2VT2A

Structure and functional properties of the bacillus subtilis transcriptional repressor rex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
199
structure length
184
Chain Sequence
ATAKRLPLYYRFLKNLHASGKQRVSSAELSDAVKVDSATIRRDFSYFGALGYNVDYLLSFFRKTLDQDDVILIGVGNLGTAFLHYTKISMAFDINESKIGTEVGGVPVYNLDDLEQHVKDESVAILTVPAVAAQSITDRLVALGIKGILNFTPARLNVPEHIRIHHIDLAVELQSLVYFLKHYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and functional properties of the Bacillus subtilis transcriptional repressor Rex.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
molecule keywords REDOX-SENSING TRANSCRIPTIONAL REPRESSOR REX
total genus 56
structure length 184
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02629 CoA_binding CoA binding domain
A PF06971 Put_DNA-bind_N Putative DNA-binding protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2vt2A01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2vt2A02
4KA4A 2G82A 2XKOA 4OKIA 3A4VA 3NJ4A 4LB5A 3VFZA 3HTSB 2GGSA 3BAZA 4J2OA 4L73A 3PFWO 4W6ZA 1K0UA 1P4AA 1HF3A 2XPCA 1QYWA 5FLXZ 3GFGA 1ZEJA 1RUNA 5BPDA 3G79A 4PZJA 4J0EA 5L4SA 2PLYA 4MIEA 1GPJA 3FBGA 3FI9A 3JQEA 4XQGA 3ZHBA 4MKRA 4W4TA 4J6FA 2LF7A 2DFIA 3PQKA 3WQSB 1E1KA 2DU8A 2H94A 3K2BA 4KMUX 1Y7TA 4IQGA 3ZHYA 5FI3A 4AJIA 1PZEA 2LDXA 4BO7A 2PQ8A 1E0DA 2DFVA 3E5QA 5LEKA 2Q2WA 3KB6A 3ORFA 3LA7A 2RNJA 4JQFA 3V1YA 3D3EA 5T8KA 2GYYA 1T4BA 4Y15A 4CMHA 5T5QA 3GZ5A 2XV4S 3RKWA 3N58A 3JYLA 4L0QA 1U6GA 2IEBA 5A05A 2MBFA 3SVTA 4E70A 1MDMA 3JCZA 5D5VB 2BF7A 2IYPA 1SFXA 1HLDA 1P4WA 3WTYC 4IHTA 1B8UA 1CQIA 1I10A 2CY0A 3ROQA 1JHFA 5A2QZ 2V1UA 2P4QA 4HBLA 4FFRA 2XXJA 3DF8A 2A5YB 3IIEA 3JSPA 1FC3A 3PQEA 3PIIA 4L9RA 2ISZA 4AJ1A 1DAOA 4L9NA 1PR9A 3UOGA 3E8XA 2AS5F 2X86A 1A72A 1VJTA 2K4JA 2RHRA 1BXGB 5U4QA 3HIFA 2WC2A 3SC4A 1DFGA 1D4FA 1PJTA 4KP7A 3ELKA 1KVRA 4BNGA 2QWWA 4MVJF 4G6DA 1ZSYA 1OBFO 1DPGA 2Y0EA 3OJOA 4IIUA 4RQUA 3BZUA 4RLSA 5HDGA 4A5NA 4GVLA 1KERA 1KVUA 2YUTA 3DMTA 5ER9A 4AVYA 1ON1A 3TDZC 1DC4A 1UR5A 4BAYA 4FN4A 2ZCVA 1WSUA 1BXGA 3QJ5A 1IF1A 2RC4A 4G2NA 1XLTA 2IT0A 1PGPA 1BHSA 5F6FA 4M54A 2NTJA 1LDBA 1MGOA 1ODDA 5JMPA 1LUAA 3WICA 5THQA 2HMTA 4IF4A 4BXUA 3EAGA 4IGFA 4EEZA 5BR7A 8LDHA 3WU1B 2ZCUA 5L4NA 3CH6A 1SPXA 1SFUA 4PG6A 5L3BA 1MB4A 1TNSA 3F23A 2QBYA 1C14A 1R4NB 1AWCA 1TBXA 3R4KA 3KP5A 2GIVA 3QRFF 2FP4A 2HLPA 1KVQA 1P1FA 5AXAA 1ML3A 3ZW8A 4YIFA 1XYGA 3Q9SA 2BLLA 3ULQB 4WUVA 3RU7A 2OD5A 1BDMA 5H81A 1NFFA 2EEZA 2O2SA 4KWIA 4EBFA 1AGNA 2FZWA 5LLQA 5CLSA 3CO6C 4CV3A 5F1PA 3WYEA 1RI7A 1CF7B 3MTGA 4ND4A 3HADA 4Y98A 1ZXBA 2EA2A 3VVCA 2OZUA 4FOSA 4BKQA 1ZCJA 4TRRA 2CWEA 5HVQC 2PKRA 2V6GA 5IT9K 4Z0TA 3WMXA 4BNZA 1O7FA 3IC7A 2VUUA 4NDNE 2Y93A 3FNEA 1R66A 3I4CA 3W4JA 3WR5A 1I30A 1R36A 1LDMA 1P44A 3NX4A 3RTRA 2PNFA 4JBAA 1HDZA 6ADHA 4BHPA 4CM1A 3GN2A 5AQ1A 1WVGA 5ER6A 1CWUA 4DIBA 1PL7A 3HTUA 3L9WA 5KWEA 1T4DA 4LK1F 4ZZLA 3VTFA 3ML6A 4NG5A 2ZFWA 2D1YA 1GAEO 1ADBA 1L1FA 2MLKA 3HHPA 3WTZA 4CHUA 1GHCA 2A07F 1GYRA 4YB8A 3ZZNA 4CM7A 2FRDA 1XSEA 2BI8A 4JX8A 5JXWA 2GA1A 4N5MA 3QW2A 1EFLA 4PLZA 3D4PA 3ZV3A 4UUMA 2VOOA 4ROSA 1VI2A 3H6KA 3H3ZA 3JQBC 3QU3A 3G1UA 1EH8A 3F8FA 1CEQA 3DXFA 1X15A 2B36A 3D7LA 5H83A 4B8WA 2XHKA 5HLHA 2JKVA 1YL7A 2AQIA 4S04A 3VKUA 4UV8A 3IKVA 1C1DB 3G3EA 3EC7A 4YRDA 5CP8A 1EH7A 1HETA 1SD5A 1RM0A 4CM9D 5D5UB 1GZ6A 4I09A 3J81K 5C5IA 1ONVA 3IL2A 3TQNA 4OMZA 1UDCA 1HE4A 3I23A 4ON0A 5U1PA 4XB1A 2FXAA 5D6EA 3B6ZA 4I5GA 4TWRA 3F21A 3UN1A 4ALJA 1HW5A 3JD2A 2HRBA 2DO7A 2NNNA 2Y0CA 3GH3A 3I4PA 2KRFA 4AJPA 1PUEE 3S2FA 4RJTA 3DV8A 2H5LA 2A6HF 2QUFA 3I5UA 2YX7A 3RBZA 1MC5A 5HM8A 3I9OA 4YEDA 3EYIA 4KDFA 5EPOA 3AY6A 3BROA 1HSJA 4GSLA 2Q50A 3WODF 4Q3EA 1KC3A 1VJ1A 1O3RA 4FIZA 4YTEA 5AOVA 3ZWBA 4CM3A 1RUOA 1MFZA 3MJCA 5BSHA 1YW7A 4MTEA 4HLYA 1PJSA 1U3UA 1PU2A 2FY8A 2X6TA 3L9XA 3PWSA 3CTMA 2Q2EA 1MX3A 1YBMA 2CUKA 4M87A 2RN7A 3QPTA 1HW1A 1EQUA 1GEEA 3I1JA 3VEPA 3TNLA 4AD9A 4BS9A 4J43A 4PG7A 2X9VA 4YQZA 1B9NA 5IDQA 1NNUA 3KXDA 3H3FA 1VLLA 4ID9A 2EV0A 4E21A 3WTXC 1GDHA 3WJAA 4C7JA 4JCOA 5JDIA 3M8FA 3WOHA 3QWBA 1YONA 1EUDA 1YW8A 2O3RA 3GVCA 4QECA 4LSWA 2WTEA 2DUUA 4MP6A 1R5HA 3F3XA 1K6XA 3KZZA 3KEOA 4CQMA 3U09A 1WAMA 3GEGA 1IN8A 4EJWA 4CLHA 4DWVA 5JFOA 3KEQA 1AHHA 3HE3A 3W8FA 1USSA 3HRSA 4UVAA 3GVIA 1UXHA 3INTA 3P7MA 3V7CA 3WGZA 5TQVA 2JT1A 2QRKA 4JJIA 1NX6A 5FD6A 3JYQA 3EDPA 1J7KA 1JA9A 3PRJA 1GU7A 3GY0A 4UVIA 1FWZA 1G6NA 3PQDA 4IXAA 1V35A 1XR3A 3GQVA 1FSEA 1IULA 5TRDA 2LF8A 3AUTA 4J1QA 2ZYAA 3DBLB 1K78B 4N5LA 5IZCA 4F45A 2GLXA 5CEEA 5TT0A 3LZ6A 4JQCA 1FX7A 4EV0A 2RQPA 1EE9A 1ZSNA 5D5WB 2X7HA 2FMYA 2EHDA 5EMHA 3ZWMA 3NJ8A 1J75A 1TQMA 4CMCA 2DQ4A 3DMYA 2M8EA 4NHJA 2CO5A 2XAJA 1TI7A 4OHUA 4XIJA 3VPSA 4CV2A 1ADCA 1OYWA 1IAWA 3A9WA 4G8XA 5HA5A 2NADA 3CSDA 4YAGA 2OZPA 4KUMA 3WTSC 2IE0A 4PLPA 1UZLA 3ABTA 1LDDA 1KQ8A 3H2ZA 2P9EA 3ITKA 1BIAA 3DL2A 3WS7A 4NU6A 5JAZA 3JQAB 3BMQA 5DUKA 2QZ9A 1P4XA 4BNUA 1HE2A 3BIOA 3PYXA 5CPBA 4CMKA 1JKJA 4GX2A 4DC1A 6LDHA 1PWZA 4WASA 4A03A 4RF4A 5DT9A 4IBOA 3V1TC 4MVJP 4EJUA 2GF2A 1F1ZA 3GLXA 5IT9Z 1K5HA 3VH3A 4D46A 2PGLA 3DZKA 4RAYA 3IQDB 3O26A 1IPFA 3PJFA 4M9XA 3GR6A 3C1DA 3Q0EA 4K28A 4A0XA 5DP1A 2HRZA 2H63A 4QEDA 2HTJA 2BKAA 4A0YA 4IM7A 3WYCA 1J6UA 5DULA 4AWXB 5D4RA 2D59A 4LISA 2NU9A 1HKSA 1GR0A 1NYTA 2H6EA 3WNVA 3D3WA 3P19A 3PPIA 3HYIA 2PBIA 4BNKA 3EHEA 1T2KA 3GA0A 4A7PA 2H1SA 3UCEA 3EUWA 4DTIA 4ND1A 1YS6A 3JV7A 3DBHB 1SD6A 3PFIA 1ZRCA 4IGEA 4A73A 2MC3A 4FX0A 3PQFA 1F4KA 1X7GA 2WYUA 1ZRFA 1ON2A 2Q2VA 4TZTA 5K6AA 1JKFA 4WGGA 3P2YA 2R00C 1UDBA 3OMLA 1ZYRF 2YV1A 1DRVA 1BI2A 2EFOA 4OIRF 1U3VA 1BMDA 1FXSA 3J7AO 3B1FA 3TO6A 2WYWA 3H65A 4KOAA 2HDCA 2D0IA 3FBTA 1PQUA 1C0WA 2PWZA 3RI3A 1OFGA 2QHXA 2C5AA 1XQ6A 3PHIA 1T24A 3LT2A 4QO8A 4Z3DA 3F46A 2W98A 2QIOA 4FW8A 4KWHA 4N18A 3FXRA 4NFYA 1LEAA 4Q4ZF 2HZTA 4J1SA 2VOPA 3E9NA 1Y8RB 5LBQA 3FF5A 3MWDB 3MOIA 5A03A 3HDQA 1JW9B 5JI6A 2GUGA 3ZWPA 1K6OA 3DZIA 1A4IA 1PQPA 4RVFA 3RKYA 1FDSA 1LNWA 4KYWA 2FNPA 3RUFA 4DVJA 3DOOA 4I9UA 5JCXA 1P31A 1DP7P 2FBIA 2HMSA 2JFGA 1DLJA 5G0UA 4E5KA 5B4TA 4OIQF 1U78A 4HYEA 1ULSA 5JCJD 5A4DA 2VC0A 1J0RA 3FNHA 4YVFA 4RB0A 1O94A 5J6XA 4CO8A 2FMLA 1VPDA 2PD6A 5JS6A 2R7DA 4R8HA 5DD8A 1VC2A 4IY1A 2UV8A 4CLRB 3BDDA 2P5VA 3GOHA 3RC7A 4E2XA 5I9NA 1OZAA 4RDIA 3MEQA 4OGWA 2CVZA 1I01A 1TQIA 1B15A 4AJ2A 4EJ0A 2VYVA 3K1NA 4R54A 5C37A 1U2DA 1YQXA 5DCFA 4UHTA 1FZPB 2L02A 2NQTA 2I9PA 4P9UA 4RZIA 4YDRA 3QQPA 5A1TA 4K6FA 4ZU3A 4DC0A 5L3FA 1R0SA 2B35A 2Q99A 3UUWA 4B7XA 1TT5A 1B14A 3ERED 4J91A 4RPKA 1KIFA 1XDSA 3DFGA 1R23A 1LQUA 5K5RA 4FS3A 3GGOA 1SMTA 2NSDA 5G4LA 4NK4A 4PLHA 1OMOA 3K69A 4BHTA 3H3JA 1OMIA 1UUFA 5FF9A 5BS6A 1T0FA 3JYPA 1ISGA 2XAFA 1O89A 3NEUA 2NU6A 5TNXA 4AJOA 2XAHA 1YO5C 2L3DA 1I3MA 2P5YA 1XD7A 3DONA 3DPLC 3FPLA 4ENJA 1I1GA 4HQMA 3NUGA 3ZMSA 3E6CC 4I98B 3E1KA 4BNJA 2DK8A 2PFGA 3DDNA 3M1AA 3QVSA 4Q48A 1FYKA 1WNTA 3OHSX 4IZHA 4YAEA 2E1CA 2D5CA 5IAAA 3WSWA 1A5ZA 1G3SA 1I8TA 2XXBA 1FOKA 1XU9A 5J8CA 4KNYA 3GX4X 2O7SA 3JTMA 1YWGO 4I08A 1YTYA 4GWGA 4H0EA 2W25A 3D0SA 4NQWA 1ISHA 2FPIA 3QAHA 3TN7A 3KETA 3N97A 3W6ZA 3ZWWA 4BO0A 4A10A 1J5PA 4AJLA 3ABIA 1UXGA 2Q0OA 3IUSA 1TT7A 1S7AA 3D0OA 4FD3A 3Q9UA 2QYOA 1UZNA 2DBZA 1JN0A 3Q6IA 4DPMA 1RYDA 4HX4A 4MEYF 2LDUA 5HS7A 4QX6A 1P1KA 1Y8RA 1ZGJA 2Y1FA 2ZMEB 1NFRA 3CXRA 5F1OA 1JVSA 4QT0A 1PEDA 1IRFA 4Q3NA 3ZNOA 4B3HA 1MXFA 1HSZA 4ALIA 3FM3A 2FSVA 4XQCA 5DYMA 3HSKA 3H3UA 2CVQA 1BDBA 1GYPA 4HFRA 1JWAB 2Z3YA 4FGWA 2DQLA 5E8IA 4N9HA 1J9IA 2AE1A 5FFFA 4D3FA 1BVRA 1D7OA 3V8KA 3I9LA 3I0TA 5G4KB 1AHIA 5BNIA 1EBFA 2NUAA 3FTNA 3KYDB 4Y13A 4ESJA 5ILGA 1BI1A 1T6SA 1T25A 3TZ6A 2X58A 2VZ9A 1AXGA 1U8FO 2JCYA 4NH4A 1U3TA 3GLQA 4J4BA 3WJ7A 2VYND 4CDGA 1IRGA 1CERA 2PZLA 2UDPA 5G0TA 5EEHA 1IOLA 3SQNA 2JFHA 3MAJA 2HFHA 1DIAA 1RPNA 4DPLA 1QG6A 2D45A 3GHYA 4B79A 8ADHA 1XSDA 3PXXA 3OM9A 2QYSA 1EDOA 2EFPA 2VWHA 1U9JA 3CDHA 5EIOA 1IYZA 3GWZA 3Q2KA 3B73A 2QQAA 3FTPA 3FHZA 3DFZA 1KU3A 5DDGA 3RUIA 1T2DA 3ZHZA 3AOEC 3JQAD 2IZ1A 2P5KA 1K6IA 4Z6KA 1RYEA 1UDAA 5IN4A 5BNFA 2CF6A 3MZYA 3PHHA 3OA2A 5JCJA 1DAPA 4ZQHA 4CM9A 1IHXA 3JYOA 2C54A 3SZTA 2H09A 4HV5A 3OJLA 3DHEA 2O8XA 3MJVA 3Q9NA 3C1OA 5FEUA 1KEUA 4R3NA 2P5UA 4GBJA 1U3EM 2L4MA 3ETGA 1YXMA 4XD2A 5JPIA 1IN4A 3RFVA 5TSDA 2ILTA 4Q3CA 1EH6A 1YKFA 3ZMUA 1FBUA 2JRTA 2IDZA 2VZ0A 3H5NA 3LT1A 2Q3EA 3R1IA 3LFKA 1BW9A 3ZPLA 3CTAA 2M45A 1U5TA 3RUAA 4QSMA 2I99A 2OHXA 4YJDA 5KJEA 3WGOA 3ZH2A 1WRJA 1HE5A 3FWEA 2F5FA 1B8VA 2EF1A 1KVSA 1O8CA 2BI7A 3KO8A 4R1NA 3RUEA 5JW6A 3EQLF 5JY1A 4P4NA 2VZ8A 1MLDA 3DHYA 3ADOA 4XRFA 5DOVA 1MP0A 3MJTA 1ZKMA 2Z1MA 1IZ0A 4P96A 4CLOB 1H9GA 1U4OA 4LMYA 2ZTLA 2WEKA 2PY6A 2Q4BA 2X22A 4OXNA 1PIWA 4CM4A 1OKRA 4RF2A 4RGSA 1XGKA 1LLDA 2NTVA 1T26A 4K1LA 1T2AA 2J5KA 1W7PD 1F5TA 4FJ2A 3OP4A 2CQKA 2Y75A 1BC8C 1MGTA 1A7KA 1F06A 1JVBA 1QGPA 9LDTA 1GXPA 4U0VA 3OFSA 1P2FA 4RL6A 4GL4A 5ENDA 1DEHA 1ID1A 4Q5SF 2A61A 1PGNA 1YE3A 2YQ4A 3K1MA 1SOVA 4Y6PA 5H82A 3OOPA 4PVCA 3O3KA 3TDUC 2BV6A 5AIQA 1WZEA 1ZUD1 3ANLA 3E6BA 3G17A 4UREA 4DGSA 5GMOA 5A5FA 3OQ1A 2L4AA 1M6HA 5BSGA 2B4TO 2W2LD 1E1NA 1HDGO 2QX7A 1E3WB 4NR0A 4YQYA 4ZRMA 4KIFA 2OXIA 3BPVA 1DB3A 1XHLA 1EVYA 3EK2A 4RGBA 3EGOA 4BGUA 2WMDA 2AHRA 4H3VA 3IWFA 1ENYA 3QWHA 2M30A 2FWMX 4G81A 4CMEC 4LLGF 5C7OO 4E12A 3GG9A 1V0JA 4H7PA 1REPC 2TMDA 2MD5A 3NRVA 5FFXA 4RB1A 4WCFA 4W7HA 1XSVA 1A71A 4D41A 1E6EA 2W4QA 1E3EA 1VL6A 3PWKA 1O0SA 1WMBA 1IZ1A 3FR7A 3UKOA 3GZ4A 4JBGA 4ZJUA 4IZIA 3F1KA 4BNWA 2V6FA 1ULUA 2GDZA 4WOKA 2BFAA 4M6YA 4LD5A 2F5EA 2EW2A 4B3IA 5I7FA 3F47A 3BHJA 3WIDA 2ZB4A 5B1YA 3RYRA 3GFJA 1ZO8A 3TOZA 4U7WA 2O61A 3F4BA 4MVJM 5IXYA 4L5IA 1LDGA 3FXQA 2ETHA 4YAKA 3LSTA 4G9YA 2IVMA 3T5XA 3JQ9A 3Q2IA 2J5PA 3TZKA 1R4NA 4HDUA 4IINA 4LRTB 4IJWA 5ICSA 1TVEA 2YV2A 1ARZA 4WJZA 4FFLA 4DMMA 4EJ6A 2GA2A 2ACJA 2LKPA 3COSA 5L3ZA 3JQDA 1TB4A 2HK8A 2VE8A 3E6DA 3R60A 4D0PA 1I33A 1YDWA 3U4IA 2CFXA 1QO0D 3M1EA 3KP3A 1Z74A 3KYCA 4UVGA 3PFFA 1Q0QA 3QIVA 2I5PO 3SXPA 4YG2F 1FBQA 4HFJA 1F12A 3SJ7A 1BC7C 3NT5A 1R00A 1S7CA 3T8RA 2J8ZA 3V7RA 4YJFB 5B12A 5CEJA 4BNCA 3TOBA 1GV0A 2C82A 2P4HX 3HQ4O 2A69F 2EIHA 5HDKA 1EV7A 2YR2A 5JAQA 3UVEA 4WK6A 2C20A 3GGGA 3X2FA 4AFNA 1QORA 3SX2A 3T4EA 2IYOA 4E13A 2VXZA 3QLJA 4JROA 4XRGA 5U9CA 1BI3A 2ZQZA 1LBEA 1C0KA 3PDJA 3PJDA 4NFHA 1X7DA 3F8CA 3RI4A 3QVTA 5T67A 3LF2A 2X0IA 3TL2A 3KSZO 3KLMX 5D8LB 1LEBA 2O7QA 1TA4A 2YJZA 3H9JA 3JD1A 4PVDA 1H6BA 4Q3AA 4PGHA 2RIRA 3RKUA 1QP8A 2ZKZA 1Z82A 3K30A 5THKA 3CZRA 1Z91A 4A27A 4XLPF 3J80K 1SB8A 3JD3A 2VNAA 1DO8A 4J7UA 4MVJG 2EFQA 4BQPA 4D7AA 1J59A 1X0VA 2Q46A 2ISYA 3WX0A 4DL9A 1N5DA 3OEWA 4MINA 2NVUA 4IXTA 5ITWA 2DW4A 2C59A 5K5OA 2DBBA 1NPYA 3COAC 2X0NA 3I5MA 4IDCA 4EMSA 5MDHA 2NTNA 3FHLA 1O5IA 2W2KA 4I9NA 3WIEA 4EDFA 3A06A 5CFZA 1Y1PA 2POQX 2HYFA 4JGBA 3GF4A 3WLFA 3NEPX 5KVVA 1B3RA 1SEPA 2C2XA 5GZ1A 4UVBA 5ED4A 1W7PA 2AXLA 1H9BA 1ZK4A 2A3SA 4IJAA 1TXGA 4DUPA 3PGXA 1KEWA 2OBPA 1QYCA 2HQ1A 2JFFA 3BPXA 1DHTA 3PP8A 3AOEA 4CXFA 1K7AA 3QWFA 4CLEA 3T4XA 1PQWA 4RPGA 4BNYA 1C1XB 2Z5UA 2P9CA 3BTOA 3E03A 5BQFA 2ESHA 3L4BC 2Z33A 5FFZA 1JKIA 5J8FA 1E3JA 3JQCA 4CM8B 5DCWA 2BGKA 5KVSA 1GVJA 1HQCA 5TT1A 5LRSA 5KKAA 1EVJA 2JL1A 3ZN0A 3LWFA 4DBZA 1K2WA 4YT4A 2PKQP 3BXXA 2DPDA 4IDBA 4IDDA 4YACA 4BO8A 2BGMA 4A12A 1PZHA 1K79A 4UULA 3GG2A 1Q7CA 4GMGA 4WCFB 2FA5A 1LA2A 1MZBA 2QVOA 2EFWA 1DOHA 2V1DA 2VE9A 1Y8QB 4MNUA 4GGOA 4QFCA 3M1LA 4R1UA 1FLIA 4BIIA 4CQMB 2WD8A 1WQ2A 3PWZA 4MHGA 4JXKA 4QO7A 3QSGA 4NJMA 3I52A 1ZZEA 2GZ1A 4ZQFA 2VCYA 5KVQA 1TEHA 3NDIA 2D3TA 3K73O 1H93A 2R7FA 5F3RA 4OXKA 4NBWA 1HKUA 4BB6A 2Q45A 4IMRA 2X4GA 1U28A 1NQTA 3LQQA 2GPTA 5EQDA 5A02A 4KTVE 1MDMB 1GZ4A 4GX1A 4L76A 3GUDA 4EGZA 3EYWA 3BMNA 5D4SA 1VL0A 4M6XA 1KEPA 5EN4A 1YQAA 5D5XB 3E5MA 4JP3A 1QYXA 3RJ9A 4EM2A 1A9ZA 2GN4A 3LK7A 2V9VA 4UUOA 3GGPA 1HXDA 3QA9A 1R7JA 4XQ9A 4J4TA 1NVGA 4B4VA 4HUJA 4Z0PA 1Z05A 3U2RA 3WGYA 3MJ4A 2PMUA 4LJZF 1X14A 3R0IA 4E0BA 1R4MA 4M74A 4M73A 1WDMA 1ZH5A 1V4RA 2RGVA 5H6RA 2GN8A 1LDNA 2NU7A 2VUTA 5T6BA 4CQLB 1YRLA 1R1TA 4ALKA 4ND3A 4LRSB 1O3QA 4WLUA 3TZHA 2A68F 4Q39A 2CF5A 2HJSA 1F8FA 2DAPA 2EKLA 3AY3A 3SC6A 1E3IA 1O6ZA 2P6SA 5ICFA 4JLWA 4XGKA 1E1MA 1JDJA 5L3EA 1ZLJA 3EUHA 4IJVA 2Y68A 1SO8A 3C7AA 3WGHA 1YVEI 5DCUA 3NKLA 1HZZA 1ORRA 4OIOF 4OSPA 3MOGA 2JJYA 1PJBA 2DT5A 3EZYA 1XMAA 2FRHA 3V5NA 4Z9YA 3GMDA 4RQTA 4NBUA 1TLHB 1YG2A 4ETSA 3CPSA 3H9QA 2ZJ2A 1X7HA 4EUFA 1X3UA 5JO9A 4HF1A 1JWBB 1EE2A 2PV7A 2DPHA 2G1UA 2X23A 2PJPA 1PP8F 4DMLA 2VBXA 3FWNA 3LF1A 4CYDA 2GR9A 4RB2C 2BD0A 3RBXA 3RFXA 3VH4A 3ZDFA 2VRBA 1IW7F 2O23A 3LSYA 4F7ZA 3IP3A 4NBTA 2BEOA 2DPUA 4HKTA 3EMKA 3O4RA 2K4BA 1AXEA 2Z1NA 3FX3A 4OYRA 2VYVD 3E6AA 4LLLA 2VBYA 5G0VA 2STWA 2HTSA 4EJVA 4RF5A 5C7LO 1W8DA 2PD3A 3DFUA 4WLNA 2XVCA 2X0LA 4OOEA 2EGGA 3U5TA 1DBVO 1P0FA 3QP9A 1IN5A 1SAXA 3QY9A 1YB1A 3UAGA 1E7SA 2OL4A 3QV1A 1D8AA 1C1XA 1U5AA 1ZAOA 2V1XA 3E9MA 1SEVA 1QLHA 4KMSA 5COBA 1MJAA 2X5OA 5F21A 3ZI0A 2JCXA 4CQLA 1YOVA 4M71A 2YFQA 1KQ9A 1LRJA 2E4AA 2ZQYA 5IXSA 4FOOA 3C7JA 4I0AA 3NT2A 3QWAA 4MKXA 3FMQA 2HEOA 4CL3A 3C3WA 1XDWA 4CMJA 5LHIA 4BNHA 2ZNYA 1XB4A 1DUXC 3ROMA 2NV6A 2DU9A 3WFIA 1A4UA 4BO2A 4YYZA 1BJAA 1EMDA 3ANMA 3AUUA 3ZCXA 2I3GA 3F8MA 5LGNA 1E7YA 3BZ6A 3F72A 2X9GA 2VNSA 1ZW1A 3BMNB 1ULYA 3GFMA 1L0OC 1FYLA 4G7OF 4YXFA 4CR6A 1IY8A 2VHZA 2VRCD 4R1SA 4W7IA 5LEJA 5CAEA 1U8XX 2E37A 2GSDA 1ZMTA 2WM3A 3QU6A 4J2HA 3ULKA 1J0XO 3JD0A 4J16A 1NPDA 3OH8A 4QQRA 4F6LA 2PG4A 1VJ0A 2C2YA 2FR8A 1USTA 3ENKA 1C0PA 4GLLA 3LLVA 1KS9A 3C1TA 1WZIA 3DZFA 3CUKA 2R00A 4M86A 3KLOA 1QKIA 3ZN2A 1HYEA 4LLNA 1KETA 2OUIA 2HS5A 2CFCA 4E33A 4MDHA 4XR4A 1FNNA 2NAZA 4KIBA 1DPUA 5ILUA 3MFKA 4OOFA 3BY6A 1BI0A 3HFGA 3SEFA 3SJUA 3DB2A 1W5SA 5E1WA 3CZMA 3UF0A 2BRUA 1PSDA 3Q1LA 1HL3A 1KYQA 4BNVA 1XQ1A 1R12A 1P1RA 3HUDA 4U8GA 3OQ6A 4UV9A 5AVOA 2ZB7A 3AU9A 4UVDA 2BFPA 4XQEA 5BSFA 1PJ4A 3T8TA 3PHLA 3HRMA 2PD4A 1UP6A 1EDZA 3GNTA 3V4GA 1EUZA 2FSSA 2B4QA 3U62A 1H0KA 4M8SA 4AIHA 2IPQX 1VKNA 4ZHSA 4NBRA 4I8XA 2H6BA 1H94A 4CICA 2PK3A 1R58A 1IXRC 4ALLA 5GZ6A 2VWPA 2HGCA 1HBXG 1IHYA 2EGHA 1FDVA 1KY5A 2XOXA 4PG5A 3QP6A 5BT9A 1HDXA 2FN7A 2EP7A 3RPUA 3B70A 4BQRA 3C1AA 3D64A 3H9EO 2DPGA 4WLEA 4XKJA 3TWOA 1XGNA 2NVWA 1N2SA 4EUEA 2O3FA 3L77A 4RVUA 5KVRA 2D5AA 1GV1A 1JQBA 4IDGA 3ZU3A 2ZJ1A 3UGKA 4M72A 1RKXA 2VOJA 4P55A 3F6VA 3P9KA 1W73A 3I6QA 3IUPA 2WWYA 4FCCA 1R1VA 3I71A 5COQA 3VVBA 1LJ9A 4I02A 5KK1A 1R0KA 5IF3A 2OFPA 4IS2A 4MPDA 1LC0A 4XGIA 3VDRA 1HDOA 1EK5A 3RDIA 2WD7A 4Z2YA 1UH5A 2YPRA 1YB4A 5L7WA 4IRHA 2IEDA 2ZKLA 2CD9A 3HSRA 1I2CA 1KY4A 3BYZA 4JBHA 4YT5A 3VZQA 3R0AA 3ZNNA 3V8LA 1GCOA 4GWKA 2PZMA 3F8BA 5TF4A 3KP7A 3WDSA 1E7WA 2A6EF 1LX6A 1YJQA 1PP7U 2LDBA 5CVJA 4NZ9A 5ENVA 4WEQA 5BMZA 2CW0F 4IQ8A 3WYBA 1NBOA 2HCTA 3FF4A 2JCVA 4B7UA 4RAZA 3PZRA 4HNHA 1JLLA 2PR2A 2PTGA 2Q1TA 2LSOA 4XDYA 1WMAA 2QRJA 4BMNA 4IDFA 5E1ZB 2M5WA 4Y6RA 3ADPA 3HHGA 1ZGAA 3PQJA 3IRRA 1ISMA 3HSEA 3DPTA 1WDLA 2ZATA 4PRLA 2P7CB 3RPQA 2P5LC 2X5KO 2O6GE 2QG4A 3PK0A 2CNBA 5LHHA 2IXBA 1IXSB 1K89A 5JDIC 3G73A 1WLYA 5CVRA 4JJGA 3W6UA 1T1SA 4DLLA 9LDBA 5K9ZA 1ZG1A 3GHHA 7MDHA 2P4WA 4OH1A 1TNTA 3ZWAA 4WWCA 3KP4A 1P1IA 1R1UA 1YH3A 2EV5A 3SLKA 2ZXJA 3X2EA 2HKOA 3JSAA 1U2WA 3KV3O 4RVHA 3U4HA 1UCRA 2R3SA 2RCYA 4YR9A 4XLNF 1VSVA 1DC6A 1G3YA 3RBVA 2Y1CA 2FF4A 1D1TA 2KJBA 3WBBA 2L01A 4BQAA 3NGXA 3V2UA 4MQ9F 2WWRA 1DPRA 5K0ZA 5EQFA 2J3HA 4RGUA 3V1UA 2DFDA 4EM0B 1ZARA 1ZK0A 1LLUA 3DZBA 3GUYA 4DXHA 3ON5A 4CMBA 1ONNA 4N5NA 2EERA 4D45A 1E6WA 1G3TA 1YOVB 1HSTA 3TF5A 3EY4A 4D44A 1Z6RA 3P5SA 4NJOA 1LC3A 3U9LA 4CUZA 5FI5A 1V3FA 3TGNA 1NTOA 5ICMA 4PGFA 1I2BA 3TZCA 2JD2A 1E92A 2XAGA 2FR1A 1NAIA 4RLHA 4YJHA 1R15A 2O3SA 1EZ4A 2IRWA 5E17F 4CODB 4FR5A 4CMEA 1LDKB 1B3BA 1QZZA 2H9IA 3R6DA 4Z0HO 1Y0UA 1G0NA 4GGPA 4OL9A 3WE2A 4YFKF 2O3JA 3EVNA 5J23A 2E82A 3JQ8A 2W90A 4FJ1A 3VC7A 1EUCA 4OIMA 1OPCA 5ERIA 3IC5A 4LCEA 3L2CA 5CEFA 2P6TA 4TV7A 3MWMA 3M9AA 4FFOA 4R4JA 2O50A 3HOTA 2E1NA 3J80Z 1V6AA 1YO6A 2C5EA 1BXKA 4YAJA 5JDCA 1ISIA 1O3TA 4ONEA 2IJLA 2ET6A 4BO6A 1YYVA 2B37A 2EJRA 4QWQA 1CETA 3HZZA 2ZTMA 3ECHA 4TRNA 2MH2A 1U1IA 3U4CA 4D0RA 2MH9A 1EK6A 1FP2A 2VUSA 2DTDA 4BO5A 1RWBA 3PI7A 1P33A 3I6IA 1Z7UA 1WWXA 3MJEA 1OI7A 4R5HA 3V7SA 2CGPA 4HF2A 2M87A 1SMKA 4CM8A 3E5UA 1P45A 3U9GA 1WPQA 1PDNC 4YBZA 1XGSA 3ZGYA 4R5MA 2HAEA 4WLOA 2RHCA 4UUVA 3GFIA 2HMUA 2WTBA 1ZJZA 1I5RA 1LQ1A 3OJ0A 4K9DA 1R4MB 1YS4A 4ZQBA 3H5AA 2NU8A 1JAXA 1ADGA 3DQPA 3GRKA 1ZSVA 3ZQ7A 5TIIA 3DZHA 3LC7O 1W5TA 2EWNA 3H5RA 1N1GA 3BJOA 1B8PA 3HRTA 3OV8A 1EQ2A 4R1TA 2DQRA 3ICCA 3K96A 3U0BA 5L40A 5DBGA 5I9MA 1C3VA 1ENPA 1U5TC 3TOXA 3H9GA 1ZG3A 4ZQGA 3KHUA 3STHA 1LSUA 2YX4A 4I2OA 1KU7A 2YFHA 3HDJA 4G7ZF 2VN8A 4M1QA 1MKMA 1LDYA 5E20A 2JHFA 1IZ9A 3QWIA 1B2LA 1H9TA 2ZO4A 2NWQA 2QM3A 3I3OA 4ESBA 2Y0DA 3AM5A 3KE2A 2TMGA 4CUJA 1DFIA 1IB6A 2FOIA 2EKPA 5CVUA 4KUEA 3DBLA 4MP3A 4OQZA 4YRBA 2O03A 3K6JA 2OBNA 3MZ0A 1E7MA 4G65A 1SMYF 1Z73A 5B37A 1LJ8A 3ANNA 4U0YA 3T0YA 1GXQA 5JVTA 3WFJA 4GPD1 1IL0A 4P4GA 1JXSA 1SC6A 2YYYA 5EESA 2DLDA 4CR8A 5ITVA 2FMUA 1QQIA 1DJNA 4TRMA 4OIPF 1I5ZA 2HR3A 1S6YA 1Z7BA 3F5SA 2BGCA 2CG4A 1S8NA 1Z6TA 4JK3A 1YDEA 2DLLA 1ZXLA 1OOEA 1OR7A 2I65A 4UUPA 3LLSA 3ZWVA 3M7GA 4BL5A 4L74A 2VT3A 1IN7A 4P9FA 1BG6A 1P74A 3FPCA 5K5QA 2I76A 3ITDA 1RZ4A 1E7QA 1GQ2A 4XYLA 1N9GA 5KJFA 1GTMA 1VSUA 4UVHA 3JTHA 2RV8A 4B4OA 1KBZA 2O0YA 2IW5A 2J3JA 2G76A 3W6JB 2HQNA 4O6JA 5HS6A 2Y1GA 4A5OA 1C1DA 2PGDA 5HTOA 1FP1D 3HG7A 3V2HA 5KIAA 5JAIA 2H6CA 2Q1SA 1U8RA 2KIFA 2VN2A 5ES3A 2QQBA 4JNKA 2HKIA 3GC6A 5T8KC 1FDUA 4ENKA 1NQ5A 1IN6A 1N92A 2I3AA 2OP0A 3RU9A 4RPJA 4OU0A 2ZB8A 2WDZA 3VHRA 1T2FA 1I24A 1BTOA 2HK9A 4CV0A 4FB5A 3A1NA 4IXWA 2ZNZA 4L8VA 4HZFA 3WTVC 4LCJA 1AUPA 4P4LA 2Y48A 4E5YA 1I27A 3O38A 4H15A 2XGXA 2Z95A 2JD1A 5CYVA 3WTUC 1B16A 1KU2A 3Q11A 4B4UA 1XU7A 2DTRA 1B6AA 2DBQA 5I7VA 4WPGA 1G1AA 2HJRA 4YIIA 2PLAA 3DZGA 2YZ7A 4FSHA 4II3A 2D2WA 1HRDA 4O63O 3WNQA 3D4OA 4MVJD 2VHWA 2Q1UA 3HN7A 1NAHA 4TKLA 4EGYA 1ONOA 3WMWA 4TMFA 1J49A 1DIRA 3ZN1A 1P9LA 3WWYA 2FE3A 5HS9A 2CDBA 1IXCA 3NGLA 2F00A 4ZVVA 4HV4A 1LLCA 2H27A 3P2OA 1H9AA 3CLOA 2YU3A 5TJJA 1PR3A 1XELA 4RVGA 3K9TA 1GUFA 5DN9A 1NHGA 5ILSA 2VTDA 3GNSA 3HUGA 4HFMA 4HNGA 4P8RA 1T2CA 5FLXK 2DUWA 5ADHA 4N54A 4OKNA 3BOQA 3OSUA 3QVXA 3P9CA 3S55A 3JAMZ 1VTNC 3RJPA 4EZBA 2Q2QA 2RAFA 4R41A 5IZ4A 3EYYA 4K2EA 4S05A 1I3KA 3N74A 2I66A 4EGFA 1C0LA 4IHSA 1QRRA 5DUIA 2YDYA 3KBOA 4BKPA 3MCVA 1GCUA 3NQOA 4LG0A 3FZVA 4MVJH 2WE7A 3VH2A 1KA8A 3WQQA 1S29A 5TC4A 4BKRA 5AYVA 1KEVA 4NHEA 2VWGA 4RVSA 4WCFC 3I64A 4GLOA 5CG1A 1XKQA 2AEFA 2R6JA 4Y8VA 4JJFA 4YT8A 3FMSA 3U4DA 5ICEA 2CDAA 3JQAA 1ZK1A 4HX5A 4BB5A 2HUNA 3KYDA 3FM5A 3GMSA 4KDEA 2EK5A 3OF2A 1C0IA 4BNMA 4R9RA 3O8QA 2Y99A 4DLBA 3AU8A 3CKYA 4RGXA 1LSJA 3JQ7A 4UXNA 3IWZA 3IRQA 4XSXF 5KVCA 4M55A 1W6UA 3QVWA 5ICCA 1G3WA 3C24A 3RUDA 3ZV4A 2G17A 1PGOA 2FQ3A 3VPXA 2AMFA 4BKUA 2ZYGA 3GEDA 3WTCA 1DLIA 1ZBQA 3AM3A 2PA3A 4YJHB 4AL4A 4G94A 4YFXF 3PHJA 3VTZA 3AK4A 4URFA 2EV6A 3ONFA 3L00A 3GPIA 1CGPA 4ZYHA 2JTVA 5JC8A 4BH9A 3HHHA 2O3UA 1UB9A 4PLVA 1GL3A 4ZYEA 4E5MA 1G0OA 2VRCA 3JQBA 3PYMA 5IT3A 5LHGA 4A26A 1NPTO 5FGMA 2P2SA 3GXOA 4EEXA 3JYNA 5D8KB 2BMAA 4I0BA 1XG5A 1XCVA 4LG0B 4FFNA 4M89A 1B59A 4UEJA 5CHEA 2JHGA 2O4CA 2X9NA 4K6CA 4E3ZA 2ZB3A 3CMCO 3K9QO 3DKWA 4PZCA 4DQVA 1R5GA 1UP4A 3DOJA 5JNLA 4QXMA 2UXXA 3M8EA 2WD7B 5CDSA 1BGVA 3RIHA 3KOUA 2M1BA 4PCQA 2Z99A 1QLJA 4II2A 5COAA 5IDWA 3LU1A 3BWGA 1D1SA 2JAHA 1DIHA 5A3VA 1PS8A 2GZWA 3AWDA 3V8BA 5JYDA 2BH9A 4E2YA 4HXYA 3VH1A 5HS4A 4DRYA 1Z7EA 1NR1A 2ZK7A 2AW5A 4HW0A 5EEGA 4RB3C 2W2KB 4OSOA 3BMCA 3LT4A 4FFPA 2FOKA 3DO5A 4TVOA 4N0BA 3AI1A 5G0SA 4I9HA 2W2LA 3KTDA 4L0ZB 2D8AA 2P68A 3KLPX 4NIMA 3ICPA 4BO3A 2NRAC 3GZNB 1HDYA 1BN5A 1WP4A 1NVTA 2OQRA 2IODA 4QTZA 1OAAA 3JD4A 4ZQEA 5LDGA 4KUHA 5A04A 5I8ZA 3C7CB 1SAYA 2CYYA 3D3WB 3PYLA 4ZH4F 4XZ3A 3S8MA 1ZK3A 1QSGA 5CPFA 5LGTA 4GCVA 4NBVA 4UUNA 4GXOA 1J4AA 1ZH8A 4FBGA 1CQJA 2JPCA 3NTRA 1QZYA 2HMVA 2A35A 3BHMA 1WW8A 1TLTA 2JAPA 4ZICA 5G2OA 3RKXA 1FMCA 3E97A 4FX4A 3L6OO 4NMHA 3GW2A 3GVXA 2QRLA 1F14A 1E5LA 4FHTA 3K92A 4PG8A 2O3TA 2XAQA 1PJQA 5DEQA 4CR7A 2VT2A 5DBIA 3FR8A 4BNXA 4B7CA 5HOOA 3G1TA 1F0YA 3GUCA 2GASA 4MVJA 1R0LA 4RORA 4EJOA 1E2XA 2WE8A 3O2PE 3FXUA 3ROUA 4IDAA 2OO5A 3AI2A 3OETA 3OJFA 4W99A 1YJ8A 5A5EA 2EKQA 1Q0HA 1KVTA 5A9TA 1ISJA 2C7VA 2CSUA 3NRCA 1V3VA 1Z45A 3KSDO 4E5PA 4YAIA 3J81Z 4MEXF 1P6RA 2B0JA 4TSKA 1JU9A 4GYIA 4B4WA 3AFNA 3RROA 3ZU4A 1U7TA 3SLGA 4MOWA 4HF0A 2PKQO 1KQ0A 2KKOA 1YBAA 2Y05A 1DJQA 2HMWA 1Z75A 3PTZA 5JC1A 4GH5A 3LAPA 4L75A 1YL5A 3CINA 3REOA 1T38A 3KRTA 1Y8QA 4XCVA 3DBVO 5L4LA 1XDUA 4CV1A 1S6LA 4EJMA 1ENOA 4Z9FA 3UHAA 1UHMA 4W9NA 4PIVA 4RPLA 3D5LA 3RFTA 2B83A 2UZKA 4CMIA 5K1YA 4A0ZA 3H7AA 4CUKA 2KIMA 3GVHA 1SCUA 1PS0A 4DIOA 4EVIA 1DRWA 1QXSA 2DBVO 3DOCA 2C7GA 4UEOA 2GN6A 4EYEA 3ZNPA 4CLDA 3ZV5A 1NQAO 5IJZA 3TSCA 3PIDA 3ENNA 3QRWA 2WV0A 3CUQA 3TO9A 3DEYX 4LVUA 2AXQA 2HU2A 3KYCB 4OAQA 3U3XA 2FNAA 2IXAA 4IS3A 1E3WA 4L4RA 4DYDA 1XA0A 1HDCA 3JQFC 1MG0A 5CVIA 4A5MA 1SD4A 3DTYA 1DRUA 3PHGA 4UVCA 3WLEA 1Q7BA 4XBFA 3UW3A 2XKPA 3TOAA 3MTJA 3AUAA 5L3GA 2BFOA 1D3YA 2EP5A 4R9SA 4XYGA 2NQ8A 3IMFA 4XYEA 3QVOA 5BOXA 1M76A 1QBJA 2NM0A 2Y66A 3K5PA 5L45A 3LQFA 2NS0A 1M75A 1TT5B 1MD0A 5LRRA 3L07A 5KCZA 2G7UA 1TTYA 2ESNA 3W4KA 4D3SA 3S2EA 1PZFA 3N7UA 2Y1OA 2AQ8A 2Q8KA 2ZBKA 3K8ZA 1GADO 1Q1NA 5MGBA 4BYYA 2K86A 3M6IA 1M6WA 3D1LA 2HKXA 2YV3A 1Y5MA 3HNPA 5AXBA 1ZG5A 5DV5A 3BA1A 5FYDA 1DDNA 3DXJF 2LNBA 3F9IA 1UXKA 2ZJ0A 1I32A 3ETDA 3MEXA 1K78A 2YSRA 3VOEA 4PG4A 1V8BA 4R01A 1N1EA 4R79A 4KN7X 4AIJA 4RS8A 2V65A 1MJ9A 1YW9A 1D8JA 1NHWA 3ZW9A 3GFLA 4IPTA 2MLGA 3OEYA 1G4DA 3P9IA 1SOWA 5KNLA 4YRAA 5DZSA 1PJLA 2VWQA 5DOZA 1F9NA 1BVUA 5A9SA 1CIVA 3M2TA 2PGJA 2EB7A 4U0KA 1M2WA 3KUXA 3HFSA 1SBYA 3WB9A 2AG5A 5BPIA 4WXCA 2NLOA 4HY3A 2W57A 3KLNA 1A7AA 3PVZA 5ILVA 2GN9A 4XA8A 1YL6A 2GZ3A 2J3IA 3C7DB 3IJRA 3S2IA 4DIFA 5JO0A 3V2GA 4IQ0A 1H6DA 3INGA 5LDHA 4EJTA 1ZHFA 1MFPA 3TJRA 5I8WA 3A14A 3Q9VA 4MVJE 4PN3A 2VC1A 5HLGA 3EZLA 1GZ3A 1QV7A 4OXYA 1VL8A 3FRJA 2HO5A 5IFLA 5JFRA 2O48X 1E5QA 1LRLA 3HOSA 3JQFA 4GI2A 5L7YA 3BMOA 5A9RA 3OIDA 1UFMA 3BP8A 4XR9A 1PX0A 2GO1A 3W4IA 3L7WA 3H92A 2VBWA 2TDXA 2Y0MA 4LFUA 3CO7C 3BTSA 3W6KB 2JD0A 1U2GA 3ZU5A 3FSRA 3G49A 3B1KA 4RPHA 4DYVA 3DP7A 3E18A 1ENZA 3DBHA 2GXBA 4YT2A 2QLZA 3I9JA 2XASA 2AQHA 2G5CA 1HKTA 3JTGA 1KC1A 1D8KA 4OO3A 4LGVA 4YFNF 1DC3A 3SBOA 4OMYA 1EBUA 1H2HA 3RVDA 3K0LA 3GYHX 2HSDA 4HFNA 3H2SA 1D5VA 4IDEA 2PI0A 2E6UX 2GERA 4IRGA 5D6FA 1U3WA 1B7GO 2YQ5A 4GVXA 3VZRA 2GWRA 4BMVA 3IS3A 5KOIA 4NI5A 2R2GA 3RYPA 1P1HA 3ZHXA 2WJPA 4HOBA 4RO0A 3VZSA 4NU5A 5G4KA 3KFWX 3CIFA 1B26A 5TRTA 4TVBA 3VOSA 3I54A 2PMHA 3F22A 2HK7A 3ETEA 1L3LA 4O59O 5HWSA 1XGMA 1I3LA 1HEUA 3TFOA 1W7PB 4WK8F 1GEGA 1GQQA 2A4KA 1HE3A 4LSMA 1N7HA 4MIYA 5EERA 5I7SA 4AJNA 3H4VA 3KYBA 1U5CA 3EW7A 3KSUA 1I1SA 3BMQB 4BO1A 3ZMDA 3E5XA 3BMCB 2E7WA 1JHHA 5AXDA 1MXHA 2V6CA 1F17A 5H6QA 2IA0A 1Y9EA 2E48A 1YB5A 4UAGA 2WYVA 4HADA 3DR3A 1HXHA 4L5JA 1CRWG 2OAZA 3JQ6A 4MO2A 3NAQA 3ASUA 1LXCA 4EITA 1FY7A 2NNLD 1HZJA 3DMTC 3KCCA 4KICA 4KQXA 3JQGB 5A9SB 1HLPA 5TGDA 2E7XA 2OORA 4CM6A 2X0JA 1UJMA 3E48A 1P0CA 4CLXA 2RDPA 4WECA 5E8GA 2PFBA 3WGIA 1A9YA 3RIRA 1N8KA 3LA2A 2J6IA 3GEMA 4R51A 5IZCC 1QPMA 1Z6ZA 3GDFA 3ST7A 3GVPA 4A0SA 2STTA 4CLOA 4PLFA 4BHBA 1LB2A 5L53A 2HYGD 1E7RA 1Q7GA 5C3MA 1DFHA 2UXNA 4A6EA 5FWNA 4XRRA 2FBKA 3OICA 1ADFA 1R6DA 1XGOA 3BMOB 1DIBA 3PLRA 2W85A 2K27A 4OM8A 1ZREA 2EA4A 5KTKA 5DCMB 4F3YA 2G9WA 2RVCA 1R22A 3G3ZA 3ISPA 1SNYA 4IUYA 3VPFA 1GYQA 3GDGA 2EFNA 1A27A 2BELA 4BUCA 1TW2A 4Q47A 1L7DA 1OC2A 1P1JA 2Q49A 1OYYA 3UCFA 3WU0A 3TKYA 3PGJA 3IAHA 3UICA 2BGLA 4DQXA 2C29D 2QW8A 2D4AA 3OBBA 3MJSA 1RJWA 3ZWCA 3JW4A 4ENNA 2QBYB 1NP3A 2DTXA 3ZWXA 4L18B 1BRMA 2D1HA 4NFSA 2ZTUA 3HJAA 1B1BA 4KUGA 1QNTA 4ESOA 3LC2O 2VOEA 1BBYA 2AE2A 2OP1A 4PRKA 1V3TA 4L9VA 4AG3A 3H9UA 1HTBA 3IKTA 1W0CA 4D3DA 4S1VA 1HSOA 3JQ9C 2I67A 5F64A 2WSBA 1VM6A 2DM6A 2Q4EA 3LYLA 5CDTA 3KZVA 3VDQA 4GYGA 4ZN6A 3K2EA 3PDUA 2J5QA 3WGGA 1LRKA 3L6EA 4PLWA 5CDYA 4XB2A 5BQTA 3LC1O 4TROA 2JSCA 3F8NA 1CF7A 4J9UE 4L4SA 1NWHA 5KJ1A 2V79A 4MP8A 4TRJA 4YJFA 5IDYA 5DD4A 4FC6A 4E31A 1UP7A 1WI9A 4A2UA 5TS3A 2X4HA 3I53A 3TPCA 5F5LA 4DQUA 4E4YA 3TO7A 2NYXA 1PGQA 4BNIA 2GQQA 1KOLA 5F5NA 3I4FA 1Q2XA 5AIPA 3GDOA 2X8LA 3EDMA 4PZEA 4OMUA 1P92A 1QR6A 5JE8A 5GZ3A 3SZPA 1FBSA 4LW8A 5JAMA 3GVAA 2ELHA 3R61A 1YGYA 1EFKA 1X1TA 2W84A 3UFXA 2HWVA 3AOGA 4BNLA 3TDKA 4U7BA 4UEKA 1PL6A 1ZFNA 1VE9A 2AEMA 5BSEA 2P7VB 4EM1A 1MG5A 2BBYA 3SXYA 3GF2A 4FT8A 5E1XA 5G0WA 4LMPA 3L4SO 5LCXA 4AJHA 4IVNA 3DAGA 3DBRB 4J49A 1GD1O 1CYDA 2PZKA 4U0WA 3RC1A 3GFBA 3CUOA 3TRIA 4D79A 4E2ZA 1FPQA 4KIGA 1AN9A 1GQYA 2VHYA 1SB9A 1ZEMA 5E18F 4R69A 3NDJA 4P38A 3ZMVA 1X0XA 2QQ9A 1XIVA 4W9NC 4B09A 4ND5A 5TJ9A 2GRAA 4AJJA 7ADHA 1I6XA 3D5QA 4ZRNA 2B69A 4AJEA 2GNAA 2C07A 4MTDA 2ZTVA 3DAFA 1ONPA 4XX0A 4B8ZA 3QOPA 3MZHA 1E17A 3CMMA 3R3SA 4MVJI 4PLGA 5DP2A 2EW8A 4BV8A 4NB5A 3MWEB 4I5FA 3VKVA 4J3FA 5JR3A 1RM4A 2AQKA 2DAOA 4LK3A 4CM5A 5L51A 1BM9A 4ZYGA 4M49A 4LVCA 4OJNA 5I9LA 3ZWNA 4GGGA 2K02A 2FR0A 3ROKA 2KIUA 1TW3A 1Y5RA 3UCXA 3PJEA 1A04A 1SD7A 4R1HA 1BXZA 4HA8A 2AEJA 2X1HA 3GAFA 3GZNA 3T7CA 4D42A 3IHUA 2NACA 1U7HA 2O2YA 2J3KA 4J1TA 1MA0A 2D2IA 3WTWC 4MKZA 3EVTA 3DBRA 3L09A 3U49A 4AJ4A 1YS7A 3K2ZA 2QENA 4U88A 2OU2A 3FWZA 1XCBA 2IRFG 3M2PA 4PCVA 1HKQA 3P7NA 5L3CA 1IUKA 2ZIZA 4E2WA 4HAMA 4KZPA 1HYGA 3RQSA 1MV8A 1UAGA 4BVAA 2XROA 2NVUB 3RJ5A 2QZZA 4PLYA 3I9NA 2DBRA 4AIKA 2X5JO 4XDZA 2D1VA 1BSVA 3L6DA 2GD1O 1PTJA 4WOJA 4BMSA 5ILOA 4YJGB 1JAYA 3HSFA 3NDRA 4GKBA 4ZGWA 3HWRA 3E5RA 3PEFA 3ABUA 1LVAA 1FYMA 1P77A 3OIGA 1DHRA 1WDKA 3C8MA 4JIGA 1B4AA 2W8ZA 4HLXA 5GY7A 4QFDA 2VYNA 4C7KA 1KGSA 4GQAA 4HBGA 1CJCA 3KP2A 4KN4X 4KT5C 1NR7A 1T2EA 2CMDA 3I59B 3RC9A 4I1IA 1HT0A 1CF2O 2ZCWA 1B9MA 2AA3A 2A92A 2UUOA 3AM4A 3W8EA 4BKOA 1RM5A 4H16A 4XGNA 5H20A 4Y6SA 3ZU2A 4A2CA 3GZ6A 3RWBA 5TX7A 1Q0LA 4X54A 3VPGA 4DA9A 5JYEA 3S1LA 1BW9B 1FJHA 3OIFA 3DEUA 1NM5A 4GMFA 4E30A 3NYWA 4ZZDA 5DDIP 1PS9A 3LA3A 3AUSA 3RC2A 3AI3A 3UXYA 4L0YB 3O9ZA 4MGRA 4KQWA 4O5OA 2F1KA 1MUUA 1W4ZA 2CZCA 2OOSA 4XJSA 2DVMA 2B5VA 4E5NA 4ILKA 3E3VA 5DNAA 3C85A 3GT0A 5HDNA 4MIOA 3RSHA 2FSWA 1LDEA 3R3JA 1H6CA 4DREA 1IUYA 2AG8A 4HX7A 2CDCA 2OGUA 3SHFA 5EL0A 3GN1A 1DC5A 1XEAA 2O3QA 3O03A 5TLSA 1J5YA 3ASVA 2QZ8A 2VONA 4J0FA 4C4OA 3LAJA 1RIOH 1T1RA 2V6BA 1KYZA 1G6KA 5EJ2A 2QQ5A 4BV9A 1NHAA 1Y81A 3C18A 3DC2A 1T39A 5KJCA 3BTVA 4S3MA 2C6YA 3DZJA 3AJRA 4RF3A 4GO1A 1KU9A 4BNFA 4AJKA 3GPDG 2YHUA 1GUYA 1NXQA 4CM4B 3ECOA 4TQGA 5CDUA 3OA0A 3LQRA 2VBZA 2CSOA 1P3DA 3GAZA 4KFCA 1PWXA 1LU9A 2YHIB 1IE3A 4Q3DA 3TL3A 4L9TA 1HDRA 3SFZA 4BNTA 1MJBA 3QP5A 1NVMB 1LTHR 2L54A 4BGVA 5T57A 5B4UA 1ZRDA 1HYHA 4ENMA 4GSKA 4CGZA 3IJPA 1M67A 1ZVMA 4FDAA 1V3UA 1X1EA 2P8TA 2DKNA 3F6OA 4ZA2A 1I36A 3I9KA 3T7EA 3ONDA 1H5QA 3A28A 4WKGA 4RGRA 4RV9A 3B1JA 3O8QB 4BOYA 3PZBA 1NWCA 4PZDA 2IA2A 1YBVA 4D0SA 1FT9A 3S2WA 1Z9CA 4P5OA 2ZMEA 1ZJYA 2RKHA 3HDHA 1NFQA 3RKRA 1O95A 4WNIA 3L0DA 5AXCA 4CMGA 3K31A 4KMFA 2RBEA 4WE3A 2C0CA 4MQVA 5A06A 3U1DA 4BHCA 4K26A 5L95A 1X13A 2DC1A 3JSOA 4PGGA 1BIBA 1I2ZA 3ZMZA 2E49A 1ZMOA 2EV9A 4PLCA 1ISFA 3B02A 4YPOA 1Z1DA 3CUQC 3HB4X 3I59A 3CUQB 1E3SA 2YW9A 4HQEA 1GY8A 4JN6B 5FB2A 2W24A 4L4XA 3WTTC 4EUHA 3BJAA 1LQTA 3ZMTA 1WXDA 1STZA 3D4NA 4AVPA 1YQDA 4HV6A 2GAUA 5JLAA 3WBFA 3IP1A 4D43A 4U7DA 2VHXA 3F1LA 2DTEA 4AICA 1S3JA 2O4UX 3OJEA 4NQZA 4GKVA 4XSZF 3CE6A 3GEZA 1CDOA 5L3DA 3MQ0A 1O3SA 3DHNA 3E9QA 3H8VA 3JAMK 3HB5X 1E1LA 4QUKA 2OZ6A 3T1BA 3FN4A 3FD8A 5DCYA 5HRUA 4CQMD 3D5TA 4J9VA 4G7HF 3NT4A 2Z9OA 3I9MA 4WLVA 3LVFO 3WG9A 3C3XA 4HWKA 5LC1A 2GCGA 1F8GA 2Z5LA 4B8XA 5CG2A 3O6BB 2XRNA 4LGWA 2EXXA 4RDHA 3KVOA 3F4LA 4WEOA 2IA1A 5FO5A 5T64A 1IPEA 1ZLKA 1DXYA 4IJUA 4FGSA 3RASA 2YDXA 3NTOA 5TJHA 2HQRA 4WF2A 2FEZA 5JHUA 1FF9A 5F1KA 4NPCA 4FFMA 1UZMA 1HW2A 2UAGA 4NNJA 4Z9XA 1O57A 3RD5A 4UVEA 5B4VA 1ZNQO 1PJ2A 2GZ2A 2V7PA 3ROPA 4CPDA 3NTQA 4IJKA 1R16A 1EVZA 1R37A 2P9GA 4TKMA 4O6VA 4XYBA 3VAZA 4I5EA 3VB2A 2ADUA 3QPHA 1EVIA 3HDYA 1QV6A 4CMIB 1O7LA 5JY6A 2G0TA 5K6AC 3G0OA 4FPXA 2BE5F 3TFQA 5A3JA 4E32A 3WSVA 4RVDA 5L7TA 1H0MA 1LLQA 2F5CA 4PFJA 3RUHA 1Q1HA 4DPKA 5I7EA 4FQ8A 4WLFA 3L4BA 2VODA 4U6SA 3IOYA 5L9AA 1WWKA 3CJNA 1DSSG 2IZZA 2RH8A 3V8JA 2SCUA 4J7XA 3QHAA 3F6YA 4ALNA 1VRWA 4Z3KA 2BYVE 2BFMA 3I83A 3PLNA 3RAJA 5IDXA 2B0LA 2XF8A 1W4MA 2OQGA 3ZWYA 4LN1A 1FDWA 3JQ7B 4O1MA 4BNNA 3AY7A 2FPPA 3EETA 1FSHA 1DDOA 3F5QA 3PJGA 1BWSA 1GFSA 1B0AA 1UAYA 1ZK2A 4YWJA 2FHSA 3BJ6A 4Y67A 3WTBA 2A9FA 1HWYA 4U0JA 4WNCA 1L7EA 4JP2A 5ICGA 1OC4A 1TQPA 1WKMA 2DK5A 4ALMA 1PGJA 1I0ZA 4WXDA 3QE3A 4GAEA 1M66A 4YCAA 2J5OA 4DLAA 3UH1A 1XWFA 2NNYA 2Y67A 2K7LA 4L9JA 4FJ0A 4KDPA 3KP6A 4ZD6A 3B20A 5EINA 2F2EA 5A2QK 2A94A 4LK0F 2YY7A 1U4SA 3F3SA 3LDHA 4OQYA 2FU4A 4U5QA 3DTTA 1E6UA 4JK1X 1JE8A 2BHLA 4HDVA 3AAFA 4CJXA 4CZZA 4PDKA 5C7IO 3HRUA 4I5DA 2ZYDA 3ZWOA 4EW6A 1JGSA 1I3NA 2OMEA 4FC7A 4J7CA 2V6MA 4DBVO 3FMRA 2UUPA 4GX5A 1H2BA 4Q9NA 2B4RO 4P22A 5HLIA 4CMAA 1UXJA 3W1VA 2G7HA 1E77A 2FZEA 4Y9DA 2GXGA 4XJTA 4MJLA 4YJGA 3L9FA 4M9ZA 3WE3A 1Y6JA 3WQRA 2F5DA 3GO5A 4M9SA 4O5VA 4WXHA 3DAPA 4R16A 3FNGA 1AE1A 3I58A 1ZN2A 4WCGA 2NVBA 1LEHA 4J4HA 4E6PA 4TZKA 3N4MA 1FDTA 2XAAA 1LSOA 4WX9A 4G5HA 1JTVA 2Y1DA 4R68A 4OOIA 4UNOA 1PZGA 2VQ3A 4YA6A 2PEXA 3WWZA 2MA3A 2EG9A 4LB6B 3JQ8B 4HP8A 4RCVA 4F46A 3VODA 4G6QA 1NASA 3KM0A 4J1NA 3ZNQA 4IRIA 3WGTA 3KZYA 4BO4A 2IZ0A 1OYIA 2JZYA 3GK3A 3GNQA 3LT0A 4JBIA 4LMRA 3TQHA 1N9GB 4XWYA 3S2GA 1BOAA 3DQVC 1E3LA 4PLTA 1YIOA 3BHIA 1FK8A 1K6JA 1KYWA 2OBYA 1J2XA 2RH4A 1H6AA 2P91A 3FCOA 4IMPA 6PAXA 4J90A 4R3WA 4WCDA 4CLRA 5JMWA 3K1PA 5CVVA 1ZIDA 3Q3CA 5KKCA 1SZJG 4CL8A 1AOYA 2OA4A 2YHIA 3ZP5A 4F6CA 4GX0A 1RNLA 3GRPA 3ONEA 2IP2A 1GUZA 1QYDA 1Y9AA 2EWMA 2HOEA 5F1RA 4ZYDA 2J5RA 2Y1EA 4ASNA 3VPHA 5IG2A 4O3MA 4XYMA 3JQGA 2PN6A 4ESFA 3Q5FA 1U5TB 4QLCU 5IN5A 5LGUA 1PL8A 1EEHA 4W82A 4U6QA 5CDGA 5JDCC 1XN7A 2UWMA 2XIGA 4IIVA 1QMGA 2Q1WA 3RUCA 4B3JA 1LI4A 2XUBA 3INRA 5JBIA 2COMA 3BTUA 4Y17A 3VZPA 2UYYA 3E6MA 1V9LA 3W8DA 4NJMB 4BGEA 2JPBA 4I7HA 4XEHA 2X0RA 2CVOA 3R6SA 3AFMA 1S7OA 3R0JA 3OECA 1NQOA 3NV9A 1PJCA 1D3AA 3E82A 4NK5A 3WGQA 1YLFA 1YFHA 1GPDG 3ZV6A 1LNQA 4BGIA 3CEAA 3FNFA 1XSXA 5JSFA 1O9BA 2EJWA 4DNCA 3WXBA 5DBFA 1LDJA 5HS8A 2HDHA 4ND2A 1T98A 3RCBA 4EI2A 1YQGA 4N9IA 5CJ9A 1UHWA 1SFEA 1PJ3A 2VHVA 1DIGA 2PH3A 2FBHA 2VTEA 2PZJA 3IDSA 1N7GA 5KJ6A 1UXIA 5HBRA 1XMKA 2QYTA 3HN2A 1QYVA 5DCMA 3AW9A 3OQBA 4XIYA 3TZQA 4O0LA 4RZHA 1RM3A 4A6DA 4KTTE 1K3TA 2DI3A 4I01A 1VKOA 2B5WA 4DQ2A 4EQQA 1LSSA 4Q3BA 1MC4A 2I6TA 3MCZA 4HX8A 4ITUA 2FPGA 4N7RA 4BO9A 2UVDA 2EJVA 5FD5A 5DF1A 2KJCA 4OINF 4IPAA 5AONA 2PH5A 3DWFA 4INAA 5BNTA
chains in the Genus database with same CATH superfamily
2G82A 4OKIA 4J2OA 4P3OA 4LB5A 2IU4A 3BXOA 1KP3A 2I4TA 1FUYB 2WJ4A 2Z5FA 3K9HA 3P9QA 4D3XA 3U7QB 2O7NA 4INOA 5F5XA 1UBTS 5LMNB 2JFZA 5TMEA 3RJMA 1KMNA 2XGOA 4PZJA 1CC1S 3QUQA 4MQFB 4P3KA 1GPJA 3FBGA 4JVLA 5FPPA 4XQGA 1IV8A 3UHOA 4Z7JA 1AMOA 1U5BB 2L19A 3I04A 3PFNA 5DTQA 4UM5A 4DMUB 5BVHA 5FI3A 4Q7QA 4MWSA 2BSAA 2LDXA 3KK0A 1VJCA 3FBNB 3EVEA 5LEKA 2NQ2C 2Q2WA 1I4DD 3LUBA 4RETA 2RNJA 4YCDA 4D0LB 3D3EA 3DDZX 3B5EA 1Z2OX 5T8KA 3V46A 3W5UA 1DZIA 1ZIXA 2WJIA 3X0DA 5T5QA 2XV4S 3MERA 1D2RA 4M1TA 1U6GA 2WADA 3JAKA 3O4VA 3UXEA 1B23P 4PPNA 5CYPA 3SVTA 4E70A 3JCZA 5D5VB 1ZICA 2IYPA 2VDRB 1OIVA 3WTYC 1C9KA 3KYLA 1QQ5A 1VA5A 1R0XA 2B92A 3AF1A 4EPTA 4TXMA 2G3YA 1QZ3A 1T91A 2DH6A 4G07A 2GI4A 3DF8A 2YINC 1E1YA 4L9RA 5L3QA 3PIIA 2FK8A 2ISZA 2NT4A 3H9CA 1DAOA 5JT1A 1Q7EA 3E8XA 2BOVA 2AS5F 2X86A 1A72A 1YIAA 4N12A 4BAUA 2RHRA 1BXGB 3HIFA 5B1AH 2OTJI 3LL4A 1DMSA 5HGJA 3BUSA 3UJ8A 3V4FA 3MLAA 1AQJA 2RARA 2O54A 1T1EA 2H1VA 5AVVA 4G4SP 4X90A 1RW4A 2C9DA 4MVJF 3SR4A 3MS4A 4L4ZA 1DPGA 3T9BA 4IIUA 1U8ZA 1WU7A 4ER5A 4RQUA 5JRDS 1P18A 2OENG 2ZWOA 4RLQA 4RLSA 1V16B 4D6YA 3SHQA 5HDGA 1BCSB 4HDSB 4PHTA 4M2LA 1RMTA 5IHXA 3JWGA 3BT7A 5C81A 4XXHA 2FEOA 1OXXK 1JLRA 1E4EA 4DLXA 4DSZA 2IHBA 2R96A 1PKEA 3DWGA 4F7DA 3TSZA 2PKXA 1RE0A 1BHSA 4M54A 1AZLA 5AW0A 1LDBA 5JMPA 1YQQA 4JV5B 1EINA 3EAGA 2ZI5A 3L8GA 1O96B 4HEA1 4NZMA 1RAAA 3FWYA 3WKBA 3L2RA 4IOCF 3RW9A 1SFUA 4FOTA 5L3BA 2IVFA 1TNSA 3F23A 2QBYA 3IT2A 3CZ6A 3LT5A 1TBXA 4E30A 1RP7A 1U8EA 4XIDA 1PJ8A 3QKSA 1P1FA 1CUBA 1W85B 2JJ1A 5AQEA 1XYGA 2JAOA 1F38A 4D5GA 3Q9SA 3ULQB 3O93A 3JPYA 2KZGA 4NOKA 4IOAF 2OYRA 4EBFA 4KWIA 1DTWA 1OW3B 3HDTA 1V7ZA 1AGNA 2FJPA 1IM5A 3U1KA 3BD9A 1LS6A 3K6SB 5CLSA 3WYEA 3AR3A 4LGMA 1NDUA 2H51A 2QQ0A 1ND6A 3O82A 4CKBB 1F1BA 4ND4A 2J30A 2B21A 2C4TA 2C4MA 3PGMA 4FOSA 1ZCJA 4TRRA 2AG0A 1JIKA 3WMXA 3EWSA 4Z0TA 2X7XA 3C7TA 2VUUA 4NDNE 1E0JA 1P7ZA 2WY8Q 1UBNA 3FLMA 3KPWA 3KSRA 4M0CA 3S28A 1E9AA 3HLYA 3G1LA 2A9QA 3CIOA 3N8KA 3NX4A 3WR5A 4AUMA 4D82A 1F8YA 3NIFB 1HDZA 4W5WA 4XFKA 4BJ6A 4EKEA 3A31A 3WL5A 4BLSA 3I6BA 5IHPA 1Q20A 1WNFA 4BTEA 4Z49A 5TGTA 1QC5A 2Z2JA 1S3GA 2IKQA 2XE6A 3DG9A 3IPLA 3KFXA 2LY2A 2VPYA 3A8TA 1M5TA 4Q4HB 1EH5A 1FRFS 2Q4DA 1GCGA 2W6MA 2YMQA 2ZITA 2W6ID 1OHHA 3D54D 3LL7A 4E2FA 1GHCA 1XKXA 3WLSA 3W8NA 2K9QA 3GLTA 5FNVA 2BI8A 2FLWA 4V0NA 4JYAB 3A6KA 1EFLA 3ONQA 4PLZA 1K4SA 3S81A 3ZV3A 2VTVA 4J01A 2VOOA 5D3MB 2IEIA 3H6KA 2NO5A 4FHZA 2ZBUA 1EH8A 3BWCA 1CEQA 1LY1A 1Z06A 3DXFA 5FLYA 4B8WA 3PT9A 2ZJBA 4ZEXA 4GKJB 1T10A 3ONNA 3VKUA 5BW4A 2A0YA 3FPEA 4E22A 4YRDA 3HBJA 5F23A 3ZWQA 1E69A 4GG1A 1HETA 3FK6A 2CCJA 3D2CA 3KOMA 1SD5A 1PFWA 3WK9A 3O91A 4CM9D 1QWSA 4I09A 3J81K 5TF0A 4PC2A 1HCRA 1S2NA 3TQNA 1CUGA 1E79D 2QQFA 5CA0B 4XRSG 2PXAA 1GVHA 1HE4A 4ON0A 2XA1A 1IY2A 3C15C 1KHHA 3IAFA 2FXAA 4MTLA 5U1PA 4UZSA 3IA7A 4W97A 4TWRA 3V33A 4QYIA 3JD2A 1XJWA 3MMZA 4ENSA 5JVDF 1IO2A 3I9V6 3I4PA 1EXVA 4WBNF 3ABMH 2ZSAA 1PUEE 1UM9A 1DL5A 2W9XA 1UC8A 3BKWA 3KAKA 1U9IA 2QUFA 2EJBA 2HOQA 2YX7A 3UKGA 1SURA 3LW8A 4ND6A 4REOA 3W6OA 3ABKH 4Z2AA 1T9DA 3U6KA 4B3MB 3BGSA 3O8CA 2CDRA 3L7BA 2XSZA 1HSJA 4NU0A 4Q3EA 5JCZA 4TMYA 3Q8MA 1VJ1A 3S7TA 4RNDB 3ZWBA 2OVBA 1WJCA 2VAVA 4QSHA 5CX4A 4HLYA 2FY8A 3L9XA 4JT4A 5CBPA 4MYTA 4ZGBA 3TXYA 3LC0A 2SBTA 2QD2A 1XN4A 2Q2EA 3OYFA 1MX3A 1FVXA 1N5JA 1SVIA 1XNJA 2AOUB 4M87A 3UJ7A 3QPTA 3EC2A 1EQUA 3K4LA 3NVKI 3HGQA 4AD9A 3RHZA 3BA6A 4J43A 4JOQA 4KRYA 3VJKA 1N2OA 1RHJA 2FSFA 2EIKH 5CQEA 2O1EA 3MJDA 4Q02A 4WOCA 1UXOA 2Z2IA 4IILA 3RSSA 1Q74A 1R4ZA 3H3FA 1O96A 5GJBA 3WTXC 1SA0A 3R20A 4I2NA 3UJHA 4A6PA 4C7JA 3RYIB 1GUBA 3RJZA 4JCOA 3WOHA 1VLJA 5CB8A 3BK2A 1YONA 1K97A 1EUDA 2O3RA 2WTEA 2NZ2A 4D8UA 3F3XA 4IFIA 1K6XA 4O1HA 2RREA 4UU8A 2UUZA 4DWJA 3HK2A 2PHZA 3MTBA 4UNRA 3OQMA 4U3JA 1A5AB 5JCOC 2VDPB 1AHHA 3UJPA 1UXHA 2JJQA 4UHBA 2JA6J 4GE0A 4AIDA 1P0IA 1V2GA 1W0KA 2QRKA 5TQVA 3WC4A 1XRRA 1M0TA 2G70A 4JJIA 1RJEA 4YRNA 1NX6A 5FD6A 4G0ZA 3PRJA 2IW1A 2FSUA 2VF4X 5BR4A 2IF0A 4UVIA 3TRFA 2QTVA 4IXAA 1V35A 2RHLA 3ER6A 3FZNA 3GQVA 1IULA 4MQMA 2ZIXA 2OXFA 3B60A 5T4HA 4MQUA 2LF8A 3N70A 4J1QA 2YHBA 3DBLB 4UFOA 3WK6A 2OZLB 1Z9BA 3K9LA 2LV8A 4HWGA 4CXMA 5CIYA 2FDRA 3L8FA 5A4MS 5TT0A 4QICA 1ZSNA 4P3NA 2RQPA 1GFIA 4JCCA 2QI9F 3SIRA 4M53A 1CBUA 1ZD4A 3SZRA 1VL5A 3VHLB 1M10A 1MORA 2XOKA 5LBUA 3EG5A 2EZLA 4PIPA 4YV2A 1DWQA 4XLEA 4ZOAA 3G0IA 4Y4RA 3FA2A 4V0MA 2CO5A 2XAJA 1GZ5A 3F6BX 4OHUA 4XIJA 1KDZA 2VYQA 3VPSA 1OYWA 2JI7A 4DCNA 3W2AA 2FMTA 4IVRA 5HA5A 3CSDA 4KUMA 1E4OA 3DR5A 3ABTA 1LDDA 3H2ZA 4PLPA 1TC3C 2GRJA 1BIAA 1ACIA 3ONWA 4I1UA 5ALFA 5DYWA 3VZCA 4MULA 3JQAB 3WS7A 3S2YA 1JEDA 4BNUA 4CMKA 1HE2A 3BIOA 3WK4A 1WHSA 1RAIA 2YJ3A 4GX2A 4MKHA 3EH1A 3FUCA 3B13B 4J29A 4MUYA 3ECCA 5DT9A 4EJUA 4QUHA 3GLXA 5IT9Z 1HKHA 3KG2A 5JAIA 1A6QA 2A05A 3DZKA 3IQDB 4C03A 2OV2A 5CXUA 3GR6A 3DL0A 3C1DA 3PE3A 4K28A 4A0XA 5B55A 2OTLI 5DP1A 2HRZA 4B71A 2H63A 4EB6B 2ZIUB 4OYYA 3SHTA 3U2QA 5DULA 4GZMA 4AWXB 2JSPA 1SVMA 5JJCA 2OCYC 2R7QA 3HYNA 3SD7A 3NMUF 4AYBN 2BTQA 2JI4A 3C41J 4K9PA 2IX3A 1RTTA 1T2KA 4FCVA 1I7NA 3GT4A 3UCEA 1WQ1R 3MB5A 3JV7A 3PFIA 2G40A 3K7AJ 5AFSA 2MC3A 2HQBA 3I9FA 4O2AF 2D0OB 3PQFA 2R1VA 1X70A 1OLSA 3D5RC 1IC8A 1X7GA 2WWGA 3AKDA 4G5FA 4XB6B 4RK5A 3Q6IA 2BW3A 1ZRFA 3W2IA 1U1GA 1LFBA 5I9SA 3A9UA 3F7MA 4P08A 1ZYRF 5FEMA 5JALA 2XECA 3B1FA 2EFOA 5D3MA 4BDSA 1ULHA 2Z8ZA 1FXSA 2DTZA 2WYWA 3WKDA 5HIKA 2HDCA 2D0IA 3FBTA 4JI5B 2Q9UA 4NV3A 5CMLA 2BGWA 4KL8S 1IWBB 2C5AA 2R25B 3DGFC 3N86A 4IEIA 1BJKA 3ZLUA 2Z58A 4G5SA 5G40A 4YY3B 2W98A 1YRYE 1ZGGA 3L0BA 2VNHA 4MQ6A 4NATA 4DG9A 3HOUJ 1QAQA 1QIDA 1G17A 4XWKA 2XCLA 3T0GA 2WHYA 2IV2X 3SYNA 3E9NA 3P4YA 3FF5A 1JG1A 4J75A 4DLNA 1Z4PX 3H0EA 4YUXA 5A03A 4JI4B 4QNMA 1A31A 5LOVA 4RVFA 4F84A 3L3BA 4PW0A 4DVJA 2N47A 4WOPA 1DP7P 4TT8A 1U0LA 4UJ5A 4LZLA 3CKMA 4E5KA 4AN4A 3CUUA 4FYHA 3JASA 4YI5A 4F92B 4OTZA 3L4JA 1J0RA 3I0NA 3DPSA 4JY7A 2OFFA 4U2BA 4RB0A 4DIEA 3WU2C 2GBCA 2Y1WA 4CO8A 3KJZA 2ZSJA 1VPDA 5GINE 3HJEA 2ZSKA 2F9FA 3IUYA 1VC2A 1VMIA 4FMPA 2VUIB 4J16C 1RYNA 2UV8A 2BEVA 4AM8A 5KSWB 2H18A 1F2VA 2XH8A 4LV8B 5I9NA 1P9OA 3LSJA 3H75A 3PC6A 3MEQA 4OGWA 4RDIA 5BW5A 3QXXA 2R44A 3TGPA 4AJ2A 3QXJA 3K1NA 2UUCB 4B32A 3P0HA 5BXQC 3ZBQA 4MRPA 4EYQA 3ONVA 2A33A 5JQWA 1FZPB 4HZIA 1PFUA 1Y5LA 4P9UA 1H2WA 3NOVA 4IIFA 3V48A 2V5UA 2FSVC 4DMCA 5KHOC 4ABTA 3OIUA 4IGAA 1JHMA 2I7TA 4G84A 5DV9A 1S4MA 1SAUA 2B35A 1KZ7B 1JHXA 2ZJQF 2ANCA 1B14A 4MEBA 1SCQA 5F4BA 2PMWB 5LQCA 4JJZA 1R23A 1EIZA 1LQUA 2ZJOA 3BZCA 4V3BA 3GGOA 3MF4A 1SMTA 3H35A 3IBYA 3RTBA 3WGMA 4EPXA 3NFYA 1C8VB 4NK4A 3K69A 1PTKA 4KV9A 4RIEA 1E2LA 1UBSB 3IP5A 3VKFA 1T0FA 1QZTA 2Q6TA 3JYPA 3L7DA 2LKSA 4JJ7A 3VJMA 1E3TA 2P5YA 3K0FB 5AKJA 1V8FA 3NUGA 1QPIA 4CTJA 3E6CC 3RVJA 1OFCX 1TAQA 2QW1A 2DK8A 4L02A 4DC9A 4MUIA 3DDNA 2GILA 3RADC 3M1AA 3S16J 4Q48A 1FYKA 3EQ7A 4IZHA 1RI1A 1KAQA 4AO6A 5A7FA 2WSLA 1SVUA 5EE3A 4ARSA 2ODTX 2R1UA 5AW4A 3IEVA 4EB6A 1G2OA 5FKOA 1R5OA 1Z25A 2O7SA 2XUFA 4H0EA 1GTVA 2WAQN 3K5IA 3J7ZI 1NJ1A 1ISHA 3L5OA 4TMWA 3VOAA 2M98A 2ERXA 2BHNA 4WX2B 4AJLA 2NUBA 3ABIA 5JYCA 3USCS 2Y2VA 2NUPA 4XLHA 1IM8A 3MXOA 1TZBA 2BM9A 1YHQI 1KDTA 1MOQA 1UBKS 1UMBA 1C0EA 1P39A 4MEYF 2YNMA 2LDUA 4X94A 3WL6A 1D1PA 4JLSA 4OGGA 3PBKA 3R5XA 5LYJA 1M5UA 2Y1FA 1Z2CA 1M0SA 3CXRA 3MGAA 2HHJA 2GCIA 5F1OA 5IM5A 1MJ5A 5AIBA 4OG2A 3OCXA 1D2MA 2WLTA 3VSEA 4NOJA 5AVJA 3TM4A 3EQZA 2FSVA 3KYJB 4XQCA 2OQ2A 5LUBA 2CUNA 1ELOA 3MRSA 3D6TB 2G88A 1ATIA 2PSHA 2JBAB 4AN1A 2AE1A 5FFFA 3AONB 2RB4A 2QLJA 1EX9A 1UMCB 5G4KB 4M8KA 1FL9A 2K5UA 4W8GA 3ZVKA 3KYDB 1EBFA 1NF2A 2GETA 4TTAA 4Y1RA 5AMXA 4AW9A 3EX7C 4JA2A 1L5YA 1BI1A 3T5CA 1WPRA 3I42A 2P9ZA 5BRNA 4ZDOA 1T5BA 1F9EA 4J4BA 5BORA 1CERA 4OQEA 1GPYA 1RJDA 3K8QA 3CCLI 3SQNA 2RGCA 1M2OB 3AHIA 2I6XA 5GM1A 4DPLA 3ASYA 1O97C 3K9NA 5ENZA 2F43B 3QNMA 2OB2A 3QPVA 1EDOA 2EFPA 2C2ZA 3E9DA 1W1WE 1Z77A 4E7IA 2EEPA 2M32A 3D7MA 3OCVA 4LY9A 4P7BA 5G53C 1NVEA 221PA 2NVOA 2R7AA 3E4CA 5DGXA 3AILA 2HCBA 5EJ9A 1K8YB 1WETA 2QQAA 3GGDA 3CF5F 3FTPA 1KO5A 2ZSUA 3FB1A 1Z3IX 4WFIA 1KU3A 5BYBA 4G2TA 1I7SB 2RK3A 1ITZA 1T2DA 2ZRFA 4NBSA 3SE0A 1CDEA 2V9KA 2IZ1A 1K6IA 1RS0A 1U11A 4C1NA 1PT7A 1XALA 5BNFA 1WPGA 2RHWA 2C97A 2DGDA 1ZCAA 1EVEA 3QFFA 5F1JA 1F4VA 4OJKA 4W9RA 2G9RA 1IHXA 5SV2A 4EHBA 3VA7A 4UHFA 3WSTA 3TTYA 3VSBA 1QK3A 3MJVA 4BQEA 3C1OA 4PYJA 3LG2A 1TQDA 4QL3A 5FEUA 1JG6A 4IKEA 1VF9A 4R3NA 5FIUA 2V7FA 3HDDA 2B34A 2L4MA 3U1BA 4KG7A 1YXMA 2F64A 4LJ8A 5JPIA 4DCPA 1W5CC 2GPAA 3RF7A 3RFVA 3NBZC 1AU9A 4Z4HA 5E3NA 1X3ZB 3FFBA 4Q4AB 1FBUA 4RANA 1MBJA 4RIGA 3LT1A 1NXTA 2QVZX 4B84A 2FPRA 2ZRNA 3BE4A 5A5VA 1I9CA 1XZDA 2MSKA 3ABSB 2FJ1A 3HCNA 1ZA2A 4OGFA 4YJDA 3IJEB 3WGOA 4XUGB 3W7BA 1WXHA 1WXWA 4XASA 1GXSB 4J3NA 3IUQA 3FGOA 3KO8A 3RUEA 3CSUA 3ETCA 3EZ7A 1E3OC 4MAAA 2L7MP 1J8DA 2WHXA 1EFUA 4XRFA 1D5WA 3DHYA 1MP0A 4Q4JB 3LBAA 5HILA 5THXA 4EB3A 3H36A 4ZMBA 5EMKA 1DBSA 2OZVA 4AMYA 4D4MA 4CLOB 4P96A 5LP6F 2ZSIA 2ASVA 3TJZA 2E5NA 4LMYA 1C50A 2Q21A 2WEKA 2ZTLA 3BIXA 4HDAA 5ILQA 4UHEA 4OKSA 4DV6B 1PIWA 3EVBA 4QEZA 5DNYB 3O75A 2BM0A 4RGSA 1A9OA 2AN1A 4RF2A 4X62B 1W0JA 3KV1A 5L6LB 4RU1A 2WMNB 4UJ3A 3WRXA 3DW3X 3OP4A 4YRQA 1R0WA 4HZGA 2VPIA 1MGTA 2KS6A 1TYDE 5KOHB 1J00A 1G20B 2DT6A 2OR3A 4S2EA 4AUNA 5IXJA 2PUCA 1QGPA 1DG3A 5CJ2A 3R7FA 4IX7A 1MO4A 2PBZA 1LLFA 2CKMA 3OFSA 2VTBA 4AI6A 1PGNA 1YE3A 3W9YA 5EP2A 3H5IA 3CCVI 1IZZA 4J3JA 2QRMA 3O3KA 3TDUC 5AIQA 3CA8A 4LZAA 4PZ9A 4RV5A 4UREA 5IAOA 1Q91A 5GMOA 2EPFA 4BB0A 5KWIA 4ZAGA 1WF6A 3PUBA 3U9SA 4BPRA 1NVFA 2G72A 4ND8A 5BSGA 1WHTA 1XZFA 2WSMA 2JGLA 4NR0A 4YQYA 1E3WB 1HGXA 4ZRMA 3GCMA 5H70A 4B73A 3NETA 2EIXA 1XHLA 2P3OA 4PNPA 2DMPA 1P81A 4A6XA 3L7IA 4DSNA 3SX0A 5DYGA 4X64B 6NULA 4Z51A 1OZGA 3N0TA 1YRNB 4G81A 4OV6B 2NOGA 4E12A 1H05A 2C77A 4C0WA 5EJAA 1REPC 3CRQA 3V8EA 2BGGA 4IH4A 4IG9A 4PHHA 4D81A 1AH2A 4W7HA 1JSXA 3LJKA 1J9EA 1FNMA 2H7CA 1S3IA 4YGYA 1E3EA 2XE8A 2C94A 2HYDA 2ZE7A 5P21A 4UD6A 1RI4A 3C8HA 4TQ9A 3L0OA 1NR5A 4BNWA 2RMKA 1ULUA 2HTFA 4WOKA 4JL6A 2BFAA 2C57A 4LD5A 3SKXA 2F5EA 3G5AA 1DKMA 2I6QA 4NCBA 1ORVA 1ZS9A 3GFJA 4GYJA 4UUAA 1I6WA 1JR3A 2NAFA 3OZGA 2O61A 3TOZA 3V1NA 4MVJM 1KI9A 1LDGA 3DLAA 2ETHA 1JIVA 2AFHB 3EDQA 4YAKA 5J4KA 4OBBA 3T5XA 3Q2IA 3LCRA 4TL7A 2J5PA 3SC3A 3JAWA 2WY2D 1I0LA 2BR3A 1RC9A 4BWGA 1XWIA 2QRGA 3HCEA 4OLAA 1TVEA 1ARZA 5LPNA 5LCXA 4EJ6A 3COSA 1VQ4I 5BSRA 4JOBA 5L3ZA 5KZMB 5JRJA 4CI9A 3HUGB 1I33A 2GEFA 3ET4A 2KMUA 4D0PA 2Q3HA 3OQIB 3PFBA 1L1QA 1QO0D 2E5FA 3KP3A 2A5FA 3RSFA 1E6KA 1E1RA