1J0RA

Crystal structure of the replication termination protein mutant c110s
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
114
structure length
114
Chain Sequence
TGFLVKQRAFLKLYMITMTEQERLYGLKLLEVLRSEFKEIGFKPNHTEVYRSLHELLDDGILKQIKVKKEGAKLQEVVLYQFKDYEAAKLYKKQLKVELDRSKKLIEKALSDNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Replication
molecule keywords replication termination protein
publication title The impact of single cysteine residue mutations on the replication terminator protein
pubmed doi rcsb
source organism Bacillus subtilis
total genus 42
structure length 114
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02334 RTP Replication terminator protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1j0rA00
3U1DA 3L7WA 2NAZA 2Q2EA 1O7LA 3TQNA 2ZJ2A 1Z6RA 2R7FA 2EFPA 1OYWA 2RKHA 4I7HA 1H9TA 1U2WA 3HRTA 4QWQA 5E8GA 3F23A 1BI0A 3WGHA 3FXRA 3ZMSA 1GHCA 4HF2A 2LSOA 1KYWA 4G7OF 3HSEA 2DAOA 1BI1A 2VOOA 1SD4A 3BP8A 4IHTA 2L3DA 2PMUA 3WTSC 1O57A 2XVCA 3I5UA 4ENJA 4MEYF 4MHGA 1TTYA 4RB0A 1FBSA 3V7SA 2P5LC 4RB2C 2L54A 1K78A 1BC7C 3ERED 2QQBA 2CG4A 4CXFA 4AIJA 1R7JA 3LA7A 1XGSA 3TO9A 1FNNA 1GXQA 5DD4A 4UHTA 3JSOA 1WSUA 2DQLA 1JHHA 3KEQA 2FE3A 2C6YA 5LHHA 4OIOF 1Z9CA 3W6JB 1QGPA 3RYPA 2ZO4A 2UZKA 3F8FA 1LEAA 2UWMA 5HOOA 2PBIA 1G4DA 3I53A 4ZZLA 5ILVA 1UFMA 4M9SA 1VTNC 3Q5FA 1SFXA 2GXBA 2MBFA 2ZNZA 2P5KA 2XRNA 2D1VA 2IA0A 1FYKA 4BHCA 4WX9A 1XSVA 2HYGD 2W85A 4IRGA 3C18A 2VOPA 4I2OA 4N9HA 1KU7A 4ESFA 3GUDA 2EV0A 2FBKA 5LEJA 3HOSA 5E1XA 1D5VA 2GWRA 5K5QA 4NQWA 1W7PD 2ZXJA 3WODF 3CLOA 3I0TA 2QWWA 2IRFG 5KVRA 4ETSA 4UV9A 4AWXB 3CDHA 3PFIA 4ESBA 4I09A 1UHMA 3HRSA 4UUVA 3ZN0A 4KYWA 1ZN2A 2V1UA 3PQJA 5E1WA 4IVNA 3U9GA 2YR2A 5D5UB 1ODDA 1LJ9A 3HRUA 3HSFA 1D8KA 1QPMA 1E17A 5LGTA 3ROUA 1R00A 3WU0A 2A69F 2QLZA 4N9IA 3K1NA 2A68F 3K1PA 3MZYA 4HZFA 1B1BA 5CVIA 2QUFA 4L9NA 3TO7A 2PN6A 1RUNA 4EVIA 1ZLKA 1R5HA 2JT1A 4ENMA 2RC4A 2JTVA 2A5YB 2M87A 2HKOA 4XRFA 2DLLA 3HIFA 1YQAA 4YIIA 2XHKA 1SMTA 3KETA 3O6BB 4OIQF 5H6QA 2PFBA 4ON0A 2IP2A 1R58A 4HV6A 3ISPA 3RIRA 3F3XA 4FX4A 5E17F 2UXNA 1EH7A 1FSEA 1A04A 1CF7B 3PQKA 3C3WA 3BPVA 5JR3A 1PP8F 4HX8A 5ERIA 4EMSA 5ICEA 4LMYA 1O7FA 4I98B 2DTRA 4WWCA 2VBWA 3R0AA 4WXHA 3H3ZA 1XSDA 1IRFA 4Y15A 2KRFA 3BZ6A 3EYYA 2A61A 2LDUA 4LLNA 4ASNA 3FWEA 1YO5C 1BOAA 3F6VA 1O3QA 3RKWA 2M30A 1T2KA 3FZVA 5HDGA 2EJRA 1L3LA 3DQVC 4UNOA 3KP3A 3WE3A 3VODA 5HDNA 1YYVA 4R79A 5BPIA 1J7KA 2MH2A 2YX7A 1FSHA 2GXGA 5FB2A 1K79A 3B02A 2HQNA 1HSJA 1TQMA 1WI9A 4L9VA 3V8JA 2Q0OA 3DPTA 3F8MA 3TDUC 4O3MA 3NRVA 1Z7UA 5A2QZ 3R4KA 1XGNA 1IXCA 3E5UA 3BDDA 3BOQA 2ETHA 2L02A 2QVOA 2YU3A 4LLLA 4AIKA 3ZN1A 3V7RA 2XIGA 3LA3A 5DUIA 4GYIA 3EYIA 2TDXA 4WXCA 5HS9A 1KQ9A 1C0WA 1F5TA 2PLYA 2XAGA 3EUHA 5DV5A 2HGCA 1KQ0A 2QQ9A 3CUOA 3RKYA 4LGWA 1XGOA 2IA1A 1I5ZA 2RDPA 2YPRA 3KP6A 2KIMA 4CHUA 1IN8A 4HV5A 4M9ZA 3JTGA 3FF5A 2JZYA 2HYFA 3E5QA 1R1TA 3MCZA 3C7JA 4A0YA 3ABTA 4U0VA 1STZA 4P55A 3JW4A 4B09A 2M8EA 5D4RA 1U8RA 5BS6A 1JGSA 5IT9K 2VT2A 4Q48A 5F64A 3KP4A 1ZREA 4KMFA 1B9MA 1BN5A 3P9CA 4ENNA 3KE2A 4EGZA 1QBJA 3L09A 1BC8C 2K4JA 4XLPF 1AOYA 1FZPB 4HF0A 3FMRA 3BROA 4LG0B 1XGMA 3GZ6A 3MQ0A 4AD9A 2ZBKA 4HBLA 1MJ9A 5CYVA 4UVAA 3WGGA 2ZMEB 1FOKA 2P7VB 5AIPA 3KLNA 4CO8A 2VONA 2ISYA 3IRQA 5IT9Z 5E20A 2R7DA 5CJ9A 1O3TA 5LLQA 4QLCU 5EEGA 1O3RA 2LF8A 2MLGA 2OZ6A 4PGHA 4PCQA 4WXDA 4EM0B 1LVAA 2XAFA 2ISZA 4KT5C 3VB2A 4KNYA 5D5VB 3SXYA 3I59B 1GVJA 2W24A 4G9YA 2EFNA 4R1HA 2H6BA 3GYHX 2GQQA 5IT3A 4BH9A 3V4GA 1U5TB 2KJCA 4WCGA 4JK1X 3JAMZ 2MD5A 2HFHA 3RJPA 3F22A 1T98A 1J75A 4M71A 2LF7A 3CO6C 1YIOA 4EM2A 2A3SA 3ZMDA 1IN4A 1HQCA 1WRJA 3QPTA 4XSZF 3P7NA 4ZYEA 3KZZA 1RNLA 3MFKA 4YIFA 3F8BA 4HLYA 3QP5A 4U7DA 4CDGA 3RKXA 2L4MA 2BEOA 1FYLA 5L3DA 3QRFF 3LFKA 2VC0A 3V8LA 3RYRA 4F7ZA 3JSPA 3ZPLA 2MC3A 4EJVA 1LDDA 2EV5A 1SD7A 2O03A 1SFEA 3KZYA 1W5SA 2ZCWA 1Z91A 1KGSA 5ICFA 1V3FA 4O5VA 4EV0A 2EV6A 5J6XA 4EM1A 2W57A 1SD5A 3H3UA 4A2UA 4BHBA 3RDIA 1TW3A 1FBQA 1S6LA 2VBYA 3MZHA 4XSXF 3E6MA 4OINF 2QQAA 1ZHFA 5D5WB 4CGZA 2DK8A 4L5IA 5BMZA 4G7HF 1T38A 2JRTA 3V7CA 1UHWA 3IL2A 4CICA 2ELHA 4UVCA 3C1DA 4K2EA 5DCMA 1OKRA 3T8TA 3LAJA 3BY6A 6PAXA 3N4MA 1IF1A 5FD6A 3CUQC 4KN4X 4P96A 2NRAC 1QZYA 2ESHA 1SAXA 2DK5A 2RV8A 4BXUA 3F21A 3ZMZA 4ZH4F 1P6RA 3DXJF 5CVUA 1B9NA 3HSRA 1K78B 4G8XA 4LLGF 5J8CA 2BV6A 2FOKA 1IW7F 3K0LA 1DDNA 2GA1A 4LB5A 1SD6A 1RI7A 2O6GE 3E97A 3CJNA 2RNJA 4IRHA 4RAZA 3FM5A 3DV8A 1S7AA 3F8CA 4S04A 2FMYA 2NNNA 3KP5A 2WC2A 4HW0A 3TKYA 2IA2A 5HLGA 3WGIA 2FBHA 4AIHA 3M1EA 1IXSB 3ABUA 2XROA 4ENKA 4B8XA 2HWVA 4BHPA 4ZYGA 2LNBA 2QYOA 2DW4A 4UVBA 1YW9A 2F5DA 3IRRA 2E7XA 1FWZA 4YFXF 2P8TA 4L0YB 3WTWC 4U0YA 5J8FA 1R23A 4L0ZB 4YFNF 2QBYA 2COMA 1DPUA 2FQ3A 3FXQA 1I1GA 1KQ8A 3G3ZA 5LRRA 2CQKA 2OBPA 1H0MA 2NYXA 1TNTA 4OIPF 1LNWA 2MA3A 2K86A 4G94A 1QNTA 1TQPA 4Q47A 2XASA 1BBYA 3ZMUA 4RGUA 2A6EF 4MQ9F 2XAHA 3WTZA 3EQLF 2WV0A 2HKXA 3M8EA 2QZ8A 1MJAA 1YS6A 1ZARA 4NHJA 3DF8A 1UB9A 4FX0A 2XUBA 4MGRA 3TGNA 3FM3A 1IXRC 2OZUA 1EH8A 4L5JA 2PMHA 1FC3A 4IF4A 1G3YA 3I54A 3E6DA 2DBBA 2PG4A 5HDKA 2FRHA 3BWGA 2OA4A 1LDJA 4OOIA 3VOEA 1F9NA 2GZWA 2Z9OA 3FX3A 4S05A 5F1RA 1R1UA 3WTYC 5K1YA 2H09A 1UCRA 2FEZA 2ZFWA 1J2XA 2XGXA 1IZ1A 3GW2A 4P9UA 3GEZA 1V4RA 3WE2A 4ZYDA 5A2QK 1RIOH 3LQRA 2IPQX 5CVJA 2JSCA 2J5OA 2IVMA 5HLIA 2G7HA 3F72A 3B73A 1IN5A 1IRGA 3IKTA 1E2XA 2HS5A 2KJBA 3CUQA 4OMZA 1OPCA 1O3SA 3OV8A 3EETA 4KICA 4A12A 2P7CB 1Z1DA 2QENA 5FFZA 2DFIA 1MGTA 1XMKA 2RQPA 2WTEA 2ADUA 2D45A 4ESJA 2V1DA 2X0LA 4I0BA 5H6RA 2R3SA 2CGPA 1ZYRF 1J5YA 3AAFA 1IAWA 3BPXA 3REOA 2O0YA 5L3CA 3T0YA 2M1BA 2OQRA 1D3YA 5K5RA 3LWFA 4EJWA 1BJAA 3RPQA 1MKMA 5E8IA 4FHTA 4YFKF 3E6BA 3BJOA 2VBZA 3SQNA 5FLXK 4LK1F 1TW2A 2H6CA 3KCCA 2IW5A 4RB1A 3SZTA 4O6JA 3FXUA 2OAZA 4M72A 2P6SA 3IWFA 4EGYA 1R5GA 5F6FA 1DP7P 1Z6TA 4EJTA 3K69A 2FSWA 1ZRCA 5E1ZB 4KMUX 2H94A 2XAJA 4L18B 4PZJA 4IRIA 4KN7X 4A6EA 3WTXC 4ZYHA 3KEOA 5ED4A 1K7AA 4G7ZF 1KU9A 4RS8A 2GA2A 5FD5A 3Q9SA 1MDMA 3L2CA 5FLXZ 3DFGA 4P5OA 2PI0A 1REPC 1F4KA 3E5XA 4BNCA 2HDCA 2DU9A 1U78A 2VODA 3OOPA 4GO1A 5LHIA 1WKMA 3R61A 1W7PA 4G6QA 1BIBA 1HKQA 3QP6A 5TRDA 3FHZA 5LRSA 5LEKA 1TNSA 3TDZC 1DUXC 2F5FA 2GIVA 1TQIA 4XBFA 2FXAA 3IHUA 5ILSA 3ULQB 1HBXG 2F5CA 4A5NA 2JPCA 1G3WA 2HQRA 1XSXA 4LD5A 1OYIA 2EK5A 1FBUA 1FX7A 2HTJA 2EA4A 1PP7U 2BE5F 2W25A 3JAMK 2V9VA 2PQ8A 2CSOA 3K1MA 1P4AA 1YW7A 4A0XA 1I6XA 3TOBA 1ZG1A 4BQAA 4UV8A 2IT0A 3SFZA 5L3BA 1HW2A 1ULYA 4EQQA 1ONVA 3U2RA 5DDGA 4Y13A 4I02A 2V6CA 2EFWA 1S3JA 3D0SA 2VE9A 2Y0MA 5HS7A 3QPHA 2O8XA 2E1CA 2XAQA 1BIAA 2EB7A 1T39A 2RN7A 1ZGAA 4NB5A 3FMQA 1FP1D 4KIFA 5KK1A 1RZ4A 5ICGA 2STWA 4L9TA 4RGXA 2AS5F 3SZPA 2CO5A 5JVTA 4CYDA 1YLFA 4ZZDA 5JHUA 5CLSA 1OYYA 3GLXA 2FMLA 3EDPA 1HW5A 1QZZA 4MNUA 5CVRA 2B0LA 3LA2A 3ZQ7A 2J5PA 5DYMA 2Y75A 3KP2A 1KU2A 5L3FA 3QOPA 2OD5A 5FGMA 3GFJA 2JPBA 4JBAA 4IXAA 2QM3A 1ON2A 1DPRA 2KIUA 1J0RA 1YG2A 1JE8A 3FMSA 2Z3YA 1HSTA 5CVVA 1J59A 4JQFA 4OIRF 1PDNC 1F1ZA 3CTAA 4RGRA 1LEBA 1ZAOA 4MEXF 1XDSA 4RAYA 4Y17A 4H0EA 2STTA 4M73A 3QU3A 3IWZA 5BOXA 3GFMA 4KFCA 2PJPA 4I0AA 1T0FA 2M5WA 3SHFA 4MQVA 4KIGA 1XD7A 1FP2A 3ZMTA 1ZG3A 1P2FA 4LJZF 4M6XA 3KLOA 3I58A 2Y48A 4WK8F 2HZTA 4U0WA 2DQRA 2LKPA 3BJ6A 1X3UA 5LHGA 3MAJA 3S2WA 2G7UA 1I1SA 3MWMA 1EV7A 5DD8A 4M6YA 5DEQA 1YS7A 3M8FA 1ZG5A 3P9KA 4GGGA 4LFUA 2CFXA 2O61A 2FNPA 1D8JA 2FBIA 2VC1A 4IJAA 1R22A 3P9IA 5LBQA 1CGPA 1WQ2A 3T5XA 1OR7A 3Q9VA 4Z2YA 2FA5A 5DCMB 1XN7A 4Q5SF 4HYEA 2D1HA 4HDVA 3R60A 2OU2A 3M7GA 4EJUA 4HQEA 1B59A 2VT3A 2EFQA 3JTHA 2WWYA 3GWZA 3HUGA 1XB4A 1ZRFA 2D2WA 2EWNA 2Z33A 4CZZA 3LQQA 1W4MA 2K7LA 2DPDA 4HAMA 3VEPA 3HYIA 3KFWX 4HDUA 1K6OA 1PUEE 4G6DA 2BYVE 5BQTA 3N97A 2NNYA 3L00A 3K2ZA 2HEOA 4M9XA 3IC7A 4LK0F 2NS0A 2CWEA 4A6DA 1QO0D 3GVAA 5FO5A 2DI3A 1R1VA 1MZBA 1ZRDA 2ACJA 3I71A 5D6EA 3V8KA 3R0JA 1SMYF 4GYGA 1CF7A 1HXDA 3H92A 2Z99A 1H9GA 2FU4A 1FLIA 1W5TA 1HKTA 2VE8A 5D4SA 1MD0A 1HW1A 3ZMVA 3GX4X 4GCVA 2F2EA 1T6SA 1P4XA 1FT9A 3J80K 2QBYB 3I64A 3MEXA 3WTUC 2RVCA 4HOBA 5D5XB 3E3VA 4OU0A 1TLHB 1YFHA 2E1NA 1XCVA 2KIFA 1SFUA 3J7AO 1LB2A 3WTTC 2A6HF 5L3GA 1JHFA 1GXPA 1ZH5A 3RTRA 1U5TC 1KYZA 3LSTA 1KU3A 1HKSA 3ECOA 1P4WA 2XKPA 3HHHA 1G3SA 2P4WA 4N0BA 2VXZA 3BJAA 3HHGA 1RUOA 1USTA 4HA8A 5K5OA 1P92A 3J80Z 1G6NA 2K4BA 1B4AA 3E6CC 2P6TA 4IHSA 5HVQC 4E70A 2DO7A 2ESNA 2L01A 1NHAA 1ZGJA 3M9AA 4U88A 1S29A 2FF4A 4A5MA 5DCFA 5DUKA 1JXSA 2DPUA 2OQGA 1Y0UA 2BGCA 3QU6A 5LGUA 4MTEA 2CW0F 2Z5UA 4D0PA 1J9IA 1YTYA 1OMIA 4BAYA 3GFLA 3G73A 2HTSA 3NEUA 3IKVA 1ZLJA 2YSRA 4HX7A 4KDPA 1Z05A 3DPLC 4XLNF 2EFOA 1MJBA 4DQ2A 5HS8A 3CUQB 5L3EA 3RI4A 3HTUA 4LB6B 1XCBA 3T1BA 2UXXA 3DKWA 3GO5A 2ZNYA 1YW8A 3D5LA 2MH9A 3J81K 1U3EM 4P9FA 4RB3C 3WTVC 5JFRA 3CO7C 3L9FA 1BI3A 3ECHA 2BBYA 3W6KB 4MTDA 2AXLA 2K02A 3O2PE 1TBXA 2GAUA 4TV7A 4PGGA 5D8LB 3TOAA 4L9JA 2L4AA 5H20A 3F8NA 1XMAA 1L0OC 5EEHA 2A07F 1LQ1A 5D6FA 1Q1HA 2M45A 2P5VA 1S7OA 5AIQA 1FYMA 4LG0A 3O3KA 3DP7A 2ZKZA 3NQOA 3GXOA 4PDKA 2V1XA 1I27A 2ZMEA 4FT8A 1G3TA 3ML6A 4KIBA 3J81Z 1KA8A 4EJOA 3T8RA 2V79A 1IN6A 1U6GA 2HOEA 3HOTA 1WWXA 4U7BA 5ILUA 2DT5A 3TO6A 3K9TA 4IPAA 5AONA 2F5EA 3I59A 4I01A 2W84A 4KA4A 5E18F 2KKOA 1MDMB 3ELKA 5LGNA 4HQMA 2VN2A 5TJJA 1FPQA 1U5TA 2PEXA 1USSA 2XKOA 1W7PB 3R6SA 3QAHA 4DNCA 2YX4A 3LAPA 5FFXA 2IJLA 2RGVA 3HRMA 3ZP5A 2O3FA 3GF2A 5JI6A 3WU1B 4KUMA 2VBXA 3WG9A 3RPUA 3HTSB 4RGSA 4Q4ZF 2MLKA 4GXOA 5HLHA 1LDKB 2E7WA 1B6AA 1FY7A 4WF2A 1AWCA 1IN7A 1BI2A 4UXNA 3I4PA 4OMYA 3F6OA 3VFZA 5D8KB 1IUYA 4HX4A 1QQIA 4YG2F 1ON1A 4M74A 1XDUA 4R8HA 4BYYA 1R36A 2G9WA 3DEUA 5ICCA 1BM9A 2K27A 3GFIA 2H27A 4AVPA 2FNAA 1EH6A 2HR3A 2CYYA 3KP7A 4HLXA 4A0ZA 3COAC 5BPDA 2Q8KA 3GZ5A 2XV4S 1S8NA 2EA2A 2X4HA 4HF1A
chains in the Genus database with same CATH superfamily
4II2A 5GPAA 2E2IJ 3GTJJ 4DZPA 1NTCA 3U1DA 3L7WA 2NAZA 2ICWG 2Q2EA 3AKZA 1WPKA 1O7LA 5IY5H 3TQNA 1X4OA 2ZJ2A 1Z6RA 2R7FA 2EFPA 2H8WA 1VQ6I 1OYWA 1UAAA 1V5EA 5K7ZA 3BT9A 2RKHA 1S5LC 3FHNA 4I7HA 3PM1A 1H9TA 1U2WA 3HRTA 4QWQA 2XRLA 5E8GA 5F04A 3F23A 1SAUA 1BI0A 3WGHA 3FXRA 3ZMSA 1WJBA 2AHQA 3G71I 1GHCA 1X2NA 2X51A 4HF2A 1K83J 2LSOA 1KYWA 5FJ8J 3G1OA 3OOUA 4A69C 1B8IB 2P0WA 4G7OF 3ABLH 3HSEA 1PVEA 2DAOA 3VDXA 1K4TA 1VQ7I 2XPVA 1BI1A 1I3QJ 2AXTC 3LFUA 2LKSA 1HC8A 2VOOA 1SD4A 3GTMJ 5F0CA 3BP8A 4IHTA 4BJ5C 3L2UA 2L3DA 3HZJA 2PMUA 3WTSC 1WVRA 1YE9A 1O57A 2XVCA 3I5UA 3OYCA 2XC7A 4ENJA 4MEYF 4MHGA 2IS6A 2HQAA 1E3HA 3PNVA 1TTYA 2E2HJ 1DGWY 4RB0A 4IOAF 1FBSA 2R5ZB 2IGMA 3GMEA 2H1KA 3V7SA 5TGTA 4B43A 4A3LJ 4DJAA 9ANTA 3AL0C 5K7HA 2P5LC 4RB2C 2L54A 1K78A 3S8PA 2IS2A 1BC7C 1AHDP 1I3AA 4IHXA 3ERED 3OYIA 2QQBA 3U1KA 2LFBA 3C2HA 3HOZJ 4C2UA 2CG4A 4CXFA 4AIJA 1P7IA 1I6HJ 1R7JA 3LA7A 1XGSA 3TO9A 5IP9J 1FNNA 1GXQA 5DD4A 3LSKA 4UHTA 1YJWI 3JRGA 3JSOA 3OIPA 2VJJA 1OLTA 1WSUA 4BDZA 1JHHA 2DQLA 4UB8C 3KEQA 3LOCA 4A3KJ 2FE3A 2C6YA 2HOSA 5LHHA 4OIOF 1Z9CA 2MGQA 1WJEA 3W6JB 1HA8A 2RAEA 2M0MA 1QGPA 2L9RA 3RYPA 2X1CA 2ZO4A 4ZC3A 1YIJI 2UZKA 3F8FA 1LEAA 1ENHA 5IPAA 1UMQA 2DMNA 2UWMA 4JX5A 1XS9A 5HOOA 4M3GA 1MSFC 3BTIA 1WHUA 2PBIA 1G4DA 3S16J 2VI6A 3I53A 3TEDA 1HF0A 2R7WA 4ZZLA 5ILVA 4IQ4A 1UFMA 2FOWA 2BXZA 2VQGA 2KDZA 4M9SA 2CQNA 1VTNC 1BW6A 2JK3A 3Q5FA 1SFXA 4XRMA 2GXBA 3BCAA 1XX5A 2HDDA 2MBFA 2ZNZA 2P5KA 3QYBA 4CCKA 5EEAA 1MNEA 2XRNA 1FTTA 4PJLA 2D1VA 1ZR2A 3LSIA 1H88C 4IKFA 2IA0A 2IXSA 2ZB9A 3W2VA 4V2GA 1FYKA 4BHCA 4WX9A 1XSVA 5FKLA 2E1OA 2HYGD 2Y2ZA 2W85A 4IRGA 3FXMA 3C18A 2VOPA 4I2OA 4IOCF 2FJ1A 4N9HA 1KU7A 2ZXIA 4ESFA 3Q0WA 3GUDA 2EV0A 2FBKA 5LEJA 3I9V2 5E1XA 3HOSA 4BACA 2CV2A 3S32A 1J09A 1D5VA 2GWRA 3H9JA 3RCOA 5K5QA 4NQWA 1W7PD 2PJRB 2ZXJA 3WODF 4XLCA 5EDNA 3CLOA 3I0TA 2QWWA 3C2GA 3CP8A 4XRSA 2IRFG 5KVRA 1ETVA 1LE8B 4ETSA 4UV9A 4I76A 5EZGA 2NVTJ 4AWXB 3CDHA 4E7SA 3PFIA 4ESBA 4I09A 1ETOA 3OYGA 1ZGWA 1UHMA 3HRSA 4UUVA 3ZN0A 3J7ZI 4KYWA 1G2HA 1ZN2A 2V1UA 3EUHC 3PQJA 4XOPA 5E1WA 4IVNA 3U9GA 2LMDA 2YR2A 5D5UB 1ODDA 1Z67A 1LJ9A 3HRUA 3JRAA 2HOAA 2LD5A 2VKVA 1FOYA 1MMSA 3HSFA 1NK2P 1D8KA 1RRJA 3ESWB 3MN2A 4BQQA 1MMNA 1QPMA 1V5FA 1QU3A 4XLAA 4PJNA 4II3A 1E17A 3L2QA 3BTJA 5LGTA 3GTQJ 3HDDA 3ROUA 1R00A 2R5YB 3WU0A 3DBLB 2A69F 4A3GJ 3KEYA 2QLZA 4N9IA 3K1NA 2A68F 3HUGB 2R7ZJ 3K4NA 4AU7A 1PYVA 1OISA 3K1PA 3MZYA 4HZFA 4KISA 2XSDC 5J1YA 1B1BA 1D1BA 3CCVI 5CVIA 2QUFA 4M6VA 3O8GA 4I6ZA 4L9NA 1Z77A 3K70C 5IOZA 3TO7A 1NH3A 2PN6A 1RUNA 4EVIA 1ZLKA 1R5HA 2JT1A 5F27A 4LOCA 4ENMA 2DA3A 2DYRH 3CCEI 5HODA 2RC4A 4NC6A 3BG7A 2JTVA 2LRDA 2A5YB 4QTRA 5LFAA 2KRHA 2M87A 2UUZA 2HKOA 4S0HB 3QPSA 4XRFA 2DLLA 3HIFA 1YQAA 1Y1WJ 4YIIA 2XHKA 2V6EA 1SMTA 4XN3A 3JRDA 2WAEA 3KETA 3O6BB 4OIQF 3OR1C 2V4JC 5H6QA 1R4MB 2PFBA 4ON0A 2IP2A 4X6AJ 1R58A 4HV6A 3OS2A 3WHBA 3ISPA 2NS8A 5E3MA 5IYCJ 3RIRA 2W4SA 2X9DA 4PJJA 3F3XA 4FX4A 1WH5A 5E17F 2UXNA 1EH7A 1X4PA 3Q0VA 1FSEA 5C4JJ 2LBFB 1A04A 3DTKA 1A36A 1QHGA 1CF7B 1VQKI 3M8JA 1V5GA 3P5JA 3PQKA 4F52A 3C3WA 4M3BA 2E71A 3BPVA 5JR3A 1FOWA 3RZOJ 1PP8F 4HX8A 5ERIA 4EMSA 3HOXJ 2OC6A 5ICEA 5M5XJ 4E7IA 4LMYA 1JTXA 1O7FA 3HBLA 2NOJB 4I98B 2DTRA 2YUSA 3A02A 3I55I 3D5SC 4CYCA 4XKCA 4C30A 4WWCA 4XKVA 2KLOA 2VBWA 3CJRB 2XGEA 3R0AA 4WXHA 1JKQC 1D1CA 3H3ZA 1XSDA 1IRZA 4OWRB 1IRFA 4Y15A 2KRFA 3BZ6A 3EYYA 2A61A 2LDUA 1NG7A 2QKMB 4LLNA 4ASNA 3FWEA 1YO5C 1BOAA 1KONA 3H0DA 3F6VA 1RC9A 1O3QA 3RKWA 4FCYA 4QSHA 4B3XA 2LKXA 2M30A 4X1EA 1T2KA 3A01A 3FZVA 5HDGA 1FOXA 3QWLA 3IH4A 4NUBA 2EJRA 2WBMA 1L3LA 3DQVC 4CCNA 2O9LA 1U8BA 4UNOA 3KP3A 3WE3A 3VODA 1FMVA 5HDNA 1YYVA 4R79A 3HC7A 2LK2A 5BPIA 1J7KA 3GTOJ 1VQLI 3ABMH 3RQ4A 2MH2A 1W36D 2YX7A 1FSHA 2E2JJ 1TWGJ 1RESA 3AL0B 1ZTRA 2GXGA 4U87A 3OYFA 5FB2A 2ZJQF 5FKMA 1K79A 2JA5J 3N05A 3HPHA 3B02A 1TP4A 3QYFA 2HQNA 2LREA 1HSJA 1TQMA 2M7AA 1IJWC 1WI9A 4L9VA 3V8JA 2Q0OA 3DPTA 3F8MA 3TDUC 2R7SA 3B6CA 2Y0SN 4O3MA 3NRVA 1MMGA 1Z7UA 4GRIA 5A2QZ 3R4KA 3ASOH 1XGNA 1IXCA 3OYEA 3E5UA 2WB1A 2Y30A 3BDDA 3BOQA 2ETHA 2L02A 4MO7A 4OAYA 2QVOA 2YU3A 3H36A 1JJ8C 2XDVA 4LLLA 4AIKA 3LSRA 3A2KA 3ZN1A 5GAGJ 2PX9A 3V7RA 2VL8A 2XIGA 3LA3A 4DBQA 3HJEA 4V2FA 3BZCA 5DUIA 3Q0UA 4GYIA 3EYIA 3ZXSA 1IV8A 2TDXA 3DLLF 2M0CA 4IZZA 2R7XA 4WXCA 5HS9A 4DGWB 2A05A 1KQ9A 5F1JA 1WCMJ 2EIMH 4B3AA 1C0WA 1F5TA 2PLYA 3MVPA 3HG9A 1JKOC 2XAGA 2RNGA 2NVQJ 3EUHA 4JOMA 5DV5A 4ZDPA 1MBGA 1XTAA 3ZCOA 2HGCA 1KQ0A 3CLQA 4E6KG 2QQ9A 5JHFA 3CUOA 1Y39A 3TMOA 4CCMA 2H1LA 3RKYA 4LGWA 1XGOA 2IA1A 1D1AA 4NDLA 2ZSIB 3QPLA 1I5ZA 2RDPA 1ORKA 2YPRA 3KP6A 1P7JA 5JLXA 2O8KA 2KIMA 1H89C 4DZJA 4CHUA 1IN8A 4HV5A 2DJIA 3H35A 4M9ZA 3JTGA 3FF5A 1PJRA 2CUFA 2JZYA 2HYFA 3E5QA 1R1TA 3MCZA 5IYDJ 4CH7A 2GBYA 2K5CA 1D0XA 1R9TJ 3C7JA 4A0YA 3ABTA 4AC0A 2CQ7A 1VFCA 4U0VA 1STZA 4P55A 2HPIA 3CMYA 2Y9ZA 3JW4A 3BTCA 4B09A 5M5YJ 2M8EA 2B63J 4BXFA 4F92B 5D4RA 1U8RA 3U21A 5BS6A 1JGSA 5IT9K 2VT2A 3LSMA 3M4OJ 5E79C 4Q48A 5F64A 1DGRM 2CRGA 3KP4A 1ZREA 4KMFA 2WAQA 1B9MA 1BN5A 2K3PA 2MABA 3P9CA 4ZTJA 4ENNA 2R7UA 1OQYA 1IRXA 1VQ9I 3CMAI 3KE2A 4EGZA 3A0BC 1QBJA 4BS9A 3H5NA 3L09A 2OPTA 4P1WA 1BC8C 2K4JA 1UG2A 4XLPF 3DTIA 1AOYA 5J1RA 1R4NB 1MBFA 1FZPB 2K3FA 2KDOA 4HF0A 2GOMA 2EZKA 3FMRA 3BROA 3ZQLA 2KZGA 4LG0B 1XGMA 3GZ6A 3MQ0A 4AD9A 2ZBKA 4HBLA 3FXJA 1MJ9A 2DFHA 5CYVA 4UVAA 1X19A 3WGGA 5M5WJ 2ZMEB 1FOKA 2P7VB 1TC3C 5AIPA 2R7QA 3KLNA 2HQ5A 4CO8A 2VONA 3DKXA 2ISYA 1X3ZB 3IRQA 5IT9Z 5E20A 2R7DA 4HPQA 2IGOA 5CJ9A 1O3TA 5LLQA 2ZXHA 1FEXA 4QLCU 2ELJA 5EEGA 2B7EA 1O3RA 1MNMC 2TRTA 2LF8A 2MLGA 2OZ6A 4PGHA 3BR0A 4PCQA 4WXDA 4EM0B 1LVAA 2XAFA 2ISZA 3M07A 4KT5C 2OTLI 3OYMA 1VQPI 3VB2A 1VZ0A 3SDGA 2LH9A 4KNYA 3V42A 5D5VB 3SXYA 3I59B 1GVJA 4GFBA 3LL7A 2W24A 2CJJA 3OSGA 1T56A 4G9YA 3O8HA 2EFNA 4R1HA 3HOUJ 2E1MC 2H6BA 1TWAJ 3CCRI 2DJNA 3CCMI 3OYHA 3GYHX 3WG7H 2I8DA 2GQQA 5IT3A 4BH9A 3V4GA 2XF5A 4M3FA 1U5TB 2KPMA 1WZ2A 3WHCA 1D0ZA 1UHSA 2FUG2 2F4OB 2ECCA 5KCMA 4BBRJ 2KJCA 4WCGA 4A3JJ 3ZQCA 4JK1X 2OTJI 3JAMZ 2MD5A 2HFHA 2VXDA 3RJPA 3F22A 1T98A 2L5QA 1J75A 4M71A 2LF7A 3CO6C 2MYSA 1YIOA 2EZHA 4EM2A 2A3SA 3ZMDA 1IN4A 1W0TA 1HQCA 1WRJA 3QPTA 4XSZF 3P7NA 1HDPA 2HVSA 1SEUA 3J7YJ 1A35A 2F4MB 4ZYEA 3FXOA 2NVXJ 2X6WA 3AFHA 3PFYA 3HGGA 5GTHC 3KZZA 2PMZN 1PUFB 5FKNA 3S3NA 1RNLA 2BY0A 4CSWA 4W1UA 3MFKA 1XPXA 2B9SA 4FE7A 4YIFA 4FTHA 2EIKH 2WA0A 3F8BA 5EGOB 4HLYA 3QP5A 4U7DA 3WU2C 4CDGA 3RKXA 2L4MA 2BEOA 3SYTA 1FYLA 5L3DA 2JQ7A 3QRFF 2MW8A 1TL8A 3LFKA 2VC0A 3V8LA 3CF5F 3RYRA 3CC7I 4F7ZA 3JSPA 2JUGA 3ZPLA 2MC3A 4CCLA 5E3NA 4EJVA 1LDDA 2EV5A 4B47A 3OIOA 1SD7A 2O03A 3M3YJ 1AKHB 2L2OA 1SFEA 2MD0A 3KZYA 1W5SA 3HB9A 2ZCWA 1Z91A 3AG2H 1KGSA 5ICFA 1V3FA 4O5VA 4EV0A 1XC5A 2EV6A 5J6XA 3I4MJ 2L9NA 3GTKJ 3C2BA 1WJFA 4EM1A 1IUFA 2W57A 1SD5A 3H1CA 3SFIA 3H3UA 4A2UA 4BHBA 3RDIA 3RQIA 3CC2I 1TW3A 3H3VK 1FBQA 4J19A 1N77A 2Y9YA 2DCEA 4C3HJ 1S6LA 3MMYB 1I50J 1QPIA 2VBYA 3S3MA 1ZKGA 3FK7A 3MZHA 3D1NI 2Q2EB 4MFDA 2XF6A 4XSXF 3E6MA 4UY8I 4OINF 2QQAA 1ZHFA 5D5WB 3GTGJ 2R7TA 3ZQIA 4M3EA 2W48A 2WY8Q 5FRNA 4CGZA 3KYCB 2OJED 1TWHJ 2VPRA 2DK8A 1IDZA 4L5IA 1U9NA 2DA5A 3NWSA 5BMZA 1X58A 4HNUA 4G7HF 2Y69H 3EUAA 1T38A 3DBRB 2JRTA 3V7CA 1UHWA 3OYKA 3IL2A 4CICA 2ELHA 4UVCA 1QRYA 3C1DA 4K2EA 5DCMA 1OKRA 3T8TA 3LAJA 4MFEA 4BU2A 5JLWA 3BY6A 2VKEA 3PNTA 6PAXA 3N4MA 1IF1A 2L7ZA 5FD6A 1VQ8I 2ID6A 3CUQC 4KN4X 1QZEA 4P96A 1MBHA 1QZYA 1TWFJ 4F3QA 2NRAC 2QSGX 5KHDA 2ESHA 2EH3A 1SAXA 2DK5A 2RV8A 3FKJA 4BXUA 3F21A 3MD2A 3ZMZA 4ZH4F 1P6RA 1MW7A 2LOOA 2ME0A 4XM3A 1YOVB 4ZJZA 3A03A 1X1BA 3DXJF 2PMZA 5CVUA 1B9NA 5B1AH 3OYJA 1Z7LA 3HSRA 1K78B 2CUZA 1ZQ3P 4G8XA 4LLGF 2QSHX 5J8CA 2BV6A 2MC4A 2FOKA 1IW7F 3FDYA 2QSFX 2R4GA 3K0LA 4D7NA 1DDNA 2GA1A 2F6CA 3KIOA 5FLMJ 4LB5A 4E7HA 1SD6A 1VI0A 2ECBA 2F5VA 2CW7A 3CCSI 3S93A 2DA6A 1ETQA 1RI7A 2O6GE 3E97A 3G1MA 2X6XA 3CJNA 2RNJA 4IRHA 4RAZA 3FM5A 3DV8A 1X1DA 1A6IA 1S7AA 3F8CA 4S04A 4E7JA 2FMYA 2NNNA 3KP5A 5F0HA 2WC2A 4HW0A 3PO2J 3TKYA 3FISA 2IA2A 5F0FA 5HLGA 3WGIA 4Y7NJ 2FBHA 3JRFA 1T8IA 1T95A 4AIHA 3M1EA 1IXSB 1YI2I 3ABUA 3UR3C 4CZCA 2XROA 4ENKA 4B8XA 2HWVA 1DU6A 4BHPA 4ZYGA 2R0QC 2LNBA 1JUSA 4IEJA 5F08A 5GAEJ 2QYOA 2DW4A 4FASD 1GLNA 4RAGA 3CCUI 4FETA 3KPHA 2QKLB 2VQHA 4UVBA 2QF7A 1YW9A 2F5DA 3IRRA 2E7XA 1FIPA 2WAFA 1FWZA 1RKTA 1WJDA 3VYSB 4YFXF 2L0KA 4QPQA 4XICA 3TW6A 2P8TA 4L0YB 4XIDA 3WTWC 4DW6A 4U0YA 5J8FA 1R23A 4L0ZB 4YFNF 5E3LA 2QBYA 2DMQA 4RMNA 5HLTA 3BCBA 3BQZA 2COMA 1DPUA 2FQ3A 2JN6A 3FXQA 5E3OA 1I1GA 1KQ8A 3G3ZA 2G0EA 1Y0NA 5LRRA 2CQKA 2OBPA 1H0MA 5C3EJ 1WI3A 2NYXA 3HPGA 2CW8A 1TNTA 2Y31A 3MKWB 4NQWB 1LNWA 4OIPF 2ZSHB 2YS9A 2MA3A 2K86A 2HXIA 4G94A 1QNTA 2HZDA 1DU0A 1TQPA 1LPQA 4Q47A 2XASA 1IO2A 2FD5A 1BBYA 2JA2A 3ZMUA 4RGUA 2A6EF 4MQ9F 2XAHA 4J00A 2K40A 3WTZA 4J01A 3EQLF 2WV0A 2HKXA 3W2AA 2DMUA 2DFFA 2V9KA 3RPUD 3CJTB 3M8EA 4BEHA 2QZ8A 4XK4A 1MJAA 1YS6A 1ZARA 2WB1N 2HI3A 3ZQQA 5CQEA 4NHJA 1OCRH 1UB9A 3DF8A 2DYSH 1BR2A 2BW3A 3QYEA 2XUBA 4FX0A 4MGRA 4Y4RA 3TGNA 3FM3A 1IXRC 2OZUA 1EH8A 3K4KA 2PMHA 4L5JA 4E7KA 4G12A 2COBA 1FC3A 1ZELA 3I56I 3ERMA 4IF4A 4HNTA 1G3YA 3I54A 3E6DA 2DBBA 2PG4A 5HDKA 4B4CA 2FRHA 3BWGA 2LLKA 3JRBA 3CMEI 2OA4A 1LDJA 1VNDA 4OOIA 2KHMA 3VOEA 1F9NA 4XMYA 2M7BA 3GCMA 3K7AJ 2GZWA 2VUMJ 2ZXWH 2Z9OA 2ELKA 3FX3A 4S05A 5F1RA 1R1UA 5FLVA 1JTYA 3QODA 5K1YA 3WTYC 4PJ0C 5EG0A 3H5AA 5J4VA 2H09A 4YRVA 2JA7J 1K4SA 4XL9A 3ABKH 1UCRA 2EQRA 2FEZA 2ZFWA 2EZLA 1J2XA 2LC2A 4N4OB 2XGXA 2M3AA 2XPWA 1IZ1A 3OYDA 3GW2A 4P9UA 3H9QA 3L1PA 3GLLA 4E7LA 2IGKA 3GEZA 5DM6F 1V4RA 3WE2A 4ZYDA 2MFZA 5A2QK 2XAUA 1YHQI 1RIOH 3LQRA 2IPQX 2WADA 5CVJA 2JSCA 2J5OA 2GLOA 2E19A 4PFPA 2IVMA 5HLIA 1KZHA 2G7HA 4B1RA 3SEQA 5IP6A 3F72A 3AG1H 3OMYA 1YITI 2DT7B 3B73A 3HL2A 1IDYA 1IN5A 2BHYA 4XLHA 1QA6A 4X0GA 1IRGA 1ERDA 3IKTA 1E2XA 2AQFA 2HS5A 2KJBA 3BG6A 1X3WB 3CUQA 4LG3A 4OMZA 2CV0A 3TP3A 2OUMA 3JCUC 1OPCA 2V1NA 3ZGKA 3OY9A 1O3SA 1LUJB 3OV8A 1TWCJ 3EETA 3PSIA 3BR3A 4KICA 4A12A 2P7CB 2TCTA 1Z1DA 5B66C 1M1EB 2QENA 2XPUA 2FX0A 5FFZA 2DFIA 1MGTA 3VSKA 2WAQN 1SVLA 1UZCA 2WY7Q 2XB0X 2WV1A 1XMKA 3KZIC 2YU9J 3SEZA 2OF7A 2RQPA 2WTEA 2ADUA 2D45A 4ESJA 2UV1A 2V1DA 2X0LA 3DCFA 4I0BA 5H6RA 2R3SA 1Y56A 2CGPA 1ZYRF 2CMPA 1J5YA 3AAFA 2X85A 1IAWA 1R49A 3CQZJ 3BPXA 1LKXA 3REOA 2O0YA 1SVMA 5L3CA 2VQLA 3T0YA 4HSTA 4RA2A 2M1BA 2OQRA 3IP4B 1JT0A 1B72B 1D3YA 5K5RA 4Z6YA 2E34A 2DA2A 1Y1VJ 3LWFA 4EJWA 1BJAA 1ETXA 3RPQA 2EILH 1MKMA 3A01B 2VJ4A 1YX5A 5FKOA 1WFXA 5E8IA 3HGYA 4FHTA 5GP9A 4YFKF 2RREA 2QQ8A 3E6BA 2VQCA 2VBZA 3BJOA 3SQNA 4C2MJ 5FLXK 1H8AC 3BQYA 4LK1F 2KZVA 5BNGA 3OL4A 3PUBA 1TW2A 2H6CA 3KCCA 2K9QA 4LIVA 2IW5A 4RB1A 1X1CA 4YEJA 3SZTA 4O6JA 3FXUA 2OAZA 4M72A 3VPRA 2P6SA 4IL6C 3IAM2 1V54H 3EPZA 3IWFA 4EGYA 1R5GA 5F6FA 1DP7P 1Z6TA 4EJTA 3K69A 2FSWA 1ZRCA 5E1ZB 5KAIC 1YRNA 1K6YA 4KMUX 1TT0A 5C44J 2EZIA 2H94A 3S1MJ 2XAJA 3BG9A 2JA8J 4G6TB 4L18B 4PZJA 3CDIA 3VYRB 2W1OA 4IRIA 1EA3A 4KN7X 1T08B 2VPLA 4A6EA 3QOEA 1WJCA 4UUSA 3WTXC 3ZQFA 1T0FC 4QPOA 4ZYHA 3KEOA 5ED4A 3AG3H 1IV6A 1IGNA 1K7AA 4G7ZF 1LFUP 1KU9A 3S14J 2I5UA 4RS8A 3FXKA 2GA2A 5FD5A 3Q9SA 4XQFA 4DYCA 1MDMA 1Y8QB 3L2CA 5FLXZ 3DTEA 1Q1VA 2K9SA 3DFGA 3G1LA 4P5OA 1REPC 1F4KA 3TL4X 2PI0A 4PSXA 3E5XA 1AA7A 2DDAA 4BNCA 2HDCA 2DU9A 1U78A 2VODA 3OOPA 2EPFA 4GO1A 2OCEA 2E60A 5LHIA 1WKMA 3RZDJ 2DMTA 3R61A 2DXIA 4A93J 1W7PA 4G6QA 2M9HA 2X1DA 1BIBA 1EKEA 2FQ4A 1HKQA 1FIAA 2AO9A 3DPUA 3BC8A 1RPWA 3QP6A 4HEA2 4E7ZA 3OYNA 5TRDA 1OCCH 2QGUA 3NARA 3K10A 4CCJA 3FHZA 2DN0A 2ME6A 4QIWN 5LRSA 5LEKA 1TNSA 3TDZC 1DUXC 2F5FA 2GIVA 4KT6A 1TQIA 4XBFA 1TT5B 2FXAA 3IHUA 4D5CA 5ILSA 4Y52J 3ULQB 3X2QH 1JKPC 1HBXG 1BJZA 2JA6J 1QVTA 2F5CA 4A5NA 2JPCA 1G3WA 1ETWA 4IHYA 3ZRGA 2HQRA 2E36A 3G6EI 2HXOA 4PUSA 3OL3A 1XSXA 4LD5A 1HCRA 1OYIA 3OS0A 1FBUA 2EK5A 1FX7A 2HTJA 2EA4A 4BE0A 1PP7U 2BE5F 3TBIA 2W25A 3JAMK 2V9VA 2PQ8A 2X6OA 4YIRX 2CSOA 2HVQA 3K1MA 3QQAA 2L7MP 3E0JB 1P4AA 1YW7A 1APLC 2IGNA 1SFKA 4A0XA 2N8GA 1S72I 4AIDA 1I6XA 1VF9A 3TOBA 1ZG1A 2DOFA 4BQAA 1LFBA 4UV8A 2IT0A 3SFZA 3IH3A 5L3BA 1HW2A 1QVUA 2F4IA 2X6YA 1ULYA 4EQQA 1K61A 3BR5A 1ONVA 3U2RA 5DDGA 4Y13A 4I02A 5HNHA 4DIQA 2CU7A 2KMUA 2V6CA 2EFWA 2AQEA 1FTZA 2DTZA 4DYRA 1S3JA 3D0SA 2VE9A 2Y0MA 1I39A 3SZGA 5HS7A 3QPHA 2O8XA 2E1CA 1R6RA 2CFOA 2M4KA 1AU7A 1ETKA 2XAQA 4ZDOA 1BIAA 2EB7A 1T39A 2RN7A 1BA5A 1MBKA 1ZGAA 4JX6A 1N75A 5KAFC 4NB5A 3FMQA 1FP1D 3L2RA 3GTPJ 1G59A 1N78A 4KIFA 1F43A 5KK1A 1RZ4A 5ICGA 2ZJPF 2STWA 3D5RC 3LMMA 1MH3A 4L9TA 4RGXA 2HOTA 2AS5F 3SZPA 3S2HJ 2CO5A 5JVTA 1VQNI 1FJLA 4CYDA 1YLFA 2W82A 4ZZDA 5JHUA 5CLSA 2HYJA 1B8IA 1OYYA 5K7FA 3GLXA 2FMLA 2K9MA 2KIQA 3EDPA 1TZLA 2LG4A 1HW5A 1RETA 1QZZA 4MNUA 1RR7A 3DEWA 5CVRA 5FROA 3ONQA 3VSLA 2B0LA 3LA2A 3H5RA 3VYTB 3ZQ7A 2J5PA 1HLVA 1MMAA 5CKTA 5DYMA 2Y75A 3KP2A 2HPMA 3K6GA 3FIWA 2EINH 1KU2A 3QOPA 5L3FA 2OD5A 1OJLA 4HSRA 2CS3A 2R5ZA 4ANJA 4IO9F 2Z1DA 2M4GA 5FGMA 4BQNA 1ZR4A 3PL8A 1VQ5I 3FK6A 2KQRA 3GFJA 2JPBA 4JBAA 1A31A 1S7EA 4IXAA 2QM3A 4D7MA 4KJZA 2V26A 5JVGF 1ON2A 4XKBA 1DPRA 2KIUA 1J0RA 1YG2A 1JE8A 1DQUA 3FMSA 2Z3YA 4UB6C 1SANA 1HSTA 2R7RA 2VJIA 5HNFA 4AUXA 5CVVA 1J59A 4JQFA 4OIRF 2MG4A 1F1ZA 1PDNC 3K4CA 3CTAA 1X2MA 2BOLA 3IUOA 4RGRA 4A3MJ 1LEBA 4RBOA 1ZAOA 4MEXF 1XDSA 2EBIA 4RAYA 4Y17A 4PFOA 4IQJA 2LY2A 4H0EA 2LTPA 1R5ID 2IS1A 1XMXA 2BVLA 4CCOA 4XR6A 2STTA 1Y6IA 2CUEA 4M73A 2IEKA 3QU3A 4LIUA 4V19K 5GTIC 4JP0A 1POGA 4BJTA 3CCJI 4BBSJ 2LYCA 3IWZA 3JREA 5BOXA 3GFMA 4KFCA 2PJPA 2E5ZA 1QHHD 3NWTA 3BG3A 4I0AA 4XNFA 3GZNB 3BR2A 4XORA 1T0FA 2M5WA 3SHFA 4MQVA 4KIGA 1XD7A 3G4SI 1FP2A 3HEFA 1LVKA 3ZMTA 1JUPA 3K4MA 3S17J 1O4XA 1ZG3A 1P2FA 4LJZF 4M6XA 5J1UA 2DA4A 3MKLA 2GM4A 2DA1A 3A1YA 1ETYA 3KLOA 3I58A 2Y48A 4WK8F 3LNQA 1T33A 2HZTA 4U0WA 2DQRA 2LKPA 1YX3A 3BJ6A 1X3UA 2V7FA 5LHGA 4IHWA 3OYLA 2DODA 1NG6A 5EYRA 3MAJA 3S2WA 4NNJA 2G7UA 2EIJH 3TP0A 1I1SA 4FQGA 2O7OA 3MWMA 1EV7A 4I99C 3K4JA 4CA0A 2DDBA 2Z2SB 5DD8A 3J7AY 1UG0A 4M6YA 2QA4I 3W3CA 1E3PA 2NOGA 5DEQA 3ZQGA 2PJRA 4AYBN 1YJ9I 1YS7A 3OIQA 3DU5A 3M8FA 3H0GJ 1ZG5A 1XG1A 4NC7A 3P9KA 4GGGA 2R93J 1LE8A 4LFUA 2CFXA 1UELB 4BGDA 3HOYJ 2O61A 2FNPA 2XB5A 4EEFG 1VQ4I 1D8JA 2FBIA 2VC1A 3BR1A 1F36A 3PJRA 4IJAA 4PJMA 1R22A 3LSHA 4BUPA 2M34A 2NVUB 3HOWJ 3P9IA 4F93B 5LBQA 4ABZA 2KISA 1CGPA 1GDTA 1P9QC 1WQ2A 3HXLA 3T5XA 4YELA 1CQTA 1OR7A 2P81A 3Q9VA 4Z2YA 2FA5A 2DT6A 5DCMB 1XN7A 4XONA 4Q5SF 3PIPF 3OS1A 4HYEA 2D1HA 3OSFA 4HDVA 3R60A 2OU2A 3M7GA 4EJUA 2R5YA 4HQEA 1B59A 2VT3A 2EFQA 3JTHA 5IOYA 3CP2A 2WWYA 3GWZA 3W6VA 3HUGA 3S3OA 1GUUA 1XB4A 2D2WA 2CH0A 2EWNA 3B6AA 3JRCA 3K70D 1ZRFA 3BR6A 2Z33A 5J47A 4CZZA 3LQQA 1VQMI 1W4MA 2K7LA 3DKYA 2DPDA 1V55H 4HAMA 3VEPA 3HYIA 4FISA 1DP3A 2QCOA 3KFWX 5C4XJ 4RLFA 4HDUA 1SFOJ 1K6OA 2Q1ZB 1A5JA 2KP6A 1PUEE 3NAUA 4G6DA 2LY1A 2BYVE 5BQTA 3N97A 2NXNB 1UJ8A 4EATA 4RM2A 2NNYA 4PK4A 1IC8A 3CC4I 3PNYA 4A3CJ 3L00A 3DLAA 1MH4A 2L7KA 3A0HC 3K2ZA 2HEOA 4M9XA 2LVSA 4AVZA 3CZ6A 3IV5A 4E4HA 1YJNI 3IC7A 4LK0F 2NVYJ 1Z0XA 2NS0A 2CWEA 4NBQA 2KFDA 4A6DA 1QO0D 3K4LA 2E35A 1BOBA 2W00A 1LFPA 3GVAA 5FO5A 3ZR8X 1GVDA 2DI3A 4F55A 3K2AA 1R1VA 1Z3YA 1MZBA 1SVOA 3JRIA 2BY1A 1ZRDA 2ACJA 1HOMA 3I71A 5D6EA 5EJCA 3V8KA 3R0JA 5KNLA 5TISC 3PUFA 2LBFA 1SMYF 4GYGA 3CMMA 1CF7A 1HXDA 4GDFA 3H92A 4XLEA 3CD6I 2Z99A 1H9GA 3CESA 1MBEA 4AYBA 4DBRA 2BHZA 2FU4A 1FLIA 2KL4A 2ZMEC 1W5TA 1HKTA 2VE8A 5D4SA 3FBNB 1MD0A 1GT0C 2E1MB 1IG7A 2JVHA 3PIOF 1HW1A 2DOEA 3S1RJ 1N25A 2JJ7A 3M1CA 4Y3OA 3ZMVA 3GX4X 4GCVA 2F2EA 1MIJA 1T6SA 5DM7F 3CCQI 1P4XA 1FT9A 3J80K 5DTDA 3I64A 2F48A 3MEXA 2QBYB 3F9KA 2VKDA 3WTUC 2RVCA 2LR8A 4HOBA 4B48A 5LD2C 2A5WA 5D5XB 2K9NA 3BTLA 3JR9A 2ZJRF 3E3VA 1MSEC 2XGDA 4OU0A 1TLHB 1YFHA 2E1NA 1XCVA 2KIFA 1SFUA 3J7AO 4IX7A 4MIMA 1LB2A 3AG4H 3WTTC 1EF4A 2A6HF 3OYAA 3BG5A 5L3GA 1JHFA 1GXPA 1ZH5A 2R92J 3FKIJ 1Y8RB 4A3BJ 3RTRA 2L7FP 1U5TC 1KYZA 3LSTA 4BKXA 1KU3A 1HKSA 3ECOA 1P4WA 2XF7A 2XKPA 3HHHA 2R7VA 1X1PA 2GXAA 1G3SA 2DOAA 4NC8A 2P4WA 1G8XA 3ZQHA 4N0BA 4BE2A 5EZHA 4BEHB 2VXZA 3S2DJ 2CV1A 3BJAA 3HHGA 3UKGA 5B1BH 2QEXI 1WJAA 4OAZA 1RUOA 4A3DJ 4ITVA 4XLFA 1USTA 4M3DA 4HA8A 1W1WE 5CQGA 2BW3B 5K5OA 1P92A 4AM3A 4F91B 1A6QA 3LSJA 1G6NA 3J80Z 1W0UA 3GBGA 2K4BA 3RSNA 2VIXA 1B4AA 1FMWA 5J40A 3E6CC 2MSYA 2ID3A 2P6TA 4IHSA 3OYBA 1B72A 1JKRC 5HVQC 4E70A 2DO7A 2ESNA 2L01A 2I10A 3IAS2 4IHVA 1NHAA 3VWBA 1ZGJA 3M9AA 2A6TA 3ZOBA 4U88A 4CUGA 5FRMA 1S29A 2FF4A 2XGCA 4A5MA 1W5CC 3LSGA 5DCFA 3F0CA 2GOXB 5GADJ 5EG0B 3BLYA 4D1QA 2NS7A 5DUKA 3E1SA 5CPRB 1JXSA 2DPUA 2OQGA 1Y0UA 2L9SA 2BGCA 3S1QJ 3QU6A 4CYCB 1U0JA 2JUCA 5LGUA 3S1NJ 2VASA 1BW5A 4D5FA 4MTEA 1BR4A 2CW0F 2Z5UA 4XKWA 4D0PA 1E3OC 5IYBJ 1J9IA 1YTYA 2Z16A 1OMIA 4BAYA 3GFLA 3G73A 2HTSA 4C3JJ 3NEUA 4BDYA 4DYQA 1JJ6C 1ZK8A 3IKVA 4W97A 4C9YA 1JGGA 2OV7A 2ZC2A 3W2WA 1ZLJA 2YSRA 4HX7A 3DBHB 2VKHA 4KDPA 1Z05A 3PSFA 2K85A 3DPLC 4ZTFA 2JVGA 3OR2C 4XLNF 3ASNH 2EFOA 3S15J 2ZFUA 4Y33A 3CCLI 1MJBA 4DQ2A 5HS8A 3CUQB 5L3EA 3RI4A 4XN0A 3I4NJ 3HTUA 4LB6B 1BL0A 3DEEA 1MNDA 1XCBA 2BXYA 3T1BA 3E7LA 4HNVA 2UXXA 3DKWA 3GO5A 2ZNYA 1HDDC 1D0YA 4BJ6C 4N4NB 1SC7A 1WGXA 5J3LA 1YW8A 3D5LA 2MH9A 5M3MJ 3J81K 5IP7J 4FE4A 1U3EM 2CUJA 4B44A 4P9FA 4RB3C 1W36C 3WTVC 5JFRA 4RLQA 5DS9A 1OFCX 1R71A 1E0EA 3CO7C 3L9FA 5GAHJ 1BI3A 3ECHA 2BBYA 2CQQA 2VB6A 3W6KB 4MTDA 2M2EA 3KYLA 3DU6A 2JWTA 2AXLA 4PSWA 1WH7A 1X1AA 2K02A 3TW7A 1Z3XA 3O2PE 1TBXA 2GAUA 2H8RA 4TV7A 4BY7J 2E5NA 4PGGA 5M3FJ 5EF6A 5D8LB 3H9GA 3TOAA 4L9JA 2W7NA 2L4AA 5H20A 4UUTA 3F8NA 2DMPA 1XMAA 1L0OC 5EEHA 5FKKA 2KRCA 2A07F 1LQ1A 5D6FA 1Q1HA 3L2WA 2M45A 2P5VA 1OCPA 1S7OA 3CCYA 5AIQA 1FYMA 4LG0A 2JRMA 3BZKA 3O3KA 3DP7A 2ZKZA 1D5YA 3HKZN 3NQOA 3GXOA 4BXXJ 1OCTC 4PDKA 2V1XA 1I27A 2ZMEA 4FT8A 4ZYAA 3MKZA 1RKWA 1G3TA 3ML6A 4KIBA 3J81Z 2IAIA 4MLOA 1KA8A 4EJOA 3T8RA 2V79A 1YRNB 2O5RA 2VLAA 1GV2A 3RKQA 1MBJA 3EUKL 2HNHA 1IN6A 1MMDA 1ACIA 1U6GA 2CQXA 2HOEA 5H2FC 3HOTA 1WWXA 2KT0A 5GPCA 4RAFA 1GV5A 4U7BA 3KYDB 5ILUA 2D5VA 4A3EJ 4HRIA 2DT5A 3TO6A 3K9TA 4IPAA 4UUSB 3MKYB 2L9VA 5AONA 5B5EC 2F5EA 4JYKA 4L5EA 2R7OA 3FXLA 4HG2A 4BL0B 2HDWA 2LY9A 3CF2A 4A3FJ 3I59A 4I01A 2W84A 1JUMA 2Y0SA 4KA4A 1NK3P 3HM5A 2KKOA 5E18F 1JT6A 1MDMB 2DA7A 2DFEA 3ELKA 3CDLA 5LGNA 2M8GX 2XSJC 1JI8A 4HQMA 2VN2A 5TJJA 2BY2A 3VYUB 1OR7C 1FPQA 1U5TA 2PEXA 4RDUA 1USSA 2XKOA 3SDBA 1W7PB 2BZTA 3R6SA 3QAHA 4DNCA 2HVRA 2YX4A 3LAPA 2LP0A 3I3LA 5FFXA 4DOZA 3K4BA 2IJLA 2RGVA 2OCCH 2BVMA 3MZ8A 1ITYA 4H4KC 2X48A 3G2BA 3HRMA 3ZP5A 3HOVJ 1U9OA 2O3FA 3GF2A 4C3IJ 5JI6A 3WU1B 4KUMA 2BY3A 3GTLJ 2VBXA 2K9LA 2V9PA 1S9HA 3KX2A 3WG9A 4BY1J 3DWLE 3RPUA 3Q3SA 3HTSB 2IS4A 4JX4A 4RGSA 4Q4ZF 2MLKA 1WJ5A 4GXOA 1PUFA 5HLHA 1LDKB 2E7WA 1Z21A 1B6AA 1FY7A 4WF2A 1AWCA 3A4CA 3CJQB 5EGOA 1IN7A 4XOTA 1BR1A 1BI2A 3FBIB 3JRHA 4BE1A 2HU9A 3PO3J 4D9JA 4BQOA 3OWTA 4UXNA 3I4PA 4OMYA 3F6OA 2JMWA 2VJ5A 3VFZA 5D8KB 4KITB 1IUYA 3UNGC 1EJ9A 1RR8C 2JSPA 4HX4A 1QQIA 4YG2F 1ON1A 4M74A 1XDUA 4R8HA 4ZDLA 2GIZA 4BYYA 1R36A 3LSPA 1VQOI 3HKZA 2G9WA 3DEUA 1AKHA 4LITA 5ICCA 1BM9A 2K27A 3GFIA 2RQQA 2H27A 4AVPA 1OCOH 5J4YA 2FNAA 1EH6A 2HR3A 2CYYA 2IBDA 3KP7A 4HLXA 1OCZH 4RM3A 4A0ZA 3COAC 4C2TA 5BPDA 3SJMA 2Q8KA 3GZ5A 2X1EA 5B3SH 2XV4S 1S8NA 2EA2A 2X4HA 4A3IJ 4HF1A 4XRSG 3L2VA 3IH2A
chains in the Genus database with same CATH topology
3U1DA 3L7WA 2NAZA 2Q2EA 1O7LA 3TQNA 2ZJ2A 1Z6RA 2R7FA 2EFPA 1OYWA 2RKHA 4I7HA 1H9TA 1U2WA 3HRTA 4QWQA 5E8GA 3F23A 1BI0A 3WGHA 3FXRA 3ZMSA 1GHCA 4HF2A 2LSOA 1KYWA 4G7OF 3HSEA 2DAOA 1BI1A 2VOOA 1SD4A 3BP8A 4IHTA 2L3DA 2PMUA 3WTSC 1O57A 2XVCA 3I5UA 4ENJA 4MEYF 4MHGA 1TTYA 4RB0A 1FBSA 3V7SA 2P5LC 4RB2C 2L54A 1K78A 1BC7C 3ERED 2QQBA 2CG4A 4CXFA 4AIJA 1R7JA 3LA7A 1XGSA 3TO9A 1FNNA 1GXQA 5DD4A 4UHTA 3JSOA 1WSUA 2DQLA 1JHHA 3KEQA 2FE3A 2C6YA 5LHHA 4OIOF 1Z9CA 3W6JB 1QGPA 3RYPA 2ZO4A 2UZKA 3F8FA 1LEAA 2UWMA 5HOOA 2PBIA 1G4DA 3I53A 4ZZLA 5ILVA 1UFMA 4M9SA 1VTNC 3Q5FA 1SFXA 2GXBA 2MBFA 2ZNZA 2P5KA 2XRNA 2D1VA 2IA0A 1FYKA 4BHCA 4WX9A 1XSVA 2HYGD 2W85A 4IRGA 3C18A 2VOPA 4I2OA 4N9HA 1KU7A 4ESFA 3GUDA 2EV0A 2FBKA 5LEJA 3HOSA 5E1XA 1D5VA 2GWRA 5K5QA 4NQWA 1W7PD 2ZXJA 3WODF 3CLOA 3I0TA 2QWWA 2IRFG 5KVRA 4ETSA 4UV9A 4AWXB 3CDHA 3PFIA 4ESBA 4I09A 1UHMA 3HRSA 4UUVA 3ZN0A 4KYWA 1ZN2A 2V1UA 3PQJA 5E1WA 4IVNA 3U9GA 2YR2A 5D5UB 1ODDA 1LJ9A 3HRUA 3HSFA 1D8KA 1QPMA 1E17A 5LGTA 3ROUA 1R00A 3WU0A 2A69F 2QLZA 4N9IA 3K1NA 2A68F 3K1PA 3MZYA 4HZFA 1B1BA 5CVIA 2QUFA 4L9NA 3TO7A 2PN6A 1RUNA 4EVIA 1ZLKA 1R5HA 2JT1A 4ENMA 2RC4A 2JTVA 2A5YB 2M87A 2HKOA 4XRFA 2DLLA 3HIFA 1YQAA 4YIIA 2XHKA 1SMTA 3KETA 3O6BB 4OIQF 5H6QA 2PFBA 4ON0A 2IP2A 1R58A 4HV6A 3ISPA 3RIRA 3F3XA 4FX4A 5E17F 2UXNA 1EH7A 1FSEA 1A04A 1CF7B 3PQKA 3C3WA 3BPVA 5JR3A 1PP8F 4HX8A 5ERIA 4EMSA 5ICEA 4LMYA 1O7FA 4I98B 2DTRA 4WWCA 2VBWA 3R0AA 4WXHA 3H3ZA 1XSDA 1IRFA 4Y15A 2KRFA 3BZ6A 3EYYA 2A61A 2LDUA 4LLNA 4ASNA 3FWEA 1YO5C 1BOAA 3F6VA 1O3QA 3RKWA 2M30A 1T2KA 3FZVA 5HDGA 2EJRA 1L3LA 3DQVC 4UNOA 3KP3A 3WE3A 3VODA 5HDNA 1YYVA 4R79A 5BPIA 1J7KA 2MH2A 2YX7A 1FSHA 2GXGA 5FB2A 1K79A 3B02A 2HQNA 1HSJA 1TQMA 1WI9A 4L9VA 3V8JA 2Q0OA 3DPTA 3F8MA 3TDUC 4O3MA 3NRVA 1Z7UA 5A2QZ 3R4KA 1XGNA 1IXCA 3E5UA 3BDDA 3BOQA 2ETHA 2L02A 2QVOA 2YU3A 4LLLA 4AIKA 3ZN1A 3V7RA 2XIGA 3LA3A 5DUIA 4GYIA 3EYIA 2TDXA 4WXCA 5HS9A 1KQ9A 1C0WA 1F5TA 2PLYA 2XAGA 3EUHA 5DV5A 2HGCA 1KQ0A 2QQ9A 3CUOA 3RKYA 4LGWA 1XGOA 2IA1A 1I5ZA 2RDPA 2YPRA 3KP6A 2KIMA 4CHUA 1IN8A 4HV5A 4M9ZA 3JTGA 3FF5A 2JZYA 2HYFA 3E5QA 1R1TA 3MCZA 3C7JA 4A0YA 3ABTA 4U0VA 1STZA 4P55A 3JW4A 4B09A 2M8EA 5D4RA 1U8RA 5BS6A 1JGSA 5IT9K 2VT2A 4Q48A 5F64A 3KP4A 1ZREA 4KMFA 1B9MA 1BN5A 3P9CA 4ENNA 3KE2A 4EGZA 1QBJA 3L09A 1BC8C 2K4JA 4XLPF 1AOYA 1FZPB 4HF0A 3FMRA 3BROA 4LG0B 1XGMA 3GZ6A 3MQ0A 4AD9A 2ZBKA 4HBLA 1MJ9A 5CYVA 4UVAA 3WGGA 2ZMEB 1FOKA 2P7VB 5AIPA 3KLNA 4CO8A 2VONA 2ISYA 3IRQA 5IT9Z 5E20A 2R7DA 5CJ9A 1O3TA 5LLQA 4QLCU 5EEGA 1O3RA 2LF8A 2MLGA 2OZ6A 4PGHA 4PCQA 4WXDA 4EM0B 1LVAA 2XAFA 2ISZA 4KT5C 3VB2A 4KNYA 5D5VB 3SXYA 3I59B 1GVJA 2W24A 4G9YA 2EFNA 4R1HA 2H6BA 3GYHX 2GQQA 5IT3A 4BH9A 3V4GA 1U5TB 2KJCA 4WCGA 4JK1X 3JAMZ 2MD5A 2HFHA 3RJPA 3F22A 1T98A 1J75A 4M71A 2LF7A 3CO6C 1YIOA 4EM2A 2A3SA 3ZMDA 1IN4A 1HQCA 1WRJA 3QPTA 4XSZF 3P7NA 4ZYEA 3KZZA 1RNLA 3MFKA 4YIFA 3F8BA 4HLYA 3QP5A 4U7DA 4CDGA 3RKXA 2L4MA 2BEOA 1FYLA 5L3DA 3QRFF 3LFKA 2VC0A 3V8LA 3RYRA 4F7ZA 3JSPA 3ZPLA 2MC3A 4EJVA 1LDDA 2EV5A 1SD7A 2O03A 1SFEA 3KZYA 1W5SA 2ZCWA 1Z91A 1KGSA 5ICFA 1V3FA 4O5VA 4EV0A 2EV6A 5J6XA 4EM1A 2W57A 1SD5A 3H3UA 4A2UA 4BHBA 3RDIA 1TW3A 1FBQA 1S6LA 2VBYA 3MZHA 4XSXF 3E6MA 4OINF 2QQAA 1ZHFA 5D5WB 4CGZA 2DK8A 4L5IA 5BMZA 4G7HF 1T38A 2JRTA 3V7CA 1UHWA 3IL2A 4CICA 2ELHA 4UVCA 3C1DA 4K2EA 5DCMA 1OKRA 3T8TA 3LAJA 3BY6A 6PAXA 3N4MA 1IF1A 5FD6A 3CUQC 4KN4X 4P96A 2NRAC 1QZYA 2ESHA 1SAXA 2DK5A 2RV8A 4BXUA 3F21A 3ZMZA 4ZH4F 1P6RA 3DXJF 5CVUA 1B9NA 3HSRA 1K78B 4G8XA 4LLGF 5J8CA 2BV6A 2FOKA 1IW7F 3K0LA 1DDNA 2GA1A 4LB5A 1SD6A 1RI7A 2O6GE 3E97A 3CJNA 2RNJA 4IRHA 4RAZA 3FM5A 3DV8A 1S7AA 3F8CA 4S04A 2FMYA 2NNNA 3KP5A 2WC2A 4HW0A 3TKYA 2IA2A 5HLGA 3WGIA 2FBHA 4AIHA 3M1EA 1IXSB 3ABUA 2XROA 4ENKA 4B8XA 2HWVA 4BHPA 4ZYGA 2LNBA 2QYOA 2DW4A 4UVBA 1YW9A 2F5DA 3IRRA 2E7XA 1FWZA 4YFXF 2P8TA 4L0YB 3WTWC 4U0YA 5J8FA 1R23A 4L0ZB 4YFNF 2QBYA 2COMA 1DPUA 2FQ3A 3FXQA 1I1GA 1KQ8A 3G3ZA 5LRRA 2CQKA 2OBPA 1H0MA 2NYXA 1TNTA 4OIPF 1LNWA 2MA3A 2K86A 4G94A 1QNTA 1TQPA 4Q47A 2XASA 1BBYA 3ZMUA 4RGUA 2A6EF 4MQ9F 2XAHA 3WTZA 3EQLF 2WV0A 2HKXA 3M8EA 2QZ8A 1MJAA 1YS6A 1ZARA 4NHJA 3DF8A 1UB9A 4FX0A 2XUBA 4MGRA 3TGNA 3FM3A 1IXRC 2OZUA 1EH8A 4L5JA 2PMHA 1FC3A 4IF4A 1G3YA 3I54A 3E6DA 2DBBA 2PG4A 5HDKA 2FRHA 3BWGA 2OA4A 1LDJA 4OOIA 3VOEA 1F9NA 2GZWA 2Z9OA 3FX3A 4S05A 5F1RA 1R1UA 3WTYC 5K1YA 2H09A 1UCRA 2FEZA 2ZFWA 1J2XA 2XGXA 1IZ1A 3GW2A 4P9UA 3GEZA 1V4RA 3WE2A 4ZYDA 5A2QK 1RIOH 3LQRA 2IPQX 5CVJA 2JSCA 2J5OA 2IVMA 5HLIA 2G7HA 3F72A 3B73A 1IN5A 1IRGA 3IKTA 1E2XA 2HS5A 2KJBA 3CUQA 4OMZA 1OPCA 1O3SA 3OV8A 3EETA 4KICA 4A12A 2P7CB 1Z1DA 2QENA 5FFZA 2DFIA 1MGTA 1XMKA 2RQPA 2WTEA 2ADUA 2D45A 4ESJA 2V1DA 2X0LA 4I0BA 5H6RA 2R3SA 2CGPA 1ZYRF 1J5YA 3AAFA 1IAWA 3BPXA 3REOA 2O0YA 5L3CA 3T0YA 2M1BA 2OQRA 1D3YA 5K5RA 3LWFA 4EJWA 1BJAA 3RPQA 1MKMA 5E8IA 4FHTA 4YFKF 3E6BA 3BJOA 2VBZA 3SQNA 5FLXK 4LK1F 1TW2A 2H6CA 3KCCA 2IW5A 4RB1A 3SZTA 4O6JA 3FXUA 2OAZA 4M72A 2P6SA 3IWFA 4EGYA 1R5GA 5F6FA 1DP7P 1Z6TA 4EJTA 3K69A 2FSWA 1ZRCA 5E1ZB 4KMUX 2H94A 2XAJA 4L18B 4PZJA 4IRIA 4KN7X 4A6EA 3WTXC 4ZYHA 3KEOA 5ED4A 1K7AA 4G7ZF 1KU9A 4RS8A 2GA2A 5FD5A 3Q9SA 1MDMA 3L2CA 5FLXZ 3DFGA 4P5OA 2PI0A 1REPC 1F4KA 3E5XA 4BNCA 2HDCA 2DU9A 1U78A 2VODA 3OOPA 4GO1A 5LHIA 1WKMA 3R61A 1W7PA 4G6QA 1BIBA 1HKQA 3QP6A 5TRDA 3FHZA 5LRSA 5LEKA 1TNSA 3TDZC 1DUXC 2F5FA 2GIVA 1TQIA 4XBFA 2FXAA 3IHUA 5ILSA 3ULQB 1HBXG 2F5CA 4A5NA 2JPCA 1G3WA 2HQRA 1XSXA 4LD5A 1OYIA 2EK5A 1FBUA 1FX7A 2HTJA 2EA4A 1PP7U 2BE5F 2W25A 3JAMK 2V9VA 2PQ8A 2CSOA 3K1MA 1P4AA 1YW7A 4A0XA 1I6XA 3TOBA 1ZG1A 4BQAA 4UV8A 2IT0A 3SFZA 5L3BA 1HW2A 1ULYA 4EQQA 1ONVA 3U2RA 5DDGA 4Y13A 4I02A 2V6CA 2EFWA 1S3JA 3D0SA 2VE9A 2Y0MA 5HS7A 3QPHA 2O8XA 2E1CA 2XAQA 1BIAA 2EB7A 1T39A 2RN7A 1ZGAA 4NB5A 3FMQA 1FP1D 4KIFA 5KK1A 1RZ4A 5ICGA 2STWA 4L9TA 4RGXA 2AS5F 3SZPA 2CO5A 5JVTA 4CYDA 1YLFA 4ZZDA 5JHUA 5CLSA 1OYYA 3GLXA 2FMLA 3EDPA 1HW5A 1QZZA 4MNUA 5CVRA 2B0LA 3LA2A 3ZQ7A 2J5PA 5DYMA 2Y75A 3KP2A 1KU2A 5L3FA 3QOPA 2OD5A 5FGMA 3GFJA 2JPBA 4JBAA 4IXAA 2QM3A 1ON2A 1DPRA 2KIUA 1J0RA 1YG2A 1JE8A 3FMSA 2Z3YA 1HSTA 5CVVA 1J59A 4JQFA 4OIRF 1PDNC 1F1ZA 3CTAA 4RGRA 1LEBA 1ZAOA 4MEXF 1XDSA 4RAYA 4Y17A 4H0EA 2STTA 4M73A 3QU3A 3IWZA 5BOXA 3GFMA 4KFCA 2PJPA 4I0AA 1T0FA 2M5WA 3SHFA 4MQVA 4KIGA 1XD7A 1FP2A 3ZMTA 1ZG3A 1P2FA 4LJZF 4M6XA 3KLOA 3I58A 2Y48A 4WK8F 2HZTA 4U0WA 2DQRA 2LKPA 3BJ6A 1X3UA 5LHGA 3MAJA 3S2WA 2G7UA 1I1SA 3MWMA 1EV7A 5DD8A 4M6YA 5DEQA 1YS7A 3M8FA 1ZG5A 3P9KA 4GGGA 4LFUA 2CFXA 2O61A 2FNPA 1D8JA 2FBIA 2VC1A 4IJAA 1R22A 3P9IA 5LBQA 1CGPA 1WQ2A 3T5XA 1OR7A 3Q9VA 4Z2YA 2FA5A 5DCMB 1XN7A 4Q5SF 4HYEA 2D1HA 4HDVA 3R60A 2OU2A 3M7GA 4EJUA 4HQEA 1B59A 2VT3A 2EFQA 3JTHA 2WWYA 3GWZA 3HUGA 1XB4A 1ZRFA 2D2WA 2EWNA 2Z33A 4CZZA 3LQQA 1W4MA 2K7LA 2DPDA 4HAMA 3VEPA 3HYIA 3KFWX 4HDUA 1K6OA 1PUEE 4G6DA 2BYVE 5BQTA 3N97A 2NNYA 3L00A 3K2ZA 2HEOA 4M9XA 3IC7A 4LK0F 2NS0A 2CWEA 4A6DA 1QO0D 3GVAA 5FO5A 2DI3A 1R1VA 1MZBA 1ZRDA 2ACJA 3I71A 5D6EA 3V8KA 3R0JA 1SMYF 4GYGA 1CF7A 1HXDA 3H92A 2Z99A 1H9GA 2FU4A 1FLIA 1W5TA 1HKTA 2VE8A 5D4SA 1MD0A 1HW1A 3ZMVA 3GX4X 4GCVA 2F2EA 1T6SA 1P4XA 1FT9A 3J80K 2QBYB 3I64A 3MEXA 3WTUC 2RVCA 4HOBA 5D5XB 3E3VA 4OU0A 1TLHB 1YFHA 2E1NA 1XCVA 2KIFA 1SFUA 3J7AO 1LB2A 3WTTC 2A6HF 5L3GA 1JHFA 1GXPA 1ZH5A 3RTRA 1U5TC 1KYZA 3LSTA 1KU3A 1HKSA 3ECOA 1P4WA 2XKPA 3HHHA 1G3SA 2P4WA 4N0BA 2VXZA 3BJAA 3HHGA 1RUOA 1USTA 4HA8A 5K5OA 1P92A 3J80Z 1G6NA 2K4BA 1B4AA 3E6CC 2P6TA 4IHSA 5HVQC 4E70A 2DO7A 2ESNA 2L01A 1NHAA 1ZGJA 3M9AA 4U88A 1S29A 2FF4A 4A5MA 5DCFA 5DUKA 1JXSA 2DPUA 2OQGA 1Y0UA 2BGCA 3QU6A 5LGUA 4MTEA 2CW0F 2Z5UA 4D0PA 1J9IA 1YTYA 1OMIA 4BAYA 3GFLA 3G73A 2HTSA 3NEUA 3IKVA 1ZLJA 2YSRA 4HX7A 4KDPA 1Z05A 3DPLC 4XLNF 2EFOA 1MJBA 4DQ2A 5HS8A 3CUQB 5L3EA 3RI4A 3HTUA 4LB6B 1XCBA 3T1BA 2UXXA 3DKWA 3GO5A 2ZNYA 1YW8A 3D5LA 2MH9A 3J81K 1U3EM 4P9FA 4RB3C 3WTVC 5JFRA 3CO7C 3L9FA 1BI3A 3ECHA 2BBYA 3W6KB 4MTDA 2AXLA 2K02A 3O2PE 1TBXA 2GAUA 4TV7A 4PGGA 5D8LB 3TOAA 4L9JA 2L4AA 5H20A 3F8NA 1XMAA 1L0OC 5EEHA 2A07F 1LQ1A 5D6FA 1Q1HA 2M45A 2P5VA 1S7OA 5AIQA 1FYMA 4LG0A 3O3KA 3DP7A 2ZKZA 3NQOA 3GXOA 4PDKA 2V1XA 1I27A 2ZMEA 4FT8A 1G3TA 3ML6A 4KIBA 3J81Z 1KA8A 4EJOA 3T8RA 2V79A 1IN6A 1U6GA 2HOEA 3HOTA 1WWXA 4U7BA 5ILUA 2DT5A 3TO6A 3K9TA 4IPAA 5AONA 2F5EA 3I59A 4I01A 2W84A 4KA4A 5E18F 2KKOA 1MDMB 3ELKA 5LGNA 4HQMA 2VN2A 5TJJA 1FPQA 1U5TA 2PEXA 1USSA 2XKOA 1W7PB 3R6SA 3QAHA 4DNCA 2YX4A 3LAPA 5FFXA 2IJLA 2RGVA 3HRMA 3ZP5A 2O3FA 3GF2A 5JI6A 3WU1B 4KUMA 2VBXA 3WG9A 3RPUA 3HTSB 4RGSA 4Q4ZF 2MLKA 4GXOA 5HLHA 1LDKB 2E7WA 1B6AA 1FY7A 4WF2A 1AWCA 1IN7A 1BI2A 4UXNA 3I4PA 4OMYA 3F6OA 3VFZA 5D8KB 1IUYA 4HX4A 1QQIA 4YG2F 1ON1A 4M74A 1XDUA 4R8HA 4BYYA 1R36A 2G9WA 3DEUA 5ICCA 1BM9A 2K27A 3GFIA 2H27A 4AVPA 2FNAA 1EH6A 2HR3A 2CYYA 3KP7A 4HLXA 4A0ZA 3COAC 5BPDA 2Q8KA 3GZ5A 2XV4S 1S8NA 2EA2A 2X4HA 4HF1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U1D A;  3L7W A;  2NAZ A;  2Q2E A;  1O7L A;  3TQN A;  2ZJ2 A;  1Z6R A;  2R7F A;  2EFP A;  1OYW A;  2RKH A;  4I7H A;  1H9T A;  1U2W A;  3HRT A;  4QWQ A;  5E8G A;  3F23 A;  1BI0 A;  3WGH A;  3FXR A;  3ZMS A;  1GHC A;  4HF2 A;  2LSO A;  1KYW A;  4G7O F;  3HSE A;  2DAO A;  1BI1 A;  2VOO A;  1SD4 A;  3BP8 A;  4IHT A;  2L3D A;  2PMU A;  3WTS C;  1O57 A;  2XVC A;  3I5U A;  4ENJ A;  4MEY F;  4MHG A;  1TTY A;  4RB0 A;  1FBS A;  3V7S A;  2P5L C;  4RB2 C;  2L54 A;  1K78 A;  1BC7 C;  3ERE D;  2QQB A;  2CG4 A;  4CXF A;  4AIJ A;  1R7J A;  3LA7 A;  1XGS A;  3TO9 A;  1FNN A;  1GXQ A;  5DD4 A;  4UHT A;  3JSO A;  1WSU A;  2DQL A;  1JHH A;  3KEQ A;  2FE3 A;  2C6Y A;  5LHH A;  4OIO F;  1Z9C A;  3W6J B;  1QGP A;  3RYP A;  2ZO4 A;  2UZK A;  3F8F A;  1LEA A;  2UWM A;  5HOO A;  2PBI A;  1G4D A;  3I53 A;  4ZZL A;  5ILV A;  1UFM A;  4M9S A;  1VTN C;  3Q5F A;  1SFX A;  2GXB A;  2MBF A;  2ZNZ A;  2P5K A;  2XRN A;  2D1V A;  2IA0 A;  1FYK A;  4BHC A;  4WX9 A;  1XSV A;  2HYG D;  2W85 A;  4IRG A;  3C18 A;  2VOP A;  4I2O A;  4N9H A;  1KU7 A;  4ESF A;  3GUD A;  2EV0 A;  2FBK A;  5LEJ A;  3HOS A;  5E1X A;  1D5V A;  2GWR A;  5K5Q A;  4NQW A;  1W7P D;  2ZXJ A;  3WOD F;  3CLO A;  3I0T A;  2QWW A;  2IRF G;  5KVR A;  4ETS A;  4UV9 A;  4AWX B;  3CDH A;  3PFI A;  4ESB A;  4I09 A;  1UHM A;  3HRS A;  4UUV A;  3ZN0 A;  4KYW A;  1ZN2 A;  2V1U A;  3PQJ A;  5E1W A;  4IVN A;  3U9G A;  2YR2 A;  5D5U B;  1ODD A;  1LJ9 A;  3HRU A;  3HSF A;  1D8K A;  1QPM A;  1E17 A;  5LGT A;  3ROU A;  1R00 A;  3WU0 A;  2A69 F;  2QLZ A;  4N9I A;  3K1N A;  2A68 F;  3K1P A;  3MZY A;  4HZF A;  1B1B A;  5CVI A;  2QUF A;  4L9N A;  3TO7 A;  2PN6 A;  1RUN A;  4EVI A;  1ZLK A;  1R5H A;  2JT1 A;  4ENM A;  2RC4 A;  2JTV A;  2A5Y B;  2M87 A;  2HKO A;  4XRF A;  2DLL A;  3HIF A;  1YQA A;  4YII A;  2XHK A;  1SMT A;  3KET A;  3O6B B;  4OIQ F;  5H6Q A;  2PFB A;  4ON0 A;  2IP2 A;  1R58 A;  4HV6 A;  3ISP A;  3RIR A;  3F3X A;  4FX4 A;  5E17 F;  2UXN A;  1EH7 A;  1FSE A;  1A04 A;  1CF7 B;  3PQK A;  3C3W A;  3BPV A;  5JR3 A;  1PP8 F;  4HX8 A;  5ERI A;  4EMS A;  5ICE A;  4LMY A;  1O7F A;  4I98 B;  2DTR A;  4WWC A;  2VBW A;  3R0A A;  4WXH A;  3H3Z A;  1XSD A;  1IRF A;  4Y15 A;  2KRF A;  3BZ6 A;  3EYY A;  2A61 A;  2LDU A;  4LLN A;  4ASN A;  3FWE A;  1YO5 C;  1BOA A;  3F6V A;  1O3Q A;  3RKW A;  2M30 A;  1T2K A;  3FZV A;  5HDG A;  2EJR A;  1L3L A;  3DQV C;  4UNO A;  3KP3 A;  3WE3 A;  3VOD A;  5HDN A;  1YYV A;  4R79 A;  5BPI A;  1J7K A;  2MH2 A;  2YX7 A;  1FSH A;  2GXG A;  5FB2 A;  1K79 A;  3B02 A;  2HQN A;  1HSJ A;  1TQM A;  1WI9 A;  4L9V A;  3V8J A;  2Q0O A;  3DPT A;  3F8M A;  3TDU C;  4O3M A;  3NRV A;  1Z7U A;  5A2Q Z;  3R4K A;  1XGN A;  1IXC A;  3E5U A;  3BDD A;  3BOQ A;  2ETH A;  2L02 A;  2QVO A;  2YU3 A;  4LLL A;  4AIK A;  3ZN1 A;  3V7R A;  2XIG A;  3LA3 A;  5DUI A;  4GYI A;  3EYI A;  2TDX A;  4WXC A;  5HS9 A;  1KQ9 A;  1C0W A;  1F5T A;  2PLY A;  2XAG A;  3EUH A;  5DV5 A;  2HGC A;  1KQ0 A;  2QQ9 A;  3CUO A;  3RKY A;  4LGW A;  1XGO A;  2IA1 A;  1I5Z A;  2RDP A;  2YPR A;  3KP6 A;  2KIM A;  4CHU A;  1IN8 A;  4HV5 A;  4M9Z A;  3JTG A;  3FF5 A;  2JZY A;  2HYF A;  3E5Q A;  1R1T A;  3MCZ A;  3C7J A;  4A0Y A;  3ABT A;  4U0V A;  1STZ A;  4P55 A;  3JW4 A;  4B09 A;  2M8E A;  5D4R A;  1U8R A;  5BS6 A;  1JGS A;  5IT9 K;  2VT2 A;  4Q48 A;  5F64 A;  3KP4 A;  1ZRE A;  4KMF A;  1B9M A;  1BN5 A;  3P9C A;  4ENN A;  3KE2 A;  4EGZ A;  1QBJ A;  3L09 A;  1BC8 C;  2K4J A;  4XLP F;  1AOY A;  1FZP B;  4HF0 A;  3FMR A;  3BRO A;  4LG0 B;  1XGM A;  3GZ6 A;  3MQ0 A;  4AD9 A;  2ZBK A;  4HBL A;  1MJ9 A;  5CYV A;  4UVA A;  3WGG A;  2ZME B;  1FOK A;  2P7V B;  5AIP A;  3KLN A;  4CO8 A;  2VON A;  2ISY A;  3IRQ A;  5IT9 Z;  5E20 A;  2R7D A;  5CJ9 A;  1O3T A;  5LLQ A;  4QLC U;  5EEG A;  1O3R A;  2LF8 A;  2MLG A;  2OZ6 A;  4PGH A;  4PCQ A;  4WXD A;  4EM0 B;  1LVA A;  2XAF A;  2ISZ A;  4KT5 C;  3VB2 A;  4KNY A;  5D5V B;  3SXY A;  3I59 B;  1GVJ A;  2W24 A;  4G9Y A;  2EFN A;  4R1H A;  2H6B A;  3GYH X;  2GQQ A;  5IT3 A;  4BH9 A;  3V4G A;  1U5T B;  2KJC A;  4WCG A;  4JK1 X;  3JAM Z;  2MD5 A;  2HFH A;  3RJP A;  3F22 A;  1T98 A;  1J75 A;  4M71 A;  2LF7 A;  3CO6 C;  1YIO A;  4EM2 A;  2A3S A;  3ZMD A;  1IN4 A;  1HQC A;  1WRJ A;  3QPT A;  4XSZ F;  3P7N A;  4ZYE A;  3KZZ A;  1RNL A;  3MFK A;  4YIF A;  3F8B A;  4HLY A;  3QP5 A;  4U7D A;  4CDG A;  3RKX A;  2L4M A;  2BEO A;  1FYL A;  5L3D A;  3QRF F;  3LFK A;  2VC0 A;  3V8L A;  3RYR A;  4F7Z A;  3JSP A;  3ZPL A;  2MC3 A;  4EJV A;  1LDD A;  2EV5 A;  1SD7 A;  2O03 A;  1SFE A;  3KZY A;  1W5S A;  2ZCW A;  1Z91 A;  1KGS A;  5ICF A;  1V3F A;  4O5V A;  4EV0 A;  2EV6 A;  5J6X A;  4EM1 A;  2W57 A;  1SD5 A;  3H3U A;  4A2U A;  4BHB A;  3RDI A;  1TW3 A;  1FBQ A;  1S6L A;  2VBY A;  3MZH A;  4XSX F;  3E6M A;  4OIN F;  2QQA A;  1ZHF A;  5D5W B;  4CGZ A;  2DK8 A;  4L5I A;  5BMZ A;  4G7H F;  1T38 A;  2JRT A;  3V7C A;  1UHW A;  3IL2 A;  4CIC A;  2ELH A;  4UVC A;  3C1D A;  4K2E A;  5DCM A;  1OKR A;  3T8T A;  3LAJ A;  3BY6 A;  6PAX A;  3N4M A;  1IF1 A;  5FD6 A;  3CUQ C;  4KN4 X;  4P96 A;  2NRA C;  1QZY A;  2ESH A;  1SAX A;  2DK5 A;  2RV8 A;  4BXU A;  3F21 A;  3ZMZ A;  4ZH4 F;  1P6R A;  3DXJ F;  5CVU A;  1B9N A;  3HSR A;  1K78 B;  4G8X A;  4LLG F;  5J8C A;  2BV6 A;  2FOK A;  1IW7 F;  3K0L A;  1DDN A;  2GA1 A;  4LB5 A;  1SD6 A;  1RI7 A;  2O6G E;  3E97 A;  3CJN A;  2RNJ A;  4IRH A;  4RAZ A;  3FM5 A;  3DV8 A;  1S7A A;  3F8C A;  4S04 A;  2FMY A;  2NNN A;  3KP5 A;  2WC2 A;  4HW0 A;  3TKY A;  2IA2 A;  5HLG A;  3WGI A;  2FBH A;  4AIH A;  3M1E A;  1IXS B;  3ABU A;  2XRO A;  4ENK A;  4B8X A;  2HWV A;  4BHP A;  4ZYG A;  2LNB A;  2QYO A;  2DW4 A;  4UVB A;  1YW9 A;  2F5D A;  3IRR A;  2E7X A;  1FWZ A;  4YFX F;  2P8T A;  4L0Y B;  3WTW C;  4U0Y A;  5J8F A;  1R23 A;  4L0Z B;  4YFN F;  2QBY A;  2COM A;  1DPU A;  2FQ3 A;  3FXQ A;  1I1G A;  1KQ8 A;  3G3Z A;  5LRR A;  2CQK A;  2OBP A;  1H0M A;  2NYX A;  1TNT A;  4OIP F;  1LNW A;  2MA3 A;  2K86 A;  4G94 A;  1QNT A;  1TQP A;  4Q47 A;  2XAS A;  1BBY A;  3ZMU A;  4RGU A;  2A6E F;  4MQ9 F;  2XAH A;  3WTZ A;  3EQL F;  2WV0 A;  2HKX A;  3M8E A;  2QZ8 A;  1MJA A;  1YS6 A;  1ZAR A;  4NHJ A;  3DF8 A;  1UB9 A;  4FX0 A;  2XUB A;  4MGR A;  3TGN A;  3FM3 A;  1IXR C;  2OZU A;  1EH8 A;  4L5J A;  2PMH A;  1FC3 A;  4IF4 A;  1G3Y A;  3I54 A;  3E6D A;  2DBB A;  2PG4 A;  5HDK A;  2FRH A;  3BWG A;  2OA4 A;  1LDJ A;  4OOI A;  3VOE A;  1F9N A;  2GZW A;  2Z9O A;  3FX3 A;  4S05 A;  5F1R A;  1R1U A;  3WTY C;  5K1Y A;  2H09 A;  1UCR A;  2FEZ A;  2ZFW A;  1J2X A;  2XGX A;  1IZ1 A;  3GW2 A;  4P9U A;  3GEZ A;  1V4R A;  3WE2 A;  4ZYD A;  5A2Q K;  1RIO H;  3LQR A;  2IPQ X;  5CVJ A;  2JSC A;  2J5O A;  2IVM A;  5HLI A;  2G7H A;  3F72 A;  3B73 A;  1IN5 A;  1IRG A;  3IKT A;  1E2X A;  2HS5 A;  2KJB A;  3CUQ A;  4OMZ A;  1OPC A;  1O3S A;  3OV8 A;  3EET A;  4KIC A;  4A12 A;  2P7C B;  1Z1D A;  2QEN A;  5FFZ A;  2DFI A;  1MGT A;  1XMK A;  2RQP A;  2WTE A;  2ADU A;  2D45 A;  4ESJ A;  2V1D A;  2X0L A;  4I0B A;  5H6R A;  2R3S A;  2CGP A;  1ZYR F;  1J5Y A;  3AAF A;  1IAW A;  3BPX A;  3REO A;  2O0Y A;  5L3C A;  3T0Y A;  2M1B A;  2OQR A;  1D3Y A;  5K5R A;  3LWF A;  4EJW A;  1BJA A;  3RPQ A;  1MKM A;  5E8I A;  4FHT A;  4YFK F;  3E6B A;  3BJO A;  2VBZ A;  3SQN A;  5FLX K;  4LK1 F;  1TW2 A;  2H6C A;  3KCC A;  2IW5 A;  4RB1 A;  3SZT A;  4O6J A;  3FXU A;  2OAZ A;  4M72 A;  2P6S A;  3IWF A;  4EGY A;  1R5G A;  5F6F A;  1DP7 P;  1Z6T A;  4EJT A;  3K69 A;  2FSW A;  1ZRC A;  5E1Z B;  4KMU X;  2H94 A;  2XAJ A;  4L18 B;  4PZJ A;  4IRI A;  4KN7 X;  4A6E A;  3WTX C;  4ZYH A;  3KEO A;  5ED4 A;  1K7A A;  4G7Z F;  1KU9 A;  4RS8 A;  2GA2 A;  5FD5 A;  3Q9S A;  1MDM A;  3L2C A;  5FLX Z;  3DFG A;  4P5O A;  2PI0 A;  1REP C;  1F4K A;  3E5X A;  4BNC A;  2HDC A;  2DU9 A;  1U78 A;  2VOD A;  3OOP A;  4GO1 A;  5LHI A;  1WKM A;  3R61 A;  1W7P A;  4G6Q A;  1BIB A;  1HKQ A;  3QP6 A;  5TRD A;  3FHZ A;  5LRS A;  5LEK A;  1TNS A;  3TDZ C;  1DUX C;  2F5F A;  2GIV A;  1TQI A;  4XBF A;  2FXA A;  3IHU A;  5ILS A;  3ULQ B;  1HBX G;  2F5C A;  4A5N A;  2JPC A;  1G3W A;  2HQR A;  1XSX A;  4LD5 A;  1OYI A;  2EK5 A;  1FBU A;  1FX7 A;  2HTJ A;  2EA4 A;  1PP7 U;  2BE5 F;  2W25 A;  3JAM K;  2V9V A;  2PQ8 A;  2CSO A;  3K1M A;  1P4A A;  1YW7 A;  4A0X A;  1I6X A;  3TOB A;  1ZG1 A;  4BQA A;  4UV8 A;  2IT0 A;  3SFZ A;  5L3B A;  1HW2 A;  1ULY A;  4EQQ A;  1ONV A;  3U2R A;  5DDG A;  4Y13 A;  4I02 A;  2V6C A;  2EFW A;  1S3J A;  3D0S A;  2VE9 A;  2Y0M A;  5HS7 A;  3QPH A;  2O8X A;  2E1C A;  2XAQ A;  1BIA A;  2EB7 A;  1T39 A;  2RN7 A;  1ZGA A;  4NB5 A;  3FMQ A;  1FP1 D;  4KIF A;  5KK1 A;  1RZ4 A;  5ICG A;  2STW A;  4L9T A;  4RGX A;  2AS5 F;  3SZP A;  2CO5 A;  5JVT A;  4CYD A;  1YLF A;  4ZZD A;  5JHU A;  5CLS A;  1OYY A;  3GLX A;  2FML A;  3EDP A;  1HW5 A;  1QZZ A;  4MNU A;  5CVR A;  2B0L A;  3LA2 A;  3ZQ7 A;  2J5P A;  5DYM A;  2Y75 A;  3KP2 A;  1KU2 A;  5L3F A;  3QOP A;  2OD5 A;  5FGM A;  3GFJ A;  2JPB A;  4JBA A;  4IXA A;  2QM3 A;  1ON2 A;  1DPR A;  2KIU A;  1J0R A;  1YG2 A;  1JE8 A;  3FMS A;  2Z3Y A;  1HST A;  5CVV A;  1J59 A;  4JQF A;  4OIR F;  1PDN C;  1F1Z A;  3CTA A;  4RGR A;  1LEB A;  1ZAO A;  4MEX F;  1XDS A;  4RAY A;  4Y17 A;  4H0E A;  2STT A;  4M73 A;  3QU3 A;  3IWZ A;  5BOX A;  3GFM A;  4KFC A;  2PJP A;  4I0A A;  1T0F A;  2M5W A;  3SHF A;  4MQV A;  4KIG A;  1XD7 A;  1FP2 A;  3ZMT A;  1ZG3 A;  1P2F A;  4LJZ F;  4M6X A;  3KLO A;  3I58 A;  2Y48 A;  4WK8 F;  2HZT A;  4U0W A;  2DQR A;  2LKP A;  3BJ6 A;  1X3U A;  5LHG A;  3MAJ A;  3S2W A;  2G7U A;  1I1S A;  3MWM A;  1EV7 A;  5DD8 A;  4M6Y A;  5DEQ A;  1YS7 A;  3M8F A;  1ZG5 A;  3P9K A;  4GGG A;  4LFU A;  2CFX A;  2O61 A;  2FNP A;  1D8J A;  2FBI A;  2VC1 A;  4IJA A;  1R22 A;  3P9I A;  5LBQ A;  1CGP A;  1WQ2 A;  3T5X A;  1OR7 A;  3Q9V A;  4Z2Y A;  2FA5 A;  5DCM B;  1XN7 A;  4Q5S F;  4HYE A;  2D1H A;  4HDV A;  3R60 A;  2OU2 A;  3M7G A;  4EJU A;  4HQE A;  1B59 A;  2VT3 A;  2EFQ A;  3JTH A;  2WWY A;  3GWZ A;  3HUG A;  1XB4 A;  1ZRF A;  2D2W A;  2EWN A;  2Z33 A;  4CZZ A;  3LQQ A;  1W4M A;  2K7L A;  2DPD A;  4HAM A;  3VEP A;  3HYI A;  3KFW X;  4HDU A;  1K6O A;  1PUE E;  4G6D A;  2BYV E;  5BQT A;  3N97 A;  2NNY A;  3L00 A;  3K2Z A;  2HEO A;  4M9X A;  3IC7 A;  4LK0 F;  2NS0 A;  2CWE A;  4A6D A;  1QO0 D;  3GVA A;  5FO5 A;  2DI3 A;  1R1V A;  1MZB A;  1ZRD A;  2ACJ A;  3I71 A;  5D6E A;  3V8K A;  3R0J A;  1SMY F;  4GYG A;  1CF7 A;  1HXD A;  3H92 A;  2Z99 A;  1H9G A;  2FU4 A;  1FLI A;  1W5T A;  1HKT A;  2VE8 A;  5D4S A;  1MD0 A;  1HW1 A;  3ZMV A;  3GX4 X;  4GCV A;  2F2E A;  1T6S A;  1P4X A;  1FT9 A;  3J80 K;  2QBY B;  3I64 A;  3MEX A;  3WTU C;  2RVC A;  4HOB A;  5D5X B;  3E3V A;  4OU0 A;  1TLH B;  1YFH A;  2E1N A;  1XCV A;  2KIF A;  1SFU A;  3J7A O;  1LB2 A;  3WTT C;  2A6H F;  5L3G A;  1JHF A;  1GXP A;  1ZH5 A;  3RTR A;  1U5T C;  1KYZ A;  3LST A;  1KU3 A;  1HKS A;  3ECO A;  1P4W A;  2XKP A;  3HHH A;  1G3S A;  2P4W A;  4N0B A;  2VXZ A;  3BJA A;  3HHG A;  1RUO A;  1UST A;  4HA8 A;  5K5O A;  1P92 A;  3J80 Z;  1G6N A;  2K4B A;  1B4A A;  3E6C C;  2P6T A;  4IHS A;  5HVQ C;  4E70 A;  2DO7 A;  2ESN A;  2L01 A;  1NHA A;  1ZGJ A;  3M9A A;  4U88 A;  1S29 A;  2FF4 A;  4A5M A;  5DCF A;  5DUK A;  1JXS A;  2DPU A;  2OQG A;  1Y0U A;  2BGC A;  3QU6 A;  5LGU A;  4MTE A;  2CW0 F;  2Z5U A;  4D0P A;  1J9I A;  1YTY A;  1OMI A;  4BAY A;  3GFL A;  3G73 A;  2HTS A;  3NEU A;  3IKV A;  1ZLJ A;  2YSR A;  4HX7 A;  4KDP A;  1Z05 A;  3DPL C;  4XLN F;  2EFO A;  1MJB A;  4DQ2 A;  5HS8 A;  3CUQ B;  5L3E A;  3RI4 A;  3HTU A;  4LB6 B;  1XCB A;  3T1B A;  2UXX A;  3DKW A;  3GO5 A;  2ZNY A;  1YW8 A;  3D5L A;  2MH9 A;  3J81 K;  1U3E M;  4P9F A;  4RB3 C;  3WTV C;  5JFR A;  3CO7 C;  3L9F A;  1BI3 A;  3ECH A;  2BBY A;  3W6K B;  4MTD A;  2AXL A;  2K02 A;  3O2P E;  1TBX A;  2GAU A;  4TV7 A;  4PGG A;  5D8L B;  3TOA A;  4L9J A;  2L4A A;  5H20 A;  3F8N A;  1XMA A;  1L0O C;  5EEH A;  2A07 F;  1LQ1 A;  5D6F A;  1Q1H A;  2M45 A;  2P5V A;  1S7O A;  5AIQ A;  1FYM A;  4LG0 A;  3O3K A;  3DP7 A;  2ZKZ A;  3NQO A;  3GXO A;  4PDK A;  2V1X A;  1I27 A;  2ZME A;  4FT8 A;  1G3T A;  3ML6 A;  4KIB A;  3J81 Z;  1KA8 A;  4EJO A;  3T8R A;  2V79 A;  1IN6 A;  1U6G A;  2HOE A;  3HOT A;  1WWX A;  4U7B A;  5ILU A;  2DT5 A;  3TO6 A;  3K9T A;  4IPA A;  5AON A;  2F5E A;  3I59 A;  4I01 A;  2W84 A;  4KA4 A;  5E18 F;  2KKO A;  1MDM B;  3ELK A;  5LGN A;  4HQM A;  2VN2 A;  5TJJ A;  1FPQ A;  1U5T A;  2PEX A;  1USS A;  2XKO A;  1W7P B;  3R6S A;  3QAH A;  4DNC A;  2YX4 A;  3LAP A;  5FFX A;  2IJL A;  2RGV A;  3HRM A;  3ZP5 A;  2O3F A;  3GF2 A;  5JI6 A;  3WU1 B;  4KUM A;  2VBX A;  3WG9 A;  3RPU A;  3HTS B;  4RGS A;  4Q4Z F;  2MLK A;  4GXO A;  5HLH A;  1LDK B;  2E7W A;  1B6A A;  1FY7 A;  4WF2 A;  1AWC A;  1IN7 A;  1BI2 A;  4UXN A;  3I4P A;  4OMY A;  3F6O A;  3VFZ A;  5D8K B;  1IUY A;  4HX4 A;  1QQI A;  4YG2 F;  1ON1 A;  4M74 A;  1XDU A;  4R8H A;  4BYY A;  1R36 A;  2G9W A;  3DEU A;  5ICC A;  1BM9 A;  2K27 A;  3GFI A;  2H27 A;  4AVP A;  2FNA A;  1EH6 A;  2HR3 A;  2CYY A;  3KP7 A;  4HLX A;  4A0Z A;  3COA C;  5BPD A;  2Q8K A;  3GZ5 A;  2XV4 S;  1S8N A;  2EA2 A;  2X4H A;  4HF1 A; 
#chains in the Genus database with same CATH topology
 4II2 A;  5GPA A;  2E2I J;  3GTJ J;  4DZP A;  1NTC A;  3U1D A;  3L7W A;  2NAZ A;  2ICW G;  2Q2E A;  3AKZ A;  1WPK A;  1O7L A;  5IY5 H;  3TQN A;  1X4O A;  2ZJ2 A;  1Z6R A;  2R7F A;  2EFP A;  2H8W A;  1VQ6 I;  1OYW A;  1UAA A;  1V5E A;  5K7Z A;  3BT9 A;  2RKH A;  1S5L C;  3FHN A;  4I7H A;  3PM1 A;  1H9T A;  1U2W A;  3HRT A;  4QWQ A;  2XRL A;  5E8G A;  5F04 A;  3F23 A;  1SAU A;  1BI0 A;  3WGH A;  3FXR A;  3ZMS A;  1WJB A;  2AHQ A;  3G71 I;  1GHC A;  1X2N A;  2X51 A;  4HF2 A;  1K83 J;  2LSO A;  1KYW A;  5FJ8 J;  3G1O A;  3OOU A;  4A69 C;  1B8I B;  2P0W A;  4G7O F;  3ABL H;  3HSE A;  1PVE A;  2DAO A;  3VDX A;  1K4T A;  1VQ7 I;  2XPV A;  1BI1 A;  1I3Q J;  2AXT C;  3LFU A;  2LKS A;  1HC8 A;  2VOO A;  1SD4 A;  3GTM J;  5F0C A;  3BP8 A;  4IHT A;  4BJ5 C;  3L2U A;  2L3D A;  3HZJ A;  2PMU A;  3WTS C;  1WVR A;  1YE9 A;  1O57 A;  2XVC A;  3I5U A;  3OYC A;  2XC7 A;  4ENJ A;  4MEY F;  4MHG A;  2IS6 A;  2HQA A;  1E3H A;  3PNV A;  1TTY A;  2E2H J;  1DGW Y;  4RB0 A;  4IOA F;  1FBS A;  2R5Z B;  2IGM A;  3GME A;  2H1K A;  3V7S A;  5TGT A;  4B43 A;  4A3L J;  4DJA A;  9ANT A;  3AL0 C;  5K7H A;  2P5L C;  4RB2 C;  2L54 A;  1K78 A;  3S8P A;  2IS2 A;  1BC7 C;  1AHD P;  1I3A A;  4IHX A;  3ERE D;  3OYI A;  2QQB A;  3U1K A;  2LFB A;  3C2H A;  3HOZ J;  4C2U A;  2CG4 A;  4CXF A;  4AIJ A;  1P7I A;  1I6H J;  1R7J A;  3LA7 A;  1XGS A;  3TO9 A;  5IP9 J;  1FNN A;  1GXQ A;  5DD4 A;  3LSK A;  4UHT A;  1YJW I;  3JRG A;  3JSO A;  3OIP A;  2VJJ A;  1OLT A;  1WSU A;  4BDZ A;  1JHH A;  2DQL A;  4UB8 C;  3KEQ A;  3LOC A;  4A3K J;  2FE3 A;  2C6Y A;  2HOS A;  5LHH A;  4OIO F;  1Z9C A;  2MGQ A;  1WJE A;  3W6J B;  1HA8 A;  2RAE A;  2M0M A;  1QGP A;  2L9R A;  3RYP A;  2X1C A;  2ZO4 A;  4ZC3 A;  1YIJ I;  2UZK A;  3F8F A;  1LEA A;  1ENH A;  5IPA A;  1UMQ A;  2DMN A;  2UWM A;  4JX5 A;  1XS9 A;  5HOO A;  4M3G A;  1MSF C;  3BTI A;  1WHU A;  2PBI A;  1G4D A;  3S16 J;  2VI6 A;  3I53 A;  3TED A;  1HF0 A;  2R7W A;  4ZZL A;  5ILV A;  4IQ4 A;  1UFM A;  2FOW A;  2BXZ A;  2VQG A;  2KDZ A;  4M9S A;  2CQN A;  1VTN C;  1BW6 A;  2JK3 A;  3Q5F A;  1SFX A;  4XRM A;  2GXB A;  3BCA A;  1XX5 A;  2HDD A;  2MBF A;  2ZNZ A;  2P5K A;  3QYB A;  4CCK A;  5EEA A;  1MNE A;  2XRN A;  1FTT A;  4PJL A;  2D1V A;  1ZR2 A;  3LSI A;  1H88 C;  4IKF A;  2IA0 A;  2IXS A;  2ZB9 A;  3W2V A;  4V2G A;  1FYK A;  4BHC A;  4WX9 A;  1XSV A;  5FKL A;  2E1O A;  2HYG D;  2Y2Z A;  2W85 A;  4IRG A;  3FXM A;  3C18 A;  2VOP A;  4I2O A;  4IOC F;  2FJ1 A;  4N9H A;  1KU7 A;  2ZXI A;  4ESF A;  3Q0W A;  3GUD A;  2EV0 A;  2FBK A;  5LEJ A;  3I9V 2;  5E1X A;  3HOS A;  4BAC A;  2CV2 A;  3S32 A;  1J09 A;  1D5V A;  2GWR A;  3H9J A;  3RCO A;  5K5Q A;  4NQW A;  1W7P D;  2PJR B;  2ZXJ A;  3WOD F;  4XLC A;  5EDN A;  3CLO A;  3I0T A;  2QWW A;  3C2G A;  3CP8 A;  4XRS A;  2IRF G;  5KVR A;  1ETV A;  1LE8 B;  4ETS A;  4UV9 A;  4I76 A;  5EZG A;  2NVT J;  4AWX B;  3CDH A;  4E7S A;  3PFI A;  4ESB A;  4I09 A;  1ETO A;  3OYG A;  1ZGW A;  1UHM A;  3HRS A;  4UUV A;  3ZN0 A;  3J7Z I;  4KYW A;  1G2H A;  1ZN2 A;  2V1U A;  3EUH C;  3PQJ A;  4XOP A;  5E1W A;  4IVN A;  3U9G A;  2LMD A;  2YR2 A;  5D5U B;  1ODD A;  1Z67 A;  1LJ9 A;  3HRU A;  3JRA A;  2HOA A;  2LD5 A;  2VKV A;  1FOY A;  1MMS A;  3HSF A;  1NK2 P;  1D8K A;  1RRJ A;  3ESW B;  3MN2 A;  4BQQ A;  1MMN A;  1QPM A;  1V5F A;  1QU3 A;  4XLA A;  4PJN A;  4II3 A;  1E17 A;  3L2Q A;  3BTJ A;  5LGT A;  3GTQ J;  3HDD A;  3ROU A;  1R00 A;  2R5Y B;  3WU0 A;  3DBL B;  2A69 F;  4A3G J;  3KEY A;  2QLZ A;  4N9I A;  3K1N A;  2A68 F;  3HUG B;  2R7Z J;  3K4N A;  4AU7 A;  1PYV A;  1OIS A;  3K1P A;  3MZY A;  4HZF A;  4KIS A;  2XSD C;  5J1Y A;  1B1B A;  1D1B A;  3CCV I;  5CVI A;  2QUF A;  4M6V A;  3O8G A;  4I6Z A;  4L9N A;  1Z77 A;  3K70 C;  5IOZ A;  3TO7 A;  1NH3 A;  2PN6 A;  1RUN A;  4EVI A;  1ZLK A;  1R5H A;  2JT1 A;  5F27 A;  4LOC A;  4ENM A;  2DA3 A;  2DYR H;  3CCE I;  5HOD A;  2RC4 A;  4NC6 A;  3BG7 A;  2JTV A;  2LRD A;  2A5Y B;  4QTR A;  5LFA A;  2KRH A;  2M87 A;  2UUZ A;  2HKO A;  4S0H B;  3QPS A;  4XRF A;  2DLL A;  3HIF A;  1YQA A;  1Y1W J;  4YII A;  2XHK A;  2V6E A;  1SMT A;  4XN3 A;  3JRD A;  2WAE A;  3KET A;  3O6B B;  4OIQ F;  3OR1 C;  2V4J C;  5H6Q A;  1R4M B;  2PFB A;  4ON0 A;  2IP2 A;  4X6A J;  1R58 A;  4HV6 A;  3OS2 A;  3WHB A;  3ISP A;  2NS8 A;  5E3M A;  5IYC J;  3RIR A;  2W4S A;  2X9D A;  4PJJ A;  3F3X A;  4FX4 A;  1WH5 A;  5E17 F;  2UXN A;  1EH7 A;  1X4P A;  3Q0V A;  1FSE A;  5C4J J;  2LBF B;  1A04 A;  3DTK A;  1A36 A;  1QHG A;  1CF7 B;  1VQK I;  3M8J A;  1V5G A;  3P5J A;  3PQK A;  4F52 A;  3C3W A;  4M3B A;  2E71 A;  3BPV A;  5JR3 A;  1FOW A;  3RZO J;  1PP8 F;  4HX8 A;  5ERI A;  4EMS A;  3HOX J;  2OC6 A;  5ICE A;  5M5X J;  4E7I A;  4LMY A;  1JTX A;  1O7F A;  3HBL A;  2NOJ B;  4I98 B;  2DTR A;  2YUS A;  3A02 A;  3I55 I;  3D5S C;  4CYC A;  4XKC A;  4C30 A;  4WWC A;  4XKV A;  2KLO A;  2VBW A;  3CJR B;  2XGE A;  3R0A A;  4WXH A;  1JKQ C;  1D1C A;  3H3Z A;  1XSD A;  1IRZ A;  4OWR B;  1IRF A;  4Y15 A;  2KRF A;  3BZ6 A;  3EYY A;  2A61 A;  2LDU A;  1NG7 A;  2QKM B;  4LLN A;  4ASN A;  3FWE A;  1YO5 C;  1BOA A;  1KON A;  3H0D A;  3F6V A;  1RC9 A;  1O3Q A;  3RKW A;  4FCY A;  4QSH A;  4B3X A;  2LKX A;  2M30 A;  4X1E A;  1T2K A;  3A01 A;  3FZV A;  5HDG A;  1FOX A;  3QWL A;  3IH4 A;  4NUB A;  2EJR A;  2WBM A;  1L3L A;  3DQV C;  4CCN A;  2O9L A;  1U8B A;  4UNO A;  3KP3 A;  3WE3 A;  3VOD A;  1FMV A;  5HDN A;  1YYV A;  4R79 A;  3HC7 A;  2LK2 A;  5BPI A;  1J7K A;  3GTO J;  1VQL I;  3ABM H;  3RQ4 A;  2MH2 A;  1W36 D;  2YX7 A;  1FSH A;  2E2J J;  1TWG J;  1RES A;  3AL0 B;  1ZTR A;  2GXG A;  4U87 A;  3OYF A;  5FB2 A;  2ZJQ F;  5FKM A;  1K79 A;  2JA5 J;  3N05 A;  3HPH A;  3B02 A;  1TP4 A;  3QYF A;  2HQN A;  2LRE A;  1HSJ A;  1TQM A;  2M7A A;  1IJW C;  1WI9 A;  4L9V A;  3V8J A;  2Q0O A;  3DPT A;  3F8M A;  3TDU C;  2R7S A;  3B6C A;  2Y0S N;  4O3M A;  3NRV A;  1MMG A;  1Z7U A;  4GRI A;  5A2Q Z;  3R4K A;  3ASO H;  1XGN A;  1IXC A;  3OYE A;  3E5U A;  2WB1 A;  2Y30 A;  3BDD A;  3BOQ A;  2ETH A;  2L02 A;  4MO7 A;  4OAY A;  2QVO A;  2YU3 A;  3H36 A;  1JJ8 C;  2XDV A;  4LLL A;  4AIK A;  3LSR A;  3A2K A;  3ZN1 A;  5GAG J;  2PX9 A;  3V7R A;  2VL8 A;  2XIG A;  3LA3 A;  4DBQ A;  3HJE A;  4V2F A;  3BZC A;  5DUI A;  3Q0U A;  4GYI A;  3EYI A;  3ZXS A;  1IV8 A;  2TDX A;  3DLL F;  2M0C A;  4IZZ A;  2R7X A;  4WXC A;  5HS9 A;  4DGW B;  2A05 A;  1KQ9 A;  5F1J A;  1WCM J;  2EIM H;  4B3A A;  1C0W A;  1F5T A;  2PLY A;  3MVP A;  3HG9 A;  1JKO C;  2XAG A;  2RNG A;  2NVQ J;  3EUH A;  4JOM A;  5DV5 A;  4ZDP A;  1MBG A;  1XTA A;  3ZCO A;  2HGC A;  1KQ0 A;  3CLQ A;  4E6K G;  2QQ9 A;  5JHF A;  3CUO A;  1Y39 A;  3TMO A;  4CCM A;  2H1L A;  3RKY A;  4LGW A;  1XGO A;  2IA1 A;  1D1A A;  4NDL A;  2ZSI B;  3QPL A;  1I5Z A;  2RDP A;  1ORK A;  2YPR A;  3KP6 A;  1P7J A;  5JLX A;  2O8K A;  2KIM A;  1H89 C;  4DZJ A;  4CHU A;  1IN8 A;  4HV5 A;  2DJI A;  3H35 A;  4M9Z A;  3JTG A;  3FF5 A;  1PJR A;  2CUF A;  2JZY A;  2HYF A;  3E5Q A;  1R1T A;  3MCZ A;  5IYD J;  4CH7 A;  2GBY A;  2K5C A;  1D0X A;  1R9T J;  3C7J A;  4A0Y A;  3ABT A;  4AC0 A;  2CQ7 A;  1VFC A;  4U0V A;  1STZ A;  4P55 A;  2HPI A;  3CMY A;  2Y9Z A;  3JW4 A;  3BTC A;  4B09 A;  5M5Y J;  2M8E A;  2B63 J;  4BXF A;  4F92 B;  5D4R A;  1U8R A;  3U21 A;  5BS6 A;  1JGS A;  5IT9 K;  2VT2 A;  3LSM A;  3M4O J;  5E79 C;  4Q48 A;  5F64 A;  1DGR M;  2CRG A;  3KP4 A;  1ZRE A;  4KMF A;  2WAQ A;  1B9M A;  1BN5 A;  2K3P A;  2MAB A;  3P9C A;  4ZTJ A;  4ENN A;  2R7U A;  1OQY A;  1IRX A;  1VQ9 I;  3CMA I;  3KE2 A;  4EGZ A;  3A0B C;  1QBJ A;  4BS9 A;  3H5N A;  3L09 A;  2OPT A;  4P1W A;  1BC8 C;  2K4J A;  1UG2 A;  4XLP F;  3DTI A;  1AOY A;  5J1R A;  1R4N B;  1MBF A;  1FZP B;  2K3F A;  2KDO A;  4HF0 A;  2GOM A;  2EZK A;  3FMR A;  3BRO A;  3ZQL A;  2KZG A;  4LG0 B;  1XGM A;  3GZ6 A;  3MQ0 A;  4AD9 A;  2ZBK A;  4HBL A;  3FXJ A;  1MJ9 A;  2DFH A;  5CYV A;  4UVA A;  1X19 A;  3WGG A;  5M5W J;  2ZME B;  1FOK A;  2P7V B;  1TC3 C;  5AIP A;  2R7Q A;  3KLN A;  2HQ5 A;  4CO8 A;  2VON A;  3DKX A;  2ISY A;  1X3Z B;  3IRQ A;  5IT9 Z;  5E20 A;  2R7D A;  4HPQ A;  2IGO A;  5CJ9 A;  1O3T A;  5LLQ A;  2ZXH A;  1FEX A;  4QLC U;  2ELJ A;  5EEG A;  2B7E A;  1O3R A;  1MNM C;  2TRT A;  2LF8 A;  2MLG A;  2OZ6 A;  4PGH A;  3BR0 A;  4PCQ A;  4WXD A;  4EM0 B;  1LVA A;  2XAF A;  2ISZ A;  3M07 A;  4KT5 C;  2OTL I;  3OYM A;  1VQP I;  3VB2 A;  1VZ0 A;  3SDG A;  2LH9 A;  4KNY A;  3V42 A;  5D5V B;  3SXY A;  3I59 B;  1GVJ A;  4GFB A;  3LL7 A;  2W24 A;  2CJJ A;  3OSG A;  1T56 A;  4G9Y A;  3O8H A;  2EFN A;  4R1H A;  3HOU J;  2E1M C;  2H6B A;  1TWA J;  3CCR I;  2DJN A;  3CCM I;  3OYH A;  3GYH X;  3WG7 H;  2I8D A;  2GQQ A;  5IT3 A;  4BH9 A;  3V4G A;  2XF5 A;  4M3F A;  1U5T B;  2KPM A;  1WZ2 A;  3WHC A;  1D0Z A;  1UHS A;  2FUG 2;  2F4O B;  2ECC A;  5KCM A;  4BBR J;  2KJC A;  4WCG A;  4A3J J;  3ZQC A;  4JK1 X;  2OTJ I;  3JAM Z;  2MD5 A;  2HFH A;  2VXD A;  3RJP A;  3F22 A;  1T98 A;  2L5Q A;  1J75 A;  4M71 A;  2LF7 A;  3CO6 C;  2MYS A;  1YIO A;  2EZH A;  4EM2 A;  2A3S A;  3ZMD A;  1IN4 A;  1W0T A;  1HQC A;  1WRJ A;  3QPT A;  4XSZ F;  3P7N A;  1HDP A;  2HVS A;  1SEU A;  3J7Y J;  1A35 A;  2F4M B;  4ZYE A;  3FXO A;  2NVX J;  2X6W A;  3AFH A;  3PFY A;  3HGG A;  5GTH C;  3KZZ A;  2PMZ N;  1PUF B;  5FKN A;  3S3N A;  1RNL A;  2BY0 A;  4CSW A;  4W1U A;  3MFK A;  1XPX A;  2B9S A;  4FE7 A;  4YIF A;  4FTH A;  2EIK H;  2WA0 A;  3F8B A;  5EGO B;  4HLY A;  3QP5 A;  4U7D A;  3WU2 C;  4CDG A;  3RKX A;  2L4M A;  2BEO A;  3SYT A;  1FYL A;  5L3D A;  2JQ7 A;  3QRF F;  2MW8 A;  1TL8 A;  3LFK A;  2VC0 A;  3V8L A;  3CF5 F;  3RYR A;  3CC7 I;  4F7Z A;  3JSP A;  2JUG A;  3ZPL A;  2MC3 A;  4CCL A;  5E3N A;  4EJV A;  1LDD A;  2EV5 A;  4B47 A;  3OIO A;  1SD7 A;  2O03 A;  3M3Y J;  1AKH B;  2L2O A;  1SFE A;  2MD0 A;  3KZY A;  1W5S A;  3HB9 A;  2ZCW A;  1Z91 A;  3AG2 H;  1KGS A;  5ICF A;  1V3F A;  4O5V A;  4EV0 A;  1XC5 A;  2EV6 A;  5J6X A;  3I4M J;  2L9N A;  3GTK J;  3C2B A;  1WJF A;  4EM1 A;  1IUF A;  2W57 A;  1SD5 A;  3H1C A;  3SFI A;  3H3U A;  4A2U A;  4BHB A;  3RDI A;  3RQI A;  3CC2 I;  1TW3 A;  3H3V K;  1FBQ A;  4J19 A;  1N77 A;  2Y9Y A;  2DCE A;  4C3H J;  1S6L A;  3MMY B;  1I50 J;  1QPI A;  2VBY A;  3S3M A;  1ZKG A;  3FK7 A;  3MZH A;  3D1N I;  2Q2E B;  4MFD A;  2XF6 A;  4XSX F;  3E6M A;  4UY8 I;  4OIN F;  2QQA A;  1ZHF A;  5D5W B;  3GTG J;  2R7T A;  3ZQI A;  4M3E A;  2W48 A;  2WY8 Q;  5FRN A;  4CGZ A;  3KYC B;  2OJE D;  1TWH J;  2VPR A;  2DK8 A;  1IDZ A;  4L5I A;  1U9N A;  2DA5 A;  3NWS A;  5BMZ A;  1X58 A;  4HNU A;  4G7H F;  2Y69 H;  3EUA A;  1T38 A;  3DBR B;  2JRT A;  3V7C A;  1UHW A;  3OYK A;  3IL2 A;  4CIC A;  2ELH A;  4UVC A;  1QRY A;  3C1D A;  4K2E A;  5DCM A;  1OKR A;  3T8T A;  3LAJ A;  4MFE A;  4BU2 A;  5JLW A;  3BY6 A;  2VKE A;  3PNT A;  6PAX A;  3N4M A;  1IF1 A;  2L7Z A;  5FD6 A;  1VQ8 I;  2ID6 A;  3CUQ C;  4KN4 X;  1QZE A;  4P96 A;  1MBH A;  1QZY A;  1TWF J;  4F3Q A;  2NRA C;  2QSG X;  5KHD A;  2ESH A;  2EH3 A;  1SAX A;  2DK5 A;  2RV8 A;  3FKJ A;  4BXU A;  3F21 A;  3MD2 A;  3ZMZ A;  4ZH4 F;  1P6R A;  1MW7 A;  2LOO A;  2ME0 A;  4XM3 A;  1YOV B;  4ZJZ A;  3A03 A;  1X1B A;  3DXJ F;  2PMZ A;  5CVU A;  1B9N A;  5B1A H;  3OYJ A;  1Z7L A;  3HSR A;  1K78 B;  2CUZ A;  1ZQ3 P;  4G8X A;  4LLG F;  2QSH X;  5J8C A;  2BV6 A;  2MC4 A;  2FOK A;  1IW7 F;  3FDY A;  2QSF X;  2R4G A;  3K0L A;  4D7N A;  1DDN A;  2GA1 A;  2F6C A;  3KIO A;  5FLM J;  4LB5 A;  4E7H A;  1SD6 A;  1VI0 A;  2ECB A;  2F5V A;  2CW7 A;  3CCS I;  3S93 A;  2DA6 A;  1ETQ A;  1RI7 A;  2O6G E;  3E97 A;  3G1M A;  2X6X A;  3CJN A;  2RNJ A;  4IRH A;  4RAZ A;  3FM5 A;  3DV8 A;  1X1D A;  1A6I A;  1S7A A;  3F8C A;  4S04 A;  4E7J A;  2FMY A;  2NNN A;  3KP5 A;  5F0H A;  2WC2 A;  4HW0 A;  3PO2 J;  3TKY A;  3FIS A;  2IA2 A;  5F0F A;  5HLG A;  3WGI A;  4Y7N J;  2FBH A;  3JRF A;  1T8I A;  1T95 A;  4AIH A;  3M1E A;  1IXS B;  1YI2 I;  3ABU A;  3UR3 C;  4CZC A;  2XRO A;  4ENK A;  4B8X A;  2HWV A;  1DU6 A;  4BHP A;  4ZYG A;  2R0Q C;  2LNB A;  1JUS A;  4IEJ A;  5F08 A;  5GAE J;  2QYO A;  2DW4 A;  4FAS D;  1GLN A;  4RAG A;  3CCU I;  4FET A;  3KPH A;  2QKL B;  2VQH A;  4UVB A;  2QF7 A;  1YW9 A;  2F5D A;  3IRR A;  2E7X A;  1FIP A;  2WAF A;  1FWZ A;  1RKT A;  1WJD A;  3VYS B;  4YFX F;  2L0K A;  4QPQ A;  4XIC A;  3TW6 A;  2P8T A;  4L0Y B;  4XID A;  3WTW C;  4DW6 A;  4U0Y A;  5J8F A;  1R23 A;  4L0Z B;  4YFN F;  5E3L A;  2QBY A;  2DMQ A;  4RMN A;  5HLT A;  3BCB A;  3BQZ A;  2COM A;  1DPU A;  2FQ3 A;  2JN6 A;  3FXQ A;  5E3O A;  1I1G A;  1KQ8 A;  3G3Z A;  2G0E A;  1Y0N A;  5LRR A;  2CQK A;  2OBP A;  1H0M A;  5C3E J;  1WI3 A;  2NYX A;  3HPG A;  2CW8 A;  1TNT A;  2Y31 A;  3MKW B;  4NQW B;  1LNW A;  4OIP F;  2ZSH B;  2YS9 A;  2MA3 A;  2K86 A;  2HXI A;  4G94 A;  1QNT A;  2HZD A;  1DU0 A;  1TQP A;  1LPQ A;  4Q47 A;  2XAS A;  1IO2 A;  2FD5 A;  1BBY A;  2JA2 A;  3ZMU A;  4RGU A;  2A6E F;  4MQ9 F;  2XAH A;  4J00 A;  2K40 A;  3WTZ A;  4J01 A;  3EQL F;  2WV0 A;  2HKX A;  3W2A A;  2DMU A;  2DFF A;  2V9K A;  3RPU D;  3CJT B;  3M8E A;  4BEH A;  2QZ8 A;  4XK4 A;  1MJA A;  1YS6 A;  1ZAR A;  2WB1 N;  2HI3 A;  3ZQQ A;  5CQE A;  4NHJ A;  1OCR H;  1UB9 A;  3DF8 A;  2DYS H;  1BR2 A;  2BW3 A;  3QYE A;  2XUB A;  4FX0 A;  4MGR A;  4Y4R A;  3TGN A;  3FM3 A;  1IXR C;  2OZU A;  1EH8 A;  3K4K A;  2PMH A;  4L5J A;  4E7K A;  4G12 A;  2COB A;  1FC3 A;  1ZEL A;  3I56 I;  3ERM A;  4IF4 A;  4HNT A;  1G3Y A;  3I54 A;  3E6D A;  2DBB A;  2PG4 A;  5HDK A;  4B4C A;  2FRH A;  3BWG A;  2LLK A;  3JRB A;  3CME I;  2OA4 A;  1LDJ A;  1VND A;  4OOI A;  2KHM A;  3VOE A;  1F9N A;  4XMY A;  2M7B A;  3GCM A;  3K7A J;  2GZW A;  2VUM J;  2ZXW H;  2Z9O A;  2ELK A;  3FX3 A;  4S05 A;  5F1R A;  1R1U A;  5FLV A;  1JTY A;  3QOD A;  5K1Y A;  3WTY C;  4PJ0 C;  5EG0 A;  3H5A A;  5J4V A;  2H09 A;  4YRV A;  2JA7 J;  1K4S A;  4XL9 A;  3ABK H;  1UCR A;  2EQR A;  2FEZ A;  2ZFW A;  2EZL A;  1J2X A;  2LC2 A;  4N4O B;  2XGX A;  2M3A A;  2XPW A;  1IZ1 A;  3OYD A;  3GW2 A;  4P9U A;  3H9Q A;  3L1P A;  3GLL A;  4E7L A;  2IGK A;  3GEZ A;  5DM6 F;  1V4R A;  3WE2 A;  4ZYD A;  2MFZ A;  5A2Q K;  2XAU A;  1YHQ I;  1RIO H;  3LQR A;  2IPQ X;  2WAD A;  5CVJ A;  2JSC A;  2J5O A;  2GLO A;  2E19 A;  4PFP A;  2IVM A;  5HLI A;  1KZH A;  2G7H A;  4B1R A;  3SEQ A;  5IP6 A;  3F72 A;  3AG1 H;  3OMY A;  1YIT I;  2DT7 B;  3B73 A;  3HL2 A;  1IDY A;  1IN5 A;  2BHY A;  4XLH A;  1QA6 A;  4X0G A;  1IRG A;  1ERD A;  3IKT A;  1E2X A;  2AQF A;  2HS5 A;  2KJB A;  3BG6 A;  1X3W B;  3CUQ A;  4LG3 A;  4OMZ A;  2CV0 A;  3TP3 A;  2OUM A;  3JCU C;  1OPC A;  2V1N A;  3ZGK A;  3OY9 A;  1O3S A;  1LUJ B;  3OV8 A;  1TWC J;  3EET A;  3PSI A;  3BR3 A;  4KIC A;  4A12 A;  2P7C B;  2TCT A;  1Z1D A;  5B66 C;  1M1E B;  2QEN A;  2XPU A;  2FX0 A;  5FFZ A;  2DFI A;  1MGT A;  3VSK A;  2WAQ N;  1SVL A;  1UZC A;  2WY7 Q;  2XB0 X;  2WV1 A;  1XMK A;  3KZI C;  2YU9 J;  3SEZ A;  2OF7 A;  2RQP A;  2WTE A;  2ADU A;  2D45 A;  4ESJ A;  2UV1 A;  2V1D A;  2X0L A;  3DCF A;  4I0B A;  5H6R A;  2R3S A;  1Y56 A;  2CGP A;  1ZYR F;  2CMP A;  1J5Y A;  3AAF A;  2X85 A;  1IAW A;  1R49 A;  3CQZ J;  3BPX A;  1LKX A;  3REO A;  2O0Y A;  1SVM A;  5L3C A;  2VQL A;  3T0Y A;  4HST A;  4RA2 A;  2M1B A;  2OQR A;  3IP4 B;  1JT0 A;  1B72 B;  1D3Y A;  5K5R A;  4Z6Y A;  2E34 A;  2DA2 A;  1Y1V J;  3LWF A;  4EJW A;  1BJA A;  1ETX A;  3RPQ A;  2EIL H;  1MKM A;  3A01 B;  2VJ4 A;  1YX5 A;  5FKO A;  1WFX A;  5E8I A;  3HGY A;  4FHT A;  5GP9 A;  4YFK F;  2RRE A;  2QQ8 A;  3E6B A;  2VQC A;  2VBZ A;  3BJO A;  3SQN A;  4C2M J;  5FLX K;  1H8A C;  3BQY A;  4LK1 F;  2KZV A;  5BNG A;  3OL4 A;  3PUB A;  1TW2 A;  2H6C A;  3KCC A;  2K9Q A;  4LIV A;  2IW5 A;  4RB1 A;  1X1C A;  4YEJ A;  3SZT A;  4O6J A;  3FXU A;  2OAZ A;  4M72 A;  3VPR A;  2P6S A;  4IL6 C;  3IAM 2;  1V54 H;  3EPZ A;  3IWF A;  4EGY A;  1R5G A;  5F6F A;  1DP7 P;  1Z6T A;  4EJT A;  3K69 A;  2FSW A;  1ZRC A;  5E1Z B;  5KAI C;  1YRN A;  1K6Y A;  4KMU X;  1TT0 A;  5C44 J;  2EZI A;  2H94 A;  3S1M J;  2XAJ A;  3BG9 A;  2JA8 J;  4G6T B;  4L18 B;  4PZJ A;  3CDI A;  3VYR B;  2W1O A;  4IRI A;  1EA3 A;  4KN7 X;  1T08 B;  2VPL A;  4A6E A;  3QOE A;  1WJC A;  4UUS A;  3WTX C;  3ZQF A;  1T0F C;  4QPO A;  4ZYH A;  3KEO A;  5ED4 A;  3AG3 H;  1IV6 A;  1IGN A;  1K7A A;  4G7Z F;  1LFU P;  1KU9 A;  3S14 J;  2I5U A;  4RS8 A;  3FXK A;  2GA2 A;  5FD5 A;  3Q9S A;  4XQF A;  4DYC A;  1MDM A;  1Y8Q B;  3L2C A;  5FLX Z;  3DTE A;  1Q1V A;  2K9S A;  3DFG A;  3G1L A;  4P5O A;  1REP C;  1F4K A;  3TL4 X;  2PI0 A;  4PSX A;  3E5X A;  1AA7 A;  2DDA A;  4BNC A;  2HDC A;  2DU9 A;  1U78 A;  2VOD A;  3OOP A;  2EPF A;  4GO1 A;  2OCE A;  2E60 A;  5LHI A;  1WKM A;  3RZD J;  2DMT A;  3R61 A;  2DXI A;  4A93 J;  1W7P A;  4G6Q A;  2M9H A;  2X1D A;  1BIB A;  1EKE A;  2FQ4 A;  1HKQ A;  1FIA A;  2AO9 A;  3DPU A;  3BC8 A;  1RPW A;  3QP6 A;  4HEA 2;  4E7Z A;  3OYN A;  5TRD A;  1OCC H;  2QGU A;  3NAR A;  3K10 A;  4CCJ A;  3FHZ A;  2DN0 A;  2ME6 A;  4QIW N;  5LRS A;  5LEK A;  1TNS A;  3TDZ C;  1DUX C;  2F5F A;  2GIV A;  4KT6 A;  1TQI A;  4XBF A;  1TT5 B;  2FXA A;  3IHU A;  4D5C A;  5ILS A;  4Y52 J;  3ULQ B;  3X2Q H;  1JKP C;  1HBX G;  1BJZ A;  2JA6 J;  1QVT A;  2F5C A;  4A5N A;  2JPC A;  1G3W A;  1ETW A;  4IHY A;  3ZRG A;  2HQR A;  2E36 A;  3G6E I;  2HXO A;  4PUS A;  3OL3 A;  1XSX A;  4LD5 A;  1HCR A;  1OYI A;  3OS0 A;  1FBU A;  2EK5 A;  1FX7 A;  2HTJ A;  2EA4 A;  4BE0 A;  1PP7 U;  2BE5 F;  3TBI A;  2W25 A;  3JAM K;  2V9V A;  2PQ8 A;  2X6O A;  4YIR X;  2CSO A;  2HVQ A;  3K1M A;  3QQA A;  2L7M P;  3E0J B;  1P4A A;  1YW7 A;  1APL C;  2IGN A;  1SFK A;  4A0X A;  2N8G A;  1S72 I;  4AID A;  1I6X A;  1VF9 A;  3TOB A;  1ZG1 A;  2DOF A;  4BQA A;  1LFB A;  4UV8 A;  2IT0 A;  3SFZ A;  3IH3 A;  5L3B A;  1HW2 A;  1QVU A;  2F4I A;  2X6Y A;  1ULY A;  4EQQ A;  1K61 A;  3BR5 A;  1ONV A;  3U2R A;  5DDG A;  4Y13 A;  4I02 A;  5HNH A;  4DIQ A;  2CU7 A;  2KMU A;  2V6C A;  2EFW A;  2AQE A;  1FTZ A;  2DTZ A;  4DYR A;  1S3J A;  3D0S A;  2VE9 A;  2Y0M A;  1I39 A;  3SZG A;  5HS7 A;  3QPH A;  2O8X A;  2E1C A;  1R6R A;  2CFO A;  2M4K A;  1AU7 A;  1ETK A;  2XAQ A;  4ZDO A;  1BIA A;  2EB7 A;  1T39 A;  2RN7 A;  1BA5 A;  1MBK A;  1ZGA A;  4JX6 A;  1N75 A;  5KAF C;  4NB5 A;  3FMQ A;  1FP1 D;  3L2R A;  3GTP J;  1G59 A;  1N78 A;  4KIF A;  1F43 A;  5KK1 A;  1RZ4 A;  5ICG A;  2ZJP F;  2STW A;  3D5R C;  3LMM A;  1MH3 A;  4L9T A;  4RGX A;  2HOT A;  2AS5 F;  3SZP A;  3S2H J;  2CO5 A;  5JVT A;  1VQN I;  1FJL A;  4CYD A;  1YLF A;  2W82 A;  4ZZD A;  5JHU A;  5CLS A;  2HYJ A;  1B8I A;  1OYY A;  5K7F A;  3GLX A;  2FML A;  2K9M A;  2KIQ A;  3EDP A;  1TZL A;  2LG4 A;  1HW5 A;  1RET A;  1QZZ A;  4MNU A;  1RR7 A;  3DEW A;  5CVR A;  5FRO A;  3ONQ A;  3VSL A;  2B0L A;  3LA2 A;  3H5R A;  3VYT B;  3ZQ7 A;  2J5P A;  1HLV A;  1MMA A;  5CKT A;  5DYM A;  2Y75 A;  3KP2 A;  2HPM A;  3K6G A;  3FIW A;  2EIN H;  1KU2 A;  3QOP A;  5L3F A;  2OD5 A;  1OJL A;  4HSR A;  2CS3 A;  2R5Z A;  4ANJ A;  4IO9 F;  2Z1D A;  2M4G A;  5FGM A;  4BQN A;  1ZR4 A;  3PL8 A;  1VQ5 I;  3FK6 A;  2KQR A;  3GFJ A;  2JPB A;  4JBA A;  1A31 A;  1S7E A;  4IXA A;  2QM3 A;  4D7M A;  4KJZ A;  2V26 A;  5JVG F;  1ON2 A;  4XKB A;  1DPR A;  2KIU A;  1J0R A;  1YG2 A;  1JE8 A;  1DQU A;  3FMS A;  2Z3Y A;  4UB6 C;  1SAN A;  1HST A;  2R7R A;  2VJI A;  5HNF A;  4AUX A;  5CVV A;  1J59 A;  4JQF A;  4OIR F;  2MG4 A;  1F1Z A;  1PDN C;  3K4C A;  3CTA A;  1X2M A;  2BOL A;  3IUO A;  4RGR A;  4A3M J;  1LEB A;  4RBO A;  1ZAO A;  4MEX F;  1XDS A;  2EBI A;  4RAY A;  4Y17 A;  4PFO A;  4IQJ A;  2LY2 A;  4H0E A;  2LTP A;  1R5I D;  2IS1 A;  1XMX A;  2BVL A;  4CCO A;  4XR6 A;  2STT A;  1Y6I A;  2CUE A;  4M73 A;  2IEK A;  3QU3 A;  4LIU A;  4V19 K;  5GTI C;  4JP0 A;  1POG A;  4BJT A;  3CCJ I;  4BBS J;  2LYC A;  3IWZ A;  3JRE A;  5BOX A;  3GFM A;  4KFC A;  2PJP A;  2E5Z A;  1QHH D;  3NWT A;  3BG3 A;  4I0A A;  4XNF A;  3GZN B;  3BR2 A;  4XOR A;  1T0F A;  2M5W A;  3SHF A;  4MQV A;  4KIG A;  1XD7 A;  3G4S I;  1FP2 A;  3HEF A;  1LVK A;  3ZMT A;  1JUP A;  3K4M A;  3S17 J;  1O4X A;  1ZG3 A;  1P2F A;  4LJZ F;  4M6X A;  5J1U A;  2DA4 A;  3MKL A;  2GM4 A;  2DA1 A;  3A1Y A;  1ETY A;  3KLO A;  3I58 A;  2Y48 A;  4WK8 F;  3LNQ A;  1T33 A;  2HZT A;  4U0W A;  2DQR A;  2LKP A;  1YX3 A;  3BJ6 A;  1X3U A;  2V7F A;  5LHG A;  4IHW A;  3OYL A;  2DOD A;  1NG6 A;  5EYR A;  3MAJ A;  3S2W A;  4NNJ A;  2G7U A;  2EIJ H;  3TP0 A;  1I1S A;  4FQG A;  2O7O A;  3MWM A;  1EV7 A;  4I99 C;  3K4J A;  4CA0 A;  2DDB A;  2Z2S B;  5DD8 A;  3J7A Y;  1UG0 A;  4M6Y A;  2QA4 I;  3W3C A;  1E3P A;  2NOG A;  5DEQ A;  3ZQG A;  2PJR A;  4AYB N;  1YJ9 I;  1YS7 A;  3OIQ A;  3DU5 A;  3M8F A;  3H0G J;  1ZG5 A;  1XG1 A;  4NC7 A;  3P9K A;  4GGG A;  2R93 J;  1LE8 A;  4LFU A;  2CFX A;  1UEL B;  4BGD A;  3HOY J;  2O61 A;  2FNP A;  2XB5 A;  4EEF G;  1VQ4 I;  1D8J A;  2FBI A;  2VC1 A;  3BR1 A;  1F36 A;  3PJR A;  4IJA A;  4PJM A;  1R22 A;  3LSH A;  4BUP A;  2M34 A;  2NVU B;  3HOW J;  3P9I A;  4F93 B;  5LBQ A;  4ABZ A;  2KIS A;  1CGP A;  1GDT A;  1P9Q C;  1WQ2 A;  3HXL A;  3T5X A;  4YEL A;  1CQT A;  1OR7 A;  2P81 A;  3Q9V A;  4Z2Y A;  2FA5 A;  2DT6 A;  5DCM B;  1XN7 A;  4XON A;  4Q5S F;  3PIP F;  3OS1 A;  4HYE A;  2D1H A;  3OSF A;  4HDV A;  3R60 A;  2OU2 A;  3M7G A;  4EJU A;  2R5Y A;  4HQE A;  1B59 A;  2VT3 A;  2EFQ A;  3JTH A;  5IOY A;  3CP2 A;  2WWY A;  3GWZ A;  3W6V A;  3HUG A;  3S3O A;  1GUU A;  1XB4 A;  2D2W A;  2CH0 A;  2EWN A;  3B6A A;  3JRC A;  3K70 D;  1ZRF A;  3BR6 A;  2Z33 A;  5J47 A;  4CZZ A;  3LQQ A;  1VQM I;  1W4M A;  2K7L A;  3DKY A;  2DPD A;  1V55 H;  4HAM A;  3VEP A;  3HYI A;  4FIS A;  1DP3 A;  2QCO A;  3KFW X;  5C4X J;  4RLF A;  4HDU A;  1SFO J;  1K6O A;  2Q1Z B;  1A5J A;  2KP6 A;  1PUE E;  3NAU A;  4G6D A;  2LY1 A;  2BYV E;  5BQT A;  3N97 A;  2NXN B;  1UJ8 A;  4EAT A;  4RM2 A;  2NNY A;  4PK4 A;  1IC8 A;  3CC4 I;  3PNY A;  4A3C J;  3L00 A;  3DLA A;  1MH4 A;  2L7K A;  3A0H C;  3K2Z A;  2HEO A;  4M9X A;  2LVS A;  4AVZ A;  3CZ6 A;  3IV5 A;  4E4H A;  1YJN I;  3IC7 A;  4LK0 F;  2NVY J;  1Z0X A;  2NS0 A;  2CWE A;  4NBQ A;  2KFD A;  4A6D A;  1QO0 D;  3K4L A;  2E35 A;  1BOB A;  2W00 A;  1LFP A;  3GVA A;  5FO5 A;  3ZR8 X;  1GVD A;  2DI3 A;  4F55 A;  3K2A A;  1R1V A;  1Z3Y A;  1MZB A;  1SVO A;  3JRI A;  2BY1 A;  1ZRD A;  2ACJ A;  1HOM A;  3I71 A;  5D6E A;  5EJC A;  3V8K A;  3R0J A;  5KNL A;  5TIS C;  3PUF A;  2LBF A;  1SMY F;  4GYG A;  3CMM A;  1CF7 A;  1HXD A;  4GDF A;  3H92 A;  4XLE A;  3CD6 I;  2Z99 A;  1H9G A;  3CES A;  1MBE A;  4AYB A;  4DBR A;  2BHZ A;  2FU4 A;  1FLI A;  2KL4 A;  2ZME C;  1W5T A;  1HKT A;  2VE8 A;  5D4S A;  3FBN B;  1MD0 A;  1GT0 C;  2E1M B;  1IG7 A;  2JVH A;  3PIO F;  1HW1 A;  2DOE A;  3S1R J;  1N25 A;  2JJ7 A;  3M1C A;  4Y3O A;  3ZMV A;  3GX4 X;  4GCV A;  2F2E A;  1MIJ A;  1T6S A;  5DM7 F;  3CCQ I;  1P4X A;  1FT9 A;  3J80 K;  5DTD A;  3I64 A;  2F48 A;  3MEX A;  2QBY B;  3F9K A;  2VKD A;  3WTU C;  2RVC A;  2LR8 A;  4HOB A;  4B48 A;  5LD2 C;  2A5W A;  5D5X B;  2K9N A;  3BTL A;  3JR9 A;  2ZJR F;  3E3V A;  1MSE C;  2XGD A;  4OU0 A;  1TLH B;  1YFH A;  2E1N A;  1XCV A;  2KIF A;  1SFU A;  3J7A O;  4IX7 A;  4MIM A;  1LB2 A;  3AG4 H;  3WTT C;  1EF4 A;  2A6H F;  3OYA A;  3BG5 A;  5L3G A;  1JHF A;  1GXP A;  1ZH5 A;  2R92 J;  3FKI J;  1Y8R B;  4A3B J;  3RTR A;  2L7F P;  1U5T C;  1KYZ A;  3LST A;  4BKX A;  1KU3 A;  1HKS A;  3ECO A;  1P4W A;  2XF7 A;  2XKP A;  3HHH A;  2R7V A;  1X1P A;  2GXA A;  1G3S A;  2DOA A;  4NC8 A;  2P4W A;  1G8X A;  3ZQH A;  4N0B A;  4BE2 A;  5EZH A;  4BEH B;  2VXZ A;  3S2D J;  2CV1 A;  3BJA A;  3HHG A;  3UKG A;  5B1B H;  2QEX I;  1WJA A;  4OAZ A;  1RUO A;  4A3D J;  4ITV A;  4XLF A;  1UST A;  4M3D A;  4HA8 A;  1W1W E;  5CQG A;  2BW3 B;  5K5O A;  1P92 A;  4AM3 A;  4F91 B;  1A6Q A;  3LSJ A;  1G6N A;  3J80 Z;  1W0U A;  3GBG A;  2K4B A;  3RSN A;  2VIX A;  1B4A A;  1FMW A;  5J40 A;  3E6C C;  2MSY A;  2ID3 A;  2P6T A;  4IHS A;  3OYB A;  1B72 A;  1JKR C;  5HVQ C;  4E70 A;  2DO7 A;  2ESN A;  2L01 A;  2I10 A;  3IAS 2;  4IHV A;  1NHA A;  3VWB A;  1ZGJ A;  3M9A A;  2A6T A;  3ZOB A;  4U88 A;  4CUG A;  5FRM A;  1S29 A;  2FF4 A;  2XGC A;  4A5M A;  1W5C C;  3LSG A;  5DCF A;  3F0C A;  2GOX B;  5GAD J;  5EG0 B;  3BLY A;  4D1Q A;  2NS7 A;  5DUK A;  3E1S A;  5CPR B;  1JXS A;  2DPU A;  2OQG A;  1Y0U A;  2L9S A;  2BGC A;  3S1Q J;  3QU6 A;  4CYC B;  1U0J A;  2JUC A;  5LGU A;  3S1N J;  2VAS A;  1BW5 A;  4D5F A;  4MTE A;  1BR4 A;  2CW0 F;  2Z5U A;  4XKW A;  4D0P A;  1E3O C;  5IYB J;  1J9I A;  1YTY A;  2Z16 A;  1OMI A;  4BAY A;  3GFL A;  3G73 A;  2HTS A;  4C3J J;  3NEU A;  4BDY A;  4DYQ A;  1JJ6 C;  1ZK8 A;  3IKV A;  4W97 A;  4C9Y A;  1JGG A;  2OV7 A;  2ZC2 A;  3W2W A;  1ZLJ A;  2YSR A;  4HX7 A;  3DBH B;  2VKH A;  4KDP A;  1Z05 A;  3PSF A;  2K85 A;  3DPL C;  4ZTF A;  2JVG A;  3OR2 C;  4XLN F;  3ASN H;  2EFO A;  3S15 J;  2ZFU A;  4Y33 A;  3CCL I;  1MJB A;  4DQ2 A;  5HS8 A;  3CUQ B;  5L3E A;  3RI4 A;  4XN0 A;  3I4N J;  3HTU A;  4LB6 B;  1BL0 A;  3DEE A;  1MND A;  1XCB A;  2BXY A;  3T1B A;  3E7L A;  4HNV A;  2UXX A;  3DKW A;  3GO5 A;  2ZNY A;  1HDD C;  1D0Y A;  4BJ6 C;  4N4N B;  1SC7 A;  1WGX A;  5J3L A;  1YW8 A;  3D5L A;  2MH9 A;  5M3M J;  3J81 K;  5IP7 J;  4FE4 A;  1U3E M;  2CUJ A;  4B44 A;  4P9F A;  4RB3 C;  1W36 C;  3WTV C;  5JFR A;  4RLQ A;  5DS9 A;  1OFC X;  1R71 A;  1E0E A;  3CO7 C;  3L9F A;  5GAH J;  1BI3 A;  3ECH A;  2BBY A;  2CQQ A;  2VB6 A;  3W6K B;  4MTD A;  2M2E A;  3KYL A;  3DU6 A;  2JWT A;  2AXL A;  4PSW A;  1WH7 A;  1X1A A;  2K02 A;  3TW7 A;  1Z3X A;  3O2P E;  1TBX A;  2GAU A;  2H8R A;  4TV7 A;  4BY7 J;  2E5N A;  4PGG A;  5M3F J;  5EF6 A;  5D8L B;  3H9G A;  3TOA A;  4L9J A;  2W7N A;  2L4A A;  5H20 A;  4UUT A;  3F8N A;  2DMP A;  1XMA A;  1L0O C;  5EEH A;  5FKK A;  2KRC A;  2A07 F;  1LQ1 A;  5D6F A;  1Q1H A;  3L2W A;  2M45 A;  2P5V A;  1OCP A;  1S7O A;  3CCY A;  5AIQ A;  1FYM A;  4LG0 A;  2JRM A;  3BZK A;  3O3K A;  3DP7 A;  2ZKZ A;  1D5Y A;  3HKZ N;  3NQO A;  3GXO A;  4BXX J;  1OCT C;  4PDK A;  2V1X A;  1I27 A;  2ZME A;  4FT8 A;  4ZYA A;  3MKZ A;  1RKW A;  1G3T A;  3ML6 A;  4KIB A;  3J81 Z;  2IAI A;  4MLO A;  1KA8 A;  4EJO A;  3T8R A;  2V79 A;  1YRN B;  2O5R A;  2VLA A;  1GV2 A;  3RKQ A;  1MBJ A;  3EUK L;  2HNH A;  1IN6 A;  1MMD A;  1ACI A;  1U6G A;  2CQX A;  2HOE A;  5H2F C;  3HOT A;  1WWX A;  2KT0 A;  5GPC A;  4RAF A;  1GV5 A;  4U7B A;  3KYD B;  5ILU A;  2D5V A;  4A3E J;  4HRI A;  2DT5 A;  3TO6 A;  3K9T A;  4IPA A;  4UUS B;  3MKY B;  2L9V A;  5AON A;  5B5E C;  2F5E A;  4JYK A;  4L5E A;  2R7O A;  3FXL A;  4HG2 A;  4BL0 B;  2HDW A;  2LY9 A;  3CF2 A;  4A3F J;  3I59 A;  4I01 A;  2W84 A;  1JUM A;  2Y0S A;  4KA4 A;  1NK3 P;  3HM5 A;  2KKO A;  5E18 F;  1JT6 A;  1MDM B;  2DA7 A;  2DFE A;  3ELK A;  3CDL A;  5LGN A;  2M8G X;  2XSJ C;  1JI8 A;  4HQM A;  2VN2 A;  5TJJ A;  2BY2 A;  3VYU B;  1OR7 C;  1FPQ A;  1U5T A;  2PEX A;  4RDU A;  1USS A;  2XKO A;  3SDB A;  1W7P B;  2BZT A;  3R6S A;  3QAH A;  4DNC A;  2HVR A;  2YX4 A;  3LAP A;  2LP0 A;  3I3L A;  5FFX A;  4DOZ A;  3K4B A;  2IJL A;  2RGV A;  2OCC H;  2BVM A;  3MZ8 A;  1ITY A;  4H4K C;  2X48 A;  3G2B A;  3HRM A;  3ZP5 A;  3HOV J;  1U9O A;  2O3F A;  3GF2 A;  4C3I J;  5JI6 A;  3WU1 B;  4KUM A;  2BY3 A;  3GTL J;  2VBX A;  2K9L A;  2V9P A;  1S9H A;  3KX2 A;  3WG9 A;  4BY1 J;  3DWL E;  3RPU A;  3Q3S A;  3HTS B;  2IS4 A;  4JX4 A;  4RGS A;  4Q4Z F;  2MLK A;  1WJ5 A;  4GXO A;  1PUF A;  5HLH A;  1LDK B;  2E7W A;  1Z21 A;  1B6A A;  1FY7 A;  4WF2 A;  1AWC A;  3A4C A;  3CJQ B;  5EGO A;  1IN7 A;  4XOT A;  1BR1 A;  1BI2 A;  3FBI B;  3JRH A;  4BE1 A;  2HU9 A;  3PO3 J;  4D9J A;  4BQO A;  3OWT A;  4UXN A;  3I4P A;  4OMY A;  3F6O A;  2JMW A;  2VJ5 A;  3VFZ A;  5D8K B;  4KIT B;  1IUY A;  3UNG C;  1EJ9 A;  1RR8 C;  2JSP A;  4HX4 A;  1QQI A;  4YG2 F;  1ON1 A;  4M74 A;  1XDU A;  4R8H A;  4ZDL A;  2GIZ A;  4BYY A;  1R36 A;  3LSP A;  1VQO I;  3HKZ A;  2G9W A;  3DEU A;  1AKH A;  4LIT A;  5ICC A;  1BM9 A;  2K27 A;  3GFI A;  2RQQ A;  2H27 A;  4AVP A;  1OCO H;  5J4Y A;  2FNA A;  1EH6 A;  2HR3 A;  2CYY A;  2IBD A;  3KP7 A;  4HLX A;  1OCZ H;  4RM3 A;  4A0Z A;  3COA C;  4C2T A;  5BPD A;  3SJM A;  2Q8K A;  3GZ5 A;  2X1E A;  5B3S H;  2XV4 S;  1S8N A;  2EA2 A;  2X4H A;  4A3I J;  4HF1 A;  4XRS G;  3L2V A;  3IH2 A; 
#chains in the Genus database with same CATH homology
 3U1D A;  3L7W A;  2NAZ A;  2Q2E A;  1O7L A;  3TQN A;  2ZJ2 A;  1Z6R A;  2R7F A;  2EFP A;  1OYW A;  2RKH A;  4I7H A;  1H9T A;  1U2W A;  3HRT A;  4QWQ A;  5E8G A;  3F23 A;  1BI0 A;  3WGH A;  3FXR A;  3ZMS A;  1GHC A;  4HF2 A;  2LSO A;  1KYW A;  4G7O F;  3HSE A;  2DAO A;  1BI1 A;  2VOO A;  1SD4 A;  3BP8 A;  4IHT A;  2L3D A;  2PMU A;  3WTS C;  1O57 A;  2XVC A;  3I5U A;  4ENJ A;  4MEY F;  4MHG A;  1TTY A;  4RB0 A;  1FBS A;  3V7S A;  2P5L C;  4RB2 C;  2L54 A;  1K78 A;  1BC7 C;  3ERE D;  2QQB A;  2CG4 A;  4CXF A;  4AIJ A;  1R7J A;  3LA7 A;  1XGS A;  3TO9 A;  1FNN A;  1GXQ A;  5DD4 A;  4UHT A;  3JSO A;  1WSU A;  2DQL A;  1JHH A;  3KEQ A;  2FE3 A;  2C6Y A;  5LHH A;  4OIO F;  1Z9C A;  3W6J B;  1QGP A;  3RYP A;  2ZO4 A;  2UZK A;  3F8F A;  1LEA A;  2UWM A;  5HOO A;  2PBI A;  1G4D A;  3I53 A;  4ZZL A;  5ILV A;  1UFM A;  4M9S A;  1VTN C;  3Q5F A;  1SFX A;  2GXB A;  2MBF A;  2ZNZ A;  2P5K A;  2XRN A;  2D1V A;  2IA0 A;  1FYK A;  4BHC A;  4WX9 A;  1XSV A;  2HYG D;  2W85 A;  4IRG A;  3C18 A;  2VOP A;  4I2O A;  4N9H A;  1KU7 A;  4ESF A;  3GUD A;  2EV0 A;  2FBK A;  5LEJ A;  3HOS A;  5E1X A;  1D5V A;  2GWR A;  5K5Q A;  4NQW A;  1W7P D;  2ZXJ A;  3WOD F;  3CLO A;  3I0T A;  2QWW A;  2IRF G;  5KVR A;  4ETS A;  4UV9 A;  4AWX B;  3CDH A;  3PFI A;  4ESB A;  4I09 A;  1UHM A;  3HRS A;  4UUV A;  3ZN0 A;  4KYW A;  1ZN2 A;  2V1U A;  3PQJ A;  5E1W A;  4IVN A;  3U9G A;  2YR2 A;  5D5U B;  1ODD A;  1LJ9 A;  3HRU A;  3HSF A;  1D8K A;  1QPM A;  1E17 A;  5LGT A;  3ROU A;  1R00 A;  3WU0 A;  2A69 F;  2QLZ A;  4N9I A;  3K1N A;  2A68 F;  3K1P A;  3MZY A;  4HZF A;  1B1B A;  5CVI A;  2QUF A;  4L9N A;  3TO7 A;  2PN6 A;  1RUN A;  4EVI A;  1ZLK A;  1R5H A;  2JT1 A;  4ENM A;  2RC4 A;  2JTV A;  2A5Y B;  2M87 A;  2HKO A;  4XRF A;  2DLL A;  3HIF A;  1YQA A;  4YII A;  2XHK A;  1SMT A;  3KET A;  3O6B B;  4OIQ F;  5H6Q A;  2PFB A;  4ON0 A;  2IP2 A;  1R58 A;  4HV6 A;  3ISP A;  3RIR A;  3F3X A;  4FX4 A;  5E17 F;  2UXN A;  1EH7 A;  1FSE A;  1A04 A;  1CF7 B;  3PQK A;  3C3W A;  3BPV A;  5JR3 A;  1PP8 F;  4HX8 A;  5ERI A;  4EMS A;  5ICE A;  4LMY A;  1O7F A;  4I98 B;  2DTR A;  4WWC A;  2VBW A;  3R0A A;  4WXH A;  3H3Z A;  1XSD A;  1IRF A;  4Y15 A;  2KRF A;  3BZ6 A;  3EYY A;  2A61 A;  2LDU A;  4LLN A;  4ASN A;  3FWE A;  1YO5 C;  1BOA A;  3F6V A;  1O3Q A;  3RKW A;  2M30 A;  1T2K A;  3FZV A;  5HDG A;  2EJR A;  1L3L A;  3DQV C;  4UNO A;  3KP3 A;  3WE3 A;  3VOD A;  5HDN A;  1YYV A;  4R79 A;  5BPI A;  1J7K A;  2MH2 A;  2YX7 A;  1FSH A;  2GXG A;  5FB2 A;  1K79 A;  3B02 A;  2HQN A;  1HSJ A;  1TQM A;  1WI9 A;  4L9V A;  3V8J A;  2Q0O A;  3DPT A;  3F8M A;  3TDU C;  4O3M A;  3NRV A;  1Z7U A;  5A2Q Z;  3R4K A;  1XGN A;  1IXC A;  3E5U A;  3BDD A;  3BOQ A;  2ETH A;  2L02 A;  2QVO A;  2YU3 A;  4LLL A;  4AIK A;  3ZN1 A;  3V7R A;  2XIG A;  3LA3 A;  5DUI A;  4GYI A;  3EYI A;  2TDX A;  4WXC A;  5HS9 A;  1KQ9 A;  1C0W A;  1F5T A;  2PLY A;  2XAG A;  3EUH A;  5DV5 A;  2HGC A;  1KQ0 A;  2QQ9 A;  3CUO A;  3RKY A;  4LGW A;  1XGO A;  2IA1 A;  1I5Z A;  2RDP A;  2YPR A;  3KP6 A;  2KIM A;  4CHU A;  1IN8 A;  4HV5 A;  4M9Z A;  3JTG A;  3FF5 A;  2JZY A;  2HYF A;  3E5Q A;  1R1T A;  3MCZ A;  3C7J A;  4A0Y A;  3ABT A;  4U0V A;  1STZ A;  4P55 A;  3JW4 A;  4B09 A;  2M8E A;  5D4R A;  1U8R A;  5BS6 A;  1JGS A;  5IT9 K;  2VT2 A;  4Q48 A;  5F64 A;  3KP4 A;  1ZRE A;  4KMF A;  1B9M A;  1BN5 A;  3P9C A;  4ENN A;  3KE2 A;  4EGZ A;  1QBJ A;  3L09 A;  1BC8 C;  2K4J A;  4XLP F;  1AOY A;  1FZP B;  4HF0 A;  3FMR A;  3BRO A;  4LG0 B;  1XGM A;  3GZ6 A;  3MQ0 A;  4AD9 A;  2ZBK A;  4HBL A;  1MJ9 A;  5CYV A;  4UVA A;  3WGG A;  2ZME B;  1FOK A;  2P7V B;  5AIP A;  3KLN A;  4CO8 A;  2VON A;  2ISY A;  3IRQ A;  5IT9 Z;  5E20 A;  2R7D A;  5CJ9 A;  1O3T A;  5LLQ A;  4QLC U;  5EEG A;  1O3R A;  2LF8 A;  2MLG A;  2OZ6 A;  4PGH A;  4PCQ A;  4WXD A;  4EM0 B;  1LVA A;  2XAF A;  2ISZ A;  4KT5 C;  3VB2 A;  4KNY A;  5D5V B;  3SXY A;  3I59 B;  1GVJ A;  2W24 A;  4G9Y A;  2EFN A;  4R1H A;  2H6B A;  3GYH X;  2GQQ A;  5IT3 A;  4BH9 A;  3V4G A;  1U5T B;  2KJC A;  4WCG A;  4JK1 X;  3JAM Z;  2MD5 A;  2HFH A;  3RJP A;  3F22 A;  1T98 A;  1J75 A;  4M71 A;  2LF7 A;  3CO6 C;  1YIO A;  4EM2 A;  2A3S A;  3ZMD A;  1IN4 A;  1HQC A;  1WRJ A;  3QPT A;  4XSZ F;  3P7N A;  4ZYE A;  3KZZ A;  1RNL A;  3MFK A;  4YIF A;  3F8B A;  4HLY A;  3QP5 A;  4U7D A;  4CDG A;  3RKX A;  2L4M A;  2BEO A;  1FYL A;  5L3D A;  3QRF F;  3LFK A;  2VC0 A;  3V8L A;  3RYR A;  4F7Z A;  3JSP A;  3ZPL A;  2MC3 A;  4EJV A;  1LDD A;  2EV5 A;  1SD7 A;  2O03 A;  1SFE A;  3KZY A;  1W5S A;  2ZCW A;  1Z91 A;  1KGS A;  5ICF A;  1V3F A;  4O5V A;  4EV0 A;  2EV6 A;  5J6X A;  4EM1 A;  2W57 A;  1SD5 A;  3H3U A;  4A2U A;  4BHB A;  3RDI A;  1TW3 A;  1FBQ A;  1S6L A;  2VBY A;  3MZH A;  4XSX F;  3E6M A;  4OIN F;  2QQA A;  1ZHF A;  5D5W B;  4CGZ A;  2DK8 A;  4L5I A;  5BMZ A;  4G7H F;  1T38 A;  2JRT A;  3V7C A;  1UHW A;  3IL2 A;  4CIC A;  2ELH A;  4UVC A;  3C1D A;  4K2E A;  5DCM A;  1OKR A;  3T8T A;  3LAJ A;  3BY6 A;  6PAX A;  3N4M A;  1IF1 A;  5FD6 A;  3CUQ C;  4KN4 X;  4P96 A;  2NRA C;  1QZY A;  2ESH A;  1SAX A;  2DK5 A;  2RV8 A;  4BXU A;  3F21 A;  3ZMZ A;  4ZH4 F;  1P6R A;  3DXJ F;  5CVU A;  1B9N A;  3HSR A;  1K78 B;  4G8X A;  4LLG F;  5J8C A;  2BV6 A;  2FOK A;  1IW7 F;  3K0L A;  1DDN A;  2GA1 A;  4LB5 A;  1SD6 A;  1RI7 A;  2O6G E;  3E97 A;  3CJN A;  2RNJ A;  4IRH A;  4RAZ A;  3FM5 A;  3DV8 A;  1S7A A;  3F8C A;  4S04 A;  2FMY A;  2NNN A;  3KP5 A;  2WC2 A;  4HW0 A;  3TKY A;  2IA2 A;  5HLG A;  3WGI A;  2FBH A;  4AIH A;  3M1E A;  1IXS B;  3ABU A;  2XRO A;  4ENK A;  4B8X A;  2HWV A;  4BHP A;  4ZYG A;  2LNB A;  2QYO A;  2DW4 A;  4UVB A;  1YW9 A;  2F5D A;  3IRR A;  2E7X A;  1FWZ A;  4YFX F;  2P8T A;  4L0Y B;  3WTW C;  4U0Y A;  5J8F A;  1R23 A;  4L0Z B;  4YFN F;  2QBY A;  2COM A;  1DPU A;  2FQ3 A;  3FXQ A;  1I1G A;  1KQ8 A;  3G3Z A;  5LRR A;  2CQK A;  2OBP A;  1H0M A;  2NYX A;  1TNT A;  4OIP F;  1LNW A;  2MA3 A;  2K86 A;  4G94 A;  1QNT A;  1TQP A;  4Q47 A;  2XAS A;  1BBY A;  3ZMU A;  4RGU A;  2A6E F;  4MQ9 F;  2XAH A;  3WTZ A;  3EQL F;  2WV0 A;  2HKX A;  3M8E A;  2QZ8 A;  1MJA A;  1YS6 A;  1ZAR A;  4NHJ A;  3DF8 A;  1UB9 A;  4FX0 A;  2XUB A;  4MGR A;  3TGN A;  3FM3 A;  1IXR C;  2OZU A;  1EH8 A;  4L5J A;  2PMH A;  1FC3 A;  4IF4 A;  1G3Y A;  3I54 A;  3E6D A;  2DBB A;  2PG4 A;  5HDK A;  2FRH A;  3BWG A;  2OA4 A;  1LDJ A;  4OOI A;  3VOE A;  1F9N A;  2GZW A;  2Z9O A;  3FX3 A;  4S05 A;  5F1R A;  1R1U A;  3WTY C;  5K1Y A;  2H09 A;  1UCR A;  2FEZ A;  2ZFW A;  1J2X A;  2XGX A;  1IZ1 A;  3GW2 A;  4P9U A;  3GEZ A;  1V4R A;  3WE2 A;  4ZYD A;  5A2Q K;  1RIO H;  3LQR A;  2IPQ X;  5CVJ A;  2JSC A;  2J5O A;  2IVM A;  5HLI A;  2G7H A;  3F72 A;  3B73 A;  1IN5 A;  1IRG A;  3IKT A;  1E2X A;  2HS5 A;  2KJB A;  3CUQ A;  4OMZ A;  1OPC A;  1O3S A;  3OV8 A;  3EET A;  4KIC A;  4A12 A;  2P7C B;  1Z1D A;  2QEN A;  5FFZ A;  2DFI A;  1MGT A;  1XMK A;  2RQP A;  2WTE A;  2ADU A;  2D45 A;  4ESJ A;  2V1D A;  2X0L A;  4I0B A;  5H6R A;  2R3S A;  2CGP A;  1ZYR F;  1J5Y A;  3AAF A;  1IAW A;  3BPX A;  3REO A;  2O0Y A;  5L3C A;  3T0Y A;  2M1B A;  2OQR A;  1D3Y A;  5K5R A;  3LWF A;  4EJW A;  1BJA A;  3RPQ A;  1MKM A;  5E8I A;  4FHT A;  4YFK F;  3E6B A;  3BJO A;  2VBZ A;  3SQN A;  5FLX K;  4LK1 F;  1TW2 A;  2H6C A;  3KCC A;  2IW5 A;  4RB1 A;  3SZT A;  4O6J A;  3FXU A;  2OAZ A;  4M72 A;  2P6S A;  3IWF A;  4EGY A;  1R5G A;  5F6F A;  1DP7 P;  1Z6T A;  4EJT A;  3K69 A;  2FSW A;  1ZRC A;  5E1Z B;  4KMU X;  2H94 A;  2XAJ A;  4L18 B;  4PZJ A;  4IRI A;  4KN7 X;  4A6E A;  3WTX C;  4ZYH A;  3KEO A;  5ED4 A;  1K7A A;  4G7Z F;  1KU9 A;  4RS8 A;  2GA2 A;  5FD5 A;  3Q9S A;  1MDM A;  3L2C A;  5FLX Z;  3DFG A;  4P5O A;  2PI0 A;  1REP C;  1F4K A;  3E5X A;  4BNC A;  2HDC A;  2DU9 A;  1U78 A;  2VOD A;  3OOP A;  4GO1 A;  5LHI A;  1WKM A;  3R61 A;  1W7P A;  4G6Q A;  1BIB A;  1HKQ A;  3QP6 A;  5TRD A;  3FHZ A;  5LRS A;  5LEK A;  1TNS A;  3TDZ C;  1DUX C;  2F5F A;  2GIV A;  1TQI A;  4XBF A;  2FXA A;  3IHU A;  5ILS A;  3ULQ B;  1HBX G;  2F5C A;  4A5N A;  2JPC A;  1G3W A;  2HQR A;  1XSX A;  4LD5 A;  1OYI A;  2EK5 A;  1FBU A;  1FX7 A;  2HTJ A;  2EA4 A;  1PP7 U;  2BE5 F;  2W25 A;  3JAM K;  2V9V A;  2PQ8 A;  2CSO A;  3K1M A;  1P4A A;  1YW7 A;  4A0X A;  1I6X A;  3TOB A;  1ZG1 A;  4BQA A;  4UV8 A;  2IT0 A;  3SFZ A;  5L3B A;  1HW2 A;  1ULY A;  4EQQ A;  1ONV A;  3U2R A;  5DDG A;  4Y13 A;  4I02 A;  2V6C A;  2EFW A;  1S3J A;  3D0S A;  2VE9 A;  2Y0M A;  5HS7 A;  3QPH A;  2O8X A;  2E1C A;  2XAQ A;  1BIA A;  2EB7 A;  1T39 A;  2RN7 A;  1ZGA A;  4NB5 A;  3FMQ A;  1FP1 D;  4KIF A;  5KK1 A;  1RZ4 A;  5ICG A;  2STW A;  4L9T A;  4RGX A;  2AS5 F;  3SZP A;  2CO5 A;  5JVT A;  4CYD A;  1YLF A;  4ZZD A;  5JHU A;  5CLS A;  1OYY A;  3GLX A;  2FML A;  3EDP A;  1HW5 A;  1QZZ A;  4MNU A;  5CVR A;  2B0L A;  3LA2 A;  3ZQ7 A;  2J5P A;  5DYM A;  2Y75 A;  3KP2 A;  1KU2 A;  5L3F A;  3QOP A;  2OD5 A;  5FGM A;  3GFJ A;  2JPB A;  4JBA A;  4IXA A;  2QM3 A;  1ON2 A;  1DPR A;  2KIU A;  1J0R A;  1YG2 A;  1JE8 A;  3FMS A;  2Z3Y A;  1HST A;  5CVV A;  1J59 A;  4JQF A;  4OIR F;  1PDN C;  1F1Z A;  3CTA A;  4RGR A;  1LEB A;  1ZAO A;  4MEX F;  1XDS A;  4RAY A;  4Y17 A;  4H0E A;  2STT A;  4M73 A;  3QU3 A;  3IWZ A;  5BOX A;  3GFM A;  4KFC A;  2PJP A;  4I0A A;  1T0F A;  2M5W A;  3SHF A;  4MQV A;  4KIG A;  1XD7 A;  1FP2 A;  3ZMT A;  1ZG3 A;  1P2F A;  4LJZ F;  4M6X A;  3KLO A;  3I58 A;  2Y48 A;  4WK8 F;  2HZT A;  4U0W A;  2DQR A;  2LKP A;  3BJ6 A;  1X3U A;  5LHG A;  3MAJ A;  3S2W A;  2G7U A;  1I1S A;  3MWM A;  1EV7 A;  5DD8 A;  4M6Y A;  5DEQ A;  1YS7 A;  3M8F A;  1ZG5 A;  3P9K A;  4GGG A;  4LFU A;  2CFX A;  2O61 A;  2FNP A;  1D8J A;  2FBI A;  2VC1 A;  4IJA A;  1R22 A;  3P9I A;  5LBQ A;  1CGP A;  1WQ2 A;  3T5X A;  1OR7 A;  3Q9V A;  4Z2Y A;  2FA5 A;  5DCM B;  1XN7 A;  4Q5S F;  4HYE A;  2D1H A;  4HDV A;  3R60 A;  2OU2 A;  3M7G A;  4EJU A;  4HQE A;  1B59 A;  2VT3 A;  2EFQ A;  3JTH A;  2WWY A;  3GWZ A;  3HUG A;  1XB4 A;  1ZRF A;  2D2W A;  2EWN A;  2Z33 A;  4CZZ A;  3LQQ A;  1W4M A;  2K7L A;  2DPD A;  4HAM A;  3VEP A;  3HYI A;  3KFW X;  4HDU A;  1K6O A;  1PUE E;  4G6D A;  2BYV E;  5BQT A;  3N97 A;  2NNY A;  3L00 A;  3K2Z A;  2HEO A;  4M9X A;  3IC7 A;  4LK0 F;  2NS0 A;  2CWE A;  4A6D A;  1QO0 D;  3GVA A;  5FO5 A;  2DI3 A;  1R1V A;  1MZB A;  1ZRD A;  2ACJ A;  3I71 A;  5D6E A;  3V8K A;  3R0J A;  1SMY F;  4GYG A;  1CF7 A;  1HXD A;  3H92 A;  2Z99 A;  1H9G A;  2FU4 A;  1FLI A;  1W5T A;  1HKT A;  2VE8 A;  5D4S A;  1MD0 A;  1HW1 A;  3ZMV A;  3GX4 X;  4GCV A;  2F2E A;  1T6S A;  1P4X A;  1FT9 A;  3J80 K;  2QBY B;  3I64 A;  3MEX A;  3WTU C;  2RVC A;  4HOB A;  5D5X B;  3E3V A;  4OU0 A;  1TLH B;  1YFH A;  2E1N A;  1XCV A;  2KIF A;  1SFU A;  3J7A O;  1LB2 A;  3WTT C;  2A6H F;  5L3G A;  1JHF A;  1GXP A;  1ZH5 A;  3RTR A;  1U5T C;  1KYZ A;  3LST A;  1KU3 A;  1HKS A;  3ECO A;  1P4W A;  2XKP A;  3HHH A;  1G3S A;  2P4W A;  4N0B A;  2VXZ A;  3BJA A;  3HHG A;  1RUO A;  1UST A;  4HA8 A;  5K5O A;  1P92 A;  3J80 Z;  1G6N A;  2K4B A;  1B4A A;  3E6C C;  2P6T A;  4IHS A;  5HVQ C;  4E70 A;  2DO7 A;  2ESN A;  2L01 A;  1NHA A;  1ZGJ A;  3M9A A;  4U88 A;  1S29 A;  2FF4 A;  4A5M A;  5DCF A;  5DUK A;  1JXS A;  2DPU A;  2OQG A;  1Y0U A;  2BGC A;  3QU6 A;  5LGU A;  4MTE A;  2CW0 F;  2Z5U A;  4D0P A;  1J9I A;  1YTY A;  1OMI A;  4BAY A;  3GFL A;  3G73 A;  2HTS A;  3NEU A;  3IKV A;  1ZLJ A;  2YSR A;  4HX7 A;  4KDP A;  1Z05 A;  3DPL C;  4XLN F;  2EFO A;  1MJB A;  4DQ2 A;  5HS8 A;  3CUQ B;  5L3E A;  3RI4 A;  3HTU A;  4LB6 B;  1XCB A;  3T1B A;  2UXX A;  3DKW A;  3GO5 A;  2ZNY A;  1YW8 A;  3D5L A;  2MH9 A;  3J81 K;  1U3E M;  4P9F A;  4RB3 C;  3WTV C;  5JFR A;  3CO7 C;  3L9F A;  1BI3 A;  3ECH A;  2BBY A;  3W6K B;  4MTD A;  2AXL A;  2K02 A;  3O2P E;  1TBX A;  2GAU A;  4TV7 A;  4PGG A;  5D8L B;  3TOA A;  4L9J A;  2L4A A;  5H20 A;  3F8N A;  1XMA A;  1L0O C;  5EEH A;  2A07 F;  1LQ1 A;  5D6F A;  1Q1H A;  2M45 A;  2P5V A;  1S7O A;  5AIQ A;  1FYM A;  4LG0 A;  3O3K A;  3DP7 A;  2ZKZ A;  3NQO A;  3GXO A;  4PDK A;  2V1X A;  1I27 A;  2ZME A;  4FT8 A;  1G3T A;  3ML6 A;  4KIB A;  3J81 Z;  1KA8 A;  4EJO A;  3T8R A;  2V79 A;  1IN6 A;  1U6G A;  2HOE A;  3HOT A;  1WWX A;  4U7B A;  5ILU A;  2DT5 A;  3TO6 A;  3K9T A;  4IPA A;  5AON A;  2F5E A;  3I59 A;  4I01 A;  2W84 A;  4KA4 A;  5E18 F;  2KKO A;  1MDM B;  3ELK A;  5LGN A;  4HQM A;  2VN2 A;  5TJJ A;  1FPQ A;  1U5T A;  2PEX A;  1USS A;  2XKO A;  1W7P B;  3R6S A;  3QAH A;  4DNC A;  2YX4 A;  3LAP A;  5FFX A;  2IJL A;  2RGV A;  3HRM A;  3ZP5 A;  2O3F A;  3GF2 A;  5JI6 A;  3WU1 B;  4KUM A;  2VBX A;  3WG9 A;  3RPU A;  3HTS B;  4RGS A;  4Q4Z F;  2MLK A;  4GXO A;  5HLH A;  1LDK B;  2E7W A;  1B6A A;  1FY7 A;  4WF2 A;  1AWC A;  1IN7 A;  1BI2 A;  4UXN A;  3I4P A;  4OMY A;  3F6O A;  3VFZ A;  5D8K B;  1IUY A;  4HX4 A;  1QQI A;  4YG2 F;  1ON1 A;  4M74 A;  1XDU A;  4R8H A;  4BYY A;  1R36 A;  2G9W A;  3DEU A;  5ICC A;  1BM9 A;  2K27 A;  3GFI A;  2H27 A;  4AVP A;  2FNA A;  1EH6 A;  2HR3 A;  2CYY A;  3KP7 A;  4HLX A;  4A0Z A;  3COA C;  5BPD A;  2Q8K A;  3GZ5 A;  2XV4 S;  1S8N A;  2EA2 A;  2X4H A;  4HF1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...