1HKSA

Solution structure of the dna-binding domain of drosophila heat shock transcription factor
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
106
structure length
106
Chain Sequence
GSGVPAFLAKLWRLVDDADTNRLICWTKDGQSFVIQNQAQFAKELLPLNYKHNNMASFIRQLNMYGFHKITSIDNGGLRFDRDEIEFSHPFFKRNSPFLLDQIKRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulation
molecule keywords HEAT-SHOCK TRANSCRIPTION FACTOR
publication title Solution structure of the DNA-binding domain of Drosophila heat shock transcription factor.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 11
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1994-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00447 HSF_DNA-bind HSF-type DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1hksA00
1O3SA 2P6SA 3L09A 1TNSA 1T2KA 2OA4A 3BJAA 3ISPA 1FLIA 3WGIA 2CQKA 3W6KB 4RAZA 3IL2A 5FO5A 1ON2A 3K0LA 4ZYEA 1LEAA 1FT9A 4HZFA 1XGOA 2HEOA 2VBWA 2R7DA 2IA2A 4KN7X 3MZHA 1DDNA 2HTJA 2HKOA 3F23A 2L01A 5AIPA 1G3YA 3REOA 2OZUA 3GLXA 4GCVA 4EJOA 2VC1A 2W84A 2QENA 1K78B 2WV0A 2Q2EA 2R3SA 5HS8A 1P4XA 2H94A 4KN4X 4JK1X 4LMYA 1LJ9A 3V7SA 2FQ3A 1OYIA 1MD0A 1T98A 3KP4A 3BZ6A 2FBKA 1GHCA 2Y48A 3HSRA 4Q4ZF 4LJZF 2HYGD 2VBXA 3VODA 2RN7A 3QAHA 3R0JA 3C3WA 3MZYA 1ODDA 3GX4X 5KK1A 2XASA 3LSTA 4L0ZB 5E1XA 2RNJA 3TKYA 3JAMK 3HRUA 5ICGA 3G3ZA 2QYOA 2GXBA 4U0YA 2HOEA 1DP7P 3HUGA 1XCBA 4ASNA 1FPQA 4XLNF 5HDGA 4G94A 5LBQA 5LLQA 3HTSB 1U5TA 2XAQA 1XSDA 2KIFA 4ENJA 2F5CA 2QWWA 1W7PB 3SXYA 4KDPA 2EA2A 5FFZA 3L00A 4OINF 5D5VB 3RKWA 3J80K 4IHTA 5JFRA 2HKXA 1JHHA 1B6AA 1S7AA 5CLSA 2DFIA 4RB0A 3KLOA 2LF7A 3D0SA 2O61A 4ESFA 4FX4A 1I6XA 4G7OF 4I0BA 4BYYA 1MJBA 4HX8A 2E7WA 2H6BA 2QQAA 2F5FA 4XLPF 2J5OA 1UB9A 4RGUA 2QVOA 4IXAA 3GF2A 4HOBA 4IRGA 3WE2A 5FLXK 4R8HA 5L3EA 4G7HF 2EJRA 3M1EA 1KQ8A 4JQFA 3LAJA 2OQGA 2EFNA 1HW1A 1UCRA 2O6GE 4KNYA 1ZAOA 2XRNA 2PN6A 2BBYA 5HDNA 4HF0A 2DK8A 3TDUC 3FXUA 4HV6A 2NNNA 1DPRA 2DW4A 2GWRA 1KU9A 1IUYA 3HIFA 1H0MA 1F5TA 5IT9Z 2IPQX 4L5IA 2DK5A 4M9ZA 2KRFA 4RGSA 4RB2C 1YFHA 5HLIA 4A2UA 3GXOA 1Z6RA 3ZN0A 2OAZA 2GIVA 4RGXA 1Q1HA 4NHJA 1IF1A 1XN7A 2DAOA 3QP6A 3I59A 5AONA 4HLYA 5D5XB 2LDUA 1R5HA 2FF4A 2FBHA 5D8KB 4I09A 5D5WB 2A6HF 1TW2A 4L18B 3CTAA 3FHZA 3WE3A 1TBXA 2F5EA 3RJPA 4E70A 1K7AA 3ZMZA 2PEXA 1RI7A 3IRQA 3MWMA 3ZP5A 1ZYRF 4GO1A 4CICA 1ZHFA 2Y75A 4PDKA 2UXXA 3VOEA 3CUOA 3WU1B 3I59B 3V8KA 5F6FA 2HZTA 4HQEA 2DLLA 3KP6A 3P9CA 3R6SA 1Z9CA 4R79A 1J75A 1TW3A 5K5RA 2VT3A 1T0FA 1D8KA 1R58A 4R1HA 1XDSA 3NQOA 3IHUA 2GAUA 3FXQA 4I98B 2VE9A 3KP7A 3F21A 5D8LB 2MC3A 1BI2A 1XGSA 5BQTA 4MQ9F 5LGUA 2K4JA 2E1CA 1G3WA 3J81K 1ZG3A 4ESBA 5DEQA 4CZZA 2RGVA 1RUNA 4A6DA 3U9GA 1L0OC 4KIFA 1G6NA 1Z6TA 4LD5A 1SMYF 2E7XA 5J6XA 4ESJA 3BPXA 2QUFA 1T38A 1IN4A 4HX4A 1P92A 1XGNA 2Z3YA 3C18A 2M45A 3RKXA 3P9KA 3WTZA 3QRFF 1BC7C 1MKMA 3O3KA 3I53A 1UHWA 1O3QA 2ZMEA 1WSUA 5BPDA 4KIBA 1BIBA 4CHUA 1ZGJA 1KU3A 3Q9SA 5E8IA 4AVPA 1R5GA 3HRTA 3IKTA 3O2PE 4ENNA 4EMSA 1S7OA 2YPRA 3V7CA 2Q0OA 4M9XA 3Q5FA 4LB6B 3EETA 5HS9A 3LQQA 1SMTA 2VOOA 3RYPA 2OU2A 3F72A 4YFKF 2FRHA 4MTEA 4ZYHA 3KFWX 3J80Z 1FP1D 1ZRDA 1ZLKA 4BNCA 2EV0A 2ZMEB 2K86A 3T5XA 4IRHA 1D5VA 3MQ0A 2RC4A 5D6FA 5D6EA 1IRGA 3F8FA 1HW5A 2OD5A 3U1DA 4A5NA 1O3RA 3E5UA 4OU0A 5CVUA 2PI0A 4HA8A 1HKTA 2YX7A 4FT8A 4WCGA 2HTSA 3H3UA 2XKPA 5FLXZ 2A68F 3IRRA 3E6DA 3JW4A 3F8MA 2GQQA 1ZG5A 1ZN2A 3WTWC 1Z91A 5E18F 1J9IA 3ZN1A 2X4HA 2ADUA 3E6CC 4LB5A 4KUMA 1GXPA 5HLHA 5JR3A 4ZZDA 2CFXA 5HVQC 2UXNA 4OIQF 4QLCU 1U6GA 1IN7A 1REPC 2P5LC 1D3YA 2MBFA 4AD9A 3LA7A 2JPCA 3GO5A 4BH9A 1Y0UA 4FX0A 1G3TA 3PQKA 2R7FA 1VTNC 1BN5A 5CJ9A 1WKMA 2V1UA 3RYRA 1LNWA 1RUOA 3QP5A 2ZXJA 1BM9A 3FM3A 2XUBA 3TOBA 4UV8A 2HR3A 1JXSA 2L02A 5DD4A 1X3UA 3DXJF 1FYLA 1QNTA 4A5MA 2FNPA 2XHKA 3RDIA 1F9NA 2V6CA 1F4KA 1KA8A 4LG0A 4KT5C 5LGTA 4WXDA 2HFHA 1SD5A 1XSVA 4DQ2A 4EM1A 4GYGA 2DBBA 4Y17A 2A07F 5LRRA 1QZZA 4S05A 4LFUA 4YFXF 2F5DA 3IKVA 2MLKA 1SD7A 2IP2A 4EV0A 4KA4A 3K1MA 1E17A 4RB1A 1BOAA 5DDGA 1ZRCA 1LDDA 1U5TC 1ULYA 2QLZA 4CDGA 3QOPA 2IA0A 4ON0A 1TQMA 5L3BA 4LG0B 4ENKA 3CO6C 1B9MA 2A61A 2CW0F 1EH6A 2KJBA 3GWZA 1O7FA 4G7ZF 1KGSA 2DQLA 3U2RA 3K1NA 3HSFA 5FGMA 3ABUA 5CVIA 3J81Z 2FXAA 3V4GA 4GXOA 3TDZC 1L3LA 4MEYF 4UVAA 2VT2A 1U8RA 1HXDA 2L54A 5BS6A 2WTEA 4TV7A 4UVBA 1BI0A 2HGCA 2H27A 1E2XA 1R1TA 1P4AA 1FYKA 1BI1A 1KYZA 3I5UA 2J5PA 2JTVA 4IF4A 4EVIA 3SZPA 4ZYDA 2NAZA 2O0YA 1KU7A 4MQVA 1O3TA 3VFZA 4XSZF 1J5YA 3V8LA 2CSOA 1DUXC 1B1BA 4D0PA 5L3GA 4IRIA 1FYMA 3PFIA 4H0EA 5E1ZB 1OYYA 3DEUA 2QZ8A 4M72A 5HOOA 1TQIA 2EV6A 4GGGA 4MHGA 3BY6A 2K4BA 4Q5SF 1KYWA 2MH9A 3GEZA 2CGPA 3LWFA 5ED4A 2GA2A 1UFMA 2CO5A 4L5JA 2P5KA 5CVJA 3I71A 3B73A 5ICCA 3KETA 5DCFA 1U5TB 2IRFG 3M7GA 4RGRA 4HLXA 2P7VB 2AXLA 3QU6A 4MTDA 2NRAC 3ZMDA 2XAFA 3V7RA 3I0TA 3ZMVA 2ZFWA 2HQNA 4ZZLA 2KJCA 3RPQA 2HDCA 5ILVA 3I64A 2YU3A 4HF2A 2A3SA 1QPMA 2CYYA 2DPDA 3ZMSA 2FE3A 4O3MA 3I54A 5K1YA 3RTRA 4OOIA 2JPBA 3E5QA 2A69F 4L9TA 1NHAA 1FZPB 4ENMA 4LLGF 1SFEA 4WK8F 3WTSC 3E5XA 2PJPA 2RQPA 4XRFA 4YG2F 2A6EF 1XSXA 3HOSA 2VOPA 1W5SA 3M9AA 2VN2A 1ZGAA 4Y13A 1LVAA 3EYIA 1K6OA 2LF8A 5A2QK 2KIMA 2Z5UA 2D1HA 3S2WA 2ZJ2A 3L9FA 1IN8A 3F8NA 1YS7A 1IN5A 4CXFA 4EGZA 4BAYA 5E17F 3KLNA 4G9YA 2XAGA 1YS6A 1W7PD 2LKPA 2A5YB 2GXGA 2PMUA 1IXRC 5ILUA 2Z33A 2D2WA 3JTGA 3JSOA 3R4KA 3HHGA 3DF8A 3GFIA 3GVAA 5JVTA 3E97A 1SD4A 3SQNA 1FOKA 1BJAA 1GXQA 4I2OA 5DV5A 3ML6A 2Z9OA 2VONA 2M30A 3GFJA 3EUHA 4A0YA 5H20A 1STZA 5HLGA 3BROA 3CJNA 3K9TA 3QPTA 1MJ9A 3CO7C 3DQVC 3N4MA 4EJWA 3HOTA 4HV5A 3DPLC 2QBYA 4WWCA 2ESNA 1G3SA 5FFXA 2DTRA 1HW2A 1OYWA 1MJAA 4HX7A 1W5TA 2WC2A 2BEOA 3WGHA 3ZQ7A 4QWQA 3ROUA 4IPAA 2P6TA 2FEZA 1CF7A 4L9VA 2W85A 3ULQB 4KMUX 3T8TA 2M5WA 1PP8F 3RPUA 3Q9VA 4AIKA 3WG9A 1XD7A 6PAXA 1HKQA 2RVCA 3JAMZ 3GYHX 1EH8A 2YX4A 2ESHA 5JHUA 3FXRA 4BHCA 4KYWA 3D5LA 2COMA 4EJTA 1FP2A 4IVNA 4F7ZA 3HRSA 5E20A 4A6EA 2D1VA 5DCMA 3F3XA 4P96A 4UNOA 1CF7B 1O7LA 3WU0A 2EFOA 2FMLA 1KQ0A 5AIQA 5ICFA 4N9IA 4PGHA 1B9NA 1BIAA 1I1GA 2BV6A 4CO8A 3FX3A 4XSXF 5J8FA 1YQAA 1QGPA 2W57A 2ZCWA 4O5VA 4EJVA 3TO9A 5DCMB 2EWNA 2B0LA 2LSOA 5LGNA 5DUIA 4HW0A 5BPIA 5LEJA 4GYIA 1U3EM 1C0WA 3N97A 1Z1DA 4CYDA 2V1DA 5LHGA 2X0LA 2XKOA 3H92A 3R61A 4I02A 1FC3A 4U0WA 1H9GA 4EM0B 2ZNYA 1RIOH 1A04A 1UHMA 3GUDA 4AIJA 1WRJA 3WTYC 2XIGA 3FWEA 1R22A 3G73A 2KKOA 1J0RA 4KFCA 3GZ5A 2DT5A 1FBQA 1XDUA 5IT9K 1I1SA 3BJOA 4MGRA 4UV9A 3PQJA 1XMAA 4A12A 2DU9A 2NYXA 2KIUA 4Z2YA 3WTUC 1AOYA 3HTUA 1XGMA 1YLFA 4G6QA 1R00A 2K02A 4XBFA 5ICEA 1V4RA 4Q48A 1G4DA 2ISZA 1BBYA 2IW5A 1Z05A 4DNCA 3GW2A 1USSA 4YIIA 5F64A 2EK5A 4NQWA 3LAPA 1J7KA 2LNBA 1FBUA 5A2QZ 5DD8A 2HQRA 1HKSA 2ISYA 1FNNA 4L0YB 3J7AO 3WTXC 2EFQA 4ZH4F 2ACJA 2CWEA 1ON1A 1KU2A 3FMSA 4U7DA 1XB4A 3K1PA 1K78A 3OV8A 4WF2A 4LK0F 2PG4A 3ZPLA 3FZVA 3EYYA 4B09A 2EFPA 4K2EA 5K5OA 2GA1A 4HAMA 5D4RA 1QZYA 1AWCA 5L3CA 3SFZA 4CGZA 4EJUA 3KE2A 2ZNZA 1SFXA 2MA3A 2P4WA 3KZYA 5E1WA 3HYIA 3CUQA 2D45A 1T6SA 1S29A 4UUVA 4ETSA 3DFGA 4Q47A 4ZYGA 2BE5F 4B8XA 4FHTA 2C6YA 3TO6A 1QQIA 1S6LA 1ZG1A 2F2EA 4AIHA 2XGXA 5TRDA 1U2WA 5FD5A 1WWXA 3JSPA 2FMYA 4OMZA 1YW8A 4P55A 2NNYA 3F6OA 4A0ZA 2PMHA 2IJLA 3CUQB 1USTA 1W7PA 3COAC 2IT0A 1LB2A 4YIFA 4OIOF 3KP5A 3JTHA 1FSEA 4RS8A 1P4WA 2G9WA 2L4MA 1FWZA 4Y15A 4P9FA 2CG4A 3WODF 4HF1A 1MZBA 3VEPA 2YR2A 1F1ZA 3TQNA 3I58A 1J2XA 3C1DA 4G6DA 1YW7A 2FOKA 3P9IA 2H09A 3ABTA 4IHSA 2P7CB 1B59A 4MNUA 5FB2A 4NB5A 2IVMA 3QPHA 4WXHA 1IAWA 4WX9A 4M6YA 5FD6A 5CYVA 2VODA 1OPCA 4M74A 2XVCA 1DPUA 3MFKA 2UZKA 1BI3A 1V3FA 1TNTA 4LGWA 2FBIA 4PCQA 3ZMTA 5BOXA 5EEGA 1J59A 1WI9A 1ZLJA 1JHFA 3T8RA 1U78A 4N0BA 2VBZA 4RAYA 1LQ1A 1R36A 1FY7A 4O6JA 1W4MA 5J8CA 1S8NA 2RV8A 2EV5A 1YO5C 4UHTA 3AAFA 3HRMA 1R1UA 4HBLA 1R7JA 3FM5A 2BGCA 1Z7UA 5BMZA 2FNAA 1PP7U 4EQQA 5D4SA 3L7WA 3HSEA 2QQBA 3IC7A 1P2FA 1PUEE 3GFMA 4I01A 3SHFA 4M73A 4YFNF 4AWXB 4KIGA 3WGGA 1LDKB 2Q8KA 3RI4A 3MEXA 2P5VA 2RDPA 3FMRA 1SD6A 5CVRA 3CLOA 3K69A 5DUKA 3VB2A 2XAHA 1OMIA 1JGSA 1EH7A 3I4PA 2DQRA 1RZ4A 1IZ1A 3DP7A 4G8XA 5H6RA 5K5QA 3RKYA 3M8FA 3E6BA 3IWZA 2DI3A 4LK1F 2QM3A 4BHBA 2O3FA 5LHIA 3KEOA 2EA4A 4M71A 1R23A 1WQ2A 4P5OA 2W25A 1HQCA 2GZWA 1HSTA 1IN6A 2HYFA 5DYMA 3DV8A 4EM2A 3BOQA 1S3JA 2V1XA 1T39A 2O8XA 1ONVA 5JI6A 3GZ6A 3H3ZA 3E3VA 1CGPA 4L9NA 4BQAA 2OBPA 3P7NA 3R0AA 4M6XA 3BPVA 1SFUA 4OIPF 1OKRA 2ZKZA 2IA1A 3QU3A 5ILSA 4UVCA 1MGTA 3DKWA 2DO7A 4L9JA 3MAJA 1QO0D 1IRFA 4HDVA 2VXZA 3B02A 2V79A 2UWMA 2FA5A 4I7HA 3O6BB 1EV7A 2M87A 3BJ6A 2L4AA 2MH2A 3KP2A 3F6VA 2ELHA 2FU4A 2O03A 3F22A 2TDXA 1ZARA 1I5ZA 3BP8A 4U7BA 5LHHA 3TO7A 2QQ9A 5L3DA 1HBXG 2JRTA 2VBYA 5HS7A 2OZ6A 4S04A 1FSHA 2MD5A 2K27A 2AS5F 2QBYB 1B4AA 3TGNA 2FSWA 2JSCA 4PZJA 4HDUA 1P6RA 3ECHA 3WTTC 3KCCA 2PLYA 5TJJA 1IXCA 2PQ8A 5H6QA 4LLNA 2XAJA 1XCVA 2M1BA 4A0XA 4BXUA 4I0AA 3DPTA 3BWGA 5L3FA 3SZTA 3OOPA 2STWA 5LRSA 2P8TA 2WWYA 1D8JA 1TTYA 3ELKA 4LLLA 3FMQA 1YYVA 2K7LA 2OQRA 2ZBKA 1HSJA 2RKHA 1FBSA 3ZMUA 1OR7A 3R60A 2JZYA 1IXSB 1R1VA 1I27A 4KMFA 1KQ9A 2XROA 3RIRA 3CDHA 3WTVC 5D5UB 3ERED 2L3DA 4EGYA 2PFBA 2G7HA 4OIRF 2ETHA 3LFKA 1MDMA 2E1NA 2EB7A 5LEKA 1JE8A 3C7JA 2G7UA 1QBJA 4M9SA 2Y0MA 4KICA 1H9TA 4RB3C 3MCZA 5E8GA 2V9VA 3LA3A 1TLHB 2NS0A 2ZO4A 4WXCA 3GFLA 2VC0A 4U88A 5F1RA 4BHPA 2YSRA 1ZH5A 2M8EA 5ERIA 1ZREA 2XV4S 3HHHA 2BYVE 3E6MA 3LA2A 1TQPA 3LQRA 3T1BA 1MDMB 3KZZA 2DPUA 3IWFA 3T0YA 2HWVA 1LDJA 3FF5A 2PBIA 2MLGA 4UXNA 1FX7A 3W6JB 1BC8C 4OMYA 2Z99A 5KVRA 2W24A 1IW7F 1SAXA 3NEUA 1GVJA 3KEQA 1O57A 2VE8A 4P9UA 5EEHA 5HDKA 1PDNC 3KP3A 3NRVA 2STTA 5CVVA 4MEXF 1YG2A 1K79A 4N9HA 3CUQC 1XMKA 4U0VA 3F8BA 2JT1A 1YTYA 3TOAA 3V8JA 4PGGA 1ZRFA 2HS5A 1LEBA 3EQLF 3F8CA 1YW9A 3ECOA 4JBAA 1RNLA 3M8EA 2H6CA 3K2ZA 4HQMA 3EDPA 5IT3A 4HYEA 3L2CA 1YIOA 3BDDA 4IJAA 2EFWA
chains in the Genus database with same CATH superfamily
1O3SA 1R6RA 2P6SA 3VSKA 3L09A 1H88C 1TNSA 2L9VA 3OIQA 4PSXA 3I4MJ 1T2KA 1ENHA 2OA4A 3DBRB 3BJAA 1ETKA 1ZK8A 4NQWB 2W82A 3ISPA 1FLIA 1VF9A 3WGIA 2CQKA 4B1RA 3PSFA 2IAIA 3QYFA 3W6KB 4RAZA 3IL2A 3OYGA 5FO5A 3QQAA 1ON2A 2WAQN 3K0LA 2R7WA 3FISA 4ZYEA 1LEAA 1FT9A 4HZFA 3DCFA 2RQQA 2ECCA 4M3BA 5FROA 1XGOA 2HYJA 3DU5A 2HEOA 3BR3A 3W6VA 2VBWA 1R49A 2R7DA 2IA2A 2ZB9A 4KN7X 3MZHA 1DDNA 1YOVB 2HTJA 2HKOA 3F23A 2L9RA 2L01A 5TISC 5AIPA 4IOCF 1WJ5A 3SFIA 5J1YA 1MBJA 3OS0A 1G3YA 5E3MA 3REOA 2OZUA 3GLXA 4GCVA 5B1BH 2VC1A 2W84A 2XGEA 2QENA 3FBNB 4EJOA 1K78B 2E2JJ 3MKZA 2WV0A 2V6EA 2Q2EA 1NG6A 1FIPA 3ZQQA 4W1UA 2R3SA 3LSRA 5HS8A 2F4IA 1P4XA 2H94A 4KN4X 2K40A 4CYCA 2K9QA 2PMZN 3A01A 4JK1X 4LMYA 1LJ9A 3V7SA 2FQ3A 1OYIA 4MO7A 3CMAI 2ZJPF 2XF6A 2LRDA 1MD0A 4XQFA 2LY2A 3IH2A 2GM4A 1T98A 1AA7A 3NARA 3KP4A 2GLOA 3BZ6A 2FBKA 2WADA 1GHCA 2Y48A 3HSRA 3CDLA 1FJLA 4Q4ZF 1R4NB 4LJZF 1IJWC 2HYGD 2VBXA 2E34A 2W4SA 2V9PA 1GVDA 2F4MB 3VODA 2LD5A 4BL0B 2RN7A 3QAHA 3R0JA 3C3WA 3HOXJ 1JKRC 1JKQC 3MZYA 2KZGA 5FJ8J 1ODDA 3GX4X 5KK1A 2XASA 2O8KA 2EILH 2Q2EB 3LSTA 4L0ZB 5E1XA 2RNJA 2KQRA 3TKYA 3P5JA 1X2NA 3JAMK 3S17J 1JI8A 2DYRH 5TGTA 3DU6A 1RR8C 3HRUA 5ICGA 3G3ZA 2QYOA 3A01B 2GXBA 3EUKL 3GBGA 2MD0A 4XLEA 4U0YA 2HOEA 1DP7P 1VI0A 3HUGA 2VXDA 3CQZJ 2ZJRF 1XCBA 3CMEI 4E7HA 4ASNA 1FPQA 4XLNF 1QRYA 5HDGA 3JRAA 3GTPJ 2GOMA 4G94A 5LBQA 1N78A 4DYQA 5LLQA 3HTSB 2P0WA 4RBOA 1S72I 1U5TA 2XAQA 4FE7A 1XSDA 2KIFA 4ITVA 4ENJA 2F5CA 2DFFA 1W7PB 2QWWA 5F0HA 2R7UA 2ZC2A 3SXYA 4LIVA 1MW7A 1EKEA 4KDPA 1Y1WJ 4A3JJ 4HRIA 2EA2A 5FFZA 1J09A 3L00A 3H36A 4OINF 1KZHA 1S5LC 5D5VB 1K6YA 2VKHA 3RKWA 2K3PA 4B3XA 3J80K 3V42A 3VYSB 4IHTA 1X1CA 5JFRA 2HKXA 1JHHA 1B6AA 1S7AA 4F93B 5CLSA 2DFIA 4RB0A 2P81A 3KLOA 2LF7A 3D0SA 2O61A 4A3CJ 5F1JA 3CCVI 1MMGA 4ESFA 2AHQA 4FX4A 4QTRA 3UKGA 4DGWB 1I6XA 1SFOJ 4G7OF 3BR5A 2A05A 4I0BA 3S8PA 4BYYA 1MJBA 4HX8A 2E7WA 2H6BA 2QQAA 2F5FA 4XLPF 2J5OA 2EINH 2OJED 1UB9A 3K4JA 4RGUA 2QVOA 5C4JJ 3WU2C 4IXAA 1A6IA 3GF2A 4HOBA 2VUMJ 2M8GX 4IRGA 3WE2A 3ZOBA 1AU7A 2M2EA 5FLXK 4PJ0C 1ZGWA 1X3ZB 5EGOB 3BLYA 5GADJ 4R8HA 5L3EA 4G7HF 5KHDA 1N75A 2EJRA 2M7BA 3M1EA 1KQ8A 4JQFA 3LAJA 2OQGA 2EFNA 1JTYA 1HW1A 4NDLA 1UCRA 2VL8A 2L7MP 2O6GE 4KNYA 1ZAOA 1DU6A 2XRNA 3BZCA 2PN6A 2AQEA 1FOYA 2BBYA 4DIQA 5HDNA 4HF0A 3B6CA 2DK8A 3OL4A 4NC8A 4E7IA 3TDUC 3FXUA 5IYDJ 4HV6A 2NNNA 1TWCJ 3S3OA 1DPRA 5C44J 2DW4A 1WCMJ 2GWRA 1KU9A 1BR1A 1OFCX 1UG0A 1IUYA 2R7OA 2JK3A 3HIFA 1S9HA 1H0MA 1F5TA 5IT9Z 2HVSA 2IPQX 1X4PA 4BQNA 4L5IA 2CRGA 2DK5A 4M9ZA 2KRFA 2EQRA 2BW3A 2QKLB 4RGSA 4RB2C 1YFHA 5HLIA 4A2UA 4LOCA 2LKSA 3GXOA 1Z6RA 4GRIA 3ZN0A 1F43A 2OAZA 3A4CA 2GIVA 4ZYAA 2JVGA 4QPQA 4RGXA 2XC7A 1Q1HA 3K2AA 4NHJA 1T0FC 4RLFA 1IF1A 1XN7A 1HF0A 1JTXA 4FTHA 2E1OA 5LD2C 1JUMA 2DAOA 2M9HA 3VSLA 2OCCH 3QP6A 3I59A 5AONA 3VPRA 1Z77A 3LSPA 2DA1A 2VASA 3NAUA 3TW6A 2HOTA 4CSWA 4Y3OA 1K61A 2ELJA 4HLYA 4BXXJ 1TWHJ 2NOJB 5D5XB 2LDUA 1R5HA 2FF4A 1RRJA 2FBHA 2E60A 5D8KB 3A0BC 3HEFA 5M5YJ 1GDTA 3RQIA 1JUPA 5J1RA 3RZOJ 3JCUC 5E3OA 3TP0A 4I09A 2ZSHB 2A6HF 2DFEA 5D5WB 3CCYA 2BW3B 1TW2A 4L18B 3DBHB 3W3CA 3OYCA 3CTAA 3FHZA 3WE3A 1TBXA 2F5EA 3RJPA 1JKOC 2FD5A 4E70A 4BJ6C 1K7AA 3ZMZA 2PEXA 4BACA 1RI7A 1POGA 5KCMA 3IRQA 4IOAF 2XRLA 3MWMA 2XB0X 4RM2A 4E7ZA 3ZP5A 1ZYRF 4GO1A 4CICA 1ZHFA 2G0EA 2Y75A 5C3EJ 4PDKA 2UXXA 2E1MC 2LREA 3VOEA 3CUOA 5EJCA 3KPHA 4XRSA 3WU1B 1LE8A 3QPSA 3I59B 3H5RA 1FOXA 4HEA2 3V8KA 5F6FA 4JX6A 2HZTA 5K7FA 4HQEA 2DLLA 2E2HJ 3KP6A 1B72A 3P9CA 3R6SA 1Z9CA 4R79A 1J75A 4DW6A 1TW3A 5K5RA 2FUG2 5J40A 4C2MJ 3IV5A 2VT3A 2BVLA 3ZQCA 3LOCA 1T0FA 1D8KA 1R58A 1RKTA 3H9JA 4R1HA 1XDSA 3NQOA 1ERDA 2QCOA 3IHUA 2HU9A 2GAUA 3BG9A 3C2HA 3HZJA 3FXQA 5KAFC 2MYSA 2LVSA 1OCCH 3K70C 2CFOA 2DYSH 4I98B 4B43A 3FKIJ 2VE9A 3KP7A 3F21A 5D8LB 2MC3A 1BI2A 3OIOA 1XGSA 5BQTA 1SC7A 1FMVA 4MQ9F 2LR8A 5LGUA 1Z7LA 5DM6F 2K4JA 3MVPA 4XLAA 3VWBA 3HOYJ 4GDFA 2E1CA 2V1NA 3H0GJ 1VQ5I 2MFZA 1G3WA 3IH3A 3K7AJ 3J81K 1ZG3A 4ESBA 5DEQA 3LNQA 1ETQA 1TL8A 2Q1ZB 1B72B 4CZZA 2RGVA 4XKCA 3X2QH 1RUNA 2XSDC 4A6DA 1U9NA 3U9GA 1L0OC 4KIFA 1G6NA 1Z6TA 4LD5A 2R5ZA 1B8IB 1FIAA 1SMYF 2BHYA 4D7NA 2E7XA 3SJMA 4FETA 3DKXA 5J6XA 4ESJA 3M3YJ 1OJLA 1R71A 3BPXA 2WY8Q 2QUFA 4XIDA 2R0QC 1T38A 1IN4A 1EJ9A 4HX4A 1P92A 2DA7A 2IS2A 1XGNA 2Z3YA 5IYBJ 3CCEI 3C18A 2M45A 2X85A 3RKXA 3HPHA 3P9KA 3WTZA 4M3EA 1XTAA 3QRFF 3ZGKA 1BC7C 2OC6A 4OAYA 2KDZA 1V5GA 3BCBA 3ZR8X 2IGNA 1MKMA 3O3KA 3I53A 1UHWA 1O3QA 1X19A 2ZMEA 3S2HJ 1WSUA 5BPDA 2CJJA 4KIBA 1RETA 1VFCA 2DJIA 1Q1VA 5EDNA 4IHVA 1BIBA 1S7EA 4XK4A 1Z21A 4CHUA 4H4KC 1ITYA 1HA8A 1V5EA 1ZGJA 2H1LA 3S93A 2DXIA 3AG3H 1KU3A 3Q9SA 5E8IA 2LY1A 2R5ZB 4AVPA 1R5GA 2NVQJ 3W2AA 1TT5B 3HRTA 3IKTA 2IGOA 3O2PE 2QGUA 2E1MB 4ENNA 4EMSA 1S7OA 3HOZJ 4Y7NJ 2YPRA 4AC0A 3V7CA 2Q0OA 4M9XA 1U9OA 4LB6B 3Q5FA 1TWAJ 3Q3SA 3EETA 5HS9A 1UG2A 1SMTA 3LQQA 2VOOA 4JX4A 3RYPA 2OU2A 3F72A 4IQ4A 4YFKF 2FRHA 5IOYA 4MTEA 4ZYHA 3KFWX 3J80Z 1FP1D 1ZRDA 4IHXA 2OCEA 4D5FA 3S2DJ 1ZLKA 1IUFA 5DS9A 1TWGJ 2OPTA 4BNCA 2EV0A 2L9NA 3FBIB 2ZMEB 2B9SA 2K86A 3T5XA 4IKFA 5CKTA 1A5JA 1MH4A 4IRHA 4B48A 1D5VA 3U21A 4IEJA 3OYNA 3MQ0A 2Z1DA 2RC4A 3EPZA 5D6FA 5D6EA 3TBIA 4J01A 1D5YA 1IRGA 3F8FA 1BW6A 1HW5A 3S32A 2OD5A 3U1DA 2DTZA 4A5NA 1IRXA 2CMPA 2PJRA 2PMZA 4G6TB 1O3RA 3E5UA 4PFOA 4OU0A 5CVUA 2R7XA 2PI0A 4HA8A 1HKTA 3KYDB 3OL3A 2YX7A 4FT8A 1RKWA 3BG7A 4BY7J 2HTSA 2O5RA 4WCGA 2ICWG 3OR1C 3H3UA 2XKPA 1VQ8I 2K9SA 4XKBA 2A68F 5FLXZ 4J00A 1T56A 3IRRA 2CUJA 3HOVJ 3E6DA 2L7KA 3JW4A 3F8MA 2GQQA 4ZDLA 3GTMJ 3BTCA 2I5UA 3LSIA 1KONA 4F52A 2CS3A 3H5NA 1ZG5A 1GUUA 1ZN2A 4BDYA 2HQAA 2F48A 3CLQA 2YUSA 4A3IJ 3WTWC 4E7LA 1QHGA 1Z91A 5E18F 2CUEA 1J9IA 3ZN1A 3CCJI 2X4HA 3CCSI 2PJRB 2ADUA 3E6CC 2VQLA 4LB5A 3UNGC 5FLVA 1MNEA 2PX9A 4KUMA 4XOPA 1FMWA 3OYJA 1GXPA 2DJNA 4PUSA 2VLAA 1LPQA 1X1DA 5JR3A 5HLHA 1WH5A 4ZZDA 2CFXA 5HVQC 2UXNA 4OIQF 4QLCU 1D1BA 1YX5A 1U6GA 3VYTB 1IN7A 1REPC 2P5LC 1D3YA 2MBFA 3LSGA 1F36A 3I3LA 4AD9A 3QPLA 3S16J 3LA7A 2JPCA 2XGCA 2EZLA 4DBRA 3GO5A 4C3HJ 4BH9A 2VB6A 1MBEA 1Y0UA 2DDAA 2X1CA 4FX0A 1G3TA 3QYEA 3PQKA 2R7FA 3FXMA 1VTNC 1BN5A 4B4CA 3BG5A 5CJ9A 1WKMA 2V1UA 4CCMA 3RYRA 1LNWA 1RUOA 2E71A 3QP5A 1Y0NA 2ZXJA 1BM9A 3FM3A 2N8GA 2XUBA 1MIJA 3NWSA 3TOBA 4UV8A 2HR3A 5M5XJ 1JXSA 2L02A 1QZEA 5DD4A 2V9KA 1DQUA 1X3UA 2LTPA 1FTZA 3DXJF 1FYLA 2XB5A 1MBGA 1QNTA 4A5MA 2FNPA 2LY9A 2XHKA 1VQOI 3BQZA 3RDIA 2AO9A 3FKJA 1F9NA 3RPUD 2V6CA 1F4KA 1KA8A 2DA6A 4LG0A 4KT5C 4B3AA 5LGTA 1I50J 4WXDA 2HFHA 1SD5A 1XSVA 2WAEA 1I39A 4DQ2A 4EM1A 4PFPA 4GYGA 3I55I 2X6YA 2JA8J 3KYLA 2DBBA 5EF6A 4Y17A 4E7SA 1SVOA 4XLHA 2A07F 5LRRA 4A3DJ 1QZZA 2H8WA 2F5VA 2VKVA 4UB6C 4S05A 4LFUA 2OV7A 2HNHA 3LSMA 3O8HA 2E35A 2KPMA 4YFXF 2F5DA 2X6WA 3IKVA 2MLKA 2VJ5A 1SD7A 3PUBA 3I56I 3KYCB 1MNMC 4NC6A 2IP2A 3F9KA 4EV0A 1YI2I 4KA4A 3K1MA 1E17A 2I10A 4RB1A 1BOAA 2X48A 4AYBA 5DDGA 1TC3C 1ZRCA 1LDDA 1OCPA 1U5TC 1VQ7I 1R4MB 2ELKA 1ULYA 2QLZA 4CDGA 3QOPA 2IA0A 4ON0A 1TQMA 5L3BA 1JJ6C 4LG0B 4ENKA 3CO6C 4BBRJ 1B9MA 2A61A 2LOOA 2CW0F 4A3BJ 1WHUA 1EH6A 2WV1A 2KJBA 3GWZA 2D5VA 3K6GA 1O7FA 3DTEA 1EA3A 1W0TA 4G7ZF 1KGSA 2DA5A 3AFHA 2B63J 2JA2A 2NXNB 2DQLA 2HZDA 3HM5A 3U2RA 4F3QA 3LSJA 4A3MJ 1BOBA 3K1NA 4Y4RA 3HSFA 5FGMA 3KEYA 4BQQA 3ABUA 1JT0A 2VKDA 1R5ID 3GMEA 3HOWJ 5CVIA 1NG7A 2WA0A 2ZJQF 2KZVA 1UELB 3J81Z 3PIPF 4DBQA 1WGXA 2FXAA 3V4GA 4GXOA 3TDZC 1L3LA 2CQQA 4I76A 4MEYF 1HDPA 4UVAA 2VT2A 1U8RA 2HVRA 2VI6A 1HXDA 3G2BA 2L54A 5BS6A 2WTEA 3PO3J 4LITA 4TV7A 1E3HA 4UVBA 4CYCB 1VQMI 1BI0A 3MKLA 3G6EI 2HGCA 4JYKA 1E2XA 2H27A 1R1TA 1P4AA 1FYKA 3OYFA 1E3PA 3ASNH 1MBKA 1BI1A 2NS8A 4D9JA 2Y9YA 5B5EC 1KYZA 3I5UA 2J5PA 2JTVA 4IF4A 4EVIA 4XOTA 3SZPA 4ZYDA 2NAZA 1G2HA 4F55A 4YIRX 1X1PA 2O0YA 1KU7A 4MQVA 2L7FP 1O3TA 3PFYA 3VFZA 3OYKA 1P7JA 2Y9ZA 3OYEA 3OYBA 4XSZF 1J5YA 3V8LA 1FTTA 2CSOA 1T95A 1DUXC 1B1BA 4D0PA 2BY0A 3CCUI 5L3GA 4IRIA 2JN6A 1FYMA 3PFIA 1K4SA 4H0EA 5E1ZB 1OYYA 2ECBA 3IUOA 5DTDA 2HXIA 3DEUA 2QZ8A 4M72A 2L5QA 5JHFA 4BKXA 4N4OB 2CH0A 5HOOA 2RREA 1TQIA 2EV6A 5B66C 2HDDA 4GGGA 2Y30A 1WJDA 4MHGA 3BY6A 2K4BA 1MSFC 1BR4A 4Q5SF 3A2KA 1KYWA 1ETVA 2MH9A 4UB8C 3GEZA 2CGPA 3LWFA 5ED4A 4M3GA 3HUGB 2GA2A 2JUCA 4JOMA 3WHBA 1UFMA 1YE9A 2CO5A 4L5JA 2P5KA 5CVJA 3I71A 3B73A 2DOEA 5ICCA 3KETA 3GCMA 5DCFA 1U5TB 1VQLI 3JREA 1SFKA 2IRFG 4BQOA 2DA3A 3DTKA 3TMOA 4BE2A 3M7GA 3JRCA 1WFXA 4RGRA 4HLXA 3CCMI 5B1AH 1SAUA 2P7VB 3ZQFA 2AXLA 3QU6A 4MTDA 1V55H 4MFDA 2NRAC 3ZMDA 5J1UA 2XAFA 3V7RA 2XF5A 4D1QA 3I0TA 3ZMVA 1AHDP 1X58A 2ZFWA 2X9DA 2HOSA 2XPVA 2HQNA 4C2UA 2R93J 1HOMA 4ZZLA 2KJCA 3HKZN 3DEEA 2MGQA 3CC7I 3RPQA 3QWLA 5DM7F 3OYDA 1OCOH 2HDCA 2DOFA 2EIJH 5ILVA 3I64A 4JX5A 2YU3A 4HF2A 3SZGA 2A3SA 1P7IA 1QPMA 2CYYA 3ZQHA 2DPDA 3BR2A 3ZMSA 4GFBA 2IBDA 3DPUA 1HLVA 2FE3A 3NWTA 4AYBN 4O3MA 1GV2A 3I54A 5K1YA 3CCQI 3RTRA 4OOIA 2JPBA 2IGKA 5E3LA 4Y52J 3E5QA 2TCTA 5F08A 2A69F 4L9TA 4BE1A 1NHAA 3H9QA 1FZPB 5KNLA 4ENMA 2TRTA 4HNUA 4LLGF 4NUBA 1SFEA 4E7JA 4XORA 5M5WJ 4WK8F 3WTSC 3DKYA 1ZQ3P 2EBIA 3OMYA 3VYRB 3E5XA 2VJ4A 3OOUA 2PJPA 2RQPA 4XRFA 1MMAA 4YG2F 2A6EF 1XSXA 3BQYA 3HOSA 2E5ZA 2VOPA 5HNFA 1MMDA 3BR0A 1W5SA 3M9AA 5IY5H 3D1NI 1IG7A 5GTHC 2KMUA 2VN2A 4PJMA 5KAIC 3HC7A 2JSPA 3MKYB 2CW8A 1ZGAA 3G1MA 4Y13A 1LVAA 1IO2A 3EYIA 3BC8A 3TP3A 1U8BA 2QA4I 3CCLI 2HXOA 2K5CA 1K6OA 4EEFG 4LIUA 2LF8A 1WJEA 3BTJA 1I6HJ 5A2QK 2KIMA 2Z5UA 2D1HA 3S2WA 2QKMB 3MMYB 2ZJ2A 3L9FA 2CV0A 3CC4I 3IAS2 4I6ZA 1IN8A 3F8NA 1YS7A 2FQ4A 1IN5A 4CXFA 4EGZA 2VJIA 4BAYA 5E17F 3KLNA 4G9YA 2XF7A 3SEZA 2XAGA 3H0DA 1YS6A 1SANA 4Z6YA 1W7PD 2LKPA 4HG2A 3LFUA 4MLOA 2A5YB 2GXGA 2MABA 1LFPA 2EPFA 2PMUA 4A3FJ 1IXRC 3FXLA 5ILUA 2Z33A 2D2WA 5IP6A 1X4OA 3JTGA 2OF7A 3JSOA 3R4KA 1O4XA 3BT9A 3HHGA 2KL4A 3DF8A 1XX5A 3GFIA 3GVAA 5JVTA 4G12A 3AG4H 3E97A 1SD4A 3JRHA 3SQNA 1FOKA 1BJAA 1GXQA 4I2OA 4ZDPA 4CCKA 5DV5A 3ML6A 2Z9OA 1H8AC 3GTOJ 3HL2A 4Y33A 1WJCA 2M30A 2VONA 3GFJA 4YELA 3EUHA 5F0CA 4ABZA 4A0YA 5H20A 2HQ5A 1HCRA 1STZA 2ZMEC 2ME0A 5HLGA 4FE4A 3ASOH 2R5YA 3BROA 3GTQJ 1OCRH 3CJNA 2EIKH 3K9TA 4BUPA 3S15J 3QPTA 1APLC 1TWFJ 3E1SA 1MJ9A 3CO7C 3DQVC 3K4LA 3N4MA 3OY9A 1PYVA 4EJWA 3HOTA 1HDDC 4HV5A 3DPLC 1IV8A 4CH7A 2QBYA 4BY1J 2KDOA 4WWCA 1D1CA 3E0JB 2ID3A 3VYUB 5IOZA 2ESNA 3CP8A 3ONQA 4U87A 1LE8B 1G3SA 5FFXA 4CZCA 3ZQIA 5EG0A 2DTRA 3PUFA 1HW2A 1OYWA 1MJAA 4HX7A 1W5TA 2K85A 2WC2A 2JA6J 4ZTFA 2BEOA 3WGHA 3M07A 4XRMA 2E5NA 2WBMA 3ZQ7A 3B6AA 4QWQA 3ROUA 4IPAA 3CDIA 1DU0A 2L9SA 2P6TA 2E2IJ 3CF5F 2FEZA 2Y69H 3TW7A 2JA7J 1JJ8C 2XPWA 1CF7A 1NK3P 4L9VA 3MKWB 2W85A 3ULQB 2R5YB 4KMUX 3T8TA 5FRMA 2Y0SN 5FKKA 2M5WA 1PP8F 5FKMA 3CESA 3RPUA 2KHMA 4XLCA 3Q9VA 3BG3A 3WG9A 1XD7A 4D7MA 5B3SH 4AIKA 6PAXA 3S3NA 4E4HA 4AUXA 2DT7B 4KISA 1HKQA 2RVCA 2E19A 3RCOA 5IPAA 3JAMZ 4NBQA 3KZIC 3GYHX 1EH8A 2YX4A 2H8RA 3FDYA 5EG0B 2ESHA 5JHUA 3GTLJ 3FXRA 4BHCA 1CQTA 4KYWA 3D5LA 1E3OC 3HG9A 2K9NA 2COMA 4EJTA 1FP2A 1OCZH 4IVNA 3GLLA 3HRSA 4F7ZA 2Z2SB 2RAEA 2LLKA 1DGWY 2KRHA 5E20A 2LMDA 2ZFUA 4A6EA 2D1VA 2GIZA 5DCMA 1MBHA 3F3XA 2RNGA 4P96A 4UNOA 1CF7B 2NS7A 1O7LA 3HBLA 3OIPA 3WU0A 1MH3A 1WPKA 2EFOA 4BXFA 3I9V2 2FMLA 1KQ0A 3M1CA 5AIQA 5ICFA 2X6OA 4N9IA 4EATA 3BR6A 4F91B 1QVUA 2EZKA 4PGHA 1B9NA 1BIAA 3H1CA 5CPRB 1LUJB 4HSTA 1Y56A 1I1GA 2BV6A 3JRIA 3K4MA 2K9MA 4HNTA 2XPUA 4CO8A 3FX3A 5EZGA 4XSXF 3J7YJ 1ZELA 1X1BA 3W2WA 5J8FA 1YQAA 3ABLH 1QGPA 1RC9A 4FASD 2QSHX 3ZQLA 3E7LA 4D5CA 1ACIA 2W57A 4CCNA 2ZCWA 3MZ8A 4RA2A 3DBLB 4O5VA 3CD6I 5FLMJ 2DODA 4EJVA 4MIMA 3TO9A 5DCMB 2HDWA 3A0HC 2VQCA 2EWNA 1PJRA 2B0LA 1N77A 2KP6A 2LSOA 5K7ZA 5LGNA 5DUIA 1XC5A 4HW0A 1NTCA 1TP4A 3G4SI 5BPIA 5LEJA 1Y8RB 3OYMA 4GYIA 1U3EM 1C0WA 3N97A 3PNTA 2DMNA 1Z1DA 4CYDA 2V1DA 5LHGA 2IS4A 2X0LA 2XKOA 3H92A 3R61A 5M3MJ 5FKNA 4I02A 1NH3A 1IDZA 1FC3A 4U0WA 4AVZA 1T8IA 2CUFA 1H9GA 4EM0B 3C2BA 2ZNYA 1YJNI 1RIOH 2ZSIB 1A04A 1XG1A 2BZTA 2CUZA 1UHMA 3GUDA 1G59A 3M4OJ 4AIJA 1WRJA 3WTYC 2XIGA 3LSHA 3FWEA 1R22A 3G73A 2KKOA 1J0RA 4KFCA 1T08B 2W7NA 3QOEA 3GZ5A 2DT5A 2B7EA 1FBQA 2DMUA 1MBFA 1XDUA 4II2A 5IT9K 1I1SA 2KRCA 2L0KA 3BJOA 1OLTA 3H5AA 4MGRA 2KISA 4UV9A 2LP0A 3PQJA 2JWTA 1XMAA 4A12A 2DU9A 2NVYJ 2NYXA 2KIUA 4Z2YA 4BJ5C 1X2MA 2GOXB 1Z0XA 3WTUC 3UR3C 4X0GA 4ZJZA 2I8DA 1AOYA 3HTUA 3A1YA 1XGMA 1YLFA 1I3QJ 4OAZA 4G6QA 1R00A 5IYCJ 2K02A 4XBFA 5ICEA 1V4RA 4A3EJ 5HODA 1DGRM 3OYHA 5GPCA 4Q48A 1Y8QB 1G4DA 1Z67A 3OYAA 2ISZA 1BBYA 2WY7Q 2IW5A 1Z05A 3BCAA 1QA6A 4DNCA 1VQ6I 3PM1A 1I3AA 4A3LJ 4JP0A 3ESWB 3GW2A 1USSA 4YIIA 5F64A 2EK5A 4NQWA 3LAPA 1J7KA 4RAFA 2LNBA 2WAFA 1FBUA 3ZRGA 2Y31A 2QEXI 3ABKH 2AXTC 5A2QZ 5DD8A 1YITI 5GP9A 2LKXA 2W00A 2HQRA 1HKSA 2ISYA 1FNNA 2K3FA 3CMMA 3HB9A 1K4TA 4L0YB 3J7AO 3WTXC 2EFQA 4ZH4F 4M3FA 2ACJA 5CQEA 3IAM2 2AQFA 2CWEA 4I99C 1OCTC 3IP4B 4B47A 2DMTA 4C9YA 1ON1A 2M4KA 3HOUJ 2IGMA 2HI3A 1KU2A 3FMSA 5JLWA 4U7DA 1XB4A 2LC2A 3K1PA 2W48A 5J3LA 2V26A 4RDUA 9ANTA 5HLTA 1K78A 3OV8A 4WF2A 4CCOA 4LK0F 3L1PA 2NVTJ 2PG4A 3ZPLA 3L2QA 4RAGA 3HKZA 3JRBA 3FZVA 3EYYA 4B09A 2EFPA 4K2EA 5K5OA 2BVMA 4IZZA 2GA1A 4HAMA 3WG7H 3I4NJ 4XICA 5D4RA 1QZYA 5FRNA 1AWCA 5L3CA 3CJRB 2JA5J 3SFZA 4CGZA 2ZXIA 4EJUA 3KE2A 2ZNZA 3K70D 4DYRA 1SFXA 2MA3A 2P4WA 3KZYA 4AIDA 5E1WA 3HYIA 1Y6IA 2WB1A 3ZXSA 3CUQA 3CJQB 2D45A 2R4GA 1T6SA 1NK2P 1S29A 2CQ7A 2BHZA 4UUVA 4ETSA 3DFGA 3Q0UA 4Q47A 1V5FA 4ZYGA 2BE5F 4B8XA 1W5CC 4IX7A 3AL0C 3J7AY 4FHTA 2C6YA 3TO6A 1RPWA 3DLAA 1QQIA 1S6LA 3W2VA 1ZG1A 1M1EB 1FEXA 2R7TA 5JVGF 2F2EA 2R7SA 2LFBA 4AIHA 4DZPA 2XGXA 5K7HA 3S3MA 2R7RA 5TRDA 4UUSA 1U2WA 5FD5A 4A93J 1WWXA 3JSPA 2FMYA 4OMZA 1YW8A 4P55A 3HGYA 5FKLA 3L2UA 2NNYA 1QHHD 3F6OA 3MD2A 4CCLA 4A0ZA 2XGDA 3G1LA 2IXSA 2PMHA 2IJLA 3CUQB 3LL7A 1USTA 1W7PA 3COAC 2IT0A 1LB2A 4XNFA 4YIFA 2JJ7A 4OIOF 1XPXA 3KP5A 1YJ9I 3JTHA 4XN0A 3L2VA 2BXZA 4QIWN 1UMQA 1WJFA 1A31A 2VQGA 1FSEA 2Y2ZA 4RS8A 2LG4A 1P4WA 2G9WA 2L4MA 1FWZA 1PVEA 4Y15A 4BEHA 3S14J 3RQ4A 4P9FA 2CG4A 4XRSG 3WODF 2V7FA 1WH7A 4CA0A 4KITB 2EZHA 3HPGA 1W36C 1Y39A 4HF1A 2M4GA 1GV5A 2BY2A 3PNVA 2DT6A 1MZBA 3VEPA 3N05A 4ZDOA 2YR2A 2YS9A 1F1ZA 4KJZA 4UUSB 2LK2A 3TQNA 3I58A 1OQYA 1J2XA 3C1DA 2OUMA 3IH4A 4G6DA 1YW7A 1ETYA 2BY3A 2FOKA 3P9IA 4X6AJ 4C2TA 5GAHJ 2VPLA 2H09A 3ABTA 4IHSA 4C3IJ 2P7CB 2X1DA 1B59A 4IO9F 4MNUA 5FB2A 4NB5A 1H89C 2IVMA 3QPHA 4WXHA 1IAWA 3Q0WA 4WX9A 1WVRA 4PJLA 2CQNA 4M6YA 5FD6A 2NVXJ 5CYVA 4BEHB 2VODA 1OPCA 4M74A 1G8XA 1WJBA 2XVCA 3BTIA 1UJ8A 5EGOA 1DPUA 3OS2A 3MFKA 1IV6A 2UZKA 1BI3A 2KT0A 2MG4A 4BS9A 1V3FA 1TNTA 2R7QA 5JLXA 4LGWA 2FBIA 4PCQA 3ZMTA 5E3NA 5BOXA 1VQ9I 5EEGA 1J59A 1WI9A 1ZLJA 1JHFA 2COBA 3T8RA 3TEDA 1U78A 5GTIC 3O8GA 4N0BA 3MN2A 1Y1VJ 2VBZA 4RAYA 3S1RJ 1ZKGA 1LQ1A 1MSEC 1R36A 1FY7A 4O6JA 3OR2C 1W4MA 3CCRI 5J8CA 3AL0B 1S8NA 3C2GA 2RV8A 2EV5A 1E0EA 3RZDJ 1YO5C 4UHTA 4YEJA 2QSGX 3GZNB 4IHYA 4PK4A 4XKWA 2YU9J 1BR2A 1RESA 3AAFA 2M0MA 1OISA 2BOLA 3FXJA 1JUSA 3HRMA 4XN3A 1A36A 1R1UA 4HBLA 1R7JA 3FM5A 2BGCA 1Z7UA 4DJAA 2CV2A 5BMZA 5EEAA 2FNAA 1PP7U 4AM3A 2VIXA 4ZC3A 5M3FJ 4EQQA 2Y0SA 2WB1N 2HOAA 5D4SA 1VQPI 3AG1H 3L7WA 3HSEA 4A3KJ 2EZIA 2FX0A 2QQBA 4FISA 3IC7A 4P1WA 3L2RA 1P2FA 1PUEE 1D1AA 4CCJA 4NC7A 3FK7A 3GTGJ 3GFMA 4RM3A 1W0UA 4I01A 4II3A 4RMNA 4IQJA 3SHFA 4AU7A 4M73A 4YFNF 3OYLA 5IP7J 4AWXB 4KIGA 3QODA 4OWRB 4XL9A 3WGGA 3FK6A 1LDKB 3FHNA 1JT6A 2Q8KA 1ZTRA 3EUHC 3FXKA 3A02A 4XONA 1LVKA 3RI4A 4V2FA 3MEXA 4C3JJ 1W1WE 3CZ6A 4NNJA 3K4CA 4V19K 2M7AA 1BJZA 1X1AA 3OS1A 4CUGA 2P5VA 3Q0VA 2RDPA 2MSYA 3FMRA 1YHQI 4XMYA 1SD6A 5CVRA 2KFDA 3CLOA 3K69A 4IHWA 1WZ2A 1D0XA 2K9LA 5DUKA 1UAAA 4ZTJA 5LFAA 4E7KA 3VB2A 2DMPA 5GPAA 2XAHA 4J19A 1OMIA 1JGSA 1EH7A 3ABMH 1ETWA 4BDZA 3PJRA 3I4PA 1MNDA 1QU3A 2DQRA 1RZ4A 1IZ1A 2ID6A 1LFBA 3DP7A 4G8XA 5H6RA 5K5QA 3RKYA 3M8FA 3E6BA 4M3DA 3IWZA 5J4VA 2DI3A 4LK1F 3LSKA 1YX3A 2QM3A 4BHBA 1JGGA 2O3FA 3HGGA 4XM3A 5LHIA 2NVUB 3KEOA 2IS1A 2DN0A 2EA4A 1ETOA 4M71A 1R23A 1WQ2A 4P5OA 1UHSA 2JUGA 2W25A 1HQCA 2GZWA 1HSTA 1IN6A 2HYFA 4E6KG 2M0CA 4XLFA 3JRFA 1PUFA 5DYMA 1VQKI 3DV8A 4EM2A 1IGNA 3BOQA 1S3JA 2V1XA 2L7ZA 2NOGA 1IRZA 1T39A 2O8XA 2DMQA 1ONVA 1V54H 5JI6A 3GZ6A 1FOWA 3H3ZA 3PSIA 3OSFA 3E3VA 1CGPA 1ORKA 1YJWI 4L9NA 4HPQA 4BQAA 5CQGA 2Z16A 2KLOA 2OBPA 3D5SC 3P7NA 3R0AA 2VKEA 1LKXA 4M6XA 3CC2I 1XMXA 3BPVA 2HPIA 2VQHA 4QSHA 1SFUA 4OIPF 1OKRA 2O9LA 2ZKZA 3WHCA 3BZKA 2IA1A 3QU3A 1X3WB 3CJTB 5ILSA 2FOWA 1B8IA 4UVCA 5EZHA 1MGTA 5F0FA 3DKWA 2BY1A 2ME6A 2DO7A 2L2OA 4L9JA 4A69C 3MAJA 3BG6A 2EIMH 1QO0D 1IRFA 4HDVA 3S1NJ 4LG3A 2VXZA 2ZXWH 3B02A 1R9TJ 2DA2A 1PUFB 1D0YA 2V79A 2UWMA 2FA5A 4I7HA 4RLQA 4MFEA 3O6BB 3HJEA 2X51A 1EV7A 2M87A 1SVLA 4BJTA 4BE0A 3BJ6A 2L4AA 2MH2A 3KP2A 2F4OB 2UUZA 1N25A 2ELHA 3F6VA 4PSWA 1AKHA 2FU4A 2O03A 5C4XJ 2CQXA 1ZR2A 1BA5A 3F22A 2CW7A 2TDXA 1A6QA 1OR7C 1ZARA 1I5ZA 4S0HB 3BP8A 4U7BA 3L2WA 3H3VK 5LHHA 2DFHA 3TO7A 2QQ9A 1YRNA 5L3DA 1HBXG 3JRDA 2X6XA 2JRTA 3GTJJ 2VBYA 3ERMA 5HS7A 2OZ6A 4S04A 1FSHA 2BXYA 2MD5A 2K27A 4QPOA 3PIOF 4W97A 2AS5F 2KIQA 2QBYB 1B4AA 3HXLA 3TGNA 2FSWA 4IL6C 2JSCA 1VQ4I 3VDXA 2LBFA 2DA4A 2UV1A 4HNVA 3K10A 4PZJA 4HDUA 3HDDA 1P6RA 3ECHA 3SEQA 3G1OA 3WTTC 2OTLI 1VZ0A 3KCCA 5F27A 3OWTA 3K4KA 2XSJC 2PLYA 3DLLF 4XKVA 5TJJA 1W36D 1IXCA 2PQ8A 5H6QA 4LLNA 2XAJA 1XCVA 2M1BA 2LH9A 4A0XA 4BXUA 2ZXHA 4I0AA 4HSRA 3DPTA 3A03A 1AKHB 3BWGA 3H9GA 5L3FA 2GXAA 3AKZA 2DCEA 3SZTA 3OOPA 4N4NB 2STWA 3PL8A 3FIWA 2P8TA 5LRSA 2WWYA 3PO2J 1BW5A 1D8JA 3F0CA 1YRNB 1TTYA 3ELKA 4LLLA 3GTKJ 1YIJI 3FMQA 3SYTA 2DOAA 1SVMA 1YYVA 3KX2A 2JVHA 2K7LA 2OQRA 2W1OA 2ZBKA 1U0JA 1HSJA 2XAUA 5GAEJ 3EUAA 2RKHA 2LBFB 4X1EA 3ZCOA 2R7VA 3H35A 2A6TA 3U1KA 2IS6A 5H2FC 1FBSA 3D5RC 3ZMUA 4XR6A 2HPMA 2JRMA 1OR7A 2WAQA 3R60A 2A5WA 2JZYA 1IDYA 1Z3YA 1QPIA 1RR7A 3JRGA 1IXSB 1R1VA 3BR1A 2R7ZJ 1I27A 2JMWA 4KMFA 1KQ9A 2E36A 2XROA 3PNYA 2JQ7A 1P9QC 3OSGA 3RIRA 1MMNA 3CDHA 3WTVC 5D5UB 3ERED 4KT6A 1T33A 2L3DA 3K4BA 2QF7A 1TZLA 4EGYA 2PFBA 2EH3A 2G7HA 4OIRF 2MC4A 2ETHA 1Z3XA 1SEUA 3LFKA 4L5EA 1MDMA 1GT0C 1WI3A 2E1NA 2EB7A 5LEKA 1JE8A 3C7JA 2G7UA 4YRVA 1QBJA 4M9SA 2Y0MA 2M3AA 4KICA 1K83J 1H9TA 3DEWA 1TT0A 3DWLE 4V2GA 3SDBA 4BBSJ 4RB3C 3MCZA 3S1QJ 5E8GA 1JKPC 2V9VA 3FXOA 4BU2A 3LA3A 2LYCA 2FJ1A 1TLHB 2GBYA 2HVQA 2NS0A 2ZO4A 3G71I 2F6CA 4WXCA 3GFLA 2VPRA 2VC0A 4U88A 1VNDA 2M34A 5F1RA 4M6VA 1IC8A 4BHPA 5J4YA 2XDVA 3J7ZI 1DP3A 2YSRA 1ZH5A 2M8EA 5ERIA 1ZREA 2DDBA 2R92J 3ZQGA 2XV4S 5FKOA 2X1EA 3HHHA 1GLNA 2BYVE 1WJAA 3E6MA 2QQ8A 1TQPA 3LA2A 3LQRA 3T1BA 1MDMB 2V4JC 4UUTA 3KZZA 4DZJA 2DPUA 3IWFA 1UZCA 2O7OA 3T0YA 2HWVA 1EF4A 1LDJA 3FF5A 2PBIA 2MLGA 4UXNA 4DYCA 3BTLA 1FX7A 3CF2A 3K4NA 3DTIA 3W6JB 1BC8C 3LMMA 4OMYA 2Z99A 3OYIA 4FCYA 5KVRA 5IP9J 2W24A 1IW7F 4C30A 1SAXA 3NEUA 3M8JA 1GVJA 3KEQA 5GAGJ 1O57A 2VE8A 2CV1A 4BGDA 3RKQA 4P9UA 5EEHA 4ANJA 5HDKA 5E79C 1PDNC 3JR9A 1HC8A 3KP3A 3AG2H 3NRVA 2STTA 5CVVA 3SDGA 4UY8I 1QVTA 1ZR4A 4A3GJ 4MEXF 3CMYA 1YG2A 5BNGA 1K79A 1ETXA 3KIOA 1LFUP 3TL4X 4N9HA 3CUQC 1XMKA 4U0VA 3F8BA 4F92B 2QSFX 2JT1A 1YTYA 3TOAA 1A35A 3V8JA 5F04A 4PGGA 5EYRA 4DOZA 1D0ZA 1ZRFA 2H1KA 4PJJA 2HS5A 1VQNI 5J47A 3RSNA 2VJJA 3CP2A 1MMSA 1BL0A 1LEBA 3EQLF 3F8CA 2IEKA 1YW9A 4PJNA 3ECOA 4JBAA 1RNLA 4FQGA 3M8EA 2MW8A 2H6CA 3K2ZA 1XS9A 3S1MJ 2OTJI 4HQMA 3EDPA 4B44A 2CU7A 5IT3A 3QYBA 4HYEA 3L2CA 1YIOA 3BDDA 4IJAA 2EFWA 5HNHA
chains in the Genus database with same CATH topology
1O3SA 2P6SA 3L09A 1TNSA 1T2KA 2OA4A 3BJAA 3ISPA 1FLIA 3WGIA 2CQKA 3W6KB 4RAZA 3IL2A 5FO5A 1ON2A 3K0LA 4ZYEA 1LEAA 1FT9A 4HZFA 1XGOA 2HEOA 2VBWA 2R7DA 2IA2A 4KN7X 3MZHA 1DDNA 2HTJA 2HKOA 3F23A 2L01A 5AIPA 1G3YA 3REOA 2OZUA 3GLXA 4GCVA 4EJOA 2VC1A 2W84A 2QENA 1K78B 2WV0A 2Q2EA 2R3SA 5HS8A 1P4XA 2H94A 4KN4X 4JK1X 4LMYA 1LJ9A 3V7SA 2FQ3A 1OYIA 1MD0A 1T98A 3KP4A 3BZ6A 2FBKA 1GHCA 2Y48A 3HSRA 4Q4ZF 4LJZF 2HYGD 2VBXA 3VODA 2RN7A 3QAHA 3R0JA 3C3WA 3MZYA 1ODDA 3GX4X 5KK1A 2XASA 3LSTA 4L0ZB 5E1XA 2RNJA 3TKYA 3JAMK 3HRUA 5ICGA 3G3ZA 2QYOA 2GXBA 4U0YA 2HOEA 1DP7P 3HUGA 1XCBA 4ASNA 1FPQA 4XLNF 5HDGA 4G94A 5LBQA 5LLQA 3HTSB 1U5TA 2XAQA 1XSDA 2KIFA 4ENJA 2F5CA 2QWWA 1W7PB 3SXYA 4KDPA 2EA2A 5FFZA 3L00A 4OINF 5D5VB 3RKWA 3J80K 4IHTA 5JFRA 2HKXA 1JHHA 1B6AA 1S7AA 5CLSA 2DFIA 4RB0A 3KLOA 2LF7A 3D0SA 2O61A 4ESFA 4FX4A 1I6XA 4G7OF 4I0BA 4BYYA 1MJBA 4HX8A 2E7WA 2H6BA 2QQAA 2F5FA 4XLPF 2J5OA 1UB9A 4RGUA 2QVOA 4IXAA 3GF2A 4HOBA 4IRGA 3WE2A 5FLXK 4R8HA 5L3EA 4G7HF 2EJRA 3M1EA 1KQ8A 4JQFA 3LAJA 2OQGA 2EFNA 1HW1A 1UCRA 2O6GE 4KNYA 1ZAOA 2XRNA 2PN6A 2BBYA 5HDNA 4HF0A 2DK8A 3TDUC 3FXUA 4HV6A 2NNNA 1DPRA 2DW4A 2GWRA 1KU9A 1IUYA 3HIFA 1H0MA 1F5TA 5IT9Z 2IPQX 4L5IA 2DK5A 4M9ZA 2KRFA 4RGSA 4RB2C 1YFHA 5HLIA 4A2UA 3GXOA 1Z6RA 3ZN0A 2OAZA 2GIVA 4RGXA 1Q1HA 4NHJA 1IF1A 1XN7A 2DAOA 3QP6A 3I59A 5AONA 4HLYA 5D5XB 2LDUA 1R5HA 2FF4A 2FBHA 5D8KB 4I09A 5D5WB 2A6HF 1TW2A 4L18B 3CTAA 3FHZA 3WE3A 1TBXA 2F5EA 3RJPA 4E70A 1K7AA 3ZMZA 2PEXA 1RI7A 3IRQA 3MWMA 3ZP5A 1ZYRF 4GO1A 4CICA 1ZHFA 2Y75A 4PDKA 2UXXA 3VOEA 3CUOA 3WU1B 3I59B 3V8KA 5F6FA 2HZTA 4HQEA 2DLLA 3KP6A 3P9CA 3R6SA 1Z9CA 4R79A 1J75A 1TW3A 5K5RA 2VT3A 1T0FA 1D8KA 1R58A 4R1HA 1XDSA 3NQOA 3IHUA 2GAUA 3FXQA 4I98B 2VE9A 3KP7A 3F21A 5D8LB 2MC3A 1BI2A 1XGSA 5BQTA 4MQ9F 5LGUA 2K4JA 2E1CA 1G3WA 3J81K 1ZG3A 4ESBA 5DEQA 4CZZA 2RGVA 1RUNA 4A6DA 3U9GA 1L0OC 4KIFA 1G6NA 1Z6TA 4LD5A 1SMYF 2E7XA 5J6XA 4ESJA 3BPXA 2QUFA 1T38A 1IN4A 4HX4A 1P92A 1XGNA 2Z3YA 3C18A 2M45A 3RKXA 3P9KA 3WTZA 3QRFF 1BC7C 1MKMA 3O3KA 3I53A 1UHWA 1O3QA 2ZMEA 1WSUA 5BPDA 4KIBA 1BIBA 4CHUA 1ZGJA 1KU3A 3Q9SA 5E8IA 4AVPA 1R5GA 3HRTA 3IKTA 3O2PE 4ENNA 4EMSA 1S7OA 2YPRA 3V7CA 2Q0OA 4M9XA 3Q5FA 4LB6B 3EETA 5HS9A 3LQQA 1SMTA 2VOOA 3RYPA 2OU2A 3F72A 4YFKF 2FRHA 4MTEA 4ZYHA 3KFWX 3J80Z 1FP1D 1ZRDA 1ZLKA 4BNCA 2EV0A 2ZMEB 2K86A 3T5XA 4IRHA 1D5VA 3MQ0A 2RC4A 5D6FA 5D6EA 1IRGA 3F8FA 1HW5A 2OD5A 3U1DA 4A5NA 1O3RA 3E5UA 4OU0A 5CVUA 2PI0A 4HA8A 1HKTA 2YX7A 4FT8A 4WCGA 2HTSA 3H3UA 2XKPA 5FLXZ 2A68F 3IRRA 3E6DA 3JW4A 3F8MA 2GQQA 1ZG5A 1ZN2A 3WTWC 1Z91A 5E18F 1J9IA 3ZN1A 2X4HA 2ADUA 3E6CC 4LB5A 4KUMA 1GXPA 5HLHA 5JR3A 4ZZDA 2CFXA 5HVQC 2UXNA 4OIQF 4QLCU 1U6GA 1IN7A 1REPC 2P5LC 1D3YA 2MBFA 4AD9A 3LA7A 2JPCA 3GO5A 4BH9A 1Y0UA 4FX0A 1G3TA 3PQKA 2R7FA 1VTNC 1BN5A 5CJ9A 1WKMA 2V1UA 3RYRA 1LNWA 1RUOA 3QP5A 2ZXJA 1BM9A 3FM3A 2XUBA 3TOBA 4UV8A 2HR3A 1JXSA 2L02A 5DD4A 1X3UA 3DXJF 1FYLA 1QNTA 4A5MA 2FNPA 2XHKA 3RDIA 1F9NA 2V6CA 1F4KA 1KA8A 4LG0A 4KT5C 5LGTA 4WXDA 2HFHA 1SD5A 1XSVA 4DQ2A 4EM1A 4GYGA 2DBBA 4Y17A 2A07F 5LRRA 1QZZA 4S05A 4LFUA 4YFXF 2F5DA 3IKVA 2MLKA 1SD7A 2IP2A 4EV0A 4KA4A 3K1MA 1E17A 4RB1A 1BOAA 5DDGA 1ZRCA 1LDDA 1U5TC 1ULYA 2QLZA 4CDGA 3QOPA 2IA0A 4ON0A 1TQMA 5L3BA 4LG0B 4ENKA 3CO6C 1B9MA 2A61A 2CW0F 1EH6A 2KJBA 3GWZA 1O7FA 4G7ZF 1KGSA 2DQLA 3U2RA 3K1NA 3HSFA 5FGMA 3ABUA 5CVIA 3J81Z 2FXAA 3V4GA 4GXOA 3TDZC 1L3LA 4MEYF 4UVAA 2VT2A 1U8RA 1HXDA 2L54A 5BS6A 2WTEA 4TV7A 4UVBA 1BI0A 2HGCA 2H27A 1E2XA 1R1TA 1P4AA 1FYKA 1BI1A 1KYZA 3I5UA 2J5PA 2JTVA 4IF4A 4EVIA 3SZPA 4ZYDA 2NAZA 2O0YA 1KU7A 4MQVA 1O3TA 3VFZA 4XSZF 1J5YA 3V8LA 2CSOA 1DUXC 1B1BA 4D0PA 5L3GA 4IRIA 1FYMA 3PFIA 4H0EA 5E1ZB 1OYYA 3DEUA 2QZ8A 4M72A 5HOOA 1TQIA 2EV6A 4GGGA 4MHGA 3BY6A 2K4BA 4Q5SF 1KYWA 2MH9A 3GEZA 2CGPA 3LWFA 5ED4A 2GA2A 1UFMA 2CO5A 4L5JA 2P5KA 5CVJA 3I71A 3B73A 5ICCA 3KETA 5DCFA 1U5TB 2IRFG 3M7GA 4RGRA 4HLXA 2P7VB 2AXLA 3QU6A 4MTDA 2NRAC 3ZMDA 2XAFA 3V7RA 3I0TA 3ZMVA 2ZFWA 2HQNA 4ZZLA 2KJCA 3RPQA 2HDCA 5ILVA 3I64A 2YU3A 4HF2A 2A3SA 1QPMA 2CYYA 2DPDA 3ZMSA 2FE3A 4O3MA 3I54A 5K1YA 3RTRA 4OOIA 2JPBA 3E5QA 2A69F 4L9TA 1NHAA 1FZPB 4ENMA 4LLGF 1SFEA 4WK8F 3WTSC 3E5XA 2PJPA 2RQPA 4XRFA 4YG2F 2A6EF 1XSXA 3HOSA 2VOPA 1W5SA 3M9AA 2VN2A 1ZGAA 4Y13A 1LVAA 3EYIA 1K6OA 2LF8A 5A2QK 2KIMA 2Z5UA 2D1HA 3S2WA 2ZJ2A 3L9FA 1IN8A 3F8NA 1YS7A 1IN5A 4CXFA 4EGZA 4BAYA 5E17F 3KLNA 4G9YA 2XAGA 1YS6A 1W7PD 2LKPA 2A5YB 2GXGA 2PMUA 1IXRC 5ILUA 2Z33A 2D2WA 3JTGA 3JSOA 3R4KA 3HHGA 3DF8A 3GFIA 3GVAA 5JVTA 3E97A 1SD4A 3SQNA 1FOKA 1BJAA 1GXQA 4I2OA 5DV5A 3ML6A 2Z9OA 2VONA 2M30A 3GFJA 3EUHA 4A0YA 5H20A 1STZA 5HLGA 3BROA 3CJNA 3K9TA 3QPTA 1MJ9A 3CO7C 3DQVC 3N4MA 4EJWA 3HOTA 4HV5A 3DPLC 2QBYA 4WWCA 2ESNA 1G3SA 5FFXA 2DTRA 1HW2A 1OYWA 1MJAA 4HX7A 1W5TA 2WC2A 2BEOA 3WGHA 3ZQ7A 4QWQA 3ROUA 4IPAA 2P6TA 2FEZA 1CF7A 4L9VA 2W85A 3ULQB 4KMUX 3T8TA 2M5WA 1PP8F 3RPUA 3Q9VA 4AIKA 3WG9A 1XD7A 6PAXA 1HKQA 2RVCA 3JAMZ 3GYHX 1EH8A 2YX4A 2ESHA 5JHUA 3FXRA 4BHCA 4KYWA 3D5LA 2COMA 4EJTA 1FP2A 4IVNA 4F7ZA 3HRSA 5E20A 4A6EA 2D1VA 5DCMA 3F3XA 4P96A 4UNOA 1CF7B 1O7LA 3WU0A 2EFOA 2FMLA 1KQ0A 5AIQA 5ICFA 4N9IA 4PGHA 1B9NA 1BIAA 1I1GA 2BV6A 4CO8A 3FX3A 4XSXF 5J8FA 1YQAA 1QGPA 2W57A 2ZCWA 4O5VA 4EJVA 3TO9A 5DCMB 2EWNA 2B0LA 2LSOA 5LGNA 5DUIA 4HW0A 5BPIA 5LEJA 4GYIA 1U3EM 1C0WA 3N97A 1Z1DA 4CYDA 2V1DA 5LHGA 2X0LA 2XKOA 3H92A 3R61A 4I02A 1FC3A 4U0WA 1H9GA 4EM0B 2ZNYA 1RIOH 1A04A 1UHMA 3GUDA 4AIJA 1WRJA 3WTYC 2XIGA 3FWEA 1R22A 3G73A 2KKOA 1J0RA 4KFCA 3GZ5A 2DT5A 1FBQA 1XDUA 5IT9K 1I1SA 3BJOA 4MGRA 4UV9A 3PQJA 1XMAA 4A12A 2DU9A 2NYXA 2KIUA 4Z2YA 3WTUC 1AOYA 3HTUA 1XGMA 1YLFA 4G6QA 1R00A 2K02A 4XBFA 5ICEA 1V4RA 4Q48A 1G4DA 2ISZA 1BBYA 2IW5A 1Z05A 4DNCA 3GW2A 1USSA 4YIIA 5F64A 2EK5A 4NQWA 3LAPA 1J7KA 2LNBA 1FBUA 5A2QZ 5DD8A 2HQRA 1HKSA 2ISYA 1FNNA 4L0YB 3J7AO 3WTXC 2EFQA 4ZH4F 2ACJA 2CWEA 1ON1A 1KU2A 3FMSA 4U7DA 1XB4A 3K1PA 1K78A 3OV8A 4WF2A 4LK0F 2PG4A 3ZPLA 3FZVA 3EYYA 4B09A 2EFPA 4K2EA 5K5OA 2GA1A 4HAMA 5D4RA 1QZYA 1AWCA 5L3CA 3SFZA 4CGZA 4EJUA 3KE2A 2ZNZA 1SFXA 2MA3A 2P4WA 3KZYA 5E1WA 3HYIA 3CUQA 2D45A 1T6SA 1S29A 4UUVA 4ETSA 3DFGA 4Q47A 4ZYGA 2BE5F 4B8XA 4FHTA 2C6YA 3TO6A 1QQIA 1S6LA 1ZG1A 2F2EA 4AIHA 2XGXA 5TRDA 1U2WA 5FD5A 1WWXA 3JSPA 2FMYA 4OMZA 1YW8A 4P55A 2NNYA 3F6OA 4A0ZA 2PMHA 2IJLA 3CUQB 1USTA 1W7PA 3COAC 2IT0A 1LB2A 4YIFA 4OIOF 3KP5A 3JTHA 1FSEA 4RS8A 1P4WA 2G9WA 2L4MA 1FWZA 4Y15A 4P9FA 2CG4A 3WODF 4HF1A 1MZBA 3VEPA 2YR2A 1F1ZA 3TQNA 3I58A 1J2XA 3C1DA 4G6DA 1YW7A 2FOKA 3P9IA 2H09A 3ABTA 4IHSA 2P7CB 1B59A 4MNUA 5FB2A 4NB5A 2IVMA 3QPHA 4WXHA 1IAWA 4WX9A 4M6YA 5FD6A 5CYVA 2VODA 1OPCA 4M74A 2XVCA 1DPUA 3MFKA 2UZKA 1BI3A 1V3FA 1TNTA 4LGWA 2FBIA 4PCQA 3ZMTA 5BOXA 5EEGA 1J59A 1WI9A 1ZLJA 1JHFA 3T8RA 1U78A 4N0BA 2VBZA 4RAYA 1LQ1A 1R36A 1FY7A 4O6JA 1W4MA 5J8CA 1S8NA 2RV8A 2EV5A 1YO5C 4UHTA 3AAFA 3HRMA 1R1UA 4HBLA 1R7JA 3FM5A 2BGCA 1Z7UA 5BMZA 2FNAA 1PP7U 4EQQA 5D4SA 3L7WA 3HSEA 2QQBA 3IC7A 1P2FA 1PUEE 3GFMA 4I01A 3SHFA 4M73A 4YFNF 4AWXB 4KIGA 3WGGA 1LDKB 2Q8KA 3RI4A 3MEXA 2P5VA 2RDPA 3FMRA 1SD6A 5CVRA 3CLOA 3K69A 5DUKA 3VB2A 2XAHA 1OMIA 1JGSA 1EH7A 3I4PA 2DQRA 1RZ4A 1IZ1A 3DP7A 4G8XA 5H6RA 5K5QA 3RKYA 3M8FA 3E6BA 3IWZA 2DI3A 4LK1F 2QM3A 4BHBA 2O3FA 5LHIA 3KEOA 2EA4A 4M71A 1R23A 1WQ2A 4P5OA 2W25A 1HQCA 2GZWA 1HSTA 1IN6A 2HYFA 5DYMA 3DV8A 4EM2A 3BOQA 1S3JA 2V1XA 1T39A 2O8XA 1ONVA 5JI6A 3GZ6A 3H3ZA 3E3VA 1CGPA 4L9NA 4BQAA 2OBPA 3P7NA 3R0AA 4M6XA 3BPVA 1SFUA 4OIPF 1OKRA 2ZKZA 2IA1A 3QU3A 5ILSA 4UVCA 1MGTA 3DKWA 2DO7A 4L9JA 3MAJA 1QO0D 1IRFA 4HDVA 2VXZA 3B02A 2V79A 2UWMA 2FA5A 4I7HA 3O6BB 1EV7A 2M87A 3BJ6A 2L4AA 2MH2A 3KP2A 3F6VA 2ELHA 2FU4A 2O03A 3F22A 2TDXA 1ZARA 1I5ZA 3BP8A 4U7BA 5LHHA 3TO7A 2QQ9A 5L3DA 1HBXG 2JRTA 2VBYA 5HS7A 2OZ6A 4S04A 1FSHA 2MD5A 2K27A 2AS5F 2QBYB 1B4AA 3TGNA 2FSWA 2JSCA 4PZJA 4HDUA 1P6RA 3ECHA 3WTTC 3KCCA 2PLYA 5TJJA 1IXCA 2PQ8A 5H6QA 4LLNA 2XAJA 1XCVA 2M1BA 4A0XA 4BXUA 4I0AA 3DPTA 3BWGA 5L3FA 3SZTA 3OOPA 2STWA 5LRSA 2P8TA 2WWYA 1D8JA 1TTYA 3ELKA 4LLLA 3FMQA 1YYVA 2K7LA 2OQRA 2ZBKA 1HSJA 2RKHA 1FBSA 3ZMUA 1OR7A 3R60A 2JZYA 1IXSB 1R1VA 1I27A 4KMFA 1KQ9A 2XROA 3RIRA 3CDHA 3WTVC 5D5UB 3ERED 2L3DA 4EGYA 2PFBA 2G7HA 4OIRF 2ETHA 3LFKA 1MDMA 2E1NA 2EB7A 5LEKA 1JE8A 3C7JA 2G7UA 1QBJA 4M9SA 2Y0MA 4KICA 1H9TA 4RB3C 3MCZA 5E8GA 2V9VA 3LA3A 1TLHB 2NS0A 2ZO4A 4WXCA 3GFLA 2VC0A 4U88A 5F1RA 4BHPA 2YSRA 1ZH5A 2M8EA 5ERIA 1ZREA 2XV4S 3HHHA 2BYVE 3E6MA 3LA2A 1TQPA 3LQRA 3T1BA 1MDMB 3KZZA 2DPUA 3IWFA 3T0YA 2HWVA 1LDJA 3FF5A 2PBIA 2MLGA 4UXNA 1FX7A 3W6JB 1BC8C 4OMYA 2Z99A 5KVRA 2W24A 1IW7F 1SAXA 3NEUA 1GVJA 3KEQA 1O57A 2VE8A 4P9UA 5EEHA 5HDKA 1PDNC 3KP3A 3NRVA 2STTA 5CVVA 4MEXF 1YG2A 1K79A 4N9HA 3CUQC 1XMKA 4U0VA 3F8BA 2JT1A 1YTYA 3TOAA 3V8JA 4PGGA 1ZRFA 2HS5A 1LEBA 3EQLF 3F8CA 1YW9A 3ECOA 4JBAA 1RNLA 3M8EA 2H6CA 3K2ZA 4HQMA 3EDPA 5IT3A 4HYEA 3L2CA 1YIOA 3BDDA 4IJAA 2EFWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O3S A;  2P6S A;  3L09 A;  1TNS A;  1T2K A;  2OA4 A;  3BJA A;  3ISP A;  1FLI A;  3WGI A;  2CQK A;  3W6K B;  4RAZ A;  3IL2 A;  5FO5 A;  1ON2 A;  3K0L A;  4ZYE A;  1LEA A;  1FT9 A;  4HZF A;  1XGO A;  2HEO A;  2VBW A;  2R7D A;  2IA2 A;  4KN7 X;  3MZH A;  1DDN A;  2HTJ A;  2HKO A;  3F23 A;  2L01 A;  5AIP A;  1G3Y A;  3REO A;  2OZU A;  3GLX A;  4GCV A;  4EJO A;  2VC1 A;  2W84 A;  2QEN A;  1K78 B;  2WV0 A;  2Q2E A;  2R3S A;  5HS8 A;  1P4X A;  2H94 A;  4KN4 X;  4JK1 X;  4LMY A;  1LJ9 A;  3V7S A;  2FQ3 A;  1OYI A;  1MD0 A;  1T98 A;  3KP4 A;  3BZ6 A;  2FBK A;  1GHC A;  2Y48 A;  3HSR A;  4Q4Z F;  4LJZ F;  2HYG D;  2VBX A;  3VOD A;  2RN7 A;  3QAH A;  3R0J A;  3C3W A;  3MZY A;  1ODD A;  3GX4 X;  5KK1 A;  2XAS A;  3LST A;  4L0Z B;  5E1X A;  2RNJ A;  3TKY A;  3JAM K;  3HRU A;  5ICG A;  3G3Z A;  2QYO A;  2GXB A;  4U0Y A;  2HOE A;  1DP7 P;  3HUG A;  1XCB A;  4ASN A;  1FPQ A;  4XLN F;  5HDG A;  4G94 A;  5LBQ A;  5LLQ A;  3HTS B;  1U5T A;  2XAQ A;  1XSD A;  2KIF A;  4ENJ A;  2F5C A;  2QWW A;  1W7P B;  3SXY A;  4KDP A;  2EA2 A;  5FFZ A;  3L00 A;  4OIN F;  5D5V B;  3RKW A;  3J80 K;  4IHT A;  5JFR A;  2HKX A;  1JHH A;  1B6A A;  1S7A A;  5CLS A;  2DFI A;  4RB0 A;  3KLO A;  2LF7 A;  3D0S A;  2O61 A;  4ESF A;  4FX4 A;  1I6X A;  4G7O F;  4I0B A;  4BYY A;  1MJB A;  4HX8 A;  2E7W A;  2H6B A;  2QQA A;  2F5F A;  4XLP F;  2J5O A;  1UB9 A;  4RGU A;  2QVO A;  4IXA A;  3GF2 A;  4HOB A;  4IRG A;  3WE2 A;  5FLX K;  4R8H A;  5L3E A;  4G7H F;  2EJR A;  3M1E A;  1KQ8 A;  4JQF A;  3LAJ A;  2OQG A;  2EFN A;  1HW1 A;  1UCR A;  2O6G E;  4KNY A;  1ZAO A;  2XRN A;  2PN6 A;  2BBY A;  5HDN A;  4HF0 A;  2DK8 A;  3TDU C;  3FXU A;  4HV6 A;  2NNN A;  1DPR A;  2DW4 A;  2GWR A;  1KU9 A;  1IUY A;  3HIF A;  1H0M A;  1F5T A;  5IT9 Z;  2IPQ X;  4L5I A;  2DK5 A;  4M9Z A;  2KRF A;  4RGS A;  4RB2 C;  1YFH A;  5HLI A;  4A2U A;  3GXO A;  1Z6R A;  3ZN0 A;  2OAZ A;  2GIV A;  4RGX A;  1Q1H A;  4NHJ A;  1IF1 A;  1XN7 A;  2DAO A;  3QP6 A;  3I59 A;  5AON A;  4HLY A;  5D5X B;  2LDU A;  1R5H A;  2FF4 A;  2FBH A;  5D8K B;  4I09 A;  5D5W B;  2A6H F;  1TW2 A;  4L18 B;  3CTA A;  3FHZ A;  3WE3 A;  1TBX A;  2F5E A;  3RJP A;  4E70 A;  1K7A A;  3ZMZ A;  2PEX A;  1RI7 A;  3IRQ A;  3MWM A;  3ZP5 A;  1ZYR F;  4GO1 A;  4CIC A;  1ZHF A;  2Y75 A;  4PDK A;  2UXX A;  3VOE A;  3CUO A;  3WU1 B;  3I59 B;  3V8K A;  5F6F A;  2HZT A;  4HQE A;  2DLL A;  3KP6 A;  3P9C A;  3R6S A;  1Z9C A;  4R79 A;  1J75 A;  1TW3 A;  5K5R A;  2VT3 A;  1T0F A;  1D8K A;  1R58 A;  4R1H A;  1XDS A;  3NQO A;  3IHU A;  2GAU A;  3FXQ A;  4I98 B;  2VE9 A;  3KP7 A;  3F21 A;  5D8L B;  2MC3 A;  1BI2 A;  1XGS A;  5BQT A;  4MQ9 F;  5LGU A;  2K4J A;  2E1C A;  1G3W A;  3J81 K;  1ZG3 A;  4ESB A;  5DEQ A;  4CZZ A;  2RGV A;  1RUN A;  4A6D A;  3U9G A;  1L0O C;  4KIF A;  1G6N A;  1Z6T A;  4LD5 A;  1SMY F;  2E7X A;  5J6X A;  4ESJ A;  3BPX A;  2QUF A;  1T38 A;  1IN4 A;  4HX4 A;  1P92 A;  1XGN A;  2Z3Y A;  3C18 A;  2M45 A;  3RKX A;  3P9K A;  3WTZ A;  3QRF F;  1BC7 C;  1MKM A;  3O3K A;  3I53 A;  1UHW A;  1O3Q A;  2ZME A;  1WSU A;  5BPD A;  4KIB A;  1BIB A;  4CHU A;  1ZGJ A;  1KU3 A;  3Q9S A;  5E8I A;  4AVP A;  1R5G A;  3HRT A;  3IKT A;  3O2P E;  4ENN A;  4EMS A;  1S7O A;  2YPR A;  3V7C A;  2Q0O A;  4M9X A;  3Q5F A;  4LB6 B;  3EET A;  5HS9 A;  3LQQ A;  1SMT A;  2VOO A;  3RYP A;  2OU2 A;  3F72 A;  4YFK F;  2FRH A;  4MTE A;  4ZYH A;  3KFW X;  3J80 Z;  1FP1 D;  1ZRD A;  1ZLK A;  4BNC A;  2EV0 A;  2ZME B;  2K86 A;  3T5X A;  4IRH A;  1D5V A;  3MQ0 A;  2RC4 A;  5D6F A;  5D6E A;  1IRG A;  3F8F A;  1HW5 A;  2OD5 A;  3U1D A;  4A5N A;  1O3R A;  3E5U A;  4OU0 A;  5CVU A;  2PI0 A;  4HA8 A;  1HKT A;  2YX7 A;  4FT8 A;  4WCG A;  2HTS A;  3H3U A;  2XKP A;  5FLX Z;  2A68 F;  3IRR A;  3E6D A;  3JW4 A;  3F8M A;  2GQQ A;  1ZG5 A;  1ZN2 A;  3WTW C;  1Z91 A;  5E18 F;  1J9I A;  3ZN1 A;  2X4H A;  2ADU A;  3E6C C;  4LB5 A;  4KUM A;  1GXP A;  5HLH A;  5JR3 A;  4ZZD A;  2CFX A;  5HVQ C;  2UXN A;  4OIQ F;  4QLC U;  1U6G A;  1IN7 A;  1REP C;  2P5L C;  1D3Y A;  2MBF A;  4AD9 A;  3LA7 A;  2JPC A;  3GO5 A;  4BH9 A;  1Y0U A;  4FX0 A;  1G3T A;  3PQK A;  2R7F A;  1VTN C;  1BN5 A;  5CJ9 A;  1WKM A;  2V1U A;  3RYR A;  1LNW A;  1RUO A;  3QP5 A;  2ZXJ A;  1BM9 A;  3FM3 A;  2XUB A;  3TOB A;  4UV8 A;  2HR3 A;  1JXS A;  2L02 A;  5DD4 A;  1X3U A;  3DXJ F;  1FYL A;  1QNT A;  4A5M A;  2FNP A;  2XHK A;  3RDI A;  1F9N A;  2V6C A;  1F4K A;  1KA8 A;  4LG0 A;  4KT5 C;  5LGT A;  4WXD A;  2HFH A;  1SD5 A;  1XSV A;  4DQ2 A;  4EM1 A;  4GYG A;  2DBB A;  4Y17 A;  2A07 F;  5LRR A;  1QZZ A;  4S05 A;  4LFU A;  4YFX F;  2F5D A;  3IKV A;  2MLK A;  1SD7 A;  2IP2 A;  4EV0 A;  4KA4 A;  3K1M A;  1E17 A;  4RB1 A;  1BOA A;  5DDG A;  1ZRC A;  1LDD A;  1U5T C;  1ULY A;  2QLZ A;  4CDG A;  3QOP A;  2IA0 A;  4ON0 A;  1TQM A;  5L3B A;  4LG0 B;  4ENK A;  3CO6 C;  1B9M A;  2A61 A;  2CW0 F;  1EH6 A;  2KJB A;  3GWZ A;  1O7F A;  4G7Z F;  1KGS A;  2DQL A;  3U2R A;  3K1N A;  3HSF A;  5FGM A;  3ABU A;  5CVI A;  3J81 Z;  2FXA A;  3V4G A;  4GXO A;  3TDZ C;  1L3L A;  4MEY F;  4UVA A;  2VT2 A;  1U8R A;  1HXD A;  2L54 A;  5BS6 A;  2WTE A;  4TV7 A;  4UVB A;  1BI0 A;  2HGC A;  2H27 A;  1E2X A;  1R1T A;  1P4A A;  1FYK A;  1BI1 A;  1KYZ A;  3I5U A;  2J5P A;  2JTV A;  4IF4 A;  4EVI A;  3SZP A;  4ZYD A;  2NAZ A;  2O0Y A;  1KU7 A;  4MQV A;  1O3T A;  3VFZ A;  4XSZ F;  1J5Y A;  3V8L A;  2CSO A;  1DUX C;  1B1B A;  4D0P A;  5L3G A;  4IRI A;  1FYM A;  3PFI A;  4H0E A;  5E1Z B;  1OYY A;  3DEU A;  2QZ8 A;  4M72 A;  5HOO A;  1TQI A;  2EV6 A;  4GGG A;  4MHG A;  3BY6 A;  2K4B A;  4Q5S F;  1KYW A;  2MH9 A;  3GEZ A;  2CGP A;  3LWF A;  5ED4 A;  2GA2 A;  1UFM A;  2CO5 A;  4L5J A;  2P5K A;  5CVJ A;  3I71 A;  3B73 A;  5ICC A;  3KET A;  5DCF A;  1U5T B;  2IRF G;  3M7G A;  4RGR A;  4HLX A;  2P7V B;  2AXL A;  3QU6 A;  4MTD A;  2NRA C;  3ZMD A;  2XAF A;  3V7R A;  3I0T A;  3ZMV A;  2ZFW A;  2HQN A;  4ZZL A;  2KJC A;  3RPQ A;  2HDC A;  5ILV A;  3I64 A;  2YU3 A;  4HF2 A;  2A3S A;  1QPM A;  2CYY A;  2DPD A;  3ZMS A;  2FE3 A;  4O3M A;  3I54 A;  5K1Y A;  3RTR A;  4OOI A;  2JPB A;  3E5Q A;  2A69 F;  4L9T A;  1NHA A;  1FZP B;  4ENM A;  4LLG F;  1SFE A;  4WK8 F;  3WTS C;  3E5X A;  2PJP A;  2RQP A;  4XRF A;  4YG2 F;  2A6E F;  1XSX A;  3HOS A;  2VOP A;  1W5S A;  3M9A A;  2VN2 A;  1ZGA A;  4Y13 A;  1LVA A;  3EYI A;  1K6O A;  2LF8 A;  5A2Q K;  2KIM A;  2Z5U A;  2D1H A;  3S2W A;  2ZJ2 A;  3L9F A;  1IN8 A;  3F8N A;  1YS7 A;  1IN5 A;  4CXF A;  4EGZ A;  4BAY A;  5E17 F;  3KLN A;  4G9Y A;  2XAG A;  1YS6 A;  1W7P D;  2LKP A;  2A5Y B;  2GXG A;  2PMU A;  1IXR C;  5ILU A;  2Z33 A;  2D2W A;  3JTG A;  3JSO A;  3R4K A;  3HHG A;  3DF8 A;  3GFI A;  3GVA A;  5JVT A;  3E97 A;  1SD4 A;  3SQN A;  1FOK A;  1BJA A;  1GXQ A;  4I2O A;  5DV5 A;  3ML6 A;  2Z9O A;  2VON A;  2M30 A;  3GFJ A;  3EUH A;  4A0Y A;  5H20 A;  1STZ A;  5HLG A;  3BRO A;  3CJN A;  3K9T A;  3QPT A;  1MJ9 A;  3CO7 C;  3DQV C;  3N4M A;  4EJW A;  3HOT A;  4HV5 A;  3DPL C;  2QBY A;  4WWC A;  2ESN A;  1G3S A;  5FFX A;  2DTR A;  1HW2 A;  1OYW A;  1MJA A;  4HX7 A;  1W5T A;  2WC2 A;  2BEO A;  3WGH A;  3ZQ7 A;  4QWQ A;  3ROU A;  4IPA A;  2P6T A;  2FEZ A;  1CF7 A;  4L9V A;  2W85 A;  3ULQ B;  4KMU X;  3T8T A;  2M5W A;  1PP8 F;  3RPU A;  3Q9V A;  4AIK A;  3WG9 A;  1XD7 A;  6PAX A;  1HKQ A;  2RVC A;  3JAM Z;  3GYH X;  1EH8 A;  2YX4 A;  2ESH A;  5JHU A;  3FXR A;  4BHC A;  4KYW A;  3D5L A;  2COM A;  4EJT A;  1FP2 A;  4IVN A;  4F7Z A;  3HRS A;  5E20 A;  4A6E A;  2D1V A;  5DCM A;  3F3X A;  4P96 A;  4UNO A;  1CF7 B;  1O7L A;  3WU0 A;  2EFO A;  2FML A;  1KQ0 A;  5AIQ A;  5ICF A;  4N9I A;  4PGH A;  1B9N A;  1BIA A;  1I1G A;  2BV6 A;  4CO8 A;  3FX3 A;  4XSX F;  5J8F A;  1YQA A;  1QGP A;  2W57 A;  2ZCW A;  4O5V A;  4EJV A;  3TO9 A;  5DCM B;  2EWN A;  2B0L A;  2LSO A;  5LGN A;  5DUI A;  4HW0 A;  5BPI A;  5LEJ A;  4GYI A;  1U3E M;  1C0W A;  3N97 A;  1Z1D A;  4CYD A;  2V1D A;  5LHG A;  2X0L A;  2XKO A;  3H92 A;  3R61 A;  4I02 A;  1FC3 A;  4U0W A;  1H9G A;  4EM0 B;  2ZNY A;  1RIO H;  1A04 A;  1UHM A;  3GUD A;  4AIJ A;  1WRJ A;  3WTY C;  2XIG A;  3FWE A;  1R22 A;  3G73 A;  2KKO A;  1J0R A;  4KFC A;  3GZ5 A;  2DT5 A;  1FBQ A;  1XDU A;  5IT9 K;  1I1S A;  3BJO A;  4MGR A;  4UV9 A;  3PQJ A;  1XMA A;  4A12 A;  2DU9 A;  2NYX A;  2KIU A;  4Z2Y A;  3WTU C;  1AOY A;  3HTU A;  1XGM A;  1YLF A;  4G6Q A;  1R00 A;  2K02 A;  4XBF A;  5ICE A;  1V4R A;  4Q48 A;  1G4D A;  2ISZ A;  1BBY A;  2IW5 A;  1Z05 A;  4DNC A;  3GW2 A;  1USS A;  4YII A;  5F64 A;  2EK5 A;  4NQW A;  3LAP A;  1J7K A;  2LNB A;  1FBU A;  5A2Q Z;  5DD8 A;  2HQR A;  1HKS A;  2ISY A;  1FNN A;  4L0Y B;  3J7A O;  3WTX C;  2EFQ A;  4ZH4 F;  2ACJ A;  2CWE A;  1ON1 A;  1KU2 A;  3FMS A;  4U7D A;  1XB4 A;  3K1P A;  1K78 A;  3OV8 A;  4WF2 A;  4LK0 F;  2PG4 A;  3ZPL A;  3FZV A;  3EYY A;  4B09 A;  2EFP A;  4K2E A;  5K5O A;  2GA1 A;  4HAM A;  5D4R A;  1QZY A;  1AWC A;  5L3C A;  3SFZ A;  4CGZ A;  4EJU A;  3KE2 A;  2ZNZ A;  1SFX A;  2MA3 A;  2P4W A;  3KZY A;  5E1W A;  3HYI A;  3CUQ A;  2D45 A;  1T6S A;  1S29 A;  4UUV A;  4ETS A;  3DFG A;  4Q47 A;  4ZYG A;  2BE5 F;  4B8X A;  4FHT A;  2C6Y A;  3TO6 A;  1QQI A;  1S6L A;  1ZG1 A;  2F2E A;  4AIH A;  2XGX A;  5TRD A;  1U2W A;  5FD5 A;  1WWX A;  3JSP A;  2FMY A;  4OMZ A;  1YW8 A;  4P55 A;  2NNY A;  3F6O A;  4A0Z A;  2PMH A;  2IJL A;  3CUQ B;  1UST A;  1W7P A;  3COA C;  2IT0 A;  1LB2 A;  4YIF A;  4OIO F;  3KP5 A;  3JTH A;  1FSE A;  4RS8 A;  1P4W A;  2G9W A;  2L4M A;  1FWZ A;  4Y15 A;  4P9F A;  2CG4 A;  3WOD F;  4HF1 A;  1MZB A;  3VEP A;  2YR2 A;  1F1Z A;  3TQN A;  3I58 A;  1J2X A;  3C1D A;  4G6D A;  1YW7 A;  2FOK A;  3P9I A;  2H09 A;  3ABT A;  4IHS A;  2P7C B;  1B59 A;  4MNU A;  5FB2 A;  4NB5 A;  2IVM A;  3QPH A;  4WXH A;  1IAW A;  4WX9 A;  4M6Y A;  5FD6 A;  5CYV A;  2VOD A;  1OPC A;  4M74 A;  2XVC A;  1DPU A;  3MFK A;  2UZK A;  1BI3 A;  1V3F A;  1TNT A;  4LGW A;  2FBI A;  4PCQ A;  3ZMT A;  5BOX A;  5EEG A;  1J59 A;  1WI9 A;  1ZLJ A;  1JHF A;  3T8R A;  1U78 A;  4N0B A;  2VBZ A;  4RAY A;  1LQ1 A;  1R36 A;  1FY7 A;  4O6J A;  1W4M A;  5J8C A;  1S8N A;  2RV8 A;  2EV5 A;  1YO5 C;  4UHT A;  3AAF A;  3HRM A;  1R1U A;  4HBL A;  1R7J A;  3FM5 A;  2BGC A;  1Z7U A;  5BMZ A;  2FNA A;  1PP7 U;  4EQQ A;  5D4S A;  3L7W A;  3HSE A;  2QQB A;  3IC7 A;  1P2F A;  1PUE E;  3GFM A;  4I01 A;  3SHF A;  4M73 A;  4YFN F;  4AWX B;  4KIG A;  3WGG A;  1LDK B;  2Q8K A;  3RI4 A;  3MEX A;  2P5V A;  2RDP A;  3FMR A;  1SD6 A;  5CVR A;  3CLO A;  3K69 A;  5DUK A;  3VB2 A;  2XAH A;  1OMI A;  1JGS A;  1EH7 A;  3I4P A;  2DQR A;  1RZ4 A;  1IZ1 A;  3DP7 A;  4G8X A;  5H6R A;  5K5Q A;  3RKY A;  3M8F A;  3E6B A;  3IWZ A;  2DI3 A;  4LK1 F;  2QM3 A;  4BHB A;  2O3F A;  5LHI A;  3KEO A;  2EA4 A;  4M71 A;  1R23 A;  1WQ2 A;  4P5O A;  2W25 A;  1HQC A;  2GZW A;  1HST A;  1IN6 A;  2HYF A;  5DYM A;  3DV8 A;  4EM2 A;  3BOQ A;  1S3J A;  2V1X A;  1T39 A;  2O8X A;  1ONV A;  5JI6 A;  3GZ6 A;  3H3Z A;  3E3V A;  1CGP A;  4L9N A;  4BQA A;  2OBP A;  3P7N A;  3R0A A;  4M6X A;  3BPV A;  1SFU A;  4OIP F;  1OKR A;  2ZKZ A;  2IA1 A;  3QU3 A;  5ILS A;  4UVC A;  1MGT A;  3DKW A;  2DO7 A;  4L9J A;  3MAJ A;  1QO0 D;  1IRF A;  4HDV A;  2VXZ A;  3B02 A;  2V79 A;  2UWM A;  2FA5 A;  4I7H A;  3O6B B;  1EV7 A;  2M87 A;  3BJ6 A;  2L4A A;  2MH2 A;  3KP2 A;  3F6V A;  2ELH A;  2FU4 A;  2O03 A;  3F22 A;  2TDX A;  1ZAR A;  1I5Z A;  3BP8 A;  4U7B A;  5LHH A;  3TO7 A;  2QQ9 A;  5L3D A;  1HBX G;  2JRT A;  2VBY A;  5HS7 A;  2OZ6 A;  4S04 A;  1FSH A;  2MD5 A;  2K27 A;  2AS5 F;  2QBY B;  1B4A A;  3TGN A;  2FSW A;  2JSC A;  4PZJ A;  4HDU A;  1P6R A;  3ECH A;  3WTT C;  3KCC A;  2PLY A;  5TJJ A;  1IXC A;  2PQ8 A;  5H6Q A;  4LLN A;  2XAJ A;  1XCV A;  2M1B A;  4A0X A;  4BXU A;  4I0A A;  3DPT A;  3BWG A;  5L3F A;  3SZT A;  3OOP A;  2STW A;  5LRS A;  2P8T A;  2WWY A;  1D8J A;  1TTY A;  3ELK A;  4LLL A;  3FMQ A;  1YYV A;  2K7L A;  2OQR A;  2ZBK A;  1HSJ A;  2RKH A;  1FBS A;  3ZMU A;  1OR7 A;  3R60 A;  2JZY A;  1IXS B;  1R1V A;  1I27 A;  4KMF A;  1KQ9 A;  2XRO A;  3RIR A;  3CDH A;  3WTV C;  5D5U B;  3ERE D;  2L3D A;  4EGY A;  2PFB A;  2G7H A;  4OIR F;  2ETH A;  3LFK A;  1MDM A;  2E1N A;  2EB7 A;  5LEK A;  1JE8 A;  3C7J A;  2G7U A;  1QBJ A;  4M9S A;  2Y0M A;  4KIC A;  1H9T A;  4RB3 C;  3MCZ A;  5E8G A;  2V9V A;  3LA3 A;  1TLH B;  2NS0 A;  2ZO4 A;  4WXC A;  3GFL A;  2VC0 A;  4U88 A;  5F1R A;  4BHP A;  2YSR A;  1ZH5 A;  2M8E A;  5ERI A;  1ZRE A;  2XV4 S;  3HHH A;  2BYV E;  3E6M A;  3LA2 A;  1TQP A;  3LQR A;  3T1B A;  1MDM B;  3KZZ A;  2DPU A;  3IWF A;  3T0Y A;  2HWV A;  1LDJ A;  3FF5 A;  2PBI A;  2MLG A;  4UXN A;  1FX7 A;  3W6J B;  1BC8 C;  4OMY A;  2Z99 A;  5KVR A;  2W24 A;  1IW7 F;  1SAX A;  3NEU A;  1GVJ A;  3KEQ A;  1O57 A;  2VE8 A;  4P9U A;  5EEH A;  5HDK A;  1PDN C;  3KP3 A;  3NRV A;  2STT A;  5CVV A;  4MEX F;  1YG2 A;  1K79 A;  4N9H A;  3CUQ C;  1XMK A;  4U0V A;  3F8B A;  2JT1 A;  1YTY A;  3TOA A;  3V8J A;  4PGG A;  1ZRF A;  2HS5 A;  1LEB A;  3EQL F;  3F8C A;  1YW9 A;  3ECO A;  4JBA A;  1RNL A;  3M8E A;  2H6C A;  3K2Z A;  4HQM A;  3EDP A;  5IT3 A;  4HYE A;  3L2C A;  1YIO A;  3BDD A;  4IJA A;  2EFW A; 
#chains in the Genus database with same CATH topology
 1O3S A;  1R6R A;  2P6S A;  3VSK A;  3L09 A;  1H88 C;  1TNS A;  2L9V A;  3OIQ A;  4PSX A;  3I4M J;  1T2K A;  1ENH A;  2OA4 A;  3DBR B;  3BJA A;  1ETK A;  1ZK8 A;  4NQW B;  2W82 A;  3ISP A;  1FLI A;  1VF9 A;  3WGI A;  2CQK A;  4B1R A;  3PSF A;  2IAI A;  3QYF A;  3W6K B;  4RAZ A;  3IL2 A;  3OYG A;  5FO5 A;  3QQA A;  1ON2 A;  2WAQ N;  3K0L A;  2R7W A;  3FIS A;  4ZYE A;  1LEA A;  1FT9 A;  4HZF A;  3DCF A;  2RQQ A;  2ECC A;  4M3B A;  5FRO A;  1XGO A;  2HYJ A;  3DU5 A;  2HEO A;  3BR3 A;  3W6V A;  2VBW A;  1R49 A;  2R7D A;  2IA2 A;  2ZB9 A;  4KN7 X;  3MZH A;  1DDN A;  1YOV B;  2HTJ A;  2HKO A;  3F23 A;  2L9R A;  2L01 A;  5TIS C;  5AIP A;  4IOC F;  1WJ5 A;  3SFI A;  5J1Y A;  1MBJ A;  3OS0 A;  1G3Y A;  5E3M A;  3REO A;  2OZU A;  3GLX A;  4GCV A;  5B1B H;  2VC1 A;  2W84 A;  2XGE A;  2QEN A;  3FBN B;  4EJO A;  1K78 B;  2E2J J;  3MKZ A;  2WV0 A;  2V6E A;  2Q2E A;  1NG6 A;  1FIP A;  3ZQQ A;  4W1U A;  2R3S A;  3LSR A;  5HS8 A;  2F4I A;  1P4X A;  2H94 A;  4KN4 X;  2K40 A;  4CYC A;  2K9Q A;  2PMZ N;  3A01 A;  4JK1 X;  4LMY A;  1LJ9 A;  3V7S A;  2FQ3 A;  1OYI A;  4MO7 A;  3CMA I;  2ZJP F;  2XF6 A;  2LRD A;  1MD0 A;  4XQF A;  2LY2 A;  3IH2 A;  2GM4 A;  1T98 A;  1AA7 A;  3NAR A;  3KP4 A;  2GLO A;  3BZ6 A;  2FBK A;  2WAD A;  1GHC A;  2Y48 A;  3HSR A;  3CDL A;  1FJL A;  4Q4Z F;  1R4N B;  4LJZ F;  1IJW C;  2HYG D;  2VBX A;  2E34 A;  2W4S A;  2V9P A;  1GVD A;  2F4M B;  3VOD A;  2LD5 A;  4BL0 B;  2RN7 A;  3QAH A;  3R0J A;  3C3W A;  3HOX J;  1JKR C;  1JKQ C;  3MZY A;  2KZG A;  5FJ8 J;  1ODD A;  3GX4 X;  5KK1 A;  2XAS A;  2O8K A;  2EIL H;  2Q2E B;  3LST A;  4L0Z B;  5E1X A;  2RNJ A;  2KQR A;  3TKY A;  3P5J A;  1X2N A;  3JAM K;  3S17 J;  1JI8 A;  2DYR H;  5TGT A;  3DU6 A;  1RR8 C;  3HRU A;  5ICG A;  3G3Z A;  2QYO A;  3A01 B;  2GXB A;  3EUK L;  3GBG A;  2MD0 A;  4XLE A;  4U0Y A;  2HOE A;  1DP7 P;  1VI0 A;  3HUG A;  2VXD A;  3CQZ J;  2ZJR F;  1XCB A;  3CME I;  4E7H A;  4ASN A;  1FPQ A;  4XLN F;  1QRY A;  5HDG A;  3JRA A;  3GTP J;  2GOM A;  4G94 A;  5LBQ A;  1N78 A;  4DYQ A;  5LLQ A;  3HTS B;  2P0W A;  4RBO A;  1S72 I;  1U5T A;  2XAQ A;  4FE7 A;  1XSD A;  2KIF A;  4ITV A;  4ENJ A;  2F5C A;  2DFF A;  1W7P B;  2QWW A;  5F0H A;  2R7U A;  2ZC2 A;  3SXY A;  4LIV A;  1MW7 A;  1EKE A;  4KDP A;  1Y1W J;  4A3J J;  4HRI A;  2EA2 A;  5FFZ A;  1J09 A;  3L00 A;  3H36 A;  4OIN F;  1KZH A;  1S5L C;  5D5V B;  1K6Y A;  2VKH A;  3RKW A;  2K3P A;  4B3X A;  3J80 K;  3V42 A;  3VYS B;  4IHT A;  1X1C A;  5JFR A;  2HKX A;  1JHH A;  1B6A A;  1S7A A;  4F93 B;  5CLS A;  2DFI A;  4RB0 A;  2P81 A;  3KLO A;  2LF7 A;  3D0S A;  2O61 A;  4A3C J;  5F1J A;  3CCV I;  1MMG A;  4ESF A;  2AHQ A;  4FX4 A;  4QTR A;  3UKG A;  4DGW B;  1I6X A;  1SFO J;  4G7O F;  3BR5 A;  2A05 A;  4I0B A;  3S8P A;  4BYY A;  1MJB A;  4HX8 A;  2E7W A;  2H6B A;  2QQA A;  2F5F A;  4XLP F;  2J5O A;  2EIN H;  2OJE D;  1UB9 A;  3K4J A;  4RGU A;  2QVO A;  5C4J J;  3WU2 C;  4IXA A;  1A6I A;  3GF2 A;  4HOB A;  2VUM J;  2M8G X;  4IRG A;  3WE2 A;  3ZOB A;  1AU7 A;  2M2E A;  5FLX K;  4PJ0 C;  1ZGW A;  1X3Z B;  5EGO B;  3BLY A;  5GAD J;  4R8H A;  5L3E A;  4G7H F;  5KHD A;  1N75 A;  2EJR A;  2M7B A;  3M1E A;  1KQ8 A;  4JQF A;  3LAJ A;  2OQG A;  2EFN A;  1JTY A;  1HW1 A;  4NDL A;  1UCR A;  2VL8 A;  2L7M P;  2O6G E;  4KNY A;  1ZAO A;  1DU6 A;  2XRN A;  3BZC A;  2PN6 A;  2AQE A;  1FOY A;  2BBY A;  4DIQ A;  5HDN A;  4HF0 A;  3B6C A;  2DK8 A;  3OL4 A;  4NC8 A;  4E7I A;  3TDU C;  3FXU A;  5IYD J;  4HV6 A;  2NNN A;  1TWC J;  3S3O A;  1DPR A;  5C44 J;  2DW4 A;  1WCM J;  2GWR A;  1KU9 A;  1BR1 A;  1OFC X;  1UG0 A;  1IUY A;  2R7O A;  2JK3 A;  3HIF A;  1S9H A;  1H0M A;  1F5T A;  5IT9 Z;  2HVS A;  2IPQ X;  1X4P A;  4BQN A;  4L5I A;  2CRG A;  2DK5 A;  4M9Z A;  2KRF A;  2EQR A;  2BW3 A;  2QKL B;  4RGS A;  4RB2 C;  1YFH A;  5HLI A;  4A2U A;  4LOC A;  2LKS A;  3GXO A;  1Z6R A;  4GRI A;  3ZN0 A;  1F43 A;  2OAZ A;  3A4C A;  2GIV A;  4ZYA A;  2JVG A;  4QPQ A;  4RGX A;  2XC7 A;  1Q1H A;  3K2A A;  4NHJ A;  1T0F C;  4RLF A;  1IF1 A;  1XN7 A;  1HF0 A;  1JTX A;  4FTH A;  2E1O A;  5LD2 C;  1JUM A;  2DAO A;  2M9H A;  3VSL A;  2OCC H;  3QP6 A;  3I59 A;  5AON A;  3VPR A;  1Z77 A;  3LSP A;  2DA1 A;  2VAS A;  3NAU A;  3TW6 A;  2HOT A;  4CSW A;  4Y3O A;  1K61 A;  2ELJ A;  4HLY A;  4BXX J;  1TWH J;  2NOJ B;  5D5X B;  2LDU A;  1R5H A;  2FF4 A;  1RRJ A;  2FBH A;  2E60 A;  5D8K B;  3A0B C;  3HEF A;  5M5Y J;  1GDT A;  3RQI A;  1JUP A;  5J1R A;  3RZO J;  3JCU C;  5E3O A;  3TP0 A;  4I09 A;  2ZSH B;  2A6H F;  2DFE A;  5D5W B;  3CCY A;  2BW3 B;  1TW2 A;  4L18 B;  3DBH B;  3W3C A;  3OYC A;  3CTA A;  3FHZ A;  3WE3 A;  1TBX A;  2F5E A;  3RJP A;  1JKO C;  2FD5 A;  4E70 A;  4BJ6 C;  1K7A A;  3ZMZ A;  2PEX A;  4BAC A;  1RI7 A;  1POG A;  5KCM A;  3IRQ A;  4IOA F;  2XRL A;  3MWM A;  2XB0 X;  4RM2 A;  4E7Z A;  3ZP5 A;  1ZYR F;  4GO1 A;  4CIC A;  1ZHF A;  2G0E A;  2Y75 A;  5C3E J;  4PDK A;  2UXX A;  2E1M C;  2LRE A;  3VOE A;  3CUO A;  5EJC A;  3KPH A;  4XRS A;  3WU1 B;  1LE8 A;  3QPS A;  3I59 B;  3H5R A;  1FOX A;  4HEA 2;  3V8K A;  5F6F A;  4JX6 A;  2HZT A;  5K7F A;  4HQE A;  2DLL A;  2E2H J;  3KP6 A;  1B72 A;  3P9C A;  3R6S A;  1Z9C A;  4R79 A;  1J75 A;  4DW6 A;  1TW3 A;  5K5R A;  2FUG 2;  5J40 A;  4C2M J;  3IV5 A;  2VT3 A;  2BVL A;  3ZQC A;  3LOC A;  1T0F A;  1D8K A;  1R58 A;  1RKT A;  3H9J A;  4R1H A;  1XDS A;  3NQO A;  1ERD A;  2QCO A;  3IHU A;  2HU9 A;  2GAU A;  3BG9 A;  3C2H A;  3HZJ A;  3FXQ A;  5KAF C;  2MYS A;  2LVS A;  1OCC H;  3K70 C;  2CFO A;  2DYS H;  4I98 B;  4B43 A;  3FKI J;  2VE9 A;  3KP7 A;  3F21 A;  5D8L B;  2MC3 A;  1BI2 A;  3OIO A;  1XGS A;  5BQT A;  1SC7 A;  1FMV A;  4MQ9 F;  2LR8 A;  5LGU A;  1Z7L A;  5DM6 F;  2K4J A;  3MVP A;  4XLA A;  3VWB A;  3HOY J;  4GDF A;  2E1C A;  2V1N A;  3H0G J;  1VQ5 I;  2MFZ A;  1G3W A;  3IH3 A;  3K7A J;  3J81 K;  1ZG3 A;  4ESB A;  5DEQ A;  3LNQ A;  1ETQ A;  1TL8 A;  2Q1Z B;  1B72 B;  4CZZ A;  2RGV A;  4XKC A;  3X2Q H;  1RUN A;  2XSD C;  4A6D A;  1U9N A;  3U9G A;  1L0O C;  4KIF A;  1G6N A;  1Z6T A;  4LD5 A;  2R5Z A;  1B8I B;  1FIA A;  1SMY F;  2BHY A;  4D7N A;  2E7X A;  3SJM A;  4FET A;  3DKX A;  5J6X A;  4ESJ A;  3M3Y J;  1OJL A;  1R71 A;  3BPX A;  2WY8 Q;  2QUF A;  4XID A;  2R0Q C;  1T38 A;  1IN4 A;  1EJ9 A;  4HX4 A;  1P92 A;  2DA7 A;  2IS2 A;  1XGN A;  2Z3Y A;  5IYB J;  3CCE I;  3C18 A;  2M45 A;  2X85 A;  3RKX A;  3HPH A;  3P9K A;  3WTZ A;  4M3E A;  1XTA A;  3QRF F;  3ZGK A;  1BC7 C;  2OC6 A;  4OAY A;  2KDZ A;  1V5G A;  3BCB A;  3ZR8 X;  2IGN A;  1MKM A;  3O3K A;  3I53 A;  1UHW A;  1O3Q A;  1X19 A;  2ZME A;  3S2H J;  1WSU A;  5BPD A;  2CJJ A;  4KIB A;  1RET A;  1VFC A;  2DJI A;  1Q1V A;  5EDN A;  4IHV A;  1BIB A;  1S7E A;  4XK4 A;  1Z21 A;  4CHU A;  4H4K C;  1ITY A;  1HA8 A;  1V5E A;  1ZGJ A;  2H1L A;  3S93 A;  2DXI A;  3AG3 H;  1KU3 A;  3Q9S A;  5E8I A;  2LY1 A;  2R5Z B;  4AVP A;  1R5G A;  2NVQ J;  3W2A A;  1TT5 B;  3HRT A;  3IKT A;  2IGO A;  3O2P E;  2QGU A;  2E1M B;  4ENN A;  4EMS A;  1S7O A;  3HOZ J;  4Y7N J;  2YPR A;  4AC0 A;  3V7C A;  2Q0O A;  4M9X A;  1U9O A;  4LB6 B;  3Q5F A;  1TWA J;  3Q3S A;  3EET A;  5HS9 A;  1UG2 A;  1SMT A;  3LQQ A;  2VOO A;  4JX4 A;  3RYP A;  2OU2 A;  3F72 A;  4IQ4 A;  4YFK F;  2FRH A;  5IOY A;  4MTE A;  4ZYH A;  3KFW X;  3J80 Z;  1FP1 D;  1ZRD A;  4IHX A;  2OCE A;  4D5F A;  3S2D J;  1ZLK A;  1IUF A;  5DS9 A;  1TWG J;  2OPT A;  4BNC A;  2EV0 A;  2L9N A;  3FBI B;  2ZME B;  2B9S A;  2K86 A;  3T5X A;  4IKF A;  5CKT A;  1A5J A;  1MH4 A;  4IRH A;  4B48 A;  1D5V A;  3U21 A;  4IEJ A;  3OYN A;  3MQ0 A;  2Z1D A;  2RC4 A;  3EPZ A;  5D6F A;  5D6E A;  3TBI A;  4J01 A;  1D5Y A;  1IRG A;  3F8F A;  1BW6 A;  1HW5 A;  3S32 A;  2OD5 A;  3U1D A;  2DTZ A;  4A5N A;  1IRX A;  2CMP A;  2PJR A;  2PMZ A;  4G6T B;  1O3R A;  3E5U A;  4PFO A;  4OU0 A;  5CVU A;  2R7X A;  2PI0 A;  4HA8 A;  1HKT A;  3KYD B;  3OL3 A;  2YX7 A;  4FT8 A;  1RKW A;  3BG7 A;  4BY7 J;  2HTS A;  2O5R A;  4WCG A;  2ICW G;  3OR1 C;  3H3U A;  2XKP A;  1VQ8 I;  2K9S A;  4XKB A;  2A68 F;  5FLX Z;  4J00 A;  1T56 A;  3IRR A;  2CUJ A;  3HOV J;  3E6D A;  2L7K A;  3JW4 A;  3F8M A;  2GQQ A;  4ZDL A;  3GTM J;  3BTC A;  2I5U A;  3LSI A;  1KON A;  4F52 A;  2CS3 A;  3H5N A;  1ZG5 A;  1GUU A;  1ZN2 A;  4BDY A;  2HQA A;  2F48 A;  3CLQ A;  2YUS A;  4A3I J;  3WTW C;  4E7L A;  1QHG A;  1Z91 A;  5E18 F;  2CUE A;  1J9I A;  3ZN1 A;  3CCJ I;  2X4H A;  3CCS I;  2PJR B;  2ADU A;  3E6C C;  2VQL A;  4LB5 A;  3UNG C;  5FLV A;  1MNE A;  2PX9 A;  4KUM A;  4XOP A;  1FMW A;  3OYJ A;  1GXP A;  2DJN A;  4PUS A;  2VLA A;  1LPQ A;  1X1D A;  5JR3 A;  5HLH A;  1WH5 A;  4ZZD A;  2CFX A;  5HVQ C;  2UXN A;  4OIQ F;  4QLC U;  1D1B A;  1YX5 A;  1U6G A;  3VYT B;  1IN7 A;  1REP C;  2P5L C;  1D3Y A;  2MBF A;  3LSG A;  1F36 A;  3I3L A;  4AD9 A;  3QPL A;  3S16 J;  3LA7 A;  2JPC A;  2XGC A;  2EZL A;  4DBR A;  3GO5 A;  4C3H J;  4BH9 A;  2VB6 A;  1MBE A;  1Y0U A;  2DDA A;  2X1C A;  4FX0 A;  1G3T A;  3QYE A;  3PQK A;  2R7F A;  3FXM A;  1VTN C;  1BN5 A;  4B4C A;  3BG5 A;  5CJ9 A;  1WKM A;  2V1U A;  4CCM A;  3RYR A;  1LNW A;  1RUO A;  2E71 A;  3QP5 A;  1Y0N A;  2ZXJ A;  1BM9 A;  3FM3 A;  2N8G A;  2XUB A;  1MIJ A;  3NWS A;  3TOB A;  4UV8 A;  2HR3 A;  5M5X J;  1JXS A;  2L02 A;  1QZE A;  5DD4 A;  2V9K A;  1DQU A;  1X3U A;  2LTP A;  1FTZ A;  3DXJ F;  1FYL A;  2XB5 A;  1MBG A;  1QNT A;  4A5M A;  2FNP A;  2LY9 A;  2XHK A;  1VQO I;  3BQZ A;  3RDI A;  2AO9 A;  3FKJ A;  1F9N A;  3RPU D;  2V6C A;  1F4K A;  1KA8 A;  2DA6 A;  4LG0 A;  4KT5 C;  4B3A A;  5LGT A;  1I50 J;  4WXD A;  2HFH A;  1SD5 A;  1XSV A;  2WAE A;  1I39 A;  4DQ2 A;  4EM1 A;  4PFP A;  4GYG A;  3I55 I;  2X6Y A;  2JA8 J;  3KYL A;  2DBB A;  5EF6 A;  4Y17 A;  4E7S A;  1SVO A;  4XLH A;  2A07 F;  5LRR A;  4A3D J;  1QZZ A;  2H8W A;  2F5V A;  2VKV A;  4UB6 C;  4S05 A;  4LFU A;  2OV7 A;  2HNH A;  3LSM A;  3O8H A;  2E35 A;  2KPM A;  4YFX F;  2F5D A;  2X6W A;  3IKV A;  2MLK A;  2VJ5 A;  1SD7 A;  3PUB A;  3I56 I;  3KYC B;  1MNM C;  4NC6 A;  2IP2 A;  3F9K A;  4EV0 A;  1YI2 I;  4KA4 A;  3K1M A;  1E17 A;  2I10 A;  4RB1 A;  1BOA A;  2X48 A;  4AYB A;  5DDG A;  1TC3 C;  1ZRC A;  1LDD A;  1OCP A;  1U5T C;  1VQ7 I;  1R4M B;  2ELK A;  1ULY A;  2QLZ A;  4CDG A;  3QOP A;  2IA0 A;  4ON0 A;  1TQM A;  5L3B A;  1JJ6 C;  4LG0 B;  4ENK A;  3CO6 C;  4BBR J;  1B9M A;  2A61 A;  2LOO A;  2CW0 F;  4A3B J;  1WHU A;  1EH6 A;  2WV1 A;  2KJB A;  3GWZ A;  2D5V A;  3K6G A;  1O7F A;  3DTE A;  1EA3 A;  1W0T A;  4G7Z F;  1KGS A;  2DA5 A;  3AFH A;  2B63 J;  2JA2 A;  2NXN B;  2DQL A;  2HZD A;  3HM5 A;  3U2R A;  4F3Q A;  3LSJ A;  4A3M J;  1BOB A;  3K1N A;  4Y4R A;  3HSF A;  5FGM A;  3KEY A;  4BQQ A;  3ABU A;  1JT0 A;  2VKD A;  1R5I D;  3GME A;  3HOW J;  5CVI A;  1NG7 A;  2WA0 A;  2ZJQ F;  2KZV A;  1UEL B;  3J81 Z;  3PIP F;  4DBQ A;  1WGX A;  2FXA A;  3V4G A;  4GXO A;  3TDZ C;  1L3L A;  2CQQ A;  4I76 A;  4MEY F;  1HDP A;  4UVA A;  2VT2 A;  1U8R A;  2HVR A;  2VI6 A;  1HXD A;  3G2B A;  2L54 A;  5BS6 A;  2WTE A;  3PO3 J;  4LIT A;  4TV7 A;  1E3H A;  4UVB A;  4CYC B;  1VQM I;  1BI0 A;  3MKL A;  3G6E I;  2HGC A;  4JYK A;  1E2X A;  2H27 A;  1R1T A;  1P4A A;  1FYK A;  3OYF A;  1E3P A;  3ASN H;  1MBK A;  1BI1 A;  2NS8 A;  4D9J A;  2Y9Y A;  5B5E C;  1KYZ A;  3I5U A;  2J5P A;  2JTV A;  4IF4 A;  4EVI A;  4XOT A;  3SZP A;  4ZYD A;  2NAZ A;  1G2H A;  4F55 A;  4YIR X;  1X1P A;  2O0Y A;  1KU7 A;  4MQV A;  2L7F P;  1O3T A;  3PFY A;  3VFZ A;  3OYK A;  1P7J A;  2Y9Z A;  3OYE A;  3OYB A;  4XSZ F;  1J5Y A;  3V8L A;  1FTT A;  2CSO A;  1T95 A;  1DUX C;  1B1B A;  4D0P A;  2BY0 A;  3CCU I;  5L3G A;  4IRI A;  2JN6 A;  1FYM A;  3PFI A;  1K4S A;  4H0E A;  5E1Z B;  1OYY A;  2ECB A;  3IUO A;  5DTD A;  2HXI A;  3DEU A;  2QZ8 A;  4M72 A;  2L5Q A;  5JHF A;  4BKX A;  4N4O B;  2CH0 A;  5HOO A;  2RRE A;  1TQI A;  2EV6 A;  5B66 C;  2HDD A;  4GGG A;  2Y30 A;  1WJD A;  4MHG A;  3BY6 A;  2K4B A;  1MSF C;  1BR4 A;  4Q5S F;  3A2K A;  1KYW A;  1ETV A;  2MH9 A;  4UB8 C;  3GEZ A;  2CGP A;  3LWF A;  5ED4 A;  4M3G A;  3HUG B;  2GA2 A;  2JUC A;  4JOM A;  3WHB A;  1UFM A;  1YE9 A;  2CO5 A;  4L5J A;  2P5K A;  5CVJ A;  3I71 A;  3B73 A;  2DOE A;  5ICC A;  3KET A;  3GCM A;  5DCF A;  1U5T B;  1VQL I;  3JRE A;  1SFK A;  2IRF G;  4BQO A;  2DA3 A;  3DTK A;  3TMO A;  4BE2 A;  3M7G A;  3JRC A;  1WFX A;  4RGR A;  4HLX A;  3CCM I;  5B1A H;  1SAU A;  2P7V B;  3ZQF A;  2AXL A;  3QU6 A;  4MTD A;  1V55 H;  4MFD A;  2NRA C;  3ZMD A;  5J1U A;  2XAF A;  3V7R A;  2XF5 A;  4D1Q A;  3I0T A;  3ZMV A;  1AHD P;  1X58 A;  2ZFW A;  2X9D A;  2HOS A;  2XPV A;  2HQN A;  4C2U A;  2R93 J;  1HOM A;  4ZZL A;  2KJC A;  3HKZ N;  3DEE A;  2MGQ A;  3CC7 I;  3RPQ A;  3QWL A;  5DM7 F;  3OYD A;  1OCO H;  2HDC A;  2DOF A;  2EIJ H;  5ILV A;  3I64 A;  4JX5 A;  2YU3 A;  4HF2 A;  3SZG A;  2A3S A;  1P7I A;  1QPM A;  2CYY A;  3ZQH A;  2DPD A;  3BR2 A;  3ZMS A;  4GFB A;  2IBD A;  3DPU A;  1HLV A;  2FE3 A;  3NWT A;  4AYB N;  4O3M A;  1GV2 A;  3I54 A;  5K1Y A;  3CCQ I;  3RTR A;  4OOI A;  2JPB A;  2IGK A;  5E3L A;  4Y52 J;  3E5Q A;  2TCT A;  5F08 A;  2A69 F;  4L9T A;  4BE1 A;  1NHA A;  3H9Q A;  1FZP B;  5KNL A;  4ENM A;  2TRT A;  4HNU A;  4LLG F;  4NUB A;  1SFE A;  4E7J A;  4XOR A;  5M5W J;  4WK8 F;  3WTS C;  3DKY A;  1ZQ3 P;  2EBI A;  3OMY A;  3VYR B;  3E5X A;  2VJ4 A;  3OOU A;  2PJP A;  2RQP A;  4XRF A;  1MMA A;  4YG2 F;  2A6E F;  1XSX A;  3BQY A;  3HOS A;  2E5Z A;  2VOP A;  5HNF A;  1MMD A;  3BR0 A;  1W5S A;  3M9A A;  5IY5 H;  3D1N I;  1IG7 A;  5GTH C;  2KMU A;  2VN2 A;  4PJM A;  5KAI C;  3HC7 A;  2JSP A;  3MKY B;  2CW8 A;  1ZGA A;  3G1M A;  4Y13 A;  1LVA A;  1IO2 A;  3EYI A;  3BC8 A;  3TP3 A;  1U8B A;  2QA4 I;  3CCL I;  2HXO A;  2K5C A;  1K6O A;  4EEF G;  4LIU A;  2LF8 A;  1WJE A;  3BTJ A;  1I6H J;  5A2Q K;  2KIM A;  2Z5U A;  2D1H A;  3S2W A;  2QKM B;  3MMY B;  2ZJ2 A;  3L9F A;  2CV0 A;  3CC4 I;  3IAS 2;  4I6Z A;  1IN8 A;  3F8N A;  1YS7 A;  2FQ4 A;  1IN5 A;  4CXF A;  4EGZ A;  2VJI A;  4BAY A;  5E17 F;  3KLN A;  4G9Y A;  2XF7 A;  3SEZ A;  2XAG A;  3H0D A;  1YS6 A;  1SAN A;  4Z6Y A;  1W7P D;  2LKP A;  4HG2 A;  3LFU A;  4MLO A;  2A5Y B;  2GXG A;  2MAB A;  1LFP A;  2EPF A;  2PMU A;  4A3F J;  1IXR C;  3FXL A;  5ILU A;  2Z33 A;  2D2W A;  5IP6 A;  1X4O A;  3JTG A;  2OF7 A;  3JSO A;  3R4K A;  1O4X A;  3BT9 A;  3HHG A;  2KL4 A;  3DF8 A;  1XX5 A;  3GFI A;  3GVA A;  5JVT A;  4G12 A;  3AG4 H;  3E97 A;  1SD4 A;  3JRH A;  3SQN A;  1FOK A;  1BJA A;  1GXQ A;  4I2O A;  4ZDP A;  4CCK A;  5DV5 A;  3ML6 A;  2Z9O A;  1H8A C;  3GTO J;  3HL2 A;  4Y33 A;  1WJC A;  2M30 A;  2VON A;  3GFJ A;  4YEL A;  3EUH A;  5F0C A;  4ABZ A;  4A0Y A;  5H20 A;  2HQ5 A;  1HCR A;  1STZ A;  2ZME C;  2ME0 A;  5HLG A;  4FE4 A;  3ASO H;  2R5Y A;  3BRO A;  3GTQ J;  1OCR H;  3CJN A;  2EIK H;  3K9T A;  4BUP A;  3S15 J;  3QPT A;  1APL C;  1TWF J;  3E1S A;  1MJ9 A;  3CO7 C;  3DQV C;  3K4L A;  3N4M A;  3OY9 A;  1PYV A;  4EJW A;  3HOT A;  1HDD C;  4HV5 A;  3DPL C;  1IV8 A;  4CH7 A;  2QBY A;  4BY1 J;  2KDO A;  4WWC A;  1D1C A;  3E0J B;  2ID3 A;  3VYU B;  5IOZ A;  2ESN A;  3CP8 A;  3ONQ A;  4U87 A;  1LE8 B;  1G3S A;  5FFX A;  4CZC A;  3ZQI A;  5EG0 A;  2DTR A;  3PUF A;  1HW2 A;  1OYW A;  1MJA A;  4HX7 A;  1W5T A;  2K85 A;  2WC2 A;  2JA6 J;  4ZTF A;  2BEO A;  3WGH A;  3M07 A;  4XRM A;  2E5N A;  2WBM A;  3ZQ7 A;  3B6A A;  4QWQ A;  3ROU A;  4IPA A;  3CDI A;  1DU0 A;  2L9S A;  2P6T A;  2E2I J;  3CF5 F;  2FEZ A;  2Y69 H;  3TW7 A;  2JA7 J;  1JJ8 C;  2XPW A;  1CF7 A;  1NK3 P;  4L9V A;  3MKW B;  2W85 A;  3ULQ B;  2R5Y B;  4KMU X;  3T8T A;  5FRM A;  2Y0S N;  5FKK A;  2M5W A;  1PP8 F;  5FKM A;  3CES A;  3RPU A;  2KHM A;  4XLC A;  3Q9V A;  3BG3 A;  3WG9 A;  1XD7 A;  4D7M A;  5B3S H;  4AIK A;  6PAX A;  3S3N A;  4E4H A;  4AUX A;  2DT7 B;  4KIS A;  1HKQ A;  2RVC A;  2E19 A;  3RCO A;  5IPA A;  3JAM Z;  4NBQ A;  3KZI C;  3GYH X;  1EH8 A;  2YX4 A;  2H8R A;  3FDY A;  5EG0 B;  2ESH A;  5JHU A;  3GTL J;  3FXR A;  4BHC A;  1CQT A;  4KYW A;  3D5L A;  1E3O C;  3HG9 A;  2K9N A;  2COM A;  4EJT A;  1FP2 A;  1OCZ H;  4IVN A;  3GLL A;  3HRS A;  4F7Z A;  2Z2S B;  2RAE A;  2LLK A;  1DGW Y;  2KRH A;  5E20 A;  2LMD A;  2ZFU A;  4A6E A;  2D1V A;  2GIZ A;  5DCM A;  1MBH A;  3F3X A;  2RNG A;  4P96 A;  4UNO A;  1CF7 B;  2NS7 A;  1O7L A;  3HBL A;  3OIP A;  3WU0 A;  1MH3 A;  1WPK A;  2EFO A;  4BXF A;  3I9V 2;  2FML A;  1KQ0 A;  3M1C A;  5AIQ A;  5ICF A;  2X6O A;  4N9I A;  4EAT A;  3BR6 A;  4F91 B;  1QVU A;  2EZK A;  4PGH A;  1B9N A;  1BIA A;  3H1C A;  5CPR B;  1LUJ B;  4HST A;  1Y56 A;  1I1G A;  2BV6 A;  3JRI A;  3K4M A;  2K9M A;  4HNT A;  2XPU A;  4CO8 A;  3FX3 A;  5EZG A;  4XSX F;  3J7Y J;  1ZEL A;  1X1B A;  3W2W A;  5J8F A;  1YQA A;  3ABL H;  1QGP A;  1RC9 A;  4FAS D;  2QSH X;  3ZQL A;  3E7L A;  4D5C A;  1ACI A;  2W57 A;  4CCN A;  2ZCW A;  3MZ8 A;  4RA2 A;  3DBL B;  4O5V A;  3CD6 I;  5FLM J;  2DOD A;  4EJV A;  4MIM A;  3TO9 A;  5DCM B;  2HDW A;  3A0H C;  2VQC A;  2EWN A;  1PJR A;  2B0L A;  1N77 A;  2KP6 A;  2LSO A;  5K7Z A;  5LGN A;  5DUI A;  1XC5 A;  4HW0 A;  1NTC A;  1TP4 A;  3G4S I;  5BPI A;  5LEJ A;  1Y8R B;  3OYM A;  4GYI A;  1U3E M;  1C0W A;  3N97 A;  3PNT A;  2DMN A;  1Z1D A;  4CYD A;  2V1D A;  5LHG A;  2IS4 A;  2X0L A;  2XKO A;  3H92 A;  3R61 A;  5M3M J;  5FKN A;  4I02 A;  1NH3 A;  1IDZ A;  1FC3 A;  4U0W A;  4AVZ A;  1T8I A;  2CUF A;  1H9G A;  4EM0 B;  3C2B A;  2ZNY A;  1YJN I;  1RIO H;  2ZSI B;  1A04 A;  1XG1 A;  2BZT A;  2CUZ A;  1UHM A;  3GUD A;  1G59 A;  3M4O J;  4AIJ A;  1WRJ A;  3WTY C;  2XIG A;  3LSH A;  3FWE A;  1R22 A;  3G73 A;  2KKO A;  1J0R A;  4KFC A;  1T08 B;  2W7N A;  3QOE A;  3GZ5 A;  2DT5 A;  2B7E A;  1FBQ A;  2DMU A;  1MBF A;  1XDU A;  4II2 A;  5IT9 K;  1I1S A;  2KRC A;  2L0K A;  3BJO A;  1OLT A;  3H5A A;  4MGR A;  2KIS A;  4UV9 A;  2LP0 A;  3PQJ A;  2JWT A;  1XMA A;  4A12 A;  2DU9 A;  2NVY J;  2NYX A;  2KIU A;  4Z2Y A;  4BJ5 C;  1X2M A;  2GOX B;  1Z0X A;  3WTU C;  3UR3 C;  4X0G A;  4ZJZ A;  2I8D A;  1AOY A;  3HTU A;  3A1Y A;  1XGM A;  1YLF A;  1I3Q J;  4OAZ A;  4G6Q A;  1R00 A;  5IYC J;  2K02 A;  4XBF A;  5ICE A;  1V4R A;  4A3E J;  5HOD A;  1DGR M;  3OYH A;  5GPC A;  4Q48 A;  1Y8Q B;  1G4D A;  1Z67 A;  3OYA A;  2ISZ A;  1BBY A;  2WY7 Q;  2IW5 A;  1Z05 A;  3BCA A;  1QA6 A;  4DNC A;  1VQ6 I;  3PM1 A;  1I3A A;  4A3L J;  4JP0 A;  3ESW B;  3GW2 A;  1USS A;  4YII A;  5F64 A;  2EK5 A;  4NQW A;  3LAP A;  1J7K A;  4RAF A;  2LNB A;  2WAF A;  1FBU A;  3ZRG A;  2Y31 A;  2QEX I;  3ABK H;  2AXT C;  5A2Q Z;  5DD8 A;  1YIT I;  5GP9 A;  2LKX A;  2W00 A;  2HQR A;  1HKS A;  2ISY A;  1FNN A;  2K3F A;  3CMM A;  3HB9 A;  1K4T A;  4L0Y B;  3J7A O;  3WTX C;  2EFQ A;  4ZH4 F;  4M3F A;  2ACJ A;  5CQE A;  3IAM 2;  2AQF A;  2CWE A;  4I99 C;  1OCT C;  3IP4 B;  4B47 A;  2DMT A;  4C9Y A;  1ON1 A;  2M4K A;  3HOU J;  2IGM A;  2HI3 A;  1KU2 A;  3FMS A;  5JLW A;  4U7D A;  1XB4 A;  2LC2 A;  3K1P A;  2W48 A;  5J3L A;  2V26 A;  4RDU A;  9ANT A;  5HLT A;  1K78 A;  3OV8 A;  4WF2 A;  4CCO A;  4LK0 F;  3L1P A;  2NVT J;  2PG4 A;  3ZPL A;  3L2Q A;  4RAG A;  3HKZ A;  3JRB A;  3FZV A;  3EYY A;  4B09 A;  2EFP A;  4K2E A;  5K5O A;  2BVM A;  4IZZ A;  2GA1 A;  4HAM A;  3WG7 H;  3I4N J;  4XIC A;  5D4R A;  1QZY A;  5FRN A;  1AWC A;  5L3C A;  3CJR B;  2JA5 J;  3SFZ A;  4CGZ A;  2ZXI A;  4EJU A;  3KE2 A;  2ZNZ A;  3K70 D;  4DYR A;  1SFX A;  2MA3 A;  2P4W A;  3KZY A;  4AID A;  5E1W A;  3HYI A;  1Y6I A;  2WB1 A;  3ZXS A;  3CUQ A;  3CJQ B;  2D45 A;  2R4G A;  1T6S A;  1NK2 P;  1S29 A;  2CQ7 A;  2BHZ A;  4UUV A;  4ETS A;  3DFG A;  3Q0U A;  4Q47 A;  1V5F A;  4ZYG A;  2BE5 F;  4B8X A;  1W5C C;  4IX7 A;  3AL0 C;  3J7A Y;  4FHT A;  2C6Y A;  3TO6 A;  1RPW A;  3DLA A;  1QQI A;  1S6L A;  3W2V A;  1ZG1 A;  1M1E B;  1FEX A;  2R7T A;  5JVG F;  2F2E A;  2R7S A;  2LFB A;  4AIH A;  4DZP A;  2XGX A;  5K7H A;  3S3M A;  2R7R A;  5TRD A;  4UUS A;  1U2W A;  5FD5 A;  4A93 J;  1WWX A;  3JSP A;  2FMY A;  4OMZ A;  1YW8 A;  4P55 A;  3HGY A;  5FKL A;  3L2U A;  2NNY A;  1QHH D;  3F6O A;  3MD2 A;  4CCL A;  4A0Z A;  2XGD A;  3G1L A;  2IXS A;  2PMH A;  2IJL A;  3CUQ B;  3LL7 A;  1UST A;  1W7P A;  3COA C;  2IT0 A;  1LB2 A;  4XNF A;  4YIF A;  2JJ7 A;  4OIO F;  1XPX A;  3KP5 A;  1YJ9 I;  3JTH A;  4XN0 A;  3L2V A;  2BXZ A;  4QIW N;  1UMQ A;  1WJF A;  1A31 A;  2VQG A;  1FSE A;  2Y2Z A;  4RS8 A;  2LG4 A;  1P4W A;  2G9W A;  2L4M A;  1FWZ A;  1PVE A;  4Y15 A;  4BEH A;  3S14 J;  3RQ4 A;  4P9F A;  2CG4 A;  4XRS G;  3WOD F;  2V7F A;  1WH7 A;  4CA0 A;  4KIT B;  2EZH A;  3HPG A;  1W36 C;  1Y39 A;  4HF1 A;  2M4G A;  1GV5 A;  2BY2 A;  3PNV A;  2DT6 A;  1MZB A;  3VEP A;  3N05 A;  4ZDO A;  2YR2 A;  2YS9 A;  1F1Z A;  4KJZ A;  4UUS B;  2LK2 A;  3TQN A;  3I58 A;  1OQY A;  1J2X A;  3C1D A;  2OUM A;  3IH4 A;  4G6D A;  1YW7 A;  1ETY A;  2BY3 A;  2FOK A;  3P9I A;  4X6A J;  4C2T A;  5GAH J;  2VPL A;  2H09 A;  3ABT A;  4IHS A;  4C3I J;  2P7C B;  2X1D A;  1B59 A;  4IO9 F;  4MNU A;  5FB2 A;  4NB5 A;  1H89 C;  2IVM A;  3QPH A;  4WXH A;  1IAW A;  3Q0W A;  4WX9 A;  1WVR A;  4PJL A;  2CQN A;  4M6Y A;  5FD6 A;  2NVX J;  5CYV A;  4BEH B;  2VOD A;  1OPC A;  4M74 A;  1G8X A;  1WJB A;  2XVC A;  3BTI A;  1UJ8 A;  5EGO A;  1DPU A;  3OS2 A;  3MFK A;  1IV6 A;  2UZK A;  1BI3 A;  2KT0 A;  2MG4 A;  4BS9 A;  1V3F A;  1TNT A;  2R7Q A;  5JLX A;  4LGW A;  2FBI A;  4PCQ A;  3ZMT A;  5E3N A;  5BOX A;  1VQ9 I;  5EEG A;  1J59 A;  1WI9 A;  1ZLJ A;  1JHF A;  2COB A;  3T8R A;  3TED A;  1U78 A;  5GTI C;  3O8G A;  4N0B A;  3MN2 A;  1Y1V J;  2VBZ A;  4RAY A;  3S1R J;  1ZKG A;  1LQ1 A;  1MSE C;  1R36 A;  1FY7 A;  4O6J A;  3OR2 C;  1W4M A;  3CCR I;  5J8C A;  3AL0 B;  1S8N A;  3C2G A;  2RV8 A;  2EV5 A;  1E0E A;  3RZD J;  1YO5 C;  4UHT A;  4YEJ A;  2QSG X;  3GZN B;  4IHY A;  4PK4 A;  4XKW A;  2YU9 J;  1BR2 A;  1RES A;  3AAF A;  2M0M A;  1OIS A;  2BOL A;  3FXJ A;  1JUS A;  3HRM A;  4XN3 A;  1A36 A;  1R1U A;  4HBL A;  1R7J A;  3FM5 A;  2BGC A;  1Z7U A;  4DJA A;  2CV2 A;  5BMZ A;  5EEA A;  2FNA A;  1PP7 U;  4AM3 A;  2VIX A;  4ZC3 A;  5M3F J;  4EQQ A;  2Y0S A;  2WB1 N;  2HOA A;  5D4S A;  1VQP I;  3AG1 H;  3L7W A;  3HSE A;  4A3K J;  2EZI A;  2FX0 A;  2QQB A;  4FIS A;  3IC7 A;  4P1W A;  3L2R A;  1P2F A;  1PUE E;  1D1A A;  4CCJ A;  4NC7 A;  3FK7 A;  3GTG J;  3GFM A;  4RM3 A;  1W0U A;  4I01 A;  4II3 A;  4RMN A;  4IQJ A;  3SHF A;  4AU7 A;  4M73 A;  4YFN F;  3OYL A;  5IP7 J;  4AWX B;  4KIG A;  3QOD A;  4OWR B;  4XL9 A;  3WGG A;  3FK6 A;  1LDK B;  3FHN A;  1JT6 A;  2Q8K A;  1ZTR A;  3EUH C;  3FXK A;  3A02 A;  4XON A;  1LVK A;  3RI4 A;  4V2F A;  3MEX A;  4C3J J;  1W1W E;  3CZ6 A;  4NNJ A;  3K4C A;  4V19 K;  2M7A A;  1BJZ A;  1X1A A;  3OS1 A;  4CUG A;  2P5V A;  3Q0V A;  2RDP A;  2MSY A;  3FMR A;  1YHQ I;  4XMY A;  1SD6 A;  5CVR A;  2KFD A;  3CLO A;  3K69 A;  4IHW A;  1WZ2 A;  1D0X A;  2K9L A;  5DUK A;  1UAA A;  4ZTJ A;  5LFA A;  4E7K A;  3VB2 A;  2DMP A;  5GPA A;  2XAH A;  4J19 A;  1OMI A;  1JGS A;  1EH7 A;  3ABM H;  1ETW A;  4BDZ A;  3PJR A;  3I4P A;  1MND A;  1QU3 A;  2DQR A;  1RZ4 A;  1IZ1 A;  2ID6 A;  1LFB A;  3DP7 A;  4G8X A;  5H6R A;  5K5Q A;  3RKY A;  3M8F A;  3E6B A;  4M3D A;  3IWZ A;  5J4V A;  2DI3 A;  4LK1 F;  3LSK A;  1YX3 A;  2QM3 A;  4BHB A;  1JGG A;  2O3F A;  3HGG A;  4XM3 A;  5LHI A;  2NVU B;  3KEO A;  2IS1 A;  2DN0 A;  2EA4 A;  1ETO A;  4M71 A;  1R23 A;  1WQ2 A;  4P5O A;  1UHS A;  2JUG A;  2W25 A;  1HQC A;  2GZW A;  1HST A;  1IN6 A;  2HYF A;  4E6K G;  2M0C A;  4XLF A;  3JRF A;  1PUF A;  5DYM A;  1VQK I;  3DV8 A;  4EM2 A;  1IGN A;  3BOQ A;  1S3J A;  2V1X A;  2L7Z A;  2NOG A;  1IRZ A;  1T39 A;  2O8X A;  2DMQ A;  1ONV A;  1V54 H;  5JI6 A;  3GZ6 A;  1FOW A;  3H3Z A;  3PSI A;  3OSF A;  3E3V A;  1CGP A;  1ORK A;  1YJW I;  4L9N A;  4HPQ A;  4BQA A;  5CQG A;  2Z16 A;  2KLO A;  2OBP A;  3D5S C;  3P7N A;  3R0A A;  2VKE A;  1LKX A;  4M6X A;  3CC2 I;  1XMX A;  3BPV A;  2HPI A;  2VQH A;  4QSH A;  1SFU A;  4OIP F;  1OKR A;  2O9L A;  2ZKZ A;  3WHC A;  3BZK A;  2IA1 A;  3QU3 A;  1X3W B;  3CJT B;  5ILS A;  2FOW A;  1B8I A;  4UVC A;  5EZH A;  1MGT A;  5F0F A;  3DKW A;  2BY1 A;  2ME6 A;  2DO7 A;  2L2O A;  4L9J A;  4A69 C;  3MAJ A;  3BG6 A;  2EIM H;  1QO0 D;  1IRF A;  4HDV A;  3S1N J;  4LG3 A;  2VXZ A;  2ZXW H;  3B02 A;  1R9T J;  2DA2 A;  1PUF B;  1D0Y A;  2V79 A;  2UWM A;  2FA5 A;  4I7H A;  4RLQ A;  4MFE A;  3O6B B;  3HJE A;  2X51 A;  1EV7 A;  2M87 A;  1SVL A;  4BJT A;  4BE0 A;  3BJ6 A;  2L4A A;  2MH2 A;  3KP2 A;  2F4O B;  2UUZ A;  1N25 A;  2ELH A;  3F6V A;  4PSW A;  1AKH A;  2FU4 A;  2O03 A;  5C4X J;  2CQX A;  1ZR2 A;  1BA5 A;  3F22 A;  2CW7 A;  2TDX A;  1A6Q A;  1OR7 C;  1ZAR A;  1I5Z A;  4S0H B;  3BP8 A;  4U7B A;  3L2W A;  3H3V K;  5LHH A;  2DFH A;  3TO7 A;  2QQ9 A;  1YRN A;  5L3D A;  1HBX G;  3JRD A;  2X6X A;  2JRT A;  3GTJ J;  2VBY A;  3ERM A;  5HS7 A;  2OZ6 A;  4S04 A;  1FSH A;  2BXY A;  2MD5 A;  2K27 A;  4QPO A;  3PIO F;  4W97 A;  2AS5 F;  2KIQ A;  2QBY B;  1B4A A;  3HXL A;  3TGN A;  2FSW A;  4IL6 C;  2JSC A;  1VQ4 I;  3VDX A;  2LBF A;  2DA4 A;  2UV1 A;  4HNV A;  3K10 A;  4PZJ A;  4HDU A;  3HDD A;  1P6R A;  3ECH A;  3SEQ A;  3G1O A;  3WTT C;  2OTL I;  1VZ0 A;  3KCC A;  5F27 A;  3OWT A;  3K4K A;  2XSJ C;  2PLY A;  3DLL F;  4XKV A;  5TJJ A;  1W36 D;  1IXC A;  2PQ8 A;  5H6Q A;  4LLN A;  2XAJ A;  1XCV A;  2M1B A;  2LH9 A;  4A0X A;  4BXU A;  2ZXH A;  4I0A A;  4HSR A;  3DPT A;  3A03 A;  1AKH B;  3BWG A;  3H9G A;  5L3F A;  2GXA A;  3AKZ A;  2DCE A;  3SZT A;  3OOP A;  4N4N B;  2STW A;  3PL8 A;  3FIW A;  2P8T A;  5LRS A;  2WWY A;  3PO2 J;  1BW5 A;  1D8J A;  3F0C A;  1YRN B;  1TTY A;  3ELK A;  4LLL A;  3GTK J;  1YIJ I;  3FMQ A;  3SYT A;  2DOA A;  1SVM A;  1YYV A;  3KX2 A;  2JVH A;  2K7L A;  2OQR A;  2W1O A;  2ZBK A;  1U0J A;  1HSJ A;  2XAU A;  5GAE J;  3EUA A;  2RKH A;  2LBF B;  4X1E A;  3ZCO A;  2R7V A;  3H35 A;  2A6T A;  3U1K A;  2IS6 A;  5H2F C;  1FBS A;  3D5R C;  3ZMU A;  4XR6 A;  2HPM A;  2JRM A;  1OR7 A;  2WAQ A;  3R60 A;  2A5W A;  2JZY A;  1IDY A;  1Z3Y A;  1QPI A;  1RR7 A;  3JRG A;  1IXS B;  1R1V A;  3BR1 A;  2R7Z J;  1I27 A;  2JMW A;  4KMF A;  1KQ9 A;  2E36 A;  2XRO A;  3PNY A;  2JQ7 A;  1P9Q C;  3OSG A;  3RIR A;  1MMN A;  3CDH A;  3WTV C;  5D5U B;  3ERE D;  4KT6 A;  1T33 A;  2L3D A;  3K4B A;  2QF7 A;  1TZL A;  4EGY A;  2PFB A;  2EH3 A;  2G7H A;  4OIR F;  2MC4 A;  2ETH A;  1Z3X A;  1SEU A;  3LFK A;  4L5E A;  1MDM A;  1GT0 C;  1WI3 A;  2E1N A;  2EB7 A;  5LEK A;  1JE8 A;  3C7J A;  2G7U A;  4YRV A;  1QBJ A;  4M9S A;  2Y0M A;  2M3A A;  4KIC A;  1K83 J;  1H9T A;  3DEW A;  1TT0 A;  3DWL E;  4V2G A;  3SDB A;  4BBS J;  4RB3 C;  3MCZ A;  3S1Q J;  5E8G A;  1JKP C;  2V9V A;  3FXO A;  4BU2 A;  3LA3 A;  2LYC A;  2FJ1 A;  1TLH B;  2GBY A;  2HVQ A;  2NS0 A;  2ZO4 A;  3G71 I;  2F6C A;  4WXC A;  3GFL A;  2VPR A;  2VC0 A;  4U88 A;  1VND A;  2M34 A;  5F1R A;  4M6V A;  1IC8 A;  4BHP A;  5J4Y A;  2XDV A;  3J7Z I;  1DP3 A;  2YSR A;  1ZH5 A;  2M8E A;  5ERI A;  1ZRE A;  2DDB A;  2R92 J;  3ZQG A;  2XV4 S;  5FKO A;  2X1E A;  3HHH A;  1GLN A;  2BYV E;  1WJA A;  3E6M A;  2QQ8 A;  1TQP A;  3LA2 A;  3LQR A;  3T1B A;  1MDM B;  2V4J C;  4UUT A;  3KZZ A;  4DZJ A;  2DPU A;  3IWF A;  1UZC A;  2O7O A;  3T0Y A;  2HWV A;  1EF4 A;  1LDJ A;  3FF5 A;  2PBI A;  2MLG A;  4UXN A;  4DYC A;  3BTL A;  1FX7 A;  3CF2 A;  3K4N A;  3DTI A;  3W6J B;  1BC8 C;  3LMM A;  4OMY A;  2Z99 A;  3OYI A;  4FCY A;  5KVR A;  5IP9 J;  2W24 A;  1IW7 F;  4C30 A;  1SAX A;  3NEU A;  3M8J A;  1GVJ A;  3KEQ A;  5GAG J;  1O57 A;  2VE8 A;  2CV1 A;  4BGD A;  3RKQ A;  4P9U A;  5EEH A;  4ANJ A;  5HDK A;  5E79 C;  1PDN C;  3JR9 A;  1HC8 A;  3KP3 A;  3AG2 H;  3NRV A;  2STT A;  5CVV A;  3SDG A;  4UY8 I;  1QVT A;  1ZR4 A;  4A3G J;  4MEX F;  3CMY A;  1YG2 A;  5BNG A;  1K79 A;  1ETX A;  3KIO A;  1LFU P;  3TL4 X;  4N9H A;  3CUQ C;  1XMK A;  4U0V A;  3F8B A;  4F92 B;  2QSF X;  2JT1 A;  1YTY A;  3TOA A;  1A35 A;  3V8J A;  5F04 A;  4PGG A;  5EYR A;  4DOZ A;  1D0Z A;  1ZRF A;  2H1K A;  4PJJ A;  2HS5 A;  1VQN I;  5J47 A;  3RSN A;  2VJJ A;  3CP2 A;  1MMS A;  1BL0 A;  1LEB A;  3EQL F;  3F8C A;  2IEK A;  1YW9 A;  4PJN A;  3ECO A;  4JBA A;  1RNL A;  4FQG A;  3M8E A;  2MW8 A;  2H6C A;  3K2Z A;  1XS9 A;  3S1M J;  2OTJ I;  4HQM A;  3EDP A;  4B44 A;  2CU7 A;  5IT3 A;  3QYB A;  4HYE A;  3L2C A;  1YIO A;  3BDD A;  4IJA A;  2EFW A;  5HNH A; 
#chains in the Genus database with same CATH homology
 1O3S A;  2P6S A;  3L09 A;  1TNS A;  1T2K A;  2OA4 A;  3BJA A;  3ISP A;  1FLI A;  3WGI A;  2CQK A;  3W6K B;  4RAZ A;  3IL2 A;  5FO5 A;  1ON2 A;  3K0L A;  4ZYE A;  1LEA A;  1FT9 A;  4HZF A;  1XGO A;  2HEO A;  2VBW A;  2R7D A;  2IA2 A;  4KN7 X;  3MZH A;  1DDN A;  2HTJ A;  2HKO A;  3F23 A;  2L01 A;  5AIP A;  1G3Y A;  3REO A;  2OZU A;  3GLX A;  4GCV A;  4EJO A;  2VC1 A;  2W84 A;  2QEN A;  1K78 B;  2WV0 A;  2Q2E A;  2R3S A;  5HS8 A;  1P4X A;  2H94 A;  4KN4 X;  4JK1 X;  4LMY A;  1LJ9 A;  3V7S A;  2FQ3 A;  1OYI A;  1MD0 A;  1T98 A;  3KP4 A;  3BZ6 A;  2FBK A;  1GHC A;  2Y48 A;  3HSR A;  4Q4Z F;  4LJZ F;  2HYG D;  2VBX A;  3VOD A;  2RN7 A;  3QAH A;  3R0J A;  3C3W A;  3MZY A;  1ODD A;  3GX4 X;  5KK1 A;  2XAS A;  3LST A;  4L0Z B;  5E1X A;  2RNJ A;  3TKY A;  3JAM K;  3HRU A;  5ICG A;  3G3Z A;  2QYO A;  2GXB A;  4U0Y A;  2HOE A;  1DP7 P;  3HUG A;  1XCB A;  4ASN A;  1FPQ A;  4XLN F;  5HDG A;  4G94 A;  5LBQ A;  5LLQ A;  3HTS B;  1U5T A;  2XAQ A;  1XSD A;  2KIF A;  4ENJ A;  2F5C A;  2QWW A;  1W7P B;  3SXY A;  4KDP A;  2EA2 A;  5FFZ A;  3L00 A;  4OIN F;  5D5V B;  3RKW A;  3J80 K;  4IHT A;  5JFR A;  2HKX A;  1JHH A;  1B6A A;  1S7A A;  5CLS A;  2DFI A;  4RB0 A;  3KLO A;  2LF7 A;  3D0S A;  2O61 A;  4ESF A;  4FX4 A;  1I6X A;  4G7O F;  4I0B A;  4BYY A;  1MJB A;  4HX8 A;  2E7W A;  2H6B A;  2QQA A;  2F5F A;  4XLP F;  2J5O A;  1UB9 A;  4RGU A;  2QVO A;  4IXA A;  3GF2 A;  4HOB A;  4IRG A;  3WE2 A;  5FLX K;  4R8H A;  5L3E A;  4G7H F;  2EJR A;  3M1E A;  1KQ8 A;  4JQF A;  3LAJ A;  2OQG A;  2EFN A;  1HW1 A;  1UCR A;  2O6G E;  4KNY A;  1ZAO A;  2XRN A;  2PN6 A;  2BBY A;  5HDN A;  4HF0 A;  2DK8 A;  3TDU C;  3FXU A;  4HV6 A;  2NNN A;  1DPR A;  2DW4 A;  2GWR A;  1KU9 A;  1IUY A;  3HIF A;  1H0M A;  1F5T A;  5IT9 Z;  2IPQ X;  4L5I A;  2DK5 A;  4M9Z A;  2KRF A;  4RGS A;  4RB2 C;  1YFH A;  5HLI A;  4A2U A;  3GXO A;  1Z6R A;  3ZN0 A;  2OAZ A;  2GIV A;  4RGX A;  1Q1H A;  4NHJ A;  1IF1 A;  1XN7 A;  2DAO A;  3QP6 A;  3I59 A;  5AON A;  4HLY A;  5D5X B;  2LDU A;  1R5H A;  2FF4 A;  2FBH A;  5D8K B;  4I09 A;  5D5W B;  2A6H F;  1TW2 A;  4L18 B;  3CTA A;  3FHZ A;  3WE3 A;  1TBX A;  2F5E A;  3RJP A;  4E70 A;  1K7A A;  3ZMZ A;  2PEX A;  1RI7 A;  3IRQ A;  3MWM A;  3ZP5 A;  1ZYR F;  4GO1 A;  4CIC A;  1ZHF A;  2Y75 A;  4PDK A;  2UXX A;  3VOE A;  3CUO A;  3WU1 B;  3I59 B;  3V8K A;  5F6F A;  2HZT A;  4HQE A;  2DLL A;  3KP6 A;  3P9C A;  3R6S A;  1Z9C A;  4R79 A;  1J75 A;  1TW3 A;  5K5R A;  2VT3 A;  1T0F A;  1D8K A;  1R58 A;  4R1H A;  1XDS A;  3NQO A;  3IHU A;  2GAU A;  3FXQ A;  4I98 B;  2VE9 A;  3KP7 A;  3F21 A;  5D8L B;  2MC3 A;  1BI2 A;  1XGS A;  5BQT A;  4MQ9 F;  5LGU A;  2K4J A;  2E1C A;  1G3W A;  3J81 K;  1ZG3 A;  4ESB A;  5DEQ A;  4CZZ A;  2RGV A;  1RUN A;  4A6D A;  3U9G A;  1L0O C;  4KIF A;  1G6N A;  1Z6T A;  4LD5 A;  1SMY F;  2E7X A;  5J6X A;  4ESJ A;  3BPX A;  2QUF A;  1T38 A;  1IN4 A;  4HX4 A;  1P92 A;  1XGN A;  2Z3Y A;  3C18 A;  2M45 A;  3RKX A;  3P9K A;  3WTZ A;  3QRF F;  1BC7 C;  1MKM A;  3O3K A;  3I53 A;  1UHW A;  1O3Q A;  2ZME A;  1WSU A;  5BPD A;  4KIB A;  1BIB A;  4CHU A;  1ZGJ A;  1KU3 A;  3Q9S A;  5E8I A;  4AVP A;  1R5G A;  3HRT A;  3IKT A;  3O2P E;  4ENN A;  4EMS A;  1S7O A;  2YPR A;  3V7C A;  2Q0O A;  4M9X A;  3Q5F A;  4LB6 B;  3EET A;  5HS9 A;  3LQQ A;  1SMT A;  2VOO A;  3RYP A;  2OU2 A;  3F72 A;  4YFK F;  2FRH A;  4MTE A;  4ZYH A;  3KFW X;  3J80 Z;  1FP1 D;  1ZRD A;  1ZLK A;  4BNC A;  2EV0 A;  2ZME B;  2K86 A;  3T5X A;  4IRH A;  1D5V A;  3MQ0 A;  2RC4 A;  5D6F A;  5D6E A;  1IRG A;  3F8F A;  1HW5 A;  2OD5 A;  3U1D A;  4A5N A;  1O3R A;  3E5U A;  4OU0 A;  5CVU A;  2PI0 A;  4HA8 A;  1HKT A;  2YX7 A;  4FT8 A;  4WCG A;  2HTS A;  3H3U A;  2XKP A;  5FLX Z;  2A68 F;  3IRR A;  3E6D A;  3JW4 A;  3F8M A;  2GQQ A;  1ZG5 A;  1ZN2 A;  3WTW C;  1Z91 A;  5E18 F;  1J9I A;  3ZN1 A;  2X4H A;  2ADU A;  3E6C C;  4LB5 A;  4KUM A;  1GXP A;  5HLH A;  5JR3 A;  4ZZD A;  2CFX A;  5HVQ C;  2UXN A;  4OIQ F;  4QLC U;  1U6G A;  1IN7 A;  1REP C;  2P5L C;  1D3Y A;  2MBF A;  4AD9 A;  3LA7 A;  2JPC A;  3GO5 A;  4BH9 A;  1Y0U A;  4FX0 A;  1G3T A;  3PQK A;  2R7F A;  1VTN C;  1BN5 A;  5CJ9 A;  1WKM A;  2V1U A;  3RYR A;  1LNW A;  1RUO A;  3QP5 A;  2ZXJ A;  1BM9 A;  3FM3 A;  2XUB A;  3TOB A;  4UV8 A;  2HR3 A;  1JXS A;  2L02 A;  5DD4 A;  1X3U A;  3DXJ F;  1FYL A;  1QNT A;  4A5M A;  2FNP A;  2XHK A;  3RDI A;  1F9N A;  2V6C A;  1F4K A;  1KA8 A;  4LG0 A;  4KT5 C;  5LGT A;  4WXD A;  2HFH A;  1SD5 A;  1XSV A;  4DQ2 A;  4EM1 A;  4GYG A;  2DBB A;  4Y17 A;  2A07 F;  5LRR A;  1QZZ A;  4S05 A;  4LFU A;  4YFX F;  2F5D A;  3IKV A;  2MLK A;  1SD7 A;  2IP2 A;  4EV0 A;  4KA4 A;  3K1M A;  1E17 A;  4RB1 A;  1BOA A;  5DDG A;  1ZRC A;  1LDD A;  1U5T C;  1ULY A;  2QLZ A;  4CDG A;  3QOP A;  2IA0 A;  4ON0 A;  1TQM A;  5L3B A;  4LG0 B;  4ENK A;  3CO6 C;  1B9M A;  2A61 A;  2CW0 F;  1EH6 A;  2KJB A;  3GWZ A;  1O7F A;  4G7Z F;  1KGS A;  2DQL A;  3U2R A;  3K1N A;  3HSF A;  5FGM A;  3ABU A;  5CVI A;  3J81 Z;  2FXA A;  3V4G A;  4GXO A;  3TDZ C;  1L3L A;  4MEY F;  4UVA A;  2VT2 A;  1U8R A;  1HXD A;  2L54 A;  5BS6 A;  2WTE A;  4TV7 A;  4UVB A;  1BI0 A;  2HGC A;  2H27 A;  1E2X A;  1R1T A;  1P4A A;  1FYK A;  1BI1 A;  1KYZ A;  3I5U A;  2J5P A;  2JTV A;  4IF4 A;  4EVI A;  3SZP A;  4ZYD A;  2NAZ A;  2O0Y A;  1KU7 A;  4MQV A;  1O3T A;  3VFZ A;  4XSZ F;  1J5Y A;  3V8L A;  2CSO A;  1DUX C;  1B1B A;  4D0P A;  5L3G A;  4IRI A;  1FYM A;  3PFI A;  4H0E A;  5E1Z B;  1OYY A;  3DEU A;  2QZ8 A;  4M72 A;  5HOO A;  1TQI A;  2EV6 A;  4GGG A;  4MHG A;  3BY6 A;  2K4B A;  4Q5S F;  1KYW A;  2MH9 A;  3GEZ A;  2CGP A;  3LWF A;  5ED4 A;  2GA2 A;  1UFM A;  2CO5 A;  4L5J A;  2P5K A;  5CVJ A;  3I71 A;  3B73 A;  5ICC A;  3KET A;  5DCF A;  1U5T B;  2IRF G;  3M7G A;  4RGR A;  4HLX A;  2P7V B;  2AXL A;  3QU6 A;  4MTD A;  2NRA C;  3ZMD A;  2XAF A;  3V7R A;  3I0T A;  3ZMV A;  2ZFW A;  2HQN A;  4ZZL A;  2KJC A;  3RPQ A;  2HDC A;  5ILV A;  3I64 A;  2YU3 A;  4HF2 A;  2A3S A;  1QPM A;  2CYY A;  2DPD A;  3ZMS A;  2FE3 A;  4O3M A;  3I54 A;  5K1Y A;  3RTR A;  4OOI A;  2JPB A;  3E5Q A;  2A69 F;  4L9T A;  1NHA A;  1FZP B;  4ENM A;  4LLG F;  1SFE A;  4WK8 F;  3WTS C;  3E5X A;  2PJP A;  2RQP A;  4XRF A;  4YG2 F;  2A6E F;  1XSX A;  3HOS A;  2VOP A;  1W5S A;  3M9A A;  2VN2 A;  1ZGA A;  4Y13 A;  1LVA A;  3EYI A;  1K6O A;  2LF8 A;  5A2Q K;  2KIM A;  2Z5U A;  2D1H A;  3S2W A;  2ZJ2 A;  3L9F A;  1IN8 A;  3F8N A;  1YS7 A;  1IN5 A;  4CXF A;  4EGZ A;  4BAY A;  5E17 F;  3KLN A;  4G9Y A;  2XAG A;  1YS6 A;  1W7P D;  2LKP A;  2A5Y B;  2GXG A;  2PMU A;  1IXR C;  5ILU A;  2Z33 A;  2D2W A;  3JTG A;  3JSO A;  3R4K A;  3HHG A;  3DF8 A;  3GFI A;  3GVA A;  5JVT A;  3E97 A;  1SD4 A;  3SQN A;  1FOK A;  1BJA A;  1GXQ A;  4I2O A;  5DV5 A;  3ML6 A;  2Z9O A;  2VON A;  2M30 A;  3GFJ A;  3EUH A;  4A0Y A;  5H20 A;  1STZ A;  5HLG A;  3BRO A;  3CJN A;  3K9T A;  3QPT A;  1MJ9 A;  3CO7 C;  3DQV C;  3N4M A;  4EJW A;  3HOT A;  4HV5 A;  3DPL C;  2QBY A;  4WWC A;  2ESN A;  1G3S A;  5FFX A;  2DTR A;  1HW2 A;  1OYW A;  1MJA A;  4HX7 A;  1W5T A;  2WC2 A;  2BEO A;  3WGH A;  3ZQ7 A;  4QWQ A;  3ROU A;  4IPA A;  2P6T A;  2FEZ A;  1CF7 A;  4L9V A;  2W85 A;  3ULQ B;  4KMU X;  3T8T A;  2M5W A;  1PP8 F;  3RPU A;  3Q9V A;  4AIK A;  3WG9 A;  1XD7 A;  6PAX A;  1HKQ A;  2RVC A;  3JAM Z;  3GYH X;  1EH8 A;  2YX4 A;  2ESH A;  5JHU A;  3FXR A;  4BHC A;  4KYW A;  3D5L A;  2COM A;  4EJT A;  1FP2 A;  4IVN A;  4F7Z A;  3HRS A;  5E20 A;  4A6E A;  2D1V A;  5DCM A;  3F3X A;  4P96 A;  4UNO A;  1CF7 B;  1O7L A;  3WU0 A;  2EFO A;  2FML A;  1KQ0 A;  5AIQ A;  5ICF A;  4N9I A;  4PGH A;  1B9N A;  1BIA A;  1I1G A;  2BV6 A;  4CO8 A;  3FX3 A;  4XSX F;  5J8F A;  1YQA A;  1QGP A;  2W57 A;  2ZCW A;  4O5V A;  4EJV A;  3TO9 A;  5DCM B;  2EWN A;  2B0L A;  2LSO A;  5LGN A;  5DUI A;  4HW0 A;  5BPI A;  5LEJ A;  4GYI A;  1U3E M;  1C0W A;  3N97 A;  1Z1D A;  4CYD A;  2V1D A;  5LHG A;  2X0L A;  2XKO A;  3H92 A;  3R61 A;  4I02 A;  1FC3 A;  4U0W A;  1H9G A;  4EM0 B;  2ZNY A;  1RIO H;  1A04 A;  1UHM A;  3GUD A;  4AIJ A;  1WRJ A;  3WTY C;  2XIG A;  3FWE A;  1R22 A;  3G73 A;  2KKO A;  1J0R A;  4KFC A;  3GZ5 A;  2DT5 A;  1FBQ A;  1XDU A;  5IT9 K;  1I1S A;  3BJO A;  4MGR A;  4UV9 A;  3PQJ A;  1XMA A;  4A12 A;  2DU9 A;  2NYX A;  2KIU A;  4Z2Y A;  3WTU C;  1AOY A;  3HTU A;  1XGM A;  1YLF A;  4G6Q A;  1R00 A;  2K02 A;  4XBF A;  5ICE A;  1V4R A;  4Q48 A;  1G4D A;  2ISZ A;  1BBY A;  2IW5 A;  1Z05 A;  4DNC A;  3GW2 A;  1USS A;  4YII A;  5F64 A;  2EK5 A;  4NQW A;  3LAP A;  1J7K A;  2LNB A;  1FBU A;  5A2Q Z;  5DD8 A;  2HQR A;  1HKS A;  2ISY A;  1FNN A;  4L0Y B;  3J7A O;  3WTX C;  2EFQ A;  4ZH4 F;  2ACJ A;  2CWE A;  1ON1 A;  1KU2 A;  3FMS A;  4U7D A;  1XB4 A;  3K1P A;  1K78 A;  3OV8 A;  4WF2 A;  4LK0 F;  2PG4 A;  3ZPL A;  3FZV A;  3EYY A;  4B09 A;  2EFP A;  4K2E A;  5K5O A;  2GA1 A;  4HAM A;  5D4R A;  1QZY A;  1AWC A;  5L3C A;  3SFZ A;  4CGZ A;  4EJU A;  3KE2 A;  2ZNZ A;  1SFX A;  2MA3 A;  2P4W A;  3KZY A;  5E1W A;  3HYI A;  3CUQ A;  2D45 A;  1T6S A;  1S29 A;  4UUV A;  4ETS A;  3DFG A;  4Q47 A;  4ZYG A;  2BE5 F;  4B8X A;  4FHT A;  2C6Y A;  3TO6 A;  1QQI A;  1S6L A;  1ZG1 A;  2F2E A;  4AIH A;  2XGX A;  5TRD A;  1U2W A;  5FD5 A;  1WWX A;  3JSP A;  2FMY A;  4OMZ A;  1YW8 A;  4P55 A;  2NNY A;  3F6O A;  4A0Z A;  2PMH A;  2IJL A;  3CUQ B;  1UST A;  1W7P A;  3COA C;  2IT0 A;  1LB2 A;  4YIF A;  4OIO F;  3KP5 A;  3JTH A;  1FSE A;  4RS8 A;  1P4W A;  2G9W A;  2L4M A;  1FWZ A;  4Y15 A;  4P9F A;  2CG4 A;  3WOD F;  4HF1 A;  1MZB A;  3VEP A;  2YR2 A;  1F1Z A;  3TQN A;  3I58 A;  1J2X A;  3C1D A;  4G6D A;  1YW7 A;  2FOK A;  3P9I A;  2H09 A;  3ABT A;  4IHS A;  2P7C B;  1B59 A;  4MNU A;  5FB2 A;  4NB5 A;  2IVM A;  3QPH A;  4WXH A;  1IAW A;  4WX9 A;  4M6Y A;  5FD6 A;  5CYV A;  2VOD A;  1OPC A;  4M74 A;  2XVC A;  1DPU A;  3MFK A;  2UZK A;  1BI3 A;  1V3F A;  1TNT A;  4LGW A;  2FBI A;  4PCQ A;  3ZMT A;  5BOX A;  5EEG A;  1J59 A;  1WI9 A;  1ZLJ A;  1JHF A;  3T8R A;  1U78 A;  4N0B A;  2VBZ A;  4RAY A;  1LQ1 A;  1R36 A;  1FY7 A;  4O6J A;  1W4M A;  5J8C A;  1S8N A;  2RV8 A;  2EV5 A;  1YO5 C;  4UHT A;  3AAF A;  3HRM A;  1R1U A;  4HBL A;  1R7J A;  3FM5 A;  2BGC A;  1Z7U A;  5BMZ A;  2FNA A;  1PP7 U;  4EQQ A;  5D4S A;  3L7W A;  3HSE A;  2QQB A;  3IC7 A;  1P2F A;  1PUE E;  3GFM A;  4I01 A;  3SHF A;  4M73 A;  4YFN F;  4AWX B;  4KIG A;  3WGG A;  1LDK B;  2Q8K A;  3RI4 A;  3MEX A;  2P5V A;  2RDP A;  3FMR A;  1SD6 A;  5CVR A;  3CLO A;  3K69 A;  5DUK A;  3VB2 A;  2XAH A;  1OMI A;  1JGS A;  1EH7 A;  3I4P A;  2DQR A;  1RZ4 A;  1IZ1 A;  3DP7 A;  4G8X A;  5H6R A;  5K5Q A;  3RKY A;  3M8F A;  3E6B A;  3IWZ A;  2DI3 A;  4LK1 F;  2QM3 A;  4BHB A;  2O3F A;  5LHI A;  3KEO A;  2EA4 A;  4M71 A;  1R23 A;  1WQ2 A;  4P5O A;  2W25 A;  1HQC A;  2GZW A;  1HST A;  1IN6 A;  2HYF A;  5DYM A;  3DV8 A;  4EM2 A;  3BOQ A;  1S3J A;  2V1X A;  1T39 A;  2O8X A;  1ONV A;  5JI6 A;  3GZ6 A;  3H3Z A;  3E3V A;  1CGP A;  4L9N A;  4BQA A;  2OBP A;  3P7N A;  3R0A A;  4M6X A;  3BPV A;  1SFU A;  4OIP F;  1OKR A;  2ZKZ A;  2IA1 A;  3QU3 A;  5ILS A;  4UVC A;  1MGT A;  3DKW A;  2DO7 A;  4L9J A;  3MAJ A;  1QO0 D;  1IRF A;  4HDV A;  2VXZ A;  3B02 A;  2V79 A;  2UWM A;  2FA5 A;  4I7H A;  3O6B B;  1EV7 A;  2M87 A;  3BJ6 A;  2L4A A;  2MH2 A;  3KP2 A;  3F6V A;  2ELH A;  2FU4 A;  2O03 A;  3F22 A;  2TDX A;  1ZAR A;  1I5Z A;  3BP8 A;  4U7B A;  5LHH A;  3TO7 A;  2QQ9 A;  5L3D A;  1HBX G;  2JRT A;  2VBY A;  5HS7 A;  2OZ6 A;  4S04 A;  1FSH A;  2MD5 A;  2K27 A;  2AS5 F;  2QBY B;  1B4A A;  3TGN A;  2FSW A;  2JSC A;  4PZJ A;  4HDU A;  1P6R A;  3ECH A;  3WTT C;  3KCC A;  2PLY A;  5TJJ A;  1IXC A;  2PQ8 A;  5H6Q A;  4LLN A;  2XAJ A;  1XCV A;  2M1B A;  4A0X A;  4BXU A;  4I0A A;  3DPT A;  3BWG A;  5L3F A;  3SZT A;  3OOP A;  2STW A;  5LRS A;  2P8T A;  2WWY A;  1D8J A;  1TTY A;  3ELK A;  4LLL A;  3FMQ A;  1YYV A;  2K7L A;  2OQR A;  2ZBK A;  1HSJ A;  2RKH A;  1FBS A;  3ZMU A;  1OR7 A;  3R60 A;  2JZY A;  1IXS B;  1R1V A;  1I27 A;  4KMF A;  1KQ9 A;  2XRO A;  3RIR A;  3CDH A;  3WTV C;  5D5U B;  3ERE D;  2L3D A;  4EGY A;  2PFB A;  2G7H A;  4OIR F;  2ETH A;  3LFK A;  1MDM A;  2E1N A;  2EB7 A;  5LEK A;  1JE8 A;  3C7J A;  2G7U A;  1QBJ A;  4M9S A;  2Y0M A;  4KIC A;  1H9T A;  4RB3 C;  3MCZ A;  5E8G A;  2V9V A;  3LA3 A;  1TLH B;  2NS0 A;  2ZO4 A;  4WXC A;  3GFL A;  2VC0 A;  4U88 A;  5F1R A;  4BHP A;  2YSR A;  1ZH5 A;  2M8E A;  5ERI A;  1ZRE A;  2XV4 S;  3HHH A;  2BYV E;  3E6M A;  3LA2 A;  1TQP A;  3LQR A;  3T1B A;  1MDM B;  3KZZ A;  2DPU A;  3IWF A;  3T0Y A;  2HWV A;  1LDJ A;  3FF5 A;  2PBI A;  2MLG A;  4UXN A;  1FX7 A;  3W6J B;  1BC8 C;  4OMY A;  2Z99 A;  5KVR A;  2W24 A;  1IW7 F;  1SAX A;  3NEU A;  1GVJ A;  3KEQ A;  1O57 A;  2VE8 A;  4P9U A;  5EEH A;  5HDK A;  1PDN C;  3KP3 A;  3NRV A;  2STT A;  5CVV A;  4MEX F;  1YG2 A;  1K79 A;  4N9H A;  3CUQ C;  1XMK A;  4U0V A;  3F8B A;  2JT1 A;  1YTY A;  3TOA A;  3V8J A;  4PGG A;  1ZRF A;  2HS5 A;  1LEB A;  3EQL F;  3F8C A;  1YW9 A;  3ECO A;  4JBA A;  1RNL A;  3M8E A;  2H6C A;  3K2Z A;  4HQM A;  3EDP A;  5IT3 A;  4HYE A;  3L2C A;  1YIO A;  3BDD A;  4IJA A;  2EFW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...