1J0RA

Crystal structure of the replication termination protein mutant c110s
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
114
structure length
114
Chain Sequence
TGFLVKQRAFLKLYMITMTEQERLYGLKLLEVLRSEFKEIGFKPNHTEVYRSLHELLDDGILKQIKVKKEGAKLQEVVLYQFKDYEAAKLYKKQLKVELDRSKKLIEKALSDNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The impact of single cysteine residue mutations on the replication terminator protein
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Replication
molecule keywords replication termination protein
total genus 42
structure length 114
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02334 RTP Replication terminator protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1j0rA00
3O3KA 1KU3A 1I6XA 1QZYA 2VXZA 2WTEA 2ZCWA 3VEPA 1ZLJA 3RJPA 1S7AA 1BBYA 1HSJA 3QU6A 3CUOA 4KA4A 3GFLA 3ZMDA 1XGMA 3GYHX 4KNYA 1P92A 2JTVA 1V4RA 4M73A 2CW0F 3K1PA 1BI3A 2FSWA 3FZVA 2RNJA 2QUFA 1FC3A 3LQQA 4WCGA 2EFNA 4A0XA 1IZ1A 4N0BA 1IRGA 1FSHA 1D5VA 5DD8A 4IF4A 3PFIA 2PI0A 4BH9A 4I0AA 3DV8A 1R1VA 2WWYA 1FYLA 1FYMA 1ZH5A 3GW2A 2EA4A 3O6BB 4IRHA 4O3MA 1XB4A 4L9TA 2NAZA 3F8NA 4A6DA 2VN2A 3EYIA 3F8MA 4QWQA 2MA3A 2COMA 1BIAA 4HDVA 2CO5A 3MWMA 1R00A 1XGSA 1OYIA 4UNOA 1Z91A 4ZH4F 2Y75A 2VC1A 4BYYA 3F3XA 4UV9A 4RB0A 3HRUA 2FU4A 3WTTC 1O3RA 1J9IA 4G7OF 1USSA 2EWNA 4EM1A 1TLHB 2EK5A 1L0OC 2XAHA 1O3QA 4JK1X 4WXHA 5L3DA 3HIFA 1BM9A 2P6SA 2YSRA 4DQ2A 3KP7A 1RI7A 2Y48A 2IJLA 3C1DA 4Q4ZF 3AAFA 4IHSA 1U6GA 2ZNYA 4NQWA 3M8EA 1TTYA 2M87A 3P9IA 1TQPA 4FX0A 4ESJA 1I1SA 3ABTA 4BHCA 1XDSA 3GFMA 1KU7A 3WTYC 4L9JA 2L3DA 4WXCA 2D2WA 3F22A 2F5DA 3ML6A 3DXJF 1RNLA 2BEOA 3IKTA 2E7XA 3RDIA 2D1HA 2P4WA 4ZZDA 1REPC 4Y13A 2OQRA 1OR7A 2MH2A 3C3WA 4L9NA 4EJUA 3PQJA 3FX3A 3QPHA 3I59B 3MAJA 5L3FA 4B8XA 3WTUC 3B02A 2LDUA 4GYGA 5BOXA 3KFWX 5HDKA 3J81K 4RGRA 2VBZA 4OOIA 2JPBA 2AXLA 2O3FA 1KQ8A 5LHIA 5KVRA 1RIOH 2AS5F 2FOKA 4RB3C 5FD5A 4A12A 4MTEA 2ZFWA 4KIBA 3I54A 3LAJA 2DW4A 1HW2A 2ZNZA 1XN7A 1R5HA 3S2WA 4P5OA 1I1GA 3E3VA 4LK0F 5CVUA 4D0PA 3HYIA 1U5TB 2L4AA 3JAMZ 1TNTA 2EV6A 2M45A 4U7BA 5ERIA 3IWZA 4HDUA 2X4HA 4XLPF 1ZG5A 2LNBA 5LGNA 3GWZA 4B09A 1A04A 3GZ6A 1O57A 1B9MA 4ON0A 4Q47A 1WQ2A 2YU3A 4ZYHA 3WG9A 4UUVA 3LA2A 5FGMA 2V1DA 2VT3A 3TDZC 4LB5A 2FBKA 4HOBA 4RB2C 2Z99A 5CVVA 1ON1A 3E97A 3EETA 3HHHA 3IRRA 1MDMB 4EJWA 3C7JA 3FMRA 5E1WA 1HXDA 3QP6A 4G8XA 4CO8A 2CFXA 1P4WA 3V8LA 1UCRA 3TKYA 2NNNA 4MEYF 5H20A 3GLXA 2OU2A 5CLSA 4RGXA 2XASA 1B9NA 2EFQA 2KJBA 3HTUA 2QYOA 3M9AA 3IHUA 2ZMEB 3ZP5A 3ROUA 1IN7A 1BOAA 3FXUA 3F8BA 1SD7A 4N9IA 2FEZA 5EEGA 1W7PA 3HRTA 3QRFF 2HWVA 2FBHA 2Z5UA 3GO5A 3E5UA 5J8FA 1BI1A 2VE8A 1P6RA 4LMYA 4QLCU 1Z1DA 4G6QA 2F5EA 1OYWA 2CQKA 2A5YB 2DFIA 3FM5A 5E18F 4ZYGA 1IXCA 1IXSB 2EFWA 1J5YA 3GX4X 3J7AO 2RDPA 2OA4A 3R0JA 2CGPA 1KU2A 2VT2A 4U0VA 4M9ZA 5JR3A 2EA2A 4YFNF 2XIGA 1YYVA 4N9HA 1IN4A 5HOOA 2FRHA 5H6RA 2QVOA 4MEXF 3HOSA 3FXRA 5JFRA 5DD4A 3R61A 3U2RA 2FBIA 1SD6A 4HX8A 2K4BA 1FLIA 1UB9A 3D0SA 1U3EM 2CYYA 2HOEA 2LKPA 2A6HF 2L01A 5L3GA 3I58A 3ZN0A 2H6CA 1T39A 1SD4A 1TQMA 2A07F 2O61A 1ULYA 1BN5A 2PMUA 3VB2A 4R8HA 2W25A 1QZZA 5K5OA 2GA2A 5DCMB 2HQRA 3FMSA 3GFJA 2VBYA 4MQVA 3M1EA 4LG0A 3SQNA 1ZGAA 1LNWA 2O6GE 2V9VA 4U88A 5FFZA 2FXAA 2W24A 2DQLA 4ETSA 2DO7A 4BXUA 2GA1A 1J2XA 1G3SA 5LRSA 4H0EA 1XD7A 4I7HA 3PQKA 2QQBA 3RI4A 3B73A 2K27A 1ZARA 1K78B 1ON2A 2BE5F 3OV8A 2HS5A 1BC8C 3SHFA 2DPDA 4CYDA 4M6XA 2HYGD 2MC3A 1FBUA 2DPUA 1OPCA 2ZKZA 1T38A 4OIPF 1FSEA 3GVAA 1ZREA 4U0YA 2R3SA 4I0BA 2XAQA 5D5WB 2EFPA 1BIBA 3SFZA 5DV5A 1HBXG 2XROA 2PJPA 2OAZA 1HW5A 3TO9A 3IL2A 2XAJA 3V8KA 4Z2YA 1X3UA 4KICA 3L00A 4MNUA 5BMZA 3GUDA 3N4MA 4PCQA 3BZ6A 3FWEA 3TGNA 3R60A 4EM2A 2XV4S 2BYVE 2V1XA 2F5CA 3GEZA 1YS7A 3DFGA 5LGUA 2OD5A 2NYXA 3F72A 1Q1HA 4Y15A 1FP2A 1R23A 2OBPA 1FBQA 2DBBA 5JI6A 3FXQA 5BPIA 1HSTA 1CF7B 1UFMA 3P9KA 4HF0A 3F23A 1LVAA 3C18A 3J80K 1W4MA 1W7PD 2H94A 4RB1A 2J5PA 5EEHA 2Y0MA 4Q48A 4M72A 4HYEA 3KP2A 2XAGA 4CXFA 3CO7C 1KU9A 1V3FA 4EMSA 3MFKA 3Q5FA 2M30A 3CJNA 2IP2A 3HRMA 5FLXZ 3CUQA 1W7PB 3QOPA 5DCFA 5TRDA 1DDNA 1U8RA 3CTAA 1B59A 2DK5A 3EDPA 1J7KA 2IA2A 4LLLA 3V7SA 4RS8A 2NNYA 4O6JA 1YW9A 1Z6RA 4XSXF 1MGTA 4G94A 2KKOA 5DUIA 1P4AA 4ENMA 3F8FA 5BQTA 4ESBA 1PP8F 4RGSA 5D5XB 3I0TA 4IJAA 3J81Z 4UXNA 1MDMA 4M71A 3CUQB 5LHGA 1FYKA 1EV7A 2EB7A 2CWEA 3WTWC 3IWFA 2P5VA 1LEBA 1I27A 4GGGA 4GO1A 2FE3A 4OIOF 3HUGA 3V7RA 1EH8A 3KETA 5LGTA 3M8FA 2IVMA 2FMLA 2BV6A 1CF7A 2RN7A 2YR2A 1FWZA 5D5VB 2STTA 4JQFA 1QO0D 2GXGA 3D5LA 1RZ4A 2NS0A 2PEXA 2QZ8A 4Q5SF 3SZPA 4A0ZA 5AONA 1U5TA 3WE2A 3E6CC 3Q9VA 4P9FA 3E6MA 3W6KB 3BJOA 4L0ZB 1FT9A 2OZ6A 2P5LC 1YFHA 2WV0A 2DI3A 1PP7U 3I5UA 5ILVA 1OYYA 3DEUA 2P5KA 2DAOA 4KN4X 2H09A 5D4RA 1YQAA 3MQ0A 3VFZA 1T0FA 2LF8A 3OOPA 1Z05A 1DPRA 4ZZLA 5BS6A 3QAHA 4L5IA 4P55A 1JHHA 2FNPA 1IN8A 1KQ9A 3HTSB 5KK1A 2KIMA 1J0RA 1Y0UA 2E7WA 5E1XA 4EJTA 1HQCA 1LJ9A 3I59A 1SFUA 2L4MA 4R1HA 1R1TA 1CGPA 5F6FA 4ENNA 4R79A 3EQLF 2A6EF 5HS7A 4HW0A 1LQ1A 4EJVA 1J59A 2G9WA 5CVJA 1QPMA 3EUHA 4NB5A 1RUOA 4HAMA 4HV6A 1IAWA 1K78A 2J5OA 1D8JA 5E8IA 4JBAA 5HDNA 4CDGA 1XMAA 3FF5A 2HQNA 2L54A 5AIQA 4YFXF 2ZBKA 3JW4A 2ELHA 4AVPA 3P9CA 5D8LB 2ESHA 2Q0OA 4G7HF 4LG0B 4KFCA 1XSDA 2M1BA 3KP4A 3DP7A 3WTZA 3BPXA 3TOAA 5DCMA 1XMKA 3I71A 2R7DA 2A3SA 5HS9A 1B6AA 4HV5A 2XAFA 4LFUA 1IN6A 4NHJA 1O3SA 5IT3A 3TDUC 3KP6A 1TNSA 3T8TA 3K1NA 1ONVA 1T2KA 3ECHA 3RPQA 2HTJA 3RPUA 4U0WA 2KRFA 4CICA 5A2QZ 4LJZF 2GZWA 3R6SA 1DUXC 1YW7A 1G6NA 5LLQA 2XUBA 4FHTA 1W5SA 5DUKA 4M9XA 2PLYA 3KZYA 3WTXC 4HZFA 4KDPA 2E1CA 3RTRA 4LD5A 4OMYA 2PG4A 2PBIA 3ZMVA 5A2QK 1YG2A 3KLOA 4HQMA 2D45A 1H9TA 4CHUA 4L0YB 2WC2A 1YS6A 2M5WA 1GXQA 2QQ9A 3ZMZA 3REOA 2HKOA 2DU9A 2MBFA 5DDGA 2GWRA 2IT0A 1IF1A 4PGHA 5AIPA 1NHAA 1XSVA 3F8CA 5F64A 1SFEA 4HLXA 2ZMEA 4YG2F 2ZO4A 1WWXA 3KE2A 1G3WA 4MHGA 1O3TA 2VE9A 3I64A 5ICEA 3MZYA 4EGYA 1USTA 5K5QA 2G7HA 2JRTA 2FNAA 3COAC 1AWCA 4OIRF 3QP5A 1K7AA 4OIQF 4HA8A 2YPRA 1IW7F 4XSZF 1ODDA 4UVCA 1YO5C 2EFOA 4IRIA 4M6YA 4K2EA 4KIFA 4BHPA 4F7ZA 4A5MA 3K69A 3JSPA 3U1DA 3R4KA 3V7CA 1MJ9A 2X0LA 2VBXA 2P7VB 4AIHA 4G9YA 3T8RA 5K1YA 5FD6A 5H6QA 1XGNA 3L09A 1XCBA 2MH9A 5CYVA 1G4DA 2FA5A 3E6DA 2RKHA 3NEUA 3MEXA 4YFKF 1BI2A 5ICFA 4ZYEA 4KMFA 4EGZA 4EJOA 3L7WA 3MZHA 3H92A 4ZYDA 2MLKA 2YX7A 2EV5A 3I53A 4UV8A 4WX9A 3CUQC 2DTRA 3G73A 4M74A 1H0MA 3WTSC 3RIRA 4IRGA 3LA7A 3HSEA 1H9GA 3WU1B 2EJRA 1QGPA 3IKVA 2IW5A 1HKTA 5ED4A 4G7ZF 1ZRCA 4FT8A 3T0YA 2UXNA 4XRFA 3NRVA 2B0LA 1GHCA 5D8KB 1SMYF 4S05A 2DQRA 4BAYA 2W84A 3GXOA 1R7JA 1ZG1A 2JPCA 2K02A 1K79A 2HEOA 4HF1A 6PAXA 2R7FA 1T6SA 3DPTA 3WE3A 2Z3YA 2VC0A 1ZYRF 2H27A 2LSOA 3F6VA 4WF2A 3M7GA 4O5VA 2A68F 1FPQA 4GCVA 3WGGA 1FOKA 5ICCA 2H6BA 5J8CA 3JTHA 3EYYA 1WI9A 3LWFA 1FZPB 4BNCA 1SMTA 2ACJA 1XSXA 4FX4A 3HHGA 1XCVA 2XGXA 2PN6A 2M8EA 2XKOA 5JHUA 2V6CA 1FX7A 1LDJA 2CG4A 2ADUA 4TV7A 4XLNF 4G6DA 4GXOA 4GYIA 2ZJ2A 3LAPA 4EM0B 1MJAA 3WGHA 4HX7A 4LGWA 5LHHA 2FF4A 1HW1A 4BHBA 2IPQX 5DEQA 5DYMA 4L5JA 1YIOA 3BPVA 3JAMK 1BI0A 5LRRA 4BQAA 2RGVA 1G3YA 2TDXA 2GQQA 2W85A 2VODA 3CLOA 5IT9Z 1TW3A 2QM3A 3ZMTA 3QPTA 3ZMUA 2Z33A 5L3EA 1OKRA 2HYFA 4PDKA 3V4GA 2FMYA 1FBSA 4S04A 3KCCA 1LEAA 3LFKA 5FB2A 4LLGF 5HS8A 4P9UA 2HR3A 4P96A 1PUEE 3DPLC 5J6XA 1ZGJA 2YX4A 1IRFA 1JHFA 5HVQC 5L3CA 2E1NA 4RAYA 2VOOA 2QBYB 5D5UB 1RUNA 4LLNA 3ZQ7A 1Z6TA 1JXSA 3JSOA 4A0YA 1MD0A 1YTYA 2K4JA 1TQIA 2XKPA 1WKMA 4OINF 2PFBA 2RVCA 3E5XA 2UWMA 2IA1A 3ZN1A 3DQVC 2JSCA 1FNNA 5CVRA 2W57A 1S3JA 2EV0A 1R5GA 4E70A 5BPDA 1J75A 3RYPA 2QLZA 3K9TA 4EV0A 1W5TA 3P7NA 4UVBA 5L3BA 1F4KA 4WWCA 5D4SA 3F21A 4I02A 2MLGA 3BOQA 3G3ZA 1KQ0A 1R58A 2C6YA 3L9FA 4CZZA 4KYWA 3BROA 4KUMA 1LDDA 3WTVC 1E17A 4HBLA 1IXRC 1STZA 1QNTA 1SFXA 3KEOA 1ZN2A 4ENJA 3KLNA 3FHZA 4IVNA 4PZJA 2ZXJA 1BJAA 2K86A 1XGOA 1O7LA 5CJ9A 1G3TA 1TW2A 3E5QA 5JVTA 3TOBA 3L2CA 2NRAC 3CO6C 3RKYA 3T5XA 1MZBA 1B4AA 1ZRDA 2PQ8A 2MD5A 2ISYA 2KJCA 2XHKA 3BJAA 3W6JB 4AWXB 4EQQA 4ENKA 2CSOA 2A69F 2KIUA 3BY6A 5E1ZB 5F1RA 4UHTA 1P4XA 1F1ZA 5FFXA 2HZTA 2DK8A 1WRJA 3ZMSA 2VONA 3O2PE 1D8KA 1F5TA 3TQNA 1EH6A 2O8XA 2KIFA 1ZG3A 5E8GA 3U9GA 2BBYA 2P6TA 1UHMA 2GXBA 1LDKB 4ESFA 4CGZA 1KA8A 1S6LA 3KEQA 3I4PA 4IPAA 3SZTA 4L9VA 1JE8A 4HF2A 3LQRA 1QBJA 1K6OA 2Z9OA 2IA0A 3RYRA 5LBQA 2UXXA 3NQOA 4I98B 4YIIA 3WGIA 1HKSA 5E17F 1S7OA 3K0LA 4KN7X 4A2UA 3Q9SA 1T98A 3J80Z 4AIKA 3VODA 1MJBA 4HX4A 2GIVA 5HLIA 3IRQA 1R22A 4AIJA 1C0WA 1P2FA 3ERED 1SAXA 2V79A 2QBYA 4A6EA 5E20A 5FO5A 1DP7P 2FQ3A 2RC4A 5FLXK 1O7FA 3HSFA 3ZPLA 1U5TC 3GF2A 4OU0A 1YW8A 1MKMA 5D6EA 1TBXA 3BP8A 4MQ9F 5HLHA 2Q2EA 4M9SA 1AOYA 4MGRA 2GAUA 3ABUA 2VBWA 3R0AA 1FY7A 1ZHFA 1ZAOA 1WSUA 3BDDA 1XDUA 3RKWA 2K7LA 5HLGA 2F5FA 4MTDA 3GZ5A 1B1BA 4KIGA 4LB6B 3BJ6A 2OQGA 5ILUA 2DLLA 3JTGA 4ASNA 3N97A 2O0YA 4IHTA 3MCZA 2HKXA 3IC7A 3KZZA 1ZLKA 3SXYA 3ISPA 3LA3A 3V8JA 3WU0A 3WODF 5D6FA 5HDGA 4U7DA 4KT5C 2IRFG 1FP1D 1IUYA 3KP3A 3HSRA 4XBFA 1EH7A 4I01A 1PDNC 4YIFA 1R36A 1DPUA 1BC7C 1L3LA 2P7CB 5LEJA 3KP5A 5LEKA 2QENA 2O03A 3LSTA 2F2EA 1E2XA 4KMUX 4DNCA 2RV8A 4HLYA 1ZRFA 2HFHA 1OMIA 3E6BA 4L18B 4IXAA 2JT1A 3HOTA 2Q8KA 2VOPA 2UZKA 1S8NA 4RAZA 1GXPA 2STWA 4HQEA 4LK1F 1YLFA 3ELKA 4WXDA 4I2OA 1KYZA 1KYWA 1QQIA 2XRNA 1VTNC 2ETHA 1KGSA 4EVIA 4WK8F 1D3YA 4Y17A 5ICGA 1Z9CA 3TO7A 2V1UA 5CVIA 2RQPA 2A61A 3K1MA 3RKXA 2ESNA 2HTSA 2P8TA 2PMHA 1HKQA 3TO6A 2D1VA 2L02A 3ECOA 4OMZA 1U2WA 2LF7A 3K2ZA 1F9NA 2XVCA 1IN5A 3GFIA 2QQAA 3BWGA 3DF8A 2JZYA 2G7UA 4AD9A 3T1BA 2OZUA 2DT5A 3FM3A 4RGUA 3HRSA 3QU3A 3DKWA 2HDCA 4UVAA 3FMQA 1JGSA 3VOEA 3ULQB 1S29A 2ISZA 3CDHA 1UHWA 3H3ZA 1GVJA 2BGCA 4A5NA 1LB2A 1R1UA 5TJJA 1I5ZA 1Z7UA 3F6OA 2HGCA 2QWWA 4I09A 5K5RA 5IT9K 5ILSA 1U78A 4PGGA 1SD5A 3H3UA
chains in the Genus database with same CATH superfamily
2QEXI 3O3KA 3K4JA 1KU3A 1J09A 2COBA 2KLOA 3QPSA 1I6XA 1QZYA 2VXZA 2WTEA 1OISA 4MFEA 2ZCWA 3VEPA 1ZLJA 3RJPA 1S7AA 3KYCB 2K9QA 1BBYA 3FBIB 4A3JJ 1ETVA 1HSJA 2QQ8A 2HVRA 3QU6A 3CUOA 4KA4A 5BNGA 2L7MP 2MYSA 3GFLA 1A6QA 3ZMDA 1XGMA 2W7NA 3PJRA 2LK2A 3GYHX 1WVRA 1VQOI 4KNYA 4PK4A 3ONQA 1P92A 2JTVA 1V4RA 4M73A 3ASOH 2WA0A 2CUFA 2L9VA 4NC6A 5GTHC 3VYTB 2OCEA 4JOMA 4HG2A 4LOCA 2CW0F 3K1PA 1BI3A 2FSWA 3FZVA 3JREA 4IHXA 5FKOA 2RNJA 2QUFA 1FC3A 3LQQA 4WCGA 3SZGA 3IH3A 1VQ9I 1IDZA 4HNVA 2EFNA 4A0XA 5K7ZA 1JJ8C 2V6EA 4A3LJ 3JRGA 1HA8A 1IZ1A 1VF9A 4N0BA 3CCLI 1IRGA 1AA7A 2UV1A 2WY8Q 1FSHA 1D5VA 5DD8A 4IF4A 3LSMA 1X1PA 2VXDA 2ID3A 3PFIA 2PI0A 4BH9A 4I0AA 3DV8A 1LVKA 3AKZA 1R1VA 2WWYA 1FYLA 1FYMA 4I76A 5M5WJ 1ZH5A 3GW2A 4BU2A 2EA4A 3O6BB 3K4MA 4AUXA 3W3CA 4IRHA 4O3MA 1XB4A 2M9HA 4L9TA 1MW7A 2NAZA 3PUFA 1WJ5A 3L2WA 3F8NA 2GBYA 4G6TB 3K4BA 4B1RA 4A3FJ 1MSEC 4A6DA 3DCFA 2VN2A 3EYIA 1NG6A 2CFOA 2IAIA 3F8MA 3SEQA 1TT5B 4QWQA 2F48A 2W48A 2MA3A 2VUMJ 2COMA 2MABA 4BBSJ 1BIAA 4HDVA 5B66C 2R0QC 1X58A 2CO5A 2EPFA 3MWMA 2BY2A 3ZQHA 5J4VA 1R00A 1XGSA 4JX4A 3TMOA 4HRIA 1OYIA 2IBDA 4XKBA 2DCEA 4UNOA 3ZXSA 1Z91A 2ZB9A 4ZH4F 2Y75A 2VC1A 3K6GA 3F3XA 3QYEA 4BYYA 2HPMA 4UV9A 4RB0A 2E2JJ 3HRUA 5EG0B 4BS9A 3CCRI 4UUTA 2ECCA 2GIZA 5EDNA 2R5ZB 2FU4A 3WTTC 1O3RA 3H35A 3EPZA 2LH9A 1J9IA 4G7OF 4PJJA 1ITYA 1USSA 2EWNA 4EM1A 2R7XA 1TLHB 1X4PA 2EK5A 1L0OC 2LKXA 2XAHA 2E1MC 4FISA 3M8JA 1O3QA 4LIUA 2DT6A 3PSIA 4JK1X 4WXHA 4F91B 5L3DA 3IH2A 1BA5A 4YEJA 1JUSA 2OTLI 1JT6A 3HIFA 3RKQA 3CCQI 1BM9A 2CS3A 3KPHA 2WB1N 4J01A 2L9NA 4C2MJ 2P6SA 2YSRA 4A3CJ 4DQ2A 1MBJA 3KP7A 1RI7A 2Y48A 2IJLA 3C1DA 4Q4ZF 1ETQA 3AAFA 4MO7A 3JRFA 4IHSA 1U6GA 2ZNYA 2EIKH 4NQWA 3M8EA 1TTYA 2M87A 1R6RA 3P9IA 1TQPA 3H5RA 4FX0A 4ESJA 1I1SA 3ABTA 2DA7A 4BHCA 3QYBA 3IP4B 1XDSA 3GFMA 2WAEA 1KU7A 4BE2A 3WTYC 4ZJZA 4L9JA 2L3DA 1X2NA 4WXCA 4XLFA 2D2WA 3OIPA 3F22A 3E7LA 2ZJPF 2F5DA 3ML6A 3DXJF 4ZTJA 4Y7NJ 1RNLA 2BEOA 3IKTA 2E7XA 3RDIA 1WZ2A 2D1HA 4UY8I 3ZQCA 4CCMA 2DMNA 1HDPA 2P4WA 3FISA 4ZZDA 5K7FA 4JP0A 4Y13A 2OQRA 1REPC 1VZ0A 1OR7A 2MH2A 3C3WA 3OYKA 3ZGKA 4UUSA 4L9NA 4EJUA 2DFFA 4AIDA 3PQJA 3FX3A 2JUCA 3QPHA 4RLQA 3I59B 3MAJA 3LNQA 5L3FA 2CQNA 1I50J 2F6CA 2FQ4A 5IP9J 2R7SA 4B8XA 3S17J 3WTUC 2DMPA 3RPUD 3B02A 2LDUA 3G6EI 4GYGA 2A05A 2FX0A 3CD6I 5BOXA 3KFWX 5HDKA 4XR6A 3J81K 4RGRA 2VBZA 4OOIA 5CQEA 2FOWA 2JPBA 2AXLA 4MFDA 2MW8A 2O3FA 1KQ8A 2R93J 3NARA 3G1OA 1Y6IA 5EEAA 5FROA 5LHIA 3HPHA 2XF5A 2VQLA 4MIMA 5KVRA 4CUGA 1RIOH 2AS5F 2FOKA 5C4JJ 2XF7A 4RB3C 4AYBA 5FD5A 2HPIA 2E2IJ 4A12A 4MTEA 3ASNH 5TGTA 3G71I 3CF2A 2ZFWA 3S15J 1PYVA 1QPIA 4KIBA 5GP9A 3I54A 3OYJA 3LAJA 2DW4A 1AKHB 5F27A 1W5CC 3S32A 3ZRGA 5DM6F 1HW2A 3U21A 1RKTA 2ZNZA 1XN7A 1R5HA 3S2WA 2GXAA 4XOTA 1LFUP 2LC2A 4P5OA 3GTJJ 4CH7A 1I1GA 3E3VA 2R92J 1TL8A 4LK0F 4E7IA 2CMPA 1G2HA 2CJJA 2UUZA 5CVUA 3L2RA 2KQRA 4D0PA 2Y0SN 2PX9A 3HYIA 1U5TB 2L4AA 3JAMZ 1TNTA 4G12A 5GPCA 1OCCH 1A5JA 2PMZA 4F92B 2EV6A 2M45A 3S1NJ 2Y31A 5DS9A 4U7BA 5ERIA 2DOAA 2EBIA 2KZVA 3A02A 3IWZA 4HDUA 2XC7A 2X4HA 4XLPF 1MMNA 1ZG5A 2X6XA 2LNBA 5LGNA 1UHSA 3GWZA 1A6IA 4B09A 3HOYJ 2L9RA 4PJLA 3CMYA 1A04A 3GZ6A 5JLWA 1I39A 1O57A 1B9MA 4ON0A 4Q47A 1VI0A 1WQ2A 3QWLA 2CV0A 4XRSG 2IGNA 3HOVJ 2YU3A 4ZYHA 2I8DA 3WG9A 3ZQIA 4UUVA 3LA2A 5FGMA 3PM1A 2V1DA 2VT3A 2WB1A 4XM3A 3TDZC 4LB5A 2FBKA 4HOBA 4RB2C 2CRGA 5TISC 2Z99A 1D0XA 1X2MA 5CVVA 4HNUA 1ON1A 2I5UA 3MKZA 3E97A 3EETA 3HHHA 3IRRA 1Y39A 1MDMB 3HXLA 2KIQA 2KISA 4EJWA 5FJ8J 3W2VA 2DYSH 3C7JA 3FMRA 3HPGA 1SFKA 3KIOA 5E1WA 1HXDA 5E3LA 3QP6A 3EUAA 4EATA 5DTDA 4G8XA 3GTQJ 4IO9F 4CO8A 5C4XJ 2CFXA 1P4WA 4PSWA 4A93J 1D1AA 3V8LA 3MKYB 1UCRA 4AU7A 1B8IA 3TKYA 4D5FA 2NNNA 2IS1A 1XC5A 4MEYF 2HVSA 2DJIA 2XPVA 5H20A 2CW7A 2LG4A 3GLXA 2OU2A 5CLSA 4RGXA 1T95A 2XASA 1B9NA 3FDYA 2EFQA 2KJBA 3HTUA 1FJLA 2QYOA 3M9AA 3IHUA 2ZMEB 3OOUA 2MG4A 3ZP5A 3ROUA 3DTIA 1BOBA 1BJZA 1ETWA 1IN7A 3LSPA 1BOAA 3FXUA 3F8BA 1SD7A 4N9IA 2FEZA 3PNVA 5EEGA 1W7PA 3HRTA 2JA6J 1GUUA 2MSYA 3QRFF 1IV8A 2HWVA 2A6TA 2FBHA 4DBRA 3N05A 4BEHA 2E19A 2Z5UA 3GO5A 5E3OA 1YJ9I 1E3OC 3E5UA 4F93B 5J8FA 1BI1A 4F55A 3ABMH 3ZQFA 2VE8A 1P6RA 4ZDOA 4LMYA 4QLCU 5F04A 1Z1DA 2BVMA 3H0GJ 4G6QA 2F5EA 1OYWA 1ZK8A 2CQKA 2A5YB 2DFIA 5LFAA 2KPMA 3KX2A 3FM5A 4ZYGA 5E18F 1IXCA 1IXSB 2EFWA 2OCCH 1J5YA 3CCJI 4HSTA 3GX4X 3A0BC 2HYJA 3CCEI 3J7AO 2NOGA 1EF4A 2RDPA 2OA4A 3R0JA 2CGPA 1KU2A 2VT2A 5KAIC 4U0VA 4M9ZA 5JR3A 4FE4A 3GLLA 1VQ7I 4RMNA 4YIRX 4BUPA 1JI8A 2EA2A 4YFNF 3AG4H 2XIGA 1YYVA 4N9HA 1IN4A 5HOOA 3VPRA 2HDDA 3GTGJ 4E7SA 2FRHA 5H6RA 2NOJB 2QVOA 5FLMJ 3CLQA 3BR3A 2M7AA 3HOSA 4MEXF 3FXRA 3VYRB 5JFRA 5DD4A 2HDWA 3R61A 1UELB 2EINH 3U2RA 1JTYA 2FBIA 4BQOA 2HOAA 1SD6A 2FJ1A 4HX8A 2K4BA 1FLIA 5K7HA 1UB9A 3D0SA 2GOXB 2CYYA 1U3EM 2HOEA 1O4XA 2JA5J 2LKPA 2A6HF 2B7EA 2L01A 1YE9A 5L3GA 1QA6A 4BGDA 1XG1A 2LTPA 3I58A 3ZN0A 3UNGC 3S2DJ 2H6CA 3PO3J 3GCMA 3QOEA 1T39A 1SD4A 1TQMA 2A07F 3CCYA 5E79C 2O61A 1ULYA 3CC4I 1BN5A 2M0MA 2PMUA 1TWHJ 1I3AA 2EZKA 2M8GX 3BR0A 3H9JA 2W25A 4R8HA 3VB2A 1QZZA 1FOWA 1OCTC 4X1EA 1UJ8A 5K5OA 2R4GA 2GA2A 5DCMB 2HQRA 3X2QH 3FMSA 1BR1A 4KISA 3GFJA 2VBYA 2MGQA 4MQVA 1TZLA 2PJRB 1ETYA 2QSFX 3M1EA 3BTJA 4LG0A 5FKKA 3OL4A 2WBMA 4CCLA 3DU5A 1T8IA 2YS9A 4A3IJ 1OFCX 2K85A 3SQNA 1ZGAA 1LNWA 2O6GE 2V9VA 4U88A 5FFZA 2FXAA 2W00A 2W24A 2DQLA 4ETSA 2DO7A 4BXUA 4BXFA 2GA1A 1J2XA 1X4OA 1G3SA 5LRSA 1ZELA 2V26A 4B48A 3S93A 2XSDC 4H0EA 1BW5A 1XD7A 4I7HA 4DBQA 3PQKA 1PJRA 2ME0A 2QQBA 3RI4A 1FEXA 1YITI 3B73A 2K27A 2DA2A 1ZARA 1K78B 1ON2A 2JUGA 4RAFA 1NG7A 2BE5F 3OV8A 4CYCA 2E35A 3CESA 1X1CA 2HS5A 1BC8C 4CYCB 5GPAA 2OC6A 2Z1DA 3SHFA 3JRCA 2DPDA 4CYDA 3A4CA 4M6XA 2HYGD 2Y2ZA 3HC7A 2MC3A 1K4SA 1FBUA 2DPUA 1OPCA 1RETA 2ZKZA 1T38A 1APLC 3L2UA 4OIPF 1FSEA 3GVAA 1ZREA 2DDAA 5EGOB 4U0YA 3S8PA 5B5EC 1U8BA 2R3SA 5E3NA 4I0BA 2LREA 2XAQA 2ZXWH 4XICA 2BXYA 5D5WB 3TW6A 4QIWN 3B6CA 2E2HJ 2EFPA 1BIBA 5CKTA 3SFZA 3DTKA 3O8GA 5DV5A 1HBXG 2XROA 2PJPA 3ZR8X 2OAZA 4B43A 1HW5A 2QSHX 3MVPA 3TO9A 3IL2A 2XAJA 3V8KA 4Z2YA 4M3DA 5HNFA 1WH7A 1X3UA 4KICA 1JKQC 4W1UA 3BG5A 1X1DA 2X51A 4I6ZA 3L00A 1ETXA 4MNUA 5BMZA 2MFZA 2IS6A 3GUDA 1Z67A 4BACA 3OYIA 3N4MA 5LD2C 4PCQA 2OUMA 3BZ6A 3CJQB 3FWEA 3TGNA 4ANJA 3HEFA 3R60A 3MN2A 2VB6A 3FIWA 1R4NB 3CCVI 4EM2A 2XV4S 5J4YA 1TT0A 1AHDP 2BYVE 3OYAA 2V1XA 3NWTA 2F5CA 3BR6A 3GEZA 2JVGA 5JVGF 2BZTA 2EZIA 1YS7A 3DFGA 5LGUA 3TEDA 1Z7LA 2LY1A 2OD5A 2IGMA 2NYXA 3DEWA 2NVTJ 3F72A 1Q1HA 1YJNI 1MH4A 1W1WE 3S3MA 4Y15A 1JKPC 1NK2P 2W82A 1FP2A 1R23A 2E71A 2KRHA 4IZZA 1UZCA 1BL0A 1VNDA 2OBPA 4BQQA 3H9GA 1FBQA 4E7ZA 2DBBA 5JI6A 4XLHA 3AL0C 3FXQA 3OYCA 5BPIA 3MMYB 2HQ5A 1HSTA 3C2HA 1CF7B 1UFMA 2OV7A 3P9KA 4HF0A 1B72A 3B6AA 2R7ZJ 3OS2A 3F23A 1LVAA 3DU6A 1MNEA 4JX6A 1QU3A 2F5VA 2XB5A 3C18A 3J80K 1W4MA 1OR7C 1W7PD 2NS8A 2H94A 4RB1A 2H8WA 2J5PA 3OL3A 2Y0MA 4Q48A 5EEHA 1UMQA 3HUGB 4M72A 3QPLA 3DLAA 2DMQA 2R7UA 4HYEA 3KP2A 3JRDA 1GVDA 2XAGA 3A03A 1OCOH 4CXFA 3CO7C 1KU9A 1V3FA 4EMSA 1VQPI 3HGGA 3MFKA 3Q5FA 2R7OA 1W0TA 2M30A 3CJNA 2IP2A 3HRMA 5FLXZ 3CUQA 1W7PB 2W4SA 1IRXA 3QOPA 1SVLA 2KP6A 5DCFA 4FE7A 4C3IJ 5GAHJ 5TRDA 1DDNA 1MMAA 1U8RA 3CTAA 1B59A 2DK5A 3F0CA 3FXLA 5EZGA 3EDPA 1J7KA 2IA2A 4LLLA 1VQ8I 1OCPA 3V7SA 4RS8A 2NNYA 4O6JA 2H8RA 1YW9A 1Z6RA 4XSXF 3PFYA 1MGTA 4G94A 2KKOA 4XONA 1B8IB 3H3VK 5DUIA 1P4AA 3C2BA 5FKLA 4ENMA 2VJ4A 2LY2A 3F8FA 5BQTA 4ESBA 1PP8F 1XTAA 4RGSA 5D5XB 3I0TA 3OR1C 2DA3A 4IJAA 4C30A 3VWBA 3J81Z 2EIMH 3S1QJ 4UXNA 3PO2J 1MDMA 4M71A 3CUQB 5LHGA 3BR5A 1FYKA 1EV7A 3MD2A 2EB7A 2CWEA 5J1UA 3WTWC 3IWFA 4V2GA 2QA4I 2P5VA 3SYTA 1LEBA 2G0EA 1I27A 5KAFC 3OS1A 4GGGA 4GO1A 2FE3A 4OIOF 3HUGA 1Y0NA 2WY7Q 2DA6A 1TP4A 1R71A 3V7RA 1EH8A 3KYDB 3KETA 5LGTA 2R7WA 1T56A 3M8FA 1HDDC 2IVMA 1ZGWA 2FMLA 2BV6A 1B72B 2M0CA 1CF7A 2RN7A 5FRNA 1SFOJ 5IY5H 2OTJI 2YR2A 1FWZA 1JUMA 5D5VB 2STTA 4HEA2 4JQFA 2EZHA 1QO0D 2GXGA 3D5LA 2O8KA 3WU2C 1RZ4A 2NS0A 2PEXA 2QZ8A 4Q5SF 3SZPA 4A0ZA 3VDXA 2Z2SB 1U5TA 5AONA 3WE2A 1ETOA 3E6CC 2H1KA 3Q9VA 2VKEA 4P9FA 3E6MA 1OJLA 3W6KB 3BJOA 4L0ZB 1FT9A 2OZ6A 1ZQ3P 2P5LC 1YFHA 2DFHA 4XRMA 1W0UA 2WV0A 2DI3A 1PP7U 3NAUA 4AYBN 4BJTA 1FTTA 2O9LA 4DZJA 3I5UA 5ILVA 1ERDA 1OYYA 2VQGA 4JYKA 3DEUA 2P5KA 2DAOA 2M7BA 2H09A 4KN4X 5D4RA 1YQAA 4P1WA 3CC2I 4ZTFA 3CP8A 3MQ0A 3HL2A 3VFZA 2Z16A 3CMAI 1T0FA 2LF8A 4PJ0C 2KL4A 3OOPA 1Z05A 1DPRA 4ZZLA 5BS6A 3OWTA 3QAHA 4L5IA 4P55A 4OAZA 5EF6A 4RBOA 3W2AA 2R7VA 1JHHA 5J40A 4XL9A 1JUPA 4KITB 2FNPA 1BR4A 2KFDA 4IHYA 4A3DJ 3RZOJ 1IN8A 1KQ9A 3HTSB 5KK1A 2Q1ZB 2KIMA 1J0RA 1Y0UA 1Z0XA 4M3GA 4OWRB 1HLVA 1TWAJ 2HNHA 2E7WA 2LR8A 5E1XA 2VJIA 3JRIA 4HPQA 2E5ZA 3K70D 4EJTA 1HQCA 5JLXA 1Z3XA 1LJ9A 3I59A 4B3XA 1SFUA 2L4MA 4BBRJ 4R1HA 4BY7J 1R1TA 1U0JA 3E0JB 5EGOA 3OSFA 1CGPA 5F6FA 4ENNA 4R79A 3S1MJ 3HOWJ 3EQLF 2A6EF 2HU9A 5HS7A 3LSGA 4HW0A 5B1BH 1LQ1A 2FD5A 4EJVA 1J59A 5HLTA 3PNYA 2G9WA 5CVJA 1QPMA 3EUHA 4NB5A 3HJEA 1RUOA 3BQYA 4HAMA 4HV6A 1IAWA 2WV1A 2VJJA 3DKYA 1K78A 3OYDA 2J5OA 1D8JA 5E8IA 1IC8A 1FOYA 5C3EJ 4JBAA 5HDNA 4CDGA 1MH3A 1FMWA 2JJ7A 1XMAA 3ESWB 3QODA 2K3FA 3FF5A 3LMMA 1X3ZB 2HQNA 2L54A 5GAEJ 4L5EA 5AIQA 1RESA 3E1SA 4YFXF 1YJWI 2ZBKA 3JW4A 4S0HB 3L1PA 2ELHA 1N75A 4XKVA 3ZQLA 4NQWB 4GFBA 1WI3A 2ZC2A 2VQHA 2M34A 4AVPA 1MMDA 3P9CA 2DTZA 1LKXA 2BY1A 2VASA 4ITVA 5D8LB 1RR8C 2ESHA 3CJRB 2Q0OA 3BT9A 3CC7I 1LFPA 4G7HF 4LG0B 2CUJA 4KFCA 2OF7A 4CZCA 4Y33A 1XSDA 2M1BA 2PJRA 3IH4A 3KP4A 3DP7A 4N4OB 4IX7A 2IS4A 1X1BA 1DU0A 3WTZA 1FMVA 2XRLA 3BPXA 1SVMA 3TOAA 1OQYA 5DCMA 1XMKA 2O7OA 3I71A 1BR2A 2I10A 2A3SA 2R7DA 1K61A 5HNHA 4RDUA 5HS9A 4BY1J 3FXMA 1B6AA 3Q0UA 4ZC3A 2LFBA 4HV5A 2XAFA 4LFUA 2L9SA 1IN6A 2X6OA 4NHJA 1O3SA 3IUOA 3NWSA 2JSPA 5IT3A 1LUJB 3TDUC 2VPRA 3KP6A 4ZDPA 1TNSA 3S16J 1WPKA 3CCMI 1QVTA 2X1DA 1RKWA 3K1NA 3T8TA 1ONVA 1T2KA 3ECHA 3CQZJ 3GBGA 3MKWB 3RPQA 2HTJA 4AVZA 2V9KA 1PVEA 3RPUA 2RQQA 3OR2C 4U0WA 5IYDJ 2KRFA 5IOYA 4FETA 2BXZA 4CICA 2PMZN 3V42A 5A2QZ 4LJZF 2F4MB 2GZWA 3R6SA 1DUXC 1YW7A 2K9SA 1UG0A 1G6NA 3CMEI 2XSJC 2GOMA 4PJMA 5LLQA 2XUBA 2VKHA 4FHTA 2VQCA 1W5SA 5DUKA 1X3WB 3Q0VA 4M9XA 4QTRA 2PLYA 3KZYA 2M3AA 1R49A 1XS9A 3WTXC 2V7FA 3HKZN 4M3EA 4D5CA 4HZFA 4KDPA 2E5NA 4OAYA 3RTRA 2E1CA 3OY9A 4LD5A 4BL0B 4OMYA 1VQ5I 2PG4A 2PBIA 5EYRA 3OS0A 3ZMVA 4YELA 4IL6C 5A2QK 5GADJ 1YG2A 4RLFA 3KLOA 2NVXJ 4HQMA 2D45A 1H9TA 1VQLI 2XF6A 4CHUA 3MZ8A 3CF5F 3BC8A 4L0YB 2KDOA 2WC2A 4NUBA 1YS6A 2V1NA 4FTHA 2M5WA 1GXQA 2BOLA 2QQ9A 3ZMZA 4MLOA 3DLLF 5J3LA 3REOA 2HKOA 2DU9A 2MBFA 4IQ4A 5DDGA 1K83J 4J19A 2P81A 3W2WA 3AL0B 2GWRA 2LP0A 2KRCA 2IT0A 5EZHA 3BLYA 4BEHB 1KONA 2K5CA 1IF1A 2A5WA 3GTOJ 5J1YA 1U9NA 3TW7A 3SEZA 4Z6YA 5FLVA 4PGHA 4XN0A 5AIPA 1ENHA 3DBRB 3GTMJ 3JCUC 1NHAA 1XSVA 3F8CA 5IYBJ 5F64A 3S14J 1SFEA 4II3A 4HLXA 3FHNA 4IHWA 3Q0WA 2ZMEA 3HBLA 4LITA 3ABLH 4YG2F 2VLAA 2ZO4A 1WWXA 3KE2A 1G3WA 4MHGA 4XKCA 2VE9A 3I64A 1O3TA 5ICEA 4RM3A 3MZYA 1WCMJ 4EGYA 1USTA 5K5QA 1V5GA 2G7HA 2JRTA 4IOAF 2FNAA 1HC8A 3COAC 2IGOA 1AWCA 2LOOA 1QZEA 4NDLA 4XQFA 3WHBA 3G4SI 1SANA 2M4KA 4OIRF 3QP5A 4XMYA 1K7AA 3VYSB 1IV6A 4M3FA 1F43A 2KT0A 5FKNA 2JA8J 4LIVA 1E3PA 4OIQF 4EEFG 4HA8A 1G8XA 3OYMA 2YPRA 2VIXA 1IW7F 4XSZF 1ODDA 4UVCA 1YO5C 2EFOA 4IRIA 4RA2A 4M6YA 2L7FP 3FBNB 2ECBA 3S1RJ 4GRIA 5IP7J 4K2EA 4KIFA 2DA4A 4BHPA 4CCJA 4F7ZA 4A5MA 2VPLA 3K69A 2LVSA 1TWCJ 3PL8A 1V54H 5KCMA 3JSPA 3U1DA 3R4KA 2Y9YA 3V7CA 1MJ9A 2X0LA 3D5RC 4D7NA 1V5EA 2VBXA 1FIPA 2P7VB 4AIHA 4G9YA 3T8RA 1FOXA 3LSIA 5K1YA 5FD6A 5H6QA 1GV2A 1XGNA 3L09A 3ERMA 1XCBA 2MH9A 5CYVA 1GLNA 2K40A 1G4DA 2FA5A 3E6DA 2RKHA 3NEUA 3MEXA 1Z21A 4BDYA 4YFKF 1YX5A 1BI2A 2XDVA 5ICFA 4ZYEA 4KMFA 2QCOA 1HF0A 4EGZA 4EJOA 3L7WA 3MZHA 3H92A 4CA0A 4ZYDA 4D7MA 1D0ZA 2MLKA 3HDDA 3BG9A 1UG2A 2MD0A 2YX7A 1D0YA 1VQMI 2B9SA 2EV5A 3I53A 2ZJQF 1MBEA 4UV8A 3WHCA 1Z77A 4WX9A 3CUQC 2DTRA 2P0WA 3K4LA 4GDFA 3BG6A 4PFPA 2K9LA 2GLOA 3G73A 4M74A 2HI3A 4N4NB 3RCOA 1H0MA 3WTSC 3J7AY 2H1LA 3RIRA 5B1AH 1AKHA 3VYUB 4IRGA 1LFBA 2R7QA 3F9KA 2BY0A 3LA7A 4XN3A 3PIPF 2LD5A 1IG7A 1MBKA 3HSEA 4IOCF 1H9GA 3WU1B 1W36D 3DPUA 2EJRA 1HOMA 4X0GA 1QGPA 3IKVA 2IW5A 3HZJA 5EJCA 1HKTA 3FK7A 5ED4A 4G7ZF 2JA2A 1ZRCA 2QKMB 3OSGA 4FT8A 2ID6A 2LY9A 4BE1A 1JKOC 2Y30A 1OLTA 3T0YA 1K4TA 2UXNA 4XRFA 3NRVA 4BE0A 3ZQGA 2B0LA 4IKFA 5FKMA 1GHCA 5D8KB 1SMYF 3BG7A 2EIJH 4S05A 4I99C 2DQRA 3OIQA 2EILH 2W84A 2XGDA 3GXOA 3DKXA 4BAYA 4II2A 1R7JA 2DDBA 2JRMA 1POGA 2BY3A 2AQFA 4ZYAA 2JN6A 3OYGA 1ZG1A 2JPCA 1IO2A 2K02A 3CDLA 9ANTA 2AO9A 4XORA 1K79A 2HEOA 4HF1A 6PAXA 2R7FA 1T6SA 3DPTA 3WE3A 3QYFA 2K9MA 2Z3YA 1Y8RB 2VC0A 5FRMA 3UR3C 1ZYRF 2H27A 2LSOA 3F6VA 3OYBA 3OIOA 1V5FA 1Q1VA 4UUSB 2CUEA 4WF2A 1T08B 4M3BA 3M7GA 1JKRC 2HOSA 4O5VA 2A68F 4CCNA 2GM4A 1FPQA 1VQ6I 4GCVA 3M1CA 3WGGA 1FOKA 5ICCA 1RPWA 1SVOA 2H6BA 5J8CA 3RZDJ 1MNMC 3JTHA 4DYCA 3EYYA 1WI9A 3LWFA 2LBFB 1FZPB 4BNCA 1EKEA 3JRAA 2F4OB 5F0HA 1SMTA 2WADA 3OMYA 2ACJA 1XSXA 3CMMA 1BW6A 4FX4A 1LE8B 3HHGA 1XCVA 2KMUA 2XGXA 1SAUA 1JGGA 1H8AC 2PN6A 4CSWA 2XAUA 3HOXJ 2M8EA 4E7KA 5CPRB 2E60A 2CV1A 2XKOA 5JHUA 3DBHB 1MSFC 2V6CA 1FX7A 1LDJA 3FK6A 2CG4A 2ADUA 5F0CA 4A3BJ 3KZIC 4TV7A 3QQAA 3K4NA 4XLNF 2VJ5A 3DBLB 4G6DA 3BCAA 4GXOA 1TWGJ 4GYIA 3HGYA 4X6AJ 2HZDA 2ZJ2A 3LAPA 4EM0B 1MJAA 3WGHA 4HX7A 4LGWA 5LHHA 2DODA 4DZPA 1WFXA 1E3HA 2FF4A 2DMTA 1FIAA 3CCUI 1QHHD 1HW1A 3K2AA 4BHBA 2IPQX 5DEQA 5DYMA 2IGKA 4AC0A 1Z3YA 1TWFJ 3CP2A 4L5JA 1YIOA 2K9NA 2M4GA 3BPVA 3OYNA 2CH0A 2R5ZA 2L2OA 3JAMK 5EG0A 1BI0A 3H36A 5LRRA 4BQAA 2RGVA 2W1OA 1NK3P 1G3YA 2TDXA 3DWLE 2GQQA 1D1BA 2W85A 5IP6A 4PFOA 1VQNI 4DOZA 1P7JA 5IOZA 4BDZA 1R9TJ 2VODA 3CLOA 1GDTA 5IT9Z 1TW3A 2WAFA 3H0DA 4BXXJ 4E4HA 2AHQA 4NC7A 2L7KA 3LSHA 1QHGA 3LL7A 2QM3A 3ZMTA 2KZGA 3QPTA 4W97A 1MNDA 2VL8A 3ZMUA 3PUBA 1ZR2A 2LKSA 2Z33A 1OKRA 1T33A 2HYFA 3C2GA 4PDKA 3V4GA 5L3EA 3SJMA 2FMYA 3IAM2 1DU6A 1ACIA 1FBSA 1MBGA 1OCRH 3RQ4A 4S04A 2Y0SA 2EZLA 2YU9J 3KCCA 1LEAA 4F3QA 3LFKA 2JK3A 2RAEA 4LLGF 5FB2A 5HS8A 4P9UA 2HR3A 4P96A 3TP0A 3K70C 1PUEE 3DPLC 4IHVA 1ZR4A 3D5SC 5J6XA 4H4KC 1ZGJA 2YX4A 1N78A 3G2BA 2N8GA 1IRFA 1JHFA 4FASD 5HVQC 5L3CA 2E1NA 3BG3A 4RAYA 2VOOA 3JRBA 2QBYB 1ORKA 3OYLA 1TC3C 5D5UB 4DIQA 5B3SH 1RUNA 4LLNA 2CQXA 3ZQ7A 1Z6TA 1JXSA 2DFEA 3JSOA 4A0YA 1MD0A 2VKVA 2WAQA 2ZSHB 2K4JA 1YTYA 2V9PA 1TQIA 2XKPA 1WKMA 4XNFA 4OINF 3SDGA 2NVYJ 2PFBA 1S5LC 1IUFA 2R5YA 2RVCA 3E5XA 2UWMA 2IA1A 3ZN1A 3DQVC 2DJNA 3AFHA 3HOZJ 2JSCA 1FNNA 5CVRA 1OCZH 2W57A 5M5XJ 3CDIA 1S3JA 2EV0A 1R5GA 5F0FA 2BHYA 4E70A 5BPDA 3PNTA 1J75A 2E36A 4C3HJ 3RYPA 2ZXHA 2QLZA 3K9TA 4QPQA 2HXOA 4EV0A 1W5TA 3P7NA 4UVBA 3ABKH 3FXKA 5DM7F 2MC4A 3H1CA 3BTCA 5L3BA 1F4KA 2E34A 4WWCA 5D4SA 3F21A 4I02A 5H2FC 2MLGA 1MMSA 3BOQA 3G3ZA 1PUFA 5J47A 1KQ0A 3S2HJ 3KEYA 1R58A 2C6YA 2E1MB 1RC9A 3L9FA 1YX3A 1WH5A 1JJ6C 2QKLB 1S7EA 4CZZA 4KYWA 3BROA 4KUMA 3I56I 1LDDA 2OPTA 3L2VA 2DMUA 3DEEA 3WTVC 2R7TA 1E17A 1DGRM 4HBLA 1IXRC 1STZA 2RNGA 5E3MA 1QNTA 1VFCA 3HOUJ 2X9DA 1GT0C 1SFXA 3KEOA 1ZN2A 4ENJA 3KLNA 2IEKA 3FHZA 3LOCA 4IVNA 5GAGJ 2HOTA 4PZJA 2ZXJA 2ME6A 1BJAA 2K86A 1XGOA 3VSKA 2CQQA 1O7LA 4C2UA 5CJ9A 1G3TA 1TW2A 4DGWB 3E5QA 4DYRA 5JVTA 4E7HA 2K3PA 4XKWA 3TOBA 1I3QJ 3L2CA 2EQRA 2NRAC 2AQEA 3A0HC 3RKYA 3T5XA 3CO6C 1MZBA 4AM3A 1B4AA 1ZRDA 3AG1H 4PSXA 4NNJA 2JQ7A 4XRSA 3K4CA 2NS7A 1SEUA 2PQ8A 2MD5A 4A3EJ 2ISYA 4D1QA 2KJCA 2XHKA 3BJAA 3W6JB 3A1YA 4AWXB 3RQIA 4EQQA 4ENKA 3A01B 2CSOA 2A69F 1H88C 2CU7A 1WJBA 3H9QA 2KIUA 4BQNA 3BY6A 5E1ZB 5F1RA 1MMGA 2Y9ZA 2X6YA 2X6WA 4UHTA 3FXJA 1RRJA 1P7IA 1S9HA 3MKLA 3ZQQA 1P4XA 1F1ZA 5FFXA 2HZTA 2DK8A 1YHQI 1AU7A 4DW6A 2JVHA 4KT6A 1EJ9A 3GTPJ 4CCOA 1WRJA 3ZMSA 2VONA 2XGEA 3GTKJ 3O2PE 3GZNB 1D8KA 1XX5A 1F5TA 1KZHA 3A2KA 4BJ5C 3TQNA 1EH6A 3M07A 1WJAA 4FQGA 2O8XA 4C3JJ 4V2FA 2KIFA 3M3YJ 1HCRA 1ZG3A 2LYCA 4UB6C 5E8GA 3HKZA 2DOEA 3U9GA 2BBYA 2P6TA 1UHMA 2NVUB 2GXBA 1LDKB 4ESFA 1Y1VJ 5F1JA 4CGZA 3ZCOA 1PUFB 4RAGA 3BQZA 1KA8A 1S6LA 3KEQA 2BW3A 3I4PA 3UKGA 2VI6A 2HXIA 4FCYA 4IPAA 3SZTA 4L9VA 1JE8A 4HF2A 4XOPA 3LQRA 4BKXA 1QBJA 4JX5A 3EUHC 4DYQA 1K6OA 2X1EA 2Z9OA 2IA0A 3RYRA 5LBQA 4XLAA 2UXXA 3NQOA 4I98B 2FUG2 4YIIA 3WGIA 4M6VA 1HKSA 4ZDLA 3SDBA 1WHUA 3K4KA 5E17F 1S7OA 3K0LA 2KDZA 4J00A 2L0KA 4KN7X 4A2UA 1P9QC 3Q9SA 2DOFA 3EUKL 1T98A 3OYEA 3J80Z 4AIKA 3VODA 2ICWG 4C2TA 1MJBA 4HX4A 2R5YB 3LSKA 1LPQA 2ELJA 4A69C 4A3MJ 2GIVA 2JMWA 2YUSA 5HLIA 2QF7A 2V4JC 1YOVB 3IRQA 1R22A 4AIJA 1C0WA 1P2FA 3ERED 3LSJA 1SAXA 2V79A 2QBYA 4A3GJ 4A6EA 5E20A 2DA5A 3HG9A 1MBFA 3I4NJ 1M1EB 3LFUA 5FO5A 1DP7P 3HM5A 4YRVA 2FQ3A 1X1AA 2RC4A 5FLXK 1O7FA 4ABZA 1SC7A 1YRNB 3HSFA 3BTLA 2D5VA 2ZSIB 4XLEA 3ZPLA 1U5TC 3GF2A 4QPOA 2NVQJ 3TBIA 4U87A 3WG7H 4OU0A 1F36A 1YW8A 3PIOF 1A35A 1MKMA 5D6EA 1TBXA 3BP8A 2LRDA 4MQ9F 5HLHA 2Q2EA 3Q3SA 1N25A 2NXNB 3DTEA 3I9V2 4M9SA 4V19K 1AOYA 2VKDA 5IYCJ 4MGRA 1DGWY 2GAUA 3IAS2 1ETKA 3ABUA 1NH3A 2CV2A 1Y8QB 2VBWA 1FY7A 3R0AA 4E7LA 3PSFA 5KHDA 3FKJA 4LG3A 1ZHFA 1YI2I 1ZAOA 1WSUA 3BDDA 1V55H 1XDUA 3FXOA 1IGNA 3RKWA 2K7LA 5HLGA 3G1LA 2EH3A 2F5FA 4MTDA 2L7ZA 2XB0X 4Y4RA 3GZ5A 1B1BA 4KIGA 4LB6B 2DYRH 3BJ6A 5JHFA 4E7JA 2OQGA 5ILUA 2DLLA 5M3MJ 3JTGA 1H89C 5M3FJ 1D5YA 4ASNA 3N97A 1ZKGA 2O0YA 4IHTA 3MCZA 2HKXA 4HSRA 2OJED 4KJZA 2JWTA 3IC7A 3KZZA 1ZLKA 4Y3OA 3BZCA 2QSGX 4NC8A 3SXYA 1I6HJ 3ISPA 3LA3A 3V8JA 3WODF 3WU0A 1W36C 3K10A 5D6FA 5HDGA 4RM2A 1Y1WJ 4U7DA 5GTIC 4KT5C 5IPAA 3G1MA 2IRFG 1A31A 1FP1D 3AG2H 2Q2EB 4E6KG 1IUYA 3KP3A 3I3LA 3HSRA 3IV5A 4XBFA 1G59A 1EH7A 4I01A 1DQUA 1PDNC 4YIFA 1D1CA 1R36A 2B63J 1DPUA 1BC7C 1L3LA 1YRNA 2ZFUA 1LE8A 2P7CB 5LEJA 4B3AA 3KP5A 5LEKA 1QRYA 3BZKA 2QENA 2O03A 3S3NA 4Y52J 3K7AJ 3LSTA 2F2EA 2LBFA 3TP3A 4PJNA 1CQTA 5J1RA 1E2XA 1NTCA 1JTXA 4KMUX 4DNCA 5C44J 2TRTA 1ZTRA 1WJCA 2RV8A 1WJFA 3TL4X 3AG3H 1FTZA 4HLYA 1ZRFA 2WAQN 3S3OA 3BCBA 4F52A 2HFHA 4DJAA 2LLKA 1OMIA 3E6BA 2X48A 4L18B 4IXAA 2JT1A 2IXSA 2CQ7A 3HOTA 2RREA 2Q8KA 2VOPA 2UZKA 2KHMA 3H5NA 1S8NA 4RAZA 2F4IA 1GXPA 2STWA 1VQ4I 3ZOBA 3D1NI 1QVUA 1RR7A 4B4CA 3U1KA 3CCSI 1T0FC 4C9YA 3I4MJ 4XIDA 3LSRA 4HQEA 4LK1F 1DP3A 1YLFA 1VQKI 3ELKA 1Y56A 1UAAA 4WXDA 4I2OA 1KYZA 1KYWA 5HODA 1QQIA 1U9OA 2BVLA 4IQJA 3P5JA 2XRNA 2BW3B 3SFIA 2TCTA 1VTNC 2ETHA 3L2QA 2HVQA 2O5RA 1KGSA 2CUZA 4EVIA 3VSLA 4HNTA 4WK8F 1D3YA 4UB8C 2L5QA 3M4OJ 3RSNA 1MIJA 3O8HA 2DN0A 4Y17A 5F08A 2LMDA 5ICGA 1Z9CA 5CQGA 3TO7A 4NBQA 3J7YJ 3J7ZI 2V1UA 2JA7J 1IDYA 5CVIA 4XLCA 2RQPA 3FKIJ 2A61A 5M5YJ 2BHZA 4XK4A 3CZ6A 3K1MA 3RKXA 3H5AA 2ESNA 2HTSA 3OYHA 2P8TA 1XPXA 2PMHA 4B44A 2ZJRF 2DXIA 1HKQA 2XPUA 3TO6A 2D1VA 3GTLJ 1IJWC 2L02A 3ECOA 1IRZA 1X19A 4OMZA 3JRHA 3BTIA 1U2WA 1GV5A 2LF7A 3KYLA 1E0EA 3K2ZA 4IEJA 1F9NA 2XVCA 3GMEA 1IN5A 4PUSA 3GFIA 2QQAA 3CJTB 3BWGA 3DF8A 2Y69H 2QGUA 2XGCA 2JZYA 2G7UA 4AD9A 3T1BA 3BR2A 2OZUA 3A01A 1WGXA 2DT5A 3FM3A 4RGUA 3HB9A 1JT0A 3HRSA 2DT7B 3QU3A 4BJ6C 3DKWA 2ZMEC 2HDCA 2CW8A 1R4MB 2XPWA 4UVAA 1R5ID 3FMQA 4A3KJ 1JGSA 3VOEA 4CCKA 3ULQB 2M2EA 1S29A 1WJDA 2ISZA 4D9JA 3CDHA 1YIJI 2IS2A 3W6VA 1UHWA 1WJEA 5KNLA 3H3ZA 1GVJA 1S72I 1A36A 2BGCA 4A5NA 1LB2A 1R1UA 2ELKA 5TJJA 3JR9A 3OYFA 1I5ZA 1Z7UA 3F6OA 2HGCA 2ZXIA 1K6YA 3I55I 2QWWA 2X1CA 4I09A 5K5RA 5IT9K 1EA3A 4QSHA 1N77A 4B47A 2R7RA 5ILSA 1XMXA 2X85A 1U78A 4PGGA 2AXTC 2DA1A 2E1OA 1SD5A 1MBHA 3H3UA 2HQAA 3BR1A
chains in the Genus database with same CATH topology
3O3KA 1KU3A 1I6XA 1QZYA 2VXZA 2WTEA 2ZCWA 3VEPA 1ZLJA 3RJPA 1S7AA 1BBYA 1HSJA 3QU6A 3CUOA 4KA4A 3GFLA 3ZMDA 1XGMA 3GYHX 4KNYA 1P92A 2JTVA 1V4RA 4M73A 2CW0F 3K1PA 1BI3A 2FSWA 3FZVA 2RNJA 2QUFA 1FC3A 3LQQA 4WCGA 2EFNA 4A0XA 1IZ1A 4N0BA 1IRGA 1FSHA 1D5VA 5DD8A 4IF4A 3PFIA 2PI0A 4BH9A 4I0AA 3DV8A 1R1VA 2WWYA 1FYLA 1FYMA 1ZH5A 3GW2A 2EA4A 3O6BB 4IRHA 4O3MA 1XB4A 4L9TA 2NAZA 3F8NA 4A6DA 2VN2A 3EYIA 3F8MA 4QWQA 2MA3A 2COMA 1BIAA 4HDVA 2CO5A 3MWMA 1R00A 1XGSA 1OYIA 4UNOA 1Z91A 4ZH4F 2Y75A 2VC1A 4BYYA 3F3XA 4UV9A 4RB0A 3HRUA 2FU4A 3WTTC 1O3RA 1J9IA 4G7OF 1USSA 2EWNA 4EM1A 1TLHB 2EK5A 1L0OC 2XAHA 1O3QA 4JK1X 4WXHA 5L3DA 3HIFA 1BM9A 2P6SA 2YSRA 4DQ2A 3KP7A 1RI7A 2Y48A 2IJLA 3C1DA 4Q4ZF 3AAFA 4IHSA 1U6GA 2ZNYA 4NQWA 3M8EA 1TTYA 2M87A 3P9IA 1TQPA 4FX0A 4ESJA 1I1SA 3ABTA 4BHCA 1XDSA 3GFMA 1KU7A 3WTYC 4L9JA 2L3DA 4WXCA 2D2WA 3F22A 2F5DA 3ML6A 3DXJF 1RNLA 2BEOA 3IKTA 2E7XA 3RDIA 2D1HA 2P4WA 4ZZDA 1REPC 4Y13A 2OQRA 1OR7A 2MH2A 3C3WA 4L9NA 4EJUA 3PQJA 3FX3A 3QPHA 3I59B 3MAJA 5L3FA 4B8XA 3WTUC 3B02A 2LDUA 4GYGA 5BOXA 3KFWX 5HDKA 3J81K 4RGRA 2VBZA 4OOIA 2JPBA 2AXLA 2O3FA 1KQ8A 5LHIA 5KVRA 1RIOH 2AS5F 2FOKA 4RB3C 5FD5A 4A12A 4MTEA 2ZFWA 4KIBA 3I54A 3LAJA 2DW4A 1HW2A 2ZNZA 1XN7A 1R5HA 3S2WA 4P5OA 1I1GA 3E3VA 4LK0F 5CVUA 4D0PA 3HYIA 1U5TB 2L4AA 3JAMZ 1TNTA 2EV6A 2M45A 4U7BA 5ERIA 3IWZA 4HDUA 2X4HA 4XLPF 1ZG5A 2LNBA 5LGNA 3GWZA 4B09A 1A04A 3GZ6A 1O57A 1B9MA 4ON0A 4Q47A 1WQ2A 2YU3A 4ZYHA 3WG9A 4UUVA 3LA2A 5FGMA 2V1DA 2VT3A 3TDZC 4LB5A 2FBKA 4HOBA 4RB2C 2Z99A 5CVVA 1ON1A 3E97A 3EETA 3HHHA 3IRRA 1MDMB 4EJWA 3C7JA 3FMRA 5E1WA 1HXDA 3QP6A 4G8XA 4CO8A 2CFXA 1P4WA 3V8LA 1UCRA 3TKYA 2NNNA 4MEYF 5H20A 3GLXA 2OU2A 5CLSA 4RGXA 2XASA 1B9NA 2EFQA 2KJBA 3HTUA 2QYOA 3M9AA 3IHUA 2ZMEB 3ZP5A 3ROUA 1IN7A 1BOAA 3FXUA 3F8BA 1SD7A 4N9IA 2FEZA 5EEGA 1W7PA 3HRTA 3QRFF 2HWVA 2FBHA 2Z5UA 3GO5A 3E5UA 5J8FA 1BI1A 2VE8A 1P6RA 4LMYA 4QLCU 1Z1DA 4G6QA 2F5EA 1OYWA 2CQKA 2A5YB 2DFIA 3FM5A 5E18F 4ZYGA 1IXCA 1IXSB 2EFWA 1J5YA 3GX4X 3J7AO 2RDPA 2OA4A 3R0JA 2CGPA 1KU2A 2VT2A 4U0VA 4M9ZA 5JR3A 2EA2A 4YFNF 2XIGA 1YYVA 4N9HA 1IN4A 5HOOA 2FRHA 5H6RA 2QVOA 4MEXF 3HOSA 3FXRA 5JFRA 5DD4A 3R61A 3U2RA 2FBIA 1SD6A 4HX8A 2K4BA 1FLIA 1UB9A 3D0SA 1U3EM 2CYYA 2HOEA 2LKPA 2A6HF 2L01A 5L3GA 3I58A 3ZN0A 2H6CA 1T39A 1SD4A 1TQMA 2A07F 2O61A 1ULYA 1BN5A 2PMUA 3VB2A 4R8HA 2W25A 1QZZA 5K5OA 2GA2A 5DCMB 2HQRA 3FMSA 3GFJA 2VBYA 4MQVA 3M1EA 4LG0A 3SQNA 1ZGAA 1LNWA 2O6GE 2V9VA 4U88A 5FFZA 2FXAA 2W24A 2DQLA 4ETSA 2DO7A 4BXUA 2GA1A 1J2XA 1G3SA 5LRSA 4H0EA 1XD7A 4I7HA 3PQKA 2QQBA 3RI4A 3B73A 2K27A 1ZARA 1K78B 1ON2A 2BE5F 3OV8A 2HS5A 1BC8C 3SHFA 2DPDA 4CYDA 4M6XA 2HYGD 2MC3A 1FBUA 2DPUA 1OPCA 2ZKZA 1T38A 4OIPF 1FSEA 3GVAA 1ZREA 4U0YA 2R3SA 4I0BA 2XAQA 5D5WB 2EFPA 1BIBA 3SFZA 5DV5A 1HBXG 2XROA 2PJPA 2OAZA 1HW5A 3TO9A 3IL2A 2XAJA 3V8KA 4Z2YA 1X3UA 4KICA 3L00A 4MNUA 5BMZA 3GUDA 3N4MA 4PCQA 3BZ6A 3FWEA 3TGNA 3R60A 4EM2A 2XV4S 2BYVE 2V1XA 2F5CA 3GEZA 1YS7A 3DFGA 5LGUA 2OD5A 2NYXA 3F72A 1Q1HA 4Y15A 1FP2A 1R23A 2OBPA 1FBQA 2DBBA 5JI6A 3FXQA 5BPIA 1HSTA 1CF7B 1UFMA 3P9KA 4HF0A 3F23A 1LVAA 3C18A 3J80K 1W4MA 1W7PD 2H94A 4RB1A 2J5PA 5EEHA 2Y0MA 4Q48A 4M72A 4HYEA 3KP2A 2XAGA 4CXFA 3CO7C 1KU9A 1V3FA 4EMSA 3MFKA 3Q5FA 2M30A 3CJNA 2IP2A 3HRMA 5FLXZ 3CUQA 1W7PB 3QOPA 5DCFA 5TRDA 1DDNA 1U8RA 3CTAA 1B59A 2DK5A 3EDPA 1J7KA 2IA2A 4LLLA 3V7SA 4RS8A 2NNYA 4O6JA 1YW9A 1Z6RA 4XSXF 1MGTA 4G94A 2KKOA 5DUIA 1P4AA 4ENMA 3F8FA 5BQTA 4ESBA 1PP8F 4RGSA 5D5XB 3I0TA 4IJAA 3J81Z 4UXNA 1MDMA 4M71A 3CUQB 5LHGA 1FYKA 1EV7A 2EB7A 2CWEA 3WTWC 3IWFA 2P5VA 1LEBA 1I27A 4GGGA 4GO1A 2FE3A 4OIOF 3HUGA 3V7RA 1EH8A 3KETA 5LGTA 3M8FA 2IVMA 2FMLA 2BV6A 1CF7A 2RN7A 2YR2A 1FWZA 5D5VB 2STTA 4JQFA 1QO0D 2GXGA 3D5LA 1RZ4A 2NS0A 2PEXA 2QZ8A 4Q5SF 3SZPA 4A0ZA 5AONA 1U5TA 3WE2A 3E6CC 3Q9VA 4P9FA 3E6MA 3W6KB 3BJOA 4L0ZB 1FT9A 2OZ6A 2P5LC 1YFHA 2WV0A 2DI3A 1PP7U 3I5UA 5ILVA 1OYYA 3DEUA 2P5KA 2DAOA 4KN4X 2H09A 5D4RA 1YQAA 3MQ0A 3VFZA 1T0FA 2LF8A 3OOPA 1Z05A 1DPRA 4ZZLA 5BS6A 3QAHA 4L5IA 4P55A 1JHHA 2FNPA 1IN8A 1KQ9A 3HTSB 5KK1A 2KIMA 1J0RA 1Y0UA 2E7WA 5E1XA 4EJTA 1HQCA 1LJ9A 3I59A 1SFUA 2L4MA 4R1HA 1R1TA 1CGPA 5F6FA 4ENNA 4R79A 3EQLF 2A6EF 5HS7A 4HW0A 1LQ1A 4EJVA 1J59A 2G9WA 5CVJA 1QPMA 3EUHA 4NB5A 1RUOA 4HAMA 4HV6A 1IAWA 1K78A 2J5OA 1D8JA 5E8IA 4JBAA 5HDNA 4CDGA 1XMAA 3FF5A 2HQNA 2L54A 5AIQA 4YFXF 2ZBKA 3JW4A 2ELHA 4AVPA 3P9CA 5D8LB 2ESHA 2Q0OA 4G7HF 4LG0B 4KFCA 1XSDA 2M1BA 3KP4A 3DP7A 3WTZA 3BPXA 3TOAA 5DCMA 1XMKA 3I71A 2R7DA 2A3SA 5HS9A 1B6AA 4HV5A 2XAFA 4LFUA 1IN6A 4NHJA 1O3SA 5IT3A 3TDUC 3KP6A 1TNSA 3T8TA 3K1NA 1ONVA 1T2KA 3ECHA 3RPQA 2HTJA 3RPUA 4U0WA 2KRFA 4CICA 5A2QZ 4LJZF 2GZWA 3R6SA 1DUXC 1YW7A 1G6NA 5LLQA 2XUBA 4FHTA 1W5SA 5DUKA 4M9XA 2PLYA 3KZYA 3WTXC 4HZFA 4KDPA 2E1CA 3RTRA 4LD5A 4OMYA 2PG4A 2PBIA 3ZMVA 5A2QK 1YG2A 3KLOA 4HQMA 2D45A 1H9TA 4CHUA 4L0YB 2WC2A 1YS6A 2M5WA 1GXQA 2QQ9A 3ZMZA 3REOA 2HKOA 2DU9A 2MBFA 5DDGA 2GWRA 2IT0A 1IF1A 4PGHA 5AIPA 1NHAA 1XSVA 3F8CA 5F64A 1SFEA 4HLXA 2ZMEA 4YG2F 2ZO4A 1WWXA 3KE2A 1G3WA 4MHGA 1O3TA 2VE9A 3I64A 5ICEA 3MZYA 4EGYA 1USTA 5K5QA 2G7HA 2JRTA 2FNAA 3COAC 1AWCA 4OIRF 3QP5A 1K7AA 4OIQF 4HA8A 2YPRA 1IW7F 4XSZF 1ODDA 4UVCA 1YO5C 2EFOA 4IRIA 4M6YA 4K2EA 4KIFA 4BHPA 4F7ZA 4A5MA 3K69A 3JSPA 3U1DA 3R4KA 3V7CA 1MJ9A 2X0LA 2VBXA 2P7VB 4AIHA 4G9YA 3T8RA 5K1YA 5FD6A 5H6QA 1XGNA 3L09A 1XCBA 2MH9A 5CYVA 1G4DA 2FA5A 3E6DA 2RKHA 3NEUA 3MEXA 4YFKF 1BI2A 5ICFA 4ZYEA 4KMFA 4EGZA 4EJOA 3L7WA 3MZHA 3H92A 4ZYDA 2MLKA 2YX7A 2EV5A 3I53A 4UV8A 4WX9A 3CUQC 2DTRA 3G73A 4M74A 1H0MA 3WTSC 3RIRA 4IRGA 3LA7A 3HSEA 1H9GA 3WU1B 2EJRA 1QGPA 3IKVA 2IW5A 1HKTA 5ED4A 4G7ZF 1ZRCA 4FT8A 3T0YA 2UXNA 4XRFA 3NRVA 2B0LA 1GHCA 5D8KB 1SMYF 4S05A 2DQRA 4BAYA 2W84A 3GXOA 1R7JA 1ZG1A 2JPCA 2K02A 1K79A 2HEOA 4HF1A 6PAXA 2R7FA 1T6SA 3DPTA 3WE3A 2Z3YA 2VC0A 1ZYRF 2H27A 2LSOA 3F6VA 4WF2A 3M7GA 4O5VA 2A68F 1FPQA 4GCVA 3WGGA 1FOKA 5ICCA 2H6BA 5J8CA 3JTHA 3EYYA 1WI9A 3LWFA 1FZPB 4BNCA 1SMTA 2ACJA 1XSXA 4FX4A 3HHGA 1XCVA 2XGXA 2PN6A 2M8EA 2XKOA 5JHUA 2V6CA 1FX7A 1LDJA 2CG4A 2ADUA 4TV7A 4XLNF 4G6DA 4GXOA 4GYIA 2ZJ2A 3LAPA 4EM0B 1MJAA 3WGHA 4HX7A 4LGWA 5LHHA 2FF4A 1HW1A 4BHBA 2IPQX 5DEQA 5DYMA 4L5JA 1YIOA 3BPVA 3JAMK 1BI0A 5LRRA 4BQAA 2RGVA 1G3YA 2TDXA 2GQQA 2W85A 2VODA 3CLOA 5IT9Z 1TW3A 2QM3A 3ZMTA 3QPTA 3ZMUA 2Z33A 5L3EA 1OKRA 2HYFA 4PDKA 3V4GA 2FMYA 1FBSA 4S04A 3KCCA 1LEAA 3LFKA 5FB2A 4LLGF 5HS8A 4P9UA 2HR3A 4P96A 1PUEE 3DPLC 5J6XA 1ZGJA 2YX4A 1IRFA 1JHFA 5HVQC 5L3CA 2E1NA 4RAYA 2VOOA 2QBYB 5D5UB 1RUNA 4LLNA 3ZQ7A 1Z6TA 1JXSA 3JSOA 4A0YA 1MD0A 1YTYA 2K4JA 1TQIA 2XKPA 1WKMA 4OINF 2PFBA 2RVCA 3E5XA 2UWMA 2IA1A 3ZN1A 3DQVC 2JSCA 1FNNA 5CVRA 2W57A 1S3JA 2EV0A 1R5GA 4E70A 5BPDA 1J75A 3RYPA 2QLZA 3K9TA 4EV0A 1W5TA 3P7NA 4UVBA 5L3BA 1F4KA 4WWCA 5D4SA 3F21A 4I02A 2MLGA 3BOQA 3G3ZA 1KQ0A 1R58A 2C6YA 3L9FA 4CZZA 4KYWA 3BROA 4KUMA 1LDDA 3WTVC 1E17A 4HBLA 1IXRC 1STZA 1QNTA 1SFXA 3KEOA 1ZN2A 4ENJA 3KLNA 3FHZA 4IVNA 4PZJA 2ZXJA 1BJAA 2K86A 1XGOA 1O7LA 5CJ9A 1G3TA 1TW2A 3E5QA 5JVTA 3TOBA 3L2CA 2NRAC 3CO6C 3RKYA 3T5XA 1MZBA 1B4AA 1ZRDA 2PQ8A 2MD5A 2ISYA 2KJCA 2XHKA 3BJAA 3W6JB 4AWXB 4EQQA 4ENKA 2CSOA 2A69F 2KIUA 3BY6A 5E1ZB 5F1RA 4UHTA 1P4XA 1F1ZA 5FFXA 2HZTA 2DK8A 1WRJA 3ZMSA 2VONA 3O2PE 1D8KA 1F5TA 3TQNA 1EH6A 2O8XA 2KIFA 1ZG3A 5E8GA 3U9GA 2BBYA 2P6TA 1UHMA 2GXBA 1LDKB 4ESFA 4CGZA 1KA8A 1S6LA 3KEQA 3I4PA 4IPAA 3SZTA 4L9VA 1JE8A 4HF2A 3LQRA 1QBJA 1K6OA 2Z9OA 2IA0A 3RYRA 5LBQA 2UXXA 3NQOA 4I98B 4YIIA 3WGIA 1HKSA 5E17F 1S7OA 3K0LA 4KN7X 4A2UA 3Q9SA 1T98A 3J80Z 4AIKA 3VODA 1MJBA 4HX4A 2GIVA 5HLIA 3IRQA 1R22A 4AIJA 1C0WA 1P2FA 3ERED 1SAXA 2V79A 2QBYA 4A6EA 5E20A 5FO5A 1DP7P 2FQ3A 2RC4A 5FLXK 1O7FA 3HSFA 3ZPLA 1U5TC 3GF2A 4OU0A 1YW8A 1MKMA 5D6EA 1TBXA 3BP8A 4MQ9F 5HLHA 2Q2EA 4M9SA 1AOYA 4MGRA 2GAUA 3ABUA 2VBWA 3R0AA 1FY7A 1ZHFA 1ZAOA 1WSUA 3BDDA 1XDUA 3RKWA 2K7LA 5HLGA 2F5FA 4MTDA 3GZ5A 1B1BA 4KIGA 4LB6B 3BJ6A 2OQGA 5ILUA 2DLLA 3JTGA 4ASNA 3N97A 2O0YA 4IHTA 3MCZA 2HKXA 3IC7A 3KZZA 1ZLKA 3SXYA 3ISPA 3LA3A 3V8JA 3WU0A 3WODF 5D6FA 5HDGA 4U7DA 4KT5C 2IRFG 1FP1D 1IUYA 3KP3A 3HSRA 4XBFA 1EH7A 4I01A 1PDNC 4YIFA 1R36A 1DPUA 1BC7C 1L3LA 2P7CB 5LEJA 3KP5A 5LEKA 2QENA 2O03A 3LSTA 2F2EA 1E2XA 4KMUX 4DNCA 2RV8A 4HLYA 1ZRFA 2HFHA 1OMIA 3E6BA 4L18B 4IXAA 2JT1A 3HOTA 2Q8KA 2VOPA 2UZKA 1S8NA 4RAZA 1GXPA 2STWA 4HQEA 4LK1F 1YLFA 3ELKA 4WXDA 4I2OA 1KYZA 1KYWA 1QQIA 2XRNA 1VTNC 2ETHA 1KGSA 4EVIA 4WK8F 1D3YA 4Y17A 5ICGA 1Z9CA 3TO7A 2V1UA 5CVIA 2RQPA 2A61A 3K1MA 3RKXA 2ESNA 2HTSA 2P8TA 2PMHA 1HKQA 3TO6A 2D1VA 2L02A 3ECOA 4OMZA 1U2WA 2LF7A 3K2ZA 1F9NA 2XVCA 1IN5A 3GFIA 2QQAA 3BWGA 3DF8A 2JZYA 2G7UA 4AD9A 3T1BA 2OZUA 2DT5A 3FM3A 4RGUA 3HRSA 3QU3A 3DKWA 2HDCA 4UVAA 3FMQA 1JGSA 3VOEA 3ULQB 1S29A 2ISZA 3CDHA 1UHWA 3H3ZA 1GVJA 2BGCA 4A5NA 1LB2A 1R1UA 5TJJA 1I5ZA 1Z7UA 3F6OA 2HGCA 2QWWA 4I09A 5K5RA 5IT9K 5ILSA 1U78A 4PGGA 1SD5A 3H3UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O3K A;  1KU3 A;  1I6X A;  1QZY A;  2VXZ A;  2WTE A;  2ZCW A;  3VEP A;  1ZLJ A;  3RJP A;  1S7A A;  1BBY A;  1HSJ A;  3QU6 A;  3CUO A;  4KA4 A;  3GFL A;  3ZMD A;  1XGM A;  3GYH X;  4KNY A;  1P92 A;  2JTV A;  1V4R A;  4M73 A;  2CW0 F;  3K1P A;  1BI3 A;  2FSW A;  3FZV A;  2RNJ A;  2QUF A;  1FC3 A;  3LQQ A;  4WCG A;  2EFN A;  4A0X A;  1IZ1 A;  4N0B A;  1IRG A;  1FSH A;  1D5V A;  5DD8 A;  4IF4 A;  3PFI A;  2PI0 A;  4BH9 A;  4I0A A;  3DV8 A;  1R1V A;  2WWY A;  1FYL A;  1FYM A;  1ZH5 A;  3GW2 A;  2EA4 A;  3O6B B;  4IRH A;  4O3M A;  1XB4 A;  4L9T A;  2NAZ A;  3F8N A;  4A6D A;  2VN2 A;  3EYI A;  3F8M A;  4QWQ A;  2MA3 A;  2COM A;  1BIA A;  4HDV A;  2CO5 A;  3MWM A;  1R00 A;  1XGS A;  1OYI A;  4UNO A;  1Z91 A;  4ZH4 F;  2Y75 A;  2VC1 A;  4BYY A;  3F3X A;  4UV9 A;  4RB0 A;  3HRU A;  2FU4 A;  3WTT C;  1O3R A;  1J9I A;  4G7O F;  1USS A;  2EWN A;  4EM1 A;  1TLH B;  2EK5 A;  1L0O C;  2XAH A;  1O3Q A;  4JK1 X;  4WXH A;  5L3D A;  3HIF A;  1BM9 A;  2P6S A;  2YSR A;  4DQ2 A;  3KP7 A;  1RI7 A;  2Y48 A;  2IJL A;  3C1D A;  4Q4Z F;  3AAF A;  4IHS A;  1U6G A;  2ZNY A;  4NQW A;  3M8E A;  1TTY A;  2M87 A;  3P9I A;  1TQP A;  4FX0 A;  4ESJ A;  1I1S A;  3ABT A;  4BHC A;  1XDS A;  3GFM A;  1KU7 A;  3WTY C;  4L9J A;  2L3D A;  4WXC A;  2D2W A;  3F22 A;  2F5D A;  3ML6 A;  3DXJ F;  1RNL A;  2BEO A;  3IKT A;  2E7X A;  3RDI A;  2D1H A;  2P4W A;  4ZZD A;  1REP C;  4Y13 A;  2OQR A;  1OR7 A;  2MH2 A;  3C3W A;  4L9N A;  4EJU A;  3PQJ A;  3FX3 A;  3QPH A;  3I59 B;  3MAJ A;  5L3F A;  4B8X A;  3WTU C;  3B02 A;  2LDU A;  4GYG A;  5BOX A;  3KFW X;  5HDK A;  3J81 K;  4RGR A;  2VBZ A;  4OOI A;  2JPB A;  2AXL A;  2O3F A;  1KQ8 A;  5LHI A;  5KVR A;  1RIO H;  2AS5 F;  2FOK A;  4RB3 C;  5FD5 A;  4A12 A;  4MTE A;  2ZFW A;  4KIB A;  3I54 A;  3LAJ A;  2DW4 A;  1HW2 A;  2ZNZ A;  1XN7 A;  1R5H A;  3S2W A;  4P5O A;  1I1G A;  3E3V A;  4LK0 F;  5CVU A;  4D0P A;  3HYI A;  1U5T B;  2L4A A;  3JAM Z;  1TNT A;  2EV6 A;  2M45 A;  4U7B A;  5ERI A;  3IWZ A;  4HDU A;  2X4H A;  4XLP F;  1ZG5 A;  2LNB A;  5LGN A;  3GWZ A;  4B09 A;  1A04 A;  3GZ6 A;  1O57 A;  1B9M A;  4ON0 A;  4Q47 A;  1WQ2 A;  2YU3 A;  4ZYH A;  3WG9 A;  4UUV A;  3LA2 A;  5FGM A;  2V1D A;  2VT3 A;  3TDZ C;  4LB5 A;  2FBK A;  4HOB A;  4RB2 C;  2Z99 A;  5CVV A;  1ON1 A;  3E97 A;  3EET A;  3HHH A;  3IRR A;  1MDM B;  4EJW A;  3C7J A;  3FMR A;  5E1W A;  1HXD A;  3QP6 A;  4G8X A;  4CO8 A;  2CFX A;  1P4W A;  3V8L A;  1UCR A;  3TKY A;  2NNN A;  4MEY F;  5H20 A;  3GLX A;  2OU2 A;  5CLS A;  4RGX A;  2XAS A;  1B9N A;  2EFQ A;  2KJB A;  3HTU A;  2QYO A;  3M9A A;  3IHU A;  2ZME B;  3ZP5 A;  3ROU A;  1IN7 A;  1BOA A;  3FXU A;  3F8B A;  1SD7 A;  4N9I A;  2FEZ A;  5EEG A;  1W7P A;  3HRT A;  3QRF F;  2HWV A;  2FBH A;  2Z5U A;  3GO5 A;  3E5U A;  5J8F A;  1BI1 A;  2VE8 A;  1P6R A;  4LMY A;  4QLC U;  1Z1D A;  4G6Q A;  2F5E A;  1OYW A;  2CQK A;  2A5Y B;  2DFI A;  3FM5 A;  5E18 F;  4ZYG A;  1IXC A;  1IXS B;  2EFW A;  1J5Y A;  3GX4 X;  3J7A O;  2RDP A;  2OA4 A;  3R0J A;  2CGP A;  1KU2 A;  2VT2 A;  4U0V A;  4M9Z A;  5JR3 A;  2EA2 A;  4YFN F;  2XIG A;  1YYV A;  4N9H A;  1IN4 A;  5HOO A;  2FRH A;  5H6R A;  2QVO A;  4MEX F;  3HOS A;  3FXR A;  5JFR A;  5DD4 A;  3R61 A;  3U2R A;  2FBI A;  1SD6 A;  4HX8 A;  2K4B A;  1FLI A;  1UB9 A;  3D0S A;  1U3E M;  2CYY A;  2HOE A;  2LKP A;  2A6H F;  2L01 A;  5L3G A;  3I58 A;  3ZN0 A;  2H6C A;  1T39 A;  1SD4 A;  1TQM A;  2A07 F;  2O61 A;  1ULY A;  1BN5 A;  2PMU A;  3VB2 A;  4R8H A;  2W25 A;  1QZZ A;  5K5O A;  2GA2 A;  5DCM B;  2HQR A;  3FMS A;  3GFJ A;  2VBY A;  4MQV A;  3M1E A;  4LG0 A;  3SQN A;  1ZGA A;  1LNW A;  2O6G E;  2V9V A;  4U88 A;  5FFZ A;  2FXA A;  2W24 A;  2DQL A;  4ETS A;  2DO7 A;  4BXU A;  2GA1 A;  1J2X A;  1G3S A;  5LRS A;  4H0E A;  1XD7 A;  4I7H A;  3PQK A;  2QQB A;  3RI4 A;  3B73 A;  2K27 A;  1ZAR A;  1K78 B;  1ON2 A;  2BE5 F;  3OV8 A;  2HS5 A;  1BC8 C;  3SHF A;  2DPD A;  4CYD A;  4M6X A;  2HYG D;  2MC3 A;  1FBU A;  2DPU A;  1OPC A;  2ZKZ A;  1T38 A;  4OIP F;  1FSE A;  3GVA A;  1ZRE A;  4U0Y A;  2R3S A;  4I0B A;  2XAQ A;  5D5W B;  2EFP A;  1BIB A;  3SFZ A;  5DV5 A;  1HBX G;  2XRO A;  2PJP A;  2OAZ A;  1HW5 A;  3TO9 A;  3IL2 A;  2XAJ A;  3V8K A;  4Z2Y A;  1X3U A;  4KIC A;  3L00 A;  4MNU A;  5BMZ A;  3GUD A;  3N4M A;  4PCQ A;  3BZ6 A;  3FWE A;  3TGN A;  3R60 A;  4EM2 A;  2XV4 S;  2BYV E;  2V1X A;  2F5C A;  3GEZ A;  1YS7 A;  3DFG A;  5LGU A;  2OD5 A;  2NYX A;  3F72 A;  1Q1H A;  4Y15 A;  1FP2 A;  1R23 A;  2OBP A;  1FBQ A;  2DBB A;  5JI6 A;  3FXQ A;  5BPI A;  1HST A;  1CF7 B;  1UFM A;  3P9K A;  4HF0 A;  3F23 A;  1LVA A;  3C18 A;  3J80 K;  1W4M A;  1W7P D;  2H94 A;  4RB1 A;  2J5P A;  5EEH A;  2Y0M A;  4Q48 A;  4M72 A;  4HYE A;  3KP2 A;  2XAG A;  4CXF A;  3CO7 C;  1KU9 A;  1V3F A;  4EMS A;  3MFK A;  3Q5F A;  2M30 A;  3CJN A;  2IP2 A;  3HRM A;  5FLX Z;  3CUQ A;  1W7P B;  3QOP A;  5DCF A;  5TRD A;  1DDN A;  1U8R A;  3CTA A;  1B59 A;  2DK5 A;  3EDP A;  1J7K A;  2IA2 A;  4LLL A;  3V7S A;  4RS8 A;  2NNY A;  4O6J A;  1YW9 A;  1Z6R A;  4XSX F;  1MGT A;  4G94 A;  2KKO A;  5DUI A;  1P4A A;  4ENM A;  3F8F A;  5BQT A;  4ESB A;  1PP8 F;  4RGS A;  5D5X B;  3I0T A;  4IJA A;  3J81 Z;  4UXN A;  1MDM A;  4M71 A;  3CUQ B;  5LHG A;  1FYK A;  1EV7 A;  2EB7 A;  2CWE A;  3WTW C;  3IWF A;  2P5V A;  1LEB A;  1I27 A;  4GGG A;  4GO1 A;  2FE3 A;  4OIO F;  3HUG A;  3V7R A;  1EH8 A;  3KET A;  5LGT A;  3M8F A;  2IVM A;  2FML A;  2BV6 A;  1CF7 A;  2RN7 A;  2YR2 A;  1FWZ A;  5D5V B;  2STT A;  4JQF A;  1QO0 D;  2GXG A;  3D5L A;  1RZ4 A;  2NS0 A;  2PEX A;  2QZ8 A;  4Q5S F;  3SZP A;  4A0Z A;  5AON A;  1U5T A;  3WE2 A;  3E6C C;  3Q9V A;  4P9F A;  3E6M A;  3W6K B;  3BJO A;  4L0Z B;  1FT9 A;  2OZ6 A;  2P5L C;  1YFH A;  2WV0 A;  2DI3 A;  1PP7 U;  3I5U A;  5ILV A;  1OYY A;  3DEU A;  2P5K A;  2DAO A;  4KN4 X;  2H09 A;  5D4R A;  1YQA A;  3MQ0 A;  3VFZ A;  1T0F A;  2LF8 A;  3OOP A;  1Z05 A;  1DPR A;  4ZZL A;  5BS6 A;  3QAH A;  4L5I A;  4P55 A;  1JHH A;  2FNP A;  1IN8 A;  1KQ9 A;  3HTS B;  5KK1 A;  2KIM A;  1J0R A;  1Y0U A;  2E7W A;  5E1X A;  4EJT A;  1HQC A;  1LJ9 A;  3I59 A;  1SFU A;  2L4M A;  4R1H A;  1R1T A;  1CGP A;  5F6F A;  4ENN A;  4R79 A;  3EQL F;  2A6E F;  5HS7 A;  4HW0 A;  1LQ1 A;  4EJV A;  1J59 A;  2G9W A;  5CVJ A;  1QPM A;  3EUH A;  4NB5 A;  1RUO A;  4HAM A;  4HV6 A;  1IAW A;  1K78 A;  2J5O A;  1D8J A;  5E8I A;  4JBA A;  5HDN A;  4CDG A;  1XMA A;  3FF5 A;  2HQN A;  2L54 A;  5AIQ A;  4YFX F;  2ZBK A;  3JW4 A;  2ELH A;  4AVP A;  3P9C A;  5D8L B;  2ESH A;  2Q0O A;  4G7H F;  4LG0 B;  4KFC A;  1XSD A;  2M1B A;  3KP4 A;  3DP7 A;  3WTZ A;  3BPX A;  3TOA A;  5DCM A;  1XMK A;  3I71 A;  2R7D A;  2A3S A;  5HS9 A;  1B6A A;  4HV5 A;  2XAF A;  4LFU A;  1IN6 A;  4NHJ A;  1O3S A;  5IT3 A;  3TDU C;  3KP6 A;  1TNS A;  3T8T A;  3K1N A;  1ONV A;  1T2K A;  3ECH A;  3RPQ A;  2HTJ A;  3RPU A;  4U0W A;  2KRF A;  4CIC A;  5A2Q Z;  4LJZ F;  2GZW A;  3R6S A;  1DUX C;  1YW7 A;  1G6N A;  5LLQ A;  2XUB A;  4FHT A;  1W5S A;  5DUK A;  4M9X A;  2PLY A;  3KZY A;  3WTX C;  4HZF A;  4KDP A;  2E1C A;  3RTR A;  4LD5 A;  4OMY A;  2PG4 A;  2PBI A;  3ZMV A;  5A2Q K;  1YG2 A;  3KLO A;  4HQM A;  2D45 A;  1H9T A;  4CHU A;  4L0Y B;  2WC2 A;  1YS6 A;  2M5W A;  1GXQ A;  2QQ9 A;  3ZMZ A;  3REO A;  2HKO A;  2DU9 A;  2MBF A;  5DDG A;  2GWR A;  2IT0 A;  1IF1 A;  4PGH A;  5AIP A;  1NHA A;  1XSV A;  3F8C A;  5F64 A;  1SFE A;  4HLX A;  2ZME A;  4YG2 F;  2ZO4 A;  1WWX A;  3KE2 A;  1G3W A;  4MHG A;  1O3T A;  2VE9 A;  3I64 A;  5ICE A;  3MZY A;  4EGY A;  1UST A;  5K5Q A;  2G7H A;  2JRT A;  2FNA A;  3COA C;  1AWC A;  4OIR F;  3QP5 A;  1K7A A;  4OIQ F;  4HA8 A;  2YPR A;  1IW7 F;  4XSZ F;  1ODD A;  4UVC A;  1YO5 C;  2EFO A;  4IRI A;  4M6Y A;  4K2E A;  4KIF A;  4BHP A;  4F7Z A;  4A5M A;  3K69 A;  3JSP A;  3U1D A;  3R4K A;  3V7C A;  1MJ9 A;  2X0L A;  2VBX A;  2P7V B;  4AIH A;  4G9Y A;  3T8R A;  5K1Y A;  5FD6 A;  5H6Q A;  1XGN A;  3L09 A;  1XCB A;  2MH9 A;  5CYV A;  1G4D A;  2FA5 A;  3E6D A;  2RKH A;  3NEU A;  3MEX A;  4YFK F;  1BI2 A;  5ICF A;  4ZYE A;  4KMF A;  4EGZ A;  4EJO A;  3L7W A;  3MZH A;  3H92 A;  4ZYD A;  2MLK A;  2YX7 A;  2EV5 A;  3I53 A;  4UV8 A;  4WX9 A;  3CUQ C;  2DTR A;  3G73 A;  4M74 A;  1H0M A;  3WTS C;  3RIR A;  4IRG A;  3LA7 A;  3HSE A;  1H9G A;  3WU1 B;  2EJR A;  1QGP A;  3IKV A;  2IW5 A;  1HKT A;  5ED4 A;  4G7Z F;  1ZRC A;  4FT8 A;  3T0Y A;  2UXN A;  4XRF A;  3NRV A;  2B0L A;  1GHC A;  5D8K B;  1SMY F;  4S05 A;  2DQR A;  4BAY A;  2W84 A;  3GXO A;  1R7J A;  1ZG1 A;  2JPC A;  2K02 A;  1K79 A;  2HEO A;  4HF1 A;  6PAX A;  2R7F A;  1T6S A;  3DPT A;  3WE3 A;  2Z3Y A;  2VC0 A;  1ZYR F;  2H27 A;  2LSO A;  3F6V A;  4WF2 A;  3M7G A;  4O5V A;  2A68 F;  1FPQ A;  4GCV A;  3WGG A;  1FOK A;  5ICC A;  2H6B A;  5J8C A;  3JTH A;  3EYY A;  1WI9 A;  3LWF A;  1FZP B;  4BNC A;  1SMT A;  2ACJ A;  1XSX A;  4FX4 A;  3HHG A;  1XCV A;  2XGX A;  2PN6 A;  2M8E A;  2XKO A;  5JHU A;  2V6C A;  1FX7 A;  1LDJ A;  2CG4 A;  2ADU A;  4TV7 A;  4XLN F;  4G6D A;  4GXO A;  4GYI A;  2ZJ2 A;  3LAP A;  4EM0 B;  1MJA A;  3WGH A;  4HX7 A;  4LGW A;  5LHH A;  2FF4 A;  1HW1 A;  4BHB A;  2IPQ X;  5DEQ A;  5DYM A;  4L5J A;  1YIO A;  3BPV A;  3JAM K;  1BI0 A;  5LRR A;  4BQA A;  2RGV A;  1G3Y A;  2TDX A;  2GQQ A;  2W85 A;  2VOD A;  3CLO A;  5IT9 Z;  1TW3 A;  2QM3 A;  3ZMT A;  3QPT A;  3ZMU A;  2Z33 A;  5L3E A;  1OKR A;  2HYF A;  4PDK A;  3V4G A;  2FMY A;  1FBS A;  4S04 A;  3KCC A;  1LEA A;  3LFK A;  5FB2 A;  4LLG F;  5HS8 A;  4P9U A;  2HR3 A;  4P96 A;  1PUE E;  3DPL C;  5J6X A;  1ZGJ A;  2YX4 A;  1IRF A;  1JHF A;  5HVQ C;  5L3C A;  2E1N A;  4RAY A;  2VOO A;  2QBY B;  5D5U B;  1RUN A;  4LLN A;  3ZQ7 A;  1Z6T A;  1JXS A;  3JSO A;  4A0Y A;  1MD0 A;  1YTY A;  2K4J A;  1TQI A;  2XKP A;  1WKM A;  4OIN F;  2PFB A;  2RVC A;  3E5X A;  2UWM A;  2IA1 A;  3ZN1 A;  3DQV C;  2JSC A;  1FNN A;  5CVR A;  2W57 A;  1S3J A;  2EV0 A;  1R5G A;  4E70 A;  5BPD A;  1J75 A;  3RYP A;  2QLZ A;  3K9T A;  4EV0 A;  1W5T A;  3P7N A;  4UVB A;  5L3B A;  1F4K A;  4WWC A;  5D4S A;  3F21 A;  4I02 A;  2MLG A;  3BOQ A;  3G3Z A;  1KQ0 A;  1R58 A;  2C6Y A;  3L9F A;  4CZZ A;  4KYW A;  3BRO A;  4KUM A;  1LDD A;  3WTV C;  1E17 A;  4HBL A;  1IXR C;  1STZ A;  1QNT A;  1SFX A;  3KEO A;  1ZN2 A;  4ENJ A;  3KLN A;  3FHZ A;  4IVN A;  4PZJ A;  2ZXJ A;  1BJA A;  2K86 A;  1XGO A;  1O7L A;  5CJ9 A;  1G3T A;  1TW2 A;  3E5Q A;  5JVT A;  3TOB A;  3L2C A;  2NRA C;  3CO6 C;  3RKY A;  3T5X A;  1MZB A;  1B4A A;  1ZRD A;  2PQ8 A;  2MD5 A;  2ISY A;  2KJC A;  2XHK A;  3BJA A;  3W6J B;  4AWX B;  4EQQ A;  4ENK A;  2CSO A;  2A69 F;  2KIU A;  3BY6 A;  5E1Z B;  5F1R A;  4UHT A;  1P4X A;  1F1Z A;  5FFX A;  2HZT A;  2DK8 A;  1WRJ A;  3ZMS A;  2VON A;  3O2P E;  1D8K A;  1F5T A;  3TQN A;  1EH6 A;  2O8X A;  2KIF A;  1ZG3 A;  5E8G A;  3U9G A;  2BBY A;  2P6T A;  1UHM A;  2GXB A;  1LDK B;  4ESF A;  4CGZ A;  1KA8 A;  1S6L A;  3KEQ A;  3I4P A;  4IPA A;  3SZT A;  4L9V A;  1JE8 A;  4HF2 A;  3LQR A;  1QBJ A;  1K6O A;  2Z9O A;  2IA0 A;  3RYR A;  5LBQ A;  2UXX A;  3NQO A;  4I98 B;  4YII A;  3WGI A;  1HKS A;  5E17 F;  1S7O A;  3K0L A;  4KN7 X;  4A2U A;  3Q9S A;  1T98 A;  3J80 Z;  4AIK A;  3VOD A;  1MJB A;  4HX4 A;  2GIV A;  5HLI A;  3IRQ A;  1R22 A;  4AIJ A;  1C0W A;  1P2F A;  3ERE D;  1SAX A;  2V79 A;  2QBY A;  4A6E A;  5E20 A;  5FO5 A;  1DP7 P;  2FQ3 A;  2RC4 A;  5FLX K;  1O7F A;  3HSF A;  3ZPL A;  1U5T C;  3GF2 A;  4OU0 A;  1YW8 A;  1MKM A;  5D6E A;  1TBX A;  3BP8 A;  4MQ9 F;  5HLH A;  2Q2E A;  4M9S A;  1AOY A;  4MGR A;  2GAU A;  3ABU A;  2VBW A;  3R0A A;  1FY7 A;  1ZHF A;  1ZAO A;  1WSU A;  3BDD A;  1XDU A;  3RKW A;  2K7L A;  5HLG A;  2F5F A;  4MTD A;  3GZ5 A;  1B1B A;  4KIG A;  4LB6 B;  3BJ6 A;  2OQG A;  5ILU A;  2DLL A;  3JTG A;  4ASN A;  3N97 A;  2O0Y A;  4IHT A;  3MCZ A;  2HKX A;  3IC7 A;  3KZZ A;  1ZLK A;  3SXY A;  3ISP A;  3LA3 A;  3V8J A;  3WU0 A;  3WOD F;  5D6F A;  5HDG A;  4U7D A;  4KT5 C;  2IRF G;  1FP1 D;  1IUY A;  3KP3 A;  3HSR A;  4XBF A;  1EH7 A;  4I01 A;  1PDN C;  4YIF A;  1R36 A;  1DPU A;  1BC7 C;  1L3L A;  2P7C B;  5LEJ A;  3KP5 A;  5LEK A;  2QEN A;  2O03 A;  3LST A;  2F2E A;  1E2X A;  4KMU X;  4DNC A;  2RV8 A;  4HLY A;  1ZRF A;  2HFH A;  1OMI A;  3E6B A;  4L18 B;  4IXA A;  2JT1 A;  3HOT A;  2Q8K A;  2VOP A;  2UZK A;  1S8N A;  4RAZ A;  1GXP A;  2STW A;  4HQE A;  4LK1 F;  1YLF A;  3ELK A;  4WXD A;  4I2O A;  1KYZ A;  1KYW A;  1QQI A;  2XRN A;  1VTN C;  2ETH A;  1KGS A;  4EVI A;  4WK8 F;  1D3Y A;  4Y17 A;  5ICG A;  1Z9C A;  3TO7 A;  2V1U A;  5CVI A;  2RQP A;  2A61 A;  3K1M A;  3RKX A;  2ESN A;  2HTS A;  2P8T A;  2PMH A;  1HKQ A;  3TO6 A;  2D1V A;  2L02 A;  3ECO A;  4OMZ A;  1U2W A;  2LF7 A;  3K2Z A;  1F9N A;  2XVC A;  1IN5 A;  3GFI A;  2QQA A;  3BWG A;  3DF8 A;  2JZY A;  2G7U A;  4AD9 A;  3T1B A;  2OZU A;  2DT5 A;  3FM3 A;  4RGU A;  3HRS A;  3QU3 A;  3DKW A;  2HDC A;  4UVA A;  3FMQ A;  1JGS A;  3VOE A;  3ULQ B;  1S29 A;  2ISZ A;  3CDH A;  1UHW A;  3H3Z A;  1GVJ A;  2BGC A;  4A5N A;  1LB2 A;  1R1U A;  5TJJ A;  1I5Z A;  1Z7U A;  3F6O A;  2HGC A;  2QWW A;  4I09 A;  5K5R A;  5IT9 K;  5ILS A;  1U78 A;  4PGG A;  1SD5 A;  3H3U A; 
#chains in the Genus database with same CATH topology
 2QEX I;  3O3K A;  3K4J A;  1KU3 A;  1J09 A;  2COB A;  2KLO A;  3QPS A;  1I6X A;  1QZY A;  2VXZ A;  2WTE A;  1OIS A;  4MFE A;  2ZCW A;  3VEP A;  1ZLJ A;  3RJP A;  1S7A A;  3KYC B;  2K9Q A;  1BBY A;  3FBI B;  4A3J J;  1ETV A;  1HSJ A;  2QQ8 A;  2HVR A;  3QU6 A;  3CUO A;  4KA4 A;  5BNG A;  2L7M P;  2MYS A;  3GFL A;  1A6Q A;  3ZMD A;  1XGM A;  2W7N A;  3PJR A;  2LK2 A;  3GYH X;  1WVR A;  1VQO I;  4KNY A;  4PK4 A;  3ONQ A;  1P92 A;  2JTV A;  1V4R A;  4M73 A;  3ASO H;  2WA0 A;  2CUF A;  2L9V A;  4NC6 A;  5GTH C;  3VYT B;  2OCE A;  4JOM A;  4HG2 A;  4LOC A;  2CW0 F;  3K1P A;  1BI3 A;  2FSW A;  3FZV A;  3JRE A;  4IHX A;  5FKO A;  2RNJ A;  2QUF A;  1FC3 A;  3LQQ A;  4WCG A;  3SZG A;  3IH3 A;  1VQ9 I;  1IDZ A;  4HNV A;  2EFN A;  4A0X A;  5K7Z A;  1JJ8 C;  2V6E A;  4A3L J;  3JRG A;  1HA8 A;  1IZ1 A;  1VF9 A;  4N0B A;  3CCL I;  1IRG A;  1AA7 A;  2UV1 A;  2WY8 Q;  1FSH A;  1D5V A;  5DD8 A;  4IF4 A;  3LSM A;  1X1P A;  2VXD A;  2ID3 A;  3PFI A;  2PI0 A;  4BH9 A;  4I0A A;  3DV8 A;  1LVK A;  3AKZ A;  1R1V A;  2WWY A;  1FYL A;  1FYM A;  4I76 A;  5M5W J;  1ZH5 A;  3GW2 A;  4BU2 A;  2EA4 A;  3O6B B;  3K4M A;  4AUX A;  3W3C A;  4IRH A;  4O3M A;  1XB4 A;  2M9H A;  4L9T A;  1MW7 A;  2NAZ A;  3PUF A;  1WJ5 A;  3L2W A;  3F8N A;  2GBY A;  4G6T B;  3K4B A;  4B1R A;  4A3F J;  1MSE C;  4A6D A;  3DCF A;  2VN2 A;  3EYI A;  1NG6 A;  2CFO A;  2IAI A;  3F8M A;  3SEQ A;  1TT5 B;  4QWQ A;  2F48 A;  2W48 A;  2MA3 A;  2VUM J;  2COM A;  2MAB A;  4BBS J;  1BIA A;  4HDV A;  5B66 C;  2R0Q C;  1X58 A;  2CO5 A;  2EPF A;  3MWM A;  2BY2 A;  3ZQH A;  5J4V A;  1R00 A;  1XGS A;  4JX4 A;  3TMO A;  4HRI A;  1OYI A;  2IBD A;  4XKB A;  2DCE A;  4UNO A;  3ZXS A;  1Z91 A;  2ZB9 A;  4ZH4 F;  2Y75 A;  2VC1 A;  3K6G A;  3F3X A;  3QYE A;  4BYY A;  2HPM A;  4UV9 A;  4RB0 A;  2E2J J;  3HRU A;  5EG0 B;  4BS9 A;  3CCR I;  4UUT A;  2ECC A;  2GIZ A;  5EDN A;  2R5Z B;  2FU4 A;  3WTT C;  1O3R A;  3H35 A;  3EPZ A;  2LH9 A;  1J9I A;  4G7O F;  4PJJ A;  1ITY A;  1USS A;  2EWN A;  4EM1 A;  2R7X A;  1TLH B;  1X4P A;  2EK5 A;  1L0O C;  2LKX A;  2XAH A;  2E1M C;  4FIS A;  3M8J A;  1O3Q A;  4LIU A;  2DT6 A;  3PSI A;  4JK1 X;  4WXH A;  4F91 B;  5L3D A;  3IH2 A;  1BA5 A;  4YEJ A;  1JUS A;  2OTL I;  1JT6 A;  3HIF A;  3RKQ A;  3CCQ I;  1BM9 A;  2CS3 A;  3KPH A;  2WB1 N;  4J01 A;  2L9N A;  4C2M J;  2P6S A;  2YSR A;  4A3C J;  4DQ2 A;  1MBJ A;  3KP7 A;  1RI7 A;  2Y48 A;  2IJL A;  3C1D A;  4Q4Z F;  1ETQ A;  3AAF A;  4MO7 A;  3JRF A;  4IHS A;  1U6G A;  2ZNY A;  2EIK H;  4NQW A;  3M8E A;  1TTY A;  2M87 A;  1R6R A;  3P9I A;  1TQP A;  3H5R A;  4FX0 A;  4ESJ A;  1I1S A;  3ABT A;  2DA7 A;  4BHC A;  3QYB A;  3IP4 B;  1XDS A;  3GFM A;  2WAE A;  1KU7 A;  4BE2 A;  3WTY C;  4ZJZ A;  4L9J A;  2L3D A;  1X2N A;  4WXC A;  4XLF A;  2D2W A;  3OIP A;  3F22 A;  3E7L A;  2ZJP F;  2F5D A;  3ML6 A;  3DXJ F;  4ZTJ A;  4Y7N J;  1RNL A;  2BEO A;  3IKT A;  2E7X A;  3RDI A;  1WZ2 A;  2D1H A;  4UY8 I;  3ZQC A;  4CCM A;  2DMN A;  1HDP A;  2P4W A;  3FIS A;  4ZZD A;  5K7F A;  4JP0 A;  4Y13 A;  2OQR A;  1REP C;  1VZ0 A;  1OR7 A;  2MH2 A;  3C3W A;  3OYK A;  3ZGK A;  4UUS A;  4L9N A;  4EJU A;  2DFF A;  4AID A;  3PQJ A;  3FX3 A;  2JUC A;  3QPH A;  4RLQ A;  3I59 B;  3MAJ A;  3LNQ A;  5L3F A;  2CQN A;  1I50 J;  2F6C A;  2FQ4 A;  5IP9 J;  2R7S A;  4B8X A;  3S17 J;  3WTU C;  2DMP A;  3RPU D;  3B02 A;  2LDU A;  3G6E I;  4GYG A;  2A05 A;  2FX0 A;  3CD6 I;  5BOX A;  3KFW X;  5HDK A;  4XR6 A;  3J81 K;  4RGR A;  2VBZ A;  4OOI A;  5CQE A;  2FOW A;  2JPB A;  2AXL A;  4MFD A;  2MW8 A;  2O3F A;  1KQ8 A;  2R93 J;  3NAR A;  3G1O A;  1Y6I A;  5EEA A;  5FRO A;  5LHI A;  3HPH A;  2XF5 A;  2VQL A;  4MIM A;  5KVR A;  4CUG A;  1RIO H;  2AS5 F;  2FOK A;  5C4J J;  2XF7 A;  4RB3 C;  4AYB A;  5FD5 A;  2HPI A;  2E2I J;  4A12 A;  4MTE A;  3ASN H;  5TGT A;  3G71 I;  3CF2 A;  2ZFW A;  3S15 J;  1PYV A;  1QPI A;  4KIB A;  5GP9 A;  3I54 A;  3OYJ A;  3LAJ A;  2DW4 A;  1AKH B;  5F27 A;  1W5C C;  3S32 A;  3ZRG A;  5DM6 F;  1HW2 A;  3U21 A;  1RKT A;  2ZNZ A;  1XN7 A;  1R5H A;  3S2W A;  2GXA A;  4XOT A;  1LFU P;  2LC2 A;  4P5O A;  3GTJ J;  4CH7 A;  1I1G A;  3E3V A;  2R92 J;  1TL8 A;  4LK0 F;  4E7I A;  2CMP A;  1G2H A;  2CJJ A;  2UUZ A;  5CVU A;  3L2R A;  2KQR A;  4D0P A;  2Y0S N;  2PX9 A;  3HYI A;  1U5T B;  2L4A A;  3JAM Z;  1TNT A;  4G12 A;  5GPC A;  1OCC H;  1A5J A;  2PMZ A;  4F92 B;  2EV6 A;  2M45 A;  3S1N J;  2Y31 A;  5DS9 A;  4U7B A;  5ERI A;  2DOA A;  2EBI A;  2KZV A;  3A02 A;  3IWZ A;  4HDU A;  2XC7 A;  2X4H A;  4XLP F;  1MMN A;  1ZG5 A;  2X6X A;  2LNB A;  5LGN A;  1UHS A;  3GWZ A;  1A6I A;  4B09 A;  3HOY J;  2L9R A;  4PJL A;  3CMY A;  1A04 A;  3GZ6 A;  5JLW A;  1I39 A;  1O57 A;  1B9M A;  4ON0 A;  4Q47 A;  1VI0 A;  1WQ2 A;  3QWL A;  2CV0 A;  4XRS G;  2IGN A;  3HOV J;  2YU3 A;  4ZYH A;  2I8D A;  3WG9 A;  3ZQI A;  4UUV A;  3LA2 A;  5FGM A;  3PM1 A;  2V1D A;  2VT3 A;  2WB1 A;  4XM3 A;  3TDZ C;  4LB5 A;  2FBK A;  4HOB A;  4RB2 C;  2CRG A;  5TIS C;  2Z99 A;  1D0X A;  1X2M A;  5CVV A;  4HNU A;  1ON1 A;  2I5U A;  3MKZ A;  3E97 A;  3EET A;  3HHH A;  3IRR A;  1Y39 A;  1MDM B;  3HXL A;  2KIQ A;  2KIS A;  4EJW A;  5FJ8 J;  3W2V A;  2DYS H;  3C7J A;  3FMR A;  3HPG A;  1SFK A;  3KIO A;  5E1W A;  1HXD A;  5E3L A;  3QP6 A;  3EUA A;  4EAT A;  5DTD A;  4G8X A;  3GTQ J;  4IO9 F;  4CO8 A;  5C4X J;  2CFX A;  1P4W A;  4PSW A;  4A93 J;  1D1A A;  3V8L A;  3MKY B;  1UCR A;  4AU7 A;  1B8I A;  3TKY A;  4D5F A;  2NNN A;  2IS1 A;  1XC5 A;  4MEY F;  2HVS A;  2DJI A;  2XPV A;  5H20 A;  2CW7 A;  2LG4 A;  3GLX A;  2OU2 A;  5CLS A;  4RGX A;  1T95 A;  2XAS A;  1B9N A;  3FDY A;  2EFQ A;  2KJB A;  3HTU A;  1FJL A;  2QYO A;  3M9A A;  3IHU A;  2ZME B;  3OOU A;  2MG4 A;  3ZP5 A;  3ROU A;  3DTI A;  1BOB A;  1BJZ A;  1ETW A;  1IN7 A;  3LSP A;  1BOA A;  3FXU A;  3F8B A;  1SD7 A;  4N9I A;  2FEZ A;  3PNV A;  5EEG A;  1W7P A;  3HRT A;  2JA6 J;  1GUU A;  2MSY A;  3QRF F;  1IV8 A;  2HWV A;  2A6T A;  2FBH A;  4DBR A;  3N05 A;  4BEH A;  2E19 A;  2Z5U A;  3GO5 A;  5E3O A;  1YJ9 I;  1E3O C;  3E5U A;  4F93 B;  5J8F A;  1BI1 A;  4F55 A;  3ABM H;  3ZQF A;  2VE8 A;  1P6R A;  4ZDO A;  4LMY A;  4QLC U;  5F04 A;  1Z1D A;  2BVM A;  3H0G J;  4G6Q A;  2F5E A;  1OYW A;  1ZK8 A;  2CQK A;  2A5Y B;  2DFI A;  5LFA A;  2KPM A;  3KX2 A;  3FM5 A;  4ZYG A;  5E18 F;  1IXC A;  1IXS B;  2EFW A;  2OCC H;  1J5Y A;  3CCJ I;  4HST A;  3GX4 X;  3A0B C;  2HYJ A;  3CCE I;  3J7A O;  2NOG A;  1EF4 A;  2RDP A;  2OA4 A;  3R0J A;  2CGP A;  1KU2 A;  2VT2 A;  5KAI C;  4U0V A;  4M9Z A;  5JR3 A;  4FE4 A;  3GLL A;  1VQ7 I;  4RMN A;  4YIR X;  4BUP A;  1JI8 A;  2EA2 A;  4YFN F;  3AG4 H;  2XIG A;  1YYV A;  4N9H A;  1IN4 A;  5HOO A;  3VPR A;  2HDD A;  3GTG J;  4E7S A;  2FRH A;  5H6R A;  2NOJ B;  2QVO A;  5FLM J;  3CLQ A;  3BR3 A;  2M7A A;  3HOS A;  4MEX F;  3FXR A;  3VYR B;  5JFR A;  5DD4 A;  2HDW A;  3R61 A;  1UEL B;  2EIN H;  3U2R A;  1JTY A;  2FBI A;  4BQO A;  2HOA A;  1SD6 A;  2FJ1 A;  4HX8 A;  2K4B A;  1FLI A;  5K7H A;  1UB9 A;  3D0S A;  2GOX B;  2CYY A;  1U3E M;  2HOE A;  1O4X A;  2JA5 J;  2LKP A;  2A6H F;  2B7E A;  2L01 A;  1YE9 A;  5L3G A;  1QA6 A;  4BGD A;  1XG1 A;  2LTP A;  3I58 A;  3ZN0 A;  3UNG C;  3S2D J;  2H6C A;  3PO3 J;  3GCM A;  3QOE A;  1T39 A;  1SD4 A;  1TQM A;  2A07 F;  3CCY A;  5E79 C;  2O61 A;  1ULY A;  3CC4 I;  1BN5 A;  2M0M A;  2PMU A;  1TWH J;  1I3A A;  2EZK A;  2M8G X;  3BR0 A;  3H9J A;  2W25 A;  4R8H A;  3VB2 A;  1QZZ A;  1FOW A;  1OCT C;  4X1E A;  1UJ8 A;  5K5O A;  2R4G A;  2GA2 A;  5DCM B;  2HQR A;  3X2Q H;  3FMS A;  1BR1 A;  4KIS A;  3GFJ A;  2VBY A;  2MGQ A;  4MQV A;  1TZL A;  2PJR B;  1ETY A;  2QSF X;  3M1E A;  3BTJ A;  4LG0 A;  5FKK A;  3OL4 A;  2WBM A;  4CCL A;  3DU5 A;  1T8I A;  2YS9 A;  4A3I J;  1OFC X;  2K85 A;  3SQN A;  1ZGA A;  1LNW A;  2O6G E;  2V9V A;  4U88 A;  5FFZ A;  2FXA A;  2W00 A;  2W24 A;  2DQL A;  4ETS A;  2DO7 A;  4BXU A;  4BXF A;  2GA1 A;  1J2X A;  1X4O A;  1G3S A;  5LRS A;  1ZEL A;  2V26 A;  4B48 A;  3S93 A;  2XSD C;  4H0E A;  1BW5 A;  1XD7 A;  4I7H A;  4DBQ A;  3PQK A;  1PJR A;  2ME0 A;  2QQB A;  3RI4 A;  1FEX A;  1YIT I;  3B73 A;  2K27 A;  2DA2 A;  1ZAR A;  1K78 B;  1ON2 A;  2JUG A;  4RAF A;  1NG7 A;  2BE5 F;  3OV8 A;  4CYC A;  2E35 A;  3CES A;  1X1C A;  2HS5 A;  1BC8 C;  4CYC B;  5GPA A;  2OC6 A;  2Z1D A;  3SHF A;  3JRC A;  2DPD A;  4CYD A;  3A4C A;  4M6X A;  2HYG D;  2Y2Z A;  3HC7 A;  2MC3 A;  1K4S A;  1FBU A;  2DPU A;  1OPC A;  1RET A;  2ZKZ A;  1T38 A;  1APL C;  3L2U A;  4OIP F;  1FSE A;  3GVA A;  1ZRE A;  2DDA A;  5EGO B;  4U0Y A;  3S8P A;  5B5E C;  1U8B A;  2R3S A;  5E3N A;  4I0B A;  2LRE A;  2XAQ A;  2ZXW H;  4XIC A;  2BXY A;  5D5W B;  3TW6 A;  4QIW N;  3B6C A;  2E2H J;  2EFP A;  1BIB A;  5CKT A;  3SFZ A;  3DTK A;  3O8G A;  5DV5 A;  1HBX G;  2XRO A;  2PJP A;  3ZR8 X;  2OAZ A;  4B43 A;  1HW5 A;  2QSH X;  3MVP A;  3TO9 A;  3IL2 A;  2XAJ A;  3V8K A;  4Z2Y A;  4M3D A;  5HNF A;  1WH7 A;  1X3U A;  4KIC A;  1JKQ C;  4W1U A;  3BG5 A;  1X1D A;  2X51 A;  4I6Z A;  3L00 A;  1ETX A;  4MNU A;  5BMZ A;  2MFZ A;  2IS6 A;  3GUD A;  1Z67 A;  4BAC A;  3OYI A;  3N4M A;  5LD2 C;  4PCQ A;  2OUM A;  3BZ6 A;  3CJQ B;  3FWE A;  3TGN A;  4ANJ A;  3HEF A;  3R60 A;  3MN2 A;  2VB6 A;  3FIW A;  1R4N B;  3CCV I;  4EM2 A;  2XV4 S;  5J4Y A;  1TT0 A;  1AHD P;  2BYV E;  3OYA A;  2V1X A;  3NWT A;  2F5C A;  3BR6 A;  3GEZ A;  2JVG A;  5JVG F;  2BZT A;  2EZI A;  1YS7 A;  3DFG A;  5LGU A;  3TED A;  1Z7L A;  2LY1 A;  2OD5 A;  2IGM A;  2NYX A;  3DEW A;  2NVT J;  3F72 A;  1Q1H A;  1YJN I;  1MH4 A;  1W1W E;  3S3M A;  4Y15 A;  1JKP C;  1NK2 P;  2W82 A;  1FP2 A;  1R23 A;  2E71 A;  2KRH A;  4IZZ A;  1UZC A;  1BL0 A;  1VND A;  2OBP A;  4BQQ A;  3H9G A;  1FBQ A;  4E7Z A;  2DBB A;  5JI6 A;  4XLH A;  3AL0 C;  3FXQ A;  3OYC A;  5BPI A;  3MMY B;  2HQ5 A;  1HST A;  3C2H A;  1CF7 B;  1UFM A;  2OV7 A;  3P9K A;  4HF0 A;  1B72 A;  3B6A A;  2R7Z J;  3OS2 A;  3F23 A;  1LVA A;  3DU6 A;  1MNE A;  4JX6 A;  1QU3 A;  2F5V A;  2XB5 A;  3C18 A;  3J80 K;  1W4M A;  1OR7 C;  1W7P D;  2NS8 A;  2H94 A;  4RB1 A;  2H8W A;  2J5P A;  3OL3 A;  2Y0M A;  4Q48 A;  5EEH A;  1UMQ A;  3HUG B;  4M72 A;  3QPL A;  3DLA A;  2DMQ A;  2R7U A;  4HYE A;  3KP2 A;  3JRD A;  1GVD A;  2XAG A;  3A03 A;  1OCO H;  4CXF A;  3CO7 C;  1KU9 A;  1V3F A;  4EMS A;  1VQP I;  3HGG A;  3MFK A;  3Q5F A;  2R7O A;  1W0T A;  2M30 A;  3CJN A;  2IP2 A;  3HRM A;  5FLX Z;  3CUQ A;  1W7P B;  2W4S A;  1IRX A;  3QOP A;  1SVL A;  2KP6 A;  5DCF A;  4FE7 A;  4C3I J;  5GAH J;  5TRD A;  1DDN A;  1MMA A;  1U8R A;  3CTA A;  1B59 A;  2DK5 A;  3F0C A;  3FXL A;  5EZG A;  3EDP A;  1J7K A;  2IA2 A;  4LLL A;  1VQ8 I;  1OCP A;  3V7S A;  4RS8 A;  2NNY A;  4O6J A;  2H8R A;  1YW9 A;  1Z6R A;  4XSX F;  3PFY A;  1MGT A;  4G94 A;  2KKO A;  4XON A;  1B8I B;  3H3V K;  5DUI A;  1P4A A;  3C2B A;  5FKL A;  4ENM A;  2VJ4 A;  2LY2 A;  3F8F A;  5BQT A;  4ESB A;  1PP8 F;  1XTA A;  4RGS A;  5D5X B;  3I0T A;  3OR1 C;  2DA3 A;  4IJA A;  4C30 A;  3VWB A;  3J81 Z;  2EIM H;  3S1Q J;  4UXN A;  3PO2 J;  1MDM A;  4M71 A;  3CUQ B;  5LHG A;  3BR5 A;  1FYK A;  1EV7 A;  3MD2 A;  2EB7 A;  2CWE A;  5J1U A;  3WTW C;  3IWF A;  4V2G A;  2QA4 I;  2P5V A;  3SYT A;  1LEB A;  2G0E A;  1I27 A;  5KAF C;  3OS1 A;  4GGG A;  4GO1 A;  2FE3 A;  4OIO F;  3HUG A;  1Y0N A;  2WY7 Q;  2DA6 A;  1TP4 A;  1R71 A;  3V7R A;  1EH8 A;  3KYD B;  3KET A;  5LGT A;  2R7W A;  1T56 A;  3M8F A;  1HDD C;  2IVM A;  1ZGW A;  2FML A;  2BV6 A;  1B72 B;  2M0C A;  1CF7 A;  2RN7 A;  5FRN A;  1SFO J;  5IY5 H;  2OTJ I;  2YR2 A;  1FWZ A;  1JUM A;  5D5V B;  2STT A;  4HEA 2;  4JQF A;  2EZH A;  1QO0 D;  2GXG A;  3D5L A;  2O8K A;  3WU2 C;  1RZ4 A;  2NS0 A;  2PEX A;  2QZ8 A;  4Q5S F;  3SZP A;  4A0Z A;  3VDX A;  2Z2S B;  1U5T A;  5AON A;  3WE2 A;  1ETO A;  3E6C C;  2H1K A;  3Q9V A;  2VKE A;  4P9F A;  3E6M A;  1OJL A;  3W6K B;  3BJO A;  4L0Z B;  1FT9 A;  2OZ6 A;  1ZQ3 P;  2P5L C;  1YFH A;  2DFH A;  4XRM A;  1W0U A;  2WV0 A;  2DI3 A;  1PP7 U;  3NAU A;  4AYB N;  4BJT A;  1FTT A;  2O9L A;  4DZJ A;  3I5U A;  5ILV A;  1ERD A;  1OYY A;  2VQG A;  4JYK A;  3DEU A;  2P5K A;  2DAO A;  2M7B A;  2H09 A;  4KN4 X;  5D4R A;  1YQA A;  4P1W A;  3CC2 I;  4ZTF A;  3CP8 A;  3MQ0 A;  3HL2 A;  3VFZ A;  2Z16 A;  3CMA I;  1T0F A;  2LF8 A;  4PJ0 C;  2KL4 A;  3OOP A;  1Z05 A;  1DPR A;  4ZZL A;  5BS6 A;  3OWT A;  3QAH A;  4L5I A;  4P55 A;  4OAZ A;  5EF6 A;  4RBO A;  3W2A A;  2R7V A;  1JHH A;  5J40 A;  4XL9 A;  1JUP A;  4KIT B;  2FNP A;  1BR4 A;  2KFD A;  4IHY A;  4A3D J;  3RZO J;  1IN8 A;  1KQ9 A;  3HTS B;  5KK1 A;  2Q1Z B;  2KIM A;  1J0R A;  1Y0U A;  1Z0X A;  4M3G A;  4OWR B;  1HLV A;  1TWA J;  2HNH A;  2E7W A;  2LR8 A;  5E1X A;  2VJI A;  3JRI A;  4HPQ A;  2E5Z A;  3K70 D;  4EJT A;  1HQC A;  5JLX A;  1Z3X A;  1LJ9 A;  3I59 A;  4B3X A;  1SFU A;  2L4M A;  4BBR J;  4R1H A;  4BY7 J;  1R1T A;  1U0J A;  3E0J B;  5EGO A;  3OSF A;  1CGP A;  5F6F A;  4ENN A;  4R79 A;  3S1M J;  3HOW J;  3EQL F;  2A6E F;  2HU9 A;  5HS7 A;  3LSG A;  4HW0 A;  5B1B H;  1LQ1 A;  2FD5 A;  4EJV A;  1J59 A;  5HLT A;  3PNY A;  2G9W A;  5CVJ A;  1QPM A;  3EUH A;  4NB5 A;  3HJE A;  1RUO A;  3BQY A;  4HAM A;  4HV6 A;  1IAW A;  2WV1 A;  2VJJ A;  3DKY A;  1K78 A;  3OYD A;  2J5O A;  1D8J A;  5E8I A;  1IC8 A;  1FOY A;  5C3E J;  4JBA A;  5HDN A;  4CDG A;  1MH3 A;  1FMW A;  2JJ7 A;  1XMA A;  3ESW B;  3QOD A;  2K3F A;  3FF5 A;  3LMM A;  1X3Z B;  2HQN A;  2L54 A;  5GAE J;  4L5E A;  5AIQ A;  1RES A;  3E1S A;  4YFX F;  1YJW I;  2ZBK A;  3JW4 A;  4S0H B;  3L1P A;  2ELH A;  1N75 A;  4XKV A;  3ZQL A;  4NQW B;  4GFB A;  1WI3 A;  2ZC2 A;  2VQH A;  2M34 A;  4AVP A;  1MMD A;  3P9C A;  2DTZ A;  1LKX A;  2BY1 A;  2VAS A;  4ITV A;  5D8L B;  1RR8 C;  2ESH A;  3CJR B;  2Q0O A;  3BT9 A;  3CC7 I;  1LFP A;  4G7H F;  4LG0 B;  2CUJ A;  4KFC A;  2OF7 A;  4CZC A;  4Y33 A;  1XSD A;  2M1B A;  2PJR A;  3IH4 A;  3KP4 A;  3DP7 A;  4N4O B;  4IX7 A;  2IS4 A;  1X1B A;  1DU0 A;  3WTZ A;  1FMV A;  2XRL A;  3BPX A;  1SVM A;  3TOA A;  1OQY A;  5DCM A;  1XMK A;  2O7O A;  3I71 A;  1BR2 A;  2I10 A;  2A3S A;  2R7D A;  1K61 A;  5HNH A;  4RDU A;  5HS9 A;  4BY1 J;  3FXM A;  1B6A A;  3Q0U A;  4ZC3 A;  2LFB A;  4HV5 A;  2XAF A;  4LFU A;  2L9S A;  1IN6 A;  2X6O A;  4NHJ A;  1O3S A;  3IUO A;  3NWS A;  2JSP A;  5IT3 A;  1LUJ B;  3TDU C;  2VPR A;  3KP6 A;  4ZDP A;  1TNS A;  3S16 J;  1WPK A;  3CCM I;  1QVT A;  2X1D A;  1RKW A;  3K1N A;  3T8T A;  1ONV A;  1T2K A;  3ECH A;  3CQZ J;  3GBG A;  3MKW B;  3RPQ A;  2HTJ A;  4AVZ A;  2V9K A;  1PVE A;  3RPU A;  2RQQ A;  3OR2 C;  4U0W A;  5IYD J;  2KRF A;  5IOY A;  4FET A;  2BXZ A;  4CIC A;  2PMZ N;  3V42 A;  5A2Q Z;  4LJZ F;  2F4M B;  2GZW A;  3R6S A;  1DUX C;  1YW7 A;  2K9S A;  1UG0 A;  1G6N A;  3CME I;  2XSJ C;  2GOM A;  4PJM A;  5LLQ A;  2XUB A;  2VKH A;  4FHT A;  2VQC A;  1W5S A;  5DUK A;  1X3W B;  3Q0V A;  4M9X A;  4QTR A;  2PLY A;  3KZY A;  2M3A A;  1R49 A;  1XS9 A;  3WTX C;  2V7F A;  3HKZ N;  4M3E A;  4D5C A;  4HZF A;  4KDP A;  2E5N A;  4OAY A;  3RTR A;  2E1C A;  3OY9 A;  4LD5 A;  4BL0 B;  4OMY A;  1VQ5 I;  2PG4 A;  2PBI A;  5EYR A;  3OS0 A;  3ZMV A;  4YEL A;  4IL6 C;  5A2Q K;  5GAD J;  1YG2 A;  4RLF A;  3KLO A;  2NVX J;  4HQM A;  2D45 A;  1H9T A;  1VQL I;  2XF6 A;  4CHU A;  3MZ8 A;  3CF5 F;  3BC8 A;  4L0Y B;  2KDO A;  2WC2 A;  4NUB A;  1YS6 A;  2V1N A;  4FTH A;  2M5W A;  1GXQ A;  2BOL A;  2QQ9 A;  3ZMZ A;  4MLO A;  3DLL F;  5J3L A;  3REO A;  2HKO A;  2DU9 A;  2MBF A;  4IQ4 A;  5DDG A;  1K83 J;  4J19 A;  2P81 A;  3W2W A;  3AL0 B;  2GWR A;  2LP0 A;  2KRC A;  2IT0 A;  5EZH A;  3BLY A;  4BEH B;  1KON A;  2K5C A;  1IF1 A;  2A5W A;  3GTO J;  5J1Y A;  1U9N A;  3TW7 A;  3SEZ A;  4Z6Y A;  5FLV A;  4PGH A;  4XN0 A;  5AIP A;  1ENH A;  3DBR B;  3GTM J;  3JCU C;  1NHA A;  1XSV A;  3F8C A;  5IYB J;  5F64 A;  3S14 J;  1SFE A;  4II3 A;  4HLX A;  3FHN A;  4IHW A;  3Q0W A;  2ZME A;  3HBL A;  4LIT A;  3ABL H;  4YG2 F;  2VLA A;  2ZO4 A;  1WWX A;  3KE2 A;  1G3W A;  4MHG A;  4XKC A;  2VE9 A;  3I64 A;  1O3T A;  5ICE A;  4RM3 A;  3MZY A;  1WCM J;  4EGY A;  1UST A;  5K5Q A;  1V5G A;  2G7H A;  2JRT A;  4IOA F;  2FNA A;  1HC8 A;  3COA C;  2IGO A;  1AWC A;  2LOO A;  1QZE A;  4NDL A;  4XQF A;  3WHB A;  3G4S I;  1SAN A;  2M4K A;  4OIR F;  3QP5 A;  4XMY A;  1K7A A;  3VYS B;  1IV6 A;  4M3F A;  1F43 A;  2KT0 A;  5FKN A;  2JA8 J;  4LIV A;  1E3P A;  4OIQ F;  4EEF G;  4HA8 A;  1G8X A;  3OYM A;  2YPR A;  2VIX A;  1IW7 F;  4XSZ F;  1ODD A;  4UVC A;  1YO5 C;  2EFO A;  4IRI A;  4RA2 A;  4M6Y A;  2L7F P;  3FBN B;  2ECB A;  3S1R J;  4GRI A;  5IP7 J;  4K2E A;  4KIF A;  2DA4 A;  4BHP A;  4CCJ A;  4F7Z A;  4A5M A;  2VPL A;  3K69 A;  2LVS A;  1TWC J;  3PL8 A;  1V54 H;  5KCM A;  3JSP A;  3U1D A;  3R4K A;  2Y9Y A;  3V7C A;  1MJ9 A;  2X0L A;  3D5R C;  4D7N A;  1V5E A;  2VBX A;  1FIP A;  2P7V B;  4AIH A;  4G9Y A;  3T8R A;  1FOX A;  3LSI A;  5K1Y A;  5FD6 A;  5H6Q A;  1GV2 A;  1XGN A;  3L09 A;  3ERM A;  1XCB A;  2MH9 A;  5CYV A;  1GLN A;  2K40 A;  1G4D A;  2FA5 A;  3E6D A;  2RKH A;  3NEU A;  3MEX A;  1Z21 A;  4BDY A;  4YFK F;  1YX5 A;  1BI2 A;  2XDV A;  5ICF A;  4ZYE A;  4KMF A;  2QCO A;  1HF0 A;  4EGZ A;  4EJO A;  3L7W A;  3MZH A;  3H92 A;  4CA0 A;  4ZYD A;  4D7M A;  1D0Z A;  2MLK A;  3HDD A;  3BG9 A;  1UG2 A;  2MD0 A;  2YX7 A;  1D0Y A;  1VQM I;  2B9S A;  2EV5 A;  3I53 A;  2ZJQ F;  1MBE A;  4UV8 A;  3WHC A;  1Z77 A;  4WX9 A;  3CUQ C;  2DTR A;  2P0W A;  3K4L A;  4GDF A;  3BG6 A;  4PFP A;  2K9L A;  2GLO A;  3G73 A;  4M74 A;  2HI3 A;  4N4N B;  3RCO A;  1H0M A;  3WTS C;  3J7A Y;  2H1L A;  3RIR A;  5B1A H;  1AKH A;  3VYU B;  4IRG A;  1LFB A;  2R7Q A;  3F9K A;  2BY0 A;  3LA7 A;  4XN3 A;  3PIP F;  2LD5 A;  1IG7 A;  1MBK A;  3HSE A;  4IOC F;  1H9G A;  3WU1 B;  1W36 D;  3DPU A;  2EJR A;  1HOM A;  4X0G A;  1QGP A;  3IKV A;  2IW5 A;  3HZJ A;  5EJC A;  1HKT A;  3FK7 A;  5ED4 A;  4G7Z F;  2JA2 A;  1ZRC A;  2QKM B;  3OSG A;  4FT8 A;  2ID6 A;  2LY9 A;  4BE1 A;  1JKO C;  2Y30 A;  1OLT A;  3T0Y A;  1K4T A;  2UXN A;  4XRF A;  3NRV A;  4BE0 A;  3ZQG A;  2B0L A;  4IKF A;  5FKM A;  1GHC A;  5D8K B;  1SMY F;  3BG7 A;  2EIJ H;  4S05 A;  4I99 C;  2DQR A;  3OIQ A;  2EIL H;  2W84 A;  2XGD A;  3GXO A;  3DKX A;  4BAY A;  4II2 A;  1R7J A;  2DDB A;  2JRM A;  1POG A;  2BY3 A;  2AQF A;  4ZYA A;  2JN6 A;  3OYG A;  1ZG1 A;  2JPC A;  1IO2 A;  2K02 A;  3CDL A;  9ANT A;  2AO9 A;  4XOR A;  1K79 A;  2HEO A;  4HF1 A;  6PAX A;  2R7F A;  1T6S A;  3DPT A;  3WE3 A;  3QYF A;  2K9M A;  2Z3Y A;  1Y8R B;  2VC0 A;  5FRM A;  3UR3 C;  1ZYR F;  2H27 A;  2LSO A;  3F6V A;  3OYB A;  3OIO A;  1V5F A;  1Q1V A;  4UUS B;  2CUE A;  4WF2 A;  1T08 B;  4M3B A;  3M7G A;  1JKR C;  2HOS A;  4O5V A;  2A68 F;  4CCN A;  2GM4 A;  1FPQ A;  1VQ6 I;  4GCV A;  3M1C A;  3WGG A;  1FOK A;  5ICC A;  1RPW A;  1SVO A;  2H6B A;  5J8C A;  3RZD J;  1MNM C;  3JTH A;  4DYC A;  3EYY A;  1WI9 A;  3LWF A;  2LBF B;  1FZP B;  4BNC A;  1EKE A;  3JRA A;  2F4O B;  5F0H A;  1SMT A;  2WAD A;  3OMY A;  2ACJ A;  1XSX A;  3CMM A;  1BW6 A;  4FX4 A;  1LE8 B;  3HHG A;  1XCV A;  2KMU A;  2XGX A;  1SAU A;  1JGG A;  1H8A C;  2PN6 A;  4CSW A;  2XAU A;  3HOX J;  2M8E A;  4E7K A;  5CPR B;  2E60 A;  2CV1 A;  2XKO A;  5JHU A;  3DBH B;  1MSF C;  2V6C A;  1FX7 A;  1LDJ A;  3FK6 A;  2CG4 A;  2ADU A;  5F0C A;  4A3B J;  3KZI C;  4TV7 A;  3QQA A;  3K4N A;  4XLN F;  2VJ5 A;  3DBL B;  4G6D A;  3BCA A;  4GXO A;  1TWG J;  4GYI A;  3HGY A;  4X6A J;  2HZD A;  2ZJ2 A;  3LAP A;  4EM0 B;  1MJA A;  3WGH A;  4HX7 A;  4LGW A;  5LHH A;  2DOD A;  4DZP A;  1WFX A;  1E3H A;  2FF4 A;  2DMT A;  1FIA A;  3CCU I;  1QHH D;  1HW1 A;  3K2A A;  4BHB A;  2IPQ X;  5DEQ A;  5DYM A;  2IGK A;  4AC0 A;  1Z3Y A;  1TWF J;  3CP2 A;  4L5J A;  1YIO A;  2K9N A;  2M4G A;  3BPV A;  3OYN A;  2CH0 A;  2R5Z A;  2L2O A;  3JAM K;  5EG0 A;  1BI0 A;  3H36 A;  5LRR A;  4BQA A;  2RGV A;  2W1O A;  1NK3 P;  1G3Y A;  2TDX A;  3DWL E;  2GQQ A;  1D1B A;  2W85 A;  5IP6 A;  4PFO A;  1VQN I;  4DOZ A;  1P7J A;  5IOZ A;  4BDZ A;  1R9T J;  2VOD A;  3CLO A;  1GDT A;  5IT9 Z;  1TW3 A;  2WAF A;  3H0D A;  4BXX J;  4E4H A;  2AHQ A;  4NC7 A;  2L7K A;  3LSH A;  1QHG A;  3LL7 A;  2QM3 A;  3ZMT A;  2KZG A;  3QPT A;  4W97 A;  1MND A;  2VL8 A;  3ZMU A;  3PUB A;  1ZR2 A;  2LKS A;  2Z33 A;  1OKR A;  1T33 A;  2HYF A;  3C2G A;  4PDK A;  3V4G A;  5L3E A;  3SJM A;  2FMY A;  3IAM 2;  1DU6 A;  1ACI A;  1FBS A;  1MBG A;  1OCR H;  3RQ4 A;  4S04 A;  2Y0S A;  2EZL A;  2YU9 J;  3KCC A;  1LEA A;  4F3Q A;  3LFK A;  2JK3 A;  2RAE A;  4LLG F;  5FB2 A;  5HS8 A;  4P9U A;  2HR3 A;  4P96 A;  3TP0 A;  3K70 C;  1PUE E;  3DPL C;  4IHV A;  1ZR4 A;  3D5S C;  5J6X A;  4H4K C;  1ZGJ A;  2YX4 A;  1N78 A;  3G2B A;  2N8G A;  1IRF A;  1JHF A;  4FAS D;  5HVQ C;  5L3C A;  2E1N A;  3BG3 A;  4RAY A;  2VOO A;  3JRB A;  2QBY B;  1ORK A;  3OYL A;  1TC3 C;  5D5U B;  4DIQ A;  5B3S H;  1RUN A;  4LLN A;  2CQX A;  3ZQ7 A;  1Z6T A;  1JXS A;  2DFE A;  3JSO A;  4A0Y A;  1MD0 A;  2VKV A;  2WAQ A;  2ZSH B;  2K4J A;  1YTY A;  2V9P A;  1TQI A;  2XKP A;  1WKM A;  4XNF A;  4OIN F;  3SDG A;  2NVY J;  2PFB A;  1S5L C;  1IUF A;  2R5Y A;  2RVC A;  3E5X A;  2UWM A;  2IA1 A;  3ZN1 A;  3DQV C;  2DJN A;  3AFH A;  3HOZ J;  2JSC A;  1FNN A;  5CVR A;  1OCZ H;  2W57 A;  5M5X J;  3CDI A;  1S3J A;  2EV0 A;  1R5G A;  5F0F A;  2BHY A;  4E70 A;  5BPD A;  3PNT A;  1J75 A;  2E36 A;  4C3H J;  3RYP A;  2ZXH A;  2QLZ A;  3K9T A;  4QPQ A;  2HXO A;  4EV0 A;  1W5T A;  3P7N A;  4UVB A;  3ABK H;  3FXK A;  5DM7 F;  2MC4 A;  3H1C A;  3BTC A;  5L3B A;  1F4K A;  2E34 A;  4WWC A;  5D4S A;  3F21 A;  4I02 A;  5H2F C;  2MLG A;  1MMS A;  3BOQ A;  3G3Z A;  1PUF A;  5J47 A;  1KQ0 A;  3S2H J;  3KEY A;  1R58 A;  2C6Y A;  2E1M B;  1RC9 A;  3L9F A;  1YX3 A;  1WH5 A;  1JJ6 C;  2QKL B;  1S7E A;  4CZZ A;  4KYW A;  3BRO A;  4KUM A;  3I56 I;  1LDD A;  2OPT A;  3L2V A;  2DMU A;  3DEE A;  3WTV C;  2R7T A;  1E17 A;  1DGR M;  4HBL A;  1IXR C;  1STZ A;  2RNG A;  5E3M A;  1QNT A;  1VFC A;  3HOU J;  2X9D A;  1GT0 C;  1SFX A;  3KEO A;  1ZN2 A;  4ENJ A;  3KLN A;  2IEK A;  3FHZ A;  3LOC A;  4IVN A;  5GAG J;  2HOT A;  4PZJ A;  2ZXJ A;  2ME6 A;  1BJA A;  2K86 A;  1XGO A;  3VSK A;  2CQQ A;  1O7L A;  4C2U A;  5CJ9 A;  1G3T A;  1TW2 A;  4DGW B;  3E5Q A;  4DYR A;  5JVT A;  4E7H A;  2K3P A;  4XKW A;  3TOB A;  1I3Q J;  3L2C A;  2EQR A;  2NRA C;  2AQE A;  3A0H C;  3RKY A;  3T5X A;  3CO6 C;  1MZB A;  4AM3 A;  1B4A A;  1ZRD A;  3AG1 H;  4PSX A;  4NNJ A;  2JQ7 A;  4XRS A;  3K4C A;  2NS7 A;  1SEU A;  2PQ8 A;  2MD5 A;  4A3E J;  2ISY A;  4D1Q A;  2KJC A;  2XHK A;  3BJA A;  3W6J B;  3A1Y A;  4AWX B;  3RQI A;  4EQQ A;  4ENK A;  3A01 B;  2CSO A;  2A69 F;  1H88 C;  2CU7 A;  1WJB A;  3H9Q A;  2KIU A;  4BQN A;  3BY6 A;  5E1Z B;  5F1R A;  1MMG A;  2Y9Z A;  2X6Y A;  2X6W A;  4UHT A;  3FXJ A;  1RRJ A;  1P7I A;  1S9H A;  3MKL A;  3ZQQ A;  1P4X A;  1F1Z A;  5FFX A;  2HZT A;  2DK8 A;  1YHQ I;  1AU7 A;  4DW6 A;  2JVH A;  4KT6 A;  1EJ9 A;  3GTP J;  4CCO A;  1WRJ A;  3ZMS A;  2VON A;  2XGE A;  3GTK J;  3O2P E;  3GZN B;  1D8K A;  1XX5 A;  1F5T A;  1KZH A;  3A2K A;  4BJ5 C;  3TQN A;  1EH6 A;  3M07 A;  1WJA A;  4FQG A;  2O8X A;  4C3J J;  4V2F A;  2KIF A;  3M3Y J;  1HCR A;  1ZG3 A;  2LYC A;  4UB6 C;  5E8G A;  3HKZ A;  2DOE A;  3U9G A;  2BBY A;  2P6T A;  1UHM A;  2NVU B;  2GXB A;  1LDK B;  4ESF A;  1Y1V J;  5F1J A;  4CGZ A;  3ZCO A;  1PUF B;  4RAG A;  3BQZ A;  1KA8 A;  1S6L A;  3KEQ A;  2BW3 A;  3I4P A;  3UKG A;  2VI6 A;  2HXI A;  4FCY A;  4IPA A;  3SZT A;  4L9V A;  1JE8 A;  4HF2 A;  4XOP A;  3LQR A;  4BKX A;  1QBJ A;  4JX5 A;  3EUH C;  4DYQ A;  1K6O A;  2X1E A;  2Z9O A;  2IA0 A;  3RYR A;  5LBQ A;  4XLA A;  2UXX A;  3NQO A;  4I98 B;  2FUG 2;  4YII A;  3WGI A;  4M6V A;  1HKS A;  4ZDL A;  3SDB A;  1WHU A;  3K4K A;  5E17 F;  1S7O A;  3K0L A;  2KDZ A;  4J00 A;  2L0K A;  4KN7 X;  4A2U A;  1P9Q C;  3Q9S A;  2DOF A;  3EUK L;  1T98 A;  3OYE A;  3J80 Z;  4AIK A;  3VOD A;  2ICW G;  4C2T A;  1MJB A;  4HX4 A;  2R5Y B;  3LSK A;  1LPQ A;  2ELJ A;  4A69 C;  4A3M J;  2GIV A;  2JMW A;  2YUS A;  5HLI A;  2QF7 A;  2V4J C;  1YOV B;  3IRQ A;  1R22 A;  4AIJ A;  1C0W A;  1P2F A;  3ERE D;  3LSJ A;  1SAX A;  2V79 A;  2QBY A;  4A3G J;  4A6E A;  5E20 A;  2DA5 A;  3HG9 A;  1MBF A;  3I4N J;  1M1E B;  3LFU A;  5FO5 A;  1DP7 P;  3HM5 A;  4YRV A;  2FQ3 A;  1X1A A;  2RC4 A;  5FLX K;  1O7F A;  4ABZ A;  1SC7 A;  1YRN B;  3HSF A;  3BTL A;  2D5V A;  2ZSI B;  4XLE A;  3ZPL A;  1U5T C;  3GF2 A;  4QPO A;  2NVQ J;  3TBI A;  4U87 A;  3WG7 H;  4OU0 A;  1F36 A;  1YW8 A;  3PIO F;  1A35 A;  1MKM A;  5D6E A;  1TBX A;  3BP8 A;  2LRD A;  4MQ9 F;  5HLH A;  2Q2E A;  3Q3S A;  1N25 A;  2NXN B;  3DTE A;  3I9V 2;  4M9S A;  4V19 K;  1AOY A;  2VKD A;  5IYC J;  4MGR A;  1DGW Y;  2GAU A;  3IAS 2;  1ETK A;  3ABU A;  1NH3 A;  2CV2 A;  1Y8Q B;  2VBW A;  1FY7 A;  3R0A A;  4E7L A;  3PSF A;  5KHD A;  3FKJ A;  4LG3 A;  1ZHF A;  1YI2 I;  1ZAO A;  1WSU A;  3BDD A;  1V55 H;  1XDU A;  3FXO A;  1IGN A;  3RKW A;  2K7L A;  5HLG A;  3G1L A;  2EH3 A;  2F5F A;  4MTD A;  2L7Z A;  2XB0 X;  4Y4R A;  3GZ5 A;  1B1B A;  4KIG A;  4LB6 B;  2DYR H;  3BJ6 A;  5JHF A;  4E7J A;  2OQG A;  5ILU A;  2DLL A;  5M3M J;  3JTG A;  1H89 C;  5M3F J;  1D5Y A;  4ASN A;  3N97 A;  1ZKG A;  2O0Y A;  4IHT A;  3MCZ A;  2HKX A;  4HSR A;  2OJE D;  4KJZ A;  2JWT A;  3IC7 A;  3KZZ A;  1ZLK A;  4Y3O A;  3BZC A;  2QSG X;  4NC8 A;  3SXY A;  1I6H J;  3ISP A;  3LA3 A;  3V8J A;  3WOD F;  3WU0 A;  1W36 C;  3K10 A;  5D6F A;  5HDG A;  4RM2 A;  1Y1W J;  4U7D A;  5GTI C;  4KT5 C;  5IPA A;  3G1M A;  2IRF G;  1A31 A;  1FP1 D;  3AG2 H;  2Q2E B;  4E6K G;  1IUY A;  3KP3 A;  3I3L A;  3HSR A;  3IV5 A;  4XBF A;  1G59 A;  1EH7 A;  4I01 A;  1DQU A;  1PDN C;  4YIF A;  1D1C A;  1R36 A;  2B63 J;  1DPU A;  1BC7 C;  1L3L A;  1YRN A;  2ZFU A;  1LE8 A;  2P7C B;  5LEJ A;  4B3A A;  3KP5 A;  5LEK A;  1QRY A;  3BZK A;  2QEN A;  2O03 A;  3S3N A;  4Y52 J;  3K7A J;  3LST A;  2F2E A;  2LBF A;  3TP3 A;  4PJN A;  1CQT A;  5J1R A;  1E2X A;  1NTC A;  1JTX A;  4KMU X;  4DNC A;  5C44 J;  2TRT A;  1ZTR A;  1WJC A;  2RV8 A;  1WJF A;  3TL4 X;  3AG3 H;  1FTZ A;  4HLY A;  1ZRF A;  2WAQ N;  3S3O A;  3BCB A;  4F52 A;  2HFH A;  4DJA A;  2LLK A;  1OMI A;  3E6B A;  2X48 A;  4L18 B;  4IXA A;  2JT1 A;  2IXS A;  2CQ7 A;  3HOT A;  2RRE A;  2Q8K A;  2VOP A;  2UZK A;  2KHM A;  3H5N A;  1S8N A;  4RAZ A;  2F4I A;  1GXP A;  2STW A;  1VQ4 I;  3ZOB A;  3D1N I;  1QVU A;  1RR7 A;  4B4C A;  3U1K A;  3CCS I;  1T0F C;  4C9Y A;  3I4M J;  4XID A;  3LSR A;  4HQE A;  4LK1 F;  1DP3 A;  1YLF A;  1VQK I;  3ELK A;  1Y56 A;  1UAA A;  4WXD A;  4I2O A;  1KYZ A;  1KYW A;  5HOD A;  1QQI A;  1U9O A;  2BVL A;  4IQJ A;  3P5J A;  2XRN A;  2BW3 B;  3SFI A;  2TCT A;  1VTN C;  2ETH A;  3L2Q A;  2HVQ A;  2O5R A;  1KGS A;  2CUZ A;  4EVI A;  3VSL A;  4HNT A;  4WK8 F;  1D3Y A;  4UB8 C;  2L5Q A;  3M4O J;  3RSN A;  1MIJ A;  3O8H A;  2DN0 A;  4Y17 A;  5F08 A;  2LMD A;  5ICG A;  1Z9C A;  5CQG A;  3TO7 A;  4NBQ A;  3J7Y J;  3J7Z I;  2V1U A;  2JA7 J;  1IDY A;  5CVI A;  4XLC A;  2RQP A;  3FKI J;  2A61 A;  5M5Y J;  2BHZ A;  4XK4 A;  3CZ6 A;  3K1M A;  3RKX A;  3H5A A;  2ESN A;  2HTS A;  3OYH A;  2P8T A;  1XPX A;  2PMH A;  4B44 A;  2ZJR F;  2DXI A;  1HKQ A;  2XPU A;  3TO6 A;  2D1V A;  3GTL J;  1IJW C;  2L02 A;  3ECO A;  1IRZ A;  1X19 A;  4OMZ A;  3JRH A;  3BTI A;  1U2W A;  1GV5 A;  2LF7 A;  3KYL A;  1E0E A;  3K2Z A;  4IEJ A;  1F9N A;  2XVC A;  3GME A;  1IN5 A;  4PUS A;  3GFI A;  2QQA A;  3CJT B;  3BWG A;  3DF8 A;  2Y69 H;  2QGU A;  2XGC A;  2JZY A;  2G7U A;  4AD9 A;  3T1B A;  3BR2 A;  2OZU A;  3A01 A;  1WGX A;  2DT5 A;  3FM3 A;  4RGU A;  3HB9 A;  1JT0 A;  3HRS A;  2DT7 B;  3QU3 A;  4BJ6 C;  3DKW A;  2ZME C;  2HDC A;  2CW8 A;  1R4M B;  2XPW A;  4UVA A;  1R5I D;  3FMQ A;  4A3K J;  1JGS A;  3VOE A;  4CCK A;  3ULQ B;  2M2E A;  1S29 A;  1WJD A;  2ISZ A;  4D9J A;  3CDH A;  1YIJ I;  2IS2 A;  3W6V A;  1UHW A;  1WJE A;  5KNL A;  3H3Z A;  1GVJ A;  1S72 I;  1A36 A;  2BGC A;  4A5N A;  1LB2 A;  1R1U A;  2ELK A;  5TJJ A;  3JR9 A;  3OYF A;  1I5Z A;  1Z7U A;  3F6O A;  2HGC A;  2ZXI A;  1K6Y A;  3I55 I;  2QWW A;  2X1C A;  4I09 A;  5K5R A;  5IT9 K;  1EA3 A;  4QSH A;  1N77 A;  4B47 A;  2R7R A;  5ILS A;  1XMX A;  2X85 A;  1U78 A;  4PGG A;  2AXT C;  2DA1 A;  2E1O A;  1SD5 A;  1MBH A;  3H3U A;  2HQA A;  3BR1 A; 
#chains in the Genus database with same CATH homology
 3O3K A;  1KU3 A;  1I6X A;  1QZY A;  2VXZ A;  2WTE A;  2ZCW A;  3VEP A;  1ZLJ A;  3RJP A;  1S7A A;  1BBY A;  1HSJ A;  3QU6 A;  3CUO A;  4KA4 A;  3GFL A;  3ZMD A;  1XGM A;  3GYH X;  4KNY A;  1P92 A;  2JTV A;  1V4R A;  4M73 A;  2CW0 F;  3K1P A;  1BI3 A;  2FSW A;  3FZV A;  2RNJ A;  2QUF A;  1FC3 A;  3LQQ A;  4WCG A;  2EFN A;  4A0X A;  1IZ1 A;  4N0B A;  1IRG A;  1FSH A;  1D5V A;  5DD8 A;  4IF4 A;  3PFI A;  2PI0 A;  4BH9 A;  4I0A A;  3DV8 A;  1R1V A;  2WWY A;  1FYL A;  1FYM A;  1ZH5 A;  3GW2 A;  2EA4 A;  3O6B B;  4IRH A;  4O3M A;  1XB4 A;  4L9T A;  2NAZ A;  3F8N A;  4A6D A;  2VN2 A;  3EYI A;  3F8M A;  4QWQ A;  2MA3 A;  2COM A;  1BIA A;  4HDV A;  2CO5 A;  3MWM A;  1R00 A;  1XGS A;  1OYI A;  4UNO A;  1Z91 A;  4ZH4 F;  2Y75 A;  2VC1 A;  4BYY A;  3F3X A;  4UV9 A;  4RB0 A;  3HRU A;  2FU4 A;  3WTT C;  1O3R A;  1J9I A;  4G7O F;  1USS A;  2EWN A;  4EM1 A;  1TLH B;  2EK5 A;  1L0O C;  2XAH A;  1O3Q A;  4JK1 X;  4WXH A;  5L3D A;  3HIF A;  1BM9 A;  2P6S A;  2YSR A;  4DQ2 A;  3KP7 A;  1RI7 A;  2Y48 A;  2IJL A;  3C1D A;  4Q4Z F;  3AAF A;  4IHS A;  1U6G A;  2ZNY A;  4NQW A;  3M8E A;  1TTY A;  2M87 A;  3P9I A;  1TQP A;  4FX0 A;  4ESJ A;  1I1S A;  3ABT A;  4BHC A;  1XDS A;  3GFM A;  1KU7 A;  3WTY C;  4L9J A;  2L3D A;  4WXC A;  2D2W A;  3F22 A;  2F5D A;  3ML6 A;  3DXJ F;  1RNL A;  2BEO A;  3IKT A;  2E7X A;  3RDI A;  2D1H A;  2P4W A;  4ZZD A;  1REP C;  4Y13 A;  2OQR A;  1OR7 A;  2MH2 A;  3C3W A;  4L9N A;  4EJU A;  3PQJ A;  3FX3 A;  3QPH A;  3I59 B;  3MAJ A;  5L3F A;  4B8X A;  3WTU C;  3B02 A;  2LDU A;  4GYG A;  5BOX A;  3KFW X;  5HDK A;  3J81 K;  4RGR A;  2VBZ A;  4OOI A;  2JPB A;  2AXL A;  2O3F A;  1KQ8 A;  5LHI A;  5KVR A;  1RIO H;  2AS5 F;  2FOK A;  4RB3 C;  5FD5 A;  4A12 A;  4MTE A;  2ZFW A;  4KIB A;  3I54 A;  3LAJ A;  2DW4 A;  1HW2 A;  2ZNZ A;  1XN7 A;  1R5H A;  3S2W A;  4P5O A;  1I1G A;  3E3V A;  4LK0 F;  5CVU A;  4D0P A;  3HYI A;  1U5T B;  2L4A A;  3JAM Z;  1TNT A;  2EV6 A;  2M45 A;  4U7B A;  5ERI A;  3IWZ A;  4HDU A;  2X4H A;  4XLP F;  1ZG5 A;  2LNB A;  5LGN A;  3GWZ A;  4B09 A;  1A04 A;  3GZ6 A;  1O57 A;  1B9M A;  4ON0 A;  4Q47 A;  1WQ2 A;  2YU3 A;  4ZYH A;  3WG9 A;  4UUV A;  3LA2 A;  5FGM A;  2V1D A;  2VT3 A;  3TDZ C;  4LB5 A;  2FBK A;  4HOB A;  4RB2 C;  2Z99 A;  5CVV A;  1ON1 A;  3E97 A;  3EET A;  3HHH A;  3IRR A;  1MDM B;  4EJW A;  3C7J A;  3FMR A;  5E1W A;  1HXD A;  3QP6 A;  4G8X A;  4CO8 A;  2CFX A;  1P4W A;  3V8L A;  1UCR A;  3TKY A;  2NNN A;  4MEY F;  5H20 A;  3GLX A;  2OU2 A;  5CLS A;  4RGX A;  2XAS A;  1B9N A;  2EFQ A;  2KJB A;  3HTU A;  2QYO A;  3M9A A;  3IHU A;  2ZME B;  3ZP5 A;  3ROU A;  1IN7 A;  1BOA A;  3FXU A;  3F8B A;  1SD7 A;  4N9I A;  2FEZ A;  5EEG A;  1W7P A;  3HRT A;  3QRF F;  2HWV A;  2FBH A;  2Z5U A;  3GO5 A;  3E5U A;  5J8F A;  1BI1 A;  2VE8 A;  1P6R A;  4LMY A;  4QLC U;  1Z1D A;  4G6Q A;  2F5E A;  1OYW A;  2CQK A;  2A5Y B;  2DFI A;  3FM5 A;  5E18 F;  4ZYG A;  1IXC A;  1IXS B;  2EFW A;  1J5Y A;  3GX4 X;  3J7A O;  2RDP A;  2OA4 A;  3R0J A;  2CGP A;  1KU2 A;  2VT2 A;  4U0V A;  4M9Z A;  5JR3 A;  2EA2 A;  4YFN F;  2XIG A;  1YYV A;  4N9H A;  1IN4 A;  5HOO A;  2FRH A;  5H6R A;  2QVO A;  4MEX F;  3HOS A;  3FXR A;  5JFR A;  5DD4 A;  3R61 A;  3U2R A;  2FBI A;  1SD6 A;  4HX8 A;  2K4B A;  1FLI A;  1UB9 A;  3D0S A;  1U3E M;  2CYY A;  2HOE A;  2LKP A;  2A6H F;  2L01 A;  5L3G A;  3I58 A;  3ZN0 A;  2H6C A;  1T39 A;  1SD4 A;  1TQM A;  2A07 F;  2O61 A;  1ULY A;  1BN5 A;  2PMU A;  3VB2 A;  4R8H A;  2W25 A;  1QZZ A;  5K5O A;  2GA2 A;  5DCM B;  2HQR A;  3FMS A;  3GFJ A;  2VBY A;  4MQV A;  3M1E A;  4LG0 A;  3SQN A;  1ZGA A;  1LNW A;  2O6G E;  2V9V A;  4U88 A;  5FFZ A;  2FXA A;  2W24 A;  2DQL A;  4ETS A;  2DO7 A;  4BXU A;  2GA1 A;  1J2X A;  1G3S A;  5LRS A;  4H0E A;  1XD7 A;  4I7H A;  3PQK A;  2QQB A;  3RI4 A;  3B73 A;  2K27 A;  1ZAR A;  1K78 B;  1ON2 A;  2BE5 F;  3OV8 A;  2HS5 A;  1BC8 C;  3SHF A;  2DPD A;  4CYD A;  4M6X A;  2HYG D;  2MC3 A;  1FBU A;  2DPU A;  1OPC A;  2ZKZ A;  1T38 A;  4OIP F;  1FSE A;  3GVA A;  1ZRE A;  4U0Y A;  2R3S A;  4I0B A;  2XAQ A;  5D5W B;  2EFP A;  1BIB A;  3SFZ A;  5DV5 A;  1HBX G;  2XRO A;  2PJP A;  2OAZ A;  1HW5 A;  3TO9 A;  3IL2 A;  2XAJ A;  3V8K A;  4Z2Y A;  1X3U A;  4KIC A;  3L00 A;  4MNU A;  5BMZ A;  3GUD A;  3N4M A;  4PCQ A;  3BZ6 A;  3FWE A;  3TGN A;  3R60 A;  4EM2 A;  2XV4 S;  2BYV E;  2V1X A;  2F5C A;  3GEZ A;  1YS7 A;  3DFG A;  5LGU A;  2OD5 A;  2NYX A;  3F72 A;  1Q1H A;  4Y15 A;  1FP2 A;  1R23 A;  2OBP A;  1FBQ A;  2DBB A;  5JI6 A;  3FXQ A;  5BPI A;  1HST A;  1CF7 B;  1UFM A;  3P9K A;  4HF0 A;  3F23 A;  1LVA A;  3C18 A;  3J80 K;  1W4M A;  1W7P D;  2H94 A;  4RB1 A;  2J5P A;  5EEH A;  2Y0M A;  4Q48 A;  4M72 A;  4HYE A;  3KP2 A;  2XAG A;  4CXF A;  3CO7 C;  1KU9 A;  1V3F A;  4EMS A;  3MFK A;  3Q5F A;  2M30 A;  3CJN A;  2IP2 A;  3HRM A;  5FLX Z;  3CUQ A;  1W7P B;  3QOP A;  5DCF A;  5TRD A;  1DDN A;  1U8R A;  3CTA A;  1B59 A;  2DK5 A;  3EDP A;  1J7K A;  2IA2 A;  4LLL A;  3V7S A;  4RS8 A;  2NNY A;  4O6J A;  1YW9 A;  1Z6R A;  4XSX F;  1MGT A;  4G94 A;  2KKO A;  5DUI A;  1P4A A;  4ENM A;  3F8F A;  5BQT A;  4ESB A;  1PP8 F;  4RGS A;  5D5X B;  3I0T A;  4IJA A;  3J81 Z;  4UXN A;  1MDM A;  4M71 A;  3CUQ B;  5LHG A;  1FYK A;  1EV7 A;  2EB7 A;  2CWE A;  3WTW C;  3IWF A;  2P5V A;  1LEB A;  1I27 A;  4GGG A;  4GO1 A;  2FE3 A;  4OIO F;  3HUG A;  3V7R A;  1EH8 A;  3KET A;  5LGT A;  3M8F A;  2IVM A;  2FML A;  2BV6 A;  1CF7 A;  2RN7 A;  2YR2 A;  1FWZ A;  5D5V B;  2STT A;  4JQF A;  1QO0 D;  2GXG A;  3D5L A;  1RZ4 A;  2NS0 A;  2PEX A;  2QZ8 A;  4Q5S F;  3SZP A;  4A0Z A;  5AON A;  1U5T A;  3WE2 A;  3E6C C;  3Q9V A;  4P9F A;  3E6M A;  3W6K B;  3BJO A;  4L0Z B;  1FT9 A;  2OZ6 A;  2P5L C;  1YFH A;  2WV0 A;  2DI3 A;  1PP7 U;  3I5U A;  5ILV A;  1OYY A;  3DEU A;  2P5K A;  2DAO A;  4KN4 X;  2H09 A;  5D4R A;  1YQA A;  3MQ0 A;  3VFZ A;  1T0F A;  2LF8 A;  3OOP A;  1Z05 A;  1DPR A;  4ZZL A;  5BS6 A;  3QAH A;  4L5I A;  4P55 A;  1JHH A;  2FNP A;  1IN8 A;  1KQ9 A;  3HTS B;  5KK1 A;  2KIM A;  1J0R A;  1Y0U A;  2E7W A;  5E1X A;  4EJT A;  1HQC A;  1LJ9 A;  3I59 A;  1SFU A;  2L4M A;  4R1H A;  1R1T A;  1CGP A;  5F6F A;  4ENN A;  4R79 A;  3EQL F;  2A6E F;  5HS7 A;  4HW0 A;  1LQ1 A;  4EJV A;  1J59 A;  2G9W A;  5CVJ A;  1QPM A;  3EUH A;  4NB5 A;  1RUO A;  4HAM A;  4HV6 A;  1IAW A;  1K78 A;  2J5O A;  1D8J A;  5E8I A;  4JBA A;  5HDN A;  4CDG A;  1XMA A;  3FF5 A;  2HQN A;  2L54 A;  5AIQ A;  4YFX F;  2ZBK A;  3JW4 A;  2ELH A;  4AVP A;  3P9C A;  5D8L B;  2ESH A;  2Q0O A;  4G7H F;  4LG0 B;  4KFC A;  1XSD A;  2M1B A;  3KP4 A;  3DP7 A;  3WTZ A;  3BPX A;  3TOA A;  5DCM A;  1XMK A;  3I71 A;  2R7D A;  2A3S A;  5HS9 A;  1B6A A;  4HV5 A;  2XAF A;  4LFU A;  1IN6 A;  4NHJ A;  1O3S A;  5IT3 A;  3TDU C;  3KP6 A;  1TNS A;  3T8T A;  3K1N A;  1ONV A;  1T2K A;  3ECH A;  3RPQ A;  2HTJ A;  3RPU A;  4U0W A;  2KRF A;  4CIC A;  5A2Q Z;  4LJZ F;  2GZW A;  3R6S A;  1DUX C;  1YW7 A;  1G6N A;  5LLQ A;  2XUB A;  4FHT A;  1W5S A;  5DUK A;  4M9X A;  2PLY A;  3KZY A;  3WTX C;  4HZF A;  4KDP A;  2E1C A;  3RTR A;  4LD5 A;  4OMY A;  2PG4 A;  2PBI A;  3ZMV A;  5A2Q K;  1YG2 A;  3KLO A;  4HQM A;  2D45 A;  1H9T A;  4CHU A;  4L0Y B;  2WC2 A;  1YS6 A;  2M5W A;  1GXQ A;  2QQ9 A;  3ZMZ A;  3REO A;  2HKO A;  2DU9 A;  2MBF A;  5DDG A;  2GWR A;  2IT0 A;  1IF1 A;  4PGH A;  5AIP A;  1NHA A;  1XSV A;  3F8C A;  5F64 A;  1SFE A;  4HLX A;  2ZME A;  4YG2 F;  2ZO4 A;  1WWX A;  3KE2 A;  1G3W A;  4MHG A;  1O3T A;  2VE9 A;  3I64 A;  5ICE A;  3MZY A;  4EGY A;  1UST A;  5K5Q A;  2G7H A;  2JRT A;  2FNA A;  3COA C;  1AWC A;  4OIR F;  3QP5 A;  1K7A A;  4OIQ F;  4HA8 A;  2YPR A;  1IW7 F;  4XSZ F;  1ODD A;  4UVC A;  1YO5 C;  2EFO A;  4IRI A;  4M6Y A;  4K2E A;  4KIF A;  4BHP A;  4F7Z A;  4A5M A;  3K69 A;  3JSP A;  3U1D A;  3R4K A;  3V7C A;  1MJ9 A;  2X0L A;  2VBX A;  2P7V B;  4AIH A;  4G9Y A;  3T8R A;  5K1Y A;  5FD6 A;  5H6Q A;  1XGN A;  3L09 A;  1XCB A;  2MH9 A;  5CYV A;  1G4D A;  2FA5 A;  3E6D A;  2RKH A;  3NEU A;  3MEX A;  4YFK F;  1BI2 A;  5ICF A;  4ZYE A;  4KMF A;  4EGZ A;  4EJO A;  3L7W A;  3MZH A;  3H92 A;  4ZYD A;  2MLK A;  2YX7 A;  2EV5 A;  3I53 A;  4UV8 A;  4WX9 A;  3CUQ C;  2DTR A;  3G73 A;  4M74 A;  1H0M A;  3WTS C;  3RIR A;  4IRG A;  3LA7 A;  3HSE A;  1H9G A;  3WU1 B;  2EJR A;  1QGP A;  3IKV A;  2IW5 A;  1HKT A;  5ED4 A;  4G7Z F;  1ZRC A;  4FT8 A;  3T0Y A;  2UXN A;  4XRF A;  3NRV A;  2B0L A;  1GHC A;  5D8K B;  1SMY F;  4S05 A;  2DQR A;  4BAY A;  2W84 A;  3GXO A;  1R7J A;  1ZG1 A;  2JPC A;  2K02 A;  1K79 A;  2HEO A;  4HF1 A;  6PAX A;  2R7F A;  1T6S A;  3DPT A;  3WE3 A;  2Z3Y A;  2VC0 A;  1ZYR F;  2H27 A;  2LSO A;  3F6V A;  4WF2 A;  3M7G A;  4O5V A;  2A68 F;  1FPQ A;  4GCV A;  3WGG A;  1FOK A;  5ICC A;  2H6B A;  5J8C A;  3JTH A;  3EYY A;  1WI9 A;  3LWF A;  1FZP B;  4BNC A;  1SMT A;  2ACJ A;  1XSX A;  4FX4 A;  3HHG A;  1XCV A;  2XGX A;  2PN6 A;  2M8E A;  2XKO A;  5JHU A;  2V6C A;  1FX7 A;  1LDJ A;  2CG4 A;  2ADU A;  4TV7 A;  4XLN F;  4G6D A;  4GXO A;  4GYI A;  2ZJ2 A;  3LAP A;  4EM0 B;  1MJA A;  3WGH A;  4HX7 A;  4LGW A;  5LHH A;  2FF4 A;  1HW1 A;  4BHB A;  2IPQ X;  5DEQ A;  5DYM A;  4L5J A;  1YIO A;  3BPV A;  3JAM K;  1BI0 A;  5LRR A;  4BQA A;  2RGV A;  1G3Y A;  2TDX A;  2GQQ A;  2W85 A;  2VOD A;  3CLO A;  5IT9 Z;  1TW3 A;  2QM3 A;  3ZMT A;  3QPT A;  3ZMU A;  2Z33 A;  5L3E A;  1OKR A;  2HYF A;  4PDK A;  3V4G A;  2FMY A;  1FBS A;  4S04 A;  3KCC A;  1LEA A;  3LFK A;  5FB2 A;  4LLG F;  5HS8 A;  4P9U A;  2HR3 A;  4P96 A;  1PUE E;  3DPL C;  5J6X A;  1ZGJ A;  2YX4 A;  1IRF A;  1JHF A;  5HVQ C;  5L3C A;  2E1N A;  4RAY A;  2VOO A;  2QBY B;  5D5U B;  1RUN A;  4LLN A;  3ZQ7 A;  1Z6T A;  1JXS A;  3JSO A;  4A0Y A;  1MD0 A;  1YTY A;  2K4J A;  1TQI A;  2XKP A;  1WKM A;  4OIN F;  2PFB A;  2RVC A;  3E5X A;  2UWM A;  2IA1 A;  3ZN1 A;  3DQV C;  2JSC A;  1FNN A;  5CVR A;  2W57 A;  1S3J A;  2EV0 A;  1R5G A;  4E70 A;  5BPD A;  1J75 A;  3RYP A;  2QLZ A;  3K9T A;  4EV0 A;  1W5T A;  3P7N A;  4UVB A;  5L3B A;  1F4K A;  4WWC A;  5D4S A;  3F21 A;  4I02 A;  2MLG A;  3BOQ A;  3G3Z A;  1KQ0 A;  1R58 A;  2C6Y A;  3L9F A;  4CZZ A;  4KYW A;  3BRO A;  4KUM A;  1LDD A;  3WTV C;  1E17 A;  4HBL A;  1IXR C;  1STZ A;  1QNT A;  1SFX A;  3KEO A;  1ZN2 A;  4ENJ A;  3KLN A;  3FHZ A;  4IVN A;  4PZJ A;  2ZXJ A;  1BJA A;  2K86 A;  1XGO A;  1O7L A;  5CJ9 A;  1G3T A;  1TW2 A;  3E5Q A;  5JVT A;  3TOB A;  3L2C A;  2NRA C;  3CO6 C;  3RKY A;  3T5X A;  1MZB A;  1B4A A;  1ZRD A;  2PQ8 A;  2MD5 A;  2ISY A;  2KJC A;  2XHK A;  3BJA A;  3W6J B;  4AWX B;  4EQQ A;  4ENK A;  2CSO A;  2A69 F;  2KIU A;  3BY6 A;  5E1Z B;  5F1R A;  4UHT A;  1P4X A;  1F1Z A;  5FFX A;  2HZT A;  2DK8 A;  1WRJ A;  3ZMS A;  2VON A;  3O2P E;  1D8K A;  1F5T A;  3TQN A;  1EH6 A;  2O8X A;  2KIF A;  1ZG3 A;  5E8G A;  3U9G A;  2BBY A;  2P6T A;  1UHM A;  2GXB A;  1LDK B;  4ESF A;  4CGZ A;  1KA8 A;  1S6L A;  3KEQ A;  3I4P A;  4IPA A;  3SZT A;  4L9V A;  1JE8 A;  4HF2 A;  3LQR A;  1QBJ A;  1K6O A;  2Z9O A;  2IA0 A;  3RYR A;  5LBQ A;  2UXX A;  3NQO A;  4I98 B;  4YII A;  3WGI A;  1HKS A;  5E17 F;  1S7O A;  3K0L A;  4KN7 X;  4A2U A;  3Q9S A;  1T98 A;  3J80 Z;  4AIK A;  3VOD A;  1MJB A;  4HX4 A;  2GIV A;  5HLI A;  3IRQ A;  1R22 A;  4AIJ A;  1C0W A;  1P2F A;  3ERE D;  1SAX A;  2V79 A;  2QBY A;  4A6E A;  5E20 A;  5FO5 A;  1DP7 P;  2FQ3 A;  2RC4 A;  5FLX K;  1O7F A;  3HSF A;  3ZPL A;  1U5T C;  3GF2 A;  4OU0 A;  1YW8 A;  1MKM A;  5D6E A;  1TBX A;  3BP8 A;  4MQ9 F;  5HLH A;  2Q2E A;  4M9S A;  1AOY A;  4MGR A;  2GAU A;  3ABU A;  2VBW A;  3R0A A;  1FY7 A;  1ZHF A;  1ZAO A;  1WSU A;  3BDD A;  1XDU A;  3RKW A;  2K7L A;  5HLG A;  2F5F A;  4MTD A;  3GZ5 A;  1B1B A;  4KIG A;  4LB6 B;  3BJ6 A;  2OQG A;  5ILU A;  2DLL A;  3JTG A;  4ASN A;  3N97 A;  2O0Y A;  4IHT A;  3MCZ A;  2HKX A;  3IC7 A;  3KZZ A;  1ZLK A;  3SXY A;  3ISP A;  3LA3 A;  3V8J A;  3WU0 A;  3WOD F;  5D6F A;  5HDG A;  4U7D A;  4KT5 C;  2IRF G;  1FP1 D;  1IUY A;  3KP3 A;  3HSR A;  4XBF A;  1EH7 A;  4I01 A;  1PDN C;  4YIF A;  1R36 A;  1DPU A;  1BC7 C;  1L3L A;  2P7C B;  5LEJ A;  3KP5 A;  5LEK A;  2QEN A;  2O03 A;  3LST A;  2F2E A;  1E2X A;  4KMU X;  4DNC A;  2RV8 A;  4HLY A;  1ZRF A;  2HFH A;  1OMI A;  3E6B A;  4L18 B;  4IXA A;  2JT1 A;  3HOT A;  2Q8K A;  2VOP A;  2UZK A;  1S8N A;  4RAZ A;  1GXP A;  2STW A;  4HQE A;  4LK1 F;  1YLF A;  3ELK A;  4WXD A;  4I2O A;  1KYZ A;  1KYW A;  1QQI A;  2XRN A;  1VTN C;  2ETH A;  1KGS A;  4EVI A;  4WK8 F;  1D3Y A;  4Y17 A;  5ICG A;  1Z9C A;  3TO7 A;  2V1U A;  5CVI A;  2RQP A;  2A61 A;  3K1M A;  3RKX A;  2ESN A;  2HTS A;  2P8T A;  2PMH A;  1HKQ A;  3TO6 A;  2D1V A;  2L02 A;  3ECO A;  4OMZ A;  1U2W A;  2LF7 A;  3K2Z A;  1F9N A;  2XVC A;  1IN5 A;  3GFI A;  2QQA A;  3BWG A;  3DF8 A;  2JZY A;  2G7U A;  4AD9 A;  3T1B A;  2OZU A;  2DT5 A;  3FM3 A;  4RGU A;  3HRS A;  3QU3 A;  3DKW A;  2HDC A;  4UVA A;  3FMQ A;  1JGS A;  3VOE A;  3ULQ B;  1S29 A;  2ISZ A;  3CDH A;  1UHW A;  3H3Z A;  1GVJ A;  2BGC A;  4A5N A;  1LB2 A;  1R1U A;  5TJJ A;  1I5Z A;  1Z7U A;  3F6O A;  2HGC A;  2QWW A;  4I09 A;  5K5R A;  5IT9 K;  5ILS A;  1U78 A;  4PGG A;  1SD5 A;  3H3U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...