2LMDA

Minimal constraints solution nmr structure of prospero homeobox protein 1 from homo sapiens, northeast structural genomics consortium target hr4660b
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
174
structure length
174
Chain Sequence
MGHHHHHHSHMAMQEGLSPNHLKKAKLMFFYTRYPSSNMLKTYFSDVKFNRCITSQLIKWFSNFREFYYIQMEKYARQAINDGVTSTEELSITRDCELYRALNMHYNKANDFEVPERFLEVAQITLREFFNAIIAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCLQELLHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prospero homeobox protein 1
publication title Determination of solution structures of proteins up to 40 kDa using CS-Rosetta with sparse NMR data from deuterated samples.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 52
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2011-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05044 HPD Homeo-prospero domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.500 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeo-prospero domain 2lmdA00
2LMDA 1MIJA 1XPXA
chains in the Genus database with same CATH superfamily
2E19A 3MQ0A 2JK3A 1G3TA 4D5CA 3H0DA 1Y1WJ 5JR3A 1XN7A 3G2BA 4FASD 3DBLB 1O57A 2BEOA 3PIOF 1Z3XA 1I1GA 1Z91A 2GZWA 1NK3P 1FBUA 3J81Z 2K4JA 4KUMA 5GADJ 3Q5FA 2D1VA 4I7HA 3ABMH 1SEUA 3JRCA 3Q9VA 4IRGA 3G3ZA 1PP8F 2I8DA 4P55A 4ASNA 2K27A 3CMAI 4J00A 1B1BA 3BTJA 1Y56A 4NUBA 1MDMB 5K5QA 2VXDA 4IHXA 3SDGA 4LMYA 3WG7H 1ENHA 2K40A 3IH2A 4BQNA 3PNTA 3SQNA 5HODA 4E7IA 2HI3A 3EUAA 2O8KA 2PI0A 3E3VA 1V5FA 1ZARA 2G7HA 2AHQA 3J80K 5LHGA 5FGMA 3FXMA 3PL8A 3TGNA 4UUVA 4B3XA 3G4SI 2LOOA 5FROA 3E5QA 1OCTC 1YRNA 1FMVA 2LY9A 2LBFB 1APLC 3DCFA 3H5RA 2M1BA 3CCVI 3SHFA 3ABUA 4KIFA 3BR6A 2IAIA 1S7OA 3QU6A 5KNLA 2LK2A 2NVQJ 3MZYA 1SFUA 5AIPA 5LGUA 3HPHA 3RCOA 4KA4A 3RYRA 2E5NA 3RQIA 2W84A 4Y13A 1FTZA 2IXSA 1W7PA 2ESNA 3CF5F 1ZH5A 2VKDA 1Z0XA 1XSDA 1SVLA 2A61A 3TO6A 1ORKA 2FA5A 4D1QA 1DPUA 2Z5UA 1T2KA 3HGGA 3GTJJ 3CTAA 1ZG1A 2XF5A 3BT9A 2ESHA 2WBMA 2Y69H 1Z67A 1QO0D 2PMHA 1MJAA 2W57A 3FXJA 5LBQA 1R36A 5M5YJ 2CH0A 3LFKA 1A5JA 1F1ZA 2PEXA 5B1AH 3BC8A 4N4OB 3VFZA 1QVTA 5B5EC 3EUHC 3GFJA 2CG4A 2JPBA 4ITVA 2DFFA 2ISZA 2Y0MA 2MABA 2F5DA 5L3DA 1VQ4I 3O2PE 3ERMA 3QAHA 5F1RA 4P5OA 5IYBJ 1X4OA 3HSRA 1P7IA 1PP7U 1SVOA 1I6HJ 4G7HF 1YIOA 2W48A 4MQVA 2PJRB 1JUSA 1HSJA 2XHKA 1V55H 2DMUA 3GX4X 2ZNZA 4C30A 1XDUA 2QGUA 1FZPB 5H6QA 3HRUA 3J7AY 1K4SA 5GAEJ 4J19A 2ECCA 1MMDA 4G8XA 1FBSA 4BL0B 3C3WA 1UZCA 3PQJA 3OYAA 4H4KC 1SMYF 4YRVA 2EA4A 4XONA 3KE2A 1SFKA 2XPUA 1SD6A 2QVOA 2ID3A 2ZMEB 5C4JJ 4W1UA 2Z33A 5LFAA 5EDNA 1B8IB 5GPCA 4IQ4A 4X6AJ 4WF2A 3CJTB 4RB0A 1X2NA 3BG7A 4HBLA 4LK1F 4KMFA 1TTYA 4BHCA 2EV5A 3GTMJ 2K9QA 2VBYA 1VQMI 3VYUB 3GYHX 2X85A 4A3EJ 3RPUD 1IN6A 3DU5A 1G59A 4E6KG 4Q47A 3TP0A 3DP7A 2A68F 4B4CA 2JSPA 4EM2A 2BW3B 3B73A 3A01A 1HF0A 1MD0A 2KLOA 3RKXA 4ESJA 2KISA 1MBGA 2LMDA 2CW8A 1IRFA 4UVAA 3KCCA 2VOPA 4FE4A 4K2EA 4RBOA 4CYCB 3BPVA 1SD5A 4WXCA 5E3MA 1F4KA 2MLGA 5HLHA 2UUZA 4KITB 3BR3A 4W97A 5DUIA 4A3MJ 2KIQA 5L3BA 4PUSA 5E1XA 5DDGA 1D0XA 2R7TA 2OAZA 2M5WA 4KIGA 4MO7A 3ZQIA 5LEJA 3CCYA 3LWFA 1JE8A 3BR2A 1MJBA 3AG4H 5D5UB 1ONVA 3PSIA 2RQPA 1Z7UA 2PMZA 1YITI 2FE3A 4XQFA 4HYEA 1ETVA 5DUKA 5K7HA 5LEKA 3UR3C 4EJOA 3HC7A 3OYBA 3FK7A 1UFMA 4LGWA 4FETA 2FU4A 4AUXA 3KZYA 2KKOA 2WAFA 3CLOA 1CGPA 3A02A 2ELJA 2X4HA 2RVCA 5JHFA 1W4MA 2MH2A 3IAS2 3T5XA 5F6FA 5EG0B 3ZR8X 3L2RA 4GDFA 5GAGJ 4GYGA 4Z2YA 1DQUA 3K4JA 5FRNA 2DT6A 2OBPA 5EZHA 3CO7C 2H1LA 2XB5A 1FJLA 2DFIA 2RGVA 2EV6A 3LL7A 1BA5A 4U0WA 3G73A 4RGUA 1MBHA 3V4GA 5M5WJ 2HZTA 2M34A 1HQCA 2IS1A 2VN2A 4XKCA 3FBIB 4L0ZB 2R5YA 5AIQA 3RSNA 1MZBA 4BAYA 1X19A 3BR0A 1ON1A 3BLYA 3BP8A 2HXOA 1BI3A 4LG0A 5M5XJ 2KIUA 4NQWB 3RPUA 2BVLA 1VTNC 4HEA2 4UV8A 4DQ2A 1Y8QB 3P5JA 5FD5A 4XRSG 1BC7C 2DODA 5FKOA 1R1VA 2JJ7A 1SC7A 5E18F 2QSHX 2R7ZJ 2HVQA 3U2RA 1HW1A 4D7NA 4WXDA 2ZFUA 1WH7A 2EILH 2B0LA 1DP3A 4XMYA 4YFKF 5L3EA 1MSEC 1FTTA 1VF9A 3C1DA 2AXTC 5F0FA 1FOXA 3ZOBA 5D4SA 4QLCU 2WAQA 3GUDA 3IRQA 4BBSJ 5F0HA 4OMYA 3EUHA 3WG9A 4ETSA 5J1UA 2V1XA 3L09A 1YS6A 2M0CA 4P96A 4B43A 3K2AA 2VE9A 3JCUC 4B48A 1SD7A 4BY7J 2AO9A 3JRIA 3HRSA 3N4MA 2F4IA 3CF2A 4A12A 2CV1A 2M4GA 3QU3A 4M9SA 4CCNA 2GXBA 1L0OC 2E71A 2K7LA 3ERED 3RQ4A 3S1NJ 1I3AA 1P2FA 3S16J 4A5MA 3FWEA 5LHHA 4HNUA 1WJDA 3SZTA 1E3HA 4ON0A 2DA7A 3F8CA 1ERDA 4OIQF 3M1CA 3PSFA 1QGPA 4G6DA 2BOLA 1GVJA 3Q0WA 5CVIA 3N97A 4UNOA 4Q48A 2FNPA 3FDYA 2IBDA 2E2HJ 1QZZA 2XGCA 4PGGA 4BUPA 5F1JA 3ESWB 3F8MA 2R3SA 3E5UA 4Y7NJ 3C2BA 3BZKA 2R7XA 4LD5A 1DU0A 1ETXA 1USTA 5FD6A 4LB5A 1ZGJA 2KIFA 1C0WA 3ASOH 1KQ0A 4S05A 1XSVA 1JXSA 2VPRA 5BMZA 4ANJA 3TBIA 4WWCA 2MA3A 1YJWI 1TP4A 3CUQC 3WTXC 3OYCA 2HKOA 4IHYA 2QQ9A 4G6QA 2CUFA 2K9SA 4KICA 2FX0A 1ETYA 1S9HA 1LQ1A 1EH6A 1EH8A 4DBRA 2M3AA 1R5ID 2OPTA 1LE8A 3LQRA 2OZUA 2QQ8A 3ZQLA 1TWHJ 4HNTA 3GEZA 4HDVA 1LNWA 1LKXA 3IWFA 3ROUA 2L9NA 3OYHA 3GFLA 2Q1ZB 2A69F 3TOAA 2ZB9A 2M87A 4DZJA 4LLNA 1LVKA 1PUEE 1QQIA 2JMWA 3DFGA 5C3EJ 1O3SA 2WB1A 4BJ5C 3R61A 1Q1HA 3P7NA 5CLSA 3ZXSA 4I2OA 2E7WA 1LUJB 1BW6A 2DT7B 4I6ZA 1F9NA 2DOAA 3QPSA 4HLXA 1IRZA 1KQ8A 1ODDA 4Y33A 4A5NA 4L18B 5LRRA 3CLQA 1B6AA 2DA5A 3P9IA 4TV7A 3GCMA 3H9JA 5KCMA 1T8IA 2W1OA 2O8XA 1YO5C 1XCVA 4S0HB 3PQKA 1VZ0A 2DMPA 2RN7A 3ZMZA 1X3ZB 1X1CA 5DCMA 1T38A 3VOEA 1IUYA 5K7FA 2KIMA 2BY1A 5CVJA 3K2ZA 4RM2A 5DYMA 2Q2EA 3B6CA 3FKJA 1X3UA 4D0PA 3BR5A 1QZEA 4RAFA 2CMPA 3HZJA 4CYDA 4XKWA 1YJ9I 3F0CA 1UELB 1RPWA 2FQ3A 2IPQX 5ICEA 3DEWA 1HC8A 3JREA 3KIOA 2HQ5A 3I59B 3PFYA 3ZQ7A 4D9JA 1OYYA 3BG6A 4I76A 1G3WA 3DU6A 2B9SA 1JKQC 2LRDA 1ZLJA 3IH3A 1W5CC 3ZGKA 4F93B 1RR8C 2WV0A 1PDNC 2CUJA 3PUFA 2BE5F 3G1MA 2DDAA 3HG9A 1W36C 3I56I 4DGWB 1OLTA 4EMSA 3IP4B 4XLFA 4OIPF 1P9QC 2FF4A 4RGXA 2FMYA 4DYCA 5A2QZ 3JTHA 3I4PA 1VQLI 3TDUC 2CFOA 4CICA 1WRJA 3FHNA 3CCJI 3W6JB 3TW6A 3JAMK 2O3FA 3MCZA 5DV5A 1HBXG 3AFHA 1AHDP 2K9NA 3CC4I 4BU2A 1AWCA 2E34A 2EA2A 1T39A 4I02A 3CCUI 3I4NJ 3FKIJ 4GO1A 3BTIA 3MKWB 4XRFA 1Y39A 4IQJA 4A3CJ 4HAMA 5IOZA 2R7OA 3BG3A 2JA2A 2HYFA 1IRXA 3QYBA 5D5WB 4IZZA 1X1DA 2Z1DA 3TL4X 2ME6A 2OV7A 2XRLA 2TRTA 4AM3A 1FOYA 1X1PA 3DTKA 4A3LJ 2VQCA 1USSA 2D5VA 1IN5A 2XDVA 3H3VK 3CC2I 3KYCB 4RAYA 1I27A 3CUQA 4E4HA 5DEQA 4OAZA 2VBZA 2CQNA 4XOTA 3S1RJ 4F91B 1YJNI 1LDKB 4PZJA 4UHTA 1HA8A 2BVMA 1GXQA 2GOXB 1XS9A 2DPDA 2MSYA 4EM0B 1IC8A 4LIVA 4UVCA 1MBKA 5B1BH 3L00A 3FHZA 3KYDB 1D8KA 2G9WA 2P5LC 4BDYA 5ERIA 2CJJA 2PG4A 5J8FA 5L3CA 1IDZA 2D1HA 2E36A 2HGCA 2Q0OA 4DOZA 2L5QA 1PUFB 3U1KA 1R71A 2XGXA 3DKXA 3SXYA 1YOVB 1IGNA 2VODA 2VJJA 3O8GA 4X0GA 5J6XA 4EVIA 4RLQA 2R5ZA 3MAJA 2ZSHB 1WKMA 1OYIA 2DK8A 4RLFA 4BXXJ 2WAEA 1O3QA 1S3JA 4UXNA 3LA2A 2WV1A 4HA8A 3RZOJ 1LJ9A 2X6YA 2P7CB 1ITYA 3DKWA 1IO2A 1NG6A 2P7VB 3L7WA 4JBAA 4WXHA 3H35A 1TQPA 2EIMH 1D5YA 4HV5A 2NYXA 1XD7A 2DYSH 2QCOA 3HUGB 3JSOA 4IXAA 2FBKA 4LB6B 3ZMVA 2TDXA 1X1AA 4JX5A 4XKVA 3OOPA 5BQTA 2XPVA 1OYWA 5KHDA 1I5ZA 2W00A 5F64A 1KU7A 5HNHA 3DPUA 1G2HA 1Y1VJ 2Y0SA 3HHGA 3VDXA 2VLAA 1JHHA 1BI2A 1UB9A 2VXZA 2ZXJA 3OIQA 5C44J 2X51A 5J8CA 1OJLA 2FBIA 3DPLC 4WX9A 2KDZA 1O7LA 4ABZA 1V54H 2DQLA 1EKEA 1HW5A 2LF8A 5E1ZB 2ZBKA 1IF1A 2R7VA 1GV5A 2K4BA 3DKYA 3KFWX 2LREA 4GXOA 5D6EA 4A3IJ 1FY7A 2ISYA 2DN0A 4L5JA 2X1EA 2A07F 3H92A 2ZXWH 4BH9A 2A5WA 2W7NA 3M07A 2OQGA 3P9KA 2H09A 4XL9A 2VJIA 3HOXJ 4QTRA 3DTIA 2STWA 3HPGA 4HV6A 4YG2F 4BBRJ 3CCEI 4I98B 2VOOA 2CFXA 4RS8A 5FLXK 1O7FA 2ZJRF 2O03A 2KDOA 1ULYA 2E7XA 2VKVA 3BCAA 1MBJA 1RUNA 3M9AA 3QQAA 4ENJA 4U87A 3SFZA 4JX6A 4NBQA 3FXUA 5F0CA 4BHPA 1FOWA 4G9YA 1ZTRA 4JP0A 3VEPA 1K7AA 2MYSA 2TCTA 2VUMJ 2VBWA 2JA7J 1MGTA 1VQ6I 3Q0VA 4A0ZA 1BW5A 4IKFA 1H9TA 2CW0F 5E17F 4KIBA 4XICA 5L3FA 2R7SA 1ZRFA 4KDPA 2F6CA 5JVTA 3FF5A 2FEZA 2OCEA 3K0LA 4XK4A 1ZR2A 2V6CA 4ZTJA 4UUSB 4NDLA 2GBYA 1WHUA 5TISC 4MEYF 2VB6A 4ENKA 3CZ6A 2QUFA 2K3PA 3HTSB 4LLLA 3IRRA 1S72I 2VJ4A 2QF7A 4Y3OA 3OYDA 1KU2A 1MDMA 3UNGC 5M3FJ 3CJNA 2HQNA 4E7SA 5FKMA 2R7UA 1HOMA 2O61A 2WWYA 1IV6A 4RM3A 3OYIA 5IT3A 3EETA 1TL8A 1A35A 2FSWA 3WTWC 2NNNA 2F4OB 5IY5H 2HQAA 3HBLA 4PGHA 2M7AA 1ZELA 2OF7A 2P6SA 4OU0A 1KZHA 3BQYA 4ESFA 2QBYA 5BPIA 1YQAA 2QSGX 5CVRA 1JI8A 2DMQA 1T33A 4A3JJ 4S04A 1EV7A 1JGGA 2LBFA 3D1NI 2M9HA 1OR7C 1LVAA 2HZDA 3WU1B 2UXNA 3FMRA 3QYEA 3FMQA 4RAZA 4L9NA 1VQOI 3BPXA 2M0MA 2FRHA 1OKRA 3J7ZI 3WTYC 1GXPA 4HX4A 1R00A 5ILSA 3ZCOA 1B4AA 5JHUA 1R58A 3M4OJ 3B6AA 2FOWA 4G6TB 2E60A 2Y9ZA 1JUMA 1A04A 4L9VA 3OS2A 2Y75A 1WJAA 4L9TA 1EA3A 2XF7A 3GF2A 3K4CA 3ISPA 4IHVA 2VKEA 4OOIA 1S5LC 1Z3YA 4A3FJ 5EJCA 1HCRA 3JR9A 1Y8RB 2QZ8A 2ZNYA 4CCMA 4U88A 2RDPA 2DOEA 4AU7A 3COAC 1QPIA 3KPHA 4KFCA 2PFBA 3ECHA 1D3YA 3HGYA 1VQPI 4GFBA 3FX3A 4BHBA 1A6IA 2HU9A 3PO3J 2XV4S 4MLOA 1RETA 3OSFA 1I6XA 2RC4A 2ME0A 3O3KA 3MKYB 4HQEA 1FIPA 2JSCA 1IG7A 2VQHA 2FNAA 2L4AA 3WTZA 4BE0A 2PJRA 3IV5A 4BS9A 3IAM2 2FMLA 2R7RA 3OR1C 2XAJA 3BG5A 5F27A 3CCLI 1QU3A 3OYMA 4I01A 1IDYA 1ETKA 3I3LA 1A31A 4XNFA 4XN0A 2QKLB 3HEFA 4LOCA 4ZTFA 4DIQA 3AL0B 3HOZJ 4EJTA 4ESBA 4ZYDA 3SEQA 1MNEA 2E1MB 1JKRC 4ENMA 1H88C 2KP6A 4B3AA 2NVYJ 3JRBA 4BQAA 2M30A 1O4XA 3U21A 1DPRA 5CQGA 2Y31A 2GXGA 3A01B 1UAAA 2YX7A 3MMYB 1X1BA 2HOTA 2PX9A 3OYKA 2X6XA 4HW0A 4O6JA 3R0JA 2N8GA 2BXZA 2XIGA 4HF1A 3CJQB 4M72A 3I9V2 2YU9J 2DJNA 1FLIA 4BJTA 2MC4A 3ZQFA 3PFIA 2B63J 4FQGA 2XSJC 1MMSA 2PMZN 1G3YA 1PVEA 3DBRB 3Q9SA 3LAPA 2JRMA 4C2TA 2CQXA 3LSHA 3WHCA 5A2QK 3ECOA 2IEKA 2Q8KA 3DLAA 1RIOH 3IKTA 1E3OC 1V5GA 2CS3A 2DYRH 2MC3A 3HOTA 2LKSA 1Z6RA 4XKBA 2CSOA 3BJOA 2L01A 3VSLA 5IT9Z 2P81A 3GZ6A 2IGNA 5E3NA 1ZGAA 3MZ8A 4EGZA 2C6YA 5EG0A 1K4TA 2HYGD 2NOGA 2VQGA 2RREA 5LGNA 1QZYA 2ADUA 3BG9A 3E1SA 2IGOA 5HDNA 2IA1A 2IA0A 1DGRM 3GXOA 2Y30A 1FPQA 5E8IA 5IYDJ 2HPIA 4OWRB 4PFOA 1R49A 1K78A 3E6MA 3CDHA 3VB2A 2VKHA 4LIUA 3NARA 1UHWA 1JUPA 2L4MA 4JQFA 5HLTA 3RJPA 2EH3A 2GIZA 3A4CA 2BBYA 3HIFA 4B44A 1T0FA 4ZZLA 1H9GA 2CRGA 3PM1A 4CO8A 2HXIA 1OR7A 5K5OA 2HWVA 2D45A 4KT5C 2A6TA 1ETQA 4G94A 4EJUA 1OCPA 2LF7A 2H8RA 3BOQA 2CUEA 2QLZA 2KL4A 3GTPJ 2BYVE 1R5HA 1D1BA 4UY8I 2LY2A 3G1OA 4FE7A 4XM3A 1GUUA 3TOBA 1Q1VA 4M9ZA 2EZLA 4HNVA 5HVQC 2COMA 2LVSA 1LFUP 3PIPF 2HOEA 2MG4A 3K9TA 5GP9A 2VQLA 5BNGA 1XX5A 4CA0A 2WAQN 2JWTA 4I99C 3GTKJ 2YPRA 4XSXF 4MTEA 4CCKA 1ZGWA 2STTA 1FEXA 4CZZA 1QVUA 2AQFA 1VQ7I 3HRTA 1Y0UA 3D5LA 1FP2A 1RUOA 3VSKA 5FO5A 3J7AO 2L3DA 4QSHA 3AG2H 3IHUA 2LKPA 2FBHA 3G1LA 2HFHA 3RTRA 1XTAA 1O3TA 1BJAA 1P92A 5H6RA 3HHHA 3NWSA 5CVUA 3PNVA 4IJAA 2V9KA 2Z9OA 3VYSB 3AG3H 4HDUA 4F7ZA 3GWZA 2IP2A 3F8BA 3BDDA 5HS9A 2O6GE 3L9FA 1WSUA 1W0UA 1TQIA 2LDUA 2CYYA 1KU3A 3ZN1A 2P5KA 1GDTA 1J0RA 2CWEA 2P5VA 1ZG5A 3V8JA 1ZG3A 2I5UA 2H1KA 4L5EA 4XLEA 2DFEA 3K69A 3WU2C 3J7YJ 1YIJI 4Y17A 2L9RA 3CMEI 2F48A 2HYJA 2GAUA 5DTDA 3JRFA 2Y9YA 3S14J 2G0EA 3K4BA 1J2XA 3S2WA 3V7CA 2ZFWA 5EEHA 3GTGJ 4DW6A 1YI2I 3VWBA 3VYTB 4UUTA 1QHGA 4MGRA 1REPC 4M6VA 4CCOA 1S8NA 3GVAA 3S32A 2DK5A 2B7EA 3M1EA 1R9TJ 1WVRA 4U7DA 3F6OA 1HKTA 2BY0A 1D8JA 2RNGA 3S3OA 1BOBA 3BJ6A 2WB1N 2KRCA 1D0YA 2W24A 5BOXA 1B59A 3KLOA 1FYKA 1R7JA 4MTDA 1IZ1A 3FIWA 2WA0A 3E0JB 2RQQA 1IN7A 1E2XA 3F22A 1YS7A 1X58A 1WJBA 2VT3A 1BL0A 1MIJA 4EJVA 3OWTA 3MD2A 3F6VA 3RIRA 4F52A 4FX0A 1T08B 4B09A 2Y2ZA 3KP3A 4BKXA 2XKOA 4PJ0C 5HOOA 1LDJA 3SZGA 3CCSI 2GWRA 5JFRA 4HF2A 4IVNA 3L2VA 2COBA 4XLAA 2HDCA 4BEHA 3OYGA 3T8RA 2EFQA 5KVRA 3J81K 1TW3A 2XROA 2HOAA 3EDPA 1WJEA 2X9DA 4Y4RA 5DCMB 3RDIA 5DD4A 3WHBA 3CDLA 1JGSA 1WH5A 1WI3A 2XAQA 1U9OA 1J7KA 3DTEA 3MKLA 2CW7A 4HSRA 3M8FA 1JT0A 2IVMA 4YEJA 2D2WA 4A0XA 3A0BC 5HDGA 4E7KA 2NOJB 3FZVA 1FSEA 5EGOB 4PK4A 2HVRA 2UWMA 2EIKH 2P0WA 3HSFA 3VPRA 3C2GA 3MFKA 3ZMTA 3JTGA 1TQMA 3BR1A 1DUXC 5KAIC 2HNHA 1BBYA 1Z77A 3H5NA 4XLPF 2XPWA 1U3EM 3E6DA 2YU3A 3NQOA 3PO2J 1R6RA 1VNDA 5HS8A 3F8FA 4YIRX 1U5TB 1I3QJ 4F3QA 3A1YA 4ZDLA 3IKVA 4EGYA 1P4XA 1R4MB 1CQTA 4N4NB 3CC7I 4IOAF 2RV8A 4JYKA 5CYVA 3LNQA 4AYBA 1FX7A 4ZYHA 3ZPLA 1YYVA 4U0VA 2XAHA 1FNNA 3WU0A 4M3FA 4EQQA 1AKHA 1H0MA 3TP3A 4IF4A 3ZQCA 3T0YA 1LEAA 1R1UA 1BIAA 2DOFA 5ICGA 3WODF 3E5XA 4IRHA 2ZC2A 2BY3A 1OCRH 4II3A 4A0YA 4UB6C 3MZHA 2RKHA 3PUBA 5IYCJ 2OD5A 3IL2A 4NNJA 1LFPA 1Y6IA 3I71A 3A03A 2L9VA 2CQQA 2O5RA 4PCQA 3M3YJ 2H27A 3L1PA 3H3UA 3ZN0A 2O7OA 5KK1A 1K83J 3ABLH 3EQLF 2EZHA 2X6WA 2K9LA 3T8TA 3R0AA 3DEEA 1B9NA 4PJNA 1ZRCA 2XSDC 1TWAJ 4N9IA 1TWGJ 5EZGA 3D0SA 1UG2A 5HS7A 5CVVA 4JOMA 1X2MA 2DMNA 3JSPA 2V9VA 3ZQQA 3OYFA 3UKGA 2EBIA 1BR4A 4LJZF 3ML6A 1T95A 1V4RA 1VQNI 5CQEA 1QRYA 1V3FA 2I10A 1BC8C 5TRDA 1R4NB 4XOPA 5IOYA 1UMQA 4EV0A 2YUSA 2A05A 5J1YA 4XN3A 2NVTJ 4KISA 1K61A 3KETA 3ZMUA 3SZPA 3OSGA 1MH4A 4YIIA 2F5CA 2EFPA 3ABTA 2E2IJ 5D5VB 1U0JA 3JRAA 3CUQB 5H2FC 2BY2A 2DTZA 1Y0NA 2HTSA 3ULQB 1BOAA 3LA3A 1TNSA 1XGSA 2ELKA 1BR2A 2V7FA 2JUGA 4RA2A 3JRHA 2UV1A 3GLXA 4CGZA 6PAXA 2F5EA 1D0ZA 4BE1A 3SDBA 3LSMA 1UHMA 1WWXA 1FIAA 4DZPA 2PN6A 2HR3A 4ZDOA 1YW9A 3MVPA 3FM3A 2FQ4A 4IPAA 4KN4X 4XLNF 1SAUA 3TO9A 5ILUA 1CF7A 2EINH 2BV6A 2NS0A 2K5CA 3TKYA 1JHFA 4AIHA 3DF8A 1Z05A 2DA6A 3BROA 3HYIA 3FK6A 2VONA 4OMZA 3OL3A 4NC8A 5EEGA 4ZZDA 4LK0F 1ZN2A 5FKLA 2R5ZB 3QRFF 4QPQA 4HSTA 1XGOA 4IHWA 3DPTA 1U6GA 2IW5A 1J09A 2FOKA 4I09A 5HDKA 4EM1A 1N25A 3HXLA 1QNTA 4CDGA 2VBXA 1MW7A 2GOMA 2V79A 3E6CC 1WJ5A 2Y0SN 5B3SH 2FJ1A 2JPCA 3I53A 3WTUC 3F23A 1ZRDA 3A2KA 1TWCJ 4XORA 3NRVA 3I5UA 3M8EA 3OOUA 3DQVC 2R0QC 1WJCA 2A6HF 2LNBA 2YSRA 4CXFA 2OU2A 2Z16A 2ZJ2A 1GVDA 2AXLA 2IGKA 5E79C 4HF0A 3BZCA 4IEJA 2LYCA 2L0KA 3ELKA 3LOCA 5IP7J 5IT9K 4PSXA 1OPCA 3S15J 5F08A 2ZMEC 1QHHD 1IRGA 1TWFJ 3TW7A 1TW2A 2MFZA 3K1NA 2QSFX 5TGTA 4MHGA 4EEFG 1HDDC 2IRFG 5IP9J 3T1BA 5B66C 2JUCA 3HTUA 5BS6A 3FXOA 1IJWC 1OCOH 4MQ9F 2LP0A 1YW8A 4ZJZA 3S2DJ 2BHYA 1L3LA 2Y48A 4PDKA 4CCLA 2LD5A 2EWNA 3U9GA 1MSFC 2DCEA 2V1DA 2E1MC 5E20A 2LC2A 3QWLA 1V5EA 3LSPA 1B72A 3KYLA 1MNMC 4AVPA 3OYLA 1VQ5I 2DAOA 2YX4A 3G71I 3RKWA 2A5YB 2EJRA 3Q3SA 5LHIA 1P6RA 4F55A 1BR1A 3K4NA 5D8LB 4ENNA 2JN6A 4MFDA 3QYFA 3QPLA 4RDUA 4B1RA 1OISA 5H20A 4Z6YA 2M7BA 2MD5A 2CQ7A 3W2WA 1YHQI 1N78A 5FLMJ 2JA8J 2ELHA 1D1CA 2LLKA 1SFEA 3KP2A 1RC9A 1OFCX 2W4SA 2EK5A 5HNFA 4XRMA 1AOYA 1YG2A 3K4KA 1FYLA 3VYRB 1F5TA 2L54A 1RKTA 3GZ5A 2E1NA 2QWWA 4R1HA 4IRIA 1Z9CA 3TQNA 3P9CA 2X48A 1EF4A 3GFMA 4RB1A 5DCFA 2VC1A 1H89C 4UUSA 1MMAA 5FKKA 2VI6A 2MGQA 3HSEA 1VQKI 3FM5A 2F2EA 1BJZA 3GMEA 1G6NA 1G8XA 1YX5A 3CJRB 1HKQA 2HVSA 3LSIA 1ZLKA 4KJZA 4OAYA 4LITA 3SYTA 2ICWG 4IOCF 1I50J 4E70A 3CUOA 1WZ2A 1WCMJ 4HZFA 2LSOA 1FT9A 1XG1A 4PJMA 1YRNB 1T0FC 5JVGF 1LB2A 4RB3C 3WTSC 2DA1A 1XMKA 5FFZA 2QBYB 4CSWA 5ICFA 4BACA 4BNCA 1R1TA 1W0TA 4Q5SF 1U8BA 3WE3A 2ZJQF 3OR2C 3GW2A 3OIOA 4CUGA 2HEOA 3HOWJ 1LEBA 2HQRA 2WY8Q 4P9UA 2KRFA 2PMUA 1VFCA 4FT8A 1VQ8I 1E17A 4U0YA 4DBQA 2R7QA 2VC0A 1W7PB 3O6BB 4UVBA 2DXIA 4DJAA 1JTYA 5K5RA 2E1OA 1BI1A 3JAMZ 5EF6A 5E1WA 2ZO4A 4V2FA 4L9JA 3N05A 4A69C 4BDZA 1HSTA 2ZCWA 4C2UA 4YFXF 4M3DA 2NS8A 4HG2A 1T6SA 2EV0A 2K02A 3FMSA 4FHTA 2CV0A 3AAFA 3JRGA 2H6CA 2XB0X 1IV8A 3H36A 3K7AJ 2A6EF 1I39A 4J01A 3CP8A 2EIJH 4HX8A 5CJ9A 1FBQA 1A6QA 4ZC3A 3HOSA 2L02A 2RNJA 1XB4A 3HDDA 2XF6A 2FXAA 5D4RA 3TEDA 1AU7A 4ZYAA 1TNTA 3I58A 1YLFA 3BWGA 4AIKA 3E6BA 3TO7A 3R4KA 4KMUX 4HQMA 5CKTA 1Z21A 4YIFA 3CMYA 3ASNH 2GA1A 4LLGF 2ZMEA 4FISA 1JT6A 1R5GA 5JLXA 4YFNF 5JI6A 2QA4I 4CHUA 1B8IA 2OTJI 2R7FA 3EPZA 5M3MJ 1MNDA 2OZ6A 2GQQA 1JTXA 1GT0C 1WJFA 3TDZC 1XGMA 4AWXB 5J47A 4R79A 2H6BA 4YELA 2G7UA 4HRIA 5GTHC 4XLCA 4XLHA 2BW3A 1DGWY 3RPQA 2DDBA 2KRHA 1IN8A 4PSWA 1ZQ3P 2MBFA 3H0GJ 2IT0A 4QWQA 1G4DA 3HKZA 3CD6I 3EYYA 3HKZN 4PFPA 4CYCA 3HOYJ 4CZCA 5FRMA 1ETWA 2IA2A 2JTVA 2E1CA 3ONQA 2K9MA 4XR6A 2BGCA 2KHMA 2YS9A 1HW2A 1NHAA 2ID6A 3OYNA 2FD5A 4FCYA 3KZZA 4FX4A 3KEQA 3NWTA 2EZIA 1POGA 1MMNA 2MLKA 3LSGA 4P1WA 5DS9A 1FWZA 4KN7X 4B8XA 3OYJA 1W5SA 4BE2A 3MEXA 2JVGA 1FSHA 1VQ9I 1RI7A 2PBIA 1X3WB 1STZA 2L7MP 2DA2A 3CCMI 3FXLA 4OIRF 3F72A 2KFDA 2X1DA 3WTVC 1IN4A 1IW7F 2ACJA 1W1WE 2F5FA 2EZKA 2CUZA 3SFIA 1K79A 3OY9A 3I0TA 3H3ZA 4V19K 3GTOJ 4XBFA 2AS5F 2OJED 2ECBA 4Y52J 3F8NA 2DT5A 3K10A 4HPQA 5CPRB 3SEZA 3RYPA 3M8JA 3V7SA 1O3RA 4BY1J 3HOUJ 3H9GA 1LPQA 3KP6A 2L9SA 3CESA 2HKXA 3ZQHA 2GXAA 2L7ZA 2GA2A 1MKMA 1ON2A 3F21A 3DLLF 3OL4A 4AIDA 2LTPA 1ZREA 4C2MJ 1ZAOA 1PYVA 1TT5B 5E3OA 1KONA 2V1NA 4M3BA 3S1QJ 4GRIA 2IGMA 1K78B 4RGSA 5LGTA 3QOPA 2R5YB 3GBGA 4R8HA 1QBJA 3MWMA 5E8GA 3C18A 3KEYA 5KAFC 4AC0A 5FLXZ 4LG0B 2A3SA 4IO9F 2OA4A 3HRMA 3AKZA 4NQWA 4JK1X 2O0YA 2M8GX 5C4XJ 4BJ6C 4A3GJ 1RRJA 2KT0A 5BPDA 3KP7A 1I1SA 5GPAA 1FYMA 3L2QA 3EYIA 1EH7A 2QKMB 1N75A 3L2WA 2CV2A 2E5ZA 5D8KB 2VT2A 2YR2A 2LFBA 3K4MA 1U5TC 3LSTA 1SMTA 2CQKA 1XCBA 1KYWA 5DM6F 1XC5A 2LG4A 2L7KA 2QYOA 1B9MA 3TMOA 1Z6TA 1IXRC 2KMUA 2ZXIA 2EFNA 3S8PA 1DP7P 3C7JA 2CU7A 2XGDA 2KZGA 1HXDA 3LA7A 3KP5A 2VJ5A 2JZYA 4RMNA 2DI3A 4U7BA 4A3DJ 1WI9A 2M2EA 1OMIA 2DLLA 2NS7A 3S2HJ 2V9PA 4N0BA 4A93J 3R6SA 1PJRA 1D5VA 2GIVA 3M7GA 1OCCH 1IUFA 2J5OA 2AQEA 2QQAA 1MH3A 4D5FA 3BZ6A 3QOEA 3OMYA 5L3GA 2DO7A 2R93J 3GFIA 1RESA 3RKYA 2V6EA 3S93A 1FMWA 2XUBA 2MD0A 2QM3A 4C3HJ 4D7MA 3WGIA 4NB5A 2WC2A 1JKPC 3B02A 3I64A 3J80Z 2W85A 3CQZJ 3PJRA 1H8AC 1MBFA 1MBEA 2P6TA 2JQ7A 4C3IJ 2IJLA 4AD9A 3LFUA 3V8LA 1R22A 4M6YA 5LLQA 1XSXA 1YE9A 1U9NA 2FUG2 4M3GA 2XASA 2JA5J 2F4MB 4FTHA 1K6OA 2CGPA 3F3XA 2ETHA 5IPAA 5E3LA 2IS4A 1T56A 3Q0UA 3W6KB 3BTLA 1GHCA 2K85A 1LE8B 2KQRA 2HTJA 1NH3A 5LD2C 3S1MJ 4O5VA 3KEOA 4DYRA 2HDDA 3QPHA 2PQ8A 3X2QH 4N9HA 2P4WA 4AVZA 1XDSA 2XKPA 4BGDA 2NNYA 1S6LA 5J40A 3LSKA 4MEXF 2KZVA 4I0AA 2GLOA 2JA6J 4A6DA 3ZMSA 1JJ6C 3DBHB 1WPKA 4E7LA 3NAUA 4M71A 3LSJA 2DU9A 1JKOC 1KA8A 5J4YA 1F43A 1UJ8A 2KPMA 3DWLE 3HB9A 2R92J 2O9LA 3PNYA 2UXXA 1UCRA 1OQYA 5FJ8J 3MN2A 1J9IA 1QPMA 2E35A 1HKSA 4M74A 1KYZA 4G7OF 3OYEA 2E2JJ 2X1CA 3BCBA 4E7ZA 3RI4A 1ETOA 2CO5A 1XMXA 3BQZA 3C2HA 3CMMA 4X1EA 1N77A 3DV8A 4NC6A 3FXKA 5K7ZA 3E97A 2BXYA 4CH7A 1FOKA 4NC7A 2NAZA 2DBBA 1RKWA 2EPFA 2LH9A 2XGEA 4M6XA 4M73A 4BEHB 9ANTA 1NG7A 1GLNA 2WY7Q 2WTEA 2Q2EB 5ILVA 1ZHFA 3GO5A 3CDIA 3JRDA 2VE8A 1P4AA 3HOVJ 3D5SC 3HJEA 5GAHJ 4ZYEA 1JJ8C 4A6EA 1DU6A 2X0LA 2W25A 4XIDA 3WE2A 4ZDPA 2LR8A 2OC6A 2OCCH 3I59A 2L7FP 2XRNA 5EGOA 4C9YA 2V1UA 2HDWA 4H0EA 4OIOF 4E7HA 2ZJPF 4GCVA 1P7JA 2OTLI 4GYIA 4GGGA 4WK8F 3OS0A 2V26A 2BZTA 1YTYA 5J3LA 2KJCA 3SJMA 2GM4A 2JRTA 4AYBN 1NTCA 1U5TA 1YX3A 1RNLA 3BTCA 3OIPA 2MW8A 5F04A 4C3JJ 4NHJA 1AA7A 2M8EA 3A0HC 2XVCA 1NK2P 2PLYA 2QEXI 1ZYRF 1J75A 2VASA 3S3MA 1XGNA 3D5RC 1AKHB 3K6GA 4DYQA 3DXJF 3IUOA 2EFWA 3K1MA 3VODA 3G6EI 4LG3A 5LRSA 4G7ZF 2Z2SB 4A2UA 2M4KA 2RAEA 4DNCA 3S3NA 2IS6A 2DFHA 4KNYA 1TBXA 4PJLA 3HL2A 3V7RA 4QIWN 1D1AA 3I4MJ 3W6VA 4AIJA 4L0YB 3LSRA 4G12A 2IS2A 4B47A 2QQBA 5JLWA 3GTLJ 5DM7F 4EATA 5AONA 2K86A 1ZK8A 3GZNB 3ZMDA 3RKQA 3IH4A 1K6YA 2XC7A 4MNUA 4BXUA 3W3CA 3R60A 4IL6C 3DEUA 2R4GA 1Z7LA 1BI0A 5FLVA 1E3PA 2L2OA 1ZR4A 5ED4A 1X4PA 4IHTA 2F5VA 3AG1H 1M1EB 1RR7A 4JX4A 2DTRA 1P4WA 4EJWA 1IAWA 4QPOA 3GTQJ 1KGSA 5K1YA 2QENA 2JVHA 3K1PA 1RZ4A 4L5IA 5HLIA 1ZKGA 3W2VA 3U1DA 5TJJA 2OUMA 3K70C 1S7AA 5FKNA 1J59A 3ZP5A 1QA6A 4I0BA 3CP2A 3V8KA 4UV9A 1WFXA 2K3FA 2NVUB 3JW4A 2Z99A 2JT1A 3KZIC 1MJ9A 4IHSA 1J5YA 2ZXHA 3FISA 3IWZA 3RZDJ 1OCZH 4KYWA 4LFUA 2VL8A 4BQOA 4BQQA 1KU9A 4RAGA 2DMTA 3OS1A 2Z3YA 3I54A 1XMAA 4V2GA 1PUFA 1W36D 1LDDA 3MKZA 1BIBA 1IXCA 4RGRA 2EB7A 1SVMA 1YW7A 5D5XB 1FP1D 1T98A 2DA3A 1CF7B 1U78A 5EYRA 3BJAA 4BYYA 3W2AA 1F36A 3F9KA 5J1RA 2HS5A 2OQRA 1SD4A 1XPXA 4MIMA 3HM5A 3KLNA 4Y15A 3QPTA 2HPMA 2VPLA 1KQ9A 5HLGA 4WCGA 1A36A 3FXQA 1ACIA 2DJIA 3KP4A 3L2CA 3ZQGA 3WTTC 2BHZA 2DA4A 1HDPA 3WGHA 5IP6A 2LKXA 2MH9A 3HUGA 3IC7A 4ZH4F 4CCJA 3CCQI 2KJBA 2R7WA 1TT0A 3KX2A 1SFXA 2DW4A 2M45A 3LMMA 3H1CA 3BY6A 4HLYA 2WADA 3S17J 2EFOA 2PJPA 5ICCA 1W5TA 5FB2A 2EQRA 3REOA 1BN5A 5D6FA 1R23A 3I55I 1EJ9A 3CO6C 2H8WA 3CCRI 2J5PA 2P8TA 3E7LA 5FFXA 3K70D 3ZRGA 3V42A 1G3SA 4IX7A 4E7JA 4M3EA 3L2UA 1HLVA 4MFEA 4XRSA 2V4JC 2NRAC 3EUKL 4A3BJ 3NEUA 3GLLA 4KT6A 2NXNB 3QODA 1S7EA 3FXRA 2DPUA 1UHSA 2H94A 1VI0A 3AL0C 2XAGA 3H5AA 3FBNB 2X6OA 1Z1DA 1U2WA 1E0EA 4UB8C 2VIXA 1FC3A 3ABKH 3O8HA 1TC3C 1IXSB 2DQRA 1WQ2A 4HX7A 1DDNA 4F92B 1S29A 1TZLA 2R7DA 1LFBA 5DD8A 2W82A 4OINF 2UZKA 4II2A 4BXFA 2XAUA 4XSZF 1B72B 4P9FA 1BM9A 3QP6A 2LY1A 3QP5A 1MMGA 4PJJA 2ZSIB 4Q4ZF 1WGXA 4A3KJ 2ZKZA 2HOSA 1YFHA 1W7PD 5EEAA 1SFOJ 1TLHB 3OV8A 1SANA 2NVXJ 1GV2A 3WGGA 1SAXA 3H9QA 4O3MA 5J4VA 4HOBA 4M9XA 3LAJA 3K4LA 4RB2C 3LQQA 1UG0A 1U8RA 5GTIC 2XAFA 4ZYGA
chains in the Genus database with same CATH topology
2LMDA 1MIJA 1XPXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LMD A;  1MIJ A;  1XPX A; 
#chains in the Genus database with same CATH topology
 2E19 A;  3MQ0 A;  2JK3 A;  1G3T A;  4D5C A;  3H0D A;  1Y1W J;  5JR3 A;  1XN7 A;  3G2B A;  4FAS D;  3DBL B;  1O57 A;  2BEO A;  3PIO F;  1Z3X A;  1I1G A;  1Z91 A;  2GZW A;  1NK3 P;  1FBU A;  3J81 Z;  2K4J A;  4KUM A;  5GAD J;  3Q5F A;  2D1V A;  4I7H A;  3ABM H;  1SEU A;  3JRC A;  3Q9V A;  4IRG A;  3G3Z A;  1PP8 F;  2I8D A;  4P55 A;  4ASN A;  2K27 A;  3CMA I;  4J00 A;  1B1B A;  3BTJ A;  1Y56 A;  4NUB A;  1MDM B;  5K5Q A;  2VXD A;  4IHX A;  3SDG A;  4LMY A;  3WG7 H;  1ENH A;  2K40 A;  3IH2 A;  4BQN A;  3PNT A;  3SQN A;  5HOD A;  4E7I A;  2HI3 A;  3EUA A;  2O8K A;  2PI0 A;  3E3V A;  1V5F A;  1ZAR A;  2G7H A;  2AHQ A;  3J80 K;  5LHG A;  5FGM A;  3FXM A;  3PL8 A;  3TGN A;  4UUV A;  4B3X A;  3G4S I;  2LOO A;  5FRO A;  3E5Q A;  1OCT C;  1YRN A;  1FMV A;  2LY9 A;  2LBF B;  1APL C;  3DCF A;  3H5R A;  2M1B A;  3CCV I;  3SHF A;  3ABU A;  4KIF A;  3BR6 A;  2IAI A;  1S7O A;  3QU6 A;  5KNL A;  2LK2 A;  2NVQ J;  3MZY A;  1SFU A;  5AIP A;  5LGU A;  3HPH A;  3RCO A;  4KA4 A;  3RYR A;  2E5N A;  3RQI A;  2W84 A;  4Y13 A;  1FTZ A;  2IXS A;  1W7P A;  2ESN A;  3CF5 F;  1ZH5 A;  2VKD A;  1Z0X A;  1XSD A;  1SVL A;  2A61 A;  3TO6 A;  1ORK A;  2FA5 A;  4D1Q A;  1DPU A;  2Z5U A;  1T2K A;  3HGG A;  3GTJ J;  3CTA A;  1ZG1 A;  2XF5 A;  3BT9 A;  2ESH A;  2WBM A;  2Y69 H;  1Z67 A;  1QO0 D;  2PMH A;  1MJA A;  2W57 A;  3FXJ A;  5LBQ A;  1R36 A;  5M5Y J;  2CH0 A;  3LFK A;  1A5J A;  1F1Z A;  2PEX A;  5B1A H;  3BC8 A;  4N4O B;  3VFZ A;  1QVT A;  5B5E C;  3EUH C;  3GFJ A;  2CG4 A;  2JPB A;  4ITV A;  2DFF A;  2ISZ A;  2Y0M A;  2MAB A;  2F5D A;  5L3D A;  1VQ4 I;  3O2P E;  3ERM A;  3QAH A;  5F1R A;  4P5O A;  5IYB J;  1X4O A;  3HSR A;  1P7I A;  1PP7 U;  1SVO A;  1I6H J;  4G7H F;  1YIO A;  2W48 A;  4MQV A;  2PJR B;  1JUS A;  1HSJ A;  2XHK A;  1V55 H;  2DMU A;  3GX4 X;  2ZNZ A;  4C30 A;  1XDU A;  2QGU A;  1FZP B;  5H6Q A;  3HRU A;  3J7A Y;  1K4S A;  5GAE J;  4J19 A;  2ECC A;  1MMD A;  4G8X A;  1FBS A;  4BL0 B;  3C3W A;  1UZC A;  3PQJ A;  3OYA A;  4H4K C;  1SMY F;  4YRV A;  2EA4 A;  4XON A;  3KE2 A;  1SFK A;  2XPU A;  1SD6 A;  2QVO A;  2ID3 A;  2ZME B;  5C4J J;  4W1U A;  2Z33 A;  5LFA A;  5EDN A;  1B8I B;  5GPC A;  4IQ4 A;  4X6A J;  4WF2 A;  3CJT B;  4RB0 A;  1X2N A;  3BG7 A;  4HBL A;  4LK1 F;  4KMF A;  1TTY A;  4BHC A;  2EV5 A;  3GTM J;  2K9Q A;  2VBY A;  1VQM I;  3VYU B;  3GYH X;  2X85 A;  4A3E J;  3RPU D;  1IN6 A;  3DU5 A;  1G59 A;  4E6K G;  4Q47 A;  3TP0 A;  3DP7 A;  2A68 F;  4B4C A;  2JSP A;  4EM2 A;  2BW3 B;  3B73 A;  3A01 A;  1HF0 A;  1MD0 A;  2KLO A;  3RKX A;  4ESJ A;  2KIS A;  1MBG A;  2LMD A;  2CW8 A;  1IRF A;  4UVA A;  3KCC A;  2VOP A;  4FE4 A;  4K2E A;  4RBO A;  4CYC B;  3BPV A;  1SD5 A;  4WXC A;  5E3M A;  1F4K A;  2MLG A;  5HLH A;  2UUZ A;  4KIT B;  3BR3 A;  4W97 A;  5DUI A;  4A3M J;  2KIQ A;  5L3B A;  4PUS A;  5E1X A;  5DDG A;  1D0X A;  2R7T A;  2OAZ A;  2M5W A;  4KIG A;  4MO7 A;  3ZQI A;  5LEJ A;  3CCY A;  3LWF A;  1JE8 A;  3BR2 A;  1MJB A;  3AG4 H;  5D5U B;  1ONV A;  3PSI A;  2RQP A;  1Z7U A;  2PMZ A;  1YIT I;  2FE3 A;  4XQF A;  4HYE A;  1ETV A;  5DUK A;  5K7H A;  5LEK A;  3UR3 C;  4EJO A;  3HC7 A;  3OYB A;  3FK7 A;  1UFM A;  4LGW A;  4FET A;  2FU4 A;  4AUX A;  3KZY A;  2KKO A;  2WAF A;  3CLO A;  1CGP A;  3A02 A;  2ELJ A;  2X4H A;  2RVC A;  5JHF A;  1W4M A;  2MH2 A;  3IAS 2;  3T5X A;  5F6F A;  5EG0 B;  3ZR8 X;  3L2R A;  4GDF A;  5GAG J;  4GYG A;  4Z2Y A;  1DQU A;  3K4J A;  5FRN A;  2DT6 A;  2OBP A;  5EZH A;  3CO7 C;  2H1L A;  2XB5 A;  1FJL A;  2DFI A;  2RGV A;  2EV6 A;  3LL7 A;  1BA5 A;  4U0W A;  3G73 A;  4RGU A;  1MBH A;  3V4G A;  5M5W J;  2HZT A;  2M34 A;  1HQC A;  2IS1 A;  2VN2 A;  4XKC A;  3FBI B;  4L0Z B;  2R5Y A;  5AIQ A;  3RSN A;  1MZB A;  4BAY A;  1X19 A;  3BR0 A;  1ON1 A;  3BLY A;  3BP8 A;  2HXO A;  1BI3 A;  4LG0 A;  5M5X J;  2KIU A;  4NQW B;  3RPU A;  2BVL A;  1VTN C;  4HEA 2;  4UV8 A;  4DQ2 A;  1Y8Q B;  3P5J A;  5FD5 A;  4XRS G;  1BC7 C;  2DOD A;  5FKO A;  1R1V A;  2JJ7 A;  1SC7 A;  5E18 F;  2QSH X;  2R7Z J;  2HVQ A;  3U2R A;  1HW1 A;  4D7N A;  4WXD A;  2ZFU A;  1WH7 A;  2EIL H;  2B0L A;  1DP3 A;  4XMY A;  4YFK F;  5L3E A;  1MSE C;  1FTT A;  1VF9 A;  3C1D A;  2AXT C;  5F0F A;  1FOX A;  3ZOB A;  5D4S A;  4QLC U;  2WAQ A;  3GUD A;  3IRQ A;  4BBS J;  5F0H A;  4OMY A;  3EUH A;  3WG9 A;  4ETS A;  5J1U A;  2V1X A;  3L09 A;  1YS6 A;  2M0C A;  4P96 A;  4B43 A;  3K2A A;  2VE9 A;  3JCU C;  4B48 A;  1SD7 A;  4BY7 J;  2AO9 A;  3JRI A;  3HRS A;  3N4M A;  2F4I A;  3CF2 A;  4A12 A;  2CV1 A;  2M4G A;  3QU3 A;  4M9S A;  4CCN A;  2GXB A;  1L0O C;  2E71 A;  2K7L A;  3ERE D;  3RQ4 A;  3S1N J;  1I3A A;  1P2F A;  3S16 J;  4A5M A;  3FWE A;  5LHH A;  4HNU A;  1WJD A;  3SZT A;  1E3H A;  4ON0 A;  2DA7 A;  3F8C A;  1ERD A;  4OIQ F;  3M1C A;  3PSF A;  1QGP A;  4G6D A;  2BOL A;  1GVJ A;  3Q0W A;  5CVI A;  3N97 A;  4UNO A;  4Q48 A;  2FNP A;  3FDY A;  2IBD A;  2E2H J;  1QZZ A;  2XGC A;  4PGG A;  4BUP A;  5F1J A;  3ESW B;  3F8M A;  2R3S A;  3E5U A;  4Y7N J;  3C2B A;  3BZK A;  2R7X A;  4LD5 A;  1DU0 A;  1ETX A;  1UST A;  5FD6 A;  4LB5 A;  1ZGJ A;  2KIF A;  1C0W A;  3ASO H;  1KQ0 A;  4S05 A;  1XSV A;  1JXS A;  2VPR A;  5BMZ A;  4ANJ A;  3TBI A;  4WWC A;  2MA3 A;  1YJW I;  1TP4 A;  3CUQ C;  3WTX C;  3OYC A;  2HKO A;  4IHY A;  2QQ9 A;  4G6Q A;  2CUF A;  2K9S A;  4KIC A;  2FX0 A;  1ETY A;  1S9H A;  1LQ1 A;  1EH6 A;  1EH8 A;  4DBR A;  2M3A A;  1R5I D;  2OPT A;  1LE8 A;  3LQR A;  2OZU A;  2QQ8 A;  3ZQL A;  1TWH J;  4HNT A;  3GEZ A;  4HDV A;  1LNW A;  1LKX A;  3IWF A;  3ROU A;  2L9N A;  3OYH A;  3GFL A;  2Q1Z B;  2A69 F;  3TOA A;  2ZB9 A;  2M87 A;  4DZJ A;  4LLN A;  1LVK A;  1PUE E;  1QQI A;  2JMW A;  3DFG A;  5C3E J;  1O3S A;  2WB1 A;  4BJ5 C;  3R61 A;  1Q1H A;  3P7N A;  5CLS A;  3ZXS A;  4I2O A;  2E7W A;  1LUJ B;  1BW6 A;  2DT7 B;  4I6Z A;  1F9N A;  2DOA A;  3QPS A;  4HLX A;  1IRZ A;  1KQ8 A;  1ODD A;  4Y33 A;  4A5N A;  4L18 B;  5LRR A;  3CLQ A;  1B6A A;  2DA5 A;  3P9I A;  4TV7 A;  3GCM A;  3H9J A;  5KCM A;  1T8I A;  2W1O A;  2O8X A;  1YO5 C;  1XCV A;  4S0H B;  3PQK A;  1VZ0 A;  2DMP A;  2RN7 A;  3ZMZ A;  1X3Z B;  1X1C A;  5DCM A;  1T38 A;  3VOE A;  1IUY A;  5K7F A;  2KIM A;  2BY1 A;  5CVJ A;  3K2Z A;  4RM2 A;  5DYM A;  2Q2E A;  3B6C A;  3FKJ A;  1X3U A;  4D0P A;  3BR5 A;  1QZE A;  4RAF A;  2CMP A;  3HZJ A;  4CYD A;  4XKW A;  1YJ9 I;  3F0C A;  1UEL B;  1RPW A;  2FQ3 A;  2IPQ X;  5ICE A;  3DEW A;  1HC8 A;  3JRE A;  3KIO A;  2HQ5 A;  3I59 B;  3PFY A;  3ZQ7 A;  4D9J A;  1OYY A;  3BG6 A;  4I76 A;  1G3W A;  3DU6 A;  2B9S A;  1JKQ C;  2LRD A;  1ZLJ A;  3IH3 A;  1W5C C;  3ZGK A;  4F93 B;  1RR8 C;  2WV0 A;  1PDN C;  2CUJ A;  3PUF A;  2BE5 F;  3G1M A;  2DDA A;  3HG9 A;  1W36 C;  3I56 I;  4DGW B;  1OLT A;  4EMS A;  3IP4 B;  4XLF A;  4OIP F;  1P9Q C;  2FF4 A;  4RGX A;  2FMY A;  4DYC A;  5A2Q Z;  3JTH A;  3I4P A;  1VQL I;  3TDU C;  2CFO A;  4CIC A;  1WRJ A;  3FHN A;  3CCJ I;  3W6J B;  3TW6 A;  3JAM K;  2O3F A;  3MCZ A;  5DV5 A;  1HBX G;  3AFH A;  1AHD P;  2K9N A;  3CC4 I;  4BU2 A;  1AWC A;  2E34 A;  2EA2 A;  1T39 A;  4I02 A;  3CCU I;  3I4N J;  3FKI J;  4GO1 A;  3BTI A;  3MKW B;  4XRF A;  1Y39 A;  4IQJ A;  4A3C J;  4HAM A;  5IOZ A;  2R7O A;  3BG3 A;  2JA2 A;  2HYF A;  1IRX A;  3QYB A;  5D5W B;  4IZZ A;  1X1D A;  2Z1D A;  3TL4 X;  2ME6 A;  2OV7 A;  2XRL A;  2TRT A;  4AM3 A;  1FOY A;  1X1P A;  3DTK A;  4A3L J;  2VQC A;  1USS A;  2D5V A;  1IN5 A;  2XDV A;  3H3V K;  3CC2 I;  3KYC B;  4RAY A;  1I27 A;  3CUQ A;  4E4H A;  5DEQ A;  4OAZ A;  2VBZ A;  2CQN A;  4XOT A;  3S1R J;  4F91 B;  1YJN I;  1LDK B;  4PZJ A;  4UHT A;  1HA8 A;  2BVM A;  1GXQ A;  2GOX B;  1XS9 A;  2DPD A;  2MSY A;  4EM0 B;  1IC8 A;  4LIV A;  4UVC A;  1MBK A;  5B1B H;  3L00 A;  3FHZ A;  3KYD B;  1D8K A;  2G9W A;  2P5L C;  4BDY A;  5ERI A;  2CJJ A;  2PG4 A;  5J8F A;  5L3C A;  1IDZ A;  2D1H A;  2E36 A;  2HGC A;  2Q0O A;  4DOZ A;  2L5Q A;  1PUF B;  3U1K A;  1R71 A;  2XGX A;  3DKX A;  3SXY A;  1YOV B;  1IGN A;  2VOD A;  2VJJ A;  3O8G A;  4X0G A;  5J6X A;  4EVI A;  4RLQ A;  2R5Z A;  3MAJ A;  2ZSH B;  1WKM A;  1OYI A;  2DK8 A;  4RLF A;  4BXX J;  2WAE A;  1O3Q A;  1S3J A;  4UXN A;  3LA2 A;  2WV1 A;  4HA8 A;  3RZO J;  1LJ9 A;  2X6Y A;  2P7C B;  1ITY A;  3DKW A;  1IO2 A;  1NG6 A;  2P7V B;  3L7W A;  4JBA A;  4WXH A;  3H35 A;  1TQP A;  2EIM H;  1D5Y A;  4HV5 A;  2NYX A;  1XD7 A;  2DYS H;  2QCO A;  3HUG B;  3JSO A;  4IXA A;  2FBK A;  4LB6 B;  3ZMV A;  2TDX A;  1X1A A;  4JX5 A;  4XKV A;  3OOP A;  5BQT A;  2XPV A;  1OYW A;  5KHD A;  1I5Z A;  2W00 A;  5F64 A;  1KU7 A;  5HNH A;  3DPU A;  1G2H A;  1Y1V J;  2Y0S A;  3HHG A;  3VDX A;  2VLA A;  1JHH A;  1BI2 A;  1UB9 A;  2VXZ A;  2ZXJ A;  3OIQ A;  5C44 J;  2X51 A;  5J8C A;  1OJL A;  2FBI A;  3DPL C;  4WX9 A;  2KDZ A;  1O7L A;  4ABZ A;  1V54 H;  2DQL A;  1EKE A;  1HW5 A;  2LF8 A;  5E1Z B;  2ZBK A;  1IF1 A;  2R7V A;  1GV5 A;  2K4B A;  3DKY A;  3KFW X;  2LRE A;  4GXO A;  5D6E A;  4A3I J;  1FY7 A;  2ISY A;  2DN0 A;  4L5J A;  2X1E A;  2A07 F;  3H92 A;  2ZXW H;  4BH9 A;  2A5W A;  2W7N A;  3M07 A;  2OQG A;  3P9K A;  2H09 A;  4XL9 A;  2VJI A;  3HOX J;  4QTR A;  3DTI A;  2STW A;  3HPG A;  4HV6 A;  4YG2 F;  4BBR J;  3CCE I;  4I98 B;  2VOO A;  2CFX A;  4RS8 A;  5FLX K;  1O7F A;  2ZJR F;  2O03 A;  2KDO A;  1ULY A;  2E7X A;  2VKV A;  3BCA A;  1MBJ A;  1RUN A;  3M9A A;  3QQA A;  4ENJ A;  4U87 A;  3SFZ A;  4JX6 A;  4NBQ A;  3FXU A;  5F0C A;  4BHP A;  1FOW A;  4G9Y A;  1ZTR A;  4JP0 A;  3VEP A;  1K7A A;  2MYS A;  2TCT A;  2VUM J;  2VBW A;  2JA7 J;  1MGT A;  1VQ6 I;  3Q0V A;  4A0Z A;  1BW5 A;  4IKF A;  1H9T A;  2CW0 F;  5E17 F;  4KIB A;  4XIC A;  5L3F A;  2R7S A;  1ZRF A;  4KDP A;  2F6C A;  5JVT A;  3FF5 A;  2FEZ A;  2OCE A;  3K0L A;  4XK4 A;  1ZR2 A;  2V6C A;  4ZTJ A;  4UUS B;  4NDL A;  2GBY A;  1WHU A;  5TIS C;  4MEY F;  2VB6 A;  4ENK A;  3CZ6 A;  2QUF A;  2K3P A;  3HTS B;  4LLL A;  3IRR A;  1S72 I;  2VJ4 A;  2QF7 A;  4Y3O A;  3OYD A;  1KU2 A;  1MDM A;  3UNG C;  5M3F J;  3CJN A;  2HQN A;  4E7S A;  5FKM A;  2R7U A;  1HOM A;  2O61 A;  2WWY A;  1IV6 A;  4RM3 A;  3OYI A;  5IT3 A;  3EET A;  1TL8 A;  1A35 A;  2FSW A;  3WTW C;  2NNN A;  2F4O B;  5IY5 H;  2HQA A;  3HBL A;  4PGH A;  2M7A A;  1ZEL A;  2OF7 A;  2P6S A;  4OU0 A;  1KZH A;  3BQY A;  4ESF A;  2QBY A;  5BPI A;  1YQA A;  2QSG X;  5CVR A;  1JI8 A;  2DMQ A;  1T33 A;  4A3J J;  4S04 A;  1EV7 A;  1JGG A;  2LBF A;  3D1N I;  2M9H A;  1OR7 C;  1LVA A;  2HZD A;  3WU1 B;  2UXN A;  3FMR A;  3QYE A;  3FMQ A;  4RAZ A;  4L9N A;  1VQO I;  3BPX A;  2M0M A;  2FRH A;  1OKR A;  3J7Z I;  3WTY C;  1GXP A;  4HX4 A;  1R00 A;  5ILS A;  3ZCO A;  1B4A A;  5JHU A;  1R58 A;  3M4O J;  3B6A A;  2FOW A;  4G6T B;  2E60 A;  2Y9Z A;  1JUM A;  1A04 A;  4L9V A;  3OS2 A;  2Y75 A;  1WJA A;  4L9T A;  1EA3 A;  2XF7 A;  3GF2 A;  3K4C A;  3ISP A;  4IHV A;  2VKE A;  4OOI A;  1S5L C;  1Z3Y A;  4A3F J;  5EJC A;  1HCR A;  3JR9 A;  1Y8R B;  2QZ8 A;  2ZNY A;  4CCM A;  4U88 A;  2RDP A;  2DOE A;  4AU7 A;  3COA C;  1QPI A;  3KPH A;  4KFC A;  2PFB A;  3ECH A;  1D3Y A;  3HGY A;  1VQP I;  4GFB A;  3FX3 A;  4BHB A;  1A6I A;  2HU9 A;  3PO3 J;  2XV4 S;  4MLO A;  1RET A;  3OSF A;  1I6X A;  2RC4 A;  2ME0 A;  3O3K A;  3MKY B;  4HQE A;  1FIP A;  2JSC A;  1IG7 A;  2VQH A;  2FNA A;  2L4A A;  3WTZ A;  4BE0 A;  2PJR A;  3IV5 A;  4BS9 A;  3IAM 2;  2FML A;  2R7R A;  3OR1 C;  2XAJ A;  3BG5 A;  5F27 A;  3CCL I;  1QU3 A;  3OYM A;  4I01 A;  1IDY A;  1ETK A;  3I3L A;  1A31 A;  4XNF A;  4XN0 A;  2QKL B;  3HEF A;  4LOC A;  4ZTF A;  4DIQ A;  3AL0 B;  3HOZ J;  4EJT A;  4ESB A;  4ZYD A;  3SEQ A;  1MNE A;  2E1M B;  1JKR C;  4ENM A;  1H88 C;  2KP6 A;  4B3A A;  2NVY J;  3JRB A;  4BQA A;  2M30 A;  1O4X A;  3U21 A;  1DPR A;  5CQG A;  2Y31 A;  2GXG A;  3A01 B;  1UAA A;  2YX7 A;  3MMY B;  1X1B A;  2HOT A;  2PX9 A;  3OYK A;  2X6X A;  4HW0 A;  4O6J A;  3R0J A;  2N8G A;  2BXZ A;  2XIG A;  4HF1 A;  3CJQ B;  4M72 A;  3I9V 2;  2YU9 J;  2DJN A;  1FLI A;  4BJT A;  2MC4 A;  3ZQF A;  3PFI A;  2B63 J;  4FQG A;  2XSJ C;  1MMS A;  2PMZ N;  1G3Y A;  1PVE A;  3DBR B;  3Q9S A;  3LAP A;  2JRM A;  4C2T A;  2CQX A;  3LSH A;  3WHC A;  5A2Q K;  3ECO A;  2IEK A;  2Q8K A;  3DLA A;  1RIO H;  3IKT A;  1E3O C;  1V5G A;  2CS3 A;  2DYR H;  2MC3 A;  3HOT A;  2LKS A;  1Z6R A;  4XKB A;  2CSO A;  3BJO A;  2L01 A;  3VSL A;  5IT9 Z;  2P81 A;  3GZ6 A;  2IGN A;  5E3N A;  1ZGA A;  3MZ8 A;  4EGZ A;  2C6Y A;  5EG0 A;  1K4T A;  2HYG D;  2NOG A;  2VQG A;  2RRE A;  5LGN A;  1QZY A;  2ADU A;  3BG9 A;  3E1S A;  2IGO A;  5HDN A;  2IA1 A;  2IA0 A;  1DGR M;  3GXO A;  2Y30 A;  1FPQ A;  5E8I A;  5IYD J;  2HPI A;  4OWR B;  4PFO A;  1R49 A;  1K78 A;  3E6M A;  3CDH A;  3VB2 A;  2VKH A;  4LIU A;  3NAR A;  1UHW A;  1JUP A;  2L4M A;  4JQF A;  5HLT A;  3RJP A;  2EH3 A;  2GIZ A;  3A4C A;  2BBY A;  3HIF A;  4B44 A;  1T0F A;  4ZZL A;  1H9G A;  2CRG A;  3PM1 A;  4CO8 A;  2HXI A;  1OR7 A;  5K5O A;  2HWV A;  2D45 A;  4KT5 C;  2A6T A;  1ETQ A;  4G94 A;  4EJU A;  1OCP A;  2LF7 A;  2H8R A;  3BOQ A;  2CUE A;  2QLZ A;  2KL4 A;  3GTP J;  2BYV E;  1R5H A;  1D1B A;  4UY8 I;  2LY2 A;  3G1O A;  4FE7 A;  4XM3 A;  1GUU A;  3TOB A;  1Q1V A;  4M9Z A;  2EZL A;  4HNV A;  5HVQ C;  2COM A;  2LVS A;  1LFU P;  3PIP F;  2HOE A;  2MG4 A;  3K9T A;  5GP9 A;  2VQL A;  5BNG A;  1XX5 A;  4CA0 A;  2WAQ N;  2JWT A;  4I99 C;  3GTK J;  2YPR A;  4XSX F;  4MTE A;  4CCK A;  1ZGW A;  2STT A;  1FEX A;  4CZZ A;  1QVU A;  2AQF A;  1VQ7 I;  3HRT A;  1Y0U A;  3D5L A;  1FP2 A;  1RUO A;  3VSK A;  5FO5 A;  3J7A O;  2L3D A;  4QSH A;  3AG2 H;  3IHU A;  2LKP A;  2FBH A;  3G1L A;  2HFH A;  3RTR A;  1XTA A;  1O3T A;  1BJA A;  1P92 A;  5H6R A;  3HHH A;  3NWS A;  5CVU A;  3PNV A;  4IJA A;  2V9K A;  2Z9O A;  3VYS B;  3AG3 H;  4HDU A;  4F7Z A;  3GWZ A;  2IP2 A;  3F8B A;  3BDD A;  5HS9 A;  2O6G E;  3L9F A;  1WSU A;  1W0U A;  1TQI A;  2LDU A;  2CYY A;  1KU3 A;  3ZN1 A;  2P5K A;  1GDT A;  1J0R A;  2CWE A;  2P5V A;  1ZG5 A;  3V8J A;  1ZG3 A;  2I5U A;  2H1K A;  4L5E A;  4XLE A;  2DFE A;  3K69 A;  3WU2 C;  3J7Y J;  1YIJ I;  4Y17 A;  2L9R A;  3CME I;  2F48 A;  2HYJ A;  2GAU A;  5DTD A;  3JRF A;  2Y9Y A;  3S14 J;  2G0E A;  3K4B A;  1J2X A;  3S2W A;  3V7C A;  2ZFW A;  5EEH A;  3GTG J;  4DW6 A;  1YI2 I;  3VWB A;  3VYT B;  4UUT A;  1QHG A;  4MGR A;  1REP C;  4M6V A;  4CCO A;  1S8N A;  3GVA A;  3S32 A;  2DK5 A;  2B7E A;  3M1E A;  1R9T J;  1WVR A;  4U7D A;  3F6O A;  1HKT A;  2BY0 A;  1D8J A;  2RNG A;  3S3O A;  1BOB A;  3BJ6 A;  2WB1 N;  2KRC A;  1D0Y A;  2W24 A;  5BOX A;  1B59 A;  3KLO A;  1FYK A;  1R7J A;  4MTD A;  1IZ1 A;  3FIW A;  2WA0 A;  3E0J B;  2RQQ A;  1IN7 A;  1E2X A;  3F22 A;  1YS7 A;  1X58 A;  1WJB A;  2VT3 A;  1BL0 A;  1MIJ A;  4EJV A;  3OWT A;  3MD2 A;  3F6V A;  3RIR A;  4F52 A;  4FX0 A;  1T08 B;  4B09 A;  2Y2Z A;  3KP3 A;  4BKX A;  2XKO A;  4PJ0 C;  5HOO A;  1LDJ A;  3SZG A;  3CCS I;  2GWR A;  5JFR A;  4HF2 A;  4IVN A;  3L2V A;  2COB A;  4XLA A;  2HDC A;  4BEH A;  3OYG A;  3T8R A;  2EFQ A;  5KVR A;  3J81 K;  1TW3 A;  2XRO A;  2HOA A;  3EDP A;  1WJE A;  2X9D A;  4Y4R A;  5DCM B;  3RDI A;  5DD4 A;  3WHB A;  3CDL A;  1JGS A;  1WH5 A;  1WI3 A;  2XAQ A;  1U9O A;  1J7K A;  3DTE A;  3MKL A;  2CW7 A;  4HSR A;  3M8F A;  1JT0 A;  2IVM A;  4YEJ A;  2D2W A;  4A0X A;  3A0B C;  5HDG A;  4E7K A;  2NOJ B;  3FZV A;  1FSE A;  5EGO B;  4PK4 A;  2HVR A;  2UWM A;  2EIK H;  2P0W A;  3HSF A;  3VPR A;  3C2G A;  3MFK A;  3ZMT A;  3JTG A;  1TQM A;  3BR1 A;  1DUX C;  5KAI C;  2HNH A;  1BBY A;  1Z77 A;  3H5N A;  4XLP F;  2XPW A;  1U3E M;  3E6D A;  2YU3 A;  3NQO A;  3PO2 J;  1R6R A;  1VND A;  5HS8 A;  3F8F A;  4YIR X;  1U5T B;  1I3Q J;  4F3Q A;  3A1Y A;  4ZDL A;  3IKV A;  4EGY A;  1P4X A;  1R4M B;  1CQT A;  4N4N B;  3CC7 I;  4IOA F;  2RV8 A;  4JYK A;  5CYV A;  3LNQ A;  4AYB A;  1FX7 A;  4ZYH A;  3ZPL A;  1YYV A;  4U0V A;  2XAH A;  1FNN A;  3WU0 A;  4M3F A;  4EQQ A;  1AKH A;  1H0M A;  3TP3 A;  4IF4 A;  3ZQC A;  3T0Y A;  1LEA A;  1R1U A;  1BIA A;  2DOF A;  5ICG A;  3WOD F;  3E5X A;  4IRH A;  2ZC2 A;  2BY3 A;  1OCR H;  4II3 A;  4A0Y A;  4UB6 C;  3MZH A;  2RKH A;  3PUB A;  5IYC J;  2OD5 A;  3IL2 A;  4NNJ A;  1LFP A;  1Y6I A;  3I71 A;  3A03 A;  2L9V A;  2CQQ A;  2O5R A;  4PCQ A;  3M3Y J;  2H27 A;  3L1P A;  3H3U A;  3ZN0 A;  2O7O A;  5KK1 A;  1K83 J;  3ABL H;  3EQL F;  2EZH A;  2X6W A;  2K9L A;  3T8T A;  3R0A A;  3DEE A;  1B9N A;  4PJN A;  1ZRC A;  2XSD C;  1TWA J;  4N9I A;  1TWG J;  5EZG A;  3D0S A;  1UG2 A;  5HS7 A;  5CVV A;  4JOM A;  1X2M A;  2DMN A;  3JSP A;  2V9V A;  3ZQQ A;  3OYF A;  3UKG A;  2EBI A;  1BR4 A;  4LJZ F;  3ML6 A;  1T95 A;  1V4R A;  1VQN I;  5CQE A;  1QRY A;  1V3F A;  2I10 A;  1BC8 C;  5TRD A;  1R4N B;  4XOP A;  5IOY A;  1UMQ A;  4EV0 A;  2YUS A;  2A05 A;  5J1Y A;  4XN3 A;  2NVT J;  4KIS A;  1K61 A;  3KET A;  3ZMU A;  3SZP A;  3OSG A;  1MH4 A;  4YII A;  2F5C A;  2EFP A;  3ABT A;  2E2I J;  5D5V B;  1U0J A;  3JRA A;  3CUQ B;  5H2F C;  2BY2 A;  2DTZ A;  1Y0N A;  2HTS A;  3ULQ B;  1BOA A;  3LA3 A;  1TNS A;  1XGS A;  2ELK A;  1BR2 A;  2V7F A;  2JUG A;  4RA2 A;  3JRH A;  2UV1 A;  3GLX A;  4CGZ A;  6PAX A;  2F5E A;  1D0Z A;  4BE1 A;  3SDB A;  3LSM A;  1UHM A;  1WWX A;  1FIA A;  4DZP A;  2PN6 A;  2HR3 A;  4ZDO A;  1YW9 A;  3MVP A;  3FM3 A;  2FQ4 A;  4IPA A;  4KN4 X;  4XLN F;  1SAU A;  3TO9 A;  5ILU A;  1CF7 A;  2EIN H;  2BV6 A;  2NS0 A;  2K5C A;  3TKY A;  1JHF A;  4AIH A;  3DF8 A;  1Z05 A;  2DA6 A;  3BRO A;  3HYI A;  3FK6 A;  2VON A;  4OMZ A;  3OL3 A;  4NC8 A;  5EEG A;  4ZZD A;  4LK0 F;  1ZN2 A;  5FKL A;  2R5Z B;  3QRF F;  4QPQ A;  4HST A;  1XGO A;  4IHW A;  3DPT A;  1U6G A;  2IW5 A;  1J09 A;  2FOK A;  4I09 A;  5HDK A;  4EM1 A;  1N25 A;  3HXL A;  1QNT A;  4CDG A;  2VBX A;  1MW7 A;  2GOM A;  2V79 A;  3E6C C;  1WJ5 A;  2Y0S N;  5B3S H;  2FJ1 A;  2JPC A;  3I53 A;  3WTU C;  3F23 A;  1ZRD A;  3A2K A;  1TWC J;  4XOR A;  3NRV A;  3I5U A;  3M8E A;  3OOU A;  3DQV C;  2R0Q C;  1WJC A;  2A6H F;  2LNB A;  2YSR A;  4CXF A;  2OU2 A;  2Z16 A;  2ZJ2 A;  1GVD A;  2AXL A;  2IGK A;  5E79 C;  4HF0 A;  3BZC A;  4IEJ A;  2LYC A;  2L0K A;  3ELK A;  3LOC A;  5IP7 J;  5IT9 K;  4PSX A;  1OPC A;  3S15 J;  5F08 A;  2ZME C;  1QHH D;  1IRG A;  1TWF J;  3TW7 A;  1TW2 A;  2MFZ A;  3K1N A;  2QSF X;  5TGT A;  4MHG A;  4EEF G;  1HDD C;  2IRF G;  5IP9 J;  3T1B A;  5B66 C;  2JUC A;  3HTU A;  5BS6 A;  3FXO A;  1IJW C;  1OCO H;  4MQ9 F;  2LP0 A;  1YW8 A;  4ZJZ A;  3S2D J;  2BHY A;  1L3L A;  2Y48 A;  4PDK A;  4CCL A;  2LD5 A;  2EWN A;  3U9G A;  1MSF C;  2DCE A;  2V1D A;  2E1M C;  5E20 A;  2LC2 A;  3QWL A;  1V5E A;  3LSP A;  1B72 A;  3KYL A;  1MNM C;  4AVP A;  3OYL A;  1VQ5 I;  2DAO A;  2YX4 A;  3G71 I;  3RKW A;  2A5Y B;  2EJR A;  3Q3S A;  5LHI A;  1P6R A;  4F55 A;  1BR1 A;  3K4N A;  5D8L B;  4ENN A;  2JN6 A;  4MFD A;  3QYF A;  3QPL A;  4RDU A;  4B1R A;  1OIS A;  5H20 A;  4Z6Y A;  2M7B A;  2MD5 A;  2CQ7 A;  3W2W A;  1YHQ I;  1N78 A;  5FLM J;  2JA8 J;  2ELH A;  1D1C A;  2LLK A;  1SFE A;  3KP2 A;  1RC9 A;  1OFC X;  2W4S A;  2EK5 A;  5HNF A;  4XRM A;  1AOY A;  1YG2 A;  3K4K A;  1FYL A;  3VYR B;  1F5T A;  2L54 A;  1RKT A;  3GZ5 A;  2E1N A;  2QWW A;  4R1H A;  4IRI A;  1Z9C A;  3TQN A;  3P9C A;  2X48 A;  1EF4 A;  3GFM A;  4RB1 A;  5DCF A;  2VC1 A;  1H89 C;  4UUS A;  1MMA A;  5FKK A;  2VI6 A;  2MGQ A;  3HSE A;  1VQK I;  3FM5 A;  2F2E A;  1BJZ A;  3GME A;  1G6N A;  1G8X A;  1YX5 A;  3CJR B;  1HKQ A;  2HVS A;  3LSI A;  1ZLK A;  4KJZ A;  4OAY A;  4LIT A;  3SYT A;  2ICW G;  4IOC F;  1I50 J;  4E70 A;  3CUO A;  1WZ2 A;  1WCM J;  4HZF A;  2LSO A;  1FT9 A;  1XG1 A;  4PJM A;  1YRN B;  1T0F C;  5JVG F;  1LB2 A;  4RB3 C;  3WTS C;  2DA1 A;  1XMK A;  5FFZ A;  2QBY B;  4CSW A;  5ICF A;  4BAC A;  4BNC A;  1R1T A;  1W0T A;  4Q5S F;  1U8B A;  3WE3 A;  2ZJQ F;  3OR2 C;  3GW2 A;  3OIO A;  4CUG A;  2HEO A;  3HOW J;  1LEB A;  2HQR A;  2WY8 Q;  4P9U A;  2KRF A;  2PMU A;  1VFC A;  4FT8 A;  1VQ8 I;  1E17 A;  4U0Y A;  4DBQ A;  2R7Q A;  2VC0 A;  1W7P B;  3O6B B;  4UVB A;  2DXI A;  4DJA A;  1JTY A;  5K5R A;  2E1O A;  1BI1 A;  3JAM Z;  5EF6 A;  5E1W A;  2ZO4 A;  4V2F A;  4L9J A;  3N05 A;  4A69 C;  4BDZ A;  1HST A;  2ZCW A;  4C2U A;  4YFX F;  4M3D A;  2NS8 A;  4HG2 A;  1T6S A;  2EV0 A;  2K02 A;  3FMS A;  4FHT A;  2CV0 A;  3AAF A;  3JRG A;  2H6C A;  2XB0 X;  1IV8 A;  3H36 A;  3K7A J;  2A6E F;  1I39 A;  4J01 A;  3CP8 A;  2EIJ H;  4HX8 A;  5CJ9 A;  1FBQ A;  1A6Q A;  4ZC3 A;  3HOS A;  2L02 A;  2RNJ A;  1XB4 A;  3HDD A;  2XF6 A;  2FXA A;  5D4R A;  3TED A;  1AU7 A;  4ZYA A;  1TNT A;  3I58 A;  1YLF A;  3BWG A;  4AIK A;  3E6B A;  3TO7 A;  3R4K A;  4KMU X;  4HQM A;  5CKT A;  1Z21 A;  4YIF A;  3CMY A;  3ASN H;  2GA1 A;  4LLG F;  2ZME A;  4FIS A;  1JT6 A;  1R5G A;  5JLX A;  4YFN F;  5JI6 A;  2QA4 I;  4CHU A;  1B8I A;  2OTJ I;  2R7F A;  3EPZ A;  5M3M J;  1MND A;  2OZ6 A;  2GQQ A;  1JTX A;  1GT0 C;  1WJF A;  3TDZ C;  1XGM A;  4AWX B;  5J47 A;  4R79 A;  2H6B A;  4YEL A;  2G7U A;  4HRI A;  5GTH C;  4XLC A;  4XLH A;  2BW3 A;  1DGW Y;  3RPQ A;  2DDB A;  2KRH A;  1IN8 A;  4PSW A;  1ZQ3 P;  2MBF A;  3H0G J;  2IT0 A;  4QWQ A;  1G4D A;  3HKZ A;  3CD6 I;  3EYY A;  3HKZ N;  4PFP A;  4CYC A;  3HOY J;  4CZC A;  5FRM A;  1ETW A;  2IA2 A;  2JTV A;  2E1C A;  3ONQ A;  2K9M A;  4XR6 A;  2BGC A;  2KHM A;  2YS9 A;  1HW2 A;  1NHA A;  2ID6 A;  3OYN A;  2FD5 A;  4FCY A;  3KZZ A;  4FX4 A;  3KEQ A;  3NWT A;  2EZI A;  1POG A;  1MMN A;  2MLK A;  3LSG A;  4P1W A;  5DS9 A;  1FWZ A;  4KN7 X;  4B8X A;  3OYJ A;  1W5S A;  4BE2 A;  3MEX A;  2JVG A;  1FSH A;  1VQ9 I;  1RI7 A;  2PBI A;  1X3W B;  1STZ A;  2L7M P;  2DA2 A;  3CCM I;  3FXL A;  4OIR F;  3F72 A;  2KFD A;  2X1D A;  3WTV C;  1IN4 A;  1IW7 F;  2ACJ A;  1W1W E;  2F5F A;  2EZK A;  2CUZ A;  3SFI A;  1K79 A;  3OY9 A;  3I0T A;  3H3Z A;  4V19 K;  3GTO J;  4XBF A;  2AS5 F;  2OJE D;  2ECB A;  4Y52 J;  3F8N A;  2DT5 A;  3K10 A;  4HPQ A;  5CPR B;  3SEZ A;  3RYP A;  3M8J A;  3V7S A;  1O3R A;  4BY1 J;  3HOU J;  3H9G A;  1LPQ A;  3KP6 A;  2L9S A;  3CES A;  2HKX A;  3ZQH A;  2GXA A;  2L7Z A;  2GA2 A;  1MKM A;  1ON2 A;  3F21 A;  3DLL F;  3OL4 A;  4AID A;  2LTP A;  1ZRE A;  4C2M J;  1ZAO A;  1PYV A;  1TT5 B;  5E3O A;  1KON A;  2V1N A;  4M3B A;  3S1Q J;  4GRI A;  2IGM A;  1K78 B;  4RGS A;  5LGT A;  3QOP A;  2R5Y B;  3GBG A;  4R8H A;  1QBJ A;  3MWM A;  5E8G A;  3C18 A;  3KEY A;  5KAF C;  4AC0 A;  5FLX Z;  4LG0 B;  2A3S A;  4IO9 F;  2OA4 A;  3HRM A;  3AKZ A;  4NQW A;  4JK1 X;  2O0Y A;  2M8G X;  5C4X J;  4BJ6 C;  4A3G J;  1RRJ A;  2KT0 A;  5BPD A;  3KP7 A;  1I1S A;  5GPA A;  1FYM A;  3L2Q A;  3EYI A;  1EH7 A;  2QKM B;  1N75 A;  3L2W A;  2CV2 A;  2E5Z A;  5D8K B;  2VT2 A;  2YR2 A;  2LFB A;  3K4M A;  1U5T C;  3LST A;  1SMT A;  2CQK A;  1XCB A;  1KYW A;  5DM6 F;  1XC5 A;  2LG4 A;  2L7K A;  2QYO A;  1B9M A;  3TMO A;  1Z6T A;  1IXR C;  2KMU A;  2ZXI A;  2EFN A;  3S8P A;  1DP7 P;  3C7J A;  2CU7 A;  2XGD A;  2KZG A;  1HXD A;  3LA7 A;  3KP5 A;  2VJ5 A;  2JZY A;  4RMN A;  2DI3 A;  4U7B A;  4A3D J;  1WI9 A;  2M2E A;  1OMI A;  2DLL A;  2NS7 A;  3S2H J;  2V9P A;  4N0B A;  4A93 J;  3R6S A;  1PJR A;  1D5V A;  2GIV A;  3M7G A;  1OCC H;  1IUF A;  2J5O A;  2AQE A;  2QQA A;  1MH3 A;  4D5F A;  3BZ6 A;  3QOE A;  3OMY A;  5L3G A;  2DO7 A;  2R93 J;  3GFI A;  1RES A;  3RKY A;  2V6E A;  3S93 A;  1FMW A;  2XUB A;  2MD0 A;  2QM3 A;  4C3H J;  4D7M A;  3WGI A;  4NB5 A;  2WC2 A;  1JKP C;  3B02 A;  3I64 A;  3J80 Z;  2W85 A;  3CQZ J;  3PJR A;  1H8A C;  1MBF A;  1MBE A;  2P6T A;  2JQ7 A;  4C3I J;  2IJL A;  4AD9 A;  3LFU A;  3V8L A;  1R22 A;  4M6Y A;  5LLQ A;  1XSX A;  1YE9 A;  1U9N A;  2FUG 2;  4M3G A;  2XAS A;  2JA5 J;  2F4M B;  4FTH A;  1K6O A;  2CGP A;  3F3X A;  2ETH A;  5IPA A;  5E3L A;  2IS4 A;  1T56 A;  3Q0U A;  3W6K B;  3BTL A;  1GHC A;  2K85 A;  1LE8 B;  2KQR A;  2HTJ A;  1NH3 A;  5LD2 C;  3S1M J;  4O5V A;  3KEO A;  4DYR A;  2HDD A;  3QPH A;  2PQ8 A;  3X2Q H;  4N9H A;  2P4W A;  4AVZ A;  1XDS A;  2XKP A;  4BGD A;  2NNY A;  1S6L A;  5J40 A;  3LSK A;  4MEX F;  2KZV A;  4I0A A;  2GLO A;  2JA6 J;  4A6D A;  3ZMS A;  1JJ6 C;  3DBH B;  1WPK A;  4E7L A;  3NAU A;  4M71 A;  3LSJ A;  2DU9 A;  1JKO C;  1KA8 A;  5J4Y A;  1F43 A;  1UJ8 A;  2KPM A;  3DWL E;  3HB9 A;  2R92 J;  2O9L A;  3PNY A;  2UXX A;  1UCR A;  1OQY A;  5FJ8 J;  3MN2 A;  1J9I A;  1QPM A;  2E35 A;  1HKS A;  4M74 A;  1KYZ A;  4G7O F;  3OYE A;  2E2J J;  2X1C A;  3BCB A;  4E7Z A;  3RI4 A;  1ETO A;  2CO5 A;  1XMX A;  3BQZ A;  3C2H A;  3CMM A;  4X1E A;  1N77 A;  3DV8 A;  4NC6 A;  3FXK A;  5K7Z A;  3E97 A;  2BXY A;  4CH7 A;  1FOK A;  4NC7 A;  2NAZ A;  2DBB A;  1RKW A;  2EPF A;  2LH9 A;  2XGE A;  4M6X A;  4M73 A;  4BEH B;  9ANT A;  1NG7 A;  1GLN A;  2WY7 Q;  2WTE A;  2Q2E B;  5ILV A;  1ZHF A;  3GO5 A;  3CDI A;  3JRD A;  2VE8 A;  1P4A A;  3HOV J;  3D5S C;  3HJE A;  5GAH J;  4ZYE A;  1JJ8 C;  4A6E A;  1DU6 A;  2X0L A;  2W25 A;  4XID A;  3WE2 A;  4ZDP A;  2LR8 A;  2OC6 A;  2OCC H;  3I59 A;  2L7F P;  2XRN A;  5EGO A;  4C9Y A;  2V1U A;  2HDW A;  4H0E A;  4OIO F;  4E7H A;  2ZJP F;  4GCV A;  1P7J A;  2OTL I;  4GYI A;  4GGG A;  4WK8 F;  3OS0 A;  2V26 A;  2BZT A;  1YTY A;  5J3L A;  2KJC A;  3SJM A;  2GM4 A;  2JRT A;  4AYB N;  1NTC A;  1U5T A;  1YX3 A;  1RNL A;  3BTC A;  3OIP A;  2MW8 A;  5F04 A;  4C3J J;  4NHJ A;  1AA7 A;  2M8E A;  3A0H C;  2XVC A;  1NK2 P;  2PLY A;  2QEX I;  1ZYR F;  1J75 A;  2VAS A;  3S3M A;  1XGN A;  3D5R C;  1AKH B;  3K6G A;  4DYQ A;  3DXJ F;  3IUO A;  2EFW A;  3K1M A;  3VOD A;  3G6E I;  4LG3 A;  5LRS A;  4G7Z F;  2Z2S B;  4A2U A;  2M4K A;  2RAE A;  4DNC A;  3S3N A;  2IS6 A;  2DFH A;  4KNY A;  1TBX A;  4PJL A;  3HL2 A;  3V7R A;  4QIW N;  1D1A A;  3I4M J;  3W6V A;  4AIJ A;  4L0Y B;  3LSR A;  4G12 A;  2IS2 A;  4B47 A;  2QQB A;  5JLW A;  3GTL J;  5DM7 F;  4EAT A;  5AON A;  2K86 A;  1ZK8 A;  3GZN B;  3ZMD A;  3RKQ A;  3IH4 A;  1K6Y A;  2XC7 A;  4MNU A;  4BXU A;  3W3C A;  3R60 A;  4IL6 C;  3DEU A;  2R4G A;  1Z7L A;  1BI0 A;  5FLV A;  1E3P A;  2L2O A;  1ZR4 A;  5ED4 A;  1X4P A;  4IHT A;  2F5V A;  3AG1 H;  1M1E B;  1RR7 A;  4JX4 A;  2DTR A;  1P4W A;  4EJW A;  1IAW A;  4QPO A;  3GTQ J;  1KGS A;  5K1Y A;  2QEN A;  2JVH A;  3K1P A;  1RZ4 A;  4L5I A;  5HLI A;  1ZKG A;  3W2V A;  3U1D A;  5TJJ A;  2OUM A;  3K70 C;  1S7A A;  5FKN A;  1J59 A;  3ZP5 A;  1QA6 A;  4I0B A;  3CP2 A;  3V8K A;  4UV9 A;  1WFX A;  2K3F A;  2NVU B;  3JW4 A;  2Z99 A;  2JT1 A;  3KZI C;  1MJ9 A;  4IHS A;  1J5Y A;  2ZXH A;  3FIS A;  3IWZ A;  3RZD J;  1OCZ H;  4KYW A;  4LFU A;  2VL8 A;  4BQO A;  4BQQ A;  1KU9 A;  4RAG A;  2DMT A;  3OS1 A;  2Z3Y A;  3I54 A;  1XMA A;  4V2G A;  1PUF A;  1W36 D;  1LDD A;  3MKZ A;  1BIB A;  1IXC A;  4RGR A;  2EB7 A;  1SVM A;  1YW7 A;  5D5X B;  1FP1 D;  1T98 A;  2DA3 A;  1CF7 B;  1U78 A;  5EYR A;  3BJA A;  4BYY A;  3W2A A;  1F36 A;  3F9K A;  5J1R A;  2HS5 A;  2OQR A;  1SD4 A;  1XPX A;  4MIM A;  3HM5 A;  3KLN A;  4Y15 A;  3QPT A;  2HPM A;  2VPL A;  1KQ9 A;  5HLG A;  4WCG A;  1A36 A;  3FXQ A;  1ACI A;  2DJI A;  3KP4 A;  3L2C A;  3ZQG A;  3WTT C;  2BHZ A;  2DA4 A;  1HDP A;  3WGH A;  5IP6 A;  2LKX A;  2MH9 A;  3HUG A;  3IC7 A;  4ZH4 F;  4CCJ A;  3CCQ I;  2KJB A;  2R7W A;  1TT0 A;  3KX2 A;  1SFX A;  2DW4 A;  2M45 A;  3LMM A;  3H1C A;  3BY6 A;  4HLY A;  2WAD A;  3S17 J;  2EFO A;  2PJP A;  5ICC A;  1W5T A;  5FB2 A;  2EQR A;  3REO A;  1BN5 A;  5D6F A;  1R23 A;  3I55 I;  1EJ9 A;  3CO6 C;  2H8W A;  3CCR I;  2J5P A;  2P8T A;  3E7L A;  5FFX A;  3K70 D;  3ZRG A;  3V42 A;  1G3S A;  4IX7 A;  4E7J A;  4M3E A;  3L2U A;  1HLV A;  4MFE A;  4XRS A;  2V4J C;  2NRA C;  3EUK L;  4A3B J;  3NEU A;  3GLL A;  4KT6 A;  2NXN B;  3QOD A;  1S7E A;  3FXR A;  2DPU A;  1UHS A;  2H94 A;  1VI0 A;  3AL0 C;  2XAG A;  3H5A A;  3FBN B;  2X6O A;  1Z1D A;  1U2W A;  1E0E A;  4UB8 C;  2VIX A;  1FC3 A;  3ABK H;  3O8H A;  1TC3 C;  1IXS B;  2DQR A;  1WQ2 A;  4HX7 A;  1DDN A;  4F92 B;  1S29 A;  1TZL A;  2R7D A;  1LFB A;  5DD8 A;  2W82 A;  4OIN F;  2UZK A;  4II2 A;  4BXF A;  2XAU A;  4XSZ F;  1B72 B;  4P9F A;  1BM9 A;  3QP6 A;  2LY1 A;  3QP5 A;  1MMG A;  4PJJ A;  2ZSI B;  4Q4Z F;  1WGX A;  4A3K J;  2ZKZ A;  2HOS A;  1YFH A;  1W7P D;  5EEA A;  1SFO J;  1TLH B;  3OV8 A;  1SAN A;  2NVX J;  1GV2 A;  3WGG A;  1SAX A;  3H9Q A;  4O3M A;  5J4V A;  4HOB A;  4M9X A;  3LAJ A;  3K4L A;  4RB2 C;  3LQQ A;  1UG0 A;  1U8R A;  5GTI C;  2XAF A;  4ZYG A; 
#chains in the Genus database with same CATH homology
 2LMD A;  1MIJ A;  1XPX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...