2ELHA

Solution structure of the cenp-b n-terminal dna-binding domain of fruit fly distal antenna cg11849-pa
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
87
structure length
87
Chain Sequence
GSSGSSGMNIRMGTKGKRPLRSLTPRDKIHAIQRIHDGESKASVARDIGVPESTLRGWCKNEDKLRFMSRQSATDNLCADALGDKMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the CENP-B N-terminal DNA-binding domain of fruit fly distal antenna CG11849-PA
rcsb
source organism Drosophila melanogaster
molecule tags Dna binding protein
molecule keywords CG11849-PA
total genus 11
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2007-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04218 CENP-B_N CENP-B N-terminal DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2elhA01
1K7AA 4OINF 5ICGA 2KKOA 4HOBA 4A0ZA 1ZYRF 3P9KA 1ZG5A 2R3SA 2K4JA 3LA3A 2HZTA 5DCMB 1FYLA 1OYYA 3FWEA 3V7RA 1QZYA 4ZZDA 5LGTA 2DQRA 4YFXF 2W25A 1UCRA 3H3ZA 3EQLF 4M9ZA 1K79A 3LQRA 3DXJF 1J59A 3ZMUA 3RPUA 1KQ8A 4D0PA 3HOTA 2MH9A 5CVIA 2RDPA 2Z99A 3LAPA 1G3YA 3TQNA 4KT5C 1KU7A 2GZWA 5E20A 5HLHA 2JSCA 3R0JA 5L3FA 3GWZA 2XIGA 1LDDA 4OIPF 3IKVA 2FEZA 3GZ5A 4N9IA 2A5YB 2LSOA 4LD5A 1U78A 2DPDA 2YX7A 1SD4A 2QZ8A 3MCZA 4UVCA 1R00A 2VE8A 1I1GA 5LLQA 3IRQA 5LEKA 1FZPB 2QUFA 4FHTA 4AVPA 4ZYGA 4OIOF 3CO6C 4H0EA 5HLGA 3KZYA 1XN7A 4F7ZA 3ZN1A 5DD4A 2CGPA 4JQFA 2KIUA 4LB5A 2PFBA 4O6JA 1O3TA 4MGRA 1EH8A 2BV6A 5D5XB 2DO7A 4PDKA 2CFXA 3DPLC 3H92A 3HSFA 5K5OA 2P5KA 4KICA 5DV5A 2Q2EA 3WGGA 3WU1B 2PI0A 1JHFA 2M45A 2X4HA 2PJPA 3TO7A 4XRFA 1RUNA 4EM1A 1ZRFA 3F8FA 3C3WA 4LLNA 3WTTC 5KK1A 3GFLA 2GXBA 4FX0A 2HFHA 1U5TC 5FD5A 3EYIA 1FBQA 3TOBA 1XCVA 3SXYA 1GHCA 3LSTA 2XASA 2YX4A 5ICFA 5LHGA 5KVRA 4G7ZF 3F8NA 2DT5A 2P8TA 5CVUA 3E5QA 2RC4A 1BIAA 4Y17A 5ICEA 3FMSA 4YIFA 3ABTA 1TNSA 5HDNA 2FU4A 3WGIA 1V3FA 2CG4A 1B9MA 4ESFA 5F1RA 1U5TA 3WGHA 4M9SA 3BROA 2A68F 2DFIA 4RGXA 2LKPA 3IC7A 2XAHA 4A12A 3KFWX 4BXUA 2FQ3A 4L9NA 4HX8A 3ZMZA 3G73A 3ISPA 4O5VA 1YS7A 3RKXA 1C0WA 2EV6A 2W57A 1RZ4A 3F21A 3DV8A 3TKYA 4EQQA 2EFQA 2FRHA 2H6BA 4TV7A 5E18F 3GVAA 1KYZA 2XKPA 1J5YA 2Y75A 5K5QA 4QLCU 1Z7UA 2L4AA 5L3EA 3BPVA 4MNUA 2ISYA 3U9GA 2DI3A 2D1VA 2PQ8A 5AIQA 3C18A 3KP4A 1YYVA 2ETHA 4UVAA 2FOKA 4LK1F 1W7PD 3CDHA 3RKWA 1CF7B 1X3UA 4WWCA 2GIVA 4BH9A 5DDGA 2KJBA 5E8GA 2GAUA 3L2CA 1D3YA 3NEUA 2QLZA 3R60A 1HKQA 3L9FA 4UVBA 3LA2A 2ZFWA 4YFKF 4WXCA 4Y13A 3F22A 4L9VA 2Y48A 5ILUA 4ZYHA 2VBXA 1IZ1A 4HYEA 1R58A 3KLNA 4UNOA 5D6EA 3V7SA 5HDKA 1IN6A 2ESNA 1W7PA 3ECHA 3TGNA 3QPTA 5JI6A 5L3DA 5H20A 5LGNA 1JE8A 3DPTA 1FC3A 4LLLA 4BNCA 2YU3A 2QQ9A 3E6DA 4KUMA 5AIPA 2H6CA 5J8FA 4DNCA 2YPRA 2ACJA 2QQAA 1AOYA 1XGMA 4HQMA 4CDGA 2HKXA 3MAJA 5IT3A 2BYVE 2LF7A 1LDKB 5DD8A 4S04A 1WKMA 2M8EA 3NRVA 4O3MA 3GFJA 1T0FA 3V7CA 2DPUA 2GQQA 3P7NA 3BY6A 4AIKA 1Z9CA 3FXQA 1FNNA 3J81Z 3AAFA 2LF8A 1F5TA 2NRAC 1RNLA 4CO8A 4OIRF 2KIMA 3C1DA 2P7VB 1ON2A 4U0YA 3JSPA 3FM5A 4A2UA 2ZKZA 1IN7A 1FOKA 3PFIA 2EFOA 3GF2A 2K27A 3RI4A 3HRMA 3ZQ7A 4BQAA 4L18B 1FYMA 1SD5A 2HS5A 3ROUA 2L01A 3K2ZA 3WTYC 3MZYA 1OR7A 2FMLA 2FBIA 4KA4A 1B6AA 4KDPA 4HQEA 3ML6A 4BHBA 1SMTA 2Z3YA 4YFNF 2ZMEA 1RIOH 4M73A 2NNNA 3CUQA 3MFKA 5E8IA 3HTSB 1LB2A 2CQKA 2H09A 1J0RA 5LBQA 4PGHA 1FPQA 1O3RA 2EJRA 1E2XA 2WV0A 1STZA 2EFWA 3I59B 3CUQB 3J80K 3V8JA 2K7LA 2VBWA 1LEBA 1OYWA 4ASNA 2EFNA 1ZN2A 1Z05A 5F64A 5CJ9A 5D5WB 4GXOA 1YW9A 2OZUA 2V79A 3WTZA 4UV9A 5E1ZB 2AS5F 4I02A 1U2WA 2ADUA 5CVRA 3HRSA 2A6HF 2XAFA 4BHPA 1FSHA 3QOPA 2ZO4A 1ODDA 2CO5A 3R61A 4I2OA 4BAYA 2UXNA 4I0AA 1D8JA 2K86A 5TRDA 3R4KA 4KMUX 2Z33A 1HSTA 3F6OA 3O2PE 1ULYA 1J9IA 4U0VA 1MKMA 4MQVA 2GA2A 4NB5A 4OIQF 1DDNA 5JFRA 1QQIA 3E6CC 2IA1A 1QPMA 3I0TA 1PUEE 2UWMA 2KIFA 1B59A 1G3WA 1F4KA 5J8CA 4EJUA 2M5WA 3GFMA 1H9GA 1Z91A 3K0LA 3U2RA 2B0LA 4CGZA 1ZH5A 1DPRA 1FT9A 4P9FA 4EJWA 1VTNC 4G7OF 1B9NA 4L5JA 2VBZA 3R6SA 2HTSA 5CLSA 2VONA 3L7WA 1SFUA 2P5LC 3H3UA 3M7GA 3CO7C 3TDZC 2A3SA 5J6XA 4IVNA 2VC1A 1S7AA 4RAZA 3BDDA 3IWFA 1I1SA 4N9HA 3RYRA 3T8RA 3ZPLA 1S3JA 1HQCA 4KIBA 1IXSB 2F2EA 2FE3A 1XDSA 4I09A 2NNYA 1BM9A 1ZARA 2M30A 3REOA 1YW7A 1BI2A 4I0BA 3TOAA 1XGNA 1BN5A 4MTEA 2PMUA 2VODA 3WU0A 4KFCA 1HW2A 1BIBA 3GEZA 3KEOA 4OOIA 1ZHFA 2FNAA 1SD6A 1L0OC 2R7DA 1LVAA 2J5PA 2FA5A 3FM3A 5D4RA 1WRJA 2D1HA 4A6EA 4HF1A 1O3QA 2W85A 2HQNA 5BMZA 1U8RA 3KP6A 3WE2A 2FBKA 2E1CA 1S8NA 2DW4A 4ZYDA 3I64A 3JAMZ 2FXAA 1YFHA 1KU3A 4G9YA 3RDIA 3ZMSA 4XSXF 4EM0B 3O6BB 2EFPA 2BEOA 2Z5UA 1AWCA 1D5VA 4I01A 1ON1A 2XAQA 3N4MA 1XSDA 2NAZA 3EETA 1P6RA 3DQVC 1W4MA 2O6GE 1HXDA 2R7FA 2F5EA 4IRHA 3KP2A 4R79A 1MJ9A 2IRFG 2OQGA 1DPUA 1G6NA 4ZH4F 1U3EM 2OAZA 3BP8A 4IJAA 4WF2A 1HW5A 1R5HA 1USTA 4CICA 2ZCWA 1XSVA 3QPHA 1YG2A 2IA2A 1XCBA 2KRFA 3S2WA 1BI3A 1G3TA 1B1BA 2NYXA 3TO9A 4U88A 2O8XA 2QWWA 4UXNA 1XDUA 5IT9Z 1LNWA 4CXFA 2V1XA 2O0YA 3F3XA 3V8LA 2P4WA 4G8XA 2PN6A 3QAHA 2HTJA 2IPQX 3KETA 4MEXF 4PGGA 3MWMA 4HF2A 2P6SA 4K2EA 3VEPA 4I7HA 4RS8A 2GXGA 2HDCA 4LGWA 4EGZA 1OMIA 2GWRA 4KIFA 2HYGD 3L00A 4HZFA 2MA3A 4WXDA 2LDUA 5L3GA 3BJAA 2D2WA 2ZJ2A 3VFZA 3RKYA 3PQJA 2W24A 5ILVA 1FSEA 3HHGA 3T8TA 3WTVC 2CSOA 1FWZA 2G7HA 3M1EA 3EDPA 1HKSA 3J81K 3P9IA 1YO5C 4Y15A 4DQ2A 2EV5A 1FY7A 3JTHA 3BJOA 3QP6A 2DTRA 1B4AA 1YIOA 4HLXA 3F6VA 2XGXA 4Q5SF 3WTXC 3K1MA 3GLXA 4YG2F 4RB2C 3GX4X 3BPXA 3JTGA 5D5UB 5A2QK 2V6CA 1GXPA 2HKOA 2P5VA 4RGRA 1RI7A 3W6KB 3JSOA 1MZBA 5EEHA 2QYOA 4R1HA 4FX4A 2VBYA 5A2QZ 2RV8A 4P9UA 2E1NA 1XGOA 3E97A 1XB4A 4JBAA 4P55A 5D4SA 1IN5A 4EM2A 4HX7A 1LQ1A 2HEOA 1I27A 1P2FA 3RIRA 3T5XA 1G4DA 3IL2A 3CTAA 3MZHA 2VE9A 4B09A 1MD0A 2JRTA 1YS6A 5EEGA 3QU3A 4EVIA 2DBBA 4EV0A 4G6DA 1ZLKA 1BJAA 2L4MA 4LB6B 1SMYF 4UHTA 2WC2A 1PDNC 3VB2A 5D5VB 1UB9A 3J80Z 1SFEA 3D5LA 4XLPF 1O7FA 2ISZA 1Z1DA 4HV6A 1FP1D 1G3SA 3WTSC 1KQ0A 4M9XA 2OA4A 4AD9A 2G7UA 1LEAA 2K02A 4HBLA 3WODF 4FT8A 1TTYA 1KU2A 3V8KA 2O61A 5LRRA 2EA4A 1KGSA 2PLYA 3KP5A 3FF5A 4I98B 3LWFA 3KEQA 3TDUC 2FBHA 4M74A 5HOOA 3HYIA 2QM3A 3HSEA 2DK8A 2Y0MA 3E5XA 1S7OA 2EV0A 3E3VA 1L3LA 3RTRA 1YTYA 1T38A 4MHGA 3F8CA 5L3BA 2FNPA 5E1XA 4EGYA 2HOEA 4PZJA 4ENNA 5D8KB 1ZG3A 1IXCA 2VOPA 3I59A 2IVMA 2A6EF 1BI0A 3DKWA 3I58A 4MTDA 2A07F 2UXXA 1JHHA 1OKRA 3I53A 3V4GA 2D45A 3WTUC 1E17A 1SFXA 4BHCA 3FHZA 2WWYA 1PP8F 1BBYA 2L54A 1ZRCA 3J7AO 4RB0A 1WQ2A 2GA1A 2ESHA 4KIGA 5K1YA 5HS8A 2PG4A 4GCVA 2ELHA 2XUBA 1KQ9A 1R1UA 1TNTA 5FO5A 1DUXC 5BQTA 4HA8A 2RVCA 4ESBA 3ABUA 1KU9A 5DEQA 4KMFA 3ZMVA 3GO5A 3IKTA 1D8KA 2MLKA 5AONA 3U1DA 4OMZA 2MBFA 4U0WA 2VT3A 1XD7A 3W6JB 1FP2A 1LDJA 1QZZA 4L0YB 5ED4A 3FMQA 4A0XA 3QU6A 2MD5A 3K69A 5E1WA 4AWXB 5LRSA 1FBUA 1QNTA 1USSA 3KLOA 2XROA 4G94A 1WSUA 4EMSA 5LEJA 1HBXG 1F1ZA 1UHMA 5CVJA 4AIHA 3FXUA 2IP2A 4UV8A 4HDUA 1MDMA 2TDXA 2VXZA 1TW2A 3GW2A 3JAMK 4MEYF 2VT2A 1R5GA 4LG0A 2JPBA 4L9JA 1ZG1A 5BPIA 2KJCA 2XV4S 5HLIA 4A5MA 1Z6TA 4PCQA 4HLYA 1K78A 4LJZF 4RGSA 3COAC 1IAWA 1FX7A 4L5IA 1ZAOA 1IN4A 2RKHA 1JXSA 3E5UA 3GUDA 4U7DA 1UFMA 3L09A 4MQ9F 1H0MA 4HDVA 3F72A 4KN4X 1IRGA 1F9NA 1Y0UA 2STTA 2ZMEB 3HUGA 2M1BA 4ETSA 2YSRA 1Q1HA 2WTEA 2JZYA 5DCMA 3SZPA 1O3SA 2PEXA 1GVJA 3LAJA 3K1PA 1H9TA 2XAGA 3BZ6A 3HRTA 2XRNA 4KN7X 5JR3A 2X0LA 3T1BA 5FLXK 1HW1A 3I71A 3E6BA 3ZP5A 5FB2A 4RAYA 4AIJA 4YIIA 1YW8A 1I6XA 1O7LA 4NHJA 3KP3A 1ONVA 5BS6A 4QWQA 4JK1X 4HAMA 5LHHA 1UHWA 2BBYA 1FYKA 3RJPA 2A61A 1JGSA 5HS7A 3DP7A 2PMHA 1W7PB 1J7KA 2L02A 1ZRDA 1OYIA 3Q5FA 1T2KA 2HQRA 2O03A 1U5TB 1WWXA 2DU9A 1O57A 3ZN0A 1QGPA 1TQIA 2H94A 4G7HF 2L3DA 1K6OA 1ZLJA 2CYYA 3FXRA 1A04A 5FD6A 3B73A 2O3FA 3OV8A 3CLOA 3HHHA 4ENJA 3D0SA 4U7BA 1P4XA 3BOQA 3O3KA 4ESJA 2JTVA 3KZZA 1Z6RA 3GFIA 5H6RA 4A0YA 2V1DA 2HR3A 2E7XA 4CZZA 3ERED 1S29A 1YQAA 3GYHX 2FMYA 2JT1A 4A6DA 4LK0F 3M8EA 1IN8A 2JPCA 4LLGF 1R22A 2OU2A 3QRFF 1KYWA 4UUVA 3I5UA 4ZYEA 2OQRA 1TQPA 1NHAA 3OOPA 4LFUA 3I54A 5FFXA 2EA2A 1R1VA 1XMAA 3Q9SA 2CWEA 4IHSA 2FSWA 3EUHA 4RB3C 1KA8A 2COMA 5D6FA 2M87A 3KCCA 2AXLA 6PAXA 3IWZA 3SHFA 1T98A 3WTWC 3F23A 2MH2A 4WX9A 4Q4ZF 1ZGAA 4WK8F 4LG0B 2RNJA 4WCGA 2J5OA 2STWA 3I4PA 3MEXA 2W84A 1J2XA 1P4AA 4WXHA 3LFKA 2IA0A 4OU0A 4HV5A 2VN2A 3FX3A 3VODA 4L0ZB 2VC0A 2PBIA 3HSRA 4ENMA 2XKOA 3IRRA 2MC3A 1MDMB 2QBYA 2Z9OA 4RB1A 5CVVA 1HSJA 2K4BA 2XVCA 3E6MA 2XHKA 3G3ZA 1BC7C 2HYFA 4ON0A 2IJLA 3F8BA 1CGPA 5DCFA 2QQBA 3LQQA 3GZ6A 1R7JA 1K78B 4IXAA 5ILSA 2F5DA 4M72A 5JHUA 5HDGA 1V4RA 1T39A 3JW4A 2ZNZA 5JVTA 3K1NA 1REPC 4B8XA 3KE2A 2A69F 3DFGA 1ZGJA 3M9AA 3B02A 4RGUA 2P7CB 5L3CA 1QBJA 3VOEA 1BI1A 2QVOA 2HWVA 1IUYA 5DUKA 1DP7P 2IT0A 4XBFA 3SZTA 1MJBA 1BC8C 2EWNA 4R8HA 4IPAA 1GXQA 4NQWA 3EYYA 1TLHB 1OPCA 2ZNYA 2DAOA 2QBYB 4EJOA 4EJTA 3P9CA 1MGTA 4OMYA 1TW3A 3HIFA 3NQOA 5DUIA 1FLIA 1EH7A 2YR2A 3ECOA 1CF7A 4Z2YA 2RGVA 4Q48A 2DLLA 3MQ0A 2DK5A 1P4WA 2ZBKA 2ZXJA 2QENA 3RPQA 1XGSA 4P5OA 4ZZLA 2E7WA 2VOOA 2RN7A 4M71A 3LA7A 5FGMA 1P92A 4HX4A 3M8FA 5HS9A 3ZMDA 4IF4A 4L9TA 2UZKA 1EH6A 1BOAA 4CHUA 5D8LB 1TBXA 1SAXA 2H27A 4GO1A 3WG9A 5ERIA 5TJJA 2IW5A 2Q0OA 2V9VA 4Q47A 1YLFA 3FZVA 1R1TA 3K9TA 3QP5A 2NS0A 5CYVA 3SQNA 4CYDA 3HTUA 3KP7A 3HOSA 2BGCA 1I5ZA 3IHUA 4IHTA 1R36A 1W5SA 2Q8KA 4P96A 3DEUA 1TQMA 4M6YA 1T6SA 4GYGA 4GYIA 2OZ6A 3DF8A 1IW7F 4LMYA 3RYPA 2P6TA 3CUQC 4BYYA 1ZREA 2EB7A 5BPDA 3BJ6A 5K5RA 2OD5A 4XSZF 3PQKA 3C7JA 3SFZA 4N0BA 1EV7A 3ZMTA 3CJNA 3Q9VA 2RQPA 5BOXA 5LHIA 4A5NA 5DYMA 4HF0A 2BE5F 1XMKA 4ENKA 1LJ9A 2MLGA 4KYWA 2LNBA 5ICCA 3GXOA 4M6XA 3WE3A 1WI9A 2DQLA 5FLXZ 1MJAA 2XAJA 1S6LA 1QO0D 5E17F 3TO6A 4EJVA 3ELKA 1FBSA 1IRFA 1HKTA 5F6FA 1U6GA 1J75A 1IF1A 3HRUA 4E70A 2C6YA 5IT9K 4G6QA 2HGCA 5FFZA 3T0YA 1RUOA 3R0AA 5LGUA 4IRIA 4KNYA 2FF4A 4S05A 2OBPA 3N97A 3F8MA 4XLNF 2F5FA 2CW0F 3ULQB 2EK5A 1W5TA 3BWGA 5HVQC 4HW0A 4GGGA 2G9WA 1R23A 3FMRA 5H6QA 1IXRC 3CUOA 2F5CA 4IRGA 1SD7A 1PP7U 2V1UA 1XSXA
chains in the Genus database with same CATH superfamily
2CUJA 1K7AA 4OINF 2CW7A 5ICGA 1SEUA 2KKOA 1JKRC 3OIOA 4HOBA 4A0ZA 2K9NA 3ZQCA 1BR4A 1QZEA 1VZ0A 3LOCA 1ZYRF 2Z2SB 3HOZJ 2VQCA 3S15J 3P9KA 1ZG5A 2R3SA 2K4JA 3LA3A 2HZTA 3NWSA 3BZCA 2PJRB 5DCMB 3ZR8X 1FYLA 1OYYA 1D0XA 3FWEA 2K9SA 3V7RA 2K9LA 1YJ9I 1QZYA 4ZZDA 4H4KC 2BY1A 5LGTA 3ZXSA 1DU0A 3VWBA 2DQRA 2F48A 4YFXF 2W25A 1UCRA 3H3ZA 3CCMI 3EQLF 3PUFA 4M9ZA 3HUGB 3CMAI 2CMPA 1K79A 4Y52J 3LQRA 3DXJF 4M3GA 4BJ5C 1J59A 1RKWA 3ZMUA 5J4VA 4OAYA 1V5EA 3TBIA 2WV1A 1Z7LA 4BE0A 2L9VA 3RPUA 3ONQA 1KQ8A 1BOBA 4D0PA 3HOTA 2MH9A 2DODA 5GADJ 1RESA 1NK2P 5CVIA 1W0UA 2RDPA 2Z99A 3LAPA 2DA5A 1G3YA 4JX6A 3TQNA 1MNDA 4KT5C 1KU7A 2GZWA 3ZQHA 3MKYB 5E20A 3EUKL 5HLHA 2LH9A 2JSCA 2CQXA 3R0JA 5L3FA 3GWZA 2XIGA 1LDDA 2FX0A 2M4GA 4OIPF 3IKVA 4OAZA 1P9QC 2ZFUA 4XM3A 2FEZA 3GZ5A 3GTJJ 2HDWA 4A3MJ 2WAFA 4N9IA 2A5YB 3CF2A 2R7UA 5FKNA 4C3HJ 3OYNA 2LSOA 4LD5A 1U78A 2E2HJ 1I39A 2DPDA 2YX7A 1FEXA 1SD4A 5TISC 2QZ8A 3MCZA 4UVCA 2X48A 2VASA 3SDBA 3OYHA 1R00A 2VE8A 1I1GA 5LLQA 4BKXA 4CA0A 3IRQA 4NDLA 5LEKA 2L9RA 1FZPB 2IBDA 2AHQA 2FUG2 2QUFA 4FHTA 4AVPA 4ZYGA 1QVTA 4OIOF 1D1AA 3CO6C 1IGNA 2Q1ZB 4BJ6C 3F9KA 1IDYA 4BDZA 4H0EA 5HLGA 3KZYA 1XN7A 2L0KA 3BQYA 3MVPA 3K4NA 4F7ZA 5J4YA 3CC4I 3ZN1A 3FXMA 3RQ4A 4C3IJ 5DD4A 1SVMA 2CGPA 3HOVJ 3D1NI 4JQFA 4PJLA 4PJ0C 2KIUA 2PX9A 4LB5A 2E5ZA 2PFBA 3BR3A 2CV1A 5EEAA 4O6JA 3DBHB 2IGKA 4IHWA 2DJNA 1O3TA 4MGRA 2VB6A 4N4OB 1EH8A 3I4NJ 1A5JA 2BV6A 1QA6A 5D5XB 2DO7A 4PDKA 2CFXA 3DPLC 2DA6A 3H92A 2Y2ZA 3HSFA 5K5OA 2LY2A 2P5KA 4KICA 2ECCA 4A3BJ 1SVOA 3PM1A 2ELJA 5DV5A 1WJFA 3S32A 1BJZA 3OS0A 2ZSHB 3U1KA 2Q2EA 3WGGA 1JTXA 2WAQA 2OC6A 3WU1B 2PI0A 1JHFA 2M45A 2X4HA 2PJPA 3PIPF 4HSTA 2DMNA 3TO7A 3ZQQA 4XRFA 1RUNA 4EM1A 1RRJA 1K4TA 1ZRFA 3F8FA 1S5LC 3C3WA 4LLNA 4II2A 2Y9YA 2JVHA 1ITYA 1UG2A 1WJAA 3WTTC 5KK1A 3GFLA 2GXBA 4FX0A 2HFHA 1Z77A 1U5TC 2KP6A 1HLVA 5FD5A 3ZCOA 3EYIA 1FBQA 3TOBA 1XCVA 3SXYA 4E7JA 1FOWA 1GHCA 3Q3SA 3LSTA 2XASA 2YX4A 5E3OA 4IL6C 5ICFA 2P81A 4XNFA 5LHGA 5KVRA 5IP7J 4XICA 4B44A 4G7ZF 3S3MA 5BNGA 3F8NA 3EUAA 2DT5A 2R4GA 2P8TA 4XKCA 4XQFA 5CVUA 3E5QA 2RC4A 4LITA 1BIAA 3A01B 4Y17A 4HNUA 5ICEA 3FMSA 4YIFA 3ABTA 1TNSA 5HDNA 4DJAA 4I76A 3DU5A 2FU4A 3WGIA 2KRCA 1TZLA 1V3FA 3BR1A 1YE9A 2CG4A 1B9MA 4ESFA 1D5YA 5F1RA 1U5TA 3PFYA 4IHYA 3WGHA 4PK4A 2M7BA 1MBKA 4M9SA 3L2QA 4IQ4A 3RQIA 3BROA 2A68F 3H5NA 5M5XJ 1R9TJ 2K5CA 2DFIA 3VSKA 2CV2A 1EKEA 2NVXJ 2V6EA 4V19K 4A3GJ 4RGXA 2LKPA 1GT0C 3IC7A 2XAHA 3OYMA 4A12A 3KFWX 4BXUA 2FQ3A 4X6AJ 4Y3OA 1VQ6I 1MBGA 1Y1VJ 3QOEA 4L9NA 3OY9A 4HX8A 3ZMZA 1HOMA 1V54H 3G73A 3ISPA 4O5VA 4RAGA 1YS7A 3RKXA 1C0WA 3BTIA 2EV6A 2W57A 1RZ4A 3DV8A 3F21A 3TKYA 1TC3C 3K4LA 1MSFC 1NH3A 4EQQA 3OYAA 4MO7A 1ETVA 2EFQA 3VYRB 2FRHA 2H6BA 4TV7A 1JUPA 1I50J 2GM4A 3B6AA 2NVUB 5E18F 2R5ZB 1PVEA 3GBGA 3GVAA 1HDPA 1KYZA 4S0HB 2D5VA 2XKPA 1J5YA 3DKYA 4RDUA 3CCQI 2Y75A 5K5QA 4QLCU 1Z7UA 2L4AA 3FXLA 1JKOC 1MMNA 3G4SI 3FISA 4F92B 3BPVA 5L3EA 2EBIA 2X51A 4MNUA 4Y33A 1MSEC 2ISYA 3DPUA 1UG0A 2EILH 2XC7A 4IEJA 4CZCA 3BR2A 3U9GA 2BOLA 1YOVB 2CFOA 2DI3A 2MGQA 4QPOA 2LTPA 2D1VA 2PQ8A 4CSWA 5AIQA 3S16J 4B48A 2EZHA 3TMOA 2ME6A 3C18A 3KP4A 5KHDA 3CMEI 1K6YA 1YYVA 2ETHA 3JRFA 4UVAA 4FASD 5HNFA 2FOKA 4LK1F 2VKDA 1T33A 4F52A 2KPMA 4AYBN 1W7PD 3CDHA 3RKWA 1VQOI 2AQFA 1CF7B 1X3UA 2HDDA 4WWCA 2NVQJ 2GIVA 4FE7A 3AFHA 2HPMA 2Z1DA 3BQZA 4XIDA 1FOXA 4BH9A 1ZKGA 5DDGA 2RREA 3FDYA 2KJBA 5GTIC 3LSPA 1OCTC 5E8GA 2DA4A 2XPUA 2GAUA 3L2CA 2KQRA 1D3YA 4ZTJA 1RETA 2X6WA 3NEUA 2QLZA 3P5JA 3R60A 4IQJA 3S14J 3BT9A 1HKQA 3L9FA 4UVBA 3LA2A 1IJWC 3KYDB 2ZFWA 4YFKF 2NOGA 4WXCA 2DYRH 1U8BA 3GTMJ 4Y13A 3F22A 4L9VA 2Y48A 1U0JA 1D0ZA 5ILUA 4ZYHA 2VBXA 2VKEA 1IZ1A 4HYEA 1R58A 1WZ2A 3KLNA 4QTRA 4UNOA 2NOJB 5D6EA 3DU6A 3V7SA 5HDKA 1IN6A 1YHQI 2ESNA 1W7PA 4UB6C 4ZDOA 1RC9A 3ECHA 2EPFA 3TGNA 3QPTA 3QPSA 5JI6A 1IRZA 5L3DA 5H20A 5JVGF 1JGGA 5LGNA 4G6TB 4LOCA 5K7FA 3K4BA 1JE8A 1QVUA 4E7IA 2NVTJ 3FK7A 3K6GA 3DBLB 4BY7J 2BW3A 3DPTA 3OOUA 3CESA 1UELB 2XB5A 1FC3A 1V5GA 4LLLA 4BBSJ 5HODA 4BNCA 2YU3A 2QQ9A 3E6DA 5FRNA 2JA6J 3SJMA 4KUMA 2CUFA 5AIPA 2H6CA 1WJEA 5J8FA 2E1MC 4DNCA 5KAFC 3OYIA 3VDXA 3LSIA 2YPRA 2ACJA 4C3JJ 1BA5A 2QQAA 1AOYA 1XGMA 4HQMA 4CDGA 3S1NJ 2KL4A 3DWLE 2HKXA 3MAJA 2Z16A 5IT3A 4I6ZA 2JRMA 2BYVE 2LF7A 2KFDA 4J19A 1LDKB 4PSWA 5DD8A 1AA7A 4S04A 2LRDA 1WKMA 2M2EA 2M8EA 2OCEA 2TRTA 3LSHA 2B63J 3NRVA 4L5EA 4A3IJ 1MNMC 1ETXA 5IY5H 4O3MA 3GFJA 2PMZA 1T0FA 3V7CA 2DPUA 2JK3A 2GQQA 3P7NA 3DBRB 1IV6A 1O4XA 3H9GA 3BY6A 3DTEA 3AG3H 5DTDA 2YU9J 4XLFA 1R5ID 4AIKA 2OTLI 1Z9CA 3RZDJ 3FXQA 1OFCX 1FNNA 1W36D 3HGGA 2OCCH 3J81Z 3AAFA 2LF8A 4QPQA 1F5TA 2NRAC 2O9LA 3N05A 1RNLA 1HCRA 4CO8A 3FIWA 2KT0A 3K4CA 4A69C 4OIRF 2KIMA 3C1DA 3W2WA 2P7VB 1ON2A 1X4OA 4U0YA 3HG9A 3JSPA 1TP4A 1JUMA 3FM5A 4A2UA 2ZKZA 3GZNB 1IN7A 1FOKA 1XC5A 3PFIA 2JSPA 2R7SA 4EEFG 2PMZN 5KNLA 2EFOA 1GDTA 3GF2A 2K27A 3OL3A 4CCNA 2DDAA 3RI4A 3HRMA 3ZQ7A 4BQAA 4L18B 5EJCA 3PIOF 1FYMA 2A5WA 3CCLI 1SD5A 2HS5A 3H1CA 3ROUA 3S1QJ 2L01A 1G2HA 3K2ZA 1ORKA 3WTYC 3MZYA 1OR7A 2DN0A 3LSJA 3Q0WA 3OYLA 2FMLA 2CS3A 2FBIA 1EJ9A 4KA4A 1B6AA 3JR9A 2XF7A 1WJBA 2TCTA 4KDPA 3S8PA 4HQEA 1LFUP 3K4KA 2RAEA 3ML6A 2Y9ZA 3G6EI 1B72A 1JKPC 2XF5A 4BHBA 1SMTA 2Z3YA 4YFNF 1TL8A 2ZMEA 3D5RC 1QU3A 2E2JJ 1RIOH 4M73A 2NNNA 3OYEA 3CUQA 3MFKA 5IP9J 2PJRA 4RM3A 5E8IA 5FKLA 3HTSB 1LB2A 2CQKA 1ZQ3P 2H09A 4A3LJ 1J0RA 5LBQA 4PGHA 9ANTA 3NAUA 2HOTA 1ENHA 3S3NA 1FPQA 1O3RA 2EJRA 3I55I 3K2AA 1E2XA 3CDLA 2WV0A 3M8JA 5E79C 1STZA 3HDDA 1E3OC 2EFWA 2E2IJ 3I59B 4PJJA 3CUQB 4ZDPA 3J80K 2KZVA 3V8JA 2K7LA 2VBWA 1LEBA 1OYWA 4ASNA 2EFNA 1ZN2A 1Z05A 5F64A 5CJ9A 2H8RA 5K7HA 4GXOA 5D5WB 1YW9A 2OZUA 2V79A 2Y31A 3WTZA 4HPQA 4UV9A 5E1ZB 3OYDA 2AS5F 1B8IA 4I02A 2DYSH 1U2WA 2ADUA 5CVRA 1X3WB 3HRSA 1RR8C 3HOYJ 2A6HF 3VPRA 4BL0B 1S7EA 2XAFA 3UKGA 1MIJA 1I3QJ 2DDBA 1PUFA 3FXKA 2WB1N 4BHPA 1FSHA 3QOPA 2MW8A 1MNEA 1XX5A 2ZO4A 2ZC2A 4C30A 1ODDA 1OLTA 1J09A 2CO5A 2R7ZJ 4XN3A 3R61A 2V9KA 4I2OA 4BAYA 2UXNA 4I0AA 1D8JA 4MIMA 2XB0X 2K86A 1B8IB 5TRDA 1TT0A 2BW3B 3R4KA 1HSTA 4KMUX 2Z33A 3F6OA 3O2PE 4NC7A 5E3MA 1ULYA 3LL7A 2L7MP 1J9IA 4U0VA 1MKMA 4MQVA 2GA2A 4NB5A 4BEHA 4UUSA 1DDNA 1VQ4I 4OIQF 5JFRA 2KDOA 1QQIA 3E6CC 2IA1A 4CUGA 1QPMA 3I0TA 3L2VA 2XPWA 1PUEE 2UWMA 2KIFA 4E7HA 1B59A 1G3WA 4MFDA 1F4KA 1SVLA 5J8CA 4RA2A 5EDNA 1QHGA 4EJUA 2M5WA 3H0DA 3AL0B 3M3YJ 4BU2A 1A36A 3GFMA 4B1RA 2OJED 1H9GA 2BXZA 2WY7Q 2DT6A 2LYCA 4HNTA 3CQZJ 2CV0A 2XSDC 1Z91A 2EIMH 3K0LA 2E34A 3U2RA 2B0LA 4CGZA 1ZH5A 1DPRA 1FT9A 2XDVA 4P9FA 4EJWA 3K4MA 4DYQA 3DTIA 2VKVA 1VTNC 4G7OF 5F0FA 2R7TA 2WAEA 1B9NA 4E7SA 3KX2A 4L5JA 2DA3A 2VBZA 2DMPA 2NVYJ 3R6SA 2HTSA 5CLSA 3QYFA 2LKSA 2VONA 1SANA 3L7WA 4HG2A 1SFUA 3OR2C 3H3UA 2P5LC 3M7GA 3D5SC 3CO7C 2GBYA 1IRXA 3TDZC 1YX5A 3RPUD 1PYVA 2A3SA 1S9HA 3LSRA 5J6XA 3UNGC 4IVNA 2VC1A 1S7AA 4RAZA 2NXNB 4RLFA 3BDDA 5KAIC 3CCSI 3JRIA 3IWFA 1I1SA 1ACIA 3QWLA 4N9HA 3RYRA 3HM5A 3T8RA 1VNDA 3ASNH 3ZPLA 1S3JA 1HQCA 4KIBA 1MW7A 4D7MA 2H8WA 1SFKA 1IXSB 1WJDA 3H9JA 2F2EA 2FE3A 1XDSA 4I09A 1HC8A 2NNYA 1BM9A 1HDDC 1Z67A 2IAIA 1ZARA 1D1CA 3ZGKA 2M30A 4ZC3A 3REOA 1YW7A 4BGDA 1GVDA 2HZDA 1BI2A 4I0BA 2F5VA 1FIAA 3OS2A 3CF5F 2HNHA 3TOAA 1XGNA 1BN5A 1PJRA 4XOPA 1TT5B 1ZGWA 4MTEA 2PMUA 4IX7A 2VODA 3MN2A 2DA2A 2E60A 1TWHJ 1OR7C 2DA7A 3WU0A 4KFCA 2BHZA 2DFFA 1HW2A 1X1AA 1BIBA 3GEZA 4DZPA 3KEOA 3G71I 4OOIA 1ZHFA 5F0HA 4F91B 2FNAA 3BG3A 1SD6A 3C2BA 1L0OC 4U87A 2L2OA 1LVAA 2R7DA 4XK4A 2H1KA 3BR0A 2J5PA 3ZQGA 3KIOA 2FA5A 3FM3A 1ETOA 4W1UA 2GLOA 1ZELA 4AUXA 3O8GA 5D4RA 1WRJA 2D1HA 4BBRJ 2DOEA 2YUSA 4A6EA 1GLNA 1O3QA 2W85A 2HQNA 5BMZA 4HF1A 3FBNB 1U8RA 3KP6A 3WE2A 2FBKA 2E1CA 1S8NA 4CCOA 2ZB9A 2DW4A 3E1SA 3ABKH 2V7FA 3IP4B 4ZYDA 1R4MB 3I64A 5B1AH 3KYCB 2Y0SA 1GUUA 3CCVI 3JAMZ 2FXAA 2MFZA 5LFAA 1YFHA 2R5YA 1KU3A 2R7WA 5FKMA 4G9YA 1FTTA 4RBOA 3RDIA 3ZMSA 4XSXF 4UY8I 4EM0B 3O6BB 1R71A 4B3AA 2EFPA 2BEOA 2Z5UA 2QSFX 1AWCA 1D5VA 4I01A 3W2VA 1ON1A 2XAQA 5C3EJ 3N4MA 1XSDA 2NAZA 3EETA 1P6RA 5FJ8J 3A03A 3DQVC 1W4MA 2L9NA 4F55A 1N25A 3JRGA 2G0EA 1T95A 1HXDA 2R7FA 3BG7A 2O6GE 1XS9A 2F5EA 3A4CA 4IRHA 3KP2A 4R79A 1MJ9A 2IRFG 1X3ZB 2OQGA 1DPUA 5M3FJ 1G6NA 4ZH4F 1U3EM 2EH3A 5FKOA 3CCYA 4II3A 2HXOA 2IS6A 4X1EA 3ZRGA 4A3JJ 2OAZA 2MG4A 2NS8A 3BP8A 4IJAA 1MH3A 4WF2A 3JRHA 1HW5A 1R5HA 1USTA 1Y8QB 4GDFA 4QSHA 1VQ7I 3CMMA 3VYSB 4CICA 1K83J 4BQOA 2VJ4A 1X1PA 2ZCWA 1XSVA 1WCMJ 3DCFA 3QPHA 1YG2A 2IA2A 1XCBA 2KRFA 4RM2A 3S2WA 3L2UA 5E3LA 1BI3A 1G3TA 2M3AA 4J01A 1B1BA 5CQEA 3ESWB 5F27A 3QODA 2NYXA 3TO9A 3WU2C 4U88A 2O8XA 2QWWA 4UXNA 4C2UA 5C4JJ 3Q0UA 3GTGJ 2EIJH 1X58A 4UUSB 1XDUA 4FQGA 4XLHA 5LD2C 5IT9Z 3OS1A 1LNWA 2DOAA 1IDZA 4CXFA 5CQGA 4V2GA 2V1XA 2EIKH 1W1WE 4XLAA 2E5NA 1A31A 1UZCA 2O0YA 5JLWA 3PL8A 3F3XA 3ABLH 2KZGA 1I3AA 1VQ5I 3V8LA 2K3FA 3OIPA 2B9SA 2P4WA 3SYTA 3BG6A 1FMWA 4JX5A 4G8XA 2PN6A 1ETYA 2AO9A 4A3FJ 2E71A 3QAHA 1WHUA 3KPHA 2WY8Q 2HTJA 2IPQX 1VQPI 3KETA 5DS9A 4MEXF 4PGGA 3MWMA 4JYKA 1JJ6C 1JT6A 1F43A 4HF2A 2P6SA 4K2EA 3VEPA 3J7YJ 1UHSA 4I7HA 2Y69H 1X2NA 1SAUA 1U9OA 4RS8A 2XGEA 2IGOA 2GXGA 4PFPA 2HDCA 4LGWA 2LD5A 3H9QA 4EGZA 2QSHX 1OMIA 2GWRA 3CDIA 2VQHA 4KIFA 5FLVA 2HYGD 2Y30A 3L00A 1JJ8C 4HZFA 2MA3A 4WXDA 2LDUA 5L3GA 3BJAA 4RMNA 2D2WA 3OYGA 1D1BA 4X0GA 2ZJ2A 2I5UA 3VFZA 3H36A 3VYUB 3QYEA 3RKYA 2EZIA 3G1OA 4XORA 4NBQA 1OCRH 2QCOA 3GLLA 1FOYA 3PQJA 2DOFA 1R6RA 2JA2A 4ZYAA 2W24A 4RAFA 5ILVA 2HVSA 1FSEA 3HHGA 3BR5A 1OQYA 3T8TA 3WTVC 2CSOA 1FWZA 2G7HA 1NG7A 3M1EA 4XRSA 1W0TA 1QPIA 4LIVA 3HKZN 2BY0A 3EDPA 2ZJPF 1EA3A 1HKSA 3RCOA 1OCOH 3J81K 3JRCA 3P9IA 1UJ8A 1WJ5A 4Y15A 4DQ2A 1YO5C 2EV5A 2N8GA 1FY7A 3CJQB 1U9NA 3JTHA 3BJOA 3QP6A 3NWTA 2DTRA 1GV2A 3QPLA 1B4AA 1OCCH 1YIOA 2X1EA 4HLXA 1T8IA 1GV5A 2LG4A 3F6VA 2XGXA 2E1OA 2ELKA 4Q5SF 3WTXC 3K1MA 3JRAA 2JA7J 3GLXA 4D5CA 5JHFA 4YG2F 4RB2C 3OSGA 3HB9A 2E1MB 3FHNA 2JA5J 3GX4X 3DLAA 3HBLA 3W2AA 3BPXA 3OYJA 3JTGA 1LE8B 3OR1C 5GTHC 1MBEA 2M7AA 5D5UB 5A2QK 4XLCA 3IAM2 2Y0SN 2V6CA 1ZR4A 2JUCA 4PFOA 5IYCJ 1GXPA 2HKOA 2P5VA 4RGRA 1WGXA 5C4XJ 3GMEA 1RI7A 3W6KB 3JSOA 2CQQA 2V1NA 1MZBA 5EEHA 2QYOA 4R1HA 4BQNA 4BDYA 4FX4A 2VBYA 5A2QZ 2RV8A 4P9UA 3TL4X 4KITB 2E1NA 3DEEA 2ZMEC 1AHDP 1G59A 2VKHA 2L5QA 5TGTA 3BLYA 3JRBA 4E7KA 1XGOA 2KIQA 3E97A 5DM6F 1XB4A 4JBAA 4P55A 3EPZA 1POGA 1UAAA 5D4SA 1IN5A 2M4KA 4HX7A 4EM2A 4IKFA 1LQ1A 2HEOA 1I27A 1P2FA 2HQAA 2LY9A 3RIRA 3LSKA 3T5XA 1G4DA 4CCMA 3IL2A 4E4HA 3CP2A 3CTAA 4XL9A 3MZHA 1ETKA 2VE9A 1YJWI 4B09A 1MD0A 2FQ4A 4XMYA 2JRTA 1YS6A 2XGDA 2R0QC 5EEGA 2BHYA 3QU3A 4AVZA 4EVIA 2DBBA 1H88C 1HF0A 2QKLB 4CYCB 4EV0A 3QQAA 4G6DA 2HOSA 1VQMI 5EG0B 4C2MJ 1IUFA 1ZLKA 5IYDJ 1BJAA 4AC0A 2L4MA 4LB6B 1XMXA 1SMYF 4UHTA 3WHCA 1W5CC 2WC2A 1PDNC 3VB2A 5F08A 5D5VB 1UB9A 3J80Z 1SFEA 4OWRB 3D5LA 4XLPF 4MLOA 1O7FA 5EGOB 2ISZA 1Z1DA 4HV6A 3G1MA 1FP1D 1G3SA 1JUSA 3IH3A 4W97A 3WTSC 1FTZA 1K61A 1KQ0A 3BZKA 4M9XA 2OA4A 1SC7A 4AD9A 2G7UA 4E7ZA 2MD0A 1LEAA 1APLC 4XKBA 2K02A 4HBLA 3WODF 4FT8A 1MBHA 1TTYA 2BVMA 1PUFB 1X1BA 2R7XA 3LMMA 1DP3A 1KU2A 3L2WA 2LBFA 3I4MJ 3V8KA 2O61A 2COBA 3PNVA 5LRRA 4ABZA 3J7ZI 2EA4A 1T0FC 1KGSA 2FOWA 4F93B 2PLYA 2X1CA 4GRIA 3E7LA 4ITVA 3KP5A 2O7OA 3FF5A 3K7AJ 4I98B 2R7VA 3CCUI 3LWFA 3U21A 2FD5A 2VJJA 2DXIA 3KEQA 1VQ9I 3TDUC 1P7IA 2FBHA 4M74A 5HOOA 2H1LA 3HYIA 1DU6A 1DGRM 2LVSA 2NS7A 2QM3A 2WAQN 4E6KG 2HVRA 3HSEA 4YIRX 2DK8A 5FKKA 1NG6A 4FETA 2VI6A 3HPHA 1WI3A 4GFBA 2Y0MA 3E5XA 1S7OA 2EV0A 3E3VA 1L3LA 4NNJA 4XONA 3RTRA 2CUZA 1YTYA 2XF6A 1T38A 4MHGA 3F8CA 5FLMJ 3RZOJ 5M5YJ 2KDZA 4IZZA 3S1RJ 3FBIB 2L7FP 5L3BA 3ERMA 2FNPA 5EYRA 5E1XA 4M3EA 4EGYA 2HOEA 2KHMA 4YELA 2LREA 4PZJA 3AL0C 4ENNA 4AM3A 1QRYA 2K85A 4QIWN 2IGMA 3PSIA 5D8KB 3OWTA 2CRGA 1ZG3A 1IXCA 2VOPA 3I59A 2IVMA 3HGYA 1Y0NA 2FJ1A 2LFBA 3OYCA 3CCRI 3GTKJ 3H5AA 2A6EF 1BI0A 3BCAA 4NUBA 4A93J 3DKWA 3LNQA 3I58A 2MSYA 2BXYA 2E36A 2L7KA 4MTDA 3MZ8A 2A07F 1ZK8A 2UXXA 1BW6A 1JHHA 1OKRA 3I53A 2ZXHA 3V4GA 2D45A 3WTUC 3PO2J 3VYTB 1E17A 1SFXA 3IUOA 4BHCA 3FHZA 1MMSA 5J1YA 1TWCJ 2WWYA 1PP8F 2X6YA 2VPLA 1BBYA 4BEHB 3I56I 2GXAA 2K40A 3S2DJ 3E0JB 2MYSA 4N4NB 2L54A 1ZRCA 2EQRA 1AKHB 1WFXA 5J1RA 2JA8J 3L2RA 3J7AO 3VSLA 2A6TA 4IO9F 4RB0A 1WQ2A 5F04A 2GA1A 2JMWA 2ESHA 4KIGA 5K1YA 5HS8A 3HL2A 1Y8RB 4IHXA 2DFEA 2PG4A 4KT6A 5EZGA 4BXFA 4GCVA 3NARA 2EINH 2ELHA 2XUBA 1KQ9A 3KZIC 1R1UA 3S17J 1TNTA 5FO5A 2W48A 1DUXC 5BQTA 4HA8A 2RVCA 4DZJA 4ESBA 1TWGJ 3ABUA 4A3DJ 1KU9A 5B66C 5DEQA 4KMFA 3ZMVA 3GCMA 1E3PA 2B7EA 3GO5A 1Y1WJ 3IKTA 1D8KA 1D0YA 2MLKA 5AONA 1BL0A 2KISA 1P7JA 3U1DA 1K4SA 1N78A 4JX4A 3C2GA 2MBFA 4OMZA 4U0WA 2VT3A 1XD7A 5J47A 3W6JB 1FP2A 1ETQA 3C2HA 1BW5A 1AU7A 1LDJA 1QZZA 3M07A 4L0YB 5ED4A 3W3CA 1WJCA 3FMQA 4A0XA 3QU6A 2DTZA 4FE4A 2X1DA 1B72B 5IOYA 5F0CA 2MD5A 2P0WA 2ICWG 3K69A 5E1WA 4AWXB 1FJLA 5LRSA 1FBUA 4Y4RA 1QNTA 4XR6A 1USSA 3KLOA 4BUPA 2XROA 5EG0A 4FCYA 2AXTC 4G94A 4DYCA 1WSUA 2XSJC 3G2BA 4LG3A 4EMSA 1YRNB 4CCLA 5LEJA 1HBXG 3IAS2 3Q0VA 1F1ZA 3IH2A 1UHMA 5CVJA 3K70C 2JWTA 2ZXWH 2MABA 4AIHA 5KCMA 3FXUA 3WHBA 2IP2A 1SFOJ 3KYLA 4UV8A 4HDUA 1MDMA 2TDXA 2VXZA 1TW2A 3GW2A 3OIQA 2DT7B 4MEYF 3JAMK 3K10A 2VT2A 1R5GA 2EZLA 4LG0A 5DM7F 2JPBA 3PO3J 4L9JA 1ZG1A 5BPIA 2KJCA 2XV4S 5HLIA 4A5MA 1Z6TA 2KRHA 4PCQA 4HLYA 1K78A 2ID6A 3OSFA 4XKWA 4LJZF 3A0HC 2L9SA 2VQLA 2XAUA 3A02A 4RGSA 3COAC 5CKTA 5E3NA 1IAWA 1FX7A 1RKTA 2DCEA 5CPRB 2LOOA 4L5IA 1WH7A 1ZAOA 2W82A 1IN4A 4A3EJ 2RKHA 1JXSA 3E5UA 3GUDA 1UFMA 4U7DA 3L09A 3M4OJ 2K9MA 4MQ9F 1H0MA 3I3LA 4IHVA 1ERDA 4HDVA 1Y39A 3F72A 4KN4X 1IRGA 3CD6I 3OYKA 1F9NA 3CCJI 1Y0UA 2R5YB 2STTA 2ZMEB 3H3VK 2V9PA 3HUGA 2XGCA 2X6OA 4DBQA 2M1BA 2BVLA 2WB1A 1H89C 1KZHA 4ETSA 1WPKA 2DFHA 3AG1H 2YSRA 1UMQA 1Q1HA 3HZJA 2WTEA 2LKXA 1N77A 2JZYA 3A01A 3CC2I 1YX3A 5DCMA 4B3XA 3SZPA 1O3SA 2PEXA 2OUMA 2W1OA 3ABMH 3PJRA 1GVJA 3TP3A 3HEFA 3LAJA 3K1PA 5GAEJ 3AG2H 1H9TA 2XAGA 3BZ6A 3HRTA 2XRNA 4KN7X 1S72I 1LVKA 3KEYA 3ZOBA 5JR3A 1ETWA 2X0LA 3T1BA 4A3KJ 1RR7A 5J1UA 2O8KA 4ANJA 1HW1A 5FLXK 1OCZH 2W7NA 3I71A 1YJNI 1JTYA 3E6BA 3ZP5A 5FB2A 4RAYA 4AIJA 1TWFJ 2CH0A 2X9DA 4YIIA 1YW8A 1VI0A 2LK2A 2VL8A 1I6XA 1O7LA 4NHJA 1F36A 4AU7A 3KP3A 1ONVA 5BS6A 2CW8A 4C2TA 4PSXA 2K9QA 2OV7A 1ZTRA 4QWQA 3GTQJ 4JK1X 2R92J 4HAMA 5LHHA 5FRMA 2VUMJ 1UHWA 2RNGA 2BBYA 1FYKA 2IS2A 3RJPA 1R49A 2A61A 2F4MB 2KLOA 3V42A 1JGSA 5HS7A 3DP7A 2PMHA 3FKIJ 2ZJQF 2LLKA 3BTCA 2W00A 1W7PB 1J7KA 5GP9A 2L02A 4E7LA 3BR6A 1ZRDA 3HKZA 1E0EA 1OYIA 1A6IA 4HNVA 3Q5FA 1T2KA 4NC6A 2M0CA 4DBRA 4UUTA 4YRVA 3RKQA 2QQ8A 3MKWB 2HQRA 4UB8C 2O03A 1A6QA 1U5TB 2IGNA 3BG5A 1WWXA 2DU9A 2K3PA 2R7RA 2DMTA 1O57A 4HRIA 3ZN0A 1QGPA 1TQIA 1LFBA 2H94A 4G7HF 2L3DA 1BR1A 3BTJA 3GTLJ 1K6OA 5IPAA 2V26A 1ZLJA 2CYYA 1ZR2A 3FXRA 1A04A 3LSMA 5FD6A 3B73A 2ECBA 2O3FA 3PNTA 3OV8A 2JN6A 3CLOA 3HHHA 4ENJA 1V55H 5M5WJ 2YS9A 4B43A 4B47A 4P1WA 4EATA 2L7ZA 1Z21A 3D0SA 4U7BA 1P4XA 4NC8A 3BOQA 3O3KA 1VQLI 1LKXA 2VXDA 4ESJA 2JTVA 3SDGA 1RPWA 4JOMA 3KZZA 5GPCA 1OJLA 1Z6RA 1XG1A 2E35A 2ME0A 4G12A 3GFIA 2VIXA 5H6RA 3L1PA 5H2FC 1KONA 4Z6YA 4A0YA 2V1DA 2HR3A 3B6CA 3CC7I 3RSNA 2E7XA 2VJIA 4CZZA 3JRDA 3ERED 3BTLA 1S29A 2CQNA 3IH4A 1YQAA 2XPVA 3GYHX 2FMYA 2JT1A 1Y6IA 3PNYA 4A6DA 4AYBA 4LK0F 4BQQA 3IV5A 3OYBA 3HOXJ 4XKVA 2VJ5A 2X6XA 3M8EA 1IN8A 2A05A 3OYFA 2JPCA 4LLGF 1R22A 2OU2A 3QRFF 1KYWA 4UUVA 3I5UA 3FK6A 4ZYEA 2OQRA 4ZTFA 1G8XA 1NHAA 1TQPA 3OOPA 4D1QA 2F4OB 3MMYB 4LFUA 4D7NA 1EF4A 1Z3YA 4B4CA 1X2MA 1AKHA 1OISA 3S2HJ 3I54A 3J7AY 4A3CJ 1YIJI 5FFXA 2EA2A 1R1VA 3HOWJ 4PUSA 1XMAA 3Q9SA 2CWEA 4IHSA 2FSWA 3EUHA 4RB3C 1KA8A 4ZDLA 1TWAJ 2COMA 1FIPA 1Z0XA 4M6VA 5D6FA 2M87A 3A2KA 2VQGA 3KCCA 4PJMA 1R4NB 2AXLA 1OCPA 6PAXA 3IWZA 5B5EC 1NK3P 2GOXB 2DJIA 3SHFA 1YITI 1VFCA 2RQQA 4BJTA 1T98A 3WTWC 3F23A 2MH2A 2HQ5A 4WX9A 4Q4ZF 5B3SH 1ZGAA 4XLEA 1MH4A 4WK8F 3DLLF 4LG0B 4IOAF 1I6HJ 3K4JA 5GAGJ 3TEDA 1IO2A 2RNJA 4WCGA 2JJ7A 2HPIA 3HXLA 2HVQA 2J5OA 2STWA 2Q2EB 3I4PA 5IYBJ 3DEWA 1MMGA 3MEXA 2W84A 3LSGA 2JVGA 2WADA 1J2XA 1P4AA 4WXHA 5M3MJ 3LFKA 2IA0A 1WH5A 4OU0A 4HV5A 2VN2A 3FX3A 1Q1VA 3VODA 3AG4H 4L0ZB 2VC0A 3ZQLA 2PBIA 3HSRA 4ENMA 4PJNA 3H0GJ 3PSFA 2XKOA 3IRRA 5B1BH 2MC3A 1YRNA 1MDMB 2CJJA 3I9V2 2QBYA 4CYCA 2Z9OA 2MC4A 2QEXI 4RB1A 2JUGA 4Y7NJ 5CVVA 1HSJA 2K4BA 1X1CA 2XVCA 3E6MA 3UR3C 5F1JA 2XHKA 1XTAA 3G3ZA 1BC7C 2OPTA 3DKXA 3H5RA 3X2QH 4BE1A 2HYFA 2IS4A 1VF9A 4ON0A 2IJLA 3F8BA 1DQUA 4DOZA 5DCFA 1CGPA 1V5FA 3MD2A 2QQBA 3LQQA 5EZHA 4CCJA 3GZ6A 1R7JA 1K78B 1X4PA 4IXAA 5ILSA 3SZGA 4J00A 4DIQA 2F5DA 4M72A 5JHUA 1JKQC 5HDGA 2JQ7A 1V4RA 3A1YA 4F3QA 3JW4A 1T39A 2ZNZA 5GAHJ 3F0CA 2DMQA 5JVTA 3K1NA 2V4JC 4BE2A 1H8AC 3HPGA 4JP0A 4ZJZA 1REPC 4B8XA 2R93J 2R5ZA 2CU7A 3KE2A 2VLAA 1WVRA 2CQ7A 1CQTA 1HA8A 2A69F 3EUHC 3DFGA 1ZGJA 3M9AA 3B02A 4RGUA 2P7CB 2I8DA 3SFIA 5J3LA 5L3CA 1QBJA 3WG7H 3VOEA 2EZKA 1BI1A 2QVOA 2HWVA 2UUZA 4AIDA 1IUYA 5DUKA 3CJRB 3O8HA 1DP7P 1VQNI 1M1EB 2LBFB 2IT0A 4XBFA 3SZTA 1MJBA 1BC8C 2EWNA 4IOCF 4R8HA 2ZSIB 4IPAA 1GXQA 4NQWA 3EYYA 1TLHB 2LMDA 4HSRA 1IC8A 1OPCA 2ZNYA 3S3OA 2DAOA 5K7ZA 2QBYB 4XOTA 4LIUA 4EJOA 4CH7A 3CMYA 4EJTA 3P9CA 2M8GX 1MGTA 2HI3A 1T56A 3JREA 4OMYA 1TW3A 3HIFA 3NQOA 5DUIA 3CJTB 1FLIA 2LC2A 1Z3XA 1EH7A 2M0MA 2YR2A 2GIZA 3ECOA 3BC8A 2HU9A 3TP0A 4M3DA 1CF7A 4Z2YA 2GOMA 5HLTA 2RGVA 4Q48A 4M3FA 3OMYA 2ZXIA 2DLLA 3MQ0A 2DK5A 1P4WA 2ZBKA 2ZXJA 2QENA 3RPQA 2VPRA 1XGSA 4P5OA 4ZZLA 2E7WA 2QF7A 3HC7A 2OF7A 2VOOA 2RN7A 4M71A 1YI2I 2E19A 3M1CA 3LA7A 5FGMA 3DTKA 1X19A 1P92A 4HX4A 1MMAA 2IEKA 4D5FA 2WA0A 5IP6A 3TW7A 3M8FA 1N75A 5HS9A 3ZMDA 4YEJA 4IF4A 4L9TA 2UZKA 4BACA 1EH6A 2KMUA 1BOAA 5GPAA 2IXSA 4CHUA 5D8LB 1TBXA 3A0BC 1SAXA 2H27A 4GO1A 3WG9A 2F4IA 5ERIA 5TJJA 2IW5A 2M9HA 2Q0OA 3H35A 2V9VA 2W4SA 4Q47A 2OTJI 4V2FA 1YLFA 2AQEA 3FZVA 1LPQA 4M3BA 1R1TA 3CCEI 1LFPA 3K9TA 3FXJA 3QP5A 2NS0A 2ZJRF 4FISA 4NQWB 1XPXA 3GTOJ 5CYVA 4D9JA 4CCKA 2O5RA 3BG9A 5EF6A 3JCUC 3SQNA 3SEZA 3HOUJ 1LUJB 4CYDA 3HTUA 3KP7A 3OL4A 4KJZA 3HOSA 2BGCA 1JI8A 3W6VA 2HXIA 2M34A 2QGUA 1A35A 3G1LA 1I5ZA 5C44J 3IHUA 3QYBA 4IHTA 4C9YA 1R36A 1W5SA 2HYJA 3CZ6A 4P96A 2Q8KA 3ZQFA 3S1MJ 1IV8A 3MKZA 3CP8A 2DMUA 3DEUA 3FKJA 1TQMA 4M6YA 5J40A 1T6SA 4GYGA 4GYIA 2OZ6A 3DF8A 1IW7F 4MFEA 4LMYA 1VQKI 3RYPA 2P6TA 3CUQC 3AKZA 1T08B 4BYYA 1ZREA 1QHHD 5HNHA 2EB7A 3PUBA 5BPDA 2R7QA 4XRMA 3BJ6A 4FTHA 5K5RA 4HEA2 2OD5A 4XRSG 4XSZF 2LP0A 3PQKA 5EGOA 3C7JA 3SFZA 2R7OA 4N0BA 1EV7A 3ZMTA 1VQ8I 1E3HA 4DYRA 3CJNA 1DGWY 2RQPA 3Q9VA 3SEQA 5BOXA 5LHIA 3K70D 1X1DA 4A5NA 4DW6A 3HJEA 4RLQA 5DYMA 4BY1J 1IG7A 4HF0A 2BE5F 1XMKA 4BXXJ 4I99C 2QA4I 4ENKA 1LJ9A 2MLGA 2LNBA 3GXOA 3WE3A 4M6XA 5ICCA 4KYWA 1WI9A 2DQLA 1W36C 2BY3A 5FLXZ 1MJAA 2XAJA 1S6LA 3ASOH 1MMDA 1QO0D 5E17F 3ZQIA 3FXOA 3TO6A 3GTPJ 3CLQA 2XRLA 4DGWB 4EJVA 2F6CA 3ELKA 2IS1A 1FBSA 1MBJA 3TW6A 1IRFA 1HKTA 3BCBA 5F6FA 1U6GA 1J75A 2DA1A 3S93A 1IF1A 2ID3A 3HRUA 4E70A 2C6YA 2CUEA 2BZTA 5IOZA 5IT9K 4BS9A 4G6QA 2HGCA 2LY1A 5FFZA 2WBMA 3T0YA 1RUOA 3R0AA 5LGUA 1NTCA 2QSGX 4IRIA 4KNYA 2FF4A 3LFUA 3MKLA 1MBFA 2HOAA 4S05A 2OBPA 3N97A 2I10A 1BR2A 3F8MA 4XLNF 2F5FA 1Y56A 5FROA 2CW0F 3ULQB 1JT0A 2QKMB 1FMVA 2EK5A 4XN0A 1W5TA 3BWGA 4HW0A 5HVQC 4KISA 4GGGA 2G9WA 1LE8A 1R23A 3FMRA 2X85A 5H6QA 1IXRC 2LR8A 3CUOA 5JLXA 2BY2A 2F5CA 4IRGA 2UV1A 1SD7A 1PP7U 2V1UA 1XSXA
chains in the Genus database with same CATH topology
1K7AA 4OINF 5ICGA 2KKOA 4HOBA 4A0ZA 1ZYRF 3P9KA 1ZG5A 2R3SA 2K4JA 3LA3A 2HZTA 5DCMB 1FYLA 1OYYA 3FWEA 3V7RA 1QZYA 4ZZDA 5LGTA 2DQRA 4YFXF 2W25A 1UCRA 3H3ZA 3EQLF 4M9ZA 1K79A 3LQRA 3DXJF 1J59A 3ZMUA 3RPUA 1KQ8A 4D0PA 3HOTA 2MH9A 5CVIA 2RDPA 2Z99A 3LAPA 1G3YA 3TQNA 4KT5C 1KU7A 2GZWA 5E20A 5HLHA 2JSCA 3R0JA 5L3FA 3GWZA 2XIGA 1LDDA 4OIPF 3IKVA 2FEZA 3GZ5A 4N9IA 2A5YB 2LSOA 4LD5A 1U78A 2DPDA 2YX7A 1SD4A 2QZ8A 3MCZA 4UVCA 1R00A 2VE8A 1I1GA 5LLQA 3IRQA 5LEKA 1FZPB 2QUFA 4FHTA 4AVPA 4ZYGA 4OIOF 3CO6C 4H0EA 5HLGA 3KZYA 1XN7A 4F7ZA 3ZN1A 5DD4A 2CGPA 4JQFA 2KIUA 4LB5A 2PFBA 4O6JA 1O3TA 4MGRA 1EH8A 2BV6A 5D5XB 2DO7A 4PDKA 2CFXA 3DPLC 3H92A 3HSFA 5K5OA 2P5KA 4KICA 5DV5A 2Q2EA 3WGGA 3WU1B 2PI0A 1JHFA 2M45A 2X4HA 2PJPA 3TO7A 4XRFA 1RUNA 4EM1A 1ZRFA 3F8FA 3C3WA 4LLNA 3WTTC 5KK1A 3GFLA 2GXBA 4FX0A 2HFHA 1U5TC 5FD5A 3EYIA 1FBQA 3TOBA 1XCVA 3SXYA 1GHCA 3LSTA 2XASA 2YX4A 5ICFA 5LHGA 5KVRA 4G7ZF 3F8NA 2DT5A 2P8TA 5CVUA 3E5QA 2RC4A 1BIAA 4Y17A 5ICEA 3FMSA 4YIFA 3ABTA 1TNSA 5HDNA 2FU4A 3WGIA 1V3FA 2CG4A 1B9MA 4ESFA 5F1RA 1U5TA 3WGHA 4M9SA 3BROA 2A68F 2DFIA 4RGXA 2LKPA 3IC7A 2XAHA 4A12A 3KFWX 4BXUA 2FQ3A 4L9NA 4HX8A 3ZMZA 3G73A 3ISPA 4O5VA 1YS7A 3RKXA 1C0WA 2EV6A 2W57A 1RZ4A 3F21A 3DV8A 3TKYA 4EQQA 2EFQA 2FRHA 2H6BA 4TV7A 5E18F 3GVAA 1KYZA 2XKPA 1J5YA 2Y75A 5K5QA 4QLCU 1Z7UA 2L4AA 5L3EA 3BPVA 4MNUA 2ISYA 3U9GA 2DI3A 2D1VA 2PQ8A 5AIQA 3C18A 3KP4A 1YYVA 2ETHA 4UVAA 2FOKA 4LK1F 1W7PD 3CDHA 3RKWA 1CF7B 1X3UA 4WWCA 2GIVA 4BH9A 5DDGA 2KJBA 5E8GA 2GAUA 3L2CA 1D3YA 3NEUA 2QLZA 3R60A 1HKQA 3L9FA 4UVBA 3LA2A 2ZFWA 4YFKF 4WXCA 4Y13A 3F22A 4L9VA 2Y48A 5ILUA 4ZYHA 2VBXA 1IZ1A 4HYEA 1R58A 3KLNA 4UNOA 5D6EA 3V7SA 5HDKA 1IN6A 2ESNA 1W7PA 3ECHA 3TGNA 3QPTA 5JI6A 5L3DA 5H20A 5LGNA 1JE8A 3DPTA 1FC3A 4LLLA 4BNCA 2YU3A 2QQ9A 3E6DA 4KUMA 5AIPA 2H6CA 5J8FA 4DNCA 2YPRA 2ACJA 2QQAA 1AOYA 1XGMA 4HQMA 4CDGA 2HKXA 3MAJA 5IT3A 2BYVE 2LF7A 1LDKB 5DD8A 4S04A 1WKMA 2M8EA 3NRVA 4O3MA 3GFJA 1T0FA 3V7CA 2DPUA 2GQQA 3P7NA 3BY6A 4AIKA 1Z9CA 3FXQA 1FNNA 3J81Z 3AAFA 2LF8A 1F5TA 2NRAC 1RNLA 4CO8A 4OIRF 2KIMA 3C1DA 2P7VB 1ON2A 4U0YA 3JSPA 3FM5A 4A2UA 2ZKZA 1IN7A 1FOKA 3PFIA 2EFOA 3GF2A 2K27A 3RI4A 3HRMA 3ZQ7A 4BQAA 4L18B 1FYMA 1SD5A 2HS5A 3ROUA 2L01A 3K2ZA 3WTYC 3MZYA 1OR7A 2FMLA 2FBIA 4KA4A 1B6AA 4KDPA 4HQEA 3ML6A 4BHBA 1SMTA 2Z3YA 4YFNF 2ZMEA 1RIOH 4M73A 2NNNA 3CUQA 3MFKA 5E8IA 3HTSB 1LB2A 2CQKA 2H09A 1J0RA 5LBQA 4PGHA 1FPQA 1O3RA 2EJRA 1E2XA 2WV0A 1STZA 2EFWA 3I59B 3CUQB 3J80K 3V8JA 2K7LA 2VBWA 1LEBA 1OYWA 4ASNA 2EFNA 1ZN2A 1Z05A 5F64A 5CJ9A 5D5WB 4GXOA 1YW9A 2OZUA 2V79A 3WTZA 4UV9A 5E1ZB 2AS5F 4I02A 1U2WA 2ADUA 5CVRA 3HRSA 2A6HF 2XAFA 4BHPA 1FSHA 3QOPA 2ZO4A 1ODDA 2CO5A 3R61A 4I2OA 4BAYA 2UXNA 4I0AA 1D8JA 2K86A 5TRDA 3R4KA 4KMUX 2Z33A 1HSTA 3F6OA 3O2PE 1ULYA 1J9IA 4U0VA 1MKMA 4MQVA 2GA2A 4NB5A 4OIQF 1DDNA 5JFRA 1QQIA 3E6CC 2IA1A 1QPMA 3I0TA 1PUEE 2UWMA 2KIFA 1B59A 1G3WA 1F4KA 5J8CA 4EJUA 2M5WA 3GFMA 1H9GA 1Z91A 3K0LA 3U2RA 2B0LA 4CGZA 1ZH5A 1DPRA 1FT9A 4P9FA 4EJWA 1VTNC 4G7OF 1B9NA 4L5JA 2VBZA 3R6SA 2HTSA 5CLSA 2VONA 3L7WA 1SFUA 2P5LC 3H3UA 3M7GA 3CO7C 3TDZC 2A3SA 5J6XA 4IVNA 2VC1A 1S7AA 4RAZA 3BDDA 3IWFA 1I1SA 4N9HA 3RYRA 3T8RA 3ZPLA 1S3JA 1HQCA 4KIBA 1IXSB 2F2EA 2FE3A 1XDSA 4I09A 2NNYA 1BM9A 1ZARA 2M30A 3REOA 1YW7A 1BI2A 4I0BA 3TOAA 1XGNA 1BN5A 4MTEA 2PMUA 2VODA 3WU0A 4KFCA 1HW2A 1BIBA 3GEZA 3KEOA 4OOIA 1ZHFA 2FNAA 1SD6A 1L0OC 2R7DA 1LVAA 2J5PA 2FA5A 3FM3A 5D4RA 1WRJA 2D1HA 4A6EA 4HF1A 1O3QA 2W85A 2HQNA 5BMZA 1U8RA 3KP6A 3WE2A 2FBKA 2E1CA 1S8NA 2DW4A 4ZYDA 3I64A 3JAMZ 2FXAA 1YFHA 1KU3A 4G9YA 3RDIA 3ZMSA 4XSXF 4EM0B 3O6BB 2EFPA 2BEOA 2Z5UA 1AWCA 1D5VA 4I01A 1ON1A 2XAQA 3N4MA 1XSDA 2NAZA 3EETA 1P6RA 3DQVC 1W4MA 2O6GE 1HXDA 2R7FA 2F5EA 4IRHA 3KP2A 4R79A 1MJ9A 2IRFG 2OQGA 1DPUA 1G6NA 4ZH4F 1U3EM 2OAZA 3BP8A 4IJAA 4WF2A 1HW5A 1R5HA 1USTA 4CICA 2ZCWA 1XSVA 3QPHA 1YG2A 2IA2A 1XCBA 2KRFA 3S2WA 1BI3A 1G3TA 1B1BA 2NYXA 3TO9A 4U88A 2O8XA 2QWWA 4UXNA 1XDUA 5IT9Z 1LNWA 4CXFA 2V1XA 2O0YA 3F3XA 3V8LA 2P4WA 4G8XA 2PN6A 3QAHA 2HTJA 2IPQX 3KETA 4MEXF 4PGGA 3MWMA 4HF2A 2P6SA 4K2EA 3VEPA 4I7HA 4RS8A 2GXGA 2HDCA 4LGWA 4EGZA 1OMIA 2GWRA 4KIFA 2HYGD 3L00A 4HZFA 2MA3A 4WXDA 2LDUA 5L3GA 3BJAA 2D2WA 2ZJ2A 3VFZA 3RKYA 3PQJA 2W24A 5ILVA 1FSEA 3HHGA 3T8TA 3WTVC 2CSOA 1FWZA 2G7HA 3M1EA 3EDPA 1HKSA 3J81K 3P9IA 1YO5C 4Y15A 4DQ2A 2EV5A 1FY7A 3JTHA 3BJOA 3QP6A 2DTRA 1B4AA 1YIOA 4HLXA 3F6VA 2XGXA 4Q5SF 3WTXC 3K1MA 3GLXA 4YG2F 4RB2C 3GX4X 3BPXA 3JTGA 5D5UB 5A2QK 2V6CA 1GXPA 2HKOA 2P5VA 4RGRA 1RI7A 3W6KB 3JSOA 1MZBA 5EEHA 2QYOA 4R1HA 4FX4A 2VBYA 5A2QZ 2RV8A 4P9UA 2E1NA 1XGOA 3E97A 1XB4A 4JBAA 4P55A 5D4SA 1IN5A 4EM2A 4HX7A 1LQ1A 2HEOA 1I27A 1P2FA 3RIRA 3T5XA 1G4DA 3IL2A 3CTAA 3MZHA 2VE9A 4B09A 1MD0A 2JRTA 1YS6A 5EEGA 3QU3A 4EVIA 2DBBA 4EV0A 4G6DA 1ZLKA 1BJAA 2L4MA 4LB6B 1SMYF 4UHTA 2WC2A 1PDNC 3VB2A 5D5VB 1UB9A 3J80Z 1SFEA 3D5LA 4XLPF 1O7FA 2ISZA 1Z1DA 4HV6A 1FP1D 1G3SA 3WTSC 1KQ0A 4M9XA 2OA4A 4AD9A 2G7UA 1LEAA 2K02A 4HBLA 3WODF 4FT8A 1TTYA 1KU2A 3V8KA 2O61A 5LRRA 2EA4A 1KGSA 2PLYA 3KP5A 3FF5A 4I98B 3LWFA 3KEQA 3TDUC 2FBHA 4M74A 5HOOA 3HYIA 2QM3A 3HSEA 2DK8A 2Y0MA 3E5XA 1S7OA 2EV0A 3E3VA 1L3LA 3RTRA 1YTYA 1T38A 4MHGA 3F8CA 5L3BA 2FNPA 5E1XA 4EGYA 2HOEA 4PZJA 4ENNA 5D8KB 1ZG3A 1IXCA 2VOPA 3I59A 2IVMA 2A6EF 1BI0A 3DKWA 3I58A 4MTDA 2A07F 2UXXA 1JHHA 1OKRA 3I53A 3V4GA 2D45A 3WTUC 1E17A 1SFXA 4BHCA 3FHZA 2WWYA 1PP8F 1BBYA 2L54A 1ZRCA 3J7AO 4RB0A 1WQ2A 2GA1A 2ESHA 4KIGA 5K1YA 5HS8A 2PG4A 4GCVA 2ELHA 2XUBA 1KQ9A 1R1UA 1TNTA 5FO5A 1DUXC 5BQTA 4HA8A 2RVCA 4ESBA 3ABUA 1KU9A 5DEQA 4KMFA 3ZMVA 3GO5A 3IKTA 1D8KA 2MLKA 5AONA 3U1DA 4OMZA 2MBFA 4U0WA 2VT3A 1XD7A 3W6JB 1FP2A 1LDJA 1QZZA 4L0YB 5ED4A 3FMQA 4A0XA 3QU6A 2MD5A 3K69A 5E1WA 4AWXB 5LRSA 1FBUA 1QNTA 1USSA 3KLOA 2XROA 4G94A 1WSUA 4EMSA 5LEJA 1HBXG 1F1ZA 1UHMA 5CVJA 4AIHA 3FXUA 2IP2A 4UV8A 4HDUA 1MDMA 2TDXA 2VXZA 1TW2A 3GW2A 3JAMK 4MEYF 2VT2A 1R5GA 4LG0A 2JPBA 4L9JA 1ZG1A 5BPIA 2KJCA 2XV4S 5HLIA 4A5MA 1Z6TA 4PCQA 4HLYA 1K78A 4LJZF 4RGSA 3COAC 1IAWA 1FX7A 4L5IA 1ZAOA 1IN4A 2RKHA 1JXSA 3E5UA 3GUDA 4U7DA 1UFMA 3L09A 4MQ9F 1H0MA 4HDVA 3F72A 4KN4X 1IRGA 1F9NA 1Y0UA 2STTA 2ZMEB 3HUGA 2M1BA 4ETSA 2YSRA 1Q1HA 2WTEA 2JZYA 5DCMA 3SZPA 1O3SA 2PEXA 1GVJA 3LAJA 3K1PA 1H9TA 2XAGA 3BZ6A 3HRTA 2XRNA 4KN7X 5JR3A 2X0LA 3T1BA 5FLXK 1HW1A 3I71A 3E6BA 3ZP5A 5FB2A 4RAYA 4AIJA 4YIIA 1YW8A 1I6XA 1O7LA 4NHJA 3KP3A 1ONVA 5BS6A 4QWQA 4JK1X 4HAMA 5LHHA 1UHWA 2BBYA 1FYKA 3RJPA 2A61A 1JGSA 5HS7A 3DP7A 2PMHA 1W7PB 1J7KA 2L02A 1ZRDA 1OYIA 3Q5FA 1T2KA 2HQRA 2O03A 1U5TB 1WWXA 2DU9A 1O57A 3ZN0A 1QGPA 1TQIA 2H94A 4G7HF 2L3DA 1K6OA 1ZLJA 2CYYA 3FXRA 1A04A 5FD6A 3B73A 2O3FA 3OV8A 3CLOA 3HHHA 4ENJA 3D0SA 4U7BA 1P4XA 3BOQA 3O3KA 4ESJA 2JTVA 3KZZA 1Z6RA 3GFIA 5H6RA 4A0YA 2V1DA 2HR3A 2E7XA 4CZZA 3ERED 1S29A 1YQAA 3GYHX 2FMYA 2JT1A 4A6DA 4LK0F 3M8EA 1IN8A 2JPCA 4LLGF 1R22A 2OU2A 3QRFF 1KYWA 4UUVA 3I5UA 4ZYEA 2OQRA 1TQPA 1NHAA 3OOPA 4LFUA 3I54A 5FFXA 2EA2A 1R1VA 1XMAA 3Q9SA 2CWEA 4IHSA 2FSWA 3EUHA 4RB3C 1KA8A 2COMA 5D6FA 2M87A 3KCCA 2AXLA 6PAXA 3IWZA 3SHFA 1T98A 3WTWC 3F23A 2MH2A 4WX9A 4Q4ZF 1ZGAA 4WK8F 4LG0B 2RNJA 4WCGA 2J5OA 2STWA 3I4PA 3MEXA 2W84A 1J2XA 1P4AA 4WXHA 3LFKA 2IA0A 4OU0A 4HV5A 2VN2A 3FX3A 3VODA 4L0ZB 2VC0A 2PBIA 3HSRA 4ENMA 2XKOA 3IRRA 2MC3A 1MDMB 2QBYA 2Z9OA 4RB1A 5CVVA 1HSJA 2K4BA 2XVCA 3E6MA 2XHKA 3G3ZA 1BC7C 2HYFA 4ON0A 2IJLA 3F8BA 1CGPA 5DCFA 2QQBA 3LQQA 3GZ6A 1R7JA 1K78B 4IXAA 5ILSA 2F5DA 4M72A 5JHUA 5HDGA 1V4RA 1T39A 3JW4A 2ZNZA 5JVTA 3K1NA 1REPC 4B8XA 3KE2A 2A69F 3DFGA 1ZGJA 3M9AA 3B02A 4RGUA 2P7CB 5L3CA 1QBJA 3VOEA 1BI1A 2QVOA 2HWVA 1IUYA 5DUKA 1DP7P 2IT0A 4XBFA 3SZTA 1MJBA 1BC8C 2EWNA 4R8HA 4IPAA 1GXQA 4NQWA 3EYYA 1TLHB 1OPCA 2ZNYA 2DAOA 2QBYB 4EJOA 4EJTA 3P9CA 1MGTA 4OMYA 1TW3A 3HIFA 3NQOA 5DUIA 1FLIA 1EH7A 2YR2A 3ECOA 1CF7A 4Z2YA 2RGVA 4Q48A 2DLLA 3MQ0A 2DK5A 1P4WA 2ZBKA 2ZXJA 2QENA 3RPQA 1XGSA 4P5OA 4ZZLA 2E7WA 2VOOA 2RN7A 4M71A 3LA7A 5FGMA 1P92A 4HX4A 3M8FA 5HS9A 3ZMDA 4IF4A 4L9TA 2UZKA 1EH6A 1BOAA 4CHUA 5D8LB 1TBXA 1SAXA 2H27A 4GO1A 3WG9A 5ERIA 5TJJA 2IW5A 2Q0OA 2V9VA 4Q47A 1YLFA 3FZVA 1R1TA 3K9TA 3QP5A 2NS0A 5CYVA 3SQNA 4CYDA 3HTUA 3KP7A 3HOSA 2BGCA 1I5ZA 3IHUA 4IHTA 1R36A 1W5SA 2Q8KA 4P96A 3DEUA 1TQMA 4M6YA 1T6SA 4GYGA 4GYIA 2OZ6A 3DF8A 1IW7F 4LMYA 3RYPA 2P6TA 3CUQC 4BYYA 1ZREA 2EB7A 5BPDA 3BJ6A 5K5RA 2OD5A 4XSZF 3PQKA 3C7JA 3SFZA 4N0BA 1EV7A 3ZMTA 3CJNA 3Q9VA 2RQPA 5BOXA 5LHIA 4A5NA 5DYMA 4HF0A 2BE5F 1XMKA 4ENKA 1LJ9A 2MLGA 4KYWA 2LNBA 5ICCA 3GXOA 4M6XA 3WE3A 1WI9A 2DQLA 5FLXZ 1MJAA 2XAJA 1S6LA 1QO0D 5E17F 3TO6A 4EJVA 3ELKA 1FBSA 1IRFA 1HKTA 5F6FA 1U6GA 1J75A 1IF1A 3HRUA 4E70A 2C6YA 5IT9K 4G6QA 2HGCA 5FFZA 3T0YA 1RUOA 3R0AA 5LGUA 4IRIA 4KNYA 2FF4A 4S05A 2OBPA 3N97A 3F8MA 4XLNF 2F5FA 2CW0F 3ULQB 2EK5A 1W5TA 3BWGA 5HVQC 4HW0A 4GGGA 2G9WA 1R23A 3FMRA 5H6QA 1IXRC 3CUOA 2F5CA 4IRGA 1SD7A 1PP7U 2V1UA 1XSXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K7A A;  4OIN F;  5ICG A;  2KKO A;  4HOB A;  4A0Z A;  1ZYR F;  3P9K A;  1ZG5 A;  2R3S A;  2K4J A;  3LA3 A;  2HZT A;  5DCM B;  1FYL A;  1OYY A;  3FWE A;  3V7R A;  1QZY A;  4ZZD A;  5LGT A;  2DQR A;  4YFX F;  2W25 A;  1UCR A;  3H3Z A;  3EQL F;  4M9Z A;  1K79 A;  3LQR A;  3DXJ F;  1J59 A;  3ZMU A;  3RPU A;  1KQ8 A;  4D0P A;  3HOT A;  2MH9 A;  5CVI A;  2RDP A;  2Z99 A;  3LAP A;  1G3Y A;  3TQN A;  4KT5 C;  1KU7 A;  2GZW A;  5E20 A;  5HLH A;  2JSC A;  3R0J A;  5L3F A;  3GWZ A;  2XIG A;  1LDD A;  4OIP F;  3IKV A;  2FEZ A;  3GZ5 A;  4N9I A;  2A5Y B;  2LSO A;  4LD5 A;  1U78 A;  2DPD A;  2YX7 A;  1SD4 A;  2QZ8 A;  3MCZ A;  4UVC A;  1R00 A;  2VE8 A;  1I1G A;  5LLQ A;  3IRQ A;  5LEK A;  1FZP B;  2QUF A;  4FHT A;  4AVP A;  4ZYG A;  4OIO F;  3CO6 C;  4H0E A;  5HLG A;  3KZY A;  1XN7 A;  4F7Z A;  3ZN1 A;  5DD4 A;  2CGP A;  4JQF A;  2KIU A;  4LB5 A;  2PFB A;  4O6J A;  1O3T A;  4MGR A;  1EH8 A;  2BV6 A;  5D5X B;  2DO7 A;  4PDK A;  2CFX A;  3DPL C;  3H92 A;  3HSF A;  5K5O A;  2P5K A;  4KIC A;  5DV5 A;  2Q2E A;  3WGG A;  3WU1 B;  2PI0 A;  1JHF A;  2M45 A;  2X4H A;  2PJP A;  3TO7 A;  4XRF A;  1RUN A;  4EM1 A;  1ZRF A;  3F8F A;  3C3W A;  4LLN A;  3WTT C;  5KK1 A;  3GFL A;  2GXB A;  4FX0 A;  2HFH A;  1U5T C;  5FD5 A;  3EYI A;  1FBQ A;  3TOB A;  1XCV A;  3SXY A;  1GHC A;  3LST A;  2XAS A;  2YX4 A;  5ICF A;  5LHG A;  5KVR A;  4G7Z F;  3F8N A;  2DT5 A;  2P8T A;  5CVU A;  3E5Q A;  2RC4 A;  1BIA A;  4Y17 A;  5ICE A;  3FMS A;  4YIF A;  3ABT A;  1TNS A;  5HDN A;  2FU4 A;  3WGI A;  1V3F A;  2CG4 A;  1B9M A;  4ESF A;  5F1R A;  1U5T A;  3WGH A;  4M9S A;  3BRO A;  2A68 F;  2DFI A;  4RGX A;  2LKP A;  3IC7 A;  2XAH A;  4A12 A;  3KFW X;  4BXU A;  2FQ3 A;  4L9N A;  4HX8 A;  3ZMZ A;  3G73 A;  3ISP A;  4O5V A;  1YS7 A;  3RKX A;  1C0W A;  2EV6 A;  2W57 A;  1RZ4 A;  3F21 A;  3DV8 A;  3TKY A;  4EQQ A;  2EFQ A;  2FRH A;  2H6B A;  4TV7 A;  5E18 F;  3GVA A;  1KYZ A;  2XKP A;  1J5Y A;  2Y75 A;  5K5Q A;  4QLC U;  1Z7U A;  2L4A A;  5L3E A;  3BPV A;  4MNU A;  2ISY A;  3U9G A;  2DI3 A;  2D1V A;  2PQ8 A;  5AIQ A;  3C18 A;  3KP4 A;  1YYV A;  2ETH A;  4UVA A;  2FOK A;  4LK1 F;  1W7P D;  3CDH A;  3RKW A;  1CF7 B;  1X3U A;  4WWC A;  2GIV A;  4BH9 A;  5DDG A;  2KJB A;  5E8G A;  2GAU A;  3L2C A;  1D3Y A;  3NEU A;  2QLZ A;  3R60 A;  1HKQ A;  3L9F A;  4UVB A;  3LA2 A;  2ZFW A;  4YFK F;  4WXC A;  4Y13 A;  3F22 A;  4L9V A;  2Y48 A;  5ILU A;  4ZYH A;  2VBX A;  1IZ1 A;  4HYE A;  1R58 A;  3KLN A;  4UNO A;  5D6E A;  3V7S A;  5HDK A;  1IN6 A;  2ESN A;  1W7P A;  3ECH A;  3TGN A;  3QPT A;  5JI6 A;  5L3D A;  5H20 A;  5LGN A;  1JE8 A;  3DPT A;  1FC3 A;  4LLL A;  4BNC A;  2YU3 A;  2QQ9 A;  3E6D A;  4KUM A;  5AIP A;  2H6C A;  5J8F A;  4DNC A;  2YPR A;  2ACJ A;  2QQA A;  1AOY A;  1XGM A;  4HQM A;  4CDG A;  2HKX A;  3MAJ A;  5IT3 A;  2BYV E;  2LF7 A;  1LDK B;  5DD8 A;  4S04 A;  1WKM A;  2M8E A;  3NRV A;  4O3M A;  3GFJ A;  1T0F A;  3V7C A;  2DPU A;  2GQQ A;  3P7N A;  3BY6 A;  4AIK A;  1Z9C A;  3FXQ A;  1FNN A;  3J81 Z;  3AAF A;  2LF8 A;  1F5T A;  2NRA C;  1RNL A;  4CO8 A;  4OIR F;  2KIM A;  3C1D A;  2P7V B;  1ON2 A;  4U0Y A;  3JSP A;  3FM5 A;  4A2U A;  2ZKZ A;  1IN7 A;  1FOK A;  3PFI A;  2EFO A;  3GF2 A;  2K27 A;  3RI4 A;  3HRM A;  3ZQ7 A;  4BQA A;  4L18 B;  1FYM A;  1SD5 A;  2HS5 A;  3ROU A;  2L01 A;  3K2Z A;  3WTY C;  3MZY A;  1OR7 A;  2FML A;  2FBI A;  4KA4 A;  1B6A A;  4KDP A;  4HQE A;  3ML6 A;  4BHB A;  1SMT A;  2Z3Y A;  4YFN F;  2ZME A;  1RIO H;  4M73 A;  2NNN A;  3CUQ A;  3MFK A;  5E8I A;  3HTS B;  1LB2 A;  2CQK A;  2H09 A;  1J0R A;  5LBQ A;  4PGH A;  1FPQ A;  1O3R A;  2EJR A;  1E2X A;  2WV0 A;  1STZ A;  2EFW A;  3I59 B;  3CUQ B;  3J80 K;  3V8J A;  2K7L A;  2VBW A;  1LEB A;  1OYW A;  4ASN A;  2EFN A;  1ZN2 A;  1Z05 A;  5F64 A;  5CJ9 A;  5D5W B;  4GXO A;  1YW9 A;  2OZU A;  2V79 A;  3WTZ A;  4UV9 A;  5E1Z B;  2AS5 F;  4I02 A;  1U2W A;  2ADU A;  5CVR A;  3HRS A;  2A6H F;  2XAF A;  4BHP A;  1FSH A;  3QOP A;  2ZO4 A;  1ODD A;  2CO5 A;  3R61 A;  4I2O A;  4BAY A;  2UXN A;  4I0A A;  1D8J A;  2K86 A;  5TRD A;  3R4K A;  4KMU X;  2Z33 A;  1HST A;  3F6O A;  3O2P E;  1ULY A;  1J9I A;  4U0V A;  1MKM A;  4MQV A;  2GA2 A;  4NB5 A;  4OIQ F;  1DDN A;  5JFR A;  1QQI A;  3E6C C;  2IA1 A;  1QPM A;  3I0T A;  1PUE E;  2UWM A;  2KIF A;  1B59 A;  1G3W A;  1F4K A;  5J8C A;  4EJU A;  2M5W A;  3GFM A;  1H9G A;  1Z91 A;  3K0L A;  3U2R A;  2B0L A;  4CGZ A;  1ZH5 A;  1DPR A;  1FT9 A;  4P9F A;  4EJW A;  1VTN C;  4G7O F;  1B9N A;  4L5J A;  2VBZ A;  3R6S A;  2HTS A;  5CLS A;  2VON A;  3L7W A;  1SFU A;  2P5L C;  3H3U A;  3M7G A;  3CO7 C;  3TDZ C;  2A3S A;  5J6X A;  4IVN A;  2VC1 A;  1S7A A;  4RAZ A;  3BDD A;  3IWF A;  1I1S A;  4N9H A;  3RYR A;  3T8R A;  3ZPL A;  1S3J A;  1HQC A;  4KIB A;  1IXS B;  2F2E A;  2FE3 A;  1XDS A;  4I09 A;  2NNY A;  1BM9 A;  1ZAR A;  2M30 A;  3REO A;  1YW7 A;  1BI2 A;  4I0B A;  3TOA A;  1XGN A;  1BN5 A;  4MTE A;  2PMU A;  2VOD A;  3WU0 A;  4KFC A;  1HW2 A;  1BIB A;  3GEZ A;  3KEO A;  4OOI A;  1ZHF A;  2FNA A;  1SD6 A;  1L0O C;  2R7D A;  1LVA A;  2J5P A;  2FA5 A;  3FM3 A;  5D4R A;  1WRJ A;  2D1H A;  4A6E A;  4HF1 A;  1O3Q A;  2W85 A;  2HQN A;  5BMZ A;  1U8R A;  3KP6 A;  3WE2 A;  2FBK A;  2E1C A;  1S8N A;  2DW4 A;  4ZYD A;  3I64 A;  3JAM Z;  2FXA A;  1YFH A;  1KU3 A;  4G9Y A;  3RDI A;  3ZMS A;  4XSX F;  4EM0 B;  3O6B B;  2EFP A;  2BEO A;  2Z5U A;  1AWC A;  1D5V A;  4I01 A;  1ON1 A;  2XAQ A;  3N4M A;  1XSD A;  2NAZ A;  3EET A;  1P6R A;  3DQV C;  1W4M A;  2O6G E;  1HXD A;  2R7F A;  2F5E A;  4IRH A;  3KP2 A;  4R79 A;  1MJ9 A;  2IRF G;  2OQG A;  1DPU A;  1G6N A;  4ZH4 F;  1U3E M;  2OAZ A;  3BP8 A;  4IJA A;  4WF2 A;  1HW5 A;  1R5H A;  1UST A;  4CIC A;  2ZCW A;  1XSV A;  3QPH A;  1YG2 A;  2IA2 A;  1XCB A;  2KRF A;  3S2W A;  1BI3 A;  1G3T A;  1B1B A;  2NYX A;  3TO9 A;  4U88 A;  2O8X A;  2QWW A;  4UXN A;  1XDU A;  5IT9 Z;  1LNW A;  4CXF A;  2V1X A;  2O0Y A;  3F3X A;  3V8L A;  2P4W A;  4G8X A;  2PN6 A;  3QAH A;  2HTJ A;  2IPQ X;  3KET A;  4MEX F;  4PGG A;  3MWM A;  4HF2 A;  2P6S A;  4K2E A;  3VEP A;  4I7H A;  4RS8 A;  2GXG A;  2HDC A;  4LGW A;  4EGZ A;  1OMI A;  2GWR A;  4KIF A;  2HYG D;  3L00 A;  4HZF A;  2MA3 A;  4WXD A;  2LDU A;  5L3G A;  3BJA A;  2D2W A;  2ZJ2 A;  3VFZ A;  3RKY A;  3PQJ A;  2W24 A;  5ILV A;  1FSE A;  3HHG A;  3T8T A;  3WTV C;  2CSO A;  1FWZ A;  2G7H A;  3M1E A;  3EDP A;  1HKS A;  3J81 K;  3P9I A;  1YO5 C;  4Y15 A;  4DQ2 A;  2EV5 A;  1FY7 A;  3JTH A;  3BJO A;  3QP6 A;  2DTR A;  1B4A A;  1YIO A;  4HLX A;  3F6V A;  2XGX A;  4Q5S F;  3WTX C;  3K1M A;  3GLX A;  4YG2 F;  4RB2 C;  3GX4 X;  3BPX A;  3JTG A;  5D5U B;  5A2Q K;  2V6C A;  1GXP A;  2HKO A;  2P5V A;  4RGR A;  1RI7 A;  3W6K B;  3JSO A;  1MZB A;  5EEH A;  2QYO A;  4R1H A;  4FX4 A;  2VBY A;  5A2Q Z;  2RV8 A;  4P9U A;  2E1N A;  1XGO A;  3E97 A;  1XB4 A;  4JBA A;  4P55 A;  5D4S A;  1IN5 A;  4EM2 A;  4HX7 A;  1LQ1 A;  2HEO A;  1I27 A;  1P2F A;  3RIR A;  3T5X A;  1G4D A;  3IL2 A;  3CTA A;  3MZH A;  2VE9 A;  4B09 A;  1MD0 A;  2JRT A;  1YS6 A;  5EEG A;  3QU3 A;  4EVI A;  2DBB A;  4EV0 A;  4G6D A;  1ZLK A;  1BJA A;  2L4M A;  4LB6 B;  1SMY F;  4UHT A;  2WC2 A;  1PDN C;  3VB2 A;  5D5V B;  1UB9 A;  3J80 Z;  1SFE A;  3D5L A;  4XLP F;  1O7F A;  2ISZ A;  1Z1D A;  4HV6 A;  1FP1 D;  1G3S A;  3WTS C;  1KQ0 A;  4M9X A;  2OA4 A;  4AD9 A;  2G7U A;  1LEA A;  2K02 A;  4HBL A;  3WOD F;  4FT8 A;  1TTY A;  1KU2 A;  3V8K A;  2O61 A;  5LRR A;  2EA4 A;  1KGS A;  2PLY A;  3KP5 A;  3FF5 A;  4I98 B;  3LWF A;  3KEQ A;  3TDU C;  2FBH A;  4M74 A;  5HOO A;  3HYI A;  2QM3 A;  3HSE A;  2DK8 A;  2Y0M A;  3E5X A;  1S7O A;  2EV0 A;  3E3V A;  1L3L A;  3RTR A;  1YTY A;  1T38 A;  4MHG A;  3F8C A;  5L3B A;  2FNP A;  5E1X A;  4EGY A;  2HOE A;  4PZJ A;  4ENN A;  5D8K B;  1ZG3 A;  1IXC A;  2VOP A;  3I59 A;  2IVM A;  2A6E F;  1BI0 A;  3DKW A;  3I58 A;  4MTD A;  2A07 F;  2UXX A;  1JHH A;  1OKR A;  3I53 A;  3V4G A;  2D45 A;  3WTU C;  1E17 A;  1SFX A;  4BHC A;  3FHZ A;  2WWY A;  1PP8 F;  1BBY A;  2L54 A;  1ZRC A;  3J7A O;  4RB0 A;  1WQ2 A;  2GA1 A;  2ESH A;  4KIG A;  5K1Y A;  5HS8 A;  2PG4 A;  4GCV A;  2ELH A;  2XUB A;  1KQ9 A;  1R1U A;  1TNT A;  5FO5 A;  1DUX C;  5BQT A;  4HA8 A;  2RVC A;  4ESB A;  3ABU A;  1KU9 A;  5DEQ A;  4KMF A;  3ZMV A;  3GO5 A;  3IKT A;  1D8K A;  2MLK A;  5AON A;  3U1D A;  4OMZ A;  2MBF A;  4U0W A;  2VT3 A;  1XD7 A;  3W6J B;  1FP2 A;  1LDJ A;  1QZZ A;  4L0Y B;  5ED4 A;  3FMQ A;  4A0X A;  3QU6 A;  2MD5 A;  3K69 A;  5E1W A;  4AWX B;  5LRS A;  1FBU A;  1QNT A;  1USS A;  3KLO A;  2XRO A;  4G94 A;  1WSU A;  4EMS A;  5LEJ A;  1HBX G;  1F1Z A;  1UHM A;  5CVJ A;  4AIH A;  3FXU A;  2IP2 A;  4UV8 A;  4HDU A;  1MDM A;  2TDX A;  2VXZ A;  1TW2 A;  3GW2 A;  3JAM K;  4MEY F;  2VT2 A;  1R5G A;  4LG0 A;  2JPB A;  4L9J A;  1ZG1 A;  5BPI A;  2KJC A;  2XV4 S;  5HLI A;  4A5M A;  1Z6T A;  4PCQ A;  4HLY A;  1K78 A;  4LJZ F;  4RGS A;  3COA C;  1IAW A;  1FX7 A;  4L5I A;  1ZAO A;  1IN4 A;  2RKH A;  1JXS A;  3E5U A;  3GUD A;  4U7D A;  1UFM A;  3L09 A;  4MQ9 F;  1H0M A;  4HDV A;  3F72 A;  4KN4 X;  1IRG A;  1F9N A;  1Y0U A;  2STT A;  2ZME B;  3HUG A;  2M1B A;  4ETS A;  2YSR A;  1Q1H A;  2WTE A;  2JZY A;  5DCM A;  3SZP A;  1O3S A;  2PEX A;  1GVJ A;  3LAJ A;  3K1P A;  1H9T A;  2XAG A;  3BZ6 A;  3HRT A;  2XRN A;  4KN7 X;  5JR3 A;  2X0L A;  3T1B A;  5FLX K;  1HW1 A;  3I71 A;  3E6B A;  3ZP5 A;  5FB2 A;  4RAY A;  4AIJ A;  4YII A;  1YW8 A;  1I6X A;  1O7L A;  4NHJ A;  3KP3 A;  1ONV A;  5BS6 A;  4QWQ A;  4JK1 X;  4HAM A;  5LHH A;  1UHW A;  2BBY A;  1FYK A;  3RJP A;  2A61 A;  1JGS A;  5HS7 A;  3DP7 A;  2PMH A;  1W7P B;  1J7K A;  2L02 A;  1ZRD A;  1OYI A;  3Q5F A;  1T2K A;  2HQR A;  2O03 A;  1U5T B;  1WWX A;  2DU9 A;  1O57 A;  3ZN0 A;  1QGP A;  1TQI A;  2H94 A;  4G7H F;  2L3D A;  1K6O A;  1ZLJ A;  2CYY A;  3FXR A;  1A04 A;  5FD6 A;  3B73 A;  2O3F A;  3OV8 A;  3CLO A;  3HHH A;  4ENJ A;  3D0S A;  4U7B A;  1P4X A;  3BOQ A;  3O3K A;  4ESJ A;  2JTV A;  3KZZ A;  1Z6R A;  3GFI A;  5H6R A;  4A0Y A;  2V1D A;  2HR3 A;  2E7X A;  4CZZ A;  3ERE D;  1S29 A;  1YQA A;  3GYH X;  2FMY A;  2JT1 A;  4A6D A;  4LK0 F;  3M8E A;  1IN8 A;  2JPC A;  4LLG F;  1R22 A;  2OU2 A;  3QRF F;  1KYW A;  4UUV A;  3I5U A;  4ZYE A;  2OQR A;  1TQP A;  1NHA A;  3OOP A;  4LFU A;  3I54 A;  5FFX A;  2EA2 A;  1R1V A;  1XMA A;  3Q9S A;  2CWE A;  4IHS A;  2FSW A;  3EUH A;  4RB3 C;  1KA8 A;  2COM A;  5D6F A;  2M87 A;  3KCC A;  2AXL A;  6PAX A;  3IWZ A;  3SHF A;  1T98 A;  3WTW C;  3F23 A;  2MH2 A;  4WX9 A;  4Q4Z F;  1ZGA A;  4WK8 F;  4LG0 B;  2RNJ A;  4WCG A;  2J5O A;  2STW A;  3I4P A;  3MEX A;  2W84 A;  1J2X A;  1P4A A;  4WXH A;  3LFK A;  2IA0 A;  4OU0 A;  4HV5 A;  2VN2 A;  3FX3 A;  3VOD A;  4L0Z B;  2VC0 A;  2PBI A;  3HSR A;  4ENM A;  2XKO A;  3IRR A;  2MC3 A;  1MDM B;  2QBY A;  2Z9O A;  4RB1 A;  5CVV A;  1HSJ A;  2K4B A;  2XVC A;  3E6M A;  2XHK A;  3G3Z A;  1BC7 C;  2HYF A;  4ON0 A;  2IJL A;  3F8B A;  1CGP A;  5DCF A;  2QQB A;  3LQQ A;  3GZ6 A;  1R7J A;  1K78 B;  4IXA A;  5ILS A;  2F5D A;  4M72 A;  5JHU A;  5HDG A;  1V4R A;  1T39 A;  3JW4 A;  2ZNZ A;  5JVT A;  3K1N A;  1REP C;  4B8X A;  3KE2 A;  2A69 F;  3DFG A;  1ZGJ A;  3M9A A;  3B02 A;  4RGU A;  2P7C B;  5L3C A;  1QBJ A;  3VOE A;  1BI1 A;  2QVO A;  2HWV A;  1IUY A;  5DUK A;  1DP7 P;  2IT0 A;  4XBF A;  3SZT A;  1MJB A;  1BC8 C;  2EWN A;  4R8H A;  4IPA A;  1GXQ A;  4NQW A;  3EYY A;  1TLH B;  1OPC A;  2ZNY A;  2DAO A;  2QBY B;  4EJO A;  4EJT A;  3P9C A;  1MGT A;  4OMY A;  1TW3 A;  3HIF A;  3NQO A;  5DUI A;  1FLI A;  1EH7 A;  2YR2 A;  3ECO A;  1CF7 A;  4Z2Y A;  2RGV A;  4Q48 A;  2DLL A;  3MQ0 A;  2DK5 A;  1P4W A;  2ZBK A;  2ZXJ A;  2QEN A;  3RPQ A;  1XGS A;  4P5O A;  4ZZL A;  2E7W A;  2VOO A;  2RN7 A;  4M71 A;  3LA7 A;  5FGM A;  1P92 A;  4HX4 A;  3M8F A;  5HS9 A;  3ZMD A;  4IF4 A;  4L9T A;  2UZK A;  1EH6 A;  1BOA A;  4CHU A;  5D8L B;  1TBX A;  1SAX A;  2H27 A;  4GO1 A;  3WG9 A;  5ERI A;  5TJJ A;  2IW5 A;  2Q0O A;  2V9V A;  4Q47 A;  1YLF A;  3FZV A;  1R1T A;  3K9T A;  3QP5 A;  2NS0 A;  5CYV A;  3SQN A;  4CYD A;  3HTU A;  3KP7 A;  3HOS A;  2BGC A;  1I5Z A;  3IHU A;  4IHT A;  1R36 A;  1W5S A;  2Q8K A;  4P96 A;  3DEU A;  1TQM A;  4M6Y A;  1T6S A;  4GYG A;  4GYI A;  2OZ6 A;  3DF8 A;  1IW7 F;  4LMY A;  3RYP A;  2P6T A;  3CUQ C;  4BYY A;  1ZRE A;  2EB7 A;  5BPD A;  3BJ6 A;  5K5R A;  2OD5 A;  4XSZ F;  3PQK A;  3C7J A;  3SFZ A;  4N0B A;  1EV7 A;  3ZMT A;  3CJN A;  3Q9V A;  2RQP A;  5BOX A;  5LHI A;  4A5N A;  5DYM A;  4HF0 A;  2BE5 F;  1XMK A;  4ENK A;  1LJ9 A;  2MLG A;  4KYW A;  2LNB A;  5ICC A;  3GXO A;  4M6X A;  3WE3 A;  1WI9 A;  2DQL A;  5FLX Z;  1MJA A;  2XAJ A;  1S6L A;  1QO0 D;  5E17 F;  3TO6 A;  4EJV A;  3ELK A;  1FBS A;  1IRF A;  1HKT A;  5F6F A;  1U6G A;  1J75 A;  1IF1 A;  3HRU A;  4E70 A;  2C6Y A;  5IT9 K;  4G6Q A;  2HGC A;  5FFZ A;  3T0Y A;  1RUO A;  3R0A A;  5LGU A;  4IRI A;  4KNY A;  2FF4 A;  4S05 A;  2OBP A;  3N97 A;  3F8M A;  4XLN F;  2F5F A;  2CW0 F;  3ULQ B;  2EK5 A;  1W5T A;  3BWG A;  5HVQ C;  4HW0 A;  4GGG A;  2G9W A;  1R23 A;  3FMR A;  5H6Q A;  1IXR C;  3CUO A;  2F5C A;  4IRG A;  1SD7 A;  1PP7 U;  2V1U A;  1XSX A; 
#chains in the Genus database with same CATH topology
 2CUJ A;  1K7A A;  4OIN F;  2CW7 A;  5ICG A;  1SEU A;  2KKO A;  1JKR C;  3OIO A;  4HOB A;  4A0Z A;  2K9N A;  3ZQC A;  1BR4 A;  1QZE A;  1VZ0 A;  3LOC A;  1ZYR F;  2Z2S B;  3HOZ J;  2VQC A;  3S15 J;  3P9K A;  1ZG5 A;  2R3S A;  2K4J A;  3LA3 A;  2HZT A;  3NWS A;  3BZC A;  2PJR B;  5DCM B;  3ZR8 X;  1FYL A;  1OYY A;  1D0X A;  3FWE A;  2K9S A;  3V7R A;  2K9L A;  1YJ9 I;  1QZY A;  4ZZD A;  4H4K C;  2BY1 A;  5LGT A;  3ZXS A;  1DU0 A;  3VWB A;  2DQR A;  2F48 A;  4YFX F;  2W25 A;  1UCR A;  3H3Z A;  3CCM I;  3EQL F;  3PUF A;  4M9Z A;  3HUG B;  3CMA I;  2CMP A;  1K79 A;  4Y52 J;  3LQR A;  3DXJ F;  4M3G A;  4BJ5 C;  1J59 A;  1RKW A;  3ZMU A;  5J4V A;  4OAY A;  1V5E A;  3TBI A;  2WV1 A;  1Z7L A;  4BE0 A;  2L9V A;  3RPU A;  3ONQ A;  1KQ8 A;  1BOB A;  4D0P A;  3HOT A;  2MH9 A;  2DOD A;  5GAD J;  1RES A;  1NK2 P;  5CVI A;  1W0U A;  2RDP A;  2Z99 A;  3LAP A;  2DA5 A;  1G3Y A;  4JX6 A;  3TQN A;  1MND A;  4KT5 C;  1KU7 A;  2GZW A;  3ZQH A;  3MKY B;  5E20 A;  3EUK L;  5HLH A;  2LH9 A;  2JSC A;  2CQX A;  3R0J A;  5L3F A;  3GWZ A;  2XIG A;  1LDD A;  2FX0 A;  2M4G A;  4OIP F;  3IKV A;  4OAZ A;  1P9Q C;  2ZFU A;  4XM3 A;  2FEZ A;  3GZ5 A;  3GTJ J;  2HDW A;  4A3M J;  2WAF A;  4N9I A;  2A5Y B;  3CF2 A;  2R7U A;  5FKN A;  4C3H J;  3OYN A;  2LSO A;  4LD5 A;  1U78 A;  2E2H J;  1I39 A;  2DPD A;  2YX7 A;  1FEX A;  1SD4 A;  5TIS C;  2QZ8 A;  3MCZ A;  4UVC A;  2X48 A;  2VAS A;  3SDB A;  3OYH A;  1R00 A;  2VE8 A;  1I1G A;  5LLQ A;  4BKX A;  4CA0 A;  3IRQ A;  4NDL A;  5LEK A;  2L9R A;  1FZP B;  2IBD A;  2AHQ A;  2FUG 2;  2QUF A;  4FHT A;  4AVP A;  4ZYG A;  1QVT A;  4OIO F;  1D1A A;  3CO6 C;  1IGN A;  2Q1Z B;  4BJ6 C;  3F9K A;  1IDY A;  4BDZ A;  4H0E A;  5HLG A;  3KZY A;  1XN7 A;  2L0K A;  3BQY A;  3MVP A;  3K4N A;  4F7Z A;  5J4Y A;  3CC4 I;  3ZN1 A;  3FXM A;  3RQ4 A;  4C3I J;  5DD4 A;  1SVM A;  2CGP A;  3HOV J;  3D1N I;  4JQF A;  4PJL A;  4PJ0 C;  2KIU A;  2PX9 A;  4LB5 A;  2E5Z A;  2PFB A;  3BR3 A;  2CV1 A;  5EEA A;  4O6J A;  3DBH B;  2IGK A;  4IHW A;  2DJN A;  1O3T A;  4MGR A;  2VB6 A;  4N4O B;  1EH8 A;  3I4N J;  1A5J A;  2BV6 A;  1QA6 A;  5D5X B;  2DO7 A;  4PDK A;  2CFX A;  3DPL C;  2DA6 A;  3H92 A;  2Y2Z A;  3HSF A;  5K5O A;  2LY2 A;  2P5K A;  4KIC A;  2ECC A;  4A3B J;  1SVO A;  3PM1 A;  2ELJ A;  5DV5 A;  1WJF A;  3S32 A;  1BJZ A;  3OS0 A;  2ZSH B;  3U1K A;  2Q2E A;  3WGG A;  1JTX A;  2WAQ A;  2OC6 A;  3WU1 B;  2PI0 A;  1JHF A;  2M45 A;  2X4H A;  2PJP A;  3PIP F;  4HST A;  2DMN A;  3TO7 A;  3ZQQ A;  4XRF A;  1RUN A;  4EM1 A;  1RRJ A;  1K4T A;  1ZRF A;  3F8F A;  1S5L C;  3C3W A;  4LLN A;  4II2 A;  2Y9Y A;  2JVH A;  1ITY A;  1UG2 A;  1WJA A;  3WTT C;  5KK1 A;  3GFL A;  2GXB A;  4FX0 A;  2HFH A;  1Z77 A;  1U5T C;  2KP6 A;  1HLV A;  5FD5 A;  3ZCO A;  3EYI A;  1FBQ A;  3TOB A;  1XCV A;  3SXY A;  4E7J A;  1FOW A;  1GHC A;  3Q3S A;  3LST A;  2XAS A;  2YX4 A;  5E3O A;  4IL6 C;  5ICF A;  2P81 A;  4XNF A;  5LHG A;  5KVR A;  5IP7 J;  4XIC A;  4B44 A;  4G7Z F;  3S3M A;  5BNG A;  3F8N A;  3EUA A;  2DT5 A;  2R4G A;  2P8T A;  4XKC A;  4XQF A;  5CVU A;  3E5Q A;  2RC4 A;  4LIT A;  1BIA A;  3A01 B;  4Y17 A;  4HNU A;  5ICE A;  3FMS A;  4YIF A;  3ABT A;  1TNS A;  5HDN A;  4DJA A;  4I76 A;  3DU5 A;  2FU4 A;  3WGI A;  2KRC A;  1TZL A;  1V3F A;  3BR1 A;  1YE9 A;  2CG4 A;  1B9M A;  4ESF A;  1D5Y A;  5F1R A;  1U5T A;  3PFY A;  4IHY A;  3WGH A;  4PK4 A;  2M7B A;  1MBK A;  4M9S A;  3L2Q A;  4IQ4 A;  3RQI A;  3BRO A;  2A68 F;  3H5N A;  5M5X J;  1R9T J;  2K5C A;  2DFI A;  3VSK A;  2CV2 A;  1EKE A;  2NVX J;  2V6E A;  4V19 K;  4A3G J;  4RGX A;  2LKP A;  1GT0 C;  3IC7 A;  2XAH A;  3OYM A;  4A12 A;  3KFW X;  4BXU A;  2FQ3 A;  4X6A J;  4Y3O A;  1VQ6 I;  1MBG A;  1Y1V J;  3QOE A;  4L9N A;  3OY9 A;  4HX8 A;  3ZMZ A;  1HOM A;  1V54 H;  3G73 A;  3ISP A;  4O5V A;  4RAG A;  1YS7 A;  3RKX A;  1C0W A;  3BTI A;  2EV6 A;  2W57 A;  1RZ4 A;  3DV8 A;  3F21 A;  3TKY A;  1TC3 C;  3K4L A;  1MSF C;  1NH3 A;  4EQQ A;  3OYA A;  4MO7 A;  1ETV A;  2EFQ A;  3VYR B;  2FRH A;  2H6B A;  4TV7 A;  1JUP A;  1I50 J;  2GM4 A;  3B6A A;  2NVU B;  5E18 F;  2R5Z B;  1PVE A;  3GBG A;  3GVA A;  1HDP A;  1KYZ A;  4S0H B;  2D5V A;  2XKP A;  1J5Y A;  3DKY A;  4RDU A;  3CCQ I;  2Y75 A;  5K5Q A;  4QLC U;  1Z7U A;  2L4A A;  3FXL A;  1JKO C;  1MMN A;  3G4S I;  3FIS A;  4F92 B;  3BPV A;  5L3E A;  2EBI A;  2X51 A;  4MNU A;  4Y33 A;  1MSE C;  2ISY A;  3DPU A;  1UG0 A;  2EIL H;  2XC7 A;  4IEJ A;  4CZC A;  3BR2 A;  3U9G A;  2BOL A;  1YOV B;  2CFO A;  2DI3 A;  2MGQ A;  4QPO A;  2LTP A;  2D1V A;  2PQ8 A;  4CSW A;  5AIQ A;  3S16 J;  4B48 A;  2EZH A;  3TMO A;  2ME6 A;  3C18 A;  3KP4 A;  5KHD A;  3CME I;  1K6Y A;  1YYV A;  2ETH A;  3JRF A;  4UVA A;  4FAS D;  5HNF A;  2FOK A;  4LK1 F;  2VKD A;  1T33 A;  4F52 A;  2KPM A;  4AYB N;  1W7P D;  3CDH A;  3RKW A;  1VQO I;  2AQF A;  1CF7 B;  1X3U A;  2HDD A;  4WWC A;  2NVQ J;  2GIV A;  4FE7 A;  3AFH A;  2HPM A;  2Z1D A;  3BQZ A;  4XID A;  1FOX A;  4BH9 A;  1ZKG A;  5DDG A;  2RRE A;  3FDY A;  2KJB A;  5GTI C;  3LSP A;  1OCT C;  5E8G A;  2DA4 A;  2XPU A;  2GAU A;  3L2C A;  2KQR A;  1D3Y A;  4ZTJ A;  1RET A;  2X6W A;  3NEU A;  2QLZ A;  3P5J A;  3R60 A;  4IQJ A;  3S14 J;  3BT9 A;  1HKQ A;  3L9F A;  4UVB A;  3LA2 A;  1IJW C;  3KYD B;  2ZFW A;  4YFK F;  2NOG A;  4WXC A;  2DYR H;  1U8B A;  3GTM J;  4Y13 A;  3F22 A;  4L9V A;  2Y48 A;  1U0J A;  1D0Z A;  5ILU A;  4ZYH A;  2VBX A;  2VKE A;  1IZ1 A;  4HYE A;  1R58 A;  1WZ2 A;  3KLN A;  4QTR A;  4UNO A;  2NOJ B;  5D6E A;  3DU6 A;  3V7S A;  5HDK A;  1IN6 A;  1YHQ I;  2ESN A;  1W7P A;  4UB6 C;  4ZDO A;  1RC9 A;  3ECH A;  2EPF A;  3TGN A;  3QPT A;  3QPS A;  5JI6 A;  1IRZ A;  5L3D A;  5H20 A;  5JVG F;  1JGG A;  5LGN A;  4G6T B;  4LOC A;  5K7F A;  3K4B A;  1JE8 A;  1QVU A;  4E7I A;  2NVT J;  3FK7 A;  3K6G A;  3DBL B;  4BY7 J;  2BW3 A;  3DPT A;  3OOU A;  3CES A;  1UEL B;  2XB5 A;  1FC3 A;  1V5G A;  4LLL A;  4BBS J;  5HOD A;  4BNC A;  2YU3 A;  2QQ9 A;  3E6D A;  5FRN A;  2JA6 J;  3SJM A;  4KUM A;  2CUF A;  5AIP A;  2H6C A;  1WJE A;  5J8F A;  2E1M C;  4DNC A;  5KAF C;  3OYI A;  3VDX A;  3LSI A;  2YPR A;  2ACJ A;  4C3J J;  1BA5 A;  2QQA A;  1AOY A;  1XGM A;  4HQM A;  4CDG A;  3S1N J;  2KL4 A;  3DWL E;  2HKX A;  3MAJ A;  2Z16 A;  5IT3 A;  4I6Z A;  2JRM A;  2BYV E;  2LF7 A;  2KFD A;  4J19 A;  1LDK B;  4PSW A;  5DD8 A;  1AA7 A;  4S04 A;  2LRD A;  1WKM A;  2M2E A;  2M8E A;  2OCE A;  2TRT A;  3LSH A;  2B63 J;  3NRV A;  4L5E A;  4A3I J;  1MNM C;  1ETX A;  5IY5 H;  4O3M A;  3GFJ A;  2PMZ A;  1T0F A;  3V7C A;  2DPU A;  2JK3 A;  2GQQ A;  3P7N A;  3DBR B;  1IV6 A;  1O4X A;  3H9G A;  3BY6 A;  3DTE A;  3AG3 H;  5DTD A;  2YU9 J;  4XLF A;  1R5I D;  4AIK A;  2OTL I;  1Z9C A;  3RZD J;  3FXQ A;  1OFC X;  1FNN A;  1W36 D;  3HGG A;  2OCC H;  3J81 Z;  3AAF A;  2LF8 A;  4QPQ A;  1F5T A;  2NRA C;  2O9L A;  3N05 A;  1RNL A;  1HCR A;  4CO8 A;  3FIW A;  2KT0 A;  3K4C A;  4A69 C;  4OIR F;  2KIM A;  3C1D A;  3W2W A;  2P7V B;  1ON2 A;  1X4O A;  4U0Y A;  3HG9 A;  3JSP A;  1TP4 A;  1JUM A;  3FM5 A;  4A2U A;  2ZKZ A;  3GZN B;  1IN7 A;  1FOK A;  1XC5 A;  3PFI A;  2JSP A;  2R7S A;  4EEF G;  2PMZ N;  5KNL A;  2EFO A;  1GDT A;  3GF2 A;  2K27 A;  3OL3 A;  4CCN A;  2DDA A;  3RI4 A;  3HRM A;  3ZQ7 A;  4BQA A;  4L18 B;  5EJC A;  3PIO F;  1FYM A;  2A5W A;  3CCL I;  1SD5 A;  2HS5 A;  3H1C A;  3ROU A;  3S1Q J;  2L01 A;  1G2H A;  3K2Z A;  1ORK A;  3WTY C;  3MZY A;  1OR7 A;  2DN0 A;  3LSJ A;  3Q0W A;  3OYL A;  2FML A;  2CS3 A;  2FBI A;  1EJ9 A;  4KA4 A;  1B6A A;  3JR9 A;  2XF7 A;  1WJB A;  2TCT A;  4KDP A;  3S8P A;  4HQE A;  1LFU P;  3K4K A;  2RAE A;  3ML6 A;  2Y9Z A;  3G6E I;  1B72 A;  1JKP C;  2XF5 A;  4BHB A;  1SMT A;  2Z3Y A;  4YFN F;  1TL8 A;  2ZME A;  3D5R C;  1QU3 A;  2E2J J;  1RIO H;  4M73 A;  2NNN A;  3OYE A;  3CUQ A;  3MFK A;  5IP9 J;  2PJR A;  4RM3 A;  5E8I A;  5FKL A;  3HTS B;  1LB2 A;  2CQK A;  1ZQ3 P;  2H09 A;  4A3L J;  1J0R A;  5LBQ A;  4PGH A;  9ANT A;  3NAU A;  2HOT A;  1ENH A;  3S3N A;  1FPQ A;  1O3R A;  2EJR A;  3I55 I;  3K2A A;  1E2X A;  3CDL A;  2WV0 A;  3M8J A;  5E79 C;  1STZ A;  3HDD A;  1E3O C;  2EFW A;  2E2I J;  3I59 B;  4PJJ A;  3CUQ B;  4ZDP A;  3J80 K;  2KZV A;  3V8J A;  2K7L A;  2VBW A;  1LEB A;  1OYW A;  4ASN A;  2EFN A;  1ZN2 A;  1Z05 A;  5F64 A;  5CJ9 A;  2H8R A;  5K7H A;  4GXO A;  5D5W B;  1YW9 A;  2OZU A;  2V79 A;  2Y31 A;  3WTZ A;  4HPQ A;  4UV9 A;  5E1Z B;  3OYD A;  2AS5 F;  1B8I A;  4I02 A;  2DYS H;  1U2W A;  2ADU A;  5CVR A;  1X3W B;  3HRS A;  1RR8 C;  3HOY J;  2A6H F;  3VPR A;  4BL0 B;  1S7E A;  2XAF A;  3UKG A;  1MIJ A;  1I3Q J;  2DDB A;  1PUF A;  3FXK A;  2WB1 N;  4BHP A;  1FSH A;  3QOP A;  2MW8 A;  1MNE A;  1XX5 A;  2ZO4 A;  2ZC2 A;  4C30 A;  1ODD A;  1OLT A;  1J09 A;  2CO5 A;  2R7Z J;  4XN3 A;  3R61 A;  2V9K A;  4I2O A;  4BAY A;  2UXN A;  4I0A A;  1D8J A;  4MIM A;  2XB0 X;  2K86 A;  1B8I B;  5TRD A;  1TT0 A;  2BW3 B;  3R4K A;  1HST A;  4KMU X;  2Z33 A;  3F6O A;  3O2P E;  4NC7 A;  5E3M A;  1ULY A;  3LL7 A;  2L7M P;  1J9I A;  4U0V A;  1MKM A;  4MQV A;  2GA2 A;  4NB5 A;  4BEH A;  4UUS A;  1DDN A;  1VQ4 I;  4OIQ F;  5JFR A;  2KDO A;  1QQI A;  3E6C C;  2IA1 A;  4CUG A;  1QPM A;  3I0T A;  3L2V A;  2XPW A;  1PUE E;  2UWM A;  2KIF A;  4E7H A;  1B59 A;  1G3W A;  4MFD A;  1F4K A;  1SVL A;  5J8C A;  4RA2 A;  5EDN A;  1QHG A;  4EJU A;  2M5W A;  3H0D A;  3AL0 B;  3M3Y J;  4BU2 A;  1A36 A;  3GFM A;  4B1R A;  2OJE D;  1H9G A;  2BXZ A;  2WY7 Q;  2DT6 A;  2LYC A;  4HNT A;  3CQZ J;  2CV0 A;  2XSD C;  1Z91 A;  2EIM H;  3K0L A;  2E34 A;  3U2R A;  2B0L A;  4CGZ A;  1ZH5 A;  1DPR A;  1FT9 A;  2XDV A;  4P9F A;  4EJW A;  3K4M A;  4DYQ A;  3DTI A;  2VKV A;  1VTN C;  4G7O F;  5F0F A;  2R7T A;  2WAE A;  1B9N A;  4E7S A;  3KX2 A;  4L5J A;  2DA3 A;  2VBZ A;  2DMP A;  2NVY J;  3R6S A;  2HTS A;  5CLS A;  3QYF A;  2LKS A;  2VON A;  1SAN A;  3L7W A;  4HG2 A;  1SFU A;  3OR2 C;  3H3U A;  2P5L C;  3M7G A;  3D5S C;  3CO7 C;  2GBY A;  1IRX A;  3TDZ C;  1YX5 A;  3RPU D;  1PYV A;  2A3S A;  1S9H A;  3LSR A;  5J6X A;  3UNG C;  4IVN A;  2VC1 A;  1S7A A;  4RAZ A;  2NXN B;  4RLF A;  3BDD A;  5KAI C;  3CCS I;  3JRI A;  3IWF A;  1I1S A;  1ACI A;  3QWL A;  4N9H A;  3RYR A;  3HM5 A;  3T8R A;  1VND A;  3ASN H;  3ZPL A;  1S3J A;  1HQC A;  4KIB A;  1MW7 A;  4D7M A;  2H8W A;  1SFK A;  1IXS B;  1WJD A;  3H9J A;  2F2E A;  2FE3 A;  1XDS A;  4I09 A;  1HC8 A;  2NNY A;  1BM9 A;  1HDD C;  1Z67 A;  2IAI A;  1ZAR A;  1D1C A;  3ZGK A;  2M30 A;  4ZC3 A;  3REO A;  1YW7 A;  4BGD A;  1GVD A;  2HZD A;  1BI2 A;  4I0B A;  2F5V A;  1FIA A;  3OS2 A;  3CF5 F;  2HNH A;  3TOA A;  1XGN A;  1BN5 A;  1PJR A;  4XOP A;  1TT5 B;  1ZGW A;  4MTE A;  2PMU A;  4IX7 A;  2VOD A;  3MN2 A;  2DA2 A;  2E60 A;  1TWH J;  1OR7 C;  2DA7 A;  3WU0 A;  4KFC A;  2BHZ A;  2DFF A;  1HW2 A;  1X1A A;  1BIB A;  3GEZ A;  4DZP A;  3KEO A;  3G71 I;  4OOI A;  1ZHF A;  5F0H A;  4F91 B;  2FNA A;  3BG3 A;  1SD6 A;  3C2B A;  1L0O C;  4U87 A;  2L2O A;  1LVA A;  2R7D A;  4XK4 A;  2H1K A;  3BR0 A;  2J5P A;  3ZQG A;  3KIO A;  2FA5 A;  3FM3 A;  1ETO A;  4W1U A;  2GLO A;  1ZEL A;  4AUX A;  3O8G A;  5D4R A;  1WRJ A;  2D1H A;  4BBR J;  2DOE A;  2YUS A;  4A6E A;  1GLN A;  1O3Q A;  2W85 A;  2HQN A;  5BMZ A;  4HF1 A;  3FBN B;  1U8R A;  3KP6 A;  3WE2 A;  2FBK A;  2E1C A;  1S8N A;  4CCO A;  2ZB9 A;  2DW4 A;  3E1S A;  3ABK H;  2V7F A;  3IP4 B;  4ZYD A;  1R4M B;  3I64 A;  5B1A H;  3KYC B;  2Y0S A;  1GUU A;  3CCV I;  3JAM Z;  2FXA A;  2MFZ A;  5LFA A;  1YFH A;  2R5Y A;  1KU3 A;  2R7W A;  5FKM A;  4G9Y A;  1FTT A;  4RBO A;  3RDI A;  3ZMS A;  4XSX F;  4UY8 I;  4EM0 B;  3O6B B;  1R71 A;  4B3A A;  2EFP A;  2BEO A;  2Z5U A;  2QSF X;  1AWC A;  1D5V A;  4I01 A;  3W2V A;  1ON1 A;  2XAQ A;  5C3E J;  3N4M A;  1XSD A;  2NAZ A;  3EET A;  1P6R A;  5FJ8 J;  3A03 A;  3DQV C;  1W4M A;  2L9N A;  4F55 A;  1N25 A;  3JRG A;  2G0E A;  1T95 A;  1HXD A;  2R7F A;  3BG7 A;  2O6G E;  1XS9 A;  2F5E A;  3A4C A;  4IRH A;  3KP2 A;  4R79 A;  1MJ9 A;  2IRF G;  1X3Z B;  2OQG A;  1DPU A;  5M3F J;  1G6N A;  4ZH4 F;  1U3E M;  2EH3 A;  5FKO A;  3CCY A;  4II3 A;  2HXO A;  2IS6 A;  4X1E A;  3ZRG A;  4A3J J;  2OAZ A;  2MG4 A;  2NS8 A;  3BP8 A;  4IJA A;  1MH3 A;  4WF2 A;  3JRH A;  1HW5 A;  1R5H A;  1UST A;  1Y8Q B;  4GDF A;  4QSH A;  1VQ7 I;  3CMM A;  3VYS B;  4CIC A;  1K83 J;  4BQO A;  2VJ4 A;  1X1P A;  2ZCW A;  1XSV A;  1WCM J;  3DCF A;  3QPH A;  1YG2 A;  2IA2 A;  1XCB A;  2KRF A;  4RM2 A;  3S2W A;  3L2U A;  5E3L A;  1BI3 A;  1G3T A;  2M3A A;  4J01 A;  1B1B A;  5CQE A;  3ESW B;  5F27 A;  3QOD A;  2NYX A;  3TO9 A;  3WU2 C;  4U88 A;  2O8X A;  2QWW A;  4UXN A;  4C2U A;  5C4J J;  3Q0U A;  3GTG J;  2EIJ H;  1X58 A;  4UUS B;  1XDU A;  4FQG A;  4XLH A;  5LD2 C;  5IT9 Z;  3OS1 A;  1LNW A;  2DOA A;  1IDZ A;  4CXF A;  5CQG A;  4V2G A;  2V1X A;  2EIK H;  1W1W E;  4XLA A;  2E5N A;  1A31 A;  1UZC A;  2O0Y A;  5JLW A;  3PL8 A;  3F3X A;  3ABL H;  2KZG A;  1I3A A;  1VQ5 I;  3V8L A;  2K3F A;  3OIP A;  2B9S A;  2P4W A;  3SYT A;  3BG6 A;  1FMW A;  4JX5 A;  4G8X A;  2PN6 A;  1ETY A;  2AO9 A;  4A3F J;  2E71 A;  3QAH A;  1WHU A;  3KPH A;  2WY8 Q;  2HTJ A;  2IPQ X;  1VQP I;  3KET A;  5DS9 A;  4MEX F;  4PGG A;  3MWM A;  4JYK A;  1JJ6 C;  1JT6 A;  1F43 A;  4HF2 A;  2P6S A;  4K2E A;  3VEP A;  3J7Y J;  1UHS A;  4I7H A;  2Y69 H;  1X2N A;  1SAU A;  1U9O A;  4RS8 A;  2XGE A;  2IGO A;  2GXG A;  4PFP A;  2HDC A;  4LGW A;  2LD5 A;  3H9Q A;  4EGZ A;  2QSH X;  1OMI A;  2GWR A;  3CDI A;  2VQH A;  4KIF A;  5FLV A;  2HYG D;  2Y30 A;  3L00 A;  1JJ8 C;  4HZF A;  2MA3 A;  4WXD A;  2LDU A;  5L3G A;  3BJA A;  4RMN A;  2D2W A;  3OYG A;  1D1B A;  4X0G A;  2ZJ2 A;  2I5U A;  3VFZ A;  3H36 A;  3VYU B;  3QYE A;  3RKY A;  2EZI A;  3G1O A;  4XOR A;  4NBQ A;  1OCR H;  2QCO A;  3GLL A;  1FOY A;  3PQJ A;  2DOF A;  1R6R A;  2JA2 A;  4ZYA A;  2W24 A;  4RAF A;  5ILV A;  2HVS A;  1FSE A;  3HHG A;  3BR5 A;  1OQY A;  3T8T A;  3WTV C;  2CSO A;  1FWZ A;  2G7H A;  1NG7 A;  3M1E A;  4XRS A;  1W0T A;  1QPI A;  4LIV A;  3HKZ N;  2BY0 A;  3EDP A;  2ZJP F;  1EA3 A;  1HKS A;  3RCO A;  1OCO H;  3J81 K;  3JRC A;  3P9I A;  1UJ8 A;  1WJ5 A;  4Y15 A;  4DQ2 A;  1YO5 C;  2EV5 A;  2N8G A;  1FY7 A;  3CJQ B;  1U9N A;  3JTH A;  3BJO A;  3QP6 A;  3NWT A;  2DTR A;  1GV2 A;  3QPL A;  1B4A A;  1OCC H;  1YIO A;  2X1E A;  4HLX A;  1T8I A;  1GV5 A;  2LG4 A;  3F6V A;  2XGX A;  2E1O A;  2ELK A;  4Q5S F;  3WTX C;  3K1M A;  3JRA A;  2JA7 J;  3GLX A;  4D5C A;  5JHF A;  4YG2 F;  4RB2 C;  3OSG A;  3HB9 A;  2E1M B;  3FHN A;  2JA5 J;  3GX4 X;  3DLA A;  3HBL A;  3W2A A;  3BPX A;  3OYJ A;  3JTG A;  1LE8 B;  3OR1 C;  5GTH C;  1MBE A;  2M7A A;  5D5U B;  5A2Q K;  4XLC A;  3IAM 2;  2Y0S N;  2V6C A;  1ZR4 A;  2JUC A;  4PFO A;  5IYC J;  1GXP A;  2HKO A;  2P5V A;  4RGR A;  1WGX A;  5C4X J;  3GME A;  1RI7 A;  3W6K B;  3JSO A;  2CQQ A;  2V1N A;  1MZB A;  5EEH A;  2QYO A;  4R1H A;  4BQN A;  4BDY A;  4FX4 A;  2VBY A;  5A2Q Z;  2RV8 A;  4P9U A;  3TL4 X;  4KIT B;  2E1N A;  3DEE A;  2ZME C;  1AHD P;  1G59 A;  2VKH A;  2L5Q A;  5TGT A;  3BLY A;  3JRB A;  4E7K A;  1XGO A;  2KIQ A;  3E97 A;  5DM6 F;  1XB4 A;  4JBA A;  4P55 A;  3EPZ A;  1POG A;  1UAA A;  5D4S A;  1IN5 A;  2M4K A;  4HX7 A;  4EM2 A;  4IKF A;  1LQ1 A;  2HEO A;  1I27 A;  1P2F A;  2HQA A;  2LY9 A;  3RIR A;  3LSK A;  3T5X A;  1G4D A;  4CCM A;  3IL2 A;  4E4H A;  3CP2 A;  3CTA A;  4XL9 A;  3MZH A;  1ETK A;  2VE9 A;  1YJW I;  4B09 A;  1MD0 A;  2FQ4 A;  4XMY A;  2JRT A;  1YS6 A;  2XGD A;  2R0Q C;  5EEG A;  2BHY A;  3QU3 A;  4AVZ A;  4EVI A;  2DBB A;  1H88 C;  1HF0 A;  2QKL B;  4CYC B;  4EV0 A;  3QQA A;  4G6D A;  2HOS A;  1VQM I;  5EG0 B;  4C2M J;  1IUF A;  1ZLK A;  5IYD J;  1BJA A;  4AC0 A;  2L4M A;  4LB6 B;  1XMX A;  1SMY F;  4UHT A;  3WHC A;  1W5C C;  2WC2 A;  1PDN C;  3VB2 A;  5F08 A;  5D5V B;  1UB9 A;  3J80 Z;  1SFE A;  4OWR B;  3D5L A;  4XLP F;  4MLO A;  1O7F A;  5EGO B;  2ISZ A;  1Z1D A;  4HV6 A;  3G1M A;  1FP1 D;  1G3S A;  1JUS A;  3IH3 A;  4W97 A;  3WTS C;  1FTZ A;  1K61 A;  1KQ0 A;  3BZK A;  4M9X A;  2OA4 A;  1SC7 A;  4AD9 A;  2G7U A;  4E7Z A;  2MD0 A;  1LEA A;  1APL C;  4XKB A;  2K02 A;  4HBL A;  3WOD F;  4FT8 A;  1MBH A;  1TTY A;  2BVM A;  1PUF B;  1X1B A;  2R7X A;  3LMM A;  1DP3 A;  1KU2 A;  3L2W A;  2LBF A;  3I4M J;  3V8K A;  2O61 A;  2COB A;  3PNV A;  5LRR A;  4ABZ A;  3J7Z I;  2EA4 A;  1T0F C;  1KGS A;  2FOW A;  4F93 B;  2PLY A;  2X1C A;  4GRI A;  3E7L A;  4ITV A;  3KP5 A;  2O7O A;  3FF5 A;  3K7A J;  4I98 B;  2R7V A;  3CCU I;  3LWF A;  3U21 A;  2FD5 A;  2VJJ A;  2DXI A;  3KEQ A;  1VQ9 I;  3TDU C;  1P7I A;  2FBH A;  4M74 A;  5HOO A;  2H1L A;  3HYI A;  1DU6 A;  1DGR M;  2LVS A;  2NS7 A;  2QM3 A;  2WAQ N;  4E6K G;  2HVR A;  3HSE A;  4YIR X;  2DK8 A;  5FKK A;  1NG6 A;  4FET A;  2VI6 A;  3HPH A;  1WI3 A;  4GFB A;  2Y0M A;  3E5X A;  1S7O A;  2EV0 A;  3E3V A;  1L3L A;  4NNJ A;  4XON A;  3RTR A;  2CUZ A;  1YTY A;  2XF6 A;  1T38 A;  4MHG A;  3F8C A;  5FLM J;  3RZO J;  5M5Y J;  2KDZ A;  4IZZ A;  3S1R J;  3FBI B;  2L7F P;  5L3B A;  3ERM A;  2FNP A;  5EYR A;  5E1X A;  4M3E A;  4EGY A;  2HOE A;  2KHM A;  4YEL A;  2LRE A;  4PZJ A;  3AL0 C;  4ENN A;  4AM3 A;  1QRY A;  2K85 A;  4QIW N;  2IGM A;  3PSI A;  5D8K B;  3OWT A;  2CRG A;  1ZG3 A;  1IXC A;  2VOP A;  3I59 A;  2IVM A;  3HGY A;  1Y0N A;  2FJ1 A;  2LFB A;  3OYC A;  3CCR I;  3GTK J;  3H5A A;  2A6E F;  1BI0 A;  3BCA A;  4NUB A;  4A93 J;  3DKW A;  3LNQ A;  3I58 A;  2MSY A;  2BXY A;  2E36 A;  2L7K A;  4MTD A;  3MZ8 A;  2A07 F;  1ZK8 A;  2UXX A;  1BW6 A;  1JHH A;  1OKR A;  3I53 A;  2ZXH A;  3V4G A;  2D45 A;  3WTU C;  3PO2 J;  3VYT B;  1E17 A;  1SFX A;  3IUO A;  4BHC A;  3FHZ A;  1MMS A;  5J1Y A;  1TWC J;  2WWY A;  1PP8 F;  2X6Y A;  2VPL A;  1BBY A;  4BEH B;  3I56 I;  2GXA A;  2K40 A;  3S2D J;  3E0J B;  2MYS A;  4N4N B;  2L54 A;  1ZRC A;  2EQR A;  1AKH B;  1WFX A;  5J1R A;  2JA8 J;  3L2R A;  3J7A O;  3VSL A;  2A6T A;  4IO9 F;  4RB0 A;  1WQ2 A;  5F04 A;  2GA1 A;  2JMW A;  2ESH A;  4KIG A;  5K1Y A;  5HS8 A;  3HL2 A;  1Y8R B;  4IHX A;  2DFE A;  2PG4 A;  4KT6 A;  5EZG A;  4BXF A;  4GCV A;  3NAR A;  2EIN H;  2ELH A;  2XUB A;  1KQ9 A;  3KZI C;  1R1U A;  3S17 J;  1TNT A;  5FO5 A;  2W48 A;  1DUX C;  5BQT A;  4HA8 A;  2RVC A;  4DZJ A;  4ESB A;  1TWG J;  3ABU A;  4A3D J;  1KU9 A;  5B66 C;  5DEQ A;  4KMF A;  3ZMV A;  3GCM A;  1E3P A;  2B7E A;  3GO5 A;  1Y1W J;  3IKT A;  1D8K A;  1D0Y A;  2MLK A;  5AON A;  1BL0 A;  2KIS A;  1P7J A;  3U1D A;  1K4S A;  1N78 A;  4JX4 A;  3C2G A;  2MBF A;  4OMZ A;  4U0W A;  2VT3 A;  1XD7 A;  5J47 A;  3W6J B;  1FP2 A;  1ETQ A;  3C2H A;  1BW5 A;  1AU7 A;  1LDJ A;  1QZZ A;  3M07 A;  4L0Y B;  5ED4 A;  3W3C A;  1WJC A;  3FMQ A;  4A0X A;  3QU6 A;  2DTZ A;  4FE4 A;  2X1D A;  1B72 B;  5IOY A;  5F0C A;  2MD5 A;  2P0W A;  2ICW G;  3K69 A;  5E1W A;  4AWX B;  1FJL A;  5LRS A;  1FBU A;  4Y4R A;  1QNT A;  4XR6 A;  1USS A;  3KLO A;  4BUP A;  2XRO A;  5EG0 A;  4FCY A;  2AXT C;  4G94 A;  4DYC A;  1WSU A;  2XSJ C;  3G2B A;  4LG3 A;  4EMS A;  1YRN B;  4CCL A;  5LEJ A;  1HBX G;  3IAS 2;  3Q0V A;  1F1Z A;  3IH2 A;  1UHM A;  5CVJ A;  3K70 C;  2JWT A;  2ZXW H;  2MAB A;  4AIH A;  5KCM A;  3FXU A;  3WHB A;  2IP2 A;  1SFO J;  3KYL A;  4UV8 A;  4HDU A;  1MDM A;  2TDX A;  2VXZ A;  1TW2 A;  3GW2 A;  3OIQ A;  2DT7 B;  4MEY F;  3JAM K;  3K10 A;  2VT2 A;  1R5G A;  2EZL A;  4LG0 A;  5DM7 F;  2JPB A;  3PO3 J;  4L9J A;  1ZG1 A;  5BPI A;  2KJC A;  2XV4 S;  5HLI A;  4A5M A;  1Z6T A;  2KRH A;  4PCQ A;  4HLY A;  1K78 A;  2ID6 A;  3OSF A;  4XKW A;  4LJZ F;  3A0H C;  2L9S A;  2VQL A;  2XAU A;  3A02 A;  4RGS A;  3COA C;  5CKT A;  5E3N A;  1IAW A;  1FX7 A;  1RKT A;  2DCE A;  5CPR B;  2LOO A;  4L5I A;  1WH7 A;  1ZAO A;  2W82 A;  1IN4 A;  4A3E J;  2RKH A;  1JXS A;  3E5U A;  3GUD A;  1UFM A;  4U7D A;  3L09 A;  3M4O J;  2K9M A;  4MQ9 F;  1H0M A;  3I3L A;  4IHV A;  1ERD A;  4HDV A;  1Y39 A;  3F72 A;  4KN4 X;  1IRG A;  3CD6 I;  3OYK A;  1F9N A;  3CCJ I;  1Y0U A;  2R5Y B;  2STT A;  2ZME B;  3H3V K;  2V9P A;  3HUG A;  2XGC A;  2X6O A;  4DBQ A;  2M1B A;  2BVL A;  2WB1 A;  1H89 C;  1KZH A;  4ETS A;  1WPK A;  2DFH A;  3AG1 H;  2YSR A;  1UMQ A;  1Q1H A;  3HZJ A;  2WTE A;  2LKX A;  1N77 A;  2JZY A;  3A01 A;  3CC2 I;  1YX3 A;  5DCM A;  4B3X A;  3SZP A;  1O3S A;  2PEX A;  2OUM A;  2W1O A;  3ABM H;  3PJR A;  1GVJ A;  3TP3 A;  3HEF A;  3LAJ A;  3K1P A;  5GAE J;  3AG2 H;  1H9T A;  2XAG A;  3BZ6 A;  3HRT A;  2XRN A;  4KN7 X;  1S72 I;  1LVK A;  3KEY A;  3ZOB A;  5JR3 A;  1ETW A;  2X0L A;  3T1B A;  4A3K J;  1RR7 A;  5J1U A;  2O8K A;  4ANJ A;  1HW1 A;  5FLX K;  1OCZ H;  2W7N A;  3I71 A;  1YJN I;  1JTY A;  3E6B A;  3ZP5 A;  5FB2 A;  4RAY A;  4AIJ A;  1TWF J;  2CH0 A;  2X9D A;  4YII A;  1YW8 A;  1VI0 A;  2LK2 A;  2VL8 A;  1I6X A;  1O7L A;  4NHJ A;  1F36 A;  4AU7 A;  3KP3 A;  1ONV A;  5BS6 A;  2CW8 A;  4C2T A;  4PSX A;  2K9Q A;  2OV7 A;  1ZTR A;  4QWQ A;  3GTQ J;  4JK1 X;  2R92 J;  4HAM A;  5LHH A;  5FRM A;  2VUM J;  1UHW A;  2RNG A;  2BBY A;  1FYK A;  2IS2 A;  3RJP A;  1R49 A;  2A61 A;  2F4M B;  2KLO A;  3V42 A;  1JGS A;  5HS7 A;  3DP7 A;  2PMH A;  3FKI J;  2ZJQ F;  2LLK A;  3BTC A;  2W00 A;  1W7P B;  1J7K A;  5GP9 A;  2L02 A;  4E7L A;  3BR6 A;  1ZRD A;  3HKZ A;  1E0E A;  1OYI A;  1A6I A;  4HNV A;  3Q5F A;  1T2K A;  4NC6 A;  2M0C A;  4DBR A;  4UUT A;  4YRV A;  3RKQ A;  2QQ8 A;  3MKW B;  2HQR A;  4UB8 C;  2O03 A;  1A6Q A;  1U5T B;  2IGN A;  3BG5 A;  1WWX A;  2DU9 A;  2K3P A;  2R7R A;  2DMT A;  1O57 A;  4HRI A;  3ZN0 A;  1QGP A;  1TQI A;  1LFB A;  2H94 A;  4G7H F;  2L3D A;  1BR1 A;  3BTJ A;  3GTL J;  1K6O A;  5IPA A;  2V26 A;  1ZLJ A;  2CYY A;  1ZR2 A;  3FXR A;  1A04 A;  3LSM A;  5FD6 A;  3B73 A;  2ECB A;  2O3F A;  3PNT A;  3OV8 A;  2JN6 A;  3CLO A;  3HHH A;  4ENJ A;  1V55 H;  5M5W J;  2YS9 A;  4B43 A;  4B47 A;  4P1W A;  4EAT A;  2L7Z A;  1Z21 A;  3D0S A;  4U7B A;  1P4X A;  4NC8 A;  3BOQ A;  3O3K A;  1VQL I;  1LKX A;  2VXD A;  4ESJ A;  2JTV A;  3SDG A;  1RPW A;  4JOM A;  3KZZ A;  5GPC A;  1OJL A;  1Z6R A;  1XG1 A;  2E35 A;  2ME0 A;  4G12 A;  3GFI A;  2VIX A;  5H6R A;  3L1P A;  5H2F C;  1KON A;  4Z6Y A;  4A0Y A;  2V1D A;  2HR3 A;  3B6C A;  3CC7 I;  3RSN A;  2E7X A;  2VJI A;  4CZZ A;  3JRD A;  3ERE D;  3BTL A;  1S29 A;  2CQN A;  3IH4 A;  1YQA A;  2XPV A;  3GYH X;  2FMY A;  2JT1 A;  1Y6I A;  3PNY A;  4A6D A;  4AYB A;  4LK0 F;  4BQQ A;  3IV5 A;  3OYB A;  3HOX J;  4XKV A;  2VJ5 A;  2X6X A;  3M8E A;  1IN8 A;  2A05 A;  3OYF A;  2JPC A;  4LLG F;  1R22 A;  2OU2 A;  3QRF F;  1KYW A;  4UUV A;  3I5U A;  3FK6 A;  4ZYE A;  2OQR A;  4ZTF A;  1G8X A;  1NHA A;  1TQP A;  3OOP A;  4D1Q A;  2F4O B;  3MMY B;  4LFU A;  4D7N A;  1EF4 A;  1Z3Y A;  4B4C A;  1X2M A;  1AKH A;  1OIS A;  3S2H J;  3I54 A;  3J7A Y;  4A3C J;  1YIJ I;  5FFX A;  2EA2 A;  1R1V A;  3HOW J;  4PUS A;  1XMA A;  3Q9S A;  2CWE A;  4IHS A;  2FSW A;  3EUH A;  4RB3 C;  1KA8 A;  4ZDL A;  1TWA J;  2COM A;  1FIP A;  1Z0X A;  4M6V A;  5D6F A;  2M87 A;  3A2K A;  2VQG A;  3KCC A;  4PJM A;  1R4N B;  2AXL A;  1OCP A;  6PAX A;  3IWZ A;  5B5E C;  1NK3 P;  2GOX B;  2DJI A;  3SHF A;  1YIT I;  1VFC A;  2RQQ A;  4BJT A;  1T98 A;  3WTW C;  3F23 A;  2MH2 A;  2HQ5 A;  4WX9 A;  4Q4Z F;  5B3S H;  1ZGA A;  4XLE A;  1MH4 A;  4WK8 F;  3DLL F;  4LG0 B;  4IOA F;  1I6H J;  3K4J A;  5GAG J;  3TED A;  1IO2 A;  2RNJ A;  4WCG A;  2JJ7 A;  2HPI A;  3HXL A;  2HVQ A;  2J5O A;  2STW A;  2Q2E B;  3I4P A;  5IYB J;  3DEW A;  1MMG A;  3MEX A;  2W84 A;  3LSG A;  2JVG A;  2WAD A;  1J2X A;  1P4A A;  4WXH A;  5M3M J;  3LFK A;  2IA0 A;  1WH5 A;  4OU0 A;  4HV5 A;  2VN2 A;  3FX3 A;  1Q1V A;  3VOD A;  3AG4 H;  4L0Z B;  2VC0 A;  3ZQL A;  2PBI A;  3HSR A;  4ENM A;  4PJN A;  3H0G J;  3PSF A;  2XKO A;  3IRR A;  5B1B H;  2MC3 A;  1YRN A;  1MDM B;  2CJJ A;  3I9V 2;  2QBY A;  4CYC A;  2Z9O A;  2MC4 A;  2QEX I;  4RB1 A;  2JUG A;  4Y7N J;  5CVV A;  1HSJ A;  2K4B A;  1X1C A;  2XVC A;  3E6M A;  3UR3 C;  5F1J A;  2XHK A;  1XTA A;  3G3Z A;  1BC7 C;  2OPT A;  3DKX A;  3H5R A;  3X2Q H;  4BE1 A;  2HYF A;  2IS4 A;  1VF9 A;  4ON0 A;  2IJL A;  3F8B A;  1DQU A;  4DOZ A;  5DCF A;  1CGP A;  1V5F A;  3MD2 A;  2QQB A;  3LQQ A;  5EZH A;  4CCJ A;  3GZ6 A;  1R7J A;  1K78 B;  1X4P A;  4IXA A;  5ILS A;  3SZG A;  4J00 A;  4DIQ A;  2F5D A;  4M72 A;  5JHU A;  1JKQ C;  5HDG A;  2JQ7 A;  1V4R A;  3A1Y A;  4F3Q A;  3JW4 A;  1T39 A;  2ZNZ A;  5GAH J;  3F0C A;  2DMQ A;  5JVT A;  3K1N A;  2V4J C;  4BE2 A;  1H8A C;  3HPG A;  4JP0 A;  4ZJZ A;  1REP C;  4B8X A;  2R93 J;  2R5Z A;  2CU7 A;  3KE2 A;  2VLA A;  1WVR A;  2CQ7 A;  1CQT A;  1HA8 A;  2A69 F;  3EUH C;  3DFG A;  1ZGJ A;  3M9A A;  3B02 A;  4RGU A;  2P7C B;  2I8D A;  3SFI A;  5J3L A;  5L3C A;  1QBJ A;  3WG7 H;  3VOE A;  2EZK A;  1BI1 A;  2QVO A;  2HWV A;  2UUZ A;  4AID A;  1IUY A;  5DUK A;  3CJR B;  3O8H A;  1DP7 P;  1VQN I;  1M1E B;  2LBF B;  2IT0 A;  4XBF A;  3SZT A;  1MJB A;  1BC8 C;  2EWN A;  4IOC F;  4R8H A;  2ZSI B;  4IPA A;  1GXQ A;  4NQW A;  3EYY A;  1TLH B;  2LMD A;  4HSR A;  1IC8 A;  1OPC A;  2ZNY A;  3S3O A;  2DAO A;  5K7Z A;  2QBY B;  4XOT A;  4LIU A;  4EJO A;  4CH7 A;  3CMY A;  4EJT A;  3P9C A;  2M8G X;  1MGT A;  2HI3 A;  1T56 A;  3JRE A;  4OMY A;  1TW3 A;  3HIF A;  3NQO A;  5DUI A;  3CJT B;  1FLI A;  2LC2 A;  1Z3X A;  1EH7 A;  2M0M A;  2YR2 A;  2GIZ A;  3ECO A;  3BC8 A;  2HU9 A;  3TP0 A;  4M3D A;  1CF7 A;  4Z2Y A;  2GOM A;  5HLT A;  2RGV A;  4Q48 A;  4M3F A;  3OMY A;  2ZXI A;  2DLL A;  3MQ0 A;  2DK5 A;  1P4W A;  2ZBK A;  2ZXJ A;  2QEN A;  3RPQ A;  2VPR A;  1XGS A;  4P5O A;  4ZZL A;  2E7W A;  2QF7 A;  3HC7 A;  2OF7 A;  2VOO A;  2RN7 A;  4M71 A;  1YI2 I;  2E19 A;  3M1C A;  3LA7 A;  5FGM A;  3DTK A;  1X19 A;  1P92 A;  4HX4 A;  1MMA A;  2IEK A;  4D5F A;  2WA0 A;  5IP6 A;  3TW7 A;  3M8F A;  1N75 A;  5HS9 A;  3ZMD A;  4YEJ A;  4IF4 A;  4L9T A;  2UZK A;  4BAC A;  1EH6 A;  2KMU A;  1BOA A;  5GPA A;  2IXS A;  4CHU A;  5D8L B;  1TBX A;  3A0B C;  1SAX A;  2H27 A;  4GO1 A;  3WG9 A;  2F4I A;  5ERI A;  5TJJ A;  2IW5 A;  2M9H A;  2Q0O A;  3H35 A;  2V9V A;  2W4S A;  4Q47 A;  2OTJ I;  4V2F A;  1YLF A;  2AQE A;  3FZV A;  1LPQ A;  4M3B A;  1R1T A;  3CCE I;  1LFP A;  3K9T A;  3FXJ A;  3QP5 A;  2NS0 A;  2ZJR F;  4FIS A;  4NQW B;  1XPX A;  3GTO J;  5CYV A;  4D9J A;  4CCK A;  2O5R A;  3BG9 A;  5EF6 A;  3JCU C;  3SQN A;  3SEZ A;  3HOU J;  1LUJ B;  4CYD A;  3HTU A;  3KP7 A;  3OL4 A;  4KJZ A;  3HOS A;  2BGC A;  1JI8 A;  3W6V A;  2HXI A;  2M34 A;  2QGU A;  1A35 A;  3G1L A;  1I5Z A;  5C44 J;  3IHU A;  3QYB A;  4IHT A;  4C9Y A;  1R36 A;  1W5S A;  2HYJ A;  3CZ6 A;  4P96 A;  2Q8K A;  3ZQF A;  3S1M J;  1IV8 A;  3MKZ A;  3CP8 A;  2DMU A;  3DEU A;  3FKJ A;  1TQM A;  4M6Y A;  5J40 A;  1T6S A;  4GYG A;  4GYI A;  2OZ6 A;  3DF8 A;  1IW7 F;  4MFE A;  4LMY A;  1VQK I;  3RYP A;  2P6T A;  3CUQ C;  3AKZ A;  1T08 B;  4BYY A;  1ZRE A;  1QHH D;  5HNH A;  2EB7 A;  3PUB A;  5BPD A;  2R7Q A;  4XRM A;  3BJ6 A;  4FTH A;  5K5R A;  4HEA 2;  2OD5 A;  4XRS G;  4XSZ F;  2LP0 A;  3PQK A;  5EGO A;  3C7J A;  3SFZ A;  2R7O A;  4N0B A;  1EV7 A;  3ZMT A;  1VQ8 I;  1E3H A;  4DYR A;  3CJN A;  1DGW Y;  2RQP A;  3Q9V A;  3SEQ A;  5BOX A;  5LHI A;  3K70 D;  1X1D A;  4A5N A;  4DW6 A;  3HJE A;  4RLQ A;  5DYM A;  4BY1 J;  1IG7 A;  4HF0 A;  2BE5 F;  1XMK A;  4BXX J;  4I99 C;  2QA4 I;  4ENK A;  1LJ9 A;  2MLG A;  2LNB A;  3GXO A;  3WE3 A;  4M6X A;  5ICC A;  4KYW A;  1WI9 A;  2DQL A;  1W36 C;  2BY3 A;  5FLX Z;  1MJA A;  2XAJ A;  1S6L A;  3ASO H;  1MMD A;  1QO0 D;  5E17 F;  3ZQI A;  3FXO A;  3TO6 A;  3GTP J;  3CLQ A;  2XRL A;  4DGW B;  4EJV A;  2F6C A;  3ELK A;  2IS1 A;  1FBS A;  1MBJ A;  3TW6 A;  1IRF A;  1HKT A;  3BCB A;  5F6F A;  1U6G A;  1J75 A;  2DA1 A;  3S93 A;  1IF1 A;  2ID3 A;  3HRU A;  4E70 A;  2C6Y A;  2CUE A;  2BZT A;  5IOZ A;  5IT9 K;  4BS9 A;  4G6Q A;  2HGC A;  2LY1 A;  5FFZ A;  2WBM A;  3T0Y A;  1RUO A;  3R0A A;  5LGU A;  1NTC A;  2QSG X;  4IRI A;  4KNY A;  2FF4 A;  3LFU A;  3MKL A;  1MBF A;  2HOA A;  4S05 A;  2OBP A;  3N97 A;  2I10 A;  1BR2 A;  3F8M A;  4XLN F;  2F5F A;  1Y56 A;  5FRO A;  2CW0 F;  3ULQ B;  1JT0 A;  2QKM B;  1FMV A;  2EK5 A;  4XN0 A;  1W5T A;  3BWG A;  4HW0 A;  5HVQ C;  4KIS A;  4GGG A;  2G9W A;  1LE8 A;  1R23 A;  3FMR A;  2X85 A;  5H6Q A;  1IXR C;  2LR8 A;  3CUO A;  5JLX A;  2BY2 A;  2F5C A;  4IRG A;  2UV1 A;  1SD7 A;  1PP7 U;  2V1U A;  1XSX A; 
#chains in the Genus database with same CATH homology
 1K7A A;  4OIN F;  5ICG A;  2KKO A;  4HOB A;  4A0Z A;  1ZYR F;  3P9K A;  1ZG5 A;  2R3S A;  2K4J A;  3LA3 A;  2HZT A;  5DCM B;  1FYL A;  1OYY A;  3FWE A;  3V7R A;  1QZY A;  4ZZD A;  5LGT A;  2DQR A;  4YFX F;  2W25 A;  1UCR A;  3H3Z A;  3EQL F;  4M9Z A;  1K79 A;  3LQR A;  3DXJ F;  1J59 A;  3ZMU A;  3RPU A;  1KQ8 A;  4D0P A;  3HOT A;  2MH9 A;  5CVI A;  2RDP A;  2Z99 A;  3LAP A;  1G3Y A;  3TQN A;  4KT5 C;  1KU7 A;  2GZW A;  5E20 A;  5HLH A;  2JSC A;  3R0J A;  5L3F A;  3GWZ A;  2XIG A;  1LDD A;  4OIP F;  3IKV A;  2FEZ A;  3GZ5 A;  4N9I A;  2A5Y B;  2LSO A;  4LD5 A;  1U78 A;  2DPD A;  2YX7 A;  1SD4 A;  2QZ8 A;  3MCZ A;  4UVC A;  1R00 A;  2VE8 A;  1I1G A;  5LLQ A;  3IRQ A;  5LEK A;  1FZP B;  2QUF A;  4FHT A;  4AVP A;  4ZYG A;  4OIO F;  3CO6 C;  4H0E A;  5HLG A;  3KZY A;  1XN7 A;  4F7Z A;  3ZN1 A;  5DD4 A;  2CGP A;  4JQF A;  2KIU A;  4LB5 A;  2PFB A;  4O6J A;  1O3T A;  4MGR A;  1EH8 A;  2BV6 A;  5D5X B;  2DO7 A;  4PDK A;  2CFX A;  3DPL C;  3H92 A;  3HSF A;  5K5O A;  2P5K A;  4KIC A;  5DV5 A;  2Q2E A;  3WGG A;  3WU1 B;  2PI0 A;  1JHF A;  2M45 A;  2X4H A;  2PJP A;  3TO7 A;  4XRF A;  1RUN A;  4EM1 A;  1ZRF A;  3F8F A;  3C3W A;  4LLN A;  3WTT C;  5KK1 A;  3GFL A;  2GXB A;  4FX0 A;  2HFH A;  1U5T C;  5FD5 A;  3EYI A;  1FBQ A;  3TOB A;  1XCV A;  3SXY A;  1GHC A;  3LST A;  2XAS A;  2YX4 A;  5ICF A;  5LHG A;  5KVR A;  4G7Z F;  3F8N A;  2DT5 A;  2P8T A;  5CVU A;  3E5Q A;  2RC4 A;  1BIA A;  4Y17 A;  5ICE A;  3FMS A;  4YIF A;  3ABT A;  1TNS A;  5HDN A;  2FU4 A;  3WGI A;  1V3F A;  2CG4 A;  1B9M A;  4ESF A;  5F1R A;  1U5T A;  3WGH A;  4M9S A;  3BRO A;  2A68 F;  2DFI A;  4RGX A;  2LKP A;  3IC7 A;  2XAH A;  4A12 A;  3KFW X;  4BXU A;  2FQ3 A;  4L9N A;  4HX8 A;  3ZMZ A;  3G73 A;  3ISP A;  4O5V A;  1YS7 A;  3RKX A;  1C0W A;  2EV6 A;  2W57 A;  1RZ4 A;  3F21 A;  3DV8 A;  3TKY A;  4EQQ A;  2EFQ A;  2FRH A;  2H6B A;  4TV7 A;  5E18 F;  3GVA A;  1KYZ A;  2XKP A;  1J5Y A;  2Y75 A;  5K5Q A;  4QLC U;  1Z7U A;  2L4A A;  5L3E A;  3BPV A;  4MNU A;  2ISY A;  3U9G A;  2DI3 A;  2D1V A;  2PQ8 A;  5AIQ A;  3C18 A;  3KP4 A;  1YYV A;  2ETH A;  4UVA A;  2FOK A;  4LK1 F;  1W7P D;  3CDH A;  3RKW A;  1CF7 B;  1X3U A;  4WWC A;  2GIV A;  4BH9 A;  5DDG A;  2KJB A;  5E8G A;  2GAU A;  3L2C A;  1D3Y A;  3NEU A;  2QLZ A;  3R60 A;  1HKQ A;  3L9F A;  4UVB A;  3LA2 A;  2ZFW A;  4YFK F;  4WXC A;  4Y13 A;  3F22 A;  4L9V A;  2Y48 A;  5ILU A;  4ZYH A;  2VBX A;  1IZ1 A;  4HYE A;  1R58 A;  3KLN A;  4UNO A;  5D6E A;  3V7S A;  5HDK A;  1IN6 A;  2ESN A;  1W7P A;  3ECH A;  3TGN A;  3QPT A;  5JI6 A;  5L3D A;  5H20 A;  5LGN A;  1JE8 A;  3DPT A;  1FC3 A;  4LLL A;  4BNC A;  2YU3 A;  2QQ9 A;  3E6D A;  4KUM A;  5AIP A;  2H6C A;  5J8F A;  4DNC A;  2YPR A;  2ACJ A;  2QQA A;  1AOY A;  1XGM A;  4HQM A;  4CDG A;  2HKX A;  3MAJ A;  5IT3 A;  2BYV E;  2LF7 A;  1LDK B;  5DD8 A;  4S04 A;  1WKM A;  2M8E A;  3NRV A;  4O3M A;  3GFJ A;  1T0F A;  3V7C A;  2DPU A;  2GQQ A;  3P7N A;  3BY6 A;  4AIK A;  1Z9C A;  3FXQ A;  1FNN A;  3J81 Z;  3AAF A;  2LF8 A;  1F5T A;  2NRA C;  1RNL A;  4CO8 A;  4OIR F;  2KIM A;  3C1D A;  2P7V B;  1ON2 A;  4U0Y A;  3JSP A;  3FM5 A;  4A2U A;  2ZKZ A;  1IN7 A;  1FOK A;  3PFI A;  2EFO A;  3GF2 A;  2K27 A;  3RI4 A;  3HRM A;  3ZQ7 A;  4BQA A;  4L18 B;  1FYM A;  1SD5 A;  2HS5 A;  3ROU A;  2L01 A;  3K2Z A;  3WTY C;  3MZY A;  1OR7 A;  2FML A;  2FBI A;  4KA4 A;  1B6A A;  4KDP A;  4HQE A;  3ML6 A;  4BHB A;  1SMT A;  2Z3Y A;  4YFN F;  2ZME A;  1RIO H;  4M73 A;  2NNN A;  3CUQ A;  3MFK A;  5E8I A;  3HTS B;  1LB2 A;  2CQK A;  2H09 A;  1J0R A;  5LBQ A;  4PGH A;  1FPQ A;  1O3R A;  2EJR A;  1E2X A;  2WV0 A;  1STZ A;  2EFW A;  3I59 B;  3CUQ B;  3J80 K;  3V8J A;  2K7L A;  2VBW A;  1LEB A;  1OYW A;  4ASN A;  2EFN A;  1ZN2 A;  1Z05 A;  5F64 A;  5CJ9 A;  5D5W B;  4GXO A;  1YW9 A;  2OZU A;  2V79 A;  3WTZ A;  4UV9 A;  5E1Z B;  2AS5 F;  4I02 A;  1U2W A;  2ADU A;  5CVR A;  3HRS A;  2A6H F;  2XAF A;  4BHP A;  1FSH A;  3QOP A;  2ZO4 A;  1ODD A;  2CO5 A;  3R61 A;  4I2O A;  4BAY A;  2UXN A;  4I0A A;  1D8J A;  2K86 A;  5TRD A;  3R4K A;  4KMU X;  2Z33 A;  1HST A;  3F6O A;  3O2P E;  1ULY A;  1J9I A;  4U0V A;  1MKM A;  4MQV A;  2GA2 A;  4NB5 A;  4OIQ F;  1DDN A;  5JFR A;  1QQI A;  3E6C C;  2IA1 A;  1QPM A;  3I0T A;  1PUE E;  2UWM A;  2KIF A;  1B59 A;  1G3W A;  1F4K A;  5J8C A;  4EJU A;  2M5W A;  3GFM A;  1H9G A;  1Z91 A;  3K0L A;  3U2R A;  2B0L A;  4CGZ A;  1ZH5 A;  1DPR A;  1FT9 A;  4P9F A;  4EJW A;  1VTN C;  4G7O F;  1B9N A;  4L5J A;  2VBZ A;  3R6S A;  2HTS A;  5CLS A;  2VON A;  3L7W A;  1SFU A;  2P5L C;  3H3U A;  3M7G A;  3CO7 C;  3TDZ C;  2A3S A;  5J6X A;  4IVN A;  2VC1 A;  1S7A A;  4RAZ A;  3BDD A;  3IWF A;  1I1S A;  4N9H A;  3RYR A;  3T8R A;  3ZPL A;  1S3J A;  1HQC A;  4KIB A;  1IXS B;  2F2E A;  2FE3 A;  1XDS A;  4I09 A;  2NNY A;  1BM9 A;  1ZAR A;  2M30 A;  3REO A;  1YW7 A;  1BI2 A;  4I0B A;  3TOA A;  1XGN A;  1BN5 A;  4MTE A;  2PMU A;  2VOD A;  3WU0 A;  4KFC A;  1HW2 A;  1BIB A;  3GEZ A;  3KEO A;  4OOI A;  1ZHF A;  2FNA A;  1SD6 A;  1L0O C;  2R7D A;  1LVA A;  2J5P A;  2FA5 A;  3FM3 A;  5D4R A;  1WRJ A;  2D1H A;  4A6E A;  4HF1 A;  1O3Q A;  2W85 A;  2HQN A;  5BMZ A;  1U8R A;  3KP6 A;  3WE2 A;  2FBK A;  2E1C A;  1S8N A;  2DW4 A;  4ZYD A;  3I64 A;  3JAM Z;  2FXA A;  1YFH A;  1KU3 A;  4G9Y A;  3RDI A;  3ZMS A;  4XSX F;  4EM0 B;  3O6B B;  2EFP A;  2BEO A;  2Z5U A;  1AWC A;  1D5V A;  4I01 A;  1ON1 A;  2XAQ A;  3N4M A;  1XSD A;  2NAZ A;  3EET A;  1P6R A;  3DQV C;  1W4M A;  2O6G E;  1HXD A;  2R7F A;  2F5E A;  4IRH A;  3KP2 A;  4R79 A;  1MJ9 A;  2IRF G;  2OQG A;  1DPU A;  1G6N A;  4ZH4 F;  1U3E M;  2OAZ A;  3BP8 A;  4IJA A;  4WF2 A;  1HW5 A;  1R5H A;  1UST A;  4CIC A;  2ZCW A;  1XSV A;  3QPH A;  1YG2 A;  2IA2 A;  1XCB A;  2KRF A;  3S2W A;  1BI3 A;  1G3T A;  1B1B A;  2NYX A;  3TO9 A;  4U88 A;  2O8X A;  2QWW A;  4UXN A;  1XDU A;  5IT9 Z;  1LNW A;  4CXF A;  2V1X A;  2O0Y A;  3F3X A;  3V8L A;  2P4W A;  4G8X A;  2PN6 A;  3QAH A;  2HTJ A;  2IPQ X;  3KET A;  4MEX F;  4PGG A;  3MWM A;  4HF2 A;  2P6S A;  4K2E A;  3VEP A;  4I7H A;  4RS8 A;  2GXG A;  2HDC A;  4LGW A;  4EGZ A;  1OMI A;  2GWR A;  4KIF A;  2HYG D;  3L00 A;  4HZF A;  2MA3 A;  4WXD A;  2LDU A;  5L3G A;  3BJA A;  2D2W A;  2ZJ2 A;  3VFZ A;  3RKY A;  3PQJ A;  2W24 A;  5ILV A;  1FSE A;  3HHG A;  3T8T A;  3WTV C;  2CSO A;  1FWZ A;  2G7H A;  3M1E A;  3EDP A;  1HKS A;  3J81 K;  3P9I A;  1YO5 C;  4Y15 A;  4DQ2 A;  2EV5 A;  1FY7 A;  3JTH A;  3BJO A;  3QP6 A;  2DTR A;  1B4A A;  1YIO A;  4HLX A;  3F6V A;  2XGX A;  4Q5S F;  3WTX C;  3K1M A;  3GLX A;  4YG2 F;  4RB2 C;  3GX4 X;  3BPX A;  3JTG A;  5D5U B;  5A2Q K;  2V6C A;  1GXP A;  2HKO A;  2P5V A;  4RGR A;  1RI7 A;  3W6K B;  3JSO A;  1MZB A;  5EEH A;  2QYO A;  4R1H A;  4FX4 A;  2VBY A;  5A2Q Z;  2RV8 A;  4P9U A;  2E1N A;  1XGO A;  3E97 A;  1XB4 A;  4JBA A;  4P55 A;  5D4S A;  1IN5 A;  4EM2 A;  4HX7 A;  1LQ1 A;  2HEO A;  1I27 A;  1P2F A;  3RIR A;  3T5X A;  1G4D A;  3IL2 A;  3CTA A;  3MZH A;  2VE9 A;  4B09 A;  1MD0 A;  2JRT A;  1YS6 A;  5EEG A;  3QU3 A;  4EVI A;  2DBB A;  4EV0 A;  4G6D A;  1ZLK A;  1BJA A;  2L4M A;  4LB6 B;  1SMY F;  4UHT A;  2WC2 A;  1PDN C;  3VB2 A;  5D5V B;  1UB9 A;  3J80 Z;  1SFE A;  3D5L A;  4XLP F;  1O7F A;  2ISZ A;  1Z1D A;  4HV6 A;  1FP1 D;  1G3S A;  3WTS C;  1KQ0 A;  4M9X A;  2OA4 A;  4AD9 A;  2G7U A;  1LEA A;  2K02 A;  4HBL A;  3WOD F;  4FT8 A;  1TTY A;  1KU2 A;  3V8K A;  2O61 A;  5LRR A;  2EA4 A;  1KGS A;  2PLY A;  3KP5 A;  3FF5 A;  4I98 B;  3LWF A;  3KEQ A;  3TDU C;  2FBH A;  4M74 A;  5HOO A;  3HYI A;  2QM3 A;  3HSE A;  2DK8 A;  2Y0M A;  3E5X A;  1S7O A;  2EV0 A;  3E3V A;  1L3L A;  3RTR A;  1YTY A;  1T38 A;  4MHG A;  3F8C A;  5L3B A;  2FNP A;  5E1X A;  4EGY A;  2HOE A;  4PZJ A;  4ENN A;  5D8K B;  1ZG3 A;  1IXC A;  2VOP A;  3I59 A;  2IVM A;  2A6E F;  1BI0 A;  3DKW A;  3I58 A;  4MTD A;  2A07 F;  2UXX A;  1JHH A;  1OKR A;  3I53 A;  3V4G A;  2D45 A;  3WTU C;  1E17 A;  1SFX A;  4BHC A;  3FHZ A;  2WWY A;  1PP8 F;  1BBY A;  2L54 A;  1ZRC A;  3J7A O;  4RB0 A;  1WQ2 A;  2GA1 A;  2ESH A;  4KIG A;  5K1Y A;  5HS8 A;  2PG4 A;  4GCV A;  2ELH A;  2XUB A;  1KQ9 A;  1R1U A;  1TNT A;  5FO5 A;  1DUX C;  5BQT A;  4HA8 A;  2RVC A;  4ESB A;  3ABU A;  1KU9 A;  5DEQ A;  4KMF A;  3ZMV A;  3GO5 A;  3IKT A;  1D8K A;  2MLK A;  5AON A;  3U1D A;  4OMZ A;  2MBF A;  4U0W A;  2VT3 A;  1XD7 A;  3W6J B;  1FP2 A;  1LDJ A;  1QZZ A;  4L0Y B;  5ED4 A;  3FMQ A;  4A0X A;  3QU6 A;  2MD5 A;  3K69 A;  5E1W A;  4AWX B;  5LRS A;  1FBU A;  1QNT A;  1USS A;  3KLO A;  2XRO A;  4G94 A;  1WSU A;  4EMS A;  5LEJ A;  1HBX G;  1F1Z A;  1UHM A;  5CVJ A;  4AIH A;  3FXU A;  2IP2 A;  4UV8 A;  4HDU A;  1MDM A;  2TDX A;  2VXZ A;  1TW2 A;  3GW2 A;  3JAM K;  4MEY F;  2VT2 A;  1R5G A;  4LG0 A;  2JPB A;  4L9J A;  1ZG1 A;  5BPI A;  2KJC A;  2XV4 S;  5HLI A;  4A5M A;  1Z6T A;  4PCQ A;  4HLY A;  1K78 A;  4LJZ F;  4RGS A;  3COA C;  1IAW A;  1FX7 A;  4L5I A;  1ZAO A;  1IN4 A;  2RKH A;  1JXS A;  3E5U A;  3GUD A;  4U7D A;  1UFM A;  3L09 A;  4MQ9 F;  1H0M A;  4HDV A;  3F72 A;  4KN4 X;  1IRG A;  1F9N A;  1Y0U A;  2STT A;  2ZME B;  3HUG A;  2M1B A;  4ETS A;  2YSR A;  1Q1H A;  2WTE A;  2JZY A;  5DCM A;  3SZP A;  1O3S A;  2PEX A;  1GVJ A;  3LAJ A;  3K1P A;  1H9T A;  2XAG A;  3BZ6 A;  3HRT A;  2XRN A;  4KN7 X;  5JR3 A;  2X0L A;  3T1B A;  5FLX K;  1HW1 A;  3I71 A;  3E6B A;  3ZP5 A;  5FB2 A;  4RAY A;  4AIJ A;  4YII A;  1YW8 A;  1I6X A;  1O7L A;  4NHJ A;  3KP3 A;  1ONV A;  5BS6 A;  4QWQ A;  4JK1 X;  4HAM A;  5LHH A;  1UHW A;  2BBY A;  1FYK A;  3RJP A;  2A61 A;  1JGS A;  5HS7 A;  3DP7 A;  2PMH A;  1W7P B;  1J7K A;  2L02 A;  1ZRD A;  1OYI A;  3Q5F A;  1T2K A;  2HQR A;  2O03 A;  1U5T B;  1WWX A;  2DU9 A;  1O57 A;  3ZN0 A;  1QGP A;  1TQI A;  2H94 A;  4G7H F;  2L3D A;  1K6O A;  1ZLJ A;  2CYY A;  3FXR A;  1A04 A;  5FD6 A;  3B73 A;  2O3F A;  3OV8 A;  3CLO A;  3HHH A;  4ENJ A;  3D0S A;  4U7B A;  1P4X A;  3BOQ A;  3O3K A;  4ESJ A;  2JTV A;  3KZZ A;  1Z6R A;  3GFI A;  5H6R A;  4A0Y A;  2V1D A;  2HR3 A;  2E7X A;  4CZZ A;  3ERE D;  1S29 A;  1YQA A;  3GYH X;  2FMY A;  2JT1 A;  4A6D A;  4LK0 F;  3M8E A;  1IN8 A;  2JPC A;  4LLG F;  1R22 A;  2OU2 A;  3QRF F;  1KYW A;  4UUV A;  3I5U A;  4ZYE A;  2OQR A;  1TQP A;  1NHA A;  3OOP A;  4LFU A;  3I54 A;  5FFX A;  2EA2 A;  1R1V A;  1XMA A;  3Q9S A;  2CWE A;  4IHS A;  2FSW A;  3EUH A;  4RB3 C;  1KA8 A;  2COM A;  5D6F A;  2M87 A;  3KCC A;  2AXL A;  6PAX A;  3IWZ A;  3SHF A;  1T98 A;  3WTW C;  3F23 A;  2MH2 A;  4WX9 A;  4Q4Z F;  1ZGA A;  4WK8 F;  4LG0 B;  2RNJ A;  4WCG A;  2J5O A;  2STW A;  3I4P A;  3MEX A;  2W84 A;  1J2X A;  1P4A A;  4WXH A;  3LFK A;  2IA0 A;  4OU0 A;  4HV5 A;  2VN2 A;  3FX3 A;  3VOD A;  4L0Z B;  2VC0 A;  2PBI A;  3HSR A;  4ENM A;  2XKO A;  3IRR A;  2MC3 A;  1MDM B;  2QBY A;  2Z9O A;  4RB1 A;  5CVV A;  1HSJ A;  2K4B A;  2XVC A;  3E6M A;  2XHK A;  3G3Z A;  1BC7 C;  2HYF A;  4ON0 A;  2IJL A;  3F8B A;  1CGP A;  5DCF A;  2QQB A;  3LQQ A;  3GZ6 A;  1R7J A;  1K78 B;  4IXA A;  5ILS A;  2F5D A;  4M72 A;  5JHU A;  5HDG A;  1V4R A;  1T39 A;  3JW4 A;  2ZNZ A;  5JVT A;  3K1N A;  1REP C;  4B8X A;  3KE2 A;  2A69 F;  3DFG A;  1ZGJ A;  3M9A A;  3B02 A;  4RGU A;  2P7C B;  5L3C A;  1QBJ A;  3VOE A;  1BI1 A;  2QVO A;  2HWV A;  1IUY A;  5DUK A;  1DP7 P;  2IT0 A;  4XBF A;  3SZT A;  1MJB A;  1BC8 C;  2EWN A;  4R8H A;  4IPA A;  1GXQ A;  4NQW A;  3EYY A;  1TLH B;  1OPC A;  2ZNY A;  2DAO A;  2QBY B;  4EJO A;  4EJT A;  3P9C A;  1MGT A;  4OMY A;  1TW3 A;  3HIF A;  3NQO A;  5DUI A;  1FLI A;  1EH7 A;  2YR2 A;  3ECO A;  1CF7 A;  4Z2Y A;  2RGV A;  4Q48 A;  2DLL A;  3MQ0 A;  2DK5 A;  1P4W A;  2ZBK A;  2ZXJ A;  2QEN A;  3RPQ A;  1XGS A;  4P5O A;  4ZZL A;  2E7W A;  2VOO A;  2RN7 A;  4M71 A;  3LA7 A;  5FGM A;  1P92 A;  4HX4 A;  3M8F A;  5HS9 A;  3ZMD A;  4IF4 A;  4L9T A;  2UZK A;  1EH6 A;  1BOA A;  4CHU A;  5D8L B;  1TBX A;  1SAX A;  2H27 A;  4GO1 A;  3WG9 A;  5ERI A;  5TJJ A;  2IW5 A;  2Q0O A;  2V9V A;  4Q47 A;  1YLF A;  3FZV A;  1R1T A;  3K9T A;  3QP5 A;  2NS0 A;  5CYV A;  3SQN A;  4CYD A;  3HTU A;  3KP7 A;  3HOS A;  2BGC A;  1I5Z A;  3IHU A;  4IHT A;  1R36 A;  1W5S A;  2Q8K A;  4P96 A;  3DEU A;  1TQM A;  4M6Y A;  1T6S A;  4GYG A;  4GYI A;  2OZ6 A;  3DF8 A;  1IW7 F;  4LMY A;  3RYP A;  2P6T A;  3CUQ C;  4BYY A;  1ZRE A;  2EB7 A;  5BPD A;  3BJ6 A;  5K5R A;  2OD5 A;  4XSZ F;  3PQK A;  3C7J A;  3SFZ A;  4N0B A;  1EV7 A;  3ZMT A;  3CJN A;  3Q9V A;  2RQP A;  5BOX A;  5LHI A;  4A5N A;  5DYM A;  4HF0 A;  2BE5 F;  1XMK A;  4ENK A;  1LJ9 A;  2MLG A;  4KYW A;  2LNB A;  5ICC A;  3GXO A;  4M6X A;  3WE3 A;  1WI9 A;  2DQL A;  5FLX Z;  1MJA A;  2XAJ A;  1S6L A;  1QO0 D;  5E17 F;  3TO6 A;  4EJV A;  3ELK A;  1FBS A;  1IRF A;  1HKT A;  5F6F A;  1U6G A;  1J75 A;  1IF1 A;  3HRU A;  4E70 A;  2C6Y A;  5IT9 K;  4G6Q A;  2HGC A;  5FFZ A;  3T0Y A;  1RUO A;  3R0A A;  5LGU A;  4IRI A;  4KNY A;  2FF4 A;  4S05 A;  2OBP A;  3N97 A;  3F8M A;  4XLN F;  2F5F A;  2CW0 F;  3ULQ B;  2EK5 A;  1W5T A;  3BWG A;  5HVQ C;  4HW0 A;  4GGG A;  2G9W A;  1R23 A;  3FMR A;  5H6Q A;  1IXR C;  3CUO A;  2F5C A;  4IRG A;  1SD7 A;  1PP7 U;  2V1U A;  1XSX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...