1FTTA

Thyroid transcription factor 1 homeodomain (rattus norvegicus)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
68
structure length
68
Chain Sequence
MRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKAAQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Analysis of the solution structure of the homeodomain of rat thyroid transcription factor 1 by 1H-NMR spectroscopy and restrained molecular mechanics.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Dna binding protein
molecule keywords THYROID TRANSCRIPTION FACTOR 1 HOMEODOMAIN
total genus 19
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 1995-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1fttA00
1JKOC 1ETVA 3H3VK 1LE8A 2K9QA 3QQAA 1FJLA 1NK3P 5FKMA 2VKEA 3HDDA 2L7ZA 1BJZA 4A3EJ 3ZQHA 3BQYA 4B3AA 1QPIA 1ETWA 1B72B 2EBIA 1K61A 3UKGA 5K7FA 1U9NA 3WHBA 5K7ZA 1MH4A 4FISA 1S7EA 1ZGWA 3MN2A 4IEJA 1RESA 4B1RA 5F0FA 2L9RA 2Y2ZA 3M4OJ 5BNGA 1W0UA 2L7MP 2GLOA 3F0CA 4J19A 1JKQC 1B72A 1I50J 3BTCA 3JRAA 5IPAA 2EZIA 1H89C 4D7MA 2XGEA 3HOVJ 2MGQA 4A3LJ 1TWHJ 2K9NA 2WAQN 4MFDA 2YUSA 5EGOB 5IYDJ 5M5WJ 2XPVA 3L1PA 4C2MJ 3E7LA 1BA5A 1EF4A 3PM1A 4I76A 2E1OA 1H8AC 5IOYA 5C4XJ 3BR0A 5EYRA 4L5EA 4XRSA 3S2HJ 2DA2A 1JJ8C 2AO9A 4QIWN 1GUUA 2KT0A 2JA8J 2DA5A 2O9LA 1F36A 4IHVA 2Y0SN 2NS8A 2FQ4A 1YRNB 1UHSA 1JJ6C 2IBDA 2OF7A 1Y1WJ 1JGGA 3LOCA 3GTQJ 3B6AA 4QSHA 3LSPA 4A3CJ 1IRZA 1T33A 4DZPA 4C3JJ 1MBGA 2LP0A 5E3OA 2MSYA 2M34A 3RZOJ 3JRDA 1FIAA 4X6AJ 1RR7A 4JYKA 3VPRA 3ZQLA 2DMNA 2XGCA 4G12A 1X2MA 2D5VA 1TWFJ 1A5JA 2Y9ZA 2M8GX 2TRTA 3C2BA 3GBGA 1K83J 3NAUA 5EZHA 3I4MJ 1XC5A 2AHQA 3JRBA 4UUTA 2COBA 1GV2A 3A01A 5M3FJ 2DN0A 2LFBA 1IDZA 2XPUA 2LKXA 1LFBA 2HOTA 4D5FA 1TC3C 4LOCA 2YS9A 3RZDJ 1FEXA 3HM5A 5GP9A 2DA1A 4MIMA 5GPCA 1LFUP 2WB1N 4HNVA 1RETA 3LNQA 3GTKJ 1JKPC 3ZOBA 4BXXJ 1BL0A 1GVDA 4QTRA 4EEFG 4I6ZA 3BR5A 2H1KA 3JRIA 1JUPA 2CQXA 4FE4A 2DMUA 1FTZA 2FD5A 3G1OA 2NVXJ 4NDLA 4A3KJ 2N8GA 4JX6A 1U9OA 5M3MJ 3RKQA 2O8KA 3JRGA 2TCTA 3CDLA 2ECBA 2WV1A 1X58A 3SFIA 3TEDA 1R9TJ 1JT0A 2HOSA 3BTIA 2HOAA 3BR3A 2G0EA 2FX0A 2VI6A 2X48A 5J1YA 4C3IJ 4UUSB 2CQQA 4JX5A 5HODA 4X1EA 1Z77A 4A93J 3Q0WA 5FJ8J 9ANTA 1T56A 4M3EA 5FLMJ 1W0TA 1MBFA 1P7IA 2YU9J 4A3JJ 3PO3J 4ABZA 1Q1VA 5F0CA 2HXOA 5EZGA 2LR8A 5IP9J 1AHDP 1MBEA 2MG4A 4BY1J 4Y7NJ 2E19A 2DA7A 4A3IJ 2NVYJ 4MO7A 1QVTA 2X6OA 2LY9A 1ETQA 1OJLA 5M5XJ 1IJWC 2ECCA 5FLVA 3NARA 3HKZN 1DU6A 4AC0A 1HOMA 5E3LA 3HGGA 5F0HA 1B8IA 2LTPA 2E2JJ 5DTDA 1WI3A 2JA6J 3G1MA 3S15J 1OFCX 2L7FP 1MSFC 1AKHA 4XRSG 5C3EJ 3HOUJ 2DMQA 5E3MA 3A02A 3JRHA 1SANA 2CU7A 1MBHA 2I10A 5GPAA 4DYRA 1IGNA 4IHXA 2FJ1A 1IV6A 4RBOA 1IDYA 3RQIA 4M3DA 1VFCA 1HF0A 5IP7J 3HGYA 3GTMJ 1ZKGA 1RPWA 2ID3A 3FISA 1UG2A 1ORKA 3K2AA 4IHWA 4A3BJ 4DYQA 3IV5A 5EG0B 2O7OA 1AU7A 2DMTA 1MBJA 3JR9A 4A3MJ 4AYBN 3S1QJ 2GBYA 3HOYJ 2M9HA 1WGXA 3DCFA 3MVPA 3TP3A 2LLKA 1IUFA 4BY7J 3HOWJ 4CYCB 4V2GA 2Y31A 2VUMJ 1JTYA 4M3FA 3BG5A 2QCOA 3ZQIA 3O8GA 4JX4A 2DMPA 2R92J 2R5ZB 2XB5A 3WHCA 2XSDC 3GTOJ 2K40A 3PO2J 4DYCA 2DA3A 5EF6A 2LVSA 1O4XA 2R5ZA 2EH3A 3ZQGA 2P81A 2CJJA 1JUSA 4Y52J 1MBKA 2HYJA 5FKKA 3Q0UA 3OSGA 1Y1VJ 2NVTJ 1WH7A 1A6IA 5F1JA 3TW6A 1F43A 1MH3A 1ZR4A 2DTZA 1QVUA 1OCPA 4M6VA 2DA4A 4XRMA 1IC8A 2HQ5A 1YRNA 1ZTRA 1CQTA 4CYCA 3GTPJ 4BBRJ 4IHYA 1RKWA 4XK4A 3HOZJ 5IP6A 3FK7A 3K7AJ 3TP0A 3BR6A 2NOGA 1APLC 1X2NA 4W1UA 1ITYA 1XS9A 1VNDA 1JKRC 3W6VA 5F08A 2RAEA 1WPKA 1VI0A 1GT0C 2DA6A 5FKOA 1BW6A 1GV5A 1JUMA 4BKXA 4GFBA 1HDDC 2HXIA 1TWCJ 2ME6A 3LSGA 3CCYA 1NTCA 2LD5A 3S1MJ 3CMYA 2JA7J 5DS9A 2Y9YA 3FKIJ 2JJ7A 2JA5J 2H8RA 1GDTA 2X9DA 4D5CA 5F27A 3SDGA 1OCTC 2R7ZJ 3GTGJ 2L0KA 1NK2P 1ETOA 4MFEA 3B6CA 1ETKA 2OPTA 3IH2A 1QRYA 3HEFA 2VPRA 2NVQJ 1I3QJ 4DZJA 3SJMA 5J1UA 5F04A 2CRGA 2GM4A 3H0GJ 3MKLA 3I4NJ 5JLXA 5K7HA 3LSRA 5M5YJ 1D5YA 3LSJA 1MNMC 3Q0VA 5E3NA 5FKNA 4W97A 2CUEA 3FK6A 3S1NJ 2E2IJ 1ZK8A 2R93J 1FIPA 3GTLJ 2B63J 2JK3A 1JTXA 2W48A 5FKLA 1U78A 2LK2A 3HB9A 3D1NI 2HDDA 2VKVA 3ZQCA 3BQZA 5IYCJ 3JRCA 4A3DJ 4BBSJ 3S1RJ 4V2FA 3IH4A 2XB0X 2R5YA 2DJNA 1XG1A 5J3LA 3HBLA 3G1LA 1TWGJ 2R0QC 3S14J 2ID6A 1WCMJ 1IG7A 2XPWA 4A3GJ 3GTJJ 3BTLA 4M3GA 3OSFA 5EDNA 3Q3SA 1BW5A 5EEAA 2MW8A 3A01B 1PUFA 2EZKA 1HCRA 2JWTA 2M2EA 1ZR2A 4M3BA 3O8HA 3BTJA 2Y30A 2R5YB 1JT6A 1FTTA 1B8IB 4MLOA 2XGDA 2XRLA 3BT9A 2ME0A 3S2DJ 3QPSA 1U8BA 3IH3A 2NS7A 1HDPA 3OIOA 2EZHA 3FIWA 5IOZA 3M3YJ 4XICA 2JN6A 2QF7A 4FE7A 1E3OC 4A3FJ 5J1RA 5C44J 4C3HJ 3BG9A 4UUSA 2HI3A 3BR2A 3JRFA 3S17J 2PMZN 2KDZA 1POGA 2E2HJ 1P7JA 2ZB9A 4B4CA 1DU0A 5JLWA 3ZQFA 2IAIA 3JREA 2CUFA 1WH5A 5C4JJ 1HLVA 1Z0XA 2ELKA 2EZLA 2IEKA 1G2HA 1ENHA 3TW7A 3BR1A 4XIDA 4AUXA 5EGOA 1MSEC 4RDUA 3OOUA 1AKHB 1LE8B 1RKTA 2M0CA 1PUFB 1VF9A 1UMQA 2K9SA 4A69C 3A03A 5EG0A 4DW6A 4FTHA 4JP0A 4D7NA 1SFOJ 2JMWA 3BG3A 3S16J 1ZQ3P 3QPLA 4S0HB 4FCYA 1I6HJ 3CQZJ 5IYBJ 1H88C 2EQRA 1ETXA 3HOXJ 1TWAJ 1ETYA 3DEWA
chains in the Genus database with same CATH superfamily
3PNVA 2E71A 2O8XA 1LE8A 2Y69H 3QQAA 4U0YA 3U2RA 3F21A 4G9YA 3ZMSA 1F5TA 2VKEA 3SHFA 4BH9A 1PJRA 3HDDA 2K85A 2PFBA 1UELB 3OYIA 3OOPA 4JBAA 1W36D 4UUVA 2CO5A 3K0LA 4G6TB 4ENMA 5K7ZA 2DFHA 3QYEA 3K6GA 1E3HA 4HW0A 1S7EA 2BBYA 4G6QA 3MN2A 3H0DA 4GDFA 3J7YJ 1U6GA 3BPVA 5BNGA 4RB2C 2RNGA 1W0UA 2GAUA 4J19A 1N77A 1FYLA 5L3CA 1I50J 3BTCA 3JRAA 3KIOA 1OPCA 3K4BA 4U0WA 4BYYA 1H89C 3OWTA 3M8FA 3ZXSA 5CKTA 4Y17A 4EJOA 4BE1A 1I39A 3M8EA 1W5CC 4MFDA 4DBQA 1AWCA 2QLZA 3M1CA 2X1EA 2V1DA 5KAIC 1C0WA 5M5WJ 3E6MA 3FXOA 2CWEA 2ZSIB 1BC8C 2XPVA 4YEJA 2CH0A 2QSHX 3E7LA 3OYGA 2E1OA 1LVAA 5IOYA 4KNYA 5CQGA 5KK1A 5DD8A 2PMZA 3E3VA 5EYRA 5J47A 2OUMA 3LSHA 3Q5FA 1SAUA 2FMLA 1LNWA 2AO9A 4BE2A 2BXZA 4CCJA 3MKWB 2CV1A 2O0YA 3DV8A 3V42A 2MLKA 4BUPA 2WBMA 3MMYB 2KT0A 5ILSA 4AYBA 2Y0SN 2HFHA 4GXOA 4HX4A 4KMFA 4IRGA 4RGSA 3ZR8X 5GAHJ 3L2RA 4RLQA 3IKTA 1N78A 3LOCA 2XHKA 4QSHA 1T33A 4PFPA 5E3OA 2MSYA 2X1DA 1RR7A 1Z1DA 2OU2A 3HXLA 4Y4RA 2ADUA 2NNYA 4HA8A 1TWFJ 2ZKZA 2TRTA 3ZMTA 1RR8C 3I4MJ 2HQAA 2L02A 1VQ6I 1EH8A 1GV2A 1TZLA 5GTIC 1VTNC 4KYWA 2LKPA 4GRIA 3PJRA 2WY7Q 1G59A 1E0EA 2DN0A 2LG4A 4BS9A 4A0ZA 2LKXA 4O3MA 4D5FA 1FYMA 4C30A 4ENKA 1XCVA 1TC3C 1DDNA 3RCOA 1X4OA 2I5UA 3HM5A 1FX7A 2X6WA 3ABKH 3MKZA 1T0FA 2PJPA 1LFUP 2BW3A 3CUOA 4IF4A 1Y39A 1FOKA 1WJCA 4OIOF 3GTKJ 1JKPC 4EATA 1V4RA 4LB6B 4B8XA 4QTRA 3EUHC 1BL0A 3BR5A 1EA3A 1JUPA 3ERED 1XD7A 2PQ8A 2FD5A 3LSIA 4LGWA 3EYYA 3AL0C 3ZMDA 2X6XA 4I0AA 4IO9F 4A3KJ 1XN7A 4JX6A 1U9OA 4GO1A 1WWXA 3ZMVA 3OYDA 3BWGA 2KIMA 2WV1A 3SFIA 1R9TJ 2HOSA 4L5JA 4BJ6C 2R7OA 2M0MA 2E34A 3C2HA 2G0EA 1R7JA 2CV2A 2CMPA 2L9NA 5ICGA 3H36A 2LRDA 3I0TA 5J8CA 2X48A 3E5XA 5B66C 4C3IJ 3OYMA 4B44A 3DPLC 4DOZA 2MA3A 3WG7H 1T56A 3E1SA 4M3EA 5E18F 4BAYA 2Q2EA 2A61A 3REOA 2HYFA 3D5RC 3CMAI 3PO3J 4ABZA 2EILH 2CGPA 1I3AA 2HXOA 4A6EA 5EZGA 1AHDP 4OMZA 2EINH 3WGHA 1QO0D 4XLAA 1F4KA 2M5WA 4MO7A 3WTUC 2EPFA 1QVTA 2X6OA 2Z5UA 1OJLA 3SDBA 3WTZA 3OS1A 1I5ZA 1RIOH 1JHHA 4RGUA 1UG0A 2RDPA 5E3LA 4HDVA 2IA1A 5F0HA 2D1VA 2HYGD 1Y0NA 3TOBA 1J59A 3SQNA 1PP7U 4HLXA 1FYKA 3HHHA 5JR3A 3FXQA 4XRSG 3CCEI 4PUSA 5FD5A 3OYNA 5GPAA 1MBHA 4DYRA 1IGNA 1TNSA 4IHXA 5GAGJ 2V1XA 1JGSA 1IV6A 1Z21A 2XUBA 1R5ID 3BDDA 1HF0A 4LK1F 1YLFA 3HGYA 3FISA 1RI7A 3K2AA 1D1AA 3KCCA 3ASOH 2JT1A 4DYQA 2VQLA 3CCRI 4AWXB 2B0LA 3W2VA 5EG0B 2KHMA 2GOMA 2MD5A 2PJRA 1SD7A 4U7DA 3F72A 3C18A 3RJPA 2YR2A 3HOYJ 1WGXA 2GA1A 3MVPA 3TP3A 2XROA 2LLKA 2YX4A 4BY7J 4BEHB 1W4MA 3M07A 4V2GA 3T1BA 3TO7A 2GXBA 2QCOA 2NYXA 3DTKA 3O8GA 4NB5A 1KYWA 2R5ZB 2XB5A 3HKZA 1HXDA 4PJNA 4KMUX 5DDGA 2R92J 2KPMA 2HU9A 3HJEA 3PO2J 2VQGA 3CP2A 4O5VA 2F4IA 1O4XA 4ZC3A 2FNAA 2P8TA 2X1CA 2XAHA 3HRMA 2EH3A 3N05A 3F8BA 3DWLE 5FKKA 3HTSB 2IS1A 3OSGA 4AVPA 2K02A 2DI3A 1WH7A 1WKMA 1F43A 1MJ9A 1R1TA 4M6VA 1RUOA 3ONQA 2DA4A 4XRMA 4F92B 1CQTA 1P4AA 4BBRJ 3K4JA 3VFZA 5IP6A 2VJ5A 3F8MA 4IJAA 4CA0A 2VASA 1FNNA 2W00A 3K1PA 2KDOA 2LREA 3KZIC 4DBRA 1CF7B 2O6GE 2XAJA 4UVAA 2JUGA 4FT8A 4Y13A 1SD6A 3C1DA 3RKWA 3W6VA 1IRXA 2FXAA 2M7AA 1VI0A 1GT0C 3OY9A 5LD2C 1JUMA 3KEQA 4ENJA 4G7ZF 2NVUB 1FMVA 1WVRA 1TT0A 4LMYA 5CVRA 2JA7J 4J01A 3KP7A 3BZKA 1BM9A 5DCMA 3CJRB 3FKIJ 4RAZA 2JJ7A 2JA5J 2X9DA 1XPXA 2KJCA 3OL3A 5BQTA 2FOKA 1S3JA 2R7VA 1ZLKA 1ZLJA 2H6CA 1NK2P 4MFEA 3LFKA 2BVLA 3IH2A 1QRYA 1YX3A 3J7AO 2GZWA 2VE9A 2KKOA 3GW2A 1ODDA 2IT0A 4AU7A 1P9QC 3SJMA 4U88A 2L3DA 5J1UA 1Y8RB 5LFAA 4XSXF 1CGPA 4LFUA 3N97A 1G3YA 4GYIA 4UNOA 3FM5A 2AXTC 3R4KA 4WXDA 3CD6I 3LSJA 2LYCA 1OR7C 3HTUA 5CVVA 5FKNA 2L54A 3IAS2 1IW7F 1WJAA 3VB2A 4II2A 1L0OC 2L9SA 4CCNA 3VWBA 5HLGA 5D5UB 2R93J 4BXUA 1FIPA 1KZHA 2M87A 3LAJA 2IRFG 2HPMA 3HB9A 4I2OA 4M73A 3WE3A 1EKEA 2HDDA 2PX9A 3JRCA 2VE8A 4V2FA 1D5VA 2XF6A 3OYBA 3S3OA 4M9SA 2CS3A 3TGNA 3FBNB 3HBLA 2R0QC 3WU2C 2EA2A 3EUHA 3HSEA 1M1EB 1FSHA 5HDNA 4OIRF 2FBIA 2F2EA 2MW8A 4HQEA 2VN2A 1PUFA 3J81K 3KPHA 1HCRA 2V1UA 1OCRH 2VT3A 4YFKF 2M2EA 5HLHA 3IRRA 1ZR2A 1O3QA 4G7OF 3PL8A 2Y48A 2Y30A 3QYFA 1XSXA 4P96A 3HIFA 2BY1A 2IP2A 2XGDA 3CDHA 3KP4A 4ZZLA 1IN5A 3IH3A 1U8BA 1U3EM 3EPZA 2NS7A 1HDPA 3VSLA 5J6XA 3FIWA 4XICA 5FFZA 3WE2A 4I09A 3DEEA 3ISPA 3I9V2 5C44J 1FOWA 2ZXWH 4YELA 4BACA 4KISA 3BJAA 3KE2A 2PJRB 3S17J 2DOEA 3WU1B 2PMZN 3FMSA 2MH9A 4Y33A 2X51A 3ZN0A 2MH2A 3MZYA 1SFXA 4XLPF 3NEUA 3W2WA 2W7NA 2XVCA 5LEJA 1A31A 5C4JJ 3U21A 1HLVA 4AM3A 2UXNA 1UHWA 2M4GA 4RM2A 4Y3OA 1VQ4I 3AFHA 2CFOA 4S05A 1B9NA 1ENHA 3TW7A 2A6TA 3BR1A 1D1CA 1L3LA 2W84A 3GXOA 3R61A 4AUXA 2JRMA 5E8IA 3CC7I 1YJWI 1LKXA 5LGTA 4R1HA 3VYTB 1IXSB 1TNTA 4IOAF 2WC2A 2M3AA 4H0EA 4X0GA 1MZBA 1VF9A 2QWWA 2PG4A 5EG0A 5DV5A 1FP2A 1R4MB 3G73A 4G6DA 3L2UA 3WTTC 1SFOJ 2DT7B 3QPLA 4FCYA 1U5TC 3P5JA 4H4KC 4KJZA 2IA2A 2EQRA 3HPGA 3HOXJ 4CICA 3KP3A 4PZJA 4B47A 3EYIA 1HKQA 2FUG2 4OINF 3H3VK 3I59A 2IS6A 4OOIA 5L3BA 2A69F 3KP2A 1Z3XA 5FKMA 4ZJZA 5KVRA 2VONA 1TBXA 1ZREA 3ZQHA 3BQYA 1ETWA 4CYDA 1UFMA 2ESNA 2PN6A 4KIGA 4RAYA 4MGRA 3WHBA 2HVQA 1KQ8A 1B4AA 4L5IA 4TV7A 2BHZA 4RB3C 1SFUA 1RESA 4B1RA 5F0FA 2LF8A 2Y2ZA 2BEOA 2GLOA 3BOQA 3F0CA 1HSTA 3F8FA 5HOOA 4HF2A 1HKTA 5IPAA 2EZIA 4JOMA 4HPQA 3M7GA 3JAMZ 1A04A 2XGEA 2P5KA 5EJCA 3HOVJ 2R3SA 3RPUA 2G9WA 2MGQA 1A36A 1TWHJ 2K9NA 2YUSA 2F5CA 1V54H 4KIBA 2ZC2A 4HNTA 2BW3B 3QP5A 5D8KB 3KEYA 2E1MB 2IPQX 1SMYF 1WJBA 3ZPLA 2MBFA 5LGNA 2Z3YA 2LMDA 3BPXA 1ERDA 3BLYA 5LHHA 1H8AC 3BR0A 4KT5C 2QSGX 2J5PA 4L5EA 2Y75A 3P7NA 2DFIA 2DA2A 1UAAA 4UY8I 1YX5A 3GFLA 1W36C 4LB5A 3OR2C 2VBWA 1XGNA 5CVIA 1ZHFA 2AXLA 2O9LA 4D9JA 3KP6A 4M6YA 2NS8A 2ISYA 5AONA 2K27A 2XGXA 1YRNB 1UHSA 1Z05A 1I1SA 2P4WA 4E7ZA 5K5RA 3S3NA 2DODA 2KISA 4BHCA 3G4SI 4HRIA 2ZMEB 4ETSA 5J4VA 4BDZA 4A3CJ 1ZAOA 3QWLA 1IRZA 3DKXA 2HZDA 4DZPA 4C3JJ 2LP0A 1Z9CA 5LHGA 2M34A 3RZOJ 1X3UA 1K78A 4X6AJ 2YPRA 1KGSA 2Z99A 4RM3A 4JYKA 2XGCA 4G12A 3CTAA 2OZ6A 3C2BA 3GBGA 4C9YA 1K83J 4XL9A 4F52A 2VPLA 1XC5A 1KYZA 2Q1ZB 3SZTA 3KZZA 2COBA 2JVGA 4Q5SF 3CUQC 5D4SA 3DTIA 4RS8A 4QPQA 3VODA 2B9SA 3CLQA 1VQ7I 2DOFA 2QZ8A 2OQGA 3DF8A 3DBLB 1R58A 3R6SA 1MD0A 3NWSA 3I59B 1AA7A 4LOCA 1GXQA 1MNDA 3TMOA 3WTXC 2FBHA 2R7FA 1I27A 3LA2A 3VYSB 2V6EA 4B3XA 5GPCA 2F5FA 3DP7A 4HNVA 1K6YA 4EJUA 4KN4X 2W57A 1WJFA 5CPRB 4WK8F 4BXXJ 2VQHA 2X0LA 4I6ZA 3HUGB 4P5OA 1D0XA 4YFNF 3JRIA 5ICCA 2MLGA 2CQXA 4CCOA 2CQNA 1HQCA 2NVXJ 1IN6A 3BP8A 1YW8A 2ESHA 2TDXA 2HS5A 5M3MJ 2BOLA 3TDZC 3VDXA 2EV6A 1UB9A 4XLEA 1OYIA 3V8KA 2O8KA 3CDLA 1VQ9I 1O7FA 5HS8A 3TEDA 2OCCH 3FXUA 3KLNA 2IGNA 3BR3A 4EM1A 1OQYA 3FMRA 2UV1A 4ZTFA 3TDUC 2VI6A 3GUDA 1E3PA 1QZZA 4JX5A 3L2VA 1BI2A 1ULYA 4X1EA 3FMQA 2JRTA 1U5TB 3NQOA 1LPQA 4A93J 4NNJA 2VOPA 3IWFA 2F6CA 3PFIA 3Q0WA 4NC6A 4Q4ZF 2ELJA 1T95A 3WU0A 5BOXA 4KUMA 2XASA 1YW9A 1Q1VA 2FF4A 2R7WA 3CCVI 5IP9J 3JTHA 1MBEA 4K2EA 3H5RA 3G2BA 4WCGA 4BY1J 4XOTA 3NRVA 4WXHA 1WJEA 3R60A 5ED4A 2QQAA 2CQ7A 3S32A 3HOSA 5M5XJ 1OCOH 3E6CC 4XONA 4KT6A 2ECCA 1NHAA 3NARA 3HKZN 3LA3A 4CCMA 4AC0A 3HGGA 2CYYA 2EA4A 4J00A 4XLCA 2RVCA 4ASNA 1H9TA 3S15J 3TO9A 3SYTA 5HLTA 2HVSA 1AKHA 2VLAA 1TLHB 5DD4A 1IAWA 4XKWA 3D0SA 4IXAA 2DMQA 3Q9VA 4XOPA 3FXRA 2V4JC 1SANA 1XMKA 4CCLA 3I53A 4ENNA 1IDYA 3RQIA 4M3DA 3ZQ7A 1VFCA 2V6CA 4BGDA 4OMYA 3G6EI 2DOAA 1YI2I 2HEOA 4ESJA 2ICWG 3QRFF 2VODA 3AL0B 2VXDA 2FBKA 2E1MC 3PQKA 1T08B 3H5NA 4L9NA 4IHWA 3MZ8A 1ZRFA 4BDYA 2VT2A 3DTEA 1K6OA 1YW7A 1GHCA 1UCRA 5L3EA 1ZELA 3E6DA 4A3MJ 1J09A 2EV5A 2GBYA 1QHGA 3PNYA 3DCFA 2ZFWA 3SZGA 3OYLA 4XSZF 5FGMA 3T8TA 1VQKI 3SZPA 2Y31A 3I4PA 1SD5A 4E7JA 2BVMA 1G3WA 1LDJA 4JX4A 3J7ZI 3WHCA 2FA5A 5LEKA 1VZ0A 3DLAA 3GTOJ 4XKBA 4CZZA 2OQRA 4NUBA 1XGMA 3ZQQA 3KP5A 4R8HA 4N9HA 1WJDA 4LLGF 1ON2A 3KFWX 3ZQGA 2P81A 3K70D 3FXKA 2EWNA 1RC9A 2JA2A 1MBKA 3ML6A 2HVRA 4Y52J 2DT5A 4XORA 3VOEA 3SXYA 1GLNA 2VBZA 3EETA 1SMTA 1HSJA 5KCMA 1ZR4A 3QPTA 1OCPA 1MMAA 2D1HA 5CLSA 4GYGA 1IC8A 1FT9A 1S9HA 5DUKA 2GQQA 3CUQB 3GTPJ 1IXRC 2G7UA 1RKWA 3H9JA 1K78B 2H1LA 3H92A 1LQ1A 1MIJA 3CCLI 2JUCA 3S2WA 4RAFA 1YG2A 4BNCA 2DQLA 1APLC 1W7PA 1JKRC 1Z3YA 4YG2F 3KYLA 5F08A 1IF1A 3JSPA 2QM3A 4PSXA 5FKOA 3TBIA 1GV5A 2DDAA 2HDWA 4G7HF 3IL2A 1RRJA 3X2QH 4FASD 2HXIA 1TWCJ 2ME6A 2UUZA 1HDDC 4C2TA 2IGOA 2IJLA 4BL0B 3K4NA 4AIDA 5DS9A 1BR2A 3A1YA 1NG6A 2MABA 1DUXC 1Z6RA 1GDTA 2MYSA 2PI0A 2B7EA 4D5CA 1VQPI 5F27A 3CC2I 1VQNI 1STZA 1T2KA 4I01A 2K4BA 2L0KA 1ETOA 2BE5F 1FOYA 2E1NA 4L18B 2OPTA 1MDMA 1DGWY 4HX8A 3C2GA 2CQKA 2VPRA 1SFKA 3IRQA 1I3QJ 3CJNA 1FBQA 4B43A 4DZJA 4MTEA 1QZYA 2CFXA 4E4HA 3QP6A 2CRGA 2GM4A 4P55A 1N25A 3MKLA 2PMHA 2DQRA 2STTA 5JLXA 3LSRA 3I4NJ 4HF0A 3RSNA 4RGXA 5M5YJ 1D5YA 1T6SA 1MNMC 4ON0A 5EEHA 3LQRA 4UB6C 3ASNH 3FK6A 1ZK8A 2OZUA 2KL4A 4HNUA 2JK3A 2W48A 4AD9A 5HNHA 2KIFA 1MKMA 2E5ZA 3WGGA 1DGRM 1R1VA 1Y8QB 3D1NI 2C6YA 2HKXA 3HG9A 4KIFA 3DPTA 2VQCA 4M74A 2O3FA 1VQOI 3K4MA 3W2AA 2EFPA 3LMMA 2EFNA 3PIOF 2BHYA 3HRSA 3S14J 2ID6A 4BQOA 1GXPA 1IG7A 5DM7F 3BTLA 3GEZA 3ABMH 1Y56A 3HRUA 5EEAA 3GFJA 4M9XA 4CZCA 3A01B 2EV0A 3IP4B 5LRRA 4ZZDA 4PGHA 4NC8A 3H5AA 4M3BA 5FLXZ 4ZDOA 3K70C 2E5NA 1JT6A 4EMSA 1W1WE 1FTTA 5GAEJ 1ZARA 4YIRX 2L4MA 3BT9A 4O6JA 3QPSA 3DBRB 4U0VA 5IOZA 3CCQI 4FE7A 3GZNB 1YHQI 3ABUA 5E8GA 1J2XA 2XAUA 3RKYA 1IUYA 2P0WA 3MAJA 2Z16A 1E3OC 2E1CA 2XC7A 1R4NB 4UHTA 1BIBA 4DGWB 2XKPA 3BG9A 2JPCA 3BR2A 4UUSA 1YIOA 2OC6A 3JRFA 3VYRB 1R49A 2QQ8A 2HDCA 3LFUA 2ZB9A 1X3WB 4B4CA 2Q2EB 3QU6A 2RV8A 2GIVA 3SFZA 2W24A 3ZQFA 3WTWC 2IAIA 3JREA 3CO7C 1WH5A 4MNUA 1Z0XA 2VKDA 2ZJ2A 2IEKA 5D5XB 2LH9A 2Z2SB 1ZYRF 4PJ0C 3TO6A 2G7HA 4XM3A 2ELHA 1PDNC 2VJ4A 1E2XA 2VC1A 4XKVA 3B73A 3E0JB 2JSCA 3O6BB 2NAZA 3H3ZA 1O3SA 4XNFA 1TQIA 1XGOA 2A6EF 3L9FA 3K10A 4Y15A 1UMQA 2EIJH 5L3DA 2ZNZA 3IKVA 2KIUA 4FTHA 2ZXHA 4XBFA 1R23A 1IXCA 3HSRA 3V4GA 3BG3A 5E79C 3S16J 3OIQA 1ZQ3P 2W85A 1QZEA 2L2OA 3CQZJ 5LHIA 1J7KA 2DAOA 2K7LA 3LAPA 3UNGC 1CF7A 4N4OB 2CV0A 1ETYA 1BBYA 3BROA 1JKOC 2V79A 2IS2A 3U1KA 1TTYA 2O03A 2P5LC 2E7XA 1ZGAA 2RNJA 2HPIA 2L7ZA 3FWEA 1BJZA 4D0PA 4A3EJ 4AIJA 2VJJA 3QU3A 3TL4X 4EVIA 2VB6A 4HOBA 1B72B 3LL7A 2R7RA 2FNPA 1YTYA 2L9VA 4RB0A 3E5UA 2XAFA 5IT9Z 4RGRA 1MH4A 3VSKA 3IWZA 4IEJA 2R7SA 1T8IA 1K7AA 1HW1A 2L9RA 5DCMB 4S04A 2L7MP 3K4CA 3Q9SA 4OIPF 2K3PA 2PLYA 3FXLA 4MEYF 4D7MA 5TGTA 1BC7C 4A3LJ 2L01A 3WTSC 4MHGA 2RN7A 5EGOB 1KA8A 4IHSA 2D2WA 3ZCOA 3H35A 4A5NA 4IKFA 5GTHC 3L1PA 3O3KA 5HVQC 1BA5A 4A12A 2STWA 1EF4A 3HRTA 3QYBA 1G3SA 3LQQA 3EQLF 3RI4A 2QKLB 3OS0A 3C3WA 2UZKA 2E60A 4Z6YA 1HKSA 3ZMZA 4XLHA 2GIZA 4QIWN 3OYHA 1GUUA 3NWTA 2RKHA 2A3SA 3I58A 3FHZA 5BS6A 3K4KA 2DA5A 2JA8J 4IHVA 5FRNA 1NH3A 2QYOA 1U8RA 2R4GA 2HTJA 4ZYGA 3GMEA 4FQGA 4XMYA 2LNBA 1JJ6C 3FX3A 3W6JB 2K3FA 2OF7A 1Y1WJ 1JGGA 2HOEA 2DO7A 3GTQJ 3B6AA 5DM6F 1XSVA 3LSPA 1QU3A 2BGCA 5HNFA 1B1BA 4G94A 3JSOA 1MDMB 2Q0OA 2YX7A 3JRDA 1FIAA 1YS6A 1TW3A 3GVAA 3VPRA 2DMNA 1X2MA 3M9AA 2BY0A 4FX0A 3NAUA 4IVNA 2Y9ZA 2HR3A 4R79A 3JRBA 1OYWA 4GGGA 2XAQA 2ZJPF 2IGMA 3MWMA 4CH7A 4BHPA 2KFDA 4CGZA 5A2QK 4F93B 3MFKA 2Z33A 1IDZA 2XPUA 1J9IA 3FBIB 5D8LB 1LFBA 4U7BA 1LEAA 3LSKA 4E7SA 3UR3C 4WX9A 3DLLF 3C7JA 1F9NA 5FROA 2DYRH 4A0XA 2YS9A 4IQJA 4RMNA 5K5QA 3TKYA 2WV0A 2XDVA 4AIKA 3BG7A 2HNHA 3RZDJ 3TQNA 2HZTA 3M1EA 1X4PA 4BJTA 5ERIA 5GP9A 1D3YA 4EGZA 3CCSI 2V7FA 2XAGA 4DIQA 3LNQA 2F4OB 3CLOA 3DPUA 1FPQA 3ZOBA 1YS7A 5TJJA 1U0JA 2ZXIA 3K1NA 5HLIA 4BQQA 1FWZA 4L0YB 1T39A 2FEZA 4FE4A 2DMUA 5D5VB 1FTZA 1DP7P 2M1BA 1BI3A 3IUOA 4CUGA 1XSDA 1R36A 3T5XA 1SAXA 2HWVA 4B09A 3RKQA 4MQVA 2YU3A 3JRGA 2EIMH 1X58A 5D6EA 1JT0A 1NG7A 1FY7A 3CP8A 3BTIA 2HOAA 4OWRB 1O3RA 1S7OA 3AG2H 1I1GA 4QPOA 1LDKB 2FX0A 2DXIA 1EV7A 5FRMA 3ZMUA 3P9KA 3L7WA 4UUSB 5HODA 1XDUA 3OYKA 3D5SC 3FF5A 5D5WB 3OS2A 5FJ8J 9ANTA 2COMA 2ZMEC 5FLMJ 1V5FA 5KNLA 1MBFA 2YU9J 2NRAC 4PGGA 4A3JJ 2H09A 4G8XA 4ZYAA 3WG9A 2AQEA 2P7VB 1BR4A 1N75A 2QBYB 1ZRCA 2FE3A 2DA7A 2NVYJ 3CESA 4EV0A 2LY9A 3HSFA 1ETQA 4WF2A 1F1ZA 2ZNYA 2BV6A 2QA4I 1SC7A 2DYSH 3V7SA 1HOMA 4ESBA 2DW4A 5J40A 2EJRA 1TW2A 1ONVA 4OU0A 2RC4A 2R7TA 2LTPA 5DTDA 1WI3A 4OAYA 2JA6J 1E17A 2L7FP 1HA8A 1MSFC 4ZYHA 5AIQA 3HOUJ 3A4CA 3PNTA 5E3MA 4UVCA 2RQPA 4BE0A 1WHUA 2M8EA 1FLIA 2CU7A 2I10A 3K9TA 4CSWA 5JVTA 3JTGA 2LOOA 3CF5F 4RBOA 1IRGA 2A6HF 2DU9A 2AS5F 5IP7J 4IQ4A 3HPHA 1SVMA 1KQ9A 1ZKGA 2ID3A 3GTMJ 1UG2A 1ORKA 1X3ZB 2WAEA 1X19A 3FXMA 4M9ZA 4A3BJ 5DCFA 2Q8KA 4E7IA 2XRNA 2LC2A 2O7OA 2ISZA 5JI6A 4KN7X 5JHFA 4EQQA 3OYJA 3MKYB 1VQLI 4IRIA 3S1QJ 4GCVA 4XR6A 2M9HA 5H2FC 1SEUA 1IUFA 1OKRA 1H9GA 4CYCB 4HF1A 2VUMJ 1JI8A 1RUNA 1SVLA 3OR1C 3ZQIA 3P9IA 2V1NA 2NNNA 2OTLI 2OA4A 5FLXK 2H94A 3KETA 3V7RA 1UHMA 2DA3A 3S8PA 5EF6A 2R5ZA 1ZG3A 2P7CB 1PYVA 2W25A 2HTSA 3RQ4A 2UWMA 3ELKA 2CUJA 5D4RA 4FX4A 4BEHA 4FETA 1K4SA 1YFHA 1JUSA 2DK8A 1P4WA 5HS9A 3GX4X 2KRCA 1Y1VJ 3HHGA 1YITI 2NVTJ 3QOEA 4JQFA 1A6IA 4D1QA 1D8JA 3TW6A 2FQ3A 2OD5A 1Z7UA 1QVUA 3CJTB 5CQEA 3K2ZA 3FM3A 1MJAA 2HQ5A 4XLFA 1YRNA 4CYCA 3BCAA 2XF5A 4MEXF 4PCQA 1V5EA 4L9JA 1RZ4A 2RQQA 3RIRA 4EJVA 1LDDA 3GYHX 4XK4A 3WTYC 2ACJA 1VQ8I 3HYIA 4ITVA 3EUAA 3HOZJ 3A0BC 3FK7A 5KAFC 3TP0A 2IVMA 4PJMA 1QNTA 2OJED 3RYPA 2NOGA 1D0ZA 3T0YA 3PSFA 4HZFA 3AG1H 4WXCA 4IHTA 3GF2A 4E7KA 2RAEA 1KQ0A 2R7UA 2DA6A 4PSWA 4F3QA 4Q47A 1BW6A 4N9IA 1P6RA 4RAGA 2GA2A 3H9GA 4P1WA 4BKXA 3G3ZA 3QPHA 1J75A 3LSGA 4QLCU 2LD5A 1OMIA 1WRJA 1RNLA 1R5HA 2A07F 4I0BA 3ESWB 5ILVA 2ZJRF 1W7PD 3HUGA 2H27A 1QHHD 2WAFA 4YIFA 1QA6A 1O7LA 3KYCB 3HL2A 4I7HA 4HV5A 1LVKA 3RPQA 3RDIA 3CC4I 1B9MA 3F3XA 4LIUA 3GTGJ 2R7ZJ 2RGVA 1WJ5A 4IZZA 3MQ0A 3HEFA 4HYEA 2NVQJ 1O57A 1KU2A 1USSA 3F8CA 3DU6A 3CUQA 2HQRA 2X4HA 1KU9A 2ZJQF 1P92A 1MW7A 2OCEA 2W4SA 3H0GJ 4PFOA 4KICA 4DNCA 2XIGA 2CW7A 1D1BA 3Q0VA 5E3NA 4EJWA 4W97A 4HG2A 2ZXJA 4KA4A 2E2IJ 5CJ9A 2EB7A 3DU5A 3GTLJ 5KHDA 2B63J 1JTXA 4QWQA 1MNEA 2JSPA 1K4TA 2VKVA 3ZQCA 3CZ6A 2VJIA 3BQZA 3JCUC 4BBSJ 5E1ZB 3S1RJ 2ZO4A 2EIKH 2NS0A 3RPUD 2V9VA 2R5YA 2DJNA 3QODA 2WWYA 4BJ5C 3WODF 4IOCF 3CJQB 4P9FA 1TWGJ 1EH7A 3R0JA 5H6QA 5J8FA 4A3GJ 2XPWA 1XMXA 1ZRDA 4M3GA 2Y0MA 2W1OA 1BW5A 5LLQA 4DQ2A 4UV8A 2EZKA 3LSMA 1FBUA 2JWTA 1R00A 3LSTA 3I64A 2BXYA 4BQAA 2YSRA 3BTJA 1FP1D 3KLOA 1YIJI 2DFEA 1PUEE 5HDGA 1B8IB 1JHFA 2ME0A 3L00A 1V55H 2DDBA 3OIOA 3BJ6A 2JN6A 1QBJA 2QF7A 2GWRA 5TISC 1XTAA 2L7KA 2BY3A 1P2FA 4C3HJ 5CVUA 2HI3A 4LITA 2KDZA 1POGA 4ZYDA 4HBLA 2E2HJ 4N0BA 2LDUA 1Y0UA 4IL6C 4M72A 5JLWA 2CUFA 2W82A 3OL4A 2DK5A 5ICFA 3MCZA 2P6TA 2ELKA 2EZLA 1G2HA 1UZCA 2QENA 2K4JA 1XDSA 2VIXA 5EGOA 3PIPF 2ZBKA 3HC7A 4ZDPA 3OYCA 1MSEC 3OOUA 2A68F 1YJNI 1U5TA 1XB4A 2M0CA 3CO6C 1PUFB 3JAMK 4XRFA 2KIQA 4CXFA 4I99C 2K9SA 2K9LA 5IT9K 2ETHA 3A03A 2LBFA 4DW6A 2ZCWA 3GWZA 2V26A 4JP0A 4D7NA 3HZJA 4F55A 5ILUA 4LJZF 3EUKL 1JE8A 2DT6A 5H20A 4UXNA 1QPMA 1Z91A 4F91B 2LF7A 1H88C 1ETXA 4RA2A 5FD6A 2QBYA 3DEWA 4BXFA 4IRHA 1MMDA 3VEPA 1ETVA 3CCJI 3H9QA 4E70A 2VOOA 2K9QA 1P4XA 2Z1DA 5F1RA 1OISA 1FJLA 4PJJA 5B3SH 1NK3P 2F48A 1SVOA 5ICEA 1DPRA 2R7QA 3I5UA 1S8NA 3RKXA 4B3AA 1QPIA 4HLYA 4XLNF 4L9TA 4AVZA 2EBIA 1K61A 1X1AA 1YJ9I 3UKGA 1WFXA 5K7FA 4Q48A 2DLLA 2OV7A 2ZMEA 5E17F 1U9NA 3E6BA 4LG3A 4PDKA 3KX2A 4FISA 1ZGWA 1D8KA 3PQJA 1HC8A 5FO5A 2X6YA 4BQNA 3SEZA 3M4OJ 2H6BA 4HAMA 5JHUA 4LD5A 1X1PA 5AIPA 1JKQC 1B72A 3DEUA 1LJ9A 3AKZA 3QAHA 4HSTA 3OYFA 1Y6IA 3HOTA 3FZVA 3DXJF 2WAQN 2P5VA 3S3MA 2K5CA 2EK5A 4JK1X 2WY8Q 5IYDJ 2QEXI 2K86A 3EDPA 3L2WA 2GXGA 4V19K 4HV6A 2F5DA 2VL8A 4C2MJ 1OR7A 3PM1A 4I76A 1O3TA 5C4XJ 1J5YA 5JFRA 1BOBA 5EEGA 4XRSA 3S2HJ 4Z2YA 2O5RA 2JPBA 1JXSA 1OLTA 1JJ8C 2ZSHB 1KU3A 1ZG5A 5HDKA 2J5OA 1HBXG 2D45A 4EGYA 1KU7A 2QSFX 2OBPA 5D6FA 2FU4A 3GFIA 1F36A 1FC3A 2VBXA 1HW5A 2BYVE 2WA0A 2DTRA 3B02A 3AG4H 2FQ4A 3FXJA 3U1DA 3CMMA 2IBDA 5JVGF 3ROUA 3J80K 4MQ9F 1MBGA 2DPUA 1TL8A 4NQWB 4XN3A 3ZQLA 4DJAA 3LWFA 3ZGKA 1WZ2A 3V8JA 2D5VA 1A5JA 4N4NB 2M8GX 1Z67A 5EZHA 1W5TA 4C2UA 2AHQA 1PVEA 1SD4A 4I02A 4UUTA 3J81Z 1TT5B 2VKHA 3A01A 1B6AA 1KONA 2WB1A 4UV9A 3L2CA 5M3FJ 2AQFA 3L09A 2LFBA 4LG0A 5BMZA 3BCBA 2EFOA 2RREA 4XN0A 1XGSA 4ZTJA 3SEQA 2HOTA 2KP6A 2KZVA 3KZYA 3AG3H 1MMNA 1WI9A 1A35A 3A0HC 1FEXA 1ZG1A 1LB2A 5IY5H 1OCZH 3I71A 2DA1A 4MIMA 2WB1N 4PJLA 1XX5A 1RETA 2GOXB 1GVDA 4EEFG 1DPUA 2H1KA 1G3TA 2O61A 1B59A 2PBIA 3KYDB 4YIIA 1H0MA 3G1OA 4NDLA 3W6KB 1ZH5A 1IRFA 1XCBA 2N8GA 3GLXA 2PMUA 4ESFA 1ON1A 4OAZA 2TCTA 3ABTA 1FBSA 2ECBA 2JQ7A 1S6LA 3ECHA 4ZH4F 4OIQF 2DJIA 4A6DA 2K9MA 3PUFA 2WAQA 5J1YA 4PK4A 3OYAA 2DPDA 2BZTA 3E5QA 2CQQA 3P9CA 1QGPA 1Z77A 3T8RA 1VQ5I 1VQMI 5L3FA 2LSOA 1ZN2A 1W0TA 4IPAA 3GFMA 1MMGA 4CO8A 1P7IA 3ABLH 1SFEA 2MD0A 3KEOA 4E7LA 3K69A 5F0CA 2F5VA 5F64A 4E6KG 3CCUI 2LR8A 3IHUA 5BPDA 2MG4A 2MC4A 4Y7NJ 2E19A 3GLLA 3F22A 4A3IJ 3BY6A 3S93A 2EFWA 1FZPB 4KDPA 4B48A 1IJWC 4KITB 3FKJA 3ZP5A 4P9UA 3K1MA 5FLVA 4HEA2 1K79A 2FRHA 3FDYA 1DU6A 1XMAA 1B8IA 1EH6A 4XKCA 2E2JJ 3G1MA 4L0ZB 1OFCX 2IXSA 2PEXA 4UVBA 3IAM2 4RLFA 5C3EJ 2GXAA 3GO5A 1LFPA 3A02A 5LBQA 3JRHA 3M8JA 2FJ1A 2XKOA 5FB2A 3ERMA 3BZ6A 3CDIA 2KRFA 4M71A 1RPWA 3DKWA 4I98B 3F6OA 3VYUB 1MJBA 4LG0B 3IV5A 1AU7A 3BJOA 2DMTA 1IV8A 3U9GA 1MBJA 1FMWA 2JTVA 5H6RA 4AYBN 3JR9A 2E35A 1TP4A 2Y0SA 3H3UA 2M30A 2QGUA 1V3FA 4AIHA 2HGCA 2OTJI 2IS4A 4XQFA 3HOWJ 2VC0A 3MZHA 1G4DA 3RTRA 1JTYA 1R22A 3DFGA 4M3FA 3BG5A 4ZYEA 3OMYA 2DMPA 4NQWA 3PSIA 3F23A 1S5LC 2XSDC 3J7AY 1BOAA 2K40A 4DYCA 2V9PA 1BN5A 2LVSA 2IW5A 2M45A 3QOPA 2CJJA 5LGUA 3ZN1A 1G8XA 2HYJA 4EM2A 2VXZA 1QQIA 4WWCA 2QKMB 3Q0UA 3F6VA 1UJ8A 5HS7A 1OCCH 1T98A 2X85A 5F1JA 1MH3A 2DTZA 2A5WA 4BHBA 1ZTRA 5CYVA 3N4MA 3W3CA 2XF7A 3E97A 1EJ9A 3TOAA 3LA7A 2UXXA 4IHYA 2OAZA 1YOVB 2QVOA 2LY1A 3K7AJ 3BR6A 3IC7A 1IN8A 2XSJC 5FFXA 2DCEA 1X2NA 4W1UA 1R6RA 1ITYA 4RB1A 1VNDA 1XS9A 1J0RA 1BI0A 2M4KA 1WPKA 2A05A 4EJTA 1U2WA 1W5SA 4A5MA 4HQMA 3BZCA 3GZ5A 4L9VA 4GFBA 3ZRGA 1USTA 4FHTA 1BR1A 2F5EA 3CCYA 1NTCA 3S1MJ 3CMYA 2MFZA 2Y9YA 3ULQB 2H8WA 4BU2A 2XV4S 1TQMA 4YFXF 2H8RA 4UB8C 1A6QA 3SDGA 1OCTC 5DUIA 1FOXA 3B6CA 5DYMA 1ETKA 3MD2A 2E36A 1WQ2A 1IN4A 3OYEA 2ZFUA 2EFQA 1Z6TA 4LLLA 1R5GA 3MEXA 3L2QA 1MMSA 5F04A 5K7HA 2E7WA 1ZGJA 4M6XA 2NXNB 1Z7LA 3I3LA 1YO5C 4MTDA 2IGKA 3BG6A 1X1DA 3K4LA 1D0YA 1ACIA 1BI1A 4II3A 2CUEA 2CW8A 2KZGA 2HKOA 3S1NJ 3RYRA 2CSOA 3F9KA 1YYVA 3CCMI 2R7DA 3R0AA 1BJAA 1R1UA 5FKLA 1U78A 2LK2A 3GZ6A 3CF2A 3I54A 1FSEA 5F6FA 1T38A 4A2UA 1IZ1A 2A5YB 5E1XA 4NC7A 1IN7A 5IYCJ 6PAXA 4A3DJ 1IO2A 4LK0F 5J4YA 3IH4A 4LIVA 4KFCA 1OYYA 2XB0X 4HX7A 1XG1A 5J3LA 2QQ9A 4ANJA 2KQRA 2MC3A 3G1LA 2LKSA 4EM0B 2CUZA 1WCMJ 1GVJA 2LY2A 2FSWA 3GTJJ 3OSFA 1DQUA 1LUJB 2QQBA 5EDNA 3Q3SA 4IX7A 1REPC 2DBBA 5K1YA 1YE9A 5B1BH 3V8LA 2F4MB 3OIPA 2JVHA 1S72I 2WTEA 1S29A 3O8HA 5L3GA 3WGIA 1YQAA 2R5YB 1DP3A 5E1WA 3I56I 3PFYA 1LEBA 2FOWA 2IA0A 2JZYA 1HW2A 1W7PB 2P6SA 1X1CA 4MLOA 2LBFB 2XRLA 2FMYA 4CDGA 3S2DJ 3AAFA 5K5OA 4NHJA 4CHUA 4LLNA 3DBHB 2EZHA 3M3YJ 2V9KA 1X1BA 3G71I 5IT3A 5B1AH 4A3FJ 5J1RA 4HDUA 1S7AA 2L4AA 3H1CA 2R7XA 3DKYA 2CW0F 1BIAA 1P7JA 3PUBA 2DFFA 4HSRA 3O2PE 1DU0A 3COAC 2BY2A 4YRVA 3DQVC 3OV8A 4ZDLA 2HQNA 2I8DA 5GADJ 5E20A 2VBYA 1V5GA 1AOYA 1Q1HA 3BC8A 5TRDA 3JW4A 2L5QA 2QUFA 4U87A 4XIDA 1R71A 3CMEI 1I6XA 2M7BA 2NOJB 5B5EC 2Z9OA 3WTVC 5DEQA 5LRSA 4RDUA 1AKHB 3J80Z 2WADA 1LE8B 1RKTA 2KRHA 2KJBA 1MGTA 3GCMA 4A69C 3A2KA 3FHNA 4NBQA 2CG4A 2KMUA 4A0YA 1TQPA 5A2QZ 2JMWA 3D5LA 2KLOA 4CCKA 3F8NA 1T0FC 5CVJA 4E7HA 1G6NA 4S0HB 3I55I 1I6HJ 3ECOA 3V7CA 5IYBJ 5BPIA 1WSUA 1PP8F 1TWAJ 4F7ZA
chains in the Genus database with same CATH topology
1JKOC 1ETVA 3H3VK 1LE8A 2K9QA 3QQAA 1FJLA 1NK3P 5FKMA 2VKEA 3HDDA 2L7ZA 1BJZA 4A3EJ 3ZQHA 3BQYA 4B3AA 1QPIA 1ETWA 1B72B 2EBIA 1K61A 3UKGA 5K7FA 1U9NA 3WHBA 5K7ZA 1MH4A 4FISA 1S7EA 1ZGWA 3MN2A 4IEJA 1RESA 4B1RA 5F0FA 2L9RA 2Y2ZA 3M4OJ 5BNGA 1W0UA 2L7MP 2GLOA 3F0CA 4J19A 1JKQC 1B72A 1I50J 3BTCA 3JRAA 5IPAA 2EZIA 1H89C 4D7MA 2XGEA 3HOVJ 2MGQA 4A3LJ 1TWHJ 2K9NA 2WAQN 4MFDA 2YUSA 5EGOB 5IYDJ 5M5WJ 2XPVA 3L1PA 4C2MJ 3E7LA 1BA5A 1EF4A 3PM1A 4I76A 2E1OA 1H8AC 5IOYA 5C4XJ 3BR0A 5EYRA 4L5EA 4XRSA 3S2HJ 2DA2A 1JJ8C 2AO9A 4QIWN 1GUUA 2KT0A 2JA8J 2DA5A 2O9LA 1F36A 4IHVA 2Y0SN 2NS8A 2FQ4A 1YRNB 1UHSA 1JJ6C 2IBDA 2OF7A 1Y1WJ 1JGGA 3LOCA 3GTQJ 3B6AA 4QSHA 3LSPA 4A3CJ 1IRZA 1T33A 4DZPA 4C3JJ 1MBGA 2LP0A 5E3OA 2MSYA 2M34A 3RZOJ 3JRDA 1FIAA 4X6AJ 1RR7A 4JYKA 3VPRA 3ZQLA 2DMNA 2XGCA 4G12A 1X2MA 2D5VA 1TWFJ 1A5JA 2Y9ZA 2M8GX 2TRTA 3C2BA 3GBGA 1K83J 3NAUA 5EZHA 3I4MJ 1XC5A 2AHQA 3JRBA 4UUTA 2COBA 1GV2A 3A01A 5M3FJ 2DN0A 2LFBA 1IDZA 2XPUA 2LKXA 1LFBA 2HOTA 4D5FA 1TC3C 4LOCA 2YS9A 3RZDJ 1FEXA 3HM5A 5GP9A 2DA1A 4MIMA 5GPCA 1LFUP 2WB1N 4HNVA 1RETA 3LNQA 3GTKJ 1JKPC 3ZOBA 4BXXJ 1BL0A 1GVDA 4QTRA 4EEFG 4I6ZA 3BR5A 2H1KA 3JRIA 1JUPA 2CQXA 4FE4A 2DMUA 1FTZA 2FD5A 3G1OA 2NVXJ 4NDLA 4A3KJ 2N8GA 4JX6A 1U9OA 5M3MJ 3RKQA 2O8KA 3JRGA 2TCTA 3CDLA 2ECBA 2WV1A 1X58A 3SFIA 3TEDA 1R9TJ 1JT0A 2HOSA 3BTIA 2HOAA 3BR3A 2G0EA 2FX0A 2VI6A 2X48A 5J1YA 4C3IJ 4UUSB 2CQQA 4JX5A 5HODA 4X1EA 1Z77A 4A93J 3Q0WA 5FJ8J 9ANTA 1T56A 4M3EA 5FLMJ 1W0TA 1MBFA 1P7IA 2YU9J 4A3JJ 3PO3J 4ABZA 1Q1VA 5F0CA 2HXOA 5EZGA 2LR8A 5IP9J 1AHDP 1MBEA 2MG4A 4BY1J 4Y7NJ 2E19A 2DA7A 4A3IJ 2NVYJ 4MO7A 1QVTA 2X6OA 2LY9A 1ETQA 1OJLA 5M5XJ 1IJWC 2ECCA 5FLVA 3NARA 3HKZN 1DU6A 4AC0A 1HOMA 5E3LA 3HGGA 5F0HA 1B8IA 2LTPA 2E2JJ 5DTDA 1WI3A 2JA6J 3G1MA 3S15J 1OFCX 2L7FP 1MSFC 1AKHA 4XRSG 5C3EJ 3HOUJ 2DMQA 5E3MA 3A02A 3JRHA 1SANA 2CU7A 1MBHA 2I10A 5GPAA 4DYRA 1IGNA 4IHXA 2FJ1A 1IV6A 4RBOA 1IDYA 3RQIA 4M3DA 1VFCA 1HF0A 5IP7J 3HGYA 3GTMJ 1ZKGA 1RPWA 2ID3A 3FISA 1UG2A 1ORKA 3K2AA 4IHWA 4A3BJ 4DYQA 3IV5A 5EG0B 2O7OA 1AU7A 2DMTA 1MBJA 3JR9A 4A3MJ 4AYBN 3S1QJ 2GBYA 3HOYJ 2M9HA 1WGXA 3DCFA 3MVPA 3TP3A 2LLKA 1IUFA 4BY7J 3HOWJ 4CYCB 4V2GA 2Y31A 2VUMJ 1JTYA 4M3FA 3BG5A 2QCOA 3ZQIA 3O8GA 4JX4A 2DMPA 2R92J 2R5ZB 2XB5A 3WHCA 2XSDC 3GTOJ 2K40A 3PO2J 4DYCA 2DA3A 5EF6A 2LVSA 1O4XA 2R5ZA 2EH3A 3ZQGA 2P81A 2CJJA 1JUSA 4Y52J 1MBKA 2HYJA 5FKKA 3Q0UA 3OSGA 1Y1VJ 2NVTJ 1WH7A 1A6IA 5F1JA 3TW6A 1F43A 1MH3A 1ZR4A 2DTZA 1QVUA 1OCPA 4M6VA 2DA4A 4XRMA 1IC8A 2HQ5A 1YRNA 1ZTRA 1CQTA 4CYCA 3GTPJ 4BBRJ 4IHYA 1RKWA 4XK4A 3HOZJ 5IP6A 3FK7A 3K7AJ 3TP0A 3BR6A 2NOGA 1APLC 1X2NA 4W1UA 1ITYA 1XS9A 1VNDA 1JKRC 3W6VA 5F08A 2RAEA 1WPKA 1VI0A 1GT0C 2DA6A 5FKOA 1BW6A 1GV5A 1JUMA 4BKXA 4GFBA 1HDDC 2HXIA 1TWCJ 2ME6A 3LSGA 3CCYA 1NTCA 2LD5A 3S1MJ 3CMYA 2JA7J 5DS9A 2Y9YA 3FKIJ 2JJ7A 2JA5J 2H8RA 1GDTA 2X9DA 4D5CA 5F27A 3SDGA 1OCTC 2R7ZJ 3GTGJ 2L0KA 1NK2P 1ETOA 4MFEA 3B6CA 1ETKA 2OPTA 3IH2A 1QRYA 3HEFA 2VPRA 2NVQJ 1I3QJ 4DZJA 3SJMA 5J1UA 5F04A 2CRGA 2GM4A 3H0GJ 3MKLA 3I4NJ 5JLXA 5K7HA 3LSRA 5M5YJ 1D5YA 3LSJA 1MNMC 3Q0VA 5E3NA 5FKNA 4W97A 2CUEA 3FK6A 3S1NJ 2E2IJ 1ZK8A 2R93J 1FIPA 3GTLJ 2B63J 2JK3A 1JTXA 2W48A 5FKLA 1U78A 2LK2A 3HB9A 3D1NI 2HDDA 2VKVA 3ZQCA 3BQZA 5IYCJ 3JRCA 4A3DJ 4BBSJ 3S1RJ 4V2FA 3IH4A 2XB0X 2R5YA 2DJNA 1XG1A 5J3LA 3HBLA 3G1LA 1TWGJ 2R0QC 3S14J 2ID6A 1WCMJ 1IG7A 2XPWA 4A3GJ 3GTJJ 3BTLA 4M3GA 3OSFA 5EDNA 3Q3SA 1BW5A 5EEAA 2MW8A 3A01B 1PUFA 2EZKA 1HCRA 2JWTA 2M2EA 1ZR2A 4M3BA 3O8HA 3BTJA 2Y30A 2R5YB 1JT6A 1FTTA 1B8IB 4MLOA 2XGDA 2XRLA 3BT9A 2ME0A 3S2DJ 3QPSA 1U8BA 3IH3A 2NS7A 1HDPA 3OIOA 2EZHA 3FIWA 5IOZA 3M3YJ 4XICA 2JN6A 2QF7A 4FE7A 1E3OC 4A3FJ 5J1RA 5C44J 4C3HJ 3BG9A 4UUSA 2HI3A 3BR2A 3JRFA 3S17J 2PMZN 2KDZA 1POGA 2E2HJ 1P7JA 2ZB9A 4B4CA 1DU0A 5JLWA 3ZQFA 2IAIA 3JREA 2CUFA 1WH5A 5C4JJ 1HLVA 1Z0XA 2ELKA 2EZLA 2IEKA 1G2HA 1ENHA 3TW7A 3BR1A 4XIDA 4AUXA 5EGOA 1MSEC 4RDUA 3OOUA 1AKHB 1LE8B 1RKTA 2M0CA 1PUFB 1VF9A 1UMQA 2K9SA 4A69C 3A03A 5EG0A 4DW6A 4FTHA 4JP0A 4D7NA 1SFOJ 2JMWA 3BG3A 3S16J 1ZQ3P 3QPLA 4S0HB 4FCYA 1I6HJ 3CQZJ 5IYBJ 1H88C 2EQRA 1ETXA 3HOXJ 1TWAJ 1ETYA 3DEWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JKO C;  1ETV A;  3H3V K;  1LE8 A;  2K9Q A;  3QQA A;  1FJL A;  1NK3 P;  5FKM A;  2VKE A;  3HDD A;  2L7Z A;  1BJZ A;  4A3E J;  3ZQH A;  3BQY A;  4B3A A;  1QPI A;  1ETW A;  1B72 B;  2EBI A;  1K61 A;  3UKG A;  5K7F A;  1U9N A;  3WHB A;  5K7Z A;  1MH4 A;  4FIS A;  1S7E A;  1ZGW A;  3MN2 A;  4IEJ A;  1RES A;  4B1R A;  5F0F A;  2L9R A;  2Y2Z A;  3M4O J;  5BNG A;  1W0U A;  2L7M P;  2GLO A;  3F0C A;  4J19 A;  1JKQ C;  1B72 A;  1I50 J;  3BTC A;  3JRA A;  5IPA A;  2EZI A;  1H89 C;  4D7M A;  2XGE A;  3HOV J;  2MGQ A;  4A3L J;  1TWH J;  2K9N A;  2WAQ N;  4MFD A;  2YUS A;  5EGO B;  5IYD J;  5M5W J;  2XPV A;  3L1P A;  4C2M J;  3E7L A;  1BA5 A;  1EF4 A;  3PM1 A;  4I76 A;  2E1O A;  1H8A C;  5IOY A;  5C4X J;  3BR0 A;  5EYR A;  4L5E A;  4XRS A;  3S2H J;  2DA2 A;  1JJ8 C;  2AO9 A;  4QIW N;  1GUU A;  2KT0 A;  2JA8 J;  2DA5 A;  2O9L A;  1F36 A;  4IHV A;  2Y0S N;  2NS8 A;  2FQ4 A;  1YRN B;  1UHS A;  1JJ6 C;  2IBD A;  2OF7 A;  1Y1W J;  1JGG A;  3LOC A;  3GTQ J;  3B6A A;  4QSH A;  3LSP A;  4A3C J;  1IRZ A;  1T33 A;  4DZP A;  4C3J J;  1MBG A;  2LP0 A;  5E3O A;  2MSY A;  2M34 A;  3RZO J;  3JRD A;  1FIA A;  4X6A J;  1RR7 A;  4JYK A;  3VPR A;  3ZQL A;  2DMN A;  2XGC A;  4G12 A;  1X2M A;  2D5V A;  1TWF J;  1A5J A;  2Y9Z A;  2M8G X;  2TRT A;  3C2B A;  3GBG A;  1K83 J;  3NAU A;  5EZH A;  3I4M J;  1XC5 A;  2AHQ A;  3JRB A;  4UUT A;  2COB A;  1GV2 A;  3A01 A;  5M3F J;  2DN0 A;  2LFB A;  1IDZ A;  2XPU A;  2LKX A;  1LFB A;  2HOT A;  4D5F A;  1TC3 C;  4LOC A;  2YS9 A;  3RZD J;  1FEX A;  3HM5 A;  5GP9 A;  2DA1 A;  4MIM A;  5GPC A;  1LFU P;  2WB1 N;  4HNV A;  1RET A;  3LNQ A;  3GTK J;  1JKP C;  3ZOB A;  4BXX J;  1BL0 A;  1GVD A;  4QTR A;  4EEF G;  4I6Z A;  3BR5 A;  2H1K A;  3JRI A;  1JUP A;  2CQX A;  4FE4 A;  2DMU A;  1FTZ A;  2FD5 A;  3G1O A;  2NVX J;  4NDL A;  4A3K J;  2N8G A;  4JX6 A;  1U9O A;  5M3M J;  3RKQ A;  2O8K A;  3JRG A;  2TCT A;  3CDL A;  2ECB A;  2WV1 A;  1X58 A;  3SFI A;  3TED A;  1R9T J;  1JT0 A;  2HOS A;  3BTI A;  2HOA A;  3BR3 A;  2G0E A;  2FX0 A;  2VI6 A;  2X48 A;  5J1Y A;  4C3I J;  4UUS B;  2CQQ A;  4JX5 A;  5HOD A;  4X1E A;  1Z77 A;  4A93 J;  3Q0W A;  5FJ8 J;  9ANT A;  1T56 A;  4M3E A;  5FLM J;  1W0T A;  1MBF A;  1P7I A;  2YU9 J;  4A3J J;  3PO3 J;  4ABZ A;  1Q1V A;  5F0C A;  2HXO A;  5EZG A;  2LR8 A;  5IP9 J;  1AHD P;  1MBE A;  2MG4 A;  4BY1 J;  4Y7N J;  2E19 A;  2DA7 A;  4A3I J;  2NVY J;  4MO7 A;  1QVT A;  2X6O A;  2LY9 A;  1ETQ A;  1OJL A;  5M5X J;  1IJW C;  2ECC A;  5FLV A;  3NAR A;  3HKZ N;  1DU6 A;  4AC0 A;  1HOM A;  5E3L A;  3HGG A;  5F0H A;  1B8I A;  2LTP A;  2E2J J;  5DTD A;  1WI3 A;  2JA6 J;  3G1M A;  3S15 J;  1OFC X;  2L7F P;  1MSF C;  1AKH A;  4XRS G;  5C3E J;  3HOU J;  2DMQ A;  5E3M A;  3A02 A;  3JRH A;  1SAN A;  2CU7 A;  1MBH A;  2I10 A;  5GPA A;  4DYR A;  1IGN A;  4IHX A;  2FJ1 A;  1IV6 A;  4RBO A;  1IDY A;  3RQI A;  4M3D A;  1VFC A;  1HF0 A;  5IP7 J;  3HGY A;  3GTM J;  1ZKG A;  1RPW A;  2ID3 A;  3FIS A;  1UG2 A;  1ORK A;  3K2A A;  4IHW A;  4A3B J;  4DYQ A;  3IV5 A;  5EG0 B;  2O7O A;  1AU7 A;  2DMT A;  1MBJ A;  3JR9 A;  4A3M J;  4AYB N;  3S1Q J;  2GBY A;  3HOY J;  2M9H A;  1WGX A;  3DCF A;  3MVP A;  3TP3 A;  2LLK A;  1IUF A;  4BY7 J;  3HOW J;  4CYC B;  4V2G A;  2Y31 A;  2VUM J;  1JTY A;  4M3F A;  3BG5 A;  2QCO A;  3ZQI A;  3O8G A;  4JX4 A;  2DMP A;  2R92 J;  2R5Z B;  2XB5 A;  3WHC A;  2XSD C;  3GTO J;  2K40 A;  3PO2 J;  4DYC A;  2DA3 A;  5EF6 A;  2LVS A;  1O4X A;  2R5Z A;  2EH3 A;  3ZQG A;  2P81 A;  2CJJ A;  1JUS A;  4Y52 J;  1MBK A;  2HYJ A;  5FKK A;  3Q0U A;  3OSG A;  1Y1V J;  2NVT J;  1WH7 A;  1A6I A;  5F1J A;  3TW6 A;  1F43 A;  1MH3 A;  1ZR4 A;  2DTZ A;  1QVU A;  1OCP A;  4M6V A;  2DA4 A;  4XRM A;  1IC8 A;  2HQ5 A;  1YRN A;  1ZTR A;  1CQT A;  4CYC A;  3GTP J;  4BBR J;  4IHY A;  1RKW A;  4XK4 A;  3HOZ J;  5IP6 A;  3FK7 A;  3K7A J;  3TP0 A;  3BR6 A;  2NOG A;  1APL C;  1X2N A;  4W1U A;  1ITY A;  1XS9 A;  1VND A;  1JKR C;  3W6V A;  5F08 A;  2RAE A;  1WPK A;  1VI0 A;  1GT0 C;  2DA6 A;  5FKO A;  1BW6 A;  1GV5 A;  1JUM A;  4BKX A;  4GFB A;  1HDD C;  2HXI A;  1TWC J;  2ME6 A;  3LSG A;  3CCY A;  1NTC A;  2LD5 A;  3S1M J;  3CMY A;  2JA7 J;  5DS9 A;  2Y9Y A;  3FKI J;  2JJ7 A;  2JA5 J;  2H8R A;  1GDT A;  2X9D A;  4D5C A;  5F27 A;  3SDG A;  1OCT C;  2R7Z J;  3GTG J;  2L0K A;  1NK2 P;  1ETO A;  4MFE A;  3B6C A;  1ETK A;  2OPT A;  3IH2 A;  1QRY A;  3HEF A;  2VPR A;  2NVQ J;  1I3Q J;  4DZJ A;  3SJM A;  5J1U A;  5F04 A;  2CRG A;  2GM4 A;  3H0G J;  3MKL A;  3I4N J;  5JLX A;  5K7H A;  3LSR A;  5M5Y J;  1D5Y A;  3LSJ A;  1MNM C;  3Q0V A;  5E3N A;  5FKN A;  4W97 A;  2CUE A;  3FK6 A;  3S1N J;  2E2I J;  1ZK8 A;  2R93 J;  1FIP A;  3GTL J;  2B63 J;  2JK3 A;  1JTX A;  2W48 A;  5FKL A;  1U78 A;  2LK2 A;  3HB9 A;  3D1N I;  2HDD A;  2VKV A;  3ZQC A;  3BQZ A;  5IYC J;  3JRC A;  4A3D J;  4BBS J;  3S1R J;  4V2F A;  3IH4 A;  2XB0 X;  2R5Y A;  2DJN A;  1XG1 A;  5J3L A;  3HBL A;  3G1L A;  1TWG J;  2R0Q C;  3S14 J;  2ID6 A;  1WCM J;  1IG7 A;  2XPW A;  4A3G J;  3GTJ J;  3BTL A;  4M3G A;  3OSF A;  5EDN A;  3Q3S A;  1BW5 A;  5EEA A;  2MW8 A;  3A01 B;  1PUF A;  2EZK A;  1HCR A;  2JWT A;  2M2E A;  1ZR2 A;  4M3B A;  3O8H A;  3BTJ A;  2Y30 A;  2R5Y B;  1JT6 A;  1FTT A;  1B8I B;  4MLO A;  2XGD A;  2XRL A;  3BT9 A;  2ME0 A;  3S2D J;  3QPS A;  1U8B A;  3IH3 A;  2NS7 A;  1HDP A;  3OIO A;  2EZH A;  3FIW A;  5IOZ A;  3M3Y J;  4XIC A;  2JN6 A;  2QF7 A;  4FE7 A;  1E3O C;  4A3F J;  5J1R A;  5C44 J;  4C3H J;  3BG9 A;  4UUS A;  2HI3 A;  3BR2 A;  3JRF A;  3S17 J;  2PMZ N;  2KDZ A;  1POG A;  2E2H J;  1P7J A;  2ZB9 A;  4B4C A;  1DU0 A;  5JLW A;  3ZQF A;  2IAI A;  3JRE A;  2CUF A;  1WH5 A;  5C4J J;  1HLV A;  1Z0X A;  2ELK A;  2EZL A;  2IEK A;  1G2H A;  1ENH A;  3TW7 A;  3BR1 A;  4XID A;  4AUX A;  5EGO A;  1MSE C;  4RDU A;  3OOU A;  1AKH B;  1LE8 B;  1RKT A;  2M0C A;  1PUF B;  1VF9 A;  1UMQ A;  2K9S A;  4A69 C;  3A03 A;  5EG0 A;  4DW6 A;  4FTH A;  4JP0 A;  4D7N A;  1SFO J;  2JMW A;  3BG3 A;  3S16 J;  1ZQ3 P;  3QPL A;  4S0H B;  4FCY A;  1I6H J;  3CQZ J;  5IYB J;  1H88 C;  2EQR A;  1ETX A;  3HOX J;  1TWA J;  1ETY A;  3DEW A; 
#chains in the Genus database with same CATH topology
 3PNV A;  2E71 A;  2O8X A;  1LE8 A;  2Y69 H;  3QQA A;  4U0Y A;  3U2R A;  3F21 A;  4G9Y A;  3ZMS A;  1F5T A;  2VKE A;  3SHF A;  4BH9 A;  1PJR A;  3HDD A;  2K85 A;  2PFB A;  1UEL B;  3OYI A;  3OOP A;  4JBA A;  1W36 D;  4UUV A;  2CO5 A;  3K0L A;  4G6T B;  4ENM A;  5K7Z A;  2DFH A;  3QYE A;  3K6G A;  1E3H A;  4HW0 A;  1S7E A;  2BBY A;  4G6Q A;  3MN2 A;  3H0D A;  4GDF A;  3J7Y J;  1U6G A;  3BPV A;  5BNG A;  4RB2 C;  2RNG A;  1W0U A;  2GAU A;  4J19 A;  1N77 A;  1FYL A;  5L3C A;  1I50 J;  3BTC A;  3JRA A;  3KIO A;  1OPC A;  3K4B A;  4U0W A;  4BYY A;  1H89 C;  3OWT A;  3M8F A;  3ZXS A;  5CKT A;  4Y17 A;  4EJO A;  4BE1 A;  1I39 A;  3M8E A;  1W5C C;  4MFD A;  4DBQ A;  1AWC A;  2QLZ A;  3M1C A;  2X1E A;  2V1D A;  5KAI C;  1C0W A;  5M5W J;  3E6M A;  3FXO A;  2CWE A;  2ZSI B;  1BC8 C;  2XPV A;  4YEJ A;  2CH0 A;  2QSH X;  3E7L A;  3OYG A;  2E1O A;  1LVA A;  5IOY A;  4KNY A;  5CQG A;  5KK1 A;  5DD8 A;  2PMZ A;  3E3V A;  5EYR A;  5J47 A;  2OUM A;  3LSH A;  3Q5F A;  1SAU A;  2FML A;  1LNW A;  2AO9 A;  4BE2 A;  2BXZ A;  4CCJ A;  3MKW B;  2CV1 A;  2O0Y A;  3DV8 A;  3V42 A;  2MLK A;  4BUP A;  2WBM A;  3MMY B;  2KT0 A;  5ILS A;  4AYB A;  2Y0S N;  2HFH A;  4GXO A;  4HX4 A;  4KMF A;  4IRG A;  4RGS A;  3ZR8 X;  5GAH J;  3L2R A;  4RLQ A;  3IKT A;  1N78 A;  3LOC A;  2XHK A;  4QSH A;  1T33 A;  4PFP A;  5E3O A;  2MSY A;  2X1D A;  1RR7 A;  1Z1D A;  2OU2 A;  3HXL A;  4Y4R A;  2ADU A;  2NNY A;  4HA8 A;  1TWF J;  2ZKZ A;  2TRT A;  3ZMT A;  1RR8 C;  3I4M J;  2HQA A;  2L02 A;  1VQ6 I;  1EH8 A;  1GV2 A;  1TZL A;  5GTI C;  1VTN C;  4KYW A;  2LKP A;  4GRI A;  3PJR A;  2WY7 Q;  1G59 A;  1E0E A;  2DN0 A;  2LG4 A;  4BS9 A;  4A0Z A;  2LKX A;  4O3M A;  4D5F A;  1FYM A;  4C30 A;  4ENK A;  1XCV A;  1TC3 C;  1DDN A;  3RCO A;  1X4O A;  2I5U A;  3HM5 A;  1FX7 A;  2X6W A;  3ABK H;  3MKZ A;  1T0F A;  2PJP A;  1LFU P;  2BW3 A;  3CUO A;  4IF4 A;  1Y39 A;  1FOK A;  1WJC A;  4OIO F;  3GTK J;  1JKP C;  4EAT A;  1V4R A;  4LB6 B;  4B8X A;  4QTR A;  3EUH C;  1BL0 A;  3BR5 A;  1EA3 A;  1JUP A;  3ERE D;  1XD7 A;  2PQ8 A;  2FD5 A;  3LSI A;  4LGW A;  3EYY A;  3AL0 C;  3ZMD A;  2X6X A;  4I0A A;  4IO9 F;  4A3K J;  1XN7 A;  4JX6 A;  1U9O A;  4GO1 A;  1WWX A;  3ZMV A;  3OYD A;  3BWG A;  2KIM A;  2WV1 A;  3SFI A;  1R9T J;  2HOS A;  4L5J A;  4BJ6 C;  2R7O A;  2M0M A;  2E34 A;  3C2H A;  2G0E A;  1R7J A;  2CV2 A;  2CMP A;  2L9N A;  5ICG A;  3H36 A;  2LRD A;  3I0T A;  5J8C A;  2X48 A;  3E5X A;  5B66 C;  4C3I J;  3OYM A;  4B44 A;  3DPL C;  4DOZ A;  2MA3 A;  3WG7 H;  1T56 A;  3E1S A;  4M3E A;  5E18 F;  4BAY A;  2Q2E A;  2A61 A;  3REO A;  2HYF A;  3D5R C;  3CMA I;  3PO3 J;  4ABZ A;  2EIL H;  2CGP A;  1I3A A;  2HXO A;  4A6E A;  5EZG A;  1AHD P;  4OMZ A;  2EIN H;  3WGH A;  1QO0 D;  4XLA A;  1F4K A;  2M5W A;  4MO7 A;  3WTU C;  2EPF A;  1QVT A;  2X6O A;  2Z5U A;  1OJL A;  3SDB A;  3WTZ A;  3OS1 A;  1I5Z A;  1RIO H;  1JHH A;  4RGU A;  1UG0 A;  2RDP A;  5E3L A;  4HDV A;  2IA1 A;  5F0H A;  2D1V A;  2HYG D;  1Y0N A;  3TOB A;  1J59 A;  3SQN A;  1PP7 U;  4HLX A;  1FYK A;  3HHH A;  5JR3 A;  3FXQ A;  4XRS G;  3CCE I;  4PUS A;  5FD5 A;  3OYN A;  5GPA A;  1MBH A;  4DYR A;  1IGN A;  1TNS A;  4IHX A;  5GAG J;  2V1X A;  1JGS A;  1IV6 A;  1Z21 A;  2XUB A;  1R5I D;  3BDD A;  1HF0 A;  4LK1 F;  1YLF A;  3HGY A;  3FIS A;  1RI7 A;  3K2A A;  1D1A A;  3KCC A;  3ASO H;  2JT1 A;  4DYQ A;  2VQL A;  3CCR I;  4AWX B;  2B0L A;  3W2V A;  5EG0 B;  2KHM A;  2GOM A;  2MD5 A;  2PJR A;  1SD7 A;  4U7D A;  3F72 A;  3C18 A;  3RJP A;  2YR2 A;  3HOY J;  1WGX A;  2GA1 A;  3MVP A;  3TP3 A;  2XRO A;  2LLK A;  2YX4 A;  4BY7 J;  4BEH B;  1W4M A;  3M07 A;  4V2G A;  3T1B A;  3TO7 A;  2GXB A;  2QCO A;  2NYX A;  3DTK A;  3O8G A;  4NB5 A;  1KYW A;  2R5Z B;  2XB5 A;  3HKZ A;  1HXD A;  4PJN A;  4KMU X;  5DDG A;  2R92 J;  2KPM A;  2HU9 A;  3HJE A;  3PO2 J;  2VQG A;  3CP2 A;  4O5V A;  2F4I A;  1O4X A;  4ZC3 A;  2FNA A;  2P8T A;  2X1C A;  2XAH A;  3HRM A;  2EH3 A;  3N05 A;  3F8B A;  3DWL E;  5FKK A;  3HTS B;  2IS1 A;  3OSG A;  4AVP A;  2K02 A;  2DI3 A;  1WH7 A;  1WKM A;  1F43 A;  1MJ9 A;  1R1T A;  4M6V A;  1RUO A;  3ONQ A;  2DA4 A;  4XRM A;  4F92 B;  1CQT A;  1P4A A;  4BBR J;  3K4J A;  3VFZ A;  5IP6 A;  2VJ5 A;  3F8M A;  4IJA A;  4CA0 A;  2VAS A;  1FNN A;  2W00 A;  3K1P A;  2KDO A;  2LRE A;  3KZI C;  4DBR A;  1CF7 B;  2O6G E;  2XAJ A;  4UVA A;  2JUG A;  4FT8 A;  4Y13 A;  1SD6 A;  3C1D A;  3RKW A;  3W6V A;  1IRX A;  2FXA A;  2M7A A;  1VI0 A;  1GT0 C;  3OY9 A;  5LD2 C;  1JUM A;  3KEQ A;  4ENJ A;  4G7Z F;  2NVU B;  1FMV A;  1WVR A;  1TT0 A;  4LMY A;  5CVR A;  2JA7 J;  4J01 A;  3KP7 A;  3BZK A;  1BM9 A;  5DCM A;  3CJR B;  3FKI J;  4RAZ A;  2JJ7 A;  2JA5 J;  2X9D A;  1XPX A;  2KJC A;  3OL3 A;  5BQT A;  2FOK A;  1S3J A;  2R7V A;  1ZLK A;  1ZLJ A;  2H6C A;  1NK2 P;  4MFE A;  3LFK A;  2BVL A;  3IH2 A;  1QRY A;  1YX3 A;  3J7A O;  2GZW A;  2VE9 A;  2KKO A;  3GW2 A;  1ODD A;  2IT0 A;  4AU7 A;  1P9Q C;  3SJM A;  4U88 A;  2L3D A;  5J1U A;  1Y8R B;  5LFA A;  4XSX F;  1CGP A;  4LFU A;  3N97 A;  1G3Y A;  4GYI A;  4UNO A;  3FM5 A;  2AXT C;  3R4K A;  4WXD A;  3CD6 I;  3LSJ A;  2LYC A;  1OR7 C;  3HTU A;  5CVV A;  5FKN A;  2L54 A;  3IAS 2;  1IW7 F;  1WJA A;  3VB2 A;  4II2 A;  1L0O C;  2L9S A;  4CCN A;  3VWB A;  5HLG A;  5D5U B;  2R93 J;  4BXU A;  1FIP A;  1KZH A;  2M87 A;  3LAJ A;  2IRF G;  2HPM A;  3HB9 A;  4I2O A;  4M73 A;  3WE3 A;  1EKE A;  2HDD A;  2PX9 A;  3JRC A;  2VE8 A;  4V2F A;  1D5V A;  2XF6 A;  3OYB A;  3S3O A;  4M9S A;  2CS3 A;  3TGN A;  3FBN B;  3HBL A;  2R0Q C;  3WU2 C;  2EA2 A;  3EUH A;  3HSE A;  1M1E B;  1FSH A;  5HDN A;  4OIR F;  2FBI A;  2F2E A;  2MW8 A;  4HQE A;  2VN2 A;  1PUF A;  3J81 K;  3KPH A;  1HCR A;  2V1U A;  1OCR H;  2VT3 A;  4YFK F;  2M2E A;  5HLH A;  3IRR A;  1ZR2 A;  1O3Q A;  4G7O F;  3PL8 A;  2Y48 A;  2Y30 A;  3QYF A;  1XSX A;  4P96 A;  3HIF A;  2BY1 A;  2IP2 A;  2XGD A;  3CDH A;  3KP4 A;  4ZZL A;  1IN5 A;  3IH3 A;  1U8B A;  1U3E M;  3EPZ A;  2NS7 A;  1HDP A;  3VSL A;  5J6X A;  3FIW A;  4XIC A;  5FFZ A;  3WE2 A;  4I09 A;  3DEE A;  3ISP A;  3I9V 2;  5C44 J;  1FOW A;  2ZXW H;  4YEL A;  4BAC A;  4KIS A;  3BJA A;  3KE2 A;  2PJR B;  3S17 J;  2DOE A;  3WU1 B;  2PMZ N;  3FMS A;  2MH9 A;  4Y33 A;  2X51 A;  3ZN0 A;  2MH2 A;  3MZY A;  1SFX A;  4XLP F;  3NEU A;  3W2W A;  2W7N A;  2XVC A;  5LEJ A;  1A31 A;  5C4J J;  3U21 A;  1HLV A;  4AM3 A;  2UXN A;  1UHW A;  2M4G A;  4RM2 A;  4Y3O A;  1VQ4 I;  3AFH A;  2CFO A;  4S05 A;  1B9N A;  1ENH A;  3TW7 A;  2A6T A;  3BR1 A;  1D1C A;  1L3L A;  2W84 A;  3GXO A;  3R61 A;  4AUX A;  2JRM A;  5E8I A;  3CC7 I;  1YJW I;  1LKX A;  5LGT A;  4R1H A;  3VYT B;  1IXS B;  1TNT A;  4IOA F;  2WC2 A;  2M3A A;  4H0E A;  4X0G A;  1MZB A;  1VF9 A;  2QWW A;  2PG4 A;  5EG0 A;  5DV5 A;  1FP2 A;  1R4M B;  3G73 A;  4G6D A;  3L2U A;  3WTT C;  1SFO J;  2DT7 B;  3QPL A;  4FCY A;  1U5T C;  3P5J A;  4H4K C;  4KJZ A;  2IA2 A;  2EQR A;  3HPG A;  3HOX J;  4CIC A;  3KP3 A;  4PZJ A;  4B47 A;  3EYI A;  1HKQ A;  2FUG 2;  4OIN F;  3H3V K;  3I59 A;  2IS6 A;  4OOI A;  5L3B A;  2A69 F;  3KP2 A;  1Z3X A;  5FKM A;  4ZJZ A;  5KVR A;  2VON A;  1TBX A;  1ZRE A;  3ZQH A;  3BQY A;  1ETW A;  4CYD A;  1UFM A;  2ESN A;  2PN6 A;  4KIG A;  4RAY A;  4MGR A;  3WHB A;  2HVQ A;  1KQ8 A;  1B4A A;  4L5I A;  4TV7 A;  2BHZ A;  4RB3 C;  1SFU A;  1RES A;  4B1R A;  5F0F A;  2LF8 A;  2Y2Z A;  2BEO A;  2GLO A;  3BOQ A;  3F0C A;  1HST A;  3F8F A;  5HOO A;  4HF2 A;  1HKT A;  5IPA A;  2EZI A;  4JOM A;  4HPQ A;  3M7G A;  3JAM Z;  1A04 A;  2XGE A;  2P5K A;  5EJC A;  3HOV J;  2R3S A;  3RPU A;  2G9W A;  2MGQ A;  1A36 A;  1TWH J;  2K9N A;  2YUS A;  2F5C A;  1V54 H;  4KIB A;  2ZC2 A;  4HNT A;  2BW3 B;  3QP5 A;  5D8K B;  3KEY A;  2E1M B;  2IPQ X;  1SMY F;  1WJB A;  3ZPL A;  2MBF A;  5LGN A;  2Z3Y A;  2LMD A;  3BPX A;  1ERD A;  3BLY A;  5LHH A;  1H8A C;  3BR0 A;  4KT5 C;  2QSG X;  2J5P A;  4L5E A;  2Y75 A;  3P7N A;  2DFI A;  2DA2 A;  1UAA A;  4UY8 I;  1YX5 A;  3GFL A;  1W36 C;  4LB5 A;  3OR2 C;  2VBW A;  1XGN A;  5CVI A;  1ZHF A;  2AXL A;  2O9L A;  4D9J A;  3KP6 A;  4M6Y A;  2NS8 A;  2ISY A;  5AON A;  2K27 A;  2XGX A;  1YRN B;  1UHS A;  1Z05 A;  1I1S A;  2P4W A;  4E7Z A;  5K5R A;  3S3N A;  2DOD A;  2KIS A;  4BHC A;  3G4S I;  4HRI A;  2ZME B;  4ETS A;  5J4V A;  4BDZ A;  4A3C J;  1ZAO A;  3QWL A;  1IRZ A;  3DKX A;  2HZD A;  4DZP A;  4C3J J;  2LP0 A;  1Z9C A;  5LHG A;  2M34 A;  3RZO J;  1X3U A;  1K78 A;  4X6A J;  2YPR A;  1KGS A;  2Z99 A;  4RM3 A;  4JYK A;  2XGC A;  4G12 A;  3CTA A;  2OZ6 A;  3C2B A;  3GBG A;  4C9Y A;  1K83 J;  4XL9 A;  4F52 A;  2VPL A;  1XC5 A;  1KYZ A;  2Q1Z B;  3SZT A;  3KZZ A;  2COB A;  2JVG A;  4Q5S F;  3CUQ C;  5D4S A;  3DTI A;  4RS8 A;  4QPQ A;  3VOD A;  2B9S A;  3CLQ A;  1VQ7 I;  2DOF A;  2QZ8 A;  2OQG A;  3DF8 A;  3DBL B;  1R58 A;  3R6S A;  1MD0 A;  3NWS A;  3I59 B;  1AA7 A;  4LOC A;  1GXQ A;  1MND A;  3TMO A;  3WTX C;  2FBH A;  2R7F A;  1I27 A;  3LA2 A;  3VYS B;  2V6E A;  4B3X A;  5GPC A;  2F5F A;  3DP7 A;  4HNV A;  1K6Y A;  4EJU A;  4KN4 X;  2W57 A;  1WJF A;  5CPR B;  4WK8 F;  4BXX J;  2VQH A;  2X0L A;  4I6Z A;  3HUG B;  4P5O A;  1D0X A;  4YFN F;  3JRI A;  5ICC A;  2MLG A;  2CQX A;  4CCO A;  2CQN A;  1HQC A;  2NVX J;  1IN6 A;  3BP8 A;  1YW8 A;  2ESH A;  2TDX A;  2HS5 A;  5M3M J;  2BOL A;  3TDZ C;  3VDX A;  2EV6 A;  1UB9 A;  4XLE A;  1OYI A;  3V8K A;  2O8K A;  3CDL A;  1VQ9 I;  1O7F A;  5HS8 A;  3TED A;  2OCC H;  3FXU A;  3KLN A;  2IGN A;  3BR3 A;  4EM1 A;  1OQY A;  3FMR A;  2UV1 A;  4ZTF A;  3TDU C;  2VI6 A;  3GUD A;  1E3P A;  1QZZ A;  4JX5 A;  3L2V A;  1BI2 A;  1ULY A;  4X1E A;  3FMQ A;  2JRT A;  1U5T B;  3NQO A;  1LPQ A;  4A93 J;  4NNJ A;  2VOP A;  3IWF A;  2F6C A;  3PFI A;  3Q0W A;  4NC6 A;  4Q4Z F;  2ELJ A;  1T95 A;  3WU0 A;  5BOX A;  4KUM A;  2XAS A;  1YW9 A;  1Q1V A;  2FF4 A;  2R7W A;  3CCV I;  5IP9 J;  3JTH A;  1MBE A;  4K2E A;  3H5R A;  3G2B A;  4WCG A;  4BY1 J;  4XOT A;  3NRV A;  4WXH A;  1WJE A;  3R60 A;  5ED4 A;  2QQA A;  2CQ7 A;  3S32 A;  3HOS A;  5M5X J;  1OCO H;  3E6C C;  4XON A;  4KT6 A;  2ECC A;  1NHA A;  3NAR A;  3HKZ N;  3LA3 A;  4CCM A;  4AC0 A;  3HGG A;  2CYY A;  2EA4 A;  4J00 A;  4XLC A;  2RVC A;  4ASN A;  1H9T A;  3S15 J;  3TO9 A;  3SYT A;  5HLT A;  2HVS A;  1AKH A;  2VLA A;  1TLH B;  5DD4 A;  1IAW A;  4XKW A;  3D0S A;  4IXA A;  2DMQ A;  3Q9V A;  4XOP A;  3FXR A;  2V4J C;  1SAN A;  1XMK A;  4CCL A;  3I53 A;  4ENN A;  1IDY A;  3RQI A;  4M3D A;  3ZQ7 A;  1VFC A;  2V6C A;  4BGD A;  4OMY A;  3G6E I;  2DOA A;  1YI2 I;  2HEO A;  4ESJ A;  2ICW G;  3QRF F;  2VOD A;  3AL0 B;  2VXD A;  2FBK A;  2E1M C;  3PQK A;  1T08 B;  3H5N A;  4L9N A;  4IHW A;  3MZ8 A;  1ZRF A;  4BDY A;  2VT2 A;  3DTE A;  1K6O A;  1YW7 A;  1GHC A;  1UCR A;  5L3E A;  1ZEL A;  3E6D A;  4A3M J;  1J09 A;  2EV5 A;  2GBY A;  1QHG A;  3PNY A;  3DCF A;  2ZFW A;  3SZG A;  3OYL A;  4XSZ F;  5FGM A;  3T8T A;  1VQK I;  3SZP A;  2Y31 A;  3I4P A;  1SD5 A;  4E7J A;  2BVM A;  1G3W A;  1LDJ A;  4JX4 A;  3J7Z I;  3WHC A;  2FA5 A;  5LEK A;  1VZ0 A;  3DLA A;  3GTO J;  4XKB A;  4CZZ A;  2OQR A;  4NUB A;  1XGM A;  3ZQQ A;  3KP5 A;  4R8H A;  4N9H A;  1WJD A;  4LLG F;  1ON2 A;  3KFW X;  3ZQG A;  2P81 A;  3K70 D;  3FXK A;  2EWN A;  1RC9 A;  2JA2 A;  1MBK A;  3ML6 A;  2HVR A;  4Y52 J;  2DT5 A;  4XOR A;  3VOE A;  3SXY A;  1GLN A;  2VBZ A;  3EET A;  1SMT A;  1HSJ A;  5KCM A;  1ZR4 A;  3QPT A;  1OCP A;  1MMA A;  2D1H A;  5CLS A;  4GYG A;  1IC8 A;  1FT9 A;  1S9H A;  5DUK A;  2GQQ A;  3CUQ B;  3GTP J;  1IXR C;  2G7U A;  1RKW A;  3H9J A;  1K78 B;  2H1L A;  3H92 A;  1LQ1 A;  1MIJ A;  3CCL I;  2JUC A;  3S2W A;  4RAF A;  1YG2 A;  4BNC A;  2DQL A;  1APL C;  1W7P A;  1JKR C;  1Z3Y A;  4YG2 F;  3KYL A;  5F08 A;  1IF1 A;  3JSP A;  2QM3 A;  4PSX A;  5FKO A;  3TBI A;  1GV5 A;  2DDA A;  2HDW A;  4G7H F;  3IL2 A;  1RRJ A;  3X2Q H;  4FAS D;  2HXI A;  1TWC J;  2ME6 A;  2UUZ A;  1HDD C;  4C2T A;  2IGO A;  2IJL A;  4BL0 B;  3K4N A;  4AID A;  5DS9 A;  1BR2 A;  3A1Y A;  1NG6 A;  2MAB A;  1DUX C;  1Z6R A;  1GDT A;  2MYS A;  2PI0 A;  2B7E A;  4D5C A;  1VQP I;  5F27 A;  3CC2 I;  1VQN I;  1STZ A;  1T2K A;  4I01 A;  2K4B A;  2L0K A;  1ETO A;  2BE5 F;  1FOY A;  2E1N A;  4L18 B;  2OPT A;  1MDM A;  1DGW Y;  4HX8 A;  3C2G A;  2CQK A;  2VPR A;  1SFK A;  3IRQ A;  1I3Q J;  3CJN A;  1FBQ A;  4B43 A;  4DZJ A;  4MTE A;  1QZY A;  2CFX A;  4E4H A;  3QP6 A;  2CRG A;  2GM4 A;  4P55 A;  1N25 A;  3MKL A;  2PMH A;  2DQR A;  2STT A;  5JLX A;  3LSR A;  3I4N J;  4HF0 A;  3RSN A;  4RGX A;  5M5Y J;  1D5Y A;  1T6S A;  1MNM C;  4ON0 A;  5EEH A;  3LQR A;  4UB6 C;  3ASN H;  3FK6 A;  1ZK8 A;  2OZU A;  2KL4 A;  4HNU A;  2JK3 A;  2W48 A;  4AD9 A;  5HNH A;  2KIF A;  1MKM A;  2E5Z A;  3WGG A;  1DGR M;  1R1V A;  1Y8Q B;  3D1N I;  2C6Y A;  2HKX A;  3HG9 A;  4KIF A;  3DPT A;  2VQC A;  4M74 A;  2O3F A;  1VQO I;  3K4M A;  3W2A A;  2EFP A;  3LMM A;  2EFN A;  3PIO F;  2BHY A;  3HRS A;  3S14 J;  2ID6 A;  4BQO A;  1GXP A;  1IG7 A;  5DM7 F;  3BTL A;  3GEZ A;  3ABM H;  1Y56 A;  3HRU A;  5EEA A;  3GFJ A;  4M9X A;  4CZC A;  3A01 B;  2EV0 A;  3IP4 B;  5LRR A;  4ZZD A;  4PGH A;  4NC8 A;  3H5A A;  4M3B A;  5FLX Z;  4ZDO A;  3K70 C;  2E5N A;  1JT6 A;  4EMS A;  1W1W E;  1FTT A;  5GAE J;  1ZAR A;  4YIR X;  2L4M A;  3BT9 A;  4O6J A;  3QPS A;  3DBR B;  4U0V A;  5IOZ A;  3CCQ I;  4FE7 A;  3GZN B;  1YHQ I;  3ABU A;  5E8G A;  1J2X A;  2XAU A;  3RKY A;  1IUY A;  2P0W A;  3MAJ A;  2Z16 A;  1E3O C;  2E1C A;  2XC7 A;  1R4N B;  4UHT A;  1BIB A;  4DGW B;  2XKP A;  3BG9 A;  2JPC A;  3BR2 A;  4UUS A;  1YIO A;  2OC6 A;  3JRF A;  3VYR B;  1R49 A;  2QQ8 A;  2HDC A;  3LFU A;  2ZB9 A;  1X3W B;  4B4C A;  2Q2E B;  3QU6 A;  2RV8 A;  2GIV A;  3SFZ A;  2W24 A;  3ZQF A;  3WTW C;  2IAI A;  3JRE A;  3CO7 C;  1WH5 A;  4MNU A;  1Z0X A;  2VKD A;  2ZJ2 A;  2IEK A;  5D5X B;  2LH9 A;  2Z2S B;  1ZYR F;  4PJ0 C;  3TO6 A;  2G7H A;  4XM3 A;  2ELH A;  1PDN C;  2VJ4 A;  1E2X A;  2VC1 A;  4XKV A;  3B73 A;  3E0J B;  2JSC A;  3O6B B;  2NAZ A;  3H3Z A;  1O3S A;  4XNF A;  1TQI A;  1XGO A;  2A6E F;  3L9F A;  3K10 A;  4Y15 A;  1UMQ A;  2EIJ H;  5L3D A;  2ZNZ A;  3IKV A;  2KIU A;  4FTH A;  2ZXH A;  4XBF A;  1R23 A;  1IXC A;  3HSR A;  3V4G A;  3BG3 A;  5E79 C;  3S16 J;  3OIQ A;  1ZQ3 P;  2W85 A;  1QZE A;  2L2O A;  3CQZ J;  5LHI A;  1J7K A;  2DAO A;  2K7L A;  3LAP A;  3UNG C;  1CF7 A;  4N4O B;  2CV0 A;  1ETY A;  1BBY A;  3BRO A;  1JKO C;  2V79 A;  2IS2 A;  3U1K A;  1TTY A;  2O03 A;  2P5L C;  2E7X A;  1ZGA A;  2RNJ A;  2HPI A;  2L7Z A;  3FWE A;  1BJZ A;  4D0P A;  4A3E J;  4AIJ A;  2VJJ A;  3QU3 A;  3TL4 X;  4EVI A;  2VB6 A;  4HOB A;  1B72 B;  3LL7 A;  2R7R A;  2FNP A;  1YTY A;  2L9V A;  4RB0 A;  3E5U A;  2XAF A;  5IT9 Z;  4RGR A;  1MH4 A;  3VSK A;  3IWZ A;  4IEJ A;  2R7S A;  1T8I A;  1K7A A;  1HW1 A;  2L9R A;  5DCM B;  4S04 A;  2L7M P;  3K4C A;  3Q9S A;  4OIP F;  2K3P A;  2PLY A;  3FXL A;  4MEY F;  4D7M A;  5TGT A;  1BC7 C;  4A3L J;  2L01 A;  3WTS C;  4MHG A;  2RN7 A;  5EGO B;  1KA8 A;  4IHS A;  2D2W A;  3ZCO A;  3H35 A;  4A5N A;  4IKF A;  5GTH C;  3L1P A;  3O3K A;  5HVQ C;  1BA5 A;  4A12 A;  2STW A;  1EF4 A;  3HRT A;  3QYB A;  1G3S A;  3LQQ A;  3EQL F;  3RI4 A;  2QKL B;  3OS0 A;  3C3W A;  2UZK A;  2E60 A;  4Z6Y A;  1HKS A;  3ZMZ A;  4XLH A;  2GIZ A;  4QIW N;  3OYH A;  1GUU A;  3NWT A;  2RKH A;  2A3S A;  3I58 A;  3FHZ A;  5BS6 A;  3K4K A;  2DA5 A;  2JA8 J;  4IHV A;  5FRN A;  1NH3 A;  2QYO A;  1U8R A;  2R4G A;  2HTJ A;  4ZYG A;  3GME A;  4FQG A;  4XMY A;  2LNB A;  1JJ6 C;  3FX3 A;  3W6J B;  2K3F A;  2OF7 A;  1Y1W J;  1JGG A;  2HOE A;  2DO7 A;  3GTQ J;  3B6A A;  5DM6 F;  1XSV A;  3LSP A;  1QU3 A;  2BGC A;  5HNF A;  1B1B A;  4G94 A;  3JSO A;  1MDM B;  2Q0O A;  2YX7 A;  3JRD A;  1FIA A;  1YS6 A;  1TW3 A;  3GVA A;  3VPR A;  2DMN A;  1X2M A;  3M9A A;  2BY0 A;  4FX0 A;  3NAU A;  4IVN A;  2Y9Z A;  2HR3 A;  4R79 A;  3JRB A;  1OYW A;  4GGG A;  2XAQ A;  2ZJP F;  2IGM A;  3MWM A;  4CH7 A;  4BHP A;  2KFD A;  4CGZ A;  5A2Q K;  4F93 B;  3MFK A;  2Z33 A;  1IDZ A;  2XPU A;  1J9I A;  3FBI B;  5D8L B;  1LFB A;  4U7B A;  1LEA A;  3LSK A;  4E7S A;  3UR3 C;  4WX9 A;  3DLL F;  3C7J A;  1F9N A;  5FRO A;  2DYR H;  4A0X A;  2YS9 A;  4IQJ A;  4RMN A;  5K5Q A;  3TKY A;  2WV0 A;  2XDV A;  4AIK A;  3BG7 A;  2HNH A;  3RZD J;  3TQN A;  2HZT A;  3M1E A;  1X4P A;  4BJT A;  5ERI A;  5GP9 A;  1D3Y A;  4EGZ A;  3CCS I;  2V7F A;  2XAG A;  4DIQ A;  3LNQ A;  2F4O B;  3CLO A;  3DPU A;  1FPQ A;  3ZOB A;  1YS7 A;  5TJJ A;  1U0J A;  2ZXI A;  3K1N A;  5HLI A;  4BQQ A;  1FWZ A;  4L0Y B;  1T39 A;  2FEZ A;  4FE4 A;  2DMU A;  5D5V B;  1FTZ A;  1DP7 P;  2M1B A;  1BI3 A;  3IUO A;  4CUG A;  1XSD A;  1R36 A;  3T5X A;  1SAX A;  2HWV A;  4B09 A;  3RKQ A;  4MQV A;  2YU3 A;  3JRG A;  2EIM H;  1X58 A;  5D6E A;  1JT0 A;  1NG7 A;  1FY7 A;  3CP8 A;  3BTI A;  2HOA A;  4OWR B;  1O3R A;  1S7O A;  3AG2 H;  1I1G A;  4QPO A;  1LDK B;  2FX0 A;  2DXI A;  1EV7 A;  5FRM A;  3ZMU A;  3P9K A;  3L7W A;  4UUS B;  5HOD A;  1XDU A;  3OYK A;  3D5S C;  3FF5 A;  5D5W B;  3OS2 A;  5FJ8 J;  9ANT A;  2COM A;  2ZME C;  5FLM J;  1V5F A;  5KNL A;  1MBF A;  2YU9 J;  2NRA C;  4PGG A;  4A3J J;  2H09 A;  4G8X A;  4ZYA A;  3WG9 A;  2AQE A;  2P7V B;  1BR4 A;  1N75 A;  2QBY B;  1ZRC A;  2FE3 A;  2DA7 A;  2NVY J;  3CES A;  4EV0 A;  2LY9 A;  3HSF A;  1ETQ A;  4WF2 A;  1F1Z A;  2ZNY A;  2BV6 A;  2QA4 I;  1SC7 A;  2DYS H;  3V7S A;  1HOM A;  4ESB A;  2DW4 A;  5J40 A;  2EJR A;  1TW2 A;  1ONV A;  4OU0 A;  2RC4 A;  2R7T A;  2LTP A;  5DTD A;  1WI3 A;  4OAY A;  2JA6 J;  1E17 A;  2L7F P;  1HA8 A;  1MSF C;  4ZYH A;  5AIQ A;  3HOU J;  3A4C A;  3PNT A;  5E3M A;  4UVC A;  2RQP A;  4BE0 A;  1WHU A;  2M8E A;  1FLI A;  2CU7 A;  2I10 A;  3K9T A;  4CSW A;  5JVT A;  3JTG A;  2LOO A;  3CF5 F;  4RBO A;  1IRG A;  2A6H F;  2DU9 A;  2AS5 F;  5IP7 J;  4IQ4 A;  3HPH A;  1SVM A;  1KQ9 A;  1ZKG A;  2ID3 A;  3GTM J;  1UG2 A;  1ORK A;  1X3Z B;  2WAE A;  1X19 A;  3FXM A;  4M9Z A;  4A3B J;  5DCF A;  2Q8K A;  4E7I A;  2XRN A;  2LC2 A;  2O7O A;  2ISZ A;  5JI6 A;  4KN7 X;  5JHF A;  4EQQ A;  3OYJ A;  3MKY B;  1VQL I;  4IRI A;  3S1Q J;  4GCV A;  4XR6 A;  2M9H A;  5H2F C;  1SEU A;  1IUF A;  1OKR A;  1H9G A;  4CYC B;  4HF1 A;  2VUM J;  1JI8 A;  1RUN A;  1SVL A;  3OR1 C;  3ZQI A;  3P9I A;  2V1N A;  2NNN A;  2OTL I;  2OA4 A;  5FLX K;  2H94 A;  3KET A;  3V7R A;  1UHM A;  2DA3 A;  3S8P A;  5EF6 A;  2R5Z A;  1ZG3 A;  2P7C B;  1PYV A;  2W25 A;  2HTS A;  3RQ4 A;  2UWM A;  3ELK A;  2CUJ A;  5D4R A;  4FX4 A;  4BEH A;  4FET A;  1K4S A;  1YFH A;  1JUS A;  2DK8 A;  1P4W A;  5HS9 A;  3GX4 X;  2KRC A;  1Y1V J;  3HHG A;  1YIT I;  2NVT J;  3QOE A;  4JQF A;  1A6I A;  4D1Q A;  1D8J A;  3TW6 A;  2FQ3 A;  2OD5 A;  1Z7U A;  1QVU A;  3CJT B;  5CQE A;  3K2Z A;  3FM3 A;  1MJA A;  2HQ5 A;  4XLF A;  1YRN A;  4CYC A;  3BCA A;  2XF5 A;  4MEX F;  4PCQ A;  1V5E A;  4L9J A;  1RZ4 A;  2RQQ A;  3RIR A;  4EJV A;  1LDD A;  3GYH X;  4XK4 A;  3WTY C;  2ACJ A;  1VQ8 I;  3HYI A;  4ITV A;  3EUA A;  3HOZ J;  3A0B C;  3FK7 A;  5KAF C;  3TP0 A;  2IVM A;  4PJM A;  1QNT A;  2OJE D;  3RYP A;  2NOG A;  1D0Z A;  3T0Y A;  3PSF A;  4HZF A;  3AG1 H;  4WXC A;  4IHT A;  3GF2 A;  4E7K A;  2RAE A;  1KQ0 A;  2R7U A;  2DA6 A;  4PSW A;  4F3Q A;  4Q47 A;  1BW6 A;  4N9I A;  1P6R A;  4RAG A;  2GA2 A;  3H9G A;  4P1W A;  4BKX A;  3G3Z A;  3QPH A;  1J75 A;  3LSG A;  4QLC U;  2LD5 A;  1OMI A;  1WRJ A;  1RNL A;  1R5H A;  2A07 F;  4I0B A;  3ESW B;  5ILV A;  2ZJR F;  1W7P D;  3HUG A;  2H27 A;  1QHH D;  2WAF A;  4YIF A;  1QA6 A;  1O7L A;  3KYC B;  3HL2 A;  4I7H A;  4HV5 A;  1LVK A;  3RPQ A;  3RDI A;  3CC4 I;  1B9M A;  3F3X A;  4LIU A;  3GTG J;  2R7Z J;  2RGV A;  1WJ5 A;  4IZZ A;  3MQ0 A;  3HEF A;  4HYE A;  2NVQ J;  1O57 A;  1KU2 A;  1USS A;  3F8C A;  3DU6 A;  3CUQ A;  2HQR A;  2X4H A;  1KU9 A;  2ZJQ F;  1P92 A;  1MW7 A;  2OCE A;  2W4S A;  3H0G J;  4PFO A;  4KIC A;  4DNC A;  2XIG A;  2CW7 A;  1D1B A;  3Q0V A;  5E3N A;  4EJW A;  4W97 A;  4HG2 A;  2ZXJ A;  4KA4 A;  2E2I J;  5CJ9 A;  2EB7 A;  3DU5 A;  3GTL J;  5KHD A;  2B63 J;  1JTX A;  4QWQ A;  1MNE A;  2JSP A;  1K4T A;  2VKV A;  3ZQC A;  3CZ6 A;  2VJI A;  3BQZ A;  3JCU C;  4BBS J;  5E1Z B;  3S1R J;  2ZO4 A;  2EIK H;  2NS0 A;  3RPU D;  2V9V A;  2R5Y A;  2DJN A;  3QOD A;  2WWY A;  4BJ5 C;  3WOD F;  4IOC F;  3CJQ B;  4P9F A;  1TWG J;  1EH7 A;  3R0J A;  5H6Q A;  5J8F A;  4A3G J;  2XPW A;  1XMX A;  1ZRD A;  4M3G A;  2Y0M A;  2W1O A;  1BW5 A;  5LLQ A;  4DQ2 A;  4UV8 A;  2EZK A;  3LSM A;  1FBU A;  2JWT A;  1R00 A;  3LST A;  3I64 A;  2BXY A;  4BQA A;  2YSR A;  3BTJ A;  1FP1 D;  3KLO A;  1YIJ I;  2DFE A;  1PUE E;  5HDG A;  1B8I B;  1JHF A;  2ME0 A;  3L00 A;  1V55 H;  2DDB A;  3OIO A;  3BJ6 A;  2JN6 A;  1QBJ A;  2QF7 A;  2GWR A;  5TIS C;  1XTA A;  2L7K A;  2BY3 A;  1P2F A;  4C3H J;  5CVU A;  2HI3 A;  4LIT A;  2KDZ A;  1POG A;  4ZYD A;  4HBL A;  2E2H J;  4N0B A;  2LDU A;  1Y0U A;  4IL6 C;  4M72 A;  5JLW A;  2CUF A;  2W82 A;  3OL4 A;  2DK5 A;  5ICF A;  3MCZ A;  2P6T A;  2ELK A;  2EZL A;  1G2H A;  1UZC A;  2QEN A;  2K4J A;  1XDS A;  2VIX A;  5EGO A;  3PIP F;  2ZBK A;  3HC7 A;  4ZDP A;  3OYC A;  1MSE C;  3OOU A;  2A68 F;  1YJN I;  1U5T A;  1XB4 A;  2M0C A;  3CO6 C;  1PUF B;  3JAM K;  4XRF A;  2KIQ A;  4CXF A;  4I99 C;  2K9S A;  2K9L A;  5IT9 K;  2ETH A;  3A03 A;  2LBF A;  4DW6 A;  2ZCW A;  3GWZ A;  2V26 A;  4JP0 A;  4D7N A;  3HZJ A;  4F55 A;  5ILU A;  4LJZ F;  3EUK L;  1JE8 A;  2DT6 A;  5H20 A;  4UXN A;  1QPM A;  1Z91 A;  4F91 B;  2LF7 A;  1H88 C;  1ETX A;  4RA2 A;  5FD6 A;  2QBY A;  3DEW A;  4BXF A;  4IRH A;  1MMD A;  3VEP A;  1ETV A;  3CCJ I;  3H9Q A;  4E70 A;  2VOO A;  2K9Q A;  1P4X A;  2Z1D A;  5F1R A;  1OIS A;  1FJL A;  4PJJ A;  5B3S H;  1NK3 P;  2F48 A;  1SVO A;  5ICE A;  1DPR A;  2R7Q A;  3I5U A;  1S8N A;  3RKX A;  4B3A A;  1QPI A;  4HLY A;  4XLN F;  4L9T A;  4AVZ A;  2EBI A;  1K61 A;  1X1A A;  1YJ9 I;  3UKG A;  1WFX A;  5K7F A;  4Q48 A;  2DLL A;  2OV7 A;  2ZME A;  5E17 F;  1U9N A;  3E6B A;  4LG3 A;  4PDK A;  3KX2 A;  4FIS A;  1ZGW A;  1D8K A;  3PQJ A;  1HC8 A;  5FO5 A;  2X6Y A;  4BQN A;  3SEZ A;  3M4O J;  2H6B A;  4HAM A;  5JHU A;  4LD5 A;  1X1P A;  5AIP A;  1JKQ C;  1B72 A;  3DEU A;  1LJ9 A;  3AKZ A;  3QAH A;  4HST A;  3OYF A;  1Y6I A;  3HOT A;  3FZV A;  3DXJ F;  2WAQ N;  2P5V A;  3S3M A;  2K5C A;  2EK5 A;  4JK1 X;  2WY8 Q;  5IYD J;  2QEX I;  2K86 A;  3EDP A;  3L2W A;  2GXG A;  4V19 K;  4HV6 A;  2F5D A;  2VL8 A;  4C2M J;  1OR7 A;  3PM1 A;  4I76 A;  1O3T A;  5C4X J;  1J5Y A;  5JFR A;  1BOB A;  5EEG A;  4XRS A;  3S2H J;  4Z2Y A;  2O5R A;  2JPB A;  1JXS A;  1OLT A;  1JJ8 C;  2ZSH B;  1KU3 A;  1ZG5 A;  5HDK A;  2J5O A;  1HBX G;  2D45 A;  4EGY A;  1KU7 A;  2QSF X;  2OBP A;  5D6F A;  2FU4 A;  3GFI A;  1F36 A;  1FC3 A;  2VBX A;  1HW5 A;  2BYV E;  2WA0 A;  2DTR A;  3B02 A;  3AG4 H;  2FQ4 A;  3FXJ A;  3U1D A;  3CMM A;  2IBD A;  5JVG F;  3ROU A;  3J80 K;  4MQ9 F;  1MBG A;  2DPU A;  1TL8 A;  4NQW B;  4XN3 A;  3ZQL A;  4DJA A;  3LWF A;  3ZGK A;  1WZ2 A;  3V8J A;  2D5V A;  1A5J A;  4N4N B;  2M8G X;  1Z67 A;  5EZH A;  1W5T A;  4C2U A;  2AHQ A;  1PVE A;  1SD4 A;  4I02 A;  4UUT A;  3J81 Z;  1TT5 B;  2VKH A;  3A01 A;  1B6A A;  1KON A;  2WB1 A;  4UV9 A;  3L2C A;  5M3F J;  2AQF A;  3L09 A;  2LFB A;  4LG0 A;  5BMZ A;  3BCB A;  2EFO A;  2RRE A;  4XN0 A;  1XGS A;  4ZTJ A;  3SEQ A;  2HOT A;  2KP6 A;  2KZV A;  3KZY A;  3AG3 H;  1MMN A;  1WI9 A;  1A35 A;  3A0H C;  1FEX A;  1ZG1 A;  1LB2 A;  5IY5 H;  1OCZ H;  3I71 A;  2DA1 A;  4MIM A;  2WB1 N;  4PJL A;  1XX5 A;  1RET A;  2GOX B;  1GVD A;  4EEF G;  1DPU A;  2H1K A;  1G3T A;  2O61 A;  1B59 A;  2PBI A;  3KYD B;  4YII A;  1H0M A;  3G1O A;  4NDL A;  3W6K B;  1ZH5 A;  1IRF A;  1XCB A;  2N8G A;  3GLX A;  2PMU A;  4ESF A;  1ON1 A;  4OAZ A;  2TCT A;  3ABT A;  1FBS A;  2ECB A;  2JQ7 A;  1S6L A;  3ECH A;  4ZH4 F;  4OIQ F;  2DJI A;  4A6D A;  2K9M A;  3PUF A;  2WAQ A;  5J1Y A;  4PK4 A;  3OYA A;  2DPD A;  2BZT A;  3E5Q A;  2CQQ A;  3P9C A;  1QGP A;  1Z77 A;  3T8R A;  1VQ5 I;  1VQM I;  5L3F A;  2LSO A;  1ZN2 A;  1W0T A;  4IPA A;  3GFM A;  1MMG A;  4CO8 A;  1P7I A;  3ABL H;  1SFE A;  2MD0 A;  3KEO A;  4E7L A;  3K69 A;  5F0C A;  2F5V A;  5F64 A;  4E6K G;  3CCU I;  2LR8 A;  3IHU A;  5BPD A;  2MG4 A;  2MC4 A;  4Y7N J;  2E19 A;  3GLL A;  3F22 A;  4A3I J;  3BY6 A;  3S93 A;  2EFW A;  1FZP B;  4KDP A;  4B48 A;  1IJW C;  4KIT B;  3FKJ A;  3ZP5 A;  4P9U A;  3K1M A;  5FLV A;  4HEA 2;  1K79 A;  2FRH A;  3FDY A;  1DU6 A;  1XMA A;  1B8I A;  1EH6 A;  4XKC A;  2E2J J;  3G1M A;  4L0Z B;  1OFC X;  2IXS A;  2PEX A;  4UVB A;  3IAM 2;  4RLF A;  5C3E J;  2GXA A;  3GO5 A;  1LFP A;  3A02 A;  5LBQ A;  3JRH A;  3M8J A;  2FJ1 A;  2XKO A;  5FB2 A;  3ERM A;  3BZ6 A;  3CDI A;  2KRF A;  4M71 A;  1RPW A;  3DKW A;  4I98 B;  3F6O A;  3VYU B;  1MJB A;  4LG0 B;  3IV5 A;  1AU7 A;  3BJO A;  2DMT A;  1IV8 A;  3U9G A;  1MBJ A;  1FMW A;  2JTV A;  5H6R A;  4AYB N;  3JR9 A;  2E35 A;  1TP4 A;  2Y0S A;  3H3U A;  2M30 A;  2QGU A;  1V3F A;  4AIH A;  2HGC A;  2OTJ I;  2IS4 A;  4XQF A;  3HOW J;  2VC0 A;  3MZH A;  1G4D A;  3RTR A;  1JTY A;  1R22 A;  3DFG A;  4M3F A;  3BG5 A;  4ZYE A;  3OMY A;  2DMP A;  4NQW A;  3PSI A;  3F23 A;  1S5L C;  2XSD C;  3J7A Y;  1BOA A;  2K40 A;  4DYC A;  2V9P A;  1BN5 A;  2LVS A;  2IW5 A;  2M45 A;  3QOP A;  2CJJ A;  5LGU A;  3ZN1 A;  1G8X A;  2HYJ A;  4EM2 A;  2VXZ A;  1QQI A;  4WWC A;  2QKM B;  3Q0U A;  3F6V A;  1UJ8 A;  5HS7 A;  1OCC H;  1T98 A;  2X85 A;  5F1J A;  1MH3 A;  2DTZ A;  2A5W A;  4BHB A;  1ZTR A;  5CYV A;  3N4M A;  3W3C A;  2XF7 A;  3E97 A;  1EJ9 A;  3TOA A;  3LA7 A;  2UXX A;  4IHY A;  2OAZ A;  1YOV B;  2QVO A;  2LY1 A;  3K7A J;  3BR6 A;  3IC7 A;  1IN8 A;  2XSJ C;  5FFX A;  2DCE A;  1X2N A;  4W1U A;  1R6R A;  1ITY A;  4RB1 A;  1VND A;  1XS9 A;  1J0R A;  1BI0 A;  2M4K A;  1WPK A;  2A05 A;  4EJT A;  1U2W A;  1W5S A;  4A5M A;  4HQM A;  3BZC A;  3GZ5 A;  4L9V A;  4GFB A;  3ZRG A;  1UST A;  4FHT A;  1BR1 A;  2F5E A;  3CCY A;  1NTC A;  3S1M J;  3CMY A;  2MFZ A;  2Y9Y A;  3ULQ B;  2H8W A;  4BU2 A;  2XV4 S;  1TQM A;  4YFX F;  2H8R A;  4UB8 C;  1A6Q A;  3SDG A;  1OCT C;  5DUI A;  1FOX A;  3B6C A;  5DYM A;  1ETK A;  3MD2 A;  2E36 A;  1WQ2 A;  1IN4 A;  3OYE A;  2ZFU A;  2EFQ A;  1Z6T A;  4LLL A;  1R5G A;  3MEX A;  3L2Q A;  1MMS A;  5F04 A;  5K7H A;  2E7W A;  1ZGJ A;  4M6X A;  2NXN B;  1Z7L A;  3I3L A;  1YO5 C;  4MTD A;  2IGK A;  3BG6 A;  1X1D A;  3K4L A;  1D0Y A;  1ACI A;  1BI1 A;  4II3 A;  2CUE A;  2CW8 A;  2KZG A;  2HKO A;  3S1N J;  3RYR A;  2CSO A;  3F9K A;  1YYV A;  3CCM I;  2R7D A;  3R0A A;  1BJA A;  1R1U A;  5FKL A;  1U78 A;  2LK2 A;  3GZ6 A;  3CF2 A;  3I54 A;  1FSE A;  5F6F A;  1T38 A;  4A2U A;  1IZ1 A;  2A5Y B;  5E1X A;  4NC7 A;  1IN7 A;  5IYC J;  6PAX A;  4A3D J;  1IO2 A;  4LK0 F;  5J4Y A;  3IH4 A;  4LIV A;  4KFC A;  1OYY A;  2XB0 X;  4HX7 A;  1XG1 A;  5J3L A;  2QQ9 A;  4ANJ A;  2KQR A;  2MC3 A;  3G1L A;  2LKS A;  4EM0 B;  2CUZ A;  1WCM J;  1GVJ A;  2LY2 A;  2FSW A;  3GTJ J;  3OSF A;  1DQU A;  1LUJ B;  2QQB A;  5EDN A;  3Q3S A;  4IX7 A;  1REP C;  2DBB A;  5K1Y A;  1YE9 A;  5B1B H;  3V8L A;  2F4M B;  3OIP A;  2JVH A;  1S72 I;  2WTE A;  1S29 A;  3O8H A;  5L3G A;  3WGI A;  1YQA A;  2R5Y B;  1DP3 A;  5E1W A;  3I56 I;  3PFY A;  1LEB A;  2FOW A;  2IA0 A;  2JZY A;  1HW2 A;  1W7P B;  2P6S A;  1X1C A;  4MLO A;  2LBF B;  2XRL A;  2FMY A;  4CDG A;  3S2D J;  3AAF A;  5K5O A;  4NHJ A;  4CHU A;  4LLN A;  3DBH B;  2EZH A;  3M3Y J;  2V9K A;  1X1B A;  3G71 I;  5IT3 A;  5B1A H;  4A3F J;  5J1R A;  4HDU A;  1S7A A;  2L4A A;  3H1C A;  2R7X A;  3DKY A;  2CW0 F;  1BIA A;  1P7J A;  3PUB A;  2DFF A;  4HSR A;  3O2P E;  1DU0 A;  3COA C;  2BY2 A;  4YRV A;  3DQV C;  3OV8 A;  4ZDL A;  2HQN A;  2I8D A;  5GAD J;  5E20 A;  2VBY A;  1V5G A;  1AOY A;  1Q1H A;  3BC8 A;  5TRD A;  3JW4 A;  2L5Q A;  2QUF A;  4U87 A;  4XID A;  1R71 A;  3CME I;  1I6X A;  2M7B A;  2NOJ B;  5B5E C;  2Z9O A;  3WTV C;  5DEQ A;  5LRS A;  4RDU A;  1AKH B;  3J80 Z;  2WAD A;  1LE8 B;  1RKT A;  2KRH A;  2KJB A;  1MGT A;  3GCM A;  4A69 C;  3A2K A;  3FHN A;  4NBQ A;  2CG4 A;  2KMU A;  4A0Y A;  1TQP A;  5A2Q Z;  2JMW A;  3D5L A;  2KLO A;  4CCK A;  3F8N A;  1T0F C;  5CVJ A;  4E7H A;  1G6N A;  4S0H B;  3I55 I;  1I6H J;  3ECO A;  3V7C A;  5IYB J;  5BPI A;  1WSU A;  1PP8 F;  1TWA J;  4F7Z A; 
#chains in the Genus database with same CATH homology
 1JKO C;  1ETV A;  3H3V K;  1LE8 A;  2K9Q A;  3QQA A;  1FJL A;  1NK3 P;  5FKM A;  2VKE A;  3HDD A;  2L7Z A;  1BJZ A;  4A3E J;  3ZQH A;  3BQY A;  4B3A A;  1QPI A;  1ETW A;  1B72 B;  2EBI A;  1K61 A;  3UKG A;  5K7F A;  1U9N A;  3WHB A;  5K7Z A;  1MH4 A;  4FIS A;  1S7E A;  1ZGW A;  3MN2 A;  4IEJ A;  1RES A;  4B1R A;  5F0F A;  2L9R A;  2Y2Z A;  3M4O J;  5BNG A;  1W0U A;  2L7M P;  2GLO A;  3F0C A;  4J19 A;  1JKQ C;  1B72 A;  1I50 J;  3BTC A;  3JRA A;  5IPA A;  2EZI A;  1H89 C;  4D7M A;  2XGE A;  3HOV J;  2MGQ A;  4A3L J;  1TWH J;  2K9N A;  2WAQ N;  4MFD A;  2YUS A;  5EGO B;  5IYD J;  5M5W J;  2XPV A;  3L1P A;  4C2M J;  3E7L A;  1BA5 A;  1EF4 A;  3PM1 A;  4I76 A;  2E1O A;  1H8A C;  5IOY A;  5C4X J;  3BR0 A;  5EYR A;  4L5E A;  4XRS A;  3S2H J;  2DA2 A;  1JJ8 C;  2AO9 A;  4QIW N;  1GUU A;  2KT0 A;  2JA8 J;  2DA5 A;  2O9L A;  1F36 A;  4IHV A;  2Y0S N;  2NS8 A;  2FQ4 A;  1YRN B;  1UHS A;  1JJ6 C;  2IBD A;  2OF7 A;  1Y1W J;  1JGG A;  3LOC A;  3GTQ J;  3B6A A;  4QSH A;  3LSP A;  4A3C J;  1IRZ A;  1T33 A;  4DZP A;  4C3J J;  1MBG A;  2LP0 A;  5E3O A;  2MSY A;  2M34 A;  3RZO J;  3JRD A;  1FIA A;  4X6A J;  1RR7 A;  4JYK A;  3VPR A;  3ZQL A;  2DMN A;  2XGC A;  4G12 A;  1X2M A;  2D5V A;  1TWF J;  1A5J A;  2Y9Z A;  2M8G X;  2TRT A;  3C2B A;  3GBG A;  1K83 J;  3NAU A;  5EZH A;  3I4M J;  1XC5 A;  2AHQ A;  3JRB A;  4UUT A;  2COB A;  1GV2 A;  3A01 A;  5M3F J;  2DN0 A;  2LFB A;  1IDZ A;  2XPU A;  2LKX A;  1LFB A;  2HOT A;  4D5F A;  1TC3 C;  4LOC A;  2YS9 A;  3RZD J;  1FEX A;  3HM5 A;  5GP9 A;  2DA1 A;  4MIM A;  5GPC A;  1LFU P;  2WB1 N;  4HNV A;  1RET A;  3LNQ A;  3GTK J;  1JKP C;  3ZOB A;  4BXX J;  1BL0 A;  1GVD A;  4QTR A;  4EEF G;  4I6Z A;  3BR5 A;  2H1K A;  3JRI A;  1JUP A;  2CQX A;  4FE4 A;  2DMU A;  1FTZ A;  2FD5 A;  3G1O A;  2NVX J;  4NDL A;  4A3K J;  2N8G A;  4JX6 A;  1U9O A;  5M3M J;  3RKQ A;  2O8K A;  3JRG A;  2TCT A;  3CDL A;  2ECB A;  2WV1 A;  1X58 A;  3SFI A;  3TED A;  1R9T J;  1JT0 A;  2HOS A;  3BTI A;  2HOA A;  3BR3 A;  2G0E A;  2FX0 A;  2VI6 A;  2X48 A;  5J1Y A;  4C3I J;  4UUS B;  2CQQ A;  4JX5 A;  5HOD A;  4X1E A;  1Z77 A;  4A93 J;  3Q0W A;  5FJ8 J;  9ANT A;  1T56 A;  4M3E A;  5FLM J;  1W0T A;  1MBF A;  1P7I A;  2YU9 J;  4A3J J;  3PO3 J;  4ABZ A;  1Q1V A;  5F0C A;  2HXO A;  5EZG A;  2LR8 A;  5IP9 J;  1AHD P;  1MBE A;  2MG4 A;  4BY1 J;  4Y7N J;  2E19 A;  2DA7 A;  4A3I J;  2NVY J;  4MO7 A;  1QVT A;  2X6O A;  2LY9 A;  1ETQ A;  1OJL A;  5M5X J;  1IJW C;  2ECC A;  5FLV A;  3NAR A;  3HKZ N;  1DU6 A;  4AC0 A;  1HOM A;  5E3L A;  3HGG A;  5F0H A;  1B8I A;  2LTP A;  2E2J J;  5DTD A;  1WI3 A;  2JA6 J;  3G1M A;  3S15 J;  1OFC X;  2L7F P;  1MSF C;  1AKH A;  4XRS G;  5C3E J;  3HOU J;  2DMQ A;  5E3M A;  3A02 A;  3JRH A;  1SAN A;  2CU7 A;  1MBH A;  2I10 A;  5GPA A;  4DYR A;  1IGN A;  4IHX A;  2FJ1 A;  1IV6 A;  4RBO A;  1IDY A;  3RQI A;  4M3D A;  1VFC A;  1HF0 A;  5IP7 J;  3HGY A;  3GTM J;  1ZKG A;  1RPW A;  2ID3 A;  3FIS A;  1UG2 A;  1ORK A;  3K2A A;  4IHW A;  4A3B J;  4DYQ A;  3IV5 A;  5EG0 B;  2O7O A;  1AU7 A;  2DMT A;  1MBJ A;  3JR9 A;  4A3M J;  4AYB N;  3S1Q J;  2GBY A;  3HOY J;  2M9H A;  1WGX A;  3DCF A;  3MVP A;  3TP3 A;  2LLK A;  1IUF A;  4BY7 J;  3HOW J;  4CYC B;  4V2G A;  2Y31 A;  2VUM J;  1JTY A;  4M3F A;  3BG5 A;  2QCO A;  3ZQI A;  3O8G A;  4JX4 A;  2DMP A;  2R92 J;  2R5Z B;  2XB5 A;  3WHC A;  2XSD C;  3GTO J;  2K40 A;  3PO2 J;  4DYC A;  2DA3 A;  5EF6 A;  2LVS A;  1O4X A;  2R5Z A;  2EH3 A;  3ZQG A;  2P81 A;  2CJJ A;  1JUS A;  4Y52 J;  1MBK A;  2HYJ A;  5FKK A;  3Q0U A;  3OSG A;  1Y1V J;  2NVT J;  1WH7 A;  1A6I A;  5F1J A;  3TW6 A;  1F43 A;  1MH3 A;  1ZR4 A;  2DTZ A;  1QVU A;  1OCP A;  4M6V A;  2DA4 A;  4XRM A;  1IC8 A;  2HQ5 A;  1YRN A;  1ZTR A;  1CQT A;  4CYC A;  3GTP J;  4BBR J;  4IHY A;  1RKW A;  4XK4 A;  3HOZ J;  5IP6 A;  3FK7 A;  3K7A J;  3TP0 A;  3BR6 A;  2NOG A;  1APL C;  1X2N A;  4W1U A;  1ITY A;  1XS9 A;  1VND A;  1JKR C;  3W6V A;  5F08 A;  2RAE A;  1WPK A;  1VI0 A;  1GT0 C;  2DA6 A;  5FKO A;  1BW6 A;  1GV5 A;  1JUM A;  4BKX A;  4GFB A;  1HDD C;  2HXI A;  1TWC J;  2ME6 A;  3LSG A;  3CCY A;  1NTC A;  2LD5 A;  3S1M J;  3CMY A;  2JA7 J;  5DS9 A;  2Y9Y A;  3FKI J;  2JJ7 A;  2JA5 J;  2H8R A;  1GDT A;  2X9D A;  4D5C A;  5F27 A;  3SDG A;  1OCT C;  2R7Z J;  3GTG J;  2L0K A;  1NK2 P;  1ETO A;  4MFE A;  3B6C A;  1ETK A;  2OPT A;  3IH2 A;  1QRY A;  3HEF A;  2VPR A;  2NVQ J;  1I3Q J;  4DZJ A;  3SJM A;  5J1U A;  5F04 A;  2CRG A;  2GM4 A;  3H0G J;  3MKL A;  3I4N J;  5JLX A;  5K7H A;  3LSR A;  5M5Y J;  1D5Y A;  3LSJ A;  1MNM C;  3Q0V A;  5E3N A;  5FKN A;  4W97 A;  2CUE A;  3FK6 A;  3S1N J;  2E2I J;  1ZK8 A;  2R93 J;  1FIP A;  3GTL J;  2B63 J;  2JK3 A;  1JTX A;  2W48 A;  5FKL A;  1U78 A;  2LK2 A;  3HB9 A;  3D1N I;  2HDD A;  2VKV A;  3ZQC A;  3BQZ A;  5IYC J;  3JRC A;  4A3D J;  4BBS J;  3S1R J;  4V2F A;  3IH4 A;  2XB0 X;  2R5Y A;  2DJN A;  1XG1 A;  5J3L A;  3HBL A;  3G1L A;  1TWG J;  2R0Q C;  3S14 J;  2ID6 A;  1WCM J;  1IG7 A;  2XPW A;  4A3G J;  3GTJ J;  3BTL A;  4M3G A;  3OSF A;  5EDN A;  3Q3S A;  1BW5 A;  5EEA A;  2MW8 A;  3A01 B;  1PUF A;  2EZK A;  1HCR A;  2JWT A;  2M2E A;  1ZR2 A;  4M3B A;  3O8H A;  3BTJ A;  2Y30 A;  2R5Y B;  1JT6 A;  1FTT A;  1B8I B;  4MLO A;  2XGD A;  2XRL A;  3BT9 A;  2ME0 A;  3S2D J;  3QPS A;  1U8B A;  3IH3 A;  2NS7 A;  1HDP A;  3OIO A;  2EZH A;  3FIW A;  5IOZ A;  3M3Y J;  4XIC A;  2JN6 A;  2QF7 A;  4FE7 A;  1E3O C;  4A3F J;  5J1R A;  5C44 J;  4C3H J;  3BG9 A;  4UUS A;  2HI3 A;  3BR2 A;  3JRF A;  3S17 J;  2PMZ N;  2KDZ A;  1POG A;  2E2H J;  1P7J A;  2ZB9 A;  4B4C A;  1DU0 A;  5JLW A;  3ZQF A;  2IAI A;  3JRE A;  2CUF A;  1WH5 A;  5C4J J;  1HLV A;  1Z0X A;  2ELK A;  2EZL A;  2IEK A;  1G2H A;  1ENH A;  3TW7 A;  3BR1 A;  4XID A;  4AUX A;  5EGO A;  1MSE C;  4RDU A;  3OOU A;  1AKH B;  1LE8 B;  1RKT A;  2M0C A;  1PUF B;  1VF9 A;  1UMQ A;  2K9S A;  4A69 C;  3A03 A;  5EG0 A;  4DW6 A;  4FTH A;  4JP0 A;  4D7N A;  1SFO J;  2JMW A;  3BG3 A;  3S16 J;  1ZQ3 P;  3QPL A;  4S0H B;  4FCY A;  1I6H J;  3CQZ J;  5IYB J;  1H88 C;  2EQR A;  1ETX A;  3HOX J;  1TWA J;  1ETY A;  3DEW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...