1FTTA

Thyroid transcription factor 1 homeodomain (rattus norvegicus)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
68
structure length
68
Chain Sequence
b'MRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKAAQQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THYROID TRANSCRIPTION FACTOR 1 HOMEODOMAIN
molecule tags Dna binding protein
source organism Rattus norvegicus
publication title Analysis of the solution structure of the homeodomain of rat thyroid transcription factor 1 by 1H-NMR spectroscopy and restrained molecular mechanics.
pubmed doi rcsb
total genus 19
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 1995-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1fttA00
3WHBA 1GT0C 1QPIA 3Q0UA 5K7FA 1H8AC 4XRSG 2XGCA 3HM5A 4M3GA 1JKQC 2JN6A 4Y52J 1HOMA 1WPKA 1RKWA 1A6IA 3A02A 2XB0X 3RZOJ 4UUSB 3BR2A 2XPUA 1B72B 4A3BJ 3C2BA 1QRYA 3MVPA 3S15J 3JREA 1ZGWA 2MSYA 2JMWA 3TW6A 4IHWA 1JUSA 4B1RA 1ENHA 2HOAA 2NVYJ 4X1EA 3S16J 2L0KA 4D7MA 1K61A 4A3IJ 3ZQLA 4JYKA 1Q1VA 3A03A 4JX5A 3OSFA 2JA6J 1XG1A 3DCFA 1MBKA 2LFBA 4DYQA 2DA6A 4BY1J 2NS8A 1ETWA 2ECCA 2IEKA 2JJ7A 1ZKGA 2RAEA 1ZR4A 5IOYA 1I6HJ 3S1QJ 2O8KA 2XB5A 4FCYA 3B6AA 3QPSA 3RQIA 2K9NA 3FIWA 2LR8A 1ZR2A 2AHQA 2DMTA 1E3OC 4AYBN 4IHXA 1QVUA 2DJNA 3BTLA 4AC0A 5HODA 2M9HA 3HOYJ 3SFIA 3LSJA 5IYCJ 1F36A 2GBYA 1OCPA 2HXIA 2LP0A 3FKIJ 2QCOA 3QPLA 3OSGA 3BQZA 3OIOA 2DN0A 5J1UA 3TP3A 9ANTA 5F0FA 1BJZA 2ZB9A 3BR6A 4FE4A 2N8GA 1EF4A 5BNGA 1JGGA 1AHDP 1XC5A 4A3MJ 1JJ6C 4MFEA 5M5WJ 1SANA 3BR1A 4JP0A 3G1OA 2FJ1A 3TP0A 5M5XJ 1T33A 5GP9A 4BXXJ 4UUTA 3S2HJ 4RBOA 1IDYA 2R5ZB 3RZDJ 4V2GA 5GPCA 1P7JA 2NVXJ 1ETOA 3A01B 2GLOA 5FJ8J 1OFCX 2MGQA 5C44J 1JT0A 3Q3SA 3BT9A 2P81A 1LFBA 1IRZA 2LY9A 1IUFA 2LKXA 3S2DJ 2Y0SN 4RDUA 3GTOJ 3SJMA 1ITYA 3GTJJ 5M3FJ 1Y1WJ 4CYCA 5F27A 4XICA 4IHYA 4LOCA 1ETQA 5EF6A 1RR7A 3O8GA 1MBHA 4C3IJ 1IGNA 2O9LA 3GTKJ 4A3LJ 2ELKA 2Y9ZA 2Y9YA 1HCRA 3BTCA 2CJJA 4CYCB 2L7ZA 1WH5A 2EZKA 1I3QJ 4AUXA 1FIAA 1FIPA 5EYRA 3Q0VA 3SDGA 2X6OA 2EH3A 2E19A 3HOZJ 3Q0WA 5E3OA 1LE8A 1RPWA 1D5YA 3WHCA 1UHSA 1ZK8A 2ECBA 4QSHA 3GTGJ 1BA5A 2CU7A 2W48A 1OJLA 4W1UA 1ZQ3P 3O8HA 3JRGA 5FKNA 5K7HA 3HBLA 1TWCJ 3HDDA 3HOUJ 2M2EA 1Z77A 3BQYA 2X48A 4DYCA 2JA7J 4B4CA 3G1MA 4XRMA 2NOGA 1WH7A 2HQ5A 4B3AA 1AKHA 3ZQHA 1ETYA 2M34A 1Y1VJ 5GPAA 2R7ZJ 5DS9A 5EG0A 1IG7A 4A3CJ 2ID6A 1RESA 3UKGA 4IHVA 4HNVA 3ZOBA 1AKHB 1X2MA 4DZJA 5FLVA 1JTYA 2HDDA 5EGOB 2CRGA 5F1JA 2JWTA 2DA7A 5FKOA 3ZQFA 3S1NJ 1BL0A 2KT0A 1PUFB 1TWAJ 1MNMC 1F43A 4FE7A 1MBEA 1UG2A 1P7IA 4FTHA 5JLXA 1W0TA 1IC8A 1OCTC 3I4NJ 2NVQJ 4A3KJ 3GTQJ 1FEXA 2EZIA 3A01A 1SFOJ 3GTLJ 2YS9A 4NDLA 5E3MA 1DU0A 5FKLA 1MBJA 1S7EA 2OPTA 2OF7A 1GV5A 1JUPA 2NVTJ 1IJWC 1PUFA 4M3BA 1GDTA 2LK2A 2ID3A 3S1MJ 1AU7A 2DMNA 4MIMA 5IP9J 3HOWJ 5F04A 1TWGJ 4D7NA 2DMQA 4J19A 3M3YJ 1DU6A 1GUUA 5FKKA 4MO7A 1TWHJ 3JRCA 1IDZA 1JT6A 2VKEA 5C4XJ 4MLOA 2DTZA 1U9OA 5EG0B 2TCTA 1U8BA 1NK2P 2ME0A 2MW8A 2COBA 3LSGA 3RKQA 5IP6A 5IYDJ 1ETKA 3JRFA 3HOVJ 4D5FA 5FKMA 4A3EJ 3BG3A 3LOCA 2L7FP 3CDLA 2ME6A 1HF0A 1T56A 1X58A 4QIWN 1VNDA 2DA3A 1JKRC 3IV5A 2YUSA 2R5ZA 1BW5A 3BTIA 2CUEA 1MSEC 3JRIA 2I10A 5F0HA 3JR9A 1FTTA 1VF9A 1JJ8C 3FISA 1MSFC 1MBFA 5F0CA 3K7AJ 3IH3A 1IV6A 2B63J 4Y7NJ 3E7LA 4BY7J 1JUMA 4I76A 5J1YA 3M4OJ 3S14J 2FQ4A 2HXOA 3BTJA 1FJLA 2H8RA 5J3LA 5IPAA 2HI3A 4GFBA 2DA1A 1WI3A 4JX6A 3MN2A 3MKLA 2HOSA 1VFCA 2VI6A 5C4JJ 2K9SA 4M3DA 1HDDC 1JTXA 2VPRA 2LLKA 2MG4A 3BR3A 5EEAA 3HGYA 4M6VA 3CQZJ 5M5YJ 1U9NA 2K9QA 3H0GJ 3PO2J 1MH3A 4X6AJ 3K2AA 2HYJA 3PM1A 2WAQN 4A3JJ 2YU9J 1A5JA 1FTZA 3CMYA 2FX0A 2L9RA 3TW7A 4IEJA 2X9DA 1MBGA 2L7MP 4A93J 3VPRA 3IH2A 3LNQA 5EDNA 1UMQA 1ORKA 5C3EJ 3GTMJ 2XSDC 5FLMJ 3GBGA 2JA5J 1X2NA 2DA4A 4DW6A 5M3MJ 3CCYA 2PMZN 1TWFJ 3G1LA 2EZLA 2D5VA 3PO3J 2O7OA 3QQAA 5E3NA 3TEDA 4W97A 1B72A 3LSRA 1POGA 2AO9A 5EGOA 1RKTA 3HEFA 1G2HA 5K7ZA 4XRSA 2Y30A 2EZHA 5IP7J 4C3HJ 2HOTA 4S0HB 2KDZA 1YRNA 2QF7A 4FISA 2E2JJ 2WB1N 3JRBA 3ZQCA 5EZGA 3W6VA 2CQXA 2WV1A 2EQRA 3HB9A 3ZQIA 2DMUA 3FK7A 2VKVA 1ETVA 5IYBJ 1W0UA 1ZTRA 2E1OA 2R92J 3DEWA 2IBDA 2JK3A 4C2MJ 2LD5A 3BG5A 1CQTA 2CUFA 2CQQA 2LVSA 2R0QC 1NK3P 5J1RA 3IH4A 1GVDA 2XRLA 4M3FA 3JRHA 4QTRA 1RETA 1Z0XA 1LE8B 3B6CA 2GM4A 2E2IJ 2M8GX 1WCMJ 4XIDA 2JA8J 3H3VK 2M0CA 3OOUA 1YRNB 2VUMJ 4BBRJ 1MH4A 4JX4A 1WGXA 1LFUP 4G12A 1O4XA 4BBSJ 4XK4A 4DZPA 3I4MJ 1B8IA 4A3GJ 2EBIA 1ETXA 2R5YB 2XGEA 2Y31A 3S17J 3LSPA 3HKZN 4D5CA 1R9TJ 4A69C 3GTPJ 4BKXA 1U78A 1H89C 4M3EA 2LTPA 3HGGA 3F0CA 2XPWA 2R5YA 2XPVA 1B8IB 2DMPA 4UUSA 3NAUA 2Y2ZA 3S1RJ 3BR0A 1NTCA 2G0EA 3JRAA 1JKOC 2NS7A 4I6ZA 1APLC 1I50J 2E2HJ 2R93J 1QVTA 5DTDA 3D1NI 2TRTA 1K83J 5F08A 1JKPC 3BG9A 3FK6A 4V2FA 5JLWA 1H88C 2K40A 3BR5A 5E3LA 4EEFG 1TC3C 1HDPA 5IOZA 3HOXJ 1BW6A 2DA5A 3JRDA 1VI0A 2IAIA 3ZQGA 4A3FJ 3L1PA 2DA2A 1HLVA 2XGDA 1XS9A 4A3DJ 1GV2A 2FD5A 4L5EA 5EZHA 3NARA 4DYRA 2H1KA 4MFDA 4C3JJ 4ABZA
chains in the Genus database with same CATH superfamily
2RDPA 4DIQA 3EYIA 3NWSA 2X1CA 4XRSG 3RI4A 4Y4RA 4O3MA 1V3FA 4M3GA 3K4LA 2R7WA 3PNVA 4IOCF 4A2UA 1HW5A 3F3XA 3F21A 3IWFA 1B72B 2XPUA 4PJ0C 3F22A 2GA2A 3VFZA 3S15J 1L0OC 3I71A 3K1NA 1I1GA 3ZR8X 3JREA 1R4NB 1ZGWA 3I59A 4A0XA 1JUSA 5CYVA 2WC2A 4DQ2A 1FOWA 3CUQA 3CC7I 4EJTA 2HOAA 3S16J 4L5JA 5D5VB 4Y33A 3DPUA 2VQCA 3PSFA 5KVRA 3WTWC 3ZQLA 4LGWA 3OYAA 3EUHA 1K7AA 4M72A 1HKQA 3OSFA 2PLYA 3DCFA 1UAAA 3IAM2 2DFIA 2VOPA 3CCRI 1R1UA 4PCQA 4EGYA 1EH7A 4BY1J 2ECCA 3HUGA 3HRUA 1FNNA 1X3ZB 3EETA 1FMVA 3KPHA 4FQGA 1I6HJ 1K4TA 2O8KA 2ZMEA 3V7SA 2FQ3A 2GQQA 3RQIA 4IHXA 1B6AA 1W5TA 1XDUA 3KIOA 5ILUA 5L3BA 3HOYJ 1GLNA 2QSHX 2Z1DA 3VWBA 3V7RA 2VOOA 1F36A 3G6EI 2IJLA 3KP3A 3DLLF 2IA0A 3JTHA 1G8XA 1DPRA 1Z3XA 3OIOA 3OL3A 4RA2A 4BACA 5CVJA 1NHAA 1BJZA 2F48A 1TNTA 2FA5A 4EV0A 3FXOA 2LDUA 3BR6A 1X4OA 3CLOA 2DFEA 1EF4A 4HX7A 1AHDP 2W25A 4A3MJ 5B5EC 5LGUA 1T0FC 1LUJB 5M5WJ 4IHTA 3L2WA 4ETSA 4LLGF 3PUBA 4HF0A 2F5CA 5GP9A 4I0AA 3WTVC 3E97A 2ZFWA 4UUTA 1E2XA 2DOAA 4RGSA 1ZRDA 3OV8A 3S2HJ 3HOTA 4OMZA 4GRIA 1Y0NA 5HNHA 4V2GA 2DPUA 1R5ID 4BDZA 1TQPA 2GLOA 3ZMDA 1OFCX 2V4JC 1WJBA 2DBBA 4LK1F 4BU2A 4HG2A 2KIFA 1LFBA 5AIQA 2LY9A 5GTIC 2ETHA 4BXUA 3MD2A 4XR6A 4HSRA 2E60A 2MYSA 4BUPA 2BOLA 3SYTA 3DBRB 4ZYHA 2MFZA 4XICA 4IHYA 2R7SA 1Z3YA 2CFXA 1IGNA 2QM3A 3WODF 2CV1A 1WJAA 3V8LA 4LIUA 2ELKA 2Y9ZA 4J00A 1HCRA 3EUAA 1FT9A 4L0YB 4KISA 2QSFX 4UNOA 3OYNA 1I6XA 5HLIA 2LOOA 2EFNA 4LJZF 3F9KA 1U5TB 2BY2A 3JCUC 4QLCU 3ZQ7A 4AUXA 3K4MA 2BW3B 1FIPA 2RN7A 5EYRA 3SFZA 3V7CA 3R6SA 3W2VA 3SDGA 3IWZA 2EH3A 3VYTB 3J80K 4BE1A 1MJBA 1RPWA 2X6WA 2X4HA 4F52A 3J81Z 3GZ5A 2I8DA 4E7ZA 4E7KA 1MMNA 1S29A 3QP6A 2VN2A 1R22A 3O8HA 2LRDA 3JRGA 1LVAA 4KFCA 5EJCA 2ZJQF 3HOUJ 3H9GA 3U2RA 2X85A 3PFIA 2EV6A 3IKVA 3BQYA 3ERMA 4DYCA 2JA7J 4KN7X 3FM3A 2KRFA 2OTJI 3DXJF 4IX7A 2QENA 3FXQA 2F4OB 4WCGA 3MAJA 1QHGA 5D4SA 2M34A 2VT3A 1Y1VJ 2BXYA 3FF5A 4OINF 3ZMTA 4NB5A 5L3FA 1REPC 1DQUA 3BC8A 2PQ8A 2IW5A 1T2KA 5BQTA 2EJRA 3K10A 2QQ8A 1MMDA 2WA0A 4IJAA 1RESA 2IXSA 2HYGD 5FLXK 4XOPA 1X3WB 4MGRA 1X19A 2HPMA 1JTYA 5E20A 1WJEA 5JR3A 1S7OA 1QBJA 5FKOA 2PMHA 3WU2C 3ZQFA 3S1NJ 1TW2A 2DK5A 2KT0A 2AQFA 2PBIA 2D2WA 5DCMA 1TBXA 1WHUA 1S72I 1ZREA 4FTHA 2P0WA 2VJ4A 2FNPA 2BYVE 2NNYA 4M9SA 2NVQJ 4A3KJ 1FEXA 3K4BA 4EMSA 3ZMUA 1SFOJ 3K70C 3GTLJ 2YS9A 3E5QA 3RTRA 4YELA 4RLFA 3ZMSA 1IRGA 3C2HA 3PQKA 5GAEJ 3LMMA 1GV5A 3DV8A 1SVMA 3KP6A 2VC0A 2A68F 3BG7A 4M3BA 1GDTA 4XKWA 2ICWG 2K86A 2Q2EB 2ID3A 4KUMA 3M7GA 3L2CA 3IC7A 3U1DA 1TNSA 4B47A 2EV0A 1FSEA 1QZZA 2A5WA 3ASNH 1XSVA 1TWGJ 5F04A 2ZBKA 4BEHA 3JSPA 3BZKA 4Y15A 5K5QA 2G7HA 4GO1A 2XAJA 1E3PA 1TWHJ 1IDZA 4G7HF 2KMUA 5J8CA 2B9SA 2E35A 2P7CB 2VJJA 1YLFA 1U9OA 3F8MA 1STZA 1O3RA 3H5AA 2BZTA 2COBA 2XF5A 1W36C 3RKQA 2W24A 5IP6A 5CVUA 4BE2A 2VLAA 2OZ6A 4HPQA 5FKMA 4A3EJ 2JUGA 1FYMA 3LOCA 3HRSA 2QZ8A 1BR2A 1T8IA 4BEHB 3SDBA 2ME6A 1HF0A 4UUVA 2LMDA 3O6BB 5ILVA 2D1VA 3DBHB 4BGDA 4CGZA 2R5ZA 1FWZA 1HXDA 2HDCA 4BNCA 4UXNA 4HQEA 2MBFA 5F0HA 4E4HA 1FTTA 3H9QA 1FY7A 4OAYA 2HZDA 4I76A 1XGOA 4U0WA 3DWLE 4IHSA 2JSCA 3BTJA 1B9NA 4XKBA 2QKLB 2HWVA 3PNTA 2ZXJA 3NWTA 3VYRB 3BPXA 5IT9Z 2O3FA 2JT1A 2CQ7A 2DJIA 4P1WA 5FFXA 2RVCA 1VQNI 2JPCA 1D1CA 2Y48A 3O3KA 3FX3A 3QU3A 4PUSA 4PJJA 5E17F 2JA2A 2VPRA 1T6SA 1MNDA 4XMYA 1IN8A 2MG4A 1LDJA 1FLIA 2A6EF 3J7AO 2DI3A 1TL8A 2OBPA 2Z99A 3IRQA 3QYBA 2CQNA 3F8FA 3QOEA 2F2EA 5F6FA 1TW3A 3R4KA 1YFHA 4EJWA 5FD5A 4A3JJ 3BCBA 2YU9J 5EEGA 4OIQF 5JHFA 2L9RA 4M9ZA 2ZJ2A 2WAEA 4IRGA 3IH2A 3LNQA 1YS6A 5B1AH 5HLGA 1ORKA 3GTMJ 2E1MB 2K9MA 2W57A 5LLQA 2ISZA 4RMNA 4WXDA 2H09A 2QGUA 1X1CA 2VB6A 2V1UA 2OCEA 4HRIA 3PO3J 2CO5A 3S32A 2MD5A 1SD6A 2BXZA 2H8WA 2LG4A 4W97A 4P5OA 1X1BA 5JVTA 1U2WA 3TEDA 4ZJZA 1OCOH 2IGKA 4IVNA 2AO9A 2OZUA 3CUOA 5TGTA 3H5RA 1N75A 1LFPA 3HEFA 3OYGA 1P2FA 2EZHA 5FGMA 1USTA 4I0BA 4C3HJ 4S05A 1J75A 2KDZA 2ZJRF 4IQJA 1Y0UA 2E2JJ 2WB1N 2XKOA 3W6VA 3Q9VA 2K5CA 5FFZA 3HB9A 3ZQIA 3CP8A 2DMUA 3FK7A 2XSJC 2VE8A 3QPTA 3LWFA 1MMSA 5J40A 1IRFA 4JBAA 4CCLA 4KT6A 2R92J 1QHHD 4MTDA 1H0MA 4C2MJ 1LKXA 2LD5A 3BG5A 3GEZA 1CQTA 3MKYB 5J1RA 2RQPA 3G3ZA 1ONVA 3IH4A 2CYYA 3CMEI 3GFIA 1JXSA 1LPQA 3OYDA 3TOBA 1V5EA 4QTRA 1LE8B 1OCCH 3B6CA 3D0SA 4IXAA 1BR4A 4II2A 1N77A 2E2IJ 2EIMH 3TKYA 5DD4A 4G6QA 4XIDA 1SAXA 3LQRA 3E6DA 3OOUA 3B02A 1LQ1A 1WGXA 2E1CA 4I02A 2R7XA 1EH6A 2UUZA 4BBSJ 1SFXA 3RPUD 3OYHA 2IRFG 2LY1A 3FM5A 4N4OB 1Z6RA 2HDWA 3S17J 3WGHA 2A6HF 1J59A 2KRCA 2EA4A 5LFAA 3GFMA 3HKZN 5F64A 3AFHA 2CGPA 2DQRA 2LBFB 5BMZA 2NRAC 3HGGA 3HTSB 4FHTA 2QBYA 2FEZA 2BVMA 2DMPA 4UUSA 1MMGA 3CCJI 3S1RJ 5BPIA 2XRNA 1VQ4I 3HTUA 2RQQA 3JRAA 3WTXC 1X3UA 1APLC 1OYYA 1Y6IA 4ZH4F 1J5YA 4JQFA 1I50J 3CC2I 1UELB 2R93J 1QVTA 2PN6A 1MJ9A 3D1NI 1SVLA 2MC3A 2ZXWH 3DU5A 3FK6A 1H88C 3FBNB 3V42A 1OYWA 2UV1A 2K27A 4HOBA 5E3LA 4EEFG 1TC3C 1HDPA 3HOXJ 1QZYA 2VC1A 3JRDA 4HZFA 3A1YA 1I5ZA 2K4BA 4NC6A 2IAIA 2QLZA 3A0HC 2EA2A 2XGDA 1XS9A 1GV2A 2F5DA 2FD5A 3HOSA 4CA0A 1R23A 4XLCA 1X4PA 2H1KA 4ABZA 3WHBA 1GT0C 1QPIA 4OIPF 2HNHA 5K7FA 2XGCA 1C0WA 2MLKA 3HHHA 2HQRA 1HOMA 3S3OA 3P9KA 2XF7A 3CZ6A 3CUQB 4LB6B 3DPTA 1T38A 1IZ1A 2ZSIB 3MVPA 4I01A 1WSUA 1DPUA 1BI2A 2R7RA 2F5FA 3HPHA 2MSYA 3TW6A 2EV5A 2CWEA 3MMYB 5HS9A 4B1RA 2Z16A 1HW1A 4C30A 2DPDA 4CHUA 4O6JA 3SEZA 2P7VB 3GF2A 2OD5A 3I56I 2L0KA 3OS2A 1XPXA 3DU6A 2X0LA 3J7AY 1AA7A 4A3IJ 1FP1D 1MKMA 5B1BH 3S2WA 3A03A 4GCVA 4DYQA 1BBYA 2DA6A 4DGWB 2B7EA 3MQ0A 5LHGA 5HLTA 2G7UA 5L3CA 2NS8A 4AWXB 2IEKA 3K1PA 4I09A 2RAEA 5IOYA 4XL9A 3CCLI 2XB5A 4FCYA 2IS4A 1V54H 2K9NA 1ZR2A 2LR8A 3PL8A 4ITVA 2JQ7A 4G8XA 2O61A 1XB4A 5DV5A 3IL2A 2M4GA 2DJNA 3BTLA 4RGUA 2R7FA 3TDZC 5DUIA 2QEXI 1ZGJA 1P4WA 3WG7H 1P6RA 5FB2A 2HXIA 3FKIJ 1TT0A 4H0EA 3LA2A 3BQZA 4J01A 3QWLA 2DN0A 4HNUA 2QA4I 5F0FA 2JSPA 2ZB9A 3EUKL 4X0GA 1L3LA 4P9UA 4G6DA 1BIAA 1R7JA 1WJFA 4FE4A 3QOPA 1YJ9I 1XX5A 1XC5A 1JJ6C 1ZRFA 4MFEA 2XVCA 3G1OA 2XAUA 2FBHA 3KZIC 3U9GA 3C3WA 4U7DA 1QQIA 3HRTA 4BXXJ 3BZ6A 2OQRA 4IRIA 3N97A 4AU7A 1MJAA 2UZKA 4RBOA 3M1CA 2L4AA 2W85A 2RREA 2R5ZB 1TTYA 2NVXJ 1CGPA 2HQNA 1S9HA 2H6CA 3FMRA 4R1HA 5C44J 1JT0A 2DT7B 2CQKA 3JW4A 4M71A 2QKMB 2WADA 4BE0A 2LKXA 6PAXA 5L3DA 4U7BA 5HS7A 4XRFA 1EV7A 3GTOJ 4E7JA 4CYCA 2QYOA 5F27A 2X6XA 5CVVA 5EF6A 3CESA 3O8GA 2Y0MA 4C3IJ 1ZG1A 1UB9A 1WWXA 3GTKJ 1OLTA 2ZXIA 1J09A 3CP2A 2Y9YA 3HKZA 3BTCA 3C2GA 3KLOA 4LD5A 2IA2A 1R4MB 3FZVA 4AIKA 1PVEA 2HFHA 4XLNF 3LSMA 1R00A 2LY2A 4CYCB 2EZKA 1LEAA 3KYLA 3NQOA 1IRXA 2KZVA 2PI0A 4KT5C 4PSWA 3Q0VA 1I3AA 4XN3A 2E19A 2CG4A 3Q0WA 2MABA 2Z3YA 3ZN1A 1ZK8A 1YX5A 2AXTC 1QO0D 3GTGJ 4CCKA 2IGNA 5ICGA 4KYWA 3DKXA 2PMUA 3PSIA 3KEOA 1OJLA 2WAQA 2EFPA 5K5OA 1HC8A 4XORA 5FKNA 5K7HA 3MFKA 2DOFA 1IAWA 3EUHC 3HDDA 1SMTA 1WQ2A 1Z77A 4NQWA 2LF8A 4P9FA 2L3DA 3G1MA 4B4CA 2BHYA 5D5UB 1S8NA 2NOGA 1YTYA 1VQOI 4XKCA 1VQ7I 2F5EA 3CF2A 1WH7A 2HQ5A 3F23A 2VT2A 4B3AA 1AKHA 1ETYA 2COMA 3DPLC 4GDFA 2EINH 1FBQA 4AVZA 1KYWA 2A5YB 1YW8A 2CS3A 3VOEA 3BWGA 1QGPA 4A3CJ 1SMYF 3LL7A 5LEKA 1GXQA 4YRVA 2W7NA 4E7SA 3ISPA 1X2MA 1ZELA 4ZZLA 5FLVA 5ED4A 2HDDA 5EGOB 3A4CA 5BS6A 2IS2A 3BJOA 4E6KG 5HLHA 5FLXZ 2GXBA 1LNWA 2NAZA 2KRHA 1BC7C 2GAUA 1MNMC 1Z6TA 1WZ2A 4FE7A 1K78A 1HSJA 3TBIA 2F4IA 2CSOA 1KGSA 1W0TA 1OCZH 3TGNA 3N4MA 1IC8A 3TL4X 3GTQJ 4XNFA 1WJCA 2R4GA 2VASA 3H92A 5JHUA 2VL8A 2UWMA 2M8EA 4HX4A 1S7EA 2X1DA 2EFQA 2OF7A 2DXIA 3DKWA 2NVTJ 2ACJA 2HVQA 3I64A 1PUFA 2LK2A 5ERIA 5F1RA 3BPVA 4IZZA 1WFXA 1AU7A 2A61A 3OR2C 3QP5A 4IF4A 3IAS2 5IP9J 5L3EA 1O3SA 1I39A 5FKKA 5KAIC 3OIPA 3ZGKA 2C6YA 3JTGA 3MZYA 4UVBA 1J0RA 1XGNA 1TZLA 2JPBA 2L02A 2OAZA 3KP7A 3SZPA 4KIBA 2WTEA 1F1ZA 2VQLA 4LG0B 3FHZA 4A0ZA 2XROA 4RAFA 2HVRA 2XKPA 4BH9A 4F7ZA 4EM2A 1ZG5A 5JVGF 3BG3A 5ILSA 4L9TA 2L7FP 1VNDA 2DA3A 3H35A 5DUKA 4BAYA 3IV5A 1BW5A 3CJRB 3BTIA 1T95A 1KA8A 4Q5SF 4M9XA 4L9NA 3JRIA 1OQYA 2I10A 3JR9A 1VF9A 4CYDA 1K4SA 1MBFA 2CW7A 2DU9A 3M9AA 4M74A 4PFPA 2J5PA 4HNTA 4PK4A 3IH3A 4YFNF 4EM0B 1IN6A 2XC7A 4BY7J 2JUCA 1JUMA 4NC8A 3CCQI 2OA4A 4MNUA 3L09A 3I3LA 3S14J 4H4KC 1SFKA 2GOMA 1S3JA 2H8RA 2HI3A 4RLQA 4GFBA 4KMFA 4D0PA 3VSLA 3W2AA 2ISYA 1SC7A 1ACIA 3MN2A 1VFCA 5C4JJ 5TISC 2K9SA 2MA3A 1JTXA 4HF2A 1V5FA 3BR3A 4Y17A 3CQZJ 3IP4B 3PQJA 3PJRA 2YU3A 2GXAA 2XUBA 3ZN0A 4N0BA 1VQLI 3K4KA 3R61A 5KNLA 3M8JA 3OYKA 5HS8A 4X6AJ 3E5UA 2FBIA 3X2QH 2HYJA 2BY1A 2WAQN 3CCEI 1FTZA 2P5VA 2FX0A 3MKZA 2EFWA 1LDKB 1MBGA 1UMQA 1FBSA 1Z91A 2P6TA 3ZMZA 2E7WA 5E8GA 3AG3H 3SZGA 5B3SH 2VIXA 4NQWB 3COAC 4P55A 3GX4X 3QPHA 1CF7B 4DW6A 3CCYA 2EZLA 2D5VA 4BJTA 1MDMA 3K4CA 4D1QA 3K2ZA 4M6XA 2FXAA 3AG2H 1IN4A 5E1WA 4U87A 4D9JA 2W4SA 3JAMK 2V6CA 5DYMA 4L5IA 3EPZA 1V4RA 1B9MA 3TMOA 3SXYA 2HQAA 2P8TA 3KE2A 2KIMA 3VODA 4BL0B 4DBQA 1RKTA 2JRTA 2E34A 5H6QA 5HDNA 1W4MA 4XRSA 2Y30A 1FC3A 4A6EA 4NUBA 3ESWB 2V9KA 3ZP5A 4FISA 4LIVA 5JI6A 3CCMI 1ZYRF 5FRMA 1YI2I 1FOXA 2WV1A 2Q1ZB 4NC7A 5E1ZB 1X1AA 2VKVA 4LITA 5IYBJ 5GADJ 5CPRB 1JHHA 2R7VA 1BC8C 3ZQQA 2IBDA 2JK3A 3HSEA 3IKTA 1G4DA 2HGCA 2XHKA 3P9IA 2CUFA 2LVSA 2E1NA 2FRHA 2XRLA 2Y69H 3P7NA 3J7YJ 1EH8A 4E70A 1RETA 2KHMA 1W1WE 3QYFA 2XGXA 5ICCA 2JA8J 2ZC2A 3CO7C 1YRNB 3EQLF 2VUMJ 2EIJH 3KP4A 4BBRJ 1MH4A 2IP2A 2O03A 4JX4A 5J4YA 4G12A 3PUFA 3GO5A 2RC4A 2XASA 3I4MJ 1KQ0A 4HV5A 1ETXA 1K6OA 3U1KA 2XGEA 2Y31A 4OIRF 1Z21A 3T5XA 1YIJI 1FOYA 4HQMA 5DCMB 3HYIA 2CH0A 5CKTA 1R9TJ 4A69C 3GTPJ 4YG2F 1IXRC 1H89C 2VKHA 3DP7A 3GZ6A 3OYCA 1RZ4A 2K9LA 4AIDA 2W82A 4N9IA 3E1SA 1IUYA 2Y2ZA 3ONQA 4RM3A 5LRRA 1NTCA 1D1BA 2MLGA 2G0EA 1S7AA 1JKOC 3KZYA 1DGRM 4F93B 2FU4A 1G3WA 1U5TA 4V2FA 4LFUA 5GAHJ 1U5TC 2STTA 4XKVA 2LKSA 3BR5A 3P9CA 4OIOF 3LFUA 2OTLI 2ZFUA 1YOVB 2VONA 1VQ9I 3HIFA 1Z67A 1ON1A 1MZBA 3H3ZA 2VJ5A 4BQQA 1HLVA 2LREA 1G6NA 1VTNC 4A3DJ 3CDIA 1DUXC 3NARA 3CO6C 2O0YA 5D6EA 1OR7C 4B44A 1MW7A 2FMYA 3Q0UA 3WGGA 3QODA 1H8AC 1Z9CA 5D8LB 2A3SA 4B09A 2DK8A 2XDVA 2JN6A 4Y52J 1WPKA 1A6IA 1U3EM 4RGXA 4AM3A 3RZOJ 5CLSA 1PUEE 4UUSB 1KQ8A 4A0YA 4HW0A 1H9TA 4UVCA 1XMKA 2MH9A 4HYEA 4RB1A 5HNFA 1ENHA 3OWTA 2H94A 1YIOA 2L4MA 4X1EA 3RPUA 4XONA 4D7MA 4HDVA 1K61A 1F9NA 1XMXA 4HSTA 3AL0C 3HJEA 3BJAA 1N25A 4F92B 4P96A 5J8FA 5D6FA 4JX5A 1Z1DA 1XG1A 2JRMA 2LFBA 4A12A 4HAMA 1YJWI 2LBFA 2DODA 2HS5A 3GXOA 4ANJA 1ETWA 2J5OA 2HTSA 3KEQA 3S1QJ 1M1EB 3B6AA 2ZNYA 3FIWA 2Z2SB 4AYBN 2W00A 3V8KA 4ZDOA 4AC0A 3RIRA 2M9HA 2L01A 4ENJA 1RNLA 4IO9F 4LMYA 2ZMEB 5IYCJ 4RB3C 1KU7A 2GBYA 2LP0A 3F72A 3QPLA 5DDGA 3OSGA 1QPMA 1UJ8A 3DQVC 2FE3A 3TP3A 5J1UA 1XD7A 1XCBA 2BE5F 4JK1X 1F4KA 2KPMA 3OIQA 4R79A 3E3VA 1RUOA 5HVQC 3DFGA 1TQIA 4HLXA 2RKHA 4MTEA 2N8GA 1JGGA 2WY7Q 1I27A 3VYUB 2IGOA 3IHUA 4RAGA 4XLPF 1SANA 3BR1A 3GLLA 5KK1A 3K9TA 3RJPA 1K78B 4LG3A 4HEA2 3GLXA 4CUGA 3FHNA 2H6BA 4FX4A 2UXNA 2L7KA 3EYYA 3HXLA 4WXCA 2JVHA 2G9WA 2EFOA 2PJPA 4C2TA 4RB2C 1LEBA 1A36A 2W1OA 1IXSB 2K85A 1B59A 3L2UA 3KP2A 1Z7UA 3CCUI 1P7JA 3DTIA 3GMEA 4BDYA 3WGIA 3CTAA 1D1AA 1D0XA 1ZH5A 2MGQA 3WTYC 2JVGA 1AOYA 2IA1A 2BGCA 3H3UA 5D5WB 1VZ0A 3Q3SA 3BT9A 1IRZA 3PNYA 1B4AA 2Y0SN 2BV6A 1Y1WJ 1H9GA 2Q8KA 1KQ9A 4ZYEA 5TJJA 4XBFA 3ABUA 3HPGA 5LHIA 2XAFA 4LOCA 3OS1A 5A2QK 2V9PA 1RR7A 2JZYA 2VBYA 1MBHA 2L9NA 4BS9A 1Y39A 4A3LJ 2A07F 2WAFA 3A0BC 4KMUX 2HPIA 2FOWA 2PMZA 1FZPB 2CJJA 3FXJA 4B3XA 4BJ5C 1ZRCA 1WKMA 1DP3A 1WH5A 2EPFA 1I3QJ 3H5NA 2QQBA 1XCVA 3FMSA 2MC4A 1WI9A 2M30A 5E3OA 1SD7A 2QSGX 1D5YA 1UHSA 2ECBA 3QRFF 2EILH 3BCAA 3WU0A 4NHJA 3QU6A 2CU7A 4M73A 4V19K 2YX7A 3LSIA 2DLLA 1D0YA 4BHCA 4W1UA 3RCOA 4CZZA 1ZQ3P 3AG4H 3ASOH 1TWCJ 3ABMH 2HKXA 4JOMA 5HDGA 2M2EA 4CICA 1IO2A 4PJNA 1K79A 4RS8A 3OR1C 5BPDA 3HSFA 2IS6A 1UFMA 3IUOA 3ZQHA 1T08B 5GPAA 2D45A 2D1HA 1JGSA 5E8IA 5DS9A 3L9FA 3BLYA 1OMIA 3DLAA 4YIRX 4HNVA 4PGGA 4G6TB 4DZJA 2JWTA 2O8XA 2DA7A 3E6MA 3LA7A 2O6GE 2M7AA 2ZMEC 1OR7A 3GVAA 1BI1A 1TLHB 4NBQA 1V5GA 1BL0A 1WJDA 2DYRH 1R5HA 2CUJA 3F8NA 1R5GA 2DDBA 1TWAJ 3DF8A 1PUFB 1F43A 1MD0A 3GUDA 1MBEA 4BQOA 1P7IA 2HU9A 4ZDPA 5JLXA 2YPRA 3ECHA 3OL4A 2BVLA 1ZARA 4XOTA 1W7PD 1BOBA 2L9VA 3CDHA 4KN4X 3A01A 3FBIB 1HA8A 4MQ9F 5GTHC 1DU0A 3CMMA 1IN5A 1B1BA 4KA4A 3K4NA 2ADUA 1E3HA 3ERED 1MIJA 1JUPA 2ELJA 1YHQI 4WXHA 2PG4A 2Y0SA 2K7LA 3S1MJ 2DMNA 3CLQA 4L9VA 1YYVA 2VBWA 3RPQA 4DOZA 1UHWA 3LSTA 2DMQA 3HSRA 3R0AA 1ON2A 1DU6A 1ZG3A 3KYCB 4GYIA 1U6GA 1G59A 1DGWY 1UHMA 1Z7LA 1FOKA 4XSZF 2CMPA 4Y13A 1ZLKA 4LLNA 2L9SA 2VKEA 4MLOA 2HOEA 2DTZA 2YR2A 2F6CA 2HYFA 5EG0B 1U8BA 3HL2A 3TO9A 3OYIA 1QA6A 2KIUA 2ME0A 5CQEA 4AVPA 4E7IA 3CUQC 3LSGA 1IF1A 4HBLA 4EM1A 1ETKA 3D5LA 5B66C 4CH7A 1TP4A 2K02A 3CDLA 1T56A 1X58A 3OYEA 1JKRC 3KZZA 4EQQA 2YUSA 5CVRA 1BI3A 1BOAA 1BJAA 2DFHA 3OS0A 5H6RA 1LJ9A 2CUEA 3SQNA 4K2EA 1MSFC 3FISA 2KDOA 5F0CA 3K7AJ 1ULYA 1IV6A 1GVJA 3F6VA 3TQNA 3WTTC 3E7LA 1ZHFA 1UCRA 2XV4S 5J1YA 5LEJA 2FQ4A 1SEUA 1FJLA 1Y56A 5J3LA 5IPAA 1X1PA 4R8HA 2DA1A 1WI3A 3ZRGA 4JX6A 2FSWA 3W6KB 1NH3A 1QNTA 3MKLA 4CXFA 2VI6A 3AAFA 3S3MA 2X51A 1BN5A 2LLKA 2VQGA 4I99C 1YW9A 1IN7A 3HHGA 3HGYA 4U0YA 4M6VA 5M5YJ 2ZJPF 2ZCWA 3BJ6A 1U9NA 4LK0F 2M3AA 1MH3A 2AQEA 3KLNA 3T8TA 5KHDA 5J4VA 3DKYA 1OPCA 1A5JA 1EKEA 3CMYA 1XGMA 2E36A 4IEJA 2X9DA 2L7MP 2K4JA 4UB8C 1PP7U 5K1YA 4A93J 3CC4I 2R7UA 3G71I 1RC9A 1YJNI 5C3EJ 3ECOA 1ZN2A 2IPQX 5CJ9A 5FLMJ 3GBGA 4ASNA 2QBYB 2DO7A 4B8XA 2RV8A 2DA4A 1O57A 3BOQA 2MD0A 3AL0B 4Q4ZF 5M3MJ 2PFBA 2NXNB 1PP8F 3AG1H 3QQAA 2A05A 3BP8A 2CV0A 4UVAA 1B72A 2K3PA 2IS1A 3OMYA 1P9QC 2KISA 3N05A 3GZNB 3FXRA 5L3GA 2DT5A 2I5UA 5K7ZA 4RAYA 1ZLJA 4RGRA 4Z2YA 3EDPA 5IP7J 1IXCA 1DDNA 3FXKA 4M6YA 3OYMA 2QF7A 4ZTJA 2IGMA 4KITB 2AXLA 2VODA 3JRBA 4MEXF 5EZGA 2CQXA 4IKFA 3T8RA 3BG6A 4A5MA 1MDMB 4MEYF 1LDDA 3RKYA 2HEOA 2RNGA 1ETVA 4LB5A 4FT8A 1ZTRA 3HZJA 4BYYA 4HA8A 4KDPA 1QZEA 2R0QC 3VDXA 1ZAOA 3GYHX 4AIHA 4ZZDA 2K3FA 3E5XA 4ON0A 1Z0XA 2OV7A 2GM4A 4U88A 2M5WA 4I98B 4OOIA 3H3VK 2M0CA 2L5QA 2FOKA 1R71A 4ZYDA 1O3QA 1S6LA 2BBYA 1LFUP 3HG9A 1W7PB 3OYFA 2OCCH 1VQ6I 2GA1A 1O4XA 3J7ZI 2KP6A 3KETA 2P6SA 2NOJB 3OYLA 4G9YA 4D5CA 2GIZA 3I59B 1DP7P 4PJMA 2F4MB 4BKXA 1U8RA 1U78A 2OUMA 2DQLA 4WX9A 3F0CA 2R5YA 4AIJA 3TO7A 2GIVA 1B8IB 3WE2A 1WVRA 3D5RC 2IVMA 1YE9A 5JFRA 5H2FC 5LGNA 3REOA 4EATA 1W7PA 4KIFA 3U21A 1Q1HA 2NS7A 5DD8A 3IRRA 4I6ZA 1RR8C 3ML6A 3VYSB 2E2HJ 5LBQA 5DTDA 1D8KA 2GOXB 2TRTA 3FWEA 3BG9A 4WK8F 1YX3A 4KJZA 3LAPA 3GFLA 3ZMVA 1ERDA 4CZCA 2L54A 2O5RA 3Q5FA 4TV7A 1G3SA 5H20A 3V8JA 1T39A 2H27A 1BW6A 3BZCA 2DA5A 3PIPF 2M0MA 3ZQGA 4A3FJ 5D5XB 1UZCA 2DA2A 2HKOA 4ENNA 2ZXHA 2E5NA 3QYEA 4L5EA 2FF4A 4FETA 4DYRA 4MFDA 3BROA 4EGZA 1Z05A 2A6TA 3HM5A 2ZNZA 4G7ZF 4IOAF 4UHTA 3ROUA 5AONA 2STWA 2CW0F 4EJOA 1LB2A 3QAHA 4IRHA 4CCOA 1R49A 1JKQC 1RKWA 3A02A 2XB0X 1HKTA 4ZTFA 1F5TA 2GWRA 3BR2A 4A3BJ 2FUG2 2FNAA 2KJCA 2VXDA 3C2BA 1QRYA 2EB7A 4YIFA 3RDIA 1IW7F 1J2XA 3I58A 3K4JA 3CMAI 5FO5A 1HW2A 4O5VA 3H0DA 2VE9A 2JMWA 4IHWA 2Z9OA 3M8EA 3ABTA 2EIKH 1A6QA 2NVYJ 4Q48A 3MWMA 2YX4A 5LRSA 1OISA 1TT5B 1KZHA 5DM7F 3I4PA 3HUGB 4JYKA 1Q1VA 1QU3A 2WWYA 2JA6J 1R1TA 3CF5F 2KL4A 1MBKA 3ULQB 2X1EA 1MNEA 1HQCA 3W6JB 2LSOA 4PFOA 3TDUC 4XLEA 2ZSHB 2JJ7A 1ZKGA 1ZR4A 2P5LC 3QPSA 1D5VA 5TRDA 2AHQA 2DMTA 5D4RA 2R3SA 1E3OC 4AYBA 3F8BA 1QVUA 3L2RA 5HODA 1XTAA 4DBRA 3C18A 4G94A 3SFIA 2LC2A 2Y75A 3LSJA 2UXXA 1OCPA 4PGHA 3R60A 2QCOA 4YEJA 4OMYA 4QPQA 2V79A 1VQ5I 9ANTA 2WV0A 3LFKA 2VPLA 3RSNA 3I54A 1XN7A 3E6BA 3T1BA 4XSXF 5BNGA 2CUZA 4L9JA 1N78A 1FYLA 3TO6A 1T98A 3J81K 1JHFA 2FMLA 4JP0A 2FJ1A 2KJBA 2NYXA 3M1EA 3TP0A 1A31A 2PJRB 1BR1A 1T33A 5FD6A 5M5XJ 3ZPLA 2IT0A 3S8PA 5KAFC 3WTSC 3H9JA 1IDYA 4OAZA 3RZDJ 4F3QA 4BXFA 5GPCA 4ZYGA 2ZO4A 4C9YA 2DYSH 1ETOA 1W5SA 4GYGA 2P5KA 5GAGJ 5DM6F 3A01B 1XSDA 4UV9A 4Z6YA 5FJ8J 5CQGA 3WTZA 3I55I 2LF7A 5DEQA 1WRJA 4N9HA 1SD4A 1FBUA 2BW3A 2P81A 3S3NA 2VQHA 4KICA 1IUFA 3S2DJ 2V9VA 4RDUA 3AKZA 3SJMA 3DEUA 2WY8Q 1ITYA 3GTJJ 5M3FJ 2Q0OA 2W84A 1YITI 4EVIA 4PDKA 1CF7A 3B73A 1ETQA 1FX7A 3RYPA 1E0EA 2E7XA 2RNJA 3G2BA 2BEOA 2DT6A 2O9LA 2LNBA 3I53A 4GGGA 5CVIA 3VEPA 2DFFA 2HVSA 2CW8A 2F5VA 4AD9A 2L7ZA 2LH9A 1IV8A 1FIAA 1VQMI 4ZC3A 2X6OA 1G3TA 3NEUA 4YIIA 4CO8A 4OU0A 1LE8A 3HOZJ 3KFWX 2QWWA 3WHCA 1XMAA 4QSHA 2B0LA 1FYKA 1BA5A 1Y8RB 2EK5A 1R6RA 3V4GA 4F91B 1O7FA 2QUFA 2W48A 3K69A 4N4NB 3WE3A 5ICFA 2VJIA 3LSHA 3PIOF 2QQAA 3WU1B 4IQ4A 3HBLA 4WWCA 1MGTA 5KCMA 3BY6A 3ZXSA 2PJRA 4U0VA 1YW7A 3T0YA 2X48A 1BIBA 2GZWA 1NG7A 3K1MA 1SFUA 2QQ9A 4XRMA 1E17A 3FXUA 1D8JA 2AS5F 4UV8A 1KU3A 2OU2A 3E6CC 4IL6C 4YFKF 1EJ9A 1PYVA 4ZDLA 2TDXA 3OYJA 3GW2A 2R7ZJ 4NNJA 5EG0A 3M07A 1YO5C 1IG7A 3LAJA 2ID6A 4PSXA 4IHVA 3UKGA 3ZOBA 4GXOA 3F8CA 1AKHB 2NS0A 5LGTA 3K70D 4I7HA 1GHCA 2M87A 2CRGA 1WJ5A 5F1JA 3L2QA 3RKXA 4DNCA 3I5UA 2WBMA 1T0FA 5EEHA 1P4AA 4MHGA 3LA3A 3MEXA 1JE8A 1LVKA 1UG2A 4BHPA 3CCVI 1R58A 1FP2A 5E79C 1U0JA 2DAOA 3WTUC 2GXGA 2Z33A 2V1XA 2M4KA 1OCTC 1GXPA 1W5CC 3I4NJ 1RRJA 2EZIA 3OOPA 4DJAA 4NDLA 3K6GA 5E3MA 3L7WA 1ZGAA 4WF2A 4CCNA 5FKLA 1MBJA 2OPTA 2LKPA 2NNNA 3E0JB 1IJWC 3FDYA 4MIMA 3H36A 1YS7A 1Y8QB 3K0LA 3HOWJ 2OJED 4D7NA 4J19A 4E7LA 3M3YJ 3PFYA 3ZCOA 1GUUA 4MO7A 4II3A 1KYZA 3J80Z 3JRCA 4C2UA 2V1NA 3FMQA 1YQAA 1SD5A 1JT6A 5C4XJ 2XF6A 2ZKZA 2CV2A 2A69F 2TCTA 1NK2P 1OKRA 4E7HA 1SAUA 2MW8A 3RQ4A 2OQGA 3LQQA 4L18B 4HV6A 3SZTA 5IYDJ 1KONA 2ESHA 3JRFA 3HOVJ 3CJNA 4D5FA 3VSKA 5A2QZ 1O3TA 4RM2A 2VXZA 4G7OF 2R7DA 3ABKH 4RAZA 1V55H 3GCMA 1XGSA 2R7TA 2LYCA 4QIWN 2HR3A 4L0ZB 1YG2A 4ESJA 1AWCA 1PJRA 1MSEC 4FASD 4XN0A 4PJLA 1JJ8C 2WB1A 2XAGA 2FBKA 3C1DA 4PZJA 3I0TA 2B63J 4Y7NJ 2L2OA 4QWQA 5ICEA 5D8KB 2X6YA 2CFOA 2XAHA 3KP5A 4Y3OA 2VBZA 3UNGC 5J47A 3M4OJ 2HXOA 2KLOA 4FX0A 4ENKA 3DTKA 3Q9SA 2V6EA 2YSRA 4I2OA 4KIGA 2V1DA 5BOXA 1FSHA 1FPQA 5HDKA 4IPAA 2VBXA 3GFJA 1P92A 3I9V2 3KEYA 2QVOA 4ENMA 2HOSA 1D3YA 2KQRA 4M3DA 3SHFA 1HDDC 3MZ8A 4HF1A 4BQNA 4OWRB 3CJQB 5EEAA 1HKSA 2DCEA 2E5ZA 1P4XA 3H0GJ 1USSA 1J7KA 2K9QA 3L00A 3PO2J 2V26A 2MH2A 1FMWA 3K2AA 3ELKA 3PM1A 3OY9A 2PX9A 3DTEA 4UY8I 1SFEA 4QPOA 2PEXA 3TW7A 3G73A 4BQAA 3UR3C 1RUNA 5FRNA 3WG9A 1HSTA 1XSXA 2M7BA 3VPRA 5EDNA 2KIQA 2BY3A 4CCMA 1JI8A 3HC7A 2XSDC 2BY0A 2JA5J 4B48A 4BHBA 1X2NA 3JSOA 3DEEA 4RB0A 4B43A 2PMZN 1TWFJ 4XLAA 3G1LA 2P4WA 3A2KA 1XDSA 1ODDA 2JTVA 4Q47A 2O7OA 3TOAA 5E3NA 1HBXG 4ESFA 4MQVA 3CCSI 5FROA 5LD2C 3JAMZ 3LSRA 1POGA 2H1LA 2E71A 4A6DA 4F55A 5IY5H 1VQ8I 1A35A 5EGOA 3SEQA 4CSWA 4LLLA 1G2HA 1BI0A 1K6YA 2DW4A 1R36A 1EA3A 5E18F 3RYRA 2HOTA 4S0HB 1YRNA 1S5LC 4EJVA 1G3YA 4HLYA 3ZQCA 1BM9A 1D0ZA 3KYDB 4XM3A 2EQRA 2XAQA 4HX8A 1W36D 3CD6I 3MKWB 3FXMA 1W0UA 3LSKA 2E1OA 3KCCA 3RKWA 2V7FA 3DEWA 1X1DA 3D5SC 2ELHA 2HTJA 2DDAA 2CQQA 1NK3P 3FKJA 2E1MC 5LHHA 3R0JA 4EJUA 1GVDA 4M3FA 2DTRA 3JRHA 3O2PE 2Q2EA 5HOOA 2M8GX 1WCMJ 2R7OA 2EWNA 1I1SA 3FXLA 3MCZA 3CJTB 4UB6C 4XLHA 3HRMA 4ZYAA 2KZGA 1R1VA 3L2VA 4KNYA 5E1XA 4BJ6C 2RGVA 3G4SI 3DBLB 1MMAA 4XK4A 4DZPA 1B8IA 2KFDA 4A3GJ 2EBIA 1KU2A 2R5YB 2ESNA 3OYBA 2M45A 2M1BA 4HDUA 1RI7A 5J6XA 4YFXF 1O7LA 3LSPA 2KKOA 3S93A 1J9IA 2DOEA 1UG0A 2BHZA 4CDGA 1PDNC 1TQMA 2HZTA 2LTPA 4M3EA 1RIOH 2XPWA 2XPVA 1VQPI 4ESBA 2NVUB 3NAUA 4XQFA 3KX2A 5IT3A 1KU9A 3F6OA 4XLFA 3GWZA 1A04A 3BR0A 1OCRH 5K5RA 5AIPA 3W3CA 3P5JA 3M8FA 1OYIA 3ABLH 3VB2A 4A5NA 5F08A 1K83J 1JKPC 3BDDA 5JLWA 2K40A 3W2WA 2R7QA 2VKDA 5IT9K 1NG6A 5DCFA 2OC6A 5IOZA 2XIGA 1VI0A 3MZHA 3L1PA 3H1CA 2Z5UA 1VQKI 4CCJA 5EZHA 1SVOA 4LG0A 3NRVA 4S04A 4C3JJ 3C7JA
chains in the Genus database with same CATH topology
3WHBA 1GT0C 1QPIA 3Q0UA 5K7FA 1H8AC 4XRSG 2XGCA 3HM5A 4M3GA 1JKQC 2JN6A 4Y52J 1HOMA 1WPKA 1RKWA 1A6IA 3A02A 2XB0X 3RZOJ 4UUSB 3BR2A 2XPUA 1B72B 4A3BJ 3C2BA 1QRYA 3MVPA 3S15J 3JREA 1ZGWA 2MSYA 2JMWA 3TW6A 4IHWA 1JUSA 4B1RA 1ENHA 2HOAA 2NVYJ 4X1EA 3S16J 2L0KA 4D7MA 1K61A 4A3IJ 3ZQLA 4JYKA 1Q1VA 3A03A 4JX5A 3OSFA 2JA6J 1XG1A 3DCFA 1MBKA 2LFBA 4DYQA 2DA6A 4BY1J 2NS8A 1ETWA 2ECCA 2IEKA 2JJ7A 1ZKGA 2RAEA 1ZR4A 5IOYA 1I6HJ 3S1QJ 2O8KA 2XB5A 4FCYA 3B6AA 3QPSA 3RQIA 2K9NA 3FIWA 2LR8A 1ZR2A 2AHQA 2DMTA 1E3OC 4AYBN 4IHXA 1QVUA 2DJNA 3BTLA 4AC0A 5HODA 2M9HA 3HOYJ 3SFIA 3LSJA 5IYCJ 1F36A 2GBYA 1OCPA 2HXIA 2LP0A 3FKIJ 2QCOA 3QPLA 3OSGA 3BQZA 3OIOA 2DN0A 5J1UA 3TP3A 9ANTA 5F0FA 1BJZA 2ZB9A 3BR6A 4FE4A 2N8GA 1EF4A 5BNGA 1JGGA 1AHDP 1XC5A 4A3MJ 1JJ6C 4MFEA 5M5WJ 1SANA 3BR1A 4JP0A 3G1OA 2FJ1A 3TP0A 5M5XJ 1T33A 5GP9A 4BXXJ 4UUTA 3S2HJ 4RBOA 1IDYA 2R5ZB 3RZDJ 4V2GA 5GPCA 1P7JA 2NVXJ 1ETOA 3A01B 2GLOA 5FJ8J 1OFCX 2MGQA 5C44J 1JT0A 3Q3SA 3BT9A 2P81A 1LFBA 1IRZA 2LY9A 1IUFA 2LKXA 3S2DJ 2Y0SN 4RDUA 3GTOJ 3SJMA 1ITYA 3GTJJ 5M3FJ 1Y1WJ 4CYCA 5F27A 4XICA 4IHYA 4LOCA 1ETQA 5EF6A 1RR7A 3O8GA 1MBHA 4C3IJ 1IGNA 2O9LA 3GTKJ 4A3LJ 2ELKA 2Y9ZA 2Y9YA 1HCRA 3BTCA 2CJJA 4CYCB 2L7ZA 1WH5A 2EZKA 1I3QJ 4AUXA 1FIAA 1FIPA 5EYRA 3Q0VA 3SDGA 2X6OA 2EH3A 2E19A 3HOZJ 3Q0WA 5E3OA 1LE8A 1RPWA 1D5YA 3WHCA 1UHSA 1ZK8A 2ECBA 4QSHA 3GTGJ 1BA5A 2CU7A 2W48A 1OJLA 4W1UA 1ZQ3P 3O8HA 3JRGA 5FKNA 5K7HA 3HBLA 1TWCJ 3HDDA 3HOUJ 2M2EA 1Z77A 3BQYA 2X48A 4DYCA 2JA7J 4B4CA 3G1MA 4XRMA 2NOGA 1WH7A 2HQ5A 4B3AA 1AKHA 3ZQHA 1ETYA 2M34A 1Y1VJ 5GPAA 2R7ZJ 5DS9A 5EG0A 1IG7A 4A3CJ 2ID6A 1RESA 3UKGA 4IHVA 4HNVA 3ZOBA 1AKHB 1X2MA 4DZJA 5FLVA 1JTYA 2HDDA 5EGOB 2CRGA 5F1JA 2JWTA 2DA7A 5FKOA 3ZQFA 3S1NJ 1BL0A 2KT0A 1PUFB 1TWAJ 1MNMC 1F43A 4FE7A 1MBEA 1UG2A 1P7IA 4FTHA 5JLXA 1W0TA 1IC8A 1OCTC 3I4NJ 2NVQJ 4A3KJ 3GTQJ 1FEXA 2EZIA 3A01A 1SFOJ 3GTLJ 2YS9A 4NDLA 5E3MA 1DU0A 5FKLA 1MBJA 1S7EA 2OPTA 2OF7A 1GV5A 1JUPA 2NVTJ 1IJWC 1PUFA 4M3BA 1GDTA 2LK2A 2ID3A 3S1MJ 1AU7A 2DMNA 4MIMA 5IP9J 3HOWJ 5F04A 1TWGJ 4D7NA 2DMQA 4J19A 3M3YJ 1DU6A 1GUUA 5FKKA 4MO7A 1TWHJ 3JRCA 1IDZA 1JT6A 2VKEA 5C4XJ 4MLOA 2DTZA 1U9OA 5EG0B 2TCTA 1U8BA 1NK2P 2ME0A 2MW8A 2COBA 3LSGA 3RKQA 5IP6A 5IYDJ 1ETKA 3JRFA 3HOVJ 4D5FA 5FKMA 4A3EJ 3BG3A 3LOCA 2L7FP 3CDLA 2ME6A 1HF0A 1T56A 1X58A 4QIWN 1VNDA 2DA3A 1JKRC 3IV5A 2YUSA 2R5ZA 1BW5A 3BTIA 2CUEA 1MSEC 3JRIA 2I10A 5F0HA 3JR9A 1FTTA 1VF9A 1JJ8C 3FISA 1MSFC 1MBFA 5F0CA 3K7AJ 3IH3A 1IV6A 2B63J 4Y7NJ 3E7LA 4BY7J 1JUMA 4I76A 5J1YA 3M4OJ 3S14J 2FQ4A 2HXOA 3BTJA 1FJLA 2H8RA 5J3LA 5IPAA 2HI3A 4GFBA 2DA1A 1WI3A 4JX6A 3MN2A 3MKLA 2HOSA 1VFCA 2VI6A 5C4JJ 2K9SA 4M3DA 1HDDC 1JTXA 2VPRA 2LLKA 2MG4A 3BR3A 5EEAA 3HGYA 4M6VA 3CQZJ 5M5YJ 1U9NA 2K9QA 3H0GJ 3PO2J 1MH3A 4X6AJ 3K2AA 2HYJA 3PM1A 2WAQN 4A3JJ 2YU9J 1A5JA 1FTZA 3CMYA 2FX0A 2L9RA 3TW7A 4IEJA 2X9DA 1MBGA 2L7MP 4A93J 3VPRA 3IH2A 3LNQA 5EDNA 1UMQA 1ORKA 5C3EJ 3GTMJ 2XSDC 5FLMJ 3GBGA 2JA5J 1X2NA 2DA4A 4DW6A 5M3MJ 3CCYA 2PMZN 1TWFJ 3G1LA 2EZLA 2D5VA 3PO3J 2O7OA 3QQAA 5E3NA 3TEDA 4W97A 1B72A 3LSRA 1POGA 2AO9A 5EGOA 1RKTA 3HEFA 1G2HA 5K7ZA 4XRSA 2Y30A 2EZHA 5IP7J 4C3HJ 2HOTA 4S0HB 2KDZA 1YRNA 2QF7A 4FISA 2E2JJ 2WB1N 3JRBA 3ZQCA 5EZGA 3W6VA 2CQXA 2WV1A 2EQRA 3HB9A 3ZQIA 2DMUA 3FK7A 2VKVA 1ETVA 5IYBJ 1W0UA 1ZTRA 2E1OA 2R92J 3DEWA 2IBDA 2JK3A 4C2MJ 2LD5A 3BG5A 1CQTA 2CUFA 2CQQA 2LVSA 2R0QC 1NK3P 5J1RA 3IH4A 1GVDA 2XRLA 4M3FA 3JRHA 4QTRA 1RETA 1Z0XA 1LE8B 3B6CA 2GM4A 2E2IJ 2M8GX 1WCMJ 4XIDA 2JA8J 3H3VK 2M0CA 3OOUA 1YRNB 2VUMJ 4BBRJ 1MH4A 4JX4A 1WGXA 1LFUP 4G12A 1O4XA 4BBSJ 4XK4A 4DZPA 3I4MJ 1B8IA 4A3GJ 2EBIA 1ETXA 2R5YB 2XGEA 2Y31A 3S17J 3LSPA 3HKZN 4D5CA 1R9TJ 4A69C 3GTPJ 4BKXA 1U78A 1H89C 4M3EA 2LTPA 3HGGA 3F0CA 2XPWA 2R5YA 2XPVA 1B8IB 2DMPA 4UUSA 3NAUA 2Y2ZA 3S1RJ 3BR0A 1NTCA 2G0EA 3JRAA 1JKOC 2NS7A 4I6ZA 1APLC 1I50J 2E2HJ 2R93J 1QVTA 5DTDA 3D1NI 2TRTA 1K83J 5F08A 1JKPC 3BG9A 3FK6A 4V2FA 5JLWA 1H88C 2K40A 3BR5A 5E3LA 4EEFG 1TC3C 1HDPA 5IOZA 3HOXJ 1BW6A 2DA5A 3JRDA 1VI0A 2IAIA 3ZQGA 4A3FJ 3L1PA 2DA2A 1HLVA 2XGDA 1XS9A 4A3DJ 1GV2A 2FD5A 4L5EA 5EZHA 3NARA 4DYRA 2H1KA 4MFDA 4C3JJ 4ABZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WHB A;  1GT0 C;  1QPI A;  3Q0U A;  5K7F A;  1H8A C;  4XRS G;  2XGC A;  3HM5 A;  4M3G A;  1JKQ C;  2JN6 A;  4Y52 J;  1HOM A;  1WPK A;  1RKW A;  1A6I A;  3A02 A;  2XB0 X;  3RZO J;  4UUS B;  3BR2 A;  2XPU A;  1B72 B;  4A3B J;  3C2B A;  1QRY A;  3MVP A;  3S15 J;  3JRE A;  1ZGW A;  2MSY A;  2JMW A;  3TW6 A;  4IHW A;  1JUS A;  4B1R A;  1ENH A;  2HOA A;  2NVY J;  4X1E A;  3S16 J;  2L0K A;  4D7M A;  1K61 A;  4A3I J;  3ZQL A;  4JYK A;  1Q1V A;  3A03 A;  4JX5 A;  3OSF A;  2JA6 J;  1XG1 A;  3DCF A;  1MBK A;  2LFB A;  4DYQ A;  2DA6 A;  4BY1 J;  2NS8 A;  1ETW A;  2ECC A;  2IEK A;  2JJ7 A;  1ZKG A;  2RAE A;  1ZR4 A;  5IOY A;  1I6H J;  3S1Q J;  2O8K A;  2XB5 A;  4FCY A;  3B6A A;  3QPS A;  3RQI A;  2K9N A;  3FIW A;  2LR8 A;  1ZR2 A;  2AHQ A;  2DMT A;  1E3O C;  4AYB N;  4IHX A;  1QVU A;  2DJN A;  3BTL A;  4AC0 A;  5HOD A;  2M9H A;  3HOY J;  3SFI A;  3LSJ A;  5IYC J;  1F36 A;  2GBY A;  1OCP A;  2HXI A;  2LP0 A;  3FKI J;  2QCO A;  3QPL A;  3OSG A;  3BQZ A;  3OIO A;  2DN0 A;  5J1U A;  3TP3 A;  9ANT A;  5F0F A;  1BJZ A;  2ZB9 A;  3BR6 A;  4FE4 A;  2N8G A;  1EF4 A;  5BNG A;  1JGG A;  1AHD P;  1XC5 A;  4A3M J;  1JJ6 C;  4MFE A;  5M5W J;  1SAN A;  3BR1 A;  4JP0 A;  3G1O A;  2FJ1 A;  3TP0 A;  5M5X J;  1T33 A;  5GP9 A;  4BXX J;  4UUT A;  3S2H J;  4RBO A;  1IDY A;  2R5Z B;  3RZD J;  4V2G A;  5GPC A;  1P7J A;  2NVX J;  1ETO A;  3A01 B;  2GLO A;  5FJ8 J;  1OFC X;  2MGQ A;  5C44 J;  1JT0 A;  3Q3S A;  3BT9 A;  2P81 A;  1LFB A;  1IRZ A;  2LY9 A;  1IUF A;  2LKX A;  3S2D J;  2Y0S N;  4RDU A;  3GTO J;  3SJM A;  1ITY A;  3GTJ J;  5M3F J;  1Y1W J;  4CYC A;  5F27 A;  4XIC A;  4IHY A;  4LOC A;  1ETQ A;  5EF6 A;  1RR7 A;  3O8G A;  1MBH A;  4C3I J;  1IGN A;  2O9L A;  3GTK J;  4A3L J;  2ELK A;  2Y9Z A;  2Y9Y A;  1HCR A;  3BTC A;  2CJJ A;  4CYC B;  2L7Z A;  1WH5 A;  2EZK A;  1I3Q J;  4AUX A;  1FIA A;  1FIP A;  5EYR A;  3Q0V A;  3SDG A;  2X6O A;  2EH3 A;  2E19 A;  3HOZ J;  3Q0W A;  5E3O A;  1LE8 A;  1RPW A;  1D5Y A;  3WHC A;  1UHS A;  1ZK8 A;  2ECB A;  4QSH A;  3GTG J;  1BA5 A;  2CU7 A;  2W48 A;  1OJL A;  4W1U A;  1ZQ3 P;  3O8H A;  3JRG A;  5FKN A;  5K7H A;  3HBL A;  1TWC J;  3HDD A;  3HOU J;  2M2E A;  1Z77 A;  3BQY A;  2X48 A;  4DYC A;  2JA7 J;  4B4C A;  3G1M A;  4XRM A;  2NOG A;  1WH7 A;  2HQ5 A;  4B3A A;  1AKH A;  3ZQH A;  1ETY A;  2M34 A;  1Y1V J;  5GPA A;  2R7Z J;  5DS9 A;  5EG0 A;  1IG7 A;  4A3C J;  2ID6 A;  1RES A;  3UKG A;  4IHV A;  4HNV A;  3ZOB A;  1AKH B;  1X2M A;  4DZJ A;  5FLV A;  1JTY A;  2HDD A;  5EGO B;  2CRG A;  5F1J A;  2JWT A;  2DA7 A;  5FKO A;  3ZQF A;  3S1N J;  1BL0 A;  2KT0 A;  1PUF B;  1TWA J;  1MNM C;  1F43 A;  4FE7 A;  1MBE A;  1UG2 A;  1P7I A;  4FTH A;  5JLX A;  1W0T A;  1IC8 A;  1OCT C;  3I4N J;  2NVQ J;  4A3K J;  3GTQ J;  1FEX A;  2EZI A;  3A01 A;  1SFO J;  3GTL J;  2YS9 A;  4NDL A;  5E3M A;  1DU0 A;  5FKL A;  1MBJ A;  1S7E A;  2OPT A;  2OF7 A;  1GV5 A;  1JUP A;  2NVT J;  1IJW C;  1PUF A;  4M3B A;  1GDT A;  2LK2 A;  2ID3 A;  3S1M J;  1AU7 A;  2DMN A;  4MIM A;  5IP9 J;  3HOW J;  5F04 A;  1TWG J;  4D7N A;  2DMQ A;  4J19 A;  3M3Y J;  1DU6 A;  1GUU A;  5FKK A;  4MO7 A;  1TWH J;  3JRC A;  1IDZ A;  1JT6 A;  2VKE A;  5C4X J;  4MLO A;  2DTZ A;  1U9O A;  5EG0 B;  2TCT A;  1U8B A;  1NK2 P;  2ME0 A;  2MW8 A;  2COB A;  3LSG A;  3RKQ A;  5IP6 A;  5IYD J;  1ETK A;  3JRF A;  3HOV J;  4D5F A;  5FKM A;  4A3E J;  3BG3 A;  3LOC A;  2L7F P;  3CDL A;  2ME6 A;  1HF0 A;  1T56 A;  1X58 A;  4QIW N;  1VND A;  2DA3 A;  1JKR C;  3IV5 A;  2YUS A;  2R5Z A;  1BW5 A;  3BTI A;  2CUE A;  1MSE C;  3JRI A;  2I10 A;  5F0H A;  3JR9 A;  1FTT A;  1VF9 A;  1JJ8 C;  3FIS A;  1MSF C;  1MBF A;  5F0C A;  3K7A J;  3IH3 A;  1IV6 A;  2B63 J;  4Y7N J;  3E7L A;  4BY7 J;  1JUM A;  4I76 A;  5J1Y A;  3M4O J;  3S14 J;  2FQ4 A;  2HXO A;  3BTJ A;  1FJL A;  2H8R A;  5J3L A;  5IPA A;  2HI3 A;  4GFB A;  2DA1 A;  1WI3 A;  4JX6 A;  3MN2 A;  3MKL A;  2HOS A;  1VFC A;  2VI6 A;  5C4J J;  2K9S A;  4M3D A;  1HDD C;  1JTX A;  2VPR A;  2LLK A;  2MG4 A;  3BR3 A;  5EEA A;  3HGY A;  4M6V A;  3CQZ J;  5M5Y J;  1U9N A;  2K9Q A;  3H0G J;  3PO2 J;  1MH3 A;  4X6A J;  3K2A A;  2HYJ A;  3PM1 A;  2WAQ N;  4A3J J;  2YU9 J;  1A5J A;  1FTZ A;  3CMY A;  2FX0 A;  2L9R A;  3TW7 A;  4IEJ A;  2X9D A;  1MBG A;  2L7M P;  4A93 J;  3VPR A;  3IH2 A;  3LNQ A;  5EDN A;  1UMQ A;  1ORK A;  5C3E J;  3GTM J;  2XSD C;  5FLM J;  3GBG A;  2JA5 J;  1X2N A;  2DA4 A;  4DW6 A;  5M3M J;  3CCY A;  2PMZ N;  1TWF J;  3G1L A;  2EZL A;  2D5V A;  3PO3 J;  2O7O A;  3QQA A;  5E3N A;  3TED A;  4W97 A;  1B72 A;  3LSR A;  1POG A;  2AO9 A;  5EGO A;  1RKT A;  3HEF A;  1G2H A;  5K7Z A;  4XRS A;  2Y30 A;  2EZH A;  5IP7 J;  4C3H J;  2HOT A;  4S0H B;  2KDZ A;  1YRN A;  2QF7 A;  4FIS A;  2E2J J;  2WB1 N;  3JRB A;  3ZQC A;  5EZG A;  3W6V A;  2CQX A;  2WV1 A;  2EQR A;  3HB9 A;  3ZQI A;  2DMU A;  3FK7 A;  2VKV A;  1ETV A;  5IYB J;  1W0U A;  1ZTR A;  2E1O A;  2R92 J;  3DEW A;  2IBD A;  2JK3 A;  4C2M J;  2LD5 A;  3BG5 A;  1CQT A;  2CUF A;  2CQQ A;  2LVS A;  2R0Q C;  1NK3 P;  5J1R A;  3IH4 A;  1GVD A;  2XRL A;  4M3F A;  3JRH A;  4QTR A;  1RET A;  1Z0X A;  1LE8 B;  3B6C A;  2GM4 A;  2E2I J;  2M8G X;  1WCM J;  4XID A;  2JA8 J;  3H3V K;  2M0C A;  3OOU A;  1YRN B;  2VUM J;  4BBR J;  1MH4 A;  4JX4 A;  1WGX A;  1LFU P;  4G12 A;  1O4X A;  4BBS J;  4XK4 A;  4DZP A;  3I4M J;  1B8I A;  4A3G J;  2EBI A;  1ETX A;  2R5Y B;  2XGE A;  2Y31 A;  3S17 J;  3LSP A;  3HKZ N;  4D5C A;  1R9T J;  4A69 C;  3GTP J;  4BKX A;  1U78 A;  1H89 C;  4M3E A;  2LTP A;  3HGG A;  3F0C A;  2XPW A;  2R5Y A;  2XPV A;  1B8I B;  2DMP A;  4UUS A;  3NAU A;  2Y2Z A;  3S1R J;  3BR0 A;  1NTC A;  2G0E A;  3JRA A;  1JKO C;  2NS7 A;  4I6Z A;  1APL C;  1I50 J;  2E2H J;  2R93 J;  1QVT A;  5DTD A;  3D1N I;  2TRT A;  1K83 J;  5F08 A;  1JKP C;  3BG9 A;  3FK6 A;  4V2F A;  5JLW A;  1H88 C;  2K40 A;  3BR5 A;  5E3L A;  4EEF G;  1TC3 C;  1HDP A;  5IOZ A;  3HOX J;  1BW6 A;  2DA5 A;  3JRD A;  1VI0 A;  2IAI A;  3ZQG A;  4A3F J;  3L1P A;  2DA2 A;  1HLV A;  2XGD A;  1XS9 A;  4A3D J;  1GV2 A;  2FD5 A;  4L5E A;  5EZH A;  3NAR A;  4DYR A;  2H1K A;  4MFD A;  4C3J J;  4ABZ A; 
#chains in the Genus database with same CATH topology
 2RDP A;  4DIQ A;  3EYI A;  3NWS A;  2X1C A;  4XRS G;  3RI4 A;  4Y4R A;  4O3M A;  1V3F A;  4M3G A;  3K4L A;  2R7W A;  3PNV A;  4IOC F;  4A2U A;  1HW5 A;  3F3X A;  3F21 A;  3IWF A;  1B72 B;  2XPU A;  4PJ0 C;  3F22 A;  2GA2 A;  3VFZ A;  3S15 J;  1L0O C;  3I71 A;  3K1N A;  1I1G A;  3ZR8 X;  3JRE A;  1R4N B;  1ZGW A;  3I59 A;  4A0X A;  1JUS A;  5CYV A;  2WC2 A;  4DQ2 A;  1FOW A;  3CUQ A;  3CC7 I;  4EJT A;  2HOA A;  3S16 J;  4L5J A;  5D5V B;  4Y33 A;  3DPU A;  2VQC A;  3PSF A;  5KVR A;  3WTW C;  3ZQL A;  4LGW A;  3OYA A;  3EUH A;  1K7A A;  4M72 A;  1HKQ A;  3OSF A;  2PLY A;  3DCF A;  1UAA A;  3IAM 2;  2DFI A;  2VOP A;  3CCR I;  1R1U A;  4PCQ A;  4EGY A;  1EH7 A;  4BY1 J;  2ECC A;  3HUG A;  3HRU A;  1FNN A;  1X3Z B;  3EET A;  1FMV A;  3KPH A;  4FQG A;  1I6H J;  1K4T A;  2O8K A;  2ZME A;  3V7S A;  2FQ3 A;  2GQQ A;  3RQI A;  4IHX A;  1B6A A;  1W5T A;  1XDU A;  3KIO A;  5ILU A;  5L3B A;  3HOY J;  1GLN A;  2QSH X;  2Z1D A;  3VWB A;  3V7R A;  2VOO A;  1F36 A;  3G6E I;  2IJL A;  3KP3 A;  3DLL F;  2IA0 A;  3JTH A;  1G8X A;  1DPR A;  1Z3X A;  3OIO A;  3OL3 A;  4RA2 A;  4BAC A;  5CVJ A;  1NHA A;  1BJZ A;  2F48 A;  1TNT A;  2FA5 A;  4EV0 A;  3FXO A;  2LDU A;  3BR6 A;  1X4O A;  3CLO A;  2DFE A;  1EF4 A;  4HX7 A;  1AHD P;  2W25 A;  4A3M J;  5B5E C;  5LGU A;  1T0F C;  1LUJ B;  5M5W J;  4IHT A;  3L2W A;  4ETS A;  4LLG F;  3PUB A;  4HF0 A;  2F5C A;  5GP9 A;  4I0A A;  3WTV C;  3E97 A;  2ZFW A;  4UUT A;  1E2X A;  2DOA A;  4RGS A;  1ZRD A;  3OV8 A;  3S2H J;  3HOT A;  4OMZ A;  4GRI A;  1Y0N A;  5HNH A;  4V2G A;  2DPU A;  1R5I D;  4BDZ A;  1TQP A;  2GLO A;  3ZMD A;  1OFC X;  2V4J C;  1WJB A;  2DBB A;  4LK1 F;  4BU2 A;  4HG2 A;  2KIF A;  1LFB A;  5AIQ A;  2LY9 A;  5GTI C;  2ETH A;  4BXU A;  3MD2 A;  4XR6 A;  4HSR A;  2E60 A;  2MYS A;  4BUP A;  2BOL A;  3SYT A;  3DBR B;  4ZYH A;  2MFZ A;  4XIC A;  4IHY A;  2R7S A;  1Z3Y A;  2CFX A;  1IGN A;  2QM3 A;  3WOD F;  2CV1 A;  1WJA A;  3V8L A;  4LIU A;  2ELK A;  2Y9Z A;  4J00 A;  1HCR A;  3EUA A;  1FT9 A;  4L0Y B;  4KIS A;  2QSF X;  4UNO A;  3OYN A;  1I6X A;  5HLI A;  2LOO A;  2EFN A;  4LJZ F;  3F9K A;  1U5T B;  2BY2 A;  3JCU C;  4QLC U;  3ZQ7 A;  4AUX A;  3K4M A;  2BW3 B;  1FIP A;  2RN7 A;  5EYR A;  3SFZ A;  3V7C A;  3R6S A;  3W2V A;  3SDG A;  3IWZ A;  2EH3 A;  3VYT B;  3J80 K;  4BE1 A;  1MJB A;  1RPW A;  2X6W A;  2X4H A;  4F52 A;  3J81 Z;  3GZ5 A;  2I8D A;  4E7Z A;  4E7K A;  1MMN A;  1S29 A;  3QP6 A;  2VN2 A;  1R22 A;  3O8H A;  2LRD A;  3JRG A;  1LVA A;  4KFC A;  5EJC A;  2ZJQ F;  3HOU J;  3H9G A;  3U2R A;  2X85 A;  3PFI A;  2EV6 A;  3IKV A;  3BQY A;  3ERM A;  4DYC A;  2JA7 J;  4KN7 X;  3FM3 A;  2KRF A;  2OTJ I;  3DXJ F;  4IX7 A;  2QEN A;  3FXQ A;  2F4O B;  4WCG A;  3MAJ A;  1QHG A;  5D4S A;  2M34 A;  2VT3 A;  1Y1V J;  2BXY A;  3FF5 A;  4OIN F;  3ZMT A;  4NB5 A;  5L3F A;  1REP C;  1DQU A;  3BC8 A;  2PQ8 A;  2IW5 A;  1T2K A;  5BQT A;  2EJR A;  3K10 A;  2QQ8 A;  1MMD A;  2WA0 A;  4IJA A;  1RES A;  2IXS A;  2HYG D;  5FLX K;  4XOP A;  1X3W B;  4MGR A;  1X19 A;  2HPM A;  1JTY A;  5E20 A;  1WJE A;  5JR3 A;  1S7O A;  1QBJ A;  5FKO A;  2PMH A;  3WU2 C;  3ZQF A;  3S1N J;  1TW2 A;  2DK5 A;  2KT0 A;  2AQF A;  2PBI A;  2D2W A;  5DCM A;  1TBX A;  1WHU A;  1S72 I;  1ZRE A;  4FTH A;  2P0W A;  2VJ4 A;  2FNP A;  2BYV E;  2NNY A;  4M9S A;  2NVQ J;  4A3K J;  1FEX A;  3K4B A;  4EMS A;  3ZMU A;  1SFO J;  3K70 C;  3GTL J;  2YS9 A;  3E5Q A;  3RTR A;  4YEL A;  4RLF A;  3ZMS A;  1IRG A;  3C2H A;  3PQK A;  5GAE J;  3LMM A;  1GV5 A;  3DV8 A;  1SVM A;  3KP6 A;  2VC0 A;  2A68 F;  3BG7 A;  4M3B A;  1GDT A;  4XKW A;  2ICW G;  2K86 A;  2Q2E B;  2ID3 A;  4KUM A;  3M7G A;  3L2C A;  3IC7 A;  3U1D A;  1TNS A;  4B47 A;  2EV0 A;  1FSE A;  1QZZ A;  2A5W A;  3ASN H;  1XSV A;  1TWG J;  5F04 A;  2ZBK A;  4BEH A;  3JSP A;  3BZK A;  4Y15 A;  5K5Q A;  2G7H A;  4GO1 A;  2XAJ A;  1E3P A;  1TWH J;  1IDZ A;  4G7H F;  2KMU A;  5J8C A;  2B9S A;  2E35 A;  2P7C B;  2VJJ A;  1YLF A;  1U9O A;  3F8M A;  1STZ A;  1O3R A;  3H5A A;  2BZT A;  2COB A;  2XF5 A;  1W36 C;  3RKQ A;  2W24 A;  5IP6 A;  5CVU A;  4BE2 A;  2VLA A;  2OZ6 A;  4HPQ A;  5FKM A;  4A3E J;  2JUG A;  1FYM A;  3LOC A;  3HRS A;  2QZ8 A;  1BR2 A;  1T8I A;  4BEH B;  3SDB A;  2ME6 A;  1HF0 A;  4UUV A;  2LMD A;  3O6B B;  5ILV A;  2D1V A;  3DBH B;  4BGD A;  4CGZ A;  2R5Z A;  1FWZ A;  1HXD A;  2HDC A;  4BNC A;  4UXN A;  4HQE A;  2MBF A;  5F0H A;  4E4H A;  1FTT A;  3H9Q A;  1FY7 A;  4OAY A;  2HZD A;  4I76 A;  1XGO A;  4U0W A;  3DWL E;  4IHS A;  2JSC A;  3BTJ A;  1B9N A;  4XKB A;  2QKL B;  2HWV A;  3PNT A;  2ZXJ A;  3NWT A;  3VYR B;  3BPX A;  5IT9 Z;  2O3F A;  2JT1 A;  2CQ7 A;  2DJI A;  4P1W A;  5FFX A;  2RVC A;  1VQN I;  2JPC A;  1D1C A;  2Y48 A;  3O3K A;  3FX3 A;  3QU3 A;  4PUS A;  4PJJ A;  5E17 F;  2JA2 A;  2VPR A;  1T6S A;  1MND A;  4XMY A;  1IN8 A;  2MG4 A;  1LDJ A;  1FLI A;  2A6E F;  3J7A O;  2DI3 A;  1TL8 A;  2OBP A;  2Z99 A;  3IRQ A;  3QYB A;  2CQN A;  3F8F A;  3QOE A;  2F2E A;  5F6F A;  1TW3 A;  3R4K A;  1YFH A;  4EJW A;  5FD5 A;  4A3J J;  3BCB A;  2YU9 J;  5EEG A;  4OIQ F;  5JHF A;  2L9R A;  4M9Z A;  2ZJ2 A;  2WAE A;  4IRG A;  3IH2 A;  3LNQ A;  1YS6 A;  5B1A H;  5HLG A;  1ORK A;  3GTM J;  2E1M B;  2K9M A;  2W57 A;  5LLQ A;  2ISZ A;  4RMN A;  4WXD A;  2H09 A;  2QGU A;  1X1C A;  2VB6 A;  2V1U A;  2OCE A;  4HRI A;  3PO3 J;  2CO5 A;  3S32 A;  2MD5 A;  1SD6 A;  2BXZ A;  2H8W A;  2LG4 A;  4W97 A;  4P5O A;  1X1B A;  5JVT A;  1U2W A;  3TED A;  4ZJZ A;  1OCO H;  2IGK A;  4IVN A;  2AO9 A;  2OZU A;  3CUO A;  5TGT A;  3H5R A;  1N75 A;  1LFP A;  3HEF A;  3OYG A;  1P2F A;  2EZH A;  5FGM A;  1UST A;  4I0B A;  4C3H J;  4S05 A;  1J75 A;  2KDZ A;  2ZJR F;  4IQJ A;  1Y0U A;  2E2J J;  2WB1 N;  2XKO A;  3W6V A;  3Q9V A;  2K5C A;  5FFZ A;  3HB9 A;  3ZQI A;  3CP8 A;  2DMU A;  3FK7 A;  2XSJ C;  2VE8 A;  3QPT A;  3LWF A;  1MMS A;  5J40 A;  1IRF A;  4JBA A;  4CCL A;  4KT6 A;  2R92 J;  1QHH D;  4MTD A;  1H0M A;  4C2M J;  1LKX A;  2LD5 A;  3BG5 A;  3GEZ A;  1CQT A;  3MKY B;  5J1R A;  2RQP A;  3G3Z A;  1ONV A;  3IH4 A;  2CYY A;  3CME I;  3GFI A;  1JXS A;  1LPQ A;  3OYD A;  3TOB A;  1V5E A;  4QTR A;  1LE8 B;  1OCC H;  3B6C A;  3D0S A;  4IXA A;  1BR4 A;  4II2 A;  1N77 A;  2E2I J;  2EIM H;  3TKY A;  5DD4 A;  4G6Q A;  4XID A;  1SAX A;  3LQR A;  3E6D A;  3OOU A;  3B02 A;  1LQ1 A;  1WGX A;  2E1C A;  4I02 A;  2R7X A;  1EH6 A;  2UUZ A;  4BBS J;  1SFX A;  3RPU D;  3OYH A;  2IRF G;  2LY1 A;  3FM5 A;  4N4O B;  1Z6R A;  2HDW A;  3S17 J;  3WGH A;  2A6H F;  1J59 A;  2KRC A;  2EA4 A;  5LFA A;  3GFM A;  3HKZ N;  5F64 A;  3AFH A;  2CGP A;  2DQR A;  2LBF B;  5BMZ A;  2NRA C;  3HGG A;  3HTS B;  4FHT A;  2QBY A;  2FEZ A;  2BVM A;  2DMP A;  4UUS A;  1MMG A;  3CCJ I;  3S1R J;  5BPI A;  2XRN A;  1VQ4 I;  3HTU A;  2RQQ A;  3JRA A;  3WTX C;  1X3U A;  1APL C;  1OYY A;  1Y6I A;  4ZH4 F;  1J5Y A;  4JQF A;  1I50 J;  3CC2 I;  1UEL B;  2R93 J;  1QVT A;  2PN6 A;  1MJ9 A;  3D1N I;  1SVL A;  2MC3 A;  2ZXW H;  3DU5 A;  3FK6 A;  1H88 C;  3FBN B;  3V42 A;  1OYW A;  2UV1 A;  2K27 A;  4HOB A;  5E3L A;  4EEF G;  1TC3 C;  1HDP A;  3HOX J;  1QZY A;  2VC1 A;  3JRD A;  4HZF A;  3A1Y A;  1I5Z A;  2K4B A;  4NC6 A;  2IAI A;  2QLZ A;  3A0H C;  2EA2 A;  2XGD A;  1XS9 A;  1GV2 A;  2F5D A;  2FD5 A;  3HOS A;  4CA0 A;  1R23 A;  4XLC A;  1X4P A;  2H1K A;  4ABZ A;  3WHB A;  1GT0 C;  1QPI A;  4OIP F;  2HNH A;  5K7F A;  2XGC A;  1C0W A;  2MLK A;  3HHH A;  2HQR A;  1HOM A;  3S3O A;  3P9K A;  2XF7 A;  3CZ6 A;  3CUQ B;  4LB6 B;  3DPT A;  1T38 A;  1IZ1 A;  2ZSI B;  3MVP A;  4I01 A;  1WSU A;  1DPU A;  1BI2 A;  2R7R A;  2F5F A;  3HPH A;  2MSY A;  3TW6 A;  2EV5 A;  2CWE A;  3MMY B;  5HS9 A;  4B1R A;  2Z16 A;  1HW1 A;  4C30 A;  2DPD A;  4CHU A;  4O6J A;  3SEZ A;  2P7V B;  3GF2 A;  2OD5 A;  3I56 I;  2L0K A;  3OS2 A;  1XPX A;  3DU6 A;  2X0L A;  3J7A Y;  1AA7 A;  4A3I J;  1FP1 D;  1MKM A;  5B1B H;  3S2W A;  3A03 A;  4GCV A;  4DYQ A;  1BBY A;  2DA6 A;  4DGW B;  2B7E A;  3MQ0 A;  5LHG A;  5HLT A;  2G7U A;  5L3C A;  2NS8 A;  4AWX B;  2IEK A;  3K1P A;  4I09 A;  2RAE A;  5IOY A;  4XL9 A;  3CCL I;  2XB5 A;  4FCY A;  2IS4 A;  1V54 H;  2K9N A;  1ZR2 A;  2LR8 A;  3PL8 A;  4ITV A;  2JQ7 A;  4G8X A;  2O61 A;  1XB4 A;  5DV5 A;  3IL2 A;  2M4G A;  2DJN A;  3BTL A;  4RGU A;  2R7F A;  3TDZ C;  5DUI A;  2QEX I;  1ZGJ A;  1P4W A;  3WG7 H;  1P6R A;  5FB2 A;  2HXI A;  3FKI J;  1TT0 A;  4H0E A;  3LA2 A;  3BQZ A;  4J01 A;  3QWL A;  2DN0 A;  4HNU A;  2QA4 I;  5F0F A;  2JSP A;  2ZB9 A;  3EUK L;  4X0G A;  1L3L A;  4P9U A;  4G6D A;  1BIA A;  1R7J A;  1WJF A;  4FE4 A;  3QOP A;  1YJ9 I;  1XX5 A;  1XC5 A;  1JJ6 C;  1ZRF A;  4MFE A;  2XVC A;  3G1O A;  2XAU A;  2FBH A;  3KZI C;  3U9G A;  3C3W A;  4U7D A;  1QQI A;  3HRT A;  4BXX J;  3BZ6 A;  2OQR A;  4IRI A;  3N97 A;  4AU7 A;  1MJA A;  2UZK A;  4RBO A;  3M1C A;  2L4A A;  2W85 A;  2RRE A;  2R5Z B;  1TTY A;  2NVX J;  1CGP A;  2HQN A;  1S9H A;  2H6C A;  3FMR A;  4R1H A;  5C44 J;  1JT0 A;  2DT7 B;  2CQK A;  3JW4 A;  4M71 A;  2QKM B;  2WAD A;  4BE0 A;  2LKX A;  6PAX A;  5L3D A;  4U7B A;  5HS7 A;  4XRF A;  1EV7 A;  3GTO J;  4E7J A;  4CYC A;  2QYO A;  5F27 A;  2X6X A;  5CVV A;  5EF6 A;  3CES A;  3O8G A;  2Y0M A;  4C3I J;  1ZG1 A;  1UB9 A;  1WWX A;  3GTK J;  1OLT A;  2ZXI A;  1J09 A;  3CP2 A;  2Y9Y A;  3HKZ A;  3BTC A;  3C2G A;  3KLO A;  4LD5 A;  2IA2 A;  1R4M B;  3FZV A;  4AIK A;  1PVE A;  2HFH A;  4XLN F;  3LSM A;  1R00 A;  2LY2 A;  4CYC B;  2EZK A;  1LEA A;  3KYL A;  3NQO A;  1IRX A;  2KZV A;  2PI0 A;  4KT5 C;  4PSW A;  3Q0V A;  1I3A A;  4XN3 A;  2E19 A;  2CG4 A;  3Q0W A;  2MAB A;  2Z3Y A;  3ZN1 A;  1ZK8 A;  1YX5 A;  2AXT C;  1QO0 D;  3GTG J;  4CCK A;  2IGN A;  5ICG A;  4KYW A;  3DKX A;  2PMU A;  3PSI A;  3KEO A;  1OJL A;  2WAQ A;  2EFP A;  5K5O A;  1HC8 A;  4XOR A;  5FKN A;  5K7H A;  3MFK A;  2DOF A;  1IAW A;  3EUH C;  3HDD A;  1SMT A;  1WQ2 A;  1Z77 A;  4NQW A;  2LF8 A;  4P9F A;  2L3D A;  3G1M A;  4B4C A;  2BHY A;  5D5U B;  1S8N A;  2NOG A;  1YTY A;  1VQO I;  4XKC A;  1VQ7 I;  2F5E A;  3CF2 A;  1WH7 A;  2HQ5 A;  3F23 A;  2VT2 A;  4B3A A;  1AKH A;  1ETY A;  2COM A;  3DPL C;  4GDF A;  2EIN H;  1FBQ A;  4AVZ A;  1KYW A;  2A5Y B;  1YW8 A;  2CS3 A;  3VOE A;  3BWG A;  1QGP A;  4A3C J;  1SMY F;  3LL7 A;  5LEK A;  1GXQ A;  4YRV A;  2W7N A;  4E7S A;  3ISP A;  1X2M A;  1ZEL A;  4ZZL A;  5FLV A;  5ED4 A;  2HDD A;  5EGO B;  3A4C A;  5BS6 A;  2IS2 A;  3BJO A;  4E6K G;  5HLH A;  5FLX Z;  2GXB A;  1LNW A;  2NAZ A;  2KRH A;  1BC7 C;  2GAU A;  1MNM C;  1Z6T A;  1WZ2 A;  4FE7 A;  1K78 A;  1HSJ A;  3TBI A;  2F4I A;  2CSO A;  1KGS A;  1W0T A;  1OCZ H;  3TGN A;  3N4M A;  1IC8 A;  3TL4 X;  3GTQ J;  4XNF A;  1WJC A;  2R4G A;  2VAS A;  3H92 A;  5JHU A;  2VL8 A;  2UWM A;  2M8E A;  4HX4 A;  1S7E A;  2X1D A;  2EFQ A;  2OF7 A;  2DXI A;  3DKW A;  2NVT J;  2ACJ A;  2HVQ A;  3I64 A;  1PUF A;  2LK2 A;  5ERI A;  5F1R A;  3BPV A;  4IZZ A;  1WFX A;  1AU7 A;  2A61 A;  3OR2 C;  3QP5 A;  4IF4 A;  3IAS 2;  5IP9 J;  5L3E A;  1O3S A;  1I39 A;  5FKK A;  5KAI C;  3OIP A;  3ZGK A;  2C6Y A;  3JTG A;  3MZY A;  4UVB A;  1J0R A;  1XGN A;  1TZL A;  2JPB A;  2L02 A;  2OAZ A;  3KP7 A;  3SZP A;  4KIB A;  2WTE A;  1F1Z A;  2VQL A;  4LG0 B;  3FHZ A;  4A0Z A;  2XRO A;  4RAF A;  2HVR A;  2XKP A;  4BH9 A;  4F7Z A;  4EM2 A;  1ZG5 A;  5JVG F;  3BG3 A;  5ILS A;  4L9T A;  2L7F P;  1VND A;  2DA3 A;  3H35 A;  5DUK A;  4BAY A;  3IV5 A;  1BW5 A;  3CJR B;  3BTI A;  1T95 A;  1KA8 A;  4Q5S F;  4M9X A;  4L9N A;  3JRI A;  1OQY A;  2I10 A;  3JR9 A;  1VF9 A;  4CYD A;  1K4S A;  1MBF A;  2CW7 A;  2DU9 A;  3M9A A;  4M74 A;  4PFP A;  2J5P A;  4HNT A;  4PK4 A;  3IH3 A;  4YFN F;  4EM0 B;  1IN6 A;  2XC7 A;  4BY7 J;  2JUC A;  1JUM A;  4NC8 A;  3CCQ I;  2OA4 A;  4MNU A;  3L09 A;  3I3L A;  3S14 J;  4H4K C;  1SFK A;  2GOM A;  1S3J A;  2H8R A;  2HI3 A;  4RLQ A;  4GFB A;  4KMF A;  4D0P A;  3VSL A;  3W2A A;  2ISY A;  1SC7 A;  1ACI A;  3MN2 A;  1VFC A;  5C4J J;  5TIS C;  2K9S A;  2MA3 A;  1JTX A;  4HF2 A;  1V5F A;  3BR3 A;  4Y17 A;  3CQZ J;  3IP4 B;  3PQJ A;  3PJR A;  2YU3 A;  2GXA A;  2XUB A;  3ZN0 A;  4N0B A;  1VQL I;  3K4K A;  3R61 A;  5KNL A;  3M8J A;  3OYK A;  5HS8 A;  4X6A J;  3E5U A;  2FBI A;  3X2Q H;  2HYJ A;  2BY1 A;  2WAQ N;  3CCE I;  1FTZ A;  2P5V A;  2FX0 A;  3MKZ A;  2EFW A;  1LDK B;  1MBG A;  1UMQ A;  1FBS A;  1Z91 A;  2P6T A;  3ZMZ A;  2E7W A;  5E8G A;  3AG3 H;  3SZG A;  5B3S H;  2VIX A;  4NQW B;  3COA C;  4P55 A;  3GX4 X;  3QPH A;  1CF7 B;  4DW6 A;  3CCY A;  2EZL A;  2D5V A;  4BJT A;  1MDM A;  3K4C A;  4D1Q A;  3K2Z A;  4M6X A;  2FXA A;  3AG2 H;  1IN4 A;  5E1W A;  4U87 A;  4D9J A;  2W4S A;  3JAM K;  2V6C A;  5DYM A;  4L5I A;  3EPZ A;  1V4R A;  1B9M A;  3TMO A;  3SXY A;  2HQA A;  2P8T A;  3KE2 A;  2KIM A;  3VOD A;  4BL0 B;  4DBQ A;  1RKT A;  2JRT A;  2E34 A;  5H6Q A;  5HDN A;  1W4M A;  4XRS A;  2Y30 A;  1FC3 A;  4A6E A;  4NUB A;  3ESW B;  2V9K A;  3ZP5 A;  4FIS A;  4LIV A;  5JI6 A;  3CCM I;  1ZYR F;  5FRM A;  1YI2 I;  1FOX A;  2WV1 A;  2Q1Z B;  4NC7 A;  5E1Z B;  1X1A A;  2VKV A;  4LIT A;  5IYB J;  5GAD J;  5CPR B;  1JHH A;  2R7V A;  1BC8 C;  3ZQQ A;  2IBD A;  2JK3 A;  3HSE A;  3IKT A;  1G4D A;  2HGC A;  2XHK A;  3P9I A;  2CUF A;  2LVS A;  2E1N A;  2FRH A;  2XRL A;  2Y69 H;  3P7N A;  3J7Y J;  1EH8 A;  4E70 A;  1RET A;  2KHM A;  1W1W E;  3QYF A;  2XGX A;  5ICC A;  2JA8 J;  2ZC2 A;  3CO7 C;  1YRN B;  3EQL F;  2VUM J;  2EIJ H;  3KP4 A;  4BBR J;  1MH4 A;  2IP2 A;  2O03 A;  4JX4 A;  5J4Y A;  4G12 A;  3PUF A;  3GO5 A;  2RC4 A;  2XAS A;  3I4M J;  1KQ0 A;  4HV5 A;  1ETX A;  1K6O A;  3U1K A;  2XGE A;  2Y31 A;  4OIR F;  1Z21 A;  3T5X A;  1YIJ I;  1FOY A;  4HQM A;  5DCM B;  3HYI A;  2CH0 A;  5CKT A;  1R9T J;  4A69 C;  3GTP J;  4YG2 F;  1IXR C;  1H89 C;  2VKH A;  3DP7 A;  3GZ6 A;  3OYC A;  1RZ4 A;  2K9L A;  4AID A;  2W82 A;  4N9I A;  3E1S A;  1IUY A;  2Y2Z A;  3ONQ A;  4RM3 A;  5LRR A;  1NTC A;  1D1B A;  2MLG A;  2G0E A;  1S7A A;  1JKO C;  3KZY A;  1DGR M;  4F93 B;  2FU4 A;  1G3W A;  1U5T A;  4V2F A;  4LFU A;  5GAH J;  1U5T C;  2STT A;  4XKV A;  2LKS A;  3BR5 A;  3P9C A;  4OIO F;  3LFU A;  2OTL I;  2ZFU A;  1YOV B;  2VON A;  1VQ9 I;  3HIF A;  1Z67 A;  1ON1 A;  1MZB A;  3H3Z A;  2VJ5 A;  4BQQ A;  1HLV A;  2LRE A;  1G6N A;  1VTN C;  4A3D J;  3CDI A;  1DUX C;  3NAR A;  3CO6 C;  2O0Y A;  5D6E A;  1OR7 C;  4B44 A;  1MW7 A;  2FMY A;  3Q0U A;  3WGG A;  3QOD A;  1H8A C;  1Z9C A;  5D8L B;  2A3S A;  4B09 A;  2DK8 A;  2XDV A;  2JN6 A;  4Y52 J;  1WPK A;  1A6I A;  1U3E M;  4RGX A;  4AM3 A;  3RZO J;  5CLS A;  1PUE E;  4UUS B;  1KQ8 A;  4A0Y A;  4HW0 A;  1H9T A;  4UVC A;  1XMK A;  2MH9 A;  4HYE A;  4RB1 A;  5HNF A;  1ENH A;  3OWT A;  2H94 A;  1YIO A;  2L4M A;  4X1E A;  3RPU A;  4XON A;  4D7M A;  4HDV A;  1K61 A;  1F9N A;  1XMX A;  4HST A;  3AL0 C;  3HJE A;  3BJA A;  1N25 A;  4F92 B;  4P96 A;  5J8F A;  5D6F A;  4JX5 A;  1Z1D A;  1XG1 A;  2JRM A;  2LFB A;  4A12 A;  4HAM A;  1YJW I;  2LBF A;  2DOD A;  2HS5 A;  3GXO A;  4ANJ A;  1ETW A;  2J5O A;  2HTS A;  3KEQ A;  3S1Q J;  1M1E B;  3B6A A;  2ZNY A;  3FIW A;  2Z2S B;  4AYB N;  2W00 A;  3V8K A;  4ZDO A;  4AC0 A;  3RIR A;  2M9H A;  2L01 A;  4ENJ A;  1RNL A;  4IO9 F;  4LMY A;  2ZME B;  5IYC J;  4RB3 C;  1KU7 A;  2GBY A;  2LP0 A;  3F72 A;  3QPL A;  5DDG A;  3OSG A;  1QPM A;  1UJ8 A;  3DQV C;  2FE3 A;  3TP3 A;  5J1U A;  1XD7 A;  1XCB A;  2BE5 F;  4JK1 X;  1F4K A;  2KPM A;  3OIQ A;  4R79 A;  3E3V A;  1RUO A;  5HVQ C;  3DFG A;  1TQI A;  4HLX A;  2RKH A;  4MTE A;  2N8G A;  1JGG A;  2WY7 Q;  1I27 A;  3VYU B;  2IGO A;  3IHU A;  4RAG A;  4XLP F;  1SAN A;  3BR1 A;  3GLL A;  5KK1 A;  3K9T A;  3RJP A;  1K78 B;  4LG3 A;  4HEA 2;  3GLX A;  4CUG A;  3FHN A;  2H6B A;  4FX4 A;  2UXN A;  2L7K A;  3EYY A;  3HXL A;  4WXC A;  2JVH A;  2G9W A;  2EFO A;  2PJP A;  4C2T A;  4RB2 C;  1LEB A;  1A36 A;  2W1O A;  1IXS B;  2K85 A;  1B59 A;  3L2U A;  3KP2 A;  1Z7U A;  3CCU I;  1P7J A;  3DTI A;  3GME A;  4BDY A;  3WGI A;  3CTA A;  1D1A A;  1D0X A;  1ZH5 A;  2MGQ A;  3WTY C;  2JVG A;  1AOY A;  2IA1 A;  2BGC A;  3H3U A;  5D5W B;  1VZ0 A;  3Q3S A;  3BT9 A;  1IRZ A;  3PNY A;  1B4A A;  2Y0S N;  2BV6 A;  1Y1W J;  1H9G A;  2Q8K A;  1KQ9 A;  4ZYE A;  5TJJ A;  4XBF A;  3ABU A;  3HPG A;  5LHI A;  2XAF A;  4LOC A;  3OS1 A;  5A2Q K;  2V9P A;  1RR7 A;  2JZY A;  2VBY A;  1MBH A;  2L9N A;  4BS9 A;  1Y39 A;  4A3L J;  2A07 F;  2WAF A;  3A0B C;  4KMU X;  2HPI A;  2FOW A;  2PMZ A;  1FZP B;  2CJJ A;  3FXJ A;  4B3X A;  4BJ5 C;  1ZRC A;  1WKM A;  1DP3 A;  1WH5 A;  2EPF A;  1I3Q J;  3H5N A;  2QQB A;  1XCV A;  3FMS A;  2MC4 A;  1WI9 A;  2M30 A;  5E3O A;  1SD7 A;  2QSG X;  1D5Y A;  1UHS A;  2ECB A;  3QRF F;  2EIL H;  3BCA A;  3WU0 A;  4NHJ A;  3QU6 A;  2CU7 A;  4M73 A;  4V19 K;  2YX7 A;  3LSI A;  2DLL A;  1D0Y A;  4BHC A;  4W1U A;  3RCO A;  4CZZ A;  1ZQ3 P;  3AG4 H;  3ASO H;  1TWC J;  3ABM H;  2HKX A;  4JOM A;  5HDG A;  2M2E A;  4CIC A;  1IO2 A;  4PJN A;  1K79 A;  4RS8 A;  3OR1 C;  5BPD A;  3HSF A;  2IS6 A;  1UFM A;  3IUO A;  3ZQH A;  1T08 B;  5GPA A;  2D45 A;  2D1H A;  1JGS A;  5E8I A;  5DS9 A;  3L9F A;  3BLY A;  1OMI A;  3DLA A;  4YIR X;  4HNV A;  4PGG A;  4G6T B;  4DZJ A;  2JWT A;  2O8X A;  2DA7 A;  3E6M A;  3LA7 A;  2O6G E;  2M7A A;  2ZME C;  1OR7 A;  3GVA A;  1BI1 A;  1TLH B;  4NBQ A;  1V5G A;  1BL0 A;  1WJD A;  2DYR H;  1R5H A;  2CUJ A;  3F8N A;  1R5G A;  2DDB A;  1TWA J;  3DF8 A;  1PUF B;  1F43 A;  1MD0 A;  3GUD A;  1MBE A;  4BQO A;  1P7I A;  2HU9 A;  4ZDP A;  5JLX A;  2YPR A;  3ECH A;  3OL4 A;  2BVL A;  1ZAR A;  4XOT A;  1W7P D;  1BOB A;  2L9V A;  3CDH A;  4KN4 X;  3A01 A;  3FBI B;  1HA8 A;  4MQ9 F;  5GTH C;  1DU0 A;  3CMM A;  1IN5 A;  1B1B A;  4KA4 A;  3K4N A;  2ADU A;  1E3H A;  3ERE D;  1MIJ A;  1JUP A;  2ELJ A;  1YHQ I;  4WXH A;  2PG4 A;  2Y0S A;  2K7L A;  3S1M J;  2DMN A;  3CLQ A;  4L9V A;  1YYV A;  2VBW A;  3RPQ A;  4DOZ A;  1UHW A;  3LST A;  2DMQ A;  3HSR A;  3R0A A;  1ON2 A;  1DU6 A;  1ZG3 A;  3KYC B;  4GYI A;  1U6G A;  1G59 A;  1DGW Y;  1UHM A;  1Z7L A;  1FOK A;  4XSZ F;  2CMP A;  4Y13 A;  1ZLK A;  4LLN A;  2L9S A;  2VKE A;  4MLO A;  2HOE A;  2DTZ A;  2YR2 A;  2F6C A;  2HYF A;  5EG0 B;  1U8B A;  3HL2 A;  3TO9 A;  3OYI A;  1QA6 A;  2KIU A;  2ME0 A;  5CQE A;  4AVP A;  4E7I A;  3CUQ C;  3LSG A;  1IF1 A;  4HBL A;  4EM1 A;  1ETK A;  3D5L A;  5B66 C;  4CH7 A;  1TP4 A;  2K02 A;  3CDL A;  1T56 A;  1X58 A;  3OYE A;  1JKR C;  3KZZ A;  4EQQ A;  2YUS A;  5CVR A;  1BI3 A;  1BOA A;  1BJA A;  2DFH A;  3OS0 A;  5H6R A;  1LJ9 A;  2CUE A;  3SQN A;  4K2E A;  1MSF C;  3FIS A;  2KDO A;  5F0C A;  3K7A J;  1ULY A;  1IV6 A;  1GVJ A;  3F6V A;  3TQN A;  3WTT C;  3E7L A;  1ZHF A;  1UCR A;  2XV4 S;  5J1Y A;  5LEJ A;  2FQ4 A;  1SEU A;  1FJL A;  1Y56 A;  5J3L A;  5IPA A;  1X1P A;  4R8H A;  2DA1 A;  1WI3 A;  3ZRG A;  4JX6 A;  2FSW A;  3W6K B;  1NH3 A;  1QNT A;  3MKL A;  4CXF A;  2VI6 A;  3AAF A;  3S3M A;  2X51 A;  1BN5 A;  2LLK A;  2VQG A;  4I99 C;  1YW9 A;  1IN7 A;  3HHG A;  3HGY A;  4U0Y A;  4M6V A;  5M5Y J;  2ZJP F;  2ZCW A;  3BJ6 A;  1U9N A;  4LK0 F;  2M3A A;  1MH3 A;  2AQE A;  3KLN A;  3T8T A;  5KHD A;  5J4V A;  3DKY A;  1OPC A;  1A5J A;  1EKE A;  3CMY A;  1XGM A;  2E36 A;  4IEJ A;  2X9D A;  2L7M P;  2K4J A;  4UB8 C;  1PP7 U;  5K1Y A;  4A93 J;  3CC4 I;  2R7U A;  3G71 I;  1RC9 A;  1YJN I;  5C3E J;  3ECO A;  1ZN2 A;  2IPQ X;  5CJ9 A;  5FLM J;  3GBG A;  4ASN A;  2QBY B;  2DO7 A;  4B8X A;  2RV8 A;  2DA4 A;  1O57 A;  3BOQ A;  2MD0 A;  3AL0 B;  4Q4Z F;  5M3M J;  2PFB A;  2NXN B;  1PP8 F;  3AG1 H;  3QQA A;  2A05 A;  3BP8 A;  2CV0 A;  4UVA A;  1B72 A;  2K3P A;  2IS1 A;  3OMY A;  1P9Q C;  2KIS A;  3N05 A;  3GZN B;  3FXR A;  5L3G A;  2DT5 A;  2I5U A;  5K7Z A;  4RAY A;  1ZLJ A;  4RGR A;  4Z2Y A;  3EDP A;  5IP7 J;  1IXC A;  1DDN A;  3FXK A;  4M6Y A;  3OYM A;  2QF7 A;  4ZTJ A;  2IGM A;  4KIT B;  2AXL A;  2VOD A;  3JRB A;  4MEX F;  5EZG A;  2CQX A;  4IKF A;  3T8R A;  3BG6 A;  4A5M A;  1MDM B;  4MEY F;  1LDD A;  3RKY A;  2HEO A;  2RNG A;  1ETV A;  4LB5 A;  4FT8 A;  1ZTR A;  3HZJ A;  4BYY A;  4HA8 A;  4KDP A;  1QZE A;  2R0Q C;  3VDX A;  1ZAO A;  3GYH X;  4AIH A;  4ZZD A;  2K3F A;  3E5X A;  4ON0 A;  1Z0X A;  2OV7 A;  2GM4 A;  4U88 A;  2M5W A;  4I98 B;  4OOI A;  3H3V K;  2M0C A;  2L5Q A;  2FOK A;  1R71 A;  4ZYD A;  1O3Q A;  1S6L A;  2BBY A;  1LFU P;  3HG9 A;  1W7P B;  3OYF A;  2OCC H;  1VQ6 I;  2GA1 A;  1O4X A;  3J7Z I;  2KP6 A;  3KET A;  2P6S A;  2NOJ B;  3OYL A;  4G9Y A;  4D5C A;  2GIZ A;  3I59 B;  1DP7 P;  4PJM A;  2F4M B;  4BKX A;  1U8R A;  1U78 A;  2OUM A;  2DQL A;  4WX9 A;  3F0C A;  2R5Y A;  4AIJ A;  3TO7 A;  2GIV A;  1B8I B;  3WE2 A;  1WVR A;  3D5R C;  2IVM A;  1YE9 A;  5JFR A;  5H2F C;  5LGN A;  3REO A;  4EAT A;  1W7P A;  4KIF A;  3U21 A;  1Q1H A;  2NS7 A;  5DD8 A;  3IRR A;  4I6Z A;  1RR8 C;  3ML6 A;  3VYS B;  2E2H J;  5LBQ A;  5DTD A;  1D8K A;  2GOX B;  2TRT A;  3FWE A;  3BG9 A;  4WK8 F;  1YX3 A;  4KJZ A;  3LAP A;  3GFL A;  3ZMV A;  1ERD A;  4CZC A;  2L54 A;  2O5R A;  3Q5F A;  4TV7 A;  1G3S A;  5H20 A;  3V8J A;  1T39 A;  2H27 A;  1BW6 A;  3BZC A;  2DA5 A;  3PIP F;  2M0M A;  3ZQG A;  4A3F J;  5D5X B;  1UZC A;  2DA2 A;  2HKO A;  4ENN A;  2ZXH A;  2E5N A;  3QYE A;  4L5E A;  2FF4 A;  4FET A;  4DYR A;  4MFD A;  3BRO A;  4EGZ A;  1Z05 A;  2A6T A;  3HM5 A;  2ZNZ A;  4G7Z F;  4IOA F;  4UHT A;  3ROU A;  5AON A;  2STW A;  2CW0 F;  4EJO A;  1LB2 A;  3QAH A;  4IRH A;  4CCO A;  1R49 A;  1JKQ C;  1RKW A;  3A02 A;  2XB0 X;  1HKT A;  4ZTF A;  1F5T A;  2GWR A;  3BR2 A;  4A3B J;  2FUG 2;  2FNA A;  2KJC A;  2VXD A;  3C2B A;  1QRY A;  2EB7 A;  4YIF A;  3RDI A;  1IW7 F;  1J2X A;  3I58 A;  3K4J A;  3CMA I;  5FO5 A;  1HW2 A;  4O5V A;  3H0D A;  2VE9 A;  2JMW A;  4IHW A;  2Z9O A;  3M8E A;  3ABT A;  2EIK H;  1A6Q A;  2NVY J;  4Q48 A;  3MWM A;  2YX4 A;  5LRS A;  1OIS A;  1TT5 B;  1KZH A;  5DM7 F;  3I4P A;  3HUG B;  4JYK A;  1Q1V A;  1QU3 A;  2WWY A;  2JA6 J;  1R1T A;  3CF5 F;  2KL4 A;  1MBK A;  3ULQ B;  2X1E A;  1MNE A;  1HQC A;  3W6J B;  2LSO A;  4PFO A;  3TDU C;  4XLE A;  2ZSH B;  2JJ7 A;  1ZKG A;  1ZR4 A;  2P5L C;  3QPS A;  1D5V A;  5TRD A;  2AHQ A;  2DMT A;  5D4R A;  2R3S A;  1E3O C;  4AYB A;  3F8B A;  1QVU A;  3L2R A;  5HOD A;  1XTA A;  4DBR A;  3C18 A;  4G94 A;  3SFI A;  2LC2 A;  2Y75 A;  3LSJ A;  2UXX A;  1OCP A;  4PGH A;  3R60 A;  2QCO A;  4YEJ A;  4OMY A;  4QPQ A;  2V79 A;  1VQ5 I;  9ANT A;  2WV0 A;  3LFK A;  2VPL A;  3RSN A;  3I54 A;  1XN7 A;  3E6B A;  3T1B A;  4XSX F;  5BNG A;  2CUZ A;  4L9J A;  1N78 A;  1FYL A;  3TO6 A;  1T98 A;  3J81 K;  1JHF A;  2FML A;  4JP0 A;  2FJ1 A;  2KJB A;  2NYX A;  3M1E A;  3TP0 A;  1A31 A;  2PJR B;  1BR1 A;  1T33 A;  5FD6 A;  5M5X J;  3ZPL A;  2IT0 A;  3S8P A;  5KAF C;  3WTS C;  3H9J A;  1IDY A;  4OAZ A;  3RZD J;  4F3Q A;  4BXF A;  5GPC A;  4ZYG A;  2ZO4 A;  4C9Y A;  2DYS H;  1ETO A;  1W5S A;  4GYG A;  2P5K A;  5GAG J;  5DM6 F;  3A01 B;  1XSD A;  4UV9 A;  4Z6Y A;  5FJ8 J;  5CQG A;  3WTZ A;  3I55 I;  2LF7 A;  5DEQ A;  1WRJ A;  4N9H A;  1SD4 A;  1FBU A;  2BW3 A;  2P81 A;  3S3N A;  2VQH A;  4KIC A;  1IUF A;  3S2D J;  2V9V A;  4RDU A;  3AKZ A;  3SJM A;  3DEU A;  2WY8 Q;  1ITY A;  3GTJ J;  5M3F J;  2Q0O A;  2W84 A;  1YIT I;  4EVI A;  4PDK A;  1CF7 A;  3B73 A;  1ETQ A;  1FX7 A;  3RYP A;  1E0E A;  2E7X A;  2RNJ A;  3G2B A;  2BEO A;  2DT6 A;  2O9L A;  2LNB A;  3I53 A;  4GGG A;  5CVI A;  3VEP A;  2DFF A;  2HVS A;  2CW8 A;  2F5V A;  4AD9 A;  2L7Z A;  2LH9 A;  1IV8 A;  1FIA A;  1VQM I;  4ZC3 A;  2X6O A;  1G3T A;  3NEU A;  4YII A;  4CO8 A;  4OU0 A;  1LE8 A;  3HOZ J;  3KFW X;  2QWW A;  3WHC A;  1XMA A;  4QSH A;  2B0L A;  1FYK A;  1BA5 A;  1Y8R B;  2EK5 A;  1R6R A;  3V4G A;  4F91 B;  1O7F A;  2QUF A;  2W48 A;  3K69 A;  4N4N B;  3WE3 A;  5ICF A;  2VJI A;  3LSH A;  3PIO F;  2QQA A;  3WU1 B;  4IQ4 A;  3HBL A;  4WWC A;  1MGT A;  5KCM A;  3BY6 A;  3ZXS A;  2PJR A;  4U0V A;  1YW7 A;  3T0Y A;  2X48 A;  1BIB A;  2GZW A;  1NG7 A;  3K1M A;  1SFU A;  2QQ9 A;  4XRM A;  1E17 A;  3FXU A;  1D8J A;  2AS5 F;  4UV8 A;  1KU3 A;  2OU2 A;  3E6C C;  4IL6 C;  4YFK F;  1EJ9 A;  1PYV A;  4ZDL A;  2TDX A;  3OYJ A;  3GW2 A;  2R7Z J;  4NNJ A;  5EG0 A;  3M07 A;  1YO5 C;  1IG7 A;  3LAJ A;  2ID6 A;  4PSX A;  4IHV A;  3UKG A;  3ZOB A;  4GXO A;  3F8C A;  1AKH B;  2NS0 A;  5LGT A;  3K70 D;  4I7H A;  1GHC A;  2M87 A;  2CRG A;  1WJ5 A;  5F1J A;  3L2Q A;  3RKX A;  4DNC A;  3I5U A;  2WBM A;  1T0F A;  5EEH A;  1P4A A;  4MHG A;  3LA3 A;  3MEX A;  1JE8 A;  1LVK A;  1UG2 A;  4BHP A;  3CCV I;  1R58 A;  1FP2 A;  5E79 C;  1U0J A;  2DAO A;  3WTU C;  2GXG A;  2Z33 A;  2V1X A;  2M4K A;  1OCT C;  1GXP A;  1W5C C;  3I4N J;  1RRJ A;  2EZI A;  3OOP A;  4DJA A;  4NDL A;  3K6G A;  5E3M A;  3L7W A;  1ZGA A;  4WF2 A;  4CCN A;  5FKL A;  1MBJ A;  2OPT A;  2LKP A;  2NNN A;  3E0J B;  1IJW C;  3FDY A;  4MIM A;  3H36 A;  1YS7 A;  1Y8Q B;  3K0L A;  3HOW J;  2OJE D;  4D7N A;  4J19 A;  4E7L A;  3M3Y J;  3PFY A;  3ZCO A;  1GUU A;  4MO7 A;  4II3 A;  1KYZ A;  3J80 Z;  3JRC A;  4C2U A;  2V1N A;  3FMQ A;  1YQA A;  1SD5 A;  1JT6 A;  5C4X J;  2XF6 A;  2ZKZ A;  2CV2 A;  2A69 F;  2TCT A;  1NK2 P;  1OKR A;  4E7H A;  1SAU A;  2MW8 A;  3RQ4 A;  2OQG A;  3LQQ A;  4L18 B;  4HV6 A;  3SZT A;  5IYD J;  1KON A;  2ESH A;  3JRF A;  3HOV J;  3CJN A;  4D5F A;  3VSK A;  5A2Q Z;  1O3T A;  4RM2 A;  2VXZ A;  4G7O F;  2R7D A;  3ABK H;  4RAZ A;  1V55 H;  3GCM A;  1XGS A;  2R7T A;  2LYC A;  4QIW N;  2HR3 A;  4L0Z B;  1YG2 A;  4ESJ A;  1AWC A;  1PJR A;  1MSE C;  4FAS D;  4XN0 A;  4PJL A;  1JJ8 C;  2WB1 A;  2XAG A;  2FBK A;  3C1D A;  4PZJ A;  3I0T A;  2B63 J;  4Y7N J;  2L2O A;  4QWQ A;  5ICE A;  5D8K B;  2X6Y A;  2CFO A;  2XAH A;  3KP5 A;  4Y3O A;  2VBZ A;  3UNG C;  5J47 A;  3M4O J;  2HXO A;  2KLO A;  4FX0 A;  4ENK A;  3DTK A;  3Q9S A;  2V6E A;  2YSR A;  4I2O A;  4KIG A;  2V1D A;  5BOX A;  1FSH A;  1FPQ A;  5HDK A;  4IPA A;  2VBX A;  3GFJ A;  1P92 A;  3I9V 2;  3KEY A;  2QVO A;  4ENM A;  2HOS A;  1D3Y A;  2KQR A;  4M3D A;  3SHF A;  1HDD C;  3MZ8 A;  4HF1 A;  4BQN A;  4OWR B;  3CJQ B;  5EEA A;  1HKS A;  2DCE A;  2E5Z A;  1P4X A;  3H0G J;  1USS A;  1J7K A;  2K9Q A;  3L00 A;  3PO2 J;  2V26 A;  2MH2 A;  1FMW A;  3K2A A;  3ELK A;  3PM1 A;  3OY9 A;  2PX9 A;  3DTE A;  4UY8 I;  1SFE A;  4QPO A;  2PEX A;  3TW7 A;  3G73 A;  4BQA A;  3UR3 C;  1RUN A;  5FRN A;  3WG9 A;  1HST A;  1XSX A;  2M7B A;  3VPR A;  5EDN A;  2KIQ A;  2BY3 A;  4CCM A;  1JI8 A;  3HC7 A;  2XSD C;  2BY0 A;  2JA5 J;  4B48 A;  4BHB A;  1X2N A;  3JSO A;  3DEE A;  4RB0 A;  4B43 A;  2PMZ N;  1TWF J;  4XLA A;  3G1L A;  2P4W A;  3A2K A;  1XDS A;  1ODD A;  2JTV A;  4Q47 A;  2O7O A;  3TOA A;  5E3N A;  1HBX G;  4ESF A;  4MQV A;  3CCS I;  5FRO A;  5LD2 C;  3JAM Z;  3LSR A;  1POG A;  2H1L A;  2E71 A;  4A6D A;  4F55 A;  5IY5 H;  1VQ8 I;  1A35 A;  5EGO A;  3SEQ A;  4CSW A;  4LLL A;  1G2H A;  1BI0 A;  1K6Y A;  2DW4 A;  1R36 A;  1EA3 A;  5E18 F;  3RYR A;  2HOT A;  4S0H B;  1YRN A;  1S5L C;  4EJV A;  1G3Y A;  4HLY A;  3ZQC A;  1BM9 A;  1D0Z A;  3KYD B;  4XM3 A;  2EQR A;  2XAQ A;  4HX8 A;  1W36 D;  3CD6 I;  3MKW B;  3FXM A;  1W0U A;  3LSK A;  2E1O A;  3KCC A;  3RKW A;  2V7F A;  3DEW A;  1X1D A;  3D5S C;  2ELH A;  2HTJ A;  2DDA A;  2CQQ A;  1NK3 P;  3FKJ A;  2E1M C;  5LHH A;  3R0J A;  4EJU A;  1GVD A;  4M3F A;  2DTR A;  3JRH A;  3O2P E;  2Q2E A;  5HOO A;  2M8G X;  1WCM J;  2R7O A;  2EWN A;  1I1S A;  3FXL A;  3MCZ A;  3CJT B;  4UB6 C;  4XLH A;  3HRM A;  4ZYA A;  2KZG A;  1R1V A;  3L2V A;  4KNY A;  5E1X A;  4BJ6 C;  2RGV A;  3G4S I;  3DBL B;  1MMA A;  4XK4 A;  4DZP A;  1B8I A;  2KFD A;  4A3G J;  2EBI A;  1KU2 A;  2R5Y B;  2ESN A;  3OYB A;  2M45 A;  2M1B A;  4HDU A;  1RI7 A;  5J6X A;  4YFX F;  1O7L A;  3LSP A;  2KKO A;  3S93 A;  1J9I A;  2DOE A;  1UG0 A;  2BHZ A;  4CDG A;  1PDN C;  1TQM A;  2HZT A;  2LTP A;  4M3E A;  1RIO H;  2XPW A;  2XPV A;  1VQP I;  4ESB A;  2NVU B;  3NAU A;  4XQF A;  3KX2 A;  5IT3 A;  1KU9 A;  3F6O A;  4XLF A;  3GWZ A;  1A04 A;  3BR0 A;  1OCR H;  5K5R A;  5AIP A;  3W3C A;  3P5J A;  3M8F A;  1OYI A;  3ABL H;  3VB2 A;  4A5N A;  5F08 A;  1K83 J;  1JKP C;  3BDD A;  5JLW A;  2K40 A;  3W2W A;  2R7Q A;  2VKD A;  5IT9 K;  1NG6 A;  5DCF A;  2OC6 A;  5IOZ A;  2XIG A;  1VI0 A;  3MZH A;  3L1P A;  3H1C A;  2Z5U A;  1VQK I;  4CCJ A;  5EZH A;  1SVO A;  4LG0 A;  3NRV A;  4S04 A;  4C3J J;  3C7J A; 
#chains in the Genus database with same CATH homology
 3WHB A;  1GT0 C;  1QPI A;  3Q0U A;  5K7F A;  1H8A C;  4XRS G;  2XGC A;  3HM5 A;  4M3G A;  1JKQ C;  2JN6 A;  4Y52 J;  1HOM A;  1WPK A;  1RKW A;  1A6I A;  3A02 A;  2XB0 X;  3RZO J;  4UUS B;  3BR2 A;  2XPU A;  1B72 B;  4A3B J;  3C2B A;  1QRY A;  3MVP A;  3S15 J;  3JRE A;  1ZGW A;  2MSY A;  2JMW A;  3TW6 A;  4IHW A;  1JUS A;  4B1R A;  1ENH A;  2HOA A;  2NVY J;  4X1E A;  3S16 J;  2L0K A;  4D7M A;  1K61 A;  4A3I J;  3ZQL A;  4JYK A;  1Q1V A;  3A03 A;  4JX5 A;  3OSF A;  2JA6 J;  1XG1 A;  3DCF A;  1MBK A;  2LFB A;  4DYQ A;  2DA6 A;  4BY1 J;  2NS8 A;  1ETW A;  2ECC A;  2IEK A;  2JJ7 A;  1ZKG A;  2RAE A;  1ZR4 A;  5IOY A;  1I6H J;  3S1Q J;  2O8K A;  2XB5 A;  4FCY A;  3B6A A;  3QPS A;  3RQI A;  2K9N A;  3FIW A;  2LR8 A;  1ZR2 A;  2AHQ A;  2DMT A;  1E3O C;  4AYB N;  4IHX A;  1QVU A;  2DJN A;  3BTL A;  4AC0 A;  5HOD A;  2M9H A;  3HOY J;  3SFI A;  3LSJ A;  5IYC J;  1F36 A;  2GBY A;  1OCP A;  2HXI A;  2LP0 A;  3FKI J;  2QCO A;  3QPL A;  3OSG A;  3BQZ A;  3OIO A;  2DN0 A;  5J1U A;  3TP3 A;  9ANT A;  5F0F A;  1BJZ A;  2ZB9 A;  3BR6 A;  4FE4 A;  2N8G A;  1EF4 A;  5BNG A;  1JGG A;  1AHD P;  1XC5 A;  4A3M J;  1JJ6 C;  4MFE A;  5M5W J;  1SAN A;  3BR1 A;  4JP0 A;  3G1O A;  2FJ1 A;  3TP0 A;  5M5X J;  1T33 A;  5GP9 A;  4BXX J;  4UUT A;  3S2H J;  4RBO A;  1IDY A;  2R5Z B;  3RZD J;  4V2G A;  5GPC A;  1P7J A;  2NVX J;  1ETO A;  3A01 B;  2GLO A;  5FJ8 J;  1OFC X;  2MGQ A;  5C44 J;  1JT0 A;  3Q3S A;  3BT9 A;  2P81 A;  1LFB A;  1IRZ A;  2LY9 A;  1IUF A;  2LKX A;  3S2D J;  2Y0S N;  4RDU A;  3GTO J;  3SJM A;  1ITY A;  3GTJ J;  5M3F J;  1Y1W J;  4CYC A;  5F27 A;  4XIC A;  4IHY A;  4LOC A;  1ETQ A;  5EF6 A;  1RR7 A;  3O8G A;  1MBH A;  4C3I J;  1IGN A;  2O9L A;  3GTK J;  4A3L J;  2ELK A;  2Y9Z A;  2Y9Y A;  1HCR A;  3BTC A;  2CJJ A;  4CYC B;  2L7Z A;  1WH5 A;  2EZK A;  1I3Q J;  4AUX A;  1FIA A;  1FIP A;  5EYR A;  3Q0V A;  3SDG A;  2X6O A;  2EH3 A;  2E19 A;  3HOZ J;  3Q0W A;  5E3O A;  1LE8 A;  1RPW A;  1D5Y A;  3WHC A;  1UHS A;  1ZK8 A;  2ECB A;  4QSH A;  3GTG J;  1BA5 A;  2CU7 A;  2W48 A;  1OJL A;  4W1U A;  1ZQ3 P;  3O8H A;  3JRG A;  5FKN A;  5K7H A;  3HBL A;  1TWC J;  3HDD A;  3HOU J;  2M2E A;  1Z77 A;  3BQY A;  2X48 A;  4DYC A;  2JA7 J;  4B4C A;  3G1M A;  4XRM A;  2NOG A;  1WH7 A;  2HQ5 A;  4B3A A;  1AKH A;  3ZQH A;  1ETY A;  2M34 A;  1Y1V J;  5GPA A;  2R7Z J;  5DS9 A;  5EG0 A;  1IG7 A;  4A3C J;  2ID6 A;  1RES A;  3UKG A;  4IHV A;  4HNV A;  3ZOB A;  1AKH B;  1X2M A;  4DZJ A;  5FLV A;  1JTY A;  2HDD A;  5EGO B;  2CRG A;  5F1J A;  2JWT A;  2DA7 A;  5FKO A;  3ZQF A;  3S1N J;  1BL0 A;  2KT0 A;  1PUF B;  1TWA J;  1MNM C;  1F43 A;  4FE7 A;  1MBE A;  1UG2 A;  1P7I A;  4FTH A;  5JLX A;  1W0T A;  1IC8 A;  1OCT C;  3I4N J;  2NVQ J;  4A3K J;  3GTQ J;  1FEX A;  2EZI A;  3A01 A;  1SFO J;  3GTL J;  2YS9 A;  4NDL A;  5E3M A;  1DU0 A;  5FKL A;  1MBJ A;  1S7E A;  2OPT A;  2OF7 A;  1GV5 A;  1JUP A;  2NVT J;  1IJW C;  1PUF A;  4M3B A;  1GDT A;  2LK2 A;  2ID3 A;  3S1M J;  1AU7 A;  2DMN A;  4MIM A;  5IP9 J;  3HOW J;  5F04 A;  1TWG J;  4D7N A;  2DMQ A;  4J19 A;  3M3Y J;  1DU6 A;  1GUU A;  5FKK A;  4MO7 A;  1TWH J;  3JRC A;  1IDZ A;  1JT6 A;  2VKE A;  5C4X J;  4MLO A;  2DTZ A;  1U9O A;  5EG0 B;  2TCT A;  1U8B A;  1NK2 P;  2ME0 A;  2MW8 A;  2COB A;  3LSG A;  3RKQ A;  5IP6 A;  5IYD J;  1ETK A;  3JRF A;  3HOV J;  4D5F A;  5FKM A;  4A3E J;  3BG3 A;  3LOC A;  2L7F P;  3CDL A;  2ME6 A;  1HF0 A;  1T56 A;  1X58 A;  4QIW N;  1VND A;  2DA3 A;  1JKR C;  3IV5 A;  2YUS A;  2R5Z A;  1BW5 A;  3BTI A;  2CUE A;  1MSE C;  3JRI A;  2I10 A;  5F0H A;  3JR9 A;  1FTT A;  1VF9 A;  1JJ8 C;  3FIS A;  1MSF C;  1MBF A;  5F0C A;  3K7A J;  3IH3 A;  1IV6 A;  2B63 J;  4Y7N J;  3E7L A;  4BY7 J;  1JUM A;  4I76 A;  5J1Y A;  3M4O J;  3S14 J;  2FQ4 A;  2HXO A;  3BTJ A;  1FJL A;  2H8R A;  5J3L A;  5IPA A;  2HI3 A;  4GFB A;  2DA1 A;  1WI3 A;  4JX6 A;  3MN2 A;  3MKL A;  2HOS A;  1VFC A;  2VI6 A;  5C4J J;  2K9S A;  4M3D A;  1HDD C;  1JTX A;  2VPR A;  2LLK A;  2MG4 A;  3BR3 A;  5EEA A;  3HGY A;  4M6V A;  3CQZ J;  5M5Y J;  1U9N A;  2K9Q A;  3H0G J;  3PO2 J;  1MH3 A;  4X6A J;  3K2A A;  2HYJ A;  3PM1 A;  2WAQ N;  4A3J J;  2YU9 J;  1A5J A;  1FTZ A;  3CMY A;  2FX0 A;  2L9R A;  3TW7 A;  4IEJ A;  2X9D A;  1MBG A;  2L7M P;  4A93 J;  3VPR A;  3IH2 A;  3LNQ A;  5EDN A;  1UMQ A;  1ORK A;  5C3E J;  3GTM J;  2XSD C;  5FLM J;  3GBG A;  2JA5 J;  1X2N A;  2DA4 A;  4DW6 A;  5M3M J;  3CCY A;  2PMZ N;  1TWF J;  3G1L A;  2EZL A;  2D5V A;  3PO3 J;  2O7O A;  3QQA A;  5E3N A;  3TED A;  4W97 A;  1B72 A;  3LSR A;  1POG A;  2AO9 A;  5EGO A;  1RKT A;  3HEF A;  1G2H A;  5K7Z A;  4XRS A;  2Y30 A;  2EZH A;  5IP7 J;  4C3H J;  2HOT A;  4S0H B;  2KDZ A;  1YRN A;  2QF7 A;  4FIS A;  2E2J J;  2WB1 N;  3JRB A;  3ZQC A;  5EZG A;  3W6V A;  2CQX A;  2WV1 A;  2EQR A;  3HB9 A;  3ZQI A;  2DMU A;  3FK7 A;  2VKV A;  1ETV A;  5IYB J;  1W0U A;  1ZTR A;  2E1O A;  2R92 J;  3DEW A;  2IBD A;  2JK3 A;  4C2M J;  2LD5 A;  3BG5 A;  1CQT A;  2CUF A;  2CQQ A;  2LVS A;  2R0Q C;  1NK3 P;  5J1R A;  3IH4 A;  1GVD A;  2XRL A;  4M3F A;  3JRH A;  4QTR A;  1RET A;  1Z0X A;  1LE8 B;  3B6C A;  2GM4 A;  2E2I J;  2M8G X;  1WCM J;  4XID A;  2JA8 J;  3H3V K;  2M0C A;  3OOU A;  1YRN B;  2VUM J;  4BBR J;  1MH4 A;  4JX4 A;  1WGX A;  1LFU P;  4G12 A;  1O4X A;  4BBS J;  4XK4 A;  4DZP A;  3I4M J;  1B8I A;  4A3G J;  2EBI A;  1ETX A;  2R5Y B;  2XGE A;  2Y31 A;  3S17 J;  3LSP A;  3HKZ N;  4D5C A;  1R9T J;  4A69 C;  3GTP J;  4BKX A;  1U78 A;  1H89 C;  4M3E A;  2LTP A;  3HGG A;  3F0C A;  2XPW A;  2R5Y A;  2XPV A;  1B8I B;  2DMP A;  4UUS A;  3NAU A;  2Y2Z A;  3S1R J;  3BR0 A;  1NTC A;  2G0E A;  3JRA A;  1JKO C;  2NS7 A;  4I6Z A;  1APL C;  1I50 J;  2E2H J;  2R93 J;  1QVT A;  5DTD A;  3D1N I;  2TRT A;  1K83 J;  5F08 A;  1JKP C;  3BG9 A;  3FK6 A;  4V2F A;  5JLW A;  1H88 C;  2K40 A;  3BR5 A;  5E3L A;  4EEF G;  1TC3 C;  1HDP A;  5IOZ A;  3HOX J;  1BW6 A;  2DA5 A;  3JRD A;  1VI0 A;  2IAI A;  3ZQG A;  4A3F J;  3L1P A;  2DA2 A;  1HLV A;  2XGD A;  1XS9 A;  4A3D J;  1GV2 A;  2FD5 A;  4L5E A;  5EZH A;  3NAR A;  4DYR A;  2H1K A;  4MFD A;  4C3J J;  4ABZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...