLK A;  4ETS A;  4AVP A;  3SHF A;  1Y0U A;  3WGG A;  4HDV A;  1ODD A;  2LF8 A;  3ULQ B;  2EV0 A;  1DPU A;  4HAM A;  2JRT A;  3E6M A;  5DEQ A;  4CDG A;  4EJO A;  2NAZ A;  4K2E A;  2COM A;  4HW0 A;  4FX4 A;  2CWE A;  4XSZ F;  3WTY C;  3F23 A;  1PUE E;  2ZFW A;  4QWQ A;  2XV4 S;  2GIV A;  4JBA A;  1PP8 F;  4UVA A;  4M72 A;  3DP7 A;  2LF7 A;  5DD4 A;  2E7X A;  3EUH A;  2P5V A;  2X0L A;  5D8K B;  2HKO A;  1JGS A;  3WTV C;  3BJA A;  3OOP A;  3MCZ A;  1ZAR A;  1S29 A;  4B09 A;  5D6F A;  2CW0 F;  5DUK A;  1PDN C;  4MEY F;  4XLP F;  3TKY A;  1KQ8 A;  1MD0 A;  2Z5U A;  2GA2 A;  4NQW A;  3RPQ A;  1BI3 A;  1G4D A;  4OMY A;  3HTS B;  4NB5 A;  2V9V A;  2FRH A;  3DPL C;  5FO5 A;  5BS6 A;  3IRQ A;  5ILS A;  3MEX A;  3CTA A;  1O3Q A;  3BJ6 A;  2BEO A;  2FF4 A;  3ZN1 A;  4MQV A;  2DW4 A;  1ZGJ A;  1E17 A;  2GXG A;  2MH9 A;  5CJ9 A;  4IRH A;  1QBJ A;  3P9K A;  2EFW A;  1KGS A;  1HKQ A;  2K27 A;  3SXY A;  2MC3 A;  3RJP A;  1S3J A;  5E20 A;  2H6B A;  1ON2 A;  5JR3 A;  1MKM A;  2FQ3 A;  1R1T A;  4EM2 A;  3GZ6 A;  1YFH A;  2PFB A;  1IRG A;  1B1B A;  3RIR A;  1ZYR F;  2LNB A;  3WTZ A;  4GYG A;  5HS8 A;  3FF5 A;  4L0Y B;  4Z2Y A;  2QUF A;  5L3C A;  1W7P A;  1ONV A;  4AWX B;  1J59 A;  4P55 A;  4CO8 A;  1EH7 A;  1RI7 A;  5LHI A;  1RUN A;  4U0W A;  4BHP A;  5E1W A;  3L9F A;  1T0F A;  2DPD A;  2A68 F;  4UHT A;  3HRU A;  4R8H A;  5JHU A;  5FD6 A;  1OPC A;  3M8E A;  4KMF A;  4O3M A;  5BQT A;  4IF4 A;  3QRF F;  5FLX Z;  2F5E A;  2DQR A;  5LEJ A;  1Z6T A;  4P9U A;  1SD6 A;  2KKO A;  4MHG A;  1SD5 A;  2VC0 A;  3HSE A;  3RI4 A;  3QPH A;  4O5V A;  2P4W A;  4LB6 B;  4B8X A;  2XAG A;  2F2E A;  5FFZ A;  4G7H F;  4NHJ A;  4M74 A;  5DCM B;  1WKM A;  2DTR A;  1T39 A;  3E5X A;  4BH9 A;  3SQN A;  1IZ1 A;  2XKO A;  1ZHF A;  2FNP A;  1B6A A;  3MZY A;  2AXL A;  3MFK A;  1I1S A;  3K69 A;  4LMY A;  3EET A;  3ZMD A;  2FU4 A;  2FNA A;  2A3S A;  4GXO A;  1P2F A;  2DT5 A;  3BRO A;  1OR7 A;  3GVA A;  4L9J A;  1BIA A;  3GF2 A;  4LGW A;  4S04 A;  1HST A;  3FZV A;  4FT8 A;  4BHC A;  4H0E A;  1KQ0 A;  4LLG F;  3ZPL A;  2CFX A;  2EFQ A;  4EGZ A;  1SFX A;  4ZH4 F;  2KIF A;  4I0B A;  2E7W A;  3K9T A;  5KK1 A;  2MLG A;  2ESH A;  3C18 A;  1P4X A;  1S6L A;  3U1D A;  2XGX A;  4KMU X;  3RYP A;  3EDP A;  5LLQ A;  3KP6 A;  2BYV E;  3WGI A;  1UHW A;  4EM1 A;  4RB0 A;  5L3B A;  1XSD A;  3T0Y A;  2MD5 A;  3QAH A;  2XAJ A;  5D5V B;  1CF7 A;  3I71 A;  2B0L A;  3BPX A;  4PCQ A;  4KIB A;  3GO5 A;  3E6C C;  3TOA A;  2PMH A;  2OD5 A;  5EEH A;  2HS5 A;  2OU2 A;  1R00 A;  4HX8 A;  5AON A;  4RAZ A;  3ZMT A;  2PQ8 A;  4XBF A;  2QWW A;  4P96 A;  1GHC A;  1P4W A;  2DO7 A;  4ESF A;  1C0W A;  2VOP A;  5E8G A;  3HHG A;  3COA C;  2ZNZ A;  2G7U A;  2DLL A;  2P7V B;  3HYI A;  4OOI A;  1O3T A;  1JXS A;  3JSO A;  1D8J A;  3Q9V A;  2FA5 A;  2NYX A;  3HRS A;  5L3F A;  2VBW A;  3VOD A;  1XGM A;  1O3S A;  4I01 A;  3R0A A;  2L4M A;  1R5H A;  3I64 A;  3ISP A;  4E70 A;  4ZYE A;  4KN4 X;  3WTS C;  3GLX A;  4LFU A;  2UWM A;  5H6Q A;  2DU9 A;  5KVR A;  2ISY A;  4M9Z A;  1XMK A;  3TO6 A;  1RUO A;  3QP6 A;  1ZRC A;  3SZT A;  2PLY A;  3O3K A;  5E17 F;  2FBI A;  4A12 A;  1G6N A;  3EYI A;  1HSJ A;  4U88 A;  1LJ9 A;  1JHF A;  5K1Y A;  1QO0 D;  4A6E A;  1D5V A;  4Y17 A;  4YG2 F;  4G7O F;  5LGU A;  3G73 A;  2P5K A;  1K78 B;  3E5Q A;  1R1U A;  2KJC A;  3V7C A;  4LK0 F;  5CVI A;  3DPT A;  4KIF A;  1SFU A;  1EV7 A;  2VOD A;  3P9C A;  4YFK F;  1GVJ A;  5CVR A;  2NNY A;  2ZCW A;  5FB2 A;  2A6E F;  4G6D A;  2HTJ A;  2M8E A;  2RN7 A;  5CVV A;  4IVN A;  1LNW A;  4P5O A;  2CG4 A;  1U3E M;  5L3E A;  1F9N A;  2EK5 A;  3HRT A;  2IA2 A;  3N97 A;  3LWF A;  4M73 A;  4Y15 A;  5JVT A;  2O61 A;  3V8K A;  4M9S A;  4ZYH A;  2OZU A;  3R4K A;  4HOB A;  2JPB A;  1TNS A;  2YPR A;  2O3F A;  2STT A;  2DBB A;  1HKS A;  2ZME B;  2PJP A;  5A2Q Z;  1R22 A;  2XRO A;  1FBU A;  3WGH A;  5E1Z B;  3FMS A;  2HKX A;  3GX4 X;  4GGG A;  5HLI A;  1OYW A;  3HUG A;  5FLX K;  2HEO A;  2XUB A;  4LK1 F;  5FFX A;  1J2X A;  3GYH X;  1SD7 A;  4WXD A;  1UHM A;  1A04 A;  1OMI A;  2D2W A;  1ULY A;  3HRM A;  2Y75 A;  1Z9C A;  1KYZ A;  2XKP A;  5D5U B;  4PGG A;  5HVQ C;  3MWM A;  2YR2 A;  4HF1 A;  1XGS A;  4WX9 A;  1HW5 A;  2EFP A;  3U2R A;  1SFE A;  3VB2 A;  2P7C B;  2EJR A;  5AIQ A;  4ESB A;  4CGZ A;  2Q8K A;  3FXR A;  3TDU C;  2IRF G;  1BN5 A;  1FSH A;  1TQP A;  2H94 A;  4MGR A;  4MQ9 F;  1IN7 A;  3CLO A;  3Q5F A;  2E1N A;  2W85 A;  3KP4 A;  2ZKZ A;  4TV7 A;  2QLZ A;  1I1G A;  3I53 A;  1FLI A;  1ZLK A;  4RB3 C;  5JFR A;  2Z3Y A;  3KP2 A;  4HBL A;  3GFI A;  1HXD A;  4RGU A;  3GEZ A;  5CVJ A;  3GFM A;  3BDD A;  4KIC A;  5H6R A;  5L3G A;  3L09 A;  2ACJ A;  1XCB A;  2G9W A;  4N9I A;  4MTE A;  1Z7U A;  1FNN A;  3ZMU A;  1IAW A;  1RIO H;  3KET A;  4IHS A;  1D3Y A;  3VEP A;  1P6R A;  4BXU A;  4EVI A;  4WK8 F;  3FX3 A;  1U6G A;  2JPC A;  5DD8 A;  2JSC A;  4ZYG A;  1YS7 A;  3KZZ A;  4D0P A;  3F8N A;  1DP7 P;  1FC3 A;  5LRS A;  1WWX A;  2QQA A;  1H0M A;  2GZW A;  3JW4 A;  3R0J A;  3C1D A;  4GCV A;  1FOK A;  4KT5 C;  4YIF A;  1B9N A;  1F4K A;  1TTY A;  2ZJ2 A;  4N9H A;  3LA7 A;  2D1H A;  3DQV C;  1V3F A;  2F5D A;  3SFZ A;  4Y13 A;  1BC7 C;  2STW A;  2JTV A;  3M9A A;  5HLG A;  2QEN A;  2BV6 A;  4OIP F;  2V6C A;  4CHU A;  3CO6 C;  3KLO A;  4EMS A;  2GA1 A;  3RKW A;  2IP2 A;  3J81 Z;  1I6X A;  3BP8 A;  3L00 A;  1R1V A;  2HGC A;  3ELK A;  1AOY A;  3BJO A;  4I02 A;  4ASN A;  3AAF A;  4L9V A;  1F1Z A;  3LST A;  3H92 A;  3QPT A;  3ZMS A;  4G9Y A;  3KP5 A;  3V7S A;  3MAJ A;  2Q2E A;  4DNC A;  1FT9 A;  1PP7 U;  3R61 A;  3GFL A;  1XMA A;  1J0R A;  4YFN F;  3I58 A;  1XSV A;  3TO7 A;  4WXC A;  1ZGA A;  3HSR A;  3HOS A;  3ZMZ A;  3F8M A;  1TW2 A;  2V1U A;  1OKR A;  1DUX C;  1X3U A;  1LQ1 A;  5HDN A;  4YFX F;  2PEX A;  3FWE A;  5BPD A;  3TOB A;  3F3X A;  4LJZ F;  4KFC A;  2HOE A;  3E5U A;  1U2W A;  2YSR A;  3HOT A;  4KIG A;  4EQQ A;  1XDU A;  3GFJ A;  5E1X A;  5LBQ A;  3RKX A;  4OIO F;  1KQ9 A;  3BZ6 A;  1YIO A;  1STZ A;  1ZRE A;  2H27 A;  4G6Q A;  2JZY A;  2GAU A;  3ZP5 A;  2BGC A;  4RGR A;  1P4A A;  3MQ0 A;  1YW8 A;  4OMZ A;  2ZO4 A;  3ABU A;  4ON0 A;  1ZG5 A;  1IF1 A;  4MNU A;  1MJB A;  1W7P B;  2P6T A;  2BBY A;  1L3L A;  2O6G E;  5FD5 A;  2F5C A;  4OU0 A;  4GO1 A;  2A07 F;  3WTX C;  2PG4 A;  2CGP A;  3L7W A;  4EJT A;  5CVU A;  4OIR F;  1U8R A;  3P7N A;  3B73 A;  3J80 Z;  4F7Z A;  1TQM A;  4IJA A;  1BM9 A;  4DQ2 A;  2FBK A;  2HQR A;  1OYI A;  3RDI A;  3C3W A;  3E6D A;  2XAQ A;  1T6S A;  3V8J A;  3FM3 A;  3G3Z A;  4R1H A;  4ENM A;  1MGT A;  2DAO A;  2GWR A;  3B02 A;  2WC2 A;  4A0Z A;  2EV5 A;  2J5O A;  1HKT A;  2ZXJ A;  1TW3 A;  5K5Q A;  1P92 A;  4U7D A;  1HW1 A;  1USS A;  2VBZ A;  1LEA A;  4P9F A;  2BE5 F;  3ZMV A;  4ENN A;  2L01 A;  3IC7 A;  2RDP A;  3V4G A;  4A2U A;  2FMY A;  1ON1 A;  2DI3 A;  4G94 A;  4UNO A;  1RNL A;  2XAS A;  5AIP A;  3SZP A;  3TDZ C;  3KP3 A;  4HZF A;  1K78 A;  2K4J A;  1FYK A;  2EA4 A;  2E1C A;  2FML A;  1KU7 A;  2QBY A;  2IA0 A;  4L9T A;  4HV6 A;  3W6K B;  3IRR A;  3DV8 A;  1WSU A;  3WTU C;  2AS5 F;  3KFW X;  5IT3 A;  2PN6 A;  2XVC A;  3O2P E;  5D4R A;  3PQJ A;  2YX4 A;  1K6O A;  1LDD A;  1YW7 A;  1BOA A;  3Q9S A;  2A61 A;  3GZ5 A;  2W57 A;  1MDM B;  3MZH A;  1IXC A;  1XSX A;  4OIN F;  3JSP A;  2OQG A;  1TLH B;  1YLF A;  4AIH A;  1CF7 B;  2OAZ A;  3K1M A;  5JI6 A;  1KU9 A;  2HZT A;  2FXA A;  5LEK A;  5BMZ A;  1EH6 A;  3IKT A;  1R23 A;  2QQ9 A;  2VBY A;  3LQQ A;  2RKH A;  2MBF A;  4A0Y A;  2ZME A;  2MH2 A;  3FHZ A;  1S8N A;  3JTH A;  4FX0 A;  3RKY A;  4ZZL A;  4IHT A;  4HLX A;  4LLN A;  1T38 A;  2LKP A;  1SD4 A;  2ADU A;  1BI0 A;  4AIK A;  3VFZ A;  4LG0 A;  4HF0 A;  1H9G A;  3FXU A;  1T98 A;  5LHH A;  2H09 A;  3W6J B;  2VE8 A;  4WXH A;  1FYL A;  4M6Y A;  2RGV A;  2JT1 A;  2OZ6 A;  1IN5 A;  1VTN C;  5DCF A;  4KNY A;  4EJW A;  1QGP A;  1G3T A;  1U5T B;  1J9I A;  4CIC A;  2IA1 A;  4HA8 A;  1J5Y A;  1JHH A;  3HIF A;  5TJJ A;  4MTD A;  2IT0 A;  1FX7 A;  2PI0 A;  1F5T A;  1LB2 A;  2OQR A;  2CYY A;  3QU6 A;  2D45 A;  3BPV A;  1IN4 A;  2QQB A;  3WE2 A;  1L0O C;  2FSW A;  2EFN A;  3GXO A;  3I4P A;  2V1D A;  5CLS A;  3F6V A;  3H3U A;  1FZP B;  1RZ4 A;  4GYI A;  3CUQ B;  5L3D A;  4ZYD A;  4S05 A;  2IVM A;  2QM3 A;  1KU3 A;  4PGH A;  5ICC A;  2ZNY A;  4L18 B;  1BI2 A;  3NRV A;  3FM5 A;  3C7J A;  2A6H F;  2IPQ X;  1I27 A;  3ZQ7 A;  1LVA A;  2KJB A;  3I59 B;  2HYF A;  3LQR A;  1YO5 C;  3U9G A;  4U0V A;  5ICE A;  3EYY A;  1ZG1 A;  3I54 A;  1UST A;  4N0B A;  1GXP A;  1WRJ A;  1AWC A;  2K86 A;  2GXB A;  1YYV A;  3GUD A;  4LB5 A;  1IXS B;  3F8B A;  1DPR A;  1EH8 A;  2HQN A;  3F22 A;  4YII A;  1B59 A;  2VE9 A;  5IT9 Z;  1HW2 A;  2QZ8 A;  4CZZ A;  1R36 A;  1ZRD A;  4M9X A;  3JAM Z;  2F5F A;  1FWZ A;  2HWV A;  3TO9 A;  4IRG A;  5F6F A;  3J80 K;  1YTY A;  2K7L A;  4UVC A;  2OA4 A;  1XCV A;  2HFH A;  1Z6R A;  4L5I A;  3ECO A;  4UUV A;  2C6Y A;  4G7Z F;  2NS0 A;  4EGY A;  4L9N A;  2NRA C;  4LLL A;  1ZAO A;  4EJV A;  2G7H A;  3K2Z A;  1T2K A;  2ZBK A;  4XLN F;  4ESJ A;  2LSO A;  4AIJ A;  2WWY A;  4I98 B;  1IUY A;  4WWC A;  2M87 A;  3ECH A;  3LA3 A;  3KZY A;  2Y0M A;  2LDU A;  2A69 F;  2RQP A;  5ERI A;  2VC1 A;  3ABT A;  1KYW A;  3E6B A;  4IRI A;  4UV9 A;  1ZLJ A;  2V1X A;  2EV6 A;  2VT2 A;  4M71 A;  3E3V A;  4WCG A;  4EV0 A;  4HX4 A;  5DYM A;  4CXF A;  4I09 A;  4OIQ F;  2IJL A;  1BI1 A;  2GQQ A;  1G3S A;  3T8R A;  3KEQ A;  2HR3 A;  2VT3 A;  1J7K A;  3TGN A;  3O6B B;  4UXN A;  2VBX A;  4RGS A;  2K02 A;  3VOE A;  3P9I A;  4I7H A;  4A0X A;  1Z05 A;  4KYW A;  2EFO A;  3I5U A;  5DCM A;  2H6C A;  2FBH A;  1ZH5 A;  3IHU A;  1GXQ A;  4ENJ A;  3T1B A;  2YX7 A;  1FP2 A;  1W4M A;  3CJN A;  3F8F A;  3HTU A;  2KRF A;  4R79 A;  1SMT A;  3L2C A;  5HS7 A;  1BJA A;  3LAJ A;  2NNN A;  4ENK A;  3WTT C;  3F72 A;  5ED4 A;  1MJA A;  3BWG A;  2CSO A;  4M6X A;  1HQC A;  2CO5 A;  2R3S A;  4QLC U;  4I2O A;  1U5T C;  4A6D A;  5HDG A;  3WU1 B;  1JE8 A;  2TDX A;  1S7A A;  2Z33 A;  4PZJ A;  3WTW C;  1J75 A;  3LAP A;  3WG9 A;  3T8T A;  4BYY A;  3DF8 A;  3DKW A;  1FY7 A;  1XGN A;  4MEX F;  1LDK B;  3CUQ C;  4BAY A;  3T5X A;  1G3W A;  2P5L C;  3CUO A;  1G3Y A;  5DDG A;  2A5Y B;  4XSX F;  2M30 A;  1BC8 C;  5BPI A;  4HDU A;  1WQ2 A;  3FXQ A;  2Z99 A;  4Q4Z F;  2RVC A;  5LRR A;  4EJU A;  2DQL A;  2RC4 A;  1TNT A;  1I5Z A;  3D0S A;  3BY6 A;  3IKV A;  2M45 A;  2P6S A;  4Q48 A;  3CDH A;  2Z9O A;  2MA3 A;  5J8F A;  3ROU A;  5K5O A;  5A2Q K;  2OBP A;  1IN6 A;  2FOK A;  1WI9 A;  5ILV A;  4EM0 B;  3GW2 A;  5ICG A;  1QNT A;  4BNC A;  2ETH A;  1ZG3 A;  4HYE A;  1W7P D;  3FMR A;  2K4B A;  1XB4 A;  2R7D A;  3WOD F;  1S7O A;  3HSF A;  3WU0 A;  1LDJ A;  2UXN A;  2DK8 A;  1FPQ A;  3KEO A;  2EB7 A;  4IPA A;  2W25 A;  5BOX A;  2XIG A;  4KUM A;  4BHB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...