1FTTA

Thyroid transcription factor 1 homeodomain (rattus norvegicus)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
68
structure length
68
Chain Sequence
MRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKAAQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THYROID TRANSCRIPTION FACTOR 1 HOMEODOMAIN
publication title Analysis of the solution structure of the homeodomain of rat thyroid transcription factor 1 by 1H-NMR spectroscopy and restrained molecular mechanics.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Dna binding protein
total genus 19
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 1995-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1fttA00
1JUPA 1ETOA 1HOMA 3G1LA 3S2DJ 2X9DA 2XB5A 2XGEA 1TWAJ 1JGGA 3H0GJ 1QRYA 2Y0SN 4JP0A 3JRDA 2Y9ZA 4A3IJ 2I10A 1W0TA 2CQQA 2MW8A 1YRNB 4C2MJ 3A01A 1WH5A 2DA4A 2HYJA 3BTIA 4XK4A 1GV2A 5M3FJ 4BY1J 4B3AA 2PMZN 2HOTA 3OSGA 4MO7A 1QVTA 5IOYA 1JKOC 3S14J 4D7NA 1OFCX 2H1KA 1VFCA 3ZQFA 2HXOA 2FD5A 3S15J 5C4XJ 2K9NA 3F0CA 2E2HJ 3QQAA 1CQTA 1UHSA 3IH2A 5GP9A 1GV5A 1NTCA 3G1OA 1BW5A 1XS9A 3HGGA 1ORKA 4C3HJ 2TCTA 5FKOA 5M5YJ 3GTLJ 2DA2A 3HOWJ 4MIMA 4IHYA 4FISA 4JX6A 3NARA 1R9TJ 5EDNA 5EYRA 4V2GA 1RKTA 2DMTA 3TW6A 3LNQA 2M2EA 2NS7A 5M5WJ 4B4CA 1NK3P 3ZQCA 4S0HB 3BR0A 3GTQJ 1MBJA 4HNVA 3B6AA 1BL0A 4V2FA 2O7OA 2CU7A 2NVQJ 5FKMA 4D7MA 4A3MJ 2NS8A 5F0HA 3GTMJ 1JKPC 3BG3A 1RPWA 3HBLA 4ABZA 4FCYA 3UKGA 2ZB9A 5IYDJ 1IDZA 5F27A 1T56A 3D1NI 4J19A 2ECBA 3JRAA 1BW6A 1JJ6C 4BBSJ 4UUTA 5F0CA 2NVXJ 3IH4A 1K61A 1H88C 3WHCA 1B72B 3GTGJ 1P7JA 1ZTRA 1IGNA 5GPCA 4A3FJ 4C3IJ 3S2HJ 1JUSA 1ETXA 1AHDP 4AYBN 2E19A 2DMNA 2LY9A 2DMQA 1U9NA 1OCTC 4NDLA 1WI3A 2M8GX 5JLXA 1JTYA 1JTXA 5C4JJ 1LE8A 1ETVA 3BG9A 2YUSA 3C2BA 2OPTA 1IJWC 1S7EA 3E7LA 4JX5A 3TW7A 4I76A 2R7ZJ 1H89C 3BTLA 1BJZA 4QIWN 2NOGA 3S1QJ 2Y31A 4A3CJ 2GBYA 3RQIA 1JKQC 1ETYA 3OSFA 2XRLA 3K2AA 4UUSB 1W0UA 3DCFA 2DMPA 2RAEA 3FISA 4M3FA 3GTJJ 1MNMC 3RZDJ 3G1MA 4A3LJ 4IHXA 5HODA 5C44J 3HOZJ 4FE4A 3BR1A 2XPUA 4M3DA 3WHBA 1IG7A 2R0QC 5FKKA 3HOUJ 1B8IB 1MSFC 5EEAA 4XRSG 3HDDA 5IOZA 2CQXA 4LOCA 4BKXA 2XGDA 2R92J 4QTRA 4UUSA 4FTHA 3RZOJ 2EH3A 4DZPA 3JREA 1FJLA 1HDPA 2DA1A 1TWGJ 2LR8A 3I4MJ 2JMWA 2CJJA 3BT9A 3ZQIA 1ZKGA 5DS9A 1HDDC 4M3GA 1Q1VA 1E3OC 4XIDA 1VNDA 2IBDA 1PUFB 3TP3A 1B8IA 2DA3A 1XC5A 3SDGA 3K7AJ 3L1PA 2OF7A 4XRSA 3RKQA 3BQZA 5F08A 4DZJA 2IAIA 4A3JJ 3Q0WA 1JT0A 3ZQLA 1WPKA 2LTPA 3GTPJ 1P7IA 1MBGA 2L7FP 2XPVA 4W1UA 5EZHA 1I6HJ 3BR2A 4MLOA 3HEFA 1TWCJ 2E2IJ 3ZQGA 3BR6A 1GVDA 4JYKA 1F43A 5IP7J 5F0FA 4X6AJ 3FK6A 1ETWA 5F1JA 3OIOA 3A02A 4L5EA 1PUFA 2E1OA 3TP0A 3B6CA 2LFBA 3CCYA 2MGQA 4X1EA 3OOUA 1OJLA 1SFOJ 4Y52J 2VUMJ 2JWTA 2ECCA 5FJ8J 1APLC 3BG5A 5M5XJ 3S16J 2K40A 5EZGA 1ZR4A 2LKXA 4BY7J 3JRIA 1DU0A 1D5YA 1SANA 2LVSA 2AHQA 5K7ZA 3IV5A 1LE8B 4A3GJ 1LFBA 3Q0VA 4JX4A 1FIPA 2X6OA 1ZGWA 1OCPA 2DTZA 5J1UA 3FIWA 5DTDA 2W48A 2AO9A 5GPAA 4IHVA 3VPRA 3QPLA 1GDTA 2L9RA 2M0CA 1TWFJ 5E3MA 1ZK8A 5JLWA 3LSPA 4DYRA 2NVTJ 1MBEA 1JUMA 2R5ZB 2R5YA 2YS9A 5J1YA 2L7MP 1WH7A 1X58A 3I4NJ 1JKRC 1I50J 2VI6A 3LSRA 1QPIA 2EZHA 2COBA 2JN6A 1U9OA 1O4XA 4AUXA 1IC8A 1IUFA 4DYQA 4A3DJ 2XPWA 5J1RA 2FQ4A 1POGA 1RESA 2TRTA 1ETKA 3LSGA 4A3EJ 2E2JJ 1F36A 2K9SA 1GUUA 2D5VA 3QPSA 2WB1N 2XSDC 3S17J 1MBKA 9ANTA 4M3BA 2R5ZA 2KDZA 4GFBA 1MH4A 2O9LA 2JK3A 3CMYA 2MG4A 5EGOB 3PM1A 3BR3A 2DMUA 1IV6A 4A93J 3H3VK 3SFIA 1G2HA 2JA5J 4RBOA 4IEJA 1RR7A 1ITYA 3MN2A 2MSYA 1AU7A 5EG0B 5F04A 1VF9A 5FKNA 1Z0XA 5FLMJ 1AKHA 2M34A 3Q0UA 2VPRA 5EGOA 3JRGA 1MBFA 1Y1WJ 2YU9J 1QVUA 3GBGA 2CRGA 2L7ZA 2FX0A 3HOXJ 2JA7J 1FTTA 2Y2ZA 4B1RA 1X2MA 4DW6A 3FKIJ 1MSEC 4DYCA 2X48A 2GLOA 4BXXJ 2LD5A 1ENHA 3CQZJ 2WV1A 3BR5A 5EG0A 3BTCA 1K83J 5IYCJ 1HLVA 4IHWA 1MBHA 3HKZN 2HXIA 2B63J 4XRMA 2HDDA 3TEDA 2CUEA 2R93J 3BTJA 3W6VA 3M4OJ 1IRZA 3HB9A 2EQRA 1WCMJ 2Y30A 1LFUP 4Y7NJ 5BNGA 1U8BA 3LSJA 3S1NJ 2WAQN 2JJ7A 1YRNA 2JA6J 1H8AC 3HM5A 2O8KA 5FKLA 4G12A 3JRBA 4A3KJ 1NK2P 3ZQHA 3HGYA 1GT0C 5IPAA 4CYCB 1HCRA 3MKLA 2QCOA 2JA8J 3JR9A 2N8GA 3SJMA 2XGCA 2R5YB 5J3LA 2Y9YA 2GM4A 2LP0A 4BBRJ 4EEFG 3JRCA 1RKWA 3IH3A 2HQ5A 1VI0A 3S1RJ 4A3BJ 2DA6A 2DN0A 3PO3J 1WGXA 5EF6A 1JJ8C 1TWHJ 3NAUA 4QSHA 1A6IA 2ME0A 3MVPA 4I6ZA 2P81A 2ELKA 1DU6A 4W97A 4XICA 3O8HA 3M3YJ 1BA5A 3S1MJ 2DJNA 3BQYA 2ID3A 2LLKA 2VKVA 1Z77A 4CYCA 2EZIA 2KT0A 1U78A 3CDLA 1X2NA 1RETA 1ZR2A 2LK2A 2K9QA 2HOSA 1T33A 4M3EA 4MFDA 3HOVJ 3O8GA 4A69C 3Q3SA 1ZQ3P 4D5FA 1Y1VJ 3ZOBA 1HF0A 2HI3A 3FK7A 2FJ1A 2L0KA 4D5CA 5C3EJ 2EBIA 2H8RA 3DEWA 1FIAA 1MH3A 2ME6A 1UMQA 1TC3C 1A5JA 4FE7A 5K7HA 2ID6A 1IDYA 1ETQA 1FEXA 3GTOJ 5IP6A 2DA5A 4RDUA 2M9HA 1JT6A 1AKHB 5FLVA 1XG1A 3JRFA 5M3MJ 3LOCA 1EF4A 3A03A 5E3LA 5IP9J 3HOYJ 5K7FA 5E3NA 1B72A 2QF7A 4MFEA 3GTKJ 1UG2A 2NVYJ 2DA7A 4C3JJ 2EZLA 5E3OA 2VKEA 2HOAA 2G0EA 4M6VA 3JRHA 3PO2J 2CUFA 3A01B 2EZKA 4AC0A 2IEKA 1I3QJ 1FTZA 5IYBJ 2XB0X
chains in the Genus database with same CATH superfamily
2DU9A 3SEZA 4P96A 1ETOA 4MTDA 4UXNA 2QSHX 1R00A 2E7WA 2O03A 3F9KA 1D0XA 2L7KA 2LY2A 1HOMA 3O3KA 4M9SA 1QRYA 3QYFA 4Y15A 1TQPA 3K1MA 5TJJA 2FBIA 4HA8A 3NEUA 1R71A 4HQMA 4C2MJ 1YLFA 2XGXA 2JA2A 2DA4A 4ZTJA 4XK4A 1LVKA 4L0YB 1BM9A 5E8IA 4B3AA 3OSGA 3ZMUA 4CHUA 5KHDA 2QQBA 1KZHA 3VWBA 2HGCA 3B02A 1ZG5A 1FYMA 3LFKA 3HOSA 2W84A 3F0CA 4ZH4F 3J7AO 2FQ3A 3WGGA 2E2HJ 3QQAA 4LD5A 4F93B 1CQTA 2VC0A 2QEXI 3CF5F 3IH2A 5GP9A 3W2AA 1NTCA 2VE8A 1U2WA 3BG7A 3H5NA 3OYCA 3H5AA 2P7CB 2VB6A 1T0FC 2DODA 4MIMA 4B48A 4FISA 3TDUC 4JX6A 5H6QA 1W5SA 2BVLA 3NARA 2K86A 1R9TJ 2LY1A 1UAAA 1GXPA 1RKTA 2DMTA 2V1UA 2NS7A 3S93A 5GAEJ 2HVSA 1NK3P 4E7IA 2Q0OA 3V7SA 1FSEA 4D0PA 4IZZA 1XPXA 2LNBA 3FX3A 4XKWA 2FMYA 4E7LA 2CU7A 3TO9A 2RN7A 1K78B 1NHAA 1RPWA 2Y69H 5H6RA 1OYWA 3IWFA 3WU1B 1IDZA 3AAFA 2F5FA 2RKHA 4HX8A 1PP8F 2F4IA 3C7JA 4CUGA 4I98B 5F0CA 4CYDA 2DXIA 2XAUA 2OZUA 1H88C 2P4WA 4PFOA 1STZA 1IGNA 2DTRA 5EEHA 4B47A 2EILH 1D0ZA 2FSWA 4A3FJ 3KP4A 1MMNA 5CVJA 1IXCA 2E19A 3L9FA 2DMNA 2IJLA 1DGWY 3R61A 1LPQA 2QSFX 3GZ6A 2QGUA 4ZJZA 3H9QA 3CF2A 3LA7A 1XSXA 2STTA 1WJFA 2G7UA 5L3DA 3F23A 1BBYA 3J80K 2OPTA 2KP6A 2UV1A 2V1NA 1IJWC 1W4MA 1BC7C 2UWMA 3GVAA 4ZC3A 2R7TA 2K27A 2MA3A 1FX7A 3HSFA 3C2GA 3CUOA 4A2UA 1I3AA 3DKXA 2GBYA 2R7OA 1VZ0A 3RQIA 1JKQC 3W2WA 4LJZF 1WHUA 3DTEA 1O7LA 1S8NA 2DMPA 3DCFA 2LSOA 3GTJJ 4RAGA 4BE1A 1KONA 1ZG3A 2CQNA 2TDXA 4RS8A 5HODA 4WWCA 3HOZJ 1LDJA 2XPUA 3BY6A 4Q47A 2EFNA 1B8IB 4M6XA 4XKCA 1NG6A 2V7FA 3DEUA 2EFPA 5F1RA 3I0TA 3L00A 3E6CC 1S9HA 3ULQB 4XN3A 2A6TA 1X1AA 1XCBA 3FF5A 5DD4A 1YYVA 2LR8A 1SFXA 2DA1A 3PSFA 3N97A 2MH9A 5FFXA 3RKXA 4IHSA 3HXLA 2KIMA 1O3QA 2RNGA 4CDGA 1SD5A 2HNHA 1HDDC 4NC7A 2CUJA 4XIDA 2IBDA 4EVIA 1B8IA 3IRRA 3CC4I 3LQRA 1TW2A 1WJDA 3LFUA 1HW5A 4XRSA 2KIUA 2IVMA 4I7HA 2IAIA 2WADA 1ZAOA 3Q0WA 4CGZA 4F7ZA 1LQ1A 4GGGA 4ENJA 2DFFA 1MBGA 5EZHA 5E17F 2OA4A 3BR2A 4RB3C 3T1BA 2WY7Q 1SFUA 2ESNA 3BR6A 3S3MA 1SAXA 4J00A 2GIVA 3ML6A 3RJPA 3CCQI 2BV6A 5J40A 5BMZA 2YU3A 3OIOA 3DBLB 2V9PA 4HV6A 2KJCA 5JFRA 2OD5A 2MGQA 5CVRA 2O0YA 2VXZA 4KT5C 2ISYA 2CFOA 3IAM2 1FOYA 4P5OA 5JHFA 2ZXHA 1HA8A 1S72I 3BG5A 3HRMA 5CVUA 4OIQF 3OYHA 3S16J 4RM2A 1IRGA 3G71I 1V4RA 1D5YA 3TMOA 4BNCA 3KE2A 2LVSA 2AHQA 5K7ZA 4S04A 4XKBA 1G8XA 1LE8B 1VQ6I 3CDHA 2DJIA 1KA8A 1FIPA 2X6OA 4CZCA 1OCPA 1ZGWA 5DTDA 2WC2A 4KIFA 2AO9A 4IHVA 3LSTA 3WE2A 2JSCA 3FWEA 4ZYHA 2H94A 2IGMA 4Y3OA 5KAFC 1W7PB 4DJAA 2R4GA 1YHQI 3VSKA 2M0CA 2HVQA 4FETA 4TV7A 5D8KB 4BJTA 5DDGA 4U0WA 3QWLA 1O3RA 4NB5A 3LSPA 2NVTJ 4HX4A 1JHFA 1USSA 2GAUA 2M5WA 4XLPF 2ESHA 3JTGA 1T6SA 3F3XA 1P92A 6PAXA 1C0WA 3LWFA 2VJ5A 1PDNC 4OIOF 3ONQA 3LSRA 1MJBA 1R23A 2J5PA 4RB0A 5D5UB 2EZHA 3VYRB 5K5OA 1Z6RA 2JT1A 1IUFA 1DGRM 4DYQA 2HDCA 2XPWA 4WCGA 5B1AH 5B66C 1ETKA 1RNLA 4I09A 1W7PA 2NNNA 2K9SA 4RLFA 2QM3A 1HC8A 2OAZA 2XVCA 1XDUA 2LMDA 3QPSA 4HG2A 2V1XA 1MBKA 5L3BA 4OIPF 2CQKA 2BY3A 4XSZF 1YX5A 9ANTA 4RGUA 4OIRF 3HJEA 5CJ9A 3PM1A 3GW2A 1L3LA 2DMUA 1IV6A 2V1DA 2L54A 4A93J 5AIQA 2QKLB 4XM3A 3RPUA 1V55H 1XSDA 4RBOA 4B3XA 2X6XA 1W5TA 3OL4A 1RRJA 1ITYA 4I0AA 5FD5A 3P5JA 2Y48A 2MSYA 4HEA2 2VN2A 1AU7A 2X85A 4LB6B 3HUGB 4OINF 3A4CA 2P5LC 4GYGA 5H20A 4O6JA 2K9MA 3E97A 1A35A 1BI3A 2DOFA 1PUEE 2Y75A 3PSIA 1BIBA 2L9SA 3W2VA 2XC7A 2KHMA 2M4KA 1QVUA 3GBGA 2VQGA 2EWNA 3WU2C 2VPLA 3HOXJ 4BYYA 3HTUA 2JA7J 4B1RA 5B5EC 1X2MA 3DP7A 2W24A 4OOIA 1QO0D 2X48A 2GLOA 4BXXJ 1ENHA 1JI8A 3BR5A 1HLVA 2RGVA 1G3TA 2B63J 5KVRA 2CUEA 4PJMA 2R93J 3BTJA 3S2WA 3C2HA 3KFWX 3GFIA 3M4OJ 4EJUA 3H0DA 2DT5A 4M71A 2Y30A 4Y7NJ 1JGSA 5BNGA 1U8BA 2KDOA 2EFWA 2DT6A 5HLTA 1MDMB 1P4WA 2M7BA 2AXTC 1H8AC 3DBRB 4G12A 1T8IA 3WU0A 1K79A 5LRSA 2CWEA 3HGYA 1Z67A 4G9YA 2MH2A 2IS2A 4BGDA 3MKLA 5LHIA 2CH0A 5FLXZ 1IF1A 2N8GA 2DPUA 1Z9CA 3CCVI 5J3LA 2A05A 3IUOA 5IT9Z 4IJAA 2CUZA 3JRCA 4AM3A 1F1ZA 1SVOA 1B9NA 2IW5A 1VI0A 1YG2A 3ERMA 2DA6A 4C2UA 4LB5A 3PO3J 1OISA 2FU4A 3I56I 2HTJA 3K69A 3NAUA 1MDMA 2ME0A 1YQAA 3MVPA 3OV8A 2KJBA 1T95A 2E1MC 3GO5A 2F4MB 1U5TC 4LK0F 3T8RA 4BQOA 1H0MA 3GLXA 3I3LA 2LOOA 3LSHA 4ETSA 1EH8A 1IZ1A 4LIVA 1E0EA 1IV8A 2O61A 4EQQA 2BOLA 4MFDA 3HTSB 4XOPA 3O8GA 4KMFA 3GEZA 4BAYA 3Q3SA 1AWCA 5FGMA 1HF0A 2HI3A 1Z1DA 2LYCA 2L0KA 4IF4A 1TLHB 4PZJA 5CQEA 5HNHA 5C3EJ 2EBIA 1IXSB 2H8RA 5FB2A 3DEWA 1MH3A 1T08B 1RUNA 1A5JA 5K7HA 2ID6A 3ROUA 4GDFA 2L2OA 1YE9A 2DCEA 3HRUA 3CMEI 3TGNA 2M9HA 3GWZA 4BE0A 1JT6A 1XG1A 5M3MJ 4ENNA 3HOYJ 2XUBA 3ZR8X 1TTYA 3BC8A 2RV8A 3I54A 5K7FA 5E3NA 3OYFA 2CW7A 4NHJA 4UNOA 3EETA 1L0OC 4C3JJ 2BY1A 4ZDLA 2KIQA 1XTAA 2EZLA 3MFKA 5E3OA 3G73A 2HOAA 4N4NB 2GOMA 1BIAA 2IPQX 1KU2A 4KIBA 3RI4A 5E1XA 4RAZA 1VQLI 4AC0A 5DUIA 2IEKA 1S29A 3ABMH 5IYBJ 2F5VA 2ZNYA 4IQJA 3QOEA 1J75A 4O3MA 4LG3A 3OL3A 3ZP5A 5FFZA 2CQ7A 2DPDA 1D8JA 1SEUA 1VQNI 2DFEA 1YW7A 3DWLE 1DP7P 3P7NA 3BDDA 2X9DA 2XB5A 3GCMA 2MLGA 4L0ZB 2AXLA 3H0GJ 4WXDA 2X1CA 2Y0SN 3I59B 3V4GA 2GOXB 3H3UA 3HPHA 3CMMA 2DDBA 3CUQA 2CQQA 4LG0A 1D0YA 3F8CA 3QYEA 2HYJA 4IL6C 2QBYA 2CSOA 4PJNA 3RIRA 4HV5A 5AONA 2WAFA 4QLCU 2XKPA 5M3FJ 1F5TA 1XMAA 2EA4A 1DPRA 3ABKH 2OQRA 3P9CA 4MO7A 5IOYA 1JKOC 1OFCX 4P1WA 4WX9A 5IT3A 2VOOA 3ZQFA 2NNYA 4U87A 1S5LC 1REPC 3S15J 2K9NA 2P5VA 3CUQC 3O2PE 3A2KA 3I59A 3KLOA 3ZQ7A 3QU3A 3ZMVA 2P6SA 1YX3A 3KLNA 5FRNA 3V8KA 1BC8C 3REOA 2KRHA 4BACA 5FLXK 2UXXA 1J5YA 3HGGA 4WXCA 4BJ5C 1I5ZA 2TCTA 3RPQA 4RGSA 4XR6A 5IT9K 1TW3A 1W5CC 3CLOA 1R36A 1TQIA 3QRFF 2KRFA 2DYSH 4RGXA 1ZRDA 3U9GA 4YELA 5D4RA 2JPCA 1EA3A 3C3WA 5CQGA 5EYRA 2KRCA 4DQ2A 4BEHB 3F22A 5M5WJ 2B9SA 4HYEA 4B4CA 1HW1A 3ZQCA 1MJ9A 1S3JA 1Y8QB 4BU2A 4HSTA 4EATA 1BL0A 2HPIA 2VT3A 3KEOA 1J2XA 1JE8A 4A3MJ 2NS8A 4KICA 5HNFA 3SFZA 2VC1A 3OS1A 4FCYA 2ZB9A 1K4TA 1P4AA 3CJQB 5E1ZB 1BW6A 4PDKA 1IRFA 1B59A 4BBSJ 5KCMA 4UVAA 1VQ7I 3AG3H 1B72B 4BEHA 4QWQA 4PCQA 1WJBA 4HSRA 5BPDA 4PSWA 2ZJQF 2PN6A 1JUSA 2XIGA 3QAHA 4AYBN 2LY9A 4ESBA 2DMQA 2DT7B 1TNSA 3HL2A 1WI3A 2NRAC 4HDVA 1FOKA 1JTYA 3FBIB 3P9IA 2OV7A 1ETVA 3BG9A 1MW7A 3HRTA 1LJ9A 4OMYA 2ELJA 4NC6A 1R5GA 3W6JB 5J6XA 1YTYA 2Z9OA 5HDKA 1H89C 3ECHA 2QZ8A 2IGKA 5ICGA 3JSPA 2QKMB 5ICCA 3M1CA 1ETYA 4L9JA 4YIRX 2XRLA 3K2AA 1E3PA 2O3FA 4UUSB 1I1SA 4CCNA 3A1YA 4GCVA 4M3FA 2VBWA 3E6MA 5E8GA 3RZDJ 3G1MA 4A3LJ 4ENMA 4XOTA 4X0GA 3WHBA 2KFDA 2RQQA 3D5RC 1MSFC 2HKXA 3QOPA 3H35A 4XRSG 5EEAA 3DPTA 3HDDA 2M8EA 2RC4A 3EYYA 1YOVB 4MEYF 3TO7A 1LB2A 2R92J 4QTRA 3EUAA 4UUSA 1XB4A 4UB6C 1V5FA 5BPIA 3VFZA 3DU6A 2OCEA 4HQEA 3OYMA 1TWGJ 3VYTB 2XF5A 3JCUC 3KP3A 2XV4S 3IWZA 2JMWA 1T39A 3RDIA 3ZQIA 4LFUA 4EV0A 1T0FA 2EJRA 3AG2H 3G3ZA 3QPHA 2EV6A 3CJRB 3H5RA 1X1BA 4IPAA 4YRVA 1BI1A 1XC5A 3D5SC 4GO1A 1R58A 3SDGA 3OYGA 3M7GA 3RKQA 3BQZA 1QBJA 4DZJA 4BJ6C 1IAWA 4E7SA 5L3EA 3QP5A 2BE5F 1Z6TA 4ZDPA 1R49A 1JT0A 2XDVA 1ZRFA 3ZQLA 1KU9A 2L01A 1WPKA 3DQVC 1J9IA 3GTPJ 4W1UA 1LEBA 2VIXA 3GUDA 4MLOA 1Z7LA 3OYBA 3L2VA 2A3SA 3ZQGA 2F2EA 2IP2A 4OWRB 4KT6A 3U1DA 2BXZA 2PQ8A 5FO5A 2FNPA 2GZWA 5F0FA 4X6AJ 3E5QA 3WTXC 1ETWA 1FC3A 5ILVA 3GLLA 3HKZA 1A36A 3FHNA 3V42A 3IKVA 3CP8A 4X1EA 2R7FA 3OOUA 3MCZA 1SFOJ 3R0JA 4Y52J 2VUMJ 2WA0A 2ECCA 3J81Z 1ZHFA 2EIJH 4IRGA 4ZYGA 3VSLA 3QU6A 2HTSA 1LEAA 1UELB 2K40A 4ENKA 5EZGA 2WAQA 2LKXA 3FXKA 1SVLA 3IHUA 4AIKA 3V8LA 3E6BA 4ON0A 1MIJA 2DQRA 3IV5A 1U8RA 1LFBA 3R0AA 3E0JB 1X4PA 3DLLF 2DTZA 5CVVA 1UHWA 4IKFA 2W48A 3CP2A 5A2QZ 1R4NB 1IN6A 3I4PA 2LKSA 1O57A 3MKYB 4HW0A 1VQOI 4EJTA 1D5VA 3QPLA 1UJ8A 3CZ6A 2DI3A 2HKOA 3QYBA 1TWFJ 1ZK8A 2FOKA 4U0VA 4B8XA 1SFEA 2YSRA 3CC2I 2K02A 4HOBA 4PJLA 2YS9A 5CLSA 2R5YA 2L7MP 1X58A 4A12A 1K6OA 2VI6A 3F6OA 1QPIA 4CXFA 4N9HA 1WWXA 1O4XA 1U9OA 1MKMA 3M8EA 4AUXA 1IC8A 1F4KA 3NWTA 3COAC 4A3DJ 2FQ4A 2F4OB 1ZG1A 1RESA 3LSIA 1YS6A 2E2JJ 1F36A 1ZELA 3I53A 3X2QH 1GUUA 1UG0A 4JOMA 2E36A 2K3PA 3KETA 2D5VA 2XSDC 5ICFA 1VQ9I 2GIZA 2Y0MA 1AOYA 2XAFA 2XAQA 3ABUA 4U88A 3FM3A 3I58A 3K6GA 3OIQA 3DFGA 1ACIA 1BN5A 1PJRA 3KP5A 1VQ5I 3RYRA 2OTJI 5DCMA 3AFHA 1S7OA 1S7AA 1VQ8I 1Z05A 1GHCA 4XLFA 2MD5A 2IA0A 2MC3A 2JA5J 2OJED 1TT5B 3E5XA 2V6EA 2KZGA 1SVMA 1W36D 5F04A 3KEQA 5FKNA 2G7HA 2KKOA 3GZNB 3SZGA 5LGTA 3F21A 2ELHA 1ZARA 3ESWB 3K2ZA 2B0LA 2K85A 1AKHA 1I6XA 1G3WA 1XN7A 1VQPI 2QQAA 2VPRA 2EV5A 1MBFA 1FLIA 3NQOA 4EMSA 2CRGA 3N05A 4M74A 4A0ZA 2FF4A 4FT8A 1FTTA 2Y2ZA 2BBYA 3TBIA 4BS9A 4DW6A 3FKIJ 2DLLA 1MSEC 2Q2EB 5F64A 1U6GA 4C30A 4A6EA 3QP6A 4DYCA 2LD5A 1R5HA 3FXQA 3PUBA 4CICA 4IHWA 2Z5UA 3BTCA 1K83J 1GXQA 1MBHA 2D1VA 1QA6A 2LREA 3ZRGA 4GXOA 3DEEA 4HAMA 1M1EB 1T38A 3TEDA 4N9IA 3GX4X 4EM2A 2HZTA 1DP3A 4AIDA 2L4AA 4ZZLA 5LD2C 2EQRA 1E3HA 1VTNC 2IS4A 2PMZA 3J81K 2ICWG 4K2EA 3R6SA 4YIFA 3JSOA 1YRNA 4DNCA 4YIIA 2JA6J 1RI7A 2Q2EA 3ZN1A 2O8KA 4AD9A 3JRBA 4A3KJ 2KMUA 2E71A 3ZQHA 2JRTA 4KITB 2NOJB 1GT0C 3AL0C 3K4JA 3FXJA 3H9JA 4U7DA 2X6WA 1ERDA 2QCOA 4G6DA 2JA8J 3SJMA 2QLZA 2QQ8A 4NUBA 3TOAA 4A5NA 5GAHJ 2K9LA 1OPCA 5JI6A 2GM4A 2ZXIA 5A2QK 1KQ8A 2I8DA 5IY5H 2W4SA 4B09A 1RKWA 3BP8A 3DV8A 4A3BJ 3J7ZI 1JJ8C 1TWHJ 2MBFA 3QODA 3TKYA 3BCAA 5HLIA 4I6ZA 1XGSA 2P81A 1QZEA 2L4MA 2CFXA 2PG4A 4PJ0C 1BA5A 3S1MJ 3BQYA 4AVPA 2EZIA 4IRHA 5BQTA 3CDLA 1RETA 3V7CA 1LUJB 4EGYA 2FBHA 3ERED 3HSEA 2K9QA 4A0XA 3J7AY 4M3EA 2Z99A 4XKVA 1FYKA 2VBZA 4LLLA 2VQLA 1ZQ3P 3KPHA 1Y1VJ 3ZOBA 3OS0A 1Y0NA 1FNNA 3PQJA 4G7HF 2O8XA 3SEQA 2LDUA 2MLKA 2KQRA 3ZMSA 2DO7A 2STWA 2OC6A 1FIAA 4Y4RA 2HU9A 1B4AA 1FBSA 2ME6A 1CF7B 1TC3C 3S32A 1RUOA 1Z3XA 4FE7A 1V54H 3GFJA 4WXHA 1ETQA 4XLEA 1Y39A 3BG6A 4Y33A 5IP6A 2AS5F 2L9VA 4OAYA 3KEYA 1XGMA 3SQNA 4Z6YA 2BEOA 2HPMA 3A03A 5E3LA 3E1SA 2F5EA 3UNGC 4BH9A 4DIQA 1ZLKA 3KZYA 3GTKJ 4BHBA 2NVYJ 4ITVA 3MQ0A 1ZGAA 2QENA 4KN7X 2B7EA 3H3ZA 4D9JA 5J8FA 4LK1F 3MWMA 2E5NA 3CCJI 2FBKA 1XX5A 1CF7A 3A01B 3FDYA 3GXOA 4BHCA 3T8TA 4IRIA 1I3QJ 3P9KA 4RA2A 4CZZA 4DBRA 4FASD 3A0HC 4AIHA 3K4BA 3RKWA 4XLCA 4HX7A 2VODA 2EK5A 2MFZA 1TWAJ 2CW0F 2CO5A 3ASOH 2A5YB 2NS0A 4JP0A 3RQ4A 2CW8A 4H0EA 3CC7I 3K4KA 4A3IJ 1W0TA 3JAMK 2CYYA 2VT2A 2QYOA 3A01A 1WH5A 4F52A 1X3WB 4L9VA 3BTIA 3GFLA 3G2BA 2UXNA 3EQLF 2E1MB 1U5TB 5DUKA 2HOTA 1USTA 3SZTA 5LHHA 2VLAA 1W1WE 4XRFA 5C4XJ 4L18B 1DQUA 2P7VB 2E35A 2DQLA 2JUCA 1ZLJA 1SAUA 1G3YA 2XAHA 4XNFA 3K4CA 1UHSA 5JHUA 1GV5A 3G1OA 3CMAI 4IQ4A 3OOPA 1XS9A 1ORKA 4C3HJ 2COMA 3FBNB 5D6FA 3EYIA 5FKOA 5M5YJ 1TQMA 4IOAF 2A5WA 1OR7A 1U5TA 4RM3A 3V7RA 2DA2A 3HC7A 1MMDA 4IHYA 2H1LA 2H27A 4BXFA 5ILUA 4ZDOA 4P9FA 1T2KA 3HG9A 4JQFA 1MNDA 1MZBA 1X3ZB 3IC7A 2OTLI 1JHHA 1ONVA 3TW6A 3MMYB 1KU7A 3T5XA 2M2EA 2MABA 5HS9A 2MD0A 1MJAA 4S0HB 3BR0A 4AU7A 4CO8A 5K5RA 1GLNA 1J0RA 2O7OA 1OR7C 2RNJA 4D7MA 5F0HA 4HRIA 3HBLA 1XGNA 4ABZA 5IYDJ 1ZN2A 5F27A 5L3FA 4I2OA 4M9XA 3D1NI 2ZXWH 4FQGA 1YW8A 1JJ6C 3CCUI 2E7XA 2OCCH 4HPQA 4NQWB 2NVXJ 1K61A 3WGIA 3WHCA 5TRDA 1P7JA 3BLYA 4F92B 1P4XA 1MMSA 3IL2A 2ZSHB 1TZLA 5GPCA 3PFIA 3R60A 3H9GA 1ETXA 2CGPA 4PGGA 1ON1A 2J5OA 1B6AA 1OCTC 2M8GX 4DOZA 1JTXA 5C4JJ 3FHZA 5J4VA 4XSXF 2HR3A 3C2BA 3OR1C 4PSXA 1CGPA 1OCRH 4NQWA 1S7EA 1X4OA 3TW7A 1K4SA 4I76A 2R7ZJ 1BJZA 3NRVA 4QIWN 3FZVA 4XLHA 4HLYA 3S1QJ 2Y31A 1XCVA 1RR8C 2JPBA 5CYVA 3CUQB 4LG0B 2KIFA 5GADJ 4XONA 1HQCA 2QVOA 2BY2A 1TL8A 3K10A 1D3YA 3CDIA 2QBYB 2DYRH 1WKMA 1N78A 1MNMC 2R7QA 4KISA 4IHXA 2WV0A 4BQNA 1J09A 4M73A 2LG4A 3I9V2 3CO7C 2A07F 4FE4A 3BR1A 4M3DA 2WB1A 3HOUJ 2E1NA 2ZFUA 3U21A 3OYJA 1LDKB 1FYLA 3BJ6A 4CSWA 5FRMA 3K70D 4BKXA 2IGNA 1F9NA 3ZN0A 1GVJA 4L5JA 4FTHA 3F6VA 3RZOJ 2Z16A 4KMUX 2EH3A 2JVHA 4DZPA 4OU0A 3JREA 2CV1A 4D1QA 2VJJA 1HDPA 4P55A 4CCOA 1DDNA 3PUFA 4HZFA 5E20A 2ISZA 1PVEA 3I4MJ 2CJJA 1FOWA 1R4MB 2VXDA 4BDYA 1VNDA 5ILSA 3OWTA 1Z3YA 3K7AJ 3L1PA 2OF7A 1V5EA 5L3GA 1QU3A 1FMWA 3FM5A 4I0BA 3EDPA 1YFHA 3CD6I 1P7IA 2XPVA 1I6HJ 5D5VB 3HEFA 2E2IJ 2JQ7A 2ZCWA 2PJRB 2M0MA 1H9GA 4EM0B 1F43A 2ETHA 5IP7J 3CCLI 2Z33A 1KYZA 5F1JA 3A02A 4L5EA 3I5UA 3TP0A 3GFMA 3B6CA 4NNJA 2LFBA 3UR3C 2GA2A 1FSHA 3HSRA 2XRNA 1QZYA 3KYLA 3PNVA 2QSGX 3V8JA 2V9KA 1YO5C 5FJ8J 4XLNF 1WRJA 1VQMI 5M5XJ 1TNTA 3PQKA 3ABLH 3SDBA 2R3SA 2V26A 2BVMA 3VYSB 1ZR4A 2PJRA 4BY7J 3C1DA 3FXOA 3JRIA 2XASA 4LITA 1SANA 2EFOA 2Z2SB 1FOXA 4RAYA 4A3GJ 2ZO4A 3OR2C 3Q0VA 1HKTA 2Z1DA 4CA0A 4JX4A 3WTYC 4I01A 3L09A 4EJOA 4AIJA 1P6RA 5EEGA 2DAOA 3FIWA 1H9TA 1D1AA 4IX7A 2VKDA 1A04A 3LSKA 3VPRA 1IO2A 3DBHB 1GDTA 5JR3A 1IN7A 2L9RA 3BCBA 2DK5A 2ADUA 1SMYF 2M3AA 5E3MA 4CH7A 5LEKA 3DKWA 4A6DA 1MBEA 4MNUA 5J8CA 5J1YA 1WH7A 2H8WA 4L9TA 3BZCA 2AQFA 2HYGD 1W36C 2X6YA 1EKEA 3F8FA 3SHFA 1SD4A 1J59A 3DLAA 1T98A 3OYIA 3AG1H 1POGA 4HLXA 4A3EJ 1HXDA 4Y17A 4JBAA 4R8HA 2A6HF 2HZDA 4M3BA 4WF2A 2K5CA 2KPMA 2KDZA 5HS8A 2HQNA 1MH4A 2FE3A 2O9LA 1E17A 1Y0UA 2VJIA 3WG9A 3PJRA 4RGRA 5EGOB 2DW4A 3BR3A 3DKYA 2W1OA 3H3VK 3SFIA 2IXSA 4M6YA 2HYFA 1EJ9A 2WY8Q 1FZPB 5K5QA 1U0JA 4ZZDA 3BPVA 2V6CA 1RR7A 3MN2A 5ED4A 2OZ6A 2Q1ZB 4PGHA 1Z0XA 5DCFA 5FLMJ 1YIJI 1R1TA 1WJCA 2OU2A 5D5XB 3Q0UA 3BZ6A 3LMMA 5EGOA 3OY9A 3K1NA 1Y1WJ 2YU9J 2NVUB 4AVZA 2M30A 2M45A 3M07A 4RAFA 1G4DA 4IO9F 1A6QA 3LAPA 1MNEA 1UFMA 1OCZH 1WQ2A 5DEQA 1QHHD 1LNWA 2NAZA 2WV1A 5IYCJ 4E7KA 4YFNF 1IRXA 4KA4A 1D1CA 3HKZN 1J7KA 3Q9SA 2PEXA 3E6DA 4XRMA 2W7NA 1BJAA 2XSJC 1IRZA 3PNTA 4PFPA 1BR4A 2JSPA 1VQ4I 2P5KA 3MEXA 3U1KA 2WWYA 1LFUP 1KGSA 2PX9A 1LKXA 3LSJA 2WAQN 4HNUA 2CV0A 2JJ7A 1SD6A 3HM5A 2LBFB 1YI2I 1YS7A 3DU5A 4C9YA 3IRQA 3SZPA 1QHGA 3KP7A 3D0SA 5IPAA 4CYCB 1HCRA 2G9WA 1WSUA 2XGCA 1FP1D 1PYVA 2R5YB 4ZYEA 1HSTA 1RZ4A 2Y9YA 2H6BA 2O5RA 3ZMZA 2LP0A 4M9ZA 2E5ZA 5HDNA 3IH3A 2HQ5A 3PFYA 3S1RJ 2ZKZA 2DN0A 1WGXA 1IN8A 2RREA 1A6IA 1XSVA 3GZ5A 3F8NA 1KU3A 1ZGJA 5B1BH 5KNLA 4IXAA 2ELKA 2LBFA 1DU6A 4F91B 1XMKA 3W6KB 2DJNA 3FMRA 2ID3A 2LLKA 4L9NA 1Z77A 4CYCA 4A0YA 2X4HA 1U78A 5D8LB 3Q9VA 1X2NA 1ZR2A 4FX4A 3HPGA 1AA7A 3TL4X 3QPTA 2VQCA 1Z91A 4O5VA 2HOSA 1T33A 2DFIA 1BI2A 3HOVJ 1R1VA 3ECOA 5F6FA 4D5FA 2OUMA 1O7FA 2ZNZA 1B1BA 3OYNA 1SFKA 3D5LA 3FK7A 5DCMB 4UUVA 3ZMTA 2HFHA 1WJAA 5HS7A 1HKSA 2X1DA 2A61A 1K78A 4S05A 1IDYA 2GA1A 1FEXA 1PP7U 3KP2A 2V4JC 5HVQC 1KQ0A 3CO6C 3PL8A 3WG7H 1N77A 1AKHB 3JRFA 4B44A 1YW9A 1EF4A 2QWWA 5L3CA 2V9VA 1VQKI 1UG2A 2M4GA 5HLHA 2WAEA 2R7XA 3VYUB 4QPOA 3VODA 5GTHC 4U0YA 2VKEA 2FRHA 3ZPLA 4M6VA 2DBBA 2EZKA 3OYAA 1WJ5A 2YX4A 1DUXC 1FTZA 2A6EF 2GXGA 3IP4B 3TOBA 3FXMA 2XB0X 2K7LA 4ESFA 3OS2A 1JUPA 4KFCA 3U2RA 3ZQQA 1QNTA 3MKWB 5GTIC 1P9QC 3AL0B 1D8KA 1Z7UA 3HZJA 4PK4A 1FBUA 3FKJA 3G1LA 1K7AA 2RQPA 3S2DJ 2XGEA 3ZXSA 2JVGA 1JGGA 2BYVE 2Y9ZA 1BI0A 3JRDA 3WTZA 2BXYA 1HSJA 2I10A 4UV8A 4XQFA 4E6KG 1HBXG 4OMZA 2E60A 2MW8A 3E5UA 1BR2A 1YRNB 1Q1HA 1ZREA 3DF8A 4H4KC 3L2QA 2LRDA 3ASNH 2MC4A 3OIPA 5DD8A 1TP4A 1V3FA 3B73A 3JAMZ 1GV2A 2JZYA 1O3TA 4BY1J 3K4NA 1OKRA 3O6BB 2PMZN 3OMYA 2RVCA 4XORA 3GYHX 1EH7A 1QVTA 4II3A 2F6CA 3ELKA 5LBQA 3S14J 3I64A 4M72A 4D7NA 1OCCH 2JUGA 2H1KA 3CCSI 1VFCA 2PJPA 1V5GA 4ZYAA 2HXOA 2FD5A 2R7RA 5TISC 4FHTA 3S8PA 1UHMA 2X1EA 3H36A 3EPZA 2PMHA 4II2A 5CPRB 5J47A 2IA2A 3CCEI 2D45A 1ZYRF 4MEXF 1SC7A 2NXNB 2KZVA 5KAIC 3HYIA 3LA2A 1OLTA 4XBFA 1BW5A 2QQ9A 3M8FA 3FXRA 3ZCOA 3GTLJ 3L7WA 1ULYA 2XKOA 3HOWJ 2P0WA 4ZTFA 4AWXB 1IN5A 1HW2A 1FPQA 4JK1X 5H2FC 2F5DA 5EDNA 1FP2A 3DTIA 2MYSA 4V2GA 3KX2A 3LNQA 2XROA 4BHPA 3GTQJ 1MBJA 4J01A 2VASA 4G7OF 2M1BA 4HNVA 3B6AA 1RIOH 1FWZA 4Q5SF 3L2CA 4V2FA 1X1DA 3FXLA 2XHKA 5FKMA 2NVQJ 5D5WB 3GTMJ 2V79A 4RMNA 5LRRA 2PFBA 1JKPC 3BG3A 3UKGA 5TGTA 3JW4A 1N75A 1T56A 2BGCA 1TBXA 4LMYA 4J19A 2ECBA 3JRAA 3F8MA 2OBPA 4UUTA 5ERIA 3VDXA 3IH4A 1YJNI 4KDPA 2R7UA 1G59A 3GTGJ 4GRIA 4B43A 3G4SI 4IOCF 4ESJA 1ZTRA 2PBIA 4YFKF 1R5ID 2EV0A 3VOEA 2OQGA 1X3UA 4YFXF 4HF2A 5CKTA 4C3IJ 3S2HJ 4PUSA 3PIPF 4KN4X 1AHDP 4E7ZA 3OYEA 1OYYA 1U9NA 1Z21A 4RB1A 4NDLA 1QGPA 5JLXA 4E4HA 5FROA 3CLQA 1LE8A 3K70C 3WE3A 3I71A 2YUSA 3NWSA 3E7LA 4JX5A 3L2RA 5BOXA 3WODF 1RC9A 2M87A 2HWVA 4F55A 1MMAA 2BY0A 1XGOA 3RTRA 3BTLA 3CJTB 3A0BC 2BHYA 4IVNA 2NOGA 2O6GE 4A3CJ 3KYCB 2PLYA 4NBQA 2WBMA 2GXAA 2EPFA 3OSFA 1W0UA 2AQEA 4XMYA 3KP6A 2RAEA 3FISA 2HQRA 4BDZA 2GQQA 2E34A 5C44J 1JXSA 2EA2A 1S6LA 3WTVC 4HNTA 1IG7A 2R0QC 4UY8I 5FKKA 3TDZC 2Q8KA 3KYDB 1UB9A 1R1UA 2VKHA 3K4MA 5HOOA 2XAJA 2HQAA 3K0LA 2CQXA 3MZ8A 2FUG2 5IOZA 1G6NA 3RCOA 4WK8F 1FT9A 4HDUA 4LOCA 1I1GA 3ABTA 2XGDA 1I39A 5BS6A 1FJLA 2IT0A 4I02A 5E79C 2W82A 2VQHA 3AKZA 1Y56A 1WVRA 2HOEA 3BWGA 1OQYA 3BT9A 2DK8A 1EH6A 1ZKGA 4YEJA 4RLQA 4UVCA 5LEJA 5DS9A 4M3GA 5HDGA 1Q1VA 1E3OC 4CCKA 4LIUA 1PUFB 1LFPA 5K1YA 2DDAA 3TP3A 1OMIA 2DA3A 2LKPA 2PMUA 2DFHA 2FMLA 5F08A 1SMTA 4A3JJ 3ZGKA 2BZTA 2LTPA 3ZMDA 1ZH5A 2L7FP 3F8BA 3HUGA 1TWCJ 1BOBA 2W85A 2HS5A 2EB7A 1GVDA 3K9TA 5LFAA 2PI0A 3EUKL 4JYKA 3WTWC 4MGRA 3CESA 4N0BA 3FK6A 2K4JA 3FXUA 2EIKH 1PUFA 2E1OA 1EV7A 3CCYA 3ISPA 2UUZA 1OJLA 1IUYA 2X51A 4YG2F 2JWTA 3HIFA 4GYIA 2D1HA 1APLC 2IGOA 3H1CA 3MZYA 1WI9A 3MD2A 4HF0A 4E70A 1DU0A 4Q48A 5DM6F 3N4MA 4ASNA 2WTEA 1YITI 3J7YJ 5JVTA 4OAZA 4G7ZF 1XDSA 4LLNA 4EM1A 2Z3YA 2RDPA 2L9NA 3DPLC 2NYXA 5J1UA 3DXJF 2F48A 2A68F 3TQNA 5GPAA 2LC2A 3KZIC 4CCLA 1BOAA 3HHHA 1YJWI 3G6EI 1XMXA 3DTKA 4E7JA 1WZ2A 2CG4A 4R79A 5JLWA 4DYRA 1A31A 1JUMA 2R5ZB 4BQQA 3DPUA 2XAGA 3PNYA 4G8XA 3I4NJ 2ZJ2A 3LQQA 1UCRA 1OCOH 2F5CA 3M9AA 2I5UA 2ACJA 1IW7F 1JKRC 4ZYDA 1I50J 1LVAA 1FY7A 2COBA 2JN6A 2ZJRF 1R7JA 2P6TA 5AIPA 2L5QA 3AG4H 3I55I 1ON2A 2E1CA 2ZXJA 2ZSIB 5J1RA 4R1HA 2LH9A 2TRTA 3LSGA 2FA5A 3Q5FA 5B3SH 4IHTA 2KISA 2X0LA 3BROA 3W3CA 2WB1N 2IRFG 3S17J 3HHGA 3HOTA 4U7BA 3WTSC 4KJZA 3OYKA 4Q4ZF 2R5ZA 3S3OA 3KZZA 2H09A 4GFBA 4XLAA 1MGTA 3BZKA 2JK3A 3CMYA 2MG4A 2M7AA 2VE9A 3F72A 3LA3A 3BJAA 4BXUA 1DPUA 1Y8RB 2DOEA 1WFXA 2CV2A 2FOWA 4LLGF 2ZFWA 2EINH 5D4SA 2GXBA 1QPMA 2IS6A 1ODDA 2W57A 2IA1A 1NG7A 1YJ9I 1G2HA 4IEJA 1X1PA 3FMQA 2ZJPF 3IKTA 4HF1A 3GMEA 5EG0B 2H6CA 1VF9A 3K4LA 3C18A 1I27A 4G6QA 2EFQA 1QZZA 3BOQA 1N25A 5DM7F 3T0YA 2M34A 2DOAA 1E2XA 3JRGA 4UV9A 3R4KA 2LF7A 1KQ9A 3SXYA 4BL0B 2FEZA 1YIOA 2FXAA 2KL4A 2L7ZA 4Y13A 2FX0A 3WTTC 3WTUC 3LL7A 3OYLA 4Z2YA 2XF7A 3CJNA 3RYPA 2CS3A 1G3SA 2W25A 1Y6IA 4QPQA 3KIOA 1O3SA 5EJCA 4ANJA 4F3QA 1X1CA 4C2TA 3CQZJ 2VJ4A 4KUMA 3M1EA 3RKYA 5EG0A 2Y0SA 4XL9A 2HXIA 3JTHA 2GWRA 1W7PD 2YX7A 2HDDA 2K4BA 3WGHA 5DYMA 4PJJA 3W6VA 2BHZA 3L2UA 4FX0A 2VBYA 3CCRI 2L02A 3HB9A 3L2WA 5LHGA 1WCMJ 2HDWA 1XD7A 2VBXA 1X19A 2VOPA 2LF8A 3S1NJ 1OYIA 1B9MA 5LGUA 4MQ9F 4EJVA 1TT0A 1BR1A 1FBQA 2ZC2A 2ZMEB 5FKLA 3RSNA 5ICEA 2R7DA 5D6EA 1NK2P 2KLOA 3PIOF 3HRSA 3RPUD 2IS1A 2BW3B 3JR9A 5LGNA 2HVRA 4HBLA 3H92A 2D2WA 2QA4I 4RB2C 4BQAA 2JTVA 4BBRJ 2CMPA 4EEFG 3VB2A 5LLQA 2C6YA 4MTEA 4XN0A 4KYWA 5FD6A 4LGWA 4L5IA 5EF6A 4QSHA 2R7SA 4KIGA 1FMVA 3MAJA 1R22A 3OYDA 2ZMEA 1KYWA 4W97A 4XICA 3O8HA 3EUHA 5GAGJ 3CCMI 2VONA 3M3YJ 2QUFA 1D1BA 1U3EM 3TO6A 1MD0A 2VKVA 2KT0A 2UZKA 2EIMH 2BW3A 4MQVA 3VEPA 1SD7A 1R6RA 5CVIA 4V19K 3CTAA 1QQIA 2LK2A 4N4OB 4I99C 4CCMA 2L3DA 4G94A 1K6YA 4UVBA 4A69C 5E18F 3MKZA 2R7WA 4EGZA 1IXRC 2FJ1A 4BUPA 4D5CA 4CCJA 2W00A 2ZMEC 4KNYA 2FNAA 3EUHC 3SYTA 1IN4A 2JRMA 3KCCA 5KK1A 1UMQA 3GF2A 5J4YA 4UHTA 3FMSA 2K3FA 1ZRCA 2ZBKA 4NC8A 3MZHA 3GTOJ 4E7HA 3S3NA 2DA5A 2P8TA 3BPXA 3K1PA 4EJWA 4RDUA 4BE2A 2R7VA 4DBQA 5FLVA 1UZCA 4DGWB 1P2FA 4P9UA 3LOCA 4AYBA 2A69F 2VL8A 3IAS2 5IP9J 1B72A 2QF7A 4MFEA 1HKQA 2DA7A 2YR2A 3LAJA 3M8JA 3J80Z 2YPRA 2G0EA 3LSMA 4MHGA 4A5MA 1LDDA 4G6TB 3PO2J 3JRHA 5DV5A 2CUFA 2XF6A 1WJEA 5JVGF 1NH3A 1MMGA 3BJOA 4UB8C 5HLGA 3E3VA 5E1WA 2HEOA
chains in the Genus database with same CATH topology
1JUPA 1ETOA 1HOMA 3G1LA 3S2DJ 2X9DA 2XB5A 2XGEA 1TWAJ 1JGGA 3H0GJ 1QRYA 2Y0SN 4JP0A 3JRDA 2Y9ZA 4A3IJ 2I10A 1W0TA 2CQQA 2MW8A 1YRNB 4C2MJ 3A01A 1WH5A 2DA4A 2HYJA 3BTIA 4XK4A 1GV2A 5M3FJ 4BY1J 4B3AA 2PMZN 2HOTA 3OSGA 4MO7A 1QVTA 5IOYA 1JKOC 3S14J 4D7NA 1OFCX 2H1KA 1VFCA 3ZQFA 2HXOA 2FD5A 3S15J 5C4XJ 2K9NA 3F0CA 2E2HJ 3QQAA 1CQTA 1UHSA 3IH2A 5GP9A 1GV5A 1NTCA 3G1OA 1BW5A 1XS9A 3HGGA 1ORKA 4C3HJ 2TCTA 5FKOA 5M5YJ 3GTLJ 2DA2A 3HOWJ 4MIMA 4IHYA 4FISA 4JX6A 3NARA 1R9TJ 5EDNA 5EYRA 4V2GA 1RKTA 2DMTA 3TW6A 3LNQA 2M2EA 2NS7A 5M5WJ 4B4CA 1NK3P 3ZQCA 4S0HB 3BR0A 3GTQJ 1MBJA 4HNVA 3B6AA 1BL0A 4V2FA 2O7OA 2CU7A 2NVQJ 5FKMA 4D7MA 4A3MJ 2NS8A 5F0HA 3GTMJ 1JKPC 3BG3A 1RPWA 3HBLA 4ABZA 4FCYA 3UKGA 2ZB9A 5IYDJ 1IDZA 5F27A 1T56A 3D1NI 4J19A 2ECBA 3JRAA 1BW6A 1JJ6C 4BBSJ 4UUTA 5F0CA 2NVXJ 3IH4A 1K61A 1H88C 3WHCA 1B72B 3GTGJ 1P7JA 1ZTRA 1IGNA 5GPCA 4A3FJ 4C3IJ 3S2HJ 1JUSA 1ETXA 1AHDP 4AYBN 2E19A 2DMNA 2LY9A 2DMQA 1U9NA 1OCTC 4NDLA 1WI3A 2M8GX 5JLXA 1JTYA 1JTXA 5C4JJ 1LE8A 1ETVA 3BG9A 2YUSA 3C2BA 2OPTA 1IJWC 1S7EA 3E7LA 4JX5A 3TW7A 4I76A 2R7ZJ 1H89C 3BTLA 1BJZA 4QIWN 2NOGA 3S1QJ 2Y31A 4A3CJ 2GBYA 3RQIA 1JKQC 1ETYA 3OSFA 2XRLA 3K2AA 4UUSB 1W0UA 3DCFA 2DMPA 2RAEA 3FISA 4M3FA 3GTJJ 1MNMC 3RZDJ 3G1MA 4A3LJ 4IHXA 5HODA 5C44J 3HOZJ 4FE4A 3BR1A 2XPUA 4M3DA 3WHBA 1IG7A 2R0QC 5FKKA 3HOUJ 1B8IB 1MSFC 5EEAA 4XRSG 3HDDA 5IOZA 2CQXA 4LOCA 4BKXA 2XGDA 2R92J 4QTRA 4UUSA 4FTHA 3RZOJ 2EH3A 4DZPA 3JREA 1FJLA 1HDPA 2DA1A 1TWGJ 2LR8A 3I4MJ 2JMWA 2CJJA 3BT9A 3ZQIA 1ZKGA 5DS9A 1HDDC 4M3GA 1Q1VA 1E3OC 4XIDA 1VNDA 2IBDA 1PUFB 3TP3A 1B8IA 2DA3A 1XC5A 3SDGA 3K7AJ 3L1PA 2OF7A 4XRSA 3RKQA 3BQZA 5F08A 4DZJA 2IAIA 4A3JJ 3Q0WA 1JT0A 3ZQLA 1WPKA 2LTPA 3GTPJ 1P7IA 1MBGA 2L7FP 2XPVA 4W1UA 5EZHA 1I6HJ 3BR2A 4MLOA 3HEFA 1TWCJ 2E2IJ 3ZQGA 3BR6A 1GVDA 4JYKA 1F43A 5IP7J 5F0FA 4X6AJ 3FK6A 1ETWA 5F1JA 3OIOA 3A02A 4L5EA 1PUFA 2E1OA 3TP0A 3B6CA 2LFBA 3CCYA 2MGQA 4X1EA 3OOUA 1OJLA 1SFOJ 4Y52J 2VUMJ 2JWTA 2ECCA 5FJ8J 1APLC 3BG5A 5M5XJ 3S16J 2K40A 5EZGA 1ZR4A 2LKXA 4BY7J 3JRIA 1DU0A 1D5YA 1SANA 2LVSA 2AHQA 5K7ZA 3IV5A 1LE8B 4A3GJ 1LFBA 3Q0VA 4JX4A 1FIPA 2X6OA 1ZGWA 1OCPA 2DTZA 5J1UA 3FIWA 5DTDA 2W48A 2AO9A 5GPAA 4IHVA 3VPRA 3QPLA 1GDTA 2L9RA 2M0CA 1TWFJ 5E3MA 1ZK8A 5JLWA 3LSPA 4DYRA 2NVTJ 1MBEA 1JUMA 2R5ZB 2R5YA 2YS9A 5J1YA 2L7MP 1WH7A 1X58A 3I4NJ 1JKRC 1I50J 2VI6A 3LSRA 1QPIA 2EZHA 2COBA 2JN6A 1U9OA 1O4XA 4AUXA 1IC8A 1IUFA 4DYQA 4A3DJ 2XPWA 5J1RA 2FQ4A 1POGA 1RESA 2TRTA 1ETKA 3LSGA 4A3EJ 2E2JJ 1F36A 2K9SA 1GUUA 2D5VA 3QPSA 2WB1N 2XSDC 3S17J 1MBKA 9ANTA 4M3BA 2R5ZA 2KDZA 4GFBA 1MH4A 2O9LA 2JK3A 3CMYA 2MG4A 5EGOB 3PM1A 3BR3A 2DMUA 1IV6A 4A93J 3H3VK 3SFIA 1G2HA 2JA5J 4RBOA 4IEJA 1RR7A 1ITYA 3MN2A 2MSYA 1AU7A 5EG0B 5F04A 1VF9A 5FKNA 1Z0XA 5FLMJ 1AKHA 2M34A 3Q0UA 2VPRA 5EGOA 3JRGA 1MBFA 1Y1WJ 2YU9J 1QVUA 3GBGA 2CRGA 2L7ZA 2FX0A 3HOXJ 2JA7J 1FTTA 2Y2ZA 4B1RA 1X2MA 4DW6A 3FKIJ 1MSEC 4DYCA 2X48A 2GLOA 4BXXJ 2LD5A 1ENHA 3CQZJ 2WV1A 3BR5A 5EG0A 3BTCA 1K83J 5IYCJ 1HLVA 4IHWA 1MBHA 3HKZN 2HXIA 2B63J 4XRMA 2HDDA 3TEDA 2CUEA 2R93J 3BTJA 3W6VA 3M4OJ 1IRZA 3HB9A 2EQRA 1WCMJ 2Y30A 1LFUP 4Y7NJ 5BNGA 1U8BA 3LSJA 3S1NJ 2WAQN 2JJ7A 1YRNA 2JA6J 1H8AC 3HM5A 2O8KA 5FKLA 4G12A 3JRBA 4A3KJ 1NK2P 3ZQHA 3HGYA 1GT0C 5IPAA 4CYCB 1HCRA 3MKLA 2QCOA 2JA8J 3JR9A 2N8GA 3SJMA 2XGCA 2R5YB 5J3LA 2Y9YA 2GM4A 2LP0A 4BBRJ 4EEFG 3JRCA 1RKWA 3IH3A 2HQ5A 1VI0A 3S1RJ 4A3BJ 2DA6A 2DN0A 3PO3J 1WGXA 5EF6A 1JJ8C 1TWHJ 3NAUA 4QSHA 1A6IA 2ME0A 3MVPA 4I6ZA 2P81A 2ELKA 1DU6A 4W97A 4XICA 3O8HA 3M3YJ 1BA5A 3S1MJ 2DJNA 3BQYA 2ID3A 2LLKA 2VKVA 1Z77A 4CYCA 2EZIA 2KT0A 1U78A 3CDLA 1X2NA 1RETA 1ZR2A 2LK2A 2K9QA 2HOSA 1T33A 4M3EA 4MFDA 3HOVJ 3O8GA 4A69C 3Q3SA 1ZQ3P 4D5FA 1Y1VJ 3ZOBA 1HF0A 2HI3A 3FK7A 2FJ1A 2L0KA 4D5CA 5C3EJ 2EBIA 2H8RA 3DEWA 1FIAA 1MH3A 2ME6A 1UMQA 1TC3C 1A5JA 4FE7A 5K7HA 2ID6A 1IDYA 1ETQA 1FEXA 3GTOJ 5IP6A 2DA5A 4RDUA 2M9HA 1JT6A 1AKHB 5FLVA 1XG1A 3JRFA 5M3MJ 3LOCA 1EF4A 3A03A 5E3LA 5IP9J 3HOYJ 5K7FA 5E3NA 1B72A 2QF7A 4MFEA 3GTKJ 1UG2A 2NVYJ 2DA7A 4C3JJ 2EZLA 5E3OA 2VKEA 2HOAA 2G0EA 4M6VA 3JRHA 3PO2J 2CUFA 3A01B 2EZKA 4AC0A 2IEKA 1I3QJ 1FTZA 5IYBJ 2XB0X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JUP A;  1ETO A;  1HOM A;  3G1L A;  3S2D J;  2X9D A;  2XB5 A;  2XGE A;  1TWA J;  1JGG A;  3H0G J;  1QRY A;  2Y0S N;  4JP0 A;  3JRD A;  2Y9Z A;  4A3I J;  2I10 A;  1W0T A;  2CQQ A;  2MW8 A;  1YRN B;  4C2M J;  3A01 A;  1WH5 A;  2DA4 A;  2HYJ A;  3BTI A;  4XK4 A;  1GV2 A;  5M3F J;  4BY1 J;  4B3A A;  2PMZ N;  2HOT A;  3OSG A;  4MO7 A;  1QVT A;  5IOY A;  1JKO C;  3S14 J;  4D7N A;  1OFC X;  2H1K A;  1VFC A;  3ZQF A;  2HXO A;  2FD5 A;  3S15 J;  5C4X J;  2K9N A;  3F0C A;  2E2H J;  3QQA A;  1CQT A;  1UHS A;  3IH2 A;  5GP9 A;  1GV5 A;  1NTC A;  3G1O A;  1BW5 A;  1XS9 A;  3HGG A;  1ORK A;  4C3H J;  2TCT A;  5FKO A;  5M5Y J;  3GTL J;  2DA2 A;  3HOW J;  4MIM A;  4IHY A;  4FIS A;  4JX6 A;  3NAR A;  1R9T J;  5EDN A;  5EYR A;  4V2G A;  1RKT A;  2DMT A;  3TW6 A;  3LNQ A;  2M2E A;  2NS7 A;  5M5W J;  4B4C A;  1NK3 P;  3ZQC A;  4S0H B;  3BR0 A;  3GTQ J;  1MBJ A;  4HNV A;  3B6A A;  1BL0 A;  4V2F A;  2O7O A;  2CU7 A;  2NVQ J;  5FKM A;  4D7M A;  4A3M J;  2NS8 A;  5F0H A;  3GTM J;  1JKP C;  3BG3 A;  1RPW A;  3HBL A;  4ABZ A;  4FCY A;  3UKG A;  2ZB9 A;  5IYD J;  1IDZ A;  5F27 A;  1T56 A;  3D1N I;  4J19 A;  2ECB A;  3JRA A;  1BW6 A;  1JJ6 C;  4BBS J;  4UUT A;  5F0C A;  2NVX J;  3IH4 A;  1K61 A;  1H88 C;  3WHC A;  1B72 B;  3GTG J;  1P7J A;  1ZTR A;  1IGN A;  5GPC A;  4A3F J;  4C3I J;  3S2H J;  1JUS A;  1ETX A;  1AHD P;  4AYB N;  2E19 A;  2DMN A;  2LY9 A;  2DMQ A;  1U9N A;  1OCT C;  4NDL A;  1WI3 A;  2M8G X;  5JLX A;  1JTY A;  1JTX A;  5C4J J;  1LE8 A;  1ETV A;  3BG9 A;  2YUS A;  3C2B A;  2OPT A;  1IJW C;  1S7E A;  3E7L A;  4JX5 A;  3TW7 A;  4I76 A;  2R7Z J;  1H89 C;  3BTL A;  1BJZ A;  4QIW N;  2NOG A;  3S1Q J;  2Y31 A;  4A3C J;  2GBY A;  3RQI A;  1JKQ C;  1ETY A;  3OSF A;  2XRL A;  3K2A A;  4UUS B;  1W0U A;  3DCF A;  2DMP A;  2RAE A;  3FIS A;  4M3F A;  3GTJ J;  1MNM C;  3RZD J;  3G1M A;  4A3L J;  4IHX A;  5HOD A;  5C44 J;  3HOZ J;  4FE4 A;  3BR1 A;  2XPU A;  4M3D A;  3WHB A;  1IG7 A;  2R0Q C;  5FKK A;  3HOU J;  1B8I B;  1MSF C;  5EEA A;  4XRS G;  3HDD A;  5IOZ A;  2CQX A;  4LOC A;  4BKX A;  2XGD A;  2R92 J;  4QTR A;  4UUS A;  4FTH A;  3RZO J;  2EH3 A;  4DZP A;  3JRE A;  1FJL A;  1HDP A;  2DA1 A;  1TWG J;  2LR8 A;  3I4M J;  2JMW A;  2CJJ A;  3BT9 A;  3ZQI A;  1ZKG A;  5DS9 A;  1HDD C;  4M3G A;  1Q1V A;  1E3O C;  4XID A;  1VND A;  2IBD A;  1PUF B;  3TP3 A;  1B8I A;  2DA3 A;  1XC5 A;  3SDG A;  3K7A J;  3L1P A;  2OF7 A;  4XRS A;  3RKQ A;  3BQZ A;  5F08 A;  4DZJ A;  2IAI A;  4A3J J;  3Q0W A;  1JT0 A;  3ZQL A;  1WPK A;  2LTP A;  3GTP J;  1P7I A;  1MBG A;  2L7F P;  2XPV A;  4W1U A;  5EZH A;  1I6H J;  3BR2 A;  4MLO A;  3HEF A;  1TWC J;  2E2I J;  3ZQG A;  3BR6 A;  1GVD A;  4JYK A;  1F43 A;  5IP7 J;  5F0F A;  4X6A J;  3FK6 A;  1ETW A;  5F1J A;  3OIO A;  3A02 A;  4L5E A;  1PUF A;  2E1O A;  3TP0 A;  3B6C A;  2LFB A;  3CCY A;  2MGQ A;  4X1E A;  3OOU A;  1OJL A;  1SFO J;  4Y52 J;  2VUM J;  2JWT A;  2ECC A;  5FJ8 J;  1APL C;  3BG5 A;  5M5X J;  3S16 J;  2K40 A;  5EZG A;  1ZR4 A;  2LKX A;  4BY7 J;  3JRI A;  1DU0 A;  1D5Y A;  1SAN A;  2LVS A;  2AHQ A;  5K7Z A;  3IV5 A;  1LE8 B;  4A3G J;  1LFB A;  3Q0V A;  4JX4 A;  1FIP A;  2X6O A;  1ZGW A;  1OCP A;  2DTZ A;  5J1U A;  3FIW A;  5DTD A;  2W48 A;  2AO9 A;  5GPA A;  4IHV A;  3VPR A;  3QPL A;  1GDT A;  2L9R A;  2M0C A;  1TWF J;  5E3M A;  1ZK8 A;  5JLW A;  3LSP A;  4DYR A;  2NVT J;  1MBE A;  1JUM A;  2R5Z B;  2R5Y A;  2YS9 A;  5J1Y A;  2L7M P;  1WH7 A;  1X58 A;  3I4N J;  1JKR C;  1I50 J;  2VI6 A;  3LSR A;  1QPI A;  2EZH A;  2COB A;  2JN6 A;  1U9O A;  1O4X A;  4AUX A;  1IC8 A;  1IUF A;  4DYQ A;  4A3D J;  2XPW A;  5J1R A;  2FQ4 A;  1POG A;  1RES A;  2TRT A;  1ETK A;  3LSG A;  4A3E J;  2E2J J;  1F36 A;  2K9S A;  1GUU A;  2D5V A;  3QPS A;  2WB1 N;  2XSD C;  3S17 J;  1MBK A;  9ANT A;  4M3B A;  2R5Z A;  2KDZ A;  4GFB A;  1MH4 A;  2O9L A;  2JK3 A;  3CMY A;  2MG4 A;  5EGO B;  3PM1 A;  3BR3 A;  2DMU A;  1IV6 A;  4A93 J;  3H3V K;  3SFI A;  1G2H A;  2JA5 J;  4RBO A;  4IEJ A;  1RR7 A;  1ITY A;  3MN2 A;  2MSY A;  1AU7 A;  5EG0 B;  5F04 A;  1VF9 A;  5FKN A;  1Z0X A;  5FLM J;  1AKH A;  2M34 A;  3Q0U A;  2VPR A;  5EGO A;  3JRG A;  1MBF A;  1Y1W J;  2YU9 J;  1QVU A;  3GBG A;  2CRG A;  2L7Z A;  2FX0 A;  3HOX J;  2JA7 J;  1FTT A;  2Y2Z A;  4B1R A;  1X2M A;  4DW6 A;  3FKI J;  1MSE C;  4DYC A;  2X48 A;  2GLO A;  4BXX J;  2LD5 A;  1ENH A;  3CQZ J;  2WV1 A;  3BR5 A;  5EG0 A;  3BTC A;  1K83 J;  5IYC J;  1HLV A;  4IHW A;  1MBH A;  3HKZ N;  2HXI A;  2B63 J;  4XRM A;  2HDD A;  3TED A;  2CUE A;  2R93 J;  3BTJ A;  3W6V A;  3M4O J;  1IRZ A;  3HB9 A;  2EQR A;  1WCM J;  2Y30 A;  1LFU P;  4Y7N J;  5BNG A;  1U8B A;  3LSJ A;  3S1N J;  2WAQ N;  2JJ7 A;  1YRN A;  2JA6 J;  1H8A C;  3HM5 A;  2O8K A;  5FKL A;  4G12 A;  3JRB A;  4A3K J;  1NK2 P;  3ZQH A;  3HGY A;  1GT0 C;  5IPA A;  4CYC B;  1HCR A;  3MKL A;  2QCO A;  2JA8 J;  3JR9 A;  2N8G A;  3SJM A;  2XGC A;  2R5Y B;  5J3L A;  2Y9Y A;  2GM4 A;  2LP0 A;  4BBR J;  4EEF G;  3JRC A;  1RKW A;  3IH3 A;  2HQ5 A;  1VI0 A;  3S1R J;  4A3B J;  2DA6 A;  2DN0 A;  3PO3 J;  1WGX A;  5EF6 A;  1JJ8 C;  1TWH J;  3NAU A;  4QSH A;  1A6I A;  2ME0 A;  3MVP A;  4I6Z A;  2P81 A;  2ELK A;  1DU6 A;  4W97 A;  4XIC A;  3O8H A;  3M3Y J;  1BA5 A;  3S1M J;  2DJN A;  3BQY A;  2ID3 A;  2LLK A;  2VKV A;  1Z77 A;  4CYC A;  2EZI A;  2KT0 A;  1U78 A;  3CDL A;  1X2N A;  1RET A;  1ZR2 A;  2LK2 A;  2K9Q A;  2HOS A;  1T33 A;  4M3E A;  4MFD A;  3HOV J;  3O8G A;  4A69 C;  3Q3S A;  1ZQ3 P;  4D5F A;  1Y1V J;  3ZOB A;  1HF0 A;  2HI3 A;  3FK7 A;  2FJ1 A;  2L0K A;  4D5C A;  5C3E J;  2EBI A;  2H8R A;  3DEW A;  1FIA A;  1MH3 A;  2ME6 A;  1UMQ A;  1TC3 C;  1A5J A;  4FE7 A;  5K7H A;  2ID6 A;  1IDY A;  1ETQ A;  1FEX A;  3GTO J;  5IP6 A;  2DA5 A;  4RDU A;  2M9H A;  1JT6 A;  1AKH B;  5FLV A;  1XG1 A;  3JRF A;  5M3M J;  3LOC A;  1EF4 A;  3A03 A;  5E3L A;  5IP9 J;  3HOY J;  5K7F A;  5E3N A;  1B72 A;  2QF7 A;  4MFE A;  3GTK J;  1UG2 A;  2NVY J;  2DA7 A;  4C3J J;  2EZL A;  5E3O A;  2VKE A;  2HOA A;  2G0E A;  4M6V A;  3JRH A;  3PO2 J;  2CUF A;  3A01 B;  2EZK A;  4AC0 A;  2IEK A;  1I3Q J;  1FTZ A;  5IYB J;  2XB0 X; 
#chains in the Genus database with same CATH topology
 2DU9 A;  3SEZ A;  4P96 A;  1ETO A;  4MTD A;  4UXN A;  2QSH X;  1R00 A;  2E7W A;  2O03 A;  3F9K A;  1D0X A;  2L7K A;  2LY2 A;  1HOM A;  3O3K A;  4M9S A;  1QRY A;  3QYF A;  4Y15 A;  1TQP A;  3K1M A;  5TJJ A;  2FBI A;  4HA8 A;  3NEU A;  1R71 A;  4HQM A;  4C2M J;  1YLF A;  2XGX A;  2JA2 A;  2DA4 A;  4ZTJ A;  4XK4 A;  1LVK A;  4L0Y B;  1BM9 A;  5E8I A;  4B3A A;  3OSG A;  3ZMU A;  4CHU A;  5KHD A;  2QQB A;  1KZH A;  3VWB A;  2HGC A;  3B02 A;  1ZG5 A;  1FYM A;  3LFK A;  3HOS A;  2W84 A;  3F0C A;  4ZH4 F;  3J7A O;  2FQ3 A;  3WGG A;  2E2H J;  3QQA A;  4LD5 A;  4F93 B;  1CQT A;  2VC0 A;  2QEX I;  3CF5 F;  3IH2 A;  5GP9 A;  3W2A A;  1NTC A;  2VE8 A;  1U2W A;  3BG7 A;  3H5N A;  3OYC A;  3H5A A;  2P7C B;  2VB6 A;  1T0F C;  2DOD A;  4MIM A;  4B48 A;  4FIS A;  3TDU C;  4JX6 A;  5H6Q A;  1W5S A;  2BVL A;  3NAR A;  2K86 A;  1R9T J;  2LY1 A;  1UAA A;  1GXP A;  1RKT A;  2DMT A;  2V1U A;  2NS7 A;  3S93 A;  5GAE J;  2HVS A;  1NK3 P;  4E7I A;  2Q0O A;  3V7S A;  1FSE A;  4D0P A;  4IZZ A;  1XPX A;  2LNB A;  3FX3 A;  4XKW A;  2FMY A;  4E7L A;  2CU7 A;  3TO9 A;  2RN7 A;  1K78 B;  1NHA A;  1RPW A;  2Y69 H;  5H6R A;  1OYW A;  3IWF A;  3WU1 B;  1IDZ A;  3AAF A;  2F5F A;  2RKH A;  4HX8 A;  1PP8 F;  2F4I A;  3C7J A;  4CUG A;  4I98 B;  5F0C A;  4CYD A;  2DXI A;  2XAU A;  2OZU A;  1H88 C;  2P4W A;  4PFO A;  1STZ A;  1IGN A;  2DTR A;  5EEH A;  4B47 A;  2EIL H;  1D0Z A;  2FSW A;  4A3F J;  3KP4 A;  1MMN A;  5CVJ A;  1IXC A;  2E19 A;  3L9F A;  2DMN A;  2IJL A;  1DGW Y;  3R61 A;  1LPQ A;  2QSF X;  3GZ6 A;  2QGU A;  4ZJZ A;  3H9Q A;  3CF2 A;  3LA7 A;  1XSX A;  2STT A;  1WJF A;  2G7U A;  5L3D A;  3F23 A;  1BBY A;  3J80 K;  2OPT A;  2KP6 A;  2UV1 A;  2V1N A;  1IJW C;  1W4M A;  1BC7 C;  2UWM A;  3GVA A;  4ZC3 A;  2R7T A;  2K27 A;  2MA3 A;  1FX7 A;  3HSF A;  3C2G A;  3CUO A;  4A2U A;  1I3A A;  3DKX A;  2GBY A;  2R7O A;  1VZ0 A;  3RQI A;  1JKQ C;  3W2W A;  4LJZ F;  1WHU A;  3DTE A;  1O7L A;  1S8N A;  2DMP A;  3DCF A;  2LSO A;  3GTJ J;  4RAG A;  4BE1 A;  1KON A;  1ZG3 A;  2CQN A;  2TDX A;  4RS8 A;  5HOD A;  4WWC A;  3HOZ J;  1LDJ A;  2XPU A;  3BY6 A;  4Q47 A;  2EFN A;  1B8I B;  4M6X A;  4XKC A;  1NG6 A;  2V7F A;  3DEU A;  2EFP A;  5F1R A;  3I0T A;  3L00 A;  3E6C C;  1S9H A;  3ULQ B;  4XN3 A;  2A6T A;  1X1A A;  1XCB A;  3FF5 A;  5DD4 A;  1YYV A;  2LR8 A;  1SFX A;  2DA1 A;  3PSF A;  3N97 A;  2MH9 A;  5FFX A;  3RKX A;  4IHS A;  3HXL A;  2KIM A;  1O3Q A;  2RNG A;  4CDG A;  1SD5 A;  2HNH A;  1HDD C;  4NC7 A;  2CUJ A;  4XID A;  2IBD A;  4EVI A;  1B8I A;  3IRR A;  3CC4 I;  3LQR A;  1TW2 A;  1WJD A;  3LFU A;  1HW5 A;  4XRS A;  2KIU A;  2IVM A;  4I7H A;  2IAI A;  2WAD A;  1ZAO A;  3Q0W A;  4CGZ A;  4F7Z A;  1LQ1 A;  4GGG A;  4ENJ A;  2DFF A;  1MBG A;  5EZH A;  5E17 F;  2OA4 A;  3BR2 A;  4RB3 C;  3T1B A;  2WY7 Q;  1SFU A;  2ESN A;  3BR6 A;  3S3M A;  1SAX A;  4J00 A;  2GIV A;  3ML6 A;  3RJP A;  3CCQ I;  2BV6 A;  5J40 A;  5BMZ A;  2YU3 A;  3OIO A;  3DBL B;  2V9P A;  4HV6 A;  2KJC A;  5JFR A;  2OD5 A;  2MGQ A;  5CVR A;  2O0Y A;  2VXZ A;  4KT5 C;  2ISY A;  2CFO A;  3IAM 2;  1FOY A;  4P5O A;  5JHF A;  2ZXH A;  1HA8 A;  1S72 I;  3BG5 A;  3HRM A;  5CVU A;  4OIQ F;  3OYH A;  3S16 J;  4RM2 A;  1IRG A;  3G71 I;  1V4R A;  1D5Y A;  3TMO A;  4BNC A;  3KE2 A;  2LVS A;  2AHQ A;  5K7Z A;  4S04 A;  4XKB A;  1G8X A;  1LE8 B;  1VQ6 I;  3CDH A;  2DJI A;  1KA8 A;  1FIP A;  2X6O A;  4CZC A;  1OCP A;  1ZGW A;  5DTD A;  2WC2 A;  4KIF A;  2AO9 A;  4IHV A;  3LST A;  3WE2 A;  2JSC A;  3FWE A;  4ZYH A;  2H94 A;  2IGM A;  4Y3O A;  5KAF C;  1W7P B;  4DJA A;  2R4G A;  1YHQ I;  3VSK A;  2M0C A;  2HVQ A;  4FET A;  4TV7 A;  5D8K B;  4BJT A;  5DDG A;  4U0W A;  3QWL A;  1O3R A;  4NB5 A;  3LSP A;  2NVT J;  4HX4 A;  1JHF A;  1USS A;  2GAU A;  2M5W A;  4XLP F;  2ESH A;  3JTG A;  1T6S A;  3F3X A;  1P92 A;  6PAX A;  1C0W A;  3LWF A;  2VJ5 A;  1PDN C;  4OIO F;  3ONQ A;  3LSR A;  1MJB A;  1R23 A;  2J5P A;  4RB0 A;  5D5U B;  2EZH A;  3VYR B;  5K5O A;  1Z6R A;  2JT1 A;  1IUF A;  1DGR M;  4DYQ A;  2HDC A;  2XPW A;  4WCG A;  5B1A H;  5B66 C;  1ETK A;  1RNL A;  4I09 A;  1W7P A;  2NNN A;  2K9S A;  4RLF A;  2QM3 A;  1HC8 A;  2OAZ A;  2XVC A;  1XDU A;  2LMD A;  3QPS A;  4HG2 A;  2V1X A;  1MBK A;  5L3B A;  4OIP F;  2CQK A;  2BY3 A;  4XSZ F;  1YX5 A;  9ANT A;  4RGU A;  4OIR F;  3HJE A;  5CJ9 A;  3PM1 A;  3GW2 A;  1L3L A;  2DMU A;  1IV6 A;  2V1D A;  2L54 A;  4A93 J;  5AIQ A;  2QKL B;  4XM3 A;  3RPU A;  1V55 H;  1XSD A;  4RBO A;  4B3X A;  2X6X A;  1W5T A;  3OL4 A;  1RRJ A;  1ITY A;  4I0A A;  5FD5 A;  3P5J A;  2Y48 A;  2MSY A;  4HEA 2;  2VN2 A;  1AU7 A;  2X85 A;  4LB6 B;  3HUG B;  4OIN F;  3A4C A;  2P5L C;  4GYG A;  5H20 A;  4O6J A;  2K9M A;  3E97 A;  1A35 A;  1BI3 A;  2DOF A;  1PUE E;  2Y75 A;  3PSI A;  1BIB A;  2L9S A;  3W2V A;  2XC7 A;  2KHM A;  2M4K A;  1QVU A;  3GBG A;  2VQG A;  2EWN A;  3WU2 C;  2VPL A;  3HOX J;  4BYY A;  3HTU A;  2JA7 J;  4B1R A;  5B5E C;  1X2M A;  3DP7 A;  2W24 A;  4OOI A;  1QO0 D;  2X48 A;  2GLO A;  4BXX J;  1ENH A;  1JI8 A;  3BR5 A;  1HLV A;  2RGV A;  1G3T A;  2B63 J;  5KVR A;  2CUE A;  4PJM A;  2R93 J;  3BTJ A;  3S2W A;  3C2H A;  3KFW X;  3GFI A;  3M4O J;  4EJU A;  3H0D A;  2DT5 A;  4M71 A;  2Y30 A;  4Y7N J;  1JGS A;  5BNG A;  1U8B A;  2KDO A;  2EFW A;  2DT6 A;  5HLT A;  1MDM B;  1P4W A;  2M7B A;  2AXT C;  1H8A C;  3DBR B;  4G12 A;  1T8I A;  3WU0 A;  1K79 A;  5LRS A;  2CWE A;  3HGY A;  1Z67 A;  4G9Y A;  2MH2 A;  2IS2 A;  4BGD A;  3MKL A;  5LHI A;  2CH0 A;  5FLX Z;  1IF1 A;  2N8G A;  2DPU A;  1Z9C A;  3CCV I;  5J3L A;  2A05 A;  3IUO A;  5IT9 Z;  4IJA A;  2CUZ A;  3JRC A;  4AM3 A;  1F1Z A;  1SVO A;  1B9N A;  2IW5 A;  1VI0 A;  1YG2 A;  3ERM A;  2DA6 A;  4C2U A;  4LB5 A;  3PO3 J;  1OIS A;  2FU4 A;  3I56 I;  2HTJ A;  3K69 A;  3NAU A;  1MDM A;  2ME0 A;  1YQA A;  3MVP A;  3OV8 A;  2KJB A;  1T95 A;  2E1M C;  3GO5 A;  2F4M B;  1U5T C;  4LK0 F;  3T8R A;  4BQO A;  1H0M A;  3GLX A;  3I3L A;  2LOO A;  3LSH A;  4ETS A;  1EH8 A;  1IZ1 A;  4LIV A;  1E0E A;  1IV8 A;  2O61 A;  4EQQ A;  2BOL A;  4MFD A;  3HTS B;  4XOP A;  3O8G A;  4KMF A;  3GEZ A;  4BAY A;  3Q3S A;  1AWC A;  5FGM A;  1HF0 A;  2HI3 A;  1Z1D A;  2LYC A;  2L0K A;  4IF4 A;  1TLH B;  4PZJ A;  5CQE A;  5HNH A;  5C3E J;  2EBI A;  1IXS B;  2H8R A;  5FB2 A;  3DEW A;  1MH3 A;  1T08 B;  1RUN A;  1A5J A;  5K7H A;  2ID6 A;  3ROU A;  4GDF A;  2L2O A;  1YE9 A;  2DCE A;  3HRU A;  3CME I;  3TGN A;  2M9H A;  3GWZ A;  4BE0 A;  1JT6 A;  1XG1 A;  5M3M J;  4ENN A;  3HOY J;  2XUB A;  3ZR8 X;  1TTY A;  3BC8 A;  2RV8 A;  3I54 A;  5K7F A;  5E3N A;  3OYF A;  2CW7 A;  4NHJ A;  4UNO A;  3EET A;  1L0O C;  4C3J J;  2BY1 A;  4ZDL A;  2KIQ A;  1XTA A;  2EZL A;  3MFK A;  5E3O A;  3G73 A;  2HOA A;  4N4N B;  2GOM A;  1BIA A;  2IPQ X;  1KU2 A;  4KIB A;  3RI4 A;  5E1X A;  4RAZ A;  1VQL I;  4AC0 A;  5DUI A;  2IEK A;  1S29 A;  3ABM H;  5IYB J;  2F5V A;  2ZNY A;  4IQJ A;  3QOE A;  1J75 A;  4O3M A;  4LG3 A;  3OL3 A;  3ZP5 A;  5FFZ A;  2CQ7 A;  2DPD A;  1D8J A;  1SEU A;  1VQN I;  2DFE A;  1YW7 A;  3DWL E;  1DP7 P;  3P7N A;  3BDD A;  2X9D A;  2XB5 A;  3GCM A;  2MLG A;  4L0Z B;  2AXL A;  3H0G J;  4WXD A;  2X1C A;  2Y0S N;  3I59 B;  3V4G A;  2GOX B;  3H3U A;  3HPH A;  3CMM A;  2DDB A;  3CUQ A;  2CQQ A;  4LG0 A;  1D0Y A;  3F8C A;  3QYE A;  2HYJ A;  4IL6 C;  2QBY A;  2CSO A;  4PJN A;  3RIR A;  4HV5 A;  5AON A;  2WAF A;  4QLC U;  2XKP A;  5M3F J;  1F5T A;  1XMA A;  2EA4 A;  1DPR A;  3ABK H;  2OQR A;  3P9C A;  4MO7 A;  5IOY A;  1JKO C;  1OFC X;  4P1W A;  4WX9 A;  5IT3 A;  2VOO A;  3ZQF A;  2NNY A;  4U87 A;  1S5L C;  1REP C;  3S15 J;  2K9N A;  2P5V A;  3CUQ C;  3O2P E;  3A2K A;  3I59 A;  3KLO A;  3ZQ7 A;  3QU3 A;  3ZMV A;  2P6S A;  1YX3 A;  3KLN A;  5FRN A;  3V8K A;  1BC8 C;  3REO A;  2KRH A;  4BAC A;  5FLX K;  2UXX A;  1J5Y A;  3HGG A;  4WXC A;  4BJ5 C;  1I5Z A;  2TCT A;  3RPQ A;  4RGS A;  4XR6 A;  5IT9 K;  1TW3 A;  1W5C C;  3CLO A;  1R36 A;  1TQI A;  3QRF F;  2KRF A;  2DYS H;  4RGX A;  1ZRD A;  3U9G A;  4YEL A;  5D4R A;  2JPC A;  1EA3 A;  3C3W A;  5CQG A;  5EYR A;  2KRC A;  4DQ2 A;  4BEH B;  3F22 A;  5M5W J;  2B9S A;  4HYE A;  4B4C A;  1HW1 A;  3ZQC A;  1MJ9 A;  1S3J A;  1Y8Q B;  4BU2 A;  4HST A;  4EAT A;  1BL0 A;  2HPI A;  2VT3 A;  3KEO A;  1J2X A;  1JE8 A;  4A3M J;  2NS8 A;  4KIC A;  5HNF A;  3SFZ A;  2VC1 A;  3OS1 A;  4FCY A;  2ZB9 A;  1K4T A;  1P4A A;  3CJQ B;  5E1Z B;  1BW6 A;  4PDK A;  1IRF A;  1B59 A;  4BBS J;  5KCM A;  4UVA A;  1VQ7 I;  3AG3 H;  1B72 B;  4BEH A;  4QWQ A;  4PCQ A;  1WJB A;  4HSR A;  5BPD A;  4PSW A;  2ZJQ F;  2PN6 A;  1JUS A;  2XIG A;  3QAH A;  4AYB N;  2LY9 A;  4ESB A;  2DMQ A;  2DT7 B;  1TNS A;  3HL2 A;  1WI3 A;  2NRA C;  4HDV A;  1FOK A;  1JTY A;  3FBI B;  3P9I A;  2OV7 A;  1ETV A;  3BG9 A;  1MW7 A;  3HRT A;  1LJ9 A;  4OMY A;  2ELJ A;  4NC6 A;  1R5G A;  3W6J B;  5J6X A;  1YTY A;  2Z9O A;  5HDK A;  1H89 C;  3ECH A;  2QZ8 A;  2IGK A;  5ICG A;  3JSP A;  2QKM B;  5ICC A;  3M1C A;  1ETY A;  4L9J A;  4YIR X;  2XRL A;  3K2A A;  1E3P A;  2O3F A;  4UUS B;  1I1S A;  4CCN A;  3A1Y A;  4GCV A;  4M3F A;  2VBW A;  3E6M A;  5E8G A;  3RZD J;  3G1M A;  4A3L J;  4ENM A;  4XOT A;  4X0G A;  3WHB A;  2KFD A;  2RQQ A;  3D5R C;  1MSF C;  2HKX A;  3QOP A;  3H35 A;  4XRS G;  5EEA A;  3DPT A;  3HDD A;  2M8E A;  2RC4 A;  3EYY A;  1YOV B;  4MEY F;  3TO7 A;  1LB2 A;  2R92 J;  4QTR A;  3EUA A;  4UUS A;  1XB4 A;  4UB6 C;  1V5F A;  5BPI A;  3VFZ A;  3DU6 A;  2OCE A;  4HQE A;  3OYM A;  1TWG J;  3VYT B;  2XF5 A;  3JCU C;  3KP3 A;  2XV4 S;  3IWZ A;  2JMW A;  1T39 A;  3RDI A;  3ZQI A;  4LFU A;  4EV0 A;  1T0F A;  2EJR A;  3AG2 H;  3G3Z A;  3QPH A;  2EV6 A;  3CJR B;  3H5R A;  1X1B A;  4IPA A;  4YRV A;  1BI1 A;  1XC5 A;  3D5S C;  4GO1 A;  1R58 A;  3SDG A;  3OYG A;  3M7G A;  3RKQ A;  3BQZ A;  1QBJ A;  4DZJ A;  4BJ6 C;  1IAW A;  4E7S A;  5L3E A;  3QP5 A;  2BE5 F;  1Z6T A;  4ZDP A;  1R49 A;  1JT0 A;  2XDV A;  1ZRF A;  3ZQL A;  1KU9 A;  2L01 A;  1WPK A;  3DQV C;  1J9I A;  3GTP J;  4W1U A;  1LEB A;  2VIX A;  3GUD A;  4MLO A;  1Z7L A;  3OYB A;  3L2V A;  2A3S A;  3ZQG A;  2F2E A;  2IP2 A;  4OWR B;  4KT6 A;  3U1D A;  2BXZ A;  2PQ8 A;  5FO5 A;  2FNP A;  2GZW A;  5F0F A;  4X6A J;  3E5Q A;  3WTX C;  1ETW A;  1FC3 A;  5ILV A;  3GLL A;  3HKZ A;  1A36 A;  3FHN A;  3V42 A;  3IKV A;  3CP8 A;  4X1E A;  2R7F A;  3OOU A;  3MCZ A;  1SFO J;  3R0J A;  4Y52 J;  2VUM J;  2WA0 A;  2ECC A;  3J81 Z;  1ZHF A;  2EIJ H;  4IRG A;  4ZYG A;  3VSL A;  3QU6 A;  2HTS A;  1LEA A;  1UEL B;  2K40 A;  4ENK A;  5EZG A;  2WAQ A;  2LKX A;  3FXK A;  1SVL A;  3IHU A;  4AIK A;  3V8L A;  3E6B A;  4ON0 A;  1MIJ A;  2DQR A;  3IV5 A;  1U8R A;  1LFB A;  3R0A A;  3E0J B;  1X4P A;  3DLL F;  2DTZ A;  5CVV A;  1UHW A;  4IKF A;  2W48 A;  3CP2 A;  5A2Q Z;  1R4N B;  1IN6 A;  3I4P A;  2LKS A;  1O57 A;  3MKY B;  4HW0 A;  1VQO I;  4EJT A;  1D5V A;  3QPL A;  1UJ8 A;  3CZ6 A;  2DI3 A;  2HKO A;  3QYB A;  1TWF J;  1ZK8 A;  2FOK A;  4U0V A;  4B8X A;  1SFE A;  2YSR A;  3CC2 I;  2K02 A;  4HOB A;  4PJL A;  2YS9 A;  5CLS A;  2R5Y A;  2L7M P;  1X58 A;  4A12 A;  1K6O A;  2VI6 A;  3F6O A;  1QPI A;  4CXF A;  4N9H A;  1WWX A;  1O4X A;  1U9O A;  1MKM A;  3M8E A;  4AUX A;  1IC8 A;  1F4K A;  3NWT A;  3COA C;  4A3D J;  2FQ4 A;  2F4O B;  1ZG1 A;  1RES A;  3LSI A;  1YS6 A;  2E2J J;  1F36 A;  1ZEL A;  3I53 A;  3X2Q H;  1GUU A;  1UG0 A;  4JOM A;  2E36 A;  2K3P A;  3KET A;  2D5V A;  2XSD C;  5ICF A;  1VQ9 I;  2GIZ A;  2Y0M A;  1AOY A;  2XAF A;  2XAQ A;  3ABU A;  4U88 A;  3FM3 A;  3I58 A;  3K6G A;  3OIQ A;  3DFG A;  1ACI A;  1BN5 A;  1PJR A;  3KP5 A;  1VQ5 I;  3RYR A;  2OTJ I;  5DCM A;  3AFH A;  1S7O A;  1S7A A;  1VQ8 I;  1Z05 A;  1GHC A;  4XLF A;  2MD5 A;  2IA0 A;  2MC3 A;  2JA5 J;  2OJE D;  1TT5 B;  3E5X A;  2V6E A;  2KZG A;  1SVM A;  1W36 D;  5F04 A;  3KEQ A;  5FKN A;  2G7H A;  2KKO A;  3GZN B;  3SZG A;  5LGT A;  3F21 A;  2ELH A;  1ZAR A;  3ESW B;  3K2Z A;  2B0L A;  2K85 A;  1AKH A;  1I6X A;  1G3W A;  1XN7 A;  1VQP I;  2QQA A;  2VPR A;  2EV5 A;  1MBF A;  1FLI A;  3NQO A;  4EMS A;  2CRG A;  3N05 A;  4M74 A;  4A0Z A;  2FF4 A;  4FT8 A;  1FTT A;  2Y2Z A;  2BBY A;  3TBI A;  4BS9 A;  4DW6 A;  3FKI J;  2DLL A;  1MSE C;  2Q2E B;  5F64 A;  1U6G A;  4C30 A;  4A6E A;  3QP6 A;  4DYC A;  2LD5 A;  1R5H A;  3FXQ A;  3PUB A;  4CIC A;  4IHW A;  2Z5U A;  3BTC A;  1K83 J;  1GXQ A;  1MBH A;  2D1V A;  1QA6 A;  2LRE A;  3ZRG A;  4GXO A;  3DEE A;  4HAM A;  1M1E B;  1T38 A;  3TED A;  4N9I A;  3GX4 X;  4EM2 A;  2HZT A;  1DP3 A;  4AID A;  2L4A A;  4ZZL A;  5LD2 C;  2EQR A;  1E3H A;  1VTN C;  2IS4 A;  2PMZ A;  3J81 K;  2ICW G;  4K2E A;  3R6S A;  4YIF A;  3JSO A;  1YRN A;  4DNC A;  4YII A;  2JA6 J;  1RI7 A;  2Q2E A;  3ZN1 A;  2O8K A;  4AD9 A;  3JRB A;  4A3K J;  2KMU A;  2E71 A;  3ZQH A;  2JRT A;  4KIT B;  2NOJ B;  1GT0 C;  3AL0 C;  3K4J A;  3FXJ A;  3H9J A;  4U7D A;  2X6W A;  1ERD A;  2QCO A;  4G6D A;  2JA8 J;  3SJM A;  2QLZ A;  2QQ8 A;  4NUB A;  3TOA A;  4A5N A;  5GAH J;  2K9L A;  1OPC A;  5JI6 A;  2GM4 A;  2ZXI A;  5A2Q K;  1KQ8 A;  2I8D A;  5IY5 H;  2W4S A;  4B09 A;  1RKW A;  3BP8 A;  3DV8 A;  4A3B J;  3J7Z I;  1JJ8 C;  1TWH J;  2MBF A;  3QOD A;  3TKY A;  3BCA A;  5HLI A;  4I6Z A;  1XGS A;  2P81 A;  1QZE A;  2L4M A;  2CFX A;  2PG4 A;  4PJ0 C;  1BA5 A;  3S1M J;  3BQY A;  4AVP A;  2EZI A;  4IRH A;  5BQT A;  3CDL A;  1RET A;  3V7C A;  1LUJ B;  4EGY A;  2FBH A;  3ERE D;  3HSE A;  2K9Q A;  4A0X A;  3J7A Y;  4M3E A;  2Z99 A;  4XKV A;  1FYK A;  2VBZ A;  4LLL A;  2VQL A;  1ZQ3 P;  3KPH A;  1Y1V J;  3ZOB A;  3OS0 A;  1Y0N A;  1FNN A;  3PQJ A;  4G7H F;  2O8X A;  3SEQ A;  2LDU A;  2MLK A;  2KQR A;  3ZMS A;  2DO7 A;  2STW A;  2OC6 A;  1FIA A;  4Y4R A;  2HU9 A;  1B4A A;  1FBS A;  2ME6 A;  1CF7 B;  1TC3 C;  3S32 A;  1RUO A;  1Z3X A;  4FE7 A;  1V54 H;  3GFJ A;  4WXH A;  1ETQ A;  4XLE A;  1Y39 A;  3BG6 A;  4Y33 A;  5IP6 A;  2AS5 F;  2L9V A;  4OAY A;  3KEY A;  1XGM A;  3SQN A;  4Z6Y A;  2BEO A;  2HPM A;  3A03 A;  5E3L A;  3E1S A;  2F5E A;  3UNG C;  4BH9 A;  4DIQ A;  1ZLK A;  3KZY A;  3GTK J;  4BHB A;  2NVY J;  4ITV A;  3MQ0 A;  1ZGA A;  2QEN A;  4KN7 X;  2B7E A;  3H3Z A;  4D9J A;  5J8F A;  4LK1 F;  3MWM A;  2E5N A;  3CCJ I;  2FBK A;  1XX5 A;  1CF7 A;  3A01 B;  3FDY A;  3GXO A;  4BHC A;  3T8T A;  4IRI A;  1I3Q J;  3P9K A;  4RA2 A;  4CZZ A;  4DBR A;  4FAS D;  3A0H C;  4AIH A;  3K4B A;  3RKW A;  4XLC A;  4HX7 A;  2VOD A;  2EK5 A;  2MFZ A;  1TWA J;  2CW0 F;  2CO5 A;  3ASO H;  2A5Y B;  2NS0 A;  4JP0 A;  3RQ4 A;  2CW8 A;  4H0E A;  3CC7 I;  3K4K A;  4A3I J;  1W0T A;  3JAM K;  2CYY A;  2VT2 A;  2QYO A;  3A01 A;  1WH5 A;  4F52 A;  1X3W B;  4L9V A;  3BTI A;  3GFL A;  3G2B A;  2UXN A;  3EQL F;  2E1M B;  1U5T B;  5DUK A;  2HOT A;  1UST A;  3SZT A;  5LHH A;  2VLA A;  1W1W E;  4XRF A;  5C4X J;  4L18 B;  1DQU A;  2P7V B;  2E35 A;  2DQL A;  2JUC A;  1ZLJ A;  1SAU A;  1G3Y A;  2XAH A;  4XNF A;  3K4C A;  1UHS A;  5JHU A;  1GV5 A;  3G1O A;  3CMA I;  4IQ4 A;  3OOP A;  1XS9 A;  1ORK A;  4C3H J;  2COM A;  3FBN B;  5D6F A;  3EYI A;  5FKO A;  5M5Y J;  1TQM A;  4IOA F;  2A5W A;  1OR7 A;  1U5T A;  4RM3 A;  3V7R A;  2DA2 A;  3HC7 A;  1MMD A;  4IHY A;  2H1L A;  2H27 A;  4BXF A;  5ILU A;  4ZDO A;  4P9F A;  1T2K A;  3HG9 A;  4JQF A;  1MND A;  1MZB A;  1X3Z B;  3IC7 A;  2OTL I;  1JHH A;  1ONV A;  3TW6 A;  3MMY B;  1KU7 A;  3T5X A;  2M2E A;  2MAB A;  5HS9 A;  2MD0 A;  1MJA A;  4S0H B;  3BR0 A;  4AU7 A;  4CO8 A;  5K5R A;  1GLN A;  1J0R A;  2O7O A;  1OR7 C;  2RNJ A;  4D7M A;  5F0H A;  4HRI A;  3HBL A;  1XGN A;  4ABZ A;  5IYD J;  1ZN2 A;  5F27 A;  5L3F A;  4I2O A;  4M9X A;  3D1N I;  2ZXW H;  4FQG A;  1YW8 A;  1JJ6 C;  3CCU I;  2E7X A;  2OCC H;  4HPQ A;  4NQW B;  2NVX J;  1K61 A;  3WGI A;  3WHC A;  5TRD A;  1P7J A;  3BLY A;  4F92 B;  1P4X A;  1MMS A;  3IL2 A;  2ZSH B;  1TZL A;  5GPC A;  3PFI A;  3R60 A;  3H9G A;  1ETX A;  2CGP A;  4PGG A;  1ON1 A;  2J5O A;  1B6A A;  1OCT C;  2M8G X;  4DOZ A;  1JTX A;  5C4J J;  3FHZ A;  5J4V A;  4XSX F;  2HR3 A;  3C2B A;  3OR1 C;  4PSX A;  1CGP A;  1OCR H;  4NQW A;  1S7E A;  1X4O A;  3TW7 A;  1K4S A;  4I76 A;  2R7Z J;  1BJZ A;  3NRV A;  4QIW N;  3FZV A;  4XLH A;  4HLY A;  3S1Q J;  2Y31 A;  1XCV A;  1RR8 C;  2JPB A;  5CYV A;  3CUQ B;  4LG0 B;  2KIF A;  5GAD J;  4XON A;  1HQC A;  2QVO A;  2BY2 A;  1TL8 A;  3K10 A;  1D3Y A;  3CDI A;  2QBY B;  2DYR H;  1WKM A;  1N78 A;  1MNM C;  2R7Q A;  4KIS A;  4IHX A;  2WV0 A;  4BQN A;  1J09 A;  4M73 A;  2LG4 A;  3I9V 2;  3CO7 C;  2A07 F;  4FE4 A;  3BR1 A;  4M3D A;  2WB1 A;  3HOU J;  2E1N A;  2ZFU A;  3U21 A;  3OYJ A;  1LDK B;  1FYL A;  3BJ6 A;  4CSW A;  5FRM A;  3K70 D;  4BKX A;  2IGN A;  1F9N A;  3ZN0 A;  1GVJ A;  4L5J A;  4FTH A;  3F6V A;  3RZO J;  2Z16 A;  4KMU X;  2EH3 A;  2JVH A;  4DZP A;  4OU0 A;  3JRE A;  2CV1 A;  4D1Q A;  2VJJ A;  1HDP A;  4P55 A;  4CCO A;  1DDN A;  3PUF A;  4HZF A;  5E20 A;  2ISZ A;  1PVE A;  3I4M J;  2CJJ A;  1FOW A;  1R4M B;  2VXD A;  4BDY A;  1VND A;  5ILS A;  3OWT A;  1Z3Y A;  3K7A J;  3L1P A;  2OF7 A;  1V5E A;  5L3G A;  1QU3 A;  1FMW A;  3FM5 A;  4I0B A;  3EDP A;  1YFH A;  3CD6 I;  1P7I A;  2XPV A;  1I6H J;  5D5V B;  3HEF A;  2E2I J;  2JQ7 A;  2ZCW A;  2PJR B;  2M0M A;  1H9G A;  4EM0 B;  1F43 A;  2ETH A;  5IP7 J;  3CCL I;  2Z33 A;  1KYZ A;  5F1J A;  3A02 A;  4L5E A;  3I5U A;  3TP0 A;  3GFM A;  3B6C A;  4NNJ A;  2LFB A;  3UR3 C;  2GA2 A;  1FSH A;  3HSR A;  2XRN A;  1QZY A;  3KYL A;  3PNV A;  2QSG X;  3V8J A;  2V9K A;  1YO5 C;  5FJ8 J;  4XLN F;  1WRJ A;  1VQM I;  5M5X J;  1TNT A;  3PQK A;  3ABL H;  3SDB A;  2R3S A;  2V26 A;  2BVM A;  3VYS B;  1ZR4 A;  2PJR A;  4BY7 J;  3C1D A;  3FXO A;  3JRI A;  2XAS A;  4LIT A;  1SAN A;  2EFO A;  2Z2S B;  1FOX A;  4RAY A;  4A3G J;  2ZO4 A;  3OR2 C;  3Q0V A;  1HKT A;  2Z1D A;  4CA0 A;  4JX4 A;  3WTY C;  4I01 A;  3L09 A;  4EJO A;  4AIJ A;  1P6R A;  5EEG A;  2DAO A;  3FIW A;  1H9T A;  1D1A A;  4IX7 A;  2VKD A;  1A04 A;  3LSK A;  3VPR A;  1IO2 A;  3DBH B;  1GDT A;  5JR3 A;  1IN7 A;  2L9R A;  3BCB A;  2DK5 A;  2ADU A;  1SMY F;  2M3A A;  5E3M A;  4CH7 A;  5LEK A;  3DKW A;  4A6D A;  1MBE A;  4MNU A;  5J8C A;  5J1Y A;  1WH7 A;  2H8W A;  4L9T A;  3BZC A;  2AQF A;  2HYG D;  1W36 C;  2X6Y A;  1EKE A;  3F8F A;  3SHF A;  1SD4 A;  1J59 A;  3DLA A;  1T98 A;  3OYI A;  3AG1 H;  1POG A;  4HLX A;  4A3E J;  1HXD A;  4Y17 A;  4JBA A;  4R8H A;  2A6H F;  2HZD A;  4M3B A;  4WF2 A;  2K5C A;  2KPM A;  2KDZ A;  5HS8 A;  2HQN A;  1MH4 A;  2FE3 A;  2O9L A;  1E17 A;  1Y0U A;  2VJI A;  3WG9 A;  3PJR A;  4RGR A;  5EGO B;  2DW4 A;  3BR3 A;  3DKY A;  2W1O A;  3H3V K;  3SFI A;  2IXS A;  4M6Y A;  2HYF A;  1EJ9 A;  2WY8 Q;  1FZP B;  5K5Q A;  1U0J A;  4ZZD A;  3BPV A;  2V6C A;  1RR7 A;  3MN2 A;  5ED4 A;  2OZ6 A;  2Q1Z B;  4PGH A;  1Z0X A;  5DCF A;  5FLM J;  1YIJ I;  1R1T A;  1WJC A;  2OU2 A;  5D5X B;  3Q0U A;  3BZ6 A;  3LMM A;  5EGO A;  3OY9 A;  3K1N A;  1Y1W J;  2YU9 J;  2NVU B;  4AVZ A;  2M30 A;  2M45 A;  3M07 A;  4RAF A;  1G4D A;  4IO9 F;  1A6Q A;  3LAP A;  1MNE A;  1UFM A;  1OCZ H;  1WQ2 A;  5DEQ A;  1QHH D;  1LNW A;  2NAZ A;  2WV1 A;  5IYC J;  4E7K A;  4YFN F;  1IRX A;  4KA4 A;  1D1C A;  3HKZ N;  1J7K A;  3Q9S A;  2PEX A;  3E6D A;  4XRM A;  2W7N A;  1BJA A;  2XSJ C;  1IRZ A;  3PNT A;  4PFP A;  1BR4 A;  2JSP A;  1VQ4 I;  2P5K A;  3MEX A;  3U1K A;  2WWY A;  1LFU P;  1KGS A;  2PX9 A;  1LKX A;  3LSJ A;  2WAQ N;  4HNU A;  2CV0 A;  2JJ7 A;  1SD6 A;  3HM5 A;  2LBF B;  1YI2 I;  1YS7 A;  3DU5 A;  4C9Y A;  3IRQ A;  3SZP A;  1QHG A;  3KP7 A;  3D0S A;  5IPA A;  4CYC B;  1HCR A;  2G9W A;  1WSU A;  2XGC A;  1FP1 D;  1PYV A;  2R5Y B;  4ZYE A;  1HST A;  1RZ4 A;  2Y9Y A;  2H6B A;  2O5R A;  3ZMZ A;  2LP0 A;  4M9Z A;  2E5Z A;  5HDN A;  3IH3 A;  2HQ5 A;  3PFY A;  3S1R J;  2ZKZ A;  2DN0 A;  1WGX A;  1IN8 A;  2RRE A;  1A6I A;  1XSV A;  3GZ5 A;  3F8N A;  1KU3 A;  1ZGJ A;  5B1B H;  5KNL A;  4IXA A;  2ELK A;  2LBF A;  1DU6 A;  4F91 B;  1XMK A;  3W6K B;  2DJN A;  3FMR A;  2ID3 A;  2LLK A;  4L9N A;  1Z77 A;  4CYC A;  4A0Y A;  2X4H A;  1U78 A;  5D8L B;  3Q9V A;  1X2N A;  1ZR2 A;  4FX4 A;  3HPG A;  1AA7 A;  3TL4 X;  3QPT A;  2VQC A;  1Z91 A;  4O5V A;  2HOS A;  1T33 A;  2DFI A;  1BI2 A;  3HOV J;  1R1V A;  3ECO A;  5F6F A;  4D5F A;  2OUM A;  1O7F A;  2ZNZ A;  1B1B A;  3OYN A;  1SFK A;  3D5L A;  3FK7 A;  5DCM B;  4UUV A;  3ZMT A;  2HFH A;  1WJA A;  5HS7 A;  1HKS A;  2X1D A;  2A61 A;  1K78 A;  4S05 A;  1IDY A;  2GA1 A;  1FEX A;  1PP7 U;  3KP2 A;  2V4J C;  5HVQ C;  1KQ0 A;  3CO6 C;  3PL8 A;  3WG7 H;  1N77 A;  1AKH B;  3JRF A;  4B44 A;  1YW9 A;  1EF4 A;  2QWW A;  5L3C A;  2V9V A;  1VQK I;  1UG2 A;  2M4G A;  5HLH A;  2WAE A;  2R7X A;  3VYU B;  4QPO A;  3VOD A;  5GTH C;  4U0Y A;  2VKE A;  2FRH A;  3ZPL A;  4M6V A;  2DBB A;  2EZK A;  3OYA A;  1WJ5 A;  2YX4 A;  1DUX C;  1FTZ A;  2A6E F;  2GXG A;  3IP4 B;  3TOB A;  3FXM A;  2XB0 X;  2K7L A;  4ESF A;  3OS2 A;  1JUP A;  4KFC A;  3U2R A;  3ZQQ A;  1QNT A;  3MKW B;  5GTI C;  1P9Q C;  3AL0 B;  1D8K A;  1Z7U A;  3HZJ A;  4PK4 A;  1FBU A;  3FKJ A;  3G1L A;  1K7A A;  2RQP A;  3S2D J;  2XGE A;  3ZXS A;  2JVG A;  1JGG A;  2BYV E;  2Y9Z A;  1BI0 A;  3JRD A;  3WTZ A;  2BXY A;  1HSJ A;  2I10 A;  4UV8 A;  4XQF A;  4E6K G;  1HBX G;  4OMZ A;  2E60 A;  2MW8 A;  3E5U A;  1BR2 A;  1YRN B;  1Q1H A;  1ZRE A;  3DF8 A;  4H4K C;  3L2Q A;  2LRD A;  3ASN H;  2MC4 A;  3OIP A;  5DD8 A;  1TP4 A;  1V3F A;  3B73 A;  3JAM Z;  1GV2 A;  2JZY A;  1O3T A;  4BY1 J;  3K4N A;  1OKR A;  3O6B B;  2PMZ N;  3OMY A;  2RVC A;  4XOR A;  3GYH X;  1EH7 A;  1QVT A;  4II3 A;  2F6C A;  3ELK A;  5LBQ A;  3S14 J;  3I64 A;  4M72 A;  4D7N A;  1OCC H;  2JUG A;  2H1K A;  3CCS I;  1VFC A;  2PJP A;  1V5G A;  4ZYA A;  2HXO A;  2FD5 A;  2R7R A;  5TIS C;  4FHT A;  3S8P A;  1UHM A;  2X1E A;  3H36 A;  3EPZ A;  2PMH A;  4II2 A;  5CPR B;  5J47 A;  2IA2 A;  3CCE I;  2D45 A;  1ZYR F;  4MEX F;  1SC7 A;  2NXN B;  2KZV A;  5KAI C;  3HYI A;  3LA2 A;  1OLT A;  4XBF A;  1BW5 A;  2QQ9 A;  3M8F A;  3FXR A;  3ZCO A;  3GTL J;  3L7W A;  1ULY A;  2XKO A;  3HOW J;  2P0W A;  4ZTF A;  4AWX B;  1IN5 A;  1HW2 A;  1FPQ A;  4JK1 X;  5H2F C;  2F5D A;  5EDN A;  1FP2 A;  3DTI A;  2MYS A;  4V2G A;  3KX2 A;  3LNQ A;  2XRO A;  4BHP A;  3GTQ J;  1MBJ A;  4J01 A;  2VAS A;  4G7O F;  2M1B A;  4HNV A;  3B6A A;  1RIO H;  1FWZ A;  4Q5S F;  3L2C A;  4V2F A;  1X1D A;  3FXL A;  2XHK A;  5FKM A;  2NVQ J;  5D5W B;  3GTM J;  2V79 A;  4RMN A;  5LRR A;  2PFB A;  1JKP C;  3BG3 A;  3UKG A;  5TGT A;  3JW4 A;  1N75 A;  1T56 A;  2BGC A;  1TBX A;  4LMY A;  4J19 A;  2ECB A;  3JRA A;  3F8M A;  2OBP A;  4UUT A;  5ERI A;  3VDX A;  3IH4 A;  1YJN I;  4KDP A;  2R7U A;  1G59 A;  3GTG J;  4GRI A;  4B43 A;  3G4S I;  4IOC F;  4ESJ A;  1ZTR A;  2PBI A;  4YFK F;  1R5I D;  2EV0 A;  3VOE A;  2OQG A;  1X3U A;  4YFX F;  4HF2 A;  5CKT A;  4C3I J;  3S2H J;  4PUS A;  3PIP F;  4KN4 X;  1AHD P;  4E7Z A;  3OYE A;  1OYY A;  1U9N A;  1Z21 A;  4RB1 A;  4NDL A;  1QGP A;  5JLX A;  4E4H A;  5FRO A;  3CLQ A;  1LE8 A;  3K70 C;  3WE3 A;  3I71 A;  2YUS A;  3NWS A;  3E7L A;  4JX5 A;  3L2R A;  5BOX A;  3WOD F;  1RC9 A;  2M87 A;  2HWV A;  4F55 A;  1MMA A;  2BY0 A;  1XGO A;  3RTR A;  3BTL A;  3CJT B;  3A0B C;  2BHY A;  4IVN A;  2NOG A;  2O6G E;  4A3C J;  3KYC B;  2PLY A;  4NBQ A;  2WBM A;  2GXA A;  2EPF A;  3OSF A;  1W0U A;  2AQE A;  4XMY A;  3KP6 A;  2RAE A;  3FIS A;  2HQR A;  4BDZ A;  2GQQ A;  2E34 A;  5C44 J;  1JXS A;  2EA2 A;  1S6L A;  3WTV C;  4HNT A;  1IG7 A;  2R0Q C;  4UY8 I;  5FKK A;  3TDZ C;  2Q8K A;  3KYD B;  1UB9 A;  1R1U A;  2VKH A;  3K4M A;  5HOO A;  2XAJ A;  2HQA A;  3K0L A;  2CQX A;  3MZ8 A;  2FUG 2;  5IOZ A;  1G6N A;  3RCO A;  4WK8 F;  1FT9 A;  4HDU A;  4LOC A;  1I1G A;  3ABT A;  2XGD A;  1I39 A;  5BS6 A;  1FJL A;  2IT0 A;  4I02 A;  5E79 C;  2W82 A;  2VQH A;  3AKZ A;  1Y56 A;  1WVR A;  2HOE A;  3BWG A;  1OQY A;  3BT9 A;  2DK8 A;  1EH6 A;  1ZKG A;  4YEJ A;  4RLQ A;  4UVC A;  5LEJ A;  5DS9 A;  4M3G A;  5HDG A;  1Q1V A;  1E3O C;  4CCK A;  4LIU A;  1PUF B;  1LFP A;  5K1Y A;  2DDA A;  3TP3 A;  1OMI A;  2DA3 A;  2LKP A;  2PMU A;  2DFH A;  2FML A;  5F08 A;  1SMT A;  4A3J J;  3ZGK A;  2BZT A;  2LTP A;  3ZMD A;  1ZH5 A;  2L7F P;  3F8B A;  3HUG A;  1TWC J;  1BOB A;  2W85 A;  2HS5 A;  2EB7 A;  1GVD A;  3K9T A;  5LFA A;  2PI0 A;  3EUK L;  4JYK A;  3WTW C;  4MGR A;  3CES A;  4N0B A;  3FK6 A;  2K4J A;  3FXU A;  2EIK H;  1PUF A;  2E1O A;  1EV7 A;  3CCY A;  3ISP A;  2UUZ A;  1OJL A;  1IUY A;  2X51 A;  4YG2 F;  2JWT A;  3HIF A;  4GYI A;  2D1H A;  1APL C;  2IGO A;  3H1C A;  3MZY A;  1WI9 A;  3MD2 A;  4HF0 A;  4E70 A;  1DU0 A;  4Q48 A;  5DM6 F;  3N4M A;  4ASN A;  2WTE A;  1YIT I;  3J7Y J;  5JVT A;  4OAZ A;  4G7Z F;  1XDS A;  4LLN A;  4EM1 A;  2Z3Y A;  2RDP A;  2L9N A;  3DPL C;  2NYX A;  5J1U A;  3DXJ F;  2F48 A;  2A68 F;  3TQN A;  5GPA A;  2LC2 A;  3KZI C;  4CCL A;  1BOA A;  3HHH A;  1YJW I;  3G6E I;  1XMX A;  3DTK A;  4E7J A;  1WZ2 A;  2CG4 A;  4R79 A;  5JLW A;  4DYR A;  1A31 A;  1JUM A;  2R5Z B;  4BQQ A;  3DPU A;  2XAG A;  3PNY A;  4G8X A;  3I4N J;  2ZJ2 A;  3LQQ A;  1UCR A;  1OCO H;  2F5C A;  3M9A A;  2I5U A;  2ACJ A;  1IW7 F;  1JKR C;  4ZYD A;  1I50 J;  1LVA A;  1FY7 A;  2COB A;  2JN6 A;  2ZJR F;  1R7J A;  2P6T A;  5AIP A;  2L5Q A;  3AG4 H;  3I55 I;  1ON2 A;  2E1C A;  2ZXJ A;  2ZSI B;  5J1R A;  4R1H A;  2LH9 A;  2TRT A;  3LSG A;  2FA5 A;  3Q5F A;  5B3S H;  4IHT A;  2KIS A;  2X0L A;  3BRO A;  3W3C A;  2WB1 N;  2IRF G;  3S17 J;  3HHG A;  3HOT A;  4U7B A;  3WTS C;  4KJZ A;  3OYK A;  4Q4Z F;  2R5Z A;  3S3O A;  3KZZ A;  2H09 A;  4GFB A;  4XLA A;  1MGT A;  3BZK A;  2JK3 A;  3CMY A;  2MG4 A;  2M7A A;  2VE9 A;  3F72 A;  3LA3 A;  3BJA A;  4BXU A;  1DPU A;  1Y8R B;  2DOE A;  1WFX A;  2CV2 A;  2FOW A;  4LLG F;  2ZFW A;  2EIN H;  5D4S A;  2GXB A;  1QPM A;  2IS6 A;  1ODD A;  2W57 A;  2IA1 A;  1NG7 A;  1YJ9 I;  1G2H A;  4IEJ A;  1X1P A;  3FMQ A;  2ZJP F;  3IKT A;  4HF1 A;  3GME A;  5EG0 B;  2H6C A;  1VF9 A;  3K4L A;  3C18 A;  1I27 A;  4G6Q A;  2EFQ A;  1QZZ A;  3BOQ A;  1N25 A;  5DM7 F;  3T0Y A;  2M34 A;  2DOA A;  1E2X A;  3JRG A;  4UV9 A;  3R4K A;  2LF7 A;  1KQ9 A;  3SXY A;  4BL0 B;  2FEZ A;  1YIO A;  2FXA A;  2KL4 A;  2L7Z A;  4Y13 A;  2FX0 A;  3WTT C;  3WTU C;  3LL7 A;  3OYL A;  4Z2Y A;  2XF7 A;  3CJN A;  3RYP A;  2CS3 A;  1G3S A;  2W25 A;  1Y6I A;  4QPQ A;  3KIO A;  1O3S A;  5EJC A;  4ANJ A;  4F3Q A;  1X1C A;  4C2T A;  3CQZ J;  2VJ4 A;  4KUM A;  3M1E A;  3RKY A;  5EG0 A;  2Y0S A;  4XL9 A;  2HXI A;  3JTH A;  2GWR A;  1W7P D;  2YX7 A;  2HDD A;  2K4B A;  3WGH A;  5DYM A;  4PJJ A;  3W6V A;  2BHZ A;  3L2U A;  4FX0 A;  2VBY A;  3CCR I;  2L02 A;  3HB9 A;  3L2W A;  5LHG A;  1WCM J;  2HDW A;  1XD7 A;  2VBX A;  1X19 A;  2VOP A;  2LF8 A;  3S1N J;  1OYI A;  1B9M A;  5LGU A;  4MQ9 F;  4EJV A;  1TT0 A;  1BR1 A;  1FBQ A;  2ZC2 A;  2ZME B;  5FKL A;  3RSN A;  5ICE A;  2R7D A;  5D6E A;  1NK2 P;  2KLO A;  3PIO F;  3HRS A;  3RPU D;  2IS1 A;  2BW3 B;  3JR9 A;  5LGN A;  2HVR A;  4HBL A;  3H92 A;  2D2W A;  2QA4 I;  4RB2 C;  4BQA A;  2JTV A;  4BBR J;  2CMP A;  4EEF G;  3VB2 A;  5LLQ A;  2C6Y A;  4MTE A;  4XN0 A;  4KYW A;  5FD6 A;  4LGW A;  4L5I A;  5EF6 A;  4QSH A;  2R7S A;  4KIG A;  1FMV A;  3MAJ A;  1R22 A;  3OYD A;  2ZME A;  1KYW A;  4W97 A;  4XIC A;  3O8H A;  3EUH A;  5GAG J;  3CCM I;  2VON A;  3M3Y J;  2QUF A;  1D1B A;  1U3E M;  3TO6 A;  1MD0 A;  2VKV A;  2KT0 A;  2UZK A;  2EIM H;  2BW3 A;  4MQV A;  3VEP A;  1SD7 A;  1R6R A;  5CVI A;  4V19 K;  3CTA A;  1QQI A;  2LK2 A;  4N4O B;  4I99 C;  4CCM A;  2L3D A;  4G94 A;  1K6Y A;  4UVB A;  4A69 C;  5E18 F;  3MKZ A;  2R7W A;  4EGZ A;  1IXR C;  2FJ1 A;  4BUP A;  4D5C A;  4CCJ A;  2W00 A;  2ZME C;  4KNY A;  2FNA A;  3EUH C;  3SYT A;  1IN4 A;  2JRM A;  3KCC A;  5KK1 A;  1UMQ A;  3GF2 A;  5J4Y A;  4UHT A;  3FMS A;  2K3F A;  1ZRC A;  2ZBK A;  4NC8 A;  3MZH A;  3GTO J;  4E7H A;  3S3N A;  2DA5 A;  2P8T A;  3BPX A;  3K1P A;  4EJW A;  4RDU A;  4BE2 A;  2R7V A;  4DBQ A;  5FLV A;  1UZC A;  4DGW B;  1P2F A;  4P9U A;  3LOC A;  4AYB A;  2A69 F;  2VL8 A;  3IAS 2;  5IP9 J;  1B72 A;  2QF7 A;  4MFE A;  1HKQ A;  2DA7 A;  2YR2 A;  3LAJ A;  3M8J A;  3J80 Z;  2YPR A;  2G0E A;  3LSM A;  4MHG A;  4A5M A;  1LDD A;  4G6T B;  3PO2 J;  3JRH A;  5DV5 A;  2CUF A;  2XF6 A;  1WJE A;  5JVG F;  1NH3 A;  1MMG A;  3BJO A;  4UB8 C;  5HLG A;  3E3V A;  5E1W A;  2HEO A; 
#chains in the Genus database with same CATH homology
 1JUP A;  1ETO A;  1HOM A;  3G1L A;  3S2D J;  2X9D A;  2XB5 A;  2XGE A;  1TWA J;  1JGG A;  3H0G J;  1QRY A;  2Y0S N;  4JP0 A;  3JRD A;  2Y9Z A;  4A3I J;  2I10 A;  1W0T A;  2CQQ A;  2MW8 A;  1YRN B;  4C2M J;  3A01 A;  1WH5 A;  2DA4 A;  2HYJ A;  3BTI A;  4XK4 A;  1GV2 A;  5M3F J;  4BY1 J;  4B3A A;  2PMZ N;  2HOT A;  3OSG A;  4MO7 A;  1QVT A;  5IOY A;  1JKO C;  3S14 J;  4D7N A;  1OFC X;  2H1K A;  1VFC A;  3ZQF A;  2HXO A;  2FD5 A;  3S15 J;  5C4X J;  2K9N A;  3F0C A;  2E2H J;  3QQA A;  1CQT A;  1UHS A;  3IH2 A;  5GP9 A;  1GV5 A;  1NTC A;  3G1O A;  1BW5 A;  1XS9 A;  3HGG A;  1ORK A;  4C3H J;  2TCT A;  5FKO A;  5M5Y J;  3GTL J;  2DA2 A;  3HOW J;  4MIM A;  4IHY A;  4FIS A;  4JX6 A;  3NAR A;  1R9T J;  5EDN A;  5EYR A;  4V2G A;  1RKT A;  2DMT A;  3TW6 A;  3LNQ A;  2M2E A;  2NS7 A;  5M5W J;  4B4C A;  1NK3 P;  3ZQC A;  4S0H B;  3BR0 A;  3GTQ J;  1MBJ A;  4HNV A;  3B6A A;  1BL0 A;  4V2F A;  2O7O A;  2CU7 A;  2NVQ J;  5FKM A;  4D7M A;  4A3M J;  2NS8 A;  5F0H A;  3GTM J;  1JKP C;  3BG3 A;  1RPW A;  3HBL A;  4ABZ A;  4FCY A;  3UKG A;  2ZB9 A;  5IYD J;  1IDZ A;  5F27 A;  1T56 A;  3D1N I;  4J19 A;  2ECB A;  3JRA A;  1BW6 A;  1JJ6 C;  4BBS J;  4UUT A;  5F0C A;  2NVX J;  3IH4 A;  1K61 A;  1H88 C;  3WHC A;  1B72 B;  3GTG J;  1P7J A;  1ZTR A;  1IGN A;  5GPC A;  4A3F J;  4C3I J;  3S2H J;  1JUS A;  1ETX A;  1AHD P;  4AYB N;  2E19 A;  2DMN A;  2LY9 A;  2DMQ A;  1U9N A;  1OCT C;  4NDL A;  1WI3 A;  2M8G X;  5JLX A;  1JTY A;  1JTX A;  5C4J J;  1LE8 A;  1ETV A;  3BG9 A;  2YUS A;  3C2B A;  2OPT A;  1IJW C;  1S7E A;  3E7L A;  4JX5 A;  3TW7 A;  4I76 A;  2R7Z J;  1H89 C;  3BTL A;  1BJZ A;  4QIW N;  2NOG A;  3S1Q J;  2Y31 A;  4A3C J;  2GBY A;  3RQI A;  1JKQ C;  1ETY A;  3OSF A;  2XRL A;  3K2A A;  4UUS B;  1W0U A;  3DCF A;  2DMP A;  2RAE A;  3FIS A;  4M3F A;  3GTJ J;  1MNM C;  3RZD J;  3G1M A;  4A3L J;  4IHX A;  5HOD A;  5C44 J;  3HOZ J;  4FE4 A;  3BR1 A;  2XPU A;  4M3D A;  3WHB A;  1IG7 A;  2R0Q C;  5FKK A;  3HOU J;  1B8I B;  1MSF C;  5EEA A;  4XRS G;  3HDD A;  5IOZ A;  2CQX A;  4LOC A;  4BKX A;  2XGD A;  2R92 J;  4QTR A;  4UUS A;  4FTH A;  3RZO J;  2EH3 A;  4DZP A;  3JRE A;  1FJL A;  1HDP A;  2DA1 A;  1TWG J;  2LR8 A;  3I4M J;  2JMW A;  2CJJ A;  3BT9 A;  3ZQI A;  1ZKG A;  5DS9 A;  1HDD C;  4M3G A;  1Q1V A;  1E3O C;  4XID A;  1VND A;  2IBD A;  1PUF B;  3TP3 A;  1B8I A;  2DA3 A;  1XC5 A;  3SDG A;  3K7A J;  3L1P A;  2OF7 A;  4XRS A;  3RKQ A;  3BQZ A;  5F08 A;  4DZJ A;  2IAI A;  4A3J J;  3Q0W A;  1JT0 A;  3ZQL A;  1WPK A;  2LTP A;  3GTP J;  1P7I A;  1MBG A;  2L7F P;  2XPV A;  4W1U A;  5EZH A;  1I6H J;  3BR2 A;  4MLO A;  3HEF A;  1TWC J;  2E2I J;  3ZQG A;  3BR6 A;  1GVD A;  4JYK A;  1F43 A;  5IP7 J;  5F0F A;  4X6A J;  3FK6 A;  1ETW A;  5F1J A;  3OIO A;  3A02 A;  4L5E A;  1PUF A;  2E1O A;  3TP0 A;  3B6C A;  2LFB A;  3CCY A;  2MGQ A;  4X1E A;  3OOU A;  1OJL A;  1SFO J;  4Y52 J;  2VUM J;  2JWT A;  2ECC A;  5FJ8 J;  1APL C;  3BG5 A;  5M5X J;  3S16 J;  2K40 A;  5EZG A;  1ZR4 A;  2LKX A;  4BY7 J;  3JRI A;  1DU0 A;  1D5Y A;  1SAN A;  2LVS A;  2AHQ A;  5K7Z A;  3IV5 A;  1LE8 B;  4A3G J;  1LFB A;  3Q0V A;  4JX4 A;  1FIP A;  2X6O A;  1ZGW A;  1OCP A;  2DTZ A;  5J1U A;  3FIW A;  5DTD A;  2W48 A;  2AO9 A;  5GPA A;  4IHV A;  3VPR A;  3QPL A;  1GDT A;  2L9R A;  2M0C A;  1TWF J;  5E3M A;  1ZK8 A;  5JLW A;  3LSP A;  4DYR A;  2NVT J;  1MBE A;  1JUM A;  2R5Z B;  2R5Y A;  2YS9 A;  5J1Y A;  2L7M P;  1WH7 A;  1X58 A;  3I4N J;  1JKR C;  1I50 J;  2VI6 A;  3LSR A;  1QPI A;  2EZH A;  2COB A;  2JN6 A;  1U9O A;  1O4X A;  4AUX A;  1IC8 A;  1IUF A;  4DYQ A;  4A3D J;  2XPW A;  5J1R A;  2FQ4 A;  1POG A;  1RES A;  2TRT A;  1ETK A;  3LSG A;  4A3E J;  2E2J J;  1F36 A;  2K9S A;  1GUU A;  2D5V A;  3QPS A;  2WB1 N;  2XSD C;  3S17 J;  1MBK A;  9ANT A;  4M3B A;  2R5Z A;  2KDZ A;  4GFB A;  1MH4 A;  2O9L A;  2JK3 A;  3CMY A;  2MG4 A;  5EGO B;  3PM1 A;  3BR3 A;  2DMU A;  1IV6 A;  4A93 J;  3H3V K;  3SFI A;  1G2H A;  2JA5 J;  4RBO A;  4IEJ A;  1RR7 A;  1ITY A;  3MN2 A;  2MSY A;  1AU7 A;  5EG0 B;  5F04 A;  1VF9 A;  5FKN A;  1Z0X A;  5FLM J;  1AKH A;  2M34 A;  3Q0U A;  2VPR A;  5EGO A;  3JRG A;  1MBF A;  1Y1W J;  2YU9 J;  1QVU A;  3GBG A;  2CRG A;  2L7Z A;  2FX0 A;  3HOX J;  2JA7 J;  1FTT A;  2Y2Z A;  4B1R A;  1X2M A;  4DW6 A;  3FKI J;  1MSE C;  4DYC A;  2X48 A;  2GLO A;  4BXX J;  2LD5 A;  1ENH A;  3CQZ J;  2WV1 A;  3BR5 A;  5EG0 A;  3BTC A;  1K83 J;  5IYC J;  1HLV A;  4IHW A;  1MBH A;  3HKZ N;  2HXI A;  2B63 J;  4XRM A;  2HDD A;  3TED A;  2CUE A;  2R93 J;  3BTJ A;  3W6V A;  3M4O J;  1IRZ A;  3HB9 A;  2EQR A;  1WCM J;  2Y30 A;  1LFU P;  4Y7N J;  5BNG A;  1U8B A;  3LSJ A;  3S1N J;  2WAQ N;  2JJ7 A;  1YRN A;  2JA6 J;  1H8A C;  3HM5 A;  2O8K A;  5FKL A;  4G12 A;  3JRB A;  4A3K J;  1NK2 P;  3ZQH A;  3HGY A;  1GT0 C;  5IPA A;  4CYC B;  1HCR A;  3MKL A;  2QCO A;  2JA8 J;  3JR9 A;  2N8G A;  3SJM A;  2XGC A;  2R5Y B;  5J3L A;  2Y9Y A;  2GM4 A;  2LP0 A;  4BBR J;  4EEF G;  3JRC A;  1RKW A;  3IH3 A;  2HQ5 A;  1VI0 A;  3S1R J;  4A3B J;  2DA6 A;  2DN0 A;  3PO3 J;  1WGX A;  5EF6 A;  1JJ8 C;  1TWH J;  3NAU A;  4QSH A;  1A6I A;  2ME0 A;  3MVP A;  4I6Z A;  2P81 A;  2ELK A;  1DU6 A;  4W97 A;  4XIC A;  3O8H A;  3M3Y J;  1BA5 A;  3S1M J;  2DJN A;  3BQY A;  2ID3 A;  2LLK A;  2VKV A;  1Z77 A;  4CYC A;  2EZI A;  2KT0 A;  1U78 A;  3CDL A;  1X2N A;  1RET A;  1ZR2 A;  2LK2 A;  2K9Q A;  2HOS A;  1T33 A;  4M3E A;  4MFD A;  3HOV J;  3O8G A;  4A69 C;  3Q3S A;  1ZQ3 P;  4D5F A;  1Y1V J;  3ZOB A;  1HF0 A;  2HI3 A;  3FK7 A;  2FJ1 A;  2L0K A;  4D5C A;  5C3E J;  2EBI A;  2H8R A;  3DEW A;  1FIA A;  1MH3 A;  2ME6 A;  1UMQ A;  1TC3 C;  1A5J A;  4FE7 A;  5K7H A;  2ID6 A;  1IDY A;  1ETQ A;  1FEX A;  3GTO J;  5IP6 A;  2DA5 A;  4RDU A;  2M9H A;  1JT6 A;  1AKH B;  5FLV A;  1XG1 A;  3JRF A;  5M3M J;  3LOC A;  1EF4 A;  3A03 A;  5E3L A;  5IP9 J;  3HOY J;  5K7F A;  5E3N A;  1B72 A;  2QF7 A;  4MFE A;  3GTK J;  1UG2 A;  2NVY J;  2DA7 A;  4C3J J;  2EZL A;  5E3O A;  2VKE A;  2HOA A;  2G0E A;  4M6V A;  3JRH A;  3PO2 J;  2CUF A;  3A01 B;  2EZK A;  4AC0 A;  2IEK A;  1I3Q J;  1FTZ A;  5IYB J;  2XB0 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...