2ELHA

Solution structure of the cenp-b n-terminal dna-binding domain of fruit fly distal antenna cg11849-pa
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
87
structure length
87
Chain Sequence
b'GSSGSSGMNIRMGTKGKRPLRSLTPRDKIHAIQRIHDGESKASVARDIGVPESTLRGWCKNEDKLRFMSRQSATDNLCADALGDKMD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CG11849-PA
publication title Solution structure of the CENP-B N-terminal DNA-binding domain of fruit fly distal antenna CG11849-PA
rcsb
source organism Drosophila melanogaster
molecule tags Dna binding protein
total genus 11
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2007-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04218 CENP-B_N CENP-B N-terminal DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2elhA01
3EYIA 5HOOA 5L3DA 3DV8A 4LK1F 1RI7A 3FM5A 2M5WA 1W5TA 3ELKA 2TDXA 3JSOA 1IN5A 2O03A 3M8EA 3GEZA 3VEPA 2QENA 4WF2A 2ZKZA 2P5KA 3AAFA 4CICA 1KGSA 4PGHA 2HKXA 3BDDA 2XV4S 2HQRA 4RGXA 4XLNF 2PLYA 3HSRA 4QWQA 5FGMA 1V3FA 1YS6A 2FE3A 2KRFA 5IT9Z 4XBFA 3L09A 1QQIA 2NRAC 1XMKA 5DUIA 2BE5F 2FMLA 3RI4A 2NS0A 2V9VA 4DNCA 4LGWA 1U2WA 3CO6C 1PUEE 1ZLKA 3HTSB 3QPTA 4BHBA 1D8KA 4B8XA 3ULQB 2DAOA 1WKMA 1LQ1A 4S05A 2K27A 4RGRA 2JT1A 2Z5UA 4HBLA 4BNCA 1DP7P 3WGHA 4TV7A 3T8TA 1EH8A 1HW1A 2GAUA 1YLFA 1J9IA 4FX0A 1ZG5A 2YU3A 5E8GA 4AIJA 3J81K 1P4AA 4KN4X 4YFKF 1NHAA 4L0YB 1G3TA 1OR7A 1R36A 4G7OF 4A0XA 3MZYA 3BPVA 3LQRA 3DKWA 3LQQA 2CO5A 5HDGA 4U0YA 2FSWA 1BI3A 1YTYA 3E5QA 1E2XA 4AWXB 3HSEA 3R60A 4R79A 1D5VA 4N9IA 5HS9A 5F64A 1P4XA 2PBIA 5ICGA 1QZYA 1K78A 3F21A 2DTRA 4IPAA 1DUXC 1DPRA 1O3QA 1OYYA 1R00A 3G73A 3GO5A 2L02A 3KFWX 4L9TA 3GZ6A 4KIBA 1BOAA 4N9HA 4YIIA 5DV5A 1CGPA 2VOOA 1FYKA 4UUVA 1HSTA 3NRVA 2Q0OA 5BS6A 1ODDA 4WK8F 1MKMA 4JK1X 3HHHA 2EFWA 2W57A 3CUQA 4KIGA 2RKHA 3F22A 3OV8A 3KCCA 5BPIA 5F6FA 1IXRC 5AIQA 4MEYF 2IA0A 1ZGJA 1FX7A 3GW2A 3LA7A 3SXYA 3CTAA 3K1NA 3TDUC 2F5FA 5E1XA 2OBPA 3ZMSA 1U78A 3K1PA 1IXCA 1FLIA 4OIRF 4GGGA 1I1SA 3WG9A 3GLXA 3HUGA 1I6XA 1Z9CA 1LDDA 4KDPA 1DDNA 3J81Z 4PDKA 1BI2A 2OZUA 2RGVA 3J7AO 1VTNC 4Q4ZF 4U7BA 3TOAA 3KZYA 2CW0F 1I27A 2R7FA 4ETSA 6PAXA 4Q48A 1QBJA 5HLGA 1KYWA 1ONVA 2E1NA 1Z6RA 1K79A 2O61A 3MZHA 1BIBA 5L3CA 2RN7A 1R5HA 3V8LA 3L00A 3SFZA 1T2KA 2XAHA 4M74A 3RPQA 5FO5A 1J5YA 1G3YA 1J59A 3JAMK 1MGTA 3L9FA 1MDMA 3D5LA 3P7NA 4EVIA 3LA2A 1HQCA 4NHJA 3QU6A 2Z3YA 2FBHA 5FFZA 4ON0A 3Q9VA 1HXDA 4LB5A 4WWCA 1O57A 2EWNA 4EM2A 3F23A 3F6OA 2HZTA 2VT2A 4A6EA 2FOKA 3BWGA 1S6LA 1ZARA 1J7KA 4ENMA 2RNJA 2P6TA 5ERIA 2A07F 1WRJA 4FHTA 1O7LA 2VBYA 1FSHA 5K1YA 5CVIA 4AIKA 4OMYA 2FF4A 4F7ZA 2OD5A 3BY6A 3WGIA 1Z05A 4WXCA 3DQVC 4XRFA 4ZYEA 3TGNA 5DD4A 2H6CA 4IXAA 2XGXA 3EUHA 2ZXJA 2BV6A 2LKPA 1H9GA 4HQMA 3O3KA 2LNBA 2M1BA 2LF7A 2QWWA 4FX4A 1YW7A 3VODA 1BI0A 1USSA 2VBWA 3JSPA 2Q2EA 5JFRA 4YFXF 1I1GA 1K7AA 1IF1A 3KP7A 2DT5A 1BM9A 3M9AA 3KP5A 2ETHA 1YFHA 4Q5SF 1K78B 3NQOA 1ZG3A 4IHTA 5D8KB 1JGSA 4ZYDA 4KN7X 2WV0A 3BPXA 2KKOA 4UVCA 4IJAA 4EMSA 1FSEA 4GCVA 1Z1DA 3BJOA 5HS7A 3M7GA 3I5UA 1DPUA 5LGUA 5BMZA 2DQLA 5DDGA 1C0WA 4AVPA 1W5SA 3FMSA 2NAZA 2YPRA 3FHZA 2HOEA 3LSTA 2CSOA 2BEOA 4G7HF 3TOBA 4MGRA 2MD5A 4WCGA 3IKVA 4B09A 4CO8A 2L4MA 5ICEA 4MNUA 5FFXA 2K02A 1IN6A 3HIFA 4MQ9F 3B02A 2A6HF 4HW0A 4JQFA 1LB2A 3BZ6A 2CYYA 5HDKA 4R8HA 3JW4A 5E1WA 4O6JA 2HQNA 2IVMA 3BROA 3F8BA 2FQ3A 3HTUA 1FYLA 4OIOF 2JPCA 3IL2A 2ELHA 4CZZA 3V7RA 2X0LA 5K5OA 3KE2A 5LLQA 1P4WA 3F8CA 2DPDA 4U88A 1R7JA 4P9UA 4L18B 2FNAA 4HDVA 1MJBA 3WU0A 2CFXA 2P7CB 1USTA 1V4RA 4HYEA 4I01A 1MJ9A 1QPMA 2EFOA 4GXOA 3LWFA 3WTVC 1SFUA 2QBYA 2ZJ2A 2HR3A 4K2EA 1BN5A 3RDIA 2V79A 4GO1A 3B73A 3TKYA 2UXNA 1GHCA 2VONA 1JHHA 1FC3A 2YX4A 3HRUA 3R0AA 1MDMB 2EA4A 4EV0A 2D2WA 2VN2A 3SHFA 2WC2A 5LGNA 2STWA 1TQPA 4KICA 1BIAA 2FMYA 4OOIA 2ACJA 4I98B 2FEZA 3PQKA 1KQ0A 2J5PA 2HTJA 3KEQA 4BHCA 5ED4A 4IF4A 2GWRA 3ZP5A 2M45A 5LBQA 1QNTA 3MWMA 5D5XB 1FP1D 2FRHA 4EJVA 2F5CA 2H6BA 1LNWA 3I58A 2IA1A 1B9NA 2MC3A 2X4HA 1HKSA 4HF2A 3HRMA 3K0LA 5HLHA 3JTHA 1YIOA 3FF5A 1UHMA 1GVJA 4ZH4F 3GFLA 1OKRA 1OPCA 3FXRA 1A04A 2CG4A 3WTTC 2EV6A 1ON2A 2H09A 1O3SA 5ILUA 3MFKA 4G94A 2HTSA 2OAZA 4RGSA 2M87A 4LLLA 3QRFF 3EYYA 2NNYA 1SD5A 3V7SA 1KA8A 4BAYA 5DYMA 1OMIA 4LK0F 4HF0A 1IZ1A 2QQAA 4UVAA 3RIRA 2V1UA 2Z33A 2L01A 3WTSC 1T0FA 2OQRA 2M30A 2ESHA 1XB4A 2VC0A 2EA2A 5DCFA 2G7HA 1HKTA 1QGPA 5HDNA 2XKPA 1XDSA 1J0RA 1BJAA 1WI9A 1D8JA 2VBXA 1ZN2A 4UHTA 4PZJA 3O6BB 5D5VB 4EGYA 3EQLF 2H94A 5CVRA 4CYDA 4I02A 3IRQA 4IVNA 1D3YA 3E6MA 5L3BA 2P5VA 2J5OA 2D1HA 2BYVE 5CYVA 2H27A 1R1UA 1YW9A 2PMHA 2UZKA 2DW4A 2QUFA 4U0WA 1P6RA 1XGOA 2JZYA 2GA2A 4N0BA 2PEXA 3T0YA 4O5VA 2RC4A 1LJ9A 1ZAOA 1FBUA 3JTGA 4RS8A 3F6VA 5LEJA 3WTUC 3ECHA 2RVCA 3ZMVA 1WWXA 2XVCA 2QYOA 4LJZF 2O3FA 3CLOA 2EFQA 4U7DA 1YW8A 5HVQC 2PI0A 2A5YB 4U0VA 3QP6A 3ZMTA 2F2EA 1YQAA 1QO0D 3ROUA 1ZYRF 5CVJA 2QM3A 2VXZA 3R6SA 2C6YA 5H6QA 4M6XA 2BBYA 1EH7A 5DCMA 4RAYA 5LHGA 5E8IA 1TW2A 4A12A 3FM3A 4G6QA 1OYWA 4P9FA 2DQRA 2QBYB 1HW2A 3HRTA 1YG2A 3V4GA 5HS8A 2XAGA 2PQ8A 2DFIA 4LD5A 2XRNA 2VE9A 3PQJA 1ZLJA 3I71A 4YFNF 3P9KA 3N4MA 1SD7A 3RYPA 2JPBA 1ZRCA 1TW3A 3QOPA 4M73A 2LDUA 1KU7A 4QLCU 2JTVA 1G6NA 1Z7UA 3BJ6A 4DQ2A 1K6OA 1BI1A 2HYFA 4KMFA 3H92A 3ZQ7A 2A3SA 3I54A 5FLXK 2QVOA 1HSJA 1RUOA 2HFHA 4OIQF 3FXQA 2KIUA 2STTA 3C7JA 2F5DA 1HKQA 4ZYGA 1G3SA 2ADUA 3DXJF 3MCZA 1SD6A 1J2XA 4L9NA 5BOXA 4LG0A 2XUBA 1O3TA 2Y0MA 4YIFA 1ZREA 3U2RA 4HA8A 1IRGA 5EEGA 4ESBA 5D6EA 4A2UA 4EGZA 3GZ5A 3K69A 2V1DA 1TLHB 4ESFA 4NB5A 2ZO4A 4KYWA 3DP7A 2OZ6A 2YSRA 3RKYA 4G9YA 2D1VA 2GIVA 3ML6A 1IXSB 2DK5A 2EJRA 2OQGA 3DPLC 3I59B 3IKTA 1SFXA 2FNPA 5FB2A 4Y17A 1B1BA 3HSFA 3WE3A 1S29A 1SD4A 3HRSA 5CVUA 3TQNA 4YG2F 5JHUA 1IN7A 5L3FA 3H3ZA 5D8LB 2CQKA 1SFEA 4EM0B 1S7AA 4RB1A 3REOA 1BBYA 1TTYA 3JAMZ 4AIHA 3GF2A 4M72A 1L3LA 3NEUA 3FMRA 3GXOA 4FT8A 3GWZA 2KJBA 2RDPA 2VBZA 5H20A 5TRDA 2JRTA 1UHWA 1SMTA 3DFGA 1XCVA 2WWYA 3T8RA 5FLXZ 5LEKA 1U5TC 1P92A 2EV5A 1XGNA 2Y48A 1MJAA 1KU9A 1ZHFA 5EEHA 5AIPA 2FA5A 2WTEA 4UXNA 5LHIA 2G7UA 5ILSA 3ERED 2ZMEB 4OMZA 4UV9A 4CDGA 3KETA 1XSVA 1JHFA 4I09A 1F4KA 4HF1A 4RGUA 4ZZDA 4HX4A 2CGPA 1UFMA 1PP8F 2DO7A 3H3UA 4A5MA 2MH2A 4M9ZA 1RNLA 3HHGA 3MEXA 5IT9K 3QPHA 4KA4A 3COAC 4LMYA 5BQTA 1FT9A 3KLNA 5HLIA 3M1EA 2NYXA 2KIMA 1U6GA 2A6EF 4HX7A 3FWEA 1IAWA 3LAPA 5FD6A 4LLNA 1E17A 3ZN0A 3DPTA 4O3MA 3QP5A 4WXHA 1ZG1A 2FU4A 4MTDA 2K7LA 2V6CA 1CF7A 1REPC 3F8MA 1EV7A 3C1DA 3WTZA 5DCMB 3G3ZA 2COMA 3WU1B 2UXXA 3IHUA 1IW7F 1TNSA 1IRFA 2HWVA 4HAMA 4R1HA 5BPDA 4EJUA 3ABTA 4RAZA 5A2QK 1FP2A 1FOKA 3E6DA 2DU9A 2XROA 2ISYA 4MTEA 5J8CA 5D5UB 3HOSA 3LAJA 4I7HA 4BXUA 1P2FA 4RB2C 2B0LA 4LB6B 3T5XA 1XMAA 4LFUA 2M8EA 2QZ8A 3KLOA 4A0ZA 5FD5A 1TBXA 3C18A 1LEBA 3TO6A 3V8JA 1F1ZA 1H9TA 1YS7A 3I64A 1LDJA 1G4DA 3RYRA 3WTWC 1FBQA 2VOPA 3MQ0A 1R1VA 1B4AA 3K9TA 2A61A 1XGMA 1R23A 3CUOA 5KK1A 2CWEA 4LG0B 1AOYA 2GZWA 1W4MA 2GQQA 1R22A 3ISPA 1R58A 4JBAA 5TJJA 3Q9SA 1IN4A 2Z99A 3KP3A 5J8FA 5JR3A 2ISZA 2DI3A 3N97A 3OOPA 3ZMZA 3WTXC 4ENNA 3TDZC 2P5LC 4UV8A 5DEQA 5E1ZB 4E70A 3Q5FA 2PN6A 5IT3A 2VC1A 2R3SA 4HX8A 1XGSA 4IRGA 1OYIA 3IWFA 2G9WA 4G7ZF 1XDUA 4UVBA 2VODA 3V7CA 4RB3C 3GYHX 2YX7A 3I59A 5JVTA 4G8XA 3ZMDA 2XIGA 3HOTA 1Z91A 4M9XA 1STZA 3TO9A 1HW5A 3F8NA 5A2QZ 1T39A 1LDKB 2FBIA 2HGCA 1FWZA 2HDCA 5D4RA 4ENKA 1KU3A 1FPQA 1U5TA 2MA3A 3MAJA 1F5TA 4HV5A 3KP4A 5JI6A 1FZPB 4HOBA 3E6BA 3LFKA 2DBBA 2RQPA 3D0SA 1S8NA 1B59A 2XHKA 1RIOH 1KU2A 5J6XA 5E18F 4BHPA 1YYVA 4ENJA 3GFIA 3RPUA 5D4SA 2L54A 5LHHA 4NQWA 3WE2A 1KYZA 4MHGA 3RKWA 4Y13A 3L7WA 4BYYA 3SQNA 4Z2YA 2QQBA 1G3WA 1WQ2A 2ZMEA 2GA1A 2P8TA 4MQVA 1T98A 5CVVA 4XLPF 2IW5A 1WSUA 4Q47A 2L4AA 2K86A 3IWZA 2E7XA 1R1TA 5ICFA 2A68F 2HYGD 4P96A 3I0TA 1XSXA 1H0MA 3WTYC 2EFPA 2VE8A 4ZYHA 1IN8A 3TO7A 2L3DA 1YO5C 2R7DA 4XSZF 1J75A 2HS5A 4L5JA 3R4KA 3KP6A 3BOQA 3L2CA 4KFCA 5LRRA 5K5QA 3R61A 4RB0A 1U3EM 3CO7C 2MBFA 2MH9A 4CHUA 1AWCA 4HDUA 1FNNA 2ZNYA 3S2WA 2F5EA 2W85A 5CLSA 4UNOA 1Z6TA 3ZN1A 4XSXF 2MLGA 4MEXF 2EK5A 1W7PB 2E1CA 1CF7B 2IT0A 4Y15A 4M71A 4HLYA 4I2OA 3PFIA 4KIFA 4KT5C 5K5RA 3J80K 3K1MA 5ILVA 2A69F 2W24A 5E20A 3LA3A 4OU0A 2V1XA 2PFBA 2LSOA 1XN7A 3E5XA 2K4BA 1XSDA 2KJCA 2GXBA 3K2ZA 5LGTA 5LRSA 1B6AA 2EB7A 4EJWA 2P6SA 4P5OA 3M8FA 1RZ4A 2DLLA 2ZFWA 2ZCWA 3R0JA 3RTRA 1ZH5A 3FX3A 3ABUA 4PGGA 3SZTA 3P9CA 5AONA 1SAXA 3GFJA 4KUMA 3KEOA 4IRHA 3QAHA 3IC7A 4IHSA 3FMQA 2FXAA 3RJPA 4PCQA 3KZZA 2IRFG 1FBSA 2O8XA 3BP8A 2XASA 3E97A 3FXUA 3O2PE 2OU2A 2W84A 2UWMA 1HBXG 4ZZLA 1FY7A 1GXQA 4L9JA 2IP2A 1T6SA 2YR2A 2E7WA 1ULYA 2HKOA 4HV6A 3SZPA 3W6JB 3ECOA 1S3JA 2FBKA 4BQAA 3QU3A 4G6DA 2NNNA 3F3XA 4P55A 3ZMUA 4AD9A 4OINF 4A6DA 1R5GA 2EFNA 1F9NA 4EQQA 1TNTA 2O0YA 4D0PA 1RUNA 2QQ9A 4WX9A 1QZZA 2O6GE 2OA4A 3CJNA 3GX4X 4L5IA 1LVAA 5F1RA 3GFMA 1X3UA 1O3RA 4GYGA 2XAJA 3E6CC 3I4PA 4EJOA 3DEUA 3CDHA 3J80Z 1ZGAA 5CJ9A 4ASNA 2HEOA 5D6FA 2QLZA 3HYIA 1I5ZA 1JE8A 2ZBKA 4BH9A 2IA2A 1IUYA 3RKXA 2P4WA 3VB2A 4CXFA 1FYMA 4A5NA 2Y75A 2GXGA 2PMUA 2MLKA 3WODF 4EJTA 1U5TB 3W6KB 5E17F 4S04A 1ON1A 3U1DA 5DD8A 5L3EA 2AS5F 1SMYF 1TQMA 1PP7U 4WXDA 4M6YA 2XAFA 1EH6A 1L0OC 3EETA 4L9VA 1KQ8A 3I53A 4IRIA 3DF8A 1MZBA 1B9MA 1GXPA 2W25A 2ZNZA 4M9SA 4HQEA 4I0BA 3P9IA 2ESNA 2IJLA 2PG4A 1BC8C 1UCRA 1KQ9A 3BJAA 3GUDA 3ZPLA 5L3GA 4HLXA 5KVRA 1PDNC 4ESJA 1ZRDA 3WGGA 4L0ZB 3EDPA 3CUQB 4H0EA 1UB9A 2AXLA 2VT3A 4HZFA 2RV8A 2DK8A 3GVAA 2XKOA 2XAQA 2LF8A 3F8FA 2K4JA 1XCBA 3C3WA 2BGCA 3KP2A 1W7PA 4KMUX 4CGZA 4OIPF 1XD7A 2PJPA 3VOEA 1TQIA 3CUQC 5H6RA 2EV0A 3U9GA 1JXSA 2IPQX 5ICCA 5DUKA 1S7OA 2Z9OA 3T1BA 1ZRFA 4KNYA 5D5WB 2DPUA 4GYIA 1U8RA 3VFZA 3F72A 2Q8KA 1BC7C 3FZVA 2P7VB 1Y0UA 3E3VA 4A0YA 1Q1HA 1LEAA 3E5UA 2KIFA 1W7PD 4EM1A 2D45A 1MD0A 4I0AA 3IRRA 1O7FA 1T38A 4LLGF 3V8KA 2JSCA
chains in the Genus database with same CATH superfamily
1BR1A 3EYIA 1DGWY 4OAYA 5HOOA 4FASD 2EH3A 2ME0A 5L3DA 3DV8A 4LK1F 1RI7A 2LREA 2L0KA 3FM5A 2M5WA 3AL0B 4BQNA 4CCMA 1EKEA 1W5TA 1VQMI 3ELKA 2TDXA 4A3JJ 3JSOA 1IN5A 2O03A 3M8EA 3GEZA 3VEPA 2QENA 4WF2A 3ZXSA 2ZKZA 1IV8A 4XOPA 2K9NA 2E1OA 2P5KA 3AAFA 4CICA 3BTJA 1KGSA 4PGHA 3HBLA 2CQNA 3ABKH 2L7KA 3E7LA 2HKXA 3BDDA 2DDBA 2NXNB 5B5EC 2XV4S 4UY8I 3AL0C 2I5UA 1TWHJ 2HQRA 4M3GA 3BG9A 4RGXA 4XLNF 2CH0A 4E7ZA 2PLYA 3HSRA 4QWQA 4V2GA 1V3FA 5FGMA 1YS6A 1ITYA 2FE3A 1JUPA 2KRFA 2WV1A 3BLYA 1KZHA 5IT9Z 4XBFA 1OCRH 3ABMH 3L09A 3K70D 3ZOBA 1QQIA 3OYIA 2NRAC 1XMKA 4AM3A 3QWLA 5DTDA 5DUIA 1MNDA 2BE5F 2FMLA 3FXKA 3RI4A 1G2HA 2NOGA 2NS0A 3SEZA 3L2WA 2V9VA 1K4SA 2VQGA 4DNCA 4LGWA 5BNGA 1U2WA 3CO6C 1PUEE 1ZLKA 1H8AC 3HTSB 3BG5A 3QPTA 2KIQA 4BHBA 1D8KA 4B8XA 4HSRA 3ULQB 2JWTA 2DAOA 5C4JJ 1WKMA 3CCUI 1LQ1A 4S05A 2X6OA 4AUXA 2K27A 1R49A 2HNHA 2V9KA 4XMYA 4RGRA 2JT1A 2Z5UA 4HBLA 1ENHA 3BC8A 2LD5A 2K5CA 2DMTA 4BNCA 1DP7P 3A2KA 3WGHA 2CMPA 3OYLA 4B48A 2VQLA 3J7ZI 4TV7A 1VQ5I 2P0WA 2ZJQF 3S3OA 3T8TA 1EH8A 1HW1A 2M3AA 2GAUA 3F9KA 1FIPA 1YLFA 1J9IA 4FX0A 1ZG5A 2WAQN 2YU3A 2QSHX 2EINH 3M07A 5E8GA 4AIJA 3VYSB 1S72I 1D0YA 1P4AA 2W4SA 3J81K 4ZTFA 4KN4X 4YFKF 3CCMI 1NHAA 3OS1A 2ZXIA 1M1EB 4L0YB 1G3TA 3JRIA 2E2IJ 2E60A 1IRZA 1OR7A 1R36A 4CUGA 1OCPA 4G7OF 4B43A 3IAS2 4A0XA 2L9NA 4MLOA 3MZYA 3L2VA 3BPVA 2MG4A 3LQRA 3DKWA 2BZTA 2LR8A 3LQQA 1JJ6C 2CO5A 5HDGA 4U0YA 2FSWA 3W2VA 3OL4A 1X2MA 4FETA 1BI3A 1YTYA 3VYUB 3E5QA 4EEFG 1V55H 1E2XA 4AWXB 3HSEA 3EUHC 2COBA 3R60A 4R79A 3OS0A 1D5VA 4D9JA 5M5WJ 1ETXA 4N9IA 3FKJA 5J1RA 1UHSA 2MD0A 5HS9A 5F64A 1P4XA 2PBIA 3CP8A 2F5VA 4DYCA 2X48A 5ICGA 1QZYA 1K78A 2M4KA 3W2WA 1O4XA 1ACIA 3F21A 2DTRA 3OYKA 4IPAA 1DUXC 3VPRA 1DPRA 1O3QA 3ZQHA 1OYYA 3U21A 1R00A 3DLLF 1XS9A 2BY3A 2H8RA 3Q0WA 4M3BA 1B8IA 3G73A 4BE0A 3CMAI 4NNJA 4CYCB 3GO5A 5TISC 1LFPA 4BQOA 3B6AA 3CJRB 2L02A 2M9HA 2W48A 1PYVA 3IUOA 2QSFX 3DEWA 3KFWX 4L9TA 3GZ6A 4KIBA 1BOAA 4N9HA 4YIIA 1WJEA 2CUJA 5DV5A 1CGPA 2VOOA 1FYKA 3ASNH 4UUVA 2D5VA 3BTCA 1HSTA 3NRVA 2Q0OA 4FQGA 3RPUD 3HXLA 5BS6A 1V5FA 1ODDA 2F4OB 4CH7A 4WK8F 1MKMA 2L5QA 4JK1X 3HHHA 3OYEA 2EFWA 3QQAA 2PX9A 2W57A 3S93A 1SVMA 3DCFA 1NK3P 2ELJA 3CUQA 4KIGA 2RKHA 4XKVA 3F22A 2DJIA 3OV8A 3KCCA 5BPIA 2IS2A 5F6FA 4C3IJ 3S14J 3JCUC 1IXRC 3H5NA 5AIQA 4MEYF 2VLAA 2IA0A 1ZGJA 1FX7A 4DZPA 1Y56A 3GW2A 3LA7A 2DJNA 3QOEA 3LSIA 1R5ID 1Y39A 3SXYA 3CTAA 3K1NA 3TDUC 2F5FA 1UELB 1OCZH 2VKEA 5E1XA 2ID6A 2HOTA 2OBPA 3ZMSA 1U78A 3IH3A 3K1PA 1IXCA 1FLIA 4CA0A 4OIRF 2E35A 4GGGA 2NS8A 1I1SA 3WG9A 3GLXA 1WI3A 3HUGA 1YITI 1I6XA 1Z9CA 1LDDA 4UB6C 1JT0A 1MMNA 3HPGA 4RLQA 4KDPA 4NC6A 2L7FP 3J81Z 1DDNA 4PDKA 1BI2A 2OZUA 1HDPA 3OYMA 2RGVA 3DTEA 2DODA 3J7AO 1VTNC 4Q4ZF 4U7BA 3TOAA 3KZYA 2CW0F 1I27A 2R7FA 2QF7A 2IGKA 4ETSA 1HCRA 6PAXA 2R0QC 4Q48A 1QBJA 1KYWA 5HLGA 3PNVA 1ONVA 5KAFC 3ZQQA 2LY9A 2CUFA 2E1NA 2JMWA 5CQEA 4GDFA 1GV5A 1Z6RA 2V1NA 1K79A 2O61A 1G8XA 3NARA 3A01A 1AA7A 2XRLA 2AQEA 4XLCA 3MZHA 1D1AA 1XG1A 2HPIA 1BIBA 4F55A 1Z3XA 4XORA 5L3CA 2RN7A 3H1CA 1R5HA 3V8LA 4PJLA 4S0HB 2KZGA 3J7YJ 3L00A 3SFZA 1OCOH 1T2KA 3CD6I 2XAHA 4M74A 3RPQA 5FO5A 1J5YA 1G3YA 2IGMA 3CESA 3P5JA 1J59A 3JAMK 2GXAA 1MGTA 3L9FA 1MDMA 1VQ8I 2XAUA 3D5LA 3P7NA 5IYBJ 4XK4A 3DTKA 5GADJ 4EVIA 1A35A 4MFDA 2E5NA 3LA2A 1HQCA 4NHJA 2HU9A 4IEJA 3QU6A 3S1NJ 2XDVA 2Z3YA 2R7UA 9ANTA 1FEXA 2M8GX 2FBHA 4LG3A 2Y9ZA 1W0TA 1RKTA 5FFZA 3PL8A 2FD5A 2DA6A 3FXMA 4ON0A 1Z77A 2ZSHB 3Q9VA 3BCAA 1HXDA 2HYJA 4II2A 4CCNA 4BL0B 3SYTA 5GPCA 2LOOA 3W3CA 2JN6A 4LB5A 2KRHA 4WWCA 1O57A 2EWNA 4LIVA 4EM2A 1JJ8C 4BY1J 3F23A 3F6OA 2HZTA 2VT2A 4A6EA 2FOKA 3BWGA 1S6LA 1ZARA 1LKXA 1J7KA 4ENMA 2RNJA 2BXYA 3E1SA 5M5YJ 2P6TA 1VNDA 2WAFA 5F0CA 5H2FC 1SFKA 3IH4A 1W5CC 5ERIA 3I9V2 2A07F 1WRJA 3H3VK 3OYGA 3BZKA 4FHTA 2I8DA 1O7LA 1RR7A 2IS4A 3KZIC 2W00A 1Y1VJ 2VBYA 1UG0A 1EA3A 1FSHA 1Z7LA 5K1YA 2DT7B 5CVIA 1WZ2A 2HOSA 4KJZA 2NVYJ 4AIKA 4BJ6C 4AVZA 2DOFA 5GAEJ 2R5ZA 4OMYA 3TL4X 2FF4A 1R4NB 4F7ZA 2OD5A 3BY6A 3WGIA 1Z05A 4WXCA 5GTHC 5GPAA 3A0HC 3DQVC 4XRFA 4ZYEA 3TGNA 4IHWA 3RZOJ 3K6GA 2X6WA 5DD4A 3H35A 2H6CA 3OSGA 1W0UA 4IXAA 3KYLA 3LSJA 4XKBA 2XGXA 3EUHA 3QYFA 4DJAA 4A3LJ 4NBQA 2ZXJA 3B6CA 3DBRB 1VQKI 2BV6A 2LKPA 3AG3H 1H9GA 2XB0X 2K9QA 4E7JA 4HQMA 3O3KA 2LNBA 2M1BA 2LF7A 3GTKJ 1UG2A 2QWWA 4FX4A 1Q1VA 1YW7A 4I76A 3VODA 2DA2A 1BI0A 1R9TJ 1JT6A 1USSA 2VBWA 3JSPA 2Q2EA 3FBIB 3S15J 3AFHA 2JQ7A 5JFRA 4YFXF 1I1GA 2ZJPF 4C2UA 3C2GA 1YOVB 4D7NA 3L1PA 3CCLI 4JYKA 1K7AA 1IF1A 2R7WA 3Q0VA 2DA5A 1A5JA 3KP7A 5GP9A 2DT5A 2OCEA 1JI8A 1BM9A 1KONA 1VQLI 3M9AA 2OTLI 2VJ4A 3KP5A 3S1QJ 2ETHA 1YFHA 3HM5A 4Q5SF 1K78B 2L7MP 1T0FC 3HB9A 3NQOA 1ZG3A 5CKTA 1VFCA 4KITB 4IHTA 5D8KB 3G4SI 3LL7A 3GTOJ 1JGSA 2KISA 4ZYDA 4KN7X 2WV0A 2OC6A 1JKQC 5CPRB 3BPXA 2KKOA 1GT0C 4UVCA 4CYCA 4IJAA 4EMSA 1FSEA 4GCVA 1Z1DA 3BJOA 2E34A 2IGOA 3LSMA 5HS7A 3M7GA 3I5UA 1DPUA 1W36C 5LGUA 3CCJI 2DQLA 5DDGA 5BMZA 1C0WA 3BTLA 4AVPA 1W5SA 5JHFA 3FMSA 2NAZA 2YPRA 3FHZA 2HOEA 3LSTA 3FXJA 5HLTA 1IJWC 2VASA 4CCLA 3KYCB 2CV0A 3GTGJ 2CSOA 2Z16A 3OWTA 5F0FA 2BEOA 4G7HF 4PFOA 4AU7A 1LPQA 3TOBA 3OYCA 2ICWG 2EILH 4BJ5C 4MGRA 4YRVA 1APLC 2MD5A 2RREA 3GLLA 4WCGA 2VPLA 3IKVA 4B09A 4IOAF 3ASOH 4CO8A 1AHDP 2KFDA 2L4MA 2MC4A 5ICEA 4MNUA 2DTZA 1BW5A 5FFXA 2K02A 1IN6A 1S7EA 2NS7A 3HIFA 3G1MA 4MQ9F 3DU5A 3B02A 2A6HF 4HW0A 4JQFA 5DM7F 1LB2A 3BZ6A 2CYYA 4BY7J 5HDKA 1QPIA 4R8HA 1AKHB 1QVTA 3JW4A 4IKFA 5E1WA 4O6JA 3WHCA 2HQNA 3HKZA 2MFZA 2ZMEC 2IVMA 3BROA 3F8BA 2CV1A 3S32A 4H4KC 1ZTRA 3BZCA 2FQ3A 3HTUA 4UB8C 1CQTA 1OQYA 4BQQA 1FYLA 4OIOF 2R7VA 4RDUA 2JPCA 3LSGA 1IGNA 3IL2A 2ELHA 3HUGB 1K4TA 1F36A 4CZZA 4JX5A 3V7RA 2Q1ZB 2DA7A 5J3LA 2X0LA 5K5OA 4RLFA 3TEDA 3KE2A 5LLQA 1P4WA 3F8CA 2DPDA 4U88A 3NAUA 1R7JA 2VKHA 4P9UA 4L18B 1YIJI 2FNAA 4HDVA 3OYJA 1HOMA 3JREA 1MJBA 2EZHA 5E79C 2CFXA 3WU0A 1XPXA 2DFHA 1N77A 2P7CB 1U9NA 1WFXA 1OISA 4RMNA 4Y52J 1USTA 1V4RA 2M2EA 4HYEA 2KDOA 4XR6A 4I01A 4XQFA 1VF9A 1MJ9A 1QPMA 4NC7A 1ZELA 3HOZJ 2EFOA 4GXOA 3CMMA 3LWFA 2WAQA 3WTVC 1SFUA 3S16J 2QBYA 2P81A 2ZJ2A 4L5EA 2HR3A 2MYSA 3QYEA 1ETOA 1BN5A 4K2EA 3RDIA 5C4XJ 2V79A 2M0CA 4DGWB 1QU3A 1RRJA 3G6EI 4GO1A 3B73A 3TKYA 2UXNA 2KZVA 5J4YA 1GHCA 4HG2A 4P1WA 2MSYA 2VONA 1JHHA 3K4KA 1P7JA 5EGOB 3HOUJ 1FC3A 2YX4A 2VL8A 3PUFA 3HRUA 3R0AA 2ZXWH 1MDMB 2EA4A 4BBSJ 4EV0A 3S3MA 4IQJA 2D2WA 4N4NB 2QKLB 2VN2A 2GOXB 2XGEA 3BR2A 3K4MA 3JRHA 3SHFA 2WC2A 3HL2A 2V7FA 1D1BA 4DYQA 5LGNA 2STWA 1TQPA 4KICA 1BIAA 2FMYA 4OOIA 3I56I 2ACJA 2MGQA 4I98B 2FEZA 2VJJA 1KQ0A 2J5PA 3PQKA 2HTJA 2HDWA 3KEQA 4ZTJA 5FKNA 4BHCA 5ED4A 4IF4A 2GWRA 3ZP5A 2M45A 4PUSA 5LBQA 2BVMA 4OAZA 2VQHA 3GTMJ 1QNTA 3IAM2 3MWMA 1ZK8A 5D5XB 1FP1D 2ZB9A 3SDGA 2FRHA 4EJVA 2F5CA 2H6BA 5B1BH 2BY2A 2CUEA 1LNWA 3I58A 1WCMJ 2IA1A 1B9NA 2HQAA 2MC3A 3MKLA 4FCYA 2X4HA 2Z1DA 3HKZN 3W6VA 1HKSA 3DKXA 3BQYA 4HF2A 2BVLA 2ZJRF 3H5RA 3HRMA 4QSHA 3K0LA 5HLHA 3JTHA 1YIOA 5E3NA 4A3FJ 4V19K 2EPFA 1WGXA 2VPRA 3FF5A 1UHMA 1GVJA 4I6ZA 4ZH4F 3GFLA 2AO9A 2F4IA 2JA7J 1OKRA 1K83J 3NWTA 4II3A 1OPCA 3FXRA 1X58A 5K7FA 1A04A 2CG4A 4J00A 3WTTC 4CCOA 2EV6A 2X6YA 1BW6A 1ON2A 2JVHA 4XKCA 2H09A 1OCTC 4IX7A 1O3SA 1GLNA 5ILUA 5F1JA 2R5ZB 4E7HA 5JLXA 3V42A 2N8GA 3MFKA 4G94A 2HTSA 1TT5B 2OAZA 4HPQA 4RGSA 2M87A 1U8BA 2H1KA 3VYTB 4LLLA 1H88C 3QRFF 3EYYA 2NNYA 2R92J 3DBLB 2EIJH 2PJRA 3JR9A 2VJ5A 1IC8A 1SD5A 1U0JA 3LSKA 4IQ4A 3RCOA 3V7SA 5C3EJ 1UAAA 2IAIA 1KA8A 4BAYA 2MW8A 5DYMA 1OMIA 4LK0F 4XL9A 1X3ZB 5E3LA 4HF0A 1IZ1A 3I55I 3IP4B 3E0JB 4C3HJ 2QQAA 4NUBA 2ZSIB 2EBIA 4UVAA 4E4HA 2IGNA 3RIRA 1EJ9A 2V1UA 3S2DJ 1SANA 1S9HA 2Z33A 4BEHB 2L01A 3WTSC 1T0FA 2OQRA 1E0EA 2M30A 4HEA2 2ESHA 1XB4A 2VC0A 2Q2EB 2ECBA 2EA2A 5DCFA 2G7HA 1J09A 1HKTA 1QGPA 5HDNA 2XKPA 3GTLJ 4B3AA 1XDSA 1VQ7I 4HRIA 2BHYA 1J0RA 4FISA 4QPQA 4F91B 2F48A 3WU2C 3OIPA 1BJAA 4RM3A 3MVPA 1WI9A 2FX0A 2JUGA 1D8JA 4XM3A 1DQUA 2VBXA 1ZN2A 3EPZA 4UHTA 4UUSB 4PZJA 1WJAA 3ONQA 3I4MJ 1EF4A 3O6BB 5KHDA 1LFUP 5D5VB 4XLEA 4EGYA 3QPLA 3EQLF 5J4VA 3OYFA 2H94A 1A36A 4D1QA 4XLAA 5CVRA 4CYDA 1YI2I 4BDZA 2JA5J 4I02A 3HG9A 3IRQA 3X2QH 4IVNA 1D3YA 3JRFA 1JTYA 2L2OA 3E6MA 2P5VA 2X6XA 5L3BA 2J5OA 2D1HA 2BYVE 1ETQA 2WA0A 4G6TB 5CYVA 2H27A 1R1UA 1X1CA 2X1CA 3CCQI 4E7KA 1YW9A 2PMHA 2UZKA 2DOEA 2DW4A 3GZNB 2QUFA 1RESA 4U0WA 1P6RA 1XGOA 2CQQA 2JZYA 2GA2A 2LC2A 3JRAA 4N0BA 3OIOA 2PEXA 3K4BA 2L9SA 3T0YA 5IP6A 4O5VA 3ZQCA 1GV2A 4G12A 4MO7A 2RC4A 1LJ9A 3A4CA 5FKOA 2KPMA 2L7ZA 1ZAOA 1IG7A 4GRIA 1FBUA 3JTGA 4RS8A 2WY7Q 3F6VA 5LEJA 3WTUC 1W1WE 3DWLE 3D5RC 3ECHA 2RVCA 3K7AJ 3ZMVA 4J01A 3HOVJ 1HC8A 5E3MA 2XSDC 2WBMA 2BHZA 1ETWA 1WWXA 2XVCA 3FISA 2QYOA 4LJZF 2O3FA 3CLOA 1WHUA 2EFQA 4U7DA 4LITA 2R4GA 3CF2A 1R71A 1YW8A 4PJMA 1AKHA 5HVQC 2PI0A 3S1MJ 3AG4H 4AC0A 1RPWA 2F4MB 2A5YB 4U0VA 2XB5A 3QP6A 3ZMTA 3LMMA 1MW7A 2F2EA 3RQ4A 1YQAA 1QO0D 3ROUA 1ZYRF 1MSEC 2HZDA 3CF5F 4XIDA 3BQZA 3CJTB 5CVJA 2AXTC 3JRGA 2QM3A 2EZIA 1YHQI 1LE8B 2VXZA 3R6SA 2C6YA 1PUFA 5H6QA 4M6XA 1YE9A 2BBYA 5EDNA 2LY2A 1EH7A 1FOYA 4M3FA 1MH4A 1VQPI 2FOWA 5DCMA 4RAYA 5LHGA 5E8IA 4BJTA 3GTQJ 1TW2A 3PFYA 1ZKGA 2EQRA 4A12A 3FM3A 4G6QA 1OYWA 4P9FA 2E5ZA 1VQNI 1F43A 1G59A 2DQRA 2QBYB 5GTIC 3L2RA 1MSFC 2LKXA 1ERDA 3RZDJ 1HW2A 3FXOA 3HRTA 4HNUA 3H9JA 1XTAA 1YG2A 3V4GA 2X1EA 2E71A 4ZC3A 4XOTA 1X19A 5HS8A 2XAGA 2PQ8A 1I6HJ 2DFIA 4LD5A 2XRNA 1FMVA 1WPKA 2DT6A 5FRMA 1B72A 4A93J 4RM2A 2VE9A 3PQJA 4XN3A 1ZLJA 3I71A 5EGOA 4YFNF 2CJJA 2V4JC 2Y69H 3P9KA 3N4MA 5EYRA 1VQ4I 1POGA 1SD7A 2BXZA 3RYPA 1UMQA 2JPBA 3ZQFA 1ZRCA 1TW3A 3QOPA 4M73A 5F04A 1IRXA 2LDUA 1KU7A 4QLCU 3HOYJ 1PJRA 5IP9J 2JTVA 3CC2I 2JA2A 1T08B 3GBGA 1G6NA 1Z7UA 2LVSA 3BJ6A 4DQ2A 1K6OA 1IV6A 4ZDLA 1BI1A 1TWGJ 1BR4A 2W1OA 2O8KA 1GVDA 1YJWI 2I10A 2HYFA 1TWFJ 3RKQA 4RAGA 3HC7A 4KMFA 2NVTJ 3H92A 3ZQ7A 2A3SA 4I99C 3I54A 5FLXK 2DA1A 1YRNB 2BW3B 2QVOA 1SVOA 1HSJA 2IEKA 1RUOA 2HFHA 1S5LC 5IPAA 3FXLA 5FLVA 4ZDPA 4E7LA 1D0ZA 1MBHA 4OIQF 5IOZA 3FXQA 1X3WB 2KIUA 5C44J 2STTA 1SC7A 2KT0A 3C7JA 4IZZA 3IV5A 2F5DA 1HKQA 4ZYGA 1ETYA 2M34A 1G3SA 2ADUA 3DXJF 3MCZA 1SD6A 1JKPC 4IHYA 4BKXA 1TT0A 1J2XA 4L9NA 5BOXA 2LFBA 4LG0A 2JK3A 2XUBA 3QYBA 1O3TA 2Y0MA 3K70C 1H89C 4YIFA 1ZREA 1UJ8A 3U2RA 4CZCA 4HA8A 3PIOF 3CMYA 1IRGA 5EEGA 4JX6A 3J7AY 3OMYA 4ESBA 2OUMA 3G2BA 5D6EA 1IDZA 4PFPA 4A2UA 4IL6C 5EEAA 4EGZA 3GZ5A 3FBNB 4EATA 3K69A 3SJMA 1YJ9I 1MMAA 2DOAA 2V1DA 3QODA 1TLHB 4ESFA 4LOCA 1LFBA 3O8GA 3OR2C 3VWBA 4NB5A 2ZO4A 2CU7A 2X9DA 3CLQA 4KYWA 1QVUA 3H0GJ 3DP7A 4X1EA 2OZ6A 2YSRA 1QA6A 3RKYA 4G9YA 2D1VA 2PJRB 2GIVA 3OYDA 3ML6A 1IXSB 3JRCA 2W82A 2DK5A 4BDYA 2JA6J 2EJRA 2OQGA 2UUZA 4AYBA 3L2QA 3MN2A 5J1UA 3DPLC 3I59B 2FJ1A 3GTJJ 3QPSA 3CQZJ 3IKTA 3GMEA 1SFXA 2KMUA 5B3SH 2FNPA 3OYNA 5FB2A 3UNGC 2Y31A 4A3KJ 5FKKA 4BEHA 4Y17A 1B1BA 3HSFA 3AG1H 3WE3A 1S29A 1E3PA 2K3FA 2E36A 1SD4A 3HRSA 5CVUA 3TQNA 5B66C 3CJQB 4YG2F 3OL3A 5JHUA 1VQOI 1IN7A 5L3FA 3M1CA 2TCTA 4N4OB 3H3ZA 5D8LB 2CQKA 1DU0A 1SFEA 3MZ8A 1XX5A 4EM0B 1BL0A 2CS3A 1S7AA 4RAFA 3PNYA 3REOA 4JX4A 4RB1A 4IHVA 2KLOA 3H9GA 4C9YA 3FIWA 1FTTA 1RKWA 3LOCA 1BBYA 4UUSA 1TTYA 1JKOC 1FOXA 3JAMZ 1HF0A 4KT6A 4AIHA 4FTHA 4BACA 3N05A 1Y0NA 3GF2A 1YX3A 4M72A 4CCKA 1OCCH 4IO9F 3HZJA 2GOMA 4QTRA 5J1YA 1L3LA 3NEUA 2JA8J 3PO3J 2E2JJ 3FMRA 3GXOA 4FT8A 3DPUA 3GWZA 4F92B 2KJBA 2RDPA 2VBZA 2VB6A 5E3OA 5H20A 5TRDA 3ZQIA 3HOXJ 2JRTA 1UHWA 1SMTA 4MIMA 2EZKA 3KIOA 4PSXA 3DFGA 1XCVA 2LLKA 4NQWB 3T8RA 5FLXZ 2WWYA 1MBJA 4E6KG 2VUMJ 5LEKA 1U5TC 1P92A 4C30A 1TP4A 4C3JJ 3BG6A 2LYCA 2EV5A 1XGNA 2Y48A 1JUSA 1MJAA 1KU9A 1ZHFA 3VSLA 3S1RJ 1GDTA 3DKYA 4NDLA 2JVGA 3C2HA 5EEHA 5AIPA 2FA5A 2WTEA 4UXNA 5LHIA 1ZQ3P 2G7UA 5ILSA 3ERED 2ZMEB 4OMZA 3BR3A 1WH7A 4UV9A 4CDGA 3KETA 4X0GA 3FDYA 4CCJA 3BR1A 3BG7A 2E2HJ 2B9SA 1XSVA 1JHFA 2R7RA 4I09A 1F4KA 2V26A 3RSNA 1ZR2A 4HF1A 4RGUA 4ZZDA 1SFOJ 3K4JA 4UUTA 4HX4A 2CGPA 1UFMA 1PP8F 3G1OA 2DO7A 3H3UA 2Y0SA 1WJBA 4A5MA 1MBEA 2MH2A 4M9ZA 1RNLA 3HHGA 3DEEA 3MEXA 4XNFA 3TBIA 2DYRH 2LKSA 5IT9K 2CFOA 1FIAA 3QPHA 4KA4A 3COAC 4LMYA 5BQTA 3CMEI 1FT9A 1BA5A 3KLNA 4AYBN 5HLIA 5EG0A 3M1EA 2NYXA 2KIMA 2A5WA 1U6GA 2A6EF 4HX7A 3FWEA 1IAWA 2R7ZJ 3LAPA 4Y4RA 5FD6A 4LLNA 1E17A 3ZN0A 1I3QJ 3DPTA 2PMZN 5M3FJ 1FMWA 4O3MA 3DBHB 3QP5A 2H1LA 4LIUA 4V2FA 4WXHA 1ZG1A 1LE8A 3M8JA 2HDDA 2FU4A 5K7HA 3LSHA 4MTDA 1PUFB 4XICA 2K7LA 2V6CA 3JRDA 1CF7A 1LVKA 2CW7A 1UZCA 2DFFA 5FLMJ 2ELKA 5J40A 1MMGA 1REPC 3F8MA 1EV7A 3C1DA 3WTZA 5DCMB 3G3ZA 2COMA 1FJLA 3WU1B 3CCEI 3A0BC 3SEQA 3H0DA 1MIJA 1AU7A 1SVLA 1HLVA 2UXXA 3IHUA 1IW7F 1TNSA 2R7OA 4CSWA 1IRFA 2HWVA 2XPUA 3BG3A 3K4NA 4HAMA 2KL4A 1R4MB 4R1HA 4B47A 5JVGF 5BPDA 4EJUA 3K2AA 3ABTA 4RAZA 5A2QK 1D5YA 1FP2A 2G0EA 2LH9A 5HODA 1FOKA 1ZGWA 5TGTA 2VKVA 3E6DA 2DU9A 2XROA 2OPTA 2ISYA 3KX2A 4ITVA 3F0CA 4B1RA 4MTEA 2JRMA 4ANJA 3NWSA 5J8CA 5D5UB 3HOSA 1YJNI 3LAJA 4I7HA 4NC8A 2K85A 1TWCJ 4BXUA 3G71I 2HVRA 1B72B 1P2FA 4RB2C 2B0LA 2CQ7A 4LB6B 4GFBA 2KRCA 3FK6A 4XKWA 2E1MB 3T5XA 2DA3A 1XMAA 4LFUA 1RR8C 2L9RA 1GUUA 2M8EA 2QZ8A 3LSPA 2OV7A 2RAEA 3KLOA 4A0ZA 2KP6A 5FD5A 2XF5A 3MKZA 3ZCOA 1TBXA 3C18A 1LEBA 3TO6A 2DA4A 2Y9YA 3V8JA 1MNEA 1F1ZA 1N75A 1WJDA 1H9TA 1YS7A 3CCSI 1IDYA 3I64A 3ABLH 3SZGA 1LDJA 1G4DA 1YRNA 2CQXA 2BW3A 3MMYB 3RYRA 4DIQA 3WTWC 2HVQA 1FBQA 4MFEA 2Y0SN 3A1YA 2VOPA 3PUBA 3MQ0A 1R1VA 1B4AA 2E1MC 3K9TA 4M3DA 2A61A 3CDIA 1XGMA 2ECCA 1E3OC 3BR0A 3S8PA 1X1DA 2M0MA 1R23A 3CUOA 5KK1A 4XLFA 2CWEA 1N78A 2QQ8A 4KISA 3ESWB 3OY9A 2XF7A 4LG0B 1AOYA 3S2HJ 2WADA 1ETKA 2GZWA 1W4MA 2O7OA 2GQQA 5CQGA 1R22A 3ISPA 1R58A 2UV1A 4JBAA 5TJJA 2EZLA 3Q9SA 2DDAA 2HOAA 1IN4A 2LG4A 2Z99A 3KP3A 5J8FA 2DYSH 5JR3A 2ISZA 2DI3A 1R6RA 3N97A 2XSJC 3UKGA 3OOPA 3ZMZA 3BR6A 3WTXC 4ENNA 3TDZC 2P5LC 2DCEA 4PJJA 4UV8A 5DEQA 5E1ZB 1QHGA 4E70A 5IY5H 3Q5FA 2PN6A 5IT3A 2VC1A 2R3SA 2DMUA 4HX8A 1XGSA 4M3EA 3RQIA 4IRGA 1OYIA 2HXIA 4A3MJ 3IWFA 2HPMA 2G9WA 4G7ZF 5FRNA 2K9MA 2R7TA 3U1KA 2BY1A 1XDUA 4UVBA 2VODA 4U87A 4ZDOA 1I50J 3V7CA 1OFCX 2A05A 4RB3C 4YIRX 3GYHX 2YX7A 3I59A 1SEUA 4Y3OA 2IXSA 1WJCA 5JVTA 2FQ4A 4G8XA 5M5XJ 3ZMDA 2XIGA 5EZGA 3L2UA 3MKWB 3HOTA 1Y6IA 1U9OA 4B4CA 1XMXA 4E7SA 1Z91A 4M9XA 1STZA 3TO9A 2JSPA 3JRBA 1HW5A 3M3YJ 1N25A 2KHMA 1XC5A 3F8NA 5A2QZ 2ZFUA 1NG6A 3ZGKA 1T39A 1LDKB 1V5EA 5EF6A 2FBIA 3D1NI 3TW7A 3HDDA 2YS9A 2GLOA 1HDDC 1VQ6I 4X6AJ 4A69C 2HGCA 2XPVA 1FWZA 3TP0A 1FOWA 3HGYA 2HDCA 1X4PA 5D4RA 2B7EA 4ENKA 2QKMB 2QSGX 1KU3A 1ZR4A 1FPQA 1U5TA 2MA3A 3MAJA 3PM1A 2RNGA 1F5TA 4HV5A 1TWAJ 3KP4A 2GM4A 5JI6A 1X2NA 1FZPB 3FKIJ 1Z3YA 4HOBA 3E6BA 4HNTA 3LFKA 3CCYA 2V6EA 2DBBA 2DFEA 1OLTA 1NH3A 4C2TA 4A3BJ 2RQPA 3D0SA 4A3EJ 4BS9A 4A3CJ 1S8NA 2XGDA 1B59A 2XHKA 2W7NA 1RIOH 1KU2A 5J6XA 5E18F 4BHPA 1YYVA 1PVEA 2L9VA 2O5RA 1VQ9I 4D5CA 1X1AA 1FTZA 4ENJA 3GFIA 3RPUA 5D4SA 2L54A 5LHHA 4NQWA 2K3PA 4RA2A 3WE2A 1KYZA 1Z67A 2OCCH 4MHGA 3W2AA 3UR3C 1W36D 3RKWA 3H36A 4ZYAA 3L7WA 4Y13A 2OTJI 4BYYA 2LY1A 3SQNA 4Z2YA 2QQBA 3VYRB 5FJ8J 2Y30A 1G3WA 1WQ2A 3PIPF 2ZMEA 2GA1A 2P8TA 3OYBA 1Y1WJ 4MQVA 1QZEA 1T98A 5CVVA 4XLPF 2IW5A 1WSUA 4Q47A 2K9SA 2L4AA 2K86A 1Z21A 3IWZA 1A6QA 2E7XA 5FROA 4ABZA 1R1TA 3KEYA 5ICFA 2A68F 2HYGD 4P96A 3I0TA 2E19A 1NG7A 1XSXA 4RBOA 1H0MA 3I4NJ 1MBKA 3ERMA 2EFPA 3WTYC 3DLAA 2VE8A 1DGRM 4PSWA 4ZYHA 2IS6A 1IN8A 3TO7A 2L3DA 2WY8Q 2QA4I 1YO5C 1Z0XA 3CP2A 2R7DA 2R5YA 2MABA 3MD2A 3VDXA 4XSZF 3SFIA 1J75A 2HS5A 2OF7A 4L5JA 2VXDA 3R4KA 5EG0B 3OYAA 3KP6A 1OJLA 3BOQA 3L2CA 3O8HA 4KFCA 5LRRA 2B63J 4BE2A 1JKRC 3WHBA 5K5QA 3R61A 2M7AA 4RB0A 4BBRJ 3PSFA 3H9QA 4JOMA 1U3EM 3CO7C 2MBFA 2MH9A 4CHUA 1AWCA 1BOBA 2LRDA 4HDUA 1FNNA 2NVQJ 2ZNYA 3S2WA 2F5EA 5LD2C 2W85A 5CLSA 4UNOA 2LK2A 1Z6TA 4B44A 3ZN1A 3Q3SA 2HI3A 4XSXF 2MLGA 4MEXF 1X1PA 2EK5A 1W7PB 4XLHA 2X51A 3TW6A 4Y15A 1CF7B 2E1CA 5M3MJ 2IT0A 4M71A 1YX5A 4HLYA 3OS2A 4I2OA 3PFIA 4KIFA 5F0HA 3DTIA 4KT5C 1QHHD 3IH2A 5K5RA 5K7ZA 4FE4A 3J80K 3S3NA 2BY0A 3K1MA 2AQFA 4BXXJ 5ILVA 2A69F 2W24A 2KQRA 3FK7A 4PJNA 5KCMA 1MNMC 1MBFA 3ZR8X 5E20A 4HSTA 4DBQA 3PJRA 2XF6A 2LBFA 3LA3A 4OU0A 2V1XA 2PFBA 5DM6F 2VJIA 1WH5A 2LSOA 4JP0A 1XN7A 1MH3A 3TP3A 2X85A 1K61A 3CC7I 2R7XA 3E5XA 2VIXA 2K4BA 1XSDA 1BR2A 2HXOA 2KJCA 2Y2ZA 3HEFA 4BU2A 2GXBA 3ZQGA 4F3QA 3K2ZA 5LGTA 5F08A 5LRSA 1B6AA 2LTPA 1MMSA 4OWRB 2EB7A 4XONA 4EJWA 2P6SA 4P5OA 5KAIC 2ZXHA 2QGUA 2TRTA 3M8FA 2K9LA 1RZ4A 2DLLA 2ZFWA 2ZCWA 3R0JA 3RTRA 1ZH5A 1MBGA 3FX3A 3ABUA 4PGGA 3OYHA 2DMNA 3SZTA 3P9CA 3A02A 5AONA 1T8IA 4ZJZA 1SAXA 3GFJA 3OOUA 4KUMA 3M4OJ 3KEOA 3CCVI 4DBRA 4IRHA 2K40A 3QAHA 3IC7A 4XRSA 1E3HA 4IHSA 3FMQA 2FXAA 4E7IA 3RJPA 4PCQA 3KZZA 1SAUA 2HQ5A 1P9QC 1P7IA 2DMQA 1FBSA 2O8XA 3BP8A 2LP0A 2DMPA 5B1AH 2IRFG 2XASA 3E97A 2QCOA 3FXUA 3KPHA 1RC9A 2OU2A 2W84A 3O2PE 2UWMA 2BOLA 1HBXG 1VZ0A 3I3LA 1D1CA 3WG7H 4ZZLA 1I3AA 1FY7A 1GXQA 4L9JA 2IP2A 5FKLA 1T6SA 2YR2A 1JGGA 2E7WA 1ULYA 2F6CA 2CW8A 3A03A 2HKOA 4DZJA 4HV6A 3SZPA 3ZRGA 3W6JB 4D7MA 3ECOA 1S3JA 2FBKA 2X1DA 3BT9A 3QU3A 4BQAA 4G6DA 2NNNA 3F3XA 4P55A 3ZMUA 2VQCA 4YEJA 4AD9A 1DP3A 4OINF 4A6DA 2GIZA 2IBDA 1R5GA 2YU9J 1WJFA 5J47A 2EFNA 1TC3C 1F9NA 4EQQA 1TNTA 2O0YA 4C2MJ 4BXFA 3BTIA 4D0PA 1WVRA 3OR1C 2QQ9A 1RUNA 3CCRI 2VI6A 4WX9A 1QZZA 2O6GE 2OA4A 3CJNA 3GX4X 4L5IA 1LVAA 1IO2A 5F1RA 3GFMA 1X3UA 3HJEA 1O3RA 4GYGA 2XAJA 4F93B 3E6CC 3I4PA 4M6VA 4EJOA 3DEUA 3AG2H 3CDLA 3CDHA 3J80Z 1ZGAA 3K4CA 5CJ9A 2ME6A 4ASNA 5D6FA 2HEOA 2PMZA 2QLZA 3HYIA 1I5ZA 1JE8A 3BCBA 2ZBKA 2R7SA 1ORKA 5JLWA 1ETVA 4AIDA 4FE7A 4BH9A 2IA2A 3LSRA 1IUYA 1BJZA 3RKXA 2P4WA 3VB2A 4CXFA 5GAHJ 1FYMA 1T95A 2ZC2A 4A5NA 2M7BA 2JUCA 3LFUA 5F27A 2NVUB 2Y75A 1I39A 1T33A 2GXGA 5FKMA 2PMUA 2JJ7A 2H8WA 4YELA 2MLKA 2AHQA 3WODF 1X4OA 3GCMA 4EJTA 1U5TB 2Z2SB 3W6KB 1JUMA 4BGDA 4S04A 5E17F 5IOYA 1ON1A 3OIQA 3U1DA 5DD8A 5L3EA 2AS5F 1SMYF 1TQMA 1PP7U 1RETA 4WXDA 4M6YA 2EIKH 3G1LA 1WJ5A 2WB1A 2XAFA 2YUSA 2QEXI 1EH6A 1L0OC 3EETA 2EIMH 4L9VA 1KQ8A 1TL8A 3CC4I 1DU6A 3I53A 4IOCF 4IRIA 2CV2A 3DF8A 3Q0UA 1OR7C 3AKZA 1JTXA 1MZBA 4DW6A 1B9MA 1GXPA 5IYDJ 2W25A 2ZNZA 3BR5A 4M9SA 4HQEA 4IHXA 4I0BA 4Z6YA 1TZLA 3P9IA 2FUG2 3VSKA 2GBYA 3FHNA 1B8IB 2ESNA 4QIWN 2IJLA 2KDZA 1LUJB 3CZ6A 4D5FA 2HVSA 4XN0A 2PG4A 1BC8C 1UCRA 2NOJB 2OJED 4HNVA 5HNFA 3TMOA 1KQ9A 2R93J 3EUAA 3BJAA 3GUDA 1Y8QB 3ZPLA 2LMDA 5L3GA 3C2BA 2CRGA 4HLXA 4A3GJ 5KVRA 3DU6A 1PDNC 4Y7NJ 4W97A 4ESJA 3K4LA 1ZRDA 4A3DJ 3WGGA 2R7QA 2R5YB 4L0ZB 2XGCA 1A6IA 3EDPA 1VI0A 1T56A 3CUQB 4H0EA 1UB9A 4BUPA 2AXLA 3PNTA 4DYRA 2VT3A 3H5AA 4HZFA 1A31A 2RV8A 2DK8A 3GVAA 3MKYB 1K6YA 2VKDA 1V54H 2XKOA 5HNHA 1V5GA 2LF8A 2XAQA 3K10A 5LFAA 3F8FA 2K4JA 2O9LA 2XC7A 2XPWA 1QRYA 1XCBA 3C3WA 3ZQLA 2M4GA 2BGCA 4Y33A 3KP2A 4PK4A 1NTCA 1W7PA 4KMUX 4CGZA 4OIPF 1XD7A 2A6TA 3LNQA 2PJPA 3VOEA 4F52A 1TQIA 3CUQC 1X1BA 5H6RA 2EV0A 3U9GA 4DOZA 4W1UA 2RQQA 2DN0A 2IPQX 2IS1A 1JXSA 4J19A 3D5SC 5ICCA 4BE1A 5DUKA 1S7OA 1D0XA 2Z9OA 4A3IJ 3T1BA 3GTPJ 1ZRFA 2V9PA 4KNYA 1Y8RB 5D5WB 4PJ0C 2NVXJ 4XRMA 2DPUA 4GYIA 1U8RA 2ID3A 5IYCJ 3EUKL 3VFZA 2WB1N 3F72A 3OSFA 1IUFA 2Q8KA 1BC7C 3FZVA 3KYDB 2LBFB 3S17J 3PSIA 1NK2P 2P7VB 1Y0UA 3E3VA 4A0YA 2CUZA 3HGGA 1Q1HA 1LEAA 3E5UA 4B3XA 2KIFA 5EJCA 5GAGJ 5KNLA 2DXIA 1W7PD 3HPHA 5IP7J 4EM1A 2D45A 3HOWJ 5DS9A 3SDBA 1MD0A 4I0AA 4QPOA 1HA8A 3A01B 3IRRA 2WAEA 1O7FA 1T38A 4LLGF 4XRSG 5EZHA 3V8KA 1MMDA 3PO2J 2JSCA
chains in the Genus database with same CATH topology
3EYIA 5HOOA 5L3DA 3DV8A 4LK1F 1RI7A 3FM5A 2M5WA 1W5TA 3ELKA 2TDXA 3JSOA 1IN5A 2O03A 3M8EA 3GEZA 3VEPA 2QENA 4WF2A 2ZKZA 2P5KA 3AAFA 4CICA 1KGSA 4PGHA 2HKXA 3BDDA 2XV4S 2HQRA 4RGXA 4XLNF 2PLYA 3HSRA 4QWQA 5FGMA 1V3FA 1YS6A 2FE3A 2KRFA 5IT9Z 4XBFA 3L09A 1QQIA 2NRAC 1XMKA 5DUIA 2BE5F 2FMLA 3RI4A 2NS0A 2V9VA 4DNCA 4LGWA 1U2WA 3CO6C 1PUEE 1ZLKA 3HTSB 3QPTA 4BHBA 1D8KA 4B8XA 3ULQB 2DAOA 1WKMA 1LQ1A 4S05A 2K27A 4RGRA 2JT1A 2Z5UA 4HBLA 4BNCA 1DP7P 3WGHA 4TV7A 3T8TA 1EH8A 1HW1A 2GAUA 1YLFA 1J9IA 4FX0A 1ZG5A 2YU3A 5E8GA 4AIJA 3J81K 1P4AA 4KN4X 4YFKF 1NHAA 4L0YB 1G3TA 1OR7A 1R36A 4G7OF 4A0XA 3MZYA 3BPVA 3LQRA 3DKWA 3LQQA 2CO5A 5HDGA 4U0YA 2FSWA 1BI3A 1YTYA 3E5QA 1E2XA 4AWXB 3HSEA 3R60A 4R79A 1D5VA 4N9IA 5HS9A 5F64A 1P4XA 2PBIA 5ICGA 1QZYA 1K78A 3F21A 2DTRA 4IPAA 1DUXC 1DPRA 1O3QA 1OYYA 1R00A 3G73A 3GO5A 2L02A 3KFWX 4L9TA 3GZ6A 4KIBA 1BOAA 4N9HA 4YIIA 5DV5A 1CGPA 2VOOA 1FYKA 4UUVA 1HSTA 3NRVA 2Q0OA 5BS6A 1ODDA 4WK8F 1MKMA 4JK1X 3HHHA 2EFWA 2W57A 3CUQA 4KIGA 2RKHA 3F22A 3OV8A 3KCCA 5BPIA 5F6FA 1IXRC 5AIQA 4MEYF 2IA0A 1ZGJA 1FX7A 3GW2A 3LA7A 3SXYA 3CTAA 3K1NA 3TDUC 2F5FA 5E1XA 2OBPA 3ZMSA 1U78A 3K1PA 1IXCA 1FLIA 4OIRF 4GGGA 1I1SA 3WG9A 3GLXA 3HUGA 1I6XA 1Z9CA 1LDDA 4KDPA 1DDNA 3J81Z 4PDKA 1BI2A 2OZUA 2RGVA 3J7AO 1VTNC 4Q4ZF 4U7BA 3TOAA 3KZYA 2CW0F 1I27A 2R7FA 4ETSA 6PAXA 4Q48A 1QBJA 5HLGA 1KYWA 1ONVA 2E1NA 1Z6RA 1K79A 2O61A 3MZHA 1BIBA 5L3CA 2RN7A 1R5HA 3V8LA 3L00A 3SFZA 1T2KA 2XAHA 4M74A 3RPQA 5FO5A 1J5YA 1G3YA 1J59A 3JAMK 1MGTA 3L9FA 1MDMA 3D5LA 3P7NA 4EVIA 3LA2A 1HQCA 4NHJA 3QU6A 2Z3YA 2FBHA 5FFZA 4ON0A 3Q9VA 1HXDA 4LB5A 4WWCA 1O57A 2EWNA 4EM2A 3F23A 3F6OA 2HZTA 2VT2A 4A6EA 2FOKA 3BWGA 1S6LA 1ZARA 1J7KA 4ENMA 2RNJA 2P6TA 5ERIA 2A07F 1WRJA 4FHTA 1O7LA 2VBYA 1FSHA 5K1YA 5CVIA 4AIKA 4OMYA 2FF4A 4F7ZA 2OD5A 3BY6A 3WGIA 1Z05A 4WXCA 3DQVC 4XRFA 4ZYEA 3TGNA 5DD4A 2H6CA 4IXAA 2XGXA 3EUHA 2ZXJA 2BV6A 2LKPA 1H9GA 4HQMA 3O3KA 2LNBA 2M1BA 2LF7A 2QWWA 4FX4A 1YW7A 3VODA 1BI0A 1USSA 2VBWA 3JSPA 2Q2EA 5JFRA 4YFXF 1I1GA 1K7AA 1IF1A 3KP7A 2DT5A 1BM9A 3M9AA 3KP5A 2ETHA 1YFHA 4Q5SF 1K78B 3NQOA 1ZG3A 4IHTA 5D8KB 1JGSA 4ZYDA 4KN7X 2WV0A 3BPXA 2KKOA 4UVCA 4IJAA 4EMSA 1FSEA 4GCVA 1Z1DA 3BJOA 5HS7A 3M7GA 3I5UA 1DPUA 5LGUA 5BMZA 2DQLA 5DDGA 1C0WA 4AVPA 1W5SA 3FMSA 2NAZA 2YPRA 3FHZA 2HOEA 3LSTA 2CSOA 2BEOA 4G7HF 3TOBA 4MGRA 2MD5A 4WCGA 3IKVA 4B09A 4CO8A 2L4MA 5ICEA 4MNUA 5FFXA 2K02A 1IN6A 3HIFA 4MQ9F 3B02A 2A6HF 4HW0A 4JQFA 1LB2A 3BZ6A 2CYYA 5HDKA 4R8HA 3JW4A 5E1WA 4O6JA 2HQNA 2IVMA 3BROA 3F8BA 2FQ3A 3HTUA 1FYLA 4OIOF 2JPCA 3IL2A 2ELHA 4CZZA 3V7RA 2X0LA 5K5OA 3KE2A 5LLQA 1P4WA 3F8CA 2DPDA 4U88A 1R7JA 4P9UA 4L18B 2FNAA 4HDVA 1MJBA 3WU0A 2CFXA 2P7CB 1USTA 1V4RA 4HYEA 4I01A 1MJ9A 1QPMA 2EFOA 4GXOA 3LWFA 3WTVC 1SFUA 2QBYA 2ZJ2A 2HR3A 4K2EA 1BN5A 3RDIA 2V79A 4GO1A 3B73A 3TKYA 2UXNA 1GHCA 2VONA 1JHHA 1FC3A 2YX4A 3HRUA 3R0AA 1MDMB 2EA4A 4EV0A 2D2WA 2VN2A 3SHFA 2WC2A 5LGNA 2STWA 1TQPA 4KICA 1BIAA 2FMYA 4OOIA 2ACJA 4I98B 2FEZA 3PQKA 1KQ0A 2J5PA 2HTJA 3KEQA 4BHCA 5ED4A 4IF4A 2GWRA 3ZP5A 2M45A 5LBQA 1QNTA 3MWMA 5D5XB 1FP1D 2FRHA 4EJVA 2F5CA 2H6BA 1LNWA 3I58A 2IA1A 1B9NA 2MC3A 2X4HA 1HKSA 4HF2A 3HRMA 3K0LA 5HLHA 3JTHA 1YIOA 3FF5A 1UHMA 1GVJA 4ZH4F 3GFLA 1OKRA 1OPCA 3FXRA 1A04A 2CG4A 3WTTC 2EV6A 1ON2A 2H09A 1O3SA 5ILUA 3MFKA 4G94A 2HTSA 2OAZA 4RGSA 2M87A 4LLLA 3QRFF 3EYYA 2NNYA 1SD5A 3V7SA 1KA8A 4BAYA 5DYMA 1OMIA 4LK0F 4HF0A 1IZ1A 2QQAA 4UVAA 3RIRA 2V1UA 2Z33A 2L01A 3WTSC 1T0FA 2OQRA 2M30A 2ESHA 1XB4A 2VC0A 2EA2A 5DCFA 2G7HA 1HKTA 1QGPA 5HDNA 2XKPA 1XDSA 1J0RA 1BJAA 1WI9A 1D8JA 2VBXA 1ZN2A 4UHTA 4PZJA 3O6BB 5D5VB 4EGYA 3EQLF 2H94A 5CVRA 4CYDA 4I02A 3IRQA 4IVNA 1D3YA 3E6MA 5L3BA 2P5VA 2J5OA 2D1HA 2BYVE 5CYVA 2H27A 1R1UA 1YW9A 2PMHA 2UZKA 2DW4A 2QUFA 4U0WA 1P6RA 1XGOA 2JZYA 2GA2A 4N0BA 2PEXA 3T0YA 4O5VA 2RC4A 1LJ9A 1ZAOA 1FBUA 3JTGA 4RS8A 3F6VA 5LEJA 3WTUC 3ECHA 2RVCA 3ZMVA 1WWXA 2XVCA 2QYOA 4LJZF 2O3FA 3CLOA 2EFQA 4U7DA 1YW8A 5HVQC 2PI0A 2A5YB 4U0VA 3QP6A 3ZMTA 2F2EA 1YQAA 1QO0D 3ROUA 1ZYRF 5CVJA 2QM3A 2VXZA 3R6SA 2C6YA 5H6QA 4M6XA 2BBYA 1EH7A 5DCMA 4RAYA 5LHGA 5E8IA 1TW2A 4A12A 3FM3A 4G6QA 1OYWA 4P9FA 2DQRA 2QBYB 1HW2A 3HRTA 1YG2A 3V4GA 5HS8A 2XAGA 2PQ8A 2DFIA 4LD5A 2XRNA 2VE9A 3PQJA 1ZLJA 3I71A 4YFNF 3P9KA 3N4MA 1SD7A 3RYPA 2JPBA 1ZRCA 1TW3A 3QOPA 4M73A 2LDUA 1KU7A 4QLCU 2JTVA 1G6NA 1Z7UA 3BJ6A 4DQ2A 1K6OA 1BI1A 2HYFA 4KMFA 3H92A 3ZQ7A 2A3SA 3I54A 5FLXK 2QVOA 1HSJA 1RUOA 2HFHA 4OIQF 3FXQA 2KIUA 2STTA 3C7JA 2F5DA 1HKQA 4ZYGA 1G3SA 2ADUA 3DXJF 3MCZA 1SD6A 1J2XA 4L9NA 5BOXA 4LG0A 2XUBA 1O3TA 2Y0MA 4YIFA 1ZREA 3U2RA 4HA8A 1IRGA 5EEGA 4ESBA 5D6EA 4A2UA 4EGZA 3GZ5A 3K69A 2V1DA 1TLHB 4ESFA 4NB5A 2ZO4A 4KYWA 3DP7A 2OZ6A 2YSRA 3RKYA 4G9YA 2D1VA 2GIVA 3ML6A 1IXSB 2DK5A 2EJRA 2OQGA 3DPLC 3I59B 3IKTA 1SFXA 2FNPA 5FB2A 4Y17A 1B1BA 3HSFA 3WE3A 1S29A 1SD4A 3HRSA 5CVUA 3TQNA 4YG2F 5JHUA 1IN7A 5L3FA 3H3ZA 5D8LB 2CQKA 1SFEA 4EM0B 1S7AA 4RB1A 3REOA 1BBYA 1TTYA 3JAMZ 4AIHA 3GF2A 4M72A 1L3LA 3NEUA 3FMRA 3GXOA 4FT8A 3GWZA 2KJBA 2RDPA 2VBZA 5H20A 5TRDA 2JRTA 1UHWA 1SMTA 3DFGA 1XCVA 2WWYA 3T8RA 5FLXZ 5LEKA 1U5TC 1P92A 2EV5A 1XGNA 2Y48A 1MJAA 1KU9A 1ZHFA 5EEHA 5AIPA 2FA5A 2WTEA 4UXNA 5LHIA 2G7UA 5ILSA 3ERED 2ZMEB 4OMZA 4UV9A 4CDGA 3KETA 1XSVA 1JHFA 4I09A 1F4KA 4HF1A 4RGUA 4ZZDA 4HX4A 2CGPA 1UFMA 1PP8F 2DO7A 3H3UA 4A5MA 2MH2A 4M9ZA 1RNLA 3HHGA 3MEXA 5IT9K 3QPHA 4KA4A 3COAC 4LMYA 5BQTA 1FT9A 3KLNA 5HLIA 3M1EA 2NYXA 2KIMA 1U6GA 2A6EF 4HX7A 3FWEA 1IAWA 3LAPA 5FD6A 4LLNA 1E17A 3ZN0A 3DPTA 4O3MA 3QP5A 4WXHA 1ZG1A 2FU4A 4MTDA 2K7LA 2V6CA 1CF7A 1REPC 3F8MA 1EV7A 3C1DA 3WTZA 5DCMB 3G3ZA 2COMA 3WU1B 2UXXA 3IHUA 1IW7F 1TNSA 1IRFA 2HWVA 4HAMA 4R1HA 5BPDA 4EJUA 3ABTA 4RAZA 5A2QK 1FP2A 1FOKA 3E6DA 2DU9A 2XROA 2ISYA 4MTEA 5J8CA 5D5UB 3HOSA 3LAJA 4I7HA 4BXUA 1P2FA 4RB2C 2B0LA 4LB6B 3T5XA 1XMAA 4LFUA 2M8EA 2QZ8A 3KLOA 4A0ZA 5FD5A 1TBXA 3C18A 1LEBA 3TO6A 3V8JA 1F1ZA 1H9TA 1YS7A 3I64A 1LDJA 1G4DA 3RYRA 3WTWC 1FBQA 2VOPA 3MQ0A 1R1VA 1B4AA 3K9TA 2A61A 1XGMA 1R23A 3CUOA 5KK1A 2CWEA 4LG0B 1AOYA 2GZWA 1W4MA 2GQQA 1R22A 3ISPA 1R58A 4JBAA 5TJJA 3Q9SA 1IN4A 2Z99A 3KP3A 5J8FA 5JR3A 2ISZA 2DI3A 3N97A 3OOPA 3ZMZA 3WTXC 4ENNA 3TDZC 2P5LC 4UV8A 5DEQA 5E1ZB 4E70A 3Q5FA 2PN6A 5IT3A 2VC1A 2R3SA 4HX8A 1XGSA 4IRGA 1OYIA 3IWFA 2G9WA 4G7ZF 1XDUA 4UVBA 2VODA 3V7CA 4RB3C 3GYHX 2YX7A 3I59A 5JVTA 4G8XA 3ZMDA 2XIGA 3HOTA 1Z91A 4M9XA 1STZA 3TO9A 1HW5A 3F8NA 5A2QZ 1T39A 1LDKB 2FBIA 2HGCA 1FWZA 2HDCA 5D4RA 4ENKA 1KU3A 1FPQA 1U5TA 2MA3A 3MAJA 1F5TA 4HV5A 3KP4A 5JI6A 1FZPB 4HOBA 3E6BA 3LFKA 2DBBA 2RQPA 3D0SA 1S8NA 1B59A 2XHKA 1RIOH 1KU2A 5J6XA 5E18F 4BHPA 1YYVA 4ENJA 3GFIA 3RPUA 5D4SA 2L54A 5LHHA 4NQWA 3WE2A 1KYZA 4MHGA 3RKWA 4Y13A 3L7WA 4BYYA 3SQNA 4Z2YA 2QQBA 1G3WA 1WQ2A 2ZMEA 2GA1A 2P8TA 4MQVA 1T98A 5CVVA 4XLPF 2IW5A 1WSUA 4Q47A 2L4AA 2K86A 3IWZA 2E7XA 1R1TA 5ICFA 2A68F 2HYGD 4P96A 3I0TA 1XSXA 1H0MA 3WTYC 2EFPA 2VE8A 4ZYHA 1IN8A 3TO7A 2L3DA 1YO5C 2R7DA 4XSZF 1J75A 2HS5A 4L5JA 3R4KA 3KP6A 3BOQA 3L2CA 4KFCA 5LRRA 5K5QA 3R61A 4RB0A 1U3EM 3CO7C 2MBFA 2MH9A 4CHUA 1AWCA 4HDUA 1FNNA 2ZNYA 3S2WA 2F5EA 2W85A 5CLSA 4UNOA 1Z6TA 3ZN1A 4XSXF 2MLGA 4MEXF 2EK5A 1W7PB 2E1CA 1CF7B 2IT0A 4Y15A 4M71A 4HLYA 4I2OA 3PFIA 4KIFA 4KT5C 5K5RA 3J80K 3K1MA 5ILVA 2A69F 2W24A 5E20A 3LA3A 4OU0A 2V1XA 2PFBA 2LSOA 1XN7A 3E5XA 2K4BA 1XSDA 2KJCA 2GXBA 3K2ZA 5LGTA 5LRSA 1B6AA 2EB7A 4EJWA 2P6SA 4P5OA 3M8FA 1RZ4A 2DLLA 2ZFWA 2ZCWA 3R0JA 3RTRA 1ZH5A 3FX3A 3ABUA 4PGGA 3SZTA 3P9CA 5AONA 1SAXA 3GFJA 4KUMA 3KEOA 4IRHA 3QAHA 3IC7A 4IHSA 3FMQA 2FXAA 3RJPA 4PCQA 3KZZA 2IRFG 1FBSA 2O8XA 3BP8A 2XASA 3E97A 3FXUA 3O2PE 2OU2A 2W84A 2UWMA 1HBXG 4ZZLA 1FY7A 1GXQA 4L9JA 2IP2A 1T6SA 2YR2A 2E7WA 1ULYA 2HKOA 4HV6A 3SZPA 3W6JB 3ECOA 1S3JA 2FBKA 4BQAA 3QU3A 4G6DA 2NNNA 3F3XA 4P55A 3ZMUA 4AD9A 4OINF 4A6DA 1R5GA 2EFNA 1F9NA 4EQQA 1TNTA 2O0YA 4D0PA 1RUNA 2QQ9A 4WX9A 1QZZA 2O6GE 2OA4A 3CJNA 3GX4X 4L5IA 1LVAA 5F1RA 3GFMA 1X3UA 1O3RA 4GYGA 2XAJA 3E6CC 3I4PA 4EJOA 3DEUA 3CDHA 3J80Z 1ZGAA 5CJ9A 4ASNA 2HEOA 5D6FA 2QLZA 3HYIA 1I5ZA 1JE8A 2ZBKA 4BH9A 2IA2A 1IUYA 3RKXA 2P4WA 3VB2A 4CXFA 1FYMA 4A5NA 2Y75A 2GXGA 2PMUA 2MLKA 3WODF 4EJTA 1U5TB 3W6KB 5E17F 4S04A 1ON1A 3U1DA 5DD8A 5L3EA 2AS5F 1SMYF 1TQMA 1PP7U 4WXDA 4M6YA 2XAFA 1EH6A 1L0OC 3EETA 4L9VA 1KQ8A 3I53A 4IRIA 3DF8A 1MZBA 1B9MA 1GXPA 2W25A 2ZNZA 4M9SA 4HQEA 4I0BA 3P9IA 2ESNA 2IJLA 2PG4A 1BC8C 1UCRA 1KQ9A 3BJAA 3GUDA 3ZPLA 5L3GA 4HLXA 5KVRA 1PDNC 4ESJA 1ZRDA 3WGGA 4L0ZB 3EDPA 3CUQB 4H0EA 1UB9A 2AXLA 2VT3A 4HZFA 2RV8A 2DK8A 3GVAA 2XKOA 2XAQA 2LF8A 3F8FA 2K4JA 1XCBA 3C3WA 2BGCA 3KP2A 1W7PA 4KMUX 4CGZA 4OIPF 1XD7A 2PJPA 3VOEA 1TQIA 3CUQC 5H6RA 2EV0A 3U9GA 1JXSA 2IPQX 5ICCA 5DUKA 1S7OA 2Z9OA 3T1BA 1ZRFA 4KNYA 5D5WB 2DPUA 4GYIA 1U8RA 3VFZA 3F72A 2Q8KA 1BC7C 3FZVA 2P7VB 1Y0UA 3E3VA 4A0YA 1Q1HA 1LEAA 3E5UA 2KIFA 1W7PD 4EM1A 2D45A 1MD0A 4I0AA 3IRRA 1O7FA 1T38A 4LLGF 3V8KA 2JSCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EYI A;  5HOO A;  5L3D A;  3DV8 A;  4LK1 F;  1RI7 A;  3FM5 A;  2M5W A;  1W5T A;  3ELK A;  2TDX A;  3JSO A;  1IN5 A;  2O03 A;  3M8E A;  3GEZ A;  3VEP A;  2QEN A;  4WF2 A;  2ZKZ A;  2P5K A;  3AAF A;  4CIC A;  1KGS A;  4PGH A;  2HKX A;  3BDD A;  2XV4 S;  2HQR A;  4RGX A;  4XLN F;  2PLY A;  3HSR A;  4QWQ A;  5FGM A;  1V3F A;  1YS6 A;  2FE3 A;  2KRF A;  5IT9 Z;  4XBF A;  3L09 A;  1QQI A;  2NRA C;  1XMK A;  5DUI A;  2BE5 F;  2FML A;  3RI4 A;  2NS0 A;  2V9V A;  4DNC A;  4LGW A;  1U2W A;  3CO6 C;  1PUE E;  1ZLK A;  3HTS B;  3QPT A;  4BHB A;  1D8K A;  4B8X A;  3ULQ B;  2DAO A;  1WKM A;  1LQ1 A;  4S05 A;  2K27 A;  4RGR A;  2JT1 A;  2Z5U A;  4HBL A;  4BNC A;  1DP7 P;  3WGH A;  4TV7 A;  3T8T A;  1EH8 A;  1HW1 A;  2GAU A;  1YLF A;  1J9I A;  4FX0 A;  1ZG5 A;  2YU3 A;  5E8G A;  4AIJ A;  3J81 K;  1P4A A;  4KN4 X;  4YFK F;  1NHA A;  4L0Y B;  1G3T A;  1OR7 A;  1R36 A;  4G7O F;  4A0X A;  3MZY A;  3BPV A;  3LQR A;  3DKW A;  3LQQ A;  2CO5 A;  5HDG A;  4U0Y A;  2FSW A;  1BI3 A;  1YTY A;  3E5Q A;  1E2X A;  4AWX B;  3HSE A;  3R60 A;  4R79 A;  1D5V A;  4N9I A;  5HS9 A;  5F64 A;  1P4X A;  2PBI A;  5ICG A;  1QZY A;  1K78 A;  3F21 A;  2DTR A;  4IPA A;  1DUX C;  1DPR A;  1O3Q A;  1OYY A;  1R00 A;  3G73 A;  3GO5 A;  2L02 A;  3KFW X;  4L9T A;  3GZ6 A;  4KIB A;  1BOA A;  4N9H A;  4YII A;  5DV5 A;  1CGP A;  2VOO A;  1FYK A;  4UUV A;  1HST A;  3NRV A;  2Q0O A;  5BS6 A;  1ODD A;  4WK8 F;  1MKM A;  4JK1 X;  3HHH A;  2EFW A;  2W57 A;  3CUQ A;  4KIG A;  2RKH A;  3F22 A;  3OV8 A;  3KCC A;  5BPI A;  5F6F A;  1IXR C;  5AIQ A;  4MEY F;  2IA0 A;  1ZGJ A;  1FX7 A;  3GW2 A;  3LA7 A;  3SXY A;  3CTA A;  3K1N A;  3TDU C;  2F5F A;  5E1X A;  2OBP A;  3ZMS A;  1U78 A;  3K1P A;  1IXC A;  1FLI A;  4OIR F;  4GGG A;  1I1S A;  3WG9 A;  3GLX A;  3HUG A;  1I6X A;  1Z9C A;  1LDD A;  4KDP A;  1DDN A;  3J81 Z;  4PDK A;  1BI2 A;  2OZU A;  2RGV A;  3J7A O;  1VTN C;  4Q4Z F;  4U7B A;  3TOA A;  3KZY A;  2CW0 F;  1I27 A;  2R7F A;  4ETS A;  6PAX A;  4Q48 A;  1QBJ A;  5HLG A;  1KYW A;  1ONV A;  2E1N A;  1Z6R A;  1K79 A;  2O61 A;  3MZH A;  1BIB A;  5L3C A;  2RN7 A;  1R5H A;  3V8L A;  3L00 A;  3SFZ A;  1T2K A;  2XAH A;  4M74 A;  3RPQ A;  5FO5 A;  1J5Y A;  1G3Y A;  1J59 A;  3JAM K;  1MGT A;  3L9F A;  1MDM A;  3D5L A;  3P7N A;  4EVI A;  3LA2 A;  1HQC A;  4NHJ A;  3QU6 A;  2Z3Y A;  2FBH A;  5FFZ A;  4ON0 A;  3Q9V A;  1HXD A;  4LB5 A;  4WWC A;  1O57 A;  2EWN A;  4EM2 A;  3F23 A;  3F6O A;  2HZT A;  2VT2 A;  4A6E A;  2FOK A;  3BWG A;  1S6L A;  1ZAR A;  1J7K A;  4ENM A;  2RNJ A;  2P6T A;  5ERI A;  2A07 F;  1WRJ A;  4FHT A;  1O7L A;  2VBY A;  1FSH A;  5K1Y A;  5CVI A;  4AIK A;  4OMY A;  2FF4 A;  4F7Z A;  2OD5 A;  3BY6 A;  3WGI A;  1Z05 A;  4WXC A;  3DQV C;  4XRF A;  4ZYE A;  3TGN A;  5DD4 A;  2H6C A;  4IXA A;  2XGX A;  3EUH A;  2ZXJ A;  2BV6 A;  2LKP A;  1H9G A;  4HQM A;  3O3K A;  2LNB A;  2M1B A;  2LF7 A;  2QWW A;  4FX4 A;  1YW7 A;  3VOD A;  1BI0 A;  1USS A;  2VBW A;  3JSP A;  2Q2E A;  5JFR A;  4YFX F;  1I1G A;  1K7A A;  1IF1 A;  3KP7 A;  2DT5 A;  1BM9 A;  3M9A A;  3KP5 A;  2ETH A;  1YFH A;  4Q5S F;  1K78 B;  3NQO A;  1ZG3 A;  4IHT A;  5D8K B;  1JGS A;  4ZYD A;  4KN7 X;  2WV0 A;  3BPX A;  2KKO A;  4UVC A;  4IJA A;  4EMS A;  1FSE A;  4GCV A;  1Z1D A;  3BJO A;  5HS7 A;  3M7G A;  3I5U A;  1DPU A;  5LGU A;  5BMZ A;  2DQL A;  5DDG A;  1C0W A;  4AVP A;  1W5S A;  3FMS A;  2NAZ A;  2YPR A;  3FHZ A;  2HOE A;  3LST A;  2CSO A;  2BEO A;  4G7H F;  3TOB A;  4MGR A;  2MD5 A;  4WCG A;  3IKV A;  4B09 A;  4CO8 A;  2L4M A;  5ICE A;  4MNU A;  5FFX A;  2K02 A;  1IN6 A;  3HIF A;  4MQ9 F;  3B02 A;  2A6H F;  4HW0 A;  4JQF A;  1LB2 A;  3BZ6 A;  2CYY A;  5HDK A;  4R8H A;  3JW4 A;  5E1W A;  4O6J A;  2HQN A;  2IVM A;  3BRO A;  3F8B A;  2FQ3 A;  3HTU A;  1FYL A;  4OIO F;  2JPC A;  3IL2 A;  2ELH A;  4CZZ A;  3V7R A;  2X0L A;  5K5O A;  3KE2 A;  5LLQ A;  1P4W A;  3F8C A;  2DPD A;  4U88 A;  1R7J A;  4P9U A;  4L18 B;  2FNA A;  4HDV A;  1MJB A;  3WU0 A;  2CFX A;  2P7C B;  1UST A;  1V4R A;  4HYE A;  4I01 A;  1MJ9 A;  1QPM A;  2EFO A;  4GXO A;  3LWF A;  3WTV C;  1SFU A;  2QBY A;  2ZJ2 A;  2HR3 A;  4K2E A;  1BN5 A;  3RDI A;  2V79 A;  4GO1 A;  3B73 A;  3TKY A;  2UXN A;  1GHC A;  2VON A;  1JHH A;  1FC3 A;  2YX4 A;  3HRU A;  3R0A A;  1MDM B;  2EA4 A;  4EV0 A;  2D2W A;  2VN2 A;  3SHF A;  2WC2 A;  5LGN A;  2STW A;  1TQP A;  4KIC A;  1BIA A;  2FMY A;  4OOI A;  2ACJ A;  4I98 B;  2FEZ A;  3PQK A;  1KQ0 A;  2J5P A;  2HTJ A;  3KEQ A;  4BHC A;  5ED4 A;  4IF4 A;  2GWR A;  3ZP5 A;  2M45 A;  5LBQ A;  1QNT A;  3MWM A;  5D5X B;  1FP1 D;  2FRH A;  4EJV A;  2F5C A;  2H6B A;  1LNW A;  3I58 A;  2IA1 A;  1B9N A;  2MC3 A;  2X4H A;  1HKS A;  4HF2 A;  3HRM A;  3K0L A;  5HLH A;  3JTH A;  1YIO A;  3FF5 A;  1UHM A;  1GVJ A;  4ZH4 F;  3GFL A;  1OKR A;  1OPC A;  3FXR A;  1A04 A;  2CG4 A;  3WTT C;  2EV6 A;  1ON2 A;  2H09 A;  1O3S A;  5ILU A;  3MFK A;  4G94 A;  2HTS A;  2OAZ A;  4RGS A;  2M87 A;  4LLL A;  3QRF F;  3EYY A;  2NNY A;  1SD5 A;  3V7S A;  1KA8 A;  4BAY A;  5DYM A;  1OMI A;  4LK0 F;  4HF0 A;  1IZ1 A;  2QQA A;  4UVA A;  3RIR A;  2V1U A;  2Z33 A;  2L01 A;  3WTS C;  1T0F A;  2OQR A;  2M30 A;  2ESH A;  1XB4 A;  2VC0 A;  2EA2 A;  5DCF A;  2G7H A;  1HKT A;  1QGP A;  5HDN A;  2XKP A;  1XDS A;  1J0R A;  1BJA A;  1WI9 A;  1D8J A;  2VBX A;  1ZN2 A;  4UHT A;  4PZJ A;  3O6B B;  5D5V B;  4EGY A;  3EQL F;  2H94 A;  5CVR A;  4CYD A;  4I02 A;  3IRQ A;  4IVN A;  1D3Y A;  3E6M A;  5L3B A;  2P5V A;  2J5O A;  2D1H A;  2BYV E;  5CYV A;  2H27 A;  1R1U A;  1YW9 A;  2PMH A;  2UZK A;  2DW4 A;  2QUF A;  4U0W A;  1P6R A;  1XGO A;  2JZY A;  2GA2 A;  4N0B A;  2PEX A;  3T0Y A;  4O5V A;  2RC4 A;  1LJ9 A;  1ZAO A;  1FBU A;  3JTG A;  4RS8 A;  3F6V A;  5LEJ A;  3WTU C;  3ECH A;  2RVC A;  3ZMV A;  1WWX A;  2XVC A;  2QYO A;  4LJZ F;  2O3F A;  3CLO A;  2EFQ A;  4U7D A;  1YW8 A;  5HVQ C;  2PI0 A;  2A5Y B;  4U0V A;  3QP6 A;  3ZMT A;  2F2E A;  1YQA A;  1QO0 D;  3ROU A;  1ZYR F;  5CVJ A;  2QM3 A;  2VXZ A;  3R6S A;  2C6Y A;  5H6Q A;  4M6X A;  2BBY A;  1EH7 A;  5DCM A;  4RAY A;  5LHG A;  5E8I A;  1TW2 A;  4A12 A;  3FM3 A;  4G6Q A;  1OYW A;  4P9F A;  2DQR A;  2QBY B;  1HW2 A;  3HRT A;  1YG2 A;  3V4G A;  5HS8 A;  2XAG A;  2PQ8 A;  2DFI A;  4LD5 A;  2XRN A;  2VE9 A;  3PQJ A;  1ZLJ A;  3I71 A;  4YFN F;  3P9K A;  3N4M A;  1SD7 A;  3RYP A;  2JPB A;  1ZRC A;  1TW3 A;  3QOP A;  4M73 A;  2LDU A;  1KU7 A;  4QLC U;  2JTV A;  1G6N A;  1Z7U A;  3BJ6 A;  4DQ2 A;  1K6O A;  1BI1 A;  2HYF A;  4KMF A;  3H92 A;  3ZQ7 A;  2A3S A;  3I54 A;  5FLX K;  2QVO A;  1HSJ A;  1RUO A;  2HFH A;  4OIQ F;  3FXQ A;  2KIU A;  2STT A;  3C7J A;  2F5D A;  1HKQ A;  4ZYG A;  1G3S A;  2ADU A;  3DXJ F;  3MCZ A;  1SD6 A;  1J2X A;  4L9N A;  5BOX A;  4LG0 A;  2XUB A;  1O3T A;  2Y0M A;  4YIF A;  1ZRE A;  3U2R A;  4HA8 A;  1IRG A;  5EEG A;  4ESB A;  5D6E A;  4A2U A;  4EGZ A;  3GZ5 A;  3K69 A;  2V1D A;  1TLH B;  4ESF A;  4NB5 A;  2ZO4 A;  4KYW A;  3DP7 A;  2OZ6 A;  2YSR A;  3RKY A;  4G9Y A;  2D1V A;  2GIV A;  3ML6 A;  1IXS B;  2DK5 A;  2EJR A;  2OQG A;  3DPL C;  3I59 B;  3IKT A;  1SFX A;  2FNP A;  5FB2 A;  4Y17 A;  1B1B A;  3HSF A;  3WE3 A;  1S29 A;  1SD4 A;  3HRS A;  5CVU A;  3TQN A;  4YG2 F;  5JHU A;  1IN7 A;  5L3F A;  3H3Z A;  5D8L B;  2CQK A;  1SFE A;  4EM0 B;  1S7A A;  4RB1 A;  3REO A;  1BBY A;  1TTY A;  3JAM Z;  4AIH A;  3GF2 A;  4M72 A;  1L3L A;  3NEU A;  3FMR A;  3GXO A;  4FT8 A;  3GWZ A;  2KJB A;  2RDP A;  2VBZ A;  5H20 A;  5TRD A;  2JRT A;  1UHW A;  1SMT A;  3DFG A;  1XCV A;  2WWY A;  3T8R A;  5FLX Z;  5LEK A;  1U5T C;  1P92 A;  2EV5 A;  1XGN A;  2Y48 A;  1MJA A;  1KU9 A;  1ZHF A;  5EEH A;  5AIP A;  2FA5 A;  2WTE A;  4UXN A;  5LHI A;  2G7U A;  5ILS A;  3ERE D;  2ZME B;  4OMZ A;  4UV9 A;  4CDG A;  3KET A;  1XSV A;  1JHF A;  4I09 A;  1F4K A;  4HF1 A;  4RGU A;  4ZZD A;  4HX4 A;  2CGP A;  1UFM A;  1PP8 F;  2DO7 A;  3H3U A;  4A5M A;  2MH2 A;  4M9Z A;  1RNL A;  3HHG A;  3MEX A;  5IT9 K;  3QPH A;  4KA4 A;  3COA C;  4LMY A;  5BQT A;  1FT9 A;  3KLN A;  5HLI A;  3M1E A;  2NYX A;  2KIM A;  1U6G A;  2A6E F;  4HX7 A;  3FWE A;  1IAW A;  3LAP A;  5FD6 A;  4LLN A;  1E17 A;  3ZN0 A;  3DPT A;  4O3M A;  3QP5 A;  4WXH A;  1ZG1 A;  2FU4 A;  4MTD A;  2K7L A;  2V6C A;  1CF7 A;  1REP C;  3F8M A;  1EV7 A;  3C1D A;  3WTZ A;  5DCM B;  3G3Z A;  2COM A;  3WU1 B;  2UXX A;  3IHU A;  1IW7 F;  1TNS A;  1IRF A;  2HWV A;  4HAM A;  4R1H A;  5BPD A;  4EJU A;  3ABT A;  4RAZ A;  5A2Q K;  1FP2 A;  1FOK A;  3E6D A;  2DU9 A;  2XRO A;  2ISY A;  4MTE A;  5J8C A;  5D5U B;  3HOS A;  3LAJ A;  4I7H A;  4BXU A;  1P2F A;  4RB2 C;  2B0L A;  4LB6 B;  3T5X A;  1XMA A;  4LFU A;  2M8E A;  2QZ8 A;  3KLO A;  4A0Z A;  5FD5 A;  1TBX A;  3C18 A;  1LEB A;  3TO6 A;  3V8J A;  1F1Z A;  1H9T A;  1YS7 A;  3I64 A;  1LDJ A;  1G4D A;  3RYR A;  3WTW C;  1FBQ A;  2VOP A;  3MQ0 A;  1R1V A;  1B4A A;  3K9T A;  2A61 A;  1XGM A;  1R23 A;  3CUO A;  5KK1 A;  2CWE A;  4LG0 B;  1AOY A;  2GZW A;  1W4M A;  2GQQ A;  1R22 A;  3ISP A;  1R58 A;  4JBA A;  5TJJ A;  3Q9S A;  1IN4 A;  2Z99 A;  3KP3 A;  5J8F A;  5JR3 A;  2ISZ A;  2DI3 A;  3N97 A;  3OOP A;  3ZMZ A;  3WTX C;  4ENN A;  3TDZ C;  2P5L C;  4UV8 A;  5DEQ A;  5E1Z B;  4E70 A;  3Q5F A;  2PN6 A;  5IT3 A;  2VC1 A;  2R3S A;  4HX8 A;  1XGS A;  4IRG A;  1OYI A;  3IWF A;  2G9W A;  4G7Z F;  1XDU A;  4UVB A;  2VOD A;  3V7C A;  4RB3 C;  3GYH X;  2YX7 A;  3I59 A;  5JVT A;  4G8X A;  3ZMD A;  2XIG A;  3HOT A;  1Z91 A;  4M9X A;  1STZ A;  3TO9 A;  1HW5 A;  3F8N A;  5A2Q Z;  1T39 A;  1LDK B;  2FBI A;  2HGC A;  1FWZ A;  2HDC A;  5D4R A;  4ENK A;  1KU3 A;  1FPQ A;  1U5T A;  2MA3 A;  3MAJ A;  1F5T A;  4HV5 A;  3KP4 A;  5JI6 A;  1FZP B;  4HOB A;  3E6B A;  3LFK A;  2DBB A;  2RQP A;  3D0S A;  1S8N A;  1B59 A;  2XHK A;  1RIO H;  1KU2 A;  5J6X A;  5E18 F;  4BHP A;  1YYV A;  4ENJ A;  3GFI A;  3RPU A;  5D4S A;  2L54 A;  5LHH A;  4NQW A;  3WE2 A;  1KYZ A;  4MHG A;  3RKW A;  4Y13 A;  3L7W A;  4BYY A;  3SQN A;  4Z2Y A;  2QQB A;  1G3W A;  1WQ2 A;  2ZME A;  2GA1 A;  2P8T A;  4MQV A;  1T98 A;  5CVV A;  4XLP F;  2IW5 A;  1WSU A;  4Q47 A;  2L4A A;  2K86 A;  3IWZ A;  2E7X A;  1R1T A;  5ICF A;  2A68 F;  2HYG D;  4P96 A;  3I0T A;  1XSX A;  1H0M A;  3WTY C;  2EFP A;  2VE8 A;  4ZYH A;  1IN8 A;  3TO7 A;  2L3D A;  1YO5 C;  2R7D A;  4XSZ F;  1J75 A;  2HS5 A;  4L5J A;  3R4K A;  3KP6 A;  3BOQ A;  3L2C A;  4KFC A;  5LRR A;  5K5Q A;  3R61 A;  4RB0 A;  1U3E M;  3CO7 C;  2MBF A;  2MH9 A;  4CHU A;  1AWC A;  4HDU A;  1FNN A;  2ZNY A;  3S2W A;  2F5E A;  2W85 A;  5CLS A;  4UNO A;  1Z6T A;  3ZN1 A;  4XSX F;  2MLG A;  4MEX F;  2EK5 A;  1W7P B;  2E1C A;  1CF7 B;  2IT0 A;  4Y15 A;  4M71 A;  4HLY A;  4I2O A;  3PFI A;  4KIF A;  4KT5 C;  5K5R A;  3J80 K;  3K1M A;  5ILV A;  2A69 F;  2W24 A;  5E20 A;  3LA3 A;  4OU0 A;  2V1X A;  2PFB A;  2LSO A;  1XN7 A;  3E5X A;  2K4B A;  1XSD A;  2KJC A;  2GXB A;  3K2Z A;  5LGT A;  5LRS A;  1B6A A;  2EB7 A;  4EJW A;  2P6S A;  4P5O A;  3M8F A;  1RZ4 A;  2DLL A;  2ZFW A;  2ZCW A;  3R0J A;  3RTR A;  1ZH5 A;  3FX3 A;  3ABU A;  4PGG A;  3SZT A;  3P9C A;  5AON A;  1SAX A;  3GFJ A;  4KUM A;  3KEO A;  4IRH A;  3QAH A;  3IC7 A;  4IHS A;  3FMQ A;  2FXA A;  3RJP A;  4PCQ A;  3KZZ A;  2IRF G;  1FBS A;  2O8X A;  3BP8 A;  2XAS A;  3E97 A;  3FXU A;  3O2P E;  2OU2 A;  2W84 A;  2UWM A;  1HBX G;  4ZZL A;  1FY7 A;  1GXQ A;  4L9J A;  2IP2 A;  1T6S A;  2YR2 A;  2E7W A;  1ULY A;  2HKO A;  4HV6 A;  3SZP A;  3W6J B;  3ECO A;  1S3J A;  2FBK A;  4BQA A;  3QU3 A;  4G6D A;  2NNN A;  3F3X A;  4P55 A;  3ZMU A;  4AD9 A;  4OIN F;  4A6D A;  1R5G A;  2EFN A;  1F9N A;  4EQQ A;  1TNT A;  2O0Y A;  4D0P A;  1RUN A;  2QQ9 A;  4WX9 A;  1QZZ A;  2O6G E;  2OA4 A;  3CJN A;  3GX4 X;  4L5I A;  1LVA A;  5F1R A;  3GFM A;  1X3U A;  1O3R A;  4GYG A;  2XAJ A;  3E6C C;  3I4P A;  4EJO A;  3DEU A;  3CDH A;  3J80 Z;  1ZGA A;  5CJ9 A;  4ASN A;  2HEO A;  5D6F A;  2QLZ A;  3HYI A;  1I5Z A;  1JE8 A;  2ZBK A;  4BH9 A;  2IA2 A;  1IUY A;  3RKX A;  2P4W A;  3VB2 A;  4CXF A;  1FYM A;  4A5N A;  2Y75 A;  2GXG A;  2PMU A;  2MLK A;  3WOD F;  4EJT A;  1U5T B;  3W6K B;  5E17 F;  4S04 A;  1ON1 A;  3U1D A;  5DD8 A;  5L3E A;  2AS5 F;  1SMY F;  1TQM A;  1PP7 U;  4WXD A;  4M6Y A;  2XAF A;  1EH6 A;  1L0O C;  3EET A;  4L9V A;  1KQ8 A;  3I53 A;  4IRI A;  3DF8 A;  1MZB A;  1B9M A;  1GXP A;  2W25 A;  2ZNZ A;  4M9S A;  4HQE A;  4I0B A;  3P9I A;  2ESN A;  2IJL A;  2PG4 A;  1BC8 C;  1UCR A;  1KQ9 A;  3BJA A;  3GUD A;  3ZPL A;  5L3G A;  4HLX A;  5KVR A;  1PDN C;  4ESJ A;  1ZRD A;  3WGG A;  4L0Z B;  3EDP A;  3CUQ B;  4H0E A;  1UB9 A;  2AXL A;  2VT3 A;  4HZF A;  2RV8 A;  2DK8 A;  3GVA A;  2XKO A;  2XAQ A;  2LF8 A;  3F8F A;  2K4J A;  1XCB A;  3C3W A;  2BGC A;  3KP2 A;  1W7P A;  4KMU X;  4CGZ A;  4OIP F;  1XD7 A;  2PJP A;  3VOE A;  1TQI A;  3CUQ C;  5H6R A;  2EV0 A;  3U9G A;  1JXS A;  2IPQ X;  5ICC A;  5DUK A;  1S7O A;  2Z9O A;  3T1B A;  1ZRF A;  4KNY A;  5D5W B;  2DPU A;  4GYI A;  1U8R A;  3VFZ A;  3F72 A;  2Q8K A;  1BC7 C;  3FZV A;  2P7V B;  1Y0U A;  3E3V A;  4A0Y A;  1Q1H A;  1LEA A;  3E5U A;  2KIF A;  1W7P D;  4EM1 A;  2D45 A;  1MD0 A;  4I0A A;  3IRR A;  1O7F A;  1T38 A;  4LLG F;  3V8K A;  2JSC A; 
#chains in the Genus database with same CATH topology
 1BR1 A;  3EYI A;  1DGW Y;  4OAY A;  5HOO A;  4FAS D;  2EH3 A;  2ME0 A;  5L3D A;  3DV8 A;  4LK1 F;  1RI7 A;  2LRE A;  2L0K A;  3FM5 A;  2M5W A;  3AL0 B;  4BQN A;  4CCM A;  1EKE A;  1W5T A;  1VQM I;  3ELK A;  2TDX A;  4A3J J;  3JSO A;  1IN5 A;  2O03 A;  3M8E A;  3GEZ A;  3VEP A;  2QEN A;  4WF2 A;  3ZXS A;  2ZKZ A;  1IV8 A;  4XOP A;  2K9N A;  2E1O A;  2P5K A;  3AAF A;  4CIC A;  3BTJ A;  1KGS A;  4PGH A;  3HBL A;  2CQN A;  3ABK H;  2L7K A;  3E7L A;  2HKX A;  3BDD A;  2DDB A;  2NXN B;  5B5E C;  2XV4 S;  4UY8 I;  3AL0 C;  2I5U A;  1TWH J;  2HQR A;  4M3G A;  3BG9 A;  4RGX A;  4XLN F;  2CH0 A;  4E7Z A;  2PLY A;  3HSR A;  4QWQ A;  4V2G A;  1V3F A;  5FGM A;  1YS6 A;  1ITY A;  2FE3 A;  1JUP A;  2KRF A;  2WV1 A;  3BLY A;  1KZH A;  5IT9 Z;  4XBF A;  1OCR H;  3ABM H;  3L09 A;  3K70 D;  3ZOB A;  1QQI A;  3OYI A;  2NRA C;  1XMK A;  4AM3 A;  3QWL A;  5DTD A;  5DUI A;  1MND A;  2BE5 F;  2FML A;  3FXK A;  3RI4 A;  1G2H A;  2NOG A;  2NS0 A;  3SEZ A;  3L2W A;  2V9V A;  1K4S A;  2VQG A;  4DNC A;  4LGW A;  5BNG A;  1U2W A;  3CO6 C;  1PUE E;  1ZLK A;  1H8A C;  3HTS B;  3BG5 A;  3QPT A;  2KIQ A;  4BHB A;  1D8K A;  4B8X A;  4HSR A;  3ULQ B;  2JWT A;  2DAO A;  5C4J J;  1WKM A;  3CCU I;  1LQ1 A;  4S05 A;  2X6O A;  4AUX A;  2K27 A;  1R49 A;  2HNH A;  2V9K A;  4XMY A;  4RGR A;  2JT1 A;  2Z5U A;  4HBL A;  1ENH A;  3BC8 A;  2LD5 A;  2K5C A;  2DMT A;  4BNC A;  1DP7 P;  3A2K A;  3WGH A;  2CMP A;  3OYL A;  4B48 A;  2VQL A;  3J7Z I;  4TV7 A;  1VQ5 I;  2P0W A;  2ZJQ F;  3S3O A;  3T8T A;  1EH8 A;  1HW1 A;  2M3A A;  2GAU A;  3F9K A;  1FIP A;  1YLF A;  1J9I A;  4FX0 A;  1ZG5 A;  2WAQ N;  2YU3 A;  2QSH X;  2EIN H;  3M07 A;  5E8G A;  4AIJ A;  3VYS B;  1S72 I;  1D0Y A;  1P4A A;  2W4S A;  3J81 K;  4ZTF A;  4KN4 X;  4YFK F;  3CCM I;  1NHA A;  3OS1 A;  2ZXI A;  1M1E B;  4L0Y B;  1G3T A;  3JRI A;  2E2I J;  2E60 A;  1IRZ A;  1OR7 A;  1R36 A;  4CUG A;  1OCP A;  4G7O F;  4B43 A;  3IAS 2;  4A0X A;  2L9N A;  4MLO A;  3MZY A;  3L2V A;  3BPV A;  2MG4 A;  3LQR A;  3DKW A;  2BZT A;  2LR8 A;  3LQQ A;  1JJ6 C;  2CO5 A;  5HDG A;  4U0Y A;  2FSW A;  3W2V A;  3OL4 A;  1X2M A;  4FET A;  1BI3 A;  1YTY A;  3VYU B;  3E5Q A;  4EEF G;  1V55 H;  1E2X A;  4AWX B;  3HSE A;  3EUH C;  2COB A;  3R60 A;  4R79 A;  3OS0 A;  1D5V A;  4D9J A;  5M5W J;  1ETX A;  4N9I A;  3FKJ A;  5J1R A;  1UHS A;  2MD0 A;  5HS9 A;  5F64 A;  1P4X A;  2PBI A;  3CP8 A;  2F5V A;  4DYC A;  2X48 A;  5ICG A;  1QZY A;  1K78 A;  2M4K A;  3W2W A;  1O4X A;  1ACI A;  3F21 A;  2DTR A;  3OYK A;  4IPA A;  1DUX C;  3VPR A;  1DPR A;  1O3Q A;  3ZQH A;  1OYY A;  3U21 A;  1R00 A;  3DLL F;  1XS9 A;  2BY3 A;  2H8R A;  3Q0W A;  4M3B A;  1B8I A;  3G73 A;  4BE0 A;  3CMA I;  4NNJ A;  4CYC B;  3GO5 A;  5TIS C;  1LFP A;  4BQO A;  3B6A A;  3CJR B;  2L02 A;  2M9H A;  2W48 A;  1PYV A;  3IUO A;  2QSF X;  3DEW A;  3KFW X;  4L9T A;  3GZ6 A;  4KIB A;  1BOA A;  4N9H A;  4YII A;  1WJE A;  2CUJ A;  5DV5 A;  1CGP A;  2VOO A;  1FYK A;  3ASN H;  4UUV A;  2D5V A;  3BTC A;  1HST A;  3NRV A;  2Q0O A;  4FQG A;  3RPU D;  3HXL A;  5BS6 A;  1V5F A;  1ODD A;  2F4O B;  4CH7 A;  4WK8 F;  1MKM A;  2L5Q A;  4JK1 X;  3HHH A;  3OYE A;  2EFW A;  3QQA A;  2PX9 A;  2W57 A;  3S93 A;  1SVM A;  3DCF A;  1NK3 P;  2ELJ A;  3CUQ A;  4KIG A;  2RKH A;  4XKV A;  3F22 A;  2DJI A;  3OV8 A;  3KCC A;  5BPI A;  2IS2 A;  5F6F A;  4C3I J;  3S14 J;  3JCU C;  1IXR C;  3H5N A;  5AIQ A;  4MEY F;  2VLA A;  2IA0 A;  1ZGJ A;  1FX7 A;  4DZP A;  1Y56 A;  3GW2 A;  3LA7 A;  2DJN A;  3QOE A;  3LSI A;  1R5I D;  1Y39 A;  3SXY A;  3CTA A;  3K1N A;  3TDU C;  2F5F A;  1UEL B;  1OCZ H;  2VKE A;  5E1X A;  2ID6 A;  2HOT A;  2OBP A;  3ZMS A;  1U78 A;  3IH3 A;  3K1P A;  1IXC A;  1FLI A;  4CA0 A;  4OIR F;  2E35 A;  4GGG A;  2NS8 A;  1I1S A;  3WG9 A;  3GLX A;  1WI3 A;  3HUG A;  1YIT I;  1I6X A;  1Z9C A;  1LDD A;  4UB6 C;  1JT0 A;  1MMN A;  3HPG A;  4RLQ A;  4KDP A;  4NC6 A;  2L7F P;  3J81 Z;  1DDN A;  4PDK A;  1BI2 A;  2OZU A;  1HDP A;  3OYM A;  2RGV A;  3DTE A;  2DOD A;  3J7A O;  1VTN C;  4Q4Z F;  4U7B A;  3TOA A;  3KZY A;  2CW0 F;  1I27 A;  2R7F A;  2QF7 A;  2IGK A;  4ETS A;  1HCR A;  6PAX A;  2R0Q C;  4Q48 A;  1QBJ A;  1KYW A;  5HLG A;  3PNV A;  1ONV A;  5KAF C;  3ZQQ A;  2LY9 A;  2CUF A;  2E1N A;  2JMW A;  5CQE A;  4GDF A;  1GV5 A;  1Z6R A;  2V1N A;  1K79 A;  2O61 A;  1G8X A;  3NAR A;  3A01 A;  1AA7 A;  2XRL A;  2AQE A;  4XLC A;  3MZH A;  1D1A A;  1XG1 A;  2HPI A;  1BIB A;  4F55 A;  1Z3X A;  4XOR A;  5L3C A;  2RN7 A;  3H1C A;  1R5H A;  3V8L A;  4PJL A;  4S0H B;  2KZG A;  3J7Y J;  3L00 A;  3SFZ A;  1OCO H;  1T2K A;  3CD6 I;  2XAH A;  4M74 A;  3RPQ A;  5FO5 A;  1J5Y A;  1G3Y A;  2IGM A;  3CES A;  3P5J A;  1J59 A;  3JAM K;  2GXA A;  1MGT A;  3L9F A;  1MDM A;  1VQ8 I;  2XAU A;  3D5L A;  3P7N A;  5IYB J;  4XK4 A;  3DTK A;  5GAD J;  4EVI A;  1A35 A;  4MFD A;  2E5N A;  3LA2 A;  1HQC A;  4NHJ A;  2HU9 A;  4IEJ A;  3QU6 A;  3S1N J;  2XDV A;  2Z3Y A;  2R7U A;  9ANT A;  1FEX A;  2M8G X;  2FBH A;  4LG3 A;  2Y9Z A;  1W0T A;  1RKT A;  5FFZ A;  3PL8 A;  2FD5 A;  2DA6 A;  3FXM A;  4ON0 A;  1Z77 A;  2ZSH B;  3Q9V A;  3BCA A;  1HXD A;  2HYJ A;  4II2 A;  4CCN A;  4BL0 B;  3SYT A;  5GPC A;  2LOO A;  3W3C A;  2JN6 A;  4LB5 A;  2KRH A;  4WWC A;  1O57 A;  2EWN A;  4LIV A;  4EM2 A;  1JJ8 C;  4BY1 J;  3F23 A;  3F6O A;  2HZT A;  2VT2 A;  4A6E A;  2FOK A;  3BWG A;  1S6L A;  1ZAR A;  1LKX A;  1J7K A;  4ENM A;  2RNJ A;  2BXY A;  3E1S A;  5M5Y J;  2P6T A;  1VND A;  2WAF A;  5F0C A;  5H2F C;  1SFK A;  3IH4 A;  1W5C C;  5ERI A;  3I9V 2;  2A07 F;  1WRJ A;  3H3V K;  3OYG A;  3BZK A;  4FHT A;  2I8D A;  1O7L A;  1RR7 A;  2IS4 A;  3KZI C;  2W00 A;  1Y1V J;  2VBY A;  1UG0 A;  1EA3 A;  1FSH A;  1Z7L A;  5K1Y A;  2DT7 B;  5CVI A;  1WZ2 A;  2HOS A;  4KJZ A;  2NVY J;  4AIK A;  4BJ6 C;  4AVZ A;  2DOF A;  5GAE J;  2R5Z A;  4OMY A;  3TL4 X;  2FF4 A;  1R4N B;  4F7Z A;  2OD5 A;  3BY6 A;  3WGI A;  1Z05 A;  4WXC A;  5GTH C;  5GPA A;  3A0H C;  3DQV C;  4XRF A;  4ZYE A;  3TGN A;  4IHW A;  3RZO J;  3K6G A;  2X6W A;  5DD4 A;  3H35 A;  2H6C A;  3OSG A;  1W0U A;  4IXA A;  3KYL A;  3LSJ A;  4XKB A;  2XGX A;  3EUH A;  3QYF A;  4DJA A;  4A3L J;  4NBQ A;  2ZXJ A;  3B6C A;  3DBR B;  1VQK I;  2BV6 A;  2LKP A;  3AG3 H;  1H9G A;  2XB0 X;  2K9Q A;  4E7J A;  4HQM A;  3O3K A;  2LNB A;  2M1B A;  2LF7 A;  3GTK J;  1UG2 A;  2QWW A;  4FX4 A;  1Q1V A;  1YW7 A;  4I76 A;  3VOD A;  2DA2 A;  1BI0 A;  1R9T J;  1JT6 A;  1USS A;  2VBW A;  3JSP A;  2Q2E A;  3FBI B;  3S15 J;  3AFH A;  2JQ7 A;  5JFR A;  4YFX F;  1I1G A;  2ZJP F;  4C2U A;  3C2G A;  1YOV B;  4D7N A;  3L1P A;  3CCL I;  4JYK A;  1K7A A;  1IF1 A;  2R7W A;  3Q0V A;  2DA5 A;  1A5J A;  3KP7 A;  5GP9 A;  2DT5 A;  2OCE A;  1JI8 A;  1BM9 A;  1KON A;  1VQL I;  3M9A A;  2OTL I;  2VJ4 A;  3KP5 A;  3S1Q J;  2ETH A;  1YFH A;  3HM5 A;  4Q5S F;  1K78 B;  2L7M P;  1T0F C;  3HB9 A;  3NQO A;  1ZG3 A;  5CKT A;  1VFC A;  4KIT B;  4IHT A;  5D8K B;  3G4S I;  3LL7 A;  3GTO J;  1JGS A;  2KIS A;  4ZYD A;  4KN7 X;  2WV0 A;  2OC6 A;  1JKQ C;  5CPR B;  3BPX A;  2KKO A;  1GT0 C;  4UVC A;  4CYC A;  4IJA A;  4EMS A;  1FSE A;  4GCV A;  1Z1D A;  3BJO A;  2E34 A;  2IGO A;  3LSM A;  5HS7 A;  3M7G A;  3I5U A;  1DPU A;  1W36 C;  5LGU A;  3CCJ I;  2DQL A;  5DDG A;  5BMZ A;  1C0W A;  3BTL A;  4AVP A;  1W5S A;  5JHF A;  3FMS A;  2NAZ A;  2YPR A;  3FHZ A;  2HOE A;  3LST A;  3FXJ A;  5HLT A;  1IJW C;  2VAS A;  4CCL A;  3KYC B;  2CV0 A;  3GTG J;  2CSO A;  2Z16 A;  3OWT A;  5F0F A;  2BEO A;  4G7H F;  4PFO A;  4AU7 A;  1LPQ A;  3TOB A;  3OYC A;  2ICW G;  2EIL H;  4BJ5 C;  4MGR A;  4YRV A;  1APL C;  2MD5 A;  2RRE A;  3GLL A;  4WCG A;  2VPL A;  3IKV A;  4B09 A;  4IOA F;  3ASO H;  4CO8 A;  1AHD P;  2KFD A;  2L4M A;  2MC4 A;  5ICE A;  4MNU A;  2DTZ A;  1BW5 A;  5FFX A;  2K02 A;  1IN6 A;  1S7E A;  2NS7 A;  3HIF A;  3G1M A;  4MQ9 F;  3DU5 A;  3B02 A;  2A6H F;  4HW0 A;  4JQF A;  5DM7 F;  1LB2 A;  3BZ6 A;  2CYY A;  4BY7 J;  5HDK A;  1QPI A;  4R8H A;  1AKH B;  1QVT A;  3JW4 A;  4IKF A;  5E1W A;  4O6J A;  3WHC A;  2HQN A;  3HKZ A;  2MFZ A;  2ZME C;  2IVM A;  3BRO A;  3F8B A;  2CV1 A;  3S32 A;  4H4K C;  1ZTR A;  3BZC A;  2FQ3 A;  3HTU A;  4UB8 C;  1CQT A;  1OQY A;  4BQQ A;  1FYL A;  4OIO F;  2R7V A;  4RDU A;  2JPC A;  3LSG A;  1IGN A;  3IL2 A;  2ELH A;  3HUG B;  1K4T A;  1F36 A;  4CZZ A;  4JX5 A;  3V7R A;  2Q1Z B;  2DA7 A;  5J3L A;  2X0L A;  5K5O A;  4RLF A;  3TED A;  3KE2 A;  5LLQ A;  1P4W A;  3F8C A;  2DPD A;  4U88 A;  3NAU A;  1R7J A;  2VKH A;  4P9U A;  4L18 B;  1YIJ I;  2FNA A;  4HDV A;  3OYJ A;  1HOM A;  3JRE A;  1MJB A;  2EZH A;  5E79 C;  2CFX A;  3WU0 A;  1XPX A;  2DFH A;  1N77 A;  2P7C B;  1U9N A;  1WFX A;  1OIS A;  4RMN A;  4Y52 J;  1UST A;  1V4R A;  2M2E A;  4HYE A;  2KDO A;  4XR6 A;  4I01 A;  4XQF A;  1VF9 A;  1MJ9 A;  1QPM A;  4NC7 A;  1ZEL A;  3HOZ J;  2EFO A;  4GXO A;  3CMM A;  3LWF A;  2WAQ A;  3WTV C;  1SFU A;  3S16 J;  2QBY A;  2P81 A;  2ZJ2 A;  4L5E A;  2HR3 A;  2MYS A;  3QYE A;  1ETO A;  1BN5 A;  4K2E A;  3RDI A;  5C4X J;  2V79 A;  2M0C A;  4DGW B;  1QU3 A;  1RRJ A;  3G6E I;  4GO1 A;  3B73 A;  3TKY A;  2UXN A;  2KZV A;  5J4Y A;  1GHC A;  4HG2 A;  4P1W A;  2MSY A;  2VON A;  1JHH A;  3K4K A;  1P7J A;  5EGO B;  3HOU J;  1FC3 A;  2YX4 A;  2VL8 A;  3PUF A;  3HRU A;  3R0A A;  2ZXW H;  1MDM B;  2EA4 A;  4BBS J;  4EV0 A;  3S3M A;  4IQJ A;  2D2W A;  4N4N B;  2QKL B;  2VN2 A;  2GOX B;  2XGE A;  3BR2 A;  3K4M A;  3JRH A;  3SHF A;  2WC2 A;  3HL2 A;  2V7F A;  1D1B A;  4DYQ A;  5LGN A;  2STW A;  1TQP A;  4KIC A;  1BIA A;  2FMY A;  4OOI A;  3I56 I;  2ACJ A;  2MGQ A;  4I98 B;  2FEZ A;  2VJJ A;  1KQ0 A;  2J5P A;  3PQK A;  2HTJ A;  2HDW A;  3KEQ A;  4ZTJ A;  5FKN A;  4BHC A;  5ED4 A;  4IF4 A;  2GWR A;  3ZP5 A;  2M45 A;  4PUS A;  5LBQ A;  2BVM A;  4OAZ A;  2VQH A;  3GTM J;  1QNT A;  3IAM 2;  3MWM A;  1ZK8 A;  5D5X B;  1FP1 D;  2ZB9 A;  3SDG A;  2FRH A;  4EJV A;  2F5C A;  2H6B A;  5B1B H;  2BY2 A;  2CUE A;  1LNW A;  3I58 A;  1WCM J;  2IA1 A;  1B9N A;  2HQA A;  2MC3 A;  3MKL A;  4FCY A;  2X4H A;  2Z1D A;  3HKZ N;  3W6V A;  1HKS A;  3DKX A;  3BQY A;  4HF2 A;  2BVL A;  2ZJR F;  3H5R A;  3HRM A;  4QSH A;  3K0L A;  5HLH A;  3JTH A;  1YIO A;  5E3N A;  4A3F J;  4V19 K;  2EPF A;  1WGX A;  2VPR A;  3FF5 A;  1UHM A;  1GVJ A;  4I6Z A;  4ZH4 F;  3GFL A;  2AO9 A;  2F4I A;  2JA7 J;  1OKR A;  1K83 J;  3NWT A;  4II3 A;  1OPC A;  3FXR A;  1X58 A;  5K7F A;  1A04 A;  2CG4 A;  4J00 A;  3WTT C;  4CCO A;  2EV6 A;  2X6Y A;  1BW6 A;  1ON2 A;  2JVH A;  4XKC A;  2H09 A;  1OCT C;  4IX7 A;  1O3S A;  1GLN A;  5ILU A;  5F1J A;  2R5Z B;  4E7H A;  5JLX A;  3V42 A;  2N8G A;  3MFK A;  4G94 A;  2HTS A;  1TT5 B;  2OAZ A;  4HPQ A;  4RGS A;  2M87 A;  1U8B A;  2H1K A;  3VYT B;  4LLL A;  1H88 C;  3QRF F;  3EYY A;  2NNY A;  2R92 J;  3DBL B;  2EIJ H;  2PJR A;  3JR9 A;  2VJ5 A;  1IC8 A;  1SD5 A;  1U0J A;  3LSK A;  4IQ4 A;  3RCO A;  3V7S A;  5C3E J;  1UAA A;  2IAI A;  1KA8 A;  4BAY A;  2MW8 A;  5DYM A;  1OMI A;  4LK0 F;  4XL9 A;  1X3Z B;  5E3L A;  4HF0 A;  1IZ1 A;  3I55 I;  3IP4 B;  3E0J B;  4C3H J;  2QQA A;  4NUB A;  2ZSI B;  2EBI A;  4UVA A;  4E4H A;  2IGN A;  3RIR A;  1EJ9 A;  2V1U A;  3S2D J;  1SAN A;  1S9H A;  2Z33 A;  4BEH B;  2L01 A;  3WTS C;  1T0F A;  2OQR A;  1E0E A;  2M30 A;  4HEA 2;  2ESH A;  1XB4 A;  2VC0 A;  2Q2E B;  2ECB A;  2EA2 A;  5DCF A;  2G7H A;  1J09 A;  1HKT A;  1QGP A;  5HDN A;  2XKP A;  3GTL J;  4B3A A;  1XDS A;  1VQ7 I;  4HRI A;  2BHY A;  1J0R A;  4FIS A;  4QPQ A;  4F91 B;  2F48 A;  3WU2 C;  3OIP A;  1BJA A;  4RM3 A;  3MVP A;  1WI9 A;  2FX0 A;  2JUG A;  1D8J A;  4XM3 A;  1DQU A;  2VBX A;  1ZN2 A;  3EPZ A;  4UHT A;  4UUS B;  4PZJ A;  1WJA A;  3ONQ A;  3I4M J;  1EF4 A;  3O6B B;  5KHD A;  1LFU P;  5D5V B;  4XLE A;  4EGY A;  3QPL A;  3EQL F;  5J4V A;  3OYF A;  2H94 A;  1A36 A;  4D1Q A;  4XLA A;  5CVR A;  4CYD A;  1YI2 I;  4BDZ A;  2JA5 J;  4I02 A;  3HG9 A;  3IRQ A;  3X2Q H;  4IVN A;  1D3Y A;  3JRF A;  1JTY A;  2L2O A;  3E6M A;  2P5V A;  2X6X A;  5L3B A;  2J5O A;  2D1H A;  2BYV E;  1ETQ A;  2WA0 A;  4G6T B;  5CYV A;  2H27 A;  1R1U A;  1X1C A;  2X1C A;  3CCQ I;  4E7K A;  1YW9 A;  2PMH A;  2UZK A;  2DOE A;  2DW4 A;  3GZN B;  2QUF A;  1RES A;  4U0W A;  1P6R A;  1XGO A;  2CQQ A;  2JZY A;  2GA2 A;  2LC2 A;  3JRA A;  4N0B A;  3OIO A;  2PEX A;  3K4B A;  2L9S A;  3T0Y A;  5IP6 A;  4O5V A;  3ZQC A;  1GV2 A;  4G12 A;  4MO7 A;  2RC4 A;  1LJ9 A;  3A4C A;  5FKO A;  2KPM A;  2L7Z A;  1ZAO A;  1IG7 A;  4GRI A;  1FBU A;  3JTG A;  4RS8 A;  2WY7 Q;  3F6V A;  5LEJ A;  3WTU C;  1W1W E;  3DWL E;  3D5R C;  3ECH A;  2RVC A;  3K7A J;  3ZMV A;  4J01 A;  3HOV J;  1HC8 A;  5E3M A;  2XSD C;  2WBM A;  2BHZ A;  1ETW A;  1WWX A;  2XVC A;  3FIS A;  2QYO A;  4LJZ F;  2O3F A;  3CLO A;  1WHU A;  2EFQ A;  4U7D A;  4LIT A;  2R4G A;  3CF2 A;  1R71 A;  1YW8 A;  4PJM A;  1AKH A;  5HVQ C;  2PI0 A;  3S1M J;  3AG4 H;  4AC0 A;  1RPW A;  2F4M B;  2A5Y B;  4U0V A;  2XB5 A;  3QP6 A;  3ZMT A;  3LMM A;  1MW7 A;  2F2E A;  3RQ4 A;  1YQA A;  1QO0 D;  3ROU A;  1ZYR F;  1MSE C;  2HZD A;  3CF5 F;  4XID A;  3BQZ A;  3CJT B;  5CVJ A;  2AXT C;  3JRG A;  2QM3 A;  2EZI A;  1YHQ I;  1LE8 B;  2VXZ A;  3R6S A;  2C6Y A;  1PUF A;  5H6Q A;  4M6X A;  1YE9 A;  2BBY A;  5EDN A;  2LY2 A;  1EH7 A;  1FOY A;  4M3F A;  1MH4 A;  1VQP I;  2FOW A;  5DCM A;  4RAY A;  5LHG A;  5E8I A;  4BJT A;  3GTQ J;  1TW2 A;  3PFY A;  1ZKG A;  2EQR A;  4A12 A;  3FM3 A;  4G6Q A;  1OYW A;  4P9F A;  2E5Z A;  1VQN I;  1F43 A;  1G59 A;  2DQR A;  2QBY B;  5GTI C;  3L2R A;  1MSF C;  2LKX A;  1ERD A;  3RZD J;  1HW2 A;  3FXO A;  3HRT A;  4HNU A;  3H9J A;  1XTA A;  1YG2 A;  3V4G A;  2X1E A;  2E71 A;  4ZC3 A;  4XOT A;  1X19 A;  5HS8 A;  2XAG A;  2PQ8 A;  1I6H J;  2DFI A;  4LD5 A;  2XRN A;  1FMV A;  1WPK A;  2DT6 A;  5FRM A;  1B72 A;  4A93 J;  4RM2 A;  2VE9 A;  3PQJ A;  4XN3 A;  1ZLJ A;  3I71 A;  5EGO A;  4YFN F;  2CJJ A;  2V4J C;  2Y69 H;  3P9K A;  3N4M A;  5EYR A;  1VQ4 I;  1POG A;  1SD7 A;  2BXZ A;  3RYP A;  1UMQ A;  2JPB A;  3ZQF A;  1ZRC A;  1TW3 A;  3QOP A;  4M73 A;  5F04 A;  1IRX A;  2LDU A;  1KU7 A;  4QLC U;  3HOY J;  1PJR A;  5IP9 J;  2JTV A;  3CC2 I;  2JA2 A;  1T08 B;  3GBG A;  1G6N A;  1Z7U A;  2LVS A;  3BJ6 A;  4DQ2 A;  1K6O A;  1IV6 A;  4ZDL A;  1BI1 A;  1TWG J;  1BR4 A;  2W1O A;  2O8K A;  1GVD A;  1YJW I;  2I10 A;  2HYF A;  1TWF J;  3RKQ A;  4RAG A;  3HC7 A;  4KMF A;  2NVT J;  3H92 A;  3ZQ7 A;  2A3S A;  4I99 C;  3I54 A;  5FLX K;  2DA1 A;  1YRN B;  2BW3 B;  2QVO A;  1SVO A;  1HSJ A;  2IEK A;  1RUO A;  2HFH A;  1S5L C;  5IPA A;  3FXL A;  5FLV A;  4ZDP A;  4E7L A;  1D0Z A;  1MBH A;  4OIQ F;  5IOZ A;  3FXQ A;  1X3W B;  2KIU A;  5C44 J;  2STT A;  1SC7 A;  2KT0 A;  3C7J A;  4IZZ A;  3IV5 A;  2F5D A;  1HKQ A;  4ZYG A;  1ETY A;  2M34 A;  1G3S A;  2ADU A;  3DXJ F;  3MCZ A;  1SD6 A;  1JKP C;  4IHY A;  4BKX A;  1TT0 A;  1J2X A;  4L9N A;  5BOX A;  2LFB A;  4LG0 A;  2JK3 A;  2XUB A;  3QYB A;  1O3T A;  2Y0M A;  3K70 C;  1H89 C;  4YIF A;  1ZRE A;  1UJ8 A;  3U2R A;  4CZC A;  4HA8 A;  3PIO F;  3CMY A;  1IRG A;  5EEG A;  4JX6 A;  3J7A Y;  3OMY A;  4ESB A;  2OUM A;  3G2B A;  5D6E A;  1IDZ A;  4PFP A;  4A2U A;  4IL6 C;  5EEA A;  4EGZ A;  3GZ5 A;  3FBN B;  4EAT A;  3K69 A;  3SJM A;  1YJ9 I;  1MMA A;  2DOA A;  2V1D A;  3QOD A;  1TLH B;  4ESF A;  4LOC A;  1LFB A;  3O8G A;  3OR2 C;  3VWB A;  4NB5 A;  2ZO4 A;  2CU7 A;  2X9D A;  3CLQ A;  4KYW A;  1QVU A;  3H0G J;  3DP7 A;  4X1E A;  2OZ6 A;  2YSR A;  1QA6 A;  3RKY A;  4G9Y A;  2D1V A;  2PJR B;  2GIV A;  3OYD A;  3ML6 A;  1IXS B;  3JRC A;  2W82 A;  2DK5 A;  4BDY A;  2JA6 J;  2EJR A;  2OQG A;  2UUZ A;  4AYB A;  3L2Q A;  3MN2 A;  5J1U A;  3DPL C;  3I59 B;  2FJ1 A;  3GTJ J;  3QPS A;  3CQZ J;  3IKT A;  3GME A;  1SFX A;  2KMU A;  5B3S H;  2FNP A;  3OYN A;  5FB2 A;  3UNG C;  2Y31 A;  4A3K J;  5FKK A;  4BEH A;  4Y17 A;  1B1B A;  3HSF A;  3AG1 H;  3WE3 A;  1S29 A;  1E3P A;  2K3F A;  2E36 A;  1SD4 A;  3HRS A;  5CVU A;  3TQN A;  5B66 C;  3CJQ B;  4YG2 F;  3OL3 A;  5JHU A;  1VQO I;  1IN7 A;  5L3F A;  3M1C A;  2TCT A;  4N4O B;  3H3Z A;  5D8L B;  2CQK A;  1DU0 A;  1SFE A;  3MZ8 A;  1XX5 A;  4EM0 B;  1BL0 A;  2CS3 A;  1S7A A;  4RAF A;  3PNY A;  3REO A;  4JX4 A;  4RB1 A;  4IHV A;  2KLO A;  3H9G A;  4C9Y A;  3FIW A;  1FTT A;  1RKW A;  3LOC A;  1BBY A;  4UUS A;  1TTY A;  1JKO C;  1FOX A;  3JAM Z;  1HF0 A;  4KT6 A;  4AIH A;  4FTH A;  4BAC A;  3N05 A;  1Y0N A;  3GF2 A;  1YX3 A;  4M72 A;  4CCK A;  1OCC H;  4IO9 F;  3HZJ A;  2GOM A;  4QTR A;  5J1Y A;  1L3L A;  3NEU A;  2JA8 J;  3PO3 J;  2E2J J;  3FMR A;  3GXO A;  4FT8 A;  3DPU A;  3GWZ A;  4F92 B;  2KJB A;  2RDP A;  2VBZ A;  2VB6 A;  5E3O A;  5H20 A;  5TRD A;  3ZQI A;  3HOX J;  2JRT A;  1UHW A;  1SMT A;  4MIM A;  2EZK A;  3KIO A;  4PSX A;  3DFG A;  1XCV A;  2LLK A;  4NQW B;  3T8R A;  5FLX Z;  2WWY A;  1MBJ A;  4E6K G;  2VUM J;  5LEK A;  1U5T C;  1P92 A;  4C30 A;  1TP4 A;  4C3J J;  3BG6 A;  2LYC A;  2EV5 A;  1XGN A;  2Y48 A;  1JUS A;  1MJA A;  1KU9 A;  1ZHF A;  3VSL A;  3S1R J;  1GDT A;  3DKY A;  4NDL A;  2JVG A;  3C2H A;  5EEH A;  5AIP A;  2FA5 A;  2WTE A;  4UXN A;  5LHI A;  1ZQ3 P;  2G7U A;  5ILS A;  3ERE D;  2ZME B;  4OMZ A;  3BR3 A;  1WH7 A;  4UV9 A;  4CDG A;  3KET A;  4X0G A;  3FDY A;  4CCJ A;  3BR1 A;  3BG7 A;  2E2H J;  2B9S A;  1XSV A;  1JHF A;  2R7R A;  4I09 A;  1F4K A;  2V26 A;  3RSN A;  1ZR2 A;  4HF1 A;  4RGU A;  4ZZD A;  1SFO J;  3K4J A;  4UUT A;  4HX4 A;  2CGP A;  1UFM A;  1PP8 F;  3G1O A;  2DO7 A;  3H3U A;  2Y0S A;  1WJB A;  4A5M A;  1MBE A;  2MH2 A;  4M9Z A;  1RNL A;  3HHG A;  3DEE A;  3MEX A;  4XNF A;  3TBI A;  2DYR H;  2LKS A;  5IT9 K;  2CFO A;  1FIA A;  3QPH A;  4KA4 A;  3COA C;  4LMY A;  5BQT A;  3CME I;  1FT9 A;  1BA5 A;  3KLN A;  4AYB N;  5HLI A;  5EG0 A;  3M1E A;  2NYX A;  2KIM A;  2A5W A;  1U6G A;  2A6E F;  4HX7 A;  3FWE A;  1IAW A;  2R7Z J;  3LAP A;  4Y4R A;  5FD6 A;  4LLN A;  1E17 A;  3ZN0 A;  1I3Q J;  3DPT A;  2PMZ N;  5M3F J;  1FMW A;  4O3M A;  3DBH B;  3QP5 A;  2H1L A;  4LIU A;  4V2F A;  4WXH A;  1ZG1 A;  1LE8 A;  3M8J A;  2HDD A;  2FU4 A;  5K7H A;  3LSH A;  4MTD A;  1PUF B;  4XIC A;  2K7L A;  2V6C A;  3JRD A;  1CF7 A;  1LVK A;  2CW7 A;  1UZC A;  2DFF A;  5FLM J;  2ELK A;  5J40 A;  1MMG A;  1REP C;  3F8M A;  1EV7 A;  3C1D A;  3WTZ A;  5DCM B;  3G3Z A;  2COM A;  1FJL A;  3WU1 B;  3CCE I;  3A0B C;  3SEQ A;  3H0D A;  1MIJ A;  1AU7 A;  1SVL A;  1HLV A;  2UXX A;  3IHU A;  1IW7 F;  1TNS A;  2R7O A;  4CSW A;  1IRF A;  2HWV A;  2XPU A;  3BG3 A;  3K4N A;  4HAM A;  2KL4 A;  1R4M B;  4R1H A;  4B47 A;  5JVG F;  5BPD A;  4EJU A;  3K2A A;  3ABT A;  4RAZ A;  5A2Q K;  1D5Y A;  1FP2 A;  2G0E A;  2LH9 A;  5HOD A;  1FOK A;  1ZGW A;  5TGT A;  2VKV A;  3E6D A;  2DU9 A;  2XRO A;  2OPT A;  2ISY A;  3KX2 A;  4ITV A;  3F0C A;  4B1R A;  4MTE A;  2JRM A;  4ANJ A;  3NWS A;  5J8C A;  5D5U B;  3HOS A;  1YJN I;  3LAJ A;  4I7H A;  4NC8 A;  2K85 A;  1TWC J;  4BXU A;  3G71 I;  2HVR A;  1B72 B;  1P2F A;  4RB2 C;  2B0L A;  2CQ7 A;  4LB6 B;  4GFB A;  2KRC A;  3FK6 A;  4XKW A;  2E1M B;  3T5X A;  2DA3 A;  1XMA A;  4LFU A;  1RR8 C;  2L9R A;  1GUU A;  2M8E A;  2QZ8 A;  3LSP A;  2OV7 A;  2RAE A;  3KLO A;  4A0Z A;  2KP6 A;  5FD5 A;  2XF5 A;  3MKZ A;  3ZCO A;  1TBX A;  3C18 A;  1LEB A;  3TO6 A;  2DA4 A;  2Y9Y A;  3V8J A;  1MNE A;  1F1Z A;  1N75 A;  1WJD A;  1H9T A;  1YS7 A;  3CCS I;  1IDY A;  3I64 A;  3ABL H;  3SZG A;  1LDJ A;  1G4D A;  1YRN A;  2CQX A;  2BW3 A;  3MMY B;  3RYR A;  4DIQ A;  3WTW C;  2HVQ A;  1FBQ A;  4MFE A;  2Y0S N;  3A1Y A;  2VOP A;  3PUB A;  3MQ0 A;  1R1V A;  1B4A A;  2E1M C;  3K9T A;  4M3D A;  2A61 A;  3CDI A;  1XGM A;  2ECC A;  1E3O C;  3BR0 A;  3S8P A;  1X1D A;  2M0M A;  1R23 A;  3CUO A;  5KK1 A;  4XLF A;  2CWE A;  1N78 A;  2QQ8 A;  4KIS A;  3ESW B;  3OY9 A;  2XF7 A;  4LG0 B;  1AOY A;  3S2H J;  2WAD A;  1ETK A;  2GZW A;  1W4M A;  2O7O A;  2GQQ A;  5CQG A;  1R22 A;  3ISP A;  1R58 A;  2UV1 A;  4JBA A;  5TJJ A;  2EZL A;  3Q9S A;  2DDA A;  2HOA A;  1IN4 A;  2LG4 A;  2Z99 A;  3KP3 A;  5J8F A;  2DYS H;  5JR3 A;  2ISZ A;  2DI3 A;  1R6R A;  3N97 A;  2XSJ C;  3UKG A;  3OOP A;  3ZMZ A;  3BR6 A;  3WTX C;  4ENN A;  3TDZ C;  2P5L C;  2DCE A;  4PJJ A;  4UV8 A;  5DEQ A;  5E1Z B;  1QHG A;  4E70 A;  5IY5 H;  3Q5F A;  2PN6 A;  5IT3 A;  2VC1 A;  2R3S A;  2DMU A;  4HX8 A;  1XGS A;  4M3E A;  3RQI A;  4IRG A;  1OYI A;  2HXI A;  4A3M J;  3IWF A;  2HPM A;  2G9W A;  4G7Z F;  5FRN A;  2K9M A;  2R7T A;  3U1K A;  2BY1 A;  1XDU A;  4UVB A;  2VOD A;  4U87 A;  4ZDO A;  1I50 J;  3V7C A;  1OFC X;  2A05 A;  4RB3 C;  4YIR X;  3GYH X;  2YX7 A;  3I59 A;  1SEU A;  4Y3O A;  2IXS A;  1WJC A;  5JVT A;  2FQ4 A;  4G8X A;  5M5X J;  3ZMD A;  2XIG A;  5EZG A;  3L2U A;  3MKW B;  3HOT A;  1Y6I A;  1U9O A;  4B4C A;  1XMX A;  4E7S A;  1Z91 A;  4M9X A;  1STZ A;  3TO9 A;  2JSP A;  3JRB A;  1HW5 A;  3M3Y J;  1N25 A;  2KHM A;  1XC5 A;  3F8N A;  5A2Q Z;  2ZFU A;  1NG6 A;  3ZGK A;  1T39 A;  1LDK B;  1V5E A;  5EF6 A;  2FBI A;  3D1N I;  3TW7 A;  3HDD A;  2YS9 A;  2GLO A;  1HDD C;  1VQ6 I;  4X6A J;  4A69 C;  2HGC A;  2XPV A;  1FWZ A;  3TP0 A;  1FOW A;  3HGY A;  2HDC A;  1X4P A;  5D4R A;  2B7E A;  4ENK A;  2QKM B;  2QSG X;  1KU3 A;  1ZR4 A;  1FPQ A;  1U5T A;  2MA3 A;  3MAJ A;  3PM1 A;  2RNG A;  1F5T A;  4HV5 A;  1TWA J;  3KP4 A;  2GM4 A;  5JI6 A;  1X2N A;  1FZP B;  3FKI J;  1Z3Y A;  4HOB A;  3E6B A;  4HNT A;  3LFK A;  3CCY A;  2V6E A;  2DBB A;  2DFE A;  1OLT A;  1NH3 A;  4C2T A;  4A3B J;  2RQP A;  3D0S A;  4A3E J;  4BS9 A;  4A3C J;  1S8N A;  2XGD A;  1B59 A;  2XHK A;  2W7N A;  1RIO H;  1KU2 A;  5J6X A;  5E18 F;  4BHP A;  1YYV A;  1PVE A;  2L9V A;  2O5R A;  1VQ9 I;  4D5C A;  1X1A A;  1FTZ A;  4ENJ A;  3GFI A;  3RPU A;  5D4S A;  2L54 A;  5LHH A;  4NQW A;  2K3P A;  4RA2 A;  3WE2 A;  1KYZ A;  1Z67 A;  2OCC H;  4MHG A;  3W2A A;  3UR3 C;  1W36 D;  3RKW A;  3H36 A;  4ZYA A;  3L7W A;  4Y13 A;  2OTJ I;  4BYY A;  2LY1 A;  3SQN A;  4Z2Y A;  2QQB A;  3VYR B;  5FJ8 J;  2Y30 A;  1G3W A;  1WQ2 A;  3PIP F;  2ZME A;  2GA1 A;  2P8T A;  3OYB A;  1Y1W J;  4MQV A;  1QZE A;  1T98 A;  5CVV A;  4XLP F;  2IW5 A;  1WSU A;  4Q47 A;  2K9S A;  2L4A A;  2K86 A;  1Z21 A;  3IWZ A;  1A6Q A;  2E7X A;  5FRO A;  4ABZ A;  1R1T A;  3KEY A;  5ICF A;  2A68 F;  2HYG D;  4P96 A;  3I0T A;  2E19 A;  1NG7 A;  1XSX A;  4RBO A;  1H0M A;  3I4N J;  1MBK A;  3ERM A;  2EFP A;  3WTY C;  3DLA A;  2VE8 A;  1DGR M;  4PSW A;  4ZYH A;  2IS6 A;  1IN8 A;  3TO7 A;  2L3D A;  2WY8 Q;  2QA4 I;  1YO5 C;  1Z0X A;  3CP2 A;  2R7D A;  2R5Y A;  2MAB A;  3MD2 A;  3VDX A;  4XSZ F;  3SFI A;  1J75 A;  2HS5 A;  2OF7 A;  4L5J A;  2VXD A;  3R4K A;  5EG0 B;  3OYA A;  3KP6 A;  1OJL A;  3BOQ A;  3L2C A;  3O8H A;  4KFC A;  5LRR A;  2B63 J;  4BE2 A;  1JKR C;  3WHB A;  5K5Q A;  3R61 A;  2M7A A;  4RB0 A;  4BBR J;  3PSF A;  3H9Q A;  4JOM A;  1U3E M;  3CO7 C;  2MBF A;  2MH9 A;  4CHU A;  1AWC A;  1BOB A;  2LRD A;  4HDU A;  1FNN A;  2NVQ J;  2ZNY A;  3S2W A;  2F5E A;  5LD2 C;  2W85 A;  5CLS A;  4UNO A;  2LK2 A;  1Z6T A;  4B44 A;  3ZN1 A;  3Q3S A;  2HI3 A;  4XSX F;  2MLG A;  4MEX F;  1X1P A;  2EK5 A;  1W7P B;  4XLH A;  2X51 A;  3TW6 A;  4Y15 A;  1CF7 B;  2E1C A;  5M3M J;  2IT0 A;  4M71 A;  1YX5 A;  4HLY A;  3OS2 A;  4I2O A;  3PFI A;  4KIF A;  5F0H A;  3DTI A;  4KT5 C;  1QHH D;  3IH2 A;  5K5R A;  5K7Z A;  4FE4 A;  3J80 K;  3S3N A;  2BY0 A;  3K1M A;  2AQF A;  4BXX J;  5ILV A;  2A69 F;  2W24 A;  2KQR A;  3FK7 A;  4PJN A;  5KCM A;  1MNM C;  1MBF A;  3ZR8 X;  5E20 A;  4HST A;  4DBQ A;  3PJR A;  2XF6 A;  2LBF A;  3LA3 A;  4OU0 A;  2V1X A;  2PFB A;  5DM6 F;  2VJI A;  1WH5 A;  2LSO A;  4JP0 A;  1XN7 A;  1MH3 A;  3TP3 A;  2X85 A;  1K61 A;  3CC7 I;  2R7X A;  3E5X A;  2VIX A;  2K4B A;  1XSD A;  1BR2 A;  2HXO A;  2KJC A;  2Y2Z A;  3HEF A;  4BU2 A;  2GXB A;  3ZQG A;  4F3Q A;  3K2Z A;  5LGT A;  5F08 A;  5LRS A;  1B6A A;  2LTP A;  1MMS A;  4OWR B;  2EB7 A;  4XON A;  4EJW A;  2P6S A;  4P5O A;  5KAI C;  2ZXH A;  2QGU A;  2TRT A;  3M8F A;  2K9L A;  1RZ4 A;  2DLL A;  2ZFW A;  2ZCW A;  3R0J A;  3RTR A;  1ZH5 A;  1MBG A;  3FX3 A;  3ABU A;  4PGG A;  3OYH A;  2DMN A;  3SZT A;  3P9C A;  3A02 A;  5AON A;  1T8I A;  4ZJZ A;  1SAX A;  3GFJ A;  3OOU A;  4KUM A;  3M4O J;  3KEO A;  3CCV I;  4DBR A;  4IRH A;  2K40 A;  3QAH A;  3IC7 A;  4XRS A;  1E3H A;  4IHS A;  3FMQ A;  2FXA A;  4E7I A;  3RJP A;  4PCQ A;  3KZZ A;  1SAU A;  2HQ5 A;  1P9Q C;  1P7I A;  2DMQ A;  1FBS A;  2O8X A;  3BP8 A;  2LP0 A;  2DMP A;  5B1A H;  2IRF G;  2XAS A;  3E97 A;  2QCO A;  3FXU A;  3KPH A;  1RC9 A;  2OU2 A;  2W84 A;  3O2P E;  2UWM A;  2BOL A;  1HBX G;  1VZ0 A;  3I3L A;  1D1C A;  3WG7 H;  4ZZL A;  1I3A A;  1FY7 A;  1GXQ A;  4L9J A;  2IP2 A;  5FKL A;  1T6S A;  2YR2 A;  1JGG A;  2E7W A;  1ULY A;  2F6C A;  2CW8 A;  3A03 A;  2HKO A;  4DZJ A;  4HV6 A;  3SZP A;  3ZRG A;  3W6J B;  4D7M A;  3ECO A;  1S3J A;  2FBK A;  2X1D A;  3BT9 A;  3QU3 A;  4BQA A;  4G6D A;  2NNN A;  3F3X A;  4P55 A;  3ZMU A;  2VQC A;  4YEJ A;  4AD9 A;  1DP3 A;  4OIN F;  4A6D A;  2GIZ A;  2IBD A;  1R5G A;  2YU9 J;  1WJF A;  5J47 A;  2EFN A;  1TC3 C;  1F9N A;  4EQQ A;  1TNT A;  2O0Y A;  4C2M J;  4BXF A;  3BTI A;  4D0P A;  1WVR A;  3OR1 C;  2QQ9 A;  1RUN A;  3CCR I;  2VI6 A;  4WX9 A;  1QZZ A;  2O6G E;  2OA4 A;  3CJN A;  3GX4 X;  4L5I A;  1LVA A;  1IO2 A;  5F1R A;  3GFM A;  1X3U A;  3HJE A;  1O3R A;  4GYG A;  2XAJ A;  4F93 B;  3E6C C;  3I4P A;  4M6V A;  4EJO A;  3DEU A;  3AG2 H;  3CDL A;  3CDH A;  3J80 Z;  1ZGA A;  3K4C A;  5CJ9 A;  2ME6 A;  4ASN A;  5D6F A;  2HEO A;  2PMZ A;  2QLZ A;  3HYI A;  1I5Z A;  1JE8 A;  3BCB A;  2ZBK A;  2R7S A;  1ORK A;  5JLW A;  1ETV A;  4AID A;  4FE7 A;  4BH9 A;  2IA2 A;  3LSR A;  1IUY A;  1BJZ A;  3RKX A;  2P4W A;  3VB2 A;  4CXF A;  5GAH J;  1FYM A;  1T95 A;  2ZC2 A;  4A5N A;  2M7B A;  2JUC A;  3LFU A;  5F27 A;  2NVU B;  2Y75 A;  1I39 A;  1T33 A;  2GXG A;  5FKM A;  2PMU A;  2JJ7 A;  2H8W A;  4YEL A;  2MLK A;  2AHQ A;  3WOD F;  1X4O A;  3GCM A;  4EJT A;  1U5T B;  2Z2S B;  3W6K B;  1JUM A;  4BGD A;  4S04 A;  5E17 F;  5IOY A;  1ON1 A;  3OIQ A;  3U1D A;  5DD8 A;  5L3E A;  2AS5 F;  1SMY F;  1TQM A;  1PP7 U;  1RET A;  4WXD A;  4M6Y A;  2EIK H;  3G1L A;  1WJ5 A;  2WB1 A;  2XAF A;  2YUS A;  2QEX I;  1EH6 A;  1L0O C;  3EET A;  2EIM H;  4L9V A;  1KQ8 A;  1TL8 A;  3CC4 I;  1DU6 A;  3I53 A;  4IOC F;  4IRI A;  2CV2 A;  3DF8 A;  3Q0U A;  1OR7 C;  3AKZ A;  1JTX A;  1MZB A;  4DW6 A;  1B9M A;  1GXP A;  5IYD J;  2W25 A;  2ZNZ A;  3BR5 A;  4M9S A;  4HQE A;  4IHX A;  4I0B A;  4Z6Y A;  1TZL A;  3P9I A;  2FUG 2;  3VSK A;  2GBY A;  3FHN A;  1B8I B;  2ESN A;  4QIW N;  2IJL A;  2KDZ A;  1LUJ B;  3CZ6 A;  4D5F A;  2HVS A;  4XN0 A;  2PG4 A;  1BC8 C;  1UCR A;  2NOJ B;  2OJE D;  4HNV A;  5HNF A;  3TMO A;  1KQ9 A;  2R93 J;  3EUA A;  3BJA A;  3GUD A;  1Y8Q B;  3ZPL A;  2LMD A;  5L3G A;  3C2B A;  2CRG A;  4HLX A;  4A3G J;  5KVR A;  3DU6 A;  1PDN C;  4Y7N J;  4W97 A;  4ESJ A;  3K4L A;  1ZRD A;  4A3D J;  3WGG A;  2R7Q A;  2R5Y B;  4L0Z B;  2XGC A;  1A6I A;  3EDP A;  1VI0 A;  1T56 A;  3CUQ B;  4H0E A;  1UB9 A;  4BUP A;  2AXL A;  3PNT A;  4DYR A;  2VT3 A;  3H5A A;  4HZF A;  1A31 A;  2RV8 A;  2DK8 A;  3GVA A;  3MKY B;  1K6Y A;  2VKD A;  1V54 H;  2XKO A;  5HNH A;  1V5G A;  2LF8 A;  2XAQ A;  3K10 A;  5LFA A;  3F8F A;  2K4J A;  2O9L A;  2XC7 A;  2XPW A;  1QRY A;  1XCB A;  3C3W A;  3ZQL A;  2M4G A;  2BGC A;  4Y33 A;  3KP2 A;  4PK4 A;  1NTC A;  1W7P A;  4KMU X;  4CGZ A;  4OIP F;  1XD7 A;  2A6T A;  3LNQ A;  2PJP A;  3VOE A;  4F52 A;  1TQI A;  3CUQ C;  1X1B A;  5H6R A;  2EV0 A;  3U9G A;  4DOZ A;  4W1U A;  2RQQ A;  2DN0 A;  2IPQ X;  2IS1 A;  1JXS A;  4J19 A;  3D5S C;  5ICC A;  4BE1 A;  5DUK A;  1S7O A;  1D0X A;  2Z9O A;  4A3I J;  3T1B A;  3GTP J;  1ZRF A;  2V9P A;  4KNY A;  1Y8R B;  5D5W B;  4PJ0 C;  2NVX J;  4XRM A;  2DPU A;  4GYI A;  1U8R A;  2ID3 A;  5IYC J;  3EUK L;  3VFZ A;  2WB1 N;  3F72 A;  3OSF A;  1IUF A;  2Q8K A;  1BC7 C;  3FZV A;  3KYD B;  2LBF B;  3S17 J;  3PSI A;  1NK2 P;  2P7V B;  1Y0U A;  3E3V A;  4A0Y A;  2CUZ A;  3HGG A;  1Q1H A;  1LEA A;  3E5U A;  4B3X A;  2KIF A;  5EJC A;  5GAG J;  5KNL A;  2DXI A;  1W7P D;  3HPH A;  5IP7 J;  4EM1 A;  2D45 A;  3HOW J;  5DS9 A;  3SDB A;  1MD0 A;  4I0A A;  4QPO A;  1HA8 A;  3A01 B;  3IRR A;  2WAE A;  1O7F A;  1T38 A;  4LLG F;  4XRS G;  5EZH A;  3V8K A;  1MMD A;  3PO2 J;  2JSC A; 
#chains in the Genus database with same CATH homology
 3EYI A;  5HOO A;  5L3D A;  3DV8 A;  4LK1 F;  1RI7 A;  3FM5 A;  2M5W A;  1W5T A;  3ELK A;  2TDX A;  3JSO A;  1IN5 A;  2O03 A;  3M8E A;  3GEZ A;  3VEP A;  2QEN A;  4WF2 A;  2ZKZ A;  2P5K A;  3AAF A;  4CIC A;  1KGS A;  4PGH A;  2HKX A;  3BDD A;  2XV4 S;  2HQR A;  4RGX A;  4XLN F;  2PLY A;  3HSR A;  4QWQ A;  5FGM A;  1V3F A;  1YS6 A;  2FE3 A;  2KRF A;  5IT9 Z;  4XBF A;  3L09 A;  1QQI A;  2NRA C;  1XMK A;  5DUI A;  2BE5 F;  2FML A;  3RI4 A;  2NS0 A;  2V9V A;  4DNC A;  4LGW A;  1U2W A;  3CO6 C;  1PUE E;  1ZLK A;  3HTS B;  3QPT A;  4BHB A;  1D8K A;  4B8X A;  3ULQ B;  2DAO A;  1WKM A;  1LQ1 A;  4S05 A;  2K27 A;  4RGR A;  2JT1 A;  2Z5U A;  4HBL A;  4BNC A;  1DP7 P;  3WGH A;  4TV7 A;  3T8T A;  1EH8 A;  1HW1 A;  2GAU A;  1YLF A;  1J9I A;  4FX0 A;  1ZG5 A;  2YU3 A;  5E8G A;  4AIJ A;  3J81 K;  1P4A A;  4KN4 X;  4YFK F;  1NHA A;  4L0Y B;  1G3T A;  1OR7 A;  1R36 A;  4G7O F;  4A0X A;  3MZY A;  3BPV A;  3LQR A;  3DKW A;  3LQQ A;  2CO5 A;  5HDG A;  4U0Y A;  2FSW A;  1BI3 A;  1YTY A;  3E5Q A;  1E2X A;  4AWX B;  3HSE A;  3R60 A;  4R79 A;  1D5V A;  4N9I A;  5HS9 A;  5F64 A;  1P4X A;  2PBI A;  5ICG A;  1QZY A;  1K78 A;  3F21 A;  2DTR A;  4IPA A;  1DUX C;  1DPR A;  1O3Q A;  1OYY A;  1R00 A;  3G73 A;  3GO5 A;  2L02 A;  3KFW X;  4L9T A;  3GZ6 A;  4KIB A;  1BOA A;  4N9H A;  4YII A;  5DV5 A;  1CGP A;  2VOO A;  1FYK A;  4UUV A;  1HST A;  3NRV A;  2Q0O A;  5BS6 A;  1ODD A;  4WK8 F;  1MKM A;  4JK1 X;  3HHH A;  2EFW A;  2W57 A;  3CUQ A;  4KIG A;  2RKH A;  3F22 A;  3OV8 A;  3KCC A;  5BPI A;  5F6F A;  1IXR C;  5AIQ A;  4MEY F;  2IA0 A;  1ZGJ A;  1FX7 A;  3GW2 A;  3LA7 A;  3SXY A;  3CTA A;  3K1N A;  3TDU C;  2F5F A;  5E1X A;  2OBP A;  3ZMS A;  1U78 A;  3K1P A;  1IXC A;  1FLI A;  4OIR F;  4GGG A;  1I1S A;  3WG9 A;  3GLX A;  3HUG A;  1I6X A;  1Z9C A;  1LDD A;  4KDP A;  1DDN A;  3J81 Z;  4PDK A;  1BI2 A;  2OZU A;  2RGV A;  3J7A O;  1VTN C;  4Q4Z F;  4U7B A;  3TOA A;  3KZY A;  2CW0 F;  1I27 A;  2R7F A;  4ETS A;  6PAX A;  4Q48 A;  1QBJ A;  5HLG A;  1KYW A;  1ONV A;  2E1N A;  1Z6R A;  1K79 A;  2O61 A;  3MZH A;  1BIB A;  5L3C A;  2RN7 A;  1R5H A;  3V8L A;  3L00 A;  3SFZ A;  1T2K A;  2XAH A;  4M74 A;  3RPQ A;  5FO5 A;  1J5Y A;  1G3Y A;  1J59 A;  3JAM K;  1MGT A;  3L9F A;  1MDM A;  3D5L A;  3P7N A;  4EVI A;  3LA2 A;  1HQC A;  4NHJ A;  3QU6 A;  2Z3Y A;  2FBH A;  5FFZ A;  4ON0 A;  3Q9V A;  1HXD A;  4LB5 A;  4WWC A;  1O57 A;  2EWN A;  4EM2 A;  3F23 A;  3F6O A;  2HZT A;  2VT2 A;  4A6E A;  2FOK A;  3BWG A;  1S6L A;  1ZAR A;  1J7K A;  4ENM A;  2RNJ A;  2P6T A;  5ERI A;  2A07 F;  1WRJ A;  4FHT A;  1O7L A;  2VBY A;  1FSH A;  5K1Y A;  5CVI A;  4AIK A;  4OMY A;  2FF4 A;  4F7Z A;  2OD5 A;  3BY6 A;  3WGI A;  1Z05 A;  4WXC A;  3DQV C;  4XRF A;  4ZYE A;  3TGN A;  5DD4 A;  2H6C A;  4IXA A;  2XGX A;  3EUH A;  2ZXJ A;  2BV6 A;  2LKP A;  1H9G A;  4HQM A;  3O3K A;  2LNB A;  2M1B A;  2LF7 A;  2QWW A;  4FX4 A;  1YW7 A;  3VOD A;  1BI0 A;  1USS A;  2VBW A;  3JSP A;  2Q2E A;  5JFR A;  4YFX F;  1I1G A;  1K7A A;  1IF1 A;  3KP7 A;  2DT5 A;  1BM9 A;  3M9A A;  3KP5 A;  2ETH A;  1YFH A;  4Q5S F;  1K78 B;  3NQO A;  1ZG3 A;  4IHT A;  5D8K B;  1JGS A;  4ZYD A;  4KN7 X;  2WV0 A;  3BPX A;  2KKO A;  4UVC A;  4IJA A;  4EMS A;  1FSE A;  4GCV A;  1Z1D A;  3BJO A;  5HS7 A;  3M7G A;  3I5U A;  1DPU A;  5LGU A;  5BMZ A;  2DQL A;  5DDG A;  1C0W A;  4AVP A;  1W5S A;  3FMS A;  2NAZ A;  2YPR A;  3FHZ A;  2HOE A;  3LST A;  2CSO A;  2BEO A;  4G7H F;  3TOB A;  4MGR A;  2MD5 A;  4WCG A;  3IKV A;  4B09 A;  4CO8 A;  2L4M A;  5ICE A;  4MNU A;  5FFX A;  2K02 A;  1IN6 A;  3HIF A;  4MQ9 F;  3B02 A;  2A6H F;  4HW0 A;  4JQF A;  1LB2 A;  3BZ6 A;  2CYY A;  5HDK A;  4R8H A;  3JW4 A;  5E1W A;  4O6J A;  2HQN A;  2IVM A;  3BRO A;  3F8B A;  2FQ3 A;  3HTU A;  1FYL A;  4OIO F;  2JPC A;  3IL2 A;  2ELH A;  4CZZ A;  3V7R A;  2X0L A;  5K5O A;  3KE2 A;  5LLQ A;  1P4W A;  3F8C A;  2DPD A;  4U88 A;  1R7J A;  4P9U A;  4L18 B;  2FNA A;  4HDV A;  1MJB A;  3WU0 A;  2CFX A;  2P7C B;  1UST A;  1V4R A;  4HYE A;  4I01 A;  1MJ9 A;  1QPM A;  2EFO A;  4GXO A;  3LWF A;  3WTV C;  1SFU A;  2QBY A;  2ZJ2 A;  2HR3 A;  4K2E A;  1BN5 A;  3RDI A;  2V79 A;  4GO1 A;  3B73 A;  3TKY A;  2UXN A;  1GHC A;  2VON A;  1JHH A;  1FC3 A;  2YX4 A;  3HRU A;  3R0A A;  1MDM B;  2EA4 A;  4EV0 A;  2D2W A;  2VN2 A;  3SHF A;  2WC2 A;  5LGN A;  2STW A;  1TQP A;  4KIC A;  1BIA A;  2FMY A;  4OOI A;  2ACJ A;  4I98 B;  2FEZ A;  3PQK A;  1KQ0 A;  2J5P A;  2HTJ A;  3KEQ A;  4BHC A;  5ED4 A;  4IF4 A;  2GWR A;  3ZP5 A;  2M45 A;  5LBQ A;  1QNT A;  3MWM A;  5D5X B;  1FP1 D;  2FRH A;  4EJV A;  2F5C A;  2H6B A;  1LNW A;  3I58 A;  2IA1 A;  1B9N A;  2MC3 A;  2X4H A;  1HKS A;  4HF2 A;  3HRM A;  3K0L A;  5HLH A;  3JTH A;  1YIO A;  3FF5 A;  1UHM A;  1GVJ A;  4ZH4 F;  3GFL A;  1OKR A;  1OPC A;  3FXR A;  1A04 A;  2CG4 A;  3WTT C;  2EV6 A;  1ON2 A;  2H09 A;  1O3S A;  5ILU A;  3MFK A;  4G94 A;  2HTS A;  2OAZ A;  4RGS A;  2M87 A;  4LLL A;  3QRF F;  3EYY A;  2NNY A;  1SD5 A;  3V7S A;  1KA8 A;  4BAY A;  5DYM A;  1OMI A;  4LK0 F;  4HF0 A;  1IZ1 A;  2QQA A;  4UVA A;  3RIR A;  2V1U A;  2Z33 A;  2L01 A;  3WTS C;  1T0F A;  2OQR A;  2M30 A;  2ESH A;  1XB4 A;  2VC0 A;  2EA2 A;  5DCF A;  2G7H A;  1HKT A;  1QGP A;  5HDN A;  2XKP A;  1XDS A;  1J0R A;  1BJA A;  1WI9 A;  1D8J A;  2VBX A;  1ZN2 A;  4UHT A;  4PZJ A;  3O6B B;  5D5V B;  4EGY A;  3EQL F;  2H94 A;  5CVR A;  4CYD A;  4I02 A;  3IRQ A;  4IVN A;  1D3Y A;  3E6M A;  5L3B A;  2P5V A;  2J5O A;  2D1H A;  2BYV E;  5CYV A;  2H27 A;  1R1U A;  1YW9 A;  2PMH A;  2UZK A;  2DW4 A;  2QUF A;  4U0W A;  1P6R A;  1XGO A;  2JZY A;  2GA2 A;  4N0B A;  2PEX A;  3T0Y A;  4O5V A;  2RC4 A;  1LJ9 A;  1ZAO A;  1FBU A;  3JTG A;  4RS8 A;  3F6V A;  5LEJ A;  3WTU C;  3ECH A;  2RVC A;  3ZMV A;  1WWX A;  2XVC A;  2QYO A;  4LJZ F;  2O3F A;  3CLO A;  2EFQ A;  4U7D A;  1YW8 A;  5HVQ C;  2PI0 A;  2A5Y B;  4U0V A;  3QP6 A;  3ZMT A;  2F2E A;  1YQA A;  1QO0 D;  3ROU A;  1ZYR F;  5CVJ A;  2QM3 A;  2VXZ A;  3R6S A;  2C6Y A;  5H6Q A;  4M6X A;  2BBY A;  1EH7 A;  5DCM A;  4RAY A;  5LHG A;  5E8I A;  1TW2 A;  4A12 A;  3FM3 A;  4G6Q A;  1OYW A;  4P9F A;  2DQR A;  2QBY B;  1HW2 A;  3HRT A;  1YG2 A;  3V4G A;  5HS8 A;  2XAG A;  2PQ8 A;  2DFI A;  4LD5 A;  2XRN A;  2VE9 A;  3PQJ A;  1ZLJ A;  3I71 A;  4YFN F;  3P9K A;  3N4M A;  1SD7 A;  3RYP A;  2JPB A;  1ZRC A;  1TW3 A;  3QOP A;  4M73 A;  2LDU A;  1KU7 A;  4QLC U;  2JTV A;  1G6N A;  1Z7U A;  3BJ6 A;  4DQ2 A;  1K6O A;  1BI1 A;  2HYF A;  4KMF A;  3H92 A;  3ZQ7 A;  2A3S A;  3I54 A;  5FLX K;  2QVO A;  1HSJ A;  1RUO A;  2HFH A;  4OIQ F;  3FXQ A;  2KIU A;  2STT A;  3C7J A;  2F5D A;  1HKQ A;  4ZYG A;  1G3S A;  2ADU A;  3DXJ F;  3MCZ A;  1SD6 A;  1J2X A;  4L9N A;  5BOX A;  4LG0 A;  2XUB A;  1O3T A;  2Y0M A;  4YIF A;  1ZRE A;  3U2R A;  4HA8 A;  1IRG A;  5EEG A;  4ESB A;  5D6E A;  4A2U A;  4EGZ A;  3GZ5 A;  3K69 A;  2V1D A;  1TLH B;  4ESF A;  4NB5 A;  2ZO4 A;  4KYW A;  3DP7 A;  2OZ6 A;  2YSR A;  3RKY A;  4G9Y A;  2D1V A;  2GIV A;  3ML6 A;  1IXS B;  2DK5 A;  2EJR A;  2OQG A;  3DPL C;  3I59 B;  3IKT A;  1SFX A;  2FNP A;  5FB2 A;  4Y17 A;  1B1B A;  3HSF A;  3WE3 A;  1S29 A;  1SD4 A;  3HRS A;  5CVU A;  3TQN A;  4YG2 F;  5JHU A;  1IN7 A;  5L3F A;  3H3Z A;  5D8L B;  2CQK A;  1SFE A;  4EM0 B;  1S7A A;  4RB1 A;  3REO A;  1BBY A;  1TTY A;  3JAM Z;  4AIH A;  3GF2 A;  4M72 A;  1L3L A;  3NEU A;  3FMR A;  3GXO A;  4FT8 A;  3GWZ A;  2KJB A;  2RDP A;  2VBZ A;  5H20 A;  5TRD A;  2JRT A;  1UHW A;  1SMT A;  3DFG A;  1XCV A;  2WWY A;  3T8R A;  5FLX Z;  5LEK A;  1U5T C;  1P92 A;  2EV5 A;  1XGN A;  2Y48 A;  1MJA A;  1KU9 A;  1ZHF A;  5EEH A;  5AIP A;  2FA5 A;  2WTE A;  4UXN A;  5LHI A;  2G7U A;  5ILS A;  3ERE D;  2ZME B;  4OMZ A;  4UV9 A;  4CDG A;  3KET A;  1XSV A;  1JHF A;  4I09 A;  1F4K A;  4HF1 A;  4RGU A;  4ZZD A;  4HX4 A;  2CGP A;  1UFM A;  1PP8 F;  2DO7 A;  3H3U A;  4A5M A;  2MH2 A;  4M9Z A;  1RNL A;  3HHG A;  3MEX A;  5IT9 K;  3QPH A;  4KA4 A;  3COA C;  4LMY A;  5BQT A;  1FT9 A;  3KLN A;  5HLI A;  3M1E A;  2NYX A;  2KIM A;  1U6G A;  2A6E F;  4HX7 A;  3FWE A;  1IAW A;  3LAP A;  5FD6 A;  4LLN A;  1E17 A;  3ZN0 A;  3DPT A;  4O3M A;  3QP5 A;  4WXH A;  1ZG1 A;  2FU4 A;  4MTD A;  2K7L A;  2V6C A;  1CF7 A;  1REP C;  3F8M A;  1EV7 A;  3C1D A;  3WTZ A;  5DCM B;  3G3Z A;  2COM A;  3WU1 B;  2UXX A;  3IHU A;  1IW7 F;  1TNS A;  1IRF A;  2HWV A;  4HAM A;  4R1H A;  5BPD A;  4EJU A;  3ABT A;  4RAZ A;  5A2Q K;  1FP2 A;  1FOK A;  3E6D A;  2DU9 A;  2XRO A;  2ISY A;  4MTE A;  5J8C A;  5D5U B;  3HOS A;  3LAJ A;  4I7H A;  4BXU A;  1P2F A;  4RB2 C;  2B0L A;  4LB6 B;  3T5X A;  1XMA A;  4LFU A;  2M8E A;  2QZ8 A;  3KLO A;  4A0Z A;  5FD5 A;  1TBX A;  3C18 A;  1LEB A;  3TO6 A;  3V8J A;  1F1Z A;  1H9T A;  1YS7 A;  3I64 A;  1LDJ A;  1G4D A;  3RYR A;  3WTW C;  1FBQ A;  2VOP A;  3MQ0 A;  1R1V A;  1B4A A;  3K9T A;  2A61 A;  1XGM A;  1R23 A;  3CUO A;  5KK1 A;  2CWE A;  4LG0 B;  1AOY A;  2GZW A;  1W4M A;  2GQQ A;  1R22 A;  3ISP A;  1R58 A;  4JBA A;  5TJJ A;  3Q9S A;  1IN4 A;  2Z99 A;  3KP3 A;  5J8F A;  5JR3 A;  2ISZ A;  2DI3 A;  3N97 A;  3OOP A;  3ZMZ A;  3WTX C;  4ENN A;  3TDZ C;  2P5L C;  4UV8 A;  5DEQ A;  5E1Z B;  4E70 A;  3Q5F A;  2PN6 A;  5IT3 A;  2VC1 A;  2R3S A;  4HX8 A;  1XGS A;  4IRG A;  1OYI A;  3IWF A;  2G9W A;  4G7Z F;  1XDU A;  4UVB A;  2VOD A;  3V7C A;  4RB3 C;  3GYH X;  2YX7 A;  3I59 A;  5JVT A;  4G8X A;  3ZMD A;  2XIG A;  3HOT A;  1Z91 A;  4M9X A;  1STZ A;  3TO9 A;  1HW5 A;  3F8N A;  5A2Q Z;  1T39 A;  1LDK B;  2FBI A;  2HGC A;  1FWZ A;  2HDC A;  5D4R A;  4ENK A;  1KU3 A;  1FPQ A;  1U5T A;  2MA3 A;  3MAJ A;  1F5T A;  4HV5 A;  3KP4 A;  5JI6 A;  1FZP B;  4HOB A;  3E6B A;  3LFK A;  2DBB A;  2RQP A;  3D0S A;  1S8N A;  1B59 A;  2XHK A;  1RIO H;  1KU2 A;  5J6X A;  5E18 F;  4BHP A;  1YYV A;  4ENJ A;  3GFI A;  3RPU A;  5D4S A;  2L54 A;  5LHH A;  4NQW A;  3WE2 A;  1KYZ A;  4MHG A;  3RKW A;  4Y13 A;  3L7W A;  4BYY A;  3SQN A;  4Z2Y A;  2QQB A;  1G3W A;  1WQ2 A;  2ZME A;  2GA1 A;  2P8T A;  4MQV A;  1T98 A;  5CVV A;  4XLP F;  2IW5 A;  1WSU A;  4Q47 A;  2L4A A;  2K86 A;  3IWZ A;  2E7X A;  1R1T A;  5ICF A;  2A68 F;  2HYG D;  4P96 A;  3I0T A;  1XSX A;  1H0M A;  3WTY C;  2EFP A;  2VE8 A;  4ZYH A;  1IN8 A;  3TO7 A;  2L3D A;  1YO5 C;  2R7D A;  4XSZ F;  1J75 A;  2HS5 A;  4L5J A;  3R4K A;  3KP6 A;  3BOQ A;  3L2C A;  4KFC A;  5LRR A;  5K5Q A;  3R61 A;  4RB0 A;  1U3E M;  3CO7 C;  2MBF A;  2MH9 A;  4CHU A;  1AWC A;  4HDU A;  1FNN A;  2ZNY A;  3S2W A;  2F5E A;  2W85 A;  5CLS A;  4UNO A;  1Z6T A;  3ZN1 A;  4XSX F;  2MLG A;  4MEX F;  2EK5 A;  1W7P B;  2E1C A;  1CF7 B;  2IT0 A;  4Y15 A;  4M71 A;  4HLY A;  4I2O A;  3PFI A;  4KIF A;  4KT5 C;  5K5R A;  3J80 K;  3K1M A;  5ILV A;  2A69 F;  2W24 A;  5E20 A;  3LA3 A;  4OU0 A;  2V1X A;  2PFB A;  2LSO A;  1XN7 A;  3E5X A;  2K4B A;  1XSD A;  2KJC A;  2GXB A;  3K2Z A;  5LGT A;  5LRS A;  1B6A A;  2EB7 A;  4EJW A;  2P6S A;  4P5O A;  3M8F A;  1RZ4 A;  2DLL A;  2ZFW A;  2ZCW A;  3R0J A;  3RTR A;  1ZH5 A;  3FX3 A;  3ABU A;  4PGG A;  3SZT A;  3P9C A;  5AON A;  1SAX A;  3GFJ A;  4KUM A;  3KEO A;  4IRH A;  3QAH A;  3IC7 A;  4IHS A;  3FMQ A;  2FXA A;  3RJP A;  4PCQ A;  3KZZ A;  2IRF G;  1FBS A;  2O8X A;  3BP8 A;  2XAS A;  3E97 A;  3FXU A;  3O2P E;  2OU2 A;  2W84 A;  2UWM A;  1HBX G;  4ZZL A;  1FY7 A;  1GXQ A;  4L9J A;  2IP2 A;  1T6S A;  2YR2 A;  2E7W A;  1ULY A;  2HKO A;  4HV6 A;  3SZP A;  3W6J B;  3ECO A;  1S3J A;  2FBK A;  4BQA A;  3QU3 A;  4G6D A;  2NNN A;  3F3X A;  4P55 A;  3ZMU A;  4AD9 A;  4OIN F;  4A6D A;  1R5G A;  2EFN A;  1F9N A;  4EQQ A;  1TNT A;  2O0Y A;  4D0P A;  1RUN A;  2QQ9 A;  4WX9 A;  1QZZ A;  2O6G E;  2OA4 A;  3CJN A;  3GX4 X;  4L5I A;  1LVA A;  5F1R A;  3GFM A;  1X3U A;  1O3R A;  4GYG A;  2XAJ A;  3E6C C;  3I4P A;  4EJO A;  3DEU A;  3CDH A;  3J80 Z;  1ZGA A;  5CJ9 A;  4ASN A;  2HEO A;  5D6F A;  2QLZ A;  3HYI A;  1I5Z A;  1JE8 A;  2ZBK A;  4BH9 A;  2IA2 A;  1IUY A;  3RKX A;  2P4W A;  3VB2 A;  4CXF A;  1FYM A;  4A5N A;  2Y75 A;  2GXG A;  2PMU A;  2MLK A;  3WOD F;  4EJT A;  1U5T B;  3W6K B;  5E17 F;  4S04 A;  1ON1 A;  3U1D A;  5DD8 A;  5L3E A;  2AS5 F;  1SMY F;  1TQM A;  1PP7 U;  4WXD A;  4M6Y A;  2XAF A;  1EH6 A;  1L0O C;  3EET A;  4L9V A;  1KQ8 A;  3I53 A;  4IRI A;  3DF8 A;  1MZB A;  1B9M A;  1GXP A;  2W25 A;  2ZNZ A;  4M9S A;  4HQE A;  4I0B A;  3P9I A;  2ESN A;  2IJL A;  2PG4 A;  1BC8 C;  1UCR A;  1KQ9 A;  3BJA A;  3GUD A;  3ZPL A;  5L3G A;  4HLX A;  5KVR A;  1PDN C;  4ESJ A;  1ZRD A;  3WGG A;  4L0Z B;  3EDP A;  3CUQ B;  4H0E A;  1UB9 A;  2AXL A;  2VT3 A;  4HZF A;  2RV8 A;  2DK8 A;  3GVA A;  2XKO A;  2XAQ A;  2LF8 A;  3F8F A;  2K4J A;  1XCB A;  3C3W A;  2BGC A;  3KP2 A;  1W7P A;  4KMU X;  4CGZ A;  4OIP F;  1XD7 A;  2PJP A;  3VOE A;  1TQI A;  3CUQ C;  5H6R A;  2EV0 A;  3U9G A;  1JXS A;  2IPQ X;  5ICC A;  5DUK A;  1S7O A;  2Z9O A;  3T1B A;  1ZRF A;  4KNY A;  5D5W B;  2DPU A;  4GYI A;  1U8R A;  3VFZ A;  3F72 A;  2Q8K A;  1BC7 C;  3FZV A;  2P7V B;  1Y0U A;  3E3V A;  4A0Y A;  1Q1H A;  1LEA A;  3E5U A;  2KIF A;  1W7P D;  4EM1 A;  2D45 A;  1MD0 A;  4I0A A;  3IRR A;  1O7F A;  1T38 A;  4LLG F;  3V8K A;  2JSC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...