1J0RA

Crystal structure of the replication termination protein mutant c110s
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
114
structure length
114
Chain Sequence
TGFLVKQRAFLKLYMITMTEQERLYGLKLLEVLRSEFKEIGFKPNHTEVYRSLHELLDDGILKQIKVKKEGAKLQEVVLYQFKDYEAAKLYKKQLKVELDRSKKLIEKALSDNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords replication termination protein
publication title The impact of single cysteine residue mutations on the replication terminator protein
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Replication
total genus 42
structure length 114
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02334 RTP Replication terminator protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1j0rA00
4HX7A 3KEQA 1TW3A 2PG4A 5K5QA 1USSA 2EFOA 3J81K 1F9NA 5F64A 1B9MA 4M9ZA 4LD5A 3L09A 3ZMUA 5TRDA 3D5LA 3J80Z 1B9NA 1IZ1A 2A3SA 1O3QA 4G94A 1HSJA 3ZMVA 3EYIA 1CF7A 1W7PB 1MKMA 1RUNA 4U0WA 3FM5A 2FRHA 1ONVA 2VBXA 4GO1A 5F1RA 1O3SA 3DKWA 1ZGJA 1Z6RA 5K1YA 1ZG3A 2E1CA 3GX4X 1G3SA 3ZN1A 1Z6TA 2O61A 3Q5FA 5BQTA 2GXGA 3FMQA 4GGGA 4O5VA 4G7HF 1BI1A 1BI2A 2P5VA 1YG2A 4K2EA 2Q2EA 5FLXZ 4M9SA 1HW2A 3B73A 4O3MA 4HF2A 5E18F 4P5OA 2XAQA 1YO5C 1PDNC 3SZTA 4B09A 3E5XA 3BOQA 4U7DA 1CF7B 2OQGA 2Q0OA 1W5TA 5FB2A 3M1EA 1T38A 3L7WA 3PQJA 2ZO4A 1I1GA 4GXOA 4WXCA 3ECOA 1G3WA 1R23A 5E1ZB 2B0LA 1ULYA 2GWRA 5LRRA 1RI7A 2EJRA 2BBYA 1C0WA 1QZYA 4Q5SF 4RAZA 2X4HA 5IT9Z 1ZHFA 3QPTA 1XCBA 3FMSA 3ZQ7A 1XSVA 1TNSA 5CVUA 1R1TA 2DK5A 4H0EA 2P6TA 4CXFA 5L3FA 4QWQA 1BI0A 2MBFA 4ZH4F 3LQQA 4EJUA 5LBQA 1IN6A 4UV9A 1TQMA 1KQ9A 1KU9A 5CVJA 4OIQF 4BYYA 3HSRA 4L9NA 5DUIA 4FX4A 5E8IA 3HRMA 4YFNF 5HS8A 5AIPA 4WK8F 3BPVA 4ESBA 4G6QA 3ERED 3ISPA 4EJOA 2GA1A 2VC0A 2YX4A 4Y13A 4BQAA 4KIBA 4IVNA 4EJWA 2STTA 3CUQA 1TLHB 4OU0A 2QWWA 3CO7C 3GUDA 1T0FA 2J5PA 1ZG5A 1ZLKA 4MGRA 2ACJA 3F8MA 2P7VB 4BHCA 2JPCA 1P4XA 2X0LA 3HSEA 4YFXF 5CJ9A 2A68F 4A6DA 3QU3A 1P4AA 1YW8A 5L3BA 1HW1A 1F1ZA 2P7CB 4HDUA 1S3JA 4G7ZF 3R61A 3L2CA 1UFMA 4FT8A 3TO6A 4O6JA 3JTGA 3CUQB 2A07F 2LKPA 3WODF 4P55A 1BC8C 3CDHA 4AIHA 2K7LA 2FE3A 3WTWC 1BIAA 3KP7A 3M9AA 4KN4X 1D5VA 1SMYF 1B59A 3FXUA 5FFZA 4L5IA 2GAUA 4LGWA 2DFIA 1RUOA 4DNCA 2XASA 5FD5A 4PGGA 1R7JA 1GXPA 3JTHA 1FOKA 2HZTA 4L0YB 1MJ9A 1SD5A 2LDUA 1U3EM 1W7PD 4HQEA 4OOIA 1J7KA 2M87A 4BH9A 1G4DA 4LK0F 5A2QK 3H92A 1BN5A 3FM3A 2Z33A 1OYYA 5HDGA 3K9TA 3IKVA 4KN7X 5HLHA 2EK5A 4LLGF 4GYIA 2VT2A 2LSOA 4M73A 1ZAOA 2PQ8A 1EV7A 2UXNA 4MEXF 1YLFA 1T98A 1XD7A 4A2UA 4LLLA 5IT3A 2VONA 5TJJA 3IRQA 2V79A 2JTVA 2V1XA 2L02A 2MD5A 2A61A 5KK1A 3HOTA 5D8LB 3DFGA 2XKOA 2F5DA 2WC2A 5BS6A 3U2RA 3KZYA 5D4SA 1R22A 1XMAA 2O0YA 4YFKF 5FGMA 2ESNA 4QLCU 1Z05A 2V1UA 4WCGA 5HDNA 2EV5A 3GZ5A 3R0JA 1TTYA 3F6OA 1FY7A 4IRGA 3BZ6A 3GFLA 3KE2A 1XSXA 2L4MA 3J81Z 3JAMZ 5J8CA 2BEOA 5DD4A 3KP2A 1FBQA 1IN4A 2ZMEA 2F5FA 2XRNA 1HKTA 3GLXA 3N4MA 3HRTA 1MJBA 2EA2A 2R7DA 3RYPA 4N9IA 2FEZA 1ZRCA 1NHAA 2Z9OA 3CTAA 2FQ3A 1IN7A 2QYOA 3GEZA 4HAMA 2OZ6A 4XSXF 2XAGA 4IXAA 2PI0A 4ON0A 2DO7A 4M6YA 3HHGA 4KDPA 2M1BA 2A5YB 3SQNA 2NNNA 5BOXA 4ENNA 1BC7C 1QNTA 1DP7P 1FBSA 3FX3A 5BPDA 1X3UA 2QQBA 4ESJA 2L4AA 5JR3A 5LHGA 5HS7A 2W57A 1Q1HA 2Z99A 2FA5A 1PUEE 3ROUA 2ZCWA 3HTUA 2H6BA 3MAJA 3E97A 3I59A 4YG2F 2D2WA 1ON2A 1U5TA 3RYRA 4M6XA 3WG9A 4HV5A 2DPUA 4RGXA 3I71A 3I58A 1QQIA 3QRFF 3KCCA 5LGUA 4LG0A 1YS7A 1L3LA 1LEBA 2K86A 2OA4A 2OU2A 1EH6A 2K27A 2FNPA 4WXHA 2DQRA 5LRSA 5LHHA 3WE2A 2DPDA 3R60A 4EQQA 4GCVA 1HKQA 3LA7A 4MQVA 1ZREA 2FXAA 4JK1X 3CJNA 3I59B 3JSPA 2CGPA 1U5TB 3WGIA 4NB5A 1I27A 4KA4A 1P4WA 1K78A 1UCRA 1GHCA 4LG0B 1HBXG 2NAZA 3F72A 5L3GA 4GYGA 3T1BA 1R1UA 1XGSA 1IUYA 2ZJ2A 3EQLF 4HX8A 3SFZA 1I6XA 3GW2A 5DEQA 1SAXA 1Z7UA 1O3RA 4HA8A 2P5KA 1KA8A 3KP5A 5LEKA 2ETHA 4NQWA 5KVRA 1JE8A 1XN7A 4E70A 3TO9A 2COMA 2W85A 2PBIA 4G6DA 6PAXA 5L3DA 4HQMA 3TKYA 3GWZA 3E5UA 3ZP5A 1IXRC 2RKHA 1EH7A 1FC3A 5HVQC 2VC1A 4ZZDA 1IF1A 2FBHA 4Z2YA 2F2EA 4ETSA 3NQOA 2XHKA 1K78B 2Y0MA 2A6HF 1ZN2A 4A5NA 3BY6A 1FYMA 4DQ2A 2VE8A 3LAJA 2ISYA 4EJTA 3IWZA 1P92A 3I54A 1U5TC 2STWA 3IC7A 3CUOA 4NHJA 1ZRFA 2OAZA 1I5ZA 2UXXA 2PMHA 3R0AA 5ICGA 2DT5A 1VTNC 4CICA 1Z91A 3TQNA 2IA0A 1OYWA 3EUHA 5D6EA 4A6EA 1JHFA 4FX0A 2LF7A 4IRIA 4I09A 4RGSA 3FMRA 4G7OF 3I0TA 3L00A 5EEHA 1P6RA 3MQ0A 4RGRA 3LSTA 3ZMDA 2CWEA 3ML6A 2L3DA 2RV8A 1FWZA 1G6NA 4RS8A 5BMZA 4S04A 3VB2A 1F5TA 1D3YA 2G7HA 1DPRA 1J75A 5ILVA 3MZHA 1ODDA 1JHHA 4UVCA 3HRSA 4KNYA 1I1SA 3JSOA 4UVAA 2O3FA 4OIOF 1OPCA 5DV5A 1G3TA 1MD0A 4YIFA 4EM0B 2IPQX 3P9CA 5AIQA 2P5LC 4PGHA 4ASNA 4OIRF 4R79A 2FF4A 3WTYC 3VODA 3EYYA 1ZYRF 1IRFA 3V7RA 3CLOA 4CYDA 3KZZA 2XAJA 4KUMA 2QZ8A 2MH9A 1WWXA 2W84A 4I2OA 1K7AA 1KYWA 2V1DA 3HUGA 3DV8A 3L9FA 1D8KA 3J80K 1YTYA 5J6XA 2DI3A 3I64A 2XVCA 4L18B 1IW7F 1A04A 4MTEA 2HYGD 2HEOA 3ZMSA 4EV0A 2EV6A 1ZGAA 2DTRA 3G3ZA 3QP5A 5E1XA 1SFEA 1JXSA 5CVVA 2Y48A 2D45A 3U9GA 3IHUA 2O6GE 3P7NA 4KMUX 4CO8A 3JW4A 3E6BA 5FLXK 3QU6A 1YYVA 2KIFA 1R36A 2ISZA 1SD6A 2JRTA 2DW4A 5FFXA 2XIGA 3R4KA 1DUXC 2HTJA 1HXDA 3HRUA 4YIIA 3V8JA 3WTXC 4XLNF 1DPUA 1MZBA 2PJPA 3P9IA 3TOBA 4HOBA 5LHIA 1YQAA 4EJVA 1E17A 1Z9CA 2D1HA 1ZRDA 2CYYA 2KJBA 1K6OA 4IHSA 4CZZA 5IT9K 1H0MA 1LEAA 2XGXA 5LGTA 3K0LA 1S7AA 3M7GA 1U8RA 1R00A 4WX9A 4TV7A 3GFMA 3FWEA 5E8GA 3B02A 1B4AA 1S8NA 3O2PE 1XMKA 1FYLA 4Y15A 4I98B 2ZXJA 2HQNA 4PDKA 3NEUA 1BI3A 4P9UA 5JI6A 3CUQC 5FD6A 2FOKA 4G8XA 4RGUA 1FSEA 4L9VA 2A69F 3DPLC 4UHTA 5CYVA 4Q48A 1U6GA 1SMTA 5FO5A 5BPIA 3V8KA 3E6CC 4WWCA 1UB9A 4AD9A 1TW2A 5D8KB 5DDGA 1S29A 2FNAA 3LQRA 5DUKA 2WTEA 5JFRA 2ZKZA 4M74A 2CW0F 4A0YA 4L9JA 3M8FA 5ICEA 1LQ1A 1REPC 2JT1A 2VE9A 1QO0D 2FSWA 3T5XA 4A0XA 2HQRA 3V8LA 4M9XA 1USTA 3FXQA 1LB2A 1KGSA 2RNJA 1MGTA 5D5VB 3LAPA 1IXCA 2DU9A 2L54A 3F22A 2HR3A 2P4WA 3WGHA 1FX7A 5LEJA 2ZNZA 2CG4A 4KFCA 2LNBA 4ZYGA 3KLOA 1OR7A 4ESFA 2V9VA 3RDIA 2MLGA 2FU4A 3DXJF 2ZFWA 2M30A 2P8TA 4LMYA 3U1DA 1RNLA 3O6BB 4A0ZA 5E20A 1JGSA 5HOOA 5J8FA 3IL2A 3VOEA 3RIRA 2V6CA 1XCVA 1MDMA 2EB7A 4HW0A 1MJAA 1UHMA 4HF0A 2NNYA 3K2ZA 4EGYA 3C18A 2EFPA 3W6JB 1T6SA 5D4RA 3HTSB 4ENMA 2EFNA 3RPUA 2ZMEB 1B1BA 4LLNA 2K4JA 5HLGA 3AAFA 3OV8A 2NRAC 1YW9A 1FLIA 4UV8A 2XAHA 2PN6A 5ILUA 3KP4A 2UZKA 4CGZA 3TDZC 1MDMB 2DK8A 1TQPA 2HYFA 3WU1B 5L3CA 4KICA 1D8JA 2DBBA 4AIJA 3MCZA 1R5HA 3NRVA 3TGNA 3K1MA 4S05A 2KJCA 4IRHA 1TNTA 2QENA 3GZ6A 3Q9VA 2ESHA 1BM9A 1W5SA 3DPTA 4BXUA 3WTUC 2XUBA 1U2WA 4UUVA 3FF5A 1XGMA 1IAWA 4WF2A 4KT5C 4OINF 3MWMA 2CQKA 3FXRA 2W24A 2FBIA 3Q9SA 3OOPA 1ZLJA 3ABUA 4HDVA 2BV6A 2DLLA 4FHTA 2QQ9A 3TOAA 2OBPA 1LDJA 1J9IA 4N9HA 3BJ6A 5HLIA 3IRRA 2YR2A 3LWFA 4IF4A 2VBYA 2R7FA 1WSUA 1J59A 2HOEA 3VEPA 1OMIA 4MEYF 3E3VA 3T8RA 1WKMA 2UWMA 1KQ8A 2JPBA 3WU0A 3BJOA 3LA2A 4MHGA 3JAMK 5CLSA 4ZYHA 3LFKA 2MC3A 1HSTA 3F21A 5D5WB 4I0BA 5DCMA 3R6SA 3TO7A 2RC4A 5CVIA 2RN7A 2QM3A 3COAC 4UVBA 4KYWA 3EDPA 1SFXA 3F6VA 2ZBKA 1H9GA 4WXDA 5LLQA 3J7AO 1R5GA 3RKXA 3I4PA 4KMFA 1B6AA 5AONA 3ZMZA 1P2FA 2C6YA 3RKWA 3GF2A 1J2XA 3HSFA 2VN2A 3C7JA 4HYEA 1XGOA 3P9KA 3F3XA 4B8XA 2HDCA 2IA1A 1E2XA 3IWFA 4ENKA 2CSOA 3HYIA 2IT0A 5ICFA 5H20A 3GO5A 3DEUA 2DAOA 5DCMB 1L0OC 5ICCA 1HW5A 3BWGA 3REOA 1KYZA 1PP7U 3ZMTA 3WTTC 1F4KA 3V7SA 5E1WA 4OMZA 2QVOA 4I02A 2NS0A 2LF8A 3DQVC 2WWYA 1U78A 4XLPF 4I7HA 3BP8A 1FP2A 4ZZLA 3GFIA 1FPQA 3QPHA 4EM2A 2QLZA 5D5XB 3C1DA 1R1VA 2HTSA 3TDUC 2H94A 1G3YA 3I53A 4A5MA 4M72A 1FSHA 3HHHA 2HKXA 2MLKA 1Y0UA 3F8CA 1O7LA 1ON1A 2A6EF 3C3WA 5A2QZ 2IJLA 2ADUA 2H6CA 4P9FA 5CVRA 4BAYA 2J5OA 2ELHA 2QUFA 3ABTA 1KU2A 1BOAA 2EFWA 2O8XA 1V4RA 3RKYA 4LFUA 3F8NA 2HS5A 1KU3A 2VBWA 3WTSC 2PLYA 3ELKA 3RJPA 2BGCA 3BDDA 4L5JA 4I0AA 3W6KB 1YS6A 1S7OA 1ZH5A 1UHWA 4U0VA 1TBXA 2FMLA 2G9WA 4JQFA 1LVAA 4RAYA 2HKOA 2QQAA 4KIGA 3HIFA 5JHUA 4EMSA 1QBJA 3BPXA 4RB1A 1PP8F 1FBUA 2H27A 2W25A 1BIBA 4UNOA 2HWVA 1KQ0A 1YFHA 1AOYA 4XRFA 2BE5F 2WV0A 3VFZA 2IW5A 1RZ4A 2MA3A 5D6FA 1S6LA 2CFXA 4XSZF 1AWCA 4ENJA 3HOSA 2RVCA 2MH2A 2EFQA 2GQQA 2YPRA 4Q4ZF 4D0PA 4Y17A 4EM1A 1XGNA 2G7UA 4LB5A 1GVJA 2IA2A 1WI9A 2RDPA 1GXQA 1XB4A 2FMYA 3GFJA 3K69A 2K4BA 2VOPA 1K79A 3GXOA 5DD8A 3D0SA 4I01A 2VBZA 3K1PA 3MEXA 3DP7A 3N97A 2VODA 5D5UB 2F5EA 3KLNA 1V3FA 4XBFA 3ECHA 2KRFA 5L3EA 3O3KA 4F7ZA 1FT9A 3KP6A 4R1HA 1OYIA 2OZUA 2QBYA 1RIOH 4MNUA 3KFWX 1FZPB 2KKOA 1IXSB 2EV0A 3H3ZA 4ZYEA 4IHTA 1IN5A 4OMYA 1CGPA 3RI4A 2XAFA 4LJZF 4HF1A 2YX7A 4ZYDA 4IJAA 2JSCA 1OKRA 4G9YA 3MFKA 2VOOA 2EWNA 1IRGA 1FNNA 3T8TA 1QPMA 3S2WA 1LDKB 1EH8A 2E1NA 5JVTA 2YU3A 2OD5A 3WTZA 3E6DA 1HQCA 2H09A 3WGGA 2ZNYA 1YIOA 4A12A 2QBYB 3K1NA 4MQ9F 5ERIA 5K5RA 3V7CA 3DF8A 3F8BA 1LJ9A 2Z5UA 3PFIA 1IN8A 4UXNA 4U0YA 2VT3A 3FZVA 4L9TA 4MTDA 3V4GA 4BHBA 1XDUA 1KU7A 3QOPA 2XKPA 2K02A 1T39A 2EA4A 3PQKA 3KEOA 5H6QA 1DDNA 3KETA 2PEXA 2RQPA 1QGPA 5H6RA 3QP6A 5EEGA 3E6MA 1SD7A 5ED4A 1T2KA 1XSDA 1STZA 4AWXB 3E5QA 2OQRA 4HV6A 5K5OA 4N0BA 1J5YA 2D1VA 1TQIA 2GZWA 3KP3A 3GYHX 4HX4A 5DYMA 2YSRA 3ZPLA 1O7FA 4EGZA 3SZPA 3CO6C 2E7WA 1R58A 2O03A 2M8EA 4HLXA 4EVIA 2P6SA 2XV4S 1YW7A 3MZYA 1WQ2A 1SD4A 2IRFG 3SXYA 3EETA 2AS5F 4R8HA 1Z1DA 5HS9A 4BNCA 1HKSA 1QZZA 2GIVA 5LGNA 1W4MA 2AXLA 4AVPA 5HDKA 1FP1D 3SHFA 1H9TA 3RTRA 1FYKA 2E7XA 2R3SA 2Z3YA 3QAHA 2RGVA 1LNWA 2L01A 2XROA 4HBLA 2FBKA 1WRJA 4KIFA 2IP2A 2PMUA 4RB0A 2IVMA 3G73A 4L0ZB 2F5CA 5E17F 3T0YA 1LDDA 2DQLA 2KIMA 4JBAA 4HZFA 1BBYA 3H3UA 4RB2C 2HFHA 3F23A 5F6FA 2HGCA 3IKTA 2VXZA 4OIPF 3M8EA 3ZN0A 4CHUA 3WE3A 4IPAA 4M71A 2PFBA 2BYVE 1ZG1A 4Q47A 3RPQA 3LA3A 2NYXA 4U7BA 5ILSA 4P96A 2M5WA 3FHZA 1ZARA 5DCFA 4PZJA 3I5UA 2JZYA 2GXBA 3BROA 1BJAA 2KIUA 2M45A 4LK1F 4BHPA 1O3TA 4LB6B 1W7PA 3GVAA 2Y75A 4HLYA 4RB3C 3WTVC 4U88A 4CDGA 4PCQA 3ULQB 1J0RA 2TDXA 3BJAA 2CO5A 1XDSA 3F8FA 2Q8KA 1SFUA 4AIKA 1O57A 2GA2A
chains in the Genus database with same CATH superfamily
4HX7A 4V2GA 3JREA 2LG4A 3U1KA 3KEQA 4C3HJ 1TW3A 2PG4A 3HL2A 5K5QA 1USSA 2ELJA 4XM3A 1DGWY 2EFOA 4BGDA 3J81K 1F9NA 1EKEA 2QSGX 2O9LA 5F64A 1FMVA 1B9MA 4M9ZA 3J7ZI 4LD5A 3L09A 5BNGA 3N05A 3ZMUA 5TRDA 3D5LA 3J80Z 1B9NA 3JRHA 1IZ1A 2A3SA 1O3QA 5J3LA 4G94A 1HSJA 3ZMVA 2NS8A 2E2IJ 1TT0A 2VQLA 2NOGA 4YEJA 1CF7A 3EYIA 1W7PB 1MKMA 3TP0A 3PUFA 2HXIA 3VSKA 1RUNA 1DQUA 2DA4A 4U0WA 4HRIA 4IOAF 3FM5A 2FRHA 1ONVA 2VBXA 2AQFA 2HOAA 4GO1A 5F1RA 1O3SA 4ZJZA 3DKWA 1ZGJA 3Q0WA 1Z6RA 2K5CA 5K1YA 1A36A 4E4HA 2YS9A 1ZG3A 2V9PA 2E1CA 4XLFA 3GX4X 1V5FA 1G3SA 2DFEA 3ZN1A 1Z6TA 2O61A 3AL0B 3I3LA 4D5FA 3Q5FA 5BQTA 2GXGA 2K3PA 3FMQA 4GGGA 4IZZA 4O5VA 4G7HF 1BI1A 1BI2A 2P5VA 1KZHA 3S32A 1YG2A 4K2EA 2Q2EA 3GTMJ 5FLXZ 4M9SA 2QSHX 1HW2A 3B73A 2HVQA 3G6EI 4O3MA 1IRZA 1XC5A 4HF2A 5E18F 4P5OA 4BL0B 3DU5A 2XAQA 2X51A 2X1DA 1FIPA 1YO5C 2COBA 2Y30A 4C2TA 1NG7A 1X1BA 1ETVA 4AU7A 1PDNC 2GLOA 3SZTA 4B09A 3E5XA 3BOQA 4U7DA 1JT0A 1CF7B 2OQGA 2JK3A 2Q0OA 1N77A 3A2KA 1W5TA 5FB2A 3DPUA 3M8JA 4L5EA 3M1EA 1T38A 3CCMI 3L7WA 3PIPF 2OV7A 5FKOA 3SEZA 1VQ8I 3PQJA 2XF7A 2JJ7A 2ZO4A 5EG0A 1MNMC 2JA6J 1VQ4I 5FJ8J 2R7TA 1I1GA 4GXOA 4WXCA 3H5RA 2Z16A 3ECOA 1G3WA 2DDBA 4AIDA 4GFBA 1R23A 3FKJA 5E1ZB 1ETKA 2B0LA 1Y8QB 1ULYA 2GWRA 3KEYA 3KIOA 5LD2C 1PUFA 2P0WA 5LRRA 1WJCA 1RI7A 2EJRA 2BBYA 1W36D 1C0WA 1QZYA 5GP9A 1OCRH 2K9NA 4Q5SF 2LY2A 3QYEA 4RAZA 2LBFA 2X4HA 1K4TA 5IT9Z 1ZHFA 1GT0C 2DFHA 3SDGA 2V4JC 3B6CA 3QPTA 2F4MB 2N8GA 1XCBA 2B7EA 3FMSA 3CCYA 3ZQ7A 1XSVA 1TNSA 2ZFUA 4AC0A 2R5YA 1PJRA 5CVUA 1R1TA 2DK5A 3VSLA 4H0EA 2P6TA 4CXFA 5L3FA 4QWQA 1BI0A 1Y8RB 2MBFA 4ZH4F 3LQQA 3S3OA 2G0EA 4BU2A 2DDAA 3RZDJ 1QVUA 2WV1A 2OCEA 4EJUA 4RLFA 5EYRA 5GAEJ 1WFXA 2XF6A 5LBQA 3FISA 1IN6A 1MBFA 5KCMA 4UV9A 2NXNB 1TQMA 1KQ9A 1KU9A 5CVJA 4OIQF 3K4KA 4IL6C 4BYYA 4A3LJ 3HSRA 3HZJA 4L9NA 5DUIA 4XKBA 1PUFB 2H1LA 2MG4A 4FX4A 4LIVA 2ME6A 1S7EA 5E8IA 3UR3C 1R4NB 1W0UA 1A31A 1QHHD 2LLKA 3RSNA 3HRMA 4YFNF 2VB6A 4M3BA 4PJMA 2LBFB 1JJ6C 5HS8A 1GUUA 5AIPA 2VPLA 3CCVI 4WK8F 3BPVA 2QA4I 2NVTJ 1YJWI 4ESBA 4G6QA 4E7JA 3ERED 2M8GX 3ISPA 2WADA 4EJOA 2GA1A 2BXZA 2VC0A 2DT6A 3OS2A 2K40A 2YX4A 3OS0A 1FOYA 3I4NJ 2DFFA 4Y13A 5E79C 1J09A 4BQAA 2VKVA 1SVMA 4XLEA 4BJ6C 4KIBA 3MKYB 4IVNA 4EJWA 2IAIA 5DTDA 1Z0XA 2STTA 1Y39A 3CUQA 1TLHB 2WAQA 1UHSA 2CS3A 4OU0A 1FMWA 2QWWA 3CO7C 2OJED 3GUDA 1T0FA 2J5PA 3QPLA 1TWGJ 1ZG5A 1ZLKA 4MGRA 2X9DA 2ACJA 2RNGA 3M1CA 3F8MA 2P7VB 4BHCA 2JPCA 5E3OA 1XX5A 5IP7J 1P4XA 1X19A 2X0LA 3HSEA 4YFXF 5CJ9A 3VDXA 2A68F 3AKZA 4A6DA 1DU6A 5F08A 3BCBA 3S93A 2LKSA 3QU3A 3S3MA 1P4AA 1YW8A 5L3BA 1HW1A 2BVMA 3OYDA 1YX3A 1F1ZA 1VI0A 2Z1DA 3BR1A 4RM2A 3S1RJ 4J01A 4RBOA 2P7CB 2WY8Q 5F1JA 4HDUA 3CJRB 1S3JA 1LKXA 2M2EA 4IX7A 1QHGA 3BCAA 1BJZA 3R61A 4G7ZF 3AG3H 5E3NA 4A3CJ 1UFMA 3L2CA 4FT8A 4RDUA 2I8DA 1SVLA 3TO6A 4O6JA 1WJFA 1Z3YA 3OYMA 3JTGA 3CUQB 3HPGA 1TP4A 2A07F 2LKPA 3WODF 4P55A 1BC8C 3CDHA 4AIHA 2K7LA 2EZKA 2LP0A 5CQEA 3GTOJ 4UY8I 1MBJA 2FE3A 3WTWC 4BDYA 1V5EA 2MW8A 2LREA 3J7AY 1QPIA 1DP3A 1BIAA 3IV5A 2ZXHA 3KP7A 1N78A 3M9AA 4QPQA 4KN4X 1XTAA 4CCLA 1D5VA 4E7LA 1SMYF 3HGGA 1B59A 3FXUA 5FFZA 4L5IA 2GAUA 4LGWA 5IYDJ 2DFIA 4CUGA 1RUOA 3BTJA 4DNCA 4EATA 2XASA 1Z3XA 1OLTA 5CPRB 3JRFA 5FD5A 2IXSA 1NK3P 1ACIA 4PGGA 4MO7A 1R7JA 2E35A 2K3FA 1GXPA 3JTHA 1FOKA 2PJRB 4XK4A 2R7XA 5IYBJ 2HZTA 1YJ9I 4L0YB 1MJ9A 1SD5A 1ZTRA 2LDUA 2ECBA 1U3EM 3DBRB 4FCYA 1W7PD 4HQEA 4OOIA 1J7KA 2M87A 4BH9A 4UB6C 5F0HA 1G4DA 4LK0F 2I5UA 3H1CA 2B63J 5A2QK 2HPIA 3H92A 2RREA 4F93B 1BN5A 2X6YA 1WJBA 1WJEA 3FM3A 2Z33A 3CDLA 1X58A 2ZJPF 1IV8A 1OCCH 2CUFA 2R7QA 1OYYA 3G71I 5HDGA 4FQGA 2ZJQF 3K9TA 3IKVA 4KN7X 3PNTA 3OL3A 3A1YA 3D5SC 5HLHA 1G59A 5FRMA 3Q0VA 1P7IA 2RQQA 3ZQGA 2JVHA 3HOWJ 2EK5A 4LLGF 1T0FC 4GYIA 4F3QA 2ID3A 2VT2A 2LSOA 3CP8A 4M73A 1ZAOA 3UKGA 2PQ8A 1EV7A 2QKLB 2PX9A 2UXNA 4PJ0C 4MEXF 1YLFA 1SEUA 3BC8A 1WPKA 1T98A 1XD7A 4A2UA 3F0CA 1SFKA 1IGNA 3A0HC 4XR6A 4LLLA 3ZGKA 4F52A 5E3MA 5IT3A 2Y2ZA 1UZCA 2VL8A 2VONA 5TJJA 2XB0X 3IRQA 2R7OA 2V79A 1JUMA 2JTVA 2X48A 2V1XA 3S1MJ 2L02A 4X1EA 2MD5A 2A61A 5KK1A 3S15J 3HOTA 5D8LB 1M1EB 1TWCJ 3DFGA 2XKOA 3H5AA 3B6AA 4NC8A 2F5DA 5FLMJ 2WC2A 3IH4A 5BS6A 3U2RA 3KZYA 5FKLA 5D4SA 4FTHA 2E5ZA 2KRHA 1R22A 1V55H 3DBLB 1XMAA 2L5QA 2O0YA 3TMOA 4YFKF 5FGMA 2VKDA 3IAS2 4XNFA 1AKHA 2BOLA 2ESNA 2K85A 4ZTJA 4QLCU 5HLTA 1Z05A 2V1UA 4WCGA 5HDNA 2R7SA 2EV5A 3A0BC 3GZ5A 3R0JA 2KZGA 1ETQA 3KYCB 3ERMA 3PSIA 1TTYA 3F6OA 3BTCA 1LVKA 1FY7A 4XLCA 1ITYA 3WU2C 1OISA 4IRGA 1JKRC 3BZ6A 1W0TA 3GFLA 2DTZA 4E7HA 3KE2A 4CCKA 2VI6A 1XSXA 2L4MA 3J81Z 4ANJA 2GIZA 3JAMZ 5GAHJ 2O8KA 5J8CA 1BR4A 2BEOA 5CQGA 2DMNA 3D5RC 4LITA 5DD4A 5J40A 5FKMA 4D9JA 1X4OA 4IOCF 4M3EA 3AG1H 3KP2A 1FBQA 1IN4A 2ZMEA 1VQ6I 1X3WB 3A01A 2F5FA 2XRNA 1JUSA 2KFDA 4N4OB 5K7HA 3GLXA 1HKTA 3N4MA 4A3KJ 4AYBA 2ZSIB 1MJBA 2EA2A 3HRTA 3PIOF 1MMGA 1YI2I 2R7DA 3RYPA 3BLYA 4N9IA 2FEZA 1LE8A 4IO9F 1ZRCA 1RKTA 2L9SA 1NHAA 2Z9OA 1A6QA 4IQJA 4ZC3A 3CTAA 2FQ3A 1I3QJ 5M3FJ 1IN7A 2QYOA 3GEZA 1HC8A 1RC9A 3HBLA 4XLHA 4HAMA 1WH5A 2M0CA 2OZ6A 1UG0A 4XSXF 1MMAA 1H88C 4P1WA 2XAGA 4IXAA 2PI0A 4ON0A 2DO7A 4M6YA 4BE2A 3GTQJ 3HDDA 3HHGA 3FXLA 2EIMH 4KDPA 2M1BA 3HB9A 2A5YB 4RAFA 3SQNA 2NNNA 2ZC2A 1AA7A 3C2GA 4ENNA 5BOXA 1QNTA 1BC7C 1FBSA 3FX3A 2XPWA 1DP7P 2JA5J 2R7ZJ 1BW5A 2NVXJ 4J19A 5BPDA 1X3UA 1N25A 2OCCH 2QQBA 3FXJA 2L4AA 4ESJA 3JR9A 3HOUJ 3BZKA 5JR3A 5LHGA 5HS7A 2W57A 1Q1HA 2P81A 3MN2A 2Z99A 2FA5A 1PUEE 3ROUA 3BG3A 2ZCWA 2ZXIA 2JRMA 4G6TB 3HTUA 3VYTB 2CRGA 2H6BA 3JRGA 3MAJA 2NVYJ 3E97A 3CQZJ 3I59A 4YG2F 2D2WA 3TP3A 1ON2A 1U5TA 3RYRA 4M6XA 3OOUA 3WG9A 4HV5A 2DPUA 5EZHA 1K61A 4RGXA 3I71A 3I58A 1QQIA 2HEOA 3QRFF 3KCCA 3MKLA 3TW7A 1VQPI 5LGUA 4LG0A 1YS7A 2DYRH 3V42A 2W1OA 1L3LA 1LEBA 3DWLE 3VWBA 2K86A 3FXMA 2OA4A 2OU2A 1EH6A 2K27A 4X6AJ 2FNPA 3LSKA 1E3HA 5H2FC 3RQIA 4WXHA 2R5ZA 2HPMA 2DQRA 5LRSA 1QRYA 2DA1A 4A3DJ 4BBRJ 3ZCOA 3DTEA 4PFPA 4XKCA 3WE2A 4C9YA 5LHHA 2DPDA 3R60A 1YX5A 4EQQA 4GCVA 1HKQA 2MC4A 3LA7A 1HCRA 4MQVA 1ZREA 2FXAA 4JK1X 4V2FA 4B47A 3CJNA 2XGEA 1D0XA 1LFBA 1UJ8A 3BR0A 1IC8A 2IS2A 5J4YA 3I59B 1I3AA 3DLLF 2QEXI 3JSPA 2CGPA 1U5TB 4C30A 2Y69H 1H8AC 1PYVA 2I10A 2Q1ZB 3WGIA 4NB5A 2JSPA 1I27A 4KA4A 1VFCA 2A5WA 4IKFA 1P4WA 3ZQFA 3FIWA 5B66C 4F55A 2W7NA 3S1QJ 1K78A 4A3FJ 4B1RA 1YIJI 1UCRA 1GHCA 4LG0B 2VQCA 5J47A 1R9TJ 1HBXG 2NAZA 3F72A 5L3GA 4E7KA 2YUSA 4GYGA 2LR8A 3T1BA 1R1UA 2WY7Q 2LVSA 2WAFA 4UUSB 1UAAA 1YRNA 1XGSA 1W5CC 2R5ZB 1IUYA 2HDWA 2XSJC 2ZJ2A 3EQLF 4HX8A 3SFZA 1I6XA 3GW2A 2M4KA 5DEQA 1SAXA 1Z7UA 3S3NA 4HA8A 1O3RA 3DKXA 3GTKJ 2P5KA 1KA8A 3KP5A 5LEKA 2ETHA 4NQWA 5KVRA 3QPSA 1JE8A 1XN7A 4E70A 3TO9A 2COMA 3H0GJ 5K7FA 2QGUA 5EF6A 2W85A 4BXXJ 1Y56A 2PBIA 4G6DA 4H4KC 4HEA2 5B1BH 6PAXA 2VIXA 4RLQA 5L3DA 4HQMA 3TKYA 3GWZA 3E5UA 2LY1A 3ZP5A 1IXRC 2RKHA 4C3JJ 2DMPA 1EH7A 4V19K 3IH3A 1FC3A 4XICA 5HVQC 2BZTA 2VC1A 4ZZDA 1IF1A 1IUFA 1RPWA 4NBQA 4F91B 2FBHA 2TRTA 4Z2YA 2F2EA 4ETSA 3CCLI 3IH2A 1LFUP 3NQOA 2XHKA 4CZCA 3OR1C 2IGKA 1K78B 2Y0MA 2A6HF 1ZN2A 4A5NA 1T56A 3BY6A 1FYMA 4DQ2A 2VE8A 3LAJA 2ISYA 2IS6A 4EJTA 3IWZA 3MVPA 3CZ6A 1P92A 3I54A 4IHXA 2Y31A 1U5TC 1R71A 2STWA 2XDVA 3IC7A 1YRNB 1VF9A 3CUOA 4NHJA 2LRDA 2NVUB 3L2QA 2ICWG 1ZRFA 2OAZA 1VQLI 1I5ZA 4N4NB 1U0JA 2UXXA 2PMHA 3R0AA 1XS9A 5ICGA 2DT5A 4MIMA 1Y1VJ 1VTNC 5DM6F 4E7ZA 3SYTA 5FKNA 4CICA 1Z91A 3TQNA 2IA0A 1OYWA 3EUHA 5D6EA 4A6EA 1JHFA 1SVOA 1ZR4A 5FKKA 4FX0A 1T33A 1OJLA 2LF7A 4IRIA 2CW8A 2DOAA 4I09A 3ZRGA 4RGSA 3FMRA 4G7OF 1MH4A 2L9RA 4BEHA 3HPHA 4DBQA 2IGNA 2O5RA 1GV2A 3I0TA 3FK6A 5M3MJ 3L00A 4QTRA 2V26A 1P6RA 3MQ0A 4RGRA 2Q2EB 5EEHA 3LSTA 4M3FA 4DIQA 3ZMDA 5JHFA 2CWEA 3EUKL 3ML6A 2L3DA 4RM3A 4AUXA 2RV8A 1FWZA 3X2QH 1G6NA 4MLOA 3OIQA 4RS8A 4BE1A 2H1KA 5B3SH 5BMZA 4S04A 3AL0C 2HI3A 3VB2A 4I6ZA 1F5TA 1D3YA 2G7HA 4GDFA 5M5YJ 1DPRA 4CCJA 1J75A 5ILVA 3MZHA 1ODDA 1JHHA 4UVCA 3HRSA 4KNYA 2GBYA 5DS9A 1I1SA 3JSOA 4XLAA 2E36A 1TC3C 3MD2A 4A3GJ 3E1SA 1FTZA 2WA0A 4KITB 3L2UA 3FK7A 4UVAA 1OFCX 3CCQI 2O3FA 2FX0A 4BY1J 1D1CA 3K6GA 4OIOF 1OPCA 4QIWN 3JRBA 1OQYA 5CKTA 5DV5A 1G3TA 1G8XA 1MD0A 3VYUB 2AXTC 5EG0B 1RESA 3BR3A 4YIFA 4EM0B 2IPQX 3DEEA 3P9CA 1LUJB 1VQMI 5AIQA 3RCOA 5EGOA 2P5LC 4PGHA 3C2HA 4Y4RA 4XQFA 4ASNA 4OIRF 4U87A 2FF4A 4R79A 3WTYC 5F04A 3VODA 2E71A 3EYYA 1LFPA 3O8GA 4A3BJ 3ZOBA 3VYSB 1ZYRF 2MYSA 1IRFA 4KISA 2EZIA 3V7RA 3CLOA 4CYDA 3KZZA 4XOPA 2XAJA 4KUMA 2QZ8A 2MH9A 1WWXA 3Q3SA 4HNTA 2CUZA 2W84A 4I2OA 3J7YJ 1K7AA 4B48A 1V54H 1KYWA 1VQOI 3CCSI 2DODA 2R5YB 2LD5A 4YELA 2MABA 1VQ7I 3OYLA 2V1DA 1E0EA 3HUGA 1UMQA 3DV8A 1Y0NA 4DJAA 2W00A 3DTIA 3L9FA 1D8KA 2X1EA 1WH7A 3J80K 1HF0A 1YTYA 5J6XA 3LSJA 2DI3A 1FIAA 3I64A 2XVCA 1T08B 4L18B 2R7UA 3S14J 1IW7F 1NK2P 1A04A 3HG9A 4MTEA 4EEFG 3PSFA 2M3AA 2HYGD 1EJ9A 1ORKA 3OY9A 3ZMSA 4EV0A 2EV6A 1ZGAA 2AQEA 5EGOB 1RR8C 2DTRA 1NG6A 4LG3A 2WB1N 3G3ZA 3QP5A 4RA2A 5E1XA 1SFEA 2ZSHB 2EBIA 4B3XA 4CYCA 1JXSA 5CVVA 2Y48A 2D45A 3EUHC 3IHUA 3U9GA 2DT7B 4OWRB 3GBGA 4A3IJ 5K7ZA 2O6GE 3P7NA 4KMUX 2VQHA 4CO8A 4FISA 3PNVA 3JW4A 3E6BA 1ETXA 3GTPJ 1JI8A 1R49A 5FLXK 3QU6A 2FOWA 1YYVA 1PVEA 2CQNA 3K2AA 2CV1A 3K7AJ 2IBDA 1MSFC 2KIFA 3OIOA 2KL4A 1YITI 1EF4A 1R4MB 3OMYA 1R36A 2ISZA 3S2HJ 1SD6A 2JRTA 2ZB9A 2DW4A 1QA6A 3OL4A 3EPZA 5FFXA 5IP9J 2XIGA 2Z2SB 3R4KA 1A35A 3GTLJ 3CMMA 3ONQA 4BQNA 5GAGJ 5J1RA 4E7SA 1DUXC 3BTLA 2HTJA 1HXDA 1E3PA 1OCOH 1P9QC 2DJIA 3G4SI 3HRUA 4YIIA 3V8JA 3WTXC 4XLNF 5M5XJ 3DKYA 4XONA 3FBIB 1DPUA 4NDLA 1MZBA 2PJPA 4W1UA 2XC7A 3P9IA 3TOBA 4JX4A 3CD6I 2CMPA 4HOBA 5LHIA 1T95A 2OTLI 1ETYA 1YQAA 4XN0A 4EJVA 1JKQC 1POGA 1E17A 3O8HA 1Z9CA 3TW6A 1BL0A 3W2WA 2D1HA 1D0YA 1X2NA 1ZRDA 2CYYA 2KJBA 1K6OA 2E60A 4IHSA 3BG6A 4A93J 3HJEA 4CZZA 1GV5A 5IT9K 1H0MA 1LEAA 1MIJA 2XGXA 5LGTA 2R93J 4XKVA 3IUOA 3K0LA 1S7AA 2CQ7A 3M7GA 3OS1A 3L2RA 1U8RA 5IPAA 2HZDA 1R00A 4WX9A 4TV7A 3GFMA 2EH3A 3JCUC 4GRIA 2LC2A 2VJIA 3DEWA 3FWEA 5E8GA 3OYGA 5LFAA 1ZELA 3B02A 2HOSA 2VJ4A 1B4AA 4BDZA 1S8NA 3O2PE 4FE4A 1XMKA 3H9GA 1O4XA 3TBIA 4II3A 1FYLA 2BXYA 4Y15A 4I98B 2ZXJA 2HQNA 4PDKA 1IO2A 3NEUA 1BI3A 2KLOA 5B5EC 4P9UA 5JI6A 3CUQC 5FD6A 2B9SA 3PNYA 2FOKA 4G8XA 4RGUA 1WJDA 1FSEA 3GLLA 4L9VA 2Y9YA 2A69F 3DPLC 4UHTA 5CYVA 1K4SA 1YJNI 4Q48A 1GLNA 1U6GA 1SMTA 2NS7A 4Y52J 5FO5A 2RAEA 3V8KA 5BPIA 5C4XJ 3WHBA 3CC7I 1SC7A 5EJCA 1HA8A 3E6CC 5TGTA 4WWCA 1UB9A 2L7MP 4XOTA 4ZDOA 4AD9A 2XGCA 2KISA 1TW2A 3NWTA 5D8KB 1DU0A 5DDGA 1JJ8C 1S29A 2E2HJ 4CCOA 2FNAA 3QYBA 2LFBA 2A6TA 3DBHB 3FHNA 2LOOA 3LQRA 5DUKA 2WTEA 5JFRA 2ZKZA 4M74A 1Q1VA 2CW0F 4A0YA 4DYCA 4L9JA 2IEKA 2WAEA 1K6YA 3M8FA 3CJTB 5ICEA 1LQ1A 3K70C 3Q0UA 5IY5H 2O7OA 1REPC 2JT1A 2VE9A 1QO0D 1UG2A 2FSWA 4XL9A 3CDIA 3T5XA 2HQRA 3V8LA 2CUJA 4A0XA 4M9XA 1YE9A 1USTA 3FXKA 3FXQA 3RZOJ 2E19A 1LB2A 1KGSA 2RNJA 4CSWA 1MGTA 2PMZN 1IG7A 1S9HA 5D5VB 3LAPA 2KDOA 4C2UA 1IXCA 3LNQA 2DU9A 2L54A 4HG2A 2HR3A 3F22A 2P4WA 3PJRA 4F92B 3WGHA 2LYCA 2DN0A 1FX7A 5LEJA 2ZNZA 2CG4A 4KFCA 1XPXA 2LNBA 2VUMJ 4DYRA 4ZYGA 3KLOA 1OR7A 4ESFA 3FDYA 2LH9A 2V9VA 3RDIA 2VPRA 3CC4I 2MLGA 1TZLA 1Z7LA 2CQXA 2FU4A 3DXJF 5EZGA 4FE7A 2ZFWA 2M30A 2VJJA 2P8TA 4LMYA 4CCNA 2XGDA 3U1DA 1RNLA 2ECCA 3O6BB 4A0ZA 5E20A 1JGSA 2DA5A 4ITVA 1X3ZB 5HOOA 5J8FA 3IL2A 3VOEA 1HLVA 3RIRA 2V6CA 1XCVA 5IP6A 1P7JA 1MDMA 2DYSH 4C3IJ 1AKHB 3ZQHA 1HDDC 2EB7A 4II2A 4HW0A 2DJNA 3I9V2 3M07A 5E3LA 4XIDA 1MJAA 1UHMA 4AM3A 4HF0A 2NNYA 3K2ZA 1WJ5A 1YHQI 4CH7A 1UELB 3AG2H 4EGYA 2VXDA 3ZQLA 1VQKI 3CESA 4Z6YA 1A5JA 3C18A 2EFPA 3W6JB 2EIKH 1JKOC 1D1AA 2EILH 3BR6A 1RETA 2VKHA 4BQOA 2R92J 2JUCA 2X85A 1MW7A 2KDZA 2R7VA 2KQRA 1T6SA 5D4RA 3HTSB 4ENMA 2F4IA 1X1PA 2EFNA 2FUG2 2M0MA 3RPUA 2ZMEB 1XG1A 1B1BA 4FASD 4LLNA 2K4JA 5HLGA 3VYRB 3A01B 3AAFA 3OV8A 2CV0A 3AFHA 1BOBA 2X6WA 2NRAC 2QCOA 1YW9A 3HC7A 5F27A 1FLIA 4A69C 4UV8A 2XAHA 2K9LA 3ABLH 2PN6A 4ABZA 3KP4A 5ILUA 1D5YA 4RMNA 2UZKA 2KP6A 1LE8B 4CGZA 3K4NA 3TDZC 1MDMB 2DK8A 1TQPA 2HYFA 2HVSA 3WU1B 3PM1A 5B1AH 2Y0SN 3OYIA 2M4GA 1ERDA 5L3CA 2JVGA 4KICA 1D8JA 2DBBA 4AIJA 3MCZA 1R5HA 1U9OA 3NRVA 3TGNA 5EDNA 3OWTA 3MZ8A 3K1MA 4PJLA 4BS9A 4IQ4A 3K4MA 4S05A 3PFYA 2KJCA 5HNFA 4IRHA 1TNTA 2QENA 3GZ6A 3Q9VA 3OIPA 2ESHA 1BM9A 1W5SA 3DPTA 2LY9A 4BXUA 5IOZA 4B43A 3WTUC 3U21A 2Y9ZA 2XUBA 2XPUA 1U2WA 4UUVA 3FF5A 1XGMA 4ZDLA 3E0JB 5KHDA 1IAWA 1WJAA 4WF2A 2R7WA 4KT5C 3NWSA 4OINF 1JGGA 1WZ2A 3MWMA 2CQKA 3I56I 2E2JJ 1MH3A 1MMSA 2WBMA 2X1CA 2W24A 3FXRA 1HOMA 2FBIA 3Q9SA 3OOPA 1ZLJA 1OR7C 3ABUA 4HDVA 2TCTA 2BV6A 2DLLA 2VASA 4FHTA 4XORA 2QQ9A 3LSIA 3TOAA 2OBPA 1LDJA 2VJ5A 3BR5A 1J9IA 3CLQA 2ZMEC 4N9HA 3LFUA 3BJ6A 4IHWA 3BR2A 5HLIA 2JN6A 3IRRA 2YR2A 2KMUA 3LWFA 4IF4A 2K9MA 5J4VA 2VBYA 1B72A 2R7FA 3ZXSA 1WSUA 1J59A 4AVZA 3KZIC 2HOEA 4DBRA 3ASNH 2V6EA 3VEPA 1OMIA 4MEYF 2JWTA 3ABMH 1MSEC 2EZLA 3K70D 1RR7A 3A03A 3E3VA 3HKZA 1FOWA 1B8IA 3M4OJ 2VLAA 1MMDA 3RQ4A 1KONA 3T8RA 4DGWB 1WKMA 2UWMA 1KQ8A 4BJ5C 2JPBA 2X6XA 3WU0A 2FQ4A 2JA8J 3BJOA 3LA2A 4XN3A 1R5ID 3BG7A 4MHGA 3JAMK 1AU7A 5CLSA 4ZYHA 2DA7A 3LFKA 1DGRM 5KAIC 5GTIC 2MC3A 1HSTA 3F21A 5D5WB 4QPOA 4I0BA 5DCMA 3R6SA 3TO7A 2RC4A 5CVIA 4PK4A 2KZVA 2VQGA 2JMWA 3G1MA 2QKMB 2JQ7A 2DMUA 2RN7A 2QM3A 2W82A 4UVBA 3COAC 3CF5F 1TWAJ 2H8RA 3EDPA 4KYWA 3JRAA 1SFXA 2L0KA 4LOCA 3P5JA 3K4CA 3F6VA 5KNLA 2ZBKA 1H9GA 4WXDA 3UNGC 5LLQA 5FLVA 1B72B 4I76A 3J7AO 1R5GA 4A3MJ 3RKXA 2XB5A 3I4PA 4B3AA 4KMFA 1B6AA 2DCEA 2BY3A 3GTJJ 5AONA 3KYDB 3ZMZA 1P2FA 3BTIA 2C6YA 3RKWA 3CJQB 3GF2A 3HKZN 1J2XA 3HSFA 1B8IB 2VN2A 4MFDA 3C7JA 4HYEA 1XGOA 1MBHA 4BACA 2DMTA 3P9KA 3F3XA 4B8XA 2GM4A 4NQWB 2HDCA 2IA1A 1E2XA 1RKWA 3IWFA 1JTYA 4XMYA 4ENKA 2CSOA 3S17J 4XKWA 3GTGJ 3HYIA 2IT0A 5ICFA 2MSYA 2NVQJ 5H20A 3QWLA 5HODA 1OCTC 3GO5A 3LSMA 3DEUA 2DAOA 2XRLA 5DCMB 2LMDA 1L0OC 5ICCA 1BR2A 1HW5A 3BWGA 4HNUA 2ZJRF 3REOA 1KYZA 1PP7U 2E1MB 3ZMTA 3WTTC 2NOJB 4ZDPA 1F4KA 3V7SA 5E1WA 4NC7A 4OMZA 4PFOA 2QVOA 4I02A 1MBGA 4BUPA 2NS0A 2LF8A 3DQVC 3JRDA 2WWYA 4QSHA 1T8IA 4XLPF 1U78A 4I7HA 3BP8A 3H36A 3OYFA 1FP2A 4ZZLA 4A3EJ 3GFIA 1FPQA 3QPHA 4EM2A 4E7IA 2QLZA 2ME0A 5D5XB 3C1DA 1R1VA 2HTSA 3CMAI 3TDUC 2H94A 5J1YA 3FBNB 1G3YA 3I53A 2W48A 4NUBA 3IAM2 4A5MA 3OYHA 1SFOJ 2UV1A 4RAGA 4M72A 2IS1A 4J00A 1FSHA 3HHHA 1IDZA 2R0QC 2OF7A 3GMEA 5IYCJ 3VPRA 1BW6A 2HKXA 2MLKA 1Y0UA 2HOTA 4DW6A 1FJLA 2GOXB 2MFZA 4JYKA 3G1OA 3F8CA 1O7LA 1ON1A 1MNEA 2A6EF 3TEDA 5JLWA 5KAFC 3C3WA 1IDYA 1Z21A 5A2QZ 1JT6A 2IJLA 2ADUA 2H6CA 4P9FA 3IP4B 1JUPA 5CVRA 4BAYA 3OSGA 4BEHB 2J5OA 2WB1A 2LTPA 1WVRA 2ELHA 2QUFA 3PL8A 4KT6A 3ABTA 1ZKGA 1KU2A 5FROA 1BOAA 3CF2A 2EFWA 2BHZA 2O8XA 3H3VK 1V4RA 1I50J 3RKYA 4LFUA 4MFEA 1FOXA 3F8NA 2HS5A 2LKXA 1KU3A 2VBWA 3WTSC 2PLYA 4BBSJ 3ELKA 3RJPA 2MGQA 2HXOA 2M34A 3BQZA 1SAUA 1X4PA 2BGCA 2E1MC 3BDDA 1EA3A 3GCMA 4I0AA 4L5JA 5C3EJ 1G2HA 3C2BA 2CUEA 3W6KB 1Y1WJ 1V5GA 2ID6A 1D0ZA 1YS6A 1S7OA 1ZH5A 2M7AA 4Y3OA 4PSXA 1IV6A 4A3JJ 1UHWA 4U0VA 2VKEA 4E6KG 2IGOA 3SDBA 1TBXA 2FMLA 4S0HB 2G9WA 4JQFA 1LVAA 4RAYA 2HKOA 2QQAA 4KIGA 3HIFA 5JHUA 5HNHA 4EMSA 1QBJA 3BPXA 4RB1A 5F0FA 1PP8F 1FBUA 2DOFA 1Z67A 3W3CA 3W2VA 1ETWA 2KPMA 2H27A 4HSTA 1ZGWA 2W25A 1BIBA 1IJWC 4UNOA 3HM5A 1WGXA 1A6IA 2XSDC 2HWVA 2A05A 3OYNA 1TT5B 5GPCA 1KQ0A 3S8PA 3BT9A 3OYBA 4NC6A 4XRSG 1S5LC 2QSFX 3EUAA 4BE0A 1YFHA 2F48A 3LSRA 2BY0A 4NNJA 1AOYA 1WHUA 4XRFA 3PO2J 1HDPA 4IHVA 1JTXA 2BE5F 4IEJA 2WV0A 3VFZA 4YIRX 2IW5A 1RZ4A 3QYFA 2MA3A 3CCJI 4B4CA 1Y6IA 4BKXA 1FEXA 5D6FA 1S6LA 5C4JJ 3CCRI 2M7BA 3H0DA 4CCMA 2CFXA 2DOEA 3HUGB 4XSZF 4YRVA 4ENJA 1AWCA 4BQQA 3HOSA 2RVCA 1GVDA 2MH2A 2OTJI 4ZTFA 2EFQA 2GQQA 1H89C 2YPRA 3RPUD 3W2AA 4Q4ZF 4D0PA 2BW3A 4Y17A 3HOZJ 4EM1A 1XGNA 2G7UA 5JLXA 4LB5A 3LMMA 1GVJA 2IA2A 3BQYA 3ZQQA 1WI9A 2RDPA 1GXQA 1X2MA 2PJRA 2E34A 2EQRA 1XB4A 2OUMA 1BR1A 2FMYA 3GFJA 3K69A 2K4BA 2VOPA 1W1WE 2MD0A 1K79A 2WAQN 4D7NA 4CYCB 2DXIA 3GXOA 1APLC 3DCFA 5DD8A 3K10A 3D0SA 4I01A 2KRCA 3KYLA 2CQQA 2VBZA 3K1PA 3MEXA 1ZR2A 1TWFJ 2CW7A 3DP7A 3N97A 2L7ZA 4X0GA 2VODA 2CH0A 5D5UB 2F5EA 3KLNA 1XMXA 3LOCA 1V3FA 4XBFA 3CCUI 3ECHA 2KRFA 3OR2C 5L3EA 3DLAA 3QQAA 3O3KA 2E5NA 1RRJA 1SANA 4F7ZA 4G12A 3OYEA 1FT9A 3S1NJ 2OPTA 5M5WJ 3KP6A 3ZQCA 4R1HA 4BXFA 1MBEA 1R6RA 3HEFA 1OYIA 1GDTA 3SZGA 4DYQA 1ENHA 1ZQ3P 2BW3B 2OZUA 2QBYA 1RIOH 4MNUA 2K9QA 3KFWX 1FZPB 2KKOA 3MKZA 4BJTA 1IXSB 3BG5A 4C2MJ 1MNDA 2EV0A 3H3ZA 3MMYB 2FJ1A 4ZYEA 4IHTA 1IN5A 3WG7H 1CGPA 4OMYA 3RI4A 2BY1A 4Y7NJ 2XAFA 4LJZF 1NH3A 3BZCA 3KX2A 4HF1A 3L1PA 4DZJA 2YX7A 5J1UA 4ZYDA 4IJAA 2JSCA 1OKRA 2JUGA 1Z77A 2PMZA 4G9YA 3CMEI 3MFKA 2VOOA 2EWNA 1IRGA 2V1NA 1D1BA 1FNNA 3T8TA 1F36A 1ZK8A 1QU3A 3A02A 1QPMA 3S2WA 4XRSA 1VQ5I 1LDKB 5F0CA 1EH8A 2L7FP 3ASOH 2E1NA 5JVTA 2YU3A 3OYAA 2OD5A 2CJJA 1K83J 3WTZA 3E6DA 1HQCA 2DMQA 2H09A 4PJJA 3FXOA 3CP2A 3WGGA 1NTCA 2F5VA 2ZNYA 4UB8C 3HXLA 1X1AA 3I55I 4D7MA 4HNVA 1YIOA 3K4LA 4A12A 2QBYB 3K1NA 4MQ9F 5ERIA 5K5RA 3V7CA 4PJNA 1X1DA 1X1CA 3DF8A 3F8BA 1LJ9A 4PUSA 2Z5UA 3PFIA 2L9VA 4JOMA 1IN8A 2ZXWH 2CFOA 4UXNA 4U0YA 2VT3A 3FZVA 4L9TA 4MTDA 3V4GA 4BHBA 1XDUA 1KU7A 3QOPA 2XKPA 2K02A 4PSWA 2GXAA 2K9SA 1OCPA 1T39A 2OC6A 4HPQA 1QVTA 2EA4A 3OYKA 3PQKA 3KEOA 5H6QA 1DDNA 3KETA 2PEXA 2RQPA 1QGPA 1U9NA 5H6RA 3QP6A 3GZNB 5EEGA 2EINH 3E6MA 4HSRA 4JX5A 1SD7A 5ED4A 1T2KA 1XSDA 3L2WA 1STZA 2H8WA 4AWXB 1N75A 3HOYJ 3E5QA 1VZ0A 1U8BA 2OQRA 2HQAA 5GADJ 5C44J 4HV6A 3JRCA 5K5OA 3FKIJ 5DM7F 2L7KA 1J5YA 4N0BA 2ELKA 1TL8A 2D1VA 4W97A 3SFIA 3LSHA 2XAUA 2KHMA 3KPHA 1TQIA 3NARA 3QOEA 2GZWA 2XPVA 3KP3A 4HX4A 3LSGA 2HQ5A 2M9HA 3GYHX 2HNHA 3NAUA 5DYMA 1LPQA 2LK2A 3K4JA 2YSRA 1E3OC 3ZPLA 2F6CA 1ETOA 1O7FA 4ZYAA 2L9NA 5FRNA 4M3DA 1MBKA 4JP0A 3L2VA 4EGZA 3SZPA 1YOVB 3CO6C 2E7WA 3AG4H 4KJZA 3D1NI 3TL4X 1R58A 2O03A 3K4BA 1VQ9I 1JKPC 2FD5A 2M8EA 2F4OB 4HLXA 4EVIA 2P6SA 4CA0A 2KT0A 2XV4S 4UUTA 1YW7A 3MZYA 2E1OA 1WQ2A 2DA6A 1SD4A 2IRFG 2DA3A 3SXYA 3PUBA 3HOVJ 3EETA 2JA2A 3HOXJ 2AS5F 4R8HA 2Y0SA 3M3YJ 2CU7A 1Z1DA 1TWHJ 5HS9A 5TISC 4Y33A 4BNCA 4DOZA 2AHQA 4DZPA 1HKSA 2YU9J 2V9KA 1QZZA 2HYJA 3DTKA 3HGYA 4B44A 3S16J 4I99C 3CCEI 3MKWB 3ZR8X 2GIVA 5LGNA 1W4MA 3CC2I 2AXLA 3OYCA 4AVPA 5HDKA 1FP1D 3SHFA 3BG9A 2AO9A 3ESWB 1WCMJ 2BHYA 1H9TA 3RTRA 1FYKA 2E7XA 2R3SA 3H5NA 5GTHC 1VQNI 2QF7A 2Z3YA 3QAHA 2RGVA 1LNWA 2L01A 2XROA 5JVGF 3SJMA 1VNDA 4HBLA 2FBKA 1WRJA 4KIFA 2GOMA 3H35A 4OAYA 1W36C 3LSPA 2R4GA 2IP2A 2PMUA 4RB0A 2IVMA 3G73A 9ANTA 4L0ZB 3LL7A 4JX6A 2F5CA 2W4SA 1AHDP 3W6VA 4D5CA 5E17F 3T0YA 1LDDA 2IGMA 2DQLA 4M6VA 2HVRA 3S2DJ 2KIMA 1BA5A 3F9KA 4JBAA 4HZFA 4AYBN 2V7FA 4BY7J 2X6OA 1BBYA 3H3UA 3WHCA 2HFHA 3ZQIA 4RB2C 5F6FA 3F23A 3OYJA 2HGCA 3IKTA 2VXZA 4OIPF 2CV2A 2HDDA 1S72I 3ABKH 3DU6A 3M8EA 3PO3J 3ZN0A 4CHUA 3WE3A 3H9JA 1WI3A 2L2OA 2UUZA 3JRIA 4IPAA 4LIUA 1FTTA 4M71A 2PFBA 5GPAA 3H9QA 2BYVE 3SEQA 1QZEA 4UUSA 1ZG1A 3G2BA 4Q47A 3I4MJ 4OAZA 3RPQA 1I6HJ 3LA3A 2NYXA 4U7BA 2DA2A 5ILSA 4P96A 2M5WA 2QQ8A 4D1QA 3FHZA 5IOYA 1ZARA 5DCFA 4PZJA 3I5UA 2JZYA 2GXBA 3BROA 1BJAA 2KIUA 2M45A 4LK1F 2JA7J 1F43A 4BHPA 4XRMA 1O3TA 4LB6B 1W7PA 4IHYA 3OSFA 2BVLA 2HU9A 3E7LA 1I39A 3GVAA 1CQTA 3CMYA 1MMNA 2Y75A 4M3GA 4RB3C 2EPFA 4HLYA 2XF5A 3WTVC 4U88A 2D5VA 5EEAA 4CDGA 3QODA 4PCQA 3ULQB 1J0RA 2TDXA 2EZHA 3A4CA 3BJAA 2CO5A 4FETA 1XDSA 2BY2A 2KIQA 3F8FA 2Q8KA 1SFUA 3RKQA 2IS4A 3G1LA 2EIJH 4AIKA 1O57A 2GA2A 2R7RA 1IRXA 1OCZH
chains in the Genus database with same CATH topology
4HX7A 3KEQA 1TW3A 2PG4A 5K5QA 1USSA 2EFOA 3J81K 1F9NA 5F64A 1B9MA 4M9ZA 4LD5A 3L09A 3ZMUA 5TRDA 3D5LA 3J80Z 1B9NA 1IZ1A 2A3SA 1O3QA 4G94A 1HSJA 3ZMVA 3EYIA 1CF7A 1W7PB 1MKMA 1RUNA 4U0WA 3FM5A 2FRHA 1ONVA 2VBXA 4GO1A 5F1RA 1O3SA 3DKWA 1ZGJA 1Z6RA 5K1YA 1ZG3A 2E1CA 3GX4X 1G3SA 3ZN1A 1Z6TA 2O61A 3Q5FA 5BQTA 2GXGA 3FMQA 4GGGA 4O5VA 4G7HF 1BI1A 1BI2A 2P5VA 1YG2A 4K2EA 2Q2EA 5FLXZ 4M9SA 1HW2A 3B73A 4O3MA 4HF2A 5E18F 4P5OA 2XAQA 1YO5C 1PDNC 3SZTA 4B09A 3E5XA 3BOQA 4U7DA 1CF7B 2OQGA 2Q0OA 1W5TA 5FB2A 3M1EA 1T38A 3L7WA 3PQJA 2ZO4A 1I1GA 4GXOA 4WXCA 3ECOA 1G3WA 1R23A 5E1ZB 2B0LA 1ULYA 2GWRA 5LRRA 1RI7A 2EJRA 2BBYA 1C0WA 1QZYA 4Q5SF 4RAZA 2X4HA 5IT9Z 1ZHFA 3QPTA 1XCBA 3FMSA 3ZQ7A 1XSVA 1TNSA 5CVUA 1R1TA 2DK5A 4H0EA 2P6TA 4CXFA 5L3FA 4QWQA 1BI0A 2MBFA 4ZH4F 3LQQA 4EJUA 5LBQA 1IN6A 4UV9A 1TQMA 1KQ9A 1KU9A 5CVJA 4OIQF 4BYYA 3HSRA 4L9NA 5DUIA 4FX4A 5E8IA 3HRMA 4YFNF 5HS8A 5AIPA 4WK8F 3BPVA 4ESBA 4G6QA 3ERED 3ISPA 4EJOA 2GA1A 2VC0A 2YX4A 4Y13A 4BQAA 4KIBA 4IVNA 4EJWA 2STTA 3CUQA 1TLHB 4OU0A 2QWWA 3CO7C 3GUDA 1T0FA 2J5PA 1ZG5A 1ZLKA 4MGRA 2ACJA 3F8MA 2P7VB 4BHCA 2JPCA 1P4XA 2X0LA 3HSEA 4YFXF 5CJ9A 2A68F 4A6DA 3QU3A 1P4AA 1YW8A 5L3BA 1HW1A 1F1ZA 2P7CB 4HDUA 1S3JA 4G7ZF 3R61A 3L2CA 1UFMA 4FT8A 3TO6A 4O6JA 3JTGA 3CUQB 2A07F 2LKPA 3WODF 4P55A 1BC8C 3CDHA 4AIHA 2K7LA 2FE3A 3WTWC 1BIAA 3KP7A 3M9AA 4KN4X 1D5VA 1SMYF 1B59A 3FXUA 5FFZA 4L5IA 2GAUA 4LGWA 2DFIA 1RUOA 4DNCA 2XASA 5FD5A 4PGGA 1R7JA 1GXPA 3JTHA 1FOKA 2HZTA 4L0YB 1MJ9A 1SD5A 2LDUA 1U3EM 1W7PD 4HQEA 4OOIA 1J7KA 2M87A 4BH9A 1G4DA 4LK0F 5A2QK 3H92A 1BN5A 3FM3A 2Z33A 1OYYA 5HDGA 3K9TA 3IKVA 4KN7X 5HLHA 2EK5A 4LLGF 4GYIA 2VT2A 2LSOA 4M73A 1ZAOA 2PQ8A 1EV7A 2UXNA 4MEXF 1YLFA 1T98A 1XD7A 4A2UA 4LLLA 5IT3A 2VONA 5TJJA 3IRQA 2V79A 2JTVA 2V1XA 2L02A 2MD5A 2A61A 5KK1A 3HOTA 5D8LB 3DFGA 2XKOA 2F5DA 2WC2A 5BS6A 3U2RA 3KZYA 5D4SA 1R22A 1XMAA 2O0YA 4YFKF 5FGMA 2ESNA 4QLCU 1Z05A 2V1UA 4WCGA 5HDNA 2EV5A 3GZ5A 3R0JA 1TTYA 3F6OA 1FY7A 4IRGA 3BZ6A 3GFLA 3KE2A 1XSXA 2L4MA 3J81Z 3JAMZ 5J8CA 2BEOA 5DD4A 3KP2A 1FBQA 1IN4A 2ZMEA 2F5FA 2XRNA 1HKTA 3GLXA 3N4MA 3HRTA 1MJBA 2EA2A 2R7DA 3RYPA 4N9IA 2FEZA 1ZRCA 1NHAA 2Z9OA 3CTAA 2FQ3A 1IN7A 2QYOA 3GEZA 4HAMA 2OZ6A 4XSXF 2XAGA 4IXAA 2PI0A 4ON0A 2DO7A 4M6YA 3HHGA 4KDPA 2M1BA 2A5YB 3SQNA 2NNNA 5BOXA 4ENNA 1BC7C 1QNTA 1DP7P 1FBSA 3FX3A 5BPDA 1X3UA 2QQBA 4ESJA 2L4AA 5JR3A 5LHGA 5HS7A 2W57A 1Q1HA 2Z99A 2FA5A 1PUEE 3ROUA 2ZCWA 3HTUA 2H6BA 3MAJA 3E97A 3I59A 4YG2F 2D2WA 1ON2A 1U5TA 3RYRA 4M6XA 3WG9A 4HV5A 2DPUA 4RGXA 3I71A 3I58A 1QQIA 3QRFF 3KCCA 5LGUA 4LG0A 1YS7A 1L3LA 1LEBA 2K86A 2OA4A 2OU2A 1EH6A 2K27A 2FNPA 4WXHA 2DQRA 5LRSA 5LHHA 3WE2A 2DPDA 3R60A 4EQQA 4GCVA 1HKQA 3LA7A 4MQVA 1ZREA 2FXAA 4JK1X 3CJNA 3I59B 3JSPA 2CGPA 1U5TB 3WGIA 4NB5A 1I27A 4KA4A 1P4WA 1K78A 1UCRA 1GHCA 4LG0B 1HBXG 2NAZA 3F72A 5L3GA 4GYGA 3T1BA 1R1UA 1XGSA 1IUYA 2ZJ2A 3EQLF 4HX8A 3SFZA 1I6XA 3GW2A 5DEQA 1SAXA 1Z7UA 1O3RA 4HA8A 2P5KA 1KA8A 3KP5A 5LEKA 2ETHA 4NQWA 5KVRA 1JE8A 1XN7A 4E70A 3TO9A 2COMA 2W85A 2PBIA 4G6DA 6PAXA 5L3DA 4HQMA 3TKYA 3GWZA 3E5UA 3ZP5A 1IXRC 2RKHA 1EH7A 1FC3A 5HVQC 2VC1A 4ZZDA 1IF1A 2FBHA 4Z2YA 2F2EA 4ETSA 3NQOA 2XHKA 1K78B 2Y0MA 2A6HF 1ZN2A 4A5NA 3BY6A 1FYMA 4DQ2A 2VE8A 3LAJA 2ISYA 4EJTA 3IWZA 1P92A 3I54A 1U5TC 2STWA 3IC7A 3CUOA 4NHJA 1ZRFA 2OAZA 1I5ZA 2UXXA 2PMHA 3R0AA 5ICGA 2DT5A 1VTNC 4CICA 1Z91A 3TQNA 2IA0A 1OYWA 3EUHA 5D6EA 4A6EA 1JHFA 4FX0A 2LF7A 4IRIA 4I09A 4RGSA 3FMRA 4G7OF 3I0TA 3L00A 5EEHA 1P6RA 3MQ0A 4RGRA 3LSTA 3ZMDA 2CWEA 3ML6A 2L3DA 2RV8A 1FWZA 1G6NA 4RS8A 5BMZA 4S04A 3VB2A 1F5TA 1D3YA 2G7HA 1DPRA 1J75A 5ILVA 3MZHA 1ODDA 1JHHA 4UVCA 3HRSA 4KNYA 1I1SA 3JSOA 4UVAA 2O3FA 4OIOF 1OPCA 5DV5A 1G3TA 1MD0A 4YIFA 4EM0B 2IPQX 3P9CA 5AIQA 2P5LC 4PGHA 4ASNA 4OIRF 4R79A 2FF4A 3WTYC 3VODA 3EYYA 1ZYRF 1IRFA 3V7RA 3CLOA 4CYDA 3KZZA 2XAJA 4KUMA 2QZ8A 2MH9A 1WWXA 2W84A 4I2OA 1K7AA 1KYWA 2V1DA 3HUGA 3DV8A 3L9FA 1D8KA 3J80K 1YTYA 5J6XA 2DI3A 3I64A 2XVCA 4L18B 1IW7F 1A04A 4MTEA 2HYGD 2HEOA 3ZMSA 4EV0A 2EV6A 1ZGAA 2DTRA 3G3ZA 3QP5A 5E1XA 1SFEA 1JXSA 5CVVA 2Y48A 2D45A 3U9GA 3IHUA 2O6GE 3P7NA 4KMUX 4CO8A 3JW4A 3E6BA 5FLXK 3QU6A 1YYVA 2KIFA 1R36A 2ISZA 1SD6A 2JRTA 2DW4A 5FFXA 2XIGA 3R4KA 1DUXC 2HTJA 1HXDA 3HRUA 4YIIA 3V8JA 3WTXC 4XLNF 1DPUA 1MZBA 2PJPA 3P9IA 3TOBA 4HOBA 5LHIA 1YQAA 4EJVA 1E17A 1Z9CA 2D1HA 1ZRDA 2CYYA 2KJBA 1K6OA 4IHSA 4CZZA 5IT9K 1H0MA 1LEAA 2XGXA 5LGTA 3K0LA 1S7AA 3M7GA 1U8RA 1R00A 4WX9A 4TV7A 3GFMA 3FWEA 5E8GA 3B02A 1B4AA 1S8NA 3O2PE 1XMKA 1FYLA 4Y15A 4I98B 2ZXJA 2HQNA 4PDKA 3NEUA 1BI3A 4P9UA 5JI6A 3CUQC 5FD6A 2FOKA 4G8XA 4RGUA 1FSEA 4L9VA 2A69F 3DPLC 4UHTA 5CYVA 4Q48A 1U6GA 1SMTA 5FO5A 5BPIA 3V8KA 3E6CC 4WWCA 1UB9A 4AD9A 1TW2A 5D8KB 5DDGA 1S29A 2FNAA 3LQRA 5DUKA 2WTEA 5JFRA 2ZKZA 4M74A 2CW0F 4A0YA 4L9JA 3M8FA 5ICEA 1LQ1A 1REPC 2JT1A 2VE9A 1QO0D 2FSWA 3T5XA 4A0XA 2HQRA 3V8LA 4M9XA 1USTA 3FXQA 1LB2A 1KGSA 2RNJA 1MGTA 5D5VB 3LAPA 1IXCA 2DU9A 2L54A 3F22A 2HR3A 2P4WA 3WGHA 1FX7A 5LEJA 2ZNZA 2CG4A 4KFCA 2LNBA 4ZYGA 3KLOA 1OR7A 4ESFA 2V9VA 3RDIA 2MLGA 2FU4A 3DXJF 2ZFWA 2M30A 2P8TA 4LMYA 3U1DA 1RNLA 3O6BB 4A0ZA 5E20A 1JGSA 5HOOA 5J8FA 3IL2A 3VOEA 3RIRA 2V6CA 1XCVA 1MDMA 2EB7A 4HW0A 1MJAA 1UHMA 4HF0A 2NNYA 3K2ZA 4EGYA 3C18A 2EFPA 3W6JB 1T6SA 5D4RA 3HTSB 4ENMA 2EFNA 3RPUA 2ZMEB 1B1BA 4LLNA 2K4JA 5HLGA 3AAFA 3OV8A 2NRAC 1YW9A 1FLIA 4UV8A 2XAHA 2PN6A 5ILUA 3KP4A 2UZKA 4CGZA 3TDZC 1MDMB 2DK8A 1TQPA 2HYFA 3WU1B 5L3CA 4KICA 1D8JA 2DBBA 4AIJA 3MCZA 1R5HA 3NRVA 3TGNA 3K1MA 4S05A 2KJCA 4IRHA 1TNTA 2QENA 3GZ6A 3Q9VA 2ESHA 1BM9A 1W5SA 3DPTA 4BXUA 3WTUC 2XUBA 1U2WA 4UUVA 3FF5A 1XGMA 1IAWA 4WF2A 4KT5C 4OINF 3MWMA 2CQKA 3FXRA 2W24A 2FBIA 3Q9SA 3OOPA 1ZLJA 3ABUA 4HDVA 2BV6A 2DLLA 4FHTA 2QQ9A 3TOAA 2OBPA 1LDJA 1J9IA 4N9HA 3BJ6A 5HLIA 3IRRA 2YR2A 3LWFA 4IF4A 2VBYA 2R7FA 1WSUA 1J59A 2HOEA 3VEPA 1OMIA 4MEYF 3E3VA 3T8RA 1WKMA 2UWMA 1KQ8A 2JPBA 3WU0A 3BJOA 3LA2A 4MHGA 3JAMK 5CLSA 4ZYHA 3LFKA 2MC3A 1HSTA 3F21A 5D5WB 4I0BA 5DCMA 3R6SA 3TO7A 2RC4A 5CVIA 2RN7A 2QM3A 3COAC 4UVBA 4KYWA 3EDPA 1SFXA 3F6VA 2ZBKA 1H9GA 4WXDA 5LLQA 3J7AO 1R5GA 3RKXA 3I4PA 4KMFA 1B6AA 5AONA 3ZMZA 1P2FA 2C6YA 3RKWA 3GF2A 1J2XA 3HSFA 2VN2A 3C7JA 4HYEA 1XGOA 3P9KA 3F3XA 4B8XA 2HDCA 2IA1A 1E2XA 3IWFA 4ENKA 2CSOA 3HYIA 2IT0A 5ICFA 5H20A 3GO5A 3DEUA 2DAOA 5DCMB 1L0OC 5ICCA 1HW5A 3BWGA 3REOA 1KYZA 1PP7U 3ZMTA 3WTTC 1F4KA 3V7SA 5E1WA 4OMZA 2QVOA 4I02A 2NS0A 2LF8A 3DQVC 2WWYA 1U78A 4XLPF 4I7HA 3BP8A 1FP2A 4ZZLA 3GFIA 1FPQA 3QPHA 4EM2A 2QLZA 5D5XB 3C1DA 1R1VA 2HTSA 3TDUC 2H94A 1G3YA 3I53A 4A5MA 4M72A 1FSHA 3HHHA 2HKXA 2MLKA 1Y0UA 3F8CA 1O7LA 1ON1A 2A6EF 3C3WA 5A2QZ 2IJLA 2ADUA 2H6CA 4P9FA 5CVRA 4BAYA 2J5OA 2ELHA 2QUFA 3ABTA 1KU2A 1BOAA 2EFWA 2O8XA 1V4RA 3RKYA 4LFUA 3F8NA 2HS5A 1KU3A 2VBWA 3WTSC 2PLYA 3ELKA 3RJPA 2BGCA 3BDDA 4L5JA 4I0AA 3W6KB 1YS6A 1S7OA 1ZH5A 1UHWA 4U0VA 1TBXA 2FMLA 2G9WA 4JQFA 1LVAA 4RAYA 2HKOA 2QQAA 4KIGA 3HIFA 5JHUA 4EMSA 1QBJA 3BPXA 4RB1A 1PP8F 1FBUA 2H27A 2W25A 1BIBA 4UNOA 2HWVA 1KQ0A 1YFHA 1AOYA 4XRFA 2BE5F 2WV0A 3VFZA 2IW5A 1RZ4A 2MA3A 5D6FA 1S6LA 2CFXA 4XSZF 1AWCA 4ENJA 3HOSA 2RVCA 2MH2A 2EFQA 2GQQA 2YPRA 4Q4ZF 4D0PA 4Y17A 4EM1A 1XGNA 2G7UA 4LB5A 1GVJA 2IA2A 1WI9A 2RDPA 1GXQA 1XB4A 2FMYA 3GFJA 3K69A 2K4BA 2VOPA 1K79A 3GXOA 5DD8A 3D0SA 4I01A 2VBZA 3K1PA 3MEXA 3DP7A 3N97A 2VODA 5D5UB 2F5EA 3KLNA 1V3FA 4XBFA 3ECHA 2KRFA 5L3EA 3O3KA 4F7ZA 1FT9A 3KP6A 4R1HA 1OYIA 2OZUA 2QBYA 1RIOH 4MNUA 3KFWX 1FZPB 2KKOA 1IXSB 2EV0A 3H3ZA 4ZYEA 4IHTA 1IN5A 4OMYA 1CGPA 3RI4A 2XAFA 4LJZF 4HF1A 2YX7A 4ZYDA 4IJAA 2JSCA 1OKRA 4G9YA 3MFKA 2VOOA 2EWNA 1IRGA 1FNNA 3T8TA 1QPMA 3S2WA 1LDKB 1EH8A 2E1NA 5JVTA 2YU3A 2OD5A 3WTZA 3E6DA 1HQCA 2H09A 3WGGA 2ZNYA 1YIOA 4A12A 2QBYB 3K1NA 4MQ9F 5ERIA 5K5RA 3V7CA 3DF8A 3F8BA 1LJ9A 2Z5UA 3PFIA 1IN8A 4UXNA 4U0YA 2VT3A 3FZVA 4L9TA 4MTDA 3V4GA 4BHBA 1XDUA 1KU7A 3QOPA 2XKPA 2K02A 1T39A 2EA4A 3PQKA 3KEOA 5H6QA 1DDNA 3KETA 2PEXA 2RQPA 1QGPA 5H6RA 3QP6A 5EEGA 3E6MA 1SD7A 5ED4A 1T2KA 1XSDA 1STZA 4AWXB 3E5QA 2OQRA 4HV6A 5K5OA 4N0BA 1J5YA 2D1VA 1TQIA 2GZWA 3KP3A 3GYHX 4HX4A 5DYMA 2YSRA 3ZPLA 1O7FA 4EGZA 3SZPA 3CO6C 2E7WA 1R58A 2O03A 2M8EA 4HLXA 4EVIA 2P6SA 2XV4S 1YW7A 3MZYA 1WQ2A 1SD4A 2IRFG 3SXYA 3EETA 2AS5F 4R8HA 1Z1DA 5HS9A 4BNCA 1HKSA 1QZZA 2GIVA 5LGNA 1W4MA 2AXLA 4AVPA 5HDKA 1FP1D 3SHFA 1H9TA 3RTRA 1FYKA 2E7XA 2R3SA 2Z3YA 3QAHA 2RGVA 1LNWA 2L01A 2XROA 4HBLA 2FBKA 1WRJA 4KIFA 2IP2A 2PMUA 4RB0A 2IVMA 3G73A 4L0ZB 2F5CA 5E17F 3T0YA 1LDDA 2DQLA 2KIMA 4JBAA 4HZFA 1BBYA 3H3UA 4RB2C 2HFHA 3F23A 5F6FA 2HGCA 3IKTA 2VXZA 4OIPF 3M8EA 3ZN0A 4CHUA 3WE3A 4IPAA 4M71A 2PFBA 2BYVE 1ZG1A 4Q47A 3RPQA 3LA3A 2NYXA 4U7BA 5ILSA 4P96A 2M5WA 3FHZA 1ZARA 5DCFA 4PZJA 3I5UA 2JZYA 2GXBA 3BROA 1BJAA 2KIUA 2M45A 4LK1F 4BHPA 1O3TA 4LB6B 1W7PA 3GVAA 2Y75A 4HLYA 4RB3C 3WTVC 4U88A 4CDGA 4PCQA 3ULQB 1J0RA 2TDXA 3BJAA 2CO5A 1XDSA 3F8FA 2Q8KA 1SFUA 4AIKA 1O57A 2GA2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HX7 A;  3KEQ A;  1TW3 A;  2PG4 A;  5K5Q A;  1USS A;  2EFO A;  3J81 K;  1F9N A;  5F64 A;  1B9M A;  4M9Z A;  4LD5 A;  3L09 A;  3ZMU A;  5TRD A;  3D5L A;  3J80 Z;  1B9N A;  1IZ1 A;  2A3S A;  1O3Q A;  4G94 A;  1HSJ A;  3ZMV A;  3EYI A;  1CF7 A;  1W7P B;  1MKM A;  1RUN A;  4U0W A;  3FM5 A;  2FRH A;  1ONV A;  2VBX A;  4GO1 A;  5F1R A;  1O3S A;  3DKW A;  1ZGJ A;  1Z6R A;  5K1Y A;  1ZG3 A;  2E1C A;  3GX4 X;  1G3S A;  3ZN1 A;  1Z6T A;  2O61 A;  3Q5F A;  5BQT A;  2GXG A;  3FMQ A;  4GGG A;  4O5V A;  4G7H F;  1BI1 A;  1BI2 A;  2P5V A;  1YG2 A;  4K2E A;  2Q2E A;  5FLX Z;  4M9S A;  1HW2 A;  3B73 A;  4O3M A;  4HF2 A;  5E18 F;  4P5O A;  2XAQ A;  1YO5 C;  1PDN C;  3SZT A;  4B09 A;  3E5X A;  3BOQ A;  4U7D A;  1CF7 B;  2OQG A;  2Q0O A;  1W5T A;  5FB2 A;  3M1E A;  1T38 A;  3L7W A;  3PQJ A;  2ZO4 A;  1I1G A;  4GXO A;  4WXC A;  3ECO A;  1G3W A;  1R23 A;  5E1Z B;  2B0L A;  1ULY A;  2GWR A;  5LRR A;  1RI7 A;  2EJR A;  2BBY A;  1C0W A;  1QZY A;  4Q5S F;  4RAZ A;  2X4H A;  5IT9 Z;  1ZHF A;  3QPT A;  1XCB A;  3FMS A;  3ZQ7 A;  1XSV A;  1TNS A;  5CVU A;  1R1T A;  2DK5 A;  4H0E A;  2P6T A;  4CXF A;  5L3F A;  4QWQ A;  1BI0 A;  2MBF A;  4ZH4 F;  3LQQ A;  4EJU A;  5LBQ A;  1IN6 A;  4UV9 A;  1TQM A;  1KQ9 A;  1KU9 A;  5CVJ A;  4OIQ F;  4BYY A;  3HSR A;  4L9N A;  5DUI A;  4FX4 A;  5E8I A;  3HRM A;  4YFN F;  5HS8 A;  5AIP A;  4WK8 F;  3BPV A;  4ESB A;  4G6Q A;  3ERE D;  3ISP A;  4EJO A;  2GA1 A;  2VC0 A;  2YX4 A;  4Y13 A;  4BQA A;  4KIB A;  4IVN A;  4EJW A;  2STT A;  3CUQ A;  1TLH B;  4OU0 A;  2QWW A;  3CO7 C;  3GUD A;  1T0F A;  2J5P A;  1ZG5 A;  1ZLK A;  4MGR A;  2ACJ A;  3F8M A;  2P7V B;  4BHC A;  2JPC A;  1P4X A;  2X0L A;  3HSE A;  4YFX F;  5CJ9 A;  2A68 F;  4A6D A;  3QU3 A;  1P4A A;  1YW8 A;  5L3B A;  1HW1 A;  1F1Z A;  2P7C B;  4HDU A;  1S3J A;  4G7Z F;  3R61 A;  3L2C A;  1UFM A;  4FT8 A;  3TO6 A;  4O6J A;  3JTG A;  3CUQ B;  2A07 F;  2LKP A;  3WOD F;  4P55 A;  1BC8 C;  3CDH A;  4AIH A;  2K7L A;  2FE3 A;  3WTW C;  1BIA A;  3KP7 A;  3M9A A;  4KN4 X;  1D5V A;  1SMY F;  1B59 A;  3FXU A;  5FFZ A;  4L5I A;  2GAU A;  4LGW A;  2DFI A;  1RUO A;  4DNC A;  2XAS A;  5FD5 A;  4PGG A;  1R7J A;  1GXP A;  3JTH A;  1FOK A;  2HZT A;  4L0Y B;  1MJ9 A;  1SD5 A;  2LDU A;  1U3E M;  1W7P D;  4HQE A;  4OOI A;  1J7K A;  2M87 A;  4BH9 A;  1G4D A;  4LK0 F;  5A2Q K;  3H92 A;  1BN5 A;  3FM3 A;  2Z33 A;  1OYY A;  5HDG A;  3K9T A;  3IKV A;  4KN7 X;  5HLH A;  2EK5 A;  4LLG F;  4GYI A;  2VT2 A;  2LSO A;  4M73 A;  1ZAO A;  2PQ8 A;  1EV7 A;  2UXN A;  4MEX F;  1YLF A;  1T98 A;  1XD7 A;  4A2U A;  4LLL A;  5IT3 A;  2VON A;  5TJJ A;  3IRQ A;  2V79 A;  2JTV A;  2V1X A;  2L02 A;  2MD5 A;  2A61 A;  5KK1 A;  3HOT A;  5D8L B;  3DFG A;  2XKO A;  2F5D A;  2WC2 A;  5BS6 A;  3U2R A;  3KZY A;  5D4S A;  1R22 A;  1XMA A;  2O0Y A;  4YFK F;  5FGM A;  2ESN A;  4QLC U;  1Z05 A;  2V1U A;  4WCG A;  5HDN A;  2EV5 A;  3GZ5 A;  3R0J A;  1TTY A;  3F6O A;  1FY7 A;  4IRG A;  3BZ6 A;  3GFL A;  3KE2 A;  1XSX A;  2L4M A;  3J81 Z;  3JAM Z;  5J8C A;  2BEO A;  5DD4 A;  3KP2 A;  1FBQ A;  1IN4 A;  2ZME A;  2F5F A;  2XRN A;  1HKT A;  3GLX A;  3N4M A;  3HRT A;  1MJB A;  2EA2 A;  2R7D A;  3RYP A;  4N9I A;  2FEZ A;  1ZRC A;  1NHA A;  2Z9O A;  3CTA A;  2FQ3 A;  1IN7 A;  2QYO A;  3GEZ A;  4HAM A;  2OZ6 A;  4XSX F;  2XAG A;  4IXA A;  2PI0 A;  4ON0 A;  2DO7 A;  4M6Y A;  3HHG A;  4KDP A;  2M1B A;  2A5Y B;  3SQN A;  2NNN A;  5BOX A;  4ENN A;  1BC7 C;  1QNT A;  1DP7 P;  1FBS A;  3FX3 A;  5BPD A;  1X3U A;  2QQB A;  4ESJ A;  2L4A A;  5JR3 A;  5LHG A;  5HS7 A;  2W57 A;  1Q1H A;  2Z99 A;  2FA5 A;  1PUE E;  3ROU A;  2ZCW A;  3HTU A;  2H6B A;  3MAJ A;  3E97 A;  3I59 A;  4YG2 F;  2D2W A;  1ON2 A;  1U5T A;  3RYR A;  4M6X A;  3WG9 A;  4HV5 A;  2DPU A;  4RGX A;  3I71 A;  3I58 A;  1QQI A;  3QRF F;  3KCC A;  5LGU A;  4LG0 A;  1YS7 A;  1L3L A;  1LEB A;  2K86 A;  2OA4 A;  2OU2 A;  1EH6 A;  2K27 A;  2FNP A;  4WXH A;  2DQR A;  5LRS A;  5LHH A;  3WE2 A;  2DPD A;  3R60 A;  4EQQ A;  4GCV A;  1HKQ A;  3LA7 A;  4MQV A;  1ZRE A;  2FXA A;  4JK1 X;  3CJN A;  3I59 B;  3JSP A;  2CGP A;  1U5T B;  3WGI A;  4NB5 A;  1I27 A;  4KA4 A;  1P4W A;  1K78 A;  1UCR A;  1GHC A;  4LG0 B;  1HBX G;  2NAZ A;  3F72 A;  5L3G A;  4GYG A;  3T1B A;  1R1U A;  1XGS A;  1IUY A;  2ZJ2 A;  3EQL F;  4HX8 A;  3SFZ A;  1I6X A;  3GW2 A;  5DEQ A;  1SAX A;  1Z7U A;  1O3R A;  4HA8 A;  2P5K A;  1KA8 A;  3KP5 A;  5LEK A;  2ETH A;  4NQW A;  5KVR A;  1JE8 A;  1XN7 A;  4E70 A;  3TO9 A;  2COM A;  2W85 A;  2PBI A;  4G6D A;  6PAX A;  5L3D A;  4HQM A;  3TKY A;  3GWZ A;  3E5U A;  3ZP5 A;  1IXR C;  2RKH A;  1EH7 A;  1FC3 A;  5HVQ C;  2VC1 A;  4ZZD A;  1IF1 A;  2FBH A;  4Z2Y A;  2F2E A;  4ETS A;  3NQO A;  2XHK A;  1K78 B;  2Y0M A;  2A6H F;  1ZN2 A;  4A5N A;  3BY6 A;  1FYM A;  4DQ2 A;  2VE8 A;  3LAJ A;  2ISY A;  4EJT A;  3IWZ A;  1P92 A;  3I54 A;  1U5T C;  2STW A;  3IC7 A;  3CUO A;  4NHJ A;  1ZRF A;  2OAZ A;  1I5Z A;  2UXX A;  2PMH A;  3R0A A;  5ICG A;  2DT5 A;  1VTN C;  4CIC A;  1Z91 A;  3TQN A;  2IA0 A;  1OYW A;  3EUH A;  5D6E A;  4A6E A;  1JHF A;  4FX0 A;  2LF7 A;  4IRI A;  4I09 A;  4RGS A;  3FMR A;  4G7O F;  3I0T A;  3L00 A;  5EEH A;  1P6R A;  3MQ0 A;  4RGR A;  3LST A;  3ZMD A;  2CWE A;  3ML6 A;  2L3D A;  2RV8 A;  1FWZ A;  1G6N A;  4RS8 A;  5BMZ A;  4S04 A;  3VB2 A;  1F5T A;  1D3Y A;  2G7H A;  1DPR A;  1J75 A;  5ILV A;  3MZH A;  1ODD A;  1JHH A;  4UVC A;  3HRS A;  4KNY A;  1I1S A;  3JSO A;  4UVA A;  2O3F A;  4OIO F;  1OPC A;  5DV5 A;  1G3T A;  1MD0 A;  4YIF A;  4EM0 B;  2IPQ X;  3P9C A;  5AIQ A;  2P5L C;  4PGH A;  4ASN A;  4OIR F;  4R79 A;  2FF4 A;  3WTY C;  3VOD A;  3EYY A;  1ZYR F;  1IRF A;  3V7R A;  3CLO A;  4CYD A;  3KZZ A;  2XAJ A;  4KUM A;  2QZ8 A;  2MH9 A;  1WWX A;  2W84 A;  4I2O A;  1K7A A;  1KYW A;  2V1D A;  3HUG A;  3DV8 A;  3L9F A;  1D8K A;  3J80 K;  1YTY A;  5J6X A;  2DI3 A;  3I64 A;  2XVC A;  4L18 B;  1IW7 F;  1A04 A;  4MTE A;  2HYG D;  2HEO A;  3ZMS A;  4EV0 A;  2EV6 A;  1ZGA A;  2DTR A;  3G3Z A;  3QP5 A;  5E1X A;  1SFE A;  1JXS A;  5CVV A;  2Y48 A;  2D45 A;  3U9G A;  3IHU A;  2O6G E;  3P7N A;  4KMU X;  4CO8 A;  3JW4 A;  3E6B A;  5FLX K;  3QU6 A;  1YYV A;  2KIF A;  1R36 A;  2ISZ A;  1SD6 A;  2JRT A;  2DW4 A;  5FFX A;  2XIG A;  3R4K A;  1DUX C;  2HTJ A;  1HXD A;  3HRU A;  4YII A;  3V8J A;  3WTX C;  4XLN F;  1DPU A;  1MZB A;  2PJP A;  3P9I A;  3TOB A;  4HOB A;  5LHI A;  1YQA A;  4EJV A;  1E17 A;  1Z9C A;  2D1H A;  1ZRD A;  2CYY A;  2KJB A;  1K6O A;  4IHS A;  4CZZ A;  5IT9 K;  1H0M A;  1LEA A;  2XGX A;  5LGT A;  3K0L A;  1S7A A;  3M7G A;  1U8R A;  1R00 A;  4WX9 A;  4TV7 A;  3GFM A;  3FWE A;  5E8G A;  3B02 A;  1B4A A;  1S8N A;  3O2P E;  1XMK A;  1FYL A;  4Y15 A;  4I98 B;  2ZXJ A;  2HQN A;  4PDK A;  3NEU A;  1BI3 A;  4P9U A;  5JI6 A;  3CUQ C;  5FD6 A;  2FOK A;  4G8X A;  4RGU A;  1FSE A;  4L9V A;  2A69 F;  3DPL C;  4UHT A;  5CYV A;  4Q48 A;  1U6G A;  1SMT A;  5FO5 A;  5BPI A;  3V8K A;  3E6C C;  4WWC A;  1UB9 A;  4AD9 A;  1TW2 A;  5D8K B;  5DDG A;  1S29 A;  2FNA A;  3LQR A;  5DUK A;  2WTE A;  5JFR A;  2ZKZ A;  4M74 A;  2CW0 F;  4A0Y A;  4L9J A;  3M8F A;  5ICE A;  1LQ1 A;  1REP C;  2JT1 A;  2VE9 A;  1QO0 D;  2FSW A;  3T5X A;  4A0X A;  2HQR A;  3V8L A;  4M9X A;  1UST A;  3FXQ A;  1LB2 A;  1KGS A;  2RNJ A;  1MGT A;  5D5V B;  3LAP A;  1IXC A;  2DU9 A;  2L54 A;  3F22 A;  2HR3 A;  2P4W A;  3WGH A;  1FX7 A;  5LEJ A;  2ZNZ A;  2CG4 A;  4KFC A;  2LNB A;  4ZYG A;  3KLO A;  1OR7 A;  4ESF A;  2V9V A;  3RDI A;  2MLG A;  2FU4 A;  3DXJ F;  2ZFW A;  2M30 A;  2P8T A;  4LMY A;  3U1D A;  1RNL A;  3O6B B;  4A0Z A;  5E20 A;  1JGS A;  5HOO A;  5J8F A;  3IL2 A;  3VOE A;  3RIR A;  2V6C A;  1XCV A;  1MDM A;  2EB7 A;  4HW0 A;  1MJA A;  1UHM A;  4HF0 A;  2NNY A;  3K2Z A;  4EGY A;  3C18 A;  2EFP A;  3W6J B;  1T6S A;  5D4R A;  3HTS B;  4ENM A;  2EFN A;  3RPU A;  2ZME B;  1B1B A;  4LLN A;  2K4J A;  5HLG A;  3AAF A;  3OV8 A;  2NRA C;  1YW9 A;  1FLI A;  4UV8 A;  2XAH A;  2PN6 A;  5ILU A;  3KP4 A;  2UZK A;  4CGZ A;  3TDZ C;  1MDM B;  2DK8 A;  1TQP A;  2HYF A;  3WU1 B;  5L3C A;  4KIC A;  1D8J A;  2DBB A;  4AIJ A;  3MCZ A;  1R5H A;  3NRV A;  3TGN A;  3K1M A;  4S05 A;  2KJC A;  4IRH A;  1TNT A;  2QEN A;  3GZ6 A;  3Q9V A;  2ESH A;  1BM9 A;  1W5S A;  3DPT A;  4BXU A;  3WTU C;  2XUB A;  1U2W A;  4UUV A;  3FF5 A;  1XGM A;  1IAW A;  4WF2 A;  4KT5 C;  4OIN F;  3MWM A;  2CQK A;  3FXR A;  2W24 A;  2FBI A;  3Q9S A;  3OOP A;  1ZLJ A;  3ABU A;  4HDV A;  2BV6 A;  2DLL A;  4FHT A;  2QQ9 A;  3TOA A;  2OBP A;  1LDJ A;  1J9I A;  4N9H A;  3BJ6 A;  5HLI A;  3IRR A;  2YR2 A;  3LWF A;  4IF4 A;  2VBY A;  2R7F A;  1WSU A;  1J59 A;  2HOE A;  3VEP A;  1OMI A;  4MEY F;  3E3V A;  3T8R A;  1WKM A;  2UWM A;  1KQ8 A;  2JPB A;  3WU0 A;  3BJO A;  3LA2 A;  4MHG A;  3JAM K;  5CLS A;  4ZYH A;  3LFK A;  2MC3 A;  1HST A;  3F21 A;  5D5W B;  4I0B A;  5DCM A;  3R6S A;  3TO7 A;  2RC4 A;  5CVI A;  2RN7 A;  2QM3 A;  3COA C;  4UVB A;  4KYW A;  3EDP A;  1SFX A;  3F6V A;  2ZBK A;  1H9G A;  4WXD A;  5LLQ A;  3J7A O;  1R5G A;  3RKX A;  3I4P A;  4KMF A;  1B6A A;  5AON A;  3ZMZ A;  1P2F A;  2C6Y A;  3RKW A;  3GF2 A;  1J2X A;  3HSF A;  2VN2 A;  3C7J A;  4HYE A;  1XGO A;  3P9K A;  3F3X A;  4B8X A;  2HDC A;  2IA1 A;  1E2X A;  3IWF A;  4ENK A;  2CSO A;  3HYI A;  2IT0 A;  5ICF A;  5H20 A;  3GO5 A;  3DEU A;  2DAO A;  5DCM B;  1L0O C;  5ICC A;  1HW5 A;  3BWG A;  3REO A;  1KYZ A;  1PP7 U;  3ZMT A;  3WTT C;  1F4K A;  3V7S A;  5E1W A;  4OMZ A;  2QVO A;  4I02 A;  2NS0 A;  2LF8 A;  3DQV C;  2WWY A;  1U78 A;  4XLP F;  4I7H A;  3BP8 A;  1FP2 A;  4ZZL A;  3GFI A;  1FPQ A;  3QPH A;  4EM2 A;  2QLZ A;  5D5X B;  3C1D A;  1R1V A;  2HTS A;  3TDU C;  2H94 A;  1G3Y A;  3I53 A;  4A5M A;  4M72 A;  1FSH A;  3HHH A;  2HKX A;  2MLK A;  1Y0U A;  3F8C A;  1O7L A;  1ON1 A;  2A6E F;  3C3W A;  5A2Q Z;  2IJL A;  2ADU A;  2H6C A;  4P9F A;  5CVR A;  4BAY A;  2J5O A;  2ELH A;  2QUF A;  3ABT A;  1KU2 A;  1BOA A;  2EFW A;  2O8X A;  1V4R A;  3RKY A;  4LFU A;  3F8N A;  2HS5 A;  1KU3 A;  2VBW A;  3WTS C;  2PLY A;  3ELK A;  3RJP A;  2BGC A;  3BDD A;  4L5J A;  4I0A A;  3W6K B;  1YS6 A;  1S7O A;  1ZH5 A;  1UHW A;  4U0V A;  1TBX A;  2FML A;  2G9W A;  4JQF A;  1LVA A;  4RAY A;  2HKO A;  2QQA A;  4KIG A;  3HIF A;  5JHU A;  4EMS A;  1QBJ A;  3BPX A;  4RB1 A;  1PP8 F;  1FBU A;  2H27 A;  2W25 A;  1BIB A;  4UNO A;  2HWV A;  1KQ0 A;  1YFH A;  1AOY A;  4XRF A;  2BE5 F;  2WV0 A;  3VFZ A;  2IW5 A;  1RZ4 A;  2MA3 A;  5D6F A;  1S6L A;  2CFX A;  4XSZ F;  1AWC A;  4ENJ A;  3HOS A;  2RVC A;  2MH2 A;  2EFQ A;  2GQQ A;  2YPR A;  4Q4Z F;  4D0P A;  4Y17 A;  4EM1 A;  1XGN A;  2G7U A;  4LB5 A;  1GVJ A;  2IA2 A;  1WI9 A;  2RDP A;  1GXQ A;  1XB4 A;  2FMY A;  3GFJ A;  3K69 A;  2K4B A;  2VOP A;  1K79 A;  3GXO A;  5DD8 A;  3D0S A;  4I01 A;  2VBZ A;  3K1P A;  3MEX A;  3DP7 A;  3N97 A;  2VOD A;  5D5U B;  2F5E A;  3KLN A;  1V3F A;  4XBF A;  3ECH A;  2KRF A;  5L3E A;  3O3K A;  4F7Z A;  1FT9 A;  3KP6 A;  4R1H A;  1OYI A;  2OZU A;  2QBY A;  1RIO H;  4MNU A;  3KFW X;  1FZP B;  2KKO A;  1IXS B;  2EV0 A;  3H3Z A;  4ZYE A;  4IHT A;  1IN5 A;  4OMY A;  1CGP A;  3RI4 A;  2XAF A;  4LJZ F;  4HF1 A;  2YX7 A;  4ZYD A;  4IJA A;  2JSC A;  1OKR A;  4G9Y A;  3MFK A;  2VOO A;  2EWN A;  1IRG A;  1FNN A;  3T8T A;  1QPM A;  3S2W A;  1LDK B;  1EH8 A;  2E1N A;  5JVT A;  2YU3 A;  2OD5 A;  3WTZ A;  3E6D A;  1HQC A;  2H09 A;  3WGG A;  2ZNY A;  1YIO A;  4A12 A;  2QBY B;  3K1N A;  4MQ9 F;  5ERI A;  5K5R A;  3V7C A;  3DF8 A;  3F8B A;  1LJ9 A;  2Z5U A;  3PFI A;  1IN8 A;  4UXN A;  4U0Y A;  2VT3 A;  3FZV A;  4L9T A;  4MTD A;  3V4G A;  4BHB A;  1XDU A;  1KU7 A;  3QOP A;  2XKP A;  2K02 A;  1T39 A;  2EA4 A;  3PQK A;  3KEO A;  5H6Q A;  1DDN A;  3KET A;  2PEX A;  2RQP A;  1QGP A;  5H6R A;  3QP6 A;  5EEG A;  3E6M A;  1SD7 A;  5ED4 A;  1T2K A;  1XSD A;  1STZ A;  4AWX B;  3E5Q A;  2OQR A;  4HV6 A;  5K5O A;  4N0B A;  1J5Y A;  2D1V A;  1TQI A;  2GZW A;  3KP3 A;  3GYH X;  4HX4 A;  5DYM A;  2YSR A;  3ZPL A;  1O7F A;  4EGZ A;  3SZP A;  3CO6 C;  2E7W A;  1R58 A;  2O03 A;  2M8E A;  4HLX A;  4EVI A;  2P6S A;  2XV4 S;  1YW7 A;  3MZY A;  1WQ2 A;  1SD4 A;  2IRF G;  3SXY A;  3EET A;  2AS5 F;  4R8H A;  1Z1D A;  5HS9 A;  4BNC A;  1HKS A;  1QZZ A;  2GIV A;  5LGN A;  1W4M A;  2AXL A;  4AVP A;  5HDK A;  1FP1 D;  3SHF A;  1H9T A;  3RTR A;  1FYK A;  2E7X A;  2R3S A;  2Z3Y A;  3QAH A;  2RGV A;  1LNW A;  2L01 A;  2XRO A;  4HBL A;  2FBK A;  1WRJ A;  4KIF A;  2IP2 A;  2PMU A;  4RB0 A;  2IVM A;  3G73 A;  4L0Z B;  2F5C A;  5E17 F;  3T0Y A;  1LDD A;  2DQL A;  2KIM A;  4JBA A;  4HZF A;  1BBY A;  3H3U A;  4RB2 C;  2HFH A;  3F23 A;  5F6F A;  2HGC A;  3IKT A;  2VXZ A;  4OIP F;  3M8E A;  3ZN0 A;  4CHU A;  3WE3 A;  4IPA A;  4M71 A;  2PFB A;  2BYV E;  1ZG1 A;  4Q47 A;  3RPQ A;  3LA3 A;  2NYX A;  4U7B A;  5ILS A;  4P96 A;  2M5W A;  3FHZ A;  1ZAR A;  5DCF A;  4PZJ A;  3I5U A;  2JZY A;  2GXB A;  3BRO A;  1BJA A;  2KIU A;  2M45 A;  4LK1 F;  4BHP A;  1O3T A;  4LB6 B;  1W7P A;  3GVA A;  2Y75 A;  4HLY A;  4RB3 C;  3WTV C;  4U88 A;  4CDG A;  4PCQ A;  3ULQ B;  1J0R A;  2TDX A;  3BJA A;  2CO5 A;  1XDS A;  3F8F A;  2Q8K A;  1SFU A;  4AIK A;  1O57 A;  2GA2 A; 
#chains in the Genus database with same CATH topology
 4HX7 A;  4V2G A;  3JRE A;  2LG4 A;  3U1K A;  3KEQ A;  4C3H J;  1TW3 A;  2PG4 A;  3HL2 A;  5K5Q A;  1USS A;  2ELJ A;  4XM3 A;  1DGW Y;  2EFO A;  4BGD A;  3J81 K;  1F9N A;  1EKE A;  2QSG X;  2O9L A;  5F64 A;  1FMV A;  1B9M A;  4M9Z A;  3J7Z I;  4LD5 A;  3L09 A;  5BNG A;  3N05 A;  3ZMU A;  5TRD A;  3D5L A;  3J80 Z;  1B9N A;  3JRH A;  1IZ1 A;  2A3S A;  1O3Q A;  5J3L A;  4G94 A;  1HSJ A;  3ZMV A;  2NS8 A;  2E2I J;  1TT0 A;  2VQL A;  2NOG A;  4YEJ A;  1CF7 A;  3EYI A;  1W7P B;  1MKM A;  3TP0 A;  3PUF A;  2HXI A;  3VSK A;  1RUN A;  1DQU A;  2DA4 A;  4U0W A;  4HRI A;  4IOA F;  3FM5 A;  2FRH A;  1ONV A;  2VBX A;  2AQF A;  2HOA A;  4GO1 A;  5F1R A;  1O3S A;  4ZJZ A;  3DKW A;  1ZGJ A;  3Q0W A;  1Z6R A;  2K5C A;  5K1Y A;  1A36 A;  4E4H A;  2YS9 A;  1ZG3 A;  2V9P A;  2E1C A;  4XLF A;  3GX4 X;  1V5F A;  1G3S A;  2DFE A;  3ZN1 A;  1Z6T A;  2O61 A;  3AL0 B;  3I3L A;  4D5F A;  3Q5F A;  5BQT A;  2GXG A;  2K3P A;  3FMQ A;  4GGG A;  4IZZ A;  4O5V A;  4G7H F;  1BI1 A;  1BI2 A;  2P5V A;  1KZH A;  3S32 A;  1YG2 A;  4K2E A;  2Q2E A;  3GTM J;  5FLX Z;  4M9S A;  2QSH X;  1HW2 A;  3B73 A;  2HVQ A;  3G6E I;  4O3M A;  1IRZ A;  1XC5 A;  4HF2 A;  5E18 F;  4P5O A;  4BL0 B;  3DU5 A;  2XAQ A;  2X51 A;  2X1D A;  1FIP A;  1YO5 C;  2COB A;  2Y30 A;  4C2T A;  1NG7 A;  1X1B A;  1ETV A;  4AU7 A;  1PDN C;  2GLO A;  3SZT A;  4B09 A;  3E5X A;  3BOQ A;  4U7D A;  1JT0 A;  1CF7 B;  2OQG A;  2JK3 A;  2Q0O A;  1N77 A;  3A2K A;  1W5T A;  5FB2 A;  3DPU A;  3M8J A;  4L5E A;  3M1E A;  1T38 A;  3CCM I;  3L7W A;  3PIP F;  2OV7 A;  5FKO A;  3SEZ A;  1VQ8 I;  3PQJ A;  2XF7 A;  2JJ7 A;  2ZO4 A;  5EG0 A;  1MNM C;  2JA6 J;  1VQ4 I;  5FJ8 J;  2R7T A;  1I1G A;  4GXO A;  4WXC A;  3H5R A;  2Z16 A;  3ECO A;  1G3W A;  2DDB A;  4AID A;  4GFB A;  1R23 A;  3FKJ A;  5E1Z B;  1ETK A;  2B0L A;  1Y8Q B;  1ULY A;  2GWR A;  3KEY A;  3KIO A;  5LD2 C;  1PUF A;  2P0W A;  5LRR A;  1WJC A;  1RI7 A;  2EJR A;  2BBY A;  1W36 D;  1C0W A;  1QZY A;  5GP9 A;  1OCR H;  2K9N A;  4Q5S F;  2LY2 A;  3QYE A;  4RAZ A;  2LBF A;  2X4H A;  1K4T A;  5IT9 Z;  1ZHF A;  1GT0 C;  2DFH A;  3SDG A;  2V4J C;  3B6C A;  3QPT A;  2F4M B;  2N8G A;  1XCB A;  2B7E A;  3FMS A;  3CCY A;  3ZQ7 A;  1XSV A;  1TNS A;  2ZFU A;  4AC0 A;  2R5Y A;  1PJR A;  5CVU A;  1R1T A;  2DK5 A;  3VSL A;  4H0E A;  2P6T A;  4CXF A;  5L3F A;  4QWQ A;  1BI0 A;  1Y8R B;  2MBF A;  4ZH4 F;  3LQQ A;  3S3O A;  2G0E A;  4BU2 A;  2DDA A;  3RZD J;  1QVU A;  2WV1 A;  2OCE A;  4EJU A;  4RLF A;  5EYR A;  5GAE J;  1WFX A;  2XF6 A;  5LBQ A;  3FIS A;  1IN6 A;  1MBF A;  5KCM A;  4UV9 A;  2NXN B;  1TQM A;  1KQ9 A;  1KU9 A;  5CVJ A;  4OIQ F;  3K4K A;  4IL6 C;  4BYY A;  4A3L J;  3HSR A;  3HZJ A;  4L9N A;  5DUI A;  4XKB A;  1PUF B;  2H1L A;  2MG4 A;  4FX4 A;  4LIV A;  2ME6 A;  1S7E A;  5E8I A;  3UR3 C;  1R4N B;  1W0U A;  1A31 A;  1QHH D;  2LLK A;  3RSN A;  3HRM A;  4YFN F;  2VB6 A;  4M3B A;  4PJM A;  2LBF B;  1JJ6 C;  5HS8 A;  1GUU A;  5AIP A;  2VPL A;  3CCV I;  4WK8 F;  3BPV A;  2QA4 I;  2NVT J;  1YJW I;  4ESB A;  4G6Q A;  4E7J A;  3ERE D;  2M8G X;  3ISP A;  2WAD A;  4EJO A;  2GA1 A;  2BXZ A;  2VC0 A;  2DT6 A;  3OS2 A;  2K40 A;  2YX4 A;  3OS0 A;  1FOY A;  3I4N J;  2DFF A;  4Y13 A;  5E79 C;  1J09 A;  4BQA A;  2VKV A;  1SVM A;  4XLE A;  4BJ6 C;  4KIB A;  3MKY B;  4IVN A;  4EJW A;  2IAI A;  5DTD A;  1Z0X A;  2STT A;  1Y39 A;  3CUQ A;  1TLH B;  2WAQ A;  1UHS A;  2CS3 A;  4OU0 A;  1FMW A;  2QWW A;  3CO7 C;  2OJE D;  3GUD A;  1T0F A;  2J5P A;  3QPL A;  1TWG J;  1ZG5 A;  1ZLK A;  4MGR A;  2X9D A;  2ACJ A;  2RNG A;  3M1C A;  3F8M A;  2P7V B;  4BHC A;  2JPC A;  5E3O A;  1XX5 A;  5IP7 J;  1P4X A;  1X19 A;  2X0L A;  3HSE A;  4YFX F;  5CJ9 A;  3VDX A;  2A68 F;  3AKZ A;  4A6D A;  1DU6 A;  5F08 A;  3BCB A;  3S93 A;  2LKS A;  3QU3 A;  3S3M A;  1P4A A;  1YW8 A;  5L3B A;  1HW1 A;  2BVM A;  3OYD A;  1YX3 A;  1F1Z A;  1VI0 A;  2Z1D A;  3BR1 A;  4RM2 A;  3S1R J;  4J01 A;  4RBO A;  2P7C B;  2WY8 Q;  5F1J A;  4HDU A;  3CJR B;  1S3J A;  1LKX A;  2M2E A;  4IX7 A;  1QHG A;  3BCA A;  1BJZ A;  3R61 A;  4G7Z F;  3AG3 H;  5E3N A;  4A3C J;  1UFM A;  3L2C A;  4FT8 A;  4RDU A;  2I8D A;  1SVL A;  3TO6 A;  4O6J A;  1WJF A;  1Z3Y A;  3OYM A;  3JTG A;  3CUQ B;  3HPG A;  1TP4 A;  2A07 F;  2LKP A;  3WOD F;  4P55 A;  1BC8 C;  3CDH A;  4AIH A;  2K7L A;  2EZK A;  2LP0 A;  5CQE A;  3GTO J;  4UY8 I;  1MBJ A;  2FE3 A;  3WTW C;  4BDY A;  1V5E A;  2MW8 A;  2LRE A;  3J7A Y;  1QPI A;  1DP3 A;  1BIA A;  3IV5 A;  2ZXH A;  3KP7 A;  1N78 A;  3M9A A;  4QPQ A;  4KN4 X;  1XTA A;  4CCL A;  1D5V A;  4E7L A;  1SMY F;  3HGG A;  1B59 A;  3FXU A;  5FFZ A;  4L5I A;  2GAU A;  4LGW A;  5IYD J;  2DFI A;  4CUG A;  1RUO A;  3BTJ A;  4DNC A;  4EAT A;  2XAS A;  1Z3X A;  1OLT A;  5CPR B;  3JRF A;  5FD5 A;  2IXS A;  1NK3 P;  1ACI A;  4PGG A;  4MO7 A;  1R7J A;  2E35 A;  2K3F A;  1GXP A;  3JTH A;  1FOK A;  2PJR B;  4XK4 A;  2R7X A;  5IYB J;  2HZT A;  1YJ9 I;  4L0Y B;  1MJ9 A;  1SD5 A;  1ZTR A;  2LDU A;  2ECB A;  1U3E M;  3DBR B;  4FCY A;  1W7P D;  4HQE A;  4OOI A;  1J7K A;  2M87 A;  4BH9 A;  4UB6 C;  5F0H A;  1G4D A;  4LK0 F;  2I5U A;  3H1C A;  2B63 J;  5A2Q K;  2HPI A;  3H92 A;  2RRE A;  4F93 B;  1BN5 A;  2X6Y A;  1WJB A;  1WJE A;  3FM3 A;  2Z33 A;  3CDL A;  1X58 A;  2ZJP F;  1IV8 A;  1OCC H;  2CUF A;  2R7Q A;  1OYY A;  3G71 I;  5HDG A;  4FQG A;  2ZJQ F;  3K9T A;  3IKV A;  4KN7 X;  3PNT A;  3OL3 A;  3A1Y A;  3D5S C;  5HLH A;  1G59 A;  5FRM A;  3Q0V A;  1P7I A;  2RQQ A;  3ZQG A;  2JVH A;  3HOW J;  2EK5 A;  4LLG F;  1T0F C;  4GYI A;  4F3Q A;  2ID3 A;  2VT2 A;  2LSO A;  3CP8 A;  4M73 A;  1ZAO A;  3UKG A;  2PQ8 A;  1EV7 A;  2QKL B;  2PX9 A;  2UXN A;  4PJ0 C;  4MEX F;  1YLF A;  1SEU A;  3BC8 A;  1WPK A;  1T98 A;  1XD7 A;  4A2U A;  3F0C A;  1SFK A;  1IGN A;  3A0H C;  4XR6 A;  4LLL A;  3ZGK A;  4F52 A;  5E3M A;  5IT3 A;  2Y2Z A;  1UZC A;  2VL8 A;  2VON A;  5TJJ A;  2XB0 X;  3IRQ A;  2R7O A;  2V79 A;  1JUM A;  2JTV A;  2X48 A;  2V1X A;  3S1M J;  2L02 A;  4X1E A;  2MD5 A;  2A61 A;  5KK1 A;  3S15 J;  3HOT A;  5D8L B;  1M1E B;  1TWC J;  3DFG A;  2XKO A;  3H5A A;  3B6A A;  4NC8 A;  2F5D A;  5FLM J;  2WC2 A;  3IH4 A;  5BS6 A;  3U2R A;  3KZY A;  5FKL A;  5D4S A;  4FTH A;  2E5Z A;  2KRH A;  1R22 A;  1V55 H;  3DBL B;  1XMA A;  2L5Q A;  2O0Y A;  3TMO A;  4YFK F;  5FGM A;  2VKD A;  3IAS 2;  4XNF A;  1AKH A;  2BOL A;  2ESN A;  2K85 A;  4ZTJ A;  4QLC U;  5HLT A;  1Z05 A;  2V1U A;  4WCG A;  5HDN A;  2R7S A;  2EV5 A;  3A0B C;  3GZ5 A;  3R0J A;  2KZG A;  1ETQ A;  3KYC B;  3ERM A;  3PSI A;  1TTY A;  3F6O A;  3BTC A;  1LVK A;  1FY7 A;  4XLC A;  1ITY A;  3WU2 C;  1OIS A;  4IRG A;  1JKR C;  3BZ6 A;  1W0T A;  3GFL A;  2DTZ A;  4E7H A;  3KE2 A;  4CCK A;  2VI6 A;  1XSX A;  2L4M A;  3J81 Z;  4ANJ A;  2GIZ A;  3JAM Z;  5GAH J;  2O8K A;  5J8C A;  1BR4 A;  2BEO A;  5CQG A;  2DMN A;  3D5R C;  4LIT A;  5DD4 A;  5J40 A;  5FKM A;  4D9J A;  1X4O A;  4IOC F;  4M3E A;  3AG1 H;  3KP2 A;  1FBQ A;  1IN4 A;  2ZME A;  1VQ6 I;  1X3W B;  3A01 A;  2F5F A;  2XRN A;  1JUS A;  2KFD A;  4N4O B;  5K7H A;  3GLX A;  1HKT A;  3N4M A;  4A3K J;  4AYB A;  2ZSI B;  1MJB A;  2EA2 A;  3HRT A;  3PIO F;  1MMG A;  1YI2 I;  2R7D A;  3RYP A;  3BLY A;  4N9I A;  2FEZ A;  1LE8 A;  4IO9 F;  1ZRC A;  1RKT A;  2L9S A;  1NHA A;  2Z9O A;  1A6Q A;  4IQJ A;  4ZC3 A;  3CTA A;  2FQ3 A;  1I3Q J;  5M3F J;  1IN7 A;  2QYO A;  3GEZ A;  1HC8 A;  1RC9 A;  3HBL A;  4XLH A;  4HAM A;  1WH5 A;  2M0C A;  2OZ6 A;  1UG0 A;  4XSX F;  1MMA A;  1H88 C;  4P1W A;  2XAG A;  4IXA A;  2PI0 A;  4ON0 A;  2DO7 A;  4M6Y A;  4BE2 A;  3GTQ J;  3HDD A;  3HHG A;  3FXL A;  2EIM H;  4KDP A;  2M1B A;  3HB9 A;  2A5Y B;  4RAF A;  3SQN A;  2NNN A;  2ZC2 A;  1AA7 A;  3C2G A;  4ENN A;  5BOX A;  1QNT A;  1BC7 C;  1FBS A;  3FX3 A;  2XPW A;  1DP7 P;  2JA5 J;  2R7Z J;  1BW5 A;  2NVX J;  4J19 A;  5BPD A;  1X3U A;  1N25 A;  2OCC H;  2QQB A;  3FXJ A;  2L4A A;  4ESJ A;  3JR9 A;  3HOU J;  3BZK A;  5JR3 A;  5LHG A;  5HS7 A;  2W57 A;  1Q1H A;  2P81 A;  3MN2 A;  2Z99 A;  2FA5 A;  1PUE E;  3ROU A;  3BG3 A;  2ZCW A;  2ZXI A;  2JRM A;  4G6T B;  3HTU A;  3VYT B;  2CRG A;  2H6B A;  3JRG A;  3MAJ A;  2NVY J;  3E97 A;  3CQZ J;  3I59 A;  4YG2 F;  2D2W A;  3TP3 A;  1ON2 A;  1U5T A;  3RYR A;  4M6X A;  3OOU A;  3WG9 A;  4HV5 A;  2DPU A;  5EZH A;  1K61 A;  4RGX A;  3I71 A;  3I58 A;  1QQI A;  2HEO A;  3QRF F;  3KCC A;  3MKL A;  3TW7 A;  1VQP I;  5LGU A;  4LG0 A;  1YS7 A;  2DYR H;  3V42 A;  2W1O A;  1L3L A;  1LEB A;  3DWL E;  3VWB A;  2K86 A;  3FXM A;  2OA4 A;  2OU2 A;  1EH6 A;  2K27 A;  4X6A J;  2FNP A;  3LSK A;  1E3H A;  5H2F C;  3RQI A;  4WXH A;  2R5Z A;  2HPM A;  2DQR A;  5LRS A;  1QRY A;  2DA1 A;  4A3D J;  4BBR J;  3ZCO A;  3DTE A;  4PFP A;  4XKC A;  3WE2 A;  4C9Y A;  5LHH A;  2DPD A;  3R60 A;  1YX5 A;  4EQQ A;  4GCV A;  1HKQ A;  2MC4 A;  3LA7 A;  1HCR A;  4MQV A;  1ZRE A;  2FXA A;  4JK1 X;  4V2F A;  4B47 A;  3CJN A;  2XGE A;  1D0X A;  1LFB A;  1UJ8 A;  3BR0 A;  1IC8 A;  2IS2 A;  5J4Y A;  3I59 B;  1I3A A;  3DLL F;  2QEX I;  3JSP A;  2CGP A;  1U5T B;  4C30 A;  2Y69 H;  1H8A C;  1PYV A;  2I10 A;  2Q1Z B;  3WGI A;  4NB5 A;  2JSP A;  1I27 A;  4KA4 A;  1VFC A;  2A5W A;  4IKF A;  1P4W A;  3ZQF A;  3FIW A;  5B66 C;  4F55 A;  2W7N A;  3S1Q J;  1K78 A;  4A3F J;  4B1R A;  1YIJ I;  1UCR A;  1GHC A;  4LG0 B;  2VQC A;  5J47 A;  1R9T J;  1HBX G;  2NAZ A;  3F72 A;  5L3G A;  4E7K A;  2YUS A;  4GYG A;  2LR8 A;  3T1B A;  1R1U A;  2WY7 Q;  2LVS A;  2WAF A;  4UUS B;  1UAA A;  1YRN A;  1XGS A;  1W5C C;  2R5Z B;  1IUY A;  2HDW A;  2XSJ C;  2ZJ2 A;  3EQL F;  4HX8 A;  3SFZ A;  1I6X A;  3GW2 A;  2M4K A;  5DEQ A;  1SAX A;  1Z7U A;  3S3N A;  4HA8 A;  1O3R A;  3DKX A;  3GTK J;  2P5K A;  1KA8 A;  3KP5 A;  5LEK A;  2ETH A;  4NQW A;  5KVR A;  3QPS A;  1JE8 A;  1XN7 A;  4E70 A;  3TO9 A;  2COM A;  3H0G J;  5K7F A;  2QGU A;  5EF6 A;  2W85 A;  4BXX J;  1Y56 A;  2PBI A;  4G6D A;  4H4K C;  4HEA 2;  5B1B H;  6PAX A;  2VIX A;  4RLQ A;  5L3D A;  4HQM A;  3TKY A;  3GWZ A;  3E5U A;  2LY1 A;  3ZP5 A;  1IXR C;  2RKH A;  4C3J J;  2DMP A;  1EH7 A;  4V19 K;  3IH3 A;  1FC3 A;  4XIC A;  5HVQ C;  2BZT A;  2VC1 A;  4ZZD A;  1IF1 A;  1IUF A;  1RPW A;  4NBQ A;  4F91 B;  2FBH A;  2TRT A;  4Z2Y A;  2F2E A;  4ETS A;  3CCL I;  3IH2 A;  1LFU P;  3NQO A;  2XHK A;  4CZC A;  3OR1 C;  2IGK A;  1K78 B;  2Y0M A;  2A6H F;  1ZN2 A;  4A5N A;  1T56 A;  3BY6 A;  1FYM A;  4DQ2 A;  2VE8 A;  3LAJ A;  2ISY A;  2IS6 A;  4EJT A;  3IWZ A;  3MVP A;  3CZ6 A;  1P92 A;  3I54 A;  4IHX A;  2Y31 A;  1U5T C;  1R71 A;  2STW A;  2XDV A;  3IC7 A;  1YRN B;  1VF9 A;  3CUO A;  4NHJ A;  2LRD A;  2NVU B;  3L2Q A;  2ICW G;  1ZRF A;  2OAZ A;  1VQL I;  1I5Z A;  4N4N B;  1U0J A;  2UXX A;  2PMH A;  3R0A A;  1XS9 A;  5ICG A;  2DT5 A;  4MIM A;  1Y1V J;  1VTN C;  5DM6 F;  4E7Z A;  3SYT A;  5FKN A;  4CIC A;  1Z91 A;  3TQN A;  2IA0 A;  1OYW A;  3EUH A;  5D6E A;  4A6E A;  1JHF A;  1SVO A;  1ZR4 A;  5FKK A;  4FX0 A;  1T33 A;  1OJL A;  2LF7 A;  4IRI A;  2CW8 A;  2DOA A;  4I09 A;  3ZRG A;  4RGS A;  3FMR A;  4G7O F;  1MH4 A;  2L9R A;  4BEH A;  3HPH A;  4DBQ A;  2IGN A;  2O5R A;  1GV2 A;  3I0T A;  3FK6 A;  5M3M J;  3L00 A;  4QTR A;  2V26 A;  1P6R A;  3MQ0 A;  4RGR A;  2Q2E B;  5EEH A;  3LST A;  4M3F A;  4DIQ A;  3ZMD A;  5JHF A;  2CWE A;  3EUK L;  3ML6 A;  2L3D A;  4RM3 A;  4AUX A;  2RV8 A;  1FWZ A;  3X2Q H;  1G6N A;  4MLO A;  3OIQ A;  4RS8 A;  4BE1 A;  2H1K A;  5B3S H;  5BMZ A;  4S04 A;  3AL0 C;  2HI3 A;  3VB2 A;  4I6Z A;  1F5T A;  1D3Y A;  2G7H A;  4GDF A;  5M5Y J;  1DPR A;  4CCJ A;  1J75 A;  5ILV A;  3MZH A;  1ODD A;  1JHH A;  4UVC A;  3HRS A;  4KNY A;  2GBY A;  5DS9 A;  1I1S A;  3JSO A;  4XLA A;  2E36 A;  1TC3 C;  3MD2 A;  4A3G J;  3E1S A;  1FTZ A;  2WA0 A;  4KIT B;  3L2U A;  3FK7 A;  4UVA A;  1OFC X;  3CCQ I;  2O3F A;  2FX0 A;  4BY1 J;  1D1C A;  3K6G A;  4OIO F;  1OPC A;  4QIW N;  3JRB A;  1OQY A;  5CKT A;  5DV5 A;  1G3T A;  1G8X A;  1MD0 A;  3VYU B;  2AXT C;  5EG0 B;  1RES A;  3BR3 A;  4YIF A;  4EM0 B;  2IPQ X;  3DEE A;  3P9C A;  1LUJ B;  1VQM I;  5AIQ A;  3RCO A;  5EGO A;  2P5L C;  4PGH A;  3C2H A;  4Y4R A;  4XQF A;  4ASN A;  4OIR F;  4U87 A;  2FF4 A;  4R79 A;  3WTY C;  5F04 A;  3VOD A;  2E71 A;  3EYY A;  1LFP A;  3O8G A;  4A3B J;  3ZOB A;  3VYS B;  1ZYR F;  2MYS A;  1IRF A;  4KIS A;  2EZI A;  3V7R A;  3CLO A;  4CYD A;  3KZZ A;  4XOP A;  2XAJ A;  4KUM A;  2QZ8 A;  2MH9 A;  1WWX A;  3Q3S A;  4HNT A;  2CUZ A;  2W84 A;  4I2O A;  3J7Y J;  1K7A A;  4B48 A;  1V54 H;  1KYW A;  1VQO I;  3CCS I;  2DOD A;  2R5Y B;  2LD5 A;  4YEL A;  2MAB A;  1VQ7 I;  3OYL A;  2V1D A;  1E0E A;  3HUG A;  1UMQ A;  3DV8 A;  1Y0N A;  4DJA A;  2W00 A;  3DTI A;  3L9F A;  1D8K A;  2X1E A;  1WH7 A;  3J80 K;  1HF0 A;  1YTY A;  5J6X A;  3LSJ A;  2DI3 A;  1FIA A;  3I64 A;  2XVC A;  1T08 B;  4L18 B;  2R7U A;  3S14 J;  1IW7 F;  1NK2 P;  1A04 A;  3HG9 A;  4MTE A;  4EEF G;  3PSF A;  2M3A A;  2HYG D;  1EJ9 A;  1ORK A;  3OY9 A;  3ZMS A;  4EV0 A;  2EV6 A;  1ZGA A;  2AQE A;  5EGO B;  1RR8 C;  2DTR A;  1NG6 A;  4LG3 A;  2WB1 N;  3G3Z A;  3QP5 A;  4RA2 A;  5E1X A;  1SFE A;  2ZSH B;  2EBI A;  4B3X A;  4CYC A;  1JXS A;  5CVV A;  2Y48 A;  2D45 A;  3EUH C;  3IHU A;  3U9G A;  2DT7 B;  4OWR B;  3GBG A;  4A3I J;  5K7Z A;  2O6G E;  3P7N A;  4KMU X;  2VQH A;  4CO8 A;  4FIS A;  3PNV A;  3JW4 A;  3E6B A;  1ETX A;  3GTP J;  1JI8 A;  1R49 A;  5FLX K;  3QU6 A;  2FOW A;  1YYV A;  1PVE A;  2CQN A;  3K2A A;  2CV1 A;  3K7A J;  2IBD A;  1MSF C;  2KIF A;  3OIO A;  2KL4 A;  1YIT I;  1EF4 A;  1R4M B;  3OMY A;  1R36 A;  2ISZ A;  3S2H J;  1SD6 A;  2JRT A;  2ZB9 A;  2DW4 A;  1QA6 A;  3OL4 A;  3EPZ A;  5FFX A;  5IP9 J;  2XIG A;  2Z2S B;  3R4K A;  1A35 A;  3GTL J;  3CMM A;  3ONQ A;  4BQN A;  5GAG J;  5J1R A;  4E7S A;  1DUX C;  3BTL A;  2HTJ A;  1HXD A;  1E3P A;  1OCO H;  1P9Q C;  2DJI A;  3G4S I;  3HRU A;  4YII A;  3V8J A;  3WTX C;  4XLN F;  5M5X J;  3DKY A;  4XON A;  3FBI B;  1DPU A;  4NDL A;  1MZB A;  2PJP A;  4W1U A;  2XC7 A;  3P9I A;  3TOB A;  4JX4 A;  3CD6 I;  2CMP A;  4HOB A;  5LHI A;  1T95 A;  2OTL I;  1ETY A;  1YQA A;  4XN0 A;  4EJV A;  1JKQ C;  1POG A;  1E17 A;  3O8H A;  1Z9C A;  3TW6 A;  1BL0 A;  3W2W A;  2D1H A;  1D0Y A;  1X2N A;  1ZRD A;  2CYY A;  2KJB A;  1K6O A;  2E60 A;  4IHS A;  3BG6 A;  4A93 J;  3HJE A;  4CZZ A;  1GV5 A;  5IT9 K;  1H0M A;  1LEA A;  1MIJ A;  2XGX A;  5LGT A;  2R93 J;  4XKV A;  3IUO A;  3K0L A;  1S7A A;  2CQ7 A;  3M7G A;  3OS1 A;  3L2R A;  1U8R A;  5IPA A;  2HZD A;  1R00 A;  4WX9 A;  4TV7 A;  3GFM A;  2EH3 A;  3JCU C;  4GRI A;  2LC2 A;  2VJI A;  3DEW A;  3FWE A;  5E8G A;  3OYG A;  5LFA A;  1ZEL A;  3B02 A;  2HOS A;  2VJ4 A;  1B4A A;  4BDZ A;  1S8N A;  3O2P E;  4FE4 A;  1XMK A;  3H9G A;  1O4X A;  3TBI A;  4II3 A;  1FYL A;  2BXY A;  4Y15 A;  4I98 B;  2ZXJ A;  2HQN A;  4PDK A;  1IO2 A;  3NEU A;  1BI3 A;  2KLO A;  5B5E C;  4P9U A;  5JI6 A;  3CUQ C;  5FD6 A;  2B9S A;  3PNY A;  2FOK A;  4G8X A;  4RGU A;  1WJD A;  1FSE A;  3GLL A;  4L9V A;  2Y9Y A;  2A69 F;  3DPL C;  4UHT A;  5CYV A;  1K4S A;  1YJN I;  4Q48 A;  1GLN A;  1U6G A;  1SMT A;  2NS7 A;  4Y52 J;  5FO5 A;  2RAE A;  3V8K A;  5BPI A;  5C4X J;  3WHB A;  3CC7 I;  1SC7 A;  5EJC A;  1HA8 A;  3E6C C;  5TGT A;  4WWC A;  1UB9 A;  2L7M P;  4XOT A;  4ZDO A;  4AD9 A;  2XGC A;  2KIS A;  1TW2 A;  3NWT A;  5D8K B;  1DU0 A;  5DDG A;  1JJ8 C;  1S29 A;  2E2H J;  4CCO A;  2FNA A;  3QYB A;  2LFB A;  2A6T A;  3DBH B;  3FHN A;  2LOO A;  3LQR A;  5DUK A;  2WTE A;  5JFR A;  2ZKZ A;  4M74 A;  1Q1V A;  2CW0 F;  4A0Y A;  4DYC A;  4L9J A;  2IEK A;  2WAE A;  1K6Y A;  3M8F A;  3CJT B;  5ICE A;  1LQ1 A;  3K70 C;  3Q0U A;  5IY5 H;  2O7O A;  1REP C;  2JT1 A;  2VE9 A;  1QO0 D;  1UG2 A;  2FSW A;  4XL9 A;  3CDI A;  3T5X A;  2HQR A;  3V8L A;  2CUJ A;  4A0X A;  4M9X A;  1YE9 A;  1UST A;  3FXK A;  3FXQ A;  3RZO J;  2E19 A;  1LB2 A;  1KGS A;  2RNJ A;  4CSW A;  1MGT A;  2PMZ N;  1IG7 A;  1S9H A;  5D5V B;  3LAP A;  2KDO A;  4C2U A;  1IXC A;  3LNQ A;  2DU9 A;  2L54 A;  4HG2 A;  2HR3 A;  3F22 A;  2P4W A;  3PJR A;  4F92 B;  3WGH A;  2LYC A;  2DN0 A;  1FX7 A;  5LEJ A;  2ZNZ A;  2CG4 A;  4KFC A;  1XPX A;  2LNB A;  2VUM J;  4DYR A;  4ZYG A;  3KLO A;  1OR7 A;  4ESF A;  3FDY A;  2LH9 A;  2V9V A;  3RDI A;  2VPR A;  3CC4 I;  2MLG A;  1TZL A;  1Z7L A;  2CQX A;  2FU4 A;  3DXJ F;  5EZG A;  4FE7 A;  2ZFW A;  2M30 A;  2VJJ A;  2P8T A;  4LMY A;  4CCN A;  2XGD A;  3U1D A;  1RNL A;  2ECC A;  3O6B B;  4A0Z A;  5E20 A;  1JGS A;  2DA5 A;  4ITV A;  1X3Z B;  5HOO A;  5J8F A;  3IL2 A;  3VOE A;  1HLV A;  3RIR A;  2V6C A;  1XCV A;  5IP6 A;  1P7J A;  1MDM A;  2DYS H;  4C3I J;  1AKH B;  3ZQH A;  1HDD C;  2EB7 A;  4II2 A;  4HW0 A;  2DJN A;  3I9V 2;  3M07 A;  5E3L A;  4XID A;  1MJA A;  1UHM A;  4AM3 A;  4HF0 A;  2NNY A;  3K2Z A;  1WJ5 A;  1YHQ I;  4CH7 A;  1UEL B;  3AG2 H;  4EGY A;  2VXD A;  3ZQL A;  1VQK I;  3CES A;  4Z6Y A;  1A5J A;  3C18 A;  2EFP A;  3W6J B;  2EIK H;  1JKO C;  1D1A A;  2EIL H;  3BR6 A;  1RET A;  2VKH A;  4BQO A;  2R92 J;  2JUC A;  2X85 A;  1MW7 A;  2KDZ A;  2R7V A;  2KQR A;  1T6S A;  5D4R A;  3HTS B;  4ENM A;  2F4I A;  1X1P A;  2EFN A;  2FUG 2;  2M0M A;  3RPU A;  2ZME B;  1XG1 A;  1B1B A;  4FAS D;  4LLN A;  2K4J A;  5HLG A;  3VYR B;  3A01 B;  3AAF A;  3OV8 A;  2CV0 A;  3AFH A;  1BOB A;  2X6W A;  2NRA C;  2QCO A;  1YW9 A;  3HC7 A;  5F27 A;  1FLI A;  4A69 C;  4UV8 A;  2XAH A;  2K9L A;  3ABL H;  2PN6 A;  4ABZ A;  3KP4 A;  5ILU A;  1D5Y A;  4RMN A;  2UZK A;  2KP6 A;  1LE8 B;  4CGZ A;  3K4N A;  3TDZ C;  1MDM B;  2DK8 A;  1TQP A;  2HYF A;  2HVS A;  3WU1 B;  3PM1 A;  5B1A H;  2Y0S N;  3OYI A;  2M4G A;  1ERD A;  5L3C A;  2JVG A;  4KIC A;  1D8J A;  2DBB A;  4AIJ A;  3MCZ A;  1R5H A;  1U9O A;  3NRV A;  3TGN A;  5EDN A;  3OWT A;  3MZ8 A;  3K1M A;  4PJL A;  4BS9 A;  4IQ4 A;  3K4M A;  4S05 A;  3PFY A;  2KJC A;  5HNF A;  4IRH A;  1TNT A;  2QEN A;  3GZ6 A;  3Q9V A;  3OIP A;  2ESH A;  1BM9 A;  1W5S A;  3DPT A;  2LY9 A;  4BXU A;  5IOZ A;  4B43 A;  3WTU C;  3U21 A;  2Y9Z A;  2XUB A;  2XPU A;  1U2W A;  4UUV A;  3FF5 A;  1XGM A;  4ZDL A;  3E0J B;  5KHD A;  1IAW A;  1WJA A;  4WF2 A;  2R7W A;  4KT5 C;  3NWS A;  4OIN F;  1JGG A;  1WZ2 A;  3MWM A;  2CQK A;  3I56 I;  2E2J J;  1MH3 A;  1MMS A;  2WBM A;  2X1C A;  2W24 A;  3FXR A;  1HOM A;  2FBI A;  3Q9S A;  3OOP A;  1ZLJ A;  1OR7 C;  3ABU A;  4HDV A;  2TCT A;  2BV6 A;  2DLL A;  2VAS A;  4FHT A;  4XOR A;  2QQ9 A;  3LSI A;  3TOA A;  2OBP A;  1LDJ A;  2VJ5 A;  3BR5 A;  1J9I A;  3CLQ A;  2ZME C;  4N9H A;  3LFU A;  3BJ6 A;  4IHW A;  3BR2 A;  5HLI A;  2JN6 A;  3IRR A;  2YR2 A;  2KMU A;  3LWF A;  4IF4 A;  2K9M A;  5J4V A;  2VBY A;  1B72 A;  2R7F A;  3ZXS A;  1WSU A;  1J59 A;  4AVZ A;  3KZI C;  2HOE A;  4DBR A;  3ASN H;  2V6E A;  3VEP A;  1OMI A;  4MEY F;  2JWT A;  3ABM H;  1MSE C;  2EZL A;  3K70 D;  1RR7 A;  3A03 A;  3E3V A;  3HKZ A;  1FOW A;  1B8I A;  3M4O J;  2VLA A;  1MMD A;  3RQ4 A;  1KON A;  3T8R A;  4DGW B;  1WKM A;  2UWM A;  1KQ8 A;  4BJ5 C;  2JPB A;  2X6X A;  3WU0 A;  2FQ4 A;  2JA8 J;  3BJO A;  3LA2 A;  4XN3 A;  1R5I D;  3BG7 A;  4MHG A;  3JAM K;  1AU7 A;  5CLS A;  4ZYH A;  2DA7 A;  3LFK A;  1DGR M;  5KAI C;  5GTI C;  2MC3 A;  1HST A;  3F21 A;  5D5W B;  4QPO A;  4I0B A;  5DCM A;  3R6S A;  3TO7 A;  2RC4 A;  5CVI A;  4PK4 A;  2KZV A;  2VQG A;  2JMW A;  3G1M A;  2QKM B;  2JQ7 A;  2DMU A;  2RN7 A;  2QM3 A;  2W82 A;  4UVB A;  3COA C;  3CF5 F;  1TWA J;  2H8R A;  3EDP A;  4KYW A;  3JRA A;  1SFX A;  2L0K A;  4LOC A;  3P5J A;  3K4C A;  3F6V A;  5KNL A;  2ZBK A;  1H9G A;  4WXD A;  3UNG C;  5LLQ A;  5FLV A;  1B72 B;  4I76 A;  3J7A O;  1R5G A;  4A3M J;  3RKX A;  2XB5 A;  3I4P A;  4B3A A;  4KMF A;  1B6A A;  2DCE A;  2BY3 A;  3GTJ J;  5AON A;  3KYD B;  3ZMZ A;  1P2F A;  3BTI A;  2C6Y A;  3RKW A;  3CJQ B;  3GF2 A;  3HKZ N;  1J2X A;  3HSF A;  1B8I B;  2VN2 A;  4MFD A;  3C7J A;  4HYE A;  1XGO A;  1MBH A;  4BAC A;  2DMT A;  3P9K A;  3F3X A;  4B8X A;  2GM4 A;  4NQW B;  2HDC A;  2IA1 A;  1E2X A;  1RKW A;  3IWF A;  1JTY A;  4XMY A;  4ENK A;  2CSO A;  3S17 J;  4XKW A;  3GTG J;  3HYI A;  2IT0 A;  5ICF A;  2MSY A;  2NVQ J;  5H20 A;  3QWL A;  5HOD A;  1OCT C;  3GO5 A;  3LSM A;  3DEU A;  2DAO A;  2XRL A;  5DCM B;  2LMD A;  1L0O C;  5ICC A;  1BR2 A;  1HW5 A;  3BWG A;  4HNU A;  2ZJR F;  3REO A;  1KYZ A;  1PP7 U;  2E1M B;  3ZMT A;  3WTT C;  2NOJ B;  4ZDP A;  1F4K A;  3V7S A;  5E1W A;  4NC7 A;  4OMZ A;  4PFO A;  2QVO A;  4I02 A;  1MBG A;  4BUP A;  2NS0 A;  2LF8 A;  3DQV C;  3JRD A;  2WWY A;  4QSH A;  1T8I A;  4XLP F;  1U78 A;  4I7H A;  3BP8 A;  3H36 A;  3OYF A;  1FP2 A;  4ZZL A;  4A3E J;  3GFI A;  1FPQ A;  3QPH A;  4EM2 A;  4E7I A;  2QLZ A;  2ME0 A;  5D5X B;  3C1D A;  1R1V A;  2HTS A;  3CMA I;  3TDU C;  2H94 A;  5J1Y A;  3FBN B;  1G3Y A;  3I53 A;  2W48 A;  4NUB A;  3IAM 2;  4A5M A;  3OYH A;  1SFO J;  2UV1 A;  4RAG A;  4M72 A;  2IS1 A;  4J00 A;  1FSH A;  3HHH A;  1IDZ A;  2R0Q C;  2OF7 A;  3GME A;  5IYC J;  3VPR A;  1BW6 A;  2HKX A;  2MLK A;  1Y0U A;  2HOT A;  4DW6 A;  1FJL A;  2GOX B;  2MFZ A;  4JYK A;  3G1O A;  3F8C A;  1O7L A;  1ON1 A;  1MNE A;  2A6E F;  3TED A;  5JLW A;  5KAF C;  3C3W A;  1IDY A;  1Z21 A;  5A2Q Z;  1JT6 A;  2IJL A;  2ADU A;  2H6C A;  4P9F A;  3IP4 B;  1JUP A;  5CVR A;  4BAY A;  3OSG A;  4BEH B;  2J5O A;  2WB1 A;  2LTP A;  1WVR A;  2ELH A;  2QUF A;  3PL8 A;  4KT6 A;  3ABT A;  1ZKG A;  1KU2 A;  5FRO A;  1BOA A;  3CF2 A;  2EFW A;  2BHZ A;  2O8X A;  3H3V K;  1V4R A;  1I50 J;  3RKY A;  4LFU A;  4MFE A;  1FOX A;  3F8N A;  2HS5 A;  2LKX A;  1KU3 A;  2VBW A;  3WTS C;  2PLY A;  4BBS J;  3ELK A;  3RJP A;  2MGQ A;  2HXO A;  2M34 A;  3BQZ A;  1SAU A;  1X4P A;  2BGC A;  2E1M C;  3BDD A;  1EA3 A;  3GCM A;  4I0A A;  4L5J A;  5C3E J;  1G2H A;  3C2B A;  2CUE A;  3W6K B;  1Y1W J;  1V5G A;  2ID6 A;  1D0Z A;  1YS6 A;  1S7O A;  1ZH5 A;  2M7A A;  4Y3O A;  4PSX A;  1IV6 A;  4A3J J;  1UHW A;  4U0V A;  2VKE A;  4E6K G;  2IGO A;  3SDB A;  1TBX A;  2FML A;  4S0H B;  2G9W A;  4JQF A;  1LVA A;  4RAY A;  2HKO A;  2QQA A;  4KIG A;  3HIF A;  5JHU A;  5HNH A;  4EMS A;  1QBJ A;  3BPX A;  4RB1 A;  5F0F A;  1PP8 F;  1FBU A;  2DOF A;  1Z67 A;  3W3C A;  3W2V A;  1ETW A;  2KPM A;  2H27 A;  4HST A;  1ZGW A;  2W25 A;  1BIB A;  1IJW C;  4UNO A;  3HM5 A;  1WGX A;  1A6I A;  2XSD C;  2HWV A;  2A05 A;  3OYN A;  1TT5 B;  5GPC A;  1KQ0 A;  3S8P A;  3BT9 A;  3OYB A;  4NC6 A;  4XRS G;  1S5L C;  2QSF X;  3EUA A;  4BE0 A;  1YFH A;  2F48 A;  3LSR A;  2BY0 A;  4NNJ A;  1AOY A;  1WHU A;  4XRF A;  3PO2 J;  1HDP A;  4IHV A;  1JTX A;  2BE5 F;  4IEJ A;  2WV0 A;  3VFZ A;  4YIR X;  2IW5 A;  1RZ4 A;  3QYF A;  2MA3 A;  3CCJ I;  4B4C A;  1Y6I A;  4BKX A;  1FEX A;  5D6F A;  1S6L A;  5C4J J;  3CCR I;  2M7B A;  3H0D A;  4CCM A;  2CFX A;  2DOE A;  3HUG B;  4XSZ F;  4YRV A;  4ENJ A;  1AWC A;  4BQQ A;  3HOS A;  2RVC A;  1GVD A;  2MH2 A;  2OTJ I;  4ZTF A;  2EFQ A;  2GQQ A;  1H89 C;  2YPR A;  3RPU D;  3W2A A;  4Q4Z F;  4D0P A;  2BW3 A;  4Y17 A;  3HOZ J;  4EM1 A;  1XGN A;  2G7U A;  5JLX A;  4LB5 A;  3LMM A;  1GVJ A;  2IA2 A;  3BQY A;  3ZQQ A;  1WI9 A;  2RDP A;  1GXQ A;  1X2M A;  2PJR A;  2E34 A;  2EQR A;  1XB4 A;  2OUM A;  1BR1 A;  2FMY A;  3GFJ A;  3K69 A;  2K4B A;  2VOP A;  1W1W E;  2MD0 A;  1K79 A;  2WAQ N;  4D7N A;  4CYC B;  2DXI A;  3GXO A;  1APL C;  3DCF A;  5DD8 A;  3K10 A;  3D0S A;  4I01 A;  2KRC A;  3KYL A;  2CQQ A;  2VBZ A;  3K1P A;  3MEX A;  1ZR2 A;  1TWF J;  2CW7 A;  3DP7 A;  3N97 A;  2L7Z A;  4X0G A;  2VOD A;  2CH0 A;  5D5U B;  2F5E A;  3KLN A;  1XMX A;  3LOC A;  1V3F A;  4XBF A;  3CCU I;  3ECH A;  2KRF A;  3OR2 C;  5L3E A;  3DLA A;  3QQA A;  3O3K A;  2E5N A;  1RRJ A;  1SAN A;  4F7Z A;  4G12 A;  3OYE A;  1FT9 A;  3S1N J;  2OPT A;  5M5W J;  3KP6 A;  3ZQC A;  4R1H A;  4BXF A;  1MBE A;  1R6R A;  3HEF A;  1OYI A;  1GDT A;  3SZG A;  4DYQ A;  1ENH A;  1ZQ3 P;  2BW3 B;  2OZU A;  2QBY A;  1RIO H;  4MNU A;  2K9Q A;  3KFW X;  1FZP B;  2KKO A;  3MKZ A;  4BJT A;  1IXS B;  3BG5 A;  4C2M J;  1MND A;  2EV0 A;  3H3Z A;  3MMY B;  2FJ1 A;  4ZYE A;  4IHT A;  1IN5 A;  3WG7 H;  1CGP A;  4OMY A;  3RI4 A;  2BY1 A;  4Y7N J;  2XAF A;  4LJZ F;  1NH3 A;  3BZC A;  3KX2 A;  4HF1 A;  3L1P A;  4DZJ A;  2YX7 A;  5J1U A;  4ZYD A;  4IJA A;  2JSC A;  1OKR A;  2JUG A;  1Z77 A;  2PMZ A;  4G9Y A;  3CME I;  3MFK A;  2VOO A;  2EWN A;  1IRG A;  2V1N A;  1D1B A;  1FNN A;  3T8T A;  1F36 A;  1ZK8 A;  1QU3 A;  3A02 A;  1QPM A;  3S2W A;  4XRS A;  1VQ5 I;  1LDK B;  5F0C A;  1EH8 A;  2L7F P;  3ASO H;  2E1N A;  5JVT A;  2YU3 A;  3OYA A;  2OD5 A;  2CJJ A;  1K83 J;  3WTZ A;  3E6D A;  1HQC A;  2DMQ A;  2H09 A;  4PJJ A;  3FXO A;  3CP2 A;  3WGG A;  1NTC A;  2F5V A;  2ZNY A;  4UB8 C;  3HXL A;  1X1A A;  3I55 I;  4D7M A;  4HNV A;  1YIO A;  3K4L A;  4A12 A;  2QBY B;  3K1N A;  4MQ9 F;  5ERI A;  5K5R A;  3V7C A;  4PJN A;  1X1D A;  1X1C A;  3DF8 A;  3F8B A;  1LJ9 A;  4PUS A;  2Z5U A;  3PFI A;  2L9V A;  4JOM A;  1IN8 A;  2ZXW H;  2CFO A;  4UXN A;  4U0Y A;  2VT3 A;  3FZV A;  4L9T A;  4MTD A;  3V4G A;  4BHB A;  1XDU A;  1KU7 A;  3QOP A;  2XKP A;  2K02 A;  4PSW A;  2GXA A;  2K9S A;  1OCP A;  1T39 A;  2OC6 A;  4HPQ A;  1QVT A;  2EA4 A;  3OYK A;  3PQK A;  3KEO A;  5H6Q A;  1DDN A;  3KET A;  2PEX A;  2RQP A;  1QGP A;  1U9N A;  5H6R A;  3QP6 A;  3GZN B;  5EEG A;  2EIN H;  3E6M A;  4HSR A;  4JX5 A;  1SD7 A;  5ED4 A;  1T2K A;  1XSD A;  3L2W A;  1STZ A;  2H8W A;  4AWX B;  1N75 A;  3HOY J;  3E5Q A;  1VZ0 A;  1U8B A;  2OQR A;  2HQA A;  5GAD J;  5C44 J;  4HV6 A;  3JRC A;  5K5O A;  3FKI J;  5DM7 F;  2L7K A;  1J5Y A;  4N0B A;  2ELK A;  1TL8 A;  2D1V A;  4W97 A;  3SFI A;  3LSH A;  2XAU A;  2KHM A;  3KPH A;  1TQI A;  3NAR A;  3QOE A;  2GZW A;  2XPV A;  3KP3 A;  4HX4 A;  3LSG A;  2HQ5 A;  2M9H A;  3GYH X;  2HNH A;  3NAU A;  5DYM A;  1LPQ A;  2LK2 A;  3K4J A;  2YSR A;  1E3O C;  3ZPL A;  2F6C A;  1ETO A;  1O7F A;  4ZYA A;  2L9N A;  5FRN A;  4M3D A;  1MBK A;  4JP0 A;  3L2V A;  4EGZ A;  3SZP A;  1YOV B;  3CO6 C;  2E7W A;  3AG4 H;  4KJZ A;  3D1N I;  3TL4 X;  1R58 A;  2O03 A;  3K4B A;  1VQ9 I;  1JKP C;  2FD5 A;  2M8E A;  2F4O B;  4HLX A;  4EVI A;  2P6S A;  4CA0 A;  2KT0 A;  2XV4 S;  4UUT A;  1YW7 A;  3MZY A;  2E1O A;  1WQ2 A;  2DA6 A;  1SD4 A;  2IRF G;  2DA3 A;  3SXY A;  3PUB A;  3HOV J;  3EET A;  2JA2 A;  3HOX J;  2AS5 F;  4R8H A;  2Y0S A;  3M3Y J;  2CU7 A;  1Z1D A;  1TWH J;  5HS9 A;  5TIS C;  4Y33 A;  4BNC A;  4DOZ A;  2AHQ A;  4DZP A;  1HKS A;  2YU9 J;  2V9K A;  1QZZ A;  2HYJ A;  3DTK A;  3HGY A;  4B44 A;  3S16 J;  4I99 C;  3CCE I;  3MKW B;  3ZR8 X;  2GIV A;  5LGN A;  1W4M A;  3CC2 I;  2AXL A;  3OYC A;  4AVP A;  5HDK A;  1FP1 D;  3SHF A;  3BG9 A;  2AO9 A;  3ESW B;  1WCM J;  2BHY A;  1H9T A;  3RTR A;  1FYK A;  2E7X A;  2R3S A;  3H5N A;  5GTH C;  1VQN I;  2QF7 A;  2Z3Y A;  3QAH A;  2RGV A;  1LNW A;  2L01 A;  2XRO A;  5JVG F;  3SJM A;  1VND A;  4HBL A;  2FBK A;  1WRJ A;  4KIF A;  2GOM A;  3H35 A;  4OAY A;  1W36 C;  3LSP A;  2R4G A;  2IP2 A;  2PMU A;  4RB0 A;  2IVM A;  3G73 A;  9ANT A;  4L0Z B;  3LL7 A;  4JX6 A;  2F5C A;  2W4S A;  1AHD P;  3W6V A;  4D5C A;  5E17 F;  3T0Y A;  1LDD A;  2IGM A;  2DQL A;  4M6V A;  2HVR A;  3S2D J;  2KIM A;  1BA5 A;  3F9K A;  4JBA A;  4HZF A;  4AYB N;  2V7F A;  4BY7 J;  2X6O A;  1BBY A;  3H3U A;  3WHC A;  2HFH A;  3ZQI A;  4RB2 C;  5F6F A;  3F23 A;  3OYJ A;  2HGC A;  3IKT A;  2VXZ A;  4OIP F;  2CV2 A;  2HDD A;  1S72 I;  3ABK H;  3DU6 A;  3M8E A;  3PO3 J;  3ZN0 A;  4CHU A;  3WE3 A;  3H9J A;  1WI3 A;  2L2O A;  2UUZ A;  3JRI A;  4IPA A;  4LIU A;  1FTT A;  4M71 A;  2PFB A;  5GPA A;  3H9Q A;  2BYV E;  3SEQ A;  1QZE A;  4UUS A;  1ZG1 A;  3G2B A;  4Q47 A;  3I4M J;  4OAZ A;  3RPQ A;  1I6H J;  3LA3 A;  2NYX A;  4U7B A;  2DA2 A;  5ILS A;  4P96 A;  2M5W A;  2QQ8 A;  4D1Q A;  3FHZ A;  5IOY A;  1ZAR A;  5DCF A;  4PZJ A;  3I5U A;  2JZY A;  2GXB A;  3BRO A;  1BJA A;  2KIU A;  2M45 A;  4LK1 F;  2JA7 J;  1F43 A;  4BHP A;  4XRM A;  1O3T A;  4LB6 B;  1W7P A;  4IHY A;  3OSF A;  2BVL A;  2HU9 A;  3E7L A;  1I39 A;  3GVA A;  1CQT A;  3CMY A;  1MMN A;  2Y75 A;  4M3G A;  4RB3 C;  2EPF A;  4HLY A;  2XF5 A;  3WTV C;  4U88 A;  2D5V A;  5EEA A;  4CDG A;  3QOD A;  4PCQ A;  3ULQ B;  1J0R A;  2TDX A;  2EZH A;  3A4C A;  3BJA A;  2CO5 A;  4FET A;  1XDS A;  2BY2 A;  2KIQ A;  3F8F A;  2Q8K A;  1SFU A;  3RKQ A;  2IS4 A;  3G1L A;  2EIJ H;  4AIK A;  1O57 A;  2GA2 A;  2R7R A;  1IRX A;  1OCZ H; 
#chains in the Genus database with same CATH homology
 4HX7 A;  3KEQ A;  1TW3 A;  2PG4 A;  5K5Q A;  1USS A;  2EFO A;  3J81 K;  1F9N A;  5F64 A;  1B9M A;  4M9Z A;  4LD5 A;  3L09 A;  3ZMU A;  5TRD A;  3D5L A;  3J80 Z;  1B9N A;  1IZ1 A;  2A3S A;  1O3Q A;  4G94 A;  1HSJ A;  3ZMV A;  3EYI A;  1CF7 A;  1W7P B;  1MKM A;  1RUN A;  4U0W A;  3FM5 A;  2FRH A;  1ONV A;  2VBX A;  4GO1 A;  5F1R A;  1O3S A;  3DKW A;  1ZGJ A;  1Z6R A;  5K1Y A;  1ZG3 A;  2E1C A;  3GX4 X;  1G3S A;  3ZN1 A;  1Z6T A;  2O61 A;  3Q5F A;  5BQT A;  2GXG A;  3FMQ A;  4GGG A;  4O5V A;  4G7H F;  1BI1 A;  1BI2 A;  2P5V A;  1YG2 A;  4K2E A;  2Q2E A;  5FLX Z;  4M9S A;  1HW2 A;  3B73 A;  4O3M A;  4HF2 A;  5E18 F;  4P5O A;  2XAQ A;  1YO5 C;  1PDN C;  3SZT A;  4B09 A;  3E5X A;  3BOQ A;  4U7D A;  1CF7 B;  2OQG A;  2Q0O A;  1W5T A;  5FB2 A;  3M1E A;  1T38 A;  3L7W A;  3PQJ A;  2ZO4 A;  1I1G A;  4GXO A;  4WXC A;  3ECO A;  1G3W A;  1R23 A;  5E1Z B;  2B0L A;  1ULY A;  2GWR A;  5LRR A;  1RI7 A;  2EJR A;  2BBY A;  1C0W A;  1QZY A;  4Q5S F;  4RAZ A;  2X4H A;  5IT9 Z;  1ZHF A;  3QPT A;  1XCB A;  3FMS A;  3ZQ7 A;  1XSV A;  1TNS A;  5CVU A;  1R1T A;  2DK5 A;  4H0E A;  2P6T A;  4CXF A;  5L3F A;  4QWQ A;  1BI0 A;  2MBF A;  4ZH4 F;  3LQQ A;  4EJU A;  5LBQ A;  1IN6 A;  4UV9 A;  1TQM A;  1KQ9 A;  1KU9 A;  5CVJ A;  4OIQ F;  4BYY A;  3HSR A;  4L9N A;  5DUI A;  4FX4 A;  5E8I A;  3HRM A;  4YFN F;  5HS8 A;  5AIP A;  4WK8 F;  3BPV A;  4ESB A;  4G6Q A;  3ERE D;  3ISP A;  4EJO A;  2GA1 A;  2VC0 A;  2YX4 A;  4Y13 A;  4BQA A;  4KIB A;  4IVN A;  4EJW A;  2STT A;  3CUQ A;  1TLH B;  4OU0 A;  2QWW A;  3CO7 C;  3GUD A;  1T0F A;  2J5P A;  1ZG5 A;  1ZLK A;  4MGR A;  2ACJ A;  3F8M A;  2P7V B;  4BHC A;  2JPC A;  1P4X A;  2X0L A;  3HSE A;  4YFX F;  5CJ9 A;  2A68 F;  4A6D A;  3QU3 A;  1P4A A;  1YW8 A;  5L3B A;  1HW1 A;  1F1Z A;  2P7C B;  4HDU A;  1S3J A;  4G7Z F;  3R61 A;  3L2C A;  1UFM A;  4FT8 A;  3TO6 A;  4O6J A;  3JTG A;  3CUQ B;  2A07 F;  2LKP A;  3WOD F;  4P55 A;  1BC8 C;  3CDH A;  4AIH A;  2K7L A;  2FE3 A;  3WTW C;  1BIA A;  3KP7 A;  3M9A A;  4KN4 X;  1D5V A;  1SMY F;  1B59 A;  3FXU A;  5FFZ A;  4L5I A;  2GAU A;  4LGW A;  2DFI A;  1RUO A;  4DNC A;  2XAS A;  5FD5 A;  4PGG A;  1R7J A;  1GXP A;  3JTH A;  1FOK A;  2HZT A;  4L0Y B;  1MJ9 A;  1SD5 A;  2LDU A;  1U3E M;  1W7P D;  4HQE A;  4OOI A;  1J7K A;  2M87 A;  4BH9 A;  1G4D A;  4LK0 F;  5A2Q K;  3H92 A;  1BN5 A;  3FM3 A;  2Z33 A;  1OYY A;  5HDG A;  3K9T A;  3IKV A;  4KN7 X;  5HLH A;  2EK5 A;  4LLG F;  4GYI A;  2VT2 A;  2LSO A;  4M73 A;  1ZAO A;  2PQ8 A;  1EV7 A;  2UXN A;  4MEX F;  1YLF A;  1T98 A;  1XD7 A;  4A2U A;  4LLL A;  5IT3 A;  2VON A;  5TJJ A;  3IRQ A;  2V79 A;  2JTV A;  2V1X A;  2L02 A;  2MD5 A;  2A61 A;  5KK1 A;  3HOT A;  5D8L B;  3DFG A;  2XKO A;  2F5D A;  2WC2 A;  5BS6 A;  3U2R A;  3KZY A;  5D4S A;  1R22 A;  1XMA A;  2O0Y A;  4YFK F;  5FGM A;  2ESN A;  4QLC U;  1Z05 A;  2V1U A;  4WCG A;  5HDN A;  2EV5 A;  3GZ5 A;  3R0J A;  1TTY A;  3F6O A;  1FY7 A;  4IRG A;  3BZ6 A;  3GFL A;  3KE2 A;  1XSX A;  2L4M A;  3J81 Z;  3JAM Z;  5J8C A;  2BEO A;  5DD4 A;  3KP2 A;  1FBQ A;  1IN4 A;  2ZME A;  2F5F A;  2XRN A;  1HKT A;  3GLX A;  3N4M A;  3HRT A;  1MJB A;  2EA2 A;  2R7D A;  3RYP A;  4N9I A;  2FEZ A;  1ZRC A;  1NHA A;  2Z9O A;  3CTA A;  2FQ3 A;  1IN7 A;  2QYO A;  3GEZ A;  4HAM A;  2OZ6 A;  4XSX F;  2XAG A;  4IXA A;  2PI0 A;  4ON0 A;  2DO7 A;  4M6Y A;  3HHG A;  4KDP A;  2M1B A;  2A5Y B;  3SQN A;  2NNN A;  5BOX A;  4ENN A;  1BC7 C;  1QNT A;  1DP7 P;  1FBS A;  3FX3 A;  5BPD A;  1X3U A;  2QQB A;  4ESJ A;  2L4A A;  5JR3 A;  5LHG A;  5HS7 A;  2W57 A;  1Q1H A;  2Z99 A;  2FA5 A;  1PUE E;  3ROU A;  2ZCW A;  3HTU A;  2H6B A;  3MAJ A;  3E97 A;  3I59 A;  4YG2 F;  2D2W A;  1ON2 A;  1U5T A;  3RYR A;  4M6X A;  3WG9 A;  4HV5 A;  2DPU A;  4RGX A;  3I71 A;  3I58 A;  1QQI A;  3QRF F;  3KCC A;  5LGU A;  4LG0 A;  1YS7 A;  1L3L A;  1LEB A;  2K86 A;  2OA4 A;  2OU2 A;  1EH6 A;  2K27 A;  2FNP A;  4WXH A;  2DQR A;  5LRS A;  5LHH A;  3WE2 A;  2DPD A;  3R60 A;  4EQQ A;  4GCV A;  1HKQ A;  3LA7 A;  4MQV A;  1ZRE A;  2FXA A;  4JK1 X;  3CJN A;  3I59 B;  3JSP A;  2CGP A;  1U5T B;  3WGI A;  4NB5 A;  1I27 A;  4KA4 A;  1P4W A;  1K78 A;  1UCR A;  1GHC A;  4LG0 B;  1HBX G;  2NAZ A;  3F72 A;  5L3G A;  4GYG A;  3T1B A;  1R1U A;  1XGS A;  1IUY A;  2ZJ2 A;  3EQL F;  4HX8 A;  3SFZ A;  1I6X A;  3GW2 A;  5DEQ A;  1SAX A;  1Z7U A;  1O3R A;  4HA8 A;  2P5K A;  1KA8 A;  3KP5 A;  5LEK A;  2ETH A;  4NQW A;  5KVR A;  1JE8 A;  1XN7 A;  4E70 A;  3TO9 A;  2COM A;  2W85 A;  2PBI A;  4G6D A;  6PAX A;  5L3D A;  4HQM A;  3TKY A;  3GWZ A;  3E5U A;  3ZP5 A;  1IXR C;  2RKH A;  1EH7 A;  1FC3 A;  5HVQ C;  2VC1 A;  4ZZD A;  1IF1 A;  2FBH A;  4Z2Y A;  2F2E A;  4ETS A;  3NQO A;  2XHK A;  1K78 B;  2Y0M A;  2A6H F;  1ZN2 A;  4A5N A;  3BY6 A;  1FYM A;  4DQ2 A;  2VE8 A;  3LAJ A;  2ISY A;  4EJT A;  3IWZ A;  1P92 A;  3I54 A;  1U5T C;  2STW A;  3IC7 A;  3CUO A;  4NHJ A;  1ZRF A;  2OAZ A;  1I5Z A;  2UXX A;  2PMH A;  3R0A A;  5ICG A;  2DT5 A;  1VTN C;  4CIC A;  1Z91 A;  3TQN A;  2IA0 A;  1OYW A;  3EUH A;  5D6E A;  4A6E A;  1JHF A;  4FX0 A;  2LF7 A;  4IRI A;  4I09 A;  4RGS A;  3FMR A;  4G7O F;  3I0T A;  3L00 A;  5EEH A;  1P6R A;  3MQ0 A;  4RGR A;  3LST A;  3ZMD A;  2CWE A;  3ML6 A;  2L3D A;  2RV8 A;  1FWZ A;  1G6N A;  4RS8 A;  5BMZ A;  4S04 A;  3VB2 A;  1F5T A;  1D3Y A;  2G7H A;  1DPR A;  1J75 A;  5ILV A;  3MZH A;  1ODD A;  1JHH A;  4UVC A;  3HRS A;  4KNY A;  1I1S A;  3JSO A;  4UVA A;  2O3F A;  4OIO F;  1OPC A;  5DV5 A;  1G3T A;  1MD0 A;  4YIF A;  4EM0 B;  2IPQ X;  3P9C A;  5AIQ A;  2P5L C;  4PGH A;  4ASN A;  4OIR F;  4R79 A;  2FF4 A;  3WTY C;  3VOD A;  3EYY A;  1ZYR F;  1IRF A;  3V7R A;  3CLO A;  4CYD A;  3KZZ A;  2XAJ A;  4KUM A;  2QZ8 A;  2MH9 A;  1WWX A;  2W84 A;  4I2O A;  1K7A A;  1KYW A;  2V1D A;  3HUG A;  3DV8 A;  3L9F A;  1D8K A;  3J80 K;  1YTY A;  5J6X A;  2DI3 A;  3I64 A;  2XVC A;  4L18 B;  1IW7 F;  1A04 A;  4MTE A;  2HYG D;  2HEO A;  3ZMS A;  4EV0 A;  2EV6 A;  1ZGA A;  2DTR A;  3G3Z A;  3QP5 A;  5E1X A;  1SFE A;  1JXS A;  5CVV A;  2Y48 A;  2D45 A;  3U9G A;  3IHU A;  2O6G E;  3P7N A;  4KMU X;  4CO8 A;  3JW4 A;  3E6B A;  5FLX K;  3QU6 A;  1YYV A;  2KIF A;  1R36 A;  2ISZ A;  1SD6 A;  2JRT A;  2DW4 A;  5FFX A;  2XIG A;  3R4K A;  1DUX C;  2HTJ A;  1HXD A;  3HRU A;  4YII A;  3V8J A;  3WTX C;  4XLN F;  1DPU A;  1MZB A;  2PJP A;  3P9I A;  3TOB A;  4HOB A;  5LHI A;  1YQA A;  4EJV A;  1E17 A;  1Z9C A;  2D1H A;  1ZRD A;  2CYY A;  2KJB A;  1K6O A;  4IHS A;  4CZZ A;  5IT9 K;  1H0M A;  1LEA A;  2XGX A;  5LGT A;  3K0L A;  1S7A A;  3M7G A;  1U8R A;  1R00 A;  4WX9 A;  4TV7 A;  3GFM A;  3FWE A;  5E8G A;  3B02 A;  1B4A A;  1S8N A;  3O2P E;  1XMK A;  1FYL A;  4Y15 A;  4I98 B;  2ZXJ A;  2HQN A;  4PDK A;  3NEU A;  1BI3 A;  4P9U A;  5JI6 A;  3CUQ C;  5FD6 A;  2FOK A;  4G8X A;  4RGU A;  1FSE A;  4L9V A;  2A69 F;  3DPL C;  4UHT A;  5CYV A;  4Q48 A;  1U6G A;  1SMT A;  5FO5 A;  5BPI A;  3V8K A;  3E6C C;  4WWC A;  1UB9 A;  4AD9 A;  1TW2 A;  5D8K B;  5DDG A;  1S29 A;  2FNA A;  3LQR A;  5DUK A;  2WTE A;  5JFR A;  2ZKZ A;  4M74 A;  2CW0 F;  4A0Y A;  4L9J A;  3M8F A;  5ICE A;  1LQ1 A;  1REP C;  2JT1 A;  2VE9 A;  1QO0 D;  2FSW A;  3T5X A;  4A0X A;  2HQR A;  3V8L A;  4M9X A;  1UST A;  3FXQ A;  1LB2 A;  1KGS A;  2RNJ A;  1MGT A;  5D5V B;  3LAP A;  1IXC A;  2DU9 A;  2L54 A;  3F22 A;  2HR3 A;  2P4W A;  3WGH A;  1FX7 A;  5LEJ A;  2ZNZ A;  2CG4 A;  4KFC A;  2LNB A;  4ZYG A;  3KLO A;  1OR7 A;  4ESF A;  2V9V A;  3RDI A;  2MLG A;  2FU4 A;  3DXJ F;  2ZFW A;  2M30 A;  2P8T A;  4LMY A;  3U1D A;  1RNL A;  3O6B B;  4A0Z A;  5E20 A;  1JGS A;  5HOO A;  5J8F A;  3IL2 A;  3VOE A;  3RIR A;  2V6C A;  1XCV A;  1MDM A;  2EB7 A;  4HW0 A;  1MJA A;  1UHM A;  4HF0 A;  2NNY A;  3K2Z A;  4EGY A;  3C18 A;  2EFP A;  3W6J B;  1T6S A;  5D4R A;  3HTS B;  4ENM A;  2EFN A;  3RPU A;  2ZME B;  1B1B A;  4LLN A;  2K4J A;  5HLG A;  3AAF A;  3OV8 A;  2NRA C;  1YW9 A;  1FLI A;  4UV8 A;  2XAH A;  2PN6 A;  5ILU A;  3KP4 A;  2UZK A;  4CGZ A;  3TDZ C;  1MDM B;  2DK8 A;  1TQP A;  2HYF A;  3WU1 B;  5L3C A;  4KIC A;  1D8J A;  2DBB A;  4AIJ A;  3MCZ A;  1R5H A;  3NRV A;  3TGN A;  3K1M A;  4S05 A;  2KJC A;  4IRH A;  1TNT A;  2QEN A;  3GZ6 A;  3Q9V A;  2ESH A;  1BM9 A;  1W5S A;  3DPT A;  4BXU A;  3WTU C;  2XUB A;  1U2W A;  4UUV A;  3FF5 A;  1XGM A;  1IAW A;  4WF2 A;  4KT5 C;  4OIN F;  3MWM A;  2CQK A;  3FXR A;  2W24 A;  2FBI A;  3Q9S A;  3OOP A;  1ZLJ A;  3ABU A;  4HDV A;  2BV6 A;  2DLL A;  4FHT A;  2QQ9 A;  3TOA A;  2OBP A;  1LDJ A;  1J9I A;  4N9H A;  3BJ6 A;  5HLI A;  3IRR A;  2YR2 A;  3LWF A;  4IF4 A;  2VBY A;  2R7F A;  1WSU A;  1J59 A;  2HOE A;  3VEP A;  1OMI A;  4MEY F;  3E3V A;  3T8R A;  1WKM A;  2UWM A;  1KQ8 A;  2JPB A;  3WU0 A;  3BJO A;  3LA2 A;  4MHG A;  3JAM K;  5CLS A;  4ZYH A;  3LFK A;  2MC3 A;  1HST A;  3F21 A;  5D5W B;  4I0B A;  5DCM A;  3R6S A;  3TO7 A;  2RC4 A;  5CVI A;  2RN7 A;  2QM3 A;  3COA C;  4UVB A;  4KYW A;  3EDP A;  1SFX A;  3F6V A;  2ZBK A;  1H9G A;  4WXD A;  5LLQ A;  3J7A O;  1R5G A;  3RKX A;  3I4P A;  4KMF A;  1B6A A;  5AON A;  3ZMZ A;  1P2F A;  2C6Y A;  3RKW A;  3GF2 A;  1J2X A;  3HSF A;  2VN2 A;  3C7J A;  4HYE A;  1XGO A;  3P9K A;  3F3X A;  4B8X A;  2HDC A;  2IA1 A;  1E2X A;  3IWF A;  4ENK A;  2CSO A;  3HYI A;  2IT0 A;  5ICF A;  5H20 A;  3GO5 A;  3DEU A;  2DAO A;  5DCM B;  1L0O C;  5ICC A;  1HW5 A;  3BWG A;  3REO A;  1KYZ A;  1PP7 U;  3ZMT A;  3WTT C;  1F4K A;  3V7S A;  5E1W A;  4OMZ A;  2QVO A;  4I02 A;  2NS0 A;  2LF8 A;  3DQV C;  2WWY A;  1U78 A;  4XLP F;  4I7H A;  3BP8 A;  1FP2 A;  4ZZL A;  3GFI A;  1FPQ A;  3QPH A;  4EM2 A;  2QLZ A;  5D5X B;  3C1D A;  1R1V A;  2HTS A;  3TDU C;  2H94 A;  1G3Y A;  3I53 A;  4A5M A;  4M72 A;  1FSH A;  3HHH A;  2HKX A;  2MLK A;  1Y0U A;  3F8C A;  1O7L A;  1ON1 A;  2A6E F;  3C3W A;  5A2Q Z;  2IJL A;  2ADU A;  2H6C A;  4P9F A;  5CVR A;  4BAY A;  2J5O A;  2ELH A;  2QUF A;  3ABT A;  1KU2 A;  1BOA A;  2EFW A;  2O8X A;  1V4R A;  3RKY A;  4LFU A;  3F8N A;  2HS5 A;  1KU3 A;  2VBW A;  3WTS C;  2PLY A;  3ELK A;  3RJP A;  2BGC A;  3BDD A;  4L5J A;  4I0A A;  3W6K B;  1YS6 A;  1S7O A;  1ZH5 A;  1UHW A;  4U0V A;  1TBX A;  2FML A;  2G9W A;  4JQF A;  1LVA A;  4RAY A;  2HKO A;  2QQA A;  4KIG A;  3HIF A;  5JHU A;  4EMS A;  1QBJ A;  3BPX A;  4RB1 A;  1PP8 F;  1FBU A;  2H27 A;  2W25 A;  1BIB A;  4UNO A;  2HWV A;  1KQ0 A;  1YFH A;  1AOY A;  4XRF A;  2BE5 F;  2WV0 A;  3VFZ A;  2IW5 A;  1RZ4 A;  2MA3 A;  5D6F A;  1S6L A;  2CFX A;  4XSZ F;  1AWC A;  4ENJ A;  3HOS A;  2RVC A;  2MH2 A;  2EFQ A;  2GQQ A;  2YPR A;  4Q4Z F;  4D0P A;  4Y17 A;  4EM1 A;  1XGN A;  2G7U A;  4LB5 A;  1GVJ A;  2IA2 A;  1WI9 A;  2RDP A;  1GXQ A;  1XB4 A;  2FMY A;  3GFJ A;  3K69 A;  2K4B A;  2VOP A;  1K79 A;  3GXO A;  5DD8 A;  3D0S A;  4I01 A;  2VBZ A;  3K1P A;  3MEX A;  3DP7 A;  3N97 A;  2VOD A;  5D5U B;  2F5E A;  3KLN A;  1V3F A;  4XBF A;  3ECH A;  2KRF A;  5L3E A;  3O3K A;  4F7Z A;  1FT9 A;  3KP6 A;  4R1H A;  1OYI A;  2OZU A;  2QBY A;  1RIO H;  4MNU A;  3KFW X;  1FZP B;  2KKO A;  1IXS B;  2EV0 A;  3H3Z A;  4ZYE A;  4IHT A;  1IN5 A;  4OMY A;  1CGP A;  3RI4 A;  2XAF A;  4LJZ F;  4HF1 A;  2YX7 A;  4ZYD A;  4IJA A;  2JSC A;  1OKR A;  4G9Y A;  3MFK A;  2VOO A;  2EWN A;  1IRG A;  1FNN A;  3T8T A;  1QPM A;  3S2W A;  1LDK B;  1EH8 A;  2E1N A;  5JVT A;  2YU3 A;  2OD5 A;  3WTZ A;  3E6D A;  1HQC A;  2H09 A;  3WGG A;  2ZNY A;  1YIO A;  4A12 A;  2QBY B;  3K1N A;  4MQ9 F;  5ERI A;  5K5R A;  3V7C A;  3DF8 A;  3F8B A;  1LJ9 A;  2Z5U A;  3PFI A;  1IN8 A;  4UXN A;  4U0Y A;  2VT3 A;  3FZV A;  4L9T A;  4MTD A;  3V4G A;  4BHB A;  1XDU A;  1KU7 A;  3QOP A;  2XKP A;  2K02 A;  1T39 A;  2EA4 A;  3PQK A;  3KEO A;  5H6Q A;  1DDN A;  3KET A;  2PEX A;  2RQP A;  1QGP A;  5H6R A;  3QP6 A;  5EEG A;  3E6M A;  1SD7 A;  5ED4 A;  1T2K A;  1XSD A;  1STZ A;  4AWX B;  3E5Q A;  2OQR A;  4HV6 A;  5K5O A;  4N0B A;  1J5Y A;  2D1V A;  1TQI A;  2GZW A;  3KP3 A;  3GYH X;  4HX4 A;  5DYM A;  2YSR A;  3ZPL A;  1O7F A;  4EGZ A;  3SZP A;  3CO6 C;  2E7W A;  1R58 A;  2O03 A;  2M8E A;  4HLX A;  4EVI A;  2P6S A;  2XV4 S;  1YW7 A;  3MZY A;  1WQ2 A;  1SD4 A;  2IRF G;  3SXY A;  3EET A;  2AS5 F;  4R8H A;  1Z1D A;  5HS9 A;  4BNC A;  1HKS A;  1QZZ A;  2GIV A;  5LGN A;  1W4M A;  2AXL A;  4AVP A;  5HDK A;  1FP1 D;  3SHF A;  1H9T A;  3RTR A;  1FYK A;  2E7X A;  2R3S A;  2Z3Y A;  3QAH A;  2RGV A;  1LNW A;  2L01 A;  2XRO A;  4HBL A;  2FBK A;  1WRJ A;  4KIF A;  2IP2 A;  2PMU A;  4RB0 A;  2IVM A;  3G73 A;  4L0Z B;  2F5C A;  5E17 F;  3T0Y A;  1LDD A;  2DQL A;  2KIM A;  4JBA A;  4HZF A;  1BBY A;  3H3U A;  4RB2 C;  2HFH A;  3F23 A;  5F6F A;  2HGC A;  3IKT A;  2VXZ A;  4OIP F;  3M8E A;  3ZN0 A;  4CHU A;  3WE3 A;  4IPA A;  4M71 A;  2PFB A;  2BYV E;  1ZG1 A;  4Q47 A;  3RPQ A;  3LA3 A;  2NYX A;  4U7B A;  5ILS A;  4P96 A;  2M5W A;  3FHZ A;  1ZAR A;  5DCF A;  4PZJ A;  3I5U A;  2JZY A;  2GXB A;  3BRO A;  1BJA A;  2KIU A;  2M45 A;  4LK1 F;  4BHP A;  1O3T A;  4LB6 B;  1W7P A;  3GVA A;  2Y75 A;  4HLY A;  4RB3 C;  3WTV C;  4U88 A;  4CDG A;  4PCQ A;  3ULQ B;  1J0R A;  2TDX A;  3BJA A;  2CO5 A;  1XDS A;  3F8F A;  2Q8K A;  1SFU A;  4AIK A;  1O57 A;  2GA2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...