1KU7A

Crystal structure of thermus aquatics rna polymerase sigmaa subunit region 4 bound to-35 element dna
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
73
structure length
73
Chain Sequence
SEELEKALSKLSEREAMVLKMRKGLIDGREHTLEEVGAYFGVTRERIRQIENKALRKLKYHESRTRKLRDFLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords 5'-D(*CP*CP*TP*TP*GP*AP*CP*AP*AP*AP*G)-3'
publication title Structure of the bacterial RNA polymerase promoter specificity sigma subunit.
pubmed doi rcsb
source organism Thermus aquaticus
total genus 28
structure length 73
sequence length 73
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04545 Sigma70_r4 Sigma-70, region 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1ku7A00
1AWCA 4OIQF 4WXHA 3ZP5A 3WTUC 3I54A 5DUKA 2A3SA 1E17A 3WODF 4Q47A 2QLZA 5FGMA 3BPXA 1S8NA 1MJAA 4CYDA 4RB3C 1L3LA 4ENMA 2KJCA 1K6OA 1BBYA 3ML6A 1OR7A 3D5LA 1EH8A 3EQLF 3MCZA 2IRFG 4E70A 1YS6A 1FYKA 1H9TA 3L9FA 4KN7X 3I59B 4S04A 3KP5A 3SQNA 2Z99A 1D3YA 3ERED 1J9IA 1F9NA 5LRRA 1Z1DA 1D5VA 4NB5A 1LNWA 3I53A 2ZBKA 3DF8A 3V7RA 3HUGA 3O2PE 1LQ1A 2W85A 4ZYGA 3NEUA 5LEKA 2L54A 3FWEA 3IRRA 1BI2A 4FHTA 1PUEE 2HTJA 4HBLA 5BPDA 4GGGA 3JAMZ 4KMFA 4R1HA 2CG4A 2O0YA 2HR3A 4PCQA 2QQ9A 2IA0A 4U0VA 2FNPA 1YQAA 5DCMB 3CUQB 1KYZA 3I71A 5L3CA 2CSOA 4BHPA 1TLHB 2ZNYA 5D6EA 4MQ9F 3F23A 1I1GA 3KFWX 3Q9SA 2DK5A 3G73A 1LDKB 2H6BA 3FHZA 3J81Z 3CUQC 4WWCA 2R3SA 1WWXA 3WU0A 3DV8A 4L18B 1WSUA 3P9CA 5CYVA 1O3QA 2FBHA 1DPRA 2Q0OA 1U5TB 1FC3A 2RQPA 4BHBA 2LF8A 1ON2A 4U7DA 2GA2A 2A6HF 3V8KA 3BJAA 1I6XA 2K86A 1FYLA 3EDPA 2M87A 3TO7A 2E7WA 3RTRA 4ENKA 4HDUA 1XMAA 4HX4A 1BIBA 4S05A 4XLPF 4BAYA 1GHCA 4YIFA 4A0ZA 1FT9A 4MGRA 2MD5A 2F5CA 3F21A 3HHGA 3MFKA 4KFCA 2PMHA 5DV5A 3ISPA 3FXRA 1IN7A 2M5WA 2P6SA 1F1ZA 2CYYA 2FMLA 2P5KA 1ON1A 1IN8A 1MJBA 3WG9A 3IL2A 2DAOA 3KP6A 4N0BA 3SFZA 3RPQA 2DFIA 5L3GA 2HYFA 3EYIA 2QWWA 1USSA 2WV0A 3F8MA 2BE5F 2K27A 3RDIA 2P6TA 1QPMA 2JTVA 1SD6A 2EB7A 5H6QA 2DW4A 2WTEA 3JAMK 2M8EA 5ICGA 1RIOH 4IHSA 1VTNC 2OBPA 3N4MA 4LB5A 5CVIA 4XBFA 3HOTA 1E2XA 3VOEA 5D4SA 4L9JA 1FBSA 3K1NA 2EFWA 1IUYA 2JPCA 1SD4A 3SZPA 5D4RA 3HSEA 3GWZA 3MAJA 4OOIA 2FF4A 4UHTA 3WTTC 1EH6A 4IF4A 1T0FA 2BBYA 1CF7A 4UVBA 1IN4A 2PN6A 4EM1A 1LEBA 3J81K 3KZYA 4HYEA 4MEXF 3TOBA 4G7OF 2BEOA 1L0OC 2HZTA 4U88A 2KRFA 3M8EA 4M9SA 3WGGA 1KQ8A 3ZMTA 1R00A 4ZYDA 5BS6A 3HSRA 3RKWA 1REPC 2O8XA 3OV8A 4HLXA 2IA1A 2V79A 4O5VA 3L7WA 1Y0UA 2MBFA 3F8NA 1IN6A 1F4KA 1D8KA 2XROA 4UV8A 3TO9A 1O7FA 3K1MA 3E5UA 2V9VA 5E1ZB 3HTSB 1JXSA 2ZMEB 4MNUA 1XCVA 1SFEA 5HVQC 1FNNA 5J8CA 4EV0A 4ON0A 3F8FA 4IPAA 4RGSA 1USTA 2RDPA 5CVUA 4EJTA 3HRTA 4MQVA 5E17F 1W7PA 3GFJA 4BXUA 5LGUA 1HKQA 2W57A 1HBXG 4RAYA 5TJJA 2CGPA 5ERIA 3HTUA 1KQ0A 3V8LA 4HQEA 3GFLA 1UHWA 1G3TA 5JR3A 1O3TA 2VBXA 2A5YB 3DPTA 4ENJA 2GIVA 4BYYA 3QU3A 4HF1A 2ACJA 3K0LA 2HQRA 3P7NA 5EEHA 3GF2A 3H3ZA 2STTA 1BC8C 4LG0B 4QWQA 1KQ9A 1RUNA 4A5NA 2XIGA 4NQWA 5FB2A 3B73A 3WGHA 1ZRDA 1MDMB 3R60A 4HAMA 2FRHA 2QYOA 1QZYA 1G6NA 1ZG5A 1K78A 2CO5A 4BH9A 1T98A 1KU9A 4WXCA 3KP7A 3HOSA 4UVAA 2E1CA 1DP7P 2RC4A 1PP7U 3O3KA 3DKWA 2PJPA 2BV6A 1RZ4A 1MD0A 2GWRA 1BN5A 1V4RA 2VOPA 4M9ZA 4LLGF 4WCGA 3IRQA 3V7CA 2OQGA 2HDCA 1F5TA 5FD6A 1Z6TA 1R1TA 3F72A 3U1DA 2FU4A 3EETA 2EFQA 3L2CA 5A2QZ 4K2EA 1JE8A 2B0LA 5TRDA 4RS8A 5ICFA 1OYWA 4N9HA 1R7JA 2D1HA 1T2KA 4XLNF 4P55A 4HX8A 2HYGD 3FXUA 3GXOA 3I0TA 5DCFA 2QBYB 1SMYF 1FY7A 1C0WA 5IT9Z 5CLSA 3WE3A 3IKVA 3E3VA 3MZYA 1Z6RA 3GUDA 4Y13A 2L4MA 5KK1A 4M9XA 4IRHA 1KU2A 5DD4A 3F3XA 4I01A 3DQVC 4EM0B 1WRJA 4R79A 1MGTA 5F64A 3R61A 2Z9OA 2D1VA 2J5PA 4Q4ZF 1FP1D 1JGSA 4F7ZA 3E5XA 3C1DA 3K2ZA 3M7GA 4G6QA 4U0WA 3L09A 2JT1A 3ZMVA 2BGCA 2MH2A 1LJ9A 4EJWA 2VN2A 4AIKA 1XSVA 5DDGA 3KE2A 3KCCA 2HOEA 3W6KB 5HDGA 5EEGA 1B6AA 1I1SA 3V7SA 5HS8A 2NYXA 4LLLA 2YU3A 4PZJA 1Z7UA 5ICEA 2Y75A 1HW1A 2GA1A 1XSDA 3J80Z 1CGPA 1SAXA 2HS5A 4HV6A 4EVIA 2ZXJA 1FSHA 3WTSC 2K7LA 3TDUC 4GO1A 5A2QK 3ZMUA 3BY6A 2KJBA 4LK1F 1X3UA 3GFMA 1FSEA 3LA2A 2PMUA 4M72A 4ZYHA 4A2UA 5HOOA 4BNCA 2FBIA 3IWFA 5K5QA 1P92A 4DQ2A 4HW0A 3CDHA 5HS9A 1ZGAA 4YFKF 4NHJA 2Z3YA 1P4AA 2IA2A 5LRSA 4RB0A 1FX7A 2COMA 4EJVA 1K7AA 5IT9K 3OOPA 3CJNA 1PDNC 5IT3A 1I5ZA 2NNYA 2GXGA 5HS7A 2VT3A 1XGNA 3MZHA 1J2XA 3RKYA 2V1XA 1S7OA 3E6CC 1YLFA 4EM2A 2IJLA 5BOXA 1ZG1A 2G7UA 5E18F 4M6XA 4KMUX 1V3FA 1R58A 1YO5C 2CW0F 4HZFA 3HHHA 1T6SA 2J5OA 2QENA 2FSWA 2W25A 3SHFA 1DPUA 3CUOA 1SD7A 4LGWA 5J8FA 2K02A 4ENNA 1D8JA 2EFPA 2DK8A 1J5YA 3QOPA 3I58A 4YFXF 3M8FA 5AIQA 1H9GA 2JPBA 2OAZA 2OZUA 4KYWA 1YIOA 1MZBA 4PGHA 1GXQA 2IT0A 2PLYA 3ZMDA 3GO5A 3ULQB 1JHFA 3J80K 1FZPB 3FMSA 2F5FA 5AIPA 2NAZA 4HOBA 5ILVA 2HTSA 1R1VA 2VBYA 5K5RA 4ASNA 1U3EM 3HIFA 1ULYA 3D0SA 2ISYA 4OIOF 2XASA 3Q9VA 4AIJA 1LDJA 2EV0A 2VODA 4B8XA 1FLIA 1AOYA 1FP2A 1H0MA 4N9IA 2KIMA 1TQIA 1TQMA 5LEJA 5DUIA 2HFHA 1HW5A 1J0RA 5E1XA 3L00A 2D45A 5ILUA 4I09A 1XGMA 2XUBA 4AIHA 1XB4A 2LDUA 4A12A 1U6GA 2CQKA 1ZRCA 2HEOA 2GQQA 4A6DA 2DQRA 4YIIA 2XRNA 4RAZA 1YTYA 4KIBA 2YX4A 2DU9A 1Z91A 1BJAA 1TQPA 3QAHA 1BI0A 2Y48A 2KKOA 3JTHA 3JSOA 5JHUA 2EA4A 2QQAA 4HDVA 4CGZA 4O6JA 1DDNA 5F1RA 2EWNA 4ESBA 2M45A 1YW7A 3F8BA 4BHCA 1R36A 4IJAA 1ONVA 3C18A 1DUXC 4GYGA 2UXXA 4KIFA 2A07F 3N97A 3E6MA 1TNSA 2O03A 5LBQA 1YW9A 1SMTA 4JBAA 2GXBA 2ZO4A 3M1EA 2XV4S 5ED4A 2A61A 2LNBA 4LLNA 2R7FA 1W5SA 5JVTA 1O3RA 2ISZA 5DYMA 3AAFA 1WQ2A 2Q2EA 5ILSA 4BQAA 2JSCA 4I02A 4LMYA 5HLGA 1TNTA 1G3WA 1ZHFA 1OYYA 1UHMA 4L5JA 4WX9A 2PBIA 3TDZC 3R0JA 3HSFA 3ZMSA 1WI9A 2DI3A 2DTRA 2V1UA 2FNAA 1ZGJA 2YR2A 1YS7A 1I27A 3DFGA 1P2FA 2X0LA 3IHUA 4L9NA 4KDPA 4KT5C 4UNOA 4JQFA 3RPUA 2A69F 3KZZA 5D8LB 2X4HA 4KA4A 1LEAA 2P8TA 3VB2A 2FEZA 5ICCA 5DEQA 4EMSA 1R5GA 3HYIA 1RNLA 3VFZA 3C3WA 3U2RA 2O6GE 1FWZA 1LDDA 4UUVA 2K4BA 2PFBA 2GAUA 3VEPA 1R23A 3BROA 1OKRA 1XDSA 4GXOA 2DBBA 3E6DA 4LK0F 1B1BA 2XAHA 4UV9A 1BI3A 2F5DA 4LB6B 4Y15A 2Z5UA 4KN4X 1XCBA 2MH9A 2H09A 1CF7B 3BJOA 4UVCA 4EGZA 3T0YA 1MKMA 2IP2A 3WTWC 1IAWA 2A68F 1O57A 2E1NA 2VE9A 4LD5A 1P6RA 5DD8A 3R4KA 1XGSA 3COAC 3ECHA 4I0AA 5D6FA 3I64A 3E6BA 3R6SA 4L9TA 2HWVA 3KP4A 2W24A 3LAJA 2Q8KA 1MJ9A 2QM3A 2XGXA 1KU7A 5CVJA 2VC1A 2ZFWA 4OIRF 2RKHA 3KEOA 2XAFA 4A5MA 1ZH5A 1ODDA 3BDDA 4MTDA 4HA8A 5FD5A 4WF2A 1KGSA 1BC7C 3ECOA 3T1BA 2EJRA 2JZYA 1G4DA 2IPQX 3G3ZA 1ZRFA 1W7PB 2RVCA 5BMZA 3LQQA 2LF7A 3I59A 1QZZA 2MLKA 5BPIA 2MLGA 3GZ5A 4OMZA 4ZH4F 4WXDA 4M73A 3IWZA 2P4WA 2AXLA 3LA7A 2HGCA 3JTGA 2IW5A 1SD5A 2QVOA 3REOA 1U2WA 2EFOA 4M71A 3GVAA 2ZCWA 3IKTA 4CDGA 3ZQ7A 2MC3A 4XSXF 2YPRA 3MWMA 1R1UA 4KICA 5FFZA 4OINF 4L5IA 2L3DA 2EA2A 5DCMA 1ZREA 3CUQA 4U0YA 1OYIA 4OIPF 1W7PD 4DNCA 3QPTA 3GEZA 2PI0A 4A0YA 1S29A 2V6CA 2ZJ2A 3GYHX 4G7HF 2Z33A 4H0EA 1KYWA 3LFKA 2XAQA 2D2WA 3K69A 3V8JA 4ETSA 1U8RA 1U5TA 3LQRA 4P96A 4HQMA 5L3BA 1HXDA 2DQLA 3TQNA 2VXZA 4RB2C 3B02A 1RI7A 4D0PA 3NRVA 3ZN0A 5E20A 2WWYA 5LLQA 3MQ0A 1TTYA 3CTAA 3DPLC 1GXPA 5FO5A 1Z05A 3BJ6A 1WKMA 2PG4A 1S6LA 4Y17A 3LSTA 3WTVC 1HQCA 3U9GA 2FOKA 1GVJA 2EV6A 5AONA 1B4AA 1YFHA 5H6RA 5LHIA 1TBXA 1G3YA 3HRUA 2FQ3A 1Z9CA 1K79A 2BYVE 1YG2A 3JW4A 1R22A 5CVRA 1IW7F 5F6FA 3S2WA 2L01A 5H20A 3WE2A 2P7CB 3FMRA 3HRMA 3DP7A 4M74A 1R5HA 4R8HA 3KETA 3F8CA 4LFUA 4Q5SF 1KA8A 1O3SA 3P9IA 2NRAC 5HDNA 4XSZF 1YW8A 5K1YA 3KLNA 5CJ9A 5D5XB 4ZZDA 4KIGA 1S7AA 1O7LA 1BM9A 4CICA 2AS5F 3MEXA 3TGNA 3PQKA 2RNJA 5FLXZ 1W5TA 2KIFA 3PQJA 3ROUA 2DLLA 4KUMA 2H27A 2STWA 1HSJA 2FBKA 3ZN1A 3GFIA 2RGVA 4HX7A 1FBQA 3LWFA 1ZLJA 3GLXA 3GW2A 5HLIA 4EJUA 5D5UB 2HQNA 1XSXA 3CO7C 2XKOA 3FX3A 2RN7A 4CHUA 4QLCU 1IXSB 4L9VA 2E7XA 2H94A 4G8XA 4G9YA 2EK5A 3RI4A 3E97A 4RGUA 2QQBA 1U5TC 4Z2YA 1ZG3A 1ZAOA 2XAJA 3QRFF 1UB9A 4CXFA 4FX4A 1OPCA 4FX0A 2OD5A 1ZN2A 4IVNA 1A04A 2XHKA 2O61A 4HLYA 3C7JA 3I5UA 3ABUA 3F6OA 2ZMEA 3KP2A 3GX4X 3BP8A 1IXCA 3K1PA 1TW2A 3Q5FA 2PQ8A 4I0BA 3WU1B 3HRSA 3BWGA 2ESHA 4Q48A 3BPVA 3P9KA 5HLHA 4L0YB 5L3DA 5J6XA 4GYIA 2A6EF 3ELKA 1IZ1A 2XKPA 3NQOA 4A6EA 2UXNA 4G94A 2P5LC 3WTZA 1PP8F 5LHHA 2P7VB 2M30A 2ESNA 1G3SA 2OU2A 4YG2F 4ZYEA 2DPDA 4EJOA 5E1WA 2VE8A 2VOOA 3R0AA 4ZZLA 3DXJF 4AD9A 5FLXK 1XDUA 1EH7A 4LG0A 3ZMZA 2UWMA 4G7ZF 2M1BA 4PGGA 3I4PA 3WTXC 2C6YA 2DO7A 4IRIA 2ETHA 1HKTA 2F2EA 2F5EA 4HV5A 1MDMA 2ZNZA 3FM5A 1RUOA 2QUFA 1QGPA 3RYPA 1J7KA 4PDKA 4P9UA 4LJZF 2KIUA 5JFRA 1NHAA 4OU0A 3KEQA 3ZPLA 2VONA 3T8RA 2DT5A 5FFXA 1LB2A 4G6DA 4ESFA 1IN5A 2UZKA 1XGOA 5D5VB 1XMKA 1ZLKA 3FM3A 1YYVA 3F6VA 3BOQA 1S3JA 1QQIA 1XD7A 4IHTA 1J75A 1BI1A 2JRTA 1QBJA 2RV8A 3O6BB 4I7HA 1SFUA 4JK1X 1QO0D 1HW2A 4P9FA 4ESJA 4MTEA 3T8TA 4I98B 1IXRC 1P4XA 1Q1HA 2EV5A 3H92A 4L0ZB 3KLOA 2LKPA 2PEXA 4HF2A 4U7BA 2QBYA 5CVVA 2YX7A 4CO8A 2OQRA 1FYMA 3LA3A 3FMQA 5KVRA 3M9AA 2XVCA 2NNNA 5E8GA 1TW3A 2FA5A 4RB1A 3K9TA 3TOAA 3FXQA 2NS0A 2YSRA 4FT8A 2L02A 1T38A 2Y0MA 4RGXA 4IRGA 2WC2A 2VBZA 2FMYA 1UCRA 5L3FA 2G7HA 3FF5A 3ABTA 5LGTA 3QP6A 4I2OA 2L4AA 3J7AO 1HKSA 2XAGA 2FXAA 1B9NA 3SXYA 3BZ6A 4A0XA 2ELHA 4TV7A 5BQTA 4EGYA 1T39A 2VBWA 2VC0A 2OZ6A 3TKYA 2W84A 5HDKA 4HF0A 2MA3A 3RYRA 2V1DA 3F22A 5D5WB 3PFIA 1KU3A 2O3FA 3E5QA 1STZA 3EYYA 1J59A 1IRFA 3QPHA 4KNYA 3W6JB 1ZARA 3VODA 1IRGA 1UFMA 2ZKZA 3KP3A 3FZVA 3GZ6A 2R7DA 3DEUA 2H6CA 3EUHA 3WGIA 2GZWA 3SZTA 3QU6A 1QNTA 3CLOA 4MEYF 1EV7A 4AVPA 5LGNA 1ZYRF 2K4JA 4UXNA 1BOAA 3JSPA 2TDXA 5D8KB 4MHGA 2EFNA 2OA4A 5JI6A 2DPUA 1FPQA 2QZ8A 5K5OA 3LAPA 5LHGA 2LSOA 1BIAA 2HKXA 2FE3A 2CWEA 2CFXA 3IC7A 1IF1A 2VT2A 2P5VA 3V4GA 4O3MA 3QP5A 1JHHA 1B59A 1P4WA 4IXAA 3RIRA 2G9WA 6PAXA 4EQQA 3T5XA 1FBUA 5E8IA 1FOKA 4AWXB 1HSTA 4YFNF 1LVAA 2ADUA 4B09A 1K78B 3CO6C 2IVMA 4RGRA 4OMYA 4WK8F 1XN7A 2HKOA 4M6YA 4XRFA 3WTYC 3H3UA 4CZZA 1U78A 1B9MA 3RJPA 3RKXA 4P5OA 5L3EA 1SFXA 4GCVA 1W4MA 1OMIA 3TO6A
chains in the Genus database with same CATH superfamily
1AWCA 1WJEA 1QHGA 4OIQF 3F0CA 4WXHA 2FX0A 3ZP5A 3WTUC 4BUPA 3I54A 2RQQA 3H35A 5DUKA 1Z77A 1D0YA 2A3SA 5F0CA 2X85A 2M34A 4XNFA 1V5EA 1E17A 1FTTA 3WODF 3S1QJ 2X1CA 1WZ2A 4Q47A 2QLZA 5FGMA 3BPXA 4J01A 1S8NA 1MJAA 3DU5A 4CYDA 2ZSIB 4RB3C 2HOAA 3E0JB 4B1RA 4RAGA 1L3LA 4ENMA 1WHUA 2KJCA 1K6OA 2DMNA 1BBYA 3ML6A 2XSDC 1OR7A 3FKIJ 4CH7A 3D5LA 1MNEA 1EH8A 3K4KA 3EQLF 2RREA 3CCRI 3MCZA 3VSLA 1UJ8A 2IRFG 1WH7A 1JT6A 4XOTA 2LG4A 1QPIA 2QF7A 3KYDB 4E70A 3FK6A 1YS6A 3GTQJ 1VQ7I 1FYKA 1H9TA 1QVTA 3L9FA 4KN7X 3GTPJ 4B3XA 4D9JA 3I59B 1YJ9I 2HNHA 1I50J 4S04A 4J19A 1TZLA 1X2MA 3KP5A 3SQNA 1UG0A 2Z99A 1IO2A 1D3YA 2W1OA 3ERED 1J9IA 1YE9A 1F9NA 1I3QJ 5LRRA 1Z1DA 3G1MA 3BCAA 3S1RJ 5IP6A 1YJNI 1BL0A 1D5VA 4NB5A 3CCVI 3BG5A 1LNWA 2AXTC 4MFEA 3I53A 3S1NJ 4BJTA 1S5LC 2ZBKA 3G6EI 1UAAA 2HVRA 3DF8A 3DTKA 4F92B 3V7RA 1HF0A 3HUGA 1JKRC 1RESA 3O2PE 2EZLA 1M1EB 4CA0A 2DDAA 1LQ1A 2W85A 4ZYGA 1U0JA 3NEUA 3B6AA 5LEKA 3DTEA 4NC7A 2L54A 3FWEA 5C4JJ 1IV8A 4XN0A 3IRRA 1BI2A 1TL8A 4FHTA 1PUEE 2HTJA 3ZR8X 4HBLA 2VJIA 4YRVA 5BPDA 3VYUB 1Y1VJ 2LY2A 3ASOH 4GGGA 1YRNB 2VJJA 3JAMZ 4KMFA 1T8IA 4BDYA 2CV0A 4R1HA 5J4VA 2CG4A 2O0YA 1POGA 4LIVA 1WCMJ 2HR3A 2O5RA 4UY8I 4PCQA 4X6AJ 2QQ9A 2IA0A 2OTLI 2OV7A 4U0VA 4XKVA 2FNPA 1YQAA 5DCMB 3DBRB 3JRGA 3CUQB 1KYZA 3I71A 5L3CA 2CSOA 5KAFC 3M8JA 4BHPA 1TLHB 2ZNYA 5D6EA 4MQ9F 3F23A 1QZEA 1I1GA 1MSFC 3GBGA 1R49A 3KFWX 3LSRA 3Q9SA 2DK5A 3HPGA 4D5FA 3G73A 1LDKB 2Y0SN 3UR3C 3VYTB 1MBEA 2H6BA 3FHZA 2X9DA 3J81Z 3CUQC 2QSGX 4WWCA 2R3SA 1WWXA 3HC7A 3WU0A 3DV8A 5EZGA 3CP2A 3JREA 1WSUA 4L18B 3P9CA 5CYVA 3KYCB 3LOCA 4XRMA 4BGDA 1O3QA 2FBHA 1DPRA 2B7EA 2Q0OA 1A31A 1U5TB 1FC3A 1SVMA 2RQPA 4HG2A 4BHBA 2LF8A 1ON2A 3BG9A 4U7DA 1HDDC 2GA2A 2A6HF 3OSGA 2LP0A 4XICA 3V8KA 3BJAA 1I6XA 2K86A 1FYLA 5GADJ 3EUAA 3OS1A 4A3GJ 5CQGA 1HLVA 3EDPA 2M7AA 1FOWA 2ZSHB 2NVXJ 3W6VA 2M87A 1GVDA 4LITA 3TO7A 2E7WA 2CU7A 1SANA 3RTRA 1MMGA 3PFYA 2TRTA 4ENKA 3CC7I 2LLKA 4HDUA 1XMAA 4HX4A 1BIBA 1EJ9A 4S05A 3OIOA 2KRHA 1ZK8A 4XLPF 4BAYA 1GHCA 3RCOA 4RM3A 2M4KA 4YIFA 3CMEI 4A0ZA 4LIUA 1VNDA 4ZDLA 1FT9A 3HOUJ 3BQYA 4MGRA 1JUSA 2MD5A 3TW7A 2F5CA 3F21A 3HHGA 3MFKA 3FK7A 2PMHA 5IOZA 4KFCA 5DV5A 1RETA 3JRFA 4KITB 3ISPA 2LY1A 1GUUA 2HVQA 3FXRA 2LVSA 1A36A 1IN7A 2M5WA 2P6SA 1F1ZA 2CYYA 5FKOA 2FMLA 3CMMA 4A3EJ 5HNFA 5B3SH 2X6WA 1DQUA 4ZTFA 2P5KA 3H5RA 5GAEJ 1ON1A 1IN8A 1MJBA 3WG9A 3IL2A 2DAOA 2X6YA 3KP6A 4N0BA 3SFZA 3RPQA 2R7RA 3HOXJ 2DFIA 3GCMA 5L3GA 2HYFA 3EYIA 2QWWA 1USSA 2VKEA 4RLQA 2WV0A 3F8MA 2BE5F 2K27A 3RDIA 2P6TA 1QPMA 2JTVA 3MMYB 1SD6A 4I6ZA 2EB7A 3BTCA 1FMWA 3ZCOA 5H6QA 2DW4A 2WTEA 5FLMJ 4KISA 5K7FA 3VDXA 2LC2A 3JAMK 3K4MA 1SVOA 2M8EA 4B48A 3GTGJ 2JVHA 5ICGA 1RIOH 1UHSA 4I99C 1MH3A 5F0FA 4IHSA 2DOAA 3HDDA 1VTNC 5GTIC 3NARA 2OBPA 4CZCA 3N4MA 4LB5A 3RZOJ 1TT5B 1X1AA 2KIQA 4NBQA 5CVIA 2Y31A 3U21A 4BDZA 3M07A 1IC8A 5DTDA 1ETXA 4XBFA 3HOTA 1E2XA 3VOEA 3CMYA 2XDVA 4XKWA 5D4SA 1J09A 4L9JA 3PNVA 1X2NA 5GPCA 1FBSA 3A4CA 3K1NA 4E7IA 2EFWA 4XL9A 4IX7A 1IUYA 2KZGA 3BQZA 2JPCA 1SD4A 3SZPA 3ZQGA 5D4RA 1BJZA 3HSEA 4E7ZA 3GWZA 3MAJA 4OOIA 2FF4A 4UHTA 1EH6A 2ME6A 3WTTC 1XPXA 4IF4A 1T0FA 2BBYA 1CF7A 4UVBA 2WB1N 1IGNA 1IN4A 2FOWA 3LSIA 2PN6A 4V2GA 4EM1A 3J81K 2DT6A 3KZYA 4HYEA 1RKWA 4M6VA 3JRBA 4IZZA 4MEXF 3TOBA 4G7OF 2BEOA 5J47A 1W36D 1L0OC 2HZTA 3LMMA 2IS4A 3FKJA 3K4JA 4U88A 1Z3XA 2KRFA 3M8EA 4M9SA 1YJWI 1MH4A 3WGGA 1VQPI 2JA6J 1V5GA 2JA2A 4M3GA 1LUJB 4A3JJ 1JKOC 4YELA 3ABKH 1KQ8A 2Y9ZA 2P81A 3ZMTA 2LKSA 1R00A 4IQJA 4ZYDA 3SDBA 5BS6A 2DA2A 4IQ4A 2VLAA 5F0HA 3HSRA 3RKWA 1FOXA 1REPC 2O8XA 1MBHA 3IH3A 3OV8A 4HLXA 3BTJA 2IA1A 1AU7A 2LBFB 5EZHA 1H8AC 2R5ZB 2I5UA 2V79A 2Y9YA 1FTZA 4O5VA 3L7WA 3QQAA 1U9OA 3S17J 1Y0UA 2MBFA 2PJRB 3PNYA 4IEJA 1ZKGA 3F8NA 1HC8A 1IN6A 1F4KA 1D8KA 2I8DA 5B1AH 3K4BA 2XROA 3A2KA 2E60A 4A3CJ 4UV8A 3TO9A 1HCRA 2LREA 3QOEA 3ZXSA 1O7FA 3CC4I 3K1MA 1ZR2A 2R5YA 3E5UA 3W3CA 1Y0NA 2BY0A 2V9VA 5E1ZB 3HTSB 1BW5A 3J7ZI 1JXSA 2ZMEB 5LD2C 2ZXIA 2BHZA 4MNUA 1XCVA 1SFEA 2QSFX 2HYJA 5HVQC 1FNNA 5J8CA 4EV0A 4ON0A 3F8FA 4XQFA 5CQEA 3E1SA 2W4SA 4IPAA 4RGSA 2HZDA 2IS2A 1USTA 2H1KA 5IP7J 2RDPA 1APLC 2GM4A 4DZPA 3QPLA 5CVUA 3OYCA 2F4IA 1ETWA 2ZXHA 2KMUA 4EJTA 3HRTA 3D1NI 4MQVA 1P7JA 4QPOA 1ZELA 5E17F 2WAQN 1JKQC 3PL8A 1W7PA 3GFJA 4BXUA 3HXLA 2Z16A 1HKQA 2VB6A 2W57A 5LGUA 5GAHJ 1Z21A 4BKXA 3MKZA 1HBXG 4RAYA 3FXOA 5TJJA 2CGPA 5ERIA 4BE1A 3HTUA 1KQ0A 3V8LA 4HQEA 2LRDA 4F93B 5M5WJ 4XRSA 2BY2A 3GFLA 1UHWA 4RDUA 1G3TA 2QKLB 5JR3A 1O3TA 1YHQI 2VBXA 2A5YB 1Y1WJ 3DPTA 4ENJA 2GIVA 4BYYA 3QU3A 2L7ZA 4QPQA 4HF1A 2DJIA 2ACJA 3K0LA 2Y2ZA 2K9QA 1CQTA 2ZJPF 2HQRA 3P7NA 5EEHA 5JHFA 3GTMJ 3GF2A 2EZIA 1QHHD 3H3ZA 2HDWA 2STTA 1BC8C 2EILH 2KHMA 5M5YJ 3TL4X 3H9JA 1MMDA 3AG3H 5C44J 4QWQA 1KQ9A 2ZXWH 4LG0B 3WHBA 1LFPA 3K70C 4FASD 1X1CA 4HRIA 2W48A 1RUNA 1LVKA 4A5NA 4JP0A 2A5WA 2XIGA 4NQWA 3LFUA 4DIQA 5EG0B 2DJNA 5FB2A 3B73A 3WGHA 1ZRDA 1MDMB 3R60A 1N25A 4HAMA 3AKZA 1MSEC 2FRHA 2QYOA 3VPRA 3CDIA 1QZYA 2KRCA 1RPWA 1ETVA 1EKEA 4BEHA 1T56A 2TCTA 1G6NA 2V9PA 3SEZA 3F9KA 1ZG5A 2DOEA 2HXOA 2E34A 1K78A 2CO5A 4BH9A 1VFCA 1T98A 2XGDA 1KU9A 4YEJA 4C2TA 5FLVA 4WXCA 1X58A 1R9TJ 1P7IA 3KP7A 3HOSA 1WJBA 2WADA 4BY7J 2Y30A 4UVAA 1RRJA 2E1CA 2CV1A 1WPKA 1W0TA 1DP7P 2DFHA 2RC4A 1PP7U 3O3KA 3DKWA 1WH5A 2KDZA 2PJPA 2BV6A 1RZ4A 1MD0A 2JSPA 2GWRA 1D0ZA 4AYBA 1BN5A 1V4RA 2EZKA 2VOPA 2HQ5A 4M9ZA 4LLGF 4WCGA 3IRQA 2DYRH 3V7CA 1E3HA 2OQGA 2K40A 2HDCA 2R7VA 3V42A 3HG9A 1F5TA 2MABA 5FD6A 1WI3A 1Z6TA 3PIPF 1R1TA 1KONA 3HJEA 3K7AJ 1TWGJ 2R7WA 3LSGA 4GFBA 3F72A 3JR9A 3U1DA 4B43A 2FU4A 3EETA 2EFQA 3L2CA 5A2QZ 4K2EA 2JWTA 5E3MA 1JE8A 2B0LA 3DKXA 3OS0A 4U87A 3IP4B 5TRDA 4RS8A 5ICFA 5KCMA 3W2VA 2X6OA 3I4MJ 3Q3SA 3KX2A 4P1WA 1OYWA 4N9HA 1R7JA 3I9V2 1ZTRA 3BZCA 2L7FP 2M8GX 2D1HA 1T2KA 4XLNF 4BQNA 4P55A 3L1PA 1AA7A 5J3LA 4HX8A 2HYGD 3FXUA 3GXOA 4A3FJ 2R7SA 3FBNB 4FE4A 5KAIC 3I0TA 5DCFA 1JKPC 3B6CA 2QBYB 1MIJA 4XOPA 4PJJA 4EATA 3G1LA 1SMYF 1FY7A 4A69C 1C0WA 5CLSA 5IT9Z 3WE3A 3IKVA 5FRMA 3E3VA 3MZYA 1Z6RA 3JRIA 2JA5J 3GUDA 4Y13A 2L4MA 5KK1A 4J00A 3MN2A 4DGWB 4M9XA 1XMXA 4IRHA 1KU2A 1TC3C 3E7LA 5DD4A 1ETQA 2MYSA 2NOJB 3F3XA 1LFBA 4I01A 3DQVC 4EM0B 4Y7NJ 1WRJA 4R79A 1MGTA 1E0EA 3CD6I 1O4XA 3DTIA 1KZHA 5F64A 3R61A 2Z9OA 2D1VA 2J5PA 4EEFG 4E7JA 4YIRX 4C9YA 4Q4ZF 1MBFA 1FP1D 1JGSA 2VXDA 4F7ZA 2LKXA 3E5XA 3C1DA 5DM6F 3K2ZA 3M7GA 3K10A 1XG1A 3BR0A 4G6QA 4U0WA 3HGYA 1IV6A 1Z3YA 3L09A 2JT1A 3ZMVA 2BGCA 2R7UA 2XB0X 1F43A 2MH2A 3CJQB 2DODA 4CCLA 2R7ZJ 1LJ9A 4EJWA 2VN2A 2IS1A 2ECCA 3CJTB 4MIMA 4AIKA 1XSVA 5DDGA 1GV2A 3KE2A 3KCCA 2HOEA 3MD2A 2DXIA 2UV1A 4N4NB 3W6KB 5HDGA 5F27A 4E7HA 2HOSA 3MKLA 5EEGA 1B6AA 2ICWG 2B9SA 3OYJA 1I1SA 1TWCJ 2OF7A 2CS3A 1VQMI 3OYGA 3V7SA 5HS8A 2NYXA 1VF9A 4XLFA 1U8BA 4OWRB 4LLLA 4BACA 5E3NA 2YU3A 4PZJA 1A35A 1Z7UA 5ICEA 2Y75A 1HW1A 2GA1A 1MMAA 1XSDA 4PSXA 3HB9A 2HPMA 3J80Z 4PJNA 1A6QA 1SAXA 2HS5A 1CGPA 3C2GA 3O8HA 4HV6A 4NDLA 4B44A 2DA5A 4EVIA 5IY5H 2ZXJA 4QIWN 1FSHA 3WTSC 2K7LA 3TDUC 2YS9A 4GO1A 5A2QK 3ZMUA 3BY6A 2KJBA 3WHCA 4LK1F 1X3UA 2MD0A 3GFMA 1ERDA 1FSEA 4ABZA 3LA2A 2PMUA 4M72A 4ZYHA 3OYIA 2E2JJ 3HKZA 1SAUA 4A2UA 5HOOA 4BNCA 2FBIA 3EUHC 3IWFA 2PMZN 5K5QA 1RR8C 3WG7H 1VI0A 2CRGA 4XLCA 1P92A 4BXFA 5GTHC 4JYKA 3CQZJ 5M3FJ 4DQ2A 4HW0A 2AQEA 3CDHA 5J40A 2F4MB 1JI8A 3Q0VA 5HS9A 4IHYA 3A03A 1DGWY 1ZGAA 4YFKF 4NHJA 2Z3YA 1P4AA 2CUEA 2IA2A 5LRSA 4CCJA 3BCBA 1FX7A 4RB0A 2COMA 4EJVA 1K7AA 4E4HA 5IT9K 4A3DJ 3OOPA 3CJNA 3ZGKA 1PDNC 2JA7J 5IT3A 2E2IJ 1I5ZA 2NNYA 2GXGA 5HS7A 2VT3A 1XGNA 3MZHA 3K4NA 4CCOA 1E3OC 1AKHB 1J2XA 2V1NA 2CW7A 3RKYA 3J7AY 3VSKA 2V1XA 1Y56A 2Y69H 1S7OA 1X3WB 5GP9A 3L2VA 2E71A 3E6CC 2GIZA 2K9NA 1YLFA 4EM2A 2IJLA 5BOXA 2CW8A 3G4SI 1Z7LA 1ZG1A 4H4KC 5DS9A 2G7UA 4M3BA 5E18F 2KZVA 2V4JC 1MBGA 2KP6A 3GTOJ 4M6XA 1PUFB 4GRIA 3AFHA 4KMUX 2X1DA 2EQRA 1V3FA 2VIXA 2BY3A 1R58A 1YO5C 2CW0F 3OYLA 4HZFA 3HOZJ 2IGMA 1K4SA 1B8IB 1X3ZB 3HHHA 1LE8A 1T6SA 2J5OA 2MC4A 2BVMA 2QENA 3OIPA 1WGXA 2FSWA 3NWTA 5JLXA 3S32A 3IH2A 1JT0A 1D1AA 4LG3A 2W25A 3SHFA 3CCJI 1DPUA 3CUOA 1SD7A 4LGWA 5J8FA 2K02A 4L5EA 3QWLA 4XLAA 2G0EA 3W2WA 1VQ5I 3GTJJ 4ENNA 1SEUA 2OPTA 2XGCA 3TBIA 1D8JA 2EFPA 2W7NA 5IPAA 2DK8A 1J5YA 2HU9A 3I58A 2IBDA 3QOPA 4YFXF 1K4TA 1UELB 2QCOA 3M8FA 5AIQA 2VUMJ 1H9GA 2JPBA 2OAZA 2F6CA 2X6XA 3OYKA 3RSNA 2OZUA 4KYWA 2JQ7A 1GLNA 2P0WA 4A3BJ 4UB6C 1YIOA 2BHYA 4ZJZA 1V55H 5K7ZA 1MZBA 1X1PA 2O7OA 4FETA 4PGHA 3TEDA 3PUFA 1GXQA 4LOCA 3OMYA 2F5VA 2IT0A 2PLYA 5B1BH 3ZMDA 1VQLI 3ZQQA 1SFOJ 2A6TA 4CYCB 1WJCA 2EIKH 1OR7C 3M4OJ 2M4GA 3GO5A 3ULQB 1JHFA 3J80K 1FZPB 3FMSA 3Q0WA 3H0GJ 2F5FA 2WBMA 4DOZA 2VJ5A 5AIPA 5IYBJ 2NAZA 4HOBA 1BA5A 5ILVA 2HTSA 2VKHA 3DEWA 5E79C 1JJ6C 1R1VA 3X2QH 2VBYA 5K5RA 2OUMA 4ASNA 2K3FA 5JVGF 3HIFA 1U3EM 1ULYA 2PJRA 2FJ1A 3D0SA 3VYSB 2ISYA 3HUGB 4OIOF 2XASA 5CPRB 3OL3A 3Q9VA 4AIJA 1LDJA 2EV0A 4DZJA 2VODA 4UUSA 4B8XA 1OCOH 1FLIA 2NVUB 2W82A 2X51A 1FOYA 3H3VK 1AOYA 4GDFA 1FP2A 5EGOA 1IDYA 1H0MA 2O9LA 4N9IA 2KIMA 3BTIA 1TQIA 1TQMA 1MMSA 5LEJA 5DUIA 3BT9A 2HFHA 1HW5A 2GXAA 1J0RA 5E1XA 1DU0A 3L00A 2D45A 3TO6A 2CUFA 2N8GA 1B72B 2LD5A 1T33A 5ILUA 4I09A 1XGMA 2XUBA 4AIHA 1XB4A 2LDUA 4A12A 1U6GA 2CQKA 1ZRCA 2HEOA 2IGOA 4N4OB 2GQQA 4FTHA 4BQQA 3JRCA 4A6DA 2DQRA 3IUOA 5K7HA 4YIIA 4BBRJ 2XRNA 2ZFUA 2XPVA 3PNTA 4RAZA 1YTYA 1W5CC 4KIBA 2YX4A 2DU9A 1Z91A 3G1OA 2MG4A 1BJAA 1TQPA 1R6RA 2FQ4A 3QAHA 1BI0A 3ERMA 2Y48A 2KKOA 3JTHA 3JSOA 2NS7A 2VKVA 4Y52J 4E6KG 5JHUA 2O8KA 2EA4A 2QQAA 5HNHA 1I39A 4AIDA 4HNTA 4A3IJ 4V2FA 4HDVA 2VPLA 2FUG2 4O6JA 1DDNA 4CGZA 5F1RA 2K9LA 4NC6A 2EWNA 4ESBA 4CCMA 2M45A 1YW7A 4XM3A 3F8BA 4BHCA 1R36A 2NVYJ 4IJAA 2M7BA 1ONVA 3C18A 1DUXC 2YU9J 4GYGA 3SYTA 2UXXA 4KIFA 1ETYA 4HNVA 2A07F 2OTJI 3N97A 3E6MA 2WAFA 2DFFA 1TNSA 2O03A 5LBQA 4KT6A 3CCQI 1YW9A 2AO9A 1SMTA 4RLFA 1UG2A 1N78A 4PSWA 4JBAA 2GXBA 2ZO4A 3M1EA 2XV4S 2VL8A 5ED4A 2A61A 2LNBA 2IS6A 1OCPA 5EG0A 4LLNA 2R7FA 2WAEA 1W5SA 1HDPA 3NWSA 5JVTA 1O3RA 5IOYA 2R7OA 2JMWA 2EH3A 1R5ID 3RQIA 2ISZA 5DYMA 3AAFA 3A1YA 1WQ2A 3SDGA 3DBHB 2LK2A 2Q2EA 5M3MJ 5ILSA 4XMYA 4BQAA 2JSCA 4I02A 3SFIA 1JGGA 1FJLA 4C2UA 1X1BA 4LMYA 5HLGA 2VQCA 1D5YA 4XRSG 1TNTA 1G3WA 1D0XA 1OQYA 2GBYA 3D5SC 4HEA2 1ZHFA 1OYYA 1UHMA 2M2EA 1X19A 4L5JA 4WX9A 3S3MA 1FEXA 2PBIA 3TDZC 3R0JA 1N77A 3HSFA 3EPZA 3ZMSA 1WI9A 2NVQJ 2BW3B 2DI3A 2K5CA 4IHVA 4KJZA 2DTRA 2V1UA 2BY1A 2FNAA 1XX5A 1ZGJA 1YS7A 2YR2A 3GLLA 4XORA 4AM3A 1VZ0A 1I27A 3DFGA 1P2FA 2X0LA 3IHUA 4L9NA 2LR8A 5TGTA 2DMTA 2LY9A 2KL4A 4A3LJ 4JX5A 4KDPA 1VQOI 2WY7Q 2VASA 5EYRA 4DYCA 4KT5C 4NUBA 4UNOA 1PJRA 4JQFA 3RPUA 4BJ6C 1WJFA 2ELKA 2A69F 2L9RA 3KZZA 4ZYAA 2X4HA 5D8LB 4CUGA 1LEAA 2P8TA 3OOUA 3VB2A 5EEAA 4KA4A 2FEZA 5ICCA 5DEQA 3S3OA 4A3KJ 4EMSA 3VYRB 2Z1DA 1R5GA 1NG6A 3HYIA 4II3A 1RNLA 3VFZA 2DCEA 3C3WA 1NG7A 3U2RA 2O6GE 1FWZA 1LDDA 2DMQA 3DLLF 4UUVA 4BXXJ 4QSHA 3NAUA 2K4BA 2PFBA 5FKMA 2H1LA 2GAUA 3IH4A 3VEPA 5EJCA 1R23A 4BQOA 3BROA 1TT0A 3PO3J 1OKRA 5C4XJ 1XDSA 4GXOA 1VQ9I 1D1BA 2DBBA 3E6DA 4LK0F 1B1BA 2VI6A 3ZQLA 2CV2A 2XAHA 3FDYA 4UV9A 1BI3A 2M9HA 2F5DA 4LB6B 1S72I 1WJ5A 4Y15A 5FKNA 3HOYJ 4F91B 3CCLI 1DGRM 2VQGA 2LMDA 2Z5UA 1RKTA 4KN4X 1XCBA 2MH9A 2H09A 5FROA 1CF7B 3BJOA 4UVCA 4EGZA 3T0YA 2CMPA 3BZKA 1MKMA 5BNGA 1FMVA 1LPQA 2IP2A 3WTWC 1G2HA 2LYCA 1IAWA 3CMAI 3CCMI 2H8RA 2A68F 4W97A 3H5NA 3DCFA 1O57A 2E1NA 2JRMA 5TISC 2VE9A 4LD5A 3AL0C 1XTAA 1P6RA 5DD8A 3R4KA 1OCRH 2QKMB 1XGSA 3COAC 1QA6A 1T0FC 3ECHA 3DU6A 4I0AA 2ZB9A 3J7YJ 3I3LA 5D6FA 3I64A 3E6BA 5GAGJ 4OAZA 4BJ5C 3IAM2 4S0HB 3OY9A 3PSFA 3R6SA 4L9TA 2R4GA 1Y6IA 2HWVA 3KP4A 2HDDA 3BG6A 2W24A 3LAJA 2Q8KA 3CC2I 3S16J 1MJ9A 2QM3A 2XGXA 1KU7A 1IRZA 5CVJA 2VC1A 1MNDA 2ZFWA 2EIJH 1OJLA 3A01A 5J1RA 4OIRF 2RKHA 3KEOA 2XAFA 3K70D 4A5MA 1ZH5A 5IYDJ 1ODDA 2E35A 2L7KA 5CKTA 3BDDA 4MTDA 5B66C 4HA8A 5F1JA 2RNGA 2XF6A 2R5YB 4NNJA 5FD5A 4WF2A 1KGSA 1BC7C 3ECOA 4X0GA 3CCUI 3T1BA 2EJRA 2GLOA 1AHDP 3IV5A 3H9QA 4PUSA 2JZYA 1G4DA 2IPQX 3G3ZA 3K2AA 1NK3P 2L9NA 3FXMA 2BXZA 3OR1C 1ZRFA 1W7PB 2RVCA 5BMZA 1S9HA 3HL2A 5IYCJ 2DMPA 2Y0SA 4AUXA 4RA2A 3FISA 3LQQA 2HOTA 2BOLA 3LNQA 2LF7A 2R92J 2E1OA 1HOMA 2BZTA 3I59A 3RQ4A 1QZZA 4RM2A 2MLKA 2JA8J 5BPIA 3I4NJ 5E3LA 1NH3A 2MLGA 1GT0C 3GZ5A 4OMZA 2YUSA 4ZH4F 2FD5A 4WXDA 1ZQ3P 4M73A 3IWZA 2P4WA 2AXLA 3LA7A 1E3PA 4BY1J 2HGCA 4ITVA 3JTGA 2IW5A 3DWLE 3BLYA 2EBIA 1SD5A 1D1CA 2X48A 2QVOA 3REOA 3OYAA 1V54H 1U2WA 2EFOA 4M71A 3HPHA 2R93J 3GVAA 2ZCWA 5F04A 3IKTA 3PO2J 4CDGA 1GV5A 3ZQ7A 4IL6C 4DBQA 1A6IA 2MC3A 1YX3A 4XSXF 3H5AA 2OJED 1Y8QB 5LFAA 1YRNA 2YPRA 3DBLB 2F48A 4HNUA 3MWMA 1R1UA 2KLOA 4KICA 4XR6A 3FBIB 1VQKI 1W1WE 5FFZA 3AG1H 4OINF 4L5IA 4QTRA 4BEHB 2L3DA 2EA2A 2VPRA 2CUJA 5DCMA 2EZHA 1ZREA 3CUQA 4HSRA 1SFKA 4B47A 4U0YA 1YITI 1OYIA 4MLOA 1JTYA 4OIPF 1W7PD 4DNCA 2A05A 2KISA 2L9SA 3QPTA 3GEZA 3PUBA 4C3JJ 3MKYB 2PI0A 3LSJA 9ANTA 1OFCX 4JX6A 1XS9A 1VQ4I 4XN3A 4A0YA 3RZDJ 1NK2P 1S29A 2V6CA 3DLAA 2DA6A 4M3EA 2ZJ2A 4DW6A 4IHXA 3GYHX 4G7HF 2AHQA 2CUZA 2Z33A 4H0EA 3OYHA 2XSJC 2D5VA 1EA3A 1KYWA 2W00A 3LFKA 2MSYA 2XAQA 2D2WA 3K69A 4AC0A 3V8JA 1V5FA 4ETSA 3OYBA 1U8RA 1U5TA 2OC6A 3LQRA 5IP9J 4P96A 4HQMA 1P9QC 4X1EA 5L3BA 3U1KA 4RMNA 1HXDA 2CH0A 2DQLA 3TQNA 3HOWJ 2VXZA 4RB2C 1HA8A 2ZJRF 1IUFA 2BXYA 3B02A 1RI7A 1N75A 4D0PA 2DA3A 2F4OB 3NRVA 3ZN0A 5E20A 2WWYA 5LLQA 3MQ0A 4ZDOA 3D5RC 1TTYA 3CTAA 3DPLC 3PSIA 1GXPA 5FO5A 1Z05A 3BJ6A 3G2BA 3QYEA 4F55A 1WKMA 2PG4A 3M3YJ 1S6LA 3QODA 1F36A 3QYBA 4Y17A 3AG2H 1X4PA 2HI3A 1IRXA 3LSTA 4CYCA 1HQCA 2WB1A 3WTVC 1H88C 2EPFA 2XPWA 3U9GA 2FOKA 3DPUA 1GVJA 1R4MB 4C30A 4MFDA 1UZCA 2JUGA 2EV6A 2LH9A 3FHNA 5AONA 1B4AA 4E7KA 1YFHA 2IGKA 5H6RA 5LHIA 1MBJA 1TBXA 4I76A 1G3YA 2ZJQF 3HRUA 2FQ3A 1Z9CA 1K79A 2BYVE 1YG2A 2L0KA 2M3AA 3JW4A 1R22A 5CVRA 3HOVJ 4F52A 1IW7F 5F6FA 3S2WA 4PFPA 1FIPA 3K4LA 2L01A 5H20A 3WE2A 2P7CB 3FMRA 3HRMA 3DP7A 4E7LA 1MW7A 2L7MP 4M74A 1W0UA 1SVLA 5F08A 2IGNA 1R5HA 4PJMA 2WV1A 4R8HA 3KETA 4C3HJ 3F8CA 4AYBN 1OCZH 1I3AA 4LFUA 4G6TB 4Q5SF 1KA8A 1O3SA 3P9IA 2NRAC 4HSTA 5M5XJ 3UKGA 5HDNA 4B4CA 4XSZF 1YW8A 5K1YA 3KLNA 5CJ9A 2DDBA 5D5XB 4ZZDA 1B72A 4KIGA 2CQ7A 1S7AA 3S93A 1O7LA 1BM9A 1WJAA 4CICA 4RBOA 1RR7A 2AS5F 1QRYA 4ANJA 4DYQA 2XC7A 1U9NA 3MEXA 2R7TA 3TGNA 3PQKA 2RNJA 2AQFA 5FLXZ 1W5TA 2DN0A 4D5CA 2JK3A 2L5QA 2HVSA 2KIFA 2HXIA 2K9SA 2R7QA 3PQJA 4D1QA 3ROUA 2MFZA 4CCNA 2DLLA 4UB8C 2WAQA 4KUMA 1ZGWA 2H27A 2STWA 2OCEA 3GMEA 1HSJA 2FBKA 3ZN1A 3GFIA 3H1CA 3JRHA 2RGVA 1OCCH 4FE7A 3G71I 2K3PA 4HX7A 1TP4A 1JUPA 1FBQA 3LWFA 4RAFA 1ZLJA 3GLXA 1G59A 3K6GA 2VQLA 3CLQA 3GW2A 1BR1A 5HLIA 4EJUA 4JX4A 5D5UB 3OS2A 2HQNA 2ZC2A 1XSXA 4IKFA 1RC9A 1TWHJ 3CO7C 2XKOA 2DTZA 2L9VA 3FX3A 2RN7A 4CHUA 4QLCU 2JN6A 3QPSA 1IXSB 4L9VA 2E7XA 3ZRGA 2H94A 4XONA 3ASNH 4G8XA 4G9YA 2EK5A 3LSMA 3RI4A 1MMNA 3PJRA 3E97A 2IAIA 2Z2SB 2LBFA 4RGUA 2QQBA 3GTLJ 1U5TC 3A02A 2R5ZA 4Z2YA 2HPIA 1IG7A 1ZG3A 1ZAOA 2XAJA 3QRFF 1UB9A 3PIOF 1GDTA 4CXFA 4FX4A 1OPCA 4FX0A 4PJ0C 1R71A 2OD5A 4HPQA 5KNLA 3S14J 3OWTA 4AU7A 1ETKA 1ZN2A 4IVNA 1A04A 2CJJA 2XHKA 2O61A 1K61A 4HLYA 3C7JA 4BE2A 3I5UA 4BU2A 3VWBA 3L2UA 3ABUA 2GOMA 3F6OA 5J1UA 2ZMEA 2WY8Q 2NXNB 5FKKA 3KP2A 3GX4X 1MNMC 3LSHA 3BP8A 2BW3A 1IXCA 3K1PA 2MGQA 4PJLA 1TW2A 3OIQA 2PQ8A 3FXJA 4I0BA 3HRSA 3BWGA 3WU1B 2ESHA 3Q5FA 4Q48A 3BPVA 3DEEA 3I55I 3P9KA 5HLHA 4L0YB 3A0BC 2B63J 3CJRB 5L3DA 5J6XA 4GYIA 2M0MA 2A6EF 2HQAA 3ELKA 1IZ1A 1YX5A 2XKPA 3NQOA 1LEBA 3N05A 4PFOA 4A6EA 2UXNA 4G94A 2P5LC 1W36C 3WTZA 1PP8F 5LHHA 2P7VB 4AVZA 1FIAA 2M30A 2ESNA 3ZQIA 4ZTJA 2GOXB 1G3SA 2EINH 1PVEA 5HODA 2OU2A 4YG2F 1VQ8I 2ELJA 4ZYEA 2DPDA 4EJOA 1LE8B 3S3NA 1X4OA 5E1WA 3Q0UA 2VE8A 2VOOA 3R0AA 4ZZLA 4OAYA 2PX9A 3DXJF 4AD9A 3LSPA 5DM7F 1QU3A 2E5ZA 5FLXK 3JRAA 1XDUA 1EH7A 4LG0A 3ZMZA 3I56I 2UWMA 3HKZN 1NTCA 4G7ZF 2M1BA 4C3IJ 2V26A 4PGGA 3I4PA 4C2MJ 3WTXC 2C6YA 2DO7A 3BC8A 4IRIA 4ZDPA 3KIOA 2ETHA 2EIMH 3OYDA 1HKTA 3IAS2 4DBRA 2F2EA 4Z6YA 2LTPA 2F5EA 1X1DA 4HV5A 2DA1A 3H0DA 2ZNZA 1MDMA 3OYMA 2DT7B 2XAUA 3FM5A 2NOGA 3JCUC 1LKXA 1RUOA 4M3FA 2XPUA 2QUFA 3QYFA 4XLHA 4IOCF 1QGPA 2DOFA 3RYPA 1J7KA 4PDKA 1XC5A 4IO9F 4P9UA 3BG3A 2E5NA 4LJZF 2KIUA 5JFRA 1NHAA 4OU0A 4BL0B 3KEQA 3SJMA 2QSHX 3ZPLA 5GPAA 3BR3A 4ZC3A 1ETOA 2IEKA 2VONA 3BR5A 4M3DA 3T8RA 2DT5A 5FFXA 3OYFA 1LB2A 2E36A 4IHWA 3H36A 4G6DA 4ESFA 1SC7A 2CQQA 2VJ4A 3UNGC 2RAEA 2VQHA 5J4YA 1IN5A 2UZKA 3A0HC 1PYVA 3OSFA 1XGOA 5D5VB 1VQ6I 3C2HA 2K85A 2I10A 1XMKA 1ZLKA 4XIDA 3LL7A 3FM3A 1YYVA 3CF2A 3F6VA 4B3AA 3BOQA 1JUMA 1S3JA 2LOOA 1T08B 4UUSB 3OYEA 1QQIA 3EUKL 1XD7A 2KDOA 4UUTA 4IHTA 3ZOBA 1J75A 2CFOA 2Q1ZB 1YIJI 1BI1A 3CZ6A 4BBSJ 2JRTA 1R4NB 1WVRA 5EGOB 2MW8A 4DJAA 3S2DJ 2QGUA 3BR2A 2K9MA 1QBJA 4E7SA 1IDZA 2RV8A 3O6BB 4FCYA 1ITYA 1VQNI 2M0CA 4I7HA 3JRDA 1SFUA 2ECBA 4JK1X 1QO0D 2NVTJ 1BR2A 1HW2A 3BTLA 4P9FA 4Y33A 4ESJA 4MTEA 3T8TA 4I98B 1IXRC 2E1MB 2DFEA 3AG4H 5HLTA 1P4XA 3L2QA 4CCKA 4D7MA 2ZMEC 3L2WA 1OISA 1Q1HA 2EV5A 3H92A 4L0ZB 3OYNA 3KLOA 2PEXA 2LKPA 4HF2A 1QVUA 4U7BA 3M1CA 5CVVA 2QEXI 4W1UA 2QBYA 1DP3A 1BW6A 2YX7A 3KPHA 4CO8A 5B5EC 2OQRA 3AL0B 1MBKA 2E1MC 3MVPA 1FYMA 3SEQA 3LA3A 3FMQA 5KVRA 3M9AA 2XVCA 1TWAJ 2NNNA 1TW3A 5E8GA 2FA5A 2VKDA 1ZR4A 5FRNA 4RB1A 3K9TA 5J1YA 2XRLA 3HM5A 5C3EJ 3W2AA 3BG7A 3S1MJ 5JLWA 1S7EA 3TOAA 1EF4A 2CQXA 3FXQA 3TP3A 2NS0A 2YSRA 4FT8A 2L02A 3CCEI 2QA4I 1T38A 4XLEA 2L2OA 1Z67A 2KQRA 2Y0MA 2PMZA 3HEFA 4RGXA 4XKBA 4IRGA 2WC2A 2VBZA 2FMYA 1UCRA 1YOVB 4D7NA 5L3FA 2G7HA 2NS8A 3FF5A 1ENHA 2KT0A 3ABTA 2WA0A 3DKYA 3HGGA 5LGTA 1Q1VA 3QP6A 3KEYA 4I2OA 1K83J 3H9GA 3HZJA 4DYRA 3P5JA 2L4AA 3PM1A 3J7AO 4G12A 1HKSA 2XAGA 2Q2EB 3RKQA 2FXAA 1B9NA 3ABMH 1Y8RB 3BR6A 1Y39A 3SXYA 3BZ6A 4A0XA 2ELHA 4TV7A 5BQTA 4EGYA 1T39A 1LFUP 2V7FA 3S8PA 2COBA 2VBWA 2VC0A 2OZ6A 3TKYA 2W84A 5HDKA 2XB5A 1A5JA 4HF0A 4XKCA 2MA3A 2DA7A 1G8XA 3TMOA 2E2HJ 3S15J 3RYRA 5KHDA 2V1DA 3GZNB 3F22A 4PK4A 5D5WB 3PFIA 1KU3A 2O3FA 3E5QA 1STZA 5FJ8J 3EYYA 1TWFJ 3MZ8A 4CSWA 2LFBA 1DU6A 1WFXA 3SZGA 1J59A 1IRFA 3QPHA 4KNYA 3W6JB 5E3OA 3OR2C 3WU2C 3MKWB 1ZARA 2ID3A 3VODA 1JTXA 1IRGA 4JOMA 1UFMA 2ZKZA 3KP3A 3FZVA 2DA4A 4II2A 3ESWB 5H2FC 3GZ6A 3TW6A 2R7DA 3DEUA 4FQGA 3FIWA 2H6CA 3EUHA 3WGIA 2UUZA 2GZWA 3SZTA 3QU6A 1QNTA 2X1EA 4F3QA 2R0QC 3CLOA 4MEYF 1EV7A 3GTKJ 1OCTC 2KPMA 3ZQHA 4AVPA 2R7XA 3TP0A 4FISA 2BVLA 3K4CA 3C2BA 5LGNA 1ZYRF 5FKLA 2JVGA 2K4JA 4UXNA 1BOAA 3JSPA 1Z0XA 2TDXA 2JJ7A 3FXLA 5D8KB 4BE0A 4Y4RA 4MHGA 3KZIC 1IJWC 3ZQCA 2EFNA 2OA4A 4IOAF 2XF7A 3FXKA 2IXSA 4Y3OA 1JJ8C 1OLTA 5JI6A 2DPUA 2H8WA 3CCYA 3LSKA 1FPQA 2QZ8A 1YI2I 5K5OA 3CESA 5LHGA 3LAPA 1H89C 2LSOA 1BIAA 2HKXA 2FE3A 2KFDA 2XF5A 2CWEA 4A93J 3ABLH 2CFXA 3IC7A 5EDNA 1UMQA 2V9KA 3KYLA 1T95A 1IF1A 2VT2A 3S2HJ 2P5VA 2XGEA 3V4GA 3CCSI 4O3MA 4NQWB 3QP5A 1JHHA 1B59A 1P4WA 4IXAA 2CQNA 3RIRA 2E19A 2G9WA 2OCCH 6PAXA 1I6HJ 1AKHA 4EQQA 3T5XA 1FBUA 5E8IA 1FOKA 3ZQFA 3L2RA 2ID6A 4BS9A 4AWXB 2JUCA 4XK4A 1HSTA 2V6EA 4YFNF 1LVAA 2ADUA 4B09A 1K78B 3CDLA 3CO6C 1ORKA 2IVMA 2QQ8A 4NC8A 4RGRA 4V19K 4OMYA 1PUFA 4WK8F 1XN7A 5EF6A 4A3MJ 2HKOA 4M6YA 3RPUD 2ME0A 1ACIA 4MO7A 4XRFA 3WTYC 3CF5F 3ONQA 3H3UA 4CZZA 1U78A 1BR4A 1B9MA 3RJPA 3RKXA 3BR1A 3HBLA 4P5OA 1K6YA 5L3EA 1SFXA 1B8IA 3CP8A 3A01B 2DMUA 4GCVA 1W4MA 1WJDA 1OMIA 3O8GA 3OL4A 2DYSH 1BOBA
chains in the Genus database with same CATH topology
1AWCA 4OIQF 4WXHA 3ZP5A 3WTUC 3I54A 5DUKA 2A3SA 1E17A 3WODF 4Q47A 2QLZA 5FGMA 3BPXA 1S8NA 1MJAA 4CYDA 4RB3C 1L3LA 4ENMA 2KJCA 1K6OA 1BBYA 3ML6A 1OR7A 3D5LA 1EH8A 3EQLF 3MCZA 2IRFG 4E70A 1YS6A 1FYKA 1H9TA 3L9FA 4KN7X 3I59B 4S04A 3KP5A 3SQNA 2Z99A 1D3YA 3ERED 1J9IA 1F9NA 5LRRA 1Z1DA 1D5VA 4NB5A 1LNWA 3I53A 2ZBKA 3DF8A 3V7RA 3HUGA 3O2PE 1LQ1A 2W85A 4ZYGA 3NEUA 5LEKA 2L54A 3FWEA 3IRRA 1BI2A 4FHTA 1PUEE 2HTJA 4HBLA 5BPDA 4GGGA 3JAMZ 4KMFA 4R1HA 2CG4A 2O0YA 2HR3A 4PCQA 2QQ9A 2IA0A 4U0VA 2FNPA 1YQAA 5DCMB 3CUQB 1KYZA 3I71A 5L3CA 2CSOA 4BHPA 1TLHB 2ZNYA 5D6EA 4MQ9F 3F23A 1I1GA 3KFWX 3Q9SA 2DK5A 3G73A 1LDKB 2H6BA 3FHZA 3J81Z 3CUQC 4WWCA 2R3SA 1WWXA 3WU0A 3DV8A 4L18B 1WSUA 3P9CA 5CYVA 1O3QA 2FBHA 1DPRA 2Q0OA 1U5TB 1FC3A 2RQPA 4BHBA 2LF8A 1ON2A 4U7DA 2GA2A 2A6HF 3V8KA 3BJAA 1I6XA 2K86A 1FYLA 3EDPA 2M87A 3TO7A 2E7WA 3RTRA 4ENKA 4HDUA 1XMAA 4HX4A 1BIBA 4S05A 4XLPF 4BAYA 1GHCA 4YIFA 4A0ZA 1FT9A 4MGRA 2MD5A 2F5CA 3F21A 3HHGA 3MFKA 4KFCA 2PMHA 5DV5A 3ISPA 3FXRA 1IN7A 2M5WA 2P6SA 1F1ZA 2CYYA 2FMLA 2P5KA 1ON1A 1IN8A 1MJBA 3WG9A 3IL2A 2DAOA 3KP6A 4N0BA 3SFZA 3RPQA 2DFIA 5L3GA 2HYFA 3EYIA 2QWWA 1USSA 2WV0A 3F8MA 2BE5F 2K27A 3RDIA 2P6TA 1QPMA 2JTVA 1SD6A 2EB7A 5H6QA 2DW4A 2WTEA 3JAMK 2M8EA 5ICGA 1RIOH 4IHSA 1VTNC 2OBPA 3N4MA 4LB5A 5CVIA 4XBFA 3HOTA 1E2XA 3VOEA 5D4SA 4L9JA 1FBSA 3K1NA 2EFWA 1IUYA 2JPCA 1SD4A 3SZPA 5D4RA 3HSEA 3GWZA 3MAJA 4OOIA 2FF4A 4UHTA 3WTTC 1EH6A 4IF4A 1T0FA 2BBYA 1CF7A 4UVBA 1IN4A 2PN6A 4EM1A 1LEBA 3J81K 3KZYA 4HYEA 4MEXF 3TOBA 4G7OF 2BEOA 1L0OC 2HZTA 4U88A 2KRFA 3M8EA 4M9SA 3WGGA 1KQ8A 3ZMTA 1R00A 4ZYDA 5BS6A 3HSRA 3RKWA 1REPC 2O8XA 3OV8A 4HLXA 2IA1A 2V79A 4O5VA 3L7WA 1Y0UA 2MBFA 3F8NA 1IN6A 1F4KA 1D8KA 2XROA 4UV8A 3TO9A 1O7FA 3K1MA 3E5UA 2V9VA 5E1ZB 3HTSB 1JXSA 2ZMEB 4MNUA 1XCVA 1SFEA 5HVQC 1FNNA 5J8CA 4EV0A 4ON0A 3F8FA 4IPAA 4RGSA 1USTA 2RDPA 5CVUA 4EJTA 3HRTA 4MQVA 5E17F 1W7PA 3GFJA 4BXUA 5LGUA 1HKQA 2W57A 1HBXG 4RAYA 5TJJA 2CGPA 5ERIA 3HTUA 1KQ0A 3V8LA 4HQEA 3GFLA 1UHWA 1G3TA 5JR3A 1O3TA 2VBXA 2A5YB 3DPTA 4ENJA 2GIVA 4BYYA 3QU3A 4HF1A 2ACJA 3K0LA 2HQRA 3P7NA 5EEHA 3GF2A 3H3ZA 2STTA 1BC8C 4LG0B 4QWQA 1KQ9A 1RUNA 4A5NA 2XIGA 4NQWA 5FB2A 3B73A 3WGHA 1ZRDA 1MDMB 3R60A 4HAMA 2FRHA 2QYOA 1QZYA 1G6NA 1ZG5A 1K78A 2CO5A 4BH9A 1T98A 1KU9A 4WXCA 3KP7A 3HOSA 4UVAA 2E1CA 1DP7P 2RC4A 1PP7U 3O3KA 3DKWA 2PJPA 2BV6A 1RZ4A 1MD0A 2GWRA 1BN5A 1V4RA 2VOPA 4M9ZA 4LLGF 4WCGA 3IRQA 3V7CA 2OQGA 2HDCA 1F5TA 5FD6A 1Z6TA 1R1TA 3F72A 3U1DA 2FU4A 3EETA 2EFQA 3L2CA 5A2QZ 4K2EA 1JE8A 2B0LA 5TRDA 4RS8A 5ICFA 1OYWA 4N9HA 1R7JA 2D1HA 1T2KA 4XLNF 4P55A 4HX8A 2HYGD 3FXUA 3GXOA 3I0TA 5DCFA 2QBYB 1SMYF 1FY7A 1C0WA 5IT9Z 5CLSA 3WE3A 3IKVA 3E3VA 3MZYA 1Z6RA 3GUDA 4Y13A 2L4MA 5KK1A 4M9XA 4IRHA 1KU2A 5DD4A 3F3XA 4I01A 3DQVC 4EM0B 1WRJA 4R79A 1MGTA 5F64A 3R61A 2Z9OA 2D1VA 2J5PA 4Q4ZF 1FP1D 1JGSA 4F7ZA 3E5XA 3C1DA 3K2ZA 3M7GA 4G6QA 4U0WA 3L09A 2JT1A 3ZMVA 2BGCA 2MH2A 1LJ9A 4EJWA 2VN2A 4AIKA 1XSVA 5DDGA 3KE2A 3KCCA 2HOEA 3W6KB 5HDGA 5EEGA 1B6AA 1I1SA 3V7SA 5HS8A 2NYXA 4LLLA 2YU3A 4PZJA 1Z7UA 5ICEA 2Y75A 1HW1A 2GA1A 1XSDA 3J80Z 1CGPA 1SAXA 2HS5A 4HV6A 4EVIA 2ZXJA 1FSHA 3WTSC 2K7LA 3TDUC 4GO1A 5A2QK 3ZMUA 3BY6A 2KJBA 4LK1F 1X3UA 3GFMA 1FSEA 3LA2A 2PMUA 4M72A 4ZYHA 4A2UA 5HOOA 4BNCA 2FBIA 3IWFA 5K5QA 1P92A 4DQ2A 4HW0A 3CDHA 5HS9A 1ZGAA 4YFKF 4NHJA 2Z3YA 1P4AA 2IA2A 5LRSA 4RB0A 1FX7A 2COMA 4EJVA 1K7AA 5IT9K 3OOPA 3CJNA 1PDNC 5IT3A 1I5ZA 2NNYA 2GXGA 5HS7A 2VT3A 1XGNA 3MZHA 1J2XA 3RKYA 2V1XA 1S7OA 3E6CC 1YLFA 4EM2A 2IJLA 5BOXA 1ZG1A 2G7UA 5E18F 4M6XA 4KMUX 1V3FA 1R58A 1YO5C 2CW0F 4HZFA 3HHHA 1T6SA 2J5OA 2QENA 2FSWA 2W25A 3SHFA 1DPUA 3CUOA 1SD7A 4LGWA 5J8FA 2K02A 4ENNA 1D8JA 2EFPA 2DK8A 1J5YA 3QOPA 3I58A 4YFXF 3M8FA 5AIQA 1H9GA 2JPBA 2OAZA 2OZUA 4KYWA 1YIOA 1MZBA 4PGHA 1GXQA 2IT0A 2PLYA 3ZMDA 3GO5A 3ULQB 1JHFA 3J80K 1FZPB 3FMSA 2F5FA 5AIPA 2NAZA 4HOBA 5ILVA 2HTSA 1R1VA 2VBYA 5K5RA 4ASNA 1U3EM 3HIFA 1ULYA 3D0SA 2ISYA 4OIOF 2XASA 3Q9VA 4AIJA 1LDJA 2EV0A 2VODA 4B8XA 1FLIA 1AOYA 1FP2A 1H0MA 4N9IA 2KIMA 1TQIA 1TQMA 5LEJA 5DUIA 2HFHA 1HW5A 1J0RA 5E1XA 3L00A 2D45A 5ILUA 4I09A 1XGMA 2XUBA 4AIHA 1XB4A 2LDUA 4A12A 1U6GA 2CQKA 1ZRCA 2HEOA 2GQQA 4A6DA 2DQRA 4YIIA 2XRNA 4RAZA 1YTYA 4KIBA 2YX4A 2DU9A 1Z91A 1BJAA 1TQPA 3QAHA 1BI0A 2Y48A 2KKOA 3JTHA 3JSOA 5JHUA 2EA4A 2QQAA 4HDVA 4CGZA 4O6JA 1DDNA 5F1RA 2EWNA 4ESBA 2M45A 1YW7A 3F8BA 4BHCA 1R36A 4IJAA 1ONVA 3C18A 1DUXC 4GYGA 2UXXA 4KIFA 2A07F 3N97A 3E6MA 1TNSA 2O03A 5LBQA 1YW9A 1SMTA 4JBAA 2GXBA 2ZO4A 3M1EA 2XV4S 5ED4A 2A61A 2LNBA 4LLNA 2R7FA 1W5SA 5JVTA 1O3RA 2ISZA 5DYMA 3AAFA 1WQ2A 2Q2EA 5ILSA 4BQAA 2JSCA 4I02A 4LMYA 5HLGA 1TNTA 1G3WA 1ZHFA 1OYYA 1UHMA 4L5JA 4WX9A 2PBIA 3TDZC 3R0JA 3HSFA 3ZMSA 1WI9A 2DI3A 2DTRA 2V1UA 2FNAA 1ZGJA 2YR2A 1YS7A 1I27A 3DFGA 1P2FA 2X0LA 3IHUA 4L9NA 4KDPA 4KT5C 4UNOA 4JQFA 3RPUA 2A69F 3KZZA 5D8LB 2X4HA 4KA4A 1LEAA 2P8TA 3VB2A 2FEZA 5ICCA 5DEQA 4EMSA 1R5GA 3HYIA 1RNLA 3VFZA 3C3WA 3U2RA 2O6GE 1FWZA 1LDDA 4UUVA 2K4BA 2PFBA 2GAUA 3VEPA 1R23A 3BROA 1OKRA 1XDSA 4GXOA 2DBBA 3E6DA 4LK0F 1B1BA 2XAHA 4UV9A 1BI3A 2F5DA 4LB6B 4Y15A 2Z5UA 4KN4X 1XCBA 2MH9A 2H09A 1CF7B 3BJOA 4UVCA 4EGZA 3T0YA 1MKMA 2IP2A 3WTWC 1IAWA 2A68F 1O57A 2E1NA 2VE9A 4LD5A 1P6RA 5DD8A 3R4KA 1XGSA 3COAC 3ECHA 4I0AA 5D6FA 3I64A 3E6BA 3R6SA 4L9TA 2HWVA 3KP4A 2W24A 3LAJA 2Q8KA 1MJ9A 2QM3A 2XGXA 1KU7A 5CVJA 2VC1A 2ZFWA 4OIRF 2RKHA 3KEOA 2XAFA 4A5MA 1ZH5A 1ODDA 3BDDA 4MTDA 4HA8A 5FD5A 4WF2A 1KGSA 1BC7C 3ECOA 3T1BA 2EJRA 2JZYA 1G4DA 2IPQX 3G3ZA 1ZRFA 1W7PB 2RVCA 5BMZA 3LQQA 2LF7A 3I59A 1QZZA 2MLKA 5BPIA 2MLGA 3GZ5A 4OMZA 4ZH4F 4WXDA 4M73A 3IWZA 2P4WA 2AXLA 3LA7A 2HGCA 3JTGA 2IW5A 1SD5A 2QVOA 3REOA 1U2WA 2EFOA 4M71A 3GVAA 2ZCWA 3IKTA 4CDGA 3ZQ7A 2MC3A 4XSXF 2YPRA 3MWMA 1R1UA 4KICA 5FFZA 4OINF 4L5IA 2L3DA 2EA2A 5DCMA 1ZREA 3CUQA 4U0YA 1OYIA 4OIPF 1W7PD 4DNCA 3QPTA 3GEZA 2PI0A 4A0YA 1S29A 2V6CA 2ZJ2A 3GYHX 4G7HF 2Z33A 4H0EA 1KYWA 3LFKA 2XAQA 2D2WA 3K69A 3V8JA 4ETSA 1U8RA 1U5TA 3LQRA 4P96A 4HQMA 5L3BA 1HXDA 2DQLA 3TQNA 2VXZA 4RB2C 3B02A 1RI7A 4D0PA 3NRVA 3ZN0A 5E20A 2WWYA 5LLQA 3MQ0A 1TTYA 3CTAA 3DPLC 1GXPA 5FO5A 1Z05A 3BJ6A 1WKMA 2PG4A 1S6LA 4Y17A 3LSTA 3WTVC 1HQCA 3U9GA 2FOKA 1GVJA 2EV6A 5AONA 1B4AA 1YFHA 5H6RA 5LHIA 1TBXA 1G3YA 3HRUA 2FQ3A 1Z9CA 1K79A 2BYVE 1YG2A 3JW4A 1R22A 5CVRA 1IW7F 5F6FA 3S2WA 2L01A 5H20A 3WE2A 2P7CB 3FMRA 3HRMA 3DP7A 4M74A 1R5HA 4R8HA 3KETA 3F8CA 4LFUA 4Q5SF 1KA8A 1O3SA 3P9IA 2NRAC 5HDNA 4XSZF 1YW8A 5K1YA 3KLNA 5CJ9A 5D5XB 4ZZDA 4KIGA 1S7AA 1O7LA 1BM9A 4CICA 2AS5F 3MEXA 3TGNA 3PQKA 2RNJA 5FLXZ 1W5TA 2KIFA 3PQJA 3ROUA 2DLLA 4KUMA 2H27A 2STWA 1HSJA 2FBKA 3ZN1A 3GFIA 2RGVA 4HX7A 1FBQA 3LWFA 1ZLJA 3GLXA 3GW2A 5HLIA 4EJUA 5D5UB 2HQNA 1XSXA 3CO7C 2XKOA 3FX3A 2RN7A 4CHUA 4QLCU 1IXSB 4L9VA 2E7XA 2H94A 4G8XA 4G9YA 2EK5A 3RI4A 3E97A 4RGUA 2QQBA 1U5TC 4Z2YA 1ZG3A 1ZAOA 2XAJA 3QRFF 1UB9A 4CXFA 4FX4A 1OPCA 4FX0A 2OD5A 1ZN2A 4IVNA 1A04A 2XHKA 2O61A 4HLYA 3C7JA 3I5UA 3ABUA 3F6OA 2ZMEA 3KP2A 3GX4X 3BP8A 1IXCA 3K1PA 1TW2A 3Q5FA 2PQ8A 4I0BA 3WU1B 3HRSA 3BWGA 2ESHA 4Q48A 3BPVA 3P9KA 5HLHA 4L0YB 5L3DA 5J6XA 4GYIA 2A6EF 3ELKA 1IZ1A 2XKPA 3NQOA 4A6EA 2UXNA 4G94A 2P5LC 3WTZA 1PP8F 5LHHA 2P7VB 2M30A 2ESNA 1G3SA 2OU2A 4YG2F 4ZYEA 2DPDA 4EJOA 5E1WA 2VE8A 2VOOA 3R0AA 4ZZLA 3DXJF 4AD9A 5FLXK 1XDUA 1EH7A 4LG0A 3ZMZA 2UWMA 4G7ZF 2M1BA 4PGGA 3I4PA 3WTXC 2C6YA 2DO7A 4IRIA 2ETHA 1HKTA 2F2EA 2F5EA 4HV5A 1MDMA 2ZNZA 3FM5A 1RUOA 2QUFA 1QGPA 3RYPA 1J7KA 4PDKA 4P9UA 4LJZF 2KIUA 5JFRA 1NHAA 4OU0A 3KEQA 3ZPLA 2VONA 3T8RA 2DT5A 5FFXA 1LB2A 4G6DA 4ESFA 1IN5A 2UZKA 1XGOA 5D5VB 1XMKA 1ZLKA 3FM3A 1YYVA 3F6VA 3BOQA 1S3JA 1QQIA 1XD7A 4IHTA 1J75A 1BI1A 2JRTA 1QBJA 2RV8A 3O6BB 4I7HA 1SFUA 4JK1X 1QO0D 1HW2A 4P9FA 4ESJA 4MTEA 3T8TA 4I98B 1IXRC 1P4XA 1Q1HA 2EV5A 3H92A 4L0ZB 3KLOA 2LKPA 2PEXA 4HF2A 4U7BA 2QBYA 5CVVA 2YX7A 4CO8A 2OQRA 1FYMA 3LA3A 3FMQA 5KVRA 3M9AA 2XVCA 2NNNA 5E8GA 1TW3A 2FA5A 4RB1A 3K9TA 3TOAA 3FXQA 2NS0A 2YSRA 4FT8A 2L02A 1T38A 2Y0MA 4RGXA 4IRGA 2WC2A 2VBZA 2FMYA 1UCRA 5L3FA 2G7HA 3FF5A 3ABTA 5LGTA 3QP6A 4I2OA 2L4AA 3J7AO 1HKSA 2XAGA 2FXAA 1B9NA 3SXYA 3BZ6A 4A0XA 2ELHA 4TV7A 5BQTA 4EGYA 1T39A 2VBWA 2VC0A 2OZ6A 3TKYA 2W84A 5HDKA 4HF0A 2MA3A 3RYRA 2V1DA 3F22A 5D5WB 3PFIA 1KU3A 2O3FA 3E5QA 1STZA 3EYYA 1J59A 1IRFA 3QPHA 4KNYA 3W6JB 1ZARA 3VODA 1IRGA 1UFMA 2ZKZA 3KP3A 3FZVA 3GZ6A 2R7DA 3DEUA 2H6CA 3EUHA 3WGIA 2GZWA 3SZTA 3QU6A 1QNTA 3CLOA 4MEYF 1EV7A 4AVPA 5LGNA 1ZYRF 2K4JA 4UXNA 1BOAA 3JSPA 2TDXA 5D8KB 4MHGA 2EFNA 2OA4A 5JI6A 2DPUA 1FPQA 2QZ8A 5K5OA 3LAPA 5LHGA 2LSOA 1BIAA 2HKXA 2FE3A 2CWEA 2CFXA 3IC7A 1IF1A 2VT2A 2P5VA 3V4GA 4O3MA 3QP5A 1JHHA 1B59A 1P4WA 4IXAA 3RIRA 2G9WA 6PAXA 4EQQA 3T5XA 1FBUA 5E8IA 1FOKA 4AWXB 1HSTA 4YFNF 1LVAA 2ADUA 4B09A 1K78B 3CO6C 2IVMA 4RGRA 4OMYA 4WK8F 1XN7A 2HKOA 4M6YA 4XRFA 3WTYC 3H3UA 4CZZA 1U78A 1B9MA 3RJPA 3RKXA 4P5OA 5L3EA 1SFXA 4GCVA 1W4MA 1OMIA 3TO6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AWC A;  4OIQ F;  4WXH A;  3ZP5 A;  3WTU C;  3I54 A;  5DUK A;  2A3S A;  1E17 A;  3WOD F;  4Q47 A;  2QLZ A;  5FGM A;  3BPX A;  1S8N A;  1MJA A;  4CYD A;  4RB3 C;  1L3L A;  4ENM A;  2KJC A;  1K6O A;  1BBY A;  3ML6 A;  1OR7 A;  3D5L A;  1EH8 A;  3EQL F;  3MCZ A;  2IRF G;  4E70 A;  1YS6 A;  1FYK A;  1H9T A;  3L9F A;  4KN7 X;  3I59 B;  4S04 A;  3KP5 A;  3SQN A;  2Z99 A;  1D3Y A;  3ERE D;  1J9I A;  1F9N A;  5LRR A;  1Z1D A;  1D5V A;  4NB5 A;  1LNW A;  3I53 A;  2ZBK A;  3DF8 A;  3V7R A;  3HUG A;  3O2P E;  1LQ1 A;  2W85 A;  4ZYG A;  3NEU A;  5LEK A;  2L54 A;  3FWE A;  3IRR A;  1BI2 A;  4FHT A;  1PUE E;  2HTJ A;  4HBL A;  5BPD A;  4GGG A;  3JAM Z;  4KMF A;  4R1H A;  2CG4 A;  2O0Y A;  2HR3 A;  4PCQ A;  2QQ9 A;  2IA0 A;  4U0V A;  2FNP A;  1YQA A;  5DCM B;  3CUQ B;  1KYZ A;  3I71 A;  5L3C A;  2CSO A;  4BHP A;  1TLH B;  2ZNY A;  5D6E A;  4MQ9 F;  3F23 A;  1I1G A;  3KFW X;  3Q9S A;  2DK5 A;  3G73 A;  1LDK B;  2H6B A;  3FHZ A;  3J81 Z;  3CUQ C;  4WWC A;  2R3S A;  1WWX A;  3WU0 A;  3DV8 A;  4L18 B;  1WSU A;  3P9C A;  5CYV A;  1O3Q A;  2FBH A;  1DPR A;  2Q0O A;  1U5T B;  1FC3 A;  2RQP A;  4BHB A;  2LF8 A;  1ON2 A;  4U7D A;  2GA2 A;  2A6H F;  3V8K A;  3BJA A;  1I6X A;  2K86 A;  1FYL A;  3EDP A;  2M87 A;  3TO7 A;  2E7W A;  3RTR A;  4ENK A;  4HDU A;  1XMA A;  4HX4 A;  1BIB A;  4S05 A;  4XLP F;  4BAY A;  1GHC A;  4YIF A;  4A0Z A;  1FT9 A;  4MGR A;  2MD5 A;  2F5C A;  3F21 A;  3HHG A;  3MFK A;  4KFC A;  2PMH A;  5DV5 A;  3ISP A;  3FXR A;  1IN7 A;  2M5W A;  2P6S A;  1F1Z A;  2CYY A;  2FML A;  2P5K A;  1ON1 A;  1IN8 A;  1MJB A;  3WG9 A;  3IL2 A;  2DAO A;  3KP6 A;  4N0B A;  3SFZ A;  3RPQ A;  2DFI A;  5L3G A;  2HYF A;  3EYI A;  2QWW A;  1USS A;  2WV0 A;  3F8M A;  2BE5 F;  2K27 A;  3RDI A;  2P6T A;  1QPM A;  2JTV A;  1SD6 A;  2EB7 A;  5H6Q A;  2DW4 A;  2WTE A;  3JAM K;  2M8E A;  5ICG A;  1RIO H;  4IHS A;  1VTN C;  2OBP A;  3N4M A;  4LB5 A;  5CVI A;  4XBF A;  3HOT A;  1E2X A;  3VOE A;  5D4S A;  4L9J A;  1FBS A;  3K1N A;  2EFW A;  1IUY A;  2JPC A;  1SD4 A;  3SZP A;  5D4R A;  3HSE A;  3GWZ A;  3MAJ A;  4OOI A;  2FF4 A;  4UHT A;  3WTT C;  1EH6 A;  4IF4 A;  1T0F A;  2BBY A;  1CF7 A;  4UVB A;  1IN4 A;  2PN6 A;  4EM1 A;  1LEB A;  3J81 K;  3KZY A;  4HYE A;  4MEX F;  3TOB A;  4G7O F;  2BEO A;  1L0O C;  2HZT A;  4U88 A;  2KRF A;  3M8E A;  4M9S A;  3WGG A;  1KQ8 A;  3ZMT A;  1R00 A;  4ZYD A;  5BS6 A;  3HSR A;  3RKW A;  1REP C;  2O8X A;  3OV8 A;  4HLX A;  2IA1 A;  2V79 A;  4O5V A;  3L7W A;  1Y0U A;  2MBF A;  3F8N A;  1IN6 A;  1F4K A;  1D8K A;  2XRO A;  4UV8 A;  3TO9 A;  1O7F A;  3K1M A;  3E5U A;  2V9V A;  5E1Z B;  3HTS B;  1JXS A;  2ZME B;  4MNU A;  1XCV A;  1SFE A;  5HVQ C;  1FNN A;  5J8C A;  4EV0 A;  4ON0 A;  3F8F A;  4IPA A;  4RGS A;  1UST A;  2RDP A;  5CVU A;  4EJT A;  3HRT A;  4MQV A;  5E17 F;  1W7P A;  3GFJ A;  4BXU A;  5LGU A;  1HKQ A;  2W57 A;  1HBX G;  4RAY A;  5TJJ A;  2CGP A;  5ERI A;  3HTU A;  1KQ0 A;  3V8L A;  4HQE A;  3GFL A;  1UHW A;  1G3T A;  5JR3 A;  1O3T A;  2VBX A;  2A5Y B;  3DPT A;  4ENJ A;  2GIV A;  4BYY A;  3QU3 A;  4HF1 A;  2ACJ A;  3K0L A;  2HQR A;  3P7N A;  5EEH A;  3GF2 A;  3H3Z A;  2STT A;  1BC8 C;  4LG0 B;  4QWQ A;  1KQ9 A;  1RUN A;  4A5N A;  2XIG A;  4NQW A;  5FB2 A;  3B73 A;  3WGH A;  1ZRD A;  1MDM B;  3R60 A;  4HAM A;  2FRH A;  2QYO A;  1QZY A;  1G6N A;  1ZG5 A;  1K78 A;  2CO5 A;  4BH9 A;  1T98 A;  1KU9 A;  4WXC A;  3KP7 A;  3HOS A;  4UVA A;  2E1C A;  1DP7 P;  2RC4 A;  1PP7 U;  3O3K A;  3DKW A;  2PJP A;  2BV6 A;  1RZ4 A;  1MD0 A;  2GWR A;  1BN5 A;  1V4R A;  2VOP A;  4M9Z A;  4LLG F;  4WCG A;  3IRQ A;  3V7C A;  2OQG A;  2HDC A;  1F5T A;  5FD6 A;  1Z6T A;  1R1T A;  3F72 A;  3U1D A;  2FU4 A;  3EET A;  2EFQ A;  3L2C A;  5A2Q Z;  4K2E A;  1JE8 A;  2B0L A;  5TRD A;  4RS8 A;  5ICF A;  1OYW A;  4N9H A;  1R7J A;  2D1H A;  1T2K A;  4XLN F;  4P55 A;  4HX8 A;  2HYG D;  3FXU A;  3GXO A;  3I0T A;  5DCF A;  2QBY B;  1SMY F;  1FY7 A;  1C0W A;  5IT9 Z;  5CLS A;  3WE3 A;  3IKV A;  3E3V A;  3MZY A;  1Z6R A;  3GUD A;  4Y13 A;  2L4M A;  5KK1 A;  4M9X A;  4IRH A;  1KU2 A;  5DD4 A;  3F3X A;  4I01 A;  3DQV C;  4EM0 B;  1WRJ A;  4R79 A;  1MGT A;  5F64 A;  3R61 A;  2Z9O A;  2D1V A;  2J5P A;  4Q4Z F;  1FP1 D;  1JGS A;  4F7Z A;  3E5X A;  3C1D A;  3K2Z A;  3M7G A;  4G6Q A;  4U0W A;  3L09 A;  2JT1 A;  3ZMV A;  2BGC A;  2MH2 A;  1LJ9 A;  4EJW A;  2VN2 A;  4AIK A;  1XSV A;  5DDG A;  3KE2 A;  3KCC A;  2HOE A;  3W6K B;  5HDG A;  5EEG A;  1B6A A;  1I1S A;  3V7S A;  5HS8 A;  2NYX A;  4LLL A;  2YU3 A;  4PZJ A;  1Z7U A;  5ICE A;  2Y75 A;  1HW1 A;  2GA1 A;  1XSD A;  3J80 Z;  1CGP A;  1SAX A;  2HS5 A;  4HV6 A;  4EVI A;  2ZXJ A;  1FSH A;  3WTS C;  2K7L A;  3TDU C;  4GO1 A;  5A2Q K;  3ZMU A;  3BY6 A;  2KJB A;  4LK1 F;  1X3U A;  3GFM A;  1FSE A;  3LA2 A;  2PMU A;  4M72 A;  4ZYH A;  4A2U A;  5HOO A;  4BNC A;  2FBI A;  3IWF A;  5K5Q A;  1P92 A;  4DQ2 A;  4HW0 A;  3CDH A;  5HS9 A;  1ZGA A;  4YFK F;  4NHJ A;  2Z3Y A;  1P4A A;  2IA2 A;  5LRS A;  4RB0 A;  1FX7 A;  2COM A;  4EJV A;  1K7A A;  5IT9 K;  3OOP A;  3CJN A;  1PDN C;  5IT3 A;  1I5Z A;  2NNY A;  2GXG A;  5HS7 A;  2VT3 A;  1XGN A;  3MZH A;  1J2X A;  3RKY A;  2V1X A;  1S7O A;  3E6C C;  1YLF A;  4EM2 A;  2IJL A;  5BOX A;  1ZG1 A;  2G7U A;  5E18 F;  4M6X A;  4KMU X;  1V3F A;  1R58 A;  1YO5 C;  2CW0 F;  4HZF A;  3HHH A;  1T6S A;  2J5O A;  2QEN A;  2FSW A;  2W25 A;  3SHF A;  1DPU A;  3CUO A;  1SD7 A;  4LGW A;  5J8F A;  2K02 A;  4ENN A;  1D8J A;  2EFP A;  2DK8 A;  1J5Y A;  3QOP A;  3I58 A;  4YFX F;  3M8F A;  5AIQ A;  1H9G A;  2JPB A;  2OAZ A;  2OZU A;  4KYW A;  1YIO A;  1MZB A;  4PGH A;  1GXQ A;  2IT0 A;  2PLY A;  3ZMD A;  3GO5 A;  3ULQ B;  1JHF A;  3J80 K;  1FZP B;  3FMS A;  2F5F A;  5AIP A;  2NAZ A;  4HOB A;  5ILV A;  2HTS A;  1R1V A;  2VBY A;  5K5R A;  4ASN A;  1U3E M;  3HIF A;  1ULY A;  3D0S A;  2ISY A;  4OIO F;  2XAS A;  3Q9V A;  4AIJ A;  1LDJ A;  2EV0 A;  2VOD A;  4B8X A;  1FLI A;  1AOY A;  1FP2 A;  1H0M A;  4N9I A;  2KIM A;  1TQI A;  1TQM A;  5LEJ A;  5DUI A;  2HFH A;  1HW5 A;  1J0R A;  5E1X A;  3L00 A;  2D45 A;  5ILU A;  4I09 A;  1XGM A;  2XUB A;  4AIH A;  1XB4 A;  2LDU A;  4A12 A;  1U6G A;  2CQK A;  1ZRC A;  2HEO A;  2GQQ A;  4A6D A;  2DQR A;  4YII A;  2XRN A;  4RAZ A;  1YTY A;  4KIB A;  2YX4 A;  2DU9 A;  1Z91 A;  1BJA A;  1TQP A;  3QAH A;  1BI0 A;  2Y48 A;  2KKO A;  3JTH A;  3JSO A;  5JHU A;  2EA4 A;  2QQA A;  4HDV A;  4CGZ A;  4O6J A;  1DDN A;  5F1R A;  2EWN A;  4ESB A;  2M45 A;  1YW7 A;  3F8B A;  4BHC A;  1R36 A;  4IJA A;  1ONV A;  3C18 A;  1DUX C;  4GYG A;  2UXX A;  4KIF A;  2A07 F;  3N97 A;  3E6M A;  1TNS A;  2O03 A;  5LBQ A;  1YW9 A;  1SMT A;  4JBA A;  2GXB A;  2ZO4 A;  3M1E A;  2XV4 S;  5ED4 A;  2A61 A;  2LNB A;  4LLN A;  2R7F A;  1W5S A;  5JVT A;  1O3R A;  2ISZ A;  5DYM A;  3AAF A;  1WQ2 A;  2Q2E A;  5ILS A;  4BQA A;  2JSC A;  4I02 A;  4LMY A;  5HLG A;  1TNT A;  1G3W A;  1ZHF A;  1OYY A;  1UHM A;  4L5J A;  4WX9 A;  2PBI A;  3TDZ C;  3R0J A;  3HSF A;  3ZMS A;  1WI9 A;  2DI3 A;  2DTR A;  2V1U A;  2FNA A;  1ZGJ A;  2YR2 A;  1YS7 A;  1I27 A;  3DFG A;  1P2F A;  2X0L A;  3IHU A;  4L9N A;  4KDP A;  4KT5 C;  4UNO A;  4JQF A;  3RPU A;  2A69 F;  3KZZ A;  5D8L B;  2X4H A;  4KA4 A;  1LEA A;  2P8T A;  3VB2 A;  2FEZ A;  5ICC A;  5DEQ A;  4EMS A;  1R5G A;  3HYI A;  1RNL A;  3VFZ A;  3C3W A;  3U2R A;  2O6G E;  1FWZ A;  1LDD A;  4UUV A;  2K4B A;  2PFB A;  2GAU A;  3VEP A;  1R23 A;  3BRO A;  1OKR A;  1XDS A;  4GXO A;  2DBB A;  3E6D A;  4LK0 F;  1B1B A;  2XAH A;  4UV9 A;  1BI3 A;  2F5D A;  4LB6 B;  4Y15 A;  2Z5U A;  4KN4 X;  1XCB A;  2MH9 A;  2H09 A;  1CF7 B;  3BJO A;  4UVC A;  4EGZ A;  3T0Y A;  1MKM A;  2IP2 A;  3WTW C;  1IAW A;  2A68 F;  1O57 A;  2E1N A;  2VE9 A;  4LD5 A;  1P6R A;  5DD8 A;  3R4K A;  1XGS A;  3COA C;  3ECH A;  4I0A A;  5D6F A;  3I64 A;  3E6B A;  3R6S A;  4L9T A;  2HWV A;  3KP4 A;  2W24 A;  3LAJ A;  2Q8K A;  1MJ9 A;  2QM3 A;  2XGX A;  1KU7 A;  5CVJ A;  2VC1 A;  2ZFW A;  4OIR F;  2RKH A;  3KEO A;  2XAF A;  4A5M A;  1ZH5 A;  1ODD A;  3BDD A;  4MTD A;  4HA8 A;  5FD5 A;  4WF2 A;  1KGS A;  1BC7 C;  3ECO A;  3T1B A;  2EJR A;  2JZY A;  1G4D A;  2IPQ X;  3G3Z A;  1ZRF A;  1W7P B;  2RVC A;  5BMZ A;  3LQQ A;  2LF7 A;  3I59 A;  1QZZ A;  2MLK A;  5BPI A;  2MLG A;  3GZ5 A;  4OMZ A;  4ZH4 F;  4WXD A;  4M73 A;  3IWZ A;  2P4W A;  2AXL A;  3LA7 A;  2HGC A;  3JTG A;  2IW5 A;  1SD5 A;  2QVO A;  3REO A;  1U2W A;  2EFO A;  4M71 A;  3GVA A;  2ZCW A;  3IKT A;  4CDG A;  3ZQ7 A;  2MC3 A;  4XSX F;  2YPR A;  3MWM A;  1R1U A;  4KIC A;  5FFZ A;  4OIN F;  4L5I A;  2L3D A;  2EA2 A;  5DCM A;  1ZRE A;  3CUQ A;  4U0Y A;  1OYI A;  4OIP F;  1W7P D;  4DNC A;  3QPT A;  3GEZ A;  2PI0 A;  4A0Y A;  1S29 A;  2V6C A;  2ZJ2 A;  3GYH X;  4G7H F;  2Z33 A;  4H0E A;  1KYW A;  3LFK A;  2XAQ A;  2D2W A;  3K69 A;  3V8J A;  4ETS A;  1U8R A;  1U5T A;  3LQR A;  4P96 A;  4HQM A;  5L3B A;  1HXD A;  2DQL A;  3TQN A;  2VXZ A;  4RB2 C;  3B02 A;  1RI7 A;  4D0P A;  3NRV A;  3ZN0 A;  5E20 A;  2WWY A;  5LLQ A;  3MQ0 A;  1TTY A;  3CTA A;  3DPL C;  1GXP A;  5FO5 A;  1Z05 A;  3BJ6 A;  1WKM A;  2PG4 A;  1S6L A;  4Y17 A;  3LST A;  3WTV C;  1HQC A;  3U9G A;  2FOK A;  1GVJ A;  2EV6 A;  5AON A;  1B4A A;  1YFH A;  5H6R A;  5LHI A;  1TBX A;  1G3Y A;  3HRU A;  2FQ3 A;  1Z9C A;  1K79 A;  2BYV E;  1YG2 A;  3JW4 A;  1R22 A;  5CVR A;  1IW7 F;  5F6F A;  3S2W A;  2L01 A;  5H20 A;  3WE2 A;  2P7C B;  3FMR A;  3HRM A;  3DP7 A;  4M74 A;  1R5H A;  4R8H A;  3KET A;  3F8C A;  4LFU A;  4Q5S F;  1KA8 A;  1O3S A;  3P9I A;  2NRA C;  5HDN A;  4XSZ F;  1YW8 A;  5K1Y A;  3KLN A;  5CJ9 A;  5D5X B;  4ZZD A;  4KIG A;  1S7A A;  1O7L A;  1BM9 A;  4CIC A;  2AS5 F;  3MEX A;  3TGN A;  3PQK A;  2RNJ A;  5FLX Z;  1W5T A;  2KIF A;  3PQJ A;  3ROU A;  2DLL A;  4KUM A;  2H27 A;  2STW A;  1HSJ A;  2FBK A;  3ZN1 A;  3GFI A;  2RGV A;  4HX7 A;  1FBQ A;  3LWF A;  1ZLJ A;  3GLX A;  3GW2 A;  5HLI A;  4EJU A;  5D5U B;  2HQN A;  1XSX A;  3CO7 C;  2XKO A;  3FX3 A;  2RN7 A;  4CHU A;  4QLC U;  1IXS B;  4L9V A;  2E7X A;  2H94 A;  4G8X A;  4G9Y A;  2EK5 A;  3RI4 A;  3E97 A;  4RGU A;  2QQB A;  1U5T C;  4Z2Y A;  1ZG3 A;  1ZAO A;  2XAJ A;  3QRF F;  1UB9 A;  4CXF A;  4FX4 A;  1OPC A;  4FX0 A;  2OD5 A;  1ZN2 A;  4IVN A;  1A04 A;  2XHK A;  2O61 A;  4HLY A;  3C7J A;  3I5U A;  3ABU A;  3F6O A;  2ZME A;  3KP2 A;  3GX4 X;  3BP8 A;  1IXC A;  3K1P A;  1TW2 A;  3Q5F A;  2PQ8 A;  4I0B A;  3WU1 B;  3HRS A;  3BWG A;  2ESH A;  4Q48 A;  3BPV A;  3P9K A;  5HLH A;  4L0Y B;  5L3D A;  5J6X A;  4GYI A;  2A6E F;  3ELK A;  1IZ1 A;  2XKP A;  3NQO A;  4A6E A;  2UXN A;  4G94 A;  2P5L C;  3WTZ A;  1PP8 F;  5LHH A;  2P7V B;  2M30 A;  2ESN A;  1G3S A;  2OU2 A;  4YG2 F;  4ZYE A;  2DPD A;  4EJO A;  5E1W A;  2VE8 A;  2VOO A;  3R0A A;  4ZZL A;  3DXJ F;  4AD9 A;  5FLX K;  1XDU A;  1EH7 A;  4LG0 A;  3ZMZ A;  2UWM A;  4G7Z F;  2M1B A;  4PGG A;  3I4P A;  3WTX C;  2C6Y A;  2DO7 A;  4IRI A;  2ETH A;  1HKT A;  2F2E A;  2F5E A;  4HV5 A;  1MDM A;  2ZNZ A;  3FM5 A;  1RUO A;  2QUF A;  1QGP A;  3RYP A;  1J7K A;  4PDK A;  4P9U A;  4LJZ F;  2KIU A;  5JFR A;  1NHA A;  4OU0 A;  3KEQ A;  3ZPL A;  2VON A;  3T8R A;  2DT5 A;  5FFX A;  1LB2 A;  4G6D A;  4ESF A;  1IN5 A;  2UZK A;  1XGO A;  5D5V B;  1XMK A;  1ZLK A;  3FM3 A;  1YYV A;  3F6V A;  3BOQ A;  1S3J A;  1QQI A;  1XD7 A;  4IHT A;  1J75 A;  1BI1 A;  2JRT A;  1QBJ A;  2RV8 A;  3O6B B;  4I7H A;  1SFU A;  4JK1 X;  1QO0 D;  1HW2 A;  4P9F A;  4ESJ A;  4MTE A;  3T8T A;  4I98 B;  1IXR C;  1P4X A;  1Q1H A;  2EV5 A;  3H92 A;  4L0Z B;  3KLO A;  2LKP A;  2PEX A;  4HF2 A;  4U7B A;  2QBY A;  5CVV A;  2YX7 A;  4CO8 A;  2OQR A;  1FYM A;  3LA3 A;  3FMQ A;  5KVR A;  3M9A A;  2XVC A;  2NNN A;  5E8G A;  1TW3 A;  2FA5 A;  4RB1 A;  3K9T A;  3TOA A;  3FXQ A;  2NS0 A;  2YSR A;  4FT8 A;  2L02 A;  1T38 A;  2Y0M A;  4RGX A;  4IRG A;  2WC2 A;  2VBZ A;  2FMY A;  1UCR A;  5L3F A;  2G7H A;  3FF5 A;  3ABT A;  5LGT A;  3QP6 A;  4I2O A;  2L4A A;  3J7A O;  1HKS A;  2XAG A;  2FXA A;  1B9N A;  3SXY A;  3BZ6 A;  4A0X A;  2ELH A;  4TV7 A;  5BQT A;  4EGY A;  1T39 A;  2VBW A;  2VC0 A;  2OZ6 A;  3TKY A;  2W84 A;  5HDK A;  4HF0 A;  2MA3 A;  3RYR A;  2V1D A;  3F22 A;  5D5W B;  3PFI A;  1KU3 A;  2O3F A;  3E5Q A;  1STZ A;  3EYY A;  1J59 A;  1IRF A;  3QPH A;  4KNY A;  3W6J B;  1ZAR A;  3VOD A;  1IRG A;  1UFM A;  2ZKZ A;  3KP3 A;  3FZV A;  3GZ6 A;  2R7D A;  3DEU A;  2H6C A;  3EUH A;  3WGI A;  2GZW A;  3SZT A;  3QU6 A;  1QNT A;  3CLO A;  4MEY F;  1EV7 A;  4AVP A;  5LGN A;  1ZYR F;  2K4J A;  4UXN A;  1BOA A;  3JSP A;  2TDX A;  5D8K B;  4MHG A;  2EFN A;  2OA4 A;  5JI6 A;  2DPU A;  1FPQ A;  2QZ8 A;  5K5O A;  3LAP A;  5LHG A;  2LSO A;  1BIA A;  2HKX A;  2FE3 A;  2CWE A;  2CFX A;  3IC7 A;  1IF1 A;  2VT2 A;  2P5V A;  3V4G A;  4O3M A;  3QP5 A;  1JHH A;  1B59 A;  1P4W A;  4IXA A;  3RIR A;  2G9W A;  6PAX A;  4EQQ A;  3T5X A;  1FBU A;  5E8I A;  1FOK A;  4AWX B;  1HST A;  4YFN F;  1LVA A;  2ADU A;  4B09 A;  1K78 B;  3CO6 C;  2IVM A;  4RGR A;  4OMY A;  4WK8 F;  1XN7 A;  2HKO A;  4M6Y A;  4XRF A;  3WTY C;  3H3U A;  4CZZ A;  1U78 A;  1B9M A;  3RJP A;  3RKX A;  4P5O A;  5L3E A;  1SFX A;  4GCV A;  1W4M A;  1OMI A;  3TO6 A; 
#chains in the Genus database with same CATH topology
 1AWC A;  1WJE A;  1QHG A;  4OIQ F;  3F0C A;  4WXH A;  2FX0 A;  3ZP5 A;  3WTU C;  4BUP A;  3I54 A;  2RQQ A;  3H35 A;  5DUK A;  1Z77 A;  1D0Y A;  2A3S A;  5F0C A;  2X85 A;  2M34 A;  4XNF A;  1V5E A;  1E17 A;  1FTT A;  3WOD F;  3S1Q J;  2X1C A;  1WZ2 A;  4Q47 A;  2QLZ A;  5FGM A;  3BPX A;  4J01 A;  1S8N A;  1MJA A;  3DU5 A;  4CYD A;  2ZSI B;  4RB3 C;  2HOA A;  3E0J B;  4B1R A;  4RAG A;  1L3L A;  4ENM A;  1WHU A;  2KJC A;  1K6O A;  2DMN A;  1BBY A;  3ML6 A;  2XSD C;  1OR7 A;  3FKI J;  4CH7 A;  3D5L A;  1MNE A;  1EH8 A;  3K4K A;  3EQL F;  2RRE A;  3CCR I;  3MCZ A;  3VSL A;  1UJ8 A;  2IRF G;  1WH7 A;  1JT6 A;  4XOT A;  2LG4 A;  1QPI A;  2QF7 A;  3KYD B;  4E70 A;  3FK6 A;  1YS6 A;  3GTQ J;  1VQ7 I;  1FYK A;  1H9T A;  1QVT A;  3L9F A;  4KN7 X;  3GTP J;  4B3X A;  4D9J A;  3I59 B;  1YJ9 I;  2HNH A;  1I50 J;  4S04 A;  4J19 A;  1TZL A;  1X2M A;  3KP5 A;  3SQN A;  1UG0 A;  2Z99 A;  1IO2 A;  1D3Y A;  2W1O A;  3ERE D;  1J9I A;  1YE9 A;  1F9N A;  1I3Q J;  5LRR A;  1Z1D A;  3G1M A;  3BCA A;  3S1R J;  5IP6 A;  1YJN I;  1BL0 A;  1D5V A;  4NB5 A;  3CCV I;  3BG5 A;  1LNW A;  2AXT C;  4MFE A;  3I53 A;  3S1N J;  4BJT A;  1S5L C;  2ZBK A;  3G6E I;  1UAA A;  2HVR A;  3DF8 A;  3DTK A;  4F92 B;  3V7R A;  1HF0 A;  3HUG A;  1JKR C;  1RES A;  3O2P E;  2EZL A;  1M1E B;  4CA0 A;  2DDA A;  1LQ1 A;  2W85 A;  4ZYG A;  1U0J A;  3NEU A;  3B6A A;  5LEK A;  3DTE A;  4NC7 A;  2L54 A;  3FWE A;  5C4J J;  1IV8 A;  4XN0 A;  3IRR A;  1BI2 A;  1TL8 A;  4FHT A;  1PUE E;  2HTJ A;  3ZR8 X;  4HBL A;  2VJI A;  4YRV A;  5BPD A;  3VYU B;  1Y1V J;  2LY2 A;  3ASO H;  4GGG A;  1YRN B;  2VJJ A;  3JAM Z;  4KMF A;  1T8I A;  4BDY A;  2CV0 A;  4R1H A;  5J4V A;  2CG4 A;  2O0Y A;  1POG A;  4LIV A;  1WCM J;  2HR3 A;  2O5R A;  4UY8 I;  4PCQ A;  4X6A J;  2QQ9 A;  2IA0 A;  2OTL I;  2OV7 A;  4U0V A;  4XKV A;  2FNP A;  1YQA A;  5DCM B;  3DBR B;  3JRG A;  3CUQ B;  1KYZ A;  3I71 A;  5L3C A;  2CSO A;  5KAF C;  3M8J A;  4BHP A;  1TLH B;  2ZNY A;  5D6E A;  4MQ9 F;  3F23 A;  1QZE A;  1I1G A;  1MSF C;  3GBG A;  1R49 A;  3KFW X;  3LSR A;  3Q9S A;  2DK5 A;  3HPG A;  4D5F A;  3G73 A;  1LDK B;  2Y0S N;  3UR3 C;  3VYT B;  1MBE A;  2H6B A;  3FHZ A;  2X9D A;  3J81 Z;  3CUQ C;  2QSG X;  4WWC A;  2R3S A;  1WWX A;  3HC7 A;  3WU0 A;  3DV8 A;  5EZG A;  3CP2 A;  3JRE A;  1WSU A;  4L18 B;  3P9C A;  5CYV A;  3KYC B;  3LOC A;  4XRM A;  4BGD A;  1O3Q A;  2FBH A;  1DPR A;  2B7E A;  2Q0O A;  1A31 A;  1U5T B;  1FC3 A;  1SVM A;  2RQP A;  4HG2 A;  4BHB A;  2LF8 A;  1ON2 A;  3BG9 A;  4U7D A;  1HDD C;  2GA2 A;  2A6H F;  3OSG A;  2LP0 A;  4XIC A;  3V8K A;  3BJA A;  1I6X A;  2K86 A;  1FYL A;  5GAD J;  3EUA A;  3OS1 A;  4A3G J;  5CQG A;  1HLV A;  3EDP A;  2M7A A;  1FOW A;  2ZSH B;  2NVX J;  3W6V A;  2M87 A;  1GVD A;  4LIT A;  3TO7 A;  2E7W A;  2CU7 A;  1SAN A;  3RTR A;  1MMG A;  3PFY A;  2TRT A;  4ENK A;  3CC7 I;  2LLK A;  4HDU A;  1XMA A;  4HX4 A;  1BIB A;  1EJ9 A;  4S05 A;  3OIO A;  2KRH A;  1ZK8 A;  4XLP F;  4BAY A;  1GHC A;  3RCO A;  4RM3 A;  2M4K A;  4YIF A;  3CME I;  4A0Z A;  4LIU A;  1VND A;  4ZDL A;  1FT9 A;  3HOU J;  3BQY A;  4MGR A;  1JUS A;  2MD5 A;  3TW7 A;  2F5C A;  3F21 A;  3HHG A;  3MFK A;  3FK7 A;  2PMH A;  5IOZ A;  4KFC A;  5DV5 A;  1RET A;  3JRF A;  4KIT B;  3ISP A;  2LY1 A;  1GUU A;  2HVQ A;  3FXR A;  2LVS A;  1A36 A;  1IN7 A;  2M5W A;  2P6S A;  1F1Z A;  2CYY A;  5FKO A;  2FML A;  3CMM A;  4A3E J;  5HNF A;  5B3S H;  2X6W A;  1DQU A;  4ZTF A;  2P5K A;  3H5R A;  5GAE J;  1ON1 A;  1IN8 A;  1MJB A;  3WG9 A;  3IL2 A;  2DAO A;  2X6Y A;  3KP6 A;  4N0B A;  3SFZ A;  3RPQ A;  2R7R A;  3HOX J;  2DFI A;  3GCM A;  5L3G A;  2HYF A;  3EYI A;  2QWW A;  1USS A;  2VKE A;  4RLQ A;  2WV0 A;  3F8M A;  2BE5 F;  2K27 A;  3RDI A;  2P6T A;  1QPM A;  2JTV A;  3MMY B;  1SD6 A;  4I6Z A;  2EB7 A;  3BTC A;  1FMW A;  3ZCO A;  5H6Q A;  2DW4 A;  2WTE A;  5FLM J;  4KIS A;  5K7F A;  3VDX A;  2LC2 A;  3JAM K;  3K4M A;  1SVO A;  2M8E A;  4B48 A;  3GTG J;  2JVH A;  5ICG A;  1RIO H;  1UHS A;  4I99 C;  1MH3 A;  5F0F A;  4IHS A;  2DOA A;  3HDD A;  1VTN C;  5GTI C;  3NAR A;  2OBP A;  4CZC A;  3N4M A;  4LB5 A;  3RZO J;  1TT5 B;  1X1A A;  2KIQ A;  4NBQ A;  5CVI A;  2Y31 A;  3U21 A;  4BDZ A;  3M07 A;  1IC8 A;  5DTD A;  1ETX A;  4XBF A;  3HOT A;  1E2X A;  3VOE A;  3CMY A;  2XDV A;  4XKW A;  5D4S A;  1J09 A;  4L9J A;  3PNV A;  1X2N A;  5GPC A;  1FBS A;  3A4C A;  3K1N A;  4E7I A;  2EFW A;  4XL9 A;  4IX7 A;  1IUY A;  2KZG A;  3BQZ A;  2JPC A;  1SD4 A;  3SZP A;  3ZQG A;  5D4R A;  1BJZ A;  3HSE A;  4E7Z A;  3GWZ A;  3MAJ A;  4OOI A;  2FF4 A;  4UHT A;  1EH6 A;  2ME6 A;  3WTT C;  1XPX A;  4IF4 A;  1T0F A;  2BBY A;  1CF7 A;  4UVB A;  2WB1 N;  1IGN A;  1IN4 A;  2FOW A;  3LSI A;  2PN6 A;  4V2G A;  4EM1 A;  3J81 K;  2DT6 A;  3KZY A;  4HYE A;  1RKW A;  4M6V A;  3JRB A;  4IZZ A;  4MEX F;  3TOB A;  4G7O F;  2BEO A;  5J47 A;  1W36 D;  1L0O C;  2HZT A;  3LMM A;  2IS4 A;  3FKJ A;  3K4J A;  4U88 A;  1Z3X A;  2KRF A;  3M8E A;  4M9S A;  1YJW I;  1MH4 A;  3WGG A;  1VQP I;  2JA6 J;  1V5G A;  2JA2 A;  4M3G A;  1LUJ B;  4A3J J;  1JKO C;  4YEL A;  3ABK H;  1KQ8 A;  2Y9Z A;  2P81 A;  3ZMT A;  2LKS A;  1R00 A;  4IQJ A;  4ZYD A;  3SDB A;  5BS6 A;  2DA2 A;  4IQ4 A;  2VLA A;  5F0H A;  3HSR A;  3RKW A;  1FOX A;  1REP C;  2O8X A;  1MBH A;  3IH3 A;  3OV8 A;  4HLX A;  3BTJ A;  2IA1 A;  1AU7 A;  2LBF B;  5EZH A;  1H8A C;  2R5Z B;  2I5U A;  2V79 A;  2Y9Y A;  1FTZ A;  4O5V A;  3L7W A;  3QQA A;  1U9O A;  3S17 J;  1Y0U A;  2MBF A;  2PJR B;  3PNY A;  4IEJ A;  1ZKG A;  3F8N A;  1HC8 A;  1IN6 A;  1F4K A;  1D8K A;  2I8D A;  5B1A H;  3K4B A;  2XRO A;  3A2K A;  2E60 A;  4A3C J;  4UV8 A;  3TO9 A;  1HCR A;  2LRE A;  3QOE A;  3ZXS A;  1O7F A;  3CC4 I;  3K1M A;  1ZR2 A;  2R5Y A;  3E5U A;  3W3C A;  1Y0N A;  2BY0 A;  2V9V A;  5E1Z B;  3HTS B;  1BW5 A;  3J7Z I;  1JXS A;  2ZME B;  5LD2 C;  2ZXI A;  2BHZ A;  4MNU A;  1XCV A;  1SFE A;  2QSF X;  2HYJ A;  5HVQ C;  1FNN A;  5J8C A;  4EV0 A;  4ON0 A;  3F8F A;  4XQF A;  5CQE A;  3E1S A;  2W4S A;  4IPA A;  4RGS A;  2HZD A;  2IS2 A;  1UST A;  2H1K A;  5IP7 J;  2RDP A;  1APL C;  2GM4 A;  4DZP A;  3QPL A;  5CVU A;  3OYC A;  2F4I A;  1ETW A;  2ZXH A;  2KMU A;  4EJT A;  3HRT A;  3D1N I;  4MQV A;  1P7J A;  4QPO A;  1ZEL A;  5E17 F;  2WAQ N;  1JKQ C;  3PL8 A;  1W7P A;  3GFJ A;  4BXU A;  3HXL A;  2Z16 A;  1HKQ A;  2VB6 A;  2W57 A;  5LGU A;  5GAH J;  1Z21 A;  4BKX A;  3MKZ A;  1HBX G;  4RAY A;  3FXO A;  5TJJ A;  2CGP A;  5ERI A;  4BE1 A;  3HTU A;  1KQ0 A;  3V8L A;  4HQE A;  2LRD A;  4F93 B;  5M5W J;  4XRS A;  2BY2 A;  3GFL A;  1UHW A;  4RDU A;  1G3T A;  2QKL B;  5JR3 A;  1O3T A;  1YHQ I;  2VBX A;  2A5Y B;  1Y1W J;  3DPT A;  4ENJ A;  2GIV A;  4BYY A;  3QU3 A;  2L7Z A;  4QPQ A;  4HF1 A;  2DJI A;  2ACJ A;  3K0L A;  2Y2Z A;  2K9Q A;  1CQT A;  2ZJP F;  2HQR A;  3P7N A;  5EEH A;  5JHF A;  3GTM J;  3GF2 A;  2EZI A;  1QHH D;  3H3Z A;  2HDW A;  2STT A;  1BC8 C;  2EIL H;  2KHM A;  5M5Y J;  3TL4 X;  3H9J A;  1MMD A;  3AG3 H;  5C44 J;  4QWQ A;  1KQ9 A;  2ZXW H;  4LG0 B;  3WHB A;  1LFP A;  3K70 C;  4FAS D;  1X1C A;  4HRI A;  2W48 A;  1RUN A;  1LVK A;  4A5N A;  4JP0 A;  2A5W A;  2XIG A;  4NQW A;  3LFU A;  4DIQ A;  5EG0 B;  2DJN A;  5FB2 A;  3B73 A;  3WGH A;  1ZRD A;  1MDM B;  3R60 A;  1N25 A;  4HAM A;  3AKZ A;  1MSE C;  2FRH A;  2QYO A;  3VPR A;  3CDI A;  1QZY A;  2KRC A;  1RPW A;  1ETV A;  1EKE A;  4BEH A;  1T56 A;  2TCT A;  1G6N A;  2V9P A;  3SEZ A;  3F9K A;  1ZG5 A;  2DOE A;  2HXO A;  2E34 A;  1K78 A;  2CO5 A;  4BH9 A;  1VFC A;  1T98 A;  2XGD A;  1KU9 A;  4YEJ A;  4C2T A;  5FLV A;  4WXC A;  1X58 A;  1R9T J;  1P7I A;  3KP7 A;  3HOS A;  1WJB A;  2WAD A;  4BY7 J;  2Y30 A;  4UVA A;  1RRJ A;  2E1C A;  2CV1 A;  1WPK A;  1W0T A;  1DP7 P;  2DFH A;  2RC4 A;  1PP7 U;  3O3K A;  3DKW A;  1WH5 A;  2KDZ A;  2PJP A;  2BV6 A;  1RZ4 A;  1MD0 A;  2JSP A;  2GWR A;  1D0Z A;  4AYB A;  1BN5 A;  1V4R A;  2EZK A;  2VOP A;  2HQ5 A;  4M9Z A;  4LLG F;  4WCG A;  3IRQ A;  2DYR H;  3V7C A;  1E3H A;  2OQG A;  2K40 A;  2HDC A;  2R7V A;  3V42 A;  3HG9 A;  1F5T A;  2MAB A;  5FD6 A;  1WI3 A;  1Z6T A;  3PIP F;  1R1T A;  1KON A;  3HJE A;  3K7A J;  1TWG J;  2R7W A;  3LSG A;  4GFB A;  3F72 A;  3JR9 A;  3U1D A;  4B43 A;  2FU4 A;  3EET A;  2EFQ A;  3L2C A;  5A2Q Z;  4K2E A;  2JWT A;  5E3M A;  1JE8 A;  2B0L A;  3DKX A;  3OS0 A;  4U87 A;  3IP4 B;  5TRD A;  4RS8 A;  5ICF A;  5KCM A;  3W2V A;  2X6O A;  3I4M J;  3Q3S A;  3KX2 A;  4P1W A;  1OYW A;  4N9H A;  1R7J A;  3I9V 2;  1ZTR A;  3BZC A;  2L7F P;  2M8G X;  2D1H A;  1T2K A;  4XLN F;  4BQN A;  4P55 A;  3L1P A;  1AA7 A;  5J3L A;  4HX8 A;  2HYG D;  3FXU A;  3GXO A;  4A3F J;  2R7S A;  3FBN B;  4FE4 A;  5KAI C;  3I0T A;  5DCF A;  1JKP C;  3B6C A;  2QBY B;  1MIJ A;  4XOP A;  4PJJ A;  4EAT A;  3G1L A;  1SMY F;  1FY7 A;  4A69 C;  1C0W A;  5CLS A;  5IT9 Z;  3WE3 A;  3IKV A;  5FRM A;  3E3V A;  3MZY A;  1Z6R A;  3JRI A;  2JA5 J;  3GUD A;  4Y13 A;  2L4M A;  5KK1 A;  4J00 A;  3MN2 A;  4DGW B;  4M9X A;  1XMX A;  4IRH A;  1KU2 A;  1TC3 C;  3E7L A;  5DD4 A;  1ETQ A;  2MYS A;  2NOJ B;  3F3X A;  1LFB A;  4I01 A;  3DQV C;  4EM0 B;  4Y7N J;  1WRJ A;  4R79 A;  1MGT A;  1E0E A;  3CD6 I;  1O4X A;  3DTI A;  1KZH A;  5F64 A;  3R61 A;  2Z9O A;  2D1V A;  2J5P A;  4EEF G;  4E7J A;  4YIR X;  4C9Y A;  4Q4Z F;  1MBF A;  1FP1 D;  1JGS A;  2VXD A;  4F7Z A;  2LKX A;  3E5X A;  3C1D A;  5DM6 F;  3K2Z A;  3M7G A;  3K10 A;  1XG1 A;  3BR0 A;  4G6Q A;  4U0W A;  3HGY A;  1IV6 A;  1Z3Y A;  3L09 A;  2JT1 A;  3ZMV A;  2BGC A;  2R7U A;  2XB0 X;  1F43 A;  2MH2 A;  3CJQ B;  2DOD A;  4CCL A;  2R7Z J;  1LJ9 A;  4EJW A;  2VN2 A;  2IS1 A;  2ECC A;  3CJT B;  4MIM A;  4AIK A;  1XSV A;  5DDG A;  1GV2 A;  3KE2 A;  3KCC A;  2HOE A;  3MD2 A;  2DXI A;  2UV1 A;  4N4N B;  3W6K B;  5HDG A;  5F27 A;  4E7H A;  2HOS A;  3MKL A;  5EEG A;  1B6A A;  2ICW G;  2B9S A;  3OYJ A;  1I1S A;  1TWC J;  2OF7 A;  2CS3 A;  1VQM I;  3OYG A;  3V7S A;  5HS8 A;  2NYX A;  1VF9 A;  4XLF A;  1U8B A;  4OWR B;  4LLL A;  4BAC A;  5E3N A;  2YU3 A;  4PZJ A;  1A35 A;  1Z7U A;  5ICE A;  2Y75 A;  1HW1 A;  2GA1 A;  1MMA A;  1XSD A;  4PSX A;  3HB9 A;  2HPM A;  3J80 Z;  4PJN A;  1A6Q A;  1SAX A;  2HS5 A;  1CGP A;  3C2G A;  3O8H A;  4HV6 A;  4NDL A;  4B44 A;  2DA5 A;  4EVI A;  5IY5 H;  2ZXJ A;  4QIW N;  1FSH A;  3WTS C;  2K7L A;  3TDU C;  2YS9 A;  4GO1 A;  5A2Q K;  3ZMU A;  3BY6 A;  2KJB A;  3WHC A;  4LK1 F;  1X3U A;  2MD0 A;  3GFM A;  1ERD A;  1FSE A;  4ABZ A;  3LA2 A;  2PMU A;  4M72 A;  4ZYH A;  3OYI A;  2E2J J;  3HKZ A;  1SAU A;  4A2U A;  5HOO A;  4BNC A;  2FBI A;  3EUH C;  3IWF A;  2PMZ N;  5K5Q A;  1RR8 C;  3WG7 H;  1VI0 A;  2CRG A;  4XLC A;  1P92 A;  4BXF A;  5GTH C;  4JYK A;  3CQZ J;  5M3F J;  4DQ2 A;  4HW0 A;  2AQE A;  3CDH A;  5J40 A;  2F4M B;  1JI8 A;  3Q0V A;  5HS9 A;  4IHY A;  3A03 A;  1DGW Y;  1ZGA A;  4YFK F;  4NHJ A;  2Z3Y A;  1P4A A;  2CUE A;  2IA2 A;  5LRS A;  4CCJ A;  3BCB A;  1FX7 A;  4RB0 A;  2COM A;  4EJV A;  1K7A A;  4E4H A;  5IT9 K;  4A3D J;  3OOP A;  3CJN A;  3ZGK A;  1PDN C;  2JA7 J;  5IT3 A;  2E2I J;  1I5Z A;  2NNY A;  2GXG A;  5HS7 A;  2VT3 A;  1XGN A;  3MZH A;  3K4N A;  4CCO A;  1E3O C;  1AKH B;  1J2X A;  2V1N A;  2CW7 A;  3RKY A;  3J7A Y;  3VSK A;  2V1X A;  1Y56 A;  2Y69 H;  1S7O A;  1X3W B;  5GP9 A;  3L2V A;  2E71 A;  3E6C C;  2GIZ A;  2K9N A;  1YLF A;  4EM2 A;  2IJL A;  5BOX A;  2CW8 A;  3G4S I;  1Z7L A;  1ZG1 A;  4H4K C;  5DS9 A;  2G7U A;  4M3B A;  5E18 F;  2KZV A;  2V4J C;  1MBG A;  2KP6 A;  3GTO J;  4M6X A;  1PUF B;  4GRI A;  3AFH A;  4KMU X;  2X1D A;  2EQR A;  1V3F A;  2VIX A;  2BY3 A;  1R58 A;  1YO5 C;  2CW0 F;  3OYL A;  4HZF A;  3HOZ J;  2IGM A;  1K4S A;  1B8I B;  1X3Z B;  3HHH A;  1LE8 A;  1T6S A;  2J5O A;  2MC4 A;  2BVM A;  2QEN A;  3OIP A;  1WGX A;  2FSW A;  3NWT A;  5JLX A;  3S32 A;  3IH2 A;  1JT0 A;  1D1A A;  4LG3 A;  2W25 A;  3SHF A;  3CCJ I;  1DPU A;  3CUO A;  1SD7 A;  4LGW A;  5J8F A;  2K02 A;  4L5E A;  3QWL A;  4XLA A;  2G0E A;  3W2W A;  1VQ5 I;  3GTJ J;  4ENN A;  1SEU A;  2OPT A;  2XGC A;  3TBI A;  1D8J A;  2EFP A;  2W7N A;  5IPA A;  2DK8 A;  1J5Y A;  2HU9 A;  3I58 A;  2IBD A;  3QOP A;  4YFX F;  1K4T A;  1UEL B;  2QCO A;  3M8F A;  5AIQ A;  2VUM J;  1H9G A;  2JPB A;  2OAZ A;  2F6C A;  2X6X A;  3OYK A;  3RSN A;  2OZU A;  4KYW A;  2JQ7 A;  1GLN A;  2P0W A;  4A3B J;  4UB6 C;  1YIO A;  2BHY A;  4ZJZ A;  1V55 H;  5K7Z A;  1MZB A;  1X1P A;  2O7O A;  4FET A;  4PGH A;  3TED A;  3PUF A;  1GXQ A;  4LOC A;  3OMY A;  2F5V A;  2IT0 A;  2PLY A;  5B1B H;  3ZMD A;  1VQL I;  3ZQQ A;  1SFO J;  2A6T A;  4CYC B;  1WJC A;  2EIK H;  1OR7 C;  3M4O J;  2M4G A;  3GO5 A;  3ULQ B;  1JHF A;  3J80 K;  1FZP B;  3FMS A;  3Q0W A;  3H0G J;  2F5F A;  2WBM A;  4DOZ A;  2VJ5 A;  5AIP A;  5IYB J;  2NAZ A;  4HOB A;  1BA5 A;  5ILV A;  2HTS A;  2VKH A;  3DEW A;  5E79 C;  1JJ6 C;  1R1V A;  3X2Q H;  2VBY A;  5K5R A;  2OUM A;  4ASN A;  2K3F A;  5JVG F;  3HIF A;  1U3E M;  1ULY A;  2PJR A;  2FJ1 A;  3D0S A;  3VYS B;  2ISY A;  3HUG B;  4OIO F;  2XAS A;  5CPR B;  3OL3 A;  3Q9V A;  4AIJ A;  1LDJ A;  2EV0 A;  4DZJ A;  2VOD A;  4UUS A;  4B8X A;  1OCO H;  1FLI A;  2NVU B;  2W82 A;  2X51 A;  1FOY A;  3H3V K;  1AOY A;  4GDF A;  1FP2 A;  5EGO A;  1IDY A;  1H0M A;  2O9L A;  4N9I A;  2KIM A;  3BTI A;  1TQI A;  1TQM A;  1MMS A;  5LEJ A;  5DUI A;  3BT9 A;  2HFH A;  1HW5 A;  2GXA A;  1J0R A;  5E1X A;  1DU0 A;  3L00 A;  2D45 A;  3TO6 A;  2CUF A;  2N8G A;  1B72 B;  2LD5 A;  1T33 A;  5ILU A;  4I09 A;  1XGM A;  2XUB A;  4AIH A;  1XB4 A;  2LDU A;  4A12 A;  1U6G A;  2CQK A;  1ZRC A;  2HEO A;  2IGO A;  4N4O B;  2GQQ A;  4FTH A;  4BQQ A;  3JRC A;  4A6D A;  2DQR A;  3IUO A;  5K7H A;  4YII A;  4BBR J;  2XRN A;  2ZFU A;  2XPV A;  3PNT A;  4RAZ A;  1YTY A;  1W5C C;  4KIB A;  2YX4 A;  2DU9 A;  1Z91 A;  3G1O A;  2MG4 A;  1BJA A;  1TQP A;  1R6R A;  2FQ4 A;  3QAH A;  1BI0 A;  3ERM A;  2Y48 A;  2KKO A;  3JTH A;  3JSO A;  2NS7 A;  2VKV A;  4Y52 J;  4E6K G;  5JHU A;  2O8K A;  2EA4 A;  2QQA A;  5HNH A;  1I39 A;  4AID A;  4HNT A;  4A3I J;  4V2F A;  4HDV A;  2VPL A;  2FUG 2;  4O6J A;  1DDN A;  4CGZ A;  5F1R A;  2K9L A;  4NC6 A;  2EWN A;  4ESB A;  4CCM A;  2M45 A;  1YW7 A;  4XM3 A;  3F8B A;  4BHC A;  1R36 A;  2NVY J;  4IJA A;  2M7B A;  1ONV A;  3C18 A;  1DUX C;  2YU9 J;  4GYG A;  3SYT A;  2UXX A;  4KIF A;  1ETY A;  4HNV A;  2A07 F;  2OTJ I;  3N97 A;  3E6M A;  2WAF A;  2DFF A;  1TNS A;  2O03 A;  5LBQ A;  4KT6 A;  3CCQ I;  1YW9 A;  2AO9 A;  1SMT A;  4RLF A;  1UG2 A;  1N78 A;  4PSW A;  4JBA A;  2GXB A;  2ZO4 A;  3M1E A;  2XV4 S;  2VL8 A;  5ED4 A;  2A61 A;  2LNB A;  2IS6 A;  1OCP A;  5EG0 A;  4LLN A;  2R7F A;  2WAE A;  1W5S A;  1HDP A;  3NWS A;  5JVT A;  1O3R A;  5IOY A;  2R7O A;  2JMW A;  2EH3 A;  1R5I D;  3RQI A;  2ISZ A;  5DYM A;  3AAF A;  3A1Y A;  1WQ2 A;  3SDG A;  3DBH B;  2LK2 A;  2Q2E A;  5M3M J;  5ILS A;  4XMY A;  4BQA A;  2JSC A;  4I02 A;  3SFI A;  1JGG A;  1FJL A;  4C2U A;  1X1B A;  4LMY A;  5HLG A;  2VQC A;  1D5Y A;  4XRS G;  1TNT A;  1G3W A;  1D0X A;  1OQY A;  2GBY A;  3D5S C;  4HEA 2;  1ZHF A;  1OYY A;  1UHM A;  2M2E A;  1X19 A;  4L5J A;  4WX9 A;  3S3M A;  1FEX A;  2PBI A;  3TDZ C;  3R0J A;  1N77 A;  3HSF A;  3EPZ A;  3ZMS A;  1WI9 A;  2NVQ J;  2BW3 B;  2DI3 A;  2K5C A;  4IHV A;  4KJZ A;  2DTR A;  2V1U A;  2BY1 A;  2FNA A;  1XX5 A;  1ZGJ A;  1YS7 A;  2YR2 A;  3GLL A;  4XOR A;  4AM3 A;  1VZ0 A;  1I27 A;  3DFG A;  1P2F A;  2X0L A;  3IHU A;  4L9N A;  2LR8 A;  5TGT A;  2DMT A;  2LY9 A;  2KL4 A;  4A3L J;  4JX5 A;  4KDP A;  1VQO I;  2WY7 Q;  2VAS A;  5EYR A;  4DYC A;  4KT5 C;  4NUB A;  4UNO A;  1PJR A;  4JQF A;  3RPU A;  4BJ6 C;  1WJF A;  2ELK A;  2A69 F;  2L9R A;  3KZZ A;  4ZYA A;  2X4H A;  5D8L B;  4CUG A;  1LEA A;  2P8T A;  3OOU A;  3VB2 A;  5EEA A;  4KA4 A;  2FEZ A;  5ICC A;  5DEQ A;  3S3O A;  4A3K J;  4EMS A;  3VYR B;  2Z1D A;  1R5G A;  1NG6 A;  3HYI A;  4II3 A;  1RNL A;  3VFZ A;  2DCE A;  3C3W A;  1NG7 A;  3U2R A;  2O6G E;  1FWZ A;  1LDD A;  2DMQ A;  3DLL F;  4UUV A;  4BXX J;  4QSH A;  3NAU A;  2K4B A;  2PFB A;  5FKM A;  2H1L A;  2GAU A;  3IH4 A;  3VEP A;  5EJC A;  1R23 A;  4BQO A;  3BRO A;  1TT0 A;  3PO3 J;  1OKR A;  5C4X J;  1XDS A;  4GXO A;  1VQ9 I;  1D1B A;  2DBB A;  3E6D A;  4LK0 F;  1B1B A;  2VI6 A;  3ZQL A;  2CV2 A;  2XAH A;  3FDY A;  4UV9 A;  1BI3 A;  2M9H A;  2F5D A;  4LB6 B;  1S72 I;  1WJ5 A;  4Y15 A;  5FKN A;  3HOY J;  4F91 B;  3CCL I;  1DGR M;  2VQG A;  2LMD A;  2Z5U A;  1RKT A;  4KN4 X;  1XCB A;  2MH9 A;  2H09 A;  5FRO A;  1CF7 B;  3BJO A;  4UVC A;  4EGZ A;  3T0Y A;  2CMP A;  3BZK A;  1MKM A;  5BNG A;  1FMV A;  1LPQ A;  2IP2 A;  3WTW C;  1G2H A;  2LYC A;  1IAW A;  3CMA I;  3CCM I;  2H8R A;  2A68 F;  4W97 A;  3H5N A;  3DCF A;  1O57 A;  2E1N A;  2JRM A;  5TIS C;  2VE9 A;  4LD5 A;  3AL0 C;  1XTA A;  1P6R A;  5DD8 A;  3R4K A;  1OCR H;  2QKM B;  1XGS A;  3COA C;  1QA6 A;  1T0F C;  3ECH A;  3DU6 A;  4I0A A;  2ZB9 A;  3J7Y J;  3I3L A;  5D6F A;  3I64 A;  3E6B A;  5GAG J;  4OAZ A;  4BJ5 C;  3IAM 2;  4S0H B;  3OY9 A;  3PSF A;  3R6S A;  4L9T A;  2R4G A;  1Y6I A;  2HWV A;  3KP4 A;  2HDD A;  3BG6 A;  2W24 A;  3LAJ A;  2Q8K A;  3CC2 I;  3S16 J;  1MJ9 A;  2QM3 A;  2XGX A;  1KU7 A;  1IRZ A;  5CVJ A;  2VC1 A;  1MND A;  2ZFW A;  2EIJ H;  1OJL A;  3A01 A;  5J1R A;  4OIR F;  2RKH A;  3KEO A;  2XAF A;  3K70 D;  4A5M A;  1ZH5 A;  5IYD J;  1ODD A;  2E35 A;  2L7K A;  5CKT A;  3BDD A;  4MTD A;  5B66 C;  4HA8 A;  5F1J A;  2RNG A;  2XF6 A;  2R5Y B;  4NNJ A;  5FD5 A;  4WF2 A;  1KGS A;  1BC7 C;  3ECO A;  4X0G A;  3CCU I;  3T1B A;  2EJR A;  2GLO A;  1AHD P;  3IV5 A;  3H9Q A;  4PUS A;  2JZY A;  1G4D A;  2IPQ X;  3G3Z A;  3K2A A;  1NK3 P;  2L9N A;  3FXM A;  2BXZ A;  3OR1 C;  1ZRF A;  1W7P B;  2RVC A;  5BMZ A;  1S9H A;  3HL2 A;  5IYC J;  2DMP A;  2Y0S A;  4AUX A;  4RA2 A;  3FIS A;  3LQQ A;  2HOT A;  2BOL A;  3LNQ A;  2LF7 A;  2R92 J;  2E1O A;  1HOM A;  2BZT A;  3I59 A;  3RQ4 A;  1QZZ A;  4RM2 A;  2MLK A;  2JA8 J;  5BPI A;  3I4N J;  5E3L A;  1NH3 A;  2MLG A;  1GT0 C;  3GZ5 A;  4OMZ A;  2YUS A;  4ZH4 F;  2FD5 A;  4WXD A;  1ZQ3 P;  4M73 A;  3IWZ A;  2P4W A;  2AXL A;  3LA7 A;  1E3P A;  4BY1 J;  2HGC A;  4ITV A;  3JTG A;  2IW5 A;  3DWL E;  3BLY A;  2EBI A;  1SD5 A;  1D1C A;  2X48 A;  2QVO A;  3REO A;  3OYA A;  1V54 H;  1U2W A;  2EFO A;  4M71 A;  3HPH A;  2R93 J;  3GVA A;  2ZCW A;  5F04 A;  3IKT A;  3PO2 J;  4CDG A;  1GV5 A;  3ZQ7 A;  4IL6 C;  4DBQ A;  1A6I A;  2MC3 A;  1YX3 A;  4XSX F;  3H5A A;  2OJE D;  1Y8Q B;  5LFA A;  1YRN A;  2YPR A;  3DBL B;  2F48 A;  4HNU A;  3MWM A;  1R1U A;  2KLO A;  4KIC A;  4XR6 A;  3FBI B;  1VQK I;  1W1W E;  5FFZ A;  3AG1 H;  4OIN F;  4L5I A;  4QTR A;  4BEH B;  2L3D A;  2EA2 A;  2VPR A;  2CUJ A;  5DCM A;  2EZH A;  1ZRE A;  3CUQ A;  4HSR A;  1SFK A;  4B47 A;  4U0Y A;  1YIT I;  1OYI A;  4MLO A;  1JTY A;  4OIP F;  1W7P D;  4DNC A;  2A05 A;  2KIS A;  2L9S A;  3QPT A;  3GEZ A;  3PUB A;  4C3J J;  3MKY B;  2PI0 A;  3LSJ A;  9ANT A;  1OFC X;  4JX6 A;  1XS9 A;  1VQ4 I;  4XN3 A;  4A0Y A;  3RZD J;  1NK2 P;  1S29 A;  2V6C A;  3DLA A;  2DA6 A;  4M3E A;  2ZJ2 A;  4DW6 A;  4IHX A;  3GYH X;  4G7H F;  2AHQ A;  2CUZ A;  2Z33 A;  4H0E A;  3OYH A;  2XSJ C;  2D5V A;  1EA3 A;  1KYW A;  2W00 A;  3LFK A;  2MSY A;  2XAQ A;  2D2W A;  3K69 A;  4AC0 A;  3V8J A;  1V5F A;  4ETS A;  3OYB A;  1U8R A;  1U5T A;  2OC6 A;  3LQR A;  5IP9 J;  4P96 A;  4HQM A;  1P9Q C;  4X1E A;  5L3B A;  3U1K A;  4RMN A;  1HXD A;  2CH0 A;  2DQL A;  3TQN A;  3HOW J;  2VXZ A;  4RB2 C;  1HA8 A;  2ZJR F;  1IUF A;  2BXY A;  3B02 A;  1RI7 A;  1N75 A;  4D0P A;  2DA3 A;  2F4O B;  3NRV A;  3ZN0 A;  5E20 A;  2WWY A;  5LLQ A;  3MQ0 A;  4ZDO A;  3D5R C;  1TTY A;  3CTA A;  3DPL C;  3PSI A;  1GXP A;  5FO5 A;  1Z05 A;  3BJ6 A;  3G2B A;  3QYE A;  4F55 A;  1WKM A;  2PG4 A;  3M3Y J;  1S6L A;  3QOD A;  1F36 A;  3QYB A;  4Y17 A;  3AG2 H;  1X4P A;  2HI3 A;  1IRX A;  3LST A;  4CYC A;  1HQC A;  2WB1 A;  3WTV C;  1H88 C;  2EPF A;  2XPW A;  3U9G A;  2FOK A;  3DPU A;  1GVJ A;  1R4M B;  4C30 A;  4MFD A;  1UZC A;  2JUG A;  2EV6 A;  2LH9 A;  3FHN A;  5AON A;  1B4A A;  4E7K A;  1YFH A;  2IGK A;  5H6R A;  5LHI A;  1MBJ A;  1TBX A;  4I76 A;  1G3Y A;  2ZJQ F;  3HRU A;  2FQ3 A;  1Z9C A;  1K79 A;  2BYV E;  1YG2 A;  2L0K A;  2M3A A;  3JW4 A;  1R22 A;  5CVR A;  3HOV J;  4F52 A;  1IW7 F;  5F6F A;  3S2W A;  4PFP A;  1FIP A;  3K4L A;  2L01 A;  5H20 A;  3WE2 A;  2P7C B;  3FMR A;  3HRM A;  3DP7 A;  4E7L A;  1MW7 A;  2L7M P;  4M74 A;  1W0U A;  1SVL A;  5F08 A;  2IGN A;  1R5H A;  4PJM A;  2WV1 A;  4R8H A;  3KET A;  4C3H J;  3F8C A;  4AYB N;  1OCZ H;  1I3A A;  4LFU A;  4G6T B;  4Q5S F;  1KA8 A;  1O3S A;  3P9I A;  2NRA C;  4HST A;  5M5X J;  3UKG A;  5HDN A;  4B4C A;  4XSZ F;  1YW8 A;  5K1Y A;  3KLN A;  5CJ9 A;  2DDB A;  5D5X B;  4ZZD A;  1B72 A;  4KIG A;  2CQ7 A;  1S7A A;  3S93 A;  1O7L A;  1BM9 A;  1WJA A;  4CIC A;  4RBO A;  1RR7 A;  2AS5 F;  1QRY A;  4ANJ A;  4DYQ A;  2XC7 A;  1U9N A;  3MEX A;  2R7T A;  3TGN A;  3PQK A;  2RNJ A;  2AQF A;  5FLX Z;  1W5T A;  2DN0 A;  4D5C A;  2JK3 A;  2L5Q A;  2HVS A;  2KIF A;  2HXI A;  2K9S A;  2R7Q A;  3PQJ A;  4D1Q A;  3ROU A;  2MFZ A;  4CCN A;  2DLL A;  4UB8 C;  2WAQ A;  4KUM A;  1ZGW A;  2H27 A;  2STW A;  2OCE A;  3GME A;  1HSJ A;  2FBK A;  3ZN1 A;  3GFI A;  3H1C A;  3JRH A;  2RGV A;  1OCC H;  4FE7 A;  3G71 I;  2K3P A;  4HX7 A;  1TP4 A;  1JUP A;  1FBQ A;  3LWF A;  4RAF A;  1ZLJ A;  3GLX A;  1G59 A;  3K6G A;  2VQL A;  3CLQ A;  3GW2 A;  1BR1 A;  5HLI A;  4EJU A;  4JX4 A;  5D5U B;  3OS2 A;  2HQN A;  2ZC2 A;  1XSX A;  4IKF A;  1RC9 A;  1TWH J;  3CO7 C;  2XKO A;  2DTZ A;  2L9V A;  3FX3 A;  2RN7 A;  4CHU A;  4QLC U;  2JN6 A;  3QPS A;  1IXS B;  4L9V A;  2E7X A;  3ZRG A;  2H94 A;  4XON A;  3ASN H;  4G8X A;  4G9Y A;  2EK5 A;  3LSM A;  3RI4 A;  1MMN A;  3PJR A;  3E97 A;  2IAI A;  2Z2S B;  2LBF A;  4RGU A;  2QQB A;  3GTL J;  1U5T C;  3A02 A;  2R5Z A;  4Z2Y A;  2HPI A;  1IG7 A;  1ZG3 A;  1ZAO A;  2XAJ A;  3QRF F;  1UB9 A;  3PIO F;  1GDT A;  4CXF A;  4FX4 A;  1OPC A;  4FX0 A;  4PJ0 C;  1R71 A;  2OD5 A;  4HPQ A;  5KNL A;  3S14 J;  3OWT A;  4AU7 A;  1ETK A;  1ZN2 A;  4IVN A;  1A04 A;  2CJJ A;  2XHK A;  2O61 A;  1K61 A;  4HLY A;  3C7J A;  4BE2 A;  3I5U A;  4BU2 A;  3VWB A;  3L2U A;  3ABU A;  2GOM A;  3F6O A;  5J1U A;  2ZME A;  2WY8 Q;  2NXN B;  5FKK A;  3KP2 A;  3GX4 X;  1MNM C;  3LSH A;  3BP8 A;  2BW3 A;  1IXC A;  3K1P A;  2MGQ A;  4PJL A;  1TW2 A;  3OIQ A;  2PQ8 A;  3FXJ A;  4I0B A;  3HRS A;  3BWG A;  3WU1 B;  2ESH A;  3Q5F A;  4Q48 A;  3BPV A;  3DEE A;  3I55 I;  3P9K A;  5HLH A;  4L0Y B;  3A0B C;  2B63 J;  3CJR B;  5L3D A;  5J6X A;  4GYI A;  2M0M A;  2A6E F;  2HQA A;  3ELK A;  1IZ1 A;  1YX5 A;  2XKP A;  3NQO A;  1LEB A;  3N05 A;  4PFO A;  4A6E A;  2UXN A;  4G94 A;  2P5L C;  1W36 C;  3WTZ A;  1PP8 F;  5LHH A;  2P7V B;  4AVZ A;  1FIA A;  2M30 A;  2ESN A;  3ZQI A;  4ZTJ A;  2GOX B;  1G3S A;  2EIN H;  1PVE A;  5HOD A;  2OU2 A;  4YG2 F;  1VQ8 I;  2ELJ A;  4ZYE A;  2DPD A;  4EJO A;  1LE8 B;  3S3N A;  1X4O A;  5E1W A;  3Q0U A;  2VE8 A;  2VOO A;  3R0A A;  4ZZL A;  4OAY A;  2PX9 A;  3DXJ F;  4AD9 A;  3LSP A;  5DM7 F;  1QU3 A;  2E5Z A;  5FLX K;  3JRA A;  1XDU A;  1EH7 A;  4LG0 A;  3ZMZ A;  3I56 I;  2UWM A;  3HKZ N;  1NTC A;  4G7Z F;  2M1B A;  4C3I J;  2V26 A;  4PGG A;  3I4P A;  4C2M J;  3WTX C;  2C6Y A;  2DO7 A;  3BC8 A;  4IRI A;  4ZDP A;  3KIO A;  2ETH A;  2EIM H;  3OYD A;  1HKT A;  3IAS 2;  4DBR A;  2F2E A;  4Z6Y A;  2LTP A;  2F5E A;  1X1D A;  4HV5 A;  2DA1 A;  3H0D A;  2ZNZ A;  1MDM A;  3OYM A;  2DT7 B;  2XAU A;  3FM5 A;  2NOG A;  3JCU C;  1LKX A;  1RUO A;  4M3F A;  2XPU A;  2QUF A;  3QYF A;  4XLH A;  4IOC F;  1QGP A;  2DOF A;  3RYP A;  1J7K A;  4PDK A;  1XC5 A;  4IO9 F;  4P9U A;  3BG3 A;  2E5N A;  4LJZ F;  2KIU A;  5JFR A;  1NHA A;  4OU0 A;  4BL0 B;  3KEQ A;  3SJM A;  2QSH X;  3ZPL A;  5GPA A;  3BR3 A;  4ZC3 A;  1ETO A;  2IEK A;  2VON A;  3BR5 A;  4M3D A;  3T8R A;  2DT5 A;  5FFX A;  3OYF A;  1LB2 A;  2E36 A;  4IHW A;  3H36 A;  4G6D A;  4ESF A;  1SC7 A;  2CQQ A;  2VJ4 A;  3UNG C;  2RAE A;  2VQH A;  5J4Y A;  1IN5 A;  2UZK A;  3A0H C;  1PYV A;  3OSF A;  1XGO A;  5D5V B;  1VQ6 I;  3C2H A;  2K85 A;  2I10 A;  1XMK A;  1ZLK A;  4XID A;  3LL7 A;  3FM3 A;  1YYV A;  3CF2 A;  3F6V A;  4B3A A;  3BOQ A;  1JUM A;  1S3J A;  2LOO A;  1T08 B;  4UUS B;  3OYE A;  1QQI A;  3EUK L;  1XD7 A;  2KDO A;  4UUT A;  4IHT A;  3ZOB A;  1J75 A;  2CFO A;  2Q1Z B;  1YIJ I;  1BI1 A;  3CZ6 A;  4BBS J;  2JRT A;  1R4N B;  1WVR A;  5EGO B;  2MW8 A;  4DJA A;  3S2D J;  2QGU A;  3BR2 A;  2K9M A;  1QBJ A;  4E7S A;  1IDZ A;  2RV8 A;  3O6B B;  4FCY A;  1ITY A;  1VQN I;  2M0C A;  4I7H A;  3JRD A;  1SFU A;  2ECB A;  4JK1 X;  1QO0 D;  2NVT J;  1BR2 A;  1HW2 A;  3BTL A;  4P9F A;  4Y33 A;  4ESJ A;  4MTE A;  3T8T A;  4I98 B;  1IXR C;  2E1M B;  2DFE A;  3AG4 H;  5HLT A;  1P4X A;  3L2Q A;  4CCK A;  4D7M A;  2ZME C;  3L2W A;  1OIS A;  1Q1H A;  2EV5 A;  3H92 A;  4L0Z B;  3OYN A;  3KLO A;  2PEX A;  2LKP A;  4HF2 A;  1QVU A;  4U7B A;  3M1C A;  5CVV A;  2QEX I;  4W1U A;  2QBY A;  1DP3 A;  1BW6 A;  2YX7 A;  3KPH A;  4CO8 A;  5B5E C;  2OQR A;  3AL0 B;  1MBK A;  2E1M C;  3MVP A;  1FYM A;  3SEQ A;  3LA3 A;  3FMQ A;  5KVR A;  3M9A A;  2XVC A;  1TWA J;  2NNN A;  1TW3 A;  5E8G A;  2FA5 A;  2VKD A;  1ZR4 A;  5FRN A;  4RB1 A;  3K9T A;  5J1Y A;  2XRL A;  3HM5 A;  5C3E J;  3W2A A;  3BG7 A;  3S1M J;  5JLW A;  1S7E A;  3TOA A;  1EF4 A;  2CQX A;  3FXQ A;  3TP3 A;  2NS0 A;  2YSR A;  4FT8 A;  2L02 A;  3CCE I;  2QA4 I;  1T38 A;  4XLE A;  2L2O A;  1Z67 A;  2KQR A;  2Y0M A;  2PMZ A;  3HEF A;  4RGX A;  4XKB A;  4IRG A;  2WC2 A;  2VBZ A;  2FMY A;  1UCR A;  1YOV B;  4D7N A;  5L3F A;  2G7H A;  2NS8 A;  3FF5 A;  1ENH A;  2KT0 A;  3ABT A;  2WA0 A;  3DKY A;  3HGG A;  5LGT A;  1Q1V A;  3QP6 A;  3KEY A;  4I2O A;  1K83 J;  3H9G A;  3HZJ A;  4DYR A;  3P5J A;  2L4A A;  3PM1 A;  3J7A O;  4G12 A;  1HKS A;  2XAG A;  2Q2E B;  3RKQ A;  2FXA A;  1B9N A;  3ABM H;  1Y8R B;  3BR6 A;  1Y39 A;  3SXY A;  3BZ6 A;  4A0X A;  2ELH A;  4TV7 A;  5BQT A;  4EGY A;  1T39 A;  1LFU P;  2V7F A;  3S8P A;  2COB A;  2VBW A;  2VC0 A;  2OZ6 A;  3TKY A;  2W84 A;  5HDK A;  2XB5 A;  1A5J A;  4HF0 A;  4XKC A;  2MA3 A;  2DA7 A;  1G8X A;  3TMO A;  2E2H J;  3S15 J;  3RYR A;  5KHD A;  2V1D A;  3GZN B;  3F22 A;  4PK4 A;  5D5W B;  3PFI A;  1KU3 A;  2O3F A;  3E5Q A;  1STZ A;  5FJ8 J;  3EYY A;  1TWF J;  3MZ8 A;  4CSW A;  2LFB A;  1DU6 A;  1WFX A;  3SZG A;  1J59 A;  1IRF A;  3QPH A;  4KNY A;  3W6J B;  5E3O A;  3OR2 C;  3WU2 C;  3MKW B;  1ZAR A;  2ID3 A;  3VOD A;  1JTX A;  1IRG A;  4JOM A;  1UFM A;  2ZKZ A;  3KP3 A;  3FZV A;  2DA4 A;  4II2 A;  3ESW B;  5H2F C;  3GZ6 A;  3TW6 A;  2R7D A;  3DEU A;  4FQG A;  3FIW A;  2H6C A;  3EUH A;  3WGI A;  2UUZ A;  2GZW A;  3SZT A;  3QU6 A;  1QNT A;  2X1E A;  4F3Q A;  2R0Q C;  3CLO A;  4MEY F;  1EV7 A;  3GTK J;  1OCT C;  2KPM A;  3ZQH A;  4AVP A;  2R7X A;  3TP0 A;  4FIS A;  2BVL A;  3K4C A;  3C2B A;  5LGN A;  1ZYR F;  5FKL A;  2JVG A;  2K4J A;  4UXN A;  1BOA A;  3JSP A;  1Z0X A;  2TDX A;  2JJ7 A;  3FXL A;  5D8K B;  4BE0 A;  4Y4R A;  4MHG A;  3KZI C;  1IJW C;  3ZQC A;  2EFN A;  2OA4 A;  4IOA F;  2XF7 A;  3FXK A;  2IXS A;  4Y3O A;  1JJ8 C;  1OLT A;  5JI6 A;  2DPU A;  2H8W A;  3CCY A;  3LSK A;  1FPQ A;  2QZ8 A;  1YI2 I;  5K5O A;  3CES A;  5LHG A;  3LAP A;  1H89 C;  2LSO A;  1BIA A;  2HKX A;  2FE3 A;  2KFD A;  2XF5 A;  2CWE A;  4A93 J;  3ABL H;  2CFX A;  3IC7 A;  5EDN A;  1UMQ A;  2V9K A;  3KYL A;  1T95 A;  1IF1 A;  2VT2 A;  3S2H J;  2P5V A;  2XGE A;  3V4G A;  3CCS I;  4O3M A;  4NQW B;  3QP5 A;  1JHH A;  1B59 A;  1P4W A;  4IXA A;  2CQN A;  3RIR A;  2E19 A;  2G9W A;  2OCC H;  6PAX A;  1I6H J;  1AKH A;  4EQQ A;  3T5X A;  1FBU A;  5E8I A;  1FOK A;  3ZQF A;  3L2R A;  2ID6 A;  4BS9 A;  4AWX B;  2JUC A;  4XK4 A;  1HST A;  2V6E A;  4YFN F;  1LVA A;  2ADU A;  4B09 A;  1K78 B;  3CDL A;  3CO6 C;  1ORK A;  2IVM A;  2QQ8 A;  4NC8 A;  4RGR A;  4V19 K;  4OMY A;  1PUF A;  4WK8 F;  1XN7 A;  5EF6 A;  4A3M J;  2HKO A;  4M6Y A;  3RPU D;  2ME0 A;  1ACI A;  4MO7 A;  4XRF A;  3WTY C;  3CF5 F;  3ONQ A;  3H3U A;  4CZZ A;  1U78 A;  1BR4 A;  1B9M A;  3RJP A;  3RKX A;  3BR1 A;  3HBL A;  4P5O A;  1K6Y A;  5L3E A;  1SFX A;  1B8I A;  3CP8 A;  3A01 B;  2DMU A;  4GCV A;  1W4M A;  1WJD A;  1OMI A;  3O8G A;  3OL4 A;  2DYS H;  1BOB A; 
#chains in the Genus database with same CATH homology
 1AWC A;  4OIQ F;  4WXH A;  3ZP5 A;  3WTU C;  3I54 A;  5DUK A;  2A3S A;  1E17 A;  3WOD F;  4Q47 A;  2QLZ A;  5FGM A;  3BPX A;  1S8N A;  1MJA A;  4CYD A;  4RB3 C;  1L3L A;  4ENM A;  2KJC A;  1K6O A;  1BBY A;  3ML6 A;  1OR7 A;  3D5L A;  1EH8 A;  3EQL F;  3MCZ A;  2IRF G;  4E70 A;  1YS6 A;  1FYK A;  1H9T A;  3L9F A;  4KN7 X;  3I59 B;  4S04 A;  3KP5 A;  3SQN A;  2Z99 A;  1D3Y A;  3ERE D;  1J9I A;  1F9N A;  5LRR A;  1Z1D A;  1D5V A;  4NB5 A;  1LNW A;  3I53 A;  2ZBK A;  3DF8 A;  3V7R A;  3HUG A;  3O2P E;  1LQ1 A;  2W85 A;  4ZYG A;  3NEU A;  5LEK A;  2L54 A;  3FWE A;  3IRR A;  1BI2 A;  4FHT A;  1PUE E;  2HTJ A;  4HBL A;  5BPD A;  4GGG A;  3JAM Z;  4KMF A;  4R1H A;  2CG4 A;  2O0Y A;  2HR3 A;  4PCQ A;  2QQ9 A;  2IA0 A;  4U0V A;  2FNP A;  1YQA A;  5DCM B;  3CUQ B;  1KYZ A;  3I71 A;  5L3C A;  2CSO A;  4BHP A;  1TLH B;  2ZNY A;  5D6E A;  4MQ9 F;  3F23 A;  1I1G A;  3KFW X;  3Q9S A;  2DK5 A;  3G73 A;  1LDK B;  2H6B A;  3FHZ A;  3J81 Z;  3CUQ C;  4WWC A;  2R3S A;  1WWX A;  3WU0 A;  3DV8 A;  4L18 B;  1WSU A;  3P9C A;  5CYV A;  1O3Q A;  2FBH A;  1DPR A;  2Q0O A;  1U5T B;  1FC3 A;  2RQP A;  4BHB A;  2LF8 A;  1ON2 A;  4U7D A;  2GA2 A;  2A6H F;  3V8K A;  3BJA A;  1I6X A;  2K86 A;  1FYL A;  3EDP A;  2M87 A;  3TO7 A;  2E7W A;  3RTR A;  4ENK A;  4HDU A;  1XMA A;  4HX4 A;  1BIB A;  4S05 A;  4XLP F;  4BAY A;  1GHC A;  4YIF A;  4A0Z A;  1FT9 A;  4MGR A;  2MD5 A;  2F5C A;  3F21 A;  3HHG A;  3MFK A;  4KFC A;  2PMH A;  5DV5 A;  3ISP A;  3FXR A;  1IN7 A;  2M5W A;  2P6S A;  1F1Z A;  2CYY A;  2FML A;  2P5K A;  1ON1 A;  1IN8 A;  1MJB A;  3WG9 A;  3IL2 A;  2DAO A;  3KP6 A;  4N0B A;  3SFZ A;  3RPQ A;  2DFI A;  5L3G A;  2HYF A;  3EYI A;  2QWW A;  1USS A;  2WV0 A;  3F8M A;  2BE5 F;  2K27 A;  3RDI A;  2P6T A;  1QPM A;  2JTV A;  1SD6 A;  2EB7 A;  5H6Q A;  2DW4 A;  2WTE A;  3JAM K;  2M8E A;  5ICG A;  1RIO H;  4IHS A;  1VTN C;  2OBP A;  3N4M A;  4LB5 A;  5CVI A;  4XBF A;  3HOT A;  1E2X A;  3VOE A;  5D4S A;  4L9J A;  1FBS A;  3K1N A;  2EFW A;  1IUY A;  2JPC A;  1SD4 A;  3SZP A;  5D4R A;  3HSE A;  3GWZ A;  3MAJ A;  4OOI A;  2FF4 A;  4UHT A;  3WTT C;  1EH6 A;  4IF4 A;  1T0F A;  2BBY A;  1CF7 A;  4UVB A;  1IN4 A;  2PN6 A;  4EM1 A;  1LEB A;  3J81 K;  3KZY A;  4HYE A;  4MEX F;  3TOB A;  4G7O F;  2BEO A;  1L0O C;  2HZT A;  4U88 A;  2KRF A;  3M8E A;  4M9S A;  3WGG A;  1KQ8 A;  3ZMT A;  1R00 A;  4ZYD A;  5BS6 A;  3HSR A;  3RKW A;  1REP C;  2O8X A;  3OV8 A;  4HLX A;  2IA1 A;  2V79 A;  4O5V A;  3L7W A;  1Y0U A;  2MBF A;  3F8N A;  1IN6 A;  1F4K A;  1D8K A;  2XRO A;  4UV8 A;  3TO9 A;  1O7F A;  3K1M A;  3E5U A;  2V9V A;  5E1Z B;  3HTS B;  1JXS A;  2ZME B;  4MNU A;  1XCV A;  1SFE A;  5HVQ C;  1FNN A;  5J8C A;  4EV0 A;  4ON0 A;  3F8F A;  4IPA A;  4RGS A;  1UST A;  2RDP A;  5CVU A;  4EJT A;  3HRT A;  4MQV A;  5E17 F;  1W7P A;  3GFJ A;  4BXU A;  5LGU A;  1HKQ A;  2W57 A;  1HBX G;  4RAY A;  5TJJ A;  2CGP A;  5ERI A;  3HTU A;  1KQ0 A;  3V8L A;  4HQE A;  3GFL A;  1UHW A;  1G3T A;  5JR3 A;  1O3T A;  2VBX A;  2A5Y B;  3DPT A;  4ENJ A;  2GIV A;  4BYY A;  3QU3 A;  4HF1 A;  2ACJ A;  3K0L A;  2HQR A;  3P7N A;  5EEH A;  3GF2 A;  3H3Z A;  2STT A;  1BC8 C;  4LG0 B;  4QWQ A;  1KQ9 A;  1RUN A;  4A5N A;  2XIG A;  4NQW A;  5FB2 A;  3B73 A;  3WGH A;  1ZRD A;  1MDM B;  3R60 A;  4HAM A;  2FRH A;  2QYO A;  1QZY A;  1G6N A;  1ZG5 A;  1K78 A;  2CO5 A;  4BH9 A;  1T98 A;  1KU9 A;  4WXC A;  3KP7 A;  3HOS A;  4UVA A;  2E1C A;  1DP7 P;  2RC4 A;  1PP7 U;  3O3K A;  3DKW A;  2PJP A;  2BV6 A;  1RZ4 A;  1MD0 A;  2GWR A;  1BN5 A;  1V4R A;  2VOP A;  4M9Z A;  4LLG F;  4WCG A;  3IRQ A;  3V7C A;  2OQG A;  2HDC A;  1F5T A;  5FD6 A;  1Z6T A;  1R1T A;  3F72 A;  3U1D A;  2FU4 A;  3EET A;  2EFQ A;  3L2C A;  5A2Q Z;  4K2E A;  1JE8 A;  2B0L A;  5TRD A;  4RS8 A;  5ICF A;  1OYW A;  4N9H A;  1R7J A;  2D1H A;  1T2K A;  4XLN F;  4P55 A;  4HX8 A;  2HYG D;  3FXU A;  3GXO A;  3I0T A;  5DCF A;  2QBY B;  1SMY F;  1FY7 A;  1C0W A;  5IT9 Z;  5CLS A;  3WE3 A;  3IKV A;  3E3V A;  3MZY A;  1Z6R A;  3GUD A;  4Y13 A;  2L4M A;  5KK1 A;  4M9X A;  4IRH A;  1KU2 A;  5DD4 A;  3F3X A;  4I01 A;  3DQV C;  4EM0 B;  1WRJ A;  4R79 A;  1MGT A;  5F64 A;  3R61 A;  2Z9O A;  2D1V A;  2J5P A;  4Q4Z F;  1FP1 D;  1JGS A;  4F7Z A;  3E5X A;  3C1D A;  3K2Z A;  3M7G A;  4G6Q A;  4U0W A;  3L09 A;  2JT1 A;  3ZMV A;  2BGC A;  2MH2 A;  1LJ9 A;  4EJW A;  2VN2 A;  4AIK A;  1XSV A;  5DDG A;  3KE2 A;  3KCC A;  2HOE A;  3W6K B;  5HDG A;  5EEG A;  1B6A A;  1I1S A;  3V7S A;  5HS8 A;  2NYX A;  4LLL A;  2YU3 A;  4PZJ A;  1Z7U A;  5ICE A;  2Y75 A;  1HW1 A;  2GA1 A;  1XSD A;  3J80 Z;  1CGP A;  1SAX A;  2HS5 A;  4HV6 A;  4EVI A;  2ZXJ A;  1FSH A;  3WTS C;  2K7L A;  3TDU C;  4GO1 A;  5A2Q K;  3ZMU A;  3BY6 A;  2KJB A;  4LK1 F;  1X3U A;  3GFM A;  1FSE A;  3LA2 A;  2PMU A;  4M72 A;  4ZYH A;  4A2U A;  5HOO A;  4BNC A;  2FBI A;  3IWF A;  5K5Q A;  1P92 A;  4DQ2 A;  4HW0 A;  3CDH A;  5HS9 A;  1ZGA A;  4YFK F;  4NHJ A;  2Z3Y A;  1P4A A;  2IA2 A;  5LRS A;  4RB0 A;  1FX7 A;  2COM A;  4EJV A;  1K7A A;  5IT9 K;  3OOP A;  3CJN A;  1PDN C;  5IT3 A;  1I5Z A;  2NNY A;  2GXG A;  5HS7 A;  2VT3 A;  1XGN A;  3MZH A;  1J2X A;  3RKY A;  2V1X A;  1S7O A;  3E6C C;  1YLF A;  4EM2 A;  2IJL A;  5BOX A;  1ZG1 A;  2G7U A;  5E18 F;  4M6X A;  4KMU X;  1V3F A;  1R58 A;  1YO5 C;  2CW0 F;  4HZF A;  3HHH A;  1T6S A;  2J5O A;  2QEN A;  2FSW A;  2W25 A;  3SHF A;  1DPU A;  3CUO A;  1SD7 A;  4LGW A;  5J8F A;  2K02 A;  4ENN A;  1D8J A;  2EFP A;  2DK8 A;  1J5Y A;  3QOP A;  3I58 A;  4YFX F;  3M8F A;  5AIQ A;  1H9G A;  2JPB A;  2OAZ A;  2OZU A;  4KYW A;  1YIO A;  1MZB A;  4PGH A;  1GXQ A;  2IT0 A;  2PLY A;  3ZMD A;  3GO5 A;  3ULQ B;  1JHF A;  3J80 K;  1FZP B;  3FMS A;  2F5F A;  5AIP A;  2NAZ A;  4HOB A;  5ILV A;  2HTS A;  1R1V A;  2VBY A;  5K5R A;  4ASN A;  1U3E M;  3HIF A;  1ULY A;  3D0S A;  2ISY A;  4OIO F;  2XAS A;  3Q9V A;  4AIJ A;  1LDJ A;  2EV0 A;  2VOD A;  4B8X A;  1FLI A;  1AOY A;  1FP2 A;  1H0M A;  4N9I A;  2KIM A;  1TQI A;  1TQM A;  5LEJ A;  5DUI A;  2HFH A;  1HW5 A;  1J0R A;  5E1X A;  3L00 A;  2D45 A;  5ILU A;  4I09 A;  1XGM A;  2XUB A;  4AIH A;  1XB4 A;  2LDU A;  4A12 A;  1U6G A;  2CQK A;  1ZRC A;  2HEO A;  2GQQ A;  4A6D A;  2DQR A;  4YII A;  2XRN A;  4RAZ A;  1YTY A;  4KIB A;  2YX4 A;  2DU9 A;  1Z91 A;  1BJA A;  1TQP A;  3QAH A;  1BI0 A;  2Y48 A;  2KKO A;  3JTH A;  3JSO A;  5JHU A;  2EA4 A;  2QQA A;  4HDV A;  4CGZ A;  4O6J A;  1DDN A;  5F1R A;  2EWN A;  4ESB A;  2M45 A;  1YW7 A;  3F8B A;  4BHC A;  1R36 A;  4IJA A;  1ONV A;  3C18 A;  1DUX C;  4GYG A;  2UXX A;  4KIF A;  2A07 F;  3N97 A;  3E6M A;  1TNS A;  2O03 A;  5LBQ A;  1YW9 A;  1SMT A;  4JBA A;  2GXB A;  2ZO4 A;  3M1E A;  2XV4 S;  5ED4 A;  2A61 A;  2LNB A;  4LLN A;  2R7F A;  1W5S A;  5JVT A;  1O3R A;  2ISZ A;  5DYM A;  3AAF A;  1WQ2 A;  2Q2E A;  5ILS A;  4BQA A;  2JSC A;  4I02 A;  4LMY A;  5HLG A;  1TNT A;  1G3W A;  1ZHF A;  1OYY A;  1UHM A;  4L5J A;  4WX9 A;  2PBI A;  3TDZ C;  3R0J A;  3HSF A;  3ZMS A;  1WI9 A;  2DI3 A;  2DTR A;  2V1U A;  2FNA A;  1ZGJ A;  2YR2 A;  1YS7 A;  1I27 A;  3DFG A;  1P2F A;  2X0L A;  3IHU A;  4L9N A;  4KDP A;  4KT5 C;  4UNO A;  4JQF A;  3RPU A;  2A69 F;  3KZZ A;  5D8L B;  2X4H A;  4KA4 A;  1LEA A;  2P8T A;  3VB2 A;  2FEZ A;  5ICC A;  5DEQ A;  4EMS A;  1R5G A;  3HYI A;  1RNL A;  3VFZ A;  3C3W A;  3U2R A;  2O6G E;  1FWZ A;  1LDD A;  4UUV A;  2K4B A;  2PFB A;  2GAU A;  3VEP A;  1R23 A;  3BRO A;  1OKR A;  1XDS A;  4GXO A;  2DBB A;  3E6D A;  4LK0 F;  1B1B A;  2XAH A;  4UV9 A;  1BI3 A;  2F5D A;  4LB6 B;  4Y15 A;  2Z5U A;  4KN4 X;  1XCB A;  2MH9 A;  2H09 A;  1CF7 B;  3BJO A;  4UVC A;  4EGZ A;  3T0Y A;  1MKM A;  2IP2 A;  3WTW C;  1IAW A;  2A68 F;  1O57 A;  2E1N A;  2VE9 A;  4LD5 A;  1P6R A;  5DD8 A;  3R4K A;  1XGS A;  3COA C;  3ECH A;  4I0A A;  5D6F A;  3I64 A;  3E6B A;  3R6S A;  4L9T A;  2HWV A;  3KP4 A;  2W24 A;  3LAJ A;  2Q8K A;  1MJ9 A;  2QM3 A;  2XGX A;  1KU7 A;  5CVJ A;  2VC1 A;  2ZFW A;  4OIR F;  2RKH A;  3KEO A;  2XAF A;  4A5M A;  1ZH5 A;  1ODD A;  3BDD A;  4MTD A;  4HA8 A;  5FD5 A;  4WF2 A;  1KGS A;  1BC7 C;  3ECO A;  3T1B A;  2EJR A;  2JZY A;  1G4D A;  2IPQ X;  3G3Z A;  1ZRF A;  1W7P B;  2RVC A;  5BMZ A;  3LQQ A;  2LF7 A;  3I59 A;  1QZZ A;  2MLK A;  5BPI A;  2MLG A;  3GZ5 A;  4OMZ A;  4ZH4 F;  4WXD A;  4M73 A;  3IWZ A;  2P4W A;  2AXL A;  3LA7 A;  2HGC A;  3JTG A;  2IW5 A;  1SD5 A;  2QVO A;  3REO A;  1U2W A;  2EFO A;  4M71 A;  3GVA A;  2ZCW A;  3IKT A;  4CDG A;  3ZQ7 A;  2MC3 A;  4XSX F;  2YPR A;  3MWM A;  1R1U A;  4KIC A;  5FFZ A;  4OIN F;  4L5I A;  2L3D A;  2EA2 A;  5DCM A;  1ZRE A;  3CUQ A;  4U0Y A;  1OYI A;  4OIP F;  1W7P D;  4DNC A;  3QPT A;  3GEZ A;  2PI0 A;  4A0Y A;  1S29 A;  2V6C A;  2ZJ2 A;  3GYH X;  4G7H F;  2Z33 A;  4H0E A;  1KYW A;  3LFK A;  2XAQ A;  2D2W A;  3K69 A;  3V8J A;  4ETS A;  1U8R A;  1U5T A;  3LQR A;  4P96 A;  4HQM A;  5L3B A;  1HXD A;  2DQL A;  3TQN A;  2VXZ A;  4RB2 C;  3B02 A;  1RI7 A;  4D0P A;  3NRV A;  3ZN0 A;  5E20 A;  2WWY A;  5LLQ A;  3MQ0 A;  1TTY A;  3CTA A;  3DPL C;  1GXP A;  5FO5 A;  1Z05 A;  3BJ6 A;  1WKM A;  2PG4 A;  1S6L A;  4Y17 A;  3LST A;  3WTV C;  1HQC A;  3U9G A;  2FOK A;  1GVJ A;  2EV6 A;  5AON A;  1B4A A;  1YFH A;  5H6R A;  5LHI A;  1TBX A;  1G3Y A;  3HRU A;  2FQ3 A;  1Z9C A;  1K79 A;  2BYV E;  1YG2 A;  3JW4 A;  1R22 A;  5CVR A;  1IW7 F;  5F6F A;  3S2W A;  2L01 A;  5H20 A;  3WE2 A;  2P7C B;  3FMR A;  3HRM A;  3DP7 A;  4M74 A;  1R5H A;  4R8H A;  3KET A;  3F8C A;  4LFU A;  4Q5S F;  1KA8 A;  1O3S A;  3P9I A;  2NRA C;  5HDN A;  4XSZ F;  1YW8 A;  5K1Y A;  3KLN A;  5CJ9 A;  5D5X B;  4ZZD A;  4KIG A;  1S7A A;  1O7L A;  1BM9 A;  4CIC A;  2AS5 F;  3MEX A;  3TGN A;  3PQK A;  2RNJ A;  5FLX Z;  1W5T A;  2KIF A;  3PQJ A;  3ROU A;  2DLL A;  4KUM A;  2H27 A;  2STW A;  1HSJ A;  2FBK A;  3ZN1 A;  3GFI A;  2RGV A;  4HX7 A;  1FBQ A;  3LWF A;  1ZLJ A;  3GLX A;  3GW2 A;  5HLI A;  4EJU A;  5D5U B;  2HQN A;  1XSX A;  3CO7 C;  2XKO A;  3FX3 A;  2RN7 A;  4CHU A;  4QLC U;  1IXS B;  4L9V A;  2E7X A;  2H94 A;  4G8X A;  4G9Y A;  2EK5 A;  3RI4 A;  3E97 A;  4RGU A;  2QQB A;  1U5T C;  4Z2Y A;  1ZG3 A;  1ZAO A;  2XAJ A;  3QRF F;  1UB9 A;  4CXF A;  4FX4 A;  1OPC A;  4FX0 A;  2OD5 A;  1ZN2 A;  4IVN A;  1A04 A;  2XHK A;  2O61 A;  4HLY A;  3C7J A;  3I5U A;  3ABU A;  3F6O A;  2ZME A;  3KP2 A;  3GX4 X;  3BP8 A;  1IXC A;  3K1P A;  1TW2 A;  3Q5F A;  2PQ8 A;  4I0B A;  3WU1 B;  3HRS A;  3BWG A;  2ESH A;  4Q48 A;  3BPV A;  3P9K A;  5HLH A;  4L0Y B;  5L3D A;  5J6X A;  4GYI A;  2A6E F;  3ELK A;  1IZ1 A;  2XKP A;  3NQO A;  4A6E A;  2UXN A;  4G94 A;  2P5L C;  3WTZ A;  1PP8 F;  5LHH A;  2P7V B;  2M30 A;  2ESN A;  1G3S A;  2OU2 A;  4YG2 F;  4ZYE A;  2DPD A;  4EJO A;  5E1W A;  2VE8 A;  2VOO A;  3R0A A;  4ZZL A;  3DXJ F;  4AD9 A;  5FLX K;  1XDU A;  1EH7 A;  4LG0 A;  3ZMZ A;  2UWM A;  4G7Z F;  2M1B A;  4PGG A;  3I4P A;  3WTX C;  2C6Y A;  2DO7 A;  4IRI A;  2ETH A;  1HKT A;  2F2E A;  2F5E A;  4HV5 A;  1MDM A;  2ZNZ A;  3FM5 A;  1RUO A;  2QUF A;  1QGP A;  3RYP A;  1J7K A;  4PDK A;  4P9U A;  4LJZ F;  2KIU A;  5JFR A;  1NHA A;  4OU0 A;  3KEQ A;  3ZPL A;  2VON A;  3T8R A;  2DT5 A;  5FFX A;  1LB2 A;  4G6D A;  4ESF A;  1IN5 A;  2UZK A;  1XGO A;  5D5V B;  1XMK A;  1ZLK A;  3FM3 A;  1YYV A;  3F6V A;  3BOQ A;  1S3J A;  1QQI A;  1XD7 A;  4IHT A;  1J75 A;  1BI1 A;  2JRT A;  1QBJ A;  2RV8 A;  3O6B B;  4I7H A;  1SFU A;  4JK1 X;  1QO0 D;  1HW2 A;  4P9F A;  4ESJ A;  4MTE A;  3T8T A;  4I98 B;  1IXR C;  1P4X A;  1Q1H A;  2EV5 A;  3H92 A;  4L0Z B;  3KLO A;  2LKP A;  2PEX A;  4HF2 A;  4U7B A;  2QBY A;  5CVV A;  2YX7 A;  4CO8 A;  2OQR A;  1FYM A;  3LA3 A;  3FMQ A;  5KVR A;  3M9A A;  2XVC A;  2NNN A;  5E8G A;  1TW3 A;  2FA5 A;  4RB1 A;  3K9T A;  3TOA A;  3FXQ A;  2NS0 A;  2YSR A;  4FT8 A;  2L02 A;  1T38 A;  2Y0M A;  4RGX A;  4IRG A;  2WC2 A;  2VBZ A;  2FMY A;  1UCR A;  5L3F A;  2G7H A;  3FF5 A;  3ABT A;  5LGT A;  3QP6 A;  4I2O A;  2L4A A;  3J7A O;  1HKS A;  2XAG A;  2FXA A;  1B9N A;  3SXY A;  3BZ6 A;  4A0X A;  2ELH A;  4TV7 A;  5BQT A;  4EGY A;  1T39 A;  2VBW A;  2VC0 A;  2OZ6 A;  3TKY A;  2W84 A;  5HDK A;  4HF0 A;  2MA3 A;  3RYR A;  2V1D A;  3F22 A;  5D5W B;  3PFI A;  1KU3 A;  2O3F A;  3E5Q A;  1STZ A;  3EYY A;  1J59 A;  1IRF A;  3QPH A;  4KNY A;  3W6J B;  1ZAR A;  3VOD A;  1IRG A;  1UFM A;  2ZKZ A;  3KP3 A;  3FZV A;  3GZ6 A;  2R7D A;  3DEU A;  2H6C A;  3EUH A;  3WGI A;  2GZW A;  3SZT A;  3QU6 A;  1QNT A;  3CLO A;  4MEY F;  1EV7 A;  4AVP A;  5LGN A;  1ZYR F;  2K4J A;  4UXN A;  1BOA A;  3JSP A;  2TDX A;  5D8K B;  4MHG A;  2EFN A;  2OA4 A;  5JI6 A;  2DPU A;  1FPQ A;  2QZ8 A;  5K5O A;  3LAP A;  5LHG A;  2LSO A;  1BIA A;  2HKX A;  2FE3 A;  2CWE A;  2CFX A;  3IC7 A;  1IF1 A;  2VT2 A;  2P5V A;  3V4G A;  4O3M A;  3QP5 A;  1JHH A;  1B59 A;  1P4W A;  4IXA A;  3RIR A;  2G9W A;  6PAX A;  4EQQ A;  3T5X A;  1FBU A;  5E8I A;  1FOK A;  4AWX B;  1HST A;  4YFN F;  1LVA A;  2ADU A;  4B09 A;  1K78 B;  3CO6 C;  2IVM A;  4RGR A;  4OMY A;  4WK8 F;  1XN7 A;  2HKO A;  4M6Y A;  4XRF A;  3WTY C;  3H3U A;  4CZZ A;  1U78 A;  1B9M A;  3RJP A;  3RKX A;  4P5O A;  5L3E A;  1SFX A;  4GCV A;  1W4M A;  1OMI A;  3TO6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...