1FTTA

Thyroid transcription factor 1 homeodomain (rattus norvegicus)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
68
structure length
68
Chain Sequence
b'MRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKAAQQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THYROID TRANSCRIPTION FACTOR 1 HOMEODOMAIN
publication title Analysis of the solution structure of the homeodomain of rat thyroid transcription factor 1 by 1H-NMR spectroscopy and restrained molecular mechanics.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Dna binding protein
total genus 19
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 1995-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1fttA00
1E3OC 4FE4A 2EBIA 2KDZA 1APLC 3ZQLA 2D5VA 5E3MA 5BNGA 5C44J 3NARA 4D7MA 3FK6A 5J1YA 4BBSJ 5GPAA 3BG9A 1G2HA 1W0TA 2VKEA 2Y2ZA 2ID3A 3JRGA 2JA6J 3JRCA 5C4XJ 1A5JA 3HOWJ 3B6AA 5IP7J 2ME6A 3RZDJ 3ZQFA 2JA5J 4I76A 3S1RJ 1FEXA 1QPIA 3LNQA 4IHVA 3ZOBA 2ME0A 1H88C 2GLOA 4A3DJ 3M4OJ 1JKPC 2LFBA 4V2GA 4BY7J 1MH4A 2R93J 1IC8A 1Z0XA 2Y0SN 4FCYA 1LE8A 4QIWN 4MLOA 4DYQA 3Q0WA 2DA4A 5F0CA 2X9DA 4A3LJ 3HOXJ 1ETWA 2DA6A 3BQZA 2WAQN 5GP9A 4A93J 3GTMJ 4M3DA 1MBKA 3HB9A 1BA5A 3BR5A 2HDDA 5EZHA 2R5YB 2N8GA 4NDLA 3BTJA 1ORKA 5F1JA 1OCPA 1HDDC 1MSEC 2K9SA 1VF9A 4M3GA 2OF7A 2MW8A 4BKXA 1Y1VJ 2X6OA 3TP3A 3OSGA 1AKHB 1B8IB 3LSJA 4ABZA 5J1UA 2XPUA 4XICA 3DCFA 3O8GA 5FKNA 3GTJJ 2CU7A 3BG3A 1ZR4A 4D5FA 1RESA 3F0CA 5FLVA 2VI6A 2XPWA 3G1MA 4AUXA 2R5ZB 1F43A 1T56A 2O8KA 3SDGA 1AKHA 1B8IA 3VPRA 1ETYA 1YRNA 3I4NJ 2H1KA 3S1MJ 2L7ZA 2E2IJ 1D5YA 1IUFA 3GTKJ 3S1NJ 3FIWA 4AC0A 2HI3A 3JRDA 1NTCA 5F0HA 4GFBA 1XG1A 3E7LA 2DMNA 4MIMA 2K9NA 2NS8A 3GBGA 5IOYA 4DW6A 1RPWA 3SFIA 3JREA 4IHWA 1NK3P 4BXXJ 3S14J 2G0EA 3S2DJ 2FJ1A 2LTPA 1U9NA 1VNDA 2FD5A 3HDDA 2Y31A 5IP6A 1ETVA 1TWCJ 1HOMA 2CRGA 2LVSA 4Y52J 1JUSA 2YU9J 3BR6A 3OOUA 2XGDA 3G1LA 2E2JJ 3GTPJ 2AHQA 2W48A 2LR8A 1GVDA 2LD5A 1QVTA 1VI0A 2VPRA 4XRSA 5K7FA 5GPCA 2IBDA 2ECBA 2QCOA 1DU6A 1ETOA 4A69C 1WH5A 4DZPA 1IV6A 1UMQA 4EEFG 2ZB9A 2EZKA 5FKKA 3MKLA 3A02A 4XRSG 1PUFB 2DMQA 1FIPA 5JLWA 2JA8J 2X48A 2HXIA 2YUSA 2QF7A 1FIAA 2GBYA 2NOGA 1ZK8A 2E1OA 5IOZA 3ZQIA 2P81A 2L7FP 2XSDC 4UUSB 5EYRA 3BG5A 1O4XA 2JK3A 4S0HB 4JP0A 1K61A 5F04A 2O7OA 2CUFA 4MFDA 1PUFA 5DS9A 1XS9A 3QPLA 3GTOJ 1WH7A 3D1NI 3S17J 1ETXA 4X1EA 3S15J 3QQAA 2IEKA 2R7ZJ 1WCMJ 2Y30A 4A3CJ 1MNMC 1ZTRA 2M8GX 3W6VA 4UUSA 3A01B 2TRTA 2EH3A 3FK7A 2WB1N 1ZKGA 4L5EA 3ZQGA 2NS7A 1B72B 1TC3C 2DMPA 2EZLA 3NAUA 1LFUP 1FTZA 5F0FA 3OIOA 2E2HJ 2ID6A 5EEAA 4BY1J 1UG2A 4B1RA 4A3BJ 5K7HA 3MVPA 5C3EJ 2CQQA 4JX6A 3DEWA 3IH3A 4LOCA 1BJZA 1MH3A 2K9QA 3ZQCA 1XC5A 3CMYA 2L7MP 3I4MJ 2XPVA 4XK4A 1B72A 3CDLA 1IRZA 2HXOA 2LKXA 5FKMA 3ZQHA 2JN6A 3CCYA 3Q0UA 3BTCA 5FJ8J 4A3JJ 2VKVA 1Z77A 2XB0X 1JT6A 3JR9A 4A3FJ 2DMTA 2MGQA 2Y9ZA 2R5YA 1GV2A 5FLMJ 1DU0A 4IHXA 4BBRJ 4MO7A 2FQ4A 2TCTA 2LP0A 2YS9A 2DA2A 2M34A 4DYRA 5EGOB 2ELKA 2M2EA 1U9OA 3GTQJ 5J3LA 3BT9A 1NK2P 4QSHA 3C2BA 1QVUA 3HEFA 3LSPA 3TEDA 3JRBA 1MBGA 1WGXA 1ZR2A 4X6AJ 2E19A 3BR0A 2R5ZA 3HOYJ 2M9HA 3PO2J 3UKGA 3BR3A 9ANTA 5E3NA 2K40A 1GT0C 3LOCA 4G12A 1ZGWA 1JJ8C 1F36A 3LSRA 2XRLA 3BQYA 4RDUA 4M3FA 4FTHA 2MG4A 1FTTA 2M0CA 1K83J 4B3AA 4RBOA 3PM1A 2CUEA 1IGNA 3WHBA 3RKQA 2NVTJ 1RR7A 4B4CA 4CYCB 1X2NA 3S16J 4A3KJ 2XB5A 4W97A 1POGA 4C3HJ 1GDTA 1HCRA 1U8BA 3JRAA 3HOVJ 5FKLA 3Q0VA 2B63J 3BTLA 1HLVA 1BW6A 1JTYA 2VUMJ 1OCTC 2ECCA 2HOTA 3WHCA 2OPTA 1OJLA 4CYCA 2PMZN 2O9LA 1JT0A 3QPSA 4DYCA 1X2MA 5EG0B 3JRHA 1EF4A 2L0KA 1MBFA 2RAEA 4XRMA 1FJLA 3CQZJ 1MBHA 2EZIA 3GTGJ 2DA7A 2LY9A 3MN2A 1GUUA 1H8AC 1IDYA 3A03A 1CQTA 4C2MJ 5IPAA 5EG0A 2R92J 3HGYA 4M3EA 2JA7J 4Y7NJ 2LLKA 3LSGA 4JYKA 2DA1A 3H0GJ 3GTLJ 2HOSA 1RETA 1SFOJ 5M3FJ 3PO3J 2WV1A 5M3MJ 1LE8B 4DZJA 3RZOJ 3S2HJ 5E3LA 2JWTA 2L9RA 1P7JA 1JKRC 1ZQ3P 1TWFJ 1TWHJ 3Q3SA 2EZHA 4IHYA 1I6HJ 4C3JJ 2HQ5A 5IYCJ 2CJJA 3HOZJ 4AYBN 1AU7A 5IP9J 1R9TJ 2NVQJ 3A01A 3H3VK 2CQXA 2DTZA 1Y1WJ 1JUPA 4FE7A 2LK2A 1WPKA 1MBEA 5IYBJ 3B6CA 1AHDP 3FKIJ 1Q1VA 3SJMA 2JMWA 3K7AJ 1X58A 3TP0A 2GM4A 1JKQC 3IH2A 3HKZN 3HM5A 3HOUJ 4A3MJ 3JRFA 5HODA 3K2AA 4IEJA 3TW6A 1BW5A 4A3EJ 4W1UA 5F27A 5EF6A 4A3GJ 1ITYA 2DMUA 2DJNA 2COBA 2EQRA 3FISA 3L1PA 2AO9A 5E3OA 1ETQA 1U78A 1IJWC 4C3IJ 4D7NA 1JJ6C 3HGGA 1HF0A 4MFEA 1UHSA 1SANA 1LFBA 2DA3A 4HNVA 2FX0A 1W0UA 1RKWA 1T33A 1WI3A 2XGEA 4J19A 3IV5A 1YRNB 1ENHA 5FKOA 5C4JJ 1S7EA 1QRYA 1MBJA 1BL0A 3S1QJ 3TW7A 5JLXA 2DA5A 1JTXA 5EGOA 4A3IJ 2NVXJ 2I10A 2DN0A 4M6VA 3G1OA 3RQIA 1JGGA 1I3QJ 3BR2A 2HYJA 1ETKA 1A6IA 1P7IA 3IH4A 2Y9YA 5J1RA 5K7ZA 4FISA 1HDPA 1TWGJ 4UUTA 1IDZA 1RKTA 3JRIA 1OFCX 5EDNA 1I50J 3BTIA 1H89C 5EZGA 2KT0A 2XGCA 2HOAA 2H8RA 1MSFC 5DTDA 4D5CA 4V2FA 5M5WJ 5M5XJ 4JX5A 2NVYJ 1IG7A 3OSFA 2MSYA 3HBLA 1JKOC 5IYDJ 4I6ZA 1VFCA 3O8HA 1JUMA 3BR1A 4M3BA 1TWAJ 3M3YJ 2R0QC 4XIDA 4QTRA 5F08A 5M5YJ 2JJ7A 4JX4A 1GV5A 2IAIA
chains in the Genus database with same CATH superfamily
5HS7A 3DBRB 1APLC 1IV8A 5HLTA 5E3MA 2R7VA 4LITA 4EATA 1X3WB 1B6AA 3CMEI 2Y2ZA 4A0YA 4BQAA 4PUSA 4L18B 2ZMEB 2COMA 2OU2A 4HV5A 4MTDA 1J0RA 4IXAA 4UUVA 5IP7J 4ESJA 4UNOA 2ME6A 3LSMA 2BY0A 4G9YA 2V9KA 3OY9A 4GGGA 2JA5J 3CMAI 1DUXC 3LNQA 1G8XA 4O3MA 3I54A 3ZOBA 5L3CA 1ZH5A 3FXQA 1H88C 3S3MA 3M4OJ 5DCMB 1WVRA 2OCCH 2BEOA 1FNNA 3M8FA 2Y0SN 4MHGA 1XCVA 2NS0A 5BPDA 3RIRA 4Q5SF 1SFEA 4B3XA 4RGXA 4NUBA 2GQQA 3T5XA 2DA4A 2BHZA 3Q0WA 1B9MA 1TP4A 3JAMZ 4PJJA 3KLOA 1BI1A 3HOXJ 5KHDA 1ETWA 2WAQN 5GP9A 4WWCA 4ENKA 1I1SA 2OCEA 4U7DA 1OCOH 2F5CA 3BR5A 4XMYA 3QP5A 2N8GA 3BTJA 3M1CA 1HDDC 3MKZA 1MSEC 1EV7A 2PQ8A 3PUFA 5KAIC 2FMLA 4BKXA 2X6OA 2LSOA 4LIVA 3H35A 2CSOA 3Q9SA 2H27A 4ABZA 3BWGA 3KYDB 1UCRA 1X1DA 3B02A 3DBLB 2LBFB 3L2RA 3O8GA 3N4MA 4LIUA 2VBZA 2H6BA 5DM6F 3H92A 2LRDA 4O5VA 1RESA 1RC9A 4ON0A 4N9IA 4UHTA 1R1TA 2FF4A 3QYBA 1F43A 1MMGA 2O8KA 3OYJA 1B8IA 3C3WA 4L0ZB 1FBQA 2ZJPF 1V5EA 2BVLA 3FXUA 3I59A 1KGSA 4DNCA 2PBIA 2UZKA 1IUFA 2D1HA 2EPFA 3E6BA 1FX7A 2R7TA 3FIWA 4AC0A 2EILH 1TT5B 3AFHA 1NTCA 3DU6A 4NB5A 4A5MA 1BR4A 2VASA 3CLOA 2EFNA 4CCNA 2EIKH 3E7LA 4BXFA 2FOKA 4ESFA 5HS9A 5IOYA 2L02A 4IHTA 3H3UA 2K85A 1U5TB 1YW8A 3C1DA 1NK3P 3GXOA 3S14J 2WA0A 3S2DJ 3QOEA 2V26A 4BHCA 4AU7A 1KU3A 5EEHA 1J7KA 2HTJA 3A0HC 1EH7A 2F5FA 3CUQB 2QBYB 4G6DA 3G1LA 2VJ5A 3GFIA 1XSDA 1GVDA 3CCMI 2H1LA 3HRTA 2R7QA 1Y0UA 1QVTA 1UB9A 1YX5A 2GWRA 2VPRA 3BCBA 4XRSA 1YIJI 3CJTB 2KDOA 1YJNI 3FXJA 3WTXC 2QCOA 3T8TA 4BEHA 3ZR8X 3EQLF 4NQWA 4A69C 2IGKA 1VZ0A 4GCVA 3GCMA 2MFZA 4LG0A 2QENA 2ZMEC 1Z91A 1FIPA 2X51A 2X48A 4OAYA 1SD4A 2YUSA 2DI3A 5CVVA 1DQUA 1WHUA 2KJCA 3ZQIA 3NWSA 5FO5A 4V19K 4UUSB 5EYRA 3BG5A 1K61A 4JP0A 4XLEA 1ZARA 2CUFA 2VQLA 1XS9A 5AIQA 1FC3A 1A35A 1SAXA 1WH7A 4XLNF 1ETXA 4X1EA 4BJTA 2XUBA 1W36D 3HRMA 4IL6C 3VYUB 4A12A 3GMEA 1ZTRA 2YPRA 3L2WA 1B9NA 2CO5A 1XN7A 3A01B 1TQIA 1IRGA 4OIPF 4GYGA 4H0EA 5LD2C 3FK7A 2KRCA 3LSTA 5D5UB 3CO7C 3IP4B 4L5IA 2NS7A 2DMPA 2EA2A 3NAUA 4YFXF 4CXFA 4RGSA 4YELA 5D8KB 1MZBA 5BPIA 4R8HA 1JE8A 2OBPA 5ILSA 3IWFA 4GXOA 2QQAA 4LOCA 1MH3A 2K9QA 3ZQCA 3KFWX 3CMYA 1QNTA 2J5PA 2GZWA 2K4JA 1EA3A 1MW7A 1P92A 2LKXA 1WKMA 2IA0A 3HYIA 2ELJA 1EH6A 2ZBKA 4L9VA 5ILVA 1USSA 3MKWB 1BIAA 4HNUA 1Z77A 2DDBA 2DMTA 3H5AA 3TBIA 2HGCA 4OIRF 2BHYA 2JA2A 3KEOA 4IHXA 1FY7A 2W24A 3MAJA 4LK0F 2BY3A 4RB0A 3HTUA 2LMDA 3JAMK 1YO5C 4HLYA 2EFWA 3K4CA 5J3LA 3GVAA 4UVBA 2IA1A 4YIIA 4UB6C 4X0GA 1T39A 1K6OA 2E1MC 1LEBA 2CUJA 4XKBA 2UXXA 4X6AJ 2KRFA 3BR0A 5IY5H 2L2OA 4YIFA 4UV8A 3JSOA 1X1BA 3PO2J 4BU2A 3BR3A 3W6JB 2V1DA 5E3NA 1R1UA 3LOCA 1HKQA 1FYKA 1JJ8C 1F36A 5B5EC 1R4NB 1AA7A 4EGZA 2ISYA 2XRLA 4A2UA 4Z6YA 4FTHA 1FTTA 2XAJA 5E1ZB 1K83J 3PM1A 2M8EA 1S8NA 3L2UA 4CYCB 2NVTJ 1X2NA 1RUOA 4A3KJ 2OTJI 1I27A 1O3RA 3M07A 1POGA 1U5TA 1VQOI 3JRAA 2VQCA 3CJRB 5B1BH 2AS5F 3LMMA 2HR3A 2VONA 1YW9A 3FBIB 3A2KA 1XGSA 5E79C 2VUMJ 1T95A 2WAEA 2R7DA 1XMXA 2DYSH 5TJJA 2WBMA 5K5QA 4ZYGA 3ASNH 2QBYA 3BPXA 3QPSA 4OU0A 1X2MA 4DYCA 4HDUA 2RAEA 2VC1A 2DODA 3EYYA 1TQMA 5HDKA 2RDPA 5KCMA 2B7EA 2QKMB 2R4GA 1YW7A 2DA7A 3SDBA 5CJ9A 3HRUA 5KVRA 1Z1DA 3FMRA 1IDYA 3CCSI 3A03A 5HOOA 5A2QZ 4KN7X 4XKCA 1D8KA 2KIMA 5EG0A 5IPAA 1NG7A 3DBHB 5J40A 1IRFA 3RSNA 4ENMA 1KQ8A 2MLKA 2VIXA 1QU3A 3OS1A 1Z3YA 1LB2A 4NC6A 3HSRA 5FLXZ 5M3FJ 4XRFA 4DZJA 1GXQA 2JWTA 3LFUA 3KCCA 2L9RA 5DV5A 1FPQA 1KU9A 3DWLE 1ZRDA 3LFKA 2BZTA 1I6HJ 3E6MA 2HQ5A 2P7CB 2R7OA 3ABMH 3HOZJ 1AU7A 5IP9J 4Y15A 2BBYA 3I58A 5TGTA 5E18F 2K27A 3A01A 2CQXA 4KUMA 4FE7A 3ZMVA 1G3WA 1LQ1A 3TOBA 1U2WA 3K7AJ 1SFUA 3TOAA 2W82A 2P5VA 2HVQA 2QSHX 4PGGA 2Y75A 2H8WA 3JRFA 3A4CA 1O3SA 2W4SA 5HNFA 1FBUA 4NBQA 2IJLA 3ZN0A 4EM1A 1QHHD 4A3GJ 4MQVA 2DMUA 2COBA 5J6XA 3FBNB 4HLXA 3ZCOA 3IRRA 2XASA 1IJWC 2PI0A 1E0EA 1E17A 2F4MB 4MFEA 1R6RA 2K3PA 1MNEA 1SANA 3MWMA 3S3NA 1QGPA 2DA3A 2WAFA 3JCUC 2FX0A 4BJ6C 2X4HA 4P55A 4HDVA 1T33A 1WI3A 1W0UA 2IP2A 2XGEA 2PJRB 1V5GA 1SFXA 3PJRA 2CFXA 3M8JA 3NWTA 4WX9A 4PK4A 3HC7A 4IRIA 3S1QJ 3C2HA 2Z5UA 2Q8KA 2O03A 2CQKA 2NVXJ 3P9KA 2E34A 3OS0A 3DEEA 3G1OA 2ZO4A 1I3QJ 2CGPA 3V8KA 2DAOA 2Y9YA 4RB3C 3K4BA 2M4KA 2HYFA 4CHUA 2MC4A 5K7ZA 1X3ZB 2GXBA 2XIGA 5LGNA 3P9IA 3HOSA 2MC3A 1I5ZA 4YFNF 1H89C 2KT0A 2HOAA 5H2FC 2GOMA 4OIQF 1A36A 2VT3A 3RCOA 4IRGA 5M5WJ 2DOAA 4N4OB 3GO5A 4I0BA 2AQFA 2F5DA 4KIBA 3E6CC 3HBLA 5IYDJ 2JUCA 1VFCA 3MCZA 4MNUA 1O57A 1MMNA 5LGUA 4S04A 3JW4A 3FWEA 4M71A 2P6TA 2KFDA 1MKMA 3SEQA 4L9TA 4ZTJA 4IVNA 1OR7C 4DOZA 3OYEA 3RKYA 4P1WA 3LQRA 1HLVA 2HKXA 1K78A 1GV5A 2IAIA 3G73A 2ZJQF 3WU1B 2EBIA 4KIGA 4R1HA 2D5VA 2M5WA 5CQEA 5BNGA 2QKLB 4HAMA 2W7NA 2J5OA 3HPGA 4CZCA 3BG9A 1W0TA 1VQPI 4CYDA 3BP8A 3RKWA 2ID3A 1PUEE 3JRGA 3DTKA 1WWXA 2V1NA 4Y3OA 4BYYA 4BACA 3WGIA 3R0AA 3IAM2 3HOWJ 1XMKA 3B6AA 3DU5A 4N4NB 2D45A 2QZ8A 3J80Z 1U3EM 4ZZDA 3S1RJ 1IXSB 2STTA 2KZVA 4IHVA 2CFOA 3KP5A 4F52A 1TT0A 2R7WA 2KLOA 4OINF 2BY2A 1UAAA 4A3DJ 2LF8A 3U21A 4V2GA 1YX3A 4IOCF 3LA3A 4F55A 5LFAA 2WY7Q 1VQ5I 3TO7A 5DDGA 1TW2A 4I99C 2MA3A 4PJMA 1X4PA 3HZJA 1QHGA 1F5TA 3SHFA 5A2QK 1K7AA 4XLAA 2XF7A 1ON1A 4A93J 2XRNA 3GTMJ 2GA2A 2CW8A 5BMZA 2MH9A 4M3DA 1YE9A 4XN0A 5EZHA 4A6DA 5ICCA 1ZG5A 2R5YB 5FLXK 5F1JA 1OCPA 2IA2A 4M3GA 1D5VA 3RDIA 3BZ6A 4XM3A 2MW8A 3K4LA 2JPCA 3QRFF 1OCCH 3LQQA 3H5RA 1B8IB 5J1UA 3F9KA 3P7NA 3VEPA 3FHZA 1FSHA 4PDKA 4G94A 3KP2A 4XICA 2XROA 4EJVA 3I59B 4E4HA 2HQRA 3TO6A 1N77A 5FKNA 1IRXA 2F4IA 2FSWA 5F6FA 5KNLA 2ELHA 4RGUA 2BXYA 3GTJJ 1HBXG 2CU7A 3BG3A 3CCUI 2ESNA 4I98B 5FLVA 3BDDA 2XPWA 3G1MA 2RKHA 5EEGA 3H9GA 4EM2A 1T56A 4N0BA 1AKHA 5F1RA 2JT1A 3GLLA 4HW0A 3WTUC 4DJAA 3KIOA 3E5QA 3DPLC 2AXTC 1FOWA 3I4NJ 1XPXA 1B59A 2L7ZA 1R5ID 1HKSA 1Z6RA 2ZNZA 2MLGA 1ACIA 2ZXIA 2P6SA 1PP7U 3JRDA 3L2CA 2ZNYA 3VDXA 1I1GA 2O3FA 4BJ5C 3W6KB 3QPHA 2EV5A 1WJAA 2K9NA 2HKOA 2QSFX 1PJRA 1W1WE 3AG4H 3GBGA 1TNTA 2E60A 4GO1A 1Y0NA 5K5OA 3HHGA 2QQBA 2A6TA 2WADA 4XSXF 3SFIA 2GXGA 2IVMA 4MTEA 1R23A 4BAYA 4XLHA 1A31A 3OYBA 2LTPA 2OUMA 1U9NA 3VODA 2FD5A 3I9V2 1BR1A 2Y31A 3FF5A 4BEHB 4NQWB 1HOMA 1ZAOA 2LVSA 3I5UA 1DPRA 1BR2A 4IQ4A 4M9SA 4Q48A 4PJLA 4AIHA 3BR6A 2YU9J 1MJAA 4PCQA 4NC8A 1V3FA 5HDNA 3L00A 1ONVA 4L0YB 4AIKA 2AHQA 3RQ4A 2W48A 1X4OA 5AIPA 3BC8A 3TO9A 1F4KA 3ECOA 2V79A 3AL0B 1N25A 1KONA 5E17F 2MYSA 3KEQA 3IKTA 1J75A 3IKVA 1IV6A 1U0JA 1U8RA 1R71A 1E3HA 2G7UA 1SFKA 5FKKA 2X6YA 2EINH 4XRSG 3A02A 2WV0A 3LWFA 2DMQA 5JLWA 1VQ7I 2V1UA 1V5FA 2NRAC 1W7PB 3HHHA 2QGUA 3MZYA 5IOZA 2L7FP 2F5EA 1ULYA 3C18A 4EVIA 2VKDA 3IL2A 2CG4A 1PDNC 3R6SA 1BI2A 1GVJA 2JK3A 4S0HB 2DPDA 1E2XA 3CC2I 3AG3H 2M45A 2EB7A 4I0AA 2O7OA 3H9QA 3WTWC 2IRFG 3O2PE 3VB2A 3S17J 4HV6A 1SMYF 4YRVA 2IEKA 4K2EA 2D2WA 2L9NA 1L3LA 2XVCA 2KIQA 2Y30A 2R7ZJ 5CLSA 4CH7A 4G8XA 4II2A 3W6VA 1ZLJA 3T0YA 2TRTA 2HDWA 2EH3A 2DPUA 4D1QA 1XCBA 3BLYA 2E7XA 4HQEA 2R3SA 2UV1A 1BC8C 2JPBA 5D6FA 3COAC 3ZQGA 2EZLA 2QSGX 2LOOA 3U1DA 3ZP5A 2ID6A 2W85A 4E7KA 1O3QA 3QODA 4A3BJ 2OD5A 1IAWA 3MVPA 4BUPA 2CQQA 2XGXA 1O3TA 3UNGC 2KZGA 2XAGA 2CV2A 1IZ1A 1XC5A 4Q4ZF 2L7MP 3J80K 3I4MJ 5K5RA 5H20A 2O61A 1B72A 3CDLA 2HXOA 3LSIA 5FKMA 3ZMDA 2XDVA 2M4GA 2MD5A 4A3JJ 2R7XA 4UXNA 4HOBA 2R5YA 5L3DA 1X3UA 5FLMJ 2O6GE 2XF6A 3FXOA 4MO7A 5DD4A 2FQ4A 5E20A 5FRNA 2TCTA 4KFCA 4AIJA 2YS9A 4ZDOA 2DA2A 3OYMA 1TZLA 4XR6A 4EM0B 2DFHA 4YFKF 1PP8F 2M34A 2PMHA 2W84A 2OA4A 5EGOB 4GRIA 3DKWA 1U9OA 1D0XA 1ON2A 4CCJA 4QSHA 3TEDA 3LSPA 4ZTFA 4XORA 1MJBA 3JRBA 3PIOF 4LB6B 2C6YA 1S5LC 3J81Z 1OPCA 2E19A 1DPUA 2ZC2A 3FM5A 2FNAA 1MMDA 3HOYJ 2BY1A 2M9HA 2L4MA 5CYVA 3LA2A 3LAPA 1QPMA 1YS7A 2EFOA 4WXDA 4AVZA 1GT0C 2QVOA 1YQAA 3KPHA 1ZG1A 2ACJA 1ZGWA 3ONQA 3GLXA 4HBLA 5LHHA 1LNWA 3F8CA 4PGHA 4A0ZA 2RN7A 3TDZC 4ASNA 4LLNA 3IWZA 1IN8A 2CUZA 2LKPA 2CUEA 2BYVE 4I7HA 1RR7A 1ZGJA 3S16J 1TNSA 3OV8A 2XB5A 4C3HJ 3SYTA 4KJZA 4IHSA 3HOVJ 3EUAA 3GW2A 4KICA 2Z33A 1L0OC 5FKLA 2GXAA 3BTLA 3MD2A 2KMUA 4XNFA 2A07F 1W5CC 4EMSA 1ZREA 3WTVC 2G9WA 3OIPA 1IXCA 1YG2A 2QQ9A 1JT0A 5EG0B 1EF4A 2W25A 4MEXF 3G6EI 1R1VA 3CQZJ 3TGNA 2DO7A 3JSPA 3FX3A 3E0JB 4RB2C 3W3CA 2WB1A 3EPZA 2VOPA 1FWZA 1BBYA 1FMWA 1GUUA 2M1BA 2DTRA 1KYZA 2MABA 3DV8A 3WTTC 2HS5A 3GWZA 3G71I 3ISPA 3PNVA 4FT8A 4P9UA 2FOWA 3BG6A 4KDPA 1W7PA 3QAHA 3FM3A 2FEZA 3LSGA 3ABTA 5JFRA 1VQ4I 1IF1A 2DJIA 3F3XA 2DFFA 1RETA 1SFOJ 1K6YA 4E7LA 1Y39A 3ZGKA 3OYLA 2K5CA 3S2HJ 5E3LA 1G6NA 3IRQA 4L9JA 1P7JA 4XONA 2EZHA 3KETA 2L4AA 3K1NA 5DYMA 5IYCJ 2CJJA 3DTEA 2ESHA 5LEKA 2P8TA 1VQLI 2LH9A 1FOKA 4JK1X 1YI2I 4RMNA 1Y1WJ 2LK2A 1HQCA 1ZG3A 3TDUC 3SJMA 2YSRA 4HA8A 3TP0A 2GM4A 2DLLA 3OIQA 1JKQC 1MGTA 1CGPA 3OL4A 4A3MJ 5HODA 1BW5A 1W5SA 4IOAF 1E3PA 5E8GA 5F27A 2VKHA 1ITYA 1FOXA 2LDUA 4XN3A 3FISA 4J00A 1KA8A 2UUZA 2AO9A 5E3OA 2ICWG 1ETQA 1U78A 2O8XA 1P4XA 5L3BA 3PSIA 1K4SA 2LC2A 1UHSA 5HDGA 1LFBA 1N78A 4G7HF 4HNVA 1EH8A 1RKWA 3OYGA 3WTZA 4G6QA 5FKOA 3DLLF 5C4JJ 3WTSC 1VQMI 4OMYA 2FBHA 1BL0A 1LJ9A 3TW7A 2DA5A 2K9LA 5JI6A 5ICEA 5HLIA 2LREA 3R60A 5GADJ 1U5TC 2VC0A 5EGOA 1LDDA 2I10A 3PSFA 1S7AA 2HVRA 5ED4A 2HYJA 2OV7A 1P7IA 1R58A 4B8XA 3IH4A 2PX9A 4XOPA 2YU3A 3DPTA 1YTYA 2A05A 3SXYA 1FBSA 2PN6A 2ZFUA 3CUQC 1LVKA 2DFEA 3ROUA 1HDPA 1R00A 4XLCA 2A6EF 1HC8A 2L54A 1IDZA 3WE2A 1RKTA 3E3VA 2L3DA 5EZGA 2PFBA 3CJQB 2XGCA 4UVCA 1TBXA 2FBIA 1WFXA 2E5ZA 1XMAA 1XTAA 4KN4X 5LGTA 1MSFC 4ENJA 4D5CA 3VWBA 1IN4A 4BNCA 1TW3A 1K78B 2IXSA 1S3JA 2MSYA 5GAEJ 2VBYA 3V4GA 4UB8C 4FX0A 3WGHA 5LLQA 2UXNA 2HPMA 2HPIA 3K10A 1XSVA 5DUIA 3J81K 1ZYRF 4OOIA 4HRIA 2HQNA 1SVLA 4JOMA 5M5YJ 1YITI 3FKJA 5HVQC 1UELB 1ZRCA 3GX4X 4FE4A 2VJIA 3OYDA 2KDZA 5FFXA 3ZMTA 3ZQLA 4AYBA 3NARA 3I3LA 4MQ9F 2JZYA 5HLHA 4BBSJ 4EJTA 2CH0A 5GPAA 3REOA 2VKEA 2VXDA 3F8BA 3HG9A 1WI9A 1KYWA 3JRCA 2Y48A 3F21A 4PJ0C 2A68F 4EGYA 3K4MA 2L01A 3ZQFA 1HSTA 3M7GA 4HF1A 3L09A 2WAQA 4DBRA 1WJFA 4AVPA 1FEXA 2ISZA 1QPIA 1ZLKA 3ZPLA 4BDYA 5TISC 3QU3A 1SD7A 1R5HA 4Y13A 3BJAA 2LFBA 2OZUA 3BJ6A 2QUFA 3B73A 3K9TA 4RM2A 3S3OA 4FCYA 3G3ZA 2F6CA 1D0ZA 1RZ4A 2HNHA 4MLOA 2LF7A 2X9DA 5F0CA 4BGDA 1DDNA 4A3LJ 1SVMA 2DA6A 1WJEA 1W7PD 1XDSA 2XAHA 5B66C 3ABLH 5D4RA 3HJEA 2VLAA 1YFHA 1P9QC 5BS6A 1KQ9A 3HB9A 3RPQA 2X1EA 1BA5A 4DIQA 2BV6A 2BOLA 4QWQA 4NDLA 1ORKA 1XB4A 3KP3A 2DOEA 2EK5A 4RAFA 3V7SA 4E7SA 2B9SA 1VF9A 2K4BA 1VQ9I 5JR3A 5LHIA 4IJAA 1Y1VJ 1YJWI 2KKOA 3TP3A 3OSGA 1AKHB 3TQNA 4CA0A 2GIVA 5FD6A 3DCFA 1Q1HA 6PAXA 3FXRA 2EFPA 3N05A 1JI8A 2YX4A 2R7RA 2P4WA 2F48A 4D5FA 1OQYA 3KP6A 5DD8A 4ZYHA 2X6WA 3OYNA 1YS6A 2VI6A 4U88A 1BN5A 2R5ZB 2RVCA 1FOYA 3BZCA 3KYLA 1XX5A 4IZZA 3EUHA 3U2RA 4WCGA 3VPRA 2IT0A 1ETYA 2Z1DA 3AG2H 5GAGJ 4G6TB 4N9HA 2E2IJ 4E70A 3GTKJ 3S1NJ 1VQNI 2HI3A 3RPUA 4ETSA 2Q0OA 5F0HA 4GFBA 3PFIA 2M3AA 3IUOA 2DMNA 2M30A 4MIMA 4C30A 2EIJH 2DT7B 4KA4A 1J59A 2XC7A 4L5JA 1K79A 4DW6A 5L3EA 1N75A 2VQHA 3RJPA 2O5RA 3JTHA 4U0YA 3JREA 4BXXJ 5H6RA 2G0EA 2GAUA 4I2OA 1HXDA 1G3SA 1K4TA 2PG4A 5CPRB 3OYFA 2VE9A 5IP6A 1ETVA 1TWCJ 1STZA 2DK5A 4Y52J 1JUSA 4CUGA 3RYPA 1P4WA 1MIJA 2BGCA 1I6XA 3OYKA 4IQJA 5DUKA 1BJAA 5FROA 1RIOH 4LB5A 2CW0F 2LR8A 2KISA 3R0JA 2EJRA 4OIOF 2Z99A 4HSTA 3GZ6A 1R49A 2IS4A 2XKPA 2IBDA 5GPCA 1DU6A 1ETOA 3CTAA 2XSJC 4DZPA 1OISA 2HZTA 2EZKA 5DM7F 4U87A 2ETHA 3CMMA 1UFMA 2E71A 1QA6A 3K6GA 5F64A 4B44A 4CO8A 2DOFA 2JA8J 2HXIA 2QM3A 3DEUA 2QF7A 2GBYA 2GIZA 4UV9A 2NOGA 1JHFA 5GAHJ 1T0FA 1HW5A 2A6HF 2XSDC 2HZDA 3GFMA 1LFPA 3QYEA 2STWA 4AM3A 1XDUA 4OMZA 5F04A 1YOVB 3OMYA 1Z7UA 3L2VA 3CF5F 1PUFA 3BCAA 3QPLA 3CDHA 3D1NI 1FMVA 4LMYA 3S15J 4KITB 1PYVA 1DGWY 2RQQA 3K1MA 3QQAA 1WCMJ 3FHNA 3QOPA 3WG9A 1J9IA 2ZSHB 1OR7A 2M8GX 4M9XA 4L9NA 1IW7F 3F22A 1FP2A 1YJ9I 2KP6A 4HEA2 1UG0A 5IT3A 4U0WA 2WB1N 3A0BC 4L5EA 3T8RA 3ERMA 1B72B 2K7LA 1LFUP 4M6YA 4RB1A 3MKYB 5F0FA 2E2HJ 1NG6A 4NNJA 1AWCA 1UG2A 4HX8A 3H9JA 3HXLA 2R7FA 2ZXHA 4JX6A 1SC7A 2P5LC 3IH3A 4ZYAA 3FZVA 4B09A 1BJZA 3RKXA 2A61A 4XLPF 1UHMA 1B1BA 3ECHA 2VE8A 1QZZA 3LA7A 4XK4A 1IN5A 1A6QA 2HWVA 4HSRA 3ZQHA 3J7AY 4ZDPA 4F7ZA 2XAUA 3H3ZA 2Z2SB 3Q0UA 4AWXB 4OAZA 1JHHA 2OZ6A 2VKVA 2XB0X 1UJ8A 3JR9A 4LLGF 2MGQA 5E1WA 2M87A 1DU0A 3W2AA 3TL4X 1MNDA 1DP7P 3ZMUA 5CVJA 4DBQA 2DU9A 4ZC3A 5D8LB 2B0LA 4DYRA 5KAFC 2MH2A 2KPMA 2E36A 2ELKA 2M2EA 3EYIA 3GTQJ 4EJUA 3HPHA 1NK2P 2W1OA 2ZXWH 3ZMZA 2WY8Q 2Q2EB 2OQGA 2XF5A 2DK8A 3C2BA 3HEFA 1ZR2A 3FDYA 3VOEA 1O7FA 2L7KA 1D0YA 3DFGA 3RYRA 3CF2A 4F93B 1NH3A 2HU9A 1ZHFA 2R5ZA 5B3SH 4PZJA 2LNBA 1HW2A 1Z21A 1GXPA 2K40A 1BOAA 2IS2A 2RV8A 1W4MA 3GFJA 4RDUA 1LVAA 4M3FA 3CDIA 1R5GA 2MG4A 4S05A 2OAZA 2M0CA 2JRTA 3ZXSA 4LG3A 3WHBA 2JVGA 3HUGB 4B4CA 1T6SA 3HTSB 1QZYA 2M7AA 2V1XA 1F9NA 3BROA 3DKYA 4IF4A 4W97A 1GDTA 1HCRA 4G7ZF 2ZXJA 3FXKA 4HYEA 3Q0VA 3GEZA 4YG2F 1BW6A 2JTVA 5D5XB 2Z3YA 4Q47A 2OPTA 1OJLA 3RPUD 4B47A 2ADUA 5HNHA 2HVSA 3FMQA 4CZZA 1MBFA 1KQ0A 1FJLA 4BDZA 1J2XA 1MBHA 2V6EA 2QLZA 1R22A 3MN2A 3DPUA 4BQNA 5CQGA 1H9TA 2TDXA 2VPLA 1YYVA 4BS9A 4Y17A 3SEZA 4C2MJ 2R92J 1UZCA 3PQJA 1D1CA 3HGYA 4RLQA 2DW4A 4M3EA 4M6XA 2JA7J 1Z67A 4IO9F 2LLKA 2I8DA 3E5XA 4B48A 4HG2A 3PUBA 3OWTA 3K1PA 5HS8A 3HL2A 4XQFA 3H0GJ 3CP8A 2HOSA 2NYXA 3VFZA 1T98A 3OYHA 4RA2A 2WV1A 2A69F 4E7ZA 5LHGA 1LE8B 4ZYDA 3RZOJ 2IW5A 4ZH4F 5ICGA 5LBQA 1ZQ3P 1TWHJ 1TWFJ 5D5WB 4C3JJ 1Y6IA 4DGWB 3OOPA 2VQGA 1C0WA 4AYBN 2EFQA 3GZNB 2NVQJ 3S32A 1S9HA 1NHAA 2DYRH 2F5VA 1JUPA 3CCVI 2HQAA 2JUGA 3C7JA 1WPKA 1P2FA 2BVMA 3K0LA 3B6CA 1AHDP 1Q1VA 2NNNA 4XOTA 2JMWA 1O7LA 5LRSA 1KU2A 3LL7A 2XHKA 2YR2A 2D1VA 1FYMA 3HM5A 4M74A 3HOUJ 1AOYA 4WXHA 4UY8I 3UR3C 3LSHA 2XAQA 3SZTA 3TW6A 5B1AH 4A3EJ 3NRVA 2ZCWA 3FMSA 3VYSB 4W1UA 3VSKA 2E1NA 2DJNA 2EQRA 1HKTA 2BW3A 3L1PA 3PQKA 4UVAA 3H0DA 1CF7A 4C3IJ 4D7NA 1XGOA 4RLFA 3EDPA 1OYYA 1SAUA 4LK1F 3K4NA 3HGGA 1HF0A 4YEJA 1H9GA 1WJCA 2FQ3A 2A5YB 3GYHX 3DLAA 3L9FA 4LFUA 4BXUA 3ZQQA 3IV5A 1T38A 1YRNB 2DFIA 1ENHA 2FBKA 2KHMA 3EETA 2W00A 2UWMA 1MBJA 2L9SA 4KNYA 4I01A 4M73A 3V8JA 3TMOA 3OR1C 4AD9A 5JHFA 3IAS2 2DN0A 4M6VA 3PNTA 1X1PA 2FA5A 3RQIA 1JGGA 2PMZA 3BR2A 4EJWA 2Q2EA 1A6IA 1ETKA 3GF2A 1U6GA 4CICA 1SMTA 1KU7A 1TLHB 1WRJA 4HX7A 2MD0A 2RNGA 2XV4S 1TWGJ 2M0MA 2MBFA 2R7SA 3KYCB 2E1MB 1S72I 4BL0B 5J47A 3A1YA 1D1BA 2DT5A 1OFCX 3KLNA 1I50J 1TTYA 3AL0C 2GOXB 2H8RA 5FD5A 4XBFA 1P4AA 2VJJA 3WG7H 1I39A 1USTA 2V7FA 5DTDA 5L3GA 4BE1A 3IC7A 5M5XJ 1J5YA 5LRRA 2NVYJ 1MDMA 3RTRA 1IG7A 1DP3A 3OSFA 1X19A 2RQPA 2IS1A 2VJ4A 3HUGA 3O8HA 2EA4A 2X1CA 1IN7A 4PFOA 4KMUX 4M9ZA 1P6RA 1WQ2A 4HQMA 3HOTA 2FU4A 3BOQA 4M3BA 3OYIA 2NOJB 1WSUA 3M3YJ 3ML6A 4QTRA 3J7AO 2G7HA 5F08A 2JJ7A 1IO2A 4JX4A 1E3OC 3PNYA 3I4PA 2O0YA 3OYCA 4Z2YA 4Y4RA 5C44J 2HTSA 4D7MA 3FK6A 5J1YA 2E1CA 1G2HA 2AQEA 3MQ0A 1TL8A 4RM3A 1ZRFA 2JA6J 3BPVA 5C4XJ 1A5JA 2HFHA 2JRMA 3OL3A 1D1AA 2R7UA 3RZDJ 2RC4A 3HKZA 5CVIA 4I76A 4F92B 4BQOA 2F4OB 3O6BB 3WGGA 3LAJA 2ME0A 2GLOA 1YHQI 1JKPC 2ZMEA 5JVTA 3I64A 2H6CA 5BQTA 4BY7J 4CDGA 1MH4A 1RRJA 3ZN1A 4U7BA 3CESA 2R93J 1IC8A 1Z0XA 5ERIA 2A3SA 1LE8A 4ENNA 1Y8RB 3K4JA 5FRMA 4QIWN 4KIFA 4E7IA 4D9JA 5K1YA 1Y8QB 1ZELA 4CCLA 4DYQA 3E6DA 2ZFWA 1OCZH 4I09A 4RGRA 1G59A 1VQ6I 2JVHA 1TQPA 3BQZA 2K9MA 4M72A 4P5OA 5DCMA 2X0LA 2IGNA 5GTIC 4ANJA 3L2QA 3ABKH 3SQNA 1F1ZA 1JXSA 1MBKA 1D8JA 1V4RA 2NNYA 2HDDA 3WODF 1GLNA 3NEUA 4XKVA 3L7WA 5E1XA 2FUG2 4G7OF 1QZEA 1DGRM 2K9SA 4EV0A 2Z16A 1OYWA 1MD0A 3H5NA 2OF7A 4GDFA 5D6EA 2E7WA 5KK1A 3KP7A 1HA8A 4BHPA 1MJ9A 3LSJA 2X85A 4I02A 2XPUA 2VT2A 1R4MB 5IT9Z 3CP2A 1LDKB 2VOOA 3E5UA 1SD6A 1OKRA 3KP4A 1SD5A 3AG1H 3TKYA 3WE3A 1ZR4A 3F0CA 4RAYA 3ERED 4AUXA 3I0TA 2IS6A 3GUDA 3SDGA 2E35A 3I55I 3FXMA 4D0PA 1YRNA 2LBFA 1BI0A 3CCLI 2H1KA 3S1MJ 2XKOA 4ZZLA 3E97A 3VSLA 1D5YA 2JSCA 2NVUB 1S29A 4ZYEA 1RR8C 1VQKI 2DXIA 1XG1A 5DCFA 2NS8A 3CO6C 3F8MA 1VTNC 1RPWA 3ZRGA 2OTLI 4IHWA 4AIDA 5D5VB 1PVEA 2FJ1A 3MEXA 1VNDA 4R79A 3HDDA 2V4JC 1H0MA 4BQQA 2CRGA 3BG7A 2W57A 1IXRC 2LG4A 2KRHA 3F23A 3OOUA 3CJNA 2XGDA 2E2JJ 3GTPJ 1T08B 2LD5A 4QPOA 3LSKA 3CC7I 5E8IA 1BM9A 1VI0A 2NAZA 4BHBA 5K7FA 3M8EA 4MGRA 1ZN2A 2ECBA 4QLCU 2M7BA 5ICFA 1FSEA 3CZ6A 2KIFA 4FQGA 3G4SI 2A5WA 1WH5A 3KX2A 2LYCA 1UMQA 2H94A 4CCOA 1IN6A 4EEFG 2ZB9A 2ZJ2A 2Y0SA 3CUQA 3DXJF 3JTGA 3MKLA 2WC2A 1PUFB 2NXNB 1EJ9A 3BJOA 3G2BA 3K69A 3PL8A 3F72A 1OYIA 3I56I 3QYFA 2WWYA 1FIAA 4IRHA 1ZK8A 2E1OA 3MZHA 2P81A 2Y0MA 3GFLA 3PIPF 2QEXI 3U1KA 1T8IA 2VN2A 1WJDA 2BXZA 1O4XA 4KISA 4HPQA 1LDJA 1WJBA 4JQFA 2V9PA 4MFDA 3QWLA 3Q9VA 2RNJA 5DS9A 3GTOJ 4E7JA 5JVGF 1A04A 2FMYA 1S6LA 3HRSA 2PJPA 2LY2A 3C2GA 3H36A 4A3CJ 3V7RA 2YX7A 4LJZF 2IGMA 4RAZA 3T1BA 3OYAA 2L5QA 1MNMC 4HF2A 4PSWA 4ESBA 4UUSA 1RI7A 1I3AA 5FFZA 2H09A 4A5NA 2VODA 1ZKGA 4J01A 1R7JA 1SVOA 2KIUA 3HSFA 4OWRB 4PFPA 1TC3C 1BI3A 1FTZA 2AXLA 2L9VA 3OIOA 3K70C 4ZJZA 4KYWA 5EEAA 2P7VB 3PFYA 4MEYF 4B1RA 4BY1J 3E1SA 5K7HA 5C3EJ 2V9VA 3DEWA 3BY6A 2K02A 2QYOA 1MMAA 1V55H 1J09A 3M1EA 2BE5F 2VXZA 2XPVA 1IUYA 4HNTA 3QPTA 1IRZA 2PMUA 3EUHC 5J8CA 4RAGA 2JN6A 1LUJB 3CCYA 3BTCA 5FJ8J 1LEAA 2XAFA 3P5JA 4E7HA 1JT6A 1GHCA 4A3FJ 2Y9ZA 1FZPB 1GV2A 2EWNA 3ULQB 1UHWA 3AKZA 4BBRJ 3CUOA 2CYYA 2RGVA 4F91B 4WK8F 3F6OA 3WTYC 2LP0A 4CSWA 3CCQI 4QPQA 4FETA 2CWEA 4C2UA 1G4DA 4CCMA 4B43A 2FE3A 1HSJA 3AAFA 3CC4I 3KZYA 3RI4A 1XGMA 3W2VA 3BT9A 2FRHA 2CV1A 1QVUA 5J8FA 4U0VA 1MBGA 3D5SC 3U9GA 1WGXA 2CQNA 2RREA 5AONA 2QA4I 3CCJI 1QBJA 4LD5A 2GA1A 3DQVC 3J7YJ 3QP6A 3P9CA 2ZKZA 2FNPA 3SZGA 3UKGA 1S7OA 9ANTA 4G12A 1RNLA 3Q5FA 3LSRA 3F6VA 1Z05A 4FASD 2ZSIB 3ASOH 3BQYA 4YIRX 3HIFA 4HZFA 1QQIA 4B3AA 4RBOA 3D0SA 1IGNA 5IT9K 2FXAA 3S93A 3RKQA 3F8NA 3D5RC 1KZHA 1FYLA 3SFZA 1OLTA 1B4AA 4RS8A 4P96A 2OJED 1Z9CA 3N97A 1U8BA 2P5KA 1T0FC 3BZKA 1VQ8I 2B63J 1Y56A 2CV0A 1JTYA 4CCKA 1JGSA 3NQOA 1OCTC 2ECCA 4ZDLA 2HOTA 3WHCA 2DCEA 5L3FA 3DKXA 2PMZN 4CYCA 2O9LA 2KJBA 1BOBA 4FHTA 3JRHA 1RUNA 2L0KA 1ODDA 4XRMA 3K4KA 4XLFA 2EZIA 2KL4A 5CVUA 1G3TA 3K2ZA 4BE2A 3GTGJ 4P9FA 1ERDA 3KE2A 2LY9A 4E6KG 3ABUA 1H8AC 2PLYA 2HEOA 3V42A 1XSXA 3WU0A 1CQTA 2IPQX 3DF8A 5D4SA 2P0WA 1REPC 4FX4A 4LGWA 2ZJRF 3OS2A 1FLIA 3ZMSA 2VL8A 2DT6A 5BOXA 2QQ8A 1OMIA 3D5LA 4Y7NJ 4XSZF 3R61A 4BE0A 4JYKA 2DA1A 4IPAA 4Y33A 3GTLJ 2F2EA 1XD7A 4JBAA 3HSEA 1D3YA 1G3YA 4C2TA 3PO3J 3J7ZI 5M3MJ 2CS3A 5CVRA 1V54H 3MFKA 3S8PA 3V8LA 2X1DA 1JKRC 3Q3SA 5ILUA 4EJOA 4IHYA 1X1AA 3FXLA 3W2WA 4ITVA 2K3FA 1Z6TA 1XGNA 1T2KA 2EV0A 1R36A 4A0XA 2CQ7A 1R9TJ 3H3VK 3VYTB 2DTZA 3KZZA 2K86A 1MBEA 1YIOA 5IYBJ 1LKXA 2BW3B 4H4KC 3DP7A 3ELKA 1FT9A 3FKIJ 4GYIA 3M9AA 1Z3XA 4XL9A 3X2QH 5J4VA 1X58A 3I71A 1CF7B 1ZGAA 3I53A 3IH2A 2IGOA 3MMYB 3HKZN 3SZPA 5GTHC 2E5NA 2DQLA 4DQ2A 5JHUA 4NHJA 3K2AA 4IEJA 4PJNA 3MZ8A 2CMPA 4CGZA 2LKSA 4KT5C 5EF6A 5CKTA 3R4KA 3F8FA 3KZIC 3WU2C 2HDCA 5FB2A 2CW7A 4PSXA 5H6QA 1W5TA 2DDAA 1FP1D 2OC6A 4O6JA 1JJ6C 5EJCA 2JQ7A 4WXCA 2QWWA 2JSPA 2VBWA 4WF2A 3CD6I 4J19A 4II3A 4XKWA 1QRYA 1S7EA 4EQQA 2V6CA 2OQRA 3GZ5A 1QO0D 4F3QA 3KEYA 5JLXA 4HX4A 3V7CA 4IKFA 1JTXA 4NC7A 2X6XA 4A3IJ 4A6EA 3CCEI 5LEJA 1LPQA 3K70D 3QU6A 2PJRA 2VB6A 3DTIA 5J1RA 3VYRB 1X1CA 2LY1A 1MDMB 2HOEA 3H1CA 2VBXA 4HF0A 4FISA 2WTEA 2EIMH 3ESWB 1HW1A 4TV7A 3CCRI 4UUTA 3JRIA 5EDNA 3BTIA 1W36C 2KQRA 1Z7LA 5HLGA 2HYGD 3OR2C 4IX7A 3EUKL 4V2FA 4KMFA 4JX5A 2Q1ZB 4BH9A 2EV6A 1BC7C 2Y69H 1JKOC 2I5UA 4I6ZA 2DQRA 1JUMA 1BIBA 1M1EB 1MMSA 1YLFA 1WJ5A 3BR1A 3O3KA 2DBBA 5DEQA 2Z9OA 4C9YA 4KT6A 4LG0B 1TWAJ 3S2WA 1EKEA 1OCRH 2R0QC 4XIDA 5TRDA 4LLLA 3ZQ7A 1SEUA 3CLQA 3IHUA 1WZ2A 2PEXA 5J4YA 5FGMA
chains in the Genus database with same CATH topology
1E3OC 4FE4A 2EBIA 2KDZA 1APLC 3ZQLA 2D5VA 5E3MA 5BNGA 5C44J 3NARA 4D7MA 3FK6A 5J1YA 4BBSJ 5GPAA 3BG9A 1G2HA 1W0TA 2VKEA 2Y2ZA 2ID3A 3JRGA 2JA6J 3JRCA 5C4XJ 1A5JA 3HOWJ 3B6AA 5IP7J 2ME6A 3RZDJ 3ZQFA 2JA5J 4I76A 3S1RJ 1FEXA 1QPIA 3LNQA 4IHVA 3ZOBA 2ME0A 1H88C 2GLOA 4A3DJ 3M4OJ 1JKPC 2LFBA 4V2GA 4BY7J 1MH4A 2R93J 1IC8A 1Z0XA 2Y0SN 4FCYA 1LE8A 4QIWN 4MLOA 4DYQA 3Q0WA 2DA4A 5F0CA 2X9DA 4A3LJ 3HOXJ 1ETWA 2DA6A 3BQZA 2WAQN 5GP9A 4A93J 3GTMJ 4M3DA 1MBKA 3HB9A 1BA5A 3BR5A 2HDDA 5EZHA 2R5YB 2N8GA 4NDLA 3BTJA 1ORKA 5F1JA 1OCPA 1HDDC 1MSEC 2K9SA 1VF9A 4M3GA 2OF7A 2MW8A 4BKXA 1Y1VJ 2X6OA 3TP3A 3OSGA 1AKHB 1B8IB 3LSJA 4ABZA 5J1UA 2XPUA 4XICA 3DCFA 3O8GA 5FKNA 3GTJJ 2CU7A 3BG3A 1ZR4A 4D5FA 1RESA 3F0CA 5FLVA 2VI6A 2XPWA 3G1MA 4AUXA 2R5ZB 1F43A 1T56A 2O8KA 3SDGA 1AKHA 1B8IA 3VPRA 1ETYA 1YRNA 3I4NJ 2H1KA 3S1MJ 2L7ZA 2E2IJ 1D5YA 1IUFA 3GTKJ 3S1NJ 3FIWA 4AC0A 2HI3A 3JRDA 1NTCA 5F0HA 4GFBA 1XG1A 3E7LA 2DMNA 4MIMA 2K9NA 2NS8A 3GBGA 5IOYA 4DW6A 1RPWA 3SFIA 3JREA 4IHWA 1NK3P 4BXXJ 3S14J 2G0EA 3S2DJ 2FJ1A 2LTPA 1U9NA 1VNDA 2FD5A 3HDDA 2Y31A 5IP6A 1ETVA 1TWCJ 1HOMA 2CRGA 2LVSA 4Y52J 1JUSA 2YU9J 3BR6A 3OOUA 2XGDA 3G1LA 2E2JJ 3GTPJ 2AHQA 2W48A 2LR8A 1GVDA 2LD5A 1QVTA 1VI0A 2VPRA 4XRSA 5K7FA 5GPCA 2IBDA 2ECBA 2QCOA 1DU6A 1ETOA 4A69C 1WH5A 4DZPA 1IV6A 1UMQA 4EEFG 2ZB9A 2EZKA 5FKKA 3MKLA 3A02A 4XRSG 1PUFB 2DMQA 1FIPA 5JLWA 2JA8J 2X48A 2HXIA 2YUSA 2QF7A 1FIAA 2GBYA 2NOGA 1ZK8A 2E1OA 5IOZA 3ZQIA 2P81A 2L7FP 2XSDC 4UUSB 5EYRA 3BG5A 1O4XA 2JK3A 4S0HB 4JP0A 1K61A 5F04A 2O7OA 2CUFA 4MFDA 1PUFA 5DS9A 1XS9A 3QPLA 3GTOJ 1WH7A 3D1NI 3S17J 1ETXA 4X1EA 3S15J 3QQAA 2IEKA 2R7ZJ 1WCMJ 2Y30A 4A3CJ 1MNMC 1ZTRA 2M8GX 3W6VA 4UUSA 3A01B 2TRTA 2EH3A 3FK7A 2WB1N 1ZKGA 4L5EA 3ZQGA 2NS7A 1B72B 1TC3C 2DMPA 2EZLA 3NAUA 1LFUP 1FTZA 5F0FA 3OIOA 2E2HJ 2ID6A 5EEAA 4BY1J 1UG2A 4B1RA 4A3BJ 5K7HA 3MVPA 5C3EJ 2CQQA 4JX6A 3DEWA 3IH3A 4LOCA 1BJZA 1MH3A 2K9QA 3ZQCA 1XC5A 3CMYA 2L7MP 3I4MJ 2XPVA 4XK4A 1B72A 3CDLA 1IRZA 2HXOA 2LKXA 5FKMA 3ZQHA 2JN6A 3CCYA 3Q0UA 3BTCA 5FJ8J 4A3JJ 2VKVA 1Z77A 2XB0X 1JT6A 3JR9A 4A3FJ 2DMTA 2MGQA 2Y9ZA 2R5YA 1GV2A 5FLMJ 1DU0A 4IHXA 4BBRJ 4MO7A 2FQ4A 2TCTA 2LP0A 2YS9A 2DA2A 2M34A 4DYRA 5EGOB 2ELKA 2M2EA 1U9OA 3GTQJ 5J3LA 3BT9A 1NK2P 4QSHA 3C2BA 1QVUA 3HEFA 3LSPA 3TEDA 3JRBA 1MBGA 1WGXA 1ZR2A 4X6AJ 2E19A 3BR0A 2R5ZA 3HOYJ 2M9HA 3PO2J 3UKGA 3BR3A 9ANTA 5E3NA 2K40A 1GT0C 3LOCA 4G12A 1ZGWA 1JJ8C 1F36A 3LSRA 2XRLA 3BQYA 4RDUA 4M3FA 4FTHA 2MG4A 1FTTA 2M0CA 1K83J 4B3AA 4RBOA 3PM1A 2CUEA 1IGNA 3WHBA 3RKQA 2NVTJ 1RR7A 4B4CA 4CYCB 1X2NA 3S16J 4A3KJ 2XB5A 4W97A 1POGA 4C3HJ 1GDTA 1HCRA 1U8BA 3JRAA 3HOVJ 5FKLA 3Q0VA 2B63J 3BTLA 1HLVA 1BW6A 1JTYA 2VUMJ 1OCTC 2ECCA 2HOTA 3WHCA 2OPTA 1OJLA 4CYCA 2PMZN 2O9LA 1JT0A 3QPSA 4DYCA 1X2MA 5EG0B 3JRHA 1EF4A 2L0KA 1MBFA 2RAEA 4XRMA 1FJLA 3CQZJ 1MBHA 2EZIA 3GTGJ 2DA7A 2LY9A 3MN2A 1GUUA 1H8AC 1IDYA 3A03A 1CQTA 4C2MJ 5IPAA 5EG0A 2R92J 3HGYA 4M3EA 2JA7J 4Y7NJ 2LLKA 3LSGA 4JYKA 2DA1A 3H0GJ 3GTLJ 2HOSA 1RETA 1SFOJ 5M3FJ 3PO3J 2WV1A 5M3MJ 1LE8B 4DZJA 3RZOJ 3S2HJ 5E3LA 2JWTA 2L9RA 1P7JA 1JKRC 1ZQ3P 1TWFJ 1TWHJ 3Q3SA 2EZHA 4IHYA 1I6HJ 4C3JJ 2HQ5A 5IYCJ 2CJJA 3HOZJ 4AYBN 1AU7A 5IP9J 1R9TJ 2NVQJ 3A01A 3H3VK 2CQXA 2DTZA 1Y1WJ 1JUPA 4FE7A 2LK2A 1WPKA 1MBEA 5IYBJ 3B6CA 1AHDP 3FKIJ 1Q1VA 3SJMA 2JMWA 3K7AJ 1X58A 3TP0A 2GM4A 1JKQC 3IH2A 3HKZN 3HM5A 3HOUJ 4A3MJ 3JRFA 5HODA 3K2AA 4IEJA 3TW6A 1BW5A 4A3EJ 4W1UA 5F27A 5EF6A 4A3GJ 1ITYA 2DMUA 2DJNA 2COBA 2EQRA 3FISA 3L1PA 2AO9A 5E3OA 1ETQA 1U78A 1IJWC 4C3IJ 4D7NA 1JJ6C 3HGGA 1HF0A 4MFEA 1UHSA 1SANA 1LFBA 2DA3A 4HNVA 2FX0A 1W0UA 1RKWA 1T33A 1WI3A 2XGEA 4J19A 3IV5A 1YRNB 1ENHA 5FKOA 5C4JJ 1S7EA 1QRYA 1MBJA 1BL0A 3S1QJ 3TW7A 5JLXA 2DA5A 1JTXA 5EGOA 4A3IJ 2NVXJ 2I10A 2DN0A 4M6VA 3G1OA 3RQIA 1JGGA 1I3QJ 3BR2A 2HYJA 1ETKA 1A6IA 1P7IA 3IH4A 2Y9YA 5J1RA 5K7ZA 4FISA 1HDPA 1TWGJ 4UUTA 1IDZA 1RKTA 3JRIA 1OFCX 5EDNA 1I50J 3BTIA 1H89C 5EZGA 2KT0A 2XGCA 2HOAA 2H8RA 1MSFC 5DTDA 4D5CA 4V2FA 5M5WJ 5M5XJ 4JX5A 2NVYJ 1IG7A 3OSFA 2MSYA 3HBLA 1JKOC 5IYDJ 4I6ZA 1VFCA 3O8HA 1JUMA 3BR1A 4M3BA 1TWAJ 3M3YJ 2R0QC 4XIDA 4QTRA 5F08A 5M5YJ 2JJ7A 4JX4A 1GV5A 2IAIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E3O C;  4FE4 A;  2EBI A;  2KDZ A;  1APL C;  3ZQL A;  2D5V A;  5E3M A;  5BNG A;  5C44 J;  3NAR A;  4D7M A;  3FK6 A;  5J1Y A;  4BBS J;  5GPA A;  3BG9 A;  1G2H A;  1W0T A;  2VKE A;  2Y2Z A;  2ID3 A;  3JRG A;  2JA6 J;  3JRC A;  5C4X J;  1A5J A;  3HOW J;  3B6A A;  5IP7 J;  2ME6 A;  3RZD J;  3ZQF A;  2JA5 J;  4I76 A;  3S1R J;  1FEX A;  1QPI A;  3LNQ A;  4IHV A;  3ZOB A;  2ME0 A;  1H88 C;  2GLO A;  4A3D J;  3M4O J;  1JKP C;  2LFB A;  4V2G A;  4BY7 J;  1MH4 A;  2R93 J;  1IC8 A;  1Z0X A;  2Y0S N;  4FCY A;  1LE8 A;  4QIW N;  4MLO A;  4DYQ A;  3Q0W A;  2DA4 A;  5F0C A;  2X9D A;  4A3L J;  3HOX J;  1ETW A;  2DA6 A;  3BQZ A;  2WAQ N;  5GP9 A;  4A93 J;  3GTM J;  4M3D A;  1MBK A;  3HB9 A;  1BA5 A;  3BR5 A;  2HDD A;  5EZH A;  2R5Y B;  2N8G A;  4NDL A;  3BTJ A;  1ORK A;  5F1J A;  1OCP A;  1HDD C;  1MSE C;  2K9S A;  1VF9 A;  4M3G A;  2OF7 A;  2MW8 A;  4BKX A;  1Y1V J;  2X6O A;  3TP3 A;  3OSG A;  1AKH B;  1B8I B;  3LSJ A;  4ABZ A;  5J1U A;  2XPU A;  4XIC A;  3DCF A;  3O8G A;  5FKN A;  3GTJ J;  2CU7 A;  3BG3 A;  1ZR4 A;  4D5F A;  1RES A;  3F0C A;  5FLV A;  2VI6 A;  2XPW A;  3G1M A;  4AUX A;  2R5Z B;  1F43 A;  1T56 A;  2O8K A;  3SDG A;  1AKH A;  1B8I A;  3VPR A;  1ETY A;  1YRN A;  3I4N J;  2H1K A;  3S1M J;  2L7Z A;  2E2I J;  1D5Y A;  1IUF A;  3GTK J;  3S1N J;  3FIW A;  4AC0 A;  2HI3 A;  3JRD A;  1NTC A;  5F0H A;  4GFB A;  1XG1 A;  3E7L A;  2DMN A;  4MIM A;  2K9N A;  2NS8 A;  3GBG A;  5IOY A;  4DW6 A;  1RPW A;  3SFI A;  3JRE A;  4IHW A;  1NK3 P;  4BXX J;  3S14 J;  2G0E A;  3S2D J;  2FJ1 A;  2LTP A;  1U9N A;  1VND A;  2FD5 A;  3HDD A;  2Y31 A;  5IP6 A;  1ETV A;  1TWC J;  1HOM A;  2CRG A;  2LVS A;  4Y52 J;  1JUS A;  2YU9 J;  3BR6 A;  3OOU A;  2XGD A;  3G1L A;  2E2J J;  3GTP J;  2AHQ A;  2W48 A;  2LR8 A;  1GVD A;  2LD5 A;  1QVT A;  1VI0 A;  2VPR A;  4XRS A;  5K7F A;  5GPC A;  2IBD A;  2ECB A;  2QCO A;  1DU6 A;  1ETO A;  4A69 C;  1WH5 A;  4DZP A;  1IV6 A;  1UMQ A;  4EEF G;  2ZB9 A;  2EZK A;  5FKK A;  3MKL A;  3A02 A;  4XRS G;  1PUF B;  2DMQ A;  1FIP A;  5JLW A;  2JA8 J;  2X48 A;  2HXI A;  2YUS A;  2QF7 A;  1FIA A;  2GBY A;  2NOG A;  1ZK8 A;  2E1O A;  5IOZ A;  3ZQI A;  2P81 A;  2L7F P;  2XSD C;  4UUS B;  5EYR A;  3BG5 A;  1O4X A;  2JK3 A;  4S0H B;  4JP0 A;  1K61 A;  5F04 A;  2O7O A;  2CUF A;  4MFD A;  1PUF A;  5DS9 A;  1XS9 A;  3QPL A;  3GTO J;  1WH7 A;  3D1N I;  3S17 J;  1ETX A;  4X1E A;  3S15 J;  3QQA A;  2IEK A;  2R7Z J;  1WCM J;  2Y30 A;  4A3C J;  1MNM C;  1ZTR A;  2M8G X;  3W6V A;  4UUS A;  3A01 B;  2TRT A;  2EH3 A;  3FK7 A;  2WB1 N;  1ZKG A;  4L5E A;  3ZQG A;  2NS7 A;  1B72 B;  1TC3 C;  2DMP A;  2EZL A;  3NAU A;  1LFU P;  1FTZ A;  5F0F A;  3OIO A;  2E2H J;  2ID6 A;  5EEA A;  4BY1 J;  1UG2 A;  4B1R A;  4A3B J;  5K7H A;  3MVP A;  5C3E J;  2CQQ A;  4JX6 A;  3DEW A;  3IH3 A;  4LOC A;  1BJZ A;  1MH3 A;  2K9Q A;  3ZQC A;  1XC5 A;  3CMY A;  2L7M P;  3I4M J;  2XPV A;  4XK4 A;  1B72 A;  3CDL A;  1IRZ A;  2HXO A;  2LKX A;  5FKM A;  3ZQH A;  2JN6 A;  3CCY A;  3Q0U A;  3BTC A;  5FJ8 J;  4A3J J;  2VKV A;  1Z77 A;  2XB0 X;  1JT6 A;  3JR9 A;  4A3F J;  2DMT A;  2MGQ A;  2Y9Z A;  2R5Y A;  1GV2 A;  5FLM J;  1DU0 A;  4IHX A;  4BBR J;  4MO7 A;  2FQ4 A;  2TCT A;  2LP0 A;  2YS9 A;  2DA2 A;  2M34 A;  4DYR A;  5EGO B;  2ELK A;  2M2E A;  1U9O A;  3GTQ J;  5J3L A;  3BT9 A;  1NK2 P;  4QSH A;  3C2B A;  1QVU A;  3HEF A;  3LSP A;  3TED A;  3JRB A;  1MBG A;  1WGX A;  1ZR2 A;  4X6A J;  2E19 A;  3BR0 A;  2R5Z A;  3HOY J;  2M9H A;  3PO2 J;  3UKG A;  3BR3 A;  9ANT A;  5E3N A;  2K40 A;  1GT0 C;  3LOC A;  4G12 A;  1ZGW A;  1JJ8 C;  1F36 A;  3LSR A;  2XRL A;  3BQY A;  4RDU A;  4M3F A;  4FTH A;  2MG4 A;  1FTT A;  2M0C A;  1K83 J;  4B3A A;  4RBO A;  3PM1 A;  2CUE A;  1IGN A;  3WHB A;  3RKQ A;  2NVT J;  1RR7 A;  4B4C A;  4CYC B;  1X2N A;  3S16 J;  4A3K J;  2XB5 A;  4W97 A;  1POG A;  4C3H J;  1GDT A;  1HCR A;  1U8B A;  3JRA A;  3HOV J;  5FKL A;  3Q0V A;  2B63 J;  3BTL A;  1HLV A;  1BW6 A;  1JTY A;  2VUM J;  1OCT C;  2ECC A;  2HOT A;  3WHC A;  2OPT A;  1OJL A;  4CYC A;  2PMZ N;  2O9L A;  1JT0 A;  3QPS A;  4DYC A;  1X2M A;  5EG0 B;  3JRH A;  1EF4 A;  2L0K A;  1MBF A;  2RAE A;  4XRM A;  1FJL A;  3CQZ J;  1MBH A;  2EZI A;  3GTG J;  2DA7 A;  2LY9 A;  3MN2 A;  1GUU A;  1H8A C;  1IDY A;  3A03 A;  1CQT A;  4C2M J;  5IPA A;  5EG0 A;  2R92 J;  3HGY A;  4M3E A;  2JA7 J;  4Y7N J;  2LLK A;  3LSG A;  4JYK A;  2DA1 A;  3H0G J;  3GTL J;  2HOS A;  1RET A;  1SFO J;  5M3F J;  3PO3 J;  2WV1 A;  5M3M J;  1LE8 B;  4DZJ A;  3RZO J;  3S2H J;  5E3L A;  2JWT A;  2L9R A;  1P7J A;  1JKR C;  1ZQ3 P;  1TWF J;  1TWH J;  3Q3S A;  2EZH A;  4IHY A;  1I6H J;  4C3J J;  2HQ5 A;  5IYC J;  2CJJ A;  3HOZ J;  4AYB N;  1AU7 A;  5IP9 J;  1R9T J;  2NVQ J;  3A01 A;  3H3V K;  2CQX A;  2DTZ A;  1Y1W J;  1JUP A;  4FE7 A;  2LK2 A;  1WPK A;  1MBE A;  5IYB J;  3B6C A;  1AHD P;  3FKI J;  1Q1V A;  3SJM A;  2JMW A;  3K7A J;  1X58 A;  3TP0 A;  2GM4 A;  1JKQ C;  3IH2 A;  3HKZ N;  3HM5 A;  3HOU J;  4A3M J;  3JRF A;  5HOD A;  3K2A A;  4IEJ A;  3TW6 A;  1BW5 A;  4A3E J;  4W1U A;  5F27 A;  5EF6 A;  4A3G J;  1ITY A;  2DMU A;  2DJN A;  2COB A;  2EQR A;  3FIS A;  3L1P A;  2AO9 A;  5E3O A;  1ETQ A;  1U78 A;  1IJW C;  4C3I J;  4D7N A;  1JJ6 C;  3HGG A;  1HF0 A;  4MFE A;  1UHS A;  1SAN A;  1LFB A;  2DA3 A;  4HNV A;  2FX0 A;  1W0U A;  1RKW A;  1T33 A;  1WI3 A;  2XGE A;  4J19 A;  3IV5 A;  1YRN B;  1ENH A;  5FKO A;  5C4J J;  1S7E A;  1QRY A;  1MBJ A;  1BL0 A;  3S1Q J;  3TW7 A;  5JLX A;  2DA5 A;  1JTX A;  5EGO A;  4A3I J;  2NVX J;  2I10 A;  2DN0 A;  4M6V A;  3G1O A;  3RQI A;  1JGG A;  1I3Q J;  3BR2 A;  2HYJ A;  1ETK A;  1A6I A;  1P7I A;  3IH4 A;  2Y9Y A;  5J1R A;  5K7Z A;  4FIS A;  1HDP A;  1TWG J;  4UUT A;  1IDZ A;  1RKT A;  3JRI A;  1OFC X;  5EDN A;  1I50 J;  3BTI A;  1H89 C;  5EZG A;  2KT0 A;  2XGC A;  2HOA A;  2H8R A;  1MSF C;  5DTD A;  4D5C A;  4V2F A;  5M5W J;  5M5X J;  4JX5 A;  2NVY J;  1IG7 A;  3OSF A;  2MSY A;  3HBL A;  1JKO C;  5IYD J;  4I6Z A;  1VFC A;  3O8H A;  1JUM A;  3BR1 A;  4M3B A;  1TWA J;  3M3Y J;  2R0Q C;  4XID A;  4QTR A;  5F08 A;  5M5Y J;  2JJ7 A;  4JX4 A;  1GV5 A;  2IAI A; 
#chains in the Genus database with same CATH topology
 5HS7 A;  3DBR B;  1APL C;  1IV8 A;  5HLT A;  5E3M A;  2R7V A;  4LIT A;  4EAT A;  1X3W B;  1B6A A;  3CME I;  2Y2Z A;  4A0Y A;  4BQA A;  4PUS A;  4L18 B;  2ZME B;  2COM A;  2OU2 A;  4HV5 A;  4MTD A;  1J0R A;  4IXA A;  4UUV A;  5IP7 J;  4ESJ A;  4UNO A;  2ME6 A;  3LSM A;  2BY0 A;  4G9Y A;  2V9K A;  3OY9 A;  4GGG A;  2JA5 J;  3CMA I;  1DUX C;  3LNQ A;  1G8X A;  4O3M A;  3I54 A;  3ZOB A;  5L3C A;  1ZH5 A;  3FXQ A;  1H88 C;  3S3M A;  3M4O J;  5DCM B;  1WVR A;  2OCC H;  2BEO A;  1FNN A;  3M8F A;  2Y0S N;  4MHG A;  1XCV A;  2NS0 A;  5BPD A;  3RIR A;  4Q5S F;  1SFE A;  4B3X A;  4RGX A;  4NUB A;  2GQQ A;  3T5X A;  2DA4 A;  2BHZ A;  3Q0W A;  1B9M A;  1TP4 A;  3JAM Z;  4PJJ A;  3KLO A;  1BI1 A;  3HOX J;  5KHD A;  1ETW A;  2WAQ N;  5GP9 A;  4WWC A;  4ENK A;  1I1S A;  2OCE A;  4U7D A;  1OCO H;  2F5C A;  3BR5 A;  4XMY A;  3QP5 A;  2N8G A;  3BTJ A;  3M1C A;  1HDD C;  3MKZ A;  1MSE C;  1EV7 A;  2PQ8 A;  3PUF A;  5KAI C;  2FML A;  4BKX A;  2X6O A;  2LSO A;  4LIV A;  3H35 A;  2CSO A;  3Q9S A;  2H27 A;  4ABZ A;  3BWG A;  3KYD B;  1UCR A;  1X1D A;  3B02 A;  3DBL B;  2LBF B;  3L2R A;  3O8G A;  3N4M A;  4LIU A;  2VBZ A;  2H6B A;  5DM6 F;  3H92 A;  2LRD A;  4O5V A;  1RES A;  1RC9 A;  4ON0 A;  4N9I A;  4UHT A;  1R1T A;  2FF4 A;  3QYB A;  1F43 A;  1MMG A;  2O8K A;  3OYJ A;  1B8I A;  3C3W A;  4L0Z B;  1FBQ A;  2ZJP F;  1V5E A;  2BVL A;  3FXU A;  3I59 A;  1KGS A;  4DNC A;  2PBI A;  2UZK A;  1IUF A;  2D1H A;  2EPF A;  3E6B A;  1FX7 A;  2R7T A;  3FIW A;  4AC0 A;  2EIL H;  1TT5 B;  3AFH A;  1NTC A;  3DU6 A;  4NB5 A;  4A5M A;  1BR4 A;  2VAS A;  3CLO A;  2EFN A;  4CCN A;  2EIK H;  3E7L A;  4BXF A;  2FOK A;  4ESF A;  5HS9 A;  5IOY A;  2L02 A;  4IHT A;  3H3U A;  2K85 A;  1U5T B;  1YW8 A;  3C1D A;  1NK3 P;  3GXO A;  3S14 J;  2WA0 A;  3S2D J;  3QOE A;  2V26 A;  4BHC A;  4AU7 A;  1KU3 A;  5EEH A;  1J7K A;  2HTJ A;  3A0H C;  1EH7 A;  2F5F A;  3CUQ B;  2QBY B;  4G6D A;  3G1L A;  2VJ5 A;  3GFI A;  1XSD A;  1GVD A;  3CCM I;  2H1L A;  3HRT A;  2R7Q A;  1Y0U A;  1QVT A;  1UB9 A;  1YX5 A;  2GWR A;  2VPR A;  3BCB A;  4XRS A;  1YIJ I;  3CJT B;  2KDO A;  1YJN I;  3FXJ A;  3WTX C;  2QCO A;  3T8T A;  4BEH A;  3ZR8 X;  3EQL F;  4NQW A;  4A69 C;  2IGK A;  1VZ0 A;  4GCV A;  3GCM A;  2MFZ A;  4LG0 A;  2QEN A;  2ZME C;  1Z91 A;  1FIP A;  2X51 A;  2X48 A;  4OAY A;  1SD4 A;  2YUS A;  2DI3 A;  5CVV A;  1DQU A;  1WHU A;  2KJC A;  3ZQI A;  3NWS A;  5FO5 A;  4V19 K;  4UUS B;  5EYR A;  3BG5 A;  1K61 A;  4JP0 A;  4XLE A;  1ZAR A;  2CUF A;  2VQL A;  1XS9 A;  5AIQ A;  1FC3 A;  1A35 A;  1SAX A;  1WH7 A;  4XLN F;  1ETX A;  4X1E A;  4BJT A;  2XUB A;  1W36 D;  3HRM A;  4IL6 C;  3VYU B;  4A12 A;  3GME A;  1ZTR A;  2YPR A;  3L2W A;  1B9N A;  2CO5 A;  1XN7 A;  3A01 B;  1TQI A;  1IRG A;  4OIP F;  4GYG A;  4H0E A;  5LD2 C;  3FK7 A;  2KRC A;  3LST A;  5D5U B;  3CO7 C;  3IP4 B;  4L5I A;  2NS7 A;  2DMP A;  2EA2 A;  3NAU A;  4YFX F;  4CXF A;  4RGS A;  4YEL A;  5D8K B;  1MZB A;  5BPI A;  4R8H A;  1JE8 A;  2OBP A;  5ILS A;  3IWF A;  4GXO A;  2QQA A;  4LOC A;  1MH3 A;  2K9Q A;  3ZQC A;  3KFW X;  3CMY A;  1QNT A;  2J5P A;  2GZW A;  2K4J A;  1EA3 A;  1MW7 A;  1P92 A;  2LKX A;  1WKM A;  2IA0 A;  3HYI A;  2ELJ A;  1EH6 A;  2ZBK A;  4L9V A;  5ILV A;  1USS A;  3MKW B;  1BIA A;  4HNU A;  1Z77 A;  2DDB A;  2DMT A;  3H5A A;  3TBI A;  2HGC A;  4OIR F;  2BHY A;  2JA2 A;  3KEO A;  4IHX A;  1FY7 A;  2W24 A;  3MAJ A;  4LK0 F;  2BY3 A;  4RB0 A;  3HTU A;  2LMD A;  3JAM K;  1YO5 C;  4HLY A;  2EFW A;  3K4C A;  5J3L A;  3GVA A;  4UVB A;  2IA1 A;  4YII A;  4UB6 C;  4X0G A;  1T39 A;  1K6O A;  2E1M C;  1LEB A;  2CUJ A;  4XKB A;  2UXX A;  4X6A J;  2KRF A;  3BR0 A;  5IY5 H;  2L2O A;  4YIF A;  4UV8 A;  3JSO A;  1X1B A;  3PO2 J;  4BU2 A;  3BR3 A;  3W6J B;  2V1D A;  5E3N A;  1R1U A;  3LOC A;  1HKQ A;  1FYK A;  1JJ8 C;  1F36 A;  5B5E C;  1R4N B;  1AA7 A;  4EGZ A;  2ISY A;  2XRL A;  4A2U A;  4Z6Y A;  4FTH A;  1FTT A;  2XAJ A;  5E1Z B;  1K83 J;  3PM1 A;  2M8E A;  1S8N A;  3L2U A;  4CYC B;  2NVT J;  1X2N A;  1RUO A;  4A3K J;  2OTJ I;  1I27 A;  1O3R A;  3M07 A;  1POG A;  1U5T A;  1VQO I;  3JRA A;  2VQC A;  3CJR B;  5B1B H;  2AS5 F;  3LMM A;  2HR3 A;  2VON A;  1YW9 A;  3FBI B;  3A2K A;  1XGS A;  5E79 C;  2VUM J;  1T95 A;  2WAE A;  2R7D A;  1XMX A;  2DYS H;  5TJJ A;  2WBM A;  5K5Q A;  4ZYG A;  3ASN H;  2QBY A;  3BPX A;  3QPS A;  4OU0 A;  1X2M A;  4DYC A;  4HDU A;  2RAE A;  2VC1 A;  2DOD A;  3EYY A;  1TQM A;  5HDK A;  2RDP A;  5KCM A;  2B7E A;  2QKM B;  2R4G A;  1YW7 A;  2DA7 A;  3SDB A;  5CJ9 A;  3HRU A;  5KVR A;  1Z1D A;  3FMR A;  1IDY A;  3CCS I;  3A03 A;  5HOO A;  5A2Q Z;  4KN7 X;  4XKC A;  1D8K A;  2KIM A;  5EG0 A;  5IPA A;  1NG7 A;  3DBH B;  5J40 A;  1IRF A;  3RSN A;  4ENM A;  1KQ8 A;  2MLK A;  2VIX A;  1QU3 A;  3OS1 A;  1Z3Y A;  1LB2 A;  4NC6 A;  3HSR A;  5FLX Z;  5M3F J;  4XRF A;  4DZJ A;  1GXQ A;  2JWT A;  3LFU A;  3KCC A;  2L9R A;  5DV5 A;  1FPQ A;  1KU9 A;  3DWL E;  1ZRD A;  3LFK A;  2BZT A;  1I6H J;  3E6M A;  2HQ5 A;  2P7C B;  2R7O A;  3ABM H;  3HOZ J;  1AU7 A;  5IP9 J;  4Y15 A;  2BBY A;  3I58 A;  5TGT A;  5E18 F;  2K27 A;  3A01 A;  2CQX A;  4KUM A;  4FE7 A;  3ZMV A;  1G3W A;  1LQ1 A;  3TOB A;  1U2W A;  3K7A J;  1SFU A;  3TOA A;  2W82 A;  2P5V A;  2HVQ A;  2QSH X;  4PGG A;  2Y75 A;  2H8W A;  3JRF A;  3A4C A;  1O3S A;  2W4S A;  5HNF A;  1FBU A;  4NBQ A;  2IJL A;  3ZN0 A;  4EM1 A;  1QHH D;  4A3G J;  4MQV A;  2DMU A;  2COB A;  5J6X A;  3FBN B;  4HLX A;  3ZCO A;  3IRR A;  2XAS A;  1IJW C;  2PI0 A;  1E0E A;  1E17 A;  2F4M B;  4MFE A;  1R6R A;  2K3P A;  1MNE A;  1SAN A;  3MWM A;  3S3N A;  1QGP A;  2DA3 A;  2WAF A;  3JCU C;  2FX0 A;  4BJ6 C;  2X4H A;  4P55 A;  4HDV A;  1T33 A;  1WI3 A;  1W0U A;  2IP2 A;  2XGE A;  2PJR B;  1V5G A;  1SFX A;  3PJR A;  2CFX A;  3M8J A;  3NWT A;  4WX9 A;  4PK4 A;  3HC7 A;  4IRI A;  3S1Q J;  3C2H A;  2Z5U A;  2Q8K A;  2O03 A;  2CQK A;  2NVX J;  3P9K A;  2E34 A;  3OS0 A;  3DEE A;  3G1O A;  2ZO4 A;  1I3Q J;  2CGP A;  3V8K A;  2DAO A;  2Y9Y A;  4RB3 C;  3K4B A;  2M4K A;  2HYF A;  4CHU A;  2MC4 A;  5K7Z A;  1X3Z B;  2GXB A;  2XIG A;  5LGN A;  3P9I A;  3HOS A;  2MC3 A;  1I5Z A;  4YFN F;  1H89 C;  2KT0 A;  2HOA A;  5H2F C;  2GOM A;  4OIQ F;  1A36 A;  2VT3 A;  3RCO A;  4IRG A;  5M5W J;  2DOA A;  4N4O B;  3GO5 A;  4I0B A;  2AQF A;  2F5D A;  4KIB A;  3E6C C;  3HBL A;  5IYD J;  2JUC A;  1VFC A;  3MCZ A;  4MNU A;  1O57 A;  1MMN A;  5LGU A;  4S04 A;  3JW4 A;  3FWE A;  4M71 A;  2P6T A;  2KFD A;  1MKM A;  3SEQ A;  4L9T A;  4ZTJ A;  4IVN A;  1OR7 C;  4DOZ A;  3OYE A;  3RKY A;  4P1W A;  3LQR A;  1HLV A;  2HKX A;  1K78 A;  1GV5 A;  2IAI A;  3G73 A;  2ZJQ F;  3WU1 B;  2EBI A;  4KIG A;  4R1H A;  2D5V A;  2M5W A;  5CQE A;  5BNG A;  2QKL B;  4HAM A;  2W7N A;  2J5O A;  3HPG A;  4CZC A;  3BG9 A;  1W0T A;  1VQP I;  4CYD A;  3BP8 A;  3RKW A;  2ID3 A;  1PUE E;  3JRG A;  3DTK A;  1WWX A;  2V1N A;  4Y3O A;  4BYY A;  4BAC A;  3WGI A;  3R0A A;  3IAM 2;  3HOW J;  1XMK A;  3B6A A;  3DU5 A;  4N4N B;  2D45 A;  2QZ8 A;  3J80 Z;  1U3E M;  4ZZD A;  3S1R J;  1IXS B;  2STT A;  2KZV A;  4IHV A;  2CFO A;  3KP5 A;  4F52 A;  1TT0 A;  2R7W A;  2KLO A;  4OIN F;  2BY2 A;  1UAA A;  4A3D J;  2LF8 A;  3U21 A;  4V2G A;  1YX3 A;  4IOC F;  3LA3 A;  4F55 A;  5LFA A;  2WY7 Q;  1VQ5 I;  3TO7 A;  5DDG A;  1TW2 A;  4I99 C;  2MA3 A;  4PJM A;  1X4P A;  3HZJ A;  1QHG A;  1F5T A;  3SHF A;  5A2Q K;  1K7A A;  4XLA A;  2XF7 A;  1ON1 A;  4A93 J;  2XRN A;  3GTM J;  2GA2 A;  2CW8 A;  5BMZ A;  2MH9 A;  4M3D A;  1YE9 A;  4XN0 A;  5EZH A;  4A6D A;  5ICC A;  1ZG5 A;  2R5Y B;  5FLX K;  5F1J A;  1OCP A;  2IA2 A;  4M3G A;  1D5V A;  3RDI A;  3BZ6 A;  4XM3 A;  2MW8 A;  3K4L A;  2JPC A;  3QRF F;  1OCC H;  3LQQ A;  3H5R A;  1B8I B;  5J1U A;  3F9K A;  3P7N A;  3VEP A;  3FHZ A;  1FSH A;  4PDK A;  4G94 A;  3KP2 A;  4XIC A;  2XRO A;  4EJV A;  3I59 B;  4E4H A;  2HQR A;  3TO6 A;  1N77 A;  5FKN A;  1IRX A;  2F4I A;  2FSW A;  5F6F A;  5KNL A;  2ELH A;  4RGU A;  2BXY A;  3GTJ J;  1HBX G;  2CU7 A;  3BG3 A;  3CCU I;  2ESN A;  4I98 B;  5FLV A;  3BDD A;  2XPW A;  3G1M A;  2RKH A;  5EEG A;  3H9G A;  4EM2 A;  1T56 A;  4N0B A;  1AKH A;  5F1R A;  2JT1 A;  3GLL A;  4HW0 A;  3WTU C;  4DJA A;  3KIO A;  3E5Q A;  3DPL C;  2AXT C;  1FOW A;  3I4N J;  1XPX A;  1B59 A;  2L7Z A;  1R5I D;  1HKS A;  1Z6R A;  2ZNZ A;  2MLG A;  1ACI A;  2ZXI A;  2P6S A;  1PP7 U;  3JRD A;  3L2C A;  2ZNY A;  3VDX A;  1I1G A;  2O3F A;  4BJ5 C;  3W6K B;  3QPH A;  2EV5 A;  1WJA A;  2K9N A;  2HKO A;  2QSF X;  1PJR A;  1W1W E;  3AG4 H;  3GBG A;  1TNT A;  2E60 A;  4GO1 A;  1Y0N A;  5K5O A;  3HHG A;  2QQB A;  2A6T A;  2WAD A;  4XSX F;  3SFI A;  2GXG A;  2IVM A;  4MTE A;  1R23 A;  4BAY A;  4XLH A;  1A31 A;  3OYB A;  2LTP A;  2OUM A;  1U9N A;  3VOD A;  2FD5 A;  3I9V 2;  1BR1 A;  2Y31 A;  3FF5 A;  4BEH B;  4NQW B;  1HOM A;  1ZAO A;  2LVS A;  3I5U A;  1DPR A;  1BR2 A;  4IQ4 A;  4M9S A;  4Q48 A;  4PJL A;  4AIH A;  3BR6 A;  2YU9 J;  1MJA A;  4PCQ A;  4NC8 A;  1V3F A;  5HDN A;  3L00 A;  1ONV A;  4L0Y B;  4AIK A;  2AHQ A;  3RQ4 A;  2W48 A;  1X4O A;  5AIP A;  3BC8 A;  3TO9 A;  1F4K A;  3ECO A;  2V79 A;  3AL0 B;  1N25 A;  1KON A;  5E17 F;  2MYS A;  3KEQ A;  3IKT A;  1J75 A;  3IKV A;  1IV6 A;  1U0J A;  1U8R A;  1R71 A;  1E3H A;  2G7U A;  1SFK A;  5FKK A;  2X6Y A;  2EIN H;  4XRS G;  3A02 A;  2WV0 A;  3LWF A;  2DMQ A;  5JLW A;  1VQ7 I;  2V1U A;  1V5F A;  2NRA C;  1W7P B;  3HHH A;  2QGU A;  3MZY A;  5IOZ A;  2L7F P;  2F5E A;  1ULY A;  3C18 A;  4EVI A;  2VKD A;  3IL2 A;  2CG4 A;  1PDN C;  3R6S A;  1BI2 A;  1GVJ A;  2JK3 A;  4S0H B;  2DPD A;  1E2X A;  3CC2 I;  3AG3 H;  2M45 A;  2EB7 A;  4I0A A;  2O7O A;  3H9Q A;  3WTW C;  2IRF G;  3O2P E;  3VB2 A;  3S17 J;  4HV6 A;  1SMY F;  4YRV A;  2IEK A;  4K2E A;  2D2W A;  2L9N A;  1L3L A;  2XVC A;  2KIQ A;  2Y30 A;  2R7Z J;  5CLS A;  4CH7 A;  4G8X A;  4II2 A;  3W6V A;  1ZLJ A;  3T0Y A;  2TRT A;  2HDW A;  2EH3 A;  2DPU A;  4D1Q A;  1XCB A;  3BLY A;  2E7X A;  4HQE A;  2R3S A;  2UV1 A;  1BC8 C;  2JPB A;  5D6F A;  3COA C;  3ZQG A;  2EZL A;  2QSG X;  2LOO A;  3U1D A;  3ZP5 A;  2ID6 A;  2W85 A;  4E7K A;  1O3Q A;  3QOD A;  4A3B J;  2OD5 A;  1IAW A;  3MVP A;  4BUP A;  2CQQ A;  2XGX A;  1O3T A;  3UNG C;  2KZG A;  2XAG A;  2CV2 A;  1IZ1 A;  1XC5 A;  4Q4Z F;  2L7M P;  3J80 K;  3I4M J;  5K5R A;  5H20 A;  2O61 A;  1B72 A;  3CDL A;  2HXO A;  3LSI A;  5FKM A;  3ZMD A;  2XDV A;  2M4G A;  2MD5 A;  4A3J J;  2R7X A;  4UXN A;  4HOB A;  2R5Y A;  5L3D A;  1X3U A;  5FLM J;  2O6G E;  2XF6 A;  3FXO A;  4MO7 A;  5DD4 A;  2FQ4 A;  5E20 A;  5FRN A;  2TCT A;  4KFC A;  4AIJ A;  2YS9 A;  4ZDO A;  2DA2 A;  3OYM A;  1TZL A;  4XR6 A;  4EM0 B;  2DFH A;  4YFK F;  1PP8 F;  2M34 A;  2PMH A;  2W84 A;  2OA4 A;  5EGO B;  4GRI A;  3DKW A;  1U9O A;  1D0X A;  1ON2 A;  4CCJ A;  4QSH A;  3TED A;  3LSP A;  4ZTF A;  4XOR A;  1MJB A;  3JRB A;  3PIO F;  4LB6 B;  2C6Y A;  1S5L C;  3J81 Z;  1OPC A;  2E19 A;  1DPU A;  2ZC2 A;  3FM5 A;  2FNA A;  1MMD A;  3HOY J;  2BY1 A;  2M9H A;  2L4M A;  5CYV A;  3LA2 A;  3LAP A;  1QPM A;  1YS7 A;  2EFO A;  4WXD A;  4AVZ A;  1GT0 C;  2QVO A;  1YQA A;  3KPH A;  1ZG1 A;  2ACJ A;  1ZGW A;  3ONQ A;  3GLX A;  4HBL A;  5LHH A;  1LNW A;  3F8C A;  4PGH A;  4A0Z A;  2RN7 A;  3TDZ C;  4ASN A;  4LLN A;  3IWZ A;  1IN8 A;  2CUZ A;  2LKP A;  2CUE A;  2BYV E;  4I7H A;  1RR7 A;  1ZGJ A;  3S16 J;  1TNS A;  3OV8 A;  2XB5 A;  4C3H J;  3SYT A;  4KJZ A;  4IHS A;  3HOV J;  3EUA A;  3GW2 A;  4KIC A;  2Z33 A;  1L0O C;  5FKL A;  2GXA A;  3BTL A;  3MD2 A;  2KMU A;  4XNF A;  2A07 F;  1W5C C;  4EMS A;  1ZRE A;  3WTV C;  2G9W A;  3OIP A;  1IXC A;  1YG2 A;  2QQ9 A;  1JT0 A;  5EG0 B;  1EF4 A;  2W25 A;  4MEX F;  3G6E I;  1R1V A;  3CQZ J;  3TGN A;  2DO7 A;  3JSP A;  3FX3 A;  3E0J B;  4RB2 C;  3W3C A;  2WB1 A;  3EPZ A;  2VOP A;  1FWZ A;  1BBY A;  1FMW A;  1GUU A;  2M1B A;  2DTR A;  1KYZ A;  2MAB A;  3DV8 A;  3WTT C;  2HS5 A;  3GWZ A;  3G71 I;  3ISP A;  3PNV A;  4FT8 A;  4P9U A;  2FOW A;  3BG6 A;  4KDP A;  1W7P A;  3QAH A;  3FM3 A;  2FEZ A;  3LSG A;  3ABT A;  5JFR A;  1VQ4 I;  1IF1 A;  2DJI A;  3F3X A;  2DFF A;  1RET A;  1SFO J;  1K6Y A;  4E7L A;  1Y39 A;  3ZGK A;  3OYL A;  2K5C A;  3S2H J;  5E3L A;  1G6N A;  3IRQ A;  4L9J A;  1P7J A;  4XON A;  2EZH A;  3KET A;  2L4A A;  3K1N A;  5DYM A;  5IYC J;  2CJJ A;  3DTE A;  2ESH A;  5LEK A;  2P8T A;  1VQL I;  2LH9 A;  1FOK A;  4JK1 X;  1YI2 I;  4RMN A;  1Y1W J;  2LK2 A;  1HQC A;  1ZG3 A;  3TDU C;  3SJM A;  2YSR A;  4HA8 A;  3TP0 A;  2GM4 A;  2DLL A;  3OIQ A;  1JKQ C;  1MGT A;  1CGP A;  3OL4 A;  4A3M J;  5HOD A;  1BW5 A;  1W5S A;  4IOA F;  1E3P A;  5E8G A;  5F27 A;  2VKH A;  1ITY A;  1FOX A;  2LDU A;  4XN3 A;  3FIS A;  4J00 A;  1KA8 A;  2UUZ A;  2AO9 A;  5E3O A;  2ICW G;  1ETQ A;  1U78 A;  2O8X A;  1P4X A;  5L3B A;  3PSI A;  1K4S A;  2LC2 A;  1UHS A;  5HDG A;  1LFB A;  1N78 A;  4G7H F;  4HNV A;  1EH8 A;  1RKW A;  3OYG A;  3WTZ A;  4G6Q A;  5FKO A;  3DLL F;  5C4J J;  3WTS C;  1VQM I;  4OMY A;  2FBH A;  1BL0 A;  1LJ9 A;  3TW7 A;  2DA5 A;  2K9L A;  5JI6 A;  5ICE A;  5HLI A;  2LRE A;  3R60 A;  5GAD J;  1U5T C;  2VC0 A;  5EGO A;  1LDD A;  2I10 A;  3PSF A;  1S7A A;  2HVR A;  5ED4 A;  2HYJ A;  2OV7 A;  1P7I A;  1R58 A;  4B8X A;  3IH4 A;  2PX9 A;  4XOP A;  2YU3 A;  3DPT A;  1YTY A;  2A05 A;  3SXY A;  1FBS A;  2PN6 A;  2ZFU A;  3CUQ C;  1LVK A;  2DFE A;  3ROU A;  1HDP A;  1R00 A;  4XLC A;  2A6E F;  1HC8 A;  2L54 A;  1IDZ A;  3WE2 A;  1RKT A;  3E3V A;  2L3D A;  5EZG A;  2PFB A;  3CJQ B;  2XGC A;  4UVC A;  1TBX A;  2FBI A;  1WFX A;  2E5Z A;  1XMA A;  1XTA A;  4KN4 X;  5LGT A;  1MSF C;  4ENJ A;  4D5C A;  3VWB A;  1IN4 A;  4BNC A;  1TW3 A;  1K78 B;  2IXS A;  1S3J A;  2MSY A;  5GAE J;  2VBY A;  3V4G A;  4UB8 C;  4FX0 A;  3WGH A;  5LLQ A;  2UXN A;  2HPM A;  2HPI A;  3K10 A;  1XSV A;  5DUI A;  3J81 K;  1ZYR F;  4OOI A;  4HRI A;  2HQN A;  1SVL A;  4JOM A;  5M5Y J;  1YIT I;  3FKJ A;  5HVQ C;  1UEL B;  1ZRC A;  3GX4 X;  4FE4 A;  2VJI A;  3OYD A;  2KDZ A;  5FFX A;  3ZMT A;  3ZQL A;  4AYB A;  3NAR A;  3I3L A;  4MQ9 F;  2JZY A;  5HLH A;  4BBS J;  4EJT A;  2CH0 A;  5GPA A;  3REO A;  2VKE A;  2VXD A;  3F8B A;  3HG9 A;  1WI9 A;  1KYW A;  3JRC A;  2Y48 A;  3F21 A;  4PJ0 C;  2A68 F;  4EGY A;  3K4M A;  2L01 A;  3ZQF A;  1HST A;  3M7G A;  4HF1 A;  3L09 A;  2WAQ A;  4DBR A;  1WJF A;  4AVP A;  1FEX A;  2ISZ A;  1QPI A;  1ZLK A;  3ZPL A;  4BDY A;  5TIS C;  3QU3 A;  1SD7 A;  1R5H A;  4Y13 A;  3BJA A;  2LFB A;  2OZU A;  3BJ6 A;  2QUF A;  3B73 A;  3K9T A;  4RM2 A;  3S3O A;  4FCY A;  3G3Z A;  2F6C A;  1D0Z A;  1RZ4 A;  2HNH A;  4MLO A;  2LF7 A;  2X9D A;  5F0C A;  4BGD A;  1DDN A;  4A3L J;  1SVM A;  2DA6 A;  1WJE A;  1W7P D;  1XDS A;  2XAH A;  5B66 C;  3ABL H;  5D4R A;  3HJE A;  2VLA A;  1YFH A;  1P9Q C;  5BS6 A;  1KQ9 A;  3HB9 A;  3RPQ A;  2X1E A;  1BA5 A;  4DIQ A;  2BV6 A;  2BOL A;  4QWQ A;  4NDL A;  1ORK A;  1XB4 A;  3KP3 A;  2DOE A;  2EK5 A;  4RAF A;  3V7S A;  4E7S A;  2B9S A;  1VF9 A;  2K4B A;  1VQ9 I;  5JR3 A;  5LHI A;  4IJA A;  1Y1V J;  1YJW I;  2KKO A;  3TP3 A;  3OSG A;  1AKH B;  3TQN A;  4CA0 A;  2GIV A;  5FD6 A;  3DCF A;  1Q1H A;  6PAX A;  3FXR A;  2EFP A;  3N05 A;  1JI8 A;  2YX4 A;  2R7R A;  2P4W A;  2F48 A;  4D5F A;  1OQY A;  3KP6 A;  5DD8 A;  4ZYH A;  2X6W A;  3OYN A;  1YS6 A;  2VI6 A;  4U88 A;  1BN5 A;  2R5Z B;  2RVC A;  1FOY A;  3BZC A;  3KYL A;  1XX5 A;  4IZZ A;  3EUH A;  3U2R A;  4WCG A;  3VPR A;  2IT0 A;  1ETY A;  2Z1D A;  3AG2 H;  5GAG J;  4G6T B;  4N9H A;  2E2I J;  4E70 A;  3GTK J;  3S1N J;  1VQN I;  2HI3 A;  3RPU A;  4ETS A;  2Q0O A;  5F0H A;  4GFB A;  3PFI A;  2M3A A;  3IUO A;  2DMN A;  2M30 A;  4MIM A;  4C30 A;  2EIJ H;  2DT7 B;  4KA4 A;  1J59 A;  2XC7 A;  4L5J A;  1K79 A;  4DW6 A;  5L3E A;  1N75 A;  2VQH A;  3RJP A;  2O5R A;  3JTH A;  4U0Y A;  3JRE A;  4BXX J;  5H6R A;  2G0E A;  2GAU A;  4I2O A;  1HXD A;  1G3S A;  1K4T A;  2PG4 A;  5CPR B;  3OYF A;  2VE9 A;  5IP6 A;  1ETV A;  1TWC J;  1STZ A;  2DK5 A;  4Y52 J;  1JUS A;  4CUG A;  3RYP A;  1P4W A;  1MIJ A;  2BGC A;  1I6X A;  3OYK A;  4IQJ A;  5DUK A;  1BJA A;  5FRO A;  1RIO H;  4LB5 A;  2CW0 F;  2LR8 A;  2KIS A;  3R0J A;  2EJR A;  4OIO F;  2Z99 A;  4HST A;  3GZ6 A;  1R49 A;  2IS4 A;  2XKP A;  2IBD A;  5GPC A;  1DU6 A;  1ETO A;  3CTA A;  2XSJ C;  4DZP A;  1OIS A;  2HZT A;  2EZK A;  5DM7 F;  4U87 A;  2ETH A;  3CMM A;  1UFM A;  2E71 A;  1QA6 A;  3K6G A;  5F64 A;  4B44 A;  4CO8 A;  2DOF A;  2JA8 J;  2HXI A;  2QM3 A;  3DEU A;  2QF7 A;  2GBY A;  2GIZ A;  4UV9 A;  2NOG A;  1JHF A;  5GAH J;  1T0F A;  1HW5 A;  2A6H F;  2XSD C;  2HZD A;  3GFM A;  1LFP A;  3QYE A;  2STW A;  4AM3 A;  1XDU A;  4OMZ A;  5F04 A;  1YOV B;  3OMY A;  1Z7U A;  3L2V A;  3CF5 F;  1PUF A;  3BCA A;  3QPL A;  3CDH A;  3D1N I;  1FMV A;  4LMY A;  3S15 J;  4KIT B;  1PYV A;  1DGW Y;  2RQQ A;  3K1M A;  3QQA A;  1WCM J;  3FHN A;  3QOP A;  3WG9 A;  1J9I A;  2ZSH B;  1OR7 A;  2M8G X;  4M9X A;  4L9N A;  1IW7 F;  3F22 A;  1FP2 A;  1YJ9 I;  2KP6 A;  4HEA 2;  1UG0 A;  5IT3 A;  4U0W A;  2WB1 N;  3A0B C;  4L5E A;  3T8R A;  3ERM A;  1B72 B;  2K7L A;  1LFU P;  4M6Y A;  4RB1 A;  3MKY B;  5F0F A;  2E2H J;  1NG6 A;  4NNJ A;  1AWC A;  1UG2 A;  4HX8 A;  3H9J A;  3HXL A;  2R7F A;  2ZXH A;  4JX6 A;  1SC7 A;  2P5L C;  3IH3 A;  4ZYA A;  3FZV A;  4B09 A;  1BJZ A;  3RKX A;  2A61 A;  4XLP F;  1UHM A;  1B1B A;  3ECH A;  2VE8 A;  1QZZ A;  3LA7 A;  4XK4 A;  1IN5 A;  1A6Q A;  2HWV A;  4HSR A;  3ZQH A;  3J7A Y;  4ZDP A;  4F7Z A;  2XAU A;  3H3Z A;  2Z2S B;  3Q0U A;  4AWX B;  4OAZ A;  1JHH A;  2OZ6 A;  2VKV A;  2XB0 X;  1UJ8 A;  3JR9 A;  4LLG F;  2MGQ A;  5E1W A;  2M87 A;  1DU0 A;  3W2A A;  3TL4 X;  1MND A;  1DP7 P;  3ZMU A;  5CVJ A;  4DBQ A;  2DU9 A;  4ZC3 A;  5D8L B;  2B0L A;  4DYR A;  5KAF C;  2MH2 A;  2KPM A;  2E36 A;  2ELK A;  2M2E A;  3EYI A;  3GTQ J;  4EJU A;  3HPH A;  1NK2 P;  2W1O A;  2ZXW H;  3ZMZ A;  2WY8 Q;  2Q2E B;  2OQG A;  2XF5 A;  2DK8 A;  3C2B A;  3HEF A;  1ZR2 A;  3FDY A;  3VOE A;  1O7F A;  2L7K A;  1D0Y A;  3DFG A;  3RYR A;  3CF2 A;  4F93 B;  1NH3 A;  2HU9 A;  1ZHF A;  2R5Z A;  5B3S H;  4PZJ A;  2LNB A;  1HW2 A;  1Z21 A;  1GXP A;  2K40 A;  1BOA A;  2IS2 A;  2RV8 A;  1W4M A;  3GFJ A;  4RDU A;  1LVA A;  4M3F A;  3CDI A;  1R5G A;  2MG4 A;  4S05 A;  2OAZ A;  2M0C A;  2JRT A;  3ZXS A;  4LG3 A;  3WHB A;  2JVG A;  3HUG B;  4B4C A;  1T6S A;  3HTS B;  1QZY A;  2M7A A;  2V1X A;  1F9N A;  3BRO A;  3DKY A;  4IF4 A;  4W97 A;  1GDT A;  1HCR A;  4G7Z F;  2ZXJ A;  3FXK A;  4HYE A;  3Q0V A;  3GEZ A;  4YG2 F;  1BW6 A;  2JTV A;  5D5X B;  2Z3Y A;  4Q47 A;  2OPT A;  1OJL A;  3RPU D;  4B47 A;  2ADU A;  5HNH A;  2HVS A;  3FMQ A;  4CZZ A;  1MBF A;  1KQ0 A;  1FJL A;  4BDZ A;  1J2X A;  1MBH A;  2V6E A;  2QLZ A;  1R22 A;  3MN2 A;  3DPU A;  4BQN A;  5CQG A;  1H9T A;  2TDX A;  2VPL A;  1YYV A;  4BS9 A;  4Y17 A;  3SEZ A;  4C2M J;  2R92 J;  1UZC A;  3PQJ A;  1D1C A;  3HGY A;  4RLQ A;  2DW4 A;  4M3E A;  4M6X A;  2JA7 J;  1Z67 A;  4IO9 F;  2LLK A;  2I8D A;  3E5X A;  4B48 A;  4HG2 A;  3PUB A;  3OWT A;  3K1P A;  5HS8 A;  3HL2 A;  4XQF A;  3H0G J;  3CP8 A;  2HOS A;  2NYX A;  3VFZ A;  1T98 A;  3OYH A;  4RA2 A;  2WV1 A;  2A69 F;  4E7Z A;  5LHG A;  1LE8 B;  4ZYD A;  3RZO J;  2IW5 A;  4ZH4 F;  5ICG A;  5LBQ A;  1ZQ3 P;  1TWH J;  1TWF J;  5D5W B;  4C3J J;  1Y6I A;  4DGW B;  3OOP A;  2VQG A;  1C0W A;  4AYB N;  2EFQ A;  3GZN B;  2NVQ J;  3S32 A;  1S9H A;  1NHA A;  2DYR H;  2F5V A;  1JUP A;  3CCV I;  2HQA A;  2JUG A;  3C7J A;  1WPK A;  1P2F A;  2BVM A;  3K0L A;  3B6C A;  1AHD P;  1Q1V A;  2NNN A;  4XOT A;  2JMW A;  1O7L A;  5LRS A;  1KU2 A;  3LL7 A;  2XHK A;  2YR2 A;  2D1V A;  1FYM A;  3HM5 A;  4M74 A;  3HOU J;  1AOY A;  4WXH A;  4UY8 I;  3UR3 C;  3LSH A;  2XAQ A;  3SZT A;  3TW6 A;  5B1A H;  4A3E J;  3NRV A;  2ZCW A;  3FMS A;  3VYS B;  4W1U A;  3VSK A;  2E1N A;  2DJN A;  2EQR A;  1HKT A;  2BW3 A;  3L1P A;  3PQK A;  4UVA A;  3H0D A;  1CF7 A;  4C3I J;  4D7N A;  1XGO A;  4RLF A;  3EDP A;  1OYY A;  1SAU A;  4LK1 F;  3K4N A;  3HGG A;  1HF0 A;  4YEJ A;  1H9G A;  1WJC A;  2FQ3 A;  2A5Y B;  3GYH X;  3DLA A;  3L9F A;  4LFU A;  4BXU A;  3ZQQ A;  3IV5 A;  1T38 A;  1YRN B;  2DFI A;  1ENH A;  2FBK A;  2KHM A;  3EET A;  2W00 A;  2UWM A;  1MBJ A;  2L9S A;  4KNY A;  4I01 A;  4M73 A;  3V8J A;  3TMO A;  3OR1 C;  4AD9 A;  5JHF A;  3IAS 2;  2DN0 A;  4M6V A;  3PNT A;  1X1P A;  2FA5 A;  3RQI A;  1JGG A;  2PMZ A;  3BR2 A;  4EJW A;  2Q2E A;  1A6I A;  1ETK A;  3GF2 A;  1U6G A;  4CIC A;  1SMT A;  1KU7 A;  1TLH B;  1WRJ A;  4HX7 A;  2MD0 A;  2RNG A;  2XV4 S;  1TWG J;  2M0M A;  2MBF A;  2R7S A;  3KYC B;  2E1M B;  1S72 I;  4BL0 B;  5J47 A;  3A1Y A;  1D1B A;  2DT5 A;  1OFC X;  3KLN A;  1I50 J;  1TTY A;  3AL0 C;  2GOX B;  2H8R A;  5FD5 A;  4XBF A;  1P4A A;  2VJJ A;  3WG7 H;  1I39 A;  1UST A;  2V7F A;  5DTD A;  5L3G A;  4BE1 A;  3IC7 A;  5M5X J;  1J5Y A;  5LRR A;  2NVY J;  1MDM A;  3RTR A;  1IG7 A;  1DP3 A;  3OSF A;  1X19 A;  2RQP A;  2IS1 A;  2VJ4 A;  3HUG A;  3O8H A;  2EA4 A;  2X1C A;  1IN7 A;  4PFO A;  4KMU X;  4M9Z A;  1P6R A;  1WQ2 A;  4HQM A;  3HOT A;  2FU4 A;  3BOQ A;  4M3B A;  3OYI A;  2NOJ B;  1WSU A;  3M3Y J;  3ML6 A;  4QTR A;  3J7A O;  2G7H A;  5F08 A;  2JJ7 A;  1IO2 A;  4JX4 A;  1E3O C;  3PNY A;  3I4P A;  2O0Y A;  3OYC A;  4Z2Y A;  4Y4R A;  5C44 J;  2HTS A;  4D7M A;  3FK6 A;  5J1Y A;  2E1C A;  1G2H A;  2AQE A;  3MQ0 A;  1TL8 A;  4RM3 A;  1ZRF A;  2JA6 J;  3BPV A;  5C4X J;  1A5J A;  2HFH A;  2JRM A;  3OL3 A;  1D1A A;  2R7U A;  3RZD J;  2RC4 A;  3HKZ A;  5CVI A;  4I76 A;  4F92 B;  4BQO A;  2F4O B;  3O6B B;  3WGG A;  3LAJ A;  2ME0 A;  2GLO A;  1YHQ I;  1JKP C;  2ZME A;  5JVT A;  3I64 A;  2H6C A;  5BQT A;  4BY7 J;  4CDG A;  1MH4 A;  1RRJ A;  3ZN1 A;  4U7B A;  3CES A;  2R93 J;  1IC8 A;  1Z0X A;  5ERI A;  2A3S A;  1LE8 A;  4ENN A;  1Y8R B;  3K4J A;  5FRM A;  4QIW N;  4KIF A;  4E7I A;  4D9J A;  5K1Y A;  1Y8Q B;  1ZEL A;  4CCL A;  4DYQ A;  3E6D A;  2ZFW A;  1OCZ H;  4I09 A;  4RGR A;  1G59 A;  1VQ6 I;  2JVH A;  1TQP A;  3BQZ A;  2K9M A;  4M72 A;  4P5O A;  5DCM A;  2X0L A;  2IGN A;  5GTI C;  4ANJ A;  3L2Q A;  3ABK H;  3SQN A;  1F1Z A;  1JXS A;  1MBK A;  1D8J A;  1V4R A;  2NNY A;  2HDD A;  3WOD F;  1GLN A;  3NEU A;  4XKV A;  3L7W A;  5E1X A;  2FUG 2;  4G7O F;  1QZE A;  1DGR M;  2K9S A;  4EV0 A;  2Z16 A;  1OYW A;  1MD0 A;  3H5N A;  2OF7 A;  4GDF A;  5D6E A;  2E7W A;  5KK1 A;  3KP7 A;  1HA8 A;  4BHP A;  1MJ9 A;  3LSJ A;  2X85 A;  4I02 A;  2XPU A;  2VT2 A;  1R4M B;  5IT9 Z;  3CP2 A;  1LDK B;  2VOO A;  3E5U A;  1SD6 A;  1OKR A;  3KP4 A;  1SD5 A;  3AG1 H;  3TKY A;  3WE3 A;  1ZR4 A;  3F0C A;  4RAY A;  3ERE D;  4AUX A;  3I0T A;  2IS6 A;  3GUD A;  3SDG A;  2E35 A;  3I55 I;  3FXM A;  4D0P A;  1YRN A;  2LBF A;  1BI0 A;  3CCL I;  2H1K A;  3S1M J;  2XKO A;  4ZZL A;  3E97 A;  3VSL A;  1D5Y A;  2JSC A;  2NVU B;  1S29 A;  4ZYE A;  1RR8 C;  1VQK I;  2DXI A;  1XG1 A;  5DCF A;  2NS8 A;  3CO6 C;  3F8M A;  1VTN C;  1RPW A;  3ZRG A;  2OTL I;  4IHW A;  4AID A;  5D5V B;  1PVE A;  2FJ1 A;  3MEX A;  1VND A;  4R79 A;  3HDD A;  2V4J C;  1H0M A;  4BQQ A;  2CRG A;  3BG7 A;  2W57 A;  1IXR C;  2LG4 A;  2KRH A;  3F23 A;  3OOU A;  3CJN A;  2XGD A;  2E2J J;  3GTP J;  1T08 B;  2LD5 A;  4QPO A;  3LSK A;  3CC7 I;  5E8I A;  1BM9 A;  1VI0 A;  2NAZ A;  4BHB A;  5K7F A;  3M8E A;  4MGR A;  1ZN2 A;  2ECB A;  4QLC U;  2M7B A;  5ICF A;  1FSE A;  3CZ6 A;  2KIF A;  4FQG A;  3G4S I;  2A5W A;  1WH5 A;  3KX2 A;  2LYC A;  1UMQ A;  2H94 A;  4CCO A;  1IN6 A;  4EEF G;  2ZB9 A;  2ZJ2 A;  2Y0S A;  3CUQ A;  3DXJ F;  3JTG A;  3MKL A;  2WC2 A;  1PUF B;  2NXN B;  1EJ9 A;  3BJO A;  3G2B A;  3K69 A;  3PL8 A;  3F72 A;  1OYI A;  3I56 I;  3QYF A;  2WWY A;  1FIA A;  4IRH A;  1ZK8 A;  2E1O A;  3MZH A;  2P81 A;  2Y0M A;  3GFL A;  3PIP F;  2QEX I;  3U1K A;  1T8I A;  2VN2 A;  1WJD A;  2BXZ A;  1O4X A;  4KIS A;  4HPQ A;  1LDJ A;  1WJB A;  4JQF A;  2V9P A;  4MFD A;  3QWL A;  3Q9V A;  2RNJ A;  5DS9 A;  3GTO J;  4E7J A;  5JVG F;  1A04 A;  2FMY A;  1S6L A;  3HRS A;  2PJP A;  2LY2 A;  3C2G A;  3H36 A;  4A3C J;  3V7R A;  2YX7 A;  4LJZ F;  2IGM A;  4RAZ A;  3T1B A;  3OYA A;  2L5Q A;  1MNM C;  4HF2 A;  4PSW A;  4ESB A;  4UUS A;  1RI7 A;  1I3A A;  5FFZ A;  2H09 A;  4A5N A;  2VOD A;  1ZKG A;  4J01 A;  1R7J A;  1SVO A;  2KIU A;  3HSF A;  4OWR B;  4PFP A;  1TC3 C;  1BI3 A;  1FTZ A;  2AXL A;  2L9V A;  3OIO A;  3K70 C;  4ZJZ A;  4KYW A;  5EEA A;  2P7V B;  3PFY A;  4MEY F;  4B1R A;  4BY1 J;  3E1S A;  5K7H A;  5C3E J;  2V9V A;  3DEW A;  3BY6 A;  2K02 A;  2QYO A;  1MMA A;  1V55 H;  1J09 A;  3M1E A;  2BE5 F;  2VXZ A;  2XPV A;  1IUY A;  4HNT A;  3QPT A;  1IRZ A;  2PMU A;  3EUH C;  5J8C A;  4RAG A;  2JN6 A;  1LUJ B;  3CCY A;  3BTC A;  5FJ8 J;  1LEA A;  2XAF A;  3P5J A;  4E7H A;  1JT6 A;  1GHC A;  4A3F J;  2Y9Z A;  1FZP B;  1GV2 A;  2EWN A;  3ULQ B;  1UHW A;  3AKZ A;  4BBR J;  3CUO A;  2CYY A;  2RGV A;  4F91 B;  4WK8 F;  3F6O A;  3WTY C;  2LP0 A;  4CSW A;  3CCQ I;  4QPQ A;  4FET A;  2CWE A;  4C2U A;  1G4D A;  4CCM A;  4B43 A;  2FE3 A;  1HSJ A;  3AAF A;  3CC4 I;  3KZY A;  3RI4 A;  1XGM A;  3W2V A;  3BT9 A;  2FRH A;  2CV1 A;  1QVU A;  5J8F A;  4U0V A;  1MBG A;  3D5S C;  3U9G A;  1WGX A;  2CQN A;  2RRE A;  5AON A;  2QA4 I;  3CCJ I;  1QBJ A;  4LD5 A;  2GA1 A;  3DQV C;  3J7Y J;  3QP6 A;  3P9C A;  2ZKZ A;  2FNP A;  3SZG A;  3UKG A;  1S7O A;  9ANT A;  4G12 A;  1RNL A;  3Q5F A;  3LSR A;  3F6V A;  1Z05 A;  4FAS D;  2ZSI B;  3ASO H;  3BQY A;  4YIR X;  3HIF A;  4HZF A;  1QQI A;  4B3A A;  4RBO A;  3D0S A;  1IGN A;  5IT9 K;  2FXA A;  3S93 A;  3RKQ A;  3F8N A;  3D5R C;  1KZH A;  1FYL A;  3SFZ A;  1OLT A;  1B4A A;  4RS8 A;  4P96 A;  2OJE D;  1Z9C A;  3N97 A;  1U8B A;  2P5K A;  1T0F C;  3BZK A;  1VQ8 I;  2B63 J;  1Y56 A;  2CV0 A;  1JTY A;  4CCK A;  1JGS A;  3NQO A;  1OCT C;  2ECC A;  4ZDL A;  2HOT A;  3WHC A;  2DCE A;  5L3F A;  3DKX A;  2PMZ N;  4CYC A;  2O9L A;  2KJB A;  1BOB A;  4FHT A;  3JRH A;  1RUN A;  2L0K A;  1ODD A;  4XRM A;  3K4K A;  4XLF A;  2EZI A;  2KL4 A;  5CVU A;  1G3T A;  3K2Z A;  4BE2 A;  3GTG J;  4P9F A;  1ERD A;  3KE2 A;  2LY9 A;  4E6K G;  3ABU A;  1H8A C;  2PLY A;  2HEO A;  3V42 A;  1XSX A;  3WU0 A;  1CQT A;  2IPQ X;  3DF8 A;  5D4S A;  2P0W A;  1REP C;  4FX4 A;  4LGW A;  2ZJR F;  3OS2 A;  1FLI A;  3ZMS A;  2VL8 A;  2DT6 A;  5BOX A;  2QQ8 A;  1OMI A;  3D5L A;  4Y7N J;  4XSZ F;  3R61 A;  4BE0 A;  4JYK A;  2DA1 A;  4IPA A;  4Y33 A;  3GTL J;  2F2E A;  1XD7 A;  4JBA A;  3HSE A;  1D3Y A;  1G3Y A;  4C2T A;  3PO3 J;  3J7Z I;  5M3M J;  2CS3 A;  5CVR A;  1V54 H;  3MFK A;  3S8P A;  3V8L A;  2X1D A;  1JKR C;  3Q3S A;  5ILU A;  4EJO A;  4IHY A;  1X1A A;  3FXL A;  3W2W A;  4ITV A;  2K3F A;  1Z6T A;  1XGN A;  1T2K A;  2EV0 A;  1R36 A;  4A0X A;  2CQ7 A;  1R9T J;  3H3V K;  3VYT B;  2DTZ A;  3KZZ A;  2K86 A;  1MBE A;  1YIO A;  5IYB J;  1LKX A;  2BW3 B;  4H4K C;  3DP7 A;  3ELK A;  1FT9 A;  3FKI J;  4GYI A;  3M9A A;  1Z3X A;  4XL9 A;  3X2Q H;  5J4V A;  1X58 A;  3I71 A;  1CF7 B;  1ZGA A;  3I53 A;  3IH2 A;  2IGO A;  3MMY B;  3HKZ N;  3SZP A;  5GTH C;  2E5N A;  2DQL A;  4DQ2 A;  5JHU A;  4NHJ A;  3K2A A;  4IEJ A;  4PJN A;  3MZ8 A;  2CMP A;  4CGZ A;  2LKS A;  4KT5 C;  5EF6 A;  5CKT A;  3R4K A;  3F8F A;  3KZI C;  3WU2 C;  2HDC A;  5FB2 A;  2CW7 A;  4PSX A;  5H6Q A;  1W5T A;  2DDA A;  1FP1 D;  2OC6 A;  4O6J A;  1JJ6 C;  5EJC A;  2JQ7 A;  4WXC A;  2QWW A;  2JSP A;  2VBW A;  4WF2 A;  3CD6 I;  4J19 A;  4II3 A;  4XKW A;  1QRY A;  1S7E A;  4EQQ A;  2V6C A;  2OQR A;  3GZ5 A;  1QO0 D;  4F3Q A;  3KEY A;  5JLX A;  4HX4 A;  3V7C A;  4IKF A;  1JTX A;  4NC7 A;  2X6X A;  4A3I J;  4A6E A;  3CCE I;  5LEJ A;  1LPQ A;  3K70 D;  3QU6 A;  2PJR A;  2VB6 A;  3DTI A;  5J1R A;  3VYR B;  1X1C A;  2LY1 A;  1MDM B;  2HOE A;  3H1C A;  2VBX A;  4HF0 A;  4FIS A;  2WTE A;  2EIM H;  3ESW B;  1HW1 A;  4TV7 A;  3CCR I;  4UUT A;  3JRI A;  5EDN A;  3BTI A;  1W36 C;  2KQR A;  1Z7L A;  5HLG A;  2HYG D;  3OR2 C;  4IX7 A;  3EUK L;  4V2F A;  4KMF A;  4JX5 A;  2Q1Z B;  4BH9 A;  2EV6 A;  1BC7 C;  2Y69 H;  1JKO C;  2I5U A;  4I6Z A;  2DQR A;  1JUM A;  1BIB A;  1M1E B;  1MMS A;  1YLF A;  1WJ5 A;  3BR1 A;  3O3K A;  2DBB A;  5DEQ A;  2Z9O A;  4C9Y A;  4KT6 A;  4LG0 B;  1TWA J;  3S2W A;  1EKE A;  1OCR H;  2R0Q C;  4XID A;  5TRD A;  4LLL A;  3ZQ7 A;  1SEU A;  3CLQ A;  3IHU A;  1WZ2 A;  2PEX A;  5J4Y A;  5FGM A; 
#chains in the Genus database with same CATH homology
 1E3O C;  4FE4 A;  2EBI A;  2KDZ A;  1APL C;  3ZQL A;  2D5V A;  5E3M A;  5BNG A;  5C44 J;  3NAR A;  4D7M A;  3FK6 A;  5J1Y A;  4BBS J;  5GPA A;  3BG9 A;  1G2H A;  1W0T A;  2VKE A;  2Y2Z A;  2ID3 A;  3JRG A;  2JA6 J;  3JRC A;  5C4X J;  1A5J A;  3HOW J;  3B6A A;  5IP7 J;  2ME6 A;  3RZD J;  3ZQF A;  2JA5 J;  4I76 A;  3S1R J;  1FEX A;  1QPI A;  3LNQ A;  4IHV A;  3ZOB A;  2ME0 A;  1H88 C;  2GLO A;  4A3D J;  3M4O J;  1JKP C;  2LFB A;  4V2G A;  4BY7 J;  1MH4 A;  2R93 J;  1IC8 A;  1Z0X A;  2Y0S N;  4FCY A;  1LE8 A;  4QIW N;  4MLO A;  4DYQ A;  3Q0W A;  2DA4 A;  5F0C A;  2X9D A;  4A3L J;  3HOX J;  1ETW A;  2DA6 A;  3BQZ A;  2WAQ N;  5GP9 A;  4A93 J;  3GTM J;  4M3D A;  1MBK A;  3HB9 A;  1BA5 A;  3BR5 A;  2HDD A;  5EZH A;  2R5Y B;  2N8G A;  4NDL A;  3BTJ A;  1ORK A;  5F1J A;  1OCP A;  1HDD C;  1MSE C;  2K9S A;  1VF9 A;  4M3G A;  2OF7 A;  2MW8 A;  4BKX A;  1Y1V J;  2X6O A;  3TP3 A;  3OSG A;  1AKH B;  1B8I B;  3LSJ A;  4ABZ A;  5J1U A;  2XPU A;  4XIC A;  3DCF A;  3O8G A;  5FKN A;  3GTJ J;  2CU7 A;  3BG3 A;  1ZR4 A;  4D5F A;  1RES A;  3F0C A;  5FLV A;  2VI6 A;  2XPW A;  3G1M A;  4AUX A;  2R5Z B;  1F43 A;  1T56 A;  2O8K A;  3SDG A;  1AKH A;  1B8I A;  3VPR A;  1ETY A;  1YRN A;  3I4N J;  2H1K A;  3S1M J;  2L7Z A;  2E2I J;  1D5Y A;  1IUF A;  3GTK J;  3S1N J;  3FIW A;  4AC0 A;  2HI3 A;  3JRD A;  1NTC A;  5F0H A;  4GFB A;  1XG1 A;  3E7L A;  2DMN A;  4MIM A;  2K9N A;  2NS8 A;  3GBG A;  5IOY A;  4DW6 A;  1RPW A;  3SFI A;  3JRE A;  4IHW A;  1NK3 P;  4BXX J;  3S14 J;  2G0E A;  3S2D J;  2FJ1 A;  2LTP A;  1U9N A;  1VND A;  2FD5 A;  3HDD A;  2Y31 A;  5IP6 A;  1ETV A;  1TWC J;  1HOM A;  2CRG A;  2LVS A;  4Y52 J;  1JUS A;  2YU9 J;  3BR6 A;  3OOU A;  2XGD A;  3G1L A;  2E2J J;  3GTP J;  2AHQ A;  2W48 A;  2LR8 A;  1GVD A;  2LD5 A;  1QVT A;  1VI0 A;  2VPR A;  4XRS A;  5K7F A;  5GPC A;  2IBD A;  2ECB A;  2QCO A;  1DU6 A;  1ETO A;  4A69 C;  1WH5 A;  4DZP A;  1IV6 A;  1UMQ A;  4EEF G;  2ZB9 A;  2EZK A;  5FKK A;  3MKL A;  3A02 A;  4XRS G;  1PUF B;  2DMQ A;  1FIP A;  5JLW A;  2JA8 J;  2X48 A;  2HXI A;  2YUS A;  2QF7 A;  1FIA A;  2GBY A;  2NOG A;  1ZK8 A;  2E1O A;  5IOZ A;  3ZQI A;  2P81 A;  2L7F P;  2XSD C;  4UUS B;  5EYR A;  3BG5 A;  1O4X A;  2JK3 A;  4S0H B;  4JP0 A;  1K61 A;  5F04 A;  2O7O A;  2CUF A;  4MFD A;  1PUF A;  5DS9 A;  1XS9 A;  3QPL A;  3GTO J;  1WH7 A;  3D1N I;  3S17 J;  1ETX A;  4X1E A;  3S15 J;  3QQA A;  2IEK A;  2R7Z J;  1WCM J;  2Y30 A;  4A3C J;  1MNM C;  1ZTR A;  2M8G X;  3W6V A;  4UUS A;  3A01 B;  2TRT A;  2EH3 A;  3FK7 A;  2WB1 N;  1ZKG A;  4L5E A;  3ZQG A;  2NS7 A;  1B72 B;  1TC3 C;  2DMP A;  2EZL A;  3NAU A;  1LFU P;  1FTZ A;  5F0F A;  3OIO A;  2E2H J;  2ID6 A;  5EEA A;  4BY1 J;  1UG2 A;  4B1R A;  4A3B J;  5K7H A;  3MVP A;  5C3E J;  2CQQ A;  4JX6 A;  3DEW A;  3IH3 A;  4LOC A;  1BJZ A;  1MH3 A;  2K9Q A;  3ZQC A;  1XC5 A;  3CMY A;  2L7M P;  3I4M J;  2XPV A;  4XK4 A;  1B72 A;  3CDL A;  1IRZ A;  2HXO A;  2LKX A;  5FKM A;  3ZQH A;  2JN6 A;  3CCY A;  3Q0U A;  3BTC A;  5FJ8 J;  4A3J J;  2VKV A;  1Z77 A;  2XB0 X;  1JT6 A;  3JR9 A;  4A3F J;  2DMT A;  2MGQ A;  2Y9Z A;  2R5Y A;  1GV2 A;  5FLM J;  1DU0 A;  4IHX A;  4BBR J;  4MO7 A;  2FQ4 A;  2TCT A;  2LP0 A;  2YS9 A;  2DA2 A;  2M34 A;  4DYR A;  5EGO B;  2ELK A;  2M2E A;  1U9O A;  3GTQ J;  5J3L A;  3BT9 A;  1NK2 P;  4QSH A;  3C2B A;  1QVU A;  3HEF A;  3LSP A;  3TED A;  3JRB A;  1MBG A;  1WGX A;  1ZR2 A;  4X6A J;  2E19 A;  3BR0 A;  2R5Z A;  3HOY J;  2M9H A;  3PO2 J;  3UKG A;  3BR3 A;  9ANT A;  5E3N A;  2K40 A;  1GT0 C;  3LOC A;  4G12 A;  1ZGW A;  1JJ8 C;  1F36 A;  3LSR A;  2XRL A;  3BQY A;  4RDU A;  4M3F A;  4FTH A;  2MG4 A;  1FTT A;  2M0C A;  1K83 J;  4B3A A;  4RBO A;  3PM1 A;  2CUE A;  1IGN A;  3WHB A;  3RKQ A;  2NVT J;  1RR7 A;  4B4C A;  4CYC B;  1X2N A;  3S16 J;  4A3K J;  2XB5 A;  4W97 A;  1POG A;  4C3H J;  1GDT A;  1HCR A;  1U8B A;  3JRA A;  3HOV J;  5FKL A;  3Q0V A;  2B63 J;  3BTL A;  1HLV A;  1BW6 A;  1JTY A;  2VUM J;  1OCT C;  2ECC A;  2HOT A;  3WHC A;  2OPT A;  1OJL A;  4CYC A;  2PMZ N;  2O9L A;  1JT0 A;  3QPS A;  4DYC A;  1X2M A;  5EG0 B;  3JRH A;  1EF4 A;  2L0K A;  1MBF A;  2RAE A;  4XRM A;  1FJL A;  3CQZ J;  1MBH A;  2EZI A;  3GTG J;  2DA7 A;  2LY9 A;  3MN2 A;  1GUU A;  1H8A C;  1IDY A;  3A03 A;  1CQT A;  4C2M J;  5IPA A;  5EG0 A;  2R92 J;  3HGY A;  4M3E A;  2JA7 J;  4Y7N J;  2LLK A;  3LSG A;  4JYK A;  2DA1 A;  3H0G J;  3GTL J;  2HOS A;  1RET A;  1SFO J;  5M3F J;  3PO3 J;  2WV1 A;  5M3M J;  1LE8 B;  4DZJ A;  3RZO J;  3S2H J;  5E3L A;  2JWT A;  2L9R A;  1P7J A;  1JKR C;  1ZQ3 P;  1TWF J;  1TWH J;  3Q3S A;  2EZH A;  4IHY A;  1I6H J;  4C3J J;  2HQ5 A;  5IYC J;  2CJJ A;  3HOZ J;  4AYB N;  1AU7 A;  5IP9 J;  1R9T J;  2NVQ J;  3A01 A;  3H3V K;  2CQX A;  2DTZ A;  1Y1W J;  1JUP A;  4FE7 A;  2LK2 A;  1WPK A;  1MBE A;  5IYB J;  3B6C A;  1AHD P;  3FKI J;  1Q1V A;  3SJM A;  2JMW A;  3K7A J;  1X58 A;  3TP0 A;  2GM4 A;  1JKQ C;  3IH2 A;  3HKZ N;  3HM5 A;  3HOU J;  4A3M J;  3JRF A;  5HOD A;  3K2A A;  4IEJ A;  3TW6 A;  1BW5 A;  4A3E J;  4W1U A;  5F27 A;  5EF6 A;  4A3G J;  1ITY A;  2DMU A;  2DJN A;  2COB A;  2EQR A;  3FIS A;  3L1P A;  2AO9 A;  5E3O A;  1ETQ A;  1U78 A;  1IJW C;  4C3I J;  4D7N A;  1JJ6 C;  3HGG A;  1HF0 A;  4MFE A;  1UHS A;  1SAN A;  1LFB A;  2DA3 A;  4HNV A;  2FX0 A;  1W0U A;  1RKW A;  1T33 A;  1WI3 A;  2XGE A;  4J19 A;  3IV5 A;  1YRN B;  1ENH A;  5FKO A;  5C4J J;  1S7E A;  1QRY A;  1MBJ A;  1BL0 A;  3S1Q J;  3TW7 A;  5JLX A;  2DA5 A;  1JTX A;  5EGO A;  4A3I J;  2NVX J;  2I10 A;  2DN0 A;  4M6V A;  3G1O A;  3RQI A;  1JGG A;  1I3Q J;  3BR2 A;  2HYJ A;  1ETK A;  1A6I A;  1P7I A;  3IH4 A;  2Y9Y A;  5J1R A;  5K7Z A;  4FIS A;  1HDP A;  1TWG J;  4UUT A;  1IDZ A;  1RKT A;  3JRI A;  1OFC X;  5EDN A;  1I50 J;  3BTI A;  1H89 C;  5EZG A;  2KT0 A;  2XGC A;  2HOA A;  2H8R A;  1MSF C;  5DTD A;  4D5C A;  4V2F A;  5M5W J;  5M5X J;  4JX5 A;  2NVY J;  1IG7 A;  3OSF A;  2MSY A;  3HBL A;  1JKO C;  5IYD J;  4I6Z A;  1VFC A;  3O8H A;  1JUM A;  3BR1 A;  4M3B A;  1TWA J;  3M3Y J;  2R0Q C;  4XID A;  4QTR A;  5F08 A;  5M5Y J;  2JJ7 A;  4JX4 A;  1GV5 A;  2IAI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...