1HKSA

Solution structure of the dna-binding domain of drosophila heat shock transcription factor
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
106
structure length
106
Chain Sequence
GSGVPAFLAKLWRLVDDADTNRLICWTKDGQSFVIQNQAQFAKELLPLNYKHNNMASFIRQLNMYGFHKITSIDNGGLRFDRDEIEFSHPFFKRNSPFLLDQIKRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the DNA-binding domain of Drosophila heat shock transcription factor.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription regulation
molecule keywords HEAT-SHOCK TRANSCRIPTION FACTOR
total genus 11
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1994-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00447 HSF_DNA-bind HSF-type DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1hksA00
2BYVE 2FNPA 3HYIA 3L09A 3WODF 1QZZA 1EH6A 4A2UA 3DF8A 3QU6A 1HKTA 1FNNA 5HLIA 5E17F 5F6FA 2L01A 3FF5A 2FMYA 1J9IA 1QGPA 1UCRA 1DUXC 3LAJA 3P9KA 3NQOA 1GXPA 2BE5F 4HZFA 2L02A 3BY6A 5K5RA 5DYMA 5H6QA 4WF2A 5AIQA 2P7VB 1ONVA 4P96A 3RI4A 3KZZA 4XRFA 3WTSC 2NNYA 2HYGD 5HDGA 2PN6A 1R22A 2ISZA 2BGCA 1T38A 1OR7A 2QENA 3AAFA 4PDKA 2DBBA 3E6DA 4HLYA 1Z6TA 2X4HA 1G3SA 1XMKA 3F6VA 2HZTA 5ILSA 4NB5A 5LBQA 3ROUA 3T5XA 1MJ9A 4KMFA 1LEBA 1F5TA 2FEZA 3CO6C 1HQCA 3T1BA 4GYIA 1B4AA 3WE2A 2Z33A 1Q1HA 4RS8A 3HSFA 3K69A 5FO5A 1XGNA 1TQMA 2GZWA 4ZYHA 2GXBA 1MZBA 3GXOA 1LB2A 1W5SA 2QQ9A 5ICCA 4GXOA 2JPCA 3EETA 3WG9A 2K4BA 2COMA 2LNBA 5A2QK 5HLGA 2NNNA 5J8FA 2VXZA 3J81K 3CO7C 2TDXA 1G3WA 4XSXF 3ISPA 1T98A 1S6LA 2AXLA 1TNTA 1YLFA 1S3JA 3R60A 2BEOA 1YG2A 2KIUA 3RIRA 2UWMA 3VEPA 1XDUA 5TJJA 3KETA 4G6QA 3FMQA 1C0WA 5CVVA 5L3CA 2NRAC 2HOEA 5FD6A 2O61A 2O6GE 3ZPLA 3FMSA 3GX4X 3KZYA 4Y15A 4M9ZA 2Q2EA 4F7ZA 4JBAA 4RAZA 3I4PA 5JHUA 3O3KA 2JTVA 1KQ9A 1XGMA 5A2QZ 2R3SA 3K2ZA 2DQLA 2ZJ2A 4KDPA 5LEKA 3OV8A 5FLXK 4D0PA 2F5EA 2MD5A 3G73A 3BJOA 2NAZA 1FYKA 1EH8A 3HHGA 2MLGA 2K02A 3ZN0A 2FF4A 3V8JA 4OMZA 4ON0A 3LWFA 4GGGA 1FP1D 3HSEA 1XGOA 2J5PA 3HRUA 4EV0A 3WTYC 3VB2A 2DI3A 2W57A 4BNCA 4E70A 2IVMA 3LA2A 4RGUA 3HUGA 2OBPA 4BYYA 1CF7B 2GAUA 4HQMA 4O6JA 5FGMA 5DCFA 1IN4A 1XN7A 4YIIA 4M6XA 4DQ2A 4G8XA 1BI2A 2HS5A 2VC0A 5D5VB 4QLCU 4G94A 1XCBA 2OQRA 1QBJA 1FY7A 1AWCA 4ZYDA 1YW9A 3U1DA 2AS5F 3QU3A 1T6SA 4BH9A 5CVRA 1Z05A 1H9TA 3T0YA 1B9NA 4HV6A 3P7NA 3R6SA 4HF2A 2CWEA 4LLNA 1FX7A 3W6JB 2P7CB 1BI0A 4IRIA 2KIFA 2IPQX 4GCVA 3IKTA 2OA4A 1SFEA 3I53A 1YS7A 3F23A 3TDZC 2KIMA 4ZZLA 1D8KA 3P9IA 3GVAA 3LQRA 2EFOA 3FZVA 1UHWA 2HKOA 3T8TA 1STZA 4KA4A 3IWFA 3HTUA 4WK8F 2HKXA 3QAHA 5CYVA 4HW0A 3TQNA 1WWXA 2P5VA 3R61A 3RDIA 5DCMB 1J0RA 1YQAA 3K9TA 3EUHA 3PFIA 5HS9A 2XKPA 5D5UB 3ULQB 4MEYF 2IW5A 3I59A 2XAJA 3K0LA 2M30A 2XASA 2CO5A 2DO7A 3GWZA 4LGWA 4U7BA 1JHHA 5D4RA 1WRJA 4G9YA 5ED4A 3E3VA 1EV7A 2PJPA 1GVJA 3COAC 3ZP5A 1QQIA 1K78A 1UHMA 2ACJA 1TQIA 5JFRA 2MC3A 4UXNA 4S04A 2QVOA 3GLXA 3TOBA 1SMTA 4OIPF 4FT8A 5EEHA 1BOAA 4KIBA 1U8RA 3HRTA 3E6CC 1R1VA 1SD5A 3MCZA 1P2FA 2M45A 2W25A 3F6OA 1B1BA 4WWCA 2IA0A 3ZMUA 2IP2A 1HW2A 4PZJA 1LDKB 2YU3A 4GYGA 4A0YA 2JRTA 1W7PB 3O6BB 2DU9A 2H6BA 3ECHA 4G7ZF 2ZXJA 6PAXA 2CFXA 3U2RA 4WXCA 5HS8A 2DFIA 4XSZF 2H27A 3V4GA 5IT9K 1ZH5A 3F8BA 3DKWA 2CQKA 1K6OA 3FM5A 3K1MA 1O3QA 2IJLA 3E6MA 2QLZA 4Q4ZF 2IRFG 1S29A 2HFHA 1GXQA 2EV6A 3E5QA 4ESJA 1HSJA 2EJRA 4P55A 5BMZA 3Q9VA 1IW7F 5F64A 1S7AA 5AIPA 4FX0A 2IA2A 5HVQC 2MA3A 2ISYA 3U9GA 1B59A 1XSXA 1USTA 1CF7A 5LRSA 4CXFA 5CLSA 2BBYA 2EFQA 3IRRA 1J59A 1IN7A 4MTDA 1FSEA 2MH2A 2BV6A 1K7AA 1D3YA 1REPC 4HF1A 4I7HA 3CUQA 4MQVA 3SZPA 2Z3YA 1F4KA 3WGHA 3L7WA 5BS6A 3CJNA 4AD9A 3M7GA 3WGGA 3GEZA 3KP6A 2O03A 2FOKA 3LAPA 5E18F 2VBZA 3I5UA 2DK5A 3S2WA 2GA1A 4M6YA 2P6SA 1P4WA 4JQFA 4OIQF 4P9FA 1O3RA 4EQQA 2XHKA 1R23A 3TOAA 3CUQC 1FPQA 1XSDA 1ZGJA 2ZNYA 4EJVA 1U78A 2EK5A 4EJUA 3DEUA 1DPRA 1XSVA 4YFKF 2A6HF 2FXAA 2XKOA 1L0OC 2MBFA 1TW2A 4RGRA 3F72A 3NRVA 2M87A 1XD7A 1FWZA 5L3FA 1SAXA 3BOQA 1RUOA 2VT2A 2E1CA 3W6KB 5BPDA 2O8XA 4LJZF 3GZ5A 1BC8C 3D5LA 2RN7A 3E6BA 4OIRF 3HTSB 2OU2A 4L5IA 2EV5A 4L9VA 1FLIA 3N4MA 3ELKA 4L5JA 4MEXF 1ZGAA 1P4AA 2XV4S 4OMYA 5CVIA 3IL2A 1A04A 1U5TB 2P5LC 3H3UA 1IUYA 4HF0A 1J75A 2VE9A 4HX8A 2A68F 1XB4A 2KRFA 3BPXA 1D5VA 3BPVA 4RGXA 3KP7A 1XCVA 4G7OF 1J7KA 3GFIA 5LHHA 3QPHA 1O7LA 4KN4X 2D2WA 4IRHA 1V4RA 1QNTA 4LLGF 4M73A 5L3DA 3L2CA 1SD7A 2LF7A 1Z7UA 1G6NA 4IHSA 4ENJA 1QO0D 1TNSA 3CDHA 3DPLC 4HQEA 1G3TA 3K1NA 1USSA 2K4JA 4Y17A 4A6EA 4XLNF 2VC1A 4UVCA 1IZ1A 1ZN2A 3F8MA 2YR2A 3RKYA 1XGSA 5ERIA 4YFNF 3REOA 2DK8A 3LA7A 1YW8A 4U0WA 2WTEA 1IAWA 2W85A 1IRFA 2EFPA 4ZYGA 1OMIA 4O3MA 4G7HF 3ML6A 4EM2A 1FBUA 3MAJA 4DNCA 5KK1A 3F8NA 2FA5A 4MTEA 4YFXF 1PP7U 3EYIA 1LVAA 2Y48A 2FSWA 4UV8A 4AWXB 2D1VA 3BROA 3RYPA 4KYWA 1F9NA 1T2KA 3GFJA 3D0SA 3M8EA 3RYRA 1PP8F 3ZQ7A 4CYDA 1PUEE 3HOSA 4OU0A 3SZTA 1AOYA 2HQNA 5FB2A 3FHZA 1KGSA 5E1ZB 2QUFA 2VODA 1P4XA 3FXRA 2DPDA 5LRRA 4A5MA 4M9XA 4RAYA 1I1SA 1IXCA 3E97A 3JSOA 1BI1A 2KJBA 5FFXA 3MQ0A 1PDNC 1G3YA 4MQ9F 1LQ1A 2EB7A 3KP5A 4XBFA 3J80Z 2XROA 2ZNZA 5D5WB 5LLQA 5E1XA 2Z9OA 3I64A 4U88A 3QRFF 1YIOA 2X0LA 4HA8A 1I1GA 1FP2A 3O2PE 1T39A 3WU1B 3ABUA 1BC7C 3HRSA 4Q48A 5DD4A 1IN5A 5K5QA 3PQJA 2VBXA 1UFMA 1KQ8A 2H09A 2A6EF 3BP8A 2RGVA 2VT3A 5D4SA 3BZ6A 2WV0A 4TV7A 3VOEA 4QWQA 4YG2F 2FMLA 5J8CA 3R0AA 4U0VA 1JGSA 2V6CA 1R5GA 3IHUA 3HHHA 2ZMEB 1XDSA 4AIKA 4U0YA 3QP5A 2C6YA 5ILUA 4ESFA 2LDUA 4RB1A 4A5NA 5HOOA 4N0BA 4ESBA 1ZG5A 4UVAA 4BHCA 5DEQA 4KN7X 1RUNA 1B6AA 2ZMEA 2L54A 5HS7A 1QPMA 1DDNA 2R7FA 1IXRC 3R4KA 2K86A 4EJWA 3TGNA 2Z99A 3JAMZ 4A6DA 4I98B 2EA4A 1Y0UA 2V9VA 2PFBA 1ZHFA 4HOBA 2UXXA 2JPBA 4FHTA 5DCMA 4KNYA 1KQ0A 1BN5A 4BQAA 1QZYA 2Z5UA 2E1NA 1DP7P 3F3XA 1SFXA 1JXSA 2RV8A 5JR3A 3E5XA 2G9WA 3Q5FA 2XAFA 3J81Z 2UXNA 2ESHA 5D8LB 1G4DA 3C3WA 2KJCA 2RC4A 5IT9Z 2DLLA 2OAZA 1BIBA 3IKVA 1S7OA 5DV5A 1E17A 2GIVA 3V7RA 5LHIA 1W5TA 3LFKA 4R8HA 4ENMA 2EFNA 2CW0F 2IA1A 2GXGA 1MJAA 2PBIA 3I71A 3LA3A 5E8GA 5L3EA 1XMAA 1OKRA 3M8FA 4AVPA 3P9CA 3CTAA 2L3DA 2EV0A 2L4AA 2O0YA 2OZUA 1LEAA 1I6XA 1RZ4A 3BWGA 2GA2A 1ZRCA 3TO6A 3F21A 1LNWA 3K1PA 1YO5C 4EMSA 3B73A 1FBQA 1KU3A 2MH9A 2XRNA 2RNJA 1KYWA 5JI6A 3KFWX 1Z6RA 3RKWA 1R1TA 1OYIA 2ZFWA 3KEOA 3VFZA 1P92A 2E7WA 4HLXA 3GF2A 1BI3A 5E8IA 2GWRA 5ICFA 3V7CA 2FU4A 4MNUA 1RI7A 3KEQA 2VOOA 2P6TA 1ON2A 1ZRDA 1ULYA 2STTA 1O7FA 4IVNA 1J2XA 2PG4A 4UVBA 2F5DA 2QYOA 3IWZA 1IN6A 2VBYA 4LB5A 2M8EA 1FT9A 3C7JA 3H3ZA 1FC3A 1YW7A 1R7JA 2F5CA 2PQ8A 5CVJA 4IRGA 4HX7A 1ZARA 4ASNA 3T8RA 3RJPA 3GW2A 5KVRA 4K2EA 4A0ZA 2QBYB 1TQPA 4KIFA 1KA8A 2HEOA 1ZAOA 4A12A 1FSHA 3RKXA 2QM3A 2HDCA 2QZ8A 2R7DA 3DP7A 3FXUA 4LK0F 2DQRA 4PGGA 1E2XA 3E5UA 5LHGA 5DUKA 2A61A 2OD5A 1U2WA 2LSOA 1FBSA 2Q8KA 3JW4A 1R1UA 2LKPA 1TLHB 2EFWA 2RKHA 3JTGA 4PGHA 1JE8A 1ON1A 5ILVA 3N97A 3ABTA 4ENKA 2OZ6A 1HKQA 3I59B 4ZYEA 3MEXA 1W7PA 1R36A 2FE3A 1HW5A 1MDMB 4L18B 2KKOA 2V1DA 4Z2YA 1ZLJA 2P5KA 3KCCA 5D8KB 1EH7A 1U3EM 3FM3A 2QQAA 4O5VA 4BHPA 2IT0A 4IF4A 1WKMA 1TBXA 5CVUA 3B02A 4HX4A 1MDMA 4UV9A 4KICA 1OYYA 1Z9CA 3HOTA 2HWVA 1IN8A 5L3BA 3C1DA 1WSUA 1R00A 2A07F 4IJAA 3FX3A 3GFMA 1LDDA 2RVCA 1X3UA 3WTXC 1H9GA 4CDGA 2DT5A 3BJ6A 3BJAA 4B8XA 4R79A 1Z91A 3KLOA 3PQKA 3RPUA 4BHBA 3GFLA 3JSPA 2A5YB 2VBWA 3L9FA 4LMYA 2PEXA 4M72A 5DDGA 1D8JA 1OYWA 4LFUA 5D6EA 2ZBKA 1O3TA 3M9AA 4HDUA 1HKSA 2A3SA 3SXYA 4IPAA 5ICGA 3F8CA 3GZ6A 4Q5SF 2Y0MA 4KUMA 1B9MA 2H94A 4RB2C 1JHFA 4NQWA 2O3FA 3BDDA 4M71A 2PMUA 4HBLA 3QPTA 2W24A 1U6GA 3J80K 1YFHA 4L0YB 1F1ZA 3MZHA 4L0ZB 1ODDA 1OPCA 3MWMA 4I01A 1H0MA 2YX4A 3KP2A 2FNAA 3ZMDA 2GQQA 1TW3A 3WTZA 4JK1X 5HLHA 3SQNA 3VODA 5LGTA 2EA2A 5F1RA 5D5XB 2HTJA 3TDUC 2F5FA 1BJAA 3WTWC 4M9SA 2QBYA 2B0LA 2XAQA 2W84A 3IRQA 1BBYA 4KFCA 3MFKA 3ERED 4KMUX 4EM0B 4WXDA 3Q9SA 3F22A 2HYFA 3WTVC 2D45A 2H6CA 4RB0A 1DPUA 1ZG1A 1ZRFA 3HSRA 4HDVA 4ETSA 2XGXA 3RPQA 3QP6A 2ESNA 5H20A 1WQ2A 4L9TA 3H92A 1MD0A 3I0TA 1MGTA 4PCQA 1HW1A 3TO9A 5LEJA 2WC2A 1CGPA 1J5YA 1KYZA 1Z1DA 3CUQB 4HV5A 2XIGA 1LJ9A 3L00A 5ICEA 3LSTA 3WE3A 4EJTA 2XVCA 4LB6B 2DPUA 1ZG3A 2WWYA 4WXHA 4LLLA 1HBXG 2ETHA 5K1YA 2V79A 1W7PD 2V1XA 2A69F 2ELHA 1HSTA 5FFZA 3WGIA 4OINF 4A0XA 3EYYA 3I58A 5LGNA 1FZPB 3KLNA 4OOIA 1SD6A 4I0AA 4EM1A 1IXSB 5BQTA 5FLXZ 3FXQA 5EEGA 1IF1A 2M5WA 2HGCA 4EGZA 2ZCWA 1YS6A 3GO5A 3ZMVA 1VTNC 3I54A 3SFZA 5BOXA 2PLYA 3V8LA 4KIGA 4R1HA 1SD4A 1YTYA 4RGSA 4P5OA 4G6DA 4ENNA 2DTRA 4NHJA 1U5TC 3DXJF 2XUBA 3FWEA 2FBKA 2G7UA 3V8KA 3CLOA 5E1WA 1R58A 4LG0A 4UNOA 2VONA 4MHGA 4OIOF 5D6FA 1V3FA 2ZO4A 1WI9A 1YYVA 4I09A 1U5TA 3EQLF 2VOPA 4CO8A 3ZMZA 2HR3A 4B09A 1KU2A 2V1UA 3NEUA 4LG0B 4CHUA 1MJBA 2L4MA 5FD5A 1MKMA 3J7AO 1ZYRF 3JAMK 3RTRA 2MLKA 2G7HA 1TTYA 3JTHA 1K78B 1FYLA 4N9IA 1K79A 5IT3A 2CGPA 3TKYA 3CUOA 2FBHA 4Y13A 2VN2A 2FQ3A 3ZN1A 5TRDA 2E7XA 3G3ZA 4AIHA 1FYMA 2OQGA 1IRGA 4KT5C 4ZZDA 2P4WA 3DFGA 3OOPA 2DW4A 4EJOA 1L3LA 2EWNA 3V7SA 1W4MA 4I02A 1T0FA 2Y75A 1O57A 1GHCA 3ZMSA 4HAMA 4CGZA 1I5ZA 3DQVC 5J6XA 5BPIA 4L9JA 3KE2A 4UHTA 5CJ9A 2YSRA 2M1BA 3ZMTA 2RDPA 3HIFA 1S8NA 2QWWA 2ADUA 2CYYA 4IXAA 2JZYA 1KU7A 2RQPA 2STWA 3C18A 5DUIA 1ZREA 3WTTC 2JT1A 3MZYA 4RB3C 3FMRA 2HTSA 3TO7A 2YPRA 2YX7A 1HXDA 4L9NA 4XLPF 3M1EA 3F8FA 1P6RA 3WU0A 3DPTA 3R0JA 3DV8A 4Q47A 1SFUA 1UB9A 4AIJA 5AONA 3WTUC 4H0EA 4N9HA 3LQQA 4S05A 2QQBA 2XAHA 4LK1F 2ZKZA 1ZLKA 3SHFA 2FBIA 5E20A 4CICA 3QOPA 1LDJA 4UUVA 2NS0A 4BXUA 4YIFA 2NYXA 5L3GA 2CSOA 3IC7A 5LGUA 2XAGA 5JVTA 4WCGA 4ZH4F 4WX9A 4EGYA 1SMYF 4P9UA 2JSCA 3HRMA 2PMHA 3EDPA 1BM9A 1RNLA 2F2EA 4GO1A 4I0BA 1BIAA 1O3SA 3KP3A 5DD8A 4CZZA 5H6RA 2P8TA 4EVIA 4M74A 2FRHA 5HDKA 2J5OA 3KP4A 1R5HA 4HYEA 2LF8A 5K5OA 4U7DA 1RIOH 3GYHX 1KU9A 4MGRA 4IHTA 2PI0A 4I2OA 4LD5A 2UZKA 2HQRA 4FX4A 3GUDA 2Q0OA 2D1HA 3ECOA 1I27A 1NHAA 2CG4A 2K27A 4BAYA 2VE8A 1FOKA 2DAOA 5HDNA 2K7LA
chains in the Genus database with same CATH superfamily
2GOXB 2IGMA 1A5JA 1IV8A 2X6YA 2JVHA 2BYVE 2FNPA 3HYIA 1POGA 5GAHJ 3L09A 4ZJZA 3JRDA 3WODF 4BQNA 1QZZA 5FRNA 3QYEA 2EH3A 1EH6A 1NK2P 1K83J 4A2UA 3KYLA 3DBRB 1BOBA 3DF8A 3QU6A 4XN0A 3OS0A 1HKTA 1FNNA 5JVGF 5HLIA 2EQRA 5E17F 2LY1A 2QA4I 2X1CA 3JRAA 4X1EA 5F6FA 2L01A 3ERMA 3FF5A 1QRYA 1IO2A 2EIMH 4BXXJ 2FMYA 1J9IA 1ETVA 3GBGA 1QGPA 1UCRA 1DUXC 3LAJA 3HC7A 3P9KA 5EJCA 2M0MA 3HXLA 3NQOA 4I76A 3CESA 1WJ5A 5J3LA 2F4OB 1GXPA 2BE5F 2HDDA 1V5FA 3BTCA 5B5EC 1FTTA 4ZDOA 1SAUA 3IH3A 4HZFA 4CCKA 2L02A 3BY6A 5K5RA 5DYMA 4P1WA 5H6QA 4QTRA 3FK6A 2VIXA 2OTJI 2UUZA 4WF2A 2CRGA 5AIQA 1N25A 3OIQA 3SDBA 3U21A 2P7VB 3K4NA 1ONVA 4MFDA 4P96A 3S1RJ 3RI4A 1V5GA 1ETQA 3KZZA 4XRFA 1B72B 3L2VA 5TGTA 2FJ1A 3WTSC 2NNYA 4XORA 2HYGD 3QWLA 5HDGA 3DTKA 2PN6A 5B3SH 1R22A 1MBJA 3GTGJ 2R7RA 5GAGJ 2ISZA 2X1DA 2BGCA 1RKTA 1T38A 2X85A 5FJ8J 2GBYA 1OR7A 2LREA 2QENA 3AAFA 4IZZA 3QYBA 4PDKA 4JX4A 2DBBA 3E6DA 5K7ZA 4YELA 4HLYA 3FXMA 2DCEA 3BR2A 1E3HA 1Z6TA 2X4HA 1G3SA 1XMKA 3F6VA 1HDPA 2HZTA 5ILSA 5F1JA 2LR8A 2KZGA 4NB5A 2CV0A 3S2HJ 1SFKA 2JSPA 4B3AA 1T95A 5LBQA 3ROUA 4BGDA 1TT5B 3T5XA 1V5EA 1I50J 1MJ9A 4KMFA 1LEBA 1F5TA 2FEZA 3CO6C 1HQCA 3ABLH 3T1BA 4GYIA 1B4AA 4JOMA 3WE2A 5JHFA 5C44J 2Z33A 4XIDA 2DDBA 4XNFA 1U8BA 1Q1HA 4RS8A 2K9SA 3KIOA 3HSFA 3K69A 3PIOF 5FO5A 1XGNA 1TQMA 2GZWA 4HSTA 4UB6C 3G2BA 4ZYHA 3TP3A 2V9KA 2GXBA 1MZBA 3GXOA 1LB2A 4G6TB 2MFZA 1W5SA 2QQ9A 4FCYA 5ICCA 2FOWA 1F36A 4GXOA 2JPCA 3EETA 3WG9A 2K4BA 3VSKA 2COMA 2LNBA 5A2QK 3CLQA 1JKPC 4KJZA 4D5CA 5HLGA 2NNNA 5J8FA 2CQQA 2VXZA 3J81K 2I10A 3CO7C 2TDXA 1G3WA 1GV2A 3ISPA 4XSXF 1T98A 1S6LA 2AXLA 2M9HA 1UHSA 1TNTA 2CQ7A 1QHGA 4IQJA 4QPQA 1YLFA 1S3JA 4A3FJ 2KPMA 3CDIA 2X6OA 3DCFA 3H35A 2L7FP 2EILH 3R60A 2BEOA 1YG2A 1SVMA 2KIUA 3RIRA 2UWMA 4BQOA 3MVPA 1XDUA 5B1BH 2XPUA 2BY1A 5TJJA 3VEPA 4NC7A 3KETA 2VJJA 5EG0B 5IYCJ 3LSIA 4G6QA 4BE2A 2R4GA 2JA7J 1TWAJ 3BQZA 3FMQA 1C0WA 5CVVA 3V42A 4W97A 5L3CA 2NRAC 2XF7A 5E79C 2HOEA 5FD6A 2K9QA 2O61A 3A0BC 4N4OB 2AXTC 2XB5A 2O6GE 3W2AA 2OCCH 3ZPLA 3FMSA 3GX4X 3KZYA 4G12A 4HPQA 3H1CA 4Y15A 4M9ZA 2Q2EA 1NG7A 3J7YJ 4F7ZA 2M34A 3A2KA 3E7LA 3OYKA 4JBAA 4RAZA 3C2HA 2QCOA 2XB0X 1WH7A 3I4PA 5JHUA 1OQYA 4RA2A 3MKWB 3DLLF 3CJQB 3O3KA 2JTVA 5F0CA 1KQ9A 1XGMA 2E1OA 5A2QZ 2DA2A 2L5QA 1Q1VA 2G0EA 2R3SA 3LSGA 3K2ZA 2DT7B 3HB9A 2DQLA 2ZJ2A 4KDPA 5LEKA 3OIPA 3OV8A 3A01A 5FLXK 1XX5A 3HOXJ 4M3FA 2ID6A 3FXKA 4D0PA 1ENHA 2F5EA 2MD5A 2WAQN 3RQIA 4HG2A 3G73A 3BJOA 2NAZA 1FYKA 1EH8A 3HHGA 4E6KG 2JUGA 2K02A 2MLGA 4A3EJ 3ZN0A 3A0HC 1YRNA 2FF4A 3V8JA 3OR1C 4AIDA 4BKXA 4KISA 4OMZA 4ON0A 3LWFA 1EA3A 2L2OA 4GGGA 4B4CA 2V7FA 4XOPA 1FP1D 3CJRB 1FEXA 3HSEA 1N78A 1XGOA 3JRHA 4A3LJ 2J5PA 3HRUA 5E3LA 4EV0A 3OYBA 3WTYC 1S7EA 3FK7A 3VB2A 2DMUA 1JUMA 3PFYA 2DI3A 2D5VA 2W57A 2X51A 2KDZA 4BNCA 4E70A 4PUSA 3CCEI 1VQMI 2IVMA 2LK2A 1VZ0A 3LA2A 4RGUA 3HUGA 1IGNA 2OBPA 4BYYA 1CF7B 4ANJA 2GAUA 4HQMA 2LD5A 4O6JA 4IX7A 1IV6A 3UKGA 5FGMA 5DCFA 1IN4A 1XN7A 2IXSA 4YIIA 4EATA 2R7UA 4M6XA 3FBNB 2H8RA 4AM3A 1LVKA 4DQ2A 4DYQA 4XKCA 1GT0C 4G8XA 1N75A 1U0JA 1BI2A 1SANA 2HS5A 3PSIA 2VC0A 4FE7A 5D5VB 4QLCU 4G94A 2VXDA 1XCBA 2OQRA 1QBJA 1K61A 3L2QA 1FY7A 1QA6A 2XAUA 1AWCA 4ZYDA 1YW9A 3U1DA 2AS5F 3QU3A 1T6SA 2CW7A 4HNUA 4BH9A 3D1NI 1JJ6C 5CVRA 1NK3P 1Z05A 2E2JJ 1OR7C 2XPVA 3K6GA 1H9TA 3CQZJ 3K4KA 5K7HA 2VKEA 2MG4A 3QPSA 3T0YA 1B9NA 4HV6A 1KZHA 4CCNA 2H1LA 3P7NA 3R6SA 4HF2A 2CWEA 2WBMA 4LLNA 2JUCA 1FX7A 1MIJA 3W6JB 2P7CB 5HNHA 1VQKI 4A3CJ 1BI0A 1Z77A 1ZK8A 3IUOA 4IRIA 2DA3A 1TP4A 2KIFA 2IPQX 4GCVA 3IKTA 2OA4A 2KMUA 1SFEA 5CQGA 2JA2A 3I53A 1YS7A 2VI6A 3F23A 3TDZC 2KIMA 3IH4A 1WZ2A 4ZZLA 1D8KA 3P9IA 3GVAA 3LQRA 2M7AA 5KHDA 2EFOA 4DGWB 3FZVA 4NUBA 1UHWA 2HKOA 3T8TA 2FQ4A 1STZA 4KA4A 1BL0A 1D0ZA 3IWFA 2X6WA 1VQLI 3HTUA 2LFBA 1BR1A 4BDYA 5M3FJ 3AFHA 4WK8F 2VLAA 2DYRH 2MC4A 2L7KA 2HKXA 3QAHA 1RR7A 5CYVA 3K10A 4HW0A 3TQNA 1WWXA 1Z3YA 1A31A 2P5VA 3S1NJ 3BG5A 3R61A 3RDIA 5DCMB 1J0RA 3NWSA 1YQAA 3K9TA 2R7ZJ 3EUHA 3PFIA 5HS9A 2DMTA 5JLWA 1HDDC 2XKPA 2GLOA 1S72I 1TT0A 1Z3XA 5D5UB 1ETKA 5C4XJ 3ULQB 2K5CA 4MEYF 4M3DA 2LOOA 2JQ7A 2IW5A 3I59A 3W3CA 4FASD 1DU6A 3BG3A 3TBIA 5DM7F 2KISA 2X1EA 2LBFA 2XAJA 3K0LA 5B1AH 1VQ5I 3ZQIA 2E5NA 2M30A 4OWRB 2XASA 2CO5A 3H5RA 3QYFA 2DO7A 2ZXHA 3OYMA 3S17J 3GWZA 2IS4A 1ETOA 4LGWA 3OYFA 4U7BA 1JHHA 5D4RA 2FD5A 1WRJA 4G9YA 5ED4A 3BG9A 3E3VA 4JP0A 1EV7A 2NVTJ 2PJPA 5IP7J 1GVJA 1Y0NA 3COAC 2Y0SN 3JR9A 4IQ4A 4C3HJ 3ZP5A 1QQIA 2DOEA 1OCZH 1Y6IA 2OC6A 1WH5A 4OAYA 1VQ9I 4UUTA 1K78A 2BHYA 2BVLA 2JN6A 2KDOA 1UHMA 2KFDA 4II3A 2ACJA 1TQIA 5JFRA 2MC3A 4D9JA 2BW3A 1P9QC 2Q2EB 3OYJA 3AG4H 3D5RC 4UXNA 5GPAA 4S04A 3CJTB 2QVOA 3GLXA 4NNJA 3TOBA 3ZRGA 1SMTA 4OIPF 4FT8A 5EEHA 5HLTA 1BOAA 4KIBA 1U8RA 1UAAA 1FJLA 3HRTA 3DTIA 3E6CC 4AYBA 1DGRM 1R1VA 4BS9A 2IBDA 2DA7A 1WPKA 1SD5A 1VQ7I 4XOTA 4UUSA 2MABA 3NAUA 5E3MA 2HVRA 3M3YJ 4F91B 3FISA 3MCZA 1VFCA 1P2FA 2M45A 4BU2A 2W25A 2AQFA 4CCJA 3F6OA 1B1BA 4WWCA 2IA0A 3ZMUA 2IP2A 1HW2A 1YE9A 4PZJA 2OTLI 1LDKB 2YU3A 4RLFA 4GYGA 4A0YA 1T56A 1X3ZB 2QSFX 1P7JA 2JRTA 4V19K 5KCMA 4E7IA 1W7PB 3O6BB 2DU9A 2HVQA 2H6BA 1K6YA 2E34A 3ECHA 4G7ZF 2ZXJA 2M3AA 2R5YB 2W7NA 6PAXA 2CFXA 1UJ8A 3U2RA 2YUSA 4CCLA 3CCSI 3HKZN 4WXCA 5HS8A 3VPRA 2HOTA 2XF6A 2DFIA 1OLTA 4XSZF 2MSYA 1VQ8I 2H27A 3V4GA 5GPCA 2ICWG 1YI2I 5IT9K 1ZH5A 3JRFA 1JT0A 1VI0A 3KEYA 3F8BA 3DKWA 5EGOA 2W1OA 2R7SA 2CQKA 5TISC 1K6OA 3J7AY 3FM5A 1A35A 3K1MA 1O3QA 2IJLA 3E6MA 2QLZA 4Q4ZF 4XR6A 4CYCB 4PJJA 2LVSA 1WCMJ 3OMYA 3OYIA 2IRFG 5FROA 3H0DA 2BY3A 1S29A 4Y7NJ 4HEA2 1P7IA 2HXOA 1PVEA 1X2NA 2HFHA 1GXQA 2EV6A 3E5QA 4ESJA 1HSJA 2EJRA 4P55A 5BMZA 3Q9VA 1YX5A 3GTPJ 1IW7F 2ZSIB 3PNTA 5F64A 3L2WA 3IAS2 1Z67A 3ZQFA 4XLEA 1YX3A 2R7TA 1S7AA 3MMYB 4V2GA 2W4SA 5AIPA 5GTHC 4FX0A 3ZOBA 3LSKA 2FUG2 2E71A 4IEJA 2R5ZB 2DA6A 2IA2A 5HVQC 2MA3A 5B66C 2ISYA 3U9GA 1B59A 2HZDA 4RM2A 4BEHB 3HJEA 5FKMA 1XSXA 1TWFJ 1Y56A 4XKVA 4YRVA 4B1RA 1AKHB 4C3JJ 1WJFA 3HG9A 1USTA 2W82A 2EZKA 1CF7A 1T0FC 5LRSA 4CXFA 2VB6A 3PNYA 5CLSA 2BBYA 2EFQA 2HPMA 3IRRA 2MGQA 1J59A 1IN7A 2BZTA 4MTDA 1FSEA 2VQLA 2HPIA 2MH2A 2BV6A 3MKLA 1D3YA 1K7AA 1E3OC 1REPC 2RAEA 4HF1A 4PFOA 4UY8I 4I7HA 3CUQA 4MQVA 3SZPA 2Z3YA 4XLAA 1MH3A 3RCOA 1F4KA 3GLLA 3WGHA 2EZHA 3SZGA 3L7WA 5BS6A 1Z7LA 3CJNA 4J19A 4AD9A 2VKVA 3M7GA 2A05A 3JRCA 2CS3A 5J4YA 2NVYJ 3WGGA 3GEZA 3KP6A 3SDGA 5M3MJ 2O03A 2FOKA 2PJRB 1DQUA 2VASA 2K40A 3LAPA 1YJNI 5E18F 2VBZA 1Y8QB 5F0HA 3I5UA 2DK5A 3S2WA 3F9KA 2NS8A 2GA1A 1HCRA 4M6YA 4V2FA 1B8IA 2P6SA 4A3IJ 1P4WA 4JQFA 2KRCA 3UR3C 4OIQF 1QHHD 4P9FA 1O3RA 4EQQA 2XHKA 1R23A 2IS6A 1X58A 2L7ZA 3TOAA 2XGEA 1X19A 2V6EA 3CUQC 1FPQA 1XSDA 2RQQA 3LFUA 1ZGJA 3AG3H 2ZNYA 2RREA 4NQWB 3S14J 4EJVA 1U78A 1QVUA 2M4KA 3AL0B 2EK5A 4EJUA 3DEUA 1Y39A 1DPRA 1XSVA 2LC2A 2DJIA 1X1PA 4CCOA 4YFKF 2A6HF 2FXAA 2HNHA 3ONQA 2XKOA 1L0OC 2MBFA 4BY1J 1TW2A 4RGRA 3F72A 4C9YA 3NRVA 4RMNA 2M87A 5F08A 1XD7A 1FWZA 2CUEA 5L3FA 1SAXA 3BOQA 5EZHA 3ZXSA 1RUOA 4ZTJA 2VT2A 2HDWA 3GZNB 2B7EA 1W36C 2E1CA 2VQGA 3W6KB 2DA5A 4XL9A 1S5LC 2X6XA 2O8XA 4LJZF 2NS7A 5BPDA 3JREA 3CP2A 3GZ5A 4RM3A 1TWCJ 4XN3A 1BC8C 3LSJA 3D5LA 2RN7A 3E6BA 4OIRF 2X9DA 3WHBA 3HTSB 2CUFA 2OU2A 4NC6A 3BCBA 4L5IA 3HDDA 2VKDA 4XRSG 4DBQA 2O5RA 3K70D 3SEQA 5IOZA 3CP8A 3S15J 2EV5A 4L9VA 3AKZA 3ZQHA 2R5ZA 1FLIA 3N4MA 2JWTA 3BG7A 1MSFC 3ELKA 1BW6A 3PUBA 4L5JA 4MEXF 1ZGAA 1P4AA 2Z16A 1MBHA 2XV4S 1X1DA 4OMYA 5CVIA 3AG2H 3IL2A 1A04A 1U5TB 4I6ZA 2P5LC 3H3UA 2UV1A 1IUYA 4HNVA 2R7WA 4HF0A 4XLFA 4IOCF 2O7OA 2VE9A 4B44A 1J75A 4HX8A 2A68F 1XB4A 2KRFA 3BPXA 2CUJA 1D5VA 1NH3A 3BPVA 1IJWC 4RGXA 3KP7A 2Y30A 3O8GA 1XCVA 4G7OF 2I5UA 2XSJC 1J7KA 4C2MJ 3D5SC 3GFIA 2E2HJ 2L9SA 1HA8A 4IOAF 1JI8A 5LHHA 3TW6A 3CF5F 2QSHX 3QPHA 1O7LA 4KN4X 4UUSB 2D2WA 4F52A 1FOWA 2VQCA 4IRHA 3LSPA 1WGXA 2DMNA 2EINH 3JRGA 1PJRA 1V4RA 1QNTA 4LLGF 4M73A 5L3DA 3L2CA 1SD7A 2Y9YA 3K7AJ 4E7JA 4CUGA 2LF7A 4ZYAA 3EUHC 4MFEA 1Z7UA 1G6NA 4IHSA 4ENJA 1QO0D 1TNSA 1PYVA 3CDHA 2Y9ZA 2ZFUA 3DPLC 4DIQA 4HQEA 1G3TA 2K3FA 3ESWB 2XC7A 3K2AA 2NXNB 2CH0A 3K1NA 4IKFA 1USSA 2K4JA 2WB1N 4Y17A 4A6EA 1LPQA 4XLNF 2VC1A 4UVCA 1X4OA 1W1WE 3HM5A 1IZ1A 2JRMA 1ZN2A 3F8MA 2R7QA 2YR2A 3RKYA 4B3XA 1BR2A 4JX5A 1GV5A 1XGSA 1FOXA 5ERIA 5E3OA 3FDYA 4YFNF 3LMMA 1FMVA 4N4NB 1R49A 2KZVA 2AQEA 3REOA 5GAEJ 3ZCOA 4BEHA 2DK8A 4KITB 3LA7A 1YIJI 1VQPI 1YW8A 4U0WA 2WTEA 2JA6J 3HEFA 4XQFA 1IAWA 2W85A 1J09A 2W00A 1IRFA 2EFPA 4ZYGA 2VJ4A 1OMIA 1ZELA 1WJCA 2JA5J 4O3MA 4G7HF 3ML6A 2HQ5A 4EM2A 1FBUA 4S0HB 2NOJB 4Y3OA 4YEJA 3MAJA 1BA5A 4DNCA 5KK1A 4X0GA 2DA4A 3H9JA 1LUJB 3F8NA 5J1RA 2ECBA 2FA5A 4MTEA 4YFXF 2BXZA 2DFHA 3RQ4A 1PP7U 3EYIA 1LVAA 1JKOC 1YJ9I 2Y48A 2FSWA 4UV8A 4AWXB 1SFOJ 2D1VA 3HPHA 3HZJA 3HOVJ 3BROA 3Q0UA 2E1MB 4NDLA 3RYPA 1H8AC 3FXOA 3A1YA 1UG0A 4BE0A 4KYWA 1F9NA 1X1BA 3Q3SA 1T2KA 3GFJA 4D7NA 1B72A 3H9QA 5J47A 3D0SA 3OYEA 1XS9A 3M8EA 5CPRB 3RYRA 1PP8F 1MNEA 3ZQ7A 4CYDA 3A01B 3I55I 1PUEE 2NVXJ 3HOSA 4OU0A 1OJLA 3SZTA 4IHVA 1AOYA 1WVRA 2HQNA 5FB2A 3FHZA 1KGSA 2QUFA 1LKXA 3NWTA 5E1ZB 1P4XA 2VODA 1OCTC 1RRJA 1M1EB 3I3LA 4XKWA 3FXRA 4F3QA 2DPDA 3DBLB 5LRRA 4RAFA 3N05A 2CUZA 2M4GA 4A5MA 5DM6F 2IAIA 3DWLE 3S93A 1IDZA 1ETYA 3GTMJ 1YHQI 3EUAA 4M9XA 4RAYA 3OS2A 1I1SA 1IXCA 3E97A 4F92B 5EF6A 3JSOA 1BI1A 2KJBA 3I4MJ 1T08B 2V9PA 3BR0A 3QQAA 2XGDA 3C2BA 3OR2C 5FFXA 3MQ0A 3LOCA 1PDNC 1G3YA 4DW6A 1UELB 4FTHA 4MQ9F 1LQ1A 1H88C 2EB7A 3KP5A 2CV2A 4XBFA 3J80Z 2XROA 1RETA 2ZNZA 1RPWA 2BY0A 5D5WB 5LLQA 5E1XA 2Z9OA 3I64A 4U88A 4D5FA 3H5AA 3QRFF 1YIOA 2GXAA 2X0LA 3BZKA 3EUKL 4HA8A 1I1GA 2CQXA 4E4HA 3QODA 1FP2A 3OSFA 3O2PE 3OIOA 2K3PA 1T39A 3WU2C 2DYSH 3WU1B 3ABUA 1BC7C 3HOWJ 3K4LA 3HRSA 1V54H 4Q48A 1IN5A 5DD4A 5K5QA 3PQJA 2VBXA 1UFMA 1KQ8A 2H09A 2A6EF 3BP8A 2RGVA 4A3BJ 4NC8A 2VT3A 5DS9A 3JRBA 3GTKJ 5D4SA 3BZ6A 5JLXA 4BACA 3S3OA 2WV0A 2DOFA 3H9GA 4TV7A 3VOEA 4AYBN 4QWQA 2V4JC 4YG2F 2FMLA 3B6CA 1SVOA 5J8CA 3DEEA 3R0AA 4U0VA 2VUMJ 1MMGA 1JGSA 2V6CA 1SC7A 1R5GA 3IHUA 3S8PA 3HHHA 4A69C 2ZMEB 1XDSA 3ABMH 4U0YA 4AIKA 1EJ9A 5CQEA 3DEWA 1DU0A 1R4MB 3QP5A 2C6YA 1PUFB 4QSHA 2DN0A 1D0XA 5ILUA 1Z21A 4ESFA 2LDUA 1Y1VJ 4RB1A 5FKNA 4A5NA 5HOOA 4N0BA 2CMPA 4ESBA 1ZG5A 4UVAA 2VL8A 4BHCA 1G2HA 5DEQA 3OOUA 4KN7X 4BE1A 3HPGA 1RUNA 1B6AA 2ZMEA 2L54A 3M07A 1OFCX 2HVSA 3RSNA 3KX2A 5HS7A 3OYNA 3GMEA 1R9TJ 1JJ8C 1QPMA 1R4NB 1MSEC 4BDZA 1LFBA 4E7SA 1W36D 5IYDJ 1DDNA 2R7FA 1IXRC 3R4KA 2K86A 4EJWA 2DDAA 3TGNA 2Z99A 3JAMZ 3E1SA 4A6DA 4XMYA 2GOMA 1JT6A 4I98B 2EA4A 1Y0UA 2V9VA 3KYCB 3NARA 1I3AA 2PFBA 1RC9A 1ZHFA 4HOBA 2UXXA 2JPBA 4FHTA 2NVQJ 5DCMA 4KNYA 4BJTA 2CU7A 1KQ0A 1WJDA 1BN5A 1WI3A 4BQAA 1QZYA 2Z5UA 3CDLA 3OL4A 2E1NA 1LE8A 1DP7P 3ZQLA 3FIWA 3F3XA 1SFXA 4UB8C 1ORKA 3AL0C 1JXSA 1G59A 2RV8A 2GM4A 1Z0XA 5JR3A 3E5XA 2G9WA 3Q5FA 1VQ6I 2LG4A 2XAFA 2JK3A 3J81Z 2Z1DA 2UXNA 1RR8C 2LY9A 2OV7A 2ESHA 5GADJ 3MZ8A 5D8LB 1G4DA 3C3WA 5EEAA 1WJEA 2KJCA 3BQYA 2RC4A 3M8JA 1FMWA 5IOYA 3PNVA 5IT9Z 2OUMA 1XPXA 2WY7Q 3A03A 2DLLA 2OAZA 1BIBA 5BNGA 3BR6A 1LFUP 1QVTA 3IKVA 2F6CA 3JRIA 1S7OA 5DV5A 1E17A 3GTJJ 2GIVA 2EPFA 5F0FA 1D5YA 3V7RA 3P5JA 5EGOB 5LHIA 3W2WA 1W5TA 3LFKA 4R8HA 2BY2A 4MO7A 4LIVA 2EFNA 4ENMA 2CW0F 2LKSA 2IA1A 2GXGA 1MJAA 2PBIA 3I71A 3LA3A 5E8GA 4M3BA 3GCMA 5L3EA 3LNQA 4C2TA 1XMAA 1OKRA 5F04A 3M8FA 4AVPA 3P9CA 2ECCA 4Y52J 3CC2I 3CTAA 1OCOH 1BJZA 2L3DA 2EV0A 3HUGB 2DMPA 1S9HA 2L4AA 4D7MA 2ZXIA 2O0YA 3W6VA 2OZUA 2IGOA 1GLNA 2HQAA 1LEAA 1I6XA 2WY8Q 1RZ4A 3BWGA 1ITYA 1TWGJ 3M4OJ 2GA2A 3OY9A 1YJWI 1ZRCA 3TO6A 3F21A 1LNWA 3K1PA 1YO5C 2DT6A 4EMSA 3B73A 1FBQA 5HODA 1KU3A 3CCVI 2MH9A 1PUFA 3OYAA 2VPLA 2DMQA 2XRNA 2RNJA 2HOSA 1KYWA 5JI6A 1MNDA 1W0TA 3KFWX 4XRSA 1Z6RA 1X2MA 2IS1A 3B6AA 3RKWA 5F27A 1RESA 1R1TA 5GP9A 2E19A 1OYIA 3ZQQA 1UG2A 1IC8A 3RPUD 1HLVA 2ZFWA 3KEOA 2H8WA 3VFZA 4LG3A 1P92A 2LRDA 2HU9A 4PFPA 4BJ5C 2E7WA 3BTLA 4HLXA 4DOZA 3GF2A 2YU9J 4XLHA 3PIPF 1SEUA 1BI3A 5E8IA 4HRIA 2GWRA 3MD2A 5ICFA 3V7CA 1QPIA 2FU4A 4MNUA 3CCQI 1T8IA 2XGCA 4F93B 2QEXI 4M6VA 1UZCA 3LSRA 1RI7A 3KEQA 4DZJA 2P6TA 2VOOA 1ON2A 1X1AA 1ZRDA 4EEFG 1ULYA 2STTA 1O7FA 2PX9A 2KQRA 4IVNA 2BHZA 1J2XA 2PG4A 4UVBA 4AU7A 2F5DA 3IH2A 2QYOA 5J1UA 4L5EA 3IWZA 3VYSB 1IN6A 2VBYA 4LB5A 4ZDLA 2QKLB 2M8EA 1FT9A 3C7JA 3H3ZA 2A6TA 1WJBA 2KL4A 1FC3A 1YW7A 4E7KA 1R7JA 2F5CA 2PQ8A 2XF5A 4IRGA 5CVJA 2DJNA 3H5NA 4HX7A 2E1MC 3C2GA 3G1LA 1ZARA 4ASNA 3IP4B 2EIJH 3H36A 3T8RA 3RZDJ 2DXIA 3RJPA 1E0EA 3GW2A 2ZMEC 5KVRA 4K2EA 4A0ZA 3CMEI 2HXIA 2WAQA 2QBYB 4CH7A 1G8XA 1VQNI 2XSDC 4KT6A 1TQPA 2TCTA 4KIFA 2IS2A 1KA8A 2HEOA 1ZAOA 1ERDA 4A12A 1FSHA 3K4MA 1ETWA 3RKXA 2QM3A 2HDCA 3FKJA 2CFOA 2QZ8A 2R7DA 3DP7A 3FXUA 2ZSHB 1OCPA 4LK0F 3ASOH 3PL8A 1YOVB 4IL6C 3HGGA 2EZLA 3BR3A 5IP9J 3TL4X 4H4KC 3QOEA 4PSWA 2DQRA 3CCLI 4PGGA 1WJAA 3BLYA 3OYDA 1E2XA 3E5UA 3LSHA 5LHGA 5DUKA 2A61A 4OAZA 3VYRB 4DZPA 2OD5A 1U2WA 2LSOA 1U9OA 1FBSA 2Q8KA 2MW8A 3UNGC 3JW4A 2OPTA 1R1UA 3CMYA 2LKPA 5H2FC 4IHYA 1TLHB 1NG6A 2EFWA 2KLOA 2RKHA 3JTGA 2M0CA 4C30A 1TC3C 1QU3A 4PGHA 2XPWA 1JE8A 1ON1A 5ILVA 3N97A 3ABTA 4E7ZA 4ENKA 2OZ6A 3I56I 1HKQA 2DODA 1HF0A 3I59B 4ZYEA 4FISA 1A6IA 4LOCA 3BR5A 3MEXA 2JMWA 4GRIA 1W7PA 4ZDPA 2H1KA 5EG0A 1O4XA 2WB1A 1R36A 2FE3A 2R7XA 1HW5A 1MDMB 4L18B 2KKOA 1CQTA 2V1DA 2EZIA 4Z2YA 1Y8RB 1ZLJA 4B48A 2P5KA 3KCCA 5D8KB 1EH7A 5FRMA 2R7VA 3VSLA 1U3EM 3FM3A 3K4JA 1SVLA 2QQAA 1E3PA 4O5VA 4BHPA 2IT0A 5M5YJ 3HOUJ 4IF4A 4AC0A 1WKMA 1TBXA 5CVUA 2ELJA 3B02A 4HX4A 2W48A 3ABKH 1MDMA 3GTQJ 1I6HJ 4UV9A 4KICA 2MD0A 1OYYA 1ETXA 3LSMA 5KAIC 1Z9CA 5DTDA 2R92J 3HOTA 2HWVA 1IN8A 3PSFA 5L3BA 3C1DA 1WSUA 1R00A 3DKYA 3DU6A 2A07F 4IJAA 3FX3A 3CCJI 2LTPA 1X4PA 3ZR8X 3J7ZI 3GFMA 1LDDA 2RVCA 1X3UA 3VDXA 2CJJA 3WTXC 1H9GA 3VYUB 3CZ6A 4CDGA 3GTLJ 2DT5A 3BJ6A 3BJAA 4B8XA 3G1MA 4R79A 1Z91A 3KLOA 3H0GJ 1ZQ3P 3PQKA 1GDTA 1GVDA 2DFEA 3RPUA 4BHBA 1DGWY 1JUPA 2QQ8A 1TL8A 1YRNB 4A3GJ 3GFLA 3JSPA 2A5YB 1EF4A 2VBWA 3KZIC 3L9FA 4LMYA 2K85A 2PEXA 3K4BA 4M72A 5DDGA 3MKZA 1ZKGA 1VQ4I 3RZOJ 1D8JA 1IUFA 3E0JB 4PSXA 4XICA 1OYWA 4LFUA 2NVUB 3M1CA 4HNTA 2Y69H 5D6EA 1BR4A 2ZBKA 1O3TA 2M7BA 4RBOA 3M9AA 2K9MA 3OYCA 4HDUA 2EIKH 2NOGA 1AKHA 3DKXA 1HKSA 3O8HA 2A3SA 3SXYA 1JKQC 4IPAA 5ICGA 3F8CA 2PMZA 3GZ6A 4ZTFA 2F48A 4Q5SF 2Y0MA 4KUMA 4JYKA 2VJIA 1B9MA 2YS9A 2H94A 4RB2C 1YITI 1JHFA 4ABZA 4NQWA 4A93J 2DOAA 2O3FA 3BDDA 2KIQA 4M71A 4XM3A 2PMUA 2COBA 3LL7A 4HBLA 2Q1ZB 2L9RA 2ME0A 3QPTA 2W24A 1U6GA 3J80K 1YFHA 3BZCA 2Z2SB 4L0YB 5FKKA 3S3NA 1F1ZA 3OSGA 2F4IA 3MZHA 1X1CA 4L0ZB 1ODDA 2R5YA 1OPCA 1K4SA 3MWMA 4I01A 3PO3J 1H0MA 2FX0A 4M3GA 1LE8B 5IPAA 2YX4A 4BBRJ 3PO2J 3KP2A 2FNAA 5EYRA 3ZMDA 2LYCA 2GQQA 1NTCA 1TW3A 3WTZA 4BBSJ 4JK1X 1APLC 5HLHA 3SQNA 3VODA 5LGTA 1JGGA 2LMDA 3BTIA 2EA2A 5F1RA 5D5XB 1MBGA 2HTJA 4Z6YA 3H3VK 3TDUC 2A5WA 2F5FA 1BJAA 1IRXA 4DYRA 2LP0A 1IRZA 3CF2A 3WTWC 4M9SA 2QBYA 2B0LA 4J00A 4XRMA 2XAQA 1XTAA 5J1YA 5KAFC 2W84A 3IRQA 1BBYA 3FHNA 4KFCA 3MFKA 3ERED 4KMUX 3WHCA 4EM0B 5GTIC 2BW3B 4WXDA 2QF7A 5J40A 3HKZA 3Q9SA 3F22A 2R0QC 4HSRA 2HYFA 4B43A 2LLKA 3HBLA 3WTVC 2KHMA 3HOYJ 2D45A 3CMMA 4XONA 1VNDA 2H6CA 2E60A 4RB0A 1DPUA 1ZG1A 3L2UA 2ZJQF 1ZRFA 3S32A 3HSRA 3DTEA 1X3WB 4HDVA 1JTYA 3G1OA 4ETSA 2XGXA 3RPQA 3QP6A 3PM1A 1R71A 2ESNA 4BUPA 1FIAA 5H20A 1D0YA 3BC8A 2JJ7A 2OF7A 4CYCA 3OWTA 1WQ2A 4L9TA 3H92A 5C3EJ 4DYCA 2LBFB 3DBHB 1MD0A 1HOMA 3I0TA 1MGTA 4PCQA 2IEKA 1HW1A 4BY7J 5FKOA 3TO9A 4F55A 5EZGA 5LEJA 3BR1A 2ZXWH 3G6EI 2AO9A 2WC2A 3L1PA 1CGPA 1J5YA 2L0KA 1KYZA 1IG7A 1Z1DA 3CUQB 4HV5A 2XIGA 3K70C 1OCRH 1LJ9A 2E35A 3L00A 5ICEA 2DTZA 3LSTA 1N77A 3WE3A 3W2VA 4EJTA 3ASNH 3FBIB 2R93J 2XVCA 4LB6B 1D1AA 2DPUA 2O8KA 1T33A 1ZG3A 2WWYA 4WXHA 1MBKA 1TZLA 2QGUA 4LLLA 1HBXG 4E7HA 2VJ5A 2WADA 2ETHA 5K1YA 2V79A 4A3MJ 1W7PD 2RNGA 4LITA 4D1QA 2V1XA 2ELKA 3BT9A 3WG7H 3F0CA 1UMQA 2A69F 3TEDA 2IGKA 3ZQCA 2ELHA 1HSTA 5FFZA 4IHXA 3WGIA 4OINF 4A0XA 3EYYA 3I58A 3S1QJ 1D1CA 5LGNA 1H89C 1FZPB 2JVGA 3KLNA 4AUXA 4OOIA 1SD6A 2WV1A 4I0AA 3SYTA 4EM1A 4XK4A 1IXSB 5BQTA 1VQOI 5FLXZ 2MYSA 3DLAA 3FXQA 4X6AJ 5EEGA 4YIRX 4FQGA 2OJED 2PJRA 1FOYA 1W5CC 4BL0B 1IF1A 2M5WA 2ID3A 1Y1WJ 2HGCA 3KPHA 4EGZA 2ZCWA 3CC7I 1YS6A 3GO5A 3ZMVA 1VTNC 3I54A 3SFZA 4IO9F 3X2QH 2K9LA 5BOXA 2B63J 2PLYA 3V8LA 4KIGA 2F5VA 4R1HA 4Y4RA 1SD4A 3S3MA 3A02A 3QPLA 1YTYA 4BXFA 1ZR2A 4GDFA 4RGSA 3DU5A 4P5OA 4G6DA 4ENNA 1XG1A 2DTRA 4XKBA 4NHJA 4DBRA 1F43A 1MW7A 1U5TC 4CSWA 5E3NA 2CV1A 3DXJF 4LIUA 2M8GX 2KRHA 1MNMC 2XUBA 3FWEA 2O9LA 2AHQA 2FBKA 3L2RA 2G7UA 2L7MP 4CZCA 2ME6A 3V8KA 5FLVA 1AHDP 3CLOA 5E1WA 4I99C 4IHWA 1R58A 3BG6A 2E36A 5EDNA 1A36A 4LG0A 4UNOA 2VONA 4MHGA 4OIOF 2CQNA 5D6FA 3CMAI 3CD6I 1V3FA 2ZJPF 3CC4I 1D1BA 5LD2C 2ZO4A 1B8IB 2GIZA 1WI9A 1YYVA 4I09A 1KONA 3MKYB 5C4JJ 4QPOA 1U5TA 3EQLF 2VOPA 4CO8A 3ZMZA 3G4SI 3OL3A 2HR3A 2BXYA 4B09A 3OYHA 1KU2A 5LFAA 4M3EA 2V1UA 2K9NA 3NEUA 3MN2A 2TRTA 5IYBJ 4LG0B 1IDYA 4CHUA 1MJBA 2L4MA 5FD5A 1MKMA 3J7AO 1ZYRF 2BVMA 1W0UA 1U9NA 4RDUA 2VQHA 3JAMK 3RTRA 2MLKA 2HI3A 2X48A 2G7HA 1TTYA 3JTHA 1K78B 3IAM2 1FYLA 3U1KA 4N9IA 3EPZA 3OYLA 1K79A 5IT3A 3I9V2 3K4CA 4MIMA 3TKYA 1WFXA 3CUOA 3ZQGA 2CGPA 1OISA 1I3QJ 2FBHA 4Y13A 2VN2A 1XMXA 2I8DA 2FQ3A 3ZN1A 1EKEA 5TRDA 4NBQA 2E7XA 1R5ID 3G3ZA 4GFBA 4AIHA 1FYMA 3TP0A 2OQGA 1IRGA 4A3KJ 4KT5C 4PK4A 4ZZDA 2N8GA 2P4WA 2KT0A 3IV5A 3DFGA 3HOZJ 3KYDB 3OOPA 2BOLA 2DW4A 4EJOA 2B9SA 1L3LA 2EWNA 3V7SA 1W4MA 2OCEA 3FKIJ 4I02A 4ITVA 2V1NA 3TW7A 1T0FA 2Y75A 2EBIA 1O57A 1GHCA 3ZMSA 4HAMA 3GTOJ 4CGZA 1I5ZA 2LY2A 3DQVC 5J6XA 4E7LA 5BPIA 2E5ZA 1LFPA 3I4NJ 4L9JA 3KE2A 4UHTA 3FXJA 5CJ9A 2YSRA 1ZR4A 1V55H 2M1BA 4BQQA 1HC8A 3ZMTA 2RDPA 3PJRA 4J01A 2E2IJ 2LH9A 3HIFA 1S8NA 1FIPA 1WHUA 2QWWA 1MMSA 1VF9A 2ADUA 3JCUC 4C3IJ 2CYYA 4IXAA 2JZYA 1BW5A 4U87A 1KU7A 2CW8A 2P81A 1MBEA 2RQPA 2STWA 3C18A 4QIWN 5DUIA 1ZREA 3WTTC 2JT1A 3MZYA 4RB3C 3FMRA 2HTSA 1AU7A 2KP6A 2XDVA 4CCMA 5FKLA 1JKRC 4XLCA 1DP3A 3AG1H 1RKWA 3TO7A 2R7OA 3A4CA 5M5XJ 2F4MB 2YPRA 4A3JJ 2YX7A 3S1MJ 4PJ0C 4CA0A 1HXDA 4L9NA 3TMOA 4XLPF 1JUSA 3M1EA 3F8FA 1P6RA 3WU0A 4ZC3A 3DPTA 3R0JA 1MMDA 3DV8A 4Q47A 1SFUA 3OYGA 1UB9A 3CCYA 5AONA 4AIJA 2Y2ZA 3WTUC 3HGYA 3CCUI 1QZEA 4PJLA 4H0EA 4N9HA 2L9VA 3LQQA 2QQBA 2XAHA 4S05A 4LK1F 2ZKZA 2WAEA 1ZGWA 1I39A 1ZLKA 3G71I 3SHFA 3Q0VA 2Y31A 4B47A 2FBIA 2JA8J 3OS1A 4FE4A 5E20A 3VWBA 4CICA 3QOPA 1LDJA 5J4VA 4UUVA 1ACIA 2NS0A 4Y33A 4BXUA 4YIFA 4MLOA 1MMAA 2DA1A 1OCCH 3CCRI 3BTJA 2NYXA 5CKTA 5L3GA 1AA7A 1TWHJ 2CSOA 3IC7A 5LGUA 3CCMI 2XAGA 3DPUA 1MBFA 4W1UA 5JVTA 3S16J 2ZJRF 4RLQA 5M5WJ 4WCGA 4ZH4F 1MH4A 4WX9A 4EGYA 1SMYF 3HL2A 1FTZA 2Y0SA 2M2EA 4P9UA 2JSCA 3HRMA 2PMHA 3EDPA 3S2DJ 1BM9A 1MMNA 1RNLA 2F2EA 2V26A 2LKXA 4GO1A 4PJMA 4I0BA 3BCAA 1BIAA 3FXLA 1O3SA 3KP3A 5DD8A 4BJ6C 3Q0WA 3ZGKA 4DJAA 1R6RA 2HYJA 4CZZA 1K4TA 2QSGX 5H6RA 2P8TA 2L9NA 4EVIA 4C2UA 3VYTB 4M74A 2QKMB 4JX6A 2FRHA 5IY5H 5HDKA 5KNLA 2ZB9A 2DFFA 2J5OA 3KP4A 1R5HA 4HYEA 2LF8A 2WA0A 5K5OA 4U7DA 1RIOH 3GYHX 4RAGA 1KU9A 3SJMA 4MGRA 2IGNA 1JTXA 4IHTA 2WAFA 4II2A 5IP6A 2HOAA 2PI0A 1A6QA 4I2OA 5HNFA 4AVZA 4LD5A 2UZKA 4FETA 4PJNA 2HQRA 9ANTA 2PMZN 1XC5A 2XRLA 3SFIA 5FLMJ 4FX4A 3GUDA 2Q0OA 2D1HA 3ECOA 1I27A 2ZC2A 3SEZA 1NHAA 2CG4A 5K7FA 2VPRA 1GUUA 2K27A 2P0WA 2VKHA 4BAYA 2VE8A 3RKQA 1FOKA 2DAOA 5HDNA 4A3DJ 1ZTRA 3PUFA 2K7LA
chains in the Genus database with same CATH topology
2BYVE 2FNPA 3HYIA 3L09A 3WODF 1QZZA 1EH6A 4A2UA 3DF8A 3QU6A 1HKTA 1FNNA 5HLIA 5E17F 5F6FA 2L01A 3FF5A 2FMYA 1J9IA 1QGPA 1UCRA 1DUXC 3LAJA 3P9KA 3NQOA 1GXPA 2BE5F 4HZFA 2L02A 3BY6A 5K5RA 5DYMA 5H6QA 4WF2A 5AIQA 2P7VB 1ONVA 4P96A 3RI4A 3KZZA 4XRFA 3WTSC 2NNYA 2HYGD 5HDGA 2PN6A 1R22A 2ISZA 2BGCA 1T38A 1OR7A 2QENA 3AAFA 4PDKA 2DBBA 3E6DA 4HLYA 1Z6TA 2X4HA 1G3SA 1XMKA 3F6VA 2HZTA 5ILSA 4NB5A 5LBQA 3ROUA 3T5XA 1MJ9A 4KMFA 1LEBA 1F5TA 2FEZA 3CO6C 1HQCA 3T1BA 4GYIA 1B4AA 3WE2A 2Z33A 1Q1HA 4RS8A 3HSFA 3K69A 5FO5A 1XGNA 1TQMA 2GZWA 4ZYHA 2GXBA 1MZBA 3GXOA 1LB2A 1W5SA 2QQ9A 5ICCA 4GXOA 2JPCA 3EETA 3WG9A 2K4BA 2COMA 2LNBA 5A2QK 5HLGA 2NNNA 5J8FA 2VXZA 3J81K 3CO7C 2TDXA 1G3WA 4XSXF 3ISPA 1T98A 1S6LA 2AXLA 1TNTA 1YLFA 1S3JA 3R60A 2BEOA 1YG2A 2KIUA 3RIRA 2UWMA 3VEPA 1XDUA 5TJJA 3KETA 4G6QA 3FMQA 1C0WA 5CVVA 5L3CA 2NRAC 2HOEA 5FD6A 2O61A 2O6GE 3ZPLA 3FMSA 3GX4X 3KZYA 4Y15A 4M9ZA 2Q2EA 4F7ZA 4JBAA 4RAZA 3I4PA 5JHUA 3O3KA 2JTVA 1KQ9A 1XGMA 5A2QZ 2R3SA 3K2ZA 2DQLA 2ZJ2A 4KDPA 5LEKA 3OV8A 5FLXK 4D0PA 2F5EA 2MD5A 3G73A 3BJOA 2NAZA 1FYKA 1EH8A 3HHGA 2MLGA 2K02A 3ZN0A 2FF4A 3V8JA 4OMZA 4ON0A 3LWFA 4GGGA 1FP1D 3HSEA 1XGOA 2J5PA 3HRUA 4EV0A 3WTYC 3VB2A 2DI3A 2W57A 4BNCA 4E70A 2IVMA 3LA2A 4RGUA 3HUGA 2OBPA 4BYYA 1CF7B 2GAUA 4HQMA 4O6JA 5FGMA 5DCFA 1IN4A 1XN7A 4YIIA 4M6XA 4DQ2A 4G8XA 1BI2A 2HS5A 2VC0A 5D5VB 4QLCU 4G94A 1XCBA 2OQRA 1QBJA 1FY7A 1AWCA 4ZYDA 1YW9A 3U1DA 2AS5F 3QU3A 1T6SA 4BH9A 5CVRA 1Z05A 1H9TA 3T0YA 1B9NA 4HV6A 3P7NA 3R6SA 4HF2A 2CWEA 4LLNA 1FX7A 3W6JB 2P7CB 1BI0A 4IRIA 2KIFA 2IPQX 4GCVA 3IKTA 2OA4A 1SFEA 3I53A 1YS7A 3F23A 3TDZC 2KIMA 4ZZLA 1D8KA 3P9IA 3GVAA 3LQRA 2EFOA 3FZVA 1UHWA 2HKOA 3T8TA 1STZA 4KA4A 3IWFA 3HTUA 4WK8F 2HKXA 3QAHA 5CYVA 4HW0A 3TQNA 1WWXA 2P5VA 3R61A 3RDIA 5DCMB 1J0RA 1YQAA 3K9TA 3EUHA 3PFIA 5HS9A 2XKPA 5D5UB 3ULQB 4MEYF 2IW5A 3I59A 2XAJA 3K0LA 2M30A 2XASA 2CO5A 2DO7A 3GWZA 4LGWA 4U7BA 1JHHA 5D4RA 1WRJA 4G9YA 5ED4A 3E3VA 1EV7A 2PJPA 1GVJA 3COAC 3ZP5A 1QQIA 1K78A 1UHMA 2ACJA 1TQIA 5JFRA 2MC3A 4UXNA 4S04A 2QVOA 3GLXA 3TOBA 1SMTA 4OIPF 4FT8A 5EEHA 1BOAA 4KIBA 1U8RA 3HRTA 3E6CC 1R1VA 1SD5A 3MCZA 1P2FA 2M45A 2W25A 3F6OA 1B1BA 4WWCA 2IA0A 3ZMUA 2IP2A 1HW2A 4PZJA 1LDKB 2YU3A 4GYGA 4A0YA 2JRTA 1W7PB 3O6BB 2DU9A 2H6BA 3ECHA 4G7ZF 2ZXJA 6PAXA 2CFXA 3U2RA 4WXCA 5HS8A 2DFIA 4XSZF 2H27A 3V4GA 5IT9K 1ZH5A 3F8BA 3DKWA 2CQKA 1K6OA 3FM5A 3K1MA 1O3QA 2IJLA 3E6MA 2QLZA 4Q4ZF 2IRFG 1S29A 2HFHA 1GXQA 2EV6A 3E5QA 4ESJA 1HSJA 2EJRA 4P55A 5BMZA 3Q9VA 1IW7F 5F64A 1S7AA 5AIPA 4FX0A 2IA2A 5HVQC 2MA3A 2ISYA 3U9GA 1B59A 1XSXA 1USTA 1CF7A 5LRSA 4CXFA 5CLSA 2BBYA 2EFQA 3IRRA 1J59A 1IN7A 4MTDA 1FSEA 2MH2A 2BV6A 1K7AA 1D3YA 1REPC 4HF1A 4I7HA 3CUQA 4MQVA 3SZPA 2Z3YA 1F4KA 3WGHA 3L7WA 5BS6A 3CJNA 4AD9A 3M7GA 3WGGA 3GEZA 3KP6A 2O03A 2FOKA 3LAPA 5E18F 2VBZA 3I5UA 2DK5A 3S2WA 2GA1A 4M6YA 2P6SA 1P4WA 4JQFA 4OIQF 4P9FA 1O3RA 4EQQA 2XHKA 1R23A 3TOAA 3CUQC 1FPQA 1XSDA 1ZGJA 2ZNYA 4EJVA 1U78A 2EK5A 4EJUA 3DEUA 1DPRA 1XSVA 4YFKF 2A6HF 2FXAA 2XKOA 1L0OC 2MBFA 1TW2A 4RGRA 3F72A 3NRVA 2M87A 1XD7A 1FWZA 5L3FA 1SAXA 3BOQA 1RUOA 2VT2A 2E1CA 3W6KB 5BPDA 2O8XA 4LJZF 3GZ5A 1BC8C 3D5LA 2RN7A 3E6BA 4OIRF 3HTSB 2OU2A 4L5IA 2EV5A 4L9VA 1FLIA 3N4MA 3ELKA 4L5JA 4MEXF 1ZGAA 1P4AA 2XV4S 4OMYA 5CVIA 3IL2A 1A04A 1U5TB 2P5LC 3H3UA 1IUYA 4HF0A 1J75A 2VE9A 4HX8A 2A68F 1XB4A 2KRFA 3BPXA 1D5VA 3BPVA 4RGXA 3KP7A 1XCVA 4G7OF 1J7KA 3GFIA 5LHHA 3QPHA 1O7LA 4KN4X 2D2WA 4IRHA 1V4RA 1QNTA 4LLGF 4M73A 5L3DA 3L2CA 1SD7A 2LF7A 1Z7UA 1G6NA 4IHSA 4ENJA 1QO0D 1TNSA 3CDHA 3DPLC 4HQEA 1G3TA 3K1NA 1USSA 2K4JA 4Y17A 4A6EA 4XLNF 2VC1A 4UVCA 1IZ1A 1ZN2A 3F8MA 2YR2A 3RKYA 1XGSA 5ERIA 4YFNF 3REOA 2DK8A 3LA7A 1YW8A 4U0WA 2WTEA 1IAWA 2W85A 1IRFA 2EFPA 4ZYGA 1OMIA 4O3MA 4G7HF 3ML6A 4EM2A 1FBUA 3MAJA 4DNCA 5KK1A 3F8NA 2FA5A 4MTEA 4YFXF 1PP7U 3EYIA 1LVAA 2Y48A 2FSWA 4UV8A 4AWXB 2D1VA 3BROA 3RYPA 4KYWA 1F9NA 1T2KA 3GFJA 3D0SA 3M8EA 3RYRA 1PP8F 3ZQ7A 4CYDA 1PUEE 3HOSA 4OU0A 3SZTA 1AOYA 2HQNA 5FB2A 3FHZA 1KGSA 5E1ZB 2QUFA 2VODA 1P4XA 3FXRA 2DPDA 5LRRA 4A5MA 4M9XA 4RAYA 1I1SA 1IXCA 3E97A 3JSOA 1BI1A 2KJBA 5FFXA 3MQ0A 1PDNC 1G3YA 4MQ9F 1LQ1A 2EB7A 3KP5A 4XBFA 3J80Z 2XROA 2ZNZA 5D5WB 5LLQA 5E1XA 2Z9OA 3I64A 4U88A 3QRFF 1YIOA 2X0LA 4HA8A 1I1GA 1FP2A 3O2PE 1T39A 3WU1B 3ABUA 1BC7C 3HRSA 4Q48A 5DD4A 1IN5A 5K5QA 3PQJA 2VBXA 1UFMA 1KQ8A 2H09A 2A6EF 3BP8A 2RGVA 2VT3A 5D4SA 3BZ6A 2WV0A 4TV7A 3VOEA 4QWQA 4YG2F 2FMLA 5J8CA 3R0AA 4U0VA 1JGSA 2V6CA 1R5GA 3IHUA 3HHHA 2ZMEB 1XDSA 4AIKA 4U0YA 3QP5A 2C6YA 5ILUA 4ESFA 2LDUA 4RB1A 4A5NA 5HOOA 4N0BA 4ESBA 1ZG5A 4UVAA 4BHCA 5DEQA 4KN7X 1RUNA 1B6AA 2ZMEA 2L54A 5HS7A 1QPMA 1DDNA 2R7FA 1IXRC 3R4KA 2K86A 4EJWA 3TGNA 2Z99A 3JAMZ 4A6DA 4I98B 2EA4A 1Y0UA 2V9VA 2PFBA 1ZHFA 4HOBA 2UXXA 2JPBA 4FHTA 5DCMA 4KNYA 1KQ0A 1BN5A 4BQAA 1QZYA 2Z5UA 2E1NA 1DP7P 3F3XA 1SFXA 1JXSA 2RV8A 5JR3A 3E5XA 2G9WA 3Q5FA 2XAFA 3J81Z 2UXNA 2ESHA 5D8LB 1G4DA 3C3WA 2KJCA 2RC4A 5IT9Z 2DLLA 2OAZA 1BIBA 3IKVA 1S7OA 5DV5A 1E17A 2GIVA 3V7RA 5LHIA 1W5TA 3LFKA 4R8HA 4ENMA 2EFNA 2CW0F 2IA1A 2GXGA 1MJAA 2PBIA 3I71A 3LA3A 5E8GA 5L3EA 1XMAA 1OKRA 3M8FA 4AVPA 3P9CA 3CTAA 2L3DA 2EV0A 2L4AA 2O0YA 2OZUA 1LEAA 1I6XA 1RZ4A 3BWGA 2GA2A 1ZRCA 3TO6A 3F21A 1LNWA 3K1PA 1YO5C 4EMSA 3B73A 1FBQA 1KU3A 2MH9A 2XRNA 2RNJA 1KYWA 5JI6A 3KFWX 1Z6RA 3RKWA 1R1TA 1OYIA 2ZFWA 3KEOA 3VFZA 1P92A 2E7WA 4HLXA 3GF2A 1BI3A 5E8IA 2GWRA 5ICFA 3V7CA 2FU4A 4MNUA 1RI7A 3KEQA 2VOOA 2P6TA 1ON2A 1ZRDA 1ULYA 2STTA 1O7FA 4IVNA 1J2XA 2PG4A 4UVBA 2F5DA 2QYOA 3IWZA 1IN6A 2VBYA 4LB5A 2M8EA 1FT9A 3C7JA 3H3ZA 1FC3A 1YW7A 1R7JA 2F5CA 2PQ8A 5CVJA 4IRGA 4HX7A 1ZARA 4ASNA 3T8RA 3RJPA 3GW2A 5KVRA 4K2EA 4A0ZA 2QBYB 1TQPA 4KIFA 1KA8A 2HEOA 1ZAOA 4A12A 1FSHA 3RKXA 2QM3A 2HDCA 2QZ8A 2R7DA 3DP7A 3FXUA 4LK0F 2DQRA 4PGGA 1E2XA 3E5UA 5LHGA 5DUKA 2A61A 2OD5A 1U2WA 2LSOA 1FBSA 2Q8KA 3JW4A 1R1UA 2LKPA 1TLHB 2EFWA 2RKHA 3JTGA 4PGHA 1JE8A 1ON1A 5ILVA 3N97A 3ABTA 4ENKA 2OZ6A 1HKQA 3I59B 4ZYEA 3MEXA 1W7PA 1R36A 2FE3A 1HW5A 1MDMB 4L18B 2KKOA 2V1DA 4Z2YA 1ZLJA 2P5KA 3KCCA 5D8KB 1EH7A 1U3EM 3FM3A 2QQAA 4O5VA 4BHPA 2IT0A 4IF4A 1WKMA 1TBXA 5CVUA 3B02A 4HX4A 1MDMA 4UV9A 4KICA 1OYYA 1Z9CA 3HOTA 2HWVA 1IN8A 5L3BA 3C1DA 1WSUA 1R00A 2A07F 4IJAA 3FX3A 3GFMA 1LDDA 2RVCA 1X3UA 3WTXC 1H9GA 4CDGA 2DT5A 3BJ6A 3BJAA 4B8XA 4R79A 1Z91A 3KLOA 3PQKA 3RPUA 4BHBA 3GFLA 3JSPA 2A5YB 2VBWA 3L9FA 4LMYA 2PEXA 4M72A 5DDGA 1D8JA 1OYWA 4LFUA 5D6EA 2ZBKA 1O3TA 3M9AA 4HDUA 1HKSA 2A3SA 3SXYA 4IPAA 5ICGA 3F8CA 3GZ6A 4Q5SF 2Y0MA 4KUMA 1B9MA 2H94A 4RB2C 1JHFA 4NQWA 2O3FA 3BDDA 4M71A 2PMUA 4HBLA 3QPTA 2W24A 1U6GA 3J80K 1YFHA 4L0YB 1F1ZA 3MZHA 4L0ZB 1ODDA 1OPCA 3MWMA 4I01A 1H0MA 2YX4A 3KP2A 2FNAA 3ZMDA 2GQQA 1TW3A 3WTZA 4JK1X 5HLHA 3SQNA 3VODA 5LGTA 2EA2A 5F1RA 5D5XB 2HTJA 3TDUC 2F5FA 1BJAA 3WTWC 4M9SA 2QBYA 2B0LA 2XAQA 2W84A 3IRQA 1BBYA 4KFCA 3MFKA 3ERED 4KMUX 4EM0B 4WXDA 3Q9SA 3F22A 2HYFA 3WTVC 2D45A 2H6CA 4RB0A 1DPUA 1ZG1A 1ZRFA 3HSRA 4HDVA 4ETSA 2XGXA 3RPQA 3QP6A 2ESNA 5H20A 1WQ2A 4L9TA 3H92A 1MD0A 3I0TA 1MGTA 4PCQA 1HW1A 3TO9A 5LEJA 2WC2A 1CGPA 1J5YA 1KYZA 1Z1DA 3CUQB 4HV5A 2XIGA 1LJ9A 3L00A 5ICEA 3LSTA 3WE3A 4EJTA 2XVCA 4LB6B 2DPUA 1ZG3A 2WWYA 4WXHA 4LLLA 1HBXG 2ETHA 5K1YA 2V79A 1W7PD 2V1XA 2A69F 2ELHA 1HSTA 5FFZA 3WGIA 4OINF 4A0XA 3EYYA 3I58A 5LGNA 1FZPB 3KLNA 4OOIA 1SD6A 4I0AA 4EM1A 1IXSB 5BQTA 5FLXZ 3FXQA 5EEGA 1IF1A 2M5WA 2HGCA 4EGZA 2ZCWA 1YS6A 3GO5A 3ZMVA 1VTNC 3I54A 3SFZA 5BOXA 2PLYA 3V8LA 4KIGA 4R1HA 1SD4A 1YTYA 4RGSA 4P5OA 4G6DA 4ENNA 2DTRA 4NHJA 1U5TC 3DXJF 2XUBA 3FWEA 2FBKA 2G7UA 3V8KA 3CLOA 5E1WA 1R58A 4LG0A 4UNOA 2VONA 4MHGA 4OIOF 5D6FA 1V3FA 2ZO4A 1WI9A 1YYVA 4I09A 1U5TA 3EQLF 2VOPA 4CO8A 3ZMZA 2HR3A 4B09A 1KU2A 2V1UA 3NEUA 4LG0B 4CHUA 1MJBA 2L4MA 5FD5A 1MKMA 3J7AO 1ZYRF 3JAMK 3RTRA 2MLKA 2G7HA 1TTYA 3JTHA 1K78B 1FYLA 4N9IA 1K79A 5IT3A 2CGPA 3TKYA 3CUOA 2FBHA 4Y13A 2VN2A 2FQ3A 3ZN1A 5TRDA 2E7XA 3G3ZA 4AIHA 1FYMA 2OQGA 1IRGA 4KT5C 4ZZDA 2P4WA 3DFGA 3OOPA 2DW4A 4EJOA 1L3LA 2EWNA 3V7SA 1W4MA 4I02A 1T0FA 2Y75A 1O57A 1GHCA 3ZMSA 4HAMA 4CGZA 1I5ZA 3DQVC 5J6XA 5BPIA 4L9JA 3KE2A 4UHTA 5CJ9A 2YSRA 2M1BA 3ZMTA 2RDPA 3HIFA 1S8NA 2QWWA 2ADUA 2CYYA 4IXAA 2JZYA 1KU7A 2RQPA 2STWA 3C18A 5DUIA 1ZREA 3WTTC 2JT1A 3MZYA 4RB3C 3FMRA 2HTSA 3TO7A 2YPRA 2YX7A 1HXDA 4L9NA 4XLPF 3M1EA 3F8FA 1P6RA 3WU0A 3DPTA 3R0JA 3DV8A 4Q47A 1SFUA 1UB9A 4AIJA 5AONA 3WTUC 4H0EA 4N9HA 3LQQA 4S05A 2QQBA 2XAHA 4LK1F 2ZKZA 1ZLKA 3SHFA 2FBIA 5E20A 4CICA 3QOPA 1LDJA 4UUVA 2NS0A 4BXUA 4YIFA 2NYXA 5L3GA 2CSOA 3IC7A 5LGUA 2XAGA 5JVTA 4WCGA 4ZH4F 4WX9A 4EGYA 1SMYF 4P9UA 2JSCA 3HRMA 2PMHA 3EDPA 1BM9A 1RNLA 2F2EA 4GO1A 4I0BA 1BIAA 1O3SA 3KP3A 5DD8A 4CZZA 5H6RA 2P8TA 4EVIA 4M74A 2FRHA 5HDKA 2J5OA 3KP4A 1R5HA 4HYEA 2LF8A 5K5OA 4U7DA 1RIOH 3GYHX 1KU9A 4MGRA 4IHTA 2PI0A 4I2OA 4LD5A 2UZKA 2HQRA 4FX4A 3GUDA 2Q0OA 2D1HA 3ECOA 1I27A 1NHAA 2CG4A 2K27A 4BAYA 2VE8A 1FOKA 2DAOA 5HDNA 2K7LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BYV E;  2FNP A;  3HYI A;  3L09 A;  3WOD F;  1QZZ A;  1EH6 A;  4A2U A;  3DF8 A;  3QU6 A;  1HKT A;  1FNN A;  5HLI A;  5E17 F;  5F6F A;  2L01 A;  3FF5 A;  2FMY A;  1J9I A;  1QGP A;  1UCR A;  1DUX C;  3LAJ A;  3P9K A;  3NQO A;  1GXP A;  2BE5 F;  4HZF A;  2L02 A;  3BY6 A;  5K5R A;  5DYM A;  5H6Q A;  4WF2 A;  5AIQ A;  2P7V B;  1ONV A;  4P96 A;  3RI4 A;  3KZZ A;  4XRF A;  3WTS C;  2NNY A;  2HYG D;  5HDG A;  2PN6 A;  1R22 A;  2ISZ A;  2BGC A;  1T38 A;  1OR7 A;  2QEN A;  3AAF A;  4PDK A;  2DBB A;  3E6D A;  4HLY A;  1Z6T A;  2X4H A;  1G3S A;  1XMK A;  3F6V A;  2HZT A;  5ILS A;  4NB5 A;  5LBQ A;  3ROU A;  3T5X A;  1MJ9 A;  4KMF A;  1LEB A;  1F5T A;  2FEZ A;  3CO6 C;  1HQC A;  3T1B A;  4GYI A;  1B4A A;  3WE2 A;  2Z33 A;  1Q1H A;  4RS8 A;  3HSF A;  3K69 A;  5FO5 A;  1XGN A;  1TQM A;  2GZW A;  4ZYH A;  2GXB A;  1MZB A;  3GXO A;  1LB2 A;  1W5S A;  2QQ9 A;  5ICC A;  4GXO A;  2JPC A;  3EET A;  3WG9 A;  2K4B A;  2COM A;  2LNB A;  5A2Q K;  5HLG A;  2NNN A;  5J8F A;  2VXZ A;  3J81 K;  3CO7 C;  2TDX A;  1G3W A;  4XSX F;  3ISP A;  1T98 A;  1S6L A;  2AXL A;  1TNT A;  1YLF A;  1S3J A;  3R60 A;  2BEO A;  1YG2 A;  2KIU A;  3RIR A;  2UWM A;  3VEP A;  1XDU A;  5TJJ A;  3KET A;  4G6Q A;  3FMQ A;  1C0W A;  5CVV A;  5L3C A;  2NRA C;  2HOE A;  5FD6 A;  2O61 A;  2O6G E;  3ZPL A;  3FMS A;  3GX4 X;  3KZY A;  4Y15 A;  4M9Z A;  2Q2E A;  4F7Z A;  4JBA A;  4RAZ A;  3I4P A;  5JHU A;  3O3K A;  2JTV A;  1KQ9 A;  1XGM A;  5A2Q Z;  2R3S A;  3K2Z A;  2DQL A;  2ZJ2 A;  4KDP A;  5LEK A;  3OV8 A;  5FLX K;  4D0P A;  2F5E A;  2MD5 A;  3G73 A;  3BJO A;  2NAZ A;  1FYK A;  1EH8 A;  3HHG A;  2MLG A;  2K02 A;  3ZN0 A;  2FF4 A;  3V8J A;  4OMZ A;  4ON0 A;  3LWF A;  4GGG A;  1FP1 D;  3HSE A;  1XGO A;  2J5P A;  3HRU A;  4EV0 A;  3WTY C;  3VB2 A;  2DI3 A;  2W57 A;  4BNC A;  4E70 A;  2IVM A;  3LA2 A;  4RGU A;  3HUG A;  2OBP A;  4BYY A;  1CF7 B;  2GAU A;  4HQM A;  4O6J A;  5FGM A;  5DCF A;  1IN4 A;  1XN7 A;  4YII A;  4M6X A;  4DQ2 A;  4G8X A;  1BI2 A;  2HS5 A;  2VC0 A;  5D5V B;  4QLC U;  4G94 A;  1XCB A;  2OQR A;  1QBJ A;  1FY7 A;  1AWC A;  4ZYD A;  1YW9 A;  3U1D A;  2AS5 F;  3QU3 A;  1T6S A;  4BH9 A;  5CVR A;  1Z05 A;  1H9T A;  3T0Y A;  1B9N A;  4HV6 A;  3P7N A;  3R6S A;  4HF2 A;  2CWE A;  4LLN A;  1FX7 A;  3W6J B;  2P7C B;  1BI0 A;  4IRI A;  2KIF A;  2IPQ X;  4GCV A;  3IKT A;  2OA4 A;  1SFE A;  3I53 A;  1YS7 A;  3F23 A;  3TDZ C;  2KIM A;  4ZZL A;  1D8K A;  3P9I A;  3GVA A;  3LQR A;  2EFO A;  3FZV A;  1UHW A;  2HKO A;  3T8T A;  1STZ A;  4KA4 A;  3IWF A;  3HTU A;  4WK8 F;  2HKX A;  3QAH A;  5CYV A;  4HW0 A;  3TQN A;  1WWX A;  2P5V A;  3R61 A;  3RDI A;  5DCM B;  1J0R A;  1YQA A;  3K9T A;  3EUH A;  3PFI A;  5HS9 A;  2XKP A;  5D5U B;  3ULQ B;  4MEY F;  2IW5 A;  3I59 A;  2XAJ A;  3K0L A;  2M30 A;  2XAS A;  2CO5 A;  2DO7 A;  3GWZ A;  4LGW A;  4U7B A;  1JHH A;  5D4R A;  1WRJ A;  4G9Y A;  5ED4 A;  3E3V A;  1EV7 A;  2PJP A;  1GVJ A;  3COA C;  3ZP5 A;  1QQI A;  1K78 A;  1UHM A;  2ACJ A;  1TQI A;  5JFR A;  2MC3 A;  4UXN A;  4S04 A;  2QVO A;  3GLX A;  3TOB A;  1SMT A;  4OIP F;  4FT8 A;  5EEH A;  1BOA A;  4KIB A;  1U8R A;  3HRT A;  3E6C C;  1R1V A;  1SD5 A;  3MCZ A;  1P2F A;  2M45 A;  2W25 A;  3F6O A;  1B1B A;  4WWC A;  2IA0 A;  3ZMU A;  2IP2 A;  1HW2 A;  4PZJ A;  1LDK B;  2YU3 A;  4GYG A;  4A0Y A;  2JRT A;  1W7P B;  3O6B B;  2DU9 A;  2H6B A;  3ECH A;  4G7Z F;  2ZXJ A;  6PAX A;  2CFX A;  3U2R A;  4WXC A;  5HS8 A;  2DFI A;  4XSZ F;  2H27 A;  3V4G A;  5IT9 K;  1ZH5 A;  3F8B A;  3DKW A;  2CQK A;  1K6O A;  3FM5 A;  3K1M A;  1O3Q A;  2IJL A;  3E6M A;  2QLZ A;  4Q4Z F;  2IRF G;  1S29 A;  2HFH A;  1GXQ A;  2EV6 A;  3E5Q A;  4ESJ A;  1HSJ A;  2EJR A;  4P55 A;  5BMZ A;  3Q9V A;  1IW7 F;  5F64 A;  1S7A A;  5AIP A;  4FX0 A;  2IA2 A;  5HVQ C;  2MA3 A;  2ISY A;  3U9G A;  1B59 A;  1XSX A;  1UST A;  1CF7 A;  5LRS A;  4CXF A;  5CLS A;  2BBY A;  2EFQ A;  3IRR A;  1J59 A;  1IN7 A;  4MTD A;  1FSE A;  2MH2 A;  2BV6 A;  1K7A A;  1D3Y A;  1REP C;  4HF1 A;  4I7H A;  3CUQ A;  4MQV A;  3SZP A;  2Z3Y A;  1F4K A;  3WGH A;  3L7W A;  5BS6 A;  3CJN A;  4AD9 A;  3M7G A;  3WGG A;  3GEZ A;  3KP6 A;  2O03 A;  2FOK A;  3LAP A;  5E18 F;  2VBZ A;  3I5U A;  2DK5 A;  3S2W A;  2GA1 A;  4M6Y A;  2P6S A;  1P4W A;  4JQF A;  4OIQ F;  4P9F A;  1O3R A;  4EQQ A;  2XHK A;  1R23 A;  3TOA A;  3CUQ C;  1FPQ A;  1XSD A;  1ZGJ A;  2ZNY A;  4EJV A;  1U78 A;  2EK5 A;  4EJU A;  3DEU A;  1DPR A;  1XSV A;  4YFK F;  2A6H F;  2FXA A;  2XKO A;  1L0O C;  2MBF A;  1TW2 A;  4RGR A;  3F72 A;  3NRV A;  2M87 A;  1XD7 A;  1FWZ A;  5L3F A;  1SAX A;  3BOQ A;  1RUO A;  2VT2 A;  2E1C A;  3W6K B;  5BPD A;  2O8X A;  4LJZ F;  3GZ5 A;  1BC8 C;  3D5L A;  2RN7 A;  3E6B A;  4OIR F;  3HTS B;  2OU2 A;  4L5I A;  2EV5 A;  4L9V A;  1FLI A;  3N4M A;  3ELK A;  4L5J A;  4MEX F;  1ZGA A;  1P4A A;  2XV4 S;  4OMY A;  5CVI A;  3IL2 A;  1A04 A;  1U5T B;  2P5L C;  3H3U A;  1IUY A;  4HF0 A;  1J75 A;  2VE9 A;  4HX8 A;  2A68 F;  1XB4 A;  2KRF A;  3BPX A;  1D5V A;  3BPV A;  4RGX A;  3KP7 A;  1XCV A;  4G7O F;  1J7K A;  3GFI A;  5LHH A;  3QPH A;  1O7L A;  4KN4 X;  2D2W A;  4IRH A;  1V4R A;  1QNT A;  4LLG F;  4M73 A;  5L3D A;  3L2C A;  1SD7 A;  2LF7 A;  1Z7U A;  1G6N A;  4IHS A;  4ENJ A;  1QO0 D;  1TNS A;  3CDH A;  3DPL C;  4HQE A;  1G3T A;  3K1N A;  1USS A;  2K4J A;  4Y17 A;  4A6E A;  4XLN F;  2VC1 A;  4UVC A;  1IZ1 A;  1ZN2 A;  3F8M A;  2YR2 A;  3RKY A;  1XGS A;  5ERI A;  4YFN F;  3REO A;  2DK8 A;  3LA7 A;  1YW8 A;  4U0W A;  2WTE A;  1IAW A;  2W85 A;  1IRF A;  2EFP A;  4ZYG A;  1OMI A;  4O3M A;  4G7H F;  3ML6 A;  4EM2 A;  1FBU A;  3MAJ A;  4DNC A;  5KK1 A;  3F8N A;  2FA5 A;  4MTE A;  4YFX F;  1PP7 U;  3EYI A;  1LVA A;  2Y48 A;  2FSW A;  4UV8 A;  4AWX B;  2D1V A;  3BRO A;  3RYP A;  4KYW A;  1F9N A;  1T2K A;  3GFJ A;  3D0S A;  3M8E A;  3RYR A;  1PP8 F;  3ZQ7 A;  4CYD A;  1PUE E;  3HOS A;  4OU0 A;  3SZT A;  1AOY A;  2HQN A;  5FB2 A;  3FHZ A;  1KGS A;  5E1Z B;  2QUF A;  2VOD A;  1P4X A;  3FXR A;  2DPD A;  5LRR A;  4A5M A;  4M9X A;  4RAY A;  1I1S A;  1IXC A;  3E97 A;  3JSO A;  1BI1 A;  2KJB A;  5FFX A;  3MQ0 A;  1PDN C;  1G3Y A;  4MQ9 F;  1LQ1 A;  2EB7 A;  3KP5 A;  4XBF A;  3J80 Z;  2XRO A;  2ZNZ A;  5D5W B;  5LLQ A;  5E1X A;  2Z9O A;  3I64 A;  4U88 A;  3QRF F;  1YIO A;  2X0L A;  4HA8 A;  1I1G A;  1FP2 A;  3O2P E;  1T39 A;  3WU1 B;  3ABU A;  1BC7 C;  3HRS A;  4Q48 A;  5DD4 A;  1IN5 A;  5K5Q A;  3PQJ A;  2VBX A;  1UFM A;  1KQ8 A;  2H09 A;  2A6E F;  3BP8 A;  2RGV A;  2VT3 A;  5D4S A;  3BZ6 A;  2WV0 A;  4TV7 A;  3VOE A;  4QWQ A;  4YG2 F;  2FML A;  5J8C A;  3R0A A;  4U0V A;  1JGS A;  2V6C A;  1R5G A;  3IHU A;  3HHH A;  2ZME B;  1XDS A;  4AIK A;  4U0Y A;  3QP5 A;  2C6Y A;  5ILU A;  4ESF A;  2LDU A;  4RB1 A;  4A5N A;  5HOO A;  4N0B A;  4ESB A;  1ZG5 A;  4UVA A;  4BHC A;  5DEQ A;  4KN7 X;  1RUN A;  1B6A A;  2ZME A;  2L54 A;  5HS7 A;  1QPM A;  1DDN A;  2R7F A;  1IXR C;  3R4K A;  2K86 A;  4EJW A;  3TGN A;  2Z99 A;  3JAM Z;  4A6D A;  4I98 B;  2EA4 A;  1Y0U A;  2V9V A;  2PFB A;  1ZHF A;  4HOB A;  2UXX A;  2JPB A;  4FHT A;  5DCM A;  4KNY A;  1KQ0 A;  1BN5 A;  4BQA A;  1QZY A;  2Z5U A;  2E1N A;  1DP7 P;  3F3X A;  1SFX A;  1JXS A;  2RV8 A;  5JR3 A;  3E5X A;  2G9W A;  3Q5F A;  2XAF A;  3J81 Z;  2UXN A;  2ESH A;  5D8L B;  1G4D A;  3C3W A;  2KJC A;  2RC4 A;  5IT9 Z;  2DLL A;  2OAZ A;  1BIB A;  3IKV A;  1S7O A;  5DV5 A;  1E17 A;  2GIV A;  3V7R A;  5LHI A;  1W5T A;  3LFK A;  4R8H A;  4ENM A;  2EFN A;  2CW0 F;  2IA1 A;  2GXG A;  1MJA A;  2PBI A;  3I71 A;  3LA3 A;  5E8G A;  5L3E A;  1XMA A;  1OKR A;  3M8F A;  4AVP A;  3P9C A;  3CTA A;  2L3D A;  2EV0 A;  2L4A A;  2O0Y A;  2OZU A;  1LEA A;  1I6X A;  1RZ4 A;  3BWG A;  2GA2 A;  1ZRC A;  3TO6 A;  3F21 A;  1LNW A;  3K1P A;  1YO5 C;  4EMS A;  3B73 A;  1FBQ A;  1KU3 A;  2MH9 A;  2XRN A;  2RNJ A;  1KYW A;  5JI6 A;  3KFW X;  1Z6R A;  3RKW A;  1R1T A;  1OYI A;  2ZFW A;  3KEO A;  3VFZ A;  1P92 A;  2E7W A;  4HLX A;  3GF2 A;  1BI3 A;  5E8I A;  2GWR A;  5ICF A;  3V7C A;  2FU4 A;  4MNU A;  1RI7 A;  3KEQ A;  2VOO A;  2P6T A;  1ON2 A;  1ZRD A;  1ULY A;  2STT A;  1O7F A;  4IVN A;  1J2X A;  2PG4 A;  4UVB A;  2F5D A;  2QYO A;  3IWZ A;  1IN6 A;  2VBY A;  4LB5 A;  2M8E A;  1FT9 A;  3C7J A;  3H3Z A;  1FC3 A;  1YW7 A;  1R7J A;  2F5C A;  2PQ8 A;  5CVJ A;  4IRG A;  4HX7 A;  1ZAR A;  4ASN A;  3T8R A;  3RJP A;  3GW2 A;  5KVR A;  4K2E A;  4A0Z A;  2QBY B;  1TQP A;  4KIF A;  1KA8 A;  2HEO A;  1ZAO A;  4A12 A;  1FSH A;  3RKX A;  2QM3 A;  2HDC A;  2QZ8 A;  2R7D A;  3DP7 A;  3FXU A;  4LK0 F;  2DQR A;  4PGG A;  1E2X A;  3E5U A;  5LHG A;  5DUK A;  2A61 A;  2OD5 A;  1U2W A;  2LSO A;  1FBS A;  2Q8K A;  3JW4 A;  1R1U A;  2LKP A;  1TLH B;  2EFW A;  2RKH A;  3JTG A;  4PGH A;  1JE8 A;  1ON1 A;  5ILV A;  3N97 A;  3ABT A;  4ENK A;  2OZ6 A;  1HKQ A;  3I59 B;  4ZYE A;  3MEX A;  1W7P A;  1R36 A;  2FE3 A;  1HW5 A;  1MDM B;  4L18 B;  2KKO A;  2V1D A;  4Z2Y A;  1ZLJ A;  2P5K A;  3KCC A;  5D8K B;  1EH7 A;  1U3E M;  3FM3 A;  2QQA A;  4O5V A;  4BHP A;  2IT0 A;  4IF4 A;  1WKM A;  1TBX A;  5CVU A;  3B02 A;  4HX4 A;  1MDM A;  4UV9 A;  4KIC A;  1OYY A;  1Z9C A;  3HOT A;  2HWV A;  1IN8 A;  5L3B A;  3C1D A;  1WSU A;  1R00 A;  2A07 F;  4IJA A;  3FX3 A;  3GFM A;  1LDD A;  2RVC A;  1X3U A;  3WTX C;  1H9G A;  4CDG A;  2DT5 A;  3BJ6 A;  3BJA A;  4B8X A;  4R79 A;  1Z91 A;  3KLO A;  3PQK A;  3RPU A;  4BHB A;  3GFL A;  3JSP A;  2A5Y B;  2VBW A;  3L9F A;  4LMY A;  2PEX A;  4M72 A;  5DDG A;  1D8J A;  1OYW A;  4LFU A;  5D6E A;  2ZBK A;  1O3T A;  3M9A A;  4HDU A;  1HKS A;  2A3S A;  3SXY A;  4IPA A;  5ICG A;  3F8C A;  3GZ6 A;  4Q5S F;  2Y0M A;  4KUM A;  1B9M A;  2H94 A;  4RB2 C;  1JHF A;  4NQW A;  2O3F A;  3BDD A;  4M71 A;  2PMU A;  4HBL A;  3QPT A;  2W24 A;  1U6G A;  3J80 K;  1YFH A;  4L0Y B;  1F1Z A;  3MZH A;  4L0Z B;  1ODD A;  1OPC A;  3MWM A;  4I01 A;  1H0M A;  2YX4 A;  3KP2 A;  2FNA A;  3ZMD A;  2GQQ A;  1TW3 A;  3WTZ A;  4JK1 X;  5HLH A;  3SQN A;  3VOD A;  5LGT A;  2EA2 A;  5F1R A;  5D5X B;  2HTJ A;  3TDU C;  2F5F A;  1BJA A;  3WTW C;  4M9S A;  2QBY A;  2B0L A;  2XAQ A;  2W84 A;  3IRQ A;  1BBY A;  4KFC A;  3MFK A;  3ERE D;  4KMU X;  4EM0 B;  4WXD A;  3Q9S A;  3F22 A;  2HYF A;  3WTV C;  2D45 A;  2H6C A;  4RB0 A;  1DPU A;  1ZG1 A;  1ZRF A;  3HSR A;  4HDV A;  4ETS A;  2XGX A;  3RPQ A;  3QP6 A;  2ESN A;  5H20 A;  1WQ2 A;  4L9T A;  3H92 A;  1MD0 A;  3I0T A;  1MGT A;  4PCQ A;  1HW1 A;  3TO9 A;  5LEJ A;  2WC2 A;  1CGP A;  1J5Y A;  1KYZ A;  1Z1D A;  3CUQ B;  4HV5 A;  2XIG A;  1LJ9 A;  3L00 A;  5ICE A;  3LST A;  3WE3 A;  4EJT A;  2XVC A;  4LB6 B;  2DPU A;  1ZG3 A;  2WWY A;  4WXH A;  4LLL A;  1HBX G;  2ETH A;  5K1Y A;  2V79 A;  1W7P D;  2V1X A;  2A69 F;  2ELH A;  1HST A;  5FFZ A;  3WGI A;  4OIN F;  4A0X A;  3EYY A;  3I58 A;  5LGN A;  1FZP B;  3KLN A;  4OOI A;  1SD6 A;  4I0A A;  4EM1 A;  1IXS B;  5BQT A;  5FLX Z;  3FXQ A;  5EEG A;  1IF1 A;  2M5W A;  2HGC A;  4EGZ A;  2ZCW A;  1YS6 A;  3GO5 A;  3ZMV A;  1VTN C;  3I54 A;  3SFZ A;  5BOX A;  2PLY A;  3V8L A;  4KIG A;  4R1H A;  1SD4 A;  1YTY A;  4RGS A;  4P5O A;  4G6D A;  4ENN A;  2DTR A;  4NHJ A;  1U5T C;  3DXJ F;  2XUB A;  3FWE A;  2FBK A;  2G7U A;  3V8K A;  3CLO A;  5E1W A;  1R58 A;  4LG0 A;  4UNO A;  2VON A;  4MHG A;  4OIO F;  5D6F A;  1V3F A;  2ZO4 A;  1WI9 A;  1YYV A;  4I09 A;  1U5T A;  3EQL F;  2VOP A;  4CO8 A;  3ZMZ A;  2HR3 A;  4B09 A;  1KU2 A;  2V1U A;  3NEU A;  4LG0 B;  4CHU A;  1MJB A;  2L4M A;  5FD5 A;  1MKM A;  3J7A O;  1ZYR F;  3JAM K;  3RTR A;  2MLK A;  2G7H A;  1TTY A;  3JTH A;  1K78 B;  1FYL A;  4N9I A;  1K79 A;  5IT3 A;  2CGP A;  3TKY A;  3CUO A;  2FBH A;  4Y13 A;  2VN2 A;  2FQ3 A;  3ZN1 A;  5TRD A;  2E7X A;  3G3Z A;  4AIH A;  1FYM A;  2OQG A;  1IRG A;  4KT5 C;  4ZZD A;  2P4W A;  3DFG A;  3OOP A;  2DW4 A;  4EJO A;  1L3L A;  2EWN A;  3V7S A;  1W4M A;  4I02 A;  1T0F A;  2Y75 A;  1O57 A;  1GHC A;  3ZMS A;  4HAM A;  4CGZ A;  1I5Z A;  3DQV C;  5J6X A;  5BPI A;  4L9J A;  3KE2 A;  4UHT A;  5CJ9 A;  2YSR A;  2M1B A;  3ZMT A;  2RDP A;  3HIF A;  1S8N A;  2QWW A;  2ADU A;  2CYY A;  4IXA A;  2JZY A;  1KU7 A;  2RQP A;  2STW A;  3C18 A;  5DUI A;  1ZRE A;  3WTT C;  2JT1 A;  3MZY A;  4RB3 C;  3FMR A;  2HTS A;  3TO7 A;  2YPR A;  2YX7 A;  1HXD A;  4L9N A;  4XLP F;  3M1E A;  3F8F A;  1P6R A;  3WU0 A;  3DPT A;  3R0J A;  3DV8 A;  4Q47 A;  1SFU A;  1UB9 A;  4AIJ A;  5AON A;  3WTU C;  4H0E A;  4N9H A;  3LQQ A;  4S05 A;  2QQB A;  2XAH A;  4LK1 F;  2ZKZ A;  1ZLK A;  3SHF A;  2FBI A;  5E20 A;  4CIC A;  3QOP A;  1LDJ A;  4UUV A;  2NS0 A;  4BXU A;  4YIF A;  2NYX A;  5L3G A;  2CSO A;  3IC7 A;  5LGU A;  2XAG A;  5JVT A;  4WCG A;  4ZH4 F;  4WX9 A;  4EGY A;  1SMY F;  4P9U A;  2JSC A;  3HRM A;  2PMH A;  3EDP A;  1BM9 A;  1RNL A;  2F2E A;  4GO1 A;  4I0B A;  1BIA A;  1O3S A;  3KP3 A;  5DD8 A;  4CZZ A;  5H6R A;  2P8T A;  4EVI A;  4M74 A;  2FRH A;  5HDK A;  2J5O A;  3KP4 A;  1R5H A;  4HYE A;  2LF8 A;  5K5O A;  4U7D A;  1RIO H;  3GYH X;  1KU9 A;  4MGR A;  4IHT A;  2PI0 A;  4I2O A;  4LD5 A;  2UZK A;  2HQR A;  4FX4 A;  3GUD A;  2Q0O A;  2D1H A;  3ECO A;  1I27 A;  1NHA A;  2CG4 A;  2K27 A;  4BAY A;  2VE8 A;  1FOK A;  2DAO A;  5HDN A;  2K7L A; 
#chains in the Genus database with same CATH topology
 2GOX B;  2IGM A;  1A5J A;  1IV8 A;  2X6Y A;  2JVH A;  2BYV E;  2FNP A;  3HYI A;  1POG A;  5GAH J;  3L09 A;  4ZJZ A;  3JRD A;  3WOD F;  4BQN A;  1QZZ A;  5FRN A;  3QYE A;  2EH3 A;  1EH6 A;  1NK2 P;  1K83 J;  4A2U A;  3KYL A;  3DBR B;  1BOB A;  3DF8 A;  3QU6 A;  4XN0 A;  3OS0 A;  1HKT A;  1FNN A;  5JVG F;  5HLI A;  2EQR A;  5E17 F;  2LY1 A;  2QA4 I;  2X1C A;  3JRA A;  4X1E A;  5F6F A;  2L01 A;  3ERM A;  3FF5 A;  1QRY A;  1IO2 A;  2EIM H;  4BXX J;  2FMY A;  1J9I A;  1ETV A;  3GBG A;  1QGP A;  1UCR A;  1DUX C;  3LAJ A;  3HC7 A;  3P9K A;  5EJC A;  2M0M A;  3HXL A;  3NQO A;  4I76 A;  3CES A;  1WJ5 A;  5J3L A;  2F4O B;  1GXP A;  2BE5 F;  2HDD A;  1V5F A;  3BTC A;  5B5E C;  1FTT A;  4ZDO A;  1SAU A;  3IH3 A;  4HZF A;  4CCK A;  2L02 A;  3BY6 A;  5K5R A;  5DYM A;  4P1W A;  5H6Q A;  4QTR A;  3FK6 A;  2VIX A;  2OTJ I;  2UUZ A;  4WF2 A;  2CRG A;  5AIQ A;  1N25 A;  3OIQ A;  3SDB A;  3U21 A;  2P7V B;  3K4N A;  1ONV A;  4MFD A;  4P96 A;  3S1R J;  3RI4 A;  1V5G A;  1ETQ A;  3KZZ A;  4XRF A;  1B72 B;  3L2V A;  5TGT A;  2FJ1 A;  3WTS C;  2NNY A;  4XOR A;  2HYG D;  3QWL A;  5HDG A;  3DTK A;  2PN6 A;  5B3S H;  1R22 A;  1MBJ A;  3GTG J;  2R7R A;  5GAG J;  2ISZ A;  2X1D A;  2BGC A;  1RKT A;  1T38 A;  2X85 A;  5FJ8 J;  2GBY A;  1OR7 A;  2LRE A;  2QEN A;  3AAF A;  4IZZ A;  3QYB A;  4PDK A;  4JX4 A;  2DBB A;  3E6D A;  5K7Z A;  4YEL A;  4HLY A;  3FXM A;  2DCE A;  3BR2 A;  1E3H A;  1Z6T A;  2X4H A;  1G3S A;  1XMK A;  3F6V A;  1HDP A;  2HZT A;  5ILS A;  5F1J A;  2LR8 A;  2KZG A;  4NB5 A;  2CV0 A;  3S2H J;  1SFK A;  2JSP A;  4B3A A;  1T95 A;  5LBQ A;  3ROU A;  4BGD A;  1TT5 B;  3T5X A;  1V5E A;  1I50 J;  1MJ9 A;  4KMF A;  1LEB A;  1F5T A;  2FEZ A;  3CO6 C;  1HQC A;  3ABL H;  3T1B A;  4GYI A;  1B4A A;  4JOM A;  3WE2 A;  5JHF A;  5C44 J;  2Z33 A;  4XID A;  2DDB A;  4XNF A;  1U8B A;  1Q1H A;  4RS8 A;  2K9S A;  3KIO A;  3HSF A;  3K69 A;  3PIO F;  5FO5 A;  1XGN A;  1TQM A;  2GZW A;  4HST A;  4UB6 C;  3G2B A;  4ZYH A;  3TP3 A;  2V9K A;  2GXB A;  1MZB A;  3GXO A;  1LB2 A;  4G6T B;  2MFZ A;  1W5S A;  2QQ9 A;  4FCY A;  5ICC A;  2FOW A;  1F36 A;  4GXO A;  2JPC A;  3EET A;  3WG9 A;  2K4B A;  3VSK A;  2COM A;  2LNB A;  5A2Q K;  3CLQ A;  1JKP C;  4KJZ A;  4D5C A;  5HLG A;  2NNN A;  5J8F A;  2CQQ A;  2VXZ A;  3J81 K;  2I10 A;  3CO7 C;  2TDX A;  1G3W A;  1GV2 A;  3ISP A;  4XSX F;  1T98 A;  1S6L A;  2AXL A;  2M9H A;  1UHS A;  1TNT A;  2CQ7 A;  1QHG A;  4IQJ A;  4QPQ A;  1YLF A;  1S3J A;  4A3F J;  2KPM A;  3CDI A;  2X6O A;  3DCF A;  3H35 A;  2L7F P;  2EIL H;  3R60 A;  2BEO A;  1YG2 A;  1SVM A;  2KIU A;  3RIR A;  2UWM A;  4BQO A;  3MVP A;  1XDU A;  5B1B H;  2XPU A;  2BY1 A;  5TJJ A;  3VEP A;  4NC7 A;  3KET A;  2VJJ A;  5EG0 B;  5IYC J;  3LSI A;  4G6Q A;  4BE2 A;  2R4G A;  2JA7 J;  1TWA J;  3BQZ A;  3FMQ A;  1C0W A;  5CVV A;  3V42 A;  4W97 A;  5L3C A;  2NRA C;  2XF7 A;  5E79 C;  2HOE A;  5FD6 A;  2K9Q A;  2O61 A;  3A0B C;  4N4O B;  2AXT C;  2XB5 A;  2O6G E;  3W2A A;  2OCC H;  3ZPL A;  3FMS A;  3GX4 X;  3KZY A;  4G12 A;  4HPQ A;  3H1C A;  4Y15 A;  4M9Z A;  2Q2E A;  1NG7 A;  3J7Y J;  4F7Z A;  2M34 A;  3A2K A;  3E7L A;  3OYK A;  4JBA A;  4RAZ A;  3C2H A;  2QCO A;  2XB0 X;  1WH7 A;  3I4P A;  5JHU A;  1OQY A;  4RA2 A;  3MKW B;  3DLL F;  3CJQ B;  3O3K A;  2JTV A;  5F0C A;  1KQ9 A;  1XGM A;  2E1O A;  5A2Q Z;  2DA2 A;  2L5Q A;  1Q1V A;  2G0E A;  2R3S A;  3LSG A;  3K2Z A;  2DT7 B;  3HB9 A;  2DQL A;  2ZJ2 A;  4KDP A;  5LEK A;  3OIP A;  3OV8 A;  3A01 A;  5FLX K;  1XX5 A;  3HOX J;  4M3F A;  2ID6 A;  3FXK A;  4D0P A;  1ENH A;  2F5E A;  2MD5 A;  2WAQ N;  3RQI A;  4HG2 A;  3G73 A;  3BJO A;  2NAZ A;  1FYK A;  1EH8 A;  3HHG A;  4E6K G;  2JUG A;  2K02 A;  2MLG A;  4A3E J;  3ZN0 A;  3A0H C;  1YRN A;  2FF4 A;  3V8J A;  3OR1 C;  4AID A;  4BKX A;  4KIS A;  4OMZ A;  4ON0 A;  3LWF A;  1EA3 A;  2L2O A;  4GGG A;  4B4C A;  2V7F A;  4XOP A;  1FP1 D;  3CJR B;  1FEX A;  3HSE A;  1N78 A;  1XGO A;  3JRH A;  4A3L J;  2J5P A;  3HRU A;  5E3L A;  4EV0 A;  3OYB A;  3WTY C;  1S7E A;  3FK7 A;  3VB2 A;  2DMU A;  1JUM A;  3PFY A;  2DI3 A;  2D5V A;  2W57 A;  2X51 A;  2KDZ A;  4BNC A;  4E70 A;  4PUS A;  3CCE I;  1VQM I;  2IVM A;  2LK2 A;  1VZ0 A;  3LA2 A;  4RGU A;  3HUG A;  1IGN A;  2OBP A;  4BYY A;  1CF7 B;  4ANJ A;  2GAU A;  4HQM A;  2LD5 A;  4O6J A;  4IX7 A;  1IV6 A;  3UKG A;  5FGM A;  5DCF A;  1IN4 A;  1XN7 A;  2IXS A;  4YII A;  4EAT A;  2R7U A;  4M6X A;  3FBN B;  2H8R A;  4AM3 A;  1LVK A;  4DQ2 A;  4DYQ A;  4XKC A;  1GT0 C;  4G8X A;  1N75 A;  1U0J A;  1BI2 A;  1SAN A;  2HS5 A;  3PSI A;  2VC0 A;  4FE7 A;  5D5V B;  4QLC U;  4G94 A;  2VXD A;  1XCB A;  2OQR A;  1QBJ A;  1K61 A;  3L2Q A;  1FY7 A;  1QA6 A;  2XAU A;  1AWC A;  4ZYD A;  1YW9 A;  3U1D A;  2AS5 F;  3QU3 A;  1T6S A;  2CW7 A;  4HNU A;  4BH9 A;  3D1N I;  1JJ6 C;  5CVR A;  1NK3 P;  1Z05 A;  2E2J J;  1OR7 C;  2XPV A;  3K6G A;  1H9T A;  3CQZ J;  3K4K A;  5K7H A;  2VKE A;  2MG4 A;  3QPS A;  3T0Y A;  1B9N A;  4HV6 A;  1KZH A;  4CCN A;  2H1L A;  3P7N A;  3R6S A;  4HF2 A;  2CWE A;  2WBM A;  4LLN A;  2JUC A;  1FX7 A;  1MIJ A;  3W6J B;  2P7C B;  5HNH A;  1VQK I;  4A3C J;  1BI0 A;  1Z77 A;  1ZK8 A;  3IUO A;  4IRI A;  2DA3 A;  1TP4 A;  2KIF A;  2IPQ X;  4GCV A;  3IKT A;  2OA4 A;  2KMU A;  1SFE A;  5CQG A;  2JA2 A;  3I53 A;  1YS7 A;  2VI6 A;  3F23 A;  3TDZ C;  2KIM A;  3IH4 A;  1WZ2 A;  4ZZL A;  1D8K A;  3P9I A;  3GVA A;  3LQR A;  2M7A A;  5KHD A;  2EFO A;  4DGW B;  3FZV A;  4NUB A;  1UHW A;  2HKO A;  3T8T A;  2FQ4 A;  1STZ A;  4KA4 A;  1BL0 A;  1D0Z A;  3IWF A;  2X6W A;  1VQL I;  3HTU A;  2LFB A;  1BR1 A;  4BDY A;  5M3F J;  3AFH A;  4WK8 F;  2VLA A;  2DYR H;  2MC4 A;  2L7K A;  2HKX A;  3QAH A;  1RR7 A;  5CYV A;  3K10 A;  4HW0 A;  3TQN A;  1WWX A;  1Z3Y A;  1A31 A;  2P5V A;  3S1N J;  3BG5 A;  3R61 A;  3RDI A;  5DCM B;  1J0R A;  3NWS A;  1YQA A;  3K9T A;  2R7Z J;  3EUH A;  3PFI A;  5HS9 A;  2DMT A;  5JLW A;  1HDD C;  2XKP A;  2GLO A;  1S72 I;  1TT0 A;  1Z3X A;  5D5U B;  1ETK A;  5C4X J;  3ULQ B;  2K5C A;  4MEY F;  4M3D A;  2LOO A;  2JQ7 A;  2IW5 A;  3I59 A;  3W3C A;  4FAS D;  1DU6 A;  3BG3 A;  3TBI A;  5DM7 F;  2KIS A;  2X1E A;  2LBF A;  2XAJ A;  3K0L A;  5B1A H;  1VQ5 I;  3ZQI A;  2E5N A;  2M30 A;  4OWR B;  2XAS A;  2CO5 A;  3H5R A;  3QYF A;  2DO7 A;  2ZXH A;  3OYM A;  3S17 J;  3GWZ A;  2IS4 A;  1ETO A;  4LGW A;  3OYF A;  4U7B A;  1JHH A;  5D4R A;  2FD5 A;  1WRJ A;  4G9Y A;  5ED4 A;  3BG9 A;  3E3V A;  4JP0 A;  1EV7 A;  2NVT J;  2PJP A;  5IP7 J;  1GVJ A;  1Y0N A;  3COA C;  2Y0S N;  3JR9 A;  4IQ4 A;  4C3H J;  3ZP5 A;  1QQI A;  2DOE A;  1OCZ H;  1Y6I A;  2OC6 A;  1WH5 A;  4OAY A;  1VQ9 I;  4UUT A;  1K78 A;  2BHY A;  2BVL A;  2JN6 A;  2KDO A;  1UHM A;  2KFD A;  4II3 A;  2ACJ A;  1TQI A;  5JFR A;  2MC3 A;  4D9J A;  2BW3 A;  1P9Q C;  2Q2E B;  3OYJ A;  3AG4 H;  3D5R C;  4UXN A;  5GPA A;  4S04 A;  3CJT B;  2QVO A;  3GLX A;  4NNJ A;  3TOB A;  3ZRG A;  1SMT A;  4OIP F;  4FT8 A;  5EEH A;  5HLT A;  1BOA A;  4KIB A;  1U8R A;  1UAA A;  1FJL A;  3HRT A;  3DTI A;  3E6C C;  4AYB A;  1DGR M;  1R1V A;  4BS9 A;  2IBD A;  2DA7 A;  1WPK A;  1SD5 A;  1VQ7 I;  4XOT A;  4UUS A;  2MAB A;  3NAU A;  5E3M A;  2HVR A;  3M3Y J;  4F91 B;  3FIS A;  3MCZ A;  1VFC A;  1P2F A;  2M45 A;  4BU2 A;  2W25 A;  2AQF A;  4CCJ A;  3F6O A;  1B1B A;  4WWC A;  2IA0 A;  3ZMU A;  2IP2 A;  1HW2 A;  1YE9 A;  4PZJ A;  2OTL I;  1LDK B;  2YU3 A;  4RLF A;  4GYG A;  4A0Y A;  1T56 A;  1X3Z B;  2QSF X;  1P7J A;  2JRT A;  4V19 K;  5KCM A;  4E7I A;  1W7P B;  3O6B B;  2DU9 A;  2HVQ A;  2H6B A;  1K6Y A;  2E34 A;  3ECH A;  4G7Z F;  2ZXJ A;  2M3A A;  2R5Y B;  2W7N A;  6PAX A;  2CFX A;  1UJ8 A;  3U2R A;  2YUS A;  4CCL A;  3CCS I;  3HKZ N;  4WXC A;  5HS8 A;  3VPR A;  2HOT A;  2XF6 A;  2DFI A;  1OLT A;  4XSZ F;  2MSY A;  1VQ8 I;  2H27 A;  3V4G A;  5GPC A;  2ICW G;  1YI2 I;  5IT9 K;  1ZH5 A;  3JRF A;  1JT0 A;  1VI0 A;  3KEY A;  3F8B A;  3DKW A;  5EGO A;  2W1O A;  2R7S A;  2CQK A;  5TIS C;  1K6O A;  3J7A Y;  3FM5 A;  1A35 A;  3K1M A;  1O3Q A;  2IJL A;  3E6M A;  2QLZ A;  4Q4Z F;  4XR6 A;  4CYC B;  4PJJ A;  2LVS A;  1WCM J;  3OMY A;  3OYI A;  2IRF G;  5FRO A;  3H0D A;  2BY3 A;  1S29 A;  4Y7N J;  4HEA 2;  1P7I A;  2HXO A;  1PVE A;  1X2N A;  2HFH A;  1GXQ A;  2EV6 A;  3E5Q A;  4ESJ A;  1HSJ A;  2EJR A;  4P55 A;  5BMZ A;  3Q9V A;  1YX5 A;  3GTP J;  1IW7 F;  2ZSI B;  3PNT A;  5F64 A;  3L2W A;  3IAS 2;  1Z67 A;  3ZQF A;  4XLE A;  1YX3 A;  2R7T A;  1S7A A;  3MMY B;  4V2G A;  2W4S A;  5AIP A;  5GTH C;  4FX0 A;  3ZOB A;  3LSK A;  2FUG 2;  2E71 A;  4IEJ A;  2R5Z B;  2DA6 A;  2IA2 A;  5HVQ C;  2MA3 A;  5B66 C;  2ISY A;  3U9G A;  1B59 A;  2HZD A;  4RM2 A;  4BEH B;  3HJE A;  5FKM A;  1XSX A;  1TWF J;  1Y56 A;  4XKV A;  4YRV A;  4B1R A;  1AKH B;  4C3J J;  1WJF A;  3HG9 A;  1UST A;  2W82 A;  2EZK A;  1CF7 A;  1T0F C;  5LRS A;  4CXF A;  2VB6 A;  3PNY A;  5CLS A;  2BBY A;  2EFQ A;  2HPM A;  3IRR A;  2MGQ A;  1J59 A;  1IN7 A;  2BZT A;  4MTD A;  1FSE A;  2VQL A;  2HPI A;  2MH2 A;  2BV6 A;  3MKL A;  1D3Y A;  1K7A A;  1E3O C;  1REP C;  2RAE A;  4HF1 A;  4PFO A;  4UY8 I;  4I7H A;  3CUQ A;  4MQV A;  3SZP A;  2Z3Y A;  4XLA A;  1MH3 A;  3RCO A;  1F4K A;  3GLL A;  3WGH A;  2EZH A;  3SZG A;  3L7W A;  5BS6 A;  1Z7L A;  3CJN A;  4J19 A;  4AD9 A;  2VKV A;  3M7G A;  2A05 A;  3JRC A;  2CS3 A;  5J4Y A;  2NVY J;  3WGG A;  3GEZ A;  3KP6 A;  3SDG A;  5M3M J;  2O03 A;  2FOK A;  2PJR B;  1DQU A;  2VAS A;  2K40 A;  3LAP A;  1YJN I;  5E18 F;  2VBZ A;  1Y8Q B;  5F0H A;  3I5U A;  2DK5 A;  3S2W A;  3F9K A;  2NS8 A;  2GA1 A;  1HCR A;  4M6Y A;  4V2F A;  1B8I A;  2P6S A;  4A3I J;  1P4W A;  4JQF A;  2KRC A;  3UR3 C;  4OIQ F;  1QHH D;  4P9F A;  1O3R A;  4EQQ A;  2XHK A;  1R23 A;  2IS6 A;  1X58 A;  2L7Z A;  3TOA A;  2XGE A;  1X19 A;  2V6E A;  3CUQ C;  1FPQ A;  1XSD A;  2RQQ A;  3LFU A;  1ZGJ A;  3AG3 H;  2ZNY A;  2RRE A;  4NQW B;  3S14 J;  4EJV A;  1U78 A;  1QVU A;  2M4K A;  3AL0 B;  2EK5 A;  4EJU A;  3DEU A;  1Y39 A;  1DPR A;  1XSV A;  2LC2 A;  2DJI A;  1X1P A;  4CCO A;  4YFK F;  2A6H F;  2FXA A;  2HNH A;  3ONQ A;  2XKO A;  1L0O C;  2MBF A;  4BY1 J;  1TW2 A;  4RGR A;  3F72 A;  4C9Y A;  3NRV A;  4RMN A;  2M87 A;  5F08 A;  1XD7 A;  1FWZ A;  2CUE A;  5L3F A;  1SAX A;  3BOQ A;  5EZH A;  3ZXS A;  1RUO A;  4ZTJ A;  2VT2 A;  2HDW A;  3GZN B;  2B7E A;  1W36 C;  2E1C A;  2VQG A;  3W6K B;  2DA5 A;  4XL9 A;  1S5L C;  2X6X A;  2O8X A;  4LJZ F;  2NS7 A;  5BPD A;  3JRE A;  3CP2 A;  3GZ5 A;  4RM3 A;  1TWC J;  4XN3 A;  1BC8 C;  3LSJ A;  3D5L A;  2RN7 A;  3E6B A;  4OIR F;  2X9D A;  3WHB A;  3HTS B;  2CUF A;  2OU2 A;  4NC6 A;  3BCB A;  4L5I A;  3HDD A;  2VKD A;  4XRS G;  4DBQ A;  2O5R A;  3K70 D;  3SEQ A;  5IOZ A;  3CP8 A;  3S15 J;  2EV5 A;  4L9V A;  3AKZ A;  3ZQH A;  2R5Z A;  1FLI A;  3N4M A;  2JWT A;  3BG7 A;  1MSF C;  3ELK A;  1BW6 A;  3PUB A;  4L5J A;  4MEX F;  1ZGA A;  1P4A A;  2Z16 A;  1MBH A;  2XV4 S;  1X1D A;  4OMY A;  5CVI A;  3AG2 H;  3IL2 A;  1A04 A;  1U5T B;  4I6Z A;  2P5L C;  3H3U A;  2UV1 A;  1IUY A;  4HNV A;  2R7W A;  4HF0 A;  4XLF A;  4IOC F;  2O7O A;  2VE9 A;  4B44 A;  1J75 A;  4HX8 A;  2A68 F;  1XB4 A;  2KRF A;  3BPX A;  2CUJ A;  1D5V A;  1NH3 A;  3BPV A;  1IJW C;  4RGX A;  3KP7 A;  2Y30 A;  3O8G A;  1XCV A;  4G7O F;  2I5U A;  2XSJ C;  1J7K A;  4C2M J;  3D5S C;  3GFI A;  2E2H J;  2L9S A;  1HA8 A;  4IOA F;  1JI8 A;  5LHH A;  3TW6 A;  3CF5 F;  2QSH X;  3QPH A;  1O7L A;  4KN4 X;  4UUS B;  2D2W A;  4F52 A;  1FOW A;  2VQC A;  4IRH A;  3LSP A;  1WGX A;  2DMN A;  2EIN H;  3JRG A;  1PJR A;  1V4R A;  1QNT A;  4LLG F;  4M73 A;  5L3D A;  3L2C A;  1SD7 A;  2Y9Y A;  3K7A J;  4E7J A;  4CUG A;  2LF7 A;  4ZYA A;  3EUH C;  4MFE A;  1Z7U A;  1G6N A;  4IHS A;  4ENJ A;  1QO0 D;  1TNS A;  1PYV A;  3CDH A;  2Y9Z A;  2ZFU A;  3DPL C;  4DIQ A;  4HQE A;  1G3T A;  2K3F A;  3ESW B;  2XC7 A;  3K2A A;  2NXN B;  2CH0 A;  3K1N A;  4IKF A;  1USS A;  2K4J A;  2WB1 N;  4Y17 A;  4A6E A;  1LPQ A;  4XLN F;  2VC1 A;  4UVC A;  1X4O A;  1W1W E;  3HM5 A;  1IZ1 A;  2JRM A;  1ZN2 A;  3F8M A;  2R7Q A;  2YR2 A;  3RKY A;  4B3X A;  1BR2 A;  4JX5 A;  1GV5 A;  1XGS A;  1FOX A;  5ERI A;  5E3O A;  3FDY A;  4YFN F;  3LMM A;  1FMV A;  4N4N B;  1R49 A;  2KZV A;  2AQE A;  3REO A;  5GAE J;  3ZCO A;  4BEH A;  2DK8 A;  4KIT B;  3LA7 A;  1YIJ I;  1VQP I;  1YW8 A;  4U0W A;  2WTE A;  2JA6 J;  3HEF A;  4XQF A;  1IAW A;  2W85 A;  1J09 A;  2W00 A;  1IRF A;  2EFP A;  4ZYG A;  2VJ4 A;  1OMI A;  1ZEL A;  1WJC A;  2JA5 J;  4O3M A;  4G7H F;  3ML6 A;  2HQ5 A;  4EM2 A;  1FBU A;  4S0H B;  2NOJ B;  4Y3O A;  4YEJ A;  3MAJ A;  1BA5 A;  4DNC A;  5KK1 A;  4X0G A;  2DA4 A;  3H9J A;  1LUJ B;  3F8N A;  5J1R A;  2ECB A;  2FA5 A;  4MTE A;  4YFX F;  2BXZ A;  2DFH A;  3RQ4 A;  1PP7 U;  3EYI A;  1LVA A;  1JKO C;  1YJ9 I;  2Y48 A;  2FSW A;  4UV8 A;  4AWX B;  1SFO J;  2D1V A;  3HPH A;  3HZJ A;  3HOV J;  3BRO A;  3Q0U A;  2E1M B;  4NDL A;  3RYP A;  1H8A C;  3FXO A;  3A1Y A;  1UG0 A;  4BE0 A;  4KYW A;  1F9N A;  1X1B A;  3Q3S A;  1T2K A;  3GFJ A;  4D7N A;  1B72 A;  3H9Q A;  5J47 A;  3D0S A;  3OYE A;  1XS9 A;  3M8E A;  5CPR B;  3RYR A;  1PP8 F;  1MNE A;  3ZQ7 A;  4CYD A;  3A01 B;  3I55 I;  1PUE E;  2NVX J;  3HOS A;  4OU0 A;  1OJL A;  3SZT A;  4IHV A;  1AOY A;  1WVR A;  2HQN A;  5FB2 A;  3FHZ A;  1KGS A;  2QUF A;  1LKX A;  3NWT A;  5E1Z B;  1P4X A;  2VOD A;  1OCT C;  1RRJ A;  1M1E B;  3I3L A;  4XKW A;  3FXR A;  4F3Q A;  2DPD A;  3DBL B;  5LRR A;  4RAF A;  3N05 A;  2CUZ A;  2M4G A;  4A5M A;  5DM6 F;  2IAI A;  3DWL E;  3S93 A;  1IDZ A;  1ETY A;  3GTM J;  1YHQ I;  3EUA A;  4M9X A;  4RAY A;  3OS2 A;  1I1S A;  1IXC A;  3E97 A;  4F92 B;  5EF6 A;  3JSO A;  1BI1 A;  2KJB A;  3I4M J;  1T08 B;  2V9P A;  3BR0 A;  3QQA A;  2XGD A;  3C2B A;  3OR2 C;  5FFX A;  3MQ0 A;  3LOC A;  1PDN C;  1G3Y A;  4DW6 A;  1UEL B;  4FTH A;  4MQ9 F;  1LQ1 A;  1H88 C;  2EB7 A;  3KP5 A;  2CV2 A;  4XBF A;  3J80 Z;  2XRO A;  1RET A;  2ZNZ A;  1RPW A;  2BY0 A;  5D5W B;  5LLQ A;  5E1X A;  2Z9O A;  3I64 A;  4U88 A;  4D5F A;  3H5A A;  3QRF F;  1YIO A;  2GXA A;  2X0L A;  3BZK A;  3EUK L;  4HA8 A;  1I1G A;  2CQX A;  4E4H A;  3QOD A;  1FP2 A;  3OSF A;  3O2P E;  3OIO A;  2K3P A;  1T39 A;  3WU2 C;  2DYS H;  3WU1 B;  3ABU A;  1BC7 C;  3HOW J;  3K4L A;  3HRS A;  1V54 H;  4Q48 A;  1IN5 A;  5DD4 A;  5K5Q A;  3PQJ A;  2VBX A;  1UFM A;  1KQ8 A;  2H09 A;  2A6E F;  3BP8 A;  2RGV A;  4A3B J;  4NC8 A;  2VT3 A;  5DS9 A;  3JRB A;  3GTK J;  5D4S A;  3BZ6 A;  5JLX A;  4BAC A;  3S3O A;  2WV0 A;  2DOF A;  3H9G A;  4TV7 A;  3VOE A;  4AYB N;  4QWQ A;  2V4J C;  4YG2 F;  2FML A;  3B6C A;  1SVO A;  5J8C A;  3DEE A;  3R0A A;  4U0V A;  2VUM J;  1MMG A;  1JGS A;  2V6C A;  1SC7 A;  1R5G A;  3IHU A;  3S8P A;  3HHH A;  4A69 C;  2ZME B;  1XDS A;  3ABM H;  4U0Y A;  4AIK A;  1EJ9 A;  5CQE A;  3DEW A;  1DU0 A;  1R4M B;  3QP5 A;  2C6Y A;  1PUF B;  4QSH A;  2DN0 A;  1D0X A;  5ILU A;  1Z21 A;  4ESF A;  2LDU A;  1Y1V J;  4RB1 A;  5FKN A;  4A5N A;  5HOO A;  4N0B A;  2CMP A;  4ESB A;  1ZG5 A;  4UVA A;  2VL8 A;  4BHC A;  1G2H A;  5DEQ A;  3OOU A;  4KN7 X;  4BE1 A;  3HPG A;  1RUN A;  1B6A A;  2ZME A;  2L54 A;  3M07 A;  1OFC X;  2HVS A;  3RSN A;  3KX2 A;  5HS7 A;  3OYN A;  3GME A;  1R9T J;  1JJ8 C;  1QPM A;  1R4N B;  1MSE C;  4BDZ A;  1LFB A;  4E7S A;  1W36 D;  5IYD J;  1DDN A;  2R7F A;  1IXR C;  3R4K A;  2K86 A;  4EJW A;  2DDA A;  3TGN A;  2Z99 A;  3JAM Z;  3E1S A;  4A6D A;  4XMY A;  2GOM A;  1JT6 A;  4I98 B;  2EA4 A;  1Y0U A;  2V9V A;  3KYC B;  3NAR A;  1I3A A;  2PFB A;  1RC9 A;  1ZHF A;  4HOB A;  2UXX A;  2JPB A;  4FHT A;  2NVQ J;  5DCM A;  4KNY A;  4BJT A;  2CU7 A;  1KQ0 A;  1WJD A;  1BN5 A;  1WI3 A;  4BQA A;  1QZY A;  2Z5U A;  3CDL A;  3OL4 A;  2E1N A;  1LE8 A;  1DP7 P;  3ZQL A;  3FIW A;  3F3X A;  1SFX A;  4UB8 C;  1ORK A;  3AL0 C;  1JXS A;  1G59 A;  2RV8 A;  2GM4 A;  1Z0X A;  5JR3 A;  3E5X A;  2G9W A;  3Q5F A;  1VQ6 I;  2LG4 A;  2XAF A;  2JK3 A;  3J81 Z;  2Z1D A;  2UXN A;  1RR8 C;  2LY9 A;  2OV7 A;  2ESH A;  5GAD J;  3MZ8 A;  5D8L B;  1G4D A;  3C3W A;  5EEA A;  1WJE A;  2KJC A;  3BQY A;  2RC4 A;  3M8J A;  1FMW A;  5IOY A;  3PNV A;  5IT9 Z;  2OUM A;  1XPX A;  2WY7 Q;  3A03 A;  2DLL A;  2OAZ A;  1BIB A;  5BNG A;  3BR6 A;  1LFU P;  1QVT A;  3IKV A;  2F6C A;  3JRI A;  1S7O A;  5DV5 A;  1E17 A;  3GTJ J;  2GIV A;  2EPF A;  5F0F A;  1D5Y A;  3V7R A;  3P5J A;  5EGO B;  5LHI A;  3W2W A;  1W5T A;  3LFK A;  4R8H A;  2BY2 A;  4MO7 A;  4LIV A;  2EFN A;  4ENM A;  2CW0 F;  2LKS A;  2IA1 A;  2GXG A;  1MJA A;  2PBI A;  3I71 A;  3LA3 A;  5E8G A;  4M3B A;  3GCM A;  5L3E A;  3LNQ A;  4C2T A;  1XMA A;  1OKR A;  5F04 A;  3M8F A;  4AVP A;  3P9C A;  2ECC A;  4Y52 J;  3CC2 I;  3CTA A;  1OCO H;  1BJZ A;  2L3D A;  2EV0 A;  3HUG B;  2DMP A;  1S9H A;  2L4A A;  4D7M A;  2ZXI A;  2O0Y A;  3W6V A;  2OZU A;  2IGO A;  1GLN A;  2HQA A;  1LEA A;  1I6X A;  2WY8 Q;  1RZ4 A;  3BWG A;  1ITY A;  1TWG J;  3M4O J;  2GA2 A;  3OY9 A;  1YJW I;  1ZRC A;  3TO6 A;  3F21 A;  1LNW A;  3K1P A;  1YO5 C;  2DT6 A;  4EMS A;  3B73 A;  1FBQ A;  5HOD A;  1KU3 A;  3CCV I;  2MH9 A;  1PUF A;  3OYA A;  2VPL A;  2DMQ A;  2XRN A;  2RNJ A;  2HOS A;  1KYW A;  5JI6 A;  1MND A;  1W0T A;  3KFW X;  4XRS A;  1Z6R A;  1X2M A;  2IS1 A;  3B6A A;  3RKW A;  5F27 A;  1RES A;  1R1T A;  5GP9 A;  2E19 A;  1OYI A;  3ZQQ A;  1UG2 A;  1IC8 A;  3RPU D;  1HLV A;  2ZFW A;  3KEO A;  2H8W A;  3VFZ A;  4LG3 A;  1P92 A;  2LRD A;  2HU9 A;  4PFP A;  4BJ5 C;  2E7W A;  3BTL A;  4HLX A;  4DOZ A;  3GF2 A;  2YU9 J;  4XLH A;  3PIP F;  1SEU A;  1BI3 A;  5E8I A;  4HRI A;  2GWR A;  3MD2 A;  5ICF A;  3V7C A;  1QPI A;  2FU4 A;  4MNU A;  3CCQ I;  1T8I A;  2XGC A;  4F93 B;  2QEX I;  4M6V A;  1UZC A;  3LSR A;  1RI7 A;  3KEQ A;  4DZJ A;  2P6T A;  2VOO A;  1ON2 A;  1X1A A;  1ZRD A;  4EEF G;  1ULY A;  2STT A;  1O7F A;  2PX9 A;  2KQR A;  4IVN A;  2BHZ A;  1J2X A;  2PG4 A;  4UVB A;  4AU7 A;  2F5D A;  3IH2 A;  2QYO A;  5J1U A;  4L5E A;  3IWZ A;  3VYS B;  1IN6 A;  2VBY A;  4LB5 A;  4ZDL A;  2QKL B;  2M8E A;  1FT9 A;  3C7J A;  3H3Z A;  2A6T A;  1WJB A;  2KL4 A;  1FC3 A;  1YW7 A;  4E7K A;  1R7J A;  2F5C A;  2PQ8 A;  2XF5 A;  4IRG A;  5CVJ A;  2DJN A;  3H5N A;  4HX7 A;  2E1M C;  3C2G A;  3G1L A;  1ZAR A;  4ASN A;  3IP4 B;  2EIJ H;  3H36 A;  3T8R A;  3RZD J;  2DXI A;  3RJP A;  1E0E A;  3GW2 A;  2ZME C;  5KVR A;  4K2E A;  4A0Z A;  3CME I;  2HXI A;  2WAQ A;  2QBY B;  4CH7 A;  1G8X A;  1VQN I;  2XSD C;  4KT6 A;  1TQP A;  2TCT A;  4KIF A;  2IS2 A;  1KA8 A;  2HEO A;  1ZAO A;  1ERD A;  4A12 A;  1FSH A;  3K4M A;  1ETW A;  3RKX A;  2QM3 A;  2HDC A;  3FKJ A;  2CFO A;  2QZ8 A;  2R7D A;  3DP7 A;  3FXU A;  2ZSH B;  1OCP A;  4LK0 F;  3ASO H;  3PL8 A;  1YOV B;  4IL6 C;  3HGG A;  2EZL A;  3BR3 A;  5IP9 J;  3TL4 X;  4H4K C;  3QOE A;  4PSW A;  2DQR A;  3CCL I;  4PGG A;  1WJA A;  3BLY A;  3OYD A;  1E2X A;  3E5U A;  3LSH A;  5LHG A;  5DUK A;  2A61 A;  4OAZ A;  3VYR B;  4DZP A;  2OD5 A;  1U2W A;  2LSO A;  1U9O A;  1FBS A;  2Q8K A;  2MW8 A;  3UNG C;  3JW4 A;  2OPT A;  1R1U A;  3CMY A;  2LKP A;  5H2F C;  4IHY A;  1TLH B;  1NG6 A;  2EFW A;  2KLO A;  2RKH A;  3JTG A;  2M0C A;  4C30 A;  1TC3 C;  1QU3 A;  4PGH A;  2XPW A;  1JE8 A;  1ON1 A;  5ILV A;  3N97 A;  3ABT A;  4E7Z A;  4ENK A;  2OZ6 A;  3I56 I;  1HKQ A;  2DOD A;  1HF0 A;  3I59 B;  4ZYE A;  4FIS A;  1A6I A;  4LOC A;  3BR5 A;  3MEX A;  2JMW A;  4GRI A;  1W7P A;  4ZDP A;  2H1K A;  5EG0 A;  1O4X A;  2WB1 A;  1R36 A;  2FE3 A;  2R7X A;  1HW5 A;  1MDM B;  4L18 B;  2KKO A;  1CQT A;  2V1D A;  2EZI A;  4Z2Y A;  1Y8R B;  1ZLJ A;  4B48 A;  2P5K A;  3KCC A;  5D8K B;  1EH7 A;  5FRM A;  2R7V A;  3VSL A;  1U3E M;  3FM3 A;  3K4J A;  1SVL A;  2QQA A;  1E3P A;  4O5V A;  4BHP A;  2IT0 A;  5M5Y J;  3HOU J;  4IF4 A;  4AC0 A;  1WKM A;  1TBX A;  5CVU A;  2ELJ A;  3B02 A;  4HX4 A;  2W48 A;  3ABK H;  1MDM A;  3GTQ J;  1I6H J;  4UV9 A;  4KIC A;  2MD0 A;  1OYY A;  1ETX A;  3LSM A;  5KAI C;  1Z9C A;  5DTD A;  2R92 J;  3HOT A;  2HWV A;  1IN8 A;  3PSF A;  5L3B A;  3C1D A;  1WSU A;  1R00 A;  3DKY A;  3DU6 A;  2A07 F;  4IJA A;  3FX3 A;  3CCJ I;  2LTP A;  1X4P A;  3ZR8 X;  3J7Z I;  3GFM A;  1LDD A;  2RVC A;  1X3U A;  3VDX A;  2CJJ A;  3WTX C;  1H9G A;  3VYU B;  3CZ6 A;  4CDG A;  3GTL J;  2DT5 A;  3BJ6 A;  3BJA A;  4B8X A;  3G1M A;  4R79 A;  1Z91 A;  3KLO A;  3H0G J;  1ZQ3 P;  3PQK A;  1GDT A;  1GVD A;  2DFE A;  3RPU A;  4BHB A;  1DGW Y;  1JUP A;  2QQ8 A;  1TL8 A;  1YRN B;  4A3G J;  3GFL A;  3JSP A;  2A5Y B;  1EF4 A;  2VBW A;  3KZI C;  3L9F A;  4LMY A;  2K85 A;  2PEX A;  3K4B A;  4M72 A;  5DDG A;  3MKZ A;  1ZKG A;  1VQ4 I;  3RZO J;  1D8J A;  1IUF A;  3E0J B;  4PSX A;  4XIC A;  1OYW A;  4LFU A;  2NVU B;  3M1C A;  4HNT A;  2Y69 H;  5D6E A;  1BR4 A;  2ZBK A;  1O3T A;  2M7B A;  4RBO A;  3M9A A;  2K9M A;  3OYC A;  4HDU A;  2EIK H;  2NOG A;  1AKH A;  3DKX A;  1HKS A;  3O8H A;  2A3S A;  3SXY A;  1JKQ C;  4IPA A;  5ICG A;  3F8C A;  2PMZ A;  3GZ6 A;  4ZTF A;  2F48 A;  4Q5S F;  2Y0M A;  4KUM A;  4JYK A;  2VJI A;  1B9M A;  2YS9 A;  2H94 A;  4RB2 C;  1YIT I;  1JHF A;  4ABZ A;  4NQW A;  4A93 J;  2DOA A;  2O3F A;  3BDD A;  2KIQ A;  4M71 A;  4XM3 A;  2PMU A;  2COB A;  3LL7 A;  4HBL A;  2Q1Z B;  2L9R A;  2ME0 A;  3QPT A;  2W24 A;  1U6G A;  3J80 K;  1YFH A;  3BZC A;  2Z2S B;  4L0Y B;  5FKK A;  3S3N A;  1F1Z A;  3OSG A;  2F4I A;  3MZH A;  1X1C A;  4L0Z B;  1ODD A;  2R5Y A;  1OPC A;  1K4S A;  3MWM A;  4I01 A;  3PO3 J;  1H0M A;  2FX0 A;  4M3G A;  1LE8 B;  5IPA A;  2YX4 A;  4BBR J;  3PO2 J;  3KP2 A;  2FNA A;  5EYR A;  3ZMD A;  2LYC A;  2GQQ A;  1NTC A;  1TW3 A;  3WTZ A;  4BBS J;  4JK1 X;  1APL C;  5HLH A;  3SQN A;  3VOD A;  5LGT A;  1JGG A;  2LMD A;  3BTI A;  2EA2 A;  5F1R A;  5D5X B;  1MBG A;  2HTJ A;  4Z6Y A;  3H3V K;  3TDU C;  2A5W A;  2F5F A;  1BJA A;  1IRX A;  4DYR A;  2LP0 A;  1IRZ A;  3CF2 A;  3WTW C;  4M9S A;  2QBY A;  2B0L A;  4J00 A;  4XRM A;  2XAQ A;  1XTA A;  5J1Y A;  5KAF C;  2W84 A;  3IRQ A;  1BBY A;  3FHN A;  4KFC A;  3MFK A;  3ERE D;  4KMU X;  3WHC A;  4EM0 B;  5GTI C;  2BW3 B;  4WXD A;  2QF7 A;  5J40 A;  3HKZ A;  3Q9S A;  3F22 A;  2R0Q C;  4HSR A;  2HYF A;  4B43 A;  2LLK A;  3HBL A;  3WTV C;  2KHM A;  3HOY J;  2D45 A;  3CMM A;  4XON A;  1VND A;  2H6C A;  2E60 A;  4RB0 A;  1DPU A;  1ZG1 A;  3L2U A;  2ZJQ F;  1ZRF A;  3S32 A;  3HSR A;  3DTE A;  1X3W B;  4HDV A;  1JTY A;  3G1O A;  4ETS A;  2XGX A;  3RPQ A;  3QP6 A;  3PM1 A;  1R71 A;  2ESN A;  4BUP A;  1FIA A;  5H20 A;  1D0Y A;  3BC8 A;  2JJ7 A;  2OF7 A;  4CYC A;  3OWT A;  1WQ2 A;  4L9T A;  3H92 A;  5C3E J;  4DYC A;  2LBF B;  3DBH B;  1MD0 A;  1HOM A;  3I0T A;  1MGT A;  4PCQ A;  2IEK A;  1HW1 A;  4BY7 J;  5FKO A;  3TO9 A;  4F55 A;  5EZG A;  5LEJ A;  3BR1 A;  2ZXW H;  3G6E I;  2AO9 A;  2WC2 A;  3L1P A;  1CGP A;  1J5Y A;  2L0K A;  1KYZ A;  1IG7 A;  1Z1D A;  3CUQ B;  4HV5 A;  2XIG A;  3K70 C;  1OCR H;  1LJ9 A;  2E35 A;  3L00 A;  5ICE A;  2DTZ A;  3LST A;  1N77 A;  3WE3 A;  3W2V A;  4EJT A;  3ASN H;  3FBI B;  2R93 J;  2XVC A;  4LB6 B;  1D1A A;  2DPU A;  2O8K A;  1T33 A;  1ZG3 A;  2WWY A;  4WXH A;  1MBK A;  1TZL A;  2QGU A;  4LLL A;  1HBX G;  4E7H A;  2VJ5 A;  2WAD A;  2ETH A;  5K1Y A;  2V79 A;  4A3M J;  1W7P D;  2RNG A;  4LIT A;  4D1Q A;  2V1X A;  2ELK A;  3BT9 A;  3WG7 H;  3F0C A;  1UMQ A;  2A69 F;  3TED A;  2IGK A;  3ZQC A;  2ELH A;  1HST A;  5FFZ A;  4IHX A;  3WGI A;  4OIN F;  4A0X A;  3EYY A;  3I58 A;  3S1Q J;  1D1C A;  5LGN A;  1H89 C;  1FZP B;  2JVG A;  3KLN A;  4AUX A;  4OOI A;  1SD6 A;  2WV1 A;  4I0A A;  3SYT A;  4EM1 A;  4XK4 A;  1IXS B;  5BQT A;  1VQO I;  5FLX Z;  2MYS A;  3DLA A;  3FXQ A;  4X6A J;  5EEG A;  4YIR X;  4FQG A;  2OJE D;  2PJR A;  1FOY A;  1W5C C;  4BL0 B;  1IF1 A;  2M5W A;  2ID3 A;  1Y1W J;  2HGC A;  3KPH A;  4EGZ A;  2ZCW A;  3CC7 I;  1YS6 A;  3GO5 A;  3ZMV A;  1VTN C;  3I54 A;  3SFZ A;  4IO9 F;  3X2Q H;  2K9L A;  5BOX A;  2B63 J;  2PLY A;  3V8L A;  4KIG A;  2F5V A;  4R1H A;  4Y4R A;  1SD4 A;  3S3M A;  3A02 A;  3QPL A;  1YTY A;  4BXF A;  1ZR2 A;  4GDF A;  4RGS A;  3DU5 A;  4P5O A;  4G6D A;  4ENN A;  1XG1 A;  2DTR A;  4XKB A;  4NHJ A;  4DBR A;  1F43 A;  1MW7 A;  1U5T C;  4CSW A;  5E3N A;  2CV1 A;  3DXJ F;  4LIU A;  2M8G X;  2KRH A;  1MNM C;  2XUB A;  3FWE A;  2O9L A;  2AHQ A;  2FBK A;  3L2R A;  2G7U A;  2L7M P;  4CZC A;  2ME6 A;  3V8K A;  5FLV A;  1AHD P;  3CLO A;  5E1W A;  4I99 C;  4IHW A;  1R58 A;  3BG6 A;  2E36 A;  5EDN A;  1A36 A;  4LG0 A;  4UNO A;  2VON A;  4MHG A;  4OIO F;  2CQN A;  5D6F A;  3CMA I;  3CD6 I;  1V3F A;  2ZJP F;  3CC4 I;  1D1B A;  5LD2 C;  2ZO4 A;  1B8I B;  2GIZ A;  1WI9 A;  1YYV A;  4I09 A;  1KON A;  3MKY B;  5C4J J;  4QPO A;  1U5T A;  3EQL F;  2VOP A;  4CO8 A;  3ZMZ A;  3G4S I;  3OL3 A;  2HR3 A;  2BXY A;  4B09 A;  3OYH A;  1KU2 A;  5LFA A;  4M3E A;  2V1U A;  2K9N A;  3NEU A;  3MN2 A;  2TRT A;  5IYB J;  4LG0 B;  1IDY A;  4CHU A;  1MJB A;  2L4M A;  5FD5 A;  1MKM A;  3J7A O;  1ZYR F;  2BVM A;  1W0U A;  1U9N A;  4RDU A;  2VQH A;  3JAM K;  3RTR A;  2MLK A;  2HI3 A;  2X48 A;  2G7H A;  1TTY A;  3JTH A;  1K78 B;  3IAM 2;  1FYL A;  3U1K A;  4N9I A;  3EPZ A;  3OYL A;  1K79 A;  5IT3 A;  3I9V 2;  3K4C A;  4MIM A;  3TKY A;  1WFX A;  3CUO A;  3ZQG A;  2CGP A;  1OIS A;  1I3Q J;  2FBH A;  4Y13 A;  2VN2 A;  1XMX A;  2I8D A;  2FQ3 A;  3ZN1 A;  1EKE A;  5TRD A;  4NBQ A;  2E7X A;  1R5I D;  3G3Z A;  4GFB A;  4AIH A;  1FYM A;  3TP0 A;  2OQG A;  1IRG A;  4A3K J;  4KT5 C;  4PK4 A;  4ZZD A;  2N8G A;  2P4W A;  2KT0 A;  3IV5 A;  3DFG A;  3HOZ J;  3KYD B;  3OOP A;  2BOL A;  2DW4 A;  4EJO A;  2B9S A;  1L3L A;  2EWN A;  3V7S A;  1W4M A;  2OCE A;  3FKI J;  4I02 A;  4ITV A;  2V1N A;  3TW7 A;  1T0F A;  2Y75 A;  2EBI A;  1O57 A;  1GHC A;  3ZMS A;  4HAM A;  3GTO J;  4CGZ A;  1I5Z A;  2LY2 A;  3DQV C;  5J6X A;  4E7L A;  5BPI A;  2E5Z A;  1LFP A;  3I4N J;  4L9J A;  3KE2 A;  4UHT A;  3FXJ A;  5CJ9 A;  2YSR A;  1ZR4 A;  1V55 H;  2M1B A;  4BQQ A;  1HC8 A;  3ZMT A;  2RDP A;  3PJR A;  4J01 A;  2E2I J;  2LH9 A;  3HIF A;  1S8N A;  1FIP A;  1WHU A;  2QWW A;  1MMS A;  1VF9 A;  2ADU A;  3JCU C;  4C3I J;  2CYY A;  4IXA A;  2JZY A;  1BW5 A;  4U87 A;  1KU7 A;  2CW8 A;  2P81 A;  1MBE A;  2RQP A;  2STW A;  3C18 A;  4QIW N;  5DUI A;  1ZRE A;  3WTT C;  2JT1 A;  3MZY A;  4RB3 C;  3FMR A;  2HTS A;  1AU7 A;  2KP6 A;  2XDV A;  4CCM A;  5FKL A;  1JKR C;  4XLC A;  1DP3 A;  3AG1 H;  1RKW A;  3TO7 A;  2R7O A;  3A4C A;  5M5X J;  2F4M B;  2YPR A;  4A3J J;  2YX7 A;  3S1M J;  4PJ0 C;  4CA0 A;  1HXD A;  4L9N A;  3TMO A;  4XLP F;  1JUS A;  3M1E A;  3F8F A;  1P6R A;  3WU0 A;  4ZC3 A;  3DPT A;  3R0J A;  1MMD A;  3DV8 A;  4Q47 A;  1SFU A;  3OYG A;  1UB9 A;  3CCY A;  5AON A;  4AIJ A;  2Y2Z A;  3WTU C;  3HGY A;  3CCU I;  1QZE A;  4PJL A;  4H0E A;  4N9H A;  2L9V A;  3LQQ A;  2QQB A;  2XAH A;  4S05 A;  4LK1 F;  2ZKZ A;  2WAE A;  1ZGW A;  1I39 A;  1ZLK A;  3G71 I;  3SHF A;  3Q0V A;  2Y31 A;  4B47 A;  2FBI A;  2JA8 J;  3OS1 A;  4FE4 A;  5E20 A;  3VWB A;  4CIC A;  3QOP A;  1LDJ A;  5J4V A;  4UUV A;  1ACI A;  2NS0 A;  4Y33 A;  4BXU A;  4YIF A;  4MLO A;  1MMA A;  2DA1 A;  1OCC H;  3CCR I;  3BTJ A;  2NYX A;  5CKT A;  5L3G A;  1AA7 A;  1TWH J;  2CSO A;  3IC7 A;  5LGU A;  3CCM I;  2XAG A;  3DPU A;  1MBF A;  4W1U A;  5JVT A;  3S16 J;  2ZJR F;  4RLQ A;  5M5W J;  4WCG A;  4ZH4 F;  1MH4 A;  4WX9 A;  4EGY A;  1SMY F;  3HL2 A;  1FTZ A;  2Y0S A;  2M2E A;  4P9U A;  2JSC A;  3HRM A;  2PMH A;  3EDP A;  3S2D J;  1BM9 A;  1MMN A;  1RNL A;  2F2E A;  2V26 A;  2LKX A;  4GO1 A;  4PJM A;  4I0B A;  3BCA A;  1BIA A;  3FXL A;  1O3S A;  3KP3 A;  5DD8 A;  4BJ6 C;  3Q0W A;  3ZGK A;  4DJA A;  1R6R A;  2HYJ A;  4CZZ A;  1K4T A;  2QSG X;  5H6R A;  2P8T A;  2L9N A;  4EVI A;  4C2U A;  3VYT B;  4M74 A;  2QKM B;  4JX6 A;  2FRH A;  5IY5 H;  5HDK A;  5KNL A;  2ZB9 A;  2DFF A;  2J5O A;  3KP4 A;  1R5H A;  4HYE A;  2LF8 A;  2WA0 A;  5K5O A;  4U7D A;  1RIO H;  3GYH X;  4RAG A;  1KU9 A;  3SJM A;  4MGR A;  2IGN A;  1JTX A;  4IHT A;  2WAF A;  4II2 A;  5IP6 A;  2HOA A;  2PI0 A;  1A6Q A;  4I2O A;  5HNF A;  4AVZ A;  4LD5 A;  2UZK A;  4FET A;  4PJN A;  2HQR A;  9ANT A;  2PMZ N;  1XC5 A;  2XRL A;  3SFI A;  5FLM J;  4FX4 A;  3GUD A;  2Q0O A;  2D1H A;  3ECO A;  1I27 A;  2ZC2 A;  3SEZ A;  1NHA A;  2CG4 A;  5K7F A;  2VPR A;  1GUU A;  2K27 A;  2P0W A;  2VKH A;  4BAY A;  2VE8 A;  3RKQ A;  1FOK A;  2DAO A;  5HDN A;  4A3D J;  1ZTR A;  3PUF A;  2K7L A; 
#chains in the Genus database with same CATH homology
 2BYV E;  2FNP A;  3HYI A;  3L09 A;  3WOD F;  1QZZ A;  1EH6 A;  4A2U A;  3DF8 A;  3QU6 A;  1HKT A;  1FNN A;  5HLI A;  5E17 F;  5F6F A;  2L01 A;  3FF5 A;  2FMY A;  1J9I A;  1QGP A;  1UCR A;  1DUX C;  3LAJ A;  3P9K A;  3NQO A;  1GXP A;  2BE5 F;  4HZF A;  2L02 A;  3BY6 A;  5K5R A;  5DYM A;  5H6Q A;  4WF2 A;  5AIQ A;  2P7V B;  1ONV A;  4P96 A;  3RI4 A;  3KZZ A;  4XRF A;  3WTS C;  2NNY A;  2HYG D;  5HDG A;  2PN6 A;  1R22 A;  2ISZ A;  2BGC A;  1T38 A;  1OR7 A;  2QEN A;  3AAF A;  4PDK A;  2DBB A;  3E6D A;  4HLY A;  1Z6T A;  2X4H A;  1G3S A;  1XMK A;  3F6V A;  2HZT A;  5ILS A;  4NB5 A;  5LBQ A;  3ROU A;  3T5X A;  1MJ9 A;  4KMF A;  1LEB A;  1F5T A;  2FEZ A;  3CO6 C;  1HQC A;  3T1B A;  4GYI A;  1B4A A;  3WE2 A;  2Z33 A;  1Q1H A;  4RS8 A;  3HSF A;  3K69 A;  5FO5 A;  1XGN A;  1TQM A;  2GZW A;  4ZYH A;  2GXB A;  1MZB A;  3GXO A;  1LB2 A;  1W5S A;  2QQ9 A;  5ICC A;  4GXO A;  2JPC A;  3EET A;  3WG9 A;  2K4B A;  2COM A;  2LNB A;  5A2Q K;  5HLG A;  2NNN A;  5J8F A;  2VXZ A;  3J81 K;  3CO7 C;  2TDX A;  1G3W A;  4XSX F;  3ISP A;  1T98 A;  1S6L A;  2AXL A;  1TNT A;  1YLF A;  1S3J A;  3R60 A;  2BEO A;  1YG2 A;  2KIU A;  3RIR A;  2UWM A;  3VEP A;  1XDU A;  5TJJ A;  3KET A;  4G6Q A;  3FMQ A;  1C0W A;  5CVV A;  5L3C A;  2NRA C;  2HOE A;  5FD6 A;  2O61 A;  2O6G E;  3ZPL A;  3FMS A;  3GX4 X;  3KZY A;  4Y15 A;  4M9Z A;  2Q2E A;  4F7Z A;  4JBA A;  4RAZ A;  3I4P A;  5JHU A;  3O3K A;  2JTV A;  1KQ9 A;  1XGM A;  5A2Q Z;  2R3S A;  3K2Z A;  2DQL A;  2ZJ2 A;  4KDP A;  5LEK A;  3OV8 A;  5FLX K;  4D0P A;  2F5E A;  2MD5 A;  3G73 A;  3BJO A;  2NAZ A;  1FYK A;  1EH8 A;  3HHG A;  2MLG A;  2K02 A;  3ZN0 A;  2FF4 A;  3V8J A;  4OMZ A;  4ON0 A;  3LWF A;  4GGG A;  1FP1 D;  3HSE A;  1XGO A;  2J5P A;  3HRU A;  4EV0 A;  3WTY C;  3VB2 A;  2DI3 A;  2W57 A;  4BNC A;  4E70 A;  2IVM A;  3LA2 A;  4RGU A;  3HUG A;  2OBP A;  4BYY A;  1CF7 B;  2GAU A;  4HQM A;  4O6J A;  5FGM A;  5DCF A;  1IN4 A;  1XN7 A;  4YII A;  4M6X A;  4DQ2 A;  4G8X A;  1BI2 A;  2HS5 A;  2VC0 A;  5D5V B;  4QLC U;  4G94 A;  1XCB A;  2OQR A;  1QBJ A;  1FY7 A;  1AWC A;  4ZYD A;  1YW9 A;  3U1D A;  2AS5 F;  3QU3 A;  1T6S A;  4BH9 A;  5CVR A;  1Z05 A;  1H9T A;  3T0Y A;  1B9N A;  4HV6 A;  3P7N A;  3R6S A;  4HF2 A;  2CWE A;  4LLN A;  1FX7 A;  3W6J B;  2P7C B;  1BI0 A;  4IRI A;  2KIF A;  2IPQ X;  4GCV A;  3IKT A;  2OA4 A;  1SFE A;  3I53 A;  1YS7 A;  3F23 A;  3TDZ C;  2KIM A;  4ZZL A;  1D8K A;  3P9I A;  3GVA A;  3LQR A;  2EFO A;  3FZV A;  1UHW A;  2HKO A;  3T8T A;  1STZ A;  4KA4 A;  3IWF A;  3HTU A;  4WK8 F;  2HKX A;  3QAH A;  5CYV A;  4HW0 A;  3TQN A;  1WWX A;  2P5V A;  3R61 A;  3RDI A;  5DCM B;  1J0R A;  1YQA A;  3K9T A;  3EUH A;  3PFI A;  5HS9 A;  2XKP A;  5D5U B;  3ULQ B;  4MEY F;  2IW5 A;  3I59 A;  2XAJ A;  3K0L A;  2M30 A;  2XAS A;  2CO5 A;  2DO7 A;  3GWZ A;  4LGW A;  4U7B A;  1JHH A;  5D4R A;  1WRJ A;  4G9Y A;  5ED4 A;  3E3V A;  1EV7 A;  2PJP A;  1GVJ A;  3COA C;  3ZP5 A;  1QQI A;  1K78 A;  1UHM A;  2ACJ A;  1TQI A;  5JFR A;  2MC3 A;  4UXN A;  4S04 A;  2QVO A;  3GLX A;  3TOB A;  1SMT A;  4OIP F;  4FT8 A;  5EEH A;  1BOA A;  4KIB A;  1U8R A;  3HRT A;  3E6C C;  1R1V A;  1SD5 A;  3MCZ A;  1P2F A;  2M45 A;  2W25 A;  3F6O A;  1B1B A;  4WWC A;  2IA0 A;  3ZMU A;  2IP2 A;  1HW2 A;  4PZJ A;  1LDK B;  2YU3 A;  4GYG A;  4A0Y A;  2JRT A;  1W7P B;  3O6B B;  2DU9 A;  2H6B A;  3ECH A;  4G7Z F;  2ZXJ A;  6PAX A;  2CFX A;  3U2R A;  4WXC A;  5HS8 A;  2DFI A;  4XSZ F;  2H27 A;  3V4G A;  5IT9 K;  1ZH5 A;  3F8B A;  3DKW A;  2CQK A;  1K6O A;  3FM5 A;  3K1M A;  1O3Q A;  2IJL A;  3E6M A;  2QLZ A;  4Q4Z F;  2IRF G;  1S29 A;  2HFH A;  1GXQ A;  2EV6 A;  3E5Q A;  4ESJ A;  1HSJ A;  2EJR A;  4P55 A;  5BMZ A;  3Q9V A;  1IW7 F;  5F64 A;  1S7A A;  5AIP A;  4FX0 A;  2IA2 A;  5HVQ C;  2MA3 A;  2ISY A;  3U9G A;  1B59 A;  1XSX A;  1UST A;  1CF7 A;  5LRS A;  4CXF A;  5CLS A;  2BBY A;  2EFQ A;  3IRR A;  1J59 A;  1IN7 A;  4MTD A;  1FSE A;  2MH2 A;  2BV6 A;  1K7A A;  1D3Y A;  1REP C;  4HF1 A;  4I7H A;  3CUQ A;  4MQV A;  3SZP A;  2Z3Y A;  1F4K A;  3WGH A;  3L7W A;  5BS6 A;  3CJN A;  4AD9 A;  3M7G A;  3WGG A;  3GEZ A;  3KP6 A;  2O03 A;  2FOK A;  3LAP A;  5E18 F;  2VBZ A;  3I5U A;  2DK5 A;  3S2W A;  2GA1 A;  4M6Y A;  2P6S A;  1P4W A;  4JQF A;  4OIQ F;  4P9F A;  1O3R A;  4EQQ A;  2XHK A;  1R23 A;  3TOA A;  3CUQ C;  1FPQ A;  1XSD A;  1ZGJ A;  2ZNY A;  4EJV A;  1U78 A;  2EK5 A;  4EJU A;  3DEU A;  1DPR A;  1XSV A;  4YFK F;  2A6H F;  2FXA A;  2XKO A;  1L0O C;  2MBF A;  1TW2 A;  4RGR A;  3F72 A;  3NRV A;  2M87 A;  1XD7 A;  1FWZ A;  5L3F A;  1SAX A;  3BOQ A;  1RUO A;  2VT2 A;  2E1C A;  3W6K B;  5BPD A;  2O8X A;  4LJZ F;  3GZ5 A;  1BC8 C;  3D5L A;  2RN7 A;  3E6B A;  4OIR F;  3HTS B;  2OU2 A;  4L5I A;  2EV5 A;  4L9V A;  1FLI A;  3N4M A;  3ELK A;  4L5J A;  4MEX F;  1ZGA A;  1P4A A;  2XV4 S;  4OMY A;  5CVI A;  3IL2 A;  1A04 A;  1U5T B;  2P5L C;  3H3U A;  1IUY A;  4HF0 A;  1J75 A;  2VE9 A;  4HX8 A;  2A68 F;  1XB4 A;  2KRF A;  3BPX A;  1D5V A;  3BPV A;  4RGX A;  3KP7 A;  1XCV A;  4G7O F;  1J7K A;  3GFI A;  5LHH A;  3QPH A;  1O7L A;  4KN4 X;  2D2W A;  4IRH A;  1V4R A;  1QNT A;  4LLG F;  4M73 A;  5L3D A;  3L2C A;  1SD7 A;  2LF7 A;  1Z7U A;  1G6N A;  4IHS A;  4ENJ A;  1QO0 D;  1TNS A;  3CDH A;  3DPL C;  4HQE A;  1G3T A;  3K1N A;  1USS A;  2K4J A;  4Y17 A;  4A6E A;  4XLN F;  2VC1 A;  4UVC A;  1IZ1 A;  1ZN2 A;  3F8M A;  2YR2 A;  3RKY A;  1XGS A;  5ERI A;  4YFN F;  3REO A;  2DK8 A;  3LA7 A;  1YW8 A;  4U0W A;  2WTE A;  1IAW A;  2W85 A;  1IRF A;  2EFP A;  4ZYG A;  1OMI A;  4O3M A;  4G7H F;  3ML6 A;  4EM2 A;  1FBU A;  3MAJ A;  4DNC A;  5KK1 A;  3F8N A;  2FA5 A;  4MTE A;  4YFX F;  1PP7 U;  3EYI A;  1LVA A;  2Y48 A;  2FSW A;  4UV8 A;  4AWX B;  2D1V A;  3BRO A;  3RYP A;  4KYW A;  1F9N A;  1T2K A;  3GFJ A;  3D0S A;  3M8E A;  3RYR A;  1PP8 F;  3ZQ7 A;  4CYD A;  1PUE E;  3HOS A;  4OU0 A;  3SZT A;  1AOY A;  2HQN A;  5FB2 A;  3FHZ A;  1KGS A;  5E1Z B;  2QUF A;  2VOD A;  1P4X A;  3FXR A;  2DPD A;  5LRR A;  4A5M A;  4M9X A;  4RAY A;  1I1S A;  1IXC A;  3E97 A;  3JSO A;  1BI1 A;  2KJB A;  5FFX A;  3MQ0 A;  1PDN C;  1G3Y A;  4MQ9 F;  1LQ1 A;  2EB7 A;  3KP5 A;  4XBF A;  3J80 Z;  2XRO A;  2ZNZ A;  5D5W B;  5LLQ A;  5E1X A;  2Z9O A;  3I64 A;  4U88 A;  3QRF F;  1YIO A;  2X0L A;  4HA8 A;  1I1G A;  1FP2 A;  3O2P E;  1T39 A;  3WU1 B;  3ABU A;  1BC7 C;  3HRS A;  4Q48 A;  5DD4 A;  1IN5 A;  5K5Q A;  3PQJ A;  2VBX A;  1UFM A;  1KQ8 A;  2H09 A;  2A6E F;  3BP8 A;  2RGV A;  2VT3 A;  5D4S A;  3BZ6 A;  2WV0 A;  4TV7 A;  3VOE A;  4QWQ A;  4YG2 F;  2FML A;  5J8C A;  3R0A A;  4U0V A;  1JGS A;  2V6C A;  1R5G A;  3IHU A;  3HHH A;  2ZME B;  1XDS A;  4AIK A;  4U0Y A;  3QP5 A;  2C6Y A;  5ILU A;  4ESF A;  2LDU A;  4RB1 A;  4A5N A;  5HOO A;  4N0B A;  4ESB A;  1ZG5 A;  4UVA A;  4BHC A;  5DEQ A;  4KN7 X;  1RUN A;  1B6A A;  2ZME A;  2L54 A;  5HS7 A;  1QPM A;  1DDN A;  2R7F A;  1IXR C;  3R4K A;  2K86 A;  4EJW A;  3TGN A;  2Z99 A;  3JAM Z;  4A6D A;  4I98 B;  2EA4 A;  1Y0U A;  2V9V A;  2PFB A;  1ZHF A;  4HOB A;  2UXX A;  2JPB A;  4FHT A;  5DCM A;  4KNY A;  1KQ0 A;  1BN5 A;  4BQA A;  1QZY A;  2Z5U A;  2E1N A;  1DP7 P;  3F3X A;  1SFX A;  1JXS A;  2RV8 A;  5JR3 A;  3E5X A;  2G9W A;  3Q5F A;  2XAF A;  3J81 Z;  2UXN A;  2ESH A;  5D8L B;  1G4D A;  3C3W A;  2KJC A;  2RC4 A;  5IT9 Z;  2DLL A;  2OAZ A;  1BIB A;  3IKV A;  1S7O A;  5DV5 A;  1E17 A;  2GIV A;  3V7R A;  5LHI A;  1W5T A;  3LFK A;  4R8H A;  4ENM A;  2EFN A;  2CW0 F;  2IA1 A;  2GXG A;  1MJA A;  2PBI A;  3I71 A;  3LA3 A;  5E8G A;  5L3E A;  1XMA A;  1OKR A;  3M8F A;  4AVP A;  3P9C A;  3CTA A;  2L3D A;  2EV0 A;  2L4A A;  2O0Y A;  2OZU A;  1LEA A;  1I6X A;  1RZ4 A;  3BWG A;  2GA2 A;  1ZRC A;  3TO6 A;  3F21 A;  1LNW A;  3K1P A;  1YO5 C;  4EMS A;  3B73 A;  1FBQ A;  1KU3 A;  2MH9 A;  2XRN A;  2RNJ A;  1KYW A;  5JI6 A;  3KFW X;  1Z6R A;  3RKW A;  1R1T A;  1OYI A;  2ZFW A;  3KEO A;  3VFZ A;  1P92 A;  2E7W A;  4HLX A;  3GF2 A;  1BI3 A;  5E8I A;  2GWR A;  5ICF A;  3V7C A;  2FU4 A;  4MNU A;  1RI7 A;  3KEQ A;  2VOO A;  2P6T A;  1ON2 A;  1ZRD A;  1ULY A;  2STT A;  1O7F A;  4IVN A;  1J2X A;  2PG4 A;  4UVB A;  2F5D A;  2QYO A;  3IWZ A;  1IN6 A;  2VBY A;  4LB5 A;  2M8E A;  1FT9 A;  3C7J A;  3H3Z A;  1FC3 A;  1YW7 A;  1R7J A;  2F5C A;  2PQ8 A;  5CVJ A;  4IRG A;  4HX7 A;  1ZAR A;  4ASN A;  3T8R A;  3RJP A;  3GW2 A;  5KVR A;  4K2E A;  4A0Z A;  2QBY B;  1TQP A;  4KIF A;  1KA8 A;  2HEO A;  1ZAO A;  4A12 A;  1FSH A;  3RKX A;  2QM3 A;  2HDC A;  2QZ8 A;  2R7D A;  3DP7 A;  3FXU A;  4LK0 F;  2DQR A;  4PGG A;  1E2X A;  3E5U A;  5LHG A;  5DUK A;  2A61 A;  2OD5 A;  1U2W A;  2LSO A;  1FBS A;  2Q8K A;  3JW4 A;  1R1U A;  2LKP A;  1TLH B;  2EFW A;  2RKH A;  3JTG A;  4PGH A;  1JE8 A;  1ON1 A;  5ILV A;  3N97 A;  3ABT A;  4ENK A;  2OZ6 A;  1HKQ A;  3I59 B;  4ZYE A;  3MEX A;  1W7P A;  1R36 A;  2FE3 A;  1HW5 A;  1MDM B;  4L18 B;  2KKO A;  2V1D A;  4Z2Y A;  1ZLJ A;  2P5K A;  3KCC A;  5D8K B;  1EH7 A;  1U3E M;  3FM3 A;  2QQA A;  4O5V A;  4BHP A;  2IT0 A;  4IF4 A;  1WKM A;  1TBX A;  5CVU A;  3B02 A;  4HX4 A;  1MDM A;  4UV9 A;  4KIC A;  1OYY A;  1Z9C A;  3HOT A;  2HWV A;  1IN8 A;  5L3B A;  3C1D A;  1WSU A;  1R00 A;  2A07 F;  4IJA A;  3FX3 A;  3GFM A;  1LDD A;  2RVC A;  1X3U A;  3WTX C;  1H9G A;  4CDG A;  2DT5 A;  3BJ6 A;  3BJA A;  4B8X A;  4R79 A;  1Z91 A;  3KLO A;  3PQK A;  3RPU A;  4BHB A;  3GFL A;  3JSP A;  2A5Y B;  2VBW A;  3L9F A;  4LMY A;  2PEX A;  4M72 A;  5DDG A;  1D8J A;  1OYW A;  4LFU A;  5D6E A;  2ZBK A;  1O3T A;  3M9A A;  4HDU A;  1HKS A;  2A3S A;  3SXY A;  4IPA A;  5ICG A;  3F8C A;  3GZ6 A;  4Q5S F;  2Y0M A;  4KUM A;  1B9M A;  2H94 A;  4RB2 C;  1JHF A;  4NQW A;  2O3F A;  3BDD A;  4M71 A;  2PMU A;  4HBL A;  3QPT A;  2W24 A;  1U6G A;  3J80 K;  1YFH A;  4L0Y B;  1F1Z A;  3MZH A;  4L0Z B;  1ODD A;  1OPC A;  3MWM A;  4I01 A;  1H0M A;  2YX4 A;  3KP2 A;  2FNA A;  3ZMD A;  2GQQ A;  1TW3 A;  3WTZ A;  4JK1 X;  5HLH A;  3SQN A;  3VOD A;  5LGT A;  2EA2 A;  5F1R A;  5D5X B;  2HTJ A;  3TDU C;  2F5F A;  1BJA A;  3WTW C;  4M9S A;  2QBY A;  2B0L A;  2XAQ A;  2W84 A;  3IRQ A;  1BBY A;  4KFC A;  3MFK A;  3ERE D;  4KMU X;  4EM0 B;  4WXD A;  3Q9S A;  3F22 A;  2HYF A;  3WTV C;  2D45 A;  2H6C A;  4RB0 A;  1DPU A;  1ZG1 A;  1ZRF A;  3HSR A;  4HDV A;  4ETS A;  2XGX A;  3RPQ A;  3QP6 A;  2ESN A;  5H20 A;  1WQ2 A;  4L9T A;  3H92 A;  1MD0 A;  3I0T A;  1MGT A;  4PCQ A;  1HW1 A;  3TO9 A;  5LEJ A;  2WC2 A;  1CGP A;  1J5Y A;  1KYZ A;  1Z1D A;  3CUQ B;  4HV5 A;  2XIG A;  1LJ9 A;  3L00 A;  5ICE A;  3LST A;  3WE3 A;  4EJT A;  2XVC A;  4LB6 B;  2DPU A;  1ZG3 A;  2WWY A;  4WXH A;  4LLL A;  1HBX G;  2ETH A;  5K1Y A;  2V79 A;  1W7P D;  2V1X A;  2A69 F;  2ELH A;  1HST A;  5FFZ A;  3WGI A;  4OIN F;  4A0X A;  3EYY A;  3I58 A;  5LGN A;  1FZP B;  3KLN A;  4OOI A;  1SD6 A;  4I0A A;  4EM1 A;  1IXS B;  5BQT A;  5FLX Z;  3FXQ A;  5EEG A;  1IF1 A;  2M5W A;  2HGC A;  4EGZ A;  2ZCW A;  1YS6 A;  3GO5 A;  3ZMV A;  1VTN C;  3I54 A;  3SFZ A;  5BOX A;  2PLY A;  3V8L A;  4KIG A;  4R1H A;  1SD4 A;  1YTY A;  4RGS A;  4P5O A;  4G6D A;  4ENN A;  2DTR A;  4NHJ A;  1U5T C;  3DXJ F;  2XUB A;  3FWE A;  2FBK A;  2G7U A;  3V8K A;  3CLO A;  5E1W A;  1R58 A;  4LG0 A;  4UNO A;  2VON A;  4MHG A;  4OIO F;  5D6F A;  1V3F A;  2ZO4 A;  1WI9 A;  1YYV A;  4I09 A;  1U5T A;  3EQL F;  2VOP A;  4CO8 A;  3ZMZ A;  2HR3 A;  4B09 A;  1KU2 A;  2V1U A;  3NEU A;  4LG0 B;  4CHU A;  1MJB A;  2L4M A;  5FD5 A;  1MKM A;  3J7A O;  1ZYR F;  3JAM K;  3RTR A;  2MLK A;  2G7H A;  1TTY A;  3JTH A;  1K78 B;  1FYL A;  4N9I A;  1K79 A;  5IT3 A;  2CGP A;  3TKY A;  3CUO A;  2FBH A;  4Y13 A;  2VN2 A;  2FQ3 A;  3ZN1 A;  5TRD A;  2E7X A;  3G3Z A;  4AIH A;  1FYM A;  2OQG A;  1IRG A;  4KT5 C;  4ZZD A;  2P4W A;  3DFG A;  3OOP A;  2DW4 A;  4EJO A;  1L3L A;  2EWN A;  3V7S A;  1W4M A;  4I02 A;  1T0F A;  2Y75 A;  1O57 A;  1GHC A;  3ZMS A;  4HAM A;  4CGZ A;  1I5Z A;  3DQV C;  5J6X A;  5BPI A;  4L9J A;  3KE2 A;  4UHT A;  5CJ9 A;  2YSR A;  2M1B A;  3ZMT A;  2RDP A;  3HIF A;  1S8N A;  2QWW A;  2ADU A;  2CYY A;  4IXA A;  2JZY A;  1KU7 A;  2RQP A;  2STW A;  3C18 A;  5DUI A;  1ZRE A;  3WTT C;  2JT1 A;  3MZY A;  4RB3 C;  3FMR A;  2HTS A;  3TO7 A;  2YPR A;  2YX7 A;  1HXD A;  4L9N A;  4XLP F;  3M1E A;  3F8F A;  1P6R A;  3WU0 A;  3DPT A;  3R0J A;  3DV8 A;  4Q47 A;  1SFU A;  1UB9 A;  4AIJ A;  5AON A;  3WTU C;  4H0E A;  4N9H A;  3LQQ A;  4S05 A;  2QQB A;  2XAH A;  4LK1 F;  2ZKZ A;  1ZLK A;  3SHF A;  2FBI A;  5E20 A;  4CIC A;  3QOP A;  1LDJ A;  4UUV A;  2NS0 A;  4BXU A;  4YIF A;  2NYX A;  5L3G A;  2CSO A;  3IC7 A;  5LGU A;  2XAG A;  5JVT A;  4WCG A;  4ZH4 F;  4WX9 A;  4EGY A;  1SMY F;  4P9U A;  2JSC A;  3HRM A;  2PMH A;  3EDP A;  1BM9 A;  1RNL A;  2F2E A;  4GO1 A;  4I0B A;  1BIA A;  1O3S A;  3KP3 A;  5DD8 A;  4CZZ A;  5H6R A;  2P8T A;  4EVI A;  4M74 A;  2FRH A;  5HDK A;  2J5O A;  3KP4 A;  1R5H A;  4HYE A;  2LF8 A;  5K5O A;  4U7D A;  1RIO H;  3GYH X;  1KU9 A;  4MGR A;  4IHT A;  2PI0 A;  4I2O A;  4LD5 A;  2UZK A;  2HQR A;  4FX4 A;  3GUD A;  2Q0O A;  2D1H A;  3ECO A;  1I27 A;  1NHA A;  2CG4 A;  2K27 A;  4BAY A;  2VE8 A;  1FOK A;  2DAO A;  5HDN A;  2K7L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...