2VT2A

Structure and functional properties of the bacillus subtilis transcriptional repressor rex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
199
structure length
184
Chain Sequence
ATAKRLPLYYRFLKNLHASGKQRVSSAELSDAVKVDSATIRRDFSYFGALGYNVDYLLSFFRKTLDQDDVILIGVGNLGTAFLHYTKISMAFDINESKIGTEVGGVPVYNLDDLEQHVKDESVAILTVPAVAAQSITDRLVALGIKGILNFTPARLNVPEHIRIHHIDLAVELQSLVYFLKHYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords REDOX-SENSING TRANSCRIPTIONAL REPRESSOR REX
publication title Structure and functional properties of the Bacillus subtilis transcriptional repressor Rex.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 56
structure length 184
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02629 CoA_binding CoA binding domain
A PF06971 Put_DNA-bind_N Putative DNA-binding protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2vt2A01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2vt2A02
2DBVO 2W85A 1FK8A 3Q9UA 2FOKA 1NWHA 2VYVD 4ZQHA 5JS6A 5F1RA 1TLHB 1XG5A 4Y6PA 4HBGA 3C7AA 1ZRFA 2ISZA 4R5HA 4YXFA 9LDBA 1B26A 2JD1A 3RUEA 2P4WA 4CGZA 3LT1A 3B20A 3EDMA 1YW8A 2BMAA 5FI3A 3S2FA 1Y8RA 3BMNB 2X6TA 1NPTO 3F3SA 3UKOA 4LVCA 2TMGA 5LLQA 3TFQA 4HX7A 2I99A 3PYMA 4W4TA 4WE3A 1EE2A 3AY7A 3I1JA 1ZH8A 3P9KA 2JAHA 4IMRA 1YE3A 4R8HA 2VOOA 1GXQA 3KZZA 5EEHA 2C2YA 3DONA 3H9UA 3HN7A 4LSWA 4BIIA 3KOUA 4DIOA 3LA7A 4OQYA 2DLDA 4M73A 1CF7B 3ZWVA 3JTHA 1TTYA 3JCZA 2HFHA 2W2LD 1GR0A 4L4RA 1TXGA 5D6FA 4L9TA 1I24A 1RM0A 2RV8A 1Z73A 3I59B 2Q1SA 3SQNA 3EY4A 3NGXA 3L9WA 3QWHA 1X14A 4NI5A 4YJFB 1KU9A 2FBIA 2R3SA 2BGKA 2ZMEA 4ILKA 4LK3A 4UEKA 4FFLA 4BNLA 4CM1A 4WCDA 1AHIA 1KU2A 1IZ9A 4XD2A 1S7CA 2PMUA 3NUGA 3P19A 3ZI0A 4OU0A 1P1JA 5HLGA 3NKLA 2W8ZA 1BI0A 4CMAA 2H1SA 2A9FA 5I9NA 2DQLA 2AEJA 1YQGA 5H83A 2CQKA 4ON0A 2STTA 5KOIA 1JAYA 2EGHA 3WE2A 3Q6IA 1PSDA 4XLPF 1Q1HA 5B4TA 1R15A 2C20A 3EYYA 2O61A 1LDMA 3G3ZA 2E49A 5A3JA 2VRCD 3NT4A 3BYZA 2O3RA 4DNCA 2Q1TA 2A92A 1WWXA 2RQPA 2HKXA 2FE3A 5DUKA 1I5RA 1MFPA 3GOHA 4XJSA 4TQGA 4GSKA 3MOIA 1S7AA 1LB2A 2MC3A 1EVJA 3IJPA 3SX2A 1W6UA 1HXDA 3GEMA 5DBFA 5A03A 5KNLA 1LLQA 3TOAA 2BGLA 5AIPA 3WQRA 5KWEA 5L3FA 1LEBA 1PJ3A 2R00A 3UCEA 2ACJA 3TN7A 5G0WA 3PJDA 3T4EA 1ULUA 4EYEA 4JBGA 4Q4ZF 2O3QA 3NQOA 4UV8A 2GR9A 3QWFA 3GFJA 4H15A 2CVOA 2YHIB 3GDFA 4K9DA 1XGSA 5I9LA 4N7RA 1MLDA 2JKVA 3I5UA 3TL2A 1OC4A 2XRNA 2E1CA 3L7WA 2H6BA 2XV4S 2GXBA 4NBVA 4J0EA 4BNTA 1OC2A 2OQRA 1P0CA 3MWEB 1VL0A 4MVJD 3I6QA 2HR3A 4IJWA 3QU3A 2CYYA 4BNXA 2UDPA 1QYVA 2UXNA 2NSDA 3ASVA 3ANLA 4IS2A 4LLGF 4JBIA 4IDGA 5DOZA 4E2ZA 5D8KB 4YAKA 1STZA 1UZLA 3AWDA 4LLNA 4I9HA 4OQZA 3FF4A 4YA6A 1YBMA 4P38A 4YRAA 5HLHA 3DDNA 4IS3A 3RKYA 1H6CA 2EKPA 4FCCA 2XIGA 4IRIA 1YTYA 5EPOA 3C1TA 2ZFWA 1E3JA 5ITWA 2ELHA 1TB4A 3Q1LA 4PG4A 1PGJA 3KLPX 2O0YA 3WX0A 4RLSA 3K69A 3W6KB 2X9VA 1GUYA 1GCOA 1E7MA 2F5EA 1SFXA 2NRAC 2XF8A 3W6UA 4HFNA 3IP1A 5G4KA 3RUIA 5L9AA 4PFJA 3OM9A 2V1DA 1CERA 5T67A 3I54A 4LK0F 5I7EA 1LQUA 2Y0EA 5HDKA 1EUDA 2IT0A 2V79A 3ITDA 3GYHX 3NV9A 1LC3A 1USSA 1O3RA 4JK1X 3QVWA 1BVRA 1C0LA 4H0EA 3GN1A 3H5NA 2FRHA 1PUEE 4TKLA 4GSLA 2JT1A 3GZ5A 3TQNA 4F46A 8LDHA 4HYEA 3ZMVA 3SXYA 1GCUA 5I7VA 4MKRA 2ZTMA 3KRTA 2P5LC 3E6CC 3U62A 1P1HA 4TRJA 3RPUA 3H2SA 5FGMA 4HKTA 2L4MA 4ZZDA 1FYKA 1SD6A 1C0PA 4MP8A 4Z9XA 3PHJA 4DVJA 2Q2EA 3CIFA 4EGZA 1V35A 1T26A 2BKAA 4Z3KA 1ISIA 4EUEA 2EFQA 3HHPA 2FEZA 3E82A 3S2EA 4CV0A 4MQ9F 3GC6A 3Q2KA 3VOSA 3DF8A 3GFBA 3FBTA 2VZ0A 4R01A 4ID9A 4IGFA 3WYBA 2PV7A 3OF2A 3Q0EA 3F4LA 4UV9A 1UR5A 2JFGA 1EFKA 4P55A 1I3MA 3INTA 1DIRA 3LC7O 4L5IA 2CZCA 3WICA 2P5YA 3LF1A 1QXSA 4J3FA 1WPQA 2EG9A 3MJEA 5L53A 4MOWA 4OXKA 3L4SO 4PGFA 4UUMA 2Y67A 1N5DA 4XRRA 3DAFA 4MVJM 3D4PA 3KB6A 4KDEA 5JDIA 4EJ0A 4J7UA 1ZK1A 7ADHA 4G6QA 2LNBA 1R36A 3DEUA 4GGGA 1DIBA 4GPD1 3QLJA 3CLOA 3E5XA 3H4VA 4WCGA 5H20A 1HTBA 1HE2A 3F8BA 4Z6KA 3D5TA 1X0VA 4LG0A 4FS3A 4YACA 4EJVA 2FBHA 3DHYA 4C7JA 2GASA 4BNGA 3CTAA 1J5YA 4OIQF 1NPDA 3FNGA 4CMBA 1D8KA 4XSZF 3HSEA 1MDMA 3MAJA 1WDKA 4B3HA 2DPDA 2POQX 3HIFA 1JKIA 3SJUA 5K5RA 4NB5A 3D3WB 5JHUA 3Q2IA 4ND5A 4RORA 3D4NA 1T6SA 2WD8A 4FDAA 5EIOA 3WYEA 4II3A 5BS6A 1E1NA 4AJKA 4DMMA 3GZNB 4UVBA 5B12A 2IJLA 1R5GA 5E1ZB 1HKQA 2ZQYA 4BO9A 4DGSA 1ZIDA 5FI5A 3ZP5A 3PK0A 3H6KA 4OXYA 3P5SA 3VZQA 4ALKA 5A02A 4A2CA 2NQ8A 4CMIB 3HRUA 3PIDA 2VOEA 2OAZA 4NBWA 3AY6A 4MIEA 3L6OO 5ICEA 1M6WA 2YU3A 2VHWA 3HE3A 4IQ8A 5EERA 5F1OA 1PU2A 4Y9DA 5K9ZA 4RPHA 2D5CA 4BH9A 1AE1A 1LQTA 2RKHA 2OUIA 3CMCO 3LT2A 3RDIA 2C07A 3LYLA 1O3SA 4JJIA 4KUMA 4MVJG 4Y98A 3UCXA 4DQXA 4M9XA 3LSTA 1LNWA 2G82A 3BJAA 5K0ZA 4ESOA 4NU6A 4CQMB 4B7UA 1LI4A 1U5TC 1QLHA 4E5KA 3JSPA 1N1EA 1TVEA 1S6YA 2VT3A 3RAJA 4I02A 1J7KA 5J23A 2P5VA 3ZMTA 2P9EA 4YAEA 5BR7A 1XN7A 3J80Z 3WTUC 1DOHA 4KDPA 3HNPA 4WOJA 1Q0LA 4Z3DA 4M71A 4BNJA 4WXCA 1BMDA 3FD8A 2O3UA 1EV7A 2FHSA 3CPSA 3LAJA 2FNPA 1HKTA 1ID1A 3I5MA 1DDOA 2AQIA 1NR1A 4L0ZB 1WMBA 3JQFA 3ZHXA 4XB2A 1DLJA 1QRRA 1D7OA 4PG5A 4GO1A 4IJAA 1YS6A 1EUZA 2A5YB 1K0UA 2Q4BA 3ZQ7A 1XELA 3K2BA 4I5EA 4NBRA 4XIJA 3ZNNA 1AGNA 3FPLA 5JFOA 1E3WA 1ZRCA 2FR1A 4Z0TA 4CLOB 1SD7A 5KVSA 1P4AA 3E6DA 1ORRA 3OBBA 3I71A 1CF2O 4BB5A 5BSGA 2BBYA 2DBZA 2EIHA 5F3RA 3GZ6A 2DPUA 2J5KA 2Z5LA 5AXAA 1P1RA 1MC4A 4J0FA 5E18F 2OZPA 5LEJA 2EEZA 4TVOA 3T7EA 5A5FA 3HDHA 1QZYA 1U5TB 1R0LA 2HRZA 2MLGA 4YIIA 2J5RA 2EKQA 4BGIA 4MVJH 4KMUX 1WRJA 1IUKA 1ONVA 4NH4A 2EW2A 3QPTA 1PQPA 3DTTA 1ZG3A 4RJTA 1KVSA 3DMYA 5TLSA 4DMLA 5KTKA 3JQ7A 1MGTA 3AK4A 1E7RA 3HDQA 4JJGA 4BUCA 1LX6A 3MJVA 4PZEA 4Y6RA 4JQCA 4TMFA 1HZZA 1KC1A 4PG7A 2VCYA 4IJUA 2M87A 3OV8A 4AIJA 2YV2A 5B1YA 4IHSA 1IN5A 1V6AA 4LGWA 3CE6A 4W7HA 1AUPA 2PKRA 4BQRA 5TIIA 4O6JA 4EGYA 2F5DA 2O23A 1H0MA 1E6WA 4B3JA 1EH8A 3OJOA 1W4ZA 4WLNA 4AVYA 1A72A 1LDDA 2VYND 3VZSA 2Q4EA 3GGOA 5CPBA 4PG6A 4BMSA 4L9JA 1PQUA 2UVDA 3VPGA 3IHUA 5ICMA 1FLIA 1LSSA 1R22A 3NAQA 4AICA 2EK5A 3DPLC 3EUHA 1LLDA 1ZO8A 3NGLA 3X2EA 3UFXA 2DO7A 2BEOA 4BL5A 3KZYA 1UP6A 4LMPA 1SOVA 1I2CA 3GVIA 4Q3AA 1KQ9A 3HOSA 1N7GA 1R4MA 5D5UB 4U6QA 4JJFA 1BWSA 1H94A 1J59A 1Q7BA 3W4KA 3JD1A 3VHRA 1FX7A 3DBLA 4JBHA 4RQUA 1X0XA 5L95A 3KETA 3PLRA 1FMCA 4ZD6A 4WCFB 1L1FA 4TWRA 1IHYA 4S3MA 2RH4A 4OH1A 4D42A 2HSDA 4R9SA 5L40A 1C0KA 2GNAA 5HS9A 4GBJA 5A3VA 4R54A 2KIMA 1ZSYA 5D5XB 3OMLA 1JGSA 5JC8A 4ZVVA 5DT9A 3SC6A 2J6IA 4BKRA 5H6RA 3L9XA 1H5QA 4YJGB 2DQRA 1EEHA 1HL3A 4HADA 3HUDA 4WK6A 5COQA 2V9VA 1CYDA 1XGNA 3GF2A 4QECA 5DBGA 4XWYA 5KJEA 3TKYA 2P7VB 3JQBC 4L5JA 3E5MA 1ZGAA 3JD0A 4CM9A 1MP0A 3VKUA 4O1MA 4GVLA 3M8FA 4AIHA 3FI9A 5F5LA 3ETGA 3OA2A 3ENKA 2QVOA 1M66A 4GWKA 5A9SB 3GF4A 2CFCA 1GYPA 3NRCA 5EQFA 3I4FA 2STWA 2EHDA 3ERED 1DFHA 3FR7A 3KZVA 3U9LA 5CAEA 1TT5A 1ZN2A 2VXZA 2C54A 1BW9A 3LZ6A 4ND1A 4RZIA 5U9CA 4ZYEA 3ICCA 3K96A 2EXXA 1Z6TA 2GZWA 1VSUA 2YDXA 3F1LA 5E8IA 1MXFA 3IS3A 3NX4A 4ZQBA 4G7ZF 1KIFA 3T5XA 3UW3A 4OIPF 1B9MA 1WVGA 1IN7A 3KBOA 4GL4A 1R5HA 1MB4A 4IPTA 3WB9A 4DBZA 2ESHA 2PY6A 5B4VA 1A4UA 2GN6A 1HLPA 2CFXA 4FB5A 5IJZA 4PCQA 2F5CA 2OU2A 1J0XO 3QHAA 2ZJ0A 1W4MA 5IDYA 3TO7A 4U0JA 3FXQA 2GZ1A 3BTVA 3FSRA 4XGIA 2A35A 3ZV3A 4ESFA 5ED4A 4A5MA 2P91A 4G94A 2G1UA 3NDJA 3LLSA 3ORFA 4R68A 1YB1A 1IY8A 4AG3A 2HMSA 1WZEA 1Y9EA 5JAIA 2CSUA 1JTVA 4R4JA 3KP2A 3O6BB 1C0WA 1XYGA 4W6ZA 3ADPA 1HDRA 3AI3A 4WOKA 4BGVA 3K5PA 1ZHFA 3OQ6A 1E3EA 5FB2A 2BELA 3G79A 4KMSA 2AXLA 1R4NA 3U49A 4BKUA 2NVUB 1T0FA 1KY5A 4NMHA 3EVTA 4RGXA 5A05A 5COAA 2B5WA 2UWMA 2BRUA 3F6YA 3DB2A 1NVGA 4EZBA 3GNQA 3AW9A 4DREA 2PZJA 3NT2A 4BNWA 1LBEA 4I5GA 3KHUA 3WLEA 1QKIA 2L02A 3GVPA 1OI7A 3VKVA 1DHRA 2QYOA 2ZNZA 1UDAA 4K6FA 3WTCA 2X5JO 2D1VA 5FD5A 3LLVA 4EBFA 2NVBA 2XOXA 2YQ5A 1O9BA 4K1LA 4LD5A 2FPIA 1K6JA 1DEHA 3EZYA 2RDPA 2A4KA 5EL0A 5G0TA 3HJAA 5T57A 4PZJA 4BNFA 5CP8A 2FBKA 1KYQA 2OBYA 3M6IA 1MJBA 1UHMA 2QM3A 4XLNF 4O3MA 2OBNA 5EMHA 4PVCA 2FSVA 3EVNA 4NU5A 4U5QA 5A4DA 1YW7A 2VHVA 4GMFA 1O7LA 3PQDA 3QWBA 2PNFA 2JFHA 2A68F 4AL4A 3BP8A 2IXBA 4F7ZA 5IN5A 4UREA 3F1KA 3FWEA 3BMQB 5LBQA 1WP4A 2V6CA 2UXXA 4NG5A 5HTOA 4YQZA 3LQFA 3E6MA 2C2XA 3F3XA 2Q1WA 2VWPA 1XSXA 2VWGA 3GRKA 3WGIA 2WSBA 3INGA 1QG6A 3KP5A 4YFNF 3CSDA 4J7XA 3AUAA 1ML3A 2YUTA 4MIYA 1ZRDA 4HV4A 4XB1A 5JR3A 4HV6A 4ZRMA 3QV1A 3WIDA 4YT4A 4LLLA 2B5VA 3MJ4A 3IOYA 4CMHA 3T7CA 2HQRA 3I64A 2J3KA 3R6DA 5L3ZA 4DQVA 1HQCA 1HW2A 3CUKA 1NNUA 1UP7A 1Y8RB 3BWGA 2I76A 1I6XA 1RWBA 3H9EO 3K8ZA 3NTRA 4OOIA 4CQMA 3D4OA 3GA0A 3C85A 5AVOA 4RGSA 4IBOA 1EBUA 1E7QA 4RAYA 1KC3A 2BGMA 3PQEA 2QQ5A 2B83A 4ZJUA 1MGOA 2VODA 3ZHYA 1T2FA 1ZMTA 3EMKA 2X86A 3RJ5A 4RDIA 3JQCA 4WKGA 3DZFA 5TQVA 1DFIA 4AJHA 1YS7A 2IP2A 2WD7A 5C37A 4K2EA 3Q3CA 4CMCA 3TO6A 4S04A 5BQFA 2CDCA 1NWCA 1VKOA 2DTDA 3NYWA 4G81A 2ZMEB 3WBFA 1KY4A 1BG6A 1T2KA 3IL2A 2EWMA 2R00C 4FFNA 4NK5A 1C1DA 2OORA 2PZKA 4HUJA 4KWIA 2GN8A 1DFGA 2Y1FA 3KLNA 5CEJA 4KN4X 1R0SA 2D2WA 2FSWA 1G3SA 4ENMA 5IT9K 1KEUA 1U3UA 3D1LA 3DQPA 3SLGA 4BO1A 3KEOA 5LCXA 1ADFA 1KVUA 2D4AA 5DD4A 3TQHA 4RF3A 1GYQA 1U28A 5I8ZA 2XAQA 2OQGA 3ZV5A 3SZTA 4AJ2A 1G6KA 2DW4A 4KMFA 1GADO 3H65A 4UHTA 5A5EA 1J5PA 3C24A 3E97A 1RJWA 3K92A 1SD4A 3H5RA 4TSKA 2B36A 1FF9A 3IC5A 3OJEA 3VZRA 1YB5A 5JE8A 2C7VA 3QP5A 2H94A 1JHHA 3FMSA 1PP8F 2OOSA 2PWZA 1UFMA 2ADUA 1XIVA 4ZA2A 5ICCA 2VN2A 1Q0QA 1BN5A 3PQKA 2HK9A 3GDOA 3QVSA 4MJLA 4AJ4A 1I5ZA 4DA9A 4F6LA 3NJ8A 3BDDA 5ILUA 1H6DA 2YFHA 1HBXG 5TSDA 4KNYA 3L6DA 3I9OA 2WWRA 2EV9A 1XCBA 5A2QK 3RD5A 3V7RA 1S29A 3I3OA 4CM8A 1FBQA 2JCYA 3HB5X 3K73O 4OL9A 4CM4A 3V7SA 2OHXA 2PGLA 1VKNA 4CZZA 1Q0HA 3CINA 2V6GA 4URFA 1HDGO 3DZIA 3UH1A 3AI1A 4RAZA 3T1BA 3J81K 2VBZA 2W57A 1T39A 1QYXA 3PWZA 4YVFA 2O3SA 3HTUA 3QVTA 1NQTA 1SB9A 4XQGA 4AJNA 4KUGA 2OBPA 5ILGA 2X5OA 1T98A 3R3SA 4DPLA 1SD5A 3GUYA 2GQQA 2Z33A 3RI4A 1HKSA 4WF2A 5FFFA 3BOQA 1FPQA 2K27A 2XAAA 3I4CA 2WEKA 2FR8A 4AFNA 4CXFA 3DOCA 2ZCVA 1B0AA 4PLFA 5F1KA 5JYDA 2O7SA 4GAEA 1KEWA 1I36A 1ON1A 2XXBA 2KIUA 3H92A 1RUNA 3DZHA 2XXJA 2I3GA 3LVFO 4CQLA 3IWFA 4CMJA 2DK5A 4U0VA 4CM6A 1TQMA 2HWVA 2VTEA 2O2YA 2Y1EA 1GQQA 3LT4A 4L4XA 1FXSA 4P9UA 1XWFA 2GGSA 2NU7A 2G5CA 2V6FA 3DMTA 3JQBA 4BHCA 4JIGA 4ND3A 3E18A 2B69A 4N9HA 1NPYA 1BI2A 2VUUA 5HBRA 1P44A 5L7YA 1UHWA 1I10A 4DPMA 2JPCA 5G4KB 1ISMA 1PJ4A 1OYYA 1PL6A 2WJPA 4QXMA 3WNQA 5TF4A 3S2IA 2RHRA 4LRSB 3ZWXA 2BF7A 3CXRA 2Q49A 1MUUA 2JD2A 1ZARA 2L4AA 1YL5A 4S05A 3ZW9A 1TQIA 5DUIA 2GA1A 4WXHA 3INRA 5JDIC 1JXSA 2G7HA 1KBZA 1R7JA 3B1JA 4O5OA 3AOGA 1OMOA 2Y0DA 3QP6A 2JCVA 3SZPA 3IDSA 1D8AA 5L3EA 4FSHA 1XHLA 4CM5A 1H9BA 2W25A 3FXUA 3ZGYA 3TZCA 1DC4A 3PHLA 2IEDA 3OQ1A 4AIKA 4O0LA 3HDYA 2ESNA 1SBYA 1U7HA 1XGOA 5KVRA 1HW5A 4M9ZA 5DP2A 3U4CA 1ZEJA 5BNTA 1IF1A 1SZJG 3HADA 1WXDA 2X0LA 4UNOA 4MQVA 3NRVA 2X0IA 2ZYGA 3GR6A 3HZZA 1J4AA 4MVJE 3TZHA 3UXYA 2X23A 4BVAA 1BC7C 1LA2A 5JFRA 1U3VA 2O4UX 3OH8A 2ZQZA 3VPXA 3WOHA 5E1WA 2DK8A 1ZVMA 4CR7A 1M76A 5L4LA 2O3FA 1FZPB 3ZWNA 5CPFA 3AU9A 3AOEA 1ZK2A 3T8TA 2FWMX 4E2XA 3UHAA 1U78A 1Q2XA 5IG2A 3K2ZA 1U5CA 3PJGA 3F5QA 1UXGA 1GEGA 3OFSA 4FFPA 4IM7A 5BMZA 4P8RA 2P9GA 2HMWA 2HYFA 1E1LA 2DBRA 3WXBA 3IAHA 2VOJA 1TA4A 1Q7GA 2CVZA 4B8WA 5FEUA 1EQ2A 1X7HA 4GI2A 1PZGA 3ULKA 4PLTA 4RB2C 1XDSA 3IKTA 4WXDA 1XU9A 3W1VA 4EMSA 4BB6A 4MTDA 1W73A 1HKUA 3LQQA 2R2GA 2QX7A 3LWFA 3TNLA 2NV6A 2O50A 2PI0A 3V8LA 4LG0B 3ZWPA 3TDZC 3V2UA 2G17A 4AJ1A 3IUPA 1H2BA 1LUAA 3KLOA 2ILTA 3FHZA 1ISFA 2OP1A 5ENDA 3F72A 1WZIA 1U1IA 3DOOA 3N74A 5HRUA 1ZNQO 4CR8A 2K4BA 4LB6B 4OMYA 2EF1A 3VTFA 3KYDA 2AA3A 4M55A 3ONFA 4CUZA 1FT9A 3EAGA 3JQFC 2EP7A 4CV2A 1BOAA 4B7XA 1QORA 2XAHA 4ZH4F 4R41A 1NHAA 3S2WA 1GL3A 2YR2A 1IN4A 4KQXA 5KIAA 1DUXC 1LLUA 1QZZA 3DPTA 1ZFNA 1O57A 4FGWA 1QYWA 1R1UA 3F8CA 1KYZA 4B3IA 1VL6A 4IDFA 3GFIA 4KIFA 2YSRA 3D64A 4KZPA 4PVDA 3I0TA 2D3TA 1T38A 2P6TA 1ZBQA 4FR5A 1ZXBA 4E21A 1B15A 1Y5RA 3JQ8A 1YH3A 1Y1PA 1LDNA 2Z1MA 5BSEA 3RQSA 1UAYA 4DYVA 1FBSA 1Z6ZA 1B3BA 1K2WA 3JYPA 1LDEA 1F12A 3AU8A 3DOJA 3LF2A 4E4YA 1XQ1A 2NAZA 4OAQA 4CL3A 2RHCA 5JI6A 3B1KA 1G0NA 1W0CA 2J8ZA 3FNHA 5BNIA 3JAMZ 3PHHA 1HSTA 3KV3O 3DZKA 1LXCA 2A6HF 3D0OA 3WSWA 4B7CA 3DR3A 4WX9A 2RIRA 3GUCA 3TOBA 2L01A 3EYWA 1EQUA 5A1TA 5G0VA 4YRDA 2O4CA 3TZQA 4MVJF 5H6QA 4UVGA 4PLCA 4XCVA 3L9FA 4R69A 5TX7A 4YT2A 3DTYA 1W8DA 2HMTA 4RO0A 5F64A 2DQ4A 1E3WB 4NJOA 2OGUA 5AIQA 2BFOA 3BTUA 3ROPA 3TJRA 5E8GA 1BJAA 1E6UA 4KQWA 3PI7A 4PLGA 1NBOA 1ISHA 1TW3A 4BNNA 1F9NA 1WMAA 4HFMA 1Y81A 4DPKA 2E7XA 1KA8A 1YJ8A 2DAPA 1JLLA 3QWAA 2KIFA 4I9UA 4TRRA 4QUKA 3E5QA 1LEAA 5GZ3A 4AJLA 1B6AA 1UXJA 5J6XA 1I2ZA 4HF2A 4HWKA 2DPGA 4HX8A 1LSUA 2XPCA 1V3FA 3GMDA 1NVTA 2A94A 1AHHA 2EFNA 3ZNOA 1N9GA 1U9JA 3WGQA 2HAEA 3JQ7B 1OR7A 1HWYA 5FLXZ 2VTDA 4GCVA 1PJSA 3BIOA 4WECA 5DNAA 4BO8A 4IRGA 6ADHA 2R6JA 5F6FA 2M5WA 2VBXA 1R1VA 4ZYDA 1KU7A 4G7HF 1DIHA 4IZIA 4ONEA 2XASA 1SOWA 4D79A 4I98B 2I3AA 3OETA 4UUPA 4BOYA 5A04A 1IXCA 1CETA 3FPCA 3MJCA 4B8XA 1UXHA 4Z2YA 4OINF 1OBFO 4FW8A 4GMGA 4L0QA 3N97A 4NK4A 1YL7A 4A7PA 3ZWBA 1P3DA 1PR3A 2BFMA 2GLXA 4EVIA 3ZW8A 5KJ6A 4OKNA 5EEGA 4OM8A 2X0NA 1NHWA 1RNLA 1A5ZA 4UVHA 1JDJA 4EM2A 4HFRA 1I2BA 6PAXA 3U3XA 4HY3A 4BO7A 5IN4A 1ZKMA 3R4KA 1FDWA 2QG4A 3S2GA 3ZNQA 5L7TA 2CGPA 2CF6A 5DYMA 2NNYA 3MTGA 3PWKA 4CLHA 1XB4A 5JBIA 3JD2A 5KKCA 1P4XA 1DBVO 4TZKA 2M45A 3HTSB 3ZWMA 4KYWA 3HDJA 3FWNA 4M49A 2WYVA 3MFKA 3REOA 3KP3A 1YDEA 3DBLB 3VOEA 2PKQO 4IJKA 1RYEA 3EC7A 4P22A 4RVHA 3KTDA 4E13A 5DZSA 2O48X 2X5KO 4MP6A 1RM3A 4E5YA 1P2FA 2LKPA 2NU9A 2HTSA 5B37A 2LDUA 3KYCA 3MZYA 3F6OA 2DU8A 1SFUA 3ROUA 2QRLA 1VJ0A 3ONDA 4BNVA 1NQAO 1UUFA 4O63O 3TDUC 3IRRA 1J6UA 4J1SA 4WUVA 1LJ9A 1SCUA 4I08A 2FQ3A 2RH8A 1JKFA 3EUWA 1VI2A 2WDZA 3FM5A 4XX0A 2IDZA 5GZ6A 1ADGA 3UAGA 2Y1CA 1YOVA 2WWYA 3HRTA 3DBVO 3KP4A 3L4BA 1CQJA 4GYGA 5LGNA 3F47A 1E3LA 1ZG5A 2C29D 1LRLA 4NJMA 5KKAA 1ONPA 1TT5B 1MZBA 1NYTA 2EKLA 1BW9B 3DXFA 1HSZA 3H9GA 2PD6A 4RDHA 1XEAA 2AG5A 2ZJ2A 4CR6A 3WTTC 4CJXA 2PTGA 4RF2A 4EGFA 3WBBA 1GUZA 2ZB8A 2VBYA 1W5SA 1Y5MA 3X2FA 2VC1A 2IRFG 4XYGA 3RKRA 3W8FA 2EFOA 3ABIA 4RCVA 1SMYF 3R0JA 3SHFA 3MJSA 4LMRA 2HUNA 4J7CA 4AWXB 4YYZA 2F5FA 5LHGA 2Q2VA 4NFSA 2GDZA 2VE8A 1GY8A 1PL7A 3VPSA 4UVAA 2F2EA 4XRFA 2P8TA 1P1FA 3HN2A 1DJQA 3A06A 3C7DB 1DSSG 4KFCA 1NFFA 2XUBA 4G2NA 4J9UE 3FNEA 1K89A 1PGOA 2C59A 2OA4A 5K1YA 1VPDA 3DBRB 1U8RA 4JXKA 1IXSB 1DIAA 4GX1A 2CF5A 2NM0A 2KKOA 2CDBA 4YAGA 4JP2A 2GA2A 1C0IA 1Y6JA 3ZWOA 1ISGA 1KYWA 2JSCA 2X22A 1PTJA 1EVIA 3EDPA 3T8RA 4PZDA 1I1GA 1R4NB 4HOBA 5FO5A 5HS4A 3DHEA 3SJ7A 1HSJA 1MXHA 1PZFA 2AS5F 2P68A 4R5MA 3E5UA 2L3DA 2RNJA 2J3IA 1F06A 1YB4A 1YKFA 2GRAA 3E48A 4YAJA 4ENJA 2PLYA 2IPQX 2CMDA 1GXPA 3RJ9A 3KO8A 4YT5A 4L4SA 1QO0D 2ZK7A 3TFOA 2I65A 5TC4A 2BI7A 3ZZNA 2GD1O 4UVIA 2B4QA 5DCUA 1JKJA 4EUFA 4XJTA 2P4HX 3BMOA 1KS9A 1K7AA 4ALIA 1IYZA 3WGTA 4CICA 1R12A 5BT9A 4PLYA 2H5LA 3QQPA 4BHPA 2QENA 1YONA 4ALJA 4YAIA 2FOIA 4LW8A 2UUOA 1ZAOA 1EVYA 4PDKA 3FTPA 1KOLA 1R0KA 2AG8A 2NTJA 3GG9A 2VZ9A 3HWRA 1I3LA 1BSVA 1Y8QA 1MJ9A 5KVCA 4WPGA 3GEDA 2EP5A 3PDJA 1KVRA 2MLKA 5LDGA 3ISPA 1E3SA 5LHIA 4IF4A 1U4OA 3VPHA 4ZHSA 2DT5A 1HRDA 2ZJ1A 2DPHA 3O8QA 4DC0A 5CVVA 2P5KA 4UXNA 3CKYA 2LF8A 2DTRA 3RU9A 4DIBA 1GUFA 1IHXA 2HOEA 2W2KA 2I9PA 3ANMA 3E9QA 4M72A 3OP4A 5G0UA 3QU6A 5K5OA 1P77A 1N8KA 4RQTA 3WS7A 1DRVA 5LC1A 1U4SA 1AXGA 1C3VA 3ECOA 1K6OA 2JFFA 3JYQA 3PRJA 5G4LA 4ENNA 5IXYA 5JXWA 4KUHA 1GEEA 3CH6A 2MA3A 3VH1A 3C1AA 3WGYA 1N7HA 3WE3A 4HXYA 1ZJYA 1CIVA 1JU9A 4J4HA 3NJ4A 4XYMA 3U5TA 3HHHA 5CDUA 2RVCA 3HSKA 2VNAA 1F8FA 5LRSA 3DAPA 5TT1A 4U88A 3O03A 3F21A 3I53A 3I9MA 3JQGA 2C5AA 4PG8A 1GDHA 2TDXA 5ICFA 1C1XA 4ZU3A 3SBOA 3WJ7A 2EV0A 2WD7B 4XZ3A 2LDXA 3RSHA 4ZZLA 1D3AA 3ZWWA 4U0WA 1FOKA 3C18A 1U3TA 4ZICA 4R9RA 4Q3CA 2FZWA 3GVCA 3ZWYA 4XYBA 5JNLA 5IT3A 4CYDA 4CMGA 5CG1A 1C1DB 1B16A 4K28A 3DZGA 5A06A 3CDHA 1FSEA 2NYXA 2NS0A 1HYGA 3BMCA 3U2RA 3AUTA 3GWZA 3RYPA 1A71A 2C82A 3E9NA 3B6ZA 1CQIA 4UUNA 4HX5A 2RC4A 2JCXA 3QVOA 4K26A 3K1PA 1Z74A 4OKIA 1B3RA 1BTOA 4N5MA 3RUFA 5JAMA 1UJMA 5A9TA 2EW8A 1WW8A 4F45A 3F8FA 1U2GA 2ZATA 4WLOA 4Q47A 3VZPA 5JCJA 4A5OA 2J5PA 1LRKA 4A73A 2Y0MA 2Q3EA 3E9MA 2X0JA 4Y15A 1EH6A 3WTSC 1B14A 1PJTA 2HU2A 2I5PO 3VH2A 2GXGA 3ZDFA 4DTIA 2Y99A 4KN7X 1XGKA 1S3JA 1HDZA 3JQ9C 4IZHA 3AM3A 4OXNA 1SEPA 5JSFA 1J75A 1YRLA 1A9ZA 2HKOA 2W84A 4LRTB 2X4HA 2QBYA 3SEFA 4CM8B 3DMTC 2E6UX 1D5VA 4YQYA 1DC5A 4ETSA 3M2PA 4QT0A 1H6AA 4CLEA 3KYBA 2A6EF 5MGBA 3MOGA 3IKVA 4KTVE 3EZLA 2QYSA 1XSEA 4LCEA 2YX4A 4PLZA 3V1YA 1N2SA 2DM6A 3JQEA 1YXMA 4A27A 2EFPA 5JLAA 4BNMA 3OEYA 5ADHA 2QLZA 1PGPA 3TRIA 2K86A 5IZCC 5BPIA 1B8VA 2DTXA 3V5NA 5TRTA 2BYVE 2A69F 4G6DA 1HDXA 1P6RA 1P31A 3PZRA 4WNIA 1CEQA 5C7OO 3LU1A 1LSJA 2CO5A 1NP3A 4CUJA 3ZV4A 4H16A 3QWIA 3NT5A 4XSXF 1F0YA 2W90A 3FMRA 2YW9A 2EA4A 3WFJA 2YV1A 3W8EA 4INAA 3U4DA 3CZRA 1NASA 5EN4A 1KEVA 1QLJA 2NTVA 1BI1A 4AJOA 4LSMA 1ZCJA 4OOFA 1AWCA 3R1IA 4CQLB 4E6PA 1W7PA 2B4TO 1YWGO 5GZ1A 5IDQA 1BDBA 4CM7A 4A0XA 1R00A 3TGNA 1GFSA 1ZMOA 4D3SA 2W4QA 3NEUA 4ENKA 4E3ZA 2AW5A 2NNLD 2XGXA 1YQAA 4YB8A 3UICA 3WG9A 2EV5A 1HDOA 2OO5A 4RLHA 3PQJA 4FX4A 1EZ4A 2ET6A 3LDHA 1Y7TA 3FF5A 1RYDA 3AOEC 4MHGA 1M6HA 2YX7A 3ULQB 3RUAA 2D2IA 3ST7A 2EERA 2OZ6A 4WWCA 2GN9A 3DEYX 4FOSA 1ZH5A 4C4OA 4PGGA 2HRBA 3WFIA 1EFLA 5BSFA 1B8PA 2HTJA 4KIBA 1HZJA 1K78A 1G3YA 2BH9A 4A26A 3F8NA 4AJJA 4EW6A 4LB5A 1W5TA 4XIYA 3V1UA 2PGDA 4UUOA 1GTMA 5L4NA 2K4JA 2PR2A 2YQ4A 1R16A 3L2CA 4GGPA 4ALLA 1FWZA 2A3SA 4CV1A 4CLRA 2TMDA 4A03A 5JAQA 1X1TA 5DN9A 4BMVA 3SFZA 2Q8KA 2DFDA 4J1TA 3QRFF 3V2HA 2VHYA 1OYIA 2RGVA 4QX6A 3F46A 4F3YA 2K7LA 4XKJA 1GZ6A 2VWHA 3I6IA 3OECA 4E0BA 4NQWA 1GPDG 2YDYA 3LC2O 4GXOA 3O9ZA 3A4VA 3UF0A 1ULYA 4UVEA 2GF2A 4BYYA 3DFUA 4RV9A 3CO6C 1F17A 1D4FA 3R0AA 4JQFA 3DBHB 4FPXA 4M86A 1X15A 3OIFA 2ZXJA 3FZVA 2VUTA 3FBGA 1GV0A 1DC3A 3PYXA 3FCOA 3GG2A 4FIZA 3OJFA 4PIVA 4BKQA 3M1EA 1T2AA 2IE0A 4BNUA 2IODA 4TZTA 3HFGA 1JHFA 5CVRA 4EDFA 4GX0A 3MCVA 4YJHA 3PP8A 4IDDA 1V9LA 2QZ8A 3H2ZA 2NU8A 1MG0A 3BAZA 3CEAA 3IMFA 1Z1DA 5KK1A 2C0CA 1G3WA 4J90A 4BS9A 3D5QA 2JHGA 2ZB4A 3ZWCA 2C6YA 3RC2A 1E7WA 5JY6A 3PWSA 1BVUA 2DLLA 3WMXA 1V3UA 3C7CB 5DCYA 4Q39A 1V3TA 4Q3DA 1J0RA 3K30A 4KOAA 1HLDA 3TSCA 3DFZA 2HQ1A 4C7KA 5JCJD 4XYLA 4MO2A 1OYWA 5HDGA 2NUAA 3DWFA 1P74A 3MZ0A 4G7OF 1WLYA 4NNJA 1OMIA 3HRMA 3R61A 3DZBA 4I1IA 1XDUA 3RFXA 5FFZA 3EW7A 2PKQP 2Q2WA 1ZK3A 5HVQC 2UV8A 3FWZA 4I09A 3C1OA 3S8MA 4MGRA 1DHTA 2ZBKA 3IRQA 3AFNA 4EM1A 3F5SA 1G6NA 2ZNYA 3TO9A 1DJNA 2QZ9A 3KYDB 3ML6A 4JN6B 4E5NA 2DVMA 4U0YA 3QVXA 1E2XA 2C7GA 3RU7A 2AQKA 4CM9D 2FA5A 4I2OA 1WDLA 4QQRA 4KTTE 4JROA 2Y93A 3HHGA 3GHHA 1BIBA 1XGMA 4FFMA 1ZREA 1MFZA 3FRJA 2ETHA 4D0PA 1ENZA 3GEGA 4FJ0A 3VAZA 4OYRA 1LQ1A 1LLCA 4FN4A 2J5OA 4RB3C 4J2OA 3WQSB 4N0BA 2SCUA 2B0LA 5D5VB 2K02A 3ETEA 3JYOA 2CNBA 1DLIA 2E37A 3UVEA 2X58A 3TDKA 3UCFA 4K6CA 3E1KA 3JQ8B 2WE8A 5LDHA 5ILVA 4MP3A 2VYVA 4II2A 4WLVA 5CVUA 4GH5A 4BAYA 5D4RA 2PLAA 4PRLA 1SMKA 4ASNA 4FX0A 4I5DA 1PJLA 4W99A 3M1AA 3RUDA 1SAYA 1Z05A 4HLXA 4DYDA 5IFLA 2VC0A 1D1SA 1T1SA 4YFKF 4LVUA 4LMYA 2DI3A 1W7PD 2VBWA 1SPXA 2Y1OA 1XMAA 3MTJA 1Z7UA 4U7BA 1VC2A 1R66A 2WM3A 4ZYHA 3JQAA 4AVPA 1G1AA 2D5AA 3STHA 2HMUA 1KU3A 3I23A 3NTOA 3RVDA 3ON5A 4NBUA 3CMMA 1QYDA 3ENNA 2FF4A 2HK7A 1QGPA 1LRJA 1O0SA 1RM4A 3WJAA 2B4RO 1HEUA 1P1KA 3ETDA 4L76A 1PJBA 2V6MA 2Y1GA 3GY0A 4XA8A 1N92A 5ER9A 5ITVA 3HG7A 2PH5A 1OKRA 4YJGA 3OIGA 4RVSA 4KIGA 1A04A 5DCMA 1DC6A 1FSHA 3H5AA 3O38A 3ZU3A 3ECHA 3JD4A 3IWZA 3A9WA 2VT2A 3GLQA 4J16A 4BO5A 4N9IA 2O8XA 6LDHA 1P92A 3MEXA 2JD0A 4NHJA 1TT7A 3G73A 2GYYA 4IXTA 4LN1A 4BGEA 3PJFA 3CUQC 2FXAA 1O3TA 1E1KA 3AUUA 1FP1D 2HGCA 3LC1O 1BRMA 1UDCA 3SLKA 1N9GB 3JQ9A 2DAOA 3H7AA 3C1DA 2F1KA 4CLDA 4BNKA 4I9NA 2E7WA 4KA4A 1Z7BA 5FF9A 3L6EA 5ICSA 2HEOA 2NADA 2JPBA 1IL0A 1ZGJA 3RC1A 3WYCA 5I7SA 3RPQA 4HAMA 3WTWC 4FGSA 3D7LA 3ZHZA 1YW9A 5L51A 2H63A 4QWQA 1ZG1A 1NR7A 2CUKA 2O2SA 3NEPX 1T2DA 5JPIA 2CY0A 5ILSA 1BHSA 5DCWA 3ZH2A 3JSOA 4AJEA 2AEFA 4MTEA 4J9VA 2E1NA 3WTBA 5LHHA 4OMUA 4J6FA 3HYIA 3J80K 2QUFA 5IZCA 1UXIA 4NZ9A 1SEVA 3GAFA 1UXKA 3K31A 4EEXA 2CD9A 4RGBA 2NWQA 2QHXA 3L4BC 2DUWA 3I9LA 3T4XA 4IUYA 4EEZA 1ADBA 1RM5A 3H9QA 4CPDA 4DUPA 4YTEA 4D0RA 3GDGA 3P7NA 4LK1F 2HS5A 3DL2A 4L73A 4A10A 2VRBA 1P1IA 4NFHA 3M8EA 2Y48A 2I66A 4IQGA 4U0KA 3BJ6A 1QMGA 2WTBA 1IN8A 3WIEA 4E5PA 4DL9A 3Q9NA 4Q3BA 5T5QA 4L9VA 3PTZA 5ILOA 1GHCA 2ZYDA 5JCXA 5CDYA 2HYGD 3DHNA 2CDAA 1QV6A 2GCGA 3OICA 4YT8A 1V0JA 3W4JA 1QQIA 1H9GA 5AONA 4M54A 3S1LA 3TZ6A 3ZN2A 2ZB3A 4JX8A 3ZMUA 3KYCB 1B9NA 5JVTA 1JW9B 4R51A 1XKQA 1JAXA 1PS9A 4PLPA 3L09A 1P33A 3GVAA 2FN7A 3ICPA 3ASUA 2Z99A 2FZEA 1YG2A 3GRPA 1S7OA 3KE2A 1PGNA 2I67A 3NDIA 1QNTA 4PCVA 4W9NA 1JE8A 4FQ8A 4G65A 5T6BA 4QFDA 5IZ4A 4GLLA 3A14A 4Q48A 1YFHA 1LU9A 1YOVB 1H9TA 2XROA 1CJCA 4LJZF 4GKBA 4GWGA 2VOPA 3GVHA 3KLMX 3U4HA 1TQPA 1O6ZA 4IMPA 4NJMB 3QA9A 3JYLA 5HS7A 3CUOA 5JAZA 2QZZA 2IZZA 4N18A 3PZBA 3BJOA 1XCVA 3RKWA 4U7DA 1FDTA 4MIOA 5TS3A 1KQ0A 4KUEA 4QEDA 3HFSA 4WJZA 3V8JA 4BO2A 1SB8A 3IP3A 4J1NA 1GQ2A 5JY1A 4R1HA 2GUGA 4TKMA 3O4RA 4QSMA 5L7WA 4IPAA 2IEBA 4WEQA 2JAPA 3BROA 1ON2A 1MDMB 1ENYA 2LDBA 3BPVA 2P7CB 4PN3A 2P6SA 1PWXA 2GAUA 4UVCA 1E6EA 3EGOA 2BI8A 3TF5A 2PMHA 1I27A 3H3ZA 4XYEA 1UP4A 3WTYC 4XR9A 5GMOA 2DFVA 1SAXA 2X0RA 3F9IA 1VE9A 1E17A 4UEOA 4IINA 1ENOA 3JQAD 4RPJA 3WLFA 2EB7A 2IA0A 4A12A 4XDZA 3ZN1A 4OIRF 3TL3A 1FNNA 5FFXA 2JTVA 2QW8A 4O6VA 5JW6A 1CWUA 3W6ZA 1BDMA 4G8XA 3E6BA 5H82A 4TV7A 3IIEA 3H9JA 4IQ0A 5L4SA 1G0OA 3RBVA 1R23A 1HW1A 1QYCA 1OFGA 1O8CA 3GMSA 3KP6A 2M8EA 2OD5A 4TVBA 2DC1A 3WU0A 3SC4A 3PYLA 1PP7U 4WLFA 5COBA 1NXQA 2Y68A 1EK6A 3PHIA 1D3YA 1XMKA 3AM5A 4E5MA 2Y1DA 3WGOA 1B2LA 1K6XA 4RPGA 2ZTUA 5HS6A 3RC9A 4NHEA 4RL6A 1JA9A 4L8VA 5EQDA 1MA0A 1AOYA 2MD5A 1XLTA 3AM4A 2GZ3A 3I9NA 5FWNA 1GZ3A 1PGQA 1XDWA 2GWRA 3W4IA 3L00A 1JWAB 4IIUA 1DRWA 4P5OA 2NTNA 4B4VA 2ZCWA 2HLPA 2Z1NA 3AJRA 2NQTA 3BMOB 1SMTA 4EJUA 2QRJA 1U3EM 3KSUA 2Y66A 1G3TA 1A7AA 4FBGA 3VFZA 3EK2A 5HWSA 1CRWG 4H3VA 4WEOA 1MX3A 1KVQA 4JBAA 3FNFA 2PBIA 1X3UA 2DBBA 3I83A 1RUOA 4J1QA 1B4AA 3KFWX 2VHXA 1IZ1A 1EDOA 1T2CA 3CO7C 1Y8QB 1T24A 3MEQA 4RZHA 4AJIA 5IDWA 1ZK0A 4IJVA 5LRRA 1RIOH 3BTSA 1ONOA 2EFWA 3OA0A 1Q7CA 3EHEA 4XEHA 5T8KC 4XBFA 1X13A 3W6JB 3GX4X 1YQDA 4NQZA 3FMQA 5BNFA 1DO8A 3U1DA 1E3IA 1LDJA 1HT0A 3O8QB 3RUCA 5CEFA 5CHEA 3E5RA 1J49A 1I01A 1ISJA 3UN1A 2W2KB 2Z95A 3GH3A 3PPIA 2PA3A 1IULA 4OMZA 5AXBA 1I1SA 5BOXA 1NX6A 1F5TA 4D7AA 3P9IA 5L3CA 4GYIA 2OL4A 3RBXA 1IZ0A 3VDQA 4BO3A 4E12A 2GZ2A 4RB0A 1HDCA 4F6CA 2P5UA 2E82A 3RYRA 3OQBA 4S1VA 2XAFA 4JP3A 4D41A 5E20A 2QQBA 3RUHA 4BO0A 1GVJA 3J7AO 4HBLA 1U5AA 2XAJA 3T0YA 3F23A 4Q5SF 3LK7A 1BXZA 1ARZA 1DAOA 2Q2QA 3JQGB 1A7KA 1M67A 1S6LA 3D3EA 1C1XB 1HE3A 3FM3A 2Q50A 1VJ1A 4Z9FA 1LVAA 3ZMDA 4J43A 2B0JA 1BIAA 4KDFA 1I8TA 5I7FA 4HZFA 2GPTA 1PZEA 4RB1A 1XQ6A 1DPUA 3G1UA 4EJMA 7MDHA 1DRUA 2IRWA 3IJRA 2GO1A 4CMKA 4M87A 4M74A 3BMCB 3TWOA 1N1GA 2H6CA 1J2XA 3RKUA 4RF4A 1Z82A 4XQ9A 3PFWO 4E2WA 2NNNA 4HQEA 1OAAA 1R4MB 4CMEA 1M2WA 2UZKA 1EVZA 3CUQA 1U8FO 1G4DA 1EDZA 5I9MA 3OJ0A 3K0LA 2EJRA 1WKMA 2HK8A 1IXRC 1IB6A 3GPIA 2FMYA 1HDYA 1DDNA 1FDVA 1P4WA 2Y75A 1XSVA 1T2EA 1F14A 1RPNA 2D8AA 3N7UA 4DRYA 2Z3YA 2P4QA 4YFXF 4D43A 3QAHA 1HXHA 1BXGA 2GN4A 3E03A 1HE4A 2FPGA 3Q5FA 3OSUA 1T25A 2WV0A 3KCCA 2G76A 4WNCA 5TGDA 2JJYA 1LDGA 3OEWA 3UOGA 4IY1A 4HDVA 5AOVA 5C3MA 2UAGA 5IT9Z 5E17F 2QBYB 2VONA 1Z9CA 1PJCA 4ND2A 2M30A 1KQ8A 2KRFA 3AUSA 4D45A 3HOTA 3ONEA 3QP9A 1HYEA 4RF5A 3VPFA 2WYWA 3OOPA 3Q9VA 3GLXA 4UUVA 3V2GA 3BHMA 3WMWA 5H81A 3WTXC 4D3DA 2OP0A 3G3EA 1GD1O 4LFUA 1Y9AA 4PLVA 5L3GA 3L07A 4Q3EA 2P2SA 4R1UA 5HA5A 4DQ2A 2VZ8A 4M9SA 3VVBA 5C7LO 4A0SA 1MC5A 4HNGA 1GYRA 3G17A 2HDCA 5KVQA 3WQQA 1KEPA 1O89A 1S8NA 2VYNA 4HFJA 5KJ1A 2JHFA 1PX0A 2O3JA 4ZQGA 3ZWAA 5K6AA 2PD3A 2PGJA 4IGEA 5FD6A 4RVFA 3WNVA 1TI7A 4ALMA 1FJHA 1I32A 4NR0A 3EYIA 3G49A 3RBZA 1YGYA 1J9IA 5LGTA 1PQWA 5DDGA 2IA1A 5D8LB 2EGGA 4RVUA 3BMNA 8ADHA 3WGGA 4BQPA 2PH3A 5A2QZ 2IYOA 5CDTA 1X1EA 4WGGA 1R6DA 5DF1A 5CVJA 1W7PB 3K1MA 2VQ3A 4GVXA 5KCZA 4WK8F 1XR3A 4R1NA 2YV3A 4FFRA 1PS0A 4L9RA 5TJHA 4B4WA 3J81Z 1CF7A 1HYHA 2FP4A 4JCOA 2IA2A 3BHJA 1YO6A 1K3TA 1NAHA 3AI2A 3I59A 4BHBA 1TEHA 2PZLA 4Z0PA 3CZMA 4YJFA 4OSOA 3VH4A 4H7PA 3GAZA 3F4BA 3ROMA 3LT0A 2A07F 3P2YA 2H09A 1SC6A 4NDNE 3VTZA 1B7GO 1R1TA 1Z75A 1E0DA 4KP7A 4ZYGA 4Y6SA 2Z9OA 2AMFA 1V3VA 3PFFA 3D5LA 1FBUA 3RIHA 3WSVA 4BNYA 2IZ1A 5TT0A 4ZGWA 5ICGA 2D59A 3FR8A 3R3JA 4WLUA 2PN6A 1K78B 1TW2A 2UYYA 2LF7A 4J91A 1A27A 1AN9A 5ENVA 5IF3A 1I30A 1DB3A 2X9GA 4IDBA 4CLRB 3DO5A 2NLOA 4GLOA 1U7TA 1SFEA 1UB9A 3GW2A 3WGZA 4R3WA 2O6GE 4A0YA 1UCRA 3JD3A 1EMDA 3ZV6A 4J4BA 4EITA 4ESBA 4EJOA 1IRGA 4YJDA 5C5IA 2PK3A 1ZLJA 1B59A 1UZNA 2FSSA 2V65A 1B8UA 5AXCA 1WI9A 1IUYA 1BXKA 1GPJA 4CM3A 1LDYA 1NQ5A 1ZLKA 4BV8A 4YWJA 5L3BA 5KJFA 1PL8A 3I9KA 3V8KA 2RBEA 5AQ1A 2NVWA 4X54A 3PVZA 2BFAA 1WQ2A 1LNQA 3RFVA 3K1NA 5HLIA 1DIGA 5BPDA 1F1ZA 4YJHB 3TOZA 2FY8A 1HF3A 3E8XA 1FY7A 3PGXA 2FNAA 3GGPA 3FTNA 2XVCA 5I8WA 1V4RA 4I0BA 2YHIA 4YG2F 4GX5A 3C3XA 1I3KA 4G5HA 2BFPA 2QRKA 4DIFA 4U7WA 4EUHA 1PS8A 3G1TA 1YS4A 2PEXA 2QWWA 3KP7A 4BNZA 1L0OC 5J8CA 3DP7A 4G9YA 4BO4A 3ZU2A 2V6BA 4OOEA 5KVVA 4U8GA 4ESJA 4YIFA 1JVBA 1T4DA 3JV7A 3LQRA 4B4UA 3WWZA 4P4NA 5HM8A 3QE3A 1XU7A 1ZSNA 4BXUA 3JTGA 4IHTA 4P4LA 4EJTA 5U4QA 3C8MA 4MKXA 4HW0A 1VLLA 3JW4A 2QQ9A 1ENPA 4XR4A 3RCBA 4E32A 4P96A 2HCTA 5T8KA 1LSOA 3GQVA 1Z91A 4Y17A 3O26A 1WWKA 4CDGA 5THQA 2YFQA 3ZMZA 4WCFC 4A5NA 3GXOA 3LA2A 3RJPA 5THKA 1IN6A 2CSOA 5DOVA 4RPLA 1OZAA 4Z9YA 5FYDA 1MV8A 4XDYA 4D3FA 1DPRA 3M9AA 4L9NA 2FMLA 3VODA 3MZHA 3KM0A 3PHGA 4UEJA 1VL8A 4IXWA 2Q45A 2CWEA 4BMNA 2YY7A 5ERIA 4M6YA 5J8FA 2B37A 2I6TA 4TRNA 3OJLA 2FPPA 1O94A 4A6EA 3E3VA 4ZQEA 2Q0OA 3GO5A 3I4PA 3F8MA 3P9CA 3NDRA 2ZTVA 1PZHA 5ER6A 1VJTA 3QRWA 2DKNA 1EUCA 3K2EA 5G2OA 1T4BA 3DC2A 3FN4A 3MCZA 1VRWA 5F21A 2DUUA 4JLWA 4DC1A 4MINA 5GY7A 1IE3A 2GIVA 1IAWA 1JQBA 2JRTA 2VE9A 1SNYA 3ADOA 3K9QO 3TZKA 3U09A 4J4TA 2DFIA 2D1YA 5F1PA 2UUPA 4BGUA 4OSPA 4BHTA 1ZW1A 2EA2A 2HQNA 3K6JA 2J3HA 3U4IA 4W82A 4W7IA 2GSDA 5HOOA 1DPGA 1LDBA 4WASA 3ZU5A 2JL1A 3JQAB 5E1XA 1RI7A 1YBAA 1TNSA 3RASA 4CM4B 4I8XA 4D46A 4LCJA 1B1BA 1V8BA 3EQLF 3DZJA 3M2TA 4RVDA 3B02A 2W24A 5D5WB 3FXRA 3K9TA 1YYVA 2HKIA 2VNSA 3H3FA 3BZ6A 3BZUA 4Y67A 3H3UA 4PZCA 1NFRA 3B1FA 5ES3A 3COSA 4UULA 5AXDA 4XQCA 5AYVA 4DWVA 4A0ZA 4BNHA 2FMUA 5JDCC 1ZXLA 1EH7A 4DLBA 2A61A 5DCMB 1M75A 3QSGA 3ZU4A 3HUGA 3WTZA 4OJNA 5KJCA 2ZCUA 4YPOA 1ZUD1 3ROQA 2G7UA 2X1HA 1HE5A 1PR9A 2BE5F 3C3WA 3HQ4O 4QFCA 3H8VA 2XAGA 3SVTA 3R60A 2PZMA 4CL8A 3PGJA 1KGSA 2IW5A 1LEHA 2AXQA 5DD8A 1A4IA 1U6GA 4M89A 3GHYA 1LC0A 2D1HA 4EI2A 2X9NA 1YQXA 3PFIA 1E7SA 4NFYA 3ZHBA 1H2HA 4Y13A 2DBQA 2EJWA 3DAGA 1NAIA 3VH3A 5JMWA 3M1LA 4ITUA 1ZK4A 1E7YA 1YL6A 5JO9A 2BV6A 4QTZA 5DBIA 3GPDG 3U9GA 3UGKA 3GZ4A 2RAFA 5DP1A 4R1TA 3JTMA 2HZTA 4PGHA 4R79A 2H6EA 4YCAA 1XSDA 3W8DA 4DXHA 1BBYA 3D3WA 1HETA 2DU9A 1Y0UA 3R6SA 1I3NA 1K5HA 1SO8A 2YJZA 3JAMK 3I52A 3GZNA 3I9JA 2PQ8A 2YHUA 4M1QA 4HV5A 3V4GA 4JNKA 4QO7A 2OXIA 3KSDO 2H27A 1PJQA 5BSHA 5JC1A 4ALNA 4PRKA 4W9NC 3DBRA 3VC7A 2H9IA 5CG2A 5IXSA 2DTEA 3ZN0A 4RGUA 5JMPA 2CVQA 4J2HA 4CMIA 5CYVA 2XKOA 1YO5C 1L3LA 3I58A 1GQYA 3V7CA 1CGPA 4HF1A 1FDSA 3KUXA 4KWHA 4MEYF 3M7GA 4PLWA 2FU4A 3RIRA 2O03A 3OHSX 2HJSA 1IPFA 2AQ8A 3DV8A 2BD0A 1MJAA 4EJWA 1PDNC 2JZYA 2Q99A 2FR0A 3ZMSA 2COMA 4L0YB 1QBJA 1ZSVA 5LGUA 1E5QA 3C7JA 3BHIA 4Y8VA 1PIWA 1LJ8A 1TLTA 4MVJP 2YZ7A 1DXYA 4CODB 3QOPA 1YVEI 3O2PE 1A9YA 2WMDA 1T1RA 1NHGA 3QPHA 2XKPA 3HRSA 4RVGA 2X8LA 3GGGA 1NTOA 1VTNC 3MJTA 2C5EA 1RZ4A 1VSVA 2GERA 3PIIA 4IIVA 4LGVA 4ZRNA 5TRDA 1EK5A 4EJ6A 4MPDA 2EJVA 2VN8A 3F22A 3JYNA 3QJ5A 5B4UA 3GNSA 4FJ1A 2ZB7A 5K5QA 1KETA 2VHZA 4N5LA 4I7HA 3BTOA 3QW2A 3ITKA 1IPEA 1ONNA 3AAFA 2QYTA 5EINA 1YDWA 4R3NA 1PJ2A 1K79A 4FD3A 2Y05A 3DXJF 4JGBA 5FLXK 3CTMA 2ZIZA 5F5NA 4LISA 1RKXA 3E6AA 2IYPA 4O5VA 4MDHA 2F00A 4Z0HO 2RN7A 2E48A 4KICA 5HDNA 4BO6A 2OFPA 4P9FA 3BY6A 2HJRA 3ZPLA 3PLNA 4MVJI 5LEKA 4GGOA 1JN0A 3TOXA 2IZ0A 4CLOA 1BC8C 1Z6RA 3KSZO 1UAGA 1GZ4A 3PJEA 3Q11A 4NBTA 5IDXA 1R58A 1F4KA 1HSOA 4HA8A 5CDGA 5CFZA 4I01A 3MWDB 3JQDA 1KVTA 1MG5A 1FC3A 1U5TA 1DAPA 4IRHA 1E1MA 2D45A 4XQEA 4O59O 4CLXA 4GQAA 1D1TA 1U3WA 5BQTA 1R37A 1XA0A 1K6IA 4XGNA 4RGRA 1E92A 1JWBB 1O95A 4U6SA 4HQMA 4IVNA 1IOLA 3WR5A 1BI3A 3HSRA 1REPC 3CJNA 5CDSA 3QY9A 4CUKA 1ADCA 4CO8A 4J49A 4B8ZA 4CV3A 4D0SA 3NTQA 1NM5A 1USTA 3RC7A 4GKVA 2IVMA 4DLAA 3GNTA 2FRDA 1IRFA 1VM6A 1Z45A 1I33A 1NQOA 4IXAA 3WTVC 3QIVA 1ZYRF 5IAAA 2L54A 4UAGA 1U2DA 1ZZEA 2MH9A 2Y0CA 4IDEA 4JK3A 3RFTA 4N54A 4L75A 2ZKZA 1LTHR 4YBZA 1QR6A 2P9CA 3HSFA 4B4OA 3JSAA 3RKXA 3LA3A 5CLSA 4CHUA 3L77A 4M8SA 4FFOA 4EM0B 3BXXA 3ZNPA 4XRGA 3MQ0A 1BM9A 1JVSA 3VVCA 2VUSA 1D8JA 2EV6A 1ULSA 2BGCA 2YYYA 4N5NA 3UUWA 2ZYAA 3TPCA 1GAEO 3PEFA 3MWMA 1X7DA 5TNXA 2ZKLA 4QLCU 2WC2A 4DLLA 4E2YA 4OGWA 4IDCA 3WDSA 3ANNA 4BNIA 1YIOA 4ZQFA 4I0AA 2XHKA 4DBVO 2WE7A 3G0OA 3P2OA 3COAC 2V1UA 3DQVC 3P7MA 4ND4A 5EESA 1Q1NA 4HLYA 3O3KA 4YEDA 4YRBA 3VB2A 4B09A 4WCFA 2AE1A 2O7QA 1YLFA 3GFMA 3DFGA 4XGKA 3N4MA 1U2WA 4MNUA 2O3TA 2OZUA 4OO3A 1MKMA 1FYMA 2V7PA 2W2LA 1WAMA 3U0BA 2LSOA 2PD4A 1UZMA 3BPXA 3VEPA 3HB4X 1EE9A 2ISYA 3GUDA 1L7DA 3N58A 4NPCA 1CDOA 5CEEA 2CG4A 3LSYA 3WGHA 3EETA 1ODDA 1TBXA 2PFBA 5DV5A 1E5LA 1FDUA 1OOEA 3A28A 4A2UA 4Q3NA 5L45A 1YBVA 1AXEA 3OIDA 1ZEMA 3GFGA 1FYLA 4EQQA 4BKPA 5A9SA 4NIMA 4HDUA 4FT8A 4CMEC 4E30A 4TRMA 1UH5A 2M1BA 1GU7A 4ROSA 3GT0A 4RS8A 2NACA 1NFQA 4PLHA 2KJCA 1YJQA 1KERA 3KEQA 2Q1UA 3PQFA 2X7HA 3PXXA 4HX4A 2AE2A 3GFLA 1C14A 2OMEA 3GK3A 4MEXF 4DQUA 2G9WA 3B73A 4CQMD 5D6EA 5JYEA 2WYUA 4AD9A 2ZO4A 1O7FA 5A9RA 3D0SA 2HDHA 2VRCA 4TROA 3B70A 3LFKA 4UVDA 2J5QA 2R7DA 4Q9NA 3A1NA 4OHUA 9LDTA 1X7GA 3AFMA 4E33A 3IQDB 2HMVA 3KXDA 1QP8A 3ROKA 2MBFA 4GX2A 5DCFA 5CVIA 2B35A 2HO5A 2EWNA 1EBFA 5EJ2A 4QO8A 2D0IA 1F8GA 4HNHA 4FC7A 3V1TC 5L3DA 1WNTA 1H93A 1P0FA 5JDCA 4B79A 5JO0A 1FP2A 3DKWA 1H6BA 1Z7EA 3KVOA 4YR9A 2V1XA 2BHLA 3S55A 2AEMA 3GVXA 3L0DA 4BV9A 2ZTLA 4BQAA 3AY3A 4I5FA 1MD0A 4YDRA 2VWQA 2PJPA 5DDIP 1QSGA 2PFGA 3ABUA 5C7IO 5DEQA 2AQHA 4P4GA 5T64A 2Z5UA 2BLLA 4E31A 4KT5C 3WWYA 2NVUA 5HS8A 3CUQB 1PWZA 5MDHA 1WDMA 1P9LA 1O5IA 4WLEA 3RTRA 4FJ2A 3IC7A 5K6AC 2WTEA 2RCYA 4L74A 4OIMA 3GN2A 4MVJA 4HF0A 4D44A 2QQAA 4IDAA 1LDKB 2MH2A 4L18B 2PG4A 2YPRA 3BA1A 1XD7A 4FC6A 4EV0A 3SXPA 1QPMA 1NVMB 4BKOA 2IXAA 4FHTA 3ELKA 3WU1B 3FHLA 1PEDA 1L7EA 3FX3A 4A6DA 3PDUA 1BGVA 4OIOF 4R16A 3Q9SA 1TNTA 4M6XA 5D4SA 1I0ZA 1BXGB 3F6VA 2J3JA 3IUSA 2KJBA 2QIOA 4HP8A 3RWBA 3V8BA 4E70A 1QV7A 3ABTA 5TJ9A 4RPKA 5TJJA 4BNCA 1U8XX 2G0TA 2Q46A 1P45A 2X4GA 1OPCA 3WODF 5CJ9A 2E4AA 1UDBA 4AJPA 1ZJZA 4FOOA 3RROA 3R0IA 3GEZA 3H3JA 3RI3A 5U1PA 2R7FA 1DP7P 4R1SA 2NU6A 3JQ6A 1H0KA 3BMQA 5G0SA 2CW0F 1WSUA 3LAPA 3VDRA 4ZN6A 1IW7F 3ZCXA 1E77A 5DULA 3DBHA 1H9AA 1GV1A 2AHRA 1O3QA 4MKZA 2W98A
chains in the Genus database with same CATH superfamily
1KGDA 3HCNA 4Y6PA 1Y82A 4C20A 4IICA 3TTVA 3RUEA 1BC5A 4DMFA 5FI3A 2X6TA 4HQNA 2TMGA 3L2UA 4HB4A 3GTPJ 4FHEA 2YVKA 2QTLA 1C7FA 1AKYA 1GR0A 4L9TA 1DOAA 3BLYA 3ONNA 2ZMEA 1Y89A 2PA0A 4D82A 1GG2A 3BT9A 2IUFA 1BI0A 4X6UA 2GBYA 3WE2A 1KI2A 4ZOAA 2G1PA 1Q1HA 4UBOA 3KQTA 3W6OA 3Q41A 5JHFA 1JQDA 3VC1A 3L7CA 4OHPA 4G4JA 1UELB 3WQRA 4P3NA 1G64A 3IHTA 2LLKA 5M3MJ 3DULA 3MW8A 4XFJA 3OE7D 4RWEA 4AQYB 3W77A 3MWEB 2QRUA 1BL0A 3LECA 2L7MP 1ULHA 3K9CA 3HVKA 3ESWB 4LLNA 2VPLA 3P4XA 4FCCA 2ELHA 2H29A 3KLPX 4PYRA 3W3AH 1MVNA 4P3OA 4TV8F 1LC3A 4C01A 3CX8A 2VBGA 1TU3A 3HK2A 3GLHB 1WO8A 1A2OA 2CYAA 3TQSA 5DIZA 2TECE 3L1PA 4F96A 4MGKR 3H19A 2BSQA 5EJ6A 5AM1A 3DE6X 2I2DA 3QKIA 2VZ0A 1Q57A 4MPJA 2GK4A 3PBKA 1U6JA 2QM7A 2L0XA 4XLLA 1I3MA 3ILYA 4ZVPA 3KUKA 3ZVLA 2R97A 4MOWA 4PGFA 1UJ5A 2GHTA 4Z7OB 4UBKA 1NKTA 4X63A 1R36A 4C9YA 4GGGA 4PNPA 3H4VA 1UWLA 1HE2A 4B3RB 2XB9A 1JKOC 3X2SA 1J5YA 1NPDA 1Z3YA 3F6BX 3S2HJ 5KYXA 3HVRA 5IHPA 2NQ8A 5EXDA 2WWTA 2BHTA 4AUEA 1ULZA 2D5CA 1LQTA 2RKHA 3LYLA 3DOUA 4MVJG 1CZNA 1SM4A 4KDCA 2ZZMA 1QLHA 2JKYA 5B3SH 3LOCA 5J23A 1J7KA 4ASUD 2LY1A 3AUJB 1S8FA 4LECA 1ZY2A 1DDOA 1G2OA 1TVKA 4BBPA 1D1AA 2Q4BA 2WIKA 4IR7A 1Y37A 5B7PA 3JAKB 3QU2A 1RMQA 4ITVA 4MVJH 1J8YF 1IAQA 2C31A 1F0NA 5DNCA 4L2IB 4X1IA 4PZEA 1PKEA 5CX4A 3TW7A 1HZZA 1KC1A 2I8DA 4KIJA 1XTVA 3SHTA 2FUG6 3H5WA 3LDFA 1ATIA 3CZCA 1PQUA 2P79A 3P96A 2EK5A 1BOBA 4Q3AA 2P8SA 1R4MA 1EJ9A 3RYIB 1BWSA 4Y2RA 1XRMA 1FX7A 2EZTA 3LBYA 4RD3A 2JIPA 4IL5A 4R9SA 5DEOA 2KIMA 4MCHA 5JC8A 3B3JA 3H04A 1SQSA 2FPRA 5C1BA 5EGOA 1T36B 3ETGA 2CFCA 2ZM5A 3WYNA 2BFEB 4ZQBA 5FUXA 2J3EA 5IK2A 1B9MA 4GL4A 2OILA 2OCYC 5A3SA 2CFXA 4JP5A 2FXVA 1Y9ZA 4A5MA 1M2JA 3RK1A 4AG3A 4HDKA 2IC5A 4J6EA 3I0NA 3HDVA 2GYUA 3C6YA 4PSKA 3AI3A 4WOKA 3Q3VA 4ZT6A 4KO2S 2BHNA 1XFAA 2K85A 4LOKA 3DB2A 4EZBA 3AW9A 1VCHA 4RZXA 1BJZA 1CPYA 3ET4A 3SI7A 4LGYA 3WTCA 4JB3A 4MW1A 1EKXA 1H8HD 1O9BA 5EL0A 5LXTF 4AMBA 3PSHA 4HRYA 2FBKA 4FD2A 4GMFA 5FTWA 3HS3A 5HMLA 4B43A 2N75A 3L7NA 3F3XA 4BFSA 1GOTA 2FWAA 1L6IA 2MYUA 5B1SA 1OH7A 2XA2A 3K5IA 3F73A 1E58A 1CUBA 3SHVA 5CYPA 4IILA 1UP7A 1YQEA 2IU4A 3ORRA 1VL5A 1Z68A 3C85A 3PUXA 3EFBA 1TEZA 2C9BA 2R7NA 4AJHA 3LCMA 1YS7A 2FLWA 2HV8A 3WNCA 5BQFA 2LBPA 1NWCA 4OHCA 3LNTA 5AVQA 1C1DA 2OORA 2Z8YA 3RJTA 3DO6A 5G40A 1MW8X 1KK1A 5FBWB 5C35A 4DCGA 4PCUA 3S28A 1K4KA 1W1IA 3WZLA 4FMCF 1J2EA 3L6DA 3CR3C 2KPMA 3DDWA 4CM4A 1W76A 2CQ7A 4CHTA 2V6GA 3QFFA 1HDGO 3HSYA 2ZI5A 2CE2X 1OIXA 4WF2A 4MWZA 2V7QA 5KOHB 1NY5A 5JYDA 2GXUA 1ON1A 5AOCA 4MV1A 1HURA 1IHPA 4JUDX 3L7BA 1N5IA 2ODTX 2NG1A 2G5CA 3U39A 2JJ1A 1NPYA 1I10A 2H1IA 3MELA 2EFDB 1JRLA 4NMWA 1PJRA 1X80A 1LH0A 3D7RA 2AZXA 3TSZA 1X38A 4IHAA 1OMOA 2FCAA 3SG0A 2Y0DA 5AOAA 2XKBA 1WU7A 3NPMA 5BNTA 2BPOA 2HEGA 3L05A 4MR7A 3OH8A 3WOHA 5AI5A 3D0QA 5DM4A 1NN1A 2WVAA 5IG2A 5DHPA 2AYXA 3OYMA 3QEOA 5TMBA 2DBRA 4WBNF 2CVZA 3SMVA 5K0GA 3MS4A 3ULKA 2YNMD 2XVYA 4WXDA 4MWEA 2QVLA 4XRSG 3FPHA 1USUA 4JVMA 3K0KA 3BL5A 2JASA 4M55A 3ILXA 4R3UC 1FFDA 2XAHA 4R41A 1ZN9A 4BLUA 4PANA 3GFIA 2XUPA 4KQMA 4BRUA 1TE2A 1B0UA 4E21A 4M76B 2J3MA 1OGIA 1T2UA 2OR3A 1HSTA 1PFVA 4N4OB 4FCYA 4MVJF 4YJ2A 2OENG 4PLGA 3NRBA 1Z0SA 4QUKA 2EWWA 1U8CB 3C15C 1HCRA 3K9GA 4F2HA 5KYWB 3NBKA 1OREA 3B8EA 3QUTA 4YRLA 2D06A 3PHBE 3WLAA 4D25A 4UUPA 2D5LA 5IH3A 1OBFO 4GMGA 4NK4A 3DWEX 3CLRC 3CE9A 3U26A 4C0SA 2JA7J 2R9VA 4BY9E 5CM8B 3N8NA 4OKNA 3V4LA 4G5SA 1ZR4A 4HFRA 2X1LA 3RIEA 1LJUA 3UFXB 1TYEB 1N5JA 1OCZH 1A2KC 3MTGA 3ENVA 1GUUA 4BFYA 1WHSB 2WYVA 4EIWA 1JPJA 1MRSA 3ZDQA 4IJKA 7MHTA 3BCBA 3EF1A 4TXLA 1VLVA 1WZ2A 1Z0XA 4CI9A 3MZYA 1WNFA 2WOOA 3TDUC 3DYIA 4M0EA 2RH8A 1N4AA 4P7KA 2WDZA 2IDZA 3KVYA 2B34A 2WWYA 5DHTA 5J4VA 2C61A 1PWHA 3GCMA 3W5BA 3VNUA 4BQQA 5KTOA 3SHFA 3T7IA 2EDCA 1KSJA 3HN2A 1MMSA 2XHEA 1DJQA 3ZIDA 1UM8A 2FSVC 3IV6A 1ZGWA 1K89A 3TI7A 3LW7A 1FY2A 2UZ1A 2JLYA 5FWYA 1DIAA 1OU0A 3IR5A 2EG5A 3A9TA 3IODA 1W0JD 4JVLA 1S2DA 1ISGA 2G80A 2RKOA 4EQZA 4OLHA 4KXMA 1WY5A 2BC9A 3L1IA 4R7TA 1C9DB 4A2QA 1XA3A 3NKFA 4C05A 2WHRA 3GB9A 3QENA 5CGZA 4KHPB 1JL3A 1G18A 3WGTA 4CICA 4QBGB 2ECQA 2OK7A 3M8KA 1Z08A 2XNCA 1I3LA 1C4WA 1FRZA 5AVTA 1BX1A 3ZE9A 3RU9A 3N05A 2IZ7A 3D4LA 5AM3A 4TWBA 1ZNXA 3V4SA 1DRVA 4ML3A 1U2TA 3FMOB 5AJUA 1A9RA 1EGVB 2ZYSA 1SCIA 1GEEA 3BXHA 4ZHQB 1MO6A 5DIFA 2H5JA 2IEGA 1Z9BA 1FNMA 3F21A 4WJLA 3QJYA 1H66A 2IS6A 1HUQA 2NGRA 1J7JA 2I91A 5JNLA 2JGEA 4JUCA 2ZREA 1E2EA 3I9V6 1LPBB 2VP4A 4K26A 5A9TA 3OSGA 1SCBA 3EXEB 4ZYVA 3FUXA 2BP7B 5CNMA 3V6MA 4BXOB 3WTSC 2GXGA 1A76A 4D4KA 4CIDA 2VKTA 3LBFA 2XC7A 4DB2A 2WHXA 3SEFA 4OQPA 4P2BA 2C3MA 4YQYA 2GNOA 3ZKWB 1RR6A 2OXEA 1GCGA 4I50B 3SHWA 1X77A 2K86A 5TRTA 5C7OO 2G88A 3CNQS 2CO5A 4MEAA 1WLSA 4PC3A 2WLSA 3G8CA 3A0UA 4CF4A 2CWDA 5CDHA 3PCXA 4QC2A 3UNGC 3WRXA 3UAZA 2WIAA 1RAEA 1XQ9A 3JU3A 1JR6A 5I01A 4TS9A 1EZ4A 4MHGA 3BERA 4LX8A 3CLUC 4DAEA 5KU1A 3GGDA 2X5NA 3WLQA 3HLKA 5H7XA 3V1UA 3D2CA 2PR2A 3ER8A 4GGPA 2NX2A 1E1RA 3K9HA 3H2IA 3VZBA 3QRFF 5DNWA 4U2BA 3QX3A 2PL5A 3VPDA 2BJWA 4KQKA 2GF2A 4KQIA 2M1ZA 4M9UA 2IE0A 1JHFA 5CVRA 2OJED 1M0TA 2VKQA 3BAZA 3CEAA 2C0CA 3VJRA 3A02A 3EE6A 2V45A 3S2DJ 3UJAA 1VOTA 3AG6A 3B9PA 3FSGD 1WJEA 2GO7A 5KREA 2ICWG 4GBED 3CWZA 4NBSA 1WEKA 5FFZA 3OCYA 4A2PA 1U7DA 1SFOJ 2IVFA 3A6FA 2I62A 2I6UA 3X1YA 1U2SA 4CM9D 3H2KA 4B6JA 2X76A 2M9HA 4NCNA 5GAHJ 1LLCA 4FN4A 3R6GA 5EJFA 2X2FA 2E37A 3BGOS 1J70A 4Q9IA 2GAAA 3S1NJ 5FRMA 3H5IA 1C30A 1MOSA 1DDIA 5I7AA 3RVDA 2FF4A 2YHSA 1G6Q1 1TT0A 4YJGA 2HJVA 1A04A 1FTYA 3A8TA 2O8XA 1JLLB 4UTRA 1P92A 3MEXA 1GKLA 2R7LA 1NOKA 1MJGM 2B8JA 5ICSA 3VUEA 4NC9A 3NEPX 3GRAA 4MJ3A 1TWGJ 1NXOA 1QG0A 4YRMA 2ZBEA 4JWKA 5B6IA 3HYIA 2R1TB 4R1OA 3S93A 1RZRA 3TW8B 4NBKA 2IU6A 1CQZA 4E1BA 4BWFB 5EG0B 2CMHA 1DXHA 4EPXA 4DLNA 1P1IA 4WXPA 1U6KA 5ECDA 1EWRA 5JCXA 5LNK1 4BJ6C 5DWDA 2ANBA 2KM1A 3OZGA 3D7NA 3EUAA 1GZVA 2A9OA 2HRRA 4LQ4A 5T6BA 5CB6A 4LC0A 4GWGA 4HLCA 1O8BA 2ZBRA 1XT6A 4HWRA 2I6SA 5TQ2B 4URXR 4N76A 5L7WA 3WZMA 4CIXA 1DX9A 1PWXA 3N0RA 4LZJA 4V0OA 1XZCA 4RKYA 1UIMA 4H1TA 1E17A 1ZQ1A 3COZA 2X8AA 2EB7A 2X48A 3L0BA 2GJ9A 4TV7A 1H2WA 5F2EA 2E7ZA 4BXFA 3P2IA 3W2EA 3OPMA 4TVBA 4FZ3A 4GMDA 4KPEC 3OLYA 1NU6A 4F85A 3T9EA 3HBFA 2MD5A 2GAIA 4JR0A 3VSEA 4WERA 3HB7A 4BCDA 2ODWA 4G3XA 2A05A 4GDFA 4H3VA 4WZZA 4DDKA 1EDOA 3NHLA 2J6BA 2EFWA 3FHNA 5DASA 5TARA 2X9DA 2A5JA 6REQB 1I01A 5D8DA 4XIFA 3OLCX 3PPIA 4EY8A 1EBBA 1YQTA 1A97A 2ES4A 1P2DA 1X2NA 3KQNA 4OWRB 5AW6A 5ALFA 4BASA 4KWCA 1OXMA 3T0YA 1TYDE 1T8RA 1DAOA 2KPOA 1Q3HA 2NAFA 1MQSA 2EFGA 4JLPA 4FYIA 4WZAA 5KHAA 3V1NA 1JPVA 4RE5A 4ZT2A 3EXFA 4LNUA 4BJTA 2P0YA 1W75A 3I4LA 3BCRA 1HC8A 5B1EA 2FX3A 3UAYA 3QAHA 1GQFA 2JI8A 1RE1A 1EJ0A 4X6YA 4RTRA 1JHZA 2WIDA 4AKEA 2M30A 4RNCA 5H81A 4QOHA 1R6XA 2VP5A 2NN3C 4H4KC 5CXSA 1KE2A 2I7CA 4LRYA 1LCIA 4XVCA 3NETA 2F9FA 1TWAJ 1FJHA 4O4IB 5FKMA 2IYOA 5JZSA 1PUIA 4M6VA 3WGVA 1NC3A 2P9YA 2YV3A 3D5EA 2OG2A 3SBXA 2DQZA 2BM0A 2DA3A 3PGVA 3CZMA 3REQB 4M1MA 4Y2PA 3BTLA 5EFZA 2I2WA 3OPYA 3L5OA 1Z0ZA 3LT5A 1SPBS 2ZJOA 4R98A 3WGZA 4H3KB 3TLGA 2V65A 1Q1BA 3QMMA 3RTAA 3GLFA 2WYIA 5GQSA 5DLEA 3E70C 7REQA 1DQUA 5BPDA 2FUNB 2PJRA 3QPBA 2RHMA 2QT1A 3BH7A 2VPXA 4OOEA 2QTNA 4JHLA 4CCYB 3KR9A 3WHLA 3JW4A 4V2UA 4ZVTA 4FU0A 1X6VA 2ZIFA 5DBEX 5DNYB 3T1VA 5DE3A 2YFQA 4WCFC 5D1NA 1TAGA 4XKCA 1KOFA 4G0YA 5JHHB 2Q0OA 4IVQA 3T3EA 4REQA 2ZTVA 2EAUA 3X44A 2VE9A 3M7IA 2DFIA 5IARA 2GSDA 5T4EA 4OD0A 1ZIOA 2VNSA 2Q6IA 1A50B 3JAMA 4GMXA 5E4YA 3CV3A 4CCJA 1BR2A 3TZLA 2QR5A 2VNIA 3DKYA 4GKKB 2JGFA 2DA7A 3MHPA 1R88A 2ZJAA 2PPLA 4LDRA 2HBQA 5EYPB 5DGDA 2F90A 4HC4A 4Q21A 7GPBA 3MMXA 4L51A 2P8JA 3I58A 4HF1A 2AQ8A 4FNAA 3GRVA 2B5OA 5J47A 2FQQA 3KOZA 4EJ6A 4F5WA 1C9MA 2YX1A 2VN8A 5B4UA 1FEZA 2ZB7A 2VHZA 2HY7A 3BTOA 2CBZA 2ATXA 1UADA 4FD3A 3AJAA 4KICA 4NU8X 3BY6A 5AM5A 4TQUS 5LP6A 2J31A 1I39A 1E9AA 4PC6A 4IDOA 3VR6A 1YRBA 1PDOA 4WGFA 1RFLA 4JYAB 1Z7LA 1L4YA 2R7RA 1D5WA 1HMYA 5TISC 3AVWA 2I6XA 2XSZD 1OFVA 4F3TA 5IAAA 1L9KA 4LG3A 3OUZA 1K86A 2BZ1A 4CHUA 1KK2A 4RHXA 5CA0A 4DWOA 4YCLA 2BGCA 1E2PA 4LBWA 3IAM1 3A3NA 3Q8WA 1A0OA 4R8LA 1KJZA 4YRBA 4ZMRA 1TC1A 1M83A 1CZKA 1P18A 1IRXA 3QYEA 1PK8A 4NPCA 2HCRA 2PFBA 1E5LA 2R5ZA 3KOXA 4UE3S 2PQ0A 4G36A 4HDUA 5HJ2A 2Q0QA 1CDZA 3JR7A 5EIWA 1NFQA 4Y9TA 2OMEA 2D7DA 2VDUE 3GFOA 3ZI4A 2J5QA 3O9MA 4TYMA 2J3QA 1KXZA 3NHRA 3AR3A 4HZGA 1BW6A 1F8GA 1NUQA 5EJ7A 4BVFA 1Z7EA 4ARVA 3VI3B 1LJLA 4YDRA 4UPVA 5J3JA 4DGWB 5HS8A 1O5IA 4WLEA 1CJTC 4RADA 2PMWB 4J94A 3MWLA 4R16A 1QV7A 4N0MA 2P9JA 3AR9A 1HFWA 2ECFA 5A62A 1UDBA 3O0DA 3RROA 2H2DA 4Z4GA 3GBVA 4PSAA 1CUWA 3DMFA 1WJDA 1RIIA 2FOKA 1CUAA 1Z0JA 4EJFA 1PAUA 1XPOA 2CN1A 1EJ2A 4R5HA 5D5QA 3OT4A 2P4WA 2BBOA 3EDMA 1YW8A 2GFQA 3C4JA 1QCCA 3CX4A 1EE2A 1VQOI 2CLKB 4YGXB 4EEFG 4HUTA 3ZJ4A 3T7AA 3PSIA 5J1YA 2I33A 3VR5H 1I24A 2Q1SA 1RM0A 1GPWB 1R0RE 4QG3A 4FFLA 4WCDA 3AG4H 3CMYA 1S7CA 3IUOA 2ZPTX 1T10A 2A9FA 1BEZA 3WYDA 2DQLA 4Y9RA 2STTA 2EGHA 3IIMA 3FPAA 2DMQA 3TYXA 4EB0A 4KN6A 2BM1A 1WG8A 5DM0A 3FDZA 4K9PA 4MV7A 1MFPA 1X4OA 3ZPXA 3EY9A 4GSKA 2XCTB 5DGTA 4OV6B 4V24A 3UCEA 4UFNA 2UYOA 1US8B 2PLWA 5JQGF 1X7YA 2YHIB 2PKWA 1JBEA 2OPHA 1OBHA 1CZHA 2XV4S 1QH8A 1JKRC 1NMZA 1JFLA 5TVKA 2UXNA 4IS2A 4LLGF 1ILEA 1PZNA 3C1TA 4RHUA 1GKIA 4PG4A 3N9IA 2DH5A 2O0YA 1E79A 2WT8A 5GV7A 3GLKA 3FRIA 3OM9A 1S8OA 2RGAA 2V79A 2FPPB 4QBHA 2GEKA 1I4OA 3ZMVA 4KMRA 3R7WB 3U62A 4RZ2A 5IYZB 4C6RA 2CGEA 2L4MA 3F78A 1NUUA 3UV7A 3JALA 2ODBA 3PHJA 3OTWA 5LD2C 3D8BA 4QREA 3HHPA 3S2EA 1N8TA 1ABEA 1MB9A 4BFXA 3JWJA 2X1CA 1KKLA 1A5AB 3PTLA 3MJEA 4MS4B 1W4LA 3KB6A 5K7HA 4WN9B 5DCLA 5J2TB 2O19A 4MQBA 3AG5A 4KE8A 2OY0A 1HTBA 4WNYA 3NNDA 3WU2C 1L4HA 1L7QA 4NEHB 3HSEA 1AKUA 4DUZB 2DPDA 3U4GA 1EAYA 4ND5A 3D4NA 3TG2A 1GQSA 1R5GA 4BO9A 1FUIA 4OGFA 1J22A 2IXTA 4PPYA 1SOAA 2VOEA 4NBWA 2GZHA 1S3GA 2YU3A 1PU2A 4YWHA 4W5OA 5H5JA 3OYCA 1LPPA 1W0KA 3PUZA 2KI5A 5LU8A 1UK6A 4KU4A 2PH7A 4I02A 1ZH0A 3ZMTA 1UKZA 2DMTA 3RVKA 5LOVB 3HNPA 1J1IA 2QZJA 4OEHA 4S35A 1WMBA 1B41A 3B1XA 4IJAA 4RSHA 1AGNA 3FPLA 3BEDA 4QQNA 4Z0TA 4QXQA 1ORRA 1T9BA 3TS1A 4X65B 4V1CI 1WV0A 5BSRA 3HDHA 3QPTA 4DMLA 4J2TA 3DT9A 3G7SA 3MTIA 3DVRX 1Y1RA 3OV8A 4S2UA 1UM9B 3L8EA 1H0MA 2VYND 3VPGA 1L5RA 4MQEA 1DO0A 1IRIA 2VJPA 2BY0A 2IK8A 1E1YA 1T0UA 4JJFA 3W4KA 3PLRA 4O2AA 2CUEA 1THGA 4WCFB 2FR8C 1XALA 4OXXA 3FIJA 3B5EA 1AKQA 2GQ0A 5F76A 2LZ0A 4DMRA 3SX4A 3EWNA 3FI9A 3EQ2A 1M66A 3M3PA 2O8KA 1FMWA 4DQ0A 1Q3TA 3IVMA 4RS3A 3NLLA 1NI3A 3EGXB 3EPKA 2I7XA 3T5XA 1R5HA 2FN3A 2P3OA 2JC3A 2F5CA 1Z4LA 1Z77A 4FB4A 4KQFA 2G1UA