1J0RA

Crystal structure of the replication termination protein mutant c110s
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
114
structure length
114
Chain Sequence
TGFLVKQRAFLKLYMITMTEQERLYGLKLLEVLRSEFKEIGFKPNHTEVYRSLHELLDDGILKQIKVKKEGAKLQEVVLYQFKDYEAAKLYKKQLKVELDRSKKLIEKALSDNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The impact of single cysteine residue mutations on the replication terminator protein
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Replication
molecule keywords replication termination protein
total genus 42
structure length 114
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02334 RTP Replication terminator protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1j0rA00
1KYWA 1LNWA 4ZH4F 5HDKA 3WE3A 5F1RA 2ZXJA 3I53A 3DQVC 1P4AA 1XSVA 2FU4A 2ESNA 3BDDA 1R5HA 4Z2YA 4JK1X 4D0PA 4KFCA 1XCVA 1IUYA 3GX4X 2ETHA 1RUOA 1ZARA 2JSCA 1BI0A 4Y15A 2A6EF 1SD4A 1B1BA 4ZYHA 5HDGA 3J80K 1OYWA 1F4KA 1B9NA 2IP2A 3HOSA 1FPQA 2G9WA 1DP7P 3BPXA 3U1DA 5D5XB 4I98B 3JAMZ 2QQBA 5HS9A 3COAC 4Q5SF 4ASNA 1SAXA 1SD6A 3TQNA 3QRFF 1YO5C 1USTA 3FXUA 5BQTA 2R3SA 2F5EA 3SHFA 2MLGA 4OINF 3RPUA 2ZO4A 5ED4A 1IXSB 3F6OA 4ON0A 1K79A 1XDSA 1ZN2A 5LBQA 1J0RA 3RTRA 2STTA 5HLHA 2BE5F 5FD5A 5F64A 3ZMSA 1PP7U 1YW8A 2M8EA 2XVCA 3EYYA 3KEQA 3WG9A 2RN7A 5CVRA 5CJ9A 1K78B 2D1HA 1RZ4A 1REPC 2NS0A 5ILUA 4Q48A 1QBJA 2FQ3A 2V6CA 3JAMK 5JHUA 4L9TA 5EEHA 1HSTA 5LHGA 1HKTA 5FLXK 2FBIA 1YIOA 3U2RA 4OOIA 3DEUA 3R4KA 5D4RA 1KU9A 2H6CA 2Y75A 1IRGA 2HKXA 2IA1A 3IKTA 4DNCA 1YW9A 2JPBA 2QENA 3EDPA 5TJJA 3ABUA 4G7OF 1U6GA 2ZNZA 1UB9A 3O3KA 1EH7A 2KKOA 2ZBKA 1FOKA 1FBUA 1FSEA 2CFXA 2EFOA 4KNYA 3R0AA 3I5UA 1FLIA 4YFXF 2XIGA 4UHTA 1KQ0A 1P6RA 2QWWA 4MEYF 1XGSA 2JRTA 2Z3YA 2KJCA 2HYFA 3WTUC 4RGRA 4OIQF 4FX4A 5CVVA 1VTNC 4I2OA 1IXRC 4L0ZB 2O0YA 3IC7A 5D6FA 3E5QA 1IRFA 3HIFA 4HBLA 5K5QA 3DP7A 4F7ZA 3RI4A 5LRSA 1J75A 2BEOA 2VT3A 2LNBA 2UZKA 4CYDA 3E5UA 2BGCA 3HRMA 3QP6A 6PAXA 4M72A 4A0YA 1P4WA 1R58A 3J80Z 1J5YA 1Z7UA 1BJAA 4UUVA 3LA2A 4LK1F 1IN6A 5L3DA 4AIKA 2P4WA 1YW7A 5KK1A 1UCRA 1D8KA 2DO7A 1U5TC 3L00A 3K1MA 4M9XA 2CW0F 4KN7X 5E17F 2HEOA 2RVCA 3M1EA 1MZBA 3TO7A 1XGMA 2OD5A 2P5VA 5BMZA 2QBYB 4EV0A 2BBYA 4HF0A 2Z99A 1IN4A 2PG4A 1FY7A 4M9SA 4LD5A 1XMAA 3BJOA 4EVIA 2EJRA 3G3ZA 3MZHA 3GO5A 1L0OC 1QZYA 2VC0A 5FD6A 4AWXB 2MBFA 5BPDA 3EETA 4LG0B 3KP5A 2HYGD 5BOXA 2XROA 4PGHA 3VODA 1BOAA 3DV8A 2YR2A 1BIAA 4UXNA 1W7PA 3RKXA 2HDCA 5D5WB 1T0FA 2EFQA 3HHHA 1CF7B 2IA2A 2P5KA 3TO6A 1P2FA 1Z05A 3E6MA 3P9CA 3BOQA 4GO1A 1FC3A 4ETSA 3HTSB 5D8LB 3SZPA 5ICFA 1YFHA 2NYXA 2ESHA 2TDXA 1EH6A 1KU3A 4Q47A 2AXLA 4XSXF 3KCCA 4WXCA 5ILSA 2EFNA 2PN6A 4CXFA 1H9TA 1R22A 5D5VB 2XRNA 2H09A 4JBAA 1EV7A 2W24A 2P7CB 4HX8A 5E20A 2EB7A 4I01A 1YYVA 1XGOA 1YS6A 1LEBA 3CO7C 5FLXZ 3MFKA 4GYGA 1R5GA 4EGYA 1SD7A 3CLOA 4G6DA 2F5FA 3QU3A 1KQ8A 2HQRA 1T98A 1JGSA 2FNAA 1IN7A 3JTGA 4ENJA 3O6BB 1DUXC 3T0YA 4A0ZA 1WRJA 5DDGA 1WSUA 2Z9OA 2XHKA 3SQNA 3FXQA 1I27A 2M45A 3GYHX 3WGHA 1ZG3A 3BJ6A 2OQGA 2GXBA 3WTSC 4HYEA 1Y0UA 5FFZA 2UXXA 2XV4S 5HOOA 3CTAA 2G7UA 2DW4A 1IF1A 4I02A 1F5TA 4EM1A 3W6KB 1NHAA 3I0TA 4HDVA 1IZ1A 1R23A 1LB2A 1I1GA 1LDKB 3LSTA 5D4SA 2VE8A 2VBZA 1F1ZA 3O2PE 4HLYA 3PQJA 1O7FA 2HR3A 3ZN0A 4BXUA 5LLQA 1TW2A 4WX9A 2STWA 5DUKA 3WU1B 4N9HA 3ZMDA 1PP8F 2QZ8A 3T8TA 3TDUC 4LLLA 4YFKF 5DD8A 4XLPF 5L3CA 3E3VA 4EMSA 2GA2A 3BROA 4WWCA 3TOBA 3JW4A 3I59B 3WTYC 5BS6A 1BM9A 4ZYDA 4QWQA 3J7AO 3HRUA 1DPRA 2B0LA 2VN2A 3V4GA 5JI6A 4L0YB 1XN7A 2GZWA 4OMZA 2DPUA 2NRAC 5D8KB 3ZPLA 2JPCA 1W5SA 1Q1HA 4K2EA 4UVCA 3TO9A 2ISZA 2OA4A 2CGPA 1LJ9A 4KN4X 2Q0OA 4XRFA 2NAZA 3GEZA 2O3FA 1FWZA 2DK8A 3RKYA 3GXOA 3ELKA 2HS5A 3FHZA 3WGGA 4YFNF 4S05A 3ZN1A 1PUEE 2IPQX 3GFIA 3BP8A 2DQRA 1K78A 1T6SA 2IW5A 3REOA 4RGUA 2MH9A 3NRVA 1U5TB 4LG0A 5H6QA 4LLNA 5HLGA 3ZQ7A 1ON1A 4WCGA 5LGTA 1MD0A 4O5VA 4LK0F 1ZH5A 4R1HA 1R36A 1S7AA 1ZGJA 4KYWA 1HSJA 3MZYA 3BPVA 4R79A 4AIHA 1RUNA 3ROUA 3C18A 3AAFA 4A5MA 1BI1A 3I64A 2O61A 3QU6A 5JVTA 1KGSA 1I5ZA 5BPIA 2P8TA 4WF2A 4LMYA 1FBSA 5J8FA 1O3QA 1V4RA 2AS5F 1TNSA 2H6BA 2O6GE 1SFEA 4R8HA 2K02A 5K1YA 2HKOA 3RIRA 1STZA 5L3EA 5A2QK 1LQ1A 3KP4A 2IRFG 3J81Z 4ZZDA 4IRGA 1OPCA 5J6XA 5IT3A 5ERIA 2OZUA 5E8GA 3OOPA 1B9MA 2QUFA 2H27A 4GCVA 4H0EA 4UV9A 4A2UA 5CVIA 1BI3A 4U0WA 2JZYA 3HSEA 4M73A 1KQ9A 3MAJA 3FM5A 3ECOA 3F8NA 2K86A 2WWYA 3I54A 4RAZA 4LB6B 3V7RA 2X4HA 4L5IA 5DCMB 3CDHA 3MWMA 3T1BA 2COMA 1HKQA 3SXYA 4P55A 5D5UB 4PGGA 1ZRFA 4BNCA 2DPDA 3N97A 2CO5A 3JSPA 5FGMA 1D5VA 3V7SA 5CVUA 4RAYA 2LF8A 3SZTA 4MQVA 4NHJA 2XASA 4P96A 1XDUA 5LRRA 4Q4ZF 3JSOA 2XKOA 5FO5A 4GGGA 4PDKA 4L9VA 1OKRA 2YU3A 3TDZC 1I1SA 3OV8A 1BI2A 2V79A 3KLNA 4HA8A 4FHTA 4A6EA 2PI0A 2RV8A 3GFLA 2X0LA 3CUOA 2CG4A 3GVAA 3T8RA 2HZTA 4OIRF 1G3TA 4PCQA 2MLKA 4ENNA 3WODF 3VB2A 1FNNA 1SFUA 1Z91A 3FMQA 3KP3A 2RKHA 1QNTA 3ZMUA 1WKMA 2VBYA 3JTHA 1TQIA 2ELHA 1U78A 1TLHB 4O6JA 2FNPA 4A6DA 4G9YA 4PZJA 2KIFA 4Y17A 2IJLA 3GW2A 4L9NA 1F9NA 1YLFA 2CYYA 3FXRA 5E18F 1KU2A 2DAOA 1DPUA 4XBFA 4EJVA 3DPLC 2XAHA 1A04A 2DBBA 2P6TA 2FF4A 1BN5A 5L3BA 2LSOA 5AONA 5J8CA 3KETA 3IWZA 3I4PA 2P6SA 4A12A 4RB1A 1MDMB 3DPTA 1LVAA 1E2XA 3W6JB 3K0LA 4I0BA 4KDPA 4M74A 1U5TA 4RB3C 2O8XA 2OZ6A 4L5JA 5KVRA 1QQIA 2FMLA 1ZHFA 4WK8F 4U0YA 1HW1A 2RGVA 2E7XA 1PDNC 1ZRDA 1IXCA 2VT2A 5JR3A 4EGZA 3Q5FA 1W5TA 3H3ZA 4YIFA 4HV6A 1BC8C 3IWFA 2VONA 2HOEA 2IA0A 3WTXC 2ACJA 2F2EA 5D6EA 2HTJA 3V8LA 3GZ5A 3PFIA 2V1XA 1FX7A 3IKVA 1O3RA 2XAJA 3FM3A 1P92A 3DXJF 3H92A 2FE3A 1OR7A 1QPMA 3Q9VA 2L4MA 5DEQA 1HXDA 5TRDA 2DLLA 2EFPA 4MQ9F 3F3XA 3QOPA 4IJAA 4HF1A 2OU2A 2GQQA 2M30A 4HDUA 3M8FA 3KP7A 2MH2A 4JQFA 5E8IA 4DQ2A 4IHTA 5CYVA 4E70A 3B02A 4CO8A 1MDMA 1TNTA 3R0JA 5E1WA 2ZFWA 1TTYA 3VOEA 4KUMA 4FT8A 2VE9A 1JE8A 3R61A 1BC7C 1WWXA 4RS8A 1R7JA 2UXNA 3ZMTA 1FP2A 5EEGA 2Z33A 2K4BA 1S6LA 2GAUA 4BHPA 5HDNA 4RGSA 1D8JA 4UVBA 1UHMA 4LFUA 3I71A 3F23A 2Q2EA 2L02A 3V8KA 4IRHA 3FWEA 1JHHA 3ZMZA 3F22A 1I6XA 2PEXA 1Z6RA 1FT9A 1ZYRF 2QYOA 3FMRA 1IN5A 4EJWA 2VC1A 4HQEA 4UVAA 1MJAA 3P9KA 3E5XA 2K4JA 1TQPA 1ZG5A 1T39A 2VODA 2QQ9A 2PMHA 2PFBA 2LDUA 1UFMA 1OMIA 2M87A 1J9IA 1FP1D 3I58A 4ESBA 1ZGAA 3RDIA 4NQWA 3KP6A 3GZ6A 4QLCU 2ZKZA 3HHGA 3KLOA 3D0SA 4L9JA 2J5OA 1R1VA 1K6OA 4GYIA 2VBWA 4CDGA 1W4MA 3HRSA 5L3GA 4P9FA 4IRIA 2L3DA 4XLNF 2HWVA 3F6VA 5LGNA 1G4DA 1ODDA 3RYPA 4ZZLA 2W25A 4AVPA 5LHIA 4XSZF 2A6HF 4L18B 2RDPA 2GXGA 1HKSA 2EA4A 3S2WA 2KIUA 3TKYA 2EA2A 2A68F 5FB2A 4EM2A 1G3YA 2RQPA 2F5CA 1TW3A 2PQ8A 1OYYA 2L54A 1EH8A 5LEKA 1W7PD 1S7OA 5DYMA 2E7WA 5JFRA 2BYVE 4WXHA 3RKWA 4ESJA 4MEXF 3BJAA 3GFJA 4RB2C 3C3WA 4M71A 2DQLA 2ZMEA 4I09A 4M9ZA 2L01A 1Z6TA 1BIBA 2L4AA 2M5WA 4S04A 3WTVC 2EV6A 2QM3A 3RJPA 4BQAA 4KA4A 4HAMA 2CQKA 1B4AA 2PMUA 4KIBA 2WTEA 2Y48A 4BAYA 4A0XA 3I59A 2E1NA 4RB0A 1Z9CA 3L09A 1TQMA 2UWMA 3E6DA 3DF8A 3C1DA 3FZVA 1IN8A 3CO6C 1MKMA 1HW2A 4EJUA 1J59A 1HBXG 2O03A 2DU9A 1GVJA 5LEJA 2KJBA 4U7BA 3F21A 3LQRA 3LAPA 2YPRA 2D45A 3V8JA 3M9AA 1C0WA 4IXAA 1XGNA 2EFWA 1FYKA 2YX7A 2Q8KA 4M6XA 2W57A 4OMYA 5ICEA 3LQQA 2QQAA 1ONVA 4ZYGA 4I0AA 4ZYEA 3Q9SA 3SFZA 2FOKA 1U3EM 2ADUA 1FYMA 3QAHA 2FRHA 4LLGF 3IHUA 1RNLA 3LAJA 3ABTA 1XSDA 3HTUA 4MNUA 3VEPA 1G3WA 5K5OA 2ZMEB 5LHHA 3K2ZA 3NEUA 1ZAOA 2E1CA 1RIOH 3HYIA 1LEAA 3R6SA 4KT5C 4HW0A 3MCZA 2IT0A 3U9GA 3BWGA 2XAGA 3TOAA 4KMFA 3DKWA 2FXAA 3P7NA 2RC4A 1E17A 3C7JA 1KYZA 1USSA 1V3FA 2EK5A 3QPHA 4KIFA 2MD5A 3B73A 4OU0A 2XAQA 3J81K 1WQ2A 3EUHA 1L3LA 1XCBA 4UV8A 2F5DA 1CF7A 2FBKA 2XKPA 1LDJA 3T5XA 1J2XA 3HSFA 1Z1DA 2DT5A 3HUGA 4AD9A 2GIVA 4YIIA 3P9IA 3WTZA 3KE2A 3GF2A 3R60A 2R7DA 2Z5UA 3E97A 4BHBA 2QVOA 3WU0A 2IVMA 4G6QA 2P5LC 3DFGA 1HQCA 4ENKA 3L2CA 2FBHA 4HX4A 4LB5A 3RPQA 5DV5A 1XD7A 4HX7A 4IF4A 4Y13A 3K1NA 5HS8A 3H3UA 2OBPA 3K1PA 2NNNA 5DCFA 1YS7A 4MTEA 4B09A 5ICCA 4HZFA 2GA1A 3GUDA 2Y0MA 3WTTC 2WV0A 2RNJA 1IAWA 3GLXA 2JTVA 1W7PB 2HQNA 4BH9A 3KZYA 1B6AA 2A3SA 1GHCA 1K7AA 2EV0A 4HLXA 4CHUA 3M7GA 1S8NA 1YTYA 3KFWX 3ISPA 1T38A 1ZG1A 3WTWC 5DUIA 1TBXA 4N0BA 3GFMA 3BZ6A 3WE2A 2W85A 4HOBA 3D5LA 2R7FA 2PLYA 2G7HA 1R00A 2DFIA 2OAZA 1FSHA 4N9IA 2FSWA 1KA8A 3WGIA 1U2WA 3L7WA 3HRTA 4A5NA 2EV5A 4EJOA 2PJPA 1XSXA 4U0VA 2LF7A 1MJ9A 3LWFA 3FF5A 3L9FA 1CGPA 1QO0D 3EQLF 3V7CA 3M8EA 3ECHA 2HGCA 5A2QZ 1O3TA 5IT9K 1QGPA 2M1BA 3ERED 4U7DA 5H20A 4RGXA 2XGXA 1ZLJA 4HF2A 4OIOF 4IPAA 5FFXA 5E1ZB 4UNOA 1FBQA 2A5YB 5L3FA 1UHWA 5IT9Z 4NB5A 1RI7A 3KP2A 2ZNYA 3ZMVA 2DTRA 1O3SA 1P4XA 5H6RA 1ON2A 3F8MA 5CLSA 4P5OA 4MGRA 4BYYA 4OIPF 3BY6A 1G3SA 3CUQC 1IW7F 5K5RA 1D3YA 4MHGA 3MEXA 4FX0A 3ULQB 2ZJ2A 3CUQB 3RYRA 1S3JA 4HV5A 1SFXA 3CUQA 3K9TA 1MGTA 4ESFA 4LJZF 3MQ0A 3E6BA 2KIMA 1JXSA 2J5PA 3HOTA 1ZRCA 2VOOA 1JHFA 1XB4A 3CJNA 3TGNA 1B59A 2XAFA 5F6FA 2YX4A 4KMUX 1R1TA 1WI9A 2LKPA 2A07F 1R1UA 1SMYF 2MA3A 1AOYA 2CWEA 4BHCA 3KEOA 2JT1A 3F8FA 5ICGA 1FYLA 2GWRA 2VBXA 2W84A 1GXQA 4GXOA 1ZREA 3HSRA 4YG2F 3LA7A 1FZPB 2BV6A 1GXPA 3GWZA 5DCMA 4G7HF 4LGWA 1YG2A 4G94A 3IL2A 3ML6A 4P9UA 3EYIA 1KU7A 4WXDA 4M6YA 1ULYA 2A69F 2KRFA 2V1UA 2FA5A 3IRQA 3F72A 1QZZA 4U88A 1YQAA 1X3UA 3LFKA 2P7VB 4EM0B 4G8XA 4B8XA 2K27A 3LA3A 5HVQC 2VXZA 1G6NA 3KZZA 1U8RA 3VFZA 3E6CC 1ZLKA 4O3MA 1HW5A 3F8BA 1LDDA 3F8CA 2NNYA 1DDNA 4EJTA 2CSOA 1XMKA 2A61A 2D2WA 1OYIA 2WC2A 3K69A 3FX3A 2DK5A 1AWCA 2QLZA 3PQKA 4CZZA 2XUBA 5DD4A 4HQMA 1H9GA 4IHSA 4EQQA 5ILVA 2C6YA 2MC3A 4I7HA 2DI3A 5E1XA 1BBYA 3FMSA 4CICA 4CGZA 2HFHA 4KICA 5HS7A 1H0MA 2K7LA 2FEZA 1SMTA 1T2KA 2EWNA 2ISYA 1O57A 5HLIA 4MTDA 4TV7A 2H94A 4G7ZF 2FMYA 4AIJA 2OQRA 5AIPA 1O7LA 3NQOA 2V1DA 1MJBA 2ZCWA 5CVJA 3N4MA 4ENMA 2YSRA 2HTSA 2PBIA 3IRRA 1SD5A 2D1VA 4KIGA 5LGUA 2QBYA 3G73A 3QPTA 1S29A 5AIQA 4IVNA 2VOPA 1J7KA 3ZP5A 3QP5A 2V9VA
chains in the Genus database with same CATH superfamily
1KYWA 1LNWA 3CZ6A 3HC7A 4C9YA 3OSFA 4M3GA 5GP9A 4ZH4F 5HDKA 2GLOA 3H9QA 3S2DJ 1X3WB 3WE3A 5F1RA 4F91B 2ZXJA 3HOYJ 3I53A 4AC0A 1HDDC 3DQVC 1P4AA 1XSVA 4ZJZA 2FU4A 2CUZA 2ESNA 5F08A 5E3LA 3BDDA 2R93J 4IOAF 1JKPC 3BR0A 1R5HA 3QOEA 4Z2YA 2B7EA 1RKTA 1VQNI 1A6QA 4JK1X 4D0PA 1OLTA 4KFCA 1I6HJ 1XCVA 1IUYA 4IX7A 3GX4X 2ETHA 2DA6A 2NVXJ 3MKWB 1RUOA 1A31A 1ZARA 1NG7A 2FX0A 3HOXJ 2JSCA 4I76A 2B9SA 1BI0A 1T33A 2N8GA 2A6EF 4Y15A 1SD4A 2BHYA 4MFEA 2Y9ZA 2EIMH 1B1BA 4ZYHA 5HDGA 3J80K 2XDVA 1OYWA 1ZGWA 4IZZA 1I50J 3RQIA 2QA4I 1F4KA 1B9NA 2IP2A 3HOSA 1FPQA 2G9WA 2JA8J 1E3HA 4XN0A 3K70C 3KX2A 3E1SA 3SDBA 1DP7P 3GTJJ 3BPXA 3U1DA 5D5XB 1UAAA 2BOLA 4Z6YA 3J7ZI 2MW8A 3S1RJ 4I98B 3JAMZ 2R7VA 1SVLA 2WAQA 2QQBA 4BQOA 5HS9A 3COAC 4ZTFA 4Q5SF 1HC8A 2E19A 4ASNA 1SAXA 1SD6A 3TQNA 4UUSA 3QRFF 1YO5C 1USTA 3CESA 3FXUA 2KRHA 2R3SA 2F5EA 5BNGA 5BQTA 2LC2A 2OPTA 1W0TA 3SHFA 1MBJA 2MLGA 3PSIA 4OINF 1NK2P 3RPUA 4JOMA 1QU3A 2ZO4A 3GTKJ 3AL0C 2DODA 4CCMA 3G4SI 2NVYJ 5ED4A 1IXSB 1WH5A 3F6OA 3CCEI 4ON0A 1K79A 1XDSA 1ZN2A 5LBQA 4LIUA 2R7ZJ 3OYMA 1J0RA 9ANTA 2D5VA 3RTRA 4FASD 2BY3A 5HLHA 2STTA 1MNEA 3AL0B 3BTCA 2BE5F 1RESA 5FD5A 1BL0A 5F64A 1H88C 2R5YB 3ZMSA 1PP7U 3BR2A 3M4OJ 2Z16A 1YW8A 2M8EA 2O9LA 2XVCA 3EYYA 3KEQA 1IRXA 3WG9A 3PNVA 2DYRH 2RN7A 5CVRA 4F3QA 5CJ9A 1K78B 2D1HA 2GOXB 1RZ4A 1YI2I 1REPC 2NS0A 5ILUA 3DBHB 4Q48A 2LY1A 2ELJA 1IDZA 1QBJA 2FQ3A 2V6CA 3JAMK 3JRGA 5JHUA 3DTIA 4HNUA 3DKXA 4L9TA 1WGXA 3GLLA 5EEHA 1HSTA 2R7UA 5LHGA 1HKTA 1TWAJ 1OJLA 3LSGA 5FLXK 2FBIA 1YIOA 3U2RA 3OL4A 4OOIA 5F04A 3DEUA 2R7SA 3R4KA 2K3FA 1KU9A 2H6CA 2Y75A 5D4RA 2HKXA 1B72B 4V19K 1YJNI 2IA1A 2DA5A 4A3IJ 3HG9A 3IKTA 4DNCA 3CJTB 1YW9A 2JPBA 2LKXA 3KYDB 2QENA 3EDPA 5TJJA 1YRNB 3ABUA 1JTXA 4G7OF 2MG4A 1U6GA 2ZNZA 2HPIA 1UB9A 3O3KA 1EH7A 4BQNA 4GDFA 2EZIA 2Y31A 2KKOA 2ZBKA 1FOKA 1FBUA 3JR9A 1FSEA 2CFXA 2EFOA 2FUG2 1AKHA 4KNYA 3R0AA 2VPRA 1WPKA 3I5UA 1FLIA 3CMYA 4YFXF 2XIGA 4UHTA 1KQ0A 1P6RA 2QWWA 2LOOA 2K9NA 4MEYF 5B66C 5EYRA 2KL4A 4CZCA 1XGSA 2JRTA 5B1AH 2Z3YA 2KJCA 2HYFA 3WTUC 1IO2A 4RGRA 5F0HA 4OIQF 4S0HB 4FX4A 3IV5A 5CVVA 1VTNC 4I2OA 2PJRB 1IXRC 5GTIC 4L0ZB 4YELA 2EH3A 2O0YA 3IC7A 3MKZA 3DTKA 2KT0A 1ACIA 1ORKA 1LFBA 5GADJ 2X48A 5D6FA 3E5QA 1IRFA 3W2AA 2GM4A 5KAIC 2ID3A 3DCFA 3HIFA 4HBLA 1SANA 2F4MB 5K5QA 3DP7A 4F7ZA 3RI4A 4XORA 2GOMA 5LRSA 1J75A 1MMDA 3OYKA 1G59A 2BEOA 2VT3A 5M5YJ 3FIWA 3F9KA 2LNBA 2UZKA 2LK2A 4CYDA 2M8GX 3E5UA 4AYBN 3HEFA 2BGCA 1N77A 4E7HA 3HRMA 2CQNA 3QP6A 2DA1A 1DP3A 6PAXA 3LSPA 2IGMA 5GAGJ 1Z3YA 4J19A 4M72A 4A0YA 1P4WA 1R58A 3EUHC 3J80Z 1XX5A 1VF9A 1J5YA 1Z7UA 1BJAA 2UV1A 1HCRA 4UUVA 3LA2A 2NOJB 4LK1F 2P81A 1IN6A 3M8JA 3QYEA 4E7JA 5L3DA 4AIKA 2P4WA 3ESWB 1YW7A 5KK1A 1UCRA 1IGNA 1D8KA 2HDWA 2EZLA 1U9OA 2DO7A 2IS4A 1U5TC 5EGOA 3L00A 5IY5H 2E36A 2LMDA 3K1MA 3BQYA 4M9XA 4F93B 2CW0F 3BCBA 2A5WA 4KN7X 5E17F 2HEOA 2RVCA 1BA5A 3M1EA 4XKCA 1MZBA 3TO7A 1XGMA 2O5RA 2OD5A 2P5VA 2R7QA 3E7LA 2ME6A 4XICA 3HOVJ 2R0QC 3E0JB 2NXNB 5DS9A 2LFBA 5BMZA 1U0JA 2QBYB 4BJ5C 4EV0A 3V42A 1QHGA 2BBYA 4HF0A 2Z99A 1IN4A 2PG4A 1FY7A 1JTYA 4M9SA 4LD5A 4QSHA 1XMAA 4A3DJ 3BJOA 2KP6A 4EVIA 2EJRA 3G3ZA 4BXFA 3MZHA 1QA6A 4E7LA 3KZIC 3GO5A 1L0OC 1QZYA 2VC0A 5FD6A 1LUJB 3HXLA 1X1AA 1Q1VA 1R5ID 5B5EC 4AWXB 2MBFA 2QF7A 2F48A 3EETA 5BPDA 4LG0B 4LG3A 3KP5A 2HYGD 2JMWA 5FROA 2BY1A 5BOXA 1R49A 2IEKA 2HOSA 2XROA 4PGHA 3VODA 4ABZA 1BOAA 3DV8A 3TW6A 1SFOJ 4CYCA 2YR2A 1BIAA 4RA2A 1W7PA 2DA3A 4UXNA 2R5ZB 2LD5A 3S1MJ 3QPLA 3JRAA 3RKXA 4F52A 5D5WB 3CCSI 1T0FA 1DQUA 2JN6A 2EFQA 2L9NA 2HDCA 3HHHA 1CF7B 3ZXSA 1K83J 4B3XA 5EDNA 2IA2A 2P5KA 4BE0A 3TO6A 1P2FA 3E6MA 1Z05A 2VKEA 3P9CA 3BOQA 4GO1A 1FC3A 2CS3A 3C2GA 4ETSA 2X85A 3HTSB 5D8LB 3SZPA 2JRMA 5ICFA 1YFHA 2NYXA 2L7KA 2ESHA 2KIQA 5B3SH 2TDXA 3DPUA 1EJ9A 3A4CA 2YU9J 1VQ8I 3RZOJ 1EH6A 1KU3A 1MMGA 4Q47A 1BJZA 2TRTA 2AXLA 2AO9A 1T08B 2Y69H 4XSXF 3KCCA 2F4OB 4W97A 3ZQIA 1SVMA 4WXCA 5ILSA 2FD5A 1EA3A 2EFNA 3G71I 2PN6A 1MMAA 1AKHB 4CXFA 1H9TA 2XAUA 1R22A 5D5VB 3L2RA 1QZEA 4ANJA 2XRNA 2H09A 2W00A 5B1BH 4JBAA 3FXLA 2R7TA 1EV7A 3L2UA 2XSDC 3WHBA 2W24A 2P7CB 4HX8A 3BZCA 5E20A 2EB7A 4I01A 3OYGA 1YYVA 1XGOA 1YS6A 3H1CA 1LEBA 1KZHA 3LL7A 2LKSA 2XRLA 3CO7C 2JVGA 5J1RA 3QYFA 5FLXZ 3MFKA 4GYGA 5K7ZA 2BY0A 2OCEA 5JLXA 1R5GA 4EGYA 1SD7A 3W2WA 1RR7A 3CLOA 5HNHA 4G6DA 2F5FA 2HI3A 3QU3A 1IRZA 2DMNA 3LSJA 4BE1A 3K6GA 5C3EJ 3C2BA 1KQ8A 2HQRA 4ITVA 1T98A 1JGSA 2FNAA 1MMNA 2ICWG 1IN7A 3JTGA 4E7KA 4FE7A 2B63J 4OAZA 4IHVA 2F4IA 4ENJA 3O6BB 1DUXC 3T0YA 2E2HJ 1D0YA 4A0ZA 5FJ8J 1WRJA 2IGKA 5DDGA 3DTEA 4PJJA 1WSUA 2K9QA 2Z9OA 3HOZJ 2XHKA 3SQNA 3Q0VA 2AQFA 3FXQA 2VQLA 3K4KA 4YIRX 3CCVI 1APLC 1I27A 2M45A 4RMNA 4XRSG 3WGHA 3GYHX 2MC4A 1ZG3A 3BJ6A 3VPRA 2OQGA 3OIQA 4D5FA 3FK7A 2GXBA 3OR2C 3KPHA 3WTSC 2EPFA 4N4OB 2VKVA 4HYEA 1JGGA 1JT6A 1Y0UA 3A03A 5FFZA 2XV4S 2UXXA 2KISA 5HOOA 4XOTA 4B47A 1MH4A 2OCCH 3CTAA 2G7UA 2DW4A 3IH3A 1IF1A 4I02A 4PSWA 3TL4X 4BEHA 1F5TA 4EM1A 3W6KB 4DW6A 3HGGA 1LFUP 1NHAA 3I0TA 4XKVA 4HDVA 2GIZA 2MSYA 1K4TA 3KIOA 5CQEA 1IZ1A 1R23A 2V26A 1LB2A 1I1GA 1LDKB 4PJLA 3LSTA 3VYTB 1N78A 3CJQB 5D4SA 2VE8A 2VBZA 1F1ZA 3O2PE 4HLYA 3PQJA 4YEJA 1O7FA 2HR3A 3ZN0A 4BXUA 5K7FA 5LLQA 2DJIA 5CQGA 1TW2A 3L2QA 4WX9A 1ZQ3P 2STWA 2IS1A 2BVLA 5J1YA 5DUKA 2E71A 4N9HA 4BL0B 3SZGA 3WU1B 3ZMDA 2E1OA 1W0UA 2HVSA 3H5NA 1WFXA 1PP8F 1YIJI 1TZLA 2QZ8A 5IP7J 3T8TA 3TDUC 5M3FJ 1Y1VJ 5C4XJ 4LLLA 4UUSB 4DBQA 3OSGA 1AA7A 4YFKF 5DD8A 4QPOA 4XLPF 3S1NJ 5L3CA 3ABKH 3E3VA 4EMSA 2IXSA 4A3FJ 3OYBA 1M1EB 2GA2A 1JKOC 3BROA 4WWCA 1VQLI 2BHZA 3CLQA 1NH3A 1U9NA 1Y8QB 2XPVA 3TOBA 3JW4A 5GAHJ 3I59B 3WTYC 3PIOF 3H9GA 2R7OA 5BS6A 1BM9A 1V55H 5GAEJ 4ZYDA 2PX9A 5KAFC 4QWQA 3J7AO 3HRUA 1DPRA 4XLAA 2B0LA 2VN2A 1WVRA 3D1NI 3M1CA 3V4GA 1ZTRA 5JI6A 4DIQA 4L0YB 1XN7A 3QWLA 1I39A 2GZWA 4OMZA 3F0CA 2DPUA 4IQJA 2NRAC 2BW3A 1W36C 5EZGA 3IH2A 2Z1DA 5D8KB 3ZPLA 2LP0A 3S2HJ 4LITA 1XMXA 2JPCA 1W5SA 1Q1HA 4K2EA 2KPMA 3O8GA 4UVCA 3TO9A 5IOYA 1JJ6C 2ISZA 2VI6A 2K85A 2OA4A 2CGPA 3AG1H 2A05A 1LJ9A 1YE9A 2IGNA 4KN4X 1RRJA 2Q0OA 2OUMA 4XRFA 3PFYA 2ZXHA 2NAZA 2ECCA 3GEZA 4NNJA 2R92J 1OCOH 3K70D 2O3FA 1FWZA 2DK8A 3BR5A 5IP6A 4ZDLA 3RKYA 2JA6J 3GXOA 3ELKA 2HS5A 3FHZA 2QSHX 1XPXA 1YITI 3WGGA 4KITB 1FJLA 3CC2I 4YFNF 3HKZA 2KZVA 3CDLA 3LSHA 4S05A 3ZN1A 1HF0A 1PUEE 4HRIA 2ZSIB 4L5EA 4BJTA 2IPQX 3GFIA 2EILH 3BP8A 4CCKA 2DQRA 1K78A 1TT5B 2ZFUA 1HOMA 1T6SA 2IW5A 3REOA 1JKRC 4RGUA 2MH9A 3NRVA 1U5TB 4LG0A 5H6QA 4LLNA 3PSFA 5HLGA 3ZQ7A 1ON1A 1QHHD 4WCGA 5LGTA 1FOXA 1MD0A 4O5VA 4LK0F 1ZH5A 1BR4A 4R1HA 1R36A 4RAFA 1S7AA 1ZGJA 1UZCA 4KYWA 1A36A 1HSJA 3FDYA 2BXZA 3MZYA 3BPVA 1X2NA 4AIHA 4R79A 4II3A 2JUGA 3ROUA 1RUNA 2E1MB 3A0HC 4XNFA 2P0WA 3C18A 3I3LA 4D7MA 3AAFA 4A5MA 1R71A 1RETA 1BI1A 3CCRI 3I64A 4ZDPA 5E3MA 2VPLA 2O61A 5FLMJ 3QU6A 5JVTA 1KGSA 1I5ZA 5BPIA 1OQYA 2P8TA 3FXJA 4WF2A 4LMYA 1FBSA 5J8FA 1O3QA 3JRCA 2XF6A 1V4RA 2BXYA 2X6OA 1TNSA 2AS5F 2H6BA 1Z3XA 2O6GE 1SFEA 1ERDA 4R8HA 2K02A 2DT6A 2KQRA 2HKOA 3RIRA 3VYSB 5K1YA 1STZA 2L0KA 5L3EA 5A2QK 1LQ1A 3KP4A 3KEYA 4OAYA 3NWTA 4ZZDA 3J81Z 3L1PA 4IRGA 2IRFG 1MBKA 1X1DA 2CV0A 1OPCA 5J6XA 3JRFA 5IT3A 2M7AA 5ERIA 2OZUA 4Y3OA 4FE4A 1ETWA 3OOPA 5E8GA 1B9MA 3OL3A 2QUFA 1JUMA 3K4BA 2H27A 5K7HA 4GCVA 3M3YJ 4H0EA 4U87A 1IDYA 1A5JA 4UV9A 3CQZJ 2EIJH 3OOUA 4ZYAA 4A2UA 5CVIA 1BI3A 1UMQA 4U0WA 5IYDJ 4IKFA 2H8RA 2LR8A 4ZC3A 2JZYA 4RM3A 2JA2A 3HSEA 4A3BJ 4E7ZA 4M73A 2Y2ZA 1B8IB 1KQ9A 3MAJA 3FM5A 3ECOA 3F8NA 2K86A 2WWYA 2E5NA 3GZNB 4RBOA 3I54A 4RAZA 1OCTC 3PUBA 3RKQA 1B8IA 4LB6B 3V7RA 2CMPA 1AU7A 2PMZN 1TC3C 2X4HA 2ELKA 4L5IA 1LE8B 5DCMB 2WY7Q 3CDHA 4M3DA 2HXIA 1SC7A 3UKGA 3MWMA 3T1BA 3S17J 2XB5A 3OS1A 1YJ9I 2KDZA 2H1LA 3A2KA 4BXXJ 2COMA 4DYQA 2DA2A 2VJ4A 1HKQA 2HU9A 3SXYA 4P55A 5D5UB 2VKDA 4PGGA 3CC4I 1ZRFA 4BNCA 2DPDA 2ZMEC 4CA0A 3N97A 2CO5A 3JSPA 4BDYA 4PFOA 5FGMA 1D5VA 2TCTA 3V7SA 5CVUA 4XLCA 4RAYA 2H8WA 2LF8A 2DMPA 3ZGKA 2WY8Q 3SZTA 4MQVA 3BT9A 4B3AA 2L9RA 4IOCF 2RNGA 1T8IA 1VNDA 2M0MA 4NHJA 1SVOA 4BKXA 2XASA 5IP9J 4PFPA 4P96A 2XPWA 1Z67A 5FLVA 2CUFA 2GBYA 1E3OC 2EIKH 1XDUA 5LRRA 2E5ZA 4Q4ZF 3JSOA 2XKOA 4X0GA 1PYVA 1XTAA 2VXDA 3BC8A 5FO5A 4M3BA 3GCMA 4GGGA 4RLQA 4PDKA 3WG7H 2V9KA 1ZR4A 4L9VA 1OKRA 2YU3A 3TDZC 1I1SA 3OV8A 1BI2A 3OYFA 2V79A 3ZQHA 3JREA 3KLNA 4HA8A 4N4NB 4I99C 4FHTA 4A6EA 4B48A 2PI0A 4XMYA 2RV8A 5F1JA 1Y1WJ 3ZOBA 1S9HA 3KYCB 2W4SA 3FKIJ 3GFLA 2X0LA 3CUOA 4Y33A 2CG4A 3ABLH 3LNQA 5FKKA 3GVAA 3T8RA 2HZTA 4XK4A 4OIRF 1G3TA 2QKMB 4PCQA 2FOWA 2MLKA 1VZ0A 4ENNA 4A3GJ 2ZJRF 2JVHA 1UHSA 2L9VA 2V1NA 3WODF 3VB2A 2JA7J 3H35A 1FNNA 1SFUA 1Z91A 3FMQA 3KP3A 5DTDA 2CW7A 3G2BA 2RKHA 1QNTA 4I6ZA 3ZMUA 4E7SA 3A02A 2QSFX 2CV1A 4PJMA 2DOAA 1WKMA 5F0CA 2VBYA 3JTHA 1TQIA 2EINH 2ELHA 1U78A 3WHCA 1TLHB 4O6JA 4HSTA 2X1DA 3ZQQA 3FKJA 2FNPA 4HG2A 4KJZA 3AG4H 4A6DA 4G9YA 4PZJA 2KIFA 4Y17A 2KMUA 3JRHA 4KISA 2IJLA 3GW2A 3CF5F 2E60A 1Y39A 1SEUA 4L9NA 1F9NA 1YLFA 2CYYA 3FXRA 4NBQA 5E18F 3H0DA 4HEA2 4EATA 1MBHA 2RAEA 1KU2A 2DAOA 1TWGJ 1DPUA 4XBFA 4EJVA 1TP4A 1K6YA 3DPLC 2XAHA 1A04A 2DBBA 1ZK8A 2WB1A 3HDDA 2P6TA 2ZC2A 4E6KG 4FCYA 2ECBA 2FF4A 4PK4A 1BN5A 5L3BA 2LSOA 5IYCJ 5AONA 3DEEA 2HXOA 2DA7A 2ID6A 3OS0A 1ETKA 3WU2C 2HNHA 5J8CA 3IWZA 4KT6A 4D5CA 3I4PA 3KETA 1IG7A 2P6SA 4A12A 3S3NA 4RB1A 1MDMB 3DPTA 5IOZA 1LVAA 4IO9F 2K5CA 1E2XA 3W6JB 2OC6A 3K0LA 4I0BA 4AVZA 2MYSA 4KDPA 4M74A 4W1UA 5E79C 1U5TA 4RB3C 2O8XA 3CDIA 1O4XA 1X3ZB 2OZ6A 4L5JA 5KVRA 2X1CA 1QQIA 2W48A 2EQRA 2FMLA 2WBMA 1ZHFA 4WK8F 4U0YA 1HW1A 2DYSH 4M6VA 4XONA 1UG2A 2RGVA 4X6AJ 2E7XA 4HSRA 1PDNC 1ZRDA 1ZELA 1IXCA 3Q0UA 3MVPA 2VT2A 4CH7A 5JR3A 2EBIA 3DU5A 4EGZA 1ETOA 3UNGC 4BY7J 5FRMA 2BVMA 1W5CC 3Q5FA 3ERMA 1W5TA 3FBIB 2WB1N 3H3ZA 4YIFA 4HV6A 1BC8C 2ME0A 3IWFA 2VONA 2HOEA 2IA0A 3WTXC 2Y0SN 3ONQA 1D1AA 3K4JA 4E4HA 2ACJA 2QQ8A 4CCOA 1R4NB 1N25A 2F2EA 3TMOA 4IHWA 5D6EA 2HTJA 2WAQN 3V8LA 4DBRA 3GZ5A 3OYLA 3PFIA 2V1XA 1FX7A 1QVTA 2NOGA 5F0FA 3IKVA 4HNVA 2E35A 1MSFC 2GXAA 1O3RA 2XAJA 2ZB9A 3FM3A 4XLHA 1P92A 1VQ5I 3DXJF 4A3JJ 3H92A 2FE3A 1OR7A 4C30A 1QPMA 3Q9VA 3BR3A 2CUJA 2L4MA 1DU0A 1LPQA 2V9PA 1FMVA 1HXDA 5DEQA 5M3MJ 5TRDA 1X2MA 2K9SA 2DLLA 2XPUA 2EFPA 4MQ9F 3F3XA 3QOPA 4IJAA 1OFCX 4XOPA 3GTGJ 1V54H 4HF1A 3JRDA 2OU2A 2GQQA 3S3OA 2M30A 4A3KJ 4HDUA 3M8FA 4PJ0C 3KP7A 5EEAA 5FKLA 2MH2A 4DYRA 4JQFA 4B1RA 3K4MA 4XLEA 4XN3A 5E8IA 2O8KA 3GTPJ 4DQ2A 4IHTA 3H9JA 5CYVA 1TWHJ 4E70A 3B02A 4MFDA 4Y7NJ 5FRNA 4CO8A 1MDMA 3MN2A 1TNTA 4XM3A 3R0JA 4AYBA 5E1WA 1MBEA 3ZQCA 3DU6A 2ZFWA 1TTYA 3VOEA 3HJEA 4CYCB 4KUMA 1DGWY 4FT8A 2VE9A 3PM1A 5J47A 1XC5A 1JE8A 3R61A 1BC7C 1WWXA 1ETYA 3CJRB 4RS8A 4XKBA 1R7JA 2UXNA 3ZMTA 3ZRGA 1FP2A 5CKTA 3PNTA 3BG9A 5EEGA 2Z33A 2K4BA 1BW5A 1Z21A 1S6LA 1RKWA 2GAUA 4BHPA 1Y6IA 5HDNA 3DLLF 4RGSA 1ITYA 2HVRA 1D8JA 4UVBA 1UHMA 2VJIA 1R9TJ 4LFUA 3I71A 3CF2A 4C3HJ 1D0XA 3F23A 2Q2EA 2L02A 2XF7A 3V8KA 4IRHA 4D1QA 4X1EA 3CP2A 1KONA 3FWEA 1JHHA 3ZMZA 2M3AA 3A0BC 3F22A 3Q0WA 3X2QH 1I6XA 1UG0A 2WAFA 3ZCOA 1N75A 5IPAA 1R6RA 3TP3A 2JUCA 2PEXA 1Z6RA 3J7AY 1FT9A 1QPIA 1ZYRF 4M3FA 3GBGA 3CMMA 2QYOA 2COBA 3FMRA 1IN5A 2JQ7A 5EGOB 4EJWA 1OR7C 1WJCA 2VC1A 4GRIA 1X1BA 1G2HA 3I9V2 4HQEA 4IHYA 4UVAA 1MJAA 3MKYB 3P9KA 2DJNA 2X6XA 3K4NA 3E5XA 1MIJA 2K4JA 2ZXIA 1TQPA 1ZG5A 1T39A 1VQ9I 2VODA 2QQ9A 2PMHA 2PFBA 2R7WA 4BE2A 2LDUA 1TWCJ 1UFMA 1NG6A 1OMIA 1S7EA 1UJ8A 2M87A 1FP1D 1J9IA 3I58A 2XGCA 4ESBA 2DT7B 1ZGAA 3RDIA 1POGA 4NQWA 3KP6A 3GZ6A 3BZKA 4MO7A 4QLCU 2ZKZA 3HHGA 3KLOA 3D0SA 2FJ1A 4L9JA 4UB6C 3DBRB 2ZSHB 1QRYA 1MH3A 1X1PA 3OWTA 2J5OA 2NS7A 1R1VA 1K6OA 4GYIA 2VBWA 1Y8RB 1I3QJ 1CQTA 4CDGA 3D5RC 1W4MA 3RSNA 4D7NA 3ZQLA 1IRGA 3U21A 3HRSA 3ZQGA 4FETA 2L5QA 1QVUA 3S14J 5L3GA 4P9FA 4IRIA 2L3DA 4CUGA 3Q3SA 4XLNF 4V2GA 2HWVA 2CUEA 4E7IA 3FXKA 1W1WE 3F6VA 5LGNA 1IJWC 1G4DA 1ODDA 3RYPA 4ZZLA 2W25A 4AVPA 1ETQA 5LHIA 4XSZF 1VQ4I 2VUMJ 2A6HF 4L18B 2RDPA 2GXGA 3ABMH 4XRMA 1HKSA 1K61A 2EA4A 1WJ5A 3OYEA 1H89C 2LBFB 2KIUA 3S2WA 3TKYA 3DEWA 2EA2A 3I4MJ 2A68F 2Q2EB 5FB2A 2HVQA 4EM2A 3K7AJ 3LMMA 1G3YA 2RQPA 4BEHB 4JX6A 1FTZA 2EZHA 2JSPA 2WAEA 2F5CA 2R7RA 1TW3A 1YRNA 1WJAA 3AG3H 2VJJA 2PQ8A 1Y0NA 1OYYA 2L54A 3GTOJ 1EH8A 3CMEI 1ZKGA 1W7PD 5LEKA 3AFHA 1S7OA 3NARA 5DYMA 2E7WA 5JFRA 2BYVE 4WXHA 3RKWA 4LOCA 4ESJA 4MEXF 3BJAA 3GFJA 2DXIA 4RB2C 3C3WA 1WZ2A 4M71A 1WI3A 3BR6A 2DQLA 1VI0A 3H0GJ 1VQOI 2ZMEA 4I09A 2OV7A 1Z7LA 4M9ZA 5DM6F 3OYDA 4LIVA 2QSGX 2L01A 1BR2A 1H8AC 2PJRA 1Z6TA 2VQHA 3IH4A 2K3PA 2DMUA 3HOUJ 1BIBA 5E3NA 1HDPA 2L4AA 2M5WA 4H4KC 4EEFG 4S04A 1IUFA 3WTVC 4M3EA 5KHDA 2EV6A 2HZDA 2QM3A 2NVUB 3ASOH 3D5SC 3RJPA 4HAMA 1J09A 4KA4A 2CQKA 4BQAA 3BG7A 1B4AA 3H36A 4B4CA 2PMUA 3CCQI 4KIBA 4ZTJA 2WTEA 1SAUA 2Y48A 4BAYA 4A0XA 5H2FC 4C2TA 2F6CA 1OCCH 3I59A 2E1NA 4RB0A 3HPGA 1Z9CA 3L09A 2I5UA 2IBDA 1TQMA 3B6CA 1RPWA 4BQQA 1WJBA 2QGUA 1X58A 3O8HA 2VKHA 1A6IA 2UWMA 3E6DA 2IS6A 2JJ7A 3DF8A 3DBLB 3C1DA 3FZVA 1XG1A 1IN8A 4AU7A 1BR1A 3GTLJ 1DU6A 3RZDJ 2JK3A 4QTRA 3CO6C 1MKMA 1HW2A 4EJUA 1J59A 1HBXG 3I4NJ 1X1CA 4NC6A 4XLFA 2O03A 2E34A 2M34A 5TISC 2DU9A 1GVJA 4BBRJ 5LEJA 2KJBA 4U7BA 3F21A 3LOCA 1MSEC 3LQRA 3LAPA 4BACA 1T95A 2YPRA 1OCRH 2WADA 2D45A 4AIDA 3V8JA 3MD2A 3M9AA 1C0WA 4IXAA 1XGNA 2EFWA 4BU2A 2VIXA 3OYNA 1FYKA 4F92B 3FXOA 3SYTA 2YX7A 2Q8KA 2MFZA 4M6XA 2W57A 2CFOA 4OMYA 5ICEA 5EF6A 1VQKI 1TL8A 3LQQA 2QQAA 2IAIA 2CRGA 1T0FC 3RPUD 1ONVA 3LSRA 4ZYGA 4I0AA 4ZYEA 3A1YA 1FTTA 2ZJQF 3Q9SA 3SFIA 3SFZA 2FOKA 1U3EM 4G6TB 4CCNA 4BBSJ 1LKXA 2ADUA 1FYMA 3QAHA 2KHMA 2FRHA 1RR8C 3GTMJ 1LE8A 4A3MJ 2K9LA 4LLGF 3IHUA 1RNLA 2DA4A 3LAJA 2M0CA 3EUAA 1Z77A 5J1UA 3ABTA 3PO2J 2RREA 2CU7A 3C2HA 2MGQA 3JRBA 1XSDA 2OTLI 1WH7A 3K2AA 2DDBA 3HTUA 4IQ4A 4MNUA 3VEPA 2K9MA 3HZJA 2ZXWH 2ZJPF 1G3WA 5FKNA 5K5OA 1S5LC 2ZMEB 5LHHA 3OYAA 3K2ZA 4J00A 3VDXA 3QQAA 3NEUA 1ZAOA 2E1MC 5GTHC 4PUSA 3SEQA 3MMYB 2E1CA 3VYRB 3IP4B 4XR6A 4IL6C 3HYIA 1LEAA 3R6SA 1RIOH 3HUGB 2YS9A 4KT5C 4HW0A 3NWSA 2R7XA 3MCZA 2IGOA 2IT0A 4Y52J 3U9GA 3BWGA 2XAGA 4Y4RA 5F27A 3HM5A 3TOAA 4KMFA 3DKWA 4QIWN 2FXAA 1GV5A 4ZDOA 2DFFA 3BG3A 3P7NA 4NC7A 2RC4A 4BJ6C 1E17A 3C7JA 1KYZA 5KNLA 2VL8A 1USSA 3M07A 5EZHA 1V3FA 2EK5A 3QPHA 1V5GA 2MD5A 3B73A 4KIFA 4OU0A 2V7FA 2XGDA 2XAQA 3J81K 2I10A 3S93A 1WQ2A 2VB6A 3EUHA 1L3LA 2M2EA 2CH0A 1X4PA 3PUFA 4UY8I 1D5YA 1XCBA 1BOBA 2Z2SB 2CQXA 4UV8A 2F5DA 1CF7A 2QCOA 3G1OA 2FBKA 2XKPA 1LDJA 2CQ7A 3T5XA 3TP0A 3HPHA 4IHXA 1J2XA 4PSXA 2L9SA 3HSFA 1Z1DA 3W2VA 1P7JA 2L7MP 5LFAA 4FTHA 1D1CA 2DT5A 1VQ6I 2H1KA 3A01A 3HUGA 1D1BA 4AD9A 2GIVA 4YIIA 3P9IA 2KLOA 2IS2A 3CCJI 3WTZA 3KE2A 3GF2A 3R60A 1EKEA 2R7DA 2PMZA 2Z5UA 4A3CJ 3H3VK 3OR1C 2Q1ZB 1I3AA 3E97A 4BHBA 1VFCA 2QVOA 3WU0A 1WJFA 4C2UA 2MABA 2IVMA 2F5VA 4G6QA 3S32A 4BY1J 2P5LC 3CC7I 2XSJC 1OISA 2HOAA 4A69C 4DZJA 4A3LJ 3DFGA 1ETXA 1HQCA 2HQAA 2WA0A 4ENKA 1NTCA 3L2CA 4DOZA 3QPSA 2Y30A 3HGYA 1TWFJ 2FBHA 4HX4A 2HQ5A 3H5RA 3ZQFA 4LB5A 3RPQA 2QKLB 5DV5A 1XD7A 3HB9A 4HX7A 3CP8A 4IF4A 4Y13A 3K1NA 2JA5J 5HS8A 3H3UA 4DYCA 3HL2A 3GTQJ 4JX5A 4RLFA 2OBPA 4P1WA 2DMTA 3K1PA 2NNNA 5DCFA 1WHUA 1YS7A 3TEDA 4MTEA 4C3JJ 4B09A 5ICCA 3DLAA 5EG0A 4HZFA 2GA1A 3GUDA 2Y0MA 3L2WA 3S8PA 1JKQC 3WTTC 2WV0A 4II2A 3G6EI 2BW3B 1YJWI 2RNJA 1IAWA 3GLXA 5J4YA 2JTVA 2LVSA 1W7PB 2HQNA 3PNYA 4BGDA 4BH9A 3KZYA 1JT0A 3I56I 2L7FP 1B6AA 2A3SA 1GHCA 4V2FA 3QODA 2Y0SA 5GPAA 3OIPA 2DDAA 4YRVA 1K7AA 2EV0A 4HLXA 4CHUA 3M7GA 4MLOA 4UUTA 1S8NA 1YTYA 3KFWX 3ISPA 1B72A 1T38A 3BG5A 3CMAI 1W36D 5DM7F 1ZG1A 1FIPA 4G12A 3WTWC 3AG2H 3OYHA 3N05A 2X1EA 5DUIA 1TBXA 4N0BA 3GFMA 1JUPA 1K4SA 3BZ6A 2WV1A 1WCMJ 3JCUC 3WE2A 4XRSA 2W85A 2NVQJ 4HOBA 2CV2A 1Z0XA 3D5LA 4C2MJ 1D0ZA 2R7FA 5EG0B 2AQEA 2PLYA 3S1QJ 2G7HA 1R00A 1P7IA 3SDGA 2DFIA 3VWBA 2OAZA 4MIMA 2DTZA 2V6EA 3MZ8A 4N9IA 2VLAA 1FSHA 4J01A 2FSWA 1KA8A 3WGIA 1U2WA 3L7WA 4QPQA 4GFBA 1JI8A 3HRTA 4A5NA 2EV5A 4EJOA 1MNMC 2VQGA 2QEXI 2PJPA 1XSXA 1YX5A 4U0VA 3FISA 3P5JA 2DOFA 2NS8A 1S72I 2LF7A 1MJ9A 3LWFA 3FF5A 3L9FA 1MW7A 1FEXA 4D9JA 1QO0D 3EQLF 1CGPA 3PO3J 3V7CA 3M8EA 4CCJA 3ECHA 1LFPA 2HGCA 5A2QZ 2XB0X 3BLYA 1O3TA 4XQFA 2KFDA 5IT9K 2LG4A 1V5FA 1QGPA 3LSIA 2M1BA 3ERED 4U7DA 3DKYA 1V5EA 5H20A 2R4GA 3TBIA 1GV2A 2BZTA 1MBGA 4RGXA 4XL9A 5C44J 2XGXA 3OY9A 1ZLJA 3PIPF 4HF2A 2MD0A 4OIOF 4IPAA 5FFXA 4HPQA 4FISA 3W3CA 2CQQA 1MMSA 5E1ZB 3BCAA 4UNOA 4NQWB 3W6VA 1FBQA 2A5YB 5FKOA 5L3FA 5C4JJ 1UHWA 1WJDA 3BQZA 2CJJA 2HOTA 2M9HA 1VQMI 3FXMA 5IT9Z 3IAM2 4NB5A 1GT0C 1RI7A 2OJED 4BDZA 4NC8A 3KP2A 2ZNYA 3ZMVA 2DTRA 1O3SA 1P4XA 3LSMA 3VSKA 3OIOA 5H6RA 2LREA 1ON2A 3F8MA 2RQQA 3SJMA 5CLSA 4P5OA 5GPCA 4MGRA 4BYYA 4OWRB 4OIPF 3BY6A 1G3SA 5LD2C 1AHDP 1FOYA 3CUQC 1IW7F 2W82A 1E3PA 5K5RA 2HYJA 1D3YA 1FIAA 4MHGA 4BUPA 1HLVA 2KZGA 3B6AA 3MEXA 1JUSA 1FOWA 4RDUA 4FX0A 4XKWA 3ULQB 2CW8A 2ZJ2A 2EZKA 2LY9A 3CUQB 3RYRA 3H5AA 2R5YA 5JVGF 1S3JA 3FBNB 3LSKA 3VYUB 4HV5A 1SFXA 3CUQA 3K9TA 1MGTA 3K4LA 4ESFA 3IAS2 3K10A 4B44A 4JYKA 2LY2A 1U8BA 1RC9A 4LJZF 3MQ0A 2AHQA 3E6BA 2KIMA 3S16J 1JXSA 3HOWJ 2J5PA 3HOTA 2BY2A 1ZRCA 3HBLA 3GMEA 4NUBA 2VOOA 1JHFA 1XB4A 3CJNA 2JWTA 2E2IJ 3TGNA 1B59A 2XAFA 3FK6A 5F6FA 3OS2A 2YX4A 3CCLI 4KMUX 1R1TA 1WI9A 5FKMA 4UB8C 1HA8A 2HDDA 1ENHA 2LKPA 2A07F 1R1UA 3S3MA 2X51A 1SMYF 3NAUA 1E0EA 5M5WJ 4C3IJ 2MA3A 2M4KA 2W1OA 4BS9A 1AOYA 2CWEA 4XIDA 3G1LA 4BHCA 3CCYA 3KEOA 2JT1A 2XGEA 1OCPA 3F8FA 1VQ7I 5ICGA 1FYLA 2GWRA 3RQ4A 2VBXA 2W84A 1GDTA 1GXQA 4GXOA 2X6YA 1IV6A 3OMYA 5JHFA 1XS9A 1ZREA 1LVKA 3HSRA 5M5XJ 4YG2F 3LA7A 1FZPB 2BV6A 1GXPA 2I8DA 3GWZA 5DCMA 4G7HF 4DZPA 1R4MB 1EF4A 5CPRB 1NK3P 1JJ8C 1DGRM 4LGWA 4PJNA 2LTPA 1SFKA 1PJRA 1YG2A 4G94A 3PJRA 3IL2A 3ML6A 1PVEA 1VQPI 2LLKA 3ASNH 2X9DA 3RCOA 2M7BA 3U1KA 4P9UA 1GVDA 2W7NA 3EYIA 1A35A 1YHQI 1WJEA 1YX3A 2KRCA 1F36A 4FQGA 4RM2A 2UUZA 3A01B 1KU7A 3PL8A 2DN0A 1Y56A 4WXDA 2X6WA 4M6YA 1ULYA 2A69F 1X4OA 2KRFA 2V1UA 2DFEA 2FA5A 3UR3C 2DFHA 2V4JC 3MKLA 2LH9A 3IRQA 3F72A 1QZZA 3SEZA 3EUKL 3LFUA 3OYJA 4A3EJ 4U88A 1YQAA 1X3UA 2Y9YA 3LFKA 2DCEA 1YOVB 2P7VB 3CD6I 5E3OA 4EM0B 4G8XA 1T56A 3JRIA 5EJCA 5IYBJ 5TGTA 4B8XA 4IEJA 2K27A 3LA3A 5HVQC 2VXZA 3S15J 4CCLA 1FMWA 4F55A 1BW6A 3AKZA 3BR1A 5HODA 1G6NA 3CCUI 3KZZA 1U8RA 4AM3A 3VFZA 3CCMI 1IV8A 3E6CC 1MNDA 1ZLKA 4O3MA 1HW5A 2DOEA 3VSLA 4CSWA 1UELB 2G0EA 5J40A 5HLTA 3F8BA 1LDDA 2L7ZA 3F8CA 3DWLE 5HNFA 2VJ5A 3K4CA 2NNYA 1DDNA 2R5ZA 4EJTA 3QYBA 5J4VA 2CSOA 1XMKA 4B43A 1TT0A 2A61A 3TW7A 2A6TA 2D2WA 1OYIA 2WC2A 3KYLA 3K69A 3FX3A 2HPMA 2DK5A 4JP0A 4JX4A 1AWCA 2QLZA 3PQKA 4CZZA 1IC8A 4RAGA 5JLWA 2XUBA 5DD4A 4HQMA 2XF5A 3BTIA 3OYCA 1PUFA 1H9GA 3J7YJ 2E2JJ 4IHSA 3BG6A 1P9QC 3G1MA 5J3LA 4EQQA 5ILVA 2C6YA 2MC3A 4I7HA 1PUFB 2LRDA 4AUXA 2DI3A 5E1XA 3IUOA 1BBYA 3FMSA 4CICA 1GLNA 4CGZA 3OYIA 2HFHA 4KICA 2K40A 5HS7A 1H0MA 2K7LA 2YUSA 2KDOA 2FEZA 4HNTA 1SMTA 3EPZA 1T2KA 2EWNA 2ISYA 1O57A 5HLIA 4MTDA 1G8XA 1GUUA 2M4GA 4TV7A 1MBFA 2H94A 2XC7A 4G7ZF 2FMYA 2LBFA 2VQCA 4AIJA 2OQRA 1ZR2A 1ETVA 5AIPA 3HKZN 2AXTC 1X19A 1O7LA 2FQ4A 3NQOA 4DJAA 2VASA 4A93J 3ZR8X 2LYCA 2V1DA 1MJBA 2ZCWA 3FHNA 5CVJA 3N4MA 4NDLA 4ENMA 4DGWB 5KCMA 2YSRA 2L2OA 2HTSA 2PBIA 3IRRA 2NVTJ 2OTJI 1SD5A 2O7OA 3I55I 2D1VA 4KIGA 1OCZH 1F43A 5LGUA 2QBYA 3G73A 3QPTA 2OF7A 3BTJA 1S29A 5AIQA 4IVNA 2VOPA 1J7KA 3ZP5A 3L2VA 2DMQA 3BTLA 3QP5A 2V9VA
chains in the Genus database with same CATH topology
1KYWA 1LNWA 4ZH4F 5HDKA 3WE3A 5F1RA 2ZXJA 3I53A 3DQVC 1P4AA 1XSVA 2FU4A 2ESNA 3BDDA 1R5HA 4Z2YA 4JK1X 4D0PA 4KFCA 1XCVA 1IUYA 3GX4X 2ETHA 1RUOA 1ZARA 2JSCA 1BI0A 4Y15A 2A6EF 1SD4A 1B1BA 4ZYHA 5HDGA 3J80K 1OYWA 1F4KA 1B9NA 2IP2A 3HOSA 1FPQA 2G9WA 1DP7P 3BPXA 3U1DA 5D5XB 4I98B 3JAMZ 2QQBA 5HS9A 3COAC 4Q5SF 4ASNA 1SAXA 1SD6A 3TQNA 3QRFF 1YO5C 1USTA 3FXUA 5BQTA 2R3SA 2F5EA 3SHFA 2MLGA 4OINF 3RPUA 2ZO4A 5ED4A 1IXSB 3F6OA 4ON0A 1K79A 1XDSA 1ZN2A 5LBQA 1J0RA 3RTRA 2STTA 5HLHA 2BE5F 5FD5A 5F64A 3ZMSA 1PP7U 1YW8A 2M8EA 2XVCA 3EYYA 3KEQA 3WG9A 2RN7A 5CVRA 5CJ9A 1K78B 2D1HA 1RZ4A 1REPC 2NS0A 5ILUA 4Q48A 1QBJA 2FQ3A 2V6CA 3JAMK 5JHUA 4L9TA 5EEHA 1HSTA 5LHGA 1HKTA 5FLXK 2FBIA 1YIOA 3U2RA 4OOIA 3DEUA 3R4KA 5D4RA 1KU9A 2H6CA 2Y75A 1IRGA 2HKXA 2IA1A 3IKTA 4DNCA 1YW9A 2JPBA 2QENA 3EDPA 5TJJA 3ABUA 4G7OF 1U6GA 2ZNZA 1UB9A 3O3KA 1EH7A 2KKOA 2ZBKA 1FOKA 1FBUA 1FSEA 2CFXA 2EFOA 4KNYA 3R0AA 3I5UA 1FLIA 4YFXF 2XIGA 4UHTA 1KQ0A 1P6RA 2QWWA 4MEYF 1XGSA 2JRTA 2Z3YA 2KJCA 2HYFA 3WTUC 4RGRA 4OIQF 4FX4A 5CVVA 1VTNC 4I2OA 1IXRC 4L0ZB 2O0YA 3IC7A 5D6FA 3E5QA 1IRFA 3HIFA 4HBLA 5K5QA 3DP7A 4F7ZA 3RI4A 5LRSA 1J75A 2BEOA 2VT3A 2LNBA 2UZKA 4CYDA 3E5UA 2BGCA 3HRMA 3QP6A 6PAXA 4M72A 4A0YA 1P4WA 1R58A 3J80Z 1J5YA 1Z7UA 1BJAA 4UUVA 3LA2A 4LK1F 1IN6A 5L3DA 4AIKA 2P4WA 1YW7A 5KK1A 1UCRA 1D8KA 2DO7A 1U5TC 3L00A 3K1MA 4M9XA 2CW0F 4KN7X 5E17F 2HEOA 2RVCA 3M1EA 1MZBA 3TO7A 1XGMA 2OD5A 2P5VA 5BMZA 2QBYB 4EV0A 2BBYA 4HF0A 2Z99A 1IN4A 2PG4A 1FY7A 4M9SA 4LD5A 1XMAA 3BJOA 4EVIA 2EJRA 3G3ZA 3MZHA 3GO5A 1L0OC 1QZYA 2VC0A 5FD6A 4AWXB 2MBFA 5BPDA 3EETA 4LG0B 3KP5A 2HYGD 5BOXA 2XROA 4PGHA 3VODA 1BOAA 3DV8A 2YR2A 1BIAA 4UXNA 1W7PA 3RKXA 2HDCA 5D5WB 1T0FA 2EFQA 3HHHA 1CF7B 2IA2A 2P5KA 3TO6A 1P2FA 1Z05A 3E6MA 3P9CA 3BOQA 4GO1A 1FC3A 4ETSA 3HTSB 5D8LB 3SZPA 5ICFA 1YFHA 2NYXA 2ESHA 2TDXA 1EH6A 1KU3A 4Q47A 2AXLA 4XSXF 3KCCA 4WXCA 5ILSA 2EFNA 2PN6A 4CXFA 1H9TA 1R22A 5D5VB 2XRNA 2H09A 4JBAA 1EV7A 2W24A 2P7CB 4HX8A 5E20A 2EB7A 4I01A 1YYVA 1XGOA 1YS6A 1LEBA 3CO7C 5FLXZ 3MFKA 4GYGA 1R5GA 4EGYA 1SD7A 3CLOA 4G6DA 2F5FA 3QU3A 1KQ8A 2HQRA 1T98A 1JGSA 2FNAA 1IN7A 3JTGA 4ENJA 3O6BB 1DUXC 3T0YA 4A0ZA 1WRJA 5DDGA 1WSUA 2Z9OA 2XHKA 3SQNA 3FXQA 1I27A 2M45A 3GYHX 3WGHA 1ZG3A 3BJ6A 2OQGA 2GXBA 3WTSC 4HYEA 1Y0UA 5FFZA 2UXXA 2XV4S 5HOOA 3CTAA 2G7UA 2DW4A 1IF1A 4I02A 1F5TA 4EM1A 3W6KB 1NHAA 3I0TA 4HDVA 1IZ1A 1R23A 1LB2A 1I1GA 1LDKB 3LSTA 5D4SA 2VE8A 2VBZA 1F1ZA 3O2PE 4HLYA 3PQJA 1O7FA 2HR3A 3ZN0A 4BXUA 5LLQA 1TW2A 4WX9A 2STWA 5DUKA 3WU1B 4N9HA 3ZMDA 1PP8F 2QZ8A 3T8TA 3TDUC 4LLLA 4YFKF 5DD8A 4XLPF 5L3CA 3E3VA 4EMSA 2GA2A 3BROA 4WWCA 3TOBA 3JW4A 3I59B 3WTYC 5BS6A 1BM9A 4ZYDA 4QWQA 3J7AO 3HRUA 1DPRA 2B0LA 2VN2A 3V4GA 5JI6A 4L0YB 1XN7A 2GZWA 4OMZA 2DPUA 2NRAC 5D8KB 3ZPLA 2JPCA 1W5SA 1Q1HA 4K2EA 4UVCA 3TO9A 2ISZA 2OA4A 2CGPA 1LJ9A 4KN4X 2Q0OA 4XRFA 2NAZA 3GEZA 2O3FA 1FWZA 2DK8A 3RKYA 3GXOA 3ELKA 2HS5A 3FHZA 3WGGA 4YFNF 4S05A 3ZN1A 1PUEE 2IPQX 3GFIA 3BP8A 2DQRA 1K78A 1T6SA 2IW5A 3REOA 4RGUA 2MH9A 3NRVA 1U5TB 4LG0A 5H6QA 4LLNA 5HLGA 3ZQ7A 1ON1A 4WCGA 5LGTA 1MD0A 4O5VA 4LK0F 1ZH5A 4R1HA 1R36A 1S7AA 1ZGJA 4KYWA 1HSJA 3MZYA 3BPVA 4R79A 4AIHA 1RUNA 3ROUA 3C18A 3AAFA 4A5MA 1BI1A 3I64A 2O61A 3QU6A 5JVTA 1KGSA 1I5ZA 5BPIA 2P8TA 4WF2A 4LMYA 1FBSA 5J8FA 1O3QA 1V4RA 2AS5F 1TNSA 2H6BA 2O6GE 1SFEA 4R8HA 2K02A 5K1YA 2HKOA 3RIRA 1STZA 5L3EA 5A2QK 1LQ1A 3KP4A 2IRFG 3J81Z 4ZZDA 4IRGA 1OPCA 5J6XA 5IT3A 5ERIA 2OZUA 5E8GA 3OOPA 1B9MA 2QUFA 2H27A 4GCVA 4H0EA 4UV9A 4A2UA 5CVIA 1BI3A 4U0WA 2JZYA 3HSEA 4M73A 1KQ9A 3MAJA 3FM5A 3ECOA 3F8NA 2K86A 2WWYA 3I54A 4RAZA 4LB6B 3V7RA 2X4HA 4L5IA 5DCMB 3CDHA 3MWMA 3T1BA 2COMA 1HKQA 3SXYA 4P55A 5D5UB 4PGGA 1ZRFA 4BNCA 2DPDA 3N97A 2CO5A 3JSPA 5FGMA 1D5VA 3V7SA 5CVUA 4RAYA 2LF8A 3SZTA 4MQVA 4NHJA 2XASA 4P96A 1XDUA 5LRRA 4Q4ZF 3JSOA 2XKOA 5FO5A 4GGGA 4PDKA 4L9VA 1OKRA 2YU3A 3TDZC 1I1SA 3OV8A 1BI2A 2V79A 3KLNA 4HA8A 4FHTA 4A6EA 2PI0A 2RV8A 3GFLA 2X0LA 3CUOA 2CG4A 3GVAA 3T8RA 2HZTA 4OIRF 1G3TA 4PCQA 2MLKA 4ENNA 3WODF 3VB2A 1FNNA 1SFUA 1Z91A 3FMQA 3KP3A 2RKHA 1QNTA 3ZMUA 1WKMA 2VBYA 3JTHA 1TQIA 2ELHA 1U78A 1TLHB 4O6JA 2FNPA 4A6DA 4G9YA 4PZJA 2KIFA 4Y17A 2IJLA 3GW2A 4L9NA 1F9NA 1YLFA 2CYYA 3FXRA 5E18F 1KU2A 2DAOA 1DPUA 4XBFA 4EJVA 3DPLC 2XAHA 1A04A 2DBBA 2P6TA 2FF4A 1BN5A 5L3BA 2LSOA 5AONA 5J8CA 3KETA 3IWZA 3I4PA 2P6SA 4A12A 4RB1A 1MDMB 3DPTA 1LVAA 1E2XA 3W6JB 3K0LA 4I0BA 4KDPA 4M74A 1U5TA 4RB3C 2O8XA 2OZ6A 4L5JA 5KVRA 1QQIA 2FMLA 1ZHFA 4WK8F 4U0YA 1HW1A 2RGVA 2E7XA 1PDNC 1ZRDA 1IXCA 2VT2A 5JR3A 4EGZA 3Q5FA 1W5TA 3H3ZA 4YIFA 4HV6A 1BC8C 3IWFA 2VONA 2HOEA 2IA0A 3WTXC 2ACJA 2F2EA 5D6EA 2HTJA 3V8LA 3GZ5A 3PFIA 2V1XA 1FX7A 3IKVA 1O3RA 2XAJA 3FM3A 1P92A 3DXJF 3H92A 2FE3A 1OR7A 1QPMA 3Q9VA 2L4MA 5DEQA 1HXDA 5TRDA 2DLLA 2EFPA 4MQ9F 3F3XA 3QOPA 4IJAA 4HF1A 2OU2A 2GQQA 2M30A 4HDUA 3M8FA 3KP7A 2MH2A 4JQFA 5E8IA 4DQ2A 4IHTA 5CYVA 4E70A 3B02A 4CO8A 1MDMA 1TNTA 3R0JA 5E1WA 2ZFWA 1TTYA 3VOEA 4KUMA 4FT8A 2VE9A 1JE8A 3R61A 1BC7C 1WWXA 4RS8A 1R7JA 2UXNA 3ZMTA 1FP2A 5EEGA 2Z33A 2K4BA 1S6LA 2GAUA 4BHPA 5HDNA 4RGSA 1D8JA 4UVBA 1UHMA 4LFUA 3I71A 3F23A 2Q2EA 2L02A 3V8KA 4IRHA 3FWEA 1JHHA 3ZMZA 3F22A 1I6XA 2PEXA 1Z6RA 1FT9A 1ZYRF 2QYOA 3FMRA 1IN5A 4EJWA 2VC1A 4HQEA 4UVAA 1MJAA 3P9KA 3E5XA 2K4JA 1TQPA 1ZG5A 1T39A 2VODA 2QQ9A 2PMHA 2PFBA 2LDUA 1UFMA 1OMIA 2M87A 1J9IA 1FP1D 3I58A 4ESBA 1ZGAA 3RDIA 4NQWA 3KP6A 3GZ6A 4QLCU 2ZKZA 3HHGA 3KLOA 3D0SA 4L9JA 2J5OA 1R1VA 1K6OA 4GYIA 2VBWA 4CDGA 1W4MA 3HRSA 5L3GA 4P9FA 4IRIA 2L3DA 4XLNF 2HWVA 3F6VA 5LGNA 1G4DA 1ODDA 3RYPA 4ZZLA 2W25A 4AVPA 5LHIA 4XSZF 2A6HF 4L18B 2RDPA 2GXGA 1HKSA 2EA4A 3S2WA 2KIUA 3TKYA 2EA2A 2A68F 5FB2A 4EM2A 1G3YA 2RQPA 2F5CA 1TW3A 2PQ8A 1OYYA 2L54A 1EH8A 5LEKA 1W7PD 1S7OA 5DYMA 2E7WA 5JFRA 2BYVE 4WXHA 3RKWA 4ESJA 4MEXF 3BJAA 3GFJA 4RB2C 3C3WA 4M71A 2DQLA 2ZMEA 4I09A 4M9ZA 2L01A 1Z6TA 1BIBA 2L4AA 2M5WA 4S04A 3WTVC 2EV6A 2QM3A 3RJPA 4BQAA 4KA4A 4HAMA 2CQKA 1B4AA 2PMUA 4KIBA 2WTEA 2Y48A 4BAYA 4A0XA 3I59A 2E1NA 4RB0A 1Z9CA 3L09A 1TQMA 2UWMA 3E6DA 3DF8A 3C1DA 3FZVA 1IN8A 3CO6C 1MKMA 1HW2A 4EJUA 1J59A 1HBXG 2O03A 2DU9A 1GVJA 5LEJA 2KJBA 4U7BA 3F21A 3LQRA 3LAPA 2YPRA 2D45A 3V8JA 3M9AA 1C0WA 4IXAA 1XGNA 2EFWA 1FYKA 2YX7A 2Q8KA 4M6XA 2W57A 4OMYA 5ICEA 3LQQA 2QQAA 1ONVA 4ZYGA 4I0AA 4ZYEA 3Q9SA 3SFZA 2FOKA 1U3EM 2ADUA 1FYMA 3QAHA 2FRHA 4LLGF 3IHUA 1RNLA 3LAJA 3ABTA 1XSDA 3HTUA 4MNUA 3VEPA 1G3WA 5K5OA 2ZMEB 5LHHA 3K2ZA 3NEUA 1ZAOA 2E1CA 1RIOH 3HYIA 1LEAA 3R6SA 4KT5C 4HW0A 3MCZA 2IT0A 3U9GA 3BWGA 2XAGA 3TOAA 4KMFA 3DKWA 2FXAA 3P7NA 2RC4A 1E17A 3C7JA 1KYZA 1USSA 1V3FA 2EK5A 3QPHA 4KIFA 2MD5A 3B73A 4OU0A 2XAQA 3J81K 1WQ2A 3EUHA 1L3LA 1XCBA 4UV8A 2F5DA 1CF7A 2FBKA 2XKPA 1LDJA 3T5XA 1J2XA 3HSFA 1Z1DA 2DT5A 3HUGA 4AD9A 2GIVA 4YIIA 3P9IA 3WTZA 3KE2A 3GF2A 3R60A 2R7DA 2Z5UA 3E97A 4BHBA 2QVOA 3WU0A 2IVMA 4G6QA 2P5LC 3DFGA 1HQCA 4ENKA 3L2CA 2FBHA 4HX4A 4LB5A 3RPQA 5DV5A 1XD7A 4HX7A 4IF4A 4Y13A 3K1NA 5HS8A 3H3UA 2OBPA 3K1PA 2NNNA 5DCFA 1YS7A 4MTEA 4B09A 5ICCA 4HZFA 2GA1A 3GUDA 2Y0MA 3WTTC 2WV0A 2RNJA 1IAWA 3GLXA 2JTVA 1W7PB 2HQNA 4BH9A 3KZYA 1B6AA 2A3SA 1GHCA 1K7AA 2EV0A 4HLXA 4CHUA 3M7GA 1S8NA 1YTYA 3KFWX 3ISPA 1T38A 1ZG1A 3WTWC 5DUIA 1TBXA 4N0BA 3GFMA 3BZ6A 3WE2A 2W85A 4HOBA 3D5LA 2R7FA 2PLYA 2G7HA 1R00A 2DFIA 2OAZA 1FSHA 4N9IA 2FSWA 1KA8A 3WGIA 1U2WA 3L7WA 3HRTA 4A5NA 2EV5A 4EJOA 2PJPA 1XSXA 4U0VA 2LF7A 1MJ9A 3LWFA 3FF5A 3L9FA 1CGPA 1QO0D 3EQLF 3V7CA 3M8EA 3ECHA 2HGCA 5A2QZ 1O3TA 5IT9K 1QGPA 2M1BA 3ERED 4U7DA 5H20A 4RGXA 2XGXA 1ZLJA 4HF2A 4OIOF 4IPAA 5FFXA 5E1ZB 4UNOA 1FBQA 2A5YB 5L3FA 1UHWA 5IT9Z 4NB5A 1RI7A 3KP2A 2ZNYA 3ZMVA 2DTRA 1O3SA 1P4XA 5H6RA 1ON2A 3F8MA 5CLSA 4P5OA 4MGRA 4BYYA 4OIPF 3BY6A 1G3SA 3CUQC 1IW7F 5K5RA 1D3YA 4MHGA 3MEXA 4FX0A 3ULQB 2ZJ2A 3CUQB 3RYRA 1S3JA 4HV5A 1SFXA 3CUQA 3K9TA 1MGTA 4ESFA 4LJZF 3MQ0A 3E6BA 2KIMA 1JXSA 2J5PA 3HOTA 1ZRCA 2VOOA 1JHFA 1XB4A 3CJNA 3TGNA 1B59A 2XAFA 5F6FA 2YX4A 4KMUX 1R1TA 1WI9A 2LKPA 2A07F 1R1UA 1SMYF 2MA3A 1AOYA 2CWEA 4BHCA 3KEOA 2JT1A 3F8FA 5ICGA 1FYLA 2GWRA 2VBXA 2W84A 1GXQA 4GXOA 1ZREA 3HSRA 4YG2F 3LA7A 1FZPB 2BV6A 1GXPA 3GWZA 5DCMA 4G7HF 4LGWA 1YG2A 4G94A 3IL2A 3ML6A 4P9UA 3EYIA 1KU7A 4WXDA 4M6YA 1ULYA 2A69F 2KRFA 2V1UA 2FA5A 3IRQA 3F72A 1QZZA 4U88A 1YQAA 1X3UA 3LFKA 2P7VB 4EM0B 4G8XA 4B8XA 2K27A 3LA3A 5HVQC 2VXZA 1G6NA 3KZZA 1U8RA 3VFZA 3E6CC 1ZLKA 4O3MA 1HW5A 3F8BA 1LDDA 3F8CA 2NNYA 1DDNA 4EJTA 2CSOA 1XMKA 2A61A 2D2WA 1OYIA 2WC2A 3K69A 3FX3A 2DK5A 1AWCA 2QLZA 3PQKA 4CZZA 2XUBA 5DD4A 4HQMA 1H9GA 4IHSA 4EQQA 5ILVA 2C6YA 2MC3A 4I7HA 2DI3A 5E1XA 1BBYA 3FMSA 4CICA 4CGZA 2HFHA 4KICA 5HS7A 1H0MA 2K7LA 2FEZA 1SMTA 1T2KA 2EWNA 2ISYA 1O57A 5HLIA 4MTDA 4TV7A 2H94A 4G7ZF 2FMYA 4AIJA 2OQRA 5AIPA 1O7LA 3NQOA 2V1DA 1MJBA 2ZCWA 5CVJA 3N4MA 4ENMA 2YSRA 2HTSA 2PBIA 3IRRA 1SD5A 2D1VA 4KIGA 5LGUA 2QBYA 3G73A 3QPTA 1S29A 5AIQA 4IVNA 2VOPA 1J7KA 3ZP5A 3QP5A 2V9VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KYW A;  1LNW A;  4ZH4 F;  5HDK A;  3WE3 A;  5F1R A;  2ZXJ A;  3I53 A;  3DQV C;  1P4A A;  1XSV A;  2FU4 A;  2ESN A;  3BDD A;  1R5H A;  4Z2Y A;  4JK1 X;  4D0P A;  4KFC A;  1XCV A;  1IUY A;  3GX4 X;  2ETH A;  1RUO A;  1ZAR A;  2JSC A;  1BI0 A;  4Y15 A;  2A6E F;  1SD4 A;  1B1B A;  4ZYH A;  5HDG A;  3J80 K;  1OYW A;  1F4K A;  1B9N A;  2IP2 A;  3HOS A;  1FPQ A;  2G9W A;  1DP7 P;  3BPX A;  3U1D A;  5D5X B;  4I98 B;  3JAM Z;  2QQB A;  5HS9 A;  3COA C;  4Q5S F;  4ASN A;  1SAX A;  1SD6 A;  3TQN A;  3QRF F;  1YO5 C;  1UST A;  3FXU A;  5BQT A;  2R3S A;  2F5E A;  3SHF A;  2MLG A;  4OIN F;  3RPU A;  2ZO4 A;  5ED4 A;  1IXS B;  3F6O A;  4ON0 A;  1K79 A;  1XDS A;  1ZN2 A;  5LBQ A;  1J0R A;  3RTR A;  2STT A;  5HLH A;  2BE5 F;  5FD5 A;  5F64 A;  3ZMS A;  1PP7 U;  1YW8 A;  2M8E A;  2XVC A;  3EYY A;  3KEQ A;  3WG9 A;  2RN7 A;  5CVR A;  5CJ9 A;  1K78 B;  2D1H A;  1RZ4 A;  1REP C;  2NS0 A;  5ILU A;  4Q48 A;  1QBJ A;  2FQ3 A;  2V6C A;  3JAM K;  5JHU A;  4L9T A;  5EEH A;  1HST A;  5LHG A;  1HKT A;  5FLX K;  2FBI A;  1YIO A;  3U2R A;  4OOI A;  3DEU A;  3R4K A;  5D4R A;  1KU9 A;  2H6C A;  2Y75 A;  1IRG A;  2HKX A;  2IA1 A;  3IKT A;  4DNC A;  1YW9 A;  2JPB A;  2QEN A;  3EDP A;  5TJJ A;  3ABU A;  4G7O F;  1U6G A;  2ZNZ A;  1UB9 A;  3O3K A;  1EH7 A;  2KKO A;  2ZBK A;  1FOK A;  1FBU A;  1FSE A;  2CFX A;  2EFO A;  4KNY A;  3R0A A;  3I5U A;  1FLI A;  4YFX F;  2XIG A;  4UHT A;  1KQ0 A;  1P6R A;  2QWW A;  4MEY F;  1XGS A;  2JRT A;  2Z3Y A;  2KJC A;  2HYF A;  3WTU C;  4RGR A;  4OIQ F;  4FX4 A;  5CVV A;  1VTN C;  4I2O A;  1IXR C;  4L0Z B;  2O0Y A;  3IC7 A;  5D6F A;  3E5Q A;  1IRF A;  3HIF A;  4HBL A;  5K5Q A;  3DP7 A;  4F7Z A;  3RI4 A;  5LRS A;  1J75 A;  2BEO A;  2VT3 A;  2LNB A;  2UZK A;  4CYD A;  3E5U A;  2BGC A;  3HRM A;  3QP6 A;  6PAX A;  4M72 A;  4A0Y A;  1P4W A;  1R58 A;  3J80 Z;  1J5Y A;  1Z7U A;  1BJA A;  4UUV A;  3LA2 A;  4LK1 F;  1IN6 A;  5L3D A;  4AIK A;  2P4W A;  1YW7 A;  5KK1 A;  1UCR A;  1D8K A;  2DO7 A;  1U5T C;  3L00 A;  3K1M A;  4M9X A;  2CW0 F;  4KN7 X;  5E17 F;  2HEO A;  2RVC A;  3M1E A;  1MZB A;  3TO7 A;  1XGM A;  2OD5 A;  2P5V A;  5BMZ A;  2QBY B;  4EV0 A;  2BBY A;  4HF0 A;  2Z99 A;  1IN4 A;  2PG4 A;  1FY7 A;  4M9S A;  4LD5 A;  1XMA A;  3BJO A;  4EVI A;  2EJR A;  3G3Z A;  3MZH A;  3GO5 A;  1L0O C;  1QZY A;  2VC0 A;  5FD6 A;  4AWX B;  2MBF A;  5BPD A;  3EET A;  4LG0 B;  3KP5 A;  2HYG D;  5BOX A;  2XRO A;  4PGH A;  3VOD A;  1BOA A;  3DV8 A;  2YR2 A;  1BIA A;  4UXN A;  1W7P A;  3RKX A;  2HDC A;  5D5W B;  1T0F A;  2EFQ A;  3HHH A;  1CF7 B;  2IA2 A;  2P5K A;  3TO6 A;  1P2F A;  1Z05 A;  3E6M A;  3P9C A;  3BOQ A;  4GO1 A;  1FC3 A;  4ETS A;  3HTS B;  5D8L B;  3SZP A;  5ICF A;  1YFH A;  2NYX A;  2ESH A;  2TDX A;  1EH6 A;  1KU3 A;  4Q47 A;  2AXL A;  4XSX F;  3KCC A;  4WXC A;  5ILS A;  2EFN A;  2PN6 A;  4CXF A;  1H9T A;  1R22 A;  5D5V B;  2XRN A;  2H09 A;  4JBA A;  1EV7 A;  2W24 A;  2P7C B;  4HX8 A;  5E20 A;  2EB7 A;  4I01 A;  1YYV A;  1XGO A;  1YS6 A;  1LEB A;  3CO7 C;  5FLX Z;  3MFK A;  4GYG A;  1R5G A;  4EGY A;  1SD7 A;  3CLO A;  4G6D A;  2F5F A;  3QU3 A;  1KQ8 A;  2HQR A;  1T98 A;  1JGS A;  2FNA A;  1IN7 A;  3JTG A;  4ENJ A;  3O6B B;  1DUX C;  3T0Y A;  4A0Z A;  1WRJ A;  5DDG A;  1WSU A;  2Z9O A;  2XHK A;  3SQN A;  3FXQ A;  1I27 A;  2M45 A;  3GYH X;  3WGH A;  1ZG3 A;  3BJ6 A;  2OQG A;  2GXB A;  3WTS C;  4HYE A;  1Y0U A;  5FFZ A;  2UXX A;  2XV4 S;  5HOO A;  3CTA A;  2G7U A;  2DW4 A;  1IF1 A;  4I02 A;  1F5T A;  4EM1 A;  3W6K B;  1NHA A;  3I0T A;  4HDV A;  1IZ1 A;  1R23 A;  1LB2 A;  1I1G A;  1LDK B;  3LST A;  5D4S A;  2VE8 A;  2VBZ A;  1F1Z A;  3O2P E;  4HLY A;  3PQJ A;  1O7F A;  2HR3 A;  3ZN0 A;  4BXU A;  5LLQ A;  1TW2 A;  4WX9 A;  2STW A;  5DUK A;  3WU1 B;  4N9H A;  3ZMD A;  1PP8 F;  2QZ8 A;  3T8T A;  3TDU C;  4LLL A;  4YFK F;  5DD8 A;  4XLP F;  5L3C A;  3E3V A;  4EMS A;  2GA2 A;  3BRO A;  4WWC A;  3TOB A;  3JW4 A;  3I59 B;  3WTY C;  5BS6 A;  1BM9 A;  4ZYD A;  4QWQ A;  3J7A O;  3HRU A;  1DPR A;  2B0L A;  2VN2 A;  3V4G A;  5JI6 A;  4L0Y B;  1XN7 A;  2GZW A;  4OMZ A;  2DPU A;  2NRA C;  5D8K B;  3ZPL A;  2JPC A;  1W5S A;  1Q1H A;  4K2E A;  4UVC A;  3TO9 A;  2ISZ A;  2OA4 A;  2CGP A;  1LJ9 A;  4KN4 X;  2Q0O A;  4XRF A;  2NAZ A;  3GEZ A;  2O3F A;  1FWZ A;  2DK8 A;  3RKY A;  3GXO A;  3ELK A;  2HS5 A;  3FHZ A;  3WGG A;  4YFN F;  4S05 A;  3ZN1 A;  1PUE E;  2IPQ X;  3GFI A;  3BP8 A;  2DQR A;  1K78 A;  1T6S A;  2IW5 A;  3REO A;  4RGU A;  2MH9 A;  3NRV A;  1U5T B;  4LG0 A;  5H6Q A;  4LLN A;  5HLG A;  3ZQ7 A;  1ON1 A;  4WCG A;  5LGT A;  1MD0 A;  4O5V A;  4LK0 F;  1ZH5 A;  4R1H A;  1R36 A;  1S7A A;  1ZGJ A;  4KYW A;  1HSJ A;  3MZY A;  3BPV A;  4R79 A;  4AIH A;  1RUN A;  3ROU A;  3C18 A;  3AAF A;  4A5M A;  1BI1 A;  3I64 A;  2O61 A;  3QU6 A;  5JVT A;  1KGS A;  1I5Z A;  5BPI A;  2P8T A;  4WF2 A;  4LMY A;  1FBS A;  5J8F A;  1O3Q A;  1V4R A;  2AS5 F;  1TNS A;  2H6B A;  2O6G E;  1SFE A;  4R8H A;  2K02 A;  5K1Y A;  2HKO A;  3RIR A;  1STZ A;  5L3E A;  5A2Q K;  1LQ1 A;  3KP4 A;  2IRF G;  3J81 Z;  4ZZD A;  4IRG A;  1OPC A;  5J6X A;  5IT3 A;  5ERI A;  2OZU A;  5E8G A;  3OOP A;  1B9M A;  2QUF A;  2H27 A;  4GCV A;  4H0E A;  4UV9 A;  4A2U A;  5CVI A;  1BI3 A;  4U0W A;  2JZY A;  3HSE A;  4M73 A;  1KQ9 A;  3MAJ A;  3FM5 A;  3ECO A;  3F8N A;  2K86 A;  2WWY A;  3I54 A;  4RAZ A;  4LB6 B;  3V7R A;  2X4H A;  4L5I A;  5DCM B;  3CDH A;  3MWM A;  3T1B A;  2COM A;  1HKQ A;  3SXY A;  4P55 A;  5D5U B;  4PGG A;  1ZRF A;  4BNC A;  2DPD A;  3N97 A;  2CO5 A;  3JSP A;  5FGM A;  1D5V A;  3V7S A;  5CVU A;  4RAY A;  2LF8 A;  3SZT A;  4MQV A;  4NHJ A;  2XAS A;  4P96 A;  1XDU A;  5LRR A;  4Q4Z F;  3JSO A;  2XKO A;  5FO5 A;  4GGG A;  4PDK A;  4L9V A;  1OKR A;  2YU3 A;  3TDZ C;  1I1S A;  3OV8 A;  1BI2 A;  2V79 A;  3KLN A;  4HA8 A;  4FHT A;  4A6E A;  2PI0 A;  2RV8 A;  3GFL A;  2X0L A;  3CUO A;  2CG4 A;  3GVA A;  3T8R A;  2HZT A;  4OIR F;  1G3T A;  4PCQ A;  2MLK A;  4ENN A;  3WOD F;  3VB2 A;  1FNN A;  1SFU A;  1Z91 A;  3FMQ A;  3KP3 A;  2RKH A;  1QNT A;  3ZMU A;  1WKM A;  2VBY A;  3JTH A;  1TQI A;  2ELH A;  1U78 A;  1TLH B;  4O6J A;  2FNP A;  4A6D A;  4G9Y A;  4PZJ A;  2KIF A;  4Y17 A;  2IJL A;  3GW2 A;  4L9N A;  1F9N A;  1YLF A;  2CYY A;  3FXR A;  5E18 F;  1KU2 A;  2DAO A;  1DPU A;  4XBF A;  4EJV A;  3DPL C;  2XAH A;  1A04 A;  2DBB A;  2P6T A;  2FF4 A;  1BN5 A;  5L3B A;  2LSO A;  5AON A;  5J8C A;  3KET A;  3IWZ A;  3I4P A;  2P6S A;  4A12 A;  4RB1 A;  1MDM B;  3DPT A;  1LVA A;  1E2X A;  3W6J B;  3K0L A;  4I0B A;  4KDP A;  4M74 A;  1U5T A;  4RB3 C;  2O8X A;  2OZ6 A;  4L5J A;  5KVR A;  1QQI A;  2FML A;  1ZHF A;  4WK8 F;  4U0Y A;  1HW1 A;  2RGV A;  2E7X A;  1PDN C;  1ZRD A;  1IXC A;  2VT2 A;  5JR3 A;  4EGZ A;  3Q5F A;  1W5T A;  3H3Z A;  4YIF A;  4HV6 A;  1BC8 C;  3IWF A;  2VON A;  2HOE A;  2IA0 A;  3WTX C;  2ACJ A;  2F2E A;  5D6E A;  2HTJ A;  3V8L A;  3GZ5 A;  3PFI A;  2V1X A;  1FX7 A;  3IKV A;  1O3R A;  2XAJ A;  3FM3 A;  1P92 A;  3DXJ F;  3H92 A;  2FE3 A;  1OR7 A;  1QPM A;  3Q9V A;  2L4M A;  5DEQ A;  1HXD A;  5TRD A;  2DLL A;  2EFP A;  4MQ9 F;  3F3X A;  3QOP A;  4IJA A;  4HF1 A;  2OU2 A;  2GQQ A;  2M30 A;  4HDU A;  3M8F A;  3KP7 A;  2MH2 A;  4JQF A;  5E8I A;  4DQ2 A;  4IHT A;  5CYV A;  4E70 A;  3B02 A;  4CO8 A;  1MDM A;  1TNT A;  3R0J A;  5E1W A;  2ZFW A;  1TTY A;  3VOE A;  4KUM A;  4FT8 A;  2VE9 A;  1JE8 A;  3R61 A;  1BC7 C;  1WWX A;  4RS8 A;  1R7J A;  2UXN A;  3ZMT A;  1FP2 A;  5EEG A;  2Z33 A;  2K4B A;  1S6L A;  2GAU A;  4BHP A;  5HDN A;  4RGS A;  1D8J A;  4UVB A;  1UHM A;  4LFU A;  3I71 A;  3F23 A;  2Q2E A;  2L02 A;  3V8K A;  4IRH A;  3FWE A;  1JHH A;  3ZMZ A;  3F22 A;  1I6X A;  2PEX A;  1Z6R A;  1FT9 A;  1ZYR F;  2QYO A;  3FMR A;  1IN5 A;  4EJW A;  2VC1 A;  4HQE A;  4UVA A;  1MJA A;  3P9K A;  3E5X A;  2K4J A;  1TQP A;  1ZG5 A;  1T39 A;  2VOD A;  2QQ9 A;  2PMH A;  2PFB A;  2LDU A;  1UFM A;  1OMI A;  2M87 A;  1J9I A;  1FP1 D;  3I58 A;  4ESB A;  1ZGA A;  3RDI A;  4NQW A;  3KP6 A;  3GZ6 A;  4QLC U;  2ZKZ A;  3HHG A;  3KLO A;  3D0S A;  4L9J A;  2J5O A;  1R1V A;  1K6O A;  4GYI A;  2VBW A;  4CDG A;  1W4M A;  3HRS A;  5L3G A;  4P9F A;  4IRI A;  2L3D A;  4XLN F;  2HWV A;  3F6V A;  5LGN A;  1G4D A;  1ODD A;  3RYP A;  4ZZL A;  2W25 A;  4AVP A;  5LHI A;  4XSZ F;  2A6H F;  4L18 B;  2RDP A;  2GXG A;  1HKS A;  2EA4 A;  3S2W A;  2KIU A;  3TKY A;  2EA2 A;  2A68 F;  5FB2 A;  4EM2 A;  1G3Y A;  2RQP A;  2F5C A;  1TW3 A;  2PQ8 A;  1OYY A;  2L54 A;  1EH8 A;  5LEK A;  1W7P D;  1S7O A;  5DYM A;  2E7W A;  5JFR A;  2BYV E;  4WXH A;  3RKW A;  4ESJ A;  4MEX F;  3BJA A;  3GFJ A;  4RB2 C;  3C3W A;  4M71 A;  2DQL A;  2ZME A;  4I09 A;  4M9Z A;  2L01 A;  1Z6T A;  1BIB A;  2L4A A;  2M5W A;  4S04 A;  3WTV C;  2EV6 A;  2QM3 A;  3RJP A;  4BQA A;  4KA4 A;  4HAM A;  2CQK A;  1B4A A;  2PMU A;  4KIB A;  2WTE A;  2Y48 A;  4BAY A;  4A0X A;  3I59 A;  2E1N A;  4RB0 A;  1Z9C A;  3L09 A;  1TQM A;  2UWM A;  3E6D A;  3DF8 A;  3C1D A;  3FZV A;  1IN8 A;  3CO6 C;  1MKM A;  1HW2 A;  4EJU A;  1J59 A;  1HBX G;  2O03 A;  2DU9 A;  1GVJ A;  5LEJ A;  2KJB A;  4U7B A;  3F21 A;  3LQR A;  3LAP A;  2YPR A;  2D45 A;  3V8J A;  3M9A A;  1C0W A;  4IXA A;  1XGN A;  2EFW A;  1FYK A;  2YX7 A;  2Q8K A;  4M6X A;  2W57 A;  4OMY A;  5ICE A;  3LQQ A;  2QQA A;  1ONV A;  4ZYG A;  4I0A A;  4ZYE A;  3Q9S A;  3SFZ A;  2FOK A;  1U3E M;  2ADU A;  1FYM A;  3QAH A;  2FRH A;  4LLG F;  3IHU A;  1RNL A;  3LAJ A;  3ABT A;  1XSD A;  3HTU A;  4MNU A;  3VEP A;  1G3W A;  5K5O A;  2ZME B;  5LHH A;  3K2Z A;  3NEU A;  1ZAO A;  2E1C A;  1RIO H;  3HYI A;  1LEA A;  3R6S A;  4KT5 C;  4HW0 A;  3MCZ A;  2IT0 A;  3U9G A;  3BWG A;  2XAG A;  3TOA A;  4KMF A;  3DKW A;  2FXA A;  3P7N A;  2RC4 A;  1E17 A;  3C7J A;  1KYZ A;  1USS A;  1V3F A;  2EK5 A;  3QPH A;  4KIF A;  2MD5 A;  3B73 A;  4OU0 A;  2XAQ A;  3J81 K;  1WQ2 A;  3EUH A;  1L3L A;  1XCB A;  4UV8 A;  2F5D A;  1CF7 A;  2FBK A;  2XKP A;  1LDJ A;  3T5X A;  1J2X A;  3HSF A;  1Z1D A;  2DT5 A;  3HUG A;  4AD9 A;  2GIV A;  4YII A;  3P9I A;  3WTZ A;  3KE2 A;  3GF2 A;  3R60 A;  2R7D A;  2Z5U A;  3E97 A;  4BHB A;  2QVO A;  3WU0 A;  2IVM A;  4G6Q A;  2P5L C;  3DFG A;  1HQC A;  4ENK A;  3L2C A;  2FBH A;  4HX4 A;  4LB5 A;  3RPQ A;  5DV5 A;  1XD7 A;  4HX7 A;  4IF4 A;  4Y13 A;  3K1N A;  5HS8 A;  3H3U A;  2OBP A;  3K1P A;  2NNN A;  5DCF A;  1YS7 A;  4MTE A;  4B09 A;  5ICC A;  4HZF A;  2GA1 A;  3GUD A;  2Y0M A;  3WTT C;  2WV0 A;  2RNJ A;  1IAW A;  3GLX A;  2JTV A;  1W7P B;  2HQN A;  4BH9 A;  3KZY A;  1B6A A;  2A3S A;  1GHC A;  1K7A A;  2EV0 A;  4HLX A;  4CHU A;  3M7G A;  1S8N A;  1YTY A;  3KFW X;  3ISP A;  1T38 A;  1ZG1 A;  3WTW C;  5DUI A;  1TBX A;  4N0B A;  3GFM A;  3BZ6 A;  3WE2 A;  2W85 A;  4HOB A;  3D5L A;  2R7F A;  2PLY A;  2G7H A;  1R00 A;  2DFI A;  2OAZ A;  1FSH A;  4N9I A;  2FSW A;  1KA8 A;  3WGI A;  1U2W A;  3L7W A;  3HRT A;  4A5N A;  2EV5 A;  4EJO A;  2PJP A;  1XSX A;  4U0V A;  2LF7 A;  1MJ9 A;  3LWF A;  3FF5 A;  3L9F A;  1CGP A;  1QO0 D;  3EQL F;  3V7C A;  3M8E A;  3ECH A;  2HGC A;  5A2Q Z;  1O3T A;  5IT9 K;  1QGP A;  2M1B A;  3ERE D;  4U7D A;  5H20 A;  4RGX A;  2XGX A;  1ZLJ A;  4HF2 A;  4OIO F;  4IPA A;  5FFX A;  5E1Z B;  4UNO A;  1FBQ A;  2A5Y B;  5L3F A;  1UHW A;  5IT9 Z;  4NB5 A;  1RI7 A;  3KP2 A;  2ZNY A;  3ZMV A;  2DTR A;  1O3S A;  1P4X A;  5H6R A;  1ON2 A;  3F8M A;  5CLS A;  4P5O A;  4MGR A;  4BYY A;  4OIP F;  3BY6 A;  1G3S A;  3CUQ C;  1IW7 F;  5K5R A;  1D3Y A;  4MHG A;  3MEX A;  4FX0 A;  3ULQ B;  2ZJ2 A;  3CUQ B;  3RYR A;  1S3J A;  4HV5 A;  1SFX A;  3CUQ A;  3K9T A;  1MGT A;  4ESF A;  4LJZ F;  3MQ0 A;  3E6B A;  2KIM A;  1JXS A;  2J5P A;  3HOT A;  1ZRC A;  2VOO A;  1JHF A;  1XB4 A;  3CJN A;  3TGN A;  1B59 A;  2XAF A;  5F6F A;  2YX4 A;  4KMU X;  1R1T A;  1WI9 A;  2LKP A;  2A07 F;  1R1U A;  1SMY F;  2MA3 A;  1AOY A;  2CWE A;  4BHC A;  3KEO A;  2JT1 A;  3F8F A;  5ICG A;  1FYL A;  2GWR A;  2VBX A;  2W84 A;  1GXQ A;  4GXO A;  1ZRE A;  3HSR A;  4YG2 F;  3LA7 A;  1FZP B;  2BV6 A;  1GXP A;  3GWZ A;  5DCM A;  4G7H F;  4LGW A;  1YG2 A;  4G94 A;  3IL2 A;  3ML6 A;  4P9U A;  3EYI A;  1KU7 A;  4WXD A;  4M6Y A;  1ULY A;  2A69 F;  2KRF A;  2V1U A;  2FA5 A;  3IRQ A;  3F72 A;  1QZZ A;  4U88 A;  1YQA A;  1X3U A;  3LFK A;  2P7V B;  4EM0 B;  4G8X A;  4B8X A;  2K27 A;  3LA3 A;  5HVQ C;  2VXZ A;  1G6N A;  3KZZ A;  1U8R A;  3VFZ A;  3E6C C;  1ZLK A;  4O3M A;  1HW5 A;  3F8B A;  1LDD A;  3F8C A;  2NNY A;  1DDN A;  4EJT A;  2CSO A;  1XMK A;  2A61 A;  2D2W A;  1OYI A;  2WC2 A;  3K69 A;  3FX3 A;  2DK5 A;  1AWC A;  2QLZ A;  3PQK A;  4CZZ A;  2XUB A;  5DD4 A;  4HQM A;  1H9G A;  4IHS A;  4EQQ A;  5ILV A;  2C6Y A;  2MC3 A;  4I7H A;  2DI3 A;  5E1X A;  1BBY A;  3FMS A;  4CIC A;  4CGZ A;  2HFH A;  4KIC A;  5HS7 A;  1H0M A;  2K7L A;  2FEZ A;  1SMT A;  1T2K A;  2EWN A;  2ISY A;  1O57 A;  5HLI A;  4MTD A;  4TV7 A;  2H94 A;  4G7Z F;  2FMY A;  4AIJ A;  2OQR A;  5AIP A;  1O7L A;  3NQO A;  2V1D A;  1MJB A;  2ZCW A;  5CVJ A;  3N4M A;  4ENM A;  2YSR A;  2HTS A;  2PBI A;  3IRR A;  1SD5 A;  2D1V A;  4KIG A;  5LGU A;  2QBY A;  3G73 A;  3QPT A;  1S29 A;  5AIQ A;  4IVN A;  2VOP A;  1J7K A;  3ZP5 A;  3QP5 A;  2V9V A; 
#chains in the Genus database with same CATH topology
 1KYW A;  1LNW A;  3CZ6 A;  3HC7 A;  4C9Y A;  3OSF A;  4M3G A;  5GP9 A;  4ZH4 F;  5HDK A;  2GLO A;  3H9Q A;  3S2D J;  1X3W B;  3WE3 A;  5F1R A;  4F91 B;  2ZXJ A;  3HOY J;  3I53 A;  4AC0 A;  1HDD C;  3DQV C;  1P4A A;  1XSV A;  4ZJZ A;  2FU4 A;  2CUZ A;  2ESN A;  5F08 A;  5E3L A;  3BDD A;  2R93 J;  4IOA F;  1JKP C;  3BR0 A;  1R5H A;  3QOE A;  4Z2Y A;  2B7E A;  1RKT A;  1VQN I;  1A6Q A;  4JK1 X;  4D0P A;  1OLT A;  4KFC A;  1I6H J;  1XCV A;  1IUY A;  4IX7 A;  3GX4 X;  2ETH A;  2DA6 A;  2NVX J;  3MKW B;  1RUO A;  1A31 A;  1ZAR A;  1NG7 A;  2FX0 A;  3HOX J;  2JSC A;  4I76 A;  2B9S A;  1BI0 A;  1T33 A;  2N8G A;  2A6E F;  4Y15 A;  1SD4 A;  2BHY A;  4MFE A;  2Y9Z A;  2EIM H;  1B1B A;  4ZYH A;  5HDG A;  3J80 K;  2XDV A;  1OYW A;  1ZGW A;  4IZZ A;  1I50 J;  3RQI A;  2QA4 I;  1F4K A;  1B9N A;  2IP2 A;  3HOS A;  1FPQ A;  2G9W A;  2JA8 J;  1E3H A;  4XN0 A;  3K70 C;  3KX2 A;  3E1S A;  3SDB A;  1DP7 P;  3GTJ J;  3BPX A;  3U1D A;  5D5X B;  1UAA A;  2BOL A;  4Z6Y A;  3J7Z I;  2MW8 A;  3S1R J;  4I98 B;  3JAM Z;  2R7V A;  1SVL A;  2WAQ A;  2QQB A;  4BQO A;  5HS9 A;  3COA C;  4ZTF A;  4Q5S F;  1HC8 A;  2E19 A;  4ASN A;  1SAX A;  1SD6 A;  3TQN A;  4UUS A;  3QRF F;  1YO5 C;  1UST A;  3CES A;  3FXU A;  2KRH A;  2R3S A;  2F5E A;  5BNG A;  5BQT A;  2LC2 A;  2OPT A;  1W0T A;  3SHF A;  1MBJ A;  2MLG A;  3PSI A;  4OIN F;  1NK2 P;  3RPU A;  4JOM A;  1QU3 A;  2ZO4 A;  3GTK J;  3AL0 C;  2DOD A;  4CCM A;  3G4S I;  2NVY J;  5ED4 A;  1IXS B;  1WH5 A;  3F6O A;  3CCE I;  4ON0 A;  1K79 A;  1XDS A;  1ZN2 A;  5LBQ A;  4LIU A;  2R7Z J;  3OYM A;  1J0R A;  9ANT A;  2D5V A;  3RTR A;  4FAS D;  2BY3 A;  5HLH A;  2STT A;  1MNE A;  3AL0 B;  3BTC A;  2BE5 F;  1RES A;  5FD5 A;  1BL0 A;  5F64 A;  1H88 C;  2R5Y B;  3ZMS A;  1PP7 U;  3BR2 A;  3M4O J;  2Z16 A;  1YW8 A;  2M8E A;  2O9L A;  2XVC A;  3EYY A;  3KEQ A;  1IRX A;  3WG9 A;  3PNV A;  2DYR H;  2RN7 A;  5CVR A;  4F3Q A;  5CJ9 A;  1K78 B;  2D1H A;  2GOX B;  1RZ4 A;  1YI2 I;  1REP C;  2NS0 A;  5ILU A;  3DBH B;  4Q48 A;  2LY1 A;  2ELJ A;  1IDZ A;  1QBJ A;  2FQ3 A;  2V6C A;  3JAM K;  3JRG A;  5JHU A;  3DTI A;  4HNU A;  3DKX A;  4L9T A;  1WGX A;  3GLL A;  5EEH A;  1HST A;  2R7U A;  5LHG A;  1HKT A;  1TWA J;  1OJL A;  3LSG A;  5FLX K;  2FBI A;  1YIO A;  3U2R A;  3OL4 A;  4OOI A;  5F04 A;  3DEU A;  2R7S A;  3R4K A;  2K3F A;  1KU9 A;  2H6C A;  2Y75 A;  5D4R A;  2HKX A;  1B72 B;  4V19 K;  1YJN I;  2IA1 A;  2DA5 A;  4A3I J;  3HG9 A;  3IKT A;  4DNC A;  3CJT B;  1YW9 A;  2JPB A;  2LKX A;  3KYD B;  2QEN A;  3EDP A;  5TJJ A;  1YRN B;  3ABU A;  1JTX A;  4G7O F;  2MG4 A;  1U6G A;  2ZNZ A;  2HPI A;  1UB9 A;  3O3K A;  1EH7 A;  4BQN A;  4GDF A;  2EZI A;  2Y31 A;  2KKO A;  2ZBK A;  1FOK A;  1FBU A;  3JR9 A;  1FSE A;  2CFX A;  2EFO A;  2FUG 2;  1AKH A;  4KNY A;  3R0A A;  2VPR A;  1WPK A;  3I5U A;  1FLI A;  3CMY A;  4YFX F;  2XIG A;  4UHT A;  1KQ0 A;  1P6R A;  2QWW A;  2LOO A;  2K9N A;  4MEY F;  5B66 C;  5EYR A;  2KL4 A;  4CZC A;  1XGS A;  2JRT A;  5B1A H;  2Z3Y A;  2KJC A;  2HYF A;  3WTU C;  1IO2 A;  4RGR A;  5F0H A;  4OIQ F;  4S0H B;  4FX4 A;  3IV5 A;  5CVV A;  1VTN C;  4I2O A;  2PJR B;  1IXR C;  5GTI C;  4L0Z B;  4YEL A;  2EH3 A;  2O0Y A;  3IC7 A;  3MKZ A;  3DTK A;  2KT0 A;  1ACI A;  1ORK A;  1LFB A;  5GAD J;  2X48 A;  5D6F A;  3E5Q A;  1IRF A;  3W2A A;  2GM4 A;  5KAI C;  2ID3 A;  3DCF A;  3HIF A;  4HBL A;  1SAN A;  2F4M B;  5K5Q A;  3DP7 A;  4F7Z A;  3RI4 A;  4XOR A;  2GOM A;  5LRS A;  1J75 A;  1MMD A;  3OYK A;  1G59 A;  2BEO A;  2VT3 A;  5M5Y J;  3FIW A;  3F9K A;  2LNB A;  2UZK A;  2LK2 A;  4CYD A;  2M8G X;  3E5U A;  4AYB N;  3HEF A;  2BGC A;  1N77 A;  4E7H A;  3HRM A;  2CQN A;  3QP6 A;  2DA1 A;  1DP3 A;  6PAX A;  3LSP A;  2IGM A;  5GAG J;  1Z3Y A;  4J19 A;  4M72 A;  4A0Y A;  1P4W A;  1R58 A;  3EUH C;  3J80 Z;  1XX5 A;  1VF9 A;  1J5Y A;  1Z7U A;  1BJA A;  2UV1 A;  1HCR A;  4UUV A;  3LA2 A;  2NOJ B;  4LK1 F;  2P81 A;  1IN6 A;  3M8J A;  3QYE A;  4E7J A;  5L3D A;  4AIK A;  2P4W A;  3ESW B;  1YW7 A;  5KK1 A;  1UCR A;  1IGN A;  1D8K A;  2HDW A;  2EZL A;  1U9O A;  2DO7 A;  2IS4 A;  1U5T C;  5EGO A;  3L00 A;  5IY5 H;  2E36 A;  2LMD A;  3K1M A;  3BQY A;  4M9X A;  4F93 B;  2CW0 F;  3BCB A;  2A5W A;  4KN7 X;  5E17 F;  2HEO A;  2RVC A;  1BA5 A;  3M1E A;  4XKC A;  1MZB A;  3TO7 A;  1XGM A;  2O5R A;  2OD5 A;  2P5V A;  2R7Q A;  3E7L A;  2ME6 A;  4XIC A;  3HOV J;  2R0Q C;  3E0J B;  2NXN B;  5DS9 A;  2LFB A;  5BMZ A;  1U0J A;  2QBY B;  4BJ5 C;  4EV0 A;  3V42 A;  1QHG A;  2BBY A;  4HF0 A;  2Z99 A;  1IN4 A;  2PG4 A;  1FY7 A;  1JTY A;  4M9S A;  4LD5 A;  4QSH A;  1XMA A;  4A3D J;  3BJO A;  2KP6 A;  4EVI A;  2EJR A;  3G3Z A;  4BXF A;  3MZH A;  1QA6 A;  4E7L A;  3KZI C;  3GO5 A;  1L0O C;  1QZY A;  2VC0 A;  5FD6 A;  1LUJ B;  3HXL A;  1X1A A;  1Q1V A;  1R5I D;  5B5E C;  4AWX B;  2MBF A;  2QF7 A;  2F48 A;  3EET A;  5BPD A;  4LG0 B;  4LG3 A;  3KP5 A;  2HYG D;  2JMW A;  5FRO A;  2BY1 A;  5BOX A;  1R49 A;  2IEK A;  2HOS A;  2XRO A;  4PGH A;  3VOD A;  4ABZ A;  1BOA A;  3DV8 A;  3TW6 A;  1SFO J;  4CYC A;  2YR2 A;  1BIA A;  4RA2 A;  1W7P A;  2DA3 A;  4UXN A;  2R5Z B;  2LD5 A;  3S1M J;  3QPL A;  3JRA A;  3RKX A;  4F52 A;  5D5W B;  3CCS I;  1T0F A;  1DQU A;  2JN6 A;  2EFQ A;  2L9N A;  2HDC A;  3HHH A;  1CF7 B;  3ZXS A;  1K83 J;  4B3X A;  5EDN A;  2IA2 A;  2P5K A;  4BE0 A;  3TO6 A;  1P2F A;  3E6M A;  1Z05 A;  2VKE A;  3P9C A;  3BOQ A;  4GO1 A;  1FC3 A;  2CS3 A;  3C2G A;  4ETS A;  2X85 A;  3HTS B;  5D8L B;  3SZP A;  2JRM A;  5ICF A;  1YFH A;  2NYX A;  2L7K A;  2ESH A;  2KIQ A;  5B3S H;  2TDX A;  3DPU A;  1EJ9 A;  3A4C A;  2YU9 J;  1VQ8 I;  3RZO J;  1EH6 A;  1KU3 A;  1MMG A;  4Q47 A;  1BJZ A;  2TRT A;  2AXL A;  2AO9 A;  1T08 B;  2Y69 H;  4XSX F;  3KCC A;  2F4O B;  4W97 A;  3ZQI A;  1SVM A;  4WXC A;  5ILS A;  2FD5 A;  1EA3 A;  2EFN A;  3G71 I;  2PN6 A;  1MMA A;  1AKH B;  4CXF A;  1H9T A;  2XAU A;  1R22 A;  5D5V B;  3L2R A;  1QZE A;  4ANJ A;  2XRN A;  2H09 A;  2W00 A;  5B1B H;  4JBA A;  3FXL A;  2R7T A;  1EV7 A;  3L2U A;  2XSD C;  3WHB A;  2W24 A;  2P7C B;  4HX8 A;  3BZC A;  5E20 A;  2EB7 A;  4I01 A;  3OYG A;  1YYV A;  1XGO A;  1YS6 A;  3H1C A;  1LEB A;  1KZH A;  3LL7 A;  2LKS A;  2XRL A;  3CO7 C;  2JVG A;  5J1R A;  3QYF A;  5FLX Z;  3MFK A;  4GYG A;  5K7Z A;  2BY0 A;  2OCE A;  5JLX A;  1R5G A;  4EGY A;  1SD7 A;  3W2W A;  1RR7 A;  3CLO A;  5HNH A;  4G6D A;  2F5F A;  2HI3 A;  3QU3 A;  1IRZ A;  2DMN A;  3LSJ A;  4BE1 A;  3K6G A;  5C3E J;  3C2B A;  1KQ8 A;  2HQR A;  4ITV A;  1T98 A;  1JGS A;  2FNA A;  1MMN A;  2ICW G;  1IN7 A;  3JTG A;  4E7K A;  4FE7 A;  2B63 J;  4OAZ A;  4IHV A;  2F4I A;  4ENJ A;  3O6B B;  1DUX C;  3T0Y A;  2E2H J;  1D0Y A;  4A0Z A;  5FJ8 J;  1WRJ A;  2IGK A;  5DDG A;  3DTE A;  4PJJ A;  1WSU A;  2K9Q A;  2Z9O A;  3HOZ J;  2XHK A;  3SQN A;  3Q0V A;  2AQF A;  3FXQ A;  2VQL A;  3K4K A;  4YIR X;  3CCV I;  1APL C;  1I27 A;  2M45 A;  4RMN A;  4XRS G;  3WGH A;  3GYH X;  2MC4 A;  1ZG3 A;  3BJ6 A;  3VPR A;  2OQG A;  3OIQ A;  4D5F A;  3FK7 A;  2GXB A;  3OR2 C;  3KPH A;  3WTS C;  2EPF A;  4N4O B;  2VKV A;  4HYE A;  1JGG A;  1JT6 A;  1Y0U A;  3A03 A;  5FFZ A;  2XV4 S;  2UXX A;  2KIS A;  5HOO A;  4XOT A;  4B47 A;  1MH4 A;  2OCC H;  3CTA A;  2G7U A;  2DW4 A;  3IH3 A;  1IF1 A;  4I02 A;  4PSW A;  3TL4 X;  4BEH A;  1F5T A;  4EM1 A;  3W6K B;  4DW6 A;  3HGG A;  1LFU P;  1NHA A;  3I0T A;  4XKV A;  4HDV A;  2GIZ A;  2MSY A;  1K4T A;  3KIO A;  5CQE A;  1IZ1 A;  1R23 A;  2V26 A;  1LB2 A;  1I1G A;  1LDK B;  4PJL A;  3LST A;  3VYT B;  1N78 A;  3CJQ B;  5D4S A;  2VE8 A;  2VBZ A;  1F1Z A;  3O2P E;  4HLY A;  3PQJ A;  4YEJ A;  1O7F A;  2HR3 A;  3ZN0 A;  4BXU A;  5K7F A;  5LLQ A;  2DJI A;  5CQG A;  1TW2 A;  3L2Q A;  4WX9 A;  1ZQ3 P;  2STW A;  2IS1 A;  2BVL A;  5J1Y A;  5DUK A;  2E71 A;  4N9H A;  4BL0 B;  3SZG A;  3WU1 B;  3ZMD A;  2E1O A;  1W0U A;  2HVS A;  3H5N A;  1WFX A;  1PP8 F;  1YIJ I;  1TZL A;  2QZ8 A;  5IP7 J;  3T8T A;  3TDU C;  5M3F J;  1Y1V J;  5C4X J;  4LLL A;  4UUS B;  4DBQ A;  3OSG A;  1AA7 A;  4YFK F;  5DD8 A;  4QPO A;  4XLP F;  3S1N J;  5L3C A;  3ABK H;  3E3V A;  4EMS A;  2IXS A;  4A3F J;  3OYB A;  1M1E B;  2GA2 A;  1JKO C;  3BRO A;  4WWC A;  1VQL I;  2BHZ A;  3CLQ A;  1NH3 A;  1U9N A;  1Y8Q B;  2XPV A;  3TOB A;  3JW4 A;  5GAH J;  3I59 B;  3WTY C;  3PIO F;  3H9G A;  2R7O A;  5BS6 A;  1BM9 A;  1V55 H;  5GAE J;  4ZYD A;  2PX9 A;  5KAF C;  4QWQ A;  3J7A O;  3HRU A;  1DPR A;  4XLA A;  2B0L A;  2VN2 A;  1WVR A;  3D1N I;  3M1C A;  3V4G A;  1ZTR A;  5JI6 A;  4DIQ A;  4L0Y B;  1XN7 A;  3QWL A;  1I39 A;  2GZW A;  4OMZ A;  3F0C A;  2DPU A;  4IQJ A;  2NRA C;  2BW3 A;  1W36 C;  5EZG A;  3IH2 A;  2Z1D A;  5D8K B;  3ZPL A;  2LP0 A;  3S2H J;  4LIT A;  1XMX A;  2JPC A;  1W5S A;  1Q1H A;  4K2E A;  2KPM A;  3O8G A;  4UVC A;  3TO9 A;  5IOY A;  1JJ6 C;  2ISZ A;  2VI6 A;  2K85 A;  2OA4 A;  2CGP A;  3AG1 H;  2A05 A;  1LJ9 A;  1YE9 A;  2IGN A;  4KN4 X;  1RRJ A;  2Q0O A;  2OUM A;  4XRF A;  3PFY A;  2ZXH A;  2NAZ A;  2ECC A;  3GEZ A;  4NNJ A;  2R92 J;  1OCO H;  3K70 D;  2O3F A;  1FWZ A;  2DK8 A;  3BR5 A;  5IP6 A;  4ZDL A;  3RKY A;  2JA6 J;  3GXO A;  3ELK A;  2HS5 A;  3FHZ A;  2QSH X;  1XPX A;  1YIT I;  3WGG A;  4KIT B;  1FJL A;  3CC2 I;  4YFN F;  3HKZ A;  2KZV A;  3CDL A;  3LSH A;  4S05 A;  3ZN1 A;  1HF0 A;  1PUE E;  4HRI A;  2ZSI B;  4L5E A;  4BJT A;  2IPQ X;  3GFI A;  2EIL H;  3BP8 A;  4CCK A;  2DQR A;  1K78 A;  1TT5 B;  2ZFU A;  1HOM A;  1T6S A;  2IW5 A;  3REO A;  1JKR C;  4RGU A;  2MH9 A;  3NRV A;  1U5T B;  4LG0 A;  5H6Q A;  4LLN A;  3PSF A;  5HLG A;  3ZQ7 A;  1ON1 A;  1QHH D;  4WCG A;  5LGT A;  1FOX A;  1MD0 A;  4O5V A;  4LK0 F;  1ZH5 A;  1BR4 A;  4R1H A;  1R36 A;  4RAF A;  1S7A A;  1ZGJ A;  1UZC A;  4KYW A;  1A36 A;  1HSJ A;  3FDY A;  2BXZ A;  3MZY A;  3BPV A;  1X2N A;  4AIH A;  4R79 A;  4II3 A;  2JUG A;  3ROU A;  1RUN A;  2E1M B;  3A0H C;  4XNF A;  2P0W A;  3C18 A;  3I3L A;  4D7M A;  3AAF A;  4A5M A;  1R71 A;  1RET A;  1BI1 A;  3CCR I;  3I64 A;  4ZDP A;  5E3M A;  2VPL A;  2O61 A;  5FLM J;  3QU6 A;  5JVT A;  1KGS A;  1I5Z A;  5BPI A;  1OQY A;  2P8T A;  3FXJ A;  4WF2 A;  4LMY A;  1FBS A;  5J8F A;  1O3Q A;  3JRC A;  2XF6 A;  1V4R A;  2BXY A;  2X6O A;  1TNS A;  2AS5 F;  2H6B A;  1Z3X A;  2O6G E;  1SFE A;  1ERD A;  4R8H A;  2K02 A;  2DT6 A;  2KQR A;  2HKO A;  3RIR A;  3VYS B;  5K1Y A;  1STZ A;  2L0K A;  5L3E A;  5A2Q K;  1LQ1 A;  3KP4 A;  3KEY A;  4OAY A;  3NWT A;  4ZZD A;  3J81 Z;  3L1P A;  4IRG A;  2IRF G;  1MBK A;  1X1D A;  2CV0 A;  1OPC A;  5J6X A;  3JRF A;  5IT3 A;  2M7A A;  5ERI A;  2OZU A;  4Y3O A;  4FE4 A;  1ETW A;  3OOP A;  5E8G A;  1B9M A;  3OL3 A;  2QUF A;  1JUM A;  3K4B A;  2H27 A;  5K7H A;  4GCV A;  3M3Y J;  4H0E A;  4U87 A;  1IDY A;  1A5J A;  4UV9 A;  3CQZ J;  2EIJ H;  3OOU A;  4ZYA A;  4A2U A;  5CVI A;  1BI3 A;  1UMQ A;  4U0W A;  5IYD J;  4IKF A;  2H8R A;  2LR8 A;  4ZC3 A;  2JZY A;  4RM3 A;  2JA2 A;  3HSE A;  4A3B J;  4E7Z A;  4M73 A;  2Y2Z A;  1B8I B;  1KQ9 A;  3MAJ A;  3FM5 A;  3ECO A;  3F8N A;  2K86 A;  2WWY A;  2E5N A;  3GZN B;  4RBO A;  3I54 A;  4RAZ A;  1OCT C;  3PUB A;  3RKQ A;  1B8I A;  4LB6 B;  3V7R A;  2CMP A;  1AU7 A;  2PMZ N;  1TC3 C;  2X4H A;  2ELK A;  4L5I A;  1LE8 B;  5DCM B;  2WY7 Q;  3CDH A;  4M3D A;  2HXI A;  1SC7 A;  3UKG A;  3MWM A;  3T1B A;  3S17 J;  2XB5 A;  3OS1 A;  1YJ9 I;  2KDZ A;  2H1L A;  3A2K A;  4BXX J;  2COM A;  4DYQ A;  2DA2 A;  2VJ4 A;  1HKQ A;  2HU9 A;  3SXY A;  4P55 A;  5D5U B;  2VKD A;  4PGG A;  3CC4 I;  1ZRF A;  4BNC A;  2DPD A;  2ZME C;  4CA0 A;  3N97 A;  2CO5 A;  3JSP A;  4BDY A;  4PFO A;  5FGM A;  1D5V A;  2TCT A;  3V7S A;  5CVU A;  4XLC A;  4RAY A;  2H8W A;  2LF8 A;  2DMP A;  3ZGK A;  2WY8 Q;  3SZT A;  4MQV A;  3BT9 A;  4B3A A;  2L9R A;  4IOC F;  2RNG A;  1T8I A;  1VND A;  2M0M A;  4NHJ A;  1SVO A;  4BKX A;  2XAS A;  5IP9 J;  4PFP A;  4P96 A;  2XPW A;  1Z67 A;  5FLV A;  2CUF A;  2GBY A;  1E3O C;  2EIK H;  1XDU A;  5LRR A;  2E5Z A;  4Q4Z F;  3JSO A;  2XKO A;  4X0G A;  1PYV A;  1XTA A;  2VXD A;  3BC8 A;  5FO5 A;  4M3B A;  3GCM A;  4GGG A;  4RLQ A;  4PDK A;  3WG7 H;  2V9K A;  1ZR4 A;  4L9V A;  1OKR A;  2YU3 A;  3TDZ C;  1I1S A;  3OV8 A;  1BI2 A;  3OYF A;  2V79 A;  3ZQH A;  3JRE A;  3KLN A;  4HA8 A;  4N4N B;  4I99 C;  4FHT A;  4A6E A;  4B48 A;  2PI0 A;  4XMY A;  2RV8 A;  5F1J A;  1Y1W J;  3ZOB A;  1S9H A;  3KYC B;  2W4S A;  3FKI J;  3GFL A;  2X0L A;  3CUO A;  4Y33 A;  2CG4 A;  3ABL H;  3LNQ A;  5FKK A;  3GVA A;  3T8R A;  2HZT A;  4XK4 A;  4OIR F;  1G3T A;  2QKM B;  4PCQ A;  2FOW A;  2MLK A;  1VZ0 A;  4ENN A;  4A3G J;  2ZJR F;  2JVH A;  1UHS A;  2L9V A;  2V1N A;  3WOD F;  3VB2 A;  2JA7 J;  3H35 A;  1FNN A;  1SFU A;  1Z91 A;  3FMQ A;  3KP3 A;  5DTD A;  2CW7 A;  3G2B A;  2RKH A;  1QNT A;  4I6Z A;  3ZMU A;  4E7S A;  3A02 A;  2QSF X;  2CV1 A;  4PJM A;  2DOA A;  1WKM A;  5F0C A;  2VBY A;  3JTH A;  1TQI A;  2EIN H;  2ELH A;  1U78 A;  3WHC A;  1TLH B;  4O6J A;  4HST A;  2X1D A;  3ZQQ A;  3FKJ A;  2FNP A;  4HG2 A;  4KJZ A;  3AG4 H;  4A6D A;  4G9Y A;  4PZJ A;  2KIF A;  4Y17 A;  2KMU A;  3JRH A;  4KIS A;  2IJL A;  3GW2 A;  3CF5 F;  2E60 A;  1Y39 A;  1SEU A;  4L9N A;  1F9N A;  1YLF A;  2CYY A;  3FXR A;  4NBQ A;  5E18 F;  3H0D A;  4HEA 2;  4EAT A;  1MBH A;  2RAE A;  1KU2 A;  2DAO A;  1TWG J;  1DPU A;  4XBF A;  4EJV A;  1TP4 A;  1K6Y A;  3DPL C;  2XAH A;  1A04 A;  2DBB A;  1ZK8 A;  2WB1 A;  3HDD A;  2P6T A;  2ZC2 A;  4E6K G;  4FCY A;  2ECB A;  2FF4 A;  4PK4 A;  1BN5 A;  5L3B A;  2LSO A;  5IYC J;  5AON A;  3DEE A;  2HXO A;  2DA7 A;  2ID6 A;  3OS0 A;  1ETK A;  3WU2 C;  2HNH A;  5J8C A;  3IWZ A;  4KT6 A;  4D5C A;  3I4P A;  3KET A;  1IG7 A;  2P6S A;  4A12 A;  3S3N A;  4RB1 A;  1MDM B;  3DPT A;  5IOZ A;  1LVA A;  4IO9 F;  2K5C A;  1E2X A;  3W6J B;  2OC6 A;  3K0L A;  4I0B A;  4AVZ A;  2MYS A;  4KDP A;  4M74 A;  4W1U A;  5E79 C;  1U5T A;  4RB3 C;  2O8X A;  3CDI A;  1O4X A;  1X3Z B;  2OZ6 A;  4L5J A;  5KVR A;  2X1C A;  1QQI A;  2W48 A;  2EQR A;  2FML A;  2WBM A;  1ZHF A;  4WK8 F;  4U0Y A;  1HW1 A;  2DYS H;  4M6V A;  4XON A;  1UG2 A;  2RGV A;  4X6A J;  2E7X A;  4HSR A;  1PDN C;  1ZRD A;  1ZEL A;  1IXC A;  3Q0U A;  3MVP A;  2VT2 A;  4CH7 A;  5JR3 A;  2EBI A;  3DU5 A;  4EGZ A;  1ETO A;  3UNG C;  4BY7 J;  5FRM A;  2BVM A;  1W5C C;  3Q5F A;  3ERM A;  1W5T A;  3FBI B;  2WB1 N;  3H3Z A;  4YIF A;  4HV6 A;  1BC8 C;  2ME0 A;  3IWF A;  2VON A;  2HOE A;  2IA0 A;  3WTX C;  2Y0S N;  3ONQ A;  1D1A A;  3K4J A;  4E4H A;  2ACJ A;  2QQ8 A;  4CCO A;  1R4N B;  1N25 A;  2F2E A;  3TMO A;  4IHW A;  5D6E A;  2HTJ A;  2WAQ N;  3V8L A;  4DBR A;  3GZ5 A;  3OYL A;  3PFI A;  2V1X A;  1FX7 A;  1QVT A;  2NOG A;  5F0F A;  3IKV A;  4HNV A;  2E35 A;  1MSF C;  2GXA A;  1O3R A;  2XAJ A;  2ZB9 A;  3FM3 A;  4XLH A;  1P92 A;  1VQ5 I;  3DXJ F;  4A3J J;  3H92 A;  2FE3 A;  1OR7 A;  4C30 A;  1QPM A;  3Q9V A;  3BR3 A;  2CUJ A;  2L4M A;  1DU0 A;  1LPQ A;  2V9P A;  1FMV A;  1HXD A;  5DEQ A;  5M3M J;  5TRD A;  1X2M A;  2K9S A;  2DLL A;  2XPU A;  2EFP A;  4MQ9 F;  3F3X A;  3QOP A;  4IJA A;  1OFC X;  4XOP A;  3GTG J;  1V54 H;  4HF1 A;  3JRD A;  2OU2 A;  2GQQ A;  3S3O A;  2M30 A;  4A3K J;  4HDU A;  3M8F A;  4PJ0 C;  3KP7 A;  5EEA A;  5FKL A;  2MH2 A;  4DYR A;  4JQF A;  4B1R A;  3K4M A;  4XLE A;  4XN3 A;  5E8I A;  2O8K A;  3GTP J;  4DQ2 A;  4IHT A;  3H9J A;  5CYV A;  1TWH J;  4E70 A;  3B02 A;  4MFD A;  4Y7N J;  5FRN A;  4CO8 A;  1MDM A;  3MN2 A;  1TNT A;  4XM3 A;  3R0J A;  4AYB A;  5E1W A;  1MBE A;  3ZQC A;  3DU6 A;  2ZFW A;  1TTY A;  3VOE A;  3HJE A;  4CYC B;  4KUM A;  1DGW Y;  4FT8 A;  2VE9 A;  3PM1 A;  5J47 A;  1XC5 A;  1JE8 A;  3R61 A;  1BC7 C;  1WWX A;  1ETY A;  3CJR B;  4RS8 A;  4XKB A;  1R7J A;  2UXN A;  3ZMT A;  3ZRG A;  1FP2 A;  5CKT A;  3PNT A;  3BG9 A;  5EEG A;  2Z33 A;  2K4B A;  1BW5 A;  1Z21 A;  1S6L A;  1RKW A;  2GAU A;  4BHP A;  1Y6I A;  5HDN A;  3DLL F;  4RGS A;  1ITY A;  2HVR A;  1D8J A;  4UVB A;  1UHM A;  2VJI A;  1R9T J;  4LFU A;  3I71 A;  3CF2 A;  4C3H J;  1D0X A;  3F23 A;  2Q2E A;  2L02 A;  2XF7 A;  3V8K A;  4IRH A;  4D1Q A;  4X1E A;  3CP2 A;  1KON A;  3FWE A;  1JHH A;  3ZMZ A;  2M3A A;  3A0B C;  3F22 A;  3Q0W A;  3X2Q H;  1I6X A;  1UG0 A;  2WAF A;  3ZCO A;  1N75 A;  5IPA A;  1R6R A;  3TP3 A;  2JUC A;  2PEX A;  1Z6R A;  3J7A Y;  1FT9 A;  1QPI A;  1ZYR F;  4M3F A;  3GBG A;  3CMM A;  2QYO A;  2COB A;  3FMR A;  1IN5 A;  2JQ7 A;  5EGO B;  4EJW A;  1OR7 C;  1WJC A;  2VC1 A;  4GRI A;  1X1B A;  1G2H A;  3I9V 2;  4HQE A;  4IHY A;  4UVA A;  1MJA A;  3MKY B;  3P9K A;  2DJN A;  2X6X A;  3K4N A;  3E5X A;  1MIJ A;  2K4J A;  2ZXI A;  1TQP A;  1ZG5 A;  1T39 A;  1VQ9 I;  2VOD A;  2QQ9 A;  2PMH A;  2PFB A;  2R7W A;  4BE2 A;  2LDU A;  1TWC J;  1UFM A;  1NG6 A;  1OMI A;  1S7E A;  1UJ8 A;  2M87 A;  1FP1 D;  1J9I A;  3I58 A;  2XGC A;  4ESB A;  2DT7 B;  1ZGA A;  3RDI A;  1POG A;  4NQW A;  3KP6 A;  3GZ6 A;  3BZK A;  4MO7 A;  4QLC U;  2ZKZ A;  3HHG A;  3KLO A;  3D0S A;  2FJ1 A;  4L9J A;  4UB6 C;  3DBR B;  2ZSH B;  1QRY A;  1MH3 A;  1X1P A;  3OWT A;  2J5O A;  2NS7 A;  1R1V A;  1K6O A;  4GYI A;  2VBW A;  1Y8R B;  1I3Q J;  1CQT A;  4CDG A;  3D5R C;  1W4M A;  3RSN A;  4D7N A;  3ZQL A;  1IRG A;  3U21 A;  3HRS A;  3ZQG A;  4FET A;  2L5Q A;  1QVU A;  3S14 J;  5L3G A;  4P9F A;  4IRI A;  2L3D A;  4CUG A;  3Q3S A;  4XLN F;  4V2G A;  2HWV A;  2CUE A;  4E7I A;  3FXK A;  1W1W E;  3F6V A;  5LGN A;  1IJW C;  1G4D A;  1ODD A;  3RYP A;  4ZZL A;  2W25 A;  4AVP A;  1ETQ A;  5LHI A;  4XSZ F;  1VQ4 I;  2VUM J;  2A6H F;  4L18 B;  2RDP A;  2GXG A;  3ABM H;  4XRM A;  1HKS A;  1K61 A;  2EA4 A;  1WJ5 A;  3OYE A;  1H89 C;  2LBF B;  2KIU A;  3S2W A;  3TKY A;  3DEW A;  2EA2 A;  3I4M J;  2A68 F;  2Q2E B;  5FB2 A;  2HVQ A;  4EM2 A;  3K7A J;  3LMM A;  1G3Y A;  2RQP A;  4BEH B;  4JX6 A;  1FTZ A;  2EZH A;  2JSP A;  2WAE A;  2F5C A;  2R7R A;  1TW3 A;  1YRN A;  1WJA A;  3AG3 H;  2VJJ A;  2PQ8 A;  1Y0N A;  1OYY A;  2L54 A;  3GTO J;  1EH8 A;  3CME I;  1ZKG A;  1W7P D;  5LEK A;  3AFH A;  1S7O A;  3NAR A;  5DYM A;  2E7W A;  5JFR A;  2BYV E;  4WXH A;  3RKW A;  4LOC A;  4ESJ A;  4MEX F;  3BJA A;  3GFJ A;  2DXI A;  4RB2 C;  3C3W A;  1WZ2 A;  4M71 A;  1WI3 A;  3BR6 A;  2DQL A;  1VI0 A;  3H0G J;  1VQO I;  2ZME A;  4I09 A;  2OV7 A;  1Z7L A;  4M9Z A;  5DM6 F;  3OYD A;  4LIV A;  2QSG X;  2L01 A;  1BR2 A;  1H8A C;  2PJR A;  1Z6T A;  2VQH A;  3IH4 A;  2K3P A;  2DMU A;  3HOU J;  1BIB A;  5E3N A;  1HDP A;  2L4A A;  2M5W A;  4H4K C;  4EEF G;  4S04 A;  1IUF A;  3WTV C;  4M3E A;  5KHD A;  2EV6 A;  2HZD A;  2QM3 A;  2NVU B;  3ASO H;  3D5S C;  3RJP A;  4HAM A;  1J09 A;  4KA4 A;  2CQK A;  4BQA A;  3BG7 A;  1B4A A;  3H36 A;  4B4C A;  2PMU A;  3CCQ I;  4KIB A;  4ZTJ A;  2WTE A;  1SAU A;  2Y48 A;  4BAY A;  4A0X A;  5H2F C;  4C2T A;  2F6C A;  1OCC H;  3I59 A;  2E1N A;  4RB0 A;  3HPG A;  1Z9C A;  3L09 A;  2I5U A;  2IBD A;  1TQM A;  3B6C A;  1RPW A;  4BQQ A;  1WJB A;  2QGU A;  1X58 A;  3O8H A;  2VKH A;  1A6I A;  2UWM A;  3E6D A;  2IS6 A;  2JJ7 A;  3DF8 A;  3DBL B;  3C1D A;  3FZV A;  1XG1 A;  1IN8 A;  4AU7 A;  1BR1 A;  3GTL J;  1DU6 A;  3RZD J;  2JK3 A;  4QTR A;  3CO6 C;  1MKM A;  1HW2 A;  4EJU A;  1J59 A;  1HBX G;  3I4N J;  1X1C A;  4NC6 A;  4XLF A;  2O03 A;  2E34 A;  2M34 A;  5TIS C;  2DU9 A;  1GVJ A;  4BBR J;  5LEJ A;  2KJB A;  4U7B A;  3F21 A;  3LOC A;  1MSE C;  3LQR A;  3LAP A;  4BAC A;  1T95 A;  2YPR A;  1OCR H;  2WAD A;  2D45 A;  4AID A;  3V8J A;  3MD2 A;  3M9A A;  1C0W A;  4IXA A;  1XGN A;  2EFW A;  4BU2 A;  2VIX A;  3OYN A;  1FYK A;  4F92 B;  3FXO A;  3SYT A;  2YX7 A;  2Q8K A;  2MFZ A;  4M6X A;  2W57 A;  2CFO A;  4OMY A;  5ICE A;  5EF6 A;  1VQK I;  1TL8 A;  3LQQ A;  2QQA A;  2IAI A;  2CRG A;  1T0F C;  3RPU D;  1ONV A;  3LSR A;  4ZYG A;  4I0A A;  4ZYE A;  3A1Y A;  1FTT A;  2ZJQ F;  3Q9S A;  3SFI A;  3SFZ A;  2FOK A;  1U3E M;  4G6T B;  4CCN A;  4BBS J;  1LKX A;  2ADU A;  1FYM A;  3QAH A;  2KHM A;  2FRH A;  1RR8 C;  3GTM J;  1LE8 A;  4A3M J;  2K9L A;  4LLG F;  3IHU A;  1RNL A;  2DA4 A;  3LAJ A;  2M0C A;  3EUA A;  1Z77 A;  5J1U A;  3ABT A;  3PO2 J;  2RRE A;  2CU7 A;  3C2H A;  2MGQ A;  3JRB A;  1XSD A;  2OTL I;  1WH7 A;  3K2A A;  2DDB A;  3HTU A;  4IQ4 A;  4MNU A;  3VEP A;  2K9M A;  3HZJ A;  2ZXW H;  2ZJP F;  1G3W A;  5FKN A;  5K5O A;  1S5L C;  2ZME B;  5LHH A;  3OYA A;  3K2Z A;  4J00 A;  3VDX A;  3QQA A;  3NEU A;  1ZAO A;  2E1M C;  5GTH C;  4PUS A;  3SEQ A;  3MMY B;  2E1C A;  3VYR B;  3IP4 B;  4XR6 A;  4IL6 C;  3HYI A;  1LEA A;  3R6S A;  1RIO H;  3HUG B;  2YS9 A;  4KT5 C;  4HW0 A;  3NWS A;  2R7X A;  3MCZ A;  2IGO A;  2IT0 A;  4Y52 J;  3U9G A;  3BWG A;  2XAG A;  4Y4R A;  5F27 A;  3HM5 A;  3TOA A;  4KMF A;  3DKW A;  4QIW N;  2FXA A;  1GV5 A;  4ZDO A;  2DFF A;  3BG3 A;  3P7N A;  4NC7 A;  2RC4 A;  4BJ6 C;  1E17 A;  3C7J A;  1KYZ A;  5KNL A;  2VL8 A;  1USS A;  3M07 A;  5EZH A;  1V3F A;  2EK5 A;  3QPH A;  1V5G A;  2MD5 A;  3B73 A;  4KIF A;  4OU0 A;  2V7F A;  2XGD A;  2XAQ A;  3J81 K;  2I10 A;  3S93 A;  1WQ2 A;  2VB6 A;  3EUH A;  1L3L A;  2M2E A;  2CH0 A;  1X4P A;  3PUF A;  4UY8 I;  1D5Y A;  1XCB A;  1BOB A;  2Z2S B;  2CQX A;  4UV8 A;  2F5D A;  1CF7 A;  2QCO A;  3G1O A;  2FBK A;  2XKP A;  1LDJ A;  2CQ7 A;  3T5X A;  3TP0 A;  3HPH A;  4IHX A;  1J2X A;  4PSX A;  2L9S A;  3HSF A;  1Z1D A;  3W2V A;  1P7J A;  2L7M P;  5LFA A;  4FTH A;  1D1C A;  2DT5 A;  1VQ6 I;  2H1K A;  3A01 A;  3HUG A;  1D1B A;  4AD9 A;  2GIV A;  4YII A;  3P9I A;  2KLO A;  2IS2 A;  3CCJ I;  3WTZ A;  3KE2 A;  3GF2 A;  3R60 A;  1EKE A;  2R7D A;  2PMZ A;  2Z5U A;  4A3C J;  3H3V K;  3OR1 C;  2Q1Z B;  1I3A A;  3E97 A;  4BHB A;  1VFC A;  2QVO A;  3WU0 A;  1WJF A;  4C2U A;  2MAB A;  2IVM A;  2F5V A;  4G6Q A;  3S32 A;  4BY1 J;  2P5L C;  3CC7 I;  2XSJ C;  1OIS A;  2HOA A;  4A69 C;  4DZJ A;  4A3L J;  3DFG A;  1ETX A;  1HQC A;  2HQA A;  2WA0 A;  4ENK A;  1NTC A;  3L2C A;  4DOZ A;  3QPS A;  2Y30 A;  3HGY A;  1TWF J;  2FBH A;  4HX4 A;  2HQ5 A;  3H5R A;  3ZQF A;  4LB5 A;  3RPQ A;  2QKL B;  5DV5 A;  1XD7 A;  3HB9 A;  4HX7 A;  3CP8 A;  4IF4 A;  4Y13 A;  3K1N A;  2JA5 J;  5HS8 A;  3H3U A;  4DYC A;  3HL2 A;  3GTQ J;  4JX5 A;  4RLF A;  2OBP A;  4P1W A;  2DMT A;  3K1P A;  2NNN A;  5DCF A;  1WHU A;  1YS7 A;  3TED A;  4MTE A;  4C3J J;  4B09 A;  5ICC A;  3DLA A;  5EG0 A;  4HZF A;  2GA1 A;  3GUD A;  2Y0M A;  3L2W A;  3S8P A;  1JKQ C;  3WTT C;  2WV0 A;  4II2 A;  3G6E I;  2BW3 B;  1YJW I;  2RNJ A;  1IAW A;  3GLX A;  5J4Y A;  2JTV A;  2LVS A;  1W7P B;  2HQN A;  3PNY A;  4BGD A;  4BH9 A;  3KZY A;  1JT0 A;  3I56 I;  2L7F P;  1B6A A;  2A3S A;  1GHC A;  4V2F A;  3QOD A;  2Y0S A;  5GPA A;  3OIP A;  2DDA A;  4YRV A;  1K7A A;  2EV0 A;  4HLX A;  4CHU A;  3M7G A;  4MLO A;  4UUT A;  1S8N A;  1YTY A;  3KFW X;  3ISP A;  1B72 A;  1T38 A;  3BG5 A;  3CMA I;  1W36 D;  5DM7 F;  1ZG1 A;  1FIP A;  4G12 A;  3WTW C;  3AG2 H;  3OYH A;  3N05 A;  2X1E A;  5DUI A;  1TBX A;  4N0B A;  3GFM A;  1JUP A;  1K4S A;  3BZ6 A;  2WV1 A;  1WCM J;  3JCU C;  3WE2 A;  4XRS A;  2W85 A;  2NVQ J;  4HOB A;  2CV2 A;  1Z0X A;  3D5L A;  4C2M J;  1D0Z A;  2R7F A;  5EG0 B;  2AQE A;  2PLY A;  3S1Q J;  2G7H A;  1R00 A;  1P7I A;  3SDG A;  2DFI A;  3VWB A;  2OAZ A;  4MIM A;  2DTZ A;  2V6E A;  3MZ8 A;  4N9I A;  2VLA A;  1FSH A;  4J01 A;  2FSW A;  1KA8 A;  3WGI A;  1U2W A;  3L7W A;  4QPQ A;  4GFB A;  1JI8 A;  3HRT A;  4A5N A;  2EV5 A;  4EJO A;  1MNM C;  2VQG A;  2QEX I;  2PJP A;  1XSX A;  1YX5 A;  4U0V A;  3FIS A;  3P5J A;  2DOF A;  2NS8 A;  1S72 I;  2LF7 A;  1MJ9 A;  3LWF A;  3FF5 A;  3L9F A;  1MW7 A;  1FEX A;  4D9J A;  1QO0 D;  3EQL F;  1CGP A;  3PO3 J;  3V7C A;  3M8E A;  4CCJ A;  3ECH A;  1LFP A;  2HGC A;  5A2Q Z;  2XB0 X;  3BLY A;  1O3T A;  4XQF A;  2KFD A;  5IT9 K;  2LG4 A;  1V5F A;  1QGP A;  3LSI A;  2M1B A;  3ERE D;  4U7D A;  3DKY A;  1V5E A;  5H20 A;  2R4G A;  3TBI A;  1GV2 A;  2BZT A;  1MBG A;  4RGX A;  4XL9 A;  5C44 J;  2XGX A;  3OY9 A;  1ZLJ A;  3PIP F;  4HF2 A;  2MD0 A;  4OIO F;  4IPA A;  5FFX A;  4HPQ A;  4FIS A;  3W3C A;  2CQQ A;  1MMS A;  5E1Z B;  3BCA A;  4UNO A;  4NQW B;  3W6V A;  1FBQ A;  2A5Y B;  5FKO A;  5L3F A;  5C4J J;  1UHW A;  1WJD A;  3BQZ A;  2CJJ A;  2HOT A;  2M9H A;  1VQM I;  3FXM A;  5IT9 Z;  3IAM 2;  4NB5 A;  1GT0 C;  1RI7 A;  2OJE D;  4BDZ A;  4NC8 A;  3KP2 A;  2ZNY A;  3ZMV A;  2DTR A;  1O3S A;  1P4X A;  3LSM A;  3VSK A;  3OIO A;  5H6R A;  2LRE A;  1ON2 A;  3F8M A;  2RQQ A;  3SJM A;  5CLS A;  4P5O A;  5GPC A;  4MGR A;  4BYY A;  4OWR B;  4OIP F;  3BY6 A;  1G3S A;  5LD2 C;  1AHD P;  1FOY A;  3CUQ C;  1IW7 F;  2W82 A;  1E3P A;  5K5R A;  2HYJ A;  1D3Y A;  1FIA A;  4MHG A;  4BUP A;  1HLV A;  2KZG A;  3B6A A;  3MEX A;  1JUS A;  1FOW A;  4RDU A;  4FX0 A;  4XKW A;  3ULQ B;  2CW8 A;  2ZJ2 A;  2EZK A;  2LY9 A;  3CUQ B;  3RYR A;  3H5A A;  2R5Y A;  5JVG F;  1S3J A;  3FBN B;  3LSK A;  3VYU B;  4HV5 A;  1SFX A;  3CUQ A;  3K9T A;  1MGT A;  3K4L A;  4ESF A;  3IAS 2;  3K10 A;  4B44 A;  4JYK A;  2LY2 A;  1U8B A;  1RC9 A;  4LJZ F;  3MQ0 A;  2AHQ A;  3E6B A;  2KIM A;  3S16 J;  1JXS A;  3HOW J;  2J5P A;  3HOT A;  2BY2 A;  1ZRC A;  3HBL A;  3GME A;  4NUB A;  2VOO A;  1JHF A;  1XB4 A;  3CJN A;  2JWT A;  2E2I J;  3TGN A;  1B59 A;  2XAF A;  3FK6 A;  5F6F A;  3OS2 A;  2YX4 A;  3CCL I;  4KMU X;  1R1T A;  1WI9 A;  5FKM A;  4UB8 C;  1HA8 A;  2HDD A;  1ENH A;  2LKP A;  2A07 F;  1R1U A;  3S3M A;  2X51 A;  1SMY F;  3NAU A;  1E0E A;  5M5W J;  4C3I J;  2MA3 A;  2M4K A;  2W1O A;  4BS9 A;  1AOY A;  2CWE A;  4XID A;  3G1L A;  4BHC A;  3CCY A;  3KEO A;  2JT1 A;  2XGE A;  1OCP A;  3F8F A;  1VQ7 I;  5ICG A;  1FYL A;  2GWR A;  3RQ4 A;  2VBX A;  2W84 A;  1GDT A;  1GXQ A;  4GXO A;  2X6Y A;  1IV6 A;  3OMY A;  5JHF A;  1XS9 A;  1ZRE A;  1LVK A;  3HSR A;  5M5X J;  4YG2 F;  3LA7 A;  1FZP B;  2BV6 A;  1GXP A;  2I8D A;  3GWZ A;  5DCM A;  4G7H F;  4DZP A;  1R4M B;  1EF4 A;  5CPR B;  1NK3 P;  1JJ8 C;  1DGR M;  4LGW A;  4PJN A;  2LTP A;  1SFK A;  1PJR A;  1YG2 A;  4G94 A;  3PJR A;  3IL2 A;  3ML6 A;  1PVE A;  1VQP I;  2LLK A;  3ASN H;  2X9D A;  3RCO A;  2M7B A;  3U1K A;  4P9U A;  1GVD A;  2W7N A;  3EYI A;  1A35 A;  1YHQ I;  1WJE A;  1YX3 A;  2KRC A;  1F36 A;  4FQG A;  4RM2 A;  2UUZ A;  3A01 B;  1KU7 A;  3PL8 A;  2DN0 A;  1Y56 A;  4WXD A;  2X6W A;  4M6Y A;  1ULY A;  2A69 F;  1X4O A;  2KRF A;  2V1U A;  2DFE A;  2FA5 A;  3UR3 C;  2DFH A;  2V4J C;  3MKL A;  2LH9 A;  3IRQ A;  3F72 A;  1QZZ A;  3SEZ A;  3EUK L;  3LFU A;  3OYJ A;  4A3E J;  4U88 A;  1YQA A;  1X3U A;  2Y9Y A;  3LFK A;  2DCE A;  1YOV B;  2P7V B;  3CD6 I;  5E3O A;  4EM0 B;  4G8X A;  1T56 A;  3JRI A;  5EJC A;  5IYB J;  5TGT A;  4B8X A;  4IEJ A;  2K27 A;  3LA3 A;  5HVQ C;  2VXZ A;  3S15 J;  4CCL A;  1FMW A;  4F55 A;  1BW6 A;  3AKZ A;  3BR1 A;  5HOD A;  1G6N A;  3CCU I;  3KZZ A;  1U8R A;  4AM3 A;  3VFZ A;  3CCM I;  1IV8 A;  3E6C C;  1MND A;  1ZLK A;  4O3M A;  1HW5 A;  2DOE A;  3VSL A;  4CSW A;  1UEL B;  2G0E A;  5J40 A;  5HLT A;  3F8B A;  1LDD A;  2L7Z A;  3F8C A;  3DWL E;  5HNF A;  2VJ5 A;  3K4C A;  2NNY A;  1DDN A;  2R5Z A;  4EJT A;  3QYB A;  5J4V A;  2CSO A;  1XMK A;  4B43 A;  1TT0 A;  2A61 A;  3TW7 A;  2A6T A;  2D2W A;  1OYI A;  2WC2 A;  3KYL A;  3K69 A;  3FX3 A;  2HPM A;  2DK5 A;  4JP0 A;  4JX4 A;  1AWC A;  2QLZ A;  3PQK A;  4CZZ A;  1IC8 A;  4RAG A;  5JLW A;  2XUB A;  5DD4 A;  4HQM A;  2XF5 A;  3BTI A;  3OYC A;  1PUF A;  1H9G A;  3J7Y J;  2E2J J;  4IHS A;  3BG6 A;  1P9Q C;  3G1M A;  5J3L A;  4EQQ A;  5ILV A;  2C6Y A;  2MC3 A;  4I7H A;  1PUF B;  2LRD A;  4AUX A;  2DI3 A;  5E1X A;  3IUO A;  1BBY A;  3FMS A;  4CIC A;  1GLN A;  4CGZ A;  3OYI A;  2HFH A;  4KIC A;  2K40 A;  5HS7 A;  1H0M A;  2K7L A;  2YUS A;  2KDO A;  2FEZ A;  4HNT A;  1SMT A;  3EPZ A;  1T2K A;  2EWN A;  2ISY A;  1O57 A;  5HLI A;  4MTD A;  1G8X A;  1GUU A;  2M4G A;  4TV7 A;  1MBF A;  2H94 A;  2XC7 A;  4G7Z F;  2FMY A;  2LBF A;  2VQC A;  4AIJ A;  2OQR A;  1ZR2 A;  1ETV A;  5AIP A;  3HKZ N;  2AXT C;  1X19 A;  1O7L A;  2FQ4 A;  3NQO A;  4DJA A;  2VAS A;  4A93 J;  3ZR8 X;  2LYC A;  2V1D A;  1MJB A;  2ZCW A;  3FHN A;  5CVJ A;  3N4M A;  4NDL A;  4ENM A;  4DGW B;  5KCM A;  2YSR A;  2L2O A;  2HTS A;  2PBI A;  3IRR A;  2NVT J;  2OTJ I;  1SD5 A;  2O7O A;  3I55 I;  2D1V A;  4KIG A;  1OCZ H;  1F43 A;  5LGU A;  2QBY A;  3G73 A;  3QPT A;  2OF7 A;  3BTJ A;  1S29 A;  5AIQ A;  4IVN A;  2VOP A;  1J7K A;  3ZP5 A;  3L2V A;  2DMQ A;  3BTL A;  3QP5 A;  2V9V A; 
#chains in the Genus database with same CATH homology
 1KYW A;  1LNW A;  4ZH4 F;  5HDK A;  3WE3 A;  5F1R A;  2ZXJ A;  3I53 A;  3DQV C;  1P4A A;  1XSV A;  2FU4 A;  2ESN A;  3BDD A;  1R5H A;  4Z2Y A;  4JK1 X;  4D0P A;  4KFC A;  1XCV A;  1IUY A;  3GX4 X;  2ETH A;  1RUO A;  1ZAR A;  2JSC A;  1BI0 A;  4Y15 A;  2A6E F;  1SD4 A;  1B1B A;  4ZYH A;  5HDG A;  3J80 K;  1OYW A;  1F4K A;  1B9N A;  2IP2 A;  3HOS A;  1FPQ A;  2G9W A;  1DP7 P;  3BPX A;  3U1D A;  5D5X B;  4I98 B;  3JAM Z;  2QQB A;  5HS9 A;  3COA C;  4Q5S F;  4ASN A;  1SAX A;  1SD6 A;  3TQN A;  3QRF F;  1YO5 C;  1UST A;  3FXU A;  5BQT A;  2R3S A;  2F5E A;  3SHF A;  2MLG A;  4OIN F;  3RPU A;  2ZO4 A;  5ED4 A;  1IXS B;  3F6O A;  4ON0 A;  1K79 A;  1XDS A;  1ZN2 A;  5LBQ A;  1J0R A;  3RTR A;  2STT A;  5HLH A;  2BE5 F;  5FD5 A;  5F64 A;  3ZMS A;  1PP7 U;  1YW8 A;  2M8E A;  2XVC A;  3EYY A;  3KEQ A;  3WG9 A;  2RN7 A;  5CVR A;  5CJ9 A;  1K78 B;  2D1H A;  1RZ4 A;  1REP C;  2NS0 A;  5ILU A;  4Q48 A;  1QBJ A;  2FQ3 A;  2V6C A;  3JAM K;  5JHU A;  4L9T A;  5EEH A;  1HST A;  5LHG A;  1HKT A;  5FLX K;  2FBI A;  1YIO A;  3U2R A;  4OOI A;  3DEU A;  3R4K A;  5D4R A;  1KU9 A;  2H6C A;  2Y75 A;  1IRG A;  2HKX A;  2IA1 A;  3IKT A;  4DNC A;  1YW9 A;  2JPB A;  2QEN A;  3EDP A;  5TJJ A;  3ABU A;  4G7O F;  1U6G A;  2ZNZ A;  1UB9 A;  3O3K A;  1EH7 A;  2KKO A;  2ZBK A;  1FOK A;  1FBU A;  1FSE A;  2CFX A;  2EFO A;  4KNY A;  3R0A A;  3I5U A;  1FLI A;  4YFX F;  2XIG A;  4UHT A;  1KQ0 A;  1P6R A;  2QWW A;  4MEY F;  1XGS A;  2JRT A;  2Z3Y A;  2KJC A;  2HYF A;  3WTU C;  4RGR A;  4OIQ F;  4FX4 A;  5CVV A;  1VTN C;  4I2O A;  1IXR C;  4L0Z B;  2O0Y A;  3IC7 A;  5D6F A;  3E5Q A;  1IRF A;  3HIF A;  4HBL A;  5K5Q A;  3DP7 A;  4F7Z A;  3RI4 A;  5LRS A;  1J75 A;  2BEO A;  2VT3 A;  2LNB A;  2UZK A;  4CYD A;  3E5U A;  2BGC A;  3HRM A;  3QP6 A;  6PAX A;  4M72 A;  4A0Y A;  1P4W A;  1R58 A;  3J80 Z;  1J5Y A;  1Z7U A;  1BJA A;  4UUV A;  3LA2 A;  4LK1 F;  1IN6 A;  5L3D A;  4AIK A;  2P4W A;  1YW7 A;  5KK1 A;  1UCR A;  1D8K A;  2DO7 A;  1U5T C;  3L00 A;  3K1M A;  4M9X A;  2CW0 F;  4KN7 X;  5E17 F;  2HEO A;  2RVC A;  3M1E A;  1MZB A;  3TO7 A;  1XGM A;  2OD5 A;  2P5V A;  5BMZ A;  2QBY B;  4EV0 A;  2BBY A;  4HF0 A;  2Z99 A;  1IN4 A;  2PG4 A;  1FY7 A;  4M9S A;  4LD5 A;  1XMA A;  3BJO A;  4EVI A;  2EJR A;  3G3Z A;  3MZH A;  3GO5 A;  1L0O C;  1QZY A;  2VC0 A;  5FD6 A;  4AWX B;  2MBF A;  5BPD A;  3EET A;  4LG0 B;  3KP5 A;  2HYG D;  5BOX A;  2XRO A;  4PGH A;  3VOD A;  1BOA A;  3DV8 A;  2YR2 A;  1BIA A;  4UXN A;  1W7P A;  3RKX A;  2HDC A;  5D5W B;  1T0F A;  2EFQ A;  3HHH A;  1CF7 B;  2IA2 A;  2P5K A;  3TO6 A;  1P2F A;  1Z05 A;  3E6M A;  3P9C A;  3BOQ A;  4GO1 A;  1FC3 A;  4ETS A;  3HTS B;  5D8L B;  3SZP A;  5ICF A;  1YFH A;  2NYX A;  2ESH A;  2TDX A;  1EH6 A;  1KU3 A;  4Q47 A;  2AXL A;  4XSX F;  3KCC A;  4WXC A;  5ILS A;  2EFN A;  2PN6 A;  4CXF A;  1H9T A;  1R22 A;  5D5V B;  2XRN A;  2H09 A;  4JBA A;  1EV7 A;  2W24 A;  2P7C B;  4HX8 A;  5E20 A;  2EB7 A;  4I01 A;  1YYV A;  1XGO A;  1YS6 A;  1LEB A;  3CO7 C;  5FLX Z;  3MFK A;  4GYG A;  1R5G A;  4EGY A;  1SD7 A;  3CLO A;  4G6D A;  2F5F A;  3QU3 A;  1KQ8 A;  2HQR A;  1T98 A;  1JGS A;  2FNA A;  1IN7 A;  3JTG A;  4ENJ A;  3O6B B;  1DUX C;  3T0Y A;  4A0Z A;  1WRJ A;  5DDG A;  1WSU A;  2Z9O A;  2XHK A;  3SQN A;  3FXQ A;  1I27 A;  2M45 A;  3GYH X;  3WGH A;  1ZG3 A;  3BJ6 A;  2OQG A;  2GXB A;  3WTS C;  4HYE A;  1Y0U A;  5FFZ A;  2UXX A;  2XV4 S;  5HOO A;  3CTA A;  2G7U A;  2DW4 A;  1IF1 A;  4I02 A;  1F5T A;  4EM1 A;  3W6K B;  1NHA A;  3I0T A;  4HDV A;  1IZ1 A;  1R23 A;  1LB2 A;  1I1G A;  1LDK B;  3LST A;  5D4S A;  2VE8 A;  2VBZ A;  1F1Z A;  3O2P E;  4HLY A;  3PQJ A;  1O7F A;  2HR3 A;  3ZN0 A;  4BXU A;  5LLQ A;  1TW2 A;  4WX9 A;  2STW A;  5DUK A;  3WU1 B;  4N9H A;  3ZMD A;  1PP8 F;  2QZ8 A;  3T8T A;  3TDU C;  4LLL A;  4YFK F;  5DD8 A;  4XLP F;  5L3C A;  3E3V A;  4EMS A;  2GA2 A;  3BRO A;  4WWC A;  3TOB A;  3JW4 A;  3I59 B;  3WTY C;  5BS6 A;  1BM9 A;  4ZYD A;  4QWQ A;  3J7A O;  3HRU A;  1DPR A;  2B0L A;  2VN2 A;  3V4G A;  5JI6 A;  4L0Y B;  1XN7 A;  2GZW A;  4OMZ A;  2DPU A;  2NRA C;  5D8K B;  3ZPL A;  2JPC A;  1W5S A;  1Q1H A;  4K2E A;  4UVC A;  3TO9 A;  2ISZ A;  2OA4 A;  2CGP A;  1LJ9 A;  4KN4 X;  2Q0O A;  4XRF A;  2NAZ A;  3GEZ A;  2O3F A;  1FWZ A;  2DK8 A;  3RKY A;  3GXO A;  3ELK A;  2HS5 A;  3FHZ A;  3WGG A;  4YFN F;  4S05 A;  3ZN1 A;  1PUE E;  2IPQ X;  3GFI A;  3BP8 A;  2DQR A;  1K78 A;  1T6S A;  2IW5 A;  3REO A;  4RGU A;  2MH9 A;  3NRV A;  1U5T B;  4LG0 A;  5H6Q A;  4LLN A;  5HLG A;  3ZQ7 A;  1ON1 A;  4WCG A;  5LGT A;  1MD0 A;  4O5V A;  4LK0 F;  1ZH5 A;  4R1H A;  1R36 A;  1S7A A;  1ZGJ A;  4KYW A;  1HSJ A;  3MZY A;  3BPV A;  4R79 A;  4AIH A;  1RUN A;  3ROU A;  3C18 A;  3AAF A;  4A5M A;  1BI1 A;  3I64 A;  2O61 A;  3QU6 A;  5JVT A;  1KGS A;  1I5Z A;  5BPI A;  2P8T A;  4WF2 A;  4LMY A;  1FBS A;  5J8F A;  1O3Q A;  1V4R A;  2AS5 F;  1TNS A;  2H6B A;  2O6G E;  1SFE A;  4R8H A;  2K02 A;  5K1Y A;  2HKO A;  3RIR A;  1STZ A;  5L3E A;  5A2Q K;  1LQ1 A;  3KP4 A;  2IRF G;  3J81 Z;  4ZZD A;  4IRG A;  1OPC A;  5J6X A;  5IT3 A;  5ERI A;  2OZU A;  5E8G A;  3OOP A;  1B9M A;  2QUF A;  2H27 A;  4GCV A;  4H0E A;  4UV9 A;  4A2U A;  5CVI A;  1BI3 A;  4U0W A;  2JZY A;  3HSE A;  4M73 A;  1KQ9 A;  3MAJ A;  3FM5 A;  3ECO A;  3F8N A;  2K86 A;  2WWY A;  3I54 A;  4RAZ A;  4LB6 B;  3V7R A;  2X4H A;  4L5I A;  5DCM B;  3CDH A;  3MWM A;  3T1B A;  2COM A;  1HKQ A;  3SXY A;  4P55 A;  5D5U B;  4PGG A;  1ZRF A;  4BNC A;  2DPD A;  3N97 A;  2CO5 A;  3JSP A;  5FGM A;  1D5V A;  3V7S A;  5CVU A;  4RAY A;  2LF8 A;  3SZT A;  4MQV A;  4NHJ A;  2XAS A;  4P96 A;  1XDU A;  5LRR A;  4Q4Z F;  3JSO A;  2XKO A;  5FO5 A;  4GGG A;  4PDK A;  4L9V A;  1OKR A;  2YU3 A;  3TDZ C;  1I1S A;  3OV8 A;  1BI2 A;  2V79 A;  3KLN A;  4HA8 A;  4FHT A;  4A6E A;  2PI0 A;  2RV8 A;  3GFL A;  2X0L A;  3CUO A;  2CG4 A;  3GVA A;  3T8R A;  2HZT A;  4OIR F;  1G3T A;  4PCQ A;  2MLK A;  4ENN A;  3WOD F;  3VB2 A;  1FNN A;  1SFU A;  1Z91 A;  3FMQ A;  3KP3 A;  2RKH A;  1QNT A;  3ZMU A;  1WKM A;  2VBY A;  3JTH A;  1TQI A;  2ELH A;  1U78 A;  1TLH B;  4O6J A;  2FNP A;  4A6D A;  4G9Y A;  4PZJ A;  2KIF A;  4Y17 A;  2IJL A;  3GW2 A;  4L9N A;  1F9N A;  1YLF A;  2CYY A;  3FXR A;  5E18 F;  1KU2 A;  2DAO A;  1DPU A;  4XBF A;  4EJV A;  3DPL C;  2XAH A;  1A04 A;  2DBB A;  2P6T A;  2FF4 A;  1BN5 A;  5L3B A;  2LSO A;  5AON A;  5J8C A;  3KET A;  3IWZ A;  3I4P A;  2P6S A;  4A12 A;  4RB1 A;  1MDM B;  3DPT A;  1LVA A;  1E2X A;  3W6J B;  3K0L A;  4I0B A;  4KDP A;  4M74 A;  1U5T A;  4RB3 C;  2O8X A;  2OZ6 A;  4L5J A;  5KVR A;  1QQI A;  2FML A;  1ZHF A;  4WK8 F;  4U0Y A;  1HW1 A;  2RGV A;  2E7X A;  1PDN C;  1ZRD A;  1IXC A;  2VT2 A;  5JR3 A;  4EGZ A;  3Q5F A;  1W5T A;  3H3Z A;  4YIF A;  4HV6 A;  1BC8 C;  3IWF A;  2VON A;  2HOE A;  2IA0 A;  3WTX C;  2ACJ A;  2F2E A;  5D6E A;  2HTJ A;  3V8L A;  3GZ5 A;  3PFI A;  2V1X A;  1FX7 A;  3IKV A;  1O3R A;  2XAJ A;  3FM3 A;  1P92 A;  3DXJ F;  3H92 A;  2FE3 A;  1OR7 A;  1QPM A;  3Q9V A;  2L4M A;  5DEQ A;  1HXD A;  5TRD A;  2DLL A;  2EFP A;  4MQ9 F;  3F3X A;  3QOP A;  4IJA A;  4HF1 A;  2OU2 A;  2GQQ A;  2M30 A;  4HDU A;  3M8F A;  3KP7 A;  2MH2 A;  4JQF A;  5E8I A;  4DQ2 A;  4IHT A;  5CYV A;  4E70 A;  3B02 A;  4CO8 A;  1MDM A;  1TNT A;  3R0J A;  5E1W A;  2ZFW A;  1TTY A;  3VOE A;  4KUM A;  4FT8 A;  2VE9 A;  1JE8 A;  3R61 A;  1BC7 C;  1WWX A;  4RS8 A;  1R7J A;  2UXN A;  3ZMT A;  1FP2 A;  5EEG A;  2Z33 A;  2K4B A;  1S6L A;  2GAU A;  4BHP A;  5HDN A;  4RGS A;  1D8J A;  4UVB A;  1UHM A;  4LFU A;  3I71 A;  3F23 A;  2Q2E A;  2L02 A;  3V8K A;  4IRH A;  3FWE A;  1JHH A;  3ZMZ A;  3F22 A;  1I6X A;  2PEX A;  1Z6R A;  1FT9 A;  1ZYR F;  2QYO A;  3FMR A;  1IN5 A;  4EJW A;  2VC1 A;  4HQE A;  4UVA A;  1MJA A;  3P9K A;  3E5X A;  2K4J A;  1TQP A;  1ZG5 A;  1T39 A;  2VOD A;  2QQ9 A;  2PMH A;  2PFB A;  2LDU A;  1UFM A;  1OMI A;  2M87 A;  1J9I A;  1FP1 D;  3I58 A;  4ESB A;  1ZGA A;  3RDI A;  4NQW A;  3KP6 A;  3GZ6 A;  4QLC U;  2ZKZ A;  3HHG A;  3KLO A;  3D0S A;  4L9J A;  2J5O A;  1R1V A;  1K6O A;  4GYI A;  2VBW A;  4CDG A;  1W4M A;  3HRS A;  5L3G A;  4P9F A;  4IRI A;  2L3D A;  4XLN F;  2HWV A;  3F6V A;  5LGN A;  1G4D A;  1ODD A;  3RYP A;  4ZZL A;  2W25 A;  4AVP A;  5LHI A;  4XSZ F;  2A6H F;  4L18 B;  2RDP A;  2GXG A;  1HKS A;  2EA4 A;  3S2W A;  2KIU A;  3TKY A;  2EA2 A;  2A68 F;  5FB2 A;  4EM2 A;  1G3Y A;  2RQP A;  2F5C A;  1TW3 A;  2PQ8 A;  1OYY A;  2L54 A;  1EH8 A;  5LEK A;  1W7P D;  1S7O A;  5DYM A;  2E7W A;  5JFR A;  2BYV E;  4WXH A;  3RKW A;  4ESJ A;  4MEX F;  3BJA A;  3GFJ A;  4RB2 C;  3C3W A;  4M71 A;  2DQL A;  2ZME A;  4I09 A;  4M9Z A;  2L01 A;  1Z6T A;  1BIB A;  2L4A A;  2M5W A;  4S04 A;  3WTV C;  2EV6 A;  2QM3 A;  3RJP A;  4BQA A;  4KA4 A;  4HAM A;  2CQK A;  1B4A A;  2PMU A;  4KIB A;  2WTE A;  2Y48 A;  4BAY A;  4A0X A;  3I59 A;  2E1N A;  4RB0 A;  1Z9C A;  3L09 A;  1TQM A;  2UWM A;  3E6D A;  3DF8 A;  3C1D A;  3FZV A;  1IN8 A;  3CO6 C;  1MKM A;  1HW2 A;  4EJU A;  1J59 A;  1HBX G;  2O03 A;  2DU9 A;  1GVJ A;  5LEJ A;  2KJB A;  4U7B A;  3F21 A;  3LQR A;  3LAP A;  2YPR A;  2D45 A;  3V8J A;  3M9A A;  1C0W A;  4IXA A;  1XGN A;  2EFW A;  1FYK A;  2YX7 A;  2Q8K A;  4M6X A;  2W57 A;  4OMY A;  5ICE A;  3LQQ A;  2QQA A;  1ONV A;  4ZYG A;  4I0A A;  4ZYE A;  3Q9S A;  3SFZ A;  2FOK A;  1U3E M;  2ADU A;  1FYM A;  3QAH A;  2FRH A;  4LLG F;  3IHU A;  1RNL A;  3LAJ A;  3ABT A;  1XSD A;  3HTU A;  4MNU A;  3VEP A;  1G3W A;  5K5O A;  2ZME B;  5LHH A;  3K2Z A;  3NEU A;  1ZAO A;  2E1C A;  1RIO H;  3HYI A;  1LEA A;  3R6S A;  4KT5 C;  4HW0 A;  3MCZ A;  2IT0 A;  3U9G A;  3BWG A;  2XAG A;  3TOA A;  4KMF A;  3DKW A;  2FXA A;  3P7N A;  2RC4 A;  1E17 A;  3C7J A;  1KYZ A;  1USS A;  1V3F A;  2EK5 A;  3QPH A;  4KIF A;  2MD5 A;  3B73 A;  4OU0 A;  2XAQ A;  3J81 K;  1WQ2 A;  3EUH A;  1L3L A;  1XCB A;  4UV8 A;  2F5D A;  1CF7 A;  2FBK A;  2XKP A;  1LDJ A;  3T5X A;  1J2X A;  3HSF A;  1Z1D A;  2DT5 A;  3HUG A;  4AD9 A;  2GIV A;  4YII A;  3P9I A;  3WTZ A;  3KE2 A;  3GF2 A;  3R60 A;  2R7D A;  2Z5U A;  3E97 A;  4BHB A;  2QVO A;  3WU0 A;  2IVM A;  4G6Q A;  2P5L C;  3DFG A;  1HQC A;  4ENK A;  3L2C A;  2FBH A;  4HX4 A;  4LB5 A;  3RPQ A;  5DV5 A;  1XD7 A;  4HX7 A;  4IF4 A;  4Y13 A;  3K1N A;  5HS8 A;  3H3U A;  2OBP A;  3K1P A;  2NNN A;  5DCF A;  1YS7 A;  4MTE A;  4B09 A;  5ICC A;  4HZF A;  2GA1 A;  3GUD A;  2Y0M A;  3WTT C;  2WV0 A;  2RNJ A;  1IAW A;  3GLX A;  2JTV A;  1W7P B;  2HQN A;  4BH9 A;  3KZY A;  1B6A A;  2A3S A;  1GHC A;  1K7A A;  2EV0 A;  4HLX A;  4CHU A;  3M7G A;  1S8N A;  1YTY A;  3KFW X;  3ISP A;  1T38 A;  1ZG1 A;  3WTW C;  5DUI A;  1TBX A;  4N0B A;  3GFM A;  3BZ6 A;  3WE2 A;  2W85 A;  4HOB A;  3D5L A;  2R7F A;  2PLY A;  2G7H A;  1R00 A;  2DFI A;  2OAZ A;  1FSH A;  4N9I A;  2FSW A;  1KA8 A;  3WGI A;  1U2W A;  3L7W A;  3HRT A;  4A5N A;  2EV5 A;  4EJO A;  2PJP A;  1XSX A;  4U0V A;  2LF7 A;  1MJ9 A;  3LWF A;  3FF5 A;  3L9F A;  1CGP A;  1QO0 D;  3EQL F;  3V7C A;  3M8E A;  3ECH A;  2HGC A;  5A2Q Z;  1O3T A;  5IT9 K;  1QGP A;  2M1B A;  3ERE D;  4U7D A;  5H20 A;  4RGX A;  2XGX A;  1ZLJ A;  4HF2 A;  4OIO F;  4IPA A;  5FFX A;  5E1Z B;  4UNO A;  1FBQ A;  2A5Y B;  5L3F A;  1UHW A;  5IT9 Z;  4NB5 A;  1RI7 A;  3KP2 A;  2ZNY A;  3ZMV A;  2DTR A;  1O3S A;  1P4X A;  5H6R A;  1ON2 A;  3F8M A;  5CLS A;  4P5O A;  4MGR A;  4BYY A;  4OIP F;  3BY6 A;  1G3S A;  3CUQ C;  1IW7 F;  5K5R A;  1D3Y A;  4MHG A;  3MEX A;  4FX0 A;  3ULQ B;  2ZJ2 A;  3CUQ B;  3RYR A;  1S3J A;  4HV5 A;  1SFX A;  3CUQ A;  3K9T A;  1MGT A;  4ESF A;  4LJZ F;  3MQ0 A;  3E6B A;  2KIM A;  1JXS A;  2J5P A;  3HOT A;  1ZRC A;  2VOO A;  1JHF A;  1XB4 A;  3CJN A;  3TGN A;  1B59 A;  2XAF A;  5F6F A;  2YX4 A;  4KMU X;  1R1T A;  1WI9 A;  2LKP A;  2A07 F;  1R1U A;  1SMY F;  2MA3 A;  1AOY A;  2CWE A;  4BHC A;  3KEO A;  2JT1 A;  3F8F A;  5ICG A;  1FYL A;  2GWR A;  2VBX A;  2W84 A;  1GXQ A;  4GXO A;  1ZRE A;  3HSR A;  4YG2 F;  3LA7 A;  1FZP B;  2BV6 A;  1GXP A;  3GWZ A;  5DCM A;  4G7H F;  4LGW A;  1YG2 A;  4G94 A;  3IL2 A;  3ML6 A;  4P9U A;  3EYI A;  1KU7 A;  4WXD A;  4M6Y A;  1ULY A;  2A69 F;  2KRF A;  2V1U A;  2FA5 A;  3IRQ A;  3F72 A;  1QZZ A;  4U88 A;  1YQA A;  1X3U A;  3LFK A;  2P7V B;  4EM0 B;  4G8X A;  4B8X A;  2K27 A;  3LA3 A;  5HVQ C;  2VXZ A;  1G6N A;  3KZZ A;  1U8R A;  3VFZ A;  3E6C C;  1ZLK A;  4O3M A;  1HW5 A;  3F8B A;  1LDD A;  3F8C A;  2NNY A;  1DDN A;  4EJT A;  2CSO A;  1XMK A;  2A61 A;  2D2W A;  1OYI A;  2WC2 A;  3K69 A;  3FX3 A;  2DK5 A;  1AWC A;  2QLZ A;  3PQK A;  4CZZ A;  2XUB A;  5DD4 A;  4HQM A;  1H9G A;  4IHS A;  4EQQ A;  5ILV A;  2C6Y A;  2MC3 A;  4I7H A;  2DI3 A;  5E1X A;  1BBY A;  3FMS A;  4CIC A;  4CGZ A;  2HFH A;  4KIC A;  5HS7 A;  1H0M A;  2K7L A;  2FEZ A;  1SMT A;  1T2K A;  2EWN A;  2ISY A;  1O57 A;  5HLI A;  4MTD A;  4TV7 A;  2H94 A;  4G7Z F;  2FMY A;  4AIJ A;  2OQR A;  5AIP A;  1O7L A;  3NQO A;  2V1D A;  1MJB A;  2ZCW A;  5CVJ A;  3N4M A;  4ENM A;  2YSR A;  2HTS A;  2PBI A;  3IRR A;  1SD5 A;  2D1V A;  4KIG A;  5LGU A;  2QBY A;  3G73 A;  3QPT A;  1S29 A;  5AIQ A;  4IVN A;  2VOP A;  1J7K A;  3ZP5 A;  3QP5 A;  2V9V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...