2LMDA

Minimal constraints solution nmr structure of prospero homeobox protein 1 from homo sapiens, northeast structural genomics consortium target hr4660b
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
174
structure length
174
Chain Sequence
MGHHHHHHSHMAMQEGLSPNHLKKAKLMFFYTRYPSSNMLKTYFSDVKFNRCITSQLIKWFSNFREFYYIQMEKYARQAINDGVTSTEELSITRDCELYRALNMHYNKANDFEVPERFLEVAQITLREFFNAIIAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCLQELLHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Prospero homeobox protein 1
publication title Determination of solution structures of proteins up to 40 kDa using CS-Rosetta with sparse NMR data from deuterated samples.
pubmed doi rcsb
source organism Homo sapiens
total genus 52
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2011-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05044 HPD Homeo-prospero domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.500 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeo-prospero domain 2lmdA00
2LMDA 1MIJA 1XPXA
chains in the Genus database with same CATH superfamily
2Q0OA 4LD5A 1BI1A 1X1CA 2PMHA 5FB2A 3UR3C 1HXDA 1YITI 5ICCA 1BBYA 5KAFC 3H3VK 1MBFA 2LP0A 3CLQA 2RNGA 3QYFA 4ESFA 1MJ9A 4QTRA 3HSFA 1DGWY 3I4NJ 5D5XB 4IEJA 2EIJH 4LITA 1B72B 1S5LC 4L9JA 5TISC 3HUGA 4UV9A 4PFOA 1Y8RB 4EATA 1WI3A 4UV8A 2QBYB 2L2OA 3BR5A 1XGNA 1W7PB 2I10A 1P92A 1VZ0A 1YW8A 1U8RA 2VBXA 2IS2A 1E3PA 3ZQ7A 1TBXA 4LLGF 5IT9K 1W36D 5F1RA 1I27A 3JAMZ 2CU7A 4MEXF 4RGSA 1U9OA 3DF8A 1I50J 1ZG5A 4MFDA 1QPMA 2LLKA 3FMQA 3JRGA 4LLNA 3KLOA 4G6QA 4KIBA 4PUSA 5E20A 4ZYAA 3JAMK 4U88A 2VPRA 2R4GA 3ABKH 3IH4A 2PLYA 1FYLA 2UUZA 2DTZA 1TWHJ 5LFAA 4HPQA 4V2GA 4A3BJ 2ZNYA 1X1DA 4YELA 2M45A 2GAUA 1WI9A 2ZMEB 1B4AA 1LFPA 2ZJRF 2LFBA 5CYVA 3B73A 4D5FA 4IL6C 5K7FA 1O3SA 5FD6A 2VLAA 2LBFB 2PN6A 4I76A 3RYPA 1IN7A 2DFEA 2F5EA 1XSXA 3W6VA 4ETSA 5EYRA 1I5ZA 5IY5H 3GTKJ 2NS0A 5EEGA 4HAMA 3F9KA 3ZRGA 1ZG1A 2RQQA 4MGRA 2XB5A 4XOPA 1EH8A 4Y17A 2VBYA 3TOBA 1FIAA 1ETQA 4Q47A 4IOCF 3FKJA 3OOUA 1YQAA 4L9TA 2X6XA 4B3XA 1RETA 1Z3XA 1IUFA 3FM3A 2IA2A 3HTUA 4XLFA 1WFXA 2HTSA 4UUSB 2NS7A 3DCFA 1O3RA 1BW6A 3V7CA 5HNFA 2LK2A 2L7KA 3ZQIA 5C3EJ 2M0CA 2QQBA 3WE3A 2V1DA 1V4RA 4HW0A 4NB5A 4CZCA 3P7NA 4L18B 2GQQA 4LMYA 1J59A 1OR7C 3JSOA 3LNQA 3I58A 3BQZA 4J00A 1ZG3A 4HNVA 1F5TA 4XLCA 2P6SA 3A01A 4EQQA 2V6CA 3TP0A 3SHFA 1BL0A 4WX9A 1FIPA 4P55A 4E7LA 4GO1A 2XF5A 3C2GA 4BYYA 5ILUA 3R4KA 1YJ9I 1R4MB 1TWGJ 3FWEA 2K9LA 3DPTA 5CQGA 5EF6A 4C3HJ 5E18F 3CC2I 2JK3A 3RJPA 2JA8J 4AIKA 5LD2C 1IZ1A 2VJJA 3IKTA 2GA1A 4UY8I 5DV5A 3HOXJ 2QSGX 2YU3A 2V1XA 2A69F 4EJUA 1K6OA 2BBYA 1PP8F 2L7ZA 3CMMA 3AL0C 3VB2A 2FEZA 1N77A 2OUMA 2DYRH 1T08B 2VODA 1B1BA 2DT7B 2E1OA 2ZXJA 2RQPA 3S15J 3CF2A 4CCJA 4XRFA 1BIBA 2JN6A 3IAM2 2YSRA 5L3FA 2XAJA 2O3FA 2X6OA 5KNLA 5CVVA 3O6BB 1PUFA 1JGSA 5E8GA 3ZN0A 1W5SA 2ACJA 3REOA 2QA4I 3L7WA 1DQUA 5EZHA 1Z67A 2JVHA 1F4KA 1HKQA 2ZBKA 3H35A 5J1RA 2TCTA 3TOAA 3K4KA 2HYJA 4XORA 1Z21A 2EILH 1HSTA 2EV5A 4RM2A 4HG2A 1CQTA 3M8EA 3UKGA 4CSWA 2QQAA 4A3EJ 3KZIC 1MNMC 2F6CA 1FWZA 2HXOA 2OAZA 2WADA 3RTRA 3WTTC 3CF5F 4O5VA 2FJ1A 4NDLA 2LVSA 3IV5A 3IH3A 4EGZA 1MDMA 1OJLA 3GO5A 4B48A 3LMMA 3H5NA 4D9JA 5D5UB 3HOZJ 3BZCA 2CFOA 4HX7A 2IRFG 2BOLA 2ID6A 2V9VA 1FMVA 3DFGA 4BXFA 2FMYA 2Q1ZB 2D5VA 4IHTA 1LFBA 2M9HA 1GV2A 2W25A 4XM3A 3OIQA 2K9NA 3Q5FA 1ENHA 1FSEA 4S0HB 2K3PA 4AU7A 2HFHA 1K78B 3KIOA 1OCRH 1F43A 5GAEJ 2VKHA 3FMRA 2X4HA 4IRGA 4KUMA 3PO3J 5EDNA 5GAHJ 3NWSA 5JHUA 3QU6A 1I6XA 3I54A 2H1LA 2KIFA 3FXRA 1P4AA 1V3FA 2DTRA 4KNYA 2IAIA 5HODA 2DW4A 2HZDA 1ETVA 1ZGJA 1JKQC 5M5YJ 2CW0F 1PVEA 2KZVA 3QPSA 1MBHA 2ETHA 1U5TA 5ED4A 2D1HA 3JSPA 4O6JA 4MNUA 2HDDA 2NVTJ 3Q9VA 1MBJA 3B6AA 4BBRJ 3AFHA 3O3KA 4M74A 1BI0A 3G73A 3BLYA 2E35A 3OYFA 3T8RA 2STWA 2H94A 1OPCA 2CUEA 2GOXB 2XHKA 1VQ7I 1ZLJA 2DYSH 1LFUP 4LB6B 1RR7A 2WC2A 3PSIA 2ELJA 2QQ9A 4D1QA 2Y0SA 3CCSI 2Q2EA 2VB6A 2BE5F 1KU9A 3NEUA 4L0YB 2DFFA 3I3LA 1YW9A 3OWTA 3FXQA 3I4MJ 3DQVC 4GYIA 5E3OA 3ZPLA 2H8WA 4GFBA 3L00A 1LQ1A 4A3CJ 4BEHB 4PSWA 2XPWA 2EQRA 2B7EA 3WTUC 5FO5A 4ENMA 4DYQA 1WPKA 1NTCA 4P9FA 3E97A 2G9WA 3SXYA 2EIKH 1ITYA 2EZHA 1KONA 1B8IA 2A07F 5F6FA 1MJAA 3PFYA 2X48A 3HKZA 4C9YA 1Y39A 3KYLA 4XLHA 4XLNF 3JREA 2L3DA 5HNHA 4BJ6C 2B9SA 3A0HC 4IHXA 2MD5A 2HPIA 2OJED 2P5VA 2IJLA 4MIMA 2Z5UA 4NBQA 3TBIA 3E5UA 1RI7A 2HYGD 1OMIA 1Z77A 3K69A 1JXSA 3K1NA 2ELHA 1YW7A 1B72A 2E1CA 3CMYA 2P81A 4Y15A 3S2DJ 2QBYA 1SVOA 2K27A 3L9FA 4D7NA 2JPCA 2W57A 3W2VA 3H3ZA 2IVMA 3G2BA 3N05A 5H6QA 1XSDA 2KJBA 2WB1A 2CO5A 3BPXA 2A5YB 4LIVA 3ELKA 3CCVI 5DS9A 4Y4RA 1D8JA 2ZXWH 1MMGA 2EH3A 1OYIA 4XK4A 3DKXA 2PJPA 1FOKA 2L7FP 4IKFA 4I2OA 4RBOA 4IPAA 2QENA 2DA3A 4E7KA 2IS1A 2EZLA 1SFKA 2FQ3A 2OV7A 4ZTJA 2W24A 2CW7A 4M6VA 2JJ7A 2LY1A 2XROA 4KT6A 3C18A 2HXIA 5CLSA 4HOBA 1XSVA 4QPQA 1QZZA 2OU2A 1WJFA 3D5SC 1JT0A 2FOKA 2R5ZA 3LL7A 1SAXA 2BY3A 2LG4A 2JUGA 4E4HA 1W1WE 3EPZA 3QOPA 4DOZA 4D0PA 4II2A 1T0FA 3COAC 5DYMA 3TGNA 5LBQA 1SFOJ 3HIFA 2R7DA 3K70D 4EM0B 3WHBA 1G2HA 2CYYA 4LG0B 3Q9SA 4BE2A 3S14J 1XTAA 3J81Z 2GOMA 4UUSA 4B43A 4CCNA 1EJ9A 4A3DJ 4DIQA 1SC7A 2JMWA 2K7LA 3ONQA 2A6TA 1EV7A 2FBKA 4FE7A 2NVXJ 1HA8A 2CUFA 4BJ5C 3MEXA 5LHGA 2QSFX 4XKWA 2CQNA 1USTA 3I0TA 4A0YA 1TWAJ 5CQEA 4L5IA 4C2TA 4E6KG 1UFMA 2ME6A 4EVIA 3ISPA 4IHYA 2JTVA 2KLOA 1XMXA 4LK1F 2WAQA 3K4JA 5GAGJ 3HOVJ 2HGCA 1E3OC 3FK7A 3BTCA 4NQWB 2VXDA 3OV8A 1U2WA 5E1XA 1P9QC 2Q8KA 1R23A 5J1YA 4BXXJ 1NG7A 3OYAA 5K5RA 2LH9A 3D1NI 1WZ2A 1VQ5I 2V26A 3DWLE 5JFRA 1MSEC 3L2RA 4AM3A 1WSUA 1XPXA 4EEFG 1P4WA 2FMLA 5IP7J 4RB2C 1LEBA 3KX2A 3VYTB 3HOSA 2ISZA 1DPRA 1JTYA 2DA7A 3MVPA 4GCVA 4HRIA 5CVUA 2DOAA 1OCOH 2KDZA 2QM3A 2NYXA 3HRTA 1HOMA 3IP4B 4HNTA 1QPIA 5ICGA 2VBZA 3GYHX 3ROUA 1ORKA 3E6DA 4RLFA 3PM1A 2F5DA 1G4DA 1DPUA 2ZFUA 3DBHB 2HEOA 5FLVA 2HDWA 4V2FA 4JX4A 1I3QJ 5FFXA 2WTEA 4QWQA 4R1HA 3S2WA 1VQ6I 2XRLA 3GFLA 2CQXA 2R7TA 1FYMA 2CV0A 1ETXA 3B6CA 2WA0A 1FX7A 5EGOA 3M8JA 1ZK8A 5GPCA 1VQNI 2F5VA 2FE3A 3CCEI 2ICWG 1RESA 2MC4A 2MG4A 4CICA 1VQKI 4KYWA 2LKPA 3S3OA 1ZTRA 2CH0A 1MMSA 3ULQB 1D1BA 3DEUA 1DU6A 3BQYA 4ZTFA 2RN7A 3FXKA 4CCLA 5L3BA 3AAFA 2F5CA 4A0ZA 1ZAOA 2KIQA 4RB3C 4UXNA 1G59A 1VQPI 2UXXA 3WU0A 2M3AA 5FRNA 4P1WA 5FFZA 2R5YB 3BJOA 2OTLI 3TDZC 1I3AA 3KP6A 1R1VA 4YEJA 4XRSA 1GHCA 4IO9F 2EV0A 2EBIA 2VOPA 1G8XA 2CQQA 2KQRA 3FIWA 3AL0B 2M4GA 1MIJA 3CTAA 5FKOA 1R4NB 1TW2A 1ZKGA 2WY7Q 4AVZA 3I64A 2EINH 2FNAA 3BG7A 4PSXA 5DEQA 1K78A 2XAUA 4Z2YA 2VOOA 4N0BA 1ETOA 4UVBA 3I71A 3LSJA 2CUJA 3RPQA 3Q0UA 4M3FA 1ODDA 4OINF 3FXOA 5ILVA 5L3CA 3KP3A 4PCQA 1D0XA 2I5UA 3CO7C 1W0TA 1LVAA 3DBLB 4N4OB 2CSOA 1YJWI 4G6TB 3GCMA 2L9SA 3O8GA 4GGGA 2Z2SB 3G6EI 4CGZA 1UAAA 3O2PE 2OD5A 4NNJA 5D4RA 4HF2A 3GW2A 1G6NA 4LK0F 4RLQA 3F8CA 2A61A 3LAPA 5F04A 1JUSA 1FBSA 2E2HJ 2R7XA 2EV6A 5HS9A 1IXSB 4LB5A 2LSOA 3P9KA 2GBYA 3OYIA 1GLNA 2HU9A 2IW5A 5AONA 4XICA 2GA2A 2L5QA 2RAEA 2K3FA 3S8PA 4EJOA 3HOUJ 2CQKA 3TL4X 5J6XA 3KCCA 3GWZA 1HDDC 4YIIA 2W7NA 1IDYA 1BR4A 1WJBA 3J7YJ 1ZARA 4A3GJ 2WBMA 3OS0A 3MFKA 2FA5A 2P0WA 4A3FJ 1FEXA 3I55I 3DTKA 3NRVA 3ZP5A 2RC4A 2RREA 3E3VA 4I99C 4J19A 5KVRA 3IAS2 3HEFA 1W4MA 2DN0A 2IS4A 3V7RA 3OYGA 2QKLB 1BC7C 4RB0A 2CUZA 4ZJZA 1ETWA 4CYCA 4RM3A 4KMFA 1RUNA 1TL8A 3RQIA 2R3SA 3GTJJ 2OTJI 5D5WB 2DA5A 4A3KJ 2V9KA 1FSHA 4PK4A 5TGTA 2HOEA 1X1BA 4HF0A 5FD5A 3BZKA 2QGUA 4ZZLA 4LLLA 1YIJI 1VNDA 1WJCA 4PGGA 3OS1A 4L5JA 1NG6A 2QZ8A 4E7SA 3CMEI 2P4WA 4OOIA 5IT9Z 3CMAI 1Q1VA 3JTHA 1PUEE 5LGNA 2F5FA 3QAHA 2BY2A 1MJBA 2HQRA 3VYUB 1S8NA 2E36A 2DA6A 4KIFA 2BXZA 1DGRM 5E17F 3FX3A 4M9ZA 1YRNA 1MMDA 5B3SH 4EJTA 4P96A 1E0EA 3ASOH 2IP2A 5B1BH 3I59B 2W00A 4M6YA 4XOTA 3MMYB 1EH6A 2A05A 1Y1WJ 2CGPA 1MH4A 3BR3A 2DO7A 2KT0A 3LA2A 2KIMA 4BHCA 4RGUA 3WU1B 4KDPA 4KJZA 2P7CB 3OYEA 1TNSA 4B44A 2AQFA 3DP7A 1G3TA 2EWNA 2IT0A 2KFDA 3KFWX 1F1ZA 4C30A 3L2QA 1OCZH 2X1DA 4OIOF 1FYKA 1QVTA 4UNOA 3SEZA 1BW5A 4A3JJ 5HLIA 4J01A 3KYDB 2E34A 3LFUA 3TEDA 3FISA 3KPHA 1L3LA 4IRHA 4AYBN 3F23A 2P8TA 2R7FA 2DBBA 2VUMJ 1YYVA 1X3UA 3H0GJ 1PJRA 2DMQA 5CJ9A 3BR0A 4DNCA 2JQ7A 4MEYF 3RKXA 1ZGWA 1YX3A 3EDPA 2DJNA 2A3SA 5FLXZ 5F64A 3S1MJ 2PEXA 4BU2A 2AS5F 2V4JC 3M8FA 2H1KA 3QU3A 4MLOA 1D5VA 5F0HA 1Z91A 2PJRB 2R7RA 4HA8A 4DJAA 2K4BA 3DU5A 2XAQA 3L2UA 1SFXA 5K5OA 5FLXK 2KL4A 3KE2A 1A35A 4FHTA 3JW4A 1H89C 4XNFA 2A6EF 3F6OA 4WCGA 4BDZA 1TT0A 3I56I 1IGNA 1MMNA 2E60A 1IN5A 2BGCA 2XDVA 3V8JA 5IYCJ 2YUSA 2R7QA 3H5RA 3EETA 2HI3A 4ZDOA 1DP3A 3S3NA 3EYIA 1YLFA 3HZJA 3VPRA 1CGPA 2HDCA 2YPRA 4Z6YA 2NVUB 3BP8A 3LWFA 4PJMA 3HPGA 1YHQI 2JA7J 3GVAA 2CV2A 3MZHA 1XN7A 1HLVA 5FKMA 2B0LA 2XGXA 4L9NA 4AC0A 4XBFA 2CFXA 4A3IJ 4OIQF 1ETYA 3NQOA 4OIRF 2OF7A 1V5GA 3K2ZA 3R0JA 5E3MA 1FP2A 1XMKA 1MNEA 3IUOA 1C0WA 2XF7A 3PFIA 4HF1A 3N4MA 5AIPA 1N75A 1IDZA 3CUQB 4ENJA 5ERIA 3CDIA 5D5VB 2KZGA 3HGGA 3HTSB 5EJCA 1H9TA 3J7ZI 5K7ZA 2LKXA 1K4SA 2PMUA 3ZMUA 3DTEA 4DBRA 4PJLA 2VQHA 1BC8C 3Q0VA 4G94A 5JLXA 5HS7A 1W36C 5J40A 3BG6A 1ETKA 4HX8A 1W7PD 2IGMA 1QHHD 2RV8A 2V1NA 2X51A 2ZKZA 4S04A 2EPFA 1HCRA 2B63J 2Y48A 3GTMJ 5ILSA 5TRDA 3W6KB 1YS6A 1GT0C 1J0RA 1SD7A 1Z6TA 3D5LA 3HRMA 3JCUC 2ECCA 1VQLI 1ZLKA 1QU3A 4ZDPA 2KP6A 4F92B 1TWCJ 4XN0A 2QYOA 4OIPF 2XIGA 2GLOA 4ITVA 2VKVA 1AKHB 3CJRB 5J8CA 3FM5A 3MQ0A 1EKEA 1H88C 4DZPA 5B5EC 3BCBA 4Q48A 1N25A 3R0AA 1QHGA 1MGTA 1U5TC 2DT6A 4CHUA 1K4TA 5BMZA 3MZYA 5ICEA 3TO9A 3K4NA 2E1MC 3GBGA 1FLIA 1ZH5A 5FLMJ 4BQNA 4XKCA 3OL4A 2ESHA 2XKPA 4N9HA 4EV0A 5F1JA 3HOWJ 3I5UA 3H9GA 4BKXA 3MN2A 3DU6A 4PJ0C 3OYMA 4XLEA 3CDLA 4W1UA 3OSGA 2DA2A 3QWLA 1NK2P 3G3ZA 2X9DA 1SD5A 2K9QA 1V5FA 3DEWA 4MQVA 1IXCA 1A04A 2R0QC 2DOEA 1XS9A 4ZYEA 4WWCA 3DKWA 1D0YA 3FHZA 5ICFA 2JA2A 3ABTA 4XLPF 1Y0NA 2JVGA 1BOAA 4PFPA 2ZJ2A 5LLQA 3QRFF 2D2WA 3BG9A 4ZDLA 3M3YJ 5TJJA 1XCVA 1LJ9A 5K5QA 2IA1A 3VEPA 5IP9J 4XRMA 2YU9J 3HBLA 1UB9A 5LEJA 2HQAA 5LRRA 1XCBA 2COMA 1JTXA 2UZKA 2MLKA 4WXHA 2K02A 3QYEA 1ZHFA 4BGDA 4DW6A 4EM2A 2EFWA 4MTEA 3HB9A 1QO0D 4HV6A 3M1CA 2NAZA 3OMYA 2W82A 2OBPA 1ACIA 1WWXA 2FD5A 4LGWA 2ZJQF 1ZYRF 2HOTA 2DDAA 4M6XA 1TP4A 3FXJA 1ONVA 3GMEA 3MKWB 3SQNA 2NNYA 4CDGA 3WG7H 4GXOA 5FJ8J 1FOYA 1XGMA 3C7JA 1U0JA 2QWWA 2FOWA 5L3GA 2ZB9A 1Z7LA 4FASD 2XAFA 4LOCA 1XGOA 2FRHA 2V7FA 2XAHA 3FBNB 1R9TJ 1K61A 3A02A 3BROA 4OMYA 3H92A 3MKYB 1USSA 2VI6A 5H20A 4ZYHA 2XVCA 3KLNA 5DD4A 2CMPA 2XSJC 1BR1A 2VQCA 4B3AA 3OYJA 5JLWA 4XSXF 4K2EA 4HZFA 3A03A 2V6EA 1S7OA 4CCOA 4M72A 4NC7A 3GFIA 2PFBA 1R6RA 4UUTA 4L0ZB 3K10A 1U3EM 3T1BA 5A2QZ 1OKRA 2LREA 3FK6A 1SEUA 1WCMJ 5KHDA 3JRAA 2Z1DA 1UELB 1S9HA 1SMTA 5CVIA 4DZJA 3W6JB 4IHSA 1CF7B 5HDKA 2BEOA 2XF6A 3MCZA 1Z05A 2LC2A 4XKVA 4HSRA 5A2QK 2E2JJ 1X3ZB 5HOOA 1QA6A 1STZA 2EJRA 4Q5SF 3U9GA 2L4AA 1J75A 3W2AA 1T2KA 1T0FC 3WG9A 3C2BA 2VJIA 3E6MA 4Y33A 3TO6A 3A1YA 1D1CA 3PJRA 1TWFJ 4FX0A 4XONA 4OAYA 1W7PA 4W97A 2X6YA 5EEAA 3JRBA 1X19A 1XGSA 3ZMDA 4RGRA 3RDIA 1A6QA 2XASA 3M07A 1HF0A 1UMQA 4MHGA 2A68F 2X0LA 1DUXC 2KRHA 5DUIA 2VASA 1YI2I 1W0UA 3GZ5A 1FMWA 3BOQA 3K4CA 3I59A 1FOXA 1D5YA 4A5NA 1FT9A 2P6TA 3C2HA 3ZXSA 2XUBA 2ZXIA 1S72I 2OZUA 4P5OA 3VYSB 1RR8C 2JRTA 4XR6A 3VDXA 3DLLF 5HVQC 4YG2F 2O9LA 1HC8A 3H5AA 1RPWA 2LDUA 3BR6A 1IN8A 4HV5A 3NAUA 1Y1VJ 2JA5J 2BV6A 5KK1A 3I4PA 2VE9A 1XB4A 2ZMEA 1T95A 2Z99A 2FUG2 2XB0X 2AXLA 1IV6A 1XC5A 4ON0A 3L2VA 1GDTA 3ZN1A 1FBUA 2LBFA 2R7SA 3CCQI 4JX5A 2E1NA 4PZJA 1D0ZA 2JUCA 3HSRA 3Q3SA 3L2WA 2I8DA 4MQ9F 3BR1A 2PMZA 1Y8QB 2W4SA 4Q4ZF 4AIJA 1FC3A 2H27A 2RGVA 5JVTA 4EGYA 4RA2A 2MBFA 2HVSA 3GTPJ 3QPTA 4ZZDA 2PJRA 3RZOJ 3H3UA 3OSFA 2E2IJ 5IOZA 2UXNA 3A4CA 2WAFA 4HBLA 3ECHA 4JK1X 1KZHA 3WGHA 3ZMZA 4XIDA 3S16J 3BJAA 4X6AJ 2IA0A 3KP2A 3TDUC 3CUOA 1R22A 1SVMA 3GEZA 2LMDA 3QP5A 5DD8A 1YOVB 3ZR8X 4Y3OA 2XKOA 2AHQA 2MABA 4CUGA 3EYYA 2BW3B 2HOAA 2MFZA 1BJAA 5BQTA 2K9SA 2LR8A 3QYBA 3PIPF 1O7FA 2GXGA 1Z6RA 1E17A 4YRVA 1W5TA 1JJ8C 1HKTA 3RZDJ 1OISA 1OFCX 2DK5A 1WJDA 2ISYA 4HX4A 5DM6F 3PUBA 1SD4A 4B47A 2GXAA 3FF5A 4H4KC 2M30A 2ECBA 3K6GA 2M4KA 3LSHA 1MBKA 3CZ6A 2XAGA 1I1GA 2DLLA 5EZGA 4M73A 2PMZN 4A12A 3CCJI 1RIOH 3CUQA 1L0OC 1J09A 4KT5C 2KRCA 4HNUA 2RVCA 1XMAA 4CO8A 5HLTA 5F08A 1YX5A 2E5ZA 2VQLA 3G1LA 2H09A 2DOFA 2R7WA 2RKHA 3E7LA 2EFNA 4I09A 4S05A 4E7HA 1S7AA 4A69C 4U0WA 1KU7A 1U78A 4BY1J 3HDDA 2KRFA 4RAFA 2R7UA 2COBA 1IG7A 3LSPA 4AIDA 1RKWA 3OYBA 2H8RA 4MO7A 2HKXA 1O7LA 3AG4H 3ZQQA 3JTGA 3IWFA 4C3JJ 1BOBA 3FDYA 3J7AY 3WODF 3KEQA 2M7AA 3BY6A 5BNGA 4E7JA 2IXSA 1XDSA 1PP7U 1PYVA 2OQGA 2HYFA 4CA0A 1IRXA 4QLCU 2L9RA 5E3NA 4HEA2 3AG1H 2STTA 1OCCH 3L09A 4V19K 2LF8A 2J5OA 3CC4I 1MBGA 2CG4A 2WV1A 1SVLA 4F3QA 5FKNA 3G1OA 3WTSC 4KA4A 2DXIA 4ESBA 2C6YA 1Y0UA 3V42A 4UVCA 1QRYA 1TW3A 3MD2A 3X2QH 2DT5A 3R60A 2L7MP 1R1UA 3HG9A 1TC3C 3D5RC 4YFNF 1NHAA 4L9VA 3CP2A 1Y6IA 4M3GA 4U87A 2R92J 2L02A 4I98B 4FTHA 3CO6C 4AUXA 3S2HJ 1IV8A 4N9IA 3H36A 1WVRA 3SZGA 2X1EA 3LSGA 3R61A 5BS6A 3LOCA 3CJQB 4FQGA 3K2AA 2BY1A 4A5MA 1R5ID 2DU9A 2TDXA 3E5XA 2DMNA 3F3XA 4G7ZF 1P7JA 3R6SA 3MKZA 3BCAA 3IH2A 1MSFC 2KHMA 2O61A 2DQRA 4F55A 5IP6A 1P6RA 2LYCA 4QPOA 4WXCA 1G3WA 2ADUA 1GVJA 2XGCA 4PJNA 2V79A 3RCOA 1VQ8I 3SDGA 2DA4A 2FU4A 3F6VA 3K4MA 4G6DA 2HQ5A 3LQRA 1X1PA 4IQ4A 1IC8A 1IAWA 1WH5A 5HLHA 1YIOA 2WY8Q 1O4XA 3HSEA 4AIHA 3K0LA 3PL8A 3ECOA 1E2XA 2BY0A 3QQAA 5GTIC 2YS9A 3OYCA 1KYZA 1S7EA 1XG1A 3V8LA 5J4VA 4D7MA 3ZMSA 3PSFA 2Y69H 1QZYA 3TP3A 1OCPA 2H6CA 4I01A 4A93J 2MLGA 4HLYA 1UZCA 3OYLA 1APLC 2G7UA 1ZR2A 4ANJA 2LY9A 2JWTA 4M71A 2D45A 1REPC 1LE8B 3DKYA 2L54A 3OIPA 3ABUA 4RDUA 1LUJB 3PIOF 3WTZA 3MAJA 2JPBA 3HOYJ 1T98A 3QPHA 3KETA 1OQYA 2F2EA 3PNVA 3T0YA 4BBSJ 3K9TA 1Y56A 1YG2A 4BEHA 3PNYA 2K9MA 4GYGA 3GXOA 3TKYA 4B4CA 4C2MJ 3JRFA 4UVAA 2BXYA 1LNWA 1FNNA 1XDUA 2NVQJ 1HDPA 1R58A 4FE4A 1M1EB 3OYKA 4JYKA 4ZC3A 2IBDA 4OMZA 3A2KA 4QSHA 3V7SA 3E5QA 3EUHA 2DI3A 2M34A 4BHPA 4D5CA 2Z33A 3WGGA 1GXQA 4I02A 4AYBA 3KP7A 2L4MA 4NHJA 1I6HJ 2DAOA 3OR1C 3ABMH 1MMAA 2M7BA 1RZ4A 1TZLA 2GXBA 2EK5A 3SDBA 3IL2A 1MH3A 1BI3A 4B1RA 3LA3A 4PJJA 3FXLA 4I0BA 3RQ4A 1IXRC 4R8HA 4BS9A 1CF7A 2VQGA 2VJ5A 4G12A 1BI2A 3S17J 5C4XJ 3D0SA 3E6BA 3M7GA 4X0GA 2MD0A 4PGHA 1T8IA 3S1RJ 2F48A 1P7IA 2IGKA 4LG3A 4E7IA 3DTIA 2UWMA 1OLTA 3LSMA 3ZQCA 5F27A 2ZC2A 2HWVA 1XX5A 5CVJA 1F36A 4ZYDA 3G1MA 2O8XA 4TV7A 5HDNA 1LB2A 2W84A 4X1EA 2ZJPF 1H8AC 4M9SA 2O7OA 4IZZA 3FKIJ 1JJ6C 2CW8A 1HQCA 1AWCA 3ZOBA 5EG0B 5LGTA 3OY9A 5E79C 5FRMA 4O3MA 4IRIA 5JVGF 5DTDA 3HL2A 3ZQLA 9ANTA 1Z7UA 1KU3A 2NOGA 5L3DA 1DDNA 2Y75A 1ON1A 4KISA 5B66C 1G3YA 4U0VA 1R1TA 5EEHA 1HKSA 2R93J 4WF2A 1B9MA 1QZEA 2FBIA 5J1UA 1J5YA 5KAIC 3IC7A 1FP1D 1P2FA 1BM9A 1EA3A 2MSYA 3V8KA 3M1EA 1JI8A 1Z3YA 3IRRA 1JHHA 2NOJB 4HQMA 4BHBA 3HJEA 2R5ZB 1MD0A 1U6GA 2DPUA 5J3LA 3J7AO 5IYDJ 3OL3A 2Y9ZA 5H2FC 4F93B 3F72A 1QGPA 3F0CA 3RIRA 5BPDA 3CCYA 1FZPB 5C44J 5HLGA 2PI0A 1O57A 2EFQA 3ABLH 5H6RA 3VSKA 5JR3A 4LG0A 5K7HA 1BJZA 2IPQX 2VN2A 1K7AA 4AWXB 5IOYA 4GDFA 2MC3A 2FXAA 1GUUA 1SMYF 1K83J 2EZKA 4F91B 2M8GX 1VFCA 1QNTA 2BYVE 1DP7P 1YE9A 4FT8A 1D8KA 1NH3A 4BJTA 1LDKB 1LDJA 4E7ZA 4IHVA 4ABZA 3HOTA 1RRJA 2L9NA 3EUAA 3RI4A 2XGEA 4KICA 3S1QJ 1SAUA 2BW3A 3CD6I 2HVRA 3GX4X 3P5JA 1GXPA 3H0DA 1POGA 2ZO4A 4KN4X 3O8HA 1YFHA 4UB6C 3K1MA 4NQWA 4G7OF 1IRFA 4DGWB 2TRTA 4M3BA 2VIXA 4A6EA 4F7ZA 3TMOA 3SFZA 3VODA 2WWYA 3IRQA 3CQZJ 3WTYC 3AG3H 2YX7A 5AIQA 3CC7I 4ENNA 1LKXA 3VSLA 2GIVA 2Y9YA 4BL0B 3LAJA 3BDDA 4PDKA 2HVQA 2HNHA 3C3WA 3DPLC 1NK3P 2ZSHB 2GZWA 1WJ5A 2AQEA 3FHNA 3RYRA 5GPAA 4BXUA 1FOWA 3OYDA 2NNNA 1RC9A 3WTVC 4BDYA 4G7HF 2CS3A 5M5XJ 1VQ9I 2VT2A 4EJVA 1SFEA 5FKKA 3BTLA 3CP8A 3ZQFA 1BR2A 3JRIA 3BTIA 2N8GA 2QEXI 2GM4A 4XSZF 4AD9A 3CDHA 1OR7A 3GZNB 3RSNA 4II3A 3J80Z 3MKLA 4ESJA 2BHZA 2V1UA 2VONA 3FXUA 4CCKA 3CJTB 2VL8A 3GTLJ 5F0CA 4IOAF 3HYIA 2DPDA 1S6LA 2VJ4A 3DV8A 2XC7A 1KQ8A 2D1VA 1K6YA 3KEOA 3J80K 3HHGA 3LSTA 5EGOB 2L0KA 4UUVA 5FROA 2VC1A 5DUKA 2JSPA 2M87A 3BTJA 4CXFA 5LHIA 2OPTA 1K79A 1RNLA 1F9NA 2PQ8A 4I7HA 5CKTA 2R5YA 3U1KA 3WU2C 2F4IA 4HYEA 1B6AA 2EFOA 1V54H 5J8FA 4DBQA 3F22A 3L1PA 2G0EA 1X2MA 1MKMA 2OC6A 4XN3A 4IHWA 1A5JA 4N4NB 4BE0A 2G7HA 2JZYA 2XGDA 1HW2A 5JI6A 4I0AA 5DCMB 3F8MA 1R71A 3M4OJ 3GTQJ 2EB7A 4LJZF 3VWBA 3W2WA 5JHFA 2K40A 2F4OB 3PO2J 1WGXA 5J47A 2VE8A 1SD6A 1WRJA 2HKOA 2QLZA 1QBJA 2E7WA 4IXAA 5D4SA 2LY2A 1R36A 3GFMA 3CCRI 5M5WJ 1UHMA 2CQ7A 2J5PA 3KYCB 1TQIA 1FY7A 2A5WA 2ZCWA 1VF9A 2FX0A 2IEKA 2VXZA 4XLAA 3WTWC 4M3EA 2LNBA 3WGIA 5B1AH 1X1AA 4FX4A 3WHCA 4ENKA 2YR2A 2L01A 4JX6A 4BUPA 3OS2A 2X85A 3K1PA 2NRAC 1TT5B 3GLXA 2O6GE 1KYWA 1R49A 3RPUD 2E5NA 5HDGA 2EZIA 3G71I 2MW8A 3FBIB 4NC8A 1GV5A 3QODA 1IN4A 5E1WA 1QQIA 1JUMA 3H9QA 1N78A 2ELKA 4CH7A 4CYDA 4QIWN 2Y2ZA 3HRUA 3G4SI 1YO5C 3I53A 1FTZA 1GVDA 1UG0A 1SANA 3PUFA 4HLXA 2VKEA 3QOEA 2DQLA 3AKZA 2VBWA 3K4LA 2Z16A 3F8FA 5K1YA 4JBAA 5F0FA 2CJJA 3KP4A 5FKLA 4IF4A 4ASNA 3KZZA 1LE8A 1TTYA 3SEQA 3SZTA 3SJMA 4NUBA 2BVLA 1UJ8A 1ZGAA 1O3TA 3GUDA 3H1CA 2LF7A 1R00A 2HPMA 2MA3A 4IVNA 2NXNB 5E1ZB 3GF2A 2O5RA 3HC7A 2M1BA 4ZH4F 2HTJA 2ZMEC 1MNDA 3PNTA 4CYCB 1A31A 3CCUI 4Y52J 1OYWA 2XRNA 3FMSA 1HW1A 3RKWA 4KN7X 4XKBA 1UG2A 3SFIA 5IYBJ 2BHYA 4BQQA 1VI0A 1ZELA 1WHUA 1D3YA 4FETA 1VQ4I 4LIUA 3ZMVA 3S3MA 1S3JA 2LOOA 5BPIA 1O3QA 1AOYA 1YTYA 1D1AA 3HUGB 1FTTA 4HSTA 2VT3A 1AA7A 4BAYA 2KDOA 4P9UA 3DEEA 3BG5A 2Y30A 1JUPA 3LSRA 2GIZA 2O03A 2EFPA 5M3MJ 1YRNB 1WJAA 5C4JJ 1SFUA 2Y0SN 3C1DA 5KCMA 3F8NA 1TQPA 1RUOA 3ZQGA 3H9JA 4WXDA 5GADJ 2YX4A 3OOPA 2Z3YA 5E3LA 2IGOA 3LQQA 4A6DA 4Y7NJ 2V9PA 2IS6A 2W48A 2M8EA 1WH7A 3S93A 1KQ9A 2K4JA 3T8TA 3ZGKA 5EG0A 1P4XA 2ME0A 1E3HA 1ZQ3P 2OZ6A 5DM7F 1VQOI 3HPHA 3L2CA 3BT9A 4RAZA 1TLHB 2AO9A 3S1NJ 4L5EA 4XMYA 2JRMA 3ESWB 2OA4A 4G8XA 2H6BA 4DYCA 5CVRA 2OCEA 5GTHC 3HKZN 3U1DA 1MW7A 2E7XA 2M0MA 2EA4A 1IJWC 2WAEA 4U7DA 3RKYA 3JRHA 3CLOA 4HQEA 3FXMA 2QCOA 4M3DA 2DCEA 2VC0A 3CUQC 2XPVA 4DQ2A 2WV0A 3E6CC 1T33A 1V55H 3DPUA 2M5WA 4KITB 1QVUA 2Y31A 3DLAA 2K86A 2A6HF 4OAZA 1T39A 3ZMTA 3DXJF 2FNPA 1OYYA 4WK8F 3U2RA 4A3MJ 4BQAA 2LTPA 4OWRB 1B59A 1Z0XA 2LKSA 4H0EA 4E70A 4BE1A 1AU7A 5LHHA 4Y13A 2UV1A 3CESA 3GZ6A 2DFIA 4RAGA 1IN6A 4YFXF 5DCFA 4A0XA 4IJAA 1U9NA 2HZTA 3TQNA 2WB1N 3M9AA 3WE2A 4KMUX 1LEAA 3A01B 1G3SA 1U8BA 4XQFA 1MZBA 2Z9OA 4IQJA 2KJCA 1HSJA 2ZNZA 3TO7A 3PQJA 4HDVA 1LDDA 1IRGA 1KU2A 1MBEA 3J81K 1J9IA 2K5CA 2XV4S 3RKQA 2BVMA 3FZVA 4JP0A 4A2UA 3JRDA 4IX7A 2CRGA 5LGUA 1EF4A 1J7KA 5CPRB 5FGMA 3VOEA 1HW5A 3RPUA 1R7JA 2OQRA 2ZFWA 3BR2A 2EIMH 3EUKL 5DDGA 3ERED 1JHFA 1T38A 2ESNA 2MH9A 3K7AJ 3NWTA 2W1OA 3KZYA 4MFEA 1Q1HA 2VKDA 1PDNC 2QUFA 2BZTA 2PG4A 4KIGA 3K4BA 3W3CA 1ZRFA 2DMUA 1UHSA 2KKOA 2LRDA 4BQOA 3CCLI 2DJIA 1JGGA 4C2UA 1H9GA 2QF7A 4YIFA 3GTGJ 3OYHA 2JSCA 1ZRDA 4B8XA 3A0BC 1KGSA 2XPUA 3BZ6A 3I9V2 3BG3A 1X2NA 1LPQA 3MWMA 1JKOC 4FISA 3T5XA 4FCYA 2KPMA 4B09A 1JKRC 2HS5A 1IRZA 1PUFB 2IGNA 3TW7A 1ZN2A 4A3LJ 2FBHA 1KA8A 2HQNA 5L3EA 2LD5A 1WKMA 3KEYA 2GWRA 1AKHA 1BN5A 1FJLA 3PQKA 4MTDA 2PBIA 1AHDP 2QVOA 1A6IA 3Q0WA 3LFKA 3BWGA 3CCMI 5IPAA 3N97A 2Y0MA 2CV1A 2QKMB 2E71A 1ON2A 1R5GA 3JRCA 2CWEA 5D6FA 5J4YA 3P9CA 2WAQN 2FQ4A 3V4GA 1X4PA 3EQLF 4CCMA 2DMTA 3BC8A 5GP9A 3K70C 4RAYA 1MDMB 2O0YA 1ULYA 2O8KA 2FF4A 2E19A 2DDBA 4BNCA 4F52A 2OCCH 4UB8C 3LSIA 1Z9CA 1V5EA 2RDPA 2VPLA 1VQMI 2P5LC 3VFZA 3KP5A 2W85A 2F4MB 1JKPC 4JOMA 2KMUA 1LVKA 4UHTA 1FBQA 3IKVA 3SZPA 1J2XA 2KIUA 2EA2A 3ML6A 1R5HA 5DCMA 3DBRB 2XSDC 1WQ2A 1T56A 3OYNA 3F21A 2JA6J 4EM1A 2M2EA 4U7BA 2L9VA 3HM5A 2RNJA 5HS8A 1IW7F 2DFHA 4G9YA 3TW6A 2R7VA 1RKTA 3ZQHA 1DU0A 2AXTC 2ZXHA 5IT3A 5BOXA 4RB1A 1B9NA 4YIRX 3ASNH 3GTOJ 2ID3A 3EUHC 3HGYA 4GRIA 3AG2H 4DYRA 4AVPA 4YFKF 4R79A 2K85A 2P5KA 4OU0A 1YJNI 1U5TB 2DMPA 4CZZA 1I1SA 2KISA 4U0YA 1ZR4A 5D8KB 2P7VB 1H0MA 2E1MB 2QSHX 4RGXA 5LRSA 3ZCOA 1ZRCA 3E0JB 3SYTA 3OR2C 3IWZA 2DA1A 4BH9A 4LFUA 1BA5A 3QPLA 1JE8A 1VTNC 2DODA 1X4OA 4XL9A 4EMSA 1EH7A 5D6EA 2HOSA 4RS8A 3NARA 3B02A 3U21A 2NVYJ 6PAXA 1YS7A 2PX9A 1IF1A 1Z1DA 2HR3A 3HHHA 5LEKA 1X58A 3E1SA 4HDUA 1WJEA 2MH2A 3LSKA 3P9IA 3QP6A 3UNGC 5D8LB 1UHWA 4EJWA 2Q2EB 1I39A 1KQ0A 4BACA 1FPQA 2JT1A 4I6ZA 3JR9A 2DK8A 1S29A 1X3WB 4BY7J 3BPVA 3GLLA 4KFCA 3F8BA 3HXLA 2ZSIB 4M9XA 1ZREA 1JT6A 3MZ8A 1T6SA 2R7OA 1BIAA 1TQMA 3S32A 3GFJA 3CJNA 4XRSG 5E8IA 2MGQA 2X1CA 3ERMA 2MYSA 4RMNA 1ERDA 3IHUA 3WTXC 1TNTA 5M3FJ 3LA7A 1HBXG 4ZYGA 1B8IB 2R7ZJ 1IUYA 2NS8A 2X6WA 1UCRA 4C3IJ 3BJ6A 1A36A 1OCTC 1IO2A 1W5CC 4JQFA 3VYRB 2FSWA 4NC6A 1XD7A 3HRSA 3OIOA 2QQ8A
chains in the Genus database with same CATH topology
2LMDA 1MIJA 1XPXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LMD A;  1MIJ A;  1XPX A; 
#chains in the Genus database with same CATH topology
 2Q0O A;  4LD5 A;  1BI1 A;  1X1C A;  2PMH A;  5FB2 A;  3UR3 C;  1HXD A;  1YIT I;  5ICC A;  1BBY A;  5KAF C;  3H3V K;  1MBF A;  2LP0 A;  3CLQ A;  2RNG A;  3QYF A;  4ESF A;  1MJ9 A;  4QTR A;  3HSF A;  1DGW Y;  3I4N J;  5D5X B;  4IEJ A;  2EIJ H;  4LIT A;  1B72 B;  1S5L C;  4L9J A;  5TIS C;  3HUG A;  4UV9 A;  4PFO A;  1Y8R B;  4EAT A;  1WI3 A;  4UV8 A;  2QBY B;  2L2O A;  3BR5 A;  1XGN A;  1W7P B;  2I10 A;  1P92 A;  1VZ0 A;  1YW8 A;  1U8R A;  2VBX A;  2IS2 A;  1E3P A;  3ZQ7 A;  1TBX A;  4LLG F;  5IT9 K;  1W36 D;  5F1R A;  1I27 A;  3JAM Z;  2CU7 A;  4MEX F;  4RGS A;  1U9O A;  3DF8 A;  1I50 J;  1ZG5 A;  4MFD A;  1QPM A;  2LLK A;  3FMQ A;  3JRG A;  4LLN A;  3KLO A;  4G6Q A;  4KIB A;  4PUS A;  5E20 A;  4ZYA A;  3JAM K;  4U88 A;  2VPR A;  2R4G A;  3ABK H;  3IH4 A;  2PLY A;  1FYL A;  2UUZ A;  2DTZ A;  1TWH J;  5LFA A;  4HPQ A;  4V2G A;  4A3B J;  2ZNY A;  1X1D A;  4YEL A;  2M45 A;  2GAU A;  1WI9 A;  2ZME B;  1B4A A;  1LFP A;  2ZJR F;  2LFB A;  5CYV A;  3B73 A;  4D5F A;  4IL6 C;  5K7F A;  1O3S A;  5FD6 A;  2VLA A;  2LBF B;  2PN6 A;  4I76 A;  3RYP A;  1IN7 A;  2DFE A;  2F5E A;  1XSX A;  3W6V A;  4ETS A;  5EYR A;  1I5Z A;  5IY5 H;  3GTK J;  2NS0 A;  5EEG A;  4HAM A;  3F9K A;  3ZRG A;  1ZG1 A;  2RQQ A;  4MGR A;  2XB5 A;  4XOP A;  1EH8 A;  4Y17 A;  2VBY A;  3TOB A;  1FIA A;  1ETQ A;  4Q47 A;  4IOC F;  3FKJ A;  3OOU A;  1YQA A;  4L9T A;  2X6X A;  4B3X A;  1RET A;  1Z3X A;  1IUF A;  3FM3 A;  2IA2 A;  3HTU A;  4XLF A;  1WFX A;  2HTS A;  4UUS B;  2NS7 A;  3DCF A;  1O3R A;  1BW6 A;  3V7C A;  5HNF A;  2LK2 A;  2L7K A;  3ZQI A;  5C3E J;  2M0C A;  2QQB A;  3WE3 A;  2V1D A;  1V4R A;  4HW0 A;  4NB5 A;  4CZC A;  3P7N A;  4L18 B;  2GQQ A;  4LMY A;  1J59 A;  1OR7 C;  3JSO A;  3LNQ A;  3I58 A;  3BQZ A;  4J00 A;  1ZG3 A;  4HNV A;  1F5T A;  4XLC A;  2P6S A;  3A01 A;  4EQQ A;  2V6C A;  3TP0 A;  3SHF A;  1BL0 A;  4WX9 A;  1FIP A;  4P55 A;  4E7L A;  4GO1 A;  2XF5 A;  3C2G A;  4BYY A;  5ILU A;  3R4K A;  1YJ9 I;  1R4M B;  1TWG J;  3FWE A;  2K9L A;  3DPT A;  5CQG A;  5EF6 A;  4C3H J;  5E18 F;  3CC2 I;  2JK3 A;  3RJP A;  2JA8 J;  4AIK A;  5LD2 C;  1IZ1 A;  2VJJ A;  3IKT A;  2GA1 A;  4UY8 I;  5DV5 A;  3HOX J;  2QSG X;  2YU3 A;  2V1X A;  2A69 F;  4EJU A;  1K6O A;  2BBY A;  1PP8 F;  2L7Z A;  3CMM A;  3AL0 C;  3VB2 A;  2FEZ A;  1N77 A;  2OUM A;  2DYR H;  1T08 B;  2VOD A;  1B1B A;  2DT7 B;  2E1O A;  2ZXJ A;  2RQP A;  3S15 J;  3CF2 A;  4CCJ A;  4XRF A;  1BIB A;  2JN6 A;  3IAM 2;  2YSR A;  5L3F A;  2XAJ A;  2O3F A;  2X6O A;  5KNL A;  5CVV A;  3O6B B;  1PUF A;  1JGS A;  5E8G A;  3ZN0 A;  1W5S A;  2ACJ A;  3REO A;  2QA4 I;  3L7W A;  1DQU A;  5EZH A;  1Z67 A;  2JVH A;  1F4K A;  1HKQ A;  2ZBK A;  3H35 A;  5J1R A;  2TCT A;  3TOA A;  3K4K A;  2HYJ A;  4XOR A;  1Z21 A;  2EIL H;  1HST A;  2EV5 A;  4RM2 A;  4HG2 A;  1CQT A;  3M8E A;  3UKG A;  4CSW A;  2QQA A;  4A3E J;  3KZI C;  1MNM C;  2F6C A;  1FWZ A;  2HXO A;  2OAZ A;  2WAD A;  3RTR A;  3WTT C;  3CF5 F;  4O5V A;  2FJ1 A;  4NDL A;  2LVS A;  3IV5 A;  3IH3 A;  4EGZ A;  1MDM A;  1OJL A;  3GO5 A;  4B48 A;  3LMM A;  3H5N A;  4D9J A;  5D5U B;  3HOZ J;  3BZC A;  2CFO A;  4HX7 A;  2IRF G;  2BOL A;  2ID6 A;  2V9V A;  1FMV A;  3DFG A;  4BXF A;  2FMY A;  2Q1Z B;  2D5V A;  4IHT A;  1LFB A;  2M9H A;  1GV2 A;  2W25 A;  4XM3 A;  3OIQ A;  2K9N A;  3Q5F A;  1ENH A;  1FSE A;  4S0H B;  2K3P A;  4AU7 A;  2HFH A;  1K78 B;  3KIO A;  1OCR H;  1F43 A;  5GAE J;  2VKH A;  3FMR A;  2X4H A;  4IRG A;  4KUM A;  3PO3 J;  5EDN A;  5GAH J;  3NWS A;  5JHU A;  3QU6 A;  1I6X A;  3I54 A;  2H1L A;  2KIF A;  3FXR A;  1P4A A;  1V3F A;  2DTR A;  4KNY A;  2IAI A;  5HOD A;  2DW4 A;  2HZD A;  1ETV A;  1ZGJ A;  1JKQ C;  5M5Y J;  2CW0 F;  1PVE A;  2KZV A;  3QPS A;  1MBH A;  2ETH A;  1U5T A;  5ED4 A;  2D1H A;  3JSP A;  4O6J A;  4MNU A;  2HDD A;  2NVT J;  3Q9V A;  1MBJ A;  3B6A A;  4BBR J;  3AFH A;  3O3K A;  4M74 A;  1BI0 A;  3G73 A;  3BLY A;  2E35 A;  3OYF A;  3T8R A;  2STW A;  2H94 A;  1OPC A;  2CUE A;  2GOX B;  2XHK A;  1VQ7 I;  1ZLJ A;  2DYS H;  1LFU P;  4LB6 B;  1RR7 A;  2WC2 A;  3PSI A;  2ELJ A;  2QQ9 A;  4D1Q A;  2Y0S A;  3CCS I;  2Q2E A;  2VB6 A;  2BE5 F;  1KU9 A;  3NEU A;  4L0Y B;  2DFF A;  3I3L A;  1YW9 A;  3OWT A;  3FXQ A;  3I4M J;  3DQV C;  4GYI A;  5E3O A;  3ZPL A;  2H8W A;  4GFB A;  3L00 A;  1LQ1 A;  4A3C J;  4BEH B;  4PSW A;  2XPW A;  2EQR A;  2B7E A;  3WTU C;  5FO5 A;  4ENM A;  4DYQ A;  1WPK A;  1NTC A;  4P9F A;  3E97 A;  2G9W A;  3SXY A;  2EIK H;  1ITY A;  2EZH A;  1KON A;  1B8I A;  2A07 F;  5F6F A;  1MJA A;  3PFY A;  2X48 A;  3HKZ A;  4C9Y A;  1Y39 A;  3KYL A;  4XLH A;  4XLN F;  3JRE A;  2L3D A;  5HNH A;  4BJ6 C;  2B9S A;  3A0H C;  4IHX A;  2MD5 A;  2HPI A;  2OJE D;  2P5V A;  2IJL A;  4MIM A;  2Z5U A;  4NBQ A;  3TBI A;  3E5U A;  1RI7 A;  2HYG D;  1OMI A;  1Z77 A;  3K69 A;  1JXS A;  3K1N A;  2ELH A;  1YW7 A;  1B72 A;  2E1C A;  3CMY A;  2P81 A;  4Y15 A;  3S2D J;  2QBY A;  1SVO A;  2K27 A;  3L9F A;  4D7N A;  2JPC A;  2W57 A;  3W2V A;  3H3Z A;  2IVM A;  3G2B A;  3N05 A;  5H6Q A;  1XSD A;  2KJB A;  2WB1 A;  2CO5 A;  3BPX A;  2A5Y B;  4LIV A;  3ELK A;  3CCV I;  5DS9 A;  4Y4R A;  1D8J A;  2ZXW H;  1MMG A;  2EH3 A;  1OYI A;  4XK4 A;  3DKX A;  2PJP A;  1FOK A;  2L7F P;  4IKF A;  4I2O A;  4RBO A;  4IPA A;  2QEN A;  2DA3 A;  4E7K A;  2IS1 A;  2EZL A;  1SFK A;  2FQ3 A;  2OV7 A;  4ZTJ A;  2W24 A;  2CW7 A;  4M6V A;  2JJ7 A;  2LY1 A;  2XRO A;  4KT6 A;  3C18 A;  2HXI A;  5CLS A;  4HOB A;  1XSV A;  4QPQ A;  1QZZ A;  2OU2 A;  1WJF A;  3D5S C;  1JT0 A;  2FOK A;  2R5Z A;  3LL7 A;  1SAX A;  2BY3 A;  2LG4 A;  2JUG A;  4E4H A;  1W1W E;  3EPZ A;  3QOP A;  4DOZ A;  4D0P A;  4II2 A;  1T0F A;  3COA C;  5DYM A;  3TGN A;  5LBQ A;  1SFO J;  3HIF A;  2R7D A;  3K70 D;  4EM0 B;  3WHB A;  1G2H A;  2CYY A;  4LG0 B;  3Q9S A;  4BE2 A;  3S14 J;  1XTA A;  3J81 Z;  2GOM A;  4UUS A;  4B43 A;  4CCN A;  1EJ9 A;  4A3D J;  4DIQ A;  1SC7 A;  2JMW A;  2K7L A;  3ONQ A;  2A6T A;  1EV7 A;  2FBK A;  4FE7 A;  2NVX J;  1HA8 A;  2CUF A;  4BJ5 C;  3MEX A;  5LHG A;  2QSF X;  4XKW A;  2CQN A;  1UST A;  3I0T A;  4A0Y A;  1TWA J;  5CQE A;  4L5I A;  4C2T A;  4E6K G;  1UFM A;  2ME6 A;  4EVI A;  3ISP A;  4IHY A;  2JTV A;  2KLO A;  1XMX A;  4LK1 F;  2WAQ A;  3K4J A;  5GAG J;  3HOV J;  2HGC A;  1E3O C;  3FK7 A;  3BTC A;  4NQW B;  2VXD A;  3OV8 A;  1U2W A;  5E1X A;  1P9Q C;  2Q8K A;  1R23 A;  5J1Y A;  4BXX J;  1NG7 A;  3OYA A;  5K5R A;  2LH9 A;  3D1N I;  1WZ2 A;  1VQ5 I;  2V26 A;  3DWL E;  5JFR A;  1MSE C;  3L2R A;  4AM3 A;  1WSU A;  1XPX A;  4EEF G;  1P4W A;  2FML A;  5IP7 J;  4RB2 C;  1LEB A;  3KX2 A;  3VYT B;  3HOS A;  2ISZ A;  1DPR A;  1JTY A;  2DA7 A;  3MVP A;  4GCV A;  4HRI A;  5CVU A;  2DOA A;  1OCO H;  2KDZ A;  2QM3 A;  2NYX A;  3HRT A;  1HOM A;  3IP4 B;  4HNT A;  1QPI A;  5ICG A;  2VBZ A;  3GYH X;  3ROU A;  1ORK A;  3E6D A;  4RLF A;  3PM1 A;  2F5D A;  1G4D A;  1DPU A;  2ZFU A;  3DBH B;  2HEO A;  5FLV A;  2HDW A;  4V2F A;  4JX4 A;  1I3Q J;  5FFX A;  2WTE A;  4QWQ A;  4R1H A;  3S2W A;  1VQ6 I;  2XRL A;  3GFL A;  2CQX A;  2R7T A;  1FYM A;  2CV0 A;  1ETX A;  3B6C A;  2WA0 A;  1FX7 A;  5EGO A;  3M8J A;  1ZK8 A;  5GPC A;  1VQN I;  2F5V A;  2FE3 A;  3CCE I;  2ICW G;  1RES A;  2MC4 A;  2MG4 A;  4CIC A;  1VQK I;  4KYW A;  2LKP A;  3S3O A;  1ZTR A;  2CH0 A;  1MMS A;  3ULQ B;  1D1B A;  3DEU A;  1DU6 A;  3BQY A;  4ZTF A;  2RN7 A;  3FXK A;  4CCL A;  5L3B A;  3AAF A;  2F5C A;  4A0Z A;  1ZAO A;  2KIQ A;  4RB3 C;  4UXN A;  1G59 A;  1VQP I;  2UXX A;  3WU0 A;  2M3A A;  5FRN A;  4P1W A;  5FFZ A;  2R5Y B;  3BJO A;  2OTL I;  3TDZ C;  1I3A A;  3KP6 A;  1R1V A;  4YEJ A;  4XRS A;  1GHC A;  4IO9 F;  2EV0 A;  2EBI A;  2VOP A;  1G8X A;  2CQQ A;  2KQR A;  3FIW A;  3AL0 B;  2M4G A;  1MIJ A;  3CTA A;  5FKO A;  1R4N B;  1TW2 A;  1ZKG A;  2WY7 Q;  4AVZ A;  3I64 A;  2EIN H;  2FNA A;  3BG7 A;  4PSX A;  5DEQ A;  1K78 A;  2XAU A;  4Z2Y A;  2VOO A;  4N0B A;  1ETO A;  4UVB A;  3I71 A;  3LSJ A;  2CUJ A;  3RPQ A;  3Q0U A;  4M3F A;  1ODD A;  4OIN F;  3FXO A;  5ILV A;  5L3C A;  3KP3 A;  4PCQ A;  1D0X A;  2I5U A;  3CO7 C;  1W0T A;  1LVA A;  3DBL B;  4N4O B;  2CSO A;  1YJW I;  4G6T B;  3GCM A;  2L9S A;  3O8G A;  4GGG A;  2Z2S B;  3G6E I;  4CGZ A;  1UAA A;  3O2P E;  2OD5 A;  4NNJ A;  5D4R A;  4HF2 A;  3GW2 A;  1G6N A;  4LK0 F;  4RLQ A;  3F8C A;  2A61 A;  3LAP A;  5F04 A;  1JUS A;  1FBS A;  2E2H J;  2R7X A;  2EV6 A;  5HS9 A;  1IXS B;  4LB5 A;  2LSO A;  3P9K A;  2GBY A;  3OYI A;  1GLN A;  2HU9 A;  2IW5 A;  5AON A;  4XIC A;  2GA2 A;  2L5Q A;  2RAE A;  2K3F A;  3S8P A;  4EJO A;  3HOU J;  2CQK A;  3TL4 X;  5J6X A;  3KCC A;  3GWZ A;  1HDD C;  4YII A;  2W7N A;  1IDY A;  1BR4 A;  1WJB A;  3J7Y J;  1ZAR A;  4A3G J;  2WBM A;  3OS0 A;  3MFK A;  2FA5 A;  2P0W A;  4A3F J;  1FEX A;  3I55 I;  3DTK A;  3NRV A;  3ZP5 A;  2RC4 A;  2RRE A;  3E3V A;  4I99 C;  4J19 A;  5KVR A;  3IAS 2;  3HEF A;  1W4M A;  2DN0 A;  2IS4 A;  3V7R A;  3OYG A;  2QKL B;  1BC7 C;  4RB0 A;  2CUZ A;  4ZJZ A;  1ETW A;  4CYC A;  4RM3 A;  4KMF A;  1RUN A;  1TL8 A;  3RQI A;  2R3S A;  3GTJ J;  2OTJ I;  5D5W B;  2DA5 A;  4A3K J;  2V9K A;  1FSH A;  4PK4 A;  5TGT A;  2HOE A;  1X1B A;  4HF0 A;  5FD5 A;  3BZK A;  2QGU A;  4ZZL A;  4LLL A;  1YIJ I;  1VND A;  1WJC A;  4PGG A;  3OS1 A;  4L5J A;  1NG6 A;  2QZ8 A;  4E7S A;  3CME I;  2P4W A;  4OOI A;  5IT9 Z;  3CMA I;  1Q1V A;  3JTH A;  1PUE E;  5LGN A;  2F5F A;  3QAH A;  2BY2 A;  1MJB A;  2HQR A;  3VYU B;  1S8N A;  2E36 A;  2DA6 A;  4KIF A;  2BXZ A;  1DGR M;  5E17 F;  3FX3 A;  4M9Z A;  1YRN A;  1MMD A;  5B3S H;  4EJT A;  4P96 A;  1E0E A;  3ASO H;  2IP2 A;  5B1B H;  3I59 B;  2W00 A;  4M6Y A;  4XOT A;  3MMY B;  1EH6 A;  2A05 A;  1Y1W J;  2CGP A;  1MH4 A;  3BR3 A;  2DO7 A;  2KT0 A;  3LA2 A;  2KIM A;  4BHC A;  4RGU A;  3WU1 B;  4KDP A;  4KJZ A;  2P7C B;  3OYE A;  1TNS A;  4B44 A;  2AQF A;  3DP7 A;  1G3T A;  2EWN A;  2IT0 A;  2KFD A;  3KFW X;  1F1Z A;  4C30 A;  3L2Q A;  1OCZ H;  2X1D A;  4OIO F;  1FYK A;  1QVT A;  4UNO A;  3SEZ A;  1BW5 A;  4A3J J;  5HLI A;  4J01 A;  3KYD B;  2E34 A;  3LFU A;  3TED A;  3FIS A;  3KPH A;  1L3L A;  4IRH A;  4AYB N;  3F23 A;  2P8T A;  2R7F A;  2DBB A;  2VUM J;  1YYV A;  1X3U A;  3H0G J;  1PJR A;  2DMQ A;  5CJ9 A;  3BR0 A;  4DNC A;  2JQ7 A;  4MEY F;  3RKX A;  1ZGW A;  1YX3 A;  3EDP A;  2DJN A;  2A3S A;  5FLX Z;  5F64 A;  3S1M J;  2PEX A;  4BU2 A;  2AS5 F;  2V4J C;  3M8F A;  2H1K A;  3QU3 A;  4MLO A;  1D5V A;  5F0H A;  1Z91 A;  2PJR B;  2R7R A;  4HA8 A;  4DJA A;  2K4B A;  3DU5 A;  2XAQ A;  3L2U A;  1SFX A;  5K5O A;  5FLX K;  2KL4 A;  3KE2 A;  1A35 A;  4FHT A;  3JW4 A;  1H89 C;  4XNF A;  2A6E F;  3F6O A;  4WCG A;  4BDZ A;  1TT0 A;  3I56 I;  1IGN A;  1MMN A;  2E60 A;  1IN5 A;  2BGC A;  2XDV A;  3V8J A;  5IYC J;  2YUS A;  2R7Q A;  3H5R A;  3EET A;  2HI3 A;  4ZDO A;  1DP3 A;  3S3N A;  3EYI A;  1YLF A;  3HZJ A;  3VPR A;  1CGP A;  2HDC A;  2YPR A;  4Z6Y A;  2NVU B;  3BP8 A;  3LWF A;  4PJM A;  3HPG A;  1YHQ I;  2JA7 J;  3GVA A;  2CV2 A;  3MZH A;  1XN7 A;  1HLV A;  5FKM A;  2B0L A;  2XGX A;  4L9N A;  4AC0 A;  4XBF A;  2CFX A;  4A3I J;  4OIQ F;  1ETY A;  3NQO A;  4OIR F;  2OF7 A;  1V5G A;  3K2Z A;  3R0J A;  5E3M A;  1FP2 A;  1XMK A;  1MNE A;  3IUO A;  1C0W A;  2XF7 A;  3PFI A;  4HF1 A;  3N4M A;  5AIP A;  1N75 A;  1IDZ A;  3CUQ B;  4ENJ A;  5ERI A;  3CDI A;  5D5V B;  2KZG A;  3HGG A;  3HTS B;  5EJC A;  1H9T A;  3J7Z I;  5K7Z A;  2LKX A;  1K4S A;  2PMU A;  3ZMU A;  3DTE A;  4DBR A;  4PJL A;  2VQH A;  1BC8 C;  3Q0V A;  4G94 A;  5JLX A;  5HS7 A;  1W36 C;  5J40 A;  3BG6 A;  1ETK A;  4HX8 A;  1W7P D;  2IGM A;  1QHH D;  2RV8 A;  2V1N A;  2X51 A;  2ZKZ A;  4S04 A;  2EPF A;  1HCR A;  2B63 J;  2Y48 A;  3GTM J;  5ILS A;  5TRD A;  3W6K B;  1YS6 A;  1GT0 C;  1J0R A;  1SD7 A;  1Z6T A;  3D5L A;  3HRM A;  3JCU C;  2ECC A;  1VQL I;  1ZLK A;  1QU3 A;  4ZDP A;  2KP6 A;  4F92 B;  1TWC J;  4XN0 A;  2QYO A;  4OIP F;  2XIG A;  2GLO A;  4ITV A;  2VKV A;  1AKH B;  3CJR B;  5J8C A;  3FM5 A;  3MQ0 A;  1EKE A;  1H88 C;  4DZP A;  5B5E C;  3BCB A;  4Q48 A;  1N25 A;  3R0A A;  1QHG A;  1MGT A;  1U5T C;  2DT6 A;  4CHU A;  1K4T A;  5BMZ A;  3MZY A;  5ICE A;  3TO9 A;  3K4N A;  2E1M C;  3GBG A;  1FLI A;  1ZH5 A;  5FLM J;  4BQN A;  4XKC A;  3OL4 A;  2ESH A;  2XKP A;  4N9H A;  4EV0 A;  5F1J A;  3HOW J;  3I5U A;  3H9G A;  4BKX A;  3MN2 A;  3DU6 A;  4PJ0 C;  3OYM A;  4XLE A;  3CDL A;  4W1U A;  3OSG A;  2DA2 A;  3QWL A;  1NK2 P;  3G3Z A;  2X9D A;  1SD5 A;  2K9Q A;  1V5F A;  3DEW A;  4MQV A;  1IXC A;  1A04 A;  2R0Q C;  2DOE A;  1XS9 A;  4ZYE A;  4WWC A;  3DKW A;  1D0Y A;  3FHZ A;  5ICF A;  2JA2 A;  3ABT A;  4XLP F;  1Y0N A;  2JVG A;  1BOA A;  4PFP A;  2ZJ2 A;  5LLQ A;  3QRF F;  2D2W A;  3BG9 A;  4ZDL A;  3M3Y J;  5TJJ A;  1XCV A;  1LJ9 A;  5K5Q A;  2IA1 A;  3VEP A;  5IP9 J;  4XRM A;  2YU9 J;  3HBL A;  1UB9 A;  5LEJ A;  2HQA A;  5LRR A;  1XCB A;  2COM A;  1JTX A;  2UZK A;  2MLK A;  4WXH A;  2K02 A;  3QYE A;  1ZHF A;  4BGD A;  4DW6 A;  4EM2 A;  2EFW A;  4MTE A;  3HB9 A;  1QO0 D;  4HV6 A;  3M1C A;  2NAZ A;  3OMY A;  2W82 A;  2OBP A;  1ACI A;  1WWX A;  2FD5 A;  4LGW A;  2ZJQ F;  1ZYR F;  2HOT A;  2DDA A;  4M6X A;  1TP4 A;  3FXJ A;  1ONV A;  3GME A;  3MKW B;  3SQN A;  2NNY A;  4CDG A;  3WG7 H;  4GXO A;  5FJ8 J;  1FOY A;  1XGM A;  3C7J A;  1U0J A;  2QWW A;  2FOW A;  5L3G A;  2ZB9 A;  1Z7L A;  4FAS D;  2XAF A;  4LOC A;  1XGO A;  2FRH A;  2V7F A;  2XAH A;  3FBN B;  1R9T J;  1K61 A;  3A02 A;  3BRO A;  4OMY A;  3H92 A;  3MKY B;  1USS A;  2VI6 A;  5H20 A;  4ZYH A;  2XVC A;  3KLN A;  5DD4 A;  2CMP A;  2XSJ C;  1BR1 A;  2VQC A;  4B3A A;  3OYJ A;  5JLW A;  4XSX F;  4K2E A;  4HZF A;  3A03 A;  2V6E A;  1S7O A;  4CCO A;  4M72 A;  4NC7 A;  3GFI A;  2PFB A;  1R6R A;  4UUT A;  4L0Z B;  3K10 A;  1U3E M;  3T1B A;  5A2Q Z;  1OKR A;  2LRE A;  3FK6 A;  1SEU A;  1WCM J;  5KHD A;  3JRA A;  2Z1D A;  1UEL B;  1S9H A;  1SMT A;  5CVI A;  4DZJ A;  3W6J B;  4IHS A;  1CF7 B;  5HDK A;  2BEO A;  2XF6 A;  3MCZ A;  1Z05 A;  2LC2 A;  4XKV A;  4HSR A;  5A2Q K;  2E2J J;  1X3Z B;  5HOO A;  1QA6 A;  1STZ A;  2EJR A;  4Q5S F;  3U9G A;  2L4A A;  1J75 A;  3W2A A;  1T2K A;  1T0F C;  3WG9 A;  3C2B A;  2VJI A;  3E6M A;  4Y33 A;  3TO6 A;  3A1Y A;  1D1C A;  3PJR A;  1TWF J;  4FX0 A;  4XON A;  4OAY A;  1W7P A;  4W97 A;  2X6Y A;  5EEA A;  3JRB A;  1X19 A;  1XGS A;  3ZMD A;  4RGR A;  3RDI A;  1A6Q A;  2XAS A;  3M07 A;  1HF0 A;  1UMQ A;  4MHG A;  2A68 F;  2X0L A;  1DUX C;  2KRH A;  5DUI A;  2VAS A;  1YI2 I;  1W0U A;  3GZ5 A;  1FMW A;  3BOQ A;  3K4C A;  3I59 A;  1FOX A;  1D5Y A;  4A5N A;  1FT9 A;  2P6T A;  3C2H A;  3ZXS A;  2XUB A;  2ZXI A;  1S72 I;  2OZU A;  4P5O A;  3VYS B;  1RR8 C;  2JRT A;  4XR6 A;  3VDX A;  3DLL F;  5HVQ C;  4YG2 F;  2O9L A;  1HC8 A;  3H5A A;  1RPW A;  2LDU A;  3BR6 A;  1IN8 A;  4HV5 A;  3NAU A;  1Y1V J;  2JA5 J;  2BV6 A;  5KK1 A;  3I4P A;  2VE9 A;  1XB4 A;  2ZME A;  1T95 A;  2Z99 A;  2FUG 2;  2XB0 X;  2AXL A;  1IV6 A;  1XC5 A;  4ON0 A;  3L2V A;  1GDT A;  3ZN1 A;  1FBU A;  2LBF A;  2R7S A;  3CCQ I;  4JX5 A;  2E1N A;  4PZJ A;  1D0Z A;  2JUC A;  3HSR A;  3Q3S A;  3L2W A;  2I8D A;  4MQ9 F;  3BR1 A;  2PMZ A;  1Y8Q B;  2W4S A;  4Q4Z F;  4AIJ A;  1FC3 A;  2H27 A;  2RGV A;  5JVT A;  4EGY A;  4RA2 A;  2MBF A;  2HVS A;  3GTP J;  3QPT A;  4ZZD A;  2PJR A;  3RZO J;  3H3U A;  3OSF A;  2E2I J;  5IOZ A;  2UXN A;  3A4C A;  2WAF A;  4HBL A;  3ECH A;  4JK1 X;  1KZH A;  3WGH A;  3ZMZ A;  4XID A;  3S16 J;  3BJA A;  4X6A J;  2IA0 A;  3KP2 A;  3TDU C;  3CUO A;  1R22 A;  1SVM A;  3GEZ A;  2LMD A;  3QP5 A;  5DD8 A;  1YOV B;  3ZR8 X;  4Y3O A;  2XKO A;  2AHQ A;  2MAB A;  4CUG A;  3EYY A;  2BW3 B;  2HOA A;  2MFZ A;  1BJA A;  5BQT A;  2K9S A;  2LR8 A;  3QYB A;  3PIP F;  1O7F A;  2GXG A;  1Z6R A;  1E17 A;  4YRV A;  1W5T A;  1JJ8 C;  1HKT A;  3RZD J;  1OIS A;  1OFC X;  2DK5 A;  1WJD A;  2ISY A;  4HX4 A;  5DM6 F;  3PUB A;  1SD4 A;  4B47 A;  2GXA A;  3FF5 A;  4H4K C;  2M30 A;  2ECB A;  3K6G A;  2M4K A;  3LSH A;  1MBK A;  3CZ6 A;  2XAG A;  1I1G A;  2DLL A;  5EZG A;  4M73 A;  2PMZ N;  4A12 A;  3CCJ I;  1RIO H;  3CUQ A;  1L0O C;  1J09 A;  4KT5 C;  2KRC A;  4HNU A;  2RVC A;  1XMA A;  4CO8 A;  5HLT A;  5F08 A;  1YX5 A;  2E5Z A;  2VQL A;  3G1L A;  2H09 A;  2DOF A;  2R7W A;  2RKH A;  3E7L A;  2EFN A;  4I09 A;  4S05 A;  4E7H A;  1S7A A;  4A69 C;  4U0W A;  1KU7 A;  1U78 A;  4BY1 J;  3HDD A;  2KRF A;  4RAF A;  2R7U A;  2COB A;  1IG7 A;  3LSP A;  4AID A;  1RKW A;  3OYB A;  2H8R A;  4MO7 A;  2HKX A;  1O7L A;  3AG4 H;  3ZQQ A;  3JTG A;  3IWF A;  4C3J J;  1BOB A;  3FDY A;  3J7A Y;  3WOD F;  3KEQ A;  2M7A A;  3BY6 A;  5BNG A;  4E7J A;  2IXS A;  1XDS A;  1PP7 U;  1PYV A;  2OQG A;  2HYF A;  4CA0 A;  1IRX A;  4QLC U;  2L9R A;  5E3N A;  4HEA 2;  3AG1 H;  2STT A;  1OCC H;  3L09 A;  4V19 K;  2LF8 A;  2J5O A;  3CC4 I;  1MBG A;  2CG4 A;  2WV1 A;  1SVL A;  4F3Q A;  5FKN A;  3G1O A;  3WTS C;  4KA4 A;  2DXI A;  4ESB A;  2C6Y A;  1Y0U A;  3V42 A;  4UVC A;  1QRY A;  1TW3 A;  3MD2 A;  3X2Q H;  2DT5 A;  3R60 A;  2L7M P;  1R1U A;  3HG9 A;  1TC3 C;  3D5R C;  4YFN F;  1NHA A;  4L9V A;  3CP2 A;  1Y6I A;  4M3G A;  4U87 A;  2R92 J;  2L02 A;  4I98 B;  4FTH A;  3CO6 C;  4AUX A;  3S2H J;  1IV8 A;  4N9I A;  3H36 A;  1WVR A;  3SZG A;  2X1E A;  3LSG A;  3R61 A;  5BS6 A;  3LOC A;  3CJQ B;  4FQG A;  3K2A A;  2BY1 A;  4A5M A;  1R5I D;  2DU9 A;  2TDX A;  3E5X A;  2DMN A;  3F3X A;  4G7Z F;  1P7J A;  3R6S A;  3MKZ A;  3BCA A;  3IH2 A;  1MSF C;  2KHM A;  2O61 A;  2DQR A;  4F55 A;  5IP6 A;  1P6R A;  2LYC A;  4QPO A;  4WXC A;  1G3W A;  2ADU A;  1GVJ A;  2XGC A;  4PJN A;  2V79 A;  3RCO A;  1VQ8 I;  3SDG A;  2DA4 A;  2FU4 A;  3F6V A;  3K4M A;  4G6D A;  2HQ5 A;  3LQR A;  1X1P A;  4IQ4 A;  1IC8 A;  1IAW A;  1WH5 A;  5HLH A;  1YIO A;  2WY8 Q;  1O4X A;  3HSE A;  4AIH A;  3K0L A;  3PL8 A;  3ECO A;  1E2X A;  2BY0 A;  3QQA A;  5GTI C;  2YS9 A;  3OYC A;  1KYZ A;  1S7E A;  1XG1 A;  3V8L A;  5J4V A;  4D7M A;  3ZMS A;  3PSF A;  2Y69 H;  1QZY A;  3TP3 A;  1OCP A;  2H6C A;  4I01 A;  4A93 J;  2MLG A;  4HLY A;  1UZC A;  3OYL A;  1APL C;  2G7U A;  1ZR2 A;  4ANJ A;  2LY9 A;  2JWT A;  4M71 A;  2D45 A;  1REP C;  1LE8 B;  3DKY A;  2L54 A;  3OIP A;  3ABU A;  4RDU A;  1LUJ B;  3PIO F;  3WTZ A;  3MAJ A;  2JPB A;  3HOY J;  1T98 A;  3QPH A;  3KET A;  1OQY A;  2F2E A;  3PNV A;  3T0Y A;  4BBS J;  3K9T A;  1Y56 A;  1YG2 A;  4BEH A;  3PNY A;  2K9M A;  4GYG A;  3GXO A;  3TKY A;  4B4C A;  4C2M J;  3JRF A;  4UVA A;  2BXY A;  1LNW A;  1FNN A;  1XDU A;  2NVQ J;  1HDP A;  1R58 A;  4FE4 A;  1M1E B;  3OYK A;  4JYK A;  4ZC3 A;  2IBD A;  4OMZ A;  3A2K A;  4QSH A;  3V7S A;  3E5Q A;  3EUH A;  2DI3 A;  2M34 A;  4BHP A;  4D5C A;  2Z33 A;  3WGG A;  1GXQ A;  4I02 A;  4AYB A;  3KP7 A;  2L4M A;  4NHJ A;  1I6H J;  2DAO A;  3OR1 C;  3ABM H;  1MMA A;  2M7B A;  1RZ4 A;  1TZL A;  2GXB A;  2EK5 A;  3SDB A;  3IL2 A;  1MH3 A;  1BI3 A;  4B1R A;  3LA3 A;  4PJJ A;  3FXL A;  4I0B A;  3RQ4 A;  1IXR C;  4R8H A;  4BS9 A;  1CF7 A;  2VQG A;  2VJ5 A;  4G12 A;  1BI2 A;  3S17 J;  5C4X J;  3D0S A;  3E6B A;  3M7G A;  4X0G A;  2MD0 A;  4PGH A;  1T8I A;  3S1R J;  2F48 A;  1P7I A;  2IGK A;  4LG3 A;  4E7I A;  3DTI A;  2UWM A;  1OLT A;  3LSM A;  3ZQC A;  5F27 A;  2ZC2 A;  2HWV A;  1XX5 A;  5CVJ A;  1F36 A;  4ZYD A;  3G1M A;  2O8X A;  4TV7 A;  5HDN A;  1LB2 A;  2W84 A;  4X1E A;  2ZJP F;  1H8A C;  4M9S A;  2O7O A;  4IZZ A;  3FKI J;  1JJ6 C;  2CW8 A;  1HQC A;  1AWC A;  3ZOB A;  5EG0 B;  5LGT A;  3OY9 A;  5E79 C;  5FRM A;  4O3M A;  4IRI A;  5JVG F;  5DTD A;  3HL2 A;  3ZQL A;  9ANT A;  1Z7U A;  1KU3 A;  2NOG A;  5L3D A;  1DDN A;  2Y75 A;  1ON1 A;  4KIS A;  5B66 C;  1G3Y A;  4U0V A;  1R1T A;  5EEH A;  1HKS A;  2R93 J;  4WF2 A;  1B9M A;  1QZE A;  2FBI A;  5J1U A;  1J5Y A;  5KAI C;  3IC7 A;  1FP1 D;  1P2F A;  1BM9 A;  1EA3 A;  2MSY A;  3V8K A;  3M1E A;  1JI8 A;  1Z3Y A;  3IRR A;  1JHH A;  2NOJ B;  4HQM A;  4BHB A;  3HJE A;  2R5Z B;  1MD0 A;  1U6G A;  2DPU A;  5J3L A;  3J7A O;  5IYD J;  3OL3 A;  2Y9Z A;  5H2F C;  4F93 B;  3F72 A;  1QGP A;  3F0C A;  3RIR A;  5BPD A;  3CCY A;  1FZP B;  5C44 J;  5HLG A;  2PI0 A;  1O57 A;  2EFQ A;  3ABL H;  5H6R A;  3VSK A;  5JR3 A;  4LG0 A;  5K7H A;  1BJZ A;  2IPQ X;  2VN2 A;  1K7A A;  4AWX B;  5IOY A;  4GDF A;  2MC3 A;  2FXA A;  1GUU A;  1SMY F;  1K83 J;  2EZK A;  4F91 B;  2M8G X;  1VFC A;  1QNT A;  2BYV E;  1DP7 P;  1YE9 A;  4FT8 A;  1D8K A;  1NH3 A;  4BJT A;  1LDK B;  1LDJ A;  4E7Z A;  4IHV A;  4ABZ A;  3HOT A;  1RRJ A;  2L9N A;  3EUA A;  3RI4 A;  2XGE A;  4KIC A;  3S1Q J;  1SAU A;  2BW3 A;  3CD6 I;  2HVR A;  3GX4 X;  3P5J A;  1GXP A;  3H0D A;  1POG A;  2ZO4 A;  4KN4 X;  3O8H A;  1YFH A;  4UB6 C;  3K1M A;  4NQW A;  4G7O F;  1IRF A;  4DGW B;  2TRT A;  4M3B A;  2VIX A;  4A6E A;  4F7Z A;  3TMO A;  3SFZ A;  3VOD A;  2WWY A;  3IRQ A;  3CQZ J;  3WTY C;  3AG3 H;  2YX7 A;  5AIQ A;  3CC7 I;  4ENN A;  1LKX A;  3VSL A;  2GIV A;  2Y9Y A;  4BL0 B;  3LAJ A;  3BDD A;  4PDK A;  2HVQ A;  2HNH A;  3C3W A;  3DPL C;  1NK3 P;  2ZSH B;  2GZW A;  1WJ5 A;  2AQE A;  3FHN A;  3RYR A;  5GPA A;  4BXU A;  1FOW A;  3OYD A;  2NNN A;  1RC9 A;  3WTV C;  4BDY A;  4G7H F;  2CS3 A;  5M5X J;  1VQ9 I;  2VT2 A;  4EJV A;  1SFE A;  5FKK A;  3BTL A;  3CP8 A;  3ZQF A;  1BR2 A;  3JRI A;  3BTI A;  2N8G A;  2QEX I;  2GM4 A;  4XSZ F;  4AD9 A;  3CDH A;  1OR7 A;  3GZN B;  3RSN A;  4II3 A;  3J80 Z;  3MKL A;  4ESJ A;  2BHZ A;  2V1U A;  2VON A;  3FXU A;  4CCK A;  3CJT B;  2VL8 A;  3GTL J;  5F0C A;  4IOA F;  3HYI A;  2DPD A;  1S6L A;  2VJ4 A;  3DV8 A;  2XC7 A;  1KQ8 A;  2D1V A;  1K6Y A;  3KEO A;  3J80 K;  3HHG A;  3LST A;  5EGO B;  2L0K A;  4UUV A;  5FRO A;  2VC1 A;  5DUK A;  2JSP A;  2M87 A;  3BTJ A;  4CXF A;  5LHI A;  2OPT A;  1K79 A;  1RNL A;  1F9N A;  2PQ8 A;  4I7H A;  5CKT A;  2R5Y A;  3U1K A;  3WU2 C;  2F4I A;  4HYE A;  1B6A A;  2EFO A;  1V54 H;  5J8F A;  4DBQ A;  3F22 A;  3L1P A;  2G0E A;  1X2M A;  1MKM A;  2OC6 A;  4XN3 A;  4IHW A;  1A5J A;  4N4N B;  4BE0 A;  2G7H A;  2JZY A;  2XGD A;  1HW2 A;  5JI6 A;  4I0A A;  5DCM B;  3F8M A;  1R71 A;  3M4O J;  3GTQ J;  2EB7 A;  4LJZ F;  3VWB A;  3W2W A;  5JHF A;  2K40 A;  2F4O B;  3PO2 J;  1WGX A;  5J47 A;  2VE8 A;  1SD6 A;  1WRJ A;  2HKO A;  2QLZ A;  1QBJ A;  2E7W A;  4IXA A;  5D4S A;  2LY2 A;  1R36 A;  3GFM A;  3CCR I;  5M5W J;  1UHM A;  2CQ7 A;  2J5P A;  3KYC B;  1TQI A;  1FY7 A;  2A5W A;  2ZCW A;  1VF9 A;  2FX0 A;  2IEK A;  2VXZ A;  4XLA A;  3WTW C;  4M3E A;  2LNB A;  3WGI A;  5B1A H;  1X1A A;  4FX4 A;  3WHC A;  4ENK A;  2YR2 A;  2L01 A;  4JX6 A;  4BUP A;  3OS2 A;  2X85 A;  3K1P A;  2NRA C;  1TT5 B;  3GLX A;  2O6G E;  1KYW A;  1R49 A;  3RPU D;  2E5N A;  5HDG A;  2EZI A;  3G71 I;  2MW8 A;  3FBI B;  4NC8 A;  1GV5 A;  3QOD A;  1IN4 A;  5E1W A;  1QQI A;  1JUM A;  3H9Q A;  1N78 A;  2ELK A;  4CH7 A;  4CYD A;  4QIW N;  2Y2Z A;  3HRU A;  3G4S I;  1YO5 C;  3I53 A;  1FTZ A;  1GVD A;  1UG0 A;  1SAN A;  3PUF A;  4HLX A;  2VKE A;  3QOE A;  2DQL A;  3AKZ A;  2VBW A;  3K4L A;  2Z16 A;  3F8F A;  5K1Y A;  4JBA A;  5F0F A;  2CJJ A;  3KP4 A;  5FKL A;  4IF4 A;  4ASN A;  3KZZ A;  1LE8 A;  1TTY A;  3SEQ A;  3SZT A;  3SJM A;  4NUB A;  2BVL A;  1UJ8 A;  1ZGA A;  1O3T A;  3GUD A;  3H1C A;  2LF7 A;  1R00 A;  2HPM A;  2MA3 A;  4IVN A;  2NXN B;  5E1Z B;  3GF2 A;  2O5R A;  3HC7 A;  2M1B A;  4ZH4 F;  2HTJ A;  2ZME C;  1MND A;  3PNT A;  4CYC B;  1A31 A;  3CCU I;  4Y52 J;  1OYW A;  2XRN A;  3FMS A;  1HW1 A;  3RKW A;  4KN7 X;  4XKB A;  1UG2 A;  3SFI A;  5IYB J;  2BHY A;  4BQQ A;  1VI0 A;  1ZEL A;  1WHU A;  1D3Y A;  4FET A;  1VQ4 I;  4LIU A;  3ZMV A;  3S3M A;  1S3J A;  2LOO A;  5BPI A;  1O3Q A;  1AOY A;  1YTY A;  1D1A A;  3HUG B;  1FTT A;  4HST A;  2VT3 A;  1AA7 A;  4BAY A;  2KDO A;  4P9U A;  3DEE A;  3BG5 A;  2Y30 A;  1JUP A;  3LSR A;  2GIZ A;  2O03 A;  2EFP A;  5M3M J;  1YRN B;  1WJA A;  5C4J J;  1SFU A;  2Y0S N;  3C1D A;  5KCM A;  3F8N A;  1TQP A;  1RUO A;  3ZQG A;  3H9J A;  4WXD A;  5GAD J;  2YX4 A;  3OOP A;  2Z3Y A;  5E3L A;  2IGO A;  3LQQ A;  4A6D A;  4Y7N J;  2V9P A;  2IS6 A;  2W48 A;  2M8E A;  1WH7 A;  3S93 A;  1KQ9 A;  2K4J A;  3T8T A;  3ZGK A;  5EG0 A;  1P4X A;  2ME0 A;  1E3H A;  1ZQ3 P;  2OZ6 A;  5DM7 F;  1VQO I;  3HPH A;  3L2C A;  3BT9 A;  4RAZ A;  1TLH B;  2AO9 A;  3S1N J;  4L5E A;  4XMY A;  2JRM A;  3ESW B;  2OA4 A;  4G8X A;  2H6B A;  4DYC A;  5CVR A;  2OCE A;  5GTH C;  3HKZ N;  3U1D A;  1MW7 A;  2E7X A;  2M0M A;  2EA4 A;  1IJW C;  2WAE A;  4U7D A;  3RKY A;  3JRH A;  3CLO A;  4HQE A;  3FXM A;  2QCO A;  4M3D A;  2DCE A;  2VC0 A;  3CUQ C;  2XPV A;  4DQ2 A;  2WV0 A;  3E6C C;  1T33 A;  1V55 H;  3DPU A;  2M5W A;  4KIT B;  1QVU A;  2Y31 A;  3DLA A;  2K86 A;  2A6H F;  4OAZ A;  1T39 A;  3ZMT A;  3DXJ F;  2FNP A;  1OYY A;  4WK8 F;  3U2R A;  4A3M J;  4BQA A;  2LTP A;  4OWR B;  1B59 A;  1Z0X A;  2LKS A;  4H0E A;  4E70 A;  4BE1 A;  1AU7 A;  5LHH A;  4Y13 A;  2UV1 A;  3CES A;  3GZ6 A;  2DFI A;  4RAG A;  1IN6 A;  4YFX F;  5DCF A;  4A0X A;  4IJA A;  1U9N A;  2HZT A;  3TQN A;  2WB1 N;  3M9A A;  3WE2 A;  4KMU X;  1LEA A;  3A01 B;  1G3S A;  1U8B A;  4XQF A;  1MZB A;  2Z9O A;  4IQJ A;  2KJC A;  1HSJ A;  2ZNZ A;  3TO7 A;  3PQJ A;  4HDV A;  1LDD A;  1IRG A;  1KU2 A;  1MBE A;  3J81 K;  1J9I A;  2K5C A;  2XV4 S;  3RKQ A;  2BVM A;  3FZV A;  4JP0 A;  4A2U A;  3JRD A;  4IX7 A;  2CRG A;  5LGU A;  1EF4 A;  1J7K A;  5CPR B;  5FGM A;  3VOE A;  1HW5 A;  3RPU A;  1R7J A;  2OQR A;  2ZFW A;  3BR2 A;  2EIM H;  3EUK L;  5DDG A;  3ERE D;  1JHF A;  1T38 A;  2ESN A;  2MH9 A;  3K7A J;  3NWT A;  2W1O A;  3KZY A;  4MFE A;  1Q1H A;  2VKD A;  1PDN C;  2QUF A;  2BZT A;  2PG4 A;  4KIG A;  3K4B A;  3W3C A;  1ZRF A;  2DMU A;  1UHS A;  2KKO A;  2LRD A;  4BQO A;  3CCL I;  2DJI A;  1JGG A;  4C2U A;  1H9G A;  2QF7 A;  4YIF A;  3GTG J;  3OYH A;  2JSC A;  1ZRD A;  4B8X A;  3A0B C;  1KGS A;  2XPU A;  3BZ6 A;  3I9V 2;  3BG3 A;  1X2N A;  1LPQ A;  3MWM A;  1JKO C;  4FIS A;  3T5X A;  4FCY A;  2KPM A;  4B09 A;  1JKR C;  2HS5 A;  1IRZ A;  1PUF B;  2IGN A;  3TW7 A;  1ZN2 A;  4A3L J;  2FBH A;  1KA8 A;  2HQN A;  5L3E A;  2LD5 A;  1WKM A;  3KEY A;  2GWR A;  1AKH A;  1BN5 A;  1FJL A;  3PQK A;  4MTD A;  2PBI A;  1AHD P;  2QVO A;  1A6I A;  3Q0W A;  3LFK A;  3BWG A;  3CCM I;  5IPA A;  3N97 A;  2Y0M A;  2CV1 A;  2QKM B;  2E71 A;  1ON2 A;  1R5G A;  3JRC A;  2CWE A;  5D6F A;  5J4Y A;  3P9C A;  2WAQ N;  2FQ4 A;  3V4G A;  1X4P A;  3EQL F;  4CCM A;  2DMT A;  3BC8 A;  5GP9 A;  3K70 C;  4RAY A;  1MDM B;  2O0Y A;  1ULY A;  2O8K A;  2FF4 A;  2E19 A;  2DDB A;  4BNC A;  4F52 A;  2OCC H;  4UB8 C;  3LSI A;  1Z9C A;  1V5E A;  2RDP A;  2VPL A;  1VQM I;  2P5L C;  3VFZ A;  3KP5 A;  2W85 A;  2F4M B;  1JKP C;  4JOM A;  2KMU A;  1LVK A;  4UHT A;  1FBQ A;  3IKV A;  3SZP A;  1J2X A;  2KIU A;  2EA2 A;  3ML6 A;  1R5H A;  5DCM A;  3DBR B;  2XSD C;  1WQ2 A;  1T56 A;  3OYN A;  3F21 A;  2JA6 J;  4EM1 A;  2M2E A;  4U7B A;  2L9V A;  3HM5 A;  2RNJ A;  5HS8 A;  1IW7 F;  2DFH A;  4G9Y A;  3TW6 A;  2R7V A;  1RKT A;  3ZQH A;  1DU0 A;  2AXT C;  2ZXH A;  5IT3 A;  5BOX A;  4RB1 A;  1B9N A;  4YIR X;  3ASN H;  3GTO J;  2ID3 A;  3EUH C;  3HGY A;  4GRI A;  3AG2 H;  4DYR A;  4AVP A;  4YFK F;  4R79 A;  2K85 A;  2P5K A;  4OU0 A;  1YJN I;  1U5T B;  2DMP A;  4CZZ A;  1I1S A;  2KIS A;  4U0Y A;  1ZR4 A;  5D8K B;  2P7V B;  1H0M A;  2E1M B;  2QSH X;  4RGX A;  5LRS A;  3ZCO A;  1ZRC A;  3E0J B;  3SYT A;  3OR2 C;  3IWZ A;  2DA1 A;  4BH9 A;  4LFU A;  1BA5 A;  3QPL A;  1JE8 A;  1VTN C;  2DOD A;  1X4O A;  4XL9 A;  4EMS A;  1EH7 A;  5D6E A;  2HOS A;  4RS8 A;  3NAR A;  3B02 A;  3U21 A;  2NVY J;  6PAX A;  1YS7 A;  2PX9 A;  1IF1 A;  1Z1D A;  2HR3 A;  3HHH A;  5LEK A;  1X58 A;  3E1S A;  4HDU A;  1WJE A;  2MH2 A;  3LSK A;  3P9I A;  3QP6 A;  3UNG C;  5D8L B;  1UHW A;  4EJW A;  2Q2E B;  1I39 A;  1KQ0 A;  4BAC A;  1FPQ A;  2JT1 A;  4I6Z A;  3JR9 A;  2DK8 A;  1S29 A;  1X3W B;  4BY7 J;  3BPV A;  3GLL A;  4KFC A;  3F8B A;  3HXL A;  2ZSI B;  4M9X A;  1ZRE A;  1JT6 A;  3MZ8 A;  1T6S A;  2R7O A;  1BIA A;  1TQM A;  3S32 A;  3GFJ A;  3CJN A;  4XRS G;  5E8I A;  2MGQ A;  2X1C A;  3ERM A;  2MYS A;  4RMN A;  1ERD A;  3IHU A;  3WTX C;  1TNT A;  5M3F J;  3LA7 A;  1HBX G;  4ZYG A;  1B8I B;  2R7Z J;  1IUY A;  2NS8 A;  2X6W A;  1UCR A;  4C3I J;  3BJ6 A;  1A36 A;  1OCT C;  1IO2 A;  1W5C C;  4JQF A;  3VYR B;  2FSW A;  4NC6 A;  1XD7 A;  3HRS A;  3OIO A;  2QQ8 A; 
#chains in the Genus database with same CATH homology
 2LMD A;  1MIJ A;  1XPX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...