2JA5J

Cpd lesion containing rna polymerase ii elongation complex a
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cpd Damage Recognition by Transcribing RNA Polymerase II
pubmed doi rcsb
molecule tags Transferase
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 14
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2ja5J00
4BBRJ 3TW6A 4B3AA 1XC5A 5IP9J 4S0HB 1A5JA 2COBA 1DU0A 4B1RA 3TW7A 3SDGA 4IHVA 1RPWA 1JT6A 2DA6A 2Y31A 2O9LA 5EGOB 1D5YA 2X48A 4C3JJ 4A93J 2E2HJ 2O7OA 2W48A 1MBKA 1B72A 2Y2ZA 1OCPA 5EG0A 3S16J 1JKPC 3GTKJ 4A3JJ 2JN6A 5J1YA 1POGA 2K9QA 1TWAJ 2DA4A 2FD5A 3QPLA 3BT9A 2WV1A 3OIOA 3BTLA 3FKIJ 3I4MJ 3Q0VA 1QVUA 1OFCX 5FLMJ 1F43A 2ME6A 1W0UA 3S1QJ 2VKVA 1LFBA 2L7FP 2EZHA 3K2AA 4Y52J 3B6AA 3BR0A 3CQZJ 5JLXA 1IV6A 2MG4A 2XGEA 4X6AJ 3GTGJ 2XB0X 4AYBN 2M0CA 5F0FA 3HEFA 2YU9J 1U9OA 2DA7A 3PO3J 4A3MJ 4LOCA 5IYCJ 1XS9A 3TP0A 1PUFA 2Y30A 2JA6J 2OF7A 2DMTA 1ETXA 1I3QJ 2L9RA 2HDDA 5EYRA 4BKXA 3D1NI 1ZR2A 1ETYA 3PO2J 5EF6A 3ZQIA 3BQZA 2ELKA 4QIWN 3HOZJ 2E19A 5FKLA 4C2MJ 2OPTA 3HOUJ 2FJ1A 2NS7A 4BBSJ 4XK4A 1A6IA 2VPRA 4RDUA 1IUFA 2AHQA 4A3GJ 2E2IJ 2M9HA 2ZB9A 4EEFG 5F04A 5J3LA 5M3MJ 4ABZA 1AKHB 4DZJA 5EG0B 1HLVA 3HDDA 4UUSA 1ITYA 4C3HJ 4FCYA 1HDPA 1IDZA 3MN2A 3BR5A 3WHBA 2XB5A 3A03A 3BTIA 3OOUA 3JR9A 2CQQA 3JRIA 5EDNA 1B72B 1XG1A 3BQYA 3HM5A 1R9TJ 1SANA 3S14J 2LKXA 1MBHA 2H1KA 3GTPJ 2MGQA 1I50J 1IJWC 2EQRA 5E3LA 2XPVA 2R5ZB 3H0GJ 1H88C 2TCTA 1NK2P 5M5WJ 2CRGA 1WGXA 1T33A 1LFUP 4V2GA 1BW5A 2O8KA 1TC3C 3Q0UA 2R5YB 2CQXA 2LTPA 1DU6A 5IOZA 2R7ZJ 4C3IJ 3G1LA 2NVTJ 5C44J 5GPCA 2EZLA 3HBLA 3BG3A 4DYCA 1MBGA 2XRLA 2ID3A 4A69C 3HOYJ 2LVSA 2I10A 4W97A 3BR1A 5K7FA 1E3OC 1TWCJ 2EH3A 4J19A 1MH4A 2HXIA 3S1NJ 4A3EJ 1JT0A 1LE8B 3BR6A 3ZQCA 1W0TA 2LD5A 3UKGA 3LSPA 3BR3A 2MW8A 1JKRC 1ZK8A 2NVYJ 3HB9A 5F0CA 1WI3A 3CCYA 3LSRA 4D5CA 1K61A 3FISA 1RESA 2L7ZA 3WHCA 1Y1WJ 1K83J 3HGGA 1MBEA 2X9DA 1OCTC 4MFDA 4A3FJ 5DS9A 2DA5A 5K7ZA 2GLOA 2IEKA 2EZKA 4XICA 3GTOJ 3JRGA 5BNGA 1RETA 4JYKA 3O8GA 2KDZA 4QSHA 3IH4A 4G12A 4A3DJ 1TWGJ 2JA5J 2TRTA 1JUMA 2Y9YA 4MFEA 3DEWA 3A01B 1ENHA 2CJJA 1WCMJ 2R0QC 1X2MA 2VKEA 1OJLA 3LNQA 2NS8A 1X2NA 1JTYA 4M6VA 1Z0XA 4I76A 5IP6A 2JA8J 2DN0A 1JJ6C 2M2EA 5E3OA 5FKNA 1GDTA 1VFCA 2HXOA 4AC0A 1JKOC 2AO9A 2LR8A 5EZGA 1HOMA 1WH5A 2JA7J 1QVTA 3Q3SA 2G0EA 3JRBA 3S1RJ 2QF7A 2XPUA 1P7JA 5IOYA 4AUXA 2ME0A 2HOTA 4BXXJ 2FX0A 1VI0A 1T56A 5J1UA 1HCRA 3NAUA 5E3MA 4JX5A 4UUSB 5J1RA 1WPKA 1Q1VA 4X1EA 3HKZN 2YUSA 1ETWA 1MBFA 1IRZA 2WAQN 4D5FA 1VF9A 1MH3A 2H8RA 3SFIA 1FTZA 3BTJA 1FTTA 1ZQ3P 1ETKA 3M4OJ 1MBJA 2LLKA 2HQ5A 2CU7A 2JWTA 2HI3A 5M3FJ 4B4CA 1H89C 1U78A 2JK3A 3CMYA 3I4NJ 2IAIA 1B8IA 2VI6A 4JP0A 1RKWA 3JRCA 3BG9A 5FKKA 5IPAA 1ETOA 2YS9A 4MIMA 4JX6A 3F0CA 2DMPA 3HOXJ 5IYBJ 4A3CJ 1ZTRA 2QCOA 3C2BA 4DZPA 4M3DA 1JTXA 2K9SA 1QPIA 4I6ZA 3H3VK 5JLWA 3M3YJ 1BW6A 1FIAA 3GTJJ 1JJ8C 3S1MJ 3S2HJ 9ANTA 1TWFJ 3QPSA 5FJ8J 2JJ7A 4IHWA 2MSYA 2Y0SN 4A3LJ 3GTLJ 2NOGA 3O8HA 3CDLA 1O4XA 5M5XJ 3G1OA 2FQ4A 3L1PA 2LK2A 4HNVA 2IBDA 5K7HA 3E7LA 4XRSG 1I6HJ 5DTDA 1CQTA 4CYCB 1EF4A 2DA3A 2JMWA 2PMZN 3GBGA 1FJLA 4FTHA 1HDDC 1X58A 1GV2A 1PUFB 4XRMA 2L7MP 1UMQA 2LP0A 3BG5A 3LSJA 4MLOA 3JRDA 3G1MA 5M5YJ 2XGCA 5F27A 2DMQA 5GPAA 2DA1A 5IP7J 1RKTA 1IDYA 2HOAA 3RZOJ 3GTMJ 3MKLA 1FIPA 3HGYA 1B8IB 2XPWA 3VPRA 1Y1VJ 1IG7A 3BR2A 2EZIA 4M3BA 1FEXA 2M34A 5EZHA 2LY9A 1YRNB 1MNMC 3SJMA 2XGDA 1GVDA 5E3NA 1AU7A 3FIWA 3TP3A 1QRYA 4RBOA 3A02A 2XSDC 3W6VA 3HOWJ 1S7EA 3ZQGA 3MVPA 4JX4A 4M3EA 2M8GX 4NDLA 1RR7A 3JRHA 1APLC 3OSFA 1UG2A 2N8GA 2D5VA 4XRSA 4QTRA 4Y7NJ 1GT0C 2R5ZA 4L5EA 3RZDJ 3B6CA 5HODA 2HYJA 2ECCA 3PM1A 2E2JJ 2DJNA 3JREA 1AKHA 3NARA 2P81A 2Y9ZA 4A3BJ 3Q0WA 5F0HA 5EGOA 3ZQHA 4DYQA 4A3IJ 2KT0A 2K40A 1ORKA 3ZOBA 2NVQJ 2DMNA 2VUMJ 3JRFA 3FK6A 2RAEA 5FLVA 3RKQA 1IC8A 5F1JA 1JUSA 3JRAA 2CUEA 5FKMA 3ZQLA 2E1OA 2ECBA 4A3KJ 3LOCA 4GFBA 5C4JJ 1WH7A 1NK3P 4M3FA 2X6OA 3RQIA 1MSFC 2R92J 2GM4A 4D7NA 3S15J 3S2DJ 5GP9A 4DW6A 1YRNA 5C3EJ 1GUUA 1HF0A 3GTQJ 1ETQA 1BJZA 5F08A 2HOSA 1GV5A 3FK7A 1ZKGA 1H8AC 4FE4A 2LFBA 4M3GA 1TWHJ 3IH2A 3TEDA 2NVXJ 2DA2A 1ZR4A 3S17J 3K7AJ 1NTCA 3HOVJ 1MSEC 3BTCA 1ETVA 4FE7A 2EBIA 1SFOJ 2L0KA 1JGGA 4D7MA 2DTZA 4DYRA 5FKOA 1AHDP 2R93J 5IYDJ 1Z77A 1IGNA 4IHYA 5C4XJ 4MO7A 4UUTA 1U8BA 1G2HA 2ID6A 1U9NA 4IHXA 3IH3A 3ZQFA 4XIDA 1UHSA 2K9NA 1BL0A 4FISA 3DCFA 1VNDA 4W1UA 2GBYA 1LE8A 2B63J 3A01A 1P7IA 1JKQC 3OSGA 4IEJA 1F36A 4V2FA 4BY1J 5EEAA 4BY7J 1ZGWA 2CUFA 2R5YA 3IV5A 1BA5A 2WB1N 3LSGA 4CYCA 2DMUA 3QQAA 1JUPA
chains in the Genus database with same CATH superfamily
4B3AA 1K79A 2L5QA 5IP9J 4HYEA 2ZBKA 3FXUA 5E8GA 1A5JA 1DGRM 2YPRA 4YIFA 1UFMA 3CCJI 3SDGA 3RKXA 2E7XA 1DPUA 2DA6A 2Y31A 2O9LA 5FRMA 5EGOB 5IT3A 5HOOA 4M74A 4A93J 3ULQB 2E35A 1HW2A 1T08B 5B5EC 2O7OA 1MBKA 1R1VA 3R60A 1NG7A 2Y2ZA 2WTEA 3QOPA 3S16J 2FU4A 1SEUA 3BG7A 3OS0A 3QU6A 5J1YA 1WSUA 2K9QA 1TWAJ 2VB6A 3V42A 2G9WA 3VOEA 4BHPA 1ONVA 1UHWA 3BTLA 2BGCA 2ZJQF 4P9UA 5LLQA 3Q0VA 1QVUA 1KQ0A 2GXGA 5FLMJ 2OUMA 4RB3C 1FLIA 2EZHA 2FA5A 3B6AA 4BYYA 3BR0A 1EKEA 2R7RA 5JLXA 5H20A 2P5VA 2XGEA 1BIBA 2W7NA 1J7KA 4AYBN 3DV8A 1T95A 5F0FA 3KZIC 2BY1A 3LA2A 2YU9J 5ED4A 3SFZA 1YTYA 2QEXI 3R0AA 4AIDA 5IYCJ 2Y30A 3H0DA 3DKWA 3RI4A 3I9V2 2DMTA 2OAZA 1ETXA 1I3QJ 4BQOA 5FLXK 4U0YA 4BKXA 5K5QA 3E6CC 1ZR2A 3RPQA 1ETYA 2L01A 1T8IA 1O57A 4F55A 5J40A 2OPTA 2X51A 3V7RA 1OR7A 5H6QA 2GQQA 2FBIA 2ZJ2A 2P6SA 1J0RA 2AHQA 2YU3A 2M9HA 5L3BA 2ZB9A 5F04A 5M3MJ 4D0PA 3ZRGA 2A69F 4ABZA 2QGUA 4GCVA 1MDMB 3K4CA 5DM7F 2VT2A 3HDDA 4FHTA 4UUSA 1ITYA 4C3HJ 2P4WA 1IDZA 5JVGF 1SFKA 1VQ9I 2UZKA 1Z21A 2XB5A 1X4PA 2JZYA 2VXDA 1LEBA 1B72B 3LAPA 3U1DA 3MZ8A 1WJBA 3CCUI 1VQ4I 3I59B 3S14J 4E6KG 3KE2A 1MBHA 5J8FA 4FETA 3LSIA 1IJWC 2JQ7A 2HR3A 3K69A 2LOOA 2ZO4A 3KYLA 2LMDA 3H0GJ 1Q1HA 2TCTA 3ZP5A 3CC7I 1S29A 2CGPA 5M5WJ 1ZRFA 2KL4A 3S93A 2WC2A 2IGOA 4V2GA 5FD6A 5DCMA 1XGSA 3ERED 1S3JA 2HVSA 1FSHA 2R5YB 2KMUA 2Y75A 1EA3A 2CQXA 5JVTA 2MC3A 1DU6A 5IOZA 4L9TA 4C3IJ 5LRRA 4XORA 1FYMA 1KU3A 1I3AA 2X6YA 3EQLF 1G3YA 4ZYEA 1MBGA 4Q4ZF 5GAHJ 3AFHA 2EFWA 2LVSA 4DNCA 2A05A 4YIRX 2WAFA 4U0VA 3WU2C 1BN5A 1TWCJ 2WY7Q 4J19A 1HQCA 2HXIA 2X85A 4YG2F 2KHMA 4XLPF 2H27A 5DCFA 1XMXA 4FQGA 2PMZA 1MDMA 3MWMA 3LSPA 2FUG2 3BR3A 3K6GA 3J81K 2C6YA 3QYFA 2XAJA 4A0XA 4NNJA 4ZTJA 1ZK8A 2NVYJ 3HB9A 4RB1A 3DXJF 4BQAA 3VFZA 4KT6A 3LSRA 2DQLA 2XHKA 1RESA 3IWFA 4UY8I 1K83J 3L2RA 1QO0D 2X9DA 3ASOH 4O3MA 1WZ2A 2XAGA 4S05A 2GLOA 1JHFA 1VQNI 3ELKA 2NVUB 4CDGA 4QLCU 4EQQA 3JRGA 1DGWY 2HOEA 5JR3A 4HV5A 1IN6A 4XQFA 4A3DJ 1M1EB 1TWGJ 5D6EA 1B9MA 5CVIA 2LH9A 1MJAA 2QZ8A 3DEWA 4UUVA 3SZTA 1LKXA 1WCMJ 4IL6C 1SD6A 2XIGA 1X2NA 3GLLA 3DEUA 5KAIC 3FM3A 5F1RA 1HW1A 5IP6A 5B1BH 1XTAA 2DN0A 1U2WA 4MEXF 3VSLA 4UHTA 5FKNA 1P9QC 2DOAA 1GDTA 1VFCA 1KU9A 2HGCA 2LR8A 1WH5A 4MHGA 5DDGA 5GAGJ 4NUBA 3GZNB 4Y33A 1IN8A 1BR4A 2XPUA 1Z6TA 1FMWA 1P7JA 1BI2A 2J5PA 5IOYA 2HOTA 4I99C 2LBFA 3HSEA 2DBBA 5J1UA 5LGUA 4IOAF 4U0WA 2MABA 1TLHB 3NAUA 3WG9A 5K5OA 2D1HA 1W5TA 1MIJA 2F6CA 1Q1VA 4LFUA 5BOXA 3HKZN 2YUSA 2IPQX 1MBFA 5HS8A 4D5FA 1PDNC 1QU3A 3HRUA 4FASD 2H8RA 1FTZA 4NBQA 4RB0A 2PMHA 3OMYA 3NWTA 1ETKA 3BZCA 5CPRB 2B7EA 1G3TA 3RPUD 3V8KA 3KZZA 3N97A 3M4OJ 2Q2EB 4DBRA 2UWMA 5M3FJ 3VYRB 3EYIA 2LF7A 3SEQA 2VI6A 4DOZA 3JRCA 1W1WE 1IO2A 4Q47A 1BIAA 1ETOA 3U9GA 3DBLB 1BOBA 2CFOA 2Z1DA 4JX6A 3J7AY 4PJ0C 4A3CJ 3H5RA 1OISA 3FXLA 2P7VB 1ZTRA 2E60A 3I55I 1QBJA 1JTXA 1N75A 4I6ZA 1R58A 1FIAA 1H9TA 3PSFA 9ANTA 2P7CB 2V4JC 2R7DA 5GADJ 1ZLKA 2QQ8A 1USTA 2MSYA 3GFLA 4MNUA 3BCAA 1VQMI 1FT9A 2OD5A 2ZKZA 1RZ4A 3GTLJ 2NOGA 3JTGA 2NNNA 2EIKH 3ECOA 4M6XA 2DFFA 2RDPA 3GYHX 3VWBA 1IW7F 3G1OA 3W3CA 2FQ4A 3CO7C 4L9JA 4HNVA 2IBDA 5LD2C 1HKTA 3TKYA 2NNYA 1CQTA 2VONA 2L54A 1EF4A 1LEAA 1HDDC 2VOPA 1X58A 2X6WA 2RNGA 1P6RA 3RKYA 3OR2C 4D9JA 1UMQA 3FF5A 4M9SA 1RNLA 3FDYA 4BS9A 1E3PA 3FX3A 2W1OA 2YSRA 2M7AA 5EEHA 3LSJA 1NG6A 4I98B 3KP4A 2DQRA 4PUSA 5F27A 4B8XA 1GHCA 4U87A 4DQ2A 5KK1A 2DA1A 5IP7J 5AIQA 1IXRC 2L9NA 3W6KB 4IKFA 2IS2A 3WTWC 3QODA 4E4HA 1IDYA 1G6NA 3R4KA 2D1VA 1Y1VJ 2ZCWA 1IG7A 1O3RA 4R1HA 2EIMH 2F5FA 3IRQA 2LY9A 3IKVA 5FROA 3SJMA 1UAAA 5BPIA 3HRTA 3Q9SA 1O7FA 1GVDA 1U3EM 5DCMB 4PFOA 3AG4H 1ZREA 2FXAA 2XAHA 1UCRA 1VQ5I 2EFOA 1MMNA 4HQMA 2PJPA 3RYPA 2PJRA 1XMKA 3PJRA 3A02A 2AXLA 3W6VA 2UXNA 5D5VB 1J5YA 3L2QA 4KICA 3ECHA 4UNOA 2MD5A 4JX4A 3C3WA 3ISPA 2P6TA 2O6GE 1N78A 1TBXA 4EGYA 2CFXA 3L9FA 1Z67A 3JRHA 1XDSA 1SVMA 1JXSA 1ZGJA 3F8CA 1UG2A 4XRSA 1U5TC 4L5EA 1S9HA 4RAFA 3RZDJ 2QBYA 3HOSA 1YS6A 1OYYA 3JREA 5B3SH 1AKHA 5IT9K 1OKRA 2O3FA 1BC8C 1YG2A 2GXBA 5HLTA 1AOYA 4G7HF 4XKWA 2QQ9A 1R36A 4ZDPA 1N25A 2A61A 1ORKA 1QGPA 1Z3XA 2DMNA 3MZYA 2ZMEA 2IRFG 3IHUA 2Q1ZB 2VT3A 4DJAA 1ZRCA 1FC3A 4EJWA 2VJIA 3COAC 1P4AA 4OMYA 4M71A 1IC8A 5F1JA 3L2UA 3FMRA 2JSCA 2CUEA 2M7BA 3ZQLA 3S3OA 3RSNA 2L4AA 2ECBA 2QKLB 1GVJA 1UB9A 3LMMA 3FXJA 4M3FA 2X6OA 1MSFC 3BP8A 3S15J 1E17A 3FZVA 1GLNA 1T0FC 3GTQJ 4AIHA 4RGSA 1XCVA 3S8PA 5L3CA 5FRNA 2LFBA 4XKVA 3F6OA 3K7AJ 2LF8A 4EMSA 1MMGA 1ETVA 2CS3A 4KT5C 3E5QA 3E3VA 2V1NA 4D7MA 1JGGA 2R93J 1AHDP 1UG0A 1Z77A 1TQIA 1KZHA 3V8LA 2STWA 2NXNB 4ESJA 4IHYA 2HFHA 4DGWB 4MO7A 4RGXA 4UUTA 3O3KA 1MMAA 3TO6A 1PJRA 3V7CA 3CLQA 1OPCA 2CW7A 3GVAA 3BCBA 1RUOA 4N4OB 1VNDA 4W1UA 2GBYA 4IZZA 4OIQF 2B63J 2ZJPF 1D3YA 1R22A 3GF2A 3FHZA 3F6VA 4V2FA 3LAJA 1IXCA 4BY1J 1ZGWA 1PP8F 2W85A 3RPUA 2E5NA 4B48A 1YFHA 3IV5A 3ESWB 1BA5A 1YLFA 2VBXA 2AXTC 2DMUA 4XRSG 2FRHA 1IF1A 3PUFA 3DLAA 4BBRJ 2VPLA 2ZFUA 3ROUA 3ONQA 1WI9A 5FB2A 1HC8A 3TW7A 3KPHA 3E97A 4P9FA 3R61A 1JT6A 1HKQA 4BEHB 2W24A 1D5YA 3LL7A 2ZNZA 1PYVA 5E1XA 1B72A 3KZYA 2A6TA 3QOEA 5JHFA 3P7NA 1OCPA 2V6EA 3K70D 3NRVA 4CA0A 3BWGA 3GTKJ 2EINH 4PJNA 1DDNA 1FBQA 2FEZA 4GYGA 2DA4A 3BROA 2WB1A 2ZFWA 1S8NA 2FD5A 2PFBA 1I1SA 2BE5F 3NWSA 3QPLA 2E71A 3OIOA 2GA1A 4JQFA 2IJLA 3I4MJ 3RCOA 4CUGA 1I6XA 4E70A 4HDVA 2ME6A 2IS4A 1W0UA 4NC7A 1KGSA 2RQQA 1LFBA 2V26A 2L7FP 2BY2A 3KP2A 3CF2A 2HS5A 1Z9CA 2NS0A 1RI7A 3KEYA 4C2TA 3M9AA 4TV7A 2M0CA 4HPQA 2E1NA 2M30A 2QVOA 3H5AA 3V8JA 1H9GA 3OYDA 1IN7A 1F4KA 3OIPA 1PUFA 3QPTA 5TGTA 4S04A 6PAXA 3OYIA 2BXZA 4HNUA 4OWRB 1WJFA 2M8EA 2WAEA 1KU7A 3D1NI 4Y17A 2KIUA 2DI3A 1ON1A 4XN3A 3J7ZI 3ZQIA 2W84A 3QYEA 4ENMA 4HX8A 4HV6A 2OTLI 3RTRA 4M73A 5E8IA 3KX2A 3IC7A 2NS7A 2VPRA 3LWFA 4OAZA 4Y15A 1IUYA 3AKZA 4RM3A 2Z33A 1YJNI 3N05A 1Y6IA 1AA7A 3PSIA 3GCMA 1HLVA 1Y0NA 3WTUC 4V19K 2LREA 3DFGA 4FCYA 1SFEA 1D8KA 2QSHX 1WWXA 2WADA 3OYMA 3BTIA 3OOUA 3PFIA 3E0JB 4L5IA 5EDNA 3RKWA 1OCOH 1Z1DA 3BQYA 4XOTA 3CJQB 3SYTA 3HM5A 1R9TJ 2VIXA 2HVQA 2RQPA 1J2XA 1FNNA 2H1KA 3HPGA 2BHZA 3K1MA 5EJCA 4IRIA 2K9MA 3GTPJ 2MGQA 2Y48A 4MTDA 2HNHA 4LB5A 3BPVA 5KNLA 3LFUA 5HLIA 2DJIA 3U2RA 2PMUA 4ENKA 3ZQQA 1W36D 3E1SA 4WXDA 5ILVA 1WGXA 1T33A 4A0YA 2QSFX 3FXOA 1A36A 2CG4A 2ESNA 4PSWA 1BW5A 3M1CA 2VQCA 1TC3C 3HKZA 2LTPA 4L0ZB 4AIKA 2K86A 3G1LA 3GLXA 2NVTJ 3WGHA 2MC4A 5GPCA 3IWZA 4DYCA 3ZQ7A 2ID3A 4HA8A 4A69C 4KN7X 1OYIA 4FX4A 1Y0UA 4XNFA 3BR1A 2VLAA 2HEOA 4RM2A 1TT0A 3JSPA 3W2WA 4R8HA 3TO9A 1JT0A 2CV0A 1I39A 2JUCA 4PJLA 2PBIA 2HQNA 4M72A 2W57A 1YW8A 1XPXA 3AL0C 1OCRH 3HYIA 2FNPA 5F0CA 2ZC2A 3CCYA 4D5CA 1K61A 1KYWA 2L7ZA 2NYXA 3WHCA 1YQAA 3P9IA 1OCTC 2W25A 2KIMA 3LQQA 4A3FJ 1P4WA 5E1WA 5DS9A 2PI0A 2E7WA 2IEKA 4KIGA 1OR7C 2VJJA 5CQEA 4XICA 5HDNA 1TW2A 2GZWA 3GZ5A 1AWCA 3O8GA 3E6BA 3IH4A 3SDBA 5IY5H 2TRTA 2V1UA 1JUMA 2Y9YA 4RB2C 4HQEA 3F8FA 3A01B 2EV0A 1MJ9A 1X2MA 5HS7A 1OJLA 2HVRA 2NS8A 4DBQA 4KUMA 3X2QH 1STZA 2LC2A 4I76A 3JCUC 4WXCA 1B6AA 3ZMDA 3KFWX 1VQ6I 5GTIC 3ERMA 4BAYA 3Q9VA 1K4SA 4AC0A 2AO9A 5EZGA 3KCCA 2IA2A 4NC8A 4C2UA 1TNSA 2ZXWH 1IXSB 2QF7A 3S32A 5F6FA 4OMZA 2OQGA 3FXMA 4AUXA 2GIZA 3PFYA 4XL9A 5E1ZB 2HTSA 1QQIA 4HG2A 3VYTB 1V5EA 5D5UB 1VI0A 1T56A 3GX4X 3T5XA 3VODA 1L3LA 1SD7A 5E3MA 2IT0A 3PNVA 5J1RA 2DFIA 2PX9A 3ZCOA 2ELHA 4X1EA 4GXOA 5CVJA 1IRZA 3KYDB 3SFIA 3SQNA 2FE3A 2PLYA 1ZG1A 2DXIA 2WA0A 1MBJA 3CCLI 2OC6A 2HQ5A 2OBPA 3I59A 2JWTA 3OL4A 4NC6A 3LA7A 4G7ZF 1XSXA 3VSKA 1H89C 1U78A 4PFPA 3I4NJ 4G6DA 5DEQA 1B8IA 2WY8Q 2CV2A 4JP0A 1R6RA 5ICEA 1U5TA 4HF1A 1OCZH 5IPAA 2XAFA 2R7FA 2MA3A 3QRFF 3G73A 3WTSC 3ZN0A 3CMEI 4BU2A 2A5YB 2QSGX 4YFNF 2IA1A 3CP2A 2OJED 5H6RA 1ZHFA 2KPMA 3M3YJ 1PVEA 3CUQA 1YIOA 3QPSA 2JJ7A 5J4VA 4A3LJ 4A6EA 1QPMA 5HDGA 3G6EI 3PNYA 2MFZA 2O03A 3WODF 4CICA 1O4XA 1R5HA 2VC1A 2Q0OA 3L1PA 1LB2A 1HA8A 2F5VA 2DO7A 5BPDA 2G7UA 2CUZA 1S6LA 2EFPA 4KIFA 3WTZA 2DA3A 2FQ3A 3SXYA 4B44A 3FHNA 3J80Z 3TOBA 3BG5A 1W36C 3G1MA 2F4IA 5M5YJ 1CF7B 2DYRH 4A0ZA 1D0ZA 2DMQA 5GPAA 1IN4A 3QP5A 2Q2EA 4KISA 3C1DA 4CCLA 4O6JA 1ZH5A 3AG3H 1WJDA 2BVMA 4ZTFA 3MKLA 1RRJA 4BJTA 2OA4A 3MD2A 2GOXB 2V7FA 5ICFA 1VZ0A 1OLTA 3OWTA 2ZNYA 4M3BA 5K5RA 1W5CC 5FO5A 3OYHA 1YRNB 2EFQA 3TDUC 1MNMC 4ZYAA 2DDBA 2XGDA 2EB7A 1FP1D 2V9PA 3PNTA 1AU7A 3KP7A 3KP5A 4RBOA 2E5ZA 4KA4A 1TT5B 1U5TB 2QA4I 3M7GA 4CSWA 4RAZA 3V4GA 2EK5A 5BMZA 1IZ1A 2OV7A 4EVIA 1KONA 2M8GX 4NDLA 2IP2A 3OYCA 1XGOA 2DYSH 2DTRA 1X1DA 2RKHA 2N8GA 2VOOA 3E6MA 2BZTA 1GT0C 3GFMA 3KIOA 5FD5A 2R5ZA 4B47A 5HODA 1SAUA 2ECCA 4CZCA 2Y0MA 2BYVE 3DPTA 4A6DA 4G6TB 3K4BA 3NARA 4ENJA 3K10A 4L5JA 2CW0F 5CQGA 3WTTC 1HSTA 4XKCA 3IUOA 3VEPA 2XF6A 2DW4A 4AVZA 4A3IJ 4HOBA 1T38A 2K40A 1FOXA 3T8TA 4IOCF 1BI1A 2KQRA 2VN2A 4F93B 3FXQA 1TZLA 5FLVA 3RKQA 3GWZA 1XSDA 1JUSA 2LYCA 4X0GA 5FKMA 2IGMA 3MCZA 4BDYA 4HF2A 1EJ9A 2E1OA 5HNHA 1FBSA 3LOCA 3J7AO 1KQ8A 4GFBA 1BI3A 2LDUA 4PGGA 3JAMK 3BJ6A 3DTEA 3EDPA 3VYUB 2GM4A 2I5UA 1J59A 1YRNA 1USSA 1YS7A 2ZJRF 4E7LA 4XKBA 5TJJA 1GV5A 3AG1H 3FK7A 3ZR8X 4M3GA 1X19A 2NVXJ 1ZR4A 3B73A 1FP2A 2H09A 3LA3A 1P92A 4DYRA 1V5FA 5FKOA 5L3EA 2IGNA 3EUAA 1G3WA 5IYDJ 3C7JA 3MFKA 1P4XA 3ABTA 4ESBA 2L02A 1U8BA 3K4NA 3NEUA 1FX7A 1U9NA 1I1GA 4G6QA 4Q48A 2VODA 3CCVI 2VBYA 2X1DA 3IH3A 1BL0A 3DCFA 3H9GA 1EH8A 4IRGA 4F3QA 1P7IA 4HSRA 3OSGA 3HIFA 3BZKA 4KJZA 2DDAA 5F64A 2K85A 1SFXA 5EEAA 1R5ID 1XMAA 4HF0A 2MH9A 2VE8A 2R5YA 3HG9A 1V5GA 2WB1N 2ZXIA 5KHDA 3LSGA 2XAQA 4CGZA 3JRDA 1JUPA 1D1AA 2DLLA 3FBNB 4I7HA 4UVCA 3TW6A 3I56I 5LHGA 2QKMB 1DU0A 4XSZF 2L4MA 4IHVA 1R00A 3L2WA 2ISZA 1U6GA 4PCQA 3G2BA 4L0YB 4XN0A 5CYVA 3R6SA 3S2WA 2I8DA 2MYSA 3GMEA 2W48A 2LKPA 3DEEA 2HTJA 1YYVA 4AVPA 1LPQA 2RV8A 3K70C 3WTYC 3HRMA 2JN6A 1ZG5A 1POGA 2XUBA 4LITA 1J09A 3SZPA 2P5LC 1YHQI 2VJ5A 3MKZA 4QWQA 4P1WA 3CC2I 2QQAA 3FKIJ 2HZTA 1JGSA 4XOPA 1Y8QB 1W5SA 1OFCX 1F43A 2DOFA 3I58A 2GAUA 3BC8A 2BY3A 3K2AA 4Y52J 1KA8A 2K5CA 3K4LA 4EJOA 1ZELA 3HOTA 4K2EA 4X6AJ 3GTGJ 2H6BA 2XB0X 2XRNA 4J01A 1OYWA 1S7OA 2VBZA 3HEFA 2OZ6A 4F52A 1J9IA 1VQOI 1PUEE 1XX5A 4N4NB 4P5OA 2EPFA 2DA7A 3PO3J 2XDVA 4AD9A 4UVBA 1A31A 5E79C 4LOCA 1XS9A 3MMYB 2F4OB 1TQMA 1O3QA 3I3LA 1RUNA 1S72I 4PZJA 3N4MA 4ANJA 2LRDA 3BJOA 3OIQA 2AQEA 1ODDA 3WGGA 2RGVA 3HRSA 3PO2J 2A07F 4BUPA 5KVRA 3CZ6A 5KAFC 3HUGA 4C2MJ 1OCCH 1IRGA 3HOUJ 2FJ1A 5D6FA 3TMOA 4AU7A 5B1AH 4BBSJ 2O8XA 4OU0A 4RDUA 1IUFA 2O5RA 1VTNC 3BPXA 2QYOA 3GUDA 3L7WA 5J3LA 3HZJA 4DZJA 5HNFA 3SZGA 3PL8A 1QHHD 2M0MA 4NQWA 2H8WA 4BGDA 5DM6F 2K4JA 4HRIA 1LVAA 1O3TA 3BR5A 3WHBA 1IAWA 2NRAC 3A03A 3WG7H 4HLYA 1FSEA 2FF4A 3CUQC 4F92B 2OCEA 2O0YA 4JK1X 1XG1A 4OINF 5LEJA 1W4MA 1SANA 5J6XA 4U7DA 2LKXA 3HJEA 4PJJA 4B3XA 1I50J 3TOAA 2GWRA 1R1UA 5AONA 2EQRA 4LK1F 3C2GA 4YFKF 4GYIA 1NK2P 3G3ZA 3LSMA 1SD5A 1R4NB 4XMYA 1LFUP 3OYAA 2F48A 2R7UA 1UJ8A 2HQAA 3Q0UA 3EPZA 1YO5C 1LUJB 4FT8A 2R7TA 2XASA 2H6CA 3F8BA 2R7ZJ 2XF7A 1TQPA 1ACIA 1HSJA 3H3ZA 4Y13A 5C44J 2EZLA 3E5XA 3I4PA 2R3SA 3HHHA 4ZDLA 3HOYJ 2BOLA 5E17F 1R7JA 4KIBA 2DPDA 2K27A 2I10A 4W97A 5K7FA 2XF5A 3ABKH 1ZRDA 2EV6A 4HSTA 1LE8B 2HYFA 1LFPA 3BLYA 1T2KA 4ZH4F 2E1MC 2MLKA 4U7BA 1W7PD 3BZ6A 3BG6A 2VQLA 1WI3A 1XSVA 4MTEA 2HQRA 2X6XA 3FISA 1LQ1A 1KQ9A 3LFKA 1IRXA 4LJZF 2X1EA 3HTUA 1FY7A 2IGKA 3RJPA 1Y1WJ 4HX7A 4XR6A 3HGGA 5DD4A 1BJAA 4BXUA 2A6EF 2DA5A 5CVRA 3OY9A 1YX3A 4AIJA 2KIQA 2CW8A 2XC7A 3K4KA 1FYLA 4PJMA 5BNGA 1RETA 4JYKA 5KCMA 4QSHA 4OIPF 3CD6I 4G12A 2F4MB 2JA5J 1BOAA 5DUIA 2P5KA 4MFEA 2X0LA 2ZSIB 4LIVA 2J5OA 2IA0A 1ENHA 2ACJA 2CJJA 4EM1A 2VKEA 2QQBA 4BE0A 4WWCA 4CZZA 3F8MA 4ZC3A 3FM5A 1Z0XA 2HKXA 3FXRA 2JA8J 2MLGA 2L9VA 1Z91A 2M2EA 3ZMSA 4IPAA 1VQ7I 2YX4A 2M1BA 2DCEA 2HXOA 2JVGA 2DK8A 3ZN1A 4HX4A 3PIPF 1HBXG 1I27A 1MJBA 4PGHA 2CQKA 1SVLA 2D45A 4KFCA 3JRBA 2G0EA 1A35A 1ZYRF 4N0BA 3CUQB 2K4BA 4BH9A 4R79A 1R23A 4XLAA 2G7HA 4LG0B 4UUSB 3K1NA 3L09A 1JE8A 2RC4A 1ETWA 1LDKB 1WKMA 2WAQN 3I64A 1RR8C 1X3ZB 3I53A 4ZYHA 5D4RA 1WRJA 1K6OA 3I0TA 2LLKA 3TO7A 1X1PA 1Z6RA 4KMFA 2CU7A 2KDOA 4H4KC 3OYJA 3F21A 1BM9A 3HHGA 4BXFA 2JK3A 2FSWA 2K9LA 3FXKA 4LD5A 5LHHA 1CF7A 1RKWA 2WBMA 1RC9A 5FKKA 4CCKA 4I0BA 2YS9A 4RGRA 4MIMA 1D1BA 2DMPA 2R7XA 2LSOA 4EJTA 3DWLE 2VXZA 3C2BA 4DZPA 3H9JA 1WVRA 2IXSA 5LBQA 1OMIA 2K9SA 3L00A 4GGGA 4E7ZA 1Z7UA 2OZUA 4G7OF 5K1YA 3GTJJ 2DU9A 5CVVA 3FMQA 2RVCA 4IHSA 4BQNA 4IHWA 2EIJH 1SC7A 4KNYA 3MZHA 2JPBA 2JRTA 4RS8A 1Z3YA 2B0LA 1G8XA 2RREA 3I5UA 4HBLA 5M5XJ 1CGPA 3JW4A 2WWYA 3QYBA 2W00A 2DT6A 5K7HA 2DFEA 2V9KA 4L9NA 3ABLH 4N9IA 5DTDA 4CYCB 1Z7LA 3O2PE 3GBGA 4LMYA 1MNEA 1ON2A 2JRMA 2X4HA 1GV2A 1MZBA 1T0FA 3OS2A 3DTKA 2L7MP 1WJ5A 4RMNA 3F72A 2LP0A 1LNWA 5B66C 4MLOA 2VQGA 3B02A 2F2EA 1LVKA 4XSXF 1RKTA 4KN4X 4Z6YA 1V55H 2LY2A 2HOAA 3RZOJ 3GTMJ 2K3PA 2ZSHB 3CTAA 1D0XA 1B8IB 2DK5A 2HDWA 4NB5A 2XPWA 2F5CA 3VPRA 2O61A 1K78B 4MEYF 1FOKA 2GOMA 3T8RA 2BXYA 3BR2A 2PJRB 4BJ5C 2EZIA 2MBFA 4G94A 1DP3A 1ULYA 2XSJC 4HLXA 2HU9A 4EJUA 5EZHA 1FEXA 3MEXA 1DP7P 1D1CA 3DTIA 4MGRA 2H1LA 3VDXA 1NHAA 5E3NA 3S3MA 3HL2A 1D0YA 3HPHA 2F5DA 4RLFA 1QRYA 3S3NA 2BV6A 4UXNA 5HVQC 2XSDC 4HEA2 1S7EA 3ZQGA 4EV0A 4XBFA 3H92A 4F7ZA 4M3EA 2EA2A 2ETHA 2FMLA 2FOWA 3DU5A 4HDUA 4E7JA 2ZXJA 4BHBA 3OSFA 4CCMA 3LQRA 2A3SA 1KU2A 1HXDA 3OYGA 2D5VA 3ZPLA 3QP6A 2FBHA 4QTRA 4Y7NJ 3WTXC 2CMPA 3OV8A 2HYJA 4E7SA 3CMAI 4AM3A 2CH0A 3TGNA 3ABUA 4XRFA 3UR3C 3J81Z 1V54H 3TL4X 2P81A 4A5MA 3J80K 2Y9ZA 1K7AA 1REPC 2EWNA 1R1TA 1B4AA 1SMTA 3MKYB 3DLLF 1A6QA 3OR1C 3HSFA 4C30A 5F0HA 4DYQA 4I02A 1G3SA 3UNGC 5FFXA 3H35A 1FOYA 2IS6A 1TP4A 3NQOA 3SHFA 3JRFA 1V4RA 5BS6A 3QWLA 3FK6A 4CYDA 4OIOF 1QHGA 2CYYA 2R7QA 1GXQA 3JRAA 4EM0B 2HKOA 4QPQA 4AYBA 3WU0A 3VB2A 3U1KA 5C4JJ 2Z2SB 2R4GA 4M9XA 2R92J 3S2DJ 3ASNH 2K3FA 4XONA 5GP9A 4DW6A 4YFXF 1EV7A 4M6YA 5C3EJ 2KISA 1HF0A 1U0JA 5D5WB 1ETQA 1BJZA 1F9NA 5F08A 4IHTA 2ELJA 3TEDA 2DOEA 4BHCA 2MH2A 2COMA 3CF5F 3BTCA 4CCJA 4FE7A 2P0WA 4UVAA 2UXXA 1MMSA 1X1AA 3ZXSA 3REOA 5A2QK 3ABMH 3QU3A 1KYZA 4XLCA 1IGNA 2VKHA 3G4SI 3CCQI 4II3A 4WX9A 4WXHA 3PIOF 1SD4A 1MMDA 3EUHC 2ID6A 1GXPA 2EFNA 3CCEI 4IHXA 2XVCA 4XIDA 1UHSA 3I71A 1WFXA 2JSPA 4ZZLA 1S7AA 1Y39A 2CO5A 5ILUA 2NOJB 4LG0A 3WE2A 2QLZA 3H5NA 4J00A 5DV5A 2ZXHA 3DKYA 1VQLI 2EJRA 4H0EA 3I54A 4I09A 4ESFA 2CWEA 2HZDA 1N77A 1BR2A 3KP3A 3C2HA 1O3SA 1RIOH 3QQAA 3A0BC 5HLGA 1XC5A 3OYFA 4S0HB 4XLNF 2COBA 4ZJZA 4KDPA 5L3FA 4KYWA 3M8EA 4A12A 4B1RA 1RPWA 3KEOA 1YW7A 2KRHA 3GW2A 1D8JA 2X48A 3EYYA 4C3JJ 1ZLJA 2E2HJ 1NH3A 3ZMZA 4F91B 1F1ZA 3EETA 5HLHA 5EG0A 1JKPC 4A3JJ 4EM2A 3HXLA 2L7KA 2BHYA 4XM3A 4WCGA 4BNCA 3K2ZA 4BEHA 1XGNA 2VL8A 3RYRA 2R7VA 3BT9A 2WV1A 3G71I 1K78A 4BE1A 3FWEA 3CJTB 4C9YA 5A2QZ 3SEZA 4EJVA 3S1QJ 2VKVA 1R49A 2IW5A 3IRRA 4IX7A 2CV1A 2QM3A 2HYGD 1WHUA 3CQZJ 3F9KA 5L3GA 2TDXA 1IV6A 2MG4A 3LSHA 5BQTA 1X1BA 2HWVA 2KRFA 2YX7A 2DODA 1HW5A 3KYCB 4ZDOA 2KJBA 5D5XB 2JT1A 2NAZA 1X1CA 2D2WA 1U9OA 2BW3B 2F5EA 5CKTA 4NHJA 1P2FA 3OYBA 1J75A 3OOPA 4A3MJ 4N9HA 4YIIA 3A0HC 3TP0A 2PG4A 1SMYF 3KLNA 2JA6J 1XD7A 4IO9F 2OF7A 3IP4B 1TL8A 2KJCA 2RNJA 2L9RA 2XKPA 2HDDA 3IL2A 2V1DA 2V9VA 3M8JA 3TBIA 1MKMA 5EYRA 4KITB 3WE3A 3L2CA 2ESHA 1S5LC 1WQ2A 2E36A 2ZMEB 5EF6A 4L9VA 3BQZA 2ELKA 4QIWN 3HOZJ 2E19A 5D4SA 2JVHA 4IRHA 1B1BA 1R5GA 4LIUA 5FKLA 3CCRI 1K6YA 2JPCA 1BI0A 1ZN2A 1A6IA 4XK4A 4D1QA 3P9KA 4E7HA 1BBYA 4II2A 2H94A 5CVUA 2E2IJ 2VASA 4A3GJ 3MKWB 3JAMZ 4EEFG 4JBAA 2CUJA 2FBKA 1V3FA 5H2FC 3F22A 1AKHB 5EG0B 3DU6A 2E1MB 4Q5SF 3ZMUA 3GZ6A 3HTSB 1HDPA 3DQVC 4P96A 3MN2A 4EGZA 3DP7A 2KLOA 1ZARA 4CHUA 3JR9A 4E7KA 2Y0SA 1T6SA 2CQQA 4XLEA 3ZMTA 5JFRA 3JRIA 1R4MB 2WAQA 1WJAA 5JHUA 2ZMEC 2XAUA 3OL3A 2V1XA 5DD8A 5GTHC 5E20A 3LSTA 4ITVA 3C18A 3ZGKA 2X1CA 2Z3YA 1XB4A 2R7OA 3DBRB 5TISC 1H0MA 3DPLC 1TW3A 1IV8A 5EEGA 3FKJA 3DKXA 5E3LA 2XPVA 2R5ZB 1H88C 3R0JA 2CRGA 4YELA 3BOQA 5DUKA 3RQ4A 3AL0B 2IS1A 2O8KA 2QENA 3BY6A 4B09A 5LHIA 5CJ9A 3F23A 1G4DA 1O7LA 3M8FA 3CDIA 4PK4A 3HBLA 3BG3A 1XDUA 4UV9A 2XRLA 4G8XA 3CC4I 5J47A 4UV8A 4LGWA 2GIVA 2LY1A 5FGMA 1E3OC 3EUHA 2BY0A 2EH3A 1MH4A 5ICCA 3CO6C 2VBWA 3CCMI 2DPUA 5D8KB 3S1NJ 4DIQA 4A3EJ 1DUXC 3HC7A 3BR6A 3ZQCA 4GO1A 1Y56A 3CJRB 5ERIA 2HPIA 1W0TA 2LD5A 1ZG3A 3UKGA 1XGMA 1DQUA 2KFDA 2MW8A 1VQPI 1JKRC 2L3DA 5E18F 3A2KA 2PN6A 4IXAA 4ON0A 4OOIA 4IJAA 4MQ9F 3E6DA 3JSOA 1MBEA 4YRVA 2AS5F 4MFDA 3D5LA 5K7ZA 4LLNA 2IVMA 3D5SC 1R71A 2EZKA 2ISYA 5LGNA 3GTOJ 2VQHA 3RDIA 3F3XA 4GDFA 2CQ7A 5LFAA 1ZAOA 4YEJA 2KDZA 2QUFA 3BJAA 2BBYA 1Z05A 2DT5A 1A04A 2HPMA 4G9YA 2W82A 1X4OA 2HDCA 2XV4S 4LLLA 2L9SA 2R0QC 5FFZA 3LNQA 2YR2A 1L0OC 1C0WA 2WV0A 1SVOA 3CLOA 1JTYA 2DAOA 4ZZDA 2M4KA 4M6VA 3OYKA 4ENNA 3D5RC 4RGUA 3D0SA 1JJ6C 2STTA 3CMMA 5E3OA 1E0EA 4A5NA 2BW3A 5LRSA 3AAFA 4I0AA 2LBFB 2P8TA 1UHMA 3H9QA 4QPOA 1JKOC 1E2XA 2KKOA 3JTHA 1HOMA 2JA7J 1MD0A 1QVTA 1UELB 1DPRA 3Q3SA 4BJ6C 1SFUA 5D8LB 3S1RJ 3MAJA 2VC0A 2KZGA 2ME0A 3IKTA 4BXXJ 2L2OA 2M4GA 2FX0A 2OTJI 3GEZA 1WJEA 1EH6A 1MW7A 1HCRA 4NQWB 3GO5A 2KP6A 4JX5A 4PSXA 5IT9Z 2V79A 1WPKA 2GA2A 1VF9A 1MH3A 3QPHA 4UB6C 3GFIA 3BTJA 4LG3A 1FTTA 1ZQ3P 3K4MA 2EA4A 3E5UA 1VQKI 4HAMA 3H3UA 2FOKA 3M1EA 3HUGB 2HI3A 2CSOA 3OYLA 5LEKA 4B4CA 3ZMVA 3TDZC 3CMYA 2IAIA 1WJCA 2EV5A 2BEOA 4RA2A 2OQRA 4BE2A 5HDKA 3BG9A 2Q8KA 1EH7A 3F0CA 3HOXJ 4KMUX 4RAYA 5IYBJ 3P5JA 4UB8C 1FYKA 2RN7A 1K4TA 2QCOA 2Z5UA 3CCSI 4M3DA 5DYMA 1YE9A 1QPIA 4WF2A 5JLWA 5FLXZ 1BW6A 3H3VK 2R7WA 1FPQA 2UUZA 1BR1A 5L3DA 1XN7A 1JJ8C 3S1MJ 3S2HJ 1TWFJ 4OAYA 2K7LA 3BDDA 5FJ8J 1LJ9A 3H1CA 2Y0SN 4PDKA 3K0LA 3M07A 4I01A 4CH7A 4XLHA 2PQ8A 3O8HA 3WTVC 3CDLA 2ADUA 4ZYGA 1YJWI 3L2VA 1OQYA 2LK2A 1I5ZA 4LB6B 1E3HA 3E7LA 3U21A 5CLSA 2B9SA 3KLOA 1I6HJ 1QA6A 4CXFA 1T39A 2OCCH 2PMZN 2JMWA 2PEXA 2A6HF 2Z99A 1FJLA 4FTHA 4EATA 2R7SA 3DBHB 2M5WA 4ETSA 1YITI 4XRMA 1PUFB 1G59A 3IAS2 2KIFA 2E1CA 2M3AA 5JI6A 3CJNA 3T1BA 2VKDA 3K9TA 2LKSA 1QNTA 3PQJA 1B9NA 3F8NA 1YI2I 2XGCA 1YJ9I 2JA2A 1F5TA 3OYNA 4CO8A 3W2VA 4LK0F 3OS1A 2KZVA 2DFHA 1ERDA 5J8CA 3IAM2 1FIPA 3HGYA 4IQJA 5ICGA 3P9CA 4XLFA 3DPUA 3TQNA 4ZYDA 4LLGF 2UV1A 2M34A 2Y69H 5J4YA 3CDHA 1X3WB 2V6CA 4P55A 3V7SA 2AQFA 3FIWA 3K4JA 3TP3A 3A4CA 3CP8A 4E7IA 1YIJI 3AG2H 1LDJA 3OYEA 5TRDA 1W7PA 4HZFA 4CCOA 1BC7C 3QAHA 3HOWJ 4IVNA 2CQNA 3MQ0A 3MVPA 2GXAA 4GRIA 3LSKA 5HS9A 3PQKA 4IQ4A 4HW0A 1HKSA 1RR7A 3A1YA 4Z2YA 1APLC 3W2AA 1TNTA 1FMVA 3O6BB 3J7YJ 2M45A 2ICWG 3B6CA 3PM1A 1QZZA 2QWWA 2E2JJ 1FWZA 3K1PA 2DJNA 1MGTA 4M9ZA 1Y8RB 2A68F 1YX5A 2FNAA 3T0YA 4A3BJ 4U88A 2JTVA 1TTYA 3Q0WA 5EGOA 5LGTA 3ZQHA 1UZCA 2M87A 2KT0A 3ZOBA 1ZGAA 1VQ8I 2NVQJ 5AIPA 2MD0A 4CCNA 3KP6A 3Q5FA 2VUMJ 1QZEA 3WGIA 2RAEA 3ML6A 3KEQA 4Y3OA 3HSRA 3RIRA 4A3KJ 1XCBA 4FX0A 4OIRF 1IN5A 1W7PB 1WH7A 3EUKL 3VYSB 5GAEJ 1X3UA 2JUGA 1NK3P 3DF8A 3RQIA 3CESA 4BL0B 3GFJA 4D7NA 2E34A 4RAGA 1GUUA 2BVLA 1U8RA 4L18B 4IF4A 2A5WA 4AWXB 2HOSA 1FOWA 4Y4RA 1ZKGA 4B43A 1H8AC 1JHHA 4FE4A 1TWHJ 3IH2A 3WU1B 1QZYA 3KETA 2DA2A 1B59A 2LG4A 2W4SA 1NTCA 3S17J 3HOVJ 1MSEC 3PUBA 2KRCA 1SFOJ 2EBIA 4HNTA 4MQVA 2L0KA 4RLQA 4BDZA 2DTZA 4A2UA 1PP7U 4WK8F 1T98A 1MNDA 1YW9A 5C4XJ 2EILH 4O5VA 2VJ4A 1G2HA 3H36A 2Z9OA 3FBIB 3W6JB 4JOMA 4BACA 1FZPB 1D5VA 1JI8A 3GXOA 2K02A 3ZQFA 2XROA 1SAXA 2K9NA 2LNBA 4FISA 2OU2A 1LE8A 3FMSA 3A01A 1YOVB 2XGXA 2DT7B 1JKQC 4I2OA 2FMYA 4IEJA 5ILSA 2XKOA 1F36A 4BY7J 1FBUA 2CUFA 2Z16A 2VE9A 4BQQA 1LDDA 1IRFA 2QBYB 3CUOA 4ASNA 4CYCA
chains in the Genus database with same CATH topology
4BBRJ 3TW6A 4B3AA 1XC5A 5IP9J 4S0HB 1A5JA 2COBA 1DU0A 4B1RA 3TW7A 3SDGA 4IHVA 1RPWA 1JT6A 2DA6A 2Y31A 2O9LA 5EGOB 1D5YA 2X48A 4C3JJ 4A93J 2E2HJ 2O7OA 2W48A 1MBKA 1B72A 2Y2ZA 1OCPA 5EG0A 3S16J 1JKPC 3GTKJ 4A3JJ 2JN6A 5J1YA 1POGA 2K9QA 1TWAJ 2DA4A 2FD5A 3QPLA 3BT9A 2WV1A 3OIOA 3BTLA 3FKIJ 3I4MJ 3Q0VA 1QVUA 1OFCX 5FLMJ 1F43A 2ME6A 1W0UA 3S1QJ 2VKVA 1LFBA 2L7FP 2EZHA 3K2AA 4Y52J 3B6AA 3BR0A 3CQZJ 5JLXA 1IV6A 2MG4A 2XGEA 4X6AJ 3GTGJ 2XB0X 4AYBN 2M0CA 5F0FA 3HEFA 2YU9J 1U9OA 2DA7A 3PO3J 4A3MJ 4LOCA 5IYCJ 1XS9A 3TP0A 1PUFA 2Y30A 2JA6J 2OF7A 2DMTA 1ETXA 1I3QJ 2L9RA 2HDDA 5EYRA 4BKXA 3D1NI 1ZR2A 1ETYA 3PO2J 5EF6A 3ZQIA 3BQZA 2ELKA 4QIWN 3HOZJ 2E19A 5FKLA 4C2MJ 2OPTA 3HOUJ 2FJ1A 2NS7A 4BBSJ 4XK4A 1A6IA 2VPRA 4RDUA 1IUFA 2AHQA 4A3GJ 2E2IJ 2M9HA 2ZB9A 4EEFG 5F04A 5J3LA 5M3MJ 4ABZA 1AKHB 4DZJA 5EG0B 1HLVA 3HDDA 4UUSA 1ITYA 4C3HJ 4FCYA 1HDPA 1IDZA 3MN2A 3BR5A 3WHBA 2XB5A 3A03A 3BTIA 3OOUA 3JR9A 2CQQA 3JRIA 5EDNA 1B72B 1XG1A 3BQYA 3HM5A 1R9TJ 1SANA 3S14J 2LKXA 1MBHA 2H1KA 3GTPJ 2MGQA 1I50J 1IJWC 2EQRA 5E3LA 2XPVA 2R5ZB 3H0GJ 1H88C 2TCTA 1NK2P 5M5WJ 2CRGA 1WGXA 1T33A 1LFUP 4V2GA 1BW5A 2O8KA 1TC3C 3Q0UA 2R5YB 2CQXA 2LTPA 1DU6A 5IOZA 2R7ZJ 4C3IJ 3G1LA 2NVTJ 5C44J 5GPCA 2EZLA 3HBLA 3BG3A 4DYCA 1MBGA 2XRLA 2ID3A 4A69C 3HOYJ 2LVSA 2I10A 4W97A 3BR1A 5K7FA 1E3OC 1TWCJ 2EH3A 4J19A 1MH4A 2HXIA 3S1NJ 4A3EJ 1JT0A 1LE8B 3BR6A 3ZQCA 1W0TA 2LD5A 3UKGA 3LSPA 3BR3A 2MW8A 1JKRC 1ZK8A 2NVYJ 3HB9A 5F0CA 1WI3A 3CCYA 3LSRA 4D5CA 1K61A 3FISA 1RESA 2L7ZA 3WHCA 1Y1WJ 1K83J 3HGGA 1MBEA 2X9DA 1OCTC 4MFDA 4A3FJ 5DS9A 2DA5A 5K7ZA 2GLOA 2IEKA 2EZKA 4XICA 3GTOJ 3JRGA 5BNGA 1RETA 4JYKA 3O8GA 2KDZA 4QSHA 3IH4A 4G12A 4A3DJ 1TWGJ 2JA5J 2TRTA 1JUMA 2Y9YA 4MFEA 3DEWA 3A01B 1ENHA 2CJJA 1WCMJ 2R0QC 1X2MA 2VKEA 1OJLA 3LNQA 2NS8A 1X2NA 1JTYA 4M6VA 1Z0XA 4I76A 5IP6A 2JA8J 2DN0A 1JJ6C 2M2EA 5E3OA 5FKNA 1GDTA 1VFCA 2HXOA 4AC0A 1JKOC 2AO9A 2LR8A 5EZGA 1HOMA 1WH5A 2JA7J 1QVTA 3Q3SA 2G0EA 3JRBA 3S1RJ 2QF7A 2XPUA 1P7JA 5IOYA 4AUXA 2ME0A 2HOTA 4BXXJ 2FX0A 1VI0A 1T56A 5J1UA 1HCRA 3NAUA 5E3MA 4JX5A 4UUSB 5J1RA 1WPKA 1Q1VA 4X1EA 3HKZN 2YUSA 1ETWA 1MBFA 1IRZA 2WAQN 4D5FA 1VF9A 1MH3A 2H8RA 3SFIA 1FTZA 3BTJA 1FTTA 1ZQ3P 1ETKA 3M4OJ 1MBJA 2LLKA 2HQ5A 2CU7A 2JWTA 2HI3A 5M3FJ 4B4CA 1H89C 1U78A 2JK3A 3CMYA 3I4NJ 2IAIA 1B8IA 2VI6A 4JP0A 1RKWA 3JRCA 3BG9A 5FKKA 5IPAA 1ETOA 2YS9A 4MIMA 4JX6A 3F0CA 2DMPA 3HOXJ 5IYBJ 4A3CJ 1ZTRA 2QCOA 3C2BA 4DZPA 4M3DA 1JTXA 2K9SA 1QPIA 4I6ZA 3H3VK 5JLWA 3M3YJ 1BW6A 1FIAA 3GTJJ 1JJ8C 3S1MJ 3S2HJ 9ANTA 1TWFJ 3QPSA 5FJ8J 2JJ7A 4IHWA 2MSYA 2Y0SN 4A3LJ 3GTLJ 2NOGA 3O8HA 3CDLA 1O4XA 5M5XJ 3G1OA 2FQ4A 3L1PA 2LK2A 4HNVA 2IBDA 5K7HA 3E7LA 4XRSG 1I6HJ 5DTDA 1CQTA 4CYCB 1EF4A 2DA3A 2JMWA 2PMZN 3GBGA 1FJLA 4FTHA 1HDDC 1X58A 1GV2A 1PUFB 4XRMA 2L7MP 1UMQA 2LP0A 3BG5A 3LSJA 4MLOA 3JRDA 3G1MA 5M5YJ 2XGCA 5F27A 2DMQA 5GPAA 2DA1A 5IP7J 1RKTA 1IDYA 2HOAA 3RZOJ 3GTMJ 3MKLA 1FIPA 3HGYA 1B8IB 2XPWA 3VPRA 1Y1VJ 1IG7A 3BR2A 2EZIA 4M3BA 1FEXA 2M34A 5EZHA 2LY9A 1YRNB 1MNMC 3SJMA 2XGDA 1GVDA 5E3NA 1AU7A 3FIWA 3TP3A 1QRYA 4RBOA 3A02A 2XSDC 3W6VA 3HOWJ 1S7EA 3ZQGA 3MVPA 4JX4A 4M3EA 2M8GX 4NDLA 1RR7A 3JRHA 1APLC 3OSFA 1UG2A 2N8GA 2D5VA 4XRSA 4QTRA 4Y7NJ 1GT0C 2R5ZA 4L5EA 3RZDJ 3B6CA 5HODA 2HYJA 2ECCA 3PM1A 2E2JJ 2DJNA 3JREA 1AKHA 3NARA 2P81A 2Y9ZA 4A3BJ 3Q0WA 5F0HA 5EGOA 3ZQHA 4DYQA 4A3IJ 2KT0A 2K40A 1ORKA 3ZOBA 2NVQJ 2DMNA 2VUMJ 3JRFA 3FK6A 2RAEA 5FLVA 3RKQA 1IC8A 5F1JA 1JUSA 3JRAA 2CUEA 5FKMA 3ZQLA 2E1OA 2ECBA 4A3KJ 3LOCA 4GFBA 5C4JJ 1WH7A 1NK3P 4M3FA 2X6OA 3RQIA 1MSFC 2R92J 2GM4A 4D7NA 3S15J 3S2DJ 5GP9A 4DW6A 1YRNA 5C3EJ 1GUUA 1HF0A 3GTQJ 1ETQA 1BJZA 5F08A 2HOSA 1GV5A 3FK7A 1ZKGA 1H8AC 4FE4A 2LFBA 4M3GA 1TWHJ 3IH2A 3TEDA 2NVXJ 2DA2A 1ZR4A 3S17J 3K7AJ 1NTCA 3HOVJ 1MSEC 3BTCA 1ETVA 4FE7A 2EBIA 1SFOJ 2L0KA 1JGGA 4D7MA 2DTZA 4DYRA 5FKOA 1AHDP 2R93J 5IYDJ 1Z77A 1IGNA 4IHYA 5C4XJ 4MO7A 4UUTA 1U8BA 1G2HA 2ID6A 1U9NA 4IHXA 3IH3A 3ZQFA 4XIDA 1UHSA 2K9NA 1BL0A 4FISA 3DCFA 1VNDA 4W1UA 2GBYA 1LE8A 2B63J 3A01A 1P7IA 1JKQC 3OSGA 4IEJA 1F36A 4V2FA 4BY1J 5EEAA 4BY7J 1ZGWA 2CUFA 2R5YA 3IV5A 1BA5A 2WB1N 3LSGA 4CYCA 2DMUA 3QQAA 1JUPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BBR J;  3TW6 A;  4B3A A;  1XC5 A;  5IP9 J;  4S0H B;  1A5J A;  2COB A;  1DU0 A;  4B1R A;  3TW7 A;  3SDG A;  4IHV A;  1RPW A;  1JT6 A;  2DA6 A;  2Y31 A;  2O9L A;  5EGO B;  1D5Y A;  2X48 A;  4C3J J;  4A93 J;  2E2H J;  2O7O A;  2W48 A;  1MBK A;  1B72 A;  2Y2Z A;  1OCP A;  5EG0 A;  3S16 J;  1JKP C;  3GTK J;  4A3J J;  2JN6 A;  5J1Y A;  1POG A;  2K9Q A;  1TWA J;  2DA4 A;  2FD5 A;  3QPL A;  3BT9 A;  2WV1 A;  3OIO A;  3BTL A;  3FKI J;  3I4M J;  3Q0V A;  1QVU A;  1OFC X;  5FLM J;  1F43 A;  2ME6 A;  1W0U A;  3S1Q J;  2VKV A;  1LFB A;  2L7F P;  2EZH A;  3K2A A;  4Y52 J;  3B6A A;  3BR0 A;  3CQZ J;  5JLX A;  1IV6 A;  2MG4 A;  2XGE A;  4X6A J;  3GTG J;  2XB0 X;  4AYB N;  2M0C A;  5F0F A;  3HEF A;  2YU9 J;  1U9O A;  2DA7 A;  3PO3 J;  4A3M J;  4LOC A;  5IYC J;  1XS9 A;  3TP0 A;  1PUF A;  2Y30 A;  2JA6 J;  2OF7 A;  2DMT A;  1ETX A;  1I3Q J;  2L9R A;  2HDD A;  5EYR A;  4BKX A;  3D1N I;  1ZR2 A;  1ETY A;  3PO2 J;  5EF6 A;  3ZQI A;  3BQZ A;  2ELK A;  4QIW N;  3HOZ J;  2E19 A;  5FKL A;  4C2M J;  2OPT A;  3HOU J;  2FJ1 A;  2NS7 A;  4BBS J;  4XK4 A;  1A6I A;  2VPR A;  4RDU A;  1IUF A;  2AHQ A;  4A3G J;  2E2I J;  2M9H A;  2ZB9 A;  4EEF G;  5F04 A;  5J3L A;  5M3M J;  4ABZ A;  1AKH B;  4DZJ A;  5EG0 B;  1HLV A;  3HDD A;  4UUS A;  1ITY A;  4C3H J;  4FCY A;  1HDP A;  1IDZ A;  3MN2 A;  3BR5 A;  3WHB A;  2XB5 A;  3A03 A;  3BTI A;  3OOU A;  3JR9 A;  2CQQ A;  3JRI A;  5EDN A;  1B72 B;  1XG1 A;  3BQY A;  3HM5 A;  1R9T J;  1SAN A;  3S14 J;  2LKX A;  1MBH A;  2H1K A;  3GTP J;  2MGQ A;  1I50 J;  1IJW C;  2EQR A;  5E3L A;  2XPV A;  2R5Z B;  3H0G J;  1H88 C;  2TCT A;  1NK2 P;  5M5W J;  2CRG A;  1WGX A;  1T33 A;  1LFU P;  4V2G A;  1BW5 A;  2O8K A;  1TC3 C;  3Q0U A;  2R5Y B;  2CQX A;  2LTP A;  1DU6 A;  5IOZ A;  2R7Z J;  4C3I J;  3G1L A;  2NVT J;  5C44 J;  5GPC A;  2EZL A;  3HBL A;  3BG3 A;  4DYC A;  1MBG A;  2XRL A;  2ID3 A;  4A69 C;  3HOY J;  2LVS A;  2I10 A;  4W97 A;  3BR1 A;  5K7F A;  1E3O C;  1TWC J;  2EH3 A;  4J19 A;  1MH4 A;  2HXI A;  3S1N J;  4A3E J;  1JT0 A;  1LE8 B;  3BR6 A;  3ZQC A;  1W0T A;  2LD5 A;  3UKG A;  3LSP A;  3BR3 A;  2MW8 A;  1JKR C;  1ZK8 A;  2NVY J;  3HB9 A;  5F0C A;  1WI3 A;  3CCY A;  3LSR A;  4D5C A;  1K61 A;  3FIS A;  1RES A;  2L7Z A;  3WHC A;  1Y1W J;  1K83 J;  3HGG A;  1MBE A;  2X9D A;  1OCT C;  4MFD A;  4A3F J;  5DS9 A;  2DA5 A;  5K7Z A;  2GLO A;  2IEK A;  2EZK A;  4XIC A;  3GTO J;  3JRG A;  5BNG A;  1RET A;  4JYK A;  3O8G A;  2KDZ A;  4QSH A;  3IH4 A;  4G12 A;  4A3D J;  1TWG J;  2JA5 J;  2TRT A;  1JUM A;  2Y9Y A;  4MFE A;  3DEW A;  3A01 B;  1ENH A;  2CJJ A;  1WCM J;  2R0Q C;  1X2M A;  2VKE A;  1OJL A;  3LNQ A;  2NS8 A;  1X2N A;  1JTY A;  4M6V A;  1Z0X A;  4I76 A;  5IP6 A;  2JA8 J;  2DN0 A;  1JJ6 C;  2M2E A;  5E3O A;  5FKN A;  1GDT A;  1VFC A;  2HXO A;  4AC0 A;  1JKO C;  2AO9 A;  2LR8 A;  5EZG A;  1HOM A;  1WH5 A;  2JA7 J;  1QVT A;  3Q3S A;  2G0E A;  3JRB A;  3S1R J;  2QF7 A;  2XPU A;  1P7J A;  5IOY A;  4AUX A;  2ME0 A;  2HOT A;  4BXX J;  2FX0 A;  1VI0 A;  1T56 A;  5J1U A;  1HCR A;  3NAU A;  5E3M A;  4JX5 A;  4UUS B;  5J1R A;  1WPK A;  1Q1V A;  4X1E A;  3HKZ N;  2YUS A;  1ETW A;  1MBF A;  1IRZ A;  2WAQ N;  4D5F A;  1VF9 A;  1MH3 A;  2H8R A;  3SFI A;  1FTZ A;  3BTJ A;  1FTT A;  1ZQ3 P;  1ETK A;  3M4O J;  1MBJ A;  2LLK A;  2HQ5 A;  2CU7 A;  2JWT A;  2HI3 A;  5M3F J;  4B4C A;  1H89 C;  1U78 A;  2JK3 A;  3CMY A;  3I4N J;  2IAI A;  1B8I A;  2VI6 A;  4JP0 A;  1RKW A;  3JRC A;  3BG9 A;  5FKK A;  5IPA A;  1ETO A;  2YS9 A;  4MIM A;  4JX6 A;  3F0C A;  2DMP A;  3HOX J;  5IYB J;  4A3C J;  1ZTR A;  2QCO A;  3C2B A;  4DZP A;  4M3D A;  1JTX A;  2K9S A;  1QPI A;  4I6Z A;  3H3V K;  5JLW A;  3M3Y J;  1BW6 A;  1FIA A;  3GTJ J;  1JJ8 C;  3S1M J;  3S2H J;  9ANT A;  1TWF J;  3QPS A;  5FJ8 J;  2JJ7 A;  4IHW A;  2MSY A;  2Y0S N;  4A3L J;  3GTL J;  2NOG A;  3O8H A;  3CDL A;  1O4X A;  5M5X J;  3G1O A;  2FQ4 A;  3L1P A;  2LK2 A;  4HNV A;  2IBD A;  5K7H A;  3E7L A;  4XRS G;  1I6H J;  5DTD A;  1CQT A;  4CYC B;  1EF4 A;  2DA3 A;  2JMW A;  2PMZ N;  3GBG A;  1FJL A;  4FTH A;  1HDD C;  1X58 A;  1GV2 A;  1PUF B;  4XRM A;  2L7M P;  1UMQ A;  2LP0 A;  3BG5 A;  3LSJ A;  4MLO A;  3JRD A;  3G1M A;  5M5Y J;  2XGC A;  5F27 A;  2DMQ A;  5GPA A;  2DA1 A;  5IP7 J;  1RKT A;  1IDY A;  2HOA A;  3RZO J;  3GTM J;  3MKL A;  1FIP A;  3HGY A;  1B8I B;  2XPW A;  3VPR A;  1Y1V J;  1IG7 A;  3BR2 A;  2EZI A;  4M3B A;  1FEX A;  2M34 A;  5EZH A;  2LY9 A;  1YRN B;  1MNM C;  3SJM A;  2XGD A;  1GVD A;  5E3N A;  1AU7 A;  3FIW A;  3TP3 A;  1QRY A;  4RBO A;  3A02 A;  2XSD C;  3W6V A;  3HOW J;  1S7E A;  3ZQG A;  3MVP A;  4JX4 A;  4M3E A;  2M8G X;  4NDL A;  1RR7 A;  3JRH A;  1APL C;  3OSF A;  1UG2 A;  2N8G A;  2D5V A;  4XRS A;  4QTR A;  4Y7N J;  1GT0 C;  2R5Z A;  4L5E A;  3RZD J;  3B6C A;  5HOD A;  2HYJ A;  2ECC A;  3PM1 A;  2E2J J;  2DJN A;  3JRE A;  1AKH A;  3NAR A;  2P81 A;  2Y9Z A;  4A3B J;  3Q0W A;  5F0H A;  5EGO A;  3ZQH A;  4DYQ A;  4A3I J;  2KT0 A;  2K40 A;  1ORK A;  3ZOB A;  2NVQ J;  2DMN A;  2VUM J;  3JRF A;  3FK6 A;  2RAE A;  5FLV A;  3RKQ A;  1IC8 A;  5F1J A;  1JUS A;  3JRA A;  2CUE A;  5FKM A;  3ZQL A;  2E1O A;  2ECB A;  4A3K J;  3LOC A;  4GFB A;  5C4J J;  1WH7 A;  1NK3 P;  4M3F A;  2X6O A;  3RQI A;  1MSF C;  2R92 J;  2GM4 A;  4D7N A;  3S15 J;  3S2D J;  5GP9 A;  4DW6 A;  1YRN A;  5C3E J;  1GUU A;  1HF0 A;  3GTQ J;  1ETQ A;  1BJZ A;  5F08 A;  2HOS A;  1GV5 A;  3FK7 A;  1ZKG A;  1H8A C;  4FE4 A;  2LFB A;  4M3G A;  1TWH J;  3IH2 A;  3TED A;  2NVX J;  2DA2 A;  1ZR4 A;  3S17 J;  3K7A J;  1NTC A;  3HOV J;  1MSE C;  3BTC A;  1ETV A;  4FE7 A;  2EBI A;  1SFO J;  2L0K A;  1JGG A;  4D7M A;  2DTZ A;  4DYR A;  5FKO A;  1AHD P;  2R93 J;  5IYD J;  1Z77 A;  1IGN A;  4IHY A;  5C4X J;  4MO7 A;  4UUT A;  1U8B A;  1G2H A;  2ID6 A;  1U9N A;  4IHX A;  3IH3 A;  3ZQF A;  4XID A;  1UHS A;  2K9N A;  1BL0 A;  4FIS A;  3DCF A;  1VND A;  4W1U A;  2GBY A;  1LE8 A;  2B63 J;  3A01 A;  1P7I A;  1JKQ C;  3OSG A;  4IEJ A;  1F36 A;  4V2F A;  4BY1 J;  5EEA A;  4BY7 J;  1ZGW A;  2CUF A;  2R5Y A;  3IV5 A;  1BA5 A;  2WB1 N;  3LSG A;  4CYC A;  2DMU A;  3QQA A;  1JUP A; 
#chains in the Genus database with same CATH topology
 4B3A A;  1K79 A;  2L5Q A;  5IP9 J;  4HYE A;  2ZBK A;  3FXU A;  5E8G A;  1A5J A;  1DGR M;  2YPR A;  4YIF A;  1UFM A;  3CCJ I;  3SDG A;  3RKX A;  2E7X A;  1DPU A;  2DA6 A;  2Y31 A;  2O9L A;  5FRM A;  5EGO B;  5IT3 A;  5HOO A;  4M74 A;  4A93 J;  3ULQ B;  2E35 A;  1HW2 A;  1T08 B;  5B5E C;  2O7O A;  1MBK A;  1R1V A;  3R60 A;  1NG7 A;  2Y2Z A;  2WTE A;  3QOP A;  3S16 J;  2FU4 A;  1SEU A;  3BG7 A;  3OS0 A;  3QU6 A;  5J1Y A;  1WSU A;  2K9Q A;  1TWA J;  2VB6 A;  3V42 A;  2G9W A;  3VOE A;  4BHP A;  1ONV A;  1UHW A;  3BTL A;  2BGC A;  2ZJQ F;  4P9U A;  5LLQ A;  3Q0V A;  1QVU A;  1KQ0 A;  2GXG A;  5FLM J;  2OUM A;  4RB3 C;  1FLI A;  2EZH A;  2FA5 A;  3B6A A;  4BYY A;  3BR0 A;  1EKE A;  2R7R A;  5JLX A;  5H20 A;  2P5V A;  2XGE A;  1BIB A;  2W7N A;  1J7K A;  4AYB N;  3DV8 A;  1T95 A;  5F0F A;  3KZI C;  2BY1 A;  3LA2 A;  2YU9 J;  5ED4 A;  3SFZ A;  1YTY A;  2QEX I;  3R0A A;  4AID A;  5IYC J;  2Y30 A;  3H0D A;  3DKW A;  3RI4 A;  3I9V 2;  2DMT A;  2OAZ A;  1ETX A;  1I3Q J;  4BQO A;  5FLX K;  4U0Y A;  4BKX A;  5K5Q A;  3E6C C;  1ZR2 A;  3RPQ A;  1ETY A;  2L01 A;  1T8I A;  1O57 A;  4F55 A;  5J40 A;  2OPT A;  2X51 A;  3V7R A;  1OR7 A;  5H6Q A;  2GQQ A;  2FBI A;  2ZJ2 A;  2P6S A;  1J0R A;  2AHQ A;  2YU3 A;  2M9H A;  5L3B A;  2ZB9 A;  5F04 A;  5M3M J;  4D0P A;  3ZRG A;  2A69 F;  4ABZ A;  2QGU A;  4GCV A;  1MDM B;  3K4C A;  5DM7 F;  2VT2 A;  3HDD A;  4FHT A;  4UUS A;  1ITY A;  4C3H J;  2P4W A;  1IDZ A;  5JVG F;  1SFK A;  1VQ9 I;  2UZK A;  1Z21 A;  2XB5 A;  1X4P A;  2JZY A;  2VXD A;  1LEB A;  1B72 B;  3LAP A;  3U1D A;  3MZ8 A;  1WJB A;  3CCU I;  1VQ4 I;  3I59 B;  3S14 J;  4E6K G;  3KE2 A;  1MBH A;  5J8F A;  4FET A;  3LSI A;  1IJW C;  2JQ7 A;  2HR3 A;  3K69 A;  2LOO A;  2ZO4 A;  3KYL A;  2LMD A;  3H0G J;  1Q1H A;  2TCT A;  3ZP5 A;  3CC7 I;  1S29 A;  2CGP A;  5M5W J;  1ZRF A;  2KL4 A;  3S93 A;  2WC2 A;  2IGO A;  4V2G A;  5FD6 A;  5DCM A;  1XGS A;  3ERE D;  1S3J A;  2HVS A;  1FSH A;  2R5Y B;  2KMU A;  2Y75 A;  1EA3 A;  2CQX A;  5JVT A;  2MC3 A;  1DU6 A;  5IOZ A;  4L9T A;  4C3I J;  5LRR A;  4XOR A;  1FYM A;  1KU3 A;  1I3A A;  2X6Y A;  3EQL F;  1G3Y A;  4ZYE A;  1MBG A;  4Q4Z F;  5GAH J;  3AFH A;  2EFW A;  2LVS A;  4DNC A;  2A05 A;  4YIR X;  2WAF A;  4U0V A;  3WU2 C;  1BN5 A;  1TWC J;  2WY7 Q;  4J19 A;  1HQC A;  2HXI A;  2X85 A;  4YG2 F;  2KHM A;  4XLP F;  2H27 A;  5DCF A;  1XMX A;  4FQG A;  2PMZ A;  1MDM A;  3MWM A;  3LSP A;  2FUG 2;  3BR3 A;  3K6G A;  3J81 K;  2C6Y A;  3QYF A;  2XAJ A;  4A0X A;  4NNJ A;  4ZTJ A;  1ZK8 A;  2NVY J;  3HB9 A;  4RB1 A;  3DXJ F;  4BQA A;  3VFZ A;  4KT6 A;  3LSR A;  2DQL A;  2XHK A;  1RES A;  3IWF A;  4UY8 I;  1K83 J;  3L2R A;  1QO0 D;  2X9D A;  3ASO H;  4O3M A;  1WZ2 A;  2XAG A;  4S05 A;  2GLO A;  1JHF A;  1VQN I;  3ELK A;  2NVU B;  4CDG A;  4QLC U;  4EQQ A;  3JRG A;  1DGW Y;  2HOE A;  5JR3 A;  4HV5 A;  1IN6 A;  4XQF A;  4A3D J;  1M1E B;  1TWG J;  5D6E A;  1B9M A;  5CVI A;  2LH9 A;  1MJA A;  2QZ8 A;  3DEW A;  4UUV A;  3SZT A;  1LKX A;  1WCM J;  4IL6 C;  1SD6 A;  2XIG A;  1X2N A;  3GLL A;  3DEU A;  5KAI C;  3FM3 A;  5F1R A;  1HW1 A;  5IP6 A;  5B1B H;  1XTA A;  2DN0 A;  1U2W A;  4MEX F;  3VSL A;  4UHT A;  5FKN A;  1P9Q C;  2DOA A;  1GDT A;  1VFC A;  1KU9 A;  2HGC A;  2LR8 A;  1WH5 A;  4MHG A;  5DDG A;  5GAG J;  4NUB A;  3GZN B;  4Y33 A;  1IN8 A;  1BR4 A;  2XPU A;  1Z6T A;  1FMW A;  1P7J A;  1BI2 A;  2J5P A;  5IOY A;  2HOT A;  4I99 C;  2LBF A;  3HSE A;  2DBB A;  5J1U A;  5LGU A;  4IOA F;  4U0W A;  2MAB A;  1TLH B;  3NAU A;  3WG9 A;  5K5O A;  2D1H A;  1W5T A;  1MIJ A;  2F6C A;  1Q1V A;  4LFU A;  5BOX A;  3HKZ N;  2YUS A;  2IPQ X;  1MBF A;  5HS8 A;  4D5F A;  1PDN C;  1QU3 A;  3HRU A;  4FAS D;  2H8R A;  1FTZ A;  4NBQ A;  4RB0 A;  2PMH A;  3OMY A;  3NWT A;  1ETK A;  3BZC A;  5CPR B;  2B7E A;  1G3T A;  3RPU D;  3V8K A;  3KZZ A;  3N97 A;  3M4O J;  2Q2E B;  4DBR A;  2UWM A;  5M3F J;  3VYR B;  3EYI A;  2LF7 A;  3SEQ A;  2VI6 A;  4DOZ A;  3JRC A;  1W1W E;  1IO2 A;  4Q47 A;  1BIA A;  1ETO A;  3U9G A;  3DBL B;  1BOB A;  2CFO A;  2Z1D A;  4JX6 A;  3J7A Y;  4PJ0 C;  4A3C J;  3H5R A;  1OIS A;  3FXL A;  2P7V B;  1ZTR A;  2E60 A;  3I55 I;  1QBJ A;  1JTX A;  1N75 A;  4I6Z A;  1R58 A;  1FIA A;  1H9T A;  3PSF A;  9ANT A;  2P7C B;  2V4J C;  2R7D A;  5GAD J;  1ZLK A;  2QQ8 A;  1UST A;  2MSY A;  3GFL A;  4MNU A;  3BCA A;  1VQM I;  1FT9 A;  2OD5 A;  2ZKZ A;  1RZ4 A;  3GTL J;  2NOG A;  3JTG A;  2NNN A;  2EIK H;  3ECO A;  4M6X A;  2DFF A;  2RDP A;  3GYH X;  3VWB A;  1IW7 F;  3G1O A;  3W3C A;  2FQ4 A;  3CO7 C;  4L9J A;  4HNV A;  2IBD A;  5LD2 C;  1HKT A;  3TKY A;  2NNY A;  1CQT A;  2VON A;  2L54 A;  1EF4 A;  1LEA A;  1HDD C;  2VOP A;  1X58 A;  2X6W A;  2RNG A;  1P6R A;  3RKY A;  3OR2 C;  4D9J A;  1UMQ A;  3FF5 A;  4M9S A;  1RNL A;  3FDY A;  4BS9 A;  1E3P A;  3FX3 A;  2W1O A;  2YSR A;  2M7A A;  5EEH A;  3LSJ A;  1NG6 A;  4I98 B;  3KP4 A;  2DQR A;  4PUS A;  5F27 A;  4B8X A;  1GHC A;  4U87 A;  4DQ2 A;  5KK1 A;  2DA1 A;  5IP7 J;  5AIQ A;  1IXR C;  2L9N A;  3W6K B;  4IKF A;  2IS2 A;  3WTW C;  3QOD A;  4E4H A;  1IDY A;  1G6N A;  3R4K A;  2D1V A;  1Y1V J;  2ZCW A;  1IG7 A;  1O3R A;  4R1H A;  2EIM H;  2F5F A;  3IRQ A;  2LY9 A;  3IKV A;  5FRO A;  3SJM A;  1UAA A;  5BPI A;  3HRT A;  3Q9S A;  1O7F A;  1GVD A;  1U3E M;  5DCM B;  4PFO A;  3AG4 H;  1ZRE A;  2FXA A;  2XAH A;  1UCR A;  1VQ5 I;  2EFO A;  1MMN A;  4HQM A;  2PJP A;  3RYP A;  2PJR A;  1XMK A;  3PJR A;  3A02 A;  2AXL A;  3W6V A;  2UXN A;  5D5V B;  1J5Y A;  3L2Q A;  4KIC A;  3ECH A;  4UNO A;  2MD5 A;  4JX4 A;  3C3W A;  3ISP A;  2P6T A;  2O6G E;  1N78 A;  1TBX A;  4EGY A;  2CFX A;  3L9F A;  1Z67 A;  3JRH A;  1XDS A;  1SVM A;  1JXS A;  1ZGJ A;  3F8C A;  1UG2 A;  4XRS A;  1U5T C;  4L5E A;  1S9H A;  4RAF A;  3RZD J;  2QBY A;  3HOS A;  1YS6 A;  1OYY A;  3JRE A;  5B3S H;  1AKH A;  5IT9 K;  1OKR A;  2O3F A;  1BC8 C;  1YG2 A;  2GXB A;  5HLT A;  1AOY A;  4G7H F;  4XKW A;  2QQ9 A;  1R36 A;  4ZDP A;  1N25 A;  2A61 A;  1ORK A;  1QGP A;  1Z3X A;  2DMN A;  3MZY A;  2ZME A;  2IRF G;  3IHU A;  2Q1Z B;  2VT3 A;  4DJA A;  1ZRC A;  1FC3 A;  4EJW A;  2VJI A;  3COA C;  1P4A A;  4OMY A;  4M71 A;  1IC8 A;  5F1J A;  3L2U A;  3FMR A;  2JSC A;  2CUE A;  2M7B A;  3ZQL A;  3S3O A;  3RSN A;  2L4A A;  2ECB A;  2QKL B;  1GVJ A;  1UB9 A;  3LMM A;  3FXJ A;  4M3F A;  2X6O A;  1MSF C;  3BP8 A;  3S15 J;  1E17 A;  3FZV A;  1GLN A;  1T0F C;  3GTQ J;  4AIH A;  4RGS A;  1XCV A;  3S8P A;  5L3C A;  5FRN A;  2LFB A;  4XKV A;  3F6O A;  3K7A J;  2LF8 A;  4EMS A;  1MMG A;  1ETV A;  2CS3 A;  4KT5 C;  3E5Q A;  3E3V A;  2V1N A;  4D7M A;  1JGG A;  2R93 J;  1AHD P;  1UG0 A;  1Z77 A;  1TQI A;  1KZH A;  3V8L A;  2STW A;  2NXN B;  4ESJ A;  4IHY A;  2HFH A;  4DGW B;  4MO7 A;  4RGX A;  4UUT A;  3O3K A;  1MMA A;  3TO6 A;  1PJR A;  3V7C A;  3CLQ A;  1OPC A;  2CW7 A;  3GVA A;  3BCB A;  1RUO A;  4N4O B;  1VND A;  4W1U A;  2GBY A;  4IZZ A;  4OIQ F;  2B63 J;  2ZJP F;  1D3Y A;  1R22 A;  3GF2 A;  3FHZ A;  3F6V A;  4V2F A;  3LAJ A;  1IXC A;  4BY1 J;  1ZGW A;  1PP8 F;  2W85 A;  3RPU A;  2E5N A;  4B48 A;  1YFH A;  3IV5 A;  3ESW B;  1BA5 A;  1YLF A;  2VBX A;  2AXT C;  2DMU A;  4XRS G;  2FRH A;  1IF1 A;  3PUF A;  3DLA A;  4BBR J;  2VPL A;  2ZFU A;  3ROU A;  3ONQ A;  1WI9 A;  5FB2 A;  1HC8 A;  3TW7 A;  3KPH A;  3E97 A;  4P9F A;  3R61 A;  1JT6 A;  1HKQ A;  4BEH B;  2W24 A;  1D5Y A;  3LL7 A;  2ZNZ A;  1PYV A;  5E1X A;  1B72 A;  3KZY A;  2A6T A;  3QOE A;  5JHF A;  3P7N A;  1OCP A;  2V6E A;  3K70 D;  3NRV A;  4CA0 A;  3BWG A;  3GTK J;  2EIN H;  4PJN A;  1DDN A;  1FBQ A;  2FEZ A;  4GYG A;  2DA4 A;  3BRO A;  2WB1 A;  2ZFW A;  1S8N A;  2FD5 A;  2PFB A;  1I1S A;  2BE5 F;  3NWS A;  3QPL A;  2E71 A;  3OIO A;  2GA1 A;  4JQF A;  2IJL A;  3I4M J;  3RCO A;  4CUG A;  1I6X A;  4E70 A;  4HDV A;  2ME6 A;  2IS4 A;  1W0U A;  4NC7 A;  1KGS A;  2RQQ A;  1LFB A;  2V26 A;  2L7F P;  2BY2 A;  3KP2 A;  3CF2 A;  2HS5 A;  1Z9C A;  2NS0 A;  1RI7 A;  3KEY A;  4C2T A;  3M9A A;  4TV7 A;  2M0C A;  4HPQ A;  2E1N A;  2M30 A;  2QVO A;  3H5A A;  3V8J A;  1H9G A;  3OYD A;  1IN7 A;  1F4K A;  3OIP A;  1PUF A;  3QPT A;  5TGT A;  4S04 A;  6PAX A;  3OYI A;  2BXZ A;  4HNU A;  4OWR B;  1WJF A;  2M8E A;  2WAE A;  1KU7 A;  3D1N I;  4Y17 A;  2KIU A;  2DI3 A;  1ON1 A;  4XN3 A;  3J7Z I;  3ZQI A;  2W84 A;  3QYE A;  4ENM A;  4HX8 A;  4HV6 A;  2OTL I;  3RTR A;  4M73 A;  5E8I A;  3KX2 A;  3IC7 A;  2NS7 A;  2VPR A;  3LWF A;  4OAZ A;  4Y15 A;  1IUY A;  3AKZ A;  4RM3 A;  2Z33 A;  1YJN I;  3N05 A;  1Y6I A;  1AA7 A;  3PSI A;  3GCM A;  1HLV A;  1Y0N A;  3WTU C;  4V19 K;  2LRE A;  3DFG A;  4FCY A;  1SFE A;  1D8K A;  2QSH X;  1WWX A;  2WAD A;  3OYM A;  3BTI A;  3OOU A;  3PFI A;  3E0J B;  4L5I A;  5EDN A;  3RKW A;  1OCO H;  1Z1D A;  3BQY A;  4XOT A;  3CJQ B;  3SYT A;  3HM5 A;  1R9T J;  2VIX A;  2HVQ A;  2RQP A;  1J2X A;  1FNN A;  2H1K A;  3HPG A;  2BHZ A;  3K1M A;  5EJC A;  4IRI A;  2K9M A;  3GTP J;  2MGQ A;  2Y48 A;  4MTD A;  2HNH A;  4LB5 A;  3BPV A;  5KNL A;  3LFU A;  5HLI A;  2DJI A;  3U2R A;  2PMU A;  4ENK A;  3ZQQ A;  1W36 D;  3E1S A;  4WXD A;  5ILV A;  1WGX A;  1T33 A;  4A0Y A;  2QSF X;  3FXO A;  1A36 A;  2CG4 A;  2ESN A;  4PSW A;  1BW5 A;  3M1C A;  2VQC A;  1TC3 C;  3HKZ A;  2LTP A;  4L0Z B;  4AIK A;  2K86 A;  3G1L A;  3GLX A;  2NVT J;  3WGH A;  2MC4 A;  5GPC A;  3IWZ A;  4DYC A;  3ZQ7 A;  2ID3 A;  4HA8 A;  4A69 C;  4KN7 X;  1OYI A;  4FX4 A;  1Y0U A;  4XNF A;  3BR1 A;  2VLA A;  2HEO A;  4RM2 A;  1TT0 A;  3JSP A;  3W2W A;  4R8H A;  3TO9 A;  1JT0 A;  2CV0 A;  1I39 A;  2JUC A;  4PJL A;  2PBI A;  2HQN A;  4M72 A;  2W57 A;  1YW8 A;  1XPX A;  3AL0 C;  1OCR H;  3HYI A;  2FNP A;  5F0C A;  2ZC2 A;  3CCY A;  4D5C A;  1K61 A;  1KYW A;  2L7Z A;  2NYX A;  3WHC A;  1YQA A;  3P9I A;  1OCT C;  2W25 A;  2KIM A;  3LQQ A;  4A3F J;  1P4W A;  5E1W A;  5DS9 A;  2PI0 A;  2E7W A;  2IEK A;  4KIG A;  1OR7 C;  2VJJ A;  5CQE A;  4XIC A;  5HDN A;  1TW2 A;  2GZW A;  3GZ5 A;  1AWC A;  3O8G A;  3E6B A;  3IH4 A;  3SDB A;  5IY5 H;  2TRT A;  2V1U A;  1JUM A;  2Y9Y A;  4RB2 C;  4HQE A;  3F8F A;  3A01 B;  2EV0 A;  1MJ9 A;  1X2M A;  5HS7 A;  1OJL A;  2HVR A;  2NS8 A;  4DBQ A;  4KUM A;  3X2Q H;  1STZ A;  2LC2 A;  4I76 A;  3JCU C;  4WXC A;  1B6A A;  3ZMD A;  3KFW X;  1VQ6 I;  5GTI C;  3ERM A;  4BAY A;  3Q9V A;  1K4S A;  4AC0 A;  2AO9 A;  5EZG A;  3KCC A;  2IA2 A;  4NC8 A;  4C2U A;  1TNS A;  2ZXW H;  1IXS B;  2QF7 A;  3S32 A;  5F6F A;  4OMZ A;  2OQG A;  3FXM A;  4AUX A;  2GIZ A;  3PFY A;  4XL9 A;  5E1Z B;  2HTS A;  1QQI A;  4HG2 A;  3VYT B;  1V5E A;  5D5U B;  1VI0 A;  1T56 A;  3GX4 X;  3T5X A;  3VOD A;  1L3L A;  1SD7 A;  5E3M A;  2IT0 A;  3PNV A;  5J1R A;  2DFI A;  2PX9 A;  3ZCO A;  2ELH A;  4X1E A;  4GXO A;  5CVJ A;  1IRZ A;  3KYD B;  3SFI A;  3SQN A;  2FE3 A;  2PLY A;  1ZG1 A;  2DXI A;  2WA0 A;  1MBJ A;  3CCL I;  2OC6 A;  2HQ5 A;  2OBP A;  3I59 A;  2JWT A;  3OL4 A;  4NC6 A;  3LA7 A;  4G7Z F;  1XSX A;  3VSK A;  1H89 C;  1U78 A;  4PFP A;  3I4N J;  4G6D A;  5DEQ A;  1B8I A;  2WY8 Q;  2CV2 A;  4JP0 A;  1R6R A;  5ICE A;  1U5T A;  4HF1 A;  1OCZ H;  5IPA A;  2XAF A;  2R7F A;  2MA3 A;  3QRF F;  3G73 A;  3WTS C;  3ZN0 A;  3CME I;  4BU2 A;  2A5Y B;  2QSG X;  4YFN F;  2IA1 A;  3CP2 A;  2OJE D;  5H6R A;  1ZHF A;  2KPM A;  3M3Y J;  1PVE A;  3CUQ A;  1YIO A;  3QPS A;  2JJ7 A;  5J4V A;  4A3L J;  4A6E A;  1QPM A;  5HDG A;  3G6E I;  3PNY A;  2MFZ A;  2O03 A;  3WOD F;  4CIC A;  1O4X A;  1R5H A;  2VC1 A;  2Q0O A;  3L1P A;  1LB2 A;  1HA8 A;  2F5V A;  2DO7 A;  5BPD A;  2G7U A;  2CUZ A;  1S6L A;  2EFP A;  4KIF A;  3WTZ A;  2DA3 A;  2FQ3 A;  3SXY A;  4B44 A;  3FHN A;  3J80 Z;  3TOB A;  3BG5 A;  1W36 C;  3G1M A;  2F4I A;  5M5Y J;  1CF7 B;  2DYR H;  4A0Z A;  1D0Z A;  2DMQ A;  5GPA A;  1IN4 A;  3QP5 A;  2Q2E A;  4KIS A;  3C1D A;  4CCL A;  4O6J A;  1ZH5 A;  3AG3 H;  1WJD A;  2BVM A;  4ZTF A;  3MKL A;  1RRJ A;  4BJT A;  2OA4 A;  3MD2 A;  2GOX B;  2V7F A;  5ICF A;  1VZ0 A;  1OLT A;  3OWT A;  2ZNY A;  4M3B A;  5K5R A;  1W5C C;  5FO5 A;  3OYH A;  1YRN B;  2EFQ A;  3TDU C;  1MNM C;  4ZYA A;  2DDB A;  2XGD A;  2EB7 A;  1FP1 D;  2V9P A;  3PNT A;  1AU7 A;  3KP7 A;  3KP5 A;  4RBO A;  2E5Z A;  4KA4 A;  1TT5 B;  1U5T B;  2QA4 I;  3M7G A;  4CSW A;  4RAZ A;  3V4G A;  2EK5 A;  5BMZ A;  1IZ1 A;  2OV7 A;  4EVI A;  1KON A;  2M8G X;  4NDL A;  2IP2 A;  3OYC A;  1XGO A;  2DYS H;  2DTR A;  1X1D A;  2RKH A;  2N8G A;  2VOO A;  3E6M A;  2BZT A;  1GT0 C;  3GFM A;  3KIO A;  5FD5 A;  2R5Z A;  4B47 A;  5HOD A;  1SAU A;  2ECC A;  4CZC A;  2Y0M A;  2BYV E;  3DPT A;  4A6D A;  4G6T B;  3K4B A;  3NAR A;  4ENJ A;  3K10 A;  4L5J A;  2CW0 F;  5CQG A;  3WTT C;  1HST A;  4XKC A;  3IUO A;  3VEP A;  2XF6 A;  2DW4 A;  4AVZ A;  4A3I J;  4HOB A;  1T38 A;  2K40 A;  1FOX A;  3T8T A;  4IOC F;  1BI1 A;  2KQR A;  2VN2 A;  4F93 B;  3FXQ A;  1TZL A;  5FLV A;  3RKQ A;  3GWZ A;  1XSD A;  1JUS A;  2LYC A;  4X0G A;  5FKM A;  2IGM A;  3MCZ A;  4BDY A;  4HF2 A;  1EJ9 A;  2E1O A;  5HNH A;  1FBS A;  3LOC A;  3J7A O;  1KQ8 A;  4GFB A;  1BI3 A;  2LDU A;  4PGG A;  3JAM K;  3BJ6 A;  3DTE A;  3EDP A;  3VYU B;  2GM4 A;  2I5U A;  1J59 A;  1YRN A;  1USS A;  1YS7 A;  2ZJR F;  4E7L A;  4XKB A;  5TJJ A;  1GV5 A;  3AG1 H;  3FK7 A;  3ZR8 X;  4M3G A;  1X19 A;  2NVX J;  1ZR4 A;  3B73 A;  1FP2 A;  2H09 A;  3LA3 A;  1P92 A;  4DYR A;  1V5F A;  5FKO A;  5L3E A;  2IGN A;  3EUA A;  1G3W A;  5IYD J;  3C7J A;  3MFK A;  1P4X A;  3ABT A;  4ESB A;  2L02 A;  1U8B A;  3K4N A;  3NEU A;  1FX7 A;  1U9N A;  1I1G A;  4G6Q A;  4Q48 A;  2VOD A;  3CCV I;  2VBY A;  2X1D A;  3IH3 A;  1BL0 A;  3DCF A;  3H9G A;  1EH8 A;  4IRG A;  4F3Q A;  1P7I A;  4HSR A;  3OSG A;  3HIF A;  3BZK A;  4KJZ A;  2DDA A;  5F64 A;  2K85 A;  1SFX A;  5EEA A;  1R5I D;  1XMA A;  4HF0 A;  2MH9 A;  2VE8 A;  2R5Y A;  3HG9 A;  1V5G A;  2WB1 N;  2ZXI A;  5KHD A;  3LSG A;  2XAQ A;  4CGZ A;  3JRD A;  1JUP A;  1D1A A;  2DLL A;  3FBN B;  4I7H A;  4UVC A;  3TW6 A;  3I56 I;  5LHG A;  2QKM B;  1DU0 A;  4XSZ F;  2L4M A;  4IHV A;  1R00 A;  3L2W A;  2ISZ A;  1U6G A;  4PCQ A;  3G2B A;  4L0Y B;  4XN0 A;  5CYV A;  3R6S A;  3S2W A;  2I8D A;  2MYS A;  3GME A;  2W48 A;  2LKP A;  3DEE A;  2HTJ A;  1YYV A;  4AVP A;  1LPQ A;  2RV8 A;  3K70 C;  3WTY C;  3HRM A;  2JN6 A;  1ZG5 A;  1POG A;  2XUB A;  4LIT A;  1J09 A;  3SZP A;  2P5L C;  1YHQ I;  2VJ5 A;  3MKZ A;  4QWQ A;  4P1W A;  3CC2 I;  2QQA A;  3FKI J;  2HZT A;  1JGS A;  4XOP A;  1Y8Q B;  1W5S A;  1OFC X;  1F43 A;  2DOF A;  3I58 A;  2GAU A;  3BC8 A;  2BY3 A;  3K2A A;  4Y52 J;  1KA8 A;  2K5C A;  3K4L A;  4EJO A;  1ZEL A;  3HOT A;  4K2E A;  4X6A J;  3GTG J;  2H6B A;  2XB0 X;  2XRN A;  4J01 A;  1OYW A;  1S7O A;  2VBZ A;  3HEF A;  2OZ6 A;  4F52 A;  1J9I A;  1VQO I;  1PUE E;  1XX5 A;  4N4N B;  4P5O A;  2EPF A;  2DA7 A;  3PO3 J;  2XDV A;  4AD9 A;  4UVB A;  1A31 A;  5E79 C;  4LOC A;  1XS9 A;  3MMY B;  2F4O B;  1TQM A;  1O3Q A;  3I3L A;  1RUN A;  1S72 I;  4PZJ A;  3N4M A;  4ANJ A;  2LRD A;  3BJO A;  3OIQ A;  2AQE A;  1ODD A;  3WGG A;  2RGV A;  3HRS A;  3PO2 J;  2A07 F;  4BUP A;  5KVR A;  3CZ6 A;  5KAF C;  3HUG A;  4C2M J;  1OCC H;  1IRG A;  3HOU J;  2FJ1 A;  5D6F A;  3TMO A;  4AU7 A;  5B1A H;  4BBS J;  2O8X A;  4OU0 A;  4RDU A;  1IUF A;  2O5R A;  1VTN C;  3BPX A;  2QYO A;  3GUD A;  3L7W A;  5J3L A;  3HZJ A;  4DZJ A;  5HNF A;  3SZG A;  3PL8 A;  1QHH D;  2M0M A;  4NQW A;  2H8W A;  4BGD A;  5DM6 F;  2K4J A;  4HRI A;  1LVA A;  1O3T A;  3BR5 A;  3WHB A;  1IAW A;  2NRA C;  3A03 A;  3WG7 H;  4HLY A;  1FSE A;  2FF4 A;  3CUQ C;  4F92 B;  2OCE A;  2O0Y A;  4JK1 X;  1XG1 A;  4OIN F;  5LEJ A;  1W4M A;  1SAN A;  5J6X A;  4U7D A;  2LKX A;  3HJE A;  4PJJ A;  4B3X A;  1I50 J;  3TOA A;  2GWR A;  1R1U A;  5AON A;  2EQR A;  4LK1 F;  3C2G A;  4YFK F;  4GYI A;  1NK2 P;  3G3Z A;  3LSM A;  1SD5 A;  1R4N B;  4XMY A;  1LFU P;  3OYA A;  2F48 A;  2R7U A;  1UJ8 A;  2HQA A;  3Q0U A;  3EPZ A;  1YO5 C;  1LUJ B;  4FT8 A;  2R7T A;  2XAS A;  2H6C A;  3F8B A;  2R7Z J;  2XF7 A;  1TQP A;  1ACI A;  1HSJ A;  3H3Z A;  4Y13 A;  5C44 J;  2EZL A;  3E5X A;  3I4P A;  2R3S A;  3HHH A;  4ZDL A;  3HOY J;  2BOL A;  5E17 F;  1R7J A;  4KIB A;  2DPD A;  2K27 A;  2I10 A;  4W97 A;  5K7F A;  2XF5 A;  3ABK H;  1ZRD A;  2EV6 A;  4HST A;  1LE8 B;  2HYF A;  1LFP A;  3BLY A;  1T2K A;  4ZH4 F;  2E1M C;  2MLK A;  4U7B A;  1W7P D;  3BZ6 A;  3BG6 A;  2VQL A;  1WI3 A;  1XSV A;  4MTE A;  2HQR A;  2X6X A;  3FIS A;  1LQ1 A;  1KQ9 A;  3LFK A;  1IRX A;  4LJZ F;  2X1E A;  3HTU A;  1FY7 A;  2IGK A;  3RJP A;  1Y1W J;  4HX7 A;  4XR6 A;  3HGG A;  5DD4 A;  1BJA A;  4BXU A;  2A6E F;  2DA5 A;  5CVR A;  3OY9 A;  1YX3 A;  4AIJ A;  2KIQ A;  2CW8 A;  2XC7 A;  3K4K A;  1FYL A;  4PJM A;  5BNG A;  1RET A;  4JYK A;  5KCM A;  4QSH A;  4OIP F;  3CD6 I;  4G12 A;  2F4M B;  2JA5 J;  1BOA A;  5DUI A;  2P5K A;  4MFE A;  2X0L A;  2ZSI B;  4LIV A;  2J5O A;  2IA0 A;  1ENH A;  2ACJ A;  2CJJ A;  4EM1 A;  2VKE A;  2QQB A;  4BE0 A;  4WWC A;  4CZZ A;  3F8M A;  4ZC3 A;  3FM5 A;  1Z0X A;  2HKX A;  3FXR A;  2JA8 J;  2MLG A;  2L9V A;  1Z91 A;  2M2E A;  3ZMS A;  4IPA A;  1VQ7 I;  2YX4 A;  2M1B A;  2DCE A;  2HXO A;  2JVG A;  2DK8 A;  3ZN1 A;  4HX4 A;  3PIP F;  1HBX G;  1I27 A;  1MJB A;  4PGH A;  2CQK A;  1SVL A;  2D45 A;  4KFC A;  3JRB A;  2G0E A;  1A35 A;  1ZYR F;  4N0B A;  3CUQ B;  2K4B A;  4BH9 A;  4R79 A;  1R23 A;  4XLA A;  2G7H A;  4LG0 B;  4UUS B;  3K1N A;  3L09 A;  1JE8 A;  2RC4 A;  1ETW A;  1LDK B;  1WKM A;  2WAQ N;  3I64 A;  1RR8 C;  1X3Z B;  3I53 A;  4ZYH A;  5D4R A;  1WRJ A;  1K6O A;  3I0T A;  2LLK A;  3TO7 A;  1X1P A;  1Z6R A;  4KMF A;  2CU7 A;  2KDO A;  4H4K C;  3OYJ A;  3F21 A;  1BM9 A;  3HHG A;  4BXF A;  2JK3 A;  2FSW A;  2K9L A;  3FXK A;  4LD5 A;  5LHH A;  1CF7 A;  1RKW A;  2WBM A;  1RC9 A;  5FKK A;  4CCK A;  4I0B A;  2YS9 A;  4RGR A;  4MIM A;  1D1B A;  2DMP A;  2R7X A;  2LSO A;  4EJT A;  3DWL E;  2VXZ A;  3C2B A;  4DZP A;  3H9J A;  1WVR A;  2IXS A;  5LBQ A;  1OMI A;  2K9S A;  3L00 A;  4GGG A;  4E7Z A;  1Z7U A;  2OZU A;  4G7O F;  5K1Y A;  3GTJ J;  2DU9 A;  5CVV A;  3FMQ A;  2RVC A;  4IHS A;  4BQN A;  4IHW A;  2EIJ H;  1SC7 A;  4KNY A;  3MZH A;  2JPB A;  2JRT A;  4RS8 A;  1Z3Y A;  2B0L A;  1G8X A;  2RRE A;  3I5U A;  4HBL A;  5M5X J;  1CGP A;  3JW4 A;  2WWY A;  3QYB A;  2W00 A;  2DT6 A;  5K7H A;  2DFE A;  2V9K A;  4L9N A;  3ABL H;  4N9I A;  5DTD A;  4CYC B;  1Z7L A;  3O2P E;  3GBG A;  4LMY A;  1MNE A;  1ON2 A;  2JRM A;  2X4H A;  1GV2 A;  1MZB A;  1T0F A;  3OS2 A;  3DTK A;  2L7M P;  1WJ5 A;  4RMN A;  3F72 A;  2LP0 A;  1LNW A;  5B66 C;  4MLO A;  2VQG A;  3B02 A;  2F2E A;  1LVK A;  4XSX F;  1RKT A;  4KN4 X;  4Z6Y A;  1V55 H;  2LY2 A;  2HOA A;  3RZO J;  3GTM J;  2K3P A;  2ZSH B;  3CTA A;  1D0X A;  1B8I B;  2DK5 A;  2HDW A;  4NB5 A;  2XPW A;  2F5C A;  3VPR A;  2O61 A;  1K78 B;  4MEY F;  1FOK A;  2GOM A;  3T8R A;  2BXY A;  3BR2 A;  2PJR B;  4BJ5 C;  2EZI A;  2MBF A;  4G94 A;  1DP3 A;  1ULY A;  2XSJ C;  4HLX A;  2HU9 A;  4EJU A;  5EZH A;  1FEX A;  3MEX A;  1DP7 P;  1D1C A;  3DTI A;  4MGR A;  2H1L A;  3VDX A;  1NHA A;  5E3N A;  3S3M A;  3HL2 A;  1D0Y A;  3HPH A;  2F5D A;  4RLF A;  1QRY A;  3S3N A;  2BV6 A;  4UXN A;  5HVQ C;  2XSD C;  4HEA 2;  1S7E A;  3ZQG A;  4EV0 A;  4XBF A;  3H92 A;  4F7Z A;  4M3E A;  2EA2 A;  2ETH A;  2FML A;  2FOW A;  3DU5 A;  4HDU A;  4E7J A;  2ZXJ A;  4BHB A;  3OSF A;  4CCM A;  3LQR A;  2A3S A;  1KU2 A;  1HXD A;  3OYG A;  2D5V A;  3ZPL A;  3QP6 A;  2FBH A;  4QTR A;  4Y7N J;  3WTX C;  2CMP A;  3OV8 A;  2HYJ A;  4E7S A;  3CMA I;  4AM3 A;  2CH0 A;  3TGN A;  3ABU A;  4XRF A;  3UR3 C;  3J81 Z;  1V54 H;  3TL4 X;  2P81 A;  4A5M A;  3J80 K;  2Y9Z A;  1K7A A;  1REP C;  2EWN A;  1R1T A;  1B4A A;  1SMT A;  3MKY B;  3DLL F;  1A6Q A;  3OR1 C;  3HSF A;  4C30 A;  5F0H A;  4DYQ A;  4I02 A;  1G3S A;  3UNG C;  5FFX A;  3H35 A;  1FOY A;  2IS6 A;  1TP4 A;  3NQO A;  3SHF A;  3JRF A;  1V4R A;  5BS6 A;  3QWL A;  3FK6 A;  4CYD A;  4OIO F;  1QHG A;  2CYY A;  2R7Q A;  1GXQ A;  3JRA A;  4EM0 B;  2HKO A;  4QPQ A;  4AYB A;  3WU0 A;  3VB2 A;  3U1K A;  5C4J J;  2Z2S B;  2R4G A;  4M9X A;  2R92 J;  3S2D J;  3ASN H;  2K3F A;  4XON A;  5GP9 A;  4DW6 A;  4YFX F;  1EV7 A;  4M6Y A;  5C3E J;  2KIS A;  1HF0 A;  1U0J A;  5D5W B;  1ETQ A;  1BJZ A;  1F9N A;  5F08 A;  4IHT A;  2ELJ A;  3TED A;  2DOE A;  4BHC A;  2MH2 A;  2COM A;  3CF5 F;  3BTC A;  4CCJ A;  4FE7 A;  2P0W A;  4UVA A;  2UXX A;  1MMS A;  1X1A A;  3ZXS A;  3REO A;  5A2Q K;  3ABM H;  3QU3 A;  1KYZ A;  4XLC A;  1IGN A;  2VKH A;  3G4S I;  3CCQ I;  4II3 A;  4WX9 A;  4WXH A;  3PIO F;  1SD4 A;  1MMD A;  3EUH C;  2ID6 A;  1GXP A;  2EFN A;  3CCE I;  4IHX A;  2XVC A;  4XID A;  1UHS A;  3I71 A;  1WFX A;  2JSP A;  4ZZL A;  1S7A A;  1Y39 A;  2CO5 A;  5ILU A;  2NOJ B;  4LG0 A;  3WE2 A;  2QLZ A;  3H5N A;  4J00 A;  5DV5 A;  2ZXH A;  3DKY A;  1VQL I;  2EJR A;  4H0E A;  3I54 A;  4I09 A;  4ESF A;  2CWE A;  2HZD A;  1N77 A;  1BR2 A;  3KP3 A;  3C2H A;  1O3S A;  1RIO H;  3QQA A;  3A0B C;  5HLG A;  1XC5 A;  3OYF A;  4S0H B;  4XLN F;  2COB A;  4ZJZ A;  4KDP A;  5L3F A;  4KYW A;  3M8E A;  4A12 A;  4B1R A;  1RPW A;  3KEO A;  1YW7 A;  2KRH A;  3GW2 A;  1D8J A;  2X48 A;  3EYY A;  4C3J J;  1ZLJ A;  2E2H J;  1NH3 A;  3ZMZ A;  4F91 B;  1F1Z A;  3EET A;  5HLH A;  5EG0 A;  1JKP C;  4A3J J;  4EM2 A;  3HXL A;  2L7K A;  2BHY A;  4XM3 A;  4WCG A;  4BNC A;  3K2Z A;  4BEH A;  1XGN A;  2VL8 A;  3RYR A;  2R7V A;  3BT9 A;  2WV1 A;  3G71 I;  1K78 A;  4BE1 A;  3FWE A;  3CJT B;  4C9Y A;  5A2Q Z;  3SEZ A;  4EJV A;  3S1Q J;  2VKV A;  1R49 A;  2IW5 A;  3IRR A;  4IX7 A;  2CV1 A;  2QM3 A;  2HYG D;  1WHU A;  3CQZ J;  3F9K A;  5L3G A;  2TDX A;  1IV6 A;  2MG4 A;  3LSH A;  5BQT A;  1X1B A;  2HWV A;  2KRF A;  2YX7 A;  2DOD A;  1HW5 A;  3KYC B;  4ZDO A;  2KJB A;  5D5X B;  2JT1 A;  2NAZ A;  1X1C A;  2D2W A;  1U9O A;  2BW3 B;  2F5E A;  5CKT A;  4NHJ A;  1P2F A;  3OYB A;  1J75 A;  3OOP A;  4A3M J;  4N9H A;  4YII A;  3A0H C;  3TP0 A;  2PG4 A;  1SMY F;  3KLN A;  2JA6 J;  1XD7 A;  4IO9 F;  2OF7 A;  3IP4 B;  1TL8 A;  2KJC A;  2RNJ A;  2L9R A;  2XKP A;  2HDD A;  3IL2 A;  2V1D A;  2V9V A;  3M8J A;  3TBI A;  1MKM A;  5EYR A;  4KIT B;  3WE3 A;  3L2C A;  2ESH A;  1S5L C;  1WQ2 A;  2E36 A;  2ZME B;  5EF6 A;  4L9V A;  3BQZ A;  2ELK A;  4QIW N;  3HOZ J;  2E19 A;  5D4S A;  2JVH A;  4IRH A;  1B1B A;  1R5G A;  4LIU A;  5FKL A;  3CCR I;  1K6Y A;  2JPC A;  1BI0 A;  1ZN2 A;  1A6I A;  4XK4 A;  4D1Q A;  3P9K A;  4E7H A;  1BBY A;  4II2 A;  2H94 A;  5CVU A;  2E2I J;  2VAS A;  4A3G J;  3MKW B;  3JAM Z;  4EEF G;  4JBA A;  2CUJ A;  2FBK A;  1V3F A;  5H2F C;  3F22 A;  1AKH B;  5EG0 B;  3DU6 A;  2E1M B;  4Q5S F;  3ZMU A;  3GZ6 A;  3HTS B;  1HDP A;  3DQV C;  4P96 A;  3MN2 A;  4EGZ A;  3DP7 A;  2KLO A;  1ZAR A;  4CHU A;  3JR9 A;  4E7K A;  2Y0S A;  1T6S A;  2CQQ A;  4XLE A;  3ZMT A;  5JFR A;  3JRI A;  1R4M B;  2WAQ A;  1WJA A;  5JHU A;  2ZME C;  2XAU A;  3OL3 A;  2V1X A;  5DD8 A;  5GTH C;  5E20 A;  3LST A;  4ITV A;  3C18 A;  3ZGK A;  2X1C A;  2Z3Y A;  1XB4 A;  2R7O A;  3DBR B;  5TIS C;  1H0M A;  3DPL C;  1TW3 A;  1IV8 A;  5EEG A;  3FKJ A;  3DKX A;  5E3L A;  2XPV A;  2R5Z B;  1H88 C;  3R0J A;  2CRG A;  4YEL A;  3BOQ A;  5DUK A;  3RQ4 A;  3AL0 B;  2IS1 A;  2O8K A;  2QEN A;  3BY6 A;  4B09 A;  5LHI A;  5CJ9 A;  3F23 A;  1G4D A;  1O7L A;  3M8F A;  3CDI A;  4PK4 A;  3HBL A;  3BG3 A;  1XDU A;  4UV9 A;  2XRL A;  4G8X A;  3CC4 I;  5J47 A;  4UV8 A;  4LGW A;  2GIV A;  2LY1 A;  5FGM A;  1E3O C;  3EUH A;  2BY0 A;  2EH3 A;  1MH4 A;  5ICC A;  3CO6 C;  2VBW A;  3CCM I;  2DPU A;  5D8K B;  3S1N J;  4DIQ A;  4A3E J;  1DUX C;  3HC7 A;  3BR6 A;  3ZQC A;  4GO1 A;  1Y56 A;  3CJR B;  5ERI A;  2HPI A;  1W0T A;  2LD5 A;  1ZG3 A;  3UKG A;  1XGM A;  1DQU A;  2KFD A;  2MW8 A;  1VQP I;  1JKR C;  2L3D A;  5E18 F;  3A2K A;  2PN6 A;  4IXA A;  4ON0 A;  4OOI A;  4IJA A;  4MQ9 F;  3E6D A;  3JSO A;  1MBE A;  4YRV A;  2AS5 F;  4MFD A;  3D5L A;  5K7Z A;  4LLN A;  2IVM A;  3D5S C;  1R71 A;  2EZK A;  2ISY A;  5LGN A;  3GTO J;  2VQH A;  3RDI A;  3F3X A;  4GDF A;  2CQ7 A;  5LFA A;  1ZAO A;  4YEJ A;  2KDZ A;  2QUF A;  3BJA A;  2BBY A;  1Z05 A;  2DT5 A;  1A04 A;  2HPM A;  4G9Y A;  2W82 A;  1X4O A;  2HDC A;  2XV4 S;  4LLL A;  2L9S A;  2R0Q C;  5FFZ A;  3LNQ A;  2YR2 A;  1L0O C;  1C0W A;  2WV0 A;  1SVO A;  3CLO A;  1JTY A;  2DAO A;  4ZZD A;  2M4K A;  4M6V A;  3OYK A;  4ENN A;  3D5R C;  4RGU A;  3D0S A;  1JJ6 C;  2STT A;  3CMM A;  5E3O A;  1E0E A;  4A5N A;  2BW3 A;  5LRS A;  3AAF A;  4I0A A;  2LBF B;  2P8T A;  1UHM A;  3H9Q A;  4QPO A;  1JKO C;  1E2X A;  2KKO A;  3JTH A;  1HOM A;  2JA7 J;  1MD0 A;  1QVT A;  1UEL B;  1DPR A;  3Q3S A;  4BJ6 C;  1SFU A;  5D8L B;  3S1R J;  3MAJ A;  2VC0 A;  2KZG A;  2ME0 A;  3IKT A;  4BXX J;  2L2O A;  2M4G A;  2FX0 A;  2OTJ I;  3GEZ A;  1WJE A;  1EH6 A;  1MW7 A;  1HCR A;  4NQW B;  3GO5 A;  2KP6 A;  4JX5 A;  4PSX A;  5IT9 Z;  2V79 A;  1WPK A;  2GA2 A;  1VF9 A;  1MH3 A;  3QPH A;  4UB6 C;  3GFI A;  3BTJ A;  4LG3 A;  1FTT A;  1ZQ3 P;  3K4M A;  2EA4 A;  3E5U A;  1VQK I;  4HAM A;  3H3U A;  2FOK A;  3M1E A;  3HUG B;  2HI3 A;  2CSO A;  3OYL A;  5LEK A;  4B4C A;  3ZMV A;  3TDZ C;  3CMY A;  2IAI A;  1WJC A;  2EV5 A;  2BEO A;  4RA2 A;  2OQR A;  4BE2 A;  5HDK A;  3BG9 A;  2Q8K A;  1EH7 A;  3F0C A;  3HOX J;  4KMU X;  4RAY A;  5IYB J;  3P5J A;  4UB8 C;  1FYK A;  2RN7 A;  1K4T A;  2QCO A;  2Z5U A;  3CCS I;  4M3D A;  5DYM A;  1YE9 A;  1QPI A;  4WF2 A;  5JLW A;  5FLX Z;  1BW6 A;  3H3V K;  2R7W A;  1FPQ A;  2UUZ A;  1BR1 A;  5L3D A;  1XN7 A;  1JJ8 C;  3S1M J;  3S2H J;  1TWF J;  4OAY A;  2K7L A;  3BDD A;  5FJ8 J;  1LJ9 A;  3H1C A;  2Y0S N;  4PDK A;  3K0L A;  3M07 A;  4I01 A;  4CH7 A;  4XLH A;  2PQ8 A;  3O8H A;  3WTV C;  3CDL A;  2ADU A;  4ZYG A;  1YJW I;  3L2V A;  1OQY A;  2LK2 A;  1I5Z A;  4LB6 B;  1E3H A;  3E7L A;  3U21 A;  5CLS A;  2B9S A;  3KLO A;  1I6H J;  1QA6 A;  4CXF A;  1T39 A;  2OCC H;  2PMZ N;  2JMW A;  2PEX A;  2A6H F;  2Z99 A;  1FJL A;  4FTH A;  4EAT A;  2R7S A;  3DBH B;  2M5W A;  4ETS A;  1YIT I;  4XRM A;  1PUF B;  1G59 A;  3IAS 2;  2KIF A;  2E1C A;  2M3A A;  5JI6 A;  3CJN A;  3T1B A;  2VKD A;  3K9T A;  2LKS A;  1QNT A;  3PQJ A;  1B9N A;  3F8N A;  1YI2 I;  2XGC A;  1YJ9 I;  2JA2 A;  1F5T A;  3OYN A;  4CO8 A;  3W2V A;  4LK0 F;  3OS1 A;  2KZV A;  2DFH A;  1ERD A;  5J8C A;  3IAM 2;  1FIP A;  3HGY A;  4IQJ A;  5ICG A;  3P9C A;  4XLF A;  3DPU A;  3TQN A;  4ZYD A;  4LLG F;  2UV1 A;  2M34 A;  2Y69 H;  5J4Y A;  3CDH A;  1X3W B;  2V6C A;  4P55 A;  3V7S A;  2AQF A;  3FIW A;  3K4J A;  3TP3 A;  3A4C A;  3CP8 A;  4E7I A;  1YIJ I;  3AG2 H;  1LDJ A;  3OYE A;  5TRD A;  1W7P A;  4HZF A;  4CCO A;  1BC7 C;  3QAH A;  3HOW J;  4IVN A;  2CQN A;  3MQ0 A;  3MVP A;  2GXA A;  4GRI A;  3LSK A;  5HS9 A;  3PQK A;  4IQ4 A;  4HW0 A;  1HKS A;  1RR7 A;  3A1Y A;  4Z2Y A;  1APL C;  3W2A A;  1TNT A;  1FMV A;  3O6B B;  3J7Y J;  2M45 A;  2ICW G;  3B6C A;  3PM1 A;  1QZZ A;  2QWW A;  2E2J J;  1FWZ A;  3K1P A;  2DJN A;  1MGT A;  4M9Z A;  1Y8R B;  2A68 F;  1YX5 A;  2FNA A;  3T0Y A;  4A3B J;  4U88 A;  2JTV A;  1TTY A;  3Q0W A;  5EGO A;  5LGT A;  3ZQH A;  1UZC A;  2M87 A;  2KT0 A;  3ZOB A;  1ZGA A;  1VQ8 I;  2NVQ J;  5AIP A;  2MD0 A;  4CCN A;  3KP6 A;  3Q5F A;  2VUM J;  1QZE A;  3WGI A;  2RAE A;  3ML6 A;  3KEQ A;  4Y3O A;  3HSR A;  3RIR A;  4A3K J;  1XCB A;  4FX0 A;  4OIR F;  1IN5 A;  1W7P B;  1WH7 A;  3EUK L;  3VYS B;  5GAE J;  1X3U A;  2JUG A;  1NK3 P;  3DF8 A;  3RQI A;  3CES A;  4BL0 B;  3GFJ A;  4D7N A;  2E34 A;  4RAG A;  1GUU A;  2BVL A;  1U8R A;  4L18 B;  4IF4 A;  2A5W A;  4AWX B;  2HOS A;  1FOW A;  4Y4R A;  1ZKG A;  4B43 A;  1H8A C;  1JHH A;  4FE4 A;  1TWH J;  3IH2 A;  3WU1 B;  1QZY A;  3KET A;  2DA2 A;  1B59 A;  2LG4 A;  2W4S A;  1NTC A;  3S17 J;  3HOV J;  1MSE C;  3PUB A;  2KRC A;  1SFO J;  2EBI A;  4HNT A;  4MQV A;  2L0K A;  4RLQ A;  4BDZ A;  2DTZ A;  4A2U A;  1PP7 U;  4WK8 F;  1T98 A;  1MND A;  1YW9 A;  5C4X J;  2EIL H;  4O5V A;  2VJ4 A;  1G2H A;  3H36 A;  2Z9O A;  3FBI B;  3W6J B;  4JOM A;  4BAC A;  1FZP B;  1D5V A;  1JI8 A;  3GXO A;  2K02 A;  3ZQF A;  2XRO A;  1SAX A;  2K9N A;  2LNB A;  4FIS A;  2OU2 A;  1LE8 A;  3FMS A;  3A01 A;  1YOV B;  2XGX A;  2DT7 B;  1JKQ C;  4I2O A;  2FMY A;  4IEJ A;  5ILS A;  2XKO A;  1F36 A;  4BY7 J;  1FBU A;  2CUF A;  2Z16 A;  2VE9 A;  4BQQ A;  1LDD A;  1IRF A;  2QBY B;  3CUO A;  4ASN A;  4CYC A; 
#chains in the Genus database with same CATH homology
 4BBR J;  3TW6 A;  4B3A A;  1XC5 A;  5IP9 J;  4S0H B;  1A5J A;  2COB A;  1DU0 A;  4B1R A;  3TW7 A;  3SDG A;  4IHV A;  1RPW A;  1JT6 A;  2DA6 A;  2Y31 A;  2O9L A;  5EGO B;  1D5Y A;  2X48 A;  4C3J J;  4A93 J;  2E2H J;  2O7O A;  2W48 A;  1MBK A;  1B72 A;  2Y2Z A;  1OCP A;  5EG0 A;  3S16 J;  1JKP C;  3GTK J;  4A3J J;  2JN6 A;  5J1Y A;  1POG A;  2K9Q A;  1TWA J;  2DA4 A;  2FD5 A;  3QPL A;  3BT9 A;  2WV1 A;  3OIO A;  3BTL A;  3FKI J;  3I4M J;  3Q0V A;  1QVU A;  1OFC X;  5FLM J;  1F43 A;  2ME6 A;  1W0U A;  3S1Q J;  2VKV A;  1LFB A;  2L7F P;  2EZH A;  3K2A A;  4Y52 J;  3B6A A;  3BR0 A;  3CQZ J;  5JLX A;  1IV6 A;  2MG4 A;  2XGE A;  4X6A J;  3GTG J;  2XB0 X;  4AYB N;  2M0C A;  5F0F A;  3HEF A;  2YU9 J;  1U9O A;  2DA7 A;  3PO3 J;  4A3M J;  4LOC A;  5IYC J;  1XS9 A;  3TP0 A;  1PUF A;  2Y30 A;  2JA6 J;  2OF7 A;  2DMT A;  1ETX A;  1I3Q J;  2L9R A;  2HDD A;  5EYR A;  4BKX A;  3D1N I;  1ZR2 A;  1ETY A;  3PO2 J;  5EF6 A;  3ZQI A;  3BQZ A;  2ELK A;  4QIW N;  3HOZ J;  2E19 A;  5FKL A;  4C2M J;  2OPT A;  3HOU J;  2FJ1 A;  2NS7 A;  4BBS J;  4XK4 A;  1A6I A;  2VPR A;  4RDU A;  1IUF A;  2AHQ A;  4A3G J;  2E2I J;  2M9H A;  2ZB9 A;  4EEF G;  5F04 A;  5J3L A;  5M3M J;  4ABZ A;  1AKH B;  4DZJ A;  5EG0 B;  1HLV A;  3HDD A;  4UUS A;  1ITY A;  4C3H J;  4FCY A;  1HDP A;  1IDZ A;  3MN2 A;  3BR5 A;  3WHB A;  2XB5 A;  3A03 A;  3BTI A;  3OOU A;  3JR9 A;  2CQQ A;  3JRI A;  5EDN A;  1B72 B;  1XG1 A;  3BQY A;  3HM5 A;  1R9T J;  1SAN A;  3S14 J;  2LKX A;  1MBH A;  2H1K A;  3GTP J;  2MGQ A;  1I50 J;  1IJW C;  2EQR A;  5E3L A;  2XPV A;  2R5Z B;  3H0G J;  1H88 C;  2TCT A;  1NK2 P;  5M5W J;  2CRG A;  1WGX A;  1T33 A;  1LFU P;  4V2G A;  1BW5 A;  2O8K A;  1TC3 C;  3Q0U A;  2R5Y B;  2CQX A;  2LTP A;  1DU6 A;  5IOZ A;  2R7Z J;  4C3I J;  3G1L A;  2NVT J;  5C44 J;  5GPC A;  2EZL A;  3HBL A;  3BG3 A;  4DYC A;  1MBG A;  2XRL A;  2ID3 A;  4A69 C;  3HOY J;  2LVS A;  2I10 A;  4W97 A;  3BR1 A;  5K7F A;  1E3O C;  1TWC J;  2EH3 A;  4J19 A;  1MH4 A;  2HXI A;  3S1N J;  4A3E J;  1JT0 A;  1LE8 B;  3BR6 A;  3ZQC A;  1W0T A;  2LD5 A;  3UKG A;  3LSP A;  3BR3 A;  2MW8 A;  1JKR C;  1ZK8 A;  2NVY J;  3HB9 A;  5F0C A;  1WI3 A;  3CCY A;  3LSR A;  4D5C A;  1K61 A;  3FIS A;  1RES A;  2L7Z A;  3WHC A;  1Y1W J;  1K83 J;  3HGG A;  1MBE A;  2X9D A;  1OCT C;  4MFD A;  4A3F J;  5DS9 A;  2DA5 A;  5K7Z A;  2GLO A;  2IEK A;  2EZK A;  4XIC A;  3GTO J;  3JRG A;  5BNG A;  1RET A;  4JYK A;  3O8G A;  2KDZ A;  4QSH A;  3IH4 A;  4G12 A;  4A3D J;  1TWG J;  2JA5 J;  2TRT A;  1JUM A;  2Y9Y A;  4MFE A;  3DEW A;  3A01 B;  1ENH A;  2CJJ A;  1WCM J;  2R0Q C;  1X2M A;  2VKE A;  1OJL A;  3LNQ A;  2NS8 A;  1X2N A;  1JTY A;  4M6V A;  1Z0X A;  4I76 A;  5IP6 A;  2JA8 J;  2DN0 A;  1JJ6 C;  2M2E A;  5E3O A;  5FKN A;  1GDT A;  1VFC A;  2HXO A;  4AC0 A;  1JKO C;  2AO9 A;  2LR8 A;  5EZG A;  1HOM A;  1WH5 A;  2JA7 J;  1QVT A;  3Q3S A;  2G0E A;  3JRB A;  3S1R J;  2QF7 A;  2XPU A;  1P7J A;  5IOY A;  4AUX A;  2ME0 A;  2HOT A;  4BXX J;  2FX0 A;  1VI0 A;  1T56 A;  5J1U A;  1HCR A;  3NAU A;  5E3M A;  4JX5 A;  4UUS B;  5J1R A;  1WPK A;  1Q1V A;  4X1E A;  3HKZ N;  2YUS A;  1ETW A;  1MBF A;  1IRZ A;  2WAQ N;  4D5F A;  1VF9 A;  1MH3 A;  2H8R A;  3SFI A;  1FTZ A;  3BTJ A;  1FTT A;  1ZQ3 P;  1ETK A;  3M4O J;  1MBJ A;  2LLK A;  2HQ5 A;  2CU7 A;  2JWT A;  2HI3 A;  5M3F J;  4B4C A;  1H89 C;  1U78 A;  2JK3 A;  3CMY A;  3I4N J;  2IAI A;  1B8I A;  2VI6 A;  4JP0 A;  1RKW A;  3JRC A;  3BG9 A;  5FKK A;  5IPA A;  1ETO A;  2YS9 A;  4MIM A;  4JX6 A;  3F0C A;  2DMP A;  3HOX J;  5IYB J;  4A3C J;  1ZTR A;  2QCO A;  3C2B A;  4DZP A;  4M3D A;  1JTX A;  2K9S A;  1QPI A;  4I6Z A;  3H3V K;  5JLW A;  3M3Y J;  1BW6 A;  1FIA A;  3GTJ J;  1JJ8 C;  3S1M J;  3S2H J;  9ANT A;  1TWF J;  3QPS A;  5FJ8 J;  2JJ7 A;  4IHW A;  2MSY A;  2Y0S N;  4A3L J;  3GTL J;  2NOG A;  3O8H A;  3CDL A;  1O4X A;  5M5X J;  3G1O A;  2FQ4 A;  3L1P A;  2LK2 A;  4HNV A;  2IBD A;  5K7H A;  3E7L A;  4XRS G;  1I6H J;  5DTD A;  1CQT A;  4CYC B;  1EF4 A;  2DA3 A;  2JMW A;  2PMZ N;  3GBG A;  1FJL A;  4FTH A;  1HDD C;  1X58 A;  1GV2 A;  1PUF B;  4XRM A;  2L7M P;  1UMQ A;  2LP0 A;  3BG5 A;  3LSJ A;  4MLO A;  3JRD A;  3G1M A;  5M5Y J;  2XGC A;  5F27 A;  2DMQ A;  5GPA A;  2DA1 A;  5IP7 J;  1RKT A;  1IDY A;  2HOA A;  3RZO J;  3GTM J;  3MKL A;  1FIP A;  3HGY A;  1B8I B;  2XPW A;  3VPR A;  1Y1V J;  1IG7 A;  3BR2 A;  2EZI A;  4M3B A;  1FEX A;  2M34 A;  5EZH A;  2LY9 A;  1YRN B;  1MNM C;  3SJM A;  2XGD A;  1GVD A;  5E3N A;  1AU7 A;  3FIW A;  3TP3 A;  1QRY A;  4RBO A;  3A02 A;  2XSD C;  3W6V A;  3HOW J;  1S7E A;  3ZQG A;  3MVP A;  4JX4 A;  4M3E A;  2M8G X;  4NDL A;  1RR7 A;  3JRH A;  1APL C;  3OSF A;  1UG2 A;  2N8G A;  2D5V A;  4XRS A;  4QTR A;  4Y7N J;  1GT0 C;  2R5Z A;  4L5E A;  3RZD J;  3B6C A;  5HOD A;  2HYJ A;  2ECC A;  3PM1 A;  2E2J J;  2DJN A;  3JRE A;  1AKH A;  3NAR A;  2P81 A;  2Y9Z A;  4A3B J;  3Q0W A;  5F0H A;  5EGO A;  3ZQH A;  4DYQ A;  4A3I J;  2KT0 A;  2K40 A;  1ORK A;  3ZOB A;  2NVQ J;  2DMN A;  2VUM J;  3JRF A;  3FK6 A;  2RAE A;  5FLV A;  3RKQ A;  1IC8 A;  5F1J A;  1JUS A;  3JRA A;  2CUE A;  5FKM A;  3ZQL A;  2E1O A;  2ECB A;  4A3K J;  3LOC A;  4GFB A;  5C4J J;  1WH7 A;  1NK3 P;  4M3F A;  2X6O A;  3RQI A;  1MSF C;  2R92 J;  2GM4 A;  4D7N A;  3S15 J;  3S2D J;  5GP9 A;  4DW6 A;  1YRN A;  5C3E J;  1GUU A;  1HF0 A;  3GTQ J;  1ETQ A;  1BJZ A;  5F08 A;  2HOS A;  1GV5 A;  3FK7 A;  1ZKG A;  1H8A C;  4FE4 A;  2LFB A;  4M3G A;  1TWH J;  3IH2 A;  3TED A;  2NVX J;  2DA2 A;  1ZR4 A;  3S17 J;  3K7A J;  1NTC A;  3HOV J;  1MSE C;  3BTC A;  1ETV A;  4FE7 A;  2EBI A;  1SFO J;  2L0K A;  1JGG A;  4D7M A;  2DTZ A;  4DYR A;  5FKO A;  1AHD P;  2R93 J;  5IYD J;  1Z77 A;  1IGN A;  4IHY A;  5C4X J;  4MO7 A;  4UUT A;  1U8B A;  1G2H A;  2ID6 A;  1U9N A;  4IHX A;  3IH3 A;  3ZQF A;  4XID A;  1UHS A;  2K9N A;  1BL0 A;  4FIS A;  3DCF A;  1VND A;  4W1U A;  2GBY A;  1LE8 A;  2B63 J;  3A01 A;  1P7I A;  1JKQ C;  3OSG A;  4IEJ A;  1F36 A;  4V2F A;  4BY1 J;  5EEA A;  4BY7 J;  1ZGW A;  2CUF A;  2R5Y A;  3IV5 A;  1BA5 A;  2WB1 N;  3LSG A;  4CYC A;  2DMU A;  3QQA A;  1JUP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...