2VT2A

Structure and functional properties of the bacillus subtilis transcriptional repressor rex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
199
structure length
184
Chain Sequence
ATAKRLPLYYRFLKNLHASGKQRVSSAELSDAVKVDSATIRRDFSYFGALGYNVDYLLSFFRKTLDQDDVILIGVGNLGTAFLHYTKISMAFDINESKIGTEVGGVPVYNLDDLEQHVKDESVAILTVPAVAAQSITDRLVALGIKGILNFTPARLNVPEHIRIHHIDLAVELQSLVYFLKHYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and functional properties of the Bacillus subtilis transcriptional repressor Rex.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
molecule keywords REDOX-SENSING TRANSCRIPTIONAL REPRESSOR REX
total genus 56
structure length 184
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02629 CoA_binding CoA binding domain
A PF06971 Put_DNA-bind_N Putative DNA-binding protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2vt2A01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2vt2A02
2G9WA 3GZ6A 3U9GA 2ZK7A 5COAA 4AJNA 5ENVA 2AS5F 3ZP5A 3FSRA 1FYKA 2X6TA 5HVQC 3WIDA 3ZWAA 4ZICA 1ODDA 4WX9A 5T8KC 2M45A 2X9GA 4ZYDA 1P92A 4CICA 4XIYA 2H63A 3HRTA 5U9CA 4L73A 2IDZA 4YRBA 2Q4BA 5IDQA 4P4LA 2L4MA 5F5LA 1MA0A 2POQX 1R7JA 4AIHA 3JD2A 4DLLA 4CHUA 2GXBA 3PQKA 3WJAA 5JYDA 1HLDA 1XGNA 2X0NA 3E6AA 3WOHA 1I0ZA 1YOVB 2GD1O 4BUCA 1UP4A 1LSJA 2ZYGA 3Q5FA 2Y99A 3I83A 1VSUA 1PZGA 2HDCA 1XDUA 3BPXA 1LDNA 3E1KA 4TZTA 2I99A 4BL5A 4LK3A 3TZQA 1GU7A 1B1BA 2NM0A 1PQUA 1T2DA 2FOIA 1PU2A 4U0KA 5G2OA 3OJFA 2E48A 1I2CA 3G1TA 3W8DA 3L07A 2EJVA 5C7LO 2HQNA 1BC7C 4KMUX 4CMKA 3FCOA 4EGZA 4MQ9F 1Z6ZA 4E30A 3ORFA 3JYPA 4UEKA 2QRLA 4LW8A 5JAMA 1V3VA 3OIGA 3GFMA 3U5TA 3OEYA 2QBYA 2IW5A 2F5CA 2I66A 2PZLA 4M72A 2YJZA 3L7WA 2QVOA 3J80Z 4DMLA 1J59A 4E2WA 1ZMOA 1G4DA 2A4KA 2XKPA 3VFZA 4PN3A 3KLNA 3OOPA 2BHLA 4BHTA 1ZBQA 5C7OO 3JW4A 4DNCA 3WIEA 1X15A 3EUHA 2JAPA 4WE3A 2JJYA 3JCZA 4XR4A 3ASUA 1AHHA 4GI2A 2JTVA 4WLUA 2Q1WA 3J81K 3ETEA 4FFMA 4PIVA 1ZNQO 3G0OA 1EK6A 1ZH8A 1R37A 4NNJA 4RPLA 3I9LA 1M2WA 4CLOA 1LSUA 4EJ0A 3F72A 2A07F 1GXPA 1Z74A 3GK3A 1GDHA 2PFBA 3I52A 3LK7A 5EL0A 3VH1A 1IN7A 3ZWYA 4HF0A 3HOSA 4IDBA 4IHSA 1OC2A 4ZQFA 2X7HA 3JSAA 4KZPA 3CUQC 2ISZA 5A9SA 2QLZA 3CTMA 1OYIA 2X4HA 2Y48A 2EKPA 3F3XA 1GV1A 3IUSA 3QIVA 4RF4A 8LDHA 5JSFA 1VTNC 1P6RA 2O3RA 5G4LA 2GAUA 3MAJA 1YE3A 3WTBA 5JW6A 2IA0A 4CR7A 3UVEA 3SLGA 1FXSA 4XQGA 3I59B 1MG0A 3HZZA 2BELA 5HDNA 1Z05A 3S1LA 1DXYA 3KRTA 2RN7A 4FOOA 3TPCA 2VRBA 1Q1NA 3JQ8A 4YJFA 1BSVA 5B4UA 3OQ6A 4J43A 4CLXA 2GIVA 3CLOA 4UUNA 1ZK2A 4WXHA 4FGSA 5DCFA 4L9TA 4GAEA 1FDWA 1VKOA 2XAAA 5GMOA 1GTMA 3ZWPA 4JJGA 4DVJA 1PUEE 5ICSA 1TQIA 2FMYA 4XRRA 2CW0F 4DIFA 1W4ZA 3OHSX 4KDEA 3PFWO 3TZCA 1RNLA 1HYGA 2P6SA 4YACA 3S55A 2IE0A 1T4DA 4AJ4A 3MJCA 5A5FA 4FFNA 1ZHFA 2VWGA 4RZIA 3GFBA 2OU2A 4XJTA 4EM0B 3HG7A 1D3YA 2STWA 3GNQA 4JN6B 4CMIA 3GZ4A 1CGPA 2ZTUA 1IXCA 3ELKA 1CWUA 4IMRA 4K26A 5H20A 2NV6A 2Y93A 3F46A 1DHTA 4RF2A 2GWRA 3JAMK 1O6ZA 1EFLA 4HQEA 2EKQA 2P4HX 5I7FA 4P22A 4J2OA 4HBGA 2DPUA 5JC8A 1BN5A 1X7HA 3ZNOA 1NM5A 2ZKZA 1I8TA 4WLFA 3K69A 4D43A 1YGYA 1Y8QA 5L3DA 3CINA 3H2SA 4CM7A 6LDHA 5KVCA 3ZU2A 4M9XA 4PDKA 1IL0A 2AQIA 3K30A 3ROKA 4A7PA 4FR5A 1GYPA 3ANLA 5ER6A 4HNGA 5JFOA 2A6EF 4OSPA 4PLFA 1QYVA 1C0PA 1ZSNA 1QO0D 3E9NA 4FSHA 1XIVA 4RL6A 5IZCA 1H6DA 1W6UA 4IXAA 3L2CA 4LLNA 5ERIA 2QQ5A 3WTTC 4ZU3A 1LRJA 2A68F 4PCVA 2CWEA 3GVIA 1A04A 4H7PA 3KYDA 3LZ6A 1LB2A 4Z9YA 4N5LA 3BMOA 4Z0PA 1ADBA 3E8XA 4GPD1 1BBYA 3I9MA 3DMTA 4GGPA 1JTVA 4L9JA 3R61A 1GZ4A 4XLPF 2YFQA 1XCBA 5H83A 2GASA 2FMLA 4WKGA 3RIHA 3WE2A 2H94A 1EVJA 2HYGD 4CMEA 4E31A 1KC3A 4TROA 4F6LA 3GEDA 1VJTA 4OXKA 2BV6A 1ZXLA 3ETDA 1QMGA 4YJGA 5TRTA 3ZNQA 5FLXZ 1WZEA 2GERA 4BNNA 3U3XA 3UICA 3PJGA 3N58A 1YL6A 3R0IA 2JD1A 2IXBA 2JT1A 2O2SA 1CIVA 4W82A 4XX0A 3BYZA 1I01A 3ITDA 1UAYA 3DBLA 1I5ZA 3HE3A 2X23A 4W7HA 1GR0A 5JHUA 1IPFA 3IUPA 5KVRA 2UDPA 2OO5A 2EG9A 4MPDA 2OP0A 3V8KA 4F7ZA 3IS3A 5FI5A 4HLYA 3DBHA 2H9IA 4G5HA 1FNNA 4AJLA 5ITVA 1HEUA 4U7WA 1CETA 1CF7B 5J6XA 3L0DA 2K27A 1K6XA 1IHYA 5KWEA 1R23A 2C2XA 2PLAA 3KO8A 2X58A 3OIFA 4UUMA 4W9NA 3WGTA 5ES3A 4LD5A 4U7DA 4KOAA 3DFGA 3TNLA 4YIFA 2DUWA 4MP8A 3LLVA 4W99A 4I0AA 1R4NA 4GGOA 4HADA 2NYXA 3LF2A 4J0FA 1NPYA 2D8AA 1XKQA 3W6JB 4PZCA 1DRVA 5EQDA 1UXKA 4XSXF 1HDCA 5A3JA 4PLHA 2KIFA 2A6HF 1LDYA 1VPDA 2JPBA 4RGSA 4RVHA 2ZMEA 3F4BA 3GFIA 1SD5A 3WTCA 4YT2A 4BNWA 5JDIA 4JBIA 2H5LA 4XYLA 2EFPA 5A04A 2NVUA 3I71A 5C3MA 1ZFNA 4PVDA 4MKXA 1E7YA 3OJ0A 5D5XB 3WQQA 4DIOA 5LGNA 1D4FA 1YW7A 1XA0A 3SZTA 4YIIA 2EF1A 4J1TA 1U28A 3WSVA 1ZSVA 2JHFA 4GBJA 4D0PA 5BR7A 1IZ9A 4MVJM 2HFHA 4IQGA 5BNIA 3DAPA 1GPJA 1CF7A 5KOIA 3K1NA 2Q1SA 4F45A 5F64A 4LMYA 3TFOA 1M66A 1EBUA 2VYND 5DYMA 1D8JA 2OP1A 5THKA 1PEDA 5GZ1A 3GPIA 3DB2A 1IF1A 3PFIA 1ZLKA 3DMYA 4GH5A 1C0WA 4HX7A 2DTXA 3RKWA 3JQ7A 3UXYA 2Q2WA 2WM3A 3AUUA 1XWFA 3GGPA 2EA2A 4CLRA 5K5QA 3NGLA 4ILKA 3O8QA 4DL9A 2Z3YA 2AE2A 1DHRA 2XIGA 1IOLA 4FBGA 4MGRA 4MVJF 3W6UA 4J1SA 3TDKA 4A0XA 4CMBA 2YHUA 4W9NC 2VOPA 2P91A 3C7DB 4Q4ZF 1IY8A 1T2EA 4C7JA 3S2GA 1U2GA 4KDFA 4OIOF 5D5VB 4TRJA 2NVUB 4G8XA 2WWYA 2FEZA 1HF3A 4O6JA 3NTQA 5HS9A 2OHXA 5I9LA 1O95A 1HSOA 4AJ1A 4WPGA 2OFPA 4EJMA 3NEPX 2F00A 4BV9A 3ANMA 5HS4A 1SD6A 3JQEA 3UFXA 3PGJA 9LDBA 1HKSA 2CVOA 4YAKA 2B5VA 3PRJA 1G3WA 5EJ2A 4MEXF 1B6AA 3WX0A 2G76A 2DPGA 3NT4A 3K6JA 2HEOA 2CSUA 1XGKA 3DZHA 4G9YA 4MVJP 2QX7A 3D3WA 3GXOA 4PRLA 3RFTA 2QQ9A 3ROPA 4MHGA 3TQHA 1K0UA 3T0YA 3I6QA 3VZSA 2V6MA 1T2CA 2J5RA 3I58A 2UAGA 3OJOA 4NMHA 3ZV6A 1YQXA 3KLPX 3VHRA 1FBQA 1J6UA 2NADA 3D5TA 3T4EA 4Y15A 1V9LA 1WMAA 5ICFA 1PJ4A 4RB2C 4WK8F 3ABUA 3GW2A 1XQ1A 2IEDA 2H09A 2FWMX 3ADPA 3ROQA 4CLRB 1E5LA 1MX3A 3PLNA 5AYVA 1OYWA 3PQFA 2PGLA 2PGDA 2P2SA 5EPOA 5DDIP 1R0KA 2DUUA 2G5CA 4IXTA 3COSA 4I7HA 1J2XA 3LA3A 2ZYDA 5DNAA 3TRIA 2CF5A 3GR6A 1KU2A 5L7WA 4BQRA 3F47A 1WVGA 3F8CA 3R3JA 3RD5A 5LCXA 3WNQA 3RUAA 4IDCA 2WDZA 2TDXA 2EV9A 1DIHA 4NZ9A 2OBPA 4FPXA 4BHCA 3GN1A 4Y8VA 4RGXA 1WDKA 4JLWA 3WXBA 1DUXC 3OICA 1NPDA 1I32A 2HRBA 2J3JA 3GUYA 3DQVC 5TNXA 4RPJA 4YG2F 3DOOA 4MP3A 2PN6A 1GADO 4G81A 1MLDA 3GEGA 5U1PA 5KJ6A 3RIRA 3BA1A 3DWFA 3OEWA 4EJTA 1I3KA 3DZFA 1HL3A 1F0YA 1KERA 4IZIA 2J3HA 1IZ1A 4IRHA 1PTJA 4NQZA 1HKTA 4UREA 2EV0A 1EFKA 1EV7A 2PG4A 2AMFA 1JKFA 4J6FA 1C1DB 4WEOA 4RS8A 4K6CA 4HUJA 4ZZDA 1MC5A 4RB0A 1J49A 3GMDA 3GVXA 3PGXA 4CODB 3D4OA 5HM8A 5KJCA 5ICGA 3P7NA 2HR3A 1U8XX 5JDCC 1JQBA 1RYEA 2JFFA 2DPDA 4EQQA 5LLQA 2HTSA 3CUOA 4I2OA 1ZZEA 3KXDA 3LC1O 3NTRA 4DXHA 2O2YA 3GHHA 3UCFA 3N74A 2UUPA 3DPLC 1LNWA 4B09A 1YVEI 3ANNA 4BV8A 4BGUA 2BI8A 4ASNA 1IZ0A 3E5QA 4EUFA 4HFMA 3DFUA 1XG5A 4YJDA 3NRCA 5JMPA 4AJ2A 5ICMA 1XN7A 4D41A 3ZV4A 2Q99A 4NJOA 1UXHA 2Y1FA 3TDZC 1U5CA 2IA1A 4IJVA 1BDBA 4RAZA 3QPTA 4AIKA 4U88A 1PSDA 2UVDA 5CHEA 3LWFA 1UFMA 3DV8A 3KYBA 3HSFA 3PYLA 4GKVA 4XYEA 5DD8A 3GLQA 4XGIA 2Z33A 5T57A 1I24A 3S2FA 3A9WA 1FF9A 2D2WA 3AJRA 1MZBA 2DBQA 4HF1A 5ILUA 3HTUA 3OIDA 2JFHA 4LSWA 2NQ8A 2RC4A 3L09A 1ZYRF 1FLIA 3U1DA 2FPPA 3VOEA 4F3YA 2OXIA 4A5MA 5I7EA 3MZHA 4U8GA 4B4WA 4EITA 1ZEMA 3KUXA 3IJRA 1T2KA 4PLCA 5H81A 2O3SA 4NBVA 4Y6RA 4NBRA 2XV4S 4WK6A 3H3JA 1UJMA 5D6FA 3IHUA 4IGFA 4NPCA 1LLCA 2GR9A 1GZ3A 3GF2A 4UVIA 1U4OA 1F12A 4IDGA 2AQ8A 2CUKA 4NH4A 4YQYA 2BFAA 3U09A 3BY6A 2ZYAA 2WV0A 4M87A 3NRVA 2CYYA 1IHXA 3VZQA 4CM8A 1BIAA 3ECOA 3WGHA 4QSMA 3TO7A 2KIUA 1EH6A 1GQYA 4CM1A 1KVTA 2YHIA 2F5DA 2HDHA 3GNTA 1R58A 1U6GA 1U8RA 1P44A 1DFHA 1DDNA 4NHEA 5EQFA 5TT1A 1BWSA 1G3TA 3ZQ7A 4EDFA 2JRTA 1YJQA 1GY8A 3JTMA 3WTZA 3PJDA 4J2HA 1BIBA 1NR1A 3GN2A 4MO2A 5D5WB 4XYBA 5I8ZA 4DLAA 3BHIA 3WTVC 4OMZA 4EM2A 2IPQX 3T8RA 3L77A 4XGNA 3G17A 4A6EA 4GWKA 4LJZF 1ONVA 2CG4A 3ETGA 3GFJA 3UCEA 4FIZA 2P5LC 3KSUA 1FSHA 2GZ2A 2ZTMA 1LA2A 5LBQA 1YL5A 2W25A 1CQJA 3HHPA 2WJPA 1PIWA 1YQAA 4BKRA 3FM3A 4E5NA 3FXUA 3ZMSA 1U7TA 2P6TA 1MB4A 4P4GA 4Z3DA 1W73A 3INGA 4MVJA 2O61A 3ASVA 3ZU4A 4J3FA 3OFSA 1I30A 4E2ZA 2EV6A 2KJCA 5DEQA 3GWZA 3QWBA 3ZW9A 3RYPA 5TGDA 3WBFA 5FGMA 5JCJD 2FZWA 4BQPA 3C1AA 2IVMA 3P9IA 3DZIA 3EC7A 1KU7A 3LAJA 2R2GA 2X0LA 1UCRA 2O3JA 4EJOA 2IZ1A 2Y1EA 3BAZA 3HHHA 3WTSC 1H2BA 1LDMA 1NQTA 1V3FA 3NYWA 5A05A 2H6BA 4GX1A 3TKYA 4BO9A 2QQBA 4YAGA 2E1NA 3AOEA 3CUKA 4X54A 3PYXA 4CV0A 2YV2A 1ZXBA 4II2A 1IYZA 4A5NA 4OQYA 2DLDA 4BXUA 4Q47A 3T7CA 5IZCC 1RYDA 1ARZA 1HW2A 2FRDA 4OMYA 4Y67A 1B16A 1FT9A 4YTEA 3DDNA 4BOYA 1WKMA 3JYLA 2XKOA 2ZCWA 4QECA 4J7UA 4BGIA 2NUAA 4FW8A 2HZTA 1YW8A 3RC9A 2J3KA 3MZ0A 4WNCA 1R1TA 3VC7A 2F5EA 5I8WA 5FLXK 5KCZA 2V79A 3G73A 1GQQA 3O9ZA 2GZWA 4LCJA 1HZZA 2XF8A 4IJWA 1P1KA 2MA3A 3QRFF 1KY4A 3M8FA 3KM0A 4OO3A 5COQA 4II3A 1PJBA 2QG4A 2I3AA 1NWCA 1NHAA 2PK3A 4OGWA 5F21A 4OXYA 2QWWA 5EERA 2P7CB 1YONA 2VZ0A 4E32A 4PG5A 2FBKA 3PHLA 2M87A 4RQUA 3ZI0A 3HFSA 3RU9A 3QQPA 4WCGA 1R15A 2RBEA 3OETA 3ML6A 1V3UA 5THQA 2Z95A 3B02A 4L18B 4G6DA 1TT5B 7MDHA 4YR9A 3E9QA 5JS6A 1GUFA 1SOWA 2ZQYA 2HMSA 2XROA 3E6CC 1PJ3A 2AG8A 3D4NA 1LJ9A 3QSGA 4MIOA 4GYIA 4AFNA 4CM9D 4R1NA 4MOWA 4GQAA 4MKRA 2O3FA 2W57A 2DTEA 2BGCA 3COAC 4RPGA 2QM3A 4E5KA 1DDOA 2KRFA 5CDGA 3A06A 1EUCA 2VOEA 4WNIA 5E18F 2IYPA 4XJSA 1ONNA 1YB4A 3I0TA 2RH8A 5JFRA 3DFZA 3GG2A 4W6ZA 3HDJA 5AIPA 4KMSA 1IN5A 4J1QA 4NJMA 1DIAA 4CM4A 2GUGA 4RO0A 1ZN2A 1MFPA 1LDKB 2XGXA 5FB2A 1GAEO 2VWHA 2PKRA 3M1AA 5CP8A 4B8WA 3FX3A 2CY0A 3HRUA 5KJFA 1TQMA 1QPMA 3WE3A 2PZKA 3TZHA 3ZV3A 2X4GA 3NDJA 3JQBC 4WGGA 5AXCA 5ILSA 4NFHA 2DFIA 2FHSA 4Q3CA 4MIEA 5ILGA 1NHGA 3LT2A 5F1RA 1I3MA 3KHUA 3M2PA 1ML3A 2HK7A 3QLJA 1PJQA 5BNTA 4J16A 4DRYA 5D5UB 4GSKA 3F8MA 3MTGA 1KEPA 3B1JA 1EDZA 2HMTA 1GYRA 5L40A 3KLOA 1ENZA 1K79A 4QO8A 4NK4A 3L4SO 1YH3A 4OINF 5JI6A 2D1VA 1I1GA 4CMHA 3JQAD 3PFFA 2BEOA 3M8EA 1ID1A 1KYZA 1QGPA 1JA9A 5IT3A 4P38A 1UP7A 4R8HA 1RWBA 5FF9A 3ZN0A 3O38A 4GX5A 4CV3A 3FMRA 5CEFA 4QEDA 3JYNA 1ZG5A 1F14A 2Y1CA 2L3DA 3ZV5A 1Q0HA 4L76A 1BXGB 1ISGA 2O7QA 2O03A 4L8VA 1PWZA 5JPIA 4B79A 3L6OO 3NDIA 8ADHA 2K4BA 1Z7EA 3HN2A 3QVWA 5G0SA 2TMGA 1YG2A 4G65A 2HRZA 2GNAA 3CUQB 3K2ZA 2I3GA 4HA8A 1HE3A 1G6NA 4XB2A 3U49A 5D8KB 1A9ZA 1FDSA 4XD2A 2YDYA 2IRFG 2W2LA 3CO7C 3L6EA 3ZU5A 4E3ZA 2IEBA 2GZ3A 2PY6A 1T26A 4U6QA 1JAYA 4JBAA 4BO4A 1TB4A 4IVNA 2PWZA 4CQLB 1IULA 2MC3A 4YJGB 3EETA 1EQUA 3H65A 4TZKA 1J0XO 2VUSA 1JXSA 4WCFA 4A6DA 3DONA 3X2EA 1DJNA 1IRGA 4E5MA 1TQPA 1DFIA 3U9LA 5J8CA 3ZNNA 3A14A 2DAOA 2RNJA 3FBGA 2J8ZA 1HE4A 3BMNB 1QP8A 2P8TA 1HWYA 1GVJA 1HTBA 1JDJA 1OI7A 3H9JA 3PJEA 4WOKA 2QRJA 4FD3A 4P8RA 1TVEA 3MQ0A 1PJLA 4IDFA 5TX7A 1N8KA 5IDWA 3E5UA 3DZBA 3AU8A 3VKVA 2JCYA 1VKNA 4ZGWA 4LK0F 4AJEA 4KIBA 2PKQO 4J4TA 4E70A 4E2YA 4CM9A 2E6UX 1R36A 1Y9AA 3IKTA 2RVCA 1E6WA 1V0JA 5CVRA 3CUQA 5HLGA 3NJ8A 3RJ9A 4BNGA 3MWEB 4MTDA 2XASA 1XR3A 1W7PB 5E1ZB 2ZFWA 2JFGA 5D8LB 1UXIA 4FFPA 4GX2A 2BRUA 4AJJA 3PQEA 3CXRA 3EW7A 3L9FA 4MINA 2LF8A 3TF5A 1DOHA 3K9QO 5BMZA 4FC7A 1EVYA 1T98A 2RDPA 4W4TA 4B3HA 3D4PA 4EM1A 3LT0A 1MFZA 4DGSA 3ENNA 1RM4A 2HSDA 3ICCA 4WCFB 1U3EM 3WLEA 5L4NA 1WW8A 4JCOA 1Q7CA 3EGOA 4AJHA 3K1MA 4MKZA 2Y67A 3CSDA 3RCBA 4XQ9A 3L4BA 1LSOA 3EVTA 2FR0A 4UUPA 3OMLA 3KEQA 2IJLA 4GSLA 1KYQA 2STTA 5K5RA 4QO7A 4AVYA 3QU6A 3IIEA 1NVGA 1F4KA 4GKBA 2RCYA 5DOVA 4EBFA 4UEOA 3WS7A 3SJ7A 2ZQZA 2BE5F 5AONA 2VODA 3PPIA 1SB8A 4M86A 5AVOA 1AN9A 3B70A 2Y68A 1I6XA 1O3QA 2XAGA 1MDMB 3M6IA 3I23A 5LC1A 3CPSA 3GF4A 5CVJA 5CPBA 1B9MA 4AJOA 1A7AA 2H27A 3GGOA 3RDIA 1LLUA 4IINA 5F1OA 4M6XA 2CNBA 2V6GA 3O03A 2CF6A 3GFGA 4FT8A 2I9PA 1CJCA 5L45A 3AY3A 2F1KA 4FQ8A 3G49A 2VZ9A 2O7SA 1SO8A 3BZUA 4HV5A 3VTFA 4ALIA 3EYWA 4GO1A 1NASA 1W0CA 1X14A 2P5UA 4NR0A 4EEZA 5JCXA 3NQOA 1ISHA 2PFGA 2P9GA 4B7UA 3F5SA 4CLOB 4M49A 4BNVA 3EAGA 3KSDO 1NX6A 4K6FA 4HXYA 5LHIA 1LC3A 3ON5A 1O0SA 3GC6A 1BGVA 1G0OA 4ALNA 1SMTA 4HX4A 4IM7A 3KYCA 3RFXA 4DMMA 5ICEA 3RUHA 3CO6C 2VN8A 4YAIA 1LEHA 5CYVA 2YZ7A 1MGTA 3DF8A 4MDHA 3FF5A 1WXDA 2K86A 3BMQB 3GNSA 2CSOA 2G7UA 4CUZA 3VKUA 3JQ8B 4EMSA 4YJFB 1U3UA 2C2YA 1P74A 3NT5A 4CQMA 4NHJA 1EZ4A 1IPEA 1WLYA 1QNTA 1HKUA 1NWHA 1XMKA 1WNTA 4IHTA 3GPDG 3JQAB 4XLNF 4ENNA 4ND4A 4K9DA 4UVGA 4N18A 2IZ0A 2ZB7A 1ON1A 1LRLA 4LRSB 3FZVA 4RLSA 2OA4A 1KIFA 4FN4A 4LFUA 4U0WA 1EVZA 1E7QA 2XXBA 3AW9A 3MJVA 1V3TA 2P7VB 4IDAA 3ZWCA 1C3VA 4EJUA 3KP2A 4HV6A 1QV7A 2NU9A 4B4UA 5CJ9A 3SEFA 4WEQA 1YW9A 2UXXA 3M2TA 4ETSA 2J3IA 2OBYA 2VNAA 1SZJG 2YQ5A 3ZU3A 4OXNA 3V4GA 2YPRA 1Y5MA 1PGNA 3FRJA 4HQMA 2XAFA 3FR7A 4EUHA 5BPIA 5A9RA 4ZQGA 2E1CA 1ZK4A 5L9AA 2L54A 4I0BA 4L5IA 3GQVA 5DCUA 5KTKA 1RUOA 1B3BA 3GOHA 4IBOA 1Y9EA 2X9NA 4D46A 4YFNF 2FN7A 1C0LA 4JBGA 1G6KA 1DP7P 1T1SA 4BO7A 4IUYA 3MFKA 1S7OA 2JHGA 1ULYA 3KYDB 1USSA 5GY7A 3GY0A 1QLJA 3JQAA 1F5TA 1E3SA 5AXAA 4BGEA 5J23A 3F8NA 2D5CA 1LDDA 4DQVA 3ONFA 4HV4A 5F1KA 3DHNA 3UGKA 1WQ2A 1XLTA 3WYCA 4TKMA 1H5QA 1SD4A 2J5OA 1MJ9A 4KICA 4NQWA 1QSGA 2OMEA 1JGSA 3TL3A 4ESFA 3N97A 2BGKA 3KTDA 4HWKA 1LSSA 2QUFA 2ZCUA 3K2BA 1FYLA 1GEGA 4PG6A 1RUNA 3RASA 1EUZA 4ZZLA 3EY4A 4I02A 1R4MB 4ND1A 2BFOA 4A03A 2AXQA 3JD1A 1XSEA 1YB5A 3FWNA 3Q2IA 3EMKA 4XCVA 5K5OA 4XQEA 2ZB4A 1Y5RA 2EXXA 2Y05A 4O59O 4S3MA 1PL6A 4ENJA 4RQTA 4CL3A 1ZGAA 4YA6A 3P9KA 2FZEA 3QVOA 3RBVA 4PRKA 1H94A 4KWIA 3ZWWA 1F17A 3QWAA 2WMDA 3PP8A 4LISA 5DBIA 3ZWNA 2W84A 3IDSA 2OQGA 4DQXA 4WXDA 3KP5A 1LBEA 4BMNA 2UXNA 2NAZA 3LQQA 2FPGA 3LSTA 3DBHB 1UDBA 4K1LA 3F6VA 4HDVA 1JU9A 2ZJ2A 4L9NA 4A26A 1P2FA 2VTEA 3RVDA 1LDGA 1D8AA 4KA4A 5AIQA 4B3JA 1XQ6A 1YBVA 4HFRA 3C3WA 3JQCA 2ZCVA 3U62A 1LLQA 3PIIA 3JYQA 3P19A 1E7RA 4BMSA 1WZIA 1GD1O 2LDUA 1K89A 3WB9A 3WU0A 3U0BA 3U4IA 3E5XA 3H92A 3CJNA 3IC5A 2O0YA 1EK5A 4GLOA 4EJVA 3Q1LA 4J9VA 4CMCA 4RPHA 3RC2A 2HLPA 2HU2A 1JW9B 2HMUA 4E4YA 3D1LA 1FOKA 2COMA 1RM3A 1UH5A 2D3TA 2RHCA 2ZB3A 3VZPA 2O23A 4N7RA 1DSSG 4LB6B 4LMPA 1PP7U 4O1MA 1VL6A 2TMDA 3SZPA 1JKIA 2R7DA 2GZ1A 5BQTA 2PH3A 3GVCA 4MVJD 1FPQA 5A1TA 1QV6A 4G94A 1GQ2A 2JL1A 3HB5X 3QP6A 4NFYA 3ZWXA 3ZWMA 3K9TA 1YFHA 2VRCA 4NDNE 4FFRA 2HS5A 5FFXA 3JD4A 4E12A 3BOQA 1HE2A 1Q0QA 2B69A 4G2NA 5FYDA 5IJZA 4MEYF 2GN6A 2R3SA 4E2XA 4U5QA 3C18A 1MV8A 3ZDFA 1TEHA 3GDOA 2AHRA 2YV3A 4ZQEA 1GV0A 1USTA 2VE8A 3FTPA 3WYEA 1KQ8A 3ZWVA 1UB9A 1OFGA 4GCVA 5DZSA 2MH9A 2QENA 1XGOA 1OMOA 3JQ7B 3K31A 3KFWX 2WWRA 3NV9A 4ZA2A 1KU3A 4FX4A 4ENMA 1KY5A 1SMKA 3IWZA 3HJAA 3EYYA 1HSTA 2CDAA 3QWIA 3LC2O 4RVUA 3PVZA 1MKMA 1BC8C 4WLNA 1C0IA 2G1UA 4A0SA 1KVSA 2CO5A 4FHTA 4Y9DA 1MGOA 4PLGA 3V7CA 4XYMA 4EGFA 1Q0LA 3EHEA 3CMMA 4J90A 4XR9A 2BMAA 3GDFA 4UVEA 2PTGA 1Y8RA 5T64A 1TNSA 2P5YA 2GDZA 2AXLA 1NTOA 4FJ0A 4ESBA 1Z6TA 3ZPLA 4LG0B 3DAGA 2DQLA 2FSWA 3PQJA 2E7XA 1K2WA 2YYYA 5BNFA 5JCJA 1TLTA 2W98A 2FXAA 5H82A 1EEHA 4DBVO 3F4LA 1NFFA 1X0XA 3HYIA 4U0VA 3UAGA 1NR7A 3PTZA 4M55A 3W8FA 3AFMA 1U4SA 2DU8A 3F1LA 3RJPA 4AJIA 4DUPA 4OIQF 4E21A 3ONDA 3GG9A 3UKOA 4HP8A 2R00C 2ET6A 3CMCO 3DHYA 4R54A 3U2RA 2ZKLA 2QYSA 4D3SA 2Q49A 4QWQA 5LGUA 2BKAA 3ZN2A 4MVJG 3AOGA 1W5TA 1C14A 4EW6A 1R0SA 1OR7A 3BMCA 5G0TA 5TF4A 1NAHA 1MG5A 2VHYA 1Y81A 2WE8A 3UW3A 1H9BA 2VYNA 1ZAOA 3FXRA 2B5WA 3HADA 3JQ6A 4DA9A 2EK5A 5CVIA 1Z9CA 2IP2A 2HO5A 4JJFA 4OOIA 5IG2A 1JVBA 4IMPA 4KT5C 4XYGA 4ID9A 4A0ZA 2Y1GA 5A03A 4Z0HO 1OBFO 4WLEA 3EQLF 4Z3KA 2LNBA 3WQSB 2HUNA 2R6JA 3JQBA 4QXMA 1TNTA 5EIOA 3Q0EA 3VH3A 4LG0A 1D7OA 1KETA 2ZATA 4MP6A 1JN0A 4ZYGA 1E3IA 2PR2A 1R1VA 4CR6A 5AQ1A 1R4MA 3PWZA 1DC5A 1P0FA 5E8GA 4INAA 3P2YA 3PDJA 4DC0A 4HFJA 3IC7A 2AEFA 2Q0OA 2BGMA 4ITUA 3G3ZA 1WWXA 2V65A 4HYEA 1GCUA 1PGQA 2YW9A 3PIDA 5JDIC 3J80K 1Z7BA 3IQDB 5CVUA 4PGGA 2FBIA 2RH4A 3ZNPA 1R0LA 3PZRA 1VM6A 5IZ4A 3HTSB 3E48A 3WTUC 2NVWA 3BJAA 1TT5A 1J9IA 1C1XB 3VB2A 2YU3A 2A69F 3KOUA 3E18A 3Q9VA 1QZYA 1VJ1A 4OKNA 1D1SA 2GN8A 2QYTA 3MJEA 2FPIA 3QV1A 2DT5A 2L01A 4CPDA 3F22A 3PLRA 2P9EA 2IRWA 3VH4A 1B8VA 1Y8QB 3IP1A 1R12A 1UZNA 3GEMA 3OJEA 4WECA 2AQHA 2ZIZA 5I7VA 2CDCA 5JY6A 3BPVA 4JK3A 4DPLA 3ZMDA 4PLVA 5A3VA 4BNKA 4A5OA 4YXFA 1ZSYA 1C1DA 2VC0A 3BTOA 4S1VA 1XCVA 3WSWA 3DEYX 2XAQA 3MWDB 3IKVA 1EE2A 3OH8A 4BYYA 5HOOA 1AXEA 3RTRA 4AIJA 4IPAA 2UWMA 3HUDA 1R6DA 1FSEA 4BNMA 3HUGA 4FX0A 1PZEA 4RGUA 4N9HA 1ZW1A 4ZQHA 4UULA 3FNFA 4G7OF 3TWOA 3BTSA 4J9UE 2FRHA 1LXCA 2FR8A 3MEQA 1VRWA 4O5OA 1J0RA 5FD5A 5FFZA 5LRSA 2C29D 1FBUA 2ZNYA 1N7HA 4KN7X 4L9VA 2DK5A 2VZ8A 4JQCA 3KZVA 2PJPA 2DBZA 3F5QA 1GEEA 1V35A 3KZYA 1ISIA 2Q2EA 4BS9A 2X22A 1YO5C 1BRMA 2NTVA 4RDHA 2V6CA 1E3LA 4L75A 4WASA 2EFQA 3DZJA 1Y7TA 4RZHA 1U5AA 1SEPA 1NHWA 1KGSA 4TQGA 4M89A 4AG3A 5JXWA 1TBXA 4OOEA 4P55A 4EYEA 2ZO4A 2VUTA 5L4SA 1N9GA 4HX8A 1WAMA 1NPTO 3VTZA 1FP1D 2XHKA 2PQ8A 3IAHA 2W4QA 5EN4A 4DWVA 2X5OA 2EHDA 3H9UA 4ZN6A 5CG1A 5I7SA 3JAMZ 2W8ZA 4I98B 1S3JA 5EESA 1E2XA 2Q2QA 4XIJA 1Z7UA 1LDBA 3SC6A 1IUKA 4P96A 4ONEA 3CZMA 1X3UA 3QVXA 4CM8B 4UVDA 1HW1A 2M30A 3TO6A 1AWCA 1BMDA 1ENOA 1NQOA 2OOSA 3R60A 2LF7A 4XQCA 2EGGA 3D5QA 3T5XA 2I6TA 3W4JA 4FB5A 5KVVA 1BVUA 3BJ6A 3H3ZA 1LEBA 5DCMB 2V9VA 1ADCA 4Q48A 4BNXA 2HCTA 4R1UA 3FM5A 2V1DA 2ZMEB 1PZHA 1TXGA 4HZFA 3SLKA 4ALMA 4NBWA 5DUIA 4BO3A 1BVRA 3E5RA 4E5PA 7ADHA 5E20A 5L3CA 1QYCA 1R5HA 1GXQA 3NTOA 4I09A 4JP2A 4QFCA 2NSDA 4QTZA 5FO5A 1LQTA 3DKWA 3R1IA 2H6EA 4CR8A 4R79A 3RFVA 1E1LA 1HETA 4LLGF 2I67A 3AM3A 1N9GB 3E3VA 3P9CA 3G79A 3GVPA 3HN7A 4HLXA 3SFZA 2G7HA 1P1HA 4HAMA 1BI0A 3BMNA 5B1YA 4BMVA 2EIHA 2C7VA 4PG8A 4M1QA 3U4HA 2Z1NA 4ND2A 3C1OA 3VVBA 5ADHA 3C7JA 4E13A 2Q3EA 4WF2A 4R9RA 1I10A 1N5DA 2DC1A 4RVDA 2E49A 2VWPA 4GMGA 4GGGA 4OIRF 2HYFA 2JCXA 1Q7GA 1DJQA 5JO9A 3FF4A 5L95A 3F6OA 3VPSA 3PHIA 4A2CA 4WXCA 3I9OA 2ZBKA 5CEJA 3H9GA 1IXSB 3LQFA 2WD7A 5T67A 3N4MA 1ZLJA 4M9SA 1ON2A 4WLOA 5DN9A 2J5QA 3L9XA 2FU4A 4R41A 5EINA 5L3EA 4J7CA 2NLOA 2AQKA 1Y6JA 1HSJA 3V2GA 2VCYA 1TI7A 3I6IA 4ESOA 4UHTA 1H6BA 3IRQA 3C24A 4AL4A 2MBFA 4R68A 3ERED 3SJUA 3HDHA 5KIAA 4CM6A 3JQGB 3V1YA 4RCVA 1FX7A 3H3FA 2IXAA 1B8PA 3FPCA 1E7MA 3NUGA 1V8BA 1RIOH 4KTTE 1SCUA 3QU3A 4I5EA 2K7LA 2E4AA 4EJ6A 1NNUA 2B4TO 2VT3A 1U2DA 5B4TA 1JVSA 1HDRA 3C1TA 3FPLA 1S29A 4OL9A 2CDBA 1UR5A 2FR1A 2DBVO 2DQ4A 1QR6A 1YYVA 3V2HA 3HSEA 4IDEA 3AUSA 2CFCA 3J7AO 2NQTA 2A9FA 3RKXA 4NU6A 3BWGA 3SBOA 3BP8A 1BXKA 3DZGA 1HDYA 1X7DA 3H8VA 3UHAA 3WTYC 1DIGA 4Z6KA 3RUFA 3ZW8A 1LVAA 5HWSA 1VSVA 1RJWA 4YB8A 1Y0UA 4XB1A 4Z2YA 1S7AA 1PS9A 3E9MA 2VC1A 3SXYA 1KVRA 4A0YA 4AVPA 2AG5A 3O26A 3OECA 2GGSA 3BXXA 3AU9A 4N54A 4BKPA 3V8JA 4U7BA 2FNAA 4PLPA 3TN7A 4BKUA 1HDZA 2O3TA 3SC4A 5JAZA 4LK1F 5KKCA 2CFXA 1GUYA 2VHZA 1FZPB 2DFDA 4Y13A 5L7TA 5BQFA 1KU9A 1FDTA 4I01A 2O6GE 2X0IA 4CO8A 3NKLA 3A4VA 3I4PA 3JSPA 1M75A 1FBSA 3C8MA 1H9TA 4JIGA 1DC4A 4GLLA 4RF5A 2Q2VA 3F8BA 4PZJA 2Q1TA 3R0AA 1F06A 4QX6A 1P4WA 2NRAC 1DEHA 1JWBB 4NJMB 1S6LA 5KJ1A 2NACA 1E5QA 4RB3C 1X13A 3AM5A 4G6QA 1EBFA 3FN4A 3QP5A 3INRA 3PHHA 4JROA 4L4RA 3RSHA 2AA3A 1QYXA 1OYYA 3FBTA 1XGSA 2EB7A 2OL4A 3GLXA 4XSZF 5IF3A 4AWXB 3PJFA 1HLPA 1I2ZA 5L3FA 1E3EA 4I5DA 3UUWA 1R1UA 5KVQA 5LHHA 2VE9A 4UV9A 2F5FA 3NEUA 4YT8A 3TOXA 4QFDA 3WNVA 2P5VA 5DCMA 3FWZA 3FHZA 5CDUA 4PVCA 3TOBA 3F21A 4XEHA 3RUIA 4BVAA 3S2EA 1KBZA 1YBMA 1U1IA 1HBXG 4EUEA 1BW9B 4OM8A 3V8BA 1PJTA 3C85A 1XHLA 4CQMD 3REOA 3LSYA 4CV1A 3ULQB 1CQIA 3AUAA 3K73O 1NQAO 3HRSA 5BT9A 2OQRA 2EW2A 3CEAA 5TIIA 1L0OC 2PD6A 3QA9A 1KEVA 3DBVO 5G0UA 5T6BA 1FK8A 2E82A 4PZEA 3W1VA 5BSGA 3B20A 1STZA 1P4AA 2GXGA 4BNYA 3ZZNA 4ESJA 1LU9A 1QXSA 3IOYA 1A71A 4ND5A 4PG7A 4ZRNA 2JPCA 5A02A 2C0CA 1KA8A 1O7FA 1XDWA 3HWRA 5HDGA 4WJZA 4BB6A 2FSVA 5FI3A 1Y1PA 1R5GA 3K0LA 3V2UA 4RVSA 1BXGA 3ZWBA 3I4CA 5B37A 5IFLA 1P45A 3OSUA 3IL2A 2P5KA 2B36A 4B4VA 4B4OA 4LB5A 2X5KO 4NB5A 4XKJA 1JAXA 2SCUA 2PA3A 1U5TC 2MD5A 2UV8A 5DCWA 4BNUA 2WD7B 1E3WA 4H15A 4IRIA 5JLAA 4AJKA 3WTWC 1FDVA 1KS9A 1ISMA 4ROSA 5K6AC 2BGLA 4L4XA 4KQWA 3VOSA 1A7KA 4JXKA 3WTXC 2Q1UA 3H2ZA 5CG2A 9LDTA 1D8KA 2LSOA 4Z9XA 1S8NA 3HIFA 1VE9A 3B73A 4J0EA 4YRDA 4CLHA 4DYVA 2AW5A 1NVTA 2PZMA 2FQ3A 5DT9A 4BHBA 4PLTA 3W6ZA 4CGZA 4QT0A 2X5JO 5DF1A 4YRAA 1KVQA 1M67A 3I3OA 4L0YB 3RI3A 1Z1DA 3RI4A 4CLEA 2EFOA 2YHIB 5AXDA 2AEMA 4J7XA 1YL7A 3IMFA 1H6CA 3VZRA 5K1YA 5K6AA 4R3WA 2OUIA 4R4JA 3W4KA 2VRCD 1AE1A 1A5ZA 2XAHA 3MWMA 2WTEA 2LDXA 3DHEA 4E0BA 1E1NA 4YT5A 1C0KA 1F1ZA 3K1PA 2DKNA 1XYGA 2FMUA 3DEUA 4MVJH 4YVFA 4QUKA 3T4XA 3D7LA 3D64A 2C5AA 3GAZA 3H4VA 4O6VA 4ZQBA 1TW2A 2W85A 5TRDA 1ZRCA 3VAZA 4KYWA 2VOOA 3GVHA 1M6WA 4RV9A 4PZDA 4ZHSA 4GYGA 4KDPA 3AY6A 3ZHYA 1XSDA 3ZCXA 1UHMA 4UVBA 1GUZA 2G0TA 3B1KA 3FNEA 2P4QA 3OA2A 5HS8A 2CZCA 5JO0A 4ZYHA 1O8CA 3Q9NA 5JR3A 2R00A 3JTHA 1VL0A 2ILTA 3OJLA 2M8EA 3I9KA 3MJSA 1LDEA 2NU8A 3TSCA 3KP4A 3ZWOA 2OORA 3EK2A 2FOKA 1AXGA 4M54A 4CJXA 5BPDA 1NYTA 5L51A 1JWAB 1OAAA 1WP4A 1ZG1A 3HQ4O 4XBFA 3RJ5A 1YTYA 1MC4A 4I5FA 5DP1A 2IZZA 1Z91A 4BNIA 2VBXA 2PNFA 2D4AA 5A9SB 3QVTA 5ED4A 4IF4A 1PS0A 2D0IA 2W2KB 4HFNA 4IQ8A 1J5YA 1LJ8A 2IODA 1ZO8A 2O4UX 3FWEA 2P4WA 5BSHA 4R16A 1IN4A 1BOAA 3MEXA 3DAFA 1DLIA 1UP6A 1X1EA 4WCDA 4XA8A 2Z99A 3NGXA 1D3AA 1N7GA 4WUVA 3SX2A 2MH2A 4CMIB 4I9NA 1O5IA 2R7FA 1BG6A 4KNYA 2QZ8A 4RGRA 3KP7A 1DPRA 2ISYA 1BHSA 3DZKA 3V7RA 5EEGA 4BH9A 2D2IA 1CDOA 4O63O 2I65A 4NBTA 4RJTA 2O8XA 1U78A 1PR9A 3GVAA 2BD0A 2VQ3A 3FHLA 1LNQA 4R51A 4BNTA 3I9NA 4EZBA 4DIBA 1ZIDA 5IXSA 1NVMB 3WGIA 1UUFA 2ZTLA 3PI7A 3QP9A 3P2OA 3O2PE 5J8FA 3BMQA 4LCEA 5DULA 3WWYA 3WDSA 3FMQA 1UDCA 1YLFA 1MJAA 2WYVA 3WQRA 5F5NA 1K6OA 2O48X 2FNPA 1HKQA 4S04A 3VVCA 3KZZA 3TO9A 1PS8A 3H9EO 4JJIA 4RDIA 5B12A 2YSRA 1A9YA 5FFFA 4LLLA 4Q5SF 4J4BA 4YJHB 5TT0A 5BSFA 5HRUA 1YS6A 2VUUA 2ZJ1A 4PLZA 4EEXA 1ZRDA 1MXHA 1EH7A 1PQPA 5L53A 3DOJA 1EDOA 1F8GA 2Q8KA 1FP2A 2HWVA 2I5PO 4A12A 1O3TA 2C5EA 2NNLD 2NVBA 3Q2KA 4CLDA 5A06A 1YBAA 1U5TA 4RPKA 3Q11A 4DTIA 3WJ7A 3AFNA 4I9UA 2VBWA 2PI0A 3AM4A 3NX4A 5K0ZA 1QLHA 2VN2A 4HBLA 2KIMA 1ULSA 3ONEA 4I1IA 2EV5A 4O3MA 1WDMA 2JD0A 5DCYA 2H6CA 1SD7A 1M76A 1BJAA 3UF0A 4FFOA 1FMCA 2VT2A 1PJ2A 3MCZA 3RPQA 5EMHA 5ER9A 3ST7A 3HRMA 4OYRA 4ALKA 4C7KA 3LVFO 4M73A 4AICA 4GWGA 3HOTA 1DAOA 1J4AA 1VI2A 3ROUA 4UUVA 1PDNC 1B7GO 1HDXA 1F8FA 1O94A 2PKQP 1BDMA 5JYEA 2ZTVA 3JD0A 4XWYA 4TV7A 1ENPA 2QW8A 2XXJA 5A4DA 5L3BA 2GF2A 1J75A 4UVHA 2D1YA 2AE1A 2DI3A 1YKFA 1GL3A 4TRNA 3ITKA 4BIIA 1MD0A 3RUDA 3WGQA 2ZB8A 3BHMA 5K9ZA 4CV2A 4DYDA 5C37A 3GFLA 2PH5A 4I5GA 3PXXA 1IN8A 1B2LA 1YXMA 4UVCA 2OGUA 1LQ1A 4R1TA 2Z9OA 4CDGA 1IUYA 1XB4A 2DBBA 4F6CA 2OZ6A 1IE3A 1T25A 1G3SA 4Y98A 4A10A 1DIRA 3I5MA 3WU1B 1ZUD1 2FBHA 2QRKA 3NAQA 4KN4X 1PR3A 3OQBA 3RC7A 4B3IA 2PGJA 3E6BA 3HHGA 3TGNA 3LU1A 4MJLA 1EQ2A 3R6SA 5DOZA 4Z0TA 3H5NA 3PZBA 3VPHA 5D4SA 1T2AA 4ND3A 4D44A 3JSOA 3K96A 2QIOA 3Q9SA 1ZK1A 4QLCU 3W4IA 3KE2A 5JMWA 1U2WA 3WG9A 3MJ4A 5MGBA 4N9IA 2FSSA 1HYEA 1IXRC 5D6EA 1WMBA 2CVQA 3PWSA 4NIMA 2Z5LA 4KP7A 1XEAA 3ZHBA 5T5QA 3K5PA 3GUDA 1H6AA 3G1UA 2YDXA 5JAIA 3SHFA 1R22A 1UXJA 2X8LA 4IQ0A 3E82A 4C4OA 4CMAA 4B8XA 4YFKF 1DC3A 2Y1DA 1B59A 4PFJA 5AXBA 1SEVA 1DRWA 3UOGA 1GZ6A 3TL2A 2EKLA 4EVIA 3DXFA 1X1TA 4A27A 5IN4A 2M1BA 5LEKA 2QQAA 1LRKA 2QBYB 1K78A 4OIMA 5KNLA 1PJCA 1YDEA 1G1AA 3D3EA 3JQDA 1BI1A 4ENKA 2IA2A 1SB9A 4K2EA 4D0SA 1YS4A 1NXQA 1F9NA 2Q45A 4GXOA 1T4BA 3VPXA 1SMYF 5ICCA 1AUPA 4CMEC 4D7AA 4MNUA 4HY3A 1LTHR 3H5RA 3LC7O 4RAYA 1FYMA 1ORRA 5E1WA 1B15A 4LVCA 3MJTA 4R1SA 1WDLA 2CVZA 2GPTA 5DUKA 3CDHA 2EWMA 4PGHA 2HAEA 1XSXA 2OBNA 3Q3CA 1W7PA 3RAJA 1SFUA 3DMTC 3U4DA 1ENYA 2JCVA 5LEJA 3MOIA 5CFZA 3SVTA 5HS6A 4U0YA 1KVUA 3GYHX 2PEXA 3V1TC 5TLSA 2KJBA 1PGOA 3DTTA 4GX0A 2E37A 5G0WA 3AY7A 3JQFA 1HYHA 5T8KA 4ON0A 2W90A 1JLLA 4H16A 1BXZA 3E5MA 4BB5A 3DO5A 5DDGA 1A4IA 4J4HA 2FF4A 1L3LA 3ABTA 3EDPA 2CGPA 4XRFA 2HMVA 2VWQA 3RC1A 3RUEA 5HLHA 3M7GA 3I59A 3C7CB 4CM5A 4JGBA 1GYQA 1R00A 5G4KA 4KMFA 4CMGA 2EERA 2WE7A 3VODA 5ILVA 1XU7A 1ISJA 1LX6A 3BHJA 5ILOA 3I64A 3O4RA 2Y0EA 4PG4A 4MTEA 5DP2A 1ZEJA 1MDMA 2CQKA 5CVVA 1D5VA 3FI9A 2BF7A 1DO8A 2XPCA 3VH2A 2ETHA 2ACJA 1ADFA 3GZ5A 1L7DA 3L6DA 5JAQA 4JQFA 4M9ZA 1HRDA 1Q7BA 2H1SA 3HDQA 5CLSA 3P7MA 4Q3BA 3UN1A 2NWQA 1UAGA 3I54A 2DPHA 3BTVA 4IXWA 5A9TA 1P31A 4RB1A 1E77A 1B8UA 4R1HA 3AI3A 5MDHA 5F6FA 3PDUA 1U3TA 3OA0A 1O7LA 1A27A 1OC4A 2ZJ0A 1XDSA 3LF1A 1ZMTA 2RHRA 2YX7A 2JZYA 4AD9A 1X0VA 5B4VA 2DBRA 2B35A 5HBRA 1YRLA 4BHPA 2RIRA 5IN5A 3TZKA 2YV1A 1SBYA 3DBRB 1LQUA 1ONOA 3I4FA 4R3NA 1E92A 4Y6PA 2JKVA 3AAFA 3VEPA 4BAYA 1E17A 1OOEA 3QHAA 1G0NA 4I9HA 4IJKA 4KQXA 3BMOB 2PMUA 5G4KB 2HK8A 2V1UA 1K6JA 1I3LA 1HSZA 1PGJA 2BLLA 2EJWA 3JQFC 4R5HA 2C7GA 1ZK3A 4CQMB 2Z1MA 1P1JA 2V6FA 2DQRA 4JBHA 1T24A 3RBXA 1YDWA 5C5IA 4W7IA 5GZ3A 2J5KA 2F2EA 3I9JA 2GSDA 2VYVA 4DBZA 2RAFA 3INTA 1R66A 4WCFC 3VPGA 1PL8A 2Y0MA 2P9CA 3IP3A 3WR5A 1A4UA 2AEJA 1P9LA 1HZJA 4UXNA 1XD7A 3ZMTA 1G3YA 2NNNA 1ULUA 1E6EA 1YQDA 3DR3A 3RKUA 4N0BA 4BNHA 5A5EA 2BI7A 4BO5A 4Z9FA 1FDUA 1ZG3A 4XDYA 3G3EA 2NNYA 1DPUA 3EUWA 1L7EA 1DAPA 3QOPA 4LN1A 1XMAA 5EEHA 3JQ9A 1WWKA 2XAJA 3DBRA 4P4NA 2D59A 4UV8A 1Q1HA 2ELHA 4KUMA 1LLDA 1N1EA 3Q9UA 1ISFA 3WBBA 4RORA 5TJJA 1C1XA 1Z73A 5HTOA 3RKRA 5JNLA 5CPFA 4HW0A 1FY7A 2A61A 2EFNA 3JTGA 1CEQA 3TOZA 4BO6A 4DC1A 2ADUA 1S7CA 5JE8A 3DBLB 1ZKMA 3AUTA 3CH6A 1GFSA 1P77A 1BM9A 2DTDA 2HKXA 2G17A 2IYOA 2XOXA 3LYLA 5A2QK 3TFQA 3FXQA 2B37A 2ESNA 1K6IA 4A73A 1H9AA 1R4NB 3EZYA 1ONPA 4UAGA 2B83A 3HDYA 4KIFA 3GT0A 4BO2A 2I76A 1DBVO 4ZVVA 1YWGO 1H0MA 1JE8A 1SNYA 1H93A 2HKIA 2NU6A 3MZYA 3KEOA 3PWKA 1IW7F 1KYWA 2XVCA 1T1RA 2Y66A 4L0ZB 4FGWA 3A28A 4N5NA 1E7WA 3ZMUA 4B7CA 3PK0A 4BNFA 3KCCA 3KSZO 3GUCA 3ZN1A 4WOJA 2Q4EA 5IDXA 2QZ9A 4LVUA 2UYYA 5CDSA 3V8LA 5F1PA 3KP3A 4ZH4F 4FJ1A 4HKTA 3RKYA 1RKXA 4YDRA 1T6SA 1LEAA 3LDHA 1E1MA 3PHJA 3RU7A 3ZHZA 5LGTA 1BW9A 3DP7A 4FFLA 5IXYA 3ZMVA 3ISPA 4YT4A 1GPDG 3OM9A 2XUBA 3M9AA 4Q3EA 3VDRA 1I5RA 2DFVA 2PD4A 3B1FA 2D5AA 2WYUA 1PL7A 6PAXA 1NBOA 3FNHA 2BFMA 2VXZA 3LT1A 2PMHA 1E7SA 4XZ3A 1D1TA 5L3ZA 1REPC 3TOAA 1VJ0A 3V1UA 4TVBA 5DD4A 3D5LA 1SOVA 3UH1A 2YFHA 4CYDA 2YQ4A 3QVSA 3NT2A 3EVNA 3EZLA 4IRGA 1PGPA 4OIPF 4YEDA 1QG6A 2Q46A 3GX4X 2O3UA 3OQ1A 4LGVA 1B0AA 2E7WA 2DLLA 3CKYA 4FOSA 4XGKA 2GN4A 3T1BA 4IZHA 4ALLA 2OZUA 2HKOA 1OMIA 2KKOA 4BQAA 3VDQA 3QY9A 2O50A 4I08A 4PLWA 3Q6IA 1WPQA 1P1RA 2VHWA 4TSKA 3BJOA 4LGWA 4DQUA 1N92A 2UUOA 4EJWA 4CM3A 5LDHA 1QYWA 4KTVE 5JY1A 1FC3A 1HE5A 2K02A 1W5SA 1M6HA 3KVOA 1P4XA 1E3WB 3H6KA 2A94A 5I9MA 3CZRA 4TVOA 1RM5A 3WLFA 1QYDA 3ADOA 4UNOA 4GL4A 4BNZA 3GZNA 4YCAA 3FMSA 3ECHA 2O3QA 4CUJA 4ZJUA 1P1FA 2A35A 2C20A 3X2FA 3K8ZA 1U3VA 2YX4A 2HJRA 4YFXF 1UZLA 4EI2A 1OKRA 5IDYA 3KV3O 2FA5A 4M74A 5DV5A 4LRTB 4HOBA 4G7ZF 4D3FA 1RM0A 1V6AA 4J91A 4TMFA 3R0JA 3TDUC 4OOFA 1E1KA 4H3VA 5LDGA 4B7XA 5G0VA 4YQZA 1QZZA 3M1EA 3RQSA 2RGVA 3VPFA 5CEEA 2HOEA 4KUEA 1Z45A 3NDRA 4KFCA 4BKQA 1PJSA 2D1HA 2EJRA 3OBBA 2GA2A 1N2SA 4Y6SA 3ULKA 4NI5A 4YPOA 3IJPA 2WC2A 4HNHA 2X86A 2DW4A 3R4KA 4XDZA 1TT7A 2XRNA 2EP5A 2OZPA 3EYIA 2JD2A 4J49A 1BI2A 1MJBA 1DRUA 1Y8RB 2B0JA 2CD9A 3T8TA 2WD8A 3LA2A 3JYOA 4D0RA 1DC6A 1I1SA 2IT0A 1ZVMA 2B4QA 1MUUA 2VHVA 3GA0A 1OZAA 2GO1A 3H5AA 5F3RA 2HQ1A 4AJPA 3C1DA 1E0DA 2HMWA 4KIGA 4G7HF 1IRFA 3BDDA 1WI9A 3WGGA 2FP4A 3GZNB 3GRPA 5C7IO 4YYZA 1I27A 1J7KA 1I2BA 1VL8A 4P9UA 1U3WA 2GRAA 1SFEA 4U6SA 1Z82A 4UEJA 1LC0A 4F46A 4S05A 2ZXJA 1J5PA 3ZMZA 4TRRA 2BFPA 1PX0A 1XELA 3F3SA 4WWCA 2PBIA 2HK9A 3GH3A 1XGMA 2M5WA 2X9VA 2V6BA 4YBZA 3LFKA 4IPTA 4D79A 4GVXA 3TQNA 3BIOA 3BMCB 1QBJA 2B0LA 1QRRA 2DK8A 5KJEA 3V7SA 5H6RA 3WFJA 4BKOA 4BO8A 4KUHA 4CUKA 3JQGA 5FWNA 3RUCA 4B8ZA 4OHUA 3F6YA 4OKIA 2RV8A 4HF2A 5TQVA 3JD3A 1WRJA 3GHYA 4R5MA 1IAWA 4RF3A 2NTNA 3CE6A 3QJ5A 3ICPA 1UZMA 1SC6A 3HNPA 2LDBA 3WGOA 3FD8A 1YO6A 2GLXA 3HSRA 4L4SA 2Z5UA 2VBYA 1WSUA 1NQ5A 3E6DA 4ZRMA 3GDGA 5BOXA 4FJ2A 2L02A 3OF2A 2OAZA 2UZKA 3HFGA 3L9WA 3RROA 4Q39A 3DPTA 3AOEC 4IJUA 1KQ0A 2A92A 4Q9NA 1XSVA 5TSDA 2PLYA 3EDMA 3HB4X 3J81Z 1PWXA 1EVIA 1GHCA 5TJHA 3STHA 3MOGA 2W24A 5JVTA 1CYDA 1R16A 2GN9A 3E03A 3JV7A 5LRRA 4MIYA 2C82A 1P3DA 1YJ8A 4WLVA 2C54A 2Y0CA 1S6YA 4Q3AA 3RBZA 5HS7A 3WODF 1VC2A 3D0OA 3QPHA 3K92A 3V5NA 4YAJA 5TC4A 4R01A 4YAEA 1B3RA 1JKJA 3I53A 1SAXA 1O3SA 1DPGA 1E6UA 1P0CA 2HQRA 4LSMA 4FDAA 2C59A 3WYBA 5LHGA 1ZCJA 3LLSA 3TJRA 3MCVA 2QYOA 5CDYA 1TTYA 4M71A 3KETA 3NJ4A 4BO1A 3WGYA 4URFA 1E3JA 2DM6A 3F8FA 1HXDA 4Y17A 2RQPA 2WSBA 1EH8A 1Z6RA 3RYRA 4OQZA 1KOLA 1DFGA 3S2IA 2RKHA 2VONA 2YR2A 3AK4A 2X1HA 3BZ6A 4RVFA 1ZARA 1A72A 4L0QA 1FWZA 1P33A 5D4RA 1LUAA 1HQCA 2ESHA 4NFSA 4BGVA 5KVSA 1OPCA 1KC1A 5IT9K 3LAPA 2VYVD 3DOCA 1RPNA 1B4AA 2EFWA 1T0FA 3TZ6A 5BS6A 4IY1A 1H2HA 3ZGYA 6ADHA 4RLHA 5JBIA 2VTDA 4CXFA 3AI2A 3OP4A 4FC6A 1AHIA 1AOYA 3DTYA 4KWHA 1DLJA 5DBGA 2QZZA 3FR8A 1ZREA 3L4BC 3O6BB 4MVJI 2ZNZA 4MQVA 4OSOA 3U4CA 4JK1X 4O5VA 4L74A 1I36A 4IS2A 1ZH5A 1SPXA 3KBOA 2P68A 3H3UA 2BH9A 2D45A 2PZJA 3KP6A 1YQGA 4EV0A 3QAHA 2Y0DA 1K3TA 2DVMA 3E6MA 3PQDA 3ZHXA 3LA7A 1KEUA 5FEUA 4OU0A 1GCOA 3GGGA 1LDJA 3O8QB 4O0LA 1L1FA 3BTUA 3H9QA 4L5JA 4DPMA 3LT4A 1V4RA 5E1XA 4GVLA 4N5MA 2V7PA 4FS3A 4XRGA 5KKAA 3P5SA 1EE9A 1X7GA 4IGEA 1MXFA 4LMRA 1SFXA 1W8DA 1NP3A 1TA4A 2NS0A 2DO7A 3L00A 1XU9A 2WEKA 1TW3A 1B14A 3B6ZA 4NK5A 4E6PA 5CAEA 5JC1A 1O57A 1U7HA 4P5OA 1HDOA 2VOJA 4NBUA 5L7YA 1EMDA 2B4RO 1PP8F 2VNSA 4RVGA 2HTJA 1TLHB 5HA5A 2YY7A 5HDKA 3DL2A 3WICA 4M6YA 4NU5A 2EWNA 1HW5A 1T2FA 2J6IA 2CMDA 1BI3A 4IS3A 1BTOA 4J1NA 3WMWA 1CRWG 1U9JA 2EGHA 3QE3A 2DAPA 4DQ2A 2LKPA 3PEFA 1K5HA 4MVJE 3D3WB 3GMSA 2EEZA 4BNLA 2YUTA 1B26A 3QW2A 2BBYA 1UXGA 4M8SA 1QQIA 3W6KB 4ALJA 1IB6A 1W4MA 3M1LA 4JP3A 4KUGA 1ZJZA 5CDTA 2GCGA 2GA1A 2EW8A 1JHHA 3C3XA 4U0JA 3RWBA 4CL8A 5JDCA 3W8EA 1B9NA 5TJ9A 3GEZA 3I5UA 1YS7A 3BROA 4GMFA 1O3RA 5IT9Z 3CIFA 2MLGA 1K78B 4OMUA 4YWJA 5U4QA 1HT0A 1YOVA 1I33A 5H6QA 4HDUA 4OJNA 1ADGA 4CZZA 1RI7A 2GQQA 3PYMA 1W7PD 2DTRA 5COBA 4FCCA 3CTAA 3WGZA 2BYVE 3QWHA 4R9SA 3SXPA 1UHWA 5FD6A 1VLLA 3ABIA 3H7AA 3R3SA 4E5YA 3IRRA 3KYCB 2EP7A 5DBFA 1NAIA 3T7EA 1ZGJA 1DB3A 4K28A 1IN6A 3F9IA 2JAHA 2OD5A 3N7UA 1AGNA 2MLKA 1LI4A 4QQRA 4ZD6A 2V1XA 5GZ6A 3S8MA 1FJHA 4D42A 2VBZA 2GYYA 2NU7A 3WFIA 2O4CA 2Q50A 1Q2XA 1SAYA 4OAQA 5L4LA 3HSKA 1PZFA 3KB6A 4EGYA 1I3NA 2W2KA 3IWFA 3SQNA 3R6DA 2EA4A 1P1IA 2C07A 5IAAA 3O3KA 1HXHA 1KQ9A 4DREA 1NFQA 1CF2O 4Q3DA 3F23A 3AWDA 4D45A 5KK1A 4TKLA 1T39A 2X0JA 3GRKA 4BO0A 4CM4B 2A3SA 3WMXA 5A2QZ 2NTJA 2J5PA 3K2EA 4I8XA 3PHGA 2A5YB 3UCXA 1U8FO 2C6YA 3FNGA 2HGCA 2W2LD 5ENDA 4IIUA 5TS3A 1ZK0A 3ENKA 2Y1OA 5ITWA 3A1NA 4YJHA 1YIOA 3ZH2A 3C7AA 3GAFA 4H0EA 4R69A 3F1KA 4PLYA 4ZYEA 1DIBA 1H9GA 4OH1A 3GO5A 4E33A 4A2UA 4IJAA 1QKIA 1H0KA 3OV8A 1YB1A 1U5TB 3DXJF 4TWRA 4DPKA 4UUOA 2L4AA 3AI1A 4CMJA 1O89A 4JNKA 2FY8A 2G82A 5E17F 4BNCA 4P9FA 3QRWA 3QWFA 4HX5A 4D3DA 5BSEA 3JQ9C 4BNJA 1PQWA 5E8IA 1ZRFA 2K4JA 2HJSA 2PV7A 3DC2A 4PGFA 4TRMA 1ZJYA 2Y75A 5I9NA 1KEWA 3S2WA 4IDDA 1T38A 3E97A 4Q3NA 3ROMA 4DLBA 4RGBA 1N1GA 2VHXA 3WWZA 1MP0A 2DU9A 3RPUA 3KLMX 2JSCA 3D0SA 1HDGO 2WYWA 1EUDA 2X0RA 1UDAA 5HLIA 5L3GA 4UVAA 4JX8A 3LQRA 1QORA 2QHXA 1RZ4A 2PD3A 1JHFA 1O9BA 4PCQA 1CERA 2WTBA 4L9RA 4IIVA 3MTJA 3FTNA 1NFRA 4NG5A 5AOVA 1K7AA 4CQLA 2FE3A 3I1JA 1Z75A 3DQPA
chains in the Genus database with same CATH superfamily
1MJNA 3DEWA 1SXJA 5COAA 1M2EA 4EG0A 3C3BA 1FYKA 2FFHA 4HEA1 4LXQA 4DV1B 3JSXA 3NBMA 4IIFA 3ZWAA 1ODDA 2V96A 1RQ2A 4FSDA 4QA9A 2ZSUA 2P0WA 3CESA 2C1EA 3ENWA 2X9GA 1DX4A 1P92A 3BT9A 3KT3A 4IO0A 3C6YA 2RK3A 3WIVA 4JX9A 4WNAB 2IDZA 4O8ZA 4YRBA 4IJ5A 2XBLA 1GLVA 3A7EA 3BREA 2POQX 1R7JA 3OYCA 5E6SB 3ZCQA 1UC9A 3QHPA 1WH7A 3GCMA 4WZBB 1VB3A 4EHAA 2HA5A 4F9EA 5KI6A 4X93A 1QVUA 3UKGA 4IH4A 4Y6GB 3WJAA 5BPFA 2AW3A 3QVVA 2X0NA 4HS4A 5IK2A 3RC8A 1O96B 1BU8A 1Z4MA 2ENUA 3T06B 1OT5A 1XRMA 1YOVB 3QE2A 2IT1A 2I2CA 4HX9A 2P35A 4RU1A 1GUDA 3I83A 4LZZA 4AUMA 5KTTA 3RYCB 2ZRFA 3BPXA 1ZQ9A 2WPNA 2VPPA 2R87A 4TZTA 4TLMB 4BL5A 4IDQA 1Y56A 5LQMA 4IO9F 2NM0A 1B1BA 1X80A 3IDQA 3G0GA 1OV6A 5EMMA 5KC8A 2C7OA 2GVDC 2EJVA 3LPAA 5C7LO 5GAEJ 4XX0B 3ASOH 1PZXA 3H1AA 3HR4A 3DB1A 4CMKA 5CH5A 1MMGA 4EGZA 4FDVA 4HEHA 4MQ9F 2EFYA 1KF0A 4E30A 5J2TA 1K66A 4M8IA 1MPTA 3OIGA 3OX2A 4C7XA 4ZDKA 3OEYA 4RVOA 2QBYA 2YJZA 4DIQA 2FEXA 4AMVA 4DMLA 4E2WA 2QVOA 3J80Z 1NUPA 1K7FB 1U6KA 1ZMOA 1G4DA 2KRCA 2ZRPA 4PN3A 2REQA 3T54A 5B1AH 6REQB 5JNWA 2G07A 1BC5A 4BGDA 3WIEA 1X15A 1PLJA 1T33A 2JAPA 2C96A 2NOAA 2JJYA 3IPRA 4XR4A 1AHHA 2VQDA 4PS0A 5JCPA 2J0QA 3ETEA 4HRXA 3SFIA 4TTQA 4EABA 3GJSA 3U4DA 3PJRA 1EK6A 1P75A 1PR0A 1JIXA 4BTEA 2PRIA 1Y7IA 2AMVA 2GRJA 3RAEC 4EKDA 2VAXA 3EOAI 1LSUA 3U3DA 2A07F 1Z74A 4EJ0A 1DAFA 3GK3A 1GDHA 2PFBA 3ZWYA 1GGKA 1K9SA 4PV7A 2Y2UA 4RADA 4FXPA 4MV4A 2OSVA 2CHQA 2FPRA 3SKVA 4XWOA 3CUQC 2ZU6A 1MC1A 2XODA 4EG8A 3AYXB 1G38A 2YRWA 3A36A 3AEKA 2WIJA 4RY8A 8LDHA 5JSFA 2CCJA 2SKDA 4RTJA 4FI3C 2W6IA 1PL0A 1FMWA 1UKCA 2CNLA 4I81A 1YJAA 2BT4A 1EGMB 2IA0A 1NXVA 1PE0A 1H8AC 2D2XA 3FTFA 3UVEA 4LRQA 5LZ4A 1FXSA 3CX4A 4JP8A 1MG0A 4HGPA 1GAJA 1V8PA 4QUDA 5HDNA 5EY5B 3NBFA 1KQOA 4U8HA 4AURA 3TPCA 5IW8A 1R6VA 4OHYA 2VRBA 1A6IA 2QRHA 2RKWA 4BLRA 2IPMA 3OLQA 4UDXX 1BSVA 1ESZA 1ODLA 2H1KA 3G0BA 3OQ6A 4QVKA 3WRXA 2A1TR 4CLXA 5C4MA 3LW8A 5DCFA 2J41A 2VLBA 4GAEA 3ZWPA 1AQIA 1F2TA 5FTNA 4DVJA 3ZGOA 2FMYA 3H2JA 5KTPA 1Q1QA 4DR1B 1H5UA 1VBNA 4ZC3A 3P94A 1RNLA 3TZCA 2P6SA 1T4DA 4LBZA 3MJCA 2I2WA 2QTHA 4A3CJ 2W6JA 1VIDA 4XJTA 3FGNA 1VPTA 1ZN9A 2STWA 1QHXA 3G1OA 2IY9A 3R77A 4GKAA 1TPYA 1Y5NA 4BXFA 4GYWA 2A4MA 5BN4B 1AU7A 3U7QB 3UJ3X 1EVKA 4PJ0C 2Y93A 1JKXA 3VWBA 1J8VA 2O2EA 5AHOA 1UXOA 1DHTA 2ZWAA 5F52A 5J2TF 3TRKA 1DBQA 3T7DA 1O6ZA 3ACBA 3TQFA 3R8FA 4JU9A 4P22A 2BM8A 3E22A 2P1RA 1X1CA 2LBFB 4IMIB 2ZKZA 5H2FC 1L1QA 1T8PA 4FFBB 3K69A 4WLFA 4C3OB 4C6SA 4D43A 3W7VA 4EF5A 5A4JA 3FUUA 3PXAA 5L3DA 1Z29A 3GLIB 5FNZA 1OTHA 3CF0A 3H2SA 1SZCA 1K61A 1IL0A 3ROKA 3UBTA 1JT2A 1MX1A 1GYPA 2QNRA 5JQGA 3D31A 1NX9A 3T5GA 1GGMA 2HOAA 2XGCA 1VG0B 1X7ZA 5I4CA 3LPMA 4FSHA 2OXEA 1VE7A 2LKSA 4QREA 2FDXA 4Q03A 5F7JA 5ERIA 4ZU3A 3P2IA 3OCUA 2JIBA 3RAFC 2PX0A 3GFRA 2FN8A 3UMCA 2VTBA 4HUQB 1F7UA 2JLUA 5TEVA 3A8TA 1TUIA 4UUSB 4H7PA 4JBNA 4N5LA 1C4WA 1K6MA 2VA9A 3F8SA 3DMTA 1KBOA 1JTVA 3I9MA 3PKJA 4GGPA 3DVRX 4L07A 3ZY3A 3LXMA 4PZ0A 3WKBA 4EQZA 4XLPF 1GRQA 2BSXA 2QD1A 4YNBA 2FPUA 2ZJFA 1UBSB 2GASA 2FMLA 3KDAA 3FYHA 4WKGA 2H94A 5F5XA 5EUMA 4GP9A 2OB2A 2HYGD 2VB6A 2CVPA 1S2DA 2NUPB 3V7YA 4JX4A 3FOCA 4LZLA 4YJGA 3ZNQA 4NYJQ 2GERA 5BW4A 2XB0X 5FORA 2R47A 1XFDA 2GARA 1CIVA 1Z5OA 3MJDA 1FLDA 3BYZA 2Q8QA 2RMKA 4MVXA 2GQ0A 3R7WA 5GQSA 3AG2H 3EZXA 3KR1A 1MBJA 2X23A 2QV7A 1GR0A 1MA3A 4G07A 5KVRA 2M9HA 1IC8A 2PPLA 2OP0A 1JA0A 1V7CA 5FI5A 3DF7A 1EM8B 2HF9A 2ZU0C 3G9XA 4MWCA 1HEUA 1CETA 1NQVA 4MPRA 2F43B 3HBAA 4K7JA 1R23A 5FO1A 3AB7A 3KO8A 5EUCA 4UUMA 5ES3A 4FGUA 2NO7A 4LOLA 2QLFA 3TNLA 4YIFA 2E2WA 2H3HA 5SY6A 4I0AA 1GU1A 3R5FA 1VXOA 1L8OA 3BDAA 2C2GA 4J0FA 4MUKA 1XKQA 3W6JB 1XTRA 1CFZA 1GOTA 2UUZA 3OYGA 1VP3A 3FCUB 3I04M 3P1JA 3QFCA 4KQEA 3X2SA 5LPNA 3DBOB 1BJKA 2V5AA 3TECE 2XKJE 4OB8A 4ZAVA 1QQTA 2CBXA 2JPBA 3EXHA 4RVHA 5YASA 3A02A 1UMCB 2R1VB 2Z6UA 1LBTA 3F4BA 4N01A 2PMFA 1ND6A 1A2BA 3QFTA 3RNLA 1MMSA 1RRVA 5EMNA 1UL1X 2UXDB 3B2QA 2GKSA 3MT0A 1NG6A 3T8YA 4XYLA 1AZWA 2EFPA 4KFSA 4DRXA 2NVUA 2JNWA 4Y2JA 5C3MA 5KSWB 1ZFNA 2QM7A 3OJ0A 3GUZA 1D4FA 4V0QA 4F3RA 4YMSA 3BT7A 4MB0A 2EF1A 2Q28A 3D7SA 4YMUA 1GSIA 1P61B 1SR8A 5KAIC 4D0PA 1SCAA 1WHTB 2W37A 2XYGA 3DDZX 3L7YA 4C3UA 1DX9A 5BR7A 1HNZB 4MYTA 2WQ6A 2XCIA 4ZKDA 3F7TA 5BRJA 5FAXA 4LV8B 4KR9A 3WIUA 2EZ8A 4LMYA 2QUAA 5JVDB 5KNBH 1M66A 3QYAA 5DYMA 2OP1A 2QT1A 1K7EB 4NYIQ 3WLSA 4C78A 4BXXJ 4JB3A 3ELYA 3PFIA 3DMYA 2ASEA 3FUVA 4A4DA 3JQ7A 3MVPA 1GPLA 1QONA 3GGPA 2IU4A 2IF0A 2G04A 2DG2A 4XVHA 1AKRA 5ISMA 2P6RA 1M7BA 4DV2B 1IOLA 2XYRA 2M3AA 2C8LA 1YJ5A 4G0ZA 1OCTC 1XRPA 3HA5A 4W9NC 3RC3A 5ITZA 2CFRA 4Q4ZF 1ZZGA 2PWAA 1R6BX 1YAHA 1U2GA 4KDFA 2IS6A 4TRJA 2FEZA 2ZSIB 1P9QC 4W1UA 1JHAA 3NTQA 3PGA1 3ZBUA 2GB4A 1O95A 2WY2D 5HUJA 3EXEB 1II8B 1WPKA 4Y6LA 2V5UA 4EJMA 4BV9A 2WJWA 4PNHA 1G8GA 1L8QA 2AWNA 4IIBA 5FBHA 5I9BA 3T6KA 3UFXA 3Q9LA 2OXFA 2B5VA 3PRJA 3VNAA 1N2GA 2IQ5A 4MEXF 2H8RA 2YWHA 5EJ2A 2G76A 1S1CA 3K6JA 1V5IA 2CSUA 1XGKA 2HZBA 4G9YA 2XE7A 4PRLA 3D3WA 3GXOA 2ME6A 3IODA 4O2AF 1RXVA 1L4LA 2I8AA 2BISA 1R0CA 3EF1A 4Z3OA 4DV0B 1RBQA 2Q29A 3I6QA 4ZN6A 3A9RA 2J5RA 3OJOA 1C30A 1YQXA 3I01A 3KLPX 4HVLA 1FBQA 3WNDA 4EEFG 3D5TA 5ALZA 3PSFA 1X77A 5B53A 3T4EA 4NYIR 5C8VA 1WE2A 2OR3A 3ABUA 3GW2A 3D5EA 3HLKA 4CLRB 4UE2A 1ITZA 2GHIA 3M5WA 1GG9A 1SKMA 2DJNA 3IIKA 2HOTA 2IL1A 1PHRA 4R40A 4AF7A 1WPXA 3PQFA 3O8OA 5HQTA 3T3HA 2P2SA 1E1YA 4JR2A 2BBWA 4CIAA 2ZVDA 4EYKA 5FBZA 1KKLA 1J22A 1E9EA 3YASA 5E3OA 4TTJA 3LA3A 2OECA 2QD5A 3TRIA 4LIPD 2QUKA 3WWEA 4BQRA 5KQGA 3F8CA 5LCXA 3WNQA 4ZYZA 3FHOA 2EV9A 4C1NA 1DIHA 4JI3B 5DYTA 1M7HA 3P0FA 4DM3A 4KPUA 4I50F 5AVKA 4JLWA 4ADSG 1DUXC 3GUYA 2JGLA 2HRBA 2J3JA 1RQNA 3UMFA 1NJ6A 4YG2F 1KFCB 2VQCA 4X5OA 1A2KC 4KSYA 2PN6A 1UANA 4D80A 1FMLA 1T9DA 5LB2A 3FTEA 1GZ7A 5CCDA 3BA1A 4OAPA 3A6ZA 3PGMA 3SHTA 4AKIA 1M6EX 3OEWA 3HS3A 3IH5A 1KERA 3GTJJ 1PTJA 3RYIA 4D9GA 1YZ3A 1W4AA 2PG4A 3TW4A 2R5ZB 1UJBA 2VAPA 4CDRA 2I7DA 4W8OA 5T6MA 2J46A 5B3JC 1NNEA 1J49A 4CODB 3PGXA 2XWPA 2YMLA 4UE3S 4KO4S 1NC3A 4MGZR 5JDCC 2MW8A 3KOWA 1UJ4A 4PY2A 5B55A 1T5LA 5LLQA 3RARA 4ZC1A 4I2OA 1JEOA 2V74B 3IMKA 3KXDA 3LC1O 5DNCA 2HHLA 2QXUA 1F0PA 1D4AA 1E61A 1N8TA 1NN0A 2ZRCA 4MI6A 1QC5B 3O8DA 3UJHA 4C0SA 2UUPA 1YVEI 1LNWA 4KBGA 5AJVB 3UGTA 1RYZA 1XWWA 3BJEA 1IZ0A 2W2MA 2HQ5A 3BE4A 1Z2DA 4YJDA 4AJ2A 2BGGA 2IXGA 3UANA 1DC8A 4Y18A 4AN4A 4NJOA 3ZZ0A 2XA9A 1U5CA 2ID4A 1QOZA 1GG5A 1LKXA 4R2JA 3TCXB 3F3MA 3LGSA 3CJRA 4OMFG 4D9EA 4EFNA 4FR2A 5KAFC 1PSDA 3M9XA 2D1QA 4JU8A 5CHEA 2H17A 1UFMA 3KYBA 2YZGA 3PYLA 4GKVA 4PO3X 4XGIA 1CNFA 2SBTA 3AUYA 3ET4A 3M70A 1ZRMA 3JAKA 4UCQA 5EJMA 4LJRA 2DBQA 4MX8A 5ILUA 4HRVA 3ZQUA 1MEJA 5C8YF 2ZPAA 1DXQA 4QLOA 5ALPA 1FLIA 3PCXA 4HH1A 4RYLA 5ILQA 3CCVI 2QUIA 1WUJS 4A5MA 1Z47A 2I4RA 3IHWA 4IV0A 3MZHA 3P2JA 5LP6A 2HIHA 2Y3IA 3V4ZA 1KK3A 3HL0A 4BLTA 5ALYA 3ZXXA 5G3YA 1UPTA 5F0FA 3FKIJ 3RADC 3BEDA 4PLCA 3BH7A 4NXMB 3CGWA 3IO5A 5H81A 4AT1A 2ZYHA 1KTVA 2QRPA 1KI6B 3WADA 4AUEA 1A4RA 2K5UA 2XV4S 1OY1A 1UJMA 1UMDB 2PBZA 4KIWA 4N12A 3ZHQA 3UHJA 2GR9A 3GF2A 2ERYA 3W2HA 4I4NA 2JZCA 4UVIA 1FVOA 1BOFA 1F12A 2JAUA 2M4KA 5KU1A 3IXQA 5DS9A 3I01M 1E1CA 3BY6A 3D4BA 3OX3A 2LZ0A 1DAHA 2I6GA 2RJ3A 5J2UA 2NOJB 3WGHA 1I4LD 3TR5A 4OH7A 5FPSA 5IUJC 5A1JA 1WR8A 2IYSA 2V7QD 1DBWA 2IYAA 1RT9A 5KYYA 4GYYA 4TM7A 3MD0A 1XPXA 1DFHA 1QGED 5TT1A 4R31A 2E89A 1W4RA 3ZCRA 1A82A 1GY8A 2PSJA 3JTMA 5CVDA 5P8WA 5D5WB 1DKOA 1NMYA 2WM8A 5I8ZA 3WTVC 3L77A 4EM2A 5E9AA 1M74A 4UM5A 2XMQA 2Y8EA 2WT9A 3DUFA 1L4YA 3HGQA 3DVLA 4DV6B 1PZNA 1NBEA 3EQ9A 5T41A 3RK0A 5C32A 1DBSA 2J7PA 1OF1A 1Q3HA 4OUKX 1E2HA 1YL5A 1UBTS 1XRNA 1ZC4A 1CQJA 2Q3DA 2XRYA 3HHPA 2P65A 4QYIA 1XF9A 5D01A 4BQIA 2ZSAA 5B6IA 3DEJA 4L8YA 1A8IA 4P4GA 2EILH 1MB4A 2XRFA 3FVTA 4TSRA 3CZAA 4XASA 1A8HA 2HGSA 1I30A 5D6OA 2KJCA 1O6GA 2K4MA 3HCEA 2KI5A 4M1YA 5JCJD 4K8RB 2Y2ZA 3PM1A 1BGXT 1HV8A 3K9CA 5LA6B 3GP3A 1KU7A 2P75A 2PV0A 3S16J 3N9IA 1Z83A 4FU0A 4DFDA 1YMQA 3BAZA 3CJQA 3DTIA 5AI9A 2FLVA 1H2BA 1LDMA 1NQTA 2H2WA 2CV1A 3C8UA 3FZGA 4I4TA 2I7CA 4PAWA 4PYRA 1B93A 4XIFA 4C1BA 3J81A 2E1NA 3AOEA 4CV0A 3EQ8A 5FIUA 1NIJA 2PKXA 1E6CA 2PBRA 4OQYA 2DLDA 3T7CA 5E1OA 1ARZA 4AZ3A 2G72A 1XNJA 4BOYA 1B16A 4YTEA 3DDNA 4BGIA 2ZCWA 2XYPA 3GYGA 4Y7CA 3GZJA 3MZ0A 4XGRA 1W2WB 4G63A 4QUEA 4E07A 2O2DA 2P0EA 2CNDA 3A6JA 4HAZA 3WK8A 2V79A 3AHCA 4AD8A 4LJKA 3O9ZA 1KZ9A 1L7OA 3GPLA 2HWWA 3Q85A 4IJWA 4X60A 1P1KA 3KM0A 1VL1A 3HDDA 3M8FA 1QH1B 2VYQA 5HKAA 3EF0A 2QG4A 4IG4A 3R40A 1GFWA 3KT8A 3TR0A 2PX8A 4DZTA 3OIVA 1HUQA 5F21A 1HURA 1MDFA 4KAAA 3TL6A 4NBLA 4OL0A 2Z2XA 1L3IA 1QX4A 4OK3A 4RE6A 4E32A 2P81A 2M87A 4I3HA 1WY5A 3JVVA 3KK0A 2BLNA 3KKMA 3OD5A 3NWBA 4I1SA 4I99A 4CKXA 1NMEA 1R15A 4A0GA 4H1TA 1EYZA 5JI3E 5THQA 2Z95A 3B02A 2ZJQF 2VDOB 5E6UB 3E9QA 3AGQA 3D6JA 4AN0A 2ZQYA 2XROA 2FF7A 1PJ3A 4CM9D 3DFFA 1LJ9A 1G2IA 3JQRA 1KH3A 3QSGA 2K9MA 3BRCA 5E1MA 4ZAYA 1G19A 5B3AA 2IA5A 3FDIA 2OQVA 2HPHA 4C87A 2DTEA 2HGZA 3COAC 1YRNA 1AM4D 2GK3A 3NWOA 4MA4A 4WKCA 1BWPA 2QM3A 2FCRA 3FMIA 1D0ZA 1RZUA 2GVNA 4XVQA 2KRFA 1ZD9A 4E5KA 5FRMA 4CEIA 4WNIA 4F96A 3B38A 4M8KA 5J1SB 1IG0A 4G9BA 1P4GA 8ATCA 1YB4A 5AVUA 3BWYA 4XRSA 2L17A 1KSHA 3DFZA 1FW6A 1H0SA 1KO1A 3AM1A 5IT5A 2BMEA 4C05A 3HOYJ 4B1FA 3DXYA 3IR6A 5FI0B 5GAGJ 1GAEO 5FB2A 4HLDA 4Y1EA 5D3MA 3V8MA 5CP8A 4B8WA 5A4FS 3FX3A 2CY0A 3D3QA 4DLZA 4DR7B 2YNMD 2PZFA 5C1BA 1QPMA 1TZKA 3BR3A 3TZHA 2X4GA 2XGSA 3JQBC 3B7GA 3NDJA 3OPXA 1H5NA 2JI9A 4CIDA 4UNRA 2VF4X 4WGGA 2OAP1 1VDMA 2QP4A 5AKIA 1LNZA 1FYXA 3MWGA 3QTTA 3NC0C 3KOOA 1RCTE 1V1MB 4TL9A 3LHDA 3LT2A 5ILGA 5C4IA 5F1RA 5LJIA 1FFXB 1S9DA 2I1QA 3KHUA 3OFND 1E89A 2FI1A 3CF6R 2Q2EB 1CXZA 2HK7A 3PNVA 2KLHA 1IWOA 4M88A 4DDMA 4C0HA 3OQNA 1GQRA 3F7NA 5L3SB 1Y34E 1C3OA 2O8CA 1P1CA 1UJ8A 1DOZA 1T35A 1XA4A 3A0RB 1K79A 1POGA 1P62B 2BUCA 3H1EA 1FMJA 4FCTA 4MR9B 4P84A 4ZZ1A 3V7FA 5JNUA 1YH3A 4FEYA 4CZ2A 2QQEA 3B3GA 4P83A 2D1VA 1P6UA 1K9VF 2IHZA 3AEQB 4HD8A 1R74A 2ZTHA 4U7PB 4CMHA 1M34A 2QPAA 1QH8B 2JKYA 1ID1A 1KYZA 3AHIA 3DZ8A 1QGPA 3OLXA 5IT3A 3PC8A 1E9CA 4JZYA 1RWBA 1XFAA 1JJ7A 2R48A 1QLWA 3IELA 3O38A 4NARA 3MTEA 2JQ7A 4REQA 3RSFA 3I61A 3R0ZA 2Y1CA 3IV7A 2IEGA 2KWIA 4L76A 2O19A 4L8VA 3A6KA 3RIMA 1PWZA 2FPSA 2J6HA 3IH4A 1Z7EA 3X1WA 1S9HA 4UNSA 4F2PA 5IVHA 2TMGA 1YG2A 4G65A 4HC4A 4GDMA 4CDMA 2Q0QA 3HKEA 3PNMA 3JVDA 3PO2J 3ABMH 4HA8A 3F2VA 3F9RA 4IIYA 3DWIA 4MWOA 1IAVA 2JFVA 2XD9A 2I78A 1A9ZA 4XB2A 1PDOA 4X7BA 4CT4B 2JLZA 2E55A 4TWJA 3SN6A 3CO7C 1KK2A 4U7HA 3JWJA 3E3MA 4GECA 4DIDA 4BFTA 2MYUA 4ZYLA 2CXNA 1BEUB 4JBAA 1HC8A