4EM0B

Staphylococcus aureus marr in complex with salicylate and kanamycin
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
175
structure length
150
Chain Sequence
b'TAAAKFEMLSQEFFNSFITIYRPYLKLTEPILEKHNIYYGQWLILRDIAKHQPTTLIEISHRRAIEKPTARKTLKALIENDLITVENSLEDKRQKFLTLTPKGHELYEIVCLDVQKLQQAVVAKTNISQDQMQETINVMNQIHEILLKEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized HTH-type transcriptional regulator SAR2349
publication title Staphylococcus aureus MarR complexes
rcsb
source organism Staphylococcus aureus
molecule tags Transcription/antibiotic
total genus 54
structure length 150
sequence length 175
ec nomenclature
pdb deposition date 2012-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4em0B00
3HRTA 5HLHA 4EMSA 4UUVA 5BPIA 1Z6TA 3F8CA 3KLOA 2OZ6A 2Z33A 1MD0A 1WKMA 1S6LA 5E18F 3C3WA 3BPVA 1DP7P 2CFXA 1KQ0A 3M9AA 2Q8KA 3J80Z 4MTEA 4CICA 1HQCA 4EM1A 4A6DA 1GXPA 2QWWA 3RYRA 3F8FA 3VOEA 3F8MA 1BC8C 4E70A 2L54A 1CF7A 4OINF 4O3MA 5DCFA 1LVAA 5E1ZB 1IN8A 3C7JA 5K1YA 3J7AO 3ECOA 1TNSA 3WODF 5IT9Z 4FHTA 1R5HA 4EQQA 2PEXA 4Y17A 2DK8A 4WXHA 1ZRDA 4Q5SF 4WXDA 1QQIA 1U8RA 3T1BA 4RGUA 3ZQ7A 1WQ2A 2BYVE 2NS0A 3L00A 4IXAA 4L5JA 1DPRA 5AIPA 2DLLA 3T5XA 4HQMA 1IN7A 1W4MA 5H6QA 4GYGA 2M1BA 1R22A 1O57A 1LQ1A 1G3YA 1G6NA 1TLHB 5D5VB 2ZMEB 1K6OA 3KP2A 5A2QK 3VODA 1IRFA 1WWXA 3L2CA 3RI4A 3P9IA 2TDXA 3TO6A 4LFUA 1S29A 3GO5A 3ULQB 3BJ6A 4H0EA 2JRTA 4EJUA 2PJPA 3BPXA 2C6YA 5D8KB 3ABUA 5JFRA 1BN5A 4OOIA 2YX7A 5HS7A 3O6BB 1Q1HA 4Q4ZF 5HOOA 1R00A 4BHCA 4AIJA 4MEXF 3H3UA 2VT3A 3FM3A 1I6XA 4PDKA 1DDNA 2Y48A 1KQ9A 1G3TA 1B4AA 3WE3A 4ZZDA 2GZWA 2O03A 3RKXA 4WWCA 3V7RA 1TNTA 1ZGAA 2X4HA 2R7FA 1P4WA 4KMFA 5FB2A 2Z9OA 2NAZA 3HSFA 4M9XA 2WWYA 1SD7A 4M72A 1R23A 2EV6A 1UCRA 3M7GA 1HXDA 5D5XB 1YW8A 3E97A 4FX0A 1FPQA 2NRAC 1BI1A 2IA1A 2LKPA 3KEQA 5DEQA 3P7NA 2G7HA 1Z6RA 3SZPA 2HDCA 3K1MA 1W7PB 2P8TA 5LLQA 1HSJA 2IPQX 5L3DA 3HRUA 2BGCA 2F5EA 2ZNYA 3F8NA 3CUQB 2P7VB 1TQMA 1W5TA 2D1VA 1S3JA 1U3EM 5DCMB 4M9ZA 4FX4A 2COMA 1Z9CA 2Z99A 4A12A 4OMZA 1YTYA 3DP7A 3LA2A 1ULYA 1HKQA 1XDSA 3MZHA 2L01A 4RB0A 3U1DA 5F1RA 2JSCA 3Q9SA 2UXNA 1A04A 3D5LA 4F7ZA 2CYYA 2M30A 3FHZA 2IT0A 4G7OF 3F6VA 1TW2A 1O3QA 1FBUA 4P55A 2EA2A 2MH9A 1YQAA 1FBQA 2HKXA 2EFPA 1EH7A 1REPC 1LJ9A 2K02A 1FYMA 1P92A 1SFEA 2FSWA 1Z05A 5TRDA 2CO5A 1ON1A 3MCZA 2XAQA 2E7WA 1R36A 2DFIA 1YO5C 3EYYA 3L09A 4R1HA 2R3SA 1USSA 4A6EA 5HDNA 3IRQA 3LAPA 2H09A 5FO5A 1T6SA 3LFKA 1YW7A 4G7ZF 3ABTA 3KE2A 1S7AA 3NEUA 3S2WA 2A61A 3I64A 3GFMA 5AIQA 3P9KA 2KJCA 3REOA 4I2OA 3MAJA 3E3VA 1P2FA 3FXRA 1ZRCA 4B09A 1I27A 2EJRA 4I98B 2L4AA 2V1XA 1P6RA 4KNYA 2EFWA 1RI7A 4Y13A 4IJAA 1F9NA 3BY6A 4UV8A 3CTAA 1KYWA 3BJOA 1ON2A 1D3YA 4A2UA 4L9VA 3RDIA 3J80K 2DT5A 1U5TA 2L02A 1H9TA 2QBYB 3MEXA 3F72A 4YIIA 3KEOA 2ISYA 1YLFA 3DPLC 1USTA 5D6EA 1GVJA 3SFZA 2JTVA 2QVOA 5FFZA 2B0LA 3V4GA 5IT9K 1ONVA 3SZTA 3TDZC 1UHMA 3FM5A 3R61A 3ZN0A 4QWQA 4KN4X 1QPMA 3ZP5A 2O3FA 4BHPA 4LK0F 4JBAA 4HLXA 4FT8A 4EV0A 1FLIA 5J6XA 1I5ZA 4CXFA 1XSVA 2CW0F 4KMUX 3JSPA 5FD5A 5EEHA 5HS9A 3K1NA 2KRFA 1BC7C 2H27A 4EJVA 1XB4A 3CO6C 2NNYA 1F4KA 4RGSA 2VBWA 5J8CA 4UXNA 5L3FA 1FY7A 3JW4A 2IA2A 1ZGJA 3HHHA 5F64A 4CZZA 1D8KA 1JHHA 4L5IA 4U7BA 1WI9A 1K78B 2A68F 3T8TA 2FMLA 2O8XA 2QM3A 4I09A 1WSUA 2D1HA 4EGYA 2DW4A 4LG0A 3R0JA 3F23A 5LHIA 2EV0A 1EH8A 1ZG3A 3KP7A 2W85A 4EJOA 3VEPA 1QO0D 5J8FA 1SFUA 2XIGA 2HYFA 2HOEA 4OIQF 4RGXA 4HF2A 3K9TA 3HRMA 4I01A 2KIUA 5H20A 3ZN1A 3CUOA 2VOPA 1JGSA 3U2RA 4U88A 2FE3A 2LF7A 3KP3A 3W6KB 3RTRA 1Z1DA 3HTUA 2NNNA 5D6FA 2UWMA 3FXQA 5DUKA 4HX4A 4TV7A 3KCCA 4MQVA 2DK5A 1OYYA 3QPHA 3KLNA 1KU9A 1MDMB 4IPAA 1ZRFA 3SHFA 1D5VA 1LDJA 3IRRA 2V9VA 3F22A 2HEOA 4YG2F 4GCVA 1IUYA 5K5QA 1QZYA 2LNBA 1ZAOA 3QPTA 3QAHA 3EUHA 3TGNA 4LLGF 4RB2C 2VC1A 1L3LA 3T8RA 3WTXC 5DD8A 4NQWA 5DYMA 1KU3A 2FXAA 2HYGD 2IP2A 5FGMA 2QUFA 4IRIA 4M74A 4A0ZA 3WTSC 2YU3A 4HAMA 3ZMZA 4MEYF 3GW2A 3FWEA 4HZFA 3V8JA 2VBZA 5ILSA 5E17F 3J81Z 2VOOA 4IRHA 5DV5A 3BDDA 1B6AA 1FSHA 2PQ8A 3LWFA 5E1WA 2H6CA 2XKOA 1F5TA 1XSXA 4IF4A 4LLNA 1XD7A 3EQLF 3ZMVA 1XSDA 1IW7F 4MNUA 3BP8A 1XCVA 1QZZA 2ZMEA 4WF2A 5IT3A 2EB7A 1MJ9A 4U7DA 2E1NA 3FF5A 2DPUA 1HW1A 1HW5A 1BI3A 4G9YA 2UXXA 5CVVA 3EYIA 3IC7A 4XBFA 2ZCWA 4HW0A 1P4XA 2FMYA 5D4RA 3M8FA 3F21A 1S8NA 4OIOF 1B1BA 2DPDA 1FZPB 1FP2A 2HGCA 3F8BA 3WTUC 5L3BA 1Z7UA 4I02A 1MKMA 2GXBA 1T39A 2GQQA 3GZ5A 4GYIA 2DI3A 3QOPA 1YW9A 3MZYA 3T0YA 2J5PA 2RDPA 4JK1X 3WU0A 2D2WA 3L9FA 2HTSA 3K1PA 1LB2A 1OYWA 1XGOA 5LRRA 4UV9A 4BXUA 2ZKZA 1YS6A 2MA3A 1KGSA 3D0SA 3DEUA 2X0LA 5K5OA 2EV5A 4ZYGA 1FWZA 5D8LB 2A07F 2PI0A 3E5XA 2VT2A 4G6QA 3BZ6A 1ODDA 5HDKA 2P7CB 1W7PA 1B9MA 3O2PE 4IVNA 3C1DA 1LDDA 1MJBA 3DQVC 4L0ZB 2G7UA 2XRNA 5BOXA 3CUQA 1J0RA 5FD6A 2R7DA 5DCMA 2YSRA 3DPTA 1XGSA 5CVUA 4HA8A 1U78A 1R1UA 5LRSA 1AWCA 3JAMZ 1T98A 1QBJA 1FX7A 4ZZLA 4Q48A 1K7AA 2P6TA 2ACJA 2XHKA 2IVMA 4KUMA 2BE5F 4KICA 1O7FA 2W25A 1W7PD 4L9JA 5E8GA 2MD5A 1T0FA 5LEJA 2GA1A 3OOPA 2ZFWA 6PAXA 3DF8A 1PUEE 3O3KA 1Z91A 3KP6A 2PLYA 3ZMTA 1EH6A 2KIMA 2K27A 3I59B 3ZMSA 4HQEA 1XCBA 3GWZA 2DAOA 1B9NA 2P5KA 2XV4S 2A69F 1UFMA 4ASNA 2FA5A 3IKTA 3WGHA 4LB5A 1G3WA 1IAWA 2EWNA 2P5VA 3WGGA 1R1VA 3N97A 1BM9A 5L3EA 2M45A 4HYEA 5LEKA 2PBIA 2ZNZA 5FLXZ 2HFHA 5JI6A 3V7SA 4PCQA 4U0YA 2OQRA 4U0VA 3HSEA 1OPCA 2DBBA 3JSOA 3E6CC 2QENA 2XKPA 1IN5A 3ZMUA 2FBKA 4M6YA 1XMKA 4OU0A 5LGTA 4Q47A 4DQ2A 2JT1A 2O0YA 1ZYRF 4KIBA 2CWEA 1R1TA 3WTYC 3L7WA 4ESBA 4IHTA 1O7LA 2RKHA 2CQKA 4N0BA 3TDUC 3QRFF 4BHBA 2VXZA 3I4PA 2YR2A 1ZLKA 3BROA 4BH9A 4LMYA 3K2ZA 4HDVA 3ELKA 3QP5A 2A5YB 4D0PA 4A0XA 4HF0A 2ELHA 2DTRA 3RYPA 5LHHA 1I1GA 3TO7A 2PN6A 2GIVA 2HQNA 2FNAA 3W6JB 1B59A 1EV7A 3MQ0A 3WTVC 3E5UA 2A3SA 4P9FA 3CJNA 3HOSA 1FBSA 4A0YA 1HKTA 3E5QA 3HRSA 4WX9A 3CO7C 3WGIA 1HW2A 3ISPA 5L3CA 2ESHA 4ZYEA 3V7CA 1K78A 4G7HF 3HHGA 4G6DA 3N4MA 5HDGA 3H92A 3TQNA 3GEZA 4IRGA 2F5FA 2VE9A 1T38A 4EM0B 1O3TA 4MGRA 1J75A 4BYYA 4M9SA 4KFCA 2JPCA 2FBIA 2A6HF 4ZH4F 2K7LA 3FXUA 3I0TA 3RKYA 2FOKA 4CYDA 1JXSA 2K86A 3V8KA 2F2EA 1JE8A 4KIFA 5CJ9A 2ZXJA 3E6BA 2ZJ2A 5LGUA 4I0BA 2VBXA 4BAYA 5ERIA 5KK1A 4CGZA 2H94A 3GF2A 3JTHA 1F1ZA 2DQRA 1FOKA 4CHUA 1YS7A 2GAUA 4L9NA 2IW5A 2W84A 2P5LC 2LDUA 2BV6A 4S05A 4L9TA 1IRGA 3GZ6A 1GHCA 1IZ1A 2LSOA 4HV5A 4OIRF 5JHUA 2QQ9A 1J5YA 3I71A 2PMUA 3LAJA 1PP7U 3CDHA 4DNCA 1BJAA 5ICFA 5E1XA 4L18B 3TOAA 5K5RA 4KN7X 1J9IA 1BI2A 3DKWA 4ZYHA 3FMRA 4O5VA 3CLOA 4LK1F 2Q0OA 2K4JA 3C18A 3JAMK 1FNNA 3QU6A 1GXQA 2AXLA 3GFLA 4HX8A 4ENKA 3TKYA 2UZKA 4XLNF 2FQ3A 4PZJA 5ICEA 4YFKF 3M8EA 4RB1A 1XMAA 1RIOH 1DPUA 2PMHA 1MZBA 4LJZF 5H6RA 1ZLJA 4UVAA 1U2WA 3BWGA 3HYIA 2RGVA 3R4KA 4IHSA 4S04A 3Q9VA 3LQRA 3GUDA 2HQRA 5D5WB 4GO1A 5CVJA 2V79A 2WTEA 3TOBA 4KA4A 1O3RA 3F6OA 2W57A 4RAYA 1G4DA 4KIGA 4G94A 2WC2A 4LD5A 3ROUA 3QU3A 3WTZA 3GVAA 3OV8A 2ETHA 1LDKB 2QQAA 1BIAA 4M73A 4UVBA 1CGPA 3GLXA 5CYVA 4HLYA 1YYVA 1IF1A 1SD6A 2VC0A 1J2XA 5HLGA 5AONA 2Z5UA 1PDNC 5FLXK 3RPUA 4PGGA 5HLIA 4A5MA 2FEZA 1T2KA 5L3GA 5BMZA 4HDUA 4MHGA 3R0AA 5LHGA 1H0MA 4BQAA 1OKRA 3R60A 1LNWA 4AD9A 5D5UB 3FZVA 2RNJA 1XN7A 3SQNA 3E6MA 3LQQA 4M71A 3K69A 2IJLA 4EVIA 3IWZA 5ILUA 2EA4A 4GXOA 3SXYA 1HKSA 2KKOA 2RVCA 2E7XA 1ZG5A 4XLPF 2ZO4A 5CLSA 4RB3C 3GFIA 2EK5A 3GXOA 4LGWA 1VTNC 2KJBA 2FF4A 2PFBA 5HVQC 4B8XA 2O6GE 1KU2A 1TBXA 1SMYF 3VB2A 4JQFA 3P9CA 3GYHX 2ADUA 1X3UA 2CSOA 1R5GA 3FMSA 1HSTA 2XASA 3KZYA 2JPBA 3KFWX 3E6DA 1CF7B 1SD5A 3EETA 3LA7A 2O61A 3PQJA 4R8HA 5LGNA 3WG9A 4EGZA 2FRHA 3DXJF 1U5TC 4GGGA 3I59A 5FFXA 3DV8A 3WU1B 3I53A 2Q2EA 4KDPA 3G73A 1MJAA 2OAZA 3KETA 2XROA 1ZG1A 3HIFA 3HUGA 4CDGA 1XGNA 1TQPA 2M8EA 1V4RA 2LF8A 2VE8A 5E20A 2RN7A 1IN4A 1RUNA 5HS8A 3B73A 4AWXB 3F3XA 2Y0MA 4ESFA 2STWA 2OBPA 4MTDA 4ZYDA 2XUBA 4LLLA 5TJJA 4L0YB 5BQTA 2HR3A 1WRJA 4ENJA 1KA8A 2M87A 4WXCA 1QGPA 2QYOA 3BOQA 1ZH5A 2OQGA 1MGTA 4A5NA 3VFZA 4NB5A 3NQOA 4CO8A 3COAC 2DU9A 4ON0A 4HOBA 4G8XA 2Z3YA 1QNTA 2QZ8A 3FMQA 1LEBA 1RZ4A 2CG4A 4XSXF 3TO9A 3I5UA 2Y75A 4RGRA 4EM2A 5ICCA 1TTYA 2OA4A 4AIKA 3QP6A 2D45A 4U0WA 1DUXC 4NHJA 1TW3A 3U9GA 2XAGA 2GA2A 4XSZF 4HV6A 2V6CA 1R58A 3EDPA 2OZUA 5ILVA 2L4MA 1LEAA 1YG2A 4R79A 2EFNA 4ENMA 1KQ8A 4YFXF 1OYIA 1C0WA 3WE2A 1JHFA 1HBXG 2ZBKA 4LB6B 3H3ZA 2MLKA 5D4SA 3R6SA 2QBYA 2AS5F 3FX3A 2YX4A 1ZN2A 2FBHA 1IXCA 1W5SA 2DO7A 3RKWA 2FNPA 1SFXA 2XGXA 4P5OA 1IN6A 3V8LA 1H9GA 5F6FA 4P9UA 1U6GA 3B02A 3HSRA 4AVPA 4QLCU 3I54A 3BJAA 3NRVA 3JTGA 3I58A 3ZMDA 4BNCA 5A2QZ 5JR3A 2VONA 3WTWC 2H6BA 1J7KA 2EFOA 5DDGA 3J81K 4WK8F 4EJTA 1G3SA 2XAHA 1BOAA 5E8IA 4P96A 3K0LA 5CVRA 5ICGA 5DUIA 3IL2A 1STZA 3PFIA 1I1SA 2VODA 3AAFA 2V1DA 1ZARA 2P4WA 3MFKA 2QLZA 2HKOA 2QQBA 1SD4A 4I0AA 4AIHA 5KVRA 1XGMA 2MBFA 4PGHA 1P4AA 2JZYA 1K79A 2G9WA 3GX4X 3KP4A 4YFNF 1RUOA 1O3SA 4I7HA 2M5WA 1YFHA 2CGPA 1FT9A 1ZHFA 5ED4A 4N9HA 1YIOA 3ZPLA 4MQ9F 2KIFA 5JVTA 2STTA 2FU4A 2VN2A 2HTJA 1OR7A 2IRFG 2OD5A 1XDUA 3WTTC 2MH2A 1OMIA 4HX7A 3ERED 2PG4A 4HF1A 1J59A 1FYLA 2XVCA 3HOTA 4N9IA 4KYWA 4OMYA 4Y15A 2GWRA 5DD4A 3GFJA 5BPDA 3KP5A 2RQPA 4O6JA 3RPQA 2W24A 2ESNA 4M6XA 4OIPF 2P6SA 1MDMA 1UB9A 2J5OA 2K4BA 1KU7A 1U5TB 4ESJA 2DQLA 3LA3A 1E17A 1FC3A 3LSTA 4UNOA 1R7JA 4KT5C 2HS5A 2BEOA 3IHUA 3HTSB 1FSEA 5EEGA 3MWMA 3DFGA 2GXGA 2EFQA 1IXRC 4RAZA 4UVCA 1E2XA 3ECHA 4YIFA 4ENNA 2IA0A 1FP1D 1PP8F 2ISZA 3CUQC 3IWFA 1TQIA 5BS6A 1AOYA 2F5DA 2F5CA 1SMTA 2OU2A 1ZREA 4EJWA 1BBYA 4Z2YA 4UHTA 2HZTA 5CVIA 3ML6A 4WCGA 2L3DA 1D8JA 4K2EA 2NYXA 2XAFA 3G3ZA 2YPRA 2E1CA 1SAXA 4ETSA 3M1EA 3RIRA 1IXSB 2BBYA 2MLGA 1FYKA 3KZZA 1RNLA 1UHWA 2MC3A 1L0OC 1S7OA 2RC4A 3PQKA 3Q5FA 2VBYA 3RJPA 2A6EF 5LBQA 2WV0A 2V1UA 4RS8A 2HWVA 4HBLA 1BI0A 1Y0UA 4XRFA 1BIBA 2XAJA 3IKVA 4LG0B 1KYZA 1V3FA 1NHAA 2RV8A
chains in the Genus database with same CATH superfamily
2HVRA 2W82A 2QKLB 3HRTA 5HLHA 4EMSA 2ZXWH 3A01A 4UUVA 5BPIA 1Z6TA 1E0EA 3F8CA 3KLOA 2OZ6A 2Z33A 1MD0A 1WKMA 4IHVA 1S6LA 5E18F 1WZ2A 4CCJA 3JRAA 3GTPJ 3C3WA 2OPTA 4B44A 3BPVA 4X1EA 3MKWB 3K6GA 1DP7P 1MMAA 2CFXA 1KQ0A 4XKWA 3M9AA 2R4GA 4E7KA 2Q8KA 3J80Z 4J19A 4MTEA 4CICA 5FLVA 4GRIA 1HQCA 4XKCA 4EM1A 1Y1VJ 3M1CA 4A6DA 3PO3J 4BE2A 4FE7A 1GXPA 2QWWA 3RYRA 2ZJRF 2MYSA 1V54H 3F8FA 3VOEA 3F8MA 2PJRB 1BC8C 4JYKA 2L7FP 4E70A 2L54A 1CF7A 3OIQA 4M3EA 5K7HA 2H1LA 2LK2A 2JUGA 4OINF 4O3MA 5DCFA 1LVAA 3QODA 2W1OA 5H2FC 1JJ6C 5E1ZB 4B48A 1IN8A 3NWTA 5F0FA 1ITYA 2VUMJ 3C7JA 5K1YA 3J7AO 1A31A 3ECOA 1TNSA 4B47A 3PM1A 3WODF 5IT9Z 4FHTA 4BKXA 1R5HA 4EQQA 5FKLA 2PEXA 5FROA 4Y17A 2DK8A 4WXHA 4P1WA 1ZRDA 3PUFA 5GTIC 4II2A 4Q5SF 4WXDA 1QQIA 2X9DA 3DU5A 1U8RA 4NBQA 3T1BA 1X1CA 4XLHA 4RGUA 5JLXA 3UNGC 3ZQ7A 4C2UA 1WQ2A 4UB6C 2BYVE 2WAQN 3LNQA 2LFBA 2NS0A 1MIJA 2WY7Q 3ABKH 3L00A 3BC8A 5EG0A 4IXAA 4L5JA 3PL8A 1DPRA 3H5NA 2QSGX 5AIPA 3IH3A 2DLLA 2E34A 3T5XA 4HQMA 2DDBA 4JX6A 1IN7A 1W4MA 3FBIB 3OYJA 4DOZA 5H6QA 4GYGA 2M1BA 1R22A 4HNVA 1O57A 1ZR2A 1LQ1A 1G3YA 3J7YJ 1G6NA 1TLHB 5D5VB 2F4OB 2ZMEB 5GAEJ 1K6OA 3KP2A 3HKZA 5E3OA 5DM6F 2CS3A 2DJNA 4XN3A 2X51A 3VODA 1IRFA 1WWXA 5A2QK 3L2CA 3RI4A 4ZTFA 4KT6A 3SYTA 3P9IA 2E1MC 2TDXA 3TO6A 4LFUA 1S29A 1YX3A 3GO5A 1R49A 2R7XA 3ULQB 2NVYJ 3BJ6A 3KEYA 4H0EA 2JRTA 4D9JA 4EJUA 3JREA 3OYKA 2L7ZA 2DDAA 2KISA 2PJPA 3BPXA 2C6YA 5D8KB 4ABZA 3ABUA 1P9QC 2DJIA 3ABMH 3GTJJ 1TT0A 3CMMA 5JFRA 1FTZA 1BN5A 1NK2P 4OOIA 2YX7A 3HOXJ 2O5RA 3FIWA 5HS7A 3SFIA 3HOWJ 3O6BB 1Q1HA 4Q4ZF 5HOOA 4F92B 2OV7A 1R00A 1TC3C 4BJ6C 2GBYA 4BHCA 5IY5H 3C2HA 4AIJA 3E0JB 4MEXF 3H3UA 2IGNA 2VT3A 1ETYA 1JKRC 3MVPA 4C2TA 1T08B 1SVOA 3FM3A 1WH7A 2HDWA 1I6XA 4PDKA 5K7ZA 2EZHA 1DDNA 2Y48A 1KQ9A 2DFFA 4LITA 3CJQB 1G3TA 2LOOA 1B4AA 3WE3A 4ZZDA 3DEWA 2GZWA 1ETQA 2O03A 1WJ5A 2L7MP 3RKXA 4WWCA 1H88C 2V9PA 3OSFA 2L9SA 3V7RA 3HM5A 1TNTA 4CUGA 3A1YA 1X1DA 3RKQA 1N78A 1I39A 1ZGAA 3S15J 2X4HA 1P7IA 2R7FA 5J47A 2R93J 4OAZA 2LVSA 1P4WA 3SJMA 2EH3A 5FB2A 2Z9OA 4KMFA 3ZQQA 2NVQJ 2NAZA 3HSFA 1V55H 4M9XA 2WWYA 2ZXHA 1SD7A 4M72A 1R23A 2EV6A 1UCRA 3M7GA 2HVSA 3HEFA 1HXDA 5D5XB 1YW8A 2D5VA 4PJMA 2ME6A 1QPIA 3E97A 4FX0A 1FPQA 1X3ZB 1E3HA 2HQAA 2NRAC 1BI1A 2IA1A 2LKPA 3BZKA 4U87A 1N77A 3KEQA 2NS7A 5DEQA 3P7NA 4BQOA 2G7HA 1Z6RA 3SZPA 2HDCA 2XSJC 3K1MA 3IH2A 5JHFA 1W7PB 2N8GA 2P8TA 5LLQA 1FMVA 1HSJA 2IPQX 5L3DA 3OYIA 1MBEA 3HRUA 2BGCA 2TCTA 5FKMA 2F5EA 2ZNYA 3F8NA 3CUQB 1JUSA 2P7VB 2QGUA 1TQMA 1W5TA 2R5YA 2D1VA 3H0DA 1S3JA 3FHNA 1U3EM 1WHUA 5DCMB 4M9ZA 4FX4A 3TL4X 2COMA 1Z9CA 3HGYA 2Z99A 3QYFA 4A12A 4OMZA 1YTYA 4JX5A 1B72B 3DP7A 2L0KA 3H0GJ 4FASD 3CP2A 2E2IJ 1OFCX 3LA2A 1ULYA 1HKQA 1Z7LA 1XDSA 3S8PA 3MZHA 2L01A 2DODA 2CV2A 3CJTB 4RB0A 3U1DA 2XSDC 5F1RA 3A0HC 3BR5A 2JSCA 3Q9SA 5GTHC 2NS8A 2UXNA 1YRNA 1XTAA 2WB1N 2RAEA 1A04A 2R7TA 3DKXA 3D5LA 4F7ZA 4CA0A 2CYYA 2R7WA 2JVGA 3LSGA 2M30A 3G1OA 3FHZA 2IT0A 4G7OF 3F6VA 4BQNA 1TW2A 3H1CA 1V5EA 1O3QA 1FBUA 1ZKGA 4M3DA 4P55A 2EA2A 2EPFA 3KYCB 2MH9A 4IKFA 1YQAA 3OYMA 4RA2A 1QA6A 1FBQA 2HKXA 2JJ7A 2EFPA 1EH7A 2WAQA 3Q3SA 1IC8A 1QRYA 1REPC 1K6YA 1LJ9A 3PSIA 4DZPA 5K7FA 2K02A 1FYMA 2ECCA 2CMPA 3C2BA 5B1AH 1P92A 1SFEA 2FSWA 1Z05A 5TRDA 1IV6A 1OLTA 2AQEA 3DLLF 2UUZA 2CO5A 1ON1A 4UUTA 3MZ8A 3MCZA 2XAQA 2E7WA 1R36A 2DFIA 1YO5C 4A3FJ 3ZXSA 3IV5A 3EYYA 3L09A 4R1HA 2R3SA 2XGCA 4FTHA 1YI2I 1USSA 4A6EA 5HDNA 1B8IB 3LSPA 3OYAA 4BJ5C 5IPAA 3IRQA 3LAPA 4MIMA 2H09A 5FO5A 1T6SA 3BR1A 1YW7A 3LFKA 4G7ZF 1NG7A 3ABTA 4E7SA 4DBRA 3KE2A 1S7AA 4BEHA 3HJEA 4LIUA 3NEUA 3S2WA 9ANTA 4PFOA 4A3CJ 2VJJA 2A61A 3I64A 3GFMA 3G4SI 5AIQA 1GVDA 1WJDA 4RM3A 3P9KA 2KJCA 3REOA 1NK3P 1S7EA 3I55I 4IZZA 4I2OA 5TGTA 1XX5A 1OCOH 4NC7A 1YJ9I 1VQ5I 3OY9A 3SDGA 4E4HA 1HDPA 4BXXJ 3MAJA 1VF9A 5FJ8J 1DU0A 3E3VA 1P2FA 1IG7A 1WI3A 3ESWB 3FXRA 1ZRCA 2RQQA 4FCYA 4B09A 1I27A 2EJRA 3NAUA 4I98B 3PIOF 2OC6A 4B3AA 2HXIA 4ZJZA 2L4AA 2XDVA 2R5ZA 2DTZA 2V7FA 2V1XA 3CF5F 3BG6A 3PJRA 3CMYA 2F5VA 1P6RA 4KNYA 2EFWA 4DGWB 1RI7A 2BW3A 5EYRA 1PUFA 1U0JA 4Y13A 4AYBA 4IJAA 1F9NA 3B6AA 3BY6A 3WHCA 4UV8A 3CTAA 2EZKA 1KYWA 3BJOA 1ON2A 1D3YA 4A2UA 2BHZA 4ITVA 4DYQA 2XC7A 4L9VA 4YELA 3LFUA 3RDIA 3S2DJ 2JA2A 3QQAA 3J80K 2DT5A 1U5TA 4XK4A 2L02A 1H9TA 2I8DA 1OISA 2QBYB 1ORKA 3HG9A 2A6TA 2E5ZA 2FD5A 3H9GA 2JA6J 3MEXA 3F72A 2LY2A 2E5NA 4YIIA 5B66C 3KEOA 2ISYA 1ZR4A 1BA5A 1YLFA 3DPLC 3GMEA 1USTA 5D6EA 4XICA 3LSMA 1GVJA 1MMNA 2KHMA 5EZGA 2ZSHB 3SFZA 5LFAA 4EEFG 2JTVA 1MMSA 2QVOA 3IAM2 2IAIA 3ONQA 1X1PA 5FFZA 2B0LA 3OYNA 3V4GA 2Q1ZB 5IT9K 1ONVA 3SZTA 3TDZC 4A3IJ 1UHMA 3FM5A 3R61A 1LPQA 1Y1WJ 3ZN0A 4QWQA 3VYRB 2KRHA 4F93B 2LH9A 4KN4X 2ZB9A 1QPMA 1VQLI 3ZP5A 2O3FA 4BHPA 4LK0F 2VLAA 1WJBA 4JBAA 4HLXA 3OYFA 2K3PA 4FT8A 4CCOA 4EV0A 4QTRA 3RCOA 1M1EB 1FLIA 2E1MB 5J6XA 3BR3A 3Q0WA 2LBFB 3OWTA 1I5ZA 1S9HA 2W4SA 4CXFA 3BQZA 4M6VA 1XSVA 2CW0F 4KMUX 4HG2A 3JSPA 4PJLA 5FD5A 2MFZA 5EEHA 3KX2A 5HS9A 3K1NA 2KRFA 1BC7C 3KYDB 4EJVA 3Q0UA 2H27A 1XB4A 3CO6C 2NNYA 1F4KA 1FTTA 4RGSA 1XMXA 2VBWA 5J8CA 4G6TB 4UXNA 5L3FA 1FY7A 1ETKA 2LTPA 1D0YA 3JW4A 2R7OA 2IA2A 3ABLH 1ZGJA 3HHHA 3FXLA 5F64A 2KDZA 3VDXA 1RKTA 2WB1A 3RZOJ 5C4JJ 4CZZA 3PNYA 1D8KA 3OOUA 3PNTA 2O8KA 3I4MJ 1JHHA 4L5IA 4F55A 3AG3H 4U7BA 1WI9A 1K78B 2A68F 3BG5A 1DGRM 2DOEA 3BCBA 2E71A 2V9KA 1T56A 2K3FA 4DYCA 4F52A 3T8TA 3JRBA 2FMLA 3A02A 2O8XA 2G0EA 2QM3A 4I09A 3K4KA 4XRSA 1WSUA 2D1HA 3ZQHA 4EGYA 2DW4A 1UZCA 4LG0A 3O8GA 3R0JA 3F23A 3OIPA 1POGA 5LHIA 3V42A 2EV0A 1EH8A 1ZG3A 3BLYA 3KP7A 1BJZA 4XR6A 2W85A 4EJOA 3VEPA 1QO0D 5F0CA 5J8FA 1SFUA 2XIGA 2HYFA 3FXJA 5GPAA 2HOEA 2BY2A 1JJ8C 4OIQF 1DU6A 4RGXA 1MW7A 4HF2A 3K9TA 3HRMA 4I01A 2KIUA 5H20A 2HOTA 1QHHD 3ZN1A 3CUOA 4Y4RA 1JGSA 2VOPA 1Z21A 3U2RA 4U88A 3QPLA 3ZQFA 2BXYA 2FE3A 2IXSA 2LF7A 3KP3A 3W6KB 2K9QA 3RTRA 4PSWA 1Z1DA 3HTUA 4AVZA 2NNNA 2NVXJ 2BXZA 2RREA 3OYGA 2VASA 1X1BA 1SC7A 2O9LA 5D6FA 4BE0A 4UY8I 4OAYA 3OYBA 3FXQA 2UWMA 5DUKA 4HX4A 1R4NB 4TV7A 3KCCA 4MQVA 4XORA 2DK5A 1OYYA 3DPUA 2PJRA 3QPHA 3KLNA 1DGWY 1KU9A 1MDMB 3HPGA 4IPAA 1ZRFA 3SHFA 1D5VA 1WVRA 1LDJA 2VQGA 3IRRA 2CQNA 4HRIA 2V9VA 4C2MJ 2LC2A 4NUBA 3F22A 2HEOA 1ZK8A 4YG2F 2GOMA 2LMDA 4GCVA 1IUYA 5K5QA 1QZYA 2LNBA 1ZAOA 5F08A 2CV0A 3W3CA 1MMGA 3QPTA 3QAHA 3EUHA 3TGNA 1K83J 4LLGF 4RB2C 2VC1A 1L3LA 3T8RA 3WTXC 3O8HA 5DD8A 4NQWA 2RNGA 5BNGA 5DYMA 1KU3A 2FXAA 3S3NA 2HYGD 2IP2A 5FGMA 3X2QH 2QUFA 3ASNH 4IRIA 4M74A 4BY1J 2LYCA 1FIPA 2YU3A 4HAMA 4A0ZA 3ZMZA 3WTSC 4MEYF 2V4JC 1Z67A 3GW2A 3FWEA 2MC4A 4HZFA 3V8JA 5CPRB 5KAIC 2JWTA 2GLOA 2VBZA 5ILSA 2MW8A 3J81Z 2VOOA 5E17F 4IRHA 2OCCH 5DV5A 3BDDA 2VPLA 3FBNB 1B6AA 4A3JJ 1FSHA 2PQ8A 4HPQA 3LWFA 3K70D 5E1WA 4FE4A 3JCUC 2DA7A 2H6CA 4OWRB 2XRLA 2XKOA 1HF0A 1F5TA 2ECBA 1XSXA 2Y9YA 4IF4A 4LLNA 3HL2A 1XD7A 2HNHA 3EQLF 1WH5A 2PX9A 2JK3A 3ZMVA 3M8JA 1XSDA 1IW7F 1A35A 4MNUA 3BP8A 1XCVA 1QZZA 2ZMEA 3MD2A 4WF2A 5FRMA 5IT3A 1W1WE 2EB7A 4XQFA 2P0WA 1F43A 2HU9A 1MJ9A 2ZXIA 3KPHA 4U7DA 2E1NA 2IEKA 2JN6A 3FF5A 2DPUA 5DM7F 1HW1A 3JRHA 3FK6A 1HW5A 1TWAJ 1J09A 1BI3A 4G9YA 2UXXA 5CVVA 2ID6A 3EYIA 3IC7A 1OCZH 1P7JA 3S1NJ 1W36C 4XBFA 2ZCWA 4HW0A 2YS9A 1P4XA 4MFDA 1WJFA 3W2VA 1JTYA 3H3VK 2FMYA 5D4RA 3M8FA 4B43A 2MSYA 1IRZA 3F21A 2E1OA 1S8NA 4OIOF 1TWFJ 1B1BA 4CCKA 2DPDA 4RM2A 1FZPB 2ZJQF 1YITI 1FP2A 2HGCA 3F8BA 3A2KA 3BTCA 5L3BA 3WTUC 3S3OA 1Z7UA 4I02A 1MKMA 1X4OA 2GXBA 4BACA 1Y8RB 1T39A 1A5JA 2GQQA 3GZ5A 4GYIA 3QYEA 2DI3A 3QOPA 1RR7A 3TEDA 3ZCOA 1YW9A 1EKEA 4RAFA 4HEA2 3GTLJ 5EF6A 4D1QA 3GTMJ 3IAS2 4PK4A 3HXLA 3MZYA 3BTJA 3U21A 3T0YA 4MFEA 4CCNA 1D1BA 2DA2A 2J5PA 3MKZA 2RDPA 4JK1X 3WU0A 2D2WA 3L9FA 2HTSA 3K1PA 4D7NA 1LB2A 1OYWA 2NVTJ 1XGOA 5LRRA 2Z2SB 4UV9A 4BXUA 2XGDA 3CMAI 2VPRA 4BJTA 2F4MB 2ZKZA 5J1RA 2XB0X 2JSPA 2EZIA 5GAHJ 3BT9A 1I6HJ 3CCLI 1YS6A 1N25A 4C3IJ 2HDDA 2L9VA 2MA3A 2M0CA 1KGSA 3D0SA 5EZHA 3RQ4A 4CYCA 3BG7A 3DEUA 2X6XA 2GIZA 3I9V2 2DOFA 3F0CA 3BZCA 4HNTA 5EGOB 2X0LA 5K5OA 2EV5A 4ZYGA 1FWZA 5D8LB 1EJ9A 2DYSH 2A07F 2PI0A 3S1QJ 3E5XA 2VT2A 3ZQCA 4G6QA 4A3GJ 2LY1A 2MGQA 3BZ6A 2HVQA 1ODDA 2E35A 4UB8C 5HDKA 3OSGA 4NDLA 2P7CB 3OL4A 3KIOA 1VQ8I 1W7PA 1K4SA 3DTEA 1B9MA 3O2PE 4IVNA 3C1DA 1LDDA 5GAGJ 1MJBA 3DQVC 3VYTB 3UKGA 4L0ZB 2G7UA 2XRNA 2VKEA 1VZ0A 4XLCA 3BR2A 5BOXA 3CUQA 2OTLI 5C3EJ 1J0RA 2EIKH 2KZGA 5FD6A 3CLQA 5IP7J 2WAEA 2Y9ZA 4BL0B 2XPVA 2R7DA 5DCMA 4C30A 4XOPA 1ETWA 2YSRA 3DPTA 2X6OA 1XGSA 1IDYA 4HA8A 4XMYA 5CVUA 1U78A 1GV2A 1IRXA 2L9NA 5IOZA 3OYCA 3GTQJ 5TISC 1OR7C 3AG1H 1R1UA 5LRSA 2MG4A 4L5EA 4QPOA 3JAMZ 1AWCA 1I50J 1T98A 2IBDA 3DBLB 4CCLA 1QBJA 4Y33A 3K4JA 1FX7A 1XC5A 4ZZLA 5M5YJ 4Q48A 1K7AA 4XIDA 1NH3A 3E1SA 2OF7A 2M0MA 2P6TA 1TL8A 2ACJA 3GTOJ 2XHKA 2IVMA 2XF5A 3K7AJ 4KUMA 2EIMH 4ZC3A 2BE5F 4KICA 1O7FA 2O7OA 4D7MA 2W25A 1W7PD 4L9JA 1ERDA 3IH4A 5B1BH 2CW8A 5E8GA 4XRMA 3CCQI 2MD5A 4KJZA 3GLLA 2ZFUA 1T0FA 4IQJA 2E19A 5LEJA 1X4PA 2GA1A 3OOPA 2ZFWA 5CKTA 6PAXA 2BVLA 3L2WA 3DF8A 5HNHA 1PUEE 3O3KA 1Z91A 1HDDC 3KP6A 2PLYA 1X2NA 3ZMTA 3OYDA 4A3BJ 2E2JJ 2BZTA 3DU6A 1EH6A 4IHXA 2KIMA 2I10A 2K27A 3I59B 2MABA 3L2VA 2YU9J 3ZMSA 4HQEA 1XCBA 2M9HA 2XB5A 3GWZA 2DAOA 3LSRA 2R7UA 1WFXA 2Q2EB 5FLMJ 2YUSA 1VQNI 5IP9J 1ZTRA 4BBSJ 1B9NA 2OCEA 3ERMA 2P5KA 3BG3A 2XV4S 2A69F 1UFMA 3HUGB 2OTJI 1JT6A 3VSLA 4ASNA 5HODA 4E7ZA 2XF6A 2FA5A 5FKOA 3IKTA 3WGHA 1D1CA 4LB5A 1H89C 1G3WA 1IAWA 2EWNA 2P5VA 2KRCA 4B3XA 3CDLA 3WGGA 5KAFC 1R1VA 2NXNB 2R0QC 3N97A 1BM9A 5L3EA 2M45A 1A36A 4HYEA 2LKXA 4IL6C 1ETOA 2Y0SN 3CCUI 4IX7A 5LEKA 2PBIA 2ZNZA 2JQ7A 5FLXZ 1JKPC 2HFHA 3HC7A 5JI6A 5CQEA 3V7SA 3PIPF 4PCQA 2VJ5A 2NOJB 5EJCA 4U0YA 2OQRA 4U0VA 3HSEA 3DBHB 1OPCA 2DBBA 5GPCA 3JSOA 3E6CC 2QENA 2XKPA 1IN5A 3OL3A 3ZMUA 5HNFA 2VQCA 2FBKA 4M6YA 4Z6YA 1XMKA 1Y8QB 4OU0A 5LGTA 3JR9A 4Q47A 4DQ2A 5J1YA 2JT1A 4QPQA 3HDDA 2O0YA 3K70C 3QPSA 1ZYRF 4KIBA 4UUSB 2CWEA 1BR4A 1R1TA 4S0HB 3WTYC 3L7WA 1MNDA 2CUEA 2VJ4A 2DA5A 4ESBA 1T8IA 1CQTA 2XGEA 4IEJA 3ZQLA 3S32A 4IHTA 4A93J 1O7LA 3DBRB 2RKHA 4B1RA 1U9NA 2KLOA 2AHQA 4XM3A 1PVEA 2CQKA 1ZGWA 4N0BA 1OCRH 3TDUC 3QRFF 4BHBA 2VXZA 3I4PA 2YR2A 2XF7A 1ZLKA 3BROA 1APLC 2FUG2 4LOCA 4BH9A 2KZVA 3CF2A 2ZJPF 4E7LA 4LMYA 3K2ZA 3VYUB 3M3YJ 4HDVA 3ELKA 3A0BC 5J4VA 2BY1A 2CH0A 3C2GA 3QP5A 2LREA 5GADJ 2A5YB 4D0PA 4X0GA 3OYLA 4A0XA 2V26A 2R7ZJ 2COBA 2BY3A 4HF0A 2ELHA 1RPWA 3S93A 2L7KA 2DTRA 3OMYA 1YRNB 4MLOA 5J4YA 1JGGA 1WPKA 3RYPA 1H8AC 5E3NA 3CMEI 5LHHA 1I1GA 3TO7A 3HOYJ 3BG9A 2PN6A 4DW6A 2GIVA 3MN2A 2LBFA 3K10A 2HQNA 2L9RA 3L2RA 4NNJA 2FNAA 3W6JB 4A3DJ 1B59A 1EV7A 3H35A 3MQ0A 3WTVC 3E5UA 2A3SA 3LOCA 4XOTA 3JRFA 4P9FA 1Z0XA 3CJNA 3LSKA 1IDZA 3G6EI 2GM4A 3DEEA 3JRDA 4C3JJ 3HOSA 4XNFA 1FBSA 1D5YA 4A0YA 1HKTA 2QF7A 1UJ8A 5KNLA 2IGKA 3LL7A 3E5QA 3HRSA 1LVKA 4WX9A 5LD2C 3K4LA 1JUPA 1TWHJ 3CO7C 3JRIA 4IOCF 1WJAA 3WGIA 2BVMA 1HW2A 1BL0A 1VI0A 3ISPA 1G2HA 5L3CA 2VIXA 4J01A 2ESHA 1V5FA 4ZYEA 5CQGA 3V7CA 1K78A 2Z16A 4G7HF 3OIOA 4I76A 2QQ8A 3HHGA 4G6DA 3N4MA 5HDGA 3I3LA 3H92A 4ZDLA 1BR1A 3TQNA 2ME0A 4BBRJ 3GEZA 4IRGA 2F5FA 3SEQA 2VE9A 1T38A 4EM0B 1HC8A 1QU3A 1O3TA 1OCCH 4MGRA 4F91B 1J75A 3PNVA 4ZDOA 2DXIA 4BYYA 4M9SA 1GV5A 4KFCA 2JPCA 4AU7A 4PJ0C 3S17J 1WCMJ 2QSHX 2QEXI 4CH7A 2FBIA 1BOBA 2BOLA 3TP0A 2A6HF 4ZH4F 3EPZA 2K7LA 3CCJI 5IYDJ 3FXUA 3RQIA 2QA4I 3I0TA 1VFCA 3RKYA 4FQGA 2FOKA 1LFBA 3HGGA 4E7JA 5JVGF 2HPMA 4CYDA 1JXSA 2K86A 3V8KA 2HOSA 3J7AY 2F2EA 2IS6A 2B63J 1JE8A 3RSNA 2Y31A 4W97A 4KIFA 5CJ9A 1IO2A 1BR2A 4M3GA 2ZXJA 4XONA 4PJNA 3E6BA 2ZJ2A 1RETA 2DA1A 1VQ4I 5LGUA 4KISA 1F36A 4RMNA 3HPHA 4I0BA 5IYBJ 2VBXA 1JUMA 3HB9A 4BAYA 2CUJA 5ERIA 5KK1A 2EIJH 5JLWA 2CRGA 1DQUA 4CGZA 4XLEA 2H94A 2X1DA 3GF2A 1AA7A 3JTHA 1F1ZA 2DQRA 2VL8A 1FOKA 4CHUA 1MNEA 1ZELA 1YS7A 2Y0SA 3PFYA 1AKHB 2GAUA 4L9NA 5B5EC 2LLKA 5J3LA 2IW5A 1X58A 2F4IA 1WJCA 2LD5A 1X2MA 2W84A 2P5LC 2LDUA 1QZEA 2BV6A 1AU7A 4FETA 1SANA 2DMUA 4S05A 4L9TA 2X48A 1IRGA 1SVMA 1RRJA 3GZ6A 3RZDJ 2CQXA 1GHCA 4RAGA 1UAAA 1IZ1A 2LSOA 4HV5A 1MBFA 2W48A 1IJWC 2HI3A 4OIRF 1VQPI 4J00A 5JHUA 1HA8A 2QQ9A 3W6VA 1J5YA 1HCRA 2CQQA 3I71A 1AHDP 2PMUA 3LAJA 1PP7U 2DA3A 3CDHA 3BTIA 4DNCA 1BJAA 2QCOA 2DT6A 4IOAF 3D1NI 2VB6A 2KL4A 2CUFA 5ICFA 4IO9F 5E1XA 2M3AA 5M3MJ 4L18B 3TOAA 1U9OA 4N4OB 5K5RA 4KN7X 1X19A 3OS1A 1J9IA 2JMWA 3S1RJ 3F9KA 1BI2A 1D1AA 3DKWA 3FMRA 4C3HJ 4ZYHA 4O5VA 3CLOA 4LK1F 2Q0OA 2K4JA 3C18A 3U1KA 3BQYA 2OUMA 3JAMK 2IGOA 1FNNA 3QU6A 1GXQA 2AXLA 3GFLA 4HX8A 4ENKA 3AKZA 3TKYA 1NG6A 3K4NA 2DYRH 2B7EA 2Y30A 1MBJA 2UZKA 2JRMA 2LKSA 2VKHA 2Z1DA 4XLNF 3CD6I 2FQ3A 4PZJA 4Y52J 5ICEA 4YFKF 4DIQA 2LRDA 3KYLA 3M8EA 4M3BA 5F04A 4RB1A 1XMAA 3MMYB 1RIOH 2GOXB 1RKWA 1Y0NA 1YIJI 1SEUA 1RR8C 1DPUA 5B3SH 5DS9A 2PMHA 1MZBA 4LJZF 5H6RA 1G8XA 1ZLJA 4ANJA 4UVAA 3DKYA 1U2WA 3A4CA 3BWGA 3HYIA 2RGVA 3R4KA 4IHSA 4S04A 3FXMA 2L5QA 1V5GA 3Q9VA 1FOWA 3LQRA 3GUDA 3NARA 4RLQA 1PJRA 2HQRA 4XL9A 3CCMI 1O4XA 5D5WB 4A3KJ 1TWGJ 2VKVA 4GO1A 4E6KG 5CVJA 2V79A 2WTEA 3TOBA 4KA4A 1O3RA 1YJNI 4DZJA 3F6OA 2W57A 4RAYA 3CCYA 1G4DA 4LG3A 1TZLA 2V1NA 2KP6A 4KIGA 4G94A 3AFHA 2WC2A 4GFBA 2VQLA 4LD5A 3ROUA 2PMZN 2DT7B 2VI6A 3QU3A 3WTZA 3GVAA 1VNDA 3OV8A 2WV1A 5M5WJ 2R7SA 2ETHA 1LDKB 1KONA 3A03A 2QQAA 1BIAA 1R4MB 2JA5J 4M73A 3ZRGA 3HBLA 1VQ7I 4UVBA 3ZQGA 1CGPA 3GLXA 5CYVA 4HLYA 1ENHA 1YYVA 1IF1A 1SD6A 2VC0A 3BR6A 3HOUJ 1J2XA 1Q1VA 5E3MA 5EGOA 2DMTA 5HLGA 2M4KA 2OJED 5AONA 1MH3A 2Z5UA 1PDNC 3I4NJ 3CC7I 3HOZJ 5FLXK 1HOMA 1JT0A 2K9SA 3RPUA 2HYJA 2VQHA 3LSHA 4PGGA 4PSXA 2L2OA 5HLIA 4A5MA 1RESA 2FEZA 1T2KA 5L3GA 5BMZA 1LE8B 4HDUA 1ETXA 3JRGA 2P81A 4MHGA 3R0AA 1MBGA 1GUUA 5LHGA 1H0MA 4BQAA 1OKRA 3R60A 4LIVA 1LNWA 1Z3YA 4AD9A 5D5UB 3VWBA 3FZVA 2UV1A 4NQWB 1JKOC 2RNJA 1XN7A 3SQNA 3E6MA 5M5XJ 2LG4A 3GCMA 1LFPA 3LQQA 4M71A 3K69A 2IJLA 4CSWA 3IWZA 4EVIA 1JKQC 4H4KC 5ILUA 4HSTA 2EA4A 4GXOA 3SXYA 1HKSA 2KKOA 1Z3XA 1S5LC 3A01B 2DMPA 1EA3A 2CW7A 2E7XA 2RVCA 2VXDA 2ZO4A 5CLSA 4XLPF 4RB3C 3GFIA 1ZG5A 3G1MA 2EK5A 3GXOA 3VPRA 4LGWA 4BGDA 4ZDPA 4DYRA 1VTNC 2BHYA 1VQKI 3CCVI 5GP9A 2KJBA 2FF4A 2I5UA 3B6CA 2PFBA 5HVQC 1T33A 4B8XA 2O6GE 4BDYA 1KU2A 1TBXA 3RPUD 1SAUA 1SMYF 2ELJA 3VB2A 1E3PA 4JQFA 3P9CA 4B4CA 3GYHX 4XLFA 2ADUA 1X3UA 2NOGA 5F1JA 2CSOA 3FKIJ 1R5GA 3L1PA 3FMSA 2M34A 1HSTA 4V19K 4IHYA 2XASA 3KZYA 2JPBA 3KFWX 3E6DA 1CF7B 5IOYA 1YJWI 2IS2A 4FISA 2HXOA 1SD5A 3EETA 3LA7A 2O61A 3PQJA 4R8HA 5LGNA 4A3LJ 3I56I 3WG9A 1S72I 3AG2H 3CC4I 2K40A 2LR8A 4EGZA 2FRHA 3VSKA 3DXJF 3OS0A 4ZYAA 1U5TC 2CUZA 4GGGA 3DLAA 2QKMB 3CCSI 2K9LA 3AG4H 3TP3A 1DP3A 2KFDA 3I59A 2WAFA 5FFXA 3DV8A 3WU1B 2W7NA 3WHBA 1FMWA 3G71I 4RBOA 1LKXA 3I53A 2X85A 4BY7J 4CZCA 3H5RA 2Q2EA 1B72A 4KDPA 3G73A 3CESA 4BU2A 1T95A 2HPIA 3S14J 1MJAA 2OAZA 4V2GA 3KETA 2XROA 1ZG1A 2KT0A 3HIFA 3HUGA 4V2FA 4BE1A 3HOVJ 4CDGA 5EG0B 1XGNA 1TQPA 4AYBN 2M8EA 1V4RA 1GLNA 2V6EA 2LF8A 4GDFA 2VE8A 5E20A 4PJJA 3GZNB 3LSJA 2Y69H 2RN7A 2HOAA 1IN4A 1IV8A 3M07A 3LMMA 2GXAA 5KHDA 2F48A 1RUNA 5HS8A 1MBKA 3B73A 4Y7NJ 2DFHA 4AWXB 3F3XA 3L2UA 4HNUA 3OR1C 2Y0MA 3HZJA 4ESFA 2STWA 1QHGA 2OBPA 4MTDA 2KDOA 2XUBA 4ZYDA 4HSRA 3N05A 1ACIA 4LLLA 1D0XA 5TJJA 3H5AA 4CYCB 3G1LA 2X1EA 4L0YB 5BQTA 2HR3A 1WRJA 4ENJA 1KA8A 2M87A 4WXCA 1W0TA 3WG7H 1JI8A 1QGPA 1SFOJ 2A5WA 2DOAA 2R7RA 1MH4A 2QYOA 2VKDA 4AC0A 3K4MA 1VQ9I 1X3WB 3BOQA 1ZH5A 2OQGA 1MGTA 2XAUA 2PMZA 3OR2C 4A5NA 4NC6A 5KCMA 1XG1A 4DJAA 3CJRB 5DTDA 3VFZA 4EATA 1PYVA 2DCEA 4UUSA 4XLAA 4NB5A 2WY8Q 3TW7A 1OJLA 3K4BA 1IUFA 3NQOA 1B8IA 2K9NA 3ZQIA 4CO8A 4JOMA 2LP0A 4YRVA 3COAC 2DU9A 4ON0A 1SFKA 3CP8A 4HOBA 1MMDA 2Z3YA 4G8XA 1QNTA 2QZ8A 3H36A 2EQRA 3NWSA 3FMQA 1LEBA 1QVUA 1XS9A 1RZ4A 2CG4A 4XSXF 2EINH 3TO9A 3I5UA 3AL0B 2Y75A 3OYHA 4RGRA 4QSHA 4EM2A 1TTYA 5ICCA 1OQYA 2WADA 5J40A 3GTGJ 3S2HJ 2OA4A 4AIKA 1UELB 4G12A 2NVUB 3QP6A 1GT0C 2D45A 4U0WA 1DUXC 4NHJA 1TW3A 3UR3C 3AL0C 3U9GA 1X1AA 2XAGA 2GA2A 2WA0A 3W2AA 4XSZF 4HV6A 2V6CA 2R92J 1R58A 3EDPA 2OZUA 1YX5A 1Y39A 5ILVA 2L4MA 2E2HJ 2HQ5A 1LEAA 1YG2A 4R79A 4DBQA 3IP4B 2EFNA 4ENMA 1KQ8A 4CCMA 4YFXF 1OYIA 1C0WA 3WE2A 3FKJA 2K9MA 2F6CA 1JHFA 3D5SC 1HBXG 2ZBKA 4LB6B 3H3ZA 2X6YA 2MLKA 4XKBA 1LFUP 5D4SA 3R6SA 3SEZA 3LSIA 4A69C 1MNMC 4I6ZA 2QBYA 2AS5F 5E79C 3TBIA 3FX3A 1WJEA 3MKLA 1SVLA 3EUAA 2YX4A 1ZN2A 1FOYA 1W0UA 4BXFA 2FBHA 1IXCA 1W5SA 3EUKL 4BDZA 2DO7A 3RKWA 2FNPA 4A3MJ 2JVHA 2AO9A 1SFXA 2R5YB 2XGXA 4P5OA 1IN6A 4F3QA 2H8WA 3V8LA 1H9GA 3S3MA 5F6FA 4P9UA 3EUHC 2X6WA 2E60A 3ZR8X 1U6GA 1OCTC 1UMQA 3GTKJ 3B02A 3W2WA 3HSRA 4AVPA 4QLCU 3I54A 3BJAA 3Q0VA 4PUSA 3NRVA 4BQQA 3JTGA 1TP4A 3I58A 3ZMDA 2H1KA 3VYSB 5A2QZ 5JR3A 4BNCA 4C9YA 2VONA 1Y6IA 3WTWC 2R7VA 5EEAA 2H6BA 1J7KA 1W36D 3OYEA 4E7IA 2EFOA 3ZGKA 5DDGA 1E3OC 3S1MJ 3J81K 4WK8F 4EJTA 1G3SA 2BY0A 2XAHA 1BOAA 5E8IA 4BUPA 2M7BA 4P96A 3K0LA 5CVRA 2FOWA 3KZIC 5ICGA 2DMNA 5DUIA 1FIAA 3IL2A 2R7QA 1STZA 3PFIA 4Y3OA 1K61A 1I1SA 2VODA 3AAFA 2V1DA 2FQ4A 1ZARA 2P4WA 2M7AA 1I3AA 1Y56A 3IUOA 3MFKA 2DMQA 2IS1A 2QLZA 2ZMEC 1U8BA 2HKOA 2QQBA 1SD4A 1YHQI 4I0AA 3SZGA 4AIHA 5KVRA 1XGMA 2MBFA 5EDNA 2IS4A 4PGHA 1P4AA 2JZYA 4A3EJ 1K79A 2X1CA 4AM3A 2G9WA 2H8RA 2MD0A 1A6QA 3GX4X 3KP4A 1VQOI 2W00A 4QIWN 4YFNF 1RUOA 1YOVB 1O3SA 4I7HA 2M5WA 1AKHA 1FJLA 1YFHA 2CGPA 1FT9A 4MO7A 1ZHFA 5ED4A 4N9HA 4E7HA 3J7ZI 4JP0A 2EILH 2KQRA 1YIOA 3ZPLA 1R6RA 2CQ7A 4MQ9F 4N4NB 3BTLA 2KIFA 2LY9A 1BW6A 3PSFA 4XKVA 5JVTA 2STTA 4X6AJ 3CZ6A 2FU4A 2CU7A 4BEHB 2VN2A 2HTJA 4D5CA 5F0HA 1OR7A 2IRFG 2OD5A 1R9TJ 1XDUA 3WTTC 3CC2I 2MH2A 1OMIA 4HX7A 3ERED 2PG4A 2DA4A 1OCPA 3DTKA 3QOEA 4HF1A 1J59A 3G2BA 5C44J 4RLFA 2ID3A 3QWLA 1FYLA 1UG2A 3BCAA 3CDIA 2EZLA 2XVCA 3HOTA 4N9IA 4KYWA 4OMYA 4Y15A 2GWRA 5DD4A 2K85A 3GFJA 2VJIA 5BPDA 1R71A 3KP5A 4RDUA 2R5ZB 1UG0A 2RQPA 4O6JA 3FXKA 3RPQA 2W24A 2ESNA 4M6XA 2ZSIB 2EBIA 2BW3B 2M2EA 1PUFB 4OIPF 1FOXA 3CQZJ 3DTIA 2P6SA 1MSEC 3M4OJ 4IQ4A 3TMOA 2ZC2A 3JRCA 1UB9A 1MDMA 4PFPA 2WBMA 2M4GA 2J5OA 2K4BA 1KU7A 3FXOA 1I3QJ 3K2AA 1IGNA 1U5TB 4ESJA 2DQLA 3LA3A 4KITB 1E17A 1W5CC 1XPXA 5FRNA 1D0ZA 4ZTJA 1FC3A 3LSTA 4UNOA 4XN0A 1R7JA 4KT5C 1A6IA 2HZDA 2HS5A 2CJJA 2BEOA 5IP6A 3IHUA 3HTSB 2A05A 1FSEA 2FX0A 2TRTA 3K4CA 3MWMA 5EEGA 3DFGA 2GXGA 3GBGA 2EFQA 1IXRC 4RAZA 2E36A 4UVCA 2XPWA 1E2XA 3ECHA 4YIFA 4ENNA 3E7LA 3HKZN 1EF4A 2IA0A 3CCRI 1FP1D 3P5JA 5J1UA 1PP8F 2ICWG 2JA8J 3PO2J 2ISZA 3CUQC 2KPMA 2CFOA 3IWFA 5M3FJ 3H9JA 2DN0A 1TQIA 5BS6A 4II3A 1AOYA 4AIDA 2F5DA 2F5CA 1SMTA 2OU2A 1WGXA 1ZREA 4BS9A 1TWCJ 1BBYA 4EJWA 2Y2ZA 4Z2YA 5E3LA 1LUJB 4UHTA 4NC8A 1BW5A 2HZTA 5CVIA 1G59A 3PUBA 3ML6A 4WCGA 3DWLE 1KZHA 2L3DA 1D8JA 2JUCA 3FISA 4K2EA 2NYXA 5C4XJ 3FDYA 5FKKA 2XAFA 3G3ZA 3WU2C 2YPRA 1MSFC 5F27A 1FEXA 3QYBA 2AQFA 2E1CA 1SAXA 3MKYB 1YE9A 4I99C 2KMUA 4ETSA 4JX4A 3M1EA 3RIRA 2KIQA 1ZQ3P 3DCFA 1HLVA 1QVTA 1IXSB 2BBYA 2MLGA 5HLTA 1RC9A 1ETVA 1MBHA 4YEJA 1FYKA 2B9SA 3KZZA 1RNLA 1UHWA 4XRSG 3SDBA 4M3FA 3ASOH 2M8GX 2MC3A 1L0OC 2K5CA 1S7OA 2RC4A 1TT5B 5IYCJ 2JA7J 2FJ1A 3PQKA 3Q5FA 2AXTC 1N75A 2VBYA 1Z77A 3H9QA 3RJPA 2XPUA 2A6EF 5LBQA 2WV0A 1T0FC 2V1UA 2CV1A 3S16J 1VQMI 1GDTA 3OS2A 5FKNA 1NTCA 3BR0A 4RS8A 4D5FA 3FK7A 1LE8A 2HWVA 2IGMA 2QSFX 4HBLA 1BI0A 1Y0UA 4YIRX 4XRFA 1JTXA 1R5ID 2DFEA 1K4TA 1BIBA 3TW6A 4W1UA 2XAJA 3ZOBA 2DA6A 3CCEI 3IKVA 4AUXA 3D5RC 4IHWA 4LG0B 1KYZA 1V3FA 1NHAA 1VQ6I 2ELKA 3L2QA 1UHSA 2RV8A
chains in the Genus database with same CATH topology
3HRTA 5HLHA 4EMSA 4UUVA 5BPIA 1Z6TA 3F8CA 3KLOA 2OZ6A 2Z33A 1MD0A 1WKMA 1S6LA 5E18F 3C3WA 3BPVA 1DP7P 2CFXA 1KQ0A 3M9AA 2Q8KA 3J80Z 4MTEA 4CICA 1HQCA 4EM1A 4A6DA 1GXPA 2QWWA 3RYRA 3F8FA 3VOEA 3F8MA 1BC8C 4E70A 2L54A 1CF7A 4OINF 4O3MA 5DCFA 1LVAA 5E1ZB 1IN8A 3C7JA 5K1YA 3J7AO 3ECOA 1TNSA 3WODF 5IT9Z 4FHTA 1R5HA 4EQQA 2PEXA 4Y17A 2DK8A 4WXHA 1ZRDA 4Q5SF 4WXDA 1QQIA 1U8RA 3T1BA 4RGUA 3ZQ7A 1WQ2A 2BYVE 2NS0A 3L00A 4IXAA 4L5JA 1DPRA 5AIPA 2DLLA 3T5XA 4HQMA 1IN7A 1W4MA 5H6QA 4GYGA 2M1BA 1R22A 1O57A 1LQ1A 1G3YA 1G6NA 1TLHB 5D5VB 2ZMEB 1K6OA 3KP2A 5A2QK 3VODA 1IRFA 1WWXA 3L2CA 3RI4A 3P9IA 2TDXA 3TO6A 4LFUA 1S29A 3GO5A 3ULQB 3BJ6A 4H0EA 2JRTA 4EJUA 2PJPA 3BPXA 2C6YA 5D8KB 3ABUA 5JFRA 1BN5A 4OOIA 2YX7A 5HS7A 3O6BB 1Q1HA 4Q4ZF 5HOOA 1R00A 4BHCA 4AIJA 4MEXF 3H3UA 2VT3A 3FM3A 1I6XA 4PDKA 1DDNA 2Y48A 1KQ9A 1G3TA 1B4AA 3WE3A 4ZZDA 2GZWA 2O03A 3RKXA 4WWCA 3V7RA 1TNTA 1ZGAA 2X4HA 2R7FA 1P4WA 4KMFA 5FB2A 2Z9OA 2NAZA 3HSFA 4M9XA 2WWYA 1SD7A 4M72A 1R23A 2EV6A 1UCRA 3M7GA 1HXDA 5D5XB 1YW8A 3E97A 4FX0A 1FPQA 2NRAC 1BI1A 2IA1A 2LKPA 3KEQA 5DEQA 3P7NA 2G7HA 1Z6RA 3SZPA 2HDCA 3K1MA 1W7PB 2P8TA 5LLQA 1HSJA 2IPQX 5L3DA 3HRUA 2BGCA 2F5EA 2ZNYA 3F8NA 3CUQB 2P7VB 1TQMA 1W5TA 2D1VA 1S3JA 1U3EM 5DCMB 4M9ZA 4FX4A 2COMA 1Z9CA 2Z99A 4A12A 4OMZA 1YTYA 3DP7A 3LA2A 1ULYA 1HKQA 1XDSA 3MZHA 2L01A 4RB0A 3U1DA 5F1RA 2JSCA 3Q9SA 2UXNA 1A04A 3D5LA 4F7ZA 2CYYA 2M30A 3FHZA 2IT0A 4G7OF 3F6VA 1TW2A 1O3QA 1FBUA 4P55A 2EA2A 2MH9A 1YQAA 1FBQA 2HKXA 2EFPA 1EH7A 1REPC 1LJ9A 2K02A 1FYMA 1P92A 1SFEA 2FSWA 1Z05A 5TRDA 2CO5A 1ON1A 3MCZA 2XAQA 2E7WA 1R36A 2DFIA 1YO5C 3EYYA 3L09A 4R1HA 2R3SA 1USSA 4A6EA 5HDNA 3IRQA 3LAPA 2H09A 5FO5A 1T6SA 3LFKA 1YW7A 4G7ZF 3ABTA 3KE2A 1S7AA 3NEUA 3S2WA 2A61A 3I64A 3GFMA 5AIQA 3P9KA 2KJCA 3REOA 4I2OA 3MAJA 3E3VA 1P2FA 3FXRA 1ZRCA 4B09A 1I27A 2EJRA 4I98B 2L4AA 2V1XA 1P6RA 4KNYA 2EFWA 1RI7A 4Y13A 4IJAA 1F9NA 3BY6A 4UV8A 3CTAA 1KYWA 3BJOA 1ON2A 1D3YA 4A2UA 4L9VA 3RDIA 3J80K 2DT5A 1U5TA 2L02A 1H9TA 2QBYB 3MEXA 3F72A 4YIIA 3KEOA 2ISYA 1YLFA 3DPLC 1USTA 5D6EA 1GVJA 3SFZA 2JTVA 2QVOA 5FFZA 2B0LA 3V4GA 5IT9K 1ONVA 3SZTA 3TDZC 1UHMA 3FM5A 3R61A 3ZN0A 4QWQA 4KN4X 1QPMA 3ZP5A 2O3FA 4BHPA 4LK0F 4JBAA 4HLXA 4FT8A 4EV0A 1FLIA 5J6XA 1I5ZA 4CXFA 1XSVA 2CW0F 4KMUX 3JSPA 5FD5A 5EEHA 5HS9A 3K1NA 2KRFA 1BC7C 2H27A 4EJVA 1XB4A 3CO6C 2NNYA 1F4KA 4RGSA 2VBWA 5J8CA 4UXNA 5L3FA 1FY7A 3JW4A 2IA2A 1ZGJA 3HHHA 5F64A 4CZZA 1D8KA 1JHHA 4L5IA 4U7BA 1WI9A 1K78B 2A68F 3T8TA 2FMLA 2O8XA 2QM3A 4I09A 1WSUA 2D1HA 4EGYA 2DW4A 4LG0A 3R0JA 3F23A 5LHIA 2EV0A 1EH8A 1ZG3A 3KP7A 2W85A 4EJOA 3VEPA 1QO0D 5J8FA 1SFUA 2XIGA 2HYFA 2HOEA 4OIQF 4RGXA 4HF2A 3K9TA 3HRMA 4I01A 2KIUA 5H20A 3ZN1A 3CUOA 2VOPA 1JGSA 3U2RA 4U88A 2FE3A 2LF7A 3KP3A 3W6KB 3RTRA 1Z1DA 3HTUA 2NNNA 5D6FA 2UWMA 3FXQA 5DUKA 4HX4A 4TV7A 3KCCA 4MQVA 2DK5A 1OYYA 3QPHA 3KLNA 1KU9A 1MDMB 4IPAA 1ZRFA 3SHFA 1D5VA 1LDJA 3IRRA 2V9VA 3F22A 2HEOA 4YG2F 4GCVA 1IUYA 5K5QA 1QZYA 2LNBA 1ZAOA 3QPTA 3QAHA 3EUHA 3TGNA 4LLGF 4RB2C 2VC1A 1L3LA 3T8RA 3WTXC 5DD8A 4NQWA 5DYMA 1KU3A 2FXAA 2HYGD 2IP2A 5FGMA 2QUFA 4IRIA 4M74A 4A0ZA 3WTSC 2YU3A 4HAMA 3ZMZA 4MEYF 3GW2A 3FWEA 4HZFA 3V8JA 2VBZA 5ILSA 5E17F 3J81Z 2VOOA 4IRHA 5DV5A 3BDDA 1B6AA 1FSHA 2PQ8A 3LWFA 5E1WA 2H6CA 2XKOA 1F5TA 1XSXA 4IF4A 4LLNA 1XD7A 3EQLF 3ZMVA 1XSDA 1IW7F 4MNUA 3BP8A 1XCVA 1QZZA 2ZMEA 4WF2A 5IT3A 2EB7A 1MJ9A 4U7DA 2E1NA 3FF5A 2DPUA 1HW1A 1HW5A 1BI3A 4G9YA 2UXXA 5CVVA 3EYIA 3IC7A 4XBFA 2ZCWA 4HW0A 1P4XA 2FMYA 5D4RA 3M8FA 3F21A 1S8NA 4OIOF 1B1BA 2DPDA 1FZPB 1FP2A 2HGCA 3F8BA 3WTUC 5L3BA 1Z7UA 4I02A 1MKMA 2GXBA 1T39A 2GQQA 3GZ5A 4GYIA 2DI3A 3QOPA 1YW9A 3MZYA 3T0YA 2J5PA 2RDPA 4JK1X 3WU0A 2D2WA 3L9FA 2HTSA 3K1PA 1LB2A 1OYWA 1XGOA 5LRRA 4UV9A 4BXUA 2ZKZA 1YS6A 2MA3A 1KGSA 3D0SA 3DEUA 2X0LA 5K5OA 2EV5A 4ZYGA 1FWZA 5D8LB 2A07F 2PI0A 3E5XA 2VT2A 4G6QA 3BZ6A 1ODDA 5HDKA 2P7CB 1W7PA 1B9MA 3O2PE 4IVNA 3C1DA 1LDDA 1MJBA 3DQVC 4L0ZB 2G7UA 2XRNA 5BOXA 3CUQA 1J0RA 5FD6A 2R7DA 5DCMA 2YSRA 3DPTA 1XGSA 5CVUA 4HA8A 1U78A 1R1UA 5LRSA 1AWCA 3JAMZ 1T98A 1QBJA 1FX7A 4ZZLA 4Q48A 1K7AA 2P6TA 2ACJA 2XHKA 2IVMA 4KUMA 2BE5F 4KICA 1O7FA 2W25A 1W7PD 4L9JA 5E8GA 2MD5A 1T0FA 5LEJA 2GA1A 3OOPA 2ZFWA 6PAXA 3DF8A 1PUEE 3O3KA 1Z91A 3KP6A 2PLYA 3ZMTA 1EH6A 2KIMA 2K27A 3I59B 3ZMSA 4HQEA 1XCBA 3GWZA 2DAOA 1B9NA 2P5KA 2XV4S 2A69F 1UFMA 4ASNA 2FA5A 3IKTA 3WGHA 4LB5A 1G3WA 1IAWA 2EWNA 2P5VA 3WGGA 1R1VA 3N97A 1BM9A 5L3EA 2M45A 4HYEA 5LEKA 2PBIA 2ZNZA 5FLXZ 2HFHA 5JI6A 3V7SA 4PCQA 4U0YA 2OQRA 4U0VA 3HSEA 1OPCA 2DBBA 3JSOA 3E6CC 2QENA 2XKPA 1IN5A 3ZMUA 2FBKA 4M6YA 1XMKA 4OU0A 5LGTA 4Q47A 4DQ2A 2JT1A 2O0YA 1ZYRF 4KIBA 2CWEA 1R1TA 3WTYC 3L7WA 4ESBA 4IHTA 1O7LA 2RKHA 2CQKA 4N0BA 3TDUC 3QRFF 4BHBA 2VXZA 3I4PA 2YR2A 1ZLKA 3BROA 4BH9A 4LMYA 3K2ZA 4HDVA 3ELKA 3QP5A 2A5YB 4D0PA 4A0XA 4HF0A 2ELHA 2DTRA 3RYPA 5LHHA 1I1GA 3TO7A 2PN6A 2GIVA 2HQNA 2FNAA 3W6JB 1B59A 1EV7A 3MQ0A 3WTVC 3E5UA 2A3SA 4P9FA 3CJNA 3HOSA 1FBSA 4A0YA 1HKTA 3E5QA 3HRSA 4WX9A 3CO7C 3WGIA 1HW2A 3ISPA 5L3CA 2ESHA 4ZYEA 3V7CA 1K78A 4G7HF 3HHGA 4G6DA 3N4MA 5HDGA 3H92A 3TQNA 3GEZA 4IRGA 2F5FA 2VE9A 1T38A 4EM0B 1O3TA 4MGRA 1J75A 4BYYA 4M9SA 4KFCA 2JPCA 2FBIA 2A6HF 4ZH4F 2K7LA 3FXUA 3I0TA 3RKYA 2FOKA 4CYDA 1JXSA 2K86A 3V8KA 2F2EA 1JE8A 4KIFA 5CJ9A 2ZXJA 3E6BA 2ZJ2A 5LGUA 4I0BA 2VBXA 4BAYA 5ERIA 5KK1A 4CGZA 2H94A 3GF2A 3JTHA 1F1ZA 2DQRA 1FOKA 4CHUA 1YS7A 2GAUA 4L9NA 2IW5A 2W84A 2P5LC 2LDUA 2BV6A 4S05A 4L9TA 1IRGA 3GZ6A 1GHCA 1IZ1A 2LSOA 4HV5A 4OIRF 5JHUA 2QQ9A 1J5YA 3I71A 2PMUA 3LAJA 1PP7U 3CDHA 4DNCA 1BJAA 5ICFA 5E1XA 4L18B 3TOAA 5K5RA 4KN7X 1J9IA 1BI2A 3DKWA 4ZYHA 3FMRA 4O5VA 3CLOA 4LK1F 2Q0OA 2K4JA 3C18A 3JAMK 1FNNA 3QU6A 1GXQA 2AXLA 3GFLA 4HX8A 4ENKA 3TKYA 2UZKA 4XLNF 2FQ3A 4PZJA 5ICEA 4YFKF 3M8EA 4RB1A 1XMAA 1RIOH 1DPUA 2PMHA 1MZBA 4LJZF 5H6RA 1ZLJA 4UVAA 1U2WA 3BWGA 3HYIA 2RGVA 3R4KA 4IHSA 4S04A 3Q9VA 3LQRA 3GUDA 2HQRA 5D5WB 4GO1A 5CVJA 2V79A 2WTEA 3TOBA 4KA4A 1O3RA 3F6OA 2W57A 4RAYA 1G4DA 4KIGA 4G94A 2WC2A 4LD5A 3ROUA 3QU3A 3WTZA 3GVAA 3OV8A 2ETHA 1LDKB 2QQAA 1BIAA 4M73A 4UVBA 1CGPA 3GLXA 5CYVA 4HLYA 1YYVA 1IF1A 1SD6A 2VC0A 1J2XA 5HLGA 5AONA 2Z5UA 1PDNC 5FLXK 3RPUA 4PGGA 5HLIA 4A5MA 2FEZA 1T2KA 5L3GA 5BMZA 4HDUA 4MHGA 3R0AA 5LHGA 1H0MA 4BQAA 1OKRA 3R60A 1LNWA 4AD9A 5D5UB 3FZVA 2RNJA 1XN7A 3SQNA 3E6MA 3LQQA 4M71A 3K69A 2IJLA 4EVIA 3IWZA 5ILUA 2EA4A 4GXOA 3SXYA 1HKSA 2KKOA 2RVCA 2E7XA 1ZG5A 4XLPF 2ZO4A 5CLSA 4RB3C 3GFIA 2EK5A 3GXOA 4LGWA 1VTNC 2KJBA 2FF4A 2PFBA 5HVQC 4B8XA 2O6GE 1KU2A 1TBXA 1SMYF 3VB2A 4JQFA 3P9CA 3GYHX 2ADUA 1X3UA 2CSOA 1R5GA 3FMSA 1HSTA 2XASA 3KZYA 2JPBA 3KFWX 3E6DA 1CF7B 1SD5A 3EETA 3LA7A 2O61A 3PQJA 4R8HA 5LGNA 3WG9A 4EGZA 2FRHA 3DXJF 1U5TC 4GGGA 3I59A 5FFXA 3DV8A 3WU1B 3I53A 2Q2EA 4KDPA 3G73A 1MJAA 2OAZA 3KETA 2XROA 1ZG1A 3HIFA 3HUGA 4CDGA 1XGNA 1TQPA 2M8EA 1V4RA 2LF8A 2VE8A 5E20A 2RN7A 1IN4A 1RUNA 5HS8A 3B73A 4AWXB 3F3XA 2Y0MA 4ESFA 2STWA 2OBPA 4MTDA 4ZYDA 2XUBA 4LLLA 5TJJA 4L0YB 5BQTA 2HR3A 1WRJA 4ENJA 1KA8A 2M87A 4WXCA 1QGPA 2QYOA 3BOQA 1ZH5A 2OQGA 1MGTA 4A5NA 3VFZA 4NB5A 3NQOA 4CO8A 3COAC 2DU9A 4ON0A 4HOBA 4G8XA 2Z3YA 1QNTA 2QZ8A 3FMQA 1LEBA 1RZ4A 2CG4A 4XSXF 3TO9A 3I5UA 2Y75A 4RGRA 4EM2A 5ICCA 1TTYA 2OA4A 4AIKA 3QP6A 2D45A 4U0WA 1DUXC 4NHJA 1TW3A 3U9GA 2XAGA 2GA2A 4XSZF 4HV6A 2V6CA 1R58A 3EDPA 2OZUA 5ILVA 2L4MA 1LEAA 1YG2A 4R79A 2EFNA 4ENMA 1KQ8A 4YFXF 1OYIA 1C0WA 3WE2A 1JHFA 1HBXG 2ZBKA 4LB6B 3H3ZA 2MLKA 5D4SA 3R6SA 2QBYA 2AS5F 3FX3A 2YX4A 1ZN2A 2FBHA 1IXCA 1W5SA 2DO7A 3RKWA 2FNPA 1SFXA 2XGXA 4P5OA 1IN6A 3V8LA 1H9GA 5F6FA 4P9UA 1U6GA 3B02A 3HSRA 4AVPA 4QLCU 3I54A 3BJAA 3NRVA 3JTGA 3I58A 3ZMDA 4BNCA 5A2QZ 5JR3A 2VONA 3WTWC 2H6BA 1J7KA 2EFOA 5DDGA 3J81K 4WK8F 4EJTA 1G3SA 2XAHA 1BOAA 5E8IA 4P96A 3K0LA 5CVRA 5ICGA 5DUIA 3IL2A 1STZA 3PFIA 1I1SA 2VODA 3AAFA 2V1DA 1ZARA 2P4WA 3MFKA 2QLZA 2HKOA 2QQBA 1SD4A 4I0AA 4AIHA 5KVRA 1XGMA 2MBFA 4PGHA 1P4AA 2JZYA 1K79A 2G9WA 3GX4X 3KP4A 4YFNF 1RUOA 1O3SA 4I7HA 2M5WA 1YFHA 2CGPA 1FT9A 1ZHFA 5ED4A 4N9HA 1YIOA 3ZPLA 4MQ9F 2KIFA 5JVTA 2STTA 2FU4A 2VN2A 2HTJA 1OR7A 2IRFG 2OD5A 1XDUA 3WTTC 2MH2A 1OMIA 4HX7A 3ERED 2PG4A 4HF1A 1J59A 1FYLA 2XVCA 3HOTA 4N9IA 4KYWA 4OMYA 4Y15A 2GWRA 5DD4A 3GFJA 5BPDA 3KP5A 2RQPA 4O6JA 3RPQA 2W24A 2ESNA 4M6XA 4OIPF 2P6SA 1MDMA 1UB9A 2J5OA 2K4BA 1KU7A 1U5TB 4ESJA 2DQLA 3LA3A 1E17A 1FC3A 3LSTA 4UNOA 1R7JA 4KT5C 2HS5A 2BEOA 3IHUA 3HTSB 1FSEA 5EEGA 3MWMA 3DFGA 2GXGA 2EFQA 1IXRC 4RAZA 4UVCA 1E2XA 3ECHA 4YIFA 4ENNA 2IA0A 1FP1D 1PP8F 2ISZA 3CUQC 3IWFA 1TQIA 5BS6A 1AOYA 2F5DA 2F5CA 1SMTA 2OU2A 1ZREA 4EJWA 1BBYA 4Z2YA 4UHTA 2HZTA 5CVIA 3ML6A 4WCGA 2L3DA 1D8JA 4K2EA 2NYXA 2XAFA 3G3ZA 2YPRA 2E1CA 1SAXA 4ETSA 3M1EA 3RIRA 1IXSB 2BBYA 2MLGA 1FYKA 3KZZA 1RNLA 1UHWA 2MC3A 1L0OC 1S7OA 2RC4A 3PQKA 3Q5FA 2VBYA 3RJPA 2A6EF 5LBQA 2WV0A 2V1UA 4RS8A 2HWVA 4HBLA 1BI0A 1Y0UA 4XRFA 1BIBA 2XAJA 3IKVA 4LG0B 1KYZA 1V3FA 1NHAA 2RV8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HRT A;  5HLH A;  4EMS A;  4UUV A;  5BPI A;  1Z6T A;  3F8C A;  3KLO A;  2OZ6 A;  2Z33 A;  1MD0 A;  1WKM A;  1S6L A;  5E18 F;  3C3W A;  3BPV A;  1DP7 P;  2CFX A;  1KQ0 A;  3M9A A;  2Q8K A;  3J80 Z;  4MTE A;  4CIC A;  1HQC A;  4EM1 A;  4A6D A;  1GXP A;  2QWW A;  3RYR A;  3F8F A;  3VOE A;  3F8M A;  1BC8 C;  4E70 A;  2L54 A;  1CF7 A;  4OIN F;  4O3M A;  5DCF A;  1LVA A;  5E1Z B;  1IN8 A;  3C7J A;  5K1Y A;  3J7A O;  3ECO A;  1TNS A;  3WOD F;  5IT9 Z;  4FHT A;  1R5H A;  4EQQ A;  2PEX A;  4Y17 A;  2DK8 A;  4WXH A;  1ZRD A;  4Q5S F;  4WXD A;  1QQI A;  1U8R A;  3T1B A;  4RGU A;  3ZQ7 A;  1WQ2 A;  2BYV E;  2NS0 A;  3L00 A;  4IXA A;  4L5J A;  1DPR A;  5AIP A;  2DLL A;  3T5X A;  4HQM A;  1IN7 A;  1W4M A;  5H6Q A;  4GYG A;  2M1B A;  1R22 A;  1O57 A;  1LQ1 A;  1G3Y A;  1G6N A;  1TLH B;  5D5V B;  2ZME B;  1K6O A;  3KP2 A;  5A2Q K;  3VOD A;  1IRF A;  1WWX A;  3L2C A;  3RI4 A;  3P9I A;  2TDX A;  3TO6 A;  4LFU A;  1S29 A;  3GO5 A;  3ULQ B;  3BJ6 A;  4H0E A;  2JRT A;  4EJU A;  2PJP A;  3BPX A;  2C6Y A;  5D8K B;  3ABU A;  5JFR A;  1BN5 A;  4OOI A;  2YX7 A;  5HS7 A;  3O6B B;  1Q1H A;  4Q4Z F;  5HOO A;  1R00 A;  4BHC A;  4AIJ A;  4MEX F;  3H3U A;  2VT3 A;  3FM3 A;  1I6X A;  4PDK A;  1DDN A;  2Y48 A;  1KQ9 A;  1G3T A;  1B4A A;  3WE3 A;  4ZZD A;  2GZW A;  2O03 A;  3RKX A;  4WWC A;  3V7R A;  1TNT A;  1ZGA A;  2X4H A;  2R7F A;  1P4W A;  4KMF A;  5FB2 A;  2Z9O A;  2NAZ A;  3HSF A;  4M9X A;  2WWY A;  1SD7 A;  4M72 A;  1R23 A;  2EV6 A;  1UCR A;  3M7G A;  1HXD A;  5D5X B;  1YW8 A;  3E97 A;  4FX0 A;  1FPQ A;  2NRA C;  1BI1 A;  2IA1 A;  2LKP A;  3KEQ A;  5DEQ A;  3P7N A;  2G7H A;  1Z6R A;  3SZP A;  2HDC A;  3K1M A;  1W7P B;  2P8T A;  5LLQ A;  1HSJ A;  2IPQ X;  5L3D A;  3HRU A;  2BGC A;  2F5E A;  2ZNY A;  3F8N A;  3CUQ B;  2P7V B;  1TQM A;  1W5T A;  2D1V A;  1S3J A;  1U3E M;  5DCM B;  4M9Z A;  4FX4 A;  2COM A;  1Z9C A;  2Z99 A;  4A12 A;  4OMZ A;  1YTY A;  3DP7 A;  3LA2 A;  1ULY A;  1HKQ A;  1XDS A;  3MZH A;  2L01 A;  4RB0 A;  3U1D A;  5F1R A;  2JSC A;  3Q9S A;  2UXN A;  1A04 A;  3D5L A;  4F7Z A;  2CYY A;  2M30 A;  3FHZ A;  2IT0 A;  4G7O F;  3F6V A;  1TW2 A;  1O3Q A;  1FBU A;  4P55 A;  2EA2 A;  2MH9 A;  1YQA A;  1FBQ A;  2HKX A;  2EFP A;  1EH7 A;  1REP C;  1LJ9 A;  2K02 A;  1FYM A;  1P92 A;  1SFE A;  2FSW A;  1Z05 A;  5TRD A;  2CO5 A;  1ON1 A;  3MCZ A;  2XAQ A;  2E7W A;  1R36 A;  2DFI A;  1YO5 C;  3EYY A;  3L09 A;  4R1H A;  2R3S A;  1USS A;  4A6E A;  5HDN A;  3IRQ A;  3LAP A;  2H09 A;  5FO5 A;  1T6S A;  3LFK A;  1YW7 A;  4G7Z F;  3ABT A;  3KE2 A;  1S7A A;  3NEU A;  3S2W A;  2A61 A;  3I64 A;  3GFM A;  5AIQ A;  3P9K A;  2KJC A;  3REO A;  4I2O A;  3MAJ A;  3E3V A;  1P2F A;  3FXR A;  1ZRC A;  4B09 A;  1I27 A;  2EJR A;  4I98 B;  2L4A A;  2V1X A;  1P6R A;  4KNY A;  2EFW A;  1RI7 A;  4Y13 A;  4IJA A;  1F9N A;  3BY6 A;  4UV8 A;  3CTA A;  1KYW A;  3BJO A;  1ON2 A;  1D3Y A;  4A2U A;  4L9V A;  3RDI A;  3J80 K;  2DT5 A;  1U5T A;  2L02 A;  1H9T A;  2QBY B;  3MEX A;  3F72 A;  4YII A;  3KEO A;  2ISY A;  1YLF A;  3DPL C;  1UST A;  5D6E A;  1GVJ A;  3SFZ A;  2JTV A;  2QVO A;  5FFZ A;  2B0L A;  3V4G A;  5IT9 K;  1ONV A;  3SZT A;  3TDZ C;  1UHM A;  3FM5 A;  3R61 A;  3ZN0 A;  4QWQ A;  4KN4 X;  1QPM A;  3ZP5 A;  2O3F A;  4BHP A;  4LK0 F;  4JBA A;  4HLX A;  4FT8 A;  4EV0 A;  1FLI A;  5J6X A;  1I5Z A;  4CXF A;  1XSV A;  2CW0 F;  4KMU X;  3JSP A;  5FD5 A;  5EEH A;  5HS9 A;  3K1N A;  2KRF A;  1BC7 C;  2H27 A;  4EJV A;  1XB4 A;  3CO6 C;  2NNY A;  1F4K A;  4RGS A;  2VBW A;  5J8C A;  4UXN A;  5L3F A;  1FY7 A;  3JW4 A;  2IA2 A;  1ZGJ A;  3HHH A;  5F64 A;  4CZZ A;  1D8K A;  1JHH A;  4L5I A;  4U7B A;  1WI9 A;  1K78 B;  2A68 F;  3T8T A;  2FML A;  2O8X A;  2QM3 A;  4I09 A;  1WSU A;  2D1H A;  4EGY A;  2DW4 A;  4LG0 A;  3R0J A;  3F23 A;  5LHI A;  2EV0 A;  1EH8 A;  1ZG3 A;  3KP7 A;  2W85 A;  4EJO A;  3VEP A;  1QO0 D;  5J8F A;  1SFU A;  2XIG A;  2HYF A;  2HOE A;  4OIQ F;  4RGX A;  4HF2 A;  3K9T A;  3HRM A;  4I01 A;  2KIU A;  5H20 A;  3ZN1 A;  3CUO A;  2VOP A;  1JGS A;  3U2R A;  4U88 A;  2FE3 A;  2LF7 A;  3KP3 A;  3W6K B;  3RTR A;  1Z1D A;  3HTU A;  2NNN A;  5D6F A;  2UWM A;  3FXQ A;  5DUK A;  4HX4 A;  4TV7 A;  3KCC A;  4MQV A;  2DK5 A;  1OYY A;  3QPH A;  3KLN A;  1KU9 A;  1MDM B;  4IPA A;  1ZRF A;  3SHF A;  1D5V A;  1LDJ A;  3IRR A;  2V9V A;  3F22 A;  2HEO A;  4YG2 F;  4GCV A;  1IUY A;  5K5Q A;  1QZY A;  2LNB A;  1ZAO A;  3QPT A;  3QAH A;  3EUH A;  3TGN A;  4LLG F;  4RB2 C;  2VC1 A;  1L3L A;  3T8R A;  3WTX C;  5DD8 A;  4NQW A;  5DYM A;  1KU3 A;  2FXA A;  2HYG D;  2IP2 A;  5FGM A;  2QUF A;  4IRI A;  4M74 A;  4A0Z A;  3WTS C;  2YU3 A;  4HAM A;  3ZMZ A;  4MEY F;  3GW2 A;  3FWE A;  4HZF A;  3V8J A;  2VBZ A;  5ILS A;  5E17 F;  3J81 Z;  2VOO A;  4IRH A;  5DV5 A;  3BDD A;  1B6A A;  1FSH A;  2PQ8 A;  3LWF A;  5E1W A;  2H6C A;  2XKO A;  1F5T A;  1XSX A;  4IF4 A;  4LLN A;  1XD7 A;  3EQL F;  3ZMV A;  1XSD A;  1IW7 F;  4MNU A;  3BP8 A;  1XCV A;  1QZZ A;  2ZME A;  4WF2 A;  5IT3 A;  2EB7 A;  1MJ9 A;  4U7D A;  2E1N A;  3FF5 A;  2DPU A;  1HW1 A;  1HW5 A;  1BI3 A;  4G9Y A;  2UXX A;  5CVV A;  3EYI A;  3IC7 A;  4XBF A;  2ZCW A;  4HW0 A;  1P4X A;  2FMY A;  5D4R A;  3M8F A;  3F21 A;  1S8N A;  4OIO F;  1B1B A;  2DPD A;  1FZP B;  1FP2 A;  2HGC A;  3F8B A;  3WTU C;  5L3B A;  1Z7U A;  4I02 A;  1MKM A;  2GXB A;  1T39 A;  2GQQ A;  3GZ5 A;  4GYI A;  2DI3 A;  3QOP A;  1YW9 A;  3MZY A;  3T0Y A;  2J5P A;  2RDP A;  4JK1 X;  3WU0 A;  2D2W A;  3L9F A;  2HTS A;  3K1P A;  1LB2 A;  1OYW A;  1XGO A;  5LRR A;  4UV9 A;  4BXU A;  2ZKZ A;  1YS6 A;  2MA3 A;  1KGS A;  3D0S A;  3DEU A;  2X0L A;  5K5O A;  2EV5 A;  4ZYG A;  1FWZ A;  5D8L B;  2A07 F;  2PI0 A;  3E5X A;  2VT2 A;  4G6Q A;  3BZ6 A;  1ODD A;  5HDK A;  2P7C B;  1W7P A;  1B9M A;  3O2P E;  4IVN A;  3C1D A;  1LDD A;  1MJB A;  3DQV C;  4L0Z B;  2G7U A;  2XRN A;  5BOX A;  3CUQ A;  1J0R A;  5FD6 A;  2R7D A;  5DCM A;  2YSR A;  3DPT A;  1XGS A;  5CVU A;  4HA8 A;  1U78 A;  1R1U A;  5LRS A;  1AWC A;  3JAM Z;  1T98 A;  1QBJ A;  1FX7 A;  4ZZL A;  4Q48 A;  1K7A A;  2P6T A;  2ACJ A;  2XHK A;  2IVM A;  4KUM A;  2BE5 F;  4KIC A;  1O7F A;  2W25 A;  1W7P D;  4L9J A;  5E8G A;  2MD5 A;  1T0F A;  5LEJ A;  2GA1 A;  3OOP A;  2ZFW A;  6PAX A;  3DF8 A;  1PUE E;  3O3K A;  1Z91 A;  3KP6 A;  2PLY A;  3ZMT A;  1EH6 A;  2KIM A;  2K27 A;  3I59 B;  3ZMS A;  4HQE A;  1XCB A;  3GWZ A;  2DAO A;  1B9N A;  2P5K A;  2XV4 S;  2A69 F;  1UFM A;  4ASN A;  2FA5 A;  3IKT A;  3WGH A;  4LB5 A;  1G3W A;  1IAW A;  2EWN A;  2P5V A;  3WGG A;  1R1V A;  3N97 A;  1BM9 A;  5L3E A;  2M45 A;  4HYE A;  5LEK A;  2PBI A;  2ZNZ A;  5FLX Z;  2HFH A;  5JI6 A;  3V7S A;  4PCQ A;  4U0Y A;  2OQR A;  4U0V A;  3HSE A;  1OPC A;  2DBB A;  3JSO A;  3E6C C;  2QEN A;  2XKP A;  1IN5 A;  3ZMU A;  2FBK A;  4M6Y A;  1XMK A;  4OU0 A;  5LGT A;  4Q47 A;  4DQ2 A;  2JT1 A;  2O0Y A;  1ZYR F;  4KIB A;  2CWE A;  1R1T A;  3WTY C;  3L7W A;  4ESB A;  4IHT A;  1O7L A;  2RKH A;  2CQK A;  4N0B A;  3TDU C;  3QRF F;  4BHB A;  2VXZ A;  3I4P A;  2YR2 A;  1ZLK A;  3BRO A;  4BH9 A;  4LMY A;  3K2Z A;  4HDV A;  3ELK A;  3QP5 A;  2A5Y B;  4D0P A;  4A0X A;  4HF0 A;  2ELH A;  2DTR A;  3RYP A;  5LHH A;  1I1G A;  3TO7 A;  2PN6 A;  2GIV A;  2HQN A;  2FNA A;  3W6J B;  1B59 A;  1EV7 A;  3MQ0 A;  3WTV C;  3E5U A;  2A3S A;  4P9F A;  3CJN A;  3HOS A;  1FBS A;  4A0Y A;  1HKT A;  3E5Q A;  3HRS A;  4WX9 A;  3CO7 C;  3WGI A;  1HW2 A;  3ISP A;  5L3C A;  2ESH A;  4ZYE A;  3V7C A;  1K78 A;  4G7H F;  3HHG A;  4G6D A;  3N4M A;  5HDG A;  3H92 A;  3TQN A;  3GEZ A;  4IRG A;  2F5F A;  2VE9 A;  1T38 A;  4EM0 B;  1O3T A;  4MGR A;  1J75 A;  4BYY A;  4M9S A;  4KFC A;  2JPC A;  2FBI A;  2A6H F;  4ZH4 F;  2K7L A;  3FXU A;  3I0T A;  3RKY A;  2FOK A;  4CYD A;  1JXS A;  2K86 A;  3V8K A;  2F2E A;  1JE8 A;  4KIF A;  5CJ9 A;  2ZXJ A;  3E6B A;  2ZJ2 A;  5LGU A;  4I0B A;  2VBX A;  4BAY A;  5ERI A;  5KK1 A;  4CGZ A;  2H94 A;  3GF2 A;  3JTH A;  1F1Z A;  2DQR A;  1FOK A;  4CHU A;  1YS7 A;  2GAU A;  4L9N A;  2IW5 A;  2W84 A;  2P5L C;  2LDU A;  2BV6 A;  4S05 A;  4L9T A;  1IRG A;  3GZ6 A;  1GHC A;  1IZ1 A;  2LSO A;  4HV5 A;  4OIR F;  5JHU A;  2QQ9 A;  1J5Y A;  3I71 A;  2PMU A;  3LAJ A;  1PP7 U;  3CDH A;  4DNC A;  1BJA A;  5ICF A;  5E1X A;  4L18 B;  3TOA A;  5K5R A;  4KN7 X;  1J9I A;  1BI2 A;  3DKW A;  4ZYH A;  3FMR A;  4O5V A;  3CLO A;  4LK1 F;  2Q0O A;  2K4J A;  3C18 A;  3JAM K;  1FNN A;  3QU6 A;  1GXQ A;  2AXL A;  3GFL A;  4HX8 A;  4ENK A;  3TKY A;  2UZK A;  4XLN F;  2FQ3 A;  4PZJ A;  5ICE A;  4YFK F;  3M8E A;  4RB1 A;  1XMA A;  1RIO H;  1DPU A;  2PMH A;  1MZB A;  4LJZ F;  5H6R A;  1ZLJ A;  4UVA A;  1U2W A;  3BWG A;  3HYI A;  2RGV A;  3R4K A;  4IHS A;  4S04 A;  3Q9V A;  3LQR A;  3GUD A;  2HQR A;  5D5W B;  4GO1 A;  5CVJ A;  2V79 A;  2WTE A;  3TOB A;  4KA4 A;  1O3R A;  3F6O A;  2W57 A;  4RAY A;  1G4D A;  4KIG A;  4G94 A;  2WC2 A;  4LD5 A;  3ROU A;  3QU3 A;  3WTZ A;  3GVA A;  3OV8 A;  2ETH A;  1LDK B;  2QQA A;  1BIA A;  4M73 A;  4UVB A;  1CGP A;  3GLX A;  5CYV A;  4HLY A;  1YYV A;  1IF1 A;  1SD6 A;  2VC0 A;  1J2X A;  5HLG A;  5AON A;  2Z5U A;  1PDN C;  5FLX K;  3RPU A;  4PGG A;  5HLI A;  4A5M A;  2FEZ A;  1T2K A;  5L3G A;  5BMZ A;  4HDU A;  4MHG A;  3R0A A;  5LHG A;  1H0M A;  4BQA A;  1OKR A;  3R60 A;  1LNW A;  4AD9 A;  5D5U B;  3FZV A;  2RNJ A;  1XN7 A;  3SQN A;  3E6M A;  3LQQ A;  4M71 A;  3K69 A;  2IJL A;  4EVI A;  3IWZ A;  5ILU A;  2EA4 A;  4GXO A;  3SXY A;  1HKS A;  2KKO A;  2RVC A;  2E7X A;  1ZG5 A;  4XLP F;  2ZO4 A;  5CLS A;  4RB3 C;  3GFI A;  2EK5 A;  3GXO A;  4LGW A;  1VTN C;  2KJB A;  2FF4 A;  2PFB A;  5HVQ C;  4B8X A;  2O6G E;  1KU2 A;  1TBX A;  1SMY F;  3VB2 A;  4JQF A;  3P9C A;  3GYH X;  2ADU A;  1X3U A;  2CSO A;  1R5G A;  3FMS A;  1HST A;  2XAS A;  3KZY A;  2JPB A;  3KFW X;  3E6D A;  1CF7 B;  1SD5 A;  3EET A;  3LA7 A;  2O61 A;  3PQJ A;  4R8H A;  5LGN A;  3WG9 A;  4EGZ A;  2FRH A;  3DXJ F;  1U5T C;  4GGG A;  3I59 A;  5FFX A;  3DV8 A;  3WU1 B;  3I53 A;  2Q2E A;  4KDP A;  3G73 A;  1MJA A;  2OAZ A;  3KET A;  2XRO A;  1ZG1 A;  3HIF A;  3HUG A;  4CDG A;  1XGN A;  1TQP A;  2M8E A;  1V4R A;  2LF8 A;  2VE8 A;  5E20 A;  2RN7 A;  1IN4 A;  1RUN A;  5HS8 A;  3B73 A;  4AWX B;  3F3X A;  2Y0M A;  4ESF A;  2STW A;  2OBP A;  4MTD A;  4ZYD A;  2XUB A;  4LLL A;  5TJJ A;  4L0Y B;  5BQT A;  2HR3 A;  1WRJ A;  4ENJ A;  1KA8 A;  2M87 A;  4WXC A;  1QGP A;  2QYO A;  3BOQ A;  1ZH5 A;  2OQG A;  1MGT A;  4A5N A;  3VFZ A;  4NB5 A;  3NQO A;  4CO8 A;  3COA C;  2DU9 A;  4ON0 A;  4HOB A;  4G8X A;  2Z3Y A;  1QNT A;  2QZ8 A;  3FMQ A;  1LEB A;  1RZ4 A;  2CG4 A;  4XSX F;  3TO9 A;  3I5U A;  2Y75 A;  4RGR A;  4EM2 A;  5ICC A;  1TTY A;  2OA4 A;  4AIK A;  3QP6 A;  2D45 A;  4U0W A;  1DUX C;  4NHJ A;  1TW3 A;  3U9G A;  2XAG A;  2GA2 A;  4XSZ F;  4HV6 A;  2V6C A;  1R58 A;  3EDP A;  2OZU A;  5ILV A;  2L4M A;  1LEA A;  1YG2 A;  4R79 A;  2EFN A;  4ENM A;  1KQ8 A;  4YFX F;  1OYI A;  1C0W A;  3WE2 A;  1JHF A;  1HBX G;  2ZBK A;  4LB6 B;  3H3Z A;  2MLK A;  5D4S A;  3R6S A;  2QBY A;  2AS5 F;  3FX3 A;  2YX4 A;  1ZN2 A;  2FBH A;  1IXC A;  1W5S A;  2DO7 A;  3RKW A;  2FNP A;  1SFX A;  2XGX A;  4P5O A;  1IN6 A;  3V8L A;  1H9G A;  5F6F A;  4P9U A;  1U6G A;  3B02 A;  3HSR A;  4AVP A;  4QLC U;  3I54 A;  3BJA A;  3NRV A;  3JTG A;  3I58 A;  3ZMD A;  4BNC A;  5A2Q Z;  5JR3 A;  2VON A;  3WTW C;  2H6B A;  1J7K A;  2EFO A;  5DDG A;  3J81 K;  4WK8 F;  4EJT A;  1G3S A;  2XAH A;  1BOA A;  5E8I A;  4P96 A;  3K0L A;  5CVR A;  5ICG A;  5DUI A;  3IL2 A;  1STZ A;  3PFI A;  1I1S A;  2VOD A;  3AAF A;  2V1D A;  1ZAR A;  2P4W A;  3MFK A;  2QLZ A;  2HKO A;  2QQB A;  1SD4 A;  4I0A A;  4AIH A;  5KVR A;  1XGM A;  2MBF A;  4PGH A;  1P4A A;  2JZY A;  1K79 A;  2G9W A;  3GX4 X;  3KP4 A;  4YFN F;  1RUO A;  1O3S A;  4I7H A;  2M5W A;  1YFH A;  2CGP A;  1FT9 A;  1ZHF A;  5ED4 A;  4N9H A;  1YIO A;  3ZPL A;  4MQ9 F;  2KIF A;  5JVT A;  2STT A;  2FU4 A;  2VN2 A;  2HTJ A;  1OR7 A;  2IRF G;  2OD5 A;  1XDU A;  3WTT C;  2MH2 A;  1OMI A;  4HX7 A;  3ERE D;  2PG4 A;  4HF1 A;  1J59 A;  1FYL A;  2XVC A;  3HOT A;  4N9I A;  4KYW A;  4OMY A;  4Y15 A;  2GWR A;  5DD4 A;  3GFJ A;  5BPD A;  3KP5 A;  2RQP A;  4O6J A;  3RPQ A;  2W24 A;  2ESN A;  4M6X A;  4OIP F;  2P6S A;  1MDM A;  1UB9 A;  2J5O A;  2K4B A;  1KU7 A;  1U5T B;  4ESJ A;  2DQL A;  3LA3 A;  1E17 A;  1FC3 A;  3LST A;  4UNO A;  1R7J A;  4KT5 C;  2HS5 A;  2BEO A;  3IHU A;  3HTS B;  1FSE A;  5EEG A;  3MWM A;  3DFG A;  2GXG A;  2EFQ A;  1IXR C;  4RAZ A;  4UVC A;  1E2X A;  3ECH A;  4YIF A;  4ENN A;  2IA0 A;  1FP1 D;  1PP8 F;  2ISZ A;  3CUQ C;  3IWF A;  1TQI A;  5BS6 A;  1AOY A;  2F5D A;  2F5C A;  1SMT A;  2OU2 A;  1ZRE A;  4EJW A;  1BBY A;  4Z2Y A;  4UHT A;  2HZT A;  5CVI A;  3ML6 A;  4WCG A;  2L3D A;  1D8J A;  4K2E A;  2NYX A;  2XAF A;  3G3Z A;  2YPR A;  2E1C A;  1SAX A;  4ETS A;  3M1E A;  3RIR A;  1IXS B;  2BBY A;  2MLG A;  1FYK A;  3KZZ A;  1RNL A;  1UHW A;  2MC3 A;  1L0O C;  1S7O A;  2RC4 A;  3PQK A;  3Q5F A;  2VBY A;  3RJP A;  2A6E F;  5LBQ A;  2WV0 A;  2V1U A;  4RS8 A;  2HWV A;  4HBL A;  1BI0 A;  1Y0U A;  4XRF A;  1BIB A;  2XAJ A;  3IKV A;  4LG0 B;  1KYZ A;  1V3F A;  1NHA A;  2RV8 A; 
#chains in the Genus database with same CATH topology
 2HVR A;  2W82 A;  2QKL B;  3HRT A;  5HLH A;  4EMS A;  2ZXW H;  3A01 A;  4UUV A;  5BPI A;  1Z6T A;  1E0E A;  3F8C A;  3KLO A;  2OZ6 A;  2Z33 A;  1MD0 A;  1WKM A;  4IHV A;  1S6L A;  5E18 F;  1WZ2 A;  4CCJ A;  3JRA A;  3GTP J;  3C3W A;  2OPT A;  4B44 A;  3BPV A;  4X1E A;  3MKW B;  3K6G A;  1DP7 P;  1MMA A;  2CFX A;  1KQ0 A;  4XKW A;  3M9A A;  2R4G A;  4E7K A;  2Q8K A;  3J80 Z;  4J19 A;  4MTE A;  4CIC A;  5FLV A;  4GRI A;  1HQC A;  4XKC A;  4EM1 A;  1Y1V J;  3M1C A;  4A6D A;  3PO3 J;  4BE2 A;  4FE7 A;  1GXP A;  2QWW A;  3RYR A;  2ZJR F;  2MYS A;  1V54 H;  3F8F A;  3VOE A;  3F8M A;  2PJR B;  1BC8 C;  4JYK A;  2L7F P;  4E70 A;  2L54 A;  1CF7 A;  3OIQ A;  4M3E A;  5K7H A;  2H1L A;  2LK2 A;  2JUG A;  4OIN F;  4O3M A;  5DCF A;  1LVA A;  3QOD A;  2W1O A;  5H2F C;  1JJ6 C;  5E1Z B;  4B48 A;  1IN8 A;  3NWT A;  5F0F A;  1ITY A;  2VUM J;  3C7J A;  5K1Y A;  3J7A O;  1A31 A;  3ECO A;  1TNS A;  4B47 A;  3PM1 A;  3WOD F;  5IT9 Z;  4FHT A;  4BKX A;  1R5H A;  4EQQ A;  5FKL A;  2PEX A;  5FRO A;  4Y17 A;  2DK8 A;  4WXH A;  4P1W A;  1ZRD A;  3PUF A;  5GTI C;  4II2 A;  4Q5S F;  4WXD A;  1QQI A;  2X9D A;  3DU5 A;  1U8R A;  4NBQ A;  3T1B A;  1X1C A;  4XLH A;  4RGU A;  5JLX A;  3UNG C;  3ZQ7 A;  4C2U A;  1WQ2 A;  4UB6 C;  2BYV E;  2WAQ N;  3LNQ A;  2LFB A;  2NS0 A;  1MIJ A;  2WY7 Q;  3ABK H;  3L00 A;  3BC8 A;  5EG0 A;  4IXA A;  4L5J A;  3PL8 A;  1DPR A;  3H5N A;  2QSG X;  5AIP A;  3IH3 A;  2DLL A;  2E34 A;  3T5X A;  4HQM A;  2DDB A;  4JX6 A;  1IN7 A;  1W4M A;  3FBI B;  3OYJ A;  4DOZ A;  5H6Q A;  4GYG A;  2M1B A;  1R22 A;  4HNV A;  1O57 A;  1ZR2 A;  1LQ1 A;  1G3Y A;  3J7Y J;  1G6N A;  1TLH B;  5D5V B;  2F4O B;  2ZME B;  5GAE J;  1K6O A;  3KP2 A;  3HKZ A;  5E3O A;  5DM6 F;  2CS3 A;  2DJN A;  4XN3 A;  2X51 A;  3VOD A;  1IRF A;  1WWX A;  5A2Q K;  3L2C A;  3RI4 A;  4ZTF A;  4KT6 A;  3SYT A;  3P9I A;  2E1M C;  2TDX A;  3TO6 A;  4LFU A;  1S29 A;  1YX3 A;  3GO5 A;  1R49 A;  2R7X A;  3ULQ B;  2NVY J;  3BJ6 A;  3KEY A;  4H0E A;  2JRT A;  4D9J A;  4EJU A;  3JRE A;  3OYK A;  2L7Z A;  2DDA A;  2KIS A;  2PJP A;  3BPX A;  2C6Y A;  5D8K B;  4ABZ A;  3ABU A;  1P9Q C;  2DJI A;  3ABM H;  3GTJ J;  1TT0 A;  3CMM A;  5JFR A;  1FTZ A;  1BN5 A;  1NK2 P;  4OOI A;  2YX7 A;  3HOX J;  2O5R A;  3FIW A;  5HS7 A;  3SFI A;  3HOW J;  3O6B B;  1Q1H A;  4Q4Z F;  5HOO A;  4F92 B;  2OV7 A;  1R00 A;  1TC3 C;  4BJ6 C;  2GBY A;  4BHC A;  5IY5 H;  3C2H A;  4AIJ A;  3E0J B;  4MEX F;  3H3U A;  2IGN A;  2VT3 A;  1ETY A;  1JKR C;  3MVP A;  4C2T A;  1T08 B;  1SVO A;  3FM3 A;  1WH7 A;  2HDW A;  1I6X A;  4PDK A;  5K7Z A;  2EZH A;  1DDN A;  2Y48 A;  1KQ9 A;  2DFF A;  4LIT A;  3CJQ B;  1G3T A;  2LOO A;  1B4A A;  3WE3 A;  4ZZD A;  3DEW A;  2GZW A;  1ETQ A;  2O03 A;  1WJ5 A;  2L7M P;  3RKX A;  4WWC A;  1H88 C;  2V9P A;  3OSF A;  2L9S A;  3V7R A;  3HM5 A;  1TNT A;  4CUG A;  3A1Y A;  1X1D A;  3RKQ A;  1N78 A;  1I39 A;  1ZGA A;  3S15 J;  2X4H A;  1P7I A;  2R7F A;  5J47 A;  2R93 J;  4OAZ A;  2LVS A;  1P4W A;  3SJM A;  2EH3 A;  5FB2 A;  2Z9O A;  4KMF A;  3ZQQ A;  2NVQ J;  2NAZ A;  3HSF A;  1V55 H;  4M9X A;  2WWY A;  2ZXH A;  1SD7 A;  4M72 A;  1R23 A;  2EV6 A;  1UCR A;  3M7G A;  2HVS A;  3HEF A;  1HXD A;  5D5X B;  1YW8 A;  2D5V A;  4PJM A;  2ME6 A;  1QPI A;  3E97 A;  4FX0 A;  1FPQ A;  1X3Z B;  1E3H A;  2HQA A;  2NRA C;  1BI1 A;  2IA1 A;  2LKP A;  3BZK A;  4U87 A;  1N77 A;  3KEQ A;  2NS7 A;  5DEQ A;  3P7N A;  4BQO A;  2G7H A;  1Z6R A;  3SZP A;  2HDC A;  2XSJ C;  3K1M A;  3IH2 A;  5JHF A;  1W7P B;  2N8G A;  2P8T A;  5LLQ A;  1FMV A;  1HSJ A;  2IPQ X;  5L3D A;  3OYI A;  1MBE A;  3HRU A;  2BGC A;  2TCT A;  5FKM A;  2F5E A;  2ZNY A;  3F8N A;  3CUQ B;  1JUS A;  2P7V B;  2QGU A;  1TQM A;  1W5T A;  2R5Y A;  2D1V A;  3H0D A;  1S3J A;  3FHN A;  1U3E M;  1WHU A;  5DCM B;  4M9Z A;  4FX4 A;  3TL4 X;  2COM A;  1Z9C A;  3HGY A;  2Z99 A;  3QYF A;  4A12 A;  4OMZ A;  1YTY A;  4JX5 A;  1B72 B;  3DP7 A;  2L0K A;  3H0G J;  4FAS D;  3CP2 A;  2E2I J;  1OFC X;  3LA2 A;  1ULY A;  1HKQ A;  1Z7L A;  1XDS A;  3S8P A;  3MZH A;  2L01 A;  2DOD A;  2CV2 A;  3CJT B;  4RB0 A;  3U1D A;  2XSD C;  5F1R A;  3A0H C;  3BR5 A;  2JSC A;  3Q9S A;  5GTH C;  2NS8 A;  2UXN A;  1YRN A;  1XTA A;  2WB1 N;  2RAE A;  1A04 A;  2R7T A;  3DKX A;  3D5L A;  4F7Z A;  4CA0 A;  2CYY A;  2R7W A;  2JVG A;  3LSG A;  2M30 A;  3G1O A;  3FHZ A;  2IT0 A;  4G7O F;  3F6V A;  4BQN A;  1TW2 A;  3H1C A;  1V5E A;  1O3Q A;  1FBU A;  1ZKG A;  4M3D A;  4P55 A;  2EA2 A;  2EPF A;  3KYC B;  2MH9 A;  4IKF A;  1YQA A;  3OYM A;  4RA2 A;  1QA6 A;  1FBQ A;  2HKX A;  2JJ7 A;  2EFP A;  1EH7 A;  2WAQ A;  3Q3S A;  1IC8 A;  1QRY A;  1REP C;  1K6Y A;  1LJ9 A;  3PSI A;  4DZP A;  5K7F A;  2K02 A;  1FYM A;  2ECC A;  2CMP A;  3C2B A;  5B1A H;  1P92 A;  1SFE A;  2FSW A;  1Z05 A;  5TRD A;  1IV6 A;  1OLT A;  2AQE A;  3DLL F;  2UUZ A;  2CO5 A;  1ON1 A;  4UUT A;  3MZ8 A;  3MCZ A;  2XAQ A;  2E7W A;  1R36 A;  2DFI A;  1YO5 C;  4A3F J;  3ZXS A;  3IV5 A;  3EYY A;  3L09 A;  4R1H A;  2R3S A;  2XGC A;  4FTH A;  1YI2 I;  1USS A;  4A6E A;  5HDN A;  1B8I B;  3LSP A;  3OYA A;  4BJ5 C;  5IPA A;  3IRQ A;  3LAP A;  4MIM A;  2H09 A;  5FO5 A;  1T6S A;  3BR1 A;  1YW7 A;  3LFK A;  4G7Z F;  1NG7 A;  3ABT A;  4E7S A;  4DBR A;  3KE2 A;  1S7A A;  4BEH A;  3HJE A;  4LIU A;  3NEU A;  3S2W A;  9ANT A;  4PFO A;  4A3C J;  2VJJ A;  2A61 A;  3I64 A;  3GFM A;  3G4S I;  5AIQ A;  1GVD A;  1WJD A;  4RM3 A;  3P9K A;  2KJC A;  3REO A;  1NK3 P;  1S7E A;  3I55 I;  4IZZ A;  4I2O A;  5TGT A;  1XX5 A;  1OCO H;  4NC7 A;  1YJ9 I;  1VQ5 I;  3OY9 A;  3SDG A;  4E4H A;  1HDP A;  4BXX J;  3MAJ A;  1VF9 A;  5FJ8 J;  1DU0 A;  3E3V A;  1P2F A;  1IG7 A;  1WI3 A;  3ESW B;  3FXR A;  1ZRC A;  2RQQ A;  4FCY A;  4B09 A;  1I27 A;  2EJR A;  3NAU A;  4I98 B;  3PIO F;  2OC6 A;  4B3A A;  2HXI A;  4ZJZ A;  2L4A A;  2XDV A;  2R5Z A;  2DTZ A;  2V7F A;  2V1X A;  3CF5 F;  3BG6 A;  3PJR A;  3CMY A;  2F5V A;  1P6R A;  4KNY A;  2EFW A;  4DGW B;  1RI7 A;  2BW3 A;  5EYR A;  1PUF A;  1U0J A;  4Y13 A;  4AYB A;  4IJA A;  1F9N A;  3B6A A;  3BY6 A;  3WHC A;  4UV8 A;  3CTA A;  2EZK A;  1KYW A;  3BJO A;  1ON2 A;  1D3Y A;  4A2U A;  2BHZ A;  4ITV A;  4DYQ A;  2XC7 A;  4L9V A;  4YEL A;  3LFU A;  3RDI A;  3S2D J;  2JA2 A;  3QQA A;  3J80 K;  2DT5 A;  1U5T A;  4XK4 A;  2L02 A;  1H9T A;  2I8D A;  1OIS A;  2QBY B;  1ORK A;  3HG9 A;  2A6T A;  2E5Z A;  2FD5 A;  3H9G A;  2JA6 J;  3MEX A;  3F72 A;  2LY2 A;  2E5N A;  4YII A;  5B66 C;  3KEO A;  2ISY A;  1ZR4 A;  1BA5 A;  1YLF A;  3DPL C;  3GME A;  1UST A;  5D6E A;  4XIC A;  3LSM A;  1GVJ A;  1MMN A;  2KHM A;  5EZG A;  2ZSH B;  3SFZ A;  5LFA A;  4EEF G;  2JTV A;  1MMS A;  2QVO A;  3IAM 2;  2IAI A;  3ONQ A;  1X1P A;  5FFZ A;  2B0L A;  3OYN A;  3V4G A;  2Q1Z B;  5IT9 K;  1ONV A;  3SZT A;  3TDZ C;  4A3I J;  1UHM A;  3FM5 A;  3R61 A;  1LPQ A;  1Y1W J;  3ZN0 A;  4QWQ A;  3VYR B;  2KRH A;  4F93 B;  2LH9 A;  4KN4 X;  2ZB9 A;  1QPM A;  1VQL I;  3ZP5 A;  2O3F A;  4BHP A;  4LK0 F;  2VLA A;  1WJB A;  4JBA A;  4HLX A;  3OYF A;  2K3P A;  4FT8 A;  4CCO A;  4EV0 A;  4QTR A;  3RCO A;  1M1E B;  1FLI A;  2E1M B;  5J6X A;  3BR3 A;  3Q0W A;  2LBF B;  3OWT A;  1I5Z A;  1S9H A;  2W4S A;  4CXF A;  3BQZ A;  4M6V A;  1XSV A;  2CW0 F;  4KMU X;  4HG2 A;  3JSP A;  4PJL A;  5FD5 A;  2MFZ A;  5EEH A;  3KX2 A;  5HS9 A;  3K1N A;  2KRF A;  1BC7 C;  3KYD B;  4EJV A;  3Q0U A;  2H27 A;  1XB4 A;  3CO6 C;  2NNY A;  1F4K A;  1FTT A;  4RGS A;  1XMX A;  2VBW A;  5J8C A;  4G6T B;  4UXN A;  5L3F A;  1FY7 A;  1ETK A;  2LTP A;  1D0Y A;  3JW4 A;  2R7O A;  2IA2 A;  3ABL H;  1ZGJ A;  3HHH A;  3FXL A;  5F64 A;  2KDZ A;  3VDX A;  1RKT A;  2WB1 A;  3RZO J;  5C4J J;  4CZZ A;  3PNY A;  1D8K A;  3OOU A;  3PNT A;  2O8K A;  3I4M J;  1JHH A;  4L5I A;  4F55 A;  3AG3 H;  4U7B A;  1WI9 A;  1K78 B;  2A68 F;  3BG5 A;  1DGR M;  2DOE A;  3BCB A;  2E71 A;  2V9K A;  1T56 A;  2K3F A;  4DYC A;  4F52 A;  3T8T A;  3JRB A;  2FML A;  3A02 A;  2O8X A;  2G0E A;  2QM3 A;  4I09 A;  3K4K A;  4XRS A;  1WSU A;  2D1H A;  3ZQH A;  4EGY A;  2DW4 A;  1UZC A;  4LG0 A;  3O8G A;  3R0J A;  3F23 A;  3OIP A;  1POG A;  5LHI A;  3V42 A;  2EV0 A;  1EH8 A;  1ZG3 A;  3BLY A;  3KP7 A;  1BJZ A;  4XR6 A;  2W85 A;  4EJO A;  3VEP A;  1QO0 D;  5F0C A;  5J8F A;  1SFU A;  2XIG A;  2HYF A;  3FXJ A;  5GPA A;  2HOE A;  2BY2 A;  1JJ8 C;  4OIQ F;  1DU6 A;  4RGX A;  1MW7 A;  4HF2 A;  3K9T A;  3HRM A;  4I01 A;  2KIU A;  5H20 A;  2HOT A;  1QHH D;  3ZN1 A;  3CUO A;  4Y4R A;  1JGS A;  2VOP A;  1Z21 A;  3U2R A;  4U88 A;  3QPL A;  3ZQF A;  2BXY A;  2FE3 A;  2IXS A;  2LF7 A;  3KP3 A;  3W6K B;  2K9Q A;  3RTR A;  4PSW A;  1Z1D A;  3HTU A;  4AVZ A;  2NNN A;  2NVX J;  2BXZ A;  2RRE A;  3OYG A;  2VAS A;  1X1B A;  1SC7 A;  2O9L A;  5D6F A;  4BE0 A;  4UY8 I;  4OAY A;  3OYB A;  3FXQ A;  2UWM A;  5DUK A;  4HX4 A;  1R4N B;  4TV7 A;  3KCC A;  4MQV A;  4XOR A;  2DK5 A;  1OYY A;  3DPU A;  2PJR A;  3QPH A;  3KLN A;  1DGW Y;  1KU9 A;  1MDM B;  3HPG A;  4IPA A;  1ZRF A;  3SHF A;  1D5V A;  1WVR A;  1LDJ A;  2VQG A;  3IRR A;  2CQN A;  4HRI A;  2V9V A;  4C2M J;  2LC2 A;  4NUB A;  3F22 A;  2HEO A;  1ZK8 A;  4YG2 F;  2GOM A;  2LMD A;  4GCV A;  1IUY A;  5K5Q A;  1QZY A;  2LNB A;  1ZAO A;  5F08 A;  2CV0 A;  3W3C A;  1MMG A;  3QPT A;  3QAH A;  3EUH A;  3TGN A;  1K83 J;  4LLG F;  4RB2 C;  2VC1 A;  1L3L A;  3T8R A;  3WTX C;  3O8H A;  5DD8 A;  4NQW A;  2RNG A;  5BNG A;  5DYM A;  1KU3 A;  2FXA A;  3S3N A;  2HYG D;  2IP2 A;  5FGM A;  3X2Q H;  2QUF A;  3ASN H;  4IRI A;  4M74 A;  4BY1 J;  2LYC A;  1FIP A;  2YU3 A;  4HAM A;  4A0Z A;  3ZMZ A;  3WTS C;  4MEY F;  2V4J C;  1Z67 A;  3GW2 A;  3FWE A;  2MC4 A;  4HZF A;  3V8J A;  5CPR B;  5KAI C;  2JWT A;  2GLO A;  2VBZ A;  5ILS A;  2MW8 A;  3J81 Z;  2VOO A;  5E17 F;  4IRH A;  2OCC H;  5DV5 A;  3BDD A;  2VPL A;  3FBN B;  1B6A A;  4A3J J;  1FSH A;  2PQ8 A;  4HPQ A;  3LWF A;  3K70 D;  5E1W A;  4FE4 A;  3JCU C;  2DA7 A;  2H6C A;  4OWR B;  2XRL A;  2XKO A;  1HF0 A;  1F5T A;  2ECB A;  1XSX A;  2Y9Y A;  4IF4 A;  4LLN A;  3HL2 A;  1XD7 A;  2HNH A;  3EQL F;  1WH5 A;  2PX9 A;  2JK3 A;  3ZMV A;  3M8J A;  1XSD A;  1IW7 F;  1A35 A;  4MNU A;  3BP8 A;  1XCV A;  1QZZ A;  2ZME A;  3MD2 A;  4WF2 A;  5FRM A;  5IT3 A;  1W1W E;  2EB7 A;  4XQF A;  2P0W A;  1F43 A;  2HU9 A;  1MJ9 A;  2ZXI A;  3KPH A;  4U7D A;  2E1N A;  2IEK A;  2JN6 A;  3FF5 A;  2DPU A;  5DM7 F;  1HW1 A;  3JRH A;  3FK6 A;  1HW5 A;  1TWA J;  1J09 A;  1BI3 A;  4G9Y A;  2UXX A;  5CVV A;  2ID6 A;  3EYI A;  3IC7 A;  1OCZ H;  1P7J A;  3S1N J;  1W36 C;  4XBF A;  2ZCW A;  4HW0 A;  2YS9 A;  1P4X A;  4MFD A;  1WJF A;  3W2V A;  1JTY A;  3H3V K;  2FMY A;  5D4R A;  3M8F A;  4B43 A;  2MSY A;  1IRZ A;  3F21 A;  2E1O A;  1S8N A;  4OIO F;  1TWF J;  1B1B A;  4CCK A;  2DPD A;  4RM2 A;  1FZP B;  2ZJQ F;  1YIT I;  1FP2 A;  2HGC A;  3F8B A;  3A2K A;  3BTC A;  5L3B A;  3WTU C;  3S3O A;  1Z7U A;  4I02 A;  1MKM A;  1X4O A;  2GXB A;  4BAC A;  1Y8R B;  1T39 A;  1A5J A;  2GQQ A;  3GZ5 A;  4GYI A;  3QYE A;  2DI3 A;  3QOP A;  1RR7 A;  3TED A;  3ZCO A;  1YW9 A;  1EKE A;  4RAF A;  4HEA 2;  3GTL J;  5EF6 A;  4D1Q A;  3GTM J;  3IAS 2;  4PK4 A;  3HXL A;  3MZY A;  3BTJ A;  3U21 A;  3T0Y A;  4MFE A;  4CCN A;  1D1B A;  2DA2 A;  2J5P A;  3MKZ A;  2RDP A;  4JK1 X;  3WU0 A;  2D2W A;  3L9F A;  2HTS A;  3K1P A;  4D7N A;  1LB2 A;  1OYW A;  2NVT J;  1XGO A;  5LRR A;  2Z2S B;  4UV9 A;  4BXU A;  2XGD A;  3CMA I;  2VPR A;  4BJT A;  2F4M B;  2ZKZ A;  5J1R A;  2XB0 X;  2JSP A;  2EZI A;  5GAH J;  3BT9 A;  1I6H J;  3CCL I;  1YS6 A;  1N25 A;  4C3I J;  2HDD A;  2L9V A;  2MA3 A;  2M0C A;  1KGS A;  3D0S A;  5EZH A;  3RQ4 A;  4CYC A;  3BG7 A;  3DEU A;  2X6X A;  2GIZ A;  3I9V 2;  2DOF A;  3F0C A;  3BZC A;  4HNT A;  5EGO B;  2X0L A;  5K5O A;  2EV5 A;  4ZYG A;  1FWZ A;  5D8L B;  1EJ9 A;  2DYS H;  2A07 F;  2PI0 A;  3S1Q J;  3E5X A;  2VT2 A;  3ZQC A;  4G6Q A;  4A3G J;  2LY1 A;  2MGQ A;  3BZ6 A;  2HVQ A;  1ODD A;  2E35 A;  4UB8 C;  5HDK A;  3OSG A;  4NDL A;  2P7C B;  3OL4 A;  3KIO A;  1VQ8 I;  1W7P A;  1K4S A;  3DTE A;  1B9M A;  3O2P E;  4IVN A;  3C1D A;  1LDD A;  5GAG J;  1MJB A;  3DQV C;  3VYT B;  3UKG A;  4L0Z B;  2G7U A;  2XRN A;  2VKE A;  1VZ0 A;  4XLC A;  3BR2 A;  5BOX A;  3CUQ A;  2OTL I;  5C3E J;  1J0R A;  2EIK H;  2KZG A;  5FD6 A;  3CLQ A;  5IP7 J;  2WAE A;  2Y9Z A;  4BL0 B;  2XPV A;  2R7D A;  5DCM A;  4C30 A;  4XOP A;  1ETW A;  2YSR A;  3DPT A;  2X6O A;  1XGS A;  1IDY A;  4HA8 A;  4XMY A;  5CVU A;  1U78 A;  1GV2 A;  1IRX A;  2L9N A;  5IOZ A;  3OYC A;  3GTQ J;  5TIS C;  1OR7 C;  3AG1 H;  1R1U A;  5LRS A;  2MG4 A;  4L5E A;  4QPO A;  3JAM Z;  1AWC A;  1I50 J;  1T98 A;  2IBD A;  3DBL B;  4CCL A;  1QBJ A;  4Y33 A;  3K4J A;  1FX7 A;  1XC5 A;  4ZZL A;  5M5Y J;  4Q48 A;  1K7A A;  4XID A;  1NH3 A;  3E1S A;  2OF7 A;  2M0M A;  2P6T A;  1TL8 A;  2ACJ A;  3GTO J;  2XHK A;  2IVM A;  2XF5 A;  3K7A J;  4KUM A;  2EIM H;  4ZC3 A;  2BE5 F;  4KIC A;  1O7F A;  2O7O A;  4D7M A;  2W25 A;  1W7P D;  4L9J A;  1ERD A;  3IH4 A;  5B1B H;  2CW8 A;  5E8G A;  4XRM A;  3CCQ I;  2MD5 A;  4KJZ A;  3GLL A;  2ZFU A;  1T0F A;  4IQJ A;  2E19 A;  5LEJ A;  1X4P A;  2GA1 A;  3OOP A;  2ZFW A;  5CKT A;  6PAX A;  2BVL A;  3L2W A;  3DF8 A;  5HNH A;  1PUE E;  3O3K A;  1Z91 A;  1HDD C;  3KP6 A;  2PLY A;  1X2N A;  3ZMT A;  3OYD A;  4A3B J;  2E2J J;  2BZT A;  3DU6 A;  1EH6 A;  4IHX A;  2KIM A;  2I10 A;  2K27 A;  3I59 B;  2MAB A;  3L2V A;  2YU9 J;  3ZMS A;  4HQE A;  1XCB A;  2M9H A;  2XB5 A;  3GWZ A;  2DAO A;  3LSR A;  2R7U A;  1WFX A;  2Q2E B;  5FLM J;  2YUS A;  1VQN I;  5IP9 J;  1ZTR A;  4BBS J;  1B9N A;  2OCE A;  3ERM A;  2P5K A;  3BG3 A;  2XV4 S;  2A69 F;  1UFM A;  3HUG B;  2OTJ I;  1JT6 A;  3VSL A;  4ASN A;  5HOD A;  4E7Z A;  2XF6 A;  2FA5 A;  5FKO A;  3IKT A;  3WGH A;  1D1C A;  4LB5 A;  1H89 C;  1G3W A;  1IAW A;  2EWN A;  2P5V A;  2KRC A;  4B3X A;  3CDL A;  3WGG A;  5KAF C;  1R1V A;  2NXN B;  2R0Q C;  3N97 A;  1BM9 A;  5L3E A;  2M45 A;  1A36 A;  4HYE A;  2LKX A;  4IL6 C;  1ETO A;  2Y0S N;  3CCU I;  4IX7 A;  5LEK A;  2PBI A;  2ZNZ A;  2JQ7 A;  5FLX Z;  1JKP C;  2HFH A;  3HC7 A;  5JI6 A;  5CQE A;  3V7S A;  3PIP F;  4PCQ A;  2VJ5 A;  2NOJ B;  5EJC A;  4U0Y A;  2OQR A;  4U0V A;  3HSE A;  3DBH B;  1OPC A;  2DBB A;  5GPC A;  3JSO A;  3E6C C;  2QEN A;  2XKP A;  1IN5 A;  3OL3 A;  3ZMU A;  5HNF A;  2VQC A;  2FBK A;  4M6Y A;  4Z6Y A;  1XMK A;  1Y8Q B;  4OU0 A;  5LGT A;  3JR9 A;  4Q47 A;  4DQ2 A;  5J1Y A;  2JT1 A;  4QPQ A;  3HDD A;  2O0Y A;  3K70 C;  3QPS A;  1ZYR F;  4KIB A;  4UUS B;  2CWE A;  1BR4 A;  1R1T A;  4S0H B;  3WTY C;  3L7W A;  1MND A;  2CUE A;  2VJ4 A;  2DA5 A;  4ESB A;  1T8I A;  1CQT A;  2XGE A;  4IEJ A;  3ZQL A;  3S32 A;  4IHT A;  4A93 J;  1O7L A;  3DBR B;  2RKH A;  4B1R A;  1U9N A;  2KLO A;  2AHQ A;  4XM3 A;  1PVE A;  2CQK A;  1ZGW A;  4N0B A;  1OCR H;  3TDU C;  3QRF F;  4BHB A;  2VXZ A;  3I4P A;  2YR2 A;  2XF7 A;  1ZLK A;  3BRO A;  1APL C;  2FUG 2;  4LOC A;  4BH9 A;  2KZV A;  3CF2 A;  2ZJP F;  4E7L A;  4LMY A;  3K2Z A;  3VYU B;  3M3Y J;  4HDV A;  3ELK A;  3A0B C;  5J4V A;  2BY1 A;  2CH0 A;  3C2G A;  3QP5 A;  2LRE A;  5GAD J;  2A5Y B;  4D0P A;  4X0G A;  3OYL A;  4A0X A;  2V26 A;  2R7Z J;  2COB A;  2BY3 A;  4HF0 A;  2ELH A;  1RPW A;  3S93 A;  2L7K A;  2DTR A;  3OMY A;  1YRN B;  4MLO A;  5J4Y A;  1JGG A;  1WPK A;  3RYP A;  1H8A C;  5E3N A;  3CME I;  5LHH A;  1I1G A;  3TO7 A;  3HOY J;  3BG9 A;  2PN6 A;  4DW6 A;  2GIV A;  3MN2 A;  2LBF A;  3K10 A;  2HQN A;  2L9R A;  3L2R A;  4NNJ A;  2FNA A;  3W6J B;  4A3D J;  1B59 A;  1EV7 A;  3H35 A;  3MQ0 A;  3WTV C;  3E5U A;  2A3S A;  3LOC A;  4XOT A;  3JRF A;  4P9F A;  1Z0X A;  3CJN A;  3LSK A;  1IDZ A;  3G6E I;  2GM4 A;  3DEE A;  3JRD A;  4C3J J;  3HOS A;  4XNF A;  1FBS A;  1D5Y A;  4A0Y A;  1HKT A;  2QF7 A;  1UJ8 A;  5KNL A;  2IGK A;  3LL7 A;  3E5Q A;  3HRS A;  1LVK A;  4WX9 A;  5LD2 C;  3K4L A;  1JUP A;  1TWH J;  3CO7 C;  3JRI A;  4IOC F;  1WJA A;  3WGI A;  2BVM A;  1HW2 A;  1BL0 A;  1VI0 A;  3ISP A;  1G2H A;  5L3C A;  2VIX A;  4J01 A;  2ESH A;  1V5F A;  4ZYE A;  5CQG A;  3V7C A;  1K78 A;  2Z16 A;  4G7H F;  3OIO A;  4I76 A;  2QQ8 A;  3HHG A;  4G6D A;  3N4M A;  5HDG A;  3I3L A;  3H92 A;  4ZDL A;  1BR1 A;  3TQN A;  2ME0 A;  4BBR J;  3GEZ A;  4IRG A;  2F5F A;  3SEQ A;  2VE9 A;  1T38 A;  4EM0 B;  1HC8 A;  1QU3 A;  1O3T A;  1OCC H;  4MGR A;  4F91 B;  1J75 A;  3PNV A;  4ZDO A;  2DXI A;  4BYY A;  4M9S A;  1GV5 A;  4KFC A;  2JPC A;  4AU7 A;  4PJ0 C;  3S17 J;  1WCM J;  2QSH X;  2QEX I;  4CH7 A;  2FBI A;  1BOB A;  2BOL A;  3TP0 A;  2A6H F;  4ZH4 F;  3EPZ A;  2K7L A;  3CCJ I;  5IYD J;  3FXU A;  3RQI A;  2QA4 I;  3I0T A;  1VFC A;  3RKY A;  4FQG A;  2FOK A;  1LFB A;  3HGG A;  4E7J A;  5JVG F;  2HPM A;  4CYD A;  1JXS A;  2K86 A;  3V8K A;  2HOS A;  3J7A Y;  2F2E A;  2IS6 A;  2B63 J;  1JE8 A;  3RSN A;  2Y31 A;  4W97 A;  4KIF A;  5CJ9 A;  1IO2 A;  1BR2 A;  4M3G A;  2ZXJ A;  4XON A;  4PJN A;  3E6B A;  2ZJ2 A;  1RET A;  2DA1 A;  1VQ4 I;  5LGU A;  4KIS A;  1F36 A;  4RMN A;  3HPH A;  4I0B A;  5IYB J;  2VBX A;  1JUM A;  3HB9 A;  4BAY A;  2CUJ A;  5ERI A;  5KK1 A;  2EIJ H;  5JLW A;  2CRG A;  1DQU A;  4CGZ A;  4XLE A;  2H94 A;  2X1D A;  3GF2 A;  1AA7 A;  3JTH A;  1F1Z A;  2DQR A;  2VL8 A;  1FOK A;  4CHU A;  1MNE A;  1ZEL A;  1YS7 A;  2Y0S A;  3PFY A;  1AKH B;  2GAU A;  4L9N A;  5B5E C;  2LLK A;  5J3L A;  2IW5 A;  1X58 A;  2F4I A;  1WJC A;  2LD5 A;  1X2M A;  2W84 A;  2P5L C;  2LDU A;  1QZE A;  2BV6 A;  1AU7 A;  4FET A;  1SAN A;  2DMU A;  4S05 A;  4L9T A;  2X48 A;  1IRG A;  1SVM A;  1RRJ A;  3GZ6 A;  3RZD J;  2CQX A;  1GHC A;  4RAG A;  1UAA A;  1IZ1 A;  2LSO A;  4HV5 A;  1MBF A;  2W48 A;  1IJW C;  2HI3 A;  4OIR F;  1VQP I;  4J00 A;  5JHU A;  1HA8 A;  2QQ9 A;  3W6V A;  1J5Y A;  1HCR A;  2CQQ A;  3I71 A;  1AHD P;  2PMU A;  3LAJ A;  1PP7 U;  2DA3 A;  3CDH A;  3BTI A;  4DNC A;  1BJA A;  2QCO A;  2DT6 A;  4IOA F;  3D1N I;  2VB6 A;  2KL4 A;  2CUF A;  5ICF A;  4IO9 F;  5E1X A;  2M3A A;  5M3M J;  4L18 B;  3TOA A;  1U9O A;  4N4O B;  5K5R A;  4KN7 X;  1X19 A;  3OS1 A;  1J9I A;  2JMW A;  3S1R J;  3F9K A;  1BI2 A;  1D1A A;  3DKW A;  3FMR A;  4C3H J;  4ZYH A;  4O5V A;  3CLO A;  4LK1 F;  2Q0O A;  2K4J A;  3C18 A;  3U1K A;  3BQY A;  2OUM A;  3JAM K;  2IGO A;  1FNN A;  3QU6 A;  1GXQ A;  2AXL A;  3GFL A;  4HX8 A;  4ENK A;  3AKZ A;  3TKY A;  1NG6 A;  3K4N A;  2DYR H;  2B7E A;  2Y30 A;  1MBJ A;  2UZK A;  2JRM A;  2LKS A;  2VKH A;  2Z1D A;  4XLN F;  3CD6 I;  2FQ3 A;  4PZJ A;  4Y52 J;  5ICE A;  4YFK F;  4DIQ A;  2LRD A;  3KYL A;  3M8E A;  4M3B A;  5F04 A;  4RB1 A;  1XMA A;  3MMY B;  1RIO H;  2GOX B;  1RKW A;  1Y0N A;  1YIJ I;  1SEU A;  1RR8 C;  1DPU A;  5B3S H;  5DS9 A;  2PMH A;  1MZB A;  4LJZ F;  5H6R A;  1G8X A;  1ZLJ A;  4ANJ A;  4UVA A;  3DKY A;  1U2W A;  3A4C A;  3BWG A;  3HYI A;  2RGV A;  3R4K A;  4IHS A;  4S04 A;  3FXM A;  2L5Q A;  1V5G A;  3Q9V A;  1FOW A;  3LQR A;  3GUD A;  3NAR A;  4RLQ A;  1PJR A;  2HQR A;  4XL9 A;  3CCM I;  1O4X A;  5D5W B;  4A3K J;  1TWG J;  2VKV A;  4GO1 A;  4E6K G;  5CVJ A;  2V79 A;  2WTE A;  3TOB A;  4KA4 A;  1O3R A;  1YJN I;  4DZJ A;  3F6O A;  2W57 A;  4RAY A;  3CCY A;  1G4D A;  4LG3 A;  1TZL A;  2V1N A;  2KP6 A;  4KIG A;  4G94 A;  3AFH A;  2WC2 A;  4GFB A;  2VQL A;  4LD5 A;  3ROU A;  2PMZ N;  2DT7 B;  2VI6 A;  3QU3 A;  3WTZ A;  3GVA A;  1VND A;  3OV8 A;  2WV1 A;  5M5W J;  2R7S A;  2ETH A;  1LDK B;  1KON A;  3A03 A;  2QQA A;  1BIA A;  1R4M B;  2JA5 J;  4M73 A;  3ZRG A;  3HBL A;  1VQ7 I;  4UVB A;  3ZQG A;  1CGP A;  3GLX A;  5CYV A;  4HLY A;  1ENH A;  1YYV A;  1IF1 A;  1SD6 A;  2VC0 A;  3BR6 A;  3HOU J;  1J2X A;  1Q1V A;  5E3M A;  5EGO A;  2DMT A;  5HLG A;  2M4K A;  2OJE D;  5AON A;  1MH3 A;  2Z5U A;  1PDN C;  3I4N J;  3CC7 I;  3HOZ J;  5FLX K;  1HOM A;  1JT0 A;  2K9S A;  3RPU A;  2HYJ A;  2VQH A;  3LSH A;  4PGG A;  4PSX A;  2L2O A;  5HLI A;  4A5M A;  1RES A;  2FEZ A;  1T2K A;  5L3G A;  5BMZ A;  1LE8 B;  4HDU A;  1ETX A;  3JRG A;  2P81 A;  4MHG A;  3R0A A;  1MBG A;  1GUU A;  5LHG A;  1H0M A;  4BQA A;  1OKR A;  3R60 A;  4LIV A;  1LNW A;  1Z3Y A;  4AD9 A;  5D5U B;  3VWB A;  3FZV A;  2UV1 A;  4NQW B;  1JKO C;  2RNJ A;  1XN7 A;  3SQN A;  3E6M A;  5M5X J;  2LG4 A;  3GCM A;  1LFP A;  3LQQ A;  4M71 A;  3K69 A;  2IJL A;  4CSW A;  3IWZ A;  4EVI A;  1JKQ C;  4H4K C;  5ILU A;  4HST A;  2EA4 A;  4GXO A;  3SXY A;  1HKS A;  2KKO A;  1Z3X A;  1S5L C;  3A01 B;  2DMP A;  1EA3 A;  2CW7 A;  2E7X A;  2RVC A;  2VXD A;  2ZO4 A;  5CLS A;  4XLP F;  4RB3 C;  3GFI A;  1ZG5 A;  3G1M A;  2EK5 A;  3GXO A;  3VPR A;  4LGW A;  4BGD A;  4ZDP A;  4DYR A;  1VTN C;  2BHY A;  1VQK I;  3CCV I;  5GP9 A;  2KJB A;  2FF4 A;  2I5U A;  3B6C A;  2PFB A;  5HVQ C;  1T33 A;  4B8X A;  2O6G E;  4BDY A;  1KU2 A;  1TBX A;  3RPU D;  1SAU A;  1SMY F;  2ELJ A;  3VB2 A;  1E3P A;  4JQF A;  3P9C A;  4B4C A;  3GYH X;  4XLF A;  2ADU A;  1X3U A;  2NOG A;  5F1J A;  2CSO A;  3FKI J;  1R5G A;  3L1P A;  3FMS A;  2M34 A;  1HST A;  4V19 K;  4IHY A;  2XAS A;  3KZY A;  2JPB A;  3KFW X;  3E6D A;  1CF7 B;  5IOY A;  1YJW I;  2IS2 A;  4FIS A;  2HXO A;  1SD5 A;  3EET A;  3LA7 A;  2O61 A;  3PQJ A;  4R8H A;  5LGN A;  4A3L J;  3I56 I;  3WG9 A;  1S72 I;  3AG2 H;  3CC4 I;  2K40 A;  2LR8 A;  4EGZ A;  2FRH A;  3VSK A;  3DXJ F;  3OS0 A;  4ZYA A;  1U5T C;  2CUZ A;  4GGG A;  3DLA A;  2QKM B;  3CCS I;  2K9L A;  3AG4 H;  3TP3 A;  1DP3 A;  2KFD A;  3I59 A;  2WAF A;  5FFX A;  3DV8 A;  3WU1 B;  2W7N A;  3WHB A;  1FMW A;  3G71 I;  4RBO A;  1LKX A;  3I53 A;  2X85 A;  4BY7 J;  4CZC A;  3H5R A;  2Q2E A;  1B72 A;  4KDP A;  3G73 A;  3CES A;  4BU2 A;  1T95 A;  2HPI A;  3S14 J;  1MJA A;  2OAZ A;  4V2G A;  3KET A;  2XRO A;  1ZG1 A;  2KT0 A;  3HIF A;  3HUG A;  4V2F A;  4BE1 A;  3HOV J;  4CDG A;  5EG0 B;  1XGN A;  1TQP A;  4AYB N;  2M8E A;  1V4R A;  1GLN A;  2V6E A;  2LF8 A;  4GDF A;  2VE8 A;  5E20 A;  4PJJ A;  3GZN B;  3LSJ A;  2Y69 H;  2RN7 A;  2HOA A;  1IN4 A;  1IV8 A;  3M07 A;  3LMM A;  2GXA A;  5KHD A;  2F48 A;  1RUN A;  5HS8 A;  1MBK A;  3B73 A;  4Y7N J;  2DFH A;  4AWX B;  3F3X A;  3L2U A;  4HNU A;  3OR1 C;  2Y0M A;  3HZJ A;  4ESF A;  2STW A;  1QHG A;  2OBP A;  4MTD A;  2KDO A;  2XUB A;  4ZYD A;  4HSR A;  3N05 A;  1ACI A;  4LLL A;  1D0X A;  5TJJ A;  3H5A A;  4CYC B;  3G1L A;  2X1E A;  4L0Y B;  5BQT A;  2HR3 A;  1WRJ A;  4ENJ A;  1KA8 A;  2M87 A;  4WXC A;  1W0T A;  3WG7 H;  1JI8 A;  1QGP A;  1SFO J;  2A5W A;  2DOA A;  2R7R A;  1MH4 A;  2QYO A;  2VKD A;  4AC0 A;  3K4M A;  1VQ9 I;  1X3W B;  3BOQ A;  1ZH5 A;  2OQG A;  1MGT A;  2XAU A;  2PMZ A;  3OR2 C;  4A5N A;  4NC6 A;  5KCM A;  1XG1 A;  4DJA A;  3CJR B;  5DTD A;  3VFZ A;  4EAT A;  1PYV A;  2DCE A;  4UUS A;  4XLA A;  4NB5 A;  2WY8 Q;  3TW7 A;  1OJL A;  3K4B A;  1IUF A;  3NQO A;  1B8I A;  2K9N A;  3ZQI A;  4CO8 A;  4JOM A;  2LP0 A;  4YRV A;  3COA C;  2DU9 A;  4ON0 A;  1SFK A;  3CP8 A;  4HOB A;  1MMD A;  2Z3Y A;  4G8X A;  1QNT A;  2QZ8 A;  3H36 A;  2EQR A;  3NWS A;  3FMQ A;  1LEB A;  1QVU A;  1XS9 A;  1RZ4 A;  2CG4 A;  4XSX F;  2EIN H;  3TO9 A;  3I5U A;  3AL0 B;  2Y75 A;  3OYH A;  4RGR A;  4QSH A;  4EM2 A;  1TTY A;  5ICC A;  1OQY A;  2WAD A;  5J40 A;  3GTG J;  3S2H J;  2OA4 A;  4AIK A;  1UEL B;  4G12 A;  2NVU B;  3QP6 A;  1GT0 C;  2D45 A;  4U0W A;  1DUX C;  4NHJ A;  1TW3 A;  3UR3 C;  3AL0 C;  3U9G A;  1X1A A;  2XAG A;  2GA2 A;  2WA0 A;  3W2A A;  4XSZ F;  4HV6 A;  2V6C A;  2R92 J;  1R58 A;  3EDP A;  2OZU A;  1YX5 A;  1Y39 A;  5ILV A;  2L4M A;  2E2H J;  2HQ5 A;  1LEA A;  1YG2 A;  4R79 A;  4DBQ A;  3IP4 B;  2EFN A;  4ENM A;  1KQ8 A;  4CCM A;  4YFX F;  1OYI A;  1C0W A;  3WE2 A;  3FKJ A;  2K9M A;  2F6C A;  1JHF A;  3D5S C;  1HBX G;  2ZBK A;  4LB6 B;  3H3Z A;  2X6Y A;  2MLK A;  4XKB A;  1LFU P;  5D4S A;  3R6S A;  3SEZ A;  3LSI A;  4A69 C;  1MNM C;  4I6Z A;  2QBY A;  2AS5 F;  5E79 C;  3TBI A;  3FX3 A;  1WJE A;  3MKL A;  1SVL A;  3EUA A;  2YX4 A;  1ZN2 A;  1FOY A;  1W0U A;  4BXF A;  2FBH A;  1IXC A;  1W5S A;  3EUK L;  4BDZ A;  2DO7 A;  3RKW A;  2FNP A;  4A3M J;  2JVH A;  2AO9 A;  1SFX A;  2R5Y B;  2XGX A;  4P5O A;  1IN6 A;  4F3Q A;  2H8W A;  3V8L A;  1H9G A;  3S3M A;  5F6F A;  4P9U A;  3EUH C;  2X6W A;  2E60 A;  3ZR8 X;  1U6G A;  1OCT C;  1UMQ A;  3GTK J;  3B02 A;  3W2W A;  3HSR A;  4AVP A;  4QLC U;  3I54 A;  3BJA A;  3Q0V A;  4PUS A;  3NRV A;  4BQQ A;  3JTG A;  1TP4 A;  3I58 A;  3ZMD A;  2H1K A;  3VYS B;  5A2Q Z;  5JR3 A;  4BNC A;  4C9Y A;  2VON A;  1Y6I A;  3WTW C;  2R7V A;  5EEA A;  2H6B A;  1J7K A;  1W36 D;  3OYE A;  4E7I A;  2EFO A;  3ZGK A;  5DDG A;  1E3O C;  3S1M J;  3J81 K;  4WK8 F;  4EJT A;  1G3S A;  2BY0 A;  2XAH A;  1BOA A;  5E8I A;  4BUP A;  2M7B A;  4P96 A;  3K0L A;  5CVR A;  2FOW A;  3KZI C;  5ICG A;  2DMN A;  5DUI A;  1FIA A;  3IL2 A;  2R7Q A;  1STZ A;  3PFI A;  4Y3O A;  1K61 A;  1I1S A;  2VOD A;  3AAF A;  2V1D A;  2FQ4 A;  1ZAR A;  2P4W A;  2M7A A;  1I3A A;  1Y56 A;  3IUO A;  3MFK A;  2DMQ A;  2IS1 A;  2QLZ A;  2ZME C;  1U8B A;  2HKO A;  2QQB A;  1SD4 A;  1YHQ I;  4I0A A;  3SZG A;  4AIH A;  5KVR A;  1XGM A;  2MBF A;  5EDN A;  2IS4 A;  4PGH A;  1P4A A;  2JZY A;  4A3E J;  1K79 A;  2X1C A;  4AM3 A;  2G9W A;  2H8R A;  2MD0 A;  1A6Q A;  3GX4 X;  3KP4 A;  1VQO I;  2W00 A;  4QIW N;  4YFN F;  1RUO A;  1YOV B;  1O3S A;  4I7H A;  2M5W A;  1AKH A;  1FJL A;  1YFH A;  2CGP A;  1FT9 A;  4MO7 A;  1ZHF A;  5ED4 A;  4N9H A;  4E7H A;  3J7Z I;  4JP0 A;  2EIL H;  2KQR A;  1YIO A;  3ZPL A;  1R6R A;  2CQ7 A;  4MQ9 F;  4N4N B;  3BTL A;  2KIF A;  2LY9 A;  1BW6 A;  3PSF A;  4XKV A;  5JVT A;  2STT A;  4X6A J;  3CZ6 A;  2FU4 A;  2CU7 A;  4BEH B;  2VN2 A;  2HTJ A;  4D5C A;  5F0H A;  1OR7 A;  2IRF G;  2OD5 A;  1R9T J;  1XDU A;  3WTT C;  3CC2 I;  2MH2 A;  1OMI A;  4HX7 A;  3ERE D;  2PG4 A;  2DA4 A;  1OCP A;  3DTK A;  3QOE A;  4HF1 A;  1J59 A;  3G2B A;  5C44 J;  4RLF A;  2ID3 A;  3QWL A;  1FYL A;  1UG2 A;  3BCA A;  3CDI A;  2EZL A;  2XVC A;  3HOT A;  4N9I A;  4KYW A;  4OMY A;  4Y15 A;  2GWR A;  5DD4 A;  2K85 A;  3GFJ A;  2VJI A;  5BPD A;  1R71 A;  3KP5 A;  4RDU A;  2R5Z B;  1UG0 A;  2RQP A;  4O6J A;  3FXK A;  3RPQ A;  2W24 A;  2ESN A;  4M6X A;  2ZSI B;  2EBI A;  2BW3 B;  2M2E A;  1PUF B;  4OIP F;  1FOX A;  3CQZ J;  3DTI A;  2P6S A;  1MSE C;  3M4O J;  4IQ4 A;  3TMO A;  2ZC2 A;  3JRC A;  1UB9 A;  1MDM A;  4PFP A;  2WBM A;  2M4G A;  2J5O A;  2K4B A;  1KU7 A;  3FXO A;  1I3Q J;  3K2A A;  1IGN A;  1U5T B;  4ESJ A;  2DQL A;  3LA3 A;  4KIT B;  1E17 A;  1W5C C;  1XPX A;  5FRN A;  1D0Z A;  4ZTJ A;  1FC3 A;  3LST A;  4UNO A;  4XN0 A;  1R7J A;  4KT5 C;  1A6I A;  2HZD A;  2HS5 A;  2CJJ A;  2BEO A;  5IP6 A;  3IHU A;  3HTS B;  2A05 A;  1FSE A;  2FX0 A;  2TRT A;  3K4C A;  3MWM A;  5EEG A;  3DFG A;  2GXG A;  3GBG A;  2EFQ A;  1IXR C;  4RAZ A;  2E36 A;  4UVC A;  2XPW A;  1E2X A;  3ECH A;  4YIF A;  4ENN A;  3E7L A;  3HKZ N;  1EF4 A;  2IA0 A;  3CCR I;  1FP1 D;  3P5J A;  5J1U A;  1PP8 F;  2ICW G;  2JA8 J;  3PO2 J;  2ISZ A;  3CUQ C;  2KPM A;  2CFO A;  3IWF A;  5M3F J;  3H9J A;  2DN0 A;  1TQI A;  5BS6 A;  4II3 A;  1AOY A;  4AID A;  2F5D A;  2F5C A;  1SMT A;  2OU2 A;  1WGX A;  1ZRE A;  4BS9 A;  1TWC J;  1BBY A;  4EJW A;  2Y2Z A;  4Z2Y A;  5E3L A;  1LUJ B;  4UHT A;  4NC8 A;  1BW5 A;  2HZT A;  5CVI A;  1G59 A;  3PUB A;  3ML6 A;  4WCG A;  3DWL E;  1KZH A;  2L3D A;  1D8J A;  2JUC A;  3FIS A;  4K2E A;  2NYX A;  5C4X J;  3FDY A;  5FKK A;  2XAF A;  3G3Z A;  3WU2 C;  2YPR A;  1MSF C;  5F27 A;  1FEX A;  3QYB A;  2AQF A;  2E1C A;  1SAX A;  3MKY B;  1YE9 A;  4I99 C;  2KMU A;  4ETS A;  4JX4 A;  3M1E A;  3RIR A;  2KIQ A;  1ZQ3 P;  3DCF A;  1HLV A;  1QVT A;  1IXS B;  2BBY A;  2MLG A;  5HLT A;  1RC9 A;  1ETV A;  1MBH A;  4YEJ A;  1FYK A;  2B9S A;  3KZZ A;  1RNL A;  1UHW A;  4XRS G;  3SDB A;  4M3F A;  3ASO H;  2M8G X;  2MC3 A;  1L0O C;  2K5C A;  1S7O A;  2RC4 A;  1TT5 B;  5IYC J;  2JA7 J;  2FJ1 A;  3PQK A;  3Q5F A;  2AXT C;  1N75 A;  2VBY A;  1Z77 A;  3H9Q A;  3RJP A;  2XPU A;  2A6E F;  5LBQ A;  2WV0 A;  1T0F C;  2V1U A;  2CV1 A;  3S16 J;  1VQM I;  1GDT A;  3OS2 A;  5FKN A;  1NTC A;  3BR0 A;  4RS8 A;  4D5F A;  3FK7 A;  1LE8 A;  2HWV A;  2IGM A;  2QSF X;  4HBL A;  1BI0 A;  1Y0U A;  4YIR X;  4XRF A;  1JTX A;  1R5I D;  2DFE A;  1K4T A;  1BIB A;  3TW6 A;  4W1U A;  2XAJ A;  3ZOB A;  2DA6 A;  3CCE I;  3IKV A;  4AUX A;  3D5R C;  4IHW A;  4LG0 B;  1KYZ A;  1V3F A;  1NHA A;  1VQ6 I;  2ELK A;  3L2Q A;  1UHS A;  2RV8 A; 
#chains in the Genus database with same CATH homology
 3HRT A;  5HLH A;  4EMS A;  4UUV A;  5BPI A;  1Z6T A;  3F8C A;  3KLO A;  2OZ6 A;  2Z33 A;  1MD0 A;  1WKM A;  1S6L A;  5E18 F;  3C3W A;  3BPV A;  1DP7 P;  2CFX A;  1KQ0 A;  3M9A A;  2Q8K A;  3J80 Z;  4MTE A;  4CIC A;  1HQC A;  4EM1 A;  4A6D A;  1GXP A;  2QWW A;  3RYR A;  3F8F A;  3VOE A;  3F8M A;  1BC8 C;  4E70 A;  2L54 A;  1CF7 A;  4OIN F;  4O3M A;  5DCF A;  1LVA A;  5E1Z B;  1IN8 A;  3C7J A;  5K1Y A;  3J7A O;  3ECO A;  1TNS A;  3WOD F;  5IT9 Z;  4FHT A;  1R5H A;  4EQQ A;  2PEX A;  4Y17 A;  2DK8 A;  4WXH A;  1ZRD A;  4Q5S F;  4WXD A;  1QQI A;  1U8R A;  3T1B A;  4RGU A;  3ZQ7 A;  1WQ2 A;  2BYV E;  2NS0 A;  3L00 A;  4IXA A;  4L5J A;  1DPR A;  5AIP A;  2DLL A;  3T5X A;  4HQM A;  1IN7 A;  1W4M A;  5H6Q A;  4GYG A;  2M1B A;  1R22 A;  1O57 A;  1LQ1 A;  1G3Y A;  1G6N A;  1TLH B;  5D5V B;  2ZME B;  1K6O A;  3KP2 A;  5A2Q K;  3VOD A;  1IRF A;  1WWX A;  3L2C A;  3RI4 A;  3P9I A;  2TDX A;  3TO6 A;  4LFU A;  1S29 A;  3GO5 A;  3ULQ B;  3BJ6 A;  4H0E A;  2JRT A;  4EJU A;  2PJP A;  3BPX A;  2C6Y A;  5D8K B;  3ABU A;  5JFR A;  1BN5 A;  4OOI A;  2YX7 A;  5HS7 A;  3O6B B;  1Q1H A;  4Q4Z F;  5HOO A;  1R00 A;  4BHC A;  4AIJ A;  4MEX F;  3H3U A;  2VT3 A;  3FM3 A;  1I6X A;  4PDK A;  1DDN A;  2Y48 A;  1KQ9 A;  1G3T A;  1B4A A;  3WE3 A;  4ZZD A;  2GZW A;  2O03 A;  3RKX A;  4WWC A;  3V7R A;  1TNT A;  1ZGA A;  2X4H A;  2R7F A;  1P4W A;  4KMF A;  5FB2 A;  2Z9O A;  2NAZ A;  3HSF A;  4M9X A;  2WWY A;  1SD7 A;  4M72 A;  1R23 A;  2EV6 A;  1UCR A;  3M7G A;  1HXD A;  5D5X B;  1YW8 A;  3E97 A;  4FX0 A;  1FPQ A;  2NRA C;  1BI1 A;  2IA1 A;  2LKP A;  3KEQ A;  5DEQ A;  3P7N A;  2G7H A;  1Z6R A;  3SZP A;  2HDC A;  3K1M A;  1W7P B;  2P8T A;  5LLQ A;  1HSJ A;  2IPQ X;  5L3D A;  3HRU A;  2BGC A;  2F5E A;  2ZNY A;  3F8N A;  3CUQ B;  2P7V B;  1TQM A;  1W5T A;  2D1V A;  1S3J A;  1U3E M;  5DCM B;  4M9Z A;  4FX4 A;  2COM A;  1Z9C A;  2Z99 A;  4A12 A;  4OMZ A;  1YTY A;  3DP7 A;  3LA2 A;  1ULY A;  1HKQ A;  1XDS A;  3MZH A;  2L01 A;  4RB0 A;  3U1D A;  5F1R A;  2JSC A;  3Q9S A;  2UXN A;  1A04 A;  3D5L A;  4F7Z A;  2CYY A;  2M30 A;  3FHZ A;  2IT0 A;  4G7O F;  3F6V A;  1TW2 A;  1O3Q A;  1FBU A;  4P55 A;  2EA2 A;  2MH9 A;  1YQA A;  1FBQ A;  2HKX A;  2EFP A;  1EH7 A;  1REP C;  1LJ9 A;  2K02 A;  1FYM A;  1P92 A;  1SFE A;  2FSW A;  1Z05 A;  5TRD A;  2CO5 A;  1ON1 A;  3MCZ A;  2XAQ A;  2E7W A;  1R36 A;  2DFI A;  1YO5 C;  3EYY A;  3L09 A;  4R1H A;  2R3S A;  1USS A;  4A6E A;  5HDN A;  3IRQ A;  3LAP A;  2H09 A;  5FO5 A;  1T6S A;  3LFK A;  1YW7 A;  4G7Z F;  3ABT A;  3KE2 A;  1S7A A;  3NEU A;  3S2W A;  2A61 A;  3I64 A;  3GFM A;  5AIQ A;  3P9K A;  2KJC A;  3REO A;  4I2O A;  3MAJ A;  3E3V A;  1P2F A;  3FXR A;  1ZRC A;  4B09 A;  1I27 A;  2EJR A;  4I98 B;  2L4A A;  2V1X A;  1P6R A;  4KNY A;  2EFW A;  1RI7 A;  4Y13 A;  4IJA A;  1F9N A;  3BY6 A;  4UV8 A;  3CTA A;  1KYW A;  3BJO A;  1ON2 A;  1D3Y A;  4A2U A;  4L9V A;  3RDI A;  3J80 K;  2DT5 A;  1U5T A;  2L02 A;  1H9T A;  2QBY B;  3MEX A;  3F72 A;  4YII A;  3KEO A;  2ISY A;  1YLF A;  3DPL C;  1UST A;  5D6E A;  1GVJ A;  3SFZ A;  2JTV A;  2QVO A;  5FFZ A;  2B0L A;  3V4G A;  5IT9 K;  1ONV A;  3SZT A;  3TDZ C;  1UHM A;  3FM5 A;  3R61 A;  3ZN0 A;  4QWQ A;  4KN4 X;  1QPM A;  3ZP5 A;  2O3F A;  4BHP A;  4LK0 F;  4JBA A;  4HLX A;  4FT8 A;  4EV0 A;  1FLI A;  5J6X A;  1I5Z A;  4CXF A;  1XSV A;  2CW0 F;  4KMU X;  3JSP A;  5FD5 A;  5EEH A;  5HS9 A;  3K1N A;  2KRF A;  1BC7 C;  2H27 A;  4EJV A;  1XB4 A;  3CO6 C;  2NNY A;  1F4K A;  4RGS A;  2VBW A;  5J8C A;  4UXN A;  5L3F A;  1FY7 A;  3JW4 A;  2IA2 A;  1ZGJ A;  3HHH A;  5F64 A;  4CZZ A;  1D8K A;  1JHH A;  4L5I A;  4U7B A;  1WI9 A;  1K78 B;  2A68 F;  3T8T A;  2FML A;  2O8X A;  2QM3 A;  4I09 A;  1WSU A;  2D1H A;  4EGY A;  2DW4 A;  4LG0 A;  3R0J A;  3F23 A;  5LHI A;  2EV0 A;  1EH8 A;  1ZG3 A;  3KP7 A;  2W85 A;  4EJO A;  3VEP A;  1QO0 D;  5J8F A;  1SFU A;  2XIG A;  2HYF A;  2HOE A;  4OIQ F;  4RGX A;  4HF2 A;  3K9T A;  3HRM A;  4I01 A;  2KIU A;  5H20 A;  3ZN1 A;  3CUO A;  2VOP A;  1JGS A;  3U2R A;  4U88 A;  2FE3 A;  2LF7 A;  3KP3 A;  3W6K B;  3RTR A;  1Z1D A;  3HTU A;  2NNN A;  5D6F A;  2UWM A;  3FXQ A;  5DUK A;  4HX4 A;  4TV7 A;  3KCC A;  4MQV A;  2DK5 A;  1OYY A;  3QPH A;  3KLN A;  1KU9 A;  1MDM B;  4IPA A;  1ZRF A;  3SHF A;  1D5V A;  1LDJ A;  3IRR A;  2V9V A;  3F22 A;  2HEO A;  4YG2 F;  4GCV A;  1IUY A;  5K5Q A;  1QZY A;  2LNB A;  1ZAO A;  3QPT A;  3QAH A;  3EUH A;  3TGN A;  4LLG F;  4RB2 C;  2VC1 A;  1L3L A;  3T8R A;  3WTX C;  5DD8 A;  4NQW A;  5DYM A;  1KU3 A;  2FXA A;  2HYG D;  2IP2 A;  5FGM A;  2QUF A;  4IRI A;  4M74 A;  4A0Z A;  3WTS C;  2YU3 A;  4HAM A;  3ZMZ A;  4MEY F;  3GW2 A;  3FWE A;  4HZF A;  3V8J A;  2VBZ A;  5ILS A;  5E17 F;  3J81 Z;  2VOO A;  4IRH A;  5DV5 A;  3BDD A;  1B6A A;  1FSH A;  2PQ8 A;  3LWF A;  5E1W A;  2H6C A;  2XKO A;  1F5T A;  1XSX A;  4IF4 A;  4LLN A;  1XD7 A;  3EQL F;  3ZMV A;  1XSD A;  1IW7 F;  4MNU A;  3BP8 A;  1XCV A;  1QZZ A;  2ZME A;  4WF2 A;  5IT3 A;  2EB7 A;  1MJ9 A;  4U7D A;  2E1N A;  3FF5 A;  2DPU A;  1HW1 A;  1HW5 A;  1BI3 A;  4G9Y A;  2UXX A;  5CVV A;  3EYI A;  3IC7 A;  4XBF A;  2ZCW A;  4HW0 A;  1P4X A;  2FMY A;  5D4R A;  3M8F A;  3F21 A;  1S8N A;  4OIO F;  1B1B A;  2DPD A;  1FZP B;  1FP2 A;  2HGC A;  3F8B A;  3WTU C;  5L3B A;  1Z7U A;  4I02 A;  1MKM A;  2GXB A;  1T39 A;  2GQQ A;  3GZ5 A;  4GYI A;  2DI3 A;  3QOP A;  1YW9 A;  3MZY A;  3T0Y A;  2J5P A;  2RDP A;  4JK1 X;  3WU0 A;  2D2W A;  3L9F A;  2HTS A;  3K1P A;  1LB2 A;  1OYW A;  1XGO A;  5LRR A;  4UV9 A;  4BXU A;  2ZKZ A;  1YS6 A;  2MA3 A;  1KGS A;  3D0S A;  3DEU A;  2X0L A;  5K5O A;  2EV5 A;  4ZYG A;  1FWZ A;  5D8L B;  2A07 F;  2PI0 A;  3E5X A;  2VT2 A;  4G6Q A;  3BZ6 A;  1ODD A;  5HDK A;  2P7C B;  1W7P A;  1B9M A;  3O2P E;  4IVN A;  3C1D A;  1LDD A;  1MJB A;  3DQV C;  4L0Z B;  2G7U A;  2XRN A;  5BOX A;  3CUQ A;  1J0R A;  5FD6 A;  2R7D A;  5DCM A;  2YSR A;  3DPT A;  1XGS A;  5CVU A;  4HA8 A;  1U78 A;  1R1U A;  5LRS A;  1AWC A;  3JAM Z;  1T98 A;  1QBJ A;  1FX7 A;  4ZZL A;  4Q48 A;  1K7A A;  2P6T A;  2ACJ A;  2XHK A;  2IVM A;  4KUM A;  2BE5 F;  4KIC A;  1O7F A;  2W25 A;  1W7P D;  4L9J A;  5E8G A;  2MD5 A;  1T0F A;  5LEJ A;  2GA1 A;  3OOP A;  2ZFW A;  6PAX A;  3DF8 A;  1PUE E;  3O3K A;  1Z91 A;  3KP6 A;  2PLY A;  3ZMT A;  1EH6 A;  2KIM A;  2K27 A;  3I59 B;  3ZMS A;  4HQE A;  1XCB A;  3GWZ A;  2DAO A;  1B9N A;  2P5K A;  2XV4 S;  2A69 F;  1UFM A;  4ASN A;  2FA5 A;  3IKT A;  3WGH A;  4LB5 A;  1G3W A;  1IAW A;  2EWN A;  2P5V A;  3WGG A;  1R1V A;  3N97 A;  1BM9 A;  5L3E A;  2M45 A;  4HYE A;  5LEK A;  2PBI A;  2ZNZ A;  5FLX Z;  2HFH A;  5JI6 A;  3V7S A;  4PCQ A;  4U0Y A;  2OQR A;  4U0V A;  3HSE A;  1OPC A;  2DBB A;  3JSO A;  3E6C C;  2QEN A;  2XKP A;  1IN5 A;  3ZMU A;  2FBK A;  4M6Y A;  1XMK A;  4OU0 A;  5LGT A;  4Q47 A;  4DQ2 A;  2JT1 A;  2O0Y A;  1ZYR F;  4KIB A;  2CWE A;  1R1T A;  3WTY C;  3L7W A;  4ESB A;  4IHT A;  1O7L A;  2RKH A;  2CQK A;  4N0B A;  3TDU C;  3QRF F;  4BHB A;  2VXZ A;  3I4P A;  2YR2 A;  1ZLK A;  3BRO A;  4BH9 A;  4LMY A;  3K2Z A;  4HDV A;  3ELK A;  3QP5 A;  2A5Y B;  4D0P A;  4A0X A;  4HF0 A;  2ELH A;  2DTR A;  3RYP A;  5LHH A;  1I1G A;  3TO7 A;  2PN6 A;  2GIV A;  2HQN A;  2FNA A;  3W6J B;  1B59 A;  1EV7 A;  3MQ0 A;  3WTV C;  3E5U A;  2A3S A;  4P9F A;  3CJN A;  3HOS A;  1FBS A;  4A0Y A;  1HKT A;  3E5Q A;  3HRS A;  4WX9 A;  3CO7 C;  3WGI A;  1HW2 A;  3ISP A;  5L3C A;  2ESH A;  4ZYE A;  3V7C A;  1K78 A;  4G7H F;  3HHG A;  4G6D A;  3N4M A;  5HDG A;  3H92 A;  3TQN A;  3GEZ A;  4IRG A;  2F5F A;  2VE9 A;  1T38 A;  4EM0 B;  1O3T A;  4MGR A;  1J75 A;  4BYY A;  4M9S A;  4KFC A;  2JPC A;  2FBI A;  2A6H F;  4ZH4 F;  2K7L A;  3FXU A;  3I0T A;  3RKY A;  2FOK A;  4CYD A;  1JXS A;  2K86 A;  3V8K A;  2F2E A;  1JE8 A;  4KIF A;  5CJ9 A;  2ZXJ A;  3E6B A;  2ZJ2 A;  5LGU A;  4I0B A;  2VBX A;  4BAY A;  5ERI A;  5KK1 A;  4CGZ A;  2H94 A;  3GF2 A;  3JTH A;  1F1Z A;  2DQR A;  1FOK A;  4CHU A;  1YS7 A;  2GAU A;  4L9N A;  2IW5 A;  2W84 A;  2P5L C;  2LDU A;  2BV6 A;  4S05 A;  4L9T A;  1IRG A;  3GZ6 A;  1GHC A;  1IZ1 A;  2LSO A;  4HV5 A;  4OIR F;  5JHU A;  2QQ9 A;  1J5Y A;  3I71 A;  2PMU A;  3LAJ A;  1PP7 U;  3CDH A;  4DNC A;  1BJA A;  5ICF A;  5E1X A;  4L18 B;  3TOA A;  5K5R A;  4KN7 X;  1J9I A;  1BI2 A;  3DKW A;  4ZYH A;  3FMR A;  4O5V A;  3CLO A;  4LK1 F;  2Q0O A;  2K4J A;  3C18 A;  3JAM K;  1FNN A;  3QU6 A;  1GXQ A;  2AXL A;  3GFL A;  4HX8 A;  4ENK A;  3TKY A;  2UZK A;  4XLN F;  2FQ3 A;  4PZJ A;  5ICE A;  4YFK F;  3M8E A;  4RB1 A;  1XMA A;  1RIO H;  1DPU A;  2PMH A;  1MZB A;  4LJZ F;  5H6R A;  1ZLJ A;  4UVA A;  1U2W A;  3BWG A;  3HYI A;  2RGV A;  3R4K A;  4IHS A;  4S04 A;  3Q9V A;  3LQR A;  3GUD A;  2HQR A;  5D5W B;  4GO1 A;  5CVJ A;  2V79 A;  2WTE A;  3TOB A;  4KA4 A;  1O3R A;  3F6O A;  2W57 A;  4RAY A;  1G4D A;  4KIG A;  4G94 A;  2WC2 A;  4LD5 A;  3ROU A;  3QU3 A;  3WTZ A;  3GVA A;  3OV8 A;  2ETH A;  1LDK B;  2QQA A;  1BIA A;  4M73 A;  4UVB A;  1CGP A;  3GLX A;  5CYV A;  4HLY A;  1YYV A;  1IF1 A;  1SD6 A;  2VC0 A;  1J2X A;  5HLG A;  5AON A;  2Z5U A;  1PDN C;  5FLX K;  3RPU A;  4PGG A;  5HLI A;  4A5M A;  2FEZ A;  1T2K A;  5L3G A;  5BMZ A;  4HDU A;  4MHG A;  3R0A A;  5LHG A;  1H0M A;  4BQA A;  1OKR A;  3R60 A;  1LNW A;  4AD9 A;  5D5U B;  3FZV A;  2RNJ A;  1XN7 A;  3SQN A;  3E6M A;  3LQQ A;  4M71 A;  3K69 A;  2IJL A;  4EVI A;  3IWZ A;  5ILU A;  2EA4 A;  4GXO A;  3SXY A;  1HKS A;  2KKO A;  2RVC A;  2E7X A;  1ZG5 A;  4XLP F;  2ZO4 A;  5CLS A;  4RB3 C;  3GFI A;  2EK5 A;  3GXO A;  4LGW A;  1VTN C;  2KJB A;  2FF4 A;  2PFB A;  5HVQ C;  4B8X A;  2O6G E;  1KU2 A;  1TBX A;  1SMY F;  3VB2 A;  4JQF A;  3P9C A;  3GYH X;  2ADU A;  1X3U A;  2CSO A;  1R5G A;  3FMS A;  1HST A;  2XAS A;  3KZY A;  2JPB A;  3KFW X;  3E6D A;  1CF7 B;  1SD5 A;  3EET A;  3LA7 A;  2O61 A;  3PQJ A;  4R8H A;  5LGN A;  3WG9 A;  4EGZ A;  2FRH A;  3DXJ F;  1U5T C;  4GGG A;  3I59 A;  5FFX A;  3DV8 A;  3WU1 B;  3I53 A;  2Q2E A;  4KDP A;  3G73 A;  1MJA A;  2OAZ A;  3KET A;  2XRO A;  1ZG1 A;  3HIF A;  3HUG A;  4CDG A;  1XGN A;  1TQP A;  2M8E A;  1V4R A;  2LF8 A;  2VE8 A;  5E20 A;  2RN7 A;  1IN4 A;  1RUN A;  5HS8 A;  3B73 A;  4AWX B;  3F3X A;  2Y0M A;  4ESF A;  2STW A;  2OBP A;  4MTD A;  4ZYD A;  2XUB A;  4LLL A;  5TJJ A;  4L0Y B;  5BQT A;  2HR3 A;  1WRJ A;  4ENJ A;  1KA8 A;  2M87 A;  4WXC A;  1QGP A;  2QYO A;  3BOQ A;  1ZH5 A;  2OQG A;  1MGT A;  4A5N A;  3VFZ A;  4NB5 A;  3NQO A;  4CO8 A;  3COA C;  2DU9 A;  4ON0 A;  4HOB A;  4G8X A;  2Z3Y A;  1QNT A;  2QZ8 A;  3FMQ A;  1LEB A;  1RZ4 A;  2CG4 A;  4XSX F;  3TO9 A;  3I5U A;  2Y75 A;  4RGR A;  4EM2 A;  5ICC A;  1TTY A;  2OA4 A;  4AIK A;  3QP6 A;  2D45 A;  4U0W A;  1DUX C;  4NHJ A;  1TW3 A;  3U9G A;  2XAG A;  2GA2 A;  4XSZ F;  4HV6 A;  2V6C A;  1R58 A;  3EDP A;  2OZU A;  5ILV A;  2L4M A;  1LEA A;  1YG2 A;  4R79 A;  2EFN A;  4ENM A;  1KQ8 A;  4YFX F;  1OYI A;  1C0W A;  3WE2 A;  1JHF A;  1HBX G;  2ZBK A;  4LB6 B;  3H3Z A;  2MLK A;  5D4S A;  3R6S A;  2QBY A;  2AS5 F;  3FX3 A;  2YX4 A;  1ZN2 A;  2FBH A;  1IXC A;  1W5S A;  2DO7 A;  3RKW A;  2FNP A;  1SFX A;  2XGX A;  4P5O A;  1IN6 A;  3V8L A;  1H9G A;  5F6F A;  4P9U A;  1U6G A;  3B02 A;  3HSR A;  4AVP A;  4QLC U;  3I54 A;  3BJA A;  3NRV A;  3JTG A;  3I58 A;  3ZMD A;  4BNC A;  5A2Q Z;  5JR3 A;  2VON A;  3WTW C;  2H6B A;  1J7K A;  2EFO A;  5DDG A;  3J81 K;  4WK8 F;  4EJT A;  1G3S A;  2XAH A;  1BOA A;  5E8I A;  4P96 A;  3K0L A;  5CVR A;  5ICG A;  5DUI A;  3IL2 A;  1STZ A;  3PFI A;  1I1S A;  2VOD A;  3AAF A;  2V1D A;  1ZAR A;  2P4W A;  3MFK A;  2QLZ A;  2HKO A;  2QQB A;  1SD4 A;  4I0A A;  4AIH A;  5KVR A;  1XGM A;  2MBF A;  4PGH A;  1P4A A;  2JZY A;  1K79 A;  2G9W A;  3GX4 X;  3KP4 A;  4YFN F;  1RUO A;  1O3S A;  4I7H A;  2M5W A;  1YFH A;  2CGP A;  1FT9 A;  1ZHF A;  5ED4 A;  4N9H A;  1YIO A;  3ZPL A;  4MQ9 F;  2KIF A;  5JVT A;  2STT A;  2FU4 A;  2VN2 A;  2HTJ A;  1OR7 A;  2IRF G;  2OD5 A;  1XDU A;  3WTT C;  2MH2 A;  1OMI A;  4HX7 A;  3ERE D;  2PG4 A;  4HF1 A;  1J59 A;  1FYL A;  2XVC A;  3HOT A;  4N9I A;  4KYW A;  4OMY A;  4Y15 A;  2GWR A;  5DD4 A;  3GFJ A;  5BPD A;  3KP5 A;  2RQP A;  4O6J A;  3RPQ A;  2W24 A;  2ESN A;  4M6X A;  4OIP F;  2P6S A;  1MDM A;  1UB9 A;  2J5O A;  2K4B A;  1KU7 A;  1U5T B;  4ESJ A;  2DQL A;  3LA3 A;  1E17 A;  1FC3 A;  3LST A;  4UNO A;  1R7J A;  4KT5 C;  2HS5 A;  2BEO A;  3IHU A;  3HTS B;  1FSE A;  5EEG A;  3MWM A;  3DFG A;  2GXG A;  2EFQ A;  1IXR C;  4RAZ A;  4UVC A;  1E2X A;  3ECH A;  4YIF A;  4ENN A;  2IA0 A;  1FP1 D;  1PP8 F;  2ISZ A;  3CUQ C;  3IWF A;  1TQI A;  5BS6 A;  1AOY A;  2F5D A;  2F5C A;  1SMT A;  2OU2 A;  1ZRE A;  4EJW A;  1BBY A;  4Z2Y A;  4UHT A;  2HZT A;  5CVI A;  3ML6 A;  4WCG A;  2L3D A;  1D8J A;  4K2E A;  2NYX A;  2XAF A;  3G3Z A;  2YPR A;  2E1C A;  1SAX A;  4ETS A;  3M1E A;  3RIR A;  1IXS B;  2BBY A;  2MLG A;  1FYK A;  3KZZ A;  1RNL A;  1UHW A;  2MC3 A;  1L0O C;  1S7O A;  2RC4 A;  3PQK A;  3Q5F A;  2VBY A;  3RJP A;  2A6E F;  5LBQ A;  2WV0 A;  2V1U A;  4RS8 A;  2HWV A;  4HBL A;  1BI0 A;  1Y0U A;  4XRF A;  1BIB A;  2XAJ A;  3IKV A;  4LG0 B;  1KYZ A;  1V3F A;  1NHA A;  2RV8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...