1HKSA

Solution structure of the dna-binding domain of drosophila heat shock transcription factor
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
106
structure length
106
Chain Sequence
GSGVPAFLAKLWRLVDDADTNRLICWTKDGQSFVIQNQAQFAKELLPLNYKHNNMASFIRQLNMYGFHKITSIDNGGLRFDRDEIEFSHPFFKRNSPFLLDQIKRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEAT-SHOCK TRANSCRIPTION FACTOR
publication title Solution structure of the DNA-binding domain of Drosophila heat shock transcription factor.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription regulation
total genus 11
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1994-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00447 HSF_DNA-bind HSF-type DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1hksA00
1YQAA 1O57A 5J8CA 2LNBA 1EH8A 5LGUA 1DDNA 5D4SA 1L3LA 1K78A 4HQEA 1FBUA 2D1HA 2FBHA 2BE5F 3SHFA 1KU7A 2VODA 1E2XA 2LF8A 2VXZA 5CVJA 3V7SA 2BGCA 3BZ6A 1TQIA 5DCMB 4UVAA 2XAQA 4B09A 1FYMA 5LLQA 4EJVA 2ADUA 3HSFA 5CVRA 2VOPA 3B02A 3R0AA 1FOKA 4G94A 4HV6A 2PBIA 3QP6A 1MJBA 3DPLC 5AONA 2FBIA 3D5LA 3F8FA 3WGHA 4IRGA 2J5OA 3HHGA 2GWRA 3O3KA 4HW0A 4ENJA 3LWFA 1D8KA 5DD8A 1EH6A 1R1VA 1LDJA 3ML6A 3I71A 4BAYA 2KJBA 1K79A 1JGSA 2LF7A 3NEUA 3F21A 2G7UA 3HRTA 2L3DA 3KFWX 3RKWA 4I01A 3T0YA 3ERED 2XKOA 4CO8A 1FBSA 1S7AA 3KP4A 2DBBA 3ZMSA 1ULYA 5LEKA 4CZZA 2M8EA 1YIOA 1TLHB 1USSA 1HSJA 1IAWA 1FY7A 2RDPA 2UXXA 2QQ9A 3EDPA 2EFWA 1P92A 3F3XA 5K5OA 2V9VA 5E17F 4ZZLA 5CJ9A 4OIOF 1LJ9A 2M87A 3GVAA 1VTNC 2Q2EA 3ROUA 1R00A 3ZMVA 4IJAA 3ZMDA 3LA3A 2K02A 1SD5A 3ZMTA 3WTVC 2EFNA 1P2FA 3GUDA 2VC0A 5JVTA 2D45A 3TOAA 3KETA 3COAC 2FSWA 3KZZA 4UNOA 2LKPA 1F4KA 4LG0A 5BPDA 3G3ZA 1J5YA 3WE2A 3I64A 2FEZA 2JPBA 1RUOA 4HLYA 5LRRA 2HQNA 2OBPA 3RTRA 5CVUA 2H94A 4I2OA 2ZXJA 2NYXA 4MEXF 4G6QA 4RGRA 1T2KA 1SMYF 3DEUA 1FPQA 4L5IA 3L9FA 3FMRA 1Z6RA 4ENKA 2WTEA 2NS0A 3IL2A 3JSOA 3RYRA 1HW1A 1WWXA 4ESJA 2EWNA 3MAJA 4L18B 1OKRA 3TO9A 2STTA 4YIIA 3ZN0A 1O3SA 1B59A 3CUQB 5HDGA 2XUBA 2FE3A 4EGZA 3N4MA 3SZPA 4NQWA 5D6FA 2F5EA 4JQFA 4FX0A 2XAJA 3MZYA 1GVJA 3W6JB 1UHMA 3C1DA 5FO5A 4CICA 4LB5A 2HOEA 3JSPA 2FMYA 2QLZA 3GF2A 3DKWA 2QUFA 2OZUA 2GA1A 5LBQA 1K7AA 2EFQA 2QVOA 3V7RA 3WTYC 2QYOA 3D0SA 2L4AA 1LQ1A 5E8GA 3HTSB 4HX4A 2EA4A 4EJTA 2XV4S 2FBKA 5LGNA 3LFKA 2VBWA 2JRTA 3RPUA 3TQNA 4A0ZA 4LGWA 2RKHA 5FB2A 1BI2A 4OIPF 1FP2A 4OIRF 1YW9A 3K2ZA 4AIJA 1MZBA 1FLIA 1Z91A 4A2UA 4KA4A 3FF5A 2YR2A 4A5MA 1R22A 3WU1B 1XB4A 1LB2A 3T1BA 2XROA 3KZYA 5A2QK 2HZTA 5LGTA 3V4GA 1XSXA 1DUXC 4IVNA 1KU9A 3HOTA 3SZTA 1JHFA 2IT0A 5L3CA 5J8FA 4P55A 3SXYA 3WG9A 2DPDA 5BPIA 4LFUA 1SFEA 2QWWA 1L0OC 3QU3A 2IA2A 2CW0F 3Q9VA 4WXCA 1O3TA 2PI0A 2VBZA 5F6FA 1H0MA 3F22A 3FWEA 4RB2C 2ESNA 3GLXA 3WE3A 3BROA 3PFIA 1TQMA 1T98A 1MGTA 2IPQX 2V1UA 2DQLA 5HLHA 3BOQA 2WV0A 2ZBKA 4YFNF 3I59A 3Q9SA 2HWVA 1RI7A 5D5WB 1KGSA 5DDGA 1BI0A 3K0LA 4ETSA 1S8NA 5J6XA 2K86A 3QU6A 4H0EA 4PZJA 1QBJA 2A5YB 4HBLA 1I5ZA 1R1UA 4IRIA 1IF1A 4HAMA 3DV8A 3FMSA 2ZMEA 4PGGA 4D0PA 3E6CC 3K1NA 2VN2A 2W57A 5LHGA 2XVCA 4O3MA 1HSTA 2X4HA 4BH9A 3F8MA 2OU2A 1F9NA 1IUYA 3J7AO 2CGPA 1W5TA 4HZFA 3J81K 3LA2A 5CVVA 1UCRA 2JPCA 1ZRDA 3JAMZ 3FMQA 3IRRA 2ESHA 1I6XA 1LDKB 1SAXA 2KIFA 3GFLA 2VOOA 4Q47A 1S6LA 1T6SA 2PEXA 4A5NA 2DQRA 2EA2A 3GWZA 4YFKF 1O3RA 4K2EA 5HOOA 3CO6C 4KIBA 1ZG5A 4FHTA 1W5SA 2QENA 1HKSA 3EYIA 5AIPA 3QPTA 3M7GA 1YS7A 3FM5A 4HYEA 2J5PA 5H20A 4WX9A 1Q1HA 3CJNA 1GHCA 2Z33A 2A6EF 3KLOA 2C6YA 2BBYA 2XIGA 1E17A 5E1XA 4HLXA 3TDUC 2EFPA 1NHAA 3LQQA 4RGXA 5E1ZB 3TKYA 4BHPA 3O2PE 1PUEE 2M30A 3F6OA 3OOPA 3ZN1A 2DPUA 2KJCA 4RGSA 1OYWA 2HS5A 3GZ6A 2Z9OA 1MJAA 1OR7A 1LDDA 4OU0A 4I98B 1BC7C 2HYFA 1W7PA 2R3SA 4M74A 3RIRA 3CDHA 1FX7A 4QLCU 4KUMA 1XMKA 1Z9CA 4MTEA 3ECHA 4M6YA 3F8BA 4IPAA 5FFZA 1G3TA 3TGNA 5KVRA 1U2WA 2A68F 5DV5A 2Q0OA 2ACJA 1BI3A 2FQ3A 3WTTC 3RYPA 5HLGA 4Y15A 3SQNA 2A61A 2PFBA 5L3EA 1U78A 2QQBA 2A3SA 3VEPA 4RS8A 2KRFA 2PMHA 1TQPA 3KE2A 3KP7A 1ZYRF 1TTYA 4LLGF 4A12A 2DAOA 1TW2A 2D1VA 1FT9A 4Q48A 3V8JA 3BJAA 4M71A 3MCZA 4EM2A 3E6BA 1R5GA 3GXOA 2MH2A 4KMFA 3HSEA 3NQOA 1ODDA 3KCCA 3GX4X 4YFXF 5BQTA 2IP2A 3M8EA 4GO1A 4M73A 3J81Z 2FMLA 1U5TA 3ZQ7A 5BS6A 1MDMA 5HVQC 2E7XA 4EJWA 3WTZA 2K4BA 2PJPA 5ILSA 2RV8A 2H6BA 4OOIA 4Y13A 2V6CA 2CFXA 4G6DA 1S7OA 2QM3A 3F8NA 1WQ2A 2P6SA 1T39A 1FSEA 5L3GA 1REPC 2GIVA 2VONA 1WSUA 4HF0A 2HFHA 2V1DA 5D5XB 4MQVA 3ABTA 2QBYB 3O6BB 1J75A 2VT3A 3BDDA 2GXBA 2X0LA 2CSOA 1T38A 3ZMUA 2MH9A 3WTSC 3R0JA 4Y17A 2XKPA 5ICCA 3ULQB 3M1EA 4WWCA 4M72A 1USTA 4UV8A 4MGRA 2PLYA 2VC1A 3VODA 3C18A 3HYIA 4WK8F 4CHUA 1BOAA 1OMIA 5D8LB 5AIQA 3JTHA 3P7NA 2DT5A 3B73A 1I27A 3HTUA 5JHUA 4IHTA 3RI4A 1FP1D 4WCGA 4LLLA 3HHHA 2ZJ2A 5FLXK 4R1HA 4EJOA 5ED4A 1J9IA 1XGMA 5HS9A 4M9XA 2O61A 1G3SA 5DCMA 3WTXC 1FNNA 3ZMZA 5D5UB 1K6OA 2HKXA 3C3WA 4U0VA 2ETHA 4F7ZA 4EQQA 3I54A 2GQQA 3VOEA 4XLPF 4XSZF 1CF7A 1FYKA 1ON2A 1I1SA 2EFOA 1YO5C 1PP7U 4HQMA 5CVIA 3I59B 4RB3C 1TNTA 2TDXA 4L9NA 5FD6A 1ON1A 3KP5A 1LVAA 4AIKA 4HDUA 1ZREA 5TRDA 2XGXA 2Y0MA 1BBYA 2AS5F 2K4JA 3WTWC 5BMZA 2JSCA 4L9VA 1PP8F 2XHKA 2EB7A 4AD9A 5L3DA 2GXGA 1BI1A 4HDVA 3FHZA 3FM3A 1HW2A 4HOBA 2K27A 3IKTA 2UXNA 3KP3A 3KEQA 3CLOA 1YS6A 1QPMA 4HX7A 4U0WA 4N9HA 3DXJF 2FNAA 1IN7A 2RVCA 3DP7A 3PQJA 2DU9A 1RZ4A 5FGMA 2FOKA 4BYYA 4U0YA 3CTAA 3L2CA 3V8LA 3RJPA 1ZGJA 5E1WA 5ERIA 2FNPA 4CGZA 4RAZA 3KEOA 3U1DA 1FZPB 1IXSB 4PDKA 5TJJA 1SFUA 2M45A 1GXQA 1QNTA 3I53A 1BC8C 4PCQA 1UFMA 1ZG1A 4ZYDA 2CQKA 1Z7UA 3KP2A 4S04A 2IW5A 4M6XA 4U88A 2IA0A 4LD5A 2OQGA 4MQ9F 4P9FA 2OAZA 4GGGA 5JR3A 2VE9A 1Y0UA 2L02A 3ECOA 2DI3A 3MFKA 5E8IA 2PN6A 1UB9A 2QQAA 1R58A 4ESFA 2P7VB 4L0YB 1X3UA 2FU4A 2A69F 5CYVA 4ENNA 2ZNYA 1P4XA 4I7HA 4YIFA 1R7JA 2O6GE 4E70A 4MTDA 1O3QA 3BJ6A 3MZHA 1HBXG 1GXPA 3WU0A 2Z99A 2EK5A 4ASNA 2EJRA 1TNSA 1RIOH 2AXLA 1XDSA 1IXCA 2YPRA 3R6SA 2NNNA 2HGCA 1XCVA 1XSVA 3E5UA 2K7LA 5FLXZ 4ON0A 2P7CB 4I0BA 1S29A 3ABUA 1J59A 1QZZA 1K78B 1B4AA 2ZO4A 4HF2A 3I5UA 1G3WA 3CUQA 3RKXA 5LRSA 5ILVA 4BNCA 4OINF 3BWGA 2M1BA 2P5KA 5ICEA 4HV5A 2HKOA 2ISYA 2KIMA 2ISZA 3H92A 2W85A 1TBXA 3GZ5A 2YX7A 1BIAA 3R4KA 2O03A 2MLKA 3WODF 4ZYHA 5D6EA 4UXNA 1IRFA 1AWCA 4CDGA 2FXAA 1SD7A 5IT9K 3K1PA 1YYVA 1ZLJA 3RDIA 2R7DA 5ICGA 3FXRA 1KYWA 4LK1F 2R7FA 1HXDA 2RC4A 2NRAC 1D3YA 1W7PD 1G6NA 4UVCA 1Z05A 2V1XA 4ENMA 2DO7A 4UV9A 3GEZA 1ZGAA 2L54A 2RQPA 1PDNC 4JBAA 1U5TB 5CLSA 3FXQA 3S2WA 1H9GA 2F5CA 3QRFF 2P5LC 3L7WA 1R5HA 3WGIA 2VT2A 4BHCA 1RNLA 3E97A 2IVMA 2ELHA 1IW7F 2Z3YA 4EVIA 2OQRA 3ELKA 1FSHA 4BHBA 1CGPA 5HDNA 1ZH5A 3AAFA 1KA8A 5DCFA 1D5VA 1BJAA 1XSDA 3EYYA 1IN4A 2RNJA 3KP6A 1IN6A 3HSRA 2YX4A 4XSXF 4TV7A 3L00A 4YG2F 5A2QZ 4Q5SF 1OYYA 3K69A 3ZP5A 1IZ1A 4WF2A 3QPHA 2KKOA 1C0WA 1XGNA 4G7OF 1UHWA 1P6RA 4RB0A 4LMYA 4GCVA 1WKMA 2ZCWA 2P8TA 3QOPA 5K1YA 2VBXA 4KNYA 3R61A 1ZARA 3GFJA 3HUGA 3JTGA 3T8TA 1STZA 3E6DA 1QO0D 2NNYA 4UUVA 2XAGA 1AOYA 2YU3A 1QGPA 3ISPA 1LEBA 4WXDA 1U6GA 2COMA 4LG0B 3U2RA 3ZPLA 4LLNA 4IHSA 2OD5A 1SD4A 5LHIA 4MEYF 3GFIA 1WI9A 2Y48A 4OMZA 3TDZC 5E20A 1FBQA 4ESBA 4ZYGA 1SFXA 4ZZDA 3HIFA 1RUNA 1A04A 2W25A 3HRSA 3N97A 4KN7X 4RAYA 2RN7A 5DYMA 1CF7B 3RKYA 4PGHA 1J7KA 4G9YA 2Z5UA 2E1CA 3WGGA 3K1MA 4LJZF 4CXFA 4A0XA 1HW5A 3E5XA 2L4MA 3E3VA 4GYGA 4DNCA 2E1NA 3LSTA 5H6RA 4LB6B 2XAFA 1FYLA 4EV0A 4KMUX 3U9GA 4Q4ZF 6PAXA 1ZRCA 5IT9Z 4DQ2A 4LK0F 1G3YA 2CWEA 5DUIA 3RPQA 3TO7A 2GAUA 3L09A 3IRQA 3F72A 2XRNA 1IRGA 3PQKA 1BN5A 1QZYA 4O6JA 1EV7A 3MEXA 3FXUA 2MLGA 3H3ZA 4QWQA 2OA4A 5HDKA 4M9ZA 2F5FA 1YW7A 3WTUC 2WWYA 3LQRA 1T0FA 3P9KA 2M5WA 4KFCA 2BYVE 3LA7A 2FF4A 4AVPA 1J2XA 1OPCA 3K9TA 5FD5A 5ICFA 2DFIA 2HDCA 2GA2A 2HTJA 2GZWA 1R36A 4M9SA 2NAZA 4FT8A 4B8XA 4MNUA 1YTYA 2O8XA 3R60A 4U7DA 3TO6A 3HRMA 4GYIA 1XGOA 1ZHFA 2BV6A 1Z1DA 2VBYA 1KQ8A 2DW4A 4AWXB 3CUOA 4P96A 3W6KB 4GXOA 1O7LA 3H3UA 4O5VA 1XMAA 2IJLA 3FX3A 4U7BA 4G8XA 1B9MA 1YW8A 2IA1A 3IWZA 1B9NA 1U5TC 3M8FA 3V7CA 2DK8A 4UHTA 4S05A 2UZKA 2DLLA 5DEQA 2MBFA 1QQIA 4P9UA 1YG2A 1YFHA 3BY6A 2P5VA 2WC2A 4CYDA 4IXAA 3SFZA 2G7HA 2Q8KA 3IHUA 1OYIA 4KYWA 3JAMK 5EEGA 3M9AA 1TW3A 2F5DA 2QZ8A 2ZMEB 4FX4A 4L9JA 1R1TA 4A6EA 2A6HF 3IC7A 3LAPA 1JE8A 2P6TA 1D8JA 4AIHA 3IKVA 3VFZA 1F1ZA 1ZLKA 4IRHA 5D5VB 3EQLF 1YLFA 2VE8A 3JW4A 2CYYA 1XN7A 2Y75A 1W4MA 2PMUA 2YSRA 1I1GA 1ZAOA 3G73A 3LAJA 5HS7A 3V8KA 1WRJA 1XCBA 4KICA 2BEOA 2QBYA 4HX8A 5L3BA 1ZG3A 1KU2A 5ILUA 2PQ8A 2HQRA 2CO5A 2W84A 2H09A 4WXHA 1U3EM 1ZN2A 2DK5A 3DPTA 5F1RA 1EH7A 1O7FA 2D2WA 5D4RA 4I0AA 1J0RA 5HS8A 1LNWA 5LHHA 1DPUA 1XD7A 2HTSA 3T5XA 4BQAA 1U8RA 5K5QA 1LEAA 2JT1A 3I58A 2W24A 1S3JA 3EUHA 1B1BA 3J80K 4N9IA 3BPVA 4A6DA 3QP5A 3KLNA 1KU3A 2STWA 1H9TA 4EGYA 1SMTA 2O0YA 2MA3A 3P9CA 3F8CA 2MC3A 4HA8A 3T8RA 3DQVC 2ZKZA 2JZYA 2B0LA 2PG4A 4KT5C 2EV5A 4OIQF 4MHGA 3MWMA 1HKTA 2LSOA 4XRFA 4BXUA 2DTRA 2FRHA 3DFGA 1ONVA 5LEJA 5BOXA 1MD0A 1FWZA 4ZYEA 4R79A 2UWMA 3I4PA 1KYZA 1JXSA 1W7PB 5HLIA 5JFRA 2A07F 4OMYA 4NB5A 1P4WA 1XDUA 2IRFG 1FC3A 5KK1A 3FZVA 1B6AA 1XGSA 3C7JA 2HR3A 3IWFA 1IN8A 4EM1A 4KIGA 5L3FA 5FFXA 4KN4X 4HF1A 1BM9A 1R23A 3E5QA 3MQ0A 4I09A 3BP8A 3GYHX 4EMSA 3F6VA 5K5RA 4KDPA 2HYGD 1ZRFA 3P9IA 2KIUA 2CG4A 5DUKA 2XASA 1KQ0A 2G9WA 3GFMA 2HEOA 5EEHA 4JK1X 1DPRA 4KIFA 3GW2A 5F64A 1JHHA 2RGVA 4RB1A 2ZNZA 3BJOA 4G7HF 2P4WA 2V79A 3EETA 2E7WA 1Z6TA 1F5TA 3HOSA 3CO7C 2H27A 2OZ6A 3I0TA 2H6CA 4EM0B 4XLNF 4XBFA 1HQCA 1BIBA 2O3FA 2XAHA 4Z2YA 4N0BA 1MDMB 5H6QA 3VB2A 2JTVA 3HRUA 4G7ZF 4A0YA 4EJUA 5JI6A 2LDUA 2F2EA 1SD6A 2ZFWA 1P4AA 4I02A 4RGUA 1V3FA 1KQ9A 4ZH4F 1MJ9A 5E18F 1HKQA 1V4RA 2EV0A 4UVBA 4R8HA 4NHJA 1MKMA 2FA5A 3DF8A 3E6MA 3CUQC 1IXRC 3REOA 4L5JA 5DD4A 1IN5A 2MD5A 3GO5A 2EV6A 1G4DA 3QAHA 3F23A 3BPXA 1DP7P 4IF4A 4L9TA 3NRVA 3J80Z 5D8KB 3TOBA 3OV8A 4P5OA 4L0ZB 3Q5FA 5IT3A 2L01A
chains in the Genus database with same CATH superfamily
1IO2A 1EJ9A 1YQAA 3RCOA 1O57A 5J8CA 2LNBA 1EH8A 3DU5A 1JTYA 1WZ2A 2E1MB 5LGUA 2LYCA 1DDNA 1XX5A 3Q0WA 3A0BC 3DEEA 5D4SA 1L3LA 1K78A 4Y4RA 4MLOA 3OWTA 2CQ7A 2KISA 4HQEA 2CS3A 3GTKJ 5DM6F 1FBUA 2D1HA 2FBHA 2BE5F 3SHFA 1KU7A 2VODA 5C4XJ 2KT0A 1E2XA 2LF8A 1QHHD 2VXZA 5CVJA 2K9MA 3ASNH 4XOPA 5K7HA 3V7SA 1VQLI 2BGCA 3BZ6A 1TQIA 3G1MA 5DCMB 4UVAA 2XAQA 4B09A 1FYMA 5LLQA 2YU9J 3ONQA 1MMAA 2VKVA 4DGWB 4EJVA 2ADUA 1N77A 4JYKA 2H8WA 3HSFA 1I50J 5CVRA 1IV6A 3M07A 2EZHA 3O8HA 2VOPA 3B02A 2Z2SB 3R0AA 3A01B 1FOKA 4HRIA 4G94A 3LSPA 1H88C 2ZXHA 1T08B 2LR8A 3S1NJ 3CMYA 4HV6A 2PBIA 3HOWJ 3QP6A 1MJBA 2LD5A 3H9GA 4AYBN 4II2A 3DPLC 4NC6A 3DPUA 5AONA 1APLC 2FBIA 4V2FA 3D5LA 3JRFA 3F8FA 1T95A 2OV7A 4W97A 4UUSB 3WGHA 3JRGA 4QSHA 3DBRB 4IRGA 3L2WA 2J5OA 3HHGA 2EPFA 2GWRA 3O3KA 4NUBA 4YELA 4HW0A 3MKWB 4ENJA 5IP6A 2DA6A 3LWFA 1D8KA 1OR7C 5DD8A 1EH6A 2EZIA 1R1VA 2HU9A 1LDJA 4I99C 4BBSJ 2FUG2 3ML6A 2BXZA 3I71A 4BAYA 2KJBA 3Q3SA 1K79A 1JGSA 2Y0SN 1BW6A 2DXIA 1SFOJ 4XQFA 2LF7A 2CJJA 2DJNA 4RBOA 3NEUA 3F21A 4AM3A 1VQ6I 2G7UA 3HRTA 2L3DA 5GP9A 3KFWX 1HDDC 2BY1A 2O5RA 4E7SA 3RKWA 4FASD 2L9SA 4NC8A 3A1YA 4OAZA 4IQJA 2QGUA 3PNTA 4I01A 4CA0A 3HDDA 2OJED 1S9HA 1SC7A 3T0YA 3S3MA 3SDGA 3ERED 2XKOA 4CO8A 1FBSA 1S7AA 3E1SA 1CQTA 3KP4A 2E60A 2DBBA 2KRHA 3ZMSA 1K4SA 1ULYA 9ANTA 1X1AA 3S2DJ 5LEKA 2DODA 4CZZA 3PO2J 1U0JA 2M8EA 2NVUB 1YIOA 1TLHB 2R5ZA 1USSA 1HSJA 1IAWA 4UB6C 3VYTB 4XKVA 1FY7A 3ZQCA 1YX5A 4A69C 2RDPA 2UXXA 2QQ9A 2VQCA 2PJRA 3EDPA 2E71A 2EFWA 1P92A 2IXSA 4XIDA 3F3XA 3KYLA 1TWAJ 4E4HA 2BVLA 3OYIA 2DA4A 2QSFX 5K5OA 4E7KA 2V9VA 1TL8A 4ZZLA 5E17F 1FJLA 5CJ9A 1YI2I 4OIOF 1BR2A 1LJ9A 5B1BH 5E3OA 2E1OA 2M87A 3GVAA 1VTNC 3DWLE 4ZYAA 2Q2EA 3S3NA 3AG1H 1I39A 3ROUA 3OSGA 1R00A 4CZCA 3ZMVA 1BOBA 3FXJA 3KYDB 4IJAA 3ZMDA 2XGEA 3LA3A 2K02A 2X1DA 1U9OA 1SD5A 3ZMTA 2YUSA 3WTVC 5JVGF 3OYGA 3CC2I 2EFNA 1P2FA 3K10A 1FMWA 3GUDA 4BE0A 2VC0A 3GTOJ 3PUBA 1I3AA 5JVTA 4FTHA 2D45A 2HPMA 4MIMA 3L2RA 3TOAA 3KETA 3COAC 2FSWA 2X9DA 3CZ6A 2M3AA 3KZZA 4UNOA 2JA5J 2LKPA 2DOFA 3G4SI 1X3ZB 4LG0A 1F4KA 4BUPA 5BPDA 1Y0NA 3G3ZA 1J5YA 4II3A 3CJTB 1X4OA 3WE2A 1JUPA 3HXLA 3I64A 2PMZA 2FEZA 3BQZA 3H35A 2JPBA 1RUOA 5E3MA 4HLYA 5LRRA 2HQNA 2OBPA 3RTRA 3BG5A 4A3LJ 5CVUA 2H94A 2K40A 4I2OA 3HOXJ 1FOWA 3JREA 2F6CA 4B44A 4BY7J 2VJJA 2ZXJA 2NYXA 4MEXF 4XK4A 2L7MP 4G6QA 4RGRA 1T2KA 1SMYF 3DEUA 1FPQA 4L5IA 3L9FA 3FMRA 1ACIA 1Z6RA 4ENKA 4XKWA 2WTEA 4NNJA 2WY8Q 2NS0A 3F9KA 4A3JJ 3IL2A 1FMVA 3JSOA 1GT0C 1IDYA 3RYRA 1HW1A 1WWXA 2FX0A 4ESJA 2WADA 2EWNA 3MAJA 3BG9A 2E35A 4CH7A 2Y9YA 4L18B 1OKRA 2JRMA 3TO9A 2STTA 2XPVA 4YIIA 3ZN0A 1O3SA 3GCMA 2GXAA 1T0FC 2DFHA 3HB9A 3OYDA 1A36A 1B59A 3CUQB 5HDGA 2XUBA 4ZJZA 1MMSA 3TMOA 3HOUJ 2AQFA 2L2OA 2FE3A 1JJ6C 4AIDA 2CUJA 1X3WB 2OCEA 1TC3C 2K9SA 4EGZA 3N4MA 3SZPA 3OYEA 1AKHA 4NQWA 1MW7A 1MBHA 2R93J 5D6FA 2F5EA 3ZQLA 3MKLA 3PIPF 4JQFA 5F0CA 2JWTA 1QPIA 4YEJA 1ETVA 4FX0A 1H8AC 2R7QA 2XAJA 4XNFA 1LVKA 1GVJA 3MZYA 3W6JB 1UHMA 1U8BA 2WB1N 3C1DA 5FO5A 4CICA 4LB5A 1SVOA 2HOEA 5LD2C 3JSPA 2F4IA 2ZJRF 2FMYA 4DJAA 3S1RJ 1X58A 2QLZA 3GF2A 3DKWA 2QUFA 4OWRB 1F43A 4IOCF 2OZUA 2GA1A 3HC7A 5LBQA 2EFQA 3CCEI 1K7AA 2QVOA 3W3CA 2R7TA 4I76A 3V7RA 3WTYC 2K9QA 2QYOA 3A2KA 3D0SA 2L4AA 1N78A 4CYCA 1LQ1A 5E8GA 1OCRH 5CQEA 3HTSB 4HX4A 1W36D 1WJEA 1SANA 2EA4A 2XV4S 4EJTA 2FBKA 2IS6A 2QKLB 4W1UA 5LGNA 2X6XA 3LFKA 3TW7A 2VBWA 2JRTA 1OQYA 3K70D 3RPUA 3TQNA 4A0ZA 4Z6YA 4LGWA 2RKHA 5FB2A 4PJNA 3PJRA 1BI2A 4D5FA 1FP2A 4OIRF 4OIPF 1YW9A 1HCRA 1LFBA 4DBRA 3K2ZA 2M4KA 2XAUA 3OL3A 1SEUA 3RZOJ 4AIJA 1RUNA 4BDYA 1MZBA 1FLIA 1JTXA 4GRIA 3PSIA 4ZC3A 3LSJA 1Z91A 1WJFA 2JA6J 2V1NA 4A2UA 4I6ZA 4KA4A 3FF5A 2KDOA 2K3FA 2YR2A 4XLHA 4A5MA 1XS9A 1R22A 3WU1B 1XB4A 3CP8A 1LB2A 3T1BA 1T8IA 4JOMA 3KZYA 5A2QK 2HZTA 2XROA 5LGTA 4ZDLA 3V4GA 4PJMA 1XSXA 1DUXC 4G12A 4IVNA 1R71A 3DCFA 5DM7F 3RSNA 1KU9A 4G6TB 2B9SA 3HPHA 3HOTA 3OS2A 3SZTA 1ZQ3P 1JHFA 2IT0A 3CC7I 5L3CA 3H5RA 4AUXA 5J8FA 3DKXA 5DS9A 4QPQA 4XOTA 4RDUA 4P55A 3SXYA 3WG9A 2DPDA 4B47A 5BPIA 4LFUA 1MBEA 1SFEA 1JJ8C 3ZOBA 2QWWA 1L0OC 3QU3A 2UV1A 2IA2A 5EZHA 2I10A 2CW0F 2Y0SA 3Q9VA 3SFIA 3FXOA 4WXCA 3NARA 2XPUA 1EKEA 4LIVA 1O3TA 2PI0A 2VBZA 5F6FA 1H0MA 2MG4A 3F22A 3MZ8A 2BY3A 3FWEA 5GTIC 4RB2C 2ESNA 3OR2C 1ETOA 3ZR8X 1UHSA 1IGNA 5C3EJ 2LVSA 1V54H 2EH3A 5FKMA 1RR8C 4V19K 4F93B 1DGWY 2LP0A 3GLXA 3PFYA 3WE3A 2R5YB 3BROA 3PFIA 5GADJ 1TQMA 3PUFA 1A6IA 1SAUA 1T98A 3PNVA 1MGTA 2IPQX 1OISA 2V1UA 2DQLA 4UY8I 5HLHA 3BOQA 1VQ9I 2WV0A 2ZBKA 2DTZA 1NG7A 4YFNF 2K9LA 4D9JA 1NH3A 3I59A 3Q9SA 2HWVA 2R7UA 1RI7A 5D5WB 1KGSA 5DDGA 1BI0A 3K0LA 4B48A 4ETSA 1S8NA 3OYFA 5J6XA 1IDZA 3HUGB 2K86A 3QU6A 3EPZA 4H0EA 3FBNB 1X2NA 4HPQA 4PZJA 2ECCA 1MMDA 2CUFA 1QBJA 2A5YB 5IOZA 2I8DA 4HBLA 1I5ZA 1MMNA 2HQAA 1R1UA 3I4NJ 4IRIA 1IF1A 1P9QC 1HA8A 4JP0A 4HAMA 3CMAI 3DV8A 3FMSA 2ZMEA 4PGGA 4D0PA 1RKWA 4D7MA 3E6CC 3W2VA 3K1NA 2VN2A 3S8PA 5KHDA 2W57A 5LHGA 2XVCA 4O3MA 1HSTA 4C2MJ 1YE9A 2E5ZA 2NOJB 2X4HA 4BH9A 2X6WA 3F8MA 1BW5A 2OU2A 2F48A 1F9NA 1IUYA 4IKFA 3J7AO 4PJJA 2VJ4A 2CGPA 1W5TA 4HZFA 4E7JA 2RREA 5J4YA 3J81K 3LA2A 5CVVA 1UCRA 2JPCA 1ZRDA 3JAMZ 5M5XJ 1I6HJ 2A5WA 3FMQA 2HZDA 2JVHA 3K6GA 3IRRA 3QQAA 4PJLA 2ESHA 2HDDA 2W48A 1I6XA 5EDNA 2VUMJ 1LDKB 3QPLA 1RR7A 3JRHA 1SAXA 2V6EA 5EZGA 4BU2A 2KIFA 3GFLA 3SJMA 5FLMJ 5E3LA 4Q47A 2VOOA 3QYBA 1POGA 2CQXA 1S6LA 5K7FA 3EUHC 1T6SA 2PEXA 4A5NA 2DQRA 2EA2A 3GWZA 4YFKF 1O3RA 1ENHA 4K2EA 2X1CA 5FKLA 1F36A 2VQLA 4DIQA 2E5NA 4F91B 1ETQA 4LITA 5HOOA 3CO6C 2KIQA 4KIBA 1ZG5A 3ABLH 3L2UA 4FHTA 5F04A 1Y39A 1W5SA 4A3IJ 2QENA 5F08A 1HKSA 3LSMA 3EYIA 3I3LA 1TWHJ 3QPTA 5AIPA 3M7GA 3WHBA 1YS7A 1OJLA 3FM5A 2CV0A 4HYEA 3HOYJ 2Z1DA 2CFOA 2COBA 2J5PA 5H20A 1Q1HA 3B6CA 4WX9A 3CJNA 1GHCA 3K4NA 3D5SC 1I3QJ 2KRCA 2DA7A 2Z33A 1E3PA 3TW6A 2R7VA 3CCYA 2A6EF 1W36C 1IC8A 2X6YA 1YIJI 2DDAA 3KLOA 3OY9A 3X2QH 3K70C 2C6YA 1UG2A 2BBYA 1LE8A 2NVQJ 2XIGA 1E17A 2WAEA 5E1XA 4HLXA 3TDUC 1NK2P 2EFPA 2LBFB 1NHAA 3LQQA 4RGXA 3FK7A 5E1ZB 2LY2A 4RM3A 3TKYA 4BQQA 4BHPA 2KMUA 4M3BA 2LY9A 3KX2A 1Z21A 3O2PE 3M3YJ 1PUEE 2M30A 3F6OA 1X4PA 3K4KA 2ZSHB 3OOPA 3ERMA 3ZQQA 3DLAA 3BR5A 4XONA 3ZN1A 1WI3A 2DPUA 2JJ7A 2KJCA 2W7NA 3CCUI 1LPQA 4RGSA 4FISA 3DLLF 1OYWA 2WB1A 1K6YA 2HS5A 3GZ6A 2Z9OA 1MJAA 1OR7A 1IG7A 3VDXA 1LDDA 3HKZN 2LTPA 4OU0A 2E36A 3KEYA 1A5JA 4I98B 3PM1A 3H3VK 1BC7C 5GAHJ 2WA0A 2HYFA 1W7PA 2R3SA 4M74A 3RIRA 4KJZA 3MVPA 1Z0XA 1Y1VJ 3CDHA 1FX7A 3HGGA 2HYJA 4QLCU 2M8GX 4KUMA 5GAEJ 1XMKA 1Z9CA 4MTEA 3ECHA 4M6YA 3F8BA 3BZKA 4IPAA 1VQNI 5FFZA 1G3TA 3TGNA 1DU0A 1D0YA 3V42A 5KVRA 1U2WA 4V2GA 1ITYA 4H4KC 2A68F 5DV5A 2Q0OA 3HG9A 2ACJA 1FTZA 1BI3A 2FQ3A 2VXDA 3WTTC 1D1CA 3RYPA 5HLGA 4Y15A 3SQNA 4IEJA 2A61A 1FIAA 2PFBA 5L3EA 3A03A 5B66C 2XRLA 1U78A 2BY2A 1BJZA 3FXMA 2QQBA 5BNGA 4XLCA 2A3SA 3VEPA 4RS8A 2KRFA 4BEHB 2PMHA 1TQPA 3LMMA 1AA7A 2OC6A 2VI6A 3KE2A 3OYAA 4B43A 3KP7A 1ZYRF 3BG7A 1X1DA 1OCCH 1TTYA 2XC7A 4LLGF 3NAUA 1QA6A 4A12A 2DAOA 1TW2A 3DBLB 2D1VA 5IP9J 4DYCA 2XB0X 1WJDA 1FT9A 2XSJC 2JN6A 3W6VA 3CQZJ 4Q48A 3V8JA 3BJAA 4M71A 2IGNA 5KAFC 3MCZA 4EM2A 1XC5A 3UKGA 3E6BA 1R5GA 3GXOA 4PJ0C 1PYVA 2ID6A 2VQHA 2MH2A 4KMFA 3HSEA 4DBQA 3NQOA 3LSIA 1ODDA 3KCCA 5EG0B 4E7LA 3GTGJ 1Y8QB 2KFDA 3GX4X 4YFXF 3CCLI 1ZR4A 1ETWA 4J01A 3J7ZI 5BQTA 2IP2A 3CMEI 2F4MB 4C3JJ 1D1BA 3M8EA 4GO1A 3K4LA 4M73A 3HBLA 3H5NA 3LSRA 4M6VA 3FXLA 3AFHA 3J81Z 2H1KA 2FMLA 1R4MB 1U5TA 2X6OA 2XSDC 5E3NA 1E0EA 3C2BA 3ZQ7A 1UMQA 1QU3A 2BHYA 2E2HJ 2IS1A 5BS6A 3FK6A 1MDMA 2HVQA 5HVQC 2E7XA 1MBFA 1AKHB 1Z3YA 1MH4A 1SVLA 3CCJI 5J1UA 3EUKL 2BY0A 4EJWA 1IRXA 1VQ5I 3WTZA 2K4BA 2PJPA 3BR2A 5ILSA 2RV8A 2H6BA 4OOIA 5B3SH 4Y13A 2LLKA 2V6CA 2CFXA 4G6DA 1S7OA 2QM3A 3KZIC 3F8NA 1WQ2A 2P6SA 1T39A 4MFDA 1FSEA 5L3GA 1REPC 2GIVA 4BL0B 3ZQHA 2VONA 3WU2C 4AVZA 1WSUA 4FETA 3BC8A 3K7AJ 4HF0A 5HNHA 2HFHA 2V1DA 2DFFA 5D5XB 2DOAA 3ABTA 2KZVA 1IUFA 4MQVA 2CV1A 2DA2A 2QBYB 3O6BB 1J75A 5FLVA 2VT3A 4GDFA 3BDDA 2GXBA 2X0LA 2CSOA 1N25A 3BR0A 1M1EB 1T38A 3ZMUA 4BBRJ 1K61A 2HVSA 3CCRI 2MH9A 3WTSC 3R0JA 4Y17A 2XKPA 5ICCA 3MKZA 3ULQB 3CCSI 2CMPA 3AKZA 3M1EA 4WWCA 3FISA 4M72A 3LL7A 1USTA 4UV8A 4MGRA 2BZTA 3WHCA 2PLYA 3CD6I 2E34A 1QRYA 1EA3A 2VC1A 4J00A 3S2HJ 3VODA 2AO9A 3AL0B 3PO3J 3C18A 1XPXA 4A3EJ 3HYIA 3CMMA 4WK8F 4CHUA 1W0TA 2QEXI 4HEA2 1E3HA 1OCZH 3TL4X 5JLXA 1BOAA 1OMIA 3A02A 5D8LB 5AIQA 1R9TJ 1BL0A 3JTHA 1QZEA 2BOLA 5EF6A 3TBIA 3P7NA 2DT5A 3B73A 1I27A 3HTUA 5JHUA 4IHTA 4P1WA 3JRDA 1Z3XA 3RI4A 1FP1D 1WFXA 4WCGA 4LLLA 2IGMA 3HHHA 1HLVA 2ZJ2A 5M3FJ 5FLXK 4R1HA 2R92J 1TT5B 5M5WJ 2MC4A 4EJOA 1DGRM 5ED4A 1R4NB 1XGMA 1J9IA 3DTKA 3AG2H 5HS9A 4M9XA 2F4OB 3DKYA 2O61A 2DJIA 3CP2A 1G3SA 5DCMA 3WTXC 1FNNA 3ZMZA 5H2FC 3H36A 2ID3A 5D5UB 1K6OA 2HKXA 4HNTA 3C3WA 3AG3H 2VPRA 4U0VA 2ETHA 2V9KA 3IP4B 3A01A 3OOUA 4F7ZA 1PUFB 2VLAA 2R0QC 1Z77A 3HEFA 3I54A 4EQQA 3TP0A 3K4CA 3CJQB 2GQQA 5IP7J 3VOEA 5EGOB 1VFCA 4M3EA 1G8XA 1HDPA 1RETA 2JK3A 4XLPF 1W0UA 2IAIA 4XSZF 3LFUA 1ZR2A 1FYKA 1CF7A 1ON2A 1I1SA 2EFOA 1YO5C 2V9PA 1ERDA 1PP7U 3OR1C 3BG6A 4HQMA 5CVIA 3I59B 4FE4A 4RB3C 2EZLA 2JA2A 1TNTA 4X0GA 2TDXA 4L9NA 4C2UA 2N8GA 3RQIA 4UUSA 3IUOA 1ON1A 3KP5A 3LOCA 5FD6A 3HKZA 4HNVA 3MN2A 1LVAA 4AIKA 2KLOA 4HDUA 1ZREA 5TRDA 1G59A 3FKIJ 2CV2A 3B6AA 2XGXA 3LSHA 2Y0MA 4DZJA 4XLAA 3LSGA 3H9QA 2KHMA 3VPRA 2DDBA 1BBYA 3CCQI 2AS5F 2K4JA 3WTWC 5BMZA 2JSCA 2XPWA 4L9VA 1PP8F 2XHKA 2EB7A 4Y33A 4AD9A 5L3DA 2GXGA 1BI1A 3BQYA 3K4MA 4HDVA 1FIPA 3FHZA 2HI3A 2BW3A 1HOMA 1XTAA 2WAQN 1P7JA 3FM3A 1HW2A 4HOBA 2K27A 3J7YJ 4J19A 3IKTA 1B8IB 1RKTA 2UXNA 4AU7A 3KP3A 3KEQA 1JT0A 3OYCA 2NVYJ 2KL4A 3CLOA 1YS6A 1QPMA 4BXXJ 4HX7A 2WV1A 3OS0A 4U0WA 4C2TA 2LFBA 2M2EA 1ZGWA 5F27A 4N9HA 3DXJF 2FNAA 1IN7A 2Q1ZB 2RVCA 3DP7A 3PQJA 2DU9A 4QPOA 3S32A 1RZ4A 5FGMA 3L2QA 2VJIA 3FBIB 2MD0A 2FOKA 4D5CA 4BYYA 5J1RA 3CTAA 4U0YA 2PX9A 3OYJA 3L2CA 2XB5A 1VQKI 2QQ8A 3V8LA 3G6EI 3RJPA 2O8KA 1ZGJA 5E1WA 5ERIA 2FNPA 4CGZA 4AYBA 4RAZA 3PIOF 3KEOA 4A93J 4GFBA 3U1DA 1FZPB 5B1AH 1IXSB 4PDKA 4XR6A 5TJJA 3CCVI 1SFUA 2M45A 1GXQA 1JKOC 1QNTA 3I53A 3U1KA 1YJNI 4IHYA 2V7FA 4FCYA 1BC8C 4C9YA 4S0HB 4PCQA 3HPGA 1UFMA 5KAIC 2L9RA 4MFEA 5IY5H 4RLQA 1ZG1A 1UELB 4ZYDA 2CQKA 1Z7UA 3KP2A 2B63J 2MYSA 4BXFA 5CPRB 4S04A 4ABZA 2DMNA 2IW5A 2ZXIA 4M6XA 4U88A 2IA0A 4LD5A 2OQGA 4MQ9F 2A05A 4P9FA 2OAZA 1VF9A 3VSLA 3NWSA 1Y56A 3U21A 2B7EA 4Y3OA 3BR3A 3QOEA 4GGGA 5JR3A 2VE9A 2IS2A 1Y0UA 3LNQA 2L02A 3ECOA 2DI3A 3MFKA 5EYRA 5E8IA 2PN6A 1UB9A 2QQAA 1R58A 5JLWA 1D0ZA 2GOMA 4XRSA 1TWGJ 3GTQJ 3HZJA 4ESFA 4JX4A 2DMQA 5J1YA 1B72B 2P7VB 4L0YB 1PVEA 3K4BA 4CCNA 2WAFA 1X3UA 2FU4A 1JUSA 5M5YJ 1D1AA 2A69F 5CYVA 3FDYA 4ENNA 2ZNYA 1P4XA 1VQMI 3IAM2 1LUJB 4I7HA 4YIFA 1R7JA 2O6GE 4E70A 4MTDA 1O3QA 3BJ6A 4D1QA 3OYMA 3MZHA 1HBXG 1GXPA 2JSPA 3WU0A 3OIOA 4N4NB 5GPCA 1YHQI 3JCUC 2Z99A 2EK5A 4ASNA 2EJRA 1TNSA 1RIOH 3MMYB 4BKXA 3IH2A 2AXLA 3ESWB 1XDSA 3CC4I 1IXCA 2YPRA 2Y69H 1IJWC 3R6SA 2NNNA 2HGCA 2LC2A 2QCOA 1XCVA 1XSVA 3E5UA 2CW8A 4E6KG 4XLFA 2K7LA 5FLXZ 1WGXA 4ON0A 1FOXA 2P7CB 2HQ5A 4I0BA 1S29A 3ABUA 1R49A 4HG2A 1Y1WJ 3VYSB 1J59A 1QZZA 3H1CA 1K78B 3D1NI 2VPLA 1B4AA 2ZO4A 5M3MJ 4HF2A 2DN0A 3I5UA 2LK2A 5C44J 1G3WA 3BT9A 3CUQA 3RKXA 1K4TA 5LRSA 5ILVA 4BNCA 4OINF 3BWGA 2M1BA 2P5KA 2GBYA 2ZJPF 4ANJA 1O4XA 2L9NA 5ICEA 3MKYB 2R7ZJ 4HV5A 2HKOA 2ISYA 4BGDA 2KIMA 1MH3A 1YRNA 2ISZA 3H92A 3G2BA 2W85A 1TBXA 1FTTA 2XGDA 3GZ5A 2YX7A 3OYHA 1BIAA 3R4KA 4ZTJA 5B5EC 3AL0C 2TCTA 2O03A 4RM2A 4BE2A 4ZDOA 2MLKA 3WODF 2AHQA 3E0JB 5D6EA 4ZYHA 4UXNA 3BCAA 3A4CA 1IRFA 4PFPA 1AWCA 2NVXJ 2M4GA 4CDGA 1OLTA 2FXAA 3OSFA 1SD7A 5IT9K 3K1PA 3C2HA 2EZKA 3I56I 1X1BA 1N75A 2KPMA 4X6AJ 1YYVA 1ZLJA 3RDIA 2R7DA 3KPHA 2ZSIB 3GMEA 5ICGA 2RAEA 3FXRA 3ZCOA 1KYWA 4BDZA 2IEKA 4LK1F 4B3XA 2R7FA 2HXOA 4L5EA 2L7KA 1HXDA 3BTCA 1EF4A 4A3MJ 2RC4A 2NRAC 1MNMC 1D3YA 1W7PD 1G6NA 4UVCA 1T56A 1Z05A 2V1XA 4ENMA 2DO7A 3H0GJ 2W4SA 3OYKA 4UV9A 3GEZA 2MGQA 3RQ4A 2ZFUA 2D5VA 3JR9A 2MW8A 1ZGAA 2L54A 2VKEA 2JUCA 2RQPA 2M7BA 4BACA 1PDNC 2Y9ZA 4JBAA 1XG1A 2CH0A 1U5TB 4IHVA 1IRZA 2KDZA 3D5RC 1KONA 2JUGA 5CLSA 2CUZA 2BVMA 2L7FP 3DEWA 3FXQA 4Y7NJ 3S2WA 4M3FA 1H9GA 2F5CA 5F0HA 2FQ4A 3QRFF 2P5LC 2TRTA 3L7WA 4A3GJ 1R5HA 3WGIA 2VT2A 3SEZA 4BHCA 1RNLA 3E97A 2IVMA 2ELHA 1IW7F 2M34A 2Z3YA 4EVIA 2OQRA 3ELKA 1FSHA 4BHBA 5DTDA 3GTMJ 5TISC 1CGPA 5HDNA 4RLFA 1ZH5A 1AU7A 2X48A 4M3GA 3AAFA 1VQPI 1KA8A 4PUSA 5DCFA 3RKQA 2FOWA 1D5VA 2HOSA 2M9HA 2JA7J 2R4GA 2IGKA 3FIWA 1BJAA 4X1EA 1XSDA 3EYYA 1IN4A 1QVTA 2RNJA 5J47A 2R5ZB 3KP6A 3ZQFA 1IN6A 3HSRA 2YX4A 2ICWG 4XSXF 2XF6A 4TV7A 4EEFG 3L00A 3O8GA 2ZMEC 4YG2F 5A2QZ 2CQNA 2PJRB 4Q5SF 1FEXA 2IGOA 3EUAA 1OYYA 2KP6A 2LKXA 1H89C 3K69A 3ZP5A 2RQQA 2VQGA 2L7ZA 1IZ1A 3LSKA 2Z16A 1YX3A 4B4CA 4WF2A 1RESA 3QPHA 2KKOA 1A35A 1C0WA 2X51A 1XGNA 5E79C 5FKKA 1D0XA 4G7OF 1UHWA 4BJ5C 1P6RA 2Q2EB 3VWBA 4RB0A 4LMYA 4GCVA 1WKMA 4RMNA 2ZCWA 3HGYA 2F5VA 2P8TA 3QOPA 5K1YA 3Q0UA 5JHFA 1Y8RB 2VBXA 4KNYA 3R61A 1ZARA 2FD5A 1UZCA 2ZB9A 3GFJA 3HUGA 1GV2A 3JTGA 3TP3A 3T8TA 1STZA 3E6DA 1QO0D 5FKOA 2NNYA 4UUVA 3S1QJ 3NWTA 5GAGJ 1PJRA 1TWFJ 5HODA 4XRMA 1G2HA 2XAGA 2DYRH 2WBMA 1AOYA 2YU3A 4F92B 1Y6IA 1QGPA 3SDBA 2EINH 3ISPA 1LEBA 4IHXA 2DT6A 4WXDA 1U6GA 4BJTA 2COMA 4LG0B 3GTLJ 4BQOA 3U2RA 5HNFA 3ZPLA 4LLNA 4IHSA 2OD5A 1YJ9I 2DCEA 1SD4A 5LHIA 4MEYF 3GFIA 1P7IA 4ZDPA 4NC7A 1WI9A 2Y48A 4NBQA 4OMZA 2DMUA 3N05A 1Q1VA 2NXNB 5E20A 3TDZC 1WCMJ 1FBQA 4KITB 4ESBA 4ZYGA 1WJAA 1JI8A 2EIKH 2Y30A 1SFXA 4ZZDA 3HIFA 2NVTJ 2DFEA 4BJ6C 1A04A 2W25A 2OPTA 4F55A 3HRSA 5J40A 3BTLA 1E3OC 3N97A 2CU7A 4QIWN 4KN7X 3VSKA 4RAYA 4KISA 4FQGA 2RN7A 5DYMA 4IO9F 1S7EA 2QF7A 1CF7B 1MIJA 3RKYA 4DYQA 1AHDP 2M7AA 2OTLI 4PGHA 1YJWI 4F3QA 1J7KA 4G9YA 3RZDJ 3F0CA 4XICA 2Z5UA 2E1CA 4OAYA 3WGGA 1OCTC 3K1MA 4LJZF 4CXFA 4D7NA 3UNGC 4A0XA 1HW5A 3S17J 3E5XA 2L4MA 5IPAA 3E3VA 4GYGA 4DNCA 2E1NA 3LSTA 4CUGA 2E19A 5H6RA 4LB6B 1VZ0A 3IV5A 2XAFA 4NQWB 2AXTC 3JRCA 1FYLA 4EV0A 4KMUX 3U9GA 4N4OB 4Q4ZF 3Q0VA 1ZRCA 6PAXA 4F52A 4DQ2A 5FRMA 5IT9Z 3CCMI 4LK0F 1G3YA 2CWEA 5DUIA 1ZKGA 3RPQA 1MNDA 3W2AA 4XN0A 3TO7A 2GAUA 3L09A 3IRQA 3F72A 2XRNA 1IRGA 3PQKA 1BN5A 2BW3B 2G0EA 3JRIA 4A3KJ 2R7OA 2FJ1A 1QZYA 1JT6A 2UUZA 4O6JA 1EV7A 3MEXA 2GIZA 3FXUA 4CCOA 2LBFA 2MLGA 1X2MA 5FJ8J 3H3ZA 4XN3A 3W2WA 4QWQA 4PSXA 2OA4A 3M1CA 3A0HC 4M9ZA 2EBIA 2F5FA 1YW7A 2K5CA 5HDKA 2HXIA 3VYRB 2LMDA 3WTUC 2WWYA 3LQRA 1T0FA 3P9KA 2M5WA 4CYCB 4XLEA 4KFCA 3IAS2 2BYVE 3LA7A 1LFUP 1ETKA 2FF4A 4A3DJ 3M4OJ 4AVPA 1A31A 2EIMH 4ITVA 1J2XA 2JQ7A 4BS9A 1OFCX 2JA8J 3HOZJ 2XF5A 1OPCA 1VNDA 3K9TA 5FD5A 2K3PA 4A3CJ 4IZZA 5ICFA 2DFIA 3L1PA 2ELJA 2RNGA 5FKNA 2HDCA 3FKJA 2GA2A 2HTJA 2VASA 2GZWA 1R36A 1LKXA 4M9SA 2NAZA 1ETXA 2K9NA 3BG3A 3BR1A 2K85A 4FT8A 4XM3A 3I4MJ 4C3HJ 1WH7A 2W00A 3ZQGA 4B8XA 4MNUA 1YTYA 1UG0A 2O8XA 2Y2ZA 3R60A 1X1CA 2HDWA 4U7DA 3TO6A 3BCBA 4IX7A 3HRMA 4GYIA 2X85A 1XGOA 1MNEA 1ZHFA 2BV6A 1Z1DA 1S72I 2VBYA 1KQ8A 2DW4A 3VYUB 4AWXB 2E2IJ 3CUOA 4IL6C 3E7LA 4P96A 3W6KB 1WPKA 3BTJA 3P5JA 4GXOA 1O7LA 2XDVA 3SZGA 4DYRA 3QYFA 4M3DA 3H3UA 4O5VA 1XMAA 1VQ8I 2IJLA 2QSGX 3FX3A 2L0KA 2CUEA 4U7BA 4G8XA 1B9MA 3M8JA 4JX5A 4XRSG 4CCMA 4IOAF 1JUMA 1X1PA 4IHWA 1YW8A 2IA1A 3ASOH 3IWZA 1B9NA 4BEHA 2R7WA 1U5TC 2QA4I 3M8FA 3V7CA 2I5UA 2DK8A 2HPIA 5F0FA 4UHTA 4LIUA 4XL9A 3SEQA 2X1EA 4S05A 2UZKA 3S1MJ 2H1LA 2DLLA 5DEQA 2MFZA 3K4JA 2MBFA 4CSWA 2NS7A 1QQIA 2JVGA 2EQRA 3HM5A 2R7XA 4P9UA 2GLOA 2KZGA 3RPUD 1YG2A 1YFHA 1TT0A 2VKDA 4PFOA 3BY6A 2P5VA 2WC2A 4CYDA 4IXAA 3SFZA 4A3BJ 1GUUA 5EG0A 1V5GA 1WVRA 5HLTA 3GZNB 2G7HA 2O9LA 3FXKA 3IHUA 2Q8KA 1OYIA 1OCPA 4KYWA 1HC8A 2IBDA 3DTIA 3JAMK 5EEGA 3PL8A 3M9AA 1TW3A 2F5DA 1HF0A 3GLLA 2QZ8A 2M0CA 1BR1A 2ZMEB 4U87A 4L9JA 4FX4A 2MSYA 1R1TA 3G1LA 4QTRA 3GTJJ 4A6EA 3S3OA 2V4JC 1VQ7I 5IYBJ 2DT7B 4BY1J 2A6HF 1TZLA 3IC7A 3LAPA 1UAAA 4UB8C 2R7SA 2CRGA 1JE8A 2O7OA 2P6TA 4Y52J 1D8JA 1JKQC 4AIHA 2HOAA 3IKVA 4C3IJ 3VFZA 1YRNB 1F1ZA 1ZLKA 1ZTRA 4IRHA 5D5VB 3S15J 3WG7H 1GV5A 3QPSA 3EQLF 2BXYA 4HSTA 2IS4A 1YLFA 2VE8A 3JW4A 2LREA 3JRAA 4CCKA 2CYYA 1XN7A 1UJ8A 2Y75A 4YIRX 3KIOA 1ZELA 1W4MA 2PMUA 3AG4H 2YSRA 1VI0A 1VQOI 1I1GA 2NS8A 1ZAOA 4DZPA 5CQGA 2R7RA 3MD2A 3OS1A 1K83J 3L2VA 3OYLA 3G73A 3LAJA 1MSEC 5HS7A 3V8KA 2E1MC 1WRJA 3OYNA 1XCBA 1GLNA 1D5YA 4KICA 2BEOA 2QBYA 4HX8A 2L9VA 1U9NA 1V55H 4BQNA 5L3BA 1ZG3A 1KU2A 5ILUA 2PQ8A 2HQRA 2CO5A 2W84A 2H09A 2DMPA 4WXHA 1U3EM 1ZN2A 4FE7A 2DK5A 2DA1A 2V26A 3DPTA 4HNUA 5F1RA 1EH7A 5F1JA 2DA5A 1O7FA 1R5ID 2WY7Q 1QHGA 1XMXA 2D2WA 5D4RA 4I0AA 1SFKA 3BZCA 3G71I 4B1RA 4XKCA 1J0RA 5HS8A 3TEDA 3UR3C 1ORKA 3S14J 1LNWA 3BTIA 2VJ5A 5CKTA 4XMYA 5LHHA 1DPUA 1XD7A 3ZXSA 1DU6A 2HTSA 3T5XA 3OYBA 4BQAA 2CQQA 1U8RA 5K5QA 1WJBA 1LE8B 3HJEA 1LEAA 2JT1A 4AC0A 3CDIA 2M0MA 3I58A 2W24A 5KCMA 1S3JA 2ELKA 3EUHA 1B1BA 3J80K 1W1WE 5EJCA 4N9IA 3GTPJ 3BPVA 4A6DA 3QP5A 3KLNA 1KU3A 1MBJA 5GTHC 3QWLA 2STWA 3KYCB 1H9TA 4EGYA 1SMTA 2O0YA 2MA3A 3P9CA 2Y31A 1X19A 3F8CA 2MC3A 4HA8A 3T8RA 3DQVC 3I9V2 2ZKZA 3QODA 2JZYA 2B0LA 2PG4A 4KT5C 2EV5A 2GOXB 3CDLA 4JX6A 5FROA 2QSHX 4OIQF 4MHGA 3MWMA 4BE1A 1HKTA 2LSOA 4XRFA 4XORA 4BXUA 3IH4A 2BHZA 2DTRA 2FRHA 3CF2A 3DFGA 2HNHA 1ONVA 1SVMA 5LEJA 4A3FJ 5BOXA 1MD0A 1RC9A 2OTJI 1FWZA 3OMYA 1WHUA 4NDLA 4ZYEA 4R79A 2UWMA 1BR4A 3I4PA 1KYZA 1JXSA 1PUFA 1W7PB 3K2AA 1OCOH 5HLIA 5JFRA 2DYSH 2NOGA 2A07F 4OMYA 4NB5A 3J7AY 4KT6A 3ZQIA 1P4WA 5EGOA 1DQUA 3BR6A 3BLYA 1XDUA 2IRFG 1FC3A 3DBHB 5KK1A 3FZVA 1B6AA 2KQRA 4PSWA 1XGSA 3C7JA 2HR3A 3IWFA 1IN8A 2YS9A 1R6RA 2MABA 4EM1A 3OL4A 4YRVA 1MSFC 5J4VA 4KIGA 1TP4A 1NG6A 1ZK8A 5L3FA 2ZJQF 5FFXA 2DA3A 4KN4X 4B3AA 1BM9A 4HF1A 1R23A 4PK4A 3E5QA 3G1OA 3MQ0A 3DU6A 4LOCA 4I09A 3BP8A 2XGCA 3GYHX 4EMSA 5IOYA 3OIQA 3F6VA 1IV8A 5K5RA 4KDPA 2HYGD 1ZRFA 2LH9A 3P9IA 1V5EA 2KIUA 4EATA 5TGTA 2L5QA 2CG4A 3IH3A 5EEAA 2HOTA 2OF7A 1TWCJ 4E7ZA 3ABMH 5DUKA 4LG3A 4E7IA 2XASA 4RAGA 1KQ0A 2G9WA 3GFMA 3H5AA 2HEOA 3ZGKA 5EEHA 4E7HA 3CLQA 1QVUA 2AQEA 1MMGA 3CJRB 4JK1X 3PSFA 4RA2A 1DPRA 4KIFA 1V5FA 3GW2A 5F64A 3I55I 1B8IA 2VB6A 2ME6A 1JHHA 2RGVA 4RB1A 2ZNZA 2GM4A 3BJOA 1MBKA 1T33A 3DTEA 4G7HF 1JGGA 1J09A 2P4WA 5FRNA 2V79A 3EETA 2E7WA 1Z6TA 2DMTA 1F5TA 4HSRA 1YOVB 3HOSA 3CO7C 5GPAA 2H27A 2OZ6A 2ZC2A 1Z7LA 5KNLA 2VKHA 3I0TA 2LOOA 3OIPA 3QYEA 2W82A 1BA5A 2ME0A 2H6CA 2P81A 1ETYA 3GBGA 1RPWA 4EM0B 1RRJA 5J3LA 2ZXWH 4XLNF 3ZRGA 3CESA 3PNYA 4XBFA 1S5LC 1HQCA 1BIBA 4MO7A 2O3FA 2XAHA 4Z2YA 4N0BA 2VIXA 2P0WA 1MDMB 2XF7A 5H6QA 1FOYA 3VB2A 1GDTA 2JTVA 1NTCA 3HRUA 4UUTA 4G7ZF 3C2GA 4A0YA 1GVDA 1JKRC 2PMZN 4EJUA 2LG4A 2ECBA 4XKBA 2A6TA 5JI6A 2LDUA 1Z67A 2F2EA 1SD6A 2ZFWA 1DP3A 1P4AA 3FHNA 4CCJA 4I02A 2EILH 1WJCA 4RGUA 1V3FA 4RAFA 1KQ9A 4ZH4F 2OCCH 1MJ9A 2LKSA 2JMWA 5E18F 1HKQA 1YITI 1VQ4I 1V4RA 2EV0A 4UVBA 2OUMA 3HL2A 1WH5A 4R8HA 4CCLA 3S16J 2WAQA 4NHJA 1W5CC 5C4JJ 4IQ4A 1B72A 1MKMA 3DF8A 2FA5A 3H0DA 3E6MA 3CUQC 2CW7A 4DOZA 1NK3P 1IXRC 2H8RA 3HOVJ 4C30A 3REOA 4L5JA 5DD4A 3ABKH 2R5YA 1IN5A 2MD5A 3GO5A 3H9JA 2EV6A 1G4DA 3QAHA 5IYCJ 5IYDJ 2VL8A 3F23A 3JRBA 3BPXA 1JKPC 1DP7P 2E2JJ 5LFAA 3CF5F 2QKMB 4IF4A 2LY1A 3SYTA 4L9TA 3NRVA 2EIJH 2HVRA 2W1OA 4ZTFA 3J80Z 5D8KB 1MBGA 3TOBA 4DW6A 3OV8A 5K7ZA 1WJ5A 4P5OA 1LFPA 2DOEA 3S93A 2LRDA 1A6QA 1KZHA 4L0ZB 3Q5FA 5IT3A 2L01A
chains in the Genus database with same CATH topology
1YQAA 1O57A 5J8CA 2LNBA 1EH8A 5LGUA 1DDNA 5D4SA 1L3LA 1K78A 4HQEA 1FBUA 2D1HA 2FBHA 2BE5F 3SHFA 1KU7A 2VODA 1E2XA 2LF8A 2VXZA 5CVJA 3V7SA 2BGCA 3BZ6A 1TQIA 5DCMB 4UVAA 2XAQA 4B09A 1FYMA 5LLQA 4EJVA 2ADUA 3HSFA 5CVRA 2VOPA 3B02A 3R0AA 1FOKA 4G94A 4HV6A 2PBIA 3QP6A 1MJBA 3DPLC 5AONA 2FBIA 3D5LA 3F8FA 3WGHA 4IRGA 2J5OA 3HHGA 2GWRA 3O3KA 4HW0A 4ENJA 3LWFA 1D8KA 5DD8A 1EH6A 1R1VA 1LDJA 3ML6A 3I71A 4BAYA 2KJBA 1K79A 1JGSA 2LF7A 3NEUA 3F21A 2G7UA 3HRTA 2L3DA 3KFWX 3RKWA 4I01A 3T0YA 3ERED 2XKOA 4CO8A 1FBSA 1S7AA 3KP4A 2DBBA 3ZMSA 1ULYA 5LEKA 4CZZA 2M8EA 1YIOA 1TLHB 1USSA 1HSJA 1IAWA 1FY7A 2RDPA 2UXXA 2QQ9A 3EDPA 2EFWA 1P92A 3F3XA 5K5OA 2V9VA 5E17F 4ZZLA 5CJ9A 4OIOF 1LJ9A 2M87A 3GVAA 1VTNC 2Q2EA 3ROUA 1R00A 3ZMVA 4IJAA 3ZMDA 3LA3A 2K02A 1SD5A 3ZMTA 3WTVC 2EFNA 1P2FA 3GUDA 2VC0A 5JVTA 2D45A 3TOAA 3KETA 3COAC 2FSWA 3KZZA 4UNOA 2LKPA 1F4KA 4LG0A 5BPDA 3G3ZA 1J5YA 3WE2A 3I64A 2FEZA 2JPBA 1RUOA 4HLYA 5LRRA 2HQNA 2OBPA 3RTRA 5CVUA 2H94A 4I2OA 2ZXJA 2NYXA 4MEXF 4G6QA 4RGRA 1T2KA 1SMYF 3DEUA 1FPQA 4L5IA 3L9FA 3FMRA 1Z6RA 4ENKA 2WTEA 2NS0A 3IL2A 3JSOA 3RYRA 1HW1A 1WWXA 4ESJA 2EWNA 3MAJA 4L18B 1OKRA 3TO9A 2STTA 4YIIA 3ZN0A 1O3SA 1B59A 3CUQB 5HDGA 2XUBA 2FE3A 4EGZA 3N4MA 3SZPA 4NQWA 5D6FA 2F5EA 4JQFA 4FX0A 2XAJA 3MZYA 1GVJA 3W6JB 1UHMA 3C1DA 5FO5A 4CICA 4LB5A 2HOEA 3JSPA 2FMYA 2QLZA 3GF2A 3DKWA 2QUFA 2OZUA 2GA1A 5LBQA 1K7AA 2EFQA 2QVOA 3V7RA 3WTYC 2QYOA 3D0SA 2L4AA 1LQ1A 5E8GA 3HTSB 4HX4A 2EA4A 4EJTA 2XV4S 2FBKA 5LGNA 3LFKA 2VBWA 2JRTA 3RPUA 3TQNA 4A0ZA 4LGWA 2RKHA 5FB2A 1BI2A 4OIPF 1FP2A 4OIRF 1YW9A 3K2ZA 4AIJA 1MZBA 1FLIA 1Z91A 4A2UA 4KA4A 3FF5A 2YR2A 4A5MA 1R22A 3WU1B 1XB4A 1LB2A 3T1BA 2XROA 3KZYA 5A2QK 2HZTA 5LGTA 3V4GA 1XSXA 1DUXC 4IVNA 1KU9A 3HOTA 3SZTA 1JHFA 2IT0A 5L3CA 5J8FA 4P55A 3SXYA 3WG9A 2DPDA 5BPIA 4LFUA 1SFEA 2QWWA 1L0OC 3QU3A 2IA2A 2CW0F 3Q9VA 4WXCA 1O3TA 2PI0A 2VBZA 5F6FA 1H0MA 3F22A 3FWEA 4RB2C 2ESNA 3GLXA 3WE3A 3BROA 3PFIA 1TQMA 1T98A 1MGTA 2IPQX 2V1UA 2DQLA 5HLHA 3BOQA 2WV0A 2ZBKA 4YFNF 3I59A 3Q9SA 2HWVA 1RI7A 5D5WB 1KGSA 5DDGA 1BI0A 3K0LA 4ETSA 1S8NA 5J6XA 2K86A 3QU6A 4H0EA 4PZJA 1QBJA 2A5YB 4HBLA 1I5ZA 1R1UA 4IRIA 1IF1A 4HAMA 3DV8A 3FMSA 2ZMEA 4PGGA 4D0PA 3E6CC 3K1NA 2VN2A 2W57A 5LHGA 2XVCA 4O3MA 1HSTA 2X4HA 4BH9A 3F8MA 2OU2A 1F9NA 1IUYA 3J7AO 2CGPA 1W5TA 4HZFA 3J81K 3LA2A 5CVVA 1UCRA 2JPCA 1ZRDA 3JAMZ 3FMQA 3IRRA 2ESHA 1I6XA 1LDKB 1SAXA 2KIFA 3GFLA 2VOOA 4Q47A 1S6LA 1T6SA 2PEXA 4A5NA 2DQRA 2EA2A 3GWZA 4YFKF 1O3RA 4K2EA 5HOOA 3CO6C 4KIBA 1ZG5A 4FHTA 1W5SA 2QENA 1HKSA 3EYIA 5AIPA 3QPTA 3M7GA 1YS7A 3FM5A 4HYEA 2J5PA 5H20A 4WX9A 1Q1HA 3CJNA 1GHCA 2Z33A 2A6EF 3KLOA 2C6YA 2BBYA 2XIGA 1E17A 5E1XA 4HLXA 3TDUC 2EFPA 1NHAA 3LQQA 4RGXA 5E1ZB 3TKYA 4BHPA 3O2PE 1PUEE 2M30A 3F6OA 3OOPA 3ZN1A 2DPUA 2KJCA 4RGSA 1OYWA 2HS5A 3GZ6A 2Z9OA 1MJAA 1OR7A 1LDDA 4OU0A 4I98B 1BC7C 2HYFA 1W7PA 2R3SA 4M74A 3RIRA 3CDHA 1FX7A 4QLCU 4KUMA 1XMKA 1Z9CA 4MTEA 3ECHA 4M6YA 3F8BA 4IPAA 5FFZA 1G3TA 3TGNA 5KVRA 1U2WA 2A68F 5DV5A 2Q0OA 2ACJA 1BI3A 2FQ3A 3WTTC 3RYPA 5HLGA 4Y15A 3SQNA 2A61A 2PFBA 5L3EA 1U78A 2QQBA 2A3SA 3VEPA 4RS8A 2KRFA 2PMHA 1TQPA 3KE2A 3KP7A 1ZYRF 1TTYA 4LLGF 4A12A 2DAOA 1TW2A 2D1VA 1FT9A 4Q48A 3V8JA 3BJAA 4M71A 3MCZA 4EM2A 3E6BA 1R5GA 3GXOA 2MH2A 4KMFA 3HSEA 3NQOA 1ODDA 3KCCA 3GX4X 4YFXF 5BQTA 2IP2A 3M8EA 4GO1A 4M73A 3J81Z 2FMLA 1U5TA 3ZQ7A 5BS6A 1MDMA 5HVQC 2E7XA 4EJWA 3WTZA 2K4BA 2PJPA 5ILSA 2RV8A 2H6BA 4OOIA 4Y13A 2V6CA 2CFXA 4G6DA 1S7OA 2QM3A 3F8NA 1WQ2A 2P6SA 1T39A 1FSEA 5L3GA 1REPC 2GIVA 2VONA 1WSUA 4HF0A 2HFHA 2V1DA 5D5XB 4MQVA 3ABTA 2QBYB 3O6BB 1J75A 2VT3A 3BDDA 2GXBA 2X0LA 2CSOA 1T38A 3ZMUA 2MH9A 3WTSC 3R0JA 4Y17A 2XKPA 5ICCA 3ULQB 3M1EA 4WWCA 4M72A 1USTA 4UV8A 4MGRA 2PLYA 2VC1A 3VODA 3C18A 3HYIA 4WK8F 4CHUA 1BOAA 1OMIA 5D8LB 5AIQA 3JTHA 3P7NA 2DT5A 3B73A 1I27A 3HTUA 5JHUA 4IHTA 3RI4A 1FP1D 4WCGA 4LLLA 3HHHA 2ZJ2A 5FLXK 4R1HA 4EJOA 5ED4A 1J9IA 1XGMA 5HS9A 4M9XA 2O61A 1G3SA 5DCMA 3WTXC 1FNNA 3ZMZA 5D5UB 1K6OA 2HKXA 3C3WA 4U0VA 2ETHA 4F7ZA 4EQQA 3I54A 2GQQA 3VOEA 4XLPF 4XSZF 1CF7A 1FYKA 1ON2A 1I1SA 2EFOA 1YO5C 1PP7U 4HQMA 5CVIA 3I59B 4RB3C 1TNTA 2TDXA 4L9NA 5FD6A 1ON1A 3KP5A 1LVAA 4AIKA 4HDUA 1ZREA 5TRDA 2XGXA 2Y0MA 1BBYA 2AS5F 2K4JA 3WTWC 5BMZA 2JSCA 4L9VA 1PP8F 2XHKA 2EB7A 4AD9A 5L3DA 2GXGA 1BI1A 4HDVA 3FHZA 3FM3A 1HW2A 4HOBA 2K27A 3IKTA 2UXNA 3KP3A 3KEQA 3CLOA 1YS6A 1QPMA 4HX7A 4U0WA 4N9HA 3DXJF 2FNAA 1IN7A 2RVCA 3DP7A 3PQJA 2DU9A 1RZ4A 5FGMA 2FOKA 4BYYA 4U0YA 3CTAA 3L2CA 3V8LA 3RJPA 1ZGJA 5E1WA 5ERIA 2FNPA 4CGZA 4RAZA 3KEOA 3U1DA 1FZPB 1IXSB 4PDKA 5TJJA 1SFUA 2M45A 1GXQA 1QNTA 3I53A 1BC8C 4PCQA 1UFMA 1ZG1A 4ZYDA 2CQKA 1Z7UA 3KP2A 4S04A 2IW5A 4M6XA 4U88A 2IA0A 4LD5A 2OQGA 4MQ9F 4P9FA 2OAZA 4GGGA 5JR3A 2VE9A 1Y0UA 2L02A 3ECOA 2DI3A 3MFKA 5E8IA 2PN6A 1UB9A 2QQAA 1R58A 4ESFA 2P7VB 4L0YB 1X3UA 2FU4A 2A69F 5CYVA 4ENNA 2ZNYA 1P4XA 4I7HA 4YIFA 1R7JA 2O6GE 4E70A 4MTDA 1O3QA 3BJ6A 3MZHA 1HBXG 1GXPA 3WU0A 2Z99A 2EK5A 4ASNA 2EJRA 1TNSA 1RIOH 2AXLA 1XDSA 1IXCA 2YPRA 3R6SA 2NNNA 2HGCA 1XCVA 1XSVA 3E5UA 2K7LA 5FLXZ 4ON0A 2P7CB 4I0BA 1S29A 3ABUA 1J59A 1QZZA 1K78B 1B4AA 2ZO4A 4HF2A 3I5UA 1G3WA 3CUQA 3RKXA 5LRSA 5ILVA 4BNCA 4OINF 3BWGA 2M1BA 2P5KA 5ICEA 4HV5A 2HKOA 2ISYA 2KIMA 2ISZA 3H92A 2W85A 1TBXA 3GZ5A 2YX7A 1BIAA 3R4KA 2O03A 2MLKA 3WODF 4ZYHA 5D6EA 4UXNA 1IRFA 1AWCA 4CDGA 2FXAA 1SD7A 5IT9K 3K1PA 1YYVA 1ZLJA 3RDIA 2R7DA 5ICGA 3FXRA 1KYWA 4LK1F 2R7FA 1HXDA 2RC4A 2NRAC 1D3YA 1W7PD 1G6NA 4UVCA 1Z05A 2V1XA 4ENMA 2DO7A 4UV9A 3GEZA 1ZGAA 2L54A 2RQPA 1PDNC 4JBAA 1U5TB 5CLSA 3FXQA 3S2WA 1H9GA 2F5CA 3QRFF 2P5LC 3L7WA 1R5HA 3WGIA 2VT2A 4BHCA 1RNLA 3E97A 2IVMA 2ELHA 1IW7F 2Z3YA 4EVIA 2OQRA 3ELKA 1FSHA 4BHBA 1CGPA 5HDNA 1ZH5A 3AAFA 1KA8A 5DCFA 1D5VA 1BJAA 1XSDA 3EYYA 1IN4A 2RNJA 3KP6A 1IN6A 3HSRA 2YX4A 4XSXF 4TV7A 3L00A 4YG2F 5A2QZ 4Q5SF 1OYYA 3K69A 3ZP5A 1IZ1A 4WF2A 3QPHA 2KKOA 1C0WA 1XGNA 4G7OF 1UHWA 1P6RA 4RB0A 4LMYA 4GCVA 1WKMA 2ZCWA 2P8TA 3QOPA 5K1YA 2VBXA 4KNYA 3R61A 1ZARA 3GFJA 3HUGA 3JTGA 3T8TA 1STZA 3E6DA 1QO0D 2NNYA 4UUVA 2XAGA 1AOYA 2YU3A 1QGPA 3ISPA 1LEBA 4WXDA 1U6GA 2COMA 4LG0B 3U2RA 3ZPLA 4LLNA 4IHSA 2OD5A 1SD4A 5LHIA 4MEYF 3GFIA 1WI9A 2Y48A 4OMZA 3TDZC 5E20A 1FBQA 4ESBA 4ZYGA 1SFXA 4ZZDA 3HIFA 1RUNA 1A04A 2W25A 3HRSA 3N97A 4KN7X 4RAYA 2RN7A 5DYMA 1CF7B 3RKYA 4PGHA 1J7KA 4G9YA 2Z5UA 2E1CA 3WGGA 3K1MA 4LJZF 4CXFA 4A0XA 1HW5A 3E5XA 2L4MA 3E3VA 4GYGA 4DNCA 2E1NA 3LSTA 5H6RA 4LB6B 2XAFA 1FYLA 4EV0A 4KMUX 3U9GA 4Q4ZF 6PAXA 1ZRCA 5IT9Z 4DQ2A 4LK0F 1G3YA 2CWEA 5DUIA 3RPQA 3TO7A 2GAUA 3L09A 3IRQA 3F72A 2XRNA 1IRGA 3PQKA 1BN5A 1QZYA 4O6JA 1EV7A 3MEXA 3FXUA 2MLGA 3H3ZA 4QWQA 2OA4A 5HDKA 4M9ZA 2F5FA 1YW7A 3WTUC 2WWYA 3LQRA 1T0FA 3P9KA 2M5WA 4KFCA 2BYVE 3LA7A 2FF4A 4AVPA 1J2XA 1OPCA 3K9TA 5FD5A 5ICFA 2DFIA 2HDCA 2GA2A 2HTJA 2GZWA 1R36A 4M9SA 2NAZA 4FT8A 4B8XA 4MNUA 1YTYA 2O8XA 3R60A 4U7DA 3TO6A 3HRMA 4GYIA 1XGOA 1ZHFA 2BV6A 1Z1DA 2VBYA 1KQ8A 2DW4A 4AWXB 3CUOA 4P96A 3W6KB 4GXOA 1O7LA 3H3UA 4O5VA 1XMAA 2IJLA 3FX3A 4U7BA 4G8XA 1B9MA 1YW8A 2IA1A 3IWZA 1B9NA 1U5TC 3M8FA 3V7CA 2DK8A 4UHTA 4S05A 2UZKA 2DLLA 5DEQA 2MBFA 1QQIA 4P9UA 1YG2A 1YFHA 3BY6A 2P5VA 2WC2A 4CYDA 4IXAA 3SFZA 2G7HA 2Q8KA 3IHUA 1OYIA 4KYWA 3JAMK 5EEGA 3M9AA 1TW3A 2F5DA 2QZ8A 2ZMEB 4FX4A 4L9JA 1R1TA 4A6EA 2A6HF 3IC7A 3LAPA 1JE8A 2P6TA 1D8JA 4AIHA 3IKVA 3VFZA 1F1ZA 1ZLKA 4IRHA 5D5VB 3EQLF 1YLFA 2VE8A 3JW4A 2CYYA 1XN7A 2Y75A 1W4MA 2PMUA 2YSRA 1I1GA 1ZAOA 3G73A 3LAJA 5HS7A 3V8KA 1WRJA 1XCBA 4KICA 2BEOA 2QBYA 4HX8A 5L3BA 1ZG3A 1KU2A 5ILUA 2PQ8A 2HQRA 2CO5A 2W84A 2H09A 4WXHA 1U3EM 1ZN2A 2DK5A 3DPTA 5F1RA 1EH7A 1O7FA 2D2WA 5D4RA 4I0AA 1J0RA 5HS8A 1LNWA 5LHHA 1DPUA 1XD7A 2HTSA 3T5XA 4BQAA 1U8RA 5K5QA 1LEAA 2JT1A 3I58A 2W24A 1S3JA 3EUHA 1B1BA 3J80K 4N9IA 3BPVA 4A6DA 3QP5A 3KLNA 1KU3A 2STWA 1H9TA 4EGYA 1SMTA 2O0YA 2MA3A 3P9CA 3F8CA 2MC3A 4HA8A 3T8RA 3DQVC 2ZKZA 2JZYA 2B0LA 2PG4A 4KT5C 2EV5A 4OIQF 4MHGA 3MWMA 1HKTA 2LSOA 4XRFA 4BXUA 2DTRA 2FRHA 3DFGA 1ONVA 5LEJA 5BOXA 1MD0A 1FWZA 4ZYEA 4R79A 2UWMA 3I4PA 1KYZA 1JXSA 1W7PB 5HLIA 5JFRA 2A07F 4OMYA 4NB5A 1P4WA 1XDUA 2IRFG 1FC3A 5KK1A 3FZVA 1B6AA 1XGSA 3C7JA 2HR3A 3IWFA 1IN8A 4EM1A 4KIGA 5L3FA 5FFXA 4KN4X 4HF1A 1BM9A 1R23A 3E5QA 3MQ0A 4I09A 3BP8A 3GYHX 4EMSA 3F6VA 5K5RA 4KDPA 2HYGD 1ZRFA 3P9IA 2KIUA 2CG4A 5DUKA 2XASA 1KQ0A 2G9WA 3GFMA 2HEOA 5EEHA 4JK1X 1DPRA 4KIFA 3GW2A 5F64A 1JHHA 2RGVA 4RB1A 2ZNZA 3BJOA 4G7HF 2P4WA 2V79A 3EETA 2E7WA 1Z6TA 1F5TA 3HOSA 3CO7C 2H27A 2OZ6A 3I0TA 2H6CA 4EM0B 4XLNF 4XBFA 1HQCA 1BIBA 2O3FA 2XAHA 4Z2YA 4N0BA 1MDMB 5H6QA 3VB2A 2JTVA 3HRUA 4G7ZF 4A0YA 4EJUA 5JI6A 2LDUA 2F2EA 1SD6A 2ZFWA 1P4AA 4I02A 4RGUA 1V3FA 1KQ9A 4ZH4F 1MJ9A 5E18F 1HKQA 1V4RA 2EV0A 4UVBA 4R8HA 4NHJA 1MKMA 2FA5A 3DF8A 3E6MA 3CUQC 1IXRC 3REOA 4L5JA 5DD4A 1IN5A 2MD5A 3GO5A 2EV6A 1G4DA 3QAHA 3F23A 3BPXA 1DP7P 4IF4A 4L9TA 3NRVA 3J80Z 5D8KB 3TOBA 3OV8A 4P5OA 4L0ZB 3Q5FA 5IT3A 2L01A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YQA A;  1O57 A;  5J8C A;  2LNB A;  1EH8 A;  5LGU A;  1DDN A;  5D4S A;  1L3L A;  1K78 A;  4HQE A;  1FBU A;  2D1H A;  2FBH A;  2BE5 F;  3SHF A;  1KU7 A;  2VOD A;  1E2X A;  2LF8 A;  2VXZ A;  5CVJ A;  3V7S A;  2BGC A;  3BZ6 A;  1TQI A;  5DCM B;  4UVA A;  2XAQ A;  4B09 A;  1FYM A;  5LLQ A;  4EJV A;  2ADU A;  3HSF A;  5CVR A;  2VOP A;  3B02 A;  3R0A A;  1FOK A;  4G94 A;  4HV6 A;  2PBI A;  3QP6 A;  1MJB A;  3DPL C;  5AON A;  2FBI A;  3D5L A;  3F8F A;  3WGH A;  4IRG A;  2J5O A;  3HHG A;  2GWR A;  3O3K A;  4HW0 A;  4ENJ A;  3LWF A;  1D8K A;  5DD8 A;  1EH6 A;  1R1V A;  1LDJ A;  3ML6 A;  3I71 A;  4BAY A;  2KJB A;  1K79 A;  1JGS A;  2LF7 A;  3NEU A;  3F21 A;  2G7U A;  3HRT A;  2L3D A;  3KFW X;  3RKW A;  4I01 A;  3T0Y A;  3ERE D;  2XKO A;  4CO8 A;  1FBS A;  1S7A A;  3KP4 A;  2DBB A;  3ZMS A;  1ULY A;  5LEK A;  4CZZ A;  2M8E A;  1YIO A;  1TLH B;  1USS A;  1HSJ A;  1IAW A;  1FY7 A;  2RDP A;  2UXX A;  2QQ9 A;  3EDP A;  2EFW A;  1P92 A;  3F3X A;  5K5O A;  2V9V A;  5E17 F;  4ZZL A;  5CJ9 A;  4OIO F;  1LJ9 A;  2M87 A;  3GVA A;  1VTN C;  2Q2E A;  3ROU A;  1R00 A;  3ZMV A;  4IJA A;  3ZMD A;  3LA3 A;  2K02 A;  1SD5 A;  3ZMT A;  3WTV C;  2EFN A;  1P2F A;  3GUD A;  2VC0 A;  5JVT A;  2D45 A;  3TOA A;  3KET A;  3COA C;  2FSW A;  3KZZ A;  4UNO A;  2LKP A;  1F4K A;  4LG0 A;  5BPD A;  3G3Z A;  1J5Y A;  3WE2 A;  3I64 A;  2FEZ A;  2JPB A;  1RUO A;  4HLY A;  5LRR A;  2HQN A;  2OBP A;  3RTR A;  5CVU A;  2H94 A;  4I2O A;  2ZXJ A;  2NYX A;  4MEX F;  4G6Q A;  4RGR A;  1T2K A;  1SMY F;  3DEU A;  1FPQ A;  4L5I A;  3L9F A;  3FMR A;  1Z6R A;  4ENK A;  2WTE A;  2NS0 A;  3IL2 A;  3JSO A;  3RYR A;  1HW1 A;  1WWX A;  4ESJ A;  2EWN A;  3MAJ A;  4L18 B;  1OKR A;  3TO9 A;  2STT A;  4YII A;  3ZN0 A;  1O3S A;  1B59 A;  3CUQ B;  5HDG A;  2XUB A;  2FE3 A;  4EGZ A;  3N4M A;  3SZP A;  4NQW A;  5D6F A;  2F5E A;  4JQF A;  4FX0 A;  2XAJ A;  3MZY A;  1GVJ A;  3W6J B;  1UHM A;  3C1D A;  5FO5 A;  4CIC A;  4LB5 A;  2HOE A;  3JSP A;  2FMY A;  2QLZ A;  3GF2 A;  3DKW A;  2QUF A;  2OZU A;  2GA1 A;  5LBQ A;  1K7A A;  2EFQ A;  2QVO A;  3V7R A;  3WTY C;  2QYO A;  3D0S A;  2L4A A;  1LQ1 A;  5E8G A;  3HTS B;  4HX4 A;  2EA4 A;  4EJT A;  2XV4 S;  2FBK A;  5LGN A;  3LFK A;  2VBW A;  2JRT A;  3RPU A;  3TQN A;  4A0Z A;  4LGW A;  2RKH A;  5FB2 A;  1BI2 A;  4OIP F;  1FP2 A;  4OIR F;  1YW9 A;  3K2Z A;  4AIJ A;  1MZB A;  1FLI A;  1Z91 A;  4A2U A;  4KA4 A;  3FF5 A;  2YR2 A;  4A5M A;  1R22 A;  3WU1 B;  1XB4 A;  1LB2 A;  3T1B A;  2XRO A;  3KZY A;  5A2Q K;  2HZT A;  5LGT A;  3V4G A;  1XSX A;  1DUX C;  4IVN A;  1KU9 A;  3HOT A;  3SZT A;  1JHF A;  2IT0 A;  5L3C A;  5J8F A;  4P55 A;  3SXY A;  3WG9 A;  2DPD A;  5BPI A;  4LFU A;  1SFE A;  2QWW A;  1L0O C;  3QU3 A;  2IA2 A;  2CW0 F;  3Q9V A;  4WXC A;  1O3T A;  2PI0 A;  2VBZ A;  5F6F A;  1H0M A;  3F22 A;  3FWE A;  4RB2 C;  2ESN A;  3GLX A;  3WE3 A;  3BRO A;  3PFI A;  1TQM A;  1T98 A;  1MGT A;  2IPQ X;  2V1U A;  2DQL A;  5HLH A;  3BOQ A;  2WV0 A;  2ZBK A;  4YFN F;  3I59 A;  3Q9S A;  2HWV A;  1RI7 A;  5D5W B;  1KGS A;  5DDG A;  1BI0 A;  3K0L A;  4ETS A;  1S8N A;  5J6X A;  2K86 A;  3QU6 A;  4H0E A;  4PZJ A;  1QBJ A;  2A5Y B;  4HBL A;  1I5Z A;  1R1U A;  4IRI A;  1IF1 A;  4HAM A;  3DV8 A;  3FMS A;  2ZME A;  4PGG A;  4D0P A;  3E6C C;  3K1N A;  2VN2 A;  2W57 A;  5LHG A;  2XVC A;  4O3M A;  1HST A;  2X4H A;  4BH9 A;  3F8M A;  2OU2 A;  1F9N A;  1IUY A;  3J7A O;  2CGP A;  1W5T A;  4HZF A;  3J81 K;  3LA2 A;  5CVV A;  1UCR A;  2JPC A;  1ZRD A;  3JAM Z;  3FMQ A;  3IRR A;  2ESH A;  1I6X A;  1LDK B;  1SAX A;  2KIF A;  3GFL A;  2VOO A;  4Q47 A;  1S6L A;  1T6S A;  2PEX A;  4A5N A;  2DQR A;  2EA2 A;  3GWZ A;  4YFK F;  1O3R A;  4K2E A;  5HOO A;  3CO6 C;  4KIB A;  1ZG5 A;  4FHT A;  1W5S A;  2QEN A;  1HKS A;  3EYI A;  5AIP A;  3QPT A;  3M7G A;  1YS7 A;  3FM5 A;  4HYE A;  2J5P A;  5H20 A;  4WX9 A;  1Q1H A;  3CJN A;  1GHC A;  2Z33 A;  2A6E F;  3KLO A;  2C6Y A;  2BBY A;  2XIG A;  1E17 A;  5E1X A;  4HLX A;  3TDU C;  2EFP A;  1NHA A;  3LQQ A;  4RGX A;  5E1Z B;  3TKY A;  4BHP A;  3O2P E;  1PUE E;  2M30 A;  3F6O A;  3OOP A;  3ZN1 A;  2DPU A;  2KJC A;  4RGS A;  1OYW A;  2HS5 A;  3GZ6 A;  2Z9O A;  1MJA A;  1OR7 A;  1LDD A;  4OU0 A;  4I98 B;  1BC7 C;  2HYF A;  1W7P A;  2R3S A;  4M74 A;  3RIR A;  3CDH A;  1FX7 A;  4QLC U;  4KUM A;  1XMK A;  1Z9C A;  4MTE A;  3ECH A;  4M6Y A;  3F8B A;  4IPA A;  5FFZ A;  1G3T A;  3TGN A;  5KVR A;  1U2W A;  2A68 F;  5DV5 A;  2Q0O A;  2ACJ A;  1BI3 A;  2FQ3 A;  3WTT C;  3RYP A;  5HLG A;  4Y15 A;  3SQN A;  2A61 A;  2PFB A;  5L3E A;  1U78 A;  2QQB A;  2A3S A;  3VEP A;  4RS8 A;  2KRF A;  2PMH A;  1TQP A;  3KE2 A;  3KP7 A;  1ZYR F;  1TTY A;  4LLG F;  4A12 A;  2DAO A;  1TW2 A;  2D1V A;  1FT9 A;  4Q48 A;  3V8J A;  3BJA A;  4M71 A;  3MCZ A;  4EM2 A;  3E6B A;  1R5G A;  3GXO A;  2MH2 A;  4KMF A;  3HSE A;  3NQO A;  1ODD A;  3KCC A;  3GX4 X;  4YFX F;  5BQT A;  2IP2 A;  3M8E A;  4GO1 A;  4M73 A;  3J81 Z;  2FML A;  1U5T A;  3ZQ7 A;  5BS6 A;  1MDM A;  5HVQ C;  2E7X A;  4EJW A;  3WTZ A;  2K4B A;  2PJP A;  5ILS A;  2RV8 A;  2H6B A;  4OOI A;  4Y13 A;  2V6C A;  2CFX A;  4G6D A;  1S7O A;  2QM3 A;  3F8N A;  1WQ2 A;  2P6S A;  1T39 A;  1FSE A;  5L3G A;  1REP C;  2GIV A;  2VON A;  1WSU A;  4HF0 A;  2HFH A;  2V1D A;  5D5X B;  4MQV A;  3ABT A;  2QBY B;  3O6B B;  1J75 A;  2VT3 A;  3BDD A;  2GXB A;  2X0L A;  2CSO A;  1T38 A;  3ZMU A;  2MH9 A;  3WTS C;  3R0J A;  4Y17 A;  2XKP A;  5ICC A;  3ULQ B;  3M1E A;  4WWC A;  4M72 A;  1UST A;  4UV8 A;  4MGR A;  2PLY A;  2VC1 A;  3VOD A;  3C18 A;  3HYI A;  4WK8 F;  4CHU A;  1BOA A;  1OMI A;  5D8L B;  5AIQ A;  3JTH A;  3P7N A;  2DT5 A;  3B73 A;  1I27 A;  3HTU A;  5JHU A;  4IHT A;  3RI4 A;  1FP1 D;  4WCG A;  4LLL A;  3HHH A;  2ZJ2 A;  5FLX K;  4R1H A;  4EJO A;  5ED4 A;  1J9I A;  1XGM A;  5HS9 A;  4M9X A;  2O61 A;  1G3S A;  5DCM A;  3WTX C;  1FNN A;  3ZMZ A;  5D5U B;  1K6O A;  2HKX A;  3C3W A;  4U0V A;  2ETH A;  4F7Z A;  4EQQ A;  3I54 A;  2GQQ A;  3VOE A;  4XLP F;  4XSZ F;  1CF7 A;  1FYK A;  1ON2 A;  1I1S A;  2EFO A;  1YO5 C;  1PP7 U;  4HQM A;  5CVI A;  3I59 B;  4RB3 C;  1TNT A;  2TDX A;  4L9N A;  5FD6 A;  1ON1 A;  3KP5 A;  1LVA A;  4AIK A;  4HDU A;  1ZRE A;  5TRD A;  2XGX A;  2Y0M A;  1BBY A;  2AS5 F;  2K4J A;  3WTW C;  5BMZ A;  2JSC A;  4L9V A;  1PP8 F;  2XHK A;  2EB7 A;  4AD9 A;  5L3D A;  2GXG A;  1BI1 A;  4HDV A;  3FHZ A;  3FM3 A;  1HW2 A;  4HOB A;  2K27 A;  3IKT A;  2UXN A;  3KP3 A;  3KEQ A;  3CLO A;  1YS6 A;  1QPM A;  4HX7 A;  4U0W A;  4N9H A;  3DXJ F;  2FNA A;  1IN7 A;  2RVC A;  3DP7 A;  3PQJ A;  2DU9 A;  1RZ4 A;  5FGM A;  2FOK A;  4BYY A;  4U0Y A;  3CTA A;  3L2C A;  3V8L A;  3RJP A;  1ZGJ A;  5E1W A;  5ERI A;  2FNP A;  4CGZ A;  4RAZ A;  3KEO A;  3U1D A;  1FZP B;  1IXS B;  4PDK A;  5TJJ A;  1SFU A;  2M45 A;  1GXQ A;  1QNT A;  3I53 A;  1BC8 C;  4PCQ A;  1UFM A;  1ZG1 A;  4ZYD A;  2CQK A;  1Z7U A;  3KP2 A;  4S04 A;  2IW5 A;  4M6X A;  4U88 A;  2IA0 A;  4LD5 A;  2OQG A;  4MQ9 F;  4P9F A;  2OAZ A;  4GGG A;  5JR3 A;  2VE9 A;  1Y0U A;  2L02 A;  3ECO A;  2DI3 A;  3MFK A;  5E8I A;  2PN6 A;  1UB9 A;  2QQA A;  1R58 A;  4ESF A;  2P7V B;  4L0Y B;  1X3U A;  2FU4 A;  2A69 F;  5CYV A;  4ENN A;  2ZNY A;  1P4X A;  4I7H A;  4YIF A;  1R7J A;  2O6G E;  4E70 A;  4MTD A;  1O3Q A;  3BJ6 A;  3MZH A;  1HBX G;  1GXP A;  3WU0 A;  2Z99 A;  2EK5 A;  4ASN A;  2EJR A;  1TNS A;  1RIO H;  2AXL A;  1XDS A;  1IXC A;  2YPR A;  3R6S A;  2NNN A;  2HGC A;  1XCV A;  1XSV A;  3E5U A;  2K7L A;  5FLX Z;  4ON0 A;  2P7C B;  4I0B A;  1S29 A;  3ABU A;  1J59 A;  1QZZ A;  1K78 B;  1B4A A;  2ZO4 A;  4HF2 A;  3I5U A;  1G3W A;  3CUQ A;  3RKX A;  5LRS A;  5ILV A;  4BNC A;  4OIN F;  3BWG A;  2M1B A;  2P5K A;  5ICE A;  4HV5 A;  2HKO A;  2ISY A;  2KIM A;  2ISZ A;  3H92 A;  2W85 A;  1TBX A;  3GZ5 A;  2YX7 A;  1BIA A;  3R4K A;  2O03 A;  2MLK A;  3WOD F;  4ZYH A;  5D6E A;  4UXN A;  1IRF A;  1AWC A;  4CDG A;  2FXA A;  1SD7 A;  5IT9 K;  3K1P A;  1YYV A;  1ZLJ A;  3RDI A;  2R7D A;  5ICG A;  3FXR A;  1KYW A;  4LK1 F;  2R7F A;  1HXD A;  2RC4 A;  2NRA C;  1D3Y A;  1W7P D;  1G6N A;  4UVC A;  1Z05 A;  2V1X A;  4ENM A;  2DO7 A;  4UV9 A;  3GEZ A;  1ZGA A;  2L54 A;  2RQP A;  1PDN C;  4JBA A;  1U5T B;  5CLS A;  3FXQ A;  3S2W A;  1H9G A;  2F5C A;  3QRF F;  2P5L C;  3L7W A;  1R5H A;  3WGI A;  2VT2 A;  4BHC A;  1RNL A;  3E97 A;  2IVM A;  2ELH A;  1IW7 F;  2Z3Y A;  4EVI A;  2OQR A;  3ELK A;  1FSH A;  4BHB A;  1CGP A;  5HDN A;  1ZH5 A;  3AAF A;  1KA8 A;  5DCF A;  1D5V A;  1BJA A;  1XSD A;  3EYY A;  1IN4 A;  2RNJ A;  3KP6 A;  1IN6 A;  3HSR A;  2YX4 A;  4XSX F;  4TV7 A;  3L00 A;  4YG2 F;  5A2Q Z;  4Q5S F;  1OYY A;  3K69 A;  3ZP5 A;  1IZ1 A;  4WF2 A;  3QPH A;  2KKO A;  1C0W A;  1XGN A;  4G7O F;  1UHW A;  1P6R A;  4RB0 A;  4LMY A;  4GCV A;  1WKM A;  2ZCW A;  2P8T A;  3QOP A;  5K1Y A;  2VBX A;  4KNY A;  3R61 A;  1ZAR A;  3GFJ A;  3HUG A;  3JTG A;  3T8T A;  1STZ A;  3E6D A;  1QO0 D;  2NNY A;  4UUV A;  2XAG A;  1AOY A;  2YU3 A;  1QGP A;  3ISP A;  1LEB A;  4WXD A;  1U6G A;  2COM A;  4LG0 B;  3U2R A;  3ZPL A;  4LLN A;  4IHS A;  2OD5 A;  1SD4 A;  5LHI A;  4MEY F;  3GFI A;  1WI9 A;  2Y48 A;  4OMZ A;  3TDZ C;  5E20 A;  1FBQ A;  4ESB A;  4ZYG A;  1SFX A;  4ZZD A;  3HIF A;  1RUN A;  1A04 A;  2W25 A;  3HRS A;  3N97 A;  4KN7 X;  4RAY A;  2RN7 A;  5DYM A;  1CF7 B;  3RKY A;  4PGH A;  1J7K A;  4G9Y A;  2Z5U A;  2E1C A;  3WGG A;  3K1M A;  4LJZ F;  4CXF A;  4A0X A;  1HW5 A;  3E5X A;  2L4M A;  3E3V A;  4GYG A;  4DNC A;  2E1N A;  3LST A;  5H6R A;  4LB6 B;  2XAF A;  1FYL A;  4EV0 A;  4KMU X;  3U9G A;  4Q4Z F;  6PAX A;  1ZRC A;  5IT9 Z;  4DQ2 A;  4LK0 F;  1G3Y A;  2CWE A;  5DUI A;  3RPQ A;  3TO7 A;  2GAU A;  3L09 A;  3IRQ A;  3F72 A;  2XRN A;  1IRG A;  3PQK A;  1BN5 A;  1QZY A;  4O6J A;  1EV7 A;  3MEX A;  3FXU A;  2MLG A;  3H3Z A;  4QWQ A;  2OA4 A;  5HDK A;  4M9Z A;  2F5F A;  1YW7 A;  3WTU C;  2WWY A;  3LQR A;  1T0F A;  3P9K A;  2M5W A;  4KFC A;  2BYV E;  3LA7 A;  2FF4 A;  4AVP A;  1J2X A;  1OPC A;  3K9T A;  5FD5 A;  5ICF A;  2DFI A;  2HDC A;  2GA2 A;  2HTJ A;  2GZW A;  1R36 A;  4M9S A;  2NAZ A;  4FT8 A;  4B8X A;  4MNU A;  1YTY A;  2O8X A;  3R60 A;  4U7D A;  3TO6 A;  3HRM A;  4GYI A;  1XGO A;  1ZHF A;  2BV6 A;  1Z1D A;  2VBY A;  1KQ8 A;  2DW4 A;  4AWX B;  3CUO A;  4P96 A;  3W6K B;  4GXO A;  1O7L A;  3H3U A;  4O5V A;  1XMA A;  2IJL A;  3FX3 A;  4U7B A;  4G8X A;  1B9M A;  1YW8 A;  2IA1 A;  3IWZ A;  1B9N A;  1U5T C;  3M8F A;  3V7C A;  2DK8 A;  4UHT A;  4S05 A;  2UZK A;  2DLL A;  5DEQ A;  2MBF A;  1QQI A;  4P9U A;  1YG2 A;  1YFH A;  3BY6 A;  2P5V A;  2WC2 A;  4CYD A;  4IXA A;  3SFZ A;  2G7H A;  2Q8K A;  3IHU A;  1OYI A;  4KYW A;  3JAM K;  5EEG A;  3M9A A;  1TW3 A;  2F5D A;  2QZ8 A;  2ZME B;  4FX4 A;  4L9J A;  1R1T A;  4A6E A;  2A6H F;  3IC7 A;  3LAP A;  1JE8 A;  2P6T A;  1D8J A;  4AIH A;  3IKV A;  3VFZ A;  1F1Z A;  1ZLK A;  4IRH A;  5D5V B;  3EQL F;  1YLF A;  2VE8 A;  3JW4 A;  2CYY A;  1XN7 A;  2Y75 A;  1W4M A;  2PMU A;  2YSR A;  1I1G A;  1ZAO A;  3G73 A;  3LAJ A;  5HS7 A;  3V8K A;  1WRJ A;  1XCB A;  4KIC A;  2BEO A;  2QBY A;  4HX8 A;  5L3B A;  1ZG3 A;  1KU2 A;  5ILU A;  2PQ8 A;  2HQR A;  2CO5 A;  2W84 A;  2H09 A;  4WXH A;  1U3E M;  1ZN2 A;  2DK5 A;  3DPT A;  5F1R A;  1EH7 A;  1O7F A;  2D2W A;  5D4R A;  4I0A A;  1J0R A;  5HS8 A;  1LNW A;  5LHH A;  1DPU A;  1XD7 A;  2HTS A;  3T5X A;  4BQA A;  1U8R A;  5K5Q A;  1LEA A;  2JT1 A;  3I58 A;  2W24 A;  1S3J A;  3EUH A;  1B1B A;  3J80 K;  4N9I A;  3BPV A;  4A6D A;  3QP5 A;  3KLN A;  1KU3 A;  2STW A;  1H9T A;  4EGY A;  1SMT A;  2O0Y A;  2MA3 A;  3P9C A;  3F8C A;  2MC3 A;  4HA8 A;  3T8R A;  3DQV C;  2ZKZ A;  2JZY A;  2B0L A;  2PG4 A;  4KT5 C;  2EV5 A;  4OIQ F;  4MHG A;  3MWM A;  1HKT A;  2LSO A;  4XRF A;  4BXU A;  2DTR A;  2FRH A;  3DFG A;  1ONV A;  5LEJ A;  5BOX A;  1MD0 A;  1FWZ A;  4ZYE A;  4R79 A;  2UWM A;  3I4P A;  1KYZ A;  1JXS A;  1W7P B;  5HLI A;  5JFR A;  2A07 F;  4OMY A;  4NB5 A;  1P4W A;  1XDU A;  2IRF G;  1FC3 A;  5KK1 A;  3FZV A;  1B6A A;  1XGS A;  3C7J A;  2HR3 A;  3IWF A;  1IN8 A;  4EM1 A;  4KIG A;  5L3F A;  5FFX A;  4KN4 X;  4HF1 A;  1BM9 A;  1R23 A;  3E5Q A;  3MQ0 A;  4I09 A;  3BP8 A;  3GYH X;  4EMS A;  3F6V A;  5K5R A;  4KDP A;  2HYG D;  1ZRF A;  3P9I A;  2KIU A;  2CG4 A;  5DUK A;  2XAS A;  1KQ0 A;  2G9W A;  3GFM A;  2HEO A;  5EEH A;  4JK1 X;  1DPR A;  4KIF A;  3GW2 A;  5F64 A;  1JHH A;  2RGV A;  4RB1 A;  2ZNZ A;  3BJO A;  4G7H F;  2P4W A;  2V79 A;  3EET A;  2E7W A;  1Z6T A;  1F5T A;  3HOS A;  3CO7 C;  2H27 A;  2OZ6 A;  3I0T A;  2H6C A;  4EM0 B;  4XLN F;  4XBF A;  1HQC A;  1BIB A;  2O3F A;  2XAH A;  4Z2Y A;  4N0B A;  1MDM B;  5H6Q A;  3VB2 A;  2JTV A;  3HRU A;  4G7Z F;  4A0Y A;  4EJU A;  5JI6 A;  2LDU A;  2F2E A;  1SD6 A;  2ZFW A;  1P4A A;  4I02 A;  4RGU A;  1V3F A;  1KQ9 A;  4ZH4 F;  1MJ9 A;  5E18 F;  1HKQ A;  1V4R A;  2EV0 A;  4UVB A;  4R8H A;  4NHJ A;  1MKM A;  2FA5 A;  3DF8 A;  3E6M A;  3CUQ C;  1IXR C;  3REO A;  4L5J A;  5DD4 A;  1IN5 A;  2MD5 A;  3GO5 A;  2EV6 A;  1G4D A;  3QAH A;  3F23 A;  3BPX A;  1DP7 P;  4IF4 A;  4L9T A;  3NRV A;  3J80 Z;  5D8K B;  3TOB A;  3OV8 A;  4P5O A;  4L0Z B;  3Q5F A;  5IT3 A;  2L01 A; 
#chains in the Genus database with same CATH topology
 1IO2 A;  1EJ9 A;  1YQA A;  3RCO A;  1O57 A;  5J8C A;  2LNB A;  1EH8 A;  3DU5 A;  1JTY A;  1WZ2 A;  2E1M B;  5LGU A;  2LYC A;  1DDN A;  1XX5 A;  3Q0W A;  3A0B C;  3DEE A;  5D4S A;  1L3L A;  1K78 A;  4Y4R A;  4MLO A;  3OWT A;  2CQ7 A;  2KIS A;  4HQE A;  2CS3 A;  3GTK J;  5DM6 F;  1FBU A;  2D1H A;  2FBH A;  2BE5 F;  3SHF A;  1KU7 A;  2VOD A;  5C4X J;  2KT0 A;  1E2X A;  2LF8 A;  1QHH D;  2VXZ A;  5CVJ A;  2K9M A;  3ASN H;  4XOP A;  5K7H A;  3V7S A;  1VQL I;  2BGC A;  3BZ6 A;  1TQI A;  3G1M A;  5DCM B;  4UVA A;  2XAQ A;  4B09 A;  1FYM A;  5LLQ A;  2YU9 J;  3ONQ A;  1MMA A;  2VKV A;  4DGW B;  4EJV A;  2ADU A;  1N77 A;  4JYK A;  2H8W A;  3HSF A;  1I50 J;  5CVR A;  1IV6 A;  3M07 A;  2EZH A;  3O8H A;  2VOP A;  3B02 A;  2Z2S B;  3R0A A;  3A01 B;  1FOK A;  4HRI A;  4G94 A;  3LSP A;  1H88 C;  2ZXH A;  1T08 B;  2LR8 A;  3S1N J;  3CMY A;  4HV6 A;  2PBI A;  3HOW J;  3QP6 A;  1MJB A;  2LD5 A;  3H9G A;  4AYB N;  4II2 A;  3DPL C;  4NC6 A;  3DPU A;  5AON A;  1APL C;  2FBI A;  4V2F A;  3D5L A;  3JRF A;  3F8F A;  1T95 A;  2OV7 A;  4W97 A;  4UUS B;  3WGH A;  3JRG A;  4QSH A;  3DBR B;  4IRG A;  3L2W A;  2J5O A;  3HHG A;  2EPF A;  2GWR A;  3O3K A;  4NUB A;  4YEL A;  4HW0 A;  3MKW B;  4ENJ A;  5IP6 A;  2DA6 A;  3LWF A;  1D8K A;  1OR7 C;  5DD8 A;  1EH6 A;  2EZI A;  1R1V A;  2HU9 A;  1LDJ A;  4I99 C;  4BBS J;  2FUG 2;  3ML6 A;  2BXZ A;  3I71 A;  4BAY A;  2KJB A;  3Q3S A;  1K79 A;  1JGS A;  2Y0S N;  1BW6 A;  2DXI A;  1SFO J;  4XQF A;  2LF7 A;  2CJJ A;  2DJN A;  4RBO A;  3NEU A;  3F21 A;  4AM3 A;  1VQ6 I;  2G7U A;  3HRT A;  2L3D A;  5GP9 A;  3KFW X;  1HDD C;  2BY1 A;  2O5R A;  4E7S A;  3RKW A;  4FAS D;  2L9S A;  4NC8 A;  3A1Y A;  4OAZ A;  4IQJ A;  2QGU A;  3PNT A;  4I01 A;  4CA0 A;  3HDD A;  2OJE D;  1S9H A;  1SC7 A;  3T0Y A;  3S3M A;  3SDG A;  3ERE D;  2XKO A;  4CO8 A;  1FBS A;  1S7A A;  3E1S A;  1CQT A;  3KP4 A;  2E60 A;  2DBB A;  2KRH A;  3ZMS A;  1K4S A;  1ULY A;  9ANT A;  1X1A A;  3S2D J;  5LEK A;  2DOD A;  4CZZ A;  3PO2 J;  1U0J A;  2M8E A;  2NVU B;  1YIO A;  1TLH B;  2R5Z A;  1USS A;  1HSJ A;  1IAW A;  4UB6 C;  3VYT B;  4XKV A;  1FY7 A;  3ZQC A;  1YX5 A;  4A69 C;  2RDP A;  2UXX A;  2QQ9 A;  2VQC A;  2PJR A;  3EDP A;  2E71 A;  2EFW A;  1P92 A;  2IXS A;  4XID A;  3F3X A;  3KYL A;  1TWA J;  4E4H A;  2BVL A;  3OYI A;  2DA4 A;  2QSF X;  5K5O A;  4E7K A;  2V9V A;  1TL8 A;  4ZZL A;  5E17 F;  1FJL A;  5CJ9 A;  1YI2 I;  4OIO F;  1BR2 A;  1LJ9 A;  5B1B H;  5E3O A;  2E1O A;  2M87 A;  3GVA A;  1VTN C;  3DWL E;  4ZYA A;  2Q2E A;  3S3N A;  3AG1 H;  1I39 A;  3ROU A;  3OSG A;  1R00 A;  4CZC A;  3ZMV A;  1BOB A;  3FXJ A;  3KYD B;  4IJA A;  3ZMD A;  2XGE A;  3LA3 A;  2K02 A;  2X1D A;  1U9O A;  1SD5 A;  3ZMT A;  2YUS A;  3WTV C;  5JVG F;  3OYG A;  3CC2 I;  2EFN A;  1P2F A;  3K10 A;  1FMW A;  3GUD A;  4BE0 A;  2VC0 A;  3GTO J;  3PUB A;  1I3A A;  5JVT A;  4FTH A;  2D45 A;  2HPM A;  4MIM A;  3L2R A;  3TOA A;  3KET A;  3COA C;  2FSW A;  2X9D A;  3CZ6 A;  2M3A A;  3KZZ A;  4UNO A;  2JA5 J;  2LKP A;  2DOF A;  3G4S I;  1X3Z B;  4LG0 A;  1F4K A;  4BUP A;  5BPD A;  1Y0N A;  3G3Z A;  1J5Y A;  4II3 A;  3CJT B;  1X4O A;  3WE2 A;  1JUP A;  3HXL A;  3I64 A;  2PMZ A;  2FEZ A;  3BQZ A;  3H35 A;  2JPB A;  1RUO A;  5E3M A;  4HLY A;  5LRR A;  2HQN A;  2OBP A;  3RTR A;  3BG5 A;  4A3L J;  5CVU A;  2H94 A;  2K40 A;  4I2O A;  3HOX J;  1FOW A;  3JRE A;  2F6C A;  4B44 A;  4BY7 J;  2VJJ A;  2ZXJ A;  2NYX A;  4MEX F;  4XK4 A;  2L7M P;  4G6Q A;  4RGR A;  1T2K A;  1SMY F;  3DEU A;  1FPQ A;  4L5I A;  3L9F A;  3FMR A;  1ACI A;  1Z6R A;  4ENK A;  4XKW A;  2WTE A;  4NNJ A;  2WY8 Q;  2NS0 A;  3F9K A;  4A3J J;  3IL2 A;  1FMV A;  3JSO A;  1GT0 C;  1IDY A;  3RYR A;  1HW1 A;  1WWX A;  2FX0 A;  4ESJ A;  2WAD A;  2EWN A;  3MAJ A;  3BG9 A;  2E35 A;  4CH7 A;  2Y9Y A;  4L18 B;  1OKR A;  2JRM A;  3TO9 A;  2STT A;  2XPV A;  4YII A;  3ZN0 A;  1O3S A;  3GCM A;  2GXA A;  1T0F C;  2DFH A;  3HB9 A;  3OYD A;  1A36 A;  1B59 A;  3CUQ B;  5HDG A;  2XUB A;  4ZJZ A;  1MMS A;  3TMO A;  3HOU J;  2AQF A;  2L2O A;  2FE3 A;  1JJ6 C;  4AID A;  2CUJ A;  1X3W B;  2OCE A;  1TC3 C;  2K9S A;  4EGZ A;  3N4M A;  3SZP A;  3OYE A;  1AKH A;  4NQW A;  1MW7 A;  1MBH A;  2R93 J;  5D6F A;  2F5E A;  3ZQL A;  3MKL A;  3PIP F;  4JQF A;  5F0C A;  2JWT A;  1QPI A;  4YEJ A;  1ETV A;  4FX0 A;  1H8A C;  2R7Q A;  2XAJ A;  4XNF A;  1LVK A;  1GVJ A;  3MZY A;  3W6J B;  1UHM A;  1U8B A;  2WB1 N;  3C1D A;  5FO5 A;  4CIC A;  4LB5 A;  1SVO A;  2HOE A;  5LD2 C;  3JSP A;  2F4I A;  2ZJR F;  2FMY A;  4DJA A;  3S1R J;  1X58 A;  2QLZ A;  3GF2 A;  3DKW A;  2QUF A;  4OWR B;  1F43 A;  4IOC F;  2OZU A;  2GA1 A;  3HC7 A;  5LBQ A;  2EFQ A;  3CCE I;  1K7A A;  2QVO A;  3W3C A;  2R7T A;  4I76 A;  3V7R A;  3WTY C;  2K9Q A;  2QYO A;  3A2K A;  3D0S A;  2L4A A;  1N78 A;  4CYC A;  1LQ1 A;  5E8G A;  1OCR H;  5CQE A;  3HTS B;  4HX4 A;  1W36 D;  1WJE A;  1SAN A;  2EA4 A;  2XV4 S;  4EJT A;  2FBK A;  2IS6 A;  2QKL B;  4W1U A;  5LGN A;  2X6X A;  3LFK A;  3TW7 A;  2VBW A;  2JRT A;  1OQY A;  3K70 D;  3RPU A;  3TQN A;  4A0Z A;  4Z6Y A;  4LGW A;  2RKH A;  5FB2 A;  4PJN A;  3PJR A;  1BI2 A;  4D5F A;  1FP2 A;  4OIR F;  4OIP F;  1YW9 A;  1HCR A;  1LFB A;  4DBR A;  3K2Z A;  2M4K A;  2XAU A;  3OL3 A;  1SEU A;  3RZO J;  4AIJ A;  1RUN A;  4BDY A;  1MZB A;  1FLI A;  1JTX A;  4GRI A;  3PSI A;  4ZC3 A;  3LSJ A;  1Z91 A;  1WJF A;  2JA6 J;  2V1N A;  4A2U A;  4I6Z A;  4KA4 A;  3FF5 A;  2KDO A;  2K3F A;  2YR2 A;  4XLH A;  4A5M A;  1XS9 A;  1R22 A;  3WU1 B;  1XB4 A;  3CP8 A;  1LB2 A;  3T1B A;  1T8I A;  4JOM A;  3KZY A;  5A2Q K;  2HZT A;  2XRO A;  5LGT A;  4ZDL A;  3V4G A;  4PJM A;  1XSX A;  1DUX C;  4G12 A;  4IVN A;  1R71 A;  3DCF A;  5DM7 F;  3RSN A;  1KU9 A;  4G6T B;  2B9S A;  3HPH A;  3HOT A;  3OS2 A;  3SZT A;  1ZQ3 P;  1JHF A;  2IT0 A;  3CC7 I;  5L3C A;  3H5R A;  4AUX A;  5J8F A;  3DKX A;  5DS9 A;  4QPQ A;  4XOT A;  4RDU A;  4P55 A;  3SXY A;  3WG9 A;  2DPD A;  4B47 A;  5BPI A;  4LFU A;  1MBE A;  1SFE A;  1JJ8 C;  3ZOB A;  2QWW A;  1L0O C;  3QU3 A;  2UV1 A;  2IA2 A;  5EZH A;  2I10 A;  2CW0 F;  2Y0S A;  3Q9V A;  3SFI A;  3FXO A;  4WXC A;  3NAR A;  2XPU A;  1EKE A;  4LIV A;  1O3T A;  2PI0 A;  2VBZ A;  5F6F A;  1H0M A;  2MG4 A;  3F22 A;  3MZ8 A;  2BY3 A;  3FWE A;  5GTI C;  4RB2 C;  2ESN A;  3OR2 C;  1ETO A;  3ZR8 X;  1UHS A;  1IGN A;  5C3E J;  2LVS A;  1V54 H;  2EH3 A;  5FKM A;  1RR8 C;  4V19 K;  4F93 B;  1DGW Y;  2LP0 A;  3GLX A;  3PFY A;  3WE3 A;  2R5Y B;  3BRO A;  3PFI A;  5GAD J;  1TQM A;  3PUF A;  1A6I A;  1SAU A;  1T98 A;  3PNV A;  1MGT A;  2IPQ X;  1OIS A;  2V1U A;  2DQL A;  4UY8 I;  5HLH A;  3BOQ A;  1VQ9 I;  2WV0 A;  2ZBK A;  2DTZ A;  1NG7 A;  4YFN F;  2K9L A;  4D9J A;  1NH3 A;  3I59 A;  3Q9S A;  2HWV A;  2R7U A;  1RI7 A;  5D5W B;  1KGS A;  5DDG A;  1BI0 A;  3K0L A;  4B48 A;  4ETS A;  1S8N A;  3OYF A;  5J6X A;  1IDZ A;  3HUG B;  2K86 A;  3QU6 A;  3EPZ A;  4H0E A;  3FBN B;  1X2N A;  4HPQ A;  4PZJ A;  2ECC A;  1MMD A;  2CUF A;  1QBJ A;  2A5Y B;  5IOZ A;  2I8D A;  4HBL A;  1I5Z A;  1MMN A;  2HQA A;  1R1U A;  3I4N J;  4IRI A;  1IF1 A;  1P9Q C;  1HA8 A;  4JP0 A;  4HAM A;  3CMA I;  3DV8 A;  3FMS A;  2ZME A;  4PGG A;  4D0P A;  1RKW A;  4D7M A;  3E6C C;  3W2V A;  3K1N A;  2VN2 A;  3S8P A;  5KHD A;  2W57 A;  5LHG A;  2XVC A;  4O3M A;  1HST A;  4C2M J;  1YE9 A;  2E5Z A;  2NOJ B;  2X4H A;  4BH9 A;  2X6W A;  3F8M A;  1BW5 A;  2OU2 A;  2F48 A;  1F9N A;  1IUY A;  4IKF A;  3J7A O;  4PJJ A;  2VJ4 A;  2CGP A;  1W5T A;  4HZF A;  4E7J A;  2RRE A;  5J4Y A;  3J81 K;  3LA2 A;  5CVV A;  1UCR A;  2JPC A;  1ZRD A;  3JAM Z;  5M5X J;  1I6H J;  2A5W A;  3FMQ A;  2HZD A;  2JVH A;  3K6G A;  3IRR A;  3QQA A;  4PJL A;  2ESH A;  2HDD A;  2W48 A;  1I6X A;  5EDN A;  2VUM J;  1LDK B;  3QPL A;  1RR7 A;  3JRH A;  1SAX A;  2V6E A;  5EZG A;  4BU2 A;  2KIF A;  3GFL A;  3SJM A;  5FLM J;  5E3L A;  4Q47 A;  2VOO A;  3QYB A;  1POG A;  2CQX A;  1S6L A;  5K7F A;  3EUH C;  1T6S A;  2PEX A;  4A5N A;  2DQR A;  2EA2 A;  3GWZ A;  4YFK F;  1O3R A;  1ENH A;  4K2E A;  2X1C A;  5FKL A;  1F36 A;  2VQL A;  4DIQ A;  2E5N A;  4F91 B;  1ETQ A;  4LIT A;  5HOO A;  3CO6 C;  2KIQ A;  4KIB A;  1ZG5 A;  3ABL H;  3L2U A;  4FHT A;  5F04 A;  1Y39 A;  1W5S A;  4A3I J;  2QEN A;  5F08 A;  1HKS A;  3LSM A;  3EYI A;  3I3L A;  1TWH J;  3QPT A;  5AIP A;  3M7G A;  3WHB A;  1YS7 A;  1OJL A;  3FM5 A;  2CV0 A;  4HYE A;  3HOY J;  2Z1D A;  2CFO A;  2COB A;  2J5P A;  5H20 A;  1Q1H A;  3B6C A;  4WX9 A;  3CJN A;  1GHC A;  3K4N A;  3D5S C;  1I3Q J;  2KRC A;  2DA7 A;  2Z33 A;  1E3P A;  3TW6 A;  2R7V A;  3CCY A;  2A6E F;  1W36 C;  1IC8 A;  2X6Y A;  1YIJ I;  2DDA A;  3KLO A;  3OY9 A;  3X2Q H;  3K70 C;  2C6Y A;  1UG2 A;  2BBY A;  1LE8 A;  2NVQ J;  2XIG A;  1E17 A;  2WAE A;  5E1X A;  4HLX A;  3TDU C;  1NK2 P;  2EFP A;  2LBF B;  1NHA A;  3LQQ A;  4RGX A;  3FK7 A;  5E1Z B;  2LY2 A;  4RM3 A;  3TKY A;  4BQQ A;  4BHP A;  2KMU A;  4M3B A;  2LY9 A;  3KX2 A;  1Z21 A;  3O2P E;  3M3Y J;  1PUE E;  2M30 A;  3F6O A;  1X4P A;  3K4K A;  2ZSH B;  3OOP A;  3ERM A;  3ZQQ A;  3DLA A;  3BR5 A;  4XON A;  3ZN1 A;  1WI3 A;  2DPU A;  2JJ7 A;  2KJC A;  2W7N A;  3CCU I;  1LPQ A;  4RGS A;  4FIS A;  3DLL F;  1OYW A;  2WB1 A;  1K6Y A;  2HS5 A;  3GZ6 A;  2Z9O A;  1MJA A;  1OR7 A;  1IG7 A;  3VDX A;  1LDD A;  3HKZ N;  2LTP A;  4OU0 A;  2E36 A;  3KEY A;  1A5J A;  4I98 B;  3PM1 A;  3H3V K;  1BC7 C;  5GAH J;  2WA0 A;  2HYF A;  1W7P A;  2R3S A;  4M74 A;  3RIR A;  4KJZ A;  3MVP A;  1Z0X A;  1Y1V J;  3CDH A;  1FX7 A;  3HGG A;  2HYJ A;  4QLC U;  2M8G X;  4KUM A;  5GAE J;  1XMK A;  1Z9C A;  4MTE A;  3ECH A;  4M6Y A;  3F8B A;  3BZK A;  4IPA A;  1VQN I;  5FFZ A;  1G3T A;  3TGN A;  1DU0 A;  1D0Y A;  3V42 A;  5KVR A;  1U2W A;  4V2G A;  1ITY A;  4H4K C;  2A68 F;  5DV5 A;  2Q0O A;  3HG9 A;  2ACJ A;  1FTZ A;  1BI3 A;  2FQ3 A;  2VXD A;  3WTT C;  1D1C A;  3RYP A;  5HLG A;  4Y15 A;  3SQN A;  4IEJ A;  2A61 A;  1FIA A;  2PFB A;  5L3E A;  3A03 A;  5B66 C;  2XRL A;  1U78 A;  2BY2 A;  1BJZ A;  3FXM A;  2QQB A;  5BNG A;  4XLC A;  2A3S A;  3VEP A;  4RS8 A;  2KRF A;  4BEH B;  2PMH A;  1TQP A;  3LMM A;  1AA7 A;  2OC6 A;  2VI6 A;  3KE2 A;  3OYA A;  4B43 A;  3KP7 A;  1ZYR F;  3BG7 A;  1X1D A;  1OCC H;  1TTY A;  2XC7 A;  4LLG F;  3NAU A;  1QA6 A;  4A12 A;  2DAO A;  1TW2 A;  3DBL B;  2D1V A;  5IP9 J;  4DYC A;  2XB0 X;  1WJD A;  1FT9 A;  2XSJ C;  2JN6 A;  3W6V A;  3CQZ J;  4Q48 A;  3V8J A;  3BJA A;  4M71 A;  2IGN A;  5KAF C;  3MCZ A;  4EM2 A;  1XC5 A;  3UKG A;  3E6B A;  1R5G A;  3GXO A;  4PJ0 C;  1PYV A;  2ID6 A;  2VQH A;  2MH2 A;  4KMF A;  3HSE A;  4DBQ A;  3NQO A;  3LSI A;  1ODD A;  3KCC A;  5EG0 B;  4E7L A;  3GTG J;  1Y8Q B;  2KFD A;  3GX4 X;  4YFX F;  3CCL I;  1ZR4 A;  1ETW A;  4J01 A;  3J7Z I;  5BQT A;  2IP2 A;  3CME I;  2F4M B;  4C3J J;  1D1B A;  3M8E A;  4GO1 A;  3K4L A;  4M73 A;  3HBL A;  3H5N A;  3LSR A;  4M6V A;  3FXL A;  3AFH A;  3J81 Z;  2H1K A;  2FML A;  1R4M B;  1U5T A;  2X6O A;  2XSD C;  5E3N A;  1E0E A;  3C2B A;  3ZQ7 A;  1UMQ A;  1QU3 A;  2BHY A;  2E2H J;  2IS1 A;  5BS6 A;  3FK6 A;  1MDM A;  2HVQ A;  5HVQ C;  2E7X A;  1MBF A;  1AKH B;  1Z3Y A;  1MH4 A;  1SVL A;  3CCJ I;  5J1U A;  3EUK L;  2BY0 A;  4EJW A;  1IRX A;  1VQ5 I;  3WTZ A;  2K4B A;  2PJP A;  3BR2 A;  5ILS A;  2RV8 A;  2H6B A;  4OOI A;  5B3S H;  4Y13 A;  2LLK A;  2V6C A;  2CFX A;  4G6D A;  1S7O A;  2QM3 A;  3KZI C;  3F8N A;  1WQ2 A;  2P6S A;  1T39 A;  4MFD A;  1FSE A;  5L3G A;  1REP C;  2GIV A;  4BL0 B;  3ZQH A;  2VON A;  3WU2 C;  4AVZ A;  1WSU A;  4FET A;  3BC8 A;  3K7A J;  4HF0 A;  5HNH A;  2HFH A;  2V1D A;  2DFF A;  5D5X B;  2DOA A;  3ABT A;  2KZV A;  1IUF A;  4MQV A;  2CV1 A;  2DA2 A;  2QBY B;  3O6B B;  1J75 A;  5FLV A;  2VT3 A;  4GDF A;  3BDD A;  2GXB A;  2X0L A;  2CSO A;  1N25 A;  3BR0 A;  1M1E B;  1T38 A;  3ZMU A;  4BBR J;  1K61 A;  2HVS A;  3CCR I;  2MH9 A;  3WTS C;  3R0J A;  4Y17 A;  2XKP A;  5ICC A;  3MKZ A;  3ULQ B;  3CCS I;  2CMP A;  3AKZ A;  3M1E A;  4WWC A;  3FIS A;  4M72 A;  3LL7 A;  1UST A;  4UV8 A;  4MGR A;  2BZT A;  3WHC A;  2PLY A;  3CD6 I;  2E34 A;  1QRY A;  1EA3 A;  2VC1 A;  4J00 A;  3S2H J;  3VOD A;  2AO9 A;  3AL0 B;  3PO3 J;  3C18 A;  1XPX A;  4A3E J;  3HYI A;  3CMM A;  4WK8 F;  4CHU A;  1W0T A;  2QEX I;  4HEA 2;  1E3H A;  1OCZ H;  3TL4 X;  5JLX A;  1BOA A;  1OMI A;  3A02 A;  5D8L B;  5AIQ A;  1R9T J;  1BL0 A;  3JTH A;  1QZE A;  2BOL A;  5EF6 A;  3TBI A;  3P7N A;  2DT5 A;  3B73 A;  1I27 A;  3HTU A;  5JHU A;  4IHT A;  4P1W A;  3JRD A;  1Z3X A;  3RI4 A;  1FP1 D;  1WFX A;  4WCG A;  4LLL A;  2IGM A;  3HHH A;  1HLV A;  2ZJ2 A;  5M3F J;  5FLX K;  4R1H A;  2R92 J;  1TT5 B;  5M5W J;  2MC4 A;  4EJO A;  1DGR M;  5ED4 A;  1R4N B;  1XGM A;  1J9I A;  3DTK A;  3AG2 H;  5HS9 A;  4M9X A;  2F4O B;  3DKY A;  2O61 A;  2DJI A;  3CP2 A;  1G3S A;  5DCM A;  3WTX C;  1FNN A;  3ZMZ A;  5H2F C;  3H36 A;  2ID3 A;  5D5U B;  1K6O A;  2HKX A;  4HNT A;  3C3W A;  3AG3 H;  2VPR A;  4U0V A;  2ETH A;  2V9K A;  3IP4 B;  3A01 A;  3OOU A;  4F7Z A;  1PUF B;  2VLA A;  2R0Q C;  1Z77 A;  3HEF A;  3I54 A;  4EQQ A;  3TP0 A;  3K4C A;  3CJQ B;  2GQQ A;  5IP7 J;  3VOE A;  5EGO B;  1VFC A;  4M3E A;  1G8X A;  1HDP A;  1RET A;  2JK3 A;  4XLP F;  1W0U A;  2IAI A;  4XSZ F;  3LFU A;  1ZR2 A;  1FYK A;  1CF7 A;  1ON2 A;  1I1S A;  2EFO A;  1YO5 C;  2V9P A;  1ERD A;  1PP7 U;  3OR1 C;  3BG6 A;  4HQM A;  5CVI A;  3I59 B;  4FE4 A;  4RB3 C;  2EZL A;  2JA2 A;  1TNT A;  4X0G A;  2TDX A;  4L9N A;  4C2U A;  2N8G A;  3RQI A;  4UUS A;  3IUO A;  1ON1 A;  3KP5 A;  3LOC A;  5FD6 A;  3HKZ A;  4HNV A;  3MN2 A;  1LVA A;  4AIK A;  2KLO A;  4HDU A;  1ZRE A;  5TRD A;  1G59 A;  3FKI J;  2CV2 A;  3B6A A;  2XGX A;  3LSH A;  2Y0M A;  4DZJ A;  4XLA A;  3LSG A;  3H9Q A;  2KHM A;  3VPR A;  2DDB A;  1BBY A;  3CCQ I;  2AS5 F;  2K4J A;  3WTW C;  5BMZ A;  2JSC A;  2XPW A;  4L9V A;  1PP8 F;  2XHK A;  2EB7 A;  4Y33 A;  4AD9 A;  5L3D A;  2GXG A;  1BI1 A;  3BQY A;  3K4M A;  4HDV A;  1FIP A;  3FHZ A;  2HI3 A;  2BW3 A;  1HOM A;  1XTA A;  2WAQ N;  1P7J A;  3FM3 A;  1HW2 A;  4HOB A;  2K27 A;  3J7Y J;  4J19 A;  3IKT A;  1B8I B;  1RKT A;  2UXN A;  4AU7 A;  3KP3 A;  3KEQ A;  1JT0 A;  3OYC A;  2NVY J;  2KL4 A;  3CLO A;  1YS6 A;  1QPM A;  4BXX J;  4HX7 A;  2WV1 A;  3OS0 A;  4U0W A;  4C2T A;  2LFB A;  2M2E A;  1ZGW A;  5F27 A;  4N9H A;  3DXJ F;  2FNA A;  1IN7 A;  2Q1Z B;  2RVC A;  3DP7 A;  3PQJ A;  2DU9 A;  4QPO A;  3S32 A;  1RZ4 A;  5FGM A;  3L2Q A;  2VJI A;  3FBI B;  2MD0 A;  2FOK A;  4D5C A;  4BYY A;  5J1R A;  3CTA A;  4U0Y A;  2PX9 A;  3OYJ A;  3L2C A;  2XB5 A;  1VQK I;  2QQ8 A;  3V8L A;  3G6E I;  3RJP A;  2O8K A;  1ZGJ A;  5E1W A;  5ERI A;  2FNP A;  4CGZ A;  4AYB A;  4RAZ A;  3PIO F;  3KEO A;  4A93 J;  4GFB A;  3U1D A;  1FZP B;  5B1A H;  1IXS B;  4PDK A;  4XR6 A;  5TJJ A;  3CCV I;  1SFU A;  2M45 A;  1GXQ A;  1JKO C;  1QNT A;  3I53 A;  3U1K A;  1YJN I;  4IHY A;  2V7F A;  4FCY A;  1BC8 C;  4C9Y A;  4S0H B;  4PCQ A;  3HPG A;  1UFM A;  5KAI C;  2L9R A;  4MFE A;  5IY5 H;  4RLQ A;  1ZG1 A;  1UEL B;  4ZYD A;  2CQK A;  1Z7U A;  3KP2 A;  2B63 J;  2MYS A;  4BXF A;  5CPR B;  4S04 A;  4ABZ A;  2DMN A;  2IW5 A;  2ZXI A;  4M6X A;  4U88 A;  2IA0 A;  4LD5 A;  2OQG A;  4MQ9 F;  2A05 A;  4P9F A;  2OAZ A;  1VF9 A;  3VSL A;  3NWS A;  1Y56 A;  3U21 A;  2B7E A;  4Y3O A;  3BR3 A;  3QOE A;  4GGG A;  5JR3 A;  2VE9 A;  2IS2 A;  1Y0U A;  3LNQ A;  2L02 A;  3ECO A;  2DI3 A;  3MFK A;  5EYR A;  5E8I A;  2PN6 A;  1UB9 A;  2QQA A;  1R58 A;  5JLW A;  1D0Z A;  2GOM A;  4XRS A;  1TWG J;  3GTQ J;  3HZJ A;  4ESF A;  4JX4 A;  2DMQ A;  5J1Y A;  1B72 B;  2P7V B;  4L0Y B;  1PVE A;  3K4B A;  4CCN A;  2WAF A;  1X3U A;  2FU4 A;  1JUS A;  5M5Y J;  1D1A A;  2A69 F;  5CYV A;  3FDY A;  4ENN A;  2ZNY A;  1P4X A;  1VQM I;  3IAM 2;  1LUJ B;  4I7H A;  4YIF A;  1R7J A;  2O6G E;  4E70 A;  4MTD A;  1O3Q A;  3BJ6 A;  4D1Q A;  3OYM A;  3MZH A;  1HBX G;  1GXP A;  2JSP A;  3WU0 A;  3OIO A;  4N4N B;  5GPC A;  1YHQ I;  3JCU C;  2Z99 A;  2EK5 A;  4ASN A;  2EJR A;  1TNS A;  1RIO H;  3MMY B;  4BKX A;  3IH2 A;  2AXL A;  3ESW B;  1XDS A;  3CC4 I;  1IXC A;  2YPR A;  2Y69 H;  1IJW C;  3R6S A;  2NNN A;  2HGC A;  2LC2 A;  2QCO A;  1XCV A;  1XSV A;  3E5U A;  2CW8 A;  4E6K G;  4XLF A;  2K7L A;  5FLX Z;  1WGX A;  4ON0 A;  1FOX A;  2P7C B;  2HQ5 A;  4I0B A;  1S29 A;  3ABU A;  1R49 A;  4HG2 A;  1Y1W J;  3VYS B;  1J59 A;  1QZZ A;  3H1C A;  1K78 B;  3D1N I;  2VPL A;  1B4A A;  2ZO4 A;  5M3M J;  4HF2 A;  2DN0 A;  3I5U A;  2LK2 A;  5C44 J;  1G3W A;  3BT9 A;  3CUQ A;  3RKX A;  1K4T A;  5LRS A;  5ILV A;  4BNC A;  4OIN F;  3BWG A;  2M1B A;  2P5K A;  2GBY A;  2ZJP F;  4ANJ A;  1O4X A;  2L9N A;  5ICE A;  3MKY B;  2R7Z J;  4HV5 A;  2HKO A;  2ISY A;  4BGD A;  2KIM A;  1MH3 A;  1YRN A;  2ISZ A;  3H92 A;  3G2B A;  2W85 A;  1TBX A;  1FTT A;  2XGD A;  3GZ5 A;  2YX7 A;  3OYH A;  1BIA A;  3R4K A;  4ZTJ A;  5B5E C;  3AL0 C;  2TCT A;  2O03 A;  4RM2 A;  4BE2 A;  4ZDO A;  2MLK A;  3WOD F;  2AHQ A;  3E0J B;  5D6E A;  4ZYH A;  4UXN A;  3BCA A;  3A4C A;  1IRF A;  4PFP A;  1AWC A;  2NVX J;  2M4G A;  4CDG A;  1OLT A;  2FXA A;  3OSF A;  1SD7 A;  5IT9 K;  3K1P A;  3C2H A;  2EZK A;  3I56 I;  1X1B A;  1N75 A;  2KPM A;  4X6A J;  1YYV A;  1ZLJ A;  3RDI A;  2R7D A;  3KPH A;  2ZSI B;  3GME A;  5ICG A;  2RAE A;  3FXR A;  3ZCO A;  1KYW A;  4BDZ A;  2IEK A;  4LK1 F;  4B3X A;  2R7F A;  2HXO A;  4L5E A;  2L7K A;  1HXD A;  3BTC A;  1EF4 A;  4A3M J;  2RC4 A;  2NRA C;  1MNM C;  1D3Y A;  1W7P D;  1G6N A;  4UVC A;  1T56 A;  1Z05 A;  2V1X A;  4ENM A;  2DO7 A;  3H0G J;  2W4S A;  3OYK A;  4UV9 A;  3GEZ A;  2MGQ A;  3RQ4 A;  2ZFU A;  2D5V A;  3JR9 A;  2MW8 A;  1ZGA A;  2L54 A;  2VKE A;  2JUC A;  2RQP A;  2M7B A;  4BAC A;  1PDN C;  2Y9Z A;  4JBA A;  1XG1 A;  2CH0 A;  1U5T B;  4IHV A;  1IRZ A;  2KDZ A;  3D5R C;  1KON A;  2JUG A;  5CLS A;  2CUZ A;  2BVM A;  2L7F P;  3DEW A;  3FXQ A;  4Y7N J;  3S2W A;  4M3F A;  1H9G A;  2F5C A;  5F0H A;  2FQ4 A;  3QRF F;  2P5L C;  2TRT A;  3L7W A;  4A3G J;  1R5H A;  3WGI A;  2VT2 A;  3SEZ A;  4BHC A;  1RNL A;  3E97 A;  2IVM A;  2ELH A;  1IW7 F;  2M34 A;  2Z3Y A;  4EVI A;  2OQR A;  3ELK A;  1FSH A;  4BHB A;  5DTD A;  3GTM J;  5TIS C;  1CGP A;  5HDN A;  4RLF A;  1ZH5 A;  1AU7 A;  2X48 A;  4M3G A;  3AAF A;  1VQP I;  1KA8 A;  4PUS A;  5DCF A;  3RKQ A;  2FOW A;  1D5V A;  2HOS A;  2M9H A;  2JA7 J;  2R4G A;  2IGK A;  3FIW A;  1BJA A;  4X1E A;  1XSD A;  3EYY A;  1IN4 A;  1QVT A;  2RNJ A;  5J47 A;  2R5Z B;  3KP6 A;  3ZQF A;  1IN6 A;  3HSR A;  2YX4 A;  2ICW G;  4XSX F;  2XF6 A;  4TV7 A;  4EEF G;  3L00 A;  3O8G A;  2ZME C;  4YG2 F;  5A2Q Z;  2CQN A;  2PJR B;  4Q5S F;  1FEX A;  2IGO A;  3EUA A;  1OYY A;  2KP6 A;  2LKX A;  1H89 C;  3K69 A;  3ZP5 A;  2RQQ A;  2VQG A;  2L7Z A;  1IZ1 A;  3LSK A;  2Z16 A;  1YX3 A;  4B4C A;  4WF2 A;  1RES A;  3QPH A;  2KKO A;  1A35 A;  1C0W A;  2X51 A;  1XGN A;  5E79 C;  5FKK A;  1D0X A;  4G7O F;  1UHW A;  4BJ5 C;  1P6R A;  2Q2E B;  3VWB A;  4RB0 A;  4LMY A;  4GCV A;  1WKM A;  4RMN A;  2ZCW A;  3HGY A;  2F5V A;  2P8T A;  3QOP A;  5K1Y A;  3Q0U A;  5JHF A;  1Y8R B;  2VBX A;  4KNY A;  3R61 A;  1ZAR A;  2FD5 A;  1UZC A;  2ZB9 A;  3GFJ A;  3HUG A;  1GV2 A;  3JTG A;  3TP3 A;  3T8T A;  1STZ A;  3E6D A;  1QO0 D;  5FKO A;  2NNY A;  4UUV A;  3S1Q J;  3NWT A;  5GAG J;  1PJR A;  1TWF J;  5HOD A;  4XRM A;  1G2H A;  2XAG A;  2DYR H;  2WBM A;  1AOY A;  2YU3 A;  4F92 B;  1Y6I A;  1QGP A;  3SDB A;  2EIN H;  3ISP A;  1LEB A;  4IHX A;  2DT6 A;  4WXD A;  1U6G A;  4BJT A;  2COM A;  4LG0 B;  3GTL J;  4BQO A;  3U2R A;  5HNF A;  3ZPL A;  4LLN A;  4IHS A;  2OD5 A;  1YJ9 I;  2DCE A;  1SD4 A;  5LHI A;  4MEY F;  3GFI A;  1P7I A;  4ZDP A;  4NC7 A;  1WI9 A;  2Y48 A;  4NBQ A;  4OMZ A;  2DMU A;  3N05 A;  1Q1V A;  2NXN B;  5E20 A;  3TDZ C;  1WCM J;  1FBQ A;  4KIT B;  4ESB A;  4ZYG A;  1WJA A;  1JI8 A;  2EIK H;  2Y30 A;  1SFX A;  4ZZD A;  3HIF A;  2NVT J;  2DFE A;  4BJ6 C;  1A04 A;  2W25 A;  2OPT A;  4F55 A;  3HRS A;  5J40 A;  3BTL A;  1E3O C;  3N97 A;  2CU7 A;  4QIW N;  4KN7 X;  3VSK A;  4RAY A;  4KIS A;  4FQG A;  2RN7 A;  5DYM A;  4IO9 F;  1S7E A;  2QF7 A;  1CF7 B;  1MIJ A;  3RKY A;  4DYQ A;  1AHD P;  2M7A A;  2OTL I;  4PGH A;  1YJW I;  4F3Q A;  1J7K A;  4G9Y A;  3RZD J;  3F0C A;  4XIC A;  2Z5U A;  2E1C A;  4OAY A;  3WGG A;  1OCT C;  3K1M A;  4LJZ F;  4CXF A;  4D7N A;  3UNG C;  4A0X A;  1HW5 A;  3S17 J;  3E5X A;  2L4M A;  5IPA A;  3E3V A;  4GYG A;  4DNC A;  2E1N A;  3LST A;  4CUG A;  2E19 A;  5H6R A;  4LB6 B;  1VZ0 A;  3IV5 A;  2XAF A;  4NQW B;  2AXT C;  3JRC A;  1FYL A;  4EV0 A;  4KMU X;  3U9G A;  4N4O B;  4Q4Z F;  3Q0V A;  1ZRC A;  6PAX A;  4F52 A;  4DQ2 A;  5FRM A;  5IT9 Z;  3CCM I;  4LK0 F;  1G3Y A;  2CWE A;  5DUI A;  1ZKG A;  3RPQ A;  1MND A;  3W2A A;  4XN0 A;  3TO7 A;  2GAU A;  3L09 A;  3IRQ A;  3F72 A;  2XRN A;  1IRG A;  3PQK A;  1BN5 A;  2BW3 B;  2G0E A;  3JRI A;  4A3K J;  2R7O A;  2FJ1 A;  1QZY A;  1JT6 A;  2UUZ A;  4O6J A;  1EV7 A;  3MEX A;  2GIZ A;  3FXU A;  4CCO A;  2LBF A;  2MLG A;  1X2M A;  5FJ8 J;  3H3Z A;  4XN3 A;  3W2W A;  4QWQ A;  4PSX A;  2OA4 A;  3M1C A;  3A0H C;  4M9Z A;  2EBI A;  2F5F A;  1YW7 A;  2K5C A;  5HDK A;  2HXI A;  3VYR B;  2LMD A;  3WTU C;  2WWY A;  3LQR A;  1T0F A;  3P9K A;  2M5W A;  4CYC B;  4XLE A;  4KFC A;  3IAS 2;  2BYV E;  3LA7 A;  1LFU P;  1ETK A;  2FF4 A;  4A3D J;  3M4O J;  4AVP A;  1A31 A;  2EIM H;  4ITV A;  1J2X A;  2JQ7 A;  4BS9 A;  1OFC X;  2JA8 J;  3HOZ J;  2XF5 A;  1OPC A;  1VND A;  3K9T A;  5FD5 A;  2K3P A;  4A3C J;  4IZZ A;  5ICF A;  2DFI A;  3L1P A;  2ELJ A;  2RNG A;  5FKN A;  2HDC A;  3FKJ A;  2GA2 A;  2HTJ A;  2VAS A;  2GZW A;  1R36 A;  1LKX A;  4M9S A;  2NAZ A;  1ETX A;  2K9N A;  3BG3 A;  3BR1 A;  2K85 A;  4FT8 A;  4XM3 A;  3I4M J;  4C3H J;  1WH7 A;  2W00 A;  3ZQG A;  4B8X A;  4MNU A;  1YTY A;  1UG0 A;  2O8X A;  2Y2Z A;  3R60 A;  1X1C A;  2HDW A;  4U7D A;  3TO6 A;  3BCB A;  4IX7 A;  3HRM A;  4GYI A;  2X85 A;  1XGO A;  1MNE A;  1ZHF A;  2BV6 A;  1Z1D A;  1S72 I;  2VBY A;  1KQ8 A;  2DW4 A;  3VYU B;  4AWX B;  2E2I J;  3CUO A;  4IL6 C;  3E7L A;  4P96 A;  3W6K B;  1WPK A;  3BTJ A;  3P5J A;  4GXO A;  1O7L A;  2XDV A;  3SZG A;  4DYR A;  3QYF A;  4M3D A;  3H3U A;  4O5V A;  1XMA A;  1VQ8 I;  2IJL A;  2QSG X;  3FX3 A;  2L0K A;  2CUE A;  4U7B A;  4G8X A;  1B9M A;  3M8J A;  4JX5 A;  4XRS G;  4CCM A;  4IOA F;  1JUM A;  1X1P A;  4IHW A;  1YW8 A;  2IA1 A;  3ASO H;  3IWZ A;  1B9N A;  4BEH A;  2R7W A;  1U5T C;  2QA4 I;  3M8F A;  3V7C A;  2I5U A;  2DK8 A;  2HPI A;  5F0F A;  4UHT A;  4LIU A;  4XL9 A;  3SEQ A;  2X1E A;  4S05 A;  2UZK A;  3S1M J;  2H1L A;  2DLL A;  5DEQ A;  2MFZ A;  3K4J A;  2MBF A;  4CSW A;  2NS7 A;  1QQI A;  2JVG A;  2EQR A;  3HM5 A;  2R7X A;  4P9U A;  2GLO A;  2KZG A;  3RPU D;  1YG2 A;  1YFH A;  1TT0 A;  2VKD A;  4PFO A;  3BY6 A;  2P5V A;  2WC2 A;  4CYD A;  4IXA A;  3SFZ A;  4A3B J;  1GUU A;  5EG0 A;  1V5G A;  1WVR A;  5HLT A;  3GZN B;  2G7H A;  2O9L A;  3FXK A;  3IHU A;  2Q8K A;  1OYI A;  1OCP A;  4KYW A;  1HC8 A;  2IBD A;  3DTI A;  3JAM K;  5EEG A;  3PL8 A;  3M9A A;  1TW3 A;  2F5D A;  1HF0 A;  3GLL A;  2QZ8 A;  2M0C A;  1BR1 A;  2ZME B;  4U87 A;  4L9J A;  4FX4 A;  2MSY A;  1R1T A;  3G1L A;  4QTR A;  3GTJ J;  4A6E A;  3S3O A;  2V4J C;  1VQ7 I;  5IYB J;  2DT7 B;  4BY1 J;  2A6H F;  1TZL A;  3IC7 A;  3LAP A;  1UAA A;  4UB8 C;  2R7S A;  2CRG A;  1JE8 A;  2O7O A;  2P6T A;  4Y52 J;  1D8J A;  1JKQ C;  4AIH A;  2HOA A;  3IKV A;  4C3I J;  3VFZ A;  1YRN B;  1F1Z A;  1ZLK A;  1ZTR A;  4IRH A;  5D5V B;  3S15 J;  3WG7 H;  1GV5 A;  3QPS A;  3EQL F;  2BXY A;  4HST A;  2IS4 A;  1YLF A;  2VE8 A;  3JW4 A;  2LRE A;  3JRA A;  4CCK A;  2CYY A;  1XN7 A;  1UJ8 A;  2Y75 A;  4YIR X;  3KIO A;  1ZEL A;  1W4M A;  2PMU A;  3AG4 H;  2YSR A;  1VI0 A;  1VQO I;  1I1G A;  2NS8 A;  1ZAO A;  4DZP A;  5CQG A;  2R7R A;  3MD2 A;  3OS1 A;  1K83 J;  3L2V A;  3OYL A;  3G73 A;  3LAJ A;  1MSE C;  5HS7 A;  3V8K A;  2E1M C;  1WRJ A;  3OYN A;  1XCB A;  1GLN A;  1D5Y A;  4KIC A;  2BEO A;  2QBY A;  4HX8 A;  2L9V A;  1U9N A;  1V55 H;  4BQN A;  5L3B A;  1ZG3 A;  1KU2 A;  5ILU A;  2PQ8 A;  2HQR A;  2CO5 A;  2W84 A;  2H09 A;  2DMP A;  4WXH A;  1U3E M;  1ZN2 A;  4FE7 A;  2DK5 A;  2DA1 A;  2V26 A;  3DPT A;  4HNU A;  5F1R A;  1EH7 A;  5F1J A;  2DA5 A;  1O7F A;  1R5I D;  2WY7 Q;  1QHG A;  1XMX A;  2D2W A;  5D4R A;  4I0A A;  1SFK A;  3BZC A;  3G71 I;  4B1R A;  4XKC A;  1J0R A;  5HS8 A;  3TED A;  3UR3 C;  1ORK A;  3S14 J;  1LNW A;  3BTI A;  2VJ5 A;  5CKT A;  4XMY A;  5LHH A;  1DPU A;  1XD7 A;  3ZXS A;  1DU6 A;  2HTS A;  3T5X A;  3OYB A;  4BQA A;  2CQQ A;  1U8R A;  5K5Q A;  1WJB A;  1LE8 B;  3HJE A;  1LEA A;  2JT1 A;  4AC0 A;  3CDI A;  2M0M A;  3I58 A;  2W24 A;  5KCM A;  1S3J A;  2ELK A;  3EUH A;  1B1B A;  3J80 K;  1W1W E;  5EJC A;  4N9I A;  3GTP J;  3BPV A;  4A6D A;  3QP5 A;  3KLN A;  1KU3 A;  1MBJ A;  5GTH C;  3QWL A;  2STW A;  3KYC B;  1H9T A;  4EGY A;  1SMT A;  2O0Y A;  2MA3 A;  3P9C A;  2Y31 A;  1X19 A;  3F8C A;  2MC3 A;  4HA8 A;  3T8R A;  3DQV C;  3I9V 2;  2ZKZ A;  3QOD A;  2JZY A;  2B0L A;  2PG4 A;  4KT5 C;  2EV5 A;  2GOX B;  3CDL A;  4JX6 A;  5FRO A;  2QSH X;  4OIQ F;  4MHG A;  3MWM A;  4BE1 A;  1HKT A;  2LSO A;  4XRF A;  4XOR A;  4BXU A;  3IH4 A;  2BHZ A;  2DTR A;  2FRH A;  3CF2 A;  3DFG A;  2HNH A;  1ONV A;  1SVM A;  5LEJ A;  4A3F J;  5BOX A;  1MD0 A;  1RC9 A;  2OTJ I;  1FWZ A;  3OMY A;  1WHU A;  4NDL A;  4ZYE A;  4R79 A;  2UWM A;  1BR4 A;  3I4P A;  1KYZ A;  1JXS A;  1PUF A;  1W7P B;  3K2A A;  1OCO H;  5HLI A;  5JFR A;  2DYS H;  2NOG A;  2A07 F;  4OMY A;  4NB5 A;  3J7A Y;  4KT6 A;  3ZQI A;  1P4W A;  5EGO A;  1DQU A;  3BR6 A;  3BLY A;  1XDU A;  2IRF G;  1FC3 A;  3DBH B;  5KK1 A;  3FZV A;  1B6A A;  2KQR A;  4PSW A;  1XGS A;  3C7J A;  2HR3 A;  3IWF A;  1IN8 A;  2YS9 A;  1R6R A;  2MAB A;  4EM1 A;  3OL4 A;  4YRV A;  1MSF C;  5J4V A;  4KIG A;  1TP4 A;  1NG6 A;  1ZK8 A;  5L3F A;  2ZJQ F;  5FFX A;  2DA3 A;  4KN4 X;  4B3A A;  1BM9 A;  4HF1 A;  1R23 A;  4PK4 A;  3E5Q A;  3G1O A;  3MQ0 A;  3DU6 A;  4LOC A;  4I09 A;  3BP8 A;  2XGC A;  3GYH X;  4EMS A;  5IOY A;  3OIQ A;  3F6V A;  1IV8 A;  5K5R A;  4KDP A;  2HYG D;  1ZRF A;  2LH9 A;  3P9I A;  1V5E A;  2KIU A;  4EAT A;  5TGT A;  2L5Q A;  2CG4 A;  3IH3 A;  5EEA A;  2HOT A;  2OF7 A;  1TWC J;  4E7Z A;  3ABM H;  5DUK A;  4LG3 A;  4E7I A;  2XAS A;  4RAG A;  1KQ0 A;  2G9W A;  3GFM A;  3H5A A;  2HEO A;  3ZGK A;  5EEH A;  4E7H A;  3CLQ A;  1QVU A;  2AQE A;  1MMG A;  3CJR B;  4JK1 X;  3PSF A;  4RA2 A;  1DPR A;  4KIF A;  1V5F A;  3GW2 A;  5F64 A;  3I55 I;  1B8I A;  2VB6 A;  2ME6 A;  1JHH A;  2RGV A;  4RB1 A;  2ZNZ A;  2GM4 A;  3BJO A;  1MBK A;  1T33 A;  3DTE A;  4G7H F;  1JGG A;  1J09 A;  2P4W A;  5FRN A;  2V79 A;  3EET A;  2E7W A;  1Z6T A;  2DMT A;  1F5T A;  4HSR A;  1YOV B;  3HOS A;  3CO7 C;  5GPA A;  2H27 A;  2OZ6 A;  2ZC2 A;  1Z7L A;  5KNL A;  2VKH A;  3I0T A;  2LOO A;  3OIP A;  3QYE A;  2W82 A;  1BA5 A;  2ME0 A;  2H6C A;  2P81 A;  1ETY A;  3GBG A;  1RPW A;  4EM0 B;  1RRJ A;  5J3L A;  2ZXW H;  4XLN F;  3ZRG A;  3CES A;  3PNY A;  4XBF A;  1S5L C;  1HQC A;  1BIB A;  4MO7 A;  2O3F A;  2XAH A;  4Z2Y A;  4N0B A;  2VIX A;  2P0W A;  1MDM B;  2XF7 A;  5H6Q A;  1FOY A;  3VB2 A;  1GDT A;  2JTV A;  1NTC A;  3HRU A;  4UUT A;  4G7Z F;  3C2G A;  4A0Y A;  1GVD A;  1JKR C;  2PMZ N;  4EJU A;  2LG4 A;  2ECB A;  4XKB A;  2A6T A;  5JI6 A;  2LDU A;  1Z67 A;  2F2E A;  1SD6 A;  2ZFW A;  1DP3 A;  1P4A A;  3FHN A;  4CCJ A;  4I02 A;  2EIL H;  1WJC A;  4RGU A;  1V3F A;  4RAF A;  1KQ9 A;  4ZH4 F;  2OCC H;  1MJ9 A;  2LKS A;  2JMW A;  5E18 F;  1HKQ A;  1YIT I;  1VQ4 I;  1V4R A;  2EV0 A;  4UVB A;  2OUM A;  3HL2 A;  1WH5 A;  4R8H A;  4CCL A;  3S16 J;  2WAQ A;  4NHJ A;  1W5C C;  5C4J J;  4IQ4 A;  1B72 A;  1MKM A;  3DF8 A;  2FA5 A;  3H0D A;  3E6M A;  3CUQ C;  2CW7 A;  4DOZ A;  1NK3 P;  1IXR C;  2H8R A;  3HOV J;  4C30 A;  3REO A;  4L5J A;  5DD4 A;  3ABK H;  2R5Y A;  1IN5 A;  2MD5 A;  3GO5 A;  3H9J A;  2EV6 A;  1G4D A;  3QAH A;  5IYC J;  5IYD J;  2VL8 A;  3F23 A;  3JRB A;  3BPX A;  1JKP C;  1DP7 P;  2E2J J;  5LFA A;  3CF5 F;  2QKM B;  4IF4 A;  2LY1 A;  3SYT A;  4L9T A;  3NRV A;  2EIJ H;  2HVR A;  2W1O A;  4ZTF A;  3J80 Z;  5D8K B;  1MBG A;  3TOB A;  4DW6 A;  3OV8 A;  5K7Z A;  1WJ5 A;  4P5O A;  1LFP A;  2DOE A;  3S93 A;  2LRD A;  1A6Q A;  1KZH A;  4L0Z B;  3Q5F A;  5IT3 A;  2L01 A; 
#chains in the Genus database with same CATH homology
 1YQA A;  1O57 A;  5J8C A;  2LNB A;  1EH8 A;  5LGU A;  1DDN A;  5D4S A;  1L3L A;  1K78 A;  4HQE A;  1FBU A;  2D1H A;  2FBH A;  2BE5 F;  3SHF A;  1KU7 A;  2VOD A;  1E2X A;  2LF8 A;  2VXZ A;  5CVJ A;  3V7S A;  2BGC A;  3BZ6 A;  1TQI A;  5DCM B;  4UVA A;  2XAQ A;  4B09 A;  1FYM A;  5LLQ A;  4EJV A;  2ADU A;  3HSF A;  5CVR A;  2VOP A;  3B02 A;  3R0A A;  1FOK A;  4G94 A;  4HV6 A;  2PBI A;  3QP6 A;  1MJB A;  3DPL C;  5AON A;  2FBI A;  3D5L A;  3F8F A;  3WGH A;  4IRG A;  2J5O A;  3HHG A;  2GWR A;  3O3K A;  4HW0 A;  4ENJ A;  3LWF A;  1D8K A;  5DD8 A;  1EH6 A;  1R1V A;  1LDJ A;  3ML6 A;  3I71 A;  4BAY A;  2KJB A;  1K79 A;  1JGS A;  2LF7 A;  3NEU A;  3F21 A;  2G7U A;  3HRT A;  2L3D A;  3KFW X;  3RKW A;  4I01 A;  3T0Y A;  3ERE D;  2XKO A;  4CO8 A;  1FBS A;  1S7A A;  3KP4 A;  2DBB A;  3ZMS A;  1ULY A;  5LEK A;  4CZZ A;  2M8E A;  1YIO A;  1TLH B;  1USS A;  1HSJ A;  1IAW A;  1FY7 A;  2RDP A;  2UXX A;  2QQ9 A;  3EDP A;  2EFW A;  1P92 A;  3F3X A;  5K5O A;  2V9V A;  5E17 F;  4ZZL A;  5CJ9 A;  4OIO F;  1LJ9 A;  2M87 A;  3GVA A;  1VTN C;  2Q2E A;  3ROU A;  1R00 A;  3ZMV A;  4IJA A;  3ZMD A;  3LA3 A;  2K02 A;  1SD5 A;  3ZMT A;  3WTV C;  2EFN A;  1P2F A;  3GUD A;  2VC0 A;  5JVT A;  2D45 A;  3TOA A;  3KET A;  3COA C;  2FSW A;  3KZZ A;  4UNO A;  2LKP A;  1F4K A;  4LG0 A;  5BPD A;  3G3Z A;  1J5Y A;  3WE2 A;  3I64 A;  2FEZ A;  2JPB A;  1RUO A;  4HLY A;  5LRR A;  2HQN A;  2OBP A;  3RTR A;  5CVU A;  2H94 A;  4I2O A;  2ZXJ A;  2NYX A;  4MEX F;  4G6Q A;  4RGR A;  1T2K A;  1SMY F;  3DEU A;  1FPQ A;  4L5I A;  3L9F A;  3FMR A;  1Z6R A;  4ENK A;  2WTE A;  2NS0 A;  3IL2 A;  3JSO A;  3RYR A;  1HW1 A;  1WWX A;  4ESJ A;  2EWN A;  3MAJ A;  4L18 B;  1OKR A;  3TO9 A;  2STT A;  4YII A;  3ZN0 A;  1O3S A;  1B59 A;  3CUQ B;  5HDG A;  2XUB A;  2FE3 A;  4EGZ A;  3N4M A;  3SZP A;  4NQW A;  5D6F A;  2F5E A;  4JQF A;  4FX0 A;  2XAJ A;  3MZY A;  1GVJ A;  3W6J B;  1UHM A;  3C1D A;  5FO5 A;  4CIC A;  4LB5 A;  2HOE A;  3JSP A;  2FMY A;  2QLZ A;  3GF2 A;  3DKW A;  2QUF A;  2OZU A;  2GA1 A;  5LBQ A;  1K7A A;  2EFQ A;  2QVO A;  3V7R A;  3WTY C;  2QYO A;  3D0S A;  2L4A A;  1LQ1 A;  5E8G A;  3HTS B;  4HX4 A;  2EA4 A;  4EJT A;  2XV4 S;  2FBK A;  5LGN A;  3LFK A;  2VBW A;  2JRT A;  3RPU A;  3TQN A;  4A0Z A;  4LGW A;  2RKH A;  5FB2 A;  1BI2 A;  4OIP F;  1FP2 A;  4OIR F;  1YW9 A;  3K2Z A;  4AIJ A;  1MZB A;  1FLI A;  1Z91 A;  4A2U A;  4KA4 A;  3FF5 A;  2YR2 A;  4A5M A;  1R22 A;  3WU1 B;  1XB4 A;  1LB2 A;  3T1B A;  2XRO A;  3KZY A;  5A2Q K;  2HZT A;  5LGT A;  3V4G A;  1XSX A;  1DUX C;  4IVN A;  1KU9 A;  3HOT A;  3SZT A;  1JHF A;  2IT0 A;  5L3C A;  5J8F A;  4P55 A;  3SXY A;  3WG9 A;  2DPD A;  5BPI A;  4LFU A;  1SFE A;  2QWW A;  1L0O C;  3QU3 A;  2IA2 A;  2CW0 F;  3Q9V A;  4WXC A;  1O3T A;  2PI0 A;  2VBZ A;  5F6F A;  1H0M A;  3F22 A;  3FWE A;  4RB2 C;  2ESN A;  3GLX A;  3WE3 A;  3BRO A;  3PFI A;  1TQM A;  1T98 A;  1MGT A;  2IPQ X;  2V1U A;  2DQL A;  5HLH A;  3BOQ A;  2WV0 A;  2ZBK A;  4YFN F;  3I59 A;  3Q9S A;  2HWV A;  1RI7 A;  5D5W B;  1KGS A;  5DDG A;  1BI0 A;  3K0L A;  4ETS A;  1S8N A;  5J6X A;  2K86 A;  3QU6 A;  4H0E A;  4PZJ A;  1QBJ A;  2A5Y B;  4HBL A;  1I5Z A;  1R1U A;  4IRI A;  1IF1 A;  4HAM A;  3DV8 A;  3FMS A;  2ZME A;  4PGG A;  4D0P A;  3E6C C;  3K1N A;  2VN2 A;  2W57 A;  5LHG A;  2XVC A;  4O3M A;  1HST A;  2X4H A;  4BH9 A;  3F8M A;  2OU2 A;  1F9N A;  1IUY A;  3J7A O;  2CGP A;  1W5T A;  4HZF A;  3J81 K;  3LA2 A;  5CVV A;  1UCR A;  2JPC A;  1ZRD A;  3JAM Z;  3FMQ A;  3IRR A;  2ESH A;  1I6X A;  1LDK B;  1SAX A;  2KIF A;  3GFL A;  2VOO A;  4Q47 A;  1S6L A;  1T6S A;  2PEX A;  4A5N A;  2DQR A;  2EA2 A;  3GWZ A;  4YFK F;  1O3R A;  4K2E A;  5HOO A;  3CO6 C;  4KIB A;  1ZG5 A;  4FHT A;  1W5S A;  2QEN A;  1HKS A;  3EYI A;  5AIP A;  3QPT A;  3M7G A;  1YS7 A;  3FM5 A;  4HYE A;  2J5P A;  5H20 A;  4WX9 A;  1Q1H A;  3CJN A;  1GHC A;  2Z33 A;  2A6E F;  3KLO A;  2C6Y A;  2BBY A;  2XIG A;  1E17 A;  5E1X A;  4HLX A;  3TDU C;  2EFP A;  1NHA A;  3LQQ A;  4RGX A;  5E1Z B;  3TKY A;  4BHP A;  3O2P E;  1PUE E;  2M30 A;  3F6O A;  3OOP A;  3ZN1 A;  2DPU A;  2KJC A;  4RGS A;  1OYW A;  2HS5 A;  3GZ6 A;  2Z9O A;  1MJA A;  1OR7 A;  1LDD A;  4OU0 A;  4I98 B;  1BC7 C;  2HYF A;  1W7P A;  2R3S A;  4M74 A;  3RIR A;  3CDH A;  1FX7 A;  4QLC U;  4KUM A;  1XMK A;  1Z9C A;  4MTE A;  3ECH A;  4M6Y A;  3F8B A;  4IPA A;  5FFZ A;  1G3T A;  3TGN A;  5KVR A;  1U2W A;  2A68 F;  5DV5 A;  2Q0O A;  2ACJ A;  1BI3 A;  2FQ3 A;  3WTT C;  3RYP A;  5HLG A;  4Y15 A;  3SQN A;  2A61 A;  2PFB A;  5L3E A;  1U78 A;  2QQB A;  2A3S A;  3VEP A;  4RS8 A;  2KRF A;  2PMH A;  1TQP A;  3KE2 A;  3KP7 A;  1ZYR F;  1TTY A;  4LLG F;  4A12 A;  2DAO A;  1TW2 A;  2D1V A;  1FT9 A;  4Q48 A;  3V8J A;  3BJA A;  4M71 A;  3MCZ A;  4EM2 A;  3E6B A;  1R5G A;  3GXO A;  2MH2 A;  4KMF A;  3HSE A;  3NQO A;  1ODD A;  3KCC A;  3GX4 X;  4YFX F;  5BQT A;  2IP2 A;  3M8E A;  4GO1 A;  4M73 A;  3J81 Z;  2FML A;  1U5T A;  3ZQ7 A;  5BS6 A;  1MDM A;  5HVQ C;  2E7X A;  4EJW A;  3WTZ A;  2K4B A;  2PJP A;  5ILS A;  2RV8 A;  2H6B A;  4OOI A;  4Y13 A;  2V6C A;  2CFX A;  4G6D A;  1S7O A;  2QM3 A;  3F8N A;  1WQ2 A;  2P6S A;  1T39 A;  1FSE A;  5L3G A;  1REP C;  2GIV A;  2VON A;  1WSU A;  4HF0 A;  2HFH A;  2V1D A;  5D5X B;  4MQV A;  3ABT A;  2QBY B;  3O6B B;  1J75 A;  2VT3 A;  3BDD A;  2GXB A;  2X0L A;  2CSO A;  1T38 A;  3ZMU A;  2MH9 A;  3WTS C;  3R0J A;  4Y17 A;  2XKP A;  5ICC A;  3ULQ B;  3M1E A;  4WWC A;  4M72 A;  1UST A;  4UV8 A;  4MGR A;  2PLY A;  2VC1 A;  3VOD A;  3C18 A;  3HYI A;  4WK8 F;  4CHU A;  1BOA A;  1OMI A;  5D8L B;  5AIQ A;  3JTH A;  3P7N A;  2DT5 A;  3B73 A;  1I27 A;  3HTU A;  5JHU A;  4IHT A;  3RI4 A;  1FP1 D;  4WCG A;  4LLL A;  3HHH A;  2ZJ2 A;  5FLX K;  4R1H A;  4EJO A;  5ED4 A;  1J9I A;  1XGM A;  5HS9 A;  4M9X A;  2O61 A;  1G3S A;  5DCM A;  3WTX C;  1FNN A;  3ZMZ A;  5D5U B;  1K6O A;  2HKX A;  3C3W A;  4U0V A;  2ETH A;  4F7Z A;  4EQQ A;  3I54 A;  2GQQ A;  3VOE A;  4XLP F;  4XSZ F;  1CF7 A;  1FYK A;  1ON2 A;  1I1S A;  2EFO A;  1YO5 C;  1PP7 U;  4HQM A;  5CVI A;  3I59 B;  4RB3 C;  1TNT A;  2TDX A;  4L9N A;  5FD6 A;  1ON1 A;  3KP5 A;  1LVA A;  4AIK A;  4HDU A;  1ZRE A;  5TRD A;  2XGX A;  2Y0M A;  1BBY A;  2AS5 F;  2K4J A;  3WTW C;  5BMZ A;  2JSC A;  4L9V A;  1PP8 F;  2XHK A;  2EB7 A;  4AD9 A;  5L3D A;  2GXG A;  1BI1 A;  4HDV A;  3FHZ A;  3FM3 A;  1HW2 A;  4HOB A;  2K27 A;  3IKT A;  2UXN A;  3KP3 A;  3KEQ A;  3CLO A;  1YS6 A;  1QPM A;  4HX7 A;  4U0W A;  4N9H A;  3DXJ F;  2FNA A;  1IN7 A;  2RVC A;  3DP7 A;  3PQJ A;  2DU9 A;  1RZ4 A;  5FGM A;  2FOK A;  4BYY A;  4U0Y A;  3CTA A;  3L2C A;  3V8L A;  3RJP A;  1ZGJ A;  5E1W A;  5ERI A;  2FNP A;  4CGZ A;  4RAZ A;  3KEO A;  3U1D A;  1FZP B;  1IXS B;  4PDK A;  5TJJ A;  1SFU A;  2M45 A;  1GXQ A;  1QNT A;  3I53 A;  1BC8 C;  4PCQ A;  1UFM A;  1ZG1 A;  4ZYD A;  2CQK A;  1Z7U A;  3KP2 A;  4S04 A;  2IW5 A;  4M6X A;  4U88 A;  2IA0 A;  4LD5 A;  2OQG A;  4MQ9 F;  4P9F A;  2OAZ A;  4GGG A;  5JR3 A;  2VE9 A;  1Y0U A;  2L02 A;  3ECO A;  2DI3 A;  3MFK A;  5E8I A;  2PN6 A;  1UB9 A;  2QQA A;  1R58 A;  4ESF A;  2P7V B;  4L0Y B;  1X3U A;  2FU4 A;  2A69 F;  5CYV A;  4ENN A;  2ZNY A;  1P4X A;  4I7H A;  4YIF A;  1R7J A;  2O6G E;  4E70 A;  4MTD A;  1O3Q A;  3BJ6 A;  3MZH A;  1HBX G;  1GXP A;  3WU0 A;  2Z99 A;  2EK5 A;  4ASN A;  2EJR A;  1TNS A;  1RIO H;  2AXL A;  1XDS A;  1IXC A;  2YPR A;  3R6S A;  2NNN A;  2HGC A;  1XCV A;  1XSV A;  3E5U A;  2K7L A;  5FLX Z;  4ON0 A;  2P7C B;  4I0B A;  1S29 A;  3ABU A;  1J59 A;  1QZZ A;  1K78 B;  1B4A A;  2ZO4 A;  4HF2 A;  3I5U A;  1G3W A;  3CUQ A;  3RKX A;  5LRS A;  5ILV A;  4BNC A;  4OIN F;  3BWG A;  2M1B A;  2P5K A;  5ICE A;  4HV5 A;  2HKO A;  2ISY A;  2KIM A;  2ISZ A;  3H92 A;  2W85 A;  1TBX A;  3GZ5 A;  2YX7 A;  1BIA A;  3R4K A;  2O03 A;  2MLK A;  3WOD F;  4ZYH A;  5D6E A;  4UXN A;  1IRF A;  1AWC A;  4CDG A;  2FXA A;  1SD7 A;  5IT9 K;  3K1P A;  1YYV A;  1ZLJ A;  3RDI A;  2R7D A;  5ICG A;  3FXR A;  1KYW A;  4LK1 F;  2R7F A;  1HXD A;  2RC4 A;  2NRA C;  1D3Y A;  1W7P D;  1G6N A;  4UVC A;  1Z05 A;  2V1X A;  4ENM A;  2DO7 A;  4UV9 A;  3GEZ A;  1ZGA A;  2L54 A;  2RQP A;  1PDN C;  4JBA A;  1U5T B;  5CLS A;  3FXQ A;  3S2W A;  1H9G A;  2F5C A;  3QRF F;  2P5L C;  3L7W A;  1R5H A;  3WGI A;  2VT2 A;  4BHC A;  1RNL A;  3E97 A;  2IVM A;  2ELH A;  1IW7 F;  2Z3Y A;  4EVI A;  2OQR A;  3ELK A;  1FSH A;  4BHB A;  1CGP A;  5HDN A;  1ZH5 A;  3AAF A;  1KA8 A;  5DCF A;  1D5V A;  1BJA A;  1XSD A;  3EYY A;  1IN4 A;  2RNJ A;  3KP6 A;  1IN6 A;  3HSR A;  2YX4 A;  4XSX F;  4TV7 A;  3L00 A;  4YG2 F;  5A2Q Z;  4Q5S F;  1OYY A;  3K69 A;  3ZP5 A;  1IZ1 A;  4WF2 A;  3QPH A;  2KKO A;  1C0W A;  1XGN A;  4G7O F;  1UHW A;  1P6R A;  4RB0 A;  4LMY A;  4GCV A;  1WKM A;  2ZCW A;  2P8T A;  3QOP A;  5K1Y A;  2VBX A;  4KNY A;  3R61 A;  1ZAR A;  3GFJ A;  3HUG A;  3JTG A;  3T8T A;  1STZ A;  3E6D A;  1QO0 D;  2NNY A;  4UUV A;  2XAG A;  1AOY A;  2YU3 A;  1QGP A;  3ISP A;  1LEB A;  4WXD A;  1U6G A;  2COM A;  4LG0 B;  3U2R A;  3ZPL A;  4LLN A;  4IHS A;  2OD5 A;  1SD4 A;  5LHI A;  4MEY F;  3GFI A;  1WI9 A;  2Y48 A;  4OMZ A;  3TDZ C;  5E20 A;  1FBQ A;  4ESB A;  4ZYG A;  1SFX A;  4ZZD A;  3HIF A;  1RUN A;  1A04 A;  2W25 A;  3HRS A;  3N97 A;  4KN7 X;  4RAY A;  2RN7 A;  5DYM A;  1CF7 B;  3RKY A;  4PGH A;  1J7K A;  4G9Y A;  2Z5U A;  2E1C A;  3WGG A;  3K1M A;  4LJZ F;  4CXF A;  4A0X A;  1HW5 A;  3E5X A;  2L4M A;  3E3V A;  4GYG A;  4DNC A;  2E1N A;  3LST A;  5H6R A;  4LB6 B;  2XAF A;  1FYL A;  4EV0 A;  4KMU X;  3U9G A;  4Q4Z F;  6PAX A;  1ZRC A;  5IT9 Z;  4DQ2 A;  4LK0 F;  1G3Y A;  2CWE A;  5DUI A;  3RPQ A;  3TO7 A;  2GAU A;  3L09 A;  3IRQ A;  3F72 A;  2XRN A;  1IRG A;  3PQK A;  1BN5 A;  1QZY A;  4O6J A;  1EV7 A;  3MEX A;  3FXU A;  2MLG A;  3H3Z A;  4QWQ A;  2OA4 A;  5HDK A;  4M9Z A;  2F5F A;  1YW7 A;  3WTU C;  2WWY A;  3LQR A;  1T0F A;  3P9K A;  2M5W A;  4KFC A;  2BYV E;  3LA7 A;  2FF4 A;  4AVP A;  1J2X A;  1OPC A;  3K9T A;  5FD5 A;  5ICF A;  2DFI A;  2HDC A;  2GA2 A;  2HTJ A;  2GZW A;  1R36 A;  4M9S A;  2NAZ A;  4FT8 A;  4B8X A;  4MNU A;  1YTY A;  2O8X A;  3R60 A;  4U7D A;  3TO6 A;  3HRM A;  4GYI A;  1XGO A;  1ZHF A;  2BV6 A;  1Z1D A;  2VBY A;  1KQ8 A;  2DW4 A;  4AWX B;  3CUO A;  4P96 A;  3W6K B;  4GXO A;  1O7L A;  3H3U A;  4O5V A;  1XMA A;  2IJL A;  3FX3 A;  4U7B A;  4G8X A;  1B9M A;  1YW8 A;  2IA1 A;  3IWZ A;  1B9N A;  1U5T C;  3M8F A;  3V7C A;  2DK8 A;  4UHT A;  4S05 A;  2UZK A;  2DLL A;  5DEQ A;  2MBF A;  1QQI A;  4P9U A;  1YG2 A;  1YFH A;  3BY6 A;  2P5V A;  2WC2 A;  4CYD A;  4IXA A;  3SFZ A;  2G7H A;  2Q8K A;  3IHU A;  1OYI A;  4KYW A;  3JAM K;  5EEG A;  3M9A A;  1TW3 A;  2F5D A;  2QZ8 A;  2ZME B;  4FX4 A;  4L9J A;  1R1T A;  4A6E A;  2A6H F;  3IC7 A;  3LAP A;  1JE8 A;  2P6T A;  1D8J A;  4AIH A;  3IKV A;  3VFZ A;  1F1Z A;  1ZLK A;  4IRH A;  5D5V B;  3EQL F;  1YLF A;  2VE8 A;  3JW4 A;  2CYY A;  1XN7 A;  2Y75 A;  1W4M A;  2PMU A;  2YSR A;  1I1G A;  1ZAO A;  3G73 A;  3LAJ A;  5HS7 A;  3V8K A;  1WRJ A;  1XCB A;  4KIC A;  2BEO A;  2QBY A;  4HX8 A;  5L3B A;  1ZG3 A;  1KU2 A;  5ILU A;  2PQ8 A;  2HQR A;  2CO5 A;  2W84 A;  2H09 A;  4WXH A;  1U3E M;  1ZN2 A;  2DK5 A;  3DPT A;  5F1R A;  1EH7 A;  1O7F A;  2D2W A;  5D4R A;  4I0A A;  1J0R A;  5HS8 A;  1LNW A;  5LHH A;  1DPU A;  1XD7 A;  2HTS A;  3T5X A;  4BQA A;  1U8R A;  5K5Q A;  1LEA A;  2JT1 A;  3I58 A;  2W24 A;  1S3J A;  3EUH A;  1B1B A;  3J80 K;  4N9I A;  3BPV A;  4A6D A;  3QP5 A;  3KLN A;  1KU3 A;  2STW A;  1H9T A;  4EGY A;  1SMT A;  2O0Y A;  2MA3 A;  3P9C A;  3F8C A;  2MC3 A;  4HA8 A;  3T8R A;  3DQV C;  2ZKZ A;  2JZY A;  2B0L A;  2PG4 A;  4KT5 C;  2EV5 A;  4OIQ F;  4MHG A;  3MWM A;  1HKT A;  2LSO A;  4XRF A;  4BXU A;  2DTR A;  2FRH A;  3DFG A;  1ONV A;  5LEJ A;  5BOX A;  1MD0 A;  1FWZ A;  4ZYE A;  4R79 A;  2UWM A;  3I4P A;  1KYZ A;  1JXS A;  1W7P B;  5HLI A;  5JFR A;  2A07 F;  4OMY A;  4NB5 A;  1P4W A;  1XDU A;  2IRF G;  1FC3 A;  5KK1 A;  3FZV A;  1B6A A;  1XGS A;  3C7J A;  2HR3 A;  3IWF A;  1IN8 A;  4EM1 A;  4KIG A;  5L3F A;  5FFX A;  4KN4 X;  4HF1 A;  1BM9 A;  1R23 A;  3E5Q A;  3MQ0 A;  4I09 A;  3BP8 A;  3GYH X;  4EMS A;  3F6V A;  5K5R A;  4KDP A;  2HYG D;  1ZRF A;  3P9I A;  2KIU A;  2CG4 A;  5DUK A;  2XAS A;  1KQ0 A;  2G9W A;  3GFM A;  2HEO A;  5EEH A;  4JK1 X;  1DPR A;  4KIF A;  3GW2 A;  5F64 A;  1JHH A;  2RGV A;  4RB1 A;  2ZNZ A;  3BJO A;  4G7H F;  2P4W A;  2V79 A;  3EET A;  2E7W A;  1Z6T A;  1F5T A;  3HOS A;  3CO7 C;  2H27 A;  2OZ6 A;  3I0T A;  2H6C A;  4EM0 B;  4XLN F;  4XBF A;  1HQC A;  1BIB A;  2O3F A;  2XAH A;  4Z2Y A;  4N0B A;  1MDM B;  5H6Q A;  3VB2 A;  2JTV A;  3HRU A;  4G7Z F;  4A0Y A;  4EJU A;  5JI6 A;  2LDU A;  2F2E A;  1SD6 A;  2ZFW A;  1P4A A;  4I02 A;  4RGU A;  1V3F A;  1KQ9 A;  4ZH4 F;  1MJ9 A;  5E18 F;  1HKQ A;  1V4R A;  2EV0 A;  4UVB A;  4R8H A;  4NHJ A;  1MKM A;  2FA5 A;  3DF8 A;  3E6M A;  3CUQ C;  1IXR C;  3REO A;  4L5J A;  5DD4 A;  1IN5 A;  2MD5 A;  3GO5 A;  2EV6 A;  1G4D A;  3QAH A;  3F23 A;  3BPX A;  1DP7 P;  4IF4 A;  4L9T A;  3NRV A;  3J80 Z;  5D8K B;  3TOB A;  3OV8 A;  4P5O A;  4L0Z B;  3Q5F A;  5IT3 A;  2L01 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...