1HKSA

Solution structure of the dna-binding domain of drosophila heat shock transcription factor
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
106
structure length
106
Chain Sequence
GSGVPAFLAKLWRLVDDADTNRLICWTKDGQSFVIQNQAQFAKELLPLNYKHNNMASFIRQLNMYGFHKITSIDNGGLRFDRDEIEFSHPFFKRNSPFLLDQIKRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the DNA-binding domain of Drosophila heat shock transcription factor.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription regulation
molecule keywords HEAT-SHOCK TRANSCRIPTION FACTOR
total genus 11
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1994-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00447 HSF_DNA-bind HSF-type DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1hksA00
3HSEA 3H3UA 4K2EA 1JE8A 3E6DA 3ZP5A 3R61A 2IVMA 3C7JA 2Q2EA 2KRFA 1PP7U 5TRDA 1YLFA 5JI6A 3O2PE 1XMKA 3F6OA 1XD7A 1P6RA 3Q9VA 1R1VA 3T0YA 2XVCA 3SHFA 1W7PD 1SD5A 5LGUA 1RNLA 2G7UA 2QQBA 3ECOA 5D4RA 2E7XA 2L54A 2DPDA 2M30A 1O7FA 1V3FA 4KMUX 2KJCA 5F6FA 2PLYA 1PUEE 4E70A 4UNOA 2VOOA 1IW7F 2OA4A 4TV7A 4KIBA 1FWZA 4CDGA 2O61A 2BBYA 4A6DA 2EFQA 1TW3A 1IZ1A 3Q5FA 2V6CA 2ZCWA 2HS5A 2FU4A 3KP4A 1A04A 1KGSA 1USSA 4DQ2A 2QYOA 4YIFA 4U0VA 2YX7A 4BAYA 1TQIA 4L5JA 4LFUA 2QM3A 4MGRA 3DKWA 2P7CB 1YS7A 3TQNA 2P7VB 2HDCA 1B1BA 3F8CA 1G3YA 3NEUA 1HKSA 4RGSA 4EJTA 2MA3A 1GXQA 3MEXA 2G7HA 1ZYRF 1K79A 5D8KB 2MLKA 2DK8A 2VBWA 2KJBA 3RKWA 3VOEA 1YFHA 2A6HF 1LEAA 5D5XB 2EV6A 3V7SA 5ICGA 1FP1D 4B09A 3QOPA 3O3KA 1YO5C 2D45A 1OYWA 5E1XA 3HRTA 3P9CA 3GFMA 4BYYA 2HQRA 2ZO4A 4HYEA 1KQ0A 5ED4A 4P96A 1R7JA 3BZ6A 4G7HF 2HWVA 1GVJA 2HTJA 3KZYA 2JTVA 4HQEA 3ZMTA 3U9GA 3ROUA 1ON2A 2RDPA 4AIKA 1FSHA 2FE3A 1WRJA 3T5XA 1OYIA 3HSRA 3COAC 4I01A 3M7GA 3L7WA 3KP7A 5H20A 3HHGA 5J6XA 3RPQA 2VT2A 3FXRA 3HYIA 2ZMEB 5LHGA 3FXUA 4Q4ZF 3HOSA 3E6CC 2HTSA 3ULQB 4HF2A 2FSWA 1XGNA 1O3SA 5L3FA 3WTSC 4L0YB 1W7PA 4WX9A 1TTYA 5BOXA 1BJAA 3ELKA 3R60A 3WTTC 3FMSA 3HRUA 4UHTA 2F5EA 4HX8A 1ON1A 1RUOA 4L0ZB 1P92A 2G9WA 4LK0F 3D0SA 3OV8A 4S05A 1T2KA 3BJAA 1R1TA 4LGWA 1ZRCA 2IRFG 3SXYA 3V8JA 4HOBA 1UB9A 3WG9A 2EK5A 1QNTA 3GVAA 3GX4X 4CICA 2FBKA 2Y0MA 1OR7A 2K27A 2L02A 4WCGA 5TJJA 1SAXA 5L3GA 2Q0OA 2HR3A 3U2RA 3DV8A 2Y75A 3TGNA 3F8MA 1BI0A 2MH9A 4ZZLA 3P9KA 1LB2A 4A0ZA 3F6VA 1XB4A 2XAQA 3J7AO 5BMZA 2VONA 3GZ5A 2A68F 2DQLA 2DU9A 3O6BB 2Q8KA 4A5NA 1YTYA 5D6FA 3GF2A 3T1BA 5CVIA 3K9TA 1Z05A 1KU3A 1J5YA 2EA4A 2FRHA 3RIRA 3JTGA 2FNPA 1YQAA 4BHCA 4OMYA 2M5WA 3SZPA 3ZMDA 4QWQA 1W5SA 5E8IA 1ZHFA 2NAZA 1J59A 5IT9K 4NHJA 3TDZC 1FYMA 4JQFA 1U8RA 2VE8A 4IJAA 1S7OA 4OMZA 1IUYA 4LB6B 4O6JA 5L3EA 1F1ZA 5J8FA 2ZXJA 2V79A 3FF5A 2NNYA 2HKXA 4HX4A 4N9IA 1BOAA 4JBAA 2CSOA 1DUXC 4YFKF 3KETA 3R0AA 3M9AA 3CLOA 3MAJA 1LNWA 2IT0A 3HOTA 4ESFA 3WE3A 2OZ6A 5EEHA 4B8XA 5LEJA 3K69A 1IXCA 2XKOA 5LLQA 1Z7UA 1REPC 2X0LA 4Y13A 5HS9A 1U2WA 3D5LA 5LRRA 2Y48A 3I59A 2BEOA 3FZVA 2DQRA 3CTAA 2STTA 1XSVA 4PCQA 2EV0A 4KMFA 5ICCA 1FT9A 2QQAA 2VBYA 1S29A 4M6XA 2IPQX 3K1PA 2YX4A 2QBYA 1ZG3A 4N9HA 1I27A 5HS8A 1BI3A 4Q47A 1IRFA 2LSOA 1ZG1A 4OINF 2MH2A 5BPIA 4LD5A 1H0MA 2RNJA 3LFKA 2DLLA 4ZYEA 1LVAA 3EDPA 1FSEA 3GFIA 3PFIA 3GW2A 1J2XA 2GQQA 1U5TC 2L4AA 1K6OA 1KU9A 1SD6A 3FMQA 4LG0A 4YG2F 4U0YA 4IPAA 4OIOF 3TO9A 2EFOA 3GUDA 3ABUA 2KKOA 4RAZA 2NS0A 3GO5A 1EH6A 2EV5A 4BNCA 1LDJA 2EFNA 3FX3A 4HDUA 2E1NA 2YU3A 5HDGA 2YR2A 5FFXA 1OYYA 5L3BA 1MJAA 4KDPA 2E1CA 1FNNA 4LJZF 5BPDA 2YPRA 1XDSA 1RZ4A 3K1NA 4ON0A 1IN6A 1ZGAA 1U5TB 5ILUA 3B02A 4CO8A 4I2OA 1YW9A 2FMYA 5D5WB 2H94A 1F5TA 1JXSA 3IKVA 1GXPA 2XGXA 1KQ8A 1Q1HA 1TW2A 1WKMA 4ZYGA 4U7DA 4PDKA 2ADUA 2FQ3A 3MQ0A 5CVRA 2IW5A 2ACJA 1RI7A 2ISYA 1S6LA 1XMAA 5LRSA 1P4XA 1T38A 4Q5SF 4BH9A 3IWZA 3J80K 2KIFA 4QLCU 2NRAC 4BQAA 1P2FA 3EYIA 2DO7A 5LGNA 4EV0A 2F5CA 1VTNC 3KEOA 1HSJA 4GGGA 3WGHA 3IL2A 3F21A 2XHKA 1R58A 2A69F 1V4RA 1U3EM 4HQMA 2DW4A 1HSTA 3BDDA 1XGMA 2UWMA 2V1XA 2CGPA 2PEXA 1FBSA 4AD9A 1G3WA 1HQCA 2VOPA 3F8BA 4EJVA 4GXOA 3KLNA 5AIQA 5ICEA 3I0TA 2CFXA 3GXOA 4HAMA 2O03A 4CZZA 1S8NA 3HSFA 1IXRC 2X4HA 5IT9Z 3ZMUA 3DPTA 1D5VA 3E6BA 2P5KA 4CYDA 2CYYA 3JW4A 3SQNA 1YS6A 4P9FA 4RS8A 5E1ZB 5DD8A 2HZTA 4MTDA 2F5DA 4OU0A 1U78A 4LK1F 4UXNA 3QP6A 5CJ9A 1UCRA 4I0AA 1I6XA 4I02A 3E6MA 3EETA 3K0LA 3REOA 2ESHA 1O3QA 3I71A 5LGTA 3ZMSA 3C3WA 4RAYA 1HW1A 2UXNA 2W24A 4L9NA 3WTWC 4XBFA 3R0JA 2RV8A 5D4SA 2IJLA 2GWRA 1MDMB 2JZYA 3F3XA 2P4WA 3RYPA 3VEPA 3E5QA 3W6KB 3G3ZA 2GAUA 1ZG5A 1ONVA 3EUHA 2BYVE 2Z99A 4ETSA 5HLHA 4HF1A 2P5VA 2QVOA 2L3DA 4KNYA 1ZH5A 2OU2A 1CGPA 3SZTA 4LB5A 1F9NA 2Z5UA 1YG2A 1L3LA 2PMHA 2UXXA 4ESJA 4G6QA 3L9FA 4KN7X 2RN7A 2V9VA 1AOYA 5A2QK 2XASA 3ISPA 1H9GA 2W84A 1KU2A 1W7PB 4RGXA 3MZYA 1G3SA 4ENMA 3VODA 1QZYA 4U0WA 1JHHA 3P7NA 4LLGF 2K86A 4RB3C 1YW7A 2EA2A 1E17A 3LQRA 3E5UA 1ZLJA 3LAPA 3HTUA 3ERED 2QUFA 2JRTA 3KP2A 1QGPA 1SD4A 2PG4A 3ZN1A 2JPBA 4U7BA 4MEXF 4HBLA 3J80Z 4KIGA 3RKYA 2DK5A 3AAFA 1B6AA 3GZ6A 3U1DA 3WE2A 1KYZA 4GCVA 2M87A 3GWZA 3WTXC 2NYXA 3ML6A 3N4MA 3KCCA 5DUKA 3KEQA 2IA0A 4MEYF 1G3TA 3K2ZA 4IVNA 3QU3A 4PZJA 5LHIA 4FX0A 1XSDA 4MQ9F 1OKRA 1IN5A 1ULYA 3RPUA 2V1UA 4EM1A 3J81Z 4A0YA 2H27A 2F5FA 5JHUA 5F64A 2FXAA 4Z2YA 4MHGA 5AONA 1B9MA 1Y0UA 5K5RA 3PQJA 3B73A 1SFUA 5CVVA 3BOQA 3VFZA 1O3RA 4WXHA 1L0OC 4LLLA 3QRFF 1JHFA 4P9UA 3GLXA 1ZRFA 5CYVA 3F8NA 1ZGJA 1BM9A 2ZKZA 1KA8A 3DFGA 3CDHA 5JVTA 2XIGA 4EJUA 1IN8A 2RVCA 2XAJA 1YYVA 1B9NA 3QPTA 4EM0B 2HOEA 4GYIA 1ZRDA 1J9IA 5DYMA 1QBJA 1GHCA 1XCBA 1D3YA 2OAZA 5CVJA 1Z9CA 2QWWA 3DF8A 1UHMA 2GXBA 2Z3YA 4HLYA 1J7KA 4ASNA 1HKQA 4L9VA 1CF7B 1KQ9A 4I98B 5CVUA 5BQTA 2O8XA 3G73A 1EH7A 1J0RA 5LEKA 1Z1DA 3FWEA 2B0LA 2DTRA 3ZPLA 2XKPA 4GO1A 3I64A 4I09A 5FO5A 5E18F 4FX4A 2L4MA 1MDMA 3ZQ7A 4S04A 2IP2A 1WQ2A 3CO6C 2HKOA 5BS6A 3I53A 2EB7A 1MD0A 2DI3A 1G6NA 1KU7A 2RGVA 2MC3A 3OOPA 4BHPA 5FLXZ 2JPCA 3HHHA 3WGGA 2PFBA 4EGZA 2Z33A 4AIHA 1IXSB 1T6SA 3Q9SA 2J5PA 1RIOH 2A3SA 3L00A 3KE2A 4LG0B 2ZJ2A 4HDVA 1BN5A 1HXDA 1QO0D 1BBYA 3V8KA 2H09A 4P55A 2XRNA 4PGGA 2PMUA 3IWFA 2P8TA 2K4JA 1R23A 1PP8F 4KFCA 1ZN2A 3TO6A 1RUNA 4Q48A 2AXLA 3DEUA 5FD5A 2R7DA 4R8HA 3FHZA 4XSZF 3FMRA 3CJNA 3FM5A 1DDNA 2J5OA 3V8LA 1K78A 2FA5A 3CUOA 1I5ZA 4IRIA 1S7AA 5E1WA 4M9SA 2Z9OA 3I59B 1EH8A 3LA3A 3C18A 1SMTA 2DPUA 4FHTA 1JGSA 2XV4S 2A6EF 2FEZA 2K02A 3F72A 2EJRA 4IHSA 1TNTA 3ABTA 3DXJF 1HBXG 2OQGA 4A5MA 5F1RA 1Z6TA 2ZNZA 4EGYA 2NNNA 2O6GE 2PI0A 3I58A 4A6EA 5DCMA 1I1SA 1P4WA 4KT5C 3M1EA 2P5LC 3VB2A 2JSCA 3BP8A 2GXGA 2RKHA 4Y17A 5DUIA 4H0EA 1IF1A 3S2WA 2UZKA 1EV7A 3F8FA 2FOKA 1R5HA 1MGTA 3GYHX 3CUQB 2MLGA 1DP7P 3DQVC 1IAWA 3JAMK 3FM3A 5E17F 3PQKA 2COMA 2W57A 4M9XA 1MKMA 1LDKB 4KUMA 3GEZA 3IKTA 3MFKA 2CWEA 1TBXA 1NHAA 3KLOA 1IN7A 4EMSA 2VC1A 3WTVC 3ZMVA 4F7ZA 1KYWA 1QQIA 1C0WA 5HLGA 5CLSA 4CXFA 3LA2A 3QU6A 2VXZA 2ZBKA 5DCMB 5JR3A 2F2EA 4KYWA 1UFMA 2QENA 2DBBA 4A2UA 1STZA 5FFZA 5D8LB 5HDKA 5JFRA 1R5GA 1SD7A 1FZPB 3J81K 2ETHA 3BROA 1O3TA 3BJOA 1OPCA 3SFZA 4UVBA 2PBIA 3HTSB 3T8TA 3CUQA 1ODDA 2VC0A 4IRHA 4Y15A 2P6TA 4I0BA 4IF4A 4R1HA 4HLXA 1QZZA 2EFPA 3TOAA 3M8FA 2HEOA 3RI4A 3MZHA 1R22A 3V7RA 2K4BA 3LAJA 3WU0A 1D8KA 3HUGA 2VBZA 3V7CA 4OIQF 3KP6A 4YFNF 2FNAA 4M72A 2ELHA 4EJWA 1W4MA 2AS5F 4ENJA 1BIAA 4RB2C 3JSOA 2IA1A 5J8CA 2FBHA 1WI9A 4O3MA 1USTA 4AWXB 5AIPA 3FXQA 2A07F 1FOKA 1G4DA 4LMYA 2VT3A 4UUVA 3W6JB 2M45A 1YW8A 2W85A 3E3VA 2JT1A 5L3CA 5D5VB 4HZFA 1XSXA 2DT5A 2R3SA 3MCZA 1TLHB 3TO7A 2V1DA 2CQKA 2H6CA 4BXUA 3JTHA 1U5TA 4NQWA 4M6YA 2ESNA 4G7OF 3HRSA 1BIBA 1J75A 1FBQA 2PN6A 2HQNA 2R7FA 3NRVA 4PGHA 4M71A 3L2CA 1SMYF 3I5UA 1FPQA 2DFIA 4G94A 3QP5A 2FBIA 4EQQA 4HV6A 5L3DA 5D6EA 1I1GA 1TQMA 2FF4A 2XAGA 1SFEA 3RKXA 2WV0A 2XAHA 4HV5A 3P9IA 1FY7A 1Z91A 3IHUA 1MZBA 2HGCA 4HA8A 4ZH4F 4OOIA 1TQPA 1HW2A 3RTRA 4HF0A 5K5OA 4YIIA 3EYYA 2OZUA 4UVCA 4L5IA 2STWA 3F22A 3WGIA 4XLPF 3F23A 3RYRA 2WC2A 4L9JA 2VE9A 3WU1B 4XSXF 2PJPA 4ZYDA 4R79A 3GFJA 4KICA 1BC8C 1HKTA 1IN4A 1XN7A 4G9YA 4JK1X 5H6QA 3BWGA 1F4KA 3KZZA 2O3FA 4RB0A 2QLZA 1ZARA 1YIOA 4N0BA 2O0YA 2GIVA 2OBPA 2VODA 3E5XA 4G8XA 1XGOA 2BV6A 4BHBA 6PAXA 5FLXK 4EVIA 3JSPA 4A0XA 2WWYA 4WXCA 1R36A 5KK1A 3TKYA 5EEGA 1FX7A 1LJ9A 4IHTA 2QZ8A 3WTYC 5DCFA 1SFXA 1Z6RA 2KIMA 2QQ9A 2GA2A 2LKPA 4OIPF 4UVAA 4HW0A 3LQQA 4D0PA 1PDNC 1LQ1A 5E8GA 1FYKA 3MWMA 1BI1A 1IRGA 1T98A 3JAMZ 1MJ9A 4ESBA 4ENKA 1HW5A 1UHWA 2VN2A 5HVQC 3DPLC 1AWCA 4DNCA 4AIJA 4L18B 1E2XA 2DAOA 5HDNA 2LDUA 3ZN0A 5K1YA 1XGSA 2H6BA 3L09A 3R4KA 2BE5F 2D1HA 2LNBA 1ZLKA 2WTEA 3E97A 2K7LA 2PQ8A 4G7ZF 2XROA 4A12A 3WTZA 3CO7C 2ZMEA 4XLNF 2A5YB 2XUBA 1FYLA 4XRFA 2OD5A 2E7WA 5ICFA 4HX7A 4ENNA 4OIRF 1DPRA 2HFHA 4G6DA 2LF8A 1O57A 4M74A 1W5TA 5IT3A 5ERIA 2YSRA 3DP7A 2M8EA 4IXAA 5DEQA 2D1VA 4UV8A 2XAFA 4NB5A 1T39A 2BGCA 5D5UB 4KN4X 1FP2A 4ZYHA 5ILSA 4WK8F 4YFXF 2ZFWA 2KIUA 5HOOA 4MQVA 4P5OA 3K1MA 1O7LA 3BJ6A 2ISZA 1P4AA 1R1UA 2P6SA 3KP3A 5HLIA 2RC4A 4WWCA 3GFLA 1H9TA 4AVPA 2VBXA 4WXDA 1MJBA 3NQOA 2A61A 3KFWX 2RQPA 2HYFA 5ILVA 2MBFA 2FMLA 3IRQA 2LF7A 1TNSA 1ZAOA 3N97A 1D8JA 1CF7A 5FGMA 3BPVA 4RGUA 5DDGA 3LWFA 4M73A 1B4AA 3KP5A 4RGRA 2CG4A 3LSTA 3RDIA 3H3ZA 4ZZDA 3WTUC 1OMIA 4RB1A 2EWNA 2EFWA 3R6SA 4CHUA 1X3UA 3V4GA 2GA1A 2QBYB 5LBQA 5A2QZ 5DV5A 4O5VA 1T0FA 4I7HA 3BPXA 3QPHA 1DPUA 3IRRA 2ZNYA 5FD6A 3M8EA 3HRMA 2L01A 4KIFA 3WODF 1B59A 4MNUA 3I54A 4M9ZA 3ECHA 4L9TA 2M1BA 2W25A 1K78B 4KA4A 1WSUA 2GZWA 4FT8A 4GYGA 3EQLF 1R00A 2CW0F 1S3JA 4IRGA 2C6YA 5FB2A 3CUQC 1WWXA 2CO5A 1BI2A 4WF2A 3QAHA 4EM2A 3C1DA 4MTEA 4LLNA 1FC3A 3ZMZA 3RJPA 2MD5A 1K7AA 4UV9A 3HIFA 5K5QA 1XCVA 1XDUA 5KVRA 5E20A 3TDUC 2HYGD 3BY6A 3TOBA 5HS7A 3IC7A 1BC7C 5DD4A 1QPMA 5LHHA 1U6GA 3I4PA 2IA2A 1ZREA 1LDDA 2D2WA 1LEBA 5H6RA 1FLIA 1FBUA 4U88A 2OQRA 3H92A 4CGZA 4EJOA 2TDXA 3LA7A 3T8RA
chains in the Genus database with same CATH superfamily
1S5LC 3HSEA 3H3UA 4K2EA 1JE8A 2VXDA 3E6DA 3ZP5A 1B8IA 3R61A 2IVMA 3C7JA 2Q2EA 2KRFA 2M0CA 1IRXA 2WY7Q 1PP7U 2EQRA 5TRDA 1JKPC 1YLFA 5JI6A 3O2PE 1XMKA 3AL0C 3M07A 3F6OA 1XD7A 3SEZA 1P6RA 3Q9VA 1R1VA 3T0YA 2XVCA 3PUBA 1H88C 1R49A 3SHFA 1W7PD 1SD5A 2L7KA 5LGUA 2LR8A 1CQTA 1T8IA 1RNLA 2VIXA 2G7UA 2QQBA 4QSHA 3ECOA 4EATA 2ZJQF 5D4RA 5K7HA 2E7XA 2L54A 3GMEA 2BHYA 2DPDA 1U9OA 2M30A 2R0QC 1O7FA 2DMQA 1V3FA 4KMUX 2KJCA 1MH4A 5F6FA 5EG0A 2PLYA 1PUEE 3SDGA 4MIMA 4E70A 4UNOA 2VOOA 3DBHB 1IW7F 3OYLA 1FOWA 2ECBA 2OA4A 4TV7A 3H5RA 4KIBA 1FWZA 2W4SA 4CDGA 5E3NA 2BBYA 2DXIA 2O61A 2OJED 2XPUA 4A6DA 3K6GA 3JRIA 2EFQA 4Y52J 3BTJA 1TW3A 1IZ1A 3Q5FA 2V6CA 2ZCWA 3MVPA 4XLHA 2HS5A 2XB0X 2VQLA 2FU4A 3KP4A 1A04A 4UB8C 1KGSA 1USSA 2WB1N 5KCMA 5KAFC 1MBJA 4DQ2A 2QYOA 2WAFA 4YIFA 4U0VA 4IKFA 2YX7A 4BAYA 1TQIA 2HVRA 1IO2A 4L5JA 4LFUA 3JRDA 2QM3A 2E19A 4MGRA 3DKWA 2P7CB 2HOAA 3S15J 3EUAA 1YS7A 3TQNA 2CUEA 2P7VB 4XN3A 1B1BA 2HDCA 2K9MA 4NDLA 3F8CA 1G3YA 2CW7A 3OSGA 1NK3P 2QSGX 3E1SA 3NEUA 1HKSA 4PFPA 2L7MP 1YRNA 4RGSA 4BXXJ 4EJTA 3FXLA 2MA3A 4XOPA 3OS1A 3CLQA 1GXQA 4UY8I 3MEXA 2G7HA 2LTPA 2DODA 1ZYRF 1K79A 1Z3XA 2MLKA 5D8KB 2DK8A 3DLLF 1NH3A 2VBWA 2KJBA 2DT6A 3RKWA 4E4HA 3VOEA 1YFHA 3S8PA 2A6HF 3BR3A 1LEAA 5D5XB 2EV6A 5HNFA 3Q0WA 3V7SA 5J47A 1QPIA 5ICGA 1FP1D 2COBA 4XR6A 1X3WB 4B09A 3CMYA 2F4OB 3QOPA 3O3KA 1YO5C 2X9DA 2D45A 3CF2A 2XPVA 4YRVA 1OYWA 2IBDA 5LD2C 4B1RA 1QU3A 4J01A 1M1EB 5E1XA 1G2HA 1IDYA 3S3OA 3HRTA 3P9CA 3GFMA 4BYYA 2ME6A 3A2KA 2HQRA 2R5YB 2HNHA 2KRCA 2ZO4A 3A02A 4HYEA 1KQ0A 5E79C 5ED4A 1QVUA 2VPLA 4P96A 1VQ9I 1R7JA 3FISA 3BZ6A 4G7HF 2R7RA 1IV6A 2HWVA 2MD0A 1GVJA 2I8DA 2JRMA 3W2AA 1IGNA 2HTJA 2G0EA 3KZYA 2V9KA 2JTVA 2K85A 4CYCA 2W48A 4ZDLA 4HQEA 3ZMTA 3U9GA 1YTYA 2HOSA 3ROUA 2NVYJ 3KYDB 1ON2A 5FLMJ 4BBRJ 2RDPA 1I3AA 4AIKA 1DGRM 1FSHA 4HG2A 3HJEA 2DYSH 2LY9A 4BKXA 3OYMA 2FE3A 3DEWA 1WRJA 3H3VK 3T5XA 1OYIA 3HSRA 3D1NI 1W1WE 3COAC 4I01A 3M7GA 2AQFA 3L7WA 2FUG2 3KP7A 3HUGB 1LE8A 2EIMH 3AFHA 5H20A 1GDTA 3ABLH 3HHGA 3PSIA 5J6XA 3RPQA 2VT2A 3FXRA 3HYIA 5E3OA 3W2VA 4D9JA 4G6TB 2ZMEB 3NWSA 3WG7H 3VSKA 5LHGA 3FXUA 3QWLA 4Q4ZF 3HOSA 3E6CC 2HTSA 4ABZA 3ULQB 4HF2A 3OWTA 2FSWA 1XGNA 3S2HJ 2VQHA 2WAEA 4FCYA 2KISA 2I5UA 5L3FA 1O3SA 1HF0A 1ENHA 1MMAA 3KX2A 3CDIA 3WTSC 2ZMEC 4L0YB 1SAUA 1W7PA 5TGTA 1UG2A 4WX9A 1JJ6C 4BU2A 1TTYA 4II2A 1BJAA 3ELKA 5BOXA 1ZK8A 3R60A 3WTTC 3CCQI 3FMSA 5GTIC 2Z16A 3HRUA 4UHTA 2CQNA 2F5EA 5JLWA 3CMEI 4BACA 1OCCH 1HC8A 1VF9A 4HX8A 2XSDC 5FROA 1FIAA 4KT6A 1ON1A 3F9KA 3MKLA 4Y33A 1RUOA 4L0ZB 1P92A 2G9WA 4DBRA 4LK0F 3D0SA 3OV8A 4S05A 3LSJA 4UB6C 1MMDA 3BTCA 3QYBA 1T2KA 3BJAA 1R1TA 4LGWA 1ZRCA 4JOMA 1R71A 3DEEA 2IRFG 3SXYA 3V8JA 4HOBA 3AG4H 3BR6A 3CMMA 1G8XA 2L2OA 5GAGJ 1R5ID 2XGCA 1UB9A 1ETQA 1Y1VJ 3WG9A 2DTZA 3M1CA 2EK5A 1QNTA 5E3MA 3GVAA 3GX4X 1NTCA 4CICA 4N4OB 1IDZA 2FBKA 5EF6A 2Y0MA 2NXNB 1OR7A 2DMUA 4DGWB 2K27A 1JI8A 2L02A 2QCOA 3LSPA 1B72A 4WCGA 3K10A 4KISA 2DFEA 5TJJA 5IP9J 1SAXA 5L3GA 2Q0OA 3ASOH 2HR3A 3A0BC 3A01A 3U2RA 3DV8A 1N25A 2BY3A 4XLFA 2Y75A 2AQEA 1WJEA 2BZTA 3TGNA 3M3YJ 1ERDA 3F8MA 1BI0A 2MH9A 4F91B 4ZZLA 3P9KA 1LB2A 5C3EJ 4A0ZA 3F6VA 1WI3A 1HCRA 1XB4A 2H1KA 2XAQA 3HXLA 3J7AO 1Z0XA 5BMZA 2VONA 3K4NA 3GZ5A 2A68F 3TBIA 2DQLA 3CMAI 4A3GJ 2QKMB 2DU9A 3O6BB 2B9SA 2Q8KA 3A03A 4A5NA 3OYBA 5D6FA 1T08B 1XMXA 3GF2A 3T1BA 2Z1DA 5CVIA 2KRHA 4DZPA 2O8KA 4BEHA 3K9TA 5F04A 3TMOA 1Z05A 3K4MA 4J19A 2HVQA 4A3LJ 1KU3A 2TCTA 1J5YA 3ABKH 1OCRH 2BHZA 2EA4A 2QEXI 2VUMJ 2FRHA 3UKGA 3RIRA 3JTGA 2FNPA 1YQAA 4BHCA 4OMYA 2EINH 5DS9A 2M5WA 1E3PA 5B1BH 2Y0SA 4IOCF 5CKTA 5JHFA 3IH3A 3SZPA 3OYDA 3ZMDA 4QWQA 1W5SA 2DFHA 2VASA 5E8IA 1ZHFA 4AM3A 2NAZA 3A01B 1RC9A 3IH2A 2ZC2A 4XORA 1J59A 5IT9K 4NHJA 2ZSIB 3TDZC 2E60A 3G2BA 4XNFA 1FYMA 4JQFA 1U8RA 3LMMA 4XQFA 2VE8A 3O8HA 4IJAA 1S7OA 2M3AA 4OMZA 3MMYB 1Q1VA 5E3LA 3H0GJ 1IUYA 4BE1A 4LB6B 4O6JA 5L3EA 3JRAA 1POGA 5K7FA 1F1ZA 3W3CA 5J8FA 3C2HA 2IXSA 2ZXJA 3B6CA 2WB1A 3HOVJ 1DP3A 2V79A 2NVTJ 3FF5A 2NNYA 2HKXA 2L7FP 4HX4A 1JKRC 4N9IA 1BOAA 2CUJA 4JBAA 2CSOA 3W6VA 1DUXC 3LL7A 4YFKF 3RZOJ 3BR1A 1VQ8I 3KETA 3D5SC 2HOTA 4B3AA 2EZIA 3R0AA 3M9AA 3CLOA 3MAJA 3ZRGA 4ZDOA 4RBOA 1LNWA 3M8JA 5HNHA 4ESFA 2FJ1A 2HDWA 3HOTA 2DN0A 3WE3A 2LLKA 2OZ6A 5EEHA 1YI2I 2CV2A 3PO3J 4B8XA 2TRTA 3HM5A 5M5WJ 5LEJA 3F0CA 2MC4A 2E5ZA 3K69A 4XL9A 2YUSA 3PNVA 1IXCA 2XKOA 3LNQA 5LLQA 1Z7UA 1N75A 2K5CA 1Z7LA 3GLLA 1REPC 2F6CA 2UV1A 2X0LA 2WAQA 3S93A 1PUFB 4Y13A 5HS9A 1U2WA 2KMUA 1ZQ3P 4XRSG 4XKVA 1MBKA 3D5LA 2DJIA 5LRRA 2Y48A 3I59A 2BEOA 3FZVA 2DQRA 3CTAA 3HOWJ 1TT5B 2STTA 1XSVA 2VL8A 4PCQA 2EV0A 1VQ5I 3K7AJ 4KMFA 5ICCA 1FT9A 2KIQA 2QQAA 2VBYA 4RDUA 2ICWG 1S29A 2WADA 3FXOA 4M6XA 1GV2A 1QA6A 5F0FA 2IPQX 3K1PA 3CCEI 1ZR4A 2YX4A 2QBYA 1JJ8C 1ZG3A 4N9HA 1I27A 4BQQA 1MSFC 5HS8A 1BI3A 4RA2A 4Q47A 3B6AA 1SC7A 1IRFA 2LSOA 1ZG1A 4OINF 4E6KG 3HB9A 2MH2A 5BPIA 3O8GA 1MNDA 1Y39A 4BS9A 4LD5A 1H0MA 1YHQI 2RNJA 3LFKA 3EUKL 2LREA 2KLOA 2DLLA 4ZYEA 1QHGA 3CC7I 1LVAA 1JUMA 3EDPA 1TWFJ 1FSEA 4LITA 3GFIA 3PFIA 3GW2A 1J2XA 2GQQA 1U5TC 2L4AA 2XGEA 4FISA 1K6OA 3CCMI 1KU9A 1BR1A 1SD6A 4LIVA 1E3HA 3FMQA 4LG0A 4YG2F 4U0YA 3JRFA 1AA7A 5IYCJ 4IPAA 4OIOF 4OIPF 3TO9A 2EFOA 3FKJA 3GUDA 1TWCJ 2EPFA 1D5YA 3ABUA 4HRIA 2R5ZB 4AC0A 3VYUB 3ABMH 2KKOA 4RAZA 2NS0A 3GO5A 1EH6A 2EV5A 1O4XA 4BNCA 1MBEA 2QKLB 2Y2ZA 1LDJA 2EFNA 3GTLJ 1VQMI 3FX3A 4HDUA 2E1NA 2YU3A 1I3QJ 5JVGF 1H8AC 5HDGA 3TP0A 2OF7A 1VFCA 2YR2A 5FFXA 4V2FA 1OYYA 2IGOA 4PJNA 3QPLA 5L3BA 1MJAA 4KDPA 2E1CA 1FNNA 4LJZF 1FTZA 2YPRA 1XDSA 2EBIA 5BPDA 1PJRA 1RZ4A 3CC2I 1JTXA 2R93J 4ZJZA 3K1NA 1BW5A 2X6WA 2DT7B 1Y1WJ 2F4IA 2XDVA 1TL8A 2Q1ZB 4ON0A 1V5EA 1IN6A 3BZKA 1ZGAA 4NQWB 1OLTA 4E7KA 3H9QA 1U5TB 5ILUA 3DPUA 1TZLA 3B02A 4CO8A 3GTJJ 4BEHB 2QQ8A 2RREA 4I2OA 3CDLA 2O5RA 2Y9YA 3EUHC 4DYCA 1YW9A 2FMYA 5B1AH 4A3BJ 5D5WB 4BGDA 2H94A 1F5TA 1JXSA 3UNGC 3RQIA 1RR8C 3IKVA 1GXPA 1JKOC 1GVDA 2XGXA 4PFOA 1JKQC 2YU9J 1KQ8A 3JCUC 3HG9A 1Q1HA 1TW2A 1WKMA 3I56I 4ZYGA 1PYVA 4U7DA 4PDKA 2ADUA 2FQ3A 3MQ0A 1JUPA 5CVRA 3OIQA 2IW5A 2CUFA 2ACJA 1RI7A 2ISYA 5IOZA 2OCCH 2ELJA 2R7TA 1S6LA 1XMAA 5LRSA 1P4XA 3OL3A 1TC3C 2FX0A 2MW8A 2PX9A 4BXFA 1T38A 3S1NJ 5IOYA 2JA2A 2B7EA 4Q5SF 3V42A 4BH9A 3IWZA 3J80K 2KIFA 4QLCU 1MW7A 3ZOBA 2NRAC 1YJWI 2CMPA 4BQAA 1P2FA 3EYIA 2DO7A 2XPWA 1P7JA 3S1MJ 1QHHD 5LGNA 5EZHA 4EV0A 3PL8A 3ZQHA 2F5CA 1VTNC 3KEOA 1U8BA 1HSJA 4GGGA 3WGHA 3IL2A 3F21A 2XHKA 2NVUB 1R58A 4ITVA 3OS2A 2A69F 3MN2A 1V4RA 1VQ7I 1U3EM 4HQMA 1ORKA 4L5EA 2DW4A 3SDBA 1HSTA 4DIQA 3BDDA 4IQ4A 2JVHA 3HZJA 1XGMA 2PJRA 2UWMA 2V1XA 3K2AA 2CGPA 2ZFUA 2PEXA 1FBSA 1T56A 3BCAA 4AD9A 5GPAA 1G3WA 1HQCA 2VOPA 3F8BA 4HSTA 4EJVA 2BW3B 4GXOA 2L9RA 3KLNA 5AIQA 5ICEA 3S1RJ 1K4TA 2K3PA 1FJLA 1X1PA 3I0TA 1SFKA 2CFXA 3HOYJ 3GXOA 4HAMA 1E0EA 2O03A 4CZZA 4F52A 1S8NA 3HSFA 1IXRC 2X4HA 1VZ0A 4HNTA 2WBMA 1D1CA 3ZMUA 1XX5A 3DPTA 5IT9Z 1D5VA 3E6BA 2FOWA 2P5KA 1IRZA 4BJTA 4CYDA 3VSLA 1K61A 1OQYA 2CYYA 3JW4A 1YX5A 3ESWB 1YS6A 3SQNA 4BE2A 2KZGA 1EA3A 4P9FA 4RS8A 3LFUA 5E1ZB 5DD8A 4XMYA 2UUZA 2HZTA 4A3EJ 4MTDA 2F5DA 4OU0A 1U78A 4LK1F 4HSRA 4UXNA 4KITB 3QP6A 5CJ9A 1UCRA 4I0AA 3PNTA 2V7FA 3SJMA 1I6XA 2HVSA 2L9NA 4I02A 1NG7A 4PJ0C 4GDFA 1WVRA 3E6MA 3DKYA 3EETA 3K0LA 3REOA 1TWAJ 2ESHA 1O3QA 3I71A 4NNJA 5LGTA 3ZMSA 3C3WA 2FQ4A 4RAYA 4E7HA 1HW1A 2ZJPF 2UXNA 4PUSA 1QZEA 2W24A 4L9NA 5EEAA 3FIWA 3WTWC 4XBFA 4J00A 3G1OA 2A05A 3R0JA 2RV8A 5D4SA 1ETOA 1T95A 1OCTC 2IJLA 3KEYA 1ZKGA 2GWRA 3DU6A 2CU7A 2CH0A 3CCLI 3CC4I 1MDMB 2JZYA 2FD5A 3F3XA 2DA7A 4XLCA 1SVMA 1VQKI 2LRDA 2P4WA 3RYPA 1ZTRA 3MKZA 4ZYAA 3E5QA 3VEPA 5F0CA 3RPUD 3W6KB 2Y31A 1SVLA 3G3ZA 2GAUA 2CV1A 1ZG5A 1ONVA 3Q3SA 3EUHA 2LKSA 2BYVE 2Z99A 1T0FC 1TT0A 3FXMA 1MNEA 4ETSA 1YJ9I 5HLHA 3HDDA 5F0HA 4HF1A 2HQAA 1VI0A 2BY1A 2VPRA 2P5VA 2QVOA 2L3DA 4KNYA 3HKZA 2BXZA 1ZH5A 2OU2A 1CGPA 3SZTA 4LB5A 1F9NA 2VKVA 2Z5UA 3NWTA 3UR3C 5J4VA 1ACIA 2M7BA 1YG2A 1L3LA 2Z2SB 2PMHA 2UXXA 3LSRA 4YELA 4ESJA 4G6QA 2QSHX 3L9FA 3D5RC 3MZ8A 4KN7X 1U0JA 2RN7A 2IEKA 2V9VA 1AOYA 2GBYA 5A2QK 1S7EA 2XASA 1V5FA 3ISPA 1H9GA 1EKEA 3IAM2 2W84A 1VQOI 1GUUA 3M4OJ 3MKYB 3FK7A 4V19K 1OFCX 1KU2A 1W7PB 3HPGA 4RGXA 1EF4A 3MZYA 5F1JA 5KHDA 1G3SA 4ENMA 1XPXA 2R7VA 2H1LA 3VODA 5K7ZA 1QZYA 1V54H 1X1DA 3FBIB 4U0WA 1JHHA 3I55I 1IJWC 3P7NA 1XC5A 4LLGF 2K86A 2ZSHB 1Z21A 1WZ2A 1WHUA 2E1MC 2QSFX 4RB3C 1YW7A 3TL4X 4E7ZA 2EA2A 1E17A 2LFBA 3I4MJ 3LQRA 3HL2A 3E5UA 2CRGA 2KZVA 1KZHA 1K83J 4CSWA 3AG2H 1ZLJA 3BC8A 1RKTA 3LAPA 1AHDP 3GZNB 3HTUA 3ERED 2QUFA 4M3GA 2JRTA 1I50J 2LG4A 3KP2A 1WJ5A 2OV7A 4ZTFA 1QGPA 2NOGA 4CCOA 2XB5A 2VJIA 4B43A 1SD4A 2PG4A 1D0ZA 4XM3A 3ZN1A 4QIWN 2KPMA 2JPBA 5GAHJ 1I6HJ 4U7BA 4MEXF 2MABA 3NARA 4HBLA 3S1QJ 3OYCA 3J80Z 2X6OA 4KIGA 3E7LA 2DK5A 3RKYA 3AAFA 1B6AA 3GZ6A 3U1DA 3WE2A 1KYZA 3KZIC 4GCVA 1JUSA 2M87A 3GWZA 3WTXC 1MNMC 2MGQA 3ZCOA 2NYXA 3ML6A 3N4MA 2DA4A 4E7LA 3KCCA 4PJMA 5DUKA 3KEQA 3CCUI 2IA0A 3LOCA 4XKBA 4MEYF 5FLVA 1G3TA 2A6TA 3K2ZA 4IVNA 3QU3A 5FRMA 5M5YJ 2M0MA 4N4NB 3H1CA 4PZJA 5LHIA 4FX0A 3HKZN 1XSDA 5B3SH 4MQ9F 1OKRA 2XRLA 1IN5A 4FE7A 1ULYA 3RPUA 2V1UA 2CQXA 4EM1A 1X2MA 3J81Z 2F5VA 1MMSA 4A0YA 3OR2C 1ITYA 1X4OA 3G4SI 2H27A 2F5FA 4CCKA 5F64A 5JHUA 2FXAA 5CQEA 2VB6A 2W82A 2Q2EB 3AKZA 3JRBA 2M4GA 2OUMA 3LSIA 4Z2YA 1AKHA 4MHGA 5AONA 1XS9A 2ECCA 1WPKA 2ZXIA 2JA5J 2BY0A 1B9MA 1X19A 1Y0UA 2JUGA 4NBQA 4KJZA 1UG0A 1ZELA 5K5RA 3PQJA 3B73A 2VJ4A 1ETYA 1SFUA 1BR4A 4D5FA 5CVVA 3BOQA 2BY2A 3VFZA 1O3RA 3DTKA 4WXHA 1L0OC 5CPRB 4M3DA 3ONQA 4LLLA 3G6EI 5M3FJ 3QRFF 1JHFA 4P9UA 3L2WA 3GLXA 1ZRFA 4LOCA 1SVOA 3J7AY 4DZJA 1T33A 5CYVA 2LY1A 3F8NA 2DOFA 3OYIA 2E71A 1ZGJA 2ZXWH 1MBGA 4A69C 3PNYA 2PJRB 1BM9A 2ZKZA 1KA8A 3DFGA 3CDHA 3JR9A 5JVTA 2XIGA 3ZQIA 4Y4RA 4EJUA 1IN8A 2F48A 4XRSA 1JT6A 3S3MA 3FK6A 2RVCA 3WHCA 2XAJA 3RZDJ 1YYVA 1B9NA 3QPTA 3LSKA 1A5JA 4MFEA 3U1KA 1DU0A 4EM0B 2HOEA 4GYIA 1ZRDA 1J9IA 1LE8B 5DYMA 1QBJA 1GHCA 1XCBA 1D3YA 2OAZA 5CVJA 2LYCA 4OAZA 3OIPA 4QTRA 1OISA 5J1RA 1Z9CA 1UMQA 2H8WA 4AU7A 2QWWA 2IS4A 3DF8A 1MMNA 2V9PA 1X1CA 5EDNA 1UHMA 2GXBA 2Z3YA 3FXJA 4HLYA 1J7KA 4ASNA 5DM6F 3OYAA 1HKQA 4L9VA 1H89C 1CF7B 4D5CA 2R92J 2GOMA 1KQ9A 3CP2A 4I98B 5CVUA 4CYCB 1X2NA 2XF6A 5BQTA 2DOEA 2O8XA 1E3OC 4IOAF 4YEJA 3G73A 5DTDA 3U21A 1EH7A 2E36A 1J0RA 3C2GA 3ZQFA 1Z1DA 5LEKA 2R7ZJ 4E7SA 3FWEA 5C44J 4EEFG 2B0LA 2XC7A 3J7ZI 4PSWA 2DTRA 3PJRA 3CD6I 2PMZA 4RM2A 3ZPLA 2XKPA 4GO1A 3I64A 2CS3A 5J40A 4I09A 5FO5A 2CW8A 5E18F 4FX4A 2L4MA 1MDMA 3ZQ7A 2BVLA 1BOBA 3ZGKA 5BNGA 2L0KA 5J4YA 4CH7A 2DJNA 4S04A 2IP2A 1WQ2A 2K9NA 1WJCA 2JJ7A 3CO6C 3E0JB 2HKOA 2OCEA 2NS8A 5BS6A 2IT0A 3OYEA 2HPIA 2V6EA 3I53A 2EB7A 1MD0A 1V55H 3P5JA 1RKWA 1YE9A 2DI3A 1G6NA 4PJLA 2RGVA 2MC3A 1KU7A 2E2HJ 3OOPA 1R4NB 1MBFA 4BHPA 1F36A 4ANJA 1BJZA 2LVSA 2DMTA 3K4LA 5FLXZ 3OYJA 4FASD 2JPCA 3HHHA 3WGGA 3IH4A 2PFBA 5FKNA 3BR0A 4EGZA 1QVTA 4BBSJ 1ETVA 2EZKA 2JVGA 5HODA 2Z33A 1R4MB 5B5EC 3KIOA 1Y56A 4AIHA 1IXSB 1T6SA 2IAIA 4BL0B 3Q9SA 2J5PA 1RIOH 2A3SA 3L00A 1X1BA 3KE2A 4LG0B 2A5WA 3S3NA 2ZJ2A 2VJ5A 4HDVA 3CCVI 1BN5A 1HXDA 1QO0D 2O7OA 3DLAA 4XICA 2GM4A 4CZCA 2HXIA 1BBYA 3QQAA 4HPQA 4E7JA 3QOEA 3CP8A 4B48A 3V8KA 5EGOA 1OJLA 2H09A 3DTEA 4P55A 1W5CC 2XRNA 4PGGA 2PMUA 2IS2A 3JRGA 4D1QA 3IWFA 2P8TA 2K4JA 3VDXA 1R23A 1PP8F 2DCEA 4KFCA 2R4GA 1ZN2A 2ZB9A 2JUCA 1HOMA 4XK4A 5FKMA 3HBLA 2LBFB 3HGYA 3TO6A 4LG3A 3S14J 1Y0NA 1RUNA 4Q48A 2AXLA 3DEUA 5FD5A 4DYQA 2ZJRF 1FOXA 2R7DA 2CV0A 4R8HA 3FHZA 4XSZF 3FMRA 2CQQA 3CJNA 3BTIA 3FM5A 3LSHA 1DDNA 2M34A 3QPSA 2J5OA 1R6RA 4PSXA 3H5AA 3V8LA 5EG0B 3AL0B 2VLAA 2FA5A 3CUOA 1K78A 1D1AA 4HEA2 1I5ZA 2QA4I 1ZGWA 3ERMA 5IY5H 3FKIJ 4M3EA 3HOUJ 4IRIA 1S7AA 2VQCA 4G12A 4BJ6C 5E1WA 3FXKA 4M9SA 2Z9OA 3BZCA 3I59B 1EH8A 3OS0A 1DQUA 4BY7J 1RESA 4X6AJ 3LA3A 1XTAA 2OPTA 3C18A 4IQJA 5C4XJ 5HLTA 1SMTA 2DPUA 2M2EA 4FHTA 1D0XA 1HDPA 4BUPA 3CCJI 1JGSA 2OTLI 4XLEA 2XV4S 2QF7A 2A6EF 2WAQN 2FEZA 2K02A 3F72A 2EJRA 2LY2A 4M3BA 1TNTA 4IHSA 3ABTA 3DXJF 1N77A 1HBXG 2OQGA 4DW6A 5GTHC 2HXOA 4A5MA 2X6YA 5F1RA 1FIPA 2AXTC 1Z6TA 2E1MB 2ZNZA 4EGYA 2NNNA 3N05A 2O6GE 2PI0A 1UELB 2CFOA 2LH9A 3I58A 2XAUA 1VQLI 4A6EA 5DCMA 4FTHA 1I1SA 1IUFA 2AO9A 3L1PA 1P4WA 4KT5C 4UUSB 1X4PA 3M1EA 1YIJI 2P5LC 1F43A 2IGKA 3VB2A 1U9NA 4IHWA 2JSCA 3OYKA 1LFUP 3BP8A 2GXGA 2KFDA 2KDOA 3K70D 4B47A 2JA6J 2RKHA 4Y17A 5DUIA 2M9HA 2X48A 4H0EA 1IF1A 2XGDA 5IYDJ 3S2WA 2UZKA 3OIOA 3AG1H 1EV7A 2P0WA 5IP6A 1YJNI 3F8FA 2FOKA 1JTYA 3L2UA 1R5HA 1MGTA 3GYHX 5CQGA 4IEJA 3MD2A 3CUQB 2MLGA 1DP7P 3DQVC 5IP7J 1IAWA 3QYEA 3JAMK 3FM3A 5E17F 3PQKA 2COMA 2XF7A 2W57A 3AG3H 4M9XA 4P1WA 1MKMA 1SANA 1I39A 1WJBA 1LDKB 1IG7A 4KUMA 3RQ4A 4C3IJ 1LVKA 3GEZA 3IKTA 3MFKA 2E34A 2R5ZA 2L5QA 3CJRB 2CWEA 1TBXA 2EIKH 5FRNA 1LKXA 1NHAA 2XF5A 1QRYA 3KLOA 4F55A 2ID6A 1IN7A 4C30A 4EMSA 2VC1A 2K9SA 2OTJI 3WTVC 5J1UA 4PJJA 3ZMVA 2KHMA 4F7ZA 3GTQJ 1KYWA 3TP3A 2RAEA 3OL4A 1B8IB 1QQIA 2E2JJ 1C0WA 2VJJA 3K70C 2LD5A 5HLGA 4H4KC 5CLSA 3K4BA 4CXFA 3DBLB 3KPHA 3LA2A 3BR5A 3QU6A 5JLXA 1A31A 2Y0SN 3HPHA 2BVMA 4RM3A 2LC2A 2VXZA 2ZBKA 1LFPA 5DCMB 5JR3A 3CQZJ 2F2EA 4KYWA 2F4MB 1UFMA 1UZCA 2QENA 3GBGA 2DBBA 4A2UA 2WA0A 2M7AA 1STZA 4MLOA 5FFZA 5D8LB 3CCRI 5HDKA 1A35A 5JFRA 1R5GA 1SD7A 1FZPB 2QGUA 2ETHA 3BROA 3J81K 3CCSI 1O3TA 2MYSA 3BJOA 2L7ZA 4B44A 2R7SA 2X1EA 3PM1A 3GTGJ 2YS9A 3RSNA 1OPCA 2VKHA 3SFZA 1VQ4I 1WCMJ 1P7IA 4UVBA 3SZGA 2PBIA 1B72B 1RR7A 3HTSB 4FETA 3T8TA 3CUQA 4CA0A 2V1NA 1ODDA 2DOAA 2HU9A 1Y6IA 4XLAA 3SEQA 3TW6A 2VC0A 4IRHA 4Y15A 4IHYA 2P6TA 4I0BA 4IF4A 4GFBA 4R1HA 4HLXA 1QZZA 2E35A 3H5NA 1WJAA 5M5XJ 2EFPA 3TOAA 3M8FA 1TWHJ 2HEOA 3RI4A 3MZHA 1R22A 3V7RA 1GT0C 1VQNI 2K4BA 5FKLA 4UUSA 3LAJA 3A1YA 3S17J 3WU0A 4A3MJ 2GLOA 1D8KA 3HUGA 3S2DJ 2VBZA 3V7CA 4DJAA 4S0HB 2JMWA 4OIQF 3KP6A 4YFNF 2FNAA 3L2QA 3VYTB 3ZQCA 4M72A 1VQ6I 1BW6A 2VKDA 4MFDA 2ELHA 4EJWA 5KNLA 4IZZA 1Y8QB 3FBNB 5GADJ 1W4MA 2JSPA 1W36D 2AS5F 1NK2P 2DA2A 5IYBJ 2X85A 3RCOA 1BIAA 4RB2C 4ENJA 3JSOA 1YX3A 2IA1A 5J8CA 2FBHA 3MKWB 1WI9A 2WV1A 4O3MA 1USTA 4AWXB 1D0YA 2Y9ZA 5AIPA 2V26A 3FXQA 2A07F 1FOKA 1G4DA 4A3DJ 3BG7A 4RLFA 4LMYA 2VT3A 4UUVA 2NS7A 3W6JB 1OCOH 2KQRA 3LSMA 2M45A 4V2GA 4CCLA 2PMZN 3VWBA 4I6ZA 3FDYA 1YW8A 2W85A 4RAGA 1WFXA 3E3VA 2HPMA 2JT1A 5L3CA 5D5VB 4A3FJ 2MSYA 3DU5A 4HZFA 3IP4B 3BCBA 1XSXA 3DWLE 1MSEC 2DT5A 2R3SA 3MCZA 2B63J 3G1LA 1TLHB 3TO7A 2V1DA 2CQKA 2H6CA 1LFBA 1PUFA 4BXUA 3JTHA 5GP9A 5EYRA 1TWGJ 1U5TA 3H36A 1YOVB 1K6YA 4DBQA 4NQWA 4M6YA 3VYSB 2ESNA 2OC6A 4U87A 4G7OF 3HRSA 1BIBA 1J75A 1FBQA 2KP6A 2VKEA 2PN6A 2HQNA 2R7FA 3NRVA 4PGHA 4RLQA 4M71A 3L2CA 1SMYF 1X58A 2EH3A 3I5UA 2X6XA 1FPQA 4OAYA 3HOZJ 3CCYA 2HI3A 4ZC3A 4BQOA 2DFIA 2W00A 4G94A 3QP5A 2FBIA 4EQQA 5DM7F 2LK2A 2P81A 2W1OA 4PK4A 1S72I 4F93B 3S16J 1RRJA 4W1UA 4HV6A 1UHSA 5L3DA 5D6EA 1I1GA 3JREA 1TQMA 5EGOB 2FF4A 2XAGA 1SFEA 4F92B 3PFYA 3QODA 4OWRB 1HLVA 9ANTA 3RKXA 2WV0A 2XAHA 2LOOA 4HV5A 3P9IA 5J1YA 1VQPI 4AIDA 1FY7A 2JQ7A 1Z91A 3IHUA 4I99C 3L2RA 3GTPJ 2HQ5A 4XOTA 3OYHA 4IHVA 3GTMJ 2IS1A 3A4CA 1MZBA 1FOYA 3IUOA 2DYRH 2HGCA 4HA8A 4ZH4F 3WU2C 4JX4A 4OOIA 1TQPA 1HDDC 3ZQQA 2EZLA 4XRMA 4FQGA 1HW2A 1BL0A 4JP0A 1MMGA 3RTRA 4HF0A 5K5OA 4YIIA 1D1BA 3EYYA 5H2FC 2OZUA 1R9TJ 2X1CA 4UVCA 4HNVA 4L5IA 3DKXA 2VI6A 5GPCA 3PIPF 2STWA 1X1AA 3F22A 2IGMA 2Y30A 3WGIA 4DOZA 4DYRA 4XLPF 5B66C 3F23A 1VNDA 3L2VA 3RYRA 3GTOJ 2WC2A 4L9JA 3G71I 2EILH 3WU1B 2VE9A 5TISC 4XSXF 2PJPA 1SFOJ 2M4KA 4ZYDA 4M6VA 2O9LA 3DTIA 3ZR8X 4R79A 3GFJA 4KICA 3OYFA 4AVZA 1BC8C 1HKTA 3BG3A 1IN4A 1XN7A 4G9YA 1AU7A 3OR1C 2L9VA 4JK1X 1X3ZB 5H6QA 4LIUA 3C2BA 3BWGA 3QYFA 4F3QA 3NAUA 1F4KA 3KZZA 2O3FA 2DFFA 4RB0A 4Y3OA 2R7WA 2QLZA 1NG6A 1ZARA 1YIOA 4N0BA 2O0YA 2GIVA 3HGGA 3SYTA 2OBPA 4D7MA 2E2IJ 3OSFA 1PVEA 1W0TA 2ID3A 4BDYA 2VODA 2IGNA 3E5XA 4X0GA 4G8XA 1XGOA 2BV6A 4BHBA 1LPQA 6PAXA 4EVIA 3JSPA 1V5GA 4A0XA 2WWYA 4WXCA 5FLXK 2DDBA 1R36A 5KK1A 2BOLA 4BDZA 3TKYA 4A3KJ 5EEGA 3CJQB 1FX7A 5FKOA 1LJ9A 3BTLA 4IHTA 4XN0A 5GAEJ 4NUBA 2QZ8A 4C2MJ 1LUJB 3WTYC 1P9QC 5DCFA 1OR7C 1W0UA 2EIJH 2E1OA 1SFXA 2NVXJ 1Z6RA 1S9HA 2GOXB 2KIMA 2QQ9A 3HC7A 4A3IJ 3IV5A 2GA2A 1G59A 2I10A 2BXYA 2HYJA 2LKPA 3BQYA 4HW0A 3LQQA 4UVAA 4D0PA 1PDNC 1UAAA 1Z3YA 1LQ1A 5E8GA 2VQGA 3LSGA 1FYKA 3MWMA 2AHQA 3DBRB 2NVQJ 2X1DA 1BI1A 3RKQA 4C9YA 4HNUA 4B4CA 2GXAA 4CCJA 1IRGA 1WJFA 1T98A 1DGWY 3JAMZ 1MJ9A 4ESBA 4ENKA 1HW5A 4BY1J 4AUXA 2WY8Q 1UHWA 2VN2A 5HVQC 3DPLC 2KDZA 4XKWA 2EZHA 4DNCA 4AIJA 1AWCA 4C2UA 3K4JA 4W97A 1E2XA 5FKKA 4L18B 2DAOA 5HDNA 2LDUA 3CZ6A 3ZN0A 2CQ7A 1FMVA 3H9GA 5K1YA 4I76A 4II3A 1XGSA 2H6BA 3OYNA 3L09A 3BR2A 3R4KA 5EJCA 2BE5F 4Z6YA 2D1HA 2LNBA 5IPAA 2NOJB 1ZLKA 1OCPA 2WTEA 4GRIA 2E5NA 3E97A 2K7LA 2LMDA 2PQ8A 4G7ZF 2XROA 3DCFA 4A12A 4D7NA 3WTZA 3VYRB 1BR2A 1KONA 4FE4A 3CO7C 2ZMEA 4XLNF 4XIDA 1AKHB 2A5YB 2XUBA 3BG6A 3X2QH 1FYLA 2HDDA 4JYKA 4XRFA 4Y7NJ 3IAS2 2R7OA 2OD5A 3PO2J 2E7WA 5ICFA 4YIRX 4HX7A 4ENNA 4C3HJ 4OIRF 1DPRA 2HFHA 4G6DA 2LF8A 1GV5A 1O57A 4M74A 1W5TA 1OCZH 2GIZA 2CUZA 5IT3A 5ERIA 4C2TA 2YSRA 3DP7A 5LFAA 2M8EA 4JX6A 4IXAA 1HA8A 5DEQA 4JX5A 3FHNA 4CCMA 2K9QA 2D1VA 3I4NJ 2IS6A 4UV8A 1MIJA 2XAFA 4NB5A 1T39A 5F08A 2ZXHA 4CUGA 1FEXA 2BGCA 1N78A 1RPWA 2R7QA 5D5UB 3K4CA 4KN4X 2DA6A 1FP2A 2CJJA 4ZYHA 5ILSA 4WK8F 4YFXF 1ETWA 2L9SA 2ZFWA 1FTTA 3CF5F 2KIUA 5HOOA 4MQVA 4P5OA 1SEUA 4RMNA 3K1MA 2R5YA 1O7LA 3BLYA 1Z77A 4IX7A 2RNGA 3BJ6A 2ISZA 1P4AA 1R1UA 2MFZA 2P6SA 3KP3A 5HLIA 2JA7J 2RC4A 3ZQGA 4WWCA 1A36A 2ME0A 3GFLA 1H9TA 5C4JJ 2KL4A 2DA5A 1UJ8A 2DDAA 2VBXA 4AVPA 4WXDA 4C3JJ 1MJBA 2Y69H 4BE0A 3NQOA 4QPQA 3H0DA 4A3CJ 3Q0VA 2A61A 3KFWX 2RQPA 4E7IA 5FJ8J 2HYFA 3G1MA 1JT0A 3TW7A 5ILVA 1TP4A 2MBFA 2W7NA 2FMLA 4BJ5C 3IRQA 2K3FA 3OY9A 2LF7A 1TNSA 1ZAOA 3N97A 1D8JA 5EZGA 1CF7A 2JN6A 3BPVA 5FGMA 5F27A 4RGUA 3OOUA 5DDGA 3LWFA 5KAIC 4M73A 3BQZA 1B4AA 2HZDA 3KP5A 4RGRA 2CG4A 2M8GX 3BT9A 3PUFA 3LSTA 3OYGA 3JRCA 3CESA 2JA8J 3RDIA 4M3FA 3H3ZA 4UUTA 4ZZDA 3WTUC 1OMIA 3ZXSA 4RB1A 2EWNA 2EFWA 3H35A 3EPZA 3R6SA 2MG4A 1WJDA 4CHUA 1X3UA 3TEDA 3V4GA 4B3XA 1APLC 2GA1A 4X1EA 4CCNA 2QBYB 1GLNA 1WGXA 4NC6A 5LBQA 5A2QZ 5DV5A 4NC8A 4O5VA 1Z67A 2DA1A 1T0FA 4I7HA 4AYBN 3W2WA 1W36C 1YITI 3BPXA 1IV8A 3QPHA 1DPUA 1WH7A 3IRRA 1YRNB 4NC7A 2ZNYA 5FD6A 3M8EA 3HRMA 3PSFA 4XKCA 1A6QA 2L01A 2H8RA 2XSJC 1RETA 4KIFA 3WODF 1B59A 3I9V2 3VPRA 4MNUA 3I54A 3H9JA 4RAFA 4M9ZA 4XONA 3ECHA 4L9TA 2D5VA 2M1BA 2W25A 1BA5A 1K78B 4IHXA 2KT0A 2X51A 4AYBA 1EJ9A 1MH3A 4KA4A 4A3JJ 3HEFA 1WSUA 2GZWA 3CJTB 3KYLA 4A93J 1J09A 4FT8A 4GYGA 3EQLF 1R00A 3GCMA 2DA3A 5M3MJ 1K4SA 3GTKJ 2LBFA 4ZDPA 2CW0F 1S3JA 4IRGA 3I3LA 2C6YA 4ZTJA 5FB2A 3CUQC 2RQQA 1XG1A 3Q0UA 5J3LA 1ETXA 1WWXA 2CO5A 3ASNH 1BI2A 3HOXJ 4WF2A 3WHBA 3QAHA 4EM2A 3C1DA 4MTEA 4LLNA 4IO9F 2DMPA 1FC3A 3KYCB 4MO7A 3ZMZA 2K9LA 1ZR2A 3RJPA 2MD5A 3PIOF 3OMYA 4BQNA 2LKXA 1K7AA 4UV9A 2BW3A 3HIFA 1IC8A 5K5QA 1XCVA 1XDUA 5KVRA 3JRHA 3ZQLA 5E20A 2ELKA 3TDUC 1WH5A 2HYGD 3BY6A 3TOBA 3BG5A 5HS7A 1FMWA 3IC7A 1MBHA 1BC7C 3SFIA 2DMNA 5DD4A 1QPMA 4QPOA 5LHHA 1JGGA 1ETKA 1U6GA 3I4PA 3S32A 2IA2A 3BG9A 1ZREA 1LDDA 1DU6A 2D2WA 2V4JC 2K40A 3K4KA 1LEBA 5H6RA 2R7UA 1Y8RB 1FLIA 1A6IA 1FBUA 2JK3A 4U88A 3J7YJ 4IL6C 2OQRA 3H92A 2LP0A 4CGZA 4EJOA 2N8GA 2TDXA 2JWTA 3A0HC 3LA7A 3T8RA 2R7XA
chains in the Genus database with same CATH topology
3HSEA 3H3UA 4K2EA 1JE8A 3E6DA 3ZP5A 3R61A 2IVMA 3C7JA 2Q2EA 2KRFA 1PP7U 5TRDA 1YLFA 5JI6A 3O2PE 1XMKA 3F6OA 1XD7A 1P6RA 3Q9VA 1R1VA 3T0YA 2XVCA 3SHFA 1W7PD 1SD5A 5LGUA 1RNLA 2G7UA 2QQBA 3ECOA 5D4RA 2E7XA 2L54A 2DPDA 2M30A 1O7FA 1V3FA 4KMUX 2KJCA 5F6FA 2PLYA 1PUEE 4E70A 4UNOA 2VOOA 1IW7F 2OA4A 4TV7A 4KIBA 1FWZA 4CDGA 2O61A 2BBYA 4A6DA 2EFQA 1TW3A 1IZ1A 3Q5FA 2V6CA 2ZCWA 2HS5A 2FU4A 3KP4A 1A04A 1KGSA 1USSA 4DQ2A 2QYOA 4YIFA 4U0VA 2YX7A 4BAYA 1TQIA 4L5JA 4LFUA 2QM3A 4MGRA 3DKWA 2P7CB 1YS7A 3TQNA 2P7VB 2HDCA 1B1BA 3F8CA 1G3YA 3NEUA 1HKSA 4RGSA 4EJTA 2MA3A 1GXQA 3MEXA 2G7HA 1ZYRF 1K79A 5D8KB 2MLKA 2DK8A 2VBWA 2KJBA 3RKWA 3VOEA 1YFHA 2A6HF 1LEAA 5D5XB 2EV6A 3V7SA 5ICGA 1FP1D 4B09A 3QOPA 3O3KA 1YO5C 2D45A 1OYWA 5E1XA 3HRTA 3P9CA 3GFMA 4BYYA 2HQRA 2ZO4A 4HYEA 1KQ0A 5ED4A 4P96A 1R7JA 3BZ6A 4G7HF 2HWVA 1GVJA 2HTJA 3KZYA 2JTVA 4HQEA 3ZMTA 3U9GA 3ROUA 1ON2A 2RDPA 4AIKA 1FSHA 2FE3A 1WRJA 3T5XA 1OYIA 3HSRA 3COAC 4I01A 3M7GA 3L7WA 3KP7A 5H20A 3HHGA 5J6XA 3RPQA 2VT2A 3FXRA 3HYIA 2ZMEB 5LHGA 3FXUA 4Q4ZF 3HOSA 3E6CC 2HTSA 3ULQB 4HF2A 2FSWA 1XGNA 1O3SA 5L3FA 3WTSC 4L0YB 1W7PA 4WX9A 1TTYA 5BOXA 1BJAA 3ELKA 3R60A 3WTTC 3FMSA 3HRUA 4UHTA 2F5EA 4HX8A 1ON1A 1RUOA 4L0ZB 1P92A 2G9WA 4LK0F 3D0SA 3OV8A 4S05A 1T2KA 3BJAA 1R1TA 4LGWA 1ZRCA 2IRFG 3SXYA 3V8JA 4HOBA 1UB9A 3WG9A 2EK5A 1QNTA 3GVAA 3GX4X 4CICA 2FBKA 2Y0MA 1OR7A 2K27A 2L02A 4WCGA 5TJJA 1SAXA 5L3GA 2Q0OA 2HR3A 3U2RA 3DV8A 2Y75A 3TGNA 3F8MA 1BI0A 2MH9A 4ZZLA 3P9KA 1LB2A 4A0ZA 3F6VA 1XB4A 2XAQA 3J7AO 5BMZA 2VONA 3GZ5A 2A68F 2DQLA 2DU9A 3O6BB 2Q8KA 4A5NA 1YTYA 5D6FA 3GF2A 3T1BA 5CVIA 3K9TA 1Z05A 1KU3A 1J5YA 2EA4A 2FRHA 3RIRA 3JTGA 2FNPA 1YQAA 4BHCA 4OMYA 2M5WA 3SZPA 3ZMDA 4QWQA 1W5SA 5E8IA 1ZHFA 2NAZA 1J59A 5IT9K 4NHJA 3TDZC 1FYMA 4JQFA 1U8RA 2VE8A 4IJAA 1S7OA 4OMZA 1IUYA 4LB6B 4O6JA 5L3EA 1F1ZA 5J8FA 2ZXJA 2V79A 3FF5A 2NNYA 2HKXA 4HX4A 4N9IA 1BOAA 4JBAA 2CSOA 1DUXC 4YFKF 3KETA 3R0AA 3M9AA 3CLOA 3MAJA 1LNWA 2IT0A 3HOTA 4ESFA 3WE3A 2OZ6A 5EEHA 4B8XA 5LEJA 3K69A 1IXCA 2XKOA 5LLQA 1Z7UA 1REPC 2X0LA 4Y13A 5HS9A 1U2WA 3D5LA 5LRRA 2Y48A 3I59A 2BEOA 3FZVA 2DQRA 3CTAA 2STTA 1XSVA 4PCQA 2EV0A 4KMFA 5ICCA 1FT9A 2QQAA 2VBYA 1S29A 4M6XA 2IPQX 3K1PA 2YX4A 2QBYA 1ZG3A 4N9HA 1I27A 5HS8A 1BI3A 4Q47A 1IRFA 2LSOA 1ZG1A 4OINF 2MH2A 5BPIA 4LD5A 1H0MA 2RNJA 3LFKA 2DLLA 4ZYEA 1LVAA 3EDPA 1FSEA 3GFIA 3PFIA 3GW2A 1J2XA 2GQQA 1U5TC 2L4AA 1K6OA 1KU9A 1SD6A 3FMQA 4LG0A 4YG2F 4U0YA 4IPAA 4OIOF 3TO9A 2EFOA 3GUDA 3ABUA 2KKOA 4RAZA 2NS0A 3GO5A 1EH6A 2EV5A 4BNCA 1LDJA 2EFNA 3FX3A 4HDUA 2E1NA 2YU3A 5HDGA 2YR2A 5FFXA 1OYYA 5L3BA 1MJAA 4KDPA 2E1CA 1FNNA 4LJZF 5BPDA 2YPRA 1XDSA 1RZ4A 3K1NA 4ON0A 1IN6A 1ZGAA 1U5TB 5ILUA 3B02A 4CO8A 4I2OA 1YW9A 2FMYA 5D5WB 2H94A 1F5TA 1JXSA 3IKVA 1GXPA 2XGXA 1KQ8A 1Q1HA 1TW2A 1WKMA 4ZYGA 4U7DA 4PDKA 2ADUA 2FQ3A 3MQ0A 5CVRA 2IW5A 2ACJA 1RI7A 2ISYA 1S6LA 1XMAA 5LRSA 1P4XA 1T38A 4Q5SF 4BH9A 3IWZA 3J80K 2KIFA 4QLCU 2NRAC 4BQAA 1P2FA 3EYIA 2DO7A 5LGNA 4EV0A 2F5CA 1VTNC 3KEOA 1HSJA 4GGGA 3WGHA 3IL2A 3F21A 2XHKA 1R58A 2A69F 1V4RA 1U3EM 4HQMA 2DW4A 1HSTA 3BDDA 1XGMA 2UWMA 2V1XA 2CGPA 2PEXA 1FBSA 4AD9A 1G3WA 1HQCA 2VOPA 3F8BA 4EJVA 4GXOA 3KLNA 5AIQA 5ICEA 3I0TA 2CFXA 3GXOA 4HAMA 2O03A 4CZZA 1S8NA 3HSFA 1IXRC 2X4HA 5IT9Z 3ZMUA 3DPTA 1D5VA 3E6BA 2P5KA 4CYDA 2CYYA 3JW4A 3SQNA 1YS6A 4P9FA 4RS8A 5E1ZB 5DD8A 2HZTA 4MTDA 2F5DA 4OU0A 1U78A 4LK1F 4UXNA 3QP6A 5CJ9A 1UCRA 4I0AA 1I6XA 4I02A 3E6MA 3EETA 3K0LA 3REOA 2ESHA 1O3QA 3I71A 5LGTA 3ZMSA 3C3WA 4RAYA 1HW1A 2UXNA 2W24A 4L9NA 3WTWC 4XBFA 3R0JA 2RV8A 5D4SA 2IJLA 2GWRA 1MDMB 2JZYA 3F3XA 2P4WA 3RYPA 3VEPA 3E5QA 3W6KB 3G3ZA 2GAUA 1ZG5A 1ONVA 3EUHA 2BYVE 2Z99A 4ETSA 5HLHA 4HF1A 2P5VA 2QVOA 2L3DA 4KNYA 1ZH5A 2OU2A 1CGPA 3SZTA 4LB5A 1F9NA 2Z5UA 1YG2A 1L3LA 2PMHA 2UXXA 4ESJA 4G6QA 3L9FA 4KN7X 2RN7A 2V9VA 1AOYA 5A2QK 2XASA 3ISPA 1H9GA 2W84A 1KU2A 1W7PB 4RGXA 3MZYA 1G3SA 4ENMA 3VODA 1QZYA 4U0WA 1JHHA 3P7NA 4LLGF 2K86A 4RB3C 1YW7A 2EA2A 1E17A 3LQRA 3E5UA 1ZLJA 3LAPA 3HTUA 3ERED 2QUFA 2JRTA 3KP2A 1QGPA 1SD4A 2PG4A 3ZN1A 2JPBA 4U7BA 4MEXF 4HBLA 3J80Z 4KIGA 3RKYA 2DK5A 3AAFA 1B6AA 3GZ6A 3U1DA 3WE2A 1KYZA 4GCVA 2M87A 3GWZA 3WTXC 2NYXA 3ML6A 3N4MA 3KCCA 5DUKA 3KEQA 2IA0A 4MEYF 1G3TA 3K2ZA 4IVNA 3QU3A 4PZJA 5LHIA 4FX0A 1XSDA 4MQ9F 1OKRA 1IN5A 1ULYA 3RPUA 2V1UA 4EM1A 3J81Z 4A0YA 2H27A 2F5FA 5JHUA 5F64A 2FXAA 4Z2YA 4MHGA 5AONA 1B9MA 1Y0UA 5K5RA 3PQJA 3B73A 1SFUA 5CVVA 3BOQA 3VFZA 1O3RA 4WXHA 1L0OC 4LLLA 3QRFF 1JHFA 4P9UA 3GLXA 1ZRFA 5CYVA 3F8NA 1ZGJA 1BM9A 2ZKZA 1KA8A 3DFGA 3CDHA 5JVTA 2XIGA 4EJUA 1IN8A 2RVCA 2XAJA 1YYVA 1B9NA 3QPTA 4EM0B 2HOEA 4GYIA 1ZRDA 1J9IA 5DYMA 1QBJA 1GHCA 1XCBA 1D3YA 2OAZA 5CVJA 1Z9CA 2QWWA 3DF8A 1UHMA 2GXBA 2Z3YA 4HLYA 1J7KA 4ASNA 1HKQA 4L9VA 1CF7B 1KQ9A 4I98B 5CVUA 5BQTA 2O8XA 3G73A 1EH7A 1J0RA 5LEKA 1Z1DA 3FWEA 2B0LA 2DTRA 3ZPLA 2XKPA 4GO1A 3I64A 4I09A 5FO5A 5E18F 4FX4A 2L4MA 1MDMA 3ZQ7A 4S04A 2IP2A 1WQ2A 3CO6C 2HKOA 5BS6A 3I53A 2EB7A 1MD0A 2DI3A 1G6NA 1KU7A 2RGVA 2MC3A 3OOPA 4BHPA 5FLXZ 2JPCA 3HHHA 3WGGA 2PFBA 4EGZA 2Z33A 4AIHA 1IXSB 1T6SA 3Q9SA 2J5PA 1RIOH 2A3SA 3L00A 3KE2A 4LG0B 2ZJ2A 4HDVA 1BN5A 1HXDA 1QO0D 1BBYA 3V8KA 2H09A 4P55A 2XRNA 4PGGA 2PMUA 3IWFA 2P8TA 2K4JA 1R23A 1PP8F 4KFCA 1ZN2A 3TO6A 1RUNA 4Q48A 2AXLA 3DEUA 5FD5A 2R7DA 4R8HA 3FHZA 4XSZF 3FMRA 3CJNA 3FM5A 1DDNA 2J5OA 3V8LA 1K78A 2FA5A 3CUOA 1I5ZA 4IRIA 1S7AA 5E1WA 4M9SA 2Z9OA 3I59B 1EH8A 3LA3A 3C18A 1SMTA 2DPUA 4FHTA 1JGSA 2XV4S 2A6EF 2FEZA 2K02A 3F72A 2EJRA 4IHSA 1TNTA 3ABTA 3DXJF 1HBXG 2OQGA 4A5MA 5F1RA 1Z6TA 2ZNZA 4EGYA 2NNNA 2O6GE 2PI0A 3I58A 4A6EA 5DCMA 1I1SA 1P4WA 4KT5C 3M1EA 2P5LC 3VB2A 2JSCA 3BP8A 2GXGA 2RKHA 4Y17A 5DUIA 4H0EA 1IF1A 3S2WA 2UZKA 1EV7A 3F8FA 2FOKA 1R5HA 1MGTA 3GYHX 3CUQB 2MLGA 1DP7P 3DQVC 1IAWA 3JAMK 3FM3A 5E17F 3PQKA 2COMA 2W57A 4M9XA 1MKMA 1LDKB 4KUMA 3GEZA 3IKTA 3MFKA 2CWEA 1TBXA 1NHAA 3KLOA 1IN7A 4EMSA 2VC1A 3WTVC 3ZMVA 4F7ZA 1KYWA 1QQIA 1C0WA 5HLGA 5CLSA 4CXFA 3LA2A 3QU6A 2VXZA 2ZBKA 5DCMB 5JR3A 2F2EA 4KYWA 1UFMA 2QENA 2DBBA 4A2UA 1STZA 5FFZA 5D8LB 5HDKA 5JFRA 1R5GA 1SD7A 1FZPB 3J81K 2ETHA 3BROA 1O3TA 3BJOA 1OPCA 3SFZA 4UVBA 2PBIA 3HTSB 3T8TA 3CUQA 1ODDA 2VC0A 4IRHA 4Y15A 2P6TA 4I0BA 4IF4A 4R1HA 4HLXA 1QZZA 2EFPA 3TOAA 3M8FA 2HEOA 3RI4A 3MZHA 1R22A 3V7RA 2K4BA 3LAJA 3WU0A 1D8KA 3HUGA 2VBZA 3V7CA 4OIQF 3KP6A 4YFNF 2FNAA 4M72A 2ELHA 4EJWA 1W4MA 2AS5F 4ENJA 1BIAA 4RB2C 3JSOA 2IA1A 5J8CA 2FBHA 1WI9A 4O3MA 1USTA 4AWXB 5AIPA 3FXQA 2A07F 1FOKA 1G4DA 4LMYA 2VT3A 4UUVA 3W6JB 2M45A 1YW8A 2W85A 3E3VA 2JT1A 5L3CA 5D5VB 4HZFA 1XSXA 2DT5A 2R3SA 3MCZA 1TLHB 3TO7A 2V1DA 2CQKA 2H6CA 4BXUA 3JTHA 1U5TA 4NQWA 4M6YA 2ESNA 4G7OF 3HRSA 1BIBA 1J75A 1FBQA 2PN6A 2HQNA 2R7FA 3NRVA 4PGHA 4M71A 3L2CA 1SMYF 3I5UA 1FPQA 2DFIA 4G94A 3QP5A 2FBIA 4EQQA 4HV6A 5L3DA 5D6EA 1I1GA 1TQMA 2FF4A 2XAGA 1SFEA 3RKXA 2WV0A 2XAHA 4HV5A 3P9IA 1FY7A 1Z91A 3IHUA 1MZBA 2HGCA 4HA8A 4ZH4F 4OOIA 1TQPA 1HW2A 3RTRA 4HF0A 5K5OA 4YIIA 3EYYA 2OZUA 4UVCA 4L5IA 2STWA 3F22A 3WGIA 4XLPF 3F23A 3RYRA 2WC2A 4L9JA 2VE9A 3WU1B 4XSXF 2PJPA 4ZYDA 4R79A 3GFJA 4KICA 1BC8C 1HKTA 1IN4A 1XN7A 4G9YA 4JK1X 5H6QA 3BWGA 1F4KA 3KZZA 2O3FA 4RB0A 2QLZA 1ZARA 1YIOA 4N0BA 2O0YA 2GIVA 2OBPA 2VODA 3E5XA 4G8XA 1XGOA 2BV6A 4BHBA 6PAXA 5FLXK 4EVIA 3JSPA 4A0XA 2WWYA 4WXCA 1R36A 5KK1A 3TKYA 5EEGA 1FX7A 1LJ9A 4IHTA 2QZ8A 3WTYC 5DCFA 1SFXA 1Z6RA 2KIMA 2QQ9A 2GA2A 2LKPA 4OIPF 4UVAA 4HW0A 3LQQA 4D0PA 1PDNC 1LQ1A 5E8GA 1FYKA 3MWMA 1BI1A 1IRGA 1T98A 3JAMZ 1MJ9A 4ESBA 4ENKA 1HW5A 1UHWA 2VN2A 5HVQC 3DPLC 1AWCA 4DNCA 4AIJA 4L18B 1E2XA 2DAOA 5HDNA 2LDUA 3ZN0A 5K1YA 1XGSA 2H6BA 3L09A 3R4KA 2BE5F 2D1HA 2LNBA 1ZLKA 2WTEA 3E97A 2K7LA 2PQ8A 4G7ZF 2XROA 4A12A 3WTZA 3CO7C 2ZMEA 4XLNF 2A5YB 2XUBA 1FYLA 4XRFA 2OD5A 2E7WA 5ICFA 4HX7A 4ENNA 4OIRF 1DPRA 2HFHA 4G6DA 2LF8A 1O57A 4M74A 1W5TA 5IT3A 5ERIA 2YSRA 3DP7A 2M8EA 4IXAA 5DEQA 2D1VA 4UV8A 2XAFA 4NB5A 1T39A 2BGCA 5D5UB 4KN4X 1FP2A 4ZYHA 5ILSA 4WK8F 4YFXF 2ZFWA 2KIUA 5HOOA 4MQVA 4P5OA 3K1MA 1O7LA 3BJ6A 2ISZA 1P4AA 1R1UA 2P6SA 3KP3A 5HLIA 2RC4A 4WWCA 3GFLA 1H9TA 4AVPA 2VBXA 4WXDA 1MJBA 3NQOA 2A61A 3KFWX 2RQPA 2HYFA 5ILVA 2MBFA 2FMLA 3IRQA 2LF7A 1TNSA 1ZAOA 3N97A 1D8JA 1CF7A 5FGMA 3BPVA 4RGUA 5DDGA 3LWFA 4M73A 1B4AA 3KP5A 4RGRA 2CG4A 3LSTA 3RDIA 3H3ZA 4ZZDA 3WTUC 1OMIA 4RB1A 2EWNA 2EFWA 3R6SA 4CHUA 1X3UA 3V4GA 2GA1A 2QBYB 5LBQA 5A2QZ 5DV5A 4O5VA 1T0FA 4I7HA 3BPXA 3QPHA 1DPUA 3IRRA 2ZNYA 5FD6A 3M8EA 3HRMA 2L01A 4KIFA 3WODF 1B59A 4MNUA 3I54A 4M9ZA 3ECHA 4L9TA 2M1BA 2W25A 1K78B 4KA4A 1WSUA 2GZWA 4FT8A 4GYGA 3EQLF 1R00A 2CW0F 1S3JA 4IRGA 2C6YA 5FB2A 3CUQC 1WWXA 2CO5A 1BI2A 4WF2A 3QAHA 4EM2A 3C1DA 4MTEA 4LLNA 1FC3A 3ZMZA 3RJPA 2MD5A 1K7AA 4UV9A 3HIFA 5K5QA 1XCVA 1XDUA 5KVRA 5E20A 3TDUC 2HYGD 3BY6A 3TOBA 5HS7A 3IC7A 1BC7C 5DD4A 1QPMA 5LHHA 1U6GA 3I4PA 2IA2A 1ZREA 1LDDA 2D2WA 1LEBA 5H6RA 1FLIA 1FBUA 4U88A 2OQRA 3H92A 4CGZA 4EJOA 2TDXA 3LA7A 3T8RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HSE A;  3H3U A;  4K2E A;  1JE8 A;  3E6D A;  3ZP5 A;  3R61 A;  2IVM A;  3C7J A;  2Q2E A;  2KRF A;  1PP7 U;  5TRD A;  1YLF A;  5JI6 A;  3O2P E;  1XMK A;  3F6O A;  1XD7 A;  1P6R A;  3Q9V A;  1R1V A;  3T0Y A;  2XVC A;  3SHF A;  1W7P D;  1SD5 A;  5LGU A;  1RNL A;  2G7U A;  2QQB A;  3ECO A;  5D4R A;  2E7X A;  2L54 A;  2DPD A;  2M30 A;  1O7F A;  1V3F A;  4KMU X;  2KJC A;  5F6F A;  2PLY A;  1PUE E;  4E70 A;  4UNO A;  2VOO A;  1IW7 F;  2OA4 A;  4TV7 A;  4KIB A;  1FWZ A;  4CDG A;  2O61 A;  2BBY A;  4A6D A;  2EFQ A;  1TW3 A;  1IZ1 A;  3Q5F A;  2V6C A;  2ZCW A;  2HS5 A;  2FU4 A;  3KP4 A;  1A04 A;  1KGS A;  1USS A;  4DQ2 A;  2QYO A;  4YIF A;  4U0V A;  2YX7 A;  4BAY A;  1TQI A;  4L5J A;  4LFU A;  2QM3 A;  4MGR A;  3DKW A;  2P7C B;  1YS7 A;  3TQN A;  2P7V B;  2HDC A;  1B1B A;  3F8C A;  1G3Y A;  3NEU A;  1HKS A;  4RGS A;  4EJT A;  2MA3 A;  1GXQ A;  3MEX A;  2G7H A;  1ZYR F;  1K79 A;  5D8K B;  2MLK A;  2DK8 A;  2VBW A;  2KJB A;  3RKW A;  3VOE A;  1YFH A;  2A6H F;  1LEA A;  5D5X B;  2EV6 A;  3V7S A;  5ICG A;  1FP1 D;  4B09 A;  3QOP A;  3O3K A;  1YO5 C;  2D45 A;  1OYW A;  5E1X A;  3HRT A;  3P9C A;  3GFM A;  4BYY A;  2HQR A;  2ZO4 A;  4HYE A;  1KQ0 A;  5ED4 A;  4P96 A;  1R7J A;  3BZ6 A;  4G7H F;  2HWV A;  1GVJ A;  2HTJ A;  3KZY A;  2JTV A;  4HQE A;  3ZMT A;  3U9G A;  3ROU A;  1ON2 A;  2RDP A;  4AIK A;  1FSH A;  2FE3 A;  1WRJ A;  3T5X A;  1OYI A;  3HSR A;  3COA C;  4I01 A;  3M7G A;  3L7W A;  3KP7 A;  5H20 A;  3HHG A;  5J6X A;  3RPQ A;  2VT2 A;  3FXR A;  3HYI A;  2ZME B;  5LHG A;  3FXU A;  4Q4Z F;  3HOS A;  3E6C C;  2HTS A;  3ULQ B;  4HF2 A;  2FSW A;  1XGN A;  1O3S A;  5L3F A;  3WTS C;  4L0Y B;  1W7P A;  4WX9 A;  1TTY A;  5BOX A;  1BJA A;  3ELK A;  3R60 A;  3WTT C;  3FMS A;  3HRU A;  4UHT A;  2F5E A;  4HX8 A;  1ON1 A;  1RUO A;  4L0Z B;  1P92 A;  2G9W A;  4LK0 F;  3D0S A;  3OV8 A;  4S05 A;  1T2K A;  3BJA A;  1R1T A;  4LGW A;  1ZRC A;  2IRF G;  3SXY A;  3V8J A;  4HOB A;  1UB9 A;  3WG9 A;  2EK5 A;  1QNT A;  3GVA A;  3GX4 X;  4CIC A;  2FBK A;  2Y0M A;  1OR7 A;  2K27 A;  2L02 A;  4WCG A;  5TJJ A;  1SAX A;  5L3G A;  2Q0O A;  2HR3 A;  3U2R A;  3DV8 A;  2Y75 A;  3TGN A;  3F8M A;  1BI0 A;  2MH9 A;  4ZZL A;  3P9K A;  1LB2 A;  4A0Z A;  3F6V A;  1XB4 A;  2XAQ A;  3J7A O;  5BMZ A;  2VON A;  3GZ5 A;  2A68 F;  2DQL A;  2DU9 A;  3O6B B;  2Q8K A;  4A5N A;  1YTY A;  5D6F A;  3GF2 A;  3T1B A;  5CVI A;  3K9T A;  1Z05 A;  1KU3 A;  1J5Y A;  2EA4 A;  2FRH A;  3RIR A;  3JTG A;  2FNP A;  1YQA A;  4BHC A;  4OMY A;  2M5W A;  3SZP A;  3ZMD A;  4QWQ A;  1W5S A;  5E8I A;  1ZHF A;  2NAZ A;  1J59 A;  5IT9 K;  4NHJ A;  3TDZ C;  1FYM A;  4JQF A;  1U8R A;  2VE8 A;  4IJA A;  1S7O A;  4OMZ A;  1IUY A;  4LB6 B;  4O6J A;  5L3E A;  1F1Z A;  5J8F A;  2ZXJ A;  2V79 A;  3FF5 A;  2NNY A;  2HKX A;  4HX4 A;  4N9I A;  1BOA A;  4JBA A;  2CSO A;  1DUX C;  4YFK F;  3KET A;  3R0A A;  3M9A A;  3CLO A;  3MAJ A;  1LNW A;  2IT0 A;  3HOT A;  4ESF A;  3WE3 A;  2OZ6 A;  5EEH A;  4B8X A;  5LEJ A;  3K69 A;  1IXC A;  2XKO A;  5LLQ A;  1Z7U A;  1REP C;  2X0L A;  4Y13 A;  5HS9 A;  1U2W A;  3D5L A;  5LRR A;  2Y48 A;  3I59 A;  2BEO A;  3FZV A;  2DQR A;  3CTA A;  2STT A;  1XSV A;  4PCQ A;  2EV0 A;  4KMF A;  5ICC A;  1FT9 A;  2QQA A;  2VBY A;  1S29 A;  4M6X A;  2IPQ X;  3K1P A;  2YX4 A;  2QBY A;  1ZG3 A;  4N9H A;  1I27 A;  5HS8 A;  1BI3 A;  4Q47 A;  1IRF A;  2LSO A;  1ZG1 A;  4OIN F;  2MH2 A;  5BPI A;  4LD5 A;  1H0M A;  2RNJ A;  3LFK A;  2DLL A;  4ZYE A;  1LVA A;  3EDP A;  1FSE A;  3GFI A;  3PFI A;  3GW2 A;  1J2X A;  2GQQ A;  1U5T C;  2L4A A;  1K6O A;  1KU9 A;  1SD6 A;  3FMQ A;  4LG0 A;  4YG2 F;  4U0Y A;  4IPA A;  4OIO F;  3TO9 A;  2EFO A;  3GUD A;  3ABU A;  2KKO A;  4RAZ A;  2NS0 A;  3GO5 A;  1EH6 A;  2EV5 A;  4BNC A;  1LDJ A;  2EFN A;  3FX3 A;  4HDU A;  2E1N A;  2YU3 A;  5HDG A;  2YR2 A;  5FFX A;  1OYY A;  5L3B A;  1MJA A;  4KDP A;  2E1C A;  1FNN A;  4LJZ F;  5BPD A;  2YPR A;  1XDS A;  1RZ4 A;  3K1N A;  4ON0 A;  1IN6 A;  1ZGA A;  1U5T B;  5ILU A;  3B02 A;  4CO8 A;  4I2O A;  1YW9 A;  2FMY A;  5D5W B;  2H94 A;  1F5T A;  1JXS A;  3IKV A;  1GXP A;  2XGX A;  1KQ8 A;  1Q1H A;  1TW2 A;  1WKM A;  4ZYG A;  4U7D A;  4PDK A;  2ADU A;  2FQ3 A;  3MQ0 A;  5CVR A;  2IW5 A;  2ACJ A;  1RI7 A;  2ISY A;  1S6L A;  1XMA A;  5LRS A;  1P4X A;  1T38 A;  4Q5S F;  4BH9 A;  3IWZ A;  3J80 K;  2KIF A;  4QLC U;  2NRA C;  4BQA A;  1P2F A;  3EYI A;  2DO7 A;  5LGN A;  4EV0 A;  2F5C A;  1VTN C;  3KEO A;  1HSJ A;  4GGG A;  3WGH A;  3IL2 A;  3F21 A;  2XHK A;  1R58 A;  2A69 F;  1V4R A;  1U3E M;  4HQM A;  2DW4 A;  1HST A;  3BDD A;  1XGM A;  2UWM A;  2V1X A;  2CGP A;  2PEX A;  1FBS A;  4AD9 A;  1G3W A;  1HQC A;  2VOP A;  3F8B A;  4EJV A;  4GXO A;  3KLN A;  5AIQ A;  5ICE A;  3I0T A;  2CFX A;  3GXO A;  4HAM A;  2O03 A;  4CZZ A;  1S8N A;  3HSF A;  1IXR C;  2X4H A;  5IT9 Z;  3ZMU A;  3DPT A;  1D5V A;  3E6B A;  2P5K A;  4CYD A;  2CYY A;  3JW4 A;  3SQN A;  1YS6 A;  4P9F A;  4RS8 A;  5E1Z B;  5DD8 A;  2HZT A;  4MTD A;  2F5D A;  4OU0 A;  1U78 A;  4LK1 F;  4UXN A;  3QP6 A;  5CJ9 A;  1UCR A;  4I0A A;  1I6X A;  4I02 A;  3E6M A;  3EET A;  3K0L A;  3REO A;  2ESH A;  1O3Q A;  3I71 A;  5LGT A;  3ZMS A;  3C3W A;  4RAY A;  1HW1 A;  2UXN A;  2W24 A;  4L9N A;  3WTW C;  4XBF A;  3R0J A;  2RV8 A;  5D4S A;  2IJL A;  2GWR A;  1MDM B;  2JZY A;  3F3X A;  2P4W A;  3RYP A;  3VEP A;  3E5Q A;  3W6K B;  3G3Z A;  2GAU A;  1ZG5 A;  1ONV A;  3EUH A;  2BYV E;  2Z99 A;  4ETS A;  5HLH A;  4HF1 A;  2P5V A;  2QVO A;  2L3D A;  4KNY A;  1ZH5 A;  2OU2 A;  1CGP A;  3SZT A;  4LB5 A;  1F9N A;  2Z5U A;  1YG2 A;  1L3L A;  2PMH A;  2UXX A;  4ESJ A;  4G6Q A;  3L9F A;  4KN7 X;  2RN7 A;  2V9V A;  1AOY A;  5A2Q K;  2XAS A;  3ISP A;  1H9G A;  2W84 A;  1KU2 A;  1W7P B;  4RGX A;  3MZY A;  1G3S A;  4ENM A;  3VOD A;  1QZY A;  4U0W A;  1JHH A;  3P7N A;  4LLG F;  2K86 A;  4RB3 C;  1YW7 A;  2EA2 A;  1E17 A;  3LQR A;  3E5U A;  1ZLJ A;  3LAP A;  3HTU A;  3ERE D;  2QUF A;  2JRT A;  3KP2 A;  1QGP A;  1SD4 A;  2PG4 A;  3ZN1 A;  2JPB A;  4U7B A;  4MEX F;  4HBL A;  3J80 Z;  4KIG A;  3RKY A;  2DK5 A;  3AAF A;  1B6A A;  3GZ6 A;  3U1D A;  3WE2 A;  1KYZ A;  4GCV A;  2M87 A;  3GWZ A;  3WTX C;  2NYX A;  3ML6 A;  3N4M A;  3KCC A;  5DUK A;  3KEQ A;  2IA0 A;  4MEY F;  1G3T A;  3K2Z A;  4IVN A;  3QU3 A;  4PZJ A;  5LHI A;  4FX0 A;  1XSD A;  4MQ9 F;  1OKR A;  1IN5 A;  1ULY A;  3RPU A;  2V1U A;  4EM1 A;  3J81 Z;  4A0Y A;  2H27 A;  2F5F A;  5JHU A;  5F64 A;  2FXA A;  4Z2Y A;  4MHG A;  5AON A;  1B9M A;  1Y0U A;  5K5R A;  3PQJ A;  3B73 A;  1SFU A;  5CVV A;  3BOQ A;  3VFZ A;  1O3R A;  4WXH A;  1L0O C;  4LLL A;  3QRF F;  1JHF A;  4P9U A;  3GLX A;  1ZRF A;  5CYV A;  3F8N A;  1ZGJ A;  1BM9 A;  2ZKZ A;  1KA8 A;  3DFG A;  3CDH A;  5JVT A;  2XIG A;  4EJU A;  1IN8 A;  2RVC A;  2XAJ A;  1YYV A;  1B9N A;  3QPT A;  4EM0 B;  2HOE A;  4GYI A;  1ZRD A;  1J9I A;  5DYM A;  1QBJ A;  1GHC A;  1XCB A;  1D3Y A;  2OAZ A;  5CVJ A;  1Z9C A;  2QWW A;  3DF8 A;  1UHM A;  2GXB A;  2Z3Y A;  4HLY A;  1J7K A;  4ASN A;  1HKQ A;  4L9V A;  1CF7 B;  1KQ9 A;  4I98 B;  5CVU A;  5BQT A;  2O8X A;  3G73 A;  1EH7 A;  1J0R A;  5LEK A;  1Z1D A;  3FWE A;  2B0L A;  2DTR A;  3ZPL A;  2XKP A;  4GO1 A;  3I64 A;  4I09 A;  5FO5 A;  5E18 F;  4FX4 A;  2L4M A;  1MDM A;  3ZQ7 A;  4S04 A;  2IP2 A;  1WQ2 A;  3CO6 C;  2HKO A;  5BS6 A;  3I53 A;  2EB7 A;  1MD0 A;  2DI3 A;  1G6N A;  1KU7 A;  2RGV A;  2MC3 A;  3OOP A;  4BHP A;  5FLX Z;  2JPC A;  3HHH A;  3WGG A;  2PFB A;  4EGZ A;  2Z33 A;  4AIH A;  1IXS B;  1T6S A;  3Q9S A;  2J5P A;  1RIO H;  2A3S A;  3L00 A;  3KE2 A;  4LG0 B;  2ZJ2 A;  4HDV A;  1BN5 A;  1HXD A;  1QO0 D;  1BBY A;  3V8K A;  2H09 A;  4P55 A;  2XRN A;  4PGG A;  2PMU A;  3IWF A;  2P8T A;  2K4J A;  1R23 A;  1PP8 F;  4KFC A;  1ZN2 A;  3TO6 A;  1RUN A;  4Q48 A;  2AXL A;  3DEU A;  5FD5 A;  2R7D A;  4R8H A;  3FHZ A;  4XSZ F;  3FMR A;  3CJN A;  3FM5 A;  1DDN A;  2J5O A;  3V8L A;  1K78 A;  2FA5 A;  3CUO A;  1I5Z A;  4IRI A;  1S7A A;  5E1W A;  4M9S A;  2Z9O A;  3I59 B;  1EH8 A;  3LA3 A;  3C18 A;  1SMT A;  2DPU A;  4FHT A;  1JGS A;  2XV4 S;  2A6E F;  2FEZ A;  2K02 A;  3F72 A;  2EJR A;  4IHS A;  1TNT A;  3ABT A;  3DXJ F;  1HBX G;  2OQG A;  4A5M A;  5F1R A;  1Z6T A;  2ZNZ A;  4EGY A;  2NNN A;  2O6G E;  2PI0 A;  3I58 A;  4A6E A;  5DCM A;  1I1S A;  1P4W A;  4KT5 C;  3M1E A;  2P5L C;  3VB2 A;  2JSC A;  3BP8 A;  2GXG A;  2RKH A;  4Y17 A;  5DUI A;  4H0E A;  1IF1 A;  3S2W A;  2UZK A;  1EV7 A;  3F8F A;  2FOK A;  1R5H A;  1MGT A;  3GYH X;  3CUQ B;  2MLG A;  1DP7 P;  3DQV C;  1IAW A;  3JAM K;  3FM3 A;  5E17 F;  3PQK A;  2COM A;  2W57 A;  4M9X A;  1MKM A;  1LDK B;  4KUM A;  3GEZ A;  3IKT A;  3MFK A;  2CWE A;  1TBX A;  1NHA A;  3KLO A;  1IN7 A;  4EMS A;  2VC1 A;  3WTV C;  3ZMV A;  4F7Z A;  1KYW A;  1QQI A;  1C0W A;  5HLG A;  5CLS A;  4CXF A;  3LA2 A;  3QU6 A;  2VXZ A;  2ZBK A;  5DCM B;  5JR3 A;  2F2E A;  4KYW A;  1UFM A;  2QEN A;  2DBB A;  4A2U A;  1STZ A;  5FFZ A;  5D8L B;  5HDK A;  5JFR A;  1R5G A;  1SD7 A;  1FZP B;  3J81 K;  2ETH A;  3BRO A;  1O3T A;  3BJO A;  1OPC A;  3SFZ A;  4UVB A;  2PBI A;  3HTS B;  3T8T A;  3CUQ A;  1ODD A;  2VC0 A;  4IRH A;  4Y15 A;  2P6T A;  4I0B A;  4IF4 A;  4R1H A;  4HLX A;  1QZZ A;  2EFP A;  3TOA A;  3M8F A;  2HEO A;  3RI4 A;  3MZH A;  1R22 A;  3V7R A;  2K4B A;  3LAJ A;  3WU0 A;  1D8K A;  3HUG A;  2VBZ A;  3V7C A;  4OIQ F;  3KP6 A;  4YFN F;  2FNA A;  4M72 A;  2ELH A;  4EJW A;  1W4M A;  2AS5 F;  4ENJ A;  1BIA A;  4RB2 C;  3JSO A;  2IA1 A;  5J8C A;  2FBH A;  1WI9 A;  4O3M A;  1UST A;  4AWX B;  5AIP A;  3FXQ A;  2A07 F;  1FOK A;  1G4D A;  4LMY A;  2VT3 A;  4UUV A;  3W6J B;  2M45 A;  1YW8 A;  2W85 A;  3E3V A;  2JT1 A;  5L3C A;  5D5V B;  4HZF A;  1XSX A;  2DT5 A;  2R3S A;  3MCZ A;  1TLH B;  3TO7 A;  2V1D A;  2CQK A;  2H6C A;  4BXU A;  3JTH A;  1U5T A;  4NQW A;  4M6Y A;  2ESN A;  4G7O F;  3HRS A;  1BIB A;  1J75 A;  1FBQ A;  2PN6 A;  2HQN A;  2R7F A;  3NRV A;  4PGH A;  4M71 A;  3L2C A;  1SMY F;  3I5U A;  1FPQ A;  2DFI A;  4G94 A;  3QP5 A;  2FBI A;  4EQQ A;  4HV6 A;  5L3D A;  5D6E A;  1I1G A;  1TQM A;  2FF4 A;  2XAG A;  1SFE A;  3RKX A;  2WV0 A;  2XAH A;  4HV5 A;  3P9I A;  1FY7 A;  1Z91 A;  3IHU A;  1MZB A;  2HGC A;  4HA8 A;  4ZH4 F;  4OOI A;  1TQP A;  1HW2 A;  3RTR A;  4HF0 A;  5K5O A;  4YII A;  3EYY A;  2OZU A;  4UVC A;  4L5I A;  2STW A;  3F22 A;  3WGI A;  4XLP F;  3F23 A;  3RYR A;  2WC2 A;  4L9J A;  2VE9 A;  3WU1 B;  4XSX F;  2PJP A;  4ZYD A;  4R79 A;  3GFJ A;  4KIC A;  1BC8 C;  1HKT A;  1IN4 A;  1XN7 A;  4G9Y A;  4JK1 X;  5H6Q A;  3BWG A;  1F4K A;  3KZZ A;  2O3F A;  4RB0 A;  2QLZ A;  1ZAR A;  1YIO A;  4N0B A;  2O0Y A;  2GIV A;  2OBP A;  2VOD A;  3E5X A;  4G8X A;  1XGO A;  2BV6 A;  4BHB A;  6PAX A;  5FLX K;  4EVI A;  3JSP A;  4A0X A;  2WWY A;  4WXC A;  1R36 A;  5KK1 A;  3TKY A;  5EEG A;  1FX7 A;  1LJ9 A;  4IHT A;  2QZ8 A;  3WTY C;  5DCF A;  1SFX A;  1Z6R A;  2KIM A;  2QQ9 A;  2GA2 A;  2LKP A;  4OIP F;  4UVA A;  4HW0 A;  3LQQ A;  4D0P A;  1PDN C;  1LQ1 A;  5E8G A;  1FYK A;  3MWM A;  1BI1 A;  1IRG A;  1T98 A;  3JAM Z;  1MJ9 A;  4ESB A;  4ENK A;  1HW5 A;  1UHW A;  2VN2 A;  5HVQ C;  3DPL C;  1AWC A;  4DNC A;  4AIJ A;  4L18 B;  1E2X A;  2DAO A;  5HDN A;  2LDU A;  3ZN0 A;  5K1Y A;  1XGS A;  2H6B A;  3L09 A;  3R4K A;  2BE5 F;  2D1H A;  2LNB A;  1ZLK A;  2WTE A;  3E97 A;  2K7L A;  2PQ8 A;  4G7Z F;  2XRO A;  4A12 A;  3WTZ A;  3CO7 C;  2ZME A;  4XLN F;  2A5Y B;  2XUB A;  1FYL A;  4XRF A;  2OD5 A;  2E7W A;  5ICF A;  4HX7 A;  4ENN A;  4OIR F;  1DPR A;  2HFH A;  4G6D A;  2LF8 A;  1O57 A;  4M74 A;  1W5T A;  5IT3 A;  5ERI A;  2YSR A;  3DP7 A;  2M8E A;  4IXA A;  5DEQ A;  2D1V A;  4UV8 A;  2XAF A;  4NB5 A;  1T39 A;  2BGC A;  5D5U B;  4KN4 X;  1FP2 A;  4ZYH A;  5ILS A;  4WK8 F;  4YFX F;  2ZFW A;  2KIU A;  5HOO A;  4MQV A;  4P5O A;  3K1M A;  1O7L A;  3BJ6 A;  2ISZ A;  1P4A A;  1R1U A;  2P6S A;  3KP3 A;  5HLI A;  2RC4 A;  4WWC A;  3GFL A;  1H9T A;  4AVP A;  2VBX A;  4WXD A;  1MJB A;  3NQO A;  2A61 A;  3KFW X;  2RQP A;  2HYF A;  5ILV A;  2MBF A;  2FML A;  3IRQ A;  2LF7 A;  1TNS A;  1ZAO A;  3N97 A;  1D8J A;  1CF7 A;  5FGM A;  3BPV A;  4RGU A;  5DDG A;  3LWF A;  4M73 A;  1B4A A;  3KP5 A;  4RGR A;  2CG4 A;  3LST A;  3RDI A;  3H3Z A;  4ZZD A;  3WTU C;  1OMI A;  4RB1 A;  2EWN A;  2EFW A;  3R6S A;  4CHU A;  1X3U A;  3V4G A;  2GA1 A;  2QBY B;  5LBQ A;  5A2Q Z;  5DV5 A;  4O5V A;  1T0F A;  4I7H A;  3BPX A;  3QPH A;  1DPU A;  3IRR A;  2ZNY A;  5FD6 A;  3M8E A;  3HRM A;  2L01 A;  4KIF A;  3WOD F;  1B59 A;  4MNU A;  3I54 A;  4M9Z A;  3ECH A;  4L9T A;  2M1B A;  2W25 A;  1K78 B;  4KA4 A;  1WSU A;  2GZW A;  4FT8 A;  4GYG A;  3EQL F;  1R00 A;  2CW0 F;  1S3J A;  4IRG A;  2C6Y A;  5FB2 A;  3CUQ C;  1WWX A;  2CO5 A;  1BI2 A;  4WF2 A;  3QAH A;  4EM2 A;  3C1D A;  4MTE A;  4LLN A;  1FC3 A;  3ZMZ A;  3RJP A;  2MD5 A;  1K7A A;  4UV9 A;  3HIF A;  5K5Q A;  1XCV A;  1XDU A;  5KVR A;  5E20 A;  3TDU C;  2HYG D;  3BY6 A;  3TOB A;  5HS7 A;  3IC7 A;  1BC7 C;  5DD4 A;  1QPM A;  5LHH A;  1U6G A;  3I4P A;  2IA2 A;  1ZRE A;  1LDD A;  2D2W A;  1LEB A;  5H6R A;  1FLI A;  1FBU A;  4U88 A;  2OQR A;  3H92 A;  4CGZ A;  4EJO A;  2TDX A;  3LA7 A;  3T8R A; 
#chains in the Genus database with same CATH topology
 1S5L C;  3HSE A;  3H3U A;  4K2E A;  1JE8 A;  2VXD A;  3E6D A;  3ZP5 A;  1B8I A;  3R61 A;  2IVM A;  3C7J A;  2Q2E A;  2KRF A;  2M0C A;  1IRX A;  2WY7 Q;  1PP7 U;  2EQR A;  5TRD A;  1JKP C;  1YLF A;  5JI6 A;  3O2P E;  1XMK A;  3AL0 C;  3M07 A;  3F6O A;  1XD7 A;  3SEZ A;  1P6R A;  3Q9V A;  1R1V A;  3T0Y A;  2XVC A;  3PUB A;  1H88 C;  1R49 A;  3SHF A;  1W7P D;  1SD5 A;  2L7K A;  5LGU A;  2LR8 A;  1CQT A;  1T8I A;  1RNL A;  2VIX A;  2G7U A;  2QQB A;  4QSH A;  3ECO A;  4EAT A;  2ZJQ F;  5D4R A;  5K7H A;  2E7X A;  2L54 A;  3GME A;  2BHY A;  2DPD A;  1U9O A;  2M30 A;  2R0Q C;  1O7F A;  2DMQ A;  1V3F A;  4KMU X;  2KJC A;  1MH4 A;  5F6F A;  5EG0 A;  2PLY A;  1PUE E;  3SDG A;  4MIM A;  4E70 A;  4UNO A;  2VOO A;  3DBH B;  1IW7 F;  3OYL A;  1FOW A;  2ECB A;  2OA4 A;  4TV7 A;  3H5R A;  4KIB A;  1FWZ A;  2W4S A;  4CDG A;  5E3N A;  2BBY A;  2DXI A;  2O61 A;  2OJE D;  2XPU A;  4A6D A;  3K6G A;  3JRI A;  2EFQ A;  4Y52 J;  3BTJ A;  1TW3 A;  1IZ1 A;  3Q5F A;  2V6C A;  2ZCW A;  3MVP A;  4XLH A;  2HS5 A;  2XB0 X;  2VQL A;  2FU4 A;  3KP4 A;  1A04 A;  4UB8 C;  1KGS A;  1USS A;  2WB1 N;  5KCM A;  5KAF C;  1MBJ A;  4DQ2 A;  2QYO A;  2WAF A;  4YIF A;  4U0V A;  4IKF A;  2YX7 A;  4BAY A;  1TQI A;  2HVR A;  1IO2 A;  4L5J A;  4LFU A;  3JRD A;  2QM3 A;  2E19 A;  4MGR A;  3DKW A;  2P7C B;  2HOA A;  3S15 J;  3EUA A;  1YS7 A;  3TQN A;  2CUE A;  2P7V B;  4XN3 A;  1B1B A;  2HDC A;  2K9M A;  4NDL A;  3F8C A;  1G3Y A;  2CW7 A;  3OSG A;  1NK3 P;  2QSG X;  3E1S A;  3NEU A;  1HKS A;  4PFP A;  2L7M P;  1YRN A;  4RGS A;  4BXX J;  4EJT A;  3FXL A;  2MA3 A;  4XOP A;  3OS1 A;  3CLQ A;  1GXQ A;  4UY8 I;  3MEX A;  2G7H A;  2LTP A;  2DOD A;  1ZYR F;  1K79 A;  1Z3X A;  2MLK A;  5D8K B;  2DK8 A;  3DLL F;  1NH3 A;  2VBW A;  2KJB A;  2DT6 A;  3RKW A;  4E4H A;  3VOE A;  1YFH A;  3S8P A;  2A6H F;  3BR3 A;  1LEA A;  5D5X B;  2EV6 A;  5HNF A;  3Q0W A;  3V7S A;  5J47 A;  1QPI A;  5ICG A;  1FP1 D;  2COB A;  4XR6 A;  1X3W B;  4B09 A;  3CMY A;  2F4O B;  3QOP A;  3O3K A;  1YO5 C;  2X9D A;  2D45 A;  3CF2 A;  2XPV A;  4YRV A;  1OYW A;  2IBD A;  5LD2 C;  4B1R A;  1QU3 A;  4J01 A;  1M1E B;  5E1X A;  1G2H A;  1IDY A;  3S3O A;  3HRT A;  3P9C A;  3GFM A;  4BYY A;  2ME6 A;  3A2K A;  2HQR A;  2R5Y B;  2HNH A;  2KRC A;  2ZO4 A;  3A02 A;  4HYE A;  1KQ0 A;  5E79 C;  5ED4 A;  1QVU A;  2VPL A;  4P96 A;  1VQ9 I;  1R7J A;  3FIS A;  3BZ6 A;  4G7H F;  2R7R A;  1IV6 A;  2HWV A;  2MD0 A;  1GVJ A;  2I8D A;  2JRM A;  3W2A A;  1IGN A;  2HTJ A;  2G0E A;  3KZY A;  2V9K A;  2JTV A;  2K85 A;  4CYC A;  2W48 A;  4ZDL A;  4HQE A;  3ZMT A;  3U9G A;  1YTY A;  2HOS A;  3ROU A;  2NVY J;  3KYD B;  1ON2 A;  5FLM J;  4BBR J;  2RDP A;  1I3A A;  4AIK A;  1DGR M;  1FSH A;  4HG2 A;  3HJE A;  2DYS H;  2LY9 A;  4BKX A;  3OYM A;  2FE3 A;  3DEW A;  1WRJ A;  3H3V K;  3T5X A;  1OYI A;  3HSR A;  3D1N I;  1W1W E;  3COA C;  4I01 A;  3M7G A;  2AQF A;  3L7W A;  2FUG 2;  3KP7 A;  3HUG B;  1LE8 A;  2EIM H;  3AFH A;  5H20 A;  1GDT A;  3ABL H;  3HHG A;  3PSI A;  5J6X A;  3RPQ A;  2VT2 A;  3FXR A;  3HYI A;  5E3O A;  3W2V A;  4D9J A;  4G6T B;  2ZME B;  3NWS A;  3WG7 H;  3VSK A;  5LHG A;  3FXU A;  3QWL A;  4Q4Z F;  3HOS A;  3E6C C;  2HTS A;  4ABZ A;  3ULQ B;  4HF2 A;  3OWT A;  2FSW A;  1XGN A;  3S2H J;  2VQH A;  2WAE A;  4FCY A;  2KIS A;  2I5U A;  5L3F A;  1O3S A;  1HF0 A;  1ENH A;  1MMA A;  3KX2 A;  3CDI A;  3WTS C;  2ZME C;  4L0Y B;  1SAU A;  1W7P A;  5TGT A;  1UG2 A;  4WX9 A;  1JJ6 C;  4BU2 A;  1TTY A;  4II2 A;  1BJA A;  3ELK A;  5BOX A;  1ZK8 A;  3R60 A;  3WTT C;  3CCQ I;  3FMS A;  5GTI C;  2Z16 A;  3HRU A;  4UHT A;  2CQN A;  2F5E A;  5JLW A;  3CME I;  4BAC A;  1OCC H;  1HC8 A;  1VF9 A;  4HX8 A;  2XSD C;  5FRO A;  1FIA A;  4KT6 A;  1ON1 A;  3F9K A;  3MKL A;  4Y33 A;  1RUO A;  4L0Z B;  1P92 A;  2G9W A;  4DBR A;  4LK0 F;  3D0S A;  3OV8 A;  4S05 A;  3LSJ A;  4UB6 C;  1MMD A;  3BTC A;  3QYB A;  1T2K A;  3BJA A;  1R1T A;  4LGW A;  1ZRC A;  4JOM A;  1R71 A;  3DEE A;  2IRF G;  3SXY A;  3V8J A;  4HOB A;  3AG4 H;  3BR6 A;  3CMM A;  1G8X A;  2L2O A;  5GAG J;  1R5I D;  2XGC A;  1UB9 A;  1ETQ A;  1Y1V J;  3WG9 A;  2DTZ A;  3M1C A;  2EK5 A;  1QNT A;  5E3M A;  3GVA A;  3GX4 X;  1NTC A;  4CIC A;  4N4O B;  1IDZ A;  2FBK A;  5EF6 A;  2Y0M A;  2NXN B;  1OR7 A;  2DMU A;  4DGW B;  2K27 A;  1JI8 A;  2L02 A;  2QCO A;  3LSP A;  1B72 A;  4WCG A;  3K10 A;  4KIS A;  2DFE A;  5TJJ A;  5IP9 J;  1SAX A;  5L3G A;  2Q0O A;  3ASO H;  2HR3 A;  3A0B C;  3A01 A;  3U2R A;  3DV8 A;  1N25 A;  2BY3 A;  4XLF A;  2Y75 A;  2AQE A;  1WJE A;  2BZT A;  3TGN A;  3M3Y J;  1ERD A;  3F8M A;  1BI0 A;  2MH9 A;  4F91 B;  4ZZL A;  3P9K A;  1LB2 A;  5C3E J;  4A0Z A;  3F6V A;  1WI3 A;  1HCR A;  1XB4 A;  2H1K A;  2XAQ A;  3HXL A;  3J7A O;  1Z0X A;  5BMZ A;  2VON A;  3K4N A;  3GZ5 A;  2A68 F;  3TBI A;  2DQL A;  3CMA I;  4A3G J;  2QKM B;  2DU9 A;  3O6B B;  2B9S A;  2Q8K A;  3A03 A;  4A5N A;  3OYB A;  5D6F A;  1T08 B;  1XMX A;  3GF2 A;  3T1B A;  2Z1D A;  5CVI A;  2KRH A;  4DZP A;  2O8K A;  4BEH A;  3K9T A;  5F04 A;  3TMO A;  1Z05 A;  3K4M A;  4J19 A;  2HVQ A;  4A3L J;  1KU3 A;  2TCT A;  1J5Y A;  3ABK H;  1OCR H;  2BHZ A;  2EA4 A;  2QEX I;  2VUM J;  2FRH A;  3UKG A;  3RIR A;  3JTG A;  2FNP A;  1YQA A;  4BHC A;  4OMY A;  2EIN H;  5DS9 A;  2M5W A;  1E3P A;  5B1B H;  2Y0S A;  4IOC F;  5CKT A;  5JHF A;  3IH3 A;  3SZP A;  3OYD A;  3ZMD A;  4QWQ A;  1W5S A;  2DFH A;  2VAS A;  5E8I A;  1ZHF A;  4AM3 A;  2NAZ A;  3A01 B;  1RC9 A;  3IH2 A;  2ZC2 A;  4XOR A;  1J59 A;  5IT9 K;  4NHJ A;  2ZSI B;  3TDZ C;  2E60 A;  3G2B A;  4XNF A;  1FYM A;  4JQF A;  1U8R A;  3LMM A;  4XQF A;  2VE8 A;  3O8H A;  4IJA A;  1S7O A;  2M3A A;  4OMZ A;  3MMY B;  1Q1V A;  5E3L A;  3H0G J;  1IUY A;  4BE1 A;  4LB6 B;  4O6J A;  5L3E A;  3JRA A;  1POG A;  5K7F A;  1F1Z A;  3W3C A;  5J8F A;  3C2H A;  2IXS A;  2ZXJ A;  3B6C A;  2WB1 A;  3HOV J;  1DP3 A;  2V79 A;  2NVT J;  3FF5 A;  2NNY A;  2HKX A;  2L7F P;  4HX4 A;  1JKR C;  4N9I A;  1BOA A;  2CUJ A;  4JBA A;  2CSO A;  3W6V A;  1DUX C;  3LL7 A;  4YFK F;  3RZO J;  3BR1 A;  1VQ8 I;  3KET A;  3D5S C;  2HOT A;  4B3A A;  2EZI A;  3R0A A;  3M9A A;  3CLO A;  3MAJ A;  3ZRG A;  4ZDO A;  4RBO A;  1LNW A;  3M8J A;  5HNH A;  4ESF A;  2FJ1 A;  2HDW A;  3HOT A;  2DN0 A;  3WE3 A;  2LLK A;  2OZ6 A;  5EEH A;  1YI2 I;  2CV2 A;  3PO3 J;  4B8X A;  2TRT A;  3HM5 A;  5M5W J;  5LEJ A;  3F0C A;  2MC4 A;  2E5Z A;  3K69 A;  4XL9 A;  2YUS A;  3PNV A;  1IXC A;  2XKO A;  3LNQ A;  5LLQ A;  1Z7U A;  1N75 A;  2K5C A;  1Z7L A;  3GLL A;  1REP C;  2F6C A;  2UV1 A;  2X0L A;  2WAQ A;  3S93 A;  1PUF B;  4Y13 A;  5HS9 A;  1U2W A;  2KMU A;  1ZQ3 P;  4XRS G;  4XKV A;  1MBK A;  3D5L A;  2DJI A;  5LRR A;  2Y48 A;  3I59 A;  2BEO A;  3FZV A;  2DQR A;  3CTA A;  3HOW J;  1TT5 B;  2STT A;  1XSV A;  2VL8 A;  4PCQ A;  2EV0 A;  1VQ5 I;  3K7A J;  4KMF A;  5ICC A;  1FT9 A;  2KIQ A;  2QQA A;  2VBY A;  4RDU A;  2ICW G;  1S29 A;  2WAD A;  3FXO A;  4M6X A;  1GV2 A;  1QA6 A;  5F0F A;  2IPQ X;  3K1P A;  3CCE I;  1ZR4 A;  2YX4 A;  2QBY A;  1JJ8 C;  1ZG3 A;  4N9H A;  1I27 A;  4BQQ A;  1MSF C;  5HS8 A;  1BI3 A;  4RA2 A;  4Q47 A;  3B6A A;  1SC7 A;  1IRF A;  2LSO A;  1ZG1 A;  4OIN F;  4E6K G;  3HB9 A;  2MH2 A;  5BPI A;  3O8G A;  1MND A;  1Y39 A;  4BS9 A;  4LD5 A;  1H0M A;  1YHQ I;  2RNJ A;  3LFK A;  3EUK L;  2LRE A;  2KLO A;  2DLL A;  4ZYE A;  1QHG A;  3CC7 I;  1LVA A;  1JUM A;  3EDP A;  1TWF J;  1FSE A;  4LIT A;  3GFI A;  3PFI A;  3GW2 A;  1J2X A;  2GQQ A;  1U5T C;  2L4A A;  2XGE A;  4FIS A;  1K6O A;  3CCM I;  1KU9 A;  1BR1 A;  1SD6 A;  4LIV A;  1E3H A;  3FMQ A;  4LG0 A;  4YG2 F;  4U0Y A;  3JRF A;  1AA7 A;  5IYC J;  4IPA A;  4OIO F;  4OIP F;  3TO9 A;  2EFO A;  3FKJ A;  3GUD A;  1TWC J;  2EPF A;  1D5Y A;  3ABU A;  4HRI A;  2R5Z B;  4AC0 A;  3VYU B;  3ABM H;  2KKO A;  4RAZ A;  2NS0 A;  3GO5 A;  1EH6 A;  2EV5 A;  1O4X A;  4BNC A;  1MBE A;  2QKL B;  2Y2Z A;  1LDJ A;  2EFN A;  3GTL J;  1VQM I;  3FX3 A;  4HDU A;  2E1N A;  2YU3 A;  1I3Q J;  5JVG F;  1H8A C;  5HDG A;  3TP0 A;  2OF7 A;  1VFC A;  2YR2 A;  5FFX A;  4V2F A;  1OYY A;  2IGO A;  4PJN A;  3QPL A;  5L3B A;  1MJA A;  4KDP A;  2E1C A;  1FNN A;  4LJZ F;  1FTZ A;  2YPR A;  1XDS A;  2EBI A;  5BPD A;  1PJR A;  1RZ4 A;  3CC2 I;  1JTX A;  2R93 J;  4ZJZ A;  3K1N A;  1BW5 A;  2X6W A;  2DT7 B;  1Y1W J;  2F4I A;  2XDV A;  1TL8 A;  2Q1Z B;  4ON0 A;  1V5E A;  1IN6 A;  3BZK A;  1ZGA A;  4NQW B;  1OLT A;  4E7K A;  3H9Q A;  1U5T B;  5ILU A;  3DPU A;  1TZL A;  3B02 A;  4CO8 A;  3GTJ J;  4BEH B;  2QQ8 A;  2RRE A;  4I2O A;  3CDL A;  2O5R A;  2Y9Y A;  3EUH C;  4DYC A;  1YW9 A;  2FMY A;  5B1A H;  4A3B J;  5D5W B;  4BGD A;  2H94 A;  1F5T A;  1JXS A;  3UNG C;  3RQI A;  1RR8 C;  3IKV A;  1GXP A;  1JKO C;  1GVD A;  2XGX A;  4PFO A;  1JKQ C;  2YU9 J;  1KQ8 A;  3JCU C;  3HG9 A;  1Q1H A;  1TW2 A;  1WKM A;  3I56 I;  4ZYG A;  1PYV A;  4U7D A;  4PDK A;  2ADU A;  2FQ3 A;  3MQ0 A;  1JUP A;  5CVR A;  3OIQ A;  2IW5 A;  2CUF A;  2ACJ A;  1RI7 A;  2ISY A;  5IOZ A;  2OCC H;  2ELJ A;  2R7T A;  1S6L A;  1XMA A;  5LRS A;  1P4X A;  3OL3 A;  1TC3 C;  2FX0 A;  2MW8 A;  2PX9 A;  4BXF A;  1T38 A;  3S1N J;  5IOY A;  2JA2 A;  2B7E A;  4Q5S F;  3V42 A;  4BH9 A;  3IWZ A;  3J80 K;  2KIF A;  4QLC U;  1MW7 A;  3ZOB A;  2NRA C;  1YJW I;  2CMP A;  4BQA A;  1P2F A;  3EYI A;  2DO7 A;  2XPW A;  1P7J A;  3S1M J;  1QHH D;  5LGN A;  5EZH A;  4EV0 A;  3PL8 A;  3ZQH A;  2F5C A;  1VTN C;  3KEO A;  1U8B A;  1HSJ A;  4GGG A;  3WGH A;  3IL2 A;  3F21 A;  2XHK A;  2NVU B;  1R58 A;  4ITV A;  3OS2 A;  2A69 F;  3MN2 A;  1V4R A;  1VQ7 I;  1U3E M;  4HQM A;  1ORK A;  4L5E A;  2DW4 A;  3SDB A;  1HST A;  4DIQ A;  3BDD A;  4IQ4 A;  2JVH A;  3HZJ A;  1XGM A;  2PJR A;  2UWM A;  2V1X A;  3K2A A;  2CGP A;  2ZFU A;  2PEX A;  1FBS A;  1T56 A;  3BCA A;  4AD9 A;  5GPA A;  1G3W A;  1HQC A;  2VOP A;  3F8B A;  4HST A;  4EJV A;  2BW3 B;  4GXO A;  2L9R A;  3KLN A;  5AIQ A;  5ICE A;  3S1R J;  1K4T A;  2K3P A;  1FJL A;  1X1P A;  3I0T A;  1SFK A;  2CFX A;  3HOY J;  3GXO A;  4HAM A;  1E0E A;  2O03 A;  4CZZ A;  4F52 A;  1S8N A;  3HSF A;  1IXR C;  2X4H A;  1VZ0 A;  4HNT A;  2WBM A;  1D1C A;  3ZMU A;  1XX5 A;  3DPT A;  5IT9 Z;  1D5V A;  3E6B A;  2FOW A;  2P5K A;  1IRZ A;  4BJT A;  4CYD A;  3VSL A;  1K61 A;  1OQY A;  2CYY A;  3JW4 A;  1YX5 A;  3ESW B;  1YS6 A;  3SQN A;  4BE2 A;  2KZG A;  1EA3 A;  4P9F A;  4RS8 A;  3LFU A;  5E1Z B;  5DD8 A;  4XMY A;  2UUZ A;  2HZT A;  4A3E J;  4MTD A;  2F5D A;  4OU0 A;  1U78 A;  4LK1 F;  4HSR A;  4UXN A;  4KIT B;  3QP6 A;  5CJ9 A;  1UCR A;  4I0A A;  3PNT A;  2V7F A;  3SJM A;  1I6X A;  2HVS A;  2L9N A;  4I02 A;  1NG7 A;  4PJ0 C;  4GDF A;  1WVR A;  3E6M A;  3DKY A;  3EET A;  3K0L A;  3REO A;  1TWA J;  2ESH A;  1O3Q A;  3I71 A;  4NNJ A;  5LGT A;  3ZMS A;  3C3W A;  2FQ4 A;  4RAY A;  4E7H A;  1HW1 A;  2ZJP F;  2UXN A;  4PUS A;  1QZE A;  2W24 A;  4L9N A;  5EEA A;  3FIW A;  3WTW C;  4XBF A;  4J00 A;  3G1O A;  2A05 A;  3R0J A;  2RV8 A;  5D4S A;  1ETO A;  1T95 A;  1OCT C;  2IJL A;  3KEY A;  1ZKG A;  2GWR A;  3DU6 A;  2CU7 A;  2CH0 A;  3CCL I;  3CC4 I;  1MDM B;  2JZY A;  2FD5 A;  3F3X A;  2DA7 A;  4XLC A;  1SVM A;  1VQK I;  2LRD A;  2P4W A;  3RYP A;  1ZTR A;  3MKZ A;  4ZYA A;  3E5Q A;  3VEP A;  5F0C A;  3RPU D;  3W6K B;  2Y31 A;  1SVL A;  3G3Z A;  2GAU A;  2CV1 A;  1ZG5 A;  1ONV A;  3Q3S A;  3EUH A;  2LKS A;  2BYV E;  2Z99 A;  1T0F C;  1TT0 A;  3FXM A;  1MNE A;  4ETS A;  1YJ9 I;  5HLH A;  3HDD A;  5F0H A;  4HF1 A;  2HQA A;  1VI0 A;  2BY1 A;  2VPR A;  2P5V A;  2QVO A;  2L3D A;  4KNY A;  3HKZ A;  2BXZ A;  1ZH5 A;  2OU2 A;  1CGP A;  3SZT A;  4LB5 A;  1F9N A;  2VKV A;  2Z5U A;  3NWT A;  3UR3 C;  5J4V A;  1ACI A;  2M7B A;  1YG2 A;  1L3L A;  2Z2S B;  2PMH A;  2UXX A;  3LSR A;  4YEL A;  4ESJ A;  4G6Q A;  2QSH X;  3L9F A;  3D5R C;  3MZ8 A;  4KN7 X;  1U0J A;  2RN7 A;  2IEK A;  2V9V A;  1AOY A;  2GBY A;  5A2Q K;  1S7E A;  2XAS A;  1V5F A;  3ISP A;  1H9G A;  1EKE A;  3IAM 2;  2W84 A;  1VQO I;  1GUU A;  3M4O J;  3MKY B;  3FK7 A;  4V19 K;  1OFC X;  1KU2 A;  1W7P B;  3HPG A;  4RGX A;  1EF4 A;  3MZY A;  5F1J A;  5KHD A;  1G3S A;  4ENM A;  1XPX A;  2R7V A;  2H1L A;  3VOD A;  5K7Z A;  1QZY A;  1V54 H;  1X1D A;  3FBI B;  4U0W A;  1JHH A;  3I55 I;  1IJW C;  3P7N A;  1XC5 A;  4LLG F;  2K86 A;  2ZSH B;  1Z21 A;  1WZ2 A;  1WHU A;  2E1M C;  2QSF X;  4RB3 C;  1YW7 A;  3TL4 X;  4E7Z A;  2EA2 A;  1E17 A;  2LFB A;  3I4M J;  3LQR A;  3HL2 A;  3E5U A;  2CRG A;  2KZV A;  1KZH A;  1K83 J;  4CSW A;  3AG2 H;  1ZLJ A;  3BC8 A;  1RKT A;  3LAP A;  1AHD P;  3GZN B;  3HTU A;  3ERE D;  2QUF A;  4M3G A;  2JRT A;  1I50 J;  2LG4 A;  3KP2 A;  1WJ5 A;  2OV7 A;  4ZTF A;  1QGP A;  2NOG A;  4CCO A;  2XB5 A;  2VJI A;  4B43 A;  1SD4 A;  2PG4 A;  1D0Z A;  4XM3 A;  3ZN1 A;  4QIW N;  2KPM A;  2JPB A;  5GAH J;  1I6H J;  4U7B A;  4MEX F;  2MAB A;  3NAR A;  4HBL A;  3S1Q J;  3OYC A;  3J80 Z;  2X6O A;  4KIG A;  3E7L A;  2DK5 A;  3RKY A;  3AAF A;  1B6A A;  3GZ6 A;  3U1D A;  3WE2 A;  1KYZ A;  3KZI C;  4GCV A;  1JUS A;  2M87 A;  3GWZ A;  3WTX C;  1MNM C;  2MGQ A;  3ZCO A;  2NYX A;  3ML6 A;  3N4M A;  2DA4 A;  4E7L A;  3KCC A;  4PJM A;  5DUK A;  3KEQ A;  3CCU I;  2IA0 A;  3LOC A;  4XKB A;  4MEY F;  5FLV A;  1G3T A;  2A6T A;  3K2Z A;  4IVN A;  3QU3 A;  5FRM A;  5M5Y J;  2M0M A;  4N4N B;  3H1C A;  4PZJ A;  5LHI A;  4FX0 A;  3HKZ N;  1XSD A;  5B3S H;  4MQ9 F;  1OKR A;  2XRL A;  1IN5 A;  4FE7 A;  1ULY A;  3RPU A;  2V1U A;  2CQX A;  4EM1 A;  1X2M A;  3J81 Z;  2F5V A;  1MMS A;  4A0Y A;  3OR2 C;  1ITY A;  1X4O A;  3G4S I;  2H27 A;  2F5F A;  4CCK A;  5F64 A;  5JHU A;  2FXA A;  5CQE A;  2VB6 A;  2W82 A;  2Q2E B;  3AKZ A;  3JRB A;  2M4G A;  2OUM A;  3LSI A;  4Z2Y A;  1AKH A;  4MHG A;  5AON A;  1XS9 A;  2ECC A;  1WPK A;  2ZXI A;  2JA5 J;  2BY0 A;  1B9M A;  1X19 A;  1Y0U A;  2JUG A;  4NBQ A;  4KJZ A;  1UG0 A;  1ZEL A;  5K5R A;  3PQJ A;  3B73 A;  2VJ4 A;  1ETY A;  1SFU A;  1BR4 A;  4D5F A;  5CVV A;  3BOQ A;  2BY2 A;  3VFZ A;  1O3R A;  3DTK A;  4WXH A;  1L0O C;  5CPR B;  4M3D A;  3ONQ A;  4LLL A;  3G6E I;  5M3F J;  3QRF F;  1JHF A;  4P9U A;  3L2W A;  3GLX A;  1ZRF A;  4LOC A;  1SVO A;  3J7A Y;  4DZJ A;  1T33 A;  5CYV A;  2LY1 A;  3F8N A;  2DOF A;  3OYI A;  2E71 A;  1ZGJ A;  2ZXW H;  1MBG A;  4A69 C;  3PNY A;  2PJR B;  1BM9 A;  2ZKZ A;  1KA8 A;  3DFG A;  3CDH A;  3JR9 A;  5JVT A;  2XIG A;  3ZQI A;  4Y4R A;  4EJU A;  1IN8 A;  2F48 A;  4XRS A;  1JT6 A;  3S3M A;  3FK6 A;  2RVC A;  3WHC A;  2XAJ A;  3RZD J;  1YYV A;  1B9N A;  3QPT A;  3LSK A;  1A5J A;  4MFE A;  3U1K A;  1DU0 A;  4EM0 B;  2HOE A;  4GYI A;  1ZRD A;  1J9I A;  1LE8 B;  5DYM A;  1QBJ A;  1GHC A;  1XCB A;  1D3Y A;  2OAZ A;  5CVJ A;  2LYC A;  4OAZ A;  3OIP A;  4QTR A;  1OIS A;  5J1R A;  1Z9C A;  1UMQ A;  2H8W A;  4AU7 A;  2QWW A;  2IS4 A;  3DF8 A;  1MMN A;  2V9P A;  1X1C A;  5EDN A;  1UHM A;  2GXB A;  2Z3Y A;  3FXJ A;  4HLY A;  1J7K A;  4ASN A;  5DM6 F;  3OYA A;  1HKQ A;  4L9V A;  1H89 C;  1CF7 B;  4D5C A;  2R92 J;  2GOM A;  1KQ9 A;  3CP2 A;  4I98 B;  5CVU A;  4CYC B;  1X2N A;  2XF6 A;  5BQT A;  2DOE A;  2O8X A;  1E3O C;  4IOA F;  4YEJ A;  3G73 A;  5DTD A;  3U21 A;  1EH7 A;  2E36 A;  1J0R A;  3C2G A;  3ZQF A;  1Z1D A;  5LEK A;  2R7Z J;  4E7S A;  3FWE A;  5C44 J;  4EEF G;  2B0L A;  2XC7 A;  3J7Z I;  4PSW A;  2DTR A;  3PJR A;  3CD6 I;  2PMZ A;  4RM2 A;  3ZPL A;  2XKP A;  4GO1 A;  3I64 A;  2CS3 A;  5J40 A;  4I09 A;  5FO5 A;  2CW8 A;  5E18 F;  4FX4 A;  2L4M A;  1MDM A;  3ZQ7 A;  2BVL A;  1BOB A;  3ZGK A;  5BNG A;  2L0K A;  5J4Y A;  4CH7 A;  2DJN A;  4S04 A;  2IP2 A;  1WQ2 A;  2K9N A;  1WJC A;  2JJ7 A;  3CO6 C;  3E0J B;  2HKO A;  2OCE A;  2NS8 A;  5BS6 A;  2IT0 A;  3OYE A;  2HPI A;  2V6E A;  3I53 A;  2EB7 A;  1MD0 A;  1V55 H;  3P5J A;  1RKW A;  1YE9 A;  2DI3 A;  1G6N A;  4PJL A;  2RGV A;  2MC3 A;  1KU7 A;  2E2H J;  3OOP A;  1R4N B;  1MBF A;  4BHP A;  1F36 A;  4ANJ A;  1BJZ A;  2LVS A;  2DMT A;  3K4L A;  5FLX Z;  3OYJ A;  4FAS D;  2JPC A;  3HHH A;  3WGG A;  3IH4 A;  2PFB A;  5FKN A;  3BR0 A;  4EGZ A;  1QVT A;  4BBS J;  1ETV A;  2EZK A;  2JVG A;  5HOD A;  2Z33 A;  1R4M B;  5B5E C;  3KIO A;  1Y56 A;  4AIH A;  1IXS B;  1T6S A;  2IAI A;  4BL0 B;  3Q9S A;  2J5P A;  1RIO H;  2A3S A;  3L00 A;  1X1B A;  3KE2 A;  4LG0 B;  2A5W A;  3S3N A;  2ZJ2 A;  2VJ5 A;  4HDV A;  3CCV I;  1BN5 A;  1HXD A;  1QO0 D;  2O7O A;  3DLA A;  4XIC A;  2GM4 A;  4CZC A;  2HXI A;  1BBY A;  3QQA A;  4HPQ A;  4E7J A;  3QOE A;  3CP8 A;  4B48 A;  3V8K A;  5EGO A;  1OJL A;  2H09 A;  3DTE A;  4P55 A;  1W5C C;  2XRN A;  4PGG A;  2PMU A;  2IS2 A;  3JRG A;  4D1Q A;  3IWF A;  2P8T A;  2K4J A;  3VDX A;  1R23 A;  1PP8 F;  2DCE A;  4KFC A;  2R4G A;  1ZN2 A;  2ZB9 A;  2JUC A;  1HOM A;  4XK4 A;  5FKM A;  3HBL A;  2LBF B;  3HGY A;  3TO6 A;  4LG3 A;  3S14 J;  1Y0N A;  1RUN A;  4Q48 A;  2AXL A;  3DEU A;  5FD5 A;  4DYQ A;  2ZJR F;  1FOX A;  2R7D A;  2CV0 A;  4R8H A;  3FHZ A;  4XSZ F;  3FMR A;  2CQQ A;  3CJN A;  3BTI A;  3FM5 A;  3LSH A;  1DDN A;  2M34 A;  3QPS A;  2J5O A;  1R6R A;  4PSX A;  3H5A A;  3V8L A;  5EG0 B;  3AL0 B;  2VLA A;  2FA5 A;  3CUO A;  1K78 A;  1D1A A;  4HEA 2;  1I5Z A;  2QA4 I;  1ZGW A;  3ERM A;  5IY5 H;  3FKI J;  4M3E A;  3HOU J;  4IRI A;  1S7A A;  2VQC A;  4G12 A;  4BJ6 C;  5E1W A;  3FXK A;  4M9S A;  2Z9O A;  3BZC A;  3I59 B;  1EH8 A;  3OS0 A;  1DQU A;  4BY7 J;  1RES A;  4X6A J;  3LA3 A;  1XTA A;  2OPT A;  3C18 A;  4IQJ A;  5C4X J;  5HLT A;  1SMT A;  2DPU A;  2M2E A;  4FHT A;  1D0X A;  1HDP A;  4BUP A;  3CCJ I;  1JGS A;  2OTL I;  4XLE A;  2XV4 S;  2QF7 A;  2A6E F;  2WAQ N;  2FEZ A;  2K02 A;  3F72 A;  2EJR A;  2LY2 A;  4M3B A;  1TNT A;  4IHS A;  3ABT A;  3DXJ F;  1N77 A;  1HBX G;  2OQG A;  4DW6 A;  5GTH C;  2HXO A;  4A5M A;  2X6Y A;  5F1R A;  1FIP A;  2AXT C;  1Z6T A;  2E1M B;  2ZNZ A;  4EGY A;  2NNN A;  3N05 A;  2O6G E;  2PI0 A;  1UEL B;  2CFO A;  2LH9 A;  3I58 A;  2XAU A;  1VQL I;  4A6E A;  5DCM A;  4FTH A;  1I1S A;  1IUF A;  2AO9 A;  3L1P A;  1P4W A;  4KT5 C;  4UUS B;  1X4P A;  3M1E A;  1YIJ I;  2P5L C;  1F43 A;  2IGK A;  3VB2 A;  1U9N A;  4IHW A;  2JSC A;  3OYK A;  1LFU P;  3BP8 A;  2GXG A;  2KFD A;  2KDO A;  3K70 D;  4B47 A;  2JA6 J;  2RKH A;  4Y17 A;  5DUI A;  2M9H A;  2X48 A;  4H0E A;  1IF1 A;  2XGD A;  5IYD J;  3S2W A;  2UZK A;  3OIO A;  3AG1 H;  1EV7 A;  2P0W A;  5IP6 A;  1YJN I;  3F8F A;  2FOK A;  1JTY A;  3L2U A;  1R5H A;  1MGT A;  3GYH X;  5CQG A;  4IEJ A;  3MD2 A;  3CUQ B;  2MLG A;  1DP7 P;  3DQV C;  5IP7 J;  1IAW A;  3QYE A;  3JAM K;  3FM3 A;  5E17 F;  3PQK A;  2COM A;  2XF7 A;  2W57 A;  3AG3 H;  4M9X A;  4P1W A;  1MKM A;  1SAN A;  1I39 A;  1WJB A;  1LDK B;  1IG7 A;  4KUM A;  3RQ4 A;  4C3I J;  1LVK A;  3GEZ A;  3IKT A;  3MFK A;  2E34 A;  2R5Z A;  2L5Q A;  3CJR B;  2CWE A;  1TBX A;  2EIK H;  5FRN A;  1LKX A;  1NHA A;  2XF5 A;  1QRY A;  3KLO A;  4F55 A;  2ID6 A;  1IN7 A;  4C30 A;  4EMS A;  2VC1 A;  2K9S A;  2OTJ I;  3WTV C;  5J1U A;  4PJJ A;  3ZMV A;  2KHM A;  4F7Z A;  3GTQ J;  1KYW A;  3TP3 A;  2RAE A;  3OL4 A;  1B8I B;  1QQI A;  2E2J J;  1C0W A;  2VJJ A;  3K70 C;  2LD5 A;  5HLG A;  4H4K C;  5CLS A;  3K4B A;  4CXF A;  3DBL B;  3KPH A;  3LA2 A;  3BR5 A;  3QU6 A;  5JLX A;  1A31 A;  2Y0S N;  3HPH A;  2BVM A;  4RM3 A;  2LC2 A;  2VXZ A;  2ZBK A;  1LFP A;  5DCM B;  5JR3 A;  3CQZ J;  2F2E A;  4KYW A;  2F4M B;  1UFM A;  1UZC A;  2QEN A;  3GBG A;  2DBB A;  4A2U A;  2WA0 A;  2M7A A;  1STZ A;  4MLO A;  5FFZ A;  5D8L B;  3CCR I;  5HDK A;  1A35 A;  5JFR A;  1R5G A;  1SD7 A;  1FZP B;  2QGU A;  2ETH A;  3BRO A;  3J81 K;  3CCS I;  1O3T A;  2MYS A;  3BJO A;  2L7Z A;  4B44 A;  2R7S A;  2X1E A;  3PM1 A;  3GTG J;  2YS9 A;  3RSN A;  1OPC A;  2VKH A;  3SFZ A;  1VQ4 I;  1WCM J;  1P7I A;  4UVB A;  3SZG A;  2PBI A;  1B72 B;  1RR7 A;  3HTS B;  4FET A;  3T8T A;  3CUQ A;  4CA0 A;  2V1N A;  1ODD A;  2DOA A;  2HU9 A;  1Y6I A;  4XLA A;  3SEQ A;  3TW6 A;  2VC0 A;  4IRH A;  4Y15 A;  4IHY A;  2P6T A;  4I0B A;  4IF4 A;  4GFB A;  4R1H A;  4HLX A;  1QZZ A;  2E35 A;  3H5N A;  1WJA A;  5M5X J;  2EFP A;  3TOA A;  3M8F A;  1TWH J;  2HEO A;  3RI4 A;  3MZH A;  1R22 A;  3V7R A;  1GT0 C;  1VQN I;  2K4B A;  5FKL A;  4UUS A;  3LAJ A;  3A1Y A;  3S17 J;  3WU0 A;  4A3M J;  2GLO A;  1D8K A;  3HUG A;  3S2D J;  2VBZ A;  3V7C A;  4DJA A;  4S0H B;  2JMW A;  4OIQ F;  3KP6 A;  4YFN F;  2FNA A;  3L2Q A;  3VYT B;  3ZQC A;  4M72 A;  1VQ6 I;  1BW6 A;  2VKD A;  4MFD A;  2ELH A;  4EJW A;  5KNL A;  4IZZ A;  1Y8Q B;  3FBN B;  5GAD J;  1W4M A;  2JSP A;  1W36 D;  2AS5 F;  1NK2 P;  2DA2 A;  5IYB J;  2X85 A;  3RCO A;  1BIA A;  4RB2 C;  4ENJ A;  3JSO A;  1YX3 A;  2IA1 A;  5J8C A;  2FBH A;  3MKW B;  1WI9 A;  2WV1 A;  4O3M A;  1UST A;  4AWX B;  1D0Y A;  2Y9Z A;  5AIP A;  2V26 A;  3FXQ A;  2A07 F;  1FOK A;  1G4D A;  4A3D J;  3BG7 A;  4RLF A;  4LMY A;  2VT3 A;  4UUV A;  2NS7 A;  3W6J B;  1OCO H;  2KQR A;  3LSM A;  2M45 A;  4V2G A;  4CCL A;  2PMZ N;  3VWB A;  4I6Z A;  3FDY A;  1YW8 A;  2W85 A;  4RAG A;  1WFX A;  3E3V A;  2HPM A;  2JT1 A;  5L3C A;  5D5V B;  4A3F J;  2MSY A;  3DU5 A;  4HZF A;  3IP4 B;  3BCB A;  1XSX A;  3DWL E;  1MSE C;  2DT5 A;  2R3S A;  3MCZ A;  2B63 J;  3G1L A;  1TLH B;  3TO7 A;  2V1D A;  2CQK A;  2H6C A;  1LFB A;  1PUF A;  4BXU A;  3JTH A;  5GP9 A;  5EYR A;  1TWG J;  1U5T A;  3H36 A;  1YOV B;  1K6Y A;  4DBQ A;  4NQW A;  4M6Y A;  3VYS B;  2ESN A;  2OC6 A;  4U87 A;  4G7O F;  3HRS A;  1BIB A;  1J75 A;  1FBQ A;  2KP6 A;  2VKE A;  2PN6 A;  2HQN A;  2R7F A;  3NRV A;  4PGH A;  4RLQ A;  4M71 A;  3L2C A;  1SMY F;  1X58 A;  2EH3 A;  3I5U A;  2X6X A;  1FPQ A;  4OAY A;  3HOZ J;  3CCY A;  2HI3 A;  4ZC3 A;  4BQO A;  2DFI A;  2W00 A;  4G94 A;  3QP5 A;  2FBI A;  4EQQ A;  5DM7 F;  2LK2 A;  2P81 A;  2W1O A;  4PK4 A;  1S72 I;  4F93 B;  3S16 J;  1RRJ A;  4W1U A;  4HV6 A;  1UHS A;  5L3D A;  5D6E A;  1I1G A;  3JRE A;  1TQM A;  5EGO B;  2FF4 A;  2XAG A;  1SFE A;  4F92 B;  3PFY A;  3QOD A;  4OWR B;  1HLV A;  9ANT A;  3RKX A;  2WV0 A;  2XAH A;  2LOO A;  4HV5 A;  3P9I A;  5J1Y A;  1VQP I;  4AID A;  1FY7 A;  2JQ7 A;  1Z91 A;  3IHU A;  4I99 C;  3L2R A;  3GTP J;  2HQ5 A;  4XOT A;  3OYH A;  4IHV A;  3GTM J;  2IS1 A;  3A4C A;  1MZB A;  1FOY A;  3IUO A;  2DYR H;  2HGC A;  4HA8 A;  4ZH4 F;  3WU2 C;  4JX4 A;  4OOI A;  1TQP A;  1HDD C;  3ZQQ A;  2EZL A;  4XRM A;  4FQG A;  1HW2 A;  1BL0 A;  4JP0 A;  1MMG A;  3RTR A;  4HF0 A;  5K5O A;  4YII A;  1D1B A;  3EYY A;  5H2F C;  2OZU A;  1R9T J;  2X1C A;  4UVC A;  4HNV A;  4L5I A;  3DKX A;  2VI6 A;  5GPC A;  3PIP F;  2STW A;  1X1A A;  3F22 A;  2IGM A;  2Y30 A;  3WGI A;  4DOZ A;  4DYR A;  4XLP F;  5B66 C;  3F23 A;  1VND A;  3L2V A;  3RYR A;  3GTO J;  2WC2 A;  4L9J A;  3G71 I;  2EIL H;  3WU1 B;  2VE9 A;  5TIS C;  4XSX F;  2PJP A;  1SFO J;  2M4K A;  4ZYD A;  4M6V A;  2O9L A;  3DTI A;  3ZR8 X;  4R79 A;  3GFJ A;  4KIC A;  3OYF A;  4AVZ A;  1BC8 C;  1HKT A;  3BG3 A;  1IN4 A;  1XN7 A;  4G9Y A;  1AU7 A;  3OR1 C;  2L9V A;  4JK1 X;  1X3Z B;  5H6Q A;  4LIU A;  3C2B A;  3BWG A;  3QYF A;  4F3Q A;  3NAU A;  1F4K A;  3KZZ A;  2O3F A;  2DFF A;  4RB0 A;  4Y3O A;  2R7W A;  2QLZ A;  1NG6 A;  1ZAR A;  1YIO A;  4N0B A;  2O0Y A;  2GIV A;  3HGG A;  3SYT A;  2OBP A;  4D7M A;  2E2I J;  3OSF A;  1PVE A;  1W0T A;  2ID3 A;  4BDY A;  2VOD A;  2IGN A;  3E5X A;  4X0G A;  4G8X A;  1XGO A;  2BV6 A;  4BHB A;  1LPQ A;  6PAX A;  4EVI A;  3JSP A;  1V5G A;  4A0X A;  2WWY A;  4WXC A;  5FLX K;  2DDB A;  1R36 A;  5KK1 A;  2BOL A;  4BDZ A;  3TKY A;  4A3K J;  5EEG A;  3CJQ B;  1FX7 A;  5FKO A;  1LJ9 A;  3BTL A;  4IHT A;  4XN0 A;  5GAE J;  4NUB A;  2QZ8 A;  4C2M J;  1LUJ B;  3WTY C;  1P9Q C;  5DCF A;  1OR7 C;  1W0U A;  2EIJ H;  2E1O A;  1SFX A;  2NVX J;  1Z6R A;  1S9H A;  2GOX B;  2KIM A;  2QQ9 A;  3HC7 A;  4A3I J;  3IV5 A;  2GA2 A;  1G59 A;  2I10 A;  2BXY A;  2HYJ A;  2LKP A;  3BQY A;  4HW0 A;  3LQQ A;  4UVA A;  4D0P A;  1PDN C;  1UAA A;  1Z3Y A;  1LQ1 A;  5E8G A;  2VQG A;  3LSG A;  1FYK A;  3MWM A;  2AHQ A;  3DBR B;  2NVQ J;  2X1D A;  1BI1 A;  3RKQ A;  4C9Y A;  4HNU A;  4B4C A;  2GXA A;  4CCJ A;  1IRG A;  1WJF A;  1T98 A;  1DGW Y;  3JAM Z;  1MJ9 A;  4ESB A;  4ENK A;  1HW5 A;  4BY1 J;  4AUX A;  2WY8 Q;  1UHW A;  2VN2 A;  5HVQ C;  3DPL C;  2KDZ A;  4XKW A;  2EZH A;  4DNC A;  4AIJ A;  1AWC A;  4C2U A;  3K4J A;  4W97 A;  1E2X A;  5FKK A;  4L18 B;  2DAO A;  5HDN A;  2LDU A;  3CZ6 A;  3ZN0 A;  2CQ7 A;  1FMV A;  3H9G A;  5K1Y A;  4I76 A;  4II3 A;  1XGS A;  2H6B A;  3OYN A;  3L09 A;  3BR2 A;  3R4K A;  5EJC A;  2BE5 F;  4Z6Y A;  2D1H A;  2LNB A;  5IPA A;  2NOJ B;  1ZLK A;  1OCP A;  2WTE A;  4GRI A;  2E5N A;  3E97 A;  2K7L A;  2LMD A;  2PQ8 A;  4G7Z F;  2XRO A;  3DCF A;  4A12 A;  4D7N A;  3WTZ A;  3VYR B;  1BR2 A;  1KON A;  4FE4 A;  3CO7 C;  2ZME A;  4XLN F;  4XID A;  1AKH B;  2A5Y B;  2XUB A;  3BG6 A;  3X2Q H;  1FYL A;  2HDD A;  4JYK A;  4XRF A;  4Y7N J;  3IAS 2;  2R7O A;  2OD5 A;  3PO2 J;  2E7W A;  5ICF A;  4YIR X;  4HX7 A;  4ENN A;  4C3H J;  4OIR F;  1DPR A;  2HFH A;  4G6D A;  2LF8 A;  1GV5 A;  1O57 A;  4M74 A;  1W5T A;  1OCZ H;  2GIZ A;  2CUZ A;  5IT3 A;  5ERI A;  4C2T A;  2YSR A;  3DP7 A;  5LFA A;  2M8E A;  4JX6 A;  4IXA A;  1HA8 A;  5DEQ A;  4JX5 A;  3FHN A;  4CCM A;  2K9Q A;  2D1V A;  3I4N J;  2IS6 A;  4UV8 A;  1MIJ A;  2XAF A;  4NB5 A;  1T39 A;  5F08 A;  2ZXH A;  4CUG A;  1FEX A;  2BGC A;  1N78 A;  1RPW A;  2R7Q A;  5D5U B;  3K4C A;  4KN4 X;  2DA6 A;  1FP2 A;  2CJJ A;  4ZYH A;  5ILS A;  4WK8 F;  4YFX F;  1ETW A;  2L9S A;  2ZFW A;  1FTT A;  3CF5 F;  2KIU A;  5HOO A;  4MQV A;  4P5O A;  1SEU A;  4RMN A;  3K1M A;  2R5Y A;  1O7L A;  3BLY A;  1Z77 A;  4IX7 A;  2RNG A;  3BJ6 A;  2ISZ A;  1P4A A;  1R1U A;  2MFZ A;  2P6S A;  3KP3 A;  5HLI A;  2JA7 J;  2RC4 A;  3ZQG A;  4WWC A;  1A36 A;  2ME0 A;  3GFL A;  1H9T A;  5C4J J;  2KL4 A;  2DA5 A;  1UJ8 A;  2DDA A;  2VBX A;  4AVP A;  4WXD A;  4C3J J;  1MJB A;  2Y69 H;  4BE0 A;  3NQO A;  4QPQ A;  3H0D A;  4A3C J;  3Q0V A;  2A61 A;  3KFW X;  2RQP A;  4E7I A;  5FJ8 J;  2HYF A;  3G1M A;  1JT0 A;  3TW7 A;  5ILV A;  1TP4 A;  2MBF A;  2W7N A;  2FML A;  4BJ5 C;  3IRQ A;  2K3F A;  3OY9 A;  2LF7 A;  1TNS A;  1ZAO A;  3N97 A;  1D8J A;  5EZG A;  1CF7 A;  2JN6 A;  3BPV A;  5FGM A;  5F27 A;  4RGU A;  3OOU A;  5DDG A;  3LWF A;  5KAI C;  4M73 A;  3BQZ A;  1B4A A;  2HZD A;  3KP5 A;  4RGR A;  2CG4 A;  2M8G X;  3BT9 A;  3PUF A;  3LST A;  3OYG A;  3JRC A;  3CES A;  2JA8 J;  3RDI A;  4M3F A;  3H3Z A;  4UUT A;  4ZZD A;  3WTU C;  1OMI A;  3ZXS A;  4RB1 A;  2EWN A;  2EFW A;  3H35 A;  3EPZ A;  3R6S A;  2MG4 A;  1WJD A;  4CHU A;  1X3U A;  3TED A;  3V4G A;  4B3X A;  1APL C;  2GA1 A;  4X1E A;  4CCN A;  2QBY B;  1GLN A;  1WGX A;  4NC6 A;  5LBQ A;  5A2Q Z;  5DV5 A;  4NC8 A;  4O5V A;  1Z67 A;  2DA1 A;  1T0F A;  4I7H A;  4AYB N;  3W2W A;  1W36 C;  1YIT I;  3BPX A;  1IV8 A;  3QPH A;  1DPU A;  1WH7 A;  3IRR A;  1YRN B;  4NC7 A;  2ZNY A;  5FD6 A;  3M8E A;  3HRM A;  3PSF A;  4XKC A;  1A6Q A;  2L01 A;  2H8R A;  2XSJ C;  1RET A;  4KIF A;  3WOD F;  1B59 A;  3I9V 2;  3VPR A;  4MNU A;  3I54 A;  3H9J A;  4RAF A;  4M9Z A;  4XON A;  3ECH A;  4L9T A;  2D5V A;  2M1B A;  2W25 A;  1BA5 A;  1K78 B;  4IHX A;  2KT0 A;  2X51 A;  4AYB A;  1EJ9 A;  1MH3 A;  4KA4 A;  4A3J J;  3HEF A;  1WSU A;  2GZW A;  3CJT B;  3KYL A;  4A93 J;  1J09 A;  4FT8 A;  4GYG A;  3EQL F;  1R00 A;  3GCM A;  2DA3 A;  5M3M J;  1K4S A;  3GTK J;  2LBF A;  4ZDP A;  2CW0 F;  1S3J A;  4IRG A;  3I3L A;  2C6Y A;  4ZTJ A;  5FB2 A;  3CUQ C;  2RQQ A;  1XG1 A;  3Q0U A;  5J3L A;  1ETX A;  1WWX A;  2CO5 A;  3ASN H;  1BI2 A;  3HOX J;  4WF2 A;  3WHB A;  3QAH A;  4EM2 A;  3C1D A;  4MTE A;  4LLN A;  4IO9 F;  2DMP A;  1FC3 A;  3KYC B;  4MO7 A;  3ZMZ A;  2K9L A;  1ZR2 A;  3RJP A;  2MD5 A;  3PIO F;  3OMY A;  4BQN A;  2LKX A;  1K7A A;  4UV9 A;  2BW3 A;  3HIF A;  1IC8 A;  5K5Q A;  1XCV A;  1XDU A;  5KVR A;  3JRH A;  3ZQL A;  5E20 A;  2ELK A;  3TDU C;  1WH5 A;  2HYG D;  3BY6 A;  3TOB A;  3BG5 A;  5HS7 A;  1FMW A;  3IC7 A;  1MBH A;  1BC7 C;  3SFI A;  2DMN A;  5DD4 A;  1QPM A;  4QPO A;  5LHH A;  1JGG A;  1ETK A;  1U6G A;  3I4P A;  3S32 A;  2IA2 A;  3BG9 A;  1ZRE A;  1LDD A;  1DU6 A;  2D2W A;  2V4J C;  2K40 A;  3K4K A;  1LEB A;  5H6R A;  2R7U A;  1Y8R B;  1FLI A;  1A6I A;  1FBU A;  2JK3 A;  4U88 A;  3J7Y J;  4IL6 C;  2OQR A;  3H92 A;  2LP0 A;  4CGZ A;  4EJO A;  2N8G A;  2TDX A;  2JWT A;  3A0H C;  3LA7 A;  3T8R A;  2R7X A; 
#chains in the Genus database with same CATH homology
 3HSE A;  3H3U A;  4K2E A;  1JE8 A;  3E6D A;  3ZP5 A;  3R61 A;  2IVM A;  3C7J A;  2Q2E A;  2KRF A;  1PP7 U;  5TRD A;  1YLF A;  5JI6 A;  3O2P E;  1XMK A;  3F6O A;  1XD7 A;  1P6R A;  3Q9V A;  1R1V A;  3T0Y A;  2XVC A;  3SHF A;  1W7P D;  1SD5 A;  5LGU A;  1RNL A;  2G7U A;  2QQB A;  3ECO A;  5D4R A;  2E7X A;  2L54 A;  2DPD A;  2M30 A;  1O7F A;  1V3F A;  4KMU X;  2KJC A;  5F6F A;  2PLY A;  1PUE E;  4E70 A;  4UNO A;  2VOO A;  1IW7 F;  2OA4 A;  4TV7 A;  4KIB A;  1FWZ A;  4CDG A;  2O61 A;  2BBY A;  4A6D A;  2EFQ A;  1TW3 A;  1IZ1 A;  3Q5F A;  2V6C A;  2ZCW A;  2HS5 A;  2FU4 A;  3KP4 A;  1A04 A;  1KGS A;  1USS A;  4DQ2 A;  2QYO A;  4YIF A;  4U0V A;  2YX7 A;  4BAY A;  1TQI A;  4L5J A;  4LFU A;  2QM3 A;  4MGR A;  3DKW A;  2P7C B;  1YS7 A;  3TQN A;  2P7V B;  2HDC A;  1B1B A;  3F8C A;  1G3Y A;  3NEU A;  1HKS A;  4RGS A;  4EJT A;  2MA3 A;  1GXQ A;  3MEX A;  2G7H A;  1ZYR F;  1K79 A;  5D8K B;  2MLK A;  2DK8 A;  2VBW A;  2KJB A;  3RKW A;  3VOE A;  1YFH A;  2A6H F;  1LEA A;  5D5X B;  2EV6 A;  3V7S A;  5ICG A;  1FP1 D;  4B09 A;  3QOP A;  3O3K A;  1YO5 C;  2D45 A;  1OYW A;  5E1X A;  3HRT A;  3P9C A;  3GFM A;  4BYY A;  2HQR A;  2ZO4 A;  4HYE A;  1KQ0 A;  5ED4 A;  4P96 A;  1R7J A;  3BZ6 A;  4G7H F;  2HWV A;  1GVJ A;  2HTJ A;  3KZY A;  2JTV A;  4HQE A;  3ZMT A;  3U9G A;  3ROU A;  1ON2 A;  2RDP A;  4AIK A;  1FSH A;  2FE3 A;  1WRJ A;  3T5X A;  1OYI A;  3HSR A;  3COA C;  4I01 A;  3M7G A;  3L7W A;  3KP7 A;  5H20 A;  3HHG A;  5J6X A;  3RPQ A;  2VT2 A;  3FXR A;  3HYI A;  2ZME B;  5LHG A;  3FXU A;  4Q4Z F;  3HOS A;  3E6C C;  2HTS A;  3ULQ B;  4HF2 A;  2FSW A;  1XGN A;  1O3S A;  5L3F A;  3WTS C;  4L0Y B;  1W7P A;  4WX9 A;  1TTY A;  5BOX A;  1BJA A;  3ELK A;  3R60 A;  3WTT C;  3FMS A;  3HRU A;  4UHT A;  2F5E A;  4HX8 A;  1ON1 A;  1RUO A;  4L0Z B;  1P92 A;  2G9W A;  4LK0 F;  3D0S A;  3OV8 A;  4S05 A;  1T2K A;  3BJA A;  1R1T A;  4LGW A;  1ZRC A;  2IRF G;  3SXY A;  3V8J A;  4HOB A;  1UB9 A;  3WG9 A;  2EK5 A;  1QNT A;  3GVA A;  3GX4 X;  4CIC A;  2FBK A;  2Y0M A;  1OR7 A;  2K27 A;  2L02 A;  4WCG A;  5TJJ A;  1SAX A;  5L3G A;  2Q0O A;  2HR3 A;  3U2R A;  3DV8 A;  2Y75 A;  3TGN A;  3F8M A;  1BI0 A;  2MH9 A;  4ZZL A;  3P9K A;  1LB2 A;  4A0Z A;  3F6V A;  1XB4 A;  2XAQ A;  3J7A O;  5BMZ A;  2VON A;  3GZ5 A;  2A68 F;  2DQL A;  2DU9 A;  3O6B B;  2Q8K A;  4A5N A;  1YTY A;  5D6F A;  3GF2 A;  3T1B A;  5CVI A;  3K9T A;  1Z05 A;  1KU3 A;  1J5Y A;  2EA4 A;  2FRH A;  3RIR A;  3JTG A;  2FNP A;  1YQA A;  4BHC A;  4OMY A;  2M5W A;  3SZP A;  3ZMD A;  4QWQ A;  1W5S A;  5E8I A;  1ZHF A;  2NAZ A;  1J59 A;  5IT9 K;  4NHJ A;  3TDZ C;  1FYM A;  4JQF A;  1U8R A;  2VE8 A;  4IJA A;  1S7O A;  4OMZ A;  1IUY A;  4LB6 B;  4O6J A;  5L3E A;  1F1Z A;  5J8F A;  2ZXJ A;  2V79 A;  3FF5 A;  2NNY A;  2HKX A;  4HX4 A;  4N9I A;  1BOA A;  4JBA A;  2CSO A;  1DUX C;  4YFK F;  3KET A;  3R0A A;  3M9A A;  3CLO A;  3MAJ A;  1LNW A;  2IT0 A;  3HOT A;  4ESF A;  3WE3 A;  2OZ6 A;  5EEH A;  4B8X A;  5LEJ A;  3K69 A;  1IXC A;  2XKO A;  5LLQ A;  1Z7U A;  1REP C;  2X0L A;  4Y13 A;  5HS9 A;  1U2W A;  3D5L A;  5LRR A;  2Y48 A;  3I59 A;  2BEO A;  3FZV A;  2DQR A;  3CTA A;  2STT A;  1XSV A;  4PCQ A;  2EV0 A;  4KMF A;  5ICC A;  1FT9 A;  2QQA A;  2VBY A;  1S29 A;  4M6X A;  2IPQ X;  3K1P A;  2YX4 A;  2QBY A;  1ZG3 A;  4N9H A;  1I27 A;  5HS8 A;  1BI3 A;  4Q47 A;  1IRF A;  2LSO A;  1ZG1 A;  4OIN F;  2MH2 A;  5BPI A;  4LD5 A;  1H0M A;  2RNJ A;  3LFK A;  2DLL A;  4ZYE A;  1LVA A;  3EDP A;  1FSE A;  3GFI A;  3PFI A;  3GW2 A;  1J2X A;  2GQQ A;  1U5T C;  2L4A A;  1K6O A;  1KU9 A;  1SD6 A;  3FMQ A;  4LG0 A;  4YG2 F;  4U0Y A;  4IPA A;  4OIO F;  3TO9 A;  2EFO A;  3GUD A;  3ABU A;  2KKO A;  4RAZ A;  2NS0 A;  3GO5 A;  1EH6 A;  2EV5 A;  4BNC A;  1LDJ A;  2EFN A;  3FX3 A;  4HDU A;  2E1N A;  2YU3 A;  5HDG A;  2YR2 A;  5FFX A;  1OYY A;  5L3B A;  1MJA A;  4KDP A;  2E1C A;  1FNN A;  4LJZ F;  5BPD A;  2YPR A;  1XDS A;  1RZ4 A;  3K1N A;  4ON0 A;  1IN6 A;  1ZGA A;  1U5T B;  5ILU A;  3B02 A;  4CO8 A;  4I2O A;  1YW9 A;  2FMY A;  5D5W B;  2H94 A;  1F5T A;  1JXS A;  3IKV A;  1GXP A;  2XGX A;  1KQ8 A;  1Q1H A;  1TW2 A;  1WKM A;  4ZYG A;  4U7D A;  4PDK A;  2ADU A;  2FQ3 A;  3MQ0 A;  5CVR A;  2IW5 A;  2ACJ A;  1RI7 A;  2ISY A;  1S6L A;  1XMA A;  5LRS A;  1P4X A;  1T38 A;  4Q5S F;  4BH9 A;  3IWZ A;  3J80 K;  2KIF A;  4QLC U;  2NRA C;  4BQA A;  1P2F A;  3EYI A;  2DO7 A;  5LGN A;  4EV0 A;  2F5C A;  1VTN C;  3KEO A;  1HSJ A;  4GGG A;  3WGH A;  3IL2 A;  3F21 A;  2XHK A;  1R58 A;  2A69 F;  1V4R A;  1U3E M;  4HQM A;  2DW4 A;  1HST A;  3BDD A;  1XGM A;  2UWM A;  2V1X A;  2CGP A;  2PEX A;  1FBS A;  4AD9 A;  1G3W A;  1HQC A;  2VOP A;  3F8B A;  4EJV A;  4GXO A;  3KLN A;  5AIQ A;  5ICE A;  3I0T A;  2CFX A;  3GXO A;  4HAM A;  2O03 A;  4CZZ A;  1S8N A;  3HSF A;  1IXR C;  2X4H A;  5IT9 Z;  3ZMU A;  3DPT A;  1D5V A;  3E6B A;  2P5K A;  4CYD A;  2CYY A;  3JW4 A;  3SQN A;  1YS6 A;  4P9F A;  4RS8 A;  5E1Z B;  5DD8 A;  2HZT A;  4MTD A;  2F5D A;  4OU0 A;  1U78 A;  4LK1 F;  4UXN A;  3QP6 A;  5CJ9 A;  1UCR A;  4I0A A;  1I6X A;  4I02 A;  3E6M A;  3EET A;  3K0L A;  3REO A;  2ESH A;  1O3Q A;  3I71 A;  5LGT A;  3ZMS A;  3C3W A;  4RAY A;  1HW1 A;  2UXN A;  2W24 A;  4L9N A;  3WTW C;  4XBF A;  3R0J A;  2RV8 A;  5D4S A;  2IJL A;  2GWR A;  1MDM B;  2JZY A;  3F3X A;  2P4W A;  3RYP A;  3VEP A;  3E5Q A;  3W6K B;  3G3Z A;  2GAU A;  1ZG5 A;  1ONV A;  3EUH A;  2BYV E;  2Z99 A;  4ETS A;  5HLH A;  4HF1 A;  2P5V A;  2QVO A;  2L3D A;  4KNY A;  1ZH5 A;  2OU2 A;  1CGP A;  3SZT A;  4LB5 A;  1F9N A;  2Z5U A;  1YG2 A;  1L3L A;  2PMH A;  2UXX A;  4ESJ A;  4G6Q A;  3L9F A;  4KN7 X;  2RN7 A;  2V9V A;  1AOY A;  5A2Q K;  2XAS A;  3ISP A;  1H9G A;  2W84 A;  1KU2 A;  1W7P B;  4RGX A;  3MZY A;  1G3S A;  4ENM A;  3VOD A;  1QZY A;  4U0W A;  1JHH A;  3P7N A;  4LLG F;  2K86 A;  4RB3 C;  1YW7 A;  2EA2 A;  1E17 A;  3LQR A;  3E5U A;  1ZLJ A;  3LAP A;  3HTU A;  3ERE D;  2QUF A;  2JRT A;  3KP2 A;  1QGP A;  1SD4 A;  2PG4 A;  3ZN1 A;  2JPB A;  4U7B A;  4MEX F;  4HBL A;  3J80 Z;  4KIG A;  3RKY A;  2DK5 A;  3AAF A;  1B6A A;  3GZ6 A;  3U1D A;  3WE2 A;  1KYZ A;  4GCV A;  2M87 A;  3GWZ A;  3WTX C;  2NYX A;  3ML6 A;  3N4M A;  3KCC A;  5DUK A;  3KEQ A;  2IA0 A;  4MEY F;  1G3T A;  3K2Z A;  4IVN A;  3QU3 A;  4PZJ A;  5LHI A;  4FX0 A;  1XSD A;  4MQ9 F;  1OKR A;  1IN5 A;  1ULY A;  3RPU A;  2V1U A;  4EM1 A;  3J81 Z;  4A0Y A;  2H27 A;  2F5F A;  5JHU A;  5F64 A;  2FXA A;  4Z2Y A;  4MHG A;  5AON A;  1B9M A;  1Y0U A;  5K5R A;  3PQJ A;  3B73 A;  1SFU A;  5CVV A;  3BOQ A;  3VFZ A;  1O3R A;  4WXH A;  1L0O C;  4LLL A;  3QRF F;  1JHF A;  4P9U A;  3GLX A;  1ZRF A;  5CYV A;  3F8N A;  1ZGJ A;  1BM9 A;  2ZKZ A;  1KA8 A;  3DFG A;  3CDH A;  5JVT A;  2XIG A;  4EJU A;  1IN8 A;  2RVC A;  2XAJ A;  1YYV A;  1B9N A;  3QPT A;  4EM0 B;  2HOE A;  4GYI A;  1ZRD A;  1J9I A;  5DYM A;  1QBJ A;  1GHC A;  1XCB A;  1D3Y A;  2OAZ A;  5CVJ A;  1Z9C A;  2QWW A;  3DF8 A;  1UHM A;  2GXB A;  2Z3Y A;  4HLY A;  1J7K A;  4ASN A;  1HKQ A;  4L9V A;  1CF7 B;  1KQ9 A;  4I98 B;  5CVU A;  5BQT A;  2O8X A;  3G73 A;  1EH7 A;  1J0R A;  5LEK A;  1Z1D A;  3FWE A;  2B0L A;  2DTR A;  3ZPL A;  2XKP A;  4GO1 A;  3I64 A;  4I09 A;  5FO5 A;  5E18 F;  4FX4 A;  2L4M A;  1MDM A;  3ZQ7 A;  4S04 A;  2IP2 A;  1WQ2 A;  3CO6 C;  2HKO A;  5BS6 A;  3I53 A;  2EB7 A;  1MD0 A;  2DI3 A;  1G6N A;  1KU7 A;  2RGV A;  2MC3 A;  3OOP A;  4BHP A;  5FLX Z;  2JPC A;  3HHH A;  3WGG A;  2PFB A;  4EGZ A;  2Z33 A;  4AIH A;  1IXS B;  1T6S A;  3Q9S A;  2J5P A;  1RIO H;  2A3S A;  3L00 A;  3KE2 A;  4LG0 B;  2ZJ2 A;  4HDV A;  1BN5 A;  1HXD A;  1QO0 D;  1BBY A;  3V8K A;  2H09 A;  4P55 A;  2XRN A;  4PGG A;  2PMU A;  3IWF A;  2P8T A;  2K4J A;  1R23 A;  1PP8 F;  4KFC A;  1ZN2 A;  3TO6 A;  1RUN A;  4Q48 A;  2AXL A;  3DEU A;  5FD5 A;  2R7D A;  4R8H A;  3FHZ A;  4XSZ F;  3FMR A;  3CJN A;  3FM5 A;  1DDN A;  2J5O A;  3V8L A;  1K78 A;  2FA5 A;  3CUO A;  1I5Z A;  4IRI A;  1S7A A;  5E1W A;  4M9S A;  2Z9O A;  3I59 B;  1EH8 A;  3LA3 A;  3C18 A;  1SMT A;  2DPU A;  4FHT A;  1JGS A;  2XV4 S;  2A6E F;  2FEZ A;  2K02 A;  3F72 A;  2EJR A;  4IHS A;  1TNT A;  3ABT A;  3DXJ F;  1HBX G;  2OQG A;  4A5M A;  5F1R A;  1Z6T A;  2ZNZ A;  4EGY A;  2NNN A;  2O6G E;  2PI0 A;  3I58 A;  4A6E A;  5DCM A;  1I1S A;  1P4W A;  4KT5 C;  3M1E A;  2P5L C;  3VB2 A;  2JSC A;  3BP8 A;  2GXG A;  2RKH A;  4Y17 A;  5DUI A;  4H0E A;  1IF1 A;  3S2W A;  2UZK A;  1EV7 A;  3F8F A;  2FOK A;  1R5H A;  1MGT A;  3GYH X;  3CUQ B;  2MLG A;  1DP7 P;  3DQV C;  1IAW A;  3JAM K;  3FM3 A;  5E17 F;  3PQK A;  2COM A;  2W57 A;  4M9X A;  1MKM A;  1LDK B;  4KUM A;  3GEZ A;  3IKT A;  3MFK A;  2CWE A;  1TBX A;  1NHA A;  3KLO A;  1IN7 A;  4EMS A;  2VC1 A;  3WTV C;  3ZMV A;  4F7Z A;  1KYW A;  1QQI A;  1C0W A;  5HLG A;  5CLS A;  4CXF A;  3LA2 A;  3QU6 A;  2VXZ A;  2ZBK A;  5DCM B;  5JR3 A;  2F2E A;  4KYW A;  1UFM A;  2QEN A;  2DBB A;  4A2U A;  1STZ A;  5FFZ A;  5D8L B;  5HDK A;  5JFR A;  1R5G A;  1SD7 A;  1FZP B;  3J81 K;  2ETH A;  3BRO A;  1O3T A;  3BJO A;  1OPC A;  3SFZ A;  4UVB A;  2PBI A;  3HTS B;  3T8T A;  3CUQ A;  1ODD A;  2VC0 A;  4IRH A;  4Y15 A;  2P6T A;  4I0B A;  4IF4 A;  4R1H A;  4HLX A;  1QZZ A;  2EFP A;  3TOA A;  3M8F A;  2HEO A;  3RI4 A;  3MZH A;  1R22 A;  3V7R A;  2K4B A;  3LAJ A;  3WU0 A;  1D8K A;  3HUG A;  2VBZ A;  3V7C A;  4OIQ F;  3KP6 A;  4YFN F;  2FNA A;  4M72 A;  2ELH A;  4EJW A;  1W4M A;  2AS5 F;  4ENJ A;  1BIA A;  4RB2 C;  3JSO A;  2IA1 A;  5J8C A;  2FBH A;  1WI9 A;  4O3M A;  1UST A;  4AWX B;  5AIP A;  3FXQ A;  2A07 F;  1FOK A;  1G4D A;  4LMY A;  2VT3 A;  4UUV A;  3W6J B;  2M45 A;  1YW8 A;  2W85 A;  3E3V A;  2JT1 A;  5L3C A;  5D5V B;  4HZF A;  1XSX A;  2DT5 A;  2R3S A;  3MCZ A;  1TLH B;  3TO7 A;  2V1D A;  2CQK A;  2H6C A;  4BXU A;  3JTH A;  1U5T A;  4NQW A;  4M6Y A;  2ESN A;  4G7O F;  3HRS A;  1BIB A;  1J75 A;  1FBQ A;  2PN6 A;  2HQN A;  2R7F A;  3NRV A;  4PGH A;  4M71 A;  3L2C A;  1SMY F;  3I5U A;  1FPQ A;  2DFI A;  4G94 A;  3QP5 A;  2FBI A;  4EQQ A;  4HV6 A;  5L3D A;  5D6E A;  1I1G A;  1TQM A;  2FF4 A;  2XAG A;  1SFE A;  3RKX A;  2WV0 A;  2XAH A;  4HV5 A;  3P9I A;  1FY7 A;  1Z91 A;  3IHU A;  1MZB A;  2HGC A;  4HA8 A;  4ZH4 F;  4OOI A;  1TQP A;  1HW2 A;  3RTR A;  4HF0 A;  5K5O A;  4YII A;  3EYY A;  2OZU A;  4UVC A;  4L5I A;  2STW A;  3F22 A;  3WGI A;  4XLP F;  3F23 A;  3RYR A;  2WC2 A;  4L9J A;  2VE9 A;  3WU1 B;  4XSX F;  2PJP A;  4ZYD A;  4R79 A;  3GFJ A;  4KIC A;  1BC8 C;  1HKT A;  1IN4 A;  1XN7 A;  4G9Y A;  4JK1 X;  5H6Q A;  3BWG A;  1F4K A;  3KZZ A;  2O3F A;  4RB0 A;  2QLZ A;  1ZAR A;  1YIO A;  4N0B A;  2O0Y A;  2GIV A;  2OBP A;  2VOD A;  3E5X A;  4G8X A;  1XGO A;  2BV6 A;  4BHB A;  6PAX A;  5FLX K;  4EVI A;  3JSP A;  4A0X A;  2WWY A;  4WXC A;  1R36 A;  5KK1 A;  3TKY A;  5EEG A;  1FX7 A;  1LJ9 A;  4IHT A;  2QZ8 A;  3WTY C;  5DCF A;  1SFX A;  1Z6R A;  2KIM A;  2QQ9 A;  2GA2 A;  2LKP A;  4OIP F;  4UVA A;  4HW0 A;  3LQQ A;  4D0P A;  1PDN C;  1LQ1 A;  5E8G A;  1FYK A;  3MWM A;  1BI1 A;  1IRG A;  1T98 A;  3JAM Z;  1MJ9 A;  4ESB A;  4ENK A;  1HW5 A;  1UHW A;  2VN2 A;  5HVQ C;  3DPL C;  1AWC A;  4DNC A;  4AIJ A;  4L18 B;  1E2X A;  2DAO A;  5HDN A;  2LDU A;  3ZN0 A;  5K1Y A;  1XGS A;  2H6B A;  3L09 A;  3R4K A;  2BE5 F;  2D1H A;  2LNB A;  1ZLK A;  2WTE A;  3E97 A;  2K7L A;  2PQ8 A;  4G7Z F;  2XRO A;  4A12 A;  3WTZ A;  3CO7 C;  2ZME A;  4XLN F;  2A5Y B;  2XUB A;  1FYL A;  4XRF A;  2OD5 A;  2E7W A;  5ICF A;  4HX7 A;  4ENN A;  4OIR F;  1DPR A;  2HFH A;  4G6D A;  2LF8 A;  1O57 A;  4M74 A;  1W5T A;  5IT3 A;  5ERI A;  2YSR A;  3DP7 A;  2M8E A;  4IXA A;  5DEQ A;  2D1V A;  4UV8 A;  2XAF A;  4NB5 A;  1T39 A;  2BGC A;  5D5U B;  4KN4 X;  1FP2 A;  4ZYH A;  5ILS A;  4WK8 F;  4YFX F;  2ZFW A;  2KIU A;  5HOO A;  4MQV A;  4P5O A;  3K1M A;  1O7L A;  3BJ6 A;  2ISZ A;  1P4A A;  1R1U A;  2P6S A;  3KP3 A;  5HLI A;  2RC4 A;  4WWC A;  3GFL A;  1H9T A;  4AVP A;  2VBX A;  4WXD A;  1MJB A;  3NQO A;  2A61 A;  3KFW X;  2RQP A;  2HYF A;  5ILV A;  2MBF A;  2FML A;  3IRQ A;  2LF7 A;  1TNS A;  1ZAO A;  3N97 A;  1D8J A;  1CF7 A;  5FGM A;  3BPV A;  4RGU A;  5DDG A;  3LWF A;  4M73 A;  1B4A A;  3KP5 A;  4RGR A;  2CG4 A;  3LST A;  3RDI A;  3H3Z A;  4ZZD A;  3WTU C;  1OMI A;  4RB1 A;  2EWN A;  2EFW A;  3R6S A;  4CHU A;  1X3U A;  3V4G A;  2GA1 A;  2QBY B;  5LBQ A;  5A2Q Z;  5DV5 A;  4O5V A;  1T0F A;  4I7H A;  3BPX A;  3QPH A;  1DPU A;  3IRR A;  2ZNY A;  5FD6 A;  3M8E A;  3HRM A;  2L01 A;  4KIF A;  3WOD F;  1B59 A;  4MNU A;  3I54 A;  4M9Z A;  3ECH A;  4L9T A;  2M1B A;  2W25 A;  1K78 B;  4KA4 A;  1WSU A;  2GZW A;  4FT8 A;  4GYG A;  3EQL F;  1R00 A;  2CW0 F;  1S3J A;  4IRG A;  2C6Y A;  5FB2 A;  3CUQ C;  1WWX A;  2CO5 A;  1BI2 A;  4WF2 A;  3QAH A;  4EM2 A;  3C1D A;  4MTE A;  4LLN A;  1FC3 A;  3ZMZ A;  3RJP A;  2MD5 A;  1K7A A;  4UV9 A;  3HIF A;  5K5Q A;  1XCV A;  1XDU A;  5KVR A;  5E20 A;  3TDU C;  2HYG D;  3BY6 A;  3TOB A;  5HS7 A;  3IC7 A;  1BC7 C;  5DD4 A;  1QPM A;  5LHH A;  1U6G A;  3I4P A;  2IA2 A;  1ZRE A;  1LDD A;  2D2W A;  1LEB A;  5H6R A;  1FLI A;  1FBU A;  4U88 A;  2OQR A;  3H92 A;  4CGZ A;  4EJO A;  2TDX A;  3LA7 A;  3T8R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...