2ELHA

Solution structure of the cenp-b n-terminal dna-binding domain of fruit fly distal antenna cg11849-pa
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
87
structure length
87
Chain Sequence
GSSGSSGMNIRMGTKGKRPLRSLTPRDKIHAIQRIHDGESKASVARDIGVPESTLRGWCKNEDKLRFMSRQSATDNLCADALGDKMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords CG11849-PA
publication title Solution structure of the CENP-B N-terminal DNA-binding domain of fruit fly distal antenna CG11849-PA
rcsb
source organism Drosophila melanogaster
total genus 11
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2007-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04218 CENP-B_N CENP-B N-terminal DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2elhA01
1TQPA 1AWCA 2XHKA 5J8FA 1YFHA 5EEHA 3NEUA 1QZZA 5ED4A 2RVCA 2FQ3A 3GW2A 2MA3A 2EV5A 2O8XA 4ON0A 2FRHA 2PMHA 1LEAA 2DO7A 3IRRA 3QPTA 2VBWA 3WTUC 1PP7U 5DD8A 3KETA 3IWFA 4WXCA 2PI0A 4I0AA 1W7PA 3NQOA 5DEQA 3ZMTA 4BHCA 1EV7A 1ZAOA 4LJZF 4HW0A 2MD5A 1OR7A 4FX4A 4G7HF 4XBFA 2HYGD 2PBIA 1WWXA 2GZWA 2RGVA 3PFIA 2ZNYA 2DPDA 3F3XA 4UVAA 2V79A 1MGTA 2FNAA 2M87A 1K79A 1YW8A 3SZPA 1W7PD 2OU2A 4I0BA 3KE2A 5D8KB 1KYWA 3REOA 1O7LA 1DPUA 2CO5A 2QUFA 5AIPA 3DQVC 3ECOA 1J75A 1A04A 1BBYA 3G3ZA 1BI3A 1YW9A 2D2WA 3J81Z 4EGYA 3RYRA 1RUNA 1JHFA 4YFNF 2UXNA 2BGCA 3ZN1A 1FYLA 3EETA 2NNYA 2EJRA 4Y13A 2ETHA 1IXCA 1LDDA 4I09A 1O3TA 2IW5A 3TDZC 2OA4A 2FU4A 2GAUA 3WTVC 4R8HA 3HUGA 2LSOA 1R5HA 1HW5A 5E8IA 4ZYGA 5FD6A 5K5OA 5DYMA 1IXSB 3M8EA 1J9IA 4U7DA 5F1RA 4CO8A 1JGSA 4HDVA 4MTEA 3VEPA 1D8KA 3IRQA 1SAXA 5FO5A 2EA4A 2D45A 5E1XA 1QPMA 4AIKA 3U1DA 2EA2A 2HGCA 2XUBA 1O3RA 5L3FA 2ISZA 1I1SA 4OU0A 3N97A 2X0LA 3KEOA 1IRFA 3ZQ7A 2JPBA 1I6XA 5EEGA 1YG2A 3OOPA 4RB3C 2P5LC 3JSPA 4A0ZA 2ESHA 2YR2A 4HF0A 4MNUA 3ZMZA 4OIQF 2CFXA 1PP8F 3J80K 1S29A 1FYKA 3BOQA 2Y48A 3V7CA 5IT9K 5HS7A 1G4DA 3V8LA 3C7JA 1QQIA 5HVQC 2VONA 2XAGA 1YW7A 3R4KA 3E97A 1G3WA 5FGMA 3NRVA 3F6VA 4G7OF 2Z33A 2PJPA 5D5UB 4M73A 1O3QA 3RTRA 4PGGA 3G73A 4NB5A 4HQEA 2GIVA 1T98A 2HQRA 1J7KA 4BNCA 5BS6A 3E6CC 1ODDA 1P4AA 4A6EA 3B73A 4XLNF 1GXPA 3E6MA 4I01A 4RGRA 1MJ9A 4KMUX 4UXNA 5CJ9A 1T2KA 1X3UA 4D0PA 2CGPA 3LSTA 4QWQA 4EM0B 1ZLJA 2W84A 3RPQA 2HEOA 3HSRA 2FBKA 4YIIA 3BZ6A 1XDUA 3GWZA 1HBXG 4RB2C 3PQJA 3GFLA 1JHHA 4IHTA 4JQFA 1XCBA 4IJAA 1Q1HA 4R79A 2ELHA 3WODF 1WI9A 1FPQA 2HQNA 3SHFA 1XN7A 3J7AO 3JSOA 5BQTA 2L4MA 1FNNA 2RQPA 2XKPA 2WTEA 4EJWA 1AOYA 1Z6TA 2R7DA 4N9HA 3QU6A 1KU9A 2MLKA 1FSHA 1KQ8A 1XDSA 4EM2A 4HDUA 4O3MA 4OMZA 2FE3A 3RJPA 1OYWA 2HKXA 3TOBA 1TNTA 3M1EA 4CYDA 3WTYC 2RNJA 2VODA 2BE5F 1RI7A 4KA4A 3F6OA 2CYYA 4P9FA 4IVNA 3TQNA 2AS5F 1SD4A 2GA1A 4F7ZA 1XMKA 4XRFA 2GWRA 2HYFA 1S7AA 1BI2A 5J6XA 2Q8KA 3I59A 4LB5A 4R1HA 5ICCA 1C0WA 4MQ9F 1U5TC 5ICGA 1G3SA 4BYYA 2VN2A 4A6DA 3IL2A 5BPDA 2JRTA 3TO6A 4M72A 3KCCA 1OKRA 3WTZA 4OIRF 4HAMA 5LRSA 3JW4A 4OMYA 3GZ6A 5JVTA 4WWCA 1ZYRF 3E3VA 3E6BA 4G9YA 3HSEA 4UVBA 3ZMDA 1BJAA 3EYIA 4HX7A 2PEXA 4I2OA 5ERIA 4YIFA 2O6GE 1YIOA 3Q5FA 2ZJ2A 1O3SA 3GX4X 3F22A 5CVJA 4LD5A 4A0YA 1Z9CA 3QP5A 3COAC 2EFOA 3JTHA 1QZYA 5D5VB 2L54A 3BPXA 5D4RA 1HW2A 4KDPA 4G6QA 4GO1A 1ZG1A 2EK5A 3I53A 2DW4A 2O03A 5L3BA 5DUKA 4LFUA 1E17A 4U0VA 3ABTA 1U78A 5E17F 3F21A 1FC3A 3T0YA 4AWXB 3FXUA 2Q2EA 4ZYDA 5AIQA 3DKWA 2HZTA 1L0OC 3B02A 1XSDA 3SQNA 4Y15A 2W57A 2MC3A 2Z5UA 1R22A 4ESFA 2MLGA 1SD7A 2GQQA 2GA2A 4DNCA 3CTAA 4RS8A 1GHCA 5D4SA 1DDNA 3H92A 1IRGA 3GFJA 2DTRA 2RDPA 3GFIA 5HDGA 4RGSA 5LEJA 4KMFA 4L9TA 4HV6A 2NYXA 4EJUA 3Q9VA 1DP7P 2RN7A 5CVVA 3MAJA 4RB1A 4FHTA 2Y75A 3HHHA 1WKMA 3QOPA 1YS7A 3P9IA 2XKOA 2KKOA 5JI6A 1G3TA 2QENA 3LAJA 1L3LA 3ZMUA 3BPVA 5ILSA 3RKYA 2H27A 3GVAA 4PCQA 3GZ5A 5LRRA 2UXXA 3F8NA 1QO0D 1SFEA 4KIFA 3KP6A 5BMZA 1B6AA 3KLOA 1TQMA 2EWNA 1LB2A 5LHGA 5J8CA 3FXRA 2PG4A 2D1HA 1ZH5A 3T8RA 2QM3A 1XCVA 2C6YA 3TDUC 2FEZA 3J81K 2QLZA 4EV0A 3H3UA 4PGHA 4HLYA 3V8KA 2FMYA 2F5FA 1FYMA 5K5QA 5A2QZ 4L5IA 2CG4A 2NAZA 3EUHA 5HLGA 2JZYA 2VBXA 3HTSB 2HR3A 3BROA 2ZKZA 4EJTA 2L02A 4MQVA 2J5OA 2W24A 1SFUA 1S6LA 3V8JA 3I64A 5E1ZB 1TW2A 4AIHA 4QLCU 3VOEA 4LB6B 2QWWA 4NQWA 1XGOA 5DDGA 1HSJA 4M9ZA 4EJOA 4AVPA 2GXBA 1ZGJA 4EJVA 3BWGA 3E6DA 1STZA 4KIBA 1WQ2A 4U0YA 3WE2A 2VT2A 1FX7A 1YLFA 1F9NA 5AONA 2IVMA 2LDUA 3V4GA 4MGRA 2FMLA 4U88A 4G7ZF 4A2UA 3KLNA 3DEUA 4IRHA 3HRMA 3K1NA 4RB0A 3ZMVA 2K86A 1XGMA 4ESJA 5ILUA 3RKXA 4KN7X 2G7UA 2ADUA 3KEQA 2A07F 2STTA 4ENMA 4M6YA 2F2EA 2PN6A 4O6JA 1MJBA 4S04A 1KQ0A 3HRTA 5F64A 1YTYA 1XGNA 3MQ0A 2VT3A 5KK1A 1MD0A 1USSA 1UFMA 1D3YA 3L2CA 4ENKA 2COMA 5L3GA 2A5YB 5BOXA 1R7JA 2KIUA 2Q0OA 2HFHA 5FLXZ 1I5ZA 4B09A 2O0YA 3JAMZ 1S8NA 5BPIA 1F5TA 4EMSA 4Y17A 2ZNZA 2Z9OA 4CGZA 5H6QA 1TNSA 4M71A 3D5LA 4CHUA 2UWMA 1KU3A 1HKSA 2YSRA 1IN4A 5HDNA 2YPRA 1UB9A 3DFGA 2STWA 2EB7A 2XAQA 3I58A 2EFQA 4M6XA 3R0JA 1R1TA 2KIFA 1O57A 1TBXA 4ZZLA 4HV5A 2QBYB 3ELKA 1R23A 3VFZA 1IUYA 1Z6RA 1SD6A 5D6FA 2Y0MA 4RAYA 1R36A 4BH9A 1YQAA 5L3EA 1P92A 2FF4A 3L9FA 4WK8F 2ZMEB 3HOSA 2K02A 2IT0A 3I4PA 1BC7C 2IRFG 1IF1A 3RI4A 1ZN2A 2G7HA 2K7LA 1FZPB 3BY6A 3P9CA 2VC1A 1YO5C 3RIRA 2EFWA 1F1ZA 4AD9A 2DK8A 3CUQC 3I59B 4IRGA 1REPC 5K5RA 1T6SA 4HOBA 2OAZA 2QBYA 4M9XA 2H6BA 4OIOF 3LA3A 1RUOA 3ULQB 4BXUA 2M30A 2XASA 2JSCA 3E5UA 3K1PA 4GYGA 4L5JA 1V4RA 1BIAA 3IKVA 5ICEA 4GXOA 4I7HA 1OPCA 1HKTA 4EGZA 1SMTA 2PQ8A 3DPTA 5KVRA 4YFXF 2ZMEA 2EFPA 1QGPA 2X4HA 4L0ZB 1Z7UA 3WGIA 2VBZA 4I98B 2G9WA 1ZHFA 4ZZDA 3M8FA 3HTUA 5ILVA 3ZMSA 1ZRDA 3ERED 2LF8A 5F6FA 1IN5A 2FBHA 4UUVA 2E1CA 1KYZA 1P2FA 5L3CA 3KZYA 1FP2A 1DUXC 5CYVA 4L9VA 4MEXF 2NRAC 2YU3A 3MEXA 2M1BA 1TTYA 4IRIA 3I5UA 2ZBKA 4P9UA 2BBYA 2P5VA 2CW0F 3R61A 2GXGA 5H6RA 5E20A 3P7NA 1P4WA 4E70A 1KGSA 1RIOH 3FM5A 3R60A 3IHUA 2VC0A 4H0EA 2YX7A 3T1BA 1MKMA 3F8CA 3K9TA 3U2RA 1BIBA 5E18F 2EV6A 1H9TA 2BV6A 3FMRA 2JPCA 1S7OA 4XSZF 1FY7A 3Q9SA 4Q47A 4EVIA 2E7WA 1LNWA 1FBUA 4ZYEA 2ZFWA 2V1DA 2KJBA 3HRUA 1W5TA 3F72A 5HS9A 2FBIA 2Z99A 1TLHB 1QNTA 1UCRA 3WG9A 2W85A 1LDJA 2F5CA 1EH8A 5DD4A 1FBQA 1XSVA 4OINF 4A12A 1W5SA 1EH7A 1D8JA 2D1VA 2A69F 3K2ZA 3R0AA 2K4BA 4LG0B 3I0TA 3V7RA 3BJAA 2K4JA 2HS5A 1H9GA 2RC4A 3WTSC 4MTDA 1R58A 5IT3A 1U6GA 1I1GA 4TV7A 3RDIA 5HDKA 4UNOA 2VE9A 1HKQA 4HLXA 4O5VA 4FX0A 2OQGA 5LGNA 2V9VA 1GXQA 2M5WA 2IJLA 1USTA 1UHMA 4UVCA 2FSWA 3F8BA 4XSXF 2M45A 3FM3A 2QYOA 1LEBA 1CGPA 2XROA 1QBJA 2XIGA 1ZRFA 5H20A 3F23A 5A2QK 1IN6A 3LAPA 2KRFA 1MJAA 1HSTA 4LLGF 2WV0A 4MHGA 5HS8A 3H3ZA 5FD5A 1ZGAA 1EH6A 3FX3A 4P96A 3ZP5A 1RNLA 4PZJA 2H09A 1K7AA 2J5PA 3TGNA 5E8GA 3ZN0A 4IF4A 2QQ9A 1UHWA 2O61A 5LHHA 1H0MA 5TJJA 1F4KA 1XSXA 2VXZA 3EYYA 3WTTC 3ZPLA 4L0YB 3QAHA 1T0FA 2DK5A 5D8LB 3L09A 2MH2A 4LG0A 5D6EA 4HX4A 5JHUA 1Z91A 1XMAA 4MEYF 5LGUA 4S05A 3I71A 4LLLA 3M7GA 3S2WA 1FSEA 1IN8A 4L9NA 4N0BA 1OYIA 2OBPA 2HOEA 1ON1A 3SXYA 4KICA 1Y0UA 3ECHA 2UZKA 3FF5A 5FFZA 2DFIA 3GYHX 2AXLA 4FT8A 1ULYA 4LK1F 4L9JA 2LNBA 1P4XA 3LQQA 3HIFA 3D0SA 4IXAA 1WSUA 2A3SA 2A61A 2OZ6A 3QU3A 2DAOA 2DQLA 2HKOA 5LBQA 5HLIA 3DPLC 5DUIA 3EDPA 1V3FA 2ZO4A 3M9AA 3TOAA 2VE8A 4HZFA 2DPUA 2HWVA 3TO9A 3MWMA 1FP1D 5DCFA 3KFWX 3MZYA 2LF7A 4AIJA 5DV5A 3GO5A 4ESBA 3C18A 4HBLA 3L7WA 4PDKA 2FOKA 4LLNA 5L3DA 1SFXA 5FLXK 3K69A 3JAMK 2CSOA 5FB2A 1OMIA 4KFCA 1CF7B 2JTVA 2OQRA 2XAHA 3BJOA 4WF2A 4M9SA 3DV8A 2LKPA 4ETSA 2WWYA 1KQ9A 4GCVA 1GVJA 3WU1B 2L01A 2RV8A 2P6SA 2L4AA 2FA5A 2O3FA 3W6JB 5LGTA 3CUOA 3AAFA 1LQ1A 1FOKA 4L18B 4ZYHA 2A6HF 3LQRA 3KP3A 4LGWA 3PQKA 1S3JA 3HSFA 2Z3YA 3GUDA 2EV0A 3SFZA 4KNYA 3I54A 5D5XB 4P55A 3R6SA 4M74A 2H6CA 3BP8A 1B1BA 1T38A 2KJCA 2FXAA 2E7XA 5ICFA 3LA2A 3ABUA 3FWEA 4KIGA 3WGHA 4Q5SF 1CF7A 4UV9A 3FXQA 3HHGA 5D5WB 2IP2A 3QP6A 4BHBA 1U8RA 2P7CB 4U0WA 1IW7F 4RAZA 3T5XA 1JXSA 4A0XA 1NHAA 2NS0A 3ISPA 2DU9A 2R3SA 3KP4A 2P8TA 4B8XA 1ZG5A 1HW1A 4EM1A 2XGXA 4EQQA 1WRJA 4CDGA 1DPRA 3RYPA 5JR3A 2DT5A 3HOTA 5HLHA 1TW3A 2MH9A 3WGGA 1B4AA 2L3DA 2XAFA 6PAXA 3CUQB 2PFBA 3O3KA 4KUMA 1OYYA 1J2XA 3WTXC 4Q48A 3DF8A 1MDMB 1U2WA 4CXFA 1YS6A 5K1YA 5CLSA 3BJ6A 3GFMA 4G8XA 4Q4ZF 2ACJA 3WTWC 4BQAA 3KZZA 4WXHA 3RKWA 1FBSA 4GYIA 2TDXA 1FLIA 1VTNC 1PUEE 1LVAA 3CO7C 3DXJF 5CVUA 4ASNA 2YX4A 4U7BA 4IPAA 4JBAA 1FT9A 2EFNA 2DQRA 2F5DA 4WX9A 1BC8C 1P6RA 4Z2YA 2XRNA 2M8EA 4OOIA 4YFKF 5LLQA 3MFKA 1T39A 1YYVA 4HX8A 3CDHA 1ONVA 1J59A 1D5VA 1R1UA 3IKTA 2IPQX 3CUQA 4KN4X 2QQAA 2BYVE 3J80Z 1U5TB 3ROUA 1R00A 4XLPF 5IT9Z 1IZ1A 1MDMA 3CLOA 3O2PE 3VODA 1ZG3A 1JE8A 2A6EF 2H94A 4BAYA 2V6CA 2MBFA 3E5XA 2QQBA 1G3YA 4CICA 1SMYF 3L00A 4IHSA 2VBYA 2QZ8A 4K2EA 1ZREA 1E2XA 2JT1A 2ZCWA 3CO6C 4RGUA 2W25A 3FMSA 3OV8A 3FZVA 1J0RA 1ON2A 1LDKB 4P5OA 1SD5A 1R5GA 2V1UA 2QVOA 2PLYA 3TKYA 3RPUA 2E1NA 2RKHA 2ISYA 1IXRC 2DLLA 4WCGA 4HF2A 2XVCA 1LJ9A 4G94A 2DI3A 3P9KA 3MZHA 3HRSA 4CZZA 1U5TA 1RZ4A 4YG2F 4BHPA 1W4MA 4HF1A 1J5YA 3KP5A 1BOAA 3KP7A 3C1DA 2HTSA 1ZRCA 4N9IA 4A5NA 2P6TA 1I27A 5FFXA 1BN5A 3ML6A 2R7FA 2F5EA 1B9MA 3K0LA 2FNPA 2P5KA 3C3WA 5HOOA 3FHZA 4HA8A 4A5MA 3W6KB 2HTJA 2KIMA 2VOOA 3IWZA 2VOPA 5DCMB 1ZLKA 1R1VA 1G6NA 4G6DA 2XV4S 4UV8A 2K27A 1KU2A 4KT5C 3QPHA 3LFKA 2DBBA 2ZXJA 1KA8A 3HYIA 4RGXA 3GEZA 4LK0F 2XAJA 2V1XA 1K6OA 1HQCA 3BDDA 2CWEA 1XGSA 2A68F 4HYEA 5LEKA 3LWFA 2PMUA 2B0LA 1BI1A 3MCZA 4NHJA 5E1WA 3QRFF 5CVIA 4JK1X 1BM9A 1FWZA 4DQ2A 4LMYA 3F8MA 1K78B 1IAWA 1IN7A 1MZBA 2IA0A 2P4WA 3O6BB 2ESNA 3EQLF 1TQIA 4HQMA 4I02A 1HXDA 1B9NA 3JTGA 4ENNA 5LHIA 4WXDA 1Z05A 2IA2A 3E5QA 3TO7A 1B59A 1ZARA 5DCMA 4GGGA 3N4MA 2OD5A 1O7FA 2HDCA 3VB2A 4UHTA 1W7PB 3K1MA 3SZTA 3GF2A 3F8FA 4OIPF 1XB4A 2CQKA 1XD7A 1BI0A 3GXOA 3IC7A 3T8TA 2P7VB 3FMQA 3GLXA 3V7SA 2NNNA 3WE3A 1KU7A 5TRDA 5CVRA 3CJNA 3KP2A 2BEOA 3WU0A 3DP7A 4ZH4F 2OZUA 5JFRA 1Z1DA 4KYWA 3U9GA 2WC2A 2IA1A 3LA7A 1K78A 4ENJA 1PDNC 1U3EM
chains in the Genus database with same CATH superfamily
1TQPA 1AWCA 3EPZA 2XHKA 1W36C 2L7KA 5J8FA 1YFHA 5EEHA 3NEUA 1QZZA 2R7RA 1QU3A 5ED4A 2RVCA 2R7WA 2FQ3A 3GW2A 4IEJA 2F4IA 2MA3A 2EV5A 2O8XA 4DYRA 4ON0A 2DMPA 2FRHA 2PMHA 4F3QA 1BOBA 1XMXA 1LEAA 2DO7A 4XORA 4BJ5C 1H89C 3ZQHA 4CCMA 3IRRA 3QPTA 2VBWA 3U21A 3WTUC 1X2MA 1PP7U 5DD8A 3MVPA 3KETA 2XSJC 3IWFA 3MD2A 4WXCA 3SYTA 2PI0A 2ECCA 3ZOBA 4QPOA 4C2MJ 4I0AA 3OYCA 2HPIA 1W7PA 2ZSIB 3G1MA 2JUGA 3NQOA 5E79C 5DEQA 1OCRH 2DJIA 3ZMTA 4BHCA 2VJJA 1EV7A 1VQMI 1ZAOA 4LJZF 3PSFA 1UJ8A 2MD5A 4HW0A 3HUGB 1OR7A 4N4NB 4Z6YA 4FX4A 3QQAA 4G7HF 2CV0A 4XBFA 3ZGKA 2HYGD 2PBIA 1WWXA 2GZWA 2RGVA 2NVYJ 3PFIA 2ZNYA 1RRJA 2DPDA 1JGGA 3F3XA 2WBMA 3VYRB 4UVAA 1NTCA 2V79A 4F91B 3CD6I 1MGTA 2FNAA 4ZDLA 2M87A 4G12A 2IBDA 1K79A 4A3EJ 1YW8A 3SZPA 4B1RA 1W7PD 1D5YA 2JQ7A 2NS8A 4U87A 2Y31A 3GTLJ 3HOWJ 1F36A 2OU2A 1EA3A 4I0BA 1GT0C 5B1AH 2EILH 3KE2A 2JMWA 5D8KB 3S15J 4XIDA 1KYWA 4B48A 5IYCJ 2E1MB 2L2OA 4YEJA 3REOA 1O7LA 1DPUA 2CO5A 2QUFA 5AIPA 3DQVC 3ECOA 2JA2A 1J75A 5IOYA 1A04A 2BOLA 2RNGA 1BBYA 2HDWA 3G3ZA 5LD2C 4X0GA 1BI3A 1R71A 2OV7A 1YW9A 5HNHA 2D2WA 3J81Z 3K70D 3L2RA 4EGYA 2BY1A 3RYRA 1APLC 4E7HA 1RUNA 1Y8QB 1JHFA 3HDDA 4YFNF 2UXNA 4A3IJ 3M8JA 1Q1VA 2BGCA 4C3HJ 3OYLA 5CQGA 2DA3A 3K10A 3ZN1A 4BBRJ 1FYLA 3EETA 4XRSG 1WJEA 2NNYA 2EJRA 3EUKL 4Y13A 1MNMC 2ETHA 1IXCA 1LDDA 4I09A 1O3TA 2IW5A 3TDZC 4A3DJ 2OA4A 3MMYB 2FU4A 2GAUA 4NC8A 4DBRA 3WTVC 2NVUB 4OAYA 2HYJA 1B8IB 3OR2C 4R8HA 1MBEA 2X6WA 3HOUJ 5J47A 1X3WB 1GLNA 3CDIA 3HUGA 5EYRA 2LSOA 1R5HA 1HW5A 2LP0A 1VFCA 5E8IA 4ZYGA 5FD6A 4DOZA 5FRNA 5K5OA 5DYMA 5B66C 1IXSB 2E5ZA 3M8EA 1Y8RB 1J9IA 4U7DA 5F1RA 2BY3A 1U8BA 3RCOA 4CO8A 1JGSA 4HDVA 4MTEA 3VEPA 2L9VA 2PJRB 1D8KA 1FJLA 3IRQA 1SAXA 5FO5A 2EA4A 2CW8A 3RZOJ 4IOAF 2D45A 3NWSA 5E1XA 2MD0A 4EATA 1GV5A 1VF9A 2KMUA 1QPMA 4AIKA 1E3PA 3U1DA 3PIOF 2R7OA 1SFOJ 1V5GA 2EA2A 4DBQA 5IP9J 2LBFB 2HGCA 2A6TA 3CQZJ 2XUBA 1WFXA 1O3RA 1SFKA 5J40A 3IUOA 5L3FA 3OYKA 3TW7A 2ISZA 1I1SA 3SEZA 1JUMA 3OS2A 2F4MB 2XF6A 4OU0A 3N97A 4M3FA 3L2QA 2X0LA 3KEOA 1IRFA 2EZLA 4YELA 3ZQ7A 2JPBA 1I6XA 4FE7A 3U1KA 3BZCA 5EEGA 1YG2A 3OOPA 4RB3C 3PSIA 2P5LC 3JSPA 4A0ZA 2ESHA 2YR2A 4HF0A 4MNUA 3ZMZA 4OIQF 2CFXA 5HODA 1W0UA 1PP8F 3J80K 1JKOC 2R7SA 3UR3C 1B8IA 5M3FJ 1S29A 2E36A 3G1LA 3DKYA 3KIOA 3BOQA 1FYKA 3AG2H 2EZIA 2R5ZB 2R93J 2Y48A 3V7CA 2DJNA 5GADJ 2HDDA 5JLXA 5IT9K 5HS7A 4XN0A 1KONA 2VLAA 5EF6A 1XS9A 1G4DA 4W1UA 4PK4A 3V8LA 3C7JA 2VUMJ 4LOCA 2JSPA 4A3CJ 2E2HJ 3AG1H 2IS2A 1QQIA 3HGGA 3CCRI 4BQNA 5HVQC 2VONA 1QVUA 3HJEA 2XAGA 2ID6A 4PSWA 4KT6A 1YW7A 2TRTA 2PJRA 2QA4I 3OSGA 3VSLA 3R4KA 3E97A 1G3WA 2IGKA 5FGMA 2LFBA 3E1SA 3F6VA 2W82A 3NRVA 3QYFA 2Z33A 1N77A 3QYEA 2H8WA 5D5UB 3MKYB 2PJPA 4M73A 1O3QA 3K4NA 3RTRA 4PGGA 3G73A 4NB5A 4HQEA 2GIVA 5K7FA 1T98A 3BT9A 2LBFA 4CYCB 1K4SA 3S14J 3GLLA 1M1EB 2HQRA 1J7KA 4BNCA 5BS6A 3E6CC 1NG6A 2MYSA 1ODDA 1P4AA 1DU6A 3VWBA 4A6EA 3B73A 4RM3A 4XLNF 1GXPA 3E6MA 4I01A 4RGRA 1MJ9A 2ELJA 4KMUX 4UXNA 4HRIA 2DMNA 1WH7A 3AFHA 5CJ9A 1T2KA 3OIQA 1X3UA 1UG2A 4D0PA 3TEDA 3ABKH 2CGPA 1Z3XA 1PJRA 1GUUA 4M3EA 3LSTA 4QWQA 4EM0B 2GOMA 4FETA 3HL2A 3BR1A 4RAFA 1ZLJA 2W84A 3RPQA 2K85A 2HEOA 3HSRA 4IO9F 1CQTA 2WV1A 2WA0A 2HZDA 3FXJA 2FBKA 3W3CA 4YIIA 3BZ6A 1XDUA 3GWZA 2LH9A 4G6TB 1HBXG 4RB2C 1JKRC 2M4GA 2QGUA 4BL0B 2P81A 3PQJA 2WAEA 3GFLA 1JHHA 2ZMEC 4IHTA 1FIPA 2LY2A 4JQFA 2CUEA 1XCBA 2KT0A 5FKMA 3OYMA 4IJAA 4OAZA 3S8PA 5J4VA 1Q1HA 4R79A 1TC3C 4V2FA 4B43A 1U9OA 5J3LA 3GZNB 2Y2ZA 2ELHA 3G2BA 3KEYA 1WI9A 3WODF 1WHUA 1FPQA 2HQNA 3SHFA 5H2FC 1XN7A 1TT5B 3J7AO 3JSOA 1UAAA 5BQTA 2L4MA 4JP0A 2CJJA 2XF5A 1FNNA 2RQPA 2XKPA 1EJ9A 2WTEA 3S1QJ 1LVKA 4EJWA 5J1UA 1AOYA 1Z6TA 2R7DA 3HBLA 4N9HA 3ZXSA 3AL0C 3QU6A 1KU9A 1RR8C 2MLKA 1PUFB 1FSHA 1KQ8A 1XDSA 4EM2A 4HDUA 2CW7A 3IV5A 4O3MA 2LY1A 1Z3YA 2OCEA 4CYCA 4OMZA 2FE3A 4CCLA 4ZDOA 3RJPA 1OYWA 2HKXA 3TOBA 3PUBA 1TNTA 2IEKA 3M1EA 1YX5A 3PIPF 4CYDA 3BLYA 3WTYC 2RNJA 5KAFC 2VODA 2HQAA 2BE5F 3A01B 3HOXJ 5B3SH 1RI7A 1R4NB 1MMGA 3IP4B 5FKLA 4KA4A 3F6OA 3JRHA 2CYYA 4P9FA 4IVNA 3TQNA 1Y1WJ 1SD4A 2GA1A 4F7ZA 2AS5F 1XMKA 1D1BA 2EIJH 3FBNB 4XRFA 2DOEA 2H1LA 2GWRA 2CH0A 2HYFA 1S7AA 1BI2A 5J6XA 2Q8KA 3I59A 4LB5A 4R1HA 5ICCA 1C0WA 1Y39A 4MQ9F 4BU2A 3OS1A 5M5WJ 1U5TC 5ICGA 1WJDA 3ZQQA 1ETVA 2Q2EB 2BZTA 1G3SA 4BYYA 3OL4A 2VN2A 4A6DA 3IL2A 1FEXA 1A36A 2EBIA 2BW3B 4XRSA 5BPDA 4PSXA 3H9JA 3FBIB 2JRTA 3TO6A 4M72A 3KCCA 3TMOA 1OKRA 3WTZA 5EG0B 4OIRF 2MABA 4HAMA 5LRSA 3JW4A 3CC2I 4OMYA 3GZ6A 3KYLA 5JVTA 2QKMB 3GTMJ 1T56A 1JI8A 4RA2A 4WWCA 1ZYRF 3E3VA 1AA7A 3NAUA 3E6BA 4G9YA 5F0FA 3HSEA 4UVBA 1PUFA 1DGRM 3ZMDA 1BJAA 3EYIA 4HX7A 2E2JJ 2PEXA 4I2OA 5ERIA 4YIFA 2UV1A 2WY7Q 2XGDA 2O6GE 1YIOA 2AHQA 3Q5FA 1TP4A 4XN3A 2ZJ2A 1O3SA 2V9PA 3GX4X 3F22A 5CVJA 1T8IA 4PJMA 1YX3A 1UG0A 4LD5A 4A0YA 1Z9CA 3QP5A 2KP6A 3COAC 2EFOA 3JTHA 4XR6A 1QZYA 5D5VB 2FOWA 2W00A 3PL8A 2L54A 3BPXA 3LSRA 3A01A 2W1OA 1IDYA 5D4RA 4GDFA 3SZGA 3F0CA 4D9JA 1HW2A 4KDPA 1IRXA 4G6QA 3PO3J 2K9SA 4GO1A 3QPSA 5GTHC 1ZG1A 1VQNI 2EK5A 3I53A 4A3FJ 2DW4A 2O03A 3OYBA 4AIDA 5L3BA 1YE9A 1D0ZA 4HEA2 2LREA 4LFUA 5DUKA 5E3OA 1E17A 3CMYA 4G7OF 2V26A 4U0VA 3ABTA 1VQ7I 1ETKA 3QPLA 1U78A 1BR1A 2CV1A 5E17F 3KYDB 3SFIA 2L9RA 3F21A 2JVGA 2DTZA 1FC3A 3E7LA 3T0YA 4AWXB 3FXUA 3PNYA 1Z77A 2Q2EA 4ANJA 1R5ID 5JLWA 4ZYDA 5AIQA 3H5RA 4XLHA 4XLAA 5IOZA 2XPVA 3DKWA 2JA5J 4B4CA 2HZTA 1L0OC 2X6YA 3B02A 3FKIJ 1XSDA 3BG3A 1UMQA 2RREA 3SQNA 4Y15A 4XKWA 2W57A 2OUMA 2MC3A 2Z5UA 3ASNH 2GBYA 5CPRB 3S32A 1R22A 4E7LA 4ESFA 3FDYA 1YJWI 1MSFC 2MLGA 1SD7A 3I4MJ 2G0EA 2WB1N 2GQQA 3VYSB 2R7UA 2GA2A 4DNCA 4ZTFA 3WG7H 3BG9A 3CTAA 1LPQA 4RS8A 1GHCA 3K6GA 5D4SA 1DDNA 2DOFA 3H92A 1IRGA 3GFJA 2DTRA 2RDPA 3LSJA 3GFIA 4CCKA 2M34A 5HDGA 1U9NA 4RGSA 1ITYA 1G8XA 5LEJA 4MO7A 4KMFA 1T0FC 4L9TA 4XLCA 2EPFA 1IV8A 4HV6A 4I6ZA 2NYXA 4EJUA 3Q9VA 4CSWA 1DP7P 4DIQA 2RN7A 5CVVA 2KZGA 3NARA 3MAJA 2DFFA 2KZVA 2CQXA 4RB1A 4FHTA 3BG6A 2KDOA 2Y75A 4JX6A 4UY8I 1OCCH 3HHHA 4RLFA 1T08B 2JN6A 1WKMA 3LSKA 3QOPA 1Z21A 1OISA 1YS7A 2L7ZA 1SANA 2X51A 3P9IA 2XKOA 1P7IA 2KKOA 3W2WA 1G3TA 5JI6A 4A93J 2QENA 3LAJA 1BJZA 1L3LA 3ZMUA 4XM3A 3L1PA 3BPVA 5EZHA 2LKXA 1VI0A 2LG4A 3X2QH 5ILSA 2CUFA 4NQWB 3RKYA 2H27A 3GVAA 3H0GJ 2QKLB 1WVRA 2L5QA 1E3OC 4PCQA 3GZ5A 5DM7F 5LRRA 3BG7A 3IAM2 2UXXA 3F8NA 1QO0D 4I76A 1SFEA 4KIFA 3GCMA 1U0JA 3KP6A 4XLEA 5GAGJ 1WI3A 2Z2SB 1B6AA 2KFDA 3KLOA 3FK7A 3SDGA 5BMZA 1TQMA 2OTLI 2EWNA 3QOEA 1LB2A 1VQ5I 5IP6A 5C4JJ 5CQEA 5LHGA 5J8CA 3FXRA 3EUAA 2PG4A 2D1HA 4UB8C 3CCJI 1ZH5A 2ME6A 2E60A 1MBFA 4IOCF 5F0CA 2QEXI 1SVLA 3T8RA 2K5CA 2QM3A 1XCVA 2C6YA 1FIAA 1KZHA 3TDUC 3K7AJ 2FEZA 3J81K 3OYEA 2QLZA 4EV0A 3DBHB 3ABMH 3H3UA 4PGHA 1VNDA 2YUSA 5F1JA 2HNHA 4BGDA 4HLYA 1EKEA 3IAS2 3V8KA 1OJLA 2FMYA 1YOVB 3ERMA 3P5JA 2F5FA 4XL9A 1VQ6I 1FYMA 5F27A 5K5QA 5A2QZ 4L5IA 2GOXB 2CG4A 2NAZA 4II2A 4ZDPA 3EUHA 5HLGA 2JZYA 2DMTA 2VBXA 2A05A 3HTSB 2HR3A 1D1AA 2L7FP 3CCYA 3BROA 2XGEA 2ZKZA 3OMYA 4EJTA 1AKHB 3CCMI 2L02A 4MQVA 2J5OA 2IXSA 3FKJA 1ACIA 2W24A 2KPMA 1SFUA 1S6LA 1FMVA 2KLOA 2LTPA 5FROA 2QF7A 2JA8J 3V8JA 3LFUA 3I64A 5E1ZB 5TISC 1TW2A 4AIHA 2VPRA 4QLCU 2K3PA 3VOEA 4LB6B 2XSDC 3ZQGA 2QWWA 1IJWC 3M3YJ 3S2DJ 4OWRB 4NQWA 4DGWB 1XGOA 5DDGA 1HSJA 4M9ZA 1OCTC 4EJOA 2HOAA 4PJLA 4AVPA 2GXBA 1ZGJA 1VQPI 4EJVA 3BWGA 3E6DA 1STZA 3D5RC 3DBRB 3K2AA 4MFEA 4KIBA 1WQ2A 2XPUA 4C30A 1GVDA 4II3A 4U0YA 4D7MA 3WE2A 3OSFA 3K4CA 2VT2A 1FX7A 3CF5F 4BQQA 1QHHD 1YLFA 1F9NA 2VQHA 2HU9A 5AONA 2IVMA 2LDUA 3GTJJ 3V4GA 2E2IJ 2R7VA 1OLTA 5K7HA 4MGRA 2FMLA 1G59A 1H88C 4DW6A 3ASOH 4U88A 2DA6A 4G7ZF 3TW6A 4A2UA 3KLNA 3DEUA 1RETA 5IP7J 4GFBA 4IRHA 2GM4A 3HRMA 3K1NA 3BTCA 4UUSA 4RB0A 3ZMVA 5FKKA 2K86A 4BUPA 2L9NA 3HOVJ 4NUBA 1XGMA 4ESJA 4PJ0C 3CF2A 5ILUA 1AKHA 3RKXA 4KN7X 2G7UA 2DDBA 2ADUA 3KEQA 2A07F 2K9NA 1Y0NA 1ZTRA 4UUTA 1X3ZB 2STTA 4ENMA 4XOPA 5EJCA 2EIKH 2F2EA 4M6YA 4ABZA 1X1AA 4E7KA 2PN6A 1I3QJ 4O6JA 1MJBA 1XC5A 4S04A 1KQ0A 4BE0A 1YHQI 3HRTA 5F64A 3BZKA 1YTYA 2KHMA 1XGNA 3MQ0A 2VT3A 5KK1A 4A69C 4IQJA 4HNTA 3G4SI 1MD0A 1USSA 1T33A 1UFMA 4D1QA 1D3YA 3L2CA 5GPCA 3DWLE 4ENKA 4Y4RA 3HEFA 2COMA 5L3GA 1YITI 1ZR4A 3QYBA 2VKVA 3DCFA 2A5YB 4V2GA 5BOXA 1I50J 1R7JA 3CCSI 2KIUA 1X1DA 1MH3A 2HFHA 2Q0OA 5DTDA 3GTQJ 2E1MC 3CC4I 5FLXZ 1I5ZA 4B09A 1WJFA 2O0YA 4W97A 3JAMZ 1S8NA 5BPIA 2DT6A 2LY9A 1F5TA 4EMSA 4Y17A 4QSHA 3OIOA 5GAEJ 2ZNZA 2VJIA 4RDUA 2Z9OA 4CGZA 1WGXA 1LFPA 4M3DA 5H6QA 3BCBA 3HPHA 1TNSA 4M71A 3D5LA 1FOYA 4CHUA 2WB1A 2UWMA 1ZK8A 1KU3A 2K40A 5EGOB 1HKSA 2YSRA 4IX7A 4BE2A 1IN4A 1X1BA 5HDNA 1LUJB 2YPRA 2ZXWH 2LYCA 1UB9A 3DFGA 2X48A 3CDLA 2STWA 4BXFA 2EB7A 4LIVA 1UHSA 2XAQA 3PNTA 1R9TJ 3I58A 2ZXHA 2EFQA 4M6XA 3R0JA 1R1TA 2CS3A 2KIFA 1O57A 1TBXA 3JRGA 2OTJI 3DKXA 3CP2A 3M1CA 4HV5A 4ZZLA 2WAFA 2QBYB 3ELKA 1R23A 3LSMA 3VFZA 3KX2A 1IUYA 1LFUP 2BVMA 1Z6RA 1SD6A 5D6FA 4ZC3A 2Y0MA 3CMAI 4RAYA 2KDZA 3A2KA 2EIMH 1R36A 4BH9A 1YQAA 1HCRA 5L3EA 1P92A 2FF4A 3L9FA 3RQ4A 5B1BH 3UNGC 2EQRA 3TP3A 4WK8F 2ZMEB 5LFAA 3HOSA 2XRLA 2K02A 1K6YA 2IT0A 3I4PA 3OR1C 1BC7C 4AM3A 3BR0A 5KNLA 3JRBA 1YJNI 1IF1A 2IRFG 3RI4A 1WJ5A 2CQNA 4D5FA 1ZN2A 2G7HA 2K7LA 3AG4H 1FZPB 2DOAA 3BY6A 3LMMA 5EDNA 4HG2A 4Y52J 1QHGA 3OY9A 3S1MJ 3AL0B 3P9CA 2VC1A 3V42A 1MBGA 2Y9ZA 1YO5C 3RIRA 3OYHA 2EFWA 4QIWN 5EGOA 2YU9J 3OIPA 3K4KA 4AVZA 3M07A 1F1ZA 2DA5A 3PJRA 2HI3A 2JWTA 5J4YA 4AD9A 2VQLA 1ZKGA 2EINH 2DK8A 2IGNA 2WAQA 3CUQC 4QPQA 3J7ZI 5C3EJ 3I59B 4C3IJ 4IRGA 1REPC 5K5RA 1T6SA 2E1OA 4HOBA 4A3KJ 3DPUA 1X1PA 2IAIA 2OAZA 3Q0WA 4M9XA 2QBYA 2H6BA 4OIOF 3LA3A 3CP8A 1RUOA 3CJTB 5F08A 3ULQB 4BXUA 2M30A 1RC9A 2XASA 2JSCA 3CJRB 3E5UA 3H1CA 3K1PA 4ZYAA 1N25A 2DN0A 3BCAA 4GYGA 4L5JA 3VYUB 1V4RA 2COBA 1BIAA 2M4KA 4CZCA 3IKVA 3ZR8X 5ICEA 4GXOA 4I7HA 3VPRA 1HLVA 5IYDJ 1OPCA 3OWTA 2DFHA 1HKTA 2NS7A 1BA5A 4EGZA 1RKTA 3M4OJ 1SMTA 2PQ8A 3DPTA 5KVRA 4YFXF 2DA7A 2ZMEA 3PNVA 2EFPA 1QGPA 2VJ4A 2X4HA 4L0ZB 2R5YB 3HOYJ 1Z7UA 3WGIA 2VBZA 1BW6A 3BG5A 4IHYA 2CQ7A 4XRMA 4I98B 2G9WA 1ZHFA 3OYNA 3JCUC 5BNGA 4ZZDA 1J09A 3M8FA 2CV2A 3HTUA 5ILVA 3ZMSA 1ZRDA 4M3GA 3A02A 3ERED 2LF8A 2VKHA 2LOOA 5F6FA 1MNEA 2QSHX 1IN5A 5HLTA 1ZR2A 2X6XA 2FBHA 4UUVA 1X4PA 2E1CA 1KYZA 2V9KA 2DCEA 4Y7NJ 2CU7A 1T95A 3SDBA 1P2FA 3BTLA 5L3CA 3N05A 4DYCA 3KZYA 1FP2A 1DUXC 2UUZA 2DA1A 5CYVA 4L9VA 2O7OA 4MEXF 2NRAC 3S1RJ 2YU3A 1OCPA 2CUZA 2NOGA 3MEXA 2M1BA 4BQOA 1K83J 1TTYA 4IRIA 2VPLA 3I5UA 1X19A 2ZBKA 1FTTA 4Y3OA 4P9UA 2LVSA 1JKQC 5GTIC 4B44A 2BBYA 2IGMA 3JREA 2P5VA 3C2BA 1VQLI 2XB0X 2CW0F 2MSYA 3R61A 1WH5A 2GXGA 3K4LA 5H6RA 4XMYA 3CC7I 5E20A 3P7NA 1P4WA 4KITB 1POGA 4E70A 1KGSA 1RIOH 2BY0A 3FM5A 4JYKA 3R60A 3IHUA 2VC0A 4H0EA 2YX7A 2DA4A 3T1BA 1X58A 1MKMA 2VKDA 3F8CA 2OPTA 2FD5A 3K9TA 4ITVA 4PUSA 4DJAA 3U2RA 2BHYA 2MFZA 2ZXIA 1BIBA 5E18F 2EV6A 2OCCH 3QWLA 3OYGA 1H9TA 3IH3A 2BV6A 5KHDA 2R5YA 3S93A 3FMRA 3E0JB 2JPCA 4NC7A 2JA6J 1S7OA 4XSZF 1FY7A 3Q9SA 4Q47A 4EVIA 2E7WA 1LNWA 1FBUA 4ZYEA 2ZFWA 5IYBJ 2V1DA 2KJBA 3HRUA 1W5TA 4H4KC 4JX4A 3F72A 1DGWY 5HS9A 4RM2A 1ZGWA 2FBIA 1TL8A 2Z99A 1TLHB 1QNTA 1UCRA 3PM1A 3WG9A 2W85A 1D0XA 1A6QA 1LDJA 1UZCA 2V6EA 1PYVA 2F5CA 3OYJA 1K4TA 3H3VK 2CRGA 1EH8A 5DD4A 1FBQA 3KZIC 1XSVA 5GPAA 4IKFA 2B9SA 4FE4A 4OINF 1LE8A 4A12A 1W5SA 1EH7A 1D8JA 2O5RA 3LSHA 4BY1J 2D1VA 4J00A 2A69F 3K2ZA 3LOCA 1WCMJ 2M0MA 3R0AA 2K4BA 1F43A 1OCOH 1X2NA 3G71I 2EZHA 3D5SC 3I0TA 4MFDA 3DU5A 3BJAA 3V7RA 2K4JA 2HS5A 5EEAA 4LG0B 1H9GA 2F48A 2RC4A 3WTSC 4RBOA 1VQ9I 2PMZN 2E34A 4MTDA 1R58A 5DS9A 5IT3A 1BL0A 1U6GA 1I1GA 1LKXA 1V5FA 2DYRH 1XG1A 3WU2C 3ZQCA 1NK3P 1ZQ3P 3TP0A 4TV7A 1FOWA 3RDIA 2DFEA 5HDKA 1JUSA 4UNOA 2VE9A 1HKQA 4HLXA 4XKCA 4O5VA 5FJ8J 4FX0A 2OQGA 5LGNA 4B47A 2V9VA 1GXQA 3DU6A 2M5WA 2IJLA 1USTA 1UHMA 2DYSH 4UVCA 2FSWA 2N8GA 2BHZA 3F8BA 1P7JA 4XSXF 1OCZH 1YJ9I 2Q1ZB 2ZJRF 2M45A 2YS9A 3FM3A 2QYOA 1LEBA 4E7IA 2XROA 1CGPA 1QBJA 3FK6A 2XIGA 1HC8A 3AKZA 1Y56A 4BS9A 2X1EA 1ZRFA 5H20A 2F5VA 1DQUA 3F23A 5A2QK 1IN6A 3LAPA 2M8GX 2KRFA 1MJAA 1HSTA 4LLGF 2WV0A 4XLFA 4J01A 4MHGA 1RKWA 3H3ZA 5HS8A 1PVEA 5FD5A 1ZGAA 3BR6A 1EH6A 2DODA 3FX3A 4P96A 3ZRGA 1Z67A 5K7ZA 4BBSJ 3ZP5A 1RNLA 4PZJA 1XPXA 3DEWA 2R92J 1R49A 2QCOA 2H09A 1K7AA 2J5PA 4CUGA 2GLOA 1HA8A 3TGNA 5E8GA 3ZN0A 4IF4A 1SC7A 3CLQA 2QQ9A 1UHWA 2O61A 1JJ6C 5LHHA 4GRIA 1H0MA 5TJJA 1F4KA 3LSIA 3JRFA 1XSXA 2VXZA 1NH3A 3EYYA 2PX9A 3WTTC 3ZPLA 4L0YB 3QAHA 1T0FA 2DK5A 1WJBA 4IQ4A 4HSRA 2XAUA 3MKWB 5D8LB 3ONQA 4E7SA 3L09A 3PO2J 1FOXA 2MH2A 5FKNA 2EH3A 4LG0A 2VQCA 5D6EA 4C3JJ 4HX4A 5JHUA 1MH4A 1Z91A 1XMAA 3F9KA 1R6RA 4MEYF 4BKXA 5LGUA 4S05A 2K9LA 3BTIA 3I71A 2Y0SA 4LLLA 3IH4A 3M7GA 3HZJA 3S2WA 1FSEA 1DP3A 1IN8A 1PDNC 2L7MP 4L9NA 4N0BA 1OYIA 2OBPA 3QODA 2HOEA 5M3MJ 1I39A 1ON1A 4NC6A 3L2UA 3SXYA 4KICA 3B6AA 5E3MA 1MMSA 1Y0UA 3ECHA 4XONA 2UZKA 1MW7A 3JRCA 3FF5A 3KYCB 5FFZA 2DMQA 2DFIA 1MBJA 4DZJA 3GYHX 3DLLF 4J19A 2AXLA 5M5YJ 4FT8A 1ULYA 4LK1F 4FCYA 3A0HC 4L9JA 3MKZA 2WAQN 3W2AA 4A3GJ 2LNBA 1P4XA 3LQQA 3CCVI 5J1YA 3HIFA 1X1CA 5HNFA 4A3JJ 3OYFA 3LL7A 3JRDA 3JRAA 4F55A 1IRZA 1JJ8C 3EUHC 3D0SA 3J7AY 2Z16A 4IXAA 4UUSB 4BE1A 1WSUA 2A3SA 2A61A 3K4BA 2H1KA 2OZ6A 4E7ZA 2LD5A 2BVLA 2LLKA 1B72B 3QU3A 2DAOA 3OS0A 1OR7C 1Z7LA 2DQLA 2HKOA 1H8AC 4PFOA 3HKZN 5LBQA 2F4OB 5HLIA 3DPLC 3CJQB 5DUIA 3EDPA 1V3FA 2LC2A 2HVSA 3MZ8A 1MMAA 2ZO4A 3M9AA 3TOAA 4YRVA 1SAUA 2VE8A 3K70C 5EZGA 2R0QC 4BDYA 2KRCA 4HZFA 2DPUA 1TWCJ 2HWVA 2ELKA 4NBQA 3TO9A 3RSNA 3MWMA 1FP1D 2WY8Q 5C4XJ 4I99C 5DCFA 3KFWX 3JR9A 1MIJA 4AYBA 3CMMA 1W36D 3MZYA 2LF7A 4AIJA 2MG4A 5DV5A 2IS1A 3GO5A 4ESBA 3C18A 4HBLA 2ME0A 2MW8A 2P0WA 4AU7A 1VQ4I 3L7WA 4PDKA 2FOKA 4BJ6C 1WZ2A 3TBIA 2LKSA 2R7XA 1UELB 4LLNA 5L3DA 1SFXA 1RR7A 3K69A 3I4NJ 5FLXK 3L2VA 3S3NA 3JAMK 2CSOA 3H0DA 5FB2A 1OMIA 3A03A 3CCEI 4KFCA 5KCMA 2MC4A 1R4MB 1CF7B 4BXXJ 2DMUA 2JTVA 1YRNB 2OQRA 2XAHA 4M3BA 3BJOA 2X1DA 4WF2A 4M9SA 3DV8A 2LKPA 2NXNB 3ESWB 4KJZA 4ETSA 2WWYA 1KQ9A 3A4CA 4GCVA 1GVJA 2HPMA 5GAHJ 3WU1B 4BDZA 4D7NA 2L01A 2RV8A 2TCTA 1GDTA 2P6SA 3G1OA 4IL6C 2L4AA 2FA5A 4CCNA 2M2EA 2O3FA 2ZC2A 2GXAA 4UB6C 1A35A 3W6JB 2IS6A 5LGTA 4RLQA 3CUOA 4S0HB 3AAFA 1LQ1A 2E35A 1FOKA 2ZFUA 4F92B 2M0CA 5FKOA 4F52A 4L18B 4AUXA 4ZYHA 1B72A 2VL8A 2E19A 3H9GA 3VDXA 1QA6A 4HPQA 2A6HF 5E3LA 3SEQA 3DTKA 1TT0A 3LQRA 3S3OA 4LG3A 3KP3A 2DXIA 3GTOJ 4LGWA 1P9QC 3PQKA 1ENHA 1NG7A 4CCJA 1S3JA 1G2HA 1MMDA 1NK2P 2NOJB 2VIXA 3DTIA 3BQZA 1N75A 3HSFA 1WJCA 2Z3YA 3OL3A 2QQ8A 3GUDA 2EV0A 3SFZA 4KNYA 3I54A 2XB5A 3W2VA 5D5XB 4P55A 3R6SA 4M74A 2H6CA 3DLAA 3OYAA 2V1NA 3BP8A 1B1BA 1T38A 4C9YA 2KJCA 2KISA 2FXAA 1E0EA 2E7XA 1OFCX 2M3AA 5F04A 3VSKA 3O8HA 1ETWA 1I3AA 4XKVA 2AXTC 5ICFA 3LA2A 2PMZA 3ABUA 1IUFA 3FWEA 4KIGA 4XK4A 3WGHA 4Q5SF 1MSEC 1CF7A 4UV9A 3FXQA 3HHGA 4N4OB 1YRNA 4NNJA 2FUG2 5D5WB 1JT6A 2ICWG 1ETOA 2IP2A 3QP6A 4BHBA 4XKBA 2RAEA 1U8RA 3BQYA 4CA0A 2P7CB 3S1NJ 4U0WA 1IW7F 4RAZA 3T5XA 2D5VA 1JXSA 4A0XA 3I3LA 2FX0A 1NHAA 1IGNA 3RZDJ 2NS0A 3ISPA 3CCQI 4RMNA 2DU9A 4M6VA 2R3SA 5JVGF 3S16J 1QZEA 3FXLA 1S9HA 1SVOA 2I10A 3KP4A 2V7FA 1A6IA 2P8TA 4BY7J 1W0TA 4B8XA 1VQ8I 1ZG5A 1DU0A 1YI2I 1HW1A 4F93B 3OYDA 4EM1A 2XGXA 5KAIC 1WRJA 4EQQA 1YIJI 3RKQA 2O9LA 4CDGA 3GTKJ 2HXOA 3HOZJ 1DPRA 2DA2A 3RYPA 5JR3A 1MMNA 2DT5A 2F6CA 3HOTA 5HLHA 1TW3A 4BJTA 4PFPA 2MH9A 9ANTA 3UKGA 3WGGA 1B4AA 2L3DA 2XAFA 6PAXA 3CUQB 3GMEA 4BEHB 2GIZA 3G6EI 1W5CC 4LITA 2PFBA 4IHVA 3O3KA 4KUMA 1OYYA 2R4GA 3WHBA 1N78A 1J2XA 3WTXC 1RESA 3FISA 4Q48A 1EF4A 3DF8A 1MDMB 2ID3A 2W48A 1U2WA 2KIQA 1FMWA 1BW5A 4KISA 4JOMA 3O8GA 4CXFA 4LIUA 1YS6A 5K1YA 2CMPA 3AG3H 5CLSA 4ZTJA 5IPAA 4XQFA 5FRMA 3VYTB 3BJ6A 4NDLA 3GFMA 3FXKA 4A3MJ 1HDPA 4G8XA 2E71A 3Q0VA 4Q4ZF 2ACJA 3WTWC 3S2HJ 4BQAA 2LK2A 3KZZA 4WXHA 3RKWA 1FBSA 4GYIA 2TDXA 3TL4X 2K9MA 1FLIA 2Z1DA 3Q3SA 3PFYA 3CCUI 1VTNC 1PUEE 1JTXA 1O4XA 2HQ5A 1LVAA 1V5EA 2VB6A 3CO7C 3DXJF 2K3FA 2O8KA 5CVUA 3HC7A 4ASNA 2A5WA 2R7ZJ 2YX4A 4XICA 4U7BA 4IPAA 4JBAA 3Q0UA 1RPWA 4EEFG 2Y0SN 2IS4A 1FT9A 2EFNA 3ZQIA 5FLMJ 2DQRA 2F5DA 2Y69H 4WX9A 4BACA 1BC8C 2OF7A 1P6RA 3LSPA 2K9QA 2XRNA 2M8EA 1W1WE 1TWFJ 4OOIA 4Z2YA 2CUJA 1VZ0A 4YFKF 5LLQA 3MFKA 1T39A 1YYVA 2JUCA 4HX8A 3CDHA 2QSGX 2EZKA 1ONVA 1TZLA 1J59A 1D5VA 2W4SA 2XC7A 1R1UA 4DYQA 2NVXJ 3IKTA 2IPQX 3CUQA 4BEHA 4CCOA 1GV2A 4RAGA 4KN4X 2QQAA 2BYVE 2V4JC 3HKZA 3J80Z 2B63J 1U5TB 2R5ZA 4IZZA 3HM5A 2VI6A 3ROUA 1R00A 4XLPF 2LMDA 2XGCA 2KL4A 5IT9Z 1IZ1A 4ZJZA 1MDMA 4E6KG 4PJNA 3CLOA 3O2PE 4HNUA 2R7TA 3VODA 5JHFA 2L0KA 1X4OA 4FTHA 1ZG3A 1S5LC 1TWAJ 1A31A 1JT0A 1JE8A 2NVQJ 2A6EF 2H94A 4BAYA 2V6CA 2XF7A 2MBFA 4AC0A 3E5XA 3H5NA 2X85A 2NVTJ 1LFBA 2QQBA 5F0HA 1ZELA 4X1EA 1G3YA 2M7AA 4CICA 2ZJPF 1SMYF 3L00A 1WJAA 2FJ1A 4IHSA 3H9QA 2VBYA 2QZ8A 1OQYA 4K2EA 1ZREA 2JA7J 1E2XA 2JT1A 2ZCWA 3CO6C 4RGUA 2W25A 3FMSA 3A1YA 3OV8A 3ZCOA 3FZVA 2LRDA 1LE8B 3H35A 1J0RA 1ON2A 1LDKB 4P5OA 1K61A 4AYBN 3K4JA 4IHWA 1SD5A 2Y9YA 3NWTA 3WHCA 2I8DA 1D1CA 4Y33A 4DZPA 4FASD 1R5GA 1ETYA 2V1UA 2QVOA 2PLYA 1ETQA 3TKYA 3RPUA 2E1NA 5C44J 2RKHA 2BXZA 2ISYA 3FXMA 3HG9A 1IXRC 2XDVA 2JRMA 2X1CA 5J1RA 2ECBA 3D1NI 1D0YA 2DLLA 4WCGA 4HF2A 4PJJA 3I56I 2XVCA 1SEUA 1LJ9A 4QTRA 4G94A 1HDDC 2DI3A 1ERDA 1IV6A 3P9KA 3MZHA 3HRSA 4CZZA 2OJED 3H5AA 1ORKA 1XX5A 2AO9A 1U5TA 2VASA 5CKTA 3JRIA 1RZ4A 4YG2F 2VQGA 3MKLA 4BHPA 1W4MA 2CFOA 3OOUA 1TWGJ 3J7YJ 4HF1A 1MBKA 1J5YA 2FQ4A 3KP5A 1S7EA 1BOAA 3BR2A 2DT7B 3KP7A 3B6CA 1WPKA 3C1DA 2HTSA 3RPUD 4XOTA 1ZRCA 4N9IA 4A5NA 2P6TA 1I27A 1JUPA 3CCLI 2BXYA 4JX5A 3LNQA 1ETXA 5FFXA 4MLOA 1JKPC 2M7BA 3GTGJ 1BN5A 1MNDA 1TWHJ 2AQFA 2R7FA 3H36A 3ML6A 2ZSHB 2F5EA 2ZB9A 1MBHA 1B9MA 1S72I 1IDZA 5FLVA 4E7JA 2H8RA 1Y6IA 3K0LA 2FNPA 2P5KA 3C3WA 5HOOA 3FHZA 2MGQA 1BR2A 4HA8A 4A5MA 4XNFA 3W6KB 1AU7A 2HTJA 2KIMA 2RQQA 3OYIA 3IWZA 2VOOA 2VOPA 5DCMB 1ZLKA 1R1VA 1G6NA 4G6DA 2XV4S 4UV8A 2K27A 3FHNA 3BC8A 1KU2A 4KT5C 4E4HA 3QPHA 3C2GA 2CQQA 2DBBA 3LFKA 5IY5H 2ZXJA 3I9V2 1KA8A 3HYIA 2JVHA 3GEZA 4LK0F 4RGXA 2AQEA 3RQIA 2XAJA 2V1XA 3KPHA 1K6OA 1HQCA 1QVTA 4A3BJ 3BDDA 2CWEA 2LR8A 1SVMA 1XGSA 2A68F 2W7NA 4HYEA 5LEKA 1Y1VJ 3LWFA 2PMUA 2B0LA 1BI1A 2JJ7A 1IC8A 5E3NA 2KQRA 3SJMA 3MCZA 2ZJQF 4IHXA 5E1WA 4NHJA 2VJ5A 2Y30A 3LSGA 3FIWA 2WADA 1E3HA 5M5XJ 3CZ6A 3QRFF 2E5NA 5B5EC 5CVIA 2HOSA 4JK1X 5DM6F 2BW3A 2HVRA 2R7QA 1BM9A 3BTJA 1FWZA 4DQ2A 4LMYA 2L9SA 3F8MA 1K78B 1IAWA 5EG0A 3CMEI 1IN7A 3GTPJ 1MZBA 4V19K 1AHDP 4B3XA 2IA0A 3ZQLA 2P4WA 3A0BC 3FXOA 2ESNA 3EQLF 3O6BB 4C2TA 1TQIA 3BR5A 4HQMA 4I02A 3IH2A 1IG7A 1HXDA 3BR3A 2KRHA 3DEEA 3PUFA 3HGYA 2X6OA 1B9NA 4X6AJ 3JTGA 4ENNA 5LHIA 1QRYA 4WXDA 1Z05A 2IA2A 1Z0XA 3S3MA 2QSFX 3E5QA 1HOMA 3DTEA 1B59A 4HSTA 1ZARA 3TO7A 1HF0A 5DCMA 4GGGA 2HOTA 3N4MA 3C2HA 1V54H 4MIMA 1VQOI 2OD5A 1O7FA 2I5UA 2OC6A 2HDCA 3VB2A 4P1WA 4UHTA 1W7PB 2X9DA 4D5CA 3ZQFA 3K4MA 1IO2A 3K1MA 3SZTA 1VQKI 3GF2A 3F8FA 2HXIA 4OIPF 2IGOA 2B7EA 1XB4A 4FQGA 2CQKA 1XD7A 1BI0A 4A3LJ 3GXOA 2M9HA 1QPIA 3IC7A 3T8TA 2P7VB 1FTZA 3MN2A 3HB9A 3ABLH 3DBLB 3FMQA 4L5EA 2XPWA 3GLXA 4FISA 3V7SA 2NNNA 3WE3A 3HXLA 3W6VA 1KU7A 4HNVA 5TRDA 4C2UA 1BR4A 5CVRA 3CJNA 5GP9A 3L2WA 3KP2A 1XTAA 2BEOA 2BY2A 2HVQA 2JK3A 3S17J 2VKEA 3WU0A 3DP7A 4ZH4F 3I55I 2OZUA 1I6HJ 4CH7A 3CESA 5JFRA 1A5JA 1JTYA 1Z1DA 4KYWA 3U9GA 2WC2A 4B3AA 1V55H 2IA1A 2VXDA 3LA7A 1K78A 3GBGA 4ENJA 5TGTA 3HPGA 4YIRX 1U3EM 2DDAA
chains in the Genus database with same CATH topology
1TQPA 1AWCA 2XHKA 5J8FA 1YFHA 5EEHA 3NEUA 1QZZA 5ED4A 2RVCA 2FQ3A 3GW2A 2MA3A 2EV5A 2O8XA 4ON0A 2FRHA 2PMHA 1LEAA 2DO7A 3IRRA 3QPTA 2VBWA 3WTUC 1PP7U 5DD8A 3KETA 3IWFA 4WXCA 2PI0A 4I0AA 1W7PA 3NQOA 5DEQA 3ZMTA 4BHCA 1EV7A 1ZAOA 4LJZF 4HW0A 2MD5A 1OR7A 4FX4A 4G7HF 4XBFA 2HYGD 2PBIA 1WWXA 2GZWA 2RGVA 3PFIA 2ZNYA 2DPDA 3F3XA 4UVAA 2V79A 1MGTA 2FNAA 2M87A 1K79A 1YW8A 3SZPA 1W7PD 2OU2A 4I0BA 3KE2A 5D8KB 1KYWA 3REOA 1O7LA 1DPUA 2CO5A 2QUFA 5AIPA 3DQVC 3ECOA 1J75A 1A04A 1BBYA 3G3ZA 1BI3A 1YW9A 2D2WA 3J81Z 4EGYA 3RYRA 1RUNA 1JHFA 4YFNF 2UXNA 2BGCA 3ZN1A 1FYLA 3EETA 2NNYA 2EJRA 4Y13A 2ETHA 1IXCA 1LDDA 4I09A 1O3TA 2IW5A 3TDZC 2OA4A 2FU4A 2GAUA 3WTVC 4R8HA 3HUGA 2LSOA 1R5HA 1HW5A 5E8IA 4ZYGA 5FD6A 5K5OA 5DYMA 1IXSB 3M8EA 1J9IA 4U7DA 5F1RA 4CO8A 1JGSA 4HDVA 4MTEA 3VEPA 1D8KA 3IRQA 1SAXA 5FO5A 2EA4A 2D45A 5E1XA 1QPMA 4AIKA 3U1DA 2EA2A 2HGCA 2XUBA 1O3RA 5L3FA 2ISZA 1I1SA 4OU0A 3N97A 2X0LA 3KEOA 1IRFA 3ZQ7A 2JPBA 1I6XA 5EEGA 1YG2A 3OOPA 4RB3C 2P5LC 3JSPA 4A0ZA 2ESHA 2YR2A 4HF0A 4MNUA 3ZMZA 4OIQF 2CFXA 1PP8F 3J80K 1S29A 1FYKA 3BOQA 2Y48A 3V7CA 5IT9K 5HS7A 1G4DA 3V8LA 3C7JA 1QQIA 5HVQC 2VONA 2XAGA 1YW7A 3R4KA 3E97A 1G3WA 5FGMA 3NRVA 3F6VA 4G7OF 2Z33A 2PJPA 5D5UB 4M73A 1O3QA 3RTRA 4PGGA 3G73A 4NB5A 4HQEA 2GIVA 1T98A 2HQRA 1J7KA 4BNCA 5BS6A 3E6CC 1ODDA 1P4AA 4A6EA 3B73A 4XLNF 1GXPA 3E6MA 4I01A 4RGRA 1MJ9A 4KMUX 4UXNA 5CJ9A 1T2KA 1X3UA 4D0PA 2CGPA 3LSTA 4QWQA 4EM0B 1ZLJA 2W84A 3RPQA 2HEOA 3HSRA 2FBKA 4YIIA 3BZ6A 1XDUA 3GWZA 1HBXG 4RB2C 3PQJA 3GFLA 1JHHA 4IHTA 4JQFA 1XCBA 4IJAA 1Q1HA 4R79A 2ELHA 3WODF 1WI9A 1FPQA 2HQNA 3SHFA 1XN7A 3J7AO 3JSOA 5BQTA 2L4MA 1FNNA 2RQPA 2XKPA 2WTEA 4EJWA 1AOYA 1Z6TA 2R7DA 4N9HA 3QU6A 1KU9A 2MLKA 1FSHA 1KQ8A 1XDSA 4EM2A 4HDUA 4O3MA 4OMZA 2FE3A 3RJPA 1OYWA 2HKXA 3TOBA 1TNTA 3M1EA 4CYDA 3WTYC 2RNJA 2VODA 2BE5F 1RI7A 4KA4A 3F6OA 2CYYA 4P9FA 4IVNA 3TQNA 2AS5F 1SD4A 2GA1A 4F7ZA 1XMKA 4XRFA 2GWRA 2HYFA 1S7AA 1BI2A 5J6XA 2Q8KA 3I59A 4LB5A 4R1HA 5ICCA 1C0WA 4MQ9F 1U5TC 5ICGA 1G3SA 4BYYA 2VN2A 4A6DA 3IL2A 5BPDA 2JRTA 3TO6A 4M72A 3KCCA 1OKRA 3WTZA 4OIRF 4HAMA 5LRSA 3JW4A 4OMYA 3GZ6A 5JVTA 4WWCA 1ZYRF 3E3VA 3E6BA 4G9YA 3HSEA 4UVBA 3ZMDA 1BJAA 3EYIA 4HX7A 2PEXA 4I2OA 5ERIA 4YIFA 2O6GE 1YIOA 3Q5FA 2ZJ2A 1O3SA 3GX4X 3F22A 5CVJA 4LD5A 4A0YA 1Z9CA 3QP5A 3COAC 2EFOA 3JTHA 1QZYA 5D5VB 2L54A 3BPXA 5D4RA 1HW2A 4KDPA 4G6QA 4GO1A 1ZG1A 2EK5A 3I53A 2DW4A 2O03A 5L3BA 5DUKA 4LFUA 1E17A 4U0VA 3ABTA 1U78A 5E17F 3F21A 1FC3A 3T0YA 4AWXB 3FXUA 2Q2EA 4ZYDA 5AIQA 3DKWA 2HZTA 1L0OC 3B02A 1XSDA 3SQNA 4Y15A 2W57A 2MC3A 2Z5UA 1R22A 4ESFA 2MLGA 1SD7A 2GQQA 2GA2A 4DNCA 3CTAA 4RS8A 1GHCA 5D4SA 1DDNA 3H92A 1IRGA 3GFJA 2DTRA 2RDPA 3GFIA 5HDGA 4RGSA 5LEJA 4KMFA 4L9TA 4HV6A 2NYXA 4EJUA 3Q9VA 1DP7P 2RN7A 5CVVA 3MAJA 4RB1A 4FHTA 2Y75A 3HHHA 1WKMA 3QOPA 1YS7A 3P9IA 2XKOA 2KKOA 5JI6A 1G3TA 2QENA 3LAJA 1L3LA 3ZMUA 3BPVA 5ILSA 3RKYA 2H27A 3GVAA 4PCQA 3GZ5A 5LRRA 2UXXA 3F8NA 1QO0D 1SFEA 4KIFA 3KP6A 5BMZA 1B6AA 3KLOA 1TQMA 2EWNA 1LB2A 5LHGA 5J8CA 3FXRA 2PG4A 2D1HA 1ZH5A 3T8RA 2QM3A 1XCVA 2C6YA 3TDUC 2FEZA 3J81K 2QLZA 4EV0A 3H3UA 4PGHA 4HLYA 3V8KA 2FMYA 2F5FA 1FYMA 5K5QA 5A2QZ 4L5IA 2CG4A 2NAZA 3EUHA 5HLGA 2JZYA 2VBXA 3HTSB 2HR3A 3BROA 2ZKZA 4EJTA 2L02A 4MQVA 2J5OA 2W24A 1SFUA 1S6LA 3V8JA 3I64A 5E1ZB 1TW2A 4AIHA 4QLCU 3VOEA 4LB6B 2QWWA 4NQWA 1XGOA 5DDGA 1HSJA 4M9ZA 4EJOA 4AVPA 2GXBA 1ZGJA 4EJVA 3BWGA 3E6DA 1STZA 4KIBA 1WQ2A 4U0YA 3WE2A 2VT2A 1FX7A 1YLFA 1F9NA 5AONA 2IVMA 2LDUA 3V4GA 4MGRA 2FMLA 4U88A 4G7ZF 4A2UA 3KLNA 3DEUA 4IRHA 3HRMA 3K1NA 4RB0A 3ZMVA 2K86A 1XGMA 4ESJA 5ILUA 3RKXA 4KN7X 2G7UA 2ADUA 3KEQA 2A07F 2STTA 4ENMA 4M6YA 2F2EA 2PN6A 4O6JA 1MJBA 4S04A 1KQ0A 3HRTA 5F64A 1YTYA 1XGNA 3MQ0A 2VT3A 5KK1A 1MD0A 1USSA 1UFMA 1D3YA 3L2CA 4ENKA 2COMA 5L3GA 2A5YB 5BOXA 1R7JA 2KIUA 2Q0OA 2HFHA 5FLXZ 1I5ZA 4B09A 2O0YA 3JAMZ 1S8NA 5BPIA 1F5TA 4EMSA 4Y17A 2ZNZA 2Z9OA 4CGZA 5H6QA 1TNSA 4M71A 3D5LA 4CHUA 2UWMA 1KU3A 1HKSA 2YSRA 1IN4A 5HDNA 2YPRA 1UB9A 3DFGA 2STWA 2EB7A 2XAQA 3I58A 2EFQA 4M6XA 3R0JA 1R1TA 2KIFA 1O57A 1TBXA 4ZZLA 4HV5A 2QBYB 3ELKA 1R23A 3VFZA 1IUYA 1Z6RA 1SD6A 5D6FA 2Y0MA 4RAYA 1R36A 4BH9A 1YQAA 5L3EA 1P92A 2FF4A 3L9FA 4WK8F 2ZMEB 3HOSA 2K02A 2IT0A 3I4PA 1BC7C 2IRFG 1IF1A 3RI4A 1ZN2A 2G7HA 2K7LA 1FZPB 3BY6A 3P9CA 2VC1A 1YO5C 3RIRA 2EFWA 1F1ZA 4AD9A 2DK8A 3CUQC 3I59B 4IRGA 1REPC 5K5RA 1T6SA 4HOBA 2OAZA 2QBYA 4M9XA 2H6BA 4OIOF 3LA3A 1RUOA 3ULQB 4BXUA 2M30A 2XASA 2JSCA 3E5UA 3K1PA 4GYGA 4L5JA 1V4RA 1BIAA 3IKVA 5ICEA 4GXOA 4I7HA 1OPCA 1HKTA 4EGZA 1SMTA 2PQ8A 3DPTA 5KVRA 4YFXF 2ZMEA 2EFPA 1QGPA 2X4HA 4L0ZB 1Z7UA 3WGIA 2VBZA 4I98B 2G9WA 1ZHFA 4ZZDA 3M8FA 3HTUA 5ILVA 3ZMSA 1ZRDA 3ERED 2LF8A 5F6FA 1IN5A 2FBHA 4UUVA 2E1CA 1KYZA 1P2FA 5L3CA 3KZYA 1FP2A 1DUXC 5CYVA 4L9VA 4MEXF 2NRAC 2YU3A 3MEXA 2M1BA 1TTYA 4IRIA 3I5UA 2ZBKA 4P9UA 2BBYA 2P5VA 2CW0F 3R61A 2GXGA 5H6RA 5E20A 3P7NA 1P4WA 4E70A 1KGSA 1RIOH 3FM5A 3R60A 3IHUA 2VC0A 4H0EA 2YX7A 3T1BA 1MKMA 3F8CA 3K9TA 3U2RA 1BIBA 5E18F 2EV6A 1H9TA 2BV6A 3FMRA 2JPCA 1S7OA 4XSZF 1FY7A 3Q9SA 4Q47A 4EVIA 2E7WA 1LNWA 1FBUA 4ZYEA 2ZFWA 2V1DA 2KJBA 3HRUA 1W5TA 3F72A 5HS9A 2FBIA 2Z99A 1TLHB 1QNTA 1UCRA 3WG9A 2W85A 1LDJA 2F5CA 1EH8A 5DD4A 1FBQA 1XSVA 4OINF 4A12A 1W5SA 1EH7A 1D8JA 2D1VA 2A69F 3K2ZA 3R0AA 2K4BA 4LG0B 3I0TA 3V7RA 3BJAA 2K4JA 2HS5A 1H9GA 2RC4A 3WTSC 4MTDA 1R58A 5IT3A 1U6GA 1I1GA 4TV7A 3RDIA 5HDKA 4UNOA 2VE9A 1HKQA 4HLXA 4O5VA 4FX0A 2OQGA 5LGNA 2V9VA 1GXQA 2M5WA 2IJLA 1USTA 1UHMA 4UVCA 2FSWA 3F8BA 4XSXF 2M45A 3FM3A 2QYOA 1LEBA 1CGPA 2XROA 1QBJA 2XIGA 1ZRFA 5H20A 3F23A 5A2QK 1IN6A 3LAPA 2KRFA 1MJAA 1HSTA 4LLGF 2WV0A 4MHGA 5HS8A 3H3ZA 5FD5A 1ZGAA 1EH6A 3FX3A 4P96A 3ZP5A 1RNLA 4PZJA 2H09A 1K7AA 2J5PA 3TGNA 5E8GA 3ZN0A 4IF4A 2QQ9A 1UHWA 2O61A 5LHHA 1H0MA 5TJJA 1F4KA 1XSXA 2VXZA 3EYYA 3WTTC 3ZPLA 4L0YB 3QAHA 1T0FA 2DK5A 5D8LB 3L09A 2MH2A 4LG0A 5D6EA 4HX4A 5JHUA 1Z91A 1XMAA 4MEYF 5LGUA 4S05A 3I71A 4LLLA 3M7GA 3S2WA 1FSEA 1IN8A 4L9NA 4N0BA 1OYIA 2OBPA 2HOEA 1ON1A 3SXYA 4KICA 1Y0UA 3ECHA 2UZKA 3FF5A 5FFZA 2DFIA 3GYHX 2AXLA 4FT8A 1ULYA 4LK1F 4L9JA 2LNBA 1P4XA 3LQQA 3HIFA 3D0SA 4IXAA 1WSUA 2A3SA 2A61A 2OZ6A 3QU3A 2DAOA 2DQLA 2HKOA 5LBQA 5HLIA 3DPLC 5DUIA 3EDPA 1V3FA 2ZO4A 3M9AA 3TOAA 2VE8A 4HZFA 2DPUA 2HWVA 3TO9A 3MWMA 1FP1D 5DCFA 3KFWX 3MZYA 2LF7A 4AIJA 5DV5A 3GO5A 4ESBA 3C18A 4HBLA 3L7WA 4PDKA 2FOKA 4LLNA 5L3DA 1SFXA 5FLXK 3K69A 3JAMK 2CSOA 5FB2A 1OMIA 4KFCA 1CF7B 2JTVA 2OQRA 2XAHA 3BJOA 4WF2A 4M9SA 3DV8A 2LKPA 4ETSA 2WWYA 1KQ9A 4GCVA 1GVJA 3WU1B 2L01A 2RV8A 2P6SA 2L4AA 2FA5A 2O3FA 3W6JB 5LGTA 3CUOA 3AAFA 1LQ1A 1FOKA 4L18B 4ZYHA 2A6HF 3LQRA 3KP3A 4LGWA 3PQKA 1S3JA 3HSFA 2Z3YA 3GUDA 2EV0A 3SFZA 4KNYA 3I54A 5D5XB 4P55A 3R6SA 4M74A 2H6CA 3BP8A 1B1BA 1T38A 2KJCA 2FXAA 2E7XA 5ICFA 3LA2A 3ABUA 3FWEA 4KIGA 3WGHA 4Q5SF 1CF7A 4UV9A 3FXQA 3HHGA 5D5WB 2IP2A 3QP6A 4BHBA 1U8RA 2P7CB 4U0WA 1IW7F 4RAZA 3T5XA 1JXSA 4A0XA 1NHAA 2NS0A 3ISPA 2DU9A 2R3SA 3KP4A 2P8TA 4B8XA 1ZG5A 1HW1A 4EM1A 2XGXA 4EQQA 1WRJA 4CDGA 1DPRA 3RYPA 5JR3A 2DT5A 3HOTA 5HLHA 1TW3A 2MH9A 3WGGA 1B4AA 2L3DA 2XAFA 6PAXA 3CUQB 2PFBA 3O3KA 4KUMA 1OYYA 1J2XA 3WTXC 4Q48A 3DF8A 1MDMB 1U2WA 4CXFA 1YS6A 5K1YA 5CLSA 3BJ6A 3GFMA 4G8XA 4Q4ZF 2ACJA 3WTWC 4BQAA 3KZZA 4WXHA 3RKWA 1FBSA 4GYIA 2TDXA 1FLIA 1VTNC 1PUEE 1LVAA 3CO7C 3DXJF 5CVUA 4ASNA 2YX4A 4U7BA 4IPAA 4JBAA 1FT9A 2EFNA 2DQRA 2F5DA 4WX9A 1BC8C 1P6RA 4Z2YA 2XRNA 2M8EA 4OOIA 4YFKF 5LLQA 3MFKA 1T39A 1YYVA 4HX8A 3CDHA 1ONVA 1J59A 1D5VA 1R1UA 3IKTA 2IPQX 3CUQA 4KN4X 2QQAA 2BYVE 3J80Z 1U5TB 3ROUA 1R00A 4XLPF 5IT9Z 1IZ1A 1MDMA 3CLOA 3O2PE 3VODA 1ZG3A 1JE8A 2A6EF 2H94A 4BAYA 2V6CA 2MBFA 3E5XA 2QQBA 1G3YA 4CICA 1SMYF 3L00A 4IHSA 2VBYA 2QZ8A 4K2EA 1ZREA 1E2XA 2JT1A 2ZCWA 3CO6C 4RGUA 2W25A 3FMSA 3OV8A 3FZVA 1J0RA 1ON2A 1LDKB 4P5OA 1SD5A 1R5GA 2V1UA 2QVOA 2PLYA 3TKYA 3RPUA 2E1NA 2RKHA 2ISYA 1IXRC 2DLLA 4WCGA 4HF2A 2XVCA 1LJ9A 4G94A 2DI3A 3P9KA 3MZHA 3HRSA 4CZZA 1U5TA 1RZ4A 4YG2F 4BHPA 1W4MA 4HF1A 1J5YA 3KP5A 1BOAA 3KP7A 3C1DA 2HTSA 1ZRCA 4N9IA 4A5NA 2P6TA 1I27A 5FFXA 1BN5A 3ML6A 2R7FA 2F5EA 1B9MA 3K0LA 2FNPA 2P5KA 3C3WA 5HOOA 3FHZA 4HA8A 4A5MA 3W6KB 2HTJA 2KIMA 2VOOA 3IWZA 2VOPA 5DCMB 1ZLKA 1R1VA 1G6NA 4G6DA 2XV4S 4UV8A 2K27A 1KU2A 4KT5C 3QPHA 3LFKA 2DBBA 2ZXJA 1KA8A 3HYIA 4RGXA 3GEZA 4LK0F 2XAJA 2V1XA 1K6OA 1HQCA 3BDDA 2CWEA 1XGSA 2A68F 4HYEA 5LEKA 3LWFA 2PMUA 2B0LA 1BI1A 3MCZA 4NHJA 5E1WA 3QRFF 5CVIA 4JK1X 1BM9A 1FWZA 4DQ2A 4LMYA 3F8MA 1K78B 1IAWA 1IN7A 1MZBA 2IA0A 2P4WA 3O6BB 2ESNA 3EQLF 1TQIA 4HQMA 4I02A 1HXDA 1B9NA 3JTGA 4ENNA 5LHIA 4WXDA 1Z05A 2IA2A 3E5QA 3TO7A 1B59A 1ZARA 5DCMA 4GGGA 3N4MA 2OD5A 1O7FA 2HDCA 3VB2A 4UHTA 1W7PB 3K1MA 3SZTA 3GF2A 3F8FA 4OIPF 1XB4A 2CQKA 1XD7A 1BI0A 3GXOA 3IC7A 3T8TA 2P7VB 3FMQA 3GLXA 3V7SA 2NNNA 3WE3A 1KU7A 5TRDA 5CVRA 3CJNA 3KP2A 2BEOA 3WU0A 3DP7A 4ZH4F 2OZUA 5JFRA 1Z1DA 4KYWA 3U9GA 2WC2A 2IA1A 3LA7A 1K78A 4ENJA 1PDNC 1U3EM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TQP A;  1AWC A;  2XHK A;  5J8F A;  1YFH A;  5EEH A;  3NEU A;  1QZZ A;  5ED4 A;  2RVC A;  2FQ3 A;  3GW2 A;  2MA3 A;  2EV5 A;  2O8X A;  4ON0 A;  2FRH A;  2PMH A;  1LEA A;  2DO7 A;  3IRR A;  3QPT A;  2VBW A;  3WTU C;  1PP7 U;  5DD8 A;  3KET A;  3IWF A;  4WXC A;  2PI0 A;  4I0A A;  1W7P A;  3NQO A;  5DEQ A;  3ZMT A;  4BHC A;  1EV7 A;  1ZAO A;  4LJZ F;  4HW0 A;  2MD5 A;  1OR7 A;  4FX4 A;  4G7H F;  4XBF A;  2HYG D;  2PBI A;  1WWX A;  2GZW A;  2RGV A;  3PFI A;  2ZNY A;  2DPD A;  3F3X A;  4UVA A;  2V79 A;  1MGT A;  2FNA A;  2M87 A;  1K79 A;  1YW8 A;  3SZP A;  1W7P D;  2OU2 A;  4I0B A;  3KE2 A;  5D8K B;  1KYW A;  3REO A;  1O7L A;  1DPU A;  2CO5 A;  2QUF A;  5AIP A;  3DQV C;  3ECO A;  1J75 A;  1A04 A;  1BBY A;  3G3Z A;  1BI3 A;  1YW9 A;  2D2W A;  3J81 Z;  4EGY A;  3RYR A;  1RUN A;  1JHF A;  4YFN F;  2UXN A;  2BGC A;  3ZN1 A;  1FYL A;  3EET A;  2NNY A;  2EJR A;  4Y13 A;  2ETH A;  1IXC A;  1LDD A;  4I09 A;  1O3T A;  2IW5 A;  3TDZ C;  2OA4 A;  2FU4 A;  2GAU A;  3WTV C;  4R8H A;  3HUG A;  2LSO A;  1R5H A;  1HW5 A;  5E8I A;  4ZYG A;  5FD6 A;  5K5O A;  5DYM A;  1IXS B;  3M8E A;  1J9I A;  4U7D A;  5F1R A;  4CO8 A;  1JGS A;  4HDV A;  4MTE A;  3VEP A;  1D8K A;  3IRQ A;  1SAX A;  5FO5 A;  2EA4 A;  2D45 A;  5E1X A;  1QPM A;  4AIK A;  3U1D A;  2EA2 A;  2HGC A;  2XUB A;  1O3R A;  5L3F A;  2ISZ A;  1I1S A;  4OU0 A;  3N97 A;  2X0L A;  3KEO A;  1IRF A;  3ZQ7 A;  2JPB A;  1I6X A;  5EEG A;  1YG2 A;  3OOP A;  4RB3 C;  2P5L C;  3JSP A;  4A0Z A;  2ESH A;  2YR2 A;  4HF0 A;  4MNU A;  3ZMZ A;  4OIQ F;  2CFX A;  1PP8 F;  3J80 K;  1S29 A;  1FYK A;  3BOQ A;  2Y48 A;  3V7C A;  5IT9 K;  5HS7 A;  1G4D A;  3V8L A;  3C7J A;  1QQI A;  5HVQ C;  2VON A;  2XAG A;  1YW7 A;  3R4K A;  3E97 A;  1G3W A;  5FGM A;  3NRV A;  3F6V A;  4G7O F;  2Z33 A;  2PJP A;  5D5U B;  4M73 A;  1O3Q A;  3RTR A;  4PGG A;  3G73 A;  4NB5 A;  4HQE A;  2GIV A;  1T98 A;  2HQR A;  1J7K A;  4BNC A;  5BS6 A;  3E6C C;  1ODD A;  1P4A A;  4A6E A;  3B73 A;  4XLN F;  1GXP A;  3E6M A;  4I01 A;  4RGR A;  1MJ9 A;  4KMU X;  4UXN A;  5CJ9 A;  1T2K A;  1X3U A;  4D0P A;  2CGP A;  3LST A;  4QWQ A;  4EM0 B;  1ZLJ A;  2W84 A;  3RPQ A;  2HEO A;  3HSR A;  2FBK A;  4YII A;  3BZ6 A;  1XDU A;  3GWZ A;  1HBX G;  4RB2 C;  3PQJ A;  3GFL A;  1JHH A;  4IHT A;  4JQF A;  1XCB A;  4IJA A;  1Q1H A;  4R79 A;  2ELH A;  3WOD F;  1WI9 A;  1FPQ A;  2HQN A;  3SHF A;  1XN7 A;  3J7A O;  3JSO A;  5BQT A;  2L4M A;  1FNN A;  2RQP A;  2XKP A;  2WTE A;  4EJW A;  1AOY A;  1Z6T A;  2R7D A;  4N9H A;  3QU6 A;  1KU9 A;  2MLK A;  1FSH A;  1KQ8 A;  1XDS A;  4EM2 A;  4HDU A;  4O3M A;  4OMZ A;  2FE3 A;  3RJP A;  1OYW A;  2HKX A;  3TOB A;  1TNT A;  3M1E A;  4CYD A;  3WTY C;  2RNJ A;  2VOD A;  2BE5 F;  1RI7 A;  4KA4 A;  3F6O A;  2CYY A;  4P9F A;  4IVN A;  3TQN A;  2AS5 F;  1SD4 A;  2GA1 A;  4F7Z A;  1XMK A;  4XRF A;  2GWR A;  2HYF A;  1S7A A;  1BI2 A;  5J6X A;  2Q8K A;  3I59 A;  4LB5 A;  4R1H A;  5ICC A;  1C0W A;  4MQ9 F;  1U5T C;  5ICG A;  1G3S A;  4BYY A;  2VN2 A;  4A6D A;  3IL2 A;  5BPD A;  2JRT A;  3TO6 A;  4M72 A;  3KCC A;  1OKR A;  3WTZ A;  4OIR F;  4HAM A;  5LRS A;  3JW4 A;  4OMY A;  3GZ6 A;  5JVT A;  4WWC A;  1ZYR F;  3E3V A;  3E6B A;  4G9Y A;  3HSE A;  4UVB A;  3ZMD A;  1BJA A;  3EYI A;  4HX7 A;  2PEX A;  4I2O A;  5ERI A;  4YIF A;  2O6G E;  1YIO A;  3Q5F A;  2ZJ2 A;  1O3S A;  3GX4 X;  3F22 A;  5CVJ A;  4LD5 A;  4A0Y A;  1Z9C A;  3QP5 A;  3COA C;  2EFO A;  3JTH A;  1QZY A;  5D5V B;  2L54 A;  3BPX A;  5D4R A;  1HW2 A;  4KDP A;  4G6Q A;  4GO1 A;  1ZG1 A;  2EK5 A;  3I53 A;  2DW4 A;  2O03 A;  5L3B A;  5DUK A;  4LFU A;  1E17 A;  4U0V A;  3ABT A;  1U78 A;  5E17 F;  3F21 A;  1FC3 A;  3T0Y A;  4AWX B;  3FXU A;  2Q2E A;  4ZYD A;  5AIQ A;  3DKW A;  2HZT A;  1L0O C;  3B02 A;  1XSD A;  3SQN A;  4Y15 A;  2W57 A;  2MC3 A;  2Z5U A;  1R22 A;  4ESF A;  2MLG A;  1SD7 A;  2GQQ A;  2GA2 A;  4DNC A;  3CTA A;  4RS8 A;  1GHC A;  5D4S A;  1DDN A;  3H92 A;  1IRG A;  3GFJ A;  2DTR A;  2RDP A;  3GFI A;  5HDG A;  4RGS A;  5LEJ A;  4KMF A;  4L9T A;  4HV6 A;  2NYX A;  4EJU A;  3Q9V A;  1DP7 P;  2RN7 A;  5CVV A;  3MAJ A;  4RB1 A;  4FHT A;  2Y75 A;  3HHH A;  1WKM A;  3QOP A;  1YS7 A;  3P9I A;  2XKO A;  2KKO A;  5JI6 A;  1G3T A;  2QEN A;  3LAJ A;  1L3L A;  3ZMU A;  3BPV A;  5ILS A;  3RKY A;  2H27 A;  3GVA A;  4PCQ A;  3GZ5 A;  5LRR A;  2UXX A;  3F8N A;  1QO0 D;  1SFE A;  4KIF A;  3KP6 A;  5BMZ A;  1B6A A;  3KLO A;  1TQM A;  2EWN A;  1LB2 A;  5LHG A;  5J8C A;  3FXR A;  2PG4 A;  2D1H A;  1ZH5 A;  3T8R A;  2QM3 A;  1XCV A;  2C6Y A;  3TDU C;  2FEZ A;  3J81 K;  2QLZ A;  4EV0 A;  3H3U A;  4PGH A;  4HLY A;  3V8K A;  2FMY A;  2F5F A;  1FYM A;  5K5Q A;  5A2Q Z;  4L5I A;  2CG4 A;  2NAZ A;  3EUH A;  5HLG A;  2JZY A;  2VBX A;  3HTS B;  2HR3 A;  3BRO A;  2ZKZ A;  4EJT A;  2L02 A;  4MQV A;  2J5O A;  2W24 A;  1SFU A;  1S6L A;  3V8J A;  3I64 A;  5E1Z B;  1TW2 A;  4AIH A;  4QLC U;  3VOE A;  4LB6 B;  2QWW A;  4NQW A;  1XGO A;  5DDG A;  1HSJ A;  4M9Z A;  4EJO A;  4AVP A;  2GXB A;  1ZGJ A;  4EJV A;  3BWG A;  3E6D A;  1STZ A;  4KIB A;  1WQ2 A;  4U0Y A;  3WE2 A;  2VT2 A;  1FX7 A;  1YLF A;  1F9N A;  5AON A;  2IVM A;  2LDU A;  3V4G A;  4MGR A;  2FML A;  4U88 A;  4G7Z F;  4A2U A;  3KLN A;  3DEU A;  4IRH A;  3HRM A;  3K1N A;  4RB0 A;  3ZMV A;  2K86 A;  1XGM A;  4ESJ A;  5ILU A;  3RKX A;  4KN7 X;  2G7U A;  2ADU A;  3KEQ A;  2A07 F;  2STT A;  4ENM A;  4M6Y A;  2F2E A;  2PN6 A;  4O6J A;  1MJB A;  4S04 A;  1KQ0 A;  3HRT A;  5F64 A;  1YTY A;  1XGN A;  3MQ0 A;  2VT3 A;  5KK1 A;  1MD0 A;  1USS A;  1UFM A;  1D3Y A;  3L2C A;  4ENK A;  2COM A;  5L3G A;  2A5Y B;  5BOX A;  1R7J A;  2KIU A;  2Q0O A;  2HFH A;  5FLX Z;  1I5Z A;  4B09 A;  2O0Y A;  3JAM Z;  1S8N A;  5BPI A;  1F5T A;  4EMS A;  4Y17 A;  2ZNZ A;  2Z9O A;  4CGZ A;  5H6Q A;  1TNS A;  4M71 A;  3D5L A;  4CHU A;  2UWM A;  1KU3 A;  1HKS A;  2YSR A;  1IN4 A;  5HDN A;  2YPR A;  1UB9 A;  3DFG A;  2STW A;  2EB7 A;  2XAQ A;  3I58 A;  2EFQ A;  4M6X A;  3R0J A;  1R1T A;  2KIF A;  1O57 A;  1TBX A;  4ZZL A;  4HV5 A;  2QBY B;  3ELK A;  1R23 A;  3VFZ A;  1IUY A;  1Z6R A;  1SD6 A;  5D6F A;  2Y0M A;  4RAY A;  1R36 A;  4BH9 A;  1YQA A;  5L3E A;  1P92 A;  2FF4 A;  3L9F A;  4WK8 F;  2ZME B;  3HOS A;  2K02 A;  2IT0 A;  3I4P A;  1BC7 C;  2IRF G;  1IF1 A;  3RI4 A;  1ZN2 A;  2G7H A;  2K7L A;  1FZP B;  3BY6 A;  3P9C A;  2VC1 A;  1YO5 C;  3RIR A;  2EFW A;  1F1Z A;  4AD9 A;  2DK8 A;  3CUQ C;  3I59 B;  4IRG A;  1REP C;  5K5R A;  1T6S A;  4HOB A;  2OAZ A;  2QBY A;  4M9X A;  2H6B A;  4OIO F;  3LA3 A;  1RUO A;  3ULQ B;  4BXU A;  2M30 A;  2XAS A;  2JSC A;  3E5U A;  3K1P A;  4GYG A;  4L5J A;  1V4R A;  1BIA A;  3IKV A;  5ICE A;  4GXO A;  4I7H A;  1OPC A;  1HKT A;  4EGZ A;  1SMT A;  2PQ8 A;  3DPT A;  5KVR A;  4YFX F;  2ZME A;  2EFP A;  1QGP A;  2X4H A;  4L0Z B;  1Z7U A;  3WGI A;  2VBZ A;  4I98 B;  2G9W A;  1ZHF A;  4ZZD A;  3M8F A;  3HTU A;  5ILV A;  3ZMS A;  1ZRD A;  3ERE D;  2LF8 A;  5F6F A;  1IN5 A;  2FBH A;  4UUV A;  2E1C A;  1KYZ A;  1P2F A;  5L3C A;  3KZY A;  1FP2 A;  1DUX C;  5CYV A;  4L9V A;  4MEX F;  2NRA C;  2YU3 A;  3MEX A;  2M1B A;  1TTY A;  4IRI A;  3I5U A;  2ZBK A;  4P9U A;  2BBY A;  2P5V A;  2CW0 F;  3R61 A;  2GXG A;  5H6R A;  5E20 A;  3P7N A;  1P4W A;  4E70 A;  1KGS A;  1RIO H;  3FM5 A;  3R60 A;  3IHU A;  2VC0 A;  4H0E A;  2YX7 A;  3T1B A;  1MKM A;  3F8C A;  3K9T A;  3U2R A;  1BIB A;  5E18 F;  2EV6 A;  1H9T A;  2BV6 A;  3FMR A;  2JPC A;  1S7O A;  4XSZ F;  1FY7 A;  3Q9S A;  4Q47 A;  4EVI A;  2E7W A;  1LNW A;  1FBU A;  4ZYE A;  2ZFW A;  2V1D A;  2KJB A;  3HRU A;  1W5T A;  3F72 A;  5HS9 A;  2FBI A;  2Z99 A;  1TLH B;  1QNT A;  1UCR A;  3WG9 A;  2W85 A;  1LDJ A;  2F5C A;  1EH8 A;  5DD4 A;  1FBQ A;  1XSV A;  4OIN F;  4A12 A;  1W5S A;  1EH7 A;  1D8J A;  2D1V A;  2A69 F;  3K2Z A;  3R0A A;  2K4B A;  4LG0 B;  3I0T A;  3V7R A;  3BJA A;  2K4J A;  2HS5 A;  1H9G A;  2RC4 A;  3WTS C;  4MTD A;  1R58 A;  5IT3 A;  1U6G A;  1I1G A;  4TV7 A;  3RDI A;  5HDK A;  4UNO A;  2VE9 A;  1HKQ A;  4HLX A;  4O5V A;  4FX0 A;  2OQG A;  5LGN A;  2V9V A;  1GXQ A;  2M5W A;  2IJL A;  1UST A;  1UHM A;  4UVC A;  2FSW A;  3F8B A;  4XSX F;  2M45 A;  3FM3 A;  2QYO A;  1LEB A;  1CGP A;  2XRO A;  1QBJ A;  2XIG A;  1ZRF A;  5H20 A;  3F23 A;  5A2Q K;  1IN6 A;  3LAP A;  2KRF A;  1MJA A;  1HST A;  4LLG F;  2WV0 A;  4MHG A;  5HS8 A;  3H3Z A;  5FD5 A;  1ZGA A;  1EH6 A;  3FX3 A;  4P96 A;  3ZP5 A;  1RNL A;  4PZJ A;  2H09 A;  1K7A A;  2J5P A;  3TGN A;  5E8G A;  3ZN0 A;  4IF4 A;  2QQ9 A;  1UHW A;  2O61 A;  5LHH A;  1H0M A;  5TJJ A;  1F4K A;  1XSX A;  2VXZ A;  3EYY A;  3WTT C;  3ZPL A;  4L0Y B;  3QAH A;  1T0F A;  2DK5 A;  5D8L B;  3L09 A;  2MH2 A;  4LG0 A;  5D6E A;  4HX4 A;  5JHU A;  1Z91 A;  1XMA A;  4MEY F;  5LGU A;  4S05 A;  3I71 A;  4LLL A;  3M7G A;  3S2W A;  1FSE A;  1IN8 A;  4L9N A;  4N0B A;  1OYI A;  2OBP A;  2HOE A;  1ON1 A;  3SXY A;  4KIC A;  1Y0U A;  3ECH A;  2UZK A;  3FF5 A;  5FFZ A;  2DFI A;  3GYH X;  2AXL A;  4FT8 A;  1ULY A;  4LK1 F;  4L9J A;  2LNB A;  1P4X A;  3LQQ A;  3HIF A;  3D0S A;  4IXA A;  1WSU A;  2A3S A;  2A61 A;  2OZ6 A;  3QU3 A;  2DAO A;  2DQL A;  2HKO A;  5LBQ A;  5HLI A;  3DPL C;  5DUI A;  3EDP A;  1V3F A;  2ZO4 A;  3M9A A;  3TOA A;  2VE8 A;  4HZF A;  2DPU A;  2HWV A;  3TO9 A;  3MWM A;  1FP1 D;  5DCF A;  3KFW X;  3MZY A;  2LF7 A;  4AIJ A;  5DV5 A;  3GO5 A;  4ESB A;  3C18 A;  4HBL A;  3L7W A;  4PDK A;  2FOK A;  4LLN A;  5L3D A;  1SFX A;  5FLX K;  3K69 A;  3JAM K;  2CSO A;  5FB2 A;  1OMI A;  4KFC A;  1CF7 B;  2JTV A;  2OQR A;  2XAH A;  3BJO A;  4WF2 A;  4M9S A;  3DV8 A;  2LKP A;  4ETS A;  2WWY A;  1KQ9 A;  4GCV A;  1GVJ A;  3WU1 B;  2L01 A;  2RV8 A;  2P6S A;  2L4A A;  2FA5 A;  2O3F A;  3W6J B;  5LGT A;  3CUO A;  3AAF A;  1LQ1 A;  1FOK A;  4L18 B;  4ZYH A;  2A6H F;  3LQR A;  3KP3 A;  4LGW A;  3PQK A;  1S3J A;  3HSF A;  2Z3Y A;  3GUD A;  2EV0 A;  3SFZ A;  4KNY A;  3I54 A;  5D5X B;  4P55 A;  3R6S A;  4M74 A;  2H6C A;  3BP8 A;  1B1B A;  1T38 A;  2KJC A;  2FXA A;  2E7X A;  5ICF A;  3LA2 A;  3ABU A;  3FWE A;  4KIG A;  3WGH A;  4Q5S F;  1CF7 A;  4UV9 A;  3FXQ A;  3HHG A;  5D5W B;  2IP2 A;  3QP6 A;  4BHB A;  1U8R A;  2P7C B;  4U0W A;  1IW7 F;  4RAZ A;  3T5X A;  1JXS A;  4A0X A;  1NHA A;  2NS0 A;  3ISP A;  2DU9 A;  2R3S A;  3KP4 A;  2P8T A;  4B8X A;  1ZG5 A;  1HW1 A;  4EM1 A;  2XGX A;  4EQQ A;  1WRJ A;  4CDG A;  1DPR A;  3RYP A;  5JR3 A;  2DT5 A;  3HOT A;  5HLH A;  1TW3 A;  2MH9 A;  3WGG A;  1B4A A;  2L3D A;  2XAF A;  6PAX A;  3CUQ B;  2PFB A;  3O3K A;  4KUM A;  1OYY A;  1J2X A;  3WTX C;  4Q48 A;  3DF8 A;  1MDM B;  1U2W A;  4CXF A;  1YS6 A;  5K1Y A;  5CLS A;  3BJ6 A;  3GFM A;  4G8X A;  4Q4Z F;  2ACJ A;  3WTW C;  4BQA A;  3KZZ A;  4WXH A;  3RKW A;  1FBS A;  4GYI A;  2TDX A;  1FLI A;  1VTN C;  1PUE E;  1LVA A;  3CO7 C;  3DXJ F;  5CVU A;  4ASN A;  2YX4 A;  4U7B A;  4IPA A;  4JBA A;  1FT9 A;  2EFN A;  2DQR A;  2F5D A;  4WX9 A;  1BC8 C;  1P6R A;  4Z2Y A;  2XRN A;  2M8E A;  4OOI A;  4YFK F;  5LLQ A;  3MFK A;  1T39 A;  1YYV A;  4HX8 A;  3CDH A;  1ONV A;  1J59 A;  1D5V A;  1R1U A;  3IKT A;  2IPQ X;  3CUQ A;  4KN4 X;  2QQA A;  2BYV E;  3J80 Z;  1U5T B;  3ROU A;  1R00 A;  4XLP F;  5IT9 Z;  1IZ1 A;  1MDM A;  3CLO A;  3O2P E;  3VOD A;  1ZG3 A;  1JE8 A;  2A6E F;  2H94 A;  4BAY A;  2V6C A;  2MBF A;  3E5X A;  2QQB A;  1G3Y A;  4CIC A;  1SMY F;  3L00 A;  4IHS A;  2VBY A;  2QZ8 A;  4K2E A;  1ZRE A;  1E2X A;  2JT1 A;  2ZCW A;  3CO6 C;  4RGU A;  2W25 A;  3FMS A;  3OV8 A;  3FZV A;  1J0R A;  1ON2 A;  1LDK B;  4P5O A;  1SD5 A;  1R5G A;  2V1U A;  2QVO A;  2PLY A;  3TKY A;  3RPU A;  2E1N A;  2RKH A;  2ISY A;  1IXR C;  2DLL A;  4WCG A;  4HF2 A;  2XVC A;  1LJ9 A;  4G94 A;  2DI3 A;  3P9K A;  3MZH A;  3HRS A;  4CZZ A;  1U5T A;  1RZ4 A;  4YG2 F;  4BHP A;  1W4M A;  4HF1 A;  1J5Y A;  3KP5 A;  1BOA A;  3KP7 A;  3C1D A;  2HTS A;  1ZRC A;  4N9I A;  4A5N A;  2P6T A;  1I27 A;  5FFX A;  1BN5 A;  3ML6 A;  2R7F A;  2F5E A;  1B9M A;  3K0L A;  2FNP A;  2P5K A;  3C3W A;  5HOO A;  3FHZ A;  4HA8 A;  4A5M A;  3W6K B;  2HTJ A;  2KIM A;  2VOO A;  3IWZ A;  2VOP A;  5DCM B;  1ZLK A;  1R1V A;  1G6N A;  4G6D A;  2XV4 S;  4UV8 A;  2K27 A;  1KU2 A;  4KT5 C;  3QPH A;  3LFK A;  2DBB A;  2ZXJ A;  1KA8 A;  3HYI A;  4RGX A;  3GEZ A;  4LK0 F;  2XAJ A;  2V1X A;  1K6O A;  1HQC A;  3BDD A;  2CWE A;  1XGS A;  2A68 F;  4HYE A;  5LEK A;  3LWF A;  2PMU A;  2B0L A;  1BI1 A;  3MCZ A;  4NHJ A;  5E1W A;  3QRF F;  5CVI A;  4JK1 X;  1BM9 A;  1FWZ A;  4DQ2 A;  4LMY A;  3F8M A;  1K78 B;  1IAW A;  1IN7 A;  1MZB A;  2IA0 A;  2P4W A;  3O6B B;  2ESN A;  3EQL F;  1TQI A;  4HQM A;  4I02 A;  1HXD A;  1B9N A;  3JTG A;  4ENN A;  5LHI A;  4WXD A;  1Z05 A;  2IA2 A;  3E5Q A;  3TO7 A;  1B59 A;  1ZAR A;  5DCM A;  4GGG A;  3N4M A;  2OD5 A;  1O7F A;  2HDC A;  3VB2 A;  4UHT A;  1W7P B;  3K1M A;  3SZT A;  3GF2 A;  3F8F A;  4OIP F;  1XB4 A;  2CQK A;  1XD7 A;  1BI0 A;  3GXO A;  3IC7 A;  3T8T A;  2P7V B;  3FMQ A;  3GLX A;  3V7S A;  2NNN A;  3WE3 A;  1KU7 A;  5TRD A;  5CVR A;  3CJN A;  3KP2 A;  2BEO A;  3WU0 A;  3DP7 A;  4ZH4 F;  2OZU A;  5JFR A;  1Z1D A;  4KYW A;  3U9G A;  2WC2 A;  2IA1 A;  3LA7 A;  1K78 A;  4ENJ A;  1PDN C;  1U3E M; 
#chains in the Genus database with same CATH topology
 1TQP A;  1AWC A;  3EPZ A;  2XHK A;  1W36 C;  2L7K A;  5J8F A;  1YFH A;  5EEH A;  3NEU A;  1QZZ A;  2R7R A;  1QU3 A;  5ED4 A;  2RVC A;  2R7W A;  2FQ3 A;  3GW2 A;  4IEJ A;  2F4I A;  2MA3 A;  2EV5 A;  2O8X A;  4DYR A;  4ON0 A;  2DMP A;  2FRH A;  2PMH A;  4F3Q A;  1BOB A;  1XMX A;  1LEA A;  2DO7 A;  4XOR A;  4BJ5 C;  1H89 C;  3ZQH A;  4CCM A;  3IRR A;  3QPT A;  2VBW A;  3U21 A;  3WTU C;  1X2M A;  1PP7 U;  5DD8 A;  3MVP A;  3KET A;  2XSJ C;  3IWF A;  3MD2 A;  4WXC A;  3SYT A;  2PI0 A;  2ECC A;  3ZOB A;  4QPO A;  4C2M J;  4I0A A;  3OYC A;  2HPI A;  1W7P A;  2ZSI B;  3G1M A;  2JUG A;  3NQO A;  5E79 C;  5DEQ A;  1OCR H;  2DJI A;  3ZMT A;  4BHC A;  2VJJ A;  1EV7 A;  1VQM I;  1ZAO A;  4LJZ F;  3PSF A;  1UJ8 A;  2MD5 A;  4HW0 A;  3HUG B;  1OR7 A;  4N4N B;  4Z6Y A;  4FX4 A;  3QQA A;  4G7H F;  2CV0 A;  4XBF A;  3ZGK A;  2HYG D;  2PBI A;  1WWX A;  2GZW A;  2RGV A;  2NVY J;  3PFI A;  2ZNY A;  1RRJ A;  2DPD A;  1JGG A;  3F3X A;  2WBM A;  3VYR B;  4UVA A;  1NTC A;  2V79 A;  4F91 B;  3CD6 I;  1MGT A;  2FNA A;  4ZDL A;  2M87 A;  4G12 A;  2IBD A;  1K79 A;  4A3E J;  1YW8 A;  3SZP A;  4B1R A;  1W7P D;  1D5Y A;  2JQ7 A;  2NS8 A;  4U87 A;  2Y31 A;  3GTL J;  3HOW J;  1F36 A;  2OU2 A;  1EA3 A;  4I0B A;  1GT0 C;  5B1A H;  2EIL H;  3KE2 A;  2JMW A;  5D8K B;  3S15 J;  4XID A;  1KYW A;  4B48 A;  5IYC J;  2E1M B;  2L2O A;  4YEJ A;  3REO A;  1O7L A;  1DPU A;  2CO5 A;  2QUF A;  5AIP A;  3DQV C;  3ECO A;  2JA2 A;  1J75 A;  5IOY A;  1A04 A;  2BOL A;  2RNG A;  1BBY A;  2HDW A;  3G3Z A;  5LD2 C;  4X0G A;  1BI3 A;  1R71 A;  2OV7 A;  1YW9 A;  5HNH A;  2D2W A;  3J81 Z;  3K70 D;  3L2R A;  4EGY A;  2BY1 A;  3RYR A;  1APL C;  4E7H A;  1RUN A;  1Y8Q B;  1JHF A;  3HDD A;  4YFN F;  2UXN A;  4A3I J;  3M8J A;  1Q1V A;  2BGC A;  4C3H J;  3OYL A;  5CQG A;  2DA3 A;  3K10 A;  3ZN1 A;  4BBR J;  1FYL A;  3EET A;  4XRS G;  1WJE A;  2NNY A;  2EJR A;  3EUK L;  4Y13 A;  1MNM C;  2ETH A;  1IXC A;  1LDD A;  4I09 A;  1O3T A;  2IW5 A;  3TDZ C;  4A3D J;  2OA4 A;  3MMY B;  2FU4 A;  2GAU A;  4NC8 A;  4DBR A;  3WTV C;  2NVU B;  4OAY A;  2HYJ A;  1B8I B;  3OR2 C;  4R8H A;  1MBE A;  2X6W A;  3HOU J;  5J47 A;  1X3W B;  1GLN A;  3CDI A;  3HUG A;  5EYR A;  2LSO A;  1R5H A;  1HW5 A;  2LP0 A;  1VFC A;  5E8I A;  4ZYG A;  5FD6 A;  4DOZ A;  5FRN A;  5K5O A;  5DYM A;  5B66 C;  1IXS B;  2E5Z A;  3M8E A;  1Y8R B;  1J9I A;  4U7D A;  5F1R A;  2BY3 A;  1U8B A;  3RCO A;  4CO8 A;  1JGS A;  4HDV A;  4MTE A;  3VEP A;  2L9V A;  2PJR B;  1D8K A;  1FJL A;  3IRQ A;  1SAX A;  5FO5 A;  2EA4 A;  2CW8 A;  3RZO J;  4IOA F;  2D45 A;  3NWS A;  5E1X A;  2MD0 A;  4EAT A;  1GV5 A;  1VF9 A;  2KMU A;  1QPM A;  4AIK A;  1E3P A;  3U1D A;  3PIO F;  2R7O A;  1SFO J;  1V5G A;  2EA2 A;  4DBQ A;  5IP9 J;  2LBF B;  2HGC A;  2A6T A;  3CQZ J;  2XUB A;  1WFX A;  1O3R A;  1SFK A;  5J40 A;  3IUO A;  5L3F A;  3OYK A;  3TW7 A;  2ISZ A;  1I1S A;  3SEZ A;  1JUM A;  3OS2 A;  2F4M B;  2XF6 A;  4OU0 A;  3N97 A;  4M3F A;  3L2Q A;  2X0L A;  3KEO A;  1IRF A;  2EZL A;  4YEL A;  3ZQ7 A;  2JPB A;  1I6X A;  4FE7 A;  3U1K A;  3BZC A;  5EEG A;  1YG2 A;  3OOP A;  4RB3 C;  3PSI A;  2P5L C;  3JSP A;  4A0Z A;  2ESH A;  2YR2 A;  4HF0 A;  4MNU A;  3ZMZ A;  4OIQ F;  2CFX A;  5HOD A;  1W0U A;  1PP8 F;  3J80 K;  1JKO C;  2R7S A;  3UR3 C;  1B8I A;  5M3F J;  1S29 A;  2E36 A;  3G1L A;  3DKY A;  3KIO A;  3BOQ A;  1FYK A;  3AG2 H;  2EZI A;  2R5Z B;  2R93 J;  2Y48 A;  3V7C A;  2DJN A;  5GAD J;  2HDD A;  5JLX A;  5IT9 K;  5HS7 A;  4XN0 A;  1KON A;  2VLA A;  5EF6 A;  1XS9 A;  1G4D A;  4W1U A;  4PK4 A;  3V8L A;  3C7J A;  2VUM J;  4LOC A;  2JSP A;  4A3C J;  2E2H J;  3AG1 H;  2IS2 A;  1QQI A;  3HGG A;  3CCR I;  4BQN A;  5HVQ C;  2VON A;  1QVU A;  3HJE A;  2XAG A;  2ID6 A;  4PSW A;  4KT6 A;  1YW7 A;  2TRT A;  2PJR A;  2QA4 I;  3OSG A;  3VSL A;  3R4K A;  3E97 A;  1G3W A;  2IGK A;  5FGM A;  2LFB A;  3E1S A;  3F6V A;  2W82 A;  3NRV A;  3QYF A;  2Z33 A;  1N77 A;  3QYE A;  2H8W A;  5D5U B;  3MKY B;  2PJP A;  4M73 A;  1O3Q A;  3K4N A;  3RTR A;  4PGG A;  3G73 A;  4NB5 A;  4HQE A;  2GIV A;  5K7F A;  1T98 A;  3BT9 A;  2LBF A;  4CYC B;  1K4S A;  3S14 J;  3GLL A;  1M1E B;  2HQR A;  1J7K A;  4BNC A;  5BS6 A;  3E6C C;  1NG6 A;  2MYS A;  1ODD A;  1P4A A;  1DU6 A;  3VWB A;  4A6E A;  3B73 A;  4RM3 A;  4XLN F;  1GXP A;  3E6M A;  4I01 A;  4RGR A;  1MJ9 A;  2ELJ A;  4KMU X;  4UXN A;  4HRI A;  2DMN A;  1WH7 A;  3AFH A;  5CJ9 A;  1T2K A;  3OIQ A;  1X3U A;  1UG2 A;  4D0P A;  3TED A;  3ABK H;  2CGP A;  1Z3X A;  1PJR A;  1GUU A;  4M3E A;  3LST A;  4QWQ A;  4EM0 B;  2GOM A;  4FET A;  3HL2 A;  3BR1 A;  4RAF A;  1ZLJ A;  2W84 A;  3RPQ A;  2K85 A;  2HEO A;  3HSR A;  4IO9 F;  1CQT A;  2WV1 A;  2WA0 A;  2HZD A;  3FXJ A;  2FBK A;  3W3C A;  4YII A;  3BZ6 A;  1XDU A;  3GWZ A;  2LH9 A;  4G6T B;  1HBX G;  4RB2 C;  1JKR C;  2M4G A;  2QGU A;  4BL0 B;  2P81 A;  3PQJ A;  2WAE A;  3GFL A;  1JHH A;  2ZME C;  4IHT A;  1FIP A;  2LY2 A;  4JQF A;  2CUE A;  1XCB A;  2KT0 A;  5FKM A;  3OYM A;  4IJA A;  4OAZ A;  3S8P A;  5J4V A;  1Q1H A;  4R79 A;  1TC3 C;  4V2F A;  4B43 A;  1U9O A;  5J3L A;  3GZN B;  2Y2Z A;  2ELH A;  3G2B A;  3KEY A;  1WI9 A;  3WOD F;  1WHU A;  1FPQ A;  2HQN A;  3SHF A;  5H2F C;  1XN7 A;  1TT5 B;  3J7A O;  3JSO A;  1UAA A;  5BQT A;  2L4M A;  4JP0 A;  2CJJ A;  2XF5 A;  1FNN A;  2RQP A;  2XKP A;  1EJ9 A;  2WTE A;  3S1Q J;  1LVK A;  4EJW A;  5J1U A;  1AOY A;  1Z6T A;  2R7D A;  3HBL A;  4N9H A;  3ZXS A;  3AL0 C;  3QU6 A;  1KU9 A;  1RR8 C;  2MLK A;  1PUF B;  1FSH A;  1KQ8 A;  1XDS A;  4EM2 A;  4HDU A;  2CW7 A;  3IV5 A;  4O3M A;  2LY1 A;  1Z3Y A;  2OCE A;  4CYC A;  4OMZ A;  2FE3 A;  4CCL A;  4ZDO A;  3RJP A;  1OYW A;  2HKX A;  3TOB A;  3PUB A;  1TNT A;  2IEK A;  3M1E A;  1YX5 A;  3PIP F;  4CYD A;  3BLY A;  3WTY C;  2RNJ A;  5KAF C;  2VOD A;  2HQA A;  2BE5 F;  3A01 B;  3HOX J;  5B3S H;  1RI7 A;  1R4N B;  1MMG A;  3IP4 B;  5FKL A;  4KA4 A;  3F6O A;  3JRH A;  2CYY A;  4P9F A;  4IVN A;  3TQN A;  1Y1W J;  1SD4 A;  2GA1 A;  4F7Z A;  2AS5 F;  1XMK A;  1D1B A;  2EIJ H;  3FBN B;  4XRF A;  2DOE A;  2H1L A;  2GWR A;  2CH0 A;  2HYF A;  1S7A A;  1BI2 A;  5J6X A;  2Q8K A;  3I59 A;  4LB5 A;  4R1H A;  5ICC A;  1C0W A;  1Y39 A;  4MQ9 F;  4BU2 A;  3OS1 A;  5M5W J;  1U5T C;  5ICG A;  1WJD A;  3ZQQ A;  1ETV A;  2Q2E B;  2BZT A;  1G3S A;  4BYY A;  3OL4 A;  2VN2 A;  4A6D A;  3IL2 A;  1FEX A;  1A36 A;  2EBI A;  2BW3 B;  4XRS A;  5BPD A;  4PSX A;  3H9J A;  3FBI B;  2JRT A;  3TO6 A;  4M72 A;  3KCC A;  3TMO A;  1OKR A;  3WTZ A;  5EG0 B;  4OIR F;  2MAB A;  4HAM A;  5LRS A;  3JW4 A;  3CC2 I;  4OMY A;  3GZ6 A;  3KYL A;  5JVT A;  2QKM B;  3GTM J;  1T56 A;  1JI8 A;  4RA2 A;  4WWC A;  1ZYR F;  3E3V A;  1AA7 A;  3NAU A;  3E6B A;  4G9Y A;  5F0F A;  3HSE A;  4UVB A;  1PUF A;  1DGR M;  3ZMD A;  1BJA A;  3EYI A;  4HX7 A;  2E2J J;  2PEX A;  4I2O A;  5ERI A;  4YIF A;  2UV1 A;  2WY7 Q;  2XGD A;  2O6G E;  1YIO A;  2AHQ A;  3Q5F A;  1TP4 A;  4XN3 A;  2ZJ2 A;  1O3S A;  2V9P A;  3GX4 X;  3F22 A;  5CVJ A;  1T8I A;  4PJM A;  1YX3 A;  1UG0 A;  4LD5 A;  4A0Y A;  1Z9C A;  3QP5 A;  2KP6 A;  3COA C;  2EFO A;  3JTH A;  4XR6 A;  1QZY A;  5D5V B;  2FOW A;  2W00 A;  3PL8 A;  2L54 A;  3BPX A;  3LSR A;  3A01 A;  2W1O A;  1IDY A;  5D4R A;  4GDF A;  3SZG A;  3F0C A;  4D9J A;  1HW2 A;  4KDP A;  1IRX A;  4G6Q A;  3PO3 J;  2K9S A;  4GO1 A;  3QPS A;  5GTH C;  1ZG1 A;  1VQN I;  2EK5 A;  3I53 A;  4A3F J;  2DW4 A;  2O03 A;  3OYB A;  4AID A;  5L3B A;  1YE9 A;  1D0Z A;  4HEA 2;  2LRE A;  4LFU A;  5DUK A;  5E3O A;  1E17 A;  3CMY A;  4G7O F;  2V26 A;  4U0V A;  3ABT A;  1VQ7 I;  1ETK A;  3QPL A;  1U78 A;  1BR1 A;  2CV1 A;  5E17 F;  3KYD B;  3SFI A;  2L9R A;  3F21 A;  2JVG A;  2DTZ A;  1FC3 A;  3E7L A;  3T0Y A;  4AWX B;  3FXU A;  3PNY A;  1Z77 A;  2Q2E A;  4ANJ A;  1R5I D;  5JLW A;  4ZYD A;  5AIQ A;  3H5R A;  4XLH A;  4XLA A;  5IOZ A;  2XPV A;  3DKW A;  2JA5 J;  4B4C A;  2HZT A;  1L0O C;  2X6Y A;  3B02 A;  3FKI J;  1XSD A;  3BG3 A;  1UMQ A;  2RRE A;  3SQN A;  4Y15 A;  4XKW A;  2W57 A;  2OUM A;  2MC3 A;  2Z5U A;  3ASN H;  2GBY A;  5CPR B;  3S32 A;  1R22 A;  4E7L A;  4ESF A;  3FDY A;  1YJW I;  1MSF C;  2MLG A;  1SD7 A;  3I4M J;  2G0E A;  2WB1 N;  2GQQ A;  3VYS B;  2R7U A;  2GA2 A;  4DNC A;  4ZTF A;  3WG7 H;  3BG9 A;  3CTA A;  1LPQ A;  4RS8 A;  1GHC A;  3K6G A;  5D4S A;  1DDN A;  2DOF A;  3H92 A;  1IRG A;  3GFJ A;  2DTR A;  2RDP A;  3LSJ A;  3GFI A;  4CCK A;  2M34 A;  5HDG A;  1U9N A;  4RGS A;  1ITY A;  1G8X A;  5LEJ A;  4MO7 A;  4KMF A;  1T0F C;  4L9T A;  4XLC A;  2EPF A;  1IV8 A;  4HV6 A;  4I6Z A;  2NYX A;  4EJU A;  3Q9V A;  4CSW A;  1DP7 P;  4DIQ A;  2RN7 A;  5CVV A;  2KZG A;  3NAR A;  3MAJ A;  2DFF A;  2KZV A;  2CQX A;  4RB1 A;  4FHT A;  3BG6 A;  2KDO A;  2Y75 A;  4JX6 A;  4UY8 I;  1OCC H;  3HHH A;  4RLF A;  1T08 B;  2JN6 A;  1WKM A;  3LSK A;  3QOP A;  1Z21 A;  1OIS A;  1YS7 A;  2L7Z A;  1SAN A;  2X51 A;  3P9I A;  2XKO A;  1P7I A;  2KKO A;  3W2W A;  1G3T A;  5JI6 A;  4A93 J;  2QEN A;  3LAJ A;  1BJZ A;  1L3L A;  3ZMU A;  4XM3 A;  3L1P A;  3BPV A;  5EZH A;  2LKX A;  1VI0 A;  2LG4 A;  3X2Q H;  5ILS A;  2CUF A;  4NQW B;  3RKY A;  2H27 A;  3GVA A;  3H0G J;  2QKL B;  1WVR A;  2L5Q A;  1E3O C;  4PCQ A;  3GZ5 A;  5DM7 F;  5LRR A;  3BG7 A;  3IAM 2;  2UXX A;  3F8N A;  1QO0 D;  4I76 A;  1SFE A;  4KIF A;  3GCM A;  1U0J A;  3KP6 A;  4XLE A;  5GAG J;  1WI3 A;  2Z2S B;  1B6A A;  2KFD A;  3KLO A;  3FK7 A;  3SDG A;  5BMZ A;  1TQM A;  2OTL I;  2EWN A;  3QOE A;  1LB2 A;  1VQ5 I;  5IP6 A;  5C4J J;  5CQE A;  5LHG A;  5J8C A;  3FXR A;  3EUA A;  2PG4 A;  2D1H A;  4UB8 C;  3CCJ I;  1ZH5 A;  2ME6 A;  2E60 A;  1MBF A;  4IOC F;  5F0C A;  2QEX I;  1SVL A;  3T8R A;  2K5C A;  2QM3 A;  1XCV A;  2C6Y A;  1FIA A;  1KZH A;  3TDU C;  3K7A J;  2FEZ A;  3J81 K;  3OYE A;  2QLZ A;  4EV0 A;  3DBH B;  3ABM H;  3H3U A;  4PGH A;  1VND A;  2YUS A;  5F1J A;  2HNH A;  4BGD A;  4HLY A;  1EKE A;  3IAS 2;  3V8K A;  1OJL A;  2FMY A;  1YOV B;  3ERM A;  3P5J A;  2F5F A;  4XL9 A;  1VQ6 I;  1FYM A;  5F27 A;  5K5Q A;  5A2Q Z;  4L5I A;  2GOX B;  2CG4 A;  2NAZ A;  4II2 A;  4ZDP A;  3EUH A;  5HLG A;  2JZY A;  2DMT A;  2VBX A;  2A05 A;  3HTS B;  2HR3 A;  1D1A A;  2L7F P;  3CCY A;  3BRO A;  2XGE A;  2ZKZ A;  3OMY A;  4EJT A;  1AKH B;  3CCM I;  2L02 A;  4MQV A;  2J5O A;  2IXS A;  3FKJ A;  1ACI A;  2W24 A;  2KPM A;  1SFU A;  1S6L A;  1FMV A;  2KLO A;  2LTP A;  5FRO A;  2QF7 A;  2JA8 J;  3V8J A;  3LFU A;  3I64 A;  5E1Z B;  5TIS C;  1TW2 A;  4AIH A;  2VPR A;  4QLC U;  2K3P A;  3VOE A;  4LB6 B;  2XSD C;  3ZQG A;  2QWW A;  1IJW C;  3M3Y J;  3S2D J;  4OWR B;  4NQW A;  4DGW B;  1XGO A;  5DDG A;  1HSJ A;  4M9Z A;  1OCT C;  4EJO A;  2HOA A;  4PJL A;  4AVP A;  2GXB A;  1ZGJ A;  1VQP I;  4EJV A;  3BWG A;  3E6D A;  1STZ A;  3D5R C;  3DBR B;  3K2A A;  4MFE A;  4KIB A;  1WQ2 A;  2XPU A;  4C30 A;  1GVD A;  4II3 A;  4U0Y A;  4D7M A;  3WE2 A;  3OSF A;  3K4C A;  2VT2 A;  1FX7 A;  3CF5 F;  4BQQ A;  1QHH D;  1YLF A;  1F9N A;  2VQH A;  2HU9 A;  5AON A;  2IVM A;  2LDU A;  3GTJ J;  3V4G A;  2E2I J;  2R7V A;  1OLT A;  5K7H A;  4MGR A;  2FML A;  1G59 A;  1H88 C;  4DW6 A;  3ASO H;  4U88 A;  2DA6 A;  4G7Z F;  3TW6 A;  4A2U A;  3KLN A;  3DEU A;  1RET A;  5IP7 J;  4GFB A;  4IRH A;  2GM4 A;  3HRM A;  3K1N A;  3BTC A;  4UUS A;  4RB0 A;  3ZMV A;  5FKK A;  2K86 A;  4BUP A;  2L9N A;  3HOV J;  4NUB A;  1XGM A;  4ESJ A;  4PJ0 C;  3CF2 A;  5ILU A;  1AKH A;  3RKX A;  4KN7 X;  2G7U A;  2DDB A;  2ADU A;  3KEQ A;  2A07 F;  2K9N A;  1Y0N A;  1ZTR A;  4UUT A;  1X3Z B;  2STT A;  4ENM A;  4XOP A;  5EJC A;  2EIK H;  2F2E A;  4M6Y A;  4ABZ A;  1X1A A;  4E7K A;  2PN6 A;  1I3Q J;  4O6J A;  1MJB A;  1XC5 A;  4S04 A;  1KQ0 A;  4BE0 A;  1YHQ I;  3HRT A;  5F64 A;  3BZK A;  1YTY A;  2KHM A;  1XGN A;  3MQ0 A;  2VT3 A;  5KK1 A;  4A69 C;  4IQJ A;  4HNT A;  3G4S I;  1MD0 A;  1USS A;  1T33 A;  1UFM A;  4D1Q A;  1D3Y A;  3L2C A;  5GPC A;  3DWL E;  4ENK A;  4Y4R A;  3HEF A;  2COM A;  5L3G A;  1YIT I;  1ZR4 A;  3QYB A;  2VKV A;  3DCF A;  2A5Y B;  4V2G A;  5BOX A;  1I50 J;  1R7J A;  3CCS I;  2KIU A;  1X1D A;  1MH3 A;  2HFH A;  2Q0O A;  5DTD A;  3GTQ J;  2E1M C;  3CC4 I;  5FLX Z;  1I5Z A;  4B09 A;  1WJF A;  2O0Y A;  4W97 A;  3JAM Z;  1S8N A;  5BPI A;  2DT6 A;  2LY9 A;  1F5T A;  4EMS A;  4Y17 A;  4QSH A;  3OIO A;  5GAE J;  2ZNZ A;  2VJI A;  4RDU A;  2Z9O A;  4CGZ A;  1WGX A;  1LFP A;  4M3D A;  5H6Q A;  3BCB A;  3HPH A;  1TNS A;  4M71 A;  3D5L A;  1FOY A;  4CHU A;  2WB1 A;  2UWM A;  1ZK8 A;  1KU3 A;  2K40 A;  5EGO B;  1HKS A;  2YSR A;  4IX7 A;  4BE2 A;  1IN4 A;  1X1B A;  5HDN A;  1LUJ B;  2YPR A;  2ZXW H;  2LYC A;  1UB9 A;  3DFG A;  2X48 A;  3CDL A;  2STW A;  4BXF A;  2EB7 A;  4LIV A;  1UHS A;  2XAQ A;  3PNT A;  1R9T J;  3I58 A;  2ZXH A;  2EFQ A;  4M6X A;  3R0J A;  1R1T A;  2CS3 A;  2KIF A;  1O57 A;  1TBX A;  3JRG A;  2OTJ I;  3DKX A;  3CP2 A;  3M1C A;  4HV5 A;  4ZZL A;  2WAF A;  2QBY B;  3ELK A;  1R23 A;  3LSM A;  3VFZ A;  3KX2 A;  1IUY A;  1LFU P;  2BVM A;  1Z6R A;  1SD6 A;  5D6F A;  4ZC3 A;  2Y0M A;  3CMA I;  4RAY A;  2KDZ A;  3A2K A;  2EIM H;  1R36 A;  4BH9 A;  1YQA A;  1HCR A;  5L3E A;  1P92 A;  2FF4 A;  3L9F A;  3RQ4 A;  5B1B H;  3UNG C;  2EQR A;  3TP3 A;  4WK8 F;  2ZME B;  5LFA A;  3HOS A;  2XRL A;  2K02 A;  1K6Y A;  2IT0 A;  3I4P A;  3OR1 C;  1BC7 C;  4AM3 A;  3BR0 A;  5KNL A;  3JRB A;  1YJN I;  1IF1 A;  2IRF G;  3RI4 A;  1WJ5 A;  2CQN A;  4D5F A;  1ZN2 A;  2G7H A;  2K7L A;  3AG4 H;  1FZP B;  2DOA A;  3BY6 A;  3LMM A;  5EDN A;  4HG2 A;  4Y52 J;  1QHG A;  3OY9 A;  3S1M J;  3AL0 B;  3P9C A;  2VC1 A;  3V42 A;  1MBG A;  2Y9Z A;  1YO5 C;  3RIR A;  3OYH A;  2EFW A;  4QIW N;  5EGO A;  2YU9 J;  3OIP A;  3K4K A;  4AVZ A;  3M07 A;  1F1Z A;  2DA5 A;  3PJR A;  2HI3 A;  2JWT A;  5J4Y A;  4AD9 A;  2VQL A;  1ZKG A;  2EIN H;  2DK8 A;  2IGN A;  2WAQ A;  3CUQ C;  4QPQ A;  3J7Z I;  5C3E J;  3I59 B;  4C3I J;  4IRG A;  1REP C;  5K5R A;  1T6S A;  2E1O A;  4HOB A;  4A3K J;  3DPU A;  1X1P A;  2IAI A;  2OAZ A;  3Q0W A;  4M9X A;  2QBY A;  2H6B A;  4OIO F;  3LA3 A;  3CP8 A;  1RUO A;  3CJT B;  5F08 A;  3ULQ B;  4BXU A;  2M30 A;  1RC9 A;  2XAS A;  2JSC A;  3CJR B;  3E5U A;  3H1C A;  3K1P A;  4ZYA A;  1N25 A;  2DN0 A;  3BCA A;  4GYG A;  4L5J A;  3VYU B;  1V4R A;  2COB A;  1BIA A;  2M4K A;  4CZC A;  3IKV A;  3ZR8 X;  5ICE A;  4GXO A;  4I7H A;  3VPR A;  1HLV A;  5IYD J;  1OPC A;  3OWT A;  2DFH A;  1HKT A;  2NS7 A;  1BA5 A;  4EGZ A;  1RKT A;  3M4O J;  1SMT A;  2PQ8 A;  3DPT A;  5KVR A;  4YFX F;  2DA7 A;  2ZME A;  3PNV A;  2EFP A;  1QGP A;  2VJ4 A;  2X4H A;  4L0Z B;  2R5Y B;  3HOY J;  1Z7U A;  3WGI A;  2VBZ A;  1BW6 A;  3BG5 A;  4IHY A;  2CQ7 A;  4XRM A;  4I98 B;  2G9W A;  1ZHF A;  3OYN A;  3JCU C;  5BNG A;  4ZZD A;  1J09 A;  3M8F A;  2CV2 A;  3HTU A;  5ILV A;  3ZMS A;  1ZRD A;  4M3G A;  3A02 A;  3ERE D;  2LF8 A;  2VKH A;  2LOO A;  5F6F A;  1MNE A;  2QSH X;  1IN5 A;  5HLT A;  1ZR2 A;  2X6X A;  2FBH A;  4UUV A;  1X4P A;  2E1C A;  1KYZ A;  2V9K A;  2DCE A;  4Y7N J;  2CU7 A;  1T95 A;  3SDB A;  1P2F A;  3BTL A;  5L3C A;  3N05 A;  4DYC A;  3KZY A;  1FP2 A;  1DUX C;  2UUZ A;  2DA1 A;  5CYV A;  4L9V A;  2O7O A;  4MEX F;  2NRA C;  3S1R J;  2YU3 A;  1OCP A;  2CUZ A;  2NOG A;  3MEX A;  2M1B A;  4BQO A;  1K83 J;  1TTY A;  4IRI A;  2VPL A;  3I5U A;  1X19 A;  2ZBK A;  1FTT A;  4Y3O A;  4P9U A;  2LVS A;  1JKQ C;  5GTI C;  4B44 A;  2BBY A;  2IGM A;  3JRE A;  2P5V A;  3C2B A;  1VQL I;  2XB0 X;  2CW0 F;  2MSY A;  3R61 A;  1WH5 A;  2GXG A;  3K4L A;  5H6R A;  4XMY A;  3CC7 I;  5E20 A;  3P7N A;  1P4W A;  4KIT B;  1POG A;  4E70 A;  1KGS A;  1RIO H;  2BY0 A;  3FM5 A;  4JYK A;  3R60 A;  3IHU A;  2VC0 A;  4H0E A;  2YX7 A;  2DA4 A;  3T1B A;  1X58 A;  1MKM A;  2VKD A;  3F8C A;  2OPT A;  2FD5 A;  3K9T A;  4ITV A;  4PUS A;  4DJA A;  3U2R A;  2BHY A;  2MFZ A;  2ZXI A;  1BIB A;  5E18 F;  2EV6 A;  2OCC H;  3QWL A;  3OYG A;  1H9T A;  3IH3 A;  2BV6 A;  5KHD A;  2R5Y A;  3S93 A;  3FMR A;  3E0J B;  2JPC A;  4NC7 A;  2JA6 J;  1S7O A;  4XSZ F;  1FY7 A;  3Q9S A;  4Q47 A;  4EVI A;  2E7W A;  1LNW A;  1FBU A;  4ZYE A;  2ZFW A;  5IYB J;  2V1D A;  2KJB A;  3HRU A;  1W5T A;  4H4K C;  4JX4 A;  3F72 A;  1DGW Y;  5HS9 A;  4RM2 A;  1ZGW A;  2FBI A;  1TL8 A;  2Z99 A;  1TLH B;  1QNT A;  1UCR A;  3PM1 A;  3WG9 A;  2W85 A;  1D0X A;  1A6Q A;  1LDJ A;  1UZC A;  2V6E A;  1PYV A;  2F5C A;  3OYJ A;  1K4T A;  3H3V K;  2CRG A;  1EH8 A;  5DD4 A;  1FBQ A;  3KZI C;  1XSV A;  5GPA A;  4IKF A;  2B9S A;  4FE4 A;  4OIN F;  1LE8 A;  4A12 A;  1W5S A;  1EH7 A;  1D8J A;  2O5R A;  3LSH A;  4BY1 J;  2D1V A;  4J00 A;  2A69 F;  3K2Z A;  3LOC A;  1WCM J;  2M0M A;  3R0A A;  2K4B A;  1F43 A;  1OCO H;  1X2N A;  3G71 I;  2EZH A;  3D5S C;  3I0T A;  4MFD A;  3DU5 A;  3BJA A;  3V7R A;  2K4J A;  2HS5 A;  5EEA A;  4LG0 B;  1H9G A;  2F48 A;  2RC4 A;  3WTS C;  4RBO A;  1VQ9 I;  2PMZ N;  2E34 A;  4MTD A;  1R58 A;  5DS9 A;  5IT3 A;  1BL0 A;  1U6G A;  1I1G A;  1LKX A;  1V5F A;  2DYR H;  1XG1 A;  3WU2 C;  3ZQC A;  1NK3 P;  1ZQ3 P;  3TP0 A;  4TV7 A;  1FOW A;  3RDI A;  2DFE A;  5HDK A;  1JUS A;  4UNO A;  2VE9 A;  1HKQ A;  4HLX A;  4XKC A;  4O5V A;  5FJ8 J;  4FX0 A;  2OQG A;  5LGN A;  4B47 A;  2V9V A;  1GXQ A;  3DU6 A;  2M5W A;  2IJL A;  1UST A;  1UHM A;  2DYS H;  4UVC A;  2FSW A;  2N8G A;  2BHZ A;  3F8B A;  1P7J A;  4XSX F;  1OCZ H;  1YJ9 I;  2Q1Z B;  2ZJR F;  2M45 A;  2YS9 A;  3FM3 A;  2QYO A;  1LEB A;  4E7I A;  2XRO A;  1CGP A;  1QBJ A;  3FK6 A;  2XIG A;  1HC8 A;  3AKZ A;  1Y56 A;  4BS9 A;  2X1E A;  1ZRF A;  5H20 A;  2F5V A;  1DQU A;  3F23 A;  5A2Q K;  1IN6 A;  3LAP A;  2M8G X;  2KRF A;  1MJA A;  1HST A;  4LLG F;  2WV0 A;  4XLF A;  4J01 A;  4MHG A;  1RKW A;  3H3Z A;  5HS8 A;  1PVE A;  5FD5 A;  1ZGA A;  3BR6 A;  1EH6 A;  2DOD A;  3FX3 A;  4P96 A;  3ZRG A;  1Z67 A;  5K7Z A;  4BBS J;  3ZP5 A;  1RNL A;  4PZJ A;  1XPX A;  3DEW A;  2R92 J;  1R49 A;  2QCO A;  2H09 A;  1K7A A;  2J5P A;  4CUG A;  2GLO A;  1HA8 A;  3TGN A;  5E8G A;  3ZN0 A;  4IF4 A;  1SC7 A;  3CLQ A;  2QQ9 A;  1UHW A;  2O61 A;  1JJ6 C;  5LHH A;  4GRI A;  1H0M A;  5TJJ A;  1F4K A;  3LSI A;  3JRF A;  1XSX A;  2VXZ A;  1NH3 A;  3EYY A;  2PX9 A;  3WTT C;  3ZPL A;  4L0Y B;  3QAH A;  1T0F A;  2DK5 A;  1WJB A;  4IQ4 A;  4HSR A;  2XAU A;  3MKW B;  5D8L B;  3ONQ A;  4E7S A;  3L09 A;  3PO2 J;  1FOX A;  2MH2 A;  5FKN A;  2EH3 A;  4LG0 A;  2VQC A;  5D6E A;  4C3J J;  4HX4 A;  5JHU A;  1MH4 A;  1Z91 A;  1XMA A;  3F9K A;  1R6R A;  4MEY F;  4BKX A;  5LGU A;  4S05 A;  2K9L A;  3BTI A;  3I71 A;  2Y0S A;  4LLL A;  3IH4 A;  3M7G A;  3HZJ A;  3S2W A;  1FSE A;  1DP3 A;  1IN8 A;  1PDN C;  2L7M P;  4L9N A;  4N0B A;  1OYI A;  2OBP A;  3QOD A;  2HOE A;  5M3M J;  1I39 A;  1ON1 A;  4NC6 A;  3L2U A;  3SXY A;  4KIC A;  3B6A A;  5E3M A;  1MMS A;  1Y0U A;  3ECH A;  4XON A;  2UZK A;  1MW7 A;  3JRC A;  3FF5 A;  3KYC B;  5FFZ A;  2DMQ A;  2DFI A;  1MBJ A;  4DZJ A;  3GYH X;  3DLL F;  4J19 A;  2AXL A;  5M5Y J;  4FT8 A;  1ULY A;  4LK1 F;  4FCY A;  3A0H C;  4L9J A;  3MKZ A;  2WAQ N;  3W2A A;  4A3G J;  2LNB A;  1P4X A;  3LQQ A;  3CCV I;  5J1Y A;  3HIF A;  1X1C A;  5HNF A;  4A3J J;  3OYF A;  3LL7 A;  3JRD A;  3JRA A;  4F55 A;  1IRZ A;  1JJ8 C;  3EUH C;  3D0S A;  3J7A Y;  2Z16 A;  4IXA A;  4UUS B;  4BE1 A;  1WSU A;  2A3S A;  2A61 A;  3K4B A;  2H1K A;  2OZ6 A;  4E7Z A;  2LD5 A;  2BVL A;  2LLK A;  1B72 B;  3QU3 A;  2DAO A;  3OS0 A;  1OR7 C;  1Z7L A;  2DQL A;  2HKO A;  1H8A C;  4PFO A;  3HKZ N;  5LBQ A;  2F4O B;  5HLI A;  3DPL C;  3CJQ B;  5DUI A;  3EDP A;  1V3F A;  2LC2 A;  2HVS A;  3MZ8 A;  1MMA A;  2ZO4 A;  3M9A A;  3TOA A;  4YRV A;  1SAU A;  2VE8 A;  3K70 C;  5EZG A;  2R0Q C;  4BDY A;  2KRC A;  4HZF A;  2DPU A;  1TWC J;  2HWV A;  2ELK A;  4NBQ A;  3TO9 A;  3RSN A;  3MWM A;  1FP1 D;  2WY8 Q;  5C4X J;  4I99 C;  5DCF A;  3KFW X;  3JR9 A;  1MIJ A;  4AYB A;  3CMM A;  1W36 D;  3MZY A;  2LF7 A;  4AIJ A;  2MG4 A;  5DV5 A;  2IS1 A;  3GO5 A;  4ESB A;  3C18 A;  4HBL A;  2ME0 A;  2MW8 A;  2P0W A;  4AU7 A;  1VQ4 I;  3L7W A;  4PDK A;  2FOK A;  4BJ6 C;  1WZ2 A;  3TBI A;  2LKS A;  2R7X A;  1UEL B;  4LLN A;  5L3D A;  1SFX A;  1RR7 A;  3K69 A;  3I4N J;  5FLX K;  3L2V A;  3S3N A;  3JAM K;  2CSO A;  3H0D A;  5FB2 A;  1OMI A;  3A03 A;  3CCE I;  4KFC A;  5KCM A;  2MC4 A;  1R4M B;  1CF7 B;  4BXX J;  2DMU A;  2JTV A;  1YRN B;  2OQR A;  2XAH A;  4M3B A;  3BJO A;  2X1D A;  4WF2 A;  4M9S A;  3DV8 A;  2LKP A;  2NXN B;  3ESW B;  4KJZ A;  4ETS A;  2WWY A;  1KQ9 A;  3A4C A;  4GCV A;  1GVJ A;  2HPM A;  5GAH J;  3WU1 B;  4BDZ A;  4D7N A;  2L01 A;  2RV8 A;  2TCT A;  1GDT A;  2P6S A;  3G1O A;  4IL6 C;  2L4A A;  2FA5 A;  4CCN A;  2M2E A;  2O3F A;  2ZC2 A;  2GXA A;  4UB6 C;  1A35 A;  3W6J B;  2IS6 A;  5LGT A;  4RLQ A;  3CUO A;  4S0H B;  3AAF A;  1LQ1 A;  2E35 A;  1FOK A;  2ZFU A;  4F92 B;  2M0C A;  5FKO A;  4F52 A;  4L18 B;  4AUX A;  4ZYH A;  1B72 A;  2VL8 A;  2E19 A;  3H9G A;  3VDX A;  1QA6 A;  4HPQ A;  2A6H F;  5E3L A;  3SEQ A;  3DTK A;  1TT0 A;  3LQR A;  3S3O A;  4LG3 A;  3KP3 A;  2DXI A;  3GTO J;  4LGW A;  1P9Q C;  3PQK A;  1ENH A;  1NG7 A;  4CCJ A;  1S3J A;  1G2H A;  1MMD A;  1NK2 P;  2NOJ B;  2VIX A;  3DTI A;  3BQZ A;  1N75 A;  3HSF A;  1WJC A;  2Z3Y A;  3OL3 A;  2QQ8 A;  3GUD A;  2EV0 A;  3SFZ A;  4KNY A;  3I54 A;  2XB5 A;  3W2V A;  5D5X B;  4P55 A;  3R6S A;  4M74 A;  2H6C A;  3DLA A;  3OYA A;  2V1N A;  3BP8 A;  1B1B A;  1T38 A;  4C9Y A;  2KJC A;  2KIS A;  2FXA A;  1E0E A;  2E7X A;  1OFC X;  2M3A A;  5F04 A;  3VSK A;  3O8H A;  1ETW A;  1I3A A;  4XKV A;  2AXT C;  5ICF A;  3LA2 A;  2PMZ A;  3ABU A;  1IUF A;  3FWE A;  4KIG A;  4XK4 A;  3WGH A;  4Q5S F;  1MSE C;  1CF7 A;  4UV9 A;  3FXQ A;  3HHG A;  4N4O B;  1YRN A;  4NNJ A;  2FUG 2;  5D5W B;  1JT6 A;  2ICW G;  1ETO A;  2IP2 A;  3QP6 A;  4BHB A;  4XKB A;  2RAE A;  1U8R A;  3BQY A;  4CA0 A;  2P7C B;  3S1N J;  4U0W A;  1IW7 F;  4RAZ A;  3T5X A;  2D5V A;  1JXS A;  4A0X A;  3I3L A;  2FX0 A;  1NHA A;  1IGN A;  3RZD J;  2NS0 A;  3ISP A;  3CCQ I;  4RMN A;  2DU9 A;  4M6V A;  2R3S A;  5JVG F;  3S16 J;  1QZE A;  3FXL A;  1S9H A;  1SVO A;  2I10 A;  3KP4 A;  2V7F A;  1A6I A;  2P8T A;  4BY7 J;  1W0T A;  4B8X A;  1VQ8 I;  1ZG5 A;  1DU0 A;  1YI2 I;  1HW1 A;  4F93 B;  3OYD A;  4EM1 A;  2XGX A;  5KAI C;  1WRJ A;  4EQQ A;  1YIJ I;  3RKQ A;  2O9L A;  4CDG A;  3GTK J;  2HXO A;  3HOZ J;  1DPR A;  2DA2 A;  3RYP A;  5JR3 A;  1MMN A;  2DT5 A;  2F6C A;  3HOT A;  5HLH A;  1TW3 A;  4BJT A;  4PFP A;  2MH9 A;  9ANT A;  3UKG A;  3WGG A;  1B4A A;  2L3D A;  2XAF A;  6PAX A;  3CUQ B;  3GME A;  4BEH B;  2GIZ A;  3G6E I;  1W5C C;  4LIT A;  2PFB A;  4IHV A;  3O3K A;  4KUM A;  1OYY A;  2R4G A;  3WHB A;  1N78 A;  1J2X A;  3WTX C;  1RES A;  3FIS A;  4Q48 A;  1EF4 A;  3DF8 A;  1MDM B;  2ID3 A;  2W48 A;  1U2W A;  2KIQ A;  1FMW A;  1BW5 A;  4KIS A;  4JOM A;  3O8G A;  4CXF A;  4LIU A;  1YS6 A;  5K1Y A;  2CMP A;  3AG3 H;  5CLS A;  4ZTJ A;  5IPA A;  4XQF A;  5FRM A;  3VYT B;  3BJ6 A;  4NDL A;  3GFM A;  3FXK A;  4A3M J;  1HDP A;  4G8X A;  2E71 A;  3Q0V A;  4Q4Z F;  2ACJ A;  3WTW C;  3S2H J;  4BQA A;  2LK2 A;  3KZZ A;  4WXH A;  3RKW A;  1FBS A;  4GYI A;  2TDX A;  3TL4 X;  2K9M A;  1FLI A;  2Z1D A;  3Q3S A;  3PFY A;  3CCU I;  1VTN C;  1PUE E;  1JTX A;  1O4X A;  2HQ5 A;  1LVA A;  1V5E A;  2VB6 A;  3CO7 C;  3DXJ F;  2K3F A;  2O8K A;  5CVU A;  3HC7 A;  4ASN A;  2A5W A;  2R7Z J;  2YX4 A;  4XIC A;  4U7B A;  4IPA A;  4JBA A;  3Q0U A;  1RPW A;  4EEF G;  2Y0S N;  2IS4 A;  1FT9 A;  2EFN A;  3ZQI A;  5FLM J;  2DQR A;  2F5D A;  2Y69 H;  4WX9 A;  4BAC A;  1BC8 C;  2OF7 A;  1P6R A;  3LSP A;  2K9Q A;  2XRN A;  2M8E A;  1W1W E;  1TWF J;  4OOI A;  4Z2Y A;  2CUJ A;  1VZ0 A;  4YFK F;  5LLQ A;  3MFK A;  1T39 A;  1YYV A;  2JUC A;  4HX8 A;  3CDH A;  2QSG X;  2EZK A;  1ONV A;  1TZL A;  1J59 A;  1D5V A;  2W4S A;  2XC7 A;  1R1U A;  4DYQ A;  2NVX J;  3IKT A;  2IPQ X;  3CUQ A;  4BEH A;  4CCO A;  1GV2 A;  4RAG A;  4KN4 X;  2QQA A;  2BYV E;  2V4J C;  3HKZ A;  3J80 Z;  2B63 J;  1U5T B;  2R5Z A;  4IZZ A;  3HM5 A;  2VI6 A;  3ROU A;  1R00 A;  4XLP F;  2LMD A;  2XGC A;  2KL4 A;  5IT9 Z;  1IZ1 A;  4ZJZ A;  1MDM A;  4E6K G;  4PJN A;  3CLO A;  3O2P E;  4HNU A;  2R7T A;  3VOD A;  5JHF A;  2L0K A;  1X4O A;  4FTH A;  1ZG3 A;  1S5L C;  1TWA J;  1A31 A;  1JT0 A;  1JE8 A;  2NVQ J;  2A6E F;  2H94 A;  4BAY A;  2V6C A;  2XF7 A;  2MBF A;  4AC0 A;  3E5X A;  3H5N A;  2X85 A;  2NVT J;  1LFB A;  2QQB A;  5F0H A;  1ZEL A;  4X1E A;  1G3Y A;  2M7A A;  4CIC A;  2ZJP F;  1SMY F;  3L00 A;  1WJA A;  2FJ1 A;  4IHS A;  3H9Q A;  2VBY A;  2QZ8 A;  1OQY A;  4K2E A;  1ZRE A;  2JA7 J;  1E2X A;  2JT1 A;  2ZCW A;  3CO6 C;  4RGU A;  2W25 A;  3FMS A;  3A1Y A;  3OV8 A;  3ZCO A;  3FZV A;  2LRD A;  1LE8 B;  3H35 A;  1J0R A;  1ON2 A;  1LDK B;  4P5O A;  1K61 A;  4AYB N;  3K4J A;  4IHW A;  1SD5 A;  2Y9Y A;  3NWT A;  3WHC A;  2I8D A;  1D1C A;  4Y33 A;  4DZP A;  4FAS D;  1R5G A;  1ETY A;  2V1U A;  2QVO A;  2PLY A;  1ETQ A;  3TKY A;  3RPU A;  2E1N A;  5C44 J;  2RKH A;  2BXZ A;  2ISY A;  3FXM A;  3HG9 A;  1IXR C;  2XDV A;  2JRM A;  2X1C A;  5J1R A;  2ECB A;  3D1N I;  1D0Y A;  2DLL A;  4WCG A;  4HF2 A;  4PJJ A;  3I56 I;  2XVC A;  1SEU A;  1LJ9 A;  4QTR A;  4G94 A;  1HDD C;  2DI3 A;  1ERD A;  1IV6 A;  3P9K A;  3MZH A;  3HRS A;  4CZZ A;  2OJE D;  3H5A A;  1ORK A;  1XX5 A;  2AO9 A;  1U5T A;  2VAS A;  5CKT A;  3JRI A;  1RZ4 A;  4YG2 F;  2VQG A;  3MKL A;  4BHP A;  1W4M A;  2CFO A;  3OOU A;  1TWG J;  3J7Y J;  4HF1 A;  1MBK A;  1J5Y A;  2FQ4 A;  3KP5 A;  1S7E A;  1BOA A;  3BR2 A;  2DT7 B;  3KP7 A;  3B6C A;  1WPK A;  3C1D A;  2HTS A;  3RPU D;  4XOT A;  1ZRC A;  4N9I A;  4A5N A;  2P6T A;  1I27 A;  1JUP A;  3CCL I;  2BXY A;  4JX5 A;  3LNQ A;  1ETX A;  5FFX A;  4MLO A;  1JKP C;  2M7B A;  3GTG J;  1BN5 A;  1MND A;  1TWH J;  2AQF A;  2R7F A;  3H36 A;  3ML6 A;  2ZSH B;  2F5E A;  2ZB9 A;  1MBH A;  1B9M A;  1S72 I;  1IDZ A;  5FLV A;  4E7J A;  2H8R A;  1Y6I A;  3K0L A;  2FNP A;  2P5K A;  3C3W A;  5HOO A;  3FHZ A;  2MGQ A;  1BR2 A;  4HA8 A;  4A5M A;  4XNF A;  3W6K B;  1AU7 A;  2HTJ A;  2KIM A;  2RQQ A;  3OYI A;  3IWZ A;  2VOO A;  2VOP A;  5DCM B;  1ZLK A;  1R1V A;  1G6N A;  4G6D A;  2XV4 S;  4UV8 A;  2K27 A;  3FHN A;  3BC8 A;  1KU2 A;  4KT5 C;  4E4H A;  3QPH A;  3C2G A;  2CQQ A;  2DBB A;  3LFK A;  5IY5 H;  2ZXJ A;  3I9V 2;  1KA8 A;  3HYI A;  2JVH A;  3GEZ A;  4LK0 F;  4RGX A;  2AQE A;  3RQI A;  2XAJ A;  2V1X A;  3KPH A;  1K6O A;  1HQC A;  1QVT A;  4A3B J;  3BDD A;  2CWE A;  2LR8 A;  1SVM A;  1XGS A;  2A68 F;  2W7N A;  4HYE A;  5LEK A;  1Y1V J;  3LWF A;  2PMU A;  2B0L A;  1BI1 A;  2JJ7 A;  1IC8 A;  5E3N A;  2KQR A;  3SJM A;  3MCZ A;  2ZJQ F;  4IHX A;  5E1W A;  4NHJ A;  2VJ5 A;  2Y30 A;  3LSG A;  3FIW A;  2WAD A;  1E3H A;  5M5X J;  3CZ6 A;  3QRF F;  2E5N A;  5B5E C;  5CVI A;  2HOS A;  4JK1 X;  5DM6 F;  2BW3 A;  2HVR A;  2R7Q A;  1BM9 A;  3BTJ A;  1FWZ A;  4DQ2 A;  4LMY A;  2L9S A;  3F8M A;  1K78 B;  1IAW A;  5EG0 A;  3CME I;  1IN7 A;  3GTP J;  1MZB A;  4V19 K;  1AHD P;  4B3X A;  2IA0 A;  3ZQL A;  2P4W A;  3A0B C;  3FXO A;  2ESN A;  3EQL F;  3O6B B;  4C2T A;  1TQI A;  3BR5 A;  4HQM A;  4I02 A;  3IH2 A;  1IG7 A;  1HXD A;  3BR3 A;  2KRH A;  3DEE A;  3PUF A;  3HGY A;  2X6O A;  1B9N A;  4X6A J;  3JTG A;  4ENN A;  5LHI A;  1QRY A;  4WXD A;  1Z05 A;  2IA2 A;  1Z0X A;  3S3M A;  2QSF X;  3E5Q A;  1HOM A;  3DTE A;  1B59 A;  4HST A;  1ZAR A;  3TO7 A;  1HF0 A;  5DCM A;  4GGG A;  2HOT A;  3N4M A;  3C2H A;  1V54 H;  4MIM A;  1VQO I;  2OD5 A;  1O7F A;  2I5U A;  2OC6 A;  2HDC A;  3VB2 A;  4P1W A;  4UHT A;  1W7P B;  2X9D A;  4D5C A;  3ZQF A;  3K4M A;  1IO2 A;  3K1M A;  3SZT A;  1VQK I;  3GF2 A;  3F8F A;  2HXI A;  4OIP F;  2IGO A;  2B7E A;  1XB4 A;  4FQG A;  2CQK A;  1XD7 A;  1BI0 A;  4A3L J;  3GXO A;  2M9H A;  1QPI A;  3IC7 A;  3T8T A;  2P7V B;  1FTZ A;  3MN2 A;  3HB9 A;  3ABL H;  3DBL B;  3FMQ A;  4L5E A;  2XPW A;  3GLX A;  4FIS A;  3V7S A;  2NNN A;  3WE3 A;  3HXL A;  3W6V A;  1KU7 A;  4HNV A;  5TRD A;  4C2U A;  1BR4 A;  5CVR A;  3CJN A;  5GP9 A;  3L2W A;  3KP2 A;  1XTA A;  2BEO A;  2BY2 A;  2HVQ A;  2JK3 A;  3S17 J;  2VKE A;  3WU0 A;  3DP7 A;  4ZH4 F;  3I55 I;  2OZU A;  1I6H J;  4CH7 A;  3CES A;  5JFR A;  1A5J A;  1JTY A;  1Z1D A;  4KYW A;  3U9G A;  2WC2 A;  4B3A A;  1V55 H;  2IA1 A;  2VXD A;  3LA7 A;  1K78 A;  3GBG A;  4ENJ A;  5TGT A;  3HPG A;  4YIR X;  1U3E M;  2DDA A; 
#chains in the Genus database with same CATH homology
 1TQP A;  1AWC A;  2XHK A;  5J8F A;  1YFH A;  5EEH A;  3NEU A;  1QZZ A;  5ED4 A;  2RVC A;  2FQ3 A;  3GW2 A;  2MA3 A;  2EV5 A;  2O8X A;  4ON0 A;  2FRH A;  2PMH A;  1LEA A;  2DO7 A;  3IRR A;  3QPT A;  2VBW A;  3WTU C;  1PP7 U;  5DD8 A;  3KET A;  3IWF A;  4WXC A;  2PI0 A;  4I0A A;  1W7P A;  3NQO A;  5DEQ A;  3ZMT A;  4BHC A;  1EV7 A;  1ZAO A;  4LJZ F;  4HW0 A;  2MD5 A;  1OR7 A;  4FX4 A;  4G7H F;  4XBF A;  2HYG D;  2PBI A;  1WWX A;  2GZW A;  2RGV A;  3PFI A;  2ZNY A;  2DPD A;  3F3X A;  4UVA A;  2V79 A;  1MGT A;  2FNA A;  2M87 A;  1K79 A;  1YW8 A;  3SZP A;  1W7P D;  2OU2 A;  4I0B A;  3KE2 A;  5D8K B;  1KYW A;  3REO A;  1O7L A;  1DPU A;  2CO5 A;  2QUF A;  5AIP A;  3DQV C;  3ECO A;  1J75 A;  1A04 A;  1BBY A;  3G3Z A;  1BI3 A;  1YW9 A;  2D2W A;  3J81 Z;  4EGY A;  3RYR A;  1RUN A;  1JHF A;  4YFN F;  2UXN A;  2BGC A;  3ZN1 A;  1FYL A;  3EET A;  2NNY A;  2EJR A;  4Y13 A;  2ETH A;  1IXC A;  1LDD A;  4I09 A;  1O3T A;  2IW5 A;  3TDZ C;  2OA4 A;  2FU4 A;  2GAU A;  3WTV C;  4R8H A;  3HUG A;  2LSO A;  1R5H A;  1HW5 A;  5E8I A;  4ZYG A;  5FD6 A;  5K5O A;  5DYM A;  1IXS B;  3M8E A;  1J9I A;  4U7D A;  5F1R A;  4CO8 A;  1JGS A;  4HDV A;  4MTE A;  3VEP A;  1D8K A;  3IRQ A;  1SAX A;  5FO5 A;  2EA4 A;  2D45 A;  5E1X A;  1QPM A;  4AIK A;  3U1D A;  2EA2 A;  2HGC A;  2XUB A;  1O3R A;  5L3F A;  2ISZ A;  1I1S A;  4OU0 A;  3N97 A;  2X0L A;  3KEO A;  1IRF A;  3ZQ7 A;  2JPB A;  1I6X A;  5EEG A;  1YG2 A;  3OOP A;  4RB3 C;  2P5L C;  3JSP A;  4A0Z A;  2ESH A;  2YR2 A;  4HF0 A;  4MNU A;  3ZMZ A;  4OIQ F;  2CFX A;  1PP8 F;  3J80 K;  1S29 A;  1FYK A;  3BOQ A;  2Y48 A;  3V7C A;  5IT9 K;  5HS7 A;  1G4D A;  3V8L A;  3C7J A;  1QQI A;  5HVQ C;  2VON A;  2XAG A;  1YW7 A;  3R4K A;  3E97 A;  1G3W A;  5FGM A;  3NRV A;  3F6V A;  4G7O F;  2Z33 A;  2PJP A;  5D5U B;  4M73 A;  1O3Q A;  3RTR A;  4PGG A;  3G73 A;  4NB5 A;  4HQE A;  2GIV A;  1T98 A;  2HQR A;  1J7K A;  4BNC A;  5BS6 A;  3E6C C;  1ODD A;  1P4A A;  4A6E A;  3B73 A;  4XLN F;  1GXP A;  3E6M A;  4I01 A;  4RGR A;  1MJ9 A;  4KMU X;  4UXN A;  5CJ9 A;  1T2K A;  1X3U A;  4D0P A;  2CGP A;  3LST A;  4QWQ A;  4EM0 B;  1ZLJ A;  2W84 A;  3RPQ A;  2HEO A;  3HSR A;  2FBK A;  4YII A;  3BZ6 A;  1XDU A;  3GWZ A;  1HBX G;  4RB2 C;  3PQJ A;  3GFL A;  1JHH A;  4IHT A;  4JQF A;  1XCB A;  4IJA A;  1Q1H A;  4R79 A;  2ELH A;  3WOD F;  1WI9 A;  1FPQ A;  2HQN A;  3SHF A;  1XN7 A;  3J7A O;  3JSO A;  5BQT A;  2L4M A;  1FNN A;  2RQP A;  2XKP A;  2WTE A;  4EJW A;  1AOY A;  1Z6T A;  2R7D A;  4N9H A;  3QU6 A;  1KU9 A;  2MLK A;  1FSH A;  1KQ8 A;  1XDS A;  4EM2 A;  4HDU A;  4O3M A;  4OMZ A;  2FE3 A;  3RJP A;  1OYW A;  2HKX A;  3TOB A;  1TNT A;  3M1E A;  4CYD A;  3WTY C;  2RNJ A;  2VOD A;  2BE5 F;  1RI7 A;  4KA4 A;  3F6O A;  2CYY A;  4P9F A;  4IVN A;  3TQN A;  2AS5 F;  1SD4 A;  2GA1 A;  4F7Z A;  1XMK A;  4XRF A;  2GWR A;  2HYF A;  1S7A A;  1BI2 A;  5J6X A;  2Q8K A;  3I59 A;  4LB5 A;  4R1H A;  5ICC A;  1C0W A;  4MQ9 F;  1U5T C;  5ICG A;  1G3S A;  4BYY A;  2VN2 A;  4A6D A;  3IL2 A;  5BPD A;  2JRT A;  3TO6 A;  4M72 A;  3KCC A;  1OKR A;  3WTZ A;  4OIR F;  4HAM A;  5LRS A;  3JW4 A;  4OMY A;  3GZ6 A;  5JVT A;  4WWC A;  1ZYR F;  3E3V A;  3E6B A;  4G9Y A;  3HSE A;  4UVB A;  3ZMD A;  1BJA A;  3EYI A;  4HX7 A;  2PEX A;  4I2O A;  5ERI A;  4YIF A;  2O6G E;  1YIO A;  3Q5F A;  2ZJ2 A;  1O3S A;  3GX4 X;  3F22 A;  5CVJ A;  4LD5 A;  4A0Y A;  1Z9C A;  3QP5 A;  3COA C;  2EFO A;  3JTH A;  1QZY A;  5D5V B;  2L54 A;  3BPX A;  5D4R A;  1HW2 A;  4KDP A;  4G6Q A;  4GO1 A;  1ZG1 A;  2EK5 A;  3I53 A;  2DW4 A;  2O03 A;  5L3B A;  5DUK A;  4LFU A;  1E17 A;  4U0V A;  3ABT A;  1U78 A;  5E17 F;  3F21 A;  1FC3 A;  3T0Y A;  4AWX B;  3FXU A;  2Q2E A;  4ZYD A;  5AIQ A;  3DKW A;  2HZT A;  1L0O C;  3B02 A;  1XSD A;  3SQN A;  4Y15 A;  2W57 A;  2MC3 A;  2Z5U A;  1R22 A;  4ESF A;  2MLG A;  1SD7 A;  2GQQ A;  2GA2 A;  4DNC A;  3CTA A;  4RS8 A;  1GHC A;  5D4S A;  1DDN A;  3H92 A;  1IRG A;  3GFJ A;  2DTR A;  2RDP A;  3GFI A;  5HDG A;  4RGS A;  5LEJ A;  4KMF A;  4L9T A;  4HV6 A;  2NYX A;  4EJU A;  3Q9V A;  1DP7 P;  2RN7 A;  5CVV A;  3MAJ A;  4RB1 A;  4FHT A;  2Y75 A;  3HHH A;  1WKM A;  3QOP A;  1YS7 A;  3P9I A;  2XKO A;  2KKO A;  5JI6 A;  1G3T A;  2QEN A;  3LAJ A;  1L3L A;  3ZMU A;  3BPV A;  5ILS A;  3RKY A;  2H27 A;  3GVA A;  4PCQ A;  3GZ5 A;  5LRR A;  2UXX A;  3F8N A;  1QO0 D;  1SFE A;  4KIF A;  3KP6 A;  5BMZ A;  1B6A A;  3KLO A;  1TQM A;  2EWN A;  1LB2 A;  5LHG A;  5J8C A;  3FXR A;  2PG4 A;  2D1H A;  1ZH5 A;  3T8R A;  2QM3 A;  1XCV A;  2C6Y A;  3TDU C;  2FEZ A;  3J81 K;  2QLZ A;  4EV0 A;  3H3U A;  4PGH A;  4HLY A;  3V8K A;  2FMY A;  2F5F A;  1FYM A;  5K5Q A;  5A2Q Z;  4L5I A;  2CG4 A;  2NAZ A;  3EUH A;  5HLG A;  2JZY A;  2VBX A;  3HTS B;  2HR3 A;  3BRO A;  2ZKZ A;  4EJT A;  2L02 A;  4MQV A;  2J5O A;  2W24 A;  1SFU A;  1S6L A;  3V8J A;  3I64 A;  5E1Z B;  1TW2 A;  4AIH A;  4QLC U;  3VOE A;  4LB6 B;  2QWW A;  4NQW A;  1XGO A;  5DDG A;  1HSJ A;  4M9Z A;  4EJO A;  4AVP A;  2GXB A;  1ZGJ A;  4EJV A;  3BWG A;  3E6D A;  1STZ A;  4KIB A;  1WQ2 A;  4U0Y A;  3WE2 A;  2VT2 A;  1FX7 A;  1YLF A;  1F9N A;  5AON A;  2IVM A;  2LDU A;  3V4G A;  4MGR A;  2FML A;  4U88 A;  4G7Z F;  4A2U A;  3KLN A;  3DEU A;  4IRH A;  3HRM A;  3K1N A;  4RB0 A;  3ZMV A;  2K86 A;  1XGM A;  4ESJ A;  5ILU A;  3RKX A;  4KN7 X;  2G7U A;  2ADU A;  3KEQ A;  2A07 F;  2STT A;  4ENM A;  4M6Y A;  2F2E A;  2PN6 A;  4O6J A;  1MJB A;  4S04 A;  1KQ0 A;  3HRT A;  5F64 A;  1YTY A;  1XGN A;  3MQ0 A;  2VT3 A;  5KK1 A;  1MD0 A;  1USS A;  1UFM A;  1D3Y A;  3L2C A;  4ENK A;  2COM A;  5L3G A;  2A5Y B;  5BOX A;  1R7J A;  2KIU A;  2Q0O A;  2HFH A;  5FLX Z;  1I5Z A;  4B09 A;  2O0Y A;  3JAM Z;  1S8N A;  5BPI A;  1F5T A;  4EMS A;  4Y17 A;  2ZNZ A;  2Z9O A;  4CGZ A;  5H6Q A;  1TNS A;  4M71 A;  3D5L A;  4CHU A;  2UWM A;  1KU3 A;  1HKS A;  2YSR A;  1IN4 A;  5HDN A;  2YPR A;  1UB9 A;  3DFG A;  2STW A;  2EB7 A;  2XAQ A;  3I58 A;  2EFQ A;  4M6X A;  3R0J A;  1R1T A;  2KIF A;  1O57 A;  1TBX A;  4ZZL A;  4HV5 A;  2QBY B;  3ELK A;  1R23 A;  3VFZ A;  1IUY A;  1Z6R A;  1SD6 A;  5D6F A;  2Y0M A;  4RAY A;  1R36 A;  4BH9 A;  1YQA A;  5L3E A;  1P92 A;  2FF4 A;  3L9F A;  4WK8 F;  2ZME B;  3HOS A;  2K02 A;  2IT0 A;  3I4P A;  1BC7 C;  2IRF G;  1IF1 A;  3RI4 A;  1ZN2 A;  2G7H A;  2K7L A;  1FZP B;  3BY6 A;  3P9C A;  2VC1 A;  1YO5 C;  3RIR A;  2EFW A;  1F1Z A;  4AD9 A;  2DK8 A;  3CUQ C;  3I59 B;  4IRG A;  1REP C;  5K5R A;  1T6S A;  4HOB A;  2OAZ A;  2QBY A;  4M9X A;  2H6B A;  4OIO F;  3LA3 A;  1RUO A;  3ULQ B;  4BXU A;  2M30 A;  2XAS A;  2JSC A;  3E5U A;  3K1P A;  4GYG A;  4L5J A;  1V4R A;  1BIA A;  3IKV A;  5ICE A;  4GXO A;  4I7H A;  1OPC A;  1HKT A;  4EGZ A;  1SMT A;  2PQ8 A;  3DPT A;  5KVR A;  4YFX F;  2ZME A;  2EFP A;  1QGP A;  2X4H A;  4L0Z B;  1Z7U A;  3WGI A;  2VBZ A;  4I98 B;  2G9W A;  1ZHF A;  4ZZD A;  3M8F A;  3HTU A;  5ILV A;  3ZMS A;  1ZRD A;  3ERE D;  2LF8 A;  5F6F A;  1IN5 A;  2FBH A;  4UUV A;  2E1C A;  1KYZ A;  1P2F A;  5L3C A;  3KZY A;  1FP2 A;  1DUX C;  5CYV A;  4L9V A;  4MEX F;  2NRA C;  2YU3 A;  3MEX A;  2M1B A;  1TTY A;  4IRI A;  3I5U A;  2ZBK A;  4P9U A;  2BBY A;  2P5V A;  2CW0 F;  3R61 A;  2GXG A;  5H6R A;  5E20 A;  3P7N A;  1P4W A;  4E70 A;  1KGS A;  1RIO H;  3FM5 A;  3R60 A;  3IHU A;  2VC0 A;  4H0E A;  2YX7 A;  3T1B A;  1MKM A;  3F8C A;  3K9T A;  3U2R A;  1BIB A;  5E18 F;  2EV6 A;  1H9T A;  2BV6 A;  3FMR A;  2JPC A;  1S7O A;  4XSZ F;  1FY7 A;  3Q9S A;  4Q47 A;  4EVI A;  2E7W A;  1LNW A;  1FBU A;  4ZYE A;  2ZFW A;  2V1D A;  2KJB A;  3HRU A;  1W5T A;  3F72 A;  5HS9 A;  2FBI A;  2Z99 A;  1TLH B;  1QNT A;  1UCR A;  3WG9 A;  2W85 A;  1LDJ A;  2F5C A;  1EH8 A;  5DD4 A;  1FBQ A;  1XSV A;  4OIN F;  4A12 A;  1W5S A;  1EH7 A;  1D8J A;  2D1V A;  2A69 F;  3K2Z A;  3R0A A;  2K4B A;  4LG0 B;  3I0T A;  3V7R A;  3BJA A;  2K4J A;  2HS5 A;  1H9G A;  2RC4 A;  3WTS C;  4MTD A;  1R58 A;  5IT3 A;  1U6G A;  1I1G A;  4TV7 A;  3RDI A;  5HDK A;  4UNO A;  2VE9 A;  1HKQ A;  4HLX A;  4O5V A;  4FX0 A;  2OQG A;  5LGN A;  2V9V A;  1GXQ A;  2M5W A;  2IJL A;  1UST A;  1UHM A;  4UVC A;  2FSW A;  3F8B A;  4XSX F;  2M45 A;  3FM3 A;  2QYO A;  1LEB A;  1CGP A;  2XRO A;  1QBJ A;  2XIG A;  1ZRF A;  5H20 A;  3F23 A;  5A2Q K;  1IN6 A;  3LAP A;  2KRF A;  1MJA A;  1HST A;  4LLG F;  2WV0 A;  4MHG A;  5HS8 A;  3H3Z A;  5FD5 A;  1ZGA A;  1EH6 A;  3FX3 A;  4P96 A;  3ZP5 A;  1RNL A;  4PZJ A;  2H09 A;  1K7A A;  2J5P A;  3TGN A;  5E8G A;  3ZN0 A;  4IF4 A;  2QQ9 A;  1UHW A;  2O61 A;  5LHH A;  1H0M A;  5TJJ A;  1F4K A;  1XSX A;  2VXZ A;  3EYY A;  3WTT C;  3ZPL A;  4L0Y B;  3QAH A;  1T0F A;  2DK5 A;  5D8L B;  3L09 A;  2MH2 A;  4LG0 A;  5D6E A;  4HX4 A;  5JHU A;  1Z91 A;  1XMA A;  4MEY F;  5LGU A;  4S05 A;  3I71 A;  4LLL A;  3M7G A;  3S2W A;  1FSE A;  1IN8 A;  4L9N A;  4N0B A;  1OYI A;  2OBP A;  2HOE A;  1ON1 A;  3SXY A;  4KIC A;  1Y0U A;  3ECH A;  2UZK A;  3FF5 A;  5FFZ A;  2DFI A;  3GYH X;  2AXL A;  4FT8 A;  1ULY A;  4LK1 F;  4L9J A;  2LNB A;  1P4X A;  3LQQ A;  3HIF A;  3D0S A;  4IXA A;  1WSU A;  2A3S A;  2A61 A;  2OZ6 A;  3QU3 A;  2DAO A;  2DQL A;  2HKO A;  5LBQ A;  5HLI A;  3DPL C;  5DUI A;  3EDP A;  1V3F A;  2ZO4 A;  3M9A A;  3TOA A;  2VE8 A;  4HZF A;  2DPU A;  2HWV A;  3TO9 A;  3MWM A;  1FP1 D;  5DCF A;  3KFW X;  3MZY A;  2LF7 A;  4AIJ A;  5DV5 A;  3GO5 A;  4ESB A;  3C18 A;  4HBL A;  3L7W A;  4PDK A;  2FOK A;  4LLN A;  5L3D A;  1SFX A;  5FLX K;  3K69 A;  3JAM K;  2CSO A;  5FB2 A;  1OMI A;  4KFC A;  1CF7 B;  2JTV A;  2OQR A;  2XAH A;  3BJO A;  4WF2 A;  4M9S A;  3DV8 A;  2LKP A;  4ETS A;  2WWY A;  1KQ9 A;  4GCV A;  1GVJ A;  3WU1 B;  2L01 A;  2RV8 A;  2P6S A;  2L4A A;  2FA5 A;  2O3F A;  3W6J B;  5LGT A;  3CUO A;  3AAF A;  1LQ1 A;  1FOK A;  4L18 B;  4ZYH A;  2A6H F;  3LQR A;  3KP3 A;  4LGW A;  3PQK A;  1S3J A;  3HSF A;  2Z3Y A;  3GUD A;  2EV0 A;  3SFZ A;  4KNY A;  3I54 A;  5D5X B;  4P55 A;  3R6S A;  4M74 A;  2H6C A;  3BP8 A;  1B1B A;  1T38 A;  2KJC A;  2FXA A;  2E7X A;  5ICF A;  3LA2 A;  3ABU A;  3FWE A;  4KIG A;  3WGH A;  4Q5S F;  1CF7 A;  4UV9 A;  3FXQ A;  3HHG A;  5D5W B;  2IP2 A;  3QP6 A;  4BHB A;  1U8R A;  2P7C B;  4U0W A;  1IW7 F;  4RAZ A;  3T5X A;  1JXS A;  4A0X A;  1NHA A;  2NS0 A;  3ISP A;  2DU9 A;  2R3S A;  3KP4 A;  2P8T A;  4B8X A;  1ZG5 A;  1HW1 A;  4EM1 A;  2XGX A;  4EQQ A;  1WRJ A;  4CDG A;  1DPR A;  3RYP A;  5JR3 A;  2DT5 A;  3HOT A;  5HLH A;  1TW3 A;  2MH9 A;  3WGG A;  1B4A A;  2L3D A;  2XAF A;  6PAX A;  3CUQ B;  2PFB A;  3O3K A;  4KUM A;  1OYY A;  1J2X A;  3WTX C;  4Q48 A;  3DF8 A;  1MDM B;  1U2W A;  4CXF A;  1YS6 A;  5K1Y A;  5CLS A;  3BJ6 A;  3GFM A;  4G8X A;  4Q4Z F;  2ACJ A;  3WTW C;  4BQA A;  3KZZ A;  4WXH A;  3RKW A;  1FBS A;  4GYI A;  2TDX A;  1FLI A;  1VTN C;  1PUE E;  1LVA A;  3CO7 C;  3DXJ F;  5CVU A;  4ASN A;  2YX4 A;  4U7B A;  4IPA A;  4JBA A;  1FT9 A;  2EFN A;  2DQR A;  2F5D A;  4WX9 A;  1BC8 C;  1P6R A;  4Z2Y A;  2XRN A;  2M8E A;  4OOI A;  4YFK F;  5LLQ A;  3MFK A;  1T39 A;  1YYV A;  4HX8 A;  3CDH A;  1ONV A;  1J59 A;  1D5V A;  1R1U A;  3IKT A;  2IPQ X;  3CUQ A;  4KN4 X;  2QQA A;  2BYV E;  3J80 Z;  1U5T B;  3ROU A;  1R00 A;  4XLP F;  5IT9 Z;  1IZ1 A;  1MDM A;  3CLO A;  3O2P E;  3VOD A;  1ZG3 A;  1JE8 A;  2A6E F;  2H94 A;  4BAY A;  2V6C A;  2MBF A;  3E5X A;  2QQB A;  1G3Y A;  4CIC A;  1SMY F;  3L00 A;  4IHS A;  2VBY A;  2QZ8 A;  4K2E A;  1ZRE A;  1E2X A;  2JT1 A;  2ZCW A;  3CO6 C;  4RGU A;  2W25 A;  3FMS A;  3OV8 A;  3FZV A;  1J0R A;  1ON2 A;  1LDK B;  4P5O A;  1SD5 A;  1R5G A;  2V1U A;  2QVO A;  2PLY A;  3TKY A;  3RPU A;  2E1N A;  2RKH A;  2ISY A;  1IXR C;  2DLL A;  4WCG A;  4HF2 A;  2XVC A;  1LJ9 A;  4G94 A;  2DI3 A;  3P9K A;  3MZH A;  3HRS A;  4CZZ A;  1U5T A;  1RZ4 A;  4YG2 F;  4BHP A;  1W4M A;  4HF1 A;  1J5Y A;  3KP5 A;  1BOA A;  3KP7 A;  3C1D A;  2HTS A;  1ZRC A;  4N9I A;  4A5N A;  2P6T A;  1I27 A;  5FFX A;  1BN5 A;  3ML6 A;  2R7F A;  2F5E A;  1B9M A;  3K0L A;  2FNP A;  2P5K A;  3C3W A;  5HOO A;  3FHZ A;  4HA8 A;  4A5M A;  3W6K B;  2HTJ A;  2KIM A;  2VOO A;  3IWZ A;  2VOP A;  5DCM B;  1ZLK A;  1R1V A;  1G6N A;  4G6D A;  2XV4 S;  4UV8 A;  2K27 A;  1KU2 A;  4KT5 C;  3QPH A;  3LFK A;  2DBB A;  2ZXJ A;  1KA8 A;  3HYI A;  4RGX A;  3GEZ A;  4LK0 F;  2XAJ A;  2V1X A;  1K6O A;  1HQC A;  3BDD A;  2CWE A;  1XGS A;  2A68 F;  4HYE A;  5LEK A;  3LWF A;  2PMU A;  2B0L A;  1BI1 A;  3MCZ A;  4NHJ A;  5E1W A;  3QRF F;  5CVI A;  4JK1 X;  1BM9 A;  1FWZ A;  4DQ2 A;  4LMY A;  3F8M A;  1K78 B;  1IAW A;  1IN7 A;  1MZB A;  2IA0 A;  2P4W A;  3O6B B;  2ESN A;  3EQL F;  1TQI A;  4HQM A;  4I02 A;  1HXD A;  1B9N A;  3JTG A;  4ENN A;  5LHI A;  4WXD A;  1Z05 A;  2IA2 A;  3E5Q A;  3TO7 A;  1B59 A;  1ZAR A;  5DCM A;  4GGG A;  3N4M A;  2OD5 A;  1O7F A;  2HDC A;  3VB2 A;  4UHT A;  1W7P B;  3K1M A;  3SZT A;  3GF2 A;  3F8F A;  4OIP F;  1XB4 A;  2CQK A;  1XD7 A;  1BI0 A;  3GXO A;  3IC7 A;  3T8T A;  2P7V B;  3FMQ A;  3GLX A;  3V7S A;  2NNN A;  3WE3 A;  1KU7 A;  5TRD A;  5CVR A;  3CJN A;  3KP2 A;  2BEO A;  3WU0 A;  3DP7 A;  4ZH4 F;  2OZU A;  5JFR A;  1Z1D A;  4KYW A;  3U9G A;  2WC2 A;  2IA1 A;  3LA7 A;  1K78 A;  4ENJ A;  1PDN C;  1U3E M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...