2VT2A

Structure and functional properties of the bacillus subtilis transcriptional repressor rex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
199
structure length
184
Chain Sequence
ATAKRLPLYYRFLKNLHASGKQRVSSAELSDAVKVDSATIRRDFSYFGALGYNVDYLLSFFRKTLDQDDVILIGVGNLGTAFLHYTKISMAFDINESKIGTEVGGVPVYNLDDLEQHVKDESVAILTVPAVAAQSITDRLVALGIKGILNFTPARLNVPEHIRIHHIDLAVELQSLVYFLKHYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REDOX-SENSING TRANSCRIPTIONAL REPRESSOR REX
publication title Structure and functional properties of the Bacillus subtilis transcriptional repressor Rex.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
total genus 56
structure length 184
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02629 CoA_binding CoA binding domain
A PF06971 Put_DNA-bind_N Putative DNA-binding protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2vt2A01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2vt2A02
2GZ3A 4RB1A 4CODB 1U7HA 2FR1A 4G7OF 2ZYDA 5DCMA 3BOQA 3RJ5A 4QECA 3K2ZA 4CMKA 3KHUA 4GXOA 1BI1A 4ESBA 1A7AA 3STHA 5JCJD 2Q45A 3WTBA 3JQEA 1ZG3A 1MJAA 3P9IA 3WU1B 1M2WA 4RVUA 1ONVA 1KBZA 3P5SA 4FW8A 2STWA 4HW0A 2J8ZA 2BYVE 4MGRA 3AUAA 1XQ1A 4HF0A 2J5OA 2EJRA 1JHHA 2W98A 4BHBA 3E9NA 3FWNA 3K2BA 1E77A 1RPNA 2I66A 4DBZA 1NAHA 2L02A 2XAGA 5HS7A 3CEAA 3W6ZA 4ESOA 5JC1A 1M66A 1WWXA 1XSXA 5CJ9A 4XIYA 3I4CA 3ZU5A 5CAEA 4DLAA 4AJLA 3UF0A 3PGXA 5U1PA 5J8CA 2NNLD 4N18A 5HS6A 1HETA 2JFHA 1RUOA 2P4HX 4XQCA 5A4DA 4DQ2A 2DU9A 2ZCUA 2XF8A 4KQXA 3KTDA 1SFEA 4UAGA 3HFGA 2C07A 1MXFA 1OC4A 3ZCXA 1NTOA 4XQEA 2VT2A 1DFGA 2JZYA 3DP7A 4D46A 2BEOA 4ZYEA 4M73A 4Z6KA 5L40A 2Y1OA 1Z05A 1O6ZA 4F46A 1FK8A 3DTTA 2OO5A 3RIRA 1EVJA 1X0VA 5TRDA 1WMBA 3MJCA 4FFOA 1HDOA 4L4XA 1ZVMA 2ZJ1A 1IN5A 2ZCVA 5H82A 3ITKA 4YAJA 5ENDA 1YO5C 3VH2A 2M5WA 2P8TA 3F6YA 3DZJA 1X0XA 3I9KA 2Z99A 2HMUA 3PDJA 5L3CA 1Z6RA 2E82A 3RQSA 1M6HA 2HJSA 2ZMEA 4IIVA 4ZHSA 3I5UA 1F4KA 3HWRA 4DMLA 2AG5A 1SC6A 2E48A 2X5JO 1N9GA 3LU1A 2DTEA 4MVJP 3MCVA 2ACJA 4OIMA 3VKVA 2XPCA 4RPHA 1SAYA 3QWAA 1SMYF 3DONA 3IP1A 2WE7A 1Q7BA 2R6JA 4WLOA 1U28A 4FHTA 4EJ0A 2NV6A 1KQ8A 3NJ8A 4K9DA 4A26A 3I6IA 5DBFA 1DLIA 1NQ5A 1B8PA 1RM5A 2WJPA 3MZHA 4CQMA 1GV0A 4HA8A 2CNBA 2E7XA 5JC8A 4IVNA 1LJ9A 3FNGA 3L6OO 2A4KA 3J80Z 2LNBA 3BZ6A 2J5RA 2Z1MA 3KE2A 4D79A 5BQFA 5HTOA 4YPOA 1H6DA 1RYEA 3KLNA 1LDBA 2C2XA 2NU7A 5KVQA 3FM5A 1XSEA 3D64A 1BXKA 5JI6A 5BSEA 3OQBA 1E5QA 1BXGB 1ADFA 4M74A 2IYOA 4E33A 1R1TA 4WWCA 3NV9A 4OJNA 4W9NC 3D1LA 3WXBA 4GWKA 5DBGA 1E3IA 3ICPA 3CMMA 4WLUA 1HBXG 2BV6A 4XBFA 3E9QA 3PQDA 4WGGA 5IFLA 2QYSA 4UXNA 1QYXA 3BXXA 4KMSA 3AW9A 1XD7A 5CG2A 4CGZA 1P6RA 2IVMA 1RUNA 2ZYAA 3PWZA 4GL4A 1TVEA 4BOYA 2W24A 4OO3A 3SJUA 2HR3A 1Y81A 5K5OA 4JGBA 1MFZA 4WE3A 4TROA 2UUPA 4CR8A 3PP8A 3RFVA 3TKYA 1U8RA 1I2BA 1FSHA 2V7PA 2P6SA 3RC1A 4AL4A 1PJ2A 4O1MA 1IPEA 2RQPA 1GCUA 3ANLA 3I9NA 3O2PE 1V9LA 3H65A 2JT1A 2EW2A 3KRTA 4HQEA 5FEUA 5L51A 1F8GA 3K31A 3AFNA 4EM1A 1XKQA 2VNSA 4D7AA 1GPDG 3W1VA 5KJ6A 1DC5A 3TJRA 1GCOA 1VI2A 3RTRA 4W9NA 4CV1A 2ET6A 4U7WA 2JHGA 3VKUA 3KP4A 2MC3A 1XYGA 3R61A 4TZKA 1WZIA 2IEBA 1BRMA 4W7HA 4AJJA 5I7SA 1E6EA 2D1YA 3BMNA 3VVCA 1CGPA 1H94A 3AI1A 3ONDA 4JLWA 4CMBA 2K02A 1D8AA 5DCYA 4M89A 3JW4A 3GGOA 1LDMA 1GQYA 3HHPA 4EEZA 3HUGA 5K6AC 3CXRA 2E1NA 1KC3A 2C54A 2J3HA 4PLTA 1IZ0A 1IN4A 3DEUA 3TNLA 5C3MA 3GAZA 4NFSA 4N5MA 3ZWAA 3CUOA 4AD9A 4RZIA 2DFIA 1VKOA 1IY8A 2UWMA 3ISPA 5HLGA 2NACA 1VRWA 4RB2C 1Q7CA 3BDDA 2YZ7A 1XB4A 2GZWA 2VQ3A 4XGIA 3H9UA 1NWCA 3ZN2A 1HSJA 3P9KA 2HKOA 3L2CA 1NYTA 2DFVA 3TWOA 1TTYA 1XGOA 1VSUA 2Y0MA 1JKFA 3N4MA 3JYLA 4URFA 2XASA 3A28A 3Q1LA 3ITDA 5JMWA 4UEOA 3KSDO 5DYMA 4PLYA 1ODDA 4NQZA 5DUKA 1L1FA 4J2HA 5BSGA 2P68A 4A5OA 3RUDA 4A10A 1KETA 7MDHA 4Y8VA 4NJMB 4DVJA 2L4AA 2IZ0A 3TQHA 3CUKA 4XSZF 4D42A 4DA9A 4G2NA 3KCCA 2EXXA 1LNWA 3KP6A 5TJHA 3R1IA 1I33A 1DOHA 1QLHA 3O9ZA 4AIHA 3V1YA 1E3JA 1UDAA 1DPGA 2G0TA 1B9MA 4E6PA 2BD0A 3OBBA 2AQKA 3DF8A 1AXGA 4WK8F 4FFLA 4IXWA 3TOBA 2ZB3A 1HEUA 3E6BA 1GEGA 5L45A 1VL8A 4XIJA 4HFMA 4EZBA 3NTOA 1TXGA 5TIIA 2I3GA 3PFWO 1TNSA 2HZTA 3IWFA 1V3TA 3JQBA 3H9JA 1LEBA 3BAZA 4G5HA 4YVFA 1E7RA 4GI2A 4E2XA 4OIPF 3JQAB 5KJCA 4ALJA 3LT0A 5TJJA 4GX5A 3DMYA 2A5YB 1B16A 1MDMA 4IJVA 1P1FA 3JV7A 3L6DA 3NDRA 4ZJUA 1GDHA 2JCYA 3FZVA 5L3FA 2HMTA 4UVCA 3HZZA 4NU5A 1UXKA 1T98A 1Z73A 3K96A 1A27A 5E8IA 2H27A 1PEDA 3GVHA 3QWHA 4K6CA 1N8KA 4CPDA 2YFHA 4GH5A 3T7EA 4KUGA 4EJOA 2GN8A 3D5TA 2M30A 1I3NA 4KZPA 3TF5A 4B8ZA 5BPIA 1T4BA 3GN1A 3WGYA 1J75A 2HYFA 2MD5A 2GERA 1NXQA 2O3FA 3Q11A 4N7RA 3ROPA 5H81A 1E3SA 4PLGA 4YT5A 1PS8A 1JA9A 1R1VA 1QG6A 1VSVA 3PLNA 5AXBA 5B37A 4PGHA 4KWIA 3L9WA 5DNAA 5LLQA 4CMJA 3GW2A 3QWIA 4CMHA 1J0XO 3G1TA 2Q1SA 4EJ6A 1EK5A 2FWMX 3ZN1A 4XYBA 1U8XX 2DVMA 2VOOA 2IDZA 2C7VA 4DPMA 5DUIA 3MOIA 4GKBA 5LHGA 4J90A 1G6NA 2OBPA 1IUYA 1LX6A 2EFQA 5E1XA 4BO8A 2AG8A 2Q50A 6ADHA 2BE5F 1K6XA 4WCFC 2V6FA 3DBLB 3UUWA 5I8WA 1XDWA 1U5AA 1XLTA 4NQWA 3OICA 5LDGA 1WXDA 1NQOA 1FMCA 4M55A 1LDYA 2B4QA 3WQQA 4UUMA 1NX6A 3OIDA 4G6QA 3BTSA 3EHEA 3J81K 4ENKA 4L74A 4MVJG 1FY7A 3EGOA 4NIMA 2VWHA 2Y0DA 3RKYA 1OZAA 4O6VA 1PGPA 1VKNA 3CKYA 1PR3A 4LD5A 4HDUA 3IP3A 3F21A 3H6KA 2BGCA 1D8KA 1B1BA 2A35A 3LC2O 2AEJA 3BMQA 4R5MA 1O3QA 1X13A 2LSOA 3HSEA 3ZWOA 1NAIA 1IHYA 1KU9A 1HW1A 1FOKA 1EVYA 1T2FA 3MEXA 3PWKA 4H7PA 3F4BA 4IQ0A 4OKNA 3FXRA 5EMHA 1HE3A 2O3QA 4JN6B 4RVFA 3HYIA 4WCFA 1V3UA 1GPJA 3H9GA 3C7CB 3WG9A 3WGHA 2F5EA 1DDNA 4LLGF 1DFHA 2Q2WA 2RBEA 2EIHA 2HAEA 4J1SA 1STZA 3DBHB 4CLRB 3TSCA 5DP1A 3BTOA 1QPMA 3TZHA 2KRFA 4KNYA 1R4MA 2NVUB 3L4BC 3TZCA 1EK6A 2YPRA 3FX3A 2VYVD 3H5NA 2E6UX 1Z7EA 4D0PA 3VPHA 1U5CA 1U2DA 5CDUA 2P4QA 1KC1A 1W8DA 1W7PA 3L07A 4RF4A 3I23A 1PGJA 1MJBA 2K4JA 4LG0A 4ZYDA 1P31A 2OUIA 3SXYA 4ITUA 4YTEA 4CQMD 1CRWG 1D1TA 2PKQO 4Q3EA 1ISJA 2COMA 2L4MA 1B14A 1LA2A 5JR3A 3V8LA 5DDIP 5C5IA 1FWZA 3G3ZA 1CJCA 3BHJA 3QHAA 4JROA 5G4LA 5KJ1A 1B3RA 1NFFA 3ZWMA 1E1MA 1KVUA 1QRRA 1V3FA 1D3AA 2JD2A 3L4BA 1VL6A 3E5QA 2YHUA 3DPTA 3EC7A 1R15A 3SJ7A 1HDYA 1NBOA 4ESFA 3ETDA 1I24A 3NGLA 4RGSA 5TC4A 3KXDA 1KS9A 1CDOA 1SFXA 3GZ4A 3GO5A 3WE3A 3HE3A 3PRJA 2Q2VA 4D3DA 2GN6A 4RQUA 4GX2A 2PN6A 1UXIA 1P1RA 1GD1O 1HXHA 1S6YA 3NUGA 3OEWA 4J1QA 4HX7A 1A4UA 3ANNA 3JD2A 1K6JA 1PJCA 4J9VA 4KUHA 5A04A 4XYMA 1PJ4A 4DREA 1W5TA 3LK7A 1P4AA 2EGHA 4FBGA 2JL1A 1EUCA 2YQ5A 5FWNA 4YJFA 4G94A 1BIBA 2PGJA 4RF5A 1QZYA 3MFKA 2AXQA 2D4AA 3ZHXA 1V6AA 1H6CA 2I9PA 3Q6IA 5B4VA 3KYBA 5B12A 3ENKA 4J91A 1ZHFA 4KA4A 2GLXA 3D0SA 1LRJA 4MOWA 3T1BA 2HO5A 2RVCA 4TZTA 3LLSA 4PZDA 3RROA 2GASA 3CZMA 4P8RA 4E13A 4L73A 2OZ6A 3LQRA 2QQAA 4P38A 3GVCA 3OJLA 3HOTA 1K6IA 3JCZA 3DBRA 1I3LA 2B36A 4GGPA 1V0JA 1IF1A 4ROSA 3GLXA 3ERED 3WTXC 3CO7C 3FHZA 1W6UA 2Q2QA 2NU9A 3OM9A 3P7MA 2P6TA 5JBIA 4IJAA 1BXZA 4BYYA 1NPYA 1PL8A 4ZQBA 4NNJA 2LF8A 1QQIA 1DHRA 2VT3A 5JAQA 4LMPA 3H3UA 2JCXA 5F1RA 2G82A 2OZUA 3AOGA 2GO1A 2BFAA 4Y98A 3RUFA 4B3HA 2VOPA 1H6BA 4XYLA 1EFLA 3TDUC 5D4RA 4NMHA 5DP2A 2A69F 1MA0A 3QLJA 2KJCA 4FOSA 4PGFA 5ICCA 2EGGA 5JCJA 1KQ0A 1SPXA 1IW7F 5J8FA 3WFIA 3U5TA 4LK1F 4CUZA 3J7AO 4DUPA 1U3VA 3W4IA 2YHIB 1V35A 5K1YA 1Y5RA 3JQGB 1SB8A 1PU2A 2RCYA 2CW0F 2DK8A 2VRCA 3JQ6A 3KV3O 4HKTA 4KOAA 3ST7A 1O8CA 1YXMA 4NK5A 1WKMA 4J4HA 2I6TA 3G1UA 4EBFA 2X58A 3ZH2A 3QQPA 5A9RA 4FOOA 1C0IA 3HTUA 2PZJA 5EEHA 3UOGA 5JAMA 1VJ1A 3HB5X 3GGPA 4DNCA 4A0YA 4PRKA 4B4UA 4IQGA 4PDKA 3BJ6A 4U88A 4BNUA 1YS6A 1F14A 4PLHA 1JVSA 3F46A 1SD5A 2C20A 4I2OA 1YB4A 3AUSA 2BFMA 2XXJA 1RKXA 2W57A 3GC6A 4R1TA 3JQ8B 3W6JB 1B26A 1ISFA 1S29A 2HOEA 2KIMA 5JDIC 1IPFA 4IBOA 1B59A 4KDFA 3MJSA 4CXFA 4KN7X 5IT9Z 3VOSA 3AUUA 3O38A 2RKHA 4XJSA 2VWPA 3WGIA 3HB4X 3SLGA 2DBBA 1KQ9A 1PJSA 2NNNA 1Q0LA 5HS4A 3H5AA 4YJGB 1WDKA 2R3SA 1UZNA 4FGSA 4EJMA 2DFDA 1IN8A 1AXEA 4UVDA 1GQ2A 1PP8F 4MDHA 4GPD1 4S05A 1R23A 3TOAA 3AI3A 1E7MA 3O26A 3RBVA 4GO1A 2F5DA 1XDSA 1KVQA 3C1DA 1XU9A 3WX0A 1PDNC 2QBYB 3ZQ7A 3CO6C 2O3TA 4ZRNA 3ZWWA 1P4XA 1M76A 3REOA 4HV5A 2EA2A 4PN3A 3I9JA 4GYIA 4L18B 2X86A 3GVXA 2EW8A 4P4GA 3UCEA 1G3SA 3IJPA 4L4RA 3L09A 2GCGA 2P7CB 1CQIA 1DSSG 2MH9A 3ULQB 1E7WA 1HWYA 2DU8A 4FJ0A 1LQUA 1ENZA 2FBHA 1Y8QB 3PIIA 4J4TA 3GVPA 3Q9NA 1RM4A 4XB2A 1P92A 4NB5A 5LRSA 1N2SA 2GDZA 1QYDA 5U9CA 4CMCA 2AQ8A 3RBXA 4IHTA 1GY8A 4A0ZA 1WMAA 4EUHA 4LRSB 4I5GA 4I5FA 1WNTA 4XR9A 5JPIA 2W84A 3IKTA 1LSOA 2X9VA 4EUEA 3KP7A 4FJ1A 3MJ4A 4BB5A 4YAEA 3C3XA 3GN2A 1ISIA 1G0NA 1YOVA 3ZGYA 4LK0F 3ASVA 2ZJ2A 3KP5A 4N54A 4TV7A 4HLXA 3CSDA 3D4OA 5KIAA 1EBFA 4CM4B 4UREA 1HLDA 4LCEA 1TW2A 1LDNA 1PZGA 5JS6A 1R4NB 3M1LA 3D3WA 3K5PA 4PCQA 1XIVA 1W73A 3GWZA 1DB3A 4EITA 4K2EA 2UAGA 3U2RA 5L3EA 2OXIA 3WYCA 5IF3A 4J49A 4IDAA 3AU8A 4RORA 4JQFA 3DBVO 2NVWA 3GYHX 3R60A 3LT2A 4JBGA 3I58A 1BC8C 1ZRCA 3ZMVA 3VVBA 3MTJA 2BGLA 4DIBA 3S1LA 3WLEA 3QVWA 5BNIA 5D5XB 1C3VA 1MC5A 1RM3A 3MJTA 4N5NA 3SBOA 2L54A 3E6DA 1H2HA 1IZ9A 3DMTC 2FSVA 2X9GA 1YS4A 2DC1A 4QX6A 3H92A 3QPHA 2CG4A 4YAKA 2PV7A 3JTHA 5F64A 4EQQA 1MG5A 5KTKA 3V4GA 1I1SA 1PGNA 3ZWXA 4HLYA 1GADO 4LMRA 3ZMDA 1TT5A 4YAGA 1YQGA 2O03A 2NLOA 1EBUA 4OOEA 3GGGA 5KWEA 3IUPA 1BHSA 4LRTB 4I09A 4R01A 4KP7A 4MHGA 5BS6A 2P5YA 4RQTA 5AOVA 2QVOA 4PFJA 3GXOA 4B09A 3M6IA 4EV0A 1W7PD 2ETHA 2D2WA 2KIUA 4AIKA 2HK9A 1F1ZA 3KLOA 4O3MA 3GUCA 2ZATA 4FD3A 1T1SA 4YRDA 1MLDA 4KUEA 1O3SA 1KU3A 2XAAA 4CL8A 4BQRA 4JP2A 1P1JA 3B1FA 2GA1A 5ED4A 4DLBA 3QA9A 4DMMA 4MEXF 1NWHA 4I01A 2D3TA 4CLHA 4LN1A 4X54A 4YG2F 3RI3A 4CMIB 1MD0A 1A7KA 3HIFA 2PKRA 2GRAA 4BMSA 3KUXA 2IXAA 3IRQA 1CF7B 3PEFA 4WNIA 2IW5A 2EFOA 3MQ0A 3A14A 4GBJA 1NNUA 3S2IA 3C7JA 5HS8A 1KYQA 3P2YA 3DQPA 3K73O 5L4LA 1BM9A 3AOEA 3E6CC 1S6LA 1I5RA 1ZAOA 4UVBA 4AJNA 1J0RA 3ECOA 3OHSX 3PFFA 2EV6A 1D8JA 3H9EO 1GHCA 4DTIA 2GWRA 2ZTVA 3ONEA 3HSFA 1E7SA 1Y1PA 3GRPA 2MA3A 2HMVA 5DT9A 4J1NA 4RAYA 3X2FA 4CQLA 1IXSB 4OSPA 3RUAA 3I59B 2X5OA 2PD3A 4I0BA 3VHRA 1PGOA 1MG0A 1PS9A 5D4SA 3JQ7A 4DQVA 5TQVA 4CDGA 4OQZA 3ROUA 2QG4A 5BPDA 2R7DA 1BSVA 2BKAA 1PGQA 3GA0A 5GY7A 1IE3A 3DHEA 5FB2A 1E3EA 5EQDA 1DRWA 4MVJH 3SC4A 4EYEA 3SVTA 3FWZA 5D5UB 2EG9A 3O8QB 4M6YA 1LLCA 1FPQA 4FR5A 2CD9A 4IM7A 4HZFA 1LRLA 1Z45A 4MO2A 3TRIA 4E5KA 4FFMA 2VHXA 5COBA 1FZPB 5T67A 5CFZA 3M8FA 5LHIA 2DAOA 1LC3A 2NU6A 5CDGA 3B6ZA 3ZU4A 1TBXA 3FMQA 3IC7A 4P9UA 1AOYA 2LDXA 1WWKA 2G1UA 3P2OA 4LSMA 4W7IA 2HYGD 4E31A 5JYEA 1J9IA 1O9BA 3IS3A 4HY3A 4PVCA 3ZW8A 1K2WA 4DQXA 5MGBA 3E97A 4M9SA 1D5VA 1LC0A 3GNTA 3PJGA 4BV8A 5I9LA 2FU4A 3ORFA 1B4AA 5D6EA 2Q8KA 4I5DA 3JTGA 1VJTA 2V9VA 3GK3A 4LW8A 3RC7A 3OJOA 3ZWNA 4JK3A 2HJRA 4CZZA 4LLLA 1BC7C 3RKWA 1C0PA 2FP4A 2AE1A 1O95A 2YDXA 1UZLA 1AE1A 4R1NA 4UUPA 1J49A 2HU2A 4GAEA 1REPC 4GX1A 1IAWA 3UN1A 4BNLA 3RFXA 4QLCU 2W2KA 4DC1A 1K0UA 4PLZA 3TO7A 1DC3A 4M9XA 3L4SO 2V6CA 3ZWBA 3ASUA 1HKUA 2VRCD 2OQRA 3WTWC 1USSA 2P5VA 4YT8A 3TGNA 1JVBA 1M6WA 4ND3A 1J7KA 5ILVA 1P1KA 4R9RA 3LAPA 4R54A 5ILGA 5I7FA 1AWCA 3HDHA 3KYCB 4DPLA 3ZHZA 5BSHA 1HXDA 1LDKB 5GMOA 2CZCA 2K86A 3NTRA 5AXCA 3RJPA 3QOPA 4M71A 2VCYA 2X6TA 3F3SA 3WYBA 5FI3A 4EI2A 3WGOA 3IKVA 4UULA 5KVSA 3P19A 4EGYA 1P2FA 3LQQA 2GYYA 4PLFA 2I76A 2VONA 3T8RA 1FDVA 4HV6A 2JHFA 2HMSA 1HSTA 4EW6A 2CUKA 4XGNA 1MKMA 3GHYA 4L8VA 2WTBA 4BNMA 2FMYA 3NEUA 3T0YA 3DOCA 4B8WA 4BGEA 4NR0A 5DV5A 1YJ8A 1UP6A 2PA3A 3WTCA 4E4YA 1YB5A 2PH5A 4YT2A 1TNTA 2R00C 2JD0A 2PBIA 3HRSA 2PLAA 4RO0A 5JYDA 4YJDA 1YWGO 1EH6A 1KVRA 1FDSA 1LSSA 2PWZA 1IN7A 3OA0A 3SZTA 1P1IA 5FFZA 4BXUA 1I36A 1PIWA 4XB1A 3WR5A 1J2XA 1YBAA 1ZEJA 3GY0A 5JFRA 4FDAA 5IDYA 5HBRA 3HTSB 4EEXA 3S2WA 2VE9A 1ZRFA 3EYWA 4YWJA 1E3WB 3E1KA 1WQ2A 2YW9A 2QWWA 4AWXB 3WTZA 1UDCA 5JDCC 5ILSA 3DHNA 1BI0A 3WE2A 5ILUA 4IRIA 3U9GA 2AXLA 2Z95A 3I6QA 5TNXA 2VYVA 1VTNC 4ZD6A 1HKSA 4MPDA 5EIOA 1FBSA 3TDZC 1LU9A 2WD8A 3RASA 5I7VA 1YL6A 3C1TA 4UV8A 2TDXA 3F6OA 2DPUA 1Y8RB 1I10A 2G5CA 1Z6ZA 4BB6A 1Q0QA 3CTAA 2O4UX 1ON1A 1LSJA 1VM6A 1LUAA 2D8AA 4CUKA 2R00A 4HDVA 1SO8A 4M54A 1ULSA 4DWVA 2D59A 2PZLA 3BMCB 4UVHA 3CLOA 5CVVA 4KWHA 3FCOA 3VB2A 1C1DB 1YVEI 2ZBKA 5JY6A 1DIHA 1ZSYA 4QEDA 4ON0A 1EH8A 4I0AA 4C7KA 4BKUA 3F6VA 1AHIA 1FBQA 4ASNA 1ADGA 1YB1A 4OGWA 2WSBA 4AG3A 5FFXA 4BMVA 1C0KA 1X15A 3VZRA 3ZI0A 4PGGA 3I9OA 3EUWA 2JCVA 6LDHA 3V1UA 4LMYA 3U09A 4RVHA 3ADPA 1LEAA 2GN4A 5KNLA 1H2BA 1U9JA 3HNPA 1FYMA 4KICA 4G8XA 2V65A 4IQ8A 1ZJYA 4Q5SF 5EERA 2PY6A 3L9XA 5FI5A 5E1ZB 2X0RA 3DDNA 3VDQA 4YR9A 5K0ZA 3QP9A 3L00A 2XHKA 2DM6A 1UB9A 4U6SA 4BHCA 5HDNA 1TB4A 3Q9VA 3MAJA 4P96A 4XDYA 4MKXA 4S3MA 1YW8A 2C6YA 1Z75A 1SFUA 3EK2A 3V8KA 1K78B 4R68A 4O6JA 4FGWA 2J3KA 3SXPA 5FLXZ 2F1KA 4NHJA 1PJLA 2IT0A 2NYXA 3DV8A 1QP8A 2Y1EA 1I32A 1V3VA 4U0WA 3FPLA 4WECA 1H9AA 1U2WA 1GXQA 3BMNB 2HEOA 5EJ2A 1ML3A 4RGUA 1XN7A 3LT4A 4D41A 1C1XB 1UCRA 4M72A 1ZG1A 3JYQA 1YQAA 4WNCA 5TLSA 4Y13A 2ZQYA 2ZQZA 1B3BA 1BXGA 4BH9A 1A9YA 3MTGA 3RC2A 2GQQA 4XJTA 1R58A 3FNEA 2GXGA 4U5QA 4B8XA 1FYKA 3DR3A 2D0IA 1TEHA 1DJNA 4OKIA 3NT2A 3GEMA 3GEDA 4Z2YA 4W99A 4JX8A 2HFHA 3VZSA 3CJNA 1BDBA 3GFMA 1ZCJA 1B9NA 3ETGA 4ZYHA 1A5ZA 4L76A 1ZLJA 3F4LA 3E5UA 2Y0CA 4ND4A 4BHPA 1JE8A 1BW9B 4ZRMA 4D0SA 1XGSA 4WCDA 2PMUA 4YYZA 1E1LA 1ZARA 4BNFA 1R36A 2YV1A 5I9NA 3EDPA 3DHYA 4YFXF 2O7SA 3RAJA 4PG5A 3T7CA 5COQA 5T6BA 3D7LA 3ZMUA 2E1CA 1U3EM 1K7AA 4QXMA 2Q99A 2NS0A 1EE2A 3CDHA 2HMWA 3JQBC 4NK4A 3VH4A 4Y17A 3WMXA 4DRYA 1EVIA 3ABIA 2WD7B 3GNQA 1XEAA 1U5TB 1P0CA 2PZMA 3SC6A 3FSRA 2GXBA 3VZPA 4TQGA 2LF7A 1HDCA 3E03A 5JW6A 2OU2A 2HRZA 2PFGA 1Q0HA 2HQ1A 2Y75A 3DC2A 3I3OA 3OQ1A 5DCWA 5TS3A 3U49A 3WSVA 5CDTA 4DYVA 1EQ2A 1PL6A 1UAGA 1T2CA 4YDRA 5F1OA 2QZ8A 1EDZA 4F7ZA 5LCXA 4Y6RA 1G6KA 5G4KB 4ESJA 4KT5C 5G0UA 1PWZA 3PJDA 1JW9B 5LEJA 1EEHA 3WGGA 1KEUA 2YX7A 2DK5A 1QORA 5ER9A 3ZV3A 3ZWPA 1FT9A 1ZGAA 3X2EA 2ZTLA 4MP6A 3ZU2A 4M87A 4E5NA 4YT4A 5CEFA 1MX3A 1SEVA 5H20A 5D8KB 1PJQA 5ICGA 1JAYA 1NPTO 3G3EA 3U0BA 5JO0A 5LHHA 4O5VA 4WXHA 5IT9K 1WZEA 4NHEA 3KM0A 5CVIA 1KGSA 2HTSA 1AUPA 3VODA 1GYQA 3R3JA 1NFRA 2PNFA 3DZHA 3BTVA 2X9NA 5CHEA 3ZMSA 4NJMA 4F6CA 3EDMA 1BG6A 3LLVA 4IZHA 2VODA 1BVRA 3O4RA 4OAQA 4OIRF 1U7TA 4JIGA 4PLWA 4ZQGA 3RIHA 2Y67A 4YJHB 4FFNA 5KVVA 3AM4A 1UZMA 3JD3A 1R1UA 3JQFA 5DDGA 3PYLA 5IT3A 3ZV4A 2F5FA 2DKNA 4RF3A 3H8VA 1YKFA 2EP5A 4EJTA 3MOGA 5FD6A 1RNLA 4JCOA 3ZV6A 1ZK2A 2D2IA 5JAIA 3TFOA 4XLPF 4J0FA 2PLYA 4BQAA 4MVJD 1YBVA 2I67A 4KQWA 2A6HF 3F8FA 2MH2A 1XG5A 1QR6A 3CIFA 4MVJM 4U0KA 4QO8A 2LKPA 2IA0A 1SEPA 2NADA 3PTZA 4XCVA 4AJEA 4BIIA 1I2CA 4IDFA 1HKQA 2Q46A 3GFBA 3WGQA 5KOIA 1S8NA 1P4WA 3JQAA 5HWSA 3PQFA 2B0JA 1ZK0A 2QLZA 2IEDA 1GV1A 3ROKA 2BH9A 4Z0HO 1R22A 3NYWA 4DC0A 3KVOA 4U7BA 3NT4A 2NTNA 2Q1TA 2W2LD 4WKGA 4BVAA 1BWSA 1ON2A 1ZGJA 1NHWA 5L4NA 2B0LA 2W8ZA 3HRMA 3W6KB 1Z82A 4WUVA 5A2QZ 1ZBQA 2JPBA 3R0IA 4GSLA 2HRBA 2DI3A 3DZIA 3C18A 3QP6A 3HG7A 1QXSA 4DQUA 2WYUA 4RDHA 2B35A 2SCUA 3GR6A 4P5OA 5I8ZA 2DBQA 1P74A 1ZXLA 3FWEA 2E37A 3OECA 4GQAA 3EYIA 1HQCA 3RDIA 4N5LA 4E5PA 2Q49A 2NWQA 4ZQHA 2FOIA 3QV1A 4BNZA 3E48A 2Y1DA 2JRTA 1Y7TA 3L6EA 3QW2A 4JBAA 2KKOA 1ZO8A 1NVGA 4IXTA 3L9FA 4IRGA 1X7GA 4J7XA 1DIRA 3B1KA 4K28A 1K6OA 1WRJA 1EVZA 3OIGA 1IL0A 2H6EA 2O3RA 3KBOA 1JKIA 1OKRA 1Y0UA 4NBUA 5E20A 4BNTA 4EUFA 2H94A 1HYGA 1R0SA 2NAZA 1G3WA 1HYEA 2AEMA 4I9UA 1R5GA 1CF2O 3GG2A 4J6FA 4IS3A 2ZXJA 4A2UA 1NPDA 4OQYA 5A5EA 3KETA 3DBLA 2CFCA 4NBTA 3VZQA 3O3KA 5HRUA 3NRCA 5CVUA 2CDCA 4RPGA 2HKXA 4BMNA 1YGYA 4IJUA 4QFCA 4PG4A 3WGZA 2VYND 1GUFA 4Q3AA 4AJHA 4L9JA 3FMRA 3CZRA 2XKOA 5C7IO 2QYOA 3RWBA 3M9AA 1FDTA 1PS0A 1TI7A 2X5KO 4Z3KA 1ADCA 1YQDA 5L7WA 2HCTA 3ABTA 2QX7A 3JYOA 2HK7A 1TLHB 5ICEA 2O3JA 1ZREA 2A07F 2VRBA 3AU9A 2J3JA 1PQUA 2IPQX 4TVOA 3DB2A 3CTMA 4E30A 4FB5A 3GOHA 8ADHA 4CMEA 4LCJA 4EJWA 1ID1A 3DAGA 2QRJA 1O94A 1MXHA 4CV2A 1PZHA 1J5PA 1S7OA 2EK5A 3OMLA 1NHAA 4CLRA 3DBHA 3BJOA 1Z7UA 4JJIA 2Y0EA 4QFDA 1QBJA 2NVUA 2YYYA 4NJOA 4AJ2A 5D5VB 2V1UA 1F12A 2BF7A 2FPGA 2OQGA 5DOVA 4CHUA 4BHTA 2FMUA 4HP8A 5TT1A 5E18F 3FR7A 3HDJA 4DLLA 1YH3A 4OYRA 4WLVA 1WDMA 1NASA 1U4OA 2C29D 1O7LA 4IRHA 5ES3A 4JJGA 3L77A 4XD2A 3U4DA 1RYDA 3LQFA 4U6QA 5A9SA 2O48X 1UHWA 2VTEA 4LGWA 1E6UA 2H5LA 4TRNA 2B83A 1OMIA 1YDWA 3ICCA 4M49A 1YJQA 3GDFA 3IWZA 3RYRA 1JQBA 4FPXA 5CVJA 2DAPA 1Q7GA 3WTYC 1IXRC 1BI3A 1ZLKA 2A9FA 1R0KA 3U9LA 2PR2A 4IGEA 2FRDA 4Q9NA 4CM6A 5BOXA 4IUYA 4GWGA 4U0JA 2FA5A 5H6QA 3ENNA 3FNFA 2PFBA 4UVAA 4HUJA 1FJHA 1G4DA 1PP7U 4DXHA 1R66A 1P44A 4RGXA 2KIFA 2X4HA 3FBGA 2O0YA 3K0LA 2ZNZA 4HQMA 1ZIDA 1BJAA 5HDKA 2FR8A 2QZZA 3GLQA 2YR2A 4IZIA 1IRFA 4J2OA 3V5NA 4BNHA 5BR7A 2J5PA 3I5MA 2ESNA 3H4VA 5JVTA 1KVSA 2YSRA 1U4SA 4FC7A 3V7RA 4B79A 4CM8B 5JCXA 2Z5UA 3U4HA 4RB3C 3WJ7A 5A9TA 2ZYGA 2RV8A 3BA1A 2JJYA 1NVMB 2EEZA 1XR3A 1HF3A 5IDQA 1KEVA 3PGJA 2G17A 1PQPA 1DRVA 4LLNA 1W4MA 5F6FA 3FM3A 3TZKA 1XA0A 3HADA 1WLYA 3HFSA 5DCFA 3ZHYA 3QRFF 2AQHA 2HK8A 3KO8A 1QZZA 1KU2A 5L7YA 4A2CA 4BO4A 8LDHA 2FPIA 1QNTA 5DEQA 5A9SB 4PZJA 3JD1A 3FF5A 1LDEA 2V6GA 1F06A 1P45A 3IRRA 3FXUA 2OP1A 3T4XA 2NVBA 4BQPA 2A68F 1IB6A 5IXYA 3M2TA 4A5NA 4L9RA 4ALIA 2XGXA 3RU9A 2HDCA 2PG4A 4EM0B 1XGKA 2NQ8A 2VBXA 3QU3A 2C5EA 4ZVVA 5A06A 3R6SA 3ML6A 5CDYA 2RH8A 4FS3A 4DL9A 1I2ZA 1QYCA 2V6MA 3VDRA 4I7HA 4RL6A 5THKA 4UHTA 5CEJA 2FHSA 4B3IA 5T8KA 4M6XA 4CR7A 5G0WA 5CVRA 2WC2A 4NFHA 1HL3A 4MJLA 1WDLA 1LDJA 1MZBA 2RNJA 3WDSA 3ZW9A 2QIOA 1P1HA 4XRRA 3GUYA 3KOUA 4KDEA 4BGUA 5B4UA 5KVCA 1UDBA 2XV4S 3RUHA 2V6BA 4ETSA 4ND5A 1KEWA 2ZKZA 1DDOA 2DQLA 1JTVA 1MB4A 2DQ4A 1LDGA 3SFZA 1OYWA 4YACA 1AGNA 2IZ1A 5G0SA 2YHIA 4HFRA 3ZV5A 1UP4A 3HN7A 2CGPA 1U1IA 2K7LA 5JHUA 3JQGA 4R1SA 4PG8A 5L4SA 1VE9A 3AY3A 4JNKA 1GZ6A 2BI8A 2D1HA 1LXCA 3HRTA 2QQBA 2EWMA 2PZKA 2ZTUA 4OOFA 3PYXA 2FBKA 3GVAA 5L3GA 5L3DA 1T38A 3B20A 4KDPA 4HOBA 3F23A 4FJ2A 1F8FA 4XYEA 1KY5A 3RUIA 1I3KA 3LA2A 3GQVA 3PK0A 4E0BA 1MC4A 4LSWA 3CE6A 2QENA 2NNYA 3H3ZA 3DZGA 3Q0EA 4Y6PA 4QQRA 4WEOA 3CUQB 2ZFWA 3C8MA 1BTOA 3FN4A 1GEEA 3K69A 2YFQA 3LVFO 4HNHA 1Y9AA 1GYRA 2PGLA 3IQDB 3UXYA 4FX0A 1HKTA 3JQ8A 1LB2A 1RJWA 2C5AA 4YA6A 4MVJF 3JAMZ 4NBWA 2PQ8A 1Z7BA 3ABUA 4WX9A 4MP8A 4WOJA 1R6DA 4MKRA 2VUUA 3JQAD 1T6SA 4ID9A 3ELKA 3J80K 1E6WA 2NUAA 2X23A 4XRGA 3HSRA 1YW9A 2CMDA 1LLDA 1N7HA 3GG9A 4TWRA 2BGMA 5FFFA 5LBQA 2RDPA 4MTDA 3NQOA 4F45A 1MGTA 3RUCA 3VOEA 4YJGA 5TRTA 2FR0A 5EQFA 2FE3A 4U0YA 3PDUA 4YCAA 2CVZA 4BO6A 4KYWA 2DTRA 2A3SA 1R12A 3R6DA 2WWRA 1JHFA 3BMOB 3AY7A 1RZ4A 5A3VA 4D3SA 4WCGA 2QBYA 4EMSA 1EUDA 3ECHA 1R0LA 1SOWA 4R3NA 2EF1A 1QV6A 1X1TA 3S2FA 1ZK1A 1ONOA 3OSUA 5AVOA 3T5XA 3S8MA 4MEYF 3SZPA 4G9YA 3PI7A 2QHXA 4PIVA 4L0ZB 3UCFA 4GLOA 2XIGA 3GPIA 4OH1A 3KYDB 4BNGA 2OA4A 4ZYGA 1PSDA 1N1GA 2V79A 3QAHA 4KIGA 2LDBA 5FLXK 2RHCA 3FD8A 5JLAA 1F5TA 3PXXA 3NGXA 1H9BA 1Y8QA 4LISA 4RLHA 2VN8A 3S2EA 2YV3A 2GPTA 3W6UA 4CJXA 5LEKA 1I0ZA 3E3VA 1QLJA 5KKCA 4ONEA 4HADA 4BKQA 1FDWA 5BMZA 4WLNA 4G6DA 1O5IA 4HFJA 1DPUA 1K5HA 2IE0A 1DHTA 2M87A 2VC0A 3INGA 5IJZA 5BNFA 1Z6TA 4LB6B 3OH8A 4N9IA 3PQEA 3V2GA 5JE8A 5A5FA 3GZNB 1Q1HA 4L9TA 5ICSA 5ICMA 3M1EA 2B69A 1O3TA 2XAFA 2P5UA 5TF4A 5CDSA 1Y9EA 1CYDA 3TZ6A 1ZH8A 3DEYX 4ND2A 3AOEC 3FI9A 4CM4A 3HN2A 3HUDA 1P0FA 4HX5A 5DN9A 5LRRA 1R4NA 3HDQA 2ZCWA 4BGVA 2IRWA 4Z0TA 3VPSA 2C59A 4UEKA 2FZEA 1ORRA 2PTGA 4JJFA 1EZ4A 1HDXA 2Q1UA 1NM5A 5DD4A 3KSZO 4AJ1A 4B4VA 4CLXA 4MINA 1LLUA 1HSOA 1ZMOA 4EM2A 1WW8A 2HQRA 4OINF 5EINA 1YQXA 4CV0A 4U8GA 1Y5MA 1BVUA 3LC7O 3VAZA 4R9SA 3UW3A 1MFPA 4J0EA 1WSUA 3TQNA 1CIVA 1JKJA 1WAMA 3V8BA 2PH3A 4BO7A 4CLOB 2IYPA 1VJ0A 3C1OA 4PRLA 5ADHA 4ILKA 5IAAA 3M1AA 1I27A 5HM8A 1OAAA 4BNKA 5HS9A 5FO5A 4AIJA 1EUZA 3CMCO 3UGKA 1PR9A 2NM0A 1DJQA 3QJ5A 1H9GA 1LLQA 2NTVA 4RPKA 1I5ZA 4G7HF 4WLFA 2QM3A 4MQ9F 3SX2A 1X7HA 1ZG5A 2AEFA 1PTJA 1ZFNA 4FQ8A 4WOKA 3F8CA 3DFUA 3W4JA 3F8NA 3JSPA 4IINA 2W85A 4LFUA 4OM8A 1C0WA 4RPJA 1XCBA 4P4LA 4E32A 3G73A 3GFLA 3OIFA 4YRAA 1DO8A 4I9HA 2KJBA 3H3FA 1CEQA 2Q4BA 3GFGA 4GVLA 1B8UA 1NQAO 4R3WA 1DIAA 3BZUA 3R3SA 3TO6A 4Z9FA 2BBYA 3DKWA 3I0TA 4GMGA 2BELA 4NI5A 4QTZA 3TL2A 4CMIA 2CY0A 4BL5A 2VNAA 3KSUA 3OQ6A 1EE9A 4OMUA 4G65A 1OMOA 1E7YA 1CF7A 4ALKA 1T39A 1TT7A 4E70A 2ISZA 1JAXA 5KVRA 1PZFA 4KIBA 1IHXA 1P3DA 2P2SA 2UVDA 3IIEA 4H16A 4I02A 4Q39A 3GZ5A 4OIOF 5B4TA 4WASA 3ROQA 1ENYA 2DO7A 4L0YB 2VUSA 1L0OC 1LEHA 1SBYA 4EVIA 3GMSA 1XSDA 5LGNA 4D44A 3ONFA 3K92A 2ISYA 1L3LA 1R7JA 1T2EA 3U1DA 1D1SA 2PEXA 3V2HA 1SOVA 3N97A 2X0IA 3UKOA 4RGRA 5DCMB 2EFWA 5G0TA 4DIOA 2ZKLA 4J43A 2NQTA 3AAFA 1Y6JA 1G3TA 3I59A 1HTBA 2DBVO 1B7GO 1EDOA 4UEJA 3RJ9A 2V1XA 3OA2A 3OJFA 3CH6A 1F17A 4MVJA 4A0XA 4IDDA 3UH1A 1FX7A 2FOKA 3NRVA 2OAZA 4OIQF 2AQIA 4MNUA 4LJZF 2EV9A 4HBLA 1HW2A 2VBYA 1HYHA 3F72A 2DPGA 2GN9A 3A1NA 3BPVA 2Z1NA 3RD5A 1E7QA 1T24A 5L9AA 5CYVA 3O8QA 3DQVC 4HWKA 9LDBA 1J4AA 1JN0A 4YXFA 2RGVA 4RS8A 1EMDA 3INTA 3IL2A 1ENOA 1T4DA 4GYGA 4RVGA 1MJ9A 2EB7A 2E49A 3B1JA 3Q2KA 3QY9A 4DBVO 5F1PA 1XU7A 3DZFA 1GUZA 1YL7A 3HDYA 4YIIA 3RU7A 4GMFA 2H1SA 3F5SA 2P91A 3UFXA 3DXJF 2W2LA 4NDNE 3ZNPA 1ONPA 2YQ4A 4I5EA 2P5LC 3HOSA 1FDUA 2WTEA 3LC1O 5T5QA 3TPCA 1G0OA 3AUTA 1ISGA 1FC3A 2FQ3A 2JD1A 2WYWA 4I1IA 4O0LA 1G1AA 2VHZA 1I3MA 2CO5A 4R79A 3GNSA 5GZ3A 5T64A 1HZJA 3BIOA 1W5SA 4HV4A 3QP5A 3BP8A 2B4RO 4IPTA 2X8LA 1LVAA 1DC4A 2YX4A 3GH3A 2EA4A 3TN7A 1E1KA 3K8ZA 3UAGA 4HAMA 5EEGA 5GZ1A 1NR7A 2AA3A 3WU0A 4HXYA 2ZMEB 4RVSA 4FFPA 3IC5A 1LBEA 2OBNA 1BI2A 4MP3A 3ZDFA 4QO7A 1YDEA 3C3WA 3ROMA 1N9GB 4FCCA 2CSOA 3JYPA 4PLCA 1E17A 5IG2A 4CYDA 4A12A 2YJZA 2YUTA 4BAYA 3ADOA 2DTDA 3LYLA 2V1DA 3T8TA 1K79A 3LSTA 4YFNF 1P33A 2P9GA 3IDSA 3FXQA 1J6UA 3GT0A 3KYCA 4MVJE 4BNYA 4E3ZA 5EN4A 3OFSA 2OBYA 4II3A 4ZICA 3I4FA 3GX4X 2IZZA 5I7EA 2DPDA 2UXXA 3ZMZA 2I99A 1IUKA 3G17A 3WGTA 4AVPA 1HDGO 4WPGA 3DFGA 4RZHA 2VHVA 3AK4A 4CQMB 2I65A 1VL0A 2Q1WA 4XX0A 2Z9OA 3I52A 3KLMX 4XQGA 4CM7A 4WXCA 3MCZA 2X7HA 3QVXA 4Y15A 3JSOA 2Y1FA 4E21A 5ILOA 2VYNA 2K27A 2UUOA 3ANMA 4RGBA 4KIFA 3VTZA 3PHGA 3DAFA 3ZHBA 2QW8A 4F3YA 1GYPA 2BGKA 5D8LB 1BMDA 1HLPA 1ZK4A 2RH4A 3E18A 3F5QA 3GHHA 3WWYA 3DAPA 4BO2A 4L75A 1KERA 2VHYA 3BHMA 3OEYA 5JDCA 1QV7A 2HLPA 3JQ9C 5HA5A 5L7TA 3KLPX 1U3UA 1I1GA 2BHLA 4TKMA 3I9MA 4P4NA 3IAHA 4XRFA 4YEDA 4E2ZA 3Q3CA 3A9WA 4ZQEA 4HYEA 1OBFO 1OR7A 4AFNA 2Y05A 3GEGA 2WMDA 2J3IA 3JTMA 3MWEB 1I30A 1T25A 1E3WA 4E2YA 5JY1A 1CQJA 1YS7A 1KYZA 3WJAA 2VXZA 1IULA 1O89A 3E5MA 3I1JA 5FF9A 1T1RA 1T2AA 3TZQA 3EW7A 3K9TA 4ENNA 4WEQA 2ZJ0A 3HQ4O 3N58A 1JWAB 1BIAA 1S7CA 3OF2A 5DBIA 3H3JA 1Y8RA 3C24A 3NAQA 4S1VA 2E4AA 2OZPA 3UICA 4AJKA 1P9LA 1EH7A 3QVOA 3H5RA 1Z91A 3RBZA 3E8XA 1GZ3A 3QE3A 1UXJA 2Z5LA 2VBZA 2CYYA 3JQ9A 1SD7A 3BMCA 2OORA 4M9ZA 4NZ9A 4W6ZA 1C1DA 2XAJA 4QSMA 3MZ0A 4CUJA 2P4WA 2EJWA 3NEPX 3K6JA 1TW3A 3LFKA 3BYZA 1SMKA 5KK1A 3FR8A 1FYLA 4FIZA 1U78A 4PLPA 2I3AA 3A06A 3IJRA 5L3ZA 4E2WA 1NP3A 2XROA 4DPKA 2CWEA 2EJVA 2YY7A 1PJ3A 3QPTA 1DPRA 2Q0OA 4U7DA 1ZK3A 4IDBA 5EESA 2JAHA 1IN6A 3W4KA 2MLGA 3AWDA 4GKVA 3COAC 3GEZA 1GAEO 2P7VB 4CV3A 1KA8A 2L3DA 1ULYA 1NQTA 3NDJA 5KKAA 5ERIA 5KJEA 1ENPA 1OYIA 3AM3A 1XHLA 3F9IA 1B6AA 2DT5A 2VE8A 5LC1A 4BO3A 4NBRA 3I83A 3I54A 3WTSC 3BWGA 1YYVA 2UV8A 3LSYA 4B7CA 2QRKA 2AHRA 1MGOA 1JLLA 1H6AA 4BNVA 4ZH4F 1WPQA 4ALNA 4OSOA 2OFPA 1K78A 4BS9A 3JQCA 1GVJA 4KN4X 1E92A 4BNWA 3ZMTA 2FPPA 4LK3A 1WI9A 3IHUA 4ENJA 1W0CA 2EKLA 1K3TA 3DO5A 5IN4A 3EY4A 4GLLA 2D1VA 2VTDA 4O63O 2Y68A 3FMSA 3H2SA 3HHHA 3WQRA 5IZ4A 1A72A 1R16A 4RDIA 4XDZA 5JFOA 1C1XA 1D7OA 1YL5A 4RB0A 2ELHA 1YRLA 4OHUA 5TGDA 1FP2A 3SHFA 2ZK7A 4RPLA 1ZSNA 1TQIA 4H0EA 3U4IA 1X14A 3F1KA 3EQLF 2A61A 3GDGA 1FNNA 2HGCA 2XRNA 4OL9A 4D45A 3H7AA 1U5TC 1RI7A 1IXCA 2FZWA 1LJ8A 1SD4A 4I8XA 1RIOH 1YW7A 2M8EA 2VOJA 2VUTA 5FD5A 2G9WA 2AMFA 3KB6A 4CM9A 5A05A 2FEZA 5DCUA 4G81A 3JQFC 1SMTA 3UHAA 4PZCA 4TMFA 1UHMA 3EYYA 3VFZA 4WLEA 1T0FA 2DW4A 1BW9A 1XQ6A 3C7AA 4Q48A 1MDMB 3LF1A 1PL7A 2GD1O 3RSHA 3GUDA 1FSEA 2JFGA 2TMGA 1ZXBA 3PWSA 5K6AA 4YRBA 4DIFA 3W8EA 3LDHA 1JXSA 3TOXA 3GFJA 4NPCA 2P9EA 1ZW1A 3AY6A 4FX4A 4Q4ZF 1GFSA 4RCVA 3RVDA 2CDAA 5D6FA 2CF5A 4JP3A 1BDMA 5BT9A 4CM5A 2IP2A 3EUHA 1ZKMA 3I4PA 3OP4A 4PCVA 2WD7A 2F5CA 3KP2A 3I64A 2PK3A 1U5TA 4TRMA 3EETA 3PQKA 1AN9A 1VLLA 2BFPA 5CP8A 4ZU3A 3WLFA 1TQMA 2VWGA 4I08A 1RWBA 1DIGA 3PLRA 3Q9UA 4KTVE 5HOOA 4E12A 4WXDA 5JMPA 2EKQA 4YQZA 1O3RA 3OETA 2PJPA 5COAA 2XXBA 3OOPA 4LGVA 1XELA 4PG7A 2PD6A 4S04A 1C0LA 4C4OA 3H9QA 4MTEA 2L01A 2ZO4A 1KVTA 5G4KA 4XSXF 3TOZA 4IMPA 4BV9A 1OI7A 4W82A 3NJ4A 3DTYA 3F3XA 1YFHA 2FNAA 3WB9A 2X1HA 4R41A 4KMFA 2M1BA 3JAMK 1ADBA 1HRDA 1GQQA 2ZTMA 1KIFA 4P9FA 4BNCA 1AHHA 1GL3A 3VPXA 1X7DA 5MDHA 4E5MA 2A94A 6PAXA 2FY8A 3TDKA 3QVTA 1GU7A 1HDZA 4J16A 5DZSA 2EFNA 4D0RA 5IXSA 1A9ZA 3E82A 2ESHA 2O2SA 1SB9A 4Q3NA 4XA8A 3PHHA 2NU8A 3ZWYA 2DTXA 3GMDA 2X4GA 4CM1A 4XR4A 2Y99A 1FF9A 3OV8A 4CO8A 3G79A 2RHRA 2VC1A 4H3VA 4N9HA 4YJHA 3PFIA 4NU6A 3QVSA 4J7UA 1UR5A 4R4JA 3BMQB 4ENMA 2RC4A 4J4BA 1QKIA 4W4TA 5KCZA 3WQSB 3ZWVA 2O7QA 1PWXA 5DD8A 2IODA 1OC2A 1VPDA 4B7XA 4TSKA 3DOJA 2AW5A 3FF4A 3K2EA 1YLFA 2MBFA 4WCFB 1JGSA 2YU3A 4XGKA 4KMUX 4HNGA 2P9CA 4MQVA 2VZ0A 3DWFA 1QO0D 1R4MB 3HSKA 2C0CA 5F21A 1YBMA 2XVCA 3KFWX 4IJKA 2WDZA 4R1HA 1OFGA 4HBGA 4CMAA 3RPUA 2WWYA 1Z9CA 3U3XA 2EWNA 4WF2A 2EHDA 4BUCA 1EQUA 2DBZA 3DXFA 3GAFA 4LVCA 4PG6A 1IYZA 3DOOA 4CMEC 4ND1A 5CLSA 2FRHA 2WV0A 1E5LA 3U62A 1W7PB 1N1EA 3MJVA 4UUNA 4WJZA 2J5QA 5AYVA 3L0DA 4XKJA 1SAXA 4LG0B 1S7AA 1HE4A 4LB5A 3TO9A 2AE2A 4DYDA 3Q5FA 4QUKA 3EZLA 2UYYA 2R2GA 4MIOA 4O59O 1XSVA 1M67A 1QYWA 2CDBA 1DRUA 4IDCA 5B1YA 1XDUA 3EZYA 3PPIA 4B3JA 4AJOA 1ZN2A 4KFCA 4A73A 5J23A 2OGUA 3RKRA 2MLKA 1SD6A 3D5LA 4JK1X 1UJMA 2IRFG 1T2KA 1B15A 1ZUD1 5AXDA 4GX0A 4ZGWA 2D45A 3BPXA 3EAGA 3Q2IA 3K1MA 1FBUA 1ZEMA 2CSUA 3HHGA 2H9IA 1T2DA 2P5KA 4R5HA 2F00A 4OXKA 1LQTA 1H0MA 2NSDA 2OHXA 3PHLA 5CEEA 1XGNA 4CICA 4O5OA 4FN4A 1KOLA 1TA4A 3E5RA 2G7UA 1UFMA 5BNTA 3B02A 3FHLA 2VZ9A 1SNYA 1HSZA 4LVUA 2WYVA 2EV0A 1A4IA 3FNHA 3DL2A 4YJFB 2Y1CA 2HDHA 4H15A 3WICA 3NT5A 4Q3BA 2HUNA 2VHWA 3GDOA 2D5CA 4J9UE 2EFPA 3TFQA 4HX8A 2O6GE 2O3SA 3CINA 2G7HA 2CFXA 2XKPA 3GZ6A 3I71A 4FT8A 1HDRA 1RM0A 2QRLA 3O6BB 1JDJA 4K26A 4QT0A 1D4FA 4Z9YA 4IF4A 2QQ5A 3PYMA 5CPBA 4D43A 2ZB4A 4IDEA 1PJTA 1ZJZA 3KP3A 4XQ9A 5BSFA 4EJUA 1YTYA 1DFIA 2FBIA 2O4CA 3AM5A 1IZ1A 3ZNOA 1NR1A 4XYGA 3AI2A 3C1AA 2FSSA 3LA7A 3GF4A 5F5NA 4BNNA 5A03A 3DBRB 5E8GA 1Q1NA 4L9NA 3RC9A 1DAPA 3B73A 4L9VA 4OMYA 3OJ0A 1DXYA 3QWBA 5C37A 3IOYA 3QU6A 5JXWA 1SCUA 4Z0PA 1XMKA 4R8HA 2C82A 3FBTA 4BO9A 3R4KA 4J1TA 1V4RA 3L7WA 4A5MA 2EKPA 4U0VA 1ZNQO 2OL4A 4P22A 3JD0A 4R1UA 5E1WA 4RLSA 1GUYA 3KEQA 4GCVA 4CLDA 1ZMTA 4IGFA 4IY1A 1WP4A 2OMEA 3MZYA 5L95A 3D0OA 3WBFA 1MV8A 4BNIA 1M75A 2BFOA 3Q9SA 5HDGA 5J6XA 1IOLA 3B70A 4Q3CA 2J5KA 2UZKA 1EFKA 5AQ1A 3W8FA 1YG2A 5ER6A 4C7JA 2Z33A 4TVBA 3PIDA 5HLHA 2Y48A 2GUGA 5AIQA 5ICFA 3WIEA 4B4OA 4A6EA 2PGDA 2FXAA 4UUVA 4Y9DA 1G3YA 4ALLA 1B2LA 3WMWA 5ENVA 2WE8A 4OMZA 1NFQA 2IA1A 1CERA 4YB8A 2H63A 2X22A 3PJEA 4OXYA 1FP1D 4GSKA 4JBHA 5GZ6A 5T8KC 1KYWA 4CR6A 3CPSA 5JSFA 5AIPA 4EGFA 1XGMA 2JAPA 3ZN0A 2QZ9A 2C2YA 3FPCA 5TT0A 4A7PA 2TMDA 4OOIA 2CF6A 5F5LA 2RAFA 4PLVA 4XLNF 3U4CA 4NFYA 1E2XA 5TJ9A 5IZCC 5JAZA 4EGZA 2Q4EA 5CG1A 2G76A 5A02A 4TRJA 3D4PA 1YO6A 4HX4A 4IS2A 5A1TA 4EDFA 3V7SA 4AJ4A 2Y1GA 2PI0A 2RIRA 4R69A 3WOHA 4MKZA 3JQDA 1DLJA 4GGOA 1U3WA 4KUMA 3I9LA 4M86A 4NG5A 1D3YA 3WWZA 1MUUA 4P55A 3F8MA 3FRJA 4NH4A 3TL3A 4CL3A 2FF4A 3E9MA 3LT1A 3NDIA 4CM8A 3LZ6A 5F3RA 4CM9D 3EMKA 4BKOA 3H2ZA 5K9ZA 3DZBA 5I9MA 3E5XA 4RAZA 4UUOA 1FXSA 5LGTA 4A03A 4ZZLA 3RPQA 4UNOA 4FC6A 3E6MA 2EP7A 1LNQA 1H5QA 3MJEA 1X3UA 2E7WA 1EV7A 5H6RA 3RYPA 2GGSA 1DEHA 3NX4A 3LWFA 9LDTA 1UH5A 3QRWA 2X0NA 1R00A 4G7ZF 2FN7A 2GF2A 3PHJA 4RVDA 3RCBA 1W4ZA 3V1TC 4IJWA 5IZCA 4RJTA 3JYNA 3A4VA 2IA2A 4L5JA 1LQ1A 2GA2A 2O23A 4K1LA 3G49A 2NTJA 1ZYRF 2XAQA 5E17F 2OP0A 2OOSA 1S3JA 3SQNA 1DBVO 2Y66A 4UVIA 4Z3DA 4BGIA 3WFJA 5K5QA 1GZ4A 4MIYA 3ULKA 1LTHR 2W90A 2M45A 2VBWA 4E5YA 3RKUA 5TSDA 3I53A 3P7NA 4GVXA 3QSGA 1A04A 1LRKA 3WNQA 2XUBA 1N5DA 4HF2A 1OOEA 2DLLA 2DUUA 3VPFA 5HLIA 4Q3DA 2LDUA 1UUFA 2PD4A 4OXNA 1QSGA 2B37A 4DGSA 1NHGA 1DAOA 1Z74A 3WBBA 5K5RA 3M7GA 1ISMA 3BY6A 3INRA 2DBRA 2STTA 1PX0A 3DZKA 1TQPA 3UVEA 4HFNA 5TX7A 3SEFA 2GZ2A 1R37A 3BTUA 1J59A 2YDYA 2PKQP 2F2EA 5KJFA 2DLDA 3HJAA 2CQKA 2W4QA 2DPHA 3GFIA 3NTQA 4CMGA 4F6LA 3CUQC 2GIVA 5FGMA 3V8JA 5DF1A 2QQ9A 4UVGA 4JQCA 3T4EA 1E1NA 4YFKF 1DUXC 5ITVA 2ILTA 3D3EA 2RN7A 2QUFA 1YOVB 3V2UA 5A3JA 2B5VA 3ETEA 5JNLA 3BJAA 1U2GA 2C7GA 5LGUA 1ONNA 3O03A 3FTNA 3KZZA 2DUWA 3PZRA 3ZZNA 5G2OA 1LDDA 4ZQFA 3D3WB 1UAYA 4ZZDA 4L5IA 2Q3EA 4IHSA 3C85A 2POQX 2GNAA 2X0LA 2YV2A 2Z3YA 3K30A 1O57A 3N74A 3RFTA 5JDIA 4ZA2A 1BN5A 1ZRDA 4HF1A 1BGVA 2O50A 3RUEA 1L7DA 1UXHA 1HE2A 3FTPA 2O2YA 3WYEA 1C14A 1E0DA 1F0YA 3PQJA 2D5AA 3C7DB 1HT0A 5BQTA 2IXBA 1E3LA 3CUQA 2H6CA 3R0AA 1K89A 2HWVA 1WVGA 1U8FO 2J6IA 1B8VA 2JSCA 3F8BA 3PHIA 5L3BA 1X1EA 4YIFA 4AJPA 3DPLC 1XCVA 1ISHA 4TRRA 2BLLA 1KU7A 4IPAA 3HRUA 1LI4A 1VC2A 2Q2EA 2WEKA 3E6AA 3GPDG 1U6GA 3UCXA 3DFZA 2QYTA 1HZZA 3VEPA 2X0JA 1KY4A 1TT5B 2FSWA 2OD5A 4D3FA 2WM3A 3RKXA 2O8XA 3WIDA 3WTTC 2BI7A 3J81Z 2B4TO 4M1QA 4B7UA 4Y67A 5L53A 2VWQA 1USTA 1I8TA 1O7FA 1JWBB 4GGGA 2A6EF 5AONA 2ADUA 2R7FA 4BO1A 1H9TA 3BMOA 2VOEA 3ZPLA 1NVTA 3MWDB 5DULA 4AVYA 3R0JA 5FYDA 1L7EA 3AFMA 3LAJA 2ZB8A 4Q47A 4A0SA 4BKRA 4YBZA 2JFFA 2DQRA 3KEOA 3WS7A 4BO5A 3VTFA 2HQNA 1IRGA 3RI4A 3ZNNA 4ALMA 3VH3A 1OYYA 2HTJA 3KYDA 3NKLA 3N7UA 4TKLA 1PUEE 4CLEA 2GSDA 1YIOA 2JTVA 4WK6A 1MP0A 5THQA 1SZJG 3WTUC 1ZSVA 2ZNYA 2K4BA 4BO0A 3GVIA 1ULUA 4N0BA 5C7OO 2FNPA 1QYVA 2ZB7A 1I6XA 5HVQC 4A27A 2JKVA 4KTTE 4I9NA 1BBYA 4FSHA 5G0VA 2EERA 1BOAA 4EJVA 2Y93A 3M2PA 1F9NA 2UXNA 1UXGA 4BNXA 1LSUA 3GF2A 2XAHA 3GRKA 4CQLB 7ADHA 3GZNA 1XWFA 4IDGA 4MIEA 1DP7P 3JQ7B 3PZBA 3KZYA 4J7CA 3D5QA 5AXAA 3S2GA 2H09A 4J3FA 2HSDA 2CVQA 4YAIA 4QWQA 1DIBA 1GTMA 1Q2XA 3IMFA 2I5PO 3JD4A 1V8BA 5LDHA 3QWFA 3G0OA 3DMTA 1JU9A 2B5WA 5JO9A 5IDWA 2ZIZA 3PJFA 1OPCA 1J5YA 2BMAA 2GZ1A 4XEHA 3SLKA 4JBIA 3M8EA 4IIUA 4B4WA 1I01A 4L4SA 2HS5A 4XWYA 1T26A 5EPOA 3K9QO 3WNVA 4IXAA 5EL0A 4M8SA 3S55A 4FFRA 1DC6A 2PMHA 1YONA 4PZEA 2O3UA 3ZWCA 4R16A 5IDXA 5ITWA 4CLOA 2VZ8A 1R5HA 2FMLA 3VH1A 3WSWA 3KZVA 5C7LO 4NBVA 1A71A 3W8DA 4BKPA 3ON5A 3WTVC 1ARZA 4PVDA 3F22A 1N7GA 5D5WB 2IJLA 3F1LA 1U3TA 4AICA 2W25A 2GR9A 5CPFA 1CWUA 4JXKA 4OU0A 2JPCA 1B0AA 1N92A 4UV9A 5IN5A 1GXPA 3ZU3A 4BNJA 2W2KB 2AS5F 1Z1DA 1HW5A 3V7CA 3WODF 4XZ3A 1P77A 3AJRA 3VPGA 1H93A 1ZH5A 2CVOA 3BROA 1XMAA 1PZEA 1H0KA 1UP7A 2BRUA 2XOXA 4RF2A 1TLTA 5DOZA 3JSAA 4R51A 5H83A 3ZNQA 3IUSA 4I98B 1PQWA 3P9CA 3QIVA 3D4NA 3MEQA 1CETA 4ZN6A 4IMRA 1PJBA 2EV5A 3F47A 1KEPA 4K6FA 2UDPA 4INAA 3LF2A 4Z9XA 5T57A 4UVEA 3K1PA 3ZP5A 2NRAC 3MWMA 3EVTA 4MVJI 4YQYA 1HE5A 1YE3A 1ZZEA 1QGPA 2GAUA 3COSA 3OJEA 5F1KA 1GR0A 3K1NA 2A92A 1O0SA 4AJIA 4RV9A 2VN2A 4Y6SA 3LA3A 1FLIA 1QMGA 5U4QA 3VC7A 4II2A 2HKIA 3PVZA 2O61A 4L0QA 4CM3A 2H6BA 3EVNA 4A6DA 3BHIA 5A2QK
chains in the Genus database with same CATH superfamily
3PR2B 4G7OF 1O3YA 4XVHA 4RVUA 1ONVA 1KBZA 3JU3A 4HW0A 2OO5C 1JHHA 2AFIA 5JC1A 1QZXA 2R8OA 3MTAA 2GUWA 1MDFA 1U0NA 2JFHA 1NF8A 3R8CA 5A0VA 3L0IB 3AG6A 3K1TA 5ALUA 2DECA 2JZYA 2G4CA 1AN0A 4MEAA 1KO1A 1IN5A 4YAJA 1F3OA 5IARA 3DZJA 3I9KA 3EHDA 1Z6RA 2XRFA 2ZDGA 3HWRA 3SCZA 4G23A 3P97A 3WB0A 4CZ2A 1N9GA 1D2MA 4XKVA 1J5XA 4OIFA 4XKWA 1SAYA 3V6LA 1KQ8A 5DBFA 2XCSB 2LNBA 3H87A 1LDBA 1Y1TA 3H97A 4WWCA 5FLKA 4GWKA 3P9XA 3MWEA 3NJRA 3PQDA 4B7ZA 2FKNA 3BXXA 5HYVA 1MORA 2NZWA 1TF7A 4TROA 3C6MA 1SXHA 2P6SA 1HF0A 2RQPA 1GCUA 2JT1A 4QTYA 2QGFA 2QUJA 3O2SB 4TZKA 2H1CA 3RF7A 4YS6A 5I7SA 1OYVA 1CGPA 4JLWA 1K6YA 2FPOA 1W88A 4BPRA 1JEDA 2V6IA 1EPUA 3U4QB 2X6RA 4PZZA 2DFIA 3MGGA 1XB4A 2HPIA 2Y0MA 3TOCA 1ZD4A 4NJMB 5DM7F 4HJXA 2HXIA 5T6MA 3EF3A 4IX1A 3OBBA 1MMNA 4N1AA 2VQDA 1RWQA 1Q3TA 2HZTA 1F36A 2M7BA 2J31A 1WRBA 1MDMA 3K8OE 1P1FA 4IEEA 3HZZA 3JRHA 3GVHA 1N8KA 4QXOA 4DUYB 4L0CA 1CUZA 3K9FC 3DSRA 1DBQA 3VX3A 1WHUA 4RZ3A 5H1YA 5JZBA 3O5AA 2EIMH 5LLQA 4F6RA 3TXXA 1FEZA 3AR2A 1AQYA 1RC0A 3HDTA 1J2JA 1JP7A 1N2CA 1U81A 2OBPA 2Z09A 1BMFA 3UWSA 2C0PA 1LDYA 4AMGA 1OZAA 4QNNA 3QIAA 1QNFA 5M3FJ 5EE0A 1G19A 4LNUA 1SUIA 3PNQA 4H7PA 1T2FA 4OKNA 4CCSA 4KQHA 3SQLA 4PWYA 1K06A 1DDNA 2M0CA 1DFHA 3DDOA 4AS1A 4KNYA 3VTAA 3RJTA 3LCMA 1NOKA 5EIAA 3E7LA 3ET5A 2ZUVA 5TMDA 4B0OA 4EIWA 1W8DA 1GN8A 2R66A 3OZAA 2YXDA 3I23A 2I87A 1JDPA 4LKRA 1ERDA 3QHAA 1XF1A 4L3OA 4UM9B 3RPEA 3N2NA 2ILVA 2Y2VA 2PWAA 3ELBA 2AS0A 3M8KA 2PN6A 5CJ2A 2RKWA 1HLFA 1RYFA 4XYMA 4KAJA 2PWBA 1CFJA 2R79A 3L2QA 4G85A 1V6CA 2QEXI 4NCJA 4RHCA 1ZHFA 2HO5A 5EWLA 5KOIA 4PZDA 3K8QA 2OZ6A 1UBRS 1TGYA 4D9BA 5FTLA 3DBRA 5A1JA 3KZKA 1W6UA 1X92A 4AY3A 2PAAA 1PL8A 1JDZA 1TCUA 2W6ZA 2G82A 5GP1A 5A3RA 1XNGA 1NVDA 4AN4A 3UV3A 1I6MA 1HG1A 5FWYB 4NK5A 3M81A 1Z17A 5D6OA 3TSWA 4LYFA 4NEQA 4PRKA 1KSGA 2QV0A 3IAEA 4YI5A 3H1EA 4CN8A 4S1WA 2JH8A 3GC6A 2I6FA 2IUUA 2Z8ZA 3CTPA 3MLAA 4QXPA 4LHWA 4FS8A 3JRAA 2DMQA 3X1MA 4RMNA 3OZVA 2WNSA 2JCGA 1XU9A 3WX0A 1OCOH 3AF1A 3GVXA 3IJPA 5JVDF 3P2IA 4B1FA 5AFSA 2EAUA 3ONWA 3V00A 3C5HA 1G4HA 4GECA 3DVAA 1VI5A 2BZTA 1Z5GA 2OVFA 4R8MA 3WHPA 2WA2A 4IP0A 3LRTA 3C3XA 4WKBA 3Q8XB 5K7HA 3R6TA 5HNKA 3M1LA 3DEIA 4C0WA 1IOVA 1PTKA 2LP0A 3RKQA 3O4FA 4XASA 4G97A 3R60A 2CXUA 3UJ3X 1JDSA 2KZVA 5BNIA 3W5CA 3SDZA 1G5QA 2PV7A 5AT1A 4EQQA 2FKAA 3F7TA 5JD3A 1XVTA 2O03A 2EFGA 4US1R 3V6MA 4MHGA 2DWPA 3U7EB 4Q7LA 1NY6A 4YRDA 2XQKA 1XZJA 2JFWA 4DMMA 4O4LF 4BMSA 3ZR4B 2IXAA 2EFOA 4JUCA 2JUCA 3GTOJ 4J3NA 1S6LA 2GJ8A 3T5DA 1TM7E 3GRPA 3EISA 1S8FA 5DT9A 2L0XA 1PGOA 4DWWA 4RTOA 3N1UA 2XSZA 4XIGS 3FWZA 3BN3A 5E3JA 1XZGA 5TMPA 3L0YA 5COBA 1TM4E 2NU6A 3ZU4A 3IC7A 4JB8A 3P2OA 3CNBA 1K2WA 2GOYA 2HHCA 2B5OA 1P91A 2VKTA 2DFLA 4Z4EA 4ND3A 4WBNB 2CZCA 2WKWA 1GQFA 2NVOA 3IKVA 4EGYA 4IJMA 3AJ9A 4EW6A 2PL9A 3EMBA 2FMYA 1UMBA 3DOCA 4M7OA 3WL7A 4WK4B 5YASA 1GSIA 4K86A 2PH5A 1R8QA 4GIBA 5KPDA 4BVFA 1FRFS 2Y0PA 2H5IA 4F91B 3SQWA 4HAUA 1EFUA 4XB1A 4BXUA 4DY6A 1ZEJA 4EEXA 1PFGA 3FSJX 3HMKA 3NHFA 3K9LA 1EK1A 5CJJA 5EWJB 2OXFA 2W93A 1Y8RB 4HRXA 1Z6ZA 3CTAA 3AH8A 1II8B 3BA6A 3ML1A 4KWHA 1RR7A 4HMQA 4H9GA 4I0AA 3CLKA 4E7JA 5GM2A 1DKQA 1MPTA 1Y9DA 3NVKI 2EBFX 3SSNA 3EUWA 1MABA 2WF8A 1WVMA 4COKA 3BCHA 1A6IA 1BX3A 5EERA 3WDKA 3GH1A 4P96A 4IUCS 4JBXA 4XDYA 4WW0A 4M7RA 3BXZA 5T4HA 1PJLA 4NOKA 1GTL1 1QP8A 2HEOA 2VQFB 4V3CA 3VUFA 4UE2A 1NYLA 3DR3A 4MUNA 2JGKA 2QQEA 1WV0A 1Q3KA 3GFMA 5CTJA 2L9VA 4CT5A 1VKZA 2NVXJ 1FQOA 1ZAYA 4R2MA 1ELOA 3W2IA 3OT4A 2FSIA 3ZDYB 1EE2A 3PUIA 4R7ZA 5F51A 5J4YA 1U5TB 2WY7Q 2VNHA 2LF7A 2HRZA 2HQ1A 2W4IA 1UAGA 5JNWA 1TFUA 3WKBA 1ISRA 4IIYA 3PJDA 4E2FA 1JW9B 1P9RA 4KI0A 5EMNA 4MP6A 5D8KB 3AEQA 3LHFA 3R3JA 2X1VA 1BR1A 2JRLA 4TUYB 3L79A 2XCRB 1BVRA 3BF7A 1AHPA 4EA6A 1YKFA 4RTRA 2ZPUA 2I67A 5KC9A 1RESA 2QWXA 4XCVA 4IDFA 3VM6A 3S1MJ 1S8NA 1P4WA 1G41A 3JQAA 4OH7A 3TI7A 4OLHA 3KVOA 4LZJA 2FOWA 3QHPA 4YMUA 5J4HA 4ZDJA 3K9GA 4RDHA 1CJVC 4IIBA 5F2NA 1HQCA 2JBHA 4E5PA 3DUFB 4RIEA 1UKCA 5AW0A 3QELA 1G38A 2YMQA 5AKYA 1DIRA 2BDTA 3M3HA 5I4BA 3AR4A 2AEMA 1HYEA 3U49A 1UBEA 3KETA 2Y4OA 3Q3GE 5F77A 2VYND 5AOBA 3DPIA 2RHJA 3RWBA 2WTMA 2HIHA 4ENSA 2EQAA 1SAUA 1CQWA 1E1RD 2A07F 1UK6A 3AJ8A 1PQUA 4KCGA 2CL5A 3PTAA 4EHHA 4QDOA 2QRVA 2NVUA 1V8FA 2FPGA 3FK6A 1WDMA 1U4OA 3MRVA 2X6WA 2E5FA 2B83A 3HU2A 1EP9A 3WWPA 3IWZA 2DAPA 1ZLKA 1Q1AA 2CKDA 1R0KA 2V3VA 3TW8B 3H6GA 5KOJA 1R66A 2K9LA 4DV1B 2FG7C 3FPEA 3LUPA 2BR4A 5BR7A 3K4KA 4WQMA 4YK7A 2PUHA 1KFCB 2C4NA 2RV8A 1HF3A 5LU8A 1FU7A 3L43A 2EVWX 1F60A 1SCJA 4LJRA 3JD1A 1M73E 3FXUA 2OP1A 3OCUA 3O47A 3TE7A 5IXYA 3P45A 3M07A 4GT1A 5C1IA 4I8DA 3QU3A 1MJHA 2FJPA 1TC2A 3ML6A 2QW1A 2OKGA 3HB0A 3KELA 9ABPA 1EX9A 1I7SB 4UHTA 3R5HA 1T2VA 4YO7A 3RRNA 3WRXC 4R7TA 2RNJA 1KRXA 3O73A 2XV4S 4ETSA 4BU1A 1P7JA 2DQLA 1BKYA 2INGX 5EYRA 1RLOA 2EWMA 4HDSB 2FBKA 3GVAA 4KDPA 4DR6B 5FWAA 5G53C 2IF2A 3OI7A 4ZT6A 2OCBA 4DMKA 3SS8A 4A2QA 3DZGA 2ZFWA 2AMLA 3LVFO 4MV0A 4YA6A 4PTZA 2C5AA 4H3KB 3WWDA 3OYJA 4WX9A 4PBSA 5DX1A 3NYIA 3R5TA 4MTDA 2AEEA 4IWXA 1HQKA 4HRYA 5EG0B 2OE2A 2OFOA 3G2QA 4F56A 3A4IA 1SUDA 3MRXA 2V55B 4CKWB 1Y34E 2QHXA 3T7AA 4YRKA 3W6UA 721PA 1SVUA 3R7NA 2BKUA 3PQ6A 2QTFA 4BFXA 3Q85A 4A8HA 5IOZA 4KBYA 2EL9A 3DEYX 4ND2A 3AOEC 4CM4A 2NVTJ 2ZCWA 3A1SA 3FPFA 3KSZO 1LLUA 4EM2A 3A3OA 4TVKA 4C76A 3FXOA 4GG1A 1KOFA 1V11A 2NTVA 2VPWA 4Q66C 4YP6A 4WOKA 4IINA 3L1KA 3OIFA 3IUYA 2D54A 5MGNA 1G20E 4BL5A 3HOWJ 1Z67A 1TT7A 5GAGJ 3K72B 5KVRA 2ODWA 2GXAA 2PKCA 1XSDA 5LGNA 3ONFA 1R7JA 1NR5A 1D1SA 2KQRA 5TISC 4IRUB 4RJLA 3ZXIA 1Z6XA 2C1ZA 4K88A 2E5NA 4KVGA 4V0OA 1NT4A 1HYHA 2GYVA 3SXUB 2W71A 4RS8A 2L2OA 3G68A 4IOJA 2WKSA 5IJ0A 1D1CA 3KTFA 3ZNPA 2DHRA 2XOEA 5T5QA 1R5NA 4OLBA 1FC3A 1LFUP 4MTLA 4X3PA 1KI6B 4JB0A 1W5SA 4HV4A 2WAYA 1UELB 5GZ1A 1H8ED 5K0FA 4ZANA 1E5XA 1OVGA 5FYQA 4FCCA 4UHJA 1NG6A 3LYLA 4BAYA 1K79A 3QI7A 5B6IA 3IDSA 2XGMA 3KYCA 4MVJE 4OI0A 2FWJA 3WGTA 1HDGO 4IYRA 4FYIA 2KRHA 1UL1X 1TTTA 2ZS7A 1UM8A 4CI0B 1O2DA 2XODA 4QUGA 3ISTA 4P4NA 2TRSB 3HCFA 3A9WA 4AFNA 3GEGA 4N5IX 2WPDA 1GV5A 3I05A 4QWMA 1KYZA 3VHLB 1O89A 2PZBA 4CCMA 4ENNA 4HYYA 3N58A 2GXQA 2LREA 3GU3A 1Y7PA 2E55A 1EH7A 3F71A 3E8XA 1X2MA 2ORYA 3SE7A 3A1WA 4QSMA 3EA4A 2HF9A 1NW5A 3K6JA 1AS0A 4KXVA 3CQ9A 4FIZA 4YXFA 3GEZA 2R1UA 1ULYA 1ENPA 2Q4OA 3HJTA 4L8LA 1FYDA 2DT5A 3I83A 4ZVSA 1SBNE 3GTLJ 3TLBA 1H6AA 2IDMA 4JOMA 1K78A 3W5AA 4O63O 4OHUA 4MV5A 2ZK7A 1QG4A 3KL2A 3ORQA 4MWTA 3P2MA 4N01A 4MMZB 4WK2B 5JSYA 2G9WA 1NF2A 4CUGA 2KB0A 4G81A 4O4HF 4Z8XA 4Q48A 1VCHA 1E58A 2PKEA 3HBAA 1XKTA 2CF5A 3E9YA 1XQXA 1GAWA 3DMRA 1OTYA 2WD7A 4GM1A 4B3SB 1OAKA 5COAA 1EXVA 1C0LA 4C4OA 2YJ5A 2A2ZA 2L01A 5I9BA 1H66A 1QVTA 2F1JA 2M6RA 1YI2I 4EYSA 4Q9IA 4TKVA 4UDOA 5HQTA 1TM3E 4I2NA 3PHHA 2QMOA 3FIUA 5IXJA 3CN7A 3OV8A 4DT1A 1UR5A 3IAM2 3BMQB 1QKIA 3DZ8A 2IWHA 3H9BA 2YU3A 2JIMA 3L06A 2OESA 1XC7A 5F21A 4S0XA 4RD2A 1R5OA 3N2ZB 1YNSA 3NBMA 3IR5A 5DTIA 3SJMA 2HI3A 2AE2A 1FMVA 4OA8A 1DRUA 1XRRA 2P75A 2QRMA 3C70A 5BRNA 4FR2A 3Q2IA 2IFTA 1FBUA 3F3YA 4OQMA 3GJZA 4MLZA 5HGJA 2P5KA 4RGVA 1ZL2A 3IULA 1RDFA 2IIPA 3NBFA 2EV0A 4IYJA 3VYSB 5JI2E 6ABPA 3T5MA 3ZCUA 1RXSA 4PINA 1X7YB 1KH1A 2I03A 2UYHA 1KXZA 1ZJZA 4RSMA 4YIKA 3ROTA 4BN0A 5LYYA 5A03A 4OMYA 1UBSB 3IOYA 3B3QA 1VPTA 3MYYA 4CEHB 2Q3CA 3G8BA 3KEQA 3F4KA 1OFHA 2F43A 2I6XA 4Q3CA 5HKAA 5AIQA 2G4LA 3MTQA 5FOWA 2LUOA 1ESZA 2WE8A 1CERA 3PNTA 1W36D 1CP3A 4OXYA 1WOMA 3G8CA 1RHKA 4IF6A 1FLNA 4HMPA 3IYLW 4FNGA 1KTIA 1TECE 4AJ4A 3VR6A 3JQDA 2X9LA 3ZQCA 2XGJA 4P4TA 3F96A 3FZYA 1WU7A 1WIWA 4A03A 1PWEA 3GT4A 2ZJPF 1X9HA 3JCUC 5KWJA 4G56A 4QEKA 4BGIA 4NEGA 3CLHA 1OHHD 2BTOA 1AKUA 4ISBA 4B45A 1XTQA 1CQXA 2B37A 2JVGA 1DAOA 1DEAA 1ISMA 3UVEA 2GZ2A 3QSYA 3UC5A 1QRAA 5EG5A 4PJLA 3TEFA 2G36A 5CCBA 5GV8A 1NH3A 1IQ0A 2FWNA 4H6PA 1Z35A 3AKEA 2P1ZA 2H1IA 4JVOA 4ZZDA 1H1TA 2GNAA 2X0LA 5FHRA 1Y33E 3N74A 3WAKA 3DVQX 4AKGA 4P08A 3OQIA 1K89A 4G1FA 4TMKA 1A0OA 3HRUA 1DAHA 2HFJA 5GOZA 1ZJ6A 1KQOA 5L53A 2XNJA 4FTHA 5DULA 1UWLA 2CZGA 4M3GA 2GIZA 4HEA2 2WVHA 2LE0A 3RI4A 2X0DA 4LGCA 1MP0A 3IEIA 1ZSVA 4BO0A 2MR5A 4QLAA 3N8DA 2BFEB 4BNXA 2XJ9A 1NZFA 2VFAA 4A92A 4J3FA 2HSDA 4YAIA 4Y2YA 1JI3A 3C3AA 3G0OA 2DDBA 2ZRQA 4XEUA 4UMFA 2ZUUA 2BMAA 1N6OA 3ESWB 3B52X 3W5JA 5EPOA 1NULA 5AVZA 3WNVA 4BP3A 1GNSA 4B35A 2F8MA 1DC6A 1MO5A 4R16A 1ZUNB 3CZAA 3WSWA 3ON5A 3RYCA 1P3JA 1V9CA 2V6EA 4HDNA 2W25A 3NWSA 2GR9A 3TOVA 5CPFA 2JPCA 3PDIA 5H59A 2HJ9A 4E7ZA 3GJ0A 1N92A 2VYQA 3SXJA 3KB8A 4O2BA 4ZN6A 4IMRA 5IEBA 4LHSA 4K6FA 4Z4CA 3EDQA 1AKMA 1GR0A 2A92A 4TMTA 1T3SA 3AZQA 1E2UA 1Z34A 1T5BA 2QJTA 3PQ5A 4X94A 4GXOA 5EHNA 1MO3A 1F1BA 4EPXA 4CU5A 2VHTA 3OE4A 3KEYA 4YH1A 3E4CA 4Q1DA 4W8OA 5AH0A 1RI2A 4N18A 4FBMA 2H9AA 2D74A 2NP6A 1KP3A 2C07A 4QVIA 1IBCA 1BQ4A 1CZUA 1VQ5I 5L40A 1Y89A 4CKCB 3PC4A 3EEFA 4OHRA 2DYRH 1PT8A 2ZCVA 3WB2A 3ITKA 4X3OA 2W5UA 2X9DA 3A8TA 2VTBA 5GONF 1YAHA 5CW1A 2XTJA 4ZHSA 2E48A 4BJ3A 4OIMA 2R6FA 3OPQA 3QWAA 3LKVA 2AFIE 1QANA 4W5RA 5TMEA 3IRVA 1QPIA 4YAWA 4ZK6A 1YQEA 2CW8A 3K4CA 1QMPA 2MSNA 3RV4A 3WGJA 5CJPA 1M2OA 4M74A 2QMQA 1X77A 4MS1B 2Y0SA 1W36C 5IFLA 3AW9A 2CHFA 2OWEA 1XKXA 2WSMA 2W24A 4WSOA 3RIEA 3O2PE 4C4PA 2LZ0A 2QP4A 3JW8A 1VI2A 3DWGA 2VLAA 3SYMA 3EOBI 4ZT5A 1GQYA 1H88C 2C2WA 1RHQA 2QN8A 2GAAA 2V59A 4N5MA 4IHXA 2YJTD 1VYTA 4GM0A 2XH8A 4LTMA 1HSJA 4PNHA 1XGOA 1STOA 3N4MA 3HEAA 5DYMA 1IIBA 3EODA 4KRYA 1N5LA 2JFNA 2P68A 4A10A 2WM2A 1KETA 2HDWA 2PANA 4XSZF 1PT7A 5GM1A 4G2NA 1LNWA 3NP9A 3R1IA 2WF7A 1QLHA 5DYNA 2WJ6A 3P2JA 2RHOA 2FPUA 5CYFA 2ZJ4A 1HT2E 3W9UA 3K0EA 2BY3A 1U65A 4FFLA 4FU0A 1WJBA 4MHOA 1VL8A 4HFMA 5SICE 1I94B 2I3GA 2ODBA 1TNSA 4BWFB 5JCOA 4C3UA 1UMCB 3X1WA 1QR2A 5IKMA 4OXQA 2A5YB 3HCAA 3NHYA 1GDHA 5L3FA 3QPCA 4NU5A 4I3HA 1UXKA 1ZHOA 1A27A 2YFHA 1FNMA 5DHTA 1Y1KE 2M30A 1SC7A 2L19A 4IHWA 4W1QA 4M98A 2CBZA 1K83J 5IJAA 4QTUB 1I6WA 3H2HA 3SHTA 1EK5A 3A05A 4AO7A 4PX9A 5LD2C 1O8BA 1PJAA 3LTEA 2ZFUA 2ZSHB 2XMDA 1GGKA 4YY3B 3D59A 2XWPA 4OHZA 2B4QA 4XVCA 1R74A 3OE7D 4G0WA 2WTXA 2Q9UA 4TSFA 3H6KA 4ZOAA 1JEOA 1FOKA 1YFZA 5EMHA 3S28A 1USUA 5JV5A 1DELA 4WCFA 1V3UA 4O4JA 3AHIA 1RRMA 2CUEA 2XBUA 3T1QA 4AP5A 2QN6A 1MSFC 4ZVOA 3B3FA 3K5IA 4HYQA 3CVOA 3CVUA 1N2CE 3D3QA 4RF4A 4WI1A 4E1VA 3G3ZA 1CJCA 3LDUA 5J63A 3M7IA 2Y6UA 3W1EA 2YHUA 4KDRA 1FY2A 2HHAA 2P6MA 2QR2A 5LLSA 1CDOA 1W4BA 3DR5A 5EGOA 4PX3A 3NBYC 1BIBA 4D81A 3INYA 1OLXA 3CKLA 5SV2A 1RI1A 3ENKA 2DQKA 1ZH6A 2IS4A 4MOWA 3RO7A 3ZCTA 1WZ2A 2JI9A 3T1BA 3HG9A 3DZDA 2PGXA 3FKQA 3GVCA 2R9VA 3AFIA 5LNK6 1I9CA 4ROSA 5KCMA 3WTXC 2Q0QA