1FTTA

Thyroid transcription factor 1 homeodomain (rattus norvegicus)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
68
structure length
68
Chain Sequence
MRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKAAQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THYROID TRANSCRIPTION FACTOR 1 HOMEODOMAIN
publication title Analysis of the solution structure of the homeodomain of rat thyroid transcription factor 1 by 1H-NMR spectroscopy and restrained molecular mechanics.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Dna binding protein
total genus 19
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 1995-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1fttA00
3BTCA 1WPKA 2JA5J 4FE7A 4JYKA 1ZQ3P 5DS9A 3BR3A 3GTGJ 2XPWA 4BBRJ 4QIWN 4AC0A 1RKWA 2L7MP 1Y1WJ 2HXIA 3HEFA 2E2JJ 3BR1A 2NVQJ 3TW6A 5EDNA 2AHQA 2NVXJ 1TWCJ 1GV5A 1X2NA 3MVPA 1Z0XA 5M3MJ 1VF9A 3GTOJ 2EZKA 5FKMA 2IBDA 4XRMA 3G1MA 3ZQIA 2HQ5A 4MFDA 2DJNA 1BJZA 2FD5A 3JRGA 3HBLA 5M5WJ 5J1RA 3HGYA 4BY1J 1APLC 3JRDA 2M2EA 2O8KA 1ENHA 2MSYA 3OOUA 1GVDA 2LR8A 3BG9A 1IJWC 4A3JJ 1W0UA 1JKPC 2JA7J 1VFCA 5HODA 3K7AJ 3TP3A 4B3AA 1K61A 3A01B 2XGDA 3W6VA 1QVUA 2HI3A 2WAQN 5F0CA 1P7JA 5IOZA 3Q0VA 2LY9A 1CQTA 1W0TA 2ID3A 4IEJA 5C3EJ 3GTKJ 2CQXA 5FKLA 3SDGA 2JJ7A 3I4NJ 1XS9A 3JRFA 1JKOC 3TEDA 5C4XJ 3H3VK 4DYCA 3BG3A 2AO9A 1P7IA 3RKQA 2R92J 1D5YA 4BY7J 5EF6A 2DA7A 4FISA 4UUTA 1BA5A 4C3IJ 1JGGA 2HDDA 3HOUJ 3HOWJ 4GFBA 1HCRA 2L7FP 5EGOB 1BW5A 1B8IA 1GT0C 3B6AA 5F0HA 3ZQGA 3RZOJ 3A01A 4JX6A 4M3DA 1XC5A 4J19A 4G12A 2DMUA 1RKTA 4A3KJ 1OFCX 3LSGA 3LSJA 1IC8A 4M6VA 3RZDJ 5FJ8J 1ETOA 1JT0A 2EQRA 1UG2A 1WH7A 1A6IA 4A3GJ 1QRYA 4HNVA 5K7ZA 3BR5A 1G2HA 2DA3A 2NS8A 3IH2A 3Q3SA 4W1UA 3UKGA 5F27A 4LOCA 4C3JJ 2JN6A 2R0QC 3GTLJ 3S17J 3TW7A 1I3QJ 3S15J 5IP9J 1MH3A 1OJLA 3G1LA 3MN2A 5F08A 3ZQLA 1S7EA 4FTHA 2M9HA 2Y2ZA 1MBGA 2X48A 1FTZA 1F43A 1TWFJ 1JUSA 5EG0B 3SJMA 1Y1VJ 1SANA 2LVSA 4MLOA 2NS7A 5M5YJ 2HOAA 5EGOA 2XPUA 1ETWA 4IHYA 1POGA 4UUSB 4JP0A 1ETYA 2WV1A 2NVTJ 1WH5A 2R93J 4NDLA 2JK3A 3FKIJ 5FLVA 1K83J 2ID6A 2DMPA 3WHBA 4IHXA 4QSHA 3IV5A 1NK2P 1IUFA 3M3YJ 2D5VA 3A02A 4RDUA 4CYCB 1LFUP 1DU0A 1MSEC 1VI0A 2DMNA 1ITYA 2EH3A 3RQIA 4A69C 4X1EA 1YRNB 2OF7A 3FK7A 1HDPA 1MBJA 2E19A 1R9TJ 2ECBA 1RR7A 1MH4A 5J3LA 2VPRA 1ETVA 3BTLA 1JKRC 3HOZJ 2CRGA 5EG0A 1Q1VA 5BNGA 1IG7A 3GTPJ 3HOYJ 1B8IB 3M4OJ 1QPIA 4A3FJ 2XSDC 5IP7J 1T56A 4UUSA 2COBA 2W48A 1FIAA 2Y9YA 2DA1A 3QPLA 2NVYJ 2VUMJ 4X6AJ 3OSGA 1FTTA 4AUXA 5E3MA 3B6CA 2XPVA 2ECCA 2R5ZB 3A03A 3BR0A 2LD5A 1JUPA 1UHSA 2YU9J 4CYCA 3JRHA 2HYJA 2E1OA 2HXOA 2TCTA 5M5XJ 3LNQA 1ZR2A 4D5CA 3HKZN 1HDDC 5F1JA 1ETQA 4I6ZA 1ETKA 1YRNA 4EEFG 1B72B 2LLKA 2EZHA 2FJ1A 4FCYA 4C3HJ 3D1NI 3GBGA 2EZLA 3F0CA 1WGXA 3OSFA 2B63J 3S1QJ 1FIPA 1JUMA 3S1NJ 1ETXA 2L0KA 4D5FA 3BR2A 2YUSA 5FLMJ 2EZIA 2L9RA 4M3BA 2GLOA 1F36A 2CJJA 2LKXA 4S0HB 3JRAA 1FEXA 1O4XA 5EYRA 1T33A 4IHVA 3FISA 2CUEA 1MBKA 5M3FJ 1JJ6C 2JWTA 5J1UA 2G0EA 1MNMC 2MG4A 3E7LA 1ZGWA 2ME0A 1ZR4A 1LE8B 2R5ZA 4JX5A 1JT6A 4I76A 3ZOBA 1H88C 2HOSA 5IOYA 5IYDJ 1DU6A 5EZGA 3QPSA 4XRSG 2DMTA 4V2GA 2I10A 3BTJA 4A3DJ 3S2DJ 2MGQA 1B72A 2CUFA 1ZKGA 2MW8A 2Y31A 1IGNA 3BR6A 4B4CA 2DA5A 5JLWA 3Q0WA 4A3LJ 4M3FA 3TP0A 3HOXJ 5FKOA 4XIDA 2DA4A 1JKQC 4XICA 1TWGJ 1VNDA 3HOVJ 1TWHJ 2WB1N 3CDLA 3NARA 5DTDA 3OIOA 2LFBA 2K9SA 3HDDA 4L5EA 5F04A 3S14J 2ZB9A 4DW6A 3I4MJ 2RAEA 2H8RA 2CU7A 2K9NA 3JREA 4A93J 3PO2J 1LE8A 2R5YB 4FE4A 3CCYA 3JRBA 1U78A 3HM5A 1U9NA 2Y30A 2L7ZA 4MO7A 1PUFB 1TWAJ 3PO3J 3GTQJ 2EBIA 1Z77A 2JA8J 4A3BJ 5GPCA 3O8GA 3S1RJ 2N8GA 3VPRA 4A3MJ 2CQQA 3WHCA 4A3EJ 1IRZA 1GV2A 1MBEA 3FIWA 1NTCA 3C2BA 2K9QA 2OPTA 1U9OA 2O9LA 3NAUA 4DYRA 5C4JJ 2GM4A 5EZHA 2E2IJ 1IDZA 2DA6A 3S1MJ 2NOGA 3LSPA 1BW6A 3H0GJ 4V2FA 1OCTC 2Y0SN 2M0CA 2VI6A 1RESA 2QCOA 2JA6J 3IH3A 3HGGA 1I50J 2XGCA 4W97A 2XGEA 1HF0A 2R5YA 1X2MA 2Y9ZA 5E3OA 1LFBA 1H89C 4Y52J 2LTPA 1EF4A 5GP9A 1PUFA 2X9DA 4DYQA 1AKHB 2JMWA 3BTIA 3Q0UA 2X6OA 3QQAA 2QF7A 2P81A 3ZQFA 1GUUA 2K40A 3IH4A 3K2AA 4ABZA 2ELKA 5J1YA 2YS9A 5GPAA 3G1OA 3CQZJ 4A3CJ 1H8AC 5E3LA 2KDZA 2FQ4A 2R7ZJ 4BBSJ 2IEKA 3JR9A 4MIMA 3JRCA 4IHWA 4MFEA 4BKXA 3LOCA 2XB0X 4DZJA 5EEAA 1MBHA 2DN0A 4Y7NJ 1MSFC 3S2HJ 5IPAA 1I6HJ 5JLXA 4M3EA 4AYBN 4JX4A 1SFOJ 2VKVA 4BXXJ 3GTMJ 4B1RA 3DCFA 5IP6A 3HB9A 1FJLA 4D7NA 4XK4A 1TC3C 3LSRA 1HLVA 3O8HA 1IDYA 5FKKA 3JRIA 2VKEA 4D7MA 1QVTA 2LK2A 1ZTRA 5K7HA 2LP0A 1AHDP 2H1KA 3GTJJ 2M34A 1AKHA 2O7OA 1UMQA 2E2HJ 2XB5A 4RBOA 2DMQA 1WI3A 3ZQCA 3FK6A 5K7FA 1BL0A 1RPWA 5IYBJ 1AU7A 3PM1A 3BG5A 3ZQHA 4DZPA 1U8BA 1XG1A 1JTXA 1NK3P 2TRTA 2KT0A 5C44J 1A5JA 4XRSA 5E3NA 1GDTA 2HOTA 2FX0A 1OCPA 1RETA 3DEWA 1JTYA 1X58A 9ANTA 1ZK8A 5IYCJ 1IV6A 5F0FA 1WCMJ 2DTZA 1ORKA 4QTRA 3MKLA 5FKNA 3SFIA 4M3GA 2ME6A 3BQYA 2DA2A 1JJ8C 2XRLA 1MBFA 4A3IJ 2GBYA 4C2MJ 3BQZA 3CMYA 1HOMA 3BT9A 3S16J 2M8GX 2PMZN 3L1PA 2IAIA 1E3OC
chains in the Genus database with same CATH superfamily
4E7KA 2JA5J 2LF8A 3IKTA 4JYKA 1IO2A 2Q2EB 3BR3A 3SQNA 3HSRA 3M7GA 4BBRJ 4E6KG 4QIWN 4ZYGA 1ONVA 1Y1WJ 4XOPA 4PGHA 2L5QA 2VBZA 4D0PA 1WWXA 3MD2A 5EDNA 2AHQA 4RB2C 1TWCJ 1GV5A 1W7PA 5M3MJ 2XIGA 1XCBA 4HLYA 1HXDA 2HQ5A 2DJNA 4XN3A 3T8RA 3FKJA 5KAIC 3JRGA 4NNJA 5BS6A 4IOCF 3HUGB 2D2WA 1ZHFA 2H6CA 2QQ9A 3FXUA 3W3CA 5GADJ 3FWEA 1XX5A 3IWZA 5K5OA 2L54A 1ZRCA 1ENHA 2PG4A 2YU3A 3N05A 3MKYB 3GZNB 2ZMEC 2EIKH 1GVDA 1FC3A 3KFWX 5FO5A 2CH0A 4A3JJ 2R7XA 1W0UA 1X3ZB 1VFCA 4KT6A 5HODA 1E17A 4CZZA 4UB8C 2JVGA 3GFLA 2JUCA 4E7IA 2L2OA 4YELA 3FM5A 4ZH4F 3MZ8A 1I27A 2VASA 2KISA 5ED4A 3FXQA 5IOZA 4YFKF 2LY9A 2R7OA 3AL0B 2KIUA 1K78A 2GZWA 2XAGA 2E1MB 1R23A 2W84A 4OU0A 5FKLA 3SDGA 4Y3OA 3TEDA 5C4XJ 3DF8A 2R92J 3K4NA 1RUNA 3OYEA 2BV6A 1FMVA 3TBIA 4P1WA 3CCJI 1S3JA 2IXSA 4ITVA 4NQWB 1J75A 1KA8A 2G9WA 2R7SA 1O3QA 2KIFA 1IRXA 2MA3A 2HDWA 1JGGA 2HDDA 4ZYAA 5IY5H 1X19A 1FSHA 3HOWJ 1ZELA 2DOFA 2OQRA 5EGOB 1W7PD 2VN2A 3B6AA 5IT9K 2XROA 2A5WA 2Y69H 4MQVA 4FQGA 3A01A 1XGNA 2X6WA 2ZFUA 3W6KB 4F7ZA 1RKTA 4M73A 3I59B 3V8JA 1OFCX 2ZMEA 3LSJA 1G3YA 2LF7A 4Y33A 4PFPA 1JT0A 2EQRA 5CJ9A 2X1EA 2GOMA 4N9IA 3BR5A 2WY8Q 1G2HA 2DA3A 2OQGA 1U2WA 1YTYA 4B44A 4A5NA 4LOCA 5J47A 3OYIA 3H0DA 3ZMTA 2P7VB 1I3QJ 5IP9J 3ZXSA 3G1LA 4HF2A 2PN6A 4KNYA 2V1DA 2F5VA 2L01A 2GOXB 1SFUA 3OYGA 3VSLA 3QAHA 1SANA 1OKRA 2NS7A 1KYWA 4XMYA 2XPUA 3K4BA 2EA4A 3RYRA 1POGA 4UUSB 1Z3XA 1UFMA 4F92B 3TO7A 2VQGA 2AQEA 3V8LA 2WC2A 4XM3A 2VJIA 3CMAI 3KZZA 1WI9A 2NVTJ 2MH9A 1IXCA 1BOBA 4P5OA 1MNDA 2DMPA 2Z99A 4ENKA 1BBYA 5FLXZ 2DT5A 1YYVA 4HLXA 3A02A 3JTGA 5B1BH 1LNWA 3BJOA 2DMNA 2E71A 4NC7A 2LBFB 2EH3A 3OYKA 2UZKA 1YRNB 3FK7A 3VYRB 1MBJA 2DK8A 1X1PA 2V9VA 2GAUA 1CGPA 2QSHX 4U7DA 2Z33A 1V4RA 2VPRA 3I64A 1TLHB 3H35A 1ETVA 3BTLA 3CUOA 4HNUA 2W4SA 2CRGA 5D4SA 2Z5UA 3G2BA 3OWTA 3L2WA 1Q1VA 5BNGA 4FHTA 1MMNA 3BZ6A 3CCQI 4J01A 3GTPJ 4WXHA 3BPVA 1TTYA 3R6SA 4A3FJ 2GA2A 2BW3B 1TW2A 5BMZA 3OMYA 4AIHA 2W48A 1X1BA 1A35A 2V7FA 3BY6A 5CVIA 2ZXHA 5DD4A 3HIFA 5E3MA 2EFQA 2XPVA 2CUZA 5CKTA 1LPQA 5DUKA 3VDXA 4I99C 4C2TA 1VQMI 1JUPA 1XGOA 1XMKA 4KISA 2VONA 4DNCA 1ZR2A 4Y13A 1BOAA 4PDKA 1MGTA 1ETQA 2HR3A 2VE8A 2PMUA 4GO1A 5HNHA 4EEFG 4L5IA 1R5HA 2DO7A 4E7JA 4I02A 2KPMA 1MMGA 4XOTA 5D6EA 1YIJI 2V6CA 4KICA 2HTSA 3R0JA 2GXBA 2IRFG 1A36A 1OQYA 2YUSA 5CLSA 1AWCA 5FLMJ 2MH2A 1P4XA 2F4MB 3KX2A 3A4CA 3JW4A 2R7TA 2QENA 2X1CA 4CZCA 1VQKI 5ILVA 3E3VA 1T33A 4EV0A 4IHVA 3FISA 2CO5A 4BDZA 3O6BB 1AA7A 4CSWA 2JZYA 4RA2A 2G0EA 4QPOA 3KLNA 1K6OA 1ZGWA 4KUMA 3CCRI 2HWVA 1RZ4A 1LE8B 2FRHA 2OCEA 3QU6A 3WODF 3DP7A 3MEXA 4FT8A 3ABTA 1A31A 2Y48A 1U5TB 3QPSA 4FASD 3B73A 2LMDA 3BTJA 3OYCA 2OCCH 2UV1A 2KRFA 1A6QA 1FLIA 4F52A 4XKWA 5TJJA 1R1TA 1IGNA 3LFKA 2PQ8A 1Z6TA 3WTZA 5FKOA 1QHHD 1UELB 2K85A 2KZGA 2DA4A 3A0BC 4XLAA 3KP7A 2ZNYA 4XICA 2DXIA 2FOKA 3HOVJ 3CDLA 3M8EA 2D1VA 2XAHA 1H9GA 3MZHA 1IW7F 5HS7A 1V5GA 3IRQA 1OCZH 3HDDA 4GXOA 2JT1A 4PJ0C 2IJLA 3F22A 4G7OF 3I4MJ 3DTKA 4EVIA 2H8RA 2K9NA 3TQNA 3JREA 4L9TA 3DKWA 3CJTB 5JHUA 2V4JC 4FE4A 4HYEA 1U9NA 1YE9A 3EPZA 1YX3A 4Z6YA 1EA3A 4EJWA 1BM9A 4MEYF 1USTA 1MW7A 2F4OB 2M0MA 3PO3J 4OINF 2E7XA 2M45A 2PMHA 2DT6A 2EFWA 2HPMA 4M6YA 2JA8J 4HW0A 5FD6A 2BYVE 4XQFA 4JBAA 3TMOA 2E5NA 3WTTC 5E1XA 3WHCA 3LSHA 4N4NB 3R60A 1D0XA 2R7VA 3V42A 2K9QA 1N75A 3Q5FA 1QZYA 3SHFA 1I5ZA 2JPBA 2M87A 2OV7A 3Q9VA 4HPQA 3IL2A 2JSPA 3S3NA 3TDUC 2GM4A 2E2IJ 3ERED 1DP3A 3S1MJ 1WSUA 3FMRA 4L0ZB 3I58A 1DUXC 4PJLA 3R4KA 2VI6A 1ZGJA 3REOA 2JA6J 2XV4S 3ZMUA 3OYJA 4BE0A 2CV0A 5KK1A 3CC4I 1IZ1A 1FBUA 5ICGA 3CDHA 3LQRA 4WF2A 1SVMA 4MTEA 1AOYA 2JMWA 4EJOA 4NHJA 2X6OA 2QF7A 4U0VA 3OR1C 1X1CA 4B09A 3JSOA 3E6BA 4CYDA 3TOAA 1E3PA 3IH4A 3OYAA 3I71A 3WE3A 3QRFF 5J1YA 4RMNA 3F6OA 3F8MA 4B3XA 3LSMA 3DKXA 5E3LA 1D1CA 2DFIA 2YX7A 3T8TA 4WCGA 2VBXA 4MIMA 2K3FA 2KQRA 4E7LA 3FHNA 1ZYRF 4AD9A 2DYSH 2GIVA 4OIRF 5EEAA 3MKZA 3RYPA 4PGGA 3V4GA 4BQOA 3CCEI 1USSA 4Y7NJ 1YHQI 5IPAA 1XSXA 1SFOJ 2VJ5A 2VKVA 4IHTA 4UV8A 4AIKA 3DCFA 1JGSA 3K1PA 1S9HA 2X1DA 4XLEA 3O8HA 4LLLA 4D7MA 1ZTRA 5K7HA 4HBLA 4CCOA 1AHDP 1MMAA 2K7LA 2M34A 4KJZA 1AKHA 2MD0A 5B5EC 2E2HJ 3JAMZ 2WAEA 3ZMDA 3K4JA 1WI3A 2FEZA 3LQQA 3ZQCA 3FK6A 3QYBA 1MJAA 1KQ0A 3N97A 4V19K 4DZPA 2O03A 1XG1A 2HNHA 4S05A 1NK3P 2TRTA 2Z1DA 5FRMA 1HSTA 2ESNA 4XRSA 1UHMA 2RN7A 1PJRA 1GXQA 1JHFA 2XVCA 1FP1D 3PNTA 4KIFA 2X0LA 2V6EA 5LHGA 5D5UB 2WTEA 2Q8KA 1ZK8A 5IYCJ 4II3A 1IV6A 5FFXA 2E1NA 1YG2A 4G8XA 2VQHA 4IRHA 2DLLA 2DW4A 1XTAA 4RAGA 5J8FA 3CCLI 1BC7C 2DA2A 1JJ8C 2RKHA 1MBFA 5D5WB 4BQQA 2FQ3A 1STZA 4ZZDA 2CG4A 4I98B 2BOLA 1PDNC 1FP2A 3A2KA 3IAM2 3BROA 3CMMA 3L1PA 2X6YA 1WJCA 2A3SA 3VYTB 1E3OC 2W24A 2HVSA 1Z05A 5HLHA 1VQ6I 4B43A 3R61A 2HXIA 2M8EA 2OUMA 3BR1A 3WTSC 3U2RA 3HG9A 3MVPA 1Z0XA 2ZJPF 1VF9A 2M3AA 2FF4A 1RNLA 3ZQIA 2ICWG 4PJMA 1N78A 2WWYA 1YITI 2K27A 4DBRA 1SD5A 3HBLA 3CTAA 1KU3A 1O7FA 4BJTA 2XGXA 3HGYA 3A0HC 4L9NA 3HPHA 2L02A 4EJTA 4PSWA 2ZJQF 3LSTA 3K6GA 5J40A 1ULYA 3OOUA 3RKWA 3DLLF 5HDGA 2HQAA 4AIDA 4AM3A 2Y0MA 1JKPC 3OYMA 1FNNA 3K7AJ 3AL0C 3TP3A 4BL0B 2E1MC 2QEXI 3AKZA 1WJFA 4H4KC 1YJNI 2COMA 2QQAA 4MEXF 1VQ9I 2IA2A 1WKMA 2PX9A 2Q2EA 4RLQA 1E2XA 3KP2A 2VXZA 3EQLF 3DPTA 4UVBA 3ECOA 2P5KA 5EEHA 5F0CA 3VSKA 1KQ8A 3KETA 4CDGA 2EB7A 1Y0NA 1P7JA 2CQNA 4WXCA 1W0TA 2ID3A 3M9AA 4IEJA 4OWRB 4YIRX 3GTKJ 2CQXA 1J5YA 2M5WA 2BHZA 2K5CA 3JRFA 1JKOC 1VZ0A 2HPIA 3FMQA 3H3VK 2IPQX 3BG3A 2AO9A 3HUGA 3CUQB 4BY7J 3OYNA 1J7KA 2DA7A 2GA1A 4FISA 1DQUA 3QOPA 3AG2H 1WQ2A 4PJNA 1F9NA 3IP4B 4C3IJ 2PMZA 3QP6A 3DKYA 3K9TA 1ZREA 1X4OA 3HOUJ 2DODA 4BAYA 2LNBA 1JI8A 3OYDA 2NS0A 1Y56A 3Q9SA 1ZLJA 1LEAA 2BGCA 1YS6A 4DOZA 5F1RA 3QODA 3ZQGA 4M3DA 4G12A 2DMUA 4YFXF 2ZFWA 4A3KJ 1WJ5A 1FYKA 3J7AO 1IN4A 3FF5A 3LSGA 2XAFA 3BWGA 2MYSA 5D5VB 4M6VA 2XC7A 3E6CC 2P7CB 2GIZA 5FJ8J 3ABKH 1UG2A 1T8IA 3K0LA 1TQIA 1A6IA 3AG3H 1QRYA 5LEKA 5A2QK 1GHCA 1SFKA 1DGWY 3QPTA 2ZXWH 2F5CA 4G6DA 5F27A 3OS0A 1Z67A 4C3JJ 3CCSI 2DFEA 3TW7A 3S15J 1JXSA 1LVKA 1OYYA 2HYFA 2XAQA 3I54A 4GCVA 4NQWA 1ZGAA 5CVUA 1V5FA 1JUSA 1XGMA 1Y1VJ 2L7KA 5ILSA 1SEUA 1XGSA 3GF2A 4Y4RA 5EGOA 3FBIB 4YEJA 2E5ZA 4E7HA 5L3CA 5FGMA 4IHYA 1R1UA 3BOQA 2K4JA 1QU3A 3ZCOA 2WV1A 4LK1F 2OD5A 4XR6A 4F91B 3I59A 5FLVA 5GAEJ 2ID6A 3WHBA 3DPUA 1QBJA 1XD7A 4IHXA 4IHSA 2IGOA 5E8IA 1NK2P 3HKZA 3M3YJ 4O5VA 4EJUA 2I5UA 2ISZA 3PFYA 4CYCB 1LFUP 3CO6C 2LG4A 1K4TA 2OJED 4XLHA 1ITYA 2XDVA 3E6DA 3FM3A 4GGGA 1IRFA 1Z7UA 2DDBA 2V9KA 3FXKA 1HDPA 3VB2A 1YJWI 3WTUC 2OU2A 4B8XA 1JE8A 2E34A 3WU0A 3EUAA 4Q5SF 1MH4A 2QBYB 1T0FC 3FDYA 1LFPA 4D1QA 2JPCA 4BNCA 3DBRB 2EFPA 3B02A 1WJAA 4HQMA 1IG7A 2M7AA 3M4OJ 3RI4A 1S7AA 2RNJA 2XSDC 1ACIA 4UUSA 2Y9YA 3T0YA 2DA1A 3ZMZA 2NVYJ 2IT0A 2M7BA 2CW8A 2IS1A 4X6AJ 1FTTA 3OV8A 3VYSB 4AUXA 2HZTA 4RM3A 1WHUA 4LB5A 3BR0A 2LD5A 3QP5A 3K4CA 1SVLA 4HX8A 4UHTA 1XMXA 3VFZA 5M5XJ 2YU9J 1O3SA 2LC2A 1R5GA 3HKZN 2LBFA 4XLPF 3HL2A 1ETKA 1YRNA 2K02A 1PP8F 1XN7A 1O7LA 3DU5A 1B72B 3O2PE 4PCQA 4C3HJ 2DJIA 2EZLA 4EGZA 4IRGA 1FIPA 3S1NJ 3WE2A 5H6QA 1X3WB 2KRHA 3C2GA 3JAMK 3RCOA 3SFZA 2W85A 3W2WA 2IA1A 2EZIA 2W1OA 2LKXA 1QZEA 2BW3A 4S0HB 5HS8A 4NC6A 4DQ2A 5BPIA 4RGSA 5EYRA 1FEXA 1VQPI 2XSJC 2L9SA 1T0FA 4AU7A 1JJ6C 5K5QA 1SFEA 3WTYC 1MNMC 3DTEA 3KEOA 5H20A 1LVAA 1QNTA 1WJDA 3BDDA 3FMSA 4NC8A 5H6RA 3HPGA 1JT6A 5TISC 3ZOBA 3RIRA 1YIOA 5B3SH 2HOSA 1U8RA 1FZPB 2VJJA 5HNFA 4Y15A 5IOYA 5IYDJ 3U9GA 1YOVB 5HS9A 2MC4A 5IT3A 4IOAF 4XRSG 5CYVA 2P0WA 3FBNB 4R1HA 2OTJI 2FUG2 4OMZA 4A3DJ 4ENNA 3S2DJ 2IS4A 2MGQA 4CUGA 2A6TA 4G7ZF 4KIBA 4BU2A 5JLWA 1KYZA 4BQNA 3S3MA 4OMYA 4M3FA 3TP0A 4XIDA 4HV6A 2CV1A 2JVHA 1J2XA 4A0XA 4IO9F 1TL8A 1TWGJ 2WB1N 4BDYA 2H09A 1X4PA 3OL3A 4M9SA 1J59A 3HJEA 3W6JB 4X0GA 3J80K 2RQPA 4G7HF 2ZB9A 4LB6B 5FRNA 2A69F 2H94A 3I9V2 2CU7A 4XSZF 1U0JA 3E6MA 3O3KA 4A93J 2MD5A 3H9QA 5GAHJ 2R5YB 1LE8A 3CCYA 3JRBA 2PJRB 2R7FA 4EQQA 1KU9A 4MO7A 4CICA 4UY8I 1U5TA 1Z77A 4Q47A 2LDUA 2LY2A 2CS3A 3S1RJ 2NRAC 2LREA 3HRUA 4A3MJ 1GXPA 2FNPA 1IV8A 1MBEA 3BJAA 4B48A 4BS9A 3H9JA 5E8GA 4Y17A 5LHIA 2X4HA 1FYMA 3W2VA 1HKSA 2O9LA 4KIGA 3KLOA 2XHKA 3G3ZA 2DA6A 3E97A 2O8XA 4G6TB 1TQPA 2NOGA 3HYIA 4Q48A 3H0GJ 4V2FA 1R49A 2F5FA 2CQKA 1RESA 4HOBA 3IH3A 1RIOH 1T38A 2V79A 3ABLH 4W97A 2NAZA 3ZRGA 2W25A 2X51A 3EUKL 1VQLI 3H9GA 1YW8A 5E3OA 1B59A 2QA4I 1LFBA 4XKVA 2QM3A 4ZC3A 4PJJA 3CLOA 4HSTA 3T1BA 2X9DA 1MNEA 5DM7F 3BTIA 1RRJA 2P81A 1X1DA 1GUUA 1G8XA 5AIQA 5J8CA 2K40A 3ASOH 1LEBA 1HW2A 2Z9OA 5FFZA 2STWA 4F93B 4N9HA 1N77A 1VQNI 2FQ4A 2R7ZJ 1YO5C 4BBSJ 2IEKA 3RSNA 3JR9A 3MQ0A 3JRCA 4IHWA 4OIQF 4BKXA 2CW0F 3P9KA 3PNYA 1Z3YA 2F5DA 4F55A 2KHMA 2DN0A 1S5LC 1S72I 3S2HJ 4DIQA 2JUGA 5JLXA 4M3EA 4JX4A 4I01A 1T39A 1K7AA 1J09A 3W2AA 3GTMJ 5IP6A 4XKBA 3TGNA 2E36A 3G73A 4XK4A 2D1HA 3SZTA 3HOTA 2KJBA 1D1AA 2VKEA 2LK2A 1HW5A 2H1KA 3L2UA 2PFBA 3GTJJ 1R71A 3KP3A 2YX4A 1FX7A 4NBQA 4IZZA 2R7QA 4OAZA 2FU4A 2MC3A 4XKCA 5E1ZB 5JI6A 5L3GA 1P2FA 1TT5B 4ZYEA 1RPWA 3SEZA 3PM1A 5HLGA 1U8BA 4GYGA 3ZMVA 2GQQA 2XRNA 1NH3A 1JTXA 1HQCA 2RGVA 3LMMA 5E3NA 1GDTA 4JQFA 2HOTA 4M9ZA 3ABMH 1QGPA 1RETA 2VC0A 5LEJA 3DEWA 4XL9A 2PEXA 3F3XA 1SD6A 3RJPA 2DTZA 1W36C 4BH9A 1ORKA 4FX0A 3F8BA 4QTRA 1ERDA 4KMUX 2F5EA 2CFOA 2HS5A 3SFIA 5A2QZ 3BZCA 2ME6A 2BHYA 3BQYA 3PSFA 2E7WA 2GBYA 3BQZA 1ON1A 1FY7A 2BVMA 2ADUA 3BT9A 5KHDA 3CMYA 1HOMA 3S16J 2A07F 3OS2A 3P9IA 2KDOA 2P8TA 2KLOA 3BG5A 3PNVA 4FE7A 4OIPF 2HOEA 5DS9A 1ZQ3P 4GYIA 2ZKZA 3OYBA 3GTGJ 1KGSA 3H1CA 1OLTA 4AC0A 2L7MP 2IGKA 3HEFA 2E2JJ 2ACJA 1R36A 2NVQJ 3TW6A 1QO0D 4A12A 2NVXJ 1X2NA 4CCMA 2EZKA 4HSRA 3GX4X 1IXRC 4BEHB 3G1MA 1W1WE 4JK1X 2LRDA 1BJZA 2F2EA 3J81Z 4WWCA 4CO8A 2FBKA 2OA4A 5M5WJ 3FZVA 4KT5C 1P4AA 1C0WA 2KIQA 2VODA 2ZCWA 2NXNB 1APLC 5K1YA 1SD4A 3VODA 3J7AY 4L0YB 3PQKA 2MSYA 5AONA 4ESFA 1OPCA 1T2KA 3I55I 1LQ1A 2LR8A 4ESBA 1RI7A 3BG9A 1V54H 3GYHX 1IJWC 1FOXA 3SZPA 1MJ9A 2JA7J 2P5LC 2BBYA 4BJ6C 2VC1A 2JRTA 2XGDA 3FXMA 3OY9A 2ISYA 1BI2A 2QWWA 1H0MA 1QVUA 2HI3A 3M1CA 3WG9A 2WAQN 5B1AH 5AIPA 3NQOA 1DP7P 1CQTA 2BXZA 5C3EJ 3F72A 3PJRA 4RB1A 3KYLA 2JJ7A 4FETA 5GTHC 2CV2A 3I4NJ 3KZIC 1IF1A 3PUBA 2AXLA 4RB3C 1M1EB 1P7IA 3RKQA 1HC8A 2DDAA 5DDGA 3CP8A 1ZLKA 5EF6A 4UUTA 2JA2A 3DPLC 1YJ9I 1SAXA 3DEUA 1FOKA 1BIBA 3CJQB 2NNYA 3TKYA 3E5XA 5LHHA 1ZG5A 3RPUA 3K1MA 3KP6A 2HDCA 2KRCA 1B8IA 3K2ZA 1GT0C 1FWZA 4L9JA 3ZR8X 2JRMA 1LB2A 5L3EA 1MDMB 4JX6A 4J19A 4XLCA 5LD2C 5CQEA 2EFNA 4ENJA 4U7BA 1BIAA 1GVJA 1D5VA 1RR8C 1IC8A 4UNOA 3IKVA 1OMIA 5D8LB 2V1NA 1EV7A 1DPRA 4LG0B 1R00A 1WH7A 2QUFA 4A3GJ 1O3TA 3JTHA 4HNVA 2BE5F 2XAUA 2EJRA 1W5CC 2UXNA 4BHPA 1R6RA 1MZBA 3LWFA 3RKYA 3IH2A 3Q3SA 4W1UA 1UAAA 4LITA 4U0WA 2R0QC 2MBFA 2IS6A 3CUQA 4L5JA 1W36D 2OBPA 5D6FA 1OJLA 2HKOA 1B9NA 3MN2A 2AQFA 5F08A 3ZQLA 1S7EA 1DPUA 2LH9A 4O6JA 4CCJA 4FTHA 2Y2ZA 5LFAA 1MBGA 2X48A 1F43A 2M4KA 5HLIA 5EG0B 3H5AA 3SJMA 2XF5A 1EH6A 2RC4A 4MLOA 3CF5F 3ABUA 2VJ4A 5LRSA 1V55H 5DCFA 4HZFA 3ZPLA 1ETYA 3L2VA 4CGZA 3CMEI 1WH5A 1SC7A 2K3PA 4NDLA 1K83J 2KJCA 3ZQ7A 3CLQA 3I3LA 4CXFA 3EYYA 4QSHA 4A0ZA 4EM1A 2ZXIA 1TP4A 4XLNF 3U21A 1IUFA 1D0ZA 2O6GE 2A6HF 3J80Z 4IJAA 1MSEC 3RDIA 5HLTA 3RPUD 3F8CA 2FBIA 2J5OA 1KQ9A 2MABA 2OF7A 4AVPA 4IKFA 1R4NB 5DV5A 1HSJA 3HOSA 1K4SA 3OIPA 5J3LA 2E1CA 2QKLB 4U88A 1Z1DA 3NWSA 4RGUA 3HRTA 1T95A 1G3WA 2ZJ2A 2W7NA 5E17F 1V3FA 3NWTA 5JVTA 1B8IB 1QPIA 5IP7J 1T56A 1TBXA 3F8NA 1BR2A 1FIAA 3ROUA 2F48A 1I6XA 3G6EI 2DOEA 3HTUA 2L4MA 3OSGA 4EGYA 1UHWA 2BEOA 3BC8A 2UUZA 2VKHA 2R5ZB 1ZN2A 1UHSA 5DCMB 1I1GA 4CYCA 3JRHA 5TRDA 2E1OA 2HXOA 3KPHA 3D5LA 1O3RA 2W00A 4D5CA 1TNSA 4P9FA 2J5PA 3GVAA 4RLFA 1HDDC 5F1JA 4I6ZA 4MTDA 3P7NA 3L2RA 1ON2A 4BYYA 2BXYA 4E7SA 5HOOA 4LLGF 1EH7A 1V5EA 2EZHA 4LMYA 1Z9CA 1SVOA 3VEPA 3BPXA 5CQGA 3GBGA 3F0CA 3OSFA 3CO7C 5E1WA 3MZYA 2QBYA 4KFCA 3CC2I 1ETXA 4U0YA 1YFHA 3BR2A 1CF7B 1W4MA 3CJNA 2NYXA 1WVRA 1PP7U 1PVEA 3LFUA 4M3BA 1IRGA 1F36A 3IAS2 4UUVA 2EV0A 3JRAA 3WG7H 2M30A 3HTSB 1O4XA 3PIOF 3KEQA 3UR3C 4ETSA 3H5NA 1XPXA 4YIFA 3C7JA 2L9NA 5J1UA 1Y8RB 2MG4A 4IQ4A 3L09A 3U1KA 2ME0A 4NUBA 3WGHA 3ZP5A 4ZYDA 3CESA 3QYEA 2WY7Q 2BY1A 1FSEA 4PFOA 1NG6A 3WTVC 4LJZF 5EZGA 4KITB 2IGMA 1WJEA 1JHHA 2I10A 3WTXC 1U6GA 5CVJA 5L3BA 2QSFX 2G7UA 3VOEA 3EUHC 1B72A 4ZDOA 2DPUA 2M1BA 1ZKGA 3V8KA 4RM2A 2MW8A 2Y31A 4YFNF 4LLNA 1G3TA 4ASNA 2ZNZA 3KE2A 4II2A 3BR6A 4B4CA 2Z3YA 3ELKA 1VQOI 2DFFA 4A3LJ 3RKXA 3HOXJ 3QWLA 2W82A 2EWNA 4LIUA 3GCMA 5FD5A 4KYWA 3K69A 3M07A 2Q0OA 3QU3A 2W57A 2DOAA 3MMYB 3PUFA 3D0SA 2LFBA 2K9SA 3K70D 2ZBKA 1BR1A 2NNNA 1FMWA 1YW9A 3IUOA 3TO6A 3GUDA 4N4OB 3MAJA 5ICCA 4A6DA 4DW6A 3KYDB 3J81K 4LFUA 1F5TA 1XMAA 2DQLA 3S93A 3WU2C 4HDUA 3PO2J 1ZG3A 2HYGD 1VQ7I 4ZYHA 3HM5A 4PK4A 2Y30A 2FBHA 2P4WA 2F6CA 1PUFB 1NHAA 1TWAJ 3I4PA 2EBIA 5FB2A 2V9PA 1OYWA 4A3BJ 4HQEA 2BZTA 5GPCA 3F6VA 2C6YA 3O8GA 4ZDPA 4YIIA 2XASA 3SDBA 3HRSA 1IRZA 1GV2A 3LL7A 3FIWA 4I2OA 1G59A 1NTCA 4IQJA 4QPQA 4UXNA 3C2BA 5D8KB 3NEUA 4AIJA 2DFHA 1U9OA 4BE2A 1HKQA 3R0AA 4DYRA 2AS5F 1KU7A 1IDZA 3EUHA 3LAPA 1IN8A 2OZUA 4G6QA 1A04A 3WTWC 3LSPA 4IRIA 1QA6A 4P96A 2V26A 3IC7A 2Y0SN 2XKPA 3CDIA 3RQ4A 3F21A 1GLNA 4PSXA 2QCOA 5KVRA 3L2CA 2IW5A 3HGGA 2FMLA 4KN4X 1WFXA 4CH7A 5KCMA 2XGEA 5HDKA 1HF0A 2R5YA 1X2MA 2EA2A 2PJRA 2OZ6A 1L0OC 1WJBA 4Y52J 3OR2C 4DYQA 4AVZA 2KIMA 2HU9A 3QQAA 3ZQFA 2CYYA 4C9YA 3WGGA 2ZSIB 4LG3A 1TW3A 5B66C 3WU1B 3K2AA 4ABZA 1QZZA 1YLFA 4XLFA 2RVCA 3EETA 2YS9A 3DXJF 3LAJA 1MIJA 2D45A 2R7UA 3DBLB 3CQZJ 4HRIA 2WB1A 1I1SA 1I39A 2KDZA 1O57A 2R4GA 2ELJA 2CGPA 1R58A 3C3WA 1G6NA 4C2UA 3TO9A 3GFMA 1SAUA 2X85A 1EH8A 1HW1A 4GDFA 3A1YA 1MBHA 4IX7A 1J9IA 1U5TC 1MSFC 4RGXA 5ICEA 4J00A 1I6HJ 5DM6F 3L00A 2JQ7A 1IN7A 3S8PA 4B1RA 3HZJA 1IN5A 2RV8A 4RAFA 4D7NA 1TC3C 1HLVA 3ASNH 4PUSA 4Q4ZF 1VQ5I 3NRVA 1MKMA 2HTJA 2G7HA 2I8DA 3E0JB 4IXAA 2PLYA 2H8WA 4GRIA 3H92A 5J6XA 4ZTFA 3M8JA 1UMQA 2PBIA 4ESJA 2DMQA 3AAFA 3G71I 4RGRA 5K7FA 5H2FC 2LSOA 3ECHA 1UB9A 2YSRA 2LOOA 4D9JA 4ZTJA 1FPQA 3KCCA 3ZQHA 1TT0A 1KZHA 2WBMA 3SYTA 3BJ6A 1W7PB 2MLKA 4WK8F 1D0YA 1XB4A 5C44J 1W5SA 4XRFA 4MHGA 2FX0A 1D8JA 1OCPA 1OCRH 2CW7A 2VL8A 4KN7X 1JTYA 4G94A 2K9LA 3AG4H 4BHCA 2DPDA 3ISPA 2DK5A 3MKLA 3GO5A 5FKNA 2H6BA 5ICFA 2DBBA 2LKSA 3QYFA 4UVAA 1G3SA 4HX7A 4LK0F 4BGDA 4C2MJ 4UB6C 1MD0A 1UJ8A 2XF7A 2GXGA 3HRMA 2M8GX 2EV5A 2IAIA 3BTCA 3ONQA 1WPKA 3I53A 2QKMB 4UV9A 3GMEA 2HQNA 3GXOA 2XPWA 4BACA 2O61A 2K4BA 1D3YA 1RKWA 2OAZA 3HHGA 4M71A 5JHFA 3KP5A 2HQRA 4C30A 1K78B 2AXTC 3QPHA 3S2WA 1IAWA 1WZ2A 2FSWA 2IP2A 4L9VA 5FKMA 3GTOJ 2HVRA 2IBDA 3SZGA 5J4YA 5LGUA 2CWEA 4XRMA 3CD6I 4MFDA 3C18A 2FD5A 3IRRA 4ZDLA 2P5VA 2VE9A 3UNGC 4F3QA 4I0BA 3LA7A 5J1RA 3FXRA 4BY1J 1P6RA 2CQ7A 3JRDA 4KMFA 3DBHB 2M2EA 2KFDA 2O8KA 4LIVA 2GXAA 4XONA 1KONA 5D4RA 4IVNA 1B1BA 4ZJZA 3I0TA 1YW7A 1PUEE 2DTRA 5LGTA 3KP4A 4DBQA 2BY0A 4EM2A 3BZKA 3CCUI 1FOYA 5LLQA 4M72A 4B3AA 4AWXB 2VB6A 3CCVI 1K61A 3A01B 2EV6A 2KKOA 3W6VA 3S32A 4RS8A 1PYVA 2QZ8A 5KNLA 2ZMEB 2EIJH 2FMYA 2R7RA 3V7RA 5JR3A 2ESHA 3Q0VA 4XORA 3HXLA 3DV8A 3PSIA 1SFXA 4ANJA 1LDJA 1FOWA 4XSXF 2FNAA 2Z16A 3BG6A 1RUOA 5EJCA 1EJ9A 1XS9A 4BEHA 1T98A 3K10A 3ZGKA 1K79A 4I0AA 3BG7A 2L3DA 1X3UA 4DYCA 3WGIA 2JSCA 1ZARA 1D5YA 3RTRA 3L9FA 4MNUA 4P55A 4ENMA 4IF4A 2HEOA 2E35A 3LA2A 1BA5A 3BLYA 4HV5A 2LY1A 1FYLA 3OYFA 4HEA2 4GFBA 3H36A 3GEZA 4E4HA 2L7FP 3QOEA 1HCRA 1DGRM 2KP6A 5DYMA 1BW5A 2LKPA 1BR4A 4U87A 2YR2A 4HG2A 5F0HA 1D1BA 1B4AA 1XCVA 3PQJA 1OR7C 1TNTA 5LRRA 3RZOJ 5ILUA 1XC5A 2VT2A 3J7YJ 3SXYA 4OOIA 1XSVA 2A6EF 5D5XB 2EILH 2HGCA 2IGNA 3RZDJ 3CP2A 1S8NA 1ETOA 4A5MA 3DEEA 2DCEA 5K7ZA 3MFKA 3M8FA 3VYUB 3ZN1A 2RREA 2NS8A 5DD8A 3H5RA 4KA4A 2BVLA 5J4VA 3UKGA 3DFGA 4RAYA 3IHUA 3GTLJ 2JN6A 3TDZC 1S6LA 1Z7LA 3P5JA 3S17J 3BCAA 4UVCA 5CPRB 1MH3A 1RC9A 2KZVA 4N0BA 3I56I 2WV0A 2M9HA 2XF6A 4XNFA 3OIQA 2EIMH 1MMDA 1ODDA 2HZDA 4K2EA 1TWFJ 2O5RA 5FROA 1FTZA 3OS1A 2IVMA 1BI3A 2V1XA 4ON0A 5TGTA 2LVSA 4TV7A 5M5YJ 2B0LA 2HOAA 2B7EA 1ETWA 3GWZA 1U3EM 3PFIA 1REPC 1S29A 4M74A 4HX4A 4ZZLA 2K86A 4JP0A 2WAQA 3CC7I 1J0RA 1LDKB 3ML6A 1MDMA 2NVUB 1YX5A 3F9KA 6PAXA 3E5QA 2R93J 2EINH 3EDPA 4MQ9F 2JK3A 2RDPA 3FKIJ 5DEQA 3LA3A 2EFOA 3COAC 2DQRA 3LSIA 4E7ZA 4QLCU 2X6XA 4A0YA 3ESWB 1W5TA 3IV5A 3BP8A 4LG0A 3L2QA 1UZCA 2D5VA 4RDUA 1DU0A 5E20A 1VI0A 2NOJB 2UXXA 3FXJA 1OR7A 2Q1ZB 5JFRA 2KL4A 3RQIA 4A69C 4X1EA 3G4SI 2VBYA 4P9UA 4JOMA 2RNGA 2E19A 1QPMA 1R9TJ 2ECBA 1RR7A 3GW2A 3T5XA 2QQ8A 3MCZA 3TL4X 1IXSB 1FT9A 1ZAOA 2Y75A 4HAMA 4H0EA 2OC6A 1JKRC 3HOZJ 4R8HA 2VPLA 4DJAA 5EG0A 1Q1HA 3GZ5A 3HSFA 2FA5A 3HOYJ 2DU9A 2VT3A 1SMYF 3K4LA 2FE3A 4CCNA 3M1EA 1SMTA 2COBA 3QPLA 4E70A 2VUMJ 4MGRA 1YQAA 1T08B 2CFXA 5BOXA 1ZRFA 1LKXA 4O3MA 3ERMA 3CUQC 2LYCA 3ULQB 5E18F 1Z91A 1BI0A 3B6CA 3KIOA 2V1UA 2WAFA 4BUPA 2ECCA 2F4IA 2M4GA 3DQVC 3A03A 3JSPA 1Y39A 1DDNA 4HA8A 4R79A 2STTA 3L7WA 3GZ6A 2HYJA 2TCTA 3LNQA 1Z6RA 3GLLA 5KAFC 5HDNA 3D5RC 4IPAA 1Y6IA 4IL6C 4DGWB 3AFHA 5DUIA 2ELHA 2LLKA 2FJ1A 4FCYA 3D1NI 2B63J 4RAZA 3GLXA 1WGXA 3ZN0A 3RPQA 4EMSA 3S1QJ 1JUMA 3MKWB 4D5FA 2L0KA 1E3HA 2QVOA 3OL4A 5LBQA 1LDDA 1YI2I 1FBQA 2IA0A 4EM0B 2L9RA 3V7CA 2VBWA 2GLOA 2CJJA 1MJBA 1R4MB 3K1NA 3PL8A 2CUEA 1MBKA 2FOWA 3CCMI 5M3FJ 2JWTA 4A6EA 1S7OA 2XAJA 1XDSA 3E7LA 2A5YB 5K5RA 1ZR4A 2QQBA 4JX5A 4I76A 2R5ZA 1BC8C 1H88C 4RB0A 2Z2SB 5DCMA 2R7DA 1Y0UA 3KYCB 1XSDA 1DU6A 2E60A 1QHGA 1P9QC 4BQAA 1SD7A 4EATA 2DMTA 4V2GA 5E79C 2JTVA 5L3DA 5BQTA 1D8KA 2QGUA 3OYHA 2KMUA 2CUFA 2R3SA 5ERIA 5IT9Z 3KEYA 3EYIA 5F6FA 5BPDA 1BJAA 2DA5A 4XN0A 3Q0WA 2VOPA 3CF2A 1CF7A 1K6YA 1X1AA 2B9SA 1P92A 1JKQC 1B9MA 4CHUA 2H1LA 1VNDA 1TWHJ 2O0YA 4XBFA 2QLZA 4BE1A 3NARA 2DYRH 2O3FA 1B6AA 2HFHA 3OIOA 3JCUC 5DTDA 2OTLI 5FLXK 1ZH5A 2PJPA 4FX4A 1VQ8I 1E0EA 3K70C 4L5EA 1N25A 5F04A 3S14J 1F4KA 1LUJB 2RAEA 1R22A 2R7WA 1IN6A 1U78A 1IUYA 4BHBA 3PIPF 3F23A 2K9MA 2QYOA 3S3OA 3U1DA 3DU6A 2L7ZA 1H9TA 4BXUA 3D5SC 4OIOF 3GTQJ 1WRJA 5F64A 1BI1A 3X2QH 2ZO4A 5GTIC 1R5ID 2WA0A 3I5UA 2VLAA 4YG2F 2WADA 2GWRA 3FXOA 2N8GA 3N4MA 3VPRA 1ZRDA 4Z2YA 3BCBA 2CQQA 4A3EJ 2A05A 2EPFA 3GFIA 1OYIA 3ZQQA 4L18B 3IWFA 1BN5A 2DAOA 2OPTA 1R1VA 3C1DA 1Y8QB 2HKXA 4CCKA 1NG7A 3NAUA 4HNTA 5C4JJ 4G9YA 5EZHA 2PI0A 4AYBA 3H3ZA 2VQLA 2VXDA 1BW6A 4I7HA 2P6TA 1OCTC 4CA0A 2ZC2A 3K4KA 4EJVA 2M0CA 5CVVA 1I3AA 2ZXJA 1I50J 2XGCA 4M6XA 4OAYA 3AG1H 3FHZA 3E1SA 5HVQC 2UWMA 4A2UA 2Y9ZA 2RQQA 1H89C 3FXLA 4WX9A 2LTPA 1EF4A 5GP9A 1Z21A 4QWQA 1PUFA 1AKHB 4NB5A 2VQCA 1F1ZA 4KDPA 3Q0UA 1T6SA 4LD5A 1TQMA 4HF0A 1MMSA 2ZJRF 1R7JA 1QQIA 5L3FA 3F8FA 2FXAA 2QSGX 5GAGJ 2ELKA 1G4DA 1HKTA 2P6SA 2ETHA 1P4WA 4B47A 3J7ZI 1L3LA 5GPAA 3G1OA 4A3CJ 1H8AC 4LGWA 4BJ5C 2A68F 3CZ6A 2DI3A 2VKDA 1UCRA 4WXDA 4M9XA 4YRVA 4S04A 2DT7B 4MFEA 3LOCA 2XB0X 4DZJA 1OCOH 1VQ4I 2VOOA 2L9VA 2A61A 2YPRA 3KZYA 4AYBN 4BXXJ 1OISA 4HF1A 1TZLA 3HB9A 3DTIA 1FJLA 1OCCH 1YS7A 2L4AA 3HSEA 3MWMA 4BXFA 3LSRA 1IDYA 5FKKA 1XDUA 5LGNA 2XUBA 3JRIA 1QVTA 3ZMSA 2LP0A 2EK5A 3OOPA 2HVQA 3DWLE 2O7OA 4HDVA 2XB5A 3LSKA 4RBOA 5CVRA 1BL0A 4CCLA 3HHHA 5IYBJ 1AU7A 1KU2A 1HBXG 2MLGA 2BY2A 2CSOA 1VTNC 3C2HA 2KT0A 1A5JA 2H27A 3H3UA 1HA8A 2BY3A 1LJ9A 4PZJA 1X58A 2Y0SA 9ANTA 3V7SA 2VIXA 2IS2A 3GFJA 2XKOA 5F0FA 1WCMJ 2TDXA 2CMPA 1ZG1A 3OYLA 3CJRB 2CUJA 2ZSHB 3E5UA 3HC7A 4M3GA 5EEGA 3SEQA 2MFZA 2XRLA 4A3IJ 3P9CA 3DLAA 4I09A 3K4MA 3TOBA 1EKEA 5JVGF 2PMZN 3FX3A 1UG0A 1FBSA 3VWBA
chains in the Genus database with same CATH topology
3BTCA 1WPKA 2JA5J 4FE7A 4JYKA 1ZQ3P 5DS9A 3BR3A 3GTGJ 2XPWA 4BBRJ 4QIWN 4AC0A 1RKWA 2L7MP 1Y1WJ 2HXIA 3HEFA 2E2JJ 3BR1A 2NVQJ 3TW6A 5EDNA 2AHQA 2NVXJ 1TWCJ 1GV5A 1X2NA 3MVPA 1Z0XA 5M3MJ 1VF9A 3GTOJ 2EZKA 5FKMA 2IBDA 4XRMA 3G1MA 3ZQIA 2HQ5A 4MFDA 2DJNA 1BJZA 2FD5A 3JRGA 3HBLA 5M5WJ 5J1RA 3HGYA 4BY1J 1APLC 3JRDA 2M2EA 2O8KA 1ENHA 2MSYA 3OOUA 1GVDA 2LR8A 3BG9A 1IJWC 4A3JJ 1W0UA 1JKPC 2JA7J 1VFCA 5HODA 3K7AJ 3TP3A 4B3AA 1K61A 3A01B 2XGDA 3W6VA 1QVUA 2HI3A 2WAQN 5F0CA 1P7JA 5IOZA 3Q0VA 2LY9A 1CQTA 1W0TA 2ID3A 4IEJA 5C3EJ 3GTKJ 2CQXA 5FKLA 3SDGA 2JJ7A 3I4NJ 1XS9A 3JRFA 1JKOC 3TEDA 5C4XJ 3H3VK 4DYCA 3BG3A 2AO9A 1P7IA 3RKQA 2R92J 1D5YA 4BY7J 5EF6A 2DA7A 4FISA 4UUTA 1BA5A 4C3IJ 1JGGA 2HDDA 3HOUJ 3HOWJ 4GFBA 1HCRA 2L7FP 5EGOB 1BW5A 1B8IA 1GT0C 3B6AA 5F0HA 3ZQGA 3RZOJ 3A01A 4JX6A 4M3DA 1XC5A 4J19A 4G12A 2DMUA 1RKTA 4A3KJ 1OFCX 3LSGA 3LSJA 1IC8A 4M6VA 3RZDJ 5FJ8J 1ETOA 1JT0A 2EQRA 1UG2A 1WH7A 1A6IA 4A3GJ 1QRYA 4HNVA 5K7ZA 3BR5A 1G2HA 2DA3A 2NS8A 3IH2A 3Q3SA 4W1UA 3UKGA 5F27A 4LOCA 4C3JJ 2JN6A 2R0QC 3GTLJ 3S17J 3TW7A 1I3QJ 3S15J 5IP9J 1MH3A 1OJLA 3G1LA 3MN2A 5F08A 3ZQLA 1S7EA 4FTHA 2M9HA 2Y2ZA 1MBGA 2X48A 1FTZA 1F43A 1TWFJ 1JUSA 5EG0B 3SJMA 1Y1VJ 1SANA 2LVSA 4MLOA 2NS7A 5M5YJ 2HOAA 5EGOA 2XPUA 1ETWA 4IHYA 1POGA 4UUSB 4JP0A 1ETYA 2WV1A 2NVTJ 1WH5A 2R93J 4NDLA 2JK3A 3FKIJ 5FLVA 1K83J 2ID6A 2DMPA 3WHBA 4IHXA 4QSHA 3IV5A 1NK2P 1IUFA 3M3YJ 2D5VA 3A02A 4RDUA 4CYCB 1LFUP 1DU0A 1MSEC 1VI0A 2DMNA 1ITYA 2EH3A 3RQIA 4A69C 4X1EA 1YRNB 2OF7A 3FK7A 1HDPA 1MBJA 2E19A 1R9TJ 2ECBA 1RR7A 1MH4A 5J3LA 2VPRA 1ETVA 3BTLA 1JKRC 3HOZJ 2CRGA 5EG0A 1Q1VA 5BNGA 1IG7A 3GTPJ 3HOYJ 1B8IB 3M4OJ 1QPIA 4A3FJ 2XSDC 5IP7J 1T56A 4UUSA 2COBA 2W48A 1FIAA 2Y9YA 2DA1A 3QPLA 2NVYJ 2VUMJ 4X6AJ 3OSGA 1FTTA 4AUXA 5E3MA 3B6CA 2XPVA 2ECCA 2R5ZB 3A03A 3BR0A 2LD5A 1JUPA 1UHSA 2YU9J 4CYCA 3JRHA 2HYJA 2E1OA 2HXOA 2TCTA 5M5XJ 3LNQA 1ZR2A 4D5CA 3HKZN 1HDDC 5F1JA 1ETQA 4I6ZA 1ETKA 1YRNA 4EEFG 1B72B 2LLKA 2EZHA 2FJ1A 4FCYA 4C3HJ 3D1NI 3GBGA 2EZLA 3F0CA 1WGXA 3OSFA 2B63J 3S1QJ 1FIPA 1JUMA 3S1NJ 1ETXA 2L0KA 4D5FA 3BR2A 2YUSA 5FLMJ 2EZIA 2L9RA 4M3BA 2GLOA 1F36A 2CJJA 2LKXA 4S0HB 3JRAA 1FEXA 1O4XA 5EYRA 1T33A 4IHVA 3FISA 2CUEA 1MBKA 5M3FJ 1JJ6C 2JWTA 5J1UA 2G0EA 1MNMC 2MG4A 3E7LA 1ZGWA 2ME0A 1ZR4A 1LE8B 2R5ZA 4JX5A 1JT6A 4I76A 3ZOBA 1H88C 2HOSA 5IOYA 5IYDJ 1DU6A 5EZGA 3QPSA 4XRSG 2DMTA 4V2GA 2I10A 3BTJA 4A3DJ 3S2DJ 2MGQA 1B72A 2CUFA 1ZKGA 2MW8A 2Y31A 1IGNA 3BR6A 4B4CA 2DA5A 5JLWA 3Q0WA 4A3LJ 4M3FA 3TP0A 3HOXJ 5FKOA 4XIDA 2DA4A 1JKQC 4XICA 1TWGJ 1VNDA 3HOVJ 1TWHJ 2WB1N 3CDLA 3NARA 5DTDA 3OIOA 2LFBA 2K9SA 3HDDA 4L5EA 5F04A 3S14J 2ZB9A 4DW6A 3I4MJ 2RAEA 2H8RA 2CU7A 2K9NA 3JREA 4A93J 3PO2J 1LE8A 2R5YB 4FE4A 3CCYA 3JRBA 1U78A 3HM5A 1U9NA 2Y30A 2L7ZA 4MO7A 1PUFB 1TWAJ 3PO3J 3GTQJ 2EBIA 1Z77A 2JA8J 4A3BJ 5GPCA 3O8GA 3S1RJ 2N8GA 3VPRA 4A3MJ 2CQQA 3WHCA 4A3EJ 1IRZA 1GV2A 1MBEA 3FIWA 1NTCA 3C2BA 2K9QA 2OPTA 1U9OA 2O9LA 3NAUA 4DYRA 5C4JJ 2GM4A 5EZHA 2E2IJ 1IDZA 2DA6A 3S1MJ 2NOGA 3LSPA 1BW6A 3H0GJ 4V2FA 1OCTC 2Y0SN 2M0CA 2VI6A 1RESA 2QCOA 2JA6J 3IH3A 3HGGA 1I50J 2XGCA 4W97A 2XGEA 1HF0A 2R5YA 1X2MA 2Y9ZA 5E3OA 1LFBA 1H89C 4Y52J 2LTPA 1EF4A 5GP9A 1PUFA 2X9DA 4DYQA 1AKHB 2JMWA 3BTIA 3Q0UA 2X6OA 3QQAA 2QF7A 2P81A 3ZQFA 1GUUA 2K40A 3IH4A 3K2AA 4ABZA 2ELKA 5J1YA 2YS9A 5GPAA 3G1OA 3CQZJ 4A3CJ 1H8AC 5E3LA 2KDZA 2FQ4A 2R7ZJ 4BBSJ 2IEKA 3JR9A 4MIMA 3JRCA 4IHWA 4MFEA 4BKXA 3LOCA 2XB0X 4DZJA 5EEAA 1MBHA 2DN0A 4Y7NJ 1MSFC 3S2HJ 5IPAA 1I6HJ 5JLXA 4M3EA 4AYBN 4JX4A 1SFOJ 2VKVA 4BXXJ 3GTMJ 4B1RA 3DCFA 5IP6A 3HB9A 1FJLA 4D7NA 4XK4A 1TC3C 3LSRA 1HLVA 3O8HA 1IDYA 5FKKA 3JRIA 2VKEA 4D7MA 1QVTA 2LK2A 1ZTRA 5K7HA 2LP0A 1AHDP 2H1KA 3GTJJ 2M34A 1AKHA 2O7OA 1UMQA 2E2HJ 2XB5A 4RBOA 2DMQA 1WI3A 3ZQCA 3FK6A 5K7FA 1BL0A 1RPWA 5IYBJ 1AU7A 3PM1A 3BG5A 3ZQHA 4DZPA 1U8BA 1XG1A 1JTXA 1NK3P 2TRTA 2KT0A 5C44J 1A5JA 4XRSA 5E3NA 1GDTA 2HOTA 2FX0A 1OCPA 1RETA 3DEWA 1JTYA 1X58A 9ANTA 1ZK8A 5IYCJ 1IV6A 5F0FA 1WCMJ 2DTZA 1ORKA 4QTRA 3MKLA 5FKNA 3SFIA 4M3GA 2ME6A 3BQYA 2DA2A 1JJ8C 2XRLA 1MBFA 4A3IJ 2GBYA 4C2MJ 3BQZA 3CMYA 1HOMA 3BT9A 3S16J 2M8GX 2PMZN 3L1PA 2IAIA 1E3OC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BTC A;  1WPK A;  2JA5 J;  4FE7 A;  4JYK A;  1ZQ3 P;  5DS9 A;  3BR3 A;  3GTG J;  2XPW A;  4BBR J;  4QIW N;  4AC0 A;  1RKW A;  2L7M P;  1Y1W J;  2HXI A;  3HEF A;  2E2J J;  3BR1 A;  2NVQ J;  3TW6 A;  5EDN A;  2AHQ A;  2NVX J;  1TWC J;  1GV5 A;  1X2N A;  3MVP A;  1Z0X A;  5M3M J;  1VF9 A;  3GTO J;  2EZK A;  5FKM A;  2IBD A;  4XRM A;  3G1M A;  3ZQI A;  2HQ5 A;  4MFD A;  2DJN A;  1BJZ A;  2FD5 A;  3JRG A;  3HBL A;  5M5W J;  5J1R A;  3HGY A;  4BY1 J;  1APL C;  3JRD A;  2M2E A;  2O8K A;  1ENH A;  2MSY A;  3OOU A;  1GVD A;  2LR8 A;  3BG9 A;  1IJW C;  4A3J J;  1W0U A;  1JKP C;  2JA7 J;  1VFC A;  5HOD A;  3K7A J;  3TP3 A;  4B3A A;  1K61 A;  3A01 B;  2XGD A;  3W6V A;  1QVU A;  2HI3 A;  2WAQ N;  5F0C A;  1P7J A;  5IOZ A;  3Q0V A;  2LY9 A;  1CQT A;  1W0T A;  2ID3 A;  4IEJ A;  5C3E J;  3GTK J;  2CQX A;  5FKL A;  3SDG A;  2JJ7 A;  3I4N J;  1XS9 A;  3JRF A;  1JKO C;  3TED A;  5C4X J;  3H3V K;  4DYC A;  3BG3 A;  2AO9 A;  1P7I A;  3RKQ A;  2R92 J;  1D5Y A;  4BY7 J;  5EF6 A;  2DA7 A;  4FIS A;  4UUT A;  1BA5 A;  4C3I J;  1JGG A;  2HDD A;  3HOU J;  3HOW J;  4GFB A;  1HCR A;  2L7F P;  5EGO B;  1BW5 A;  1B8I A;  1GT0 C;  3B6A A;  5F0H A;  3ZQG A;  3RZO J;  3A01 A;  4JX6 A;  4M3D A;  1XC5 A;  4J19 A;  4G12 A;  2DMU A;  1RKT A;  4A3K J;  1OFC X;  3LSG A;  3LSJ A;  1IC8 A;  4M6V A;  3RZD J;  5FJ8 J;  1ETO A;  1JT0 A;  2EQR A;  1UG2 A;  1WH7 A;  1A6I A;  4A3G J;  1QRY A;  4HNV A;  5K7Z A;  3BR5 A;  1G2H A;  2DA3 A;  2NS8 A;  3IH2 A;  3Q3S A;  4W1U A;  3UKG A;  5F27 A;  4LOC A;  4C3J J;  2JN6 A;  2R0Q C;  3GTL J;  3S17 J;  3TW7 A;  1I3Q J;  3S15 J;  5IP9 J;  1MH3 A;  1OJL A;  3G1L A;  3MN2 A;  5F08 A;  3ZQL A;  1S7E A;  4FTH A;  2M9H A;  2Y2Z A;  1MBG A;  2X48 A;  1FTZ A;  1F43 A;  1TWF J;  1JUS A;  5EG0 B;  3SJM A;  1Y1V J;  1SAN A;  2LVS A;  4MLO A;  2NS7 A;  5M5Y J;  2HOA A;  5EGO A;  2XPU A;  1ETW A;  4IHY A;  1POG A;  4UUS B;  4JP0 A;  1ETY A;  2WV1 A;  2NVT J;  1WH5 A;  2R93 J;  4NDL A;  2JK3 A;  3FKI J;  5FLV A;  1K83 J;  2ID6 A;  2DMP A;  3WHB A;  4IHX A;  4QSH A;  3IV5 A;  1NK2 P;  1IUF A;  3M3Y J;  2D5V A;  3A02 A;  4RDU A;  4CYC B;  1LFU P;  1DU0 A;  1MSE C;  1VI0 A;  2DMN A;  1ITY A;  2EH3 A;  3RQI A;  4A69 C;  4X1E A;  1YRN B;  2OF7 A;  3FK7 A;  1HDP A;  1MBJ A;  2E19 A;  1R9T J;  2ECB A;  1RR7 A;  1MH4 A;  5J3L A;  2VPR A;  1ETV A;  3BTL A;  1JKR C;  3HOZ J;  2CRG A;  5EG0 A;  1Q1V A;  5BNG A;  1IG7 A;  3GTP J;  3HOY J;  1B8I B;  3M4O J;  1QPI A;  4A3F J;  2XSD C;  5IP7 J;  1T56 A;  4UUS A;  2COB A;  2W48 A;  1FIA A;  2Y9Y A;  2DA1 A;  3QPL A;  2NVY J;  2VUM J;  4X6A J;  3OSG A;  1FTT A;  4AUX A;  5E3M A;  3B6C A;  2XPV A;  2ECC A;  2R5Z B;  3A03 A;  3BR0 A;  2LD5 A;  1JUP A;  1UHS A;  2YU9 J;  4CYC A;  3JRH A;  2HYJ A;  2E1O A;  2HXO A;  2TCT A;  5M5X J;  3LNQ A;  1ZR2 A;  4D5C A;  3HKZ N;  1HDD C;  5F1J A;  1ETQ A;  4I6Z A;  1ETK A;  1YRN A;  4EEF G;  1B72 B;  2LLK A;  2EZH A;  2FJ1 A;  4FCY A;  4C3H J;  3D1N I;  3GBG A;  2EZL A;  3F0C A;  1WGX A;  3OSF A;  2B63 J;  3S1Q J;  1FIP A;  1JUM A;  3S1N J;  1ETX A;  2L0K A;  4D5F A;  3BR2 A;  2YUS A;  5FLM J;  2EZI A;  2L9R A;  4M3B A;  2GLO A;  1F36 A;  2CJJ A;  2LKX A;  4S0H B;  3JRA A;  1FEX A;  1O4X A;  5EYR A;  1T33 A;  4IHV A;  3FIS A;  2CUE A;  1MBK A;  5M3F J;  1JJ6 C;  2JWT A;  5J1U A;  2G0E A;  1MNM C;  2MG4 A;  3E7L A;  1ZGW A;  2ME0 A;  1ZR4 A;  1LE8 B;  2R5Z A;  4JX5 A;  1JT6 A;  4I76 A;  3ZOB A;  1H88 C;  2HOS A;  5IOY A;  5IYD J;  1DU6 A;  5EZG A;  3QPS A;  4XRS G;  2DMT A;  4V2G A;  2I10 A;  3BTJ A;  4A3D J;  3S2D J;  2MGQ A;  1B72 A;  2CUF A;  1ZKG A;  2MW8 A;  2Y31 A;  1IGN A;  3BR6 A;  4B4C A;  2DA5 A;  5JLW A;  3Q0W A;  4A3L J;  4M3F A;  3TP0 A;  3HOX J;  5FKO A;  4XID A;  2DA4 A;  1JKQ C;  4XIC A;  1TWG J;  1VND A;  3HOV J;  1TWH J;  2WB1 N;  3CDL A;  3NAR A;  5DTD A;  3OIO A;  2LFB A;  2K9S A;  3HDD A;  4L5E A;  5F04 A;  3S14 J;  2ZB9 A;  4DW6 A;  3I4M J;  2RAE A;  2H8R A;  2CU7 A;  2K9N A;  3JRE A;  4A93 J;  3PO2 J;  1LE8 A;  2R5Y B;  4FE4 A;  3CCY A;  3JRB A;  1U78 A;  3HM5 A;  1U9N A;  2Y30 A;  2L7Z A;  4MO7 A;  1PUF B;  1TWA J;  3PO3 J;  3GTQ J;  2EBI A;  1Z77 A;  2JA8 J;  4A3B J;  5GPC A;  3O8G A;  3S1R J;  2N8G A;  3VPR A;  4A3M J;  2CQQ A;  3WHC A;  4A3E J;  1IRZ A;  1GV2 A;  1MBE A;  3FIW A;  1NTC A;  3C2B A;  2K9Q A;  2OPT A;  1U9O A;  2O9L A;  3NAU A;  4DYR A;  5C4J J;  2GM4 A;  5EZH A;  2E2I J;  1IDZ A;  2DA6 A;  3S1M J;  2NOG A;  3LSP A;  1BW6 A;  3H0G J;  4V2F A;  1OCT C;  2Y0S N;  2M0C A;  2VI6 A;  1RES A;  2QCO A;  2JA6 J;  3IH3 A;  3HGG A;  1I50 J;  2XGC A;  4W97 A;  2XGE A;  1HF0 A;  2R5Y A;  1X2M A;  2Y9Z A;  5E3O A;  1LFB A;  1H89 C;  4Y52 J;  2LTP A;  1EF4 A;  5GP9 A;  1PUF A;  2X9D A;  4DYQ A;  1AKH B;  2JMW A;  3BTI A;  3Q0U A;  2X6O A;  3QQA A;  2QF7 A;  2P81 A;  3ZQF A;  1GUU A;  2K40 A;  3IH4 A;  3K2A A;  4ABZ A;  2ELK A;  5J1Y A;  2YS9 A;  5GPA A;  3G1O A;  3CQZ J;  4A3C J;  1H8A C;  5E3L A;  2KDZ A;  2FQ4 A;  2R7Z J;  4BBS J;  2IEK A;  3JR9 A;  4MIM A;  3JRC A;  4IHW A;  4MFE A;  4BKX A;  3LOC A;  2XB0 X;  4DZJ A;  5EEA A;  1MBH A;  2DN0 A;  4Y7N J;  1MSF C;  3S2H J;  5IPA A;  1I6H J;  5JLX A;  4M3E A;  4AYB N;  4JX4 A;  1SFO J;  2VKV A;  4BXX J;  3GTM J;  4B1R A;  3DCF A;  5IP6 A;  3HB9 A;  1FJL A;  4D7N A;  4XK4 A;  1TC3 C;  3LSR A;  1HLV A;  3O8H A;  1IDY A;  5FKK A;  3JRI A;  2VKE A;  4D7M A;  1QVT A;  2LK2 A;  1ZTR A;  5K7H A;  2LP0 A;  1AHD P;  2H1K A;  3GTJ J;  2M34 A;  1AKH A;  2O7O A;  1UMQ A;  2E2H J;  2XB5 A;  4RBO A;  2DMQ A;  1WI3 A;  3ZQC A;  3FK6 A;  5K7F A;  1BL0 A;  1RPW A;  5IYB J;  1AU7 A;  3PM1 A;  3BG5 A;  3ZQH A;  4DZP A;  1U8B A;  1XG1 A;  1JTX A;  1NK3 P;  2TRT A;  2KT0 A;  5C44 J;  1A5J A;  4XRS A;  5E3N A;  1GDT A;  2HOT A;  2FX0 A;  1OCP A;  1RET A;  3DEW A;  1JTY A;  1X58 A;  9ANT A;  1ZK8 A;  5IYC J;  1IV6 A;  5F0F A;  1WCM J;  2DTZ A;  1ORK A;  4QTR A;  3MKL A;  5FKN A;  3SFI A;  4M3G A;  2ME6 A;  3BQY A;  2DA2 A;  1JJ8 C;  2XRL A;  1MBF A;  4A3I J;  2GBY A;  4C2M J;  3BQZ A;  3CMY A;  1HOM A;  3BT9 A;  3S16 J;  2M8G X;  2PMZ N;  3L1P A;  2IAI A;  1E3O C; 
#chains in the Genus database with same CATH topology
 4E7K A;  2JA5 J;  2LF8 A;  3IKT A;  4JYK A;  1IO2 A;  2Q2E B;  3BR3 A;  3SQN A;  3HSR A;  3M7G A;  4BBR J;  4E6K G;  4QIW N;  4ZYG A;  1ONV A;  1Y1W J;  4XOP A;  4PGH A;  2L5Q A;  2VBZ A;  4D0P A;  1WWX A;  3MD2 A;  5EDN A;  2AHQ A;  4RB2 C;  1TWC J;  1GV5 A;  1W7P A;  5M3M J;  2XIG A;  1XCB A;  4HLY A;  1HXD A;  2HQ5 A;  2DJN A;  4XN3 A;  3T8R A;  3FKJ A;  5KAI C;  3JRG A;  4NNJ A;  5BS6 A;  4IOC F;  3HUG B;  2D2W A;  1ZHF A;  2H6C A;  2QQ9 A;  3FXU A;  3W3C A;  5GAD J;  3FWE A;  1XX5 A;  3IWZ A;  5K5O A;  2L54 A;  1ZRC A;  1ENH A;  2PG4 A;  2YU3 A;  3N05 A;  3MKY B;  3GZN B;  2ZME C;  2EIK H;  1GVD A;  1FC3 A;  3KFW X;  5FO5 A;  2CH0 A;  4A3J J;  2R7X A;  1W0U A;  1X3Z B;  1VFC A;  4KT6 A;  5HOD A;  1E17 A;  4CZZ A;  4UB8 C;  2JVG A;  3GFL A;  2JUC A;  4E7I A;  2L2O A;  4YEL A;  3FM5 A;  4ZH4 F;  3MZ8 A;  1I27 A;  2VAS A;  2KIS A;  5ED4 A;  3FXQ A;  5IOZ A;  4YFK F;  2LY9 A;  2R7O A;  3AL0 B;  2KIU A;  1K78 A;  2GZW A;  2XAG A;  2E1M B;  1R23 A;  2W84 A;  4OU0 A;  5FKL A;  3SDG A;  4Y3O A;  3TED A;  5C4X J;  3DF8 A;  2R92 J;  3K4N A;  1RUN A;  3OYE A;  2BV6 A;  1FMV A;  3TBI A;  4P1W A;  3CCJ I;  1S3J A;  2IXS A;  4ITV A;  4NQW B;  1J75 A;  1KA8 A;  2G9W A;  2R7S A;  1O3Q A;  2KIF A;  1IRX A;  2MA3 A;  2HDW A;  1JGG A;  2HDD A;  4ZYA A;  5IY5 H;  1X19 A;  1FSH A;  3HOW J;  1ZEL A;  2DOF A;  2OQR A;  5EGO B;  1W7P D;  2VN2 A;  3B6A A;  5IT9 K;  2XRO A;  2A5W A;  2Y69 H;  4MQV A;  4FQG A;  3A01 A;  1XGN A;  2X6W A;  2ZFU A;  3W6K B;  4F7Z A;  1RKT A;  4M73 A;  3I59 B;  3V8J A;  1OFC X;  2ZME A;  3LSJ A;  1G3Y A;  2LF7 A;  4Y33 A;  4PFP A;  1JT0 A;  2EQR A;  5CJ9 A;  2X1E A;  2GOM A;  4N9I A;  3BR5 A;  2WY8 Q;  1G2H A;  2DA3 A;  2OQG A;  1U2W A;  1YTY A;  4B44 A;  4A5N A;  4LOC A;  5J47 A;  3OYI A;  3H0D A;  3ZMT A;  2P7V B;  1I3Q J;  5IP9 J;  3ZXS A;  3G1L A;  4HF2 A;  2PN6 A;  4KNY A;  2V1D A;  2F5V A;  2L01 A;  2GOX B;  1SFU A;  3OYG A;  3VSL A;  3QAH A;  1SAN A;  1OKR A;  2NS7 A;  1KYW A;  4XMY A;  2XPU A;  3K4B A;  2EA4 A;  3RYR A;  1POG A;  4UUS B;  1Z3X A;  1UFM A;  4F92 B;  3TO7 A;  2VQG A;  2AQE A;  3V8L A;  2WC2 A;  4XM3 A;  2VJI A;  3CMA I;  3KZZ A;  1WI9 A;  2NVT J;  2MH9 A;  1IXC A;  1BOB A;  4P5O A;  1MND A;  2DMP A;  2Z99 A;  4ENK A;  1BBY A;  5FLX Z;  2DT5 A;  1YYV A;  4HLX A;  3A02 A;  3JTG A;  5B1B H;  1LNW A;  3BJO A;  2DMN A;  2E71 A;  4NC7 A;  2LBF B;  2EH3 A;  3OYK A;  2UZK A;  1YRN B;  3FK7 A;  3VYR B;  1MBJ A;  2DK8 A;  1X1P A;  2V9V A;  2GAU A;  1CGP A;  2QSH X;  4U7D A;  2Z33 A;  1V4R A;  2VPR A;  3I64 A;  1TLH B;  3H35 A;  1ETV A;  3BTL A;  3CUO A;  4HNU A;  2W4S A;  2CRG A;  5D4S A;  2Z5U A;  3G2B A;  3OWT A;  3L2W A;  1Q1V A;  5BNG A;  4FHT A;  1MMN A;  3BZ6 A;  3CCQ I;  4J01 A;  3GTP J;  4WXH A;  3BPV A;  1TTY A;  3R6S A;  4A3F J;  2GA2 A;  2BW3 B;  1TW2 A;  5BMZ A;  3OMY A;  4AIH A;  2W48 A;  1X1B A;  1A35 A;  2V7F A;  3BY6 A;  5CVI A;  2ZXH A;  5DD4 A;  3HIF A;  5E3M A;  2EFQ A;  2XPV A;  2CUZ A;  5CKT A;  1LPQ A;  5DUK A;  3VDX A;  4I99 C;  4C2T A;  1VQM I;  1JUP A;  1XGO A;  1XMK A;  4KIS A;  2VON A;  4DNC A;  1ZR2 A;  4Y13 A;  1BOA A;  4PDK A;  1MGT A;  1ETQ A;  2HR3 A;  2VE8 A;  2PMU A;  4GO1 A;  5HNH A;  4EEF G;  4L5I A;  1R5H A;  2DO7 A;  4E7J A;  4I02 A;  2KPM A;  1MMG A;  4XOT A;  5D6E A;  1YIJ I;  2V6C A;  4KIC A;  2HTS A;  3R0J A;  2GXB A;  2IRF G;  1A36 A;  1OQY A;  2YUS A;  5CLS A;  1AWC A;  5FLM J;  2MH2 A;  1P4X A;  2F4M B;  3KX2 A;  3A4C A;  3JW4 A;  2R7T A;  2QEN A;  2X1C A;  4CZC A;  1VQK I;  5ILV A;  3E3V A;  1T33 A;  4EV0 A;  4IHV A;  3FIS A;  2CO5 A;  4BDZ A;  3O6B B;  1AA7 A;  4CSW A;  2JZY A;  4RA2 A;  2G0E A;  4QPO A;  3KLN A;  1K6O A;  1ZGW A;  4KUM A;  3CCR I;  2HWV A;  1RZ4 A;  1LE8 B;  2FRH A;  2OCE A;  3QU6 A;  3WOD F;  3DP7 A;  3MEX A;  4FT8 A;  3ABT A;  1A31 A;  2Y48 A;  1U5T B;  3QPS A;  4FAS D;  3B73 A;  2LMD A;  3BTJ A;  3OYC A;  2OCC H;  2UV1 A;  2KRF A;  1A6Q A;  1FLI A;  4F52 A;  4XKW A;  5TJJ A;  1R1T A;  1IGN A;  3LFK A;  2PQ8 A;  1Z6T A;  3WTZ A;  5FKO A;  1QHH D;  1UEL B;  2K85 A;  2KZG A;  2DA4 A;  3A0B C;  4XLA A;  3KP7 A;  2ZNY A;  4XIC A;  2DXI A;  2FOK A;  3HOV J;  3CDL A;  3M8E A;  2D1V A;  2XAH A;  1H9G A;  3MZH A;  1IW7 F;  5HS7 A;  1V5G A;  3IRQ A;  1OCZ H;  3HDD A;  4GXO A;  2JT1 A;  4PJ0 C;  2IJL A;  3F22 A;  4G7O F;  3I4M J;  3DTK A;  4EVI A;  2H8R A;  2K9N A;  3TQN A;  3JRE A;  4L9T A;  3DKW A;  3CJT B;  5JHU A;  2V4J C;  4FE4 A;  4HYE A;  1U9N A;  1YE9 A;  3EPZ A;  1YX3 A;  4Z6Y A;  1EA3 A;  4EJW A;  1BM9 A;  4MEY F;  1UST A;  1MW7 A;  2F4O B;  2M0M A;  3PO3 J;  4OIN F;  2E7X A;  2M45 A;  2PMH A;  2DT6 A;  2EFW A;  2HPM A;  4M6Y A;  2JA8 J;  4HW0 A;  5FD6 A;  2BYV E;  4XQF A;  4JBA A;  3TMO A;  2E5N A;  3WTT C;  5E1X A;  3WHC A;  3LSH A;  4N4N B;  3R60 A;  1D0X A;  2R7V A;  3V42 A;  2K9Q A;  1N75 A;  3Q5F A;  1QZY A;  3SHF A;  1I5Z A;  2JPB A;  2M87 A;  2OV7 A;  3Q9V A;  4HPQ A;  3IL2 A;  2JSP A;  3S3N A;  3TDU C;  2GM4 A;  2E2I J;  3ERE D;  1DP3 A;  3S1M J;  1WSU A;  3FMR A;  4L0Z B;  3I58 A;  1DUX C;  4PJL A;  3R4K A;  2VI6 A;  1ZGJ A;  3REO A;  2JA6 J;  2XV4 S;  3ZMU A;  3OYJ A;  4BE0 A;  2CV0 A;  5KK1 A;  3CC4 I;  1IZ1 A;  1FBU A;  5ICG A;  3CDH A;  3LQR A;  4WF2 A;  1SVM A;  4MTE A;  1AOY A;  2JMW A;  4EJO A;  4NHJ A;  2X6O A;  2QF7 A;  4U0V A;  3OR1 C;  1X1C A;  4B09 A;  3JSO A;  3E6B A;  4CYD A;  3TOA A;  1E3P A;  3IH4 A;  3OYA A;  3I71 A;  3WE3 A;  3QRF F;  5J1Y A;  4RMN A;  3F6O A;  3F8M A;  4B3X A;  3LSM A;  3DKX A;  5E3L A;  1D1C A;  2DFI A;  2YX7 A;  3T8T A;  4WCG A;  2VBX A;  4MIM A;  2K3F A;  2KQR A;  4E7L A;  3FHN A;  1ZYR F;  4AD9 A;  2DYS H;  2GIV A;  4OIR F;  5EEA A;  3MKZ A;  3RYP A;  4PGG A;  3V4G A;  4BQO A;  3CCE I;  1USS A;  4Y7N J;  1YHQ I;  5IPA A;  1XSX A;  1SFO J;  2VJ5 A;  2VKV A;  4IHT A;  4UV8 A;  4AIK A;  3DCF A;  1JGS A;  3K1P A;  1S9H A;  2X1D A;  4XLE A;  3O8H A;  4LLL A;  4D7M A;  1ZTR A;  5K7H A;  4HBL A;  4CCO A;  1AHD P;  1MMA A;  2K7L A;  2M34 A;  4KJZ A;  1AKH A;  2MD0 A;  5B5E C;  2E2H J;  3JAM Z;  2WAE A;  3ZMD A;  3K4J A;  1WI3 A;  2FEZ A;  3LQQ A;  3ZQC A;  3FK6 A;  3QYB A;  1MJA A;  1KQ0 A;  3N97 A;  4V19 K;  4DZP A;  2O03 A;  1XG1 A;  2HNH A;  4S05 A;  1NK3 P;  2TRT A;  2Z1D A;  5FRM A;  1HST A;  2ESN A;  4XRS A;  1UHM A;  2RN7 A;  1PJR A;  1GXQ A;  1JHF A;  2XVC A;  1FP1 D;  3PNT A;  4KIF A;  2X0L A;  2V6E A;  5LHG A;  5D5U B;  2WTE A;  2Q8K A;  1ZK8 A;  5IYC J;  4II3 A;  1IV6 A;  5FFX A;  2E1N A;  1YG2 A;  4G8X A;  2VQH A;  4IRH A;  2DLL A;  2DW4 A;  1XTA A;  4RAG A;  5J8F A;  3CCL I;  1BC7 C;  2DA2 A;  1JJ8 C;  2RKH A;  1MBF A;  5D5W B;  4BQQ A;  2FQ3 A;  1STZ A;  4ZZD A;  2CG4 A;  4I98 B;  2BOL A;  1PDN C;  1FP2 A;  3A2K A;  3IAM 2;  3BRO A;  3CMM A;  3L1P A;  2X6Y A;  1WJC A;  2A3S A;  3VYT B;  1E3O C;  2W24 A;  2HVS A;  1Z05 A;  5HLH A;  1VQ6 I;  4B43 A;  3R61 A;  2HXI A;  2M8E A;  2OUM A;  3BR1 A;  3WTS C;  3U2R A;  3HG9 A;  3MVP A;  1Z0X A;  2ZJP F;  1VF9 A;  2M3A A;  2FF4 A;  1RNL A;  3ZQI A;  2ICW G;  4PJM A;  1N78 A;  2WWY A;  1YIT I;  2K27 A;  4DBR A;  1SD5 A;  3HBL A;  3CTA A;  1KU3 A;  1O7F A;  4BJT A;  2XGX A;  3HGY A;  3A0H C;  4L9N A;  3HPH A;  2L02 A;  4EJT A;  4PSW A;  2ZJQ F;  3LST A;  3K6G A;  5J40 A;  1ULY A;  3OOU A;  3RKW A;  3DLL F;  5HDG A;  2HQA A;  4AID A;  4AM3 A;  2Y0M A;  1JKP C;  3OYM A;  1FNN A;  3K7A J;  3AL0 C;  3TP3 A;  4BL0 B;  2E1M C;  2QEX I;  3AKZ A;  1WJF A;  4H4K C;  1YJN I;  2COM A;  2QQA A;  4MEX F;  1VQ9 I;  2IA2 A;  1WKM A;  2PX9 A;  2Q2E A;  4RLQ A;  1E2X A;  3KP2 A;  2VXZ A;  3EQL F;  3DPT A;  4UVB A;  3ECO A;  2P5K A;  5EEH A;  5F0C A;  3VSK A;  1KQ8 A;  3KET A;  4CDG A;  2EB7 A;  1Y0N A;  1P7J A;  2CQN A;  4WXC A;  1W0T A;  2ID3 A;  3M9A A;  4IEJ A;  4OWR B;  4YIR X;  3GTK J;  2CQX A;  1J5Y A;  2M5W A;  2BHZ A;  2K5C A;  3JRF A;  1JKO C;  1VZ0 A;  2HPI A;  3FMQ A;  3H3V K;  2IPQ X;  3BG3 A;  2AO9 A;  3HUG A;  3CUQ B;  4BY7 J;  3OYN A;  1J7K A;  2DA7 A;  2GA1 A;  4FIS A;  1DQU A;  3QOP A;  3AG2 H;  1WQ2 A;  4PJN A;  1F9N A;  3IP4 B;  4C3I J;  2PMZ A;  3QP6 A;  3DKY A;  3K9T A;  1ZRE A;  1X4O A;  3HOU J;  2DOD A;  4BAY A;  2LNB A;  1JI8 A;  3OYD A;  2NS0 A;  1Y56 A;  3Q9S A;  1ZLJ A;  1LEA A;  2BGC A;  1YS6 A;  4DOZ A;  5F1R A;  3QOD A;  3ZQG A;  4M3D A;  4G12 A;  2DMU A;  4YFX F;  2ZFW A;  4A3K J;  1WJ5 A;  1FYK A;  3J7A O;  1IN4 A;  3FF5 A;  3LSG A;  2XAF A;  3BWG A;  2MYS A;  5D5V B;  4M6V A;  2XC7 A;  3E6C C;  2P7C B;  2GIZ A;  5FJ8 J;  3ABK H;  1UG2 A;  1T8I A;  3K0L A;  1TQI A;  1A6I A;  3AG3 H;  1QRY A;  5LEK A;  5A2Q K;  1GHC A;  1SFK A;  1DGW Y;  3QPT A;  2ZXW H;  2F5C A;  4G6D A;  5F27 A;  3OS0 A;  1Z67 A;  4C3J J;  3CCS I;  2DFE A;  3TW7 A;  3S15 J;  1JXS A;  1LVK A;  1OYY A;  2HYF A;  2XAQ A;  3I54 A;  4GCV A;  4NQW A;  1ZGA A;  5CVU A;  1V5F A;  1JUS A;  1XGM A;  1Y1V J;  2L7K A;  5ILS A;  1SEU A;  1XGS A;  3GF2 A;  4Y4R A;  5EGO A;  3FBI B;  4YEJ A;  2E5Z A;  4E7H A;  5L3C A;  5FGM A;  4IHY A;  1R1U A;  3BOQ A;  2K4J A;  1QU3 A;  3ZCO A;  2WV1 A;  4LK1 F;  2OD5 A;  4XR6 A;  4F91 B;  3I59 A;  5FLV A;  5GAE J;  2ID6 A;  3WHB A;  3DPU A;  1QBJ A;  1XD7 A;  4IHX A;  4IHS A;  2IGO A;  5E8I A;  1NK2 P;  3HKZ A;  3M3Y J;  4O5V A;  4EJU A;  2I5U A;  2ISZ A;  3PFY A;  4CYC B;  1LFU P;  3CO6 C;  2LG4 A;  1K4T A;  2OJE D;  4XLH A;  1ITY A;  2XDV A;  3E6D A;  3FM3 A;  4GGG A;  1IRF A;  1Z7U A;  2DDB A;  2V9K A;  3FXK A;  1HDP A;  3VB2 A;  1YJW I;  3WTU C;  2OU2 A;  4B8X A;  1JE8 A;  2E34 A;  3WU0 A;  3EUA A;  4Q5S F;  1MH4 A;  2QBY B;  1T0F C;  3FDY A;  1LFP A;  4D1Q A;  2JPC A;  4BNC A;  3DBR B;  2EFP A;  3B02 A;  1WJA A;  4HQM A;  1IG7 A;  2M7A A;  3M4O J;  3RI4 A;  1S7A A;  2RNJ A;  2XSD C;  1ACI A;  4UUS A;  2Y9Y A;  3T0Y A;  2DA1 A;  3ZMZ A;  2NVY J;  2IT0 A;  2M7B A;  2CW8 A;  2IS1 A;  4X6A J;  1FTT A;  3OV8 A;  3VYS B;  4AUX A;  2HZT A;  4RM3 A;  1WHU A;  4LB5 A;  3BR0 A;  2LD5 A;  3QP5 A;  3K4C A;  1SVL A;  4HX8 A;  4UHT A;  1XMX A;  3VFZ A;  5M5X J;  2YU9 J;  1O3S A;  2LC2 A;  1R5G A;  3HKZ N;  2LBF A;  4XLP F;  3HL2 A;  1ETK A;  1YRN A;  2K02 A;  1PP8 F;  1XN7 A;  1O7L A;  3DU5 A;  1B72 B;  3O2P E;  4PCQ A;  4C3H J;  2DJI A;  2EZL A;  4EGZ A;  4IRG A;  1FIP A;  3S1N J;  3WE2 A;  5H6Q A;  1X3W B;  2KRH A;  3C2G A;  3JAM K;  3RCO A;  3SFZ A;  2W85 A;  3W2W A;  2IA1 A;  2EZI A;  2W1O A;  2LKX A;  1QZE A;  2BW3 A;  4S0H B;  5HS8 A;  4NC6 A;  4DQ2 A;  5BPI A;  4RGS A;  5EYR A;  1FEX A;  1VQP I;  2XSJ C;  2L9S A;  1T0F A;  4AU7 A;  1JJ6 C;  5K5Q A;  1SFE A;  3WTY C;  1MNM C;  3DTE A;  3KEO A;  5H20 A;  1LVA A;  1QNT A;  1WJD A;  3BDD A;  3FMS A;  4NC8 A;  5H6R A;  3HPG A;  1JT6 A;  5TIS C;  3ZOB A;  3RIR A;  1YIO A;  5B3S H;  2HOS A;  1U8R A;  1FZP B;  2VJJ A;  5HNF A;  4Y15 A;  5IOY A;  5IYD J;  3U9G A;  1YOV B;  5HS9 A;  2MC4 A;  5IT3 A;  4IOA F;  4XRS G;  5CYV A;  2P0W A;  3FBN B;  4R1H A;  2OTJ I;  2FUG 2;  4OMZ A;  4A3D J;  4ENN A;  3S2D J;  2IS4 A;  2MGQ A;  4CUG A;  2A6T A;  4G7Z F;  4KIB A;  4BU2 A;  5JLW A;  1KYZ A;  4BQN A;  3S3M A;  4OMY A;  4M3F A;  3TP0 A;  4XID A;  4HV6 A;  2CV1 A;  2JVH A;  1J2X A;  4A0X A;  4IO9 F;  1TL8 A;  1TWG J;  2WB1 N;  4BDY A;  2H09 A;  1X4P A;  3OL3 A;  4M9S A;  1J59 A;  3HJE A;  3W6J B;  4X0G A;  3J80 K;  2RQP A;  4G7H F;  2ZB9 A;  4LB6 B;  5FRN A;  2A69 F;  2H94 A;  3I9V 2;  2CU7 A;  4XSZ F;  1U0J A;  3E6M A;  3O3K A;  4A93 J;  2MD5 A;  3H9Q A;  5GAH J;  2R5Y B;  1LE8 A;  3CCY A;  3JRB A;  2PJR B;  2R7F A;  4EQQ A;  1KU9 A;  4MO7 A;  4CIC A;  4UY8 I;  1U5T A;  1Z77 A;  4Q47 A;  2LDU A;  2LY2 A;  2CS3 A;  3S1R J;  2NRA C;  2LRE A;  3HRU A;  4A3M J;  1GXP A;  2FNP A;  1IV8 A;  1MBE A;  3BJA A;  4B48 A;  4BS9 A;  3H9J A;  5E8G A;  4Y17 A;  5LHI A;  2X4H A;  1FYM A;  3W2V A;  1HKS A;  2O9L A;  4KIG A;  3KLO A;  2XHK A;  3G3Z A;  2DA6 A;  3E97 A;  2O8X A;  4G6T B;  1TQP A;  2NOG A;  3HYI A;  4Q48 A;  3H0G J;  4V2F A;  1R49 A;  2F5F A;  2CQK A;  1RES A;  4HOB A;  3IH3 A;  1RIO H;  1T38 A;  2V79 A;  3ABL H;  4W97 A;  2NAZ A;  3ZRG A;  2W25 A;  2X51 A;  3EUK L;  1VQL I;  3H9G A;  1YW8 A;  5E3O A;  1B59 A;  2QA4 I;  1LFB A;  4XKV A;  2QM3 A;  4ZC3 A;  4PJJ A;  3CLO A;  4HST A;  3T1B A;  2X9D A;  1MNE A;  5DM7 F;  3BTI A;  1RRJ A;  2P81 A;  1X1D A;  1GUU A;  1G8X A;  5AIQ A;  5J8C A;  2K40 A;  3ASO H;  1LEB A;  1HW2 A;  2Z9O A;  5FFZ A;  2STW A;  4F93 B;  4N9H A;  1N77 A;  1VQN I;  2FQ4 A;  2R7Z J;  1YO5 C;  4BBS J;  2IEK A;  3RSN A;  3JR9 A;  3MQ0 A;  3JRC A;  4IHW A;  4OIQ F;  4BKX A;  2CW0 F;  3P9K A;  3PNY A;  1Z3Y A;  2F5D A;  4F55 A;  2KHM A;  2DN0 A;  1S5L C;  1S72 I;  3S2H J;  4DIQ A;  2JUG A;  5JLX A;  4M3E A;  4JX4 A;  4I01 A;  1T39 A;  1K7A A;  1J09 A;  3W2A A;  3GTM J;  5IP6 A;  4XKB A;  3TGN A;  2E36 A;  3G73 A;  4XK4 A;  2D1H A;  3SZT A;  3HOT A;  2KJB A;  1D1A A;  2VKE A;  2LK2 A;  1HW5 A;  2H1K A;  3L2U A;  2PFB A;  3GTJ J;  1R71 A;  3KP3 A;  2YX4 A;  1FX7 A;  4NBQ A;  4IZZ A;  2R7Q A;  4OAZ A;  2FU4 A;  2MC3 A;  4XKC A;  5E1Z B;  5JI6 A;  5L3G A;  1P2F A;  1TT5 B;  4ZYE A;  1RPW A;  3SEZ A;  3PM1 A;  5HLG A;  1U8B A;  4GYG A;  3ZMV A;  2GQQ A;  2XRN A;  1NH3 A;  1JTX A;  1HQC A;  2RGV A;  3LMM A;  5E3N A;  1GDT A;  4JQF A;  2HOT A;  4M9Z A;  3ABM H;  1QGP A;  1RET A;  2VC0 A;  5LEJ A;  3DEW A;  4XL9 A;  2PEX A;  3F3X A;  1SD6 A;  3RJP A;  2DTZ A;  1W36 C;  4BH9 A;  1ORK A;  4FX0 A;  3F8B A;  4QTR A;  1ERD A;  4KMU X;  2F5E A;  2CFO A;  2HS5 A;  3SFI A;  5A2Q Z;  3BZC A;  2ME6 A;  2BHY A;  3BQY A;  3PSF A;  2E7W A;  2GBY A;  3BQZ A;  1ON1 A;  1FY7 A;  2BVM A;  2ADU A;  3BT9 A;  5KHD A;  3CMY A;  1HOM A;  3S16 J;  2A07 F;  3OS2 A;  3P9I A;  2KDO A;  2P8T A;  2KLO A;  3BG5 A;  3PNV A;  4FE7 A;  4OIP F;  2HOE A;  5DS9 A;  1ZQ3 P;  4GYI A;  2ZKZ A;  3OYB A;  3GTG J;  1KGS A;  3H1C A;  1OLT A;  4AC0 A;  2L7M P;  2IGK A;  3HEF A;  2E2J J;  2ACJ A;  1R36 A;  2NVQ J;  3TW6 A;  1QO0 D;  4A12 A;  2NVX J;  1X2N A;  4CCM A;  2EZK A;  4HSR A;  3GX4 X;  1IXR C;  4BEH B;  3G1M A;  1W1W E;  4JK1 X;  2LRD A;  1BJZ A;  2F2E A;  3J81 Z;  4WWC A;  4CO8 A;  2FBK A;  2OA4 A;  5M5W J;  3FZV A;  4KT5 C;  1P4A A;  1C0W A;  2KIQ A;  2VOD A;  2ZCW A;  2NXN B;  1APL C;  5K1Y A;  1SD4 A;  3VOD A;  3J7A Y;  4L0Y B;  3PQK A;  2MSY A;  5AON A;  4ESF A;  1OPC A;  1T2K A;  3I55 I;  1LQ1 A;  2LR8 A;  4ESB A;  1RI7 A;  3BG9 A;  1V54 H;  3GYH X;  1IJW C;  1FOX A;  3SZP A;  1MJ9 A;  2JA7 J;  2P5L C;  2BBY A;  4BJ6 C;  2VC1 A;  2JRT A;  2XGD A;  3FXM A;  3OY9 A;  2ISY A;  1BI2 A;  2QWW A;  1H0M A;  1QVU A;  2HI3 A;  3M1C A;  3WG9 A;  2WAQ N;  5B1A H;  5AIP A;  3NQO A;  1DP7 P;  1CQT A;  2BXZ A;  5C3E J;  3F72 A;  3PJR A;  4RB1 A;  3KYL A;  2JJ7 A;  4FET A;  5GTH C;  2CV2 A;  3I4N J;  3KZI C;  1IF1 A;  3PUB A;  2AXL A;  4RB3 C;  1M1E B;  1P7I A;  3RKQ A;  1HC8 A;  2DDA A;  5DDG A;  3CP8 A;  1ZLK A;  5EF6 A;  4UUT A;  2JA2 A;  3DPL C;  1YJ9 I;  1SAX A;  3DEU A;  1FOK A;  1BIB A;  3CJQ B;  2NNY A;  3TKY A;  3E5X A;  5LHH A;  1ZG5 A;  3RPU A;  3K1M A;  3KP6 A;  2HDC A;  2KRC A;  1B8I A;  3K2Z A;  1GT0 C;  1FWZ A;  4L9J A;  3ZR8 X;  2JRM A;  1LB2 A;  5L3E A;  1MDM B;  4JX6 A;  4J19 A;  4XLC A;  5LD2 C;  5CQE A;  2EFN A;  4ENJ A;  4U7B A;  1BIA A;  1GVJ A;  1D5V A;  1RR8 C;  1IC8 A;  4UNO A;  3IKV A;  1OMI A;  5D8L B;  2V1N A;  1EV7 A;  1DPR A;  4LG0 B;  1R00 A;  1WH7 A;  2QUF A;  4A3G J;  1O3T A;  3JTH A;  4HNV A;  2BE5 F;  2XAU A;  2EJR A;  1W5C C;  2UXN A;  4BHP A;  1R6R A;  1MZB A;  3LWF A;  3RKY A;  3IH2 A;  3Q3S A;  4W1U A;  1UAA A;  4LIT A;  4U0W A;  2R0Q C;  2MBF A;  2IS6 A;  3CUQ A;  4L5J A;  1W36 D;  2OBP A;  5D6F A;  1OJL A;  2HKO A;  1B9N A;  3MN2 A;  2AQF A;  5F08 A;  3ZQL A;  1S7E A;  1DPU A;  2LH9 A;  4O6J A;  4CCJ A;  4FTH A;  2Y2Z A;  5LFA A;  1MBG A;  2X48 A;  1F43 A;  2M4K A;  5HLI A;  5EG0 B;  3H5A A;  3SJM A;  2XF5 A;  1EH6 A;  2RC4 A;  4MLO A;  3CF5 F;  3ABU A;  2VJ4 A;  5LRS A;  1V55 H;  5DCF A;  4HZF A;  3ZPL A;  1ETY A;  3L2V A;  4CGZ A;  3CME I;  1WH5 A;  1SC7 A;  2K3P A;  4NDL A;  1K83 J;  2KJC A;  3ZQ7 A;  3CLQ A;  3I3L A;  4CXF A;  3EYY A;  4QSH A;  4A0Z A;  4EM1 A;  2ZXI A;  1TP4 A;  4XLN F;  3U21 A;  1IUF A;  1D0Z A;  2O6G E;  2A6H F;  3J80 Z;  4IJA A;  1MSE C;  3RDI A;  5HLT A;  3RPU D;  3F8C A;  2FBI A;  2J5O A;  1KQ9 A;  2MAB A;  2OF7 A;  4AVP A;  4IKF A;  1R4N B;  5DV5 A;  1HSJ A;  3HOS A;  1K4S A;  3OIP A;  5J3L A;  2E1C A;  2QKL B;  4U88 A;  1Z1D A;  3NWS A;  4RGU A;  3HRT A;  1T95 A;  1G3W A;  2ZJ2 A;  2W7N A;  5E17 F;  1V3F A;  3NWT A;  5JVT A;  1B8I B;  1QPI A;  5IP7 J;  1T56 A;  1TBX A;  3F8N A;  1BR2 A;  1FIA A;  3ROU A;  2F48 A;  1I6X A;  3G6E I;  2DOE A;  3HTU A;  2L4M A;  3OSG A;  4EGY A;  1UHW A;  2BEO A;  3BC8 A;  2UUZ A;  2VKH A;  2R5Z B;  1ZN2 A;  1UHS A;  5DCM B;  1I1G A;  4CYC A;  3JRH A;  5TRD A;  2E1O A;  2HXO A;  3KPH A;  3D5L A;  1O3R A;  2W00 A;  4D5C A;  1TNS A;  4P9F A;  2J5P A;  3GVA A;  4RLF A;  1HDD C;  5F1J A;  4I6Z A;  4MTD A;  3P7N A;  3L2R A;  1ON2 A;  4BYY A;  2BXY A;  4E7S A;  5HOO A;  4LLG F;  1EH7 A;  1V5E A;  2EZH A;  4LMY A;  1Z9C A;  1SVO A;  3VEP A;  3BPX A;  5CQG A;  3GBG A;  3F0C A;  3OSF A;  3CO7 C;  5E1W A;  3MZY A;  2QBY A;  4KFC A;  3CC2 I;  1ETX A;  4U0Y A;  1YFH A;  3BR2 A;  1CF7 B;  1W4M A;  3CJN A;  2NYX A;  1WVR A;  1PP7 U;  1PVE A;  3LFU A;  4M3B A;  1IRG A;  1F36 A;  3IAS 2;  4UUV A;  2EV0 A;  3JRA A;  3WG7 H;  2M30 A;  3HTS B;  1O4X A;  3PIO F;  3KEQ A;  3UR3 C;  4ETS A;  3H5N A;  1XPX A;  4YIF A;  3C7J A;  2L9N A;  5J1U A;  1Y8R B;  2MG4 A;  4IQ4 A;  3L09 A;  3U1K A;  2ME0 A;  4NUB A;  3WGH A;  3ZP5 A;  4ZYD A;  3CES A;  3QYE A;  2WY7 Q;  2BY1 A;  1FSE A;  4PFO A;  1NG6 A;  3WTV C;  4LJZ F;  5EZG A;  4KIT B;  2IGM A;  1WJE A;  1JHH A;  2I10 A;  3WTX C;  1U6G A;  5CVJ A;  5L3B A;  2QSF X;  2G7U A;  3VOE A;  3EUH C;  1B72 A;  4ZDO A;  2DPU A;  2M1B A;  1ZKG A;  3V8K A;  4RM2 A;  2MW8 A;  2Y31 A;  4YFN F;  4LLN A;  1G3T A;  4ASN A;  2ZNZ A;  3KE2 A;  4II2 A;  3BR6 A;  4B4C A;  2Z3Y A;  3ELK A;  1VQO I;  2DFF A;  4A3L J;  3RKX A;  3HOX J;  3QWL A;  2W82 A;  2EWN A;  4LIU A;  3GCM A;  5FD5 A;  4KYW A;  3K69 A;  3M07 A;  2Q0O A;  3QU3 A;  2W57 A;  2DOA A;  3MMY B;  3PUF A;  3D0S A;  2LFB A;  2K9S A;  3K70 D;  2ZBK A;  1BR1 A;  2NNN A;  1FMW A;  1YW9 A;  3IUO A;  3TO6 A;  3GUD A;  4N4O B;  3MAJ A;  5ICC A;  4A6D A;  4DW6 A;  3KYD B;  3J81 K;  4LFU A;  1F5T A;  1XMA A;  2DQL A;  3S93 A;  3WU2 C;  4HDU A;  3PO2 J;  1ZG3 A;  2HYG D;  1VQ7 I;  4ZYH A;  3HM5 A;  4PK4 A;  2Y30 A;  2FBH A;  2P4W A;  2F6C A;  1PUF B;  1NHA A;  1TWA J;  3I4P A;  2EBI A;  5FB2 A;  2V9P A;  1OYW A;  4A3B J;  4HQE A;  2BZT A;  5GPC A;  3F6V A;  2C6Y A;  3O8G A;  4ZDP A;  4YII A;  2XAS A;  3SDB A;  3HRS A;  1IRZ A;  1GV2 A;  3LL7 A;  3FIW A;  4I2O A;  1G59 A;  1NTC A;  4IQJ A;  4QPQ A;  4UXN A;  3C2B A;  5D8K B;  3NEU A;  4AIJ A;  2DFH A;  1U9O A;  4BE2 A;  1HKQ A;  3R0A A;  4DYR A;  2AS5 F;  1KU7 A;  1IDZ A;  3EUH A;  3LAP A;  1IN8 A;  2OZU A;  4G6Q A;  1A04 A;  3WTW C;  3LSP A;  4IRI A;  1QA6 A;  4P96 A;  2V26 A;  3IC7 A;  2Y0S N;  2XKP A;  3CDI A;  3RQ4 A;  3F21 A;  1GLN A;  4PSX A;  2QCO A;  5KVR A;  3L2C A;  2IW5 A;  3HGG A;  2FML A;  4KN4 X;  1WFX A;  4CH7 A;  5KCM A;  2XGE A;  5HDK A;  1HF0 A;  2R5Y A;  1X2M A;  2EA2 A;  2PJR A;  2OZ6 A;  1L0O C;  1WJB A;  4Y52 J;  3OR2 C;  4DYQ A;  4AVZ A;  2KIM A;  2HU9 A;  3QQA A;  3ZQF A;  2CYY A;  4C9Y A;  3WGG A;  2ZSI B;  4LG3 A;  1TW3 A;  5B66 C;  3WU1 B;  3K2A A;  4ABZ A;  1QZZ A;  1YLF A;  4XLF A;  2RVC A;  3EET A;  2YS9 A;  3DXJ F;  3LAJ A;  1MIJ A;  2D45 A;  2R7U A;  3DBL B;  3CQZ J;  4HRI A;  2WB1 A;  1I1S A;  1I39 A;  2KDZ A;  1O57 A;  2R4G A;  2ELJ A;  2CGP A;  1R58 A;  3C3W A;  1G6N A;  4C2U A;  3TO9 A;  3GFM A;  1SAU A;  2X85 A;  1EH8 A;  1HW1 A;  4GDF A;  3A1Y A;  1MBH A;  4IX7 A;  1J9I A;  1U5T C;  1MSF C;  4RGX A;  5ICE A;  4J00 A;  1I6H J;  5DM6 F;  3L00 A;  2JQ7 A;  1IN7 A;  3S8P A;  4B1R A;  3HZJ A;  1IN5 A;  2RV8 A;  4RAF A;  4D7N A;  1TC3 C;  1HLV A;  3ASN H;  4PUS A;  4Q4Z F;  1VQ5 I;  3NRV A;  1MKM A;  2HTJ A;  2G7H A;  2I8D A;  3E0J B;  4IXA A;  2PLY A;  2H8W A;  4GRI A;  3H92 A;  5J6X A;  4ZTF A;  3M8J A;  1UMQ A;  2PBI A;  4ESJ A;  2DMQ A;  3AAF A;  3G71 I;  4RGR A;  5K7F A;  5H2F C;  2LSO A;  3ECH A;  1UB9 A;  2YSR A;  2LOO A;  4D9J A;  4ZTJ A;  1FPQ A;  3KCC A;  3ZQH A;  1TT0 A;  1KZH A;  2WBM A;  3SYT A;  3BJ6 A;  1W7P B;  2MLK A;  4WK8 F;  1D0Y A;  1XB4 A;  5C44 J;  1W5S A;  4XRF A;  4MHG A;  2FX0 A;  1D8J A;  1OCP A;  1OCR H;  2CW7 A;  2VL8 A;  4KN7 X;  1JTY A;  4G94 A;  2K9L A;  3AG4 H;  4BHC A;  2DPD A;  3ISP A;  2DK5 A;  3MKL A;  3GO5 A;  5FKN A;  2H6B A;  5ICF A;  2DBB A;  2LKS A;  3QYF A;  4UVA A;  1G3S A;  4HX7 A;  4LK0 F;  4BGD A;  4C2M J;  4UB6 C;  1MD0 A;  1UJ8 A;  2XF7 A;  2GXG A;  3HRM A;  2M8G X;  2EV5 A;  2IAI A;  3BTC A;  3ONQ A;  1WPK A;  3I53 A;  2QKM B;  4UV9 A;  3GME A;  2HQN A;  3GXO A;  2XPW A;  4BAC A;  2O61 A;  2K4B A;  1D3Y A;  1RKW A;  2OAZ A;  3HHG A;  4M71 A;  5JHF A;  3KP5 A;  2HQR A;  4C30 A;  1K78 B;  2AXT C;  3QPH A;  3S2W A;  1IAW A;  1WZ2 A;  2FSW A;  2IP2 A;  4L9V A;  5FKM A;  3GTO J;  2HVR A;  2IBD A;  3SZG A;  5J4Y A;  5LGU A;  2CWE A;  4XRM A;  3CD6 I;  4MFD A;  3C18 A;  2FD5 A;  3IRR A;  4ZDL A;  2P5V A;  2VE9 A;  3UNG C;  4F3Q A;  4I0B A;  3LA7 A;  5J1R A;  3FXR A;  4BY1 J;  1P6R A;  2CQ7 A;  3JRD A;  4KMF A;  3DBH B;  2M2E A;  2KFD A;  2O8K A;  4LIV A;  2GXA A;  4XON A;  1KON A;  5D4R A;  4IVN A;  1B1B A;  4ZJZ A;  3I0T A;  1YW7 A;  1PUE E;  2DTR A;  5LGT A;  3KP4 A;  4DBQ A;  2BY0 A;  4EM2 A;  3BZK A;  3CCU I;  1FOY A;  5LLQ A;  4M72 A;  4B3A A;  4AWX B;  2VB6 A;  3CCV I;  1K61 A;  3A01 B;  2EV6 A;  2KKO A;  3W6V A;  3S32 A;  4RS8 A;  1PYV A;  2QZ8 A;  5KNL A;  2ZME B;  2EIJ H;  2FMY A;  2R7R A;  3V7R A;  5JR3 A;  2ESH A;  3Q0V A;  4XOR A;  3HXL A;  3DV8 A;  3PSI A;  1SFX A;  4ANJ A;  1LDJ A;  1FOW A;  4XSX F;  2FNA A;  2Z16 A;  3BG6 A;  1RUO A;  5EJC A;  1EJ9 A;  1XS9 A;  4BEH A;  1T98 A;  3K10 A;  3ZGK A;  1K79 A;  4I0A A;  3BG7 A;  2L3D A;  1X3U A;  4DYC A;  3WGI A;  2JSC A;  1ZAR A;  1D5Y A;  3RTR A;  3L9F A;  4MNU A;  4P55 A;  4ENM A;  4IF4 A;  2HEO A;  2E35 A;  3LA2 A;  1BA5 A;  3BLY A;  4HV5 A;  2LY1 A;  1FYL A;  3OYF A;  4HEA 2;  4GFB A;  3H36 A;  3GEZ A;  4E4H A;  2L7F P;  3QOE A;  1HCR A;  1DGR M;  2KP6 A;  5DYM A;  1BW5 A;  2LKP A;  1BR4 A;  4U87 A;  2YR2 A;  4HG2 A;  5F0H A;  1D1B A;  1B4A A;  1XCV A;  3PQJ A;  1OR7 C;  1TNT A;  5LRR A;  3RZO J;  5ILU A;  1XC5 A;  2VT2 A;  3J7Y J;  3SXY A;  4OOI A;  1XSV A;  2A6E F;  5D5X B;  2EIL H;  2HGC A;  2IGN A;  3RZD J;  3CP2 A;  1S8N A;  1ETO A;  4A5M A;  3DEE A;  2DCE A;  5K7Z A;  3MFK A;  3M8F A;  3VYU B;  3ZN1 A;  2RRE A;  2NS8 A;  5DD8 A;  3H5R A;  4KA4 A;  2BVL A;  5J4V A;  3UKG A;  3DFG A;  4RAY A;  3IHU A;  3GTL J;  2JN6 A;  3TDZ C;  1S6L A;  1Z7L A;  3P5J A;  3S17 J;  3BCA A;  4UVC A;  5CPR B;  1MH3 A;  1RC9 A;  2KZV A;  4N0B A;  3I56 I;  2WV0 A;  2M9H A;  2XF6 A;  4XNF A;  3OIQ A;  2EIM H;  1MMD A;  1ODD A;  2HZD A;  4K2E A;  1TWF J;  2O5R A;  5FRO A;  1FTZ A;  3OS1 A;  2IVM A;  1BI3 A;  2V1X A;  4ON0 A;  5TGT A;  2LVS A;  4TV7 A;  5M5Y J;  2B0L A;  2HOA A;  2B7E A;  1ETW A;  3GWZ A;  1U3E M;  3PFI A;  1REP C;  1S29 A;  4M74 A;  4HX4 A;  4ZZL A;  2K86 A;  4JP0 A;  2WAQ A;  3CC7 I;  1J0R A;  1LDK B;  3ML6 A;  1MDM A;  2NVU B;  1YX5 A;  3F9K A;  6PAX A;  3E5Q A;  2R93 J;  2EIN H;  3EDP A;  4MQ9 F;  2JK3 A;  2RDP A;  3FKI J;  5DEQ A;  3LA3 A;  2EFO A;  3COA C;  2DQR A;  3LSI A;  4E7Z A;  4QLC U;  2X6X A;  4A0Y A;  3ESW B;  1W5T A;  3IV5 A;  3BP8 A;  4LG0 A;  3L2Q A;  1UZC A;  2D5V A;  4RDU A;  1DU0 A;  5E20 A;  1VI0 A;  2NOJ B;  2UXX A;  3FXJ A;  1OR7 A;  2Q1Z B;  5JFR A;  2KL4 A;  3RQI A;  4A69 C;  4X1E A;  3G4S I;  2VBY A;  4P9U A;  4JOM A;  2RNG A;  2E19 A;  1QPM A;  1R9T J;  2ECB A;  1RR7 A;  3GW2 A;  3T5X A;  2QQ8 A;  3MCZ A;  3TL4 X;  1IXS B;  1FT9 A;  1ZAO A;  2Y75 A;  4HAM A;  4H0E A;  2OC6 A;  1JKR C;  3HOZ J;  4R8H A;  2VPL A;  4DJA A;  5EG0 A;  1Q1H A;  3GZ5 A;  3HSF A;  2FA5 A;  3HOY J;  2DU9 A;  2VT3 A;  1SMY F;  3K4L A;  2FE3 A;  4CCN A;  3M1E A;  1SMT A;  2COB A;  3QPL A;  4E70 A;  2VUM J;  4MGR A;  1YQA A;  1T08 B;  2CFX A;  5BOX A;  1ZRF A;  1LKX A;  4O3M A;  3ERM A;  3CUQ C;  2LYC A;  3ULQ B;  5E18 F;  1Z91 A;  1BI0 A;  3B6C A;  3KIO A;  2V1U A;  2WAF A;  4BUP A;  2ECC A;  2F4I A;  2M4G A;  3DQV C;  3A03 A;  3JSP A;  1Y39 A;  1DDN A;  4HA8 A;  4R79 A;  2STT A;  3L7W A;  3GZ6 A;  2HYJ A;  2TCT A;  3LNQ A;  1Z6R A;  3GLL A;  5KAF C;  5HDN A;  3D5R C;  4IPA A;  1Y6I A;  4IL6 C;  4DGW B;  3AFH A;  5DUI A;  2ELH A;  2LLK A;  2FJ1 A;  4FCY A;  3D1N I;  2B63 J;  4RAZ A;  3GLX A;  1WGX A;  3ZN0 A;  3RPQ A;  4EMS A;  3S1Q J;  1JUM A;  3MKW B;  4D5F A;  2L0K A;  1E3H A;  2QVO A;  3OL4 A;  5LBQ A;  1LDD A;  1YI2 I;  1FBQ A;  2IA0 A;  4EM0 B;  2L9R A;  3V7C A;  2VBW A;  2GLO A;  2CJJ A;  1MJB A;  1R4M B;  3K1N A;  3PL8 A;  2CUE A;  1MBK A;  2FOW A;  3CCM I;  5M3F J;  2JWT A;  4A6E A;  1S7O A;  2XAJ A;  1XDS A;  3E7L A;  2A5Y B;  5K5R A;  1ZR4 A;  2QQB A;  4JX5 A;  4I76 A;  2R5Z A;  1BC8 C;  1H88 C;  4RB0 A;  2Z2S B;  5DCM A;  2R7D A;  1Y0U A;  3KYC B;  1XSD A;  1DU6 A;  2E60 A;  1QHG A;  1P9Q C;  4BQA A;  1SD7 A;  4EAT A;  2DMT A;  4V2G A;  5E79 C;  2JTV A;  5L3D A;  5BQT A;  1D8K A;  2QGU A;  3OYH A;  2KMU A;  2CUF A;  2R3S A;  5ERI A;  5IT9 Z;  3KEY A;  3EYI A;  5F6F A;  5BPD A;  1BJA A;  2DA5 A;  4XN0 A;  3Q0W A;  2VOP A;  3CF2 A;  1CF7 A;  1K6Y A;  1X1A A;  2B9S A;  1P92 A;  1JKQ C;  1B9M A;  4CHU A;  2H1L A;  1VND A;  1TWH J;  2O0Y A;  4XBF A;  2QLZ A;  4BE1 A;  3NAR A;  2DYR H;  2O3F A;  1B6A A;  2HFH A;  3OIO A;  3JCU C;  5DTD A;  2OTL I;  5FLX K;  1ZH5 A;  2PJP A;  4FX4 A;  1VQ8 I;  1E0E A;  3K70 C;  4L5E A;  1N25 A;  5F04 A;  3S14 J;  1F4K A;  1LUJ B;  2RAE A;  1R22 A;  2R7W A;  1IN6 A;  1U78 A;  1IUY A;  4BHB A;  3PIP F;  3F23 A;  2K9M A;  2QYO A;  3S3O A;  3U1D A;  3DU6 A;  2L7Z A;  1H9T A;  4BXU A;  3D5S C;  4OIO F;  3GTQ J;  1WRJ A;  5F64 A;  1BI1 A;  3X2Q H;  2ZO4 A;  5GTI C;  1R5I D;  2WA0 A;  3I5U A;  2VLA A;  4YG2 F;  2WAD A;  2GWR A;  3FXO A;  2N8G A;  3N4M A;  3VPR A;  1ZRD A;  4Z2Y A;  3BCB A;  2CQQ A;  4A3E J;  2A05 A;  2EPF A;  3GFI A;  1OYI A;  3ZQQ A;  4L18 B;  3IWF A;  1BN5 A;  2DAO A;  2OPT A;  1R1V A;  3C1D A;  1Y8Q B;  2HKX A;  4CCK A;  1NG7 A;  3NAU A;  4HNT A;  5C4J J;  4G9Y A;  5EZH A;  2PI0 A;  4AYB A;  3H3Z A;  2VQL A;  2VXD A;  1BW6 A;  4I7H A;  2P6T A;  1OCT C;  4CA0 A;  2ZC2 A;  3K4K A;  4EJV A;  2M0C A;  5CVV A;  1I3A A;  2ZXJ A;  1I50 J;  2XGC A;  4M6X A;  4OAY A;  3AG1 H;  3FHZ A;  3E1S A;  5HVQ C;  2UWM A;  4A2U A;  2Y9Z A;  2RQQ A;  1H89 C;  3FXL A;  4WX9 A;  2LTP A;  1EF4 A;  5GP9 A;  1Z21 A;  4QWQ A;  1PUF A;  1AKH B;  4NB5 A;  2VQC A;  1F1Z A;  4KDP A;  3Q0U A;  1T6S A;  4LD5 A;  1TQM A;  4HF0 A;  1MMS A;  2ZJR F;  1R7J A;  1QQI A;  5L3F A;  3F8F A;  2FXA A;  2QSG X;  5GAG J;  2ELK A;  1G4D A;  1HKT A;  2P6S A;  2ETH A;  1P4W A;  4B47 A;  3J7Z I;  1L3L A;  5GPA A;  3G1O A;  4A3C J;  1H8A C;  4LGW A;  4BJ5 C;  2A68 F;  3CZ6 A;  2DI3 A;  2VKD A;  1UCR A;  4WXD A;  4M9X A;  4YRV A;  4S04 A;  2DT7 B;  4MFE A;  3LOC A;  2XB0 X;  4DZJ A;  1OCO H;  1VQ4 I;  2VOO A;  2L9V A;  2A61 A;  2YPR A;  3KZY A;  4AYB N;  4BXX J;  1OIS A;  4HF1 A;  1TZL A;  3HB9 A;  3DTI A;  1FJL A;  1OCC H;  1YS7 A;  2L4A A;  3HSE A;  3MWM A;  4BXF A;  3LSR A;  1IDY A;  5FKK A;  1XDU A;  5LGN A;  2XUB A;  3JRI A;  1QVT A;  3ZMS A;  2LP0 A;  2EK5 A;  3OOP A;  2HVQ A;  3DWL E;  2O7O A;  4HDV A;  2XB5 A;  3LSK A;  4RBO A;  5CVR A;  1BL0 A;  4CCL A;  3HHH A;  5IYB J;  1AU7 A;  1KU2 A;  1HBX G;  2MLG A;  2BY2 A;  2CSO A;  1VTN C;  3C2H A;  2KT0 A;  1A5J A;  2H27 A;  3H3U A;  1HA8 A;  2BY3 A;  1LJ9 A;  4PZJ A;  1X58 A;  2Y0S A;  9ANT A;  3V7S A;  2VIX A;  2IS2 A;  3GFJ A;  2XKO A;  5F0F A;  1WCM J;  2TDX A;  2CMP A;  1ZG1 A;  3OYL A;  3CJR B;  2CUJ A;  2ZSH B;  3E5U A;  3HC7 A;  4M3G A;  5EEG A;  3SEQ A;  2MFZ A;  2XRL A;  4A3I J;  3P9C A;  3DLA A;  4I09 A;  3K4M A;  3TOB A;  1EKE A;  5JVG F;  2PMZ N;  3FX3 A;  1UG0 A;  1FBS A;  3VWB A; 
#chains in the Genus database with same CATH homology
 3BTC A;  1WPK A;  2JA5 J;  4FE7 A;  4JYK A;  1ZQ3 P;  5DS9 A;  3BR3 A;  3GTG J;  2XPW A;  4BBR J;  4QIW N;  4AC0 A;  1RKW A;  2L7M P;  1Y1W J;  2HXI A;  3HEF A;  2E2J J;  3BR1 A;  2NVQ J;  3TW6 A;  5EDN A;  2AHQ A;  2NVX J;  1TWC J;  1GV5 A;  1X2N A;  3MVP A;  1Z0X A;  5M3M J;  1VF9 A;  3GTO J;  2EZK A;  5FKM A;  2IBD A;  4XRM A;  3G1M A;  3ZQI A;  2HQ5 A;  4MFD A;  2DJN A;  1BJZ A;  2FD5 A;  3JRG A;  3HBL A;  5M5W J;  5J1R A;  3HGY A;  4BY1 J;  1APL C;  3JRD A;  2M2E A;  2O8K A;  1ENH A;  2MSY A;  3OOU A;  1GVD A;  2LR8 A;  3BG9 A;  1IJW C;  4A3J J;  1W0U A;  1JKP C;  2JA7 J;  1VFC A;  5HOD A;  3K7A J;  3TP3 A;  4B3A A;  1K61 A;  3A01 B;  2XGD A;  3W6V A;  1QVU A;  2HI3 A;  2WAQ N;  5F0C A;  1P7J A;  5IOZ A;  3Q0V A;  2LY9 A;  1CQT A;  1W0T A;  2ID3 A;  4IEJ A;  5C3E J;  3GTK J;  2CQX A;  5FKL A;  3SDG A;  2JJ7 A;  3I4N J;  1XS9 A;  3JRF A;  1JKO C;  3TED A;  5C4X J;  3H3V K;  4DYC A;  3BG3 A;  2AO9 A;  1P7I A;  3RKQ A;  2R92 J;  1D5Y A;  4BY7 J;  5EF6 A;  2DA7 A;  4FIS A;  4UUT A;  1BA5 A;  4C3I J;  1JGG A;  2HDD A;  3HOU J;  3HOW J;  4GFB A;  1HCR A;  2L7F P;  5EGO B;  1BW5 A;  1B8I A;  1GT0 C;  3B6A A;  5F0H A;  3ZQG A;  3RZO J;  3A01 A;  4JX6 A;  4M3D A;  1XC5 A;  4J19 A;  4G12 A;  2DMU A;  1RKT A;  4A3K J;  1OFC X;  3LSG A;  3LSJ A;  1IC8 A;  4M6V A;  3RZD J;  5FJ8 J;  1ETO A;  1JT0 A;  2EQR A;  1UG2 A;  1WH7 A;  1A6I A;  4A3G J;  1QRY A;  4HNV A;  5K7Z A;  3BR5 A;  1G2H A;  2DA3 A;  2NS8 A;  3IH2 A;  3Q3S A;  4W1U A;  3UKG A;  5F27 A;  4LOC A;  4C3J J;  2JN6 A;  2R0Q C;  3GTL J;  3S17 J;  3TW7 A;  1I3Q J;  3S15 J;  5IP9 J;  1MH3 A;  1OJL A;  3G1L A;  3MN2 A;  5F08 A;  3ZQL A;  1S7E A;  4FTH A;  2M9H A;  2Y2Z A;  1MBG A;  2X48 A;  1FTZ A;  1F43 A;  1TWF J;  1JUS A;  5EG0 B;  3SJM A;  1Y1V J;  1SAN A;  2LVS A;  4MLO A;  2NS7 A;  5M5Y J;  2HOA A;  5EGO A;  2XPU A;  1ETW A;  4IHY A;  1POG A;  4UUS B;  4JP0 A;  1ETY A;  2WV1 A;  2NVT J;  1WH5 A;  2R93 J;  4NDL A;  2JK3 A;  3FKI J;  5FLV A;  1K83 J;  2ID6 A;  2DMP A;  3WHB A;  4IHX A;  4QSH A;  3IV5 A;  1NK2 P;  1IUF A;  3M3Y J;  2D5V A;  3A02 A;  4RDU A;  4CYC B;  1LFU P;  1DU0 A;  1MSE C;  1VI0 A;  2DMN A;  1ITY A;  2EH3 A;  3RQI A;  4A69 C;  4X1E A;  1YRN B;  2OF7 A;  3FK7 A;  1HDP A;  1MBJ A;  2E19 A;  1R9T J;  2ECB A;  1RR7 A;  1MH4 A;  5J3L A;  2VPR A;  1ETV A;  3BTL A;  1JKR C;  3HOZ J;  2CRG A;  5EG0 A;  1Q1V A;  5BNG A;  1IG7 A;  3GTP J;  3HOY J;  1B8I B;  3M4O J;  1QPI A;  4A3F J;  2XSD C;  5IP7 J;  1T56 A;  4UUS A;  2COB A;  2W48 A;  1FIA A;  2Y9Y A;  2DA1 A;  3QPL A;  2NVY J;  2VUM J;  4X6A J;  3OSG A;  1FTT A;  4AUX A;  5E3M A;  3B6C A;  2XPV A;  2ECC A;  2R5Z B;  3A03 A;  3BR0 A;  2LD5 A;  1JUP A;  1UHS A;  2YU9 J;  4CYC A;  3JRH A;  2HYJ A;  2E1O A;  2HXO A;  2TCT A;  5M5X J;  3LNQ A;  1ZR2 A;  4D5C A;  3HKZ N;  1HDD C;  5F1J A;  1ETQ A;  4I6Z A;  1ETK A;  1YRN A;  4EEF G;  1B72 B;  2LLK A;  2EZH A;  2FJ1 A;  4FCY A;  4C3H J;  3D1N I;  3GBG A;  2EZL A;  3F0C A;  1WGX A;  3OSF A;  2B63 J;  3S1Q J;  1FIP A;  1JUM A;  3S1N J;  1ETX A;  2L0K A;  4D5F A;  3BR2 A;  2YUS A;  5FLM J;  2EZI A;  2L9R A;  4M3B A;  2GLO A;  1F36 A;  2CJJ A;  2LKX A;  4S0H B;  3JRA A;  1FEX A;  1O4X A;  5EYR A;  1T33 A;  4IHV A;  3FIS A;  2CUE A;  1MBK A;  5M3F J;  1JJ6 C;  2JWT A;  5J1U A;  2G0E A;  1MNM C;  2MG4 A;  3E7L A;  1ZGW A;  2ME0 A;  1ZR4 A;  1LE8 B;  2R5Z A;  4JX5 A;  1JT6 A;  4I76 A;  3ZOB A;  1H88 C;  2HOS A;  5IOY A;  5IYD J;  1DU6 A;  5EZG A;  3QPS A;  4XRS G;  2DMT A;  4V2G A;  2I10 A;  3BTJ A;  4A3D J;  3S2D J;  2MGQ A;  1B72 A;  2CUF A;  1ZKG A;  2MW8 A;  2Y31 A;  1IGN A;  3BR6 A;  4B4C A;  2DA5 A;  5JLW A;  3Q0W A;  4A3L J;  4M3F A;  3TP0 A;  3HOX J;  5FKO A;  4XID A;  2DA4 A;  1JKQ C;  4XIC A;  1TWG J;  1VND A;  3HOV J;  1TWH J;  2WB1 N;  3CDL A;  3NAR A;  5DTD A;  3OIO A;  2LFB A;  2K9S A;  3HDD A;  4L5E A;  5F04 A;  3S14 J;  2ZB9 A;  4DW6 A;  3I4M J;  2RAE A;  2H8R A;  2CU7 A;  2K9N A;  3JRE A;  4A93 J;  3PO2 J;  1LE8 A;  2R5Y B;  4FE4 A;  3CCY A;  3JRB A;  1U78 A;  3HM5 A;  1U9N A;  2Y30 A;  2L7Z A;  4MO7 A;  1PUF B;  1TWA J;  3PO3 J;  3GTQ J;  2EBI A;  1Z77 A;  2JA8 J;  4A3B J;  5GPC A;  3O8G A;  3S1R J;  2N8G A;  3VPR A;  4A3M J;  2CQQ A;  3WHC A;  4A3E J;  1IRZ A;  1GV2 A;  1MBE A;  3FIW A;  1NTC A;  3C2B A;  2K9Q A;  2OPT A;  1U9O A;  2O9L A;  3NAU A;  4DYR A;  5C4J J;  2GM4 A;  5EZH A;  2E2I J;  1IDZ A;  2DA6 A;  3S1M J;  2NOG A;  3LSP A;  1BW6 A;  3H0G J;  4V2F A;  1OCT C;  2Y0S N;  2M0C A;  2VI6 A;  1RES A;  2QCO A;  2JA6 J;  3IH3 A;  3HGG A;  1I50 J;  2XGC A;  4W97 A;  2XGE A;  1HF0 A;  2R5Y A;  1X2M A;  2Y9Z A;  5E3O A;  1LFB A;  1H89 C;  4Y52 J;  2LTP A;  1EF4 A;  5GP9 A;  1PUF A;  2X9D A;  4DYQ A;  1AKH B;  2JMW A;  3BTI A;  3Q0U A;  2X6O A;  3QQA A;  2QF7 A;  2P81 A;  3ZQF A;  1GUU A;  2K40 A;  3IH4 A;  3K2A A;  4ABZ A;  2ELK A;  5J1Y A;  2YS9 A;  5GPA A;  3G1O A;  3CQZ J;  4A3C J;  1H8A C;  5E3L A;  2KDZ A;  2FQ4 A;  2R7Z J;  4BBS J;  2IEK A;  3JR9 A;  4MIM A;  3JRC A;  4IHW A;  4MFE A;  4BKX A;  3LOC A;  2XB0 X;  4DZJ A;  5EEA A;  1MBH A;  2DN0 A;  4Y7N J;  1MSF C;  3S2H J;  5IPA A;  1I6H J;  5JLX A;  4M3E A;  4AYB N;  4JX4 A;  1SFO J;  2VKV A;  4BXX J;  3GTM J;  4B1R A;  3DCF A;  5IP6 A;  3HB9 A;  1FJL A;  4D7N A;  4XK4 A;  1TC3 C;  3LSR A;  1HLV A;  3O8H A;  1IDY A;  5FKK A;  3JRI A;  2VKE A;  4D7M A;  1QVT A;  2LK2 A;  1ZTR A;  5K7H A;  2LP0 A;  1AHD P;  2H1K A;  3GTJ J;  2M34 A;  1AKH A;  2O7O A;  1UMQ A;  2E2H J;  2XB5 A;  4RBO A;  2DMQ A;  1WI3 A;  3ZQC A;  3FK6 A;  5K7F A;  1BL0 A;  1RPW A;  5IYB J;  1AU7 A;  3PM1 A;  3BG5 A;  3ZQH A;  4DZP A;  1U8B A;  1XG1 A;  1JTX A;  1NK3 P;  2TRT A;  2KT0 A;  5C44 J;  1A5J A;  4XRS A;  5E3N A;  1GDT A;  2HOT A;  2FX0 A;  1OCP A;  1RET A;  3DEW A;  1JTY A;  1X58 A;  9ANT A;  1ZK8 A;  5IYC J;  1IV6 A;  5F0F A;  1WCM J;  2DTZ A;  1ORK A;  4QTR A;  3MKL A;  5FKN A;  3SFI A;  4M3G A;  2ME6 A;  3BQY A;  2DA2 A;  1JJ8 C;  2XRL A;  1MBF A;  4A3I J;  2GBY A;  4C2M J;  3BQZ A;  3CMY A;  1HOM A;  3BT9 A;  3S16 J;  2M8G X;  2PMZ N;  3L1P A;  2IAI A;  1E3O C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...