2VT2A

Structure and functional properties of the bacillus subtilis transcriptional repressor rex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
199
structure length
184
Chain Sequence
ATAKRLPLYYRFLKNLHASGKQRVSSAELSDAVKVDSATIRRDFSYFGALGYNVDYLLSFFRKTLDQDDVILIGVGNLGTAFLHYTKISMAFDINESKIGTEVGGVPVYNLDDLEQHVKDESVAILTVPAVAAQSITDRLVALGIKGILNFTPARLNVPEHIRIHHIDLAVELQSLVYFLKHYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and functional properties of the Bacillus subtilis transcriptional repressor Rex.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
molecule keywords REDOX-SENSING TRANSCRIPTIONAL REPRESSOR REX
total genus 56
structure length 184
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02629 CoA_binding CoA binding domain
A PF06971 Put_DNA-bind_N Putative DNA-binding protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2vt2A01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2vt2A02
3WR5A 4OM8A 5JDIA 1QORA 3CZRA 3NJ8A 2EFQA 4RCVA 4UUPA 3ZDFA 2YQ5A 3OEWA 2F1KA 2GUGA 4LK1F 4KDEA 4XQCA 3W6JB 1I36A 2BRUA 8LDHA 1NNUA 4O5VA 2IXBA 5H6QA 3EHEA 4J2HA 3WLFA 1DOHA 4AJHA 2R7DA 2V65A 1QLHA 2VNSA 5KVQA 4DQ2A 4J7CA 3EY4A 2X5JO 2XHKA 3U0BA 1GHCA 5D5VB 3KYDB 1T38A 1E5QA 4KYWA 3EUHA 4F3YA 3WGTA 3UKOA 4BH9A 4XQEA 4YTEA 1B3RA 4D3FA 5JS6A 3ITDA 3DQVC 3GXOA 3DQPA 1QV6A 2M87A 1YTYA 3ZHYA 3BROA 1T2DA 1KBZA 4RGBA 3NV9A 3WS7A 3EK2A 1GDHA 3QA9A 1IYZA 4PG7A 2C0CA 2HMTA 2OORA 4B79A 3HSEA 3GO5A 4OMZA 2ZB3A 3KEQA 2F5DA 3F8CA 1USTA 1GEGA 1X1EA 3RCBA 4JP3A 3WBBA 5I7EA 1I32A 1BJAA 1Y81A 3WGGA 1NP3A 1U1IA 3D3WA 3LF1A 5D8KB 1HDYA 2D2IA 3F4LA 3K9TA 4CM9A 3GFJA 1HSZA 4BO4A 3JQAA 2X5OA 2QWWA 2A35A 1NQOA 2DBRA 2WJPA 2OBYA 3NYWA 4J7XA 1BG6A 1ZBQA 3CMCO 4GLOA 3QV1A 3J80K 4WUVA 4R1HA 1N1EA 1QMGA 1PZFA 1R22A 1Z7EA 3WGOA 3DOJA 4Q47A 1BI1A 3GWZA 1FBUA 2VYND 5D5WB 4XA8A 2ZXJA 3S2FA 4M9XA 4IQGA 2PLYA 1YO5C 3ADOA 4MVJG 1IN7A 3TNLA 4HYEA 4FFOA 4IQ0A 4M87A 1C0IA 1EK6A 2E7XA 1ZZEA 2EGGA 2GDZA 3JYPA 4DMMA 1MGTA 3MWMA 3HDJA 4LJZF 1Y7TA 2DLDA 2QRJA 4XYGA 5A06A 5ILOA 1JVBA 1VL0A 4GGGA 1R4NB 5GZ6A 4QEDA 2AQ8A 2J8ZA 5KVCA 2L01A 1XA0A 1YBMA 3DFUA 1FNNA 5KIAA 2D8AA 5BPDA 3RC2A 3FBGA 1VTNC 4WCFB 2GASA 3N74A 1KQ8A 3ZGYA 1A04A 1MZBA 2DFDA 1R0LA 1B7GO 2J5QA 3O8QA 3VKVA 3AY3A 7ADHA 1X13A 4ALNA 2I6TA 1KETA 4NHJA 5CDTA 1LEAA 5JCXA 4BQRA 4LGWA 2GQQA 4EV0A 2EV5A 2PK3A 2XPCA 1P77A 2ZJ2A 2ZCUA 3JYQA 4DBZA 4K2EA 1LUAA 1FBSA 3GFGA 4YB8A 4OH1A 2PKQO 4WCFC 4WLUA 1J5YA 1TW3A 2ZCVA 3E03A 2O7SA 1W5SA 5L51A 5H81A 5CAEA 2DW4A 4LMYA 1HXHA 1I30A 4YJHB 4YAEA 4BVAA 2XGXA 4BKQA 4BL5A 2FF4A 5J6XA 2EFOA 4PG5A 2FMLA 1WWKA 5L3ZA 3GY0A 2FOIA 5D4SA 2FRHA 1KYZA 4WPGA 4G7HF 4GAEA 4Z0TA 1G6KA 4UV9A 2ZQZA 3BMNA 3G3EA 3IIEA 3F3SA 3JQ7B 4DBVO 5A02A 2RIRA 3ZWAA 4MIOA 2PLAA 4BNVA 1GZ4A 4HAMA 4U0WA 1UDAA 2AHRA 1H2BA 4N5NA 1B14A 1W7PD 5EEGA 2EHDA 2C5EA 4PRKA 1EZ4A 1U3WA 2NVBA 3MOIA 1BRMA 5JFRA 1EE2A 4D0SA 4D7AA 2RH8A 1GCOA 3OECA 3F6VA 5FD5A 5JPIA 4E5KA 5L3EA 4IMPA 3H5NA 2EERA 4G9YA 4JJFA 5I9NA 3RUFA 2FPGA 1YE3A 4Z2YA 4IZHA 4ENKA 3W8DA 2J5PA 2P4HX 3E5XA 3T4XA 4UEJA 1XSXA 4IXTA 3WFIA 3QP5A 5LDGA 2YJZA 4CQLA 3OHSX 4HV6A 1QYWA 5TJ9A 4ASNA 4I5FA 3JAMK 4IGFA 4ZA2A 1HKQA 3PJEA 4Y8VA 2K27A 5TSDA 3D0SA 2WE7A 2JD1A 3LQQA 1V9LA 4UEKA 4HF1A 2XRNA 3I0TA 2PGLA 2B5VA 3RD5A 1LJ9A 4LK0F 4NBUA 3V8JA 5J8FA 4YFXF 3GG9A 4LD5A 2C6YA 4QECA 4KNYA 1QRRA 1T2FA 2B4QA 3V2GA 4D44A 1VL8A 5HBRA 1R4MB 5HTOA 3K6JA 3DP7A 5HDGA 3PVZA 4K6CA 3RKRA 5BSFA 1IF1A 2Q45A 3EZYA 4KDFA 1KEVA 5DF1A 4YR9A 2NAZA 4B3IA 3DZIA 1FX7A 5HA5A 4CMIA 1RYEA 2DTXA 1D8JA 4R3WA 1ISFA 4YRDA 4INAA 5JYDA 1ODDA 3KP7A 1LJ8A 2GLXA 4LW8A 3UHAA 5TX7A 3TQHA 1CGPA 2X8LA 1R5GA 3HDHA 4J1NA 1HE5A 3BJOA 3H9EO 1Y6JA 4MEXF 4RQTA 4ZN6A 1JWAB 1LDEA 5E18F 1HXDA 3BTUA 1PGJA 1VRWA 3BHJA 1ZXLA 3JQ6A 3LC1O 4BO1A 1B9MA 1O8CA 3JYNA 4YG2F 2IZZA 4BNCA 2W90A 3DHYA 1VJ1A 2QQ5A 3CPSA 3OBBA 4GCVA 3BXXA 1Z7UA 3ZN1A 1Z45A 4Q3NA 4BNNA 4EM2A 3GGGA 3GZ5A 3H65A 1W7PA 2UV8A 3L00A 3HJAA 2FMUA 4QWQA 1X0XA 4YWJA 4EEXA 2EGHA 1NPTO 4RJTA 2ZIZA 5DT9A 1WLYA 3TPCA 2O23A 4JNKA 3CJNA 4CGZA 3OQ1A 1C1DA 2HAEA 1IRGA 3OETA 1P0CA 1I01A 4AJ2A 2WD7A 3ADPA 4B4UA 2V6MA 2IA0A 3DAPA 2B0JA 4FX0A 1EUZA 5H83A 5TT1A 2HO5A 3RBZA 5GY7A 3KLOA 1FYMA 3DZHA 2EIHA 3J81Z 1G1AA 1AXEA 3HADA 4FJ0A 4RVSA 2GZ1A 3PYMA 4TRNA 3TZHA 4FD3A 4KUMA 3FM3A 1NBOA 2DBVO 1GCUA 2IT0A 1TA4A 5TGDA 1F9NA 2XASA 3OIGA 5DCUA 4AJOA 3LF2A 2VUTA 1E1LA 5ER6A 4HADA 3MJTA 3L2CA 3ECHA 3BYZA 2XKOA 1RM5A 3JV7A 4J3FA 3K2EA 3RI3A 4KMFA 4GX1A 5BQFA 5DZSA 2X0RA 1YB4A 3VKUA 4U0VA 3W6UA 5LDHA 3ST7A 2A6EF 3LU1A 5E1XA 3ZWMA 1GV1A 3PFFA 2ZJ1A 1O7LA 2DTEA 3K69A 3H8VA 2ESNA 4AJPA 2DBBA 3FHZA 3W6ZA 3JSPA 3WXBA 2BGMA 2FSSA 3BMQB 5ER9A 3VVCA 3A06A 3QWBA 2I99A 1ZK2A 2GAUA 3PIDA 4U7DA 3RKUA 1LEBA 3QSGA 4E2ZA 4ITUA 5G4KA 3GK3A 5HS6A 1QP8A 3GF2A 1Q0LA 2VOEA 3NT5A 3HSKA 3UVEA 1MLDA 1H94A 2CY0A 1YJ8A 5T64A 3RJ5A 2X6TA 1DAPA 4CM9D 1V3FA 4TZKA 3EZLA 3SXYA 1U5CA 1GD1O 2B4TO 2IXAA 3AOEA 3EQLF 3TKYA 2ZJ0A 3WTVC 1P9LA 5ICFA 3CMMA 3QIVA 2QQ9A 1BI2A 1QGPA 4PGGA 3E48A 1T98A 2YZ7A 2HMUA 1G3YA 2Q2QA 1N7GA 1HDXA 4B7UA 3PWZA 1I24A 4FPXA 1GQ2A 2A69F 1XD7A 1NWHA 5HLIA 1O5IA 3L9WA 2ZCWA 3DAGA 4XJTA 3ROPA 3BDDA 1UXIA 3PQKA 1DIHA 1EFKA 3GG2A 2X7HA 4NBRA 1E7WA 3RBVA 1T6SA 3VEPA 2WM3A 3DOOA 4R5MA 4EI2A 3VB2A 4G94A 1W4MA 2VN8A 3TFOA 2PBIA 4E21A 4EMSA 1P1JA 4M6XA 2QENA 1X7GA 2J5OA 1GFSA 1H6BA 1W4ZA 1YO6A 4TSKA 5FF9A 3ZN2A 4GKVA 1E7SA 4LK3A 2ZMEB 5FI3A 2HKOA 5ICGA 2GGSA 2Z1MA 4XD2A 5A5FA 4IDEA 4WCFA 5ICSA 3F5SA 2X4HA 4WXDA 3WE3A 5DCMB 4MVJA 3B1JA 3RU9A 2VZ8A 4TV7A 3V8LA 5DD8A 2HSDA 4G5HA 5BNIA 2JCVA 5DYMA 3EDMA 4WOKA 1IUKA 2WYVA 3I53A 5EMHA 3GA0A 3DMYA 3Q11A 1ZAOA 3I59A 5HOOA 3KHUA 2WSBA 4GYIA 1E77A 1IUYA 1IZ9A 3D3WB 1P33A 5TF4A 5DCFA 1UP7A 2EXXA 4DYDA 1SOWA 2R2GA 1Q7BA 1SD6A 4YACA 1DJNA 1KOLA 1FF9A 1YB1A 1GZ3A 1NFFA 1PGPA 1U5TC 3M2TA 4NBWA 3ZNQA 5U4QA 5C7LO 2DFVA 3WIEA 2NS0A 2OO5A 1I3LA 4J6FA 4R8HA 2O03A 1P1FA 5F5NA 1LQ1A 3VDQA 4DNCA 3WTZA 1PL6A 3BMCB 4QFCA 4YEDA 1WQ2A 5FFFA 5TS3A 4A26A 4BKOA 4YT2A 3ZZNA 3FF5A 1PL8A 3RASA 4DUPA 4S05A 1Q7CA 3TO7A 2Y68A 4II3A 3GEZA 1C14A 1IPEA 2ZK7A 4CLEA 4BO7A 2B0LA 4ZH4F 2P8TA 2ZB7A 1KQ9A 3AAFA 1ZCJA 5F1KA 4NK4A 5J23A 2AS5F 2HKIA 3K96A 4J4BA 1DP7P 2G9WA 5CVUA 2DAOA 2Z99A 3U4DA 3WTXC 2A3SA 2JFHA 4S3MA 3ZU4A 2OBNA 2CFXA 1YW9A 1AWCA 4OXNA 2Y1OA 3FNHA 1NQTA 1GPDG 1XHLA 4M54A 2NTJA 3RDIA 4IXAA 4DQUA 3E5RA 3PJFA 4AIHA 3RUEA 1WMAA 3WICA 4G7ZF 4LVUA 2RGVA 1DHTA 1A9ZA 1N1GA 1ZJZA 4KN4X 2BF7A 1WRJA 3QE3A 4YFKF 2ZTUA 2NU6A 3ZMTA 4LRTB 4KP7A 5BMZA 4F6LA 2HQRA 1IRFA 4YAJA 2W2LA 2GRAA 3Q2IA 1AOYA 3S2EA 2PG4A 4G7OF 2YFQA 4A12A 2BYVE 3VOEA 1AHHA 2DU8A 2NSDA 3OA0A 4H0EA 2VZ9A 4XCVA 1OBFO 4K9DA 4C4OA 1ADFA 4IJUA 4IDBA 4YAKA 1FBQA 1NR1A 2MH9A 1UXHA 1EVZA 4EUFA 3L4BC 3KB6A 4ESJA 3QU3A 2LDXA 4R9SA 5L40A 5U1PA 4MQVA 3E1KA 4R54A 1GUYA 4XQ9A 1U5TA 2P7VB 3S1LA 2PJPA 3TOAA 1DRUA 2R3SA 3GZ6A 1A7KA 4H3VA 3RIHA 4EJ6A 4CICA 2EKLA 4U7BA 2O2SA 4RPJA 2O4CA 3IAHA 1V8BA 1EBUA 4K1LA 4KUHA 4WJZA 5AXCA 4AVYA 3BPVA 2O3FA 2A61A 4U0YA 2IZ1A 1ZLKA 1N9GB 4RB0A 4ZZLA 1FDSA 2RHCA 3HN2A 4A5OA 2Q2WA 1PJLA 1Q1HA 2DFIA 3CLOA 1SMTA 4AWXB 2FPIA 2VWQA 2Y66A 3IKTA 3I6QA 3I83A 3O8QB 1SOVA 2X23A 3PQDA 1MC5A 4UUOA 1DFHA 4DLLA 2FU4A 2V1UA 2Q99A 3HHPA 4W82A 1ZGAA 1CQIA 3DEUA 3AM5A 1N7HA 1PX0A 4GMFA 3UN1A 2PH5A 3VPGA 4C7KA 1KVUA 4MHGA 2H94A 4A27A 1DC5A 1IE3A 2BV6A 3R0AA 1EQUA 3QP6A 1WDMA 4NG5A 5LC1A 1XN7A 1HSOA 1MGOA 1HW5A 1FK8A 1K2WA 2O4UX 2LDBA 4KMSA 4NJMB 1J6UA 1U2WA 2XAGA 1H0MA 3KEOA 1EVIA 3V2UA 3ANNA 4BHTA 3FR8A 1EH7A 1E7RA 4NIMA 1UFMA 2WV0A 3ZU2A 1E5LA 3K5PA 2DT5A 2RCYA 3DTTA 4KMUX 1KYWA 2DTRA 2EFNA 3OJLA 4NU6A 3TJRA 3WTCA 4HA8A 1VL6A 4M9SA 2P5KA 1R00A 4OAQA 5KJFA 1Q0QA 4M8SA 4PG8A 1M75A 4KQXA 1HWYA 4RZIA 1C1XA 3QW2A 3VOSA 3OQBA 3F9IA 4DA9A 5JHUA 3DR3A 5FI5A 4OJNA 5F21A 2W57A 1GQQA 4IRHA 3O6BB 2EEZA 2O3RA 3E82A 3FTPA 2Y0CA 3L4BA 3MOGA 3GUCA 4U8GA 2V6FA 2ZKZA 4XZ3A 4E31A 2HR3A 4S04A 4CMIB 3MFKA 4NJOA 1FDVA 2AE2A 1BXZA 4BNMA 5IXYA 1STZA 5TIIA 2NVUA 1O3QA 4E5NA 1GXPA 3LT2A 5JFOA 3C7CB 4D3DA 4TRMA 2NU7A 1REPC 1RWBA 5I8ZA 5FLXK 1IN8A 3NRVA 4AIKA 1H5QA 4B7CA 1MKMA 5KVVA 4L9VA 4A0ZA 3P7NA 3C7AA 1PS0A 1O9BA 2X0LA 3GLQA 4GGPA 4I9HA 5A03A 2FR8A 2HJSA 2CSUA 5A3JA 4KOAA 3O3KA 4IPTA 4MVJH 4TQGA 3WFJA 4UVBA 5K5QA 3M1LA 3TZ6A 2D5CA 2E4AA 2I9PA 3A4VA 1G0NA 3ZNOA 3PHJA 4HBGA 2NQ8A 1QNTA 1RZ4A 1C1DB 1YL6A 3JQCA 3R1IA 1I2CA 3K8ZA 1MDMB 1H0KA 1B4AA 2NNLD 2P5UA 3DZBA 5K6AA 3IQDB 4RPHA 2XAAA 5E20A 1DIRA 3ZWXA 2H5LA 3M8FA 2Z5LA 4J1TA 1TQMA 3D5QA 4PLWA 2YV2A 4RPKA 1QQIA 3PP8A 3DXFA 3QVOA 5DOZA 2FP4A 2DUWA 5AYVA 4OXYA 2XKPA 6PAXA 1ONNA 2GN9A 3T4EA 3I52A 3ABIA 3ZPLA 3UF0A 9LDTA 5KJCA 2BKAA 5ED4A 2BEOA 2IA2A 1UP6A 1UJMA 2TMGA 1KERA 2VTDA 1GYPA 4YVFA 1SAYA 4QLCU 4D46A 4DC1A 5ADHA 1E2XA 3BZUA 3QAHA 1O57A 4RVDA 2YHUA 2RKHA 4B4WA 4ZD6A 2EW2A 4FW8A 5CDYA 1ONPA 1W7PB 3KVOA 3F72A 1GEEA 1TNSA 3BJ6A 2D4AA 3ZMVA 1Q2XA 1W6UA 1JHFA 5G0TA 1DRVA 1E6WA 3HTSB 4NH4A 2COMA 4MINA 4GPD1 1B8PA 3ROUA 3GFBA 1XEAA 4AJLA 1JW9B 3RPUA 2P91A 3AJRA 3S2IA 1BXGB 4CMKA 4E5YA 4U0KA 2CQKA 2IP2A 1ZREA 4FJ2A 4H16A 1K6OA 4Y98A 1XCBA 2K86A 1YW7A 1FP2A 2D2WA 2AEFA 1M6HA 2KJCA 4NMHA 4UVGA 1SBYA 4G6QA 2NNNA 1H6DA 2UAGA 5AIQA 2IRFG 1CYDA 3BMOB 5BS6A 1H9TA 3I9LA 3QP9A 4RV9A 2G76A 4J1QA 3TL2A 2VE8A 3COAC 2BBYA 1R16A 5AQ1A 1ZK1A 3SJ7A 1G0OA 1XMKA 5LHGA 3OJ0A 2Y1CA 4RGSA 3B70A 2ETHA 1ENPA 1T2CA 1QZZA 1M2WA 1R4MA 1FWZA 2CNBA 2RN7A 1LSUA 4IJAA 4ZRMA 4BOYA 3U4CA 1YKFA 1HE4A 3AW9A 3LT1A 4MTEA 1C0WA 4B4OA 4RLHA 1ISGA 1OOEA 2FSWA 2IJLA 1IB6A 3JQFA 1HYGA 3QVTA 4F7ZA 3AUSA 5EPOA 2VBXA 1X14A 3OM9A 1E6EA 3GHYA 3IMFA 4MEYF 4NU5A 1MB4A 1JKJA 2LF8A 2W98A 5ILSA 5F64A 1UZNA 3W4IA 2ISYA 3CTAA 2B5WA 3GMDA 4HW0A 5THKA 4OKNA 2I66A 4BO2A 2P7CB 1VC2A 3F6YA 3JYOA 1NM5A 4FCCA 1DSSG 2CUKA 3I5MA 3MZ0A 3LK7A 3DC2A 2NNYA 1F5TA 2P68A 2WEKA 4PGHA 1TT5B 2OZPA 5AXBA 3EDPA 4NK5A 2DPHA 2J5RA 2W4QA 3ZV6A 1M67A 1JXSA 4PIVA 4HV4A 3AWDA 4FB5A 4XLNF 1A27A 2C82A 4OOEA 2V1DA 1TLTA 2BGLA 1VI2A 1DEHA 2C07A 1SMYF 3ECOA 4FR5A 4PCQA 3C1AA 1HZJA 1LB2A 2VHYA 4A03A 2GZWA 3L6OO 1EFLA 2YSRA 1DO8A 1YBAA 1DJQA 4QT0A 1RYDA 5L45A 2D59A 1Y8QB 1HKUA 2DM6A 1A72A 4YXFA 2HMSA 5L53A 4NBTA 1EV7A 4OOIA 1XYGA 4BNLA 2VE9A 4L5JA 2MLGA 2UXNA 1DB3A 1DLJA 1BIAA 1Y5MA 4JCOA 5G0UA 1W5TA 1PJQA 2JTVA 3JQ8A 3FSRA 1DXYA 2H63A 3GW2A 4B8XA 4QSMA 1WP4A 1S7OA 4RB3C 1MX3A 4DLAA 3WTSC 4HZFA 2VBWA 1VE9A 2F5EA 3RIRA 2FE3A 3F8NA 3Q1LA 3ITKA 1MG5A 1Y8QA 2R00C 4K6FA 4JBIA 3IWZA 3R3SA 4M86A 1K78B 2W25A 2R00A 1TTYA 1J9IA 1OAAA 1R58A 1SZJG 2E6UX 5CYVA 5L3FA 2QHXA 3PXXA 4NFSA 2VZ0A 4CLXA 1BW9A 1U2GA 4BO0A 2DO7A 1ZK4A 4B09A 3H6KA 3Q2KA 2VHXA 2BGKA 4NQZA 2X4GA 5JW6A 2YU3A 3FTNA 2VUUA 1MG0A 3W4KA 3CXRA 5IJZA 2LF7A 2DK8A 1U78A 1E17A 3KSZO 3GFIA 3ELKA 4N9IA 2VC0A 2GD1O 4ZQHA 2STWA 2CWEA 3BAZA 1WW8A 3EMKA 4MVJM 4BS9A 4YIIA 6ADHA 4DTIA 3OIFA 2Z3YA 2XXJA 1DIGA 2QW8A 3ZV5A 1GPJA 5KVRA 2ZO4A 3LLSA 3RUDA 1DFGA 2OZUA 2OHXA 1BW9B 2CVOA 3NDIA 4AG3A 3DZFA 3WOHA 4CXFA 2BGCA 1BMDA 5L7TA 2JT1A 3H2SA 3U4IA 4D41A 4ETSA 1LDGA 2QQBA 2PZMA 4OIMA 4EW6A 2O2YA 3DL2A 1K6XA 2OBPA 3W8EA 1DC3A 4II2A 4R01A 3DBHA 4WEQA 5TRDA 1PZHA 4FDAA 3GT0A 4R16A 4CV0A 2WE8A 4A6EA 2PFBA 1YJQA 2JCXA 2O3UA 5COBA 5JY1A 2W8ZA 1I10A 3EETA 1D3YA 1HDGO 2BD0A 3ONFA 3VAZA 1SB8A 5COAA 4N5LA 1NYTA 1Y0UA 1B0AA 3GUDA 2L3DA 3I4PA 1NPYA 2E7WA 5TLSA 1SEPA 4XQGA 1BTOA 1PJCA 2QIOA 1UB9A 3U9GA 2CMDA 2FPPA 3GVPA 4PRLA 3VTZA 2EB7A 3FZVA 3PTZA 3T0YA 3R3JA 1DLIA 2HCTA 4PGFA 5DCYA 3Q3CA 3BMNB 1ZMOA 3BOQA 1LSSA 3KYCA 4XYEA 3OEYA 1J59A 1R7JA 1IW7F 9LDBA 1R0KA 5FFZA 3I9NA 3BIOA 1O6ZA 4E5MA 4A6DA 5CVJA 1K89A 5B37A 1AGNA 4RO0A 4HY3A 4DIBA 1I1GA 4J9VA 1B59A 3F6OA 1QSGA 1XDSA 3SC4A 4E2XA 1K5HA 1ISHA 3U09A 3LLVA 1XU9A 2R7FA 2GPTA 4HNGA 3K73O 3E18A 1I3NA 2W2LD 3Q6IA 1UXKA 3DKWA 5TQVA 2EJVA 3U4HA 4RB1A 2VRCD 2OQGA 5T5QA 5EERA 2GZ3A 3MQ0A 4Q9NA 4YA6A 4DPLA 2YX4A 3SZTA 1P4XA 2AG8A 5T67A 3FN4A 1NQAO 5A2QK 1VLLA 3HOTA 1CJCA 3DMTC 3FWNA 4B4VA 4L4RA 4YDRA 4DVJA 3PGJA 1YQDA 5F5LA 1J0RA 2W84A 1LSJA 4M55A 5EINA 4JXKA 4CM3A 3OIDA 4DC0A 5JAMA 4NZ9A 3HB4X 3E6AA 3SC6A 2JPCA 3RC9A 3ZI0A 3MCZA 3D0OA 3ZCXA 2ESHA 4RS8A 1OC4A 1S6LA 2GA2A 4DQXA 5E1ZB 2C59A 3S2WA 5MDHA 4XYLA 1WMBA 2HZTA 2ZB4A 3C1DA 3GFMA 1E3LA 2VODA 3ZMDA 3OF2A 4GYGA 3QRWA 4R51A 1YIOA 3FMQA 2O6GE 2AEMA 3FPCA 3P9KA 2UVDA 2Y48A 3KO8A 4CMAA 3GDOA 4BHCA 3LSYA 2EJWA 3C24A 3H9JA 4RGXA 5A1TA 1H2HA 1PZGA 1V4RA 1SO8A 1J7KA 3QWFA 1USSA 2YHIA 3HTUA 3I58A 4XIYA 3WYBA 5IG2A 2GZ2A 3AOGA 1YGYA 1GUFA 4J16A 2V6GA 3FCOA 4EBFA 1IN6A 1ZFNA 3EVTA 1HQCA 2GXBA 4CMCA 3WE2A 1SD5A 2JRTA 1ON2A 3HIFA 4FIZA 4JP2A 3SQNA 4PLCA 1R1TA 4FHTA 4BMVA 3ZWWA 2WYUA 4FFRA 5L3DA 4YIFA 1PJTA 3PHHA 2E49A 2YV3A 3L6DA 2X0IA 2W85A 4I7HA 3F22A 2WC2A 3NDJA 4HLYA 3WSVA 1ADGA 4M9ZA 3WU0A 1CQJA 2GR9A 2GA1A 3BPXA 4WF2A 5DD4A 5H6RA 1ZG5A 1RUNA 3G49A 3O9ZA 4PLVA 1FMCA 3HG7A 1I5RA 4CMJA 1CF7A 2JFFA 2Q1WA 2NM0A 2P2SA 5K6AC 3H9QA 5DOVA 2CF5A 4PZDA 4NHEA 5C7OO 3PIIA 2K02A 3HRSA 3NRCA 2D45A 4I01A 1HDCA 1P74A 1PWXA 1KIFA 1TT5A 3PWKA 1FZPB 4ND2A 2HLPA 2NVWA 4BUCA 5DULA 5C37A 3AFMA 4Y13A 4JX8A 4IZIA 1BGVA 3CO7C 1YL7A 4W99A 5T6BA 2Y0MA 5BT9A 5ILVA 3MJSA 3H5AA 3P7MA 1R1UA 4L4XA 5K0ZA 1KU3A 2PFGA 2EA2A 2C7GA 3NTQA 4FFMA 4WGGA 4UVEA 1KEUA 5KCZA 1J0XO 4KUGA 4BNKA 1PP7U 1HETA 1QYDA 3R0IA 5JMPA 3CUQC 3S55A 5LCXA 3R6SA 2EF1A 1IAWA 4PFJA 6LDHA 4IHTA 4RF5A 4I5EA 1E3JA 2CF6A 3M1EA 3LSTA 4I8XA 2OXIA 1SMKA 2XXBA 1CDOA 1KS9A 1ZUD1 2V6BA 4U6SA 5A9RA 2D0IA 2NTNA 3TSCA 2HJRA 5A4DA 2XAQA 2VCYA 1U6GA 3T8RA 4IF4A 2YR2A 4W7IA 3MWDB 5DV5A 2A5YB 1BDBA 1V3UA 1B9NA 4ESBA 2IVMA 4HNHA 3CUQB 1GL3A 2H6BA 4MJLA 2WWYA 1FOKA 3GZNA 1GY8A 4DIFA 2AG5A 4CJXA 2OQRA 4O3MA 4RPLA 1UHWA 1EMDA 2NLOA 3DBRA 2BI7A 1TLHB 4CLRB 4A5NA 1YYVA 1OKRA 2QZZA 4IINA 2O48X 4KT5C 1DHRA 3RU7A 4BGVA 4DRYA 2FSVA 3K9QO 1EBFA 3BHIA 3NT2A 3FF4A 1D1TA 3DFGA 2PH3A 4PG6A 4JN6B 1JKIA 5TRTA 2CYYA 3MAJA 2WD8A 1D3AA 4JBHA 5LEJA 2VUSA 4IJKA 4D45A 3RWBA 1CWUA 2NACA 2C2XA 3BTOA 2Y1GA 1AN9A 1MA0A 4C7JA 1YS7A 2JHFA 2Y1DA 2AEJA 1XU7A 4EJOA 4YJGA 3U9LA 1R0SA 2O50A 2HQ1A 4P9FA 4FGSA 3FXUA 4CLRA 2Q1SA 1DDNA 3I71A 3GGPA 1PJBA 1UP4A 2YPRA 4OOFA 3DZKA 4GL4A 5IZCC 2F5FA 3IP1A 3K2ZA 2PZKA 3HFGA 1TQPA 1U3UA 2C2YA 3LVFO 3MJEA 3QHAA 1S7CA 5AXAA 3ROMA 4BMSA 2VT3A 3KSDO 3NGXA 3GZ4A 5G4KB 4DGSA 3MJVA 1QPMA 3KP4A 1SC6A 1QV7A 4FC6A 1Z7BA 5FEUA 3PPIA 2I76A 3CIFA 3FR7A 3QPHA 1LRKA 1SB9A 5CVRA 4MO2A 3DBHB 1MC4A 4UVAA 1H6AA 3E8XA 4NQWA 4IDGA 4LVCA 5ENVA 1N92A 4CMHA 5JYEA 2Y99A 1ZRCA 4IIVA 4CLDA 2OU2A 2D5AA 1BSVA 3VH4A 4ILKA 3LT0A 2H9IA 4EEZA 2CDBA 3CUOA 1W73A 2CZCA 2QX7A 3H3FA 3DXJF 4FN4A 5KWEA 1LNQA 4GX5A 3ZWOA 4EYEA 1LDYA 1H9AA 4Y17A 4D3SA 3KLNA 2XIGA 3RTRA 2WD7B 2HEOA 3PEFA 1I3KA 4RDIA 3R60A 3U2RA 4BKPA 2PTGA 1D1SA 3I5UA 1P2FA 4AL4A 1ULUA 4JQCA 2YQ4A 5DN9A 1ZYRF 3RYRA 1UUFA 1DFIA 3OOPA 2P4QA 2YY7A 3KYBA 4XGNA 1OZAA 5HM8A 1IN5A 1B15A 4CLOB 3ZW9A 1PQPA 1ID1A 5IDYA 1QG6A 1UR5A 3KFWX 2Y05A 5GZ1A 1Y9EA 2FN7A 3NDRA 1YS4A 2GIVA 3H9GA 3IS3A 1Z82A 4BNZA 5DCWA 3DZJA 1NQ5A 5LGUA 1SFEA 2M8EA 5FO5A 2Q4EA 2EK5A 2ZYAA 4CM4A 3Q5FA 2P9GA 2Z5UA 1ZRFA 1V0JA 3WX0A 1A9YA 1R15A 5F6FA 5CP8A 5IF3A 1LEHA 4PLPA 4EZBA 1KY4A 2W2KA 3P2OA 3LDHA 4OGWA 3G79A 3T8TA 5DP2A 3JQ8B 3PYXA 5BOXA 4CV1A 5DUKA 1B16A 1PEDA 1QR6A 3MWEB 3R0JA 2Y93A 3IC7A 3EGOA 4CM6A 4I5GA 1Z05A 4E70A 3M8EA 1JWBB 1ZVMA 4E2WA 2WDZA 1F0YA 3KP3A 4A7PA 2ZYGA 4J91A 2Q2EA 1M66A 3DB2A 2E37A 4D0RA 1JTVA 3R4KA 2FWMX 4IJWA 4XR4A 4CM4B 3JQEA 4XYMA 4JBGA 2RHRA 3RYPA 4JBAA 3IL2A 1K78A 1I2BA 3GAZA 4GBJA 1WI9A 4KZPA 4P4GA 1PGQA 4WCDA 3VH2A 1K79A 2W2KB 1MXFA 4Z0PA 2FMYA 1ISMA 1BC8C 1H93A 1U8XX 5U9CA 4BO5A 1ENOA 3RFVA 1ISJA 2BFPA 2EWNA 1XGOA 2CVZA 4BGIA 4CMEA 1WDLA 4M74A 5HLHA 4Q48A 2G5CA 2PD4A 3ZN0A 1ULSA 2HYGD 4D43A 1OPCA 1I6XA 1VSUA 4R69A 4KA4A 2VBYA 3OV8A 2P5LC 5K9ZA 3F1KA 3ASVA 4BKUA 1BVRA 4HV5A 5FFXA 2EKQA 2DQ4A 1HRDA 1H9GA 1GU7A 1YDWA 2UUOA 1EE9A 2NTVA 2HQNA 4U6QA 5DP1A 4CL8A 5IN4A 2HWVA 3AUUA 3RROA 4I9UA 5E1WA 4CMGA 4UV8A 4PVDA 3KZYA 1P1KA 2Q1TA 3GQVA 2HRBA 2HMWA 1PWZA 4Q4ZF 3HQ4O 3TZKA 2LDUA 3ZHBA 4N18A 1LI4A 1P1HA 3VFZA 2NADA 1MFZA 3WTBA 4JGBA 3JD2A 3OA2A 4GVXA 5L4LA 4DMLA 1EVYA 5FLXZ 4G65A 2VHVA 3G1UA 1HYEA 4NR0A 2PD6A 5A9TA 4Y9DA 3JQDA 1J2XA 1FP1D 5IT9K 2IW5A 3GFLA 2KJBA 1ON1A 3E6MA 1I3MA 1LSOA 3FHLA 4CUJA 1WNTA 5CDUA 2H6CA 5ES3A 3ICPA 1NWCA 5JR3A 2GN4A 2OP0A 2Q46A 4FQ8A 1JKFA 4IDCA 1TB4A 1ZW1A 4FSHA 1PGOA 2L4AA 1DC6A 1YOVB 4IIUA 2UZKA 3ZMUA 2GYYA 5IN5A 3HRTA 3ABUA 1WPQA 5L3GA 4NNJA 3G3ZA 2P4WA 4BHBA 4HDVA 3D1LA 3L4SO 4A2UA 2DBQA 2FBHA 3ZQ7A 2DQRA 2A07F 4EJWA 1DIBA 4E30A 3TOBA 4NFHA 4WXCA 3NT4A 1Z74A 4MNUA 2C54A 3OJEA 2Q4BA 1JAYA 1F06A 3LA7A 1O89A 2GSDA 4R1UA 3J80Z 2VT2A 4GI2A 1ZIDA 4IDDA 1U8RA 3RKXA 1L3LA 4R41A 1Z6TA 1FDWA 3V7SA 3IUSA 4CMEC 4CO8A 1ZRDA 4CDGA 2KIMA 5EN4A 5BR7A 4WNCA 2QYTA 3OSUA 1KU7A 5BNTA 4IPAA 4LLGF 5K5RA 4TZTA 1KQ0A 4WK6A 1E1MA 4UVDA 4KIBA 3QRFF 1EUCA 1KVSA 5HRUA 4KWHA 3KOUA 3KETA 1YFHA 3T7EA 5CEFA 2Y1EA 2PZJA 4BNXA 4NJMA 3GDGA 4H7PA 3JQAD 2PV7A 4ALJA 1HEUA 2OL4A 4KTTE 5I8WA 4NB5A 1CETA 1U7HA 1E7YA 3LAPA 3NKLA 1J5PA 1T0FA 3ZWVA 1KVRA 1ML3A 1WAMA 3JQFC 1P31A 5G0WA 3HSRA 3I9JA 3DTYA 5JVTA 2CSOA 3AM4A 1U8FO 4I08A 3E9MA 2X58A 2O3SA 3AI2A 4JK1X 3GVIA 5E8GA 2ZNZA 3I3OA 4W4TA 3PQEA 3H4VA 3V1TC 5DBFA 5ICCA 4CM8A 5F1OA 5LBQA 1Y8RA 3DHEA 1FXSA 2AQHA 2A4KA 4TRRA 3QWHA 4P5OA 2ZYDA 1ONOA 3AI1A 2FOKA 5D8LB 4QUKA 2G1UA 5IDXA 1O95A 4CYDA 2DBZA 1E6UA 3KXDA 3V8BA 1JVSA 2J3KA 2PWZA 1Z6RA 2QRLA 1IULA 3D5TA 3V1YA 3B20A 1K7AA 3VZRA 4N0BA 3ZWPA 2IYPA 2PKQP 1LDMA 4L0ZB 3SHFA 3K1PA 3FBTA 3FI9A 4OXKA 5JDIC 4UVCA 1EK5A 3DF8A 3F8MA 3ABTA 2GN8A 3TOXA 3LC2O 1FDUA 4OQZA 3FNEA 3ZHZA 3DBLA 2AQKA 4O0LA 3IUPA 2A68F 4OIOF 4DPKA 3EYYA 3GDFA 4D0PA 4W7HA 1VKNA 3STHA 3C7JA 3BHMA 4BNFA 1OFGA 4KFCA 1I8TA 1P4WA 4CMBA 1RKXA 2VYVA 1NHWA 4XR9A 1X0VA 4JLWA 3IOYA 3JQ7A 1RNLA 3A9WA 1WVGA 3SJUA 4JQFA 4OHUA 1JQBA 2VRBA 4FJ1A 1SAXA 4EGYA 2QRKA 1PU2A 5F1RA 1SEVA 3RQSA 3HUGA 3V4GA 4Q3BA 4EM1A 5B4VA 3GRKA 1PUEE 4GXOA 2POQX 5FWNA 1XKQA 1HSJA 3UCXA 5CEJA 1RIOH 4MVJP 1O0SA 1ZEMA 5JI6A 1T39A 2ACJA 3MJCA 3E9NA 4XDYA 4A73A 5KKAA 2JSCA 1HL3A 3A1NA 3D4OA 4ID9A 4LLLA 3UCFA 2D1VA 4I2OA 1XR3A 3DAFA 3FNFA 4LCJA 4UUMA 1E3SA 4DPMA 1P44A 1FC3A 1I27A 2DUUA 4BO3A 4ZYEA 2M1BA 2PQ8A 4E2YA 5IFLA 3CKYA 2MBFA 1WWXA 4GWKA 1GZ6A 4MVJF 3GNTA 2OFPA 4DWVA 2D3TA 3UH1A 2CGPA 1WZIA 4BO8A 4UXNA 4UAGA 3H92A 4M72A 5HVQC 4OSOA 1WDKA 2I5PO 1Z6ZA 3ZU5A 4AJKA 1JDJA 3WNVA 3W8FA 3O03A 1WZEA 4K26A 4KTVE 3ZWBA 4XGKA 1X3UA 3PHIA 5D5UB 1ARZA 2WMDA 4YJFA 4NI5A 1SCUA 4FS3A 4JK3A 4LN1A 1PS9A 4N7RA 4S1VA 4BNJA 1F8FA 3GPIA 3VH3A 4KWIA 3J81K 4R68A 2MA3A 3E6BA 1IXRC 1HE3A 3WB9A 4BB6A 5EESA 5AVOA 1YQGA 3I64A 4GH5A 3FD8A 3BJAA 3MTJA 3NUGA 1EDOA 1GYQA 3B1FA 3AU9A 1DDOA 4J2OA 4L76A 2VHZA 2M5WA 1RPNA 3C18A 3B1KA 5KVSA 3GX4X 4LG0B 3I9MA 3QJ5A 5IZ4A 1HF3A 1BI3A 3DEYX 2K4JA 3TDUC 3IRRA 3N4MA 3ZV3A 1V6AA 4CM5A 4HBLA 4JROA 2FA5A 1E1NA 3ASUA 2QVOA 1ZG3A 2JD2A 5G0VA 2JAHA 5K1YA 3S8MA 1L7DA 4EUEA 2YYYA 3ANMA 1T4BA 4IS2A 3ULKA 3KP6A 1LDKB 2RH4A 1NX6A 3F8FA 1VM6A 4CQMA 4E0BA 1XGSA 5JO0A 1LA2A 2X22A 3M9AA 5ITVA 3F21A 2VNAA 4IS3A 3GH3A 3RJPA 4LFUA 3REOA 4RORA 1YL5A 2YDXA 3JSAA 1ZH8A 1FSEA 5A04A 2DQLA 2M45A 3LT4A 3MZHA 2JJYA 2OUIA 4EITA 4Q5SF 1U3VA 3B02A 1BC7C 4MIEA 4WASA 2Y75A 1ZLJA 3B6ZA 1QBJA 3GLXA 1F4KA 2CVQA 1AXGA 4XGIA 5L7WA 3I1JA 1G3SA 1LNWA 2UWMA 4E12A 3GNQA 2EP5A 2UDPA 2XUBA 3QVSA 1O3SA 3QQPA 1L7EA 3HE3A 2P5YA 4L8VA 5BNFA 4AJNA 3JQGA 4NBVA 5MGBA 2IZ0A 4BIIA 4ZQEA 2L54A 3KP5A 1P1IA 3NX4A 3TN7A 1TXGA 1YOVA 4L74A 1YWGO 3P9CA 1XMAA 4PZCA 3DWFA 4MDHA 4RVFA 4XX0A 1C0LA 5CLSA 3BMQA 3RKWA 3I54A 2BI8A 3SLGA 4CR7A 1U3TA 1ZSNA 4MVJD 4ZRNA 4BNGA 4ON0A 2JFGA 1D8AA 4LMRA 4RDHA 4XYBA 4Z9XA 4Z3DA 2YHIB 3UCEA 1E0DA 3E6DA 5IZCA 3UFXA 3HN7A 2K7LA 4IDFA 4GKBA 3ROKA 5GZ3A 2CW0F 1YH3A 3AK4A 4O6VA 3RUHA 1OR7A 2JD0A 4J9UE 1XDWA 4FBGA 5L9AA 1PS8A 1B6AA 2ZTVA 3NTOA 3U49A 1UAGA 4TROA 1PQWA 1OYWA 2FNAA 3E97A 2CD9A 3HYIA 1OMOA 4ND1A 5LHHA 3I4FA 1MJBA 4UUVA 3AY6A 1T24A 3EVNA 4R5HA 3HHGA 3IHUA 1EH6A 2QQAA 1K6JA 3C3XA 1KC1A 4R1SA 4Q3AA 3V7CA 2P5VA 3WTWC 1KEWA 3GMSA 3OH8A 2I67A 3GNSA 1F12A 5CPBA 1S3JA 4PZJA 4A0XA 4BYYA 4HQMA 1PIWA 2B69A 3PDUA 4CPDA 3ETDA 1T1RA 1T4DA 1O7FA 3GAFA 4IBOA 3Q9UA 2CDCA 4PLHA 1NVTA 2NVUB 3I9KA 1R1VA 4J90A 3AUAA 3VDRA 1DRWA 1ZK0A 1JA9A 2JHGA 1HT0A 1BOAA 4OIQF 3P2YA 1IZ1A 1G4DA 4XRRA 1K0UA 3F47A 3HDYA 3L9XA 5G0SA 3VHRA 4QTZA 4B8ZA 1Y5RA 3RJ9A 1O3RA 3GVAA 3KP2A 2RNJA 4ENJA 5F1PA 1WKMA 3FMRA 3MCVA 5JDCC 3ZH2A 3UGKA 4AIJA 3HOSA 5DDGA 3FWZA 4N5MA 2B36A 1U9JA 3DBVO 2XROA 1PDNC 3LA2A 2OZ6A 3E5MA 4CQLB 4E32A 1CF2O 1KYQA 4OSPA 1NTOA 2X9NA 2YW9A 2VTEA 3ISPA 5AONA 4LGVA 4W6ZA 2FXAA 2RDPA 3F5QA 5JC1A 4URFA 1WXDA 4RB2C 3I4CA 4B3JA 5B4UA 4J4TA 1T2EA 3HSFA 4RZHA 4CZZA 2NU8A 5A2QZ 2PGJA 2VRCA 2G0TA 4XB2A 3JQGB 5TJHA 1ONVA 3C1TA 1ZXBA 3I9OA 1X7DA 1FY7A 4MPDA 2VONA 3PWSA 4Q3EA 2FY8A 3VPFA 2Q49A 3KUXA 1MP0A 4XB1A 1V3VA 1BI0A 1NFQA 3WGYA 4AJ1A 4ZYHA 3RI4A 3RC7A 1JN0A 3JAMZ 1LDDA 3LAJA 2BH9A 5IXSA 1ZN2A 3ANLA 4GX2A 4Y67A 3TDZC 1HKTA 5D6FA 3QOPA 4J0EA 1N5DA 3LFKA 5I7FA 2B83A 4I1IA 4N54A 2NRAC 5JSFA 1QO0D 1NR7A 3BMOA 3S2GA 1XGKA 5L7YA 1E3EA 1PL7A 1B8VA 3JD1A 3V2HA 5LRRA 4G81A 2ADUA 5DBIA 1EVJA 4O6JA 1UXGA 3PJDA 4MP3A 3RBXA 1KY5A 4HX4A 4UNOA 2D1YA 2UXXA 2GERA 2EV6A 2SCUA 3ZWNA 3GGOA 4B3HA 1GUZA 1TEHA 1V3TA 1VJ0A 2HKXA 1ENZA 3VODA 3ZMSA 4GSKA 3FWEA 2RC4A 4EJTA 1QXSA 3O38A 3NAQA 3W1VA 1C0KA 1E7MA 2BELA 3R6DA 5A3VA 4E5PA 4QX6A 1E3IA 2QBYB 4TVBA 3ZW8A 2QZ8A 4L9TA 1B1BA 1OMIA 1IHYA 3CEAA 4K28A 1A5ZA 3I6IA 3GUYA 2NQTA 4HF2A 2MC3A 1W8DA 3DO5A 5L4NA 1F1ZA 4F45A 4R1NA 2VQ3A 4NDNE 2PN6A 1LRJA 3VTFA 1CRWG 3WTUC 2Q0OA 1UHMA 1LLCA 2X1HA 2ZQYA 3PRJA 4OKIA 2VYVD 3PFIA 3IJRA 1MDMA 2DK5A 4IXWA 3ZV4A 4PVCA 2F2EA 1DBVO 3QU6A 1X1TA 1ZJYA 3RSHA 3GYHX 1JE8A 5K5OA 4J4HA 2NUAA 2Z9OA 4PG4A 3E3VA 3UICA 4M6YA 2ZFWA 1EEHA 1TVEA 3BZ6A 1ZO8A 3GRPA 4BO9A 1TBXA 2A6HF 4P55A 2Q3EA 2Z95A 4EJUA 3K92A 4OL9A 1XWFA 1F14A 2AXQA 2ET6A 3JD3A 2OOSA 1AHIA 4E4YA 5EEHA 3HDQA 4LG0A 4QQRA 1TW2A 4HF0A 3IKVA 3KYCB 2VWHA 4PLYA 2XAJA 4D42A 5ICEA 3PZBA 2JZYA 2ZB8A 2EA4A 2X9GA 4CV2A 1MD0A 1G3WA 3EC7A 3INTA 4FFLA 2BFAA 1GQYA 3AUTA 1VKOA 1ZMTA 2HS5A 3QWIA 3VPHA 2HMVA 3HUDA 3D7LA 3D64A 5IDQA 4WLVA 2KIUA 1ZARA 1DC4A 1PJSA 4YT4A 5CVIA 5T57A 3V8KA 1D5VA 4G2NA 4X54A 1UCRA 4BNHA 4BNTA 3NEPX 3EYIA 1O94A 2G17A 5KKCA 5DCMA 3K31A 4J0FA 3TWOA 4YYZA 1JGSA 1T2KA 3HFSA 5JAQA 1T2AA 4YAGA 2PNFA 1U3EM 1BXGA 4WECA 5KTKA 2DI3A 1XLTA 4UVHA 3KTDA 4B7XA 1OYYA 1HLDA 2RAFA 2P6TA 3DBLB 4RGUA 5DUIA 2Q1UA 5IT3A 3JYLA 1LVAA 3WGZA 5HDKA 4I98B 3H2ZA 3P5SA 3FM5A 3U1DA 1ADCA 2O3JA 4QXMA 4WNIA 4DXHA 1KC3A 5JY6A 1DUXC 1RM4A 4HXYA 4LISA 5ILGA 4YRAA 3WWZA 4E6PA 3GEDA 1EDZA 4D79A 3CDHA 3JQBA 2DKNA 4P4LA 2JKVA 3UUWA 5AIPA 5AXDA 4YJFB 2OA4A 2YUTA 2GXGA 4ZVVA 3T5XA 2YX7A 3PGXA 1ZG1A 2Z33A 2PMHA 2DC1A 3SBOA 4ZICA 3BMCA 4RL6A 1S6YA 3INRA 5A05A 1SFXA 5ERIA 1LDBA 4QO7A 4RAZA 1T25A 4YJHA 3DPLC 5CFZA 4P96A 2PGDA 2TMDA 2LSOA 1MXHA 1IN4A 1M6WA 3LQRA 2TDXA 3M1AA 1XIVA 4OU0A 4RVUA 3W4JA 4BV8A 3TO6A 5TT0A 1O3TA 1TQIA 3ICCA 2DPUA 4XRFA 1XELA 5DBGA 4CHUA 3KE2A 3BWGA 4FX4A 1FYLA 1KEPA 1LC0A 3DHNA 4YBZA 2BHLA 2PY6A 3GF4A 5H20A 2QYSA 4YT5A 4RGRA 2MLKA 1HYHA 3WQSB 4YT8A 1F8GA 3DBRB 3QWAA 4YQYA 1P6RA 3TRIA 1Z1DA 2J3HA 2PI0A 3OJFA 1XQ6A 3WGQA 3ZU3A 3L0DA 4A10A 5JXWA 5HLGA 4M71A 2X0NA 3TQNA 3A14A 2EV0A 1U5AA 3Q0EA 4HKTA 2DPDA 1ZGJA 1D7OA 4WEOA 3X2EA 1Q7GA 3KRTA 4L9JA 2DVMA 2D1HA 2VOOA 3MEQA 4ONEA 1LC3A 3H7AA 3P19A 3X2FA 4RF4A 1FYKA 3T7CA 3LWFA 4AJIA 1BVUA 1U28A 1LDJA 4P9UA 5FB2A 3DDNA 2E1NA 2VYNA 1QLJA 1YONA 2IDZA 3G73A 1NPDA 1UH5A 1L1FA 4WWCA 2DPGA 2CO5A 2EFWA 3I23A 3DONA 2FEZA 3M6IA 2QZ9A 4PLZA 4E33A 3JQAB 2KKOA 5EQDA 4E13A 2CFCA 3WG9A 1FDTA 4IVNA 1YVEI 2DTDA 1R6DA 3CINA 4ESOA 4Z0HO 4MVJE 2ILTA 3PLNA 4GX0A 4DLBA 1GVJA 5L3BA 3L09A 3A28A 2HK9A 3H5RA 1UZLA 2Q2VA 4TMFA 5CPFA 4CV3A 4CM1A 1F17A 1XGMA 2IEDA 1U5TB 4LRSB 5ILUA 3Q9NA 4H15A 4OQYA 3AFNA 3UXYA 5CHEA 1KA8A 4CQMD 5FGMA 4FFPA 4Z3KA 3MJ4A 4NPCA 4AD9A 1ZSYA 3OFSA 2HRZA 2IEBA 3NGLA 4GLLA 1Q1NA 4QFDA 8ADHA 4IJVA 2EJRA 1D8KA 3ONDA 3JTGA 5CJ9A 4HDUA 1NFRA 2RVCA 4L9NA 2IE0A 3K2BA 1T1SA 4HFMA 5C5IA 3NTRA 4Q3DA 2O61A 2HYFA 1L0OC 1YRLA 1QKIA 1ZKMA 4TWRA 1GYRA 2HU2A 3F4BA 4KICA 1J49A 1N8KA 1W0CA 2L02A 4ALMA 4LSMA 4WX9A 1BM9A 1FSHA 3D5LA 1Z75A 3O2PE 2EW8A 4XIJA 1I5ZA 4TKLA 4NFYA 2X5KO 2EFPA 3BA1A 3ROQA 1HTBA 3G1TA 1ULYA 2M30A 2JAPA 1JU9A 4M73A 2XF8A 3CZMA 5DEQA 3T1BA 1ZSVA 5CG2A 1AUPA 4BNIA 1U4OA 2PMUA 4PLTA 1P0FA 3GR6A 1DAOA 4RVHA 3SX2A 5A9SA 3GHHA 1LRLA 4U0JA 3TF5A 4BAYA 2W24A 3CUKA 5KJ6A 1LLQA 3CH6A 2WTBA 3WTTC 5CVVA 4MIYA 2RQPA 1HDRA 2CDAA 4FFNA 3B73A 3WBFA 4MQ9F 4GO1A 4B8WA 2H1SA 3E5QA 1NVMB 2V1XA 1R36A 1Y9AA 3RC1A 2AQIA 3C7DB 4KUEA 4WOJA 4OINF 2VOJA 1XCVA 1ISIA 3ONEA 2BE5F 4HX5A 4HWKA 3GVCA 5EJ2A 1CIVA 3VPXA 3NQOA 3ZNNA 3EYWA 3BY6A 2UUPA 4EM0B 4Y6SA 3ZWCA 1ORRA 3PDJA 2C5AA 2V79A 2B35A 4E3ZA 5T8KA 4I0BA 1LDNA 3HHHA 4P38A 5JLAA 5J8CA 3OQ6A 4HP8A 3KCCA 4BXUA 1RM3A 3ON5A 2IA1A 2F5CA 3HRUA 4ND3A 2PA3A 4GSLA 5E17F 2XAHA 2AMFA 5H82A 4HFJA 2Y0DA 3J7AO 2AA3A 3K1MA 3U5TA 3INGA 4IY1A 3WQQA 1YW8A 1HW1A 4MGRA 1I1SA 4R4JA 3KLPX 3PFWO 3SEFA 4HX8A 1ZH5A 4LMPA 3WJAA 3FNGA 1XGNA 4YCAA 4HLXA 3RPQA 1NAIA 4BNWA 3BTSA 1QYVA 2DU9A 4CM8B 3E9QA 1MJAA 4XBFA 3GEMA 1K6IA 4GQAA 1U7TA 4TVOA 4BV9A 4ZHSA 3K1NA 2MH2A 2VHWA 3CO6C 3DMTA 2ZNYA 4ZZDA 2O7QA 1LLUA 1RJWA 4IGEA 1ZEJA 3VH1A 1IOLA 1IPFA 1UAYA 3PI7A 3VZQA 3K0LA 3DFZA 4L4SA 5FD6A 4M49A 4LB6B 3ULQB 3ETEA 3QVXA 1HZZA 2P6SA 4OMYA 4CLOA 1B8UA 3D4NA 3PYLA 2HK8A 2OMEA 3SVTA 1WSUA 1AE1A 4RQUA 2FR0A 3W6KB 2FNPA 4KDPA 2FBIA 5TC4A 3QPTA 2ZBKA 3WDSA 3JW4A 4DQVA 4MP8A 1T26A 1PQUA 2RBEA 3L6EA 1XG5A 4PLGA 4BGEA 2FR1A 4ALLA 1HLPA 4WLOA 3UW3A 5LLQA 5CEEA 1Z73A 3H3ZA 1YXMA 4CL3A 3KLMX 2HTSA 2IPQX 3AI3A 4MOWA 2KRFA 2FHSA 4IUYA 5A9SB 3GPDG 3RVDA 5HS9A 3F23A 2NWQA 4MP6A 5JCJD 3F1LA 2QBYA 1YG2A 5D4RA 4EGZA 3C1OA 1P45A 3KZVA 3TFQA 1FLIA 3ZP5A 1LTHR 2NV6A 4AICA 4BQPA 1PJ4A 2PZLA 5T8KC 1E1KA 3JD0A 4XSZF 3SFZA 1DPGA 5LRSA 4JJIA 1RUOA 5CDSA 5CDGA 1PZEA 1A71A 4AJEA 3WGIA 2O0YA 5L3CA 4W9NC 5TJJA 1IXCA 3SLKA 3WMWA 2JL1A 5JCJA 1LLDA 2YV1A 1M76A 5D6EA 3PHGA 4IRIA 3H3UA 2EWMA 4BNYA 3C85A 3DOCA 1XDUA 2RV8A 3OICA 4UUNA 5JC8A 1HKSA 4Y6RA 4KQWA 1ENYA 3KV3O 3LZ6A 4P8RA 1SFUA 3IDSA 5KOIA 3RUCA 3ML6A 4WXHA 3N58A 1PR3A 2EP7A 4UULA 1UXJA 2P9EA 5FYDA 4J7UA 4MVJI 4BQAA 5JDCA 5L4SA 4XWYA 2GCGA 2VXZA 4ZYGA 2YDYA 4J1SA 2P9CA 4BHPA 4EDFA 4DIOA 2VWGA 1ADBA 4GGOA 3RFXA 1BXKA 2V7PA 4I02A 2QLZA 1BHSA 2FBKA 4EVIA 1ZNQO 4J43A 4Y6PA 5LGNA 4AJ4A 2PEXA 3LC7O 2XAFA 4BGUA 3COSA 4CQMB 3WLEA 2I3GA 4L75A 4RLSA 3M2PA 2IODA 4HUJA 1BWSA 2GN6A 2HOEA 3EW7A 5JMWA 2GWRA 2X9VA 1HSTA 3ZHXA 2HFHA 4OO3A 1GR0A 1MJ9A 3F46A 3GVXA 3GZNB 1V35A 5ICMA 4MTDA 1X7HA 2AE1A 4YJDA 3SXPA 2STTA 1B3BA 1UDBA 3KM0A 3NJ4A 3V1UA 2MD5A 3I59B 1E7QA 2I65A 4CUZA 3G17A 2V9VA 1BBYA 4PN3A 1TI7A 3O4RA 3KYDA 3ZWYA 3Q9VA 1C0PA 1OC2A 3TO9A 1KVTA 1YDEA 1Z9CA 1MFPA 3JQ9C 4O5OA 3WU1B 4JJGA 2C7VA 5LHIA 1Z91A 3HNPA 5EL0A 2H27A 2VWPA 5HS7A 4ZQGA 3JQ9A 4XJSA 4BMNA 4LLNA 3UOGA 4WLEA 4OIPF 2HTJA 2XV4S 1I0ZA 3GEGA 3GVHA 1UZMA 1FJHA 2GF2A 1S7AA 2A92A 1PP8F 4ESFA 3BTVA 2G7UA 4FT8A 2E82A 2OD5A 2CG4A 2FZEA 1LBEA 1R12A 4W9NA 4QO8A 3VC7A 5JAIA 5JBIA 1N2SA 5B12A 1SNYA 3IP3A 4L5IA 2X0JA 4YAIA 3L9FA 3M7GA 2WWRA 3ORFA 2V6CA 2GNAA 1FT9A 1MV8A 3O26A 5HDNA 2ZATA 4LCEA 1P4AA 1ZK3A 3QLJA 4JIGA 3VZSA 5JAZA 4N9HA 1J4AA 1LQTA 3L7WA 3RUAA 4PZEA 1E3WA 2OP1A 1GAEO 3JSOA 2QG4A 4ENNA 5KNLA 3C8MA 1A4IA 3IRQA 1I33A 2Y0EA 7MDHA 3F3XA 2JCYA 4O59O 4P22A 1JAXA 4HFRA 1B26A 1CEQA 3RUIA 4IDAA 3MZYA 1JHHA 1KGSA 4L9RA 3AY7A 4RPGA 1N9GA 3BP8A 4EJ0A 4L0QA 3WIDA 2EG9A 1EUDA 1R5HA 1G3TA 2E48A 1GTMA 3HRMA 3WYEA 2VBZA 2X86A 3WODF 4IRGA 2R6JA 2XOXA 4WE3A 3V5NA 4Z6KA 4EJMA 1CERA 1P1RA 1R4NA 4IM7A 4IHSA 3IC5A 5D5XB 2BMAA 3U62A 4U88A 3CSDA 2WTEA 3TZQA 2Q50A 2Y67A 4G6DA 4M1QA 5KJEA 3ZMZA 1EH8A 2Y1FA 1IZ0A 3MTGA 4TRJA 2H09A 4Z9FA 3AM3A 1U4SA 4I0AA 1EQ2A 2PD3A 1FPQA 2J6IA 1QZYA 1XSVA 1SD4A 2QUFA 2B37A 3UAGA 3HWRA 5LEKA 1LXCA 5BSHA 3ENNA 1NXQA 2JPBA 5BPIA 4IQ8A 4M89A 4CODB 4WCGA 4ALIA 3LA3A 1CF7B 1YS6A 2AW5A 2O3QA 3CE6A 4L0YB 4U7WA 3WNQA 3WJ7A 4LSWA 4MKZA 2GO1A 3PHLA 4J49A 1U2DA 5EIOA 5I9LA 4P4NA 1PSDA 4XLPF 4ZQBA 3VPSA 4CLHA 5BSGA 4ZYDA 3LQFA 4U5QA 1R66A 4CR8A 4XSXF 2ELHA 1B2LA 3RKYA 1PTJA 3KZZA 1ZHFA 2ZTMA 4A5MA 1HW2A 2WYWA 3E5UA 3N7UA 4FGWA 3HB5X 2XVCA 4FOOA 3TL3A 3GN1A 5CG1A 2LKPA 5E8IA 3K30A 1SPXA 2DAPA 5IT9Z 4ND5A 3U3XA 3EUWA 5F3RA 4BKRA 5HS4A 3PJGA 5AOVA 4OYRA 3JQBC 1PR9A 2FRDA 2QYOA 2YFHA 4XEHA 3H9UA 4DL9A 2QM3A 4XKJA 4ZQFA 3JD4A 4EQQA 1BDMA 1LQUA 3OJOA 4FOSA 4WK8F 3F8BA 4G8XA 5I7VA 1LX6A 3WMXA 1NHGA 2IRWA 3D3EA 4L18B 1DPUA 3DV8A 1K3TA 2OGUA 3OP4A 3WQRA 4RF3A 1RI7A 4MKXA 2HK7A 2ISZA 4Y15A 1VJTA 3L77A 4A0YA 5C3MA 5GMOA 4FC7A 4CM7A 1UDCA 2VC1A 5THQA 5EQFA 1YQAA 3WSWA 3PZRA 5C7IO 2ZTLA 4F6CA 3Q9SA 3KBOA 4OIRF 1OYIA 1C1XB 1JLLA 4Q39A 4YJGB 2Q8KA 1VSVA 3PQFA 1D4FA 1NVGA 3ERED 1IL0A 5BQTA 2OAZA 4AJJA 1PGNA 4R79A 5B1YA 4I5DA 4R1TA 2C29D 4A2CA 5A5EA 4GWGA 5HWSA 3H3JA 4A0SA 1S29A 2AXLA 4TKMA 4R3NA 5BSEA 1HBXG 1J75A 3WTYC 1XSEA 4OMUA 4UEOA 2HUNA 2DLLA 2FZWA 1NHAA 4CR6A 1IY8A 3TDKA 1GADO 1OI7A 1DPRA 3AOEC 2H6EA 4O1MA 4PLFA 1TNTA 4RF2A 4YFNF 4Z9YA 3VZPA 3GOHA 5ENDA 2E1CA 1Y1PA 3IWFA 1Y8RB 2HDHA 2G82A 3FPLA 4BO6A 3AU8A 4YRBA 3FXQA 1A7AA 1BN5A 3FXRA 3RFTA 3PLRA 2ZMEA 3G0OA 2FQ3A 2J5KA 1PJ3A 4ZU3A 5G4LA 1S8NA 3TGNA 5HS8A 4ENMA 2J3JA 1IXSB 2J3IA 1XQ1A 4ROSA 5I7SA 4DYVA 3OMLA 4WLFA 3JTHA 3TOZA 2O3TA 3N97A 2B4RO 1R37A 1QYCA 4ZGWA 4CUKA 1H6CA 4HQEA 1C3VA 4EJVA 4BB5A 2EV9A 4XRGA 2PR2A 5LGTA 1YQXA 2I3AA 1NASA 1KU9A 1YBVA 4O63O 5I9MA 4HX7A 1H9BA 3D4PA 1SD7A 1A4UA 1P92A 3CTMA 1P3DA 1PJ2A 2C20A 3NEUA 3JCZA 5DNAA 1IHXA 1MUUA 1HE2A 5JO9A 4R9RA 1GV0A 3VVBA 4ZJUA 3DPTA 2O8XA 5L95A 3WGHA 4YPOA 1XB4A 5KJ1A 3SZPA 4EGFA 2PKRA 4HOBA 1TT7A 3FRJA 4IMRA 2K4BA 1NAHA 4WKGA 2A9FA 2Z1NA 3P9IA 4XDZA 3R61A 3LYLA 4RVGA 5JE8A 1X15A 3ZNPA 2VN2A 5ITWA 4PDKA 3PK0A 4HFNA 2BLLA 1LU9A 3FMSA 5DDIP 4KIFA 4GMGA 1KVQA 4L73A 1XSDA 2NU9A 3L07A 4RAYA 4UVIA 3GC6A 2VOPA 3V7RA 3GN2A 5TNXA 2EKPA 2LNBA 4YQZA 4F46A 2KIFA 3ETGA 3CUQA 3TZCA 1QYXA 3ENKA 1KU2A 3C3WA 4AFNA 4ALKA 5IDWA 5KK1A 1GXQA 4WLNA 3QY9A 1HDOA 1Q0HA 3FX3A 2F00A 3KSUA 3RAJA 4BNUA 2BFMA 2BFOA 4GVLA 4UREA 1DIAA 1VPDA 3DZGA 4LB5A 1RM0A 2A94A 4ND4A 3MEXA 3QVWA 2HGCA 2NYXA 1E3WB 3PQJA 4MKRA 2G7HA 1YLFA 1HDZA 2UYYA 1R23A 2IYOA 5B4TA 3WYCA 1E92A 4UHTA 3E6CC 3JTMA 3IJPA 4PCVA 5COQA 1G6NA 4I9NA 3EAGA 2L4MA 4Q3CA 5JNLA 4AVPA 2ZKLA 4KN7X 3WWYA 3HZZA 4DREA 5G2OA 4I09A 1BIBA 4EUHA 2HDCA 1YB5A 5IAAA 4KIGA 1I2ZA
chains in the Genus database with same CATH superfamily
2WYHA 3CU5A 3WR5A 4U9IS 3STWA 3LUCA 4C22A 3HCOA 3NGMA 4G2TA 2FXIA 1G3IA 4ARUA 2RGNC 2EFJA 1FP7A 1C9DB 2GFIA 1I51A 4OQMA 3R8XA 5JJCA 5K0TA 1EFPB 2F1KA 2QRQA 3IRVA 4LK1F 5FTJA 4CG2A 2Q21A 8LDHA 3EHEA 4O5VA 3K9CA 5DCLA 2J0QA 2Z56A 5CRIA 1M8KA 1X1SA 2GD0A 4BDYA 3FH0A 1JR3D 3CVJA 1QLHA 2W6ZA 1E3PA 3MUFA 4ZQCB 2RHTA 3AIOA 2QT1A 3Q5GA 4WFQA 2X5JO 2ZUUA 3KD2A 3ECCA 1X8XA 3KYDB 2ZSUA 1T38A 4QODA 4KYWA 3ZVNA 3I04A 3MD0A 3VX4A 3UKOA 2HWUA 3AKDA 4XQEA 1B3RA 4YTEA 5JS6A 2H2FA 3DQVC 4QDUA 1ONSA 4RM2A 1TJNA 1CQXA 2V98A 2BHRA 4X85A 3DEAA 4YMIA 3UJ3X 4CNQA 2XVYA 1Z4NA 3L1VA 3WS7A 2HA4A 1GDHA 5ALZA 1G63A 4PG7A 4HWGA 1N3LA 1MX9A 4OMZA 2RHWA 2WOJA 3DVAB 2LK2A 4NBKA 2F5DA 3F8CA 2W6MA 3ABQB 3RCBA 1LH0A 4L3VA 4ZYUA 2LBFA 3B8HA 1BJAA 1IJKA 1Y81A 4DJJA 2OMKA 3H16A 5CNIA 2DCEA 1X6VA 1IDYA 1DAFA 3F4LA 1HSZA 2IX9A 4DBLE 4BO4A 3JQAA 1Y0NA 2CV2A 2FRDC 2I2FA 2QN8A 4YI5A 5FL3A 3TEMA 1FFXA 1NQOA 2DBRA 1Y1LA 2I54A 4G9EA 3NYWA 5T4EA 4J7XA 2LREA 1SCUB 3QV1A 2V7FA 2IGOA 2XUOA 4WUVA 2R5YB 2HOTA 1IRXA 1QMGA 2UZ1B 3FM9A 4WH0A 4G23A 1R22A 4AO6A 2PVPA 3R9XA 4BX9A 2OFXA 4EAQA 3GWZA 1KL7A 1G3RA 2B9EA 3LKBA 4F5DA 5D5WB 1JIUA 3LP6A 4GE0A 4AU1A 2XUJA 1P61B 1GNQA 3IXLA 1AM4D 1RRFA 4JFRA 3ADOA 1JKQC 1R0ZA 3PRYA 4IQ0A 5IPAA 2ST1A 2GEDA 3ZXSA 3GCXA 2EYQA 3GBVA 1JFLA 5F12A 3WWEA 1Y6IA 1VHDA 3G9QA 1AO0A 1SUSA 3O4FA 3A7EA 2EGGA 2GDZA 3IE0A 3SFTA 1DQNA 3ZDZB 1F2UA 2ZJAA 1SZCA 3MWMA 4L08A 2DLDA 4TTSA 4GP6A 4ZDPA 2F7SA 4PFPA 1VL0A 4DLUA 1WULS 2FLVA 2VYQA 4A5SA 1HC8A 1YBFA 1VF9A 3HJEA 1U2GC 2MD0A 5A5DA 1Z4OA 2FI1A 2VL8A 1TA0A 2QD2A 3CNLA 5KVCA 4WCVA 4CTKA 4LC9A 2PH7A 2F43B 3EPZA 1V5GA 3OLCX 3TL6A 4DAEA 1LPQA 4DJDC 4B3MB 3N74A 3N07A 121PA 4PRZA 1MZBA 1VQ4I 4WZBA 3E4CA 2HRRA 3NUQA 1B7GO 3VWBA 1SBQA 1ODLA 2ID8A 2WMOB 1M2HA 1X13A 3VKVA 4ALNA 4G86A 2I7TA 3TRDA 2XZOA 2CQQA 3JALA 4RZSA 4JZYA 3EUKL 3UBMA 1DEAA 2EV5A 2J08A 3AHGA 3CCUI 3H13A 2I4MA 4HAWA 4NSNA 2C78A 3JYQA 2ID9A 2WP0A 3OKPA 4NCKA 3H5VA 1FBSA 4YB8A 5KEIA 1W4RA 2PKQO 4MW2A 4IG9A 3S7ZA 4WCFC 1EAYA 4B75A 2GLOA 1QVRA 1J5YA 2XGGA 3JRWA 1WHUA 4RA6B 3SKXA 4F11A 4V24A 1GG5A 3EIHA 4DNXA 5L51A 1T8IA 5DHRA 5H81A 2H5EA 1E3OC 4ES6A 3GXBA 3JATB 2QPAA 4IH1A 1B8NA 1KH3A 2HBYA 1CF9A 2VCEA 4URWR 4YJHB 4YAEA 2HRDA 1RHUA 2RDMA 4OUDB 4IRXA 2O57A 4YV0A 2PFSA 4PYRA 4PYMA 2EPFA 3B78A 5L3ZA 4JX9A 4MVXA 3GY0A 3M81A 1U99A 3MVEA 4HNUA 3K70B 4CW7A 2HCRA 2A67A 1QQTA 3DTVD 4LY6A 3IIEA 4XWOA 5A02A 4I50F 2ASVA 3K7EA 3EZNA 3OWXA 4FYKA 4EVSA 2JJ1D 2PLAA 3TIFA 4BNVA 4LG1A 4Y2UA 1ORWA 1H2BA 4PWYA 3D2LA 2I6FA 4XXHA 5EEGA 1ES9A 3N8HA 3NAGA 4DKJA 2QVZX 3LKDA 3Q85A 1EE2A 5JU6A 2JIDA 1NBWB 2RIPA 4KPFC 4CG3A 4JJ4A 3H5NA 4X0GA 2FWIA 2IUTA 2A78A 1UPFA 2PZGA 2X4IA 5FI1B 1MO2A 3R74A 2FN4A 1OIXA 4EKIA 3KXLA 4Z2YA 4HTFA 4KNWA 4GPEA 2CL7X 3JVEA 1Q2UA 1VGVA 3I4MJ 2J5PA 2HPHA 3P2MA 3WLRA 4MV8A 3RVJA 5EP1A 4BGDA 3E5XA 2L7KA 4FEAA 1X7XA 4IXTA 2JAWA 3AJ8A 2BM8A 4ZOAA 2QQ8A 2V5VA 2YJZA 2YVAA 1QYWA 1I2DA 1RYNA 4OVKA 4BLVA 4I5FA 3JAMK 1HKQA 4LIPD 3AG2H 2FSIA 3D0SA 4MPTA 5BYKA 1G7SA 2L7ZA 1QB7A 1TMYA 3HA2A 1UQUA 4HF1A 3I6ZA 4JLNA 5JSQA 4L9WA 3HXQA 3U7QA 2IOFA 3LOUA 4ZO6A 4BB0A 4LK0F 1PJRA 3GG9A 1OT3A 1THTA 4MGIR 3RS0A 1QRRA 3V2GA 4D44A 3LO5A 1Z4MA 1VL8A 3HRIA 4JODA 3UJCA 1WXHA 1KEEA 3K6JA 4M8IA 2JDID 2YYZA 3FOAA 5DGTA 4H4KC 2BI4A 2Q45A 3EZYA 2R7AA 3TBFA 2JF0A 4BEVA 4DY4A 5LJLA 4GGMX 5CBPA 1CYEA 2I4OA 4YR9A 4PTZA 1PWHA 1EM8B 3NJRA 2NAZA 5EMKA 4B3IA 4A0HA 1IJFA 1WW2A 2OENG 1FX7A 2C2HA 4FNMA 1D8JA 4HZUA 1E4EA 1OD6A 4YRDA 2ZWMA 1W0KD 3USCS 4N40A 1SFRA 1VQLI 2QX4A 1W36B 4Q9IA 2QAIA 1ZHHA 2G80A 3KKKA 2X8LA 5EAIA 4XWWA 2K9LA 2VPIA 3HDHA 2D7JA 4M4SA 3U61B 3BJOA 1WQ1R 1Y6JA 1ZD9A 3C3DA 4BE0A 3BTUA 3FMFA 3IUYA 3LC1O 4TKVB 1DAGA 2ZRFA 2VASA 1B9MA 3FOBA 3IUQA 1I7QB 3OQHA 3V7YA 4BNCA 3QQAA 4Q1DA 3UA4A 4AURA 2DA1A 2QQ5A 4G1VA 1YJ5A 1Z7UA 2JAXA 1T10A 3BXXA 4Q3NA 5GADJ 3GZ5A 1X7WA 4QPZA 4EEXA 2R92J 4RJTA 1NG9A 3FVTA 4KPYA 4GSYA 1RWKA 5DHAA 2O23A 3F9RA 3CLTD 3BG6A 3EQZA 2WY8Q 4OFZA 3U37A 4B4UA 3OJWA 5CGZA 3DHVA 3RWOA 2IA0A 3D3NA 3WLNA 1EUZA 2QTRA 4BTEA 1APLC 2WILA 2YX1A 5GY7A 3RBZA 1J07A 4YDHB 4Z51A 2C5BA 2H5JA 4NENB 1G1AA 4KFSA 2P78A 2UVPB 2GZ1A 4RVSA 4PNHA 4EOGA 3FMVA 3L01A 4W5TA 2DBVO 5TGDA 1TA4A 3KD3A 2IGMA 3M33A 2GXUA 1G2OA 1K7SN 2OZVA 2V9ZA 3DWEX 4G0ZA 2VUTA 4LDJA 3I4LA 1J8MF 5E0OA 1Z4IA 1JIQA 3MJTA 3ECHA 1JIVA 3BYZA 1JT2A 4J3FA 5EIHA 3K2EA 4BMPB 4NAHA 3TE6A 2OCPA 5DZSA 4DVGA 3SHWA 4AC9A 2X0RA 3W6UA 1FVFA 5F35A 4EQZA 2A6EF 1QPIA 1DBSA 1S4MA 2A0YA 1IQ0A 3UG7A 3W7BA 2ZJ1A 4MWBA 2DTEA 1L5VA 2ORVA 4Y7CA 4QUHA 3HFJA 2PJUA 2WUGA 3FHZA 1LPMA 3TMAA 1OIVA 2B3TA 2EX4A 3VVCA 2WHPA 3AUFA 1O87A 3QWBA 1CNEA 2I99A 3OT5A 3UAXA 2WHRA 4NU0A 3RKUA 1IM8A 3GEHA 821PA 1QP8A 4NY1A 4JOCA 2OO5C 3HSKA 1MLDA 1H94A 2XTMA 3WC4A 4ER3A 4F3TA 3WWOA 1IVSA 1UFKA 1AS0A 2X6TA 4DMFA 4MCAA 3EZLA 3CMMA 1FS6A 1ZU5A 2P9TA 1PUFA 2ZJ0A 3WTVC 4FMDF 5ICFA 3BC8A 1KIAA 2O07A 3IR5A 3HL0A 1RLUA 2XMBA 3E48A 3M5CA 3R7DA 1BDIA 1MNAA 2Y4OA 1HDXA 3CB4A 3N2KB 1I24A 3EGVA 3VKWA 3VNRA 5LMUB 2WAEA 1OILA 1X3LA 3ROPA 2AN1A 5EMNA 4EG3A 4CKBB 1EFKA 3G2BA 1KXZA 1V8FA 1OI4A 1PRYA 3P1JA 4HNQA 4ZVTA 1R64A 5J4LA 1MIJA 2ZSEA 3KDPA 3VEPA 4LHXA 2FWBA 3THYA 1XTPA 4R5MA 5BV1A 1EFPA 2ZRLA 1H5NA 4G94A 1QIKA 1RR6A 3ZQQA 1Q0UA 5JNLA 1P1JA 3C8HA 2QENA 1M2KA 1H6BA 1X7GA 1Y3IA 4FYIA 1FEXA 4AN4A 2WV1A 3I8XA 1Q0PA 1E7SA 5IC6A 2BP7A 1KDYA 2ZMEB 4YQFA 5ICGA 1M1XB 2MWMA 1DQSA 1Z33A 2NVOA 3DGFC 4QOJA 4WVLA 4WCFA 4XD2A 1DGQA 3F5SA 4X1EA 2X4HA 1U0EA 2PSEA 2ZWVA 3VR1A 5IBRA 5B3LA 1R50A 4TV7A 3SHTA 4NABA 2IOYA 3EOAI 3ZV7A 4AN0A 4V1CB 2MMCA 4YPVA 4K3VA 5BNIA 2Q4TA 5DYMA 4C0QC 1Z2AA 4RTQA 2IU6A 2ZWOA 1VLQA 3GA0A 1NIPA 3RTBA 4U87A 1GPBA 2Z8XA 4WK4B 4B9AA 1ZAOA 2Q4OA 3KHUA 3OAAA 1E77A 2QUIA 5JBQA 3EZ7A 2ID7A 1UJ2A 4FFDA 1P33A 3L7NA 3Q8XB 2EXXA 3BZBA 4WXEA 3I01M 2R2GA 4G12A 4NRDA 4DEVA 1SD6A 4RTMA 4OUDA 4CA0A 2ZYUX 3HVIA 3R76A 1NFFA 1JU3A 1U5TC 1J1ZA 1JNXX 3EX7C 1GNLA 2O20A 5F5XA 3ZNQA 3MWDA 3ISTA 4G5XA 4Y2JA 3OX2A 4HSEA 2GF0A 3ZUGA 4EEKA 5BT8A 2JW5A 3LY5A 2NS0A 1YRQA 4JBNA 1I3LA 5KYXA 4D4KA 1P1FA 2IP1A 3CN9A 3OQVA 2UZ1A 4HQNA 1A98A 1I6HJ 3WTZA 1OCZH 1ABEA 3L2VA 2IOHA 2MMGA 5FWXA 5TS3A 1CDDA 4YT2A 5C9ZA 2F6CA 4LFBB 4ENQA 1OA1A 3OI7A 3TO7A 4PFOA 1JUPA 1C14A 5JJIA 4P4UA 2B0LA 4AX4A 1V7QA 3ZCSA 2XB4A 3J7TA 4R9VA 2ZB7A 5AKHA 3G68A 1MO3A 4NK4A 1BR2A 1FVOA 2HKIA 2GILA 2PXHA 5HNFA 4QDZA 2YWDA 1GNPA 2Z99A 4S3MA 2OBNA 3AKYA 2FA9A 4QBGB 1E99A 4D6PA 3B36A 1FW8A 3NXSA 2HXYA 4ND8A 4P81A 3DCNA 4OXNA 3MF4A 4OH7A 3NMUF 2IT1A 4M54A 1GUBA 4UHKA 1EE1A 3P2JA 5MFZA 4HWTA 3RDIA 2DH5A 3JAWB 2RH5A 1DX4A 2P35A 3W9YA 2QV7A 4EZEA 1N0IA 3RUEA 3QW4B 4RA9B 4LVUA 2NXNA 3AP2A 1OFUA 1IC8A 3F98A 2G9ZA 3GP3A 3PFCA 4YFKF 1NSYA 2NU6A 2GKOA 1XDZA 3ZMTA 4DZZA 5CA0B 2GNPA 4LRTB 4Q3OA 4QJ5A 5BMZA 3WLKX 2Q8NA 5G1PA 3OZDA 2W0SA 1FLNA 3PRKE 3S2EA 3D7RA 5CT5A 2CUFA 2PG4A 4FEYA 4IIJB 4KXUA 3HCDA 3WK9A 3E9ZA 3L79A 5JALA 3VOEA 2DU8A 3OA0A 3HP7A 5DSXA 2Q1YA 4H0EA 2VZ9A 2YOHA 1X8JA 4RAGA 4YAKA 4IDBA 1MMDA 1FBQA 1XQXA 5JFGA 1R6TA 3KWFA 3AEXA 4DR5B 1V8PA 2HDDA 1EGVB 5GGYA 4CL2A 2R4TA 4R8KA 1OH6A 1A4XA 1S8AA 2LDXA 4Q9LA 1AKUA 2ETVA 3QUAA 4MW1A 2RK4A 2K5CA 1GFWA 2H8KA 5ESDA 1QO0A 3S1LA 3QKTA 1SCJA 3VR2A 4A1OA 4PZLA 1CQJB 3E3NA 4DDWA 1JMVA 3J81A 3GZ6A 3K4KA 1A7KA 1CUCA 2PLNA 3L49A 4CICA 4MI6A 4EJ6A 2Y3IA 1NYRA 4JZKA 4RPJA 4LF9B 2O4CA 2Z8ZA 1CIJA 2E1RA 1V8BA 3GJ6A 2XNHA 3OX1A 1TWHJ 4MPPA 3BBLA 5AXCA 5BVHA 1H2AS 2Y6VA 4C88A 2XIQA 2HGSA 2BZ1A 5DIZA 5EZSA 2RHCA 4TQAA 3W8RA 2CUJA 1PJLA 2DFIA 2EKZA 2FPIA 3U3RA 3I2FA 1Z5WA 5CB4F 3I83A 1Z17A 4ZIRB 2UUCB 1VKRA 2X23A 3EIEA 5IYZA 1MC5A 4UUOA 1DFHA 4NS1A 1YB6A 5EWJB 4BZZA 3DPUA 1ZGAA 1ZAKA 2OCEA 4LSZA 3DEUA 5CJPA 4DNOA 1T6ZA 3UN1A 2J7KA 4C7KA 3CCVI 1WSDA 1RTKA 3SC2A 1JAIA 5EGOB 4A27A 2JIQA 2BV6A 3C5CA 1EQUA 2O4UX 3NIFB 2GXAA 1KJNA 2EZ8A 2LDBA 2F8TA 1ICEA 4UTOA 3MTIA 1EVIA 4M9UA 5FOWA 2NN3C 3FR8A 5J40A 2EHJA 4JEHA 2XGCA 4CNBA 5BN4A 2ZANA 4NYIQ 4KREA 1FOEB 1NI4B 3A2LA 3DTTA 4KMUX 3ZK7A 4M0KA 2DTRA 4NU6A 1VL2A 4P35A 3TJRA 4CTOA 5C0OE 4E46A 5K20A 1VL6A 1U8UA 4M9SA 1E32A 2BDEA 1FIUA 5KJFA 4L2IA 2R66A 3Q7EA 1URPA 3H2BA 2YICA 1CQTA 1HWYA 5DTEA 4CF7A 4RZIA 2KP6A 5DM4A 4NKRA 3F9IA 2N42A 4DA9A 4CYMA 3OSGA 4OJNA 1OLUA 1N3BA 1GQQA 1YUBA 2EEZA 3FTPA 3MOGA 5AJTA 5F21A 2Y0CA 3BVPA 2YY6A 2ZKZA 2AOUA 3CG0A 2HMYB 2FEMA 5BW4A 4NLLA 1FDVA 2NU8B 1CUSA 3L2RA 1AQ6A 5K9ZA 2O2ZA 4JOQA 3RS9A 3IAM1 4YJ2A 3FTEA 2Z2ZA 2R47A 4JXJA 4D3DA 3E1SA 2Q6VA 3ZDXB 5HW0A 5F27A 3NRVA 4AIKA 3GTLJ 1H5QA 4Y6OA 3URMA 2VFAA 4L9VA 4A0RA 4DS3A 1V6SA 5C5DA 1X8LA 3C7AA 3PV0A 3GLIA 1K9SA 3FWPA 3KOYA 2BYTA 2DR3A 2FR8A 2EOAA 4EDHA 5A3JA 3CRVA 3VO2A 1N5OX 1ZONA 2PUTA 2ZREA 5BQXA 7REQA 1JGTA 2I9PA 3S1AA 3EXFA 3PHJA 2NQ8A 3KUCA 1L5KA 3DL0A 1JHPA 1RZ4A 1YL6A 1FU4A 1UDRA 2MT9A 3VO8A 2XY4A 4OHMA 3AF4A 4RPHA 1M2NA 2D62A 5MN4A 4J6EA 2V74B 2MSWA 3QVGA 1RBZA 4J1TA 4MYTA 1KPGA 1E2EA 4RPKA 4YLYA 2JFZA 2VUHB 5K6RA 1PAUA 3QVOA 3VV2A 2FOXA 2FP4A 3ZVLA 3OQIA 4LDZA 4NCHA 1JHZA 3M4JA 1WZ2A 4O4IB 5AYVA 4CIDA 3N53A 4LJ9A 2GN9A 5EYPA 3T4EA 1B6RA 4NICA 4BRWA 2QSHX 4IHJF 1KBOA 2Z04A 3OESA 3VYWA 1BYUA 1VECA 1VPEA 2BKAA 3HA5A 5IC5A 1YCGA 5DTJA 2IA2A 3NG1A 4ZDJA 2PUFA 2F48A 1SHJA 1UJMA 1LKXA 1IHDA 1KERA 2QIPA 3F8WA 3KJQA 4PCLA 3UC5A 4OK5A 4XIGS 1MSFC 3V4SA 4QLCU 1E5DA 1N8NA 2X8JA 3SR3A 4DC1A 4FFWA 4KLCA 4PJNA 4DYRA 1F2TB 2IKQA 2OBMA 1HA3A 3BZUA 4RVDA 1QIGA 5CXXA 2XD4A 4CT0A 3G2PA 4MHSA 3OS2A 2L19A 3RAEC 5CDYA 1OA0A 3O8LA 4C5BA 1W7PB 4JLPA 1O6FA 3B1ZA 2D4AA 1Q2XA 3W2AA 1KAOA 2AJ8A 1W6UA 3LZDA 2IVFA 2EARA 1LZKA 3HTSB 5KI6A 2OZKA 1P4JA 4M8KA 1B8PA 4XONA 2BY4A 5JSYA 4TWIA 3GFBA 3UPTA 3A1TA 4CMKA 4AKHA 3S2IA 3RV4A 4FJ2A 1SUFA 4Y98A 3X0DA 5K8UA 3AEYA 1IJWC 5LKAA 1FTZA 1GTZA 2R5ZB 1FP2A 3EQ6A 5KO2A 1MHPA 2D1FA 1YZFA 2J0VA 2AEFA 4M9CA 4YCJA 5KNCH 2FFJA 1WKBA 4URXR 3GJ4A 2R8BA 4EVRA 4UVGA 1NXXA 5LMNB 1H6DA 1IHUA 2UAGA 1CYDA 2NAFA 4RY9A 1Y4AE 2G76A 3OTGA 3VZDA 1YIAA 3OC6A 1XXHB 1CX9B 2D1RA 4H0NA 5I7AA 4DV6B 3OJ0A 1M2EA 2Y1CA 1ZGWA 4NDZA 1XMXA 4N3CA 5I7OA 2CJFA 1QZZA 1FWZA 4BOYA 1SK8A 3U4CA 1HE4A 3AW9A 3HZRA 3GZTB 1L7MA 2C9BA 1TCBA 2FSWA 2JA5J 1ZRMA 2RB5A 3JQFA 3PPYA 3TW7A 2ZI4A 1NJ2A 4QQFA 5EPOA 3MT7A 3UANA 3VYUB 4YRRA 5FL7D 5E4JA 5EWLA 4CCMA 5CH5A 5I9TA 4MEYF 3ZHVA 2GPJA 4D4HA 5EZQA 1YZKA 4BCCA 5ALMA 3RJMA 3WYDA 3NYIA 2LNDA 2W98A 4C4PA 5LA6A 2EH3A 4HW0A 3T7AA 2V45A 3H0CA 3JRGA 4AY4A 3TL4X 2XE6A 1LFUP 2P7CB 3QKUA 4V1CA 2K2WA 3IV5A 4I14A 4QRDA 4NHOA 2AFIB 1A76A 1P62B 3RLFA