1PP7U

Crystal structure of the t. vaginalis initiator binding protein bound to the ferredoxin inr
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
114
structure length
114
Chain Sequence
DLEASFTSRLPPEIVAALKRKSSRDPNSRFPRKLHMLLTYLASNPQLEEEIGLSWISDTEFKMKKKNVALVMGIKLNTLNVNLRDLAFEQLQHDKGGWTQWKRSGFTRNSVFED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords FERREDOXIN INR
publication title Structural Basis of Core Promoter Recognition in a Primitive Eukaryote
pubmed doi rcsb
source organism Trichomonas vaginalis
total genus 36
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2003-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF10416 IBD Transcription-initiator DNA-binding domain IBD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1pp7U00
1J0RA 4BHCA 1OPCA 3WE2A 2VODA 4O6JA 3CUOA 2ACJA 5TJJA 1KA8A 1XSDA 4A5NA 3DQVC 2HEOA 3F6OA 2L3DA 1WQ2A 4OOIA 2UWMA 3T8RA 3QOPA 4KN4X 4LLLA 3M8FA 2R7DA 3R4KA 3J81Z 3JAMK 5CVRA 5LGUA 1IZ1A 2H94A 3DPLC 4R8HA 3KEOA 4PGGA 1OYYA 5D8LB 2O3FA 4IRIA 2YU3A 4CGZA 1T98A 1O3RA 1R7JA 1XGMA 1RUNA 1K79A 3FXUA 4BQAA 2PMUA 2BEOA 3FMRA 5E1XA 5K5QA 2P4WA 3ZQ7A 2HYFA 4RGUA 1AOYA 2E1NA 3E97A 4UUVA 2RDPA 2XASA 2KKOA 2MH2A 1LDKB 2OU2A 5CLSA 1P6RA 5DEQA 1A04A 3L2CA 3GFIA 4ENMA 4XRFA 2ZMEB 1L3LA 4AWXB 1JE8A 2Y0MA 5ICCA 2MC3A 3MCZA 3ZMVA 2H09A 2XRNA 5HLGA 4IPAA 3ZN0A 2B0LA 3E3VA 2HTJA 1D5VA 2EFOA 2Q8KA 1ZARA 3J7AO 1LNWA 3K2ZA 4N9IA 2XV4S 2QLZA 1J2XA 2FU4A 2HKOA 1ON1A 4I0AA 2M1BA 1FP1D 2ESNA 2K4BA 1K78A 3ZPLA 3BPXA 4I7HA 4IF4A 1MZBA 2VXZA 3F21A 3WTTC 3WGIA 2WWYA 4AD9A 3J80Z 1OYIA 4BAYA 3WE3A 5F64A 3DFGA 1FT9A 3P9CA 2IVMA 4Y15A 3PQKA 4L5IA 1K7AA 1SD6A 2P8TA 5F1RA 1XMAA 5KVRA 2OAZA 4AVPA 5DUKA 4ZYHA 3KP2A 3GEZA 1P4WA 2Y48A 2VC0A 5CVJA 1SMYF 1J5YA 5HDKA 2Z33A 3TO7A 5D4RA 2RC4A 5H6QA 3LQRA 1B1BA 1OMIA 3CUQB 3L7WA 4HDUA 1IN4A 1W7PD 4OMYA 3EDPA 1R5HA 4A6EA 1I1SA 1WI9A 4M6YA 3RPUA 1OYWA 3FXQA 1BIBA 1NHAA 4BHPA 2VBWA 4L18B 3HYIA 2PLYA 1T6SA 2PG4A 3F8CA 4EM0B 1LDJA 2NAZA 5LEJA 5K5RA 3HTSB 1BC7C 4DNCA 4KDPA 3H3UA 2DK8A 5ICGA 5DD4A 1Q1HA 3IWZA 1W7PB 4A0ZA 4I09A 5HS9A 2FNAA 2H6CA 2PEXA 4O3MA 1RZ4A 2HS5A 1KU9A 4ZZDA 2CW0F 1ZG1A 3P7NA 2WTEA 1G4DA 3ISPA 2KIUA 2M5WA 4OIPF 3D0SA 5E1WA 2IJLA 1EH7A 2ISZA 3M7GA 3J81K 1MDMB 3F6VA 4G6DA 4HAMA 4XLNF 2K02A 2ZCWA 1RNLA 1SFXA 4PZJA 4M9SA 2L4AA 4U0WA 1XSVA 2EFNA 1FBQA 1WRJA 3GVAA 4E70A 2FOKA 1R23A 3U9GA 1D8KA 3HRMA 1D8JA 3ZMSA 2BBYA 3FMQA 3HOTA 3IL2A 2NS0A 1R00A 4RAZA 2PI0A 1T0FA 3H3ZA 1ZRFA 1JXSA 3S2WA 5CYVA 4WWCA 3V4GA 1UHWA 4YIIA 4F7ZA 4D0PA 3LSTA 4A0YA 1UCRA 4EGYA 2A6EF 4M9ZA 1HXDA 4YFXF 1O3TA 1V3FA 3MAJA 3IHUA 1ULYA 2FF4A 3LAPA 3FM5A 4B8XA 1USTA 4YIFA 1T39A 1HBXG 1KYZA 3NEUA 4CDGA 4HA8A 3B02A 3WGGA 2EV5A 2QVOA 3JW4A 3GW2A 1KQ8A 5K5OA 4BNCA 4XSZF 1FYLA 1SAXA 3WTVC 1BOAA 5EEGA 3CUQC 2GA2A 3R61A 1KGSA 4RB3C 3RI4A 4RGXA 2XHKA 2STTA 1WSUA 4PDKA 5DDGA 4I0BA 1HKSA 3E6BA 1OKRA 3R0JA 1ODDA 4ESBA 3DPTA 1J7KA 2RQPA 1QZZA 4JQFA 4I02A 2EFWA 3WGHA 3J80K 1B6AA 1DPUA 2GXGA 1QNTA 4YFKF 5DUIA 1R1VA 4ZH4F 1SD4A 2NYXA 2V1UA 2L01A 1FYKA 2EJRA 1F9NA 5AIQA 2VBZA 3QPTA 3MWMA 1BM9A 5DD8A 4UV8A 1HSTA 2ZNYA 4HQMA 4GGGA 1YW8A 2HYGD 3D5LA 5LGNA 1CF7A 4IVNA 4G94A 1Z9CA 3FZVA 3FWEA 1YS7A 3KP4A 1MJ9A 3I4PA 3ABUA 1D3YA 1TQIA 3I59B 2IA0A 4P9UA 4WXHA 3DEUA 4OMZA 1EV7A 3QU6A 4LMYA 1E17A 4LLGF 2DO7A 2HFHA 4EM1A 1S29A 5EEHA 2Y75A 2XROA 3WTSC 5LEKA 4BH9A 2VE8A 4LB6B 2KIMA 2P7CB 4U7DA 2D2WA 4L0ZB 1DP7P 2P7VB 3CDHA 5L3CA 1FX7A 4LK1F 1RI7A 4OU0A 1L0OC 2UXXA 2W24A 5A2QK 4GCVA 3HSRA 1HSJA 2IA2A 4Q47A 4AIJA 3T0YA 4LG0B 3ECHA 2O61A 1C0WA 2OZ6A 4LK0F 2PBIA 2GQQA 1XCVA 1IN6A 3LQQA 5CVVA 4Q5SF 3MQ0A 2Q2EA 2RN7A 1BC8C 5D6FA 5D5UB 1I5ZA 1SD5A 1TNSA 5CJ9A 1FZPB 1SMTA 4U0VA 3M1EA 1PDNC 1O3SA 2STWA 4S05A 5LRSA 2YPRA 3QU3A 4N9HA 4ON0A 1ZRCA 3C3WA 5L3FA 1IXRC 2TDXA 1W5SA 4KUMA 1YQAA 4RGRA 2YX4A 1F4KA 1B59A 3I64A 3BROA 4P96A 1QBJA 3QRFF 3E5QA 1TQPA 2IT0A 3TO9A 3IRRA 1ON2A 3G3ZA 2BYVE 2M8EA 4L9JA 2R3SA 1FBSA 3LFKA 1S8NA 3RDIA 2BE5F 3PFIA 1REPC 2LKPA 2UXNA 3V7SA 4U7BA 4M9XA 1S7OA 2DT5A 2QQAA 2QZ8A 3WU1B 1HKTA 1XN7A 5BS6A 2OA4A 1UHMA 1P2FA 4HQEA 4EJWA 1U5TB 3F22A 3E5UA 3TDZC 2D45A 3K69A 3T5XA 2L4MA 2QQ9A 1S7AA 3RTRA 4HOBA 3U2RA 1USSA 4GXOA 1LB2A 4EJOA 4I2OA 4PCQA 3JSPA 2DU9A 5DYMA 2EFQA 4MHGA 2F5FA 2NNYA 2DW4A 4G6QA 3BDDA 5LRRA 1ZLJA 4KNYA 4IRHA 2UZKA 1GVJA 4BXUA 3TQNA 2Z9OA 2VOPA 3WTWC 2V1DA 5HOOA 4K2EA 4O5VA 4LB5A 1FLIA 4FHTA 4MEYF 3KP5A 2V79A 3ELKA 1O3QA 2L54A 2FQ3A 5FFXA 2IW5A 1FC3A 2P5VA 1F5TA 2XAHA 3K0LA 3L00A 1TBXA 3GZ5A 2Z99A 1IN8A 4L9VA 5J6XA 3W6KB 1HW5A 4L9TA 2IP2A 2H27A 3M9AA 4R79A 1LQ1A 2JPBA 2FE3A 1XB4A 1ZRDA 4MGRA 1YW7A 5L3BA 3OOPA 2FBIA 4A2UA 4UVAA 3GF2A 5JHUA 2ISYA 4B09A 2HR3A 4UVCA 2EV6A 1CGPA 2E7WA 5HDGA 4XSXF 3N97A 1YTYA 5L3EA 2FNPA 2XAQA 3HRUA 3F8NA 3SXYA 4P55A 3V8LA 4M72A 5ERIA 1PUEE 2VN2A 1U6GA 2RGVA 4KYWA 4R1HA 3RJPA 4UHTA 2ESHA 3IRQA 4KIGA 4RS8A 3E6CC 1T2KA 3COAC 2F5CA 1ZLKA 1I6XA 4CXFA 2ZBKA 1IRGA 2LF8A 2XVCA 3O3KA 2YSRA 5FB2A 2ADUA 2F2EA 2YR2A 1LDDA 3B73A 1YO5C 2Z5UA 3C1DA 1ZN2A 4U0YA 2XGXA 4EQQA 3U1DA 5FD6A 3FX3A 3JTHA 4ENNA 5AIPA 5FFZA 3ZMTA 1P4XA 2ZMEA 4IHTA 3I58A 1SFUA 1U5TC 2EA2A 4P9FA 1IXSB 4ZYDA 1FYMA 2GWRA 3HIFA 1E2XA 1R5GA 3N4MA 1ZHFA 3AAFA 2DQLA 2EWNA 1P92A 5BQTA 2A69F 2JPCA 3BPVA 3K1PA 1KU3A 2JZYA 4M74A 2HKXA 2W25A 3MFKA 1KQ9A 4OIQF 3KP7A 3Q9SA 5IT3A 2QBYB 4WK8F 4L0YB 5FGMA 1QO0D 1R1UA 2V9VA 1BI3A 2JT1A 3GZ6A 4G7OF 2F5DA 2H6BA 5H20A 4Y17A 3WTXC 2P6SA 2OD5A 1J75A 1IN5A 3KEQA 1IUYA 2XAGA 1ONVA 3K1NA 4HLXA 2OQGA 3K9TA 2CYYA 3CLOA 3H92A 1GXPA 4EJTA 4KT5C 5D5XB 3T8TA 2GAUA 2ELHA 4HYEA 3CUQA 3P9KA 1JGSA 3JTGA 4CICA 4HW0A 2FEZA 2Q0OA 3NRVA 4OIRF 3SZPA 2HOEA 4KA4A 3JAMZ 3BJ6A 2XKOA 4WF2A 1FSHA 3KFWX 2BGCA 2EK5A 4CO8A 5BPIA 3R60A 3HUGA 3E6MA 3DKWA 5DCMB 3LA3A 1P4AA 4YG2F 3KLOA 3L09A 2QENA 1MJAA 1W7PA 4HV6A 1FPQA 1FOKA 1HW1A 1OR7A 1B4AA 4RB0A 1ZGAA 3ULQB 2FSWA 1TNTA 1MJBA 1YFHA 1LVAA 2VC1A 3JSOA 4AIHA 1O7LA 1IAWA 2V6CA 3BY6A 1FBUA 1MKMA 4I01A 4LGWA 1FSEA 1IF1A 3ZMUA 1FWZA 5ILUA 4ASNA 1TQMA 5JR3A 1MDMA 5BMZA 4KMUX 5E8GA 4RB1A 2GA1A 3NQOA 5E1ZB 5FLXZ 2A3SA 1FY7A 2FMYA 1Z91A 1I1GA 2OBPA 1ZH5A 3RKXA 2LSOA 2OQRA 1BI0A 3TOBA 2C6YA 2MBFA 3BWGA 4L5JA 3F8FA 3ROUA 2PJPA 2IA1A 1Z1DA 3ZMDA 1U78A 1G3WA 3FXRA 5BPDA 2FBKA 1YG2A 1XDSA 3VODA 1UB9A 5L3DA 1IN7A 3SFZA 4G9YA 2WC2A 3EYIA 2DAOA 5ICFA 1R1TA 3MZHA 3KP6A 3Q9VA 4AIKA 2VOOA 3GFJA 1EH8A 1O57A 2PQ8A 2O6GE 3WTYC 5HLHA 3MZYA 1Z6RA 3WTZA 1AWCA 3SQNA 2CFXA 2FRHA 2PN6A 3TKYA 4FX4A 5HDNA 2CO5A 3KLNA 1Z05A 1XMKA 3QP5A 2D1HA 3IC7A 2CWEA 4KIBA 4G7ZF 2HGCA 5ILVA 1X3UA 2J5PA 2E1CA 2K4JA 4GO1A 4RB2C 2XUBA 3KE2A 4JK1X 2GIVA 3EETA 2MD5A 5CVIA 1VTNC 2ZXJA 1J59A 4S04A 6PAXA 3BZ6A 5ICEA 3I5UA 2A6HF 3GXOA 4HF2A 2DLLA 4MQVA 3CO7C 2P5KA 1WWXA 3GYHX 5AONA 3HRTA 4CZZA 1V4RA 5H6RA 3WU0A 1J9IA 2DBBA 2HDCA 1LJ9A 4HLYA 4BHBA 1FNNA 4XBFA 3TGNA 4HZFA 4IRGA 5J8CA 1RIOH 1G3TA 2LF7A 4IJAA 2K86A 1JHFA 1T38A 5D4SA 1S6LA 1K78B 2PMHA 3DXJF 1GXQA 4I98B 2VBXA 3C18A 4IHSA 2PFBA 5HLIA 5FO5A 2CQKA 4EJVA 1DPRA 5E17F 5BOXA 2JTVA 2OZUA 2W84A 2DFIA 4N0BA 3F8BA 3I59A 4WX9A 4MQ9F 2FA5A 2XAFA 4EGZA 3WTUC 3GFMA 2MLKA 5JI6A 2HTSA 4P5OA 5DV5A 1XDUA 2AS5F 3L9FA 1MGTA 4WXDA 3F23A 3MEXA 5FD5A 3V7CA 3VEPA 2DK5A 5D5WB 3R0AA 2KRFA 1XGSA 3VOEA 3RYRA 1UFMA 1DUXC 1ZG3A 2R7FA 3I71A 3C7JA 2DTRA 3I53A 4PGHA 3IWFA 3P9IA 1B9NA 2M87A 2MH9A 2L02A 3SZTA 1W5TA 2E7XA 5IT9Z 3TDUC 4ESFA 2A61A 4LG0A 4EJUA 3R6SA 1SFEA 3ZN1A 3CTAA 5ILSA 2MLGA 5FLXK 4HDVA 3HSEA 4ESJA 3ZMZA 5KK1A 3M8EA 3HRSA 3ABTA 4KFCA 4IXAA 2K7LA 1BIAA 2GZWA 4Q4ZF 2HWVA 4MTDA 1KU7A 3TOAA 2QQBA 2EA4A 3DP7A 3E6DA 3F72A 4M71A 3RKWA 3PQJA 5E20A 5ED4A 2BV6A 3DF8A 2CSOA 4A12A 1IXCA 3VB2A 1YW9A 4UXNA 3LA7A 4CHUA 4HX4A 2G9WA 2AXLA 4ZZLA 1BJAA 3DV8A 2LNBA 5HS7A 3K1MA 1IW7F 1QQIA 3KP3A 5LGTA 4KN7X 1PP7U 2J5OA 2XIGA 1FP2A 1LEAA 2W85A 3EQLF 3Q5FA 1W4MA 4NHJA 1K6OA 3OV8A 2VONA 4JBAA 2O0YA 4H0EA 1WKMA 1KU2A 1H9TA 1U5TA 1R22A 4KIFA 3GO5A 3RPQA 2QM3A 4NB5A 2XKPA 1BN5A 1KYWA 5D8KB 4LFUA 3GX4X 5TRDA 1RUOA 1YLFA 5JVTA 3IKTA 1B9MA 3BJOA 2O8XA 2RNJA 2COMA 3W6JB 2EB7A 3QP6A 1JHHA 5LHIA 5F6FA 4XLPF 3FHZA 4Y13A 3GUDA 2HZTA 2M45A 1ZGJA 2V1XA 2IRFG 1H9GA 1EH6A 3FF5A 4KMFA 3G73A 2RVCA 5LLQA 2KIFA 1MD0A 1R36A 1R58A 5JFRA 5D6EA 4EVIA 4OINF 2MA3A 5LHGA 5A2QZ 4A0XA 5E18F 1Z7UA 4HX7A 2FMLA 1TW2A 1TLHB 4A5MA 3V8JA 2P6TA 4UV9A 5K1YA 2DQRA 4HV5A 4MTEA 4EM2A 3FM3A 4ZYEA 3LA2A 1YYVA 2HQRA 5LBQA 3GWZA 1CF7B 2A5YB 3BOQA 3ML6A 1YIOA 4QWQA 2P5LC 2XAJA 1XD7A 2ZJ2A 1S3JA 1ZG5A 3KZZA 1XGOA 3REOA 1I27A 4L9NA 4KICA 3IKVA 4DQ2A 1QPMA 1XCBA 2KJBA 3LAJA 2CG4A 2DI3A 5IT9K 4Z2YA 4G8XA 5HS8A 1KQ0A 2QUFA 2RV8A 1SD7A 2HQNA 3HHGA 4UVBA 3RKYA 3I0TA 1GHCA 3CJNA 2NRAC 5E8IA 2CGPA 2K27A 2JSCA 1IRFA 2QWWA 2NNNA 5HVQC 1Z6TA 3E5XA 1QGPA 3BP8A 4UNOA 1BBYA 1HQCA 4LJZF 4M73A 4CYDA 4WCGA 1HKQA 3EUHA 3ZP5A 2ZKZA 1F1ZA 5D5VB 1QZYA 2KJCA 4QLCU 2ZO4A 2VE9A 2QYOA 3I54A 3O6BB 1STZA 1ZYRF 2FXAA 3QAHA 3GLXA 4HF1A 3RIRA 2X0LA 3KETA 2QBYA 1G6NA 1U2WA 2IPQX 4FX0A 1G3YA 2ETHA 3RYPA 2VBYA 4FT8A 4ENKA 2DPDA 3QPHA 1G3SA 4ETSA 3GFLA 2RKHA 4HX8A 3BJAA 5DCFA 2ZNZA 2A07F 1O7FA 3WODF 1BI1A 4HBLA 1ZAOA 3V8KA 3HTUA 4EV0A 3V7RA 2FBHA 4GYIA 1U8RA 2GXBA 2WV0A 4HF0A 2W57A 4MNUA 4Q48A 3T1BA 2EV0A 2YX7A 3HHHA 3WG9A 2G7HA 1YS6A 4A6DA 3FMSA 3SHFA 1LEBA 4NQWA 3F3XA 2LDUA 4RGSA 2DPUA 1ZREA 2VT3A 1TTYA 3LWFA 4ZYGA 2Z3YA 3CO6C 1TW3A 5CVUA 2X4HA 3KCCA 5J8FA 2A68F 4U88A 5DCMA 1HW2A 4M6XA 4RAYA 3O2PE 3TO6A 1XSXA 4EMSA 3ECOA 4G7HF 4OIOF 2ZFWA 4YFNF 2M30A 2F5EA 1BI2A 3F8MA 3KZYA 4GYGA 2D1VA 1Y0UA 2VT2A 1DDNA 4TV7A 2O03A 1PP8F 1H0MA 3HOSA 3ERED 4WXCA 3VFZA 2EFPA 4LD5A 4BYYA 5L3GA 2G7UA 4MEXF 1XGNA 3HSFA 1U3EM 5LHHA 2JRTA 4LLNA 3EYYA 4ENJA
chains in the Genus database with same CATH superfamily
1J0RA 4BHCA 1OPCA 2W48A 4A3LJ 3WE2A 3OY9A 1H89C 2VODA 4O6JA 3CUOA 2ACJA 1WJAA 5TJJA 3CCVI 5EG0B 3BR1A 2JA5J 1YJNI 1KA8A 1XSDA 4A5NA 3DQVC 1YJWI 5F0CA 2HEOA 3F6OA 2L3DA 1WQ2A 2VKDA 2CQXA 4PJMA 4OOIA 3VYTB 2R93J 2UWMA 3DLLF 1D0XA 2VQLA 3T8RA 1MMAA 1Y6IA 3BG9A 3QOPA 4KN4X 3RQ4A 4LLLA 4BGDA 4BDYA 3M8FA 2R7DA 3R4KA 1PJRA 3EUKL 5IYCJ 1JKOC 3HPGA 1UG0A 3VYUB 2R5ZA 2DOFA 1I6HJ 1POGA 1ETYA 3J81Z 3JAMK 2CW8A 4BU2A 3TW7A 4BDZA 2M4KA 3JCUC 5CVRA 3S3NA 3JRGA 1SAUA 1IZ1A 5LGUA 2H94A 5IP7J 3DTIA 3DPLC 4R8HA 3KEOA 3LMMA 2E35A 1OYYA 2UV1A 4PGGA 5JLWA 4E7LA 3BZCA 5D8LB 2O3FA 3OYGA 1JTYA 4IRIA 3QOEA 1IRXA 2YU3A 4CGZA 5IYDJ 1GLNA 1T98A 2UUZA 3V42A 3M07A 5GTIC 1Z0XA 1O3RA 1R7JA 1A36A 5J4VA 4E7JA 2Y0SN 1XGMA 4XLAA 1RUNA 3OSFA 1K79A 2EZKA 3OS2A 2KP6A 3FXUA 1SC7A 2ELKA 2KFDA 2QSFX 3L1PA 4BQAA 3S1NJ 2PMUA 2BEOA 3FMRA 4RAFA 5E1XA 2P4WA 5K5QA 3ZQ7A 2HYFA 2DDAA 4RGUA 1AOYA 2E1NA 3E97A 2HPMA 2RDPA 4UUVA 4NC8A 2XASA 3BR2A 2KKOA 2MH2A 3FISA 1LDKB 2OU2A 2K9LA 5CLSA 2D5VA 5B66C 1P6RA 2ECCA 1MBEA 5DEQA 3W2AA 1HOMA 4XM3A 3CLQA 4B44A 2X1DA 1YI2I 1S72I 3PL8A 1A04A 3L2CA 3GFIA 3S3OA 1BR1A 4ENMA 4XRFA 1D1BA 5GADJ 4JX4A 5F08A 3PSIA 3QQAA 2K9SA 2W82A 2WAQA 2W7NA 2ZMEB 1L3LA 4AWXB 1JE8A 3TP0A 3K10A 4HNTA 3SFIA 2Y0MA 3GTQJ 1JUMA 5ICCA 3G1OA 2MC3A 3MCZA 4E6KG 2LREA 4C2TA 2KQRA 3PO2J 3ZMVA 2JQ7A 2H09A 3SJMA 2XRNA 2ZSIB 2YUSA 5HLGA 4IPAA 3ZN0A 4KITB 2B0LA 3E3VA 4AM3A 1QU3A 3C2GA 3B6CA 3BC8A 2PJRB 4IEJA 4F92B 2HTJA 2LBFA 1D5VA 2EFOA 2IS6A 3CF2A 2Q8KA 2LY1A 3DKYA 3G71I 2VQGA 2WAFA 2CUJA 2JSPA 5M5YJ 1ZARA 3U21A 1Y56A 5K7FA 3J7AO 4OAYA 1LNWA 3K2ZA 1WJCA 4N9IA 5F0HA 2XV4S 3A03A 2QLZA 3DKXA 1J2XA 3ABMH 2FU4A 2HKOA 1ON1A 4I0AA 2E34A 1W36D 2M1BA 3K4JA 4RAGA 1FP1D 2ESNA 2K4BA 1K78A 3ZPLA 2RNGA 3BPXA 4I7HA 4IF4A 1MZBA 2VXZA 3OYMA 3F21A 3WTTC 1QVUA 2E5NA 3WGIA 3HOUJ 3S14J 3F0CA 3SYTA 4AD9A 3J80Z 2WWYA 1OYIA 4BAYA 5M5WJ 3WE3A 4I6ZA 2L9VA 5E79C 5F64A 4KISA 3ZGKA 3DFGA 3BG6A 1FT9A 3BG3A 3P9CA 4EEFG 3H36A 3IH3A 1OCPA 2IVMA 2Y9ZA 4Y15A 2K9MA 3PQKA 1Y8RB 4L5IA 4XOPA 1K7AA 3VYRB 1SD6A 2P8TA 5F1RA 1XMAA 5KVRA 4N4OB 3HKZA 2OAZA 4AVPA 4FISA 5DUKA 4ZYHA 3KP2A 3GEZA 1P4WA 2Y48A 3CCUI 2VC0A 3K2AA 3G4SI 5CVJA 1SMYF 4AVZA 1J5YA 2NS8A 5HDKA 1MW7A 3TO7A 2Z33A 2MGQA 5D4RA 2RC4A 5H6QA 2ZJRF 3LQRA 1B1BA 1OMIA 2OCCH 3CUQB 3Q0UA 3L7WA 4HDUA 1IN4A 1W7PD 4OMYA 3EDPA 5FRNA 2CUEA 2LP0A 3OYBA 2ZXHA 1R5HA 4A6EA 1I1SA 1V54H 2VL8A 1V5FA 1WI9A 4A3JJ 4M6YA 3OYCA 3RPUA 3MKZA 2KDOA 3K4MA 3JRDA 2JA6J 1WJ5A 2L7MP 1OYWA 3FXQA 1LVKA 1BIBA 1NHAA 4BHPA 2V7FA 2DCEA 2VBWA 4L18B 2KISA 4NC6A 3HYIA 2PLYA 3HUGB 1T6SA 3H3VK 1R6RA 5KAIC 4ITVA 2PG4A 3F8CA 5FKKA 4EM0B 5CPRB 3DLAA 1R4MB 1LDJA 4XKVA 4JP0A 2NAZA 5LEJA 3LSPA 3S2DJ 3BTJA 3H0GJ 5K5RA 2OV7A 3QPSA 3HTSB 1BC7C 4DNCA 4KDPA 3CJRB 2CMPA 3H3UA 2XAUA 3CMEI 3RCOA 1I3AA 2FQ4A 2DK8A 5ICGA 1LE8A 5DD4A 1FEXA 1Q1HA 3IWZA 3CCQI 1G59A 1W7PB 4A0ZA 1P7IA 2DMTA 4I09A 4IQ4A 2FUG2 5HS9A 2E36A 2FNAA 2H6CA 5FJ8J 2PEXA 2VKVA 4O3MA 1RZ4A 1Y1VJ 4CSWA 2HS5A 3PIOF 1KU9A 4C2MJ 2LRDA 2H1LA 3TMOA 2M0CA 4M3DA 4ZZDA 2L0KA 2CW0F 4A3CJ 2W4SA 1ZG1A 3A01A 1WJDA 3P7NA 2ZMEC 2WTEA 1VF9A 4FQGA 1G4DA 3HOXJ 3ISPA 3H1CA 2KIUA 2M5WA 3QWLA 4OIPF 3D0SA 1M1EB 4D5CA 5E1WA 2HXIA 1EH7A 2IJLA 2ISZA 4KA4A 1MBGA 3M7GA 3J81K 2R0QC 4C2UA 2KRHA 3K4CA 1MDMB 3F6VA 4G6DA 1OCCH 4HAMA 4XLNF 2K02A 2JUGA 2ZCWA 1VQ4I 1RNLA 1SFXA 4PZJA 4M9SA 2VQCA 2L4AA 3W3CA 3NARA 4U0WA 1XSVA 2EFNA 1FBQA 1WRJA 3GTMJ 1P7JA 3GVAA 2ICWG 1NTCA 4E70A 2FOKA 1R23A 3HGYA 3U9GA 2K9QA 1D8KA 4BACA 4G6TB 3M3YJ 1RR8C 3HRMA 1D8JA 3ZMSA 2BBYA 3A4CA 3FMQA 2DA1A 1XG1A 3LSJA 3HOTA 3IL2A 2NS0A 2JA2A 3FXMA 1ETXA 1R00A 3CCYA 4RAZA 1K6YA 1KONA 2CFOA 3BR5A 1T0FA 2XPWA 3H3ZA 3MKWB 2PI0A 2AHQA 3FK6A 1ZRFA 1JXSA 2VPRA 3A02A 3S2WA 2F5VA 5CYVA 4WWCA 1OCOH 4NUBA 1UHWA 3V4GA 1VQMI 3TW6A 4YIIA 4F7ZA 4D0PA 2XF6A 1ETVA 3LSTA 1YE9A 2CUZA 4A0YA 1UCRA 4CCMA 4EGYA 1VFCA 2A6EF 4M9ZA 4DJAA 4CA0A 1XTAA 2X85A 3OSGA 3Q0WA 1HXDA 2NVTJ 1R4NB 4YFXF 1O3TA 1V3FA 3CCSI 3MAJA 2KL4A 1TZLA 3IHUA 1ULYA 2FF4A 3LAPA 3FM5A 1I3QJ 4PSWA 3K4KA 2NOJB 3TBIA 1USTA 4B8XA 2DMPA 4YIFA 1T39A 1HBXG 1KYZA 2O9LA 2A05A 3NEUA 3GZNB 4CDGA 4HA8A 3K4LA 3B02A 3WGGA 4MIMA 2EV5A 3LL7A 2WY8Q 2R7XA 2QVOA 3JW4A 3GW2A 1KQ8A 1DU0A 4XQFA 5K5OA 1SFKA 2B9SA 4BNCA 4XSZF 2LFBA 1SAXA 3WTVC 1FYLA 4OWRB 1BOAA 5EEGA 1LFBA 4V2FA 2XGEA 1DQUA 3CUQC 1W36C 2GA2A 3ZQFA 3K6GA 1QRYA 3R61A 1KGSA 3FXKA 4RB3C 3MMYB 3QYBA 3RI4A 1SVMA 3PUFA 4AC0A 1Q1VA 3PIPF 3M4OJ 2IGNA 4RGXA 1UG2A 3FBNB 2XHKA 5JVGF 4I99C 2KDZA 2K5CA 3ZR8X 2STTA 1WSUA 1PUFA 4PDKA 5DDGA 4I0BA 1HKSA 3E6BA 1OKRA 3R0JA 1ODDA 2X51A 4ESBA 4RLFA 1MMGA 2F6CA 1FIPA 3DPTA 3HG9A 2R7UA 3KYLA 4M3GA 5FLMJ 1J7KA 2RQPA 1QZZA 3JRFA 4JQFA 2IS4A 4Z6YA 1X3ZB 2DA2A 2HU9A 4I02A 2ZB9A 2EFWA 3WGHA 3J80K 1VQOI 3ASOH 1B6AA 2VASA 1DPUA 5FROA 1ZTRA 2GXGA 1QNTA 4YFKF 5DUIA 1R1VA 1RR7A 4ZH4F 1SD4A 2NYXA 2MD0A 1T33A 1GV2A 2MC4A 2LR8A 4PSXA 5J40A 1OR7C 2F4MB 2V1UA 2L01A 1OFCX 3BR6A 4XORA 1FYKA 3MZ8A 2EJRA 1BR4A 3ZQQA 3I56I 1F9NA 5AIQA 3VWBA 4BQOA 2VBZA 4JX6A 3DBRB 5EF6A 5GAGJ 3QPTA 3MWMA 1BM9A 5DD8A 1WH7A 2WY7Q 4UV8A 2PX9A 1LFUP 1N25A 1HSTA 2ZNYA 4HQMA 4GGGA 1YW8A 2HYGD 3D5LA 5LGNA 1CF7A 4F52A 4ZJZA 5M3FJ 1W0UA 4IVNA 4G94A 3EPZA 4D1QA 2HPIA 2LTPA 1Z9CA 3FZVA 3PJRA 2W1OA 3FWEA 1YS7A 2LYCA 3KP4A 4C9YA 1MJ9A 3I4PA 3ABUA 2EQRA 1D3YA 1TQIA 3I59B 3CP8A 3KYCB 2IA0A 2JK3A 4PUSA 3J7YJ 1B72A 1BW5A 1WHUA 2OJED 4P9UA 4WXHA 3DEUA 3LSHA 1TWHJ 2CQNA 3JRBA 4OMZA 1ITYA 1EV7A 4QSHA 3QU6A 2M2EA 2K3PA 4A93J 4LMYA 1E17A 4LLGF 1X1BA 2DO7A 1V5GA 1X1DA 2OCEA 1JI8A 2HFHA 4EM1A 3S15J 2EZIA 1S29A 2IEKA 5EEHA 2Y75A 4CH7A 1VQ7I 3CCEI 3FKIJ 2XROA 3WTSC 5LEKA 1UAAA 4BH9A 2NVYJ 2VE8A 4LB6B 2KIMA 3DU5A 1Z21A 1F43A 4BJ6C 3S1QJ 5FKLA 2P7CB 4U7DA 2D2WA 4L0ZB 2DT6A 2HVRA 3OWTA 1DP7P 2P7VB 1APLC 3CDHA 4Y33A 4UUSB 4PFPA 5L3CA 3OYDA 2DA7A 1MSFC 3I4NJ 1FX7A 1ZK8A 1QVTA 2VIXA 4LK1F 4OAZA 5HLTA 1RI7A 4OU0A 1NK3P 2OTJI 2IXSA 1L0OC 2UXXA 3LOCA 1Z3YA 4HG2A 2W24A 3BCAA 2XGCA 1EF4A 5A2QK 1K83J 3ZQIA 3EUAA 4GCVA 5IP9J 3AG4H 3HSRA 1AA7A 1HSJA 2IA2A 4D7NA 1H8AC 2E5ZA 4BS9A 3JRHA 4Q47A 4AIJA 4G12A 2LLKA 3T0YA 4N4NB 3S1RJ 3S17J 2CJJA 4LG0B 2WAQN 3A2KA 3ECHA 2M34A 1X4OA 2DA3A 2OC6A 2O61A 2DJIA 2NS7A 3CMYA 2R7TA 1RKTA 1C0WA 2Z2SB 2OZ6A 4LK0F 2PBIA 4JOMA 1VQ9I 4C3HJ 3L2RA 1JUPA 4BJTA 2GQQA 1XCVA 2DA4A 4FETA 5C44J 1A6QA 1IN6A 3LQQA 4DYCA 1VQKI 3S16J 5CVVA 4Q5SF 3MQ0A 2NXNB 2Q2EA 3HJEA 4XMYA 2RN7A 1BC8C 5D6FA 5KCMA 4C3JJ 5D5UB 1I5ZA 1YRNB 1SD5A 3O8GA 1TNSA 2EIMH 5CJ9A 4IOCF 1B8IA 1FZPB 3TL4X 2TCTA 5HNFA 2COBA 1SMTA 3DU6A 4U0VA 3M1EA 1PDNC 1O3SA 2WADA 2STWA 4S05A 2XF5A 3S8PA 5LRSA 2YPRA 3QU3A 2FX0A 4ZDOA 4IOAF 4N9HA 4ON0A 1IGNA 1OLTA 1ZRCA 3C3WA 1VQ8I 1MBKA 4M3BA 3U1KA 1W0TA 3BR0A 2LVSA 5L3FA 1OJLA 2DYSH 1IXRC 3HZJA 2H8RA 3HPHA 2TDXA 1W5SA 1UELB 4HRIA 4A3GJ 2EINH 3DBLB 5M3MJ 4KUMA 4XLFA 1MIJA 1YQAA 4RGRA 5B3SH 2YX4A 1F4KA 1B59A 3ABLH 3I64A 1JT6A 3BROA 4P96A 4IQJA 1QBJA 2HNHA 4X1EA 5F0FA 3QRFF 3E5QA 1TQPA 2V26A 1TWFJ 2BZTA 2M4GA 2IT0A 3TO9A 3IRRA 4RM2A 1IDZA 3VYSB 1JJ6C 2GOMA 1ON2A 2V9KA 1U9OA 3G3ZA 5KHDA 2Q1ZB 2HOAA 1TWAJ 2BYVE 2BHZA 2ELJA 2M8EA 4MFDA 4L9JA 2R3SA 3LSMA 3HM5A 5IPAA 1LPQA 2IGKA 1X3WB 1XX5A 1JGGA 1RESA 3BTLA 2AXTC 5J47A 1FBSA 2EILH 2BY3A 2M9HA 2ME0A 3LFKA 1S8NA 3RDIA 3AKZA 2BE5F 3PFIA 1REPC 2LKPA 1ZQ3P 3HKZN 3BG5A 5BNGA 1V5EA 2UXNA 3V7SA 4U7BA 4M9XA 1S7OA 2DT5A 2QQAA 2QZ8A 3QODA 1A35A 3N05A 4RDUA 3WU1B 1HKTA 1XN7A 1A5JA 3MD2A 2BOLA 2ZC2A 1Y39A 5BS6A 2OA4A 1UHMA 3MKYB 1P2FA 3GTGJ 2DODA 4HQEA 4EJWA 1U5TB 4BEHB 4QIWN 3E5UA 3F22A 3TDZC 2D45A 4BXFA 2E2JJ 3S93A 1WCMJ 1WVRA 3K69A 3T5XA 4E7HA 2L4MA 1JKRC 2QQ9A 1S7AA 1I39A 3RTRA 4HOBA 3OYNA 3U2RA 1USSA 4GXOA 4MO7A 4A69C 4BL0B 1LB2A 4EJOA 4RA2A 4I2OA 2GBYA 4PCQA 3JSPA 2DU9A 2ID6A 5DYMA 2EFQA 4MHGA 2F5FA 2NNYA 2DW4A 9ANTA 4G6QA 3BDDA 5LRRA 3L2WA 1ZLJA 4KNYA 5DTDA 4IRHA 4CCOA 2UZKA 1GVJA 2YS9A 4P1WA 5IP6A 1A6IA 2GIZA 4BXUA 3TQNA 4V2GA 2Z9OA 2E2HJ 2VOPA 2HDDA 3KZIC 3GLLA 3WTWC 2V1DA 5HOOA 5DS9A 4K2EA 4U87A 4O5VA 1XS9A 4LB5A 3JRIA 3ERMA 1FLIA 4FHTA 1NG7A 4LOCA 4MEYF 5FRMA 3KIOA 2G0EA 3D5RC 3KP5A 2R5YB 2QSGX 2V79A 3ELKA 2NVUB 1AKHB 2JMWA 2L54A 1O3QA 1PVEA 2FQ3A 3FBIB 5FFXA 2IW5A 1FC3A 2P5VA 2Y2ZA 2XAHA 3OYEA 1F5TA 2B63J 4A3DJ 3NWTA 3K0LA 3L00A 1TBXA 3GZ5A 3H0DA 4BBSJ 2Z99A 4NBQA 1IN8A 4L9VA 5J6XA 3G2BA 3W6KB 5EG0A 1HW5A 1IO2A 3K4NA 4L9TA 2VJJA 4CCKA 2V6EA 2CUFA 2IP2A 2ID3A 2H27A 3M9AA 4R79A 1TC3C 1LQ1A 1J09A 2JPBA 2FE3A 3CC2I 1XB4A 2LC2A 1FOXA 2EIJH 1ZRDA 1GV5A 4MGRA 3CCJI 1X1PA 1YW7A 5L3BA 3OOPA 1SFOJ 4IHVA 3I3LA 2FBIA 4A2UA 2R4GA 5F04A 4C3IJ 1SEUA 4UVAA 5FKMA 2CS3A 3M8JA 3GF2A 5JHUA 2ISYA 4B09A 3RZDJ 2HR3A 3BLYA 2EV6A 4UVCA 5EDNA 2E71A 1CGPA 3WU2C 2VLAA 2E7WA 5HDGA 4XSXF 4JX5A 2KLOA 3N97A 1YTYA 1QHHD 4F3QA 5C4JJ 5L3EA 5J1UA 2R7OA 2FNPA 2XAQA 3CDLA 3HRUA 3F8NA 2LOOA 4DZPA 4BE1A 1HCRA 4RLQA 1E3OC 4XOTA 3SXYA 4P55A 3ZCOA 3V8LA 2JRMA 4M72A 5ERIA 1PUEE 3GMEA 3W2VA 2VN2A 2CRGA 5GPAA 2X1EA 3W2WA 1U6GA 2RGVA 4KYWA 4IHWA 2JVHA 4R1HA 1MH4A 3RJPA 4UHTA 2ESHA 3IRQA 4KIGA 4RS8A 3E6CC 1UZCA 3JRCA 2MW8A 2A6TA 1T2KA 2JJ7A 3COAC 1Z67A 2F5CA 1ZLKA 4IHYA 1I6XA 4CXFA 1MBJA 2ZBKA 2GXAA 3SDGA 5J1RA 3KYDB 1IRGA 1EJ9A 4F55A 2LF8A 2XVCA 3O3KA 5B5EC 2YSRA 5FB2A 4AUXA 2ADUA 2F2EA 2YR2A 4J01A 1LDDA 2Y31A 3B73A 2ZFUA 3E7LA 5EJCA 2Z5UA 1YO5C 3IAM2 3BQYA 3HC7A 3C1DA 2XB0X 5CQGA 3WHBA 1ZN2A 5F27A 3Q0VA 1VNDA 2XGXA 4XRSG 4U0YA 4EQQA 3U1DA 3H5AA 5FD6A 3FX3A 3JTHA 4ENNA 5AIPA 2NVQJ 3HOZJ 1IDYA 5FFZA 2M0MA 3ZMTA 3CF5F 4V19K 1P4XA 1MNEA 2ZMEA 1JUSA 4IHTA 3ZQHA 3I58A 3GTKJ 1SFUA 1U5TC 2EA2A 4P9FA 1IXSB 4BE2A 3ZRGA 4ZYDA 3LSKA 2GWRA 1FYMA 3HIFA 1FMVA 2RAEA 1E2XA 5GP9A 1R5GA 2W00A 3KEYA 3N4MA 2VXDA 1ZHFA 3AAFA 2DQLA 2R7RA 2EWNA 2HQ5A 4Y4RA 5HNHA 2CQ7A 2VKEA 5E3OA 2EH3A 1P92A 3HEFA 5BQTA 3FXLA 3HGGA 2A69F 2JPCA 4UB8C 1SANA 2V9PA 1TWGJ 3BPVA 3K1PA 1EA3A 2JUCA 1KU3A 1Z7LA 1YHQI 2JZYA 4M74A 2HKXA 1AKHA 2W25A 5J3LA 2RREA 3MFKA 1XMXA 1CQTA 1KQ9A 5EZGA 2QA4I 4ZC3A 2FD5A 1FJLA 4OIQF 3KP7A 3OYFA 3S2HJ 3Q9SA 3W6VA 5IT3A 2QBYB 2QEXI 2EZHA 4WK8F 4L0YB 2L7ZA 3HB9A 5FGMA 1QO0D 1R1UA 2V9VA 2L9NA 4CYCB 2JA8J 2QKMB 1BI3A 2JT1A 3RSNA 1VQ6I 1XC5A 2O7OA 4HNUA 5K7ZA 1TT0A 3GZ6A 4G7OF 2F5DA 4BE0A 1WFXA 4HSTA 2H6BA 1MNMC 5H20A 4Y17A 3WTXC 3OR1C 3SEZA 2TRTA 2LY9A 3J7AY 2P6SA 1LKXA 2OD5A 5C3EJ 1J75A 1IN5A 3CESA 3KEQA 1IUYA 2BVMA 2HVQA 3QYEA 2BW3B 2HOSA 4A3MJ 2XAGA 1YITI 2GM4A 3CD6I 1ONVA 3LSGA 3K1NA 4HLXA 2OQGA 3K9TA 2CYYA 1ACIA 4CUGA 4M3FA 3ZOBA 2HDWA 3J7ZI 3CLOA 5E3MA 2A5WA 3H92A 3L2VA 1GXPA 4EJTA 1X2MA 4KT5C 5D5XB 3T8TA 3UNGC 2GOXB 2GAUA 2M7AA 2ELHA 4HYEA 1MH3A 2QSHX 1IUFA 3L2QA 3HOWJ 3CUQA 3P9KA 1JGSA 3JTGA 3CJQB 4CICA 3VSLA 2VI6A 1EKEA 4XR6A 4J00A 2V4JC 4HW0A 2FEZA 2Q0OA 3NRVA 2MABA 4NQWB 2HOEA 2KRCA 5TGTA 3AG1H 4OIRF 3SZPA 1R9TJ 3JAMZ 2H1KA 2VUMJ 3BJ6A 2XKOA 1UMQA 4WF2A 4B3XA 5EZHA 1FSHA 3OYKA 3KFWX 2BGCA 4II2A 1P9QC 2EK5A 4B4CA 2ZJPF 4CO8A 5BPIA 3R60A 1IC8A 3HUGA 1WJFA 3E6MA 1NG6A 2IGMA 2X6YA 3DKWA 4FE4A 3CQZJ 5DCMB 3GTOJ 4II3A 3DEEA 1WI3A 4D7MA 4XN3A 1RRJA 3LA3A 2WA0A 3H5RA 1P4AA 4YG2F 3KLOA 1IJWC 3HXLA 2X9DA 3L09A 2PMZA 2QENA 1MJAA 1W7PA 4HV6A 1FPQA 1FOKA 2VPLA 1HW1A 1OR7A 2ME6A 1B4AA 4RB0A 1ZGAA 2DMQA 3PNYA 2FSWA 4PJJA 3FXJA 1TNTA 3ULQB 1MJBA 1YFHA 4E7SA 2VB6A 1LVAA 2VC1A 3JSOA 4AIHA 3BZKA 1DGRM 1O7LA 2VJIA 4AYBA 1IAWA 2QQ8A 5IYBJ 1Y8QB 2FOWA 2V6CA 3BY6A 1FBUA 1MKMA 5GAEJ 2OUMA 3NAUA 4I01A 4LGWA 1FSEA 3EUHC 1IF1A 4XLEA 3ZMUA 1FWZA 5ILUA 3H9GA 4ASNA 1TQMA 5JR3A 1MDMA 4PFOA 4F93B 1DP3A 1R5ID 3LNQA 1ZGWA 5BMZA 3E0JB 4KMUX 5E8GA 4RB1A 3PUBA 2VKHA 2CV2A 5FKOA 5GAHJ 1KZHA 2DOEA 2GA1A 2Z1DA 4EATA 3B6AA 2M7BA 3NQOA 4BJ5C 5E1ZB 5FLXZ 2A3SA 3SDBA 1FY7A 2FMYA 3PO3J 4L5EA 4XNFA 2H8WA 1Z91A 1I1GA 2OBPA 1ZH5A 1TWCJ 1WGXA 2LSOA 3RKXA 3RKQA 2OQRA 1BI0A 1LUJB 3TOBA 3FIWA 4XLHA 1YX5A 2C6YA 2MBFA 2X1CA 4A3IJ 3BWGA 4L5JA 3CCLI 3BTCA 2R5ZB 3F8FA 3ROUA 2PJPA 4FCYA 2E2IJ 4Y52J 2LD5A 2IA1A 1Z1DA 2P0WA 4LG3A 3ZMDA 4DZJA 4KT6A 3K70D 1U78A 2KHMA 1X1AA 2WB1A 1G3WA 2E60A 3FXRA 4QTRA 2F48A 1QPIA 3DPUA 4W1UA 2KZVA 5BPDA 2ZJQF 1D0ZA 2FBKA 1YG2A 1YX3A 1XDSA 2Y30A 3F9KA 4HPQA 3VODA 5LFAA 1BA5A 2I10A 4XRMA 1UB9A 1QZEA 4Y7NJ 2EPFA 5L3DA 2X6OA 1IN7A 3SFZA 4G9YA 2WC2A 3EYIA 2DAOA 4E7IA 5ICFA 1JTXA 1R1TA 4HNVA 5DM7F 3MZHA 3A1YA 3KP6A 3Q9VA 1AU7A 4AIKA 2VOOA 3GFJA 1EH8A 4XRSA 1O57A 2XC7A 1ORKA 1LFPA 2PQ8A 2O6GE 2NOGA 3WTYC 3MZYA 5HLHA 1Z6RA 3WTZA 1AWCA 3SQNA 2CFXA 4NC7A 2FRHA 4FE7A 5EGOB 2PN6A 3TKYA 4FX4A 5HDNA 3H9QA 2CO5A 1ETQA 3KLNA 1Z05A 3BTIA 3IH4A 4I76A 1WH5A 1G2HA 2CU7A 1XMKA 3OL3A 2QCOA 1I50J 1X2NA 3QP5A 3ESWB 3G1LA 1BW6A 2D1HA 2LKSA 3HBLA 3GCMA 3KPHA 3HDDA 2O8KA 3IC7A 2CWEA 4KIBA 2IS2A 4G7ZF 4XICA 2HGCA 5ILVA 1X3UA 3AG3H 3VPRA 2J5PA 2E1CA 2K4JA 1W5CC 4GO1A 4RB2C 1RKWA 2XUBA 3KE2A 4JK1X 2GIVA 3EETA 3OR2C 2R7WA 2MD5A 2DYRH 2DFHA 5CVIA 2ZXJA 1VZ0A 1VTNC 2BXZA 2K9NA 3PNTA 1J59A 2IBDA 4S04A 6PAXA 3VSKA 2OPTA 3BZ6A 5ICEA 3I5UA 2A6HF 4CCLA 3GXOA 4HF2A 2DLLA 1MBHA 4MQVA 1ZELA 3C2BA 4A3KJ 3CO7C 2P5KA 1WWXA 3GYHX 5AONA 3HRTA 3K7AJ 2CQQA 2LBFB 4CZZA 3LFUA 1V4RA 4PJ0C 5H6RA 3WU0A 1J9IA 5KAFC 2DBBA 3GBGA 2KMUA 4RMNA 3FDYA 2HDCA 2L5QA 1LJ9A 4D5FA 4HLYA 4BHBA 1FNNA 4XBFA 2L9RA 4BY7J 3TGNA 4HZFA 4IRGA 1JT0A 5JHFA 3LSIA 5J8CA 1RIOH 3O8HA 1RPWA 1O4XA 1G3TA 4YEJA 1VQNI 4XK4A 3KX2A 2CH0A 2LF7A 2R7ZJ 4RBOA 3FHNA 4IJAA 4BQQA 2K86A 1DGWY 1JHFA 1T38A 2HXOA 5D4SA 1S6LA 1HF0A 1K78B 1GDTA 2PMHA 2BY1A 3DXJF 1GXQA 3OIPA 4I98B 2VBXA 3MKLA 3DTKA 3C18A 4XONA 2DA5A 4IHSA 2PFBA 5HLIA 4NNJA 5FO5A 3HOYJ 2CQKA 3FXOA 3RPUD 1NH3A 3CMMA 4EJVA 1DPRA 1X4PA 5E17F 4X6AJ 5BOXA 2JTVA 2HQAA 2OZUA 2W84A 4DGWB 3JR9A 2DFIA 4N0BA 4FASD 2LY2A 3F8BA 4B47A 3I59A 4WX9A 4MQ9F 2FA5A 4GRIA 2XAFA 2M8GX 4EGZA 2KZGA 3E1SA 3WTUC 3GFMA 2CV1A 1W1WE 1G8XA 3C2HA 4GDFA 2F4OB 2MLKA 5JI6A 2HTSA 1N77A 4P5OA 5DV5A 1XDUA 2DTZA 2I5UA 4DOZA 3ZQGA 1IRZA 2AS5F 3L9FA 1MGTA 5HODA 3GTPJ 4WXDA 3F23A 5CQEA 3MEXA 5IY5H 3UR3C 5FD5A 4ZDPA 1OCTC 3V7CA 2YU9J 3VEPA 3PFYA 2KT0A 2NVXJ 2DK5A 5D5WB 3R0AA 2KRFA 3H5NA 4IL6C 3ZQLA 1XGSA 3VOEA 2R7SA 2WAEA 3RYRA 1D1AA 1UFMA 4CCNA 2IAIA 2O5RA 1IV8A 2WV1A 1DUXC 4BKXA 1K4SA 4UUSA 1ZG3A 5EGOA 2R7FA 3I71A 2DT7B 3C7JA 2DTRA 3AG2H 3I53A 4PGHA 2ECBA 3IWFA 3P9IA 1GUUA 1B9NA 2XSJC 2M87A 2MH9A 4J19A 2L02A 1PYVA 3SZTA 1W5TA 2E7XA 2JVGA 1TP4A 3BG7A 4XL9A 5IT9Z 3TDUC 2QF7A 4ESFA 3G6EI 4UUTA 2A61A 4BY1J 4LG0A 1VI0A 4EJUA 2XF7A 5LD2C 5EYRA 2HYJA 3R6SA 1SFEA 3DEWA 3ZN1A 1LE8B 1H88C 2R7QA 3CTAA 3K70C 5ILSA 2MLGA 5FLXK 4HDVA 1D1CA 4X0GA 3CC4I 3HSEA 3I9V2 4ESJA 3ZMZA 5GTHC 3IH2A 2XRLA 5KK1A 2BY2A 1YRNA 3M8EA 3A01B 3HRSA 3ABTA 4B1RA 4KFCA 4IXAA 2LH9A 4ZTJA 2K7LA 2HOTA 5FKNA 1BIAA 2F4IA 2GZWA 4Q4ZF 2HWVA 4MTDA 3TEDA 3DCFA 4DBQA 1KU7A 3TOAA 2QQBA 1X19A 1Z3XA 2EA4A 3DTEA 3OYHA 1BL0A 3DP7A 3E6DA 3F72A 1T95A 4M71A 3RKWA 3PQJA 5E20A 5ED4A 2BV6A 2R92J 3DF8A 2CSOA 4A12A 1IXCA 1E3HA 1JJ8C 3VB2A 3QPLA 4ANJA 1YW9A 2L7FP 3LA7A 4UXNA 4CHUA 2DDBA 4HX4A 2L2OA 1ENHA 2G9WA 2KPMA 2AXLA 4ZZLA 3CJTB 4H4KC 3IV5A 1BJAA 3DV8A 3MVPA 3SZGA 3OIOA 2LNBA 5HS7A 4W97A 2N8GA 4B48A 4XLCA 3K1MA 1IW7F 4AU7A 1QQIA 3KP3A 5LGTA 4KN7X 1PP7U 2XPVA 4MLOA 4M3EA 2J5OA 1OCZH 2XIGA 1D0YA 3IUOA 2K85A 1FP2A 1LEAA 2W85A 1S7EA 3BR3A 2Y0SA 4XN0A 3EQLF 3Q5FA 1HA8A 1W4MA 4NHJA 4BQNA 1D5YA 1GT0C 2LKXA 3DWLE 2AQFA 4MFEA 3I4MJ 5GPCA 1K6OA 2Y69H 3A0HC 2E1MB 1QHGA 3OV8A 1N75A 1IV6A 2VONA 2BXYA 3ZQCA 1WPKA 2XSDC 1MMNA 4JBAA 2O0YA 4H0EA 1WKMA 1ZKGA 1KU2A 1H9TA 2XGDA 1U5TA 4BEHA 3H35A 1R22A 4KIFA 1BR2A 1Y0NA 3GO5A 3RPQA 3IP4B 2M3AA 5B1BH 2QM3A 4NB5A 1MNDA 2XKPA 1ETOA 2AQEA 4D9JA 2DMNA 3PSFA 4S0HB 2MSYA 1BN5A 1KYWA 1R49A 5D8KB 4LFUA 3OYIA 3GX4X 5TRDA 5E3LA 1RUOA 2X6WA 1YIJI 4HEA2 1YLFA 1F36A 5JVTA 3IKTA 5EEAA 1B9MA 2IS1A 3BJOA 2O8XA 2RNJA 4BUPA 3CP2A 3VDXA 2COMA 1X1CA 3W6JB 2EB7A 3QP6A 5J4YA 1JHHA 5LHIA 5F6FA 1MSEC 4XLPF 3FHZA 4Y13A 4E4HA 3GUDA 1N78A 2HZTA 2M45A 1ZGJA 2L7KA 1PUFB 1NK2P 2V1XA 1WJEA 2IRFG 1H9GA 1EH6A 2PMZN 3FF5A 4DYRA 4KMFA 3G73A 2RVCA 5LLQA 5J1YA 4Y3OA 1VQLI 4F91B 2KIFA 2EIKH 1MD0A 1R36A 2R5YA 4YELA 2DFFA 1R58A 2KIQA 5JFRA 3JREA 2HI3A 3L2UA 5D6EA 4EVIA 2CV0A 2DMUA 1VQ5I 4AYBN 1S5LC 2XDVA 1SVOA 4OINF 1SVLA 4M6VA 2MA3A 4PJNA 3OYJA 5LHGA 1JKPC 5A2QZ 4A0XA 5E18F 1Z7UA 4HX7A 4JYKA 2FMLA 3ASNH 1UHSA 1TW2A 3RZOJ 2OTLI 2Z16A 1TLHB 3CZ6A 1ZR4A 2XPUA 4A5MA 1OISA 5KNLA 3V8JA 2P6TA 4UV9A 5K1YA 2DA6A 4A3BJ 5TISC 4YIRX 2DQRA 1U8BA 5M5XJ 4HV5A 4MTEA 1U0JA 4EM2A 1RETA 3FM3A 4ZYEA 3LA2A 2MYSA 4RM3A 1YYVA 2HQRA 5LBQA 3GWZA 1CF7B 4UB6C 1FOWA 2ZXIA 4E7KA 2A5YB 3BOQA 3ML6A 4LIVA 1WJBA 4PK4A 1T56A 1YIOA 1DU6A 4QWQA 2P5LC 3HOVJ 2XAJA 3MN2A 1XD7A 3BT9A 3BCBA 2V1NA 2JN6A 2BVLA 1B72B 2ZJ2A 1S3JA 3OYLA 1HDPA 4GFBA 2DOAA 2HZDA 2WB1N 1K4TA 4HSRA 1ZG5A 3KZZA 1XGOA 3REOA 4B43A 3I55I 1I27A 4DYQA 4L9NA 4KICA 3IKVA 1FIAA 4DQ2A 1QPMA 1T0FC 4BBRJ 1XCBA 1VQPI 3H9JA 2KJBA 3WHCA 3LAJA 1U9NA 2CG4A 4IX7A 2DI3A 2MFZA 4DBRA 5IT9K 4Z2YA 4G8XA 5HS8A 1KQ0A 2QUFA 1R71A 2RV8A 3S3MA 1SD7A 2HQNA 1MMSA 3HHGA 3G1MA 3FK7A 4UVBA 3RKYA 5DM6F 3I0TA 1GHCA 2E1OA 3CJNA 2NRAC 5E8IA 1FTZA 5FLVA 2EBIA 2CGPA 2K27A 2JSCA 1ERDA 2LG4A 1ETWA 1IRFA 2QWWA 1MMDA 3AL0B 2NNNA 2ZSHB 5K7HA 3A0BC 2XB5A 5HVQC 1Z6TA 2ZXWH 1QGPA 3E5XA 2E1MC 2FJ1A 3BP8A 5IOYA 4UNOA 4AIDA 1FOYA 2X48A 2DFEA 1BBYA 4XIDA 1HQCA 4LJZF 4M73A 4CYDA 1GVDA 4DW6A 4WCGA 3P5JA 4IKFA 1HKQA 2K40A 3EUHA 5H2FC 3ZP5A 3CCRI 3OOUA 3NWSA 3OYAA 4ZYAA 2ZKZA 3D5SC 3D1NI 4IZZA 1F1ZA 2IGOA 1K61A 2JWTA 5D5VB 4B3AA 1V55H 1QZYA 3Q3SA 2KJCA 4QLCU 2ZO4A 1E0EA 2VE9A 2QYOA 3ABKH 3I54A 1WZ2A 3LSRA 1IG7A 1T08B 1QA6A 3O6BB 1STZA 1X58A 2Q2EB 1ZYRF 2FXAA 2OF7A 3QAHA 3GLXA 4A3EJ 4UY8I 1HDDC 1TL8A 3UKGA 2LK2A 3ONQA 1B8IB 4HF1A 2P81A 2CW7A 3RIRA 1S9HA 3GTLJ 2X0LA 3KETA 3RQIA 2QBYA 1G6NA 1U2WA 2IPQX 4FX0A 4LIUA 1RC9A 1G3YA 1ETKA 2ETHA 3RYPA 4CYCA 3CMAI 2VBYA 4FT8A 4DIQA 4ENKA 2DPDA 4LITA 3QPHA 3M1CA 1G3SA 2DN0A 4ETSA 2DJNA 2B7EA 1BJZA 3GFLA 2RKHA 4CZCA 4HX8A 3BJAA 5DCFA 2ZNZA 2A07F 1O7FA 4ZDLA 3OS0A 3K4BA 1XPXA 3JRAA 3WODF 1E3PA 3PM1A 3SEQA 2QGUA 3ZXSA 1BI1A 4HBLA 5IOZA 2BW3A 1ZAOA 4NDLA 2VJ4A 2VQHA 4QPQA 3V8KA 1FTTA 3HTUA 4EV0A 3V7RA 1Y1WJ 3BQZA 2FBHA 5B1AH 4GYIA 3AFHA 4IO9F 1U8RA 1HLVA 2GXBA 2WV0A 4HF0A 2W57A 3S32A 4IHXA 3FKJA 4MNUA 4Q48A 4PJLA 3T1BA 1HC8A 2EV0A 2VJ5A 2YX7A 1UJ8A 3HHHA 3WG9A 5JLXA 5C4XJ 4QPOA 2G7HA 3QYFA 1YS6A 4A6DA 3CDIA 3OMYA 3FMSA 3SHFA 1FMWA 1LEBA 2K3FA 2PJRA 4NQWA 3F3XA 2BY0A 4E7ZA 3CC7I 2LDUA 4RGSA 3CCMI 3OL4A 1BOBA 3HL2A 2DPUA 4YRVA 4XKWA 1ZREA 2VT3A 4C30A 1TTYA 3IAS2 2EZLA 3LWFA 2R7VA 5E3NA 4ZYGA 2Z3YA 3CO6C 1TW3A 5F1JA 5CVUA 2X4HA 3KCCA 5J8FA 4XKBA 1YOVB 2E19A 2A68F 4U88A 1OQYA 4FTHA 3DBHB 5DCMA 1Z77A 1HW2A 1OCRH 4M6XA 1AHDP 4RAYA 3WG7H 3O2PE 3TO6A 1XSXA 4EMSA 3ECOA 3OIQA 3PNVA 4G7HF 4OIOF 2JA7J 1A31A 2ZFWA 4YFNF 2RQQA 2M30A 3X2QH 2GLOA 2BHYA 2F5EA 1BI2A 3F8MA 3KZYA 4ZTFA 4GYGA 1JKQC 2D1VA 2I8DA 2X6XA 1Y0UA 2VT2A 1DDNA 4TV7A 2O03A 2MG4A 1PP8F 2L9SA 1H0MA 3HOSA 3AL0C 4CCJA 4A3FJ 3ERED 4WXCA 3VFZA 1ZR2A 2LMDA 2EFPA 4LD5A 1MBFA 4BYYA 4ABZA 2Y9YA 4XKCA 5L3GA 2G7UA 1T8IA 4MEXF 1XGNA 2HVSA 3GTJJ 3S1MJ 4BXXJ 2AO9A 3OS1A 3HSFA 4KJZA 2WBMA 1YJ9I 1U3EM 5LHHA 2QKLB 3TP3A 2JRTA 4LLNA 3EYYA 2DXIA 1TT5B 5CKTA 4ENJA
chains in the Genus database with same CATH topology
1J0RA 4BHCA 1OPCA 3WE2A 2VODA 4O6JA 3CUOA 2ACJA 5TJJA 1KA8A 1XSDA 4A5NA 3DQVC 2HEOA 3F6OA 2L3DA 1WQ2A 4OOIA 2UWMA 3T8RA 3QOPA 4KN4X 4LLLA 3M8FA 2R7DA 3R4KA 3J81Z 3JAMK 5CVRA 5LGUA 1IZ1A 2H94A 3DPLC 4R8HA 3KEOA 4PGGA 1OYYA 5D8LB 2O3FA 4IRIA 2YU3A 4CGZA 1T98A 1O3RA 1R7JA 1XGMA 1RUNA 1K79A 3FXUA 4BQAA 2PMUA 2BEOA 3FMRA 5E1XA 5K5QA 2P4WA 3ZQ7A 2HYFA 4RGUA 1AOYA 2E1NA 3E97A 4UUVA 2RDPA 2XASA 2KKOA 2MH2A 1LDKB 2OU2A 5CLSA 1P6RA 5DEQA 1A04A 3L2CA 3GFIA 4ENMA 4XRFA 2ZMEB 1L3LA 4AWXB 1JE8A 2Y0MA 5ICCA 2MC3A 3MCZA 3ZMVA 2H09A 2XRNA 5HLGA 4IPAA 3ZN0A 2B0LA 3E3VA 2HTJA 1D5VA 2EFOA 2Q8KA 1ZARA 3J7AO 1LNWA 3K2ZA 4N9IA 2XV4S 2QLZA 1J2XA 2FU4A 2HKOA 1ON1A 4I0AA 2M1BA 1FP1D 2ESNA 2K4BA 1K78A 3ZPLA 3BPXA 4I7HA 4IF4A 1MZBA 2VXZA 3F21A 3WTTC 3WGIA 2WWYA 4AD9A 3J80Z 1OYIA 4BAYA 3WE3A 5F64A 3DFGA 1FT9A 3P9CA 2IVMA 4Y15A 3PQKA 4L5IA 1K7AA 1SD6A 2P8TA 5F1RA 1XMAA 5KVRA 2OAZA 4AVPA 5DUKA 4ZYHA 3KP2A 3GEZA 1P4WA 2Y48A 2VC0A 5CVJA 1SMYF 1J5YA 5HDKA 2Z33A 3TO7A 5D4RA 2RC4A 5H6QA 3LQRA 1B1BA 1OMIA 3CUQB 3L7WA 4HDUA 1IN4A 1W7PD 4OMYA 3EDPA 1R5HA 4A6EA 1I1SA 1WI9A 4M6YA 3RPUA 1OYWA 3FXQA 1BIBA 1NHAA 4BHPA 2VBWA 4L18B 3HYIA 2PLYA 1T6SA 2PG4A 3F8CA 4EM0B 1LDJA 2NAZA 5LEJA 5K5RA 3HTSB 1BC7C 4DNCA 4KDPA 3H3UA 2DK8A 5ICGA 5DD4A 1Q1HA 3IWZA 1W7PB 4A0ZA 4I09A 5HS9A 2FNAA 2H6CA 2PEXA 4O3MA 1RZ4A 2HS5A 1KU9A 4ZZDA 2CW0F 1ZG1A 3P7NA 2WTEA 1G4DA 3ISPA 2KIUA 2M5WA 4OIPF 3D0SA 5E1WA 2IJLA 1EH7A 2ISZA 3M7GA 3J81K 1MDMB 3F6VA 4G6DA 4HAMA 4XLNF 2K02A 2ZCWA 1RNLA 1SFXA 4PZJA 4M9SA 2L4AA 4U0WA 1XSVA 2EFNA 1FBQA 1WRJA 3GVAA 4E70A 2FOKA 1R23A 3U9GA 1D8KA 3HRMA 1D8JA 3ZMSA 2BBYA 3FMQA 3HOTA 3IL2A 2NS0A 1R00A 4RAZA 2PI0A 1T0FA 3H3ZA 1ZRFA 1JXSA 3S2WA 5CYVA 4WWCA 3V4GA 1UHWA 4YIIA 4F7ZA 4D0PA 3LSTA 4A0YA 1UCRA 4EGYA 2A6EF 4M9ZA 1HXDA 4YFXF 1O3TA 1V3FA 3MAJA 3IHUA 1ULYA 2FF4A 3LAPA 3FM5A 4B8XA 1USTA 4YIFA 1T39A 1HBXG 1KYZA 3NEUA 4CDGA 4HA8A 3B02A 3WGGA 2EV5A 2QVOA 3JW4A 3GW2A 1KQ8A 5K5OA 4BNCA 4XSZF 1FYLA 1SAXA 3WTVC 1BOAA 5EEGA 3CUQC 2GA2A 3R61A 1KGSA 4RB3C 3RI4A 4RGXA 2XHKA 2STTA 1WSUA 4PDKA 5DDGA 4I0BA 1HKSA 3E6BA 1OKRA 3R0JA 1ODDA 4ESBA 3DPTA 1J7KA 2RQPA 1QZZA 4JQFA 4I02A 2EFWA 3WGHA 3J80K 1B6AA 1DPUA 2GXGA 1QNTA 4YFKF 5DUIA 1R1VA 4ZH4F 1SD4A 2NYXA 2V1UA 2L01A 1FYKA 2EJRA 1F9NA 5AIQA 2VBZA 3QPTA 3MWMA 1BM9A 5DD8A 4UV8A 1HSTA 2ZNYA 4HQMA 4GGGA 1YW8A 2HYGD 3D5LA 5LGNA 1CF7A 4IVNA 4G94A 1Z9CA 3FZVA 3FWEA 1YS7A 3KP4A 1MJ9A 3I4PA 3ABUA 1D3YA 1TQIA 3I59B 2IA0A 4P9UA 4WXHA 3DEUA 4OMZA 1EV7A 3QU6A 4LMYA 1E17A 4LLGF 2DO7A 2HFHA 4EM1A 1S29A 5EEHA 2Y75A 2XROA 3WTSC 5LEKA 4BH9A 2VE8A 4LB6B 2KIMA 2P7CB 4U7DA 2D2WA 4L0ZB 1DP7P 2P7VB 3CDHA 5L3CA 1FX7A 4LK1F 1RI7A 4OU0A 1L0OC 2UXXA 2W24A 5A2QK 4GCVA 3HSRA 1HSJA 2IA2A 4Q47A 4AIJA 3T0YA 4LG0B 3ECHA 2O61A 1C0WA 2OZ6A 4LK0F 2PBIA 2GQQA 1XCVA 1IN6A 3LQQA 5CVVA 4Q5SF 3MQ0A 2Q2EA 2RN7A 1BC8C 5D6FA 5D5UB 1I5ZA 1SD5A 1TNSA 5CJ9A 1FZPB 1SMTA 4U0VA 3M1EA 1PDNC 1O3SA 2STWA 4S05A 5LRSA 2YPRA 3QU3A 4N9HA 4ON0A 1ZRCA 3C3WA 5L3FA 1IXRC 2TDXA 1W5SA 4KUMA 1YQAA 4RGRA 2YX4A 1F4KA 1B59A 3I64A 3BROA 4P96A 1QBJA 3QRFF 3E5QA 1TQPA 2IT0A 3TO9A 3IRRA 1ON2A 3G3ZA 2BYVE 2M8EA 4L9JA 2R3SA 1FBSA 3LFKA 1S8NA 3RDIA 2BE5F 3PFIA 1REPC 2LKPA 2UXNA 3V7SA 4U7BA 4M9XA 1S7OA 2DT5A 2QQAA 2QZ8A 3WU1B 1HKTA 1XN7A 5BS6A 2OA4A 1UHMA 1P2FA 4HQEA 4EJWA 1U5TB 3F22A 3E5UA 3TDZC 2D45A 3K69A 3T5XA 2L4MA 2QQ9A 1S7AA 3RTRA 4HOBA 3U2RA 1USSA 4GXOA 1LB2A 4EJOA 4I2OA 4PCQA 3JSPA 2DU9A 5DYMA 2EFQA 4MHGA 2F5FA 2NNYA 2DW4A 4G6QA 3BDDA 5LRRA 1ZLJA 4KNYA 4IRHA 2UZKA 1GVJA 4BXUA 3TQNA 2Z9OA 2VOPA 3WTWC 2V1DA 5HOOA 4K2EA 4O5VA 4LB5A 1FLIA 4FHTA 4MEYF 3KP5A 2V79A 3ELKA 1O3QA 2L54A 2FQ3A 5FFXA 2IW5A 1FC3A 2P5VA 1F5TA 2XAHA 3K0LA 3L00A 1TBXA 3GZ5A 2Z99A 1IN8A 4L9VA 5J6XA 3W6KB 1HW5A 4L9TA 2IP2A 2H27A 3M9AA 4R79A 1LQ1A 2JPBA 2FE3A 1XB4A 1ZRDA 4MGRA 1YW7A 5L3BA 3OOPA 2FBIA 4A2UA 4UVAA 3GF2A 5JHUA 2ISYA 4B09A 2HR3A 4UVCA 2EV6A 1CGPA 2E7WA 5HDGA 4XSXF 3N97A 1YTYA 5L3EA 2FNPA 2XAQA 3HRUA 3F8NA 3SXYA 4P55A 3V8LA 4M72A 5ERIA 1PUEE 2VN2A 1U6GA 2RGVA 4KYWA 4R1HA 3RJPA 4UHTA 2ESHA 3IRQA 4KIGA 4RS8A 3E6CC 1T2KA 3COAC 2F5CA 1ZLKA 1I6XA 4CXFA 2ZBKA 1IRGA 2LF8A 2XVCA 3O3KA 2YSRA 5FB2A 2ADUA 2F2EA 2YR2A 1LDDA 3B73A 1YO5C 2Z5UA 3C1DA 1ZN2A 4U0YA 2XGXA 4EQQA 3U1DA 5FD6A 3FX3A 3JTHA 4ENNA 5AIPA 5FFZA 3ZMTA 1P4XA 2ZMEA 4IHTA 3I58A 1SFUA 1U5TC 2EA2A 4P9FA 1IXSB 4ZYDA 1FYMA 2GWRA 3HIFA 1E2XA 1R5GA 3N4MA 1ZHFA 3AAFA 2DQLA 2EWNA 1P92A 5BQTA 2A69F 2JPCA 3BPVA 3K1PA 1KU3A 2JZYA 4M74A 2HKXA 2W25A 3MFKA 1KQ9A 4OIQF 3KP7A 3Q9SA 5IT3A 2QBYB 4WK8F 4L0YB 5FGMA 1QO0D 1R1UA 2V9VA 1BI3A 2JT1A 3GZ6A 4G7OF 2F5DA 2H6BA 5H20A 4Y17A 3WTXC 2P6SA 2OD5A 1J75A 1IN5A 3KEQA 1IUYA 2XAGA 1ONVA 3K1NA 4HLXA 2OQGA 3K9TA 2CYYA 3CLOA 3H92A 1GXPA 4EJTA 4KT5C 5D5XB 3T8TA 2GAUA 2ELHA 4HYEA 3CUQA 3P9KA 1JGSA 3JTGA 4CICA 4HW0A 2FEZA 2Q0OA 3NRVA 4OIRF 3SZPA 2HOEA 4KA4A 3JAMZ 3BJ6A 2XKOA 4WF2A 1FSHA 3KFWX 2BGCA 2EK5A 4CO8A 5BPIA 3R60A 3HUGA 3E6MA 3DKWA 5DCMB 3LA3A 1P4AA 4YG2F 3KLOA 3L09A 2QENA 1MJAA 1W7PA 4HV6A 1FPQA 1FOKA 1HW1A 1OR7A 1B4AA 4RB0A 1ZGAA 3ULQB 2FSWA 1TNTA 1MJBA 1YFHA 1LVAA 2VC1A 3JSOA 4AIHA 1O7LA 1IAWA 2V6CA 3BY6A 1FBUA 1MKMA 4I01A 4LGWA 1FSEA 1IF1A 3ZMUA 1FWZA 5ILUA 4ASNA 1TQMA 5JR3A 1MDMA 5BMZA 4KMUX 5E8GA 4RB1A 2GA1A 3NQOA 5E1ZB 5FLXZ 2A3SA 1FY7A 2FMYA 1Z91A 1I1GA 2OBPA 1ZH5A 3RKXA 2LSOA 2OQRA 1BI0A 3TOBA 2C6YA 2MBFA 3BWGA 4L5JA 3F8FA 3ROUA 2PJPA 2IA1A 1Z1DA 3ZMDA 1U78A 1G3WA 3FXRA 5BPDA 2FBKA 1YG2A 1XDSA 3VODA 1UB9A 5L3DA 1IN7A 3SFZA 4G9YA 2WC2A 3EYIA 2DAOA 5ICFA 1R1TA 3MZHA 3KP6A 3Q9VA 4AIKA 2VOOA 3GFJA 1EH8A 1O57A 2PQ8A 2O6GE 3WTYC 5HLHA 3MZYA 1Z6RA 3WTZA 1AWCA 3SQNA 2CFXA 2FRHA 2PN6A 3TKYA 4FX4A 5HDNA 2CO5A 3KLNA 1Z05A 1XMKA 3QP5A 2D1HA 3IC7A 2CWEA 4KIBA 4G7ZF 2HGCA 5ILVA 1X3UA 2J5PA 2E1CA 2K4JA 4GO1A 4RB2C 2XUBA 3KE2A 4JK1X 2GIVA 3EETA 2MD5A 5CVIA 1VTNC 2ZXJA 1J59A 4S04A 6PAXA 3BZ6A 5ICEA 3I5UA 2A6HF 3GXOA 4HF2A 2DLLA 4MQVA 3CO7C 2P5KA 1WWXA 3GYHX 5AONA 3HRTA 4CZZA 1V4RA 5H6RA 3WU0A 1J9IA 2DBBA 2HDCA 1LJ9A 4HLYA 4BHBA 1FNNA 4XBFA 3TGNA 4HZFA 4IRGA 5J8CA 1RIOH 1G3TA 2LF7A 4IJAA 2K86A 1JHFA 1T38A 5D4SA 1S6LA 1K78B 2PMHA 3DXJF 1GXQA 4I98B 2VBXA 3C18A 4IHSA 2PFBA 5HLIA 5FO5A 2CQKA 4EJVA 1DPRA 5E17F 5BOXA 2JTVA 2OZUA 2W84A 2DFIA 4N0BA 3F8BA 3I59A 4WX9A 4MQ9F 2FA5A 2XAFA 4EGZA 3WTUC 3GFMA 2MLKA 5JI6A 2HTSA 4P5OA 5DV5A 1XDUA 2AS5F 3L9FA 1MGTA 4WXDA 3F23A 3MEXA 5FD5A 3V7CA 3VEPA 2DK5A 5D5WB 3R0AA 2KRFA 1XGSA 3VOEA 3RYRA 1UFMA 1DUXC 1ZG3A 2R7FA 3I71A 3C7JA 2DTRA 3I53A 4PGHA 3IWFA 3P9IA 1B9NA 2M87A 2MH9A 2L02A 3SZTA 1W5TA 2E7XA 5IT9Z 3TDUC 4ESFA 2A61A 4LG0A 4EJUA 3R6SA 1SFEA 3ZN1A 3CTAA 5ILSA 2MLGA 5FLXK 4HDVA 3HSEA 4ESJA 3ZMZA 5KK1A 3M8EA 3HRSA 3ABTA 4KFCA 4IXAA 2K7LA 1BIAA 2GZWA 4Q4ZF 2HWVA 4MTDA 1KU7A 3TOAA 2QQBA 2EA4A 3DP7A 3E6DA 3F72A 4M71A 3RKWA 3PQJA 5E20A 5ED4A 2BV6A 3DF8A 2CSOA 4A12A 1IXCA 3VB2A 1YW9A 4UXNA 3LA7A 4CHUA 4HX4A 2G9WA 2AXLA 4ZZLA 1BJAA 3DV8A 2LNBA 5HS7A 3K1MA 1IW7F 1QQIA 3KP3A 5LGTA 4KN7X 1PP7U 2J5OA 2XIGA 1FP2A 1LEAA 2W85A 3EQLF 3Q5FA 1W4MA 4NHJA 1K6OA 3OV8A 2VONA 4JBAA 2O0YA 4H0EA 1WKMA 1KU2A 1H9TA 1U5TA 1R22A 4KIFA 3GO5A 3RPQA 2QM3A 4NB5A 2XKPA 1BN5A 1KYWA 5D8KB 4LFUA 3GX4X 5TRDA 1RUOA 1YLFA 5JVTA 3IKTA 1B9MA 3BJOA 2O8XA 2RNJA 2COMA 3W6JB 2EB7A 3QP6A 1JHHA 5LHIA 5F6FA 4XLPF 3FHZA 4Y13A 3GUDA 2HZTA 2M45A 1ZGJA 2V1XA 2IRFG 1H9GA 1EH6A 3FF5A 4KMFA 3G73A 2RVCA 5LLQA 2KIFA 1MD0A 1R36A 1R58A 5JFRA 5D6EA 4EVIA 4OINF 2MA3A 5LHGA 5A2QZ 4A0XA 5E18F 1Z7UA 4HX7A 2FMLA 1TW2A 1TLHB 4A5MA 3V8JA 2P6TA 4UV9A 5K1YA 2DQRA 4HV5A 4MTEA 4EM2A 3FM3A 4ZYEA 3LA2A 1YYVA 2HQRA 5LBQA 3GWZA 1CF7B 2A5YB 3BOQA 3ML6A 1YIOA 4QWQA 2P5LC 2XAJA 1XD7A 2ZJ2A 1S3JA 1ZG5A 3KZZA 1XGOA 3REOA 1I27A 4L9NA 4KICA 3IKVA 4DQ2A 1QPMA 1XCBA 2KJBA 3LAJA 2CG4A 2DI3A 5IT9K 4Z2YA 4G8XA 5HS8A 1KQ0A 2QUFA 2RV8A 1SD7A 2HQNA 3HHGA 4UVBA 3RKYA 3I0TA 1GHCA 3CJNA 2NRAC 5E8IA 2CGPA 2K27A 2JSCA 1IRFA 2QWWA 2NNNA 5HVQC 1Z6TA 3E5XA 1QGPA 3BP8A 4UNOA 1BBYA 1HQCA 4LJZF 4M73A 4CYDA 4WCGA 1HKQA 3EUHA 3ZP5A 2ZKZA 1F1ZA 5D5VB 1QZYA 2KJCA 4QLCU 2ZO4A 2VE9A 2QYOA 3I54A 3O6BB 1STZA 1ZYRF 2FXAA 3QAHA 3GLXA 4HF1A 3RIRA 2X0LA 3KETA 2QBYA 1G6NA 1U2WA 2IPQX 4FX0A 1G3YA 2ETHA 3RYPA 2VBYA 4FT8A 4ENKA 2DPDA 3QPHA 1G3SA 4ETSA 3GFLA 2RKHA 4HX8A 3BJAA 5DCFA 2ZNZA 2A07F 1O7FA 3WODF 1BI1A 4HBLA 1ZAOA 3V8KA 3HTUA 4EV0A 3V7RA 2FBHA 4GYIA 1U8RA 2GXBA 2WV0A 4HF0A 2W57A 4MNUA 4Q48A 3T1BA 2EV0A 2YX7A 3HHHA 3WG9A 2G7HA 1YS6A 4A6DA 3FMSA 3SHFA 1LEBA 4NQWA 3F3XA 2LDUA 4RGSA 2DPUA 1ZREA 2VT3A 1TTYA 3LWFA 4ZYGA 2Z3YA 3CO6C 1TW3A 5CVUA 2X4HA 3KCCA 5J8FA 2A68F 4U88A 5DCMA 1HW2A 4M6XA 4RAYA 3O2PE 3TO6A 1XSXA 4EMSA 3ECOA 4G7HF 4OIOF 2ZFWA 4YFNF 2M30A 2F5EA 1BI2A 3F8MA 3KZYA 4GYGA 2D1VA 1Y0UA 2VT2A 1DDNA 4TV7A 2O03A 1PP8F 1H0MA 3HOSA 3ERED 4WXCA 3VFZA 2EFPA 4LD5A 4BYYA 5L3GA 2G7UA 4MEXF 1XGNA 3HSFA 1U3EM 5LHHA 2JRTA 4LLNA 3EYYA 4ENJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J0R A;  4BHC A;  1OPC A;  3WE2 A;  2VOD A;  4O6J A;  3CUO A;  2ACJ A;  5TJJ A;  1KA8 A;  1XSD A;  4A5N A;  3DQV C;  2HEO A;  3F6O A;  2L3D A;  1WQ2 A;  4OOI A;  2UWM A;  3T8R A;  3QOP A;  4KN4 X;  4LLL A;  3M8F A;  2R7D A;  3R4K A;  3J81 Z;  3JAM K;  5CVR A;  5LGU A;  1IZ1 A;  2H94 A;  3DPL C;  4R8H A;  3KEO A;  4PGG A;  1OYY A;  5D8L B;  2O3F A;  4IRI A;  2YU3 A;  4CGZ A;  1T98 A;  1O3R A;  1R7J A;  1XGM A;  1RUN A;  1K79 A;  3FXU A;  4BQA A;  2PMU A;  2BEO A;  3FMR A;  5E1X A;  5K5Q A;  2P4W A;  3ZQ7 A;  2HYF A;  4RGU A;  1AOY A;  2E1N A;  3E97 A;  4UUV A;  2RDP A;  2XAS A;  2KKO A;  2MH2 A;  1LDK B;  2OU2 A;  5CLS A;  1P6R A;  5DEQ A;  1A04 A;  3L2C A;  3GFI A;  4ENM A;  4XRF A;  2ZME B;  1L3L A;  4AWX B;  1JE8 A;  2Y0M A;  5ICC A;  2MC3 A;  3MCZ A;  3ZMV A;  2H09 A;  2XRN A;  5HLG A;  4IPA A;  3ZN0 A;  2B0L A;  3E3V A;  2HTJ A;  1D5V A;  2EFO A;  2Q8K A;  1ZAR A;  3J7A O;  1LNW A;  3K2Z A;  4N9I A;  2XV4 S;  2QLZ A;  1J2X A;  2FU4 A;  2HKO A;  1ON1 A;  4I0A A;  2M1B A;  1FP1 D;  2ESN A;  2K4B A;  1K78 A;  3ZPL A;  3BPX A;  4I7H A;  4IF4 A;  1MZB A;  2VXZ A;  3F21 A;  3WTT C;  3WGI A;  2WWY A;  4AD9 A;  3J80 Z;  1OYI A;  4BAY A;  3WE3 A;  5F64 A;  3DFG A;  1FT9 A;  3P9C A;  2IVM A;  4Y15 A;  3PQK A;  4L5I A;  1K7A A;  1SD6 A;  2P8T A;  5F1R A;  1XMA A;  5KVR A;  2OAZ A;  4AVP A;  5DUK A;  4ZYH A;  3KP2 A;  3GEZ A;  1P4W A;  2Y48 A;  2VC0 A;  5CVJ A;  1SMY F;  1J5Y A;  5HDK A;  2Z33 A;  3TO7 A;  5D4R A;  2RC4 A;  5H6Q A;  3LQR A;  1B1B A;  1OMI A;  3CUQ B;  3L7W A;  4HDU A;  1IN4 A;  1W7P D;  4OMY A;  3EDP A;  1R5H A;  4A6E A;  1I1S A;  1WI9 A;  4M6Y A;  3RPU A;  1OYW A;  3FXQ A;  1BIB A;  1NHA A;  4BHP A;  2VBW A;  4L18 B;  3HYI A;  2PLY A;  1T6S A;  2PG4 A;  3F8C A;  4EM0 B;  1LDJ A;  2NAZ A;  5LEJ A;  5K5R A;  3HTS B;  1BC7 C;  4DNC A;  4KDP A;  3H3U A;  2DK8 A;  5ICG A;  5DD4 A;  1Q1H A;  3IWZ A;  1W7P B;  4A0Z A;  4I09 A;  5HS9 A;  2FNA A;  2H6C A;  2PEX A;  4O3M A;  1RZ4 A;  2HS5 A;  1KU9 A;  4ZZD A;  2CW0 F;  1ZG1 A;  3P7N A;  2WTE A;  1G4D A;  3ISP A;  2KIU A;  2M5W A;  4OIP F;  3D0S A;  5E1W A;  2IJL A;  1EH7 A;  2ISZ A;  3M7G A;  3J81 K;  1MDM B;  3F6V A;  4G6D A;  4HAM A;  4XLN F;  2K02 A;  2ZCW A;  1RNL A;  1SFX A;  4PZJ A;  4M9S A;  2L4A A;  4U0W A;  1XSV A;  2EFN A;  1FBQ A;  1WRJ A;  3GVA A;  4E70 A;  2FOK A;  1R23 A;  3U9G A;  1D8K A;  3HRM A;  1D8J A;  3ZMS A;  2BBY A;  3FMQ A;  3HOT A;  3IL2 A;  2NS0 A;  1R00 A;  4RAZ A;  2PI0 A;  1T0F A;  3H3Z A;  1ZRF A;  1JXS A;  3S2W A;  5CYV A;  4WWC A;  3V4G A;  1UHW A;  4YII A;  4F7Z A;  4D0P A;  3LST A;  4A0Y A;  1UCR A;  4EGY A;  2A6E F;  4M9Z A;  1HXD A;  4YFX F;  1O3T A;  1V3F A;  3MAJ A;  3IHU A;  1ULY A;  2FF4 A;  3LAP A;  3FM5 A;  4B8X A;  1UST A;  4YIF A;  1T39 A;  1HBX G;  1KYZ A;  3NEU A;  4CDG A;  4HA8 A;  3B02 A;  3WGG A;  2EV5 A;  2QVO A;  3JW4 A;  3GW2 A;  1KQ8 A;  5K5O A;  4BNC A;  4XSZ F;  1FYL A;  1SAX A;  3WTV C;  1BOA A;  5EEG A;  3CUQ C;  2GA2 A;  3R61 A;  1KGS A;  4RB3 C;  3RI4 A;  4RGX A;  2XHK A;  2STT A;  1WSU A;  4PDK A;  5DDG A;  4I0B A;  1HKS A;  3E6B A;  1OKR A;  3R0J A;  1ODD A;  4ESB A;  3DPT A;  1J7K A;  2RQP A;  1QZZ A;  4JQF A;  4I02 A;  2EFW A;  3WGH A;  3J80 K;  1B6A A;  1DPU A;  2GXG A;  1QNT A;  4YFK F;  5DUI A;  1R1V A;  4ZH4 F;  1SD4 A;  2NYX A;  2V1U A;  2L01 A;  1FYK A;  2EJR A;  1F9N A;  5AIQ A;  2VBZ A;  3QPT A;  3MWM A;  1BM9 A;  5DD8 A;  4UV8 A;  1HST A;  2ZNY A;  4HQM A;  4GGG A;  1YW8 A;  2HYG D;  3D5L A;  5LGN A;  1CF7 A;  4IVN A;  4G94 A;  1Z9C A;  3FZV A;  3FWE A;  1YS7 A;  3KP4 A;  1MJ9 A;  3I4P A;  3ABU A;  1D3Y A;  1TQI A;  3I59 B;  2IA0 A;  4P9U A;  4WXH A;  3DEU A;  4OMZ A;  1EV7 A;  3QU6 A;  4LMY A;  1E17 A;  4LLG F;  2DO7 A;  2HFH A;  4EM1 A;  1S29 A;  5EEH A;  2Y75 A;  2XRO A;  3WTS C;  5LEK A;  4BH9 A;  2VE8 A;  4LB6 B;  2KIM A;  2P7C B;  4U7D A;  2D2W A;  4L0Z B;  1DP7 P;  2P7V B;  3CDH A;  5L3C A;  1FX7 A;  4LK1 F;  1RI7 A;  4OU0 A;  1L0O C;  2UXX A;  2W24 A;  5A2Q K;  4GCV A;  3HSR A;  1HSJ A;  2IA2 A;  4Q47 A;  4AIJ A;  3T0Y A;  4LG0 B;  3ECH A;  2O61 A;  1C0W A;  2OZ6 A;  4LK0 F;  2PBI A;  2GQQ A;  1XCV A;  1IN6 A;  3LQQ A;  5CVV A;  4Q5S F;  3MQ0 A;  2Q2E A;  2RN7 A;  1BC8 C;  5D6F A;  5D5U B;  1I5Z A;  1SD5 A;  1TNS A;  5CJ9 A;  1FZP B;  1SMT A;  4U0V A;  3M1E A;  1PDN C;  1O3S A;  2STW A;  4S05 A;  5LRS A;  2YPR A;  3QU3 A;  4N9H A;  4ON0 A;  1ZRC A;  3C3W A;  5L3F A;  1IXR C;  2TDX A;  1W5S A;  4KUM A;  1YQA A;  4RGR A;  2YX4 A;  1F4K A;  1B59 A;  3I64 A;  3BRO A;  4P96 A;  1QBJ A;  3QRF F;  3E5Q A;  1TQP A;  2IT0 A;  3TO9 A;  3IRR A;  1ON2 A;  3G3Z A;  2BYV E;  2M8E A;  4L9J A;  2R3S A;  1FBS A;  3LFK A;  1S8N A;  3RDI A;  2BE5 F;  3PFI A;  1REP C;  2LKP A;  2UXN A;  3V7S A;  4U7B A;  4M9X A;  1S7O A;  2DT5 A;  2QQA A;  2QZ8 A;  3WU1 B;  1HKT A;  1XN7 A;  5BS6 A;  2OA4 A;  1UHM A;  1P2F A;  4HQE A;  4EJW A;  1U5T B;  3F22 A;  3E5U A;  3TDZ C;  2D45 A;  3K69 A;  3T5X A;  2L4M A;  2QQ9 A;  1S7A A;  3RTR A;  4HOB A;  3U2R A;  1USS A;  4GXO A;  1LB2 A;  4EJO A;  4I2O A;  4PCQ A;  3JSP A;  2DU9 A;  5DYM A;  2EFQ A;  4MHG A;  2F5F A;  2NNY A;  2DW4 A;  4G6Q A;  3BDD A;  5LRR A;  1ZLJ A;  4KNY A;  4IRH A;  2UZK A;  1GVJ A;  4BXU A;  3TQN A;  2Z9O A;  2VOP A;  3WTW C;  2V1D A;  5HOO A;  4K2E A;  4O5V A;  4LB5 A;  1FLI A;  4FHT A;  4MEY F;  3KP5 A;  2V79 A;  3ELK A;  1O3Q A;  2L54 A;  2FQ3 A;  5FFX A;  2IW5 A;  1FC3 A;  2P5V A;  1F5T A;  2XAH A;  3K0L A;  3L00 A;  1TBX A;  3GZ5 A;  2Z99 A;  1IN8 A;  4L9V A;  5J6X A;  3W6K B;  1HW5 A;  4L9T A;  2IP2 A;  2H27 A;  3M9A A;  4R79 A;  1LQ1 A;  2JPB A;  2FE3 A;  1XB4 A;  1ZRD A;  4MGR A;  1YW7 A;  5L3B A;  3OOP A;  2FBI A;  4A2U A;  4UVA A;  3GF2 A;  5JHU A;  2ISY A;  4B09 A;  2HR3 A;  4UVC A;  2EV6 A;  1CGP A;  2E7W A;  5HDG A;  4XSX F;  3N97 A;  1YTY A;  5L3E A;  2FNP A;  2XAQ A;  3HRU A;  3F8N A;  3SXY A;  4P55 A;  3V8L A;  4M72 A;  5ERI A;  1PUE E;  2VN2 A;  1U6G A;  2RGV A;  4KYW A;  4R1H A;  3RJP A;  4UHT A;  2ESH A;  3IRQ A;  4KIG A;  4RS8 A;  3E6C C;  1T2K A;  3COA C;  2F5C A;  1ZLK A;  1I6X A;  4CXF A;  2ZBK A;  1IRG A;  2LF8 A;  2XVC A;  3O3K A;  2YSR A;  5FB2 A;  2ADU A;  2F2E A;  2YR2 A;  1LDD A;  3B73 A;  1YO5 C;  2Z5U A;  3C1D A;  1ZN2 A;  4U0Y A;  2XGX A;  4EQQ A;  3U1D A;  5FD6 A;  3FX3 A;  3JTH A;  4ENN A;  5AIP A;  5FFZ A;  3ZMT A;  1P4X A;  2ZME A;  4IHT A;  3I58 A;  1SFU A;  1U5T C;  2EA2 A;  4P9F A;  1IXS B;  4ZYD A;  1FYM A;  2GWR A;  3HIF A;  1E2X A;  1R5G A;  3N4M A;  1ZHF A;  3AAF A;  2DQL A;  2EWN A;  1P92 A;  5BQT A;  2A69 F;  2JPC A;  3BPV A;  3K1P A;  1KU3 A;  2JZY A;  4M74 A;  2HKX A;  2W25 A;  3MFK A;  1KQ9 A;  4OIQ F;  3KP7 A;  3Q9S A;  5IT3 A;  2QBY B;  4WK8 F;  4L0Y B;  5FGM A;  1QO0 D;  1R1U A;  2V9V A;  1BI3 A;  2JT1 A;  3GZ6 A;  4G7O F;  2F5D A;  2H6B A;  5H20 A;  4Y17 A;  3WTX C;  2P6S A;  2OD5 A;  1J75 A;  1IN5 A;  3KEQ A;  1IUY A;  2XAG A;  1ONV A;  3K1N A;  4HLX A;  2OQG A;  3K9T A;  2CYY A;  3CLO A;  3H92 A;  1GXP A;  4EJT A;  4KT5 C;  5D5X B;  3T8T A;  2GAU A;  2ELH A;  4HYE A;  3CUQ A;  3P9K A;  1JGS A;  3JTG A;  4CIC A;  4HW0 A;  2FEZ A;  2Q0O A;  3NRV A;  4OIR F;  3SZP A;  2HOE A;  4KA4 A;  3JAM Z;  3BJ6 A;  2XKO A;  4WF2 A;  1FSH A;  3KFW X;  2BGC A;  2EK5 A;  4CO8 A;  5BPI A;  3R60 A;  3HUG A;  3E6M A;  3DKW A;  5DCM B;  3LA3 A;  1P4A A;  4YG2 F;  3KLO A;  3L09 A;  2QEN A;  1MJA A;  1W7P A;  4HV6 A;  1FPQ A;  1FOK A;  1HW1 A;  1OR7 A;  1B4A A;  4RB0 A;  1ZGA A;  3ULQ B;  2FSW A;  1TNT A;  1MJB A;  1YFH A;  1LVA A;  2VC1 A;  3JSO A;  4AIH A;  1O7L A;  1IAW A;  2V6C A;  3BY6 A;  1FBU A;  1MKM A;  4I01 A;  4LGW A;  1FSE A;  1IF1 A;  3ZMU A;  1FWZ A;  5ILU A;  4ASN A;  1TQM A;  5JR3 A;  1MDM A;  5BMZ A;  4KMU X;  5E8G A;  4RB1 A;  2GA1 A;  3NQO A;  5E1Z B;  5FLX Z;  2A3S A;  1FY7 A;  2FMY A;  1Z91 A;  1I1G A;  2OBP A;  1ZH5 A;  3RKX A;  2LSO A;  2OQR A;  1BI0 A;  3TOB A;  2C6Y A;  2MBF A;  3BWG A;  4L5J A;  3F8F A;  3ROU A;  2PJP A;  2IA1 A;  1Z1D A;  3ZMD A;  1U78 A;  1G3W A;  3FXR A;  5BPD A;  2FBK A;  1YG2 A;  1XDS A;  3VOD A;  1UB9 A;  5L3D A;  1IN7 A;  3SFZ A;  4G9Y A;  2WC2 A;  3EYI A;  2DAO A;  5ICF A;  1R1T A;  3MZH A;  3KP6 A;  3Q9V A;  4AIK A;  2VOO A;  3GFJ A;  1EH8 A;  1O57 A;  2PQ8 A;  2O6G E;  3WTY C;  5HLH A;  3MZY A;  1Z6R A;  3WTZ A;  1AWC A;  3SQN A;  2CFX A;  2FRH A;  2PN6 A;  3TKY A;  4FX4 A;  5HDN A;  2CO5 A;  3KLN A;  1Z05 A;  1XMK A;  3QP5 A;  2D1H A;  3IC7 A;  2CWE A;  4KIB A;  4G7Z F;  2HGC A;  5ILV A;  1X3U A;  2J5P A;  2E1C A;  2K4J A;  4GO1 A;  4RB2 C;  2XUB A;  3KE2 A;  4JK1 X;  2GIV A;  3EET A;  2MD5 A;  5CVI A;  1VTN C;  2ZXJ A;  1J59 A;  4S04 A;  6PAX A;  3BZ6 A;  5ICE A;  3I5U A;  2A6H F;  3GXO A;  4HF2 A;  2DLL A;  4MQV A;  3CO7 C;  2P5K A;  1WWX A;  3GYH X;  5AON A;  3HRT A;  4CZZ A;  1V4R A;  5H6R A;  3WU0 A;  1J9I A;  2DBB A;  2HDC A;  1LJ9 A;  4HLY A;  4BHB A;  1FNN A;  4XBF A;  3TGN A;  4HZF A;  4IRG A;  5J8C A;  1RIO H;  1G3T A;  2LF7 A;  4IJA A;  2K86 A;  1JHF A;  1T38 A;  5D4S A;  1S6L A;  1K78 B;  2PMH A;  3DXJ F;  1GXQ A;  4I98 B;  2VBX A;  3C18 A;  4IHS A;  2PFB A;  5HLI A;  5FO5 A;  2CQK A;  4EJV A;  1DPR A;  5E17 F;  5BOX A;  2JTV A;  2OZU A;  2W84 A;  2DFI A;  4N0B A;  3F8B A;  3I59 A;  4WX9 A;  4MQ9 F;  2FA5 A;  2XAF A;  4EGZ A;  3WTU C;  3GFM A;  2MLK A;  5JI6 A;  2HTS A;  4P5O A;  5DV5 A;  1XDU A;  2AS5 F;  3L9F A;  1MGT A;  4WXD A;  3F23 A;  3MEX A;  5FD5 A;  3V7C A;  3VEP A;  2DK5 A;  5D5W B;  3R0A A;  2KRF A;  1XGS A;  3VOE A;  3RYR A;  1UFM A;  1DUX C;  1ZG3 A;  2R7F A;  3I71 A;  3C7J A;  2DTR A;  3I53 A;  4PGH A;  3IWF A;  3P9I A;  1B9N A;  2M87 A;  2MH9 A;  2L02 A;  3SZT A;  1W5T A;  2E7X A;  5IT9 Z;  3TDU C;  4ESF A;  2A61 A;  4LG0 A;  4EJU A;  3R6S A;  1SFE A;  3ZN1 A;  3CTA A;  5ILS A;  2MLG A;  5FLX K;  4HDV A;  3HSE A;  4ESJ A;  3ZMZ A;  5KK1 A;  3M8E A;  3HRS A;  3ABT A;  4KFC A;  4IXA A;  2K7L A;  1BIA A;  2GZW A;  4Q4Z F;  2HWV A;  4MTD A;  1KU7 A;  3TOA A;  2QQB A;  2EA4 A;  3DP7 A;  3E6D A;  3F72 A;  4M71 A;  3RKW A;  3PQJ A;  5E20 A;  5ED4 A;  2BV6 A;  3DF8 A;  2CSO A;  4A12 A;  1IXC A;  3VB2 A;  1YW9 A;  4UXN A;  3LA7 A;  4CHU A;  4HX4 A;  2G9W A;  2AXL A;  4ZZL A;  1BJA A;  3DV8 A;  2LNB A;  5HS7 A;  3K1M A;  1IW7 F;  1QQI A;  3KP3 A;  5LGT A;  4KN7 X;  1PP7 U;  2J5O A;  2XIG A;  1FP2 A;  1LEA A;  2W85 A;  3EQL F;  3Q5F A;  1W4M A;  4NHJ A;  1K6O A;  3OV8 A;  2VON A;  4JBA A;  2O0Y A;  4H0E A;  1WKM A;  1KU2 A;  1H9T A;  1U5T A;  1R22 A;  4KIF A;  3GO5 A;  3RPQ A;  2QM3 A;  4NB5 A;  2XKP A;  1BN5 A;  1KYW A;  5D8K B;  4LFU A;  3GX4 X;  5TRD A;  1RUO A;  1YLF A;  5JVT A;  3IKT A;  1B9M A;  3BJO A;  2O8X A;  2RNJ A;  2COM A;  3W6J B;  2EB7 A;  3QP6 A;  1JHH A;  5LHI A;  5F6F A;  4XLP F;  3FHZ A;  4Y13 A;  3GUD A;  2HZT A;  2M45 A;  1ZGJ A;  2V1X A;  2IRF G;  1H9G A;  1EH6 A;  3FF5 A;  4KMF A;  3G73 A;  2RVC A;  5LLQ A;  2KIF A;  1MD0 A;  1R36 A;  1R58 A;  5JFR A;  5D6E A;  4EVI A;  4OIN F;  2MA3 A;  5LHG A;  5A2Q Z;  4A0X A;  5E18 F;  1Z7U A;  4HX7 A;  2FML A;  1TW2 A;  1TLH B;  4A5M A;  3V8J A;  2P6T A;  4UV9 A;  5K1Y A;  2DQR A;  4HV5 A;  4MTE A;  4EM2 A;  3FM3 A;  4ZYE A;  3LA2 A;  1YYV A;  2HQR A;  5LBQ A;  3GWZ A;  1CF7 B;  2A5Y B;  3BOQ A;  3ML6 A;  1YIO A;  4QWQ A;  2P5L C;  2XAJ A;  1XD7 A;  2ZJ2 A;  1S3J A;  1ZG5 A;  3KZZ A;  1XGO A;  3REO A;  1I27 A;  4L9N A;  4KIC A;  3IKV A;  4DQ2 A;  1QPM A;  1XCB A;  2KJB A;  3LAJ A;  2CG4 A;  2DI3 A;  5IT9 K;  4Z2Y A;  4G8X A;  5HS8 A;  1KQ0 A;  2QUF A;  2RV8 A;  1SD7 A;  2HQN A;  3HHG A;  4UVB A;  3RKY A;  3I0T A;  1GHC A;  3CJN A;  2NRA C;  5E8I A;  2CGP A;  2K27 A;  2JSC A;  1IRF A;  2QWW A;  2NNN A;  5HVQ C;  1Z6T A;  3E5X A;  1QGP A;  3BP8 A;  4UNO A;  1BBY A;  1HQC A;  4LJZ F;  4M73 A;  4CYD A;  4WCG A;  1HKQ A;  3EUH A;  3ZP5 A;  2ZKZ A;  1F1Z A;  5D5V B;  1QZY A;  2KJC A;  4QLC U;  2ZO4 A;  2VE9 A;  2QYO A;  3I54 A;  3O6B B;  1STZ A;  1ZYR F;  2FXA A;  3QAH A;  3GLX A;  4HF1 A;  3RIR A;  2X0L A;  3KET A;  2QBY A;  1G6N A;  1U2W A;  2IPQ X;  4FX0 A;  1G3Y A;  2ETH A;  3RYP A;  2VBY A;  4FT8 A;  4ENK A;  2DPD A;  3QPH A;  1G3S A;  4ETS A;  3GFL A;  2RKH A;  4HX8 A;  3BJA A;  5DCF A;  2ZNZ A;  2A07 F;  1O7F A;  3WOD F;  1BI1 A;  4HBL A;  1ZAO A;  3V8K A;  3HTU A;  4EV0 A;  3V7R A;  2FBH A;  4GYI A;  1U8R A;  2GXB A;  2WV0 A;  4HF0 A;  2W57 A;  4MNU A;  4Q48 A;  3T1B A;  2EV0 A;  2YX7 A;  3HHH A;  3WG9 A;  2G7H A;  1YS6 A;  4A6D A;  3FMS A;  3SHF A;  1LEB A;  4NQW A;  3F3X A;  2LDU A;  4RGS A;  2DPU A;  1ZRE A;  2VT3 A;  1TTY A;  3LWF A;  4ZYG A;  2Z3Y A;  3CO6 C;  1TW3 A;  5CVU A;  2X4H A;  3KCC A;  5J8F A;  2A68 F;  4U88 A;  5DCM A;  1HW2 A;  4M6X A;  4RAY A;  3O2P E;  3TO6 A;  1XSX A;  4EMS A;  3ECO A;  4G7H F;  4OIO F;  2ZFW A;  4YFN F;  2M30 A;  2F5E A;  1BI2 A;  3F8M A;  3KZY A;  4GYG A;  2D1V A;  1Y0U A;  2VT2 A;  1DDN A;  4TV7 A;  2O03 A;  1PP8 F;  1H0M A;  3HOS A;  3ERE D;  4WXC A;  3VFZ A;  2EFP A;  4LD5 A;  4BYY A;  5L3G A;  2G7U A;  4MEX F;  1XGN A;  3HSF A;  1U3E M;  5LHH A;  2JRT A;  4LLN A;  3EYY A;  4ENJ A; 
#chains in the Genus database with same CATH topology
 1J0R A;  4BHC A;  1OPC A;  2W48 A;  4A3L J;  3WE2 A;  3OY9 A;  1H89 C;  2VOD A;  4O6J A;  3CUO A;  2ACJ A;  1WJA A;  5TJJ A;  3CCV I;  5EG0 B;  3BR1 A;  2JA5 J;  1YJN I;  1KA8 A;  1XSD A;  4A5N A;  3DQV C;  1YJW I;  5F0C A;  2HEO A;  3F6O A;  2L3D A;  1WQ2 A;  2VKD A;  2CQX A;  4PJM A;  4OOI A;  3VYT B;  2R93 J;  2UWM A;  3DLL F;  1D0X A;  2VQL A;  3T8R A;  1MMA A;  1Y6I A;  3BG9 A;  3QOP A;  4KN4 X;  3RQ4 A;  4LLL A;  4BGD A;  4BDY A;  3M8F A;  2R7D A;  3R4K A;  1PJR A;  3EUK L;  5IYC J;  1JKO C;  3HPG A;  1UG0 A;  3VYU B;  2R5Z A;  2DOF A;  1I6H J;  1POG A;  1ETY A;  3J81 Z;  3JAM K;  2CW8 A;  4BU2 A;  3TW7 A;  4BDZ A;  2M4K A;  3JCU C;  5CVR A;  3S3N A;  3JRG A;  1SAU A;  1IZ1 A;  5LGU A;  2H94 A;  5IP7 J;  3DTI A;  3DPL C;  4R8H A;  3KEO A;  3LMM A;  2E35 A;  1OYY A;  2UV1 A;  4PGG A;  5JLW A;  4E7L A;  3BZC A;  5D8L B;  2O3F A;  3OYG A;  1JTY A;  4IRI A;  3QOE A;  1IRX A;  2YU3 A;  4CGZ A;  5IYD J;  1GLN A;  1T98 A;  2UUZ A;  3V42 A;  3M07 A;  5GTI C;  1Z0X A;  1O3R A;  1R7J A;  1A36 A;  5J4V A;  4E7J A;  2Y0S N;  1XGM A;  4XLA A;  1RUN A;  3OSF A;  1K79 A;  2EZK A;  3OS2 A;  2KP6 A;  3FXU A;  1SC7 A;  2ELK A;  2KFD A;  2QSF X;  3L1P A;  4BQA A;  3S1N J;  2PMU A;  2BEO A;  3FMR A;  4RAF A;  5E1X A;  2P4W A;  5K5Q A;  3ZQ7 A;  2HYF A;  2DDA A;  4RGU A;  1AOY A;  2E1N A;  3E97 A;  2HPM A;  2RDP A;  4UUV A;  4NC8 A;  2XAS A;  3BR2 A;  2KKO A;  2MH2 A;  3FIS A;  1LDK B;  2OU2 A;  2K9L A;  5CLS A;  2D5V A;  5B66 C;  1P6R A;  2ECC A;  1MBE A;  5DEQ A;  3W2A A;  1HOM A;  4XM3 A;  3CLQ A;  4B44 A;  2X1D A;  1YI2 I;  1S72 I;  3PL8 A;  1A04 A;  3L2C A;  3GFI A;  3S3O A;  1BR1 A;  4ENM A;  4XRF A;  1D1B A;  5GAD J;  4JX4 A;  5F08 A;  3PSI A;  3QQA A;  2K9S A;  2W82 A;  2WAQ A;  2W7N A;  2ZME B;  1L3L A;  4AWX B;  1JE8 A;  3TP0 A;  3K10 A;  4HNT A;  3SFI A;  2Y0M A;  3GTQ J;  1JUM A;  5ICC A;  3G1O A;  2MC3 A;  3MCZ A;  4E6K G;  2LRE A;  4C2T A;  2KQR A;  3PO2 J;  3ZMV A;  2JQ7 A;  2H09 A;  3SJM A;  2XRN A;  2ZSI B;  2YUS A;  5HLG A;  4IPA A;  3ZN0 A;  4KIT B;  2B0L A;  3E3V A;  4AM3 A;  1QU3 A;  3C2G A;  3B6C A;  3BC8 A;  2PJR B;  4IEJ A;  4F92 B;  2HTJ A;  2LBF A;  1D5V A;  2EFO A;  2IS6 A;  3CF2 A;  2Q8K A;  2LY1 A;  3DKY A;  3G71 I;  2VQG A;  2WAF A;  2CUJ A;  2JSP A;  5M5Y J;  1ZAR A;  3U21 A;  1Y56 A;  5K7F A;  3J7A O;  4OAY A;  1LNW A;  3K2Z A;  1WJC A;  4N9I A;  5F0H A;  2XV4 S;  3A03 A;  2QLZ A;  3DKX A;  1J2X A;  3ABM H;  2FU4 A;  2HKO A;  1ON1 A;  4I0A A;  2E34 A;  1W36 D;  2M1B A;  3K4J A;  4RAG A;  1FP1 D;  2ESN A;  2K4B A;  1K78 A;  3ZPL A;  2RNG A;  3BPX A;  4I7H A;  4IF4 A;  1MZB A;  2VXZ A;  3OYM A;  3F21 A;  3WTT C;  1QVU A;  2E5N A;  3WGI A;  3HOU J;  3S14 J;  3F0C A;  3SYT A;  4AD9 A;  3J80 Z;  2WWY A;  1OYI A;  4BAY A;  5M5W J;  3WE3 A;  4I6Z A;  2L9V A;  5E79 C;  5F64 A;  4KIS A;  3ZGK A;  3DFG A;  3BG6 A;  1FT9 A;  3BG3 A;  3P9C A;  4EEF G;  3H36 A;  3IH3 A;  1OCP A;  2IVM A;  2Y9Z A;  4Y15 A;  2K9M A;  3PQK A;  1Y8R B;  4L5I A;  4XOP A;  1K7A A;  3VYR B;  1SD6 A;  2P8T A;  5F1R A;  1XMA A;  5KVR A;  4N4O B;  3HKZ A;  2OAZ A;  4AVP A;  4FIS A;  5DUK A;  4ZYH A;  3KP2 A;  3GEZ A;  1P4W A;  2Y48 A;  3CCU I;  2VC0 A;  3K2A A;  3G4S I;  5CVJ A;  1SMY F;  4AVZ A;  1J5Y A;  2NS8 A;  5HDK A;  1MW7 A;  3TO7 A;  2Z33 A;  2MGQ A;  5D4R A;  2RC4 A;  5H6Q A;  2ZJR F;  3LQR A;  1B1B A;  1OMI A;  2OCC H;  3CUQ B;  3Q0U A;  3L7W A;  4HDU A;  1IN4 A;  1W7P D;  4OMY A;  3EDP A;  5FRN A;  2CUE A;  2LP0 A;  3OYB A;  2ZXH A;  1R5H A;  4A6E A;  1I1S A;  1V54 H;  2VL8 A;  1V5F A;  1WI9 A;  4A3J J;  4M6Y A;  3OYC A;  3RPU A;  3MKZ A;  2KDO A;  3K4M A;  3JRD A;  2JA6 J;  1WJ5 A;  2L7M P;  1OYW A;  3FXQ A;  1LVK A;  1BIB A;  1NHA A;  4BHP A;  2V7F A;  2DCE A;  2VBW A;  4L18 B;  2KIS A;  4NC6 A;  3HYI A;  2PLY A;  3HUG B;  1T6S A;  3H3V K;  1R6R A;  5KAI C;  4ITV A;  2PG4 A;  3F8C A;  5FKK A;  4EM0 B;  5CPR B;  3DLA A;  1R4M B;  1LDJ A;  4XKV A;  4JP0 A;  2NAZ A;  5LEJ A;  3LSP A;  3S2D J;  3BTJ A;  3H0G J;  5K5R A;  2OV7 A;  3QPS A;  3HTS B;  1BC7 C;  4DNC A;  4KDP A;  3CJR B;  2CMP A;  3H3U A;  2XAU A;  3CME I;  3RCO A;  1I3A A;  2FQ4 A;  2DK8 A;  5ICG A;  1LE8 A;  5DD4 A;  1FEX A;  1Q1H A;  3IWZ A;  3CCQ I;  1G59 A;  1W7P B;  4A0Z A;  1P7I A;  2DMT A;  4I09 A;  4IQ4 A;  2FUG 2;  5HS9 A;  2E36 A;  2FNA A;  2H6C A;  5FJ8 J;  2PEX A;  2VKV A;  4O3M A;  1RZ4 A;  1Y1V J;  4CSW A;  2HS5 A;  3PIO F;  1KU9 A;  4C2M J;  2LRD A;  2H1L A;  3TMO A;  2M0C A;  4M3D A;  4ZZD A;  2L0K A;  2CW0 F;  4A3C J;  2W4S A;  1ZG1 A;  3A01 A;  1WJD A;  3P7N A;  2ZME C;  2WTE A;  1VF9 A;  4FQG A;  1G4D A;  3HOX J;  3ISP A;  3H1C A;  2KIU A;  2M5W A;  3QWL A;  4OIP F;  3D0S A;  1M1E B;  4D5C A;  5E1W A;  2HXI A;  1EH7 A;  2IJL A;  2ISZ A;  4KA4 A;  1MBG A;  3M7G A;  3J81 K;  2R0Q C;  4C2U A;  2KRH A;  3K4C A;  1MDM B;  3F6V A;  4G6D A;  1OCC H;  4HAM A;  4XLN F;  2K02 A;  2JUG A;  2ZCW A;  1VQ4 I;  1RNL A;  1SFX A;  4PZJ A;  4M9S A;  2VQC A;  2L4A A;  3W3C A;  3NAR A;  4U0W A;  1XSV A;  2EFN A;  1FBQ A;  1WRJ A;  3GTM J;  1P7J A;  3GVA A;  2ICW G;  1NTC A;  4E70 A;  2FOK A;  1R23 A;  3HGY A;  3U9G A;  2K9Q A;  1D8K A;  4BAC A;  4G6T B;  3M3Y J;  1RR8 C;  3HRM A;  1D8J A;  3ZMS A;  2BBY A;  3A4C A;  3FMQ A;  2DA1 A;  1XG1 A;  3LSJ A;  3HOT A;  3IL2 A;  2NS0 A;  2JA2 A;  3FXM A;  1ETX A;  1R00 A;  3CCY A;  4RAZ A;  1K6Y A;  1KON A;  2CFO A;  3BR5 A;  1T0F A;  2XPW A;  3H3Z A;  3MKW B;  2PI0 A;  2AHQ A;  3FK6 A;  1ZRF A;  1JXS A;  2VPR A;  3A02 A;  3S2W A;  2F5V A;  5CYV A;  4WWC A;  1OCO H;  4NUB A;  1UHW A;  3V4G A;  1VQM I;  3TW6 A;  4YII A;  4F7Z A;  4D0P A;  2XF6 A;  1ETV A;  3LST A;  1YE9 A;  2CUZ A;  4A0Y A;  1UCR A;  4CCM A;  4EGY A;  1VFC A;  2A6E F;  4M9Z A;  4DJA A;  4CA0 A;  1XTA A;  2X85 A;  3OSG A;  3Q0W A;  1HXD A;  2NVT J;  1R4N B;  4YFX F;  1O3T A;  1V3F A;  3CCS I;  3MAJ A;  2KL4 A;  1TZL A;  3IHU A;  1ULY A;  2FF4 A;  3LAP A;  3FM5 A;  1I3Q J;  4PSW A;  3K4K A;  2NOJ B;  3TBI A;  1UST A;  4B8X A;  2DMP A;  4YIF A;  1T39 A;  1HBX G;  1KYZ A;  2O9L A;  2A05 A;  3NEU A;  3GZN B;  4CDG A;  4HA8 A;  3K4L A;  3B02 A;  3WGG A;  4MIM A;  2EV5 A;  3LL7 A;  2WY8 Q;  2R7X A;  2QVO A;  3JW4 A;  3GW2 A;  1KQ8 A;  1DU0 A;  4XQF A;  5K5O A;  1SFK A;  2B9S A;  4BNC A;  4XSZ F;  2LFB A;  1SAX A;  3WTV C;  1FYL A;  4OWR B;  1BOA A;  5EEG A;  1LFB A;  4V2F A;  2XGE A;  1DQU A;  3CUQ C;  1W36 C;  2GA2 A;  3ZQF A;  3K6G A;  1QRY A;  3R61 A;  1KGS A;  3FXK A;  4RB3 C;  3MMY B;  3QYB A;  3RI4 A;  1SVM A;  3PUF A;  4AC0 A;  1Q1V A;  3PIP F;  3M4O J;  2IGN A;  4RGX A;  1UG2 A;  3FBN B;  2XHK A;  5JVG F;  4I99 C;  2KDZ A;  2K5C A;  3ZR8 X;  2STT A;  1WSU A;  1PUF A;  4PDK A;  5DDG A;  4I0B A;  1HKS A;  3E6B A;  1OKR A;  3R0J A;  1ODD A;  2X51 A;  4ESB A;  4RLF A;  1MMG A;  2F6C A;  1FIP A;  3DPT A;  3HG9 A;  2R7U A;  3KYL A;  4M3G A;  5FLM J;  1J7K A;  2RQP A;  1QZZ A;  3JRF A;  4JQF A;  2IS4 A;  4Z6Y A;  1X3Z B;  2DA2 A;  2HU9 A;  4I02 A;  2ZB9 A;  2EFW A;  3WGH A;  3J80 K;  1VQO I;  3ASO H;  1B6A A;  2VAS A;  1DPU A;  5FRO A;  1ZTR A;  2GXG A;  1QNT A;  4YFK F;  5DUI A;  1R1V A;  1RR7 A;  4ZH4 F;  1SD4 A;  2NYX A;  2MD0 A;  1T33 A;  1GV2 A;  2MC4 A;  2LR8 A;  4PSX A;  5J40 A;  1OR7 C;  2F4M B;  2V1U A;  2L01 A;  1OFC X;  3BR6 A;  4XOR A;  1FYK A;  3MZ8 A;  2EJR A;  1BR4 A;  3ZQQ A;  3I56 I;  1F9N A;  5AIQ A;  3VWB A;  4BQO A;  2VBZ A;  4JX6 A;  3DBR B;  5EF6 A;  5GAG J;  3QPT A;  3MWM A;  1BM9 A;  5DD8 A;  1WH7 A;  2WY7 Q;  4UV8 A;  2PX9 A;  1LFU P;  1N25 A;  1HST A;  2ZNY A;  4HQM A;  4GGG A;  1YW8 A;  2HYG D;  3D5L A;  5LGN A;  1CF7 A;  4F52 A;  4ZJZ A;  5M3F J;  1W0U A;  4IVN A;  4G94 A;  3EPZ A;  4D1Q A;  2HPI A;  2LTP A;  1Z9C A;  3FZV A;  3PJR A;  2W1O A;  3FWE A;  1YS7 A;  2LYC A;  3KP4 A;  4C9Y A;  1MJ9 A;  3I4P A;  3ABU A;  2EQR A;  1D3Y A;  1TQI A;  3I59 B;  3CP8 A;  3KYC B;  2IA0 A;  2JK3 A;  4PUS A;  3J7Y J;  1B72 A;  1BW5 A;  1WHU A;  2OJE D;  4P9U A;  4WXH A;  3DEU A;  3LSH A;  1TWH J;  2CQN A;  3JRB A;  4OMZ A;  1ITY A;  1EV7 A;  4QSH A;  3QU6 A;  2M2E A;  2K3P A;  4A93 J;  4LMY A;  1E17 A;  4LLG F;  1X1B A;  2DO7 A;  1V5G A;  1X1D A;  2OCE A;  1JI8 A;  2HFH A;  4EM1 A;  3S15 J;  2EZI A;  1S29 A;  2IEK A;  5EEH A;  2Y75 A;  4CH7 A;  1VQ7 I;  3CCE I;  3FKI J;  2XRO A;  3WTS C;  5LEK A;  1UAA A;  4BH9 A;  2NVY J;  2VE8 A;  4LB6 B;  2KIM A;  3DU5 A;  1Z21 A;  1F43 A;  4BJ6 C;  3S1Q J;  5FKL A;  2P7C B;  4U7D A;  2D2W A;  4L0Z B;  2DT6 A;  2HVR A;  3OWT A;  1DP7 P;  2P7V B;  1APL C;  3CDH A;  4Y33 A;  4UUS B;  4PFP A;  5L3C A;  3OYD A;  2DA7 A;  1MSF C;  3I4N J;  1FX7 A;  1ZK8 A;  1QVT A;  2VIX A;  4LK1 F;  4OAZ A;  5HLT A;  1RI7 A;  4OU0 A;  1NK3 P;  2OTJ I;  2IXS A;  1L0O C;  2UXX A;  3LOC A;  1Z3Y A;  4HG2 A;  2W24 A;  3BCA A;  2XGC A;  1EF4 A;  5A2Q K;  1K83 J;  3ZQI A;  3EUA A;  4GCV A;  5IP9 J;  3AG4 H;  3HSR A;  1AA7 A;  1HSJ A;  2IA2 A;  4D7N A;  1H8A C;  2E5Z A;  4BS9 A;  3JRH A;  4Q47 A;  4AIJ A;  4G12 A;  2LLK A;  3T0Y A;  4N4N B;  3S1R J;  3S17 J;  2CJJ A;  4LG0 B;  2WAQ N;  3A2K A;  3ECH A;  2M34 A;  1X4O A;  2DA3 A;  2OC6 A;  2O61 A;  2DJI A;  2NS7 A;  3CMY A;  2R7T A;  1RKT A;  1C0W A;  2Z2S B;  2OZ6 A;  4LK0 F;  2PBI A;  4JOM A;  1VQ9 I;  4C3H J;  3L2R A;  1JUP A;  4BJT A;  2GQQ A;  1XCV A;  2DA4 A;  4FET A;  5C44 J;  1A6Q A;  1IN6 A;  3LQQ A;  4DYC A;  1VQK I;  3S16 J;  5CVV A;  4Q5S F;  3MQ0 A;  2NXN B;  2Q2E A;  3HJE A;  4XMY A;  2RN7 A;  1BC8 C;  5D6F A;  5KCM A;  4C3J J;  5D5U B;  1I5Z A;  1YRN B;  1SD5 A;  3O8G A;  1TNS A;  2EIM H;  5CJ9 A;  4IOC F;  1B8I A;  1FZP B;  3TL4 X;  2TCT A;  5HNF A;  2COB A;  1SMT A;  3DU6 A;  4U0V A;  3M1E A;  1PDN C;  1O3S A;  2WAD A;  2STW A;  4S05 A;  2XF5 A;  3S8P A;  5LRS A;  2YPR A;  3QU3 A;  2FX0 A;  4ZDO A;  4IOA F;  4N9H A;  4ON0 A;  1IGN A;  1OLT A;  1ZRC A;  3C3W A;  1VQ8 I;  1MBK A;  4M3B A;  3U1K A;  1W0T A;  3BR0 A;  2LVS A;  5L3F A;  1OJL A;  2DYS H;  1IXR C;  3HZJ A;  2H8R A;  3HPH A;  2TDX A;  1W5S A;  1UEL B;  4HRI A;  4A3G J;  2EIN H;  3DBL B;  5M3M J;  4KUM A;  4XLF A;  1MIJ A;  1YQA A;  4RGR A;  5B3S H;  2YX4 A;  1F4K A;  1B59 A;  3ABL H;  3I64 A;  1JT6 A;  3BRO A;  4P96 A;  4IQJ A;  1QBJ A;  2HNH A;  4X1E A;  5F0F A;  3QRF F;  3E5Q A;  1TQP A;  2V26 A;  1TWF J;  2BZT A;  2M4G A;  2IT0 A;  3TO9 A;  3IRR A;  4RM2 A;  1IDZ A;  3VYS B;  1JJ6 C;  2GOM A;  1ON2 A;  2V9K A;  1U9O A;  3G3Z A;  5KHD A;  2Q1Z B;  2HOA A;  1TWA J;  2BYV E;  2BHZ A;  2ELJ A;  2M8E A;  4MFD A;  4L9J A;  2R3S A;  3LSM A;  3HM5 A;  5IPA A;  1LPQ A;  2IGK A;  1X3W B;  1XX5 A;  1JGG A;  1RES A;  3BTL A;  2AXT C;  5J47 A;  1FBS A;  2EIL H;  2BY3 A;  2M9H A;  2ME0 A;  3LFK A;  1S8N A;  3RDI A;  3AKZ A;  2BE5 F;  3PFI A;  1REP C;  2LKP A;  1ZQ3 P;  3HKZ N;  3BG5 A;  5BNG A;  1V5E A;  2UXN A;  3V7S A;  4U7B A;  4M9X A;  1S7O A;  2DT5 A;  2QQA A;  2QZ8 A;  3QOD A;  1A35 A;  3N05 A;  4RDU A;  3WU1 B;  1HKT A;  1XN7 A;  1A5J A;  3MD2 A;  2BOL A;  2ZC2 A;  1Y39 A;  5BS6 A;  2OA4 A;  1UHM A;  3MKY B;  1P2F A;  3GTG J;  2DOD A;  4HQE A;  4EJW A;  1U5T B;  4BEH B;  4QIW N;  3E5U A;  3F22 A;  3TDZ C;  2D45 A;  4BXF A;  2E2J J;  3S93 A;  1WCM J;  1WVR A;  3K69 A;  3T5X A;  4E7H A;  2L4M A;  1JKR C;  2QQ9 A;  1S7A A;  1I39 A;  3RTR A;  4HOB A;  3OYN A;  3U2R A;  1USS A;  4GXO A;  4MO7 A;  4A69 C;  4BL0 B;  1LB2 A;  4EJO A;  4RA2 A;  4I2O A;  2GBY A;  4PCQ A;  3JSP A;  2DU9 A;  2ID6 A;  5DYM A;  2EFQ A;  4MHG A;  2F5F A;  2NNY A;  2DW4 A;  9ANT A;  4G6Q A;  3BDD A;  5LRR A;  3L2W A;  1ZLJ A;  4KNY A;  5DTD A;  4IRH A;  4CCO A;  2UZK A;  1GVJ A;  2YS9 A;  4P1W A;  5IP6 A;  1A6I A;  2GIZ A;  4BXU A;  3TQN A;  4V2G A;  2Z9O A;  2E2H J;  2VOP A;  2HDD A;  3KZI C;  3GLL A;  3WTW C;  2V1D A;  5HOO A;  5DS9 A;  4K2E A;  4U87 A;  4O5V A;  1XS9 A;  4LB5 A;  3JRI A;  3ERM A;  1FLI A;  4FHT A;  1NG7 A;  4LOC A;  4MEY F;  5FRM A;  3KIO A;  2G0E A;  3D5R C;  3KP5 A;  2R5Y B;  2QSG X;  2V79 A;  3ELK A;  2NVU B;  1AKH B;  2JMW A;  2L54 A;  1O3Q A;  1PVE A;  2FQ3 A;  3FBI B;  5FFX A;  2IW5 A;  1FC3 A;  2P5V A;  2Y2Z A;  2XAH A;  3OYE A;  1F5T A;  2B63 J;  4A3D J;  3NWT A;  3K0L A;  3L00 A;  1TBX A;  3GZ5 A;  3H0D A;  4BBS J;  2Z99 A;  4NBQ A;  1IN8 A;  4L9V A;  5J6X A;  3G2B A;  3W6K B;  5EG0 A;  1HW5 A;  1IO2 A;  3K4N A;  4L9T A;  2VJJ A;  4CCK A;  2V6E A;  2CUF A;  2IP2 A;  2ID3 A;  2H27 A;  3M9A A;  4R79 A;  1TC3 C;  1LQ1 A;  1J09 A;  2JPB A;  2FE3 A;  3CC2 I;  1XB4 A;  2LC2 A;  1FOX A;  2EIJ H;  1ZRD A;  1GV5 A;  4MGR A;  3CCJ I;  1X1P A;  1YW7 A;  5L3B A;  3OOP A;  1SFO J;  4IHV A;  3I3L A;  2FBI A;  4A2U A;  2R4G A;  5F04 A;  4C3I J;  1SEU A;  4UVA A;  5FKM A;  2CS3 A;  3M8J A;  3GF2 A;  5JHU A;  2ISY A;  4B09 A;  3RZD J;  2HR3 A;  3BLY A;  2EV6 A;  4UVC A;  5EDN A;  2E71 A;  1CGP A;  3WU2 C;  2VLA A;  2E7W A;  5HDG A;  4XSX F;  4JX5 A;  2KLO A;  3N97 A;  1YTY A;  1QHH D;  4F3Q A;  5C4J J;  5L3E A;  5J1U A;  2R7O A;  2FNP A;  2XAQ A;  3CDL A;  3HRU A;  3F8N A;  2LOO A;  4DZP A;  4BE1 A;  1HCR A;  4RLQ A;  1E3O C;  4XOT A;  3SXY A;  4P55 A;  3ZCO A;  3V8L A;  2JRM A;  4M72 A;  5ERI A;  1PUE E;  3GME A;  3W2V A;  2VN2 A;  2CRG A;  5GPA A;  2X1E A;  3W2W A;  1U6G A;  2RGV A;  4KYW A;  4IHW A;  2JVH A;  4R1H A;  1MH4 A;  3RJP A;  4UHT A;  2ESH A;  3IRQ A;  4KIG A;  4RS8 A;  3E6C C;  1UZC A;  3JRC A;  2MW8 A;  2A6T A;  1T2K A;  2JJ7 A;  3COA C;  1Z67 A;  2F5C A;  1ZLK A;  4IHY A;  1I6X A;  4CXF A;  1MBJ A;  2ZBK A;  2GXA A;  3SDG A;  5J1R A;  3KYD B;  1IRG A;  1EJ9 A;  4F55 A;  2LF8 A;  2XVC A;  3O3K A;  5B5E C;  2YSR A;  5FB2 A;  4AUX A;  2ADU A;  2F2E A;  2YR2 A;  4J01 A;  1LDD A;  2Y31 A;  3B73 A;  2ZFU A;  3E7L A;  5EJC A;  2Z5U A;  1YO5 C;  3IAM 2;  3BQY A;  3HC7 A;  3C1D A;  2XB0 X;  5CQG A;  3WHB A;  1ZN2 A;  5F27 A;  3Q0V A;  1VND A;  2XGX A;  4XRS G;  4U0Y A;  4EQQ A;  3U1D A;  3H5A A;  5FD6 A;  3FX3 A;  3JTH A;  4ENN A;  5AIP A;  2NVQ J;  3HOZ J;  1IDY A;  5FFZ A;  2M0M A;  3ZMT A;  3CF5 F;  4V19 K;  1P4X A;  1MNE A;  2ZME A;  1JUS A;  4IHT A;  3ZQH A;  3I58 A;  3GTK J;  1SFU A;  1U5T C;  2EA2 A;  4P9F A;  1IXS B;  4BE2 A;  3ZRG A;  4ZYD A;  3LSK A;  2GWR A;  1FYM A;  3HIF A;  1FMV A;  2RAE A;  1E2X A;  5GP9 A;  1R5G A;  2W00 A;  3KEY A;  3N4M A;  2VXD A;  1ZHF A;  3AAF A;  2DQL A;  2R7R A;  2EWN A;  2HQ5 A;  4Y4R A;  5HNH A;  2CQ7 A;  2VKE A;  5E3O A;  2EH3 A;  1P92 A;  3HEF A;  5BQT A;  3FXL A;  3HGG A;  2A69 F;  2JPC A;  4UB8 C;  1SAN A;  2V9P A;  1TWG J;  3BPV A;  3K1P A;  1EA3 A;  2JUC A;  1KU3 A;  1Z7L A;  1YHQ I;  2JZY A;  4M74 A;  2HKX A;  1AKH A;  2W25 A;  5J3L A;  2RRE A;  3MFK A;  1XMX A;  1CQT A;  1KQ9 A;  5EZG A;  2QA4 I;  4ZC3 A;  2FD5 A;  1FJL A;  4OIQ F;  3KP7 A;  3OYF A;  3S2H J;  3Q9S A;  3W6V A;  5IT3 A;  2QBY B;  2QEX I;  2EZH A;  4WK8 F;  4L0Y B;  2L7Z A;  3HB9 A;  5FGM A;  1QO0 D;  1R1U A;  2V9V A;  2L9N A;  4CYC B;  2JA8 J;  2QKM B;  1BI3 A;  2JT1 A;  3RSN A;  1VQ6 I;  1XC5 A;  2O7O A;  4HNU A;  5K7Z A;  1TT0 A;  3GZ6 A;  4G7O F;  2F5D A;  4BE0 A;  1WFX A;  4HST A;  2H6B A;  1MNM C;  5H20 A;  4Y17 A;  3WTX C;  3OR1 C;  3SEZ A;  2TRT A;  2LY9 A;  3J7A Y;  2P6S A;  1LKX A;  2OD5 A;  5C3E J;  1J75 A;  1IN5 A;  3CES A;  3KEQ A;  1IUY A;  2BVM A;  2HVQ A;  3QYE A;  2BW3 B;  2HOS A;  4A3M J;  2XAG A;  1YIT I;  2GM4 A;  3CD6 I;  1ONV A;  3LSG A;  3K1N A;  4HLX A;  2OQG A;  3K9T A;  2CYY A;  1ACI A;  4CUG A;  4M3F A;  3ZOB A;  2HDW A;  3J7Z I;  3CLO A;  5E3M A;  2A5W A;  3H92 A;  3L2V A;  1GXP A;  4EJT A;  1X2M A;  4KT5 C;  5D5X B;  3T8T A;  3UNG C;  2GOX B;  2GAU A;  2M7A A;  2ELH A;  4HYE A;  1MH3 A;  2QSH X;  1IUF A;  3L2Q A;  3HOW J;  3CUQ A;  3P9K A;  1JGS A;  3JTG A;  3CJQ B;  4CIC A;  3VSL A;  2VI6 A;  1EKE A;  4XR6 A;  4J00 A;  2V4J C;  4HW0 A;  2FEZ A;  2Q0O A;  3NRV A;  2MAB A;  4NQW B;  2HOE A;  2KRC A;  5TGT A;  3AG1 H;  4OIR F;  3SZP A;  1R9T J;  3JAM Z;  2H1K A;  2VUM J;  3BJ6 A;  2XKO A;  1UMQ A;  4WF2 A;  4B3X A;  5EZH A;  1FSH A;  3OYK A;  3KFW X;  2BGC A;  4II2 A;  1P9Q C;  2EK5 A;  4B4C A;  2ZJP F;  4CO8 A;  5BPI A;  3R60 A;  1IC8 A;  3HUG A;  1WJF A;  3E6M A;  1NG6 A;  2IGM A;  2X6Y A;  3DKW A;  4FE4 A;  3CQZ J;  5DCM B;  3GTO J;  4II3 A;  3DEE A;  1WI3 A;  4D7M A;  4XN3 A;  1RRJ A;  3LA3 A;  2WA0 A;  3H5R A;  1P4A A;  4YG2 F;  3KLO A;  1IJW C;  3HXL A;  2X9D A;  3L09 A;  2PMZ A;  2QEN A;  1MJA A;  1W7P A;  4HV6 A;  1FPQ A;  1FOK A;  2VPL A;  1HW1 A;  1OR7 A;  2ME6 A;  1B4A A;  4RB0 A;  1ZGA A;  2DMQ A;  3PNY A;  2FSW A;  4PJJ A;  3FXJ A;  1TNT A;  3ULQ B;  1MJB A;  1YFH A;  4E7S A;  2VB6 A;  1LVA A;  2VC1 A;  3JSO A;  4AIH A;  3BZK A;  1DGR M;  1O7L A;  2VJI A;  4AYB A;  1IAW A;  2QQ8 A;  5IYB J;  1Y8Q B;  2FOW A;  2V6C A;  3BY6 A;  1FBU A;  1MKM A;  5GAE J;  2OUM A;  3NAU A;  4I01 A;  4LGW A;  1FSE A;  3EUH C;  1IF1 A;  4XLE A;  3ZMU A;  1FWZ A;  5ILU A;  3H9G A;  4ASN A;  1TQM A;  5JR3 A;  1MDM A;  4PFO A;  4F93 B;  1DP3 A;  1R5I D;  3LNQ A;  1ZGW A;  5BMZ A;  3E0J B;  4KMU X;  5E8G A;  4RB1 A;  3PUB A;  2VKH A;  2CV2 A;  5FKO A;  5GAH J;  1KZH A;  2DOE A;  2GA1 A;  2Z1D A;  4EAT A;  3B6A A;  2M7B A;  3NQO A;  4BJ5 C;  5E1Z B;  5FLX Z;  2A3S A;  3SDB A;  1FY7 A;  2FMY A;  3PO3 J;  4L5E A;  4XNF A;  2H8W A;  1Z91 A;  1I1G A;  2OBP A;  1ZH5 A;  1TWC J;  1WGX A;  2LSO A;  3RKX A;  3RKQ A;  2OQR A;  1BI0 A;  1LUJ B;  3TOB A;  3FIW A;  4XLH A;  1YX5 A;  2C6Y A;  2MBF A;  2X1C A;  4A3I J;  3BWG A;  4L5J A;  3CCL I;  3BTC A;  2R5Z B;  3F8F A;  3ROU A;  2PJP A;  4FCY A;  2E2I J;  4Y52 J;  2LD5 A;  2IA1 A;  1Z1D A;  2P0W A;  4LG3 A;  3ZMD A;  4DZJ A;  4KT6 A;  3K70 D;  1U78 A;  2KHM A;  1X1A A;  2WB1 A;  1G3W A;  2E60 A;  3FXR A;  4QTR A;  2F48 A;  1QPI A;  3DPU A;  4W1U A;  2KZV A;  5BPD A;  2ZJQ F;  1D0Z A;  2FBK A;  1YG2 A;  1YX3 A;  1XDS A;  2Y30 A;  3F9K A;  4HPQ A;  3VOD A;  5LFA A;  1BA5 A;  2I10 A;  4XRM A;  1UB9 A;  1QZE A;  4Y7N J;  2EPF A;  5L3D A;  2X6O A;  1IN7 A;  3SFZ A;  4G9Y A;  2WC2 A;  3EYI A;  2DAO A;  4E7I A;  5ICF A;  1JTX A;  1R1T A;  4HNV A;  5DM7 F;  3MZH A;  3A1Y A;  3KP6 A;  3Q9V A;  1AU7 A;  4AIK A;  2VOO A;  3GFJ A;  1EH8 A;  4XRS A;  1O57 A;  2XC7 A;  1ORK A;  1LFP A;  2PQ8 A;  2O6G E;  2NOG A;  3WTY C;  3MZY A;  5HLH A;  1Z6R A;  3WTZ A;  1AWC A;  3SQN A;  2CFX A;  4NC7 A;  2FRH A;  4FE7 A;  5EGO B;  2PN6 A;  3TKY A;  4FX4 A;  5HDN A;  3H9Q A;  2CO5 A;  1ETQ A;  3KLN A;  1Z05 A;  3BTI A;  3IH4 A;  4I76 A;  1WH5 A;  1G2H A;  2CU7 A;  1XMK A;  3OL3 A;  2QCO A;  1I50 J;  1X2N A;  3QP5 A;  3ESW B;  3G1L A;  1BW6 A;  2D1H A;  2LKS A;  3HBL A;  3GCM A;  3KPH A;  3HDD A;  2O8K A;  3IC7 A;  2CWE A;  4KIB A;  2IS2 A;  4G7Z F;  4XIC A;  2HGC A;  5ILV A;  1X3U A;  3AG3 H;  3VPR A;  2J5P A;  2E1C A;  2K4J A;  1W5C C;  4GO1 A;  4RB2 C;  1RKW A;  2XUB A;  3KE2 A;  4JK1 X;  2GIV A;  3EET A;  3OR2 C;  2R7W A;  2MD5 A;  2DYR H;  2DFH A;  5CVI A;  2ZXJ A;  1VZ0 A;  1VTN C;  2BXZ A;  2K9N A;  3PNT A;  1J59 A;  2IBD A;  4S04 A;  6PAX A;  3VSK A;  2OPT A;  3BZ6 A;  5ICE A;  3I5U A;  2A6H F;  4CCL A;  3GXO A;  4HF2 A;  2DLL A;  1MBH A;  4MQV A;  1ZEL A;  3C2B A;  4A3K J;  3CO7 C;  2P5K A;  1WWX A;  3GYH X;  5AON A;  3HRT A;  3K7A J;  2CQQ A;  2LBF B;  4CZZ A;  3LFU A;  1V4R A;  4PJ0 C;  5H6R A;  3WU0 A;  1J9I A;  5KAF C;  2DBB A;  3GBG A;  2KMU A;  4RMN A;  3FDY A;  2HDC A;  2L5Q A;  1LJ9 A;  4D5F A;  4HLY A;  4BHB A;  1FNN A;  4XBF A;  2L9R A;  4BY7 J;  3TGN A;  4HZF A;  4IRG A;  1JT0 A;  5JHF A;  3LSI A;  5J8C A;  1RIO H;  3O8H A;  1RPW A;  1O4X A;  1G3T A;  4YEJ A;  1VQN I;  4XK4 A;  3KX2 A;  2CH0 A;  2LF7 A;  2R7Z J;  4RBO A;  3FHN A;  4IJA A;  4BQQ A;  2K86 A;  1DGW Y;  1JHF A;  1T38 A;  2HXO A;  5D4S A;  1S6L A;  1HF0 A;  1K78 B;  1GDT A;  2PMH A;  2BY1 A;  3DXJ F;  1GXQ A;  3OIP A;  4I98 B;  2VBX A;  3MKL A;  3DTK A;  3C18 A;  4XON A;  2DA5 A;  4IHS A;  2PFB A;  5HLI A;  4NNJ A;  5FO5 A;  3HOY J;  2CQK A;  3FXO A;  3RPU D;  1NH3 A;  3CMM A;  4EJV A;  1DPR A;  1X4P A;  5E17 F;  4X6A J;  5BOX A;  2JTV A;  2HQA A;  2OZU A;  2W84 A;  4DGW B;  3JR9 A;  2DFI A;  4N0B A;  4FAS D;  2LY2 A;  3F8B A;  4B47 A;  3I59 A;  4WX9 A;  4MQ9 F;  2FA5 A;  4GRI A;  2XAF A;  2M8G X;  4EGZ A;  2KZG A;  3E1S A;  3WTU C;  3GFM A;  2CV1 A;  1W1W E;  1G8X A;  3C2H A;  4GDF A;  2F4O B;  2MLK A;  5JI6 A;  2HTS A;  1N77 A;  4P5O A;  5DV5 A;  1XDU A;  2DTZ A;  2I5U A;  4DOZ A;  3ZQG A;  1IRZ A;  2AS5 F;  3L9F A;  1MGT A;  5HOD A;  3GTP J;  4WXD A;  3F23 A;  5CQE A;  3MEX A;  5IY5 H;  3UR3 C;  5FD5 A;  4ZDP A;  1OCT C;  3V7C A;  2YU9 J;  3VEP A;  3PFY A;  2KT0 A;  2NVX J;  2DK5 A;  5D5W B;  3R0A A;  2KRF A;  3H5N A;  4IL6 C;  3ZQL A;  1XGS A;  3VOE A;  2R7S A;  2WAE A;  3RYR A;  1D1A A;  1UFM A;  4CCN A;  2IAI A;  2O5R A;  1IV8 A;  2WV1 A;  1DUX C;  4BKX A;  1K4S A;  4UUS A;  1ZG3 A;  5EGO A;  2R7F A;  3I71 A;  2DT7 B;  3C7J A;  2DTR A;  3AG2 H;  3I53 A;  4PGH A;  2ECB A;  3IWF A;  3P9I A;  1GUU A;  1B9N A;  2XSJ C;  2M87 A;  2MH9 A;  4J19 A;  2L02 A;  1PYV A;  3SZT A;  1W5T A;  2E7X A;  2JVG A;  1TP4 A;  3BG7 A;  4XL9 A;  5IT9 Z;  3TDU C;  2QF7 A;  4ESF A;  3G6E I;  4UUT A;  2A61 A;  4BY1 J;  4LG0 A;  1VI0 A;  4EJU A;  2XF7 A;  5LD2 C;  5EYR A;  2HYJ A;  3R6S A;  1SFE A;  3DEW A;  3ZN1 A;  1LE8 B;  1H88 C;  2R7Q A;  3CTA A;  3K70 C;  5ILS A;  2MLG A;  5FLX K;  4HDV A;  1D1C A;  4X0G A;  3CC4 I;  3HSE A;  3I9V 2;  4ESJ A;  3ZMZ A;  5GTH C;  3IH2 A;  2XRL A;  5KK1 A;  2BY2 A;  1YRN A;  3M8E A;  3A01 B;  3HRS A;  3ABT A;  4B1R A;  4KFC A;  4IXA A;  2LH9 A;  4ZTJ A;  2K7L A;  2HOT A;  5FKN A;  1BIA A;  2F4I A;  2GZW A;  4Q4Z F;  2HWV A;  4MTD A;  3TED A;  3DCF A;  4DBQ A;  1KU7 A;  3TOA A;  2QQB A;  1X19 A;  1Z3X A;  2EA4 A;  3DTE A;  3OYH A;  1BL0 A;  3DP7 A;  3E6D A;  3F72 A;  1T95 A;  4M71 A;  3RKW A;  3PQJ A;  5E20 A;  5ED4 A;  2BV6 A;  2R92 J;  3DF8 A;  2CSO A;  4A12 A;  1IXC A;  1E3H A;  1JJ8 C;  3VB2 A;  3QPL A;  4ANJ A;  1YW9 A;  2L7F P;  3LA7 A;  4UXN A;  4CHU A;  2DDB A;  4HX4 A;  2L2O A;  1ENH A;  2G9W A;  2KPM A;  2AXL A;  4ZZL A;  3CJT B;  4H4K C;  3IV5 A;  1BJA A;  3DV8 A;  3MVP A;  3SZG A;  3OIO A;  2LNB A;  5HS7 A;  4W97 A;  2N8G A;  4B48 A;  4XLC A;  3K1M A;  1IW7 F;  4AU7 A;  1QQI A;  3KP3 A;  5LGT A;  4KN7 X;  1PP7 U;  2XPV A;  4MLO A;  4M3E A;  2J5O A;  1OCZ H;  2XIG A;  1D0Y A;  3IUO A;  2K85 A;  1FP2 A;  1LEA A;  2W85 A;  1S7E A;  3BR3 A;  2Y0S A;  4XN0 A;  3EQL F;  3Q5F A;  1HA8 A;  1W4M A;  4NHJ A;  4BQN A;  1D5Y A;  1GT0 C;  2LKX A;  3DWL E;  2AQF A;  4MFE A;  3I4M J;  5GPC A;  1K6O A;  2Y69 H;  3A0H C;  2E1M B;  1QHG A;  3OV8 A;  1N75 A;  1IV6 A;  2VON A;  2BXY A;  3ZQC A;  1WPK A;  2XSD C;  1MMN A;  4JBA A;  2O0Y A;  4H0E A;  1WKM A;  1ZKG A;  1KU2 A;  1H9T A;  2XGD A;  1U5T A;  4BEH A;  3H35 A;  1R22 A;  4KIF A;  1BR2 A;  1Y0N A;  3GO5 A;  3RPQ A;  3IP4 B;  2M3A A;  5B1B H;  2QM3 A;  4NB5 A;  1MND A;  2XKP A;  1ETO A;  2AQE A;  4D9J A;  2DMN A;  3PSF A;  4S0H B;  2MSY A;  1BN5 A;  1KYW A;  1R49 A;  5D8K B;  4LFU A;  3OYI A;  3GX4 X;  5TRD A;  5E3L A;  1RUO A;  2X6W A;  1YIJ I;  4HEA 2;  1YLF A;  1F36 A;  5JVT A;  3IKT A;  5EEA A;  1B9M A;  2IS1 A;  3BJO A;  2O8X A;  2RNJ A;  4BUP A;  3CP2 A;  3VDX A;  2COM A;  1X1C A;  3W6J B;  2EB7 A;  3QP6 A;  5J4Y A;  1JHH A;  5LHI A;  5F6F A;  1MSE C;  4XLP F;  3FHZ A;  4Y13 A;  4E4H A;  3GUD A;  1N78 A;  2HZT A;  2M45 A;  1ZGJ A;  2L7K A;  1PUF B;  1NK2 P;  2V1X A;  1WJE A;  2IRF G;  1H9G A;  1EH6 A;  2PMZ N;  3FF5 A;  4DYR A;  4KMF A;  3G73 A;  2RVC A;  5LLQ A;  5J1Y A;  4Y3O A;  1VQL I;  4F91 B;  2KIF A;  2EIK H;  1MD0 A;  1R36 A;  2R5Y A;  4YEL A;  2DFF A;  1R58 A;  2KIQ A;  5JFR A;  3JRE A;  2HI3 A;  3L2U A;  5D6E A;  4EVI A;  2CV0 A;  2DMU A;  1VQ5 I;  4AYB N;  1S5L C;  2XDV A;  1SVO A;  4OIN F;  1SVL A;  4M6V A;  2MA3 A;  4PJN A;  3OYJ A;  5LHG A;  1JKP C;  5A2Q Z;  4A0X A;  5E18 F;  1Z7U A;  4HX7 A;  4JYK A;  2FML A;  3ASN H;  1UHS A;  1TW2 A;  3RZO J;  2OTL I;  2Z16 A;  1TLH B;  3CZ6 A;  1ZR4 A;  2XPU A;  4A5M A;  1OIS A;  5KNL A;  3V8J A;  2P6T A;  4UV9 A;  5K1Y A;  2DA6 A;  4A3B J;  5TIS C;  4YIR X;  2DQR A;  1U8B A;  5M5X J;  4HV5 A;  4MTE A;  1U0J A;  4EM2 A;  1RET A;  3FM3 A;  4ZYE A;  3LA2 A;  2MYS A;  4RM3 A;  1YYV A;  2HQR A;  5LBQ A;  3GWZ A;  1CF7 B;  4UB6 C;  1FOW A;  2ZXI A;  4E7K A;  2A5Y B;  3BOQ A;  3ML6 A;  4LIV A;  1WJB A;  4PK4 A;  1T56 A;  1YIO A;  1DU6 A;  4QWQ A;  2P5L C;  3HOV J;  2XAJ A;  3MN2 A;  1XD7 A;  3BT9 A;  3BCB A;  2V1N A;  2JN6 A;  2BVL A;  1B72 B;  2ZJ2 A;  1S3J A;  3OYL A;  1HDP A;  4GFB A;  2DOA A;  2HZD A;  2WB1 N;  1K4T A;  4HSR A;  1ZG5 A;  3KZZ A;  1XGO A;  3REO A;  4B43 A;  3I55 I;  1I27 A;  4DYQ A;  4L9N A;  4KIC A;  3IKV A;  1FIA A;  4DQ2 A;  1QPM A;  1T0F C;  4BBR J;  1XCB A;  1VQP I;  3H9J A;  2KJB A;  3WHC A;  3LAJ A;  1U9N A;  2CG4 A;  4IX7 A;  2DI3 A;  2MFZ A;  4DBR A;  5IT9 K;  4Z2Y A;  4G8X A;  5HS8 A;  1KQ0 A;  2QUF A;  1R71 A;  2RV8 A;  3S3M A;  1SD7 A;  2HQN A;  1MMS A;  3HHG A;  3G1M A;  3FK7 A;  4UVB A;  3RKY A;  5DM6 F;  3I0T A;  1GHC A;  2E1O A;  3CJN A;  2NRA C;  5E8I A;  1FTZ A;  5FLV A;  2EBI A;  2CGP A;  2K27 A;  2JSC A;  1ERD A;  2LG4 A;  1ETW A;  1IRF A;  2QWW A;  1MMD A;  3AL0 B;  2NNN A;  2ZSH B;  5K7H A;  3A0B C;  2XB5 A;  5HVQ C;  1Z6T A;  2ZXW H;  1QGP A;  3E5X A;  2E1M C;  2FJ1 A;  3BP8 A;  5IOY A;  4UNO A;  4AID A;  1FOY A;  2X48 A;  2DFE A;  1BBY A;  4XID A;  1HQC A;  4LJZ F;  4M73 A;  4CYD A;  1GVD A;  4DW6 A;  4WCG A;  3P5J A;  4IKF A;  1HKQ A;  2K40 A;  3EUH A;  5H2F C;  3ZP5 A;  3CCR I;  3OOU A;  3NWS A;  3OYA A;  4ZYA A;  2ZKZ A;  3D5S C;  3D1N I;  4IZZ A;  1F1Z A;  2IGO A;  1K61 A;  2JWT A;  5D5V B;  4B3A A;  1V55 H;  1QZY A;  3Q3S A;  2KJC A;  4QLC U;  2ZO4 A;  1E0E A;  2VE9 A;  2QYO A;  3ABK H;  3I54 A;  1WZ2 A;  3LSR A;  1IG7 A;  1T08 B;  1QA6 A;  3O6B B;  1STZ A;  1X58 A;  2Q2E B;  1ZYR F;  2FXA A;  2OF7 A;  3QAH A;  3GLX A;  4A3E J;  4UY8 I;  1HDD C;  1TL8 A;  3UKG A;  2LK2 A;  3ONQ A;  1B8I B;  4HF1 A;  2P81 A;  2CW7 A;  3RIR A;  1S9H A;  3GTL J;  2X0L A;  3KET A;  3RQI A;  2QBY A;  1G6N A;  1U2W A;  2IPQ X;  4FX0 A;  4LIU A;  1RC9 A;  1G3Y A;  1ETK A;  2ETH A;  3RYP A;  4CYC A;  3CMA I;  2VBY A;  4FT8 A;  4DIQ A;  4ENK A;  2DPD A;  4LIT A;  3QPH A;  3M1C A;  1G3S A;  2DN0 A;  4ETS A;  2DJN A;  2B7E A;  1BJZ A;  3GFL A;  2RKH A;  4CZC A;  4HX8 A;  3BJA A;  5DCF A;  2ZNZ A;  2A07 F;  1O7F A;  4ZDL A;  3OS0 A;  3K4B A;  1XPX A;  3JRA A;  3WOD F;  1E3P A;  3PM1 A;  3SEQ A;  2QGU A;  3ZXS A;  1BI1 A;  4HBL A;  5IOZ A;  2BW3 A;  1ZAO A;  4NDL A;  2VJ4 A;  2VQH A;  4QPQ A;  3V8K A;  1FTT A;  3HTU A;  4EV0 A;  3V7R A;  1Y1W J;  3BQZ A;  2FBH A;  5B1A H;  4GYI A;  3AFH A;  4IO9 F;  1U8R A;  1HLV A;  2GXB A;  2WV0 A;  4HF0 A;  2W57 A;  3S32 A;  4IHX A;  3FKJ A;  4MNU A;  4Q48 A;  4PJL A;  3T1B A;  1HC8 A;  2EV0 A;  2VJ5 A;  2YX7 A;  1UJ8 A;  3HHH A;  3WG9 A;  5JLX A;  5C4X J;  4QPO A;  2G7H A;  3QYF A;  1YS6 A;  4A6D A;  3CDI A;  3OMY A;  3FMS A;  3SHF A;  1FMW A;  1LEB A;  2K3F A;  2PJR A;  4NQW A;  3F3X A;  2BY0 A;  4E7Z A;  3CC7 I;  2LDU A;  4RGS A;  3CCM I;  3OL4 A;  1BOB A;  3HL2 A;  2DPU A;  4YRV A;  4XKW A;  1ZRE A;  2VT3 A;  4C30 A;  1TTY A;  3IAS 2;  2EZL A;  3LWF A;  2R7V A;  5E3N A;  4ZYG A;  2Z3Y A;  3CO6 C;  1TW3 A;  5F1J A;  5CVU A;  2X4H A;  3KCC A;  5J8F A;  4XKB A;  1YOV B;  2E19 A;  2A68 F;  4U88 A;  1OQY A;  4FTH A;  3DBH B;  5DCM A;  1Z77 A;  1HW2 A;  1OCR H;  4M6X A;  1AHD P;  4RAY A;  3WG7 H;  3O2P E;  3TO6 A;  1XSX A;  4EMS A;  3ECO A;  3OIQ A;  3PNV A;  4G7H F;  4OIO F;  2JA7 J;  1A31 A;  2ZFW A;  4YFN F;  2RQQ A;  2M30 A;  3X2Q H;  2GLO A;  2BHY A;  2F5E A;  1BI2 A;  3F8M A;  3KZY A;  4ZTF A;  4GYG A;  1JKQ C;  2D1V A;  2I8D A;  2X6X A;  1Y0U A;  2VT2 A;  1DDN A;  4TV7 A;  2O03 A;  2MG4 A;  1PP8 F;  2L9S A;  1H0M A;  3HOS A;  3AL0 C;  4CCJ A;  4A3F J;  3ERE D;  4WXC A;  3VFZ A;  1ZR2 A;  2LMD A;  2EFP A;  4LD5 A;  1MBF A;  4BYY A;  4ABZ A;  2Y9Y A;  4XKC A;  5L3G A;  2G7U A;  1T8I A;  4MEX F;  1XGN A;  2HVS A;  3GTJ J;  3S1M J;  4BXX J;  2AO9 A;  3OS1 A;  3HSF A;  4KJZ A;  2WBM A;  1YJ9 I;  1U3E M;  5LHH A;  2QKL B;  3TP3 A;  2JRT A;  4LLN A;  3EYY A;  2DXI A;  1TT5 B;  5CKT A;  4ENJ A; 
#chains in the Genus database with same CATH homology
 1J0R A;  4BHC A;  1OPC A;  3WE2 A;  2VOD A;  4O6J A;  3CUO A;  2ACJ A;  5TJJ A;  1KA8 A;  1XSD A;  4A5N A;  3DQV C;  2HEO A;  3F6O A;  2L3D A;  1WQ2 A;  4OOI A;  2UWM A;  3T8R A;  3QOP A;  4KN4 X;  4LLL A;  3M8F A;  2R7D A;  3R4K A;  3J81 Z;  3JAM K;  5CVR A;  5LGU A;  1IZ1 A;  2H94 A;  3DPL C;  4R8H A;  3KEO A;  4PGG A;  1OYY A;  5D8L B;  2O3F A;  4IRI A;  2YU3 A;  4CGZ A;  1T98 A;  1O3R A;  1R7J A;  1XGM A;  1RUN A;  1K79 A;  3FXU A;  4BQA A;  2PMU A;  2BEO A;  3FMR A;  5E1X A;  5K5Q A;  2P4W A;  3ZQ7 A;  2HYF A;  4RGU A;  1AOY A;  2E1N A;  3E97 A;  4UUV A;  2RDP A;  2XAS A;  2KKO A;  2MH2 A;  1LDK B;  2OU2 A;  5CLS A;  1P6R A;  5DEQ A;  1A04 A;  3L2C A;  3GFI A;  4ENM A;  4XRF A;  2ZME B;  1L3L A;  4AWX B;  1JE8 A;  2Y0M A;  5ICC A;  2MC3 A;  3MCZ A;  3ZMV A;  2H09 A;  2XRN A;  5HLG A;  4IPA A;  3ZN0 A;  2B0L A;  3E3V A;  2HTJ A;  1D5V A;  2EFO A;  2Q8K A;  1ZAR A;  3J7A O;  1LNW A;  3K2Z A;  4N9I A;  2XV4 S;  2QLZ A;  1J2X A;  2FU4 A;  2HKO A;  1ON1 A;  4I0A A;  2M1B A;  1FP1 D;  2ESN A;  2K4B A;  1K78 A;  3ZPL A;  3BPX A;  4I7H A;  4IF4 A;  1MZB A;  2VXZ A;  3F21 A;  3WTT C;  3WGI A;  2WWY A;  4AD9 A;  3J80 Z;  1OYI A;  4BAY A;  3WE3 A;  5F64 A;  3DFG A;  1FT9 A;  3P9C A;  2IVM A;  4Y15 A;  3PQK A;  4L5I A;  1K7A A;  1SD6 A;  2P8T A;  5F1R A;  1XMA A;  5KVR A;  2OAZ A;  4AVP A;  5DUK A;  4ZYH A;  3KP2 A;  3GEZ A;  1P4W A;  2Y48 A;  2VC0 A;  5CVJ A;  1SMY F;  1J5Y A;  5HDK A;  2Z33 A;  3TO7 A;  5D4R A;  2RC4 A;  5H6Q A;  3LQR A;  1B1B A;  1OMI A;  3CUQ B;  3L7W A;  4HDU A;  1IN4 A;  1W7P D;  4OMY A;  3EDP A;  1R5H A;  4A6E A;  1I1S A;  1WI9 A;  4M6Y A;  3RPU A;  1OYW A;  3FXQ A;  1BIB A;  1NHA A;  4BHP A;  2VBW A;  4L18 B;  3HYI A;  2PLY A;  1T6S A;  2PG4 A;  3F8C A;  4EM0 B;  1LDJ A;  2NAZ A;  5LEJ A;  5K5R A;  3HTS B;  1BC7 C;  4DNC A;  4KDP A;  3H3U A;  2DK8 A;  5ICG A;  5DD4 A;  1Q1H A;  3IWZ A;  1W7P B;  4A0Z A;  4I09 A;  5HS9 A;  2FNA A;  2H6C A;  2PEX A;  4O3M A;  1RZ4 A;  2HS5 A;  1KU9 A;  4ZZD A;  2CW0 F;  1ZG1 A;  3P7N A;  2WTE A;  1G4D A;  3ISP A;  2KIU A;  2M5W A;  4OIP F;  3D0S A;  5E1W A;  2IJL A;  1EH7 A;  2ISZ A;  3M7G A;  3J81 K;  1MDM B;  3F6V A;  4G6D A;  4HAM A;  4XLN F;  2K02 A;  2ZCW A;  1RNL A;  1SFX A;  4PZJ A;  4M9S A;  2L4A A;  4U0W A;  1XSV A;  2EFN A;  1FBQ A;  1WRJ A;  3GVA A;  4E70 A;  2FOK A;  1R23 A;  3U9G A;  1D8K A;  3HRM A;  1D8J A;  3ZMS A;  2BBY A;  3FMQ A;  3HOT A;  3IL2 A;  2NS0 A;  1R00 A;  4RAZ A;  2PI0 A;  1T0F A;  3H3Z A;  1ZRF A;  1JXS A;  3S2W A;  5CYV A;  4WWC A;  3V4G A;  1UHW A;  4YII A;  4F7Z A;  4D0P A;  3LST A;  4A0Y A;  1UCR A;  4EGY A;  2A6E F;  4M9Z A;  1HXD A;  4YFX F;  1O3T A;  1V3F A;  3MAJ A;  3IHU A;  1ULY A;  2FF4 A;  3LAP A;  3FM5 A;  4B8X A;  1UST A;  4YIF A;  1T39 A;  1HBX G;  1KYZ A;  3NEU A;  4CDG A;  4HA8 A;  3B02 A;  3WGG A;  2EV5 A;  2QVO A;  3JW4 A;  3GW2 A;  1KQ8 A;  5K5O A;  4BNC A;  4XSZ F;  1FYL A;  1SAX A;  3WTV C;  1BOA A;  5EEG A;  3CUQ C;  2GA2 A;  3R61 A;  1KGS A;  4RB3 C;  3RI4 A;  4RGX A;  2XHK A;  2STT A;  1WSU A;  4PDK A;  5DDG A;  4I0B A;  1HKS A;  3E6B A;  1OKR A;  3R0J A;  1ODD A;  4ESB A;  3DPT A;  1J7K A;  2RQP A;  1QZZ A;  4JQF A;  4I02 A;  2EFW A;  3WGH A;  3J80 K;  1B6A A;  1DPU A;  2GXG A;  1QNT A;  4YFK F;  5DUI A;  1R1V A;  4ZH4 F;  1SD4 A;  2NYX A;  2V1U A;  2L01 A;  1FYK A;  2EJR A;  1F9N A;  5AIQ A;  2VBZ A;  3QPT A;  3MWM A;  1BM9 A;  5DD8 A;  4UV8 A;  1HST A;  2ZNY A;  4HQM A;  4GGG A;  1YW8 A;  2HYG D;  3D5L A;  5LGN A;  1CF7 A;  4IVN A;  4G94 A;  1Z9C A;  3FZV A;  3FWE A;  1YS7 A;  3KP4 A;  1MJ9 A;  3I4P A;  3ABU A;  1D3Y A;  1TQI A;  3I59 B;  2IA0 A;  4P9U A;  4WXH A;  3DEU A;  4OMZ A;  1EV7 A;  3QU6 A;  4LMY A;  1E17 A;  4LLG F;  2DO7 A;  2HFH A;  4EM1 A;  1S29 A;  5EEH A;  2Y75 A;  2XRO A;  3WTS C;  5LEK A;  4BH9 A;  2VE8 A;  4LB6 B;  2KIM A;  2P7C B;  4U7D A;  2D2W A;  4L0Z B;  1DP7 P;  2P7V B;  3CDH A;  5L3C A;  1FX7 A;  4LK1 F;  1RI7 A;  4OU0 A;  1L0O C;  2UXX A;  2W24 A;  5A2Q K;  4GCV A;  3HSR A;  1HSJ A;  2IA2 A;  4Q47 A;  4AIJ A;  3T0Y A;  4LG0 B;  3ECH A;  2O61 A;  1C0W A;  2OZ6 A;  4LK0 F;  2PBI A;  2GQQ A;  1XCV A;  1IN6 A;  3LQQ A;  5CVV A;  4Q5S F;  3MQ0 A;  2Q2E A;  2RN7 A;  1BC8 C;  5D6F A;  5D5U B;  1I5Z A;  1SD5 A;  1TNS A;  5CJ9 A;  1FZP B;  1SMT A;  4U0V A;  3M1E A;  1PDN C;  1O3S A;  2STW A;  4S05 A;  5LRS A;  2YPR A;  3QU3 A;  4N9H A;  4ON0 A;  1ZRC A;  3C3W A;  5L3F A;  1IXR C;  2TDX A;  1W5S A;  4KUM A;  1YQA A;  4RGR A;  2YX4 A;  1F4K A;  1B59 A;  3I64 A;  3BRO A;  4P96 A;  1QBJ A;  3QRF F;  3E5Q A;  1TQP A;  2IT0 A;  3TO9 A;  3IRR A;  1ON2 A;  3G3Z A;  2BYV E;  2M8E A;  4L9J A;  2R3S A;  1FBS A;  3LFK A;  1S8N A;  3RDI A;  2BE5 F;  3PFI A;  1REP C;  2LKP A;  2UXN A;  3V7S A;  4U7B A;  4M9X A;  1S7O A;  2DT5 A;  2QQA A;  2QZ8 A;  3WU1 B;  1HKT A;  1XN7 A;  5BS6 A;  2OA4 A;  1UHM A;  1P2F A;  4HQE A;  4EJW A;  1U5T B;  3F22 A;  3E5U A;  3TDZ C;  2D45 A;  3K69 A;  3T5X A;  2L4M A;  2QQ9 A;  1S7A A;  3RTR A;  4HOB A;  3U2R A;  1USS A;  4GXO A;  1LB2 A;  4EJO A;  4I2O A;  4PCQ A;  3JSP A;  2DU9 A;  5DYM A;  2EFQ A;  4MHG A;  2F5F A;  2NNY A;  2DW4 A;  4G6Q A;  3BDD A;  5LRR A;  1ZLJ A;  4KNY A;  4IRH A;  2UZK A;  1GVJ A;  4BXU A;  3TQN A;  2Z9O A;  2VOP A;  3WTW C;  2V1D A;  5HOO A;  4K2E A;  4O5V A;  4LB5 A;  1FLI A;  4FHT A;  4MEY F;  3KP5 A;  2V79 A;  3ELK A;  1O3Q A;  2L54 A;  2FQ3 A;  5FFX A;  2IW5 A;  1FC3 A;  2P5V A;  1F5T A;  2XAH A;  3K0L A;  3L00 A;  1TBX A;  3GZ5 A;  2Z99 A;  1IN8 A;  4L9V A;  5J6X A;  3W6K B;  1HW5 A;  4L9T A;  2IP2 A;  2H27 A;  3M9A A;  4R79 A;  1LQ1 A;  2JPB A;  2FE3 A;  1XB4 A;  1ZRD A;  4MGR A;  1YW7 A;  5L3B A;  3OOP A;  2FBI A;  4A2U A;  4UVA A;  3GF2 A;  5JHU A;  2ISY A;  4B09 A;  2HR3 A;  4UVC A;  2EV6 A;  1CGP A;  2E7W A;  5HDG A;  4XSX F;  3N97 A;  1YTY A;  5L3E A;  2FNP A;  2XAQ A;  3HRU A;  3F8N A;  3SXY A;  4P55 A;  3V8L A;  4M72 A;  5ERI A;  1PUE E;  2VN2 A;  1U6G A;  2RGV A;  4KYW A;  4R1H A;  3RJP A;  4UHT A;  2ESH A;  3IRQ A;  4KIG A;  4RS8 A;  3E6C C;  1T2K A;  3COA C;  2F5C A;  1ZLK A;  1I6X A;  4CXF A;  2ZBK A;  1IRG A;  2LF8 A;  2XVC A;  3O3K A;  2YSR A;  5FB2 A;  2ADU A;  2F2E A;  2YR2 A;  1LDD A;  3B73 A;  1YO5 C;  2Z5U A;  3C1D A;  1ZN2 A;  4U0Y A;  2XGX A;  4EQQ A;  3U1D A;  5FD6 A;  3FX3 A;  3JTH A;  4ENN A;  5AIP A;  5FFZ A;  3ZMT A;  1P4X A;  2ZME A;  4IHT A;  3I58 A;  1SFU A;  1U5T C;  2EA2 A;  4P9F A;  1IXS B;  4ZYD A;  1FYM A;  2GWR A;  3HIF A;  1E2X A;  1R5G A;  3N4M A;  1ZHF A;  3AAF A;  2DQL A;  2EWN A;  1P92 A;  5BQT A;  2A69 F;  2JPC A;  3BPV A;  3K1P A;  1KU3 A;  2JZY A;  4M74 A;  2HKX A;  2W25 A;  3MFK A;  1KQ9 A;  4OIQ F;  3KP7 A;  3Q9S A;  5IT3 A;  2QBY B;  4WK8 F;  4L0Y B;  5FGM A;  1QO0 D;  1R1U A;  2V9V A;  1BI3 A;  2JT1 A;  3GZ6 A;  4G7O F;  2F5D A;  2H6B A;  5H20 A;  4Y17 A;  3WTX C;  2P6S A;  2OD5 A;  1J75 A;  1IN5 A;  3KEQ A;  1IUY A;  2XAG A;  1ONV A;  3K1N A;  4HLX A;  2OQG A;  3K9T A;  2CYY A;  3CLO A;  3H92 A;  1GXP A;  4EJT A;  4KT5 C;  5D5X B;  3T8T A;  2GAU A;  2ELH A;  4HYE A;  3CUQ A;  3P9K A;  1JGS A;  3JTG A;  4CIC A;  4HW0 A;  2FEZ A;  2Q0O A;  3NRV A;  4OIR F;  3SZP A;  2HOE A;  4KA4 A;  3JAM Z;  3BJ6 A;  2XKO A;  4WF2 A;  1FSH A;  3KFW X;  2BGC A;  2EK5 A;  4CO8 A;  5BPI A;  3R60 A;  3HUG A;  3E6M A;  3DKW A;  5DCM B;  3LA3 A;  1P4A A;  4YG2 F;  3KLO A;  3L09 A;  2QEN A;  1MJA A;  1W7P A;  4HV6 A;  1FPQ A;  1FOK A;  1HW1 A;  1OR7 A;  1B4A A;  4RB0 A;  1ZGA A;  3ULQ B;  2FSW A;  1TNT A;  1MJB A;  1YFH A;  1LVA A;  2VC1 A;  3JSO A;  4AIH A;  1O7L A;  1IAW A;  2V6C A;  3BY6 A;  1FBU A;  1MKM A;  4I01 A;  4LGW A;  1FSE A;  1IF1 A;  3ZMU A;  1FWZ A;  5ILU A;  4ASN A;  1TQM A;  5JR3 A;  1MDM A;  5BMZ A;  4KMU X;  5E8G A;  4RB1 A;  2GA1 A;  3NQO A;  5E1Z B;  5FLX Z;  2A3S A;  1FY7 A;  2FMY A;  1Z91 A;  1I1G A;  2OBP A;  1ZH5 A;  3RKX A;  2LSO A;  2OQR A;  1BI0 A;  3TOB A;  2C6Y A;  2MBF A;  3BWG A;  4L5J A;  3F8F A;  3ROU A;  2PJP A;  2IA1 A;  1Z1D A;  3ZMD A;  1U78 A;  1G3W A;  3FXR A;  5BPD A;  2FBK A;  1YG2 A;  1XDS A;  3VOD A;  1UB9 A;  5L3D A;  1IN7 A;  3SFZ A;  4G9Y A;  2WC2 A;  3EYI A;  2DAO A;  5ICF A;  1R1T A;  3MZH A;  3KP6 A;  3Q9V A;  4AIK A;  2VOO A;  3GFJ A;  1EH8 A;  1O57 A;  2PQ8 A;  2O6G E;  3WTY C;  5HLH A;  3MZY A;  1Z6R A;  3WTZ A;  1AWC A;  3SQN A;  2CFX A;  2FRH A;  2PN6 A;  3TKY A;  4FX4 A;  5HDN A;  2CO5 A;  3KLN A;  1Z05 A;  1XMK A;  3QP5 A;  2D1H A;  3IC7 A;  2CWE A;  4KIB A;  4G7Z F;  2HGC A;  5ILV A;  1X3U A;  2J5P A;  2E1C A;  2K4J A;  4GO1 A;  4RB2 C;  2XUB A;  3KE2 A;  4JK1 X;  2GIV A;  3EET A;  2MD5 A;  5CVI A;  1VTN C;  2ZXJ A;  1J59 A;  4S04 A;  6PAX A;  3BZ6 A;  5ICE A;  3I5U A;  2A6H F;  3GXO A;  4HF2 A;  2DLL A;  4MQV A;  3CO7 C;  2P5K A;  1WWX A;  3GYH X;  5AON A;  3HRT A;  4CZZ A;  1V4R A;  5H6R A;  3WU0 A;  1J9I A;  2DBB A;  2HDC A;  1LJ9 A;  4HLY A;  4BHB A;  1FNN A;  4XBF A;  3TGN A;  4HZF A;  4IRG A;  5J8C A;  1RIO H;  1G3T A;  2LF7 A;  4IJA A;  2K86 A;  1JHF A;  1T38 A;  5D4S A;  1S6L A;  1K78 B;  2PMH A;  3DXJ F;  1GXQ A;  4I98 B;  2VBX A;  3C18 A;  4IHS A;  2PFB A;  5HLI A;  5FO5 A;  2CQK A;  4EJV A;  1DPR A;  5E17 F;  5BOX A;  2JTV A;  2OZU A;  2W84 A;  2DFI A;  4N0B A;  3F8B A;  3I59 A;  4WX9 A;  4MQ9 F;  2FA5 A;  2XAF A;  4EGZ A;  3WTU C;  3GFM A;  2MLK A;  5JI6 A;  2HTS A;  4P5O A;  5DV5 A;  1XDU A;  2AS5 F;  3L9F A;  1MGT A;  4WXD A;  3F23 A;  3MEX A;  5FD5 A;  3V7C A;  3VEP A;  2DK5 A;  5D5W B;  3R0A A;  2KRF A;  1XGS A;  3VOE A;  3RYR A;  1UFM A;  1DUX C;  1ZG3 A;  2R7F A;  3I71 A;  3C7J A;  2DTR A;  3I53 A;  4PGH A;  3IWF A;  3P9I A;  1B9N A;  2M87 A;  2MH9 A;  2L02 A;  3SZT A;  1W5T A;  2E7X A;  5IT9 Z;  3TDU C;  4ESF A;  2A61 A;  4LG0 A;  4EJU A;  3R6S A;  1SFE A;  3ZN1 A;  3CTA A;  5ILS A;  2MLG A;  5FLX K;  4HDV A;  3HSE A;  4ESJ A;  3ZMZ A;  5KK1 A;  3M8E A;  3HRS A;  3ABT A;  4KFC A;  4IXA A;  2K7L A;  1BIA A;  2GZW A;  4Q4Z F;  2HWV A;  4MTD A;  1KU7 A;  3TOA A;  2QQB A;  2EA4 A;  3DP7 A;  3E6D A;  3F72 A;  4M71 A;  3RKW A;  3PQJ A;  5E20 A;  5ED4 A;  2BV6 A;  3DF8 A;  2CSO A;  4A12 A;  1IXC A;  3VB2 A;  1YW9 A;  4UXN A;  3LA7 A;  4CHU A;  4HX4 A;  2G9W A;  2AXL A;  4ZZL A;  1BJA A;  3DV8 A;  2LNB A;  5HS7 A;  3K1M A;  1IW7 F;  1QQI A;  3KP3 A;  5LGT A;  4KN7 X;  1PP7 U;  2J5O A;  2XIG A;  1FP2 A;  1LEA A;  2W85 A;  3EQL F;  3Q5F A;  1W4M A;  4NHJ A;  1K6O A;  3OV8 A;  2VON A;  4JBA A;  2O0Y A;  4H0E A;  1WKM A;  1KU2 A;  1H9T A;  1U5T A;  1R22 A;  4KIF A;  3GO5 A;  3RPQ A;  2QM3 A;  4NB5 A;  2XKP A;  1BN5 A;  1KYW A;  5D8K B;  4LFU A;  3GX4 X;  5TRD A;  1RUO A;  1YLF A;  5JVT A;  3IKT A;  1B9M A;  3BJO A;  2O8X A;  2RNJ A;  2COM A;  3W6J B;  2EB7 A;  3QP6 A;  1JHH A;  5LHI A;  5F6F A;  4XLP F;  3FHZ A;  4Y13 A;  3GUD A;  2HZT A;  2M45 A;  1ZGJ A;  2V1X A;  2IRF G;  1H9G A;  1EH6 A;  3FF5 A;  4KMF A;  3G73 A;  2RVC A;  5LLQ A;  2KIF A;  1MD0 A;  1R36 A;  1R58 A;  5JFR A;  5D6E A;  4EVI A;  4OIN F;  2MA3 A;  5LHG A;  5A2Q Z;  4A0X A;  5E18 F;  1Z7U A;  4HX7 A;  2FML A;  1TW2 A;  1TLH B;  4A5M A;  3V8J A;  2P6T A;  4UV9 A;  5K1Y A;  2DQR A;  4HV5 A;  4MTE A;  4EM2 A;  3FM3 A;  4ZYE A;  3LA2 A;  1YYV A;  2HQR A;  5LBQ A;  3GWZ A;  1CF7 B;  2A5Y B;  3BOQ A;  3ML6 A;  1YIO A;  4QWQ A;  2P5L C;  2XAJ A;  1XD7 A;  2ZJ2 A;  1S3J A;  1ZG5 A;  3KZZ A;  1XGO A;  3REO A;  1I27 A;  4L9N A;  4KIC A;  3IKV A;  4DQ2 A;  1QPM A;  1XCB A;  2KJB A;  3LAJ A;  2CG4 A;  2DI3 A;  5IT9 K;  4Z2Y A;  4G8X A;  5HS8 A;  1KQ0 A;  2QUF A;  2RV8 A;  1SD7 A;  2HQN A;  3HHG A;  4UVB A;  3RKY A;  3I0T A;  1GHC A;  3CJN A;  2NRA C;  5E8I A;  2CGP A;  2K27 A;  2JSC A;  1IRF A;  2QWW A;  2NNN A;  5HVQ C;  1Z6T A;  3E5X A;  1QGP A;  3BP8 A;  4UNO A;  1BBY A;  1HQC A;  4LJZ F;  4M73 A;  4CYD A;  4WCG A;  1HKQ A;  3EUH A;  3ZP5 A;  2ZKZ A;  1F1Z A;  5D5V B;  1QZY A;  2KJC A;  4QLC U;  2ZO4 A;  2VE9 A;  2QYO A;  3I54 A;  3O6B B;  1STZ A;  1ZYR F;  2FXA A;  3QAH A;  3GLX A;  4HF1 A;  3RIR A;  2X0L A;  3KET A;  2QBY A;  1G6N A;  1U2W A;  2IPQ X;  4FX0 A;  1G3Y A;  2ETH A;  3RYP A;  2VBY A;  4FT8 A;  4ENK A;  2DPD A;  3QPH A;  1G3S A;  4ETS A;  3GFL A;  2RKH A;  4HX8 A;  3BJA A;  5DCF A;  2ZNZ A;  2A07 F;  1O7F A;  3WOD F;  1BI1 A;  4HBL A;  1ZAO A;  3V8K A;  3HTU A;  4EV0 A;  3V7R A;  2FBH A;  4GYI A;  1U8R A;  2GXB A;  2WV0 A;  4HF0 A;  2W57 A;  4MNU A;  4Q48 A;  3T1B A;  2EV0 A;  2YX7 A;  3HHH A;  3WG9 A;  2G7H A;  1YS6 A;  4A6D A;  3FMS A;  3SHF A;  1LEB A;  4NQW A;  3F3X A;  2LDU A;  4RGS A;  2DPU A;  1ZRE A;  2VT3 A;  1TTY A;  3LWF A;  4ZYG A;  2Z3Y A;  3CO6 C;  1TW3 A;  5CVU A;  2X4H A;  3KCC A;  5J8F A;  2A68 F;  4U88 A;  5DCM A;  1HW2 A;  4M6X A;  4RAY A;  3O2P E;  3TO6 A;  1XSX A;  4EMS A;  3ECO A;  4G7H F;  4OIO F;  2ZFW A;  4YFN F;  2M30 A;  2F5E A;  1BI2 A;  3F8M A;  3KZY A;  4GYG A;  2D1V A;  1Y0U A;  2VT2 A;  1DDN A;  4TV7 A;  2O03 A;  1PP8 F;  1H0M A;  3HOS A;  3ERE D;  4WXC A;  3VFZ A;  2EFP A;  4LD5 A;  4BYY A;  5L3G A;  2G7U A;  4MEX F;  1XGN A;  3HSF A;  1U3E M;  5LHH A;  2JRT A;  4LLN A;  3EYY A;  4ENJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...