2VT2A

Structure and functional properties of the bacillus subtilis transcriptional repressor rex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
199
structure length
184
Chain Sequence
ATAKRLPLYYRFLKNLHASGKQRVSSAELSDAVKVDSATIRRDFSYFGALGYNVDYLLSFFRKTLDQDDVILIGVGNLGTAFLHYTKISMAFDINESKIGTEVGGVPVYNLDDLEQHVKDESVAILTVPAVAAQSITDRLVALGIKGILNFTPARLNVPEHIRIHHIDLAVELQSLVYFLKHYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and functional properties of the Bacillus subtilis transcriptional repressor Rex.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
molecule keywords REDOX-SENSING TRANSCRIPTIONAL REPRESSOR REX
total genus 56
structure length 184
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02629 CoA_binding CoA binding domain
A PF06971 Put_DNA-bind_N Putative DNA-binding protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2vt2A01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2vt2A02
3KP3A 1ULSA 2I3GA 1GQYA 2P6TA 3BHJA 3T7EA 3GY0A 3DPTA 4RB0A 3QSGA 4YT2A 2ELHA 3BMOB 4FQ8A 2Y75A 1HYGA 1Z74A 1ZG5A 3LA2A 2HLPA 1NPDA 3OJLA 3QA9A 4GBJA 8LDHA 3SZTA 5J23A 2O3SA 4P5OA 4CMEA 2GAUA 3QQPA 4ZN6A 4WF2A 1DO8A 2K4BA 1SD5A 2RNJA 5EEGA 2LKPA 1C0KA 1J75A 3I9OA 4GSKA 3SX2A 3K73O 2P4WA 3V2GA 2J6IA 2P91A 1F17A 1A5ZA 1H0KA 5JAQA 3ZQ7A 3D1LA 2VC0A 3C8MA 3KYBA 3D0SA 1Z9CA 2O23A 2GD1O 4WGGA 4P38A 1M6HA 2OQGA 1GHCA 1IZ1A 1LA2A 3MTJA 4J2OA 1NHWA 3TZHA 3WBBA 4M72A 1B8PA 1HSZA 3M2PA 4YAIA 4WOJA 4S04A 4AJ2A 2Y1EA 3F8NA 2D1HA 1F12A 5KKAA 5TX7A 4PVDA 4XDZA 4URFA 4QEDA 2QQAA 5JI6A 1KERA 3Q2KA 3C18A 3WE2A 1BIAA 2B4RO 3QV1A 1ZG3A 4A0XA 4BHPA 3M6IA 3HNPA 4QXMA 3MEXA 5KNLA 4LMPA 4OKNA 1TT5A 1C1DB 4N7RA 3KSUA 3H9JA 2VC1A 5HVQC 5LDHA 1GPJA 2HQ1A 2F5FA 2DPHA 4DPLA 1RM5A 4J49A 2I9PA 4ZYDA 5L3CA 4D45A 2NVUB 2Y1OA 1GD1O 4IIVA 2M5WA 1IYZA 4RB2C 3FMRA 3HG7A 2L54A 1V0JA 4J43A 1IXRC 3KM0A 1VL6A 4EM2A 4TZKA 4BGEA 2LDUA 2MC3A 4M54A 3ZV6A 1LEHA 1Y8QB 3D4NA 3N7UA 4RAYA 4YEDA 3PYXA 4XB1A 2OL4A 4HWKA 4R79A 1ZK1A 2X5OA 5LEKA 3GR6A 3LVFO 4ALNA 1EUDA 3TZKA 2P68A 3J7AO 1L3LA 1SAXA 2XF8A 4S05A 2E48A 3DBHB 3DWFA 1A7KA 4I01A 2O3TA 2CF6A 3EC7A 1AOYA 1T24A 3L4BC 5IZCA 1KVUA 2VOJA 5H6RA 1X7DA 3F1LA 3WICA 3ZP5A 2Y0CA 1NASA 3E5UA 4ESBA 3QWIA 2BYVE 2JFFA 4M6YA 1C0WA 2GCGA 3IWZA 5L3FA 2YW9A 1GXQA 4R3WA 1MDMA 3A4VA 3GNQA 1DIBA 1TT7A 3JD4A 4NR0A 2XAFA 1ZK3A 2DTXA 4RZIA 3RFXA 3ST7A 4CL8A 2MD5A 4IDBA 3R61A 1E17A 3ONDA 2A61A 1CETA 1NBOA 4DQUA 2GN8A 3PDJA 3WFIA 1YE3A 5EPOA 4R16A 3SJ7A 2WD7A 2HKXA 2FOIA 4LLGF 3BMOA 2UZKA 1BMDA 3DZBA 4Q9NA 1V3FA 1B59A 1QMGA 4K28A 3LQFA 3V2UA 1B8VA 3VTFA 1AE1A 1C1XA 1ENPA 3TJRA 5JO0A 1N7GA 4A6DA 2OUIA 1LLUA 3IOYA 4J7XA 5ER9A 3KP7A 4NQWA 4KNYA 3PLNA 1I5RA 2HZTA 2O61A 4FJ1A 4XJTA 1DIRA 1E92A 1U7TA 1U1IA 1QLJA 4ND5A 2WC2A 2YY7A 3JD2A 5HS8A 5L7YA 1GYPA 5ENVA 5TRDA 4KP7A 2C7GA 2PLYA 4PGFA 3ZWMA 2MH9A 3G49A 2CSUA 1KQ0A 1IN4A 1XGSA 2ESHA 4WEQA 2DFVA 1OR7A 3VH3A 4N9HA 4UEKA 5D4SA 2I66A 5H81A 2QIOA 3WGYA 1JE8A 3FM5A 1NP3A 5IJZA 5I7EA 1HDZA 2OFPA 3QRWA 2JCVA 3F9IA 4LRSB 4GAEA 4TVBA 3COAC 4IJVA 1ISGA 1UHMA 3FR7A 4WJZA 2HQRA 3TQHA 1XCBA 3LA7A 4WE3A 2YPRA 1T98A 2FXAA 3HB5X 2HMWA 1SD6A 5T8KA 2JJYA 1S8NA 1HXDA 2WV0A 3SHFA 4C7KA 1ZK4A 4E2WA 5A1TA 1CF2O 1DRUA 4JQCA 2OP0A 3DHEA 3DZFA 4IBOA 4HX4A 3MOIA 4UREA 3RC1A 2AQIA 2ZB3A 4JP2A 4DLLA 3D4OA 4MP6A 1ZH5A 1MJBA 1KU7A 3QY9A 1JGSA 2X0JA 3V2HA 4CLXA 1BI0A 3JQ8A 3ONFA 1U5CA 4FDAA 4YCAA 5KWEA 2CFCA 4EM0B 1E6UA 2OMEA 1LQUA 4PZEA 4I02A 3TPCA 4W7IA 1AHIA 1UUFA 2NLOA 3BPVA 3LA3A 1UAYA 1YKFA 3E6BA 1G0NA 5D8LB 5KOIA 3KP5A 4BVAA 1O3QA 3RKUA 1DDNA 1KVTA 2FZEA 3DHYA 3KP4A 3WTTC 5A06A 3I6QA 4O5OA 2NM0A 4J6FA 3O2PE 3L6EA 4R54A 1CWUA 3GZNB 3CH6A 5E1WA 5FFXA 3ZMUA 4W7HA 1Z05A 5TJ9A 2DUUA 3WYEA 5BMZA 2AEJA 3PFIA 3RJ9A 3Q9UA 2B5VA 3NDRA 1IN8A 1CJCA 4XRFA 2B4TO 4Y15A 2DK5A 2ZQZA 3JYLA 4IQGA 4KUGA 1XYGA 5COBA 2EFPA 1P77A 1TT5B 4KMFA 1D3AA 5E1XA 1MD0A 1V8BA 4OGWA 3LWFA 3IWFA 3IJPA 4BNIA 3FR8A 1ENYA 1RUNA 4LN1A 3F8BA 4UVAA 2FR0A 2NSDA 1PJSA 1WNTA 3C24A 3LSTA 3JYQA 3ROUA 4UVIA 3P5SA 3TF5A 1K78A 2VBZA 3W8DA 3TO9A 5EQDA 3JQ9A 4FOSA 3K92A 1H9GA 1NQOA 1HZJA 4XYBA 1J9IA 4NG5A 5HBRA 2ZYDA 2PH5A 2I65A 2WD8A 5EINA 3UCXA 4B79A 3I9LA 3GGOA 4Z9FA 3F8FA 1H0MA 3QWBA 2HDCA 3I59A 3ZMZA 1EQ2A 1SOWA 3K69A 5G4KB 3GEGA 3BJOA 4RCVA 3HSRA 3ETEA 3S8MA 1RYEA 3KYDA 4BNMA 1K6XA 3C1DA 2JAHA 3K2EA 1XQ1A 3PVZA 1HDCA 4LK3A 1UXKA 3BAZA 3VZQA 4QWQA 2AA3A 5ILUA 3NT4A 5A3JA 1Y81A 3JQ7A 1U8FO 4S1VA 4ZGWA 3GH3A 4EGZA 2PZJA 1OOEA 4BMNA 3F6YA 3IMFA 3WTCA 3I71A 1P0CA 1QYXA 3K8ZA 4FR5A 4M87A 4DIBA 4AJ1A 4AWXB 1D5VA 1A7AA 4ZD6A 4KMUX 3F3XA 2OOSA 3Q11A 4XJSA 1VLLA 3ORFA 3UH1A 4RLSA 1EH8A 1DHRA 1YH3A 3I4CA 4Z0PA 3O3KA 4MNUA 1NWHA 4BNKA 1C3VA 5BQFA 2D0IA 3GMSA 3H3UA 5A9SB 3GGPA 4XGNA 2FBHA 2XAGA 1NPYA 1PZHA 2A4KA 1U5TC 1JAXA 3DOJA 2LF8A 1DFIA 5BQTA 1DIHA 2QBYA 2BD0A 1OZAA 4RGUA 3B20A 5TJJA 3NQOA 1N5DA 4PLCA 4IDDA 1PR3A 2VYVA 3R60A 5E17F 1Y0UA 1KU9A 5E20A 3IL2A 4FX4A 2ZKLA 4CMBA 4RVFA 1ORRA 7MDHA 1ISFA 1YL5A 1A9ZA 4HP8A 4BGIA 4R9SA 1YO6A 2H6EA 1K2WA 2IZZA 5EN4A 5T6BA 1IXSB 3RBZA 3WJAA 3KSZO 2CDAA 1MB4A 3TKYA 2OBPA 4WK8F 2QYOA 4Q48A 1E6WA 3ABIA 3PP8A 3PFFA 4OOEA 2BV6A 1BXGA 1U28A 4XKJA 5KJ6A 1OYWA 2DTDA 4EGFA 2EIHA 2PBIA 1B8UA 1IZ0A 1MC5A 2P9CA 1SCUA 1R1UA 2GLXA 1Z6TA 3W6JB 2VOOA 1C14A 2P4QA 4R4JA 3ZDFA 1KGSA 1B9NA 1VE9A 2ZCVA 3JD0A 2NVBA 2PG4A 1VM6A 1BBYA 2FSSA 3UICA 3HADA 4NDNE 1D7OA 2V6MA 1BN5A 4ZICA 4O0LA 4QECA 2G76A 4ETSA 1HF3A 3I58A 2DPDA 1YW8A 2AMFA 1G3SA 2OGUA 3I9JA 3CXRA 3TDUC 3G73A 1R22A 4GYIA 3ZMSA 1P92A 2FU4A 4U0YA 4CHUA 1QORA 1ZIDA 2M1BA 3PZBA 3WXBA 5ITVA 1FXSA 3PYLA 3C1TA 4B4OA 3C1AA 4CR8A 3GFGA 2NU6A 2IA0A 1JU9A 3GVCA 3NDIA 4E13A 4OIPF 4J4TA 1U4SA 4ZYGA 3NX4A 3A28A 3M2TA 3Q1LA 1HDXA 3PFWO 2PKQP 2C07A 4ENNA 4D0PA 1CQJA 3N58A 2Y66A 1BI3A 3ZWAA 3WFJA 4R41A 5GZ3A 3OV8A 4TROA 3D7LA 3ZWWA 1EBFA 2ZTMA 2EJRA 5IAAA 3DV8A 1PGJA 2X86A 2CSOA 2EW2A 3DAFA 4FGWA 4UUOA 4OSPA 2FHSA 4J9UE 4HV5A 5DBGA 1JKFA 2EFOA 1YO5C 1U3WA 4LK1F 2AHRA 2RHRA 1UAGA 3FN4A 1PP7U 1P31A 4PLHA 5FI3A 1LDGA 2NRAC 4NQZA 1N92A 1XU9A 5LHGA 1HRDA 4MPDA 4CV0A 1ZRCA 3U9LA 3VTZA 1O95A 4DIOA 1R4MA 2QZ8A 4RDIA 3FBGA 5FLXK 1WQ2A 3AAFA 3NRCA 5IDYA 1O7LA 1YS7A 4KN7X 3RI4A 1RUOA 5IF3A 3DO5A 3EAGA 4L4SA 1B3RA 3GZ5A 4Z6KA 2IA2A 2XOXA 4FOOA 4LVUA 2VHVA 1RM0A 2E1NA 2BBYA 2JHFA 3KYCB 4R51A 5AOVA 3UHAA 3HDQA 1UXHA 3B70A 2FMUA 3D0OA 2LNBA 5FGMA 1ZJZA 2QYTA 3TDZC 5DCFA 5L95A 3FX3A 2KKOA 3IJRA 1E3WA 1A27A 1PQUA 3K96A 3RUFA 4N5MA 1B16A 5LCXA 2CQKA 5KVRA 3TOXA 1JKIA 3O38A 3R6DA 4H0EA 3I0TA 5DCWA 3GN1A 4MEYF 2Q8KA 3OMLA 5AXCA 3UAGA 4IIUA 1IF1A 2OXIA 1BGVA 4XX0A 3C7CB 4OQYA 2VHZA 3HRUA 5KKCA 4HDVA 3I9MA 4CLEA 3U49A 1LBEA 2ZJ2A 5ICEA 2H09A 2L4MA 3H4VA 4GWGA 3HWRA 5DD8A 2QX7A 3H9QA 4G9YA 2DTRA 4TVOA 3D3WB 4RL6A 4M89A 3PK0A 1T26A 1DLJA 2D8AA 2IXAA 3H6KA 1UH5A 1KBZA 3PZRA 4BO8A 2V1DA 5BPDA 4Y9DA 3ZW9A 3FNEA 4E2XA 3WSVA 2Q2VA 3ISPA 3MTGA 5C3MA 2NVWA 4EQQA 1KU2A 3BZUA 4KMSA 3WIEA 3BPXA 4ZA2A 5JDCC 2VZ0A 5I8ZA 4ENKA 4EI2A 4RVSA 2BGCA 2GASA 3STHA 4BNGA 3OICA 2Y0MA 4M8SA 1HW5A 4WXDA 2BGKA 4ND4A 1O6ZA 4IJUA 3GEDA 1R12A 3DBVO 1BSVA 1F4KA 2JCYA 3OBBA 1DP7P 4BNHA 4JROA 4F6LA 2FSVA 2GN6A 1HLPA 5JAIA 1PQPA 2G7UA 4LB6B 3RYRA 2JTVA 3QJ5A 4U88A 5IXYA 4ZVVA 1HETA 3SXYA 2FP4A 3IP3A 1HDGO 5BR7A 2WJPA 3U5TA 4A7PA 1LEBA 4NNJA 2EG9A 2W90A 4CQLA 2YU3A 4I2OA 3ENKA 4MDHA 1W4ZA 1KETA 1O57A 4YFNF 3HSEA 1U4OA 3S2EA 1LQ1A 4XGIA 4D3DA 1KU3A 3VB2A 4YPOA 5TJHA 5TLSA 3L77A 4FB5A 4B8WA 1K7AA 4E4YA 3ANLA 1DSSG 4U6QA 4BO4A 5BNIA 1ZLKA 4MVJA 1MP0A 2ZTVA 4JIGA 1NQTA 5ADHA 4OMYA 3WE3A 2DI3A 5KVQA 2EWNA 4A03A 3I52A 3EYYA 4A73A 4IQ0A 3LLVA 3JYNA 5CAEA 4KDPA 4CM4B 5FFZA 2Y1CA 3AM5A 4CLHA 1R7JA 1IPEA 1Z73A 3FXUA 1P1HA 1LUAA 2EP5A 3E6MA 2GZ3A 1J0RA 1QNTA 3JTGA 4OH1A 3ROKA 1IY8A 1BJAA 3RPUA 1Q7BA 2D4AA 4FC7A 4I1IA 1F1ZA 3E8XA 5JDIC 4ENJA 1TLHB 3MWMA 3E5RA 1STZA 4GLOA 1SEVA 2O3FA 2NTNA 3D4PA 3WDSA 4Q3DA 3L9XA 1S7CA 1H2HA 1JVBA 4YBZA 1W8DA 3HOTA 3VPHA 4OXYA 1HW2A 1KEUA 1X14A 3JQGA 3IHUA 4F46A 3DFUA 2A69F 2H6BA 2GGSA 4DLBA 1T4DA 1P33A 4RGRA 4E30A 2A92A 1QV6A 3H7AA 3U4HA 1Q7CA 4WECA 5BS6A 2P7CB 2UYYA 4UUVA 4IJKA 5DBIA 3SC6A 3U4CA 2W24A 3I6IA 4Q3BA 5B12A 2JFGA 1ZNQO 3D5LA 3NKLA 2PJPA 1UXIA 3IAHA 3PPIA 4KUEA 4TQGA 3ZWCA 2FMYA 1PJ4A 2B4QA 3ERED 4ND1A 3IIEA 2PD4A 1BC7C 2QZZA 2QHXA 4L9NA 3FF4A 3I23A 4MIEA 2XXBA 4AJIA 1PEDA 2DM6A 3PXXA 1ZW1A 2EXXA 2Z1MA 2D1VA 4BMVA 1PSDA 1YS6A 1GEEA 2GXBA 4KIGA 3ASUA 3HOSA 1GEGA 3HDJA 3K0LA 3F47A 4HFJA 4Q3CA 3TL2A 1QRRA 1TBXA 3WQQA 4CV3A 2MBFA 4PLYA 2M87A 3I54A 3WG9A 3HN7A 3UN1A 3GFIA 3AM3A 4BNFA 3F6OA 2HCTA 1O5IA 2EA2A 1PJQA 1WP4A 2EW8A 3DZGA 3GRPA 1HW1A 5F3RA 2VN2A 1Z1DA 3BHMA 1ZJYA 4RQUA 4RF4A 3V8KA 1KYWA 4HX7A 3MEQA 3HTSB 5L4SA 4HQMA 3C7JA 1ZLJA 4I7HA 1IRGA 5EJ2A 1Z6ZA 3UOGA 4G6QA 1OFGA 1LLDA 8ADHA 4BO2A 4MIOA 1NHAA 4I9UA 3A14A 3JV7A 4PFJA 4Q3EA 4DLAA 3MFKA 5IT9Z 3ZMVA 1BVUA 4HFNA 4O59O 4R1SA 3VKUA 4CR7A 4ALLA 3U09A 2Q49A 1H5QA 3OETA 4FFPA 1PDNC 3CO7C 4UXNA 1DIAA 1A4UA 3GHHA 2P9EA 3GN2A 4JJIA 3JQGB 4DYDA 1E7QA 1VRWA 1X7HA 1OAAA 4K2EA 1G1AA 4I0AA 3GFBA 5ILVA 2EGGA 1LNQA 2YUTA 1YBAA 3H2ZA 4A5OA 4XRRA 3H3FA 3ZU4A 4YJGB 3O03A 4M49A 4L4XA 3KFWX 3JW4A 4CR6A 2KIFA 5DZSA 2QLZA 3REOA 5LRRA 3V8BA 1PQWA 2I99A 3GUYA 4J9VA 4L74A 2WM3A 3L00A 3ZWBA 4BNXA 4F6CA 3NDJA 3S2FA 3DF8A 3I9KA 4NPCA 2ZNYA 4A2CA 2PN6A 1SFUA 3GPDG 5BSHA 1XG5A 2CVQA 5IDQA 3I64A 4TZTA 2OZPA 2Q1UA 3TFOA 1UDBA 4HV6A 4L0QA 3CUQA 2AQHA 4FFNA 4DA9A 2DLLA 3INRA 1BG6A 3EHEA 1H6CA 2EHDA 2FBIA 1ARZA 1XR3A 1ISHA 3MWDB 1M66A 2EGHA 4YVFA 4IDFA 3T5XA 1WWXA 1JDJA 3LLSA 4QO8A 5DD4A 5LDGA 4PGHA 1OMOA 4CODB 1YOVB 3MJSA 3CO6C 6LDHA 3FXRA 5CG2A 3ZGYA 3ZV4A 1H6AA 1WZEA 4R1UA 3GNSA 3QVSA 3ZMDA 5L3EA 1B26A 3OIFA 5JC8A 3PWSA 2X0IA 4UV8A 4WCFC 2HK9A 2B83A 3Q3CA 4TKMA 4DWVA 1FDTA 5CDYA 1P6RA 2B0JA 3FZVA 2FY8A 1YRLA 3MWEB 2WE8A 1MKMA 1QP8A 4GX2A 4J90A 2V6BA 1PJLA 3WWZA 3WODF 3WTUC 1YL6A 3M1LA 1XIVA 4IS3A 2VONA 1WXDA 1E5QA 1U2DA 4BQRA 3KETA 3BWGA 3RKWA 3TO7A 2E37A 2O7QA 2I5PO 4IDEA 3K9TA 4IGEA 3C1OA 4Q39A 4RVUA 4YJDA 5TQVA 4CM9A 1BW9B 5BPIA 3LZ6A 2COMA 2HRBA 3GYHX 4GGOA 4ZHSA 4MKRA 5CDUA 3AU8A 3C7DB 1O89A 4CPDA 3EK2A 4JBGA 3JQFA 1YB5A 1P2FA 1C0PA 3LC2O 2Q2WA 2WMDA 3K1PA 1GZ4A 3G1UA 3NUGA 4GPD1 2PQ8A 1ZEMA 1MG5A 3ROMA 2FNAA 1PL8A 1YS4A 1HKQA 4XBFA 1G0OA 2YFQA 4I08A 4JBIA 1M76A 4EEZA 3QWFA 2EP7A 4TRMA 1ADFA 5C7LO 4BXUA 5HOOA 3AUSA 3RUEA 4XLNF 1SNYA 3AUAA 3BHIA 5TT1A 4F45A 4MOWA 2G1UA 4P9FA 2GNAA 1DJNA 5FD6A 3FRJA 2B5WA 3R4KA 3L4BA 3NGXA 1USTA 3JQAA 1GAEO 4OOFA 3FWNA 3DHNA 3HUDA 3PQKA 4M9SA 2POQX 2MLGA 1YQDA 4ENMA 1O3TA 2HSDA 4ID9A 2NVUA 3WS7A 1JAYA 4ZQFA 1YQGA 2O4UX 3CTMA 2ZBKA 4PDKA 1LB2A 2L4AA 3F72A 4PG4A 5JCXA 1I1SA 4LMYA 4J16A 5BSEA 2GERA 3FTPA 1EDOA 3SLGA 2BELA 1LX6A 4MO2A 2Z3YA 2FSWA 3CLOA 4FSHA 3FTNA 1YJ8A 3GHYA 5MDHA 2A94A 1UDCA 1ODDA 1E3IA 2M30A 3PJFA 1IN5A 3GDOA 3W8EA 2VT2A 3WGHA 4DXHA 3U0BA 1UZLA 2ZTLA 1K89A 4BIIA 3HRSA 4FHTA 1TVEA 1SB8A 2GRAA 2NADA 4K6FA 1E3WB 1H6DA 4EJVA 3FHZA 2HMSA 2I3AA 4OQZA 3AOEC 4M73A 2ZB7A 3WJ7A 2E4AA 2W2LA 4WXCA 1PJ2A 1T4BA 2D5CA 4CL3A 4BS9A 3GOHA 1DEHA 1CF7A 5E18F 1QXSA 4NFYA 4HY3A 4ALMA 1NPTO 3I4FA 3P2OA 3LC1O 2ZB8A 2F5CA 1LDJA 5IDXA 2DQLA 2G5CA 4JP3A 1ENOA 3SLKA 1O7FA 4YR9A 3MCZA 4HBGA 4JJGA 1QYCA 4EZBA 3DMTC 4FFOA 4E32A 3IUSA 3VPFA 1B15A 5CDTA 2AE2A 2BFAA 1T38A 2H63A 3AY3A 3HRTA 3PLRA 4KDFA 2YFHA 4CGZA 1TQIA 1QSGA 4JXKA 4LG0B 2X9NA 4HXYA 1OPCA 2Y99A 1H6BA 3AI3A 2BEOA 1DOHA 2VWHA 4WWCA 3CUKA 2XRNA 4ZQHA 4BQPA 1NAHA 1UJMA 4WOKA 4IVNA 2EB7A 4G7OF 1XKQA 2X9VA 1JHFA 5F5LA 3PHHA 2QRLA 2W8ZA 1ZKMA 1KEPA 3DXJF 3E5MA 4BOYA 4WASA 1DLIA 1EDZA 3FWEA 3MZ0A 4CM3A 1GUFA 3UF0A 4ZJUA 5IN4A 4EMSA 4L18B 1HE2A 5JFOA 3ZWYA 4CMEC 4EM1A 1QR6A 1U8XX 1WPQA 4KIBA 1H93A 3ADPA 5F1KA 4TMFA 4A5MA 5JBIA 3KEQA 3L0DA 2P4HX 4JBHA 4P22A 4ESOA 2J8ZA 4KWIA 3DOCA 1ZUD1 1ZCJA 4XDYA 1S6YA 1DBVO 1R0KA 1DAPA 1M67A 3R0AA 5COAA 4AD9A 3TL3A 4A0SA 1PGNA 4RPGA 1WDMA 1IRFA 4UULA 1GV1A 3D3EA 3H2SA 4Y6RA 3C3WA 2X5JO 2JD0A 1O0SA 4A26A 1O9BA 4N18A 4DVJA 3QHAA 4AJJA 5C37A 3K9QO 4BO1A 2IODA 2KRFA 3MOGA 5JDIA 1JQBA 4A27A 3KZVA 2DO7A 2V6CA 1Z82A 2GR9A 1HWYA 2WD7B 1E7WA 5KJEA 5DOVA 2EK5A 2WWYA 1T0FA 1Y8RB 4TSKA 2WDZA 5FFFA 5H83A 4YQZA 4EDFA 4DREA 1SFEA 1KYQA 5CJ9A 4PIVA 2XIGA 4U0WA 1EK5A 3VPSA 2ISYA 3C85A 2VE9A 3ONEA 5LGTA 4NBTA 5KVSA 4LJZF 1NVTA 1QKIA 2JT1A 4GCVA 3JTMA 4HAMA 2EV0A 1N8KA 3P2YA 4UVDA 4JK1X 2H94A 1NR7A 2A6EF 2NU8A 4IZIA 3GNTA 2RHCA 4CMCA 1D3YA 4NBUA 3ZHZA 4CMAA 3KSDO 1N9GA 4P4GA 5JMWA 1R5HA 1XSEA 5L9AA 2JD1A 3F8MA 1GCOA 3KLNA 2SCUA 3RD5A 4UUMA 5FEUA 1SMTA 5CVIA 4YJHA 2CVZA 4I8XA 4LGWA 4GI2A 3OQ6A 4U7DA 2VCYA 3F4BA 5I8WA 5L7WA 3GEZA 4A2UA 1SD7A 3V7CA 1E3LA 4CUKA 1TW2A 2OO5A 4G7HF 3DEYX 5ERIA 4B4UA 5CDGA 4BNLA 3ZI0A 5MGBA 4TRNA 2VNSA 4M9XA 3WTXC 4I5DA 3CEAA 1KVQA 4IMRA 3BOQA 3ZNOA 5FD5A 1XD7A 1BDMA 1IW7F 1I36A 4EUFA 4B4WA 4IRGA 3A1NA 3JSOA 3HB4X 4F3YA 3P9IA 2V6GA 4NFHA 2HS5A 4D41A 1WLYA 4QFDA 4D42A 4HF0A 2BRUA 3DBHA 4QO7A 2VUUA 2K02A 2QM3A 2DBVO 2VN8A 3WR5A 1KEVA 4IJWA 1QGPA 1BIBA 1KA8A 1EVYA 1G6KA 1MV8A 1MC4A 1K78B 3D5TA 3QE3A 4BNTA 4J7UA 2P5VA 5E8GA 2R7FA 3E48A 3PJEA 3NT5A 4MVJE 3TSCA 1REPC 2R00C 2LF7A 1PGQA 4XR9A 5BT9A 2H27A 1LDEA 1ONVA 4BNUA 4D0SA 1YWGO 4BKOA 4EYEA 1GTMA 2O8XA 3WQSB 5DCUA 3ZCXA 4YT4A 4D0RA 2D3TA 2YHIA 3WTWC 5F1PA 5JPIA 2ZYGA 4LCEA 2OQRA 2PKQO 1FBUA 1ZFNA 4TWRA 5DEQA 4R01A 5KTKA 3RUIA 1CIVA 5L45A 1ZRDA 2ZFWA 3H3ZA 3I5UA 2DBZA 4JK3A 4NZ9A 1KQ9A 3PI7A 3RC9A 3EUWA 1U5AA 5JHUA 1Z45A 4AJEA 4OM8A 4NHEA 2HYFA 4WLEA 1E1NA 3HYIA 4XD2A 1LC0A 4XB2A 3EGOA 3W4KA 1LSJA 5FB2A 2BE5F 4PRLA 2M8EA 5L4LA 5JR3A 4CQMD 3K5PA 3HDHA 5LHHA 4MEXF 1HT0A 1L7EA 3QW2A 3W4JA 2HOEA 1IXCA 3CUQC 3JQ8B 4M1QA 3TOBA 2HTJA 3ZPLA 2I6TA 1E3SA 2H5LA 2GIVA 4B7XA 4RV9A 5JXWA 1YW9A 1O94A 5L3GA 1EEHA 4Q47A 2P7VB 1NNUA 2AG5A 1CGPA 3WMWA 5DP1A 2GUGA 2RCYA 1AXGA 1FP2A 4HF1A 1KEWA 4CMIA 3JAMK 1GV0A 1UP6A 3PDUA 3UKOA 3QPTA 4RGXA 1I1GA 3RTRA 1YIOA 3A9WA 4RPJA 3R0JA 3HFGA 1JKJA 2PZKA 4D46A 5HDGA 1DHTA 2J5KA 4CDGA 1GYRA 4EITA 2F5DA 2Q1SA 3EY4A 1EBUA 2FRDA 4YAGA 2CNBA 3B1JA 1DPRA 3PQEA 5D5XB 3BMQB 4ASNA 2DU8A 1PTJA 1PIWA 1GVJA 2PV7A 1JLLA 3MJCA 4GMFA 1W6UA 4S3MA 5J6XA 2IRFG 1XA0A 1IHYA 5LHIA 3RDIA 1SPXA 2EV9A 1UDAA 2YYYA 1V4RA 2FPIA 3FCOA 5FF9A 1Z7UA 2Z99A 5T5QA 1P0FA 1V6AA 1V9LA 4OYRA 1LC3A 3GLXA 4ZH4F 2BFPA 2VHWA 2PKRA 4FFLA 5JAZA 2IJLA 2X0RA 3RYPA 3TO6A 1KIFA 2JFHA 4Y98A 1D8KA 3JYPA 3DZJA 3SVTA 3KLMX 4CQLB 5HDNA 1XQ6A 3FMQA 1FYMA 4RZHA 1H9BA 3ZNPA 4B3JA 2W2KA 1O3SA 4A5NA 4L0YB 5BSGA 4GX0A 5A9TA 1CERA 4U6SA 2MLKA 2OAZA 4HDUA 2O7SA 4FD3A 4NK4A 1CDOA 3RUHA 5JY1A 4BMSA 3INGA 4I98B 1X13A 3FSRA 1MGOA 2DUWA 1N1EA 3DFGA 5ILGA 3LT4A 1YOVA 2QYSA 2EERA 2X9GA 4AFNA 1U3EM 2FA5A 1Q1HA 5DUKA 1I3MA 3ZNQA 3V1YA 3WQRA 2FN7A 1HQCA 2O4CA 1ULUA 3JD3A 4L75A 4LW8A 2VZ9A 1QZZA 5DULA 3ZHYA 1QYWA 5EMHA 5IG2A 3VFZA 3IDSA 3WGGA 4LG0A 3CDHA 1VSUA 3IKVA 3NJ8A 3VZPA 1LTHR 1TA4A 2DFDA 2G9WA 4HADA 2F2EA 5U1PA 1EVIA 5DV5A 2B37A 3DTYA 2CMDA 2WWRA 3V7SA 2J5QA 4QX6A 2DT5A 2E7WA 3NJ4A 4QLCU 4OKIA 4WK6A 3HN2A 5G0SA 2FNPA 1DPUA 4PCVA 3U3XA 4GXOA 4GYGA 3HSFA 5BOXA 1FF9A 2CG4A 1GU7A 1YG2A 2D2IA 3HHPA 5K5OA 4IDAA 4MVJI 2JSCA 1LXCA 3BROA 5KK1A 1I24A 2Y1GA 2G17A 1NAIA 4GGGA 1U9JA 4C7JA 2A9FA 3FPCA 1U5TA 1AUPA 3OM9A 5KJFA 3WGZA 2ILTA 5I7FA 2J3JA 3CINA 3R6SA 4EGYA 2XGXA 1BC8C 1Y8QA 2C20A 2Z5LA 3PHGA 3IC5A 4ZU3A 3E18A 3LF2A 2IRWA 2VYND 4DYVA 4H7PA 5A03A 1ONOA 1R1VA 2HFHA 5DCYA 4E12A 3ROQA 1JWAB 4CUJA 4KIFA 4H15A 4EJOA 1HKSA 1VC2A 4HFRA 1FMCA 1F06A 3AK4A 3RQSA 1LRJA 4DMMA 1FNNA 3BXXA 4HLXA 1VL8A 1YFHA 1RWBA 1P4AA 4BNJA 1HSTA 1I27A 1BRMA 2VXZA 1PGPA 4ESJA 5IZCC 4E5MA 1SD4A 1NM5A 2ZTUA 3GA0A 3DONA 2IEDA 3VDRA 2DQ4A 3BJAA 4BH9A 3EVTA 3H5NA 3P19A 1WAMA 2K27A 3PQFA 4YQYA 1FOKA 1YJQA 2IVMA 3FNHA 2FMLA 1IN7A 1J59A 2XAJA 5I9MA 4XYEA 2V65A 3EYIA 1N9GB 2C29D 2OD5A 3OH8A 3ICCA 3H65A 3KLPX 2GN4A 4YFKF 2GZWA 4ONEA 4BHCA 2W98A 3QPHA 3A06A 3RAJA 3RROA 2Q0OA 2TDXA 3OJEA 4GVLA 3DR3A 1DIGA 5JSFA 5EEHA 5F1OA 3ZU5A 2OA4A 1OYYA 2QW8A 3WYCA 3DBLB 4Q4ZF 1OMIA 2EV5A 1ENZA 4OMZA 4GGPA 1QBJA 1ADBA 1XMKA 3T7CA 4YYZA 1EH7A 3H3JA 2A6HF 4RAZA 4AJKA 4N54A 3WX0A 3GXOA 4L5JA 1SB9A 4R68A 2RVCA 3ZWVA 3FNFA 4Q3AA 5D4RA 2AXLA 1ADGA 3ZWPA 1WWKA 4OXNA 2DBBA 2YX7A 1AGNA 1GYQA 2EEZA 2PGDA 2AW5A 2C54A 9LDTA 3OHSX 3WSWA 1NFFA 2JRTA 3QVWA 4P96A 3GT0A 3CJNA 3AY7A 2R7DA 5ENDA 5JS6A 1AWCA 3OJFA 1RM4A 3RWBA 4CMHA 1Y8RA 2EJWA 3KTDA 4OHUA 5A3VA 1YQXA 2DU9A 2DK8A 1LDDA 2PI0A 4EV0A 4AIJA 1LDBA 3KP6A 1U2WA 1GQQA 3JD1A 1YYVA 2F1KA 2DQRA 3VHRA 1ZO8A 3ZWXA 1R15A 1ZGAA 4E21A 4E3ZA 3V4GA 3M1AA 5AXDA 2DW4A 1HTBA 2NQ8A 2XPCA 3JQFC 4OOIA 3PIDA 4TKLA 2AXQA 2XV4S 4E2YA 3IC7A 4BV9A 3HFSA 5K6AA 1P74A 4NHJA 2VBXA 4ND3A 1W0CA 4IZHA 3TZ6A 5COQA 1TNTA 2YX4A 1NVGA 2DKNA 4YRDA 2PA3A 4L4RA 3E3VA 3AWDA 1EQUA 4D79A 1G3WA 4GKVA 2QENA 2NNLD 3GZ6A 4G6DA 4RGBA 4CMIB 1LDYA 5HA5A 2VZ8A 4L73A 4WCFB 3JQ9C 3TQNA 1E7YA 1PZEA 4N9IA 1I2BA 1D8JA 3C7AA 2BGLA 4OIRF 3L2CA 2I76A 1Z6RA 2WYWA 4PZCA 2X4HA 2VHYA 1PJCA 1H9AA 4PLZA 4FBGA 3RCBA 2VBWA 3FD8A 5I7VA 2FEZA 4AIKA 1FJHA 1P1IA 1R0LA 3OP4A 3LSYA 4UEOA 4D43A 2A3SA 1RPNA 2E82A 4CM5A 3NTQA 1R36A 1IL0A 5JVTA 3JQBC 3DAPA 3H8VA 2O3UA 4KQXA 2VBYA 1U6GA 5A9RA 1X7GA 3FWZA 5CVJA 2CD9A 1O3RA 4O63O 5JW6A 3EETA 1ZSVA 5CPBA 1R1TA 1P1FA 1IAWA 4L9RA 1R00A 2HUNA 3KYDB 4NBWA 4DC0A 4X54A 1NWCA 2WYUA 4BO9A 4EJMA 4YG2F 4GWKA 4HKTA 5ILOA 3U4IA 4CQMA 5JCJD 2Z9OA 4CXFA 2RIRA 2UAGA 4AJ4A 2ZJ0A 4BO6A 4HX8A 3VEPA 3JSPA 3LYLA 3WGTA 1B6AA 2QWWA 1R0SA 3G3EA 1ZEJA 2R2GA 4IXTA 4J1QA 1QQIA 4PLFA 2V1XA 1C1DA 3KOUA 2IT0A 4FC6A 5G4KA 3ZZNA 3QWHA 2C2YA 4XQCA 3BMNB 3GVHA 3PJDA 4EW6A 3PGXA 3NRVA 5H82A 2IZ0A 2BGMA 1MJAA 3DP7A 1M2WA 1FBSA 3BP8A 1C0IA 2A68F 1MXHA 2VUTA 3RJPA 4CLRB 3JAMZ 5G4LA 5JY6A 4CMJA 3NTRA 2RGVA 2E1CA 5CHEA 1W73A 3GPIA 1RZ4A 1XLTA 4GX1A 4EEXA 4Z9XA 1ZH8A 3PGJA 4MQVA 2NS0A 4KT5C 1I3NA 2O2YA 3K2ZA 3FXQA 3ITKA 3LQRA 4KICA 3KYCA 4HNHA 1R58A 1EE2A 3PHJA 3AJRA 1QO0D 3TNLA 4G8XA 1H2BA 3KCCA 1P1JA 3O4RA 2VRBA 4U5QA 1YB1A 3UGKA 3F23A 3BY6A 2Z95A 2RBEA 4E70A 4MGRA 4MTDA 4N0BA 3VODA 2NWQA 4II3A 3WB9A 3ZU3A 3H9GA 2B0LA 2CO5A 3K31A 1KC3A 1PJ3A 3NGLA 2PH3A 2IE0A 1BOAA 2NNNA 2BFMA 3LT0A 4BNYA 4MVJF 2W57A 2OORA 4XEHA 3LT2A 4E5KA 4OXKA 1R4NB 2FR1A 3BDDA 2PK3A 4BQAA 1JA9A 1E7RA 3WLFA 2K7LA 2RAFA 3WTVC 5K9ZA 2J3KA 3MAJA 3FM3A 3GDFA 5CYVA 4WLVA 3UCFA 2NNYA 1XGKA 1FYKA 1FP1D 4YACA 5K5QA 4BO3A 1I32A 1T25A 4PG6A 4CO8A 1GFSA 4RVDA 3EVNA 4YIIA 3WIDA 4KN4X 1L0OC 3TOAA 3ZV5A 2NTJA 2R3SA 3GUDA 2W2KB 5ICCA 3DB2A 2HRZA 4O3MA 1TNSA 1IOLA 1GZ6A 1PR9A 2EKLA 2ZATA 3EZLA 1I10A 1GY8A 3MJTA 3GWZA 1YDEA 4ZYEA 3RBXA 1DRWA 3V8LA 4WX9A 4IY1A 4RB3C 4W6ZA 3V7RA 4BUCA 3JQCA 1B14A 2P5LC 2CUKA 3E5QA 4QUKA 2UUOA 4TRRA 3Q5FA 2P5UA 3ETDA 3L9WA 4IUYA 5JAMA 3B02A 3GFJA 2DC1A 3VKVA 3F22A 3ZNNA 2OBNA 3WTSC 5BNFA 4GH5A 4RLHA 4L5IA 4IHSA 2PWZA 1QLHA 3DQVC 1I2ZA 2I67A 2E49A 3M9AA 2UWMA 3RASA 4O5VA 4HUJA 4BV8A 1X1EA 1DFHA 1NX6A 3QU6A 3B1FA 4CM4A 5C7IO 1GCUA 2FWMX 4RVHA 3LU1A 1T2FA 4A0YA 1TEHA 4IRHA 1ZBQA 1E1LA 4B7UA 1QV7A 3EMKA 3RC2A 1NHGA 3KXDA 4TV7A 6PAXA 1FDWA 2BKAA 5E8IA 3KP2A 4MINA 5FI5A 1L1FA 4B3HA 1HYEA 1SEPA 4PRKA 4GLLA 3UVEA 3DZHA 4LVCA 5A05A 3R3JA 1YTYA 1VKOA 2B36A 3NEPX 5HS6A 2XAAA 5J8CA 4XWYA 5HTOA 3JQBA 1B3BA 1YGYA 3H5RA 4II2A 2C5AA 2O2SA 2JHGA 4M71A 1F14A 3EZYA 2W85A 2HTSA 4HOBA 3JQ6A 1PL7A 4BO0A 5JYDA 4BKPA 1W5SA 2V79A 4KZPA 4W4TA 4IHTA 1MFZA 3QOPA 4WKGA 4A10A 1YVEI 1KOLA 1AXEA 4O6JA 2YQ5A 2L01A 4A12A 4AJPA 1DDOA 3HE3A 1EVJA 2KIMA 4FW8A 1PWZA 3DBRB 4D7AA 4R5MA 1GUYA 4DTIA 2CWEA 2NU7A 2VNAA 3HTUA 2GO1A 3F4LA 5T8KC 4J7CA 5HM8A 1HE3A 3DKWA 3BMCA 1P44A 3OEYA 3KO8A 5AXAA 1IB6A 4JBAA 3RFVA 2BHLA 4UVCA 1K5HA 3O26A 4YJGA 3R1IA 5L3ZA 1PJBA 3LQQA 4HF2A 5E1ZB 2XROA 1Z7EA 1PZFA 2HK7A 4E5NA 2OHXA 3NAQA 5CG1A 2UXXA 3JCZA 5IDWA 5THQA 4Y13A 3DDNA 4NBVA 4YAEA 4EJUA 4ALJA 5DF1A 4RF2A 3B6ZA 1I0ZA 3CUOA 1Y9EA 2D45A 1B9MA 1NR1A 2O3RA 3NYWA 4DNCA 3RIRA 3BMNA 3N4MA 4AJOA 4WCDA 3QVTA 4YJFB 2PR2A 3AI2A 5DDGA 4BO5A 4BHBA 3OF2A 4XZ3A 3AFMA 4OU0A 2JAPA 3FNGA 4LGVA 3KV3O 4PLGA 5L51A 1PJTA 3E9MA 4H3VA 5AONA 4XR4A 1I2CA 3BIOA 1PS0A 4BKUA 1PUEE 2A35A 2IYOA 3GZ4A 3W1VA 5JFRA 4M9ZA 1VL0A 3RSHA 1E0DA 4BAYA 5IXSA 4ESFA 3FBTA 2ET6A 2PZMA 3T0YA 2KJCA 1Y6JA 4E5YA 2BH9A 1K79A 3FHLA 4IF4A 1E77A 3Q9VA 2HK8A 2VRCA 5LC1A 1OYIA 3TWOA 5F1RA 1G3YA 2AEMA 4YJHB 1OKRA 2WTEA 3RIHA 1BI2A 4IMPA 1Z91A 5HS9A 4H16A 4LMRA 2IXBA 1VKNA 1MJ9A 1LDNA 1HYHA 1V3UA 1Y5MA 2Q2QA 4Z3KA 1UP4A 5LGUA 3AM4A 2HJRA 4ZYHA 5TIIA 2X0LA 3RFTA 2GN9A 4CM9D 2Z5UA 1LRKA 1P3DA 1N1GA 5HLHA 3PQDA 1WDLA 1V3VA 1X0XA 2O50A 4UVBA 4DBZA 1N7HA 1U3VA 3GLQA 3INTA 5JE8A 5TRTA 4FCCA 3E82A 3ASVA 5TNXA 3V5NA 3GFLA 1QPMA 3Q6IA 4E5PA 1IULA 3BTOA 1F9NA 2FR8A 3I83A 3VVBA 4R69A 5F6FA 1HKUA 2F5EA 4HFMA 4INAA 1P4WA 1KYZA 2P5KA 3DZIA 5L53A 1HSJA 2L02A 4R1HA 3L07A 3ZMTA 1G4DA 1UB9A 3K30A 5DCMA 3OIDA 1W7PB 3VVCA 3ULQB 4XA8A 2X0NA 4W9NC 4DQXA 3VZRA 2Y93A 5DP2A 4J3FA 2A5YB 5L3BA 1XMAA 3CE6A 4RO0A 1ZN2A 3VOEA 3GAZA 4OO3A 5GZ1A 1R37A 4CM8A 1QG6A 1FT9A 5TSDA 1JXSA 2YV3A 1LI4A 3DXFA 1FPQA 1YBVA 3DQPA 4YXFA 3LDHA 4RPHA 1PP8F 4FPXA 2C7VA 3IRQA 3DMTA 1ADCA 4BNNA 4CYDA 1ZAOA 4RS8A 2UXNA 1HEUA 3UW3A 5IFLA 3FMSA 1LQTA 1IUYA 2IEBA 4MVJP 1WSUA 4YAJA 3T4XA 9LDBA 1U8RA 3RU7A 3VC7A 1MX3A 5D6EA 1VPDA 4MVJG 3SQNA 4RVGA 2QG4A 2FBKA 2GZ1A 4RJTA 3H9EO 3JYOA 5KJ1A 5DDIP 4XCVA 3UXYA 3ZWOA 5ICMA 4G81A 5CLSA 2PY6A 4OINF 3BYZA 4YB8A 2J3IA 4PCQA 1MDMB 3KE2A 3GVIA 3VZSA 4QQRA 4BKQA 2NYXA 4JCOA 4W82A 1S7AA 3KLOA 1E3JA 3WBFA 4Q3NA 1D1SA 2QBYB 3K1MA 2HQNA 4KA4A 3HZZA 4FFMA 3ECOA 3GW2A 1ISMA 2JPBA 2LSOA 4B09A 1XN7A 1I01A 4WLFA 2A07F 4XGKA 5AQ1A 3WOHA 1IHXA 4NK5A 4Z3DA 4HLYA 4IPAA 2HAEA 1SMKA 4XSZF 3CPSA 2GF2A 3F46A 2XKOA 3PHIA 1Y5RA 3L6OO 3WTBA 4TRJA 3V8JA 3L4SO 5T57A 3TFQA 1IUKA 1DFGA 4MVJD 3MZHA 3Q2IA 2YJZA 4YT5A 2AS5F 4WNCA 5DOZA 1G3TA 3IQDB 5IN5A 1J4AA 5CFZA 6ADHA 1I5ZA 4CZZA 1Q1NA 1FC3A 4UHTA 2DBRA 5DNAA 4NJMA 3DEUA 1RYDA 3MJEA 3D5QA 2V1UA 2QQ5A 2VOEA 2HO5A 5IT9K 2X7HA 5CP8A 2JCXA 4BNCA 1XHLA 1I30A 3HUGA 5JMPA 5EIOA 1AHHA 3GMDA 4FS3A 2NAZA 2YDYA 4A6EA 2HEOA 4O6VA 3JQ7B 4K9DA 4R5HA 3TGNA 3E6AA 4G94A 3GG9A 3G1TA 3F3SA 3KB6A 3GK3A 3CKYA 1ZG1A 4M55A 2ZIZA 3ZHXA 4CUZA 4PN3A 1FBQA 3QRFF 1P9LA 4YT8A 1NQAO 4RPLA 3D64A 1LJ8A 3FPLA 1XDWA 1KS9A 2PGJA 1E3EA 2Z1NA 4OIMA 4CV2A 2HR3A 5DUIA 4CQMB 5B4VA 3ZN1A 3I3OA 5LEJA 4G7ZF 4PLVA 4CM7A 2X5KO 4K26A 3WTZA 1DJQA 2UDPA 5LLQA 2GZ2A 4IS2A 3AY6A 3RVDA 3W4IA 4PZDA 5FWNA 4LFUA 3M1EA 3KBOA 3CMMA 4Y6PA 4Y17A 5D6FA 1MG0A 3S2WA 2VUSA 2ZO4A 4NI5A 1BM9A 5K1YA 3ETGA 1UCRA 1R23A 1WVGA 2BFOA 1YB4A 2CZCA 2PLAA 3O8QA 4AVYA 3CSDA 3SEFA 5KCZA 2K86A 4ZQEA 2V9VA 7ADHA 3J81K 4YFXF 1SAYA 2RH4A 2VHXA 2CDCA 5TGDA 1DC6A 3W6UA 3RC7A 2C82A 3AW9A 2OU2A 4FGSA 4PG7A 4U8GA 3UCEA 4HYEA 1F0YA 4I09A 4M74A 1NFQA 1OC2A 2PD6A 2RKHA 3QP9A 3DBRA 4HX5A 4NB5A 4N5NA 4D44A 3G17A 3RI3A 5ED4A 3ECHA 1K3TA 4L76A 3NV9A 2XAHA 5T67A 5FYDA 2QQ9A 2IA1A 3JQEA 3ZV3A 3PYMA 1B0AA 2Q45A 1NFRA 2VT3A 5IT3A 4P8RA 1A72A 3O6BB 3MJ4A 2J5RA 4NMHA 4XRGA 1D8AA 1OBFO 3BTVA 3W6ZA 2KJBA 4EUHA 4MP3A 1I33A 4ROSA 3RKRA 3RUDA 2YV1A 1ZGJA 4GMGA 4RF5A 4UEJA 2VODA 5ICGA 4ZQBA 3OEWA 1NQ5A 1RIOH 2Q4EA 3E9QA 4BB5A 1DC5A 4KUHA 4B3IA 5JDCA 4U0JA 4GKBA 3TN7A 1XDSA 5A5EA 2CFXA 3P7NA 1UR5A 3ZW8A 1VI2A 3B1KA 4XYMA 5TS3A 1HXHA 4P9UA 4AJNA 3ICPA 3JSAA 1AN9A 4R3NA 4CM8B 5JO9A 1I3LA 4P55A 4HQEA 4LISA 1P1RA 4LRTB 4WUVA 1HDRA 1LLCA 1XDUA 1FX7A 4M6XA 2HJSA 3BMQA 4J1NA 1RNLA 2L3DA 2VE8A 4B8ZA 1K6JA 2CF5A 3GGGA 4J1SA 4IDGA 1NYTA 2B69A 5DCMB 3BTUA 4O1MA 4XLPF 4RB1A 2QUFA 1UZMA 4PG8A 3I53A 3I5MA 2FRHA 4MKZA 3P9KA 5EERA 4G65A 3OECA 2D1YA 4P4LA 3DL2A 1W5TA 2R00A 3SC4A 3U9GA 2DPGA 4WNIA 2HMUA 4IDCA 2YSRA 4BYYA 1WKMA 1BVRA 4J4HA 4HNGA 4F7ZA 5DN9A 2JZYA 2PEXA 3VOSA 4BHTA 1TB4A 3M7GA 1ULYA 1ZRFA 4DC1A 4DIFA 4CV1A 3GVAA 2FF4A 4I5FA 2Q1TA 5ILSA 3F5QA 5I9LA 4Z2YA 1Q0HA 4JQFA 2RDPA 4OAQA 3WYBA 2STWA 2VYVD 2JL1A 3F8CA 4B7CA 2BMAA 2HKOA 1J5YA 2ZNZA 1EVZA 3GAFA 4ALKA 5KIAA 1LSSA 2ZQYA 4XSXF 1TI7A 1E6EA 3GFMA 4XYLA 2DFIA 3M8EA 1KVSA 4I9HA 1ONPA 1R5GA 1F8GA 4U7WA 3GG2A 5F21A 4JGBA 2Y0EA 4ON0A 1PGOA 3PWZA 1FLIA 5J8FA 1T39A 1PX0A 4AL4A 3KZZA 1S7OA 1ZMOA 3FF5A 2FE3A 1USSA 3S1LA 1LRLA 2Q50A 2H6CA 3LK7A 2XAQA 3GVXA 4WXHA 1O8CA 1SFXA 2Y48A 5HLGA 2ACJA 1VJTA 2W4QA 4JNKA 3WU1B 3IKTA 1FDVA 1WMAA 4BGVA 5L40A 5L7TA 2ZMEA 1ZXBA 5D8KB 2VWQA 1D1TA 2PNFA 3PTZA 3TZCA 3UUWA 1ML3A 5K0ZA 3DC2A 1Q7GA 3TRIA 3AOEA 5A04A 5A5FA 3R3SA 1I8TA 5TF4A 2RQPA 4J2HA 3G0OA 3HRMA 1J0XO 4LSMA 4YA6A 1MXFA 1XEAA 3HIFA 4UUNA 5HS7A 5AVOA 3COSA 4DPMA 1B2LA 1XGOA 4PVCA 1VJ0A 3AU9A 1QYDA 1B1BA 1GR0A 1PS8A 2DLDA 1ZHFA 4KQWA 4KWHA 4E2ZA 3S2GA 3SZPA 3BJ6A 1F8FA 1C0LA 4MJLA 3X2FA 2XXJA 3KVOA 3AI1A 1X15A 1U5TB 4Z9YA 3LC7O 1U3UA 1FSHA 2RN7A 5JCJA 1DB3A 1S29A 3B73A 1FYLA 3ZH2A 1XB4A 4IXWA 2DAOA 1ONNA 3JQAD 2Q2EA 2QVOA 1K6OA 1V3TA 2JD2A 2Y05A 1J49A 4G2NA 3RUCA 5FLXZ 1ZK0A 3RKXA 5L3DA 1WDKA 5HRUA 4UVHA 4UV9A 1E2XA 2X23A 3VH2A 2HWVA 5LRSA 1EH6A 4GSLA 4IXAA 3J80K 1DC4A 2PTGA 2X22A 1E1KA 1KY5A 4U7BA 4GX5A 4KOAA 5B4UA 2Z33A 4LLLA 4MIYA 2Y1FA 4KYWA 4N5LA 4FJ0A 3GUCA 1YONA 4IGFA 1UHWA 1R16A 3GF4A 1MZBA 1EE9A 2EV6A 4DGSA 1ON1A 1GXPA 4R9RA 2V6FA 4Y6SA 3VPXA 4WLNA 4AVPA 4E31A 5U9CA 2VWPA 5BSFA 1R4MB 3K1NA 4BNVA 1Y9AA 4FFRA 3QU3A 3Q9NA 1QZYA 3E6CC 2P8TA 3QAHA 3RUAA 2BI8A 1IN6A 3EDPA 4QSMA 1TLTA 4BO7A 5G0VA 4ITUA 2GYYA 2B35A 1G6NA 1DAOA 3LF1A 3UFXA 3VDQA 4WLOA 4RPKA 5G2OA 4L9JA 4LSWA 2QQBA 1BTOA 1K6IA 1Z7BA 3ABTA 2BF7A 4I9NA 5DYMA 1CQIA 3ABUA 3QWAA 1W7PD 4EJTA 5ER6A 4WCFA 3AFNA 2W25A 1Q0QA 3G3ZA 3C3XA 1IZ9A 4EJWA 2CYYA 2TMGA 1J7KA 2PMUA 4CICA 3IRRA 1HL3A 2Q4BA 4RGSA 1M6WA 2H9IA 3BZ6A 5FO5A 4HV4A 1NTOA 1NVMB 3ANNA 1FK8A 3E9NA 4EVIA 1ISJA 3K6JA 4YDRA 3V1UA 1DC3A 1JVSA 5AIPA 2Y0DA 2ZB4A 1BW9A 4K1LA 4PG5A 5JNLA 4D3FA 2NV6A 5EESA 1HDOA 4PLWA 2ZYAA 2NTVA 4IQ8A 1J6UA 1BWSA 3ON5A 4CJXA 1H94A 4Z0TA 4IJAA 1A71A 3U62A 4IINA 5EQFA 2FPGA 1YQAA 1NXQA 1BXGB 2OP1A 3KHUA 4LCJA 2M45A 1X1TA 3OQ1A 1ZSNA 3H9UA 4J91A 4YWJA 3RBVA 1DPGA 1W7PA 2Q46A 2ETHA 3DBLA 2DPUA 1UXGA 3ENNA 3QP5A 1VJ1A 1ZVMA 1PS9A 2J5PA 3LT1A 4R1NA 1W4MA 1EUCA 1SO8A 5KVVA 2C5EA 3O9ZA 2ZJ1A 4KTVE 4L9TA 4BKRA 1LJ9A 5D5VB 4NFSA 4BNZA 4XQ9A 1JHHA 4A0ZA 5BNTA 3I9NA 4ZRMA 3T8RA 3S2IA 5A9SA 2EFQA 2ADUA 4JJFA 1HZZA 4RORA 2D2WA 1K0UA 4DUPA 3Q9SA 1R66A 2EKPA 3V1TC 2K4JA 4ZZLA 1VTNC 1UZNA 3GRKA 3DTTA 3R0IA 4W99A 1E5LA 3AUUA 4IM7A 1U7HA 3CZMA 3D3WA 3FI9A 3S55A 2E7XA 3U1DA 3H92A 3AUTA 5ICFA 1J2XA 2C6YA 5G0UA 3RU9A 5JYEA 2O0YA 4R8HA 3DZKA 3IUPA 4EBFA 2IDZA 3NEUA 5CVUA 5ES3A 1PL6A 4OIOF 3ML6A 5G0WA 3F1KA 3TZQA 2DVMA 1R4NA 1WW8A 3DMYA 3HSKA 2IP2A 4OJNA 4RF3A 4EJ0A 5TC4A 3J80Z 5ITWA 4P4NA 3GDGA 4HA8A 2PZLA 5CEEA 3BTSA 3CIFA 3J81Z 2YZ7A 3T4EA 2YR2A 3WMXA 1XCVA 1LSUA 1ZXLA 3EDMA 3GX4X 3WGOA 1WI9A 1DXYA 2RC4A 2OZ6A 2OBYA 1IPFA 1LDKB 2W84A 1UXJA 2DAPA 3GF2A 4KTTE 3QVXA 2XUBA 3T8TA 2BI7A 3EUHA 3GO5A 3RKYA 1Y1PA 2QRJA 3QLJA 1I3KA 1PZGA 4FJ2A 1EZ4A 2YV2A 4R1TA 3ROPA 4AJHA 3LAPA 3H5AA 5GZ6A 1S3JA 3E97A 1DRVA 2J5OA 4GVXA 2EFWA 2EKQA 3QP6A 1XSVA 3PJGA 4NU6A 4EJ6A 4KUMA 2EA4A 1EUZA 2Y1DA 4Y67A 4WPGA 4QTZA 3LAJA 1LDMA 3RPQA 4NJMB 1U2GA 4AICA 5H6QA 1Q0LA 4NIMA 1FZPB 1V35A 1MGTA 3WNVA 4FN4A 2VWGA 1RM3A 1CRWG 2HDHA 4L8VA 1ISIA 1TTYA 2IW5A 3W6KB 1GQ2A 3MCVA 5JC1A 4FX0A 1ID1A 2X58A 2NUAA 4BB6A 4UVEA 1HDYA 2CDBA 3AOGA 2V7PA 3OFSA 4GQAA 5F5NA 4GL4A 2YQ4A 2Q99A 4CMGA 2WTBA 2FPPA 2TMDA 4DPKA 4OL9A 4ALIA 3U4DA 1FDUA 3JQAB 2O48X 4IPTA 1Z75A 1HLDA 2HKIA 3SBOA 3ZU2A 4BNWA 5GY7A 1JWBB 2Q1WA 4PZJA 3DAGA 4JX8A 1U3TA 5A2QK 1B7GO 4XIJA 5AXBA 5K6AC 2GDZA 4PLPA 1D4FA 3L7WA 1MFPA 4ZZDA 1XWFA 1TXGA 2FQ3A 2LDBA 3HJAA 1LEAA 5DBFA 3P9CA 3ZHBA 4UAGA 1PWXA 1GADO 1YXMA 1MA0A 3NT2A 3PEFA 1FY7A 1CYDA 4XYGA 4AIHA 4ND2A 2FOKA 3P7MA 4CLOA 1T2AA 2JPCA 4J0FA 3MJVA 1A4IA 1JN0A 4YTEA 4E0BA 2ZXJA 1JTVA 2G7HA 3GQVA 3I4PA 3TDKA 2PFBA 4AJLA 2Q3EA 1MLDA 2G0TA 2CY0A 1J5PA 5KJCA 3KRTA 1HKTA 2VOPA 4LD5A 2DTEA 2IZ1A 5T64A 4I5GA 3QIVA 1GZ3A 5CVVA 4QT0A 1LVAA 4I0BA 5HWSA 5TT0A 1GPDG 3L09A 4B4VA 2VRCD 3W8FA 1HE4A 3U2RA 4RDHA 2G82A 2NU9A 2HMVA 2P6SA 1OC4A 3I1JA 3DOOA 1DUXC 3F6VA 1X0VA 5KVCA 3WTYC 1YLFA 1SC6A 5CDSA 4YIFA 1WZIA 4KDEA 1KY4A 2NACA 2UVDA 4K6CA 4HBLA 1MUUA 4OMUA 1X3UA 1BDBA 3PRJA 3VAZA 1A04A 4DMLA 4W9NA 1M75A 3JTHA 1C1XB 2AG8A 4Q5SF 2PMHA 2PFGA 1R6DA 2YDXA 4U0KA 2MA3A 2CW0F 1PU2A 4EUEA 1EFLA 4G5HA 2XVCA 2VQ3A 4MQ9F 4B8XA 3WNQA 4I5EA 3OJ0A 3N97A 1FWZA 5A4DA 4XQGA 3GZNA 1ZK2A 2J3HA 1TQMA 4Y8VA 4HZFA 2IYPA 2HMTA 2R6JA 3KEOA 2P2SA 2UUPA 1ZARA 2XKPA 4MP8A 4QFCA 4Z0HO 2YHUA 3SJUA 4D3SA 2AE1A 3MQ0A 2H1SA 3EW7A 3ZWNA 5G0TA 1YBMA 3OOPA 3EYWA 3CUQB 1LNWA 2XHKA 1EK6A 1P1KA 2AQKA 4LLNA 2PD3A 1KC1A 1XSXA 1ZMTA 2AQ8A 4U0VA 2X6TA 4UUPA 1N2SA 3WWYA 5AYVA 3EQLF 5CPFA 5JLAA 3VPGA 1S6LA 2GSDA 1P45A 4UNOA 1RKXA 4XIYA 3T1BA 3K2BA 5THKA 1SZJG 5LGNA 4JLWA 5GMOA 1BHSA 4YRBA 4DQ2A 3WGIA 1TW3A 4DQVA 2GA1A 5D5UB 2D59A 2O3JA 3I59B 2GQQA 2RV8A 3OJOA 3DFZA 4PLTA 4E6PA 1GL3A 2Y68A 1UFMA 2KIUA 2XASA 3WU0A 2ZK7A 3ITDA 2O6GE 1LLQA 2QZ9A 1SOVA 3GEMA 3O8QB 4WLUA 2NQTA 3F5SA 3HDYA 3OQBA 3CZRA 3SFZA 1GDHA 4UVGA 5A02A 3ANMA 4OIQF 1QYVA 2ZCWA 2DBQA 5DT9A 2BLLA 3ADOA 3CMCO 3L9FA 2ZKZA 5A2QZ 1E7SA 3LFKA 3HQ4O 4M86A 3L6DA 3OA0A 2C59A 2HGCA 3ELKA 3HHGA 5I7SA 1U78A 1WMBA 1UP7A 5LBQA 4DBVO 3M8FA 4E33A 5H20A 1E7MA 4L0ZB 1ON2A 1B4AA 4YJFA 1EFKA 2ZCUA 1SBYA 1P4XA 3MZYA 5I9NA 2YHIB 4ZRNA 1SMYF 2MH2A 4FT8A 1BI1A 1T1RA 2JKVA 4CLRA 1EMDA 1Y7TA 1CF7B 3E5XA 2FZWA 3PQJA 1LU9A 1ZREA 4CM1A 1T2DA 2ZMEB 1HSOA 2P5YA 1YW7A 2E6UX 5C5IA 1HBXG 2GXGA 2LDXA 2RH8A 2EF1A 3BMCB 4DRYA 5B4TA 4CMKA 1L7DA 5HDKA 5EL0A 1KVRA 2HYGD 2PGLA 1F5TA 1A9YA 2GWRA 4NJOA 1RI7A 3HHHA 1LSOA 2WEKA 1YDWA 4JN6B 3WLEA 4BL5A 2O03A 3F21A 3RJ5A 2CVOA 4J4BA 3ZN2A 4GO1A 1E1MA 4XQEA 2ISZA 2VYNA 1T2CA 3Q0EA 4LK0F 4BGUA 3NTOA 2C0CA 4ILKA 2EJVA 4C4OA 2O3QA 2CGPA 2UV8A 2IPQX 1IE3A 2VTEA 3DPLC 4L9VA 5B37A 3OA2A 1XSDA 5U4QA 2VTDA 5HLIA 3PWKA 4NU5A 4AG3A 2WE7A 2HU2A 2F00A 2GPTA 3KZYA 5ICSA 3VH4A 3VH1A 3IP1A 1T2EA 1WRJA 2WYVA 4MHGA 2EWMA 1BXZA 2OZUA 1T2KA 1XELA 3SXPA 1T1SA 4YAKA 5B1YA 4DL9A 1H9TA 3E1KA 4IRIA 3OSUA 4PGGA 4WCGA 1FDSA 2GA2A 3ULKA 1VSVA 1ZZEA 1FSEA 4J0EA 2W2LD 3WGQA 1KQ8A 4FIZA 1TQPA 1ZYRF 1HE5A 2X1HA 5K5RA 1YL7A 3BA1A 3X2EA 1XU7A 1CEQA 1OI7A 1Q2XA 2STTA 4CM6A 5CEFA 1ZSYA 3CTAA 4HW0A 3PHLA 4MKXA 5D5WB 4MVJM 3JQDA 5AIQA 4OSOA 1XGMA 2WSBA 2ESNA 3GVPA 5F64A 3ZN0A 5CEJA 3PIIA 4KFCA 5CVRA 3E6DA 1EV7A 2X8LA 3KUXA 2AEFA 2D5AA 3E03A 1JW9B 5L4NA 3N74A 3IS3A 2Y67A 1GUZA 4YRAA 5C7OO 5IZ4A 2P9GA 4J1TA 4NBRA 1T6SA 4WEOA 1RJWA 1I6XA 2QRKA 3OIGA 4NH4A 2EFNA 3TOZA 4CLOB 4MVJH 5HS4A 4ZQGA 4MTEA 1BXKA 3GC6A 4CLDA 3QVOA 4RQTA 1XGNA 2C2XA 2X4GA 3G79A 4LB5A
chains in the Genus database with same CATH superfamily
1LBIA 1O97D 4LDJA 3T7EA 4HQ6A 3DPTA 3PXBA 3TLMA 2Z2SB 4RB0A 3BT7A 3BMOB 4FQ8A 3OJLA 1EG7A 1Z74A 4GBJA 2HLPA 3OBIA 1K08A 5KYVA 4BEVA 2DWCA 8LDHA 3NDBB 2GAUA 2PWPA 2CXTA 4WF2A 1SD5A 1IHOA 2QORA 1J75A 2FPPB 4GSKA 3V2GA 4BBSJ 5T6MA 4PAOA 1QGUA 2GZMA 5AJYA 1OBHA 1U2TA 4ZJPA 2UV1A 3C3DA 3WC4A 4U3JB 4ZCSA 4D0SA 3K09A 3IOMA 3K0FA 1A5ZA 3T6KA 4CN8A 4DDHA 5KDOA 1QZXA 4DBLE 2CUZA 4Z4HA 2P8SA 3EQZA 1XRQA 1NKSA 5D00A 3KYBA 3D0SA 3HU1A 3A11A 5FB3A 3ME5A 3NYQA 1OI4A 1RXVA 3WK6A 1ESMA 4WGGA 5FOWA 3RREA 2OQGA 1GNTA 3MTJA 3TZHA 5ALQA 2M4GA 4MB6A 3HMQA 2J85A 3M2PA 1HSZA 3LSGA 3A26A 1X1BA 4DOMA 5G02A 5F1YA 4AMVA 5TX7A 2NTEA 2Q7XA 5CA1A 3UGTA 1F0KA 4FE3A 1NJ1A 3MZ8A 3CLRC 4QEDA 1N6RA 2X19A 4WNAB 2AXPA 2C9CA 1KERA 3Q2KA 3WE2A 1MVOA 1POWA 3K94A 1C3EA 3ORSA 3QV1A 2C9ZA 3H1CA 3MEXA 4BLVA 1WQ4A 1XJ0A 4OKNA 3EPZA 2HCBA 1XZKA 1NM5C 2DFFA 1SBHA 1E63A 4EQZA 4UTRA 5FUYA 3BXZA 2VC1A 5HVQC 2JW5A 3O7MA 3S70A 4KXUA 1U0FA 3VGPA 2F5FA 1J24A 1O96B 4RTLA 3CZ9A 4KGDA 2Q6VA 4Q9DA 1EQAA 3T54A 2I9PA 2FQWA 5L3CA 4QLBA 2J5XA 5CDGA 4JI1B 1U81A 3DE6X 2L2QA 2VSYA 2UUZA 3QYJA 3VSCA 2H2DA 3KM0A 3S8YA 1H4QA 2CT8A 1MMSA 4M54A 2AI2A 1Y8QB 1LEHA 3U3JA 3Q7QA 1LVHA 4YEDA 5JJCA 1JUMA 4JODA 2VJBA 4ZDJA 2OL4A 2WMOB 1LW6E 5H7XA 4HWKA 3TLCA 1FXWA 1ZK1A 2Q5FA 2X5OA 3G2QA 2GK6A 1AX9A 2QN1A 4DIQA 1EUDA 1MOZA 2HMAA 3DBHB 3NU1A 5LQUA 3I12A 1A7KA 4I01A 2O3TA 4YQFA 1AOYA 1T24A 1U9IA 3HCRA 4EJSA 1KVUA 2G28A 2IY7A 2VOJA 2XHZA 3ZGKA 4MH0R 4JC4A 5CDFA 1NVWQ 1NASA 4ARSA 3QWIA 1JFTA 1G7RA 2BYVE 1CC1S 2B4AA 3GLSA 4Q4AA 2EZ8A 3DEHA 4R3WA 1E3OC 3L8GA 3DBIA 1F2UA 4QSHA 1QK3A 5M5XJ 4HDSA 2WAOA 3EC2A 1P9QC 3JD4A 3N0VA 1J39A 4RZIA 2R8OA 1HC8A 3FROA 3ZR4B 2R8RA 3QPLA 5A6SA 4FZRA 3CWQA 4DQUA 1T4GA 2GN8A 3PDJA 2HSEA 2O57A 2QG9A 2BOLA 2OMKA 5IM4F 4KAJA 3LHIA 2DA6A 1VG0B 2P5SA 2VAWA 3H2JA 3L0ZA 2AK2A 4MR7B 2WUFA 3BMOA 1FFWA 1L8LA 2I6UA 3HV2A 4Q9NA 3DEEA 4ZEMA 1SKMA 1ECLA 3PFKA 4DSZA 3LQFA 5K0EA 1FB5A 2JRLA 2NXWA 1UMDB 4UHBA 4MQMA 4Y2QA 3T4PA 1ENPA 1EXMA 2DE0X 2X15A 1GL9B 2X7JA 2XWJI 1VIAA 3CGWA 4GVPA 5EJIA 4F2DA 3IOYA 5ER9A 3S8EA 3OJCA 5AO9A 4K2AA 4OH7A 1FYWA 3GRVA 1P5JA 2HZTA 3HWWA 1E92A 1JHDA 1WTAA 2XSDC 4IL5A 1GNVA 5AJZA 1RU3A 1QLJA 1U1IA 5D3QA 2WC2A 2H17A 1SXJA 5L7YA 2CJWB 1YJWI 3GRAA 3LUJA 3PCXA 3S7TA 2HCRA 3AJ8A 2ZGVA 6REQA 1PFYA 3B1VA 1XGSA 4M1EA 4NZYA 4F52A 3VH3A 1VJRA 421PA 1I5EA 3LPLA 4YP5A 2L9NA 5E9AA 2VXBA 2QIOA 4WN9A 5H81A 1JE8A 3WGYA 1P5RA 1HM5A 2FOXA 5K3BA 4AKTA 4UPEA 3OCCA 5DHQA 1LCIA 5IJZA 1NULA 4GG1A 4TVBA 3COAC 1NI4B 4DCNA 1UHMA 4B7ZA 2YPRA 3A7EA 2MTBA 1T98A 2V55B 4QHSA 1SD6A 2W4IA 4QOFA 5C31A 4OXRA 3SHFA 4Z9AA 2NO4A 4FP9A 1K98A 1JLHA 2R1UA 1DRUA 4JBYA 2ISQA 2OP0A 4JQCA 1NXWA 3RC1A 1S72I 4CU2A 2AQIA 2CU7A 2Q5CA 3ZWDA 2DR0A 4J29A 2QTLA 1ISSA 1VQ4I 2XUKA 3Q7SA 4ZOCA 1MJBA 3OQIB 4AY4A 2X0JA 2X0KA 4FDAA 3R5HA 4OQXA 4PZEA 5F33A 2G80A 4W7IA 1UUFA 4DCCA 1APBA 2A6TA 4W5NA 3UK0A 4YX9A 4X00A 3IGFA 5D8LB 3RF7A 1KDZA 5EGOA 4JDPA 4JQYA 3TLAA 4QDZA 4DJTA 3RKUA 4PW0A 4EMBA 1NBMA 5K4AA 4WAUA 1HFEL 1KJZA 3DXZA 2NM0A 1UM8A 3UYLA 3L6EA 4K87A 1YFLA 1XZIA 2JFQA 3B3GA 4RUKA 5FFXA 5I47A 3U4MA 5I7OA 2G71A 2AEJA 1K27A 3PC8C 4KO1S 4Q12A 5DSZA 3RJ9A 4AICA 4YEJA 3H2HA 4XRFA 2B4TO 5EQJB 3B6KA 4IV5A 1T6NA 4X93A 2FE1A 1RQ7A 2F48A 5E7QA 1XU4A 2BSXA 3V3KA 1EFAA 4OB6A 1Z5VA 4OGWA 3LWFA 1S5PA 3KZCA 4XI9A 2BBTA 1YQTA 2JLRA 3OI7A 4MRAA 3VTKA 3ZHRA 1FSFA 3G13A 4HPWA 3VR6D 3ROUA 1FDIA 1O58A 4YCSA 1R5ID 3OYDA 4ZJZA 1YAJA 1EM8B 2HV9A 2JHAA 2PXHA 3K1ZA 1J9IA 3K92A 4QBKA 2ZYDA 2PH5A 2I65A 3QI7A 2XR1A 4RHEA 3RSFA 3I9LA 5EWLA 2GAOA 4G2TA 5LUAA 2HPZA 2M9MA 3ZMZA 1KH2A 1YZKA 3K69A 3BJOA 2B20A 1J1IA 2ENWA 3KQOA 1V5WA 2QTHA 2VJMB 4XIGS 3S8MA 4EGCB 1FYEA 3UMYA 3NC4A 1XX5A 3C1DA 2JAHA 4I1PA 1XQ1A 4FSXA 2LRHA 4V2FA 1UXKA 4J3NA 3K4NA 4LXGA 2AA3A 2QRGA 2I8AA 1Y81A 3TXYA 3UV3A 4CF7A 2NYUA 4S1VA 2H9AA 4ZGWA 2WKWA 2YRFA 2O2DA 5ALMA 1Z2CA 1OOEA 1WNFA 3OPYB 2VVTA 4AUNA 1FLDA 1N6PA 5EZYB 4M87A 4DXAA 4A0GA 2BZGA 3DA8A 2FQYA 4AWXB 1D5VA 1QANA 3OX2A 3DULA 2GDJA 3UW1A 4KMUX 2OOSA 3C87A 4PX9A 1HA3A 3H36A 4M3DA 1TQ2A 1F4PA 3ORFA 4RLSA 1YH3A 1YASA 5BQFA 3SDSA 4MNUA 4KQGA 2O8DA 2I34A 4GM0A 3K70C 1IATA 3GMSA 5A9SB 4XGNA 2OD9A 4BU0A 2NOGA 2XAGA 1OGIA 2J45A 1JAXA 721PA 2PNJA 5CFLA 2VAPA 5BQTA 2I71A 1E4OA 2WP0A 5EVCA 1OZAA 4Y1FA 4ZWNA 3LNQA 3RYIA 3L2RA 5J2TA 5CDTA 4I4TF 2XT0A 1T9DA 1USGA 4X97A 4QUBA 1TM1E 1Y0UA 2V8OA 1KU9A 5E20A 3NFRA 4HDAA 3HUUA 5E3HA 1G8AA 4RVFA 4CCYB 2JLQA 4RLFA 1UJ4A 3KJXA 3VX3A 4R9SA 1YO6A 5EN4A 1K2WA 1U9ZA 2A8YA 2PO7A 1IXSB 3H9BA 4EUSA 5FBKA 2J48A 1MB4A 3PFFA 3ZJYA 2QYOA 3PP8A 1X7YB 2H4ZA 4TUYA 3MLEA 5KJ6A 3GLHE 2FEMA 2DTDA 3E1GA 2W6IA 2FYTA 3GCGA 1S2DA 4I19A 1B8UA 2E4ZA 3VYSB 1OZHA 2DPMA 2P9CA 3CF0A 1SCUA 1R1UA 4M21A 3SX4A 5T4HA 1KMMA 2JASA 3UPDA 4Z3OA 1P91A 4JFAA 1B9NA 1F7VA 4XIDA 4ZYTA 3V8PA 3MGAA 3K32A 4UZSA 1BBYA 2LKSA 1NDHA 1UMCB 2BR4A 2FSSA 2WVHA 3CKMA 3FFAA 3HADA 3P2JA 4N6GA 1W7AA 1M6VB 1D7OA 4RFSB 5EWJA 2DOEA 2F8LA 1TUGA 1HF3A 2AMFA 2IUYA 4MQ4A 4N18A 1JT6A 1G3SA 4XKBA 2VT7A 3M0EA 3WQQA 5KQRA 3HXQA 3SPXA 2IL1A 2JGIA 3Q98A 4FFDA 1QZEA 4XVQA 5ITVA 4OHKA 2I2AA 3PYLA 4B4OA 1JRLA 4Q4HB 2IA0A 1JEQA 1P0PA 2B8JA 3CR3C 4HNSA 1H1LB 3NI2A 3UGQA 5KNDD 1YR6A 3MMXA 1DTWA 3VR6H 3QG5A 4MKHA 4ENNA 1H4SA 3HGMA 1A1SA 3N58A 1WB4A 1BI3A 3ILXA 1WHSA 2PQ6A 4TROA 1A95A 2IYTA 1IEQA 4Q6WA 4IOKA 3HU5A 4M8LA 3VNBA 1ZOLA 1ZTRA 2V0GA 2CSOA 2VRNA 1C8BA 4XWKA 2EW2A 2IYEA 2XWBF 4FYKA 4L9AA 3ZQIA 1ZINA 4FGWA 5G40A 1R9MA 2C3UA 4DBQA 1ACLA 1MTZA 1RWOA 1SM4A 2IXEA 2EFOA 2VATA 3OZGA 1SVWA 3PI6A 4EENA 4A92A 1P31A 2O8KA 1G8FA 2QXTA 2XNKA 3B2EA 1RPTA 1VQ9I 2J08A 4NQZA 1HURA 1XU9A 2O7RA 3VR0A 2F3QA 2YINC 3H11B 3I3SR 2FMXA 3E23A 1ZRCA 4CV0A 5F2KA 2EQRA 4DIOA 1XCLA 1A2QA 3PD1A 4BLSA 3OZFA 2CNLA 2C96A 3S40A 4GL2A 1ADYA 1XZDA 5K3FB 5FLXK 3AAFA 1XTJA 4AWAA 1QKJA 1YS7A 3Q41A 4KN7X 3RI4A 4MV1A 1NUAA 2R84A 5T4BA 621PA 5IF3A 1A5SB 3RF6A 1Y4UA 1SCNE 2IA2A 2KT0A 4LVUA 4LAFA 1VQ7I 4E7IA 4GKKB 1VGRA 5HTKA 1DKQA 4I9GA 1OPRA 4PHHA 3KYCB 1SUWA 1VIDA 4HEQA 5AOVA 2TS1A 2FZVA 4EB6B 5KQMA 3B70A 2GOXB 5BMOA 3BDIA 1JS1X 1CUUA 4W5QA 3TW8B 2D6FA 4TOIA 5DCFA 2XGOA 3G2OA 2KKOA 2GF0A 3C14C 5C80A 1AU9A 1PQUA 3LE8A 2QR2A 2CLCX 1CB0A 4EYGA 5BW5A 1NBME 3F2IA 4EJ2A 5IKEA 2VHTA 3WGLA 4H0EA 4OI4A 1J2TA 3V1LA 4MEYF 2Q8KA 2IJGX 3AFGA 3UAGA 5LBTA 2OXIA 4EWLA 1TEZA 4KLCA 4XX0A 5FOQA 3M81A 1WXHA 2VHZA 3PVCA 2FG7C 3I9MA 4FX5A 1UBKS 4RKEA 5ESRA 1LBEA 1XVVA 3H4VA 1S1MA 3ZGLA 3L1UA 2QX7A 5AT1A 1YJXA 3BF7A 1CZNA 3KBBA 2AB0A 4I1SA 3ZCTA 1PG5A 1UPCA 3IAS1 4HX9A 2OCCH 1AKWA 4JGIA 5E1DA 5H5JA 2D8AA 1K97A 4Y7DA 3OYGA 4Q3OA 2CE2X 1UH5A 1KBZA 4DW6A 2JGDB 4KITB 3PZRA 5FFMA 5BPDA 1KO7A 4BO8A 1CR1A 1IAVA 1V2HE 2FTKE 2ZWIA 4NQRA 5G3YA 2XMRA 4MV6A 5LVAA 2EZTA 2FW8A 4AU7A 3RRZA 5KYYA 2W8BB 1Z4KA 2ZWAA 2Q2VA 3MTGA 3N2EA 4XARA 1VYUA 3VX4A 4D4HA 2O8FA 4PHFA 5DTIA 4OMDA 2R7NA 5T7BA 2OR3A 3TECE 2X48A 2WT9A 4KMSA 3T7CA 3D0RA 5JDCC 4EI2A 2VZ0A 3VZDA 3CF5F 2FI1A 4HYQA 4RVSA 2XQJA 1WUYA 4Y1EA 4TLAA 2Y0MA 2P0YA 1HW5A 1DGRM 4WXDA 1DGWY 1GA1A 2OAP1 2Q0XA 2VQSA 3F6RA 5IM5A 1VCMA 5GPAA 1PLJA 4DY6A 3ZQHA 5KVAA 4CIDA 1R12A 5D3MB 1F4KA 2FDCA 3RS9A 5E79C 4Q4LA 5CCXA 1FU4A 1LS6A 2FSVA 1HLPA 4GBGA 4RHUA 5JAIA 4REOA 1N77A 1F0PA 3RYRA 2JTVA 1FUUA 2QRQA 2X4DA 4M53A 2O9JA 4A15A 4YAUA 2G8LA 2GX6A 2RSLA 5FPKA 1HETA 2FP4A 3JYHA 5TMBA 3IP3A 1Z0XA 2WJPA 2EG9A 3K15A 4AN0A 4CQLA 3O8NA 3L92A 4PQGA 1W4ZA 1O57A 4D6YA 4MIMA 2PIDA 3RG8A 1F6DA 4YFNF 4LOCA 3ZQ6A 3D4LA 1MD9A 4HC4A 1Q20A 3QVMA 3ZXUB 4DMKA 3VB2A 3OYJA 4GKJB 1NI3A 1FUEA 5IHXA 1T3ZA 1QWOA 5TJHA 3SVZA 2C8KA 3Q3VA 4RVNA 3GWGA 1EFDN 4YUWA 1NJ6A 1W5EA 1MP0A 3OQHA 5ELMA 2NPIA 2QX6A 4JIGA 3LZCA 3MINA 5BSUA 4OMYA 5CLLA 3TX6A 5BXQC 5DNYB 3PX3A 3D6FA 5FA5A 2ZRHA 4A03A 2WT8A 4ITVA 3ORHA 4A73A 3JYNA 4AG5A 4B4DA 2CWWA 1SUIA 1JE0A 3DDUA 4ZDLA 3JAWA 1A98A 2PZBA 5FFZA 1XOIA 2Y1CA 1NUPA 3AHIA 3LJKA 1R7JA 5H3LA 4CXMA 3FXUA 5LM3A 4JOMA 5IYDJ 1QNTA 4P7BA 1Q7BA 1BJAA 3RPUA 4JUAA 5CUQA 5HOQA 3E8XA 2B1QA 1TLHB 5G1NA 4DCJA 2DQYA 2O3FA 5AVRA 3I32A 2V74B 2WNSA 5LYYA 4YBZA 1W8DA 3FHJA 1KYXA 4IV8A 1RWWA 2G9UA 2ZT8A 5H02A 5TEWA 4E5UA 3H7IA 1D2MA 2GGSA 3DLHA 3A6EA 4V0QA 5ESDA 1P33A 3UK1A 4LZOA 4DLBA 2GTHA 3TSWA 4D02A 1T13A 3H7AA 3OPYA 3DZCA 3U4HA 1OW3B 2AMJA 2P7CB 3K6RA 1UBOS 3KB8A 4IJKA 4QXOA 3U4CA 4A2PA 1ZIPA 3WZMA 2XTZA 4RV4A 5GAJA 1Y3DE 1ZNQO 2JFGA 4NX2A 2PJPA 5MN5A 4JL5A 1MQ9A 2FMYA 2B4QA 4P9NA 3G89A 3HJEA 2QD2A 3PNVA 1SUSA 3I23A 3OZBA 4CTNA 3IEIA 3M6WA 2XUOA 2QRNA 4F2HA 2VF7A 3AV3A 2DM6A 2VBFA 4O0MA 4R05A 5TARA 2EXXA 2ADMA 4PYOA 4MV4A 4C2AA 1M1NA 1VIMA 3IIKA 1PZXA 1PSDA 1KMHA 3EEBA 3EOBI 4HFJA 4U7HA 4KIGA 2GKOA 3HDJA 2UU9B 4ARCA 1WV0A 3PGMA 3AEKB 1Q14A 3CCYA 1GG5A 2XF6A 3PUHA 2GAIA 1UBNA 2VKTA 3RYTC 3DZGA 1FMWA 2P6OA 3JALA 3ND6A 4DT1B 2VQGA 4UATA 1JV2B 4ZP1A 1FQOA 1Z1DA 1V47A 1ZJYA 3MRXA 4RQUA 2KB0A 1KYWA 3IR6A 3PBKA 4JVMA 3FDIA 4H7DA 4F3RA 3HTSB 4HQMA 3S1SA 1C4XA 5EJ2A 2FPSA 2FVXA 1OFGA 3HBMA 1CJSA 5H16A 1NMQA 2L0KA 1HLFA 2ERYA 4B8YA 8ADHA 3VSEA 4WK2B 5IT5A 5FRDA 1AO0A 1PT9A 4QQNA 3A14A 4QPDA 1Z2NX 4QDTA 2YYSA 2J7PA 4RD6A 4IX7A 4WOBA 4P35A 4HNAB 4OHXA 3EF3A 4BTEA 3PIRA 3AUKA 5HUJA 4WH0A 3O2NA 4IIJA 2ONKA 3RPEA 2Q3FA 2QS9A 3S2DJ 2PBFA 4K2EA 4Y1RA 3DXXA 3GFBA 5ILVA 4RD2A 3QFSA 5CTJA 1A69A 1G3MA 4F91B 4FFBB 4G3XA 4N0PA 3X1JA 4MS4A 3MMYB 2XCLA 5BN5B 1SN7A 3SBXA 3H3FA 1OH6A 3WK9A 1SXPA 4L4XA 3BQ9A 3QBDA 1CUFA 4W7SA 2GJAA 2HF9A 1TEXA 2QLZA 3RABA 4CR6A 5KMGA 1UZUA 4EF4A 1QIKA 3KPVA 3GUYA 1RRKA 2WM3A 2FQXA 2HF7A 4FBLA 5LKRA 4BNXA 4BZQA 4L15A 1ENHA 3BLYA 3CNBA 4MUHA 4UBJA 1O2DA 3QEOA 3BCAA 1ABFA 2PN6A 1BD3A 1TMKA 2GPAA 2R7MA 2CVQA 2QN8A 3I64A 4I1OA 2PUGA 2DKOA 5I4IA 3VI4B 1E9VA 4E7KA 4HSEA 4MW4A 4RZXA 4FFNA 1P9WA 1R5OA 4Y2UA 3ABZA 4DV4B 1BG6A 1VE5A 3EHEA 3HSSA 2VPPA 4L7QA 2UXCB 4DZTA 4Q15A 4IJ5A 3DVLA 1M66A 1DCFA 4YVFA 4MJXA 1JDJA 1SHLA 5JQGB 3HKZA 4TWZA 4YA6A 2LFBA 3T5MA 3FXKA 1XRNA 2BEVA 2ZOSA 5M5WJ 2GARA 1DQUA 3CO6C 2D7CA 3FVRA 3MJSA 3MT9A 5CG2A 4DHWA 3UO8B 3TMKA 1YUNA 1ZNZA 2J09A 3GNSA 1LKZA 3QX8A 5L3EA 1B26A 4RANA 1M0WA 4TKUB 4Z54A 4ZV4A 5JC8A 5C52B 4WCFC 2N8GA 1NW5A 3C6MA 3LO5A 4NP6A 4R1QA 5FBRB 2JRCA 3HXMA 1P6RA 3A6DA 3FZVA 3MWEB 3GTLJ 2XLBA 4U7JA 3UT6A 2WE8A 3KYLA 1OQAA 1CR2A 3L18A 2C00A 5SZHB 4QU8A 1PJLA 4JUBA 3VU0A 3WB1A 3WTUC 1YL6A 5IANA 1A2BA 1VPEA 3C74A 5H9VA 1WXDA 2QTMA 1U0TA 1O0BA 4Z53A 1E5QA 3MWEA 5DBHX 1FTYA 5IJ9A 4EKEA 3KETA 3W77A 2UKDA 2XNCA 3TO7A 4LC0A 3WG7H 1ORWA 2WHPA 3ZE0B 3SYRA 3C3BA 1BW9B