1HKSA

Solution structure of the dna-binding domain of drosophila heat shock transcription factor
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
106
structure length
106
Chain Sequence
GSGVPAFLAKLWRLVDDADTNRLICWTKDGQSFVIQNQAQFAKELLPLNYKHNNMASFIRQLNMYGFHKITSIDNGGLRFDRDEIEFSHPFFKRNSPFLLDQIKRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the DNA-binding domain of Drosophila heat shock transcription factor.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription regulation
molecule keywords HEAT-SHOCK TRANSCRIPTION FACTOR
total genus 11
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1994-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00447 HSF_DNA-bind HSF-type DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1hksA00
2WWYA 3FF5A 3KLOA 2QLZA 5AIQA 2P5KA 4ENJA 2YPRA 4IXAA 5KK1A 2D45A 2JSCA 3DF8A 4BHPA 5JI6A 5L3FA 4UVAA 2PMUA 2P7VB 3CTAA 4MTEA 1QPMA 1BJAA 5J6XA 3GUDA 5DD4A 3RYPA 3T0YA 2NNNA 1FBSA 1LNWA 2FMLA 3F23A 1XD7A 2JRTA 4UVCA 3V4GA 4A6EA 1STZA 3ZMUA 3L9FA 2Z99A 4UV8A 2M45A 3KEOA 3BJAA 4RAYA 1LJ9A 4Q47A 5D6EA 4B8XA 3ERED 2YU3A 1IXCA 4OIQF 2AS5F 1R22A 3IRQA 5E18F 1XSXA 5KVRA 2Y0MA 3ZN1A 1NHAA 1D8KA 5FFZA 1T39A 4UXNA 3MZYA 5ICCA 2A6EF 4G94A 4KIBA 1U3EM 5L3BA 4OOIA 2IW5A 5ICFA 4RB2C 2Z3YA 3F22A 5LGUA 1TW3A 3P7NA 2ZKZA 4HOBA 2IJLA 3V8KA 5ILVA 3VFZA 3HRTA 5DCMB 2E1NA 3FXQA 4HX4A 4L9TA 3GEZA 2MH2A 3I59B 1TQIA 1KU2A 3Q9SA 4ZYHA 5E20A 3FHZA 1I5ZA 3WTTC 2HTJA 3WU1B 1FT9A 2M5WA 2H27A 1ZHFA 3N97A 1Z05A 1R58A 3LQQA 2L3DA 4WK8F 1CF7B 4YIIA 3LAPA 1E2XA 2HOEA 4ESJA 4FX0A 2JT1A 3FM3A 2EJRA 4OIPF 4Q5SF 3CO7C 3P9CA 2CFXA 3OV8A 4M71A 1K78A 5K5OA 1F5TA 3I53A 3RTRA 4CGZA 3F8NA 3T5XA 2HR3A 2EA4A 2RQPA 1LEAA 2IVMA 3SQNA 1ONVA 2R7DA 4ESBA 4A0YA 1GXQA 3WGIA 2KIMA 2RC4A 2CW0F 4O3MA 2W84A 5L3DA 3JSOA 2F5FA 4KIGA 3V8JA 3W6KB 1H9TA 1R00A 2GZWA 5ICGA 1OMIA 3JTGA 2EFNA 1D3YA 4P9UA 2Z33A 4OIRF 3V7SA 2GWRA 3M9AA 1QZZA 1FBQA 2DFIA 5LBQA 3IKTA 2ZO4A 2COMA 2JZYA 2EK5A 3TDZC 1QZYA 3WTVC 2O3FA 3ULQB 4LLGF 1S7AA 3O3KA 1G3WA 3GXOA 4JQFA 4Q48A 4KIFA 1O3QA 2FNAA 2ZNZA 1XCVA 1O3TA 2DQLA 5FD5A 4L9JA 4HX7A 1XGNA 2E1CA 5IT9K 2PLYA 1KGSA 2P4WA 2JTVA 5FB2A 2DK5A 4L5IA 2O6GE 1I1SA 3ZMSA 2A61A 3SZTA 1HBXG 5BPDA 4G7OF 4ZZLA 4HDUA 5E1WA 3HUGA 2CQKA 1IUYA 3K1PA 3R61A 2GXGA 4HZFA 1LDDA 1XCBA 4E70A 5BQTA 1USTA 5TRDA 5DYMA 3LFKA 4G7ZF 2PFBA 3Q9VA 1O7FA 3RI4A 1T6SA 2QYOA 3GZ5A 3QU3A 5ICEA 4P96A 2YSRA 3LSTA 4IRIA 3HTUA 4KFCA 1FC3A 3ELKA 2GA2A 3D0SA 4MEXF 2VBWA 3WTZA 3GZ6A 1LQ1A 1XSVA 1T98A 1U5TC 2JPBA 1U8RA 1QO0D 1J7KA 2UWMA 1U5TB 1XGOA 5D5UB 3TQNA 1U2WA 1IN5A 2PEXA 3RDIA 4A5MA 4NB5A 1KYWA 2DTRA 3EDPA 3VEPA 3P9IA 1Z6TA 2MLKA 2F5CA 1YFHA 1G3TA 2OU2A 3WGGA 4TV7A 3CUQB 1F1ZA 4EM1A 2A69F 5DCFA 1J0RA 4PGHA 1EV7A 4G9YA 3BP8A 5K5RA 1IN6A 3R6SA 3I0TA 2DAOA 3H92A 1BOAA 2CG4A 1GHCA 3O2PE 3HRSA 4M6XA 4OU0A 2R7FA 3CUQC 5JR3A 2VC1A 2XKPA 3U2RA 2QWWA 2EV6A 2MBFA 5JVTA 1G6NA 3KE2A 4L18B 3K1MA 4I0AA 2NRAC 1OYWA 3KP4A 3HSRA 2F5DA 5LGNA 3K1NA 4I98B 1HKQA 2IP2A 1FX7A 2W85A 2FBHA 3MEXA 1KQ8A 4U0VA 4M9ZA 3RKWA 2B0LA 2BE5F 3J7AO 2PJPA 5DCMA 1Z1DA 4RB3C 2D1HA 2FU4A 1P4XA 4KNYA 2W57A 4O6JA 3DP7A 3I58A 2RKHA 2Z5UA 5FGMA 2HEOA 4O5VA 1TLHB 3BDDA 2WV0A 2V6CA 2V1DA 3EYYA 2EFPA 4IRHA 4S05A 4JK1X 2VE9A 2O8XA 2P7CB 4HLXA 3C7JA 1KU3A 4HX8A 4WXCA 4YFXF 2FE3A 2ESHA 1HW2A 1USSA 2J5OA 2OQRA 4KMUX 5HLHA 2EA2A 2HQNA 5CLSA 3DPTA 2L4AA 3H3ZA 1YW9A 1YYVA 1B1BA 3QOPA 3VB2A 2M1BA 4OINF 3KP2A 1O3SA 1IAWA 1IN7A 2H6BA 2DT5A 5LEKA 2DPUA 2V1UA 5LEJA 4ENMA 3RPQA 3IC7A 1KQ9A 4PDKA 3FZVA 2STWA 1KQ0A 1R36A 1Q1HA 2VOOA 4G8XA 2MD5A 3M1EA 1J2XA 2E7WA 3VOEA 1ON2A 2A5YB 5E1XA 3TO6A 2V9VA 5FFXA 4EJWA 5HOOA 2M8EA 1FSEA 4MHGA 1BM9A 3EUHA 3LA7A 1S7OA 1MZBA 4MTDA 1RZ4A 1JE8A 3FMSA 3NQOA 2GQQA 2O0YA 5HS7A 2EFWA 1PDNC 2OZ6A 2BBYA 5EEGA 1S8NA 3ISPA 3F8MA 3T8TA 2RV8A 1ULYA 1R1TA 3TO9A 4L9NA 3U1DA 3Q5FA 2HTSA 4LMYA 2QENA 3BOQA 2BYVE 4JBAA 1PP7U 3WODF 1D5VA 4EJVA 5CVRA 3C18A 3ZMDA 3F72A 4AIJA 3KEQA 1C0WA 2DQRA 2G7HA 4HF1A 3DV8A 3F6VA 4KT5C 3ZPLA 1HKSA 4WF2A 1IZ1A 2K27A 4KUMA 1R7JA 5LHIA 4CDGA 3CUOA 4D0PA 2PN6A 3TOAA 2A07F 3E6DA 4EMSA 4RGXA 1XDSA 2IT0A 1DPUA 3GFIA 1R1VA 4QWQA 4YG2F 1FZPB 1IF1A 2A3SA 3GFLA 2AXLA 1PUEE 2FQ3A 3HRUA 2Z9OA 1LDKB 4A0ZA 1KYZA 1P6RA 1B9NA 1AOYA 3FX3A 1YS6A 4R8HA 2NYXA 1EH7A 1BC7C 2TDXA 3QAHA 4HAMA 1MJAA 5J8CA 3F3XA 2QBYA 3HRMA 2WTEA 2O03A 3QPHA 4P5OA 2XAGA 4I09A 3WE3A 4WX9A 1FPQA 3EQLF 1OYIA 4Y17A 2QM3A 1ZG1A 4F7ZA 4HW0A 3KZZA 4M9SA 1W7PB 2OAZA 4AD9A 4XBFA 3DFGA 4CO8A 5EEHA 3V7CA 3WTSC 1SMTA 3ZQ7A 2ELHA 1OPCA 2IRFG 1BI0A 2Y48A 3RKYA 2EFQA 5E8IA 2Y75A 4EQQA 3WU0A 5L3GA 2OA4A 1WWXA 4Z2YA 3ABTA 2K7LA 5BPIA 2XIGA 4ENKA 3NRVA 4HBLA 2XAHA 1ZRFA 1TBXA 2XUBA 1W7PD 3V7RA 3J81Z 1DP7P 5F64A 3ZMZA 3F6OA 2HS5A 4PCQA 1XB4A 5HS8A 4OMZA 4Q4ZF 3GF2A 1P2FA 1PP8F 3JSPA 1XGMA 3KCCA 1T2KA 3HOTA 2KIFA 3PFIA 2ESNA 2FMYA 2ISZA 1TNTA 1BIBA 5ILUA 1ZG5A 1RUNA 5H6RA 3HOSA 4ZH4F 1LDJA 3KP7A 3GWZA 3E3VA 2QQAA 5BOXA 4HDVA 3HSFA 4HQEA 1SFEA 2FA5A 4GYIA 3KETA 2ISYA 4ESFA 4RB1A 2EV0A 2F5EA 3LWFA 3N4MA 4MEYF 1FLIA 1RIOH 1B4AA 1YG2A 4IRGA 4KN4X 2VE8A 4PGGA 1O57A 3FMRA 5D8LB 1HXDA 1BI1A 2XAFA 2J5PA 3J80K 5LHGA 3J81K 4BAYA 4HF2A 2V1XA 1HSJA 2EB7A 4LK1F 3KP6A 3K0LA 3FMQA 3M8FA 4EV0A 6PAXA 1SAXA 1DDNA 1FP1D 2EV5A 5AIPA 3SFZA 2LF7A 3E5UA 1HQCA 3J80Z 1BC8C 2H6CA 2FBKA 2L4MA 2UZKA 4L9VA 3T8RA 4K2EA 4LLLA 5ERIA 4U0WA 4HF0A 4XLPF 4XLNF 1OYYA 1QBJA 1ZH5A 2ZJ2A 4G6QA 2BGCA 3WTWC 4AVPA 4MQVA 5H20A 1W4MA 1GXPA 3REOA 4OIOF 5JHUA 4EGZA 2F2EA 1ZAOA 4NHJA 2KJCA 4ASNA 2CSOA 2VT3A 1R1UA 3L7WA 2ZCWA 5DDGA 3BY6A 2V79A 2W25A 4FT8A 3KP3A 3MZHA 3IWFA 1FYKA 4EM2A 2QZ8A 1Z9CA 1E17A 1U5TA 5LRSA 2Q8KA 2PG4A 4EJOA 3NEUA 2D1VA 1YS7A 3PQJA 4I0BA 4BHCA 3E5XA 4IPAA 3HYIA 1O3RA 1TNSA 2K02A 1P4WA 3GFMA 4I2OA 3G3ZA 4BNCA 5DUKA 3RKXA 1SD4A 3IKVA 4A0XA 1BBYA 3LA3A 1SMYF 3F8CA 1ZGAA 3MQ0A 1AWCA 3EYIA 4WXHA 4CYDA 3O6BB 1J9IA 1MGTA 1LB2A 1ZLKA 3WG9A 1SFUA 3WTYC 3S2WA 4A2UA 5L3EA 4CHUA 5HDGA 1S3JA 3W6JB 3E6BA 2QBYB 4HV5A 1H9GA 2YR2A 1R5HA 3I71A 4EJUA 4HYEA 4GO1A 5HLGA 2FNPA 3CDHA 2OD5A 1RNLA 1W7PA 2ACJA 5HLIA 1JXSA 5TJJA 1F4KA 4LB5A 3DQVC 4EM0B 3G73A 3B02A 3ECHA 2PBIA 1WI9A 1B9MA 5K5QA 3CO6C 3E5QA 2P8TA 2CGPA 1X3UA 4L0ZB 2X4HA 1DPRA 1XGSA 1G4DA 4IVNA 1ODDA 3I4PA 2ETHA 4RB0A 2FBIA 3CJNA 3TDUC 2RN7A 1V4RA 2O61A 2NNYA 3SZPA 3C3WA 2M87A 2XKOA 3TKYA 3RPUA 3BPVA 1ZGJA 5FLXZ 1P92A 3HIFA 2MLGA 3DKWA 2HYFA 2LSOA 4DQ2A 3I59A 3F8BA 3I5UA 3WE2A 3V8LA 2P5LC 5D4SA 1ZREA 4R79A 4IHSA 4RGSA 2VN2A 2KJBA 2P6SA 2XV4S 1I27A 2RVCA 2DO7A 3HTSB 5JFRA 1ZYRF 1IRFA 3H3UA 1P4AA 5CYVA 3TGNA 5L3CA 1L3LA 2UXNA 4XSXF 1Y0UA 4WWCA 2XRNA 2R3SA 2OBPA 3WTUC 2VC0A 3CUQA 2D2WA 2CWEA 4HV6A 4ZZDA 1UB9A 2KIUA 2QQBA 5A2QZ 3QPTA 1SD6A 1S6LA 1H0MA 1D8JA 3BJ6A 2OZUA 1B59A 1LEBA 2PQ8A 2DBBA 4EGYA 5FO5A 2EFOA 1XSDA 3ROUA 3TOBA 5CJ9A 2KKOA 4MGRA 5BMZA 1FOKA 2PI0A 2QVOA 2HQRA 2P6TA 3QU6A 1XDUA 2DLLA 2LNBA 2OQGA 4AIHA 1ON1A 2CO5A 3BROA 4WXDA 4N0BA 4NQWA 4RGRA 3HSEA 1FWZA 3ZMTA 1FYLA 3B73A 4P55A 3LQRA 5DD8A 3CLOA 3I64A 1W5SA 2XAJA 5FLXK 1KA8A 1A04A 4I7HA 4UVBA 4RS8A 2E7XA 5FD6A 4LG0A 3EETA 1REPC 4EJTA 1BI3A 2XASA 4LK0F 1DUXC 2FXAA 4CICA 3COAC 3M7GA 1R23A 3K2ZA 5D6FA 4GXOA 5LGTA 3DXJF 3WGHA 4OMYA 2Q0OA 4HQMA 3MFKA 2ZBKA 2WC2A 3GX4X 4WCGA 3IHUA 4UHTA 5K1YA 4LFUA 3I54A 1O7LA 1EH6A 1ZARA 1XMAA 2YX7A 2VBZA 4IJAA 4M74A 1QNTA 1JGSA 4M9XA 4S04A 4AIKA 3ZN0A 1I6XA 4KYWA 2VXZA 1JHHA 3GFJA 1IN8A 2XVCA 1Z7UA 1WKMA 1OR7A 1Z6RA 5LHHA 3IRRA 4ZYGA 1KU7A 3R4KA 1KU9A 3ZP5A 1UHMA 1ZN2A 2L02A 4AWXB 3IL2A 3KP5A 3RYRA 5E17F 1K7AA 5D5XB 3ZMVA 4LJZF 4MNUA 5IT3A 2NS0A 2GXBA 4YFNF 1T0FA 2W24A 2A6HF 3DEUA 4GGGA 3SXYA 4LLNA 3JAMZ 3PQKA 3ABUA 1IRGA 1ZG3A 1OKRA 2A68F 4N9IA 4CZZA 3MCZA 4LB6B 5D5VB 1BI2A 1WRJA 2X0LA 4BQAA 1MJ9A 3OOPA 2YX4A 4H0EA 1S29A 2Q2EA 4KICA 5DUIA 2MH9A 4FHTA 2UXXA 1F9NA 3T1BA 2VONA 2HYGD 1FP2A 2MA3A 2GA1A 3F21A 4ZYDA 1FYMA 4CXFA 2FEZA 2CYYA 1GVJA 2G7UA 3DPLC 2XHKA 1L0OC 3K9TA 4EVIA 2C6YA 2LDUA 1W5TA 2GAUA 4IF4A 2HFHA 2IA2A 3GVAA 1UCRA 1SD5A 1MDMA 2IPQX 3E6MA 1SD7A 4U88A 4L0YB 5J8FA 3BPXA 2FSWA 2IA1A 4KN7X 2ZMEB 4G7HF 2K86A 2DI3A 2RDPA 2VODA 4UUVA 4A6DA 3R0JA 4Y13A 1YW7A 2FF4A 2P5VA 4ENNA 3KFWX 3GW2A 1HW5A 1HKTA 4GYGA 2K4JA 1IN4A 4Y15A 4M6YA 1LVAA 4ETSA 5IT9Z 4IHTA 2QQ9A 1XMKA 2H09A 2L54A 3HHGA 2DU9A 4U7BA 4UV9A 1YW8A 4A12A 2ZFWA 2JPCA 3GYHX 1RUOA 4RAZA 3C1DA 1WSUA 2IA0A 2G9WA 1K6OA 2ADUA 1YO5C 3FXRA 4M72A 4R1HA 3ECOA 5HDKA 1IW7F 5DV5A 2XGXA 4N9HA 1UHWA 1G3YA 1U78A 4PZJA 5H6QA 5D8KB 1MJBA 2STTA 4XRFA 4LD5A 1ZRDA 5LRRA 2PMHA 2MC3A 1ZLJA 4LGWA 1U6GA 1JHFA 1R5GA 2M30A 3JTHA 1FBUA 1MKMA 3QRFF 4MQ9F 4I02A 2K4BA 3E6CC 3QP6A 5HVQC 4P9FA 1UFMA 1CGPA 3SHFA 1IXRC 2VOPA 1FNNA 3MWMA 1TW2A 2HGCA 3ML6A 2QUFA 2VT2A 3M8EA 3FM5A 3RIRA 5HS9A 3BJOA 4FX4A 2DW4A 4LG0B 1TQPA 2LF8A 5CVIA 3RJPA 4A5NA 2VBYA 3KZYA 4G6DA 1CF7A 4YIFA 4DNCA 1MD0A 1TQMA 3FXUA 2VBXA 1I1GA 3P9KA 4HLYA 4ZYEA 1Z91A 4BYYA 3TO7A 1QGPA 1EH8A 4BH9A 2DK8A 2ZXJA 5CVJA 3QP5A 1YIOA 5A2QK 3L00A 2GIVA 2XAQA 2H94A 1V3FA 5F1RA 2NAZA 1B6AA 1K78B 3MAJA 4YFKF 3IWZA 1BIAA 3LAJA 1IXSB 3F8FA 4BXUA 4U0YA 4XSZF 5AONA 5CVVA 3L09A 2LKPA 2BEOA 2HDCA 3U9GA 3BWGA 1J75A 4I01A 4GCVA 1G3SA 5F6FA 1ZRCA 2RNJA 4KMFA 1FSHA 5D4RA 1XN7A 1TTYA 5D5WB 3WTXC 4L5JA 4BHBA 3LA2A 1J5YA 3GO5A 2HKXA 5E1ZB 2HKOA 5ILSA 1FY7A 2RGVA 2EWNA 3GLXA 2KRFA 4KA4A 2FRHA 5LLQA 5DEQA 4M73A 3KLNA 5ED4A 1J59A 2HWVA 4KDPA 3FWEA 5CVUA 5E8GA 1YLFA 1YTYA 3VODA 3AAFA 1K79A 1T38A 3BZ6A 1VTNC 4RGUA 3R60A 3K69A 3JAMK 3HHHA 4UNOA 3E97A 2ZNYA 4QLCU 1MDMB 2FOKA 4HA8A 2L01A 3JW4A 1HW1A 4B09A 1HSTA 2DPDA 4ON0A 3L2CA 1RI7A 3R0AA 1SFXA 4U7DA 1YQAA 1WQ2A 3D5LA 2HZTA 2ZMEA 2XROA 1BN5A 5HDNA 1QQIA 5BS6A 2BV6A
chains in the Genus database with same CATH superfamily
3K6GA 3JRBA 4RM3A 3NWTA 2PMZN 3S1RJ 2WWYA 3K4MA 3ASNH 3BLYA 5IP9J 3K4KA 4HRIA 2AO9A 3FF5A 1H89C 3KLOA 2JA8J 2QLZA 3JRHA 4M6VA 1YJNI 5IYDJ 2L7ZA 4A3JJ 4PJ0C 2PX9A 5AIQA 2P5KA 2ICWG 2KL4A 2L7FP 2YPRA 1IDYA 4IXAA 5KK1A 4ENJA 2D5VA 2CV2A 3AG1H 2D45A 3H5RA 2JSCA 3DF8A 4BHPA 3BZCA 5JI6A 5L3FA 4UVAA 1X58A 2PMUA 5B1BH 3S2HJ 2P7VB 3CTAA 3WHCA 4MTEA 1QPMA 1BJAA 2XGEA 2GOMA 4AVZA 4FCYA 4F3QA 5J6XA 4XKWA 3GUDA 5DD4A 3RYPA 3T0YA 1K61A 2DDBA 5JVGF 5F08A 3JRDA 5B5EC 2PJRA 2NNNA 1A31A 1FBSA 1LNWA 2FMLA 3F23A 1XD7A 1MBJA 2JRTA 1POGA 4UVCA 3V4GA 4A6EA 1STZA 1JTXA 3ZMUA 5GTHC 3L9FA 2R5YA 2Z99A 3AG2H 3K2AA 3BR1A 4UV8A 2M45A 3KEOA 3BJAA 1A6IA 2E36A 3S17J 4RAYA 1LJ9A 3HB9A 2LH9A 4Q47A 5D6EA 4B8XA 5FRNA 3ERED 3M07A 2YU3A 1IXCA 4PUSA 2VPLA 1N25A 2AS5F 4OIQF 4IZZA 1R22A 3IRQA 5E18F 1XSXA 5KVRA 2Y0MA 3ZN1A 1NHAA 4AIDA 1D8KA 2WAEA 5FFZA 1T39A 3S8PA 4UXNA 3MZYA 5ICCA 2LKSA 4C3HJ 2A6EF 4G94A 2DFFA 4KIBA 4BQQA 2YS9A 4BEHA 2L9RA 2M7AA 1U3EM 3RQIA 2P0WA 5L3BA 3EUKL 1NK2P 2A05A 4OOIA 1Y8QB 2IW5A 5ICFA 4RB2C 2XSDC 2Z3YA 3F22A 5JLXA 4C9YA 3G1LA 5LGUA 4A3MJ 1TW3A 3P7NA 2ZKZA 1I3AA 4X6AJ 4HOBA 3I4MJ 2IJLA 3V8KA 5ILVA 1PYVA 3VFZA 3JRFA 2W48A 4GDFA 3HRTA 5DCMB 1GV5A 2E1NA 3FXQA 4HX4A 4L9TA 3GTJJ 3MN2A 3GEZA 5F1JA 3K4LA 2MH2A 3I59B 3RZDJ 1TQIA 1KU2A 4E7LA 3Q9SA 4ZYHA 2V4JC 5E20A 4RMNA 3FHZA 1I5ZA 3BTLA 3WTTC 1XG1A 2GIZA 5GADJ 4XONA 3CLQA 2HTJA 1QU3A 3CCMI 3WU1B 1FT9A 2M5WA 5HNHA 1YJ9I 2H27A 1ZHFA 3BG6A 3N97A 1Z05A 1R58A 3LQQA 2L3DA 3PNTA 4WK8F 4XLEA 2IGOA 1CF7B 4YIIA 3LAPA 1E2XA 2HOEA 2YU9J 2ZXIA 4ESJA 4FX0A 4NBQA 2JT1A 1D0YA 3FM3A 2EJRA 2LR8A 4OIPF 4ZDLA 4Q5SF 4ZJZA 1UELB 3K4JA 3CO7C 5FKMA 3P9CA 5IY5H 2CFXA 3OV8A 2NXNB 1D5YA 4M71A 2HOTA 1A36A 4E7IA 1K78A 4XN3A 2WAQN 5K5OA 3Q0UA 1F5TA 3I53A 4FE7A 2FX0A 3RTRA 4CGZA 3F8NA 3T5XA 2HR3A 2EA4A 4XN0A 1P9QC 2RQPA 1LEAA 2IVMA 3SQNA 1X19A 1ONVA 4FETA 4HSRA 1AU7A 4F91B 1NG6A 2R7DA 1VQKI 4ESBA 4A0YA 1GXQA 3WGIA 2VPRA 2KIMA 1WH5A 2RC4A 2XPUA 2DTZA 2CW0F 4I99C 2XF6A 4O3MA 2W84A 5DS9A 3OYHA 5L3DA 2AXTC 3JSOA 2F5FA 2ZC2A 4KIGA 3S93A 3V8JA 2N8GA 3W6KB 1H9TA 2NVXJ 1A5JA 4UUTA 2RAEA 1R00A 2GZWA 2R7OA 3G4SI 5ICGA 1ENHA 1OMIA 1DU0A 3JTGA 3FBIB 2EFNA 1D3YA 1MIJA 4P9UA 2Z33A 4OIRF 3V7SA 2W00A 2GWRA 3SYTA 4XK4A 3M9AA 1QZZA 4BBRJ 2DOFA 3PIOF 3BG7A 2E2JJ 3CESA 1FBQA 3AG4H 2DFIA 2X6WA 5LBQA 3IKTA 1F36A 2ZO4A 1JKPC 1RC9A 2COMA 2JZYA 2EK5A 3TDZC 2NVYJ 1QZYA 2DXIA 3WTVC 2EZKA 2IGMA 2O3FA 3ULQB 4KITB 2DA1A 2ZB9A 4LLGF 3BR2A 1OCCH 1BJZA 2XPWA 1S7AA 3O3KA 3OS2A 1G3WA 2DDAA 3GXOA 4JQFA 4Q48A 5GPAA 5H2FC 2E5ZA 4KIFA 1MBGA 1O3QA 3TEDA 2FNAA 2ZNZA 1XCVA 2DMPA 1RKWA 2DQLA 1O3TA 1HDDC 5FD5A 1X1BA 4L9JA 2Z1DA 3MKZA 4HX7A 3CMYA 2GLOA 1XGNA 1OQYA 1V5FA 3ZQCA 2M3AA 2E1CA 5IT9K 1IV6A 2PLYA 1SEUA 2VKEA 4B47A 3ZRGA 1KGSA 2P4WA 2Q1ZB 3DKXA 3UR3C 2JTVA 2QA4I 3ASOH 4A3BJ 3I4NJ 5FB2A 2EPFA 2EZHA 1MNDA 2DK5A 3BZKA 2X1DA 3ZQLA 4L5IA 3LL7A 3FK6A 2O6GE 1I1SA 3OYIA 2HPMA 3ZMSA 2A61A 3SZTA 4A3EJ 1HBXG 5BPDA 4G7OF 4ZZLA 4HDUA 5E1WA 2MFZA 3I55I 1RESA 3HUGA 2HDDA 2QEXI 2Y31A 2CQKA 2F4MB 1IUYA 2CJJA 3K1PA 3R61A 2GXGA 4HZFA 3DPUA 1LDDA 2L9VA 1XCBA 2NS8A 2LBFB 3LFUA 5GPCA 3CC2I 3CMMA 2Q2EB 3LSPA 1XS9A 2X85A 1ZR2A 1I39A 3CZ6A 4E70A 2ZJPF 1H88C 1APLC 3CJRB 5BQTA 1USTA 1VZ0A 3SFIA 4DOZA 5TRDA 3PL8A 3LFKA 5DYMA 2PFBA 3Q9VA 4G7ZF 1O7FA 3S3NA 4HEA2 1T6SA 3RI4A 2QYOA 3GZ5A 3M8JA 3DU5A 4RBOA 2W7NA 1SFKA 1WPKA 3QU3A 4PJMA 2H1KA 2EINH 1YX3A 2E71A 4CYCB 2F5VA 5ICEA 4UB8C 4B1RA 4P96A 2YSRA 2ZXHA 3LSTA 3G71I 2E2IJ 4IRIA 3HTUA 4KFCA 1K6YA 1U9NA 4RM2A 1FC3A 3ELKA 2GA2A 3D0SA 2NVUB 2WB1A 3TMOA 4MEXF 2VBWA 2K9NA 2LFBA 4HPQA 2V6EA 4QPQA 3L2QA 3CP8A 3WTZA 3GZ6A 1LQ1A 2EIKH 4V2GA 4YIRX 1XSVA 1T98A 1U5TC 4C2MJ 2JPBA 3EUAA 1TWHJ 3HOUJ 1U8RA 1QO0D 1J7KA 1IUFA 2O7OA 2UWMA 1VI0A 1U5TB 1XGOA 4BXFA 5D5UB 3TQNA 2X9DA 4Y52J 4XRSG 1LFBA 2OCCH 1U2WA 2PEXA 1IN5A 2M0MA 4G6TB 2GOXB 3I56I 3RDIA 4A5MA 4NB5A 1LUJB 1VQMI 2Y9ZA 1KYWA 2DTRA 3HL2A 1VQ7I 2DFHA 3EDPA 3G1OA 3VEPA 2DT6A 3P9IA 4ZC3A 1Z6TA 2MLKA 2XPVA 3JRIA 3S1MJ 2F5CA 1SFOJ 1YFHA 2DOEA 1G3TA 1WCMJ 3BTIA 1NTCA 2OU2A 3WGGA 1A35A 4TV7A 3CUQB 1F1ZA 4EM1A 2A69F 4XIDA 1X3ZB 5DCFA 2R7XA 1G8XA 1J0RA 4PGHA 1EV7A 4AYBA 4G9YA 3BP8A 2CV1A 5K5RA 3FXJA 1IN6A 4IEJA 3R6SA 1R49A 1FMWA 3W2VA 4XKCA 4E7HA 4V2FA 4DYQA 2WBMA 1CQTA 2GM4A 3BR5A 2CRGA 3I0TA 1O4XA 4BE0A 2DAOA 1FIPA 3H92A 1BOAA 2CG4A 1GHCA 1SVOA 3O2PE 3HRSA 4M6XA 3FISA 4OU0A 1X1AA 3GZNB 1AHDP 3PIPF 2R7FA 2DA5A 3CUQC 5JR3A 4IHWA 2VC1A 4J00A 2XKPA 2BY2A 3U2RA 2QWWA 2EV6A 1NG7A 2MBFA 2BXYA 2I10A 1U0JA 1G6NA 1BR2A 3KE2A 5JVTA 4L18B 1ACIA 2F6CA 3K1MA 4I0AA 2NRAC 1OYWA 4NQWB 3KP4A 3HSRA 1ZELA 4I76A 5EF6A 4KT6A 2F5DA 5LGNA 4U87A 4FASD 3K1NA 4I98B 5KCMA 2WB1N 2XAUA 1HKQA 2IP2A 4J01A 1FX7A 2LMDA 2W85A 3CCYA 3OYLA 3CMAI 2FBHA 1I3QJ 3MEXA 2LKXA 1KQ8A 1Y6IA 4U0VA 4M9ZA 3RKWA 1E0EA 2B0LA 2BE5F 3J7AO 2LP0A 2PJPA 5DCMA 1WJEA 4JP0A 3CCRI 3KIOA 2R0QC 1Z1DA 2ME0A 1K4SA 4RB3C 2D1HA 2FU4A 1P4XA 1UZCA 2QSGX 4KNYA 2W57A 4O6JA 3NWSA 3DP7A 3I58A 2RKHA 2VQCA 2DJIA 3CCSI 2Z5UA 1WJCA 4C2UA 5FGMA 5C4JJ 2HOAA 2HEOA 2E34A 5FKOA 4O5VA 1TLHB 3BDDA 2WV0A 4BKXA 2V6CA 2V1DA 3EYYA 2EFPA 3NAUA 2DYRH 4IRHA 2ZSIB 2R7UA 3G2BA 4S05A 4JK1X 4Y3OA 5IOYA 2VE9A 2VKHA 2O8XA 4ZDPA 2P7CB 2HVSA 4HLXA 3ABMH 3C7JA 3DLLF 1KU3A 3E7LA 4HX8A 4WXCA 4XRSA 4YFXF 2FE3A 2ESHA 1HW2A 3CCLI 2BY0A 1USSA 3H0DA 1F43A 3OIQA 2J5OA 2OQRA 4KMUX 2ELJA 2DA6A 5HLHA 2EA2A 2HQNA 2HYJA 4DJAA 5CLSA 4UY8I 4NC6A 1YRNA 2JSPA 3DPTA 1SAUA 2L0KA 3JRCA 1YOVB 2L4AA 2M4KA 3H3ZA 1YW9A 1YYVA 1B1BA 2LY9A 3QOPA 3VB2A 2M1BA 4OINF 1G59A 5KHDA 2OC6A 3CP2A 3KP2A 3ZR8X 5F0CA 1O3SA 1IAWA 1IG7A 2CQNA 5DM7F 2X1CA 3E0JB 1IN7A 2H6BA 2DT5A 4JOMA 5LEKA 2DPUA 3K7AJ 2V1UA 4D9JA 5LEJA 1VNDA 2FD5A 3OMYA 4GFBA 4ENMA 3RPQA 3IC7A 1R5ID 1ETKA 1KQ9A 4PDKA 1SVLA 1ETVA 3FZVA 3VSLA 2STWA 1KQ0A 1R36A 1Q1HA 2X51A 2L2OA 3GBGA 3FHNA 3NARA 4G8XA 2VOOA 2ZFUA 3CCVI 2MD5A 1KONA 3M1EA 1J2XA 2E7WA 2R4GA 4J19A 3VOEA 1D0XA 2E2HJ 2H1LA 4W1UA 2ZSHB 3SEZA 2K85A 4JX5A 3HOXJ 3OSFA 1ON2A 3OS0A 2WV1A 1LVKA 2A5YB 2UV1A 5HODA 5E1XA 2VJJA 3TO6A 2V9VA 5FFXA 1FMVA 1YX5A 5GAEJ 3GTLJ 4A93J 1MH3A 4EJWA 2X6YA 2M8EA 1FSEA 5HOOA 3OOUA 4MHGA 2XB5A 4E7KA 1OISA 4BU2A 1RRJA 3A1YA 3MD2A 1ETQA 1BM9A 3EUHA 3LA7A 1S7OA 2W1OA 5J3LA 2LLKA 2HPIA 1MZBA 4MTDA 1RZ4A 1T0FC 2MSYA 2DA7A 2EZIA 2VXDA 1YJWI 3DBLB 1JE8A 3H35A 3FMSA 3NQOA 2GQQA 2O0YA 4MIMA 1E3HA 4XLAA 4M3BA 3HOZJ 1DGRM 1BA5A 5HS7A 2EFWA 1IDZA 1PDNC 2OZ6A 2BBYA 2LY2A 2TRTA 5EEGA 1S8NA 3ISPA 3F8MA 5IYCJ 4BE2A 1W36C 3KZIC 3S15J 3T8TA 2JN6A 2RV8A 1ULYA 1ZQ3P 1JTYA 2VL8A 1R1TA 4IQJA 1T8IA 1WJ5A 2K9QA 2MC4A 3ZQGA 3TO9A 2OV7A 2JWTA 1MBFA 2DN0A 4L9NA 3U1DA 1IV8A 3Q5FA 3F0CA 2HTSA 4LMYA 1W1WE 2QENA 2BYVE 3BOQA 4JBAA 3RPUD 1PP7U 3WODF 2V7FA 3MZ8A 1VQNI 1D5VA 4CA0A 4EJVA 2AHQA 1VQPI 1B8IB 5DTDA 2IS4A 5CVRA 2X1EA 3C18A 4M3GA 4Z6YA 2VLAA 1MW7A 3ZMDA 3GTOJ 3F72A 4AIJA 5KAIC 2MW8A 3KEQA 1HA8A 3OS1A 3P5JA 3OWTA 4LITA 1C0WA 4MFDA 4XMYA 2DQRA 2BW3B 1GLNA 2G7HA 2WY8Q 3DV8A 4HF1A 3S16J 3FXLA 2VIXA 2FOWA 3F6VA 3SDGA 2B7EA 4KT5C 3ZPLA 3AL0B 3SEQA 1HKSA 4WF2A 4BQNA 3BT9A 3IUOA 5FKNA 1IZ1A 2M2EA 2K27A 4D5FA 2BY1A 4KUMA 1R7JA 2R7WA 1ZR4A 4E7ZA 5LHIA 4CCMA 4CDGA 5M5XJ 2Y0SN 4II3A 3CUOA 4D0PA 3ZGKA 2PN6A 3TOAA 2JA5J 3I3LA 4DBQA 2A07F 2NOJB 3E6DA 3OIPA 1QA6A 4EMSA 4RGXA 1XDSA 3PFYA 4QTRA 3GFIA 2IT0A 3PNYA 1DPUA 2DMQA 1DQUA 4D7MA 1N78A 3BG5A 2HXIA 3MMYB 4C3JJ 1R1VA 4QWQA 4YG2F 3OYEA 4ZDOA 1FZPB 1IF1A 2E5NA 2A3SA 1IRXA 3GFLA 2AXLA 4X0GA 1PUEE 2FQ3A 3HRUA 1X3WB 1ZKGA 2Z9OA 1LDKB 3BCAA 1JJ8C 4A0ZA 1KYZA 1P6RA 3S32A 3LNQA 1B9NA 1AOYA 3FX3A 1OR7C 1YS6A 4R8HA 2NYXA 4B44A 1AA7A 3OSGA 1EH7A 2M4GA 1T08B 1B8IA 1T56A 1MBKA 1BC7C 2TDXA 2IEKA 3QAHA 4HAMA 1MJAA 2ECBA 5J8CA 3F3XA 3EUHC 2QBYA 3HRMA 2WTEA 2O03A 3O8GA 3BQZA 3C2HA 3U21A 2R7TA 1WI3A 3QPHA 4P5OA 2UUZA 2XAGA 2DFEA 4I09A 2JA6J 4HSTA 2NVQJ 3WE3A 4WX9A 4H4KC 3C2BA 1FPQA 3EQLF 1OYIA 4Y17A 2QM3A 3PM1A 1ETYA 2VB6A 3ZQFA 1ZG1A 3IP4B 1TL8A 4BGDA 4F7ZA 4HW0A 3KZZA 4M9SA 3K70C 1W7PB 2XRLA 2OAZA 4AD9A 5B66C 3QYEA 2O9LA 1JUPA 4XBFA 5IP7J 3DFGA 4CO8A 5EEHA 3V7CA 3WTSC 1SMTA 3ZQ7A 1WFXA 4XR6A 1M1EB 2ELHA 3LSJA 1OPCA 3L2WA 1X2NA 2IRFG 1BI0A 2Y48A 3RKYA 3DKYA 2EFQA 1Y56A 1KZHA 5E8IA 3CCJI 2Y75A 1MMNA 4EQQA 1Y1WJ 3WU0A 5L3GA 2LREA 2OA4A 3H5AA 4XOTA 2QSHX 1WWXA 4Z2YA 5KNLA 3ABTA 2ZXWH 2K7LA 2X6OA 5BPIA 2DOAA 1G2HA 3LSHA 2XIGA 1H8AC 4ENKA 3NRVA 4HBLA 1MBEA 4IHXA 2XAHA 2XF5A 3ZXSA 2XC7A 1ZRFA 2W4SA 1HOMA 1TBXA 1VQ8I 3A01A 2XUBA 3PJRA 1W7PD 1X2MA 3V7RA 1B72A 3J81Z 1DP7P 5F64A 3ZMZA 3BTJA 4E4HA 1R4NB 1GVDA 3GTKJ 3FBNB 3F6OA 2Y2ZA 4XICA 2HS5A 4BDYA 4PCQA 1XB4A 5HS8A 3DEWA 4OMZA 4Q4ZF 3GF2A 1P2FA 1PP8F 3JSPA 1XGMA 4MO7A 3KCCA 1T2KA 3HOTA 2KIFA 3PFIA 3W2WA 2ESNA 2FMYA 2ISZA 1TNTA 2ZJQF 4I6ZA 1BIBA 2ELKA 3BR0A 4PFPA 1NH3A 5ILUA 1ZG5A 1JUMA 4DW6A 1SANA 1RUNA 5H6RA 1VQ5I 3HOSA 2PMZA 4ZH4F 3OYCA 3S1NJ 1LDJA 3OYNA 1MBHA 3KP7A 1JJ6C 1YRNB 3GWZA 4P1WA 3E3VA 3L1PA 2L7MP 2QQAA 4CYCA 1MMGA 4BEHB 5BOXA 3HPHA 4HDVA 3HSFA 3B6CA 4BY7J 4HQEA 1VQ4I 4NDLA 4B3AA 1SFEA 1WGXA 2M7BA 2R5YB 1WJFA 3MKLA 3O8HA 2FA5A 4GYIA 3KETA 2ISYA 4N4OB 4ESFA 2ID6A 4RB1A 4LG3A 3RSNA 2EV0A 5B3SH 2F5EA 5CQEA 1RR7A 2KPMA 3LWFA 5LD2C 3N4MA 4MEYF 1FLIA 3HZJA 1RIOH 4CCOA 5TISC 1JGGA 1B4AA 1BR1A 1YG2A 4IRGA 5FKLA 4KN4X 5IOZA 2VE8A 4PGGA 1O57A 3ABKH 1IJWC 5JLWA 1R6RA 4YELA 4NNJA 1OCZH 3FMRA 5D8LB 2KIQA 3M4OJ 1HXDA 1EJ9A 1BI1A 4PJNA 2XAFA 2BHYA 1W5CC 5GAHJ 1TT0A 2J5PA 3J80K 5LHGA 3OYDA 1QPIA 3J81K 4BAYA 3CC4I 4IO9F 4HF2A 2B63J 1X4OA 3U1KA 2LVSA 1VQ9I 2V1XA 5M3MJ 1HSJA 4BJ5C 1FOWA 2EB7A 4LK1F 3KP6A 3K0LA 3FMQA 4BJ6C 4C3IJ 1WHUA 3M8FA 4EV0A 6PAXA 1SAXA 1ERDA 1DDNA 4PSWA 1FP1D 2EV5A 5AIPA 3SFZA 2LF7A 2H8WA 3E5UA 3RQ4A 1TP4A 1HQCA 3CC7I 3J80Z 1BC8C 2H6CA 4A3LJ 2QGUA 1HF0A 2FBKA 2BZTA 2L4MA 1IGNA 1PUFB 4XL9A 2UZKA 4L9VA 3T8RA 4L5EA 4K2EA 4LLLA 5ERIA 4U0WA 3KYDB 1P7IA 4HF0A 4XLPF 4BACA 4XLNF 1OYYA 1Y39A 1QBJA 1ZH5A 2ZJ2A 3QYBA 2R7QA 4G6QA 2R93J 2BGCA 3WTWC 5CKTA 4AVPA 4MQVA 5H20A 2LD5A 1W4MA 1GXPA 3D5SC 3REOA 3LSIA 3CJQB 4OIOF 5JHUA 5F0FA 4EGZA 3A4CA 2F2EA 3FK7A 3A03A 1XMXA 1ZAOA 4NHJA 2LTPA 2KJCA 4ASNA 5K7FA 3HC7A 2CSOA 2VT3A 2EH3A 4OAZA 3S1QJ 2KP6A 2QSFX 1R1UA 2V1NA 3L7WA 2ZCWA 5DDGA 3BY6A 3K4CA 5LFAA 3S3MA 2V79A 2W25A 3BC8A 4FT8A 2X48A 3KP3A 3MZHA 2VQGA 2BY3A 3IWFA 1FYKA 2K9MA 1WH7A 1QZEA 3W6VA 4EM2A 4F93B 2QZ8A 1Z9CA 1V55H 2MD0A 4UUSB 1E17A 1U5TA 5LRSA 2Q8KA 2PG4A 3H9JA 1TWCJ 4EJOA 2F48A 3OYBA 3NEUA 4BJTA 2D1VA 1YS7A 1JKQC 3PQJA 3W2AA 4I0BA 2VI6A 4JX6A 3VYUB 1ETWA 4CCKA 2E1MB 4BHCA 1JT0A 3DLAA 3CCQI 4CZCA 3ZCOA 1FTZA 2BW3A 3E5XA 4E6KG 4IPAA 3HYIA 3BR3A 2LC2A 1O3RA 1TNSA 4QSHA 2K02A 4DBRA 1P4WA 2VJIA 2V9KA 3GFMA 4I2OA 3G3ZA 4BNCA 4II2A 2VQLA 5DUKA 3RKXA 4BE1A 4FTHA 3BG9A 1SD4A 3IKVA 2CUFA 1DU6A 3AG3H 4OAYA 4A0XA 2E1MC 3FXMA 4DZJA 4A3GJ 2ZMEC 3JREA 1BBYA 2Z16A 5C3EJ 1OCTC 3LA3A 5J40A 4IOCF 4BL0B 1SMYF 4BUPA 3F8CA 1ZGAA 3MQ0A 1AWCA 3EYIA 4IHYA 1D1BA 2HVQA 4WXHA 4CYDA 3A2KA 5BNGA 4BBSJ 3O6BB 1JT6A 1J9IA 2VKDA 3HM5A 4XLHA 1MGTA 1LB2A 1R9TJ 3JRAA 2Y69H 1OLTA 3WG9A 1ZLKA 4M3EA 1SFUA 3WTYC 2PJRB 2DA2A 3S2WA 3PNVA 2EILH 4A2UA 5L3EA 3OYGA 4CHUA 5EZHA 5HDGA 1S3JA 2KZVA 3W6JB 3E6BA 1X1DA 2QBYB 4HV5A 3IH3A 3LSRA 2A5WA 1H9GA 2YR2A 1R5HA 3I71A 2ID3A 2QCOA 2LRDA 4GRIA 2KDZA 5DM6F 3KYCB 3CF2A 4HYEA 4EJUA 2JRMA 3D5RC 5E3OA 4AM3A 3K70D 4GO1A 2L7KA 4D7NA 4HNUA 5HLGA 2FNPA 1Z21A 3CDHA 2OD5A 1RNLA 1PVEA 1XC5A 1W7PA 2ACJA 1LE8A 1ZGWA 5HLIA 3E1SA 1JXSA 4XQFA 2JMWA 1MNMC 5TJJA 2DMNA 1J09A 2IBDA 3J7ZI 1RR8C 1F4KA 4LB5A 4D1QA 4EATA 3DQVC 4EM0B 4A3KJ 9ANTA 3G73A 3B02A 4OWRB 2O5RA 3ECHA 4AC0A 2LBFA 3HGGA 2PBIA 1WI9A 2HNHA 5C4XJ 1B9MA 2X6XA 5K5QA 3CO6C 1HC8A 3E5QA 2P8TA 3F9KA 1DGWY 2CGPA 2CUEA 1U8BA 3VYTB 1X3UA 3AFHA 2BHZA 4L0ZB 2X4HA 1DPRA 1XGSA 3H36A 3C2GA 2WAQA 3A01B 5EG0B 2XB0X 1G4DA 4IVNA 1ODDA 2HQAA 1MNEA 3FXKA 4CH7A 4JX4A 3I4PA 2DA4A 3PO3J 2ETHA 3FXOA 1FJLA 4RB0A 4DZPA 1GDTA 1TZLA 2WAFA 2MYSA 2FBIA 1Y1VJ 3CJNA 2CW8A 3TDUC 2RN7A 2KFDA 2K9LA 1V4RA 2O61A 4ZYAA 3HPGA 2NNYA 2I8DA 3SZPA 5F0HA 3C3WA 3OR2C 2LOOA 2KLOA 1EKEA 3L2UA 2R92J 2M87A 3VDXA 2XKOA 3K4BA 2COBA 3TKYA 3RPUA 3DWLE 3BPVA 1ZGJA 4RLQA 1XX5A 2M34A 5FLXZ 2MABA 2XDVA 1P92A 3HIFA 3WHBA 1GT0C 4QPOA 1MMDA 2MLGA 1GUUA 3DKWA 2HYFA 1VQOI 5EGOA 2LSOA 4DQ2A 4A3IJ 3I59A 3F8BA 3I5UA 3WE2A 3V8LA 1X1CA 3H5NA 5FJ8J 2P5LC 5D4SA 1ZREA 4R79A 4IHSA 3ZQHA 2VJ4A 3DTIA 3G1MA 4RGSA 3ZQIA 2VN2A 2KJBA 3TW6A 2P6SA 4DIQA 1QHGA 2HXOA 2IXSA 2XV4S 2QKMB 1I27A 5CPRB 4N4NB 2RVCA 5JHFA 2DO7A 4BS9A 1OFCX 4B3XA 1UHSA 4B4CA 3HTSB 5JFRA 1QVUA 1YHQI 1ZYRF 1IRFA 3H3UA 1P4AA 5CYVA 3TGNA 5L3CA 1L3LA 2CQXA 2UXNA 4XSXF 3X2QH 5M3FJ 3BTCA 1Y0UA 4WWCA 2XRNA 2R3SA 2I5UA 4F92B 2EBIA 1QHHD 2OBPA 3WTUC 2VC0A 3CUQA 1Y8RB 2CWEA 2D2WA 4HV6A 4ZZDA 1UB9A 2KIUA 2QQBA 4DYCA 5A2QZ 1D0ZA 3EPZA 3QPTA 2R7VA 1SD6A 1S6LA 3Q3SA 1ETOA 1YIJI 1H0MA 1D8JA 3GTGJ 1RKTA 3BJ6A 4S0HB 4DYRA 2HOSA 2OZUA 1B59A 3FKIJ 1LEBA 2PQ8A 2DBBA 4EGYA 2CU7A 3Q0VA 4RA2A 5FO5A 2EFOA 2RQQA 1XSDA 3OYKA 3ROUA 3TOBA 2EIMH 5CJ9A 2KKOA 4MGRA 4Y7NJ 5BMZA 2XGCA 1FOKA 2PI0A 2QVOA 1A6QA 3S14J 2HQRA 2P6TA 3QU6A 1XDUA 2DLLA 1LFPA 2LNBA 2OQGA 3MVPA 4AIHA 1ON1A 3TW7A 2M9HA 2HDWA 3ZOBA 1BW6A 1T95A 2CO5A 4G12A 4ZTFA 3QPLA 5EGOB 3BROA 4WXDA 4N0BA 4NQWA 2KRCA 1JUSA 4RGRA 3HSEA 1FWZA 3ZMTA 4DGWB 3B73A 1FYLA 4P55A 3LQRA 3L2VA 5DD8A 1Y0NA 1Z3XA 3ESWB 5C44J 2E60A 3CLOA 3LSKA 3I64A 3DBHB 3RCOA 1W5SA 2XAJA 3PUBA 5FLXK 2EIJH 2FUG2 4RAGA 1VQ6I 3TP3A 3M3YJ 3IAM2 2WY7Q 2JK3A 1Z67A 4XLFA 1KA8A 2VQHA 3LSGA 4C30A 1A04A 5EEAA 4PJJA 4I7HA 2NS7A 2GXAA 4UVBA 4Y4RA 4RS8A 2JUCA 2E7XA 2GBYA 5FD6A 4LG0A 4BQOA 3KEYA 2VJ5A 3DBRB 3EETA 1REPC 4EJTA 2B9SA 1BI3A 2IGNA 2XASA 3FIWA 4LK0F 1DUXC 2FXAA 4CICA 5B1AH 3COAC 1QVTA 3M7GA 1R23A 3K2ZA 3JCUC 5D6FA 4GXOA 1S72I 5LGTA 4C2TA 2WADA 3DXJF 2CUZA 3WGHA 4OMYA 2Q0OA 2AQFA 2KQRA 3HJEA 4HQMA 3UKGA 3MFKA 1S7EA 2JVGA 3HOVJ 3CCUI 2ZBKA 2WC2A 3GX4X 2OJED 2Y30A 4WCGA 2AQEA 3IHUA 4UHTA 2BOLA 4LFUA 5K1YA 3I54A 1O7LA 3GTQJ 1EH6A 1ZARA 4AYBN 2E19A 1XMAA 2L5QA 3OIOA 2YX7A 5FLVA 5E3MA 2VBZA 3PUFA 4IJAA 2VUMJ 1IRZA 4CSWA 4M74A 2OUMA 1QNTA 5EYRA 1JGSA 4M9XA 4S04A 4AIKA 4JYKA 4XOPA 3ERMA 5F04A 3ZN0A 3OYJA 2L9SA 3DTEA 1I6XA 1UG0A 1Z7LA 4D5CA 2TCTA 2XGDA 5GTIC 4PFOA 2E35A 4KYWA 4EEFG 3GFJA 2VXZA 1JHHA 1IN8A 4BXXJ 2XVCA 1SVMA 1Z7UA 1WKMA 1OR7A 5FKKA 1Z6RA 4AU7A 5LHHA 3IRRA 3PO2J 4ZYGA 5J47A 1KU7A 3R4KA 1KU9A 1OCPA 3ZP5A 2MG4A 1UHMA 1ZN2A 4PJLA 2BVLA 3OY9A 2L02A 1D1CA 2A6TA 4AWXB 3IL2A 3KP5A 5IP6A 3RYRA 5E17F 3ONQA 1K7AA 3GCMA 5D5XB 1XPXA 3ZMVA 4LJZF 4MNUA 4BDZA 3GTMJ 5IT3A 5J4YA 2NS0A 2GXBA 3SJMA 4YFNF 1BL0A 1X4PA 1T0FA 2W24A 2A6HF 3DEUA 3K10A 4GGGA 3SXYA 2CH0A 1T33A 1N77A 4KISA 4LLNA 3CJTB 3S2DJ 3JAMZ 3PQKA 4B43A 3ABUA 1IRGA 2R7RA 2CMPA 1ZG3A 4XNFA 1OKRA 5HNFA 2A68F 4N9IA 2CV0A 4W97A 4CZZA 3MCZA 4LB6B 3VWBA 5D5VB 1BI2A 1GV2A 1WRJA 2X0LA 3H0GJ 3IH4A 4BQAA 1MJ9A 3OOPA 2YX4A 5F27A 4H0EA 1TWGJ 3SZGA 1S29A 1MH4A 2Q2EA 3UNGC 2V9PA 4KICA 5DUIA 4CUGA 1V54H 2DT7B 2MH9A 2M0CA 4FHTA 4LIVA 3OYAA 2HZDA 1D1AA 2JVHA 2UXXA 1F9NA 1ZK8A 3T1BA 1LFUP 2VONA 3DCFA 4NC8A 2HYGD 3OL3A 1FP2A 2MA3A 2HVRA 2GA1A 1MMSA 3F21A 3GLLA 4ZYDA 1FYMA 4CXFA 2FEZA 2CYYA 1GVJA 2G7UA 1R71A 3DPLC 1FIAA 3OL4A 2VASA 2XHKA 1L0OC 4XRMA 3K9TA 4XORA 4EVIA 2RREA 2C6YA 2R5ZB 2LDUA 3QODA 1S5LC 3MKYB 3CF5F 2JA2A 4ZTJA 5M5WJ 1W5TA 3CDIA 4F55A 1R4MB 2GAUA 2OTJI 4IF4A 2HFHA 2IA2A 3GVAA 2G0EA 1UCRA 1LE8B 1SD5A 1MDMA 1HCRA 2IPQX 3E6MA 5GAGJ 1BR4A 3BG3A 4BY1J 4RLFA 2P81A 1SD7A 4CCJA 2Y9YA 4U88A 5EG0A 4L0YB 1N75A 5J4VA 2JQ7A 1OJLA 2NOGA 3LMMA 5IYBJ 5J8FA 3BPXA 2FSWA 2IA1A 4KN7X 2KT0A 2ZMEB 4G7HF 2K86A 2DI3A 2RDPA 1TT5B 4XKVA 2IS2A 1YI2I 3OYFA 2VODA 4UUVA 4A6DA 3R0JA 4HG2A 4Y13A 1WJAA 2K9SA 1HLVA 1WZ2A 1JI8A 1VF9A 1YW7A 2FF4A 2P5VA 2W82A 3HKZA 3KFWX 3GW2A 4ENNA 1HW5A 2K3FA 1HKTA 1P7JA 4GYGA 2K4JA 1IN4A 1IC8A 4Y15A 4M6YA 1LVAA 4ETSA 2HQ5A 2Z2SB 5IT9Z 4HNTA 4IHTA 2O8KA 2QQ9A 1XMKA 1I6HJ 2H09A 2L54A 1UAAA 2CS3A 3HHGA 3DU6A 2DU9A 2IS6A 3PSFA 3CQZJ 5E79C 3WU2C 2L9NA 4UV9A 2LYCA 3QOEA 4U7BA 3SDBA 1YW8A 3MKWB 3VYSB 5IPAA 1HDPA 4A12A 1I50J 4PK4A 2JA7J 2JJ7A 3ABLH 2ZFWA 2F4IA 2JPCA 3GYHX 2K3PA 4RAZA 1RUOA 3C1DA 4A3CJ 1WSUA 2IA0A 1AKHA 2G9WA 1K6OA 3JRGA 4RDUA 2ADUA 2ME6A 1YO5C 2WA0A 3FXRA 2XSJC 4M72A 3RZOJ 4R1HA 2LG4A 3ECOA 2KZGA 5HDKA 1IW7F 2KDOA 5DV5A 2XGXA 2YUSA 1UHWA 1G3YA 4N9HA 3PSIA 1U78A 4PZJA 4IOAF 3JR9A 5HLTA 3VPRA 2DMTA 4Y33A 5H6QA 3I9V2 3CCEI 1VFCA 4CCLA 3M1CA 5D8KB 1MJBA 3HOWJ 2IS1A 5M5YJ 2STTA 4XRFA 3BR6A 3LOCA 3H9QA 4LD5A 2R7SA 4A3DJ 3N05A 4LOCA 1UG2A 1ZRDA 2KRHA 3J7AY 1ZTRA 3A0HC 3D1NI 2OF7A 2CW7A 4E7SA 1TC3C 4IL6C 5LRRA 2PMHA 3A02A 2MC3A 1ZLJA 3B6AA 4LGWA 3AL0C 1U6GA 1EA3A 1JHFA 1R5GA 2M30A 4MLOA 3JTHA 1FBUA 3G6EI 3Q0WA 1WJBA 1W36D 1MKMA 2DODA 1WVRA 3QRFF 1UJ8A 3K4NA 4MQ9F 3HEFA 3W3CA 1JKOC 4I02A 2K4BA 4MFEA 3E6CC 1MSEC 1E3PA 3QP6A 4ABZA 5FLMJ 2RNGA 5HVQC 3HKZN 2IGKA 1FTTA 4P9FA 4RAFA 1YITI 2Y0SA 1UFMA 1WJDA 3AKZA 5FRMA 1CGPA 3SHFA 1IXRC 2VOPA 1FNNA 3MWMA 4UUSA 2R7ZJ 3QPSA 1TW2A 1XTAA 2CQ7A 2HGCA 2LY1A 3ML6A 1K4TA 2QUFA 1B72B 2VT2A 2BVMA 2IAIA 1OCRH 3M8EA 4NC7A 3FM5A 3HOYJ 3RIRA 5HS9A 2BXZA 2EZLA 3BJOA 4FX4A 4A3FJ 2DW4A 2JUGA 4LG0B 1TQPA 2LF8A 4X1EA 5CVIA 1PJRA 3RJPA 4A5NA 1TWFJ 2VBYA 3KZYA 4G6DA 1EF4A 1CF7A 4YIFA 4DNCA 4FE4A 1MD0A 1AKHB 1TQMA 5CQGA 1ORKA 3QQAA 5J1RA 3FXUA 2VBXA 1I1GA 3GTPJ 4ANJA 2ECCA 3OR1C 3P9KA 2K40A 4HLYA 2OTLI 4ZYEA 1Z91A 3ZQQA 4BYYA 2OPTA 3TO7A 1QGPA 4LIUA 1EH8A 4BH9A 1LPQA 2DK8A 2ZXJA 3HBLA 5CVJA 1NK3P 1Z3YA 4NUBA 2MGQA 4PSXA 2HU9A 4XM3A 2QF7A 3TP0A 2XF7A 2E1OA 4IQ4A 1Z77A 1BW5A 3QP5A 4F52A 1YIOA 5A2QK 3L00A 2GIVA 3BQYA 2XAQA 2H94A 3KYLA 1VQLI 1V3FA 5F1RA 2NAZA 3CMEI 1B6AA 3TL4X 3IV5A 3MAJA 3QWLA 3S3OA 1K78B 4YFKF 4QIWN 3IWZA 1BIAA 4YRVA 2CFOA 5K7HA 3LAJA 1IXSB 3F8FA 4BXUA 3H3VK 1DP3A 1UMQA 1K83J 3CD6I 5TGTA 3L2RA 4U0YA 4XSZF 5AONA 1V5EA 5CVVA 1PUFA 1W0TA 3L09A 3WG7H 2LKPA 2BEOA 2HDCA 1OCOH 2DMUA 3U9GA 3BWGA 2KISA 1J75A 3DTKA 2DJNA 1MMAA 2VKVA 4I01A 1TWAJ 4GCVA 4ITVA 1G3SA 5F6FA 2H8RA 1ZRCA 2RNJA 3H9GA 4KMFA 1FSHA 5D4RA 1XN7A 5EJCA 1TTYA 3QYFA 5D5WB 3WTXC 4L5JA 4BHBA 4HNVA 1Q1VA 5FROA 3FKJA 5KAFC 1S9HA 4B48A 2DYSH 5EZGA 1W0UA 3KPHA 2CUJA 3HXLA 4IHVA 3LA2A 1J5YA 3GO5A 3A0BC 2HKXA 5E1ZB 1FOYA 1SC7A 2HKOA 3H1CA 5ILSA 1FY7A 2RGVA 2EWNA 3FDYA 3GLXA 2KRFA 4FQGA 4KA4A 3OYMA 1BOBA 3HDDA 5E3LA 2QKLB 4M3FA 3V42A 3KX2A 2FRHA 5LLQA 2EQRA 5DEQA 4IX7A 1Z0XA 4M73A 1ETXA 2V26A 3KLNA 5J1YA 4A69C 2M8GX 5ED4A 1J59A 2HWVA 4KDPA 3FWEA 5CVUA 5J1UA 3IH2A 2DA3A 3RKQA 4V19K 2F4OB 5E8GA 1E3OC 1FEXA 1YLFA 1YTYA 1FOXA 3VSKA 1RETA 1X1PA 3VODA 3AAFA 1K79A 3LSMA 1T38A 5E3NA 3BZ6A 1VTNC 4RGUA 5GP9A 1MSFC 2LK2A 3R60A 1QRYA 4E7JA 3VYRB 1V5GA 2QQ8A 3K69A 3HUGB 3J7YJ 3JAMK 3HHHA 4UNOA 3E97A 2ZNYA 4AUXA 4IKFA 2CQQA 4KJZA 4QLCU 1MDMB 2FOKA 4HA8A 1U9OA 5EDNA 2KHMA 4UB6C 3CDLA 2L01A 3JW4A 2FQ4A 3GMEA 1HW1A 4FISA 4B09A 1HSTA 2NVTJ 1YE9A 2R5ZA 2DCEA 4ON0A 2DPDA 3L2CA 2K5CA 5K7ZA 1RI7A 4YEJA 3R0AA 1ITYA 1SFXA 4XLCA 1RPWA 2FJ1A 4U7DA 1YQAA 3IAS2 2OCEA 1WQ2A 2HI3A 3BCBA 3HGYA 3TBIA 1JKRC 3D5LA 4CCNA 2KMUA 2HZTA 1LKXA 4M3DA 2ZJRF 2ZMEA 2XROA 1BN5A 4XKBA 3DEEA 3HG9A 5HDNA 1QQIA 5BS6A 1IO2A 2BV6A
chains in the Genus database with same CATH topology
2WWYA 3FF5A 3KLOA 2QLZA 5AIQA 2P5KA 4ENJA 2YPRA 4IXAA 5KK1A 2D45A 2JSCA 3DF8A 4BHPA 5JI6A 5L3FA 4UVAA 2PMUA 2P7VB 3CTAA 4MTEA 1QPMA 1BJAA 5J6XA 3GUDA 5DD4A 3RYPA 3T0YA 2NNNA 1FBSA 1LNWA 2FMLA 3F23A 1XD7A 2JRTA 4UVCA 3V4GA 4A6EA 1STZA 3ZMUA 3L9FA 2Z99A 4UV8A 2M45A 3KEOA 3BJAA 4RAYA 1LJ9A 4Q47A 5D6EA 4B8XA 3ERED 2YU3A 1IXCA 4OIQF 2AS5F 1R22A 3IRQA 5E18F 1XSXA 5KVRA 2Y0MA 3ZN1A 1NHAA 1D8KA 5FFZA 1T39A 4UXNA 3MZYA 5ICCA 2A6EF 4G94A 4KIBA 1U3EM 5L3BA 4OOIA 2IW5A 5ICFA 4RB2C 2Z3YA 3F22A 5LGUA 1TW3A 3P7NA 2ZKZA 4HOBA 2IJLA 3V8KA 5ILVA 3VFZA 3HRTA 5DCMB 2E1NA 3FXQA 4HX4A 4L9TA 3GEZA 2MH2A 3I59B 1TQIA 1KU2A 3Q9SA 4ZYHA 5E20A 3FHZA 1I5ZA 3WTTC 2HTJA 3WU1B 1FT9A 2M5WA 2H27A 1ZHFA 3N97A 1Z05A 1R58A 3LQQA 2L3DA 4WK8F 1CF7B 4YIIA 3LAPA 1E2XA 2HOEA 4ESJA 4FX0A 2JT1A 3FM3A 2EJRA 4OIPF 4Q5SF 3CO7C 3P9CA 2CFXA 3OV8A 4M71A 1K78A 5K5OA 1F5TA 3I53A 3RTRA 4CGZA 3F8NA 3T5XA 2HR3A 2EA4A 2RQPA 1LEAA 2IVMA 3SQNA 1ONVA 2R7DA 4ESBA 4A0YA 1GXQA 3WGIA 2KIMA 2RC4A 2CW0F 4O3MA 2W84A 5L3DA 3JSOA 2F5FA 4KIGA 3V8JA 3W6KB 1H9TA 1R00A 2GZWA 5ICGA 1OMIA 3JTGA 2EFNA 1D3YA 4P9UA 2Z33A 4OIRF 3V7SA 2GWRA 3M9AA 1QZZA 1FBQA 2DFIA 5LBQA 3IKTA 2ZO4A 2COMA 2JZYA 2EK5A 3TDZC 1QZYA 3WTVC 2O3FA 3ULQB 4LLGF 1S7AA 3O3KA 1G3WA 3GXOA 4JQFA 4Q48A 4KIFA 1O3QA 2FNAA 2ZNZA 1XCVA 1O3TA 2DQLA 5FD5A 4L9JA 4HX7A 1XGNA 2E1CA 5IT9K 2PLYA 1KGSA 2P4WA 2JTVA 5FB2A 2DK5A 4L5IA 2O6GE 1I1SA 3ZMSA 2A61A 3SZTA 1HBXG 5BPDA 4G7OF 4ZZLA 4HDUA 5E1WA 3HUGA 2CQKA 1IUYA 3K1PA 3R61A 2GXGA 4HZFA 1LDDA 1XCBA 4E70A 5BQTA 1USTA 5TRDA 5DYMA 3LFKA 4G7ZF 2PFBA 3Q9VA 1O7FA 3RI4A 1T6SA 2QYOA 3GZ5A 3QU3A 5ICEA 4P96A 2YSRA 3LSTA 4IRIA 3HTUA 4KFCA 1FC3A 3ELKA 2GA2A 3D0SA 4MEXF 2VBWA 3WTZA 3GZ6A 1LQ1A 1XSVA 1T98A 1U5TC 2JPBA 1U8RA 1QO0D 1J7KA 2UWMA 1U5TB 1XGOA 5D5UB 3TQNA 1U2WA 1IN5A 2PEXA 3RDIA 4A5MA 4NB5A 1KYWA 2DTRA 3EDPA 3VEPA 3P9IA 1Z6TA 2MLKA 2F5CA 1YFHA 1G3TA 2OU2A 3WGGA 4TV7A 3CUQB 1F1ZA 4EM1A 2A69F 5DCFA 1J0RA 4PGHA 1EV7A 4G9YA 3BP8A 5K5RA 1IN6A 3R6SA 3I0TA 2DAOA 3H92A 1BOAA 2CG4A 1GHCA 3O2PE 3HRSA 4M6XA 4OU0A 2R7FA 3CUQC 5JR3A 2VC1A 2XKPA 3U2RA 2QWWA 2EV6A 2MBFA 5JVTA 1G6NA 3KE2A 4L18B 3K1MA 4I0AA 2NRAC 1OYWA 3KP4A 3HSRA 2F5DA 5LGNA 3K1NA 4I98B 1HKQA 2IP2A 1FX7A 2W85A 2FBHA 3MEXA 1KQ8A 4U0VA 4M9ZA 3RKWA 2B0LA 2BE5F 3J7AO 2PJPA 5DCMA 1Z1DA 4RB3C 2D1HA 2FU4A 1P4XA 4KNYA 2W57A 4O6JA 3DP7A 3I58A 2RKHA 2Z5UA 5FGMA 2HEOA 4O5VA 1TLHB 3BDDA 2WV0A 2V6CA 2V1DA 3EYYA 2EFPA 4IRHA 4S05A 4JK1X 2VE9A 2O8XA 2P7CB 4HLXA 3C7JA 1KU3A 4HX8A 4WXCA 4YFXF 2FE3A 2ESHA 1HW2A 1USSA 2J5OA 2OQRA 4KMUX 5HLHA 2EA2A 2HQNA 5CLSA 3DPTA 2L4AA 3H3ZA 1YW9A 1YYVA 1B1BA 3QOPA 3VB2A 2M1BA 4OINF 3KP2A 1O3SA 1IAWA 1IN7A 2H6BA 2DT5A 5LEKA 2DPUA 2V1UA 5LEJA 4ENMA 3RPQA 3IC7A 1KQ9A 4PDKA 3FZVA 2STWA 1KQ0A 1R36A 1Q1HA 2VOOA 4G8XA 2MD5A 3M1EA 1J2XA 2E7WA 3VOEA 1ON2A 2A5YB 5E1XA 3TO6A 2V9VA 5FFXA 4EJWA 5HOOA 2M8EA 1FSEA 4MHGA 1BM9A 3EUHA 3LA7A 1S7OA 1MZBA 4MTDA 1RZ4A 1JE8A 3FMSA 3NQOA 2GQQA 2O0YA 5HS7A 2EFWA 1PDNC 2OZ6A 2BBYA 5EEGA 1S8NA 3ISPA 3F8MA 3T8TA 2RV8A 1ULYA 1R1TA 3TO9A 4L9NA 3U1DA 3Q5FA 2HTSA 4LMYA 2QENA 3BOQA 2BYVE 4JBAA 1PP7U 3WODF 1D5VA 4EJVA 5CVRA 3C18A 3ZMDA 3F72A 4AIJA 3KEQA 1C0WA 2DQRA 2G7HA 4HF1A 3DV8A 3F6VA 4KT5C 3ZPLA 1HKSA 4WF2A 1IZ1A 2K27A 4KUMA 1R7JA 5LHIA 4CDGA 3CUOA 4D0PA 2PN6A 3TOAA 2A07F 3E6DA 4EMSA 4RGXA 1XDSA 2IT0A 1DPUA 3GFIA 1R1VA 4QWQA 4YG2F 1FZPB 1IF1A 2A3SA 3GFLA 2AXLA 1PUEE 2FQ3A 3HRUA 2Z9OA 1LDKB 4A0ZA 1KYZA 1P6RA 1B9NA 1AOYA 3FX3A 1YS6A 4R8HA 2NYXA 1EH7A 1BC7C 2TDXA 3QAHA 4HAMA 1MJAA 5J8CA 3F3XA 2QBYA 3HRMA 2WTEA 2O03A 3QPHA 4P5OA 2XAGA 4I09A 3WE3A 4WX9A 1FPQA 3EQLF 1OYIA 4Y17A 2QM3A 1ZG1A 4F7ZA 4HW0A 3KZZA 4M9SA 1W7PB 2OAZA 4AD9A 4XBFA 3DFGA 4CO8A 5EEHA 3V7CA 3WTSC 1SMTA 3ZQ7A 2ELHA 1OPCA 2IRFG 1BI0A 2Y48A 3RKYA 2EFQA 5E8IA 2Y75A 4EQQA 3WU0A 5L3GA 2OA4A 1WWXA 4Z2YA 3ABTA 2K7LA 5BPIA 2XIGA 4ENKA 3NRVA 4HBLA 2XAHA 1ZRFA 1TBXA 2XUBA 1W7PD 3V7RA 3J81Z 1DP7P 5F64A 3ZMZA 3F6OA 2HS5A 4PCQA 1XB4A 5HS8A 4OMZA 4Q4ZF 3GF2A 1P2FA 1PP8F 3JSPA 1XGMA 3KCCA 1T2KA 3HOTA 2KIFA 3PFIA 2ESNA 2FMYA 2ISZA 1TNTA 1BIBA 5ILUA 1ZG5A 1RUNA 5H6RA 3HOSA 4ZH4F 1LDJA 3KP7A 3GWZA 3E3VA 2QQAA 5BOXA 4HDVA 3HSFA 4HQEA 1SFEA 2FA5A 4GYIA 3KETA 2ISYA 4ESFA 4RB1A 2EV0A 2F5EA 3LWFA 3N4MA 4MEYF 1FLIA 1RIOH 1B4AA 1YG2A 4IRGA 4KN4X 2VE8A 4PGGA 1O57A 3FMRA 5D8LB 1HXDA 1BI1A 2XAFA 2J5PA 3J80K 5LHGA 3J81K 4BAYA 4HF2A 2V1XA 1HSJA 2EB7A 4LK1F 3KP6A 3K0LA 3FMQA 3M8FA 4EV0A 6PAXA 1SAXA 1DDNA 1FP1D 2EV5A 5AIPA 3SFZA 2LF7A 3E5UA 1HQCA 3J80Z 1BC8C 2H6CA 2FBKA 2L4MA 2UZKA 4L9VA 3T8RA 4K2EA 4LLLA 5ERIA 4U0WA 4HF0A 4XLPF 4XLNF 1OYYA 1QBJA 1ZH5A 2ZJ2A 4G6QA 2BGCA 3WTWC 4AVPA 4MQVA 5H20A 1W4MA 1GXPA 3REOA 4OIOF 5JHUA 4EGZA 2F2EA 1ZAOA 4NHJA 2KJCA 4ASNA 2CSOA 2VT3A 1R1UA 3L7WA 2ZCWA 5DDGA 3BY6A 2V79A 2W25A 4FT8A 3KP3A 3MZHA 3IWFA 1FYKA 4EM2A 2QZ8A 1Z9CA 1E17A 1U5TA 5LRSA 2Q8KA 2PG4A 4EJOA 3NEUA 2D1VA 1YS7A 3PQJA 4I0BA 4BHCA 3E5XA 4IPAA 3HYIA 1O3RA 1TNSA 2K02A 1P4WA 3GFMA 4I2OA 3G3ZA 4BNCA 5DUKA 3RKXA 1SD4A 3IKVA 4A0XA 1BBYA 3LA3A 1SMYF 3F8CA 1ZGAA 3MQ0A 1AWCA 3EYIA 4WXHA 4CYDA 3O6BB 1J9IA 1MGTA 1LB2A 1ZLKA 3WG9A 1SFUA 3WTYC 3S2WA 4A2UA 5L3EA 4CHUA 5HDGA 1S3JA 3W6JB 3E6BA 2QBYB 4HV5A 1H9GA 2YR2A 1R5HA 3I71A 4EJUA 4HYEA 4GO1A 5HLGA 2FNPA 3CDHA 2OD5A 1RNLA 1W7PA 2ACJA 5HLIA 1JXSA 5TJJA 1F4KA 4LB5A 3DQVC 4EM0B 3G73A 3B02A 3ECHA 2PBIA 1WI9A 1B9MA 5K5QA 3CO6C 3E5QA 2P8TA 2CGPA 1X3UA 4L0ZB 2X4HA 1DPRA 1XGSA 1G4DA 4IVNA 1ODDA 3I4PA 2ETHA 4RB0A 2FBIA 3CJNA 3TDUC 2RN7A 1V4RA 2O61A 2NNYA 3SZPA 3C3WA 2M87A 2XKOA 3TKYA 3RPUA 3BPVA 1ZGJA 5FLXZ 1P92A 3HIFA 2MLGA 3DKWA 2HYFA 2LSOA 4DQ2A 3I59A 3F8BA 3I5UA 3WE2A 3V8LA 2P5LC 5D4SA 1ZREA 4R79A 4IHSA 4RGSA 2VN2A 2KJBA 2P6SA 2XV4S 1I27A 2RVCA 2DO7A 3HTSB 5JFRA 1ZYRF 1IRFA 3H3UA 1P4AA 5CYVA 3TGNA 5L3CA 1L3LA 2UXNA 4XSXF 1Y0UA 4WWCA 2XRNA 2R3SA 2OBPA 3WTUC 2VC0A 3CUQA 2D2WA 2CWEA 4HV6A 4ZZDA 1UB9A 2KIUA 2QQBA 5A2QZ 3QPTA 1SD6A 1S6LA 1H0MA 1D8JA 3BJ6A 2OZUA 1B59A 1LEBA 2PQ8A 2DBBA 4EGYA 5FO5A 2EFOA 1XSDA 3ROUA 3TOBA 5CJ9A 2KKOA 4MGRA 5BMZA 1FOKA 2PI0A 2QVOA 2HQRA 2P6TA 3QU6A 1XDUA 2DLLA 2LNBA 2OQGA 4AIHA 1ON1A 2CO5A 3BROA 4WXDA 4N0BA 4NQWA 4RGRA 3HSEA 1FWZA 3ZMTA 1FYLA 3B73A 4P55A 3LQRA 5DD8A 3CLOA 3I64A 1W5SA 2XAJA 5FLXK 1KA8A 1A04A 4I7HA 4UVBA 4RS8A 2E7XA 5FD6A 4LG0A 3EETA 1REPC 4EJTA 1BI3A 2XASA 4LK0F 1DUXC 2FXAA 4CICA 3COAC 3M7GA 1R23A 3K2ZA 5D6FA 4GXOA 5LGTA 3DXJF 3WGHA 4OMYA 2Q0OA 4HQMA 3MFKA 2ZBKA 2WC2A 3GX4X 4WCGA 3IHUA 4UHTA 5K1YA 4LFUA 3I54A 1O7LA 1EH6A 1ZARA 1XMAA 2YX7A 2VBZA 4IJAA 4M74A 1QNTA 1JGSA 4M9XA 4S04A 4AIKA 3ZN0A 1I6XA 4KYWA 2VXZA 1JHHA 3GFJA 1IN8A 2XVCA 1Z7UA 1WKMA 1OR7A 1Z6RA 5LHHA 3IRRA 4ZYGA 1KU7A 3R4KA 1KU9A 3ZP5A 1UHMA 1ZN2A 2L02A 4AWXB 3IL2A 3KP5A 3RYRA 5E17F 1K7AA 5D5XB 3ZMVA 4LJZF 4MNUA 5IT3A 2NS0A 2GXBA 4YFNF 1T0FA 2W24A 2A6HF 3DEUA 4GGGA 3SXYA 4LLNA 3JAMZ 3PQKA 3ABUA 1IRGA 1ZG3A 1OKRA 2A68F 4N9IA 4CZZA 3MCZA 4LB6B 5D5VB 1BI2A 1WRJA 2X0LA 4BQAA 1MJ9A 3OOPA 2YX4A 4H0EA 1S29A 2Q2EA 4KICA 5DUIA 2MH9A 4FHTA 2UXXA 1F9NA 3T1BA 2VONA 2HYGD 1FP2A 2MA3A 2GA1A 3F21A 4ZYDA 1FYMA 4CXFA 2FEZA 2CYYA 1GVJA 2G7UA 3DPLC 2XHKA 1L0OC 3K9TA 4EVIA 2C6YA 2LDUA 1W5TA 2GAUA 4IF4A 2HFHA 2IA2A 3GVAA 1UCRA 1SD5A 1MDMA 2IPQX 3E6MA 1SD7A 4U88A 4L0YB 5J8FA 3BPXA 2FSWA 2IA1A 4KN7X 2ZMEB 4G7HF 2K86A 2DI3A 2RDPA 2VODA 4UUVA 4A6DA 3R0JA 4Y13A 1YW7A 2FF4A 2P5VA 4ENNA 3KFWX 3GW2A 1HW5A 1HKTA 4GYGA 2K4JA 1IN4A 4Y15A 4M6YA 1LVAA 4ETSA 5IT9Z 4IHTA 2QQ9A 1XMKA 2H09A 2L54A 3HHGA 2DU9A 4U7BA 4UV9A 1YW8A 4A12A 2ZFWA 2JPCA 3GYHX 1RUOA 4RAZA 3C1DA 1WSUA 2IA0A 2G9WA 1K6OA 2ADUA 1YO5C 3FXRA 4M72A 4R1HA 3ECOA 5HDKA 1IW7F 5DV5A 2XGXA 4N9HA 1UHWA 1G3YA 1U78A 4PZJA 5H6QA 5D8KB 1MJBA 2STTA 4XRFA 4LD5A 1ZRDA 5LRRA 2PMHA 2MC3A 1ZLJA 4LGWA 1U6GA 1JHFA 1R5GA 2M30A 3JTHA 1FBUA 1MKMA 3QRFF 4MQ9F 4I02A 2K4BA 3E6CC 3QP6A 5HVQC 4P9FA 1UFMA 1CGPA 3SHFA 1IXRC 2VOPA 1FNNA 3MWMA 1TW2A 2HGCA 3ML6A 2QUFA 2VT2A 3M8EA 3FM5A 3RIRA 5HS9A 3BJOA 4FX4A 2DW4A 4LG0B 1TQPA 2LF8A 5CVIA 3RJPA 4A5NA 2VBYA 3KZYA 4G6DA 1CF7A 4YIFA 4DNCA 1MD0A 1TQMA 3FXUA 2VBXA 1I1GA 3P9KA 4HLYA 4ZYEA 1Z91A 4BYYA 3TO7A 1QGPA 1EH8A 4BH9A 2DK8A 2ZXJA 5CVJA 3QP5A 1YIOA 5A2QK 3L00A 2GIVA 2XAQA 2H94A 1V3FA 5F1RA 2NAZA 1B6AA 1K78B 3MAJA 4YFKF 3IWZA 1BIAA 3LAJA 1IXSB 3F8FA 4BXUA 4U0YA 4XSZF 5AONA 5CVVA 3L09A 2LKPA 2BEOA 2HDCA 3U9GA 3BWGA 1J75A 4I01A 4GCVA 1G3SA 5F6FA 1ZRCA 2RNJA 4KMFA 1FSHA 5D4RA 1XN7A 1TTYA 5D5WB 3WTXC 4L5JA 4BHBA 3LA2A 1J5YA 3GO5A 2HKXA 5E1ZB 2HKOA 5ILSA 1FY7A 2RGVA 2EWNA 3GLXA 2KRFA 4KA4A 2FRHA 5LLQA 5DEQA 4M73A 3KLNA 5ED4A 1J59A 2HWVA 4KDPA 3FWEA 5CVUA 5E8GA 1YLFA 1YTYA 3VODA 3AAFA 1K79A 1T38A 3BZ6A 1VTNC 4RGUA 3R60A 3K69A 3JAMK 3HHHA 4UNOA 3E97A 2ZNYA 4QLCU 1MDMB 2FOKA 4HA8A 2L01A 3JW4A 1HW1A 4B09A 1HSTA 2DPDA 4ON0A 3L2CA 1RI7A 3R0AA 1SFXA 4U7DA 1YQAA 1WQ2A 3D5LA 2HZTA 2ZMEA 2XROA 1BN5A 5HDNA 1QQIA 5BS6A 2BV6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WWY A;  3FF5 A;  3KLO A;  2QLZ A;  5AIQ A;  2P5K A;  4ENJ A;  2YPR A;  4IXA A;  5KK1 A;  2D45 A;  2JSC A;  3DF8 A;  4BHP A;  5JI6 A;  5L3F A;  4UVA A;  2PMU A;  2P7V B;  3CTA A;  4MTE A;  1QPM A;  1BJA A;  5J6X A;  3GUD A;  5DD4 A;  3RYP A;  3T0Y A;  2NNN A;  1FBS A;  1LNW A;  2FML A;  3F23 A;  1XD7 A;  2JRT A;  4UVC A;  3V4G A;  4A6E A;  1STZ A;  3ZMU A;  3L9F A;  2Z99 A;  4UV8 A;  2M45 A;  3KEO A;  3BJA A;  4RAY A;  1LJ9 A;  4Q47 A;  5D6E A;  4B8X A;  3ERE D;  2YU3 A;  1IXC A;  4OIQ F;  2AS5 F;  1R22 A;  3IRQ A;  5E18 F;  1XSX A;  5KVR A;  2Y0M A;  3ZN1 A;  1NHA A;  1D8K A;  5FFZ A;  1T39 A;  4UXN A;  3MZY A;  5ICC A;  2A6E F;  4G94 A;  4KIB A;  1U3E M;  5L3B A;  4OOI A;  2IW5 A;  5ICF A;  4RB2 C;  2Z3Y A;  3F22 A;  5LGU A;  1TW3 A;  3P7N A;  2ZKZ A;  4HOB A;  2IJL A;  3V8K A;  5ILV A;  3VFZ A;  3HRT A;  5DCM B;  2E1N A;  3FXQ A;  4HX4 A;  4L9T A;  3GEZ A;  2MH2 A;  3I59 B;  1TQI A;  1KU2 A;  3Q9S A;  4ZYH A;  5E20 A;  3FHZ A;  1I5Z A;  3WTT C;  2HTJ A;  3WU1 B;  1FT9 A;  2M5W A;  2H27 A;  1ZHF A;  3N97 A;  1Z05 A;  1R58 A;  3LQQ A;  2L3D A;  4WK8 F;  1CF7 B;  4YII A;  3LAP A;  1E2X A;  2HOE A;  4ESJ A;  4FX0 A;  2JT1 A;  3FM3 A;  2EJR A;  4OIP F;  4Q5S F;  3CO7 C;  3P9C A;  2CFX A;  3OV8 A;  4M71 A;  1K78 A;  5K5O A;  1F5T A;  3I53 A;  3RTR A;  4CGZ A;  3F8N A;  3T5X A;  2HR3 A;  2EA4 A;  2RQP A;  1LEA A;  2IVM A;  3SQN A;  1ONV A;  2R7D A;  4ESB A;  4A0Y A;  1GXQ A;  3WGI A;  2KIM A;  2RC4 A;  2CW0 F;  4O3M A;  2W84 A;  5L3D A;  3JSO A;  2F5F A;  4KIG A;  3V8J A;  3W6K B;  1H9T A;  1R00 A;  2GZW A;  5ICG A;  1OMI A;  3JTG A;  2EFN A;  1D3Y A;  4P9U A;  2Z33 A;  4OIR F;  3V7S A;  2GWR A;  3M9A A;  1QZZ A;  1FBQ A;  2DFI A;  5LBQ A;  3IKT A;  2ZO4 A;  2COM A;  2JZY A;  2EK5 A;  3TDZ C;  1QZY A;  3WTV C;  2O3F A;  3ULQ B;  4LLG F;  1S7A A;  3O3K A;  1G3W A;  3GXO A;  4JQF A;  4Q48 A;  4KIF A;  1O3Q A;  2FNA A;  2ZNZ A;  1XCV A;  1O3T A;  2DQL A;  5FD5 A;  4L9J A;  4HX7 A;  1XGN A;  2E1C A;  5IT9 K;  2PLY A;  1KGS A;  2P4W A;  2JTV A;  5FB2 A;  2DK5 A;  4L5I A;  2O6G E;  1I1S A;  3ZMS A;  2A61 A;  3SZT A;  1HBX G;  5BPD A;  4G7O F;  4ZZL A;  4HDU A;  5E1W A;  3HUG A;  2CQK A;  1IUY A;  3K1P A;  3R61 A;  2GXG A;  4HZF A;  1LDD A;  1XCB A;  4E70 A;  5BQT A;  1UST A;  5TRD A;  5DYM A;  3LFK A;  4G7Z F;  2PFB A;  3Q9V A;  1O7F A;  3RI4 A;  1T6S A;  2QYO A;  3GZ5 A;  3QU3 A;  5ICE A;  4P96 A;  2YSR A;  3LST A;  4IRI A;  3HTU A;  4KFC A;  1FC3 A;  3ELK A;  2GA2 A;  3D0S A;  4MEX F;  2VBW A;  3WTZ A;  3GZ6 A;  1LQ1 A;  1XSV A;  1T98 A;  1U5T C;  2JPB A;  1U8R A;  1QO0 D;  1J7K A;  2UWM A;  1U5T B;  1XGO A;  5D5U B;  3TQN A;  1U2W A;  1IN5 A;  2PEX A;  3RDI A;  4A5M A;  4NB5 A;  1KYW A;  2DTR A;  3EDP A;  3VEP A;  3P9I A;  1Z6T A;  2MLK A;  2F5C A;  1YFH A;  1G3T A;  2OU2 A;  3WGG A;  4TV7 A;  3CUQ B;  1F1Z A;  4EM1 A;  2A69 F;  5DCF A;  1J0R A;  4PGH A;  1EV7 A;  4G9Y A;  3BP8 A;  5K5R A;  1IN6 A;  3R6S A;  3I0T A;  2DAO A;  3H92 A;  1BOA A;  2CG4 A;  1GHC A;  3O2P E;  3HRS A;  4M6X A;  4OU0 A;  2R7F A;  3CUQ C;  5JR3 A;  2VC1 A;  2XKP A;  3U2R A;  2QWW A;  2EV6 A;  2MBF A;  5JVT A;  1G6N A;  3KE2 A;  4L18 B;  3K1M A;  4I0A A;  2NRA C;  1OYW A;  3KP4 A;  3HSR A;  2F5D A;  5LGN A;  3K1N A;  4I98 B;  1HKQ A;  2IP2 A;  1FX7 A;  2W85 A;  2FBH A;  3MEX A;  1KQ8 A;  4U0V A;  4M9Z A;  3RKW A;  2B0L A;  2BE5 F;  3J7A O;  2PJP A;  5DCM A;  1Z1D A;  4RB3 C;  2D1H A;  2FU4 A;  1P4X A;  4KNY A;  2W57 A;  4O6J A;  3DP7 A;  3I58 A;  2RKH A;  2Z5U A;  5FGM A;  2HEO A;  4O5V A;  1TLH B;  3BDD A;  2WV0 A;  2V6C A;  2V1D A;  3EYY A;  2EFP A;  4IRH A;  4S05 A;  4JK1 X;  2VE9 A;  2O8X A;  2P7C B;  4HLX A;  3C7J A;  1KU3 A;  4HX8 A;  4WXC A;  4YFX F;  2FE3 A;  2ESH A;  1HW2 A;  1USS A;  2J5O A;  2OQR A;  4KMU X;  5HLH A;  2EA2 A;  2HQN A;  5CLS A;  3DPT A;  2L4A A;  3H3Z A;  1YW9 A;  1YYV A;  1B1B A;  3QOP A;  3VB2 A;  2M1B A;  4OIN F;  3KP2 A;  1O3S A;  1IAW A;  1IN7 A;  2H6B A;  2DT5 A;  5LEK A;  2DPU A;  2V1U A;  5LEJ A;  4ENM A;  3RPQ A;  3IC7 A;  1KQ9 A;  4PDK A;  3FZV A;  2STW A;  1KQ0 A;  1R36 A;  1Q1H A;  2VOO A;  4G8X A;  2MD5 A;  3M1E A;  1J2X A;  2E7W A;  3VOE A;  1ON2 A;  2A5Y B;  5E1X A;  3TO6 A;  2V9V A;  5FFX A;  4EJW A;  5HOO A;  2M8E A;  1FSE A;  4MHG A;  1BM9 A;  3EUH A;  3LA7 A;  1S7O A;  1MZB A;  4MTD A;  1RZ4 A;  1JE8 A;  3FMS A;  3NQO A;  2GQQ A;  2O0Y A;  5HS7 A;  2EFW A;  1PDN C;  2OZ6 A;  2BBY A;  5EEG A;  1S8N A;  3ISP A;  3F8M A;  3T8T A;  2RV8 A;  1ULY A;  1R1T A;  3TO9 A;  4L9N A;  3U1D A;  3Q5F A;  2HTS A;  4LMY A;  2QEN A;  3BOQ A;  2BYV E;  4JBA A;  1PP7 U;  3WOD F;  1D5V A;  4EJV A;  5CVR A;  3C18 A;  3ZMD A;  3F72 A;  4AIJ A;  3KEQ A;  1C0W A;  2DQR A;  2G7H A;  4HF1 A;  3DV8 A;  3F6V A;  4KT5 C;  3ZPL A;  1HKS A;  4WF2 A;  1IZ1 A;  2K27 A;  4KUM A;  1R7J A;  5LHI A;  4CDG A;  3CUO A;  4D0P A;  2PN6 A;  3TOA A;  2A07 F;  3E6D A;  4EMS A;  4RGX A;  1XDS A;  2IT0 A;  1DPU A;  3GFI A;  1R1V A;  4QWQ A;  4YG2 F;  1FZP B;  1IF1 A;  2A3S A;  3GFL A;  2AXL A;  1PUE E;  2FQ3 A;  3HRU A;  2Z9O A;  1LDK B;  4A0Z A;  1KYZ A;  1P6R A;  1B9N A;  1AOY A;  3FX3 A;  1YS6 A;  4R8H A;  2NYX A;  1EH7 A;  1BC7 C;  2TDX A;  3QAH A;  4HAM A;  1MJA A;  5J8C A;  3F3X A;  2QBY A;  3HRM A;  2WTE A;  2O03 A;  3QPH A;  4P5O A;  2XAG A;  4I09 A;  3WE3 A;  4WX9 A;  1FPQ A;  3EQL F;  1OYI A;  4Y17 A;  2QM3 A;  1ZG1 A;  4F7Z A;  4HW0 A;  3KZZ A;  4M9S A;  1W7P B;  2OAZ A;  4AD9 A;  4XBF A;  3DFG A;  4CO8 A;  5EEH A;  3V7C A;  3WTS C;  1SMT A;  3ZQ7 A;  2ELH A;  1OPC A;  2IRF G;  1BI0 A;  2Y48 A;  3RKY A;  2EFQ A;  5E8I A;  2Y75 A;  4EQQ A;  3WU0 A;  5L3G A;  2OA4 A;  1WWX A;  4Z2Y A;  3ABT A;  2K7L A;  5BPI A;  2XIG A;  4ENK A;  3NRV A;  4HBL A;  2XAH A;  1ZRF A;  1TBX A;  2XUB A;  1W7P D;  3V7R A;  3J81 Z;  1DP7 P;  5F64 A;  3ZMZ A;  3F6O A;  2HS5 A;  4PCQ A;  1XB4 A;  5HS8 A;  4OMZ A;  4Q4Z F;  3GF2 A;  1P2F A;  1PP8 F;  3JSP A;  1XGM A;  3KCC A;  1T2K A;  3HOT A;  2KIF A;  3PFI A;  2ESN A;  2FMY A;  2ISZ A;  1TNT A;  1BIB A;  5ILU A;  1ZG5 A;  1RUN A;  5H6R A;  3HOS A;  4ZH4 F;  1LDJ A;  3KP7 A;  3GWZ A;  3E3V A;  2QQA A;  5BOX A;  4HDV A;  3HSF A;  4HQE A;  1SFE A;  2FA5 A;  4GYI A;  3KET A;  2ISY A;  4ESF A;  4RB1 A;  2EV0 A;  2F5E A;  3LWF A;  3N4M A;  4MEY F;  1FLI A;  1RIO H;  1B4A A;  1YG2 A;  4IRG A;  4KN4 X;  2VE8 A;  4PGG A;  1O57 A;  3FMR A;  5D8L B;  1HXD A;  1BI1 A;  2XAF A;  2J5P A;  3J80 K;  5LHG A;  3J81 K;  4BAY A;  4HF2 A;  2V1X A;  1HSJ A;  2EB7 A;  4LK1 F;  3KP6 A;  3K0L A;  3FMQ A;  3M8F A;  4EV0 A;  6PAX A;  1SAX A;  1DDN A;  1FP1 D;  2EV5 A;  5AIP A;  3SFZ A;  2LF7 A;  3E5U A;  1HQC A;  3J80 Z;  1BC8 C;  2H6C A;  2FBK A;  2L4M A;  2UZK A;  4L9V A;  3T8R A;  4K2E A;  4LLL A;  5ERI A;  4U0W A;  4HF0 A;  4XLP F;  4XLN F;  1OYY A;  1QBJ A;  1ZH5 A;  2ZJ2 A;  4G6Q A;  2BGC A;  3WTW C;  4AVP A;  4MQV A;  5H20 A;  1W4M A;  1GXP A;  3REO A;  4OIO F;  5JHU A;  4EGZ A;  2F2E A;  1ZAO A;  4NHJ A;  2KJC A;  4ASN A;  2CSO A;  2VT3 A;  1R1U A;  3L7W A;  2ZCW A;  5DDG A;  3BY6 A;  2V79 A;  2W25 A;  4FT8 A;  3KP3 A;  3MZH A;  3IWF A;  1FYK A;  4EM2 A;  2QZ8 A;  1Z9C A;  1E17 A;  1U5T A;  5LRS A;  2Q8K A;  2PG4 A;  4EJO A;  3NEU A;  2D1V A;  1YS7 A;  3PQJ A;  4I0B A;  4BHC A;  3E5X A;  4IPA A;  3HYI A;  1O3R A;  1TNS A;  2K02 A;  1P4W A;  3GFM A;  4I2O A;  3G3Z A;  4BNC A;  5DUK A;  3RKX A;  1SD4 A;  3IKV A;  4A0X A;  1BBY A;  3LA3 A;  1SMY F;  3F8C A;  1ZGA A;  3MQ0 A;  1AWC A;  3EYI A;  4WXH A;  4CYD A;  3O6B B;  1J9I A;  1MGT A;  1LB2 A;  1ZLK A;  3WG9 A;  1SFU A;  3WTY C;  3S2W A;  4A2U A;  5L3E A;  4CHU A;  5HDG A;  1S3J A;  3W6J B;  3E6B A;  2QBY B;  4HV5 A;  1H9G A;  2YR2 A;  1R5H A;  3I71 A;  4EJU A;  4HYE A;  4GO1 A;  5HLG A;  2FNP A;  3CDH A;  2OD5 A;  1RNL A;  1W7P A;  2ACJ A;  5HLI A;  1JXS A;  5TJJ A;  1F4K A;  4LB5 A;  3DQV C;  4EM0 B;  3G73 A;  3B02 A;  3ECH A;  2PBI A;  1WI9 A;  1B9M A;  5K5Q A;  3CO6 C;  3E5Q A;  2P8T A;  2CGP A;  1X3U A;  4L0Z B;  2X4H A;  1DPR A;  1XGS A;  1G4D A;  4IVN A;  1ODD A;  3I4P A;  2ETH A;  4RB0 A;  2FBI A;  3CJN A;  3TDU C;  2RN7 A;  1V4R A;  2O61 A;  2NNY A;  3SZP A;  3C3W A;  2M87 A;  2XKO A;  3TKY A;  3RPU A;  3BPV A;  1ZGJ A;  5FLX Z;  1P92 A;  3HIF A;  2MLG A;  3DKW A;  2HYF A;  2LSO A;  4DQ2 A;  3I59 A;  3F8B A;  3I5U A;  3WE2 A;  3V8L A;  2P5L C;  5D4S A;  1ZRE A;  4R79 A;  4IHS A;  4RGS A;  2VN2 A;  2KJB A;  2P6S A;  2XV4 S;  1I27 A;  2RVC A;  2DO7 A;  3HTS B;  5JFR A;  1ZYR F;  1IRF A;  3H3U A;  1P4A A;  5CYV A;  3TGN A;  5L3C A;  1L3L A;  2UXN A;  4XSX F;  1Y0U A;  4WWC A;  2XRN A;  2R3S A;  2OBP A;  3WTU C;  2VC0 A;  3CUQ A;  2D2W A;  2CWE A;  4HV6 A;  4ZZD A;  1UB9 A;  2KIU A;  2QQB A;  5A2Q Z;  3QPT A;  1SD6 A;  1S6L A;  1H0M A;  1D8J A;  3BJ6 A;  2OZU A;  1B59 A;  1LEB A;  2PQ8 A;  2DBB A;  4EGY A;  5FO5 A;  2EFO A;  1XSD A;  3ROU A;  3TOB A;  5CJ9 A;  2KKO A;  4MGR A;  5BMZ A;  1FOK A;  2PI0 A;  2QVO A;  2HQR A;  2P6T A;  3QU6 A;  1XDU A;  2DLL A;  2LNB A;  2OQG A;  4AIH A;  1ON1 A;  2CO5 A;  3BRO A;  4WXD A;  4N0B A;  4NQW A;  4RGR A;  3HSE A;  1FWZ A;  3ZMT A;  1FYL A;  3B73 A;  4P55 A;  3LQR A;  5DD8 A;  3CLO A;  3I64 A;  1W5S A;  2XAJ A;  5FLX K;  1KA8 A;  1A04 A;  4I7H A;  4UVB A;  4RS8 A;  2E7X A;  5FD6 A;  4LG0 A;  3EET A;  1REP C;  4EJT A;  1BI3 A;  2XAS A;  4LK0 F;  1DUX C;  2FXA A;  4CIC A;  3COA C;  3M7G A;  1R23 A;  3K2Z A;  5D6F A;  4GXO A;  5LGT A;  3DXJ F;  3WGH A;  4OMY A;  2Q0O A;  4HQM A;  3MFK A;  2ZBK A;  2WC2 A;  3GX4 X;  4WCG A;  3IHU A;  4UHT A;  5K1Y A;  4LFU A;  3I54 A;  1O7L A;  1EH6 A;  1ZAR A;  1XMA A;  2YX7 A;  2VBZ A;  4IJA A;  4M74 A;  1QNT A;  1JGS A;  4M9X A;  4S04 A;  4AIK A;  3ZN0 A;  1I6X A;  4KYW A;  2VXZ A;  1JHH A;  3GFJ A;  1IN8 A;  2XVC A;  1Z7U A;  1WKM A;  1OR7 A;  1Z6R A;  5LHH A;  3IRR A;  4ZYG A;  1KU7 A;  3R4K A;  1KU9 A;  3ZP5 A;  1UHM A;  1ZN2 A;  2L02 A;  4AWX B;  3IL2 A;  3KP5 A;  3RYR A;  5E17 F;  1K7A A;  5D5X B;  3ZMV A;  4LJZ F;  4MNU A;  5IT3 A;  2NS0 A;  2GXB A;  4YFN F;  1T0F A;  2W24 A;  2A6H F;  3DEU A;  4GGG A;  3SXY A;  4LLN A;  3JAM Z;  3PQK A;  3ABU A;  1IRG A;  1ZG3 A;  1OKR A;  2A68 F;  4N9I A;  4CZZ A;  3MCZ A;  4LB6 B;  5D5V B;  1BI2 A;  1WRJ A;  2X0L A;  4BQA A;  1MJ9 A;  3OOP A;  2YX4 A;  4H0E A;  1S29 A;  2Q2E A;  4KIC A;  5DUI A;  2MH9 A;  4FHT A;  2UXX A;  1F9N A;  3T1B A;  2VON A;  2HYG D;  1FP2 A;  2MA3 A;  2GA1 A;  3F21 A;  4ZYD A;  1FYM A;  4CXF A;  2FEZ A;  2CYY A;  1GVJ A;  2G7U A;  3DPL C;  2XHK A;  1L0O C;  3K9T A;  4EVI A;  2C6Y A;  2LDU A;  1W5T A;  2GAU A;  4IF4 A;  2HFH A;  2IA2 A;  3GVA A;  1UCR A;  1SD5 A;  1MDM A;  2IPQ X;  3E6M A;  1SD7 A;  4U88 A;  4L0Y B;  5J8F A;  3BPX A;  2FSW A;  2IA1 A;  4KN7 X;  2ZME B;  4G7H F;  2K86 A;  2DI3 A;  2RDP A;  2VOD A;  4UUV A;  4A6D A;  3R0J A;  4Y13 A;  1YW7 A;  2FF4 A;  2P5V A;  4ENN A;  3KFW X;  3GW2 A;  1HW5 A;  1HKT A;  4GYG A;  2K4J A;  1IN4 A;  4Y15 A;  4M6Y A;  1LVA A;  4ETS A;  5IT9 Z;  4IHT A;  2QQ9 A;  1XMK A;  2H09 A;  2L54 A;  3HHG A;  2DU9 A;  4U7B A;  4UV9 A;  1YW8 A;  4A12 A;  2ZFW A;  2JPC A;  3GYH X;  1RUO A;  4RAZ A;  3C1D A;  1WSU A;  2IA0 A;  2G9W A;  1K6O A;  2ADU A;  1YO5 C;  3FXR A;  4M72 A;  4R1H A;  3ECO A;  5HDK A;  1IW7 F;  5DV5 A;  2XGX A;  4N9H A;  1UHW A;  1G3Y A;  1U78 A;  4PZJ A;  5H6Q A;  5D8K B;  1MJB A;  2STT A;  4XRF A;  4LD5 A;  1ZRD A;  5LRR A;  2PMH A;  2MC3 A;  1ZLJ A;  4LGW A;  1U6G A;  1JHF A;  1R5G A;  2M30 A;  3JTH A;  1FBU A;  1MKM A;  3QRF F;  4MQ9 F;  4I02 A;  2K4B A;  3E6C C;  3QP6 A;  5HVQ C;  4P9F A;  1UFM A;  1CGP A;  3SHF A;  1IXR C;  2VOP A;  1FNN A;  3MWM A;  1TW2 A;  2HGC A;  3ML6 A;  2QUF A;  2VT2 A;  3M8E A;  3FM5 A;  3RIR A;  5HS9 A;  3BJO A;  4FX4 A;  2DW4 A;  4LG0 B;  1TQP A;  2LF8 A;  5CVI A;  3RJP A;  4A5N A;  2VBY A;  3KZY A;  4G6D A;  1CF7 A;  4YIF A;  4DNC A;  1MD0 A;  1TQM A;  3FXU A;  2VBX A;  1I1G A;  3P9K A;  4HLY A;  4ZYE A;  1Z91 A;  4BYY A;  3TO7 A;  1QGP A;  1EH8 A;  4BH9 A;  2DK8 A;  2ZXJ A;  5CVJ A;  3QP5 A;  1YIO A;  5A2Q K;  3L00 A;  2GIV A;  2XAQ A;  2H94 A;  1V3F A;  5F1R A;  2NAZ A;  1B6A A;  1K78 B;  3MAJ A;  4YFK F;  3IWZ A;  1BIA A;  3LAJ A;  1IXS B;  3F8F A;  4BXU A;  4U0Y A;  4XSZ F;  5AON A;  5CVV A;  3L09 A;  2LKP A;  2BEO A;  2HDC A;  3U9G A;  3BWG A;  1J75 A;  4I01 A;  4GCV A;  1G3S A;  5F6F A;  1ZRC A;  2RNJ A;  4KMF A;  1FSH A;  5D4R A;  1XN7 A;  1TTY A;  5D5W B;  3WTX C;  4L5J A;  4BHB A;  3LA2 A;  1J5Y A;  3GO5 A;  2HKX A;  5E1Z B;  2HKO A;  5ILS A;  1FY7 A;  2RGV A;  2EWN A;  3GLX A;  2KRF A;  4KA4 A;  2FRH A;  5LLQ A;  5DEQ A;  4M73 A;  3KLN A;  5ED4 A;  1J59 A;  2HWV A;  4KDP A;  3FWE A;  5CVU A;  5E8G A;  1YLF A;  1YTY A;  3VOD A;  3AAF A;  1K79 A;  1T38 A;  3BZ6 A;  1VTN C;  4RGU A;  3R60 A;  3K69 A;  3JAM K;  3HHH A;  4UNO A;  3E97 A;  2ZNY A;  4QLC U;  1MDM B;  2FOK A;  4HA8 A;  2L01 A;  3JW4 A;  1HW1 A;  4B09 A;  1HST A;  2DPD A;  4ON0 A;  3L2C A;  1RI7 A;  3R0A A;  1SFX A;  4U7D A;  1YQA A;  1WQ2 A;  3D5L A;  2HZT A;  2ZME A;  2XRO A;  1BN5 A;  5HDN A;  1QQI A;  5BS6 A;  2BV6 A; 
#chains in the Genus database with same CATH topology
 3K6G A;  3JRB A;  4RM3 A;  3NWT A;  2PMZ N;  3S1R J;  2WWY A;  3K4M A;  3ASN H;  3BLY A;  5IP9 J;  3K4K A;  4HRI A;  2AO9 A;  3FF5 A;  1H89 C;  3KLO A;  2JA8 J;  2QLZ A;  3JRH A;  4M6V A;  1YJN I;  5IYD J;  2L7Z A;  4A3J J;  4PJ0 C;  2PX9 A;  5AIQ A;  2P5K A;  2ICW G;  2KL4 A;  2L7F P;  2YPR A;  1IDY A;  4IXA A;  5KK1 A;  4ENJ A;  2D5V A;  2CV2 A;  3AG1 H;  2D45 A;  3H5R A;  2JSC A;  3DF8 A;  4BHP A;  3BZC A;  5JI6 A;  5L3F A;  4UVA A;  1X58 A;  2PMU A;  5B1B H;  3S2H J;  2P7V B;  3CTA A;  3WHC A;  4MTE A;  1QPM A;  1BJA A;  2XGE A;  2GOM A;  4AVZ A;  4FCY A;  4F3Q A;  5J6X A;  4XKW A;  3GUD A;  5DD4 A;  3RYP A;  3T0Y A;  1K61 A;  2DDB A;  5JVG F;  5F08 A;  3JRD A;  5B5E C;  2PJR A;  2NNN A;  1A31 A;  1FBS A;  1LNW A;  2FML A;  3F23 A;  1XD7 A;  1MBJ A;  2JRT A;  1POG A;  4UVC A;  3V4G A;  4A6E A;  1STZ A;  1JTX A;  3ZMU A;  5GTH C;  3L9F A;  2R5Y A;  2Z99 A;  3AG2 H;  3K2A A;  3BR1 A;  4UV8 A;  2M45 A;  3KEO A;  3BJA A;  1A6I A;  2E36 A;  3S17 J;  4RAY A;  1LJ9 A;  3HB9 A;  2LH9 A;  4Q47 A;  5D6E A;  4B8X A;  5FRN A;  3ERE D;  3M07 A;  2YU3 A;  1IXC A;  4PUS A;  2VPL A;  1N25 A;  2AS5 F;  4OIQ F;  4IZZ A;  1R22 A;  3IRQ A;  5E18 F;  1XSX A;  5KVR A;  2Y0M A;  3ZN1 A;  1NHA A;  4AID A;  1D8K A;  2WAE A;  5FFZ A;  1T39 A;  3S8P A;  4UXN A;  3MZY A;  5ICC A;  2LKS A;  4C3H J;  2A6E F;  4G94 A;  2DFF A;  4KIB A;  4BQQ A;  2YS9 A;  4BEH A;  2L9R A;  2M7A A;  1U3E M;  3RQI A;  2P0W A;  5L3B A;  3EUK L;  1NK2 P;  2A05 A;  4OOI A;  1Y8Q B;  2IW5 A;  5ICF A;  4RB2 C;  2XSD C;  2Z3Y A;  3F22 A;  5JLX A;  4C9Y A;  3G1L A;  5LGU A;  4A3M J;  1TW3 A;  3P7N A;  2ZKZ A;  1I3A A;  4X6A J;  4HOB A;  3I4M J;  2IJL A;  3V8K A;  5ILV A;  1PYV A;  3VFZ A;  3JRF A;  2W48 A;  4GDF A;  3HRT A;  5DCM B;  1GV5 A;  2E1N A;  3FXQ A;  4HX4 A;  4L9T A;  3GTJ J;  3MN2 A;  3GEZ A;  5F1J A;  3K4L A;  2MH2 A;  3I59 B;  3RZD J;  1TQI A;  1KU2 A;  4E7L A;  3Q9S A;  4ZYH A;  2V4J C;  5E20 A;  4RMN A;  3FHZ A;  1I5Z A;  3BTL A;  3WTT C;  1XG1 A;  2GIZ A;  5GAD J;  4XON A;  3CLQ A;  2HTJ A;  1QU3 A;  3CCM I;  3WU1 B;  1FT9 A;  2M5W A;  5HNH A;  1YJ9 I;  2H27 A;  1ZHF A;  3BG6 A;  3N97 A;  1Z05 A;  1R58 A;  3LQQ A;  2L3D A;  3PNT A;  4WK8 F;  4XLE A;  2IGO A;  1CF7 B;  4YII A;  3LAP A;  1E2X A;  2HOE A;  2YU9 J;  2ZXI A;  4ESJ A;  4FX0 A;  4NBQ A;  2JT1 A;  1D0Y A;  3FM3 A;  2EJR A;  2LR8 A;  4OIP F;  4ZDL A;  4Q5S F;  4ZJZ A;  1UEL B;  3K4J A;  3CO7 C;  5FKM A;  3P9C A;  5IY5 H;  2CFX A;  3OV8 A;  2NXN B;  1D5Y A;  4M71 A;  2HOT A;  1A36 A;  4E7I A;  1K78 A;  4XN3 A;  2WAQ N;  5K5O A;  3Q0U A;  1F5T A;  3I53 A;  4FE7 A;  2FX0 A;  3RTR A;  4CGZ A;  3F8N A;  3T5X A;  2HR3 A;  2EA4 A;  4XN0 A;  1P9Q C;  2RQP A;  1LEA A;  2IVM A;  3SQN A;  1X19 A;  1ONV A;  4FET A;  4HSR A;  1AU7 A;  4F91 B;  1NG6 A;  2R7D A;  1VQK I;  4ESB A;  4A0Y A;  1GXQ A;  3WGI A;  2VPR A;  2KIM A;  1WH5 A;  2RC4 A;  2XPU A;  2DTZ A;  2CW0 F;  4I99 C;  2XF6 A;  4O3M A;  2W84 A;  5DS9 A;  3OYH A;  5L3D A;  2AXT C;  3JSO A;  2F5F A;  2ZC2 A;  4KIG A;  3S93 A;  3V8J A;  2N8G A;  3W6K B;  1H9T A;  2NVX J;  1A5J A;  4UUT A;  2RAE A;  1R00 A;  2GZW A;  2R7O A;  3G4S I;  5ICG A;  1ENH A;  1OMI A;  1DU0 A;  3JTG A;  3FBI B;  2EFN A;  1D3Y A;  1MIJ A;  4P9U A;  2Z33 A;  4OIR F;  3V7S A;  2W00 A;  2GWR A;  3SYT A;  4XK4 A;  3M9A A;  1QZZ A;  4BBR J;  2DOF A;  3PIO F;  3BG7 A;  2E2J J;  3CES A;  1FBQ A;  3AG4 H;  2DFI A;  2X6W A;  5LBQ A;  3IKT A;  1F36 A;  2ZO4 A;  1JKP C;  1RC9 A;  2COM A;  2JZY A;  2EK5 A;  3TDZ C;  2NVY J;  1QZY A;  2DXI A;  3WTV C;  2EZK A;  2IGM A;  2O3F A;  3ULQ B;  4KIT B;  2DA1 A;  2ZB9 A;  4LLG F;  3BR2 A;  1OCC H;  1BJZ A;  2XPW A;  1S7A A;  3O3K A;  3OS2 A;  1G3W A;  2DDA A;  3GXO A;  4JQF A;  4Q48 A;  5GPA A;  5H2F C;  2E5Z A;  4KIF A;  1MBG A;  1O3Q A;  3TED A;  2FNA A;  2ZNZ A;  1XCV A;  2DMP A;  1RKW A;  2DQL A;  1O3T A;  1HDD C;  5FD5 A;  1X1B A;  4L9J A;  2Z1D A;  3MKZ A;  4HX7 A;  3CMY A;  2GLO A;  1XGN A;  1OQY A;  1V5F A;  3ZQC A;  2M3A A;  2E1C A;  5IT9 K;  1IV6 A;  2PLY A;  1SEU A;  2VKE A;  4B47 A;  3ZRG A;  1KGS A;  2P4W A;  2Q1Z B;  3DKX A;  3UR3 C;  2JTV A;  2QA4 I;  3ASO H;  4A3B J;  3I4N J;  5FB2 A;  2EPF A;  2EZH A;  1MND A;  2DK5 A;  3BZK A;  2X1D A;  3ZQL A;  4L5I A;  3LL7 A;  3FK6 A;  2O6G E;  1I1S A;  3OYI A;  2HPM A;  3ZMS A;  2A61 A;  3SZT A;  4A3E J;  1HBX G;  5BPD A;  4G7O F;  4ZZL A;  4HDU A;  5E1W A;  2MFZ A;  3I55 I;  1RES A;  3HUG A;  2HDD A;  2QEX I;  2Y31 A;  2CQK A;  2F4M B;  1IUY A;  2CJJ A;  3K1P A;  3R61 A;  2GXG A;  4HZF A;  3DPU A;  1LDD A;  2L9V A;  1XCB A;  2NS8 A;  2LBF B;  3LFU A;  5GPC A;  3CC2 I;  3CMM A;  2Q2E B;  3LSP A;  1XS9 A;  2X85 A;  1ZR2 A;  1I39 A;  3CZ6 A;  4E70 A;  2ZJP F;  1H88 C;  1APL C;  3CJR B;  5BQT A;  1UST A;  1VZ0 A;  3SFI A;  4DOZ A;  5TRD A;  3PL8 A;  3LFK A;  5DYM A;  2PFB A;  3Q9V A;  4G7Z F;  1O7F A;  3S3N A;  4HEA 2;  1T6S A;  3RI4 A;  2QYO A;  3GZ5 A;  3M8J A;  3DU5 A;  4RBO A;  2W7N A;  1SFK A;  1WPK A;  3QU3 A;  4PJM A;  2H1K A;  2EIN H;  1YX3 A;  2E71 A;  4CYC B;  2F5V A;  5ICE A;  4UB8 C;  4B1R A;  4P96 A;  2YSR A;  2ZXH A;  3LST A;  3G71 I;  2E2I J;  4IRI A;  3HTU A;  4KFC A;  1K6Y A;  1U9N A;  4RM2 A;  1FC3 A;  3ELK A;  2GA2 A;  3D0S A;  2NVU B;  2WB1 A;  3TMO A;  4MEX F;  2VBW A;  2K9N A;  2LFB A;  4HPQ A;  2V6E A;  4QPQ A;  3L2Q A;  3CP8 A;  3WTZ A;  3GZ6 A;  1LQ1 A;  2EIK H;  4V2G A;  4YIR X;  1XSV A;  1T98 A;  1U5T C;  4C2M J;  2JPB A;  3EUA A;  1TWH J;  3HOU J;  1U8R A;  1QO0 D;  1J7K A;  1IUF A;  2O7O A;  2UWM A;  1VI0 A;  1U5T B;  1XGO A;  4BXF A;  5D5U B;  3TQN A;  2X9D A;  4Y52 J;  4XRS G;  1LFB A;  2OCC H;  1U2W A;  2PEX A;  1IN5 A;  2M0M A;  4G6T B;  2GOX B;  3I56 I;  3RDI A;  4A5M A;  4NB5 A;  1LUJ B;  1VQM I;  2Y9Z A;  1KYW A;  2DTR A;  3HL2 A;  1VQ7 I;  2DFH A;  3EDP A;  3G1O A;  3VEP A;  2DT6 A;  3P9I A;  4ZC3 A;  1Z6T A;  2MLK A;  2XPV A;  3JRI A;  3S1M J;  2F5C A;  1SFO J;  1YFH A;  2DOE A;  1G3T A;  1WCM J;  3BTI A;  1NTC A;  2OU2 A;  3WGG A;  1A35 A;  4TV7 A;  3CUQ B;  1F1Z A;  4EM1 A;  2A69 F;  4XID A;  1X3Z B;  5DCF A;  2R7X A;  1G8X A;  1J0R A;  4PGH A;  1EV7 A;  4AYB A;  4G9Y A;  3BP8 A;  2CV1 A;  5K5R A;  3FXJ A;  1IN6 A;  4IEJ A;  3R6S A;  1R49 A;  1FMW A;  3W2V A;  4XKC A;  4E7H A;  4V2F A;  4DYQ A;  2WBM A;  1CQT A;  2GM4 A;  3BR5 A;  2CRG A;  3I0T A;  1O4X A;  4BE0 A;  2DAO A;  1FIP A;  3H92 A;  1BOA A;  2CG4 A;  1GHC A;  1SVO A;  3O2P E;  3HRS A;  4M6X A;  3FIS A;  4OU0 A;  1X1A A;  3GZN B;  1AHD P;  3PIP F;  2R7F A;  2DA5 A;  3CUQ C;  5JR3 A;  4IHW A;  2VC1 A;  4J00 A;  2XKP A;  2BY2 A;  3U2R A;  2QWW A;  2EV6 A;  1NG7 A;  2MBF A;  2BXY A;  2I10 A;  1U0J A;  1G6N A;  1BR2 A;  3KE2 A;  5JVT A;  4L18 B;  1ACI A;  2F6C A;  3K1M A;  4I0A A;  2NRA C;  1OYW A;  4NQW B;  3KP4 A;  3HSR A;  1ZEL A;  4I76 A;  5EF6 A;  4KT6 A;  2F5D A;  5LGN A;  4U87 A;  4FAS D;  3K1N A;  4I98 B;  5KCM A;  2WB1 N;  2XAU A;  1HKQ A;  2IP2 A;  4J01 A;  1FX7 A;  2LMD A;  2W85 A;  3CCY A;  3OYL A;  3CMA I;  2FBH A;  1I3Q J;  3MEX A;  2LKX A;  1KQ8 A;  1Y6I A;  4U0V A;  4M9Z A;  3RKW A;  1E0E A;  2B0L A;  2BE5 F;  3J7A O;  2LP0 A;  2PJP A;  5DCM A;  1WJE A;  4JP0 A;  3CCR I;  3KIO A;  2R0Q C;  1Z1D A;  2ME0 A;  1K4S A;  4RB3 C;  2D1H A;  2FU4 A;  1P4X A;  1UZC A;  2QSG X;  4KNY A;  2W57 A;  4O6J A;  3NWS A;  3DP7 A;  3I58 A;  2RKH A;  2VQC A;  2DJI A;  3CCS I;  2Z5U A;  1WJC A;  4C2U A;  5FGM A;  5C4J J;  2HOA A;  2HEO A;  2E34 A;  5FKO A;  4O5V A;  1TLH B;  3BDD A;  2WV0 A;  4BKX A;  2V6C A;  2V1D A;  3EYY A;  2EFP A;  3NAU A;  2DYR H;  4IRH A;  2ZSI B;  2R7U A;  3G2B A;  4S05 A;  4JK1 X;  4Y3O A;  5IOY A;  2VE9 A;  2VKH A;  2O8X A;  4ZDP A;  2P7C B;  2HVS A;  4HLX A;  3ABM H;  3C7J A;  3DLL F;  1KU3 A;  3E7L A;  4HX8 A;  4WXC A;  4XRS A;  4YFX F;  2FE3 A;  2ESH A;  1HW2 A;  3CCL I;  2BY0 A;  1USS A;  3H0D A;  1F43 A;  3OIQ A;  2J5O A;  2OQR A;  4KMU X;  2ELJ A;  2DA6 A;  5HLH A;  2EA2 A;  2HQN A;  2HYJ A;  4DJA A;  5CLS A;  4UY8 I;  4NC6 A;  1YRN A;  2JSP A;  3DPT A;  1SAU A;  2L0K A;  3JRC A;  1YOV B;  2L4A A;  2M4K A;  3H3Z A;  1YW9 A;  1YYV A;  1B1B A;  2LY9 A;  3QOP A;  3VB2 A;  2M1B A;  4OIN F;  1G59 A;  5KHD A;  2OC6 A;  3CP2 A;  3KP2 A;  3ZR8 X;  5F0C A;  1O3S A;  1IAW A;  1IG7 A;  2CQN A;  5DM7 F;  2X1C A;  3E0J B;  1IN7 A;  2H6B A;  2DT5 A;  4JOM A;  5LEK A;  2DPU A;  3K7A J;  2V1U A;  4D9J A;  5LEJ A;  1VND A;  2FD5 A;  3OMY A;  4GFB A;  4ENM A;  3RPQ A;  3IC7 A;  1R5I D;  1ETK A;  1KQ9 A;  4PDK A;  1SVL A;  1ETV A;  3FZV A;  3VSL A;  2STW A;  1KQ0 A;  1R36 A;  1Q1H A;  2X51 A;  2L2O A;  3GBG A;  3FHN A;  3NAR A;  4G8X A;  2VOO A;  2ZFU A;  3CCV I;  2MD5 A;  1KON A;  3M1E A;  1J2X A;  2E7W A;  2R4G A;  4J19 A;  3VOE A;  1D0X A;  2E2H J;  2H1L A;  4W1U A;  2ZSH B;  3SEZ A;  2K85 A;  4JX5 A;  3HOX J;  3OSF A;  1ON2 A;  3OS0 A;  2WV1 A;  1LVK A;  2A5Y B;  2UV1 A;  5HOD A;  5E1X A;  2VJJ A;  3TO6 A;  2V9V A;  5FFX A;  1FMV A;  1YX5 A;  5GAE J;  3GTL J;  4A93 J;  1MH3 A;  4EJW A;  2X6Y A;  2M8E A;  1FSE A;  5HOO A;  3OOU A;  4MHG A;  2XB5 A;  4E7K A;  1OIS A;  4BU2 A;  1RRJ A;  3A1Y A;  3MD2 A;  1ETQ A;  1BM9 A;  3EUH A;  3LA7 A;  1S7O A;  2W1O A;  5J3L A;  2LLK A;  2HPI A;  1MZB A;  4MTD A;  1RZ4 A;  1T0F C;  2MSY A;  2DA7 A;  2EZI A;  2VXD A;  1YJW I;  3DBL B;  1JE8 A;  3H35 A;  3FMS A;  3NQO A;  2GQQ A;  2O0Y A;  4MIM A;  1E3H A;  4XLA A;  4M3B A;  3HOZ J;  1DGR M;  1BA5 A;  5HS7 A;  2EFW A;  1IDZ A;  1PDN C;  2OZ6 A;  2BBY A;  2LY2 A;  2TRT A;  5EEG A;  1S8N A;  3ISP A;  3F8M A;  5IYC J;  4BE2 A;  1W36 C;  3KZI C;  3S15 J;  3T8T A;  2JN6 A;  2RV8 A;  1ULY A;  1ZQ3 P;  1JTY A;  2VL8 A;  1R1T A;  4IQJ A;  1T8I A;  1WJ5 A;  2K9Q A;  2MC4 A;  3ZQG A;  3TO9 A;  2OV7 A;  2JWT A;  1MBF A;  2DN0 A;  4L9N A;  3U1D A;  1IV8 A;  3Q5F A;  3F0C A;  2HTS A;  4LMY A;  1W1W E;  2QEN A;  2BYV E;  3BOQ A;  4JBA A;  3RPU D;  1PP7 U;  3WOD F;  2V7F A;  3MZ8 A;  1VQN I;  1D5V A;  4CA0 A;  4EJV A;  2AHQ A;  1VQP I;  1B8I B;  5DTD A;  2IS4 A;  5CVR A;  2X1E A;  3C18 A;  4M3G A;  4Z6Y A;  2VLA A;  1MW7 A;  3ZMD A;  3GTO J;  3F72 A;  4AIJ A;  5KAI C;  2MW8 A;  3KEQ A;  1HA8 A;  3OS1 A;  3P5J A;  3OWT A;  4LIT A;  1C0W A;  4MFD A;  4XMY A;  2DQR A;  2BW3 B;  1GLN A;  2G7H A;  2WY8 Q;  3DV8 A;  4HF1 A;  3S16 J;  3FXL A;  2VIX A;  2FOW A;  3F6V A;  3SDG A;  2B7E A;  4KT5 C;  3ZPL A;  3AL0 B;  3SEQ A;  1HKS A;  4WF2 A;  4BQN A;  3BT9 A;  3IUO A;  5FKN A;  1IZ1 A;  2M2E A;  2K27 A;  4D5F A;  2BY1 A;  4KUM A;  1R7J A;  2R7W A;  1ZR4 A;  4E7Z A;  5LHI A;  4CCM A;  4CDG A;  5M5X J;  2Y0S N;  4II3 A;  3CUO A;  4D0P A;  3ZGK A;  2PN6 A;  3TOA A;  2JA5 J;  3I3L A;  4DBQ A;  2A07 F;  2NOJ B;  3E6D A;  3OIP A;  1QA6 A;  4EMS A;  4RGX A;  1XDS A;  3PFY A;  4QTR A;  3GFI A;  2IT0 A;  3PNY A;  1DPU A;  2DMQ A;  1DQU A;  4D7M A;  1N78 A;  3BG5 A;  2HXI A;  3MMY B;  4C3J J;  1R1V A;  4QWQ A;  4YG2 F;  3OYE A;  4ZDO A;  1FZP B;  1IF1 A;  2E5N A;  2A3S A;  1IRX A;  3GFL A;  2AXL A;  4X0G A;  1PUE E;  2FQ3 A;  3HRU A;  1X3W B;  1ZKG A;  2Z9O A;  1LDK B;  3BCA A;  1JJ8 C;  4A0Z A;  1KYZ A;  1P6R A;  3S32 A;  3LNQ A;  1B9N A;  1AOY A;  3FX3 A;  1OR7 C;  1YS6 A;  4R8H A;  2NYX A;  4B44 A;  1AA7 A;  3OSG A;  1EH7 A;  2M4G A;  1T08 B;  1B8I A;  1T56 A;  1MBK A;  1BC7 C;  2TDX A;  2IEK A;  3QAH A;  4HAM A;  1MJA A;  2ECB A;  5J8C A;  3F3X A;  3EUH C;  2QBY A;  3HRM A;  2WTE A;  2O03 A;  3O8G A;  3BQZ A;  3C2H A;  3U21 A;  2R7T A;  1WI3 A;  3QPH A;  4P5O A;  2UUZ A;  2XAG A;  2DFE A;  4I09 A;  2JA6 J;  4HST A;  2NVQ J;  3WE3 A;  4WX9 A;  4H4K C;  3C2B A;  1FPQ A;  3EQL F;  1OYI A;  4Y17 A;  2QM3 A;  3PM1 A;  1ETY A;  2VB6 A;  3ZQF A;  1ZG1 A;  3IP4 B;  1TL8 A;  4BGD A;  4F7Z A;  4HW0 A;  3KZZ A;  4M9S A;  3K70 C;  1W7P B;  2XRL A;  2OAZ A;  4AD9 A;  5B66 C;  3QYE A;  2O9L A;  1JUP A;  4XBF A;  5IP7 J;  3DFG A;  4CO8 A;  5EEH A;  3V7C A;  3WTS C;  1SMT A;  3ZQ7 A;  1WFX A;  4XR6 A;  1M1E B;  2ELH A;  3LSJ A;  1OPC A;  3L2W A;  1X2N A;  2IRF G;  1BI0 A;  2Y48 A;  3RKY A;  3DKY A;  2EFQ A;  1Y56 A;  1KZH A;  5E8I A;  3CCJ I;  2Y75 A;  1MMN A;  4EQQ A;  1Y1W J;  3WU0 A;  5L3G A;  2LRE A;  2OA4 A;  3H5A A;  4XOT A;  2QSH X;  1WWX A;  4Z2Y A;  5KNL A;  3ABT A;  2ZXW H;  2K7L A;  2X6O A;  5BPI A;  2DOA A;  1G2H A;  3LSH A;  2XIG A;  1H8A C;  4ENK A;  3NRV A;  4HBL A;  1MBE A;  4IHX A;  2XAH A;  2XF5 A;  3ZXS A;  2XC7 A;  1ZRF A;  2W4S A;  1HOM A;  1TBX A;  1VQ8 I;  3A01 A;  2XUB A;  3PJR A;  1W7P D;  1X2M A;  3V7R A;  1B72 A;  3J81 Z;  1DP7 P;  5F64 A;  3ZMZ A;  3BTJ A;  4E4H A;  1R4N B;  1GVD A;  3GTK J;  3FBN B;  3F6O A;  2Y2Z A;  4XIC A;  2HS5 A;  4BDY A;  4PCQ A;  1XB4 A;  5HS8 A;  3DEW A;  4OMZ A;  4Q4Z F;  3GF2 A;  1P2F A;  1PP8 F;  3JSP A;  1XGM A;  4MO7 A;  3KCC A;  1T2K A;  3HOT A;  2KIF A;  3PFI A;  3W2W A;  2ESN A;  2FMY A;  2ISZ A;  1TNT A;  2ZJQ F;  4I6Z A;  1BIB A;  2ELK A;  3BR0 A;  4PFP A;  1NH3 A;  5ILU A;  1ZG5 A;  1JUM A;  4DW6 A;  1SAN A;  1RUN A;  5H6R A;  1VQ5 I;  3HOS A;  2PMZ A;  4ZH4 F;  3OYC A;  3S1N J;  1LDJ A;  3OYN A;  1MBH A;  3KP7 A;  1JJ6 C;  1YRN B;  3GWZ A;  4P1W A;  3E3V A;  3L1P A;  2L7M P;  2QQA A;  4CYC A;  1MMG A;  4BEH B;  5BOX A;  3HPH A;  4HDV A;  3HSF A;  3B6C A;  4BY7 J;  4HQE A;  1VQ4 I;  4NDL A;  4B3A A;  1SFE A;  1WGX A;  2M7B A;  2R5Y B;  1WJF A;  3MKL A;  3O8H A;  2FA5 A;  4GYI A;  3KET A;  2ISY A;  4N4O B;  4ESF A;  2ID6 A;  4RB1 A;  4LG3 A;  3RSN A;  2EV0 A;  5B3S H;  2F5E A;  5CQE A;  1RR7 A;  2KPM A;  3LWF A;  5LD2 C;  3N4M A;  4MEY F;  1FLI A;  3HZJ A;  1RIO H;  4CCO A;  5TIS C;  1JGG A;  1B4A A;  1BR1 A;  1YG2 A;  4IRG A;  5FKL A;  4KN4 X;  5IOZ A;  2VE8 A;  4PGG A;  1O57 A;  3ABK H;  1IJW C;  5JLW A;  1R6R A;  4YEL A;  4NNJ A;  1OCZ H;  3FMR A;  5D8L B;  2KIQ A;  3M4O J;  1HXD A;  1EJ9 A;  1BI1 A;  4PJN A;  2XAF A;  2BHY A;  1W5C C;  5GAH J;  1TT0 A;  2J5P A;  3J80 K;  5LHG A;  3OYD A;  1QPI A;  3J81 K;  4BAY A;  3CC4 I;  4IO9 F;  4HF2 A;  2B63 J;  1X4O A;  3U1K A;  2LVS A;  1VQ9 I;  2V1X A;  5M3M J;  1HSJ A;  4BJ5 C;  1FOW A;  2EB7 A;  4LK1 F;  3KP6 A;  3K0L A;  3FMQ A;  4BJ6 C;  4C3I J;  1WHU A;  3M8F A;  4EV0 A;  6PAX A;  1SAX A;  1ERD A;  1DDN A;  4PSW A;  1FP1 D;  2EV5 A;  5AIP A;  3SFZ A;  2LF7 A;  2H8W A;  3E5U A;  3RQ4 A;  1TP4 A;  1HQC A;  3CC7 I;  3J80 Z;  1BC8 C;  2H6C A;  4A3L J;  2QGU A;  1HF0 A;  2FBK A;  2BZT A;  2L4M A;  1IGN A;  1PUF B;  4XL9 A;  2UZK A;  4L9V A;  3T8R A;  4L5E A;  4K2E A;  4LLL A;  5ERI A;  4U0W A;  3KYD B;  1P7I A;  4HF0 A;  4XLP F;  4BAC A;  4XLN F;  1OYY A;  1Y39 A;  1QBJ A;  1ZH5 A;  2ZJ2 A;  3QYB A;  2R7Q A;  4G6Q A;  2R93 J;  2BGC A;  3WTW C;  5CKT A;  4AVP A;  4MQV A;  5H20 A;  2LD5 A;  1W4M A;  1GXP A;  3D5S C;  3REO A;  3LSI A;  3CJQ B;  4OIO F;  5JHU A;  5F0F A;  4EGZ A;  3A4C A;  2F2E A;  3FK7 A;  3A03 A;  1XMX A;  1ZAO A;  4NHJ A;  2LTP A;  2KJC A;  4ASN A;  5K7F A;  3HC7 A;  2CSO A;  2VT3 A;  2EH3 A;  4OAZ A;  3S1Q J;  2KP6 A;  2QSF X;  1R1U A;  2V1N A;  3L7W A;  2ZCW A;  5DDG A;  3BY6 A;  3K4C A;  5LFA A;  3S3M A;  2V79 A;  2W25 A;  3BC8 A;  4FT8 A;  2X48 A;  3KP3 A;  3MZH A;  2VQG A;  2BY3 A;  3IWF A;  1FYK A;  2K9M A;  1WH7 A;  1QZE A;  3W6V A;  4EM2 A;  4F93 B;  2QZ8 A;  1Z9C A;  1V55 H;  2MD0 A;  4UUS B;  1E17 A;  1U5T A;  5LRS A;  2Q8K A;  2PG4 A;  3H9J A;  1TWC J;  4EJO A;  2F48 A;  3OYB A;  3NEU A;  4BJT A;  2D1V A;  1YS7 A;  1JKQ C;  3PQJ A;  3W2A A;  4I0B A;  2VI6 A;  4JX6 A;  3VYU B;  1ETW A;  4CCK A;  2E1M B;  4BHC A;  1JT0 A;  3DLA A;  3CCQ I;  4CZC A;  3ZCO A;  1FTZ A;  2BW3 A;  3E5X A;  4E6K G;  4IPA A;  3HYI A;  3BR3 A;  2LC2 A;  1O3R A;  1TNS A;  4QSH A;  2K02 A;  4DBR A;  1P4W A;  2VJI A;  2V9K A;  3GFM A;  4I2O A;  3G3Z A;  4BNC A;  4II2 A;  2VQL A;  5DUK A;  3RKX A;  4BE1 A;  4FTH A;  3BG9 A;  1SD4 A;  3IKV A;  2CUF A;  1DU6 A;  3AG3 H;  4OAY A;  4A0X A;  2E1M C;  3FXM A;  4DZJ A;  4A3G J;  2ZME C;  3JRE A;  1BBY A;  2Z16 A;  5C3E J;  1OCT C;  3LA3 A;  5J40 A;  4IOC F;  4BL0 B;  1SMY F;  4BUP A;  3F8C A;  1ZGA A;  3MQ0 A;  1AWC A;  3EYI A;  4IHY A;  1D1B A;  2HVQ A;  4WXH A;  4CYD A;  3A2K A;  5BNG A;  4BBS J;  3O6B B;  1JT6 A;  1J9I A;  2VKD A;  3HM5 A;  4XLH A;  1MGT A;  1LB2 A;  1R9T J;  3JRA A;  2Y69 H;  1OLT A;  3WG9 A;  1ZLK A;  4M3E A;  1SFU A;  3WTY C;  2PJR B;  2DA2 A;  3S2W A;  3PNV A;  2EIL H;  4A2U A;  5L3E A;  3OYG A;  4CHU A;  5EZH A;  5HDG A;  1S3J A;  2KZV A;  3W6J B;  3E6B A;  1X1D A;  2QBY B;  4HV5 A;  3IH3 A;  3LSR A;  2A5W A;  1H9G A;  2YR2 A;  1R5H A;  3I71 A;  2ID3 A;  2QCO A;  2LRD A;  4GRI A;  2KDZ A;  5DM6 F;  3KYC B;  3CF2 A;  4HYE A;  4EJU A;  2JRM A;  3D5R C;  5E3O A;  4AM3 A;  3K70 D;  4GO1 A;  2L7K A;  4D7N A;  4HNU A;  5HLG A;  2FNP A;  1Z21 A;  3CDH A;  2OD5 A;  1RNL A;  1PVE A;  1XC5 A;  1W7P A;  2ACJ A;  1LE8 A;  1ZGW A;  5HLI A;  3E1S A;  1JXS A;  4XQF A;  2JMW A;  1MNM C;  5TJJ A;  2DMN A;  1J09 A;  2IBD A;  3J7Z I;  1RR8 C;  1F4K A;  4LB5 A;  4D1Q A;  4EAT A;  3DQV C;  4EM0 B;  4A3K J;  9ANT A;  3G73 A;  3B02 A;  4OWR B;  2O5R A;  3ECH A;  4AC0 A;  2LBF A;  3HGG A;  2PBI A;  1WI9 A;  2HNH A;  5C4X J;  1B9M A;  2X6X A;  5K5Q A;  3CO6 C;  1HC8 A;  3E5Q A;  2P8T A;  3F9K A;  1DGW Y;  2CGP A;  2CUE A;  1U8B A;  3VYT B;  1X3U A;  3AFH A;  2BHZ A;  4L0Z B;  2X4H A;  1DPR A;  1XGS A;  3H36 A;  3C2G A;  2WAQ A;  3A01 B;  5EG0 B;  2XB0 X;  1G4D A;  4IVN A;  1ODD A;  2HQA A;  1MNE A;  3FXK A;  4CH7 A;  4JX4 A;  3I4P A;  2DA4 A;  3PO3 J;  2ETH A;  3FXO A;  1FJL A;  4RB0 A;  4DZP A;  1GDT A;  1TZL A;  2WAF A;  2MYS A;  2FBI A;  1Y1V J;  3CJN A;  2CW8 A;  3TDU C;  2RN7 A;  2KFD A;  2K9L A;  1V4R A;  2O61 A;  4ZYA A;  3HPG A;  2NNY A;  2I8D A;  3SZP A;  5F0H A;  3C3W A;  3OR2 C;  2LOO A;  2KLO A;  1EKE A;  3L2U A;  2R92 J;  2M87 A;  3VDX A;  2XKO A;  3K4B A;  2COB A;  3TKY A;  3RPU A;  3DWL E;  3BPV A;  1ZGJ A;  4RLQ A;  1XX5 A;  2M34 A;  5FLX Z;  2MAB A;  2XDV A;  1P92 A;  3HIF A;  3WHB A;  1GT0 C;  4QPO A;  1MMD A;  2MLG A;  1GUU A;  3DKW A;  2HYF A;  1VQO I;  5EGO A;  2LSO A;  4DQ2 A;  4A3I J;  3I59 A;  3F8B A;  3I5U A;  3WE2 A;  3V8L A;  1X1C A;  3H5N A;  5FJ8 J;  2P5L C;  5D4S A;  1ZRE A;  4R79 A;  4IHS A;  3ZQH A;  2VJ4 A;  3DTI A;  3G1M A;  4RGS A;  3ZQI A;  2VN2 A;  2KJB A;  3TW6 A;  2P6S A;  4DIQ A;  1QHG A;  2HXO A;  2IXS A;  2XV4 S;  2QKM B;  1I27 A;  5CPR B;  4N4N B;  2RVC A;  5JHF A;  2DO7 A;  4BS9 A;  1OFC X;  4B3X A;  1UHS A;  4B4C A;  3HTS B;  5JFR A;  1QVU A;  1YHQ I;  1ZYR F;  1IRF A;  3H3U A;  1P4A A;  5CYV A;  3TGN A;  5L3C A;  1L3L A;  2CQX A;  2UXN A;  4XSX F;  3X2Q H;  5M3F J;  3BTC A;  1Y0U A;  4WWC A;  2XRN A;  2R3S A;  2I5U A;  4F92 B;  2EBI A;  1QHH D;  2OBP A;  3WTU C;  2VC0 A;  3CUQ A;  1Y8R B;  2CWE A;  2D2W A;  4HV6 A;  4ZZD A;  1UB9 A;  2KIU A;  2QQB A;  4DYC A;  5A2Q Z;  1D0Z A;  3EPZ A;  3QPT A;  2R7V A;  1SD6 A;  1S6L A;  3Q3S A;  1ETO A;  1YIJ I;  1H0M A;  1D8J A;  3GTG J;  1RKT A;  3BJ6 A;  4S0H B;  4DYR A;  2HOS A;  2OZU A;  1B59 A;  3FKI J;  1LEB A;  2PQ8 A;  2DBB A;  4EGY A;  2CU7 A;  3Q0V A;  4RA2 A;  5FO5 A;  2EFO A;  2RQQ A;  1XSD A;  3OYK A;  3ROU A;  3TOB A;  2EIM H;  5CJ9 A;  2KKO A;  4MGR A;  4Y7N J;  5BMZ A;  2XGC A;  1FOK A;  2PI0 A;  2QVO A;  1A6Q A;  3S14 J;  2HQR A;  2P6T A;  3QU6 A;  1XDU A;  2DLL A;  1LFP A;  2LNB A;  2OQG A;  3MVP A;  4AIH A;  1ON1 A;  3TW7 A;  2M9H A;  2HDW A;  3ZOB A;  1BW6 A;  1T95 A;  2CO5 A;  4G12 A;  4ZTF A;  3QPL A;  5EGO B;  3BRO A;  4WXD A;  4N0B A;  4NQW A;  2KRC A;  1JUS A;  4RGR A;  3HSE A;  1FWZ A;  3ZMT A;  4DGW B;  3B73 A;  1FYL A;  4P55 A;  3LQR A;  3L2V A;  5DD8 A;  1Y0N A;  1Z3X A;  3ESW B;  5C44 J;  2E60 A;  3CLO A;  3LSK A;  3I64 A;  3DBH B;  3RCO A;  1W5S A;  2XAJ A;  3PUB A;  5FLX K;  2EIJ H;  2FUG 2;  4RAG A;  1VQ6 I;  3TP3 A;  3M3Y J;  3IAM 2;  2WY7 Q;  2JK3 A;  1Z67 A;  4XLF A;  1KA8 A;  2VQH A;  3LSG A;  4C30 A;  1A04 A;  5EEA A;  4PJJ A;  4I7H A;  2NS7 A;  2GXA A;  4UVB A;  4Y4R A;  4RS8 A;  2JUC A;  2E7X A;  2GBY A;  5FD6 A;  4LG0 A;  4BQO A;  3KEY A;  2VJ5 A;  3DBR B;  3EET A;  1REP C;  4EJT A;  2B9S A;  1BI3 A;  2IGN A;  2XAS A;  3FIW A;  4LK0 F;  1DUX C;  2FXA A;  4CIC A;  5B1A H;  3COA C;  1QVT A;  3M7G A;  1R23 A;  3K2Z A;  3JCU C;  5D6F A;  4GXO A;  1S72 I;  5LGT A;  4C2T A;  2WAD A;  3DXJ F;  2CUZ A;  3WGH A;  4OMY A;  2Q0O A;  2AQF A;  2KQR A;  3HJE A;  4HQM A;  3UKG A;  3MFK A;  1S7E A;  2JVG A;  3HOV J;  3CCU I;  2ZBK A;  2WC2 A;  3GX4 X;  2OJE D;  2Y30 A;  4WCG A;  2AQE A;  3IHU A;  4UHT A;  2BOL A;  4LFU A;  5K1Y A;  3I54 A;  1O7L A;  3GTQ J;  1EH6 A;  1ZAR A;  4AYB N;  2E19 A;  1XMA A;  2L5Q A;  3OIO A;  2YX7 A;  5FLV A;  5E3M A;  2VBZ A;  3PUF A;  4IJA A;  2VUM J;  1IRZ A;  4CSW A;  4M74 A;  2OUM A;  1QNT A;  5EYR A;  1JGS A;  4M9X A;  4S04 A;  4AIK A;  4JYK A;  4XOP A;  3ERM A;  5F04 A;  3ZN0 A;  3OYJ A;  2L9S A;  3DTE A;  1I6X A;  1UG0 A;  1Z7L A;  4D5C A;  2TCT A;  2XGD A;  5GTI C;  4PFO A;  2E35 A;  4KYW A;  4EEF G;  3GFJ A;  2VXZ A;  1JHH A;  1IN8 A;  4BXX J;  2XVC A;  1SVM A;  1Z7U A;  1WKM A;  1OR7 A;  5FKK A;  1Z6R A;  4AU7 A;  5LHH A;  3IRR A;  3PO2 J;  4ZYG A;  5J47 A;  1KU7 A;  3R4K A;  1KU9 A;  1OCP A;  3ZP5 A;  2MG4 A;  1UHM A;  1ZN2 A;  4PJL A;  2BVL A;  3OY9 A;  2L02 A;  1D1C A;  2A6T A;  4AWX B;  3IL2 A;  3KP5 A;  5IP6 A;  3RYR A;  5E17 F;  3ONQ A;  1K7A A;  3GCM A;  5D5X B;  1XPX A;  3ZMV A;  4LJZ F;  4MNU A;  4BDZ A;  3GTM J;  5IT3 A;  5J4Y A;  2NS0 A;  2GXB A;  3SJM A;  4YFN F;  1BL0 A;  1X4P A;  1T0F A;  2W24 A;  2A6H F;  3DEU A;  3K10 A;  4GGG A;  3SXY A;  2CH0 A;  1T33 A;  1N77 A;  4KIS A;  4LLN A;  3CJT B;  3S2D J;  3JAM Z;  3PQK A;  4B43 A;  3ABU A;  1IRG A;  2R7R A;  2CMP A;  1ZG3 A;  4XNF A;  1OKR A;  5HNF A;  2A68 F;  4N9I A;  2CV0 A;  4W97 A;  4CZZ A;  3MCZ A;  4LB6 B;  3VWB A;  5D5V B;  1BI2 A;  1GV2 A;  1WRJ A;  2X0L A;  3H0G J;  3IH4 A;  4BQA A;  1MJ9 A;  3OOP A;  2YX4 A;  5F27 A;  4H0E A;  1TWG J;  3SZG A;  1S29 A;  1MH4 A;  2Q2E A;  3UNG C;  2V9P A;  4KIC A;  5DUI A;  4CUG A;  1V54 H;  2DT7 B;  2MH9 A;  2M0C A;  4FHT A;  4LIV A;  3OYA A;  2HZD A;  1D1A A;  2JVH A;  2UXX A;  1F9N A;  1ZK8 A;  3T1B A;  1LFU P;  2VON A;  3DCF A;  4NC8 A;  2HYG D;  3OL3 A;  1FP2 A;  2MA3 A;  2HVR A;  2GA1 A;  1MMS A;  3F21 A;  3GLL A;  4ZYD A;  1FYM A;  4CXF A;  2FEZ A;  2CYY A;  1GVJ A;  2G7U A;  1R71 A;  3DPL C;  1FIA A;  3OL4 A;  2VAS A;  2XHK A;  1L0O C;  4XRM A;  3K9T A;  4XOR A;  4EVI A;  2RRE A;  2C6Y A;  2R5Z B;  2LDU A;  3QOD A;  1S5L C;  3MKY B;  3CF5 F;  2JA2 A;  4ZTJ A;  5M5W J;  1W5T A;  3CDI A;  4F55 A;  1R4M B;  2GAU A;  2OTJ I;  4IF4 A;  2HFH A;  2IA2 A;  3GVA A;  2G0E A;  1UCR A;  1LE8 B;  1SD5 A;  1MDM A;  1HCR A;  2IPQ X;  3E6M A;  5GAG J;  1BR4 A;  3BG3 A;  4BY1 J;  4RLF A;  2P81 A;  1SD7 A;  4CCJ A;  2Y9Y A;  4U88 A;  5EG0 A;  4L0Y B;  1N75 A;  5J4V A;  2JQ7 A;  1OJL A;  2NOG A;  3LMM A;  5IYB J;  5J8F A;  3BPX A;  2FSW A;  2IA1 A;  4KN7 X;  2KT0 A;  2ZME B;  4G7H F;  2K86 A;  2DI3 A;  2RDP A;  1TT5 B;  4XKV A;  2IS2 A;  1YI2 I;  3OYF A;  2VOD A;  4UUV A;  4A6D A;  3R0J A;  4HG2 A;  4Y13 A;  1WJA A;  2K9S A;  1HLV A;  1WZ2 A;  1JI8 A;  1VF9 A;  1YW7 A;  2FF4 A;  2P5V A;  2W82 A;  3HKZ A;  3KFW X;  3GW2 A;  4ENN A;  1HW5 A;  2K3F A;  1HKT A;  1P7J A;  4GYG A;  2K4J A;  1IN4 A;  1IC8 A;  4Y15 A;  4M6Y A;  1LVA A;  4ETS A;  2HQ5 A;  2Z2S B;  5IT9 Z;  4HNT A;  4IHT A;  2O8K A;  2QQ9 A;  1XMK A;  1I6H J;  2H09 A;  2L54 A;  1UAA A;  2CS3 A;  3HHG A;  3DU6 A;  2DU9 A;  2IS6 A;  3PSF A;  3CQZ J;  5E79 C;  3WU2 C;  2L9N A;  4UV9 A;  2LYC A;  3QOE A;  4U7B A;  3SDB A;  1YW8 A;  3MKW B;  3VYS B;  5IPA A;  1HDP A;  4A12 A;  1I50 J;  4PK4 A;  2JA7 J;  2JJ7 A;  3ABL H;  2ZFW A;  2F4I A;  2JPC A;  3GYH X;  2K3P A;  4RAZ A;  1RUO A;  3C1D A;  4A3C J;  1WSU A;  2IA0 A;  1AKH A;  2G9W A;  1K6O A;  3JRG A;  4RDU A;  2ADU A;  2ME6 A;  1YO5 C;  2WA0 A;  3FXR A;  2XSJ C;  4M72 A;  3RZO J;  4R1H A;  2LG4 A;  3ECO A;  2KZG A;  5HDK A;  1IW7 F;  2KDO A;  5DV5 A;  2XGX A;  2YUS A;  1UHW A;  1G3Y A;  4N9H A;  3PSI A;  1U78 A;  4PZJ A;  4IOA F;  3JR9 A;  5HLT A;  3VPR A;  2DMT A;  4Y33 A;  5H6Q A;  3I9V 2;  3CCE I;  1VFC A;  4CCL A;  3M1C A;  5D8K B;  1MJB A;  3HOW J;  2IS1 A;  5M5Y J;  2STT A;  4XRF A;  3BR6 A;  3LOC A;  3H9Q A;  4LD5 A;  2R7S A;  4A3D J;  3N05 A;  4LOC A;  1UG2 A;  1ZRD A;  2KRH A;  3J7A Y;  1ZTR A;  3A0H C;  3D1N I;  2OF7 A;  2CW7 A;  4E7S A;  1TC3 C;  4IL6 C;  5LRR A;  2PMH A;  3A02 A;  2MC3 A;  1ZLJ A;  3B6A A;  4LGW A;  3AL0 C;  1U6G A;  1EA3 A;  1JHF A;  1R5G A;  2M30 A;  4MLO A;  3JTH A;  1FBU A;  3G6E I;  3Q0W A;  1WJB A;  1W36 D;  1MKM A;  2DOD A;  1WVR A;  3QRF F;  1UJ8 A;  3K4N A;  4MQ9 F;  3HEF A;  3W3C A;  1JKO C;  4I02 A;  2K4B A;  4MFE A;  3E6C C;  1MSE C;  1E3P A;  3QP6 A;  4ABZ A;  5FLM J;  2RNG A;  5HVQ C;  3HKZ N;  2IGK A;  1FTT A;  4P9F A;  4RAF A;  1YIT I;  2Y0S A;  1UFM A;  1WJD A;  3AKZ A;  5FRM A;  1CGP A;  3SHF A;  1IXR C;  2VOP A;  1FNN A;  3MWM A;  4UUS A;  2R7Z J;  3QPS A;  1TW2 A;  1XTA A;  2CQ7 A;  2HGC A;  2LY1 A;  3ML6 A;  1K4T A;  2QUF A;  1B72 B;  2VT2 A;  2BVM A;  2IAI A;  1OCR H;  3M8E A;  4NC7 A;  3FM5 A;  3HOY J;  3RIR A;  5HS9 A;  2BXZ A;  2EZL A;  3BJO A;  4FX4 A;  4A3F J;  2DW4 A;  2JUG A;  4LG0 B;  1TQP A;  2LF8 A;  4X1E A;  5CVI A;  1PJR A;  3RJP A;  4A5N A;  1TWF J;  2VBY A;  3KZY A;  4G6D A;  1EF4 A;  1CF7 A;  4YIF A;  4DNC A;  4FE4 A;  1MD0 A;  1AKH B;  1TQM A;  5CQG A;  1ORK A;  3QQA A;  5J1R A;  3FXU A;  2VBX A;  1I1G A;  3GTP J;  4ANJ A;  2ECC A;  3OR1 C;  3P9K A;  2K40 A;  4HLY A;  2OTL I;  4ZYE A;  1Z91 A;  3ZQQ A;  4BYY A;  2OPT A;  3TO7 A;  1QGP A;  4LIU A;  1EH8 A;  4BH9 A;  1LPQ A;  2DK8 A;  2ZXJ A;  3HBL A;  5CVJ A;  1NK3 P;  1Z3Y A;  4NUB A;  2MGQ A;  4PSX A;  2HU9 A;  4XM3 A;  2QF7 A;  3TP0 A;  2XF7 A;  2E1O A;  4IQ4 A;  1Z77 A;  1BW5 A;  3QP5 A;  4F52 A;  1YIO A;  5A2Q K;  3L00 A;  2GIV A;  3BQY A;  2XAQ A;  2H94 A;  3KYL A;  1VQL I;  1V3F A;  5F1R A;  2NAZ A;  3CME I;  1B6A A;  3TL4 X;  3IV5 A;  3MAJ A;  3QWL A;  3S3O A;  1K78 B;  4YFK F;  4QIW N;  3IWZ A;  1BIA A;  4YRV A;  2CFO A;  5K7H A;  3LAJ A;  1IXS B;  3F8F A;  4BXU A;  3H3V K;  1DP3 A;  1UMQ A;  1K83 J;  3CD6 I;  5TGT A;  3L2R A;  4U0Y A;  4XSZ F;  5AON A;  1V5E A;  5CVV A;  1PUF A;  1W0T A;  3L09 A;  3WG7 H;  2LKP A;  2BEO A;  2HDC A;  1OCO H;  2DMU A;  3U9G A;  3BWG A;  2KIS A;  1J75 A;  3DTK A;  2DJN A;  1MMA A;  2VKV A;  4I01 A;  1TWA J;  4GCV A;  4ITV A;  1G3S A;  5F6F A;  2H8R A;  1ZRC A;  2RNJ A;  3H9G A;  4KMF A;  1FSH A;  5D4R A;  1XN7 A;  5EJC A;  1TTY A;  3QYF A;  5D5W B;  3WTX C;  4L5J A;  4BHB A;  4HNV A;  1Q1V A;  5FRO A;  3FKJ A;  5KAF C;  1S9H A;  4B48 A;  2DYS H;  5EZG A;  1W0U A;  3KPH A;  2CUJ A;  3HXL A;  4IHV A;  3LA2 A;  1J5Y A;  3GO5 A;  3A0B C;  2HKX A;  5E1Z B;  1FOY A;  1SC7 A;  2HKO A;  3H1C A;  5ILS A;  1FY7 A;  2RGV A;  2EWN A;  3FDY A;  3GLX A;  2KRF A;  4FQG A;  4KA4 A;  3OYM A;  1BOB A;  3HDD A;  5E3L A;  2QKL B;  4M3F A;  3V42 A;  3KX2 A;  2FRH A;  5LLQ A;  2EQR A;  5DEQ A;  4IX7 A;  1Z0X A;  4M73 A;  1ETX A;  2V26 A;  3KLN A;  5J1Y A;  4A69 C;  2M8G X;  5ED4 A;  1J59 A;  2HWV A;  4KDP A;  3FWE A;  5CVU A;  5J1U A;  3IH2 A;  2DA3 A;  3RKQ A;  4V19 K;  2F4O B;  5E8G A;  1E3O C;  1FEX A;  1YLF A;  1YTY A;  1FOX A;  3VSK A;  1RET A;  1X1P A;  3VOD A;  3AAF A;  1K79 A;  3LSM A;  1T38 A;  5E3N A;  3BZ6 A;  1VTN C;  4RGU A;  5GP9 A;  1MSF C;  2LK2 A;  3R60 A;  1QRY A;  4E7J A;  3VYR B;  1V5G A;  2QQ8 A;  3K69 A;  3HUG B;  3J7Y J;  3JAM K;  3HHH A;  4UNO A;  3E97 A;  2ZNY A;  4AUX A;  4IKF A;  2CQQ A;  4KJZ A;  4QLC U;  1MDM B;  2FOK A;  4HA8 A;  1U9O A;  5EDN A;  2KHM A;  4UB6 C;  3CDL A;  2L01 A;  3JW4 A;  2FQ4 A;  3GME A;  1HW1 A;  4FIS A;  4B09 A;  1HST A;  2NVT J;  1YE9 A;  2R5Z A;  2DCE A;  4ON0 A;  2DPD A;  3L2C A;  2K5C A;  5K7Z A;  1RI7 A;  4YEJ A;  3R0A A;  1ITY A;  1SFX A;  4XLC A;  1RPW A;  2FJ1 A;  4U7D A;  1YQA A;  3IAS 2;  2OCE A;  1WQ2 A;  2HI3 A;  3BCB A;  3HGY A;  3TBI A;  1JKR C;  3D5L A;  4CCN A;  2KMU A;  2HZT A;  1LKX A;  4M3D A;  2ZJR F;  2ZME A;  2XRO A;  1BN5 A;  4XKB A;  3DEE A;  3HG9 A;  5HDN A;  1QQI A;  5BS6 A;  1IO2 A;  2BV6 A; 
#chains in the Genus database with same CATH homology
 2WWY A;  3FF5 A;  3KLO A;  2QLZ A;  5AIQ A;  2P5K A;  4ENJ A;  2YPR A;  4IXA A;  5KK1 A;  2D45 A;  2JSC A;  3DF8 A;  4BHP A;  5JI6 A;  5L3F A;  4UVA A;  2PMU A;  2P7V B;  3CTA A;  4MTE A;  1QPM A;  1BJA A;  5J6X A;  3GUD A;  5DD4 A;  3RYP A;  3T0Y A;  2NNN A;  1FBS A;  1LNW A;  2FML A;  3F23 A;  1XD7 A;  2JRT A;  4UVC A;  3V4G A;  4A6E A;  1STZ A;  3ZMU A;  3L9F A;  2Z99 A;  4UV8 A;  2M45 A;  3KEO A;  3BJA A;  4RAY A;  1LJ9 A;  4Q47 A;  5D6E A;  4B8X A;  3ERE D;  2YU3 A;  1IXC A;  4OIQ F;  2AS5 F;  1R22 A;  3IRQ A;  5E18 F;  1XSX A;  5KVR A;  2Y0M A;  3ZN1 A;  1NHA A;  1D8K A;  5FFZ A;  1T39 A;  4UXN A;  3MZY A;  5ICC A;  2A6E F;  4G94 A;  4KIB A;  1U3E M;  5L3B A;  4OOI A;  2IW5 A;  5ICF A;  4RB2 C;  2Z3Y A;  3F22 A;  5LGU A;  1TW3 A;  3P7N A;  2ZKZ A;  4HOB A;  2IJL A;  3V8K A;  5ILV A;  3VFZ A;  3HRT A;  5DCM B;  2E1N A;  3FXQ A;  4HX4 A;  4L9T A;  3GEZ A;  2MH2 A;  3I59 B;  1TQI A;  1KU2 A;  3Q9S A;  4ZYH A;  5E20 A;  3FHZ A;  1I5Z A;  3WTT C;  2HTJ A;  3WU1 B;  1FT9 A;  2M5W A;  2H27 A;  1ZHF A;  3N97 A;  1Z05 A;  1R58 A;  3LQQ A;  2L3D A;  4WK8 F;  1CF7 B;  4YII A;  3LAP A;  1E2X A;  2HOE A;  4ESJ A;  4FX0 A;  2JT1 A;  3FM3 A;  2EJR A;  4OIP F;  4Q5S F;  3CO7 C;  3P9C A;  2CFX A;  3OV8 A;  4M71 A;  1K78 A;  5K5O A;  1F5T A;  3I53 A;  3RTR A;  4CGZ A;  3F8N A;  3T5X A;  2HR3 A;  2EA4 A;  2RQP A;  1LEA A;  2IVM A;  3SQN A;  1ONV A;  2R7D A;  4ESB A;  4A0Y A;  1GXQ A;  3WGI A;  2KIM A;  2RC4 A;  2CW0 F;  4O3M A;  2W84 A;  5L3D A;  3JSO A;  2F5F A;  4KIG A;  3V8J A;  3W6K B;  1H9T A;  1R00 A;  2GZW A;  5ICG A;  1OMI A;  3JTG A;  2EFN A;  1D3Y A;  4P9U A;  2Z33 A;  4OIR F;  3V7S A;  2GWR A;  3M9A A;  1QZZ A;  1FBQ A;  2DFI A;  5LBQ A;  3IKT A;  2ZO4 A;  2COM A;  2JZY A;  2EK5 A;  3TDZ C;  1QZY A;  3WTV C;  2O3F A;  3ULQ B;  4LLG F;  1S7A A;  3O3K A;  1G3W A;  3GXO A;  4JQF A;  4Q48 A;  4KIF A;  1O3Q A;  2FNA A;  2ZNZ A;  1XCV A;  1O3T A;  2DQL A;  5FD5 A;  4L9J A;  4HX7 A;  1XGN A;  2E1C A;  5IT9 K;  2PLY A;  1KGS A;  2P4W A;  2JTV A;  5FB2 A;  2DK5 A;  4L5I A;  2O6G E;  1I1S A;  3ZMS A;  2A61 A;  3SZT A;  1HBX G;  5BPD A;  4G7O F;  4ZZL A;  4HDU A;  5E1W A;  3HUG A;  2CQK A;  1IUY A;  3K1P A;  3R61 A;  2GXG A;  4HZF A;  1LDD A;  1XCB A;  4E70 A;  5BQT A;  1UST A;  5TRD A;  5DYM A;  3LFK A;  4G7Z F;  2PFB A;  3Q9V A;  1O7F A;  3RI4 A;  1T6S A;  2QYO A;  3GZ5 A;  3QU3 A;  5ICE A;  4P96 A;  2YSR A;  3LST A;  4IRI A;  3HTU A;  4KFC A;  1FC3 A;  3ELK A;  2GA2 A;  3D0S A;  4MEX F;  2VBW A;  3WTZ A;  3GZ6 A;  1LQ1 A;  1XSV A;  1T98 A;  1U5T C;  2JPB A;  1U8R A;  1QO0 D;  1J7K A;  2UWM A;  1U5T B;  1XGO A;  5D5U B;  3TQN A;  1U2W A;  1IN5 A;  2PEX A;  3RDI A;  4A5M A;  4NB5 A;  1KYW A;  2DTR A;  3EDP A;  3VEP A;  3P9I A;  1Z6T A;  2MLK A;  2F5C A;  1YFH A;  1G3T A;  2OU2 A;  3WGG A;  4TV7 A;  3CUQ B;  1F1Z A;  4EM1 A;  2A69 F;  5DCF A;  1J0R A;  4PGH A;  1EV7 A;  4G9Y A;  3BP8 A;  5K5R A;  1IN6 A;  3R6S A;  3I0T A;  2DAO A;  3H92 A;  1BOA A;  2CG4 A;  1GHC A;  3O2P E;  3HRS A;  4M6X A;  4OU0 A;  2R7F A;  3CUQ C;  5JR3 A;  2VC1 A;  2XKP A;  3U2R A;  2QWW A;  2EV6 A;  2MBF A;  5JVT A;  1G6N A;  3KE2 A;  4L18 B;  3K1M A;  4I0A A;  2NRA C;  1OYW A;  3KP4 A;  3HSR A;  2F5D A;  5LGN A;  3K1N A;  4I98 B;  1HKQ A;  2IP2 A;  1FX7 A;  2W85 A;  2FBH A;  3MEX A;  1KQ8 A;  4U0V A;  4M9Z A;  3RKW A;  2B0L A;  2BE5 F;  3J7A O;  2PJP A;  5DCM A;  1Z1D A;  4RB3 C;  2D1H A;  2FU4 A;  1P4X A;  4KNY A;  2W57 A;  4O6J A;  3DP7 A;  3I58 A;  2RKH A;  2Z5U A;  5FGM A;  2HEO A;  4O5V A;  1TLH B;  3BDD A;  2WV0 A;  2V6C A;  2V1D A;  3EYY A;  2EFP A;  4IRH A;  4S05 A;  4JK1 X;  2VE9 A;  2O8X A;  2P7C B;  4HLX A;  3C7J A;  1KU3 A;  4HX8 A;  4WXC A;  4YFX F;  2FE3 A;  2ESH A;  1HW2 A;  1USS A;  2J5O A;  2OQR A;  4KMU X;  5HLH A;  2EA2 A;  2HQN A;  5CLS A;  3DPT A;  2L4A A;  3H3Z A;  1YW9 A;  1YYV A;  1B1B A;  3QOP A;  3VB2 A;  2M1B A;  4OIN F;  3KP2 A;  1O3S A;  1IAW A;  1IN7 A;  2H6B A;  2DT5 A;  5LEK A;  2DPU A;  2V1U A;  5LEJ A;  4ENM A;  3RPQ A;  3IC7 A;  1KQ9 A;  4PDK A;  3FZV A;  2STW A;  1KQ0 A;  1R36 A;  1Q1H A;  2VOO A;  4G8X A;  2MD5 A;  3M1E A;  1J2X A;  2E7W A;  3VOE A;  1ON2 A;  2A5Y B;  5E1X A;  3TO6 A;  2V9V A;  5FFX A;  4EJW A;  5HOO A;  2M8E A;  1FSE A;  4MHG A;  1BM9 A;  3EUH A;  3LA7 A;  1S7O A;  1MZB A;  4MTD A;  1RZ4 A;  1JE8 A;  3FMS A;  3NQO A;  2GQQ A;  2O0Y A;  5HS7 A;  2EFW A;  1PDN C;  2OZ6 A;  2BBY A;  5EEG A;  1S8N A;  3ISP A;  3F8M A;  3T8T A;  2RV8 A;  1ULY A;  1R1T A;  3TO9 A;  4L9N A;  3U1D A;  3Q5F A;  2HTS A;  4LMY A;  2QEN A;  3BOQ A;  2BYV E;  4JBA A;  1PP7 U;  3WOD F;  1D5V A;  4EJV A;  5CVR A;  3C18 A;  3ZMD A;  3F72 A;  4AIJ A;  3KEQ A;  1C0W A;  2DQR A;  2G7H A;  4HF1 A;  3DV8 A;  3F6V A;  4KT5 C;  3ZPL A;  1HKS A;  4WF2 A;  1IZ1 A;  2K27 A;  4KUM A;  1R7J A;  5LHI A;  4CDG A;  3CUO A;  4D0P A;  2PN6 A;  3TOA A;  2A07 F;  3E6D A;  4EMS A;  4RGX A;  1XDS A;  2IT0 A;  1DPU A;  3GFI A;  1R1V A;  4QWQ A;  4YG2 F;  1FZP B;  1IF1 A;  2A3S A;  3GFL A;  2AXL A;  1PUE E;  2FQ3 A;  3HRU A;  2Z9O A;  1LDK B;  4A0Z A;  1KYZ A;  1P6R A;  1B9N A;  1AOY A;  3FX3 A;  1YS6 A;  4R8H A;  2NYX A;  1EH7 A;  1BC7 C;  2TDX A;  3QAH A;  4HAM A;  1MJA A;  5J8C A;  3F3X A;  2QBY A;  3HRM A;  2WTE A;  2O03 A;  3QPH A;  4P5O A;  2XAG A;  4I09 A;  3WE3 A;  4WX9 A;  1FPQ A;  3EQL F;  1OYI A;  4Y17 A;  2QM3 A;  1ZG1 A;  4F7Z A;  4HW0 A;  3KZZ A;  4M9S A;  1W7P B;  2OAZ A;  4AD9 A;  4XBF A;  3DFG A;  4CO8 A;  5EEH A;  3V7C A;  3WTS C;  1SMT A;  3ZQ7 A;  2ELH A;  1OPC A;  2IRF G;  1BI0 A;  2Y48 A;  3RKY A;  2EFQ A;  5E8I A;  2Y75 A;  4EQQ A;  3WU0 A;  5L3G A;  2OA4 A;  1WWX A;  4Z2Y A;  3ABT A;  2K7L A;  5BPI A;  2XIG A;  4ENK A;  3NRV A;  4HBL A;  2XAH A;  1ZRF A;  1TBX A;  2XUB A;  1W7P D;  3V7R A;  3J81 Z;  1DP7 P;  5F64 A;  3ZMZ A;  3F6O A;  2HS5 A;  4PCQ A;  1XB4 A;  5HS8 A;  4OMZ A;  4Q4Z F;  3GF2 A;  1P2F A;  1PP8 F;  3JSP A;  1XGM A;  3KCC A;  1T2K A;  3HOT A;  2KIF A;  3PFI A;  2ESN A;  2FMY A;  2ISZ A;  1TNT A;  1BIB A;  5ILU A;  1ZG5 A;  1RUN A;  5H6R A;  3HOS A;  4ZH4 F;  1LDJ A;  3KP7 A;  3GWZ A;  3E3V A;  2QQA A;  5BOX A;  4HDV A;  3HSF A;  4HQE A;  1SFE A;  2FA5 A;  4GYI A;  3KET A;  2ISY A;  4ESF A;  4RB1 A;  2EV0 A;  2F5E A;  3LWF A;  3N4M A;  4MEY F;  1FLI A;  1RIO H;  1B4A A;  1YG2 A;  4IRG A;  4KN4 X;  2VE8 A;  4PGG A;  1O57 A;  3FMR A;  5D8L B;  1HXD A;  1BI1 A;  2XAF A;  2J5P A;  3J80 K;  5LHG A;  3J81 K;  4BAY A;  4HF2 A;  2V1X A;  1HSJ A;  2EB7 A;  4LK1 F;  3KP6 A;  3K0L A;  3FMQ A;  3M8F A;  4EV0 A;  6PAX A;  1SAX A;  1DDN A;  1FP1 D;  2EV5 A;  5AIP A;  3SFZ A;  2LF7 A;  3E5U A;  1HQC A;  3J80 Z;  1BC8 C;  2H6C A;  2FBK A;  2L4M A;  2UZK A;  4L9V A;  3T8R A;  4K2E A;  4LLL A;  5ERI A;  4U0W A;  4HF0 A;  4XLP F;  4XLN F;  1OYY A;  1QBJ A;  1ZH5 A;  2ZJ2 A;  4G6Q A;  2BGC A;  3WTW C;  4AVP A;  4MQV A;  5H20 A;  1W4M A;  1GXP A;  3REO A;  4OIO F;  5JHU A;  4EGZ A;  2F2E A;  1ZAO A;  4NHJ A;  2KJC A;  4ASN A;  2CSO A;  2VT3 A;  1R1U A;  3L7W A;  2ZCW A;  5DDG A;  3BY6 A;  2V79 A;  2W25 A;  4FT8 A;  3KP3 A;  3MZH A;  3IWF A;  1FYK A;  4EM2 A;  2QZ8 A;  1Z9C A;  1E17 A;  1U5T A;  5LRS A;  2Q8K A;  2PG4 A;  4EJO A;  3NEU A;  2D1V A;  1YS7 A;  3PQJ A;  4I0B A;  4BHC A;  3E5X A;  4IPA A;  3HYI A;  1O3R A;  1TNS A;  2K02 A;  1P4W A;  3GFM A;  4I2O A;  3G3Z A;  4BNC A;  5DUK A;  3RKX A;  1SD4 A;  3IKV A;  4A0X A;  1BBY A;  3LA3 A;  1SMY F;  3F8C A;  1ZGA A;  3MQ0 A;  1AWC A;  3EYI A;  4WXH A;  4CYD A;  3O6B B;  1J9I A;  1MGT A;  1LB2 A;  1ZLK A;  3WG9 A;  1SFU A;  3WTY C;  3S2W A;  4A2U A;  5L3E A;  4CHU A;  5HDG A;  1S3J A;  3W6J B;  3E6B A;  2QBY B;  4HV5 A;  1H9G A;  2YR2 A;  1R5H A;  3I71 A;  4EJU A;  4HYE A;  4GO1 A;  5HLG A;  2FNP A;  3CDH A;  2OD5 A;  1RNL A;  1W7P A;  2ACJ A;  5HLI A;  1JXS A;  5TJJ A;  1F4K A;  4LB5 A;  3DQV C;  4EM0 B;  3G73 A;  3B02 A;  3ECH A;  2PBI A;  1WI9 A;  1B9M A;  5K5Q A;  3CO6 C;  3E5Q A;  2P8T A;  2CGP A;  1X3U A;  4L0Z B;  2X4H A;  1DPR A;  1XGS A;  1G4D A;  4IVN A;  1ODD A;  3I4P A;  2ETH A;  4RB0 A;  2FBI A;  3CJN A;  3TDU C;  2RN7 A;  1V4R A;  2O61 A;  2NNY A;  3SZP A;  3C3W A;  2M87 A;  2XKO A;  3TKY A;  3RPU A;  3BPV A;  1ZGJ A;  5FLX Z;  1P92 A;  3HIF A;  2MLG A;  3DKW A;  2HYF A;  2LSO A;  4DQ2 A;  3I59 A;  3F8B A;  3I5U A;  3WE2 A;  3V8L A;  2P5L C;  5D4S A;  1ZRE A;  4R79 A;  4IHS A;  4RGS A;  2VN2 A;  2KJB A;  2P6S A;  2XV4 S;  1I27 A;  2RVC A;  2DO7 A;  3HTS B;  5JFR A;  1ZYR F;  1IRF A;  3H3U A;  1P4A A;  5CYV A;  3TGN A;  5L3C A;  1L3L A;  2UXN A;  4XSX F;  1Y0U A;  4WWC A;  2XRN A;  2R3S A;  2OBP A;  3WTU C;  2VC0 A;  3CUQ A;  2D2W A;  2CWE A;  4HV6 A;  4ZZD A;  1UB9 A;  2KIU A;  2QQB A;  5A2Q Z;  3QPT A;  1SD6 A;  1S6L A;  1H0M A;  1D8J A;  3BJ6 A;  2OZU A;  1B59 A;  1LEB A;  2PQ8 A;  2DBB A;  4EGY A;  5FO5 A;  2EFO A;  1XSD A;  3ROU A;  3TOB A;  5CJ9 A;  2KKO A;  4MGR A;  5BMZ A;  1FOK A;  2PI0 A;  2QVO A;  2HQR A;  2P6T A;  3QU6 A;  1XDU A;  2DLL A;  2LNB A;  2OQG A;  4AIH A;  1ON1 A;  2CO5 A;  3BRO A;  4WXD A;  4N0B A;  4NQW A;  4RGR A;  3HSE A;  1FWZ A;  3ZMT A;  1FYL A;  3B73 A;  4P55 A;  3LQR A;  5DD8 A;  3CLO A;  3I64 A;  1W5S A;  2XAJ A;  5FLX K;  1KA8 A;  1A04 A;  4I7H A;  4UVB A;  4RS8 A;  2E7X A;  5FD6 A;  4LG0 A;  3EET A;  1REP C;  4EJT A;  1BI3 A;  2XAS A;  4LK0 F;  1DUX C;  2FXA A;  4CIC A;  3COA C;  3M7G A;  1R23 A;  3K2Z A;  5D6F A;  4GXO A;  5LGT A;  3DXJ F;  3WGH A;  4OMY A;  2Q0O A;  4HQM A;  3MFK A;  2ZBK A;  2WC2 A;  3GX4 X;  4WCG A;  3IHU A;  4UHT A;  5K1Y A;  4LFU A;  3I54 A;  1O7L A;  1EH6 A;  1ZAR A;  1XMA A;  2YX7 A;  2VBZ A;  4IJA A;  4M74 A;  1QNT A;  1JGS A;  4M9X A;  4S04 A;  4AIK A;  3ZN0 A;  1I6X A;  4KYW A;  2VXZ A;  1JHH A;  3GFJ A;  1IN8 A;  2XVC A;  1Z7U A;  1WKM A;  1OR7 A;  1Z6R A;  5LHH A;  3IRR A;  4ZYG A;  1KU7 A;  3R4K A;  1KU9 A;  3ZP5 A;  1UHM A;  1ZN2 A;  2L02 A;  4AWX B;  3IL2 A;  3KP5 A;  3RYR A;  5E17 F;  1K7A A;  5D5X B;  3ZMV A;  4LJZ F;  4MNU A;  5IT3 A;  2NS0 A;  2GXB A;  4YFN F;  1T0F A;  2W24 A;  2A6H F;  3DEU A;  4GGG A;  3SXY A;  4LLN A;  3JAM Z;  3PQK A;  3ABU A;  1IRG A;  1ZG3 A;  1OKR A;  2A68 F;  4N9I A;  4CZZ A;  3MCZ A;  4LB6 B;  5D5V B;  1BI2 A;  1WRJ A;  2X0L A;  4BQA A;  1MJ9 A;  3OOP A;  2YX4 A;  4H0E A;  1S29 A;  2Q2E A;  4KIC A;  5DUI A;  2MH9 A;  4FHT A;  2UXX A;  1F9N A;  3T1B A;  2VON A;  2HYG D;  1FP2 A;  2MA3 A;  2GA1 A;  3F21 A;  4ZYD A;  1FYM A;  4CXF A;  2FEZ A;  2CYY A;  1GVJ A;  2G7U A;  3DPL C;  2XHK A;  1L0O C;  3K9T A;  4EVI A;  2C6Y A;  2LDU A;  1W5T A;  2GAU A;  4IF4 A;  2HFH A;  2IA2 A;  3GVA A;  1UCR A;  1SD5 A;  1MDM A;  2IPQ X;  3E6M A;  1SD7 A;  4U88 A;  4L0Y B;  5J8F A;  3BPX A;  2FSW A;  2IA1 A;  4KN7 X;  2ZME B;  4G7H F;  2K86 A;  2DI3 A;  2RDP A;  2VOD A;  4UUV A;  4A6D A;  3R0J A;  4Y13 A;  1YW7 A;  2FF4 A;  2P5V A;  4ENN A;  3KFW X;  3GW2 A;  1HW5 A;  1HKT A;  4GYG A;  2K4J A;  1IN4 A;  4Y15 A;  4M6Y A;  1LVA A;  4ETS A;  5IT9 Z;  4IHT A;  2QQ9 A;  1XMK A;  2H09 A;  2L54 A;  3HHG A;  2DU9 A;  4U7B A;  4UV9 A;  1YW8 A;  4A12 A;  2ZFW A;  2JPC A;  3GYH X;  1RUO A;  4RAZ A;  3C1D A;  1WSU A;  2IA0 A;  2G9W A;  1K6O A;  2ADU A;  1YO5 C;  3FXR A;  4M72 A;  4R1H A;  3ECO A;  5HDK A;  1IW7 F;  5DV5 A;  2XGX A;  4N9H A;  1UHW A;  1G3Y A;  1U78 A;  4PZJ A;  5H6Q A;  5D8K B;  1MJB A;  2STT A;  4XRF A;  4LD5 A;  1ZRD A;  5LRR A;  2PMH A;  2MC3 A;  1ZLJ A;  4LGW A;  1U6G A;  1JHF A;  1R5G A;  2M30 A;  3JTH A;  1FBU A;  1MKM A;  3QRF F;  4MQ9 F;  4I02 A;  2K4B A;  3E6C C;  3QP6 A;  5HVQ C;  4P9F A;  1UFM A;  1CGP A;  3SHF A;  1IXR C;  2VOP A;  1FNN A;  3MWM A;  1TW2 A;  2HGC A;  3ML6 A;  2QUF A;  2VT2 A;  3M8E A;  3FM5 A;  3RIR A;  5HS9 A;  3BJO A;  4FX4 A;  2DW4 A;  4LG0 B;  1TQP A;  2LF8 A;  5CVI A;  3RJP A;  4A5N A;  2VBY A;  3KZY A;  4G6D A;  1CF7 A;  4YIF A;  4DNC A;  1MD0 A;  1TQM A;  3FXU A;  2VBX A;  1I1G A;  3P9K A;  4HLY A;  4ZYE A;  1Z91 A;  4BYY A;  3TO7 A;  1QGP A;  1EH8 A;  4BH9 A;  2DK8 A;  2ZXJ A;  5CVJ A;  3QP5 A;  1YIO A;  5A2Q K;  3L00 A;  2GIV A;  2XAQ A;  2H94 A;  1V3F A;  5F1R A;  2NAZ A;  1B6A A;  1K78 B;  3MAJ A;  4YFK F;  3IWZ A;  1BIA A;  3LAJ A;  1IXS B;  3F8F A;  4BXU A;  4U0Y A;  4XSZ F;  5AON A;  5CVV A;  3L09 A;  2LKP A;  2BEO A;  2HDC A;  3U9G A;  3BWG A;  1J75 A;  4I01 A;  4GCV A;  1G3S A;  5F6F A;  1ZRC A;  2RNJ A;  4KMF A;  1FSH A;  5D4R A;  1XN7 A;  1TTY A;  5D5W B;  3WTX C;  4L5J A;  4BHB A;  3LA2 A;  1J5Y A;  3GO5 A;  2HKX A;  5E1Z B;  2HKO A;  5ILS A;  1FY7 A;  2RGV A;  2EWN A;  3GLX A;  2KRF A;  4KA4 A;  2FRH A;  5LLQ A;  5DEQ A;  4M73 A;  3KLN A;  5ED4 A;  1J59 A;  2HWV A;  4KDP A;  3FWE A;  5CVU A;  5E8G A;  1YLF A;  1YTY A;  3VOD A;  3AAF A;  1K79 A;  1T38 A;  3BZ6 A;  1VTN C;  4RGU A;  3R60 A;  3K69 A;  3JAM K;  3HHH A;  4UNO A;  3E97 A;  2ZNY A;  4QLC U;  1MDM B;  2FOK A;  4HA8 A;  2L01 A;  3JW4 A;  1HW1 A;  4B09 A;  1HST A;  2DPD A;  4ON0 A;  3L2C A;  1RI7 A;  3R0A A;  1SFX A;  4U7D A;  1YQA A;  1WQ2 A;  3D5L A;  2HZT A;  2ZME A;  2XRO A;  1BN5 A;  5HDN A;  1QQI A;  5BS6 A;  2BV6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...