1HKSA

Solution structure of the dna-binding domain of drosophila heat shock transcription factor
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
106
structure length
106
Chain Sequence
b'GSGVPAFLAKLWRLVDDADTNRLICWTKDGQSFVIQNQAQFAKELLPLNYKHNNMASFIRQLNMYGFHKITSIDNGGLRFDRDEIEFSHPFFKRNSPFLLDQIKRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEAT-SHOCK TRANSCRIPTION FACTOR
molecule tags Transcription regulation
source organism Drosophila melanogaster
publication title Solution structure of the DNA-binding domain of Drosophila heat shock transcription factor.
pubmed doi rcsb
total genus 11
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1994-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00447 HSF_DNA-bind HSF-type DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1hksA00
2VT3A 5D4SA 2BV6A 3QPHA 2RGVA 5TJJA 2TDXA 1BI2A 3V8KA 1W7PB 2FQ3A 3J80K 1LEBA 4ZYDA 4L0ZB 3IL2A 1BI1A 2FMYA 3QP5A 1LVAA 2ISZA 3GEZA 1SD7A 2KKOA 4KT5C 3HYIA 3JAMK 4UXNA 3FZVA 1AOYA 1BM9A 2DK5A 2YU3A 1KU2A 1TBXA 4YG2F 2JTVA 4KMUX 4B09A 3LWFA 1O3RA 4G7OF 3QAHA 1UB9A 3SZPA 4HF1A 1GXPA 3GZ6A 2QYOA 5AONA 2EFOA 2QLZA 3M8EA 3KP6A 5CVVA 3E5XA 3RTRA 3G3ZA 1OR7A 3WE2A 5KVRA 1REPC 4I02A 2R3SA 4LK0F 4JBAA 1AWCA 1HXDA 3HRMA 2VN2A 4GCVA 2ESNA 5JFRA 3KP7A 3R0JA 5HDNA 3QU3A 2F2EA 1B1BA 1BI3A 1XMKA 2IP2A 2F5CA 2DAOA 2L4MA 4G6QA 3KEQA 1V4RA 3BWGA 3SQNA 4S05A 4ASNA 2Y0MA 2DBBA 3GFLA 4ZYEA 3DKWA 1J75A 3MQ0A 5BMZA 2VONA 2RC4A 2GZWA 2IJLA 1T38A 2D1VA 1X3UA 1RZ4A 2A61A 1JGSA 1YIOA 3HTUA 2NRAC 2YX4A 4HLXA 3R6SA 2YR2A 4KIBA 4HZFA 3BROA 1B59A 1U78A 5ICEA 2CG4A 1OKRA 4CHUA 3V4GA 3ZPLA 1XSXA 2AXLA 3DXJF 4NQWA 1TLHB 3C18A 2HYGD 1JHHA 3GWZA 3U1DA 4RB1A 3ULQB 3WTTC 1S7AA 5HLHA 2XGXA 4L9TA 3ZMDA 2QQBA 1QPMA 5L3FA 2EJRA 1F9NA 4ETSA 2XAFA 3U9GA 2BGCA 4HF2A 3TOAA 4S04A 5L3CA 1T0FA 2P4WA 4KDPA 3HSRA 3MEXA 4IF4A 1K78B 1KGSA 4BHPA 3FXUA 2HR3A 1W7PA 3CUOA 1IUYA 2HOEA 2RV8A 3I54A 3B73A 1LDJA 1UHMA 1XGOA 4AIHA 1B9MA 2YSRA 3IWZA 3ERED 2QQ9A 1U5TA 3BJAA 3I0TA 5J6XA 3F23A 2MBFA 4I2OA 1C0WA 2W85A 2EV0A 5AIQA 1MJBA 4A5NA 3K9TA 2F5FA 4YFNF 3MAJA 1O7FA 4ZZDA 2M8EA 4M73A 1TQPA 1BC7C 3V8JA 2CFXA 4LK1F 3WE3A 1XSVA 2V1XA 3VB2A 3HOTA 2COMA 2GWRA 1QGPA 1FBUA 1ZH5A 2PI0A 4A2UA 1HW5A 4A12A 1O3TA 2DPDA 4BHCA 5CYVA 2PBIA 2NNYA 3MWMA 3GYHX 2XUBA 3GW2A 1U5TB 3LAJA 1ZREA 2QBYA 2ISYA 2CO5A 2BE5F 2JPCA 3SFZA 4KIGA 3U2RA 3GO5A 2OZUA 4N9HA 4M71A 1IXSB 4ON0A 2A5YB 3COAC 1RNLA 1FSEA 3IWFA 5A2QZ 2PLYA 2V79A 4NHJA 4D0PA 3HIFA 3O2PE 1B9NA 3WTVC 1ZG3A 2K27A 3Q5FA 5BQTA 1IF1A 1P6RA 2DW4A 4CZZA 3GF2A 2VODA 1R36A 5LGUA 2FMLA 3BPXA 1T2KA 3L09A 3AAFA 1XGNA 5JR3A 2NAZA 3EUHA 4AIJA 3E5UA 2H6CA 3QU6A 4IHSA 4YFKF 4Q47A 2OBPA 3WTYC 1FSHA 1UHWA 2E7XA 2DI3A 3KP2A 2OAZA 4Q5SF 3F3XA 4RB0A 3SZTA 3V7SA 1BBYA 1V3FA 5L3GA 3FMSA 1D8KA 4L9VA 4UUVA 1HW2A 2RN7A 1CF7B 2FA5A 1KYZA 2A6EF 3E97A 2H6BA 3S2WA 2MH9A 3WODF 2OZ6A 3G73A 2FEZA 2VE9A 4PCQA 2P6SA 1ZN2A 2F5DA 3IKVA 2UZKA 2XIGA 1D3YA 1YW9A 1P92A 5CVRA 2RQPA 2CW0F 2DQRA 1I1SA 2VBYA 4OIQF 2UWMA 3FHZA 1FX7A 2A3SA 1KQ0A 3MCZA 4I0BA 4EQQA 2GAUA 3KZYA 3C3WA 1P4XA 3I4PA 5L3EA 1K6OA 3RPQA 1STZA 2HGCA 4G7HF 3NRVA 4PZJA 3PQJA 2KJBA 4KN7X 2ZJ2A 4HV6A 1T39A 3FM3A 4EV0A 3WG9A 1G4DA 3H3UA 1T98A 4L18B 4HYEA 1YS7A 3BDDA 2XHKA 5LEKA 4ESBA 1USTA 3I58A 1A04A 2OQGA 2PEXA 1IXRC 3L00A 3CTAA 4IVNA 4M9SA 2XKPA 4N0BA 3WGGA 2M87A 2ZMEA 1ZHFA 4KICA 1BC8C 1ZARA 1J2XA 2E1NA 3JAMZ 1YW7A 2Y48A 1BIBA 4P9FA 4RGUA 2XAQA 5ERIA 2H94A 3DEUA 4XSXF 1Z05A 4R8HA 1PP7U 3L7WA 4OMYA 3N4MA 5J8FA 2C6YA 4G6DA 4XRFA 2M45A 1EH7A 5E1WA 4IPAA 1ZG5A 2ACJA 2YPRA 3IHUA 4EJVA 3WTZA 2NS0A 1XCBA 1DPRA 4P9UA 2XVCA 2ELHA 3R61A 5F64A 3I71A 4M74A 3K2ZA 5HDGA 2ZKZA 3WTWC 2V9VA 3E6DA 4ZH4F 1Z6TA 1FYKA 1FBQA 1G3WA 3C1DA 3VODA 3BPVA 1SFUA 1S29A 1FBSA 1R23A 2QM3A 2R7DA 2DFIA 4UV8A 2QBYB 1R1TA 3WTUC 2A6HF 4I98B 3T5XA 1QZYA 5HS9A 4Y17A 4ENNA 4MTDA 3EYYA 4MNUA 3F21A 3DP7A 3FF5A 5HLGA 2EV5A 4PGGA 1ZAOA 2PMHA 2ZNZA 2L4AA 1DPUA 1LB2A 2ADUA 3SXYA 1FP2A 2Q8KA 2J5OA 4U0YA 4BNCA 3KLOA 1S3JA 4WF2A 4WX9A 3CUQC 5EEGA 1RIOH 2MA3A 2VT2A 3ABTA 1ULYA 3EQLF 3K1MA 4RAZA 4IRGA 5LBQA 2MLGA 4WCGA 3RKXA 1WI9A 4DNCA 2IPQX 5D6FA 2HZTA 5H6RA 4TV7A 1WSUA 3ML6A 4I7HA 1FWZA 1W5TA 1FY7A 3REOA 1UFMA 2STTA 2CQKA 1FNNA 4A6EA 5ICFA 5JVTA 2WV0A 2ZFWA 2E1CA 1JHFA 3DQVC 2QQAA 1K79A 3D5LA 3ZMTA 3LFKA 3E5QA 1NHAA 4GYGA 2JZYA 2PN6A 4DQ2A 3H92A 4EJOA 1S7OA 3HSFA 5FLXZ 3ZMZA 4IRHA 1R00A 4H0EA 2QZ8A 1YO5C 1HBXG 5E20A 5CLSA 4WXDA 5FLXK 3O6BB 3T8TA 1XCVA 3TKYA 1O3SA 4FT8A 2EFWA 3LA3A 2O03A 2DQLA 3ABUA 1KU3A 3HHHA 4E70A 5FO5A 1XSDA 3K1PA 1WQ2A 2DT5A 4BHBA 3NEUA 4LD5A 2FBKA 3KLNA 4RAYA 4MEYF 2V1UA 1ONVA 1Z6RA 2H09A 4UNOA 2QENA 2GIVA 2VBWA 5EEHA 4EM2A 4FHTA 3ROUA 5JHUA 3OV8A 1B6AA 2BEOA 3EYIA 1MD0A 1J7KA 3IKTA 2VC0A 3FMRA 5E18F 4M72A 3GZ5A 4GXOA 1I5ZA 5LHIA 1FPQA 2P6TA 1YLFA 4LG0A 1SD5A 3TDZC 5KK1A 4IXAA 1IN5A 5CVUA 3R60A 1KU9A 2OU2A 5D8LB 1TQMA 1O3QA 1CF7A 2PFBA 1USSA 2STWA 4KMFA 4KN4X 3IRRA 5DD8A 2J5PA 2VOPA 1E17A 1GXQA 3ZP5A 2K86A 2WWYA 3T1BA 2DTRA 2MH2A 2VC1A 2O8XA 2W25A 5ILSA 4M9XA 3W6JB 1U8RA 3Q9SA 5LHHA 1BIAA 4KYWA 4KA4A 3KP5A 1LQ1A 3TGNA 4NB5A 4LLNA 3DV8A 2RVCA 3OOPA 3FWEA 1MJ9A 3IC7A 3BY6A 4OIPF 4MHGA 2OD5A 5IT3A 1WRJA 1KYWA 4I0AA 2CGPA 4WWCA 1T6SA 4MQ9F 2K4BA 4QLCU 1L0OC 1XDSA 3HUGA 3EETA 3TDUC 1IXCA 1P2FA 4Y13A 3V7RA 2XRNA 3MZHA 3RKWA 3RI4A 1W5SA 3TQNA 1OMIA 3HRTA 3WU0A 5DV5A 2V6CA 2XAJA 2HYFA 1YFHA 3R0AA 1I1GA 3F72A 4HDUA 2AS5F 4UHTA 3K0LA 4YIIA 2EWNA 2Z99A 4CGZA 4RS8A 1YTYA 3BJ6A 2ZCWA 4GGGA 4CO8A 2FU4A 2E7WA 2D1HA 2P5VA 1R7JA 3N97A 1H0MA 5FFXA 1FT9A 4UVBA 1SMYF 3K69A 1IRGA 1G3YA 1FC3A 1MZBA 2P7VB 2IRFG 2HS5A 4ZYGA 1YW8A 3J80Z 2IT0A 3WU1B 4L9NA 2K4JA 1U3EM 4HOBA 2P8TA 5E8IA 2EV6A 2MD5A 3L9FA 1XD7A 1YS6A 3F6VA 3KEOA 1I6XA 4MQVA 3J81Z 4HQMA 2Z9OA 1KA8A 3F8BA 4GO1A 2ZXJA 2KIMA 4MEXF 2G9WA 1KQ9A 5IT9K 3ZN0A 2XAGA 2L01A 2VE8A 1F4KA 3D0SA 1LDDA 4HX4A 1R5HA 3LQQA 3L2CA 1F5TA 1CGPA 2PG4A 2DU9A 4FX0A 1MDMB 4LB5A 4G7ZF 1FP1D 3MZYA 4WXCA 2Q0OA 4LG0B 3DPTA 3FM5A 3QPTA 2L54A 2O6GE 5E1XA 2GA1A 4L9JA 1ZLJA 4YIFA 3ECOA 3E6MA 1EH8A 1ZLKA 1D5VA 3EDPA 3QOPA 3HHGA 3VFZA 4EM0B 3W6KB 3F22A 1XB4A 2FSWA 4A6DA 3DFGA 1MJAA 2JPBA 3GFIA 4N9IA 2HDCA 1FOKA 3JTHA 2M5WA 2FOKA 3JW4A 4HQEA 4LB6B 2HEOA 2PJPA 5HLIA 2DO7A 2QWWA 4BQAA 2W84A 3HOSA 2LSOA 3SHFA 3VOEA 1JXSA 4U7BA 4A0XA 1HKTA 1G3SA 4BAYA 4HF0A 4UV9A 1PP8F 5DDGA 1SD4A 4MGRA 1TW2A 1J5YA 1ZGAA 2OQRA 4M6XA 1U2WA 2RDPA 3HTSB 2JT1A 1P4AA 1RUOA 3I5UA 2M30A 3ZN1A 2CSOA 1RUNA 5HDKA 4P96A 4Z2YA 5DD4A 2XV4S 4HDVA 5FD5A 2Y75A 1P4WA 4XBFA 1ZRDA 2HQNA 4RGXA 1SFEA 3WGHA 5D5WB 4BH9A 4CXFA 2K02A 5BPIA 4EJTA 2GXGA 4U88A 1LEAA 1HQCA 4XLPF 1OYIA 3M1EA 5D5XB 1TNSA 5FB2A 3FMQA 1ZYRF 2DLLA 4EVIA 2UXXA 1Z9CA 5E17F 1HSJA 1ZRFA 2GA2A 1TQIA 5HS8A 2QUFA 1L3LA 1IAWA 1OPCA 4OIOF 4I01A 3E3VA 2ESHA 1W4MA 5LRSA 1BN5A 1ZRCA 4BYYA 3WGIA 2RKHA 1YYVA 1U5TC 2LKPA 2O0YA 2BYVE 5LRRA 1FYLA 1F1ZA 4P55A 1LDKB 2X0LA 5L3DA 3RJPA 2CWEA 2VBZA 4AD9A 1OYYA 3BJOA 3Q9VA 1IN7A 1K7AA 2PQ8A 3M8FA 4ENJA 2EFNA 4OINF 2FRHA 3IRQA 1HW1A 1ODDA 4IRIA 5FD6A 4CICA 4UVAA 1E2XA 5DCFA 4RB2C 1R1VA 3RDIA 4XLNF 4OU0A 4OOIA 1UCRA 4XSZF 1WWXA 3TOBA 2O61A 1ON2A 1QO0D 3KCCA 4O6JA 4EGZA 3CUQA 4K2EA 4U0WA 2LF7A 1KQ8A 2Z33A 1VTNC 3ZMUA 5BPDA 4I09A 3KFWX 3J81K 3J7AO 4M9ZA 3GFMA 1I27A 1SFXA 4JK1X 5D5UB 5ICGA 3M7GA 3KZZA 3LA7A 3P9CA 1GHCA 2EA4A 3CLOA 3FX3A 2IA0A 3ZQ7A 2HQRA 1XDUA 4OIRF 3M9AA 3F8NA 4JQFA 5D8KB 4LJZF 3V8LA 2XASA 3RPUA 4L5IA 2L3DA 5DYMA 2WC2A 4KIFA 1DUXC 5ICCA 3HRSA 1O57A 3BZ6A 2HFHA 1ZG1A 4ENKA 2EA2A 2V1DA 2XAHA 4RGSA 1LJ9A 5F1RA 1FYMA 3LSTA 4A5MA 4R79A 5E8GA 3CO6C 1S6LA 1JE8A 5H20A 2FXAA 5D4RA 4G9YA 1XGMA 4YFXF 1O7LA 3RIRA 1K78A 4IHTA 3C7JA 4KUMA 3RKYA 3CDHA 1SMTA 2LNBA 2PMUA 1HKSA 5HOOA 1ZGJA 6PAXA 2P5KA 2RNJA 5J8CA 3F6OA 3E6BA 3ECHA 4EGYA 3RYPA 3QRFF 2XKOA 1QQIA 2Q2EA 5HVQC 3T8RA 4FX4A 5F6FA 5L3BA 1BJAA 3PQKA 3ZMSA 4QWQA 3BP8A 5K5RA 5K5OA 5H6QA 3I64A 2OA4A 1XMAA 2Z3YA 1SAXA 5ILVA 2VOOA 3CJNA 5ILUA 1J9IA 5E1ZB 3GUDA 2P5LC 2EB7A 1U6GA 4UVCA 4G94A 1RI7A 2HTSA 5BS6A 1DDNA 4HBLA 1HKQA 4CDGA 1QNTA 4O5VA 3KP3A 4EMSA 3TO7A 1B4AA 3F8MA 5A2QK 2W24A 5DEQA 2EK5A 4GYIA 2P7CB 1D8JA 2FNPA 2G7UA 3JSPA 3FXQA 4LLGF 1G3TA 2BBYA 4LFUA 2CYYA 5LLQA 5DUKA 1WKMA 4HX8A 4ZZLA 1OYWA 3DF8A 2O3FA 4P5OA 4L0YB 3P9KA 4O3MA 1BOAA 2NNNA 2GXBA 5LHGA 2MLKA 3ELKA 1FZPB 1QZZA 2HKOA 5D5VB 2W57A 3R4KA 3RYRA 3KETA 3I59A 3MFKA 1R22A 1R5GA 2MC3A 3E6CC 3NQOA 4HX7A 1MKMA 4F7ZA 4A0ZA 1H9GA 2HTJA 4L5JA 4Y15A 2WTEA 2FF4A 5FFZA 5K1YA 2GQQA 2A07F 3TO6A 5K5QA 4ESJA 3GX4X 2KJCA 3H3ZA 4B8XA 2B0LA 5ED4A 2A69F 2FBIA 5DCMB 1MDMA 3KE2A 2LF8A 1TNTA 3CUQB 3P9IA 3V7CA 5BOXA 4HW0A 2ZMEB 4HAMA 5LGTA 5CVIA 2D45A 1BI0A 1SD6A 1TW3A 4U0VA 1TTYA 3LAPA 2YX7A 3T0YA 3LA2A 3HSEA 4EJWA 4WXHA 4HA8A 2HWVA 4PGHA 4RB3C 4G8XA 3CO7C 2X4HA 1FLIA 2KIUA 5CVJA 2R7FA 1J59A 3BOQA 5DCMA 1Z91A 4AIKA 1Z1DA 3GFJA 2JRTA 4M6YA 3K1NA 1Z7UA 1IW7F 4IJAA 2HKXA 4RGRA 2G7HA 2ZBKA 3DPLC 4LMYA 5JI6A 2FNAA 2L02A 2IW5A 4LLLA 1XN7A 3GXOA 3HRUA 2A68F 1KU7A 3WTXC 1PDNC 1PUEE 4AWXB 3KP4A 2IVMA 4LGWA 1IN8A 2FE3A 1IZ1A 1IRFA 2JSCA 2UXNA 1IN4A 4MTEA 2QVOA 4A0YA 1Q1HA 4KNYA 1MGTA 5LGNA 2EFQA 2KRFA 2VBXA 2NYXA 3TO9A 1ON1A 4BXUA 3I53A 1G6NA 1EH6A 1DP7P 5FGMA 2M1BA 2EFPA 3WTSC 3O3KA 4EJUA 4R1HA 5DUIA 2F5EA 2DK8A 3QP6A 3VEPA 4EM1A 3GLXA 1YG2A 2ETHA 4KFCA 2ZNYA 4HLYA 4OMZA 4AVPA 5D6EA 4PDKA 4Q4ZF 5IT9Z 2Z5UA 3F8FA 2ZO4A 1R1UA 1HSTA 4Q48A 5LEJA 4CYDA 3B02A 3PFIA 3ZMVA 5TRDA 4U7DA 1J0RA 1LNWA 1YQAA 3I59B 4ESFA 2IA1A 3P7NA 2VXZA 1R58A 3JTGA 2IA2A 1XGSA 5CJ9A 1GVJA 3JSOA 4HV5A 5HS7A 3FXRA 1W7PD 1QBJA 1EV7A 1H9TA 3ISPA 2DPUA 2D2WA 2FBHA 4ZYHA 4WK8F 1S8NA 4ENMA 3LQRA 3F8CA 2K7LA 2LDUA 5AIPA 2XROA 2KIFA 1IN6A 1Y0UA 3GVAA 2H27A
chains in the Genus database with same CATH superfamily
2VT3A 3CMEI 5EJCA 5D4SA 2BV6A 3QPHA 2RGVA 3G71I 5TJJA 2TDXA 2BXZA 1BI2A 3V8KA 1W7PB 2FQ3A 3J80K 2ECCA 2KIQA 4XM3A 4AIDA 1LEBA 4E7ZA 5K7ZA 4ZYDA 2VQLA 2LYCA 4L0ZB 2A05A 4J19A 2CMPA 2RREA 3VPRA 3IL2A 3TL4X 1BI1A 2FMYA 5CPRB 1BJZA 3BT9A 2WY8Q 2NVYJ 3QP5A 1LVAA 2ISZA 4IQJA 4MFEA 3GEZA 1SD7A 2L5QA 2VKVA 3DBRB 2KKOA 4KT5C 3HYIA 3H5NA 3JAMK 2YU9J 3LSMA 4UXNA 1VQKI 2I10A 3FZVA 1S7EA 1TWHJ 1BM9A 1GLNA 4FASD 1WJAA 1AOYA 2DK5A 5GPCA 2OPTA 3CESA 3OYIA 2BY2A 3EUAA 1YHQI 2YU3A 1KU2A 1TBXA 4YG2F 2YUSA 2JTVA 4KMUX 2DA1A 2DT7B 3K7AJ 2E2HJ 4JOMA 1APLC 2VXDA 1A36A 1MBGA 3HPGA 4B09A 4ABZA 3LWFA 2H8WA 4I6ZA 1O3RA 2VJIA 2KISA 2F4OB 3TW7A 4G7OF 3QAHA 3IH3A 4MO7A 1BW6A 1UB9A 3SZPA 4HF1A 1GXPA 3GZ6A 3JRHA 1R6RA 2QYOA 5AONA 2EFOA 3HKZA 2CUJA 2QLZA 3M8EA 2LTPA 1AU7A 5EDNA 2IS6A 3KP6A 2B63J 2VKEA 5CVVA 3E5XA 3RTRA 2CRGA 3G3ZA 3OL3A 3GTMJ 1F36A 1OR7A 3WE2A 3MZ8A 5KVRA 3A01A 3GTOJ 4FTHA 2WAQA 1REPC 1IUFA 4I02A 2R3SA 3PO3J 4LK0F 4F93B 4JBAA 1AWCA 3CJRB 1HXDA 2WB1A 3HRMA 2R7XA 3CLQA 4A3IJ 4E7IA 2VN2A 2ZSHB 2KL4A 4GCVA 5GAHJ 5FRMA 2ESNA 5JFRA 3KP7A 3R0JA 4XOTA 1BOBA 5HDNA 3KYLA 1ENHA 3DTKA 4UUSB 2JA7J 4JX5A 5C44J 2NOJB 1NTCA 3A4CA 1UMQA 3QU3A 2F2EA 1B1BA 1QHHD 1BI3A 3LOCA 1XMKA 4CA0A 4PUSA 3K4JA 2IP2A 2F5CA 2DAOA 2L4MA 4G6QA 2XF5A 1P9QC 5F27A 3KEQA 1OFCX 1V4RA 3BWGA 3SQNA 4S05A 1RC9A 5J1UA 2E19A 4ASNA 2DMNA 3PNTA 2JA5J 2Y0MA 3D5RC 2DBBA 3H0GJ 3GFLA 3PUBA 4ZYEA 3DKWA 3MD2A 1J75A 2JUCA 3MQ0A 1IC8A 5BMZA 2VONA 2RC4A 2GZWA 4Y52J 2IJLA 4BS9A 3VSKA 1T38A 4E7JA 2D1VA 1FIAA 1X3UA 2FD5A 1D1BA 4J01A 1RZ4A 2EIKH 1BA5A 2A61A 1JGSA 3FHNA 1YIOA 2M7BA 4II3A 3HTUA 2NRAC 2YX4A 4HLXA 3R6SA 2LY2A 2OC6A 3FDYA 2YR2A 4KIBA 4HZFA 1MMNA 3BROA 1I39A 1JTYA 1B59A 1U78A 5ICEA 3S32A 2CG4A 2DOEA 1OKRA 4CHUA 1RETA 3V4GA 1W36D 1OCOH 3BR2A 2HNHA 3ZPLA 1XSXA 2EINH 2AXLA 3DXJF 4NQWA 4CH7A 1TLHB 3JR9A 3I4MJ 3C18A 2HYGD 3OYKA 1JHHA 1IRXA 3GWZA 2VQCA 3U1DA 4RB1A 1ETKA 4DOZA 3OIQA 3ULQB 3ZQHA 3WTTC 2HPMA 1S7AA 5HLHA 2XGXA 4DBRA 1VQ7I 1X2MA 2X6YA 2ZXWH 4L9TA 3ZMDA 2W1OA 2QQBA 1QPMA 5L3FA 2EJRA 1F9NA 1OLTA 2F48A 3HOYJ 4ETSA 2XAFA 4W97A 1XG1A 3U9GA 1OR7C 2BGCA 3ZCOA 1W36C 3TOAA 4HF2A 4S04A 1VQOI 5L3CA 4PSXA 5E3LA 1T0FA 2P4WA 4KDPA 2VPLA 2WV1A 3HSRA 1WVRA 3MEXA 4IF4A 2CQNA 1K78B 3CDLA 1KGSA 1MBEA 2K3PA 3FXUA 3BQZA 4BHPA 2HR3A 4F92B 1W7PA 3CUOA 1JGGA 1IUYA 2HOEA 2RV8A 3I54A 3B73A 5K7FA 2CV2A 1LDJA 5JVGF 1DP3A 3OL4A 2E1MB 3I55I 1VQPI 1UHMA 1XGOA 2IS2A 4AIHA 2VPRA 1B9MA 2YSRA 3I3LA 3IWZA 3ERED 3LSIA 2QQ9A 1U5TA 3BJAA 3P5JA 3I0TA 5E3NA 5J6XA 3W6VA 3F23A 2MBFA 1H88C 4I2OA 3JREA 1C0WA 3FK6A 2W85A 2EV0A 3K4NA 3E7LA 5AIQA 1MJBA 4A5NA 1A31A 3K9TA 2F5FA 2QKLB 2EZHA 2RAEA 4YFNF 2WAQN 1D0ZA 3MAJA 1FOWA 1O7FA 3ZOBA 5EF6A 4ZZDA 1WJFA 2M8EA 4M73A 3PJRA 1WJCA 1TQPA 5EG0B 1BC7C 2WBMA 3V8JA 5FLVA 2XRLA 2CFXA 1TP4A 1YJ9I 4LK1F 1A6QA 2KZGA 3WE3A 4X1EA 1XSVA 1OJLA 2V1XA 3SDBA 3OYMA 3CMYA 3VB2A 3HOTA 4B43A 5B5EC 2COMA 2GWRA 1QGPA 2X51A 1FBUA 1ZH5A 2Z2SB 2PI0A 4B48A 1HOMA 3K70D 2MD0A 4A2UA 1ZR2A 1HW5A 4A12A 1O3TA 3VDXA 2DA4A 2JSPA 2DPDA 3K6GA 4BHCA 5CYVA 1FTZA 4G12A 2PBIA 2NNYA 1RKWA 2DA7A 3MWMA 5KAFC 2XAUA 3GYHX 3OYNA 2CW7A 4ZC3A 2XUBA 4BKXA 1RR8C 3GW2A 3HDDA 4BBRJ 1U5TB 1IDZA 3LAJA 3M8JA 1ZREA 2QBYA 5FKOA 2ISYA 3DTIA 5IYDJ 2VKHA 2CO5A 3C2GA 2OJED 4E4HA 4F91B 2BE5F 2JPCA 3SFZA 1BR2A 4KIGA 2VJ5A 2Z1DA 3H9QA 4HSRA 2HVQA 3U2RA 3GO5A 5GAGJ 5GTIC 1MMAA 2OZUA 2LREA 4N9HA 1R4NB 3UKGA 4M71A 4XNFA 2KDZA 1IXSB 4ON0A 2A5YB 2IGKA 2OF7A 2IEKA 3COAC 2IGOA 1RNLA 1FSEA 3IWFA 1B8IA 3S1RJ 3E0JB 5A2QZ 1A6IA 4E7HA 2BVMA 1K4SA 2PLYA 4YRVA 1OCRH 2V79A 5F0CA 4NHJA 4D0PA 3S1MJ 2QCOA 2KMUA 3HIFA 4CYCA 3O2PE 1B9NA 2CU7A 3WTVC 1ZG3A 2K27A 4BE2A 2KRHA 2Y9ZA 3Q5FA 4ZDOA 5BQTA 1IF1A 1P6RA 2DW4A 4CZZA 3GF2A 2VODA 1V5EA 4UY8I 1R36A 2PMZA 4BJ6C 3GTQJ 3L2WA 5LGUA 4JYKA 2FMLA 3BPXA 3FIWA 1T2KA 3AG2H 4BUPA 3L09A 2E36A 3AAFA 2Y0SN 1XGNA 2KT0A 5JR3A 2NAZA 3EUHA 1Y0NA 4AIJA 3E5UA 3CCRI 2H6CA 3QU6A 4IHSA 4YFKF 4Q47A 2D5VA 2OBPA 3CDIA 3WTYC 4XN0A 2OCEA 1FSHA 1UHWA 1VQ8I 1GVDA 2E7XA 2DI3A 3KP2A 2GIZA 3TW6A 2XB5A 3WU2C 2OAZA 4Q5SF 2HOAA 3F3XA 4RB0A 1I50J 3SZTA 3V7SA 5B1BH 1BBYA 4AC0A 1V3FA 5L3GA 1YOVB 2K3FA 3FMSA 4LIUA 1D8KA 4L9VA 4UUVA 5M5YJ 5F08A 4A93J 1HW2A 2RN7A 1WJBA 2FA5A 1CF7B 1PJRA 1MBKA 4D1QA 1KYZA 2P0WA 2QSHX 2A6EF 3E97A 2H6BA 2KP6A 3S2WA 2MH9A 1ACIA 3WODF 3PO2J 2OZ6A 3OIPA 1WJ5A 3G73A 1HA8A 2X1CA 2DMUA 2FEZA 2VE9A 4PCQA 2P6SA 1IG7A 1ZN2A 2CS3A 2F5DA 3IKVA 4LG3A 4XK4A 2UZKA 2XIGA 1D3YA 1HLVA 1YW9A 1EKEA 1P92A 5FKKA 3BZKA 5CVRA 2RQPA 3S3OA 2CW0F 4NNJA 5KCMA 3ERMA 2DQRA 1I1SA 1N78A 3BG7A 2VBYA 4OIQF 2UWMA 3G1LA 2MW8A 2CV1A 3FHZA 3H5RA 1FX7A 1Z3XA 3QQAA 2A3SA 1KQ0A 2E34A 3MCZA 4QPOA 4I0BA 4EQQA 1ZR4A 2GAUA 2CUZA 3KZYA 1E3OC 3C3WA 4KJZA 3JRBA 1P4XA 4II2A 1X1CA 3I4PA 5L3EA 3DLLF 1GV2A 4A3DJ 1K6OA 3RPQA 1STZA 2HGCA 4G7HF 3NRVA 4PZJA 1NG6A 3PQJA 4JX4A 5IOZA 2BZTA 2KJBA 4KN7X 2ZJ2A 4HV6A 1T39A 3FM3A 1OISA 1P7IA 2QSGX 4EV0A 2JRMA 2HQ5A 3WG9A 2NS8A 3ABLH 2R7TA 1G4DA 3DU6A 3H3UA 3L2VA 4GFBA 1T98A 2HQAA 3ZQCA 4L18B 4AUXA 4RMNA 4HYEA 1YS7A 1VQ5I 3BDDA 4D5FA 1VNDA 2XHKA 5J4YA 4EATA 5LEKA 4ESBA 2QA4I 3GTLJ 1USTA 3I58A 3ZQGA 3VYTB 1A04A 2OQGA 2PEXA 4XKBA 2ME6A 1VQ6I 1IXRC 3L00A 3CTAA 4IVNA 2XF7A 4M9SA 2XKPA 4I99C 1E3HA 4N0BA 3BTJA 4NBQA 2LD5A 1D1CA 2L9RA 3WGGA 2M87A 3M3YJ 1QRYA 1QHGA 1POGA 3RCOA 2ZMEA 1MNMC 1XX5A 2M8GX 1ZHFA 5EGOB 4KICA 5EG0A 1BC8C 1ZARA 1J2XA 2E1NA 3JAMZ 1YW7A 2Y48A 1H89C 1JI8A 1T95A 1IV8A 1BIBA 4P9FA 3TP3A 4RGUA 2E5NA 1RR7A 2DFFA 2X48A 1RPWA 3HPHA 5GAEJ 2XAQA 3QYEA 3LL7A 4HG2A 5ERIA 1UELB 2H94A 4Y3OA 2MABA 3DEUA 4XSXF 1Z05A 4R8HA 1PP7U 1MMDA 3L7WA 1Z3YA 4OMYA 1SVLA 4C3IJ 1Z21A 2CW8A 3N4MA 4FE7A 4LIVA 5J8FA 2C6YA 4G6DA 2M34A 4XRFA 2M45A 1EH7A 5E1WA 4IPAA 2DDBA 1ZG5A 1VI0A 2ACJA 2YPRA 4V19K 4V2FA 3VYSB 3FBNB 4G6TB 3L2UA 3IHUA 3O8GA 4EJVA 3ONQA 4PJMA 3WTZA 2NS0A 1XCBA 5EYRA 1DPRA 4P9UA 2CJJA 2ZC2A 4BQQA 2LY9A 2BY3A 5M3FJ 2I8DA 2Y0SA 2XVCA 2ELHA 3R61A 5F64A 4E7KA 3LSJA 3I71A 4IZZA 4M74A 2P81A 3K2ZA 5HDGA 2ZKZA 3C2HA 4CCMA 3DBHB 1O4XA 3WTWC 2V9VA 3E6DA 4ZH4F 2PJRB 1P7JA 2ZXHA 1EA3A 4ZTJA 4BQNA 1HDPA 1Z6TA 1W1WE 1FYKA 1FBQA 4W1UA 1G3WA 3C1DA 3VODA 2E2JJ 3BPVA 1SFUA 1S29A 1FBSA 3IV5A 1Y1WJ 2DJIA 1ETQA 1R23A 3Q0UA 2QM3A 2R7DA 1X4PA 2DFIA 5GTHC 4UV8A 2QBYB 1R1TA 3WTUC 3CF5F 4XL9A 2A6HF 2JJ7A 4I98B 1QZEA 1X19A 2WAEA 4KT6A 3T5XA 1QZYA 5HS9A 3LSGA 4Y17A 3CC4I 4ENNA 5C3EJ 4MTDA 3ZRGA 2QKMB 2KZVA 3CMMA 3EYYA 4MNUA 3F21A 2EH3A 3DP7A 4Y33A 1MNEA 3FF5A 5HLGA 1VQLI 2EV5A 2PMHA 1ZAOA 2ZNZA 4PGGA 1WHUA 2BVLA 2L4AA 1HCRA 1DPUA 1V55H 4DYRA 1LB2A 2ADUA 3SXYA 1FP2A 2CFOA 2X85A 3BR0A 3Q3SA 4B4CA 2Q8KA 2J5OA 4U0YA 4BNCA 2M7AA 3KLOA 1S3JA 4WF2A 5J4VA 4WX9A 3CUQC 5EEGA 1RIOH 4C30A 2MA3A 4DIQA 3EUHC 1ETOA 2VT2A 1ULYA 3ABTA 3EQLF 3K1MA 1RESA 4RAZA 3KEYA 4IRGA 3S15J 5LBQA 4A3BJ 1FJLA 2MLGA 4WCGA 3K2AA 3RKXA 3KPHA 1WI9A 4DNCA 1MH4A 2IPQX 5DTDA 5D6FA 2HZTA 3CJQB 5J47A 5H6RA 4TV7A 2GOXB 1WSUA 3ML6A 4I7HA 1FWZA 3GMEA 1W5TA 1FY7A 3CZ6A 3REOA 1UFMA 4B3XA 2STTA 2CQKA 2GXAA 2E1OA 1FNNA 4A6EA 1OCZH 1YIJI 5ICFA 5JVTA 2R7OA 2WV0A 2ZFWA 2E1CA 2HVSA 1N75A 1WI3A 2M0MA 2F4MB 3GCMA 1JHFA 3DQVC 2JWTA 3BTIA 4A69C 2QQAA 2GM4A 1K79A 3PM1A 1ERDA 3D5LA 3ZMTA 3LFKA 3E5QA 1NHAA 4GYGA 3OYBA 2JZYA 2PN6A 4DQ2A 4PFPA 2W7NA 3AG4H 3CCYA 3H92A 1SFKA 2BOLA 3Q0WA 2DOAA 4PJ0C 4EJOA 1S7OA 3IH4A 4ITVA 3HSFA 5FLXZ 1FOYA 3ZMZA 4IRHA 2XSJC 4M6VA 1R00A 4H0EA 1JUPA 2QZ8A 1YO5C 1HBXG 5E20A 1WZ2A 5CLSA 4WXDA 4RLQA 1LE8A 3K4KA 1RKTA 5FLXK 1X3WB 1Z0XA 2UV1A 3O6BB 5IYBJ 5JLXA 3QWLA 3T8TA 1U8BA 1XCVA 3S2DJ 1MBFA 3KZIC 3TKYA 4HEA2 4FT8A 2EFWA 4D7NA 1O3SA 3LA3A 3G1MA 3RQIA 2O03A 4DYCA 2DQLA 2E71A 2LH9A 4OAYA 5IP6A 3ABUA 3OS2A 1KU3A 4A3MJ 3HHHA 4E70A 5FO5A 1XSDA 3K1PA 1WQ2A 3FXKA 2DT5A 2VKDA 4BHBA 3OYGA 5FJ8J 3NEUA 4ZJZA 4LD5A 2AQEA 2FBKA 3KLNA 4RAYA 1FMVA 4IHXA 4MEYF 4FCYA 2V1UA 3OSFA 4A3EJ 5E79C 1GT0C 1MSFC 1ONVA 1Z6RA 4P1WA 2H09A 1ZK8A 4UNOA 2AHQA 2QENA 2GIVA 1ZKGA 2DMQA 1DGRM 4M3GA 2VBWA 3CCSI 5EEHA 4PK4A 1YX5A 2HZDA 4E7LA 4EM2A 3CCUI 4FHTA 3S3MA 3ROUA 5JHUA 1U9NA 3S3NA 3OV8A 2K9SA 1TL8A 2F5VA 1B6AA 2JVGA 2BEOA 4C2TA 3EYIA 2EPFA 1MD0A 3H36A 1J7KA 3IKTA 2DTZA 2VC0A 3FMRA 2UUZA 5E18F 4NUBA 5IP9J 4M72A 3GZ5A 5FKLA 4GXOA 3CCEI 1I5ZA 5E3OA 5LHIA 1FPQA 3H0DA 2P6TA 3B6CA 1YLFA 3ASNH 3RZDJ 3M4OJ 4LG0A 3EPZA 1SD5A 1U9OA 2R7UA 1ETYA 3TDZC 3QPSA 3SYTA 4J00A 1W0TA 4JX6A 5IP7J 3QODA 5KK1A 3OIOA 4IXAA 1K6YA 3A0BC 1FMWA 1IN5A 3FXMA 4XKVA 5CVUA 2MYSA 3R60A 1KU9A 2OU2A 5D8LB 2R7SA 5KNLA 4ZDLA 1TWGJ 1TQMA 1WH7A 1YX3A 2PFBA 4BE1A 1O3QA 3HGYA 1CF7A 2WA0A 4D7MA 1USSA 1UZCA 2STWA 4KMFA 1SVMA 4KN4X 3IRRA 5DD8A 2J5PA 3MKWB 2VOPA 1E17A 3IAM2 1GXQA 2M4GA 3ZP5A 2K86A 2NVXJ 2WWYA 3H5AA 3T1BA 4BE0A 2DTRA 3S8PA 2MH2A 2VC1A 2O8XA 2W25A 5ILSA 3LSPA 4IHVA 4M9XA 3QOEA 3GTPJ 3W6JB 1U8RA 2LKXA 3Q9SA 5LHHA 2EZLA 1BIAA 3DPUA 3I56I 5TGTA 1AA7A 1NK3P 2R5YB 4KYWA 4KA4A 3KP5A 3OR1C 4BXXJ 4Y7NJ 3DBLB 3TGNA 4AU7A 1LQ1A 3ZQLA 2R7VA 5BNGA 1S72I 4NB5A 1B72B 1VQ9I 4LLNA 1SC7A 3L2QA 3DV8A 2RVCA 1WJDA 4OAZA 3OOPA 3HBLA 3S1QJ 3FWEA 1MJ9A 1QVUA 3RQ4A 3IC7A 4ZTFA 2HDWA 3BY6A 4OIPF 4MHGA 2HOSA 2OD5A 2VJ4A 4KITB 1WRJA 5IT3A 1KYWA 4A3LJ 4I0AA 3ZQFA 3TBIA 2IBDA 3I9V2 2CGPA 2F6CA 4WWCA 2LR8A 3CC2I 1T6SA 4MQ9F 2E35A 2K4BA 4A3JJ 4RDUA 2R92J 1EJ9A 4QLCU 4RM2A 1JUMA 1L0OC 1XDSA 3HUGA 1R5ID 3EETA 2FJ1A 3TDUC 1OCPA 3DU5A 3PL8A 1IXCA 1P2FA 4N4OB 4U87A 4IEJA 2M0CA 4Y13A 1UG0A 3V7RA 2JA8J 5JHFA 1CQTA 3UNGC 3DKYA 2XRNA 3MZHA 3RKWA 2CQQA 2KQRA 4EEFG 4XR6A 3RI4A 3OS1A 1X2NA 1AKHB 1W5SA 5B1AH 5B66C 3HZJA 3TQNA 1OMIA 3HRTA 3WU0A 5DV5A 2V6CA 1IGNA 2XAJA 2HYFA 3H3VK 4XIDA 2BHYA 1YFHA 1ETVA 3V42A 3R0AA 1I1GA 3F72A 5HNHA 2KHMA 4HDUA 4HSTA 2K9MA 1JKOC 2LG4A 2AS5F 3VWBA 4UHTA 3K0LA 4YIIA 2CUFA 3G4SI 2O7OA 2FX0A 3OOUA 2EWNA 2N8GA 2Z99A 3A0HC 4XRMA 2HXOA 3AKZA 3OY9A 4CGZA 4XRSA 4RS8A 3K4LA 5GADJ 1YTYA 1A35A 3BJ6A 1JTXA 2W48A 2FOWA 4AYBN 2ZCWA 5FKNA 3G6EI 4GGGA 4CO8A 2FU4A 3VYUB 2I5UA 3S2HJ 1R9TJ 2E7WA 2D1HA 2X6WA 2P5VA 1R7JA 3DEWA 2AO9A 2EILH 3N97A 2F4IA 1H0MA 1ETWA 5FFXA 1FT9A 4UVBA 3FXOA 1SMYF 3K69A 1Y39A 3KYDB 4XQFA 3SEZA 1IRGA 1G3YA 1ZGWA 1WPKA 3EUKL 1FC3A 1MZBA 1S9HA 2P7VB 2IRFG 2CQXA 2HS5A 2X1DA 4BDZA 4ZYGA 1NH3A 1S5LC 1MMGA 1YW8A 4HNUA 4NC6A 2M2EA 3J80Z 2DN0A 2IT0A 3WU1B 4L9NA 2VL8A 2K4JA 1VQ4I 4L5EA 1JKPC 3JRGA 2E2IJ 1UJ8A 2BY0A 1U3EM 1G2HA 4HOBA 2P8TA 5E8IA 2EV6A 4CZCA 2MD5A 2AXTC 3L9FA 2LK2A 2HOTA 1GV5A 3BZCA 1TWFJ 2LC2A 2IGMA 1X58A 1XD7A 3PNYA 2DXIA 1T08B 1YS6A 3F6VA 3KEOA 1HDDC 1I6XA 4MQVA 2BW3B 2V7FA 3J81Z 4HQMA 1B72A 2Z9OA 1KA8A 3F8BA 4GO1A 2ZXJA 1J09A 2KIMA 5M3MJ 2G9WA 5JLWA 4MEXF 3CJTB 4BU2A 1MSEC 1KQ9A 1X1AA 5IT9K 3ZN0A 1TWAJ 2XAGA 2ZJRF 3U1KA 2L01A 2B9SA 2VE8A 4GDFA 1F4KA 3A02A 3D0SA 3NAUA 1LDDA 4LITA 4HX4A 1R5HA 1N77A 3LQQA 1YRNA 2LBFA 3L2CA 2COBA 4IL6C 1F5TA 1CGPA 2PG4A 4MIMA 2DU9A 4FX0A 1MDMB 4LB5A 4G7ZF 1T33A 3PUFA 1FP1D 3MZYA 4WXCA 2Q0OA 5CQEA 4LG0B 3DPTA 2IS1A 3FM5A 3HOZJ 2ZMEC 2XPVA 3QPTA 2L54A 3FISA 2O6GE 5E1XA 2GA1A 4XLAA 4IKFA 3OR2C 4L9JA 1ZLJA 4YIFA 4KISA 3ECOA 3E6MA 1OCTC 4BXFA 1EH8A 5J1YA 1ZLKA 3H9JA 2HXIA 1D5VA 3MMYB 3EDPA 3QOPA 3HHGA 3VFZA 1YJNI 2QQ8A 4EM0B 2Y31A 3W6KB 3OYDA 3F22A 1XB4A 2XC7A 2L9NA 1V54H 4IOCF 2FSWA 4A6DA 4XLEA 2OV7A 3DFGA 1MJAA 1X1PA 2JPBA 3GFIA 3GBGA 4N9IA 2HDCA 1FOKA 3JTHA 2M5WA 4UB8C 1FIPA 2XB0X 1R71A 3ASOH 3H9GA 2LRDA 1JT6A 5DM6F 4CSWA 2XPWA 1MIJA 2R5YA 2FOKA 3JW4A 4HQEA 3RKQA 4LB6B 2HEOA 3K4BA 2PJPA 4AYBA 4IX7A 5HLIA 2DO7A 2QWWA 4BQAA 2W84A 3HOSA 2LSOA 3SHFA 3VOEA 1JXSA 2MFZA 3K4CA 3HOUJ 4U7BA 1JUSA 4A0XA 1ITYA 1G3SA 4BAYA 1HKTA 4JP0A 4HF0A 2R0QC 2L2OA 4A3KJ 2L7KA 4UV9A 2G0EA 1PP8F 3JRCA 1UAAA 5DDGA 1SD4A 3L1PA 3HXLA 4MGRA 1E0EA 1TW2A 3MKLA 1J5YA 4M3EA 3HEFA 1X3ZB 1QVTA 1IO2A 1ZGAA 2OQRA 3F0CA 4M6XA 4CCKA 1U2WA 1LPQA 4BL0B 2RDPA 4PSWA 3HTSB 1XC5A 2JT1A 3VSLA 2GOMA 1H8AC 3AL0C 3LMMA 3K70C 2NVQJ 1P4AA 1RUOA 4RAGA 3S1NJ 4RBOA 1UG2A 2W4SA 1MBJA 5IYCJ 1N25A 3CMAI 3I5UA 4QSHA 2ME0A 2M30A 3I4NJ 3ZN1A 3MVPA 4DZJA 2CSOA 4FISA 1W5CC 2OTLI 1TT0A 1D1AA 1RUNA 5HDKA 4P96A 4Z2YA 4XRSG 5DD4A 3HOVJ 2XV4S 4HDVA 5FD5A 2M4KA 2Y75A 1KZHA 1P4WA 3HGGA 2WB1N 4XBFA 1LVKA 5LD2C 1ZRDA 1WJEA 2HQNA 2JUGA 3C2BA 4RGXA 1XS9A 1SFEA 1D0YA 1YJWI 2LLKA 3A01B 3WGHA 1VQMI 5D5WB 5EEAA 2R7WA 2RNGA 4BH9A 4CXFA 5C4JJ 2K02A 3ZGKA 5BPIA 4C3HJ 3JRFA 2GXGA 4EJTA 4U88A 2XGCA 2LMDA 4XLCA 5M5WJ 4BJTA 1D5YA 1LEAA 1HQCA 3HKZN 4XLPF 1OYIA 3M1EA 3ABKH 5D5XB 1TNSA 2JVHA 5FB2A 1T0FC 2VI6A 3FMQA 3J7YJ 1ZYRF 2DLLA 2JA6J 4EVIA 3GZNB 2R7ZJ 1M1EB 2UXXA 1Z9CA 4CCLA 3OS0A 5E17F 1HSJA 1ZRFA 1TWCJ 2GA2A 1TQIA 4XKWA 5HS8A 3CCQI 2QUFA 3BG5A 5FROA 1T56A 2L7MP 1L3LA 1IAWA 1G8XA 1OPCA 3KYCB 4OIOF 4A3CJ 2VIXA 2NXNB 4I01A 3E3VA 2ESHA 3PSFA 1YITI 1W4MA 1V5FA 5LRSA 1LFUP 1BN5A 1ZRCA 4BYYA 3WGIA 2RKHA 3BG9A 2BY1A 1YYVA 1U5TC 3OWTA 2V9PA 2LKPA 3J7AY 2O0YA 1OCCH 2BYVE 1BL0A 3RPUD 5LRRA 1FYLA 1U0JA 5F0HA 3CC7I 1F1ZA 2BW3A 2EZKA 4P55A 1X1DA 1LDKB 3HG9A 2X0LA 5L3DA 3RJPA 4DBQA 3GTKJ 2CWEA 3IAS2 3BCAA 2VBZA 3CCVI 3ESWB 3W2VA 4AD9A 3HL2A 4BBSJ 1OYYA 2DA3A 3BJOA 3Q0VA 2LOOA 1I3QJ 3JCUC 2XSDC 3Q9VA 1IN7A 1K7AA 1WFXA 2PQ8A 3OYEA 3M8FA 1JKQC 2PJRA 4CUGA 2R5ZA 4ENJA 2ZB9A 1F43A 3X2QH 2ECBA 2XGDA 4XKCA 2EFNA 4OINF 2L0KA 2FRHA 4AM3A 5FRNA 3IRQA 9ANTA 2KFDA 1HW1A 1ODDA 2ELKA 1R4MB 1Z7LA 1Z77A 4IRIA 3A1YA 5LFAA 5F0FA 3GTGJ 5FD6A 4ANJA 4CICA 3HOXJ 2Z16A 4UVAA 1Y56A 2E1MC 4FE4A 4ZYAA 5GP9A 1E2XA 5DCFA 3JRAA 4RB2C 1R1VA 2X1EA 3RDIA 4C2UA 4NDLA 4XLNF 4OU0A 4OOIA 1UCRA 3PIPF 4BACA 4XSZF 5CQGA 1IRZA 2ICWG 1PUFA 1WWXA 5CKTA 4CYCB 1W0UA 2LKSA 1LFBA 2PMZN 3TOBA 2O61A 1ON2A 5IOYA 1QO0D 1LFPA 3KCCA 2HDDA 3S17J 4O6JA 3PFYA 4EGZA 2A5WA 3CUQA 3M07A 3BG6A 4K2EA 4U0WA 2LF7A 3U21A 2XDVA 3NWTA 1EF4A 4F55A 1KQ8A 1X1BA 1MNDA 3FK7A 1Q1VA 1RRJA 3MKZA 2Z33A 1VTNC 3ZMUA 3D1NI 1QPIA 5BPDA 3G1OA 2R7QA 4I09A 3KFWX 4B3AA 3WG7H 3BR6A 2WY7Q 2X6XA 3J81K 3B6AA 2VUMJ 3J7AO 2OTJI 4M9ZA 3GFMA 2CUEA 2Q1ZB 3BG3A 1I27A 1SFXA 4JK1X 3DKXA 2KRCA 3E1SA 5D5UB 3HJEA 4PJNA 5ICGA 2DA6A 3M7GA 1BR1A 2BHZA 2FUG2 1SANA 2L7ZA 2JQ7A 1GUUA 3KZZA 3K10A 3LA7A 3P9CA 5DM7F 2B7EA 1GHCA 2EA4A 2EQRA 3CLOA 1FEXA 2MGQA 3FX3A 4DJAA 2IA0A 3ZQ7A 2R4GA 1I6HJ 4HNVA 2CV0A 4HNTA 2HQRA 1XDUA 1K61A 4OIRF 4LOCA 2R93J 3WHBA 4DW6A 3KX2A 2NS7A 2EIMH 3M9AA 3F8NA 3PNVA 3OYAA 4D5CA 2M3AA 1K83J 1UHSA 2WAFA 4JQFA 5D8KB 3PSIA 4YEJA 5J3LA 2NVUB 4LJZF 3V8LA 2XASA 2A6TA 3RPUA 4L5IA 2H8RA 2LFBA 1VZ0A 5KHDA 3FBIB 2L3DA 5DYMA 3H35A 2WC2A 1TZLA 4KIFA 1DUXC 1AKHA 5ICCA 2WADA 5C4XJ 3NWSA 1YI2I 3HRSA 1A5JA 2K9QA 1O57A 3BZ6A 3M1CA 2HFHA 1ZG1A 4D9JA 2O9LA 4ENKA 2EA2A 2V1DA 1D0XA 1MH3A 2XAHA 3BTLA 1LJ9A 2Y69H 4RGSA 4XOPA 1IDYA 5F1RA 2Q2EB 1FYMA 3A03A 3SJMA 2MC4A 5J40A 3LSTA 4A5MA 4R79A 5E8GA 4C3JJ 3CO6C 1S6LA 5F04A 5H20A 1JE8A 1HF0A 2FXAA 1SEUA 2DDAA 2DYRH 1IJWC 5D4RA 3D5SC 4G9YA 1XGMA 1WCMJ 5TISC 4YFXF 2AQFA 4M3DA 1E3PA 5IPAA 4F52A 1O7LA 3RIRA 1G59A 1K78A 1PUFB 4IHTA 3C7JA 4KUMA 3DLAA 3RKYA 3CDHA 1YRNB 4BEHA 1SMTA 2LNBA 2DA2A 2PMUA 3HB9A 1HKSA 3CCMI 5HOOA 1ZGJA 6PAXA 4FETA 1FTTA 1DU6A 3BR3A 2P5KA 2RNJA 2V9KA 3CP2A 5M5XJ 4H4KC 5J8CA 3F6OA 4NC7A 4ZDPA 2R7RA 3CP8A 3OYLA 1VF9A 1X4OA 3E6BA 1YE9A 3ECHA 4PJJA 3RYPA 4EGYA 3QRFF 2XKOA 1QQIA 2DYSH 2Q2EA 5HVQC 2KDOA 2BXYA 3T8RA 4FX4A 5F6FA 5L3BA 1BJAA 2DODA 4X6AJ 4B44A 4UB6C 3PQKA 2MG4A 4AVZA 1SVOA 3ZMSA 2VB6A 2LY1A 2QGUA 4QWQA 4BQOA 3BP8A 5FLMJ 5K5RA 3LSRA 5K5OA 5H6QA 3I64A 2OA4A 1HC8A 1XPXA 1XMAA 2Z3YA 3IP4B 1SAXA 5ILVA 2GLOA 1I3AA 3L2RA 2ZJPF 2VOOA 3CJNA 5ILUA 3UR3C 1J9IA 5E1ZB 3GUDA 1IV6A 2P5LC 2EB7A 1U6GA 4UVCA 3OYFA 3BCBA 4G94A 3HC7A 3QYBA 1RI7A 3VYRB 2HTSA 5BS6A 1VFCA 1DDNA 1BR4A 4HBLA 1HKQA 2K40A 4IHWA 5HODA 3MKYB 3QYFA 4CDGA 3NARA 1QNTA 4XORA 4C9YA 4O5VA 3KP3A 4EMSA 1JJ6C 3LSKA 4X0GA 3OSGA 4BDYA 1XMXA 2XGEA 3AG1H 3DTEA 3TO7A 3W2WA 1B4AA 3IH2A 2JN6A 1JT0A 3F8MA 5IY5H 5A2QK 2W24A 5DEQA 5HNFA 4E7SA 1GDTA 2EK5A 3SZGA 4GYIA 4IOAF 4C2MJ 2HU9A 2P7CB 1D8JA 2FNPA 2G7UA 5GPAA 3FXQA 4QTRA 3JSPA 2DA5A 3BTCA 4LLGF 1G3TA 1T8IA 2BBYA 4RAFA 4LFUA 3ZQQA 1PVEA 4MLOA 2CYYA 4MFDA 3AFHA 5DUKA 5LLQA 1WKMA 5EZGA 4HX8A 4Y4RA 1OYWA 3O8HA 3DF8A 4ZZLA 2O3FA 4P5OA 1SAUA 4I76A 4L0YB 1R49A 2EIJH 3P9KA 3FKJA 4O3MA 4RA2A 1ORKA 3OYJA 4N4NB 1Z67A 3LFUA 1BOAA 2HYJA 2E60A 2NNNA 5LHGA 2GXBA 2MLKA 3ELKA 1FZPB 2NVTJ 1QZZA 1K4TA 2HKOA 5D5VB 2W57A 2L9SA 2XPUA 2DMPA 4QPQA 1PYVA 3ABMH 3R4KA 3RYRA 4NC8A 5J1RA 1ZELA 2PX9A 3KETA 3I59A 3DEEA 3JRIA 4DYQA 3MFKA 1R22A 3S14J 1R5GA 2MC3A 1TC3C 3CQZJ 3E6CC 2VQGA 1MW7A 3NQOA 4HRIA 1AHDP 4HX7A 1MKMA 4F7ZA 4M3FA 4A0ZA 1Y1VJ 3TEDA 2DT6A 2ZJQF 1H9GA 2HTJA 4L5JA 4Y15A 2V4JC 2WTEA 2ZSIB 2FF4A 5FFZA 1LKXA 5H2FC 5K1YA 2GQQA 1NK2P 2EBIA 2A07F 2X9DA 3TO6A 5B3SH 5K5QA 2OUMA 4ESJA 3GX4X 2KJCA 3H3ZA 1B8IB 4B8XA 2K5CA 4A3FJ 2DCEA 4M3BA 1XTAA 2JMWA 2B0LA 4S0HB 1KONA 5ED4A 2A69F 3W2AA 2FBIA 2K9LA 4XLFA 3KIOA 5DCMB 2QEXI 1MDMA 3KE2A 2LF8A 1TNTA 3CUQB 3P9IA 4CCOA 2LBFB 3TMOA 2V26A 4RM3A 3LNQA 3V7CA 2DMTA 2E5ZA 3BR1A 4RLFA 3TP0A 3GTJJ 5BOXA 3HOWJ 4YELA 2V6EA 4HW0A 2ZMEB 4BJ5C 2ELJA 4HAMA 5LGTA 5CVIA 1DQUA 1BI0A 2CH0A 2D45A 1SD6A 1V5GA 4UUTA 1LE8B 2LVSA 3LSHA 3OYHA 3N05A 1TW3A 4U0VA 1TTYA 3H1CA 5EZHA 3LAPA 1FOXA 2NOGA 2YX7A 4IQ4A 1WH5A 2VQHA 3F9KA 3T0YA 4E6KG 3LA2A 4CCNA 2Y9YA 2ZXIA 3HSEA 1JJ8C 2DOFA 4XONA 2L9VA 4EJWA 1TT5B 4WXHA 4HA8A 3S93A 3JRDA 2HWVA 2IS4A 4GRIA 2R5ZB 4PGHA 4RB3C 4G8XA 2HVRA 3CO7C 2X4HA 1FLIA 2LP0A 2KIUA 5CVJA 2R7FA 1J59A 3BOQA 3CD6I 5DCMA 1SFOJ 2ID6A 1Z91A 1Z1DA 3GFJA 4AIKA 2YS9A 2JRTA 4M6YA 3K1NA 4DGWB 1Z7UA 1IW7F 3DCFA 4IJAA 2HKXA 2IGNA 3IUOA 4RGRA 2Y30A 2G7HA 2ZBKA 3SDGA 3DPLC 4LMYA 3W3CA 5JI6A 2FNAA 3G2BA 2L02A 4B1RA 2IW5A 1QA6A 4LLLA 1XN7A 1DGWY 3GXOA 3HRUA 3QPLA 2K85A 3CF2A 2A68F 1KU7A 3WTXC 1PDNC 1PUEE 4AWXB 1ZTRA 3KP4A 2IVMA 4HPQA 4LGWA 3BR5A 4V2GA 1IN8A 2FE3A 3CCLI 3OMYA 1IZ1A 1IRFA 2HI3A 2JSCA 2DJNA 2UXNA 3GLLA 3AL0B 4BEHB 1IN4A 5K7HA 4MTEA 1MBHA 2QVOA 1Q1HA 4A0YA 2VJJA 3ZR8X 4BY1J 4KNYA 1MGTA 3S16J 5LGNA 2EFQA 4CCJA 2KRFA 1JKRC 4IHYA 2VBXA 2NYXA 3RZOJ 3TO9A 4B47A 1QU3A 2XF6A 2K9NA 4YIRX 3ZXSA 4Z6YA 3WHCA 1ON1A 2HPIA 3FKIJ 4BXUA 3BC8A 3I53A 4XN3A 2QSFX 5E3MA 5HLTA 5FKMA 1G6NA 3OYCA 5DS9A 1Y8RB 4XLHA 1EH6A 2EZIA 1DP7P 2MSYA 2CQ7A 5FGMA 2M1BA 3J7ZI 2W82A 2EFPA 1VQNI 3WTSC 1BW5A 3O3KA 4EJUA 2ID3A 4R1HA 5DUIA 2OCCH 2F5EA 2Y2ZA 4PJLA 2O8KA 2DK8A 3QP6A 4XMYA 3RSNA 3VEPA 4EM1A 3GLXA 1WGXA 1YG2A 1NG7A 2IXSA 5EGOA 2ETHA 4F3QA 1DU0A 2IAIA 1Y8QB 2DFHA 4KFCA 3K4MA 3MN2A 4XICA 2TCTA 2ZNYA 3ZQIA 4HLYA 4OMZA 2DFEA 4AVPA 5D6EA 4PDKA 4Q4ZF 5IT9Z 2Z5UA 2RQQA 3PIOF 3F8FA 3BLYA 2ZO4A 2ZFUA 1R1UA 1HSTA 4Q48A 3SFIA 4FQGA 5LEJA 4CYDA 4BY7J 3B02A 2KLOA 3PFIA 4OWRB 3ZMVA 2V1NA 4IO9F 2L7FP 5TRDA 2M9HA 1J0RA 4U7DA 1LNWA 2KPMA 3FXJA 1MMSA 1YQAA 3I59B 4ESFA 4PFOA 1ETXA 2O5RA 4BGDA 3FXLA 1Y6IA 2IA1A 4NQWB 3P7NA 2VXZA 3AG3H 1R58A 5KAIC 2QF7A 3JTGA 2IA2A 1XGSA 2VLAA 5CJ9A 1GVJA 3JSOA 4HV5A 2JK3A 3A2KA 2H1LA 5HS7A 3FXRA 2FQ4A 1W7PD 1QBJA 2H1KA 1LUJB 1EV7A 1H9TA 3SEQA 3HM5A 3CCJI 3ISPA 5F1JA 2DPUA 2GBYA 2D2WA 2FBHA 4ZYHA 3HUGB 2VASA 4UUSA 4WK8F 2TRTA 4QIWN 1S8NA 2JA2A 1ZQ3P 3LQRA 4ENMA 4A3GJ 3F8CA 2K7LA 3BQYA 2LDUA 3DWLE 5AIPA 2W00A 2XROA 2KIFA 3GVAA 1IN6A 1Y0UA 2X6OA 4DZPA 1OQYA 2H27A
chains in the Genus database with same CATH topology
2VT3A 5D4SA 2BV6A 3QPHA 2RGVA 5TJJA 2TDXA 1BI2A 3V8KA 1W7PB 2FQ3A 3J80K 1LEBA 4ZYDA 4L0ZB 3IL2A 1BI1A 2FMYA 3QP5A 1LVAA 2ISZA 3GEZA 1SD7A 2KKOA 4KT5C 3HYIA 3JAMK 4UXNA 3FZVA 1AOYA 1BM9A 2DK5A 2YU3A 1KU2A 1TBXA 4YG2F 2JTVA 4KMUX 4B09A 3LWFA 1O3RA 4G7OF 3QAHA 1UB9A 3SZPA 4HF1A 1GXPA 3GZ6A 2QYOA 5AONA 2EFOA 2QLZA 3M8EA 3KP6A 5CVVA 3E5XA 3RTRA 3G3ZA 1OR7A 3WE2A 5KVRA 1REPC 4I02A 2R3SA 4LK0F 4JBAA 1AWCA 1HXDA 3HRMA 2VN2A 4GCVA 2ESNA 5JFRA 3KP7A 3R0JA 5HDNA 3QU3A 2F2EA 1B1BA 1BI3A 1XMKA 2IP2A 2F5CA 2DAOA 2L4MA 4G6QA 3KEQA 1V4RA 3BWGA 3SQNA 4S05A 4ASNA 2Y0MA 2DBBA 3GFLA 4ZYEA 3DKWA 1J75A 3MQ0A 5BMZA 2VONA 2RC4A 2GZWA 2IJLA 1T38A 2D1VA 1X3UA 1RZ4A 2A61A 1JGSA 1YIOA 3HTUA 2NRAC 2YX4A 4HLXA 3R6SA 2YR2A 4KIBA 4HZFA 3BROA 1B59A 1U78A 5ICEA 2CG4A 1OKRA 4CHUA 3V4GA 3ZPLA 1XSXA 2AXLA 3DXJF 4NQWA 1TLHB 3C18A 2HYGD 1JHHA 3GWZA 3U1DA 4RB1A 3ULQB 3WTTC 1S7AA 5HLHA 2XGXA 4L9TA 3ZMDA 2QQBA 1QPMA 5L3FA 2EJRA 1F9NA 4ETSA 2XAFA 3U9GA 2BGCA 4HF2A 3TOAA 4S04A 5L3CA 1T0FA 2P4WA 4KDPA 3HSRA 3MEXA 4IF4A 1K78B 1KGSA 4BHPA 3FXUA 2HR3A 1W7PA 3CUOA 1IUYA 2HOEA 2RV8A 3I54A 3B73A 1LDJA 1UHMA 1XGOA 4AIHA 1B9MA 2YSRA 3IWZA 3ERED 2QQ9A 1U5TA 3BJAA 3I0TA 5J6XA 3F23A 2MBFA 4I2OA 1C0WA 2W85A 2EV0A 5AIQA 1MJBA 4A5NA 3K9TA 2F5FA 4YFNF 3MAJA 1O7FA 4ZZDA 2M8EA 4M73A 1TQPA 1BC7C 3V8JA 2CFXA 4LK1F 3WE3A 1XSVA 2V1XA 3VB2A 3HOTA 2COMA 2GWRA 1QGPA 1FBUA 1ZH5A 2PI0A 4A2UA 1HW5A 4A12A 1O3TA 2DPDA 4BHCA 5CYVA 2PBIA 2NNYA 3MWMA 3GYHX 2XUBA 3GW2A 1U5TB 3LAJA 1ZREA 2QBYA 2ISYA 2CO5A 2BE5F 2JPCA 3SFZA 4KIGA 3U2RA 3GO5A 2OZUA 4N9HA 4M71A 1IXSB 4ON0A 2A5YB 3COAC 1RNLA 1FSEA 3IWFA 5A2QZ 2PLYA 2V79A 4NHJA 4D0PA 3HIFA 3O2PE 1B9NA 3WTVC 1ZG3A 2K27A 3Q5FA 5BQTA 1IF1A 1P6RA 2DW4A 4CZZA 3GF2A 2VODA 1R36A 5LGUA 2FMLA 3BPXA 1T2KA 3L09A 3AAFA 1XGNA 5JR3A 2NAZA 3EUHA 4AIJA 3E5UA 2H6CA 3QU6A 4IHSA 4YFKF 4Q47A 2OBPA 3WTYC 1FSHA 1UHWA 2E7XA 2DI3A 3KP2A 2OAZA 4Q5SF 3F3XA 4RB0A 3SZTA 3V7SA 1BBYA 1V3FA 5L3GA 3FMSA 1D8KA 4L9VA 4UUVA 1HW2A 2RN7A 1CF7B 2FA5A 1KYZA 2A6EF 3E97A 2H6BA 3S2WA 2MH9A 3WODF 2OZ6A 3G73A 2FEZA 2VE9A 4PCQA 2P6SA 1ZN2A 2F5DA 3IKVA 2UZKA 2XIGA 1D3YA 1YW9A 1P92A 5CVRA 2RQPA 2CW0F 2DQRA 1I1SA 2VBYA 4OIQF 2UWMA 3FHZA 1FX7A 2A3SA 1KQ0A 3MCZA 4I0BA 4EQQA 2GAUA 3KZYA 3C3WA 1P4XA 3I4PA 5L3EA 1K6OA 3RPQA 1STZA 2HGCA 4G7HF 3NRVA 4PZJA 3PQJA 2KJBA 4KN7X 2ZJ2A 4HV6A 1T39A 3FM3A 4EV0A 3WG9A 1G4DA 3H3UA 1T98A 4L18B 4HYEA 1YS7A 3BDDA 2XHKA 5LEKA 4ESBA 1USTA 3I58A 1A04A 2OQGA 2PEXA 1IXRC 3L00A 3CTAA 4IVNA 4M9SA 2XKPA 4N0BA 3WGGA 2M87A 2ZMEA 1ZHFA 4KICA 1BC8C 1ZARA 1J2XA 2E1NA 3JAMZ 1YW7A 2Y48A 1BIBA 4P9FA 4RGUA 2XAQA 5ERIA 2H94A 3DEUA 4XSXF 1Z05A 4R8HA 1PP7U 3L7WA 4OMYA 3N4MA 5J8FA 2C6YA 4G6DA 4XRFA 2M45A 1EH7A 5E1WA 4IPAA 1ZG5A 2ACJA 2YPRA 3IHUA 4EJVA 3WTZA 2NS0A 1XCBA 1DPRA 4P9UA 2XVCA 2ELHA 3R61A 5F64A 3I71A 4M74A 3K2ZA 5HDGA 2ZKZA 3WTWC 2V9VA 3E6DA 4ZH4F 1Z6TA 1FYKA 1FBQA 1G3WA 3C1DA 3VODA 3BPVA 1SFUA 1S29A 1FBSA 1R23A 2QM3A 2R7DA 2DFIA 4UV8A 2QBYB 1R1TA 3WTUC 2A6HF 4I98B 3T5XA 1QZYA 5HS9A 4Y17A 4ENNA 4MTDA 3EYYA 4MNUA 3F21A 3DP7A 3FF5A 5HLGA 2EV5A 4PGGA 1ZAOA 2PMHA 2ZNZA 2L4AA 1DPUA 1LB2A 2ADUA 3SXYA 1FP2A 2Q8KA 2J5OA 4U0YA 4BNCA 3KLOA 1S3JA 4WF2A 4WX9A 3CUQC 5EEGA 1RIOH 2MA3A 2VT2A 3ABTA 1ULYA 3EQLF 3K1MA 4RAZA 4IRGA 5LBQA 2MLGA 4WCGA 3RKXA 1WI9A 4DNCA 2IPQX 5D6FA 2HZTA 5H6RA 4TV7A 1WSUA 3ML6A 4I7HA 1FWZA 1W5TA 1FY7A 3REOA 1UFMA 2STTA 2CQKA 1FNNA 4A6EA 5ICFA 5JVTA 2WV0A 2ZFWA 2E1CA 1JHFA 3DQVC 2QQAA 1K79A 3D5LA 3ZMTA 3LFKA 3E5QA 1NHAA 4GYGA 2JZYA 2PN6A 4DQ2A 3H92A 4EJOA 1S7OA 3HSFA 5FLXZ 3ZMZA 4IRHA 1R00A 4H0EA 2QZ8A 1YO5C 1HBXG 5E20A 5CLSA 4WXDA 5FLXK 3O6BB 3T8TA 1XCVA 3TKYA 1O3SA 4FT8A 2EFWA 3LA3A 2O03A 2DQLA 3ABUA 1KU3A 3HHHA 4E70A 5FO5A 1XSDA 3K1PA 1WQ2A 2DT5A 4BHBA 3NEUA 4LD5A 2FBKA 3KLNA 4RAYA 4MEYF 2V1UA 1ONVA 1Z6RA 2H09A 4UNOA 2QENA 2GIVA 2VBWA 5EEHA 4EM2A 4FHTA 3ROUA 5JHUA 3OV8A 1B6AA 2BEOA 3EYIA 1MD0A 1J7KA 3IKTA 2VC0A 3FMRA 5E18F 4M72A 3GZ5A 4GXOA 1I5ZA 5LHIA 1FPQA 2P6TA 1YLFA 4LG0A 1SD5A 3TDZC 5KK1A 4IXAA 1IN5A 5CVUA 3R60A 1KU9A 2OU2A 5D8LB 1TQMA 1O3QA 1CF7A 2PFBA 1USSA 2STWA 4KMFA 4KN4X 3IRRA 5DD8A 2J5PA 2VOPA 1E17A 1GXQA 3ZP5A 2K86A 2WWYA 3T1BA 2DTRA 2MH2A 2VC1A 2O8XA 2W25A 5ILSA 4M9XA 3W6JB 1U8RA 3Q9SA 5LHHA 1BIAA 4KYWA 4KA4A 3KP5A 1LQ1A 3TGNA 4NB5A 4LLNA 3DV8A 2RVCA 3OOPA 3FWEA 1MJ9A 3IC7A 3BY6A 4OIPF 4MHGA 2OD5A 5IT3A 1WRJA 1KYWA 4I0AA 2CGPA 4WWCA 1T6SA 4MQ9F 2K4BA 4QLCU 1L0OC 1XDSA 3HUGA 3EETA 3TDUC 1IXCA 1P2FA 4Y13A 3V7RA 2XRNA 3MZHA 3RKWA 3RI4A 1W5SA 3TQNA 1OMIA 3HRTA 3WU0A 5DV5A 2V6CA 2XAJA 2HYFA 1YFHA 3R0AA 1I1GA 3F72A 4HDUA 2AS5F 4UHTA 3K0LA 4YIIA 2EWNA 2Z99A 4CGZA 4RS8A 1YTYA 3BJ6A 2ZCWA 4GGGA 4CO8A 2FU4A 2E7WA 2D1HA 2P5VA 1R7JA 3N97A 1H0MA 5FFXA 1FT9A 4UVBA 1SMYF 3K69A 1IRGA 1G3YA 1FC3A 1MZBA 2P7VB 2IRFG 2HS5A 4ZYGA 1YW8A 3J80Z 2IT0A 3WU1B 4L9NA 2K4JA 1U3EM 4HOBA 2P8TA 5E8IA 2EV6A 2MD5A 3L9FA 1XD7A 1YS6A 3F6VA 3KEOA 1I6XA 4MQVA 3J81Z 4HQMA 2Z9OA 1KA8A 3F8BA 4GO1A 2ZXJA 2KIMA 4MEXF 2G9WA 1KQ9A 5IT9K 3ZN0A 2XAGA 2L01A 2VE8A 1F4KA 3D0SA 1LDDA 4HX4A 1R5HA 3LQQA 3L2CA 1F5TA 1CGPA 2PG4A 2DU9A 4FX0A 1MDMB 4LB5A 4G7ZF 1FP1D 3MZYA 4WXCA 2Q0OA 4LG0B 3DPTA 3FM5A 3QPTA 2L54A 2O6GE 5E1XA 2GA1A 4L9JA 1ZLJA 4YIFA 3ECOA 3E6MA 1EH8A 1ZLKA 1D5VA 3EDPA 3QOPA 3HHGA 3VFZA 4EM0B 3W6KB 3F22A 1XB4A 2FSWA 4A6DA 3DFGA 1MJAA 2JPBA 3GFIA 4N9IA 2HDCA 1FOKA 3JTHA 2M5WA 2FOKA 3JW4A 4HQEA 4LB6B 2HEOA 2PJPA 5HLIA 2DO7A 2QWWA 4BQAA 2W84A 3HOSA 2LSOA 3SHFA 3VOEA 1JXSA 4U7BA 4A0XA 1HKTA 1G3SA 4BAYA 4HF0A 4UV9A 1PP8F 5DDGA 1SD4A 4MGRA 1TW2A 1J5YA 1ZGAA 2OQRA 4M6XA 1U2WA 2RDPA 3HTSB 2JT1A 1P4AA 1RUOA 3I5UA 2M30A 3ZN1A 2CSOA 1RUNA 5HDKA 4P96A 4Z2YA 5DD4A 2XV4S 4HDVA 5FD5A 2Y75A 1P4WA 4XBFA 1ZRDA 2HQNA 4RGXA 1SFEA 3WGHA 5D5WB 4BH9A 4CXFA 2K02A 5BPIA 4EJTA 2GXGA 4U88A 1LEAA 1HQCA 4XLPF 1OYIA 3M1EA 5D5XB 1TNSA 5FB2A 3FMQA 1ZYRF 2DLLA 4EVIA 2UXXA 1Z9CA 5E17F 1HSJA 1ZRFA 2GA2A 1TQIA 5HS8A 2QUFA 1L3LA 1IAWA 1OPCA 4OIOF 4I01A 3E3VA 2ESHA 1W4MA 5LRSA 1BN5A 1ZRCA 4BYYA 3WGIA 2RKHA 1YYVA 1U5TC 2LKPA 2O0YA 2BYVE 5LRRA 1FYLA 1F1ZA 4P55A 1LDKB 2X0LA 5L3DA 3RJPA 2CWEA 2VBZA 4AD9A 1OYYA 3BJOA 3Q9VA 1IN7A 1K7AA 2PQ8A 3M8FA 4ENJA 2EFNA 4OINF 2FRHA 3IRQA 1HW1A 1ODDA 4IRIA 5FD6A 4CICA 4UVAA 1E2XA 5DCFA 4RB2C 1R1VA 3RDIA 4XLNF 4OU0A 4OOIA 1UCRA 4XSZF 1WWXA 3TOBA 2O61A 1ON2A 1QO0D 3KCCA 4O6JA 4EGZA 3CUQA 4K2EA 4U0WA 2LF7A 1KQ8A 2Z33A 1VTNC 3ZMUA 5BPDA 4I09A 3KFWX 3J81K 3J7AO 4M9ZA 3GFMA 1I27A 1SFXA 4JK1X 5D5UB 5ICGA 3M7GA 3KZZA 3LA7A 3P9CA 1GHCA 2EA4A 3CLOA 3FX3A 2IA0A 3ZQ7A 2HQRA 1XDUA 4OIRF 3M9AA 3F8NA 4JQFA 5D8KB 4LJZF 3V8LA 2XASA 3RPUA 4L5IA 2L3DA 5DYMA 2WC2A 4KIFA 1DUXC 5ICCA 3HRSA 1O57A 3BZ6A 2HFHA 1ZG1A 4ENKA 2EA2A 2V1DA 2XAHA 4RGSA 1LJ9A 5F1RA 1FYMA 3LSTA 4A5MA 4R79A 5E8GA 3CO6C 1S6LA 1JE8A 5H20A 2FXAA 5D4RA 4G9YA 1XGMA 4YFXF 1O7LA 3RIRA 1K78A 4IHTA 3C7JA 4KUMA 3RKYA 3CDHA 1SMTA 2LNBA 2PMUA 1HKSA 5HOOA 1ZGJA 6PAXA 2P5KA 2RNJA 5J8CA 3F6OA 3E6BA 3ECHA 4EGYA 3RYPA 3QRFF 2XKOA 1QQIA 2Q2EA 5HVQC 3T8RA 4FX4A 5F6FA 5L3BA 1BJAA 3PQKA 3ZMSA 4QWQA 3BP8A 5K5RA 5K5OA 5H6QA 3I64A 2OA4A 1XMAA 2Z3YA 1SAXA 5ILVA 2VOOA 3CJNA 5ILUA 1J9IA 5E1ZB 3GUDA 2P5LC 2EB7A 1U6GA 4UVCA 4G94A 1RI7A 2HTSA 5BS6A 1DDNA 4HBLA 1HKQA 4CDGA 1QNTA 4O5VA 3KP3A 4EMSA 3TO7A 1B4AA 3F8MA 5A2QK 2W24A 5DEQA 2EK5A 4GYIA 2P7CB 1D8JA 2FNPA 2G7UA 3JSPA 3FXQA 4LLGF 1G3TA 2BBYA 4LFUA 2CYYA 5LLQA 5DUKA 1WKMA 4HX8A 4ZZLA 1OYWA 3DF8A 2O3FA 4P5OA 4L0YB 3P9KA 4O3MA 1BOAA 2NNNA 2GXBA 5LHGA 2MLKA 3ELKA 1FZPB 1QZZA 2HKOA 5D5VB 2W57A 3R4KA 3RYRA 3KETA 3I59A 3MFKA 1R22A 1R5GA 2MC3A 3E6CC 3NQOA 4HX7A 1MKMA 4F7ZA 4A0ZA 1H9GA 2HTJA 4L5JA 4Y15A 2WTEA 2FF4A 5FFZA 5K1YA 2GQQA 2A07F 3TO6A 5K5QA 4ESJA 3GX4X 2KJCA 3H3ZA 4B8XA 2B0LA 5ED4A 2A69F 2FBIA 5DCMB 1MDMA 3KE2A 2LF8A 1TNTA 3CUQB 3P9IA 3V7CA 5BOXA 4HW0A 2ZMEB 4HAMA 5LGTA 5CVIA 2D45A 1BI0A 1SD6A 1TW3A 4U0VA 1TTYA 3LAPA 2YX7A 3T0YA 3LA2A 3HSEA 4EJWA 4WXHA 4HA8A 2HWVA 4PGHA 4RB3C 4G8XA 3CO7C 2X4HA 1FLIA 2KIUA 5CVJA 2R7FA 1J59A 3BOQA 5DCMA 1Z91A 4AIKA 1Z1DA 3GFJA 2JRTA 4M6YA 3K1NA 1Z7UA 1IW7F 4IJAA 2HKXA 4RGRA 2G7HA 2ZBKA 3DPLC 4LMYA 5JI6A 2FNAA 2L02A 2IW5A 4LLLA 1XN7A 3GXOA 3HRUA 2A68F 1KU7A 3WTXC 1PDNC 1PUEE 4AWXB 3KP4A 2IVMA 4LGWA 1IN8A 2FE3A 1IZ1A 1IRFA 2JSCA 2UXNA 1IN4A 4MTEA 2QVOA 4A0YA 1Q1HA 4KNYA 1MGTA 5LGNA 2EFQA 2KRFA 2VBXA 2NYXA 3TO9A 1ON1A 4BXUA 3I53A 1G6NA 1EH6A 1DP7P 5FGMA 2M1BA 2EFPA 3WTSC 3O3KA 4EJUA 4R1HA 5DUIA 2F5EA 2DK8A 3QP6A 3VEPA 4EM1A 3GLXA 1YG2A 2ETHA 4KFCA 2ZNYA 4HLYA 4OMZA 4AVPA 5D6EA 4PDKA 4Q4ZF 5IT9Z 2Z5UA 3F8FA 2ZO4A 1R1UA 1HSTA 4Q48A 5LEJA 4CYDA 3B02A 3PFIA 3ZMVA 5TRDA 4U7DA 1J0RA 1LNWA 1YQAA 3I59B 4ESFA 2IA1A 3P7NA 2VXZA 1R58A 3JTGA 2IA2A 1XGSA 5CJ9A 1GVJA 3JSOA 4HV5A 5HS7A 3FXRA 1W7PD 1QBJA 1EV7A 1H9TA 3ISPA 2DPUA 2D2WA 2FBHA 4ZYHA 4WK8F 1S8NA 4ENMA 3LQRA 3F8CA 2K7LA 2LDUA 5AIPA 2XROA 2KIFA 1IN6A 1Y0UA 3GVAA 2H27A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VT3 A;  5D4S A;  2BV6 A;  3QPH A;  2RGV A;  5TJJ A;  2TDX A;  1BI2 A;  3V8K A;  1W7P B;  2FQ3 A;  3J80 K;  1LEB A;  4ZYD A;  4L0Z B;  3IL2 A;  1BI1 A;  2FMY A;  3QP5 A;  1LVA A;  2ISZ A;  3GEZ A;  1SD7 A;  2KKO A;  4KT5 C;  3HYI A;  3JAM K;  4UXN A;  3FZV A;  1AOY A;  1BM9 A;  2DK5 A;  2YU3 A;  1KU2 A;  1TBX A;  4YG2 F;  2JTV A;  4KMU X;  4B09 A;  3LWF A;  1O3R A;  4G7O F;  3QAH A;  1UB9 A;  3SZP A;  4HF1 A;  1GXP A;  3GZ6 A;  2QYO A;  5AON A;  2EFO A;  2QLZ A;  3M8E A;  3KP6 A;  5CVV A;  3E5X A;  3RTR A;  3G3Z A;  1OR7 A;  3WE2 A;  5KVR A;  1REP C;  4I02 A;  2R3S A;  4LK0 F;  4JBA A;  1AWC A;  1HXD A;  3HRM A;  2VN2 A;  4GCV A;  2ESN A;  5JFR A;  3KP7 A;  3R0J A;  5HDN A;  3QU3 A;  2F2E A;  1B1B A;  1BI3 A;  1XMK A;  2IP2 A;  2F5C A;  2DAO A;  2L4M A;  4G6Q A;  3KEQ A;  1V4R A;  3BWG A;  3SQN A;  4S05 A;  4ASN A;  2Y0M A;  2DBB A;  3GFL A;  4ZYE A;  3DKW A;  1J75 A;  3MQ0 A;  5BMZ A;  2VON A;  2RC4 A;  2GZW A;  2IJL A;  1T38 A;  2D1V A;  1X3U A;  1RZ4 A;  2A61 A;  1JGS A;  1YIO A;  3HTU A;  2NRA C;  2YX4 A;  4HLX A;  3R6S A;  2YR2 A;  4KIB A;  4HZF A;  3BRO A;  1B59 A;  1U78 A;  5ICE A;  2CG4 A;  1OKR A;  4CHU A;  3V4G A;  3ZPL A;  1XSX A;  2AXL A;  3DXJ F;  4NQW A;  1TLH B;  3C18 A;  2HYG D;  1JHH A;  3GWZ A;  3U1D A;  4RB1 A;  3ULQ B;  3WTT C;  1S7A A;  5HLH A;  2XGX A;  4L9T A;  3ZMD A;  2QQB A;  1QPM A;  5L3F A;  2EJR A;  1F9N A;  4ETS A;  2XAF A;  3U9G A;  2BGC A;  4HF2 A;  3TOA A;  4S04 A;  5L3C A;  1T0F A;  2P4W A;  4KDP A;  3HSR A;  3MEX A;  4IF4 A;  1K78 B;  1KGS A;  4BHP A;  3FXU A;  2HR3 A;  1W7P A;  3CUO A;  1IUY A;  2HOE A;  2RV8 A;  3I54 A;  3B73 A;  1LDJ A;  1UHM A;  1XGO A;  4AIH A;  1B9M A;  2YSR A;  3IWZ A;  3ERE D;  2QQ9 A;  1U5T A;  3BJA A;  3I0T A;  5J6X A;  3F23 A;  2MBF A;  4I2O A;  1C0W A;  2W85 A;  2EV0 A;  5AIQ A;  1MJB A;  4A5N A;  3K9T A;  2F5F A;  4YFN F;  3MAJ A;  1O7F A;  4ZZD A;  2M8E A;  4M73 A;  1TQP A;  1BC7 C;  3V8J A;  2CFX A;  4LK1 F;  3WE3 A;  1XSV A;  2V1X A;  3VB2 A;  3HOT A;  2COM A;  2GWR A;  1QGP A;  1FBU A;  1ZH5 A;  2PI0 A;  4A2U A;  1HW5 A;  4A12 A;  1O3T A;  2DPD A;  4BHC A;  5CYV A;  2PBI A;  2NNY A;  3MWM A;  3GYH X;  2XUB A;  3GW2 A;  1U5T B;  3LAJ A;  1ZRE A;  2QBY A;  2ISY A;  2CO5 A;  2BE5 F;  2JPC A;  3SFZ A;  4KIG A;  3U2R A;  3GO5 A;  2OZU A;  4N9H A;  4M71 A;  1IXS B;  4ON0 A;  2A5Y B;  3COA C;  1RNL A;  1FSE A;  3IWF A;  5A2Q Z;  2PLY A;  2V79 A;  4NHJ A;  4D0P A;  3HIF A;  3O2P E;  1B9N A;  3WTV C;  1ZG3 A;  2K27 A;  3Q5F A;  5BQT A;  1IF1 A;  1P6R A;  2DW4 A;  4CZZ A;  3GF2 A;  2VOD A;  1R36 A;  5LGU A;  2FML A;  3BPX A;  1T2K A;  3L09 A;  3AAF A;  1XGN A;  5JR3 A;  2NAZ A;  3EUH A;  4AIJ A;  3E5U A;  2H6C A;  3QU6 A;  4IHS A;  4YFK F;  4Q47 A;  2OBP A;  3WTY C;  1FSH A;  1UHW A;  2E7X A;  2DI3 A;  3KP2 A;  2OAZ A;  4Q5S F;  3F3X A;  4RB0 A;  3SZT A;  3V7S A;  1BBY A;  1V3F A;  5L3G A;  3FMS A;  1D8K A;  4L9V A;  4UUV A;  1HW2 A;  2RN7 A;  1CF7 B;  2FA5 A;  1KYZ A;  2A6E F;  3E97 A;  2H6B A;  3S2W A;  2MH9 A;  3WOD F;  2OZ6 A;  3G73 A;  2FEZ A;  2VE9 A;  4PCQ A;  2P6S A;  1ZN2 A;  2F5D A;  3IKV A;  2UZK A;  2XIG A;  1D3Y A;  1YW9 A;  1P92 A;  5CVR A;  2RQP A;  2CW0 F;  2DQR A;  1I1S A;  2VBY A;  4OIQ F;  2UWM A;  3FHZ A;  1FX7 A;  2A3S A;  1KQ0 A;  3MCZ A;  4I0B A;  4EQQ A;  2GAU A;  3KZY A;  3C3W A;  1P4X A;  3I4P A;  5L3E A;  1K6O A;  3RPQ A;  1STZ A;  2HGC A;  4G7H F;  3NRV A;  4PZJ A;  3PQJ A;  2KJB A;  4KN7 X;  2ZJ2 A;  4HV6 A;  1T39 A;  3FM3 A;  4EV0 A;  3WG9 A;  1G4D A;  3H3U A;  1T98 A;  4L18 B;  4HYE A;  1YS7 A;  3BDD A;  2XHK A;  5LEK A;  4ESB A;  1UST A;  3I58 A;  1A04 A;  2OQG A;  2PEX A;  1IXR C;  3L00 A;  3CTA A;  4IVN A;  4M9S A;  2XKP A;  4N0B A;  3WGG A;  2M87 A;  2ZME A;  1ZHF A;  4KIC A;  1BC8 C;  1ZAR A;  1J2X A;  2E1N A;  3JAM Z;  1YW7 A;  2Y48 A;  1BIB A;  4P9F A;  4RGU A;  2XAQ A;  5ERI A;  2H94 A;  3DEU A;  4XSX F;  1Z05 A;  4R8H A;  1PP7 U;  3L7W A;  4OMY A;  3N4M A;  5J8F A;  2C6Y A;  4G6D A;  4XRF A;  2M45 A;  1EH7 A;  5E1W A;  4IPA A;  1ZG5 A;  2ACJ A;  2YPR A;  3IHU A;  4EJV A;  3WTZ A;  2NS0 A;  1XCB A;  1DPR A;  4P9U A;  2XVC A;  2ELH A;  3R61 A;  5F64 A;  3I71 A;  4M74 A;  3K2Z A;  5HDG A;  2ZKZ A;  3WTW C;  2V9V A;  3E6D A;  4ZH4 F;  1Z6T A;  1FYK A;  1FBQ A;  1G3W A;  3C1D A;  3VOD A;  3BPV A;  1SFU A;  1S29 A;  1FBS A;  1R23 A;  2QM3 A;  2R7D A;  2DFI A;  4UV8 A;  2QBY B;  1R1T A;  3WTU C;  2A6H F;  4I98 B;  3T5X A;  1QZY A;  5HS9 A;  4Y17 A;  4ENN A;  4MTD A;  3EYY A;  4MNU A;  3F21 A;  3DP7 A;  3FF5 A;  5HLG A;  2EV5 A;  4PGG A;  1ZAO A;  2PMH A;  2ZNZ A;  2L4A A;  1DPU A;  1LB2 A;  2ADU A;  3SXY A;  1FP2 A;  2Q8K A;  2J5O A;  4U0Y A;  4BNC A;  3KLO A;  1S3J A;  4WF2 A;  4WX9 A;  3CUQ C;  5EEG A;  1RIO H;  2MA3 A;  2VT2 A;  3ABT A;  1ULY A;  3EQL F;  3K1M A;  4RAZ A;  4IRG A;  5LBQ A;  2MLG A;  4WCG A;  3RKX A;  1WI9 A;  4DNC A;  2IPQ X;  5D6F A;  2HZT A;  5H6R A;  4TV7 A;  1WSU A;  3ML6 A;  4I7H A;  1FWZ A;  1W5T A;  1FY7 A;  3REO A;  1UFM A;  2STT A;  2CQK A;  1FNN A;  4A6E A;  5ICF A;  5JVT A;  2WV0 A;  2ZFW A;  2E1C A;  1JHF A;  3DQV C;  2QQA A;  1K79 A;  3D5L A;  3ZMT A;  3LFK A;  3E5Q A;  1NHA A;  4GYG A;  2JZY A;  2PN6 A;  4DQ2 A;  3H92 A;  4EJO A;  1S7O A;  3HSF A;  5FLX Z;  3ZMZ A;  4IRH A;  1R00 A;  4H0E A;  2QZ8 A;  1YO5 C;  1HBX G;  5E20 A;  5CLS A;  4WXD A;  5FLX K;  3O6B B;  3T8T A;  1XCV A;  3TKY A;  1O3S A;  4FT8 A;  2EFW A;  3LA3 A;  2O03 A;  2DQL A;  3ABU A;  1KU3 A;  3HHH A;  4E70 A;  5FO5 A;  1XSD A;  3K1P A;  1WQ2 A;  2DT5 A;  4BHB A;  3NEU A;  4LD5 A;  2FBK A;  3KLN A;  4RAY A;  4MEY F;  2V1U A;  1ONV A;  1Z6R A;  2H09 A;  4UNO A;  2QEN A;  2GIV A;  2VBW A;  5EEH A;  4EM2 A;  4FHT A;  3ROU A;  5JHU A;  3OV8 A;  1B6A A;  2BEO A;  3EYI A;  1MD0 A;  1J7K A;  3IKT A;  2VC0 A;  3FMR A;  5E18 F;  4M72 A;  3GZ5 A;  4GXO A;  1I5Z A;  5LHI A;  1FPQ A;  2P6T A;  1YLF A;  4LG0 A;  1SD5 A;  3TDZ C;  5KK1 A;  4IXA A;  1IN5 A;  5CVU A;  3R60 A;  1KU9 A;  2OU2 A;  5D8L B;  1TQM A;  1O3Q A;  1CF7 A;  2PFB A;  1USS A;  2STW A;  4KMF A;  4KN4 X;  3IRR A;  5DD8 A;  2J5P A;  2VOP A;  1E17 A;  1GXQ A;  3ZP5 A;  2K86 A;  2WWY A;  3T1B A;  2DTR A;  2MH2 A;  2VC1 A;  2O8X A;  2W25 A;  5ILS A;  4M9X A;  3W6J B;  1U8R A;  3Q9S A;  5LHH A;  1BIA A;  4KYW A;  4KA4 A;  3KP5 A;  1LQ1 A;  3TGN A;  4NB5 A;  4LLN A;  3DV8 A;  2RVC A;  3OOP A;  3FWE A;  1MJ9 A;  3IC7 A;  3BY6 A;  4OIP F;  4MHG A;  2OD5 A;  5IT3 A;  1WRJ A;  1KYW A;  4I0A A;  2CGP A;  4WWC A;  1T6S A;  4MQ9 F;  2K4B A;  4QLC U;  1L0O C;  1XDS A;  3HUG A;  3EET A;  3TDU C;  1IXC A;  1P2F A;  4Y13 A;  3V7R A;  2XRN A;  3MZH A;  3RKW A;  3RI4 A;  1W5S A;  3TQN A;  1OMI A;  3HRT A;  3WU0 A;  5DV5 A;  2V6C A;  2XAJ A;  2HYF A;  1YFH A;  3R0A A;  1I1G A;  3F72 A;  4HDU A;  2AS5 F;  4UHT A;  3K0L A;  4YII A;  2EWN A;  2Z99 A;  4CGZ A;  4RS8 A;  1YTY A;  3BJ6 A;  2ZCW A;  4GGG A;  4CO8 A;  2FU4 A;  2E7W A;  2D1H A;  2P5V A;  1R7J A;  3N97 A;  1H0M A;  5FFX A;  1FT9 A;  4UVB A;  1SMY F;  3K69 A;  1IRG A;  1G3Y A;  1FC3 A;  1MZB A;  2P7V B;  2IRF G;  2HS5 A;  4ZYG A;  1YW8 A;  3J80 Z;  2IT0 A;  3WU1 B;  4L9N A;  2K4J A;  1U3E M;  4HOB A;  2P8T A;  5E8I A;  2EV6 A;  2MD5 A;  3L9F A;  1XD7 A;  1YS6 A;  3F6V A;  3KEO A;  1I6X A;  4MQV A;  3J81 Z;  4HQM A;  2Z9O A;  1KA8 A;  3F8B A;  4GO1 A;  2ZXJ A;  2KIM A;  4MEX F;  2G9W A;  1KQ9 A;  5IT9 K;  3ZN0 A;  2XAG A;  2L01 A;  2VE8 A;  1F4K A;  3D0S A;  1LDD A;  4HX4 A;  1R5H A;  3LQQ A;  3L2C A;  1F5T A;  1CGP A;  2PG4 A;  2DU9 A;  4FX0 A;  1MDM B;  4LB5 A;  4G7Z F;  1FP1 D;  3MZY A;  4WXC A;  2Q0O A;  4LG0 B;  3DPT A;  3FM5 A;  3QPT A;  2L54 A;  2O6G E;  5E1X A;  2GA1 A;  4L9J A;  1ZLJ A;  4YIF A;  3ECO A;  3E6M A;  1EH8 A;  1ZLK A;  1D5V A;  3EDP A;  3QOP A;  3HHG A;  3VFZ A;  4EM0 B;  3W6K B;  3F22 A;  1XB4 A;  2FSW A;  4A6D A;  3DFG A;  1MJA A;  2JPB A;  3GFI A;  4N9I A;  2HDC A;  1FOK A;  3JTH A;  2M5W A;  2FOK A;  3JW4 A;  4HQE A;  4LB6 B;  2HEO A;  2PJP A;  5HLI A;  2DO7 A;  2QWW A;  4BQA A;  2W84 A;  3HOS A;  2LSO A;  3SHF A;  3VOE A;  1JXS A;  4U7B A;  4A0X A;  1HKT A;  1G3S A;  4BAY A;  4HF0 A;  4UV9 A;  1PP8 F;  5DDG A;  1SD4 A;  4MGR A;  1TW2 A;  1J5Y A;  1ZGA A;  2OQR A;  4M6X A;  1U2W A;  2RDP A;  3HTS B;  2JT1 A;  1P4A A;  1RUO A;  3I5U A;  2M30 A;  3ZN1 A;  2CSO A;  1RUN A;  5HDK A;  4P96 A;  4Z2Y A;  5DD4 A;  2XV4 S;  4HDV A;  5FD5 A;  2Y75 A;  1P4W A;  4XBF A;  1ZRD A;  2HQN A;  4RGX A;  1SFE A;  3WGH A;  5D5W B;  4BH9 A;  4CXF A;  2K02 A;  5BPI A;  4EJT A;  2GXG A;  4U88 A;  1LEA A;  1HQC A;  4XLP F;  1OYI A;  3M1E A;  5D5X B;  1TNS A;  5FB2 A;  3FMQ A;  1ZYR F;  2DLL A;  4EVI A;  2UXX A;  1Z9C A;  5E17 F;  1HSJ A;  1ZRF A;  2GA2 A;  1TQI A;  5HS8 A;  2QUF A;  1L3L A;  1IAW A;  1OPC A;  4OIO F;  4I01 A;  3E3V A;  2ESH A;  1W4M A;  5LRS A;  1BN5 A;  1ZRC A;  4BYY A;  3WGI A;  2RKH A;  1YYV A;  1U5T C;  2LKP A;  2O0Y A;  2BYV E;  5LRR A;  1FYL A;  1F1Z A;  4P55 A;  1LDK B;  2X0L A;  5L3D A;  3RJP A;  2CWE A;  2VBZ A;  4AD9 A;  1OYY A;  3BJO A;  3Q9V A;  1IN7 A;  1K7A A;  2PQ8 A;  3M8F A;  4ENJ A;  2EFN A;  4OIN F;  2FRH A;  3IRQ A;  1HW1 A;  1ODD A;  4IRI A;  5FD6 A;  4CIC A;  4UVA A;  1E2X A;  5DCF A;  4RB2 C;  1R1V A;  3RDI A;  4XLN F;  4OU0 A;  4OOI A;  1UCR A;  4XSZ F;  1WWX A;  3TOB A;  2O61 A;  1ON2 A;  1QO0 D;  3KCC A;  4O6J A;  4EGZ A;  3CUQ A;  4K2E A;  4U0W A;  2LF7 A;  1KQ8 A;  2Z33 A;  1VTN C;  3ZMU A;  5BPD A;  4I09 A;  3KFW X;  3J81 K;  3J7A O;  4M9Z A;  3GFM A;  1I27 A;  1SFX A;  4JK1 X;  5D5U B;  5ICG A;  3M7G A;  3KZZ A;  3LA7 A;  3P9C A;  1GHC A;  2EA4 A;  3CLO A;  3FX3 A;  2IA0 A;  3ZQ7 A;  2HQR A;  1XDU A;  4OIR F;  3M9A A;  3F8N A;  4JQF A;  5D8K B;  4LJZ F;  3V8L A;  2XAS A;  3RPU A;  4L5I A;  2L3D A;  5DYM A;  2WC2 A;  4KIF A;  1DUX C;  5ICC A;  3HRS A;  1O57 A;  3BZ6 A;  2HFH A;  1ZG1 A;  4ENK A;  2EA2 A;  2V1D A;  2XAH A;  4RGS A;  1LJ9 A;  5F1R A;  1FYM A;  3LST A;  4A5M A;  4R79 A;  5E8G A;  3CO6 C;  1S6L A;  1JE8 A;  5H20 A;  2FXA A;  5D4R A;  4G9Y A;  1XGM A;  4YFX F;  1O7L A;  3RIR A;  1K78 A;  4IHT A;  3C7J A;  4KUM A;  3RKY A;  3CDH A;  1SMT A;  2LNB A;  2PMU A;  1HKS A;  5HOO A;  1ZGJ A;  6PAX A;  2P5K A;  2RNJ A;  5J8C A;  3F6O A;  3E6B A;  3ECH A;  4EGY A;  3RYP A;  3QRF F;  2XKO A;  1QQI A;  2Q2E A;  5HVQ C;  3T8R A;  4FX4 A;  5F6F A;  5L3B A;  1BJA A;  3PQK A;  3ZMS A;  4QWQ A;  3BP8 A;  5K5R A;  5K5O A;  5H6Q A;  3I64 A;  2OA4 A;  1XMA A;  2Z3Y A;  1SAX A;  5ILV A;  2VOO A;  3CJN A;  5ILU A;  1J9I A;  5E1Z B;  3GUD A;  2P5L C;  2EB7 A;  1U6G A;  4UVC A;  4G94 A;  1RI7 A;  2HTS A;  5BS6 A;  1DDN A;  4HBL A;  1HKQ A;  4CDG A;  1QNT A;  4O5V A;  3KP3 A;  4EMS A;  3TO7 A;  1B4A A;  3F8M A;  5A2Q K;  2W24 A;  5DEQ A;  2EK5 A;  4GYI A;  2P7C B;  1D8J A;  2FNP A;  2G7U A;  3JSP A;  3FXQ A;  4LLG F;  1G3T A;  2BBY A;  4LFU A;  2CYY A;  5LLQ A;  5DUK A;  1WKM A;  4HX8 A;  4ZZL A;  1OYW A;  3DF8 A;  2O3F A;  4P5O A;  4L0Y B;  3P9K A;  4O3M A;  1BOA A;  2NNN A;  2GXB A;  5LHG A;  2MLK A;  3ELK A;  1FZP B;  1QZZ A;  2HKO A;  5D5V B;  2W57 A;  3R4K A;  3RYR A;  3KET A;  3I59 A;  3MFK A;  1R22 A;  1R5G A;  2MC3 A;  3E6C C;  3NQO A;  4HX7 A;  1MKM A;  4F7Z A;  4A0Z A;  1H9G A;  2HTJ A;  4L5J A;  4Y15 A;  2WTE A;  2FF4 A;  5FFZ A;  5K1Y A;  2GQQ A;  2A07 F;  3TO6 A;  5K5Q A;  4ESJ A;  3GX4 X;  2KJC A;  3H3Z A;  4B8X A;  2B0L A;  5ED4 A;  2A69 F;  2FBI A;  5DCM B;  1MDM A;  3KE2 A;  2LF8 A;  1TNT A;  3CUQ B;  3P9I A;  3V7C A;  5BOX A;  4HW0 A;  2ZME B;  4HAM A;  5LGT A;  5CVI A;  2D45 A;  1BI0 A;  1SD6 A;  1TW3 A;  4U0V A;  1TTY A;  3LAP A;  2YX7 A;  3T0Y A;  3LA2 A;  3HSE A;  4EJW A;  4WXH A;  4HA8 A;  2HWV A;  4PGH A;  4RB3 C;  4G8X A;  3CO7 C;  2X4H A;  1FLI A;  2KIU A;  5CVJ A;  2R7F A;  1J59 A;  3BOQ A;  5DCM A;  1Z91 A;  4AIK A;  1Z1D A;  3GFJ A;  2JRT A;  4M6Y A;  3K1N A;  1Z7U A;  1IW7 F;  4IJA A;  2HKX A;  4RGR A;  2G7H A;  2ZBK A;  3DPL C;  4LMY A;  5JI6 A;  2FNA A;  2L02 A;  2IW5 A;  4LLL A;  1XN7 A;  3GXO A;  3HRU A;  2A68 F;  1KU7 A;  3WTX C;  1PDN C;  1PUE E;  4AWX B;  3KP4 A;  2IVM A;  4LGW A;  1IN8 A;  2FE3 A;  1IZ1 A;  1IRF A;  2JSC A;  2UXN A;  1IN4 A;  4MTE A;  2QVO A;  4A0Y A;  1Q1H A;  4KNY A;  1MGT A;  5LGN A;  2EFQ A;  2KRF A;  2VBX A;  2NYX A;  3TO9 A;  1ON1 A;  4BXU A;  3I53 A;  1G6N A;  1EH6 A;  1DP7 P;  5FGM A;  2M1B A;  2EFP A;  3WTS C;  3O3K A;  4EJU A;  4R1H A;  5DUI A;  2F5E A;  2DK8 A;  3QP6 A;  3VEP A;  4EM1 A;  3GLX A;  1YG2 A;  2ETH A;  4KFC A;  2ZNY A;  4HLY A;  4OMZ A;  4AVP A;  5D6E A;  4PDK A;  4Q4Z F;  5IT9 Z;  2Z5U A;  3F8F A;  2ZO4 A;  1R1U A;  1HST A;  4Q48 A;  5LEJ A;  4CYD A;  3B02 A;  3PFI A;  3ZMV A;  5TRD A;  4U7D A;  1J0R A;  1LNW A;  1YQA A;  3I59 B;  4ESF A;  2IA1 A;  3P7N A;  2VXZ A;  1R58 A;  3JTG A;  2IA2 A;  1XGS A;  5CJ9 A;  1GVJ A;  3JSO A;  4HV5 A;  5HS7 A;  3FXR A;  1W7P D;  1QBJ A;  1EV7 A;  1H9T A;  3ISP A;  2DPU A;  2D2W A;  2FBH A;  4ZYH A;  4WK8 F;  1S8N A;  4ENM A;  3LQR A;  3F8C A;  2K7L A;  2LDU A;  5AIP A;  2XRO A;  2KIF A;  1IN6 A;  1Y0U A;  3GVA A;  2H27 A; 
#chains in the Genus database with same CATH topology
 2VT3 A;  3CME I;  5EJC A;  5D4S A;  2BV6 A;  3QPH A;  2RGV A;  3G71 I;  5TJJ A;  2TDX A;  2BXZ A;  1BI2 A;  3V8K A;  1W7P B;  2FQ3 A;  3J80 K;  2ECC A;  2KIQ A;  4XM3 A;  4AID A;  1LEB A;  4E7Z A;  5K7Z A;  4ZYD A;  2VQL A;  2LYC A;  4L0Z B;  2A05 A;  4J19 A;  2CMP A;  2RRE A;  3VPR A;  3IL2 A;  3TL4 X;  1BI1 A;  2FMY A;  5CPR B;  1BJZ A;  3BT9 A;  2WY8 Q;  2NVY J;  3QP5 A;  1LVA A;  2ISZ A;  4IQJ A;  4MFE A;  3GEZ A;  1SD7 A;  2L5Q A;  2VKV A;  3DBR B;  2KKO A;  4KT5 C;  3HYI A;  3H5N A;  3JAM K;  2YU9 J;  3LSM A;  4UXN A;  1VQK I;  2I10 A;  3FZV A;  1S7E A;  1TWH J;  1BM9 A;  1GLN A;  4FAS D;  1WJA A;  1AOY A;  2DK5 A;  5GPC A;  2OPT A;  3CES A;  3OYI A;  2BY2 A;  3EUA A;  1YHQ I;  2YU3 A;  1KU2 A;  1TBX A;  4YG2 F;  2YUS A;  2JTV A;  4KMU X;  2DA1 A;  2DT7 B;  3K7A J;  2E2H J;  4JOM A;  1APL C;  2VXD A;  1A36 A;  1MBG A;  3HPG A;  4B09 A;  4ABZ A;  3LWF A;  2H8W A;  4I6Z A;  1O3R A;  2VJI A;  2KIS A;  2F4O B;  3TW7 A;  4G7O F;  3QAH A;  3IH3 A;  4MO7 A;  1BW6 A;  1UB9 A;  3SZP A;  4HF1 A;  1GXP A;  3GZ6 A;  3JRH A;  1R6R A;  2QYO A;  5AON A;  2EFO A;  3HKZ A;  2CUJ A;  2QLZ A;  3M8E A;  2LTP A;  1AU7 A;  5EDN A;  2IS6 A;  3KP6 A;  2B63 J;  2VKE A;  5CVV A;  3E5X A;  3RTR A;  2CRG A;  3G3Z A;  3OL3 A;  3GTM J;  1F36 A;  1OR7 A;  3WE2 A;  3MZ8 A;  5KVR A;  3A01 A;  3GTO J;  4FTH A;  2WAQ A;  1REP C;  1IUF A;  4I02 A;  2R3S A;  3PO3 J;  4LK0 F;  4F93 B;  4JBA A;  1AWC A;  3CJR B;  1HXD A;  2WB1 A;  3HRM A;  2R7X A;  3CLQ A;  4A3I J;  4E7I A;  2VN2 A;  2ZSH B;  2KL4 A;  4GCV A;  5GAH J;  5FRM A;  2ESN A;  5JFR A;  3KP7 A;  3R0J A;  4XOT A;  1BOB A;  5HDN A;  3KYL A;  1ENH A;  3DTK A;  4UUS B;  2JA7 J;  4JX5 A;  5C44 J;  2NOJ B;  1NTC A;  3A4C A;  1UMQ A;  3QU3 A;  2F2E A;  1B1B A;  1QHH D;  1BI3 A;  3LOC A;  1XMK A;  4CA0 A;  4PUS A;  3K4J A;  2IP2 A;  2F5C A;  2DAO A;  2L4M A;  4G6Q A;  2XF5 A;  1P9Q C;  5F27 A;  3KEQ A;  1OFC X;  1V4R A;  3BWG A;  3SQN A;  4S05 A;  1RC9 A;  5J1U A;  2E19 A;  4ASN A;  2DMN A;  3PNT A;  2JA5 J;  2Y0M A;  3D5R C;  2DBB A;  3H0G J;  3GFL A;  3PUB A;  4ZYE A;  3DKW A;  3MD2 A;  1J75 A;  2JUC A;  3MQ0 A;  1IC8 A;  5BMZ A;  2VON A;  2RC4 A;  2GZW A;  4Y52 J;  2IJL A;  4BS9 A;  3VSK A;  1T38 A;  4E7J A;  2D1V A;  1FIA A;  1X3U A;  2FD5 A;  1D1B A;  4J01 A;  1RZ4 A;  2EIK H;  1BA5 A;  2A61 A;  1JGS A;  3FHN A;  1YIO A;  2M7B A;  4II3 A;  3HTU A;  2NRA C;  2YX4 A;  4HLX A;  3R6S A;  2LY2 A;  2OC6 A;  3FDY A;  2YR2 A;  4KIB A;  4HZF A;  1MMN A;  3BRO A;  1I39 A;  1JTY A;  1B59 A;  1U78 A;  5ICE A;  3S32 A;  2CG4 A;  2DOE A;  1OKR A;  4CHU A;  1RET A;  3V4G A;  1W36 D;  1OCO H;  3BR2 A;  2HNH A;  3ZPL A;  1XSX A;  2EIN H;  2AXL A;  3DXJ F;  4NQW A;  4CH7 A;  1TLH B;  3JR9 A;  3I4M J;  3C18 A;  2HYG D;  3OYK A;  1JHH A;  1IRX A;  3GWZ A;  2VQC A;  3U1D A;  4RB1 A;  1ETK A;  4DOZ A;  3OIQ A;  3ULQ B;  3ZQH A;  3WTT C;  2HPM A;  1S7A A;  5HLH A;  2XGX A;  4DBR A;  1VQ7 I;  1X2M A;  2X6Y A;  2ZXW H;  4L9T A;  3ZMD A;  2W1O A;  2QQB A;  1QPM A;  5L3F A;  2EJR A;  1F9N A;  1OLT A;  2F48 A;  3HOY J;  4ETS A;  2XAF A;  4W97 A;  1XG1 A;  3U9G A;  1OR7 C;  2BGC A;  3ZCO A;  1W36 C;  3TOA A;  4HF2 A;  4S04 A;  1VQO I;  5L3C A;  4PSX A;  5E3L A;  1T0F A;  2P4W A;  4KDP A;  2VPL A;  2WV1 A;  3HSR A;  1WVR A;  3MEX A;  4IF4 A;  2CQN A;  1K78 B;  3CDL A;  1KGS A;  1MBE A;  2K3P A;  3FXU A;  3BQZ A;  4BHP A;  2HR3 A;  4F92 B;  1W7P A;  3CUO A;  1JGG A;  1IUY A;  2HOE A;  2RV8 A;  3I54 A;  3B73 A;  5K7F A;  2CV2 A;  1LDJ A;  5JVG F;  1DP3 A;  3OL4 A;  2E1M B;  3I55 I;  1VQP I;  1UHM A;  1XGO A;  2IS2 A;  4AIH A;  2VPR A;  1B9M A;  2YSR A;  3I3L A;  3IWZ A;  3ERE D;  3LSI A;  2QQ9 A;  1U5T A;  3BJA A;  3P5J A;  3I0T A;  5E3N A;  5J6X A;  3W6V A;  3F23 A;  2MBF A;  1H88 C;  4I2O A;  3JRE A;  1C0W A;  3FK6 A;  2W85 A;  2EV0 A;  3K4N A;  3E7L A;  5AIQ A;  1MJB A;  4A5N A;  1A31 A;  3K9T A;  2F5F A;  2QKL B;  2EZH A;  2RAE A;  4YFN F;  2WAQ N;  1D0Z A;  3MAJ A;  1FOW A;  1O7F A;  3ZOB A;  5EF6 A;  4ZZD A;  1WJF A;  2M8E A;  4M73 A;  3PJR A;  1WJC A;  1TQP A;  5EG0 B;  1BC7 C;  2WBM A;  3V8J A;  5FLV A;  2XRL A;  2CFX A;  1TP4 A;  1YJ9 I;  4LK1 F;  1A6Q A;  2KZG A;  3WE3 A;  4X1E A;  1XSV A;  1OJL A;  2V1X A;  3SDB A;  3OYM A;  3CMY A;  3VB2 A;  3HOT A;  4B43 A;  5B5E C;  2COM A;  2GWR A;  1QGP A;  2X51 A;  1FBU A;  1ZH5 A;  2Z2S B;  2PI0 A;  4B48 A;  1HOM A;  3K70 D;  2MD0 A;  4A2U A;  1ZR2 A;  1HW5 A;  4A12 A;  1O3T A;  3VDX A;  2DA4 A;  2JSP A;  2DPD A;  3K6G A;  4BHC A;  5CYV A;  1FTZ A;  4G12 A;  2PBI A;  2NNY A;  1RKW A;  2DA7 A;  3MWM A;  5KAF C;  2XAU A;  3GYH X;  3OYN A;  2CW7 A;  4ZC3 A;  2XUB A;  4BKX A;  1RR8 C;  3GW2 A;  3HDD A;  4BBR J;  1U5T B;  1IDZ A;  3LAJ A;  3M8J A;  1ZRE A;  2QBY A;  5FKO A;  2ISY A;  3DTI A;  5IYD J;  2VKH A;  2CO5 A;  3C2G A;  2OJE D;  4E4H A;  4F91 B;  2BE5 F;  2JPC A;  3SFZ A;  1BR2 A;  4KIG A;  2VJ5 A;  2Z1D A;  3H9Q A;  4HSR A;  2HVQ A;  3U2R A;  3GO5 A;  5GAG J;  5GTI C;  1MMA A;  2OZU A;  2LRE A;  4N9H A;  1R4N B;  3UKG A;  4M71 A;  4XNF A;  2KDZ A;  1IXS B;  4ON0 A;  2A5Y B;  2IGK A;  2OF7 A;  2IEK A;  3COA C;  2IGO A;  1RNL A;  1FSE A;  3IWF A;  1B8I A;  3S1R J;  3E0J B;  5A2Q Z;  1A6I A;  4E7H A;  2BVM A;  1K4S A;  2PLY A;  4YRV A;  1OCR H;  2V79 A;  5F0C A;  4NHJ A;  4D0P A;  3S1M J;  2QCO A;  2KMU A;  3HIF A;  4CYC A;  3O2P E;  1B9N A;  2CU7 A;  3WTV C;  1ZG3 A;  2K27 A;  4BE2 A;  2KRH A;  2Y9Z A;  3Q5F A;  4ZDO A;  5BQT A;  1IF1 A;  1P6R A;  2DW4 A;  4CZZ A;  3GF2 A;  2VOD A;  1V5E A;  4UY8 I;  1R36 A;  2PMZ A;  4BJ6 C;  3GTQ J;  3L2W A;  5LGU A;  4JYK A;  2FML A;  3BPX A;  3FIW A;  1T2K A;  3AG2 H;  4BUP A;  3L09 A;  2E36 A;  3AAF A;  2Y0S N;  1XGN A;  2KT0 A;  5JR3 A;  2NAZ A;  3EUH A;  1Y0N A;  4AIJ A;  3E5U A;  3CCR I;  2H6C A;  3QU6 A;  4IHS A;  4YFK F;  4Q47 A;  2D5V A;  2OBP A;  3CDI A;  3WTY C;  4XN0 A;  2OCE A;  1FSH A;  1UHW A;  1VQ8 I;  1GVD A;  2E7X A;  2DI3 A;  3KP2 A;  2GIZ A;  3TW6 A;  2XB5 A;  3WU2 C;  2OAZ A;  4Q5S F;  2HOA A;  3F3X A;  4RB0 A;  1I50 J;  3SZT A;  3V7S A;  5B1B H;  1BBY A;  4AC0 A;  1V3F A;  5L3G A;  1YOV B;  2K3F A;  3FMS A;  4LIU A;  1D8K A;  4L9V A;  4UUV A;  5M5Y J;  5F08 A;  4A93 J;  1HW2 A;  2RN7 A;  1WJB A;  2FA5 A;  1CF7 B;  1PJR A;  1MBK A;  4D1Q A;  1KYZ A;  2P0W A;  2QSH X;  2A6E F;  3E97 A;  2H6B A;  2KP6 A;  3S2W A;  2MH9 A;  1ACI A;  3WOD F;  3PO2 J;  2OZ6 A;  3OIP A;  1WJ5 A;  3G73 A;  1HA8 A;  2X1C A;  2DMU A;  2FEZ A;  2VE9 A;  4PCQ A;  2P6S A;  1IG7 A;  1ZN2 A;  2CS3 A;  2F5D A;  3IKV A;  4LG3 A;  4XK4 A;  2UZK A;  2XIG A;  1D3Y A;  1HLV A;  1YW9 A;  1EKE A;  1P92 A;  5FKK A;  3BZK A;  5CVR A;  2RQP A;  3S3O A;  2CW0 F;  4NNJ A;  5KCM A;  3ERM A;  2DQR A;  1I1S A;  1N78 A;  3BG7 A;  2VBY A;  4OIQ F;  2UWM A;  3G1L A;  2MW8 A;  2CV1 A;  3FHZ A;  3H5R A;  1FX7 A;  1Z3X A;  3QQA A;  2A3S A;  1KQ0 A;  2E34 A;  3MCZ A;  4QPO A;  4I0B A;  4EQQ A;  1ZR4 A;  2GAU A;  2CUZ A;  3KZY A;  1E3O C;  3C3W A;  4KJZ A;  3JRB A;  1P4X A;  4II2 A;  1X1C A;  3I4P A;  5L3E A;  3DLL F;  1GV2 A;  4A3D J;  1K6O A;  3RPQ A;  1STZ A;  2HGC A;  4G7H F;  3NRV A;  4PZJ A;  1NG6 A;  3PQJ A;  4JX4 A;  5IOZ A;  2BZT A;  2KJB A;  4KN7 X;  2ZJ2 A;  4HV6 A;  1T39 A;  3FM3 A;  1OIS A;  1P7I A;  2QSG X;  4EV0 A;  2JRM A;  2HQ5 A;  3WG9 A;  2NS8 A;  3ABL H;  2R7T A;  1G4D A;  3DU6 A;  3H3U A;  3L2V A;  4GFB A;  1T98 A;  2HQA A;  3ZQC A;  4L18 B;  4AUX A;  4RMN A;  4HYE A;  1YS7 A;  1VQ5 I;  3BDD A;  4D5F A;  1VND A;  2XHK A;  5J4Y A;  4EAT A;  5LEK A;  4ESB A;  2QA4 I;  3GTL J;  1UST A;  3I58 A;  3ZQG A;  3VYT B;  1A04 A;  2OQG A;  2PEX A;  4XKB A;  2ME6 A;  1VQ6 I;  1IXR C;  3L00 A;  3CTA A;  4IVN A;  2XF7 A;  4M9S A;  2XKP A;  4I99 C;  1E3H A;  4N0B A;  3BTJ A;  4NBQ A;  2LD5 A;  1D1C A;  2L9R A;  3WGG A;  2M87 A;  3M3Y J;  1QRY A;  1QHG A;  1POG A;  3RCO A;  2ZME A;  1MNM C;  1XX5 A;  2M8G X;  1ZHF A;  5EGO B;  4KIC A;  5EG0 A;  1BC8 C;  1ZAR A;  1J2X A;  2E1N A;  3JAM Z;  1YW7 A;  2Y48 A;  1H89 C;  1JI8 A;  1T95 A;  1IV8 A;  1BIB A;  4P9F A;  3TP3 A;  4RGU A;  2E5N A;  1RR7 A;  2DFF A;  2X48 A;  1RPW A;  3HPH A;  5GAE J;  2XAQ A;  3QYE A;  3LL7 A;  4HG2 A;  5ERI A;  1UEL B;  2H94 A;  4Y3O A;  2MAB A;  3DEU A;  4XSX F;  1Z05 A;  4R8H A;  1PP7 U;  1MMD A;  3L7W A;  1Z3Y A;  4OMY A;  1SVL A;  4C3I J;  1Z21 A;  2CW8 A;  3N4M A;  4FE7 A;  4LIV A;  5J8F A;  2C6Y A;  4G6D A;  2M34 A;  4XRF A;  2M45 A;  1EH7 A;  5E1W A;  4IPA A;  2DDB A;  1ZG5 A;  1VI0 A;  2ACJ A;  2YPR A;  4V19 K;  4V2F A;  3VYS B;  3FBN B;  4G6T B;  3L2U A;  3IHU A;  3O8G A;  4EJV A;  3ONQ A;  4PJM A;  3WTZ A;  2NS0 A;  1XCB A;  5EYR A;  1DPR A;  4P9U A;  2CJJ A;  2ZC2 A;  4BQQ A;  2LY9 A;  2BY3 A;  5M3F J;  2I8D A;  2Y0S A;  2XVC A;  2ELH A;  3R61 A;  5F64 A;  4E7K A;  3LSJ A;  3I71 A;  4IZZ A;  4M74 A;  2P81 A;  3K2Z A;  5HDG A;  2ZKZ A;  3C2H A;  4CCM A;  3DBH B;  1O4X A;  3WTW C;  2V9V A;  3E6D A;  4ZH4 F;  2PJR B;  1P7J A;  2ZXH A;  1EA3 A;  4ZTJ A;  4BQN A;  1HDP A;  1Z6T A;  1W1W E;  1FYK A;  1FBQ A;  4W1U A;  1G3W A;  3C1D A;  3VOD A;  2E2J J;  3BPV A;  1SFU A;  1S29 A;  1FBS A;  3IV5 A;  1Y1W J;  2DJI A;  1ETQ A;  1R23 A;  3Q0U A;  2QM3 A;  2R7D A;  1X4P A;  2DFI A;  5GTH C;  4UV8 A;  2QBY B;  1R1T A;  3WTU C;  3CF5 F;  4XL9 A;  2A6H F;  2JJ7 A;  4I98 B;  1QZE A;  1X19 A;  2WAE A;  4KT6 A;  3T5X A;  1QZY A;  5HS9 A;  3LSG A;  4Y17 A;  3CC4 I;  4ENN A;  5C3E J;  4MTD A;  3ZRG A;  2QKM B;  2KZV A;  3CMM A;  3EYY A;  4MNU A;  3F21 A;  2EH3 A;  3DP7 A;  4Y33 A;  1MNE A;  3FF5 A;  5HLG A;  1VQL I;  2EV5 A;  2PMH A;  1ZAO A;  2ZNZ A;  4PGG A;  1WHU A;  2BVL A;  2L4A A;  1HCR A;  1DPU A;  1V55 H;  4DYR A;  1LB2 A;  2ADU A;  3SXY A;  1FP2 A;  2CFO A;  2X85 A;  3BR0 A;  3Q3S A;  4B4C A;  2Q8K A;  2J5O A;  4U0Y A;  4BNC A;  2M7A A;  3KLO A;  1S3J A;  4WF2 A;  5J4V A;  4WX9 A;  3CUQ C;  5EEG A;  1RIO H;  4C30 A;  2MA3 A;  4DIQ A;  3EUH C;  1ETO A;  2VT2 A;  1ULY A;  3ABT A;  3EQL F;  3K1M A;  1RES A;  4RAZ A;  3KEY A;  4IRG A;  3S15 J;  5LBQ A;  4A3B J;  1FJL A;  2MLG A;  4WCG A;  3K2A A;  3RKX A;  3KPH A;  1WI9 A;  4DNC A;  1MH4 A;  2IPQ X;  5DTD A;  5D6F A;  2HZT A;  3CJQ B;  5J47 A;  5H6R A;  4TV7 A;  2GOX B;  1WSU A;  3ML6 A;  4I7H A;  1FWZ A;  3GME A;  1W5T A;  1FY7 A;  3CZ6 A;  3REO A;  1UFM A;  4B3X A;  2STT A;  2CQK A;  2GXA A;  2E1O A;  1FNN A;  4A6E A;  1OCZ H;  1YIJ I;  5ICF A;  5JVT A;  2R7O A;  2WV0 A;  2ZFW A;  2E1C A;  2HVS A;  1N75 A;  1WI3 A;  2M0M A;  2F4M B;  3GCM A;  1JHF A;  3DQV C;  2JWT A;  3BTI A;  4A69 C;  2QQA A;  2GM4 A;  1K79 A;  3PM1 A;  1ERD A;  3D5L A;  3ZMT A;  3LFK A;  3E5Q A;  1NHA A;  4GYG A;  3OYB A;  2JZY A;  2PN6 A;  4DQ2 A;  4PFP A;  2W7N A;  3AG4 H;  3CCY A;  3H92 A;  1SFK A;  2BOL A;  3Q0W A;  2DOA A;  4PJ0 C;  4EJO A;  1S7O A;  3IH4 A;  4ITV A;  3HSF A;  5FLX Z;  1FOY A;  3ZMZ A;  4IRH A;  2XSJ C;  4M6V A;  1R00 A;  4H0E A;  1JUP A;  2QZ8 A;  1YO5 C;  1HBX G;  5E20 A;  1WZ2 A;  5CLS A;  4WXD A;  4RLQ A;  1LE8 A;  3K4K A;  1RKT A;  5FLX K;  1X3W B;  1Z0X A;  2UV1 A;  3O6B B;  5IYB J;  5JLX A;  3QWL A;  3T8T A;  1U8B A;  1XCV A;  3S2D J;  1MBF A;  3KZI C;  3TKY A;  4HEA 2;  4FT8 A;  2EFW A;  4D7N A;  1O3S A;  3LA3 A;  3G1M A;  3RQI A;  2O03 A;  4DYC A;  2DQL A;  2E71 A;  2LH9 A;  4OAY A;  5IP6 A;  3ABU A;  3OS2 A;  1KU3 A;  4A3M J;  3HHH A;  4E70 A;  5FO5 A;  1XSD A;  3K1P A;  1WQ2 A;  3FXK A;  2DT5 A;  2VKD A;  4BHB A;  3OYG A;  5FJ8 J;  3NEU A;  4ZJZ A;  4LD5 A;  2AQE A;  2FBK A;  3KLN A;  4RAY A;  1FMV A;  4IHX A;  4MEY F;  4FCY A;  2V1U A;  3OSF A;  4A3E J;  5E79 C;  1GT0 C;  1MSF C;  1ONV A;  1Z6R A;  4P1W A;  2H09 A;  1ZK8 A;  4UNO A;  2AHQ A;  2QEN A;  2GIV A;  1ZKG A;  2DMQ A;  1DGR M;  4M3G A;  2VBW A;  3CCS I;  5EEH A;  4PK4 A;  1YX5 A;  2HZD A;  4E7L A;  4EM2 A;  3CCU I;  4FHT A;  3S3M A;  3ROU A;  5JHU A;  1U9N A;  3S3N A;  3OV8 A;  2K9S A;  1TL8 A;  2F5V A;  1B6A A;  2JVG A;  2BEO A;  4C2T A;  3EYI A;  2EPF A;  1MD0 A;  3H36 A;  1J7K A;  3IKT A;  2DTZ A;  2VC0 A;  3FMR A;  2UUZ A;  5E18 F;  4NUB A;  5IP9 J;  4M72 A;  3GZ5 A;  5FKL A;  4GXO A;  3CCE I;  1I5Z A;  5E3O A;  5LHI A;  1FPQ A;  3H0D A;  2P6T A;  3B6C A;  1YLF A;  3ASN H;  3RZD J;  3M4O J;  4LG0 A;  3EPZ A;  1SD5 A;  1U9O A;  2R7U A;  1ETY A;  3TDZ C;  3QPS A;  3SYT A;  4J00 A;  1W0T A;  4JX6 A;  5IP7 J;  3QOD A;  5KK1 A;  3OIO A;  4IXA A;  1K6Y A;  3A0B C;  1FMW A;  1IN5 A;  3FXM A;  4XKV A;  5CVU A;  2MYS A;  3R60 A;  1KU9 A;  2OU2 A;  5D8L B;  2R7S A;  5KNL A;  4ZDL A;  1TWG J;  1TQM A;  1WH7 A;  1YX3 A;  2PFB A;  4BE1 A;  1O3Q A;  3HGY A;  1CF7 A;  2WA0 A;  4D7M A;  1USS A;  1UZC A;  2STW A;  4KMF A;  1SVM A;  4KN4 X;  3IRR A;  5DD8 A;  2J5P A;  3MKW B;  2VOP A;  1E17 A;  3IAM 2;  1GXQ A;  2M4G A;  3ZP5 A;  2K86 A;  2NVX J;  2WWY A;  3H5A A;  3T1B A;  4BE0 A;  2DTR A;  3S8P A;  2MH2 A;  2VC1 A;  2O8X A;  2W25 A;  5ILS A;  3LSP A;  4IHV A;  4M9X A;  3QOE A;  3GTP J;  3W6J B;  1U8R A;  2LKX A;  3Q9S A;  5LHH A;  2EZL A;  1BIA A;  3DPU A;  3I56 I;  5TGT A;  1AA7 A;  1NK3 P;  2R5Y B;  4KYW A;  4KA4 A;  3KP5 A;  3OR1 C;  4BXX J;  4Y7N J;  3DBL B;  3TGN A;  4AU7 A;  1LQ1 A;  3ZQL A;  2R7V A;  5BNG A;  1S72 I;  4NB5 A;  1B72 B;  1VQ9 I;  4LLN A;  1SC7 A;  3L2Q A;  3DV8 A;  2RVC A;  1WJD A;  4OAZ A;  3OOP A;  3HBL A;  3S1Q J;  3FWE A;  1MJ9 A;  1QVU A;  3RQ4 A;  3IC7 A;  4ZTF A;  2HDW A;  3BY6 A;  4OIP F;  4MHG A;  2HOS A;  2OD5 A;  2VJ4 A;  4KIT B;  1WRJ A;  5IT3 A;  1KYW A;  4A3L J;  4I0A A;  3ZQF A;  3TBI A;  2IBD A;  3I9V 2;  2CGP A;  2F6C A;  4WWC A;  2LR8 A;  3CC2 I;  1T6S A;  4MQ9 F;  2E35 A;  2K4B A;  4A3J J;  4RDU A;  2R92 J;  1EJ9 A;  4QLC U;  4RM2 A;  1JUM A;  1L0O C;  1XDS A;  3HUG A;  1R5I D;  3EET A;  2FJ1 A;  3TDU C;  1OCP A;  3DU5 A;  3PL8 A;  1IXC A;  1P2F A;  4N4O B;  4U87 A;  4IEJ A;  2M0C A;  4Y13 A;  1UG0 A;  3V7R A;  2JA8 J;  5JHF A;  1CQT A;  3UNG C;  3DKY A;  2XRN A;  3MZH A;  3RKW A;  2CQQ A;  2KQR A;  4EEF G;  4XR6 A;  3RI4 A;  3OS1 A;  1X2N A;  1AKH B;  1W5S A;  5B1A H;  5B66 C;  3HZJ A;  3TQN A;  1OMI A;  3HRT A;  3WU0 A;  5DV5 A;  2V6C A;  1IGN A;  2XAJ A;  2HYF A;  3H3V K;  4XID A;  2BHY A;  1YFH A;  1ETV A;  3V42 A;  3R0A A;  1I1G A;  3F72 A;  5HNH A;  2KHM A;  4HDU A;  4HST A;  2K9M A;  1JKO C;  2LG4 A;  2AS5 F;  3VWB A;  4UHT A;  3K0L A;  4YII A;  2CUF A;  3G4S I;  2O7O A;  2FX0 A;  3OOU A;  2EWN A;  2N8G A;  2Z99 A;  3A0H C;  4XRM A;  2HXO A;  3AKZ A;  3OY9 A;  4CGZ A;  4XRS A;  4RS8 A;  3K4L A;  5GAD J;  1YTY A;  1A35 A;  3BJ6 A;  1JTX A;  2W48 A;  2FOW A;  4AYB N;  2ZCW A;  5FKN A;  3G6E I;  4GGG A;  4CO8 A;  2FU4 A;  3VYU B;  2I5U A;  3S2H J;  1R9T J;  2E7W A;  2D1H A;  2X6W A;  2P5V A;  1R7J A;  3DEW A;  2AO9 A;  2EIL H;  3N97 A;  2F4I A;  1H0M A;  1ETW A;  5FFX A;  1FT9 A;  4UVB A;  3FXO A;  1SMY F;  3K69 A;  1Y39 A;  3KYD B;  4XQF A;  3SEZ A;  1IRG A;  1G3Y A;  1ZGW A;  1WPK A;  3EUK L;  1FC3 A;  1MZB A;  1S9H A;  2P7V B;  2IRF G;  2CQX A;  2HS5 A;  2X1D A;  4BDZ A;  4ZYG A;  1NH3 A;  1S5L C;  1MMG A;  1YW8 A;  4HNU A;  4NC6 A;  2M2E A;  3J80 Z;  2DN0 A;  2IT0 A;  3WU1 B;  4L9N A;  2VL8 A;  2K4J A;  1VQ4 I;  4L5E A;  1JKP C;  3JRG A;  2E2I J;  1UJ8 A;  2BY0 A;  1U3E M;  1G2H A;  4HOB A;  2P8T A;  5E8I A;  2EV6 A;  4CZC A;  2MD5 A;  2AXT C;  3L9F A;  2LK2 A;  2HOT A;  1GV5 A;  3BZC A;  1TWF J;  2LC2 A;  2IGM A;  1X58 A;  1XD7 A;  3PNY A;  2DXI A;  1T08 B;  1YS6 A;  3F6V A;  3KEO A;  1HDD C;  1I6X A;  4MQV A;  2BW3 B;  2V7F A;  3J81 Z;  4HQM A;  1B72 A;  2Z9O A;  1KA8 A;  3F8B A;  4GO1 A;  2ZXJ A;  1J09 A;  2KIM A;  5M3M J;  2G9W A;  5JLW A;  4MEX F;  3CJT B;  4BU2 A;  1MSE C;  1KQ9 A;  1X1A A;  5IT9 K;  3ZN0 A;  1TWA J;  2XAG A;  2ZJR F;  3U1K A;  2L01 A;  2B9S A;  2VE8 A;  4GDF A;  1F4K A;  3A02 A;  3D0S A;  3NAU A;  1LDD A;  4LIT A;  4HX4 A;  1R5H A;  1N77 A;  3LQQ A;  1YRN A;  2LBF A;  3L2C A;  2COB A;  4IL6 C;  1F5T A;  1CGP A;  2PG4 A;  4MIM A;  2DU9 A;  4FX0 A;  1MDM B;  4LB5 A;  4G7Z F;  1T33 A;  3PUF A;  1FP1 D;  3MZY A;  4WXC A;  2Q0O A;  5CQE A;  4LG0 B;  3DPT A;  2IS1 A;  3FM5 A;  3HOZ J;  2ZME C;  2XPV A;  3QPT A;  2L54 A;  3FIS A;  2O6G E;  5E1X A;  2GA1 A;  4XLA A;  4IKF A;  3OR2 C;  4L9J A;  1ZLJ A;  4YIF A;  4KIS A;  3ECO A;  3E6M A;  1OCT C;  4BXF A;  1EH8 A;  5J1Y A;  1ZLK A;  3H9J A;  2HXI A;  1D5V A;  3MMY B;  3EDP A;  3QOP A;  3HHG A;  3VFZ A;  1YJN I;  2QQ8 A;  4EM0 B;  2Y31 A;  3W6K B;  3OYD A;  3F22 A;  1XB4 A;  2XC7 A;  2L9N A;  1V54 H;  4IOC F;  2FSW A;  4A6D A;  4XLE A;  2OV7 A;  3DFG A;  1MJA A;  1X1P A;  2JPB A;  3GFI A;  3GBG A;  4N9I A;  2HDC A;  1FOK A;  3JTH A;  2M5W A;  4UB8 C;  1FIP A;  2XB0 X;  1R71 A;  3ASO H;  3H9G A;  2LRD A;  1JT6 A;  5DM6 F;  4CSW A;  2XPW A;  1MIJ A;  2R5Y A;  2FOK A;  3JW4 A;  4HQE A;  3RKQ A;  4LB6 B;  2HEO A;  3K4B A;  2PJP A;  4AYB A;  4IX7 A;  5HLI A;  2DO7 A;  2QWW A;  4BQA A;  2W84 A;  3HOS A;  2LSO A;  3SHF A;  3VOE A;  1JXS A;  2MFZ A;  3K4C A;  3HOU J;  4U7B A;  1JUS A;  4A0X A;  1ITY A;  1G3S A;  4BAY A;  1HKT A;  4JP0 A;  4HF0 A;  2R0Q C;  2L2O A;  4A3K J;  2L7K A;  4UV9 A;  2G0E A;  1PP8 F;  3JRC A;  1UAA A;  5DDG A;  1SD4 A;  3L1P A;  3HXL A;  4MGR A;  1E0E A;  1TW2 A;  3MKL A;  1J5Y A;  4M3E A;  3HEF A;  1X3Z B;  1QVT A;  1IO2 A;  1ZGA A;  2OQR A;  3F0C A;  4M6X A;  4CCK A;  1U2W A;  1LPQ A;  4BL0 B;  2RDP A;  4PSW A;  3HTS B;  1XC5 A;  2JT1 A;  3VSL A;  2GOM A;  1H8A C;  3AL0 C;  3LMM A;  3K70 C;  2NVQ J;  1P4A A;  1RUO A;  4RAG A;  3S1N J;  4RBO A;  1UG2 A;  2W4S A;  1MBJ A;  5IYC J;  1N25 A;  3CMA I;  3I5U A;  4QSH A;  2ME0 A;  2M30 A;  3I4N J;  3ZN1 A;  3MVP A;  4DZJ A;  2CSO A;  4FIS A;  1W5C C;  2OTL I;  1TT0 A;  1D1A A;  1RUN A;  5HDK A;  4P96 A;  4Z2Y A;  4XRS G;  5DD4 A;  3HOV J;  2XV4 S;  4HDV A;  5FD5 A;  2M4K A;  2Y75 A;  1KZH A;  1P4W A;  3HGG A;  2WB1 N;  4XBF A;  1LVK A;  5LD2 C;  1ZRD A;  1WJE A;  2HQN A;  2JUG A;  3C2B A;  4RGX A;  1XS9 A;  1SFE A;  1D0Y A;  1YJW I;  2LLK A;  3A01 B;  3WGH A;  1VQM I;  5D5W B;  5EEA A;  2R7W A;  2RNG A;  4BH9 A;  4CXF A;  5C4J J;  2K02 A;  3ZGK A;  5BPI A;  4C3H J;  3JRF A;  2GXG A;  4EJT A;  4U88 A;  2XGC A;  2LMD A;  4XLC A;  5M5W J;  4BJT A;  1D5Y A;  1LEA A;  1HQC A;  3HKZ N;  4XLP F;  1OYI A;  3M1E A;  3ABK H;  5D5X B;  1TNS A;  2JVH A;  5FB2 A;  1T0F C;  2VI6 A;  3FMQ A;  3J7Y J;  1ZYR F;  2DLL A;  2JA6 J;  4EVI A;  3GZN B;  2R7Z J;  1M1E B;  2UXX A;  1Z9C A;  4CCL A;  3OS0 A;  5E17 F;  1HSJ A;  1ZRF A;  1TWC J;  2GA2 A;  1TQI A;  4XKW A;  5HS8 A;  3CCQ I;  2QUF A;  3BG5 A;  5FRO A;  1T56 A;  2L7M P;  1L3L A;  1IAW A;  1G8X A;  1OPC A;  3KYC B;  4OIO F;  4A3C J;  2VIX A;  2NXN B;  4I01 A;  3E3V A;  2ESH A;  3PSF A;  1YIT I;  1W4M A;  1V5F A;  5LRS A;  1LFU P;  1BN5 A;  1ZRC A;  4BYY A;  3WGI A;  2RKH A;  3BG9 A;  2BY1 A;  1YYV A;  1U5T C;  3OWT A;  2V9P A;  2LKP A;  3J7A Y;  2O0Y A;  1OCC H;  2BYV E;  1BL0 A;  3RPU D;  5LRR A;  1FYL A;  1U0J A;  5F0H A;  3CC7 I;  1F1Z A;  2BW3 A;  2EZK A;  4P55 A;  1X1D A;  1LDK B;  3HG9 A;  2X0L A;  5L3D A;  3RJP A;  4DBQ A;  3GTK J;  2CWE A;  3IAS 2;  3BCA A;  2VBZ A;  3CCV I;  3ESW B;  3W2V A;  4AD9 A;  3HL2 A;  4BBS J;  1OYY A;  2DA3 A;  3BJO A;  3Q0V A;  2LOO A;  1I3Q J;  3JCU C;  2XSD C;  3Q9V A;  1IN7 A;  1K7A A;  1WFX A;  2PQ8 A;  3OYE A;  3M8F A;  1JKQ C;  2PJR A;  4CUG A;  2R5Z A;  4ENJ A;  2ZB9 A;  1F43 A;  3X2Q H;  2ECB A;  2XGD A;  4XKC A;  2EFN A;  4OIN F;  2L0K A;  2FRH A;  4AM3 A;  5FRN A;  3IRQ A;  9ANT A;  2KFD A;  1HW1 A;  1ODD A;  2ELK A;  1R4M B;  1Z7L A;  1Z77 A;  4IRI A;  3A1Y A;  5LFA A;  5F0F A;  3GTG J;  5FD6 A;  4ANJ A;  4CIC A;  3HOX J;  2Z16 A;  4UVA A;  1Y56 A;  2E1M C;  4FE4 A;  4ZYA A;  5GP9 A;  1E2X A;  5DCF A;  3JRA A;  4RB2 C;  1R1V A;  2X1E A;  3RDI A;  4C2U A;  4NDL A;  4XLN F;  4OU0 A;  4OOI A;  1UCR A;  3PIP F;  4BAC A;  4XSZ F;  5CQG A;  1IRZ A;  2ICW G;  1PUF A;  1WWX A;  5CKT A;  4CYC B;  1W0U A;  2LKS A;  1LFB A;  2PMZ N;  3TOB A;  2O61 A;  1ON2 A;  5IOY A;  1QO0 D;  1LFP A;  3KCC A;  2HDD A;  3S17 J;  4O6J A;  3PFY A;  4EGZ A;  2A5W A;  3CUQ A;  3M07 A;  3BG6 A;  4K2E A;  4U0W A;  2LF7 A;  3U21 A;  2XDV A;  3NWT A;  1EF4 A;  4F55 A;  1KQ8 A;  1X1B A;  1MND A;  3FK7 A;  1Q1V A;  1RRJ A;  3MKZ A;  2Z33 A;  1VTN C;  3ZMU A;  3D1N I;  1QPI A;  5BPD A;  3G1O A;  2R7Q A;  4I09 A;  3KFW X;  4B3A A;  3WG7 H;  3BR6 A;  2WY7 Q;  2X6X A;  3J81 K;  3B6A A;  2VUM J;  3J7A O;  2OTJ I;  4M9Z A;  3GFM A;  2CUE A;  2Q1Z B;  3BG3 A;  1I27 A;  1SFX A;  4JK1 X;  3DKX A;  2KRC A;  3E1S A;  5D5U B;  3HJE A;  4PJN A;  5ICG A;  2DA6 A;  3M7G A;  1BR1 A;  2BHZ A;  2FUG 2;  1SAN A;  2L7Z A;  2JQ7 A;  1GUU A;  3KZZ A;  3K10 A;  3LA7 A;  3P9C A;  5DM7 F;  2B7E A;  1GHC A;  2EA4 A;  2EQR A;  3CLO A;  1FEX A;  2MGQ A;  3FX3 A;  4DJA A;  2IA0 A;  3ZQ7 A;  2R4G A;  1I6H J;  4HNV A;  2CV0 A;  4HNT A;  2HQR A;  1XDU A;  1K61 A;  4OIR F;  4LOC A;  2R93 J;  3WHB A;  4DW6 A;  3KX2 A;  2NS7 A;  2EIM H;  3M9A A;  3F8N A;  3PNV A;  3OYA A;  4D5C A;  2M3A A;  1K83 J;  1UHS A;  2WAF A;  4JQF A;  5D8K B;  3PSI A;  4YEJ A;  5J3L A;  2NVU B;  4LJZ F;  3V8L A;  2XAS A;  2A6T A;  3RPU A;  4L5I A;  2H8R A;  2LFB A;  1VZ0 A;  5KHD A;  3FBI B;  2L3D A;  5DYM A;  3H35 A;  2WC2 A;  1TZL A;  4KIF A;  1DUX C;  1AKH A;  5ICC A;  2WAD A;  5C4X J;  3NWS A;  1YI2 I;  3HRS A;  1A5J A;  2K9Q A;  1O57 A;  3BZ6 A;  3M1C A;  2HFH A;  1ZG1 A;  4D9J A;  2O9L A;  4ENK A;  2EA2 A;  2V1D A;  1D0X A;  1MH3 A;  2XAH A;  3BTL A;  1LJ9 A;  2Y69 H;  4RGS A;  4XOP A;  1IDY A;  5F1R A;  2Q2E B;  1FYM A;  3A03 A;  3SJM A;  2MC4 A;  5J40 A;  3LST A;  4A5M A;  4R79 A;  5E8G A;  4C3J J;  3CO6 C;  1S6L A;  5F04 A;  5H20 A;  1JE8 A;  1HF0 A;  2FXA A;  1SEU A;  2DDA A;  2DYR H;  1IJW C;  5D4R A;  3D5S C;  4G9Y A;  1XGM A;  1WCM J;  5TIS C;  4YFX F;  2AQF A;  4M3D A;  1E3P A;  5IPA A;  4F52 A;  1O7L A;  3RIR A;  1G59 A;  1K78 A;  1PUF B;  4IHT A;  3C7J A;  4KUM A;  3DLA A;  3RKY A;  3CDH A;  1YRN B;  4BEH A;  1SMT A;  2LNB A;  2DA2 A;  2PMU A;  3HB9 A;  1HKS A;  3CCM I;  5HOO A;  1ZGJ A;  6PAX A;  4FET A;  1FTT A;  1DU6 A;  3BR3 A;  2P5K A;  2RNJ A;  2V9K A;  3CP2 A;  5M5X J;  4H4K C;  5J8C A;  3F6O A;  4NC7 A;  4ZDP A;  2R7R A;  3CP8 A;  3OYL A;  1VF9 A;  1X4O A;  3E6B A;  1YE9 A;  3ECH A;  4PJJ A;  3RYP A;  4EGY A;  3QRF F;  2XKO A;  1QQI A;  2DYS H;  2Q2E A;  5HVQ C;  2KDO A;  2BXY A;  3T8R A;  4FX4 A;  5F6F A;  5L3B A;  1BJA A;  2DOD A;  4X6A J;  4B44 A;  4UB6 C;  3PQK A;  2MG4 A;  4AVZ A;  1SVO A;  3ZMS A;  2VB6 A;  2LY1 A;  2QGU A;  4QWQ A;  4BQO A;  3BP8 A;  5FLM J;  5K5R A;  3LSR A;  5K5O A;  5H6Q A;  3I64 A;  2OA4 A;  1HC8 A;  1XPX A;  1XMA A;  2Z3Y A;  3IP4 B;  1SAX A;  5ILV A;  2GLO A;  1I3A A;  3L2R A;  2ZJP F;  2VOO A;  3CJN A;  5ILU A;  3UR3 C;  1J9I A;  5E1Z B;  3GUD A;  1IV6 A;  2P5L C;  2EB7 A;  1U6G A;  4UVC A;  3OYF A;  3BCB A;  4G94 A;  3HC7 A;  3QYB A;  1RI7 A;  3VYR B;  2HTS A;  5BS6 A;  1VFC A;  1DDN A;  1BR4 A;  4HBL A;  1HKQ A;  2K40 A;  4IHW A;  5HOD A;  3MKY B;  3QYF A;  4CDG A;  3NAR A;  1QNT A;  4XOR A;  4C9Y A;  4O5V A;  3KP3 A;  4EMS A;  1JJ6 C;  3LSK A;  4X0G A;  3OSG A;  4BDY A;  1XMX A;  2XGE A;  3AG1 H;  3DTE A;  3TO7 A;  3W2W A;  1B4A A;  3IH2 A;  2JN6 A;  1JT0 A;  3F8M A;  5IY5 H;  5A2Q K;  2W24 A;  5DEQ A;  5HNF A;  4E7S A;  1GDT A;  2EK5 A;  3SZG A;  4GYI A;  4IOA F;  4C2M J;  2HU9 A;  2P7C B;  1D8J A;  2FNP A;  2G7U A;  5GPA A;  3FXQ A;  4QTR A;  3JSP A;  2DA5 A;  3BTC A;  4LLG F;  1G3T A;  1T8I A;  2BBY A;  4RAF A;  4LFU A;  3ZQQ A;  1PVE A;  4MLO A;  2CYY A;  4MFD A;  3AFH A;  5DUK A;  5LLQ A;  1WKM A;  5EZG A;  4HX8 A;  4Y4R A;  1OYW A;  3O8H A;  3DF8 A;  4ZZL A;  2O3F A;  4P5O A;  1SAU A;  4I76 A;  4L0Y B;  1R49 A;  2EIJ H;  3P9K A;  3FKJ A;  4O3M A;  4RA2 A;  1ORK A;  3OYJ A;  4N4N B;  1Z67 A;  3LFU A;  1BOA A;  2HYJ A;  2E60 A;  2NNN A;  5LHG A;  2GXB A;  2MLK A;  3ELK A;  1FZP B;  2NVT J;  1QZZ A;  1K4T A;  2HKO A;  5D5V B;  2W57 A;  2L9S A;  2XPU A;  2DMP A;  4QPQ A;  1PYV A;  3ABM H;  3R4K A;  3RYR A;  4NC8 A;  5J1R A;  1ZEL A;  2PX9 A;  3KET A;  3I59 A;  3DEE A;  3JRI A;  4DYQ A;  3MFK A;  1R22 A;  3S14 J;  1R5G A;  2MC3 A;  1TC3 C;  3CQZ J;  3E6C C;  2VQG A;  1MW7 A;  3NQO A;  4HRI A;  1AHD P;  4HX7 A;  1MKM A;  4F7Z A;  4M3F A;  4A0Z A;  1Y1V J;  3TED A;  2DT6 A;  2ZJQ F;  1H9G A;  2HTJ A;  4L5J A;  4Y15 A;  2V4J C;  2WTE A;  2ZSI B;  2FF4 A;  5FFZ A;  1LKX A;  5H2F C;  5K1Y A;  2GQQ A;  1NK2 P;  2EBI A;  2A07 F;  2X9D A;  3TO6 A;  5B3S H;  5K5Q A;  2OUM A;  4ESJ A;  3GX4 X;  2KJC A;  3H3Z A;  1B8I B;  4B8X A;  2K5C A;  4A3F J;  2DCE A;  4M3B A;  1XTA A;  2JMW A;  2B0L A;  4S0H B;  1KON A;  5ED4 A;  2A69 F;  3W2A A;  2FBI A;  2K9L A;  4XLF A;  3KIO A;  5DCM B;  2QEX I;  1MDM A;  3KE2 A;  2LF8 A;  1TNT A;  3CUQ B;  3P9I A;  4CCO A;  2LBF B;  3TMO A;  2V26 A;  4RM3 A;  3LNQ A;  3V7C A;  2DMT A;  2E5Z A;  3BR1 A;  4RLF A;  3TP0 A;  3GTJ J;  5BOX A;  3HOW J;  4YEL A;  2V6E A;  4HW0 A;  2ZME B;  4BJ5 C;  2ELJ A;  4HAM A;  5LGT A;  5CVI A;  1DQU A;  1BI0 A;  2CH0 A;  2D45 A;  1SD6 A;  1V5G A;  4UUT A;  1LE8 B;  2LVS A;  3LSH A;  3OYH A;  3N05 A;  1TW3 A;  4U0V A;  1TTY A;  3H1C A;  5EZH A;  3LAP A;  1FOX A;  2NOG A;  2YX7 A;  4IQ4 A;  1WH5 A;  2VQH A;  3F9K A;  3T0Y A;  4E6K G;  3LA2 A;  4CCN A;  2Y9Y A;  2ZXI A;  3HSE A;  1JJ8 C;  2DOF A;  4XON A;  2L9V A;  4EJW A;  1TT5 B;  4WXH A;  4HA8 A;  3S93 A;  3JRD A;  2HWV A;  2IS4 A;  4GRI A;  2R5Z B;  4PGH A;  4RB3 C;  4G8X A;  2HVR A;  3CO7 C;  2X4H A;  1FLI A;  2LP0 A;  2KIU A;  5CVJ A;  2R7F A;  1J59 A;  3BOQ A;  3CD6 I;  5DCM A;  1SFO J;  2ID6 A;  1Z91 A;  1Z1D A;  3GFJ A;  4AIK A;  2YS9 A;  2JRT A;  4M6Y A;  3K1N A;  4DGW B;  1Z7U A;  1IW7 F;  3DCF A;  4IJA A;  2HKX A;  2IGN A;  3IUO A;  4RGR A;  2Y30 A;  2G7H A;  2ZBK A;  3SDG A;  3DPL C;  4LMY A;  3W3C A;  5JI6 A;  2FNA A;  3G2B A;  2L02 A;  4B1R A;  2IW5 A;  1QA6 A;  4LLL A;  1XN7 A;  1DGW Y;  3GXO A;  3HRU A;  3QPL A;  2K85 A;  3CF2 A;  2A68 F;  1KU7 A;  3WTX C;  1PDN C;  1PUE E;  4AWX B;  1ZTR A;  3KP4 A;  2IVM A;  4HPQ A;  4LGW A;  3BR5 A;  4V2G A;  1IN8 A;  2FE3 A;  3CCL I;  3OMY A;  1IZ1 A;  1IRF A;  2HI3 A;  2JSC A;  2DJN A;  2UXN A;  3GLL A;  3AL0 B;  4BEH B;  1IN4 A;  5K7H A;  4MTE A;  1MBH A;  2QVO A;  1Q1H A;  4A0Y A;  2VJJ A;  3ZR8 X;  4BY1 J;  4KNY A;  1MGT A;  3S16 J;  5LGN A;  2EFQ A;  4CCJ A;  2KRF A;  1JKR C;  4IHY A;  2VBX A;  2NYX A;  3RZO J;  3TO9 A;  4B47 A;  1QU3 A;  2XF6 A;  2K9N A;  4YIR X;  3ZXS A;  4Z6Y A;  3WHC A;  1ON1 A;  2HPI A;  3FKI J;  4BXU A;  3BC8 A;  3I53 A;  4XN3 A;  2QSF X;  5E3M A;  5HLT A;  5FKM A;  1G6N A;  3OYC A;  5DS9 A;  1Y8R B;  4XLH A;  1EH6 A;  2EZI A;  1DP7 P;  2MSY A;  2CQ7 A;  5FGM A;  2M1B A;  3J7Z I;  2W82 A;  2EFP A;  1VQN I;  3WTS C;  1BW5 A;  3O3K A;  4EJU A;  2ID3 A;  4R1H A;  5DUI A;  2OCC H;  2F5E A;  2Y2Z A;  4PJL A;  2O8K A;  2DK8 A;  3QP6 A;  4XMY A;  3RSN A;  3VEP A;  4EM1 A;  3GLX A;  1WGX A;  1YG2 A;  1NG7 A;  2IXS A;  5EGO A;  2ETH A;  4F3Q A;  1DU0 A;  2IAI A;  1Y8Q B;  2DFH A;  4KFC A;  3K4M A;  3MN2 A;  4XIC A;  2TCT A;  2ZNY A;  3ZQI A;  4HLY A;  4OMZ A;  2DFE A;  4AVP A;  5D6E A;  4PDK A;  4Q4Z F;  5IT9 Z;  2Z5U A;  2RQQ A;  3PIO F;  3F8F A;  3BLY A;  2ZO4 A;  2ZFU A;  1R1U A;  1HST A;  4Q48 A;  3SFI A;  4FQG A;  5LEJ A;  4CYD A;  4BY7 J;  3B02 A;  2KLO A;  3PFI A;  4OWR B;  3ZMV A;  2V1N A;  4IO9 F;  2L7F P;  5TRD A;  2M9H A;  1J0R A;  4U7D A;  1LNW A;  2KPM A;  3FXJ A;  1MMS A;  1YQA A;  3I59 B;  4ESF A;  4PFO A;  1ETX A;  2O5R A;  4BGD A;  3FXL A;  1Y6I A;  2IA1 A;  4NQW B;  3P7N A;  2VXZ A;  3AG3 H;  1R58 A;  5KAI C;  2QF7 A;  3JTG A;  2IA2 A;  1XGS A;  2VLA A;  5CJ9 A;  1GVJ A;  3JSO A;  4HV5 A;  2JK3 A;  3A2K A;  2H1L A;  5HS7 A;  3FXR A;  2FQ4 A;  1W7P D;  1QBJ A;  2H1K A;  1LUJ B;  1EV7 A;  1H9T A;  3SEQ A;  3HM5 A;  3CCJ I;  3ISP A;  5F1J A;  2DPU A;  2GBY A;  2D2W A;  2FBH A;  4ZYH A;  3HUG B;  2VAS A;  4UUS A;  4WK8 F;  2TRT A;  4QIW N;  1S8N A;  2JA2 A;  1ZQ3 P;  3LQR A;  4ENM A;  4A3G J;  3F8C A;  2K7L A;  3BQY A;  2LDU A;  3DWL E;  5AIP A;  2W00 A;  2XRO A;  2KIF A;  3GVA A;  1IN6 A;  1Y0U A;  2X6O A;  4DZP A;  1OQY A;  2H27 A; 
#chains in the Genus database with same CATH homology
 2VT3 A;  5D4S A;  2BV6 A;  3QPH A;  2RGV A;  5TJJ A;  2TDX A;  1BI2 A;  3V8K A;  1W7P B;  2FQ3 A;  3J80 K;  1LEB A;  4ZYD A;  4L0Z B;  3IL2 A;  1BI1 A;  2FMY A;  3QP5 A;  1LVA A;  2ISZ A;  3GEZ A;  1SD7 A;  2KKO A;  4KT5 C;  3HYI A;  3JAM K;  4UXN A;  3FZV A;  1AOY A;  1BM9 A;  2DK5 A;  2YU3 A;  1KU2 A;  1TBX A;  4YG2 F;  2JTV A;  4KMU X;  4B09 A;  3LWF A;  1O3R A;  4G7O F;  3QAH A;  1UB9 A;  3SZP A;  4HF1 A;  1GXP A;  3GZ6 A;  2QYO A;  5AON A;  2EFO A;  2QLZ A;  3M8E A;  3KP6 A;  5CVV A;  3E5X A;  3RTR A;  3G3Z A;  1OR7 A;  3WE2 A;  5KVR A;  1REP C;  4I02 A;  2R3S A;  4LK0 F;  4JBA A;  1AWC A;  1HXD A;  3HRM A;  2VN2 A;  4GCV A;  2ESN A;  5JFR A;  3KP7 A;  3R0J A;  5HDN A;  3QU3 A;  2F2E A;  1B1B A;  1BI3 A;  1XMK A;  2IP2 A;  2F5C A;  2DAO A;  2L4M A;  4G6Q A;  3KEQ A;  1V4R A;  3BWG A;  3SQN A;  4S05 A;  4ASN A;  2Y0M A;  2DBB A;  3GFL A;  4ZYE A;  3DKW A;  1J75 A;  3MQ0 A;  5BMZ A;  2VON A;  2RC4 A;  2GZW A;  2IJL A;  1T38 A;  2D1V A;  1X3U A;  1RZ4 A;  2A61 A;  1JGS A;  1YIO A;  3HTU A;  2NRA C;  2YX4 A;  4HLX A;  3R6S A;  2YR2 A;  4KIB A;  4HZF A;  3BRO A;  1B59 A;  1U78 A;  5ICE A;  2CG4 A;  1OKR A;  4CHU A;  3V4G A;  3ZPL A;  1XSX A;  2AXL A;  3DXJ F;  4NQW A;  1TLH B;  3C18 A;  2HYG D;  1JHH A;  3GWZ A;  3U1D A;  4RB1 A;  3ULQ B;  3WTT C;  1S7A A;  5HLH A;  2XGX A;  4L9T A;  3ZMD A;  2QQB A;  1QPM A;  5L3F A;  2EJR A;  1F9N A;  4ETS A;  2XAF A;  3U9G A;  2BGC A;  4HF2 A;  3TOA A;  4S04 A;  5L3C A;  1T0F A;  2P4W A;  4KDP A;  3HSR A;  3MEX A;  4IF4 A;  1K78 B;  1KGS A;  4BHP A;  3FXU A;  2HR3 A;  1W7P A;  3CUO A;  1IUY A;  2HOE A;  2RV8 A;  3I54 A;  3B73 A;  1LDJ A;  1UHM A;  1XGO A;  4AIH A;  1B9M A;  2YSR A;  3IWZ A;  3ERE D;  2QQ9 A;  1U5T A;  3BJA A;  3I0T A;  5J6X A;  3F23 A;  2MBF A;  4I2O A;  1C0W A;  2W85 A;  2EV0 A;  5AIQ A;  1MJB A;  4A5N A;  3K9T A;  2F5F A;  4YFN F;  3MAJ A;  1O7F A;  4ZZD A;  2M8E A;  4M73 A;  1TQP A;  1BC7 C;  3V8J A;  2CFX A;  4LK1 F;  3WE3 A;  1XSV A;  2V1X A;  3VB2 A;  3HOT A;  2COM A;  2GWR A;  1QGP A;  1FBU A;  1ZH5 A;  2PI0 A;  4A2U A;  1HW5 A;  4A12 A;  1O3T A;  2DPD A;  4BHC A;  5CYV A;  2PBI A;  2NNY A;  3MWM A;  3GYH X;  2XUB A;  3GW2 A;  1U5T B;  3LAJ A;  1ZRE A;  2QBY A;  2ISY A;  2CO5 A;  2BE5 F;  2JPC A;  3SFZ A;  4KIG A;  3U2R A;  3GO5 A;  2OZU A;  4N9H A;  4M71 A;  1IXS B;  4ON0 A;  2A5Y B;  3COA C;  1RNL A;  1FSE A;  3IWF A;  5A2Q Z;  2PLY A;  2V79 A;  4NHJ A;  4D0P A;  3HIF A;  3O2P E;  1B9N A;  3WTV C;  1ZG3 A;  2K27 A;  3Q5F A;  5BQT A;  1IF1 A;  1P6R A;  2DW4 A;  4CZZ A;  3GF2 A;  2VOD A;  1R36 A;  5LGU A;  2FML A;  3BPX A;  1T2K A;  3L09 A;  3AAF A;  1XGN A;  5JR3 A;  2NAZ A;  3EUH A;  4AIJ A;  3E5U A;  2H6C A;  3QU6 A;  4IHS A;  4YFK F;  4Q47 A;  2OBP A;  3WTY C;  1FSH A;  1UHW A;  2E7X A;  2DI3 A;  3KP2 A;  2OAZ A;  4Q5S F;  3F3X A;  4RB0 A;  3SZT A;  3V7S A;  1BBY A;  1V3F A;  5L3G A;  3FMS A;  1D8K A;  4L9V A;  4UUV A;  1HW2 A;  2RN7 A;  1CF7 B;  2FA5 A;  1KYZ A;  2A6E F;  3E97 A;  2H6B A;  3S2W A;  2MH9 A;  3WOD F;  2OZ6 A;  3G73 A;  2FEZ A;  2VE9 A;  4PCQ A;  2P6S A;  1ZN2 A;  2F5D A;  3IKV A;  2UZK A;  2XIG A;  1D3Y A;  1YW9 A;  1P92 A;  5CVR A;  2RQP A;  2CW0 F;  2DQR A;  1I1S A;  2VBY A;  4OIQ F;  2UWM A;  3FHZ A;  1FX7 A;  2A3S A;  1KQ0 A;  3MCZ A;  4I0B A;  4EQQ A;  2GAU A;  3KZY A;  3C3W A;  1P4X A;  3I4P A;  5L3E A;  1K6O A;  3RPQ A;  1STZ A;  2HGC A;  4G7H F;  3NRV A;  4PZJ A;  3PQJ A;  2KJB A;  4KN7 X;  2ZJ2 A;  4HV6 A;  1T39 A;  3FM3 A;  4EV0 A;  3WG9 A;  1G4D A;  3H3U A;  1T98 A;  4L18 B;  4HYE A;  1YS7 A;  3BDD A;  2XHK A;  5LEK A;  4ESB A;  1UST A;  3I58 A;  1A04 A;  2OQG A;  2PEX A;  1IXR C;  3L00 A;  3CTA A;  4IVN A;  4M9S A;  2XKP A;  4N0B A;  3WGG A;  2M87 A;  2ZME A;  1ZHF A;  4KIC A;  1BC8 C;  1ZAR A;  1J2X A;  2E1N A;  3JAM Z;  1YW7 A;  2Y48 A;  1BIB A;  4P9F A;  4RGU A;  2XAQ A;  5ERI A;  2H94 A;  3DEU A;  4XSX F;  1Z05 A;  4R8H A;  1PP7 U;  3L7W A;  4OMY A;  3N4M A;  5J8F A;  2C6Y A;  4G6D A;  4XRF A;  2M45 A;  1EH7 A;  5E1W A;  4IPA A;  1ZG5 A;  2ACJ A;  2YPR A;  3IHU A;  4EJV A;  3WTZ A;  2NS0 A;  1XCB A;  1DPR A;  4P9U A;  2XVC A;  2ELH A;  3R61 A;  5F64 A;  3I71 A;  4M74 A;  3K2Z A;  5HDG A;  2ZKZ A;  3WTW C;  2V9V A;  3E6D A;  4ZH4 F;  1Z6T A;  1FYK A;  1FBQ A;  1G3W A;  3C1D A;  3VOD A;  3BPV A;  1SFU A;  1S29 A;  1FBS A;  1R23 A;  2QM3 A;  2R7D A;  2DFI A;  4UV8 A;  2QBY B;  1R1T A;  3WTU C;  2A6H F;  4I98 B;  3T5X A;  1QZY A;  5HS9 A;  4Y17 A;  4ENN A;  4MTD A;  3EYY A;  4MNU A;  3F21 A;  3DP7 A;  3FF5 A;  5HLG A;  2EV5 A;  4PGG A;  1ZAO A;  2PMH A;  2ZNZ A;  2L4A A;  1DPU A;  1LB2 A;  2ADU A;  3SXY A;  1FP2 A;  2Q8K A;  2J5O A;  4U0Y A;  4BNC A;  3KLO A;  1S3J A;  4WF2 A;  4WX9 A;  3CUQ C;  5EEG A;  1RIO H;  2MA3 A;  2VT2 A;  3ABT A;  1ULY A;  3EQL F;  3K1M A;  4RAZ A;  4IRG A;  5LBQ A;  2MLG A;  4WCG A;  3RKX A;  1WI9 A;  4DNC A;  2IPQ X;  5D6F A;  2HZT A;  5H6R A;  4TV7 A;  1WSU A;  3ML6 A;  4I7H A;  1FWZ A;  1W5T A;  1FY7 A;  3REO A;  1UFM A;  2STT A;  2CQK A;  1FNN A;  4A6E A;  5ICF A;  5JVT A;  2WV0 A;  2ZFW A;  2E1C A;  1JHF A;  3DQV C;  2QQA A;  1K79 A;  3D5L A;  3ZMT A;  3LFK A;  3E5Q A;  1NHA A;  4GYG A;  2JZY A;  2PN6 A;  4DQ2 A;  3H92 A;  4EJO A;  1S7O A;  3HSF A;  5FLX Z;  3ZMZ A;  4IRH A;  1R00 A;  4H0E A;  2QZ8 A;  1YO5 C;  1HBX G;  5E20 A;  5CLS A;  4WXD A;  5FLX K;  3O6B B;  3T8T A;  1XCV A;  3TKY A;  1O3S A;  4FT8 A;  2EFW A;  3LA3 A;  2O03 A;  2DQL A;  3ABU A;  1KU3 A;  3HHH A;  4E70 A;  5FO5 A;  1XSD A;  3K1P A;  1WQ2 A;  2DT5 A;  4BHB A;  3NEU A;  4LD5 A;  2FBK A;  3KLN A;  4RAY A;  4MEY F;  2V1U A;  1ONV A;  1Z6R A;  2H09 A;  4UNO A;  2QEN A;  2GIV A;  2VBW A;  5EEH A;  4EM2 A;  4FHT A;  3ROU A;  5JHU A;  3OV8 A;  1B6A A;  2BEO A;  3EYI A;  1MD0 A;  1J7K A;  3IKT A;  2VC0 A;  3FMR A;  5E18 F;  4M72 A;  3GZ5 A;  4GXO A;  1I5Z A;  5LHI A;  1FPQ A;  2P6T A;  1YLF A;  4LG0 A;  1SD5 A;  3TDZ C;  5KK1 A;  4IXA A;  1IN5 A;  5CVU A;  3R60 A;  1KU9 A;  2OU2 A;  5D8L B;  1TQM A;  1O3Q A;  1CF7 A;  2PFB A;  1USS A;  2STW A;  4KMF A;  4KN4 X;  3IRR A;  5DD8 A;  2J5P A;  2VOP A;  1E17 A;  1GXQ A;  3ZP5 A;  2K86 A;  2WWY A;  3T1B A;  2DTR A;  2MH2 A;  2VC1 A;  2O8X A;  2W25 A;  5ILS A;  4M9X A;  3W6J B;  1U8R A;  3Q9S A;  5LHH A;  1BIA A;  4KYW A;  4KA4 A;  3KP5 A;  1LQ1 A;  3TGN A;  4NB5 A;  4LLN A;  3DV8 A;  2RVC A;  3OOP A;  3FWE A;  1MJ9 A;  3IC7 A;  3BY6 A;  4OIP F;  4MHG A;  2OD5 A;  5IT3 A;  1WRJ A;  1KYW A;  4I0A A;  2CGP A;  4WWC A;  1T6S A;  4MQ9 F;  2K4B A;  4QLC U;  1L0O C;  1XDS A;  3HUG A;  3EET A;  3TDU C;  1IXC A;  1P2F A;  4Y13 A;  3V7R A;  2XRN A;  3MZH A;  3RKW A;  3RI4 A;  1W5S A;  3TQN A;  1OMI A;  3HRT A;  3WU0 A;  5DV5 A;  2V6C A;  2XAJ A;  2HYF A;  1YFH A;  3R0A A;  1I1G A;  3F72 A;  4HDU A;  2AS5 F;  4UHT A;  3K0L A;  4YII A;  2EWN A;  2Z99 A;  4CGZ A;  4RS8 A;  1YTY A;  3BJ6 A;  2ZCW A;  4GGG A;  4CO8 A;  2FU4 A;  2E7W A;  2D1H A;  2P5V A;  1R7J A;  3N97 A;  1H0M A;  5FFX A;  1FT9 A;  4UVB A;  1SMY F;  3K69 A;  1IRG A;  1G3Y A;  1FC3 A;  1MZB A;  2P7V B;  2IRF G;  2HS5 A;  4ZYG A;  1YW8 A;  3J80 Z;  2IT0 A;  3WU1 B;  4L9N A;  2K4J A;  1U3E M;  4HOB A;  2P8T A;  5E8I A;  2EV6 A;  2MD5 A;  3L9F A;  1XD7 A;  1YS6 A;  3F6V A;  3KEO A;  1I6X A;  4MQV A;  3J81 Z;  4HQM A;  2Z9O A;  1KA8 A;  3F8B A;  4GO1 A;  2ZXJ A;  2KIM A;  4MEX F;  2G9W A;  1KQ9 A;  5IT9 K;  3ZN0 A;  2XAG A;  2L01 A;  2VE8 A;  1F4K A;  3D0S A;  1LDD A;  4HX4 A;  1R5H A;  3LQQ A;  3L2C A;  1F5T A;  1CGP A;  2PG4 A;  2DU9 A;  4FX0 A;  1MDM B;  4LB5 A;  4G7Z F;  1FP1 D;  3MZY A;  4WXC A;  2Q0O A;  4LG0 B;  3DPT A;  3FM5 A;  3QPT A;  2L54 A;  2O6G E;  5E1X A;  2GA1 A;  4L9J A;  1ZLJ A;  4YIF A;  3ECO A;  3E6M A;  1EH8 A;  1ZLK A;  1D5V A;  3EDP A;  3QOP A;  3HHG A;  3VFZ A;  4EM0 B;  3W6K B;  3F22 A;  1XB4 A;  2FSW A;  4A6D A;  3DFG A;  1MJA A;  2JPB A;  3GFI A;  4N9I A;  2HDC A;  1FOK A;  3JTH A;  2M5W A;  2FOK A;  3JW4 A;  4HQE A;  4LB6 B;  2HEO A;  2PJP A;  5HLI A;  2DO7 A;  2QWW A;  4BQA A;  2W84 A;  3HOS A;  2LSO A;  3SHF A;  3VOE A;  1JXS A;  4U7B A;  4A0X A;  1HKT A;  1G3S A;  4BAY A;  4HF0 A;  4UV9 A;  1PP8 F;  5DDG A;  1SD4 A;  4MGR A;  1TW2 A;  1J5Y A;  1ZGA A;  2OQR A;  4M6X A;  1U2W A;  2RDP A;  3HTS B;  2JT1 A;  1P4A A;  1RUO A;  3I5U A;  2M30 A;  3ZN1 A;  2CSO A;  1RUN A;  5HDK A;  4P96 A;  4Z2Y A;  5DD4 A;  2XV4 S;  4HDV A;  5FD5 A;  2Y75 A;  1P4W A;  4XBF A;  1ZRD A;  2HQN A;  4RGX A;  1SFE A;  3WGH A;  5D5W B;  4BH9 A;  4CXF A;  2K02 A;  5BPI A;  4EJT A;  2GXG A;  4U88 A;  1LEA A;  1HQC A;  4XLP F;  1OYI A;  3M1E A;  5D5X B;  1TNS A;  5FB2 A;  3FMQ A;  1ZYR F;  2DLL A;  4EVI A;  2UXX A;  1Z9C A;  5E17 F;  1HSJ A;  1ZRF A;  2GA2 A;  1TQI A;  5HS8 A;  2QUF A;  1L3L A;  1IAW A;  1OPC A;  4OIO F;  4I01 A;  3E3V A;  2ESH A;  1W4M A;  5LRS A;  1BN5 A;  1ZRC A;  4BYY A;  3WGI A;  2RKH A;  1YYV A;  1U5T C;  2LKP A;  2O0Y A;  2BYV E;  5LRR A;  1FYL A;  1F1Z A;  4P55 A;  1LDK B;  2X0L A;  5L3D A;  3RJP A;  2CWE A;  2VBZ A;  4AD9 A;  1OYY A;  3BJO A;  3Q9V A;  1IN7 A;  1K7A A;  2PQ8 A;  3M8F A;  4ENJ A;  2EFN A;  4OIN F;  2FRH A;  3IRQ A;  1HW1 A;  1ODD A;  4IRI A;  5FD6 A;  4CIC A;  4UVA A;  1E2X A;  5DCF A;  4RB2 C;  1R1V A;  3RDI A;  4XLN F;  4OU0 A;  4OOI A;  1UCR A;  4XSZ F;  1WWX A;  3TOB A;  2O61 A;  1ON2 A;  1QO0 D;  3KCC A;  4O6J A;  4EGZ A;  3CUQ A;  4K2E A;  4U0W A;  2LF7 A;  1KQ8 A;  2Z33 A;  1VTN C;  3ZMU A;  5BPD A;  4I09 A;  3KFW X;  3J81 K;  3J7A O;  4M9Z A;  3GFM A;  1I27 A;  1SFX A;  4JK1 X;  5D5U B;  5ICG A;  3M7G A;  3KZZ A;  3LA7 A;  3P9C A;  1GHC A;  2EA4 A;  3CLO A;  3FX3 A;  2IA0 A;  3ZQ7 A;  2HQR A;  1XDU A;  4OIR F;  3M9A A;  3F8N A;  4JQF A;  5D8K B;  4LJZ F;  3V8L A;  2XAS A;  3RPU A;  4L5I A;  2L3D A;  5DYM A;  2WC2 A;  4KIF A;  1DUX C;  5ICC A;  3HRS A;  1O57 A;  3BZ6 A;  2HFH A;  1ZG1 A;  4ENK A;  2EA2 A;  2V1D A;  2XAH A;  4RGS A;  1LJ9 A;  5F1R A;  1FYM A;  3LST A;  4A5M A;  4R79 A;  5E8G A;  3CO6 C;  1S6L A;  1JE8 A;  5H20 A;  2FXA A;  5D4R A;  4G9Y A;  1XGM A;  4YFX F;  1O7L A;  3RIR A;  1K78 A;  4IHT A;  3C7J A;  4KUM A;  3RKY A;  3CDH A;  1SMT A;  2LNB A;  2PMU A;  1HKS A;  5HOO A;  1ZGJ A;  6PAX A;  2P5K A;  2RNJ A;  5J8C A;  3F6O A;  3E6B A;  3ECH A;  4EGY A;  3RYP A;  3QRF F;  2XKO A;  1QQI A;  2Q2E A;  5HVQ C;  3T8R A;  4FX4 A;  5F6F A;  5L3B A;  1BJA A;  3PQK A;  3ZMS A;  4QWQ A;  3BP8 A;  5K5R A;  5K5O A;  5H6Q A;  3I64 A;  2OA4 A;  1XMA A;  2Z3Y A;  1SAX A;  5ILV A;  2VOO A;  3CJN A;  5ILU A;  1J9I A;  5E1Z B;  3GUD A;  2P5L C;  2EB7 A;  1U6G A;  4UVC A;  4G94 A;  1RI7 A;  2HTS A;  5BS6 A;  1DDN A;  4HBL A;  1HKQ A;  4CDG A;  1QNT A;  4O5V A;  3KP3 A;  4EMS A;  3TO7 A;  1B4A A;  3F8M A;  5A2Q K;  2W24 A;  5DEQ A;  2EK5 A;  4GYI A;  2P7C B;  1D8J A;  2FNP A;  2G7U A;  3JSP A;  3FXQ A;  4LLG F;  1G3T A;  2BBY A;  4LFU A;  2CYY A;  5LLQ A;  5DUK A;  1WKM A;  4HX8 A;  4ZZL A;  1OYW A;  3DF8 A;  2O3F A;  4P5O A;  4L0Y B;  3P9K A;  4O3M A;  1BOA A;  2NNN A;  2GXB A;  5LHG A;  2MLK A;  3ELK A;  1FZP B;  1QZZ A;  2HKO A;  5D5V B;  2W57 A;  3R4K A;  3RYR A;  3KET A;  3I59 A;  3MFK A;  1R22 A;  1R5G A;  2MC3 A;  3E6C C;  3NQO A;  4HX7 A;  1MKM A;  4F7Z A;  4A0Z A;  1H9G A;  2HTJ A;  4L5J A;  4Y15 A;  2WTE A;  2FF4 A;  5FFZ A;  5K1Y A;  2GQQ A;  2A07 F;  3TO6 A;  5K5Q A;  4ESJ A;  3GX4 X;  2KJC A;  3H3Z A;  4B8X A;  2B0L A;  5ED4 A;  2A69 F;  2FBI A;  5DCM B;  1MDM A;  3KE2 A;  2LF8 A;  1TNT A;  3CUQ B;  3P9I A;  3V7C A;  5BOX A;  4HW0 A;  2ZME B;  4HAM A;  5LGT A;  5CVI A;  2D45 A;  1BI0 A;  1SD6 A;  1TW3 A;  4U0V A;  1TTY A;  3LAP A;  2YX7 A;  3T0Y A;  3LA2 A;  3HSE A;  4EJW A;  4WXH A;  4HA8 A;  2HWV A;  4PGH A;  4RB3 C;  4G8X A;  3CO7 C;  2X4H A;  1FLI A;  2KIU A;  5CVJ A;  2R7F A;  1J59 A;  3BOQ A;  5DCM A;  1Z91 A;  4AIK A;  1Z1D A;  3GFJ A;  2JRT A;  4M6Y A;  3K1N A;  1Z7U A;  1IW7 F;  4IJA A;  2HKX A;  4RGR A;  2G7H A;  2ZBK A;  3DPL C;  4LMY A;  5JI6 A;  2FNA A;  2L02 A;  2IW5 A;  4LLL A;  1XN7 A;  3GXO A;  3HRU A;  2A68 F;  1KU7 A;  3WTX C;  1PDN C;  1PUE E;  4AWX B;  3KP4 A;  2IVM A;  4LGW A;  1IN8 A;  2FE3 A;  1IZ1 A;  1IRF A;  2JSC A;  2UXN A;  1IN4 A;  4MTE A;  2QVO A;  4A0Y A;  1Q1H A;  4KNY A;  1MGT A;  5LGN A;  2EFQ A;  2KRF A;  2VBX A;  2NYX A;  3TO9 A;  1ON1 A;  4BXU A;  3I53 A;  1G6N A;  1EH6 A;  1DP7 P;  5FGM A;  2M1B A;  2EFP A;  3WTS C;  3O3K A;  4EJU A;  4R1H A;  5DUI A;  2F5E A;  2DK8 A;  3QP6 A;  3VEP A;  4EM1 A;  3GLX A;  1YG2 A;  2ETH A;  4KFC A;  2ZNY A;  4HLY A;  4OMZ A;  4AVP A;  5D6E A;  4PDK A;  4Q4Z F;  5IT9 Z;  2Z5U A;  3F8F A;  2ZO4 A;  1R1U A;  1HST A;  4Q48 A;  5LEJ A;  4CYD A;  3B02 A;  3PFI A;  3ZMV A;  5TRD A;  4U7D A;  1J0R A;  1LNW A;  1YQA A;  3I59 B;  4ESF A;  2IA1 A;  3P7N A;  2VXZ A;  1R58 A;  3JTG A;  2IA2 A;  1XGS A;  5CJ9 A;  1GVJ A;  3JSO A;  4HV5 A;  5HS7 A;  3FXR A;  1W7P D;  1QBJ A;  1EV7 A;  1H9T A;  3ISP A;  2DPU A;  2D2W A;  2FBH A;  4ZYH A;  4WK8 F;  1S8N A;  4ENM A;  3LQR A;  3F8C A;  2K7L A;  2LDU A;  5AIP A;  2XRO A;  2KIF A;  1IN6 A;  1Y0U A;  3GVA A;  2H27 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...