2VT2A

Structure and functional properties of the bacillus subtilis transcriptional repressor rex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
199
structure length
184
Chain Sequence
ATAKRLPLYYRFLKNLHASGKQRVSSAELSDAVKVDSATIRRDFSYFGALGYNVDYLLSFFRKTLDQDDVILIGVGNLGTAFLHYTKISMAFDINESKIGTEVGGVPVYNLDDLEQHVKDESVAILTVPAVAAQSITDRLVALGIKGILNFTPARLNVPEHIRIHHIDLAVELQSLVYFLKHYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REDOX-SENSING TRANSCRIPTIONAL REPRESSOR REX
publication title Structure and functional properties of the Bacillus subtilis transcriptional repressor Rex.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
total genus 56
structure length 184
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02629 CoA_binding CoA binding domain
A PF06971 Put_DNA-bind_N Putative DNA-binding protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2vt2A01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2vt2A02
4A2UA 2P9GA 1T4DA 1D8KA 2QRJA 4HX4A 1CIVA 4EUEA 2ESNA 3LK7A 2OBYA 4A27A 4UAGA 4PGGA 1W4MA 1VI2A 1TI7A 2VN8A 3H9QA 3ZW9A 3AI2A 4K2EA 3P5SA 4IGFA 2X9NA 2RVCA 7MDHA 5HWSA 2E82A 4IDBA 5CDGA 4ASNA 5KVSA 2DKNA 2RHCA 2XKPA 2BFOA 4W82A 3VPXA 3WIDA 1I5ZA 3MJEA 5K5QA 2GGSA 3H4VA 3V8LA 3QSGA 1ZJZA 2WD8A 4LLLA 2EKQA 3H8VA 4CR6A 1R5HA 4PZEA 1XGOA 3IKTA 3FX3A 1X3UA 3H3UA 3ULQB 1EBUA 2GYYA 3GGOA 4ZZLA 1FPQA 2WYVA 2PGLA 1K2WA 2F1KA 2NADA 1JKFA 5A2QK 4W6ZA 4JLWA 3IJRA 2NTNA 1DDOA 4I9HA 1XDUA 4QFDA 2BGLA 5KJ6A 3DC2A 3DBLB 3KYBA 3WQRA 4X54A 4XQCA 2I66A 4JP2A 1HLDA 4MP6A 4HQMA 4BKPA 2GIVA 1D1SA 5CHEA 3JQDA 5L45A 5TRDA 4LVUA 5L53A 2UAGA 3GFGA 5CVUA 2YFHA 4PGFA 2YHUA 2RN7A 5L3BA 3QA9A 1FBSA 1LDKB 1LDDA 5FI3A 2Z99A 4E5PA 2X5OA 4ZH4F 5AOVA 3RI4A 3GGGA 4XDZA 3EK2A 3RD5A 1DP7P 1HXHA 5BNTA 4ILKA 3TNLA 4IXWA 3RYPA 3P7MA 4WXHA 4DGSA 3WE3A 2ZCVA 3AWDA 1MJ9A 2FMLA 3GZ6A 1ZAOA 4L73A 3T7EA 4IGEA 5E1WA 2CSOA 3ZCXA 4G7ZF 2A69F 5B4UA 1V4RA 3IRQA 2WWRA 4INAA 2UZKA 2IJLA 5TS3A 3K1MA 3BHMA 1FBQA 3GK3A 6PAXA 1DLIA 2Q8KA 4O5VA 1WWXA 2WDZA 2HK7A 4TKLA 1PZGA 1IUYA 1YB5A 2Q49A 3C18A 3LVFO 1W8DA 4Y6PA 2AXLA 1VPDA 3RFTA 1WDKA 4MVJD 2D5AA 5F5LA 4N7RA 1VC2A 1R1VA 3OMLA 5D5XB 4M87A 4E32A 4DXHA 5JYEA 1U5AA 3KZVA 3LSYA 3QVOA 3V2HA 5JC1A 3LT1A 4M54A 3U9LA 1RUOA 4RVSA 4BO7A 4FB5A 2HR3A 2A9FA 1LEHA 4OMUA 5TNXA 4AJPA 1PR9A 3B1FA 2AE1A 2O2SA 2CD9A 1VJ1A 4J9UE 5ER6A 5F21A 1F12A 3L4BA 4RQUA 5L4LA 2P8TA 3CIFA 4I01A 4IJUA 3F46A 4M74A 2EFWA 2CY0A 2DLLA 1O6ZA 2DQ4A 5ICEA 2NU8A 3ROUA 4GMFA 3V1UA 3P7NA 5D5VB 3GHYA 3ZWWA 2RIRA 1QORA 4UXNA 2BKAA 2ZK7A 3DTYA 3I71A 1HW2A 4PLYA 3U5TA 1H9GA 2XASA 8ADHA 4CQMD 2EA4A 1RM5A 4L9JA 3FR7A 1PJTA 1XYGA 1XELA 1P1IA 1YE3A 1C1XA 5LLQA 4NFSA 2EEZA 3OJEA 2IZZA 2M8EA 4CUZA 3QU6A 1ZMTA 4PLTA 1C0LA 3VZQA 4P5OA 1U8RA 1TT5B 2NNLD 2DTDA 2D45A 4NB5A 1BTOA 3QPHA 2HO5A 1LB2A 3A9WA 3K9QO 4D0PA 4K1LA 3WXBA 2I3GA 5JSFA 2X5KO 2MA3A 1NVMB 4II3A 4S04A 4E12A 1GV1A 5ICCA 1YYVA 1YL6A 4RLSA 4UUMA 5IXYA 5KVVA 3GF2A 3IP3A 1RPNA 5LHGA 2BFMA 3Q3CA 3Q9NA 4BNWA 4NBUA 3JQ9A 1F1ZA 2YX7A 3NRCA 4FSHA 4MP8A 3ZNOA 5A5FA 4WEOA 4QEDA 5DP2A 5TC4A 2G7HA 1E7YA 4LRTB 4E2YA 2OO5A 3KV3O 4RPLA 4Q47A 5BPIA 1ISFA 3QRWA 4XQEA 5IZCC 1MV8A 4L76A 4KWHA 4RF5A 2C7GA 4ZD6A 3S8MA 4ALMA 5CVVA 3LAJA 3GZNB 4G8XA 3J80K 1UP4A 1V3UA 2VBWA 1SB8A 3IMFA 4DBVO 3CE6A 1C1DB 5T5QA 1YVEI 3JQ8B 3INRA 4TZTA 3LT2A 2JRTA 2Y0DA 1DPGA 3ZHXA 4HQEA 2YX4A 4ZQGA 4B8WA 4E21A 4ID9A 1O8CA 1PJ3A 4EQQA 1QV6A 2O23A 1ZLKA 3EAGA 4IMPA 4RF3A 1LDEA 2Z5LA 3LQFA 4RLHA 5FLXZ 3A14A 5DT9A 4U0WA 1MXHA 4LGWA 2KJBA 3LAPA 2P5UA 3D4OA 3GFBA 2DAOA 4WLEA 3ZMZA 4G81A 4AIJA 1EH6A 4DA9A 3HRMA 4CLEA 3JQGA 4GVXA 3ZV4A 4CQMB 2ZB8A 1STZA 2VOEA 3U4IA 3IHUA 1HF3A 2GF2A 2RQPA 3E8XA 4PLFA 2HAEA 3ITDA 3RPUA 4RB3C 3F23A 2NVUB 3OJOA 1ZH5A 3ULKA 5A9SB 1V9LA 3L9WA 1B8UA 1I1SA 2TMDA 3RDIA 2NNYA 4UUOA 3DPTA 2PNFA 4YACA 5CDUA 1P1JA 1B9NA 1I8TA 4BOYA 4A0SA 3QAHA 1F5TA 4BO1A 1P0CA 2F5EA 2G7UA 4Y15A 3BMNA 3MOGA 4CL3A 4OMZA 4JQFA 3HG7A 5LHHA 4BQAA 3AM4A 2OOSA 2PMUA 1Z73A 4FQ8A 2NQTA 2L4AA 1T2FA 2EW8A 2NU7A 2WSBA 2OFPA 3INGA 3F6VA 3DTTA 1WZIA 3ONFA 2V6MA 2X1HA 4BGEA 1WNTA 2PMHA 1IYZA 2I5PO 4BNXA 2PH3A 3E6BA 4UVAA 4BHPA 1DFGA 1PGJA 2Y0EA 5IT3A 1C0IA 4R1TA 5L3CA 2NU9A 1KVTA 3EMKA 3WTWC 1JWBB 3RJ5A 2OBNA 3GW2A 2W57A 5KK1A 2Q99A 2V1XA 2E49A 3C1OA 4MKRA 4OIRF 2Y68A 3C7JA 5HRUA 1HKSA 3RU9A 1GTMA 3BDDA 1U5TC 2FMUA 4FJ2A 4J43A 4U6QA 1LEBA 2VONA 4EW6A 5A06A 2UUPA 2Z5UA 3C1AA 1NP3A 1NWCA 1QMGA 4D46A 4EGYA 4DVJA 4YDRA 3RASA 3HSEA 1J6UA 3PGXA 4QTZA 3ZWAA 3DPLC 3GXOA 3GYHX 2O3JA 1QRRA 4GSKA 5C7IO 1KBZA 3GVAA 1R1TA 2VWHA 5F3RA 3E5UA 1WVGA 2Q50A 3JQ7B 4J1QA 2JFHA 4NH4A 1J75A 1PQUA 3Q2KA 1P3DA 2QLZA 2XAGA 3LLSA 4NK4A 2DK8A 4Z6KA 3OFSA 4CMIA 2VRCD 3KYDA 2VWGA 3BMOA 2Y1FA 4CQLB 3EVTA 4B09A 3EZYA 3GR6A 3W6KB 1DHTA 3B70A 4AJNA 3QVXA 4JNKA 4Y98A 3MCZA 5BSFA 1DIHA 3NGXA 4G5HA 4WXDA 1LNQA 2FPPA 2OQGA 3P2YA 5T64A 1VTNC 2B5VA 2EFNA 4QFCA 4WUVA 2XGXA 3F72A 3ANLA 1V3TA 1L7EA 4WCFA 2KIFA 1EBFA 2CW0F 2RV8A 5COBA 2R00A 1ONPA 3PYLA 4JJIA 4M55A 4URFA 5DN9A 5D5WB 2FEZA 4L8VA 1LLQA 4G6DA 5FFZA 1WXDA 3L00A 4LLNA 5J8FA 3JD3A 1PEDA 4LFUA 2P4HX 3WWYA 3NJ4A 4L18B 1GFSA 2Y1OA 1CEQA 5DV5A 1N9GA 4WF2A 3F6YA 3ZN1A 1BI3A 1LQ1A 5F6FA 1EE9A 1YKFA 4FJ1A 2EJRA 4J1SA 3IRRA 2EV9A 5A2QZ 1SD7A 4FOOA 3OH8A 1W6UA 4MGRA 2P4WA 1LJ8A 1HDRA 3DBVO 3V2GA 3I59A 1SMTA 1ZHFA 2UXXA 3NDJA 3WTCA 5F5NA 1A7AA 1ZUD1 5TT1A 1K3TA 4TWRA 2YSRA 2CO5A 1O0SA 2JAHA 2P2SA 4J0FA 4J90A 5DUKA 2DPUA 4QLCU 2OQRA 1JAYA 4GPD1 4DLBA 2PWZA 4YJHB 3V8JA 2A61A 1VLLA 2AA3A 3DF8A 2F00A 3MJTA 3C3WA 1GZ6A 3JQEA 1LRJA 3T7CA 1PZHA 2IA0A 1QYXA 2WE8A 1WMAA 3F47A 1HTBA 1DRWA 5LDHA 1K89A 2B36A 2FOIA 4PLZA 3QWAA 1GEEA 5JHUA 1XGMA 4A0ZA 3NEUA 3PQJA 3JTGA 2C6YA 1RM0A 4FDAA 4C4OA 5AIPA 4EGZA 1PQWA 2V1DA 3HADA 1R4MA 2CDBA 3GG2A 4I0AA 1SAXA 3F8FA 3ECOA 4M1QA 4MKZA 5FFFA 5FGMA 4L0YB 1K0UA 1R0KA 1KVRA 4Z9YA 2BGKA 4B7CA 3V8KA 3AY7A 3CMMA 3JW4A 2VBYA 3RKRA 3D3WA 3PHHA 4KDFA 1PUEE 2PKQP 4NBWA 3K31A 3RBXA 3Q9UA 1IN5A 4BNHA 4KICA 1D8AA 2IVMA 3KXDA 1B0AA 2PH5A 2IRWA 1H93A 2VQ3A 5EERA 4BV8A 4F7ZA 2K4JA 5JDIC 4IDGA 1B1BA 2RC4A 1M75A 2W24A 1ZGJA 3CINA 3BJ6A 4BNGA 5IN4A 3HDJA 3K1NA 5BSHA 1JHHA 1A5ZA 2J5KA 4MHGA 3WMXA 4L9NA 2B37A 2EP5A 2G5CA 3L6OO 2MBFA 1ENYA 2V79A 4WECA 1EZ4A 4OXNA 3R3SA 4PRKA 2PN6A 4CICA 3KOUA 4GX5A 4P4GA 4OKNA 3I6QA 3MZ0A 1BXGA 1VJTA 2ACJA 4UUPA 3VZRA 3X2FA 2NWQA 2PV7A 4UVCA 3RIHA 4CUJA 2IPQX 3TOAA 1P6RA 5LEKA 2C59A 4ALIA 1SMYF 4ZICA 1R7JA 1C14A 2YDYA 5AXAA 3UAGA 3VHRA 1HSJA 3M8EA 1E7RA 1R15A 1ZVMA 3GAZA 1E6EA 3NUGA 3WGQA 1QBJA 2A3SA 2VE8A 2DFVA 4G65A 4TVBA 2PY6A 1LXCA 1U7TA 2LNBA 2Q2VA 1DC5A 1PS9A 2QRKA 3ANNA 4FIZA 4XRFA 5BOXA 2HS5A 4YFNF 3GMSA 3GEGA 1MG0A 4IF4A 3GRPA 4I98B 1DBVO 2AE2A 2FRDA 1LSSA 2X6TA 1Z9CA 1BHSA 3ZV6A 1IF1A 3GRKA 1V3VA 4OIPF 2Y0CA 3OA0A 3JD2A 3GY0A 4A12A 4K6CA 2VUSA 4EJ0A 2VZ8A 3F9IA 4FFMA 3ZHBA 5CDSA 5DCMA 4HNGA 3TOXA 3JQCA 5ITWA 2Y1DA 1GEGA 1B9MA 2NVWA 3BIOA 1WLYA 3UICA 2FSVA 2X0RA 4WKGA 2P9EA 3WTSC 4CV0A 2Q1TA 2ZB3A 2XIGA 4FX0A 1VKOA 4XCVA 1B16A 4EUHA 2Q4EA 1MFPA 1FSEA 2OGUA 5AXDA 4EM2A 2C5EA 3LF2A 4C7KA 2X7HA 3PJFA 4L0QA 3IQDB 1JHFA 2NRAC 3QLJA 2PQ8A 5G4KA 3UHAA 3E48A 4QX6A 4UV9A 5H83A 3IWZA 1H6DA 4M8SA 3KCCA 4Q39A 3L0DA 1HZZA 1LI4A 1ZCJA 4UHTA 2K86A 3H92A 5L3DA 2ZTLA 3GVHA 4XB2A 5ILOA 4RO0A 3H7AA 2JZYA 3J80Z 4O6VA 4M72A 1LTHR 5CVIA 4MOWA 2AEFA 3C1DA 1NAIA 3WU1B 2VTDA 4R9RA 3VZPA 2BEOA 3RPQA 3ZMSA 2DFIA 5HA5A 5A5EA 5JAZA 1RM3A 3LA7A 4J7UA 2RHRA 4JJFA 4IM7A 3M1EA 3PFWO 2NAZA 4CO8A 3AUSA 1V35A 3DMYA 1I3NA 4L4XA 4PG5A 2BYVE 4RVDA 4N54A 5EJ2A 2FBKA 4RGRA 2DBZA 4FR5A 3FWEA 2C7VA 4IDDA 2DBRA 2GWRA 3OIGA 3BZ6A 2A92A 4YJFA 5BT9A 3ZV3A 3DBHB 4J2OA 4HKTA 3RKUA 3EHEA 5F1KA 1DXYA 1PZEA 4RB1A 5KJ1A 2XAFA 1IY8A 5GMOA 2DBBA 4O59O 1DFIA 4GWGA 5AIQA 4HP8A 3MTGA 3VZSA 1OFGA 2X9VA 1TTYA 4B79A 4AJ2A 4KFCA 4AJ1A 2E4AA 4A5NA 4BO0A 4JX8A 5EEGA 1OOEA 3S2EA 1YOVB 1CGPA 1RZ4A 2NM0A 4BNTA 4AJLA 1O3TA 4DWVA 4HF1A 3S2FA 4P22A 3ZQ7A 1RWBA 1TXGA 1Z75A 4Q9NA 3TL3A 4ZGWA 1P1KA 1KETA 1T2EA 5AYVA 5HVQC 4LRSB 3PZBA 2NU6A 2YW9A 2FWMX 2R7FA 4XGKA 4ZYEA 5TGDA 1Z6ZA 4CV2A 1TLTA 2CVQA 1ENPA 3I23A 4GYIA 2VXZA 2ZTMA 3DXFA 3GZ5A 3PEFA 4MNUA 4OINF 2ADUA 3JSOA 2PZLA 3SEFA 2P91A 3IWFA 1ZW1A 1YQGA 4PCVA 1V3FA 1B15A 5EL0A 3ASVA 3SXYA 3RYRA 4ON0A 3CUOA 1GQYA 4QT0A 4CM3A 1ZK0A 2RH4A 3PWSA 2WC2A 1G1AA 2MLKA 1JW9B 3QOPA 2OBPA 1YW9A 3ONEA 2PJPA 4L9RA 3WS7A 2XVCA 3N7UA 2Z3YA 1UFMA 2IW5A 4QUKA 4R1SA 3DB2A 3BTSA 3HHGA 3NT4A 4OH1A 3GN1A 4HX5A 1LLCA 1YW8A 1QV7A 1ADCA 4BNJA 3K2BA 4AICA 4P38A 2GA1A 4M9XA 4PFJA 2V6GA 2HTJA 2ZO4A 3F5QA 3D5LA 2VOOA 1T2AA 3HDQA 1Y1PA 5K9ZA 3GX4X 5ITVA 4K9DA 4NJOA 3PWZA 4CMGA 4XYMA 3FF4A 2Z9OA 1IXRC 1XLTA 1KGSA 3PHGA 5DD4A 1IN8A 2C82A 2PEXA 2B4TO 4GCVA 1KEWA 4E5MA 3RFVA 4DPLA 5H6QA 1CF7A 4OJNA 1GCOA 1HE2A 3V2UA 3I9MA 4DQUA 1EUZA 1QZZA 1O7LA 4Y13A 4TZKA 5HDNA 5JY6A 2X9GA 5L3EA 4N5LA 3QJ5A 1E5LA 2WYUA 3I9JA 3ZN2A 3CZMA 5JI6A 3EYWA 3U4DA 4AJKA 1H2BA 2DBQA 2GN6A 3HTUA 1FYMA 1B2LA 3A06A 4BNCA 2A6EF 2K7LA 1MGTA 4HAMA 3LC1O 4UVIA 2V9VA 2Q2EA 4PLPA 3WWZA 1IAWA 2P4QA 4XYGA 1FT9A 5HTOA 4PG8A 4OM8A 4QSMA 4O63O 4A26A 1M2WA 4MIOA 3GGPA 5BR7A 4II2A 4PLVA 2O48X 4J2HA 4XYLA 4EEXA 3ABUA 1G6NA 1UHMA 4RB0A 4DLLA 1WAMA 3U0BA 2CFCA 4EJMA 5ICGA 1HE4A 5K6AC 1D7OA 3ETEA 4Z9FA 4A5OA 4WCDA 1PR3A 1TQIA 2AHRA 1XN7A 3K92A 3TZQA 3JSPA 2GLXA 4ENJA 4AJEA 1WDMA 3ZMUA 2VZ9A 3P9CA 4FT8A 1H6BA 4LMYA 2Y93A 3KSUA 4AWXB 5DDIP 4BNVA 4BNLA 1TW3A 2H09A 4BNIA 1IRFA 4WLFA 4EV0A 3K2ZA 4NU6A 2HQNA 3TJRA 1JGSA 3TRIA 1R1UA 4GKVA 5LGUA 3U49A 5JPIA 4BO9A 3Q1LA 2WTEA 1VRWA 3FF5A 3PYXA 3WE2A 4XBFA 4XEHA 4ALJA 3JV7A 5KNLA 4BMVA 4JXKA 4D7AA 4Z9XA 4A6EA 1RIOH 2V65A 3KB6A 2D1VA 4NZ9A 5LRSA 1F0YA 1C1XB 4CHUA 1Y8RB 1ZEMA 2EW2A 5KCZA 2FPGA 2PD6A 1YQAA 2W2KA 1IOLA 4J7XA 2DTRA 3HHHA 1I3MA 4B3IA 3JYNA 2P5VA 1QYDA 5DDGA 2MD5A 2C5AA 2DTEA 2HMUA 2QZ9A 2X4GA 5L9AA 4XGIA 4CXFA 4KUMA 1IHYA 1YONA 5HLIA 3C3XA 2DC1A 3ZDFA 4CMKA 4E13A 1Z7UA 4YAJA 1W0CA 5B4TA 4FFPA 3OM9A 3VOEA 3G0OA 4GQAA 3GUCA 4BQPA 3RAJA 5E20A 2QX7A 4XLPF 1HT0A 2RKHA 1E3WA 2W2LA 1BW9B 3ADOA 2Q46A 3AW9A 4EJOA 2AXQA 1Y5RA 3H3JA 3OQ6A 4XLNF 1ISGA 4IDAA 1XWFA 2AG5A 1LLDA 2UV8A 3H9GA 1LU9A 1USSA 2JKVA 3ISPA 1C0PA 1EVZA 3ZNPA 3BAZA 3NV9A 3WJ7A 1ADFA 2PFGA 5EPOA 2Z95A 2O4CA 4DLAA 1X1EA 5COQA 2J6IA 2YYYA 1N92A 1RJWA 1UZLA 1I33A 4J1TA 1UDBA 3TDZC 4WX9A 1EUDA 2P7VB 1Q7GA 1F06A 3WYEA 2YV2A 3GFMA 1GAEO 4B4WA 2VN2A 3I58A 1EVJA 4JJGA 4XR4A 3OJFA 2LF7A 2QWWA 5CFZA 2VBXA 3R0IA 3D0SA 3TOZA 4CM7A 4U6SA 5CDYA 3IDSA 3JQFC 4FOSA 3B02A 3GDOA 1J4AA 3OHSX 3DR3A 4AIHA 2GRAA 4FGWA 3WGGA 1SD6A 3NYWA 2VYVD 4Z0PA 3JQGB 3GN2A 4P8RA 3MCVA 2DW4A 4ND4A 1YWGO 2EJVA 2HJRA 2HMVA 1GCUA 3SQNA 1NYTA 1UP7A 2IEBA 3G79A 1PS0A 3ZWYA 5A03A 4LK1F 2NLOA 3VB2A 3GVXA 3PQFA 5ER9A 3ZWOA 4NI5A 1ADBA 2CDAA 3KM0A 1HRDA 3GDGA 1T98A 5IT9Z 3I83A 4O6JA 5KVRA 1SC6A 4IZHA 1DPUA 5BSGA 4BMSA 2PBIA 4EJWA 1JN0A 1H0KA 2DT5A 2ET6A 1GV0A 2H9IA 4MKXA 5IZCA 1W7PA 1ZJYA 2JCXA 4XR9A 4XWYA 5AVOA 3ZU4A 1E3JA 2YU3A 1CYDA 2C29D 5H82A 4LMPA 2QQ9A 3DHYA 4CODB 5TSDA 4Y6SA 1R22A 4HDVA 3BMNB 4UEOA 3MEXA 2DU9A 1NHGA 1Q0QA 2YQ5A 3WDSA 5KJFA 1R5GA 5A05A 4RGBA 3HRTA 4RPGA 1LBEA 3DZGA 4I5EA 3VTZA 4BS9A 3TFOA 1R0SA 3R0JA 4JROA 1Y9EA 2Q45A 3M1LA 5IFLA 2EGHA 1Z91A 3FXRA 3MJ4A 1MLDA 5JNLA 2JCYA 3W8FA 4RGUA 3MTJA 1YDWA 4JBIA 4U8GA 4AFNA 3T5XA 1SNYA 2CG4A 2QBYA 1G0NA 2HK8A 4KNYA 4YBZA 4GL4A 1N7HA 5F1PA 5HOOA 1HKQA 2E7XA 2L02A 5FFXA 3GC6A 5I8ZA 5FD6A 1FSHA 4CMEA 2EF1A 3HRUA 1GZ3A 4PLHA 2YFQA 5DCUA 1ZSYA 2CYYA 2JAPA 3QQPA 4IQGA 4UUNA 3E6DA 3PLRA 3E6CC 3F3SA 1ON1A 4IPAA 4L9TA 4A73A 4FN4A 4Y6RA 2LF8A 2V6CA 4RJTA 1TT7A 4GKBA 3O3KA 3UCFA 3AU9A 1IRGA 1IPEA 3RSHA 1ISIA 4WJZA 4EEZA 3PYMA 4EZBA 1D5VA 1JVSA 1W73A 1Y81A 2VNSA 5G0VA 1YBMA 3JQ6A 2HMTA 1NHAA 2K4BA 3PQDA 3MFKA 1ARZA 2PR2A 3GHHA 3J81K 3S2IA 5JYDA 1QLJA 4MQVA 1LC3A 4KIFA 3FTPA 3IAHA 1GD1O 3LU1A 3F5SA 4O0LA 3Q9VA 3KZYA 1PL8A 4CMIB 5CDTA 3KYDB 3DL2A 5JO9A 1P4WA 1K79A 3BMOB 2CUKA 4OQYA 2NACA 4IMRA 3TO7A 4BB5A 4D3SA 5CEJA 3JTHA 3W8DA 1ZNQO 5ILSA 3HUGA 2PLYA 1IPFA 2JJYA 2W8ZA 3QVTA 4KUHA 3ADPA 3LSTA 4ESFA 5DCFA 2GR9A 3ABTA 1Q1HA 1DUXC 4N5NA 3RVDA 4YPOA 2EWNA 5K1YA 3BMQB 2TMGA 1SFUA 2FZEA 4NQZA 2HZTA 2Q1SA 3VPFA 1X7GA 3WQQA 5ICMA 1QZYA 2ZYGA 5I9MA 4ALKA 2F5CA 3GQVA 5LBQA 5DD8A 3FM5A 4RCVA 3RUCA 3ZHYA 2O61A 4D42A 2B83A 4XQGA 5JBIA 1DC4A 3CDHA 4MTDA 3VFZA 3BWGA 2Y1CA 1N9GB 1X0XA 4PVCA 4PLCA 1H6CA 1R4NA 4ZQHA 2VWQA 1LVAA 1SFEA 2C07A 3DAPA 4BV9A 3KP2A 2Q3EA 1Q0LA 4HV6A 5H81A 4B4UA 4NHEA 4PG6A 4KT5C 2HKXA 3I59B 4D44A 3U3XA 3E5QA 1PL7A 3H3FA 3ITKA 1WSUA 3RUEA 2P6TA 1XR3A 4A0YA 1UXGA 3PLNA 4PCQA 1CDOA 3RTRA 1A04A 3HN7A 4XJTA 2FA5A 5HBRA 5JO0A 3DZFA 2HYFA 1BI2A 1IXCA 1H0MA 5JCXA 1TNSA 1DAOA 4BKUA 4MVJI 5FO5A 4EMSA 1KEUA 4BNYA 2BHLA 3PZRA 5BMZA 3SHFA 2JHGA 4AJIA 1KYZA 4E5KA 4OOIA 1TEHA 3Q11A 4NG5A 5JCJA 2E1NA 1X13A 2WMDA 3L2CA 4U5QA 4E5NA 2WWYA 1R4MB 3GOHA 1DOHA 2A07F 3OJ0A 3IP1A 1XU9A 2HDHA 4Q3CA 4U88A 2NYXA 3DZKA 2GPTA 4KQWA 2HEOA 1XGNA 1K7AA 2AQKA 4H15A 4BXUA 5TJ9A 4BVAA 1O94A 3WLFA 4HLYA 2XKOA 2P5KA 3KUXA 2FNPA 4EDFA 1L3LA 1KU9A 5C5IA 3D3WB 5FEUA 2M45A 1FOKA 2JL1A 4DC1A 1P4AA 2H6EA 3HFGA 4B4VA 1TVEA 5DP1A 1ZRCA 4RPHA 2CWEA 1J49A 3WODF 2KIUA 3TDKA 2J8ZA 3U9GA 1B8VA 2ZFWA 4PDKA 1B7GO 1Q7CA 4M49A 4WEQA 3V7CA 3NEPX 3HQ4O 4IS2A 1HETA 4LG0A 1OC4A 1LX6A 3K0LA 2FZWA 2ZQYA 2ZJ0A 3MEQA 4P96A 1KU7A 2HSDA 2QYOA 2HUNA 3RKXA 2DI3A 2ZNYA 4ZZDA 1LRLA 1YH3A 2VUUA 1JQBA 4BKOA 3BPXA 1WWKA 1PP7U 3FZVA 4YA6A 2RAFA 4NDNE 4JBHA 1ZBQA 3F4BA 2JD1A 3JD1A 1GL3A 1BXGB 1Z82A 3PI7A 3QRFF 1QO0D 5JVTA 3JCZA 4HYEA 4RB2C 2BF7A 2PG4A 4BO5A 5E8GA 1YTYA 3WQSB 1DIRA 3M2PA 1JAXA 1KY5A 3ZW8A 4IQ8A 1OYWA 2YZ7A 1HQCA 5EN4A 1I27A 1IW7F 3WTTC 4XJSA 1L7DA 3O9ZA 5IG2A 4NR0A 1XMKA 2L54A 2AQHA 1S6LA 1SB9A 4BO6A 4EI2A 3ML6A 3DBRA 3OP4A 3GO5A 5HDGA 1QNTA 2DVMA 3SJUA 4Y67A 2E6UX 4QQRA 2HTSA 1XSEA 1YQDA 4R68A 1YS7A 4NQWA 5JMWA 3FHZA 4YIFA 4PVDA 5TIIA 5DCMB 2Q1WA 4D0SA 4U7WA 2IEDA 4L0ZB 3GVIA 2X86A 3GLXA 4UVDA 4XZ3A 5E18F 3LF1A 4E33A 3EQLF 3IS3A 3JAMK 3JYPA 2O3SA 4XA8A 4TROA 3I1JA 4R01A 1J5YA 3LC2O 3F8BA 1DC6A 4PLGA 4E30A 3KYCB 3NT5A 1R16A 1GY8A 4XIYA 4YAGA 1XG5A 5G0UA 3ZWCA 5F64A 4IPTA 4UNOA 1T1SA 4KIBA 2O3RA 4KN7X 3WGTA 3HHPA 2X22A 4R51A 3F8MA 3HRSA 4I1IA 3QU3A 9LDTA 5G4KB 3COAC 4DIOA 2PI0A 5HS8A 2OP1A 1UXKA 3QWFA 4H3VA 3WTXC 1U28A 4I09A 4LCJA 2M1BA 1Q0HA 2GZ1A 5JLAA 2V6FA 4Z0TA 1CQJA 1GVJA 4IUYA 3B6ZA 4CLOA 5IZ4A 4XRRA 4E0BA 4F6LA 1OYIA 1EH7A 3E5XA 1Y9AA 4KDPA 2X0IA 3OQ1A 4GGGA 3RU7A 4CV1A 1ZIDA 3GT0A 4HZFA 1BG6A 3FBGA 4Y9DA 4RGXA 1MX3A 4GWKA 3Q9SA 2PD4A 4NK5A 4CV3A 1UAYA 5EQFA 1NX6A 1UR5A 4HX7A 1F9NA 4JK1X 2E37A 2ESHA 1T2DA 1VL0A 2GUGA 2O3UA 3TZCA 3VH4A 4HV4A 4XB1A 5L7YA 3L4BC 2YUTA 1ZMOA 4WK6A 2FBHA 3DDNA 2VZ0A 4BMNA 4ENNA 2P7CB 2D1YA 4XYEA 4HFNA 4YJFB 1PGPA 4EM1A 1MA0A 4HF2A 2B0LA 3NQOA 3ONDA 4LLGF 5DNAA 2X23A 5IF3A 3KRTA 3K96A 4PN3A 3BTOA 1S7AA 4M9ZA 4XKJA 3V8BA 4FBGA 5D4RA 4D3FA 3BHIA 1JKJA 2FSWA 1UHWA 1VL8A 2KKOA 3AOEA 5D8LB 1M67A 4FHTA 4HW0A 4Q3BA 4ZQBA 1I0ZA 1GQQA 3NJ8A 4HUJA 1ZSVA 2XAAA 2VOPA 4DQVA 4F6CA 4IJWA 1K6JA 1NFRA 3CPSA 3NDRA 3RUIA 3VVBA 1HSTA 3IUPA 4W9NA 4XRGA 1S7CA 3K2EA 3ZWVA 3WSWA 2O3TA 1KVUA 3VKUA 4MP3A 4DYVA 3MQ0A 5U9CA 5D6FA 4IBOA 3BTVA 1CETA 4MEYF 1NVGA 4GX2A 2QQAA 3HDYA 4AIKA 3JQ9C 5L7WA 3H2ZA 3K69A 3UCEA 4DMMA 3T1BA 3AM5A 3HN2A 3E9NA 2DUUA 2EFPA 4NBRA 1R12A 2EKLA 2JCVA 3GFIA 2VTEA 3RUFA 3K73O 3K5PA 2NTJA 3ZPLA 3ZGYA 5LGNA 1HDCA 2CVZA 4N5MA 5BPDA 3DONA 2FF4A 1HEUA 2Q0OA 4FGSA 1QGPA 2LDXA 4DPMA 3W4JA 1OMIA 3JQBA 3SLKA 1BJAA 5LRRA 4A2CA 5L4NA 5I7EA 3ZMVA 3F3XA 4BGIA 4OAQA 1PJ4A 3GLQA 1Z45A 2H27A 3P19A 3CO6C 1NQ5A 4HY3A 5COAA 3JD0A 4CZZA 3RUAA 3ETGA 3BMCA 3JQAA 3L9FA 3PGJA 4J4HA 4J6FA 4AG3A 1JTVA 3EY4A 4Z3DA 1S7OA 4BIIA 5L95A 1E1NA 5L3FA 5L3GA 2OA4A 1XKQA 4CM6A 2IP2A 1RI7A 4E5YA 1FBUA 4GX1A 4J1NA 3CKYA 3QPTA 3SC4A 5MDHA 1QPMA 3MWDB 1WKMA 4DUPA 1BI0A 1U3TA 2I3AA 4IDFA 3K30A 1NQTA 2GSDA 3LFKA 4MVJA 5I7FA 4CM9D 1P4XA 2EV6A 4KZPA 1CF7B 3D3EA 3I6IA 3IIEA 4IRHA 1KC1A 2WE7A 2DLDA 2ILTA 1E3IA 2ZYDA 1GPJA 2HLPA 3F21A 3RI3A 5I9LA 4HADA 3ABIA 2FR8A 4ND5A 4CR7A 2ZCUA 2G76A 1NM5A 1NVTA 2GDZA 4CM4A 3L7WA 5CJ9A 1ADGA 1HWYA 3IC5A 4RZIA 1ZG1A 1GXPA 2UXNA 1DIBA 2W90A 3ORFA 2MH9A 1LSUA 1C1DA 1SEPA 3KLMX 4HFJA 4BHTA 3F8CA 3MWMA 4G7OF 1HLPA 1R58A 3I9KA 3T4EA 1EH8A 1EFLA 4DC0A 5CPBA 1EDZA 3UF0A 3M8FA 4ESJA 1XDWA 2P5YA 5LCXA 2HRZA 3WYCA 1DEHA 4M89A 3WNQA 4R3NA 5JC8A 1HDGO 1XD7A 3I0TA 2E1CA 4UUVA 3GEMA 1HYGA 5ICSA 3PFFA 3F4LA 1AHHA 4KDEA 3HWRA 1Z1DA 1A72A 2OMEA 1DDNA 3SVTA 1G0OA 2Y1EA 1A71A 3KEQA 1LLUA 5G0SA 3J7AO 1GUFA 2I67A 2PZMA 3FN4A 4Q3DA 4LK0F 4QO7A 1Z05A 5IDXA 2XRNA 3QWHA 4OIMA 5BNIA 4A0XA 1NTOA 1ISMA 4DBZA 3UUWA 2EJWA 4B4OA 3BP8A 4A5MA 3OQBA 4I5DA 3F1KA 4DTIA 1H9AA 4BGVA 3QWIA 2OZ6A 5ED4A 2IDZA 1RYEA 3AY6A 4ZRMA 4BL5A 4KIGA 3UN1A 3WGHA 3L09A 1E6WA 2GN9A 1KS9A 5L40A 4J9VA 3TZ6A 1XGSA 1RUNA 2LDBA 3R0AA 5G0TA 4A7PA 3GUYA 1DPRA 4M71A 1BDMA 4IVNA 2MH2A 3TQHA 3JTMA 5A4DA 4ND2A 1QQIA 1IE3A 1O57A 3WU0A 2W2KB 4L4SA 3AUUA 4EJVA 1QYVA 4LSWA 4RZHA 3VPGA 1GYRA 2FR1A 3STHA 1HDZA 3MJCA 4HV5A 3JYQA 4BNKA 5KTKA 4TQGA 3QY9A 1Y0UA 3UXYA 4YJGA 3E3VA 1AXEA 1D4FA 3RCBA 4R79A 3NDIA 5EIOA 1OYYA 4AJHA 2ZIZA 1QSGA 1B59A 1SMKA 3F22A 1PWZA 5T67A 2YQ4A 4ZQFA 3DOOA 4XSXF 1X15A 4NFHA 1G6KA 1XCBA 3R4KA 2GN8A 3LWFA 1U7HA 3FWNA 4I9NA 4PRLA 4WCFC 3QIVA 1E3WB 3IJPA 2BD0A 2R00C 1E5QA 5ILGA 2DPGA 3S1LA 3MZHA 1HSZA 4J49A 3DKWA 1DIAA 2EHDA 3ZI0A 4HX8A 1G3TA 1J59A 5JAMA 4RGSA 3M6IA 3IUSA 5CEEA 1JE8A 3C8MA 3KSDO 5BQTA 3CUQB 4YG2F 2JPCA 1PP8F 3D5QA 4FW8A 4RVGA 4WLOA 1F17A 3UKOA 3KP4A 1NHWA 4MO2A 4YRBA 1G4DA 1L0OC 4Q5SF 4ONEA 1GUYA 1CERA 4GI2A 2DPDA 2NSDA 3OV8A 2VHZA 4F3YA 1DO8A 3DMTA 3WTBA 2B35A 4HBLA 3AM3A 5E1XA 5JDCA 3T0YA 3PJDA 4JIGA 1HYHA 3KVOA 4E31A 2BI7A 3EETA 3KP3A 5E8IA 5FI5A 3G1UA 3KTDA 5HS6A 3W6JB 4AJOA 4BO8A 1R6DA 4TKMA 2QM3A 2Y75A 3I52A 1K6OA 1ZLJA 2Y05A 3WSVA 2EFQA 1P1HA 2GA2A 3K6JA 3I54A 3IL2A 4DQ2A 2VT2A 2CF5A 5TX7A 2Y66A 3ZU3A 1Z74A 4MJLA 1O3RA 5DBFA 3PRJA 1NPTO 4U7DA 4JCOA 4LVCA 1VE9A 2YJZA 4E3ZA 1I2CA 1WQ2A 4JBGA 3OEWA 2J3JA 1YBVA 1S29A 3JAMZ 4G6QA 3MJSA 4GSLA 3RROA 1W7PB 3AUTA 5FWNA 3F1LA 4WPGA 5AONA 3I4FA 3OECA 3SZTA 7ADHA 1N8KA 3ROMA 3GPDG 4OHUA 3ASUA 4UULA 5LC1A 4PLWA 4KQXA 1ZG5A 4LD5A 1E2XA 3WG9A 4AD9A 2R2GA 2Z1NA 1YIOA 3KP7A 3O4RA 4GH5A 4GVLA 4U0KA 4BKQA 2STTA 1JKIA 3REOA 3P9KA 1UCRA 5KWEA 1E92A 2R6JA 2ZMEA 1P9LA 3B1JA 3JYOA 1FLIA 3W8EA 2GZ3A 2I76A 2J3HA 1ISJA 3ENNA 4RORA 3K9TA 3I5MA 3PDJA 2IYPA 1BN5A 3E5RA 2QBYB 4EBFA 4BYYA 4K28A 4LCEA 4I9UA 3ZWNA 1GZ4A 2IRFG 4G9YA 3KBOA 1U8XX 3U4CA 1IN4A 3E18A 1XQ1A 1ZK3A 1BM9A 3GVCA 3AUAA 4ND3A 4BO3A 5E17F 3DZIA 2PLAA 4Q3AA 1U2GA 3OA2A 2BGCA 4XQ9A 3ZV5A 4OOFA 2VRCA 2BFAA 5JAIA 1VL6A 2NUAA 1IN7A 3EUHA 1SO8A 1TQMA 4LW8A 1H9BA 3L6DA 4H16A 3P9IA 4WLVA 4ZU3A 3FCOA 1IN6A 3VEPA 3Q2IA 2HYGD 3GWZA 4I0BA 2PFBA 1YFHA 4A6DA 5LEJA 3MJVA 3FMSA 3ROPA 2PD3A 3QHAA 4BNFA 3HOTA 1V6AA 4JQCA 2VODA 4KA4A 4XX0A 4BAYA 2QG4A 5IAAA 2YPRA 2VHVA 1WPQA 2OZPA 4H0EA 3BA1A 4ZVVA 2VWPA 1ZREA 1E1MA 5BNFA 3C7DB 1GPDG 2BGMA 2WYWA 3VDQA 3MAJA 1BGVA 1EEHA 3ICCA 2QZZA 2O03A 4IHSA 4ND1A 2FMYA 3HTSB 2QZ8A 1T26A 1UXJA 1ML3A 3I9OA 2Z33A 2JD2A 5FYDA 4EYEA 3TDUC 1YO5C 1PJQA 2OD5A 5DULA 2K02A 1FDTA 2OL4A 2YHIA 4RVHA 5F1RA 2AQ8A 1YXMA 2P5LC 3HSFA 1QR6A 2BI8A 1OAAA 2GD1O 2W84A 1YL7A 1A27A 3AI3A 1EVYA 3HUDA 4LB6B 1FP1D 2VYNA 2BE5F 1BXZA 2O7QA 1I2BA 4YAIA 3RJPA 4GAEA 4KTTE 4UVHA 3BZUA 4ZJUA 3R6DA 4IIUA 3DV8A 1AE1A 1ZK2A 4G94A 2EB7A 1YG2A 1FY7A 3OEYA 5G4LA 4ZYHA 1XCVA 4Z2YA 1R4NB 3DAGA 4R4JA 2DO7A 3DFGA 1P77A 1ZN2A 4OYRA 4YT8A 2PKQO 3ENKA 1HYEA 5KJCA 3I9NA 4NFYA 3F6OA 3M7GA 1C0KA 4AVPA 1F8GA 4KOAA 1PJSA 3AJRA 4IQ0A 4JGBA 1DHRA 4RVFA 4O1MA 1YL5A 4U7BA 1ZZEA 4KMFA 4YIIA 1I10A 3O8QA 3SBOA 4CM1A 2HDCA 2VT3A 3BJAA 1EQ2A 3ETDA 1NBOA 4J16A 1LC0A 1U3UA 3TSCA 1FDWA 5I8WA 4R8HA 4B3HA 4CUKA 2ZKZA 4Q48A 2MC3A 3BXXA 5JAQA 2HU2A 2Q1UA 3D7LA 4YB8A 1WDLA 1ONOA 1KIFA 5CP8A 1HE5A 2WM3A 3PHJA 4DL9A 3CJNA 4M73A 4CL8A 2ZTVA 3G17A 2LDUA 3R61A 4ZRNA 4YAEA 2BBYA 1O3SA 1FYKA 2Q2WA 1YJQA 3QV1A 4FPXA 3GFLA 2UVDA 3HDHA 4GGOA 4TRMA 4MVJP 5G0WA 3Q6IA 4DREA 5ERIA 5IN5A 1MDMA 1YW7A 4CJXA 3D0OA 4R5HA 2ZB7A 1NQOA 1XU7A 2ZCWA 4N9IA 4JBAA 3H3ZA 2XF8A 3D4PA 3KP6A 5JY1A 2Y0MA 4D3DA 1KEVA 2Q4BA 4NJMA 4RDIA 3QE3A 4BB6A 3ZU5A 3UH1A 1EQUA 3OIFA 3FMRA 4J3FA 4YRDA 1FDSA 3H9JA 4CMCA 2X4HA 2P9CA 3W4IA 2HGCA 2B0JA 4J0EA 5TRTA 1ZSNA 5DUIA 3RWBA 1KOLA 1YS4A 2CF6A 1TB4A 4LG0B 1Z6RA 1DAPA 5FD5A 2DFDA 4I08A 3UFXA 4ENKA 1D3YA 3PJGA 2KJCA 2X0NA 2O6GE 2POQX 3CEAA 1HKUA 1BIAA 2OU2A 5THKA 4M6XA 1KC3A 1E1KA 5TJHA 3BROA 4O3MA 2FHSA 2V1UA 3I64A 3LA2A 3ELKA 1YBAA 3TPCA 2G0TA 3ZWBA 4KN4X 1YO6A 1OPCA 3WBFA 4AL4A 1P31A 2NQ8A 3H6KA 4CM8B 3MOIA 4MVJF 5HS4A 2JTVA 4RPJA 5IXSA 3TOBA 3HNPA 1E0DA 1UAGA 3W6UA 5B12A 4GX0A 1XHLA 1X1TA 4YQYA 4UVBA 3EW7A 3QP5A 3OIDA 1N1EA 3PQEA 2DAPA 4NHJA 3DBRB 4W99A 3PWKA 3G73A 1TW2A 1UDAA 5ES3A 5L7TA 4KMUX 1LRKA 4BUCA 5JR3A 1IL0A 4Q3EA 3G49A 1QXSA 1I3KA 3GEDA 3NAQA 5HM8A 1N1GA 1XQ6A 3L77A 2C0CA 5KKAA 2BFPA 1ZGAA 2ISYA 3A1NA 3LT0A 5GZ6A 1A9YA 2IXBA 3HYIA 1GHCA 1XSVA 1I3LA 3ZWXA 3C24A 2EA2A 3ZN0A 1HE3A 2A35A 3OSUA 1CQIA 1GDHA 3UW3A 4UV8A 3QWBA 5TQVA 1ENZA 1J0XO 1Y6JA 3ZZNA 1OKRA 4CDGA 1AXGA 3CTAA 1BXKA 1U5CA 4GLOA 4K6FA 4RPKA 4YYZA 2YV3A 5HS9A 1PL6A 1KQ8A 5DOZA 4EJ6A 2DTXA 4FFNA 4OMYA 2IE0A 5K5RA 4L9VA 1BC7C 3CMCO 4DIFA 3R60A 1JVBA 1KERA 2A5YB 1K78A 1PIWA 3R6SA 2H1SA 1T0FA 2HQ1A 3CZRA 5T8KC 3D5TA 3TO9A 3FNGA 3VH3A 4CLOB 4P9FA 3D64A 1UXHA 4DMLA 1LUAA 3WGIA 3GDFA 1E7MA 3L4SO 2YR2A 2W25A 1DC3A 1VSUA 1F4KA 2D8AA 3A28A 2GAUA 3BOQA 3KSZO 1ZXBA 1N5DA 2FY8A 2COMA 1E3EA 2GCGA 2FPIA 1Q2XA 1QG6A 4PIVA 4YR9A 3KETA 1I6XA 3PIIA 4TRRA 4YEDA 2OHXA 3PJEA 2V7PA 1TBXA 3DZHA 3JQAD 1QLHA 4CLDA 5CLSA 1EK5A 4RS8A 5J8CA 3PP8A 4OXKA 5L51A 1T2KA 3WTYC 2NVBA 2DQRA 2ZKLA 3ANMA 1E77A 3H2SA 2EV0A 1LDYA 4MDHA 4R3WA 3TWOA 4AJ4A 3SFZA 4JN6B 1NFQA 1FNNA 4N9HA 1ID1A 2DUWA 1R66A 2O3QA 2ZTUA 3M9AA 1SD4A 1NR7A 4EJUA 3WJAA 2BH9A 2HKIA 3SZPA 1S3JA 1ZH8A 3LQRA 5DZSA 1YLFA 2RH8A 2GN4A 3RBVA 3B73A 3HSRA 1UDCA 4Z3KA 4WCFB 1PJCA 1X7HA 5KJEA 2AQIA 5A3VA 4MTEA 1U5TA 2EERA 2Z1MA 3QW2A 4IY1A 4R16A 3WFJA 3WIEA 4R54A 2FN7A 4D43A 3LYLA 2OP0A 2GZ2A 2HWVA 2HOEA 1WRJA 1I5RA 2H63A 3GF4A 2ZATA 4MVJM 1Y8QA 3ZNQA 3QP6A 3EGOA 1T4BA 1MC4A 4B8XA 5A9TA 1LA2A 1B3RA 1SOVA 1W4ZA 4R41A 1LSOA 5B4VA 1ZFNA 2OORA 1LEAA 2O2YA 4FFLA 3DZBA 4CM5A 5AQ1A 2PA3A 4XDYA 4CLRA 2R3SA 1T1RA 4G7HF 1P2FA 1HDYA 2DM6A 5CYVA 4PZJA 2ZBKA 3BY6A 4OU0A 3M2TA 3OJLA 1MGOA 3WGZA 6LDHA 2B69A 2ETHA 3FNHA 3VVCA 4TV7A 2D1HA 4D41A 5EESA 2Y1GA 1IZ9A 4YVFA 5U1PA 1MUUA 3VTFA 1LQTA 4KP7A 2HCTA 3E9QA 2HJSA 4P9UA 1SAYA 1DJQA 2NTVA 1NASA 3ZNNA 4GBJA 1J5PA 5EQDA 1RYDA 2VC0A 1R37A 5GY7A 3CUQC 4FCCA 3V1YA 1R36A 4FC6A 3AK4A 3E03A 2AMFA 1AWCA 3PDUA 4LK3A 1PQPA 3I9LA 5TLSA 2CNBA 2GERA 1MZBA 3BMCB 3GNTA 3WTVC 1Y8RA 3GH3A 3JQAB 3LDHA 1U1IA 2FR0A 4I8XA 1GUZA 4UVEA 3H5AA 4YAKA 2I9PA 2IXAA 1DRUA 4LMRA 2L4MA 5T57A 4WWCA 4I02A 3WBBA 3ZHZA 1EVIA 2D0IA 1IB6A 5KKCA 2WD7A 4G2NA 2PGJA 4I2OA 4XSZF 1SCUA 2XROA 3WMWA 1LDBA 1BWSA 2QIOA 3HE3A 2RGVA 2A4KA 4KUGA 2QYSA 1O95A 4BNNA 3TZKA 1EV7A 4HDUA 4BNMA 1P1RA 2C2XA 1LNWA 3FMQA 3WR5A 2ZJ2A 1BW9A 1SZJG 1VSVA 2J5OA 1GQ2A 2O7SA 3QVSA 2FU4A 4FFRA 3S55A 1WI9A 3DO5A 3UGKA 4BO4A 3EDMA 1G3WA 2JD0A 3TL2A 4N18A 4ESOA 1SD5A 2WV0A 3H5NA 1RKXA 4J7CA 4OSPA 3LQQA 1VM6A 4CM4B 3OETA 4J4TA 3INTA 2BLLA 4ZYGA 2AEMA 4PG7A 3WGOA 1HDOA 5AXBA 3R3JA 4TRJA 4AJJA 2HMWA 2O3FA 3C1TA 4I5FA 2I65A 4EITA 1ODDA 1P0FA 1FMCA 1E7QA 3NGLA 4IXTA 1U6GA 3HIFA 3DWFA 4DIBA 5GZ1A 3WGYA 2K27A 5H6RA 5BS6A 1ZO8A 4XIJA 4B7XA 1AGNA 2QVOA 4JP3A 1BC8C 2M30A 3ZH2A 2XHKA 2ZQZA 2B4RO 2L01A 3AOGA 1IZ1A 4C7JA 3CO7C 2F5FA 2MLGA 1PZFA 1KU3A 1E3LA 4MIYA 1H9TA 1I01A 1DB3A 1QYWA 4IHTA 2EIHA 1ULSA 3RC7A 1T24A 1U9JA 4W4TA 2GXGA 4IS3A 3RBZA 5JDIA 4YXFA 5CG1A 2J5RA 4CMEC 1ULYA 3NTQA 3T4XA 2E7WA 2J5QA 3PK0A 2YDXA 4O5OA 5DBGA 5TT0A 2PZJA 1O5IA 1DFHA 5EEHA 1FDUA 4P4NA 4OQZA 3VODA 2HKOA 1DLJA 4OXYA 2ZB4A 4GXOA 4CMAA 5JS6A 3L9XA 1G3YA 4EVIA 2QRLA 2EFOA 3CXRA 4HFRA 5JW6A 1BIBA 1J0RA 2IZ0A 4CMBA 2CGPA 1IZ0A 4WOJA 5JFRA 4YWJA 5GZ3A 4E6PA 3FM3A 2X58A 4WE3A 1YS6A 3RC2A 2EP7A 3DBLA 2IA2A 1OC2A 1UP6A 2YY7A 5IDQA 3ECHA 3VDRA 2FQ3A 2IYOA 4UEKA 4YJGB 3W4KA 3GG9A 1Z7BA 4EM0B 1PX0A 1USTA 2HMSA 3OF2A 4DQXA 1KQ0A 3WB9A 5IDWA 4I5GA 2JT1A 3B1KA 1HL3A 2EV5A 1YQXA 2V6BA 3E6AA 4LN1A 4S3MA 5CPFA 4E2ZA 1HSOA 3WOHA 4KWIA 3FRJA 3WYBA 1DJNA 1SFXA 3KO8A 3UVEA 2OUIA 1PGQA 3PFIA 2DQLA 4BH9A 1PSDA 2D2IA 1OR7A 2YV1A 2QW8A 1JLLA 3LZ6A 1ZARA 1P45A 4NMHA 1UZMA 1E7SA 2W98A 3EZLA 1FF9A 3E9MA 1EFKA 5AXCA 1E3SA 4Y17A 2J3KA 5C3MA 4RAZA 1KYQA 4XGNA 4EGFA 3HSKA 1HW5A 5ICFA 2VYVA 3E97A 3PHLA 2IT0A 1BSVA 1LDNA 3P2OA 4R5MA 4HBGA 2VNAA 3WICA 2B5WA 5KVCA 2O4UX 1RM4A 1ZXLA 4IDCA 1ORRA 3FD8A 1LSJA 2XPCA 3RQSA 4FJ0A 3NX4A 4J4BA 3A4VA 3U1DA 4P4LA 3BTUA 3C7CB 3ICPA 4DYDA 1FP2A 3C7AA 3KLNA 1TQPA 4OGWA 2BELA 4R1UA 3VPHA 1W5TA 2QYTA 1U3VA 4CM8A 1BBYA 1I32A 2JFGA 1GXQA 1Y7TA 1UXIA 4TSKA 3DQVC 2QQ5A 1UZNA 2FE3A 2EK5A 1UB9A 4HLXA 1XIVA 4MIEA 5D5UB 3SJ7A 1B14A 3K8ZA 3DZJA 1R23A 4M6YA 1T38A 5J23A 2FXAA 1J7KA 4OOEA 1REPC 1AUPA 3DEYX 3BMQA 2OXIA 2J5PA 1B6AA 4NU5A 1GADO 1WW8A 1BI1A 3TKYA 1I2ZA 1LQUA 4XYBA 3TO6A 3T8RA 1M76A 1HZJA 2CDCA 3RC9A 2PTGA 2TDXA 3KLOA 1M66A 2H94A 1V8BA 1YDEA 1PU2A 1XMAA 2VUTA 5D4SA 1T25A 3AFMA 3KFWX 1N2SA 3DXJF 1PJ2A 4ITUA 2O8XA 1A4UA 3F8NA 4L4RA 3GPIA 3MZYA 3IKVA 4WGGA 2G17A 3GAFA 5ENVA 3G1TA 3H65A 3WFIA 2RCYA 3RKYA 3U4HA 3WX0A 1S8NA 2PGDA 1IXSB 2ZMEB 3O2PE 4JK3A 5KIAA 2RNJA 2VYND 2VE9A 4WNCA 1YRLA 4BO2A 4DPKA 1TT5A 1Y5MA 4R9SA 3TGNA 2Y48A 4RDHA 3ZU2A 1TNTA 3EUWA 3N58A 1BMDA 1ENOA 4IDEA 1ZRDA 4YQZA 4YT5A 2C2YA 3I4CA 3X2EA 1EDOA 3DFUA 5FF9A 3VAZA 4I7HA 5L3ZA 3TZHA 4BNZA 3DP7A 5CVJA 2CVOA 3KEOA 4LGVA 3J81Z 3EYIA 1TA4A 2EGGA 3ROKA 5A04A 4CGZA 4Q4ZF 1P1FA 3ZMDA 4F46A 1MP0A 2FP4A 4RVUA 1HXDA 2D59A 2J3IA 2WTBA 1U4SA 1LJ9A 3PHIA 1NNUA 2EG9A 1NPYA 1U78A 3I5UA 2AG8A 5ADHA 1V0JA 5G2OA 3TF5A 3RKWA 5CAEA 3DHEA 2PK3A 4RF4A 3ZP5A 3BJOA 4BHCA 2DK5A 5HS7A 1UH5A 2PZKA 3GZNA 2KIMA 1SBYA 1SOWA 4L74A 4ALLA 3G3EA 3DHNA 1UUFA 3W6ZA 1EUCA 1LDMA 2EXXA 3JQ8A 4QWQA 3KE2A 4IXAA 1WZEA 3WNVA 2VHXA 4XD2A 3N97A 4IRGA 2UYYA 2W2LD 1ZYRF 4ZN6A 5JE8A 3PTZA 3NTRA 3DQPA 2D2WA 1ZKMA 4EJTA 2L3DA 1XGKA 5LHIA 2ZYAA 5DF1A 2XUBA 2ISZA 2WEKA 3BHJA 3ST7A 3WLEA 1H94A 1R0LA 2QUFA 1KVSA 4CR8A 2CQKA 1ZEJA 2A68F 1I24A 2UUOA 5IJZA 4CQMA 1QKIA 4K26A 2YHIB 1KYWA 3SX2A 2XXJA 3V1TC 4B8ZA 1YB1A 5I7VA 2C20A 4ESBA 2LKPA 2XV4S 4R69A 3Q5FA 5A9SA 2NVUA 3HB5X 3TN7A 1JWAB 3OOPA 4BHBA 1KEPA 3OICA 3D4NA 4KTVE 4OO3A 4KUEA 3B20A 5A3JA 4ZYDA 2NV6A 3RJ9A 4NPCA 2IODA 5MGBA 1T39A 5EMHA 2IA1A 1MJBA 3AAFA 1XSXA 2VOJA 1FC3A 4ENMA 4R1NA 3IOYA 4PZCA 2KRFA 2F5DA 3SC6A 1C0WA 4UVGA 5KOIA 1PGNA 1I1GA 4HA8A 1U3EM 3D1LA 2XXBA 4NBTA 2CZCA 2XAHA 1J2XA 4M9SA 3QP9A 4GO1A 3NT2A 3RUDA 1MKMA 2CMDA 1TLHB 1XB4A 2FSSA 4NIMA 4EUFA 5LGTA 2E48A 3O8QB 3SXPA 4E2XA 3TFQA 5IT9K 1D3AA 1W7PD 3HJAA 1U2WA 3UCXA 3GUDA 3FTNA 3GNQA 4M86A 5B37A 5TF4A 5K6AA 2DBVO 4Q3NA 1NR1A 3V4GA 1LDJA 3EYYA 3KYCA 2LSOA 5K5OA 2I6TA 3JYLA 3DAFA 3N4MA 2Y99A 3NKLA 1JXSA 1C3VA 1FWZA 3NRVA 1X0VA 2M87A 2QHXA 2GZWA 3FHLA 3JD4A 4HWKA 1DSSG 4Z0HO 4CPDA 3AOEC 4RQTA 1CF2O 1H5QA 2VRBA 3W1VA 2ZNZA 4YFXF 5HLGA 2EKPA 2G1UA 1MDMB 1NXQA 3C85A 4W9NC 3EC7A 2OZUA 4KMSA 1BOAA 4WXCA 1FJHA 1X14A 3GA0A 2X0LA 3DFZA 2QQBA 4MQ9F 5TJJA 1H6AA 3WTZA 1HDXA 2Q2QA 3HB4X 2X8LA 3JQ7A 1PS8A 4QO8A 3CUKA 4W7IA 4NJMB 3E1KA 1EK6A 5THQA 4FD3A 4TRNA 3PQKA 4H7PA 9LDBA 2WJPA 2JPBA 1A4IA 4WCGA 1U2DA 4IZIA 2GO1A 3ZMTA 5C7LO 3COSA 1MD0A 4CQLA 8LDHA 1KQ9A 2HFHA 1J9IA 4BQRA 1AHIA 1GYPA 1VJ0A 3E5MA 3FXUA 1NFFA 5D8KB 3AY3A 2CFXA 3HOSA 3Q0EA 1HKTA 1QP8A 4S05A 1Z6TA 2VHWA 4YCAA 3JQBC 3E82A 4RF2A 1XSDA 3I3OA 4CLXA 5H20A 4NBVA 2CSUA 2GQQA 2AW5A 2W4QA 3GVPA 4IJVA 1XEAA 2VCYA 1E7WA 4WNIA 2G9WA 3GFJA 3I4PA 3T8TA 2A94A 4IIVA 3DOJA 1K6XA 1RNLA 5A02A 2ZJ1A 3U2RA 1ZG3A 1PWXA 1K5HA 1KVQA 3QVWA 5B1YA 2H6CA 4LB5A 5A9RA 1OMOA 4HOBA 3LLVA 4KYWA 5DCWA 3V5NA 1P92A 3V7RA 2P68A 2D3TA 4D45A 5BQFA 5CEFA 1E1LA 1EMDA 2NNNA 5HLHA 3V7SA 1QYCA 1OZAA 1X7DA 3FBTA 4FS3A 4IJKA 4YT2A 3GNSA 1FYLA 3S2GA 3MWEB 1O3QA 3KLPX 3PPIA 5JFOA 3PIDA 4N0BA 1T2CA 2P6SA 2D4AA 1JA9A 3JQFA 2BMAA 5U4QA 4A10A 3KP5A 4W7HA 2EWMA 3ZWMA 4E2WA 3L6EA 1O7FA 1Q1NA 4IINA 3KZZA 3NTOA 1FDVA 4UEJA 5T6BA 1Q7BA 1B8PA 1ZK1A 3PXXA 4YJHA 2F2EA 2D5CA 1NQAO 1D1TA 5F1OA 3WTUC 4AVYA 2VHYA 2ZXJA 3RFXA 2BV6A 1MFZA 4U0JA 4ZQEA 4B3JA 3O6BB 1P74A 2UDPA 3O38A 3FWZA 5ILUA 1CJCA 1PTJA 3DOCA 4DRYA 3M1AA 1U4OA 2H5LA 3EDPA 3AFNA 3RIRA 1K78B 3BPVA 2AS5F 1PJLA 3CLOA 3BYZA 4OIOF 5C37A 4YFKF 2JFFA 1YGYA 4D79A 4NNJA 2NS0A 2XAJA 4TMFA 2VBZA 1ZRFA 3FNFA 4GYGA 2JSCA 2R7DA 1PDNC 6ADHA 4YJDA 2FNAA 1B26A 3EVNA 3CTMA 1SPXA 3H9EO 2PKRA 4FFOA 5E1ZB 1MG5A 1BRMA 5DBIA 5BSEA 5D6EA 4BKRA 5KVQA 5JCJD 1DIGA 1DRVA 4ETSA 5DOVA 1ULUA 3SLGA 4HF0A 4ZA2A 4ALNA 4D0RA 3HZZA 2UWMA 3CH6A 3O26A 3U62A 3VH1A 1ON2A 2I99A 3KHUA 5CG2A 4FC7A 3H5RA 1Z7EA 4CYDA 4Y8VA 1ONNA 1BVUA 4FX4A 4E70A 3JSAA 3G3ZA 1FZPB 4OL9A 3LT4A 4LSMA 1F8FA 3O03A 4BGUA 5I7SA 3AU8A 2FOKA 3ZWPA 3L07A 2STWA 1U5TB 1VKNA 1ONVA 2VC1A 2X0JA 4L5IA 3VC7A 1S6YA 5T8KA 3UOGA 2ELHA 2FRHA 1N7GA 4S1VA 1H2HA 1Y8QB 4F45A 1WMBA 4LISA 5FLXK 1YJ8A 1IUKA 4J91A 1MXFA 3LC7O 1U3WA 2SCUA 4CLHA 5DYMA 1HBXG 4CLRB 1FX7A 5EINA 1G3SA 2HQRA 5DEQA 4QECA 4WASA 3GMDA 3FR8A 2FBIA 3K1PA 1GR0A 2H6BA 1I36A 1NAHA 2DU8A 2BRUA 1P33A 4L5JA 2HRBA 1O9BA 1P44A 3AI1A 1IHXA 2M5WA 3TQNA 3VKVA 1OBFO 4YT4A 4DNCA 1XDSA 5HDKA 1BDBA 2DPHA 2C54A 2A6HF 4OSOA 4WLUA 1T6SA 5CVRA 1WP4A 5C7OO 3VOSA 3RUHA 3H9UA 3HFSA 5ENDA 5A1TA 1CWUA 2GNAA 2Y67A 3FI9A 3S2WA 3U09A 4OIQF 2XAQA 4MVJG 1YB4A 2W85A 2O50A 1ISHA 4U0YA 1KA8A 1A7KA 1OI7A 1ZK4A 3FSRA 4TVOA 4CM9A 4HXYA 4IJAA 4U0VA 1JDJA 4E4YA 4OKIA 1GU7A 3DMTC 1FXSA 1NWHA 1B4AA 5JDCC 5I9NA 1BVRA 4YTEA 1A9ZA 4MINA 4P55A 2B4QA 1XA0A 1O89A 5DCYA 4UREA 1E17A 2O0YA 4RAYA 1JU9A 2G82A 2RBEA 2WD7B 4GMGA 5IDYA 3I53A 1EE2A 5ILVA 3OBBA 4A03A 3GZ4A 4HNHA 1NPDA 3DEUA 1E6UA 4L75A 1F14A 1MJAA 4MPDA 2GASA 4CMHA 1UJMA 1HW1A 4ROSA 3RC1A 5LDGA 4CMJA 1D8JA 5FB2A 3FXQA 1R00A 5J6XA 1U8FO 3IC7A 3PVZA 4GGPA 4PZDA 3E6MA 4YRAA 2QENA 1W5SA 1MC5A 4PG4A 4RV9A 4ZHSA 3DBHA 4WK8F 2OAZA 2RDPA 3LA3A 1AOYA 1CRWG 2IZ1A 1LDGA 1FK8A 3GEZA 2AEJA 3CUQA 4GLLA 1SEVA 3ERED 3FPLA 1L1FA 4WLNA 5JXWA 3CSDA 3FNEA 1IULA 2XOXA 2JHFA 1KY4A 1PGOA 3N74A 4LJZF 3R1IA 4R1HA 4MVJH 4MVJE 3FPCA 4QXMA 3VH2A 2X5JO 4WOKA 5K0ZA 5L4SA 4HFMA 1AN9A 4PGHA 1M6HA 4RL6A 3VPSA 1B3BA 2GXBA 1KU2A 1YOVA 4MEXF 3ON5A 5JMPA 1GYQA 1PJBA 2HK9A 4BNUA 1M6WA 1I30A 1K6IA 3ROQA 4B7UA 4IRIA 1MB4A
chains in the Genus database with same CATH superfamily
4N49A 2VB6A 1J24A 2QRJA 2OZVA 4A27A 3CF5F 3FVTA 3H9QA 3ZW9A 4HGRA 3GX1A 5E4TA 4NBNA 4H0NA 1G20A 3GQBB 4U00A 5C7YA 1C30A 4FU0A 3VHQA 4OA8A 2IKQA 1Q14A 3EWAA 5L45A 3I39X 1T4CB 2H06A 2YHUA 4C87A 2Z99A 3QYFA 3ZJVA 5LQCA 2QROA 3FTEA 1CUIA 2WJGA 2IX3A 3UPUA 1W85A 5H68A 5M2QA 4RSRA 4TKLA 2ZYWX 2D2FA 1W96A 1Y1TA 2D5AA 4B82A 4A3EJ 3H0GJ 3KAPA 4E32A 3KZVA 3LSYA 4J16C 1VLZA 4WK2B 2CLDX 4ZCTA 4RH0A 3F46A 3IT1A 3MILA 4GMFA 1CY7A 2FPUA 1FOWA 4BPBA 3TLXA 4XASA 4WZBE 1C0LA 3N2NA 2ADOA 1NIJA 4LHVA 1SKBA 3HKZA 4LXGA 4II3A 1NVMB 1M2NA 1MBGA 3LBFA 4RIEA 3Q9NA 4L7VA 5IW8A 5DP2A 5BW4A 3DTNA 1WXFA 4DLSA 3ZBUA 1GT6A 1KSHA 3IMFA 4K9RA 1T8TA 3MT8A 1G6OA 1GTRA 2E87A 1AIPA 4RJJA 4RS3A 4U0WA 3GJ8A 2KZGA 5DXFA 1LW6E 4BMDA 1AQLA 3LKBA 4RB3C 3L9WA 2PNFA 4BACA 1WHUA 4GE0A 4Y15A 3GIWA 4OMZA 2AKYA 2OOSA 2VPIA 2Y1XA 2OFPA 2A0YA 4R1TA 3OX4A 3L18A 4W1RA 3GW2A 5KK1A 3C1OA 5KC8A 4N82A 4U6QA 1ORIA 5AVJA 3PGXA 4IX1A 3AGPA 1YJAA 5HUHA 3E5UA 4DARA 1J75A 2CL7X 2BBOA 1ZM3A 3UHOA 3GTQJ 3D6JA 1ULTA 3QVXA 3QUCA 2IYTA 1XZAA 1JYSA 3OKFA 2ZUWA 3ND9A 2KIFA 3E1SA 2F90A 5K6RA 1J21A 3P45A 4HVTA 2P4HX 3NJ4A 2CUZA 2YHSA 3AP1A 1FX0A 3FGNA 1ZQ3P 3E0QA 4NYJQ 4KJZA 2RGNC 3IBCA 4JMLA 1W6UA 2P4WA 4E94A 5T4FA 5IJXA 2AR0A 2DUMA 3AR3A 2FUEA 3GCWA 4BQFA 5LA6A 1AGYA 5B64A 3FPGA 2XNDA 2YASA 3GFQA 4LRWA 3HADA 5IKPA 3F8FA 2C9YA 2OC9A 5AKKA 2GBPA 2O8CB 2ZUDA 4BNHA 3UWKA 3PC6A 3L8FA 1E6LA 1P2DA 3QBTA 1W4CA 5HKAA 1IXZA 1ENYA 5TVKA 2ID9A 3B9PA 4TMTA 2GM3A 5LEKA 3FMPB 1KOGA 4M3FA 3NUGA 2NOJB 1JR4A 5B1EA 5FJIA 2BEVB 1YZQA 3GRKA 1ZR4A 4JJEA 2XUFA 3GY0A 4P0PB 2HPVA 4AF7A 5DCMA 2WHYA 4HNGA 1FU7A 3VNBA 4F85A 1I7DA 4LOKA 4C0BA 3MRXA 3IMKA 1OB2A 5A3QA 3E48A 1ERDA 4U7GA 3WHIA 3GMTA 2SBTA 4BLQA 5DBHX 2PH7A 3J80Z 4O6VA 4GYYA 2QY6A 4CKYA 1VECA 4GSYA 4YRKA 4UW9A 3PIOF 2NAZA 3DMYA 4O2BF 2FBKA 3N5KA 1CUAA 3HNRA 3LPLA 4RB1A 2HQSA 4GWGA 5ALVA 2XE8A 1KR2A 1DV2A 1TTYA 1GXSA 4DV2B 3QPBA 1O3TA 3QG1A 2RGBA 1KETA 5HVQC 4JWKA 3RGGA 4ZYEA 3I23A 3B1WA 2VDWA 1W5BA 5FHRA 2B0CA 3ASVA 3EG9B 4BE2A 4UNNA 5IUNC 1G1AA 2MLKA 3CM0A 3CC8A 1TPYA 5J4LA 1UJ6A 1XO1A 1V5GA 4QUKA 2WADA 1JHYA 1J20A 4YJ3B 1EWQA 3C98A 4RTRA 2D2EA 2GA1A 1VLJA 2V6GA 2ZO4A 3OAAD 4BFZA 3DBOB 3K9GA 3R9KA 4OJNA 4GRIA 3V2UA 3I9MA 3EEBA 3LDUA 2FX3A 1JQKA 3BZKA 3K0BA 5JXGA 4DLZA 1Z2NX 2HFKA 2K7LA 3PE6A 5BR7A 2L0XA 1BEUB 4XYLA 1UT8A 3LW7A 3UT6A 3U0BA 3BCAA 3U1TA 3DEHA 1XN7A 4AJEA 4LZWA 1WDMA 3A3YA 4OGGA 5DDIP 3BXZA 1A9RA 4Y6OA 2BVNA 4F6RB 4H08A 4UM8B 1TIPA 3Q1LA 3FF5A 2O9JA 3FWHA 2I7VA 3SE0A 1RIOH 2CD7A 2CBXA 1C1XB 4P2GA 3KVNA 1Z47A 3OZWA 5L9AA 3DEFA 2X4GA 3CF4A 2FH5B 3BUSA 5ALXA 4EX7A 5ESRA 5HDQA 3GUCA 3ZK7A 3BF7A 3CH7A 3OQ6A 3ABLH 3L7YA 2OCYC 1U5BB 2BBWA 2L42A 5IYDJ 2JJ7A 1ZL0A 3BWDD 3FOAA 4MW6A 1GAEO 4B4WA 4RK1A 4XR4A 2HFJA 5FOVA 5IH7A 1UQTA 4ZQCB 3OYHA 1T3GA 1ZM7A 2VJCA 4BQOA 1PT7A 2F9FA 2W6MA 3PQFA 3H17A 3M6XA 1U9ZA 2CDAA 4CFSA 4DEYA 5KVRA 2X3FA 1PTJC 5H3CA 5IZCA 1UM9B 2YU3A 3BCHA 1O54A 1YVDA 3IV9A 2Q3JA 3OQNA 5K0EA 5AHKA 3IT0A 3UJCA 4BS9A 3GLTA 2C31A 2NU7B 1OT5A 3VPAA 2HSGA 4HAVA 5JNSA 3P32A 4GL4A 2L02A 1KHHA 2JLYA 3O2QB 4Y1GA 4IIJF 3WO0A 1QAOA 2JAPA 4IEIA 1FFYA 5ECYA 1ON1A 3HU1A 1GVNB 4XOTA 3Q3SA 3ASZA 1WB4A 2CN1A 3B78A 2XTAA 2PR2A 1ZCZA 5JYDA 3S2IA 3H1BA 2QOEA 3VBCA 1YI2I 2BRUC 5JO9A 5H7XA 4IMRA 3TO7A 4D3SA 2YOHA 1ZPDA 2WF8A 3AVOA 3VPFA 4R2JA 5ICMA 3QKRA 5I9MA 3ZHYA 3OZEA 2B83A 1AUVA 3VFZA 5F9MA 3VC1A 2PAAA 1W36D 4PLCA 4B3AA 2BKLA 3TRHA 4UM9D 4B6RA 1D2MA 1JA1A 1UXGA 1LKXA 5HBRA 2DRIA 3DZFA 3UB4A 4OQFA 3UJ3X 3Q7IA 4MV5A 2VKDA 2Q9UA 2J7PD 4AJIA 4FZVA 1KYZA 2QV7A 1R4MB 2I22A 4Q3CA 3DZKA 2HEOA 3G88A 1O94A 2N46A 1P4AA 2ZOSA 4ZO7A 2CWEA 3P27A 3O2JA 1B8VA 1EFTA 1VLHA 1XTRA 3D5EA 3V4OA 3EF1A 1LX6A 1YJNI 2IU3A 2ZNYA 1LRLA 4BKOA 1WWKA 3NVMB 4G4SO 3OOUA 1G2IA 1ZBQA 2Q5QA 4F97A 3QPCA 5AM5A 5KPDA 1NZFA 4G01B 4OWRB 1R0RE 1YRYE 4BO5A 3KEGA 1I7LA 4IQ8A 5EP3A 2G4CA 3ND5A 5FRMA 2CKDA 4BO6A 1RHMA 3GEPA 2RAPA 2KBFA 4A1OA 2XTNA 4ZO8A 3V4LA 3GD7A 1MEEA 2HK6A 3KOMA 2ZPUA 3GVIA 3GLXA 3EQLF 2DQKA 4H4DA 2CYBA 3LC2O 3IAM1 1HNWB 5G0UA 3ZWCA 2PJRA 3FWKA 4R51A 4I1IA 5G4KB 1RRPA 2OP1A 3GAMA 2WM8A 3KBBA 1OYIA 1E9SA 1FUUA 1MX3A 3BFPA 2HA2A 2GYUA 1V71A 2D1YA 1AS2A 4DA8A 2QKYA 4OHCA 4NAHA 4Q7JB 4XQ0A 5IF3A 1L5HA 2XOEA 1IFXA 1U2TA 5KSWB 5JASA 5D8LB 2ZIGA 1UBTS 4F6CA 3K2EA 4WW0A 4M0UA 1NRJB 1XEXB 1UBEA 4IBOA 3ILSA 5L7WA 3T1BA 1KL7A 3KWMA 1CUFA 2LD4A 2BZGA 5L4NA 2W83A 4MQ5A 3KOWA 2C8KA 4D4JA 2EWWA 4C2MJ 4J6FA 2GUWA 1KDRA 4AG3A 1SHJA 1F48A 2IP2A 1BDIA 2CJPA 2FEAA 2Q6KA 2V7TA 5B3AA 4IDFA 4F7DA 3BILA 1WZCA 2J5BA 5F51A 4C0WA 1E9AA 4UARA 1VG8A 3OYLA 4H7KA 4BHTA 4M6WA 1UPTA 3B7WA 4M46A 5K4GA 3NARA 3A26A 4JR2A 4ESJA 5JNRA 4M89A 3ORQA 3GNLA 4XN3A 2QMZA 3GLUA 5G0SA 2BXZA 3BCUA 3HYSA 2EJWA 2I2DA 3BAFA 3AKZA 2ZBPA 4PSVA 4DJFC 3SR4A 1G21B 3WGHA 4PHGA 1ZONA 2EKBA 2LDBA 4Q1CA 1BDMA 4GT1A 4IVNA 2MH2A 1YGPA 5JCZA 1QQIA 2F67A 1O57A 1OCCH 1F8UA 4YJGA 1T6YA 4JI4B 3STUA 1U02A 3MYYA 2APJA 2PZ8A 1W0UA 4RGSA 3IUSA 1TNDA 2M32A 4KPUA 5C4JJ 4ND7A 3RO7A 3OWHA 2LBFA 2I1LA 3I34X 4ONEA 4PYIA 2O20A 2DPDA 3AM3A 3IQGX 1KEKA 4BBZA 3R9IA 5FUVA 2ZSBA 1M2VB 3HVIA 1HY3A 2WIJA 4MWZA 2IHJA 4M1EA 5TB5A 1I2CA 3EGWA 4IFEA 5EJEA 2IPLA 1ZVJA 3AUTA 1EXVA 5AONA 2YWEA 1AZTA 1J0AA 1E4OA 3PGMA 3SSAA 1CULC 3DEZA 2M9HA 3B1JA 4MQEA 1DZIA 2JI6A 3DZDA 4BYYA 2HQBA 3KTFA 1EAYA 3NM6B 2VBCA 4N12A 1A8SA 2H17A 4TYQA 4BO3A 2FJ0A 4AZVA 3MGCA 4Q3AA 1AN0A 1N2IA 1SWWA 5EWJB 3FCOA 5A0VA 1GSAA 4QVIA 3GWZA 1YFHA 5LEJA 4FYXA 3FMSA 2A1IA 1U8TA 3RYFB 2VODA 4ZGGA 4MV7A 4I9GA 2O03A 2QZ8A 2ZP1A 5G40A 1ZUNA 3BG6A 1KSFX 2BEJA 3K0AB 1F60A 4LB6B 4Q4CA 2BE5F 5I7OA 1IG7A 4KN9S 2SICE 3EX7C 1AE1A 1IDN1 1HZZC 4G1EB 3OR1C 3UPTA 2EB7A 2QAGB 2V45A 1RAGA 1O4WA 1SVOA 5T41A 3PC7A 1XLUA 2YZ2A 3K0EA 2DECA 3TLJA 2BM9A 4RVFA 1ZZEA 2X2FA 3BJAA 1W1UA 4R8HA 3DD1A 3MWFA 5E6SB 3BXXA 4YB8A 4FCVA 4Y0AA 3OG9A 2XUPA 4M73A 2RKWA 2ST1A 1CUYA 4TRMA 2O2CA 3J80A 1XU7A 4JEHA 3D4PA 2ZJYA 3V8PA 4D3DA 4JC4A 1KDPA 2F43A 4WK0B 2B3TA 2J67A 2X4HA 3C7TA 5J1RA 1ZSNA 1KOLA 1YS4A 3G1LA 1CJKC 2O6GE 4YN3A 3FPAA 1KC3A 2C03A 3ZWBA 2PWBA 1P31A 1MH4A 3AF3A 3ZKWA 4MR8B 1XE3A 3OIDA 1Y1LA 3RKSA 5CM9C 3KYJB 5JR3A 4KJXA 3N28A 3NAQA 1XLTC 5GONA 2O6HA 4AY5A 2Q3MA 2BKVA 2PR7A 4U2DA 1EINA 2PEZA 1RWMA 3R8FA 5FKJA 1UODA 2VJMA 1UZUA 3QMVA 1PG5A 4I6ZA 2B8NA 3D64A 2WIDA 3IEMA 1DC3A 1VSUA 3P71T 1S02A 2R8ZA 4J76A 3NEYA 2YZMA 3JQAD 2ODEA 4YP1A 2ZSFA 2DQRA 3TWOA 2LREA 4FISA 4N9HA 1NR7A 3NONA 2P6NA 2RH8A 3LWBA 1C9NA 1NONA 3PUIA 2GZ2A 2K2WA 5K3AA 1LA2A 2R11A 1KONA 3COWA 5B57C 5B2ZA 1AF7A 3O8CA 1MGOA 1PG0A 2ECCA 3EQ6A 3GJ4A 2WDPA 4QVGA 1R6RA 3USES 4QASA 4BX2A 2DT6A 4LF8B 4XB6B 2XB6A 4M36A 4MHSA 3IE1A 4COKA 2XUGA 2FR0A 3EGCA 2OV3A 3RZDJ 1SH7A 1Z3IX 5DM6F 4G2NA 2OCDA 4GLJA 3VKWA 4ER5A 3I2IA 4BNMA 3GEHA 4G0QA 1THTA 4OATA 2ENWA 1VM6A 1HFJA 3FK6A 1HE1C 3EDYA 4N5HX 4D97A 4WTOA 4ISCA 5E6RA 1MMGA 1AGNA 1I80A 1U4NA 2XMPA 1KU3A 5ALGA 3TVDA 1IZ7A 1EK2A 4IHTA 1DBQA 3DV2A 1WX1A 4L72A 3W2IA 5AI8A 3UK0A 5DBGA 1KEEA 1TU0A 1Z5PA 4CMAA 4AZTA 3W2GA 4HFRA 1MD9A 2EFOA 1AY0A 2YWXA 5KX5B 2VTBB 3UAOA 3U3DA 3PXGA 4E6PA 3H84A 2V3VA 1XD2A 4QA9A 1GUBA 5JCOC 4TV9B 1SULA 2W2OA 2GI4A 2YY7A 4A3BJ 5E3MA 1GZHB 5BQPA 3VDRA 4F5WA 1Q95A 5IDWA 4DVGA 3CR8A 3FRJA 5H02A 8MHTA 5CXUA 4B83A 2IU6A 1NNEA 1FF9A 4HWRA 4UTPA 1E3SA 1LBHA 1LDNA 4X3CA 4HBGA 2Y71A 2XPCA 2VK2A 4IDQA 1GA4A 4A5SA 2HZBA 3AF0A 2I4RA 1N6NA 2VL7A 1MORA 1L5KA 3B52X 1J7KA 3W7AA 4CTJA 1GADO 2FEWB 5D5QA 4CKEA 4CDMA 2VJLA 3F6RA 4B3TB 4R84A 3KU4A 1Q12A 4D25A 2PS9A 3H83A 4QPJC 1IXSB 4DZTA 4BO2A 2K9SA 2YOFA 3MELA 1AA6A 1MBFA 4K6MA 2NVYJ 3P8ZA 3HJFA 3ROKA 2FOLA 2Q1ZB 3NHFA 3ZMDA 4F46A 4RVUA 4Q24A 4RTJA 4KI7A 2JJ8A 2ZJPF 2MFZA 5LDDC 4PJ0C 1ZZGA 2OCIA 1MAAA 2GEVA 3KE2A 2GCOB 3BWXA 2IAIA 4Q9HA 3A6KA 5F0CA 2XUBA 1T15A 2QUFA 4H0FA 2JLWA 4K26A 3M4XA 4MV1A 4ZYZA 1LPSA 4EIWA 3QVJA 4N4OB 3LO5A 5F2EA 5DTJA 3MD2A 1NZJA 1EB9A 3GRAA 2XXBA 1CJSA 4GF5A 2BE9A 3SXPA 4PBRA 4TOIA 3IHKA 4XLAA 4LXQA 1EVLA 2JFNA 5B37A 4FN5A 4G0UA 4Q3NA 1WBBA 3U80A 3H2YA 4I6JA 3JYLA 4B85A 3NRVA 4U2KA 5B2EA 1UMDA 5HLGA 2N3ZA 2ZSHA 2D62A 2Q2QA 4RV4A 4H7PA 2J9FA 1I5OA 4CKXA 2AX3A 3IP8A 3JQBC 1T4MA 2CSUA 5DGHA 2CHGA 2O2HA 3F6EX 3F9RA 4R8RA 1W1WE 2CZGA 5AVKA 2GZDA 1PWXA 3THWB 1NQVA 1Z8NA 4B3FX 5M5YJ 3M3HA 5LP6C 1I13A 3KKKA 4HGOA 3KLPX 1TFRA 4YY3B 2P6SA 3LKVA 4OHZA 2BMAA 3ZWMA 3JAWB 2E1MC 1XJCA 4LKOA 1NM5C 3OLVA 1MFZA 4U7TB 5AUPB 1XTJA 2O8FB 1U4OA 5KKNB 5IPAA 4R1PA 1B26A 1R0ZA 1MG5A 5DBIA 5BSEA 1UBHS 4QODA 4ETSA 4C5CA 2CFIA 4G4GA 3BIJA 3L2QA 4BFSA 2FOKA 3TIVA 1K6EA 1VKNA 1IRZA 2VHEA 4KGDA 1W4LA 2JK1A 2YNMA 3LC7O 4GXQA 1QVRA 3BIFA 4PJNA 1GR0A 3BIXA 3L7OA 3ZE9A 3WB1A 1IHXA 4NS1A 3W2FA 2VSXA 2C54A 3OCJA 2QLNA 3RUHA 2ZRIA 3WHCA 2GK4A 3F5FA 3PKIA 2WB2A 4Z99A 1B93A 4W8OA 1K4KA 4RUKA 4P55A 5DCYA 3OPXA 1DG1G 3AL2A 5B7GA 1SUSA 2H8GA 2XI4A 4JNCA 3OCYA 5KI6A 5G3ZA 3EA4A 1MJAA 3PVZA 4RM3A 2QENA 1W5SA 1MC5A 1SZPA 3DBHA 3LA3A 4I50A 4HQOA 1UOOA 3S17J 2R7XA 2OV4A 1CUEA 1IULA 3R1IA 1KPGA 3HBAA 3MTQA 4I9FA 2HA5A 1M6HA 1BCSA 1GYQA 3SKYA 1PK9A 4PEVA 4EAAA 4PGGA 4ZAZA 2JMWA 3DB1A 2R5WA 1PFQA 4MYDA 4JSYA 2XKPA 2BMFA 5BURA 4E88A 4FHGA 4YDSA 4KNVA 5EWLB 4HVCA 2F1KA 1KFEB 5J5AA 5F7OA 3DBLB 5MGNA 3N6VA 2I66A 2QE6A 4LAFA 1RQGA 2GIVA 1M0WA 4X3OA 3L3BA 2D54A 2Z43A 2ZXWH 4ZV4A 4ZTZB 1L1QA 1DP7P 2EFGA 3K53A 2J3DA 2IBMA 1MJ9A 1XRQA 1QGZA 1YASA 2G5PA 1KY2A 221PA 4ADSG 4K5QA 2IV2X 3O2SB 5F5LA 3M3DA 4UDNA 4DXHA 4IP0A 4NLLA 4P2BA 2HA3A 2G9RA 4ZK2A 2IYFA 4TPKA 3ND8A 1JHOA 3KAJA 4X63A 5L4LA 5EE3A 1OQAA 2K4MA 2CY0A 2DLLA 2DQ4A 2Q1XA 4EPRA 3KZOA 4WESB 3H5VA 4GRAA 2QW1A 1NF3A 3BR3A 2EIKH 2EL7A 3K4LA 5LLQA 2EEZA 4PLTA 1U8RA 3JRAA 5TISC 2D45A 2H16A 3K9QO 4K1LA 5LLSA 4CXMA 1YZTA 3Q3CA 3NVDA 2G1PA 2FDCA 4JB8A 4JJ6A 3R5HA 1PO7A 4NHOA 3B1ZA 2AI3A 1PD0A 1ODFA 1TVKB 2UZ4A 3D7SA 2BXYA 2WOOA 5D3KA 3ZHXA 2ZYVX 4ID9A 4DM3A 2DAOA 5LLDA 3BFVA 4B3GA 1VQNI 1G59A 5KYWB 4UUOA 4JYPA 1B9NA 1F5TA 4DMRA 3LX6A 2IBSA 4JQFA 3SDBA 1QX3A 2WU4A 3E6BA 2I3DA 4NCKA 2XVXA 3PBKA 2X76A 2ZAMA 1UMKA 1ZI8A 3LUCA 4EW6A 4RK6A 4EKYA 2VRWA 1NWCA 1OFCX 1N0IA 2O3JA 4GSKA 1WJEA 5IRCD 2EJBA 2HWKA 3CB4A 3LLSA 1WKBA 4V03A 1X38A 4W9RA 4CMIA 1G7SA 1ILEA 1U0OC 2Y1FA 4MLOA 3W6KB 1DHTA 2OPBA 3PEVA 4A0RA 2NO1A 3OIYA 4U1RA 4WUVA 1QU2A 2R00A 4L8VA 3KFVA 4DR4B 3P4UA 1D5CA 5DV5A 3NAGA 1N9GA 5L3RA 4QTRA 5F6FA 4QYSA 1KAQA 4N01A 2P2SA 1C50A 5J2TA 5B1HA 5EJ9A 2A61A 2FE4A 1RFLA 5DM70 1GZ6A 2H51A 4MKZA 1YR3A 2BGKA 3AONB 4TWJA 4KZKA 3N8IA 1YB6A 1P6XA 3GUUA