2JA5J

Cpd lesion containing rna polymerase ii elongation complex a
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Cpd Damage Recognition by Transcribing RNA Polymerase II
pubmed doi rcsb
total genus 14
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2ja5J00
2LK2A 5J1RA 5FKKA 4JYKA 2MSYA 1MSFC 1F43A 4C3HJ 2HXOA 2X6OA 2XGDA 1XG1A 4M3FA 3OOUA 4UUSA 5EZHA 2DMTA 3BT9A 2AO9A 3BG3A 3S2HJ 2DMUA 3Q0WA 2H8RA 3HOYJ 2Y9ZA 5F27A 2FJ1A 2R5YA 1I3QJ 1B8IB 4Y52J 3WHBA 1ZR4A 1F36A 2EZHA 2FD5A 1JJ8C 3F0CA 2W48A 4NDLA 3DCFA 3HOXJ 1GVDA 4DYQA 5DTDA 1DU6A 2GM4A 5F0CA 3C2BA 5JLXA 2D5VA 1MBJA 1UHSA 4M3DA 4W97A 2GLOA 2IAIA 2KT0A 1H8AC 1IGNA 5K7ZA 5HODA 2EQRA 2MGQA 2LVSA 2O8KA 4IHXA 3LSRA 2IEKA 1ZTRA 3S1NJ 5IP6A 4JX4A 4MLOA 1FTZA 3JR9A 2XRLA 3Q0UA 1A5JA 2HOAA 3FK6A 3WHCA 4W1UA 3GTKJ 1BW6A 3S1MJ 3JRGA 3QQAA 5F0HA 1P7IA 5EZGA 2LY9A 2COBA 2X48A 1IJWC 3HOWJ 1UMQA 1WH5A 2LP0A 4DYCA 2CRGA 1PUFA 1K61A 1ITYA 1LE8B 2NVTJ 1H89C 3CMYA 1U78A 4IHVA 2L7ZA 4CYCA 1X58A 3H0GJ 5M5WJ 3PM1A 1RR7A 1AKHB 1YRNA 3NAUA 2LFBA 1T56A 2OF7A 1OFCX 1MBEA 2N8GA 2ID6A 1X2MA 2IBDA 3ZQGA 1IC8A 1R9TJ 3TW6A 1TWAJ 2O7OA 4FISA 5BNGA 1B72A 3RZDJ 2CQQA 4DYRA 1JKPC 2DN0A 2E2JJ 4A3MJ 2DA5A 5J3LA 2XSDC 3GTOJ 4QSHA 1JKOC 1SANA 2XGEA 3IH4A 2HQ5A 3GTJJ 2XB0X 1TWGJ 3I4MJ 3GBGA 5F0FA 2CUEA 3TP3A 1MBGA 2VKVA 5EF6A 3GTGJ 1FIPA 3BR1A 5E3LA 1S7EA 3SDGA 3BTLA 1MBHA 1WI3A 1OCTC 2Y30A 3GTPJ 4I76A 3A01A 2L9RA 2HDDA 5EGOA 4GFBA 1U8BA 3FK7A 1JTYA 2TRTA 3JRDA 2FX0A 5DS9A 1BJZA 1GUUA 1IRZA 3BG5A 3O8GA 4IHYA 2GBYA 3H3VK 4JX6A 2M2EA 4LOCA 2VPRA 2R92J 5FKMA 2L0KA 3BTJA 4C2MJ 1Q1VA 4B1RA 4DZJA 3L1PA 2XPVA 1TWFJ 2R7ZJ 4BXXJ 2DA4A 1NTCA 1XS9A 1IV6A 5GPAA 2EBIA 1UG2A 2I10A 3CQZJ 3FISA 1XC5A 2NS7A 3HKZN 5EDNA 3JRIA 1ZR2A 1GV2A 3BTIA 1QRYA 2HYJA 4A3FJ 2VI6A 3DEWA 1W0UA 1U9OA 2DMPA 2WV1A 1I6HJ 3BR6A 2QF7A 3BG9A 1X2NA 2R5ZA 1AU7A 2K9NA 4A3IJ 2QCOA 3MKLA 4EEFG 4IEJA 2RAEA 4BBSJ 3PO2J 4A3EJ 2Y0SN 2H1KA 3QPLA 2ME0A 3LSJA 5F08A 3S1RJ 2NS8A 3SFIA 1GDTA 1QVUA 3A02A 1ETOA 4A3CJ 3HOZJ 1JUMA 4A93J 3GTMJ 1WGXA 1IDYA 3S17J 2VUMJ 1JT6A 2HXIA 2X9DA 2LKXA 3PO3J 4I6ZA 1JGGA 3RKQA 4M6VA 2HOTA 2LR8A 2DA7A 3ZQCA 4A3GJ 1MH3A 3OSGA 2WB1N 1MBKA 3LNQA 1EF4A 4D5CA 1FTTA 3JRHA 1FEXA 1Y1VJ 2ME6A 4XRSA 3M4OJ 1QPIA 1VI0A 2DTZA 5EG0A 2LD5A 2DA6A 4FE7A 2ECBA 1TWHJ 1HDPA 4FE4A 5IYDJ 5FLMJ 2M8GX 5M3FJ 5IYBJ 1MNMC 3BR0A 3K7AJ 2E2IJ 4BY1J 2EZKA 1IUFA 3I4NJ 1W0TA 1QVTA 1ZK8A 4C3JJ 3D1NI 4V2FA 1RETA 4A3KJ 1CQTA 1IG7A 1A6IA 3MVPA 3ZQIA 1B8IA 1SFOJ 4MFEA 4UUSB 2E2HJ 1Y1WJ 1HF0A 4XIDA 4A3DJ 1FJLA 2R0QC 4Y7NJ 4XICA 1DU0A 1HLVA 2LLKA 3GTLJ 1P7JA 2R5YB 4B3AA 4G12A 2HOSA 1AHDP 1IDZA 4M3BA 5IOYA 1BA5A 2MW8A 1TC3C 3S14J 2R93J 3G1MA 4XRMA 2M9HA 2Y31A 2NVQJ 1MH4A 4A69C 4BKXA 4HNVA 4X6AJ 4MFDA 2XPWA 1LFUP 1ZGWA 4M3GA 4D5FA 1I50J 2EZIA 3CCYA 2P81A 2JA8J 3IH3A 4XK4A 2JA5J 2K9QA 2JJ7A 5FKOA 3TW7A 4J19A 2MG4A 2JA7J 1WCMJ 4BBRJ 3S1QJ 2L7FP 4V2GA 2NOGA 5C4XJ 3BQZA 1BW5A 1LE8A 4L5EA 3S16J 1Z0XA 3TEDA 3RZOJ 3QPSA 1RKWA 1JT0A 2NVXJ 3LOCA 2DJNA 1ETVA 4FTHA 2K40A 1ETKA 3MN2A 1AKHA 2PMZN 4A3BJ 2M34A 1OCPA 1PUFB 3BTCA 4AUXA 1WPKA 1ENHA 1APLC 3ZQHA 3BR5A 3B6CA 1ETQA 4CYCB 2CQXA 3JRCA 1MSEC 2EZLA 1HDDC 3IH2A 1FIAA 2JN6A 3W6VA 1YRNB 4QIWN 3TP0A 3HGYA 3ZOBA 5FLVA 1G2HA 5E3NA 5F1JA 4JX5A 1HOMA 1O4XA 1VNDA 1B72B 2OPTA 1ETWA 1RKTA 2LTPA 1MBFA 3E7LA 3HOUJ 2CJJA 2DMNA 4RDUA 3JREA 2XPUA 2Y9YA 5IP7J 2B63J 5FKLA 3RQIA 3G1LA 5J1UA 1GV5A 4C3IJ 1ETYA 5IPAA 4M3EA 2CU7A 3A01B 3HGGA 4AC0A 5EGOB 4ABZA 2TCTA 5EEAA 5E3MA 2EH3A 2G0EA 3VPRA 3ZQLA 2HI3A 1GT0C 4D7MA 3HM5A 4B4CA 3HDDA 3BQYA 1NK3P 5K7FA 1JKRC 3O8HA 1JUSA 3A03A 2YU9J 5JLWA 4D7NA 1LFBA 2ID3A 2L7MP 2CUFA 1BL0A 2JK3A 5EYRA 5IYCJ 5FJ8J 5M5XJ 3S15J 2DA1A 2K9SA 3LSPA 3M3YJ 5M5YJ 5J1YA 1JJ6C 3OSFA 1NK2P 1JUPA 1RESA 2ECCA 3CDLA 1VF9A 1D5YA 4BY7J 2AHQA 1VFCA 2KDZA 2Y2ZA 2O9LA 1Z77A 3B6AA 2ELKA 3UKGA 1H88C 4A3LJ 2M0CA 9ANTA 2WAQN 4FCYA 2DMQA 1OJLA 2DA2A 3HOVJ 3HEFA 3HB9A 3Q3SA 4JP0A 2R5ZB 2YUSA 4QTRA 2ZB9A 5E3OA 5C3EJ 3GTQJ 5M3MJ 1RPWA 4S0HB 2E19A 1POGA 3JRAA 3BR3A 4X1EA 1HCRA 3LSGA 1U9NA 5IOZA 4IHWA 5F04A 3HBLA 1T33A 2JMWA 4UUTA 4AYBN 2DA3A 4MIMA 4DZPA 3OIOA 3K2AA 3NARA 4XRSG 5C44J 3SJMA 1JTXA 1TWCJ 2VKEA 1ETXA 4RBOA 5FKNA 2FQ4A 3JRBA 1ORKA 1JKQC 1K83J 5GPCA 3IV5A 1E3OC 5K7HA 1WH7A 2JWTA 5C4JJ 2JA6J 2YS9A 1ZKGA 3FIWA 4DW6A 3S2DJ 4A3JJ 1ZQ3P 3JRFA 3G1OA 4MO7A 2XB5A 3FKIJ 3ZQFA 3Q0VA 5EG0B 2NVYJ 2E1OA 5IP9J 3BR2A 2XGCA 5GP9A
chains in the Genus database with same CATH superfamily
4LG0B 4Q5SF 2FEZA 3E0JB 1YS7A 2MSYA 1FC3A 5KAIC 4N9HA 2VC0A 2X6OA 4UY8I 2PQ8A 1U5TA 2W1OA 3LSMA 2LG4A 2ZNZA 4GGGA 5LBQA 3I54A 2DO7A 3UR3C 4EM0B 5J47A 3HOYJ 4CYDA 3ZP5A 4PUSA 4NNJA 2FJ1A 1BBYA 2R5YA 5LRRA 1EH6A 1ZR4A 3C2GA 4JQFA 4XKWA 2PMZA 4V19K 3VOEA 4Z6YA 2P6TA 3F0CA 1G4DA 4XSXF 3AFHA 3SDBA 3BDDA 3W3CA 4HX8A 3GXOA 4KIFA 5DTDA 5E79C 1UHMA 3CCSI 2GM4A 5TISC 1TQMA 2KKOA 1KYZA 3C2BA 5JLXA 4L0YB 3R4KA 3NWTA 2GLOA 2Y75A 4UB6C 3JW4A 5FGMA 1UJ8A 1OR7A 2VC1A 2MGQA 4D0PA 2DDAA 3CJQB 4B47A 4IHXA 4TV7A 2IEKA 4HDUA 4EJOA 3JR9A 2LKSA 1UCRA 3K10A 1P9QC 3E6BA 1SFEA 1YQAA 3H92A 2V1UA 1P4AA 5DUKA 3GTKJ 2LY2A 1X19A 5F0HA 2HQRA 3DEUA 4IXAA 2COBA 2CFXA 4I98B 4XL9A 3I59A 4F3QA 4FETA 3CF5F 3OYNA 4KJZA 1WJEA 4QPOA 1ZLJA 2NVTJ 2QBYA 2KZGA 4M73A 4AIKA 5CKTA 2L7ZA 1OCRH 1E3PA 4G7ZF 3FXUA 2JSPA 4E7IA 2DFIA 1PP8F 3S3OA 1QPMA 2OCEA 3PM1A 4IRIA 3G6EI 3S32A 4BQNA 4KUMA 1QHHD 4KIBA 1NHAA 2N8GA 3Q9SA 4R79A 2ID6A 2EFNA 2IBDA 2ZXIA 4G6TB 3ZQGA 1R9TJ 3OR2C 2GA2A 2HFHA 1U0JA 4FISA 1VQNI 2DOFA 2DN0A 4IL6C 3H36A 3AL0C 2OC6A 1J5YA 2DA5A 5J3LA 2XSDC 4QSHA 1R1VA 3HUGB 4HX7A 2JT1A 2HQ5A 3HPGA 3QOEA 3A0BC 1LPQA 4EJUA 1TWGJ 3I4MJ 1T6SA 3GBGA 1X1BA 4FT8A 3HXLA 2VKVA 4ZTJA 3GTGJ 1A36A 4L18B 1FIPA 1S7EA 3SDGA 1DQUA 2DOAA 1QA6A 2W85A 2CV0A 5DCFA 3RI4A 3P7NA 4YEJA 3DBHB 1R4NB 2B0LA 2Z33A 4DBRA 2L9RA 4WCGA 2HDDA 2MC3A 4XKCA 2MYSA 3FK7A 4MHGA 3JRDA 4B8XA 5LGNA 1R36A 2DU9A 3T0YA 1FOYA 1K6OA 1V5EA 2F4MB 2L01A 2GBYA 3ISPA 3OYGA 3H3VK 5CLSA 5HVQC 4EQQA 5FKMA 4E6KG 5B5EC 2XF6A 3NWSA 4P9UA 4C2MJ 2PJRB 3ASOH 2R7DA 3X2QH 4B1RA 1TBXA 4DZJA 4PDKA 2WBMA 3EUAA 3CCQI 4BXXJ 1G3SA 1JI8A 2DT7B 1D8JA 2M87A 3KP7A 2UZKA 4I2OA 5L3EA 4IX7A 3C7JA 3FISA 1GVJA 2BZTA 2K27A 3LFKA 3BLYA 4DNCA 2PN6A 2BOLA 5LHGA 4HV6A 2DMPA 4LITA 3IAS2 2QVOA 1ZG3A 2XHKA 2FMLA 1IXSB 3OYDA 1AU7A 2L5QA 4G8XA 3CP8A 5JVTA 5HNHA 2CYYA 1WQ2A 1TNSA 2EWNA 4BYYA 4BJTA 2L3DA 3HPHA 2Y0SN 3FWEA 3QPLA 2ETHA 3P9KA 3F8MA 2V6CA 4P5OA 3LSJA 1U6GA 3OYKA 3S1RJ 1K78A 2FQ3A 3HRMA 3OMYA 1ZGJA 3L00A 4RGXA 3WU1B 2EA2A 2EFOA 2MC4A 3I4PA 1ETOA 2OTLI 1HQCA 1OPCA 3DV8A 1N75A 1UZCA 1UHWA 5D5XB 3S17J 3HG9A 2HXIA 2A5YB 4PJNA 4F91B 3R60A 4ZYGA 1GXQA 1V5FA 4M6VA 3RKQA 3BY6A 3W2VA 1OYYA 2FXAA 4GCVA 1WZ2A 3U1KA 4X0GA 3TBIA 3CJTB 1Y6IA 2XF5A 1HSJA 5KCMA 1QPIA 4B3XA 4RB2C 2XUBA 3GF2A 2YU3A 1K6YA 3M1CA 3I9V2 1XMXA 4LG0A 3EQLF 4L5JA 4BDZA 2H09A 2ZKZA 2M8GX 4YFXF 2VL8A 1QGPA 3ROUA 4UV8A 1Z6TA 5LEKA 1J2XA 2STWA 3RIRA 3RDIA 1J9IA 1ZLKA 3I4NJ 1W0TA 2OZUA 1QVTA 1ZK8A 2X85A 3FHZA 3ML6A 3VODA 1FOKA 1SFOJ 1X1PA 4GRIA 4AIHA 4AIJA 3EYYA 2VQHA 2E2HJ 1Y1WJ 1SD5A 5LFAA 4A3DJ 1X3WB 2JQ7A 2G9WA 3BP8A 4ANJA 1DU0A 5E8GA 3PUFA 3C3WA 3F8BA 4J01A 4G12A 2HOSA 2A61A 2CGPA 2OJED 1HSTA 4CHUA 4KNYA 2EV0A 3BJAA 1WJ5A 3S14J 5CVRA 2R93J 2E1CA 1R22A 1G59A 3LFUA 2G7HA 4XOPA 2F2EA 1C0WA 2NVQJ 3IRRA 2WV0A 4HG2A 2Z1DA 3FXQA 5JVGF 1JHFA 1MZBA 2KPMA 1V54H 2BY1A 1I50J 2EZIA 2RREA 3FM3A 1FPQA 3GW2A 3PNTA 2W82A 2L7KA 1P4XA 3I58A 2VN2A 3MZHA 1KQ0A 4DIQA 1OYIA 3EETA 4O6JA 2JA7J 1WRJA 1IAWA 4XMYA 4BBRJ 2DFEA 5KK1A 3E6MA 2JRTA 2E71A 5C4XJ 3S3MA 4WXCA 1BW5A 4IHSA 3GFMA 1ZRFA 3S16J 2K5CA 3ZCOA 4RS8A 2NVXJ 1E17A 2R7RA 5D4SA 2DJNA 2EFPA 3GWZA 2FBHA 3L2RA 3DP7A 4PCQA 4FTHA 3MN2A 1T95A 5D5WB 1FBUA 3FXMA 4P1WA 2M34A 1PUFB 3BTCA 2PLYA 1KONA 1ENHA 2O03A 2YX4A 1XSDA 1LFPA 4RGRA 2ZXWH 1ETQA 2KFDA 3CUOA 1UG0A 2OV7A 1TW2A 4BGDA 3JRCA 3IH2A 4NHJA 1R5ID 3CTAA 2KIUA 1YRNB 3TP0A 3MFKA 3L09A 3HUGA 3DKXA 4KITB 3AAFA 5E3NA 1UB9A 5HDGA 4JX5A 1O4XA 1YTYA 1J75A 1RZ4A 2EK5A 3PIPF 2IGNA 3FM5A 2K3FA 2L54A 4KDPA 1SC7A 2DMNA 2FUG2 2M45A 2XAHA 4E7JA 1DUXC 5E8IA 2Y9YA 2XROA 2DPDA 5GAHJ 2FE3A 4HSTA 2AS5F 5ICEA 3IKVA 3M8EA 5DYMA 3MD2A 1TT0A 5IPAA 1O3TA 3VWBA 2R7XA 2RDPA 4M3EA 3HHHA 3A01B 3HGGA 4KIGA 4KFCA 3GLLA 2PJRA 5E3MA 1YW9A 5TRDA 2EH3A 2D45A 4DBQA 2W25A 5A2QK 3QP5A 2V4JC 3KLOA 1GT0C 3HM5A 2ZMEC 3BQYA 4L5IA 4RLFA 3ZMDA 5H2FC 4Z2YA 2PI0A 1GLNA 1JUSA 2P0WA 1I3AA 2W4SA 2XASA 2YU9J 2W24A 4D7NA 2ID3A 4DGWB 1BOBA 4R1HA 1BL0A 2JK3A 2ZJRF 2XKOA 2JUGA 5M5XJ 2WB1A 4ZDPA 1SFXA 1W4MA 3S15J 2K9SA 1YW7A 3FDYA 1O57A 2KJBA 2CQNA 4ZJZA 2YX7A 1JUPA 1RESA 1HXDA 1IN8A 3CO7C 2AHQA 2BY3A 4ZZDA 1EV7A 2Y2ZA 4Y13A 2O9LA 2JTVA 2W84A 1Y0UA 3F8CA 3E5XA 1QNTA 2Z3YA 4A2UA 2M0CA 1STZA 2GOXB 3IKTA 2BHZA 3HB9A 4JP0A 2XV4S 1YE9A 3DBLB 2ZO4A 1RUOA 4QTRA 5C3EJ 3R0JA 1PDNC 1RPWA 3QYFA 5IT3A 3L2UA 3JRAA 2VE9A 3M8JA 4X1EA 1O3QA 1I27A 1BM9A 3LSGA 5IOZA 2FNPA 5F04A 1OYWA 3GX4X 4AYBN 2QSHX 3I71A 2B9SA 3C2HA 2RV8A 2XGXA 5F1RA 1VTNC 2FSWA 2VKEA 1ETXA 4M72A 5HLGA 3HRSA 4HLXA 5FKNA 5CQGA 3BWGA 1X1AA 1JKQC 3BOQA 5GPCA 1S3JA 1E3OC 3GYHX 2FU4A 2JWTA 2EIMH 4CUGA 4ESFA 4A5MA 2JA6J 4OAZA 2MD5A 5E1ZB 1BIBA 2V9PA 3LSIA 3JRFA 2V1NA 1X1DA 5FFZA 1TW3A 3TO9A 5EG0B 3HTUA 2NVYJ 1XD7A 1VQ6I 2HDWA 4PSWA 1T08B 3A2KA 4N9IA 1LDDA 1W5SA 3J80K 2XAFA 3CLQA 2XGDA 1MDMB 4M3FA 3OOUA 2K4JA 2MFZA 2O8XA 1F4KA 4BU2A 2HNHA 4O3MA 2H1LA 1QZEA 1TZLA 2XKPA 3Q0WA 2R3SA 1YS6A 2HPMA 3BJOA 2Y9ZA 2QWWA 3HSRA 3OYIA 4KA4A 5K1YA 1F36A 5CVIA 2EZHA 3HRTA 2X1EA 4BE0A 4RA2A 1B9NA 4MQ9F 3PFIA 2I8DA 2W48A 2AQFA 3DCFA 4E7KA 1GVDA 1KU9A 4JK1X 3U9GA 4HPQA 4LFUA 2WY7Q 3FZVA 3F72A 4RAZA 3MWMA 2E1MB 1DU6A 3B02A 2M4KA 4BH9A 1MNEA 3DF8A 1MBJA 1UHSA 4M3DA 4W97A 4MTEA 2IAIA 2OCCH 4A5NA 4EV0A 2R7OA 1H8AC 3GZNB 3J7YJ 5K7ZA 3E6DA 3F6OA 4I99C 5DCMB 1XCVA 1BR2A 2LVSA 3QYEA 4U0VA 1YO5C 2O8KA 4OINF 3MQ0A 3KEQA 4LK1F 4MLOA 2P5LC 1FTZA 2EV6A 2V9KA 3Q0UA 4EM2A 1A5JA 1J7KA 2MLKA 2HOAA 4YIFA 3FK6A 1VQOI 4DJAA 2E7WA 4ASNA 3VYRB 2AQEA 1I39A 4WXHA 4EATA 2OTJI 2V6EA 2LY9A 3FXKA 1U2WA 4RAFA 1G6NA 3HOWJ 1BI3A 3SHFA 1WI9A 2LP0A 1FBSA 4DYCA 2B7EA 1PUFA 2DFHA 1OQYA 2KRFA 5HS7A 4F93B 1ZH5A 1LE8B 5EJCA 2PMHA 1FYMA 1H89C 4IHVA 4IZZA 1RRJA 3KYCB 5GAEJ 1EH8A 5M5WJ 2JVHA 4XLFA 4Y4RA 3OYCA 1YRNA 4LLNA 3NAUA 2OF7A 4CO8A 4H0EA 4XLCA 3IC7A 3F9KA 4OMZA 3J81K 3QAHA 4CCOA 3V7SA 2CQQA 1BI0A 1QHGA 2BGCA 3VYUB 4A3MJ 2O0YA 4XKBA 2HKOA 2EV5A 3L2VA 2D2WA 1JKOC 1SANA 3JSPA 2XIGA 2GXBA 2XB0X 1WJDA 2CW8A 4IOCF 3KETA 2CUEA 3TOBA 3TP3A 4I02A 3BCBA 1MBGA 2BBYA 5E3LA 1D8KA 3BTLA 3PFYA 2DODA 2DBBA 4I76A 2RN7A 3A01A 2YPRA 1U8BA 3QRFF 2FX0A 3VYTB 2GZWA 5DS9A 3RTRA 3BG7A 4QLCU 5GTHC 1LVAA 2P7VB 2Q2EB 2W00A 3E3VA 2R7TA 3BG5A 3COAC 3MMYB 4JX6A 3KPHA 3WGIA 3OYHA 1KA8A 2M0MA 2GQQA 2VPRA 4UVBA 3G2BA 3K0LA 3H9QA 3BPXA 4WK8F 3G4SI 3BTJA 2IA1A 5BOXA 3SEZA 1VQLI 3ERMA 1E0EA 1Q1VA 2E1MC 2QLZA 2XPVA 1TWFJ 2F48A 4HV5A 5FFXA 2M3AA 3KFWX 1X3ZB 4AD9A 2ZJQF 4S04A 5LD2C 3IUOA 1LQ1A 3JRIA 3GZ5A 3LSTA 1XDSA 4NBQA 5EDNA 1GV2A 2E60A 2DCEA 4PZJA 2G7UA 4PGGA 4F55A 1T2KA 5ERIA 1W0UA 1U9OA 2AXTC 2WV1A 1DDNA 3BR6A 2QF7A 3BG9A 1IF1A 2Z16A 2QCOA 3MKLA 2LY1A 3RPQA 3LQQA 4EEFG 1R00A 5K5RA 1SMYF 4IEJA 4XONA 1BIAA 3SEQA 3PO2J 3ESWB 2KIFA 3AKZA 5F08A 4M9XA 2NS8A 3CC2I 2XAUA 2F4IA 1RIOH 2IVMA 2ISYA 2Q0OA 4KT5C 2DQLA 3JTGA 1XGOA 4A3CJ 3K9TA 1TNTA 2LOOA 4U88A 3N4MA 3T8TA 4BEHB 1A6QA 2WTEA 2X9DA 1S8NA 1CF7B 1T8IA 1K7AA 2LR8A 2DA7A 4A3GJ 1Y56A 3L2CA 1MH3A 2R7FA 3LNQA 1EF4A 3NEUA 2DK5A 5DEQA 3VB2A 3H9GA 4P55A 1FEXA 4XRSA 5DD4A 5KAFC 2E35A 1VI0A 2F5DA 5EG0A 4HAMA 4BS9A 2P4WA 3AG4H 3CMMA 3ZQQA 3REOA 4AWXB 2L4MA 4FE7A 3TDUC 1KZHA 1FY7A 5IYDJ 2XSJC 3W2WA 5M3FJ 1R49A 4HBLA 1MDMA 4XLPF 2NVUB 2JRMA 2VJJA 2ZXJA 2E2IJ 1XSVA 2DT6A 1LB2A 5JFRA 3RKYA 3D1NI 1VQ7I 2KL4A 4WXDA 3OYFA 3ZQIA 3MVPA 4BUPA 1Y0NA 3TDZC 5LHHA 3PIOF 2DXIA 3HZJA 2JSCA 3MCZA 5ICCA 4N0BA 3IWFA 3HC7A 2VXZA 3P9CA 2M7AA 2QKLB 1FJLA 4Y7NJ 2BE5F 4XICA 3EUKL 4MGRA 3K4NA 2XVCA 4P9FA 3I53A 2V9VA 4M3BA 3GFIA 1BA5A 4R8HA 1ONVA 3G1MA 4JOMA 4XRMA 3R6SA 5FRNA 1MH4A 2KISA 5J8CA 1FMVA 4NC7A 4BKXA 1MJBA 5KHDA 4MFDA 4X6AJ 2WY8Q 5HS9A 2EFWA 3DPLC 3W6JB 2IW5A 5H6RA 4M3GA 2QUFA 2K9MA 1OMIA 4NC6A 3CCYA 2P81A 3IH3A 1LNWA 5GP9A 2RKHA 2K9QA 2JJ7A 1TL8A 3FXJA 3PUBA 1V55H 2MG4A 4FHTA 4RAGA 3DU6A 4U0WA 4B48A 2HQAA 3S1QJ 2LRDA 1ZGAA 2L7FP 3CCRI 2NOJB 4OOIA 4BHBA 1SFUA 1W36D 5FD6A 1LUJB 4Y17A 1LE8A 1FP2A 2HU9A 1WKMA 2OQGA 4L5EA 4CCMA 1F9NA 1Z0XA 5ICGA 3QPSA 1RKWA 1Z9CA 3DKYA 2Q8KA 4NQWB 3BG6A 3CESA 2K40A 1FBQA 3BROA 2X6XA 2J5OA 4AUXA 1WPKA 3LA3A 1T98A 1EH7A 3ZQHA 3ZGKA 4WF2A 2DAOA 2PG4A 2ZSHB 3N05A 3JAMZ 1HDDC 3OYLA 1S7AA 3GEZA 5L3GA 3RQ4A 1WJFA 3W6VA 3M8FA 2A6HF 3ONQA 3ZQ7A 4RB0A 1YW8A 5TJJA 3ZOBA 1EJ9A 2QZ8A 2V1XA 5FLVA 3MZYA 2VONA 1G2HA 2HYGD 5F1JA 1VNDA 1B72B 2X1DA 3DKWA 2HTJA 3WTXC 1ETWA 2JVGA 3HIFA 1D0YA 1RKTA 2ZFWA 2KLOA 3I0TA 2BYVE 4M71A 1D1BA 1DPRA 4EJWA 2XPUA 1IUYA 2OQRA 3PQJA 4LK0F 1W36C 1GXPA 4L9JA 3D5SC 2B63J 4UHTA 2Y0SA 3ABMH 3CLOA 2Q2EA 3G1LA 5FKLA 5J1UA 2DPUA 1HKTA 2QYOA 2V1DA 2VIXA 1VQMI 3O2PE 2MBFA 2CU7A 3OYAA 4XKVA 1SFKA 3FBIB 1Z91A 3EDPA 5FLXK 1XCBA 4XSZF 1O3RA 3CJNA 1A35A 3VPRA 2FNAA 2NXNB 4UVAA 2Z2SB 4LB5A 3HDDA 2LF7A 2JUCA 1QU3A 1W7PD 5K7FA 1JKRC 2GXGA 3I5UA 3WTYC 5JLWA 2Y0MA 1F1ZA 4HF1A 2E36A 3EUHC 5IYCJ 4L0ZB 4BJ6C 5J1YA 1JJ6C 2BVLA 2R7WA 3CDLA 3DEEA 1D5YA 4BY7J 4EMSA 2KDZA 2M30A 1Z77A 1K4TA 4UUVA 2QM3A 3R0AA 3FXLA 5D6FA 2ELKA 1ERDA 1H88C 2FOWA 4A3LJ 2JZYA 2WAQN 2XC7A 4G9YA 3FXOA 1OJLA 2ZMEB 2R5ZB 3OIQA 4XBFA 2YUSA 1YYVA 4OIQF 5E3OA 4M6YA 3U2RA 4S0HB 1POGA 3BR3A 4I01A 1HCRA 1QZZA 1NG7A 2JMWA 3H5RA 4UUTA 4YFKF 4RB1A 1FWZA 1CF7A 4LD5A 3TOAA 3ECOA 4LLGF 4DZPA 1I1GA 1I6XA 3K2AA 1WSUA 4KICA 3FX3A 4XRSG 3SJMA 1JTXA 1S5LC 3AG3H 5B3SH 3MKZA 4PGHA 3VDXA 5H20A 1Q1HA 5CJ9A 2FQ4A 3JRBA 1ORKA 1LDKB 2IA0A 3OYJA 3W2AA 5J40A 2DK8A 2IRFG 2CWEA 5IT9K 1LEAA 2V26A 1BC7C 4BL0B 3FIWA 2A68F 4JBAA 4MO7A 3WTUC 2BW3B 1H9TA 5HS8A 2COMA 1ODDA 3DPTA 2LK2A 1OCZH 2DDBA 5FKKA 5DV5A 1FSHA 3M1EA 5BMZA 3BPVA 1MSFC 1F43A 2EJRA 3QPHA 5HOOA 2YSRA 1ON2A 2WADA 3H3ZA 1XG1A 2QQ9A 3P9IA 5K5OA 3GO5A 2FMYA 2DJIA 3SYTA 2AO9A 3BG3A 3U1DA 3ULQB 1HBXG 3CCUI 2H8RA 3PSIA 4CH7A 1JGSA 1XN7A 3TMOA 1MW7A 3HKZA 1B8IB 1Z6RA 2ELJA 5J4YA 2DTRA 4RB3C 2GIVA 2W7NA 4BACA 4C9YA 5DM7F 4NDLA 3EUHA 1MMGA 4HW0A 4DYQA 1DP3A 4A0XA 1HW2A 4ENKA 5F6FA 4IO9F 3BCAA 3C1DA 5F0CA 1S9HA 2O5RA 3SQNA 1X1CA 1TT5B 2KT0A 1IGNA 1MMNA 5DD8A 4U0YA 1MKMA 4QPQA 2RVCA 3LL7A 4B09A 2VQCA 3LSRA 2O6GE 4XOTA 3S1NJ 5IP6A 4EGYA 1P6RA 4JX4A 4EJVA 3HOSA 2OD5A 1ZG1A 4CICA 2XRLA 4LGWA 4XN3A 4A6EA 1RUNA 3OWTA 3ZXSA 1WJCA 4W1UA 2ADUA 5EEGA 2FBIA 3S1MJ 1N25A 1R23A 3QQAA 3ABKH 4CXFA 5D5VB 4OIPF 2NNNA 1P7IA 1SVOA 3GFJA 1BI2A 1FMWA 1VZ0A 5EZGA 3WGHA 2KIMA 4NQWA 1AA7A 1IJWC 3I3LA 1O7FA 4L9VA 1P2FA 1GHCA 1LKXA 1IN6A 3O6BB 2CRGA 1ITYA 3K6GA 4C2TA 3B73A 4AU7A 4OWRB 4MEYF 3CMYA 1U78A 3GCMA 1AOYA 1X58A 4ZDOA 2MA3A 2W57A 4HOBA 2LBFB 1PP7U 5E17F 1AKHB 1NG6A 2DOEA 2LFBA 1T56A 1K4SA 1IN4A 3H1CA 4PJ0C 2BV6A 4PJMA 1E2XA 4ZDLA 3VSLA 5E18F 3CCEI 2GAUA 1H9GA 2O7OA 5BNGA 1B72A 3RZDJ 2HZDA 2MH9A 4DYRA 3U21A 1JKPC 4U7BA 3KLNA 2E2JJ 2VBWA 4CSWA 1D1AA 2DYSH 3E1SA 6PAXA 3GTJJ 2HS5A 3RPUD 3OS1A 2E5NA 5EF6A 4IQJA 2ZXHA 2HKXA 4KT6A 3KEYA 1ZRCA 1KQ8A 1FSEA 2X0LA 1WI3A 4XM3A 1OCTC 1RNLA 2Y30A 4QWQA 1P4WA 1G8XA 4IVNA 3HRUA 4WWCA 2ZNYA 4GFBA 1IRGA 3TKYA 2KRHA 3ASNH 1D5VA 1JTYA 2TRTA 3HTSB 2H27A 1BJZA 2H8WA 2X51A 1IRZA 1R4MB 3WTZA 3ELKA 3HSEA 1BI1A 4MNUA 4HNUA 1HKQA 1A04A 2M2EA 4AYBA 2VT3A 3ABLH 2R92J 2QENA 2L02A 3CJRB 4FQGA 2F5CA 3WTTC 3F8FA 5ILUA 2DFFA 2STTA 1NTCA 5JR3A 1IV6A 3KP3A 4RAYA 2IS4A 5GPAA 2EBIA 3WE3A 1QO0D 5CQEA 1I5ZA 1REPC 3CQZJ 1SVMA 3K4LA 5IY5H 2KRCA 1KGSA 3WTSC 2NS7A 2IT0A 1PUEE 1U8RA 3BTIA 1QRYA 3LWFA 4A3FJ 5BS6A 4LMYA 3CO6C 4D1QA 1X2NA 2ZMEA 1ZN2A 2P5KA 2R5ZA 5DUIA 3DXJF 4A3IJ 3BJ6A 5D5UB 3RKXA 2GIZA 3KE2A 3KZZA 4CCLA 3S93A 1XMKA 2LMDA 5LHIA 4ZTFA 3KP6A 2ZJ2A 3CC4I 4BBSJ 2H1KA 4OAYA 3NQOA 1FX7A 2ME0A 5JHFA 4HQEA 4LB6B 1LJ9A 4CCNA 4I0BA 1YHQI 2PBIA 4XQFA 1QZYA 2R4GA 3R61A 1GDTA 2PJPA 1J09A 5ILSA 2IGMA 3T8RA 1MMAA 3GZ6A 1VQ5I 3A02A 1MMDA 1Z67A 4YG2F 3HOZJ 1JUMA 2JPBA 2OAZA 3GTMJ 2BVMA 1WGXA 2CW0F 2RQQA 1D0XA 4ZH4F 3S2WA 3CCLI 4N4OB 3CF2A 1WJAA 4FX0A 2JPCA 3ZQCA 3CD6I 4KMFA 5LLQA 2UV1A 1FNNA 2WA0A 5FD5A 1FTTA 2CW7A 3JRHA 1N77A 2ME6A 5D4RA 3HL2A 1J0RA 1I1SA 2BW3A 2KZVA 4E7SA 2DTZA 3ZR8X 4E7LA 5EEHA 2A6TA 2ESHA 2DA6A 1TWHJ 3Q5FA 4HRIA 4FE4A 5FLMJ 1YFHA 3SZTA 4LG3A 2E34A 5IYBJ 3BR0A 2DT5A 2IS2A 1WWXA 4Y33A 2HOEA 3VEPA 2BY2A 1B6AA 2EZKA 2VE8A 3WE2A 1MGTA 4A0ZA 1IUFA 1ACIA 1X3UA 1T39A 3FBNB 1YIOA 3QODA 2VBYA 4ESBA 1SD4A 4FASD 1B8IA 1R1UA 2KJCA 3ECHA 2PFBA 4G6DA 4UUSB 3H3UA 5CPRB 4E4HA 1HF0A 2KQRA 4XIDA 2IS1A 1OR7C 2IP2A 3EYIA 2X1CA 5A2QZ 2K7LA 4ESJA 4M74A 1HLVA 1T0FC 1JXSA 1XGSA 2IXSA 1RC9A 2X4HA 1P7JA 4B3AA 3K4BA 2QEXI 1U3EM 1IDZA 2VKHA 3RYRA 2A5WA 5GTIC 3AG2H 4HQMA 2Z9OA 2M9HA 2MD0A 3MZ8A 2HR3A 3CCJI 4YIIA 3V8KA 4HNVA 4NC8A 4PFOA 3BZKA 4GDFA 4GYIA 1UELB 1LFUP 1BC8C 3V7RA 2IGOA 4D5FA 1FYLA 3K4MA 3RPUA 2CUJA 2RNGA 4HSRA 1JHHA 4A0YA 2CO5A 4XK4A 2JA5J 1O7LA 1IRXA 1KYWA 1MJAA 5FKOA 3TQNA 4AIDA 3V42A 4J19A 2X6WA 1VQPI 4UB8C 2CS3A 1WCMJ 4HZFA 4HEA2 2K4BA 4XNFA 2NOGA 4BJ5C 1YITI 3HSFA 2IA2A 4L9TA 2DW4A 2ELHA 4F52A 2Z5UA 2R7UA 4G6QA 2LC2A 2WAFA 1JT0A 1EA3A 3LOCA 1ETVA 1P92A 3D5LA 1VQ9I 2LBFA 1AKHA 2PMZN 2UXNA 3GVAA 4A3BJ 1XGMA 4BQQA 3OL4A 4IPAA 1FYKA 1G3YA 3B6CA 4LIVA 4CYCB 2CQXA 2CG4A 1ZAOA 4DQ2A 1MSEC 1SD6A 1USSA 4U7DA 2EZLA 4CCKA 1FIAA 2JN6A 2IJLA 2D1VA 4II3A 4AVZA 4QIWN 3HGYA 3KYDB 1Z3YA 2H6BA 3T5XA 1BR4A 1HOMA 5B1BH 3QOPA 1S7OA 2OA4A 3IRQA 1T38A 3OS2A 3IL2A 1MBFA 2QSFX 3E7LA 5L3FA 2L9NA 3J80Z 1FOWA 2CJJA 1YI2I 4RDUA 3HOUJ 4EGZA 3OIPA 2AXLA 2A69F 4PJLA 3QU3A 2VPLA 1V4RA 4II2A 5IP7J 2L2OA 3WGGA 1NH3A 4UV9A 3L2WA 1ETYA 4D9JA 3KZIC 4EM1A 2HZTA 1LVKA 3H0DA 2UWMA 5EGOB 1SD7A 2YR2A 4FX4A 5ILVA 2VT2A 3FMSA 2UUZA 2TCTA 4PK4A 2VKDA 5EEAA 3QPTA 1R5GA 2G0EA 2KHMA 1T0FA 3V8LA 3NRVA 4B4CA 2IPQX 2VJIA 5DM6F 1NK3P 3O8HA 4F7ZA 1LFBA 4NB5A 2VOOA 2OU2A 1PVEA 5HLIA 5LGUA 3CMAI 3WODF 3QWLA 2HQNA 4GXOA 2MABA 3RSNA 3MKWB 3LSPA 2I5UA 3M3YJ 5M5YJ 3H5AA 4YELA 3DPUA 1NK2P 5J4VA 5FB2A 2R7VA 4IRHA 1FOXA 3DLAA 1VFCA 2NYXA 1DP7P 3OL3A 2A05A 3B6AA 1ON1A 4ON0A 2GWRA 1HA8A 1ZELA 3F6VA 4AVPA 2P7CB 1SMTA 5ICFA 4FCYA 2DMQA 1YJWI 2DA2A 3HOVJ 1CGPA 3Q3SA 4RGSA 1MJ9A 3PL8A 2BXYA 4EVIA 2NRAC 3PNYA 2DLLA 2ZB9A 1XDUA 3GTQJ 5M3MJ 4ZYHA 3VFZA 5DCMA 1XX5A 1Z05A 4I0AA 4ENMA 5B1AH 3H9JA 3RYPA 1ZHFA 3T1BA 4K2EA 3WTVC 3TGNA 3RJPA 4IHWA 3P5JA 2ZSIB 1TLHB 2DA3A 1ULYA 2P6SA 1FZPB 3HYIA 3QP6A 2FA5A 2HVRA 5C44J 1J59A 2LF8A 4HX4A 4PFPA 2XAQA 5J8FA 2IS6A 3ABTA 4RM2A 2HWVA 3QU6A 3J81Z 3K1PA 4IJAA 3J7AY 1WHUA 2VLAA 1IN5A 5K7HA 1WH7A 3KYLA 3K1MA 2V79A 5C4JJ 4HYEA 3LAPA 2YS9A 1ZKGA 4XR6A 3S2DJ 4DW6A 4GYGA 4A3JJ 3S3NA 1ZQ3P 2RQPA 1FT9A 3KCCA 1B4AA 3ZQFA 2NAZA 3D0SA 2FRHA 3Q0VA 1RI7A 2E1OA 2VQLA 1HW5A 2Q1ZB 4RMNA 2XGCA 4A6DA 5DDGA 5J1RA 3DLLF 4G7HF 3L7WA 4JYKA 3Q9VA 1W7PB 1B9MA 4PSXA 1ZRDA 4OMYA 4C3HJ 2HXOA 5TGTA 4Q47A 1IV8A 5LRSA 4UUSA 5EZHA 2DMTA 2PMUA 4GO1A 3BT9A 3DU5A 2EIJH 1BR1A 1WFXA 3I64A 3M9AA 2DMUA 3S2HJ 3N97A 4XLEA 2R7SA 5F27A 4J00A 1I3QJ 2O61A 1MIJA 3ERED 4Y52J 3WHBA 3S8PA 5FROA 4IKFA 3K2ZA 2FD5A 2H94A 3OS0A 2XRNA 3HOTA 1JJ8C 1YX3A 3G71I 2PX9A 3DTIA 4BHPA 3HOXJ 2EINH 1YIJI 1A31A 4HLYA 2P5VA 5BPDA 3CDIA 1FLIA 2VASA 3V8JA 3A1YA 2CUZA 2D5VA 1XB4A 2E1NA 2QSGX 2VXDA 2KDOA 3K1NA 5HODA 1UAAA 2PEXA 1V5GA 2EQRA 3KZYA 2HGCA 3JCUC 1ZTRA 2DQRA 4HNTA 3ZMVA 3DWLE 1Z7UA 4XLAA 2CV1A 2EB7A 3WHCA 5GADJ 1BW6A 3KP5A 4C30A 3JRGA 4RGUA 1YJ9I 2EILH 2X48A 3SXYA 1UMQA 1WH5A 4F92B 1Z7LA 1Y39A 2VJ4A 4ETSA 4ZZLA 1K61A 2HYFA 1D1CA 3CDHA 3M07A 3RCOA 4BE2A 1S6LA 3DTKA 4IQ4A 5HDKA 4ENNA 2JA2A 4CYCA 3H0GJ 2M5WA 3WG7H 1TTYA 1RR7A 3E5UA 3CP2A 3VSKA 4ZYDA 3V4GA 1R5HA 1OFCX 1MBEA 2FOKA 4CZCA 3IAM2 1X2MA 2F6CA 1IC8A 2RC4A 1TWAJ 3BZ6A 3IHUA 3TW6A 2HVSA 4DOZA 1G3TA 5E1XA 1L3LA 4OIRF 2ESNA 5E20A 2ICWG 3E5QA 3OR1C 4BEHA 3DTEA 4ITVA 4XN0A 5B66C 3GTOJ 5D8LB 2XGEA 3IH4A 3IWZA 1YG2A 4I7HA 2F5VA 3WU0A 5F0FA 5F64A 3K4KA 2BXZA 3CZ6A 3LAJA 4L9NA 2L9VA 1EKEA 2WAQA 3BR1A 3H35A 2WAEA 1BOAA 2ISZA 1M1EB 3TO7A 1OLTA 1G3WA 2BHYA 1MBHA 2XF7A 4KMUX 3ZMSA 1SAXA 3GTPJ 1UFMA 5EGOA 2QQBA 2DYRH 1IXRC 5LGTA 2HTSA 3KX2A 2OBPA 1GUUA 3O3KA 2MH2A 3O8GA 4IHYA 3MAJA 2EFQA 3K70D 2K9LA 2VBXA 2QA4I 5E1WA 1IZ1A 4ZYAA 4LOCA 5L3DA 3UNGC 4CCJA 2L0KA 1QBJA 5HNFA 3L1PA 1IRFA 1HKSA 3RKWA 2ZFUA 3L9FA 2R7ZJ 2QQ8A 3GMEA 2KIQA 2DA4A 3KIOA 2ACJA 4U87A 1XS9A 2M7BA 3PSFA 1UG2A 2I10A 4BQOA 1XC5A 4Y15A 3HKZN 5J6XA 4YIRX 1ZR2A 3MKYB 4IOAF 2HYJA 4CZZA 2Y69H 2VI6A 5D8KB 3DEWA 2HEOA 3ZPLA 3CUQB 2J5PA 4KISA 2XDVA 1I6HJ 3L2QA 3E6CC 1IN7A 1QQIA 2K9NA 3VYSB 1YLFA 1SVLA 5JHUA 2A6EF 4Q48A 3FF5A 2LYCA 1B59A 2RAEA 4UXNA 5HDNA 4A3EJ 4BE1A 2V7FA 4LIUA 1VQKI 1R71A 4N4NB 3SFIA 3KEOA 2F4OB 1ZREA 4MTDA 1QVUA 3WG9A 3HHGA 3K70C 3CCMI 2VB6A 5AONA 5L3BA 2C6YA 4A93J 5CYVA 2CQ7A 2Y48A 2LKPA 1IDYA 2VUMJ 1DGRM 5HLHA 1JT6A 2LKXA 3CCVI 4I6ZA 3PO3J 3WU2C 1JGGA 5LEJA 2HOTA 4LJZF 3QYBA 2K86A 3OSGA 3W6KB 4XLNF 2WB1N 1MBKA 3LA2A 2TDXA 3J7ZI 4D5CA 4CA0A 3FHNA 2VBZA 1Y1VJ 2LDUA 2M4GA 3M4OJ 3D5RC 4RM3A 5L3CA 5FRMA 2H6CA 4Q4ZF 2LREA 2RGVA 3BZCA 1WVRA 2LD5A 2ECBA 3J7AO 2OZ6A 3CC7I 1HDPA 1W7PA 1USTA 1MNMC 3GLXA 3K7AJ 2BEOA 3K4JA 2CQKA 1R6RA 2ZBKA 1R7JA 4BY1J 3ZMTA 3OV8A 2KP6A 1OCOH 1WJBA 3LSHA 4C3JJ 4V2FA 1RETA 2EIKH 4A3KJ 1CQTA 1IG7A 2X6YA 3WTWC 1A6IA 4PJJA 1R1TA 1TQPA 1DPUA 3ZN0A 4MFEA 1AWCA 5KVRA 2FF4A 5FLXZ 1U5TB 1V3FA 3TO6A 3ZMUA 2GA1A 5GAGJ 1OISA 2R0QC 2VQGA 2LLKA 3GTLJ 1MMSA 1Z21A 1ZG5A 2R5YB 4G7OF 2CMPA 1AHDP 5IOYA 4ZC3A 2MW8A 5BPIA 2EA4A 4LLLA 4BHCA 1TC3C 1DGWY 4YFNF 2QGUA 2Y31A 1XGNA 5FO5A 3ZMZA 1S72I 2DI3A 2LSOA 1B1BA 3K69A 4A69C 1H0MA 1KQ9A 1MD0A 1IXCA 4B44A 3G3ZA 2XPWA 3CUQC 4S05A 1ZGWA 4M6XA 3SZGA 2WWYA 1VQ4I 4IHTA 1E3HA 3F21A 3ABUA 3IP4B 5CVUA 1BJAA 4XLHA 2JA8J 5AIPA 3TW7A 2VJ5A 2CSOA 1SEUA 3FXRA 2XAGA 3LSKA 3GFLA 4BXFA 1OKRA 1TP4A 4V2GA 2HPIA 3CMEI 3BQZA 4M9SA 4Y3OA 3OYBA 2ZC2A 2XAJA 3ZN1A 3OYEA 4A12A 3TEDA 3RZOJ 1D0ZA 4M9ZA 1Y8QB 1YOVB 4WX9A 3PJRA 3G73A 5AIQA 1ETKA 3I59B 2K3PA 4UVCA 1OCPA 1K79A 4YRVA 3DFGA 4BXUA 2LH9A 2QBYB 1APLC 3BR5A 5ED4A 1OCCH 4AM3A 2F5FA 1Z1DA 4OIOF 3H5NA 4MQVA 1TQIA 5IT9Z 2K02A 4I09A 1VQ8I 4H4KC 5CVVA 2M1BA 4G94A 4XORA 1XPXA 3SFZA 2OPTA 3MEXA 2NS0A 4NUBA 3F22A 4P96A 2HVQA 2LTPA 2P8TA 2D1HA 3BC8A 2ZCWA 1LEBA 3OYMA 3JREA 1PJRA 4KN4X 3M7GA 3C18A 3E97A 2F5EA 3FMQA 4XRFA 3GUDA 2FBKA 3RQIA 1GV5A 4C3IJ 3I56I 1U5TC 3JTHA 1KU7A 3KP2A 2QQAA 3LQRA 2NNYA 5HLTA 2EPFA 4AC0A 2CV2A 3OOPA 2LNBA 1W5CC 4O5VA 4OU0A 2K85A 3FMRA 3TL4X 4ABZA 2E5ZA 1PYVA 2CFOA 5CVJA 3ZQLA 2HI3A 1R58A 4D7MA 2HDCA 3FKJA 4ZYEA 2RNJA 1X4PA 3A03A 1KU3A 2MLGA 3F8NA 3OY9A 3I55I 2L7MP 5KNLA 4CGZA 2CUFA 1MNDA 1JE8A 4HA8A 5EYRA 1L0OC 3A4CA 5FJ8J 5K5QA 4C2UA 2A07F 3ZRGA 3F3XA 1HW1A 2WC2A 2DA1A 4IRGA 1Z3XA 4IF4A 3OSFA 3CUQA 2ECCA 1VF9A 1SAUA 2KMUA 1W1WE 2GOMA 3EPZA 4BQAA 1KU2A 4E7HA 2GXAA 4HF2A 3UKGA 1S29A 2IGKA 1O3SA 5JI6A 5H6QA 2R7QA 1ZYRF 2E7XA 1X4OA 9ANTA 3HJEA 3DBRB 3KP4A 4HDVA 3HEFA 4BDYA 4MEXF 2A3SA 3DQVC 1Y8RB 2OUMA 4ENJA 3K4CA 2CH0A 4EJTA 2E19A 2VOPA 4E70A 2O3FA 1N78A 1D3YA 1F5TA 1XMAA 4UNOA 3F23A 1U9NA 1IO2A 3JSOA 3HBLA 1T33A 1K78B 4HF0A 1YJNI 4MIMA 3A0HC 3SZPA 3PNVA 2Z99A 3OIOA 4KN7X 3NARA 4B43A 1TWCJ 2L4AA 1XTAA 4BNCA 1YX5A 4KYWA 1W5TA 1FP1D 4RBOA 2ZJPF 3LMMA 2VODA 2M8EA 1K83J 2UXXA 3AG1H 4RLQA 5BQTA 3IV5A 3JAMK 1LDJA 5D6EA 1ZARA 1BN5A 2BY0A 1HC8A 1XSXA 4CDGA 2L9SA 3G1OA 1RR8C 2XB5A 3FKIJ 4BAYA 1IW7F 3AL0B 2QKMB 3V7CA 5IP9J 3LA7A 3BR2A 4E7ZA 3PQKA
chains in the Genus database with same CATH topology
2LK2A 5J1RA 5FKKA 4JYKA 2MSYA 1MSFC 1F43A 4C3HJ 2HXOA 2X6OA 2XGDA 1XG1A 4M3FA 3OOUA 4UUSA 5EZHA 2DMTA 3BT9A 2AO9A 3BG3A 3S2HJ 2DMUA 3Q0WA 2H8RA 3HOYJ 2Y9ZA 5F27A 2FJ1A 2R5YA 1I3QJ 1B8IB 4Y52J 3WHBA 1ZR4A 1F36A 2EZHA 2FD5A 1JJ8C 3F0CA 2W48A 4NDLA 3DCFA 3HOXJ 1GVDA 4DYQA 5DTDA 1DU6A 2GM4A 5F0CA 3C2BA 5JLXA 2D5VA 1MBJA 1UHSA 4M3DA 4W97A 2GLOA 2IAIA 2KT0A 1H8AC 1IGNA 5K7ZA 5HODA 2EQRA 2MGQA 2LVSA 2O8KA 4IHXA 3LSRA 2IEKA 1ZTRA 3S1NJ 5IP6A 4JX4A 4MLOA 1FTZA 3JR9A 2XRLA 3Q0UA 1A5JA 2HOAA 3FK6A 3WHCA 4W1UA 3GTKJ 1BW6A 3S1MJ 3JRGA 3QQAA 5F0HA 1P7IA 5EZGA 2LY9A 2COBA 2X48A 1IJWC 3HOWJ 1UMQA 1WH5A 2LP0A 4DYCA 2CRGA 1PUFA 1K61A 1ITYA 1LE8B 2NVTJ 1H89C 3CMYA 1U78A 4IHVA 2L7ZA 4CYCA 1X58A 3H0GJ 5M5WJ 3PM1A 1RR7A 1AKHB 1YRNA 3NAUA 2LFBA 1T56A 2OF7A 1OFCX 1MBEA 2N8GA 2ID6A 1X2MA 2IBDA 3ZQGA 1IC8A 1R9TJ 3TW6A 1TWAJ 2O7OA 4FISA 5BNGA 1B72A 3RZDJ 2CQQA 4DYRA 1JKPC 2DN0A 2E2JJ 4A3MJ 2DA5A 5J3LA 2XSDC 3GTOJ 4QSHA 1JKOC 1SANA 2XGEA 3IH4A 2HQ5A 3GTJJ 2XB0X 1TWGJ 3I4MJ 3GBGA 5F0FA 2CUEA 3TP3A 1MBGA 2VKVA 5EF6A 3GTGJ 1FIPA 3BR1A 5E3LA 1S7EA 3SDGA 3BTLA 1MBHA 1WI3A 1OCTC 2Y30A 3GTPJ 4I76A 3A01A 2L9RA 2HDDA 5EGOA 4GFBA 1U8BA 3FK7A 1JTYA 2TRTA 3JRDA 2FX0A 5DS9A 1BJZA 1GUUA 1IRZA 3BG5A 3O8GA 4IHYA 2GBYA 3H3VK 4JX6A 2M2EA 4LOCA 2VPRA 2R92J 5FKMA 2L0KA 3BTJA 4C2MJ 1Q1VA 4B1RA 4DZJA 3L1PA 2XPVA 1TWFJ 2R7ZJ 4BXXJ 2DA4A 1NTCA 1XS9A 1IV6A 5GPAA 2EBIA 1UG2A 2I10A 3CQZJ 3FISA 1XC5A 2NS7A 3HKZN 5EDNA 3JRIA 1ZR2A 1GV2A 3BTIA 1QRYA 2HYJA 4A3FJ 2VI6A 3DEWA 1W0UA 1U9OA 2DMPA 2WV1A 1I6HJ 3BR6A 2QF7A 3BG9A 1X2NA 2R5ZA 1AU7A 2K9NA 4A3IJ 2QCOA 3MKLA 4EEFG 4IEJA 2RAEA 4BBSJ 3PO2J 4A3EJ 2Y0SN 2H1KA 3QPLA 2ME0A 3LSJA 5F08A 3S1RJ 2NS8A 3SFIA 1GDTA 1QVUA 3A02A 1ETOA 4A3CJ 3HOZJ 1JUMA 4A93J 3GTMJ 1WGXA 1IDYA 3S17J 2VUMJ 1JT6A 2HXIA 2X9DA 2LKXA 3PO3J 4I6ZA 1JGGA 3RKQA 4M6VA 2HOTA 2LR8A 2DA7A 3ZQCA 4A3GJ 1MH3A 3OSGA 2WB1N 1MBKA 3LNQA 1EF4A 4D5CA 1FTTA 3JRHA 1FEXA 1Y1VJ 2ME6A 4XRSA 3M4OJ 1QPIA 1VI0A 2DTZA 5EG0A 2LD5A 2DA6A 4FE7A 2ECBA 1TWHJ 1HDPA 4FE4A 5IYDJ 5FLMJ 2M8GX 5M3FJ 5IYBJ 1MNMC 3BR0A 3K7AJ 2E2IJ 4BY1J 2EZKA 1IUFA 3I4NJ 1W0TA 1QVTA 1ZK8A 4C3JJ 3D1NI 4V2FA 1RETA 4A3KJ 1CQTA 1IG7A 1A6IA 3MVPA 3ZQIA 1B8IA 1SFOJ 4MFEA 4UUSB 2E2HJ 1Y1WJ 1HF0A 4XIDA 4A3DJ 1FJLA 2R0QC 4Y7NJ 4XICA 1DU0A 1HLVA 2LLKA 3GTLJ 1P7JA 2R5YB 4B3AA 4G12A 2HOSA 1AHDP 1IDZA 4M3BA 5IOYA 1BA5A 2MW8A 1TC3C 3S14J 2R93J 3G1MA 4XRMA 2M9HA 2Y31A 2NVQJ 1MH4A 4A69C 4BKXA 4HNVA 4X6AJ 4MFDA 2XPWA 1LFUP 1ZGWA 4M3GA 4D5FA 1I50J 2EZIA 3CCYA 2P81A 2JA8J 3IH3A 4XK4A 2JA5J 2K9QA 2JJ7A 5FKOA 3TW7A 4J19A 2MG4A 2JA7J 1WCMJ 4BBRJ 3S1QJ 2L7FP 4V2GA 2NOGA 5C4XJ 3BQZA 1BW5A 1LE8A 4L5EA 3S16J 1Z0XA 3TEDA 3RZOJ 3QPSA 1RKWA 1JT0A 2NVXJ 3LOCA 2DJNA 1ETVA 4FTHA 2K40A 1ETKA 3MN2A 1AKHA 2PMZN 4A3BJ 2M34A 1OCPA 1PUFB 3BTCA 4AUXA 1WPKA 1ENHA 1APLC 3ZQHA 3BR5A 3B6CA 1ETQA 4CYCB 2CQXA 3JRCA 1MSEC 2EZLA 1HDDC 3IH2A 1FIAA 2JN6A 3W6VA 1YRNB 4QIWN 3TP0A 3HGYA 3ZOBA 5FLVA 1G2HA 5E3NA 5F1JA 4JX5A 1HOMA 1O4XA 1VNDA 1B72B 2OPTA 1ETWA 1RKTA 2LTPA 1MBFA 3E7LA 3HOUJ 2CJJA 2DMNA 4RDUA 3JREA 2XPUA 2Y9YA 5IP7J 2B63J 5FKLA 3RQIA 3G1LA 5J1UA 1GV5A 4C3IJ 1ETYA 5IPAA 4M3EA 2CU7A 3A01B 3HGGA 4AC0A 5EGOB 4ABZA 2TCTA 5EEAA 5E3MA 2EH3A 2G0EA 3VPRA 3ZQLA 2HI3A 1GT0C 4D7MA 3HM5A 4B4CA 3HDDA 3BQYA 1NK3P 5K7FA 1JKRC 3O8HA 1JUSA 3A03A 2YU9J 5JLWA 4D7NA 1LFBA 2ID3A 2L7MP 2CUFA 1BL0A 2JK3A 5EYRA 5IYCJ 5FJ8J 5M5XJ 3S15J 2DA1A 2K9SA 3LSPA 3M3YJ 5M5YJ 5J1YA 1JJ6C 3OSFA 1NK2P 1JUPA 1RESA 2ECCA 3CDLA 1VF9A 1D5YA 4BY7J 2AHQA 1VFCA 2KDZA 2Y2ZA 2O9LA 1Z77A 3B6AA 2ELKA 3UKGA 1H88C 4A3LJ 2M0CA 9ANTA 2WAQN 4FCYA 2DMQA 1OJLA 2DA2A 3HOVJ 3HEFA 3HB9A 3Q3SA 4JP0A 2R5ZB 2YUSA 4QTRA 2ZB9A 5E3OA 5C3EJ 3GTQJ 5M3MJ 1RPWA 4S0HB 2E19A 1POGA 3JRAA 3BR3A 4X1EA 1HCRA 3LSGA 1U9NA 5IOZA 4IHWA 5F04A 3HBLA 1T33A 2JMWA 4UUTA 4AYBN 2DA3A 4MIMA 4DZPA 3OIOA 3K2AA 3NARA 4XRSG 5C44J 3SJMA 1JTXA 1TWCJ 2VKEA 1ETXA 4RBOA 5FKNA 2FQ4A 3JRBA 1ORKA 1JKQC 1K83J 5GPCA 3IV5A 1E3OC 5K7HA 1WH7A 2JWTA 5C4JJ 2JA6J 2YS9A 1ZKGA 3FIWA 4DW6A 3S2DJ 4A3JJ 1ZQ3P 3JRFA 3G1OA 4MO7A 2XB5A 3FKIJ 3ZQFA 3Q0VA 5EG0B 2NVYJ 2E1OA 5IP9J 3BR2A 2XGCA 5GP9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LK2 A;  5J1R A;  5FKK A;  4JYK A;  2MSY A;  1MSF C;  1F43 A;  4C3H J;  2HXO A;  2X6O A;  2XGD A;  1XG1 A;  4M3F A;  3OOU A;  4UUS A;  5EZH A;  2DMT A;  3BT9 A;  2AO9 A;  3BG3 A;  3S2H J;  2DMU A;  3Q0W A;  2H8R A;  3HOY J;  2Y9Z A;  5F27 A;  2FJ1 A;  2R5Y A;  1I3Q J;  1B8I B;  4Y52 J;  3WHB A;  1ZR4 A;  1F36 A;  2EZH A;  2FD5 A;  1JJ8 C;  3F0C A;  2W48 A;  4NDL A;  3DCF A;  3HOX J;  1GVD A;  4DYQ A;  5DTD A;  1DU6 A;  2GM4 A;  5F0C A;  3C2B A;  5JLX A;  2D5V A;  1MBJ A;  1UHS A;  4M3D A;  4W97 A;  2GLO A;  2IAI A;  2KT0 A;  1H8A C;  1IGN A;  5K7Z A;  5HOD A;  2EQR A;  2MGQ A;  2LVS A;  2O8K A;  4IHX A;  3LSR A;  2IEK A;  1ZTR A;  3S1N J;  5IP6 A;  4JX4 A;  4MLO A;  1FTZ A;  3JR9 A;  2XRL A;  3Q0U A;  1A5J A;  2HOA A;  3FK6 A;  3WHC A;  4W1U A;  3GTK J;  1BW6 A;  3S1M J;  3JRG A;  3QQA A;  5F0H A;  1P7I A;  5EZG A;  2LY9 A;  2COB A;  2X48 A;  1IJW C;  3HOW J;  1UMQ A;  1WH5 A;  2LP0 A;  4DYC A;  2CRG A;  1PUF A;  1K61 A;  1ITY A;  1LE8 B;  2NVT J;  1H89 C;  3CMY A;  1U78 A;  4IHV A;  2L7Z A;  4CYC A;  1X58 A;  3H0G J;  5M5W J;  3PM1 A;  1RR7 A;  1AKH B;  1YRN A;  3NAU A;  2LFB A;  1T56 A;  2OF7 A;  1OFC X;  1MBE A;  2N8G A;  2ID6 A;  1X2M A;  2IBD A;  3ZQG A;  1IC8 A;  1R9T J;  3TW6 A;  1TWA J;  2O7O A;  4FIS A;  5BNG A;  1B72 A;  3RZD J;  2CQQ A;  4DYR A;  1JKP C;  2DN0 A;  2E2J J;  4A3M J;  2DA5 A;  5J3L A;  2XSD C;  3GTO J;  4QSH A;  1JKO C;  1SAN A;  2XGE A;  3IH4 A;  2HQ5 A;  3GTJ J;  2XB0 X;  1TWG J;  3I4M J;  3GBG A;  5F0F A;  2CUE A;  3TP3 A;  1MBG A;  2VKV A;  5EF6 A;  3GTG J;  1FIP A;  3BR1 A;  5E3L A;  1S7E A;  3SDG A;  3BTL A;  1MBH A;  1WI3 A;  1OCT C;  2Y30 A;  3GTP J;  4I76 A;  3A01 A;  2L9R A;  2HDD A;  5EGO A;  4GFB A;  1U8B A;  3FK7 A;  1JTY A;  2TRT A;  3JRD A;  2FX0 A;  5DS9 A;  1BJZ A;  1GUU A;  1IRZ A;  3BG5 A;  3O8G A;  4IHY A;  2GBY A;  3H3V K;  4JX6 A;  2M2E A;  4LOC A;  2VPR A;  2R92 J;  5FKM A;  2L0K A;  3BTJ A;  4C2M J;  1Q1V A;  4B1R A;  4DZJ A;  3L1P A;  2XPV A;  1TWF J;  2R7Z J;  4BXX J;  2DA4 A;  1NTC A;  1XS9 A;  1IV6 A;  5GPA A;  2EBI A;  1UG2 A;  2I10 A;  3CQZ J;  3FIS A;  1XC5 A;  2NS7 A;  3HKZ N;  5EDN A;  3JRI A;  1ZR2 A;  1GV2 A;  3BTI A;  1QRY A;  2HYJ A;  4A3F J;  2VI6 A;  3DEW A;  1W0U A;  1U9O A;  2DMP A;  2WV1 A;  1I6H J;  3BR6 A;  2QF7 A;  3BG9 A;  1X2N A;  2R5Z A;  1AU7 A;  2K9N A;  4A3I J;  2QCO A;  3MKL A;  4EEF G;  4IEJ A;  2RAE A;  4BBS J;  3PO2 J;  4A3E J;  2Y0S N;  2H1K A;  3QPL A;  2ME0 A;  3LSJ A;  5F08 A;  3S1R J;  2NS8 A;  3SFI A;  1GDT A;  1QVU A;  3A02 A;  1ETO A;  4A3C J;  3HOZ J;  1JUM A;  4A93 J;  3GTM J;  1WGX A;  1IDY A;  3S17 J;  2VUM J;  1JT6 A;  2HXI A;  2X9D A;  2LKX A;  3PO3 J;  4I6Z A;  1JGG A;  3RKQ A;  4M6V A;  2HOT A;  2LR8 A;  2DA7 A;  3ZQC A;  4A3G J;  1MH3 A;  3OSG A;  2WB1 N;  1MBK A;  3LNQ A;  1EF4 A;  4D5C A;  1FTT A;  3JRH A;  1FEX A;  1Y1V J;  2ME6 A;  4XRS A;  3M4O J;  1QPI A;  1VI0 A;  2DTZ A;  5EG0 A;  2LD5 A;  2DA6 A;  4FE7 A;  2ECB A;  1TWH J;  1HDP A;  4FE4 A;  5IYD J;  5FLM J;  2M8G X;  5M3F J;  5IYB J;  1MNM C;  3BR0 A;  3K7A J;  2E2I J;  4BY1 J;  2EZK A;  1IUF A;  3I4N J;  1W0T A;  1QVT A;  1ZK8 A;  4C3J J;  3D1N I;  4V2F A;  1RET A;  4A3K J;  1CQT A;  1IG7 A;  1A6I A;  3MVP A;  3ZQI A;  1B8I A;  1SFO J;  4MFE A;  4UUS B;  2E2H J;  1Y1W J;  1HF0 A;  4XID A;  4A3D J;  1FJL A;  2R0Q C;  4Y7N J;  4XIC A;  1DU0 A;  1HLV A;  2LLK A;  3GTL J;  1P7J A;  2R5Y B;  4B3A A;  4G12 A;  2HOS A;  1AHD P;  1IDZ A;  4M3B A;  5IOY A;  1BA5 A;  2MW8 A;  1TC3 C;  3S14 J;  2R93 J;  3G1M A;  4XRM A;  2M9H A;  2Y31 A;  2NVQ J;  1MH4 A;  4A69 C;  4BKX A;  4HNV A;  4X6A J;  4MFD A;  2XPW A;  1LFU P;  1ZGW A;  4M3G A;  4D5F A;  1I50 J;  2EZI A;  3CCY A;  2P81 A;  2JA8 J;  3IH3 A;  4XK4 A;  2JA5 J;  2K9Q A;  2JJ7 A;  5FKO A;  3TW7 A;  4J19 A;  2MG4 A;  2JA7 J;  1WCM J;  4BBR J;  3S1Q J;  2L7F P;  4V2G A;  2NOG A;  5C4X J;  3BQZ A;  1BW5 A;  1LE8 A;  4L5E A;  3S16 J;  1Z0X A;  3TED A;  3RZO J;  3QPS A;  1RKW A;  1JT0 A;  2NVX J;  3LOC A;  2DJN A;  1ETV A;  4FTH A;  2K40 A;  1ETK A;  3MN2 A;  1AKH A;  2PMZ N;  4A3B J;  2M34 A;  1OCP A;  1PUF B;  3BTC A;  4AUX A;  1WPK A;  1ENH A;  1APL C;  3ZQH A;  3BR5 A;  3B6C A;  1ETQ A;  4CYC B;  2CQX A;  3JRC A;  1MSE C;  2EZL A;  1HDD C;  3IH2 A;  1FIA A;  2JN6 A;  3W6V A;  1YRN B;  4QIW N;  3TP0 A;  3HGY A;  3ZOB A;  5FLV A;  1G2H A;  5E3N A;  5F1J A;  4JX5 A;  1HOM A;  1O4X A;  1VND A;  1B72 B;  2OPT A;  1ETW A;  1RKT A;  2LTP A;  1MBF A;  3E7L A;  3HOU J;  2CJJ A;  2DMN A;  4RDU A;  3JRE A;  2XPU A;  2Y9Y A;  5IP7 J;  2B63 J;  5FKL A;  3RQI A;  3G1L A;  5J1U A;  1GV5 A;  4C3I J;  1ETY A;  5IPA A;  4M3E A;  2CU7 A;  3A01 B;  3HGG A;  4AC0 A;  5EGO B;  4ABZ A;  2TCT A;  5EEA A;  5E3M A;  2EH3 A;  2G0E A;  3VPR A;  3ZQL A;  2HI3 A;  1GT0 C;  4D7M A;  3HM5 A;  4B4C A;  3HDD A;  3BQY A;  1NK3 P;  5K7F A;  1JKR C;  3O8H A;  1JUS A;  3A03 A;  2YU9 J;  5JLW A;  4D7N A;  1LFB A;  2ID3 A;  2L7M P;  2CUF A;  1BL0 A;  2JK3 A;  5EYR A;  5IYC J;  5FJ8 J;  5M5X J;  3S15 J;  2DA1 A;  2K9S A;  3LSP A;  3M3Y J;  5M5Y J;  5J1Y A;  1JJ6 C;  3OSF A;  1NK2 P;  1JUP A;  1RES A;  2ECC A;  3CDL A;  1VF9 A;  1D5Y A;  4BY7 J;  2AHQ A;  1VFC A;  2KDZ A;  2Y2Z A;  2O9L A;  1Z77 A;  3B6A A;  2ELK A;  3UKG A;  1H88 C;  4A3L J;  2M0C A;  9ANT A;  2WAQ N;  4FCY A;  2DMQ A;  1OJL A;  2DA2 A;  3HOV J;  3HEF A;  3HB9 A;  3Q3S A;  4JP0 A;  2R5Z B;  2YUS A;  4QTR A;  2ZB9 A;  5E3O A;  5C3E J;  3GTQ J;  5M3M J;  1RPW A;  4S0H B;  2E19 A;  1POG A;  3JRA A;  3BR3 A;  4X1E A;  1HCR A;  3LSG A;  1U9N A;  5IOZ A;  4IHW A;  5F04 A;  3HBL A;  1T33 A;  2JMW A;  4UUT A;  4AYB N;  2DA3 A;  4MIM A;  4DZP A;  3OIO A;  3K2A A;  3NAR A;  4XRS G;  5C44 J;  3SJM A;  1JTX A;  1TWC J;  2VKE A;  1ETX A;  4RBO A;  5FKN A;  2FQ4 A;  3JRB A;  1ORK A;  1JKQ C;  1K83 J;  5GPC A;  3IV5 A;  1E3O C;  5K7H A;  1WH7 A;  2JWT A;  5C4J J;  2JA6 J;  2YS9 A;  1ZKG A;  3FIW A;  4DW6 A;  3S2D J;  4A3J J;  1ZQ3 P;  3JRF A;  3G1O A;  4MO7 A;  2XB5 A;  3FKI J;  3ZQF A;  3Q0V A;  5EG0 B;  2NVY J;  2E1O A;  5IP9 J;  3BR2 A;  2XGC A;  5GP9 A; 
#chains in the Genus database with same CATH topology
 4LG0 B;  4Q5S F;  2FEZ A;  3E0J B;  1YS7 A;  2MSY A;  1FC3 A;  5KAI C;  4N9H A;  2VC0 A;  2X6O A;  4UY8 I;  2PQ8 A;  1U5T A;  2W1O A;  3LSM A;  2LG4 A;  2ZNZ A;  4GGG A;  5LBQ A;  3I54 A;  2DO7 A;  3UR3 C;  4EM0 B;  5J47 A;  3HOY J;  4CYD A;  3ZP5 A;  4PUS A;  4NNJ A;  2FJ1 A;  1BBY A;  2R5Y A;  5LRR A;  1EH6 A;  1ZR4 A;  3C2G A;  4JQF A;  4XKW A;  2PMZ A;  4V19 K;  3VOE A;  4Z6Y A;  2P6T A;  3F0C A;  1G4D A;  4XSX F;  3AFH A;  3SDB A;  3BDD A;  3W3C A;  4HX8 A;  3GXO A;  4KIF A;  5DTD A;  5E79 C;  1UHM A;  3CCS I;  2GM4 A;  5TIS C;  1TQM A;  2KKO A;  1KYZ A;  3C2B A;  5JLX A;  4L0Y B;  3R4K A;  3NWT A;  2GLO A;  2Y75 A;  4UB6 C;  3JW4 A;  5FGM A;  1UJ8 A;  1OR7 A;  2VC1 A;  2MGQ A;  4D0P A;  2DDA A;  3CJQ B;  4B47 A;  4IHX A;  4TV7 A;  2IEK A;  4HDU A;  4EJO A;  3JR9 A;  2LKS A;  1UCR A;  3K10 A;  1P9Q C;  3E6B A;  1SFE A;  1YQA A;  3H92 A;  2V1U A;  1P4A A;  5DUK A;  3GTK J;  2LY2 A;  1X19 A;  5F0H A;  2HQR A;  3DEU A;  4IXA A;  2COB A;  2CFX A;  4I98 B;  4XL9 A;  3I59 A;  4F3Q A;  4FET A;  3CF5 F;  3OYN A;  4KJZ A;  1WJE A;  4QPO A;  1ZLJ A;  2NVT J;  2QBY A;  2KZG A;  4M73 A;  4AIK A;  5CKT A;  2L7Z A;  1OCR H;  1E3P A;  4G7Z F;  3FXU A;  2JSP A;  4E7I A;  2DFI A;  1PP8 F;  3S3O A;  1QPM A;  2OCE A;  3PM1 A;  4IRI A;  3G6E I;  3S32 A;  4BQN A;  4KUM A;  1QHH D;  4KIB A;  1NHA A;  2N8G A;  3Q9S A;  4R79 A;  2ID6 A;  2EFN A;  2IBD A;  2ZXI A;  4G6T B;  3ZQG A;  1R9T J;  3OR2 C;  2GA2 A;  2HFH A;  1U0J A;  4FIS A;  1VQN I;  2DOF A;  2DN0 A;  4IL6 C;  3H36 A;  3AL0 C;  2OC6 A;  1J5Y A;  2DA5 A;  5J3L A;  2XSD C;  4QSH A;  1R1V A;  3HUG B;  4HX7 A;  2JT1 A;  2HQ5 A;  3HPG A;  3QOE A;  3A0B C;  1LPQ A;  4EJU A;  1TWG J;  3I4M J;  1T6S A;  3GBG A;  1X1B A;  4FT8 A;  3HXL A;  2VKV A;  4ZTJ A;  3GTG J;  1A36 A;  4L18 B;  1FIP A;  1S7E A;  3SDG A;  1DQU A;  2DOA A;  1QA6 A;  2W85 A;  2CV0 A;  5DCF A;  3RI4 A;  3P7N A;  4YEJ A;  3DBH B;  1R4N B;  2B0L A;  2Z33 A;  4DBR A;  2L9R A;  4WCG A;  2HDD A;  2MC3 A;  4XKC A;  2MYS A;  3FK7 A;  4MHG A;  3JRD A;  4B8X A;  5LGN A;  1R36 A;  2DU9 A;  3T0Y A;  1FOY A;  1K6O A;  1V5E A;  2F4M B;  2L01 A;  2GBY A;  3ISP A;  3OYG A;  3H3V K;  5CLS A;  5HVQ C;  4EQQ A;  5FKM A;  4E6K G;  5B5E C;  2XF6 A;  3NWS A;  4P9U A;  4C2M J;  2PJR B;  3ASO H;  2R7D A;  3X2Q H;  4B1R A;  1TBX A;  4DZJ A;  4PDK A;  2WBM A;  3EUA A;  3CCQ I;  4BXX J;  1G3S A;  1JI8 A;  2DT7 B;  1D8J A;  2M87 A;  3KP7 A;  2UZK A;  4I2O A;  5L3E A;  4IX7 A;  3C7J A;  3FIS A;  1GVJ A;  2BZT A;  2K27 A;  3LFK A;  3BLY A;  4DNC A;  2PN6 A;  2BOL A;  5LHG A;  4HV6 A;  2DMP A;  4LIT A;  3IAS 2;  2QVO A;  1ZG3 A;  2XHK A;  2FML A;  1IXS B;  3OYD A;  1AU7 A;  2L5Q A;  4G8X A;  3CP8 A;  5JVT A;  5HNH A;  2CYY A;  1WQ2 A;  1TNS A;  2EWN A;  4BYY A;  4BJT A;  2L3D A;  3HPH A;  2Y0S N;  3FWE A;  3QPL A;  2ETH A;  3P9K A;  3F8M A;  2V6C A;  4P5O A;  3LSJ A;  1U6G A;  3OYK A;  3S1R J;  1K78 A;  2FQ3 A;  3HRM A;  3OMY A;  1ZGJ A;  3L00 A;  4RGX A;  3WU1 B;  2EA2 A;  2EFO A;  2MC4 A;  3I4P A;  1ETO A;  2OTL I;  1HQC A;  1OPC A;  3DV8 A;  1N75 A;  1UZC A;  1UHW A;  5D5X B;  3S17 J;  3HG9 A;  2HXI A;  2A5Y B;  4PJN A;  4F91 B;  3R60 A;  4ZYG A;  1GXQ A;  1V5F A;  4M6V A;  3RKQ A;  3BY6 A;  3W2V A;  1OYY A;  2FXA A;  4GCV A;  1WZ2 A;  3U1K A;  4X0G A;  3TBI A;  3CJT B;  1Y6I A;  2XF5 A;  1HSJ A;  5KCM A;  1QPI A;  4B3X A;  4RB2 C;  2XUB A;  3GF2 A;  2YU3 A;  1K6Y A;  3M1C A;  3I9V 2;  1XMX A;  4LG0 A;  3EQL F;  4L5J A;  4BDZ A;  2H09 A;  2ZKZ A;  2M8G X;  4YFX F;  2VL8 A;  1QGP A;  3ROU A;  4UV8 A;  1Z6T A;  5LEK A;  1J2X A;  2STW A;  3RIR A;  3RDI A;  1J9I A;  1ZLK A;  3I4N J;  1W0T A;  2OZU A;  1QVT A;  1ZK8 A;  2X85 A;  3FHZ A;  3ML6 A;  3VOD A;  1FOK A;  1SFO J;  1X1P A;  4GRI A;  4AIH A;  4AIJ A;  3EYY A;  2VQH A;  2E2H J;  1Y1W J;  1SD5 A;  5LFA A;  4A3D J;  1X3W B;  2JQ7 A;  2G9W A;  3BP8 A;  4ANJ A;  1DU0 A;  5E8G A;  3PUF A;  3C3W A;  3F8B A;  4J01 A;  4G12 A;  2HOS A;  2A61 A;  2CGP A;  2OJE D;  1HST A;  4CHU A;  4KNY A;  2EV0 A;  3BJA A;  1WJ5 A;  3S14 J;  5CVR A;  2R93 J;  2E1C A;  1R22 A;  1G59 A;  3LFU A;  2G7H A;  4XOP A;  2F2E A;  1C0W A;  2NVQ J;  3IRR A;  2WV0 A;  4HG2 A;  2Z1D A;  3FXQ A;  5JVG F;  1JHF A;  1MZB A;  2KPM A;  1V54 H;  2BY1 A;  1I50 J;  2EZI A;  2RRE A;  3FM3 A;  1FPQ A;  3GW2 A;  3PNT A;  2W82 A;  2L7K A;  1P4X A;  3I58 A;  2VN2 A;  3MZH A;  1KQ0 A;  4DIQ A;  1OYI A;  3EET A;  4O6J A;  2JA7 J;  1WRJ A;  1IAW A;  4XMY A;  4BBR J;  2DFE A;  5KK1 A;  3E6M A;  2JRT A;  2E71 A;  5C4X J;  3S3M A;  4WXC A;  1BW5 A;  4IHS A;  3GFM A;  1ZRF A;  3S16 J;  2K5C A;  3ZCO A;  4RS8 A;  2NVX J;  1E17 A;  2R7R A;  5D4S A;  2DJN A;  2EFP A;  3GWZ A;  2FBH A;  3L2R A;  3DP7 A;  4PCQ A;  4FTH A;  3MN2 A;  1T95 A;  5D5W B;  1FBU A;  3FXM A;  4P1W A;  2M34 A;  1PUF B;  3BTC A;  2PLY A;  1KON A;  1ENH A;  2O03 A;  2YX4 A;  1XSD A;  1LFP A;  4RGR A;  2ZXW H;  1ETQ A;  2KFD A;  3CUO A;  1UG0 A;  2OV7 A;  1TW2 A;  4BGD A;  3JRC A;  3IH2 A;  4NHJ A;  1R5I D;  3CTA A;  2KIU A;  1YRN B;  3TP0 A;  3MFK A;  3L09 A;  3HUG A;  3DKX A;  4KIT B;  3AAF A;  5E3N A;  1UB9 A;  5HDG A;  4JX5 A;  1O4X A;  1YTY A;  1J75 A;  1RZ4 A;  2EK5 A;  3PIP F;  2IGN A;  3FM5 A;  2K3F A;  2L54 A;  4KDP A;  1SC7 A;  2DMN A;  2FUG 2;  2M45 A;  2XAH A;  4E7J A;  1DUX C;  5E8I A;  2Y9Y A;  2XRO A;  2DPD A;  5GAH J;  2FE3 A;  4HST A;  2AS5 F;  5ICE A;  3IKV A;  3M8E A;  5DYM A;  3MD2 A;  1TT0 A;  5IPA A;  1O3T A;  3VWB A;  2R7X A;  2RDP A;  4M3E A;  3HHH A;  3A01 B;  3HGG A;  4KIG A;  4KFC A;  3GLL A;  2PJR A;  5E3M A;  1YW9 A;  5TRD A;  2EH3 A;  2D45 A;  4DBQ A;  2W25 A;  5A2Q K;  3QP5 A;  2V4J C;  3KLO A;  1GT0 C;  3HM5 A;  2ZME C;  3BQY A;  4L5I A;  4RLF A;  3ZMD A;  5H2F C;  4Z2Y A;  2PI0 A;  1GLN A;  1JUS A;  2P0W A;  1I3A A;  2W4S A;  2XAS A;  2YU9 J;  2W24 A;  4D7N A;  2ID3 A;  4DGW B;  1BOB A;  4R1H A;  1BL0 A;  2JK3 A;  2ZJR F;  2XKO A;  2JUG A;  5M5X J;  2WB1 A;  4ZDP A;  1SFX A;  1W4M A;  3S15 J;  2K9S A;  1YW7 A;  3FDY A;  1O57 A;  2KJB A;  2CQN A;  4ZJZ A;  2YX7 A;  1JUP A;  1RES A;  1HXD A;  1IN8 A;  3CO7 C;  2AHQ A;  2BY3 A;  4ZZD A;  1EV7 A;  2Y2Z A;  4Y13 A;  2O9L A;  2JTV A;  2W84 A;  1Y0U A;  3F8C A;  3E5X A;  1QNT A;  2Z3Y A;  4A2U A;  2M0C A;  1STZ A;  2GOX B;  3IKT A;  2BHZ A;  3HB9 A;  4JP0 A;  2XV4 S;  1YE9 A;  3DBL B;  2ZO4 A;  1RUO A;  4QTR A;  5C3E J;  3R0J A;  1PDN C;  1RPW A;  3QYF A;  5IT3 A;  3L2U A;  3JRA A;  2VE9 A;  3M8J A;  4X1E A;  1O3Q A;  1I27 A;  1BM9 A;  3LSG A;  5IOZ A;  2FNP A;  5F04 A;  1OYW A;  3GX4 X;  4AYB N;  2QSH X;  3I71 A;  2B9S A;  3C2H A;  2RV8 A;  2XGX A;  5F1R A;  1VTN C;  2FSW A;  2VKE A;  1ETX A;  4M72 A;  5HLG A;  3HRS A;  4HLX A;  5FKN A;  5CQG A;  3BWG A;  1X1A A;  1JKQ C;  3BOQ A;  5GPC A;  1S3J A;  1E3O C;  3GYH X;  2FU4 A;  2JWT A;  2EIM H;  4CUG A;  4ESF A;  4A5M A;  2JA6 J;  4OAZ A;  2MD5 A;  5E1Z B;  1BIB A;  2V9P A;  3LSI A;  3JRF A;  2V1N A;  1X1D A;  5FFZ A;  1TW3 A;  3TO9 A;  5EG0 B;  3HTU A;  2NVY J;  1XD7 A;  1VQ6 I;  2HDW A;  4PSW A;  1T08 B;  3A2K A;  4N9I A;  1LDD A;  1W5S A;  3J80 K;  2XAF A;  3CLQ A;  2XGD A;  1MDM B;  4M3F A;  3OOU A;  2K4J A;  2MFZ A;  2O8X A;  1F4K A;  4BU2 A;  2HNH A;  4O3M A;  2H1L A;  1QZE A;  1TZL A;  2XKP A;  3Q0W A;  2R3S A;  1YS6 A;  2HPM A;  3BJO A;  2Y9Z A;  2QWW A;  3HSR A;  3OYI A;  4KA4 A;  5K1Y A;  1F36 A;  5CVI A;  2EZH A;  3HRT A;  2X1E A;  4BE0 A;  4RA2 A;  1B9N A;  4MQ9 F;  3PFI A;  2I8D A;  2W48 A;  2AQF A;  3DCF A;  4E7K A;  1GVD A;  1KU9 A;  4JK1 X;  3U9G A;  4HPQ A;  4LFU A;  2WY7 Q;  3FZV A;  3F72 A;  4RAZ A;  3MWM A;  2E1M B;  1DU6 A;  3B02 A;  2M4K A;  4BH9 A;  1MNE A;  3DF8 A;  1MBJ A;  1UHS A;  4M3D A;  4W97 A;  4MTE A;  2IAI A;  2OCC H;  4A5N A;  4EV0 A;  2R7O A;  1H8A C;  3GZN B;  3J7Y J;  5K7Z A;  3E6D A;  3F6O A;  4I99 C;  5DCM B;  1XCV A;  1BR2 A;  2LVS A;  3QYE A;  4U0V A;  1YO5 C;  2O8K A;  4OIN F;  3MQ0 A;  3KEQ A;  4LK1 F;  4MLO A;  2P5L C;  1FTZ A;  2EV6 A;  2V9K A;  3Q0U A;  4EM2 A;  1A5J A;  1J7K A;  2MLK A;  2HOA A;  4YIF A;  3FK6 A;  1VQO I;  4DJA A;  2E7W A;  4ASN A;  3VYR B;  2AQE A;  1I39 A;  4WXH A;  4EAT A;  2OTJ I;  2V6E A;  2LY9 A;  3FXK A;  1U2W A;  4RAF A;  1G6N A;  3HOW J;  1BI3 A;  3SHF A;  1WI9 A;  2LP0 A;  1FBS A;  4DYC A;  2B7E A;  1PUF A;  2DFH A;  1OQY A;  2KRF A;  5HS7 A;  4F93 B;  1ZH5 A;  1LE8 B;  5EJC A;  2PMH A;  1FYM A;  1H89 C;  4IHV A;  4IZZ A;  1RRJ A;  3KYC B;  5GAE J;  1EH8 A;  5M5W J;  2JVH A;  4XLF A;  4Y4R A;  3OYC A;  1YRN A;  4LLN A;  3NAU A;  2OF7 A;  4CO8 A;  4H0E A;  4XLC A;  3IC7 A;  3F9K A;  4OMZ A;  3J81 K;  3QAH A;  4CCO A;  3V7S A;  2CQQ A;  1BI0 A;  1QHG A;  2BGC A;  3VYU B;  4A3M J;  2O0Y A;  4XKB A;  2HKO A;  2EV5 A;  3L2V A;  2D2W A;  1JKO C;  1SAN A;  3JSP A;  2XIG A;  2GXB A;  2XB0 X;  1WJD A;  2CW8 A;  4IOC F;  3KET A;  2CUE A;  3TOB A;  3TP3 A;  4I02 A;  3BCB A;  1MBG A;  2BBY A;  5E3L A;  1D8K A;  3BTL A;  3PFY A;  2DOD A;  2DBB A;  4I76 A;  2RN7 A;  3A01 A;  2YPR A;  1U8B A;  3QRF F;  2FX0 A;  3VYT B;  2GZW A;  5DS9 A;  3RTR A;  3BG7 A;  4QLC U;  5GTH C;  1LVA A;  2P7V B;  2Q2E B;  2W00 A;  3E3V A;  2R7T A;  3BG5 A;  3COA C;  3MMY B;  4JX6 A;  3KPH A;  3WGI A;  3OYH A;  1KA8 A;  2M0M A;  2GQQ A;  2VPR A;  4UVB A;  3G2B A;  3K0L A;  3H9Q A;  3BPX A;  4WK8 F;  3G4S I;  3BTJ A;  2IA1 A;  5BOX A;  3SEZ A;  1VQL I;  3ERM A;  1E0E A;  1Q1V A;  2E1M C;  2QLZ A;  2XPV A;  1TWF J;  2F48 A;  4HV5 A;  5FFX A;  2M3A A;  3KFW X;  1X3Z B;  4AD9 A;  2ZJQ F;  4S04 A;  5LD2 C;  3IUO A;  1LQ1 A;  3JRI A;  3GZ5 A;  3LST A;  1XDS A;  4NBQ A;  5EDN A;  1GV2 A;  2E60 A;  2DCE A;  4PZJ A;  2G7U A;  4PGG A;  4F55 A;  1T2K A;  5ERI A;  1W0U A;  1U9O A;  2AXT C;  2WV1 A;  1DDN A;  3BR6 A;  2QF7 A;  3BG9 A;  1IF1 A;  2Z16 A;  2QCO A;  3MKL A;  2LY1 A;  3RPQ A;  3LQQ A;  4EEF G;  1R00 A;  5K5R A;  1SMY F;  4IEJ A;  4XON A;  1BIA A;  3SEQ A;  3PO2 J;  3ESW B;  2KIF A;  3AKZ A;  5F08 A;  4M9X A;  2NS8 A;  3CC2 I;  2XAU A;  2F4I A;  1RIO H;  2IVM A;  2ISY A;  2Q0O A;  4KT5 C;  2DQL A;  3JTG A;  1XGO A;  4A3C J;  3K9T A;  1TNT A;  2LOO A;  4U88 A;  3N4M A;  3T8T A;  4BEH B;  1A6Q A;  2WTE A;  2X9D A;  1S8N A;  1CF7 B;  1T8I A;  1K7A A;  2LR8 A;  2DA7 A;  4A3G J;  1Y56 A;  3L2C A;  1MH3 A;  2R7F A;  3LNQ A;  1EF4 A;  3NEU A;  2DK5 A;  5DEQ A;  3VB2 A;  3H9G A;  4P55 A;  1FEX A;  4XRS A;  5DD4 A;  5KAF C;  2E35 A;  1VI0 A;  2F5D A;  5EG0 A;  4HAM A;  4BS9 A;  2P4W A;  3AG4 H;  3CMM A;  3ZQQ A;  3REO A;  4AWX B;  2L4M A;  4FE7 A;  3TDU C;  1KZH A;  1FY7 A;  5IYD J;  2XSJ C;  3W2W A;  5M3F J;  1R49 A;  4HBL A;  1MDM A;  4XLP F;  2NVU B;  2JRM A;  2VJJ A;  2ZXJ A;  2E2I J;  1XSV A;  2DT6 A;  1LB2 A;  5JFR A;  3RKY A;  3D1N I;  1VQ7 I;  2KL4 A;  4WXD A;  3OYF A;  3ZQI A;  3MVP A;  4BUP A;  1Y0N A;  3TDZ C;  5LHH A;  3PIO F;  2DXI A;  3HZJ A;  2JSC A;  3MCZ A;  5ICC A;  4N0B A;  3IWF A;  3HC7 A;  2VXZ A;  3P9C A;  2M7A A;  2QKL B;  1FJL A;  4Y7N J;  2BE5 F;  4XIC A;  3EUK L;  4MGR A;  3K4N A;  2XVC A;  4P9F A;  3I53 A;  2V9V A;  4M3B A;  3GFI A;  1BA5 A;  4R8H A;  1ONV A;  3G1M A;  4JOM A;  4XRM A;  3R6S A;  5FRN A;  1MH4 A;  2KIS A;  5J8C A;  1FMV A;  4NC7 A;  4BKX A;  1MJB A;  5KHD A;  4MFD A;  4X6A J;  2WY8 Q;  5HS9 A;  2EFW A;  3DPL C;  3W6J B;  2IW5 A;  5H6R A;  4M3G A;  2QUF A;  2K9M A;  1OMI A;  4NC6 A;  3CCY A;  2P81 A;  3IH3 A;  1LNW A;  5GP9 A;  2RKH A;  2K9Q A;  2JJ7 A;  1TL8 A;  3FXJ A;  3PUB A;  1V55 H;  2MG4 A;  4FHT A;  4RAG A;  3DU6 A;  4U0W A;  4B48 A;  2HQA A;  3S1Q J;  2LRD A;  1ZGA A;  2L7F P;  3CCR I;  2NOJ B;  4OOI A;  4BHB A;  1SFU A;  1W36 D;  5FD6 A;  1LUJ B;  4Y17 A;  1LE8 A;  1FP2 A;  2HU9 A;  1WKM A;  2OQG A;  4L5E A;  4CCM A;  1F9N A;  1Z0X A;  5ICG A;  3QPS A;  1RKW A;  1Z9C A;  3DKY A;  2Q8K A;  4NQW B;  3BG6 A;  3CES A;  2K40 A;  1FBQ A;  3BRO A;  2X6X A;  2J5O A;  4AUX A;  1WPK A;  3LA3 A;  1T98 A;  1EH7 A;  3ZQH A;  3ZGK A;  4WF2 A;  2DAO A;  2PG4 A;  2ZSH B;  3N05 A;  3JAM Z;  1HDD C;  3OYL A;  1S7A A;  3GEZ A;  5L3G A;  3RQ4 A;  1WJF A;  3W6V A;  3M8F A;  2A6H F;  3ONQ A;  3ZQ7 A;  4RB0 A;  1YW8 A;  5TJJ A;  3ZOB A;  1EJ9 A;  2QZ8 A;  2V1X A;  5FLV A;  3MZY A;  2VON A;  1G2H A;  2HYG D;  5F1J A;  1VND A;  1B72 B;  2X1D A;  3DKW A;  2HTJ A;  3WTX C;  1ETW A;  2JVG A;  3HIF A;  1D0Y A;  1RKT A;  2ZFW A;  2KLO A;  3I0T A;  2BYV E;  4M71 A;  1D1B A;  1DPR A;  4EJW A;  2XPU A;  1IUY A;  2OQR A;  3PQJ A;  4LK0 F;  1W36 C;  1GXP A;  4L9J A;  3D5S C;  2B63 J;  4UHT A;  2Y0S A;  3ABM H;  3CLO A;  2Q2E A;  3G1L A;  5FKL A;  5J1U A;  2DPU A;  1HKT A;  2QYO A;  2V1D A;  2VIX A;  1VQM I;  3O2P E;  2MBF A;  2CU7 A;  3OYA A;  4XKV A;  1SFK A;  3FBI B;  1Z91 A;  3EDP A;  5FLX K;  1XCB A;  4XSZ F;  1O3R A;  3CJN A;  1A35 A;  3VPR A;  2FNA A;  2NXN B;  4UVA A;  2Z2S B;  4LB5 A;  3HDD A;  2LF7 A;  2JUC A;  1QU3 A;  1W7P D;  5K7F A;  1JKR C;  2GXG A;  3I5U A;  3WTY C;  5JLW A;  2Y0M A;  1F1Z A;  4HF1 A;  2E36 A;  3EUH C;  5IYC J;  4L0Z B;  4BJ6 C;  5J1Y A;  1JJ6 C;  2BVL A;  2R7W A;  3CDL A;  3DEE A;  1D5Y A;  4BY7 J;  4EMS A;  2KDZ A;  2M30 A;  1Z77 A;  1K4T A;  4UUV A;  2QM3 A;  3R0A A;  3FXL A;  5D6F A;  2ELK A;  1ERD A;  1H88 C;  2FOW A;  4A3L J;  2JZY A;  2WAQ N;  2XC7 A;  4G9Y A;  3FXO A;  1OJL A;  2ZME B;  2R5Z B;  3OIQ A;  4XBF A;  2YUS A;  1YYV A;  4OIQ F;  5E3O A;  4M6Y A;  3U2R A;  4S0H B;  1POG A;  3BR3 A;  4I01 A;  1HCR A;  1QZZ A;  1NG7 A;  2JMW A;  3H5R A;  4UUT A;  4YFK F;  4RB1 A;  1FWZ A;  1CF7 A;  4LD5 A;  3TOA A;  3ECO A;  4LLG F;  4DZP A;  1I1G A;  1I6X A;  3K2A A;  1WSU A;  4KIC A;  3FX3 A;  4XRS G;  3SJM A;  1JTX A;  1S5L C;  3AG3 H;  5B3S H;  3MKZ A;  4PGH A;  3VDX A;  5H20 A;  1Q1H A;  5CJ9 A;  2FQ4 A;  3JRB A;  1ORK A;  1LDK B;  2IA0 A;  3OYJ A;  3W2A A;  5J40 A;  2DK8 A;  2IRF G;  2CWE A;  5IT9 K;  1LEA A;  2V26 A;  1BC7 C;  4BL0 B;  3FIW A;  2A68 F;  4JBA A;  4MO7 A;  3WTU C;  2BW3 B;  1H9T A;  5HS8 A;  2COM A;  1ODD A;  3DPT A;  2LK2 A;  1OCZ H;  2DDB A;  5FKK A;  5DV5 A;  1FSH A;  3M1E A;  5BMZ A;  3BPV A;  1MSF C;  1F43 A;  2EJR A;  3QPH A;  5HOO A;  2YSR A;  1ON2 A;  2WAD A;  3H3Z A;  1XG1 A;  2QQ9 A;  3P9I A;  5K5O A;  3GO5 A;  2FMY A;  2DJI A;  3SYT A;  2AO9 A;  3BG3 A;  3U1D A;  3ULQ B;  1HBX G;  3CCU I;  2H8R A;  3PSI A;  4CH7 A;  1JGS A;  1XN7 A;  3TMO A;  1MW7 A;  3HKZ A;  1B8I B;  1Z6R A;  2ELJ A;  5J4Y A;  2DTR A;  4RB3 C;  2GIV A;  2W7N A;  4BAC A;  4C9Y A;  5DM7 F;  4NDL A;  3EUH A;  1MMG A;  4HW0 A;  4DYQ A;  1DP3 A;  4A0X A;  1HW2 A;  4ENK A;  5F6F A;  4IO9 F;  3BCA A;  3C1D A;  5F0C A;  1S9H A;  2O5R A;  3SQN A;  1X1C A;  1TT5 B;  2KT0 A;  1IGN A;  1MMN A;  5DD8 A;  4U0Y A;  1MKM A;  4QPQ A;  2RVC A;  3LL7 A;  4B09 A;  2VQC A;  3LSR A;  2O6G E;  4XOT A;  3S1N J;  5IP6 A;  4EGY A;  1P6R A;  4JX4 A;  4EJV A;  3HOS A;  2OD5 A;  1ZG1 A;  4CIC A;  2XRL A;  4LGW A;  4XN3 A;  4A6E A;  1RUN A;  3OWT A;  3ZXS A;  1WJC A;  4W1U A;  2ADU A;  5EEG A;  2FBI A;  3S1M J;  1N25 A;  1R23 A;  3QQA A;  3ABK H;  4CXF A;  5D5V B;  4OIP F;  2NNN A;  1P7I A;  1SVO A;  3GFJ A;  1BI2 A;  1FMW A;  1VZ0 A;  5EZG A;  3WGH A;  2KIM A;  4NQW A;  1AA7 A;  1IJW C;  3I3L A;  1O7F A;  4L9V A;  1P2F A;  1GHC A;  1LKX A;  1IN6 A;  3O6B B;  2CRG A;  1ITY A;  3K6G A;  4C2T A;  3B73 A;  4AU7 A;  4OWR B;  4MEY F;  3CMY A;  1U78 A;  3GCM A;  1AOY A;  1X58 A;  4ZDO A;  2MA3 A;  2W57 A;  4HOB A;  2LBF B;  1PP7 U;  5E17 F;  1AKH B;  1NG6 A;  2DOE A;  2LFB A;  1T56 A;  1K4S A;  1IN4 A;  3H1C A;  4PJ0 C;  2BV6 A;  4PJM A;  1E2X A;  4ZDL A;  3VSL A;  5E18 F;  3CCE I;  2GAU A;  1H9G A;  2O7O A;  5BNG A;  1B72 A;  3RZD J;  2HZD A;  2MH9 A;  4DYR A;  3U21 A;  1JKP C;  4U7B A;  3KLN A;  2E2J J;  2VBW A;  4CSW A;  1D1A A;  2DYS H;  3E1S A;  6PAX A;  3GTJ J;  2HS5 A;  3RPU D;  3OS1 A;  2E5N A;  5EF6 A;  4IQJ A;  2ZXH A;  2HKX A;  4KT6 A;  3KEY A;  1ZRC A;  1KQ8 A;  1FSE A;  2X0L A;  1WI3 A;  4XM3 A;  1OCT C;  1RNL A;  2Y30 A;  4QWQ A;  1P4W A;  1G8X A;  4IVN A;  3HRU A;  4WWC A;  2ZNY A;  4GFB A;  1IRG A;  3TKY A;  2KRH A;  3ASN H;  1D5V A;  1JTY A;  2TRT A;  3HTS B;  2H27 A;  1BJZ A;  2H8W A;  2X51 A;  1IRZ A;  1R4M B;  3WTZ A;  3ELK A;  3HSE A;  1BI1 A;  4MNU A;  4HNU A;  1HKQ A;  1A04 A;  2M2E A;  4AYB A;  2VT3 A;  3ABL H;  2R92 J;  2QEN A;  2L02 A;  3CJR B;  4FQG A;  2F5C A;  3WTT C;  3F8F A;  5ILU A;  2DFF A;  2STT A;  1NTC A;  5JR3 A;  1IV6 A;  3KP3 A;  4RAY A;  2IS4 A;  5GPA A;  2EBI A;  3WE3 A;  1QO0 D;  5CQE A;  1I5Z A;  1REP C;  3CQZ J;  1SVM A;  3K4L A;  5IY5 H;  2KRC A;  1KGS A;  3WTS C;  2NS7 A;  2IT0 A;  1PUE E;  1U8R A;  3BTI A;  1QRY A;  3LWF A;  4A3F J;  5BS6 A;  4LMY A;  3CO6 C;  4D1Q A;  1X2N A;  2ZME A;  1ZN2 A;  2P5K A;  2R5Z A;  5DUI A;  3DXJ F;  4A3I J;  3BJ6 A;  5D5U B;  3RKX A;  2GIZ A;  3KE2 A;  3KZZ A;  4CCL A;  3S93 A;  1XMK A;  2LMD A;  5LHI A;  4ZTF A;  3KP6 A;  2ZJ2 A;  3CC4 I;  4BBS J;  2H1K A;  4OAY A;  3NQO A;  1FX7 A;  2ME0 A;  5JHF A;  4HQE A;  4LB6 B;  1LJ9 A;  4CCN A;  4I0B A;  1YHQ I;  2PBI A;  4XQF A;  1QZY A;  2R4G A;  3R61 A;  1GDT A;  2PJP A;  1J09 A;  5ILS A;  2IGM A;  3T8R A;  1MMA A;  3GZ6 A;  1VQ5 I;  3A02 A;  1MMD A;  1Z67 A;  4YG2 F;  3HOZ J;  1JUM A;  2JPB A;  2OAZ A;  3GTM J;  2BVM A;  1WGX A;  2CW0 F;  2RQQ A;  1D0X A;  4ZH4 F;  3S2W A;  3CCL I;  4N4O B;  3CF2 A;  1WJA A;  4FX0 A;  2JPC A;  3ZQC A;  3CD6 I;  4KMF A;  5LLQ A;  2UV1 A;  1FNN A;  2WA0 A;  5FD5 A;  1FTT A;  2CW7 A;  3JRH A;  1N77 A;  2ME6 A;  5D4R A;  3HL2 A;  1J0R A;  1I1S A;  2BW3 A;  2KZV A;  4E7S A;  2DTZ A;  3ZR8 X;  4E7L A;  5EEH A;  2A6T A;  2ESH A;  2DA6 A;  1TWH J;  3Q5F A;  4HRI A;  4FE4 A;  5FLM J;  1YFH A;  3SZT A;  4LG3 A;  2E34 A;  5IYB J;  3BR0 A;  2DT5 A;  2IS2 A;  1WWX A;  4Y33 A;  2HOE A;  3VEP A;  2BY2 A;  1B6A A;  2EZK A;  2VE8 A;  3WE2 A;  1MGT A;  4A0Z A;  1IUF A;  1ACI A;  1X3U A;  1T39 A;  3FBN B;  1YIO A;  3QOD A;  2VBY A;  4ESB A;  1SD4 A;  4FAS D;  1B8I A;  1R1U A;  2KJC A;  3ECH A;  2PFB A;  4G6D A;  4UUS B;  3H3U A;  5CPR B;  4E4H A;  1HF0 A;  2KQR A;  4XID A;  2IS1 A;  1OR7 C;  2IP2 A;  3EYI A;  2X1C A;  5A2Q Z;  2K7L A;  4ESJ A;  4M74 A;  1HLV A;  1T0F C;  1JXS A;  1XGS A;  2IXS A;  1RC9 A;  2X4H A;  1P7J A;  4B3A A;  3K4B A;  2QEX I;  1U3E M;  1IDZ A;  2VKH A;  3RYR A;  2A5W A;  5GTI C;  3AG2 H;  4HQM A;  2Z9O A;  2M9H A;  2MD0 A;  3MZ8 A;  2HR3 A;  3CCJ I;  4YII A;  3V8K A;  4HNV A;  4NC8 A;  4PFO A;  3BZK A;  4GDF A;  4GYI A;  1UEL B;  1LFU P;  1BC8 C;  3V7R A;  2IGO A;  4D5F A;  1FYL A;  3K4M A;  3RPU A;  2CUJ A;  2RNG A;  4HSR A;  1JHH A;  4A0Y A;  2CO5 A;  4XK4 A;  2JA5 J;  1O7L A;  1IRX A;  1KYW A;  1MJA A;  5FKO A;  3TQN A;  4AID A;  3V42 A;  4J19 A;  2X6W A;  1VQP I;  4UB8 C;  2CS3 A;  1WCM J;  4HZF A;  4HEA 2;  2K4B A;  4XNF A;  2NOG A;  4BJ5 C;  1YIT I;  3HSF A;  2IA2 A;  4L9T A;  2DW4 A;  2ELH A;  4F52 A;  2Z5U A;  2R7U A;  4G6Q A;  2LC2 A;  2WAF A;  1JT0 A;  1EA3 A;  3LOC A;  1ETV A;  1P92 A;  3D5L A;  1VQ9 I;  2LBF A;  1AKH A;  2PMZ N;  2UXN A;  3GVA A;  4A3B J;  1XGM A;  4BQQ A;  3OL4 A;  4IPA A;  1FYK A;  1G3Y A;  3B6C A;  4LIV A;  4CYC B;  2CQX A;  2CG4 A;  1ZAO A;  4DQ2 A;  1MSE C;  1SD6 A;  1USS A;  4U7D A;  2EZL A;  4CCK A;  1FIA A;  2JN6 A;  2IJL A;  2D1V A;  4II3 A;  4AVZ A;  4QIW N;  3HGY A;  3KYD B;  1Z3Y A;  2H6B A;  3T5X A;  1BR4 A;  1HOM A;  5B1B H;  3QOP A;  1S7O A;  2OA4 A;  3IRQ A;  1T38 A;  3OS2 A;  3IL2 A;  1MBF A;  2QSF X;  3E7L A;  5L3F A;  2L9N A;  3J80 Z;  1FOW A;  2CJJ A;  1YI2 I;  4RDU A;  3HOU J;  4EGZ A;  3OIP A;  2AXL A;  2A69 F;  4PJL A;  3QU3 A;  2VPL A;  1V4R A;  4II2 A;  5IP7 J;  2L2O A;  3WGG A;  1NH3 A;  4UV9 A;  3L2W A;  1ETY A;  4D9J A;  3KZI C;  4EM1 A;  2HZT A;  1LVK A;  3H0D A;  2UWM A;  5EGO B;  1SD7 A;  2YR2 A;  4FX4 A;  5ILV A;  2VT2 A;  3FMS A;  2UUZ A;  2TCT A;  4PK4 A;  2VKD A;  5EEA A;  3QPT A;  1R5G A;  2G0E A;  2KHM A;  1T0F A;  3V8L A;  3NRV A;  4B4C A;  2IPQ X;  2VJI A;  5DM6 F;  1NK3 P;  3O8H A;  4F7Z A;  1LFB A;  4NB5 A;  2VOO A;  2OU2 A;  1PVE A;  5HLI A;  5LGU A;  3CMA I;  3WOD F;  3QWL A;  2HQN A;  4GXO A;  2MAB A;  3RSN A;  3MKW B;  3LSP A;  2I5U A;  3M3Y J;  5M5Y J;  3H5A A;  4YEL A;  3DPU A;  1NK2 P;  5J4V A;  5FB2 A;  2R7V A;  4IRH A;  1FOX A;  3DLA A;  1VFC A;  2NYX A;  1DP7 P;  3OL3 A;  2A05 A;  3B6A A;  1ON1 A;  4ON0 A;  2GWR A;  1HA8 A;  1ZEL A;  3F6V A;  4AVP A;  2P7C B;  1SMT A;  5ICF A;  4FCY A;  2DMQ A;  1YJW I;  2DA2 A;  3HOV J;  1CGP A;  3Q3S A;  4RGS A;  1MJ9 A;  3PL8 A;  2BXY A;  4EVI A;  2NRA C;  3PNY A;  2DLL A;  2ZB9 A;  1XDU A;  3GTQ J;  5M3M J;  4ZYH A;  3VFZ A;  5DCM A;  1XX5 A;  1Z05 A;  4I0A A;  4ENM A;  5B1A H;  3H9J A;  3RYP A;  1ZHF A;  3T1B A;  4K2E A;  3WTV C;  3TGN A;  3RJP A;  4IHW A;  3P5J A;  2ZSI B;  1TLH B;  2DA3 A;  1ULY A;  2P6S A;  1FZP B;  3HYI A;  3QP6 A;  2FA5 A;  2HVR A;  5C44 J;  1J59 A;  2LF8 A;  4HX4 A;  4PFP A;  2XAQ A;  5J8F A;  2IS6 A;  3ABT A;  4RM2 A;  2HWV A;  3QU6 A;  3J81 Z;  3K1P A;  4IJA A;  3J7A Y;  1WHU A;  2VLA A;  1IN5 A;  5K7H A;  1WH7 A;  3KYL A;  3K1M A;  2V79 A;  5C4J J;  4HYE A;  3LAP A;  2YS9 A;  1ZKG A;  4XR6 A;  3S2D J;  4DW6 A;  4GYG A;  4A3J J;  3S3N A;  1ZQ3 P;  2RQP A;  1FT9 A;  3KCC A;  1B4A A;  3ZQF A;  2NAZ A;  3D0S A;  2FRH A;  3Q0V A;  1RI7 A;  2E1O A;  2VQL A;  1HW5 A;  2Q1Z B;  4RMN A;  2XGC A;  4A6D A;  5DDG A;  5J1R A;  3DLL F;  4G7H F;  3L7W A;  4JYK A;  3Q9V A;  1W7P B;  1B9M A;  4PSX A;  1ZRD A;  4OMY A;  4C3H J;  2HXO A;  5TGT A;  4Q47 A;  1IV8 A;  5LRS A;  4UUS A;  5EZH A;  2DMT A;  2PMU A;  4GO1 A;  3BT9 A;  3DU5 A;  2EIJ H;  1BR1 A;  1WFX A;  3I64 A;  3M9A A;  2DMU A;  3S2H J;  3N97 A;  4XLE A;  2R7S A;  5F27 A;  4J00 A;  1I3Q J;  2O61 A;  1MIJ A;  3ERE D;  4Y52 J;  3WHB A;  3S8P A;  5FRO A;  4IKF A;  3K2Z A;  2FD5 A;  2H94 A;  3OS0 A;  2XRN A;  3HOT A;  1JJ8 C;  1YX3 A;  3G71 I;  2PX9 A;  3DTI A;  4BHP A;  3HOX J;  2EIN H;  1YIJ I;  1A31 A;  4HLY A;  2P5V A;  5BPD A;  3CDI A;  1FLI A;  2VAS A;  3V8J A;  3A1Y A;  2CUZ A;  2D5V A;  1XB4 A;  2E1N A;  2QSG X;  2VXD A;  2KDO A;  3K1N A;  5HOD A;  1UAA A;  2PEX A;  1V5G A;  2EQR A;  3KZY A;  2HGC A;  3JCU C;  1ZTR A;  2DQR A;  4HNT A;  3ZMV A;  3DWL E;  1Z7U A;  4XLA A;  2CV1 A;  2EB7 A;  3WHC A;  5GAD J;  1BW6 A;  3KP5 A;  4C30 A;  3JRG A;  4RGU A;  1YJ9 I;  2EIL H;  2X48 A;  3SXY A;  1UMQ A;  1WH5 A;  4F92 B;  1Z7L A;  1Y39 A;  2VJ4 A;  4ETS A;  4ZZL A;  1K61 A;  2HYF A;  1D1C A;  3CDH A;  3M07 A;  3RCO A;  4BE2 A;  1S6L A;  3DTK A;  4IQ4 A;  5HDK A;  4ENN A;  2JA2 A;  4CYC A;  3H0G J;  2M5W A;  3WG7 H;  1TTY A;  1RR7 A;  3E5U A;  3CP2 A;  3VSK A;  4ZYD A;  3V4G A;  1R5H A;  1OFC X;  1MBE A;  2FOK A;  4CZC A;  3IAM 2;  1X2M A;  2F6C A;  1IC8 A;  2RC4 A;  1TWA J;  3BZ6 A;  3IHU A;  3TW6 A;  2HVS A;  4DOZ A;  1G3T A;  5E1X A;  1L3L A;  4OIR F;  2ESN A;  5E20 A;  2ICW G;  3E5Q A;  3OR1 C;  4BEH A;  3DTE A;  4ITV A;  4XN0 A;  5B66 C;  3GTO J;  5D8L B;  2XGE A;  3IH4 A;  3IWZ A;  1YG2 A;  4I7H A;  2F5V A;  3WU0 A;  5F0F A;  5F64 A;  3K4K A;  2BXZ A;  3CZ6 A;  3LAJ A;  4L9N A;  2L9V A;  1EKE A;  2WAQ A;  3BR1 A;  3H35 A;  2WAE A;  1BOA A;  2ISZ A;  1M1E B;  3TO7 A;  1OLT A;  1G3W A;  2BHY A;  1MBH A;  2XF7 A;  4KMU X;  3ZMS A;  1SAX A;  3GTP J;  1UFM A;  5EGO A;  2QQB A;  2DYR H;  1IXR C;  5LGT A;  2HTS A;  3KX2 A;  2OBP A;  1GUU A;  3O3K A;  2MH2 A;  3O8G A;  4IHY A;  3MAJ A;  2EFQ A;  3K70 D;  2K9L A;  2VBX A;  2QA4 I;  5E1W A;  1IZ1 A;  4ZYA A;  4LOC A;  5L3D A;  3UNG C;  4CCJ A;  2L0K A;  1QBJ A;  5HNF A;  3L1P A;  1IRF A;  1HKS A;  3RKW A;  2ZFU A;  3L9F A;  2R7Z J;  2QQ8 A;  3GME A;  2KIQ A;  2DA4 A;  3KIO A;  2ACJ A;  4U87 A;  1XS9 A;  2M7B A;  3PSF A;  1UG2 A;  2I10 A;  4BQO A;  1XC5 A;  4Y15 A;  3HKZ N;  5J6X A;  4YIR X;  1ZR2 A;  3MKY B;  4IOA F;  2HYJ A;  4CZZ A;  2Y69 H;  2VI6 A;  5D8K B;  3DEW A;  2HEO A;  3ZPL A;  3CUQ B;  2J5P A;  4KIS A;  2XDV A;  1I6H J;  3L2Q A;  3E6C C;  1IN7 A;  1QQI A;  2K9N A;  3VYS B;  1YLF A;  1SVL A;  5JHU A;  2A6E F;  4Q48 A;  3FF5 A;  2LYC A;  1B59 A;  2RAE A;  4UXN A;  5HDN A;  4A3E J;  4BE1 A;  2V7F A;  4LIU A;  1VQK I;  1R71 A;  4N4N B;  3SFI A;  3KEO A;  2F4O B;  1ZRE A;  4MTD A;  1QVU A;  3WG9 A;  3HHG A;  3K70 C;  3CCM I;  2VB6 A;  5AON A;  5L3B A;  2C6Y A;  4A93 J;  5CYV A;  2CQ7 A;  2Y48 A;  2LKP A;  1IDY A;  2VUM J;  1DGR M;  5HLH A;  1JT6 A;  2LKX A;  3CCV I;  4I6Z A;  3PO3 J;  3WU2 C;  1JGG A;  5LEJ A;  2HOT A;  4LJZ F;  3QYB A;  2K86 A;  3OSG A;  3W6K B;  4XLN F;  2WB1 N;  1MBK A;  3LA2 A;  2TDX A;  3J7Z I;  4D5C A;  4CA0 A;  3FHN A;  2VBZ A;  1Y1V J;  2LDU A;  2M4G A;  3M4O J;  3D5R C;  4RM3 A;  5L3C A;  5FRM A;  2H6C A;  4Q4Z F;  2LRE A;  2RGV A;  3BZC A;  1WVR A;  2LD5 A;  2ECB A;  3J7A O;  2OZ6 A;  3CC7 I;  1HDP A;  1W7P A;  1UST A;  1MNM C;  3GLX A;  3K7A J;  2BEO A;  3K4J A;  2CQK A;  1R6R A;  2ZBK A;  1R7J A;  4BY1 J;  3ZMT A;  3OV8 A;  2KP6 A;  1OCO H;  1WJB A;  3LSH A;  4C3J J;  4V2F A;  1RET A;  2EIK H;  4A3K J;  1CQT A;  1IG7 A;  2X6Y A;  3WTW C;  1A6I A;  4PJJ A;  1R1T A;  1TQP A;  1DPU A;  3ZN0 A;  4MFE A;  1AWC A;  5KVR A;  2FF4 A;  5FLX Z;  1U5T B;  1V3F A;  3TO6 A;  3ZMU A;  2GA1 A;  5GAG J;  1OIS A;  2R0Q C;  2VQG A;  2LLK A;  3GTL J;  1MMS A;  1Z21 A;  1ZG5 A;  2R5Y B;  4G7O F;  2CMP A;  1AHD P;  5IOY A;  4ZC3 A;  2MW8 A;  5BPI A;  2EA4 A;  4LLL A;  4BHC A;  1TC3 C;  1DGW Y;  4YFN F;  2QGU A;  2Y31 A;  1XGN A;  5FO5 A;  3ZMZ A;  1S72 I;  2DI3 A;  2LSO A;  1B1B A;  3K69 A;  4A69 C;  1H0M A;  1KQ9 A;  1MD0 A;  1IXC A;  4B44 A;  3G3Z A;  2XPW A;  3CUQ C;  4S05 A;  1ZGW A;  4M6X A;  3SZG A;  2WWY A;  1VQ4 I;  4IHT A;  1E3H A;  3F21 A;  3ABU A;  3IP4 B;  5CVU A;  1BJA A;  4XLH A;  2JA8 J;  5AIP A;  3TW7 A;  2VJ5 A;  2CSO A;  1SEU A;  3FXR A;  2XAG A;  3LSK A;  3GFL A;  4BXF A;  1OKR A;  1TP4 A;  4V2G A;  2HPI A;  3CME I;  3BQZ A;  4M9S A;  4Y3O A;  3OYB A;  2ZC2 A;  2XAJ A;  3ZN1 A;  3OYE A;  4A12 A;  3TED A;  3RZO J;  1D0Z A;  4M9Z A;  1Y8Q B;  1YOV B;  4WX9 A;  3PJR A;  3G73 A;  5AIQ A;  1ETK A;  3I59 B;  2K3P A;  4UVC A;  1OCP A;  1K79 A;  4YRV A;  3DFG A;  4BXU A;  2LH9 A;  2QBY B;  1APL C;  3BR5 A;  5ED4 A;  1OCC H;  4AM3 A;  2F5F A;  1Z1D A;  4OIO F;  3H5N A;  4MQV A;  1TQI A;  5IT9 Z;  2K02 A;  4I09 A;  1VQ8 I;  4H4K C;  5CVV A;  2M1B A;  4G94 A;  4XOR A;  1XPX A;  3SFZ A;  2OPT A;  3MEX A;  2NS0 A;  4NUB A;  3F22 A;  4P96 A;  2HVQ A;  2LTP A;  2P8T A;  2D1H A;  3BC8 A;  2ZCW A;  1LEB A;  3OYM A;  3JRE A;  1PJR A;  4KN4 X;  3M7G A;  3C18 A;  3E97 A;  2F5E A;  3FMQ A;  4XRF A;  3GUD A;  2FBK A;  3RQI A;  1GV5 A;  4C3I J;  3I56 I;  1U5T C;  3JTH A;  1KU7 A;  3KP2 A;  2QQA A;  3LQR A;  2NNY A;  5HLT A;  2EPF A;  4AC0 A;  2CV2 A;  3OOP A;  2LNB A;  1W5C C;  4O5V A;  4OU0 A;  2K85 A;  3FMR A;  3TL4 X;  4ABZ A;  2E5Z A;  1PYV A;  2CFO A;  5CVJ A;  3ZQL A;  2HI3 A;  1R58 A;  4D7M A;  2HDC A;  3FKJ A;  4ZYE A;  2RNJ A;  1X4P A;  3A03 A;  1KU3 A;  2MLG A;  3F8N A;  3OY9 A;  3I55 I;  2L7M P;  5KNL A;  4CGZ A;  2CUF A;  1MND A;  1JE8 A;  4HA8 A;  5EYR A;  1L0O C;  3A4C A;  5FJ8 J;  5K5Q A;  4C2U A;  2A07 F;  3ZRG A;  3F3X A;  1HW1 A;  2WC2 A;  2DA1 A;  4IRG A;  1Z3X A;  4IF4 A;  3OSF A;  3CUQ A;  2ECC A;  1VF9 A;  1SAU A;  2KMU A;  1W1W E;  2GOM A;  3EPZ A;  4BQA A;  1KU2 A;  4E7H A;  2GXA A;  4HF2 A;  3UKG A;  1S29 A;  2IGK A;  1O3S A;  5JI6 A;  5H6Q A;  2R7Q A;  1ZYR F;  2E7X A;  1X4O A;  9ANT A;  3HJE A;  3DBR B;  3KP4 A;  4HDV A;  3HEF A;  4BDY A;  4MEX F;  2A3S A;  3DQV C;  1Y8R B;  2OUM A;  4ENJ A;  3K4C A;  2CH0 A;  4EJT A;  2E19 A;  2VOP A;  4E70 A;  2O3F A;  1N78 A;  1D3Y A;  1F5T A;  1XMA A;  4UNO A;  3F23 A;  1U9N A;  1IO2 A;  3JSO A;  3HBL A;  1T33 A;  1K78 B;  4HF0 A;  1YJN I;  4MIM A;  3A0H C;  3SZP A;  3PNV A;  2Z99 A;  3OIO A;  4KN7 X;  3NAR A;  4B43 A;  1TWC J;  2L4A A;  1XTA A;  4BNC A;  1YX5 A;  4KYW A;  1W5T A;  1FP1 D;  4RBO A;  2ZJP F;  3LMM A;  2VOD A;  2M8E A;  1K83 J;  2UXX A;  3AG1 H;  4RLQ A;  5BQT A;  3IV5 A;  3JAM K;  1LDJ A;  5D6E A;  1ZAR A;  1BN5 A;  2BY0 A;  1HC8 A;  1XSX A;  4CDG A;  2L9S A;  3G1O A;  1RR8 C;  2XB5 A;  3FKI J;  4BAY A;  1IW7 F;  3AL0 B;  2QKM B;  3V7C A;  5IP9 J;  3LA7 A;  3BR2 A;  4E7Z A;  3PQK A; 
#chains in the Genus database with same CATH homology
 2LK2 A;  5J1R A;  5FKK A;  4JYK A;  2MSY A;  1MSF C;  1F43 A;  4C3H J;  2HXO A;  2X6O A;  2XGD A;  1XG1 A;  4M3F A;  3OOU A;  4UUS A;  5EZH A;  2DMT A;  3BT9 A;  2AO9 A;  3BG3 A;  3S2H J;  2DMU A;  3Q0W A;  2H8R A;  3HOY J;  2Y9Z A;  5F27 A;  2FJ1 A;  2R5Y A;  1I3Q J;  1B8I B;  4Y52 J;  3WHB A;  1ZR4 A;  1F36 A;  2EZH A;  2FD5 A;  1JJ8 C;  3F0C A;  2W48 A;  4NDL A;  3DCF A;  3HOX J;  1GVD A;  4DYQ A;  5DTD A;  1DU6 A;  2GM4 A;  5F0C A;  3C2B A;  5JLX A;  2D5V A;  1MBJ A;  1UHS A;  4M3D A;  4W97 A;  2GLO A;  2IAI A;  2KT0 A;  1H8A C;  1IGN A;  5K7Z A;  5HOD A;  2EQR A;  2MGQ A;  2LVS A;  2O8K A;  4IHX A;  3LSR A;  2IEK A;  1ZTR A;  3S1N J;  5IP6 A;  4JX4 A;  4MLO A;  1FTZ A;  3JR9 A;  2XRL A;  3Q0U A;  1A5J A;  2HOA A;  3FK6 A;  3WHC A;  4W1U A;  3GTK J;  1BW6 A;  3S1M J;  3JRG A;  3QQA A;  5F0H A;  1P7I A;  5EZG A;  2LY9 A;  2COB A;  2X48 A;  1IJW C;  3HOW J;  1UMQ A;  1WH5 A;  2LP0 A;  4DYC A;  2CRG A;  1PUF A;  1K61 A;  1ITY A;  1LE8 B;  2NVT J;  1H89 C;  3CMY A;  1U78 A;  4IHV A;  2L7Z A;  4CYC A;  1X58 A;  3H0G J;  5M5W J;  3PM1 A;  1RR7 A;  1AKH B;  1YRN A;  3NAU A;  2LFB A;  1T56 A;  2OF7 A;  1OFC X;  1MBE A;  2N8G A;  2ID6 A;  1X2M A;  2IBD A;  3ZQG A;  1IC8 A;  1R9T J;  3TW6 A;  1TWA J;  2O7O A;  4FIS A;  5BNG A;  1B72 A;  3RZD J;  2CQQ A;  4DYR A;  1JKP C;  2DN0 A;  2E2J J;  4A3M J;  2DA5 A;  5J3L A;  2XSD C;  3GTO J;  4QSH A;  1JKO C;  1SAN A;  2XGE A;  3IH4 A;  2HQ5 A;  3GTJ J;  2XB0 X;  1TWG J;  3I4M J;  3GBG A;  5F0F A;  2CUE A;  3TP3 A;  1MBG A;  2VKV A;  5EF6 A;  3GTG J;  1FIP A;  3BR1 A;  5E3L A;  1S7E A;  3SDG A;  3BTL A;  1MBH A;  1WI3 A;  1OCT C;  2Y30 A;  3GTP J;  4I76 A;  3A01 A;  2L9R A;  2HDD A;  5EGO A;  4GFB A;  1U8B A;  3FK7 A;  1JTY A;  2TRT A;  3JRD A;  2FX0 A;  5DS9 A;  1BJZ A;  1GUU A;  1IRZ A;  3BG5 A;  3O8G A;  4IHY A;  2GBY A;  3H3V K;  4JX6 A;  2M2E A;  4LOC A;  2VPR A;  2R92 J;  5FKM A;  2L0K A;  3BTJ A;  4C2M J;  1Q1V A;  4B1R A;  4DZJ A;  3L1P A;  2XPV A;  1TWF J;  2R7Z J;  4BXX J;  2DA4 A;  1NTC A;  1XS9 A;  1IV6 A;  5GPA A;  2EBI A;  1UG2 A;  2I10 A;  3CQZ J;  3FIS A;  1XC5 A;  2NS7 A;  3HKZ N;  5EDN A;  3JRI A;  1ZR2 A;  1GV2 A;  3BTI A;  1QRY A;  2HYJ A;  4A3F J;  2VI6 A;  3DEW A;  1W0U A;  1U9O A;  2DMP A;  2WV1 A;  1I6H J;  3BR6 A;  2QF7 A;  3BG9 A;  1X2N A;  2R5Z A;  1AU7 A;  2K9N A;  4A3I J;  2QCO A;  3MKL A;  4EEF G;  4IEJ A;  2RAE A;  4BBS J;  3PO2 J;  4A3E J;  2Y0S N;  2H1K A;  3QPL A;  2ME0 A;  3LSJ A;  5F08 A;  3S1R J;  2NS8 A;  3SFI A;  1GDT A;  1QVU A;  3A02 A;  1ETO A;  4A3C J;  3HOZ J;  1JUM A;  4A93 J;  3GTM J;  1WGX A;  1IDY A;  3S17 J;  2VUM J;  1JT6 A;  2HXI A;  2X9D A;  2LKX A;  3PO3 J;  4I6Z A;  1JGG A;  3RKQ A;  4M6V A;  2HOT A;  2LR8 A;  2DA7 A;  3ZQC A;  4A3G J;  1MH3 A;  3OSG A;  2WB1 N;  1MBK A;  3LNQ A;  1EF4 A;  4D5C A;  1FTT A;  3JRH A;  1FEX A;  1Y1V J;  2ME6 A;  4XRS A;  3M4O J;  1QPI A;  1VI0 A;  2DTZ A;  5EG0 A;  2LD5 A;  2DA6 A;  4FE7 A;  2ECB A;  1TWH J;  1HDP A;  4FE4 A;  5IYD J;  5FLM J;  2M8G X;  5M3F J;  5IYB J;  1MNM C;  3BR0 A;  3K7A J;  2E2I J;  4BY1 J;  2EZK A;  1IUF A;  3I4N J;  1W0T A;  1QVT A;  1ZK8 A;  4C3J J;  3D1N I;  4V2F A;  1RET A;  4A3K J;  1CQT A;  1IG7 A;  1A6I A;  3MVP A;  3ZQI A;  1B8I A;  1SFO J;  4MFE A;  4UUS B;  2E2H J;  1Y1W J;  1HF0 A;  4XID A;  4A3D J;  1FJL A;  2R0Q C;  4Y7N J;  4XIC A;  1DU0 A;  1HLV A;  2LLK A;  3GTL J;  1P7J A;  2R5Y B;  4B3A A;  4G12 A;  2HOS A;  1AHD P;  1IDZ A;  4M3B A;  5IOY A;  1BA5 A;  2MW8 A;  1TC3 C;  3S14 J;  2R93 J;  3G1M A;  4XRM A;  2M9H A;  2Y31 A;  2NVQ J;  1MH4 A;  4A69 C;  4BKX A;  4HNV A;  4X6A J;  4MFD A;  2XPW A;  1LFU P;  1ZGW A;  4M3G A;  4D5F A;  1I50 J;  2EZI A;  3CCY A;  2P81 A;  2JA8 J;  3IH3 A;  4XK4 A;  2JA5 J;  2K9Q A;  2JJ7 A;  5FKO A;  3TW7 A;  4J19 A;  2MG4 A;  2JA7 J;  1WCM J;  4BBR J;  3S1Q J;  2L7F P;  4V2G A;  2NOG A;  5C4X J;  3BQZ A;  1BW5 A;  1LE8 A;  4L5E A;  3S16 J;  1Z0X A;  3TED A;  3RZO J;  3QPS A;  1RKW A;  1JT0 A;  2NVX J;  3LOC A;  2DJN A;  1ETV A;  4FTH A;  2K40 A;  1ETK A;  3MN2 A;  1AKH A;  2PMZ N;  4A3B J;  2M34 A;  1OCP A;  1PUF B;  3BTC A;  4AUX A;  1WPK A;  1ENH A;  1APL C;  3ZQH A;  3BR5 A;  3B6C A;  1ETQ A;  4CYC B;  2CQX A;  3JRC A;  1MSE C;  2EZL A;  1HDD C;  3IH2 A;  1FIA A;  2JN6 A;  3W6V A;  1YRN B;  4QIW N;  3TP0 A;  3HGY A;  3ZOB A;  5FLV A;  1G2H A;  5E3N A;  5F1J A;  4JX5 A;  1HOM A;  1O4X A;  1VND A;  1B72 B;  2OPT A;  1ETW A;  1RKT A;  2LTP A;  1MBF A;  3E7L A;  3HOU J;  2CJJ A;  2DMN A;  4RDU A;  3JRE A;  2XPU A;  2Y9Y A;  5IP7 J;  2B63 J;  5FKL A;  3RQI A;  3G1L A;  5J1U A;  1GV5 A;  4C3I J;  1ETY A;  5IPA A;  4M3E A;  2CU7 A;  3A01 B;  3HGG A;  4AC0 A;  5EGO B;  4ABZ A;  2TCT A;  5EEA A;  5E3M A;  2EH3 A;  2G0E A;  3VPR A;  3ZQL A;  2HI3 A;  1GT0 C;  4D7M A;  3HM5 A;  4B4C A;  3HDD A;  3BQY A;  1NK3 P;  5K7F A;  1JKR C;  3O8H A;  1JUS A;  3A03 A;  2YU9 J;  5JLW A;  4D7N A;  1LFB A;  2ID3 A;  2L7M P;  2CUF A;  1BL0 A;  2JK3 A;  5EYR A;  5IYC J;  5FJ8 J;  5M5X J;  3S15 J;  2DA1 A;  2K9S A;  3LSP A;  3M3Y J;  5M5Y J;  5J1Y A;  1JJ6 C;  3OSF A;  1NK2 P;  1JUP A;  1RES A;  2ECC A;  3CDL A;  1VF9 A;  1D5Y A;  4BY7 J;  2AHQ A;  1VFC A;  2KDZ A;  2Y2Z A;  2O9L A;  1Z77 A;  3B6A A;  2ELK A;  3UKG A;  1H88 C;  4A3L J;  2M0C A;  9ANT A;  2WAQ N;  4FCY A;  2DMQ A;  1OJL A;  2DA2 A;  3HOV J;  3HEF A;  3HB9 A;  3Q3S A;  4JP0 A;  2R5Z B;  2YUS A;  4QTR A;  2ZB9 A;  5E3O A;  5C3E J;  3GTQ J;  5M3M J;  1RPW A;  4S0H B;  2E19 A;  1POG A;  3JRA A;  3BR3 A;  4X1E A;  1HCR A;  3LSG A;  1U9N A;  5IOZ A;  4IHW A;  5F04 A;  3HBL A;  1T33 A;  2JMW A;  4UUT A;  4AYB N;  2DA3 A;  4MIM A;  4DZP A;  3OIO A;  3K2A A;  3NAR A;  4XRS G;  5C44 J;  3SJM A;  1JTX A;  1TWC J;  2VKE A;  1ETX A;  4RBO A;  5FKN A;  2FQ4 A;  3JRB A;  1ORK A;  1JKQ C;  1K83 J;  5GPC A;  3IV5 A;  1E3O C;  5K7H A;  1WH7 A;  2JWT A;  5C4J J;  2JA6 J;  2YS9 A;  1ZKG A;  3FIW A;  4DW6 A;  3S2D J;  4A3J J;  1ZQ3 P;  3JRF A;  3G1O A;  4MO7 A;  2XB5 A;  3FKI J;  3ZQF A;  3Q0V A;  5EG0 B;  2NVY J;  2E1O A;  5IP9 J;  3BR2 A;  2XGC A;  5GP9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...