2VT2A

Structure and functional properties of the bacillus subtilis transcriptional repressor rex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
199
structure length
184
Chain Sequence
b'ATAKRLPLYYRFLKNLHASGKQRVSSAELSDAVKVDSATIRRDFSYFGALGYNVDYLLSFFRKTLDQDDVILIGVGNLGTAFLHYTKISMAFDINESKIGTEVGGVPVYNLDDLEQHVKDESVAILTVPAVAAQSITDRLVALGIKGILNFTPARLNVPEHIRIHHIDLAVELQSLVYFLKHYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REDOX-SENSING TRANSCRIPTIONAL REPRESSOR REX
publication title Structure and functional properties of the Bacillus subtilis transcriptional repressor Rex.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
total genus 56
structure length 184
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02629 CoA_binding CoA binding domain
A PF06971 Put_DNA-bind_N Putative DNA-binding protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2vt2A01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2vt2A02
3GQVA 3ZHBA 4AD9A 2P6TA 3BA1A 3MJTA 2BI7A 1IRFA 3SVTA 2MBFA 3E48A 2J5QA 4U0KA 1KA8A 1KYQA 1JTVA 1LJ9A 1XCVA 2Q49A 1AWCA 1LEHA 1AHIA 2C20A 3KBOA 3H65A 3NDRA 4KUHA 4LVUA 1A4IA 1IOLA 4URFA 2FNPA 1W0CA 1W7PD 1ZK4A 1MJAA 3V7RA 3OICA 3KP5A 4ESFA 3BP8A 5K5OA 1B1BA 2Q2WA 4N54A 4R1UA 8ADHA 4D42A 4IJAA 2R00C 4MIYA 3DOJA 3R60A 3FNHA 3Q1LA 3G0OA 4EJWA 3F6YA 4DBZA 3ROQA 3CKYA 4A2CA 2RH4A 2PKRA 1QRRA 1QZYA 1TT7A 2YW9A 4TV7A 3OV8A 1DFGA 4EJUA 2Y1GA 1UHWA 2HK8A 1R5HA 1EVYA 5IFLA 1FX7A 2XXBA 3GGGA 2HJSA 4GWKA 1TEHA 2BLLA 5TX7A 2YV1A 1GUYA 5EINA 3PQJA 4RAYA 4ZQEA 1NM5A 2DVMA 4YCAA 3HHHA 3KP3A 1T2DA 2VHYA 2DT5A 1U8XX 1RJWA 1WNTA 3KVOA 1HL3A 4L75A 1L1FA 4ZGWA 3H3UA 3KLMX 1T39A 2WC2A 2VOEA 2PLAA 2GPTA 3S2FA 3DAPA 3KP2A 1E7MA 3MFKA 3QRWA 2HU2A 3TOAA 1IHXA 2Q46A 1KYWA 1NWHA 4IPAA 1ZCJA 4JN6B 1T1SA 5B4UA 1Q0QA 2PN6A 2Z1NA 3DOOA 4QWQA 2C5AA 1W5SA 3IMFA 4N7RA 3W8EA 1Y81A 5AIPA 4NR0A 2DPUA 1UXHA 3JQ8B 1YBAA 3UW3A 3E5QA 4M9XA 1SD6A 1BMDA 1E92A 2QRLA 4XR4A 1QORA 4I09A 3B6ZA 3L9XA 4U0VA 2FQ3A 2HQNA 4B4WA 3DZIA 5CDYA 1OC2A 5AYVA 3PYLA 4GX0A 5KNLA 2G76A 1T2EA 5DCUA 2GYYA 5KK1A 3QWAA 1B2LA 2PWZA 1G6NA 2GAUA 2G9WA 1B9MA 4LK0F 4NHJA 2L54A 1K79A 1YRLA 3KSZO 1YO5C 4R69A 4E2ZA 1UHMA 5HRUA 5TRDA 3QVSA 3Q9VA 1ISHA 2PY6A 1ZK1A 1PGPA 3H9QA 1SB8A 4BO3A 2OOSA 4FBGA 3FBGA 2NNNA 2XF8A 1MXHA 4NJOA 2DUUA 1YL5A 3SLKA 1BI0A 4GO1A 3MWEB 4LSMA 4BQPA 1V9LA 3L07A 4XX0A 1HDXA 4H15A 3RC2A 4JIGA 4GYIA 4CL3A 1KYZA 4EYEA 5HLIA 2CMDA 5JS6A 2NAZA 4HFNA 4WLVA 5MDHA 2WWRA 1GU7A 2Q4EA 1NFQA 1Q0HA 3GMDA 5JY6A 3GA0A 3GG9A 1EV7A 1KBZA 4GBJA 3TF5A 2E82A 4R41A 3C3XA 4ND4A 2LNBA 3SC4A 1PSDA 2P9GA 1MXFA 2PZJA 3OSUA 3EUWA 4IRGA 4LISA 5EJ2A 4NB5A 2GD1O 4FJ1A 4GCVA 2AA3A 5JDCA 3K96A 5D5VB 2HZTA 4UNOA 3NDJA 3ZWYA 2E48A 3M2PA 3QPHA 4PFJA 4QFDA 5ER9A 3T5XA 2UWMA 1ZYRF 1ZMTA 4CJXA 3V4GA 1ZSVA 3HB4X 4YT4A 4CLXA 3IRQA 3RJPA 5LGUA 5L7TA 2YU3A 1ZRFA 1SMYF 1KVSA 5FFFA 3B02A 3JTGA 4NU6A 1RNLA 5CJ9A 2ZK7A 3BAZA 4DBVO 4YXFA 4BS9A 1B8VA 3GGOA 4DIBA 5G0SA 4DRYA 2XAGA 3WFJA 3JYLA 2E7WA 3WGYA 4K6CA 5B37A 4XLPF 1MLDA 4B4VA 2Z5LA 2ZB3A 2IT0A 2BGLA 4XYLA 1YBMA 4KIGA 2W2LA 2Y1DA 2Z5UA 3I59B 1I2ZA 1V0JA 3VZQA 4BO6A 1XIVA 1U9JA 4CV3A 3CXRA 1RUNA 5LGTA 1GV1A 2PNFA 3RJ5A 1XDUA 4RGSA 4DPLA 5KKCA 1LNQA 4I9HA 5JR3A 3KV3O 3QJ5A 3F5QA 3KYDB 4EUEA 4ZVVA 1JDJA 4BAYA 2RIRA 2EV0A 4UUPA 4KDEA 4D3DA 2HDCA 3F22A 5JYDA 3L6DA 2CVQA 4W9NC 4XBFA 4RF3A 1JKIA 4Q5SF 1ID1A 2NNYA 1USTA 2Y0DA 3E97A 1NQAO 2EHDA 3KP4A 2ZXJA 3AU9A 3G3EA 5FD6A 3H9GA 4M86A 4OMUA 5DCYA 1PDNC 5LCXA 4OHUA 1J0RA 4AJLA 3FXUA 1M76A 1B59A 3FF5A 4XR9A 5I9NA 3ZHYA 2ESNA 1B15A 4HV5A 1PJTA 3HSRA 3O8QB 2F5DA 3E6AA 5CAEA 2VYVA 1R22A 5LEJA 1ZO8A 3ENNA 1JE8A 1HKTA 1DIAA 3C1TA 2W90A 4BV9A 5AOVA 4BYYA 1Q7CA 1NNUA 5D4SA 3DBVO 3M2TA 1FDTA 3QWBA 2P8TA 2IP2A 4FS3A 2O6GE 1P1KA 5JCJD 1P0CA 1UXKA 1SAYA 5AIQA 3DQPA 3ENKA 5G4LA 4OIOF 1YIOA 4J16A 2AXQA 4J9VA 3AM5A 1LU9A 4K1LA 3D4NA 1O6ZA 1EQ2A 4OXNA 3DONA 2QHXA 3MJCA 3KFWX 4WXHA 1X14A 3D5QA 3SZPA 1K0UA 2J3HA 3JQ7B 2O3UA 4HNHA 4OAQA 5DULA 1LBEA 1KGSA 4B3IA 1B14A 4RO0A 4GKVA 5LC1A 3VH3A 4OIQF 3CUQB 2HYFA 2IYOA 4R16A 4RF4A 3TO7A 3TL2A 1A27A 4CLOA 4YAGA 2BYVE 2J5KA 5L3ZA 3F3SA 3IQDB 4A0YA 1NVMB 4L9TA 3WODF 1Z6ZA 3DQVC 2D4AA 3VH2A 5D5UB 2GNAA 4NHEA 3LF1A 3JQ6A 3UFXA 1HW5A 4U0JA 2H6EA 4OO3A 1J5YA 2YZ7A 3FR8A 2V1XA 3PHHA 4FGSA 3VKUA 4R01A 1TT5B 3TL3A 2VCYA 4RVGA 5D6EA 2X22A 5JFRA 4WK6A 3TOZA 1VJTA 1X1TA 2DTXA 3N7UA 4BNFA 2CW0F 1AUPA 4KUEA 4DL9A 2DPGA 3FXRA 4G6DA 3ZGYA 3E6CC 1FBSA 2PZLA 2FR0A 1KU7A 3RBVA 4G7ZF 5BQTA 4D3FA 3DBRA 3JYOA 5JXWA 1PJ4A 4HX5A 1DJQA 1U5TA 2W4QA 2GUGA 4TRNA 3RC9A 5A9RA 3K2ZA 2AEFA 3GY0A 2RKHA 4XB1A 1C1XA 3UCEA 1ADCA 3FCOA 4I5EA 1OZAA 2XKOA 1GUZA 3VPFA 3ZNNA 2QVOA 1ULUA 2O23A 4RGUA 5AVOA 2NLOA 5ILVA 4CXFA 1DDNA 1O3SA 3P9KA 2O0YA 2HWVA 1ZG3A 1BRMA 4WKGA 3RU9A 4KWIA 5AONA 1I5RA 1DC6A 4JJIA 3VTFA 1FDVA 1FZPB 2IA1A 4Q39A 5DN9A 4XYMA 1C0PA 4YJFA 1WVGA 1FPQA 3LVFO 4GGPA 1U8FO 1X7GA 1ENPA 2ZQZA 3M1EA 3H5RA 1GZ4A 4LGVA 5T6BA 3GFLA 2BFMA 1MP0A 4J4TA 1U7TA 2DAPA 3ZWPA 4CM3A 4D3SA 3U09A 3I9MA 2P91A 3RAJA 1YWGO 1R0SA 4IHTA 4FN4A 4ALMA 1YDEA 1EUDA 3WE2A 1RZ4A 2CG4A 1H9BA 2NU9A 4WUVA 4CM1A 1KY5A 4RGXA 4GVLA 3O03A 4ZD6A 5TLSA 4BNCA 3LA2A 3I9NA 2V6CA 4RB2C 3IIEA 5G0VA 2E1NA 1LVAA 1XDSA 1ZXLA 5T8KC 3VH1A 4A7PA 2B4QA 2Y67A 3FMSA 1GPJA 2YHUA 3QP6A 4WCDA 3R3SA 2Z9OA 2DPDA 4ROSA 1C14A 4Y13A 5D5XB 5A1TA 3WBFA 3DZJA 3ZV5A 1QZZA 2HAEA 4HFJA 1N9GB 2CY0A 1Y8RB 1DFHA 1MDMA 1FNNA 4GX2A 1WDMA 2YUTA 2KJCA 5ILGA 5L40A 2EKPA 2GDZA 2GZ1A 3GFJA 1ULYA 2OD5A 4R9RA 2IA2A 4AJ2A 2X86A 3I58A 4DQUA 1NHAA 4OIPF 5JYEA 2PG4A 7MDHA 1QYCA 2X1HA 3QW2A 4BO4A 1N92A 1T98A 4Z6KA 4BHBA 3ICPA 2V1UA 1PJQA 1PL7A 5JNLA 1XHLA 3WGTA 1Z7UA 1ZRDA 2YHIB 3A1NA 3F47A 3QVTA 1B0AA 3GWZA 3NJ8A 4LMRA 1XGKA 3WGIA 3WTBA 2G1UA 1QR6A 4XGNA 4IPTA 2YR2A 1H9TA 1E2XA 4EVIA 3I83A 2DFIA 1DRWA 2NVUA 4Y67A 4ZU3A 2ZNZA 3L09A 3G3ZA 4YA6A 4CR8A 1ZREA 3P7MA 3RFVA 1UZLA 3G79A 3KLNA 5KOIA 2HYGD 4BNHA 3EUHA 1NR7A 3MEQA 4M9SA 2CF6A 3F8BA 1N5DA 2DBRA 1IZ1A 5D4RA 5FFZA 1WXDA 1Z6RA 1M67A 1NHWA 2NNLD 5G2OA 1GY8A 2D0IA 4OMZA 4L9RA 2EFWA 1LX6A 2Q99A 4RV9A 4HQEA 4TKMA 5JC1A 5L3DA 1Z9CA 1CEQA 4YTEA 2OA4A 1TW2A 4HX8A 1E3IA 2HK7A 1BVRA 2Z95A 3MTGA 2Q1SA 3SJ7A 2VWQA 3F4LA 4CQMA 2RGVA 1ZEJA 2NQ8A 4N5MA 4NI5A 4L9JA 3QP9A 4IJKA 3ZWWA 3AI1A 2YV2A 3MJ4A 4RVFA 1E3JA 4JROA 3FR7A 1C1DB 2KIUA 1UP6A 4BNXA 5HDGA 4CM4B 2Y68A 4ZRMA 2ZB4A 5CFZA 4WF2A 3R6DA 2ZFWA 5HS8A 2VHVA 4DVJA 3BHIA 4FB5A 4BGIA 5ER6A 1RM3A 2C82A 4HP8A 2VE8A 3HDJA 2F5EA 4JP3A 1JW9B 5G0TA 5L4NA 4YJHB 1HXDA 3DEUA 1E3SA 2XGXA 5F5LA 2RQPA 3T0YA 2IJLA 1QG6A 1ZSNA 1K78B 3KO8A 4L0YB 4BNJA 3KZZA 2JPBA 2GZ2A 4OKIA 1GXPA 2DTRA 2CUKA 3BXXA 4EJVA 3RROA 2STWA 3QHAA 4GPD1 1DLIA 1HXHA 3DFUA 5HDNA 3RYPA 2ZYGA 1PP8F 5L3BA 2Z3YA 3LYLA 3WLFA 5JCJA 2EV5A 3U1DA 2HDHA 3GR6A 4BO0A 1U2DA 1KQ8A 3FNEA 1PJ2A 2HMTA 4O1MA 3WWZA 3QSGA 2O4CA 1EUZA 1DC5A 1DDOA 3BMOA 4ZN6A 1Z7BA 3JSOA 3IS3A 2BE5F 3ETDA 4PLHA 4BNTA 1WP4A 5D6FA 2D8AA 1OYWA 1IL0A 2VYVD 3AOEA 1E5QA 1UAGA 3RUEA 3L4BC 4NU5A 4U0YA 3PFFA 4U7DA 3U9GA 3G49A 2VRCA 3REOA 2FSVA 2F2EA 2QQBA 3FWZA 4RPLA 2BRUA 2IZ1A 4Y98A 1O7FA 4HW0A 1HKQA 2VUTA 2Q2EA 4RF5A 3A9WA 4WCFC 2AEJA 3TGNA 3BTOA 1YG2A 3BOQA 1ZJZA 3FX3A 3H7AA 1WDKA 3H9UA 3ROKA 4NJMB 4EEXA 4ETSA 1MFPA 3EK2A 4JQFA 2DO7A 3E6MA 1GZ3A 4BVAA 5FI5A 2VC0A 3SLGA 9LDTA 3VODA 3H5NA 3QVOA 4LGWA 2DLLA 4MOWA 2YY7A 3BMNA 4IJUA 4CLEA 4CMIB 2PMUA 3V7SA 2Q45A 4QECA 2WD8A 2ZTLA 1S8NA 2VBWA 4KIBA 4YJHA 1UXGA 1KY4A 1T2FA 2VBXA 5IT9Z 1BI1A 2J5RA 3SFZA 3GEDA 4QXMA 1WRJA 1OMIA 5I7FA 1FBUA 2FXAA 4IDGA 2XOXA 3ON5A 2UUOA 1WSUA 2EJWA 3WICA 5CVRA 2JKVA 3DFZA 1I01A 1OFGA 3D64A 3RJ9A 4CMHA 1DO8A 4CO8A 2M5WA 1QYVA 4GVXA 4BO1A 4OM8A 4NMHA 4E5MA 3AWDA 1FXSA 2CYYA 3GEZA 2NWQA 4XDYA 1FT9A 2DQRA 1H2HA 2PH3A 2X4GA 1P77A 1M6HA 1LQTA 2CZCA 2P9EA 4UAGA 2ACJA 5HBRA 3RWBA 4DQ2A 1U5CA 4BNMA 2FBIA 3JQBC 2QW8A 3AFMA 1NPYA 4BNGA 4CMGA 2EKLA 1JAXA 2RDPA 4LRTB 4HWKA 1BW9B 4HF0A 4HFMA 3RPQA 1RWBA 5B1YA 3DWFA 2NVBA 2P2SA 3DHYA 4CM8B 3L7WA 4ENKA 5G4KB 2ZKLA 2R7DA 3MZHA 1FDWA 1HSTA 3RASA 1KEPA 3F46A 1R0LA 4AJ1A 5JAZA 3N97A 3BJOA 1G6KA 3VZRA 4HFRA 3WQQA 3ZWBA 1DIGA 4HXYA 3D5LA 1XSEA 3Q5FA 2VWPA 2RN7A 2W2KB 3OA2A 3OP4A 2FBHA 4ND5A 4D79A 5B4TA 1ISFA 2FR8A 3IDSA 1LDYA 3CSDA 2O3JA 3N58A 4N5LA 4II2A 2AQHA 1R1TA 5K6AC 2HMVA 3AU8A 3HDHA 4YJGB 1YLFA 1GUFA 2OAZA 2VQ3A 3DMYA 2FU4A 4DPMA 1U6GA 3E9QA 3ZQ7A 3GEMA 4R1TA 3W6UA 3PJGA 4U0WA 2VT2A 1QYXA 2EK5A 2Q4BA 2WE7A 4U5QA 4FGWA 4BOYA 3F1LA 4MO2A 4RPHA 2ZIZA 2BBYA 2STTA 2O4UX 3U9LA 4BNNA 1YW9A 3R6SA 4KA4A 2A92A 3OOPA 3HADA 1HYGA 4K26A 1H6AA 4RB1A 2JPCA 4LJZF 2ZQYA 3H2ZA 3MCZA 1O8CA 4MQVA 2BKAA 4PLYA 1MJBA 3PDJA 1ZG5A 2YQ4A 3HUDA 3HTUA 4I8XA 4YWJA 1CETA 1S3JA 5HOOA 3RCBA 1OI7A 4NFHA 2ZBKA 4L4SA 5A02A 4UEOA 5LBQA 4IDAA 4PLTA 3ZU2A 1E7YA 1P1IA 3FMQA 2WYVA 4IUYA 1EDZA 3L6EA 3RD5A 4GYGA 1EVIA 1ZUD1 4NFYA 3EAGA 4NBRA 5KJ1A 5E1WA 2QQ5A 5ICMA 4UVHA 2SCUA 4XLNF 3PI7A 4CM8A 1YYVA 2EW8A 1SOVA 5COBA 1YS7A 4ALKA 5IZCA 1O9BA 4KIFA 1A9ZA 4XYEA 4XQCA 4NK4A 1K7AA 1EBUA 4PCQA 2JFFA 5TJ9A 4CLDA 1B4AA 1VKNA 2EA2A 2Z1MA 1BVUA 2L01A 1H0KA 2A9FA 2RNJA 2WE8A 2HO5A 3NDIA 4LLLA 1OAAA 4DIFA 1IAWA 3FF4A 1ENOA 4EM2A 3CJNA 1NX6A 3DEYX 2X0RA 2DQLA 1FYMA 2QIOA 2QYSA 3PHIA 4RVDA 3VAZA 3QRFF 5AXAA 4IXTA 3GEGA 4YJGA 1P3DA 2D45A 2OMEA 4DMMA 2WD7B 3P7NA 1SMTA 1MV8A 1QXSA 4UVCA 4H0EA 2XXJA 4FPXA 3PLRA 3ZV4A 3D3EA 3MWDB 5FWNA 1Q7GA 2B83A 1TQMA 2Q8KA 1PUEE 1MGOA 1GD1O 2JSCA 3EYIA 4CMCA 3IUPA 1K6XA 4JBIA 3V1TC 4O5VA 4ZYHA 4ONEA 4WLUA 2LKPA 2UDPA 5TF4A 3OQ1A 4XQGA 1BI2A 1F12A 4I0AA 4G7OF 1A9YA 1PJLA 3B70A 2YX7A 2VHWA 3GVPA 3K1MA 2ZATA 4BNZA 4IXAA 4IQ8A 1NHGA 4D46A 4RGRA 3LT1A 1D8JA 2EIHA 4FT8A 3OJLA 4MP3A 4F3YA 1BBYA 1X7DA 2XKPA 2X4HA 2OBPA 4ENMA 4M74A 1PIWA 1ZW1A 2DBVO 4PZCA 2I99A 1F06A 3ABIA 5CVUA 1MJ9A 4G6QA 3OEWA 1W73A 4UXNA 4UVAA 2I3GA 4CQMD 2QZ8A 5JMWA 3TZKA 2B0JA 2HTJA 2O3FA 3LU1A 5C3MA 1M6WA 2GN9A 4YRAA 1IF1A 3A28A 1I3LA 4EDFA 1HKUA 1LJ8A 3Q11A 2HKOA 1XKQA 5I7VA 4PLVA 1FYLA 1GYRA 3AOGA 3W1VA 3NAQA 4A5MA 1LSJA 1W6UA 1R66A 3FPLA 3FI9A 2VBZA 5FYDA 1O95A 2XAQA 1H6CA 3QVXA 4ND3A 2EB7A 3ZP5A 2EFPA 3B73A 4KYWA 2C2YA 3S2EA 3RU7A 2WD7A 4J1SA 4HX7A 1GPDG 1T26A 2D3TA 2J3IA 3PZRA 5CVIA 2BHLA 1BTOA 5GY7A 1UXIA 1NTOA 4Y6SA 1DPRA 3VFZA 3MAJA 4FCCA 3X2FA 4DYDA 3KP6A 1OOEA 2OZPA 1LSUA 3GF2A 1YKFA 1KU3A 2PGDA 3JYPA 4KDFA 3I6IA 2E49A 2P5LC 1DSSG 3FRJA 3RKRA 3ZWOA 4A27A 4HBGA 2VWGA 4OJNA 4ZHSA 2IPQX 5DD4A 3J7AO 1S29A 4IDDA 1F17A 1E6EA 4DREA 1PS8A 3ISPA 2V79A 1HETA 5A06A 5IDQA 3F8CA 1L7EA 1ON2A 2EA4A 4BIIA 1Z05A 4J1NA 2IVMA 1YGYA 2DBQA 1R15A 1T0FA 3JQCA 5TJJA 1LLDA 2K4JA 3OJ0A 5ES3A 4HOBA 1JKJA 1S7CA 1ZGJA 2H5LA 2VRCD 1IN7A 2BI8A 3JQ9A 1HE5A 3PJDA 4MIOA 1NAHA 2J5PA 3OBBA 3PQFA 3RKWA 3O26A 1EBFA 5JHUA 4UVEA 4XSZF 3AI2A 1DEHA 4TKLA 5BNTA 1YE3A 3RUCA 2D1HA 5EEHA 2PD6A 1I36A 1FY7A 1TQIA 1YFHA 2FRDA 1YO6A 4E21A 4CYDA 4J9UE 3G1UA 1NQTA 4WNCA 1JHHA 4EJTA 1B7GO 1BGVA 3P2YA 4EJMA 1P4WA 4LG0A 3PQKA 1R00A 4HYEA 3GHHA 3GN2A 3HFSA 3IHUA 2V6MA 5I8WA 3MQ0A 2IRWA 5J8CA 4EZBA 2NVWA 4IJVA 4QTZA 3L0DA 4CM5A 2HOEA 2HMUA 3F6OA 4DQVA 3EY4A 5LHHA 2RCYA 3F23A 2WMDA 4NIMA 2DK8A 3JAMZ 1XQ1A 2MD5A 4H16A 1GVJA 2FR1A 4I2OA 1BG6A 3ZW9A 1PP7U 4OSPA 3M7GA 2JT1A 3V8JA 1H9AA 1YTYA 3RKYA 2PA3A 4FW8A 3RKXA 3ZWCA 1YS4A 2EFQA 2GR9A 4IRHA 2XAJA 3PWZA 1XN7A 4UV9A 1Y1PA 4B09A 2IYPA 3I23A 4XQEA 1HSOA 1NVGA 2IEBA 5CP8A 3SJUA 4DLLA 4E5YA 5CEEA 4GKBA 1QBJA 3JW4A 3ZN2A 3GUDA 3B1FA 1F0YA 3DP7A 4RVSA 2NU8A 1MG5A 2AS5F 5E8GA 1S6LA 3ADPA 4CODB 3TN7A 3RYRA 2B69A 3WS7A 4CM6A 3CDHA 4PGHA 2OBYA 1RM0A 3ROUA 1QYWA 2OUIA 3PWKA 1T24A 3LA7A 2ZCVA 4PG7A 4WNIA 2MLGA 3T8TA 2H6BA 3I4PA 4I98B 3KETA 4L0ZB 1LSOA 1XEAA 2PKQP 1R4MA 2W8ZA 1YW7A 2GCGA 3O4RA 5KJEA 1O0SA 5A9SB 1YVEI 2IDZA 5IN5A 4XRFA 1GR0A 3RI3A 4J43A 4FD3A 1U3VA 4RL6A 3GLXA 4AJNA 2PD4A 5ITVA 4WLEA 5F64A 4MNUA 4D44A 3HHPA 4Y8VA 3TFQA 3NKLA 3DR3A 3Q6IA 4CZZA 4PGFA 1LLUA 2QM3A 3ETGA 2MA3A 2Y48A 1OYYA 5LHGA 2GN4A 3WGHA 2VYNA 3I53A 3ABTA 5F1KA 1OPCA 2ELHA 4HX4A 1FYKA 2DUWA 4BKQA 3D0SA 1IN8A 4QSMA 1D7OA 4QO7A 5CDTA 4XSXF 2MH9A 5D5WB 3W8DA 3AJRA 2Y93A 2V65A 2HCTA 4D43A 4EITA 5TIIA 2A94A 5DDIP 1P4XA 3JQEA 2VTEA 3K1NA 2O3SA 3QV1A 4M89A 5IF3A 1YOVB 2PR2A 3DZKA 4FC7A 2C54A 2QZZA 2AG8A 4I5GA 3ZHZA 4MEXF 4RZHA 1KEUA 1DP7P 2X9VA 2YPRA 1RI7A 2OZUA 3TDZC 1OMOA 4ZQHA 2EJRA 1I1GA 3ZU5A 2OQRA 4NBWA 2GZWA 1XA0A 3DPTA 2C0CA 4CMEA 2EJVA 4M6XA 4IGFA 1LDDA 3CUQC 2O2YA 4PZJA 3HDQA 3BROA 1UDAA 4Q3NA 3EVNA 1MA0A 3M8FA 5L3GA 4PG8A 4JK3A 3OETA 1ZGAA 5C7IO 4GWGA 1GCOA 1R37A 1FDSA 1QQIA 3W6JB 5BMZA 1IZ9A 5L7WA 4IBOA 1HYHA 4OL9A 3WLEA 3H3JA 3G73A 5BSEA 2TMGA 2COMA 4I08A 5JDIC 3DL2A 4Q4ZF 2OP1A 2I66A 5TRTA 4HNGA 2PGJA 2PFGA 4AIHA 4XJSA 4R5MA 1Y9AA 1O7LA 4G2NA 1AOYA 1B8PA 1I8TA 2DAOA 2W98A 1BM9A 4RLHA 2BMAA 4LLNA 1JWBB 2ISZA 2HJRA 1K6JA 5A9SA 3ZMTA 1E6WA 1NFFA 3RQSA 2FSSA 2VWHA 4F6CA 1C0WA 3NT2A 4OQZA 1Z74A 3IP1A 2W84A 4OMYA 3BTVA 4R54A 1CF7A 4OOIA 2GWRA 2R7FA 4BHPA 5K5QA 4EGYA 1I3KA 2WWYA 5L95A 2CSUA 2NADA 3TKYA 1Y0UA 4MVJI 3NTRA 3WIDA 2EGHA 3BMQA 3B1KA 3EDMA 4PLZA 3GXOA 3LFKA 1GDHA 1W4ZA 2NTJA 5DCFA 4OIMA 1AXEA 3D7LA 5ICEA 1IULA 1T38A 1E7WA 1ML3A 3T8RA 4NFSA 3O3KA 4I02A 2B4RO 2ZCWA 1YOVA 4A2UA 5D8LB 1O5IA 3IUSA 2A35A 3V8LA 4CLOB 5EMHA 4YB8A 3JYQA 4IS3A 3DHNA 2ZCUA 1EH8A 1UZNA 2QYOA 1GFSA 6PAXA 2NU7A 4ZQFA 3SEFA 3SHFA 2FBKA 3IKTA 1DIHA 2Y1OA 4MVJG 4FHTA 1ZJYA 1NFRA 2QLZA 1WLYA 4ZYDA 5L4LA 1VJ0A 1KERA 1DPGA 2DM6A 1TLHB 4HDVA 4AIKA 2CVOA 2UXXA 1B3BA 2O50A 3FTPA 3FM5A 1P45A 3ZZNA 3RC7A 4F46A 2ADUA 2DI3A 4I7HA 4RLSA 3DBRB 5DCMA 2Q3EA 3N74A 5FEUA 1Y8QA 3INTA 4BNKA 2BFOA 2YQ5A 1U5TB 4EQQA 3H3ZA 4XDZA 4WOKA 1Y5RA 5EPOA 5HS6A 1C1XB 2D59A 5FLXZ 1ONPA 1IN6A 1ZFNA 2BF7A 3R3JA 3I5UA 3L77A 4DIOA 1EFKA 1JU9A 3CUKA 4E2WA 1GEGA 4BKRA 3PK0A 1W8DA 3ANNA 3QE3A 4M71A 4PG5A 4MDHA 1FMCA 3GPIA 3LC1O 4ND2A 1UFMA 1N7HA 3VPSA 3R4KA 2Z33A 1WW8A 2JHGA 1LI4A 3BWGA 1ZG1A 4BMNA 4DLBA 3F21A 3O6BB 5J6XA 5ILSA 4YJFB 4WCGA 2W24A 3IWFA 4K9DA 2ZKZA 3PQDA 4CGZA 4EI2A 3QU6A 4XRRA 3TZCA 4CLHA 1FF9A 2R2GA 1G0NA 1XGMA 3O2PE 1VSVA 4IDFA 4XCVA 4CUZA 2R00A 3W8FA 5TS3A 5LLQA 4Y15A 2DU9A 4P4NA 1IHYA 3VH4A 1EMDA 3CLOA 2V9VA 1A72A 2CD9A 4UEJA 2M30A 4TRMA 7ADHA 2X6TA 4G81A 2JFGA 1M2WA 4JP2A 1YS6A 1H2BA 4S3MA 2EKQA 4G7HF 4Z3KA 1VL8A 3GDGA 1EE2A 4KTTE 4UHTA 5TT1A 4M55A 2O3TA 4BKPA 1N2SA 1CF2O 1G3YA 2W25A 2ISYA 3HRTA 5ICFA 1CGPA 1AXGA 1SEPA 4QFCA 2CSOA 3DAFA 3LDHA 1PQPA 3D5TA 5TT0A 1MDMB 1ZVMA 2VOJA 1HBXG 4EMSA 3HRUA 2W85A 3I4FA 2WYUA 1ISJA 3Q9SA 2NU6A 1U4SA 1FOKA 3IC7A 5E17F 4K6FA 3HSFA 3WGQA 4N0BA 3I64A 4F7ZA 1TW3A 1A71A 3GPDG 4WPGA 2B4TO 3LT2A 1XDWA 1DXYA 2FN7A 4TWRA 2EFNA 1B3RA 1ULSA 4IINA 3TQHA 3IJRA 3VPGA 3I5MA 4L74A 3E5RA 2P5UA 2J3KA 1SB9A 4QLCU 2CGPA 4CR7A 4NQZA 4P38A 3V2GA 3MEXA 1R1UA 3ECHA 3L9FA 5J23A 2GIVA 2NVUB 3WNVA 2QUFA 2AW5A 4HV6A 2JHFA 4J0EA 4FC6A 3W6KB 4Z0PA 5B12A 1SO8A 3MJEA 1YDWA 2GN8A 4FFMA 3CZMA 5JSFA 1IB6A 4UV8A 1NP3A 4YYZA 2P4WA 5IJZA 5KJFA 3KTDA 1HT0A 1IUKA 4PCVA 4EW6A 4L8VA 1SMKA 3S1LA 3QAHA 5ENVA 4D45A 1GXQA 1SCUA 4J2OA 4HA8A 1U5AA 3E9MA 2L4AA 1O3RA 3NT4A 4I1IA 5TNXA 1X7HA 4CQMB 4XIYA 2XVCA 3T7EA 3WTCA 4CV2A 3K0LA 2ESHA 3I9OA 1BN5A 2O61A 3ELKA 1XGSA 1UDBA 4C4OA 4S05A 3WTWC 1L0OC 3HSEA 1XGNA 3ZNQA 3JYNA 3EC7A 4XQ9A 4FJ0A 4RVUA 4CLRB 2A61A 1L7DA 4U6QA 3EHEA 1F4KA 3UCFA 3WMXA 1ZK2A 1G1AA 3QU3A 1U3UA 2VYND 4A73A 2M87A 2HSDA 4ID9A 4BO5A 5IZCC 3CUOA 5HS9A 4S04A 2EV6A 4GGGA 1PL6A 3I6QA 1P6RA 2HQRA 1J49A 1GQQA 4BHCA 1OKRA 4CICA 5IT9K 1EVJA 3ZN1A 4A12A 4YG2F 1USSA 1HE3A 3MJSA 4FDAA 3PQEA 4UEKA 5LDHA 2C59A 1TI7A 3H9EO 2JD2A 3C85A 1B9NA 1Q7BA 4FFPA 3UKOA 1SFEA 1BXZA 3DDNA 4CL8A 5CYVA 2ILTA 3KRTA 5IZ4A 2ZJ1A 1UB9A 3ZMSA 1HWYA 2DU8A 2NACA 2Y1FA 1HRDA 4RB0A 3F9IA 4MVJM 3JD2A 1T2AA 5BQFA 1PQUA 4ZH4F 2RHRA 4M87A 2PJPA 3BMOB 3WB9A 2I9PA 3I4CA 4ND1A 3J81K 1AE1A 1MUUA 3HG7A 1U1IA 3IC5A 4C7JA 2VTDA 3Q2KA 2KIFA 2GASA 4WX9A 3VZPA 4R1NA 4ZICA 5DUIA 4JXKA 3W4JA 2GRAA 4GSLA 3HHGA 4KMSA 1T4BA 4A03A 2K86A 4W9NA 3TO9A 2Y0MA 4WGGA 3JCZA 3BJAA 1XU7A 3NRCA 2WDZA 3FM3A 4CLRA 4AICA 1HW1A 5ERIA 1WDLA 4BMVA 4MEYF 1PR9A 2DFVA 3WE3A 3BMNB 4EGZA 1DFIA 4J7UA 1LDMA 3GVXA 5ITWA 4Z0HO 4EM1A 2W2LD 5EN4A 4Y6RA 1IPFA 1VLLA 2YSRA 3JSAA 4D0RA 2ZNYA 3BMCA 5KCZA 3DMTC 1SD5A 4Z3DA 2FEZA 2A6HF 1LSSA 4E2YA 5T5QA 4M73A 3GYHX 1NASA 3SXYA 1ZIDA 3WFIA 1SBYA 1Y6JA 1JGSA 2XAAA 1HZJA 2HKIA 3D3WB 3KZVA 4GQAA 3RBXA 2Y0EA 2LF7A 1K89A 2GQQA 4BUCA 1IZ0A 5EQFA 1H9GA 4R79A 1Y7TA 1X15A 3E5MA 5G0UA 3UGKA 4MVJP 3RC1A 4AJEA 1W4MA 5CDUA 2Y1EA 2YFHA 3PHGA 5BR7A 1HE4A 2P6SA 1BOAA 4O6JA 4G9YA 2NSDA 4BXUA 5ADHA 5F6FA 4B4UA 4L76A 1E7QA 1XMKA 5KVRA 5C7OO 3VOSA 2O3QA 2MH2A 3IRRA 4KMFA 1ADGA 1Q2XA 3LT0A 4WLOA 5CDSA 1MZBA 1YW8A 3KXDA 5EERA 2IRFG 3U49A 3NT5A 2E6UX 3FD8A 3GGPA 4BV8A 4IM7A 4WXDA 3OHSX 3GAFA 4TMFA 5J8FA 2FMYA 3HZZA 2Y75A 5JLAA 2NM0A 3SZTA 3TDUC 1DRVA 3DTTA 1E3EA 2Q0OA 5F5NA 3P9CA 2PGLA 3TDKA 2LSOA 1LDJA 4R51A 4J91A 3BY6A 3FZVA 1C3VA 3WTTC 4PDKA 4UUVA 4UVGA 2L02A 3S2IA 3WTVC 3HOSA 4JLWA 5THQA 3QWFA 5E20A 1X0VA 2GSDA 3KEOA 2POQX 3H9JA 4HY3A 4R3WA 4TVBA 1ZARA 1E1NA 1GEEA 3KOUA 4IRIA 4J0FA 1I2BA 6ADHA 4D0SA 3WR5A 5IT3A 1IY8A 2OP0A 3KM0A 4J4BA 3ITDA 4BO8A 1HDOA 4IGEA 4Z9FA 3WYEA 1V4RA 3SBOA 1QGPA 3D3WA 3E8XA 3UAGA 2OU2A 3HOTA 1B8UA 4KZPA 1U78A 3GG2A 3GDOA 2XIGA 4AJPA 4YACA 1IUYA 4RS8A 1XYGA 3I0TA 3BTSA 2K27A 3GVCA 4RZIA 3EDPA 1W5TA 3K9TA 4WXCA 3EYYA 1LLQA 3U62A 4EUFA 2CDCA 3K9QO 1ISIA 1ZXBA 1XCBA 4GXOA 3ULKA 3WYCA 3UUWA 4R3NA 4E13A 2F5FA 5KVCA 3J81Z 5MGBA 3WTSC 2D5AA 4FQ8A 5F3RA 1WQ2A 4RAZA 2QRKA 4DMLA 1I10A 1CQIA 3FMRA 4PRKA 2KJBA 4J90A 1PJSA 2Q1TA 5L3CA 1PZFA 1GAEO 2GERA 4BNIA 4OIRF 1LEBA 2FNAA 3SQNA 1PJCA 4EUHA 1A7KA 2DPHA 4Z0TA 1CQJA 3GRPA 2P5YA 4FFNA 4B4OA 1TVEA 3PP8A 3W6ZA 3I71A 3WU0A 4A0SA 4WK8F 1GL3A 2PBIA 4LFUA 3D4PA 2FMLA 4MKXA 4I5FA 4YT2A 1F9NA 1WKMA 3JD4A 2G7HA 1ODDA 4ESBA 1ZH5A 1CRWG 1EE9A 4AVPA 1HTBA 2QG4A 3MOIA 4YJDA 5T8KA 1N1EA 4TRJA 1CYDA 3WX0A 5U9CA 2Y66A 3DXFA 2AQ8A 4MHGA 3STHA 3ONFA 4AJKA 4E31A 4E5PA 3WYBA 4XA8A 3S55A 4W82A 4E33A 3DZGA 2ZB8A 1H0MA 2GXBA 1LC0A 5JAQA 2DKNA 4RGBA 4P22A 3PWSA 2Z99A 2V7PA 3ZWMA 5JI6A 4ILKA 3M9AA 4L0QA 1KC3A 1ZLKA 3ZPLA 2G7UA 4DTIA 3QQPA 5DP2A 4QO8A 2V6BA 2JZYA 4KQWA 2O7QA 4XIJA 1KEWA 4P96A 2ZTMA 3PZBA 4Y9DA 3WXBA 4CUKA 5T57A 5HS4A 1M75A 2VOOA 2DTEA 2W57A 3ZMZA 1D1TA 4YPOA 2PD3A 2X0LA 4B8WA 4YRDA 4GL4A 4P4LA 2XV4S 1F8FA 2BGKA 3HFGA 4WOJA 4CMAA 2QX7A 3I1JA 2E7XA 1FK8A 4Q3BA 1I24A 4QX6A 4CM7A 2FSWA 1JLLA 5LGNA 1D3AA 4G8XA 1NYTA 4AJIA 3A4VA 4AFNA 3CIFA 3V8BA 4PZDA 4IZIA 3ZU4A 5U1PA 2BGCA 3QIVA 3RFXA 4WEQA 1A5ZA 4IZHA 1CWUA 4IY1A 4J2HA 3ZN0A 3AK4A 2FOKA 1F14A 4KTVE 1YONA 2JAPA 4W7IA 4RPJA 3GZ5A 3P19A 3KCCA 3ZV6A 4HF1A 3OQBA 4WCFB 3DV8A 4BNVA 2KIMA 4RB3C 2JAHA 3OM9A 3TOBA 3E6DA 2HK9A 1EK6A 1T2KA 3JAMK 1FWZA 5CG1A 2OZ6A 3WU1B 1IXSB 1J75A 1A4UA 2WSBA 3ZMVA 3CTMA 4UUMA 4ZA2A 4F45A 1O94A 1VKOA 1T25A 3R0JA 3C1AA 3IKVA 4PLWA 4L73A 3RTRA 3ZWNA 2VOPA 4HZFA 3RUHA 3WWYA 5C37A 1QO0D 1J6UA 1LNWA 1LDBA 1A7AA 3NEUA 5DOVA 2L4MA 4NH4A 1J4AA 2Q1UA 2JCXA 3K69A 3A14A 4GH5A 3TSCA 1E7SA 4E70A 1GYQA 2ZB7A 2AE1A 4IS2A 1X0XA 1RPNA 3Q3CA 4R1SA 5KKAA 1G0OA 5ILOA 1I27A 4Z2YA 2YFQA 3L9WA 2EP7A 3OJFA 1IXCA 5A5EA 2IEDA 3LA3A 3P9IA 4XJTA 1X1EA 4Y6PA 3NEPX 2EV9A 5H82A 5JDCC 4RCVA 1DLJA 1Z82A 3C3WA 5TGDA 5IDXA 2IA0A 2ETHA 1D3YA 2IXBA 2V6GA 4L4XA 2M1BA 4OU0A 3KB6A 3NRVA 3PIIA 1ONVA 1LUAA 4U88A 1LDGA 1VI2A 4A6EA 1BXGB 2OFPA 3COSA 3GNTA 3GOHA 4MGRA 4YAEA 2JCYA 1DC3A 2P7CB 1RIOH 3ICCA 4JGBA 4PLPA 2D5CA 4LG0B 3VKVA 4BNUA 1TNTA 4G94A 1JXSA 5A04A 1DOHA 3M6IA 4B8XA 2O03A 5JMPA 5JCXA 1SEVA 3F1KA 3WMWA 9LDBA 5I7SA 2AMFA 2FRHA 3L4BA 5A4DA 4NNJA 4IVNA 5JVTA 1NQOA 2FPGA 4ZRNA 5COQA 1XSXA 4ASNA 4KNYA 3MOGA 4FIZA 3QP5A 1T2CA 3CPSA 4TROA 1E1LA 3HTSB 1FC3A 4WCFA 3GFBA 1K6IA 3WQSB 4EGFA 5CDGA 5IXYA 4HBLA 1DUXC 1N8KA 1HZZA 3NJ4A 3V1YA 3VOEA 3GO5A 3WTZA 3VDRA 4XD2A 4FOSA 1E1MA 2JL1A 1OC4A 1J2XA 3KLOA 2EFOA 1R1VA 4FOOA 4RJTA 3UXYA 3OQ6A 3HJAA 1Z91A 4DC1A 2PLYA 4E5KA 5LRRA 3U2RA 3UH1A 4H7PA 4UUOA 4A0XA 2VRBA 2X9GA 1Z45A 2QRJA 3W4KA 1NAIA 4YEDA 3LC7O 3ZNOA 5KWEA 4AJHA 3T1BA 4JBHA 1V3VA 4XYBA 5HWSA 2EW2A 4I01A 3EETA 4BO7A 1I3MA 2VT3A 5LHIA 5EL0A 3OIGA 4IIVA 3HNPA 1WZEA 4AL4A 4NZ9A 4YBZA 3E03A 4WWCA 3GRKA 1FSEA 3KLPX 1R12A 1XU9A 4CQLB 3GW2A 2R3SA 1R4MB 1KETA 2EERA 3ZDFA 4AJOA 4Y17A 3MCVA 4E5NA 3FNFA 3KZYA 3T4EA 4MTDA 1E3WB 2YDYA 3DBLB 2VXZA 3D0OA 5G4KA 3E5XA 1QNTA 4Q48A 3GFIA 1BXGA 3JQBA 3K5PA 1E7RA 2YJZA 1B6AA 4YIFA 4A10A 4QQRA 2BH9A 2PH5A 3PJFA 1K6OA 2WTEA 3DAGA 3MTJA 3AI3A 3FHZA 1P33A 1FSHA 4MPDA 3ONDA 4W99A 3BIOA 4ITUA 4O5OA 4OQYA 1E17A 3GMSA 1XSVA 5IN4A 2P4HX 3ZMUA 4LSWA 4W7HA 1R5GA 1N7GA 3JD0A 3AM4A 1JWAB 3TZQA 3AUUA 2IODA 4HAMA 2O48X 1KQ9A 3ETEA 3WQRA 3BZUA 5K6AA 3H5AA 4S1VA 1MFZA 2FOIA 4IDEA 5DOZA 4P9UA 3CE6A 1EZ4A 4H3VA 3GDFA 1HQCA 2AE2A 4RQUA 3ZHXA 2J5OA 2KKOA 3DTYA 1OBFO 4FFLA 1VRWA 2VE9A 1CDOA 1HW2A 1LEAA 2GLXA 1RUOA 1QYDA 2PV7A 3RUAA 3WGZA 4OINF 3DKWA 4LCJA 5FF9A 2BGMA 4E6PA 4KUMA 5JY1A 5LRSA 3K6JA 4J49A 4BKUA 1EDOA 5H20A 3I9JA 1ISMA 4J1QA 3DPLC 1EK5A 2H27A 3PJEA 5CPBA 3C18A 2EXXA 4CDGA 1U8RA 5ICGA 5C5IA 5EESA 5L7YA 2O7SA 3U4DA 2PI0A 1SZJG 1GCUA 3VTZA 4IF4A 4P5OA 2Q1WA 4PN3A 1IRGA 5FLXK 3ML6A 1E3WA 1OYIA 3HRSA 3PFWO 5DF1A 1KU2A 5HDKA 3DBLA 4L9NA 1U5TC 1CF7B 3HDYA 5TSDA 4M49A 5G0WA 2OL4A 5BSHA 4TQGA 2XRNA 3WTXC 4L5JA 1Q1NA 3BMQB 3CH6A 5I9MA 5FO5A 1KC1A 1HYEA 3JQAB 2JRTA 4PIVA 4PVDA 5B4VA 4CM9A 2JD0A 2B36A 5DNAA 3JQFA 4DYVA 1LXCA 3FPCA 4LRSB 3ECOA 1AGNA 1TA4A 3GVAA 2LDBA 5CHEA 1HLPA 3PHLA 2WJPA 2I3AA 2FPPA 3TOXA 2AXLA 4HKTA 2AG5A 4JX8A 4ZYGA 2OHXA 1I33A 1K5HA 4FSHA 4RPKA 3V2UA 3L00A 1EVZA 1PJ3A 4BO9A 3LQRA 1C0LA 1U3EM 2HS5A 3PXXA 4M1QA 4DQXA 4I0BA 3C8MA 2PKQO 3PEFA 3UICA 1IE3A 3JTHA 1VSUA 3WTYC 1S6YA 2X0NA 2GN6A 2JCVA 4BNLA 1ADFA 4K28A 4OOEA 5T67A 2EWNA 2MLKA 1R7JA 3FHLA 1T4DA 1VC2A 1KVUA 4O63O 5F1PA 3Q2IA 4AJ4A 4XGKA 4YQZA 4K2EA 1ARZA 2H63A 3KEQA 1R4NB 5D8KB 2B5WA 3F8MA 2HMSA 2BEOA 2HQ1A 2OORA 5DCMB 5KVQA 1PWXA 3EYWA 1Y8QB 2DC1A 3TO6A 4R8HA 5HA5A 3RUFA 1H94A 2J3JA 3QVWA 2M45A 2P5KA 4WEOA 1XR3A 2Y99A 1VTNC 4BQRA 4IQGA 2G82A 1PL8A 1SD4A 2UV8A 1E3LA 4OYRA 4QT0A 5JC8A 2K4BA 2LDXA 4NK5A 3E18A 5FI3A 1ZRCA 2GGSA 3CMMA 4TVOA 5I7EA 4R68A 1EH7A 4X54A 2HRZA 1DAPA 3DB2A 3JQAA 2BD0A 1D8AA 2YX4A 4OH1A 1IPEA 4WLFA 1Q1HA 3JSPA 4RVHA 2ZJ2A 1WZIA 1PWZA 1REPC 1F8GA 4DXHA 4L4RA 2NTNA 2ZYDA 1SD7A 3V1UA 3VC7A 3JQ8A 4E2XA 1NVTA 2UUPA 5JO0A 3U4IA 4N18A 3PIDA 4BNYA 1GTMA 4E32A 3DC2A 4Q3CA 4MINA 2G5CA 5CVVA 1P1FA 4Q9NA 3RUDA 3U4CA 3ZWAA 4J7CA 2HKXA 4RPGA 3NX4A 1OR7A 1CERA 3GNSA 3ANMA 4J6FA 5THKA 3AW9A 1KOLA 1G3WA 4Q47A 1IYZA 1P74A 1SOWA 1UXJA 4BQAA 1Y9EA 5BSGA 1RM5A 4PLCA 2I5PO 4FR5A 1P44A 1VE9A 3DFGA 3HE3A 1YQXA 3AUAA 4A26A 1XGOA 3C1OA 1BC7C 3NGXA 2E4AA 2H6CA 1FP2A 1I0ZA 1R4NA 2QYTA 4WECA 1LLCA 3MZYA 2O2SA 3VEPA 1Y5MA 5BS6A 1WPQA 1N1GA 1UZMA 3E1KA 1PTJA 4Q3AA 4IDCA 1EH6A 4BHTA 2NUAA 2EF1A 2WEKA 3PLNA 1IW7F 1FP1D 1SFXA 2A69F 1YB1A 1DPUA 3AFNA 4QEDA 3UHAA 5DEQA 2YDXA 3TZ6A 4M54A 3FWNA 3H92A 1PZEA 4BKOA 4PZEA 3NQOA 1DIBA 4Q3DA 4JJFA 1GQ2A 2XUBA 1YH3A 3FSRA 1PQWA 3G1TA 2GA2A 1KVQA 2PTGA 2V6FA 3ASVA 4ALJA 2DBBA 1KEVA 3FBTA 3K2EA 4TZKA 3N4MA 3U5TA 4PGGA 3OA0A 5DCWA 4OXKA 5AXCA 3ZCXA 5ED4A 1LDEA 3OF2A 4LW8A 3TJRA 1MC5A 1ZLJA 3GK3A 4P55A 1E0DA 3GAZA 4Q3EA 4BGVA 1I32A 4C7KA 3ZU3A 1O89A 2DFDA 3JTMA 3H2SA 2LF8A 2P7VB 5E1ZB 2B37A 1JKFA 4MIEA 4NBUA 4BNWA 1I1SA 5E8IA 3K30A 3MZ0A 4PG6A 4OKNA 2A3SA 3KYCB 3RVDA 4DWVA 4XZ3A 4IQ0A 3F8FA 2J6IA 2D1YA 2BELA 4W4TA 4YQYA 3WSVA 1P1HA 2JFHA 4BH9A 3TQNA 4UULA 5GMOA 2C7GA 3S8MA 5L3FA 4P4GA 2NYXA 1D1SA 4LCEA 3WBBA 1YJQA 4LLGF 2P9CA 4JK1X 3B1JA 1G3TA 5IAAA 3I54A 2C7VA 4CMKA 4MP8A 3I59A 2PFBA 3KSDO 4J7XA 4MKZA 2RC4A 2DLDA 1G3SA 1WWKA 1ZZEA 3AOEC 2EG9A 3DZHA 4J1TA 4YVFA 3TRIA 3K73O 5L4SA 4HF2A 4IIUA 3CEAA 4E12A 1CJCA 3GZ6A 2PZMA 4G5HA 4NQWA 1UDCA 2VZ9A 3KYDA 1S7OA 1NPDA 4EJ6A 1R36A 1ADBA 1PR3A 3JV7A 3KP7A 3LAJA 3ONEA 3Q9NA 1F1ZA 5DYMA 2F1KA 1LDNA 1DHTA 1RKXA 2CDAA 4RDHA 2VNAA 1BXKA 1YQGA 1EQUA 3HIFA 1WAMA 3GF4A 1VM6A 4QUKA 1P4AA 4XKJA 3SC6A 3MWMA 1Z73A 4ALNA 4B7CA 5BSFA 1VPDA 5I9LA 4MP6A 3ADOA 3OJEA 3OH8A 4ALLA 4HUJA 2BV6A 5K0ZA 1TLTA 1DRUA 3EZYA 2HTSA 3TWOA 4JQCA 3ULQB 3I52A 3OMLA 3X2EA 3O8QA 3ERED 6LDHA 4FJ2A 2GXGA 5ENDA 5TJHA 4B7XA 4UREA 4PG4A 1X3UA 4ZYEA 3C1DA 1P1RA 4Z9YA 5K9ZA 1C0KA 4NDNE 3Q0EA 4B79A 4B8ZA 4OSOA 1HSJA 2HFHA 3BDDA 3V8KA 2NTVA 3H4VA 3WOHA 1HE2A 2AQKA 4BL5A 2DBZA 1J7KA 2X5KO 3JQDA 1MG0A 1V35A 1I6XA 2C6YA 3JQGB 3KYCA 5JE8A 5IXSA 3TNLA 3M1LA 1YJ8A 3J80K 4LK1F 1E6UA 2UAGA 1ZSYA 3RIHA 1R58A 3K8ZA 4M72A 1BDBA 2JD1A 3E5UA 2D2IA 2X7HA 4I9NA 4BGUA 5DT9A 3R0AA 1R16A 4JBGA 3GUCA 1ENYA 3M1AA 3C24A 5CVJA 5LDGA 3JQ7A 3TPCA 3LAPA 4YFXF 2VHZA 3LSYA 3PFIA 1J59A 1ONNA 4KMUX 3HUGA 3WGGA 2HEOA 2CWEA 1YQAA 2XAFA 1LB2A 3EGOA 3GZNB 4OGWA 3CUQA 4R4JA 1YBVA 1M66A 3S2GA 5GZ1A 1WMAA 3DBHB 5I8ZA 5BNFA 5FD5A 1JN0A 3RPUA 1ZK0A 2B35A 2BFPA 1XSDA 1EFLA 3FN4A 3OIFA 3U3XA 1BC8C 5A3JA 5E18F 1BWSA 3NV9A 4BGEA 3I9KA 2E37A 4U7BA 2F00A 4DPKA 2I76A 5L51A 2JJYA 4CM9D 5JDIA 3BMCB 1QV7A 1U2GA 3GHYA 1TBXA 1JQBA 2I6TA 3WNQA 1TT5A 2H9IA 2VNSA 3IWZA 3QPTA 1H6DA 3C7AA 3EVTA 3L6OO 2XASA 1P0FA 1K3TA 1PGJA 2WV0A 4CR6A 2HRBA 4KICA 1MD0A 1LTHR 3RDIA 3HB5X 2CF5A 2CFCA 4ZZDA 1P92A 3LC2O 3PYXA 4NPCA 1XWFA 4M6YA 2EP5A 4LB6B 3SXPA 5CPFA 5DD8A 3RBZA 1ZN2A 4KN4X 1D8KA 5HS7A 3ZNPA 1HLDA 3S2WA 1TB4A 4ESOA 3OEYA 4DNCA 3JQGA 5FGMA 1PGNA 4D41A 2DQ4A 2NS0A 1MC4A 1KIFA 1STZA 2HR3A 1FLIA 2GF2A 2WM3A 3HN2A 1Z6TA 4IMPA 4JCOA 5IG2A 3GFMA 5A2QK 1MX3A 4ZZLA 3L2CA 1UH5A 2XHKA 2ZYAA 5A3VA 2FWMX 2FMUA 2E1CA 2X0IA 1HEUA 1GZ6A 4LVCA 1R0KA 5EEGA 5F1RA 2RHCA 3ZWXA 2F5CA 1BSVA 1PJBA 3IAHA 3LQFA 3OFSA 4NG5A 2RBEA 4XYGA 3VVBA 3VVCA 3BHJA 5AQ1A 3T4XA 1DIRA 2PMHA 3A06A 4GLLA 3GZNA 1WI9A 4A5NA 4ESJA 1J5PA 1V3UA 2C2XA 4KOAA 4LK3A 3DBHA 4U8GA 2FP4A 1MGTA 4RF2A 2QQ9A 1SFUA 2HGCA 4KUGA 5A9TA 4D0PA 3AAFA 3ASUA 2P5VA 2G17A 1J9IA 3HSKA 5DBIA 1QP8A 1ZMOA 3JQAD 4M8SA 2VODA 2TDXA 3JD1A 3I3OA 3F8NA 4GLOA 3ZW8A 1ENZA 2V1DA 4KFCA 1U4OA 4FX0A 1XD7A 2ZTVA 2FZWA 5CEJA 4UUNA 1U3WA 3CZRA 4YT5A 2DK5A 5C7LO 4U6SA 3LZ6A 1XMAA 5H6QA 2CO5A 4EEZA 3AUTA 3PDUA 3M8EA 2ZTUA 3BYZA 1N9GA 2QWWA 1Y8RA 1DB3A 4HQMA 3U4HA 1W7PB 4GMGA 1CIVA 4ZQBA 1P2FA 2UVDA 2VUUA 1I2CA 3U0BA 2CFXA 2J8ZA 3AY3A 3UOGA 4N5NA 5DUKA 2YYYA 5DP1A 2A07F 4R5HA 2WYWA 5L45A 1DHRA 1HSZA 1PGOA 1NWCA 2A5YB 1HDRA 4BO2A 3J80Z 3WTUC 2CNBA 4KWHA 3GLQA 2RH8A 4LMYA 3CO7C 1PS0A 2B5VA 4R1HA 2YHIA 1XB4A 1BI3A 1B16A 4HADA 1PGQA 2VC1A 5KIAA 5HTOA 1F5TA 1LRKA 3WJ7A 1FBQA 3WG9A 2GO1A 3H6KA 3NTOA 4MVJA 4ENJA 2NQTA 4CMJA 2ZMEB 1HDYA 2VUSA 1BIAA 3LSTA 4P8RA 1TTYA 1IXRC 3ROPA 4HLXA 1NPTO 1H5QA 3DF8A 5H6RA 3ORFA 2TMDA 3R1IA 3AUSA 2VONA 3MJVA 5JBIA 4DUPA 3BZ6A 4MTEA 1DJNA 4ENNA 1LRLA 2BFAA 3RSHA 3PHJA 1R6DA 2YV3A 2UZKA 3RIRA 1DC4A 1LRJA 1P1JA 4OXYA 3FTNA 3KSUA 4TRRA 3ROMA 3CTAA 1BJAA 1UAYA 3LK7A 1PZGA 4NBVA 3BHMA 3QWHA 1QKIA 2IE0A 3NGLA 4F6LA 4RQTA 2XROA 4KT5C 3EZLA 2AHRA 1ZHFA 3AY7A 3PGXA 2L3DA 5DDGA 4IJWA 2X5JO 2RVCA 2D2WA 2OQGA 1C1DA 1Z1DA 1SC6A 1ISGA 1HDCA 5BPIA 4FFOA 3DOCA 1DBVO 4CM4A 3CO6C 1JAYA 2NV6A 2OO5A 3PRJA 4MKRA 1W7PA 5GZ6A 2X8LA 4XB2A 2FY8A 5GZ3A 5TQVA 5JAIA 3K1PA 2I67A 4FFRA 4II3A 3VPHA 1HDZA 4B3JA 5IDYA 3DXJF 2Q2QA 1D5VA 4MVJF 5KVVA 2LDUA 3KHUA 2RV8A 5JO9A 5A05A 5JW6A 4GGOA 1K78A 1XELA 5A2QZ 2GZ3A 3RUIA 2HMWA 4YAJA 4P9FA 5CG2A 1H6BA 2ZO4A 1I30A 1EUCA 1SPXA 4CV1A 3P2OA 3COAC 1TNSA 2IZZA 4CPDA 1QLJA 4DA9A 5JFOA 3UF0A 3JQ9C 1XG5A 3ZMDA 5L3EA 3GVHA 4OOFA 3QOPA 2VN8A 3H3FA 2H09A 3QA9A 4N9IA 4WASA 2ZMEA 1V8BA 4PRLA 1Q0LA 4CV0A 4J3FA 4J4HA 3AM3A 4PLFA 1H93A 1BIBA 2FPIA 1I5ZA 2DW4A 2X23A 2UYYA 4KP7A 5H83A 3SX2A 4MVJH 4E30A 1IN5A 2NRAC 3AY6A 4I5DA 2QZ9A 5L9AA 3WJAA 4CQLA 3KUXA 1RM4A 5DZSA 4YRBA 1NR1A 3E6BA 4EV0A 2Y0CA 1ONOA 3C7DB 3V7CA 2X0JA 3G17A 1V3FA 2HLPA 5AXDA 5LEKA 1HF3A 2O3RA 3UN1A 4B7UA 4BMSA 2VZ0A 4EBFA 3IOYA 3ZI0A 2CQKA 3T7CA 3TZHA 1U28A 4I9UA 4YAKA 1V3TA 2FA5A 1T1RA 3LLSA 4BB6A 3WDSA 4WLNA 1E1KA 4DC0A 4BB5A 2UXNA 1PU2A 2Y05A 4NJMA 2VBYA 1WMBA 1YB4A 2X9NA 3GVIA 3H8VA 3KYBA 3E82A 3LWFA 1V6AA 2P68A 3FNGA 2QBYB 2EWMA 4KQXA 4GSKA 2ET6A 2I65A 1GV0A 1S7AA 1K2WA 1YXMA 3C7JA 4CMIA 3VHRA 3TFOA 1Z7EA 3VDQA 2FE3A 3HQ4O 2DTDA 2A4KA 4PVCA 2VZ8A 1FDUA 4AVYA 2M8EA 1U2WA 2JTVA 2XAHA 1G4DA 1LQ1A 1VJ1A 3PTZA 4G65A 5F21A 1R23A 5HM8A 2K7LA 3BPVA 4ON0A 3INRA 3LF2A 4U7WA 2A68F 2QQAA 4D7AA 4A6DA 2CDBA 4UVIA 2H94A 3E3VA 3ZH2A 2OXIA 5HLHA 2FF4A 5H81A 4GAEA 3WSWA 1SAXA 2C5EA 3EMKA 2EGGA 4IXWA 5IDWA 2A6EF 1B26A 1GQYA 2ZJ0A 1KVTA 1LQUA 1JVBA 4CUJA 3EW7A 4AWXB 5BT9A 1I3NA 3KE2A 1YL7A 5EIOA 1PX0A 4IMRA 4XGIA 3GZ4A 1BW9A 4L5IA 3NUGA 5BNIA 4EJOA 1MKMA 1ZBQA 1T6SA 5HLGA 4B3HA 2H1SA 2R6JA 3PYMA 3JQFC 5F1OA 1AN9A 3VB2A 3GUYA 1XLTA 3V2HA 2Y1CA 2MC3A 3W4IA 2Q50A 4E0BA 1UJMA 3BPXA 4O6VA 4RDIA 2AEMA 2IW5A 2PZKA 1QSGA 3CMCO 1LDKB 1YL6A 3F5SA 4DLAA 8LDHA 4GMFA 5HVQC 3IP3A 1GADO 4HLYA 2CVZA 2W2KA 3QY9A 1C0IA 4E3ZA 1ZKMA 1D4FA 3F72A 3HRMA 4CHUA 1PS9A 3PPIA 1UP4A 5EQDA 1QLHA 1JVSA 3GT0A 1NXQA 4AIJA 4KDPA 1Z75A 4CMEC 2QBYA 3C7CB 4XRGA 1PEDA 4YIIA 5AXBA 3QLJA 3DMTA 4A0ZA 3QWIA 5U4QA 1ZK3A 4O59O 3F3XA 4UVBA 3BTUA 5JPIA 5KTKA 3ANLA 2X58A 1ZAOA 1MB4A 5DV5A 1LA2A 3K31A 4YT8A 3LQQA 4ALIA 2P4QA 3ST7A 4W6ZA 2IXAA 4A5OA 1P9LA 3DO5A 1FJHA 3L4SO 3VPXA 2OGUA 4FX4A 1LC3A 3DZFA 4GI2A 2WTBA 3LLVA 3R0IA 3RFTA 3WGOA 4XEHA 5KJ6A 3HYIA 2OBNA 4AG3A 1RYDA 4EM0B 3D1LA 1VL0A 2KRFA 2K02A 2B0LA 4JBAA 5K5RA 1KVRA 3F4BA 4JJGA 1XQ6A 4PLGA 3ITKA 4XWYA 3O9ZA 3WIEA 5CLSA 1DAOA 3GFGA 4LMPA 5KJCA 1IN4A 1UP7A 2PEXA 3BJ6A 2C29D 3PVZA 2PQ8A 3E9NA 4LD5A 2C07A 3GNQA 3V5NA 2IZ0A 1NQ5A 1PZHA 1JHFA 3ZWVA 1E5LA 4M9ZA 4INAA 1ORRA 4ZQGA 4GX5A 4L9VA 4ZJUA 1SNYA 2FZEA 1GYPA 2PK3A 5ICSA 4RORA 3IL2A 2RAFA 1UCRA 3K92A 3ABUA 4LN1A 5A03A 3EQLF 4WE3A 4TZTA 4DGSA 2VHXA 4YAIA 1O3TA 3I9LA 3LT4A 1QV6A 1A04A 4R9SA 3UVEA 1HDGO 3ZV3A 4MQ9F 1KQ0A 4O0LA 3OECA 4JNKA 5L53A 4IHSA 3GN1A 1BHSA 3JD3A 4YFNF 1E77A 1VL6A 4IDBA 4CMBA 2D1VA 3GC6A 5BOXA 5T64A 2AQIA 3OJOA 1GHCA 3FXQA 3GH3A 4O3MA 3GX4X 3O38A 1J0XO 4Z9XA 2VN2A 4TSKA 2X5OA 1YB5A 4L18B 5A5FA 5KVSA 3VZSA 3CINA 1KU9A 1EEHA 1QMGA 1TQPA 5FFXA 1ON1A 1O57A 3FWEA 3HWRA 1UUFA 3DHEA 3NTQA 3R61A 5BPDA 2EEZA 1U7HA 1RYEA 3B20A 3IJPA 3P5SA 5K1YA 4UVDA 2FHSA 3UCXA 4MVJD 5TC4A 4AJJA 2Q2VA 3RI4A 2XPCA 4YDRA 1UR5A 4EJ0A 4HV4A 1ZH8A 3OIDA 5E1XA 3NYWA 5FB2A 2G0TA 1BDMA 4YFKF 1L3LA 1TXGA 3PGJA 1QPMA 2GA1A 4N9HA 2O8XA 2HUNA 5CEFA 4GX1A 1KS9A 1ZEMA 5ICCA 1JA9A 4MJLA 5COAA 5JAMA 4WJZA 5ILUA 3F6VA 4MVJE 1ZNQO 3D4OA 3INGA 4LB5A 3Q9UA 4E4YA 3HN7A 3RKUA 4NBTA 1O3QA 5DBGA 4HDUA 3K2BA 1WWXA 3DZBA 2QENA 4KN7X 1AHHA 1U3TA 1YQDA 5DBFA 1NBOA 1P31A 4YR9A 1HKSA 1X13A
chains in the Genus database with same CATH superfamily
3H2KA 3VBCA 4NSNA 3KBOA 4BV3A 1DQZA 3CP8A 2IH4A 4JA0A 5K0FA 4IJAA 1N9KA 4PX5A 3WNBA 2QUBA 5EVJA 1IY9A 3HRIA 4WXRA 4TV7A 3KQHA 2MT9A 2QSJA 4MR9A 3GTQJ 2HRDA 4IGKA 4O2AB 3GUUA 4UJ3A 5LYYA 3TMAA 1YZLA 1L1FA 3RVSA 1T39A 3E35A 4F2GA 4XEUA 4EHBA 4KQ1A 3CXUA 4QYXA 1BDHA 4JN6B 3H11A 1FOXA 1BRTA 4LNHA 1SXJE 2ZQ5A 4MHTA 3FGZA 4HGQA 1FRQA 1OC2A 3TKAA 5KK1A 4Q1BA 4NHJA 1YO5C 3RVJA 2P6MA 3Q9VA 1JF8A 2ZB2A 4H1HA 4O2AA 4IL6C 4LXUA 5TPZA 2BVNA 5K7ZA 1GG9A 3ZBQA 5EJ2A 1USKA 1UC5B 4GCVA 3K96A 3QPHA 3WHKA 1ZYRF 1ZSVA 3IRQA 2Q62A 4PPYA 4YIRX 2PT5A 3GGOA 3JYLA 4IX1A 4XLPF 1X74A 2IT0A 2BGLA 2QX9A 1I2ZA 1UK9A 4O33A 3WWCA 2P79A 4I9HA 1Q1EA 2BEVB 4BAYA 2HDCA 5JYDA 4XBFA 2E3JA 5AI9A 2BR5A 3G3EA 1DEXA 4DQLA 5BWBA 1IRXA 2NXNB 3U7RA 5EG0B 2WJZB 4RDUA 2CWWA 1R22A 4P2BA 2P2ZA 3PUJA 2KDOA 2A9KA 6AT1A 1W25A 3GGSA 1QHYA 1ODKA 1LBHA 5HKKA 1M0EA 4RKYA 2BEVA 2J5KA 4LF4B 5LB4A 1OLOA 3NBAA 4P84A 5F27A 3PQ7A 2H6EA 4P92A 2VPRA 1CS0A 3PX3A 3QMPA 2O52A 4KIJA 5JXWA 4KFSA 3T5PA 3TMOA 2C8KA 2ADOA 2RKHA 3KZNA 1Q50A 2PLRA 2QVOA 1XTAA 5JAOA 4YXWA 3Q7QA 4HWRA 1YFZA 2OD2A 3G0GA 3EXHC 1IDZA 3ZG6A 4L5YA 2IA1A 3M1EA 2DAPA 2ZB9A 1WU7A 3RAJA 5GTHC 1R0SA 1VJGA 4R1MA 2HUPA 5FA6A 3ILVA 3QW4B 5JFTA 4GVLA 3CN9A 1PKEA 3SQLA 1Z63A 2DFNA 4ROSA 3K7EA 1DC7A 3BFJA 1A9XA 2GLOA 2WHPA 4RABA 4HDCA 2YUTA 4ARAA 2OV7A 1BKSB 4KI0A 4DWOA 1Z17A 1VQ1A 2VAWA 3AY0A 1H9TA 2CL7X 2VQHA 2YL2A 5JZ9A 2B21A 4PTZA 4QDOA 1XFAA 3F8BA 5EJ9A 3RYFB 1JR3A 2Q2EB 4YP0A 3WOVA 4RVFA 1E3JA 4K9QA 3PTAA 4CM4B 2ZVDA 4G4GA 1GTRA 1AQIA 3KZ1E 2OUKA 4H7KA 1DE0A 2ZS9A 2ACWA 2KSQA 1O4WA 1ZLYA 4OKIA 3F9CA 5L3BA 3GBGA 1YZVA 3O1JC 2RFLA 4KQCA 3LLCA 4W8HA 4N8SA 5EMKA 1Z16A 2BE5F 3F6SA 2X48A 2FQ4A 2PX6A 2GX6A 2Q2EA 5HQ3A 3T0FA 3HR7A 3H7AA 3H9UA 3GLTA 5LBIA 2O8BB 4V0MA 3PB3A 1G2QA 2QTTA 2P77A 4CDNA 4B3DA 1LE8B 3IBFA 2JKVA 2GMWA 5WRFA 2Q8QA 4OM8A 4DMKA 4N6NA 1P77A 2RBGA 1HYBA 1L3BA 1J33A 1BW9B 3L7WA 3TRKA 4EI7A 2HOSA 4BVHA 3O4IA 3VZRA 1VNDA 3A6JA 5JNUA 1UBOS 3OP4A 2FR8A 1K86A 3N8DA 2HDWA 4IKEA 2PM8A 4PXAA 2H17A 2VT2A 4E6EA 5HW0A 3F1LA 1YB2A 3MJFA 2P5SA 1LE8A 3HADA 2B7LA 1H6AA 4KPUB 1AQUA 3MK31 4IQFA 3RCBA 2EZ9A 3MS4A 5AICA 1XDGA 1XEFA 4U2BA 5TY0A 1SC7A 5E1WA 3FTCA 4WXMA 3LSGA 4BBAA 3MFYA 1B4AA 1CR1A 2RNJA 2B6HA 4PO8A 2QIOA 2VJMA 4RVDA 4HN9A 1P6QA 1P3DA 1QXSA 3HHEA 2J59A 3W5SA 5EP1A 3H75A 3QBJA 4UU8A 4BY1J 2XW6A 2WG2A 2WV9A 1RRMA 5BOVA 4NMXB 4A23A 2ZBFA 5FPYA 3WJ1A 1GWNA 4CF4A 3I2HA 1MX1A 2JIZD 4Y3UA 2PQMA 4ENMA 1ZW1A 2XUQA 1BROA 3A6HA 4QKQA 3EDYA 1TP4A 4MWSA 2X2PA 2I3GA 1JX6A 4DR3B 4EHIA 4FR0A 4Z86A 3Q1KA 4OL0A 4ZDPA 1HMPA 4B17A 1F2UB 3A28A 5CLLA 3KKMA 3Q11A 1VCHA 1R66A 1O95A 3G0DA 2RKBA 3CRW1 2DJNA 1H6CA 2J9XB 2D3TA 4YJ2F 5LB2A 3FTEA 3OYHA 1BJKA 5JCJD 3I6IA 4R2IA 1DSSG 3TLXA 2A33A 1GQFA 1JKRC 2V79A 2OD9A 3KSRA 2NU8B 4M9QA 3N1UA 4N82A 3ZJTA 2JRCA 1AGYA 3HO6A 1EBFA 2XOKA 4XWGA 3S5UA 3RAEC 5L6LB 1F2UA 2PX9A 1YFHA 1YO6A 5ALQA 1RAFA 4BE7B 3P2YA 1QZ3A 3S81A 3F6BX 3GN2A 4LC1A 1G8KA 2AV6A 2FN3A 4HDAA 5HMLA 2FSFA 5TQ2B 2NW6A 3HWSA 3ME5A 4A69C 5IC4A 3F6OA 3D59A 5ALFA 2DK8A 3M7GA 3P4XA 3R74A 4BJ6A 2PA3A 2FEWB 2GAFA 3CVJA 3R76A 4O4HF 2NU8A 2KRCA 3W3AH 2Z8YA 3LW8A 3ROUA 2GTPA 1O0SA 4XRFA 4X8MA 3DEJA 4QGGA 3RRMA 4Y8VA 4I50F 1LLUA 2JLXA 1SKUA 4QBIA 3I53A 3IMEA 1D7OA 1I0LA 3K9CA 3LV8A 4FHDA 4F2HA 5TQ2A 1KAHA 1PX2A 4MKIA 1YE8A 3JAWB 1G5QA 2C54A 2ZJQF 2NO1A 3PU6A 4WW0A 4DLNA 4EARA 5C7IO 3VR5A 4ESHA 4PYRA 3G73A 4BLRA 5HODA 1O7LA 1SBIA 3QOYA 4GPEA 3RQSA 2VHCA 2QY6A 4R54A 1GNPA 3ZHQA 2R7FA 1TWCJ 4MUBA 4OIMA 1AXEA 1E7WA 1OWOA 2ZSKA 3L5KA 1S4QA 5EZYB 4ZQFA 2CS3A 4IIFA 1E1RA 1KRXA 4MW7A 3GCGA 3NTVA 2YVQA 5FEUA 5DCMA 3AHJA 1Y8QA 2YQ5A 4EQQA 3H3ZA 5EPOA 3CLSC 3OTWA 2K9NA 1RE1A 1EFKA 1GEGA 2MMGA 4MDHA 1FMCA 2O8DB 4FZ5A 2EZLA 2PUWA 3NUQA 2H06A 1KOGA 4B84A 3AVVA 3TEDA 3HP7A 4I1RA 2R00A 2FPWA 1IHYA 3VH4A 3CLOA 1PK8A 3V1NA 3QU7A 4LXHA 2M30A 4G81A 4S3MA 1DT5A 2BEJA 2WJIA 4IAOA 4M0DA 5D3MA 4BQIA 2CQQA 2V6JA 3KFVA 3M1IA 1XDWA 4QVIA 5KYNA 4D80A 1UBGA 5B1HA 1NJFA 1K6MA 4XLCA 4IJ6A 1TJYA 1ESEA 2P5UA 2J3KA 3E5RA 3S7ZA 4CR7A 1J22A 2AW5A 3QVGB 2JHFA 2YKGA 1HQYE 3FFXA 1IB6A 1JMYA 4ZEOA 3FWKA 4JBWA 1GT91 4URXR 1AQJA 3B89A 2ESHA 4Z7NB 5DPMA 3C48A 2ZU0C 5HE9A 3QU3A 1U3UA 4GGGA 3ZTWA 4FDAA 2FRVA 5IBQA 5LDHA 1JQ3A 5FPTA 2GFQA 3K9NA 2M32A 2XF2A 2P3OA 2N46A 4AY6A 4KWEA 1Z13A 2GM4A 3W2VA 1SIWA 1PFGA 2FFAA 4Z4CA 4QGAA 1UFRA 2YV4A 2HF9A 4CU2A 3HC7A 3VZPA 5EJFA 5JSKA 1HEYA 1TAUA 2YCBA 3CTPA 3TO9A 3I1YA 3X1JA 2AHOA 3UEOA 2XXAA 5DXFA 1IPFA 2YSRA 3UB4A 3VOTA 4Z3DA 5ALLA 1C41A 5JWRA 2XAAA 2HKIA 4W8OA 4GPTA 2Y0EA 4KO1S 3B9QA 1FDIA 1IZ0A 2L7FP 4L5CA 3UGKA 3CKLA 3C5VA 5BR7A 1PFQA 2QMHA 1ZNWA 3WK8A 5FR1A 1V3QE 4PAMA 1P5ZB 4JOSA 2JCBA 4A1OA 3JZMA 4BV8A 3GAFA 1Y48E 2I8LA 4WBXC 3ERCA 1PJAA 2NTEA 1G5FA 5MFPA 3MTEA 2R7VA 5HSGA 4R3WA 5IU6A 1RQ2A 1X7ZA 5BOSB 2I2AA 3FVWA 4RZSA 2OU2A 2WU3A 2DWOA 2QRNA 2Q3HA 3H3XA 3I0TA 3GVCA 2PUBA 1YIJI 1DGWY 4AKHA 1ZXBA 3PQ6A 2C61A 4KVAA 4CDMA 3D6MA 4J90A 2GERA 3GRPA 4B4OA 4DNFA 1WR8A 4KDCA 1MORA 1TYCA 1F9NA 2VJ5A 1P4HA 3T5TA 2P0AA 4GYKA 2UYHA 4H7JA 2ZDHA 2GXBA 4Z7JA 2W70A 4RGBA 2H2DA 4QT4A 2Z99A 5JI6A 1E66A 1KC3A 1J00A 4LSGA 2V6BA 4XIJA 3T5GA 3WXBA 3A4LA 5IVDA 3KQUA 1MABB 1NN1A 3JPYA 2B1JA 3O2QB 3HL4A 2QX7A 4BTEA 4JD5A 3CIFA 4LQLA 1KZHA 4KTVE 1C9NA 3OM9A 3TOBA 3JAMK 5C3EJ 4JUAA 3WU1B 1IXSB 1WMDA 4UUMA 5AJYA 4TT3D 3IKVA 1N2ZA 3ZLTA 4JUDX 4C4ZA 3FOAA 3IV7A 2ORWA 4A4DA 1P7ZA 1ZL2A 3ND5A 3OJFA 4H7DA 3RK1A 1DQUA 1VYUA 1MABA 3EVGA 2IA0A 2V6GA 2ZPTX 1VI6A 2GS9A 1ONVA 1RCTE 2HCJB 2OHOA 3CB4A 4FZVA 2YC2C 2ISCA 5FADA 2PRIA 2BTOA 3KELA 4QU8A 3ROZA 4LAFA 3D6TB 1SKQA 3HJAA 2VRBA 2QRJA 3K7AJ 4L16A 4ZXFA 5HWSA 3VSDA 3BEDA 1WZEA 4YBZA 3RZOJ 3DB1A 3A05A 3OU6A 1DBWA 2IKQA 2PBRA 3I9FA 3CLUC 4AJOA 1YQTA 1W30A 5H8WA 1YCFA 1DCFA 1FZQA 1P33A 4GOXA 5EE3A 3LBNA 1RRGA 3VKWA 4QXOA 3E4DA 4ZI2A 3CE6A 3DTYA 2JGNA 4Z0NA 3OYCA 1NW9B 2G4VA 4ZCSA 1Q19A 3W9UA 3WA7A 3C18A 3A1FA 2BW0A 5J2UF 3FCYA 1L7AA 4PHFA 1MU0A 3QLUA 4JC4A 4AN4A 4M49A 3U60B 4MWDA 4LDZA 3IEUA 2ON6A 5DNAA 4AWBA 3V6LA 1GNSA 4RGQA 5FOVA 1EZZA 4C78A 4M1QA 4J29A 1YI0A 2XGCA 1VSUA 1SR8A 4MAFA 4F2DA 4K28A 3ICWA 5EGNA 2EWNA 2CUFA 3BGSA 5TMBA 4DADA 5HA5A 1CNFA 3IBCA 3N05A 3U31A 2K4BA 1KO1A 5E1DA 3M89A 1UWVA 3ZOZA 3HYLA 3I4LA 2P4SA 1JHYA 2O1SA 5JQWA 4HNVA 2KLHA 2I4MA 3G2OA 1IXYA 4BNYA 4OVKA 3BT7A 4DRXA 5LD2B 2GYVA 4MJXA 1P1FA 5CDFE 2GN0A 5FNZA 2EAUA 1KOLA 1M8FA 3OZSA 3I01A 3NGXA 4GPBA 4RY8A 3DKIA 3KKQA 4IDCA 1WBBA 1SFXA 5FJIA 4KO4S 4M54A 4L3WA 1Y6ZA 2YMPA 2HADA 1PQWA 3G1TA 2WSLA 3U6KA 4PGGA 1EFTA 2PVPA 5BNTA 1FX0B 4OLAA 4P55A 4C7KA 3JTMA 2OPBA 1CNEA 1Z88A 3WSVA 3ZZ1A 5EQTA 2FWBA 1YJQA 3RS7A 2QPOA 4MP8A 3UT6A 4KWCA 3R7DA 2C5BA 5F76A 1U8CB 4QIWN 3W5IA 1OKKA 2CDAA 1F2DA 3WLNA 1R9MA 4WK4B 4YAWA 4HUJA 1DG1G 1VPVA 3TWOA 3G2QA 4FJ2A 3VGPA 2GXGA 1FX0A 3F6RA 2FDRA 2F67A 4B8ZA 1QIDA 1E1QD 1E2HA 4LDQA 1V35A 3JQGB 1YJ8A 2ZWAA 3UG7A 4L0DA 1SD2A 4PQEA 1E6UA 3RIHA 1LPPA 2D2IA 1MHTA 1R16A 2PQ0A 1QM5A 2HQSA 5HPYB 1L7XA 3RGGA 3TSOA 1TLFA 2IZ5A 1ZK0A 4BLTA 2MSCB 2F00A 4RA9A 4YJ3B 2C78A 4B2PA 1JQBA 2I6TA 2XUFA 1FFXA 3IWZA 2CXXA 4A3LJ 1MB0A 2VDRB 3CLKA 4UQPA 3SXPA 3RBZA 2Q6TA 1VSBA 5HS7A 5KYXA 1VGQA 3JQGA 4QBFA 1KIFA 3M5WA 3IDQA 4A0GA 2E1CA 4NMLA 5DM1A 3UK1A 5D01A 1XHFA 5F1RA 5H7XA 3IE2A 3Q0TA 1I9CA 1Z8DA 2P4UA 4ZU1X 4PQYA 5LP6B 1XMPA 1J8QA 4KOAA 2EC5A 1EJ0A 5A9TA 1YITI 4OXIA 4D0PA 3U1TA 2LY1A 4TUYB 3JQAD 1MX9A 3ZKWA 4FX0A 5C0OE 2ZTVA 3R3ZA 4R0VA 4RM3A 4RA6A 5A3QA 2K7FA 3QBTA 1DB3A 1WZ2A 2Y0SA 2JZOA 4EHAA 5AOAA 3WAGA 1QANA 4ZQCB 3J80Z 4KWHA 5LJIA 1XXHB 4I1PA 2P81A 1XB4A 1FFAA 4EQZA 4Z9BA 3K1YA 3V4LA 4IDHA 4GE0A 3HJUA 5GADJ 2FJ1A 4EFMA 1H5QA 2CDRA 1DJNA 3C3MA 3KR9A 4JYMA 1BJAA 3LK7A 4TN1A 1SQ5A 4KT5C 3OS0A 2VT6A 3PGXA 4A5SA 5C5DA 2OO5A 3TR0A 5GZ3A 3OU2A 1MEJA 1DAHA 4S1WA 2GH1A 2Y0PA 4Q3OA 4P9FA 3COAC 1XXHA 2IZZA 2DDBA 5TEWA 2VN8A 4H0NA 3AM3A 1T5BA 3ZVRA 4B7AA 4AMUA 2IOYA 4YRBA 4BQQA 2BY0A 5CLQA 1EWVA 2RGUA 2VYCA 3IT3A 3FE2A 4E5UA 4MZDA 2EWMA 3ZYCA 1RHRA 1T1JA 3KHSA 3D5EA 4PVCA 3FRHA 1U2WA 3BR3A 3FGPA 4Q4AB 3M34A 4ZOQI 3ZH2A 3Q8KA 4X64B 3EMKA 3STUA 4HVCA 2PCLA 3PFGA 4R1LA 3GZ4A 1ZBQA 1MKMA 4JLKA 3N5CA 3V3TA 5ECYA 1QJ4A 1JPUA 1UJMA 5K99A 2CNOA 4E3ZA 3HRMA 4YO7A 4LGCA 2JJ2A 2SBTA 2CUNA 4XRGA 4YH1A 5C31A 5U4QA 2VCEA 1JIJA 4O59O 1MDFA 5KTKA 5JALA 2PGOA 2P4QA 1DXOA 3HR4A 5KHOC 4YFYA 2V3WA 2HJGA 2OBNA 3L6UA 3GLIB 1B6RA 3LUKA 4MS4B 4XWYA 2XF6A 3MN2A 2RAFA 5HNFA 2ZXEA 1H1DA 4HGYA 1YFLA 2W6ZA 2E2WA 2AQIA 3ONWA 3FXQA 4LJSA 4MYRA 4QQ8A 4AX4A 2C0QA 3VR2A 4UVDA 1N3YA 1ZGWA 4WT7A 1P1CA 1LS1A 1JHXA 3GLIA 4GX1A 2XECA 3D4OA 2AO9A 3RKUA 1JBQA 5K0JA 3K2BA 3DZBA 4QRHA 1YQDA 4BCBA 2WIAA 1O9GA 1JUPA 2J5QA 3DTVD 1AHIA 1IOLA 5EYPB 3ZY3A 2Q2WA 3KYLA 4CIDA 1BA3A 3S68A 4PPQA 4GZ6A 3GLGB 3PXGA 1L5FA 3SQDA 5BP7A 5KYKA 3B12A 5M7EA 2W6ID 1T2DA 5CFLA 2FW1A 1EU1A 2QMYA 2FZLA 4F5EA 3UUEA 1E7MA 1Q0QA 3RADC 3DOOA 2N75A 1I3CA 1W0JA 2R93J 4NCJA 1UIRA 1NY5A 5KNLA 5FORA 3QWAA 2GAUA 1LJLA 5GJVC 4PV7A 3GLGA 4HS4A 5AVYA 4ZJZA 1YL5A 2WIBA 5IF9A 1OCPA 3RC2A 3E9EA 5HLIA 1OX5A 4JQOA 4HFNA 3RRFA 2PLWA 1KBZA 2NIPA 3AYXB 1GPYA 1TCUA 3WBKA 3MVEA 3R7WA 4UTZA 3O1LA 2V7QA 2WWIA 3T5XA 4R0NA 2P11A 4E5VA 5L7TA 3FDZB 2W2TA 4L3VA 2CH0A 1NN0A 1SUDA 3NC4A 4ETNA 4G9GA 2HK6A 3CVYA 3C6XA 3LSPA 5BXQC 2ZR0A 5LGTA 1GV1A 2NOJB 2FUKA 4J6EA 3SCZA 4DM3A 5IM4F 1E4EB 1TC3C 4GOJA 3H9GA 1PDNC 2PEYA 3TDNA 2OT3B 3LDGA 1K68A 3C3KA 1FMVA 3DBVO 1FDTA 4GLFA 2L9RA 2YUSA 3KFWX 1ADYA 1JT2A 3VVMA 1XZJA 4UB8C 1MO5A 4XIIA 4A0SA 3CUQB 4YCCA 1TZMA 2BYVE 3CMYA 3WODF 1E4EA 1HW5A 3CQ9A 1K8XB 1GZ7A 4YRCA 4HPWA 2PZLA 1X6VA 4JLMA 4TRNA 4NVRA 4YFVA 2JIOA 3P2MA 3UCEA 2VTKA 4TL7A 1NBAA 5KX5F 2O23A 2BF4A 3IPAA 5C1DA 2HRRA 1ZG3A 1ATIA 2NXJA 3W1WA 1NBIA 3EX7C 1WVGA 1FPQA 5DX0A 2C9DA 4D3SA 4OB8A 2C99A 1RACA 3WA6A 4MI6A 1MQ8B 4QASA 1TQ8A 3GJRA 5G0VA 4AVZA 2X1VA 2PCJA 4ZAFA 3O5AA 4J75A 4DNQA 4JL8A 4F8EA 5K0GA 1N9GB 3JZFA 1QOZA 2C4HA 5A4AA 4NBLA 3BQZA 2JC3A 3FXLA 5HUHA 3ILHA 3RRNA 1XHLA 4A2PA 1EFVB 3OKFA 1A36A 1GRRA 2JJ7A 5FTJA 2OENG 5E3OA 4YMUA 2QL5A 1MW7A 5E1OA 1R5JA 2DBRA 1WXDA 1G98A 5CR9A 2D0OB 4YTEA 3T35A 1K9VF 2Y92A 3BJRA 1Z4IA 4N5MA 1ZOSA 3ZWWA 2YV2A 3VMMA 2J3QA 5HDGA 3FTQA 4EFDA 3FZQA 1M1YA 4IDNA 5L4NA 1XALA 1QG6A 2PUVA 4JSYA 1L8AA 3K15A 1EFVA 5BVGB 1HDEA 4QNNA 2G6BA 3BSFA 3C2HA 5CXUA 1XVIA 2HXYA 4AF8A 1U2DA 4WZ6A 2QX6A 4ZOBA 3TQIA 4JVSB 2W2QA 2GBLA 5D6FA 3VQTA 5IARA 2X85A 2VRCA 4XFJA 3ZWMA 1SXPA 4WCFC 4OBBA 4WOCA 3FXOA 2IU0A 3GOQA 1GZ3A 3SLGA