1KU7A

Crystal structure of thermus aquatics rna polymerase sigmaa subunit region 4 bound to-35 element dna
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
73
structure length
73
Chain Sequence
b'SEELEKALSKLSEREAMVLKMRKGLIDGREHTLEEVGAYFGVTRERIRQIENKALRKLKYHESRTRKLRDFLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(*CP*CP*TP*TP*GP*AP*CP*AP*AP*AP*G)-3'
publication title Structure of the bacterial RNA polymerase promoter specificity sigma subunit.
pubmed doi rcsb
source organism Thermus aquaticus
molecule tags Transcription/dna
total genus 28
structure length 73
sequence length 73
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04545 Sigma70_r4 Sigma-70, region 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1ku7A00
5HDNA 5JI6A 4I0BA 3F72A 1CF7B 4P9FA 2K02A 5H20A 5H6QA 2E7XA 4KIBA 3GZ5A 1P4AA 2CYYA 1RUNA 4A0XA 2PBIA 1YG2A 1K78B 2G7UA 3T0YA 3WTYC 4HYEA 4IHSA 2Y48A 4FX0A 1TNTA 1HXDA 2A68F 4CHUA 3GFLA 5DYMA 2GA2A 4EJWA 1YW9A 1P2FA 1P92A 2A5YB 2D1VA 4L5JA 4IF4A 3FXQA 1P4XA 1S29A 1LEBA 1SFXA 3MZYA 2Z9OA 3SQNA 1DUXC 3GO5A 1Z1DA 4JBAA 1JHFA 3F8BA 2L4AA 5FLXZ 1QGPA 4FHTA 4ASNA 4EGYA 3HSEA 1ZREA 3HHGA 1R5HA 5TRDA 4ESJA 4B8XA 1KU2A 5HDKA 3L9FA 4OIPF 4NQWA 2IVMA 4LLGF 4ZZLA 2VE9A 1S3JA 2A61A 1USTA 1T39A 1T2KA 4BXUA 2O61A 2F5FA 2BYVE 2OQRA 4N0BA 2F2EA 1BIBA 1BBYA 2X0LA 4A0ZA 5HS9A 2QENA 5HOOA 3IKVA 2L02A 2PQ8A 3GFMA 3V4GA 1LEAA 2XV4S 1IN4A 1B9MA 4B09A 4MNUA 4JK1X 1CF7A 3FMSA 4I09A 1JGSA 3DPLC 3HTUA 5D5VB 1ZG1A 2HOEA 5FO5A 2STWA 4EQQA 3EETA 5HLGA 1K78A 1MZBA 1S7AA 3LSTA 1SFEA 4I2OA 1UHMA 1D3YA 2CQKA 2LSOA 2V1DA 5D5UB 3G73A 3IRRA 4CICA 2MA3A 1W4MA 1IN6A 1J75A 2IT0A 2HTJA 1KYZA 3ECHA 3T8RA 1IRFA 3HHHA 1ZN2A 2OZUA 3GX4X 3IL2A 5FFZA 4GXOA 4U0WA 3TOBA 1K6OA 2PLYA 3REOA 2P7CB 3ML6A 3IKTA 3NEUA 3TO7A 1B4AA 4XSZF 3WTWC 5AIPA 3BJAA 4CXFA 2MLKA 2M87A 3Q9VA 4EGZA 2EV5A 3C1DA 4WXHA 2NNYA 2L3DA 2Z5UA 4NB5A 3KP6A 2MH9A 2R7DA 3WU1B 3EYYA 3B73A 2IP2A 3FZVA 2O0YA 2D2WA 3ZMZA 1F5TA 4LB5A 4M71A 1XMKA 1HKQA 4ENJA 4WX9A 3TOAA 2KKOA 1T38A 3K2ZA 4HF1A 1MD0A 3FX3A 1ONVA 4U7BA 2ETHA 4G8XA 1YW7A 3RKXA 4HX7A 3M8EA 4XLNF 3ZN0A 1DP7P 1ZGJA 1DDNA 3EDPA 2ELHA 2HQRA 3ABTA 1B59A 2OZ6A 2E1CA 1KQ9A 4UXNA 2ESHA 3O3KA 3WTXC 2P5VA 1W7PD 1TLHB 4O3MA 3WGHA 1FC3A 3MFKA 2QWWA 5DD4A 2H09A 3QOPA 5DD8A 2CW0F 4YIIA 3LA3A 4OU0A 2XAQA 3RDIA 5ILUA 4LK1F 2FQ3A 1BC7C 4EJTA 5E8GA 1ZRFA 3PQKA 3CUOA 1PUEE 2FBKA 1BI0A 3DQVC 2O6GE 3LWFA 1BJAA 4BAYA 3PQJA 3R0JA 3I53A 4LB6B 2JRTA 1K79A 3BOQA 4ENNA 4UVBA 5CVVA 1V3FA 1LJ9A 1TTYA 3DXJF 1QZZA 1USSA 4HZFA 3ZPLA 2YU3A 1I1GA 1KU7A 1LDDA 2AS5F 1J5YA 5CJ9A 2FNPA 1IXCA 3RKYA 4G7ZF 2YSRA 2J5PA 1BI2A 1U5TB 2FNAA 1QZYA 1ODDA 1B9NA 2H27A 3ABUA 4XSXF 1YS6A 2VC1A 4EVIA 3BZ6A 1YYVA 2XKPA 2R3SA 3ROUA 4Y13A 3V8LA 1OR7A 3LA7A 1O57A 2DBBA 3FMQA 5HDGA 3M1EA 4GO1A 1TNSA 2M8EA 4I7HA 4PGHA 1YLFA 4A6EA 2OAZA 1O3RA 2VOPA 2EK5A 2QVOA 2K4JA 2Q8KA 1Z9CA 1FYLA 4ZH4F 1H9GA 3F3XA 1RI7A 2MLGA 2ZMEA 4RB3C 3BJ6A 2HKOA 1ZLJA 4G9YA 3IRQA 5A2QZ 3D0SA 3TDUC 4N9IA 2IA2A 4IRGA 3ISPA 3C18A 2ZXJA 5ICEA 1PDNC 5DUIA 1FSHA 4YIFA 2J5OA 5FB2A 3ZMTA 2DFIA 4MEYF 4I0AA 3TO6A 5ICCA 1BI1A 1RNLA 2RGVA 5FFXA 3GEZA 2L01A 1ULYA 2M5WA 2CG4A 1KYWA 3TQNA 2W84A 2HZTA 1WWXA 5AONA 2XRNA 2BGCA 2YX7A 4WCGA 2XAHA 1XSDA 1O3QA 3U9GA 2Q0OA 3RPUA 4RAZA 4HAMA 4A5MA 3WU0A 5IT3A 2E7WA 4KN4X 1W5SA 1XSVA 4JQFA 4KMFA 4A6DA 3J81K 4F7ZA 3O6BB 2XAFA 3DKWA 3EQLF 5D4SA 3E5QA 3KLOA 3JW4A 2JTVA 4ETSA 3GZ6A 4UVAA 2R7FA 1MDMA 1XGNA 1LDKB 3K69A 1U5TA 1C0WA 3F8FA 4A0YA 5ILVA 4Z2YA 1EH8A 2FOKA 2W25A 1FP1D 2DQLA 3P9IA 3FM5A 5H6RA 3JAMK 1R7JA 2XASA 4MTDA 4TV7A 1FOKA 2ZFWA 5D6EA 4NHJA 4OMZA 2JSCA 4BHPA 5J6XA 5IT9Z 3ZP5A 3I58A 2JPCA 4MEXF 3HTSB 2CGPA 3I0TA 4IJAA 4IRIA 1CGPA 4OMYA 2ZO4A 3H3ZA 1FSEA 4LG0A 5LBQA 2M45A 3O2PE 4MGRA 3HOTA 3J80Z 2JT1A 2DPUA 4ON0A 1LQ1A 4UNOA 2EA4A 1TW2A 3HSFA 4AVPA 3HIFA 2CFXA 2NNNA 1GXPA 1L3LA 1SD4A 1T0FA 3TDZC 1MJBA 3IHUA 4AIKA 1BI3A 3DFGA 4LD5A 2VBXA 1OYIA 5D6FA 3WTUC 4HDVA 4M6XA 4ESFA 3FXUA 5LGTA 4K2EA 2L4MA 4KYWA 3SZPA 5LEJA 1D8JA 5DDGA 1U78A 3KZYA 4FT8A 2UXNA 4RB2C 3WE2A 2HQNA 2PI0A 2EV0A 2BBYA 2X4HA 2WWYA 3RPQA 4KT5C 2DI3A 2A6HF 1KQ8A 2O3FA 3ERED 3BPXA 4BH9A 2HEOA 2IRFG 2E1NA 1KQ0A 5HLIA 2DPDA 5DCMB 1SMYF 2CO5A 1Z05A 2VE8A 4M74A 1OYYA 4KUMA 3HSRA 5LHIA 3SHFA 3SZTA 2KJCA 1QQIA 1XGOA 4ENMA 1XB4A 1S8NA 4RGSA 1FWZA 3WODF 4A2UA 4BNCA 5D5XB 1OMIA 3F21A 5LHHA 1HW1A 3CUQA 3ZMVA 4KFCA 5K1YA 3WTVC 3QPTA 1HKTA 1FP2A 3QP5A 1BC8C 2XUBA 5KVRA 1D8KA 2ZCWA 4M6YA 2RVCA 2K7LA 3MWMA 1JE8A 1KU9A 5LRSA 3CJNA 5JR3A 4CO8A 1ZYRF 4KN7X 5E18F 3WTTC 5TJJA 2A6EF 3QAHA 4P55A 1JXSA 4RGXA 5LRRA 1YS7A 1TW3A 5JVTA 1IRGA 4IRHA 3H3UA 4LLLA 3JAMZ 1ZG5A 2DO7A 2EFQA 4G7HF 5BOXA 1LVAA 3G3ZA 4KNYA 1XGSA 1ZHFA 4ZYGA 4EJVA 2VXZA 4WXDA 4Y17A 2F5CA 2KIUA 1HSTA 4P5OA 3L00A 1YQAA 2HDCA 2FRHA 2QYOA 2NS0A 1QPMA 4L0YB 1KU3A 3RI4A 1I1SA 5DCMA 5L3DA 4CGZA 3LFKA 3M9AA 1LB2A 5ERIA 1LNWA 3CDHA 4M9ZA 1J9IA 3I5UA 5D5WB 3T1BA 3B02A 1F4KA 2FSWA 3MAJA 4RB0A 2WC2A 2LNBA 2COMA 1IUYA 2FA5A 3ULQB 1XGMA 2M30A 1ZAOA 4H0EA 3ZMDA 2QZ8A 3NRVA 1O7FA 5L3CA 5BPDA 4YG2F 2FU4A 3D5LA 5LGNA 2Z33A 5L3BA 4S04A 3RKWA 2P6TA 4UV8A 3MZHA 3F8CA 4XLPF 3JTGA 4MTEA 2RKHA 4O5VA 2HTSA 1Z6TA 2NAZA 1R5GA 3F8MA 3V8KA 1XDUA 3KCCA 4HOBA 2HR3A 3TO9A 4RS8A 2P7VB 2P8TA 1O3TA 1NHAA 2IJLA 3RJPA 5JFRA 2VBYA 4BYYA 4I01A 3S2WA 1RZ4A 5K5OA 3FM3A 4YFXF 4OINF 2YR2A 3E5UA 5E1ZB 2DW4A 3BDDA 2QBYB 4LLNA 1R22A 3I64A 1REPC 5F1RA 1KA8A 1WQ2A 1G3SA 1QNTA 3QU6A 2K4BA 3U1DA 3CLOA 3N4MA 1HBXG 2ZKZA 4CDGA 3KP3A 2H6BA 5CVJA 3IC7A 3WG9A 3RIRA 3KP4A 1YO5C 2CSOA 5J8CA 1VTNC 4ZYEA 3F6VA 2GIVA 3GF2A 3HUGA 4ESBA 2VONA 3HRTA 4MQ9F 2QQAA 4OOIA 2W24A 1P6RA 4Q47A 2OQGA 1GHCA 3HRMA 4L9NA 3K9TA 5FGMA 2FE3A 2CWEA 3CO6C 2XKOA 3ELKA 4OIQF 4UV9A 1FX7A 3P9CA 3E97A 5E8IA 3IWZA 3K1PA 1ON2A 4A5NA 3HYIA 3C3WA 4HQMA 2DTRA 2P4WA 2TDXA 4WXCA 4P9UA 1V4RA 1TQPA 1FY7A 2VBZA 5FD6A 3L2CA 3JTHA 5ED4A 4HF2A 3KEOA 2Y75A 3EUHA 4KICA 2P5KA 2GWRA 3HRUA 2OU2A 3I59B 1G3WA 2W85A 3P7NA 5EEHA 3GUDA 2VODA 2QQBA 2PN6A 1G6NA 2F5DA 2QBYA 2PJPA 1E2XA 1FT9A 3SFZA 4AIHA 4QLCU 4IHTA 1G3YA 3PFIA 4LJZF 1G4DA 5D8LB 4L9JA 5ICFA 2P6SA 3TGNA 1Q1HA 3E3VA 1FYMA 2UWMA 1DPRA 2Q2EA 3KP5A 4HW0A 1ZRDA 4OIOF 1UHWA 5E20A 3GWZA 4GGGA 3COAC 1R1TA 3KEQA 1YIOA 4L5IA 2DLLA 4BHCA 2LDUA 2K86A 4E70A 1Y0UA 5L3FA 1ON1A 5F6FA 1U6GA 3H92A 2UZKA 2XROA 2ISZA 4PGGA 1ZRCA 1U5TC 1BOAA 4MHGA 2RN7A 1ZH5A 1R58A 4EM1A 1A04A 4LMYA 3FXRA 1AOYA 4IPAA 3KZZA 1XN7A 3GFJA 1Z91A 2M1BA 2XVCA 4LFUA 2NRAC 2VOOA 3LQRA 2EB7A 1FLIA 4MQVA 4L0ZB 4O6JA 5JHUA 1D5VA 5E17F 3ZN1A 4EJUA 1R36A 4M9XA 3W6JB 2RC4A 2G7HA 4AWXB 3DEUA 4UUVA 2KJBA 1RUOA 5FD5A 2KIFA 3FHZA 3BWGA 2GA1A 5BMZA 1FBUA 4AIJA 3P9KA 5HS8A 2DT5A 3MQ0A 2PFBA 5AIQA 2GAUA 2F5EA 3GFIA 5ICGA 2WTEA 3R0AA 4Q48A 3VEPA 3GW2A 5CYVA 1K7AA 1XCVA 5BQTA 1J0RA 5D8KB 1U2WA 1DPUA 2RNJA 1BN5A 4WWCA 3VOEA 1U3EM 4HF0A 4CYDA 5CVRA 4Q4ZF 5CLSA 1ZLKA 3FF5A 6PAXA 4PDKA 1XCBA 3BY6A 4ZYDA 3WGIA 4HV6A 2IA1A 3ZMUA 2DAOA 2ISYA 4EM2A 2GZWA 2VC0A 5K5RA 3I4PA 3WTSC 2QUFA 5DUKA 2P5LC 1FYKA 3V7SA 5ILSA 2EFNA 2EFPA 2GQQA 2A69F 2RDPA 2H6CA 1H0MA 5EEGA 4Q5SF 3W6KB 1J2XA 3KFWX 1IN5A 2VT3A 3T5XA 5L3EA 4G7OF 1WRJA 5LEKA 3HRSA 5HVQC 1SD7A 3KP7A 2PEXA 2QQ9A 1ZARA 3E6DA 2AXLA 2DU9A 4I02A 3E5XA 5E1WA 2HWVA 3GVAA 3R60A 5BPIA 1SD6A 2HKXA 5CVUA 3U2RA 5LGUA 2W57A 1ZG3A 2KRFA 4EJOA 3KE2A 5DEQA 4G94A 3I54A 3VB2A 1SFUA 2V6CA 3CUQC 1WI9A 2FEZA 4RAYA 1R1UA 4HBLA 1EH6A 3V8JA 3J81Z 1R1VA 1Z7UA 1B6AA 2XGXA 3T8TA 2D1HA 1KGSA 2H94A 2DK8A 4DQ2A 3LA2A 1IN7A 2MH2A 2KIMA 4R79A 1J59A 1S7OA 5J8FA 2V1UA 1YFHA 2WV0A 4DNCA 3QRFF 1R00A 2BEOA 2IPQX 5DCFA 1W7PB 1IN8A 3Q5FA 2ESNA 3E6MA 3F22A 2PG4A 3KP2A 2Y0MA 4L18B 2D45A 1PP7U 4S05A 4GCVA 2K27A 2GXGA 4M9SA 1O7LA 2NYXA 2HFHA 5LLQA 1ZGAA 4I98B 2ACJA 3NQOA 1O3SA 3Q9SA 1FZPB 4EV0A 4RB1A 2OA4A 1OPCA 3BPVA 5A2QK 3OOPA 1HSJA 3F6OA 2BE5F 2LF7A 4L9VA 3V7CA 3ZQ7A 4R1HA 2QM3A 3KETA 2EWNA 2V9VA 1PP8F 2QLZA 2DQRA 2HYGD 4AD9A 2LKPA 2IA0A 2G9WA 2ZBKA 3GLXA 5L3GA 3QP6A 4OIRF 2PMUA 1FNNA 1R23A 4U0VA 2JZYA 4L9TA 2FF4A 4R8HA 4HLXA 2BV6A 3TKYA 1B1BA 4HA8A 1UB9A 2EFWA 4RGUA 3J7AO 1W5TA 2EV6A 2VBWA 1QO0D 3BP8A 2ADUA 1SMTA 3WE3A 3BROA 2YX4A 1OKRA 4KDPA 3L09A 3CTAA 2ZMEB 3VFZA 3SXYA 2RQPA 3ZMSA 4P96A 5DV5A 3R4KA 4D0PA 1XD7A 1IXRC 2B0LA 5CVIA 4UHTA 2O8XA 4IVNA 1W7PA 1YTYA 3GXOA 4XRFA 1WSUA 1EV7A 4XBFA 5HLHA 5IT9K 2UXXA 3KLNA 4LGWA 1IF1A 2O03A 4PZJA 3FMRA 4HX8A 3K0LA 1MJ9A 4HV5A 2XAGA 2JPBA 2FXAA 2A3SA 3K1MA 2HYFA 3VODA 2RV8A 2MBFA 4GYIA 4KIFA 1FPQA 1F9NA 3DP7A 1UCRA 1XDSA 3WGGA 1S6LA 3BJOA 3J80K 4GYGA 4G6DA 2C6YA 3QPHA 4BHBA 1TBXA 3AAFA 1XSXA 2YPRA 5LHGA 1EH7A 2OD5A 1MDMB 4HDUA 4CZZA 1QBJA 1P4WA 1GVJA 4KIGA 3JSOA 3DF8A 1TQMA 2GXBA 4WF2A 2EFOA 4BQAA 1FBQA 3I71A 4YFKF 4FX4A 3MEXA 1UFMA 4KA4A 1IAWA 4U88A 1SAXA 2DK5A 1SD5A 4N9HA 2XAJA 1MKMA 3DV8A 2VN2A 1HKSA 2XIGA 4EMSA 3MCZA 3DPTA 1BIAA 2Z99A 1I5ZA 4UVCA 5K5QA 3LAPA 3E6CC 4U0YA 3F23A 4YFNF 1U8RA 2ZJ2A 1T6SA 4A12A 1I27A 3IWFA 3R6SA 2A07F 4M72A 4HX4A 2ZNZA 2HS5A 5HS7A 1G3TA 4LG0B 3LAJA 1OYWA 3C7JA 2MC3A 5FLXK 2FMYA 1LDJA 4Y15A 3QU3A 2PMHA 1MJAA 1MGTA 1IZ1A 4ZZDA 1L0OC 5D4RA 4WK8F 3M7GA 2EJRA 2FBHA 2L54A 5KK1A 1I6XA 2XHKA 3OV8A 3WTZA 3JSPA 3EYIA 1X3UA 4G6QA 3M8FA 4M73A 3CO7C 3HOSA 1IXSB 4ZYHA 3N97A 1F1ZA 2MD5A 1J7KA 3RTRA 5BS6A 3R61A 3RYRA 1TQIA 4PCQA 3L7WA 2ZNYA 3K1NA 3RYPA 1IW7F 1GXQA 1HW2A 2STTA 1XMAA 4KMUX 4QWQA 4RGRA 4EM0B 2VT2A 2FBIA 1H9TA 4U7DA 3E6BA 2V79A 2OBPA 1WKMA 1JHHA 4HLYA 5E1XA 5F64A 2V1XA 1E17A 4LK0F 1BM9A 1RIOH 3FWEA 1HQCA 1STZA 2IW5A 1FBSA 4HQEA 4ENKA 3F8NA 2Z3YA 1AWCA 1T98A 1HW5A 2FMLA 3ECOA 2HGCA 3GYHX 4IXAA 2EA2A 3V7RA 3CUQB 1Z6RA 2LF8A 3I59A 3LQQA 1YW8A
chains in the Genus database with same CATH superfamily
5HDNA 4XNFA 1OFCX 5JI6A 1DU6A 2NS7A 4I0BA 3F72A 1CF7B 2OCEA 4B44A 2V4JC 4N4NB 4P9FA 2O7OA 3CC4I 2K02A 5H20A 5H6QA 4B4CA 3DBLB 1T95A 2RQQA 2E7XA 2K9QA 3VWBA 4XONA 1WZ2A 3K2AA 4KIBA 3GZ5A 2EH3A 2M8GX 2JUCA 4J00A 1QHGA 1P4AA 2E71A 2ZSIB 2CYYA 2DJNA 1RUNA 1IRXA 4A0XA 2PBIA 1YG2A 4DIQA 3EPZA 3CMYA 1BL0A 1K78B 2G7UA 3CP2A 3FK7A 3NAUA 1VQ9I 1D0YA 3LL7A 3OWTA 3LSGA 3VYSB 3T0YA 4C3JJ 1TWFJ 3WTYC 4HYEA 1EF4A 4IHSA 2Y48A 3RSNA 3OYNA 4FX0A 1Y56A 1TNTA 2W1OA 1HXDA 2A68F 4LG3A 4CHUA 3GFLA 3AG2H 3PNYA 5DYMA 1I39A 3Q0UA 4V2FA 3FXOA 1I50J 3HKZN 3LSPA 2GA2A 2MD0A 2DMTA 2G0EA 4EJWA 4A3LJ 1YW9A 3DEEA 1P2FA 1P92A 2A5YB 4FE4A 4AC0A 2D1VA 2ZXWH 4RDUA 4L5JA 2VPRA 4IF4A 3FXQA 3WHBA 2KP6A 5FRNA 1MBJA 4A3FJ 3PSFA 1P4XA 3QYEA 1S29A 2VQGA 1LEBA 1SFXA 3D5SC 3MZYA 2Z9OA 1YITI 2M4KA 5J1RA 2QSFX 5B3SH 4C2UA 2LVSA 2Z1DA 3SQNA 1E3HA 3SEQA 4KITB 1DUXC 3GO5A 1HOMA 1Z1DA 3I9V2 1PJRA 3BG3A 2F48A 4JBAA 1JHFA 3JRAA 3JR9A 3F8BA 3CCEI 2L4AA 5FLXZ 3JRDA 1QGPA 1SAUA 3CP8A 4FHTA 4BJ6C 4C9YA 3A02A 1JJ8C 1Y0NA 4ASNA 2LC2A 3HSEA 4EGYA 1B72B 1ZREA 3HHGA 3C2GA 2EIJH 3BG5A 3H0GJ 1R5HA 4LITA 4CCJA 3OS2A 4ESJA 5TRDA 4XLEA 4B8XA 2XDVA 1ETWA 5F04A 1KU2A 5HDKA 1W0TA 1U9NA 3BR0A 3L9FA 4OIPF 2HPIA 4IQ4A 4NQWA 4BE2A 1T33A 2IVMA 4LLGF 4ZZLA 2VE9A 1S3JA 1BW6A 2A61A 1USTA 1T39A 1T2KA 4BXUA 2O61A 2F5FA 2BYVE 2OQRA 3RCOA 1U9OA 5B5EC 2QEXI 4N0BA 1V5GA 5E79C 2COBA 2F2EA 5KCMA 2IGMA 4D7MA 1BIBA 3BTIA 1BBYA 2X0LA 4D9JA 4A0ZA 4PJMA 5HS9A 3S2DJ 2QENA 2PMZN 5HOOA 4IHVA 2E60A 1JUPA 3FXLA 3IKVA 1A35A 2L02A 2PQ8A 3GFMA 1KZHA 1VI0A 1O4XA 4XORA 3V4GA 3D1NI 1LEAA 3K70C 2JSPA 2XV4S 4CCOA 4G6TB 2B7EA 1IN4A 2M7BA 1B9MA 4B09A 4MNUA 1NK3P 1I6HJ 3DWLE 4JK1X 3OL4A 4M3FA 2VKEA 2L9RA 1CF7A 2KQRA 3FMSA 3TMOA 4W97A 5M3FJ 4I09A 3FXKA 1JGSA 3OYIA 3OYKA 2RAEA 3DPLC 3HTUA 1LVKA 2PJRA 5D5VB 1ZG1A 2HOEA 5FO5A 1WI3A 4PSXA 2STWA 3MMYB 3KZIC 4EQQA 3EETA 5HLGA 1K78A 1MZBA 1S7AA 3LSTA 1SFEA 4I2OA 3DTKA 1UHMA 1D3YA 2DODA 2CQKA 2LSOA 4ABZA 2V1DA 5D5UB 3G73A 2XSDC 3IRRA 3ZCOA 4CICA 2LR8A 2MA3A 1RETA 1HA8A 1AA7A 1MBGA 1W4MA 5LD2C 1IN6A 1J75A 1V5EA 2HTJA 1KYZA 2IT0A 3ECHA 3T8RA 2H1KA 1V5FA 1IRFA 5GAGJ 3HHHA 3M4OJ 1ZN2A 2OZUA 2CU7A 3GX4X 3V42A 3IL2A 1ETKA 5FFZA 4GXOA 4U0WA 3TOBA 1K6OA 4ZTFA 2PLYA 2XSJC 3REOA 2P7CB 3ML6A 3IKTA 3NEUA 3TO7A 1B4AA 4XSZF 5IYDJ 3WTWC 5AIPA 4IKFA 3BJAA 2LKXA 4CXFA 2MLKA 2CRGA 3S93A 3AG3H 2M87A 3Q9VA 3UR3C 4EGZA 2EV5A 3C1DA 2XGDA 4WXHA 2L7FP 2L3DA 3Q3SA 2Z5UA 4NB5A 2NNYA 1VQNI 3LSRA 4DZPA 2OV7A 3KP6A 2MH9A 1IV6A 2R7DA 5IP7J 2R5YA 2EZHA 3WU1B 3EYYA 4XICA 2CUEA 2Y30A 3K4BA 3B73A 4XN3A 2IP2A 1VQPI 4CZCA 3FZVA 3CESA 4JYKA 3JRCA 2O0YA 1MBHA 2FD5A 2KT0A 2D2WA 4BBSJ 3CCLI 1FIPA 2Y0SA 3ZMZA 2JUGA 3L2VA 1Y1VJ 1F5TA 4LB5A 2E36A 4M71A 1XMKA 1HKQA 4ENJA 4WX9A 3TOAA 2E5NA 4Y33A 1K6YA 4PUSA 1WJCA 2KKOA 1T38A 3K2ZA 4HF1A 1T56A 1MD0A 3FX3A 1ONVA 4U7BA 1W36C 4BQOA 2ETHA 4G8XA 3HOWJ 1BW5A 1YW7A 3RKXA 2CQ7A 2VKDA 4HX7A 4B3AA 1MH4A 2WV1A 3M8EA 1D1BA 4XLNF 3ZN0A 2X6WA 1P7JA 1DP7P 1ZGJA 1DDNA 3EDPA 2ELHA 2HQRA 2JJ7A 3FDYA 4J19A 3ABTA 1B59A 2GLOA 2OZ6A 4YELA 4BDZA 1U8BA 2E1CA 2LY9A 1KQ9A 2VXDA 4UXNA 2ESHA 3O3KA 3WTXC 2X6XA 4UB8C 1VQLI 2P5VA 5B1AH 4IHWA 5CQGA 3G1OA 2ZSHB 1W7PD 3PIOF 1TLHB 1TC3C 4O3MA 3G4SI 5GP9A 3WGHA 1DQUA 2M4GA 2M34A 1FC3A 3BTLA 3MFKA 1IJWC 2QWWA 5DD4A 3S14J 2H09A 3QOPA 5DD8A 2CW0F 4YIIA 4KISA 3LA3A 3TP0A 1R9TJ 2AHQA 2LK2A 1LUJB 4OU0A 2DA5A 1WJFA 2VQHA 2WA0A 1ORKA 2V1NA 2XAQA 3RDIA 5ILUA 3SYTA 4LK1F 2FQ3A 1WJ5A 2QSHX 5FKMA 1BC7C 2VIXA 4EJTA 5E8GA 1OJLA 1ZRFA 3OYJA 1X1BA 3PQKA 3CUOA 1PUEE 2FBKA 1BI0A 2OPTA 3LSJA 3DQVC 2O6GE 2HDWA 3LWFA 1BJAA 4L5EA 4BAYA 3PQJA 2Q2EB 3R0JA 4Z6YA 1AKHB 5C3EJ 3I53A 3LSHA 5F0CA 4LB6B 2JRTA 1K79A 3BOQA 4ENNA 2OCCH 4UVBA 5CVVA 1V3FA 1LJ9A 1TTYA 2DT6A 3DXJF 3K7AJ 1QZZA 2IS6A 3NWTA 3ABLH 1USSA 4HZFA 3ZPLA 2YU3A 5IOZA 1I1GA 2EINH 2ZXIA 4UUTA 1KU7A 5M3MJ 3PIPF 2IGNA 3FKIJ 1ETXA 3BLYA 1LDDA 2AS5F 2K85A 1J5YA 3CJRB 3ABMH 1ETQA 1R6RA 1I3QJ 2PX9A 3UKGA 3CC7I 5CJ9A 2FNPA 3BCBA 1IXCA 5E3LA 3RKYA 4BEHA 4G7ZF 3TEDA 2NVUB 2YSRA 2J5PA 4E7ZA 1P9QC 3OYEA 1BI2A 4A3JJ 1U5TB 2FNAA 2LD5A 1QZYA 1ODDA 2LBFA 1B9NA 1XTAA 2H27A 3MD2A 1ACIA 3ABUA 4XSXF 1ITYA 1XX5A 2YU9J 1YS6A 2VC1A 3QPLA 3K6GA 4EVIA 2F4MB 3BZ6A 4XRSG 1YYVA 1WJAA 2XKPA 1FTTA 1PYVA 2R3SA 1G59A 2JA8J 3ROUA 4Y13A 4ZC3A 3V8LA 1OR7A 3LA7A 1O57A 2DBBA 1DGRM 1D1AA 3JRGA 3BR6A 3CJTB 3FMQA 5HDGA 3M1EA 4F92B 4GO1A 1TNSA 3ZQIA 2M8EA 4I7HA 4PGHA 1YLFA 2LTPA 4ZTJA 2R93J 3ABKH 1MMAA 1JKPC 5JLWA 3FIWA 3W2WA 3A0HC 4A6EA 2OAZA 3DBRB 1O3RA 2VOPA 2EK5A 1SVOA 2QVOA 2K4JA 1X1PA 2Q8KA 1BR2A 3JRFA 3OL3A 1Z9CA 1FYLA 1OISA 1H9GA 4ZH4F 5J40A 2HOTA 3F3XA 4CCLA 5HODA 1RI7A 2NVQJ 2MLGA 2OJED 5IPAA 2ZMEA 4OAZA 2EZLA 4RB3C 3BJ6A 2HKOA 1ZLJA 2QGUA 1X4OA 4RM2A 4G9YA 1HF0A 4ZDOA 3IRQA 5A2QZ 3D0SA 2R7WA 2MW8A 2MABA 4M3GA 2ZMEC 4N4OB 4Y7NJ 3TDUC 4N9IA 4MO7A 1TWCJ 2IA2A 4GDFA 1ETVA 4IRGA 3ISPA 3C18A 2ZXJA 2DYSH 3A01B 5ICEA 1PDNC 5DUIA 3UNGC 1FSHA 4YIFA 3K4LA 2J5OA 5FB2A 1Z0XA 3ZMTA 2DFIA 4MEYF 4I0AA 4HPQA 4LIUA 3TO6A 5ICCA 1LE8A 5FROA 5M5WJ 3B6AA 1BI1A 1RNLA 4S0HB 4BU2A 2RGVA 5FFXA 3FXJA 2P81A 3GEZA 4I76A 2CQXA 1Z21A 2L01A 1ULYA 5GPAA 3S16J 4DBQA 2M5WA 3HPHA 2CG4A 1KYWA 1FJLA 3KEYA 5M5YJ 2LYCA 1WVRA 3TQNA 4X6AJ 2W84A 2HZTA 2VPLA 3FHNA 1WWXA 5AONA 2E1OA 1UJ8A 2XRNA 2BGCA 2YX7A 1Z3XA 4I99C 3LSKA 4WCGA 2XAHA 3PL8A 2L9VA 1XPXA 2JA6J 3HOXJ 4IL6C 1XSDA 3RZDJ 1O3QA 3U9GA 2Q0OA 3RPUA 4RAZA 2N8GA 3LOCA 2MG4A 2W00A 4FISA 4HAMA 2WY7Q 4A5MA 3WU0A 5IT3A 5KAIC 4E7HA 2E7WA 4KN4X 1W5SA 1XSVA 4JQFA 4KMFA 1IRZA 1UZCA 4A6DA 2W7NA 3J81K 2OTJI 4F7ZA 3O6BB 2XAFA 3ZQCA 1TL8A 3DKWA 2XF5A 1JTXA 3H1CA 2ID6A 1WFXA 2XGEA 3EQLF 3HXLA 5D4SA 3U1KA 2LKSA 2P0WA 3BZCA 3E5QA 3C2HA 3KLOA 3JW4A 2JTVA 4ETSA 2WAFA 3GZ6A 1JGGA 4UVAA 2R7FA 3IAM2 3VPRA 1MDMA 1XGNA 1LDKB 3K69A 4F93B 1Z67A 1U5TA 1Z77A 3F8FA 5IYBJ 2VJIA 4A0YA 1C0WA 2HI3A 4BXFA 1YJ9I 5ILVA 4Z2YA 1EH8A 2FOKA 2W25A 1FP1D 2GOMA 4PK4A 2DQLA 3TBIA 4YIRX 2JA5J 3P9IA 1V54H 3FM5A 5H6RA 1YX5A 3JAMK 1R7JA 2OUMA 2XASA 4MTDA 2VJ4A 1OCZH 4TV7A 1YJWI 1FOKA 2ZFWA 5D6EA 2WADA 1N25A 2DDAA 4NHJA 4OMZA 2JSCA 3PUFA 4BHPA 5J6XA 3LNQA 2OTLI 1PVEA 5IT9Z 4P1WA 3GTLJ 2KLOA 5DS9A 3ZP5A 3I58A 1OLTA 2JPCA 4RMNA 4MEXF 3M1CA 2DMUA 3HTSB 2CGPA 3I0TA 3ASOH 3HOVJ 1OCPA 2OC6A 4IJAA 4IRIA 1N78A 1CGPA 1J09A 1MBKA 4OMYA 2ZO4A 1NG7A 4IHYA 3H3ZA 3AL0C 1FSEA 4LG0A 4XRMA 5LBQA 2M45A 1IDYA 4C3IJ 4IHXA 3O2PE 4RAFA 4MGRA 3HOTA 3J80Z 2JT1A 2E1MB 2DPUA 1NK2P 2BHZA 4BXXJ 3K4NA 4ON0A 4E7SA 1LQ1A 4UNOA 2DA1A 3MKYB 2EA4A 1T8IA 1TW2A 3VSLA 4AU7A 3HSFA 4AVPA 3CQZJ 2V9KA 3HIFA 2CFXA 2NNNA 3A01A 3L2QA 1GXPA 3DKXA 2XAUA 4JP0A 2NVTJ 1L3LA 1NG6A 2VKHA 2DXIA 1SD4A 2EILH 1T0FA 1R5ID 3TDZC 5EG0B 2R5ZB 1N77A 1MJBA 3IHUA 4AIKA 2LH9A 1BI3A 3CJQB 3DFGA 1TT5B 1Y8QB 4LD5A 2AO9A 2VBXA 1OYIA 5D6FA 3WTUC 1K4SA 4HDVA 4M6XA 4ESFA 2Z2SB 3FXUA 5LGTA 4RA2A 2VJJA 4K2EA 1U0JA 3EUAA 2L4MA 2Y0SN 4KYWA 3SZPA 5LEJA 1D8JA 2JN6A 4CCMA 3DPUA 1EKEA 2JVHA 5DDGA 2FUG2 3G71I 2ZFUA 1U78A 3KZYA 4FT8A 2UXNA 4RB2C 3WE2A 2K5CA 2HQNA 3AFHA 1IV8A 2PI0A 2AQEA 2EV0A 2BBYA 2FOWA 2X4HA 2WWYA 3RPQA 4KT5C 1FMWA 2ECCA 4M3DA 2DI3A 5F1JA 2A6HF 1KQ8A 2O3FA 3ERED 2JWTA 3BPXA 4BH9A 2HEOA 2IRFG 5H2FC 2UV1A 2X85A 3PO2J 2E1NA 1K83J 2W82A 3CMAI 1KQ0A 1RC9A 5HLIA 2DPDA 5DCMB 1SMYF 2CO5A 4HG2A 1Z05A 1X19A 4BE0A 4W1UA 3BT9A 2DOFA 2VE8A 3DTEA 1VQMI 4MFDA 4M74A 2R7RA 1UELB 3EUKL 5E3OA 3QQAA 1OYYA 2H8RA 4KUMA 1UG2A 4Y4RA 2KRCA 2O5RA 3HSRA 5LHIA 2EIMH 2ZB9A 3SHFA 3SZTA 3N05A 1ENHA 2RNGA 2KJCA 1QQIA 3K70D 1XGOA 4ENMA 4AYBA 1XB4A 2VB6A 3S8PA 1CQTA 3DKYA 4QIWN 1S8NA 4RGSA 1FWZA 2HU9A 1A36A 2L7ZA 3WODF 4A2UA 4AVZA 3S15J 1HCRA 4BNCA 5D5XB 3S1MJ 1OMIA 5TISC 3F21A 5LHHA 1HW1A 3CUQA 4A3EJ 1QHHD 3ZMVA 2ME6A 2F5VA 1Q1VA 4KFCA 5K1YA 2D5VA 3ZGKA 3ZQGA 3WTVC 1PUFB 3QPTA 2XF7A 5GTIC 3ZRGA 3SZGA 1HKTA 1FP2A 3QP5A 1BC8C 2XUBA 5KVRA 1D8KA 2ZCWA 3IH2A 1BJZA 3WHCA 4M6YA 2KIQA 1WH5A 4RM3A 1H88C 1F43A 2RVCA 2K7LA 2CQNA 3MWMA 4IO9F 1JE8A 1KU9A 5LRSA 5IP9J 3BR1A 4JX4A 3CJNA 3W2AA 5JR3A 1YI2I 4CO8A 1MNMC 1ZYRF 2TCTA 1Z3YA 4KN7X 5FRMA 5E18F 5EG0A 2YUSA 3LFUA 3WTTC 5TJJA 2A6EF 1ZQ3P 3QAHA 3PNTA 2IEKA 4P55A 1B8IB 3PO3J 1YOVB 1JXSA 4RGXA 3Q0WA 2NVXJ 3HM5A 4II3A 3J7ZI 1RPWA 5LRRA 1YS7A 1EA3A 4LOCA 1TW3A 5JVTA 1EJ9A 4IRHA 3H3UA 1IRGA 4LLLA 4XKCA 3JAMZ 1ZG5A 2DO7A 2EFQA 4G7HF 4JOMA 2E2HJ 1H8AC 1GDTA 4DOZA 2QKMB 4BQNA 5EDNA 5BOXA 1LVAA 3G3ZA 4KNYA 2O9LA 1JT0A 4ZDPA 4IOAF 1XGSA 1ZHFA 3PNVA 1HDPA 1VZ0A 4ZYGA 4EJVA 2VXZA 4WXDA 1IDZA 4Y17A 5EF6A 4GRIA 2F5CA 3OS1A 3S17J 1BR4A 3L2UA 2KIUA 3OMYA 1HSTA 1MSFC 3CDIA 3HUGB 4P5OA 3L00A 3ZQHA 3HOZJ 1YQAA 4A3BJ 2IS1A 2HDCA 2FRHA 2QYOA 5C4JJ 2NS0A 1G2HA 3OYDA 1FOYA 1QPMA 2GIZA 2BZTA 4KT6A 4L0YB 1KU3A 3RI4A 1I1SA 2NVYJ 1R49A 5DCMA 5L3DA 2HDDA 1W36D 4CGZA 3LFKA 1RKTA 4AM3A 4M3BA 1B72A 3M9AA 1LB2A 5ERIA 1LNWA 3G1LA 3K4CA 3CDHA 3KYCB 4M9ZA 1S9HA 1J9IA 3I5UA 5D5WB 3T1BA 3B02A 1F4KA 2VQLA 3M07A 2FSWA 3I4NJ 4C2MJ 5K7ZA 3MAJA 1XMXA 1D1CA 4RB0A 2WC2A 2LNBA 3MZ8A 2WB1A 2COMA 3QYBA 3VYUB 1IUYA 2FA5A 3ULQB 3ZXSA 1XGMA 2M30A 1ZAOA 4H0EA 4DJAA 3ZMDA 2QZ8A 5GPCA 3PM1A 3NARA 3NRVA 1O7FA 5L3CA 2ZJPF 2BY0A 5BPDA 4YG2F 2FU4A 3D5LA 2XRLA 5LGNA 4DBRA 4XOPA 3TW7A 2OF7A 5L3BA 2Z33A 1S7EA 3RKWA 4S04A 2P6TA 3DLAA 4UV8A 2LY1A 1X2MA 1RR7A 1E0EA 2X6OA 1N75A 3BZKA 3MZHA 2R4GA 3F8CA 4XLPF 2BW3B 1SFOJ 2XF6A 3JTGA 4BKXA 4MTEA 2RKHA 4O5VA 3BG7A 2HTSA 1Z6TA 4B1RA 3DU6A 2NAZA 1SVMA 4Y3OA 1R5GA 3F8MA 2ELJA 3V8KA 1XDUA 4EEFG 3QYFA 3KCCA 3X2QH 1LFPA 4HOBA 2HR3A 2WAQA 3FBIB 4BGDA 3TO9A 4RS8A 4UB6C 4E4HA 4BBRJ 4MIMA 2P7VB 4DZJA 2P8TA 2VL8A 1O3TA 1NHAA 4II2A 2IJLA 3RJPA 5JFRA 2VBYA 3QODA 4I01A 3S2WA 4BYYA 1RZ4A 5E3NA 5K5OA 3FM3A 4YFXF 4OINF 2YR2A 2I10A 1K61A 3E5UA 1OCRH 5E1ZB 2DW4A 2LREA 3BDDA 3I56I 2MGQA 2GM4A 4DYRA 2QBYB 3ESWB 4LLNA 1R22A 4IEJA 3I64A 1Y8RB 2DOEA 1REPC 4D7NA 5F1RA 1KA8A 1WH7A 2ZJRF 1WQ2A 4BQQA 1G3SA 1QNTA 4B48A 3QU6A 4YRVA 2MC4A 4BY1J 1MH3A 2K4BA 2X1EA 3U1DA 2FX0A 3CLOA 1R4MB 3N4MA 1HBXG 3I55I 2A5WA 3OYLA 2I8DA 2ZKZA 4NUBA 3KP3A 4CDGA 2PMZA 3KIOA 1H89C 2H6BA 5CVJA 2BHYA 2XB0X 3O8HA 2DFHA 3IC7A 3WG9A 3RIRA 2M9HA 2LG4A 3W3CA 4F3QA 1Z7LA 3KP4A 1JKRC 1YO5C 4E6KG 2CSOA 5J8CA 3G1MA 1VTNC 1SEUA 1SVLA 2E19A 4ZYEA 3OSFA 1JKOC 1UAAA 3F6VA 4HEA2 1MMSA 2GIVA 3GF2A 3HUGA 4ESBA 2X6YA 2VONA 5F27A 1WGXA 2JK3A 3HRTA 4MQ9F 2QQAA 4OOIA 4D1QA 2W24A 3DBHB 3FBNB 1P6RA 4Q47A 2FQ4A 1VQ8I 2R7UA 1QA6A 1TWGJ 2IXSA 2OQGA 1GHCA 3JRBA 3HL2A 1MMDA 3CCJI 2IS4A 3HRMA 1P7IA 3CF2A 2ECBA 4L9NA 3K9TA 5FGMA 3S1QJ 2FE3A 2CWEA 2DA4A 3CO6C 3E0JB 2XKOA 4BY7J 3ELKA 1OQYA 4C3HJ 4FE7A 4OIQF 2Q1ZB 4UV9A 1FX7A 2QQ8A 2CUJA 1IGNA 3JRHA 3P9CA 2XPUA 3E97A 3G2BA 1D5YA 4XLAA 5FKNA 2CUFA 5E8IA 5C44J 3DLLF 3IWZA 3K1PA 3GTOJ 1ON2A 4A5NA 3HYIA 1OR7C 3C3WA 4HQMA 3OYBA 1VF9A 3H36A 1XC5A 2BXZA 3IV5A 2DTRA 2P4WA 2GBYA 5EGOB 4A3MJ 2TDXA 4PJJA 4BE1A 2AXTC 3CD6I 3CCUI 4WXCA 4P9UA 4BS9A 1V4RA 1TQPA 1FY7A 2BW3A 1MSEC 2JQ7A 2VBZA 1MNEA 5FD6A 3BCAA 2VLAA 4XIDA 3L2CA 3JTHA 4XOTA 1FEXA 5ED4A 4HF2A 3KEOA 2DA7A 3VSKA 2L9SA 2Y75A 5E3MA 3EUHA 4KICA 1MMNA 2P5KA 2GWRA 3HRUA 1VQ7I 4BUPA 3ZQLA 2R7QA 2OU2A 2Y31A 2V9PA 2K9NA 3I59B 3J7AY 2HVQA 1G3WA 2W85A 2X1CA 2DT7B 3P7NA 3BTCA 5EEHA 1X3WB 3GUDA 2VODA 2QQBA 1IO2A 2PN6A 3L2RA 1G6NA 4QTRA 2K9SA 2DFEA 1W0UA 4PJNA 2F5DA 1FOWA 4U87A 4A3IJ 3HOYJ 2DDBA 1VQKI 2QBYA 3C2BA 2V7FA 2PJPA 1E2XA 1RR8C 1FT9A 4E7LA 3GTPJ 3SFZA 4AIHA 2FJ1A 2DMQA 2LMDA 4ITVA 2L7MP 3WG7H 2I5UA 3GTJJ 1UHSA 5F0HA 1GUUA 5JHFA 4QLCU 3CCMI 4IHTA 1G3YA 3PFIA 4LJZF 4E7KA 2Y9YA 3RPUD 1G4DA 2IGOA 5D8LB 4L9JA 1R4NB 2P6SA 3PSIA 5ICFA 3TGNA 1Q1HA 3E3VA 1FYMA 2UWMA 1DPRA 3CC2I 3E1SA 2Q2EA 1HC8A 1GT0C 2M0MA 3KP5A 1AKHA 2CFOA 3J7YJ 3HZJA 1ZK8A 1RESA 4AYBN 4HW0A 1ZRDA 1OCTC 2DYRH 3RZOJ 2BY2A 4OIOF 3KYLA 3E7LA 1UHWA 2KDZA 4DGWB 3CCVI 2IGKA 5GAEJ 3NWSA 5E20A 1Y1WJ 2HZDA 3GWZA 3MVPA 4CA0A 5J47A 3GLLA 4GGGA 3COAC 1VFCA 1R1TA 2F4IA 4XLFA 3LSIA 2CH0A 3KEQA 3OR1C 1YIOA 4L5IA 2DLLA 4BHCA 2LDUA 3MKZA 1YE9A 2K86A 4E70A 1Y0UA 2HOAA 1FIAA 5L3FA 2W48A 1HLVA 1ON1A 2LFBA 1IUFA 1RRJA 5F6FA 4XKBA 1U6GA 2ZC2A 4QPQA 3H92A 4OAYA 3QOEA 4BACA 3ONQA 3TP3A 2UZKA 1I3AA 2XROA 2ISZA 4PGGA 1GVDA 2L2OA 2CJJA 4HSTA 1ZRCA 1U5TC 2A05A 2QKLB 1BOAA 4CYCB 4MHGA 2R7OA 2RN7A 3PJRA 1ZH5A 1R58A 3I3LA 3RQIA 4EM1A 1GV5A 2LP0A 5C4XJ 1A04A 4XK4A 4DYCA 4LMYA 4CUGA 4NQWB 2M0CA 3FXRA 1AOYA 4IPAA 3KZZA 5CKTA 5EGOA 1XN7A 3GFJA 2MSYA 1Z91A 1M1EB 2F6CA 3DEWA 4F91B 2M1BA 1LPQA 4I6ZA 2XVCA 4LFUA 3OYGA 5FKOA 1ZGWA 2NRAC 1TP4A 3S3MA 3S2HJ 4A3CJ 2VOOA 3LQRA 2EB7A 4IQJA 1FLIA 1G8XA 3BR2A 4MQVA 1ZR4A 4L0ZB 3F9KA 4FETA 4O6JA 5JHUA 1XS9A 1D5VA 5E17F 3ZN1A 4EJUA 1ETOA 4B47A 1R36A 3IH3A 4F55A 4HNTA 4M9XA 3W6JB 1NTCA 4UUSB 2RC4A 1OCOH 2G7HA 4AWXB 3DEUA 4XN0A 2DJIA 4UUVA 3AG4H 2WBMA 3JCUC 3ZQFA 4RBOA 5IOYA 2KJBA 1RUOA 5FD5A 3Q0VA 2KIFA 1D0ZA 4XKWA 3FHZA 3BWGA 2GA1A 5BMZA 4D5FA 2LY2A 1FBUA 4HSRA 4AIJA 3P9KA 3TW6A 5HS8A 2DT5A 2DCEA 2PJRB 3MQ0A 2X48A 2PFBA 5AIQA 3OIOA 2GAUA 3PFYA 2F5EA 3GFIA 3GCMA 5ICGA 2WTEA 1T0FC 3R0AA 4Q48A 3VEPA 3GW2A 2K40A 5K7HA 2EIKH 5CYVA 1K7AA 4CSWA 1XCVA 2E34A 4M3EA 5BQTA 4J01A 1J0RA 3OS0A 2BY1A 5D8KB 1U2WA 1DPUA 1SANA 2RNJA 3H5RA 1BN5A 1POGA 4WWCA 2WB1N 3VOEA 1U3EM 3H35A 1V55H 5DM6F 4HF0A 2BVLA 4CYDA 5CVRA 3FXMA 4Q4ZF 5GTHC 1X3ZB 5CLSA 1ZLKA 3ASNH 2Y9ZA 2K9LA 4IX7A 2Y69H 3FF5A 4NC7A 6PAXA 4PDKA 3S1NJ 1XCBA 3BY6A 3RQ4A 4ZYDA 3WGIA 3MN2A 4XLHA 2DN0A 4HV6A 2IA1A 3ZMUA 4A3DJ 2DAOA 2KL4A 5EEAA 3HGYA 2ISYA 4EM2A 5TGTA 2GZWA 3H9GA 3CLQA 3KX2A 2VC0A 5K5RA 3I4PA 2K3PA 3WTSC 2QUFA 2IAIA 5DUKA 2P5LC 1FYKA 4BJ5C 3K4MA 3V7SA 2WAQN 4E7IA 5ILSA 2EFNA 3HC7A 5EZHA 2EFPA 2EZIA 2R5YB 1Y6IA 1YRNB 1X58A 2GQQA 2DOAA 5K7FA 3OYMA 4CYCA 2CW7A 2A69F 2RDPA 2H6CA 1H0MA 5EEGA 2EBIA 1KONA 5CQEA 1WJDA 2ZJQF 4Q5SF 3W6KB 1J2XA 3KFWX 1IN5A 3BG6A 1VNDA 2M2EA 2VT3A 3T5XA 5L3EA 4G7OF 1WRJA 5LEKA 3HRSA 5HVQC 1LKXA 2BVMA 3P5JA 1R71A 3HEFA 1SD7A 3KP7A 3QPSA 2PEXA 2GOXB 2QQ9A 2CV2A 1ZARA 3I4MJ 2CS3A 1FMVA 4C2TA 2H1LA 1TWAJ 3E6DA 2AXLA 2DU9A 4I02A 3E5XA 2XC7A 1QVTA 4RLFA 5E1WA 2HWVA 2M3AA 3GVAA 3R60A 5BPIA 1SD6A 2HKXA 2IBDA 5CVUA 3U2RA 5LGUA 5HNHA 3S1RJ 2W57A 1E3PA 1ZG3A 4QPOA 3H5AA 2KRFA 3PUBA 2HOSA 4EJOA 5FLMJ 3KE2A 5DEQA 5KHDA 1DP3A 4G94A 3I54A 3VB2A 4HNVA 1SFUA 2LLKA 5JLXA 2V6CA 3CUQC 1JTYA 1WI9A 1R1UA 2FEZA 4RAYA 1WCMJ 2NOGA 3U21A 1EH6A 4HBLA 2ID3A 3V8JA 3J81Z 1R1VA 1Z7UA 1B6AA 4UUSA 2XGXA 2E2JJ 3T8TA 5HNFA 2D1HA 2NS8A 1KGSA 2H94A 5FLVA 3HB9A 5J4YA 2JA2A 1X2NA 2DK8A 4DQ2A 3LA2A 3K4JA 3FKJA 1IN7A 2MH2A 3A1YA 3HOUJ 2KIMA 2E1MC 2TRTA 1MBEA 1S7OA 4G12A 4R79A 5J8FA 2E35A 1W5CC 1J59A 2V1UA 1YFHA 3D5RC 2WV0A 2R5ZA 2KISA 2K9MA 2KPMA 2X9DA 4DNCA 3DCFA 3OYFA 3QRFF 2HPMA 1W1WE 1R00A 2R0QC 2BEOA 2IPQX 5DCFA 3CCQI 1W7PB 2BXYA 1IN8A 3AKZA 3Q5FA 2MFZA 4JX5A 1IG7A 5IY5H 3MKWB 1VQ6I 2ESNA 3E6MA 1VQ4I 3F22A 1ZR2A 2PG4A 3KP2A 4BL0B 3CCRI 3BTJA 3KPHA 2Y0MA 4L18B 1HDDC 2VJ5A 3CDLA 2D45A 1PP7U 1BR1A 3BQZA 4S05A 5J1YA 1X1CA 3OSGA 4GCVA 2L5QA 4OWRB 1A5JA 2K27A 2EZKA 2GXGA 1DU0A 2HQ5A 2EPFA 4M9SA 4XKVA 4C30A 3SFIA 1JT6A 1O7LA 2NYXA 2HFHA 5LLQA 1ZGAA 2O8KA 4I98B 4FCYA 2ACJA 1BOBA 4PJ0C 3NQOA 1O3SA 2JA7J 3Q9SA 1FZPB 1ERDA 3F0CA 4V2GA 4EV0A 4RB1A 2OA4A 3IP4B 4B43A 1OPCA 3BPVA 3L2WA 2HQAA 5A2QK 1RKWA 3OOPA 3GTKJ 1HSJA 3F6OA 3SEZA 2BE5F 5BNGA 5EJCA 3KYDB 2LF7A 4L9VA 3V7CA 2L9NA 1K4TA 3ZQ7A 4R1HA 4BEHB 2X1DA 2QM3A 3OYCA 5IYCJ 3KETA 3QWLA 5DTDA 4CCNA 1Y39A 1YRNA 3H5NA 1WJEA 2EWNA 1ZKGA 2V9VA 4FASD 2QLZA 1PP8F 3GTGJ 2DQRA 2HYGD 2W4SA 2DMNA 4AD9A 2V6EA 2LKPA 2VKVA 2LBFB 1LFBA 2IA0A 3HKZA 2G9WA 2ZBKA 3GLXA 5L3GA 2LOOA 3QP6A 4OIRF 2NXNB 1MMGA 2CQQA 2PMUA 1FNNA 1R23A 4U0VA 1E3OC 2JZYA 4XMYA 4L9TA 3AG1H 5FJ8J 1BA5A 2FF4A 4R8HA 4HLXA 2BV6A 3TKYA 1B1BA 4HA8A 1UB9A 1A31A 2EFWA 4RGUA 1S72I 2KFDA 2L0KA 3J7AO 1JUMA 1W5TA 2EV6A 3VDXA 4CH7A 2VBWA 3TL4X 1QO0D 3SJMA 3BP8A 2ADUA 1PUFA 3BR3A 1SMTA 3WE3A 2IS2A 3BROA 5J3LA 2YX4A 3BG9A 3OOUA 1OKRA 3CCSI 2XB5A 2KDOA 4H4KC 4KDPA 4GFBA 1SFKA 3L09A 3GTQJ 2CW8A 2QSGX 4QSHA 1WPKA 4ZDLA 3CTAA 3HBLA 2ZMEB 1UMQA 3VFZA 4AUXA 3SXYA 1DGWY 1XG1A 2RQPA 2XPWA 3ZMSA 4P96A 1NH3A 1QVUA 2EQRA 5DV5A 1X1AA 3R4KA 2GXAA 2Z16A 3LMMA 3CF5F 4PSWA 4D0PA 1TWHJ 1APLC 2R92J 4Y52J 1XD7A 4X1EA 1IXRC 2B0LA 4NC8A 5CPRB 4HRIA 1B8IA 3VYTB 5CVIA 4UHTA 5GAHJ 4XQFA 2O8XA 2CV0A 2A6TA 2VI6A 4IVNA 1W7PA 1YTYA 3ZQQA 3JREA 1GV2A 3GMEA 3GXOA 4XRFA 3VYRB 5J4VA 1WSUA 3HPGA 4IZZA 1EV7A 4XBFA 3GTMJ 5HLHA 5HLTA 3SDBA 1LE8B 3ZOBA 5FKLA 4MLOA 5IT9K 2UXXA 3ERMA 3KLNA 1FOXA 4LGWA 1IF1A 2O03A 2KHMA 3CCYA 4PZJA 3FMRA 1UG0A 5JVGF 4HX8A 3K0LA 1MJ9A 4HV5A 2XAGA 2JPBA 2KZGA 2FXAA 2VQCA 2A3SA 3K1MA 4V19K 2KZVA 4X0GA 1JJ6C 2HYFA 3VODA 2RV8A 5GADJ 4YEJA 2MBFA 4GYIA 1LFUP 4KIFA 1FPQA 2F4OB 1F9NA 4A3GJ 3DP7A 1UCRA 2E5ZA 1XDSA 2KMUA 3WGGA 1MNDA 1S6LA 3BJOA 3J80K 2Y2ZA 4GYGA 4UY8I 4G6DA 4LIVA 2C6YA 3QPHA 2WAEA 4BHBA 1TBXA 2ICWG 2B63J 2R7ZJ 3AAFA 1XSXA 2YPRA 4RAGA 1YHQI 3A0BC 2L7KA 5LHGA 1EH7A 2VASA 3HJEA 3WU2C 1ZELA 2OD5A 1MDMB 1YX3A 4D5CA 4HDUA 4FTHA 5F08A 4NC6A 2ZXHA 4E7JA 4CZZA 1QBJA 3S3NA 4XRSA 2JVGA 3JRIA 1P4WA 1GVJA 2KRHA 4KIGA 3BC8A 3JSOA 2K3FA 4CCKA 1QZEA 3DF8A 4MFEA 1AHDP 1F36A 1TQMA 2QCOA 2GXBA 4WF2A 3A4CA 2EFOA 4BQAA 1FBQA 3I71A 4YFKF 4FX4A 3MEXA 1UFMA 3IUOA 4KA4A 2R7XA 1IAWA 1JUSA 4U88A 1QRYA 1SAXA 2DK5A 1SD5A 4N9HA 1A6QA 5EYRA 2XAJA 1MKMA 1ETYA 1MW7A 3DV8A 3A2KA 2VN2A 1HKSA 2BY3A 2XIGA 4EMSA 4NDLA 5KAFC 3MCZA 4B3XA 4JX6A 3A03A 3DPTA 4AIDA 1BIAA 2Z99A 3AL0B 1QPIA 1I5ZA 4ANJA 1X4PA 4UVCA 2R7TA 3M8JA 5K5QA 3LAPA 3BR5A 4U0YA 2HNHA 3E6CC 2E2IJ 4XM3A 4YFNF 3F23A 5M5XJ 1U8RA 2ZJ2A 1T6SA 4A12A 1I27A 3IWFA 3H3VK 2XPVA 3R6SA 2A07F 4PFOA 4M72A 4HX4A 2ZNZA 2HS5A 3EUHC 2CUZA 5HS7A 1G3TA 4LG0B 2M7AA 3S32A 3HDDA 3OIPA 3LAJA 1OYWA 3C7JA 3OYAA 2MC3A 4XR6A 5EZGA 5FLXK 4M6VA 4HNUA 2FMYA 1LDJA 2MYSA 3MKLA 4Y15A 3QU3A 2PMHA 1MJAA 1MGTA 3HGGA 3OYHA 1JI8A 4DYQA 3RKQA 1VQ5I 1VQOI 1A6IA 4A69C 1IZ1A 2DA3A 1D0XA 4ZZDA 2ME0A 3FISA 1L0OC 5D4RA 2DTZA 2XGCA 3W6VA 1MBFA 4WK8F 3M7GA 2H8WA 2EJRA 4PJLA 3ZR8X 2HXOA 5KNLA 3SDGA 2FBHA 3W2VA 3OY9A 3H0DA 3O8GA 3G6EI 2L54A 5KK1A 1ZTRA 4EATA 1I6XA 2XHKA 2HXIA 3CMMA 3OV8A 1S5LC 3WTZA 3JSPA 2X51A 5FKKA 3EYIA 1X3UA 1TZLA 2BOLA 2UUZA 4G6QA 3M8FA 4M73A 2RREA 3DTIA 3GZNB 2R7VA 3CO7C 3OR2C 3HOSA 1IXSB 4ZYHA 2CV1A 2NOJB 3N97A 1F1ZA 2YS9A 4DW6A 3CZ6A 3H9JA 2MD5A 1J7KA 3RTRA 2DA6A 2QA4I 9ANTA 5BS6A 3R61A 3HG9A 3RYRA 3OIQA 2WY8Q 1TQIA 4PCQA 5IP6A 1FTZA 2CMPA 3L7WA 2ZNYA 1WHUA 3FK6A 5DM7F 3K1NA 3RYPA 1IW7F 1GXQA 1HW2A 2ELKA 1WJBA 4XL9A 2QF7A 2STTA 1XMAA 3K4KA 4KMUX 4QWQA 4RGRA 5LFAA 4EM0B 2VT2A 1GLNA 1MIJA 2FBIA 4XLCA 2HVSA 4NNJA 1QU3A 1H9TA 3L1PA 2VUMJ 4U7DA 3E6BA 2V79A 3LSMA 2V26A 2OBPA 4A93J 3B6CA 3BQYA 3CMEI 2DFFA 2R7SA 1WKMA 1SC7A 3GBGA 1JHHA 4KJZA 4HLYA 4FQGA 5F0FA 5E1XA 5F64A 4BDYA 4NBQA 1JKQC 2LRDA 2V1XA 1YIJI 2JMWA 1IC8A 1E17A 4LK0F 1BM9A 1RIOH 4A3KJ 3FWEA 3K10A 1HQCA 1STZA 2IW5A 5J1UA 1FBSA 1X1DA 3IH4A 1TT0A 4HQEA 4PFPA 4ENKA 1YJNI 3F8NA 2Z3YA 1AWCA 1OCCH 1T98A 2B9SA 4BJTA 1HW5A 2FMLA 3H9QA 3ECOA 5B1BH 4RLQA 3M3YJ 2HGCA 2DMPA 2HYJA 3GYHX 3S3OA 4IXAA 3IAS2 1AU7A 1T08B 5B66C 4IOCF 2EA2A 4ZJZA 3V7RA 3CUQB 1Z6RA 4ZYAA 2AQFA 2JRMA 2LF8A 3I59A 3LQQA 1YW8A 4F52A 3DU5A 2DA2A 2HVRA
chains in the Genus database with same CATH topology
5HDNA 5JI6A 4I0BA 3F72A 1CF7B 4P9FA 2K02A 5H20A 5H6QA 2E7XA 4KIBA 3GZ5A 1P4AA 2CYYA 1RUNA 4A0XA 2PBIA 1YG2A 1K78B 2G7UA 3T0YA 3WTYC 4HYEA 4IHSA 2Y48A 4FX0A 1TNTA 1HXDA 2A68F 4CHUA 3GFLA 5DYMA 2GA2A 4EJWA 1YW9A 1P2FA 1P92A 2A5YB 2D1VA 4L5JA 4IF4A 3FXQA 1P4XA 1S29A 1LEBA 1SFXA 3MZYA 2Z9OA 3SQNA 1DUXC 3GO5A 1Z1DA 4JBAA 1JHFA 3F8BA 2L4AA 5FLXZ 1QGPA 4FHTA 4ASNA 4EGYA 3HSEA 1ZREA 3HHGA 1R5HA 5TRDA 4ESJA 4B8XA 1KU2A 5HDKA 3L9FA 4OIPF 4NQWA 2IVMA 4LLGF 4ZZLA 2VE9A 1S3JA 2A61A 1USTA 1T39A 1T2KA 4BXUA 2O61A 2F5FA 2BYVE 2OQRA 4N0BA 2F2EA 1BIBA 1BBYA 2X0LA 4A0ZA 5HS9A 2QENA 5HOOA 3IKVA 2L02A 2PQ8A 3GFMA 3V4GA 1LEAA 2XV4S 1IN4A 1B9MA 4B09A 4MNUA 4JK1X 1CF7A 3FMSA 4I09A 1JGSA 3DPLC 3HTUA 5D5VB 1ZG1A 2HOEA 5FO5A 2STWA 4EQQA 3EETA 5HLGA 1K78A 1MZBA 1S7AA 3LSTA 1SFEA 4I2OA 1UHMA 1D3YA 2CQKA 2LSOA 2V1DA 5D5UB 3G73A 3IRRA 4CICA 2MA3A 1W4MA 1IN6A 1J75A 2IT0A 2HTJA 1KYZA 3ECHA 3T8RA 1IRFA 3HHHA 1ZN2A 2OZUA 3GX4X 3IL2A 5FFZA 4GXOA 4U0WA 3TOBA 1K6OA 2PLYA 3REOA 2P7CB 3ML6A 3IKTA 3NEUA 3TO7A 1B4AA 4XSZF 3WTWC 5AIPA 3BJAA 4CXFA 2MLKA 2M87A 3Q9VA 4EGZA 2EV5A 3C1DA 4WXHA 2NNYA 2L3DA 2Z5UA 4NB5A 3KP6A 2MH9A 2R7DA 3WU1B 3EYYA 3B73A 2IP2A 3FZVA 2O0YA 2D2WA 3ZMZA 1F5TA 4LB5A 4M71A 1XMKA 1HKQA 4ENJA 4WX9A 3TOAA 2KKOA 1T38A 3K2ZA 4HF1A 1MD0A 3FX3A 1ONVA 4U7BA 2ETHA 4G8XA 1YW7A 3RKXA 4HX7A 3M8EA 4XLNF 3ZN0A 1DP7P 1ZGJA 1DDNA 3EDPA 2ELHA 2HQRA 3ABTA 1B59A 2OZ6A 2E1CA 1KQ9A 4UXNA 2ESHA 3O3KA 3WTXC 2P5VA 1W7PD 1TLHB 4O3MA 3WGHA 1FC3A 3MFKA 2QWWA 5DD4A 2H09A 3QOPA 5DD8A 2CW0F 4YIIA 3LA3A 4OU0A 2XAQA 3RDIA 5ILUA 4LK1F 2FQ3A 1BC7C 4EJTA 5E8GA 1ZRFA 3PQKA 3CUOA 1PUEE 2FBKA 1BI0A 3DQVC 2O6GE 3LWFA 1BJAA 4BAYA 3PQJA 3R0JA 3I53A 4LB6B 2JRTA 1K79A 3BOQA 4ENNA 4UVBA 5CVVA 1V3FA 1LJ9A 1TTYA 3DXJF 1QZZA 1USSA 4HZFA 3ZPLA 2YU3A 1I1GA 1KU7A 1LDDA 2AS5F 1J5YA 5CJ9A 2FNPA 1IXCA 3RKYA 4G7ZF 2YSRA 2J5PA 1BI2A 1U5TB 2FNAA 1QZYA 1ODDA 1B9NA 2H27A 3ABUA 4XSXF 1YS6A 2VC1A 4EVIA 3BZ6A 1YYVA 2XKPA 2R3SA 3ROUA 4Y13A 3V8LA 1OR7A 3LA7A 1O57A 2DBBA 3FMQA 5HDGA 3M1EA 4GO1A 1TNSA 2M8EA 4I7HA 4PGHA 1YLFA 4A6EA 2OAZA 1O3RA 2VOPA 2EK5A 2QVOA 2K4JA 2Q8KA 1Z9CA 1FYLA 4ZH4F 1H9GA 3F3XA 1RI7A 2MLGA 2ZMEA 4RB3C 3BJ6A 2HKOA 1ZLJA 4G9YA 3IRQA 5A2QZ 3D0SA 3TDUC 4N9IA 2IA2A 4IRGA 3ISPA 3C18A 2ZXJA 5ICEA 1PDNC 5DUIA 1FSHA 4YIFA 2J5OA 5FB2A 3ZMTA 2DFIA 4MEYF 4I0AA 3TO6A 5ICCA 1BI1A 1RNLA 2RGVA 5FFXA 3GEZA 2L01A 1ULYA 2M5WA 2CG4A 1KYWA 3TQNA 2W84A 2HZTA 1WWXA 5AONA 2XRNA 2BGCA 2YX7A 4WCGA 2XAHA 1XSDA 1O3QA 3U9GA 2Q0OA 3RPUA 4RAZA 4HAMA 4A5MA 3WU0A 5IT3A 2E7WA 4KN4X 1W5SA 1XSVA 4JQFA 4KMFA 4A6DA 3J81K 4F7ZA 3O6BB 2XAFA 3DKWA 3EQLF 5D4SA 3E5QA 3KLOA 3JW4A 2JTVA 4ETSA 3GZ6A 4UVAA 2R7FA 1MDMA 1XGNA 1LDKB 3K69A 1U5TA 1C0WA 3F8FA 4A0YA 5ILVA 4Z2YA 1EH8A 2FOKA 2W25A 1FP1D 2DQLA 3P9IA 3FM5A 5H6RA 3JAMK 1R7JA 2XASA 4MTDA 4TV7A 1FOKA 2ZFWA 5D6EA 4NHJA 4OMZA 2JSCA 4BHPA 5J6XA 5IT9Z 3ZP5A 3I58A 2JPCA 4MEXF 3HTSB 2CGPA 3I0TA 4IJAA 4IRIA 1CGPA 4OMYA 2ZO4A 3H3ZA 1FSEA 4LG0A 5LBQA 2M45A 3O2PE 4MGRA 3HOTA 3J80Z 2JT1A 2DPUA 4ON0A 1LQ1A 4UNOA 2EA4A 1TW2A 3HSFA 4AVPA 3HIFA 2CFXA 2NNNA 1GXPA 1L3LA 1SD4A 1T0FA 3TDZC 1MJBA 3IHUA 4AIKA 1BI3A 3DFGA 4LD5A 2VBXA 1OYIA 5D6FA 3WTUC 4HDVA 4M6XA 4ESFA 3FXUA 5LGTA 4K2EA 2L4MA 4KYWA 3SZPA 5LEJA 1D8JA 5DDGA 1U78A 3KZYA 4FT8A 2UXNA 4RB2C 3WE2A 2HQNA 2PI0A 2EV0A 2BBYA 2X4HA 2WWYA 3RPQA 4KT5C 2DI3A 2A6HF 1KQ8A 2O3FA 3ERED 3BPXA 4BH9A 2HEOA 2IRFG 2E1NA 1KQ0A 5HLIA 2DPDA 5DCMB 1SMYF 2CO5A 1Z05A 2VE8A 4M74A 1OYYA 4KUMA 3HSRA 5LHIA 3SHFA 3SZTA 2KJCA 1QQIA 1XGOA 4ENMA 1XB4A 1S8NA 4RGSA 1FWZA 3WODF 4A2UA 4BNCA 5D5XB 1OMIA 3F21A 5LHHA 1HW1A 3CUQA 3ZMVA 4KFCA 5K1YA 3WTVC 3QPTA 1HKTA 1FP2A 3QP5A 1BC8C 2XUBA 5KVRA 1D8KA 2ZCWA 4M6YA 2RVCA 2K7LA 3MWMA 1JE8A 1KU9A 5LRSA 3CJNA 5JR3A 4CO8A 1ZYRF 4KN7X 5E18F 3WTTC 5TJJA 2A6EF 3QAHA 4P55A 1JXSA 4RGXA 5LRRA 1YS7A 1TW3A 5JVTA 1IRGA 4IRHA 3H3UA 4LLLA 3JAMZ 1ZG5A 2DO7A 2EFQA 4G7HF 5BOXA 1LVAA 3G3ZA 4KNYA 1XGSA 1ZHFA 4ZYGA 4EJVA 2VXZA 4WXDA 4Y17A 2F5CA 2KIUA 1HSTA 4P5OA 3L00A 1YQAA 2HDCA 2FRHA 2QYOA 2NS0A 1QPMA 4L0YB 1KU3A 3RI4A 1I1SA 5DCMA 5L3DA 4CGZA 3LFKA 3M9AA 1LB2A 5ERIA 1LNWA 3CDHA 4M9ZA 1J9IA 3I5UA 5D5WB 3T1BA 3B02A 1F4KA 2FSWA 3MAJA 4RB0A 2WC2A 2LNBA 2COMA 1IUYA 2FA5A 3ULQB 1XGMA 2M30A 1ZAOA 4H0EA 3ZMDA 2QZ8A 3NRVA 1O7FA 5L3CA 5BPDA 4YG2F 2FU4A 3D5LA 5LGNA 2Z33A 5L3BA 4S04A 3RKWA 2P6TA 4UV8A 3MZHA 3F8CA 4XLPF 3JTGA 4MTEA 2RKHA 4O5VA 2HTSA 1Z6TA 2NAZA 1R5GA 3F8MA 3V8KA 1XDUA 3KCCA 4HOBA 2HR3A 3TO9A 4RS8A 2P7VB 2P8TA 1O3TA 1NHAA 2IJLA 3RJPA 5JFRA 2VBYA 4BYYA 4I01A 3S2WA 1RZ4A 5K5OA 3FM3A 4YFXF 4OINF 2YR2A 3E5UA 5E1ZB 2DW4A 3BDDA 2QBYB 4LLNA 1R22A 3I64A 1REPC 5F1RA 1KA8A 1WQ2A 1G3SA 1QNTA 3QU6A 2K4BA 3U1DA 3CLOA 3N4MA 1HBXG 2ZKZA 4CDGA 3KP3A 2H6BA 5CVJA 3IC7A 3WG9A 3RIRA 3KP4A 1YO5C 2CSOA 5J8CA 1VTNC 4ZYEA 3F6VA 2GIVA 3GF2A 3HUGA 4ESBA 2VONA 3HRTA 4MQ9F 2QQAA 4OOIA 2W24A 1P6RA 4Q47A 2OQGA 1GHCA 3HRMA 4L9NA 3K9TA 5FGMA 2FE3A 2CWEA 3CO6C 2XKOA 3ELKA 4OIQF 4UV9A 1FX7A 3P9CA 3E97A 5E8IA 3IWZA 3K1PA 1ON2A 4A5NA 3HYIA 3C3WA 4HQMA 2DTRA 2P4WA 2TDXA 4WXCA 4P9UA 1V4RA 1TQPA 1FY7A 2VBZA 5FD6A 3L2CA 3JTHA 5ED4A 4HF2A 3KEOA 2Y75A 3EUHA 4KICA 2P5KA 2GWRA 3HRUA 2OU2A 3I59B 1G3WA 2W85A 3P7NA 5EEHA 3GUDA 2VODA 2QQBA 2PN6A 1G6NA 2F5DA 2QBYA 2PJPA 1E2XA 1FT9A 3SFZA 4AIHA 4QLCU 4IHTA 1G3YA 3PFIA 4LJZF 1G4DA 5D8LB 4L9JA 5ICFA 2P6SA 3TGNA 1Q1HA 3E3VA 1FYMA 2UWMA 1DPRA 2Q2EA 3KP5A 4HW0A 1ZRDA 4OIOF 1UHWA 5E20A 3GWZA 4GGGA 3COAC 1R1TA 3KEQA 1YIOA 4L5IA 2DLLA 4BHCA 2LDUA 2K86A 4E70A 1Y0UA 5L3FA 1ON1A 5F6FA 1U6GA 3H92A 2UZKA 2XROA 2ISZA 4PGGA 1ZRCA 1U5TC 1BOAA 4MHGA 2RN7A 1ZH5A 1R58A 4EM1A 1A04A 4LMYA 3FXRA 1AOYA 4IPAA 3KZZA 1XN7A 3GFJA 1Z91A 2M1BA 2XVCA 4LFUA 2NRAC 2VOOA 3LQRA 2EB7A 1FLIA 4MQVA 4L0ZB 4O6JA 5JHUA 1D5VA 5E17F 3ZN1A 4EJUA 1R36A 4M9XA 3W6JB 2RC4A 2G7HA 4AWXB 3DEUA 4UUVA 2KJBA 1RUOA 5FD5A 2KIFA 3FHZA 3BWGA 2GA1A 5BMZA 1FBUA 4AIJA 3P9KA 5HS8A 2DT5A 3MQ0A 2PFBA 5AIQA 2GAUA 2F5EA 3GFIA 5ICGA 2WTEA 3R0AA 4Q48A 3VEPA 3GW2A 5CYVA 1K7AA 1XCVA 5BQTA 1J0RA 5D8KB 1U2WA 1DPUA 2RNJA 1BN5A 4WWCA 3VOEA 1U3EM 4HF0A 4CYDA 5CVRA 4Q4ZF 5CLSA 1ZLKA 3FF5A 6PAXA 4PDKA 1XCBA 3BY6A 4ZYDA 3WGIA 4HV6A 2IA1A 3ZMUA 2DAOA 2ISYA 4EM2A 2GZWA 2VC0A 5K5RA 3I4PA 3WTSC 2QUFA 5DUKA 2P5LC 1FYKA 3V7SA 5ILSA 2EFNA 2EFPA 2GQQA 2A69F 2RDPA 2H6CA 1H0MA 5EEGA 4Q5SF 3W6KB 1J2XA 3KFWX 1IN5A 2VT3A 3T5XA 5L3EA 4G7OF 1WRJA 5LEKA 3HRSA 5HVQC 1SD7A 3KP7A 2PEXA 2QQ9A 1ZARA 3E6DA 2AXLA 2DU9A 4I02A 3E5XA 5E1WA 2HWVA 3GVAA 3R60A 5BPIA 1SD6A 2HKXA 5CVUA 3U2RA 5LGUA 2W57A 1ZG3A 2KRFA 4EJOA 3KE2A 5DEQA 4G94A 3I54A 3VB2A 1SFUA 2V6CA 3CUQC 1WI9A 2FEZA 4RAYA 1R1UA 4HBLA 1EH6A 3V8JA 3J81Z 1R1VA 1Z7UA 1B6AA 2XGXA 3T8TA 2D1HA 1KGSA 2H94A 2DK8A 4DQ2A 3LA2A 1IN7A 2MH2A 2KIMA 4R79A 1J59A 1S7OA 5J8FA 2V1UA 1YFHA 2WV0A 4DNCA 3QRFF 1R00A 2BEOA 2IPQX 5DCFA 1W7PB 1IN8A 3Q5FA 2ESNA 3E6MA 3F22A 2PG4A 3KP2A 2Y0MA 4L18B 2D45A 1PP7U 4S05A 4GCVA 2K27A 2GXGA 4M9SA 1O7LA 2NYXA 2HFHA 5LLQA 1ZGAA 4I98B 2ACJA 3NQOA 1O3SA 3Q9SA 1FZPB 4EV0A 4RB1A 2OA4A 1OPCA 3BPVA 5A2QK 3OOPA 1HSJA 3F6OA 2BE5F 2LF7A 4L9VA 3V7CA 3ZQ7A 4R1HA 2QM3A 3KETA 2EWNA 2V9VA 1PP8F 2QLZA 2DQRA 2HYGD 4AD9A 2LKPA 2IA0A 2G9WA 2ZBKA 3GLXA 5L3GA 3QP6A 4OIRF 2PMUA 1FNNA 1R23A 4U0VA 2JZYA 4L9TA 2FF4A 4R8HA 4HLXA 2BV6A 3TKYA 1B1BA 4HA8A 1UB9A 2EFWA 4RGUA 3J7AO 1W5TA 2EV6A 2VBWA 1QO0D 3BP8A 2ADUA 1SMTA 3WE3A 3BROA 2YX4A 1OKRA 4KDPA 3L09A 3CTAA 2ZMEB 3VFZA 3SXYA 2RQPA 3ZMSA 4P96A 5DV5A 3R4KA 4D0PA 1XD7A 1IXRC 2B0LA 5CVIA 4UHTA 2O8XA 4IVNA 1W7PA 1YTYA 3GXOA 4XRFA 1WSUA 1EV7A 4XBFA 5HLHA 5IT9K 2UXXA 3KLNA 4LGWA 1IF1A 2O03A 4PZJA 3FMRA 4HX8A 3K0LA 1MJ9A 4HV5A 2XAGA 2JPBA 2FXAA 2A3SA 3K1MA 2HYFA 3VODA 2RV8A 2MBFA 4GYIA 4KIFA 1FPQA 1F9NA 3DP7A 1UCRA 1XDSA 3WGGA 1S6LA 3BJOA 3J80K 4GYGA 4G6DA 2C6YA 3QPHA 4BHBA 1TBXA 3AAFA 1XSXA 2YPRA 5LHGA 1EH7A 2OD5A 1MDMB 4HDUA 4CZZA 1QBJA 1P4WA 1GVJA 4KIGA 3JSOA 3DF8A 1TQMA 2GXBA 4WF2A 2EFOA 4BQAA 1FBQA 3I71A 4YFKF 4FX4A 3MEXA 1UFMA 4KA4A 1IAWA 4U88A 1SAXA 2DK5A 1SD5A 4N9HA 2XAJA 1MKMA 3DV8A 2VN2A 1HKSA 2XIGA 4EMSA 3MCZA 3DPTA 1BIAA 2Z99A 1I5ZA 4UVCA 5K5QA 3LAPA 3E6CC 4U0YA 3F23A 4YFNF 1U8RA 2ZJ2A 1T6SA 4A12A 1I27A 3IWFA 3R6SA 2A07F 4M72A 4HX4A 2ZNZA 2HS5A 5HS7A 1G3TA 4LG0B 3LAJA 1OYWA 3C7JA 2MC3A 5FLXK 2FMYA 1LDJA 4Y15A 3QU3A 2PMHA 1MJAA 1MGTA 1IZ1A 4ZZDA 1L0OC 5D4RA 4WK8F 3M7GA 2EJRA 2FBHA 2L54A 5KK1A 1I6XA 2XHKA 3OV8A 3WTZA 3JSPA 3EYIA 1X3UA 4G6QA 3M8FA 4M73A 3CO7C 3HOSA 1IXSB 4ZYHA 3N97A 1F1ZA 2MD5A 1J7KA 3RTRA 5BS6A 3R61A 3RYRA 1TQIA 4PCQA 3L7WA 2ZNYA 3K1NA 3RYPA 1IW7F 1GXQA 1HW2A 2STTA 1XMAA 4KMUX 4QWQA 4RGRA 4EM0B 2VT2A 2FBIA 1H9TA 4U7DA 3E6BA 2V79A 2OBPA 1WKMA 1JHHA 4HLYA 5E1XA 5F64A 2V1XA 1E17A 4LK0F 1BM9A 1RIOH 3FWEA 1HQCA 1STZA 2IW5A 1FBSA 4HQEA 4ENKA 3F8NA 2Z3YA 1AWCA 1T98A 1HW5A 2FMLA 3ECOA 2HGCA 3GYHX 4IXAA 2EA2A 3V7RA 3CUQB 1Z6RA 2LF8A 3I59A 3LQQA 1YW8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HDN A;  5JI6 A;  4I0B A;  3F72 A;  1CF7 B;  4P9F A;  2K02 A;  5H20 A;  5H6Q A;  2E7X A;  4KIB A;  3GZ5 A;  1P4A A;  2CYY A;  1RUN A;  4A0X A;  2PBI A;  1YG2 A;  1K78 B;  2G7U A;  3T0Y A;  3WTY C;  4HYE A;  4IHS A;  2Y48 A;  4FX0 A;  1TNT A;  1HXD A;  2A68 F;  4CHU A;  3GFL A;  5DYM A;  2GA2 A;  4EJW A;  1YW9 A;  1P2F A;  1P92 A;  2A5Y B;  2D1V A;  4L5J A;  4IF4 A;  3FXQ A;  1P4X A;  1S29 A;  1LEB A;  1SFX A;  3MZY A;  2Z9O A;  3SQN A;  1DUX C;  3GO5 A;  1Z1D A;  4JBA A;  1JHF A;  3F8B A;  2L4A A;  5FLX Z;  1QGP A;  4FHT A;  4ASN A;  4EGY A;  3HSE A;  1ZRE A;  3HHG A;  1R5H A;  5TRD A;  4ESJ A;  4B8X A;  1KU2 A;  5HDK A;  3L9F A;  4OIP F;  4NQW A;  2IVM A;  4LLG F;  4ZZL A;  2VE9 A;  1S3J A;  2A61 A;  1UST A;  1T39 A;  1T2K A;  4BXU A;  2O61 A;  2F5F A;  2BYV E;  2OQR A;  4N0B A;  2F2E A;  1BIB A;  1BBY A;  2X0L A;  4A0Z A;  5HS9 A;  2QEN A;  5HOO A;  3IKV A;  2L02 A;  2PQ8 A;  3GFM A;  3V4G A;  1LEA A;  2XV4 S;  1IN4 A;  1B9M A;  4B09 A;  4MNU A;  4JK1 X;  1CF7 A;  3FMS A;  4I09 A;  1JGS A;  3DPL C;  3HTU A;  5D5V B;  1ZG1 A;  2HOE A;  5FO5 A;  2STW A;  4EQQ A;  3EET A;  5HLG A;  1K78 A;  1MZB A;  1S7A A;  3LST A;  1SFE A;  4I2O A;  1UHM A;  1D3Y A;  2CQK A;  2LSO A;  2V1D A;  5D5U B;  3G73 A;  3IRR A;  4CIC A;  2MA3 A;  1W4M A;  1IN6 A;  1J75 A;  2IT0 A;  2HTJ A;  1KYZ A;  3ECH A;  3T8R A;  1IRF A;  3HHH A;  1ZN2 A;  2OZU A;  3GX4 X;  3IL2 A;  5FFZ A;  4GXO A;  4U0W A;  3TOB A;  1K6O A;  2PLY A;  3REO A;  2P7C B;  3ML6 A;  3IKT A;  3NEU A;  3TO7 A;  1B4A A;  4XSZ F;  3WTW C;  5AIP A;  3BJA A;  4CXF A;  2MLK A;  2M87 A;  3Q9V A;  4EGZ A;  2EV5 A;  3C1D A;  4WXH A;  2NNY A;  2L3D A;  2Z5U A;  4NB5 A;  3KP6 A;  2MH9 A;  2R7D A;  3WU1 B;  3EYY A;  3B73 A;  2IP2 A;  3FZV A;  2O0Y A;  2D2W A;  3ZMZ A;  1F5T A;  4LB5 A;  4M71 A;  1XMK A;  1HKQ A;  4ENJ A;  4WX9 A;  3TOA A;  2KKO A;  1T38 A;  3K2Z A;  4HF1 A;  1MD0 A;  3FX3 A;  1ONV A;  4U7B A;  2ETH A;  4G8X A;  1YW7 A;  3RKX A;  4HX7 A;  3M8E A;  4XLN F;  3ZN0 A;  1DP7 P;  1ZGJ A;  1DDN A;  3EDP A;  2ELH A;  2HQR A;  3ABT A;  1B59 A;  2OZ6 A;  2E1C A;  1KQ9 A;  4UXN A;  2ESH A;  3O3K A;  3WTX C;  2P5V A;  1W7P D;  1TLH B;  4O3M A;  3WGH A;  1FC3 A;  3MFK A;  2QWW A;  5DD4 A;  2H09 A;  3QOP A;  5DD8 A;  2CW0 F;  4YII A;  3LA3 A;  4OU0 A;  2XAQ A;  3RDI A;  5ILU A;  4LK1 F;  2FQ3 A;  1BC7 C;  4EJT A;  5E8G A;  1ZRF A;  3PQK A;  3CUO A;  1PUE E;  2FBK A;  1BI0 A;  3DQV C;  2O6G E;  3LWF A;  1BJA A;  4BAY A;  3PQJ A;  3R0J A;  3I53 A;  4LB6 B;  2JRT A;  1K79 A;  3BOQ A;  4ENN A;  4UVB A;  5CVV A;  1V3F A;  1LJ9 A;  1TTY A;  3DXJ F;  1QZZ A;  1USS A;  4HZF A;  3ZPL A;  2YU3 A;  1I1G A;  1KU7 A;  1LDD A;  2AS5 F;  1J5Y A;  5CJ9 A;  2FNP A;  1IXC A;  3RKY A;  4G7Z F;  2YSR A;  2J5P A;  1BI2 A;  1U5T B;  2FNA A;  1QZY A;  1ODD A;  1B9N A;  2H27 A;  3ABU A;  4XSX F;  1YS6 A;  2VC1 A;  4EVI A;  3BZ6 A;  1YYV A;  2XKP A;  2R3S A;  3ROU A;  4Y13 A;  3V8L A;  1OR7 A;  3LA7 A;  1O57 A;  2DBB A;  3FMQ A;  5HDG A;  3M1E A;  4GO1 A;  1TNS A;  2M8E A;  4I7H A;  4PGH A;  1YLF A;  4A6E A;  2OAZ A;  1O3R A;  2VOP A;  2EK5 A;  2QVO A;  2K4J A;  2Q8K A;  1Z9C A;  1FYL A;  4ZH4 F;  1H9G A;  3F3X A;  1RI7 A;  2MLG A;  2ZME A;  4RB3 C;  3BJ6 A;  2HKO A;  1ZLJ A;  4G9Y A;  3IRQ A;  5A2Q Z;  3D0S A;  3TDU C;  4N9I A;  2IA2 A;  4IRG A;  3ISP A;  3C18 A;  2ZXJ A;  5ICE A;  1PDN C;  5DUI A;  1FSH A;  4YIF A;  2J5O A;  5FB2 A;  3ZMT A;  2DFI A;  4MEY F;  4I0A A;  3TO6 A;  5ICC A;  1BI1 A;  1RNL A;  2RGV A;  5FFX A;  3GEZ A;  2L01 A;  1ULY A;  2M5W A;  2CG4 A;  1KYW A;  3TQN A;  2W84 A;  2HZT A;  1WWX A;  5AON A;  2XRN A;  2BGC A;  2YX7 A;  4WCG A;  2XAH A;  1XSD A;  1O3Q A;  3U9G A;  2Q0O A;  3RPU A;  4RAZ A;  4HAM A;  4A5M A;  3WU0 A;  5IT3 A;  2E7W A;  4KN4 X;  1W5S A;  1XSV A;  4JQF A;  4KMF A;  4A6D A;  3J81 K;  4F7Z A;  3O6B B;  2XAF A;  3DKW A;  3EQL F;  5D4S A;  3E5Q A;  3KLO A;  3JW4 A;  2JTV A;  4ETS A;  3GZ6 A;  4UVA A;  2R7F A;  1MDM A;  1XGN A;  1LDK B;  3K69 A;  1U5T A;  1C0W A;  3F8F A;  4A0Y A;  5ILV A;  4Z2Y A;  1EH8 A;  2FOK A;  2W25 A;  1FP1 D;  2DQL A;  3P9I A;  3FM5 A;  5H6R A;  3JAM K;  1R7J A;  2XAS A;  4MTD A;  4TV7 A;  1FOK A;  2ZFW A;  5D6E A;  4NHJ A;  4OMZ A;  2JSC A;  4BHP A;  5J6X A;  5IT9 Z;  3ZP5 A;  3I58 A;  2JPC A;  4MEX F;  3HTS B;  2CGP A;  3I0T A;  4IJA A;  4IRI A;  1CGP A;  4OMY A;  2ZO4 A;  3H3Z A;  1FSE A;  4LG0 A;  5LBQ A;  2M45 A;  3O2P E;  4MGR A;  3HOT A;  3J80 Z;  2JT1 A;  2DPU A;  4ON0 A;  1LQ1 A;  4UNO A;  2EA4 A;  1TW2 A;  3HSF A;  4AVP A;  3HIF A;  2CFX A;  2NNN A;  1GXP A;  1L3L A;  1SD4 A;  1T0F A;  3TDZ C;  1MJB A;  3IHU A;  4AIK A;  1BI3 A;  3DFG A;  4LD5 A;  2VBX A;  1OYI A;  5D6F A;  3WTU C;  4HDV A;  4M6X A;  4ESF A;  3FXU A;  5LGT A;  4K2E A;  2L4M A;  4KYW A;  3SZP A;  5LEJ A;  1D8J A;  5DDG A;  1U78 A;  3KZY A;  4FT8 A;  2UXN A;  4RB2 C;  3WE2 A;  2HQN A;  2PI0 A;  2EV0 A;  2BBY A;  2X4H A;  2WWY A;  3RPQ A;  4KT5 C;  2DI3 A;  2A6H F;  1KQ8 A;  2O3F A;  3ERE D;  3BPX A;  4BH9 A;  2HEO A;  2IRF G;  2E1N A;  1KQ0 A;  5HLI A;  2DPD A;  5DCM B;  1SMY F;  2CO5 A;  1Z05 A;  2VE8 A;  4M74 A;  1OYY A;  4KUM A;  3HSR A;  5LHI A;  3SHF A;  3SZT A;  2KJC A;  1QQI A;  1XGO A;  4ENM A;  1XB4 A;  1S8N A;  4RGS A;  1FWZ A;  3WOD F;  4A2U A;  4BNC A;  5D5X B;  1OMI A;  3F21 A;  5LHH A;  1HW1 A;  3CUQ A;  3ZMV A;  4KFC A;  5K1Y A;  3WTV C;  3QPT A;  1HKT A;  1FP2 A;  3QP5 A;  1BC8 C;  2XUB A;  5KVR A;  1D8K A;  2ZCW A;  4M6Y A;  2RVC A;  2K7L A;  3MWM A;  1JE8 A;  1KU9 A;  5LRS A;  3CJN A;  5JR3 A;  4CO8 A;  1ZYR F;  4KN7 X;  5E18 F;  3WTT C;  5TJJ A;  2A6E F;  3QAH A;  4P55 A;  1JXS A;  4RGX A;  5LRR A;  1YS7 A;  1TW3 A;  5JVT A;  1IRG A;  4IRH A;  3H3U A;  4LLL A;  3JAM Z;  1ZG5 A;  2DO7 A;  2EFQ A;  4G7H F;  5BOX A;  1LVA A;  3G3Z A;  4KNY A;  1XGS A;  1ZHF A;  4ZYG A;  4EJV A;  2VXZ A;  4WXD A;  4Y17 A;  2F5C A;  2KIU A;  1HST A;  4P5O A;  3L00 A;  1YQA A;  2HDC A;  2FRH A;  2QYO A;  2NS0 A;  1QPM A;  4L0Y B;  1KU3 A;  3RI4 A;  1I1S A;  5DCM A;  5L3D A;  4CGZ A;  3LFK A;  3M9A A;  1LB2 A;  5ERI A;  1LNW A;  3CDH A;  4M9Z A;  1J9I A;  3I5U A;  5D5W B;  3T1B A;  3B02 A;  1F4K A;  2FSW A;  3MAJ A;  4RB0 A;  2WC2 A;  2LNB A;  2COM A;  1IUY A;  2FA5 A;  3ULQ B;  1XGM A;  2M30 A;  1ZAO A;  4H0E A;  3ZMD A;  2QZ8 A;  3NRV A;  1O7F A;  5L3C A;  5BPD A;  4YG2 F;  2FU4 A;  3D5L A;  5LGN A;  2Z33 A;  5L3B A;  4S04 A;  3RKW A;  2P6T A;  4UV8 A;  3MZH A;  3F8C A;  4XLP F;  3JTG A;  4MTE A;  2RKH A;  4O5V A;  2HTS A;  1Z6T A;  2NAZ A;  1R5G A;  3F8M A;  3V8K A;  1XDU A;  3KCC A;  4HOB A;  2HR3 A;  3TO9 A;  4RS8 A;  2P7V B;  2P8T A;  1O3T A;  1NHA A;  2IJL A;  3RJP A;  5JFR A;  2VBY A;  4BYY A;  4I01 A;  3S2W A;  1RZ4 A;  5K5O A;  3FM3 A;  4YFX F;  4OIN F;  2YR2 A;  3E5U A;  5E1Z B;  2DW4 A;  3BDD A;  2QBY B;  4LLN A;  1R22 A;  3I64 A;  1REP C;  5F1R A;  1KA8 A;  1WQ2 A;  1G3S A;  1QNT A;  3QU6 A;  2K4B A;  3U1D A;  3CLO A;  3N4M A;  1HBX G;  2ZKZ A;  4CDG A;  3KP3 A;  2H6B A;  5CVJ A;  3IC7 A;  3WG9 A;  3RIR A;  3KP4 A;  1YO5 C;  2CSO A;  5J8C A;  1VTN C;  4ZYE A;  3F6V A;  2GIV A;  3GF2 A;  3HUG A;  4ESB A;  2VON A;  3HRT A;  4MQ9 F;  2QQA A;  4OOI A;  2W24 A;  1P6R A;  4Q47 A;  2OQG A;  1GHC A;  3HRM A;  4L9N A;  3K9T A;  5FGM A;  2FE3 A;  2CWE A;  3CO6 C;  2XKO A;  3ELK A;  4OIQ F;  4UV9 A;  1FX7 A;  3P9C A;  3E97 A;  5E8I A;  3IWZ A;  3K1P A;  1ON2 A;  4A5N A;  3HYI A;  3C3W A;  4HQM A;  2DTR A;  2P4W A;  2TDX A;  4WXC A;  4P9U A;  1V4R A;  1TQP A;  1FY7 A;  2VBZ A;  5FD6 A;  3L2C A;  3JTH A;  5ED4 A;  4HF2 A;  3KEO A;  2Y75 A;  3EUH A;  4KIC A;  2P5K A;  2GWR A;  3HRU A;  2OU2 A;  3I59 B;  1G3W A;  2W85 A;  3P7N A;  5EEH A;  3GUD A;  2VOD A;  2QQB A;  2PN6 A;  1G6N A;  2F5D A;  2QBY A;  2PJP A;  1E2X A;  1FT9 A;  3SFZ A;  4AIH A;  4QLC U;  4IHT A;  1G3Y A;  3PFI A;  4LJZ F;  1G4D A;  5D8L B;  4L9J A;  5ICF A;  2P6S A;  3TGN A;  1Q1H A;  3E3V A;  1FYM A;  2UWM A;  1DPR A;  2Q2E A;  3KP5 A;  4HW0 A;  1ZRD A;  4OIO F;  1UHW A;  5E20 A;  3GWZ A;  4GGG A;  3COA C;  1R1T A;  3KEQ A;  1YIO A;  4L5I A;  2DLL A;  4BHC A;  2LDU A;  2K86 A;  4E70 A;  1Y0U A;  5L3F A;  1ON1 A;  5F6F A;  1U6G A;  3H92 A;  2UZK A;  2XRO A;  2ISZ A;  4PGG A;  1ZRC A;  1U5T C;  1BOA A;  4MHG A;  2RN7 A;  1ZH5 A;  1R58 A;  4EM1 A;  1A04 A;  4LMY A;  3FXR A;  1AOY A;  4IPA A;  3KZZ A;  1XN7 A;  3GFJ A;  1Z91 A;  2M1B A;  2XVC A;  4LFU A;  2NRA C;  2VOO A;  3LQR A;  2EB7 A;  1FLI A;  4MQV A;  4L0Z B;  4O6J A;  5JHU A;  1D5V A;  5E17 F;  3ZN1 A;  4EJU A;  1R36 A;  4M9X A;  3W6J B;  2RC4 A;  2G7H A;  4AWX B;  3DEU A;  4UUV A;  2KJB A;  1RUO A;  5FD5 A;  2KIF A;  3FHZ A;  3BWG A;  2GA1 A;  5BMZ A;  1FBU A;  4AIJ A;  3P9K A;  5HS8 A;  2DT5 A;  3MQ0 A;  2PFB A;  5AIQ A;  2GAU A;  2F5E A;  3GFI A;  5ICG A;  2WTE A;  3R0A A;  4Q48 A;  3VEP A;  3GW2 A;  5CYV A;  1K7A A;  1XCV A;  5BQT A;  1J0R A;  5D8K B;  1U2W A;  1DPU A;  2RNJ A;  1BN5 A;  4WWC A;  3VOE A;  1U3E M;  4HF0 A;  4CYD A;  5CVR A;  4Q4Z F;  5CLS A;  1ZLK A;  3FF5 A;  6PAX A;  4PDK A;  1XCB A;  3BY6 A;  4ZYD A;  3WGI A;  4HV6 A;  2IA1 A;  3ZMU A;  2DAO A;  2ISY A;  4EM2 A;  2GZW A;  2VC0 A;  5K5R A;  3I4P A;  3WTS C;  2QUF A;  5DUK A;  2P5L C;  1FYK A;  3V7S A;  5ILS A;  2EFN A;  2EFP A;  2GQQ A;  2A69 F;  2RDP A;  2H6C A;  1H0M A;  5EEG A;  4Q5S F;  3W6K B;  1J2X A;  3KFW X;  1IN5 A;  2VT3 A;  3T5X A;  5L3E A;  4G7O F;  1WRJ A;  5LEK A;  3HRS A;  5HVQ C;  1SD7 A;  3KP7 A;  2PEX A;  2QQ9 A;  1ZAR A;  3E6D A;  2AXL A;  2DU9 A;  4I02 A;  3E5X A;  5E1W A;  2HWV A;  3GVA A;  3R60 A;  5BPI A;  1SD6 A;  2HKX A;  5CVU A;  3U2R A;  5LGU A;  2W57 A;  1ZG3 A;  2KRF A;  4EJO A;  3KE2 A;  5DEQ A;  4G94 A;  3I54 A;  3VB2 A;  1SFU A;  2V6C A;  3CUQ C;  1WI9 A;  2FEZ A;  4RAY A;  1R1U A;  4HBL A;  1EH6 A;  3V8J A;  3J81 Z;  1R1V A;  1Z7U A;  1B6A A;  2XGX A;  3T8T A;  2D1H A;  1KGS A;  2H94 A;  2DK8 A;  4DQ2 A;  3LA2 A;  1IN7 A;  2MH2 A;  2KIM A;  4R79 A;  1J59 A;  1S7O A;  5J8F A;  2V1U A;  1YFH A;  2WV0 A;  4DNC A;  3QRF F;  1R00 A;  2BEO A;  2IPQ X;  5DCF A;  1W7P B;  1IN8 A;  3Q5F A;  2ESN A;  3E6M A;  3F22 A;  2PG4 A;  3KP2 A;  2Y0M A;  4L18 B;  2D45 A;  1PP7 U;  4S05 A;  4GCV A;  2K27 A;  2GXG A;  4M9S A;  1O7L A;  2NYX A;  2HFH A;  5LLQ A;  1ZGA A;  4I98 B;  2ACJ A;  3NQO A;  1O3S A;  3Q9S A;  1FZP B;  4EV0 A;  4RB1 A;  2OA4 A;  1OPC A;  3BPV A;  5A2Q K;  3OOP A;  1HSJ A;  3F6O A;  2BE5 F;  2LF7 A;  4L9V A;  3V7C A;  3ZQ7 A;  4R1H A;  2QM3 A;  3KET A;  2EWN A;  2V9V A;  1PP8 F;  2QLZ A;  2DQR A;  2HYG D;  4AD9 A;  2LKP A;  2IA0 A;  2G9W A;  2ZBK A;  3GLX A;  5L3G A;  3QP6 A;  4OIR F;  2PMU A;  1FNN A;  1R23 A;  4U0V A;  2JZY A;  4L9T A;  2FF4 A;  4R8H A;  4HLX A;  2BV6 A;  3TKY A;  1B1B A;  4HA8 A;  1UB9 A;  2EFW A;  4RGU A;  3J7A O;  1W5T A;  2EV6 A;  2VBW A;  1QO0 D;  3BP8 A;  2ADU A;  1SMT A;  3WE3 A;  3BRO A;  2YX4 A;  1OKR A;  4KDP A;  3L09 A;  3CTA A;  2ZME B;  3VFZ A;  3SXY A;  2RQP A;  3ZMS A;  4P96 A;  5DV5 A;  3R4K A;  4D0P A;  1XD7 A;  1IXR C;  2B0L A;  5CVI A;  4UHT A;  2O8X A;  4IVN A;  1W7P A;  1YTY A;  3GXO A;  4XRF A;  1WSU A;  1EV7 A;  4XBF A;  5HLH A;  5IT9 K;  2UXX A;  3KLN A;  4LGW A;  1IF1 A;  2O03 A;  4PZJ A;  3FMR A;  4HX8 A;  3K0L A;  1MJ9 A;  4HV5 A;  2XAG A;  2JPB A;  2FXA A;  2A3S A;  3K1M A;  2HYF A;  3VOD A;  2RV8 A;  2MBF A;  4GYI A;  4KIF A;  1FPQ A;  1F9N A;  3DP7 A;  1UCR A;  1XDS A;  3WGG A;  1S6L A;  3BJO A;  3J80 K;  4GYG A;  4G6D A;  2C6Y A;  3QPH A;  4BHB A;  1TBX A;  3AAF A;  1XSX A;  2YPR A;  5LHG A;  1EH7 A;  2OD5 A;  1MDM B;  4HDU A;  4CZZ A;  1QBJ A;  1P4W A;  1GVJ A;  4KIG A;  3JSO A;  3DF8 A;  1TQM A;  2GXB A;  4WF2 A;  2EFO A;  4BQA A;  1FBQ A;  3I71 A;  4YFK F;  4FX4 A;  3MEX A;  1UFM A;  4KA4 A;  1IAW A;  4U88 A;  1SAX A;  2DK5 A;  1SD5 A;  4N9H A;  2XAJ A;  1MKM A;  3DV8 A;  2VN2 A;  1HKS A;  2XIG A;  4EMS A;  3MCZ A;  3DPT A;  1BIA A;  2Z99 A;  1I5Z A;  4UVC A;  5K5Q A;  3LAP A;  3E6C C;  4U0Y A;  3F23 A;  4YFN F;  1U8R A;  2ZJ2 A;  1T6S A;  4A12 A;  1I27 A;  3IWF A;  3R6S A;  2A07 F;  4M72 A;  4HX4 A;  2ZNZ A;  2HS5 A;  5HS7 A;  1G3T A;  4LG0 B;  3LAJ A;  1OYW A;  3C7J A;  2MC3 A;  5FLX K;  2FMY A;  1LDJ A;  4Y15 A;  3QU3 A;  2PMH A;  1MJA A;  1MGT A;  1IZ1 A;  4ZZD A;  1L0O C;  5D4R A;  4WK8 F;  3M7G A;  2EJR A;  2FBH A;  2L54 A;  5KK1 A;  1I6X A;  2XHK A;  3OV8 A;  3WTZ A;  3JSP A;  3EYI A;  1X3U A;  4G6Q A;  3M8F A;  4M73 A;  3CO7 C;  3HOS A;  1IXS B;  4ZYH A;  3N97 A;  1F1Z A;  2MD5 A;  1J7K A;  3RTR A;  5BS6 A;  3R61 A;  3RYR A;  1TQI A;  4PCQ A;  3L7W A;  2ZNY A;  3K1N A;  3RYP A;  1IW7 F;  1GXQ A;  1HW2 A;  2STT A;  1XMA A;  4KMU X;  4QWQ A;  4RGR A;  4EM0 B;  2VT2 A;  2FBI A;  1H9T A;  4U7D A;  3E6B A;  2V79 A;  2OBP A;  1WKM A;  1JHH A;  4HLY A;  5E1X A;  5F64 A;  2V1X A;  1E17 A;  4LK0 F;  1BM9 A;  1RIO H;  3FWE A;  1HQC A;  1STZ A;  2IW5 A;  1FBS A;  4HQE A;  4ENK A;  3F8N A;  2Z3Y A;  1AWC A;  1T98 A;  1HW5 A;  2FML A;  3ECO A;  2HGC A;  3GYH X;  4IXA A;  2EA2 A;  3V7R A;  3CUQ B;  1Z6R A;  2LF8 A;  3I59 A;  3LQQ A;  1YW8 A; 
#chains in the Genus database with same CATH topology
 5HDN A;  4XNF A;  1OFC X;  5JI6 A;  1DU6 A;  2NS7 A;  4I0B A;  3F72 A;  1CF7 B;  2OCE A;  4B44 A;  2V4J C;  4N4N B;  4P9F A;  2O7O A;  3CC4 I;  2K02 A;  5H20 A;  5H6Q A;  4B4C A;  3DBL B;  1T95 A;  2RQQ A;  2E7X A;  2K9Q A;  3VWB A;  4XON A;  1WZ2 A;  3K2A A;  4KIB A;  3GZ5 A;  2EH3 A;  2M8G X;  2JUC A;  4J00 A;  1QHG A;  1P4A A;  2E71 A;  2ZSI B;  2CYY A;  2DJN A;  1RUN A;  1IRX A;  4A0X A;  2PBI A;  1YG2 A;  4DIQ A;  3EPZ A;  3CMY A;  1BL0 A;  1K78 B;  2G7U A;  3CP2 A;  3FK7 A;  3NAU A;  1VQ9 I;  1D0Y A;  3LL7 A;  3OWT A;  3LSG A;  3VYS B;  3T0Y A;  4C3J J;  1TWF J;  3WTY C;  4HYE A;  1EF4 A;  4IHS A;  2Y48 A;  3RSN A;  3OYN A;  4FX0 A;  1Y56 A;  1TNT A;  2W1O A;  1HXD A;  2A68 F;  4LG3 A;  4CHU A;  3GFL A;  3AG2 H;  3PNY A;  5DYM A;  1I39 A;  3Q0U A;  4V2F A;  3FXO A;  1I50 J;  3HKZ N;  3LSP A;  2GA2 A;  2MD0 A;  2DMT A;  2G0E A;  4EJW A;  4A3L J;  1YW9 A;  3DEE A;  1P2F A;  1P92 A;  2A5Y B;  4FE4 A;  4AC0 A;  2D1V A;  2ZXW H;  4RDU A;  4L5J A;  2VPR A;  4IF4 A;  3FXQ A;  3WHB A;  2KP6 A;  5FRN A;  1MBJ A;  4A3F J;  3PSF A;  1P4X A;  3QYE A;  1S29 A;  2VQG A;  1LEB A;  1SFX A;  3D5S C;  3MZY A;  2Z9O A;  1YIT I;  2M4K A;  5J1R A;  2QSF X;  5B3S H;  4C2U A;  2LVS A;  2Z1D A;  3SQN A;  1E3H A;  3SEQ A;  4KIT B;  1DUX C;  3GO5 A;  1HOM A;  1Z1D A;  3I9V 2;  1PJR A;  3BG3 A;  2F48 A;  4JBA A;  1JHF A;  3JRA A;  3JR9 A;  3F8B A;  3CCE I;  2L4A A;  5FLX Z;  3JRD A;  1QGP A;  1SAU A;  3CP8 A;  4FHT A;  4BJ6 C;  4C9Y A;  3A02 A;  1JJ8 C;  1Y0N A;  4ASN A;  2LC2 A;  3HSE A;  4EGY A;  1B72 B;  1ZRE A;  3HHG A;  3C2G A;  2EIJ H;  3BG5 A;  3H0G J;  1R5H A;  4LIT A;  4CCJ A;  3OS2 A;  4ESJ A;  5TRD A;  4XLE A;  4B8X A;  2XDV A;  1ETW A;  5F04 A;  1KU2 A;  5HDK A;  1W0T A;  1U9N A;  3BR0 A;  3L9F A;  4OIP F;  2HPI A;  4IQ4 A;  4NQW A;  4BE2 A;  1T33 A;  2IVM A;  4LLG F;  4ZZL A;  2VE9 A;  1S3J A;  1BW6 A;  2A61 A;  1UST A;  1T39 A;  1T2K A;  4BXU A;  2O61 A;  2F5F A;  2BYV E;  2OQR A;  3RCO A;  1U9O A;  5B5E C;  2QEX I;  4N0B A;  1V5G A;  5E79 C;  2COB A;  2F2E A;  5KCM A;  2IGM A;  4D7M A;  1BIB A;  3BTI A;  1BBY A;  2X0L A;  4D9J A;  4A0Z A;  4PJM A;  5HS9 A;  3S2D J;  2QEN A;  2PMZ N;  5HOO A;  4IHV A;  2E60 A;  1JUP A;  3FXL A;  3IKV A;  1A35 A;  2L02 A;  2PQ8 A;  3GFM A;  1KZH A;  1VI0 A;  1O4X A;  4XOR A;  3V4G A;  3D1N I;  1LEA A;  3K70 C;  2JSP A;  2XV4 S;  4CCO A;  4G6T B;  2B7E A;  1IN4 A;  2M7B A;  1B9M A;  4B09 A;  4MNU A;  1NK3 P;  1I6H J;  3DWL E;  4JK1 X;  3OL4 A;  4M3F A;  2VKE A;  2L9R A;  1CF7 A;  2KQR A;  3FMS A;  3TMO A;  4W97 A;  5M3F J;  4I09 A;  3FXK A;  1JGS A;  3OYI A;  3OYK A;  2RAE A;  3DPL C;  3HTU A;  1LVK A;  2PJR A;  5D5V B;  1ZG1 A;  2HOE A;  5FO5 A;  1WI3 A;  4PSX A;  2STW A;  3MMY B;  3KZI C;  4EQQ A;  3EET A;  5HLG A;  1K78 A;  1MZB A;  1S7A A;  3LST A;  1SFE A;  4I2O A;  3DTK A;  1UHM A;  1D3Y A;  2DOD A;  2CQK A;  2LSO A;  4ABZ A;  2V1D A;  5D5U B;  3G73 A;  2XSD C;  3IRR A;  3ZCO A;  4CIC A;  2LR8 A;  2MA3 A;  1RET A;  1HA8 A;  1AA7 A;  1MBG A;  1W4M A;  5LD2 C;  1IN6 A;  1J75 A;  1V5E A;  2HTJ A;  1KYZ A;  2IT0 A;  3ECH A;  3T8R A;  2H1K A;  1V5F A;  1IRF A;  5GAG J;  3HHH A;  3M4O J;  1ZN2 A;  2OZU A;  2CU7 A;  3GX4 X;  3V42 A;  3IL2 A;  1ETK A;  5FFZ A;  4GXO A;  4U0W A;  3TOB A;  1K6O A;  4ZTF A;  2PLY A;  2XSJ C;  3REO A;  2P7C B;  3ML6 A;  3IKT A;  3NEU A;  3TO7 A;  1B4A A;  4XSZ F;  5IYD J;  3WTW C;  5AIP A;  4IKF A;  3BJA A;  2LKX A;  4CXF A;  2MLK A;  2CRG A;  3S93 A;  3AG3 H;  2M87 A;  3Q9V A;  3UR3 C;  4EGZ A;  2EV5 A;  3C1D A;  2XGD A;  4WXH A;  2L7F P;  2L3D A;  3Q3S A;  2Z5U A;  4NB5 A;  2NNY A;  1VQN I;  3LSR A;  4DZP A;  2OV7 A;  3KP6 A;  2MH9 A;  1IV6 A;  2R7D A;  5IP7 J;  2R5Y A;  2EZH A;  3WU1 B;  3EYY A;  4XIC A;  2CUE A;  2Y30 A;  3K4B A;  3B73 A;  4XN3 A;  2IP2 A;  1VQP I;  4CZC A;  3FZV A;  3CES A;  4JYK A;  3JRC A;  2O0Y A;  1MBH A;  2FD5 A;  2KT0 A;  2D2W A;  4BBS J;  3CCL I;  1FIP A;  2Y0S A;  3ZMZ A;  2JUG A;  3L2V A;  1Y1V J;  1F5T A;  4LB5 A;  2E36 A;  4M71 A;  1XMK A;  1HKQ A;  4ENJ A;  4WX9 A;  3TOA A;  2E5N A;  4Y33 A;  1K6Y A;  4PUS A;  1WJC A;  2KKO A;  1T38 A;  3K2Z A;  4HF1 A;  1T56 A;  1MD0 A;  3FX3 A;  1ONV A;  4U7B A;  1W36 C;  4BQO A;  2ETH A;  4G8X A;  3HOW J;  1BW5 A;  1YW7 A;  3RKX A;  2CQ7 A;  2VKD A;  4HX7 A;  4B3A A;  1MH4 A;  2WV1 A;  3M8E A;  1D1B A;  4XLN F;  3ZN0 A;  2X6W A;  1P7J A;  1DP7 P;  1ZGJ A;  1DDN A;  3EDP A;  2ELH A;  2HQR A;  2JJ7 A;  3FDY A;  4J19 A;  3ABT A;  1B59 A;  2GLO A;  2OZ6 A;  4YEL A;  4BDZ A;  1U8B A;  2E1C A;  2LY9 A;  1KQ9 A;  2VXD A;  4UXN A;  2ESH A;  3O3K A;  3WTX C;  2X6X A;  4UB8 C;  1VQL I;  2P5V A;  5B1A H;  4IHW A;  5CQG A;  3G1O A;  2ZSH B;  1W7P D;  3PIO F;  1TLH B;  1TC3 C;  4O3M A;  3G4S I;  5GP9 A;  3WGH A;  1DQU A;  2M4G A;  2M34 A;  1FC3 A;  3BTL A;  3MFK A;  1IJW C;  2QWW A;  5DD4 A;  3S14 J;  2H09 A;  3QOP A;  5DD8 A;  2CW0 F;  4YII A;  4KIS A;  3LA3 A;  3TP0 A;  1R9T J;  2AHQ A;  2LK2 A;  1LUJ B;  4OU0 A;  2DA5 A;  1WJF A;  2VQH A;  2WA0 A;  1ORK A;  2V1N A;  2XAQ A;  3RDI A;  5ILU A;  3SYT A;  4LK1 F;  2FQ3 A;  1WJ5 A;  2QSH X;  5FKM A;  1BC7 C;  2VIX A;  4EJT A;  5E8G A;  1OJL A;  1ZRF A;  3OYJ A;  1X1B A;  3PQK A;  3CUO A;  1PUE E;  2FBK A;  1BI0 A;  2OPT A;  3LSJ A;  3DQV C;  2O6G E;  2HDW A;  3LWF A;  1BJA A;  4L5E A;  4BAY A;  3PQJ A;  2Q2E B;  3R0J A;  4Z6Y A;  1AKH B;  5C3E J;  3I53 A;  3LSH A;  5F0C A;  4LB6 B;  2JRT A;  1K79 A;  3BOQ A;  4ENN A;  2OCC H;  4UVB A;  5CVV A;  1V3F A;  1LJ9 A;  1TTY A;  2DT6 A;  3DXJ F;  3K7A J;  1QZZ A;  2IS6 A;  3NWT A;  3ABL H;  1USS A;  4HZF A;  3ZPL A;  2YU3 A;  5IOZ A;  1I1G A;  2EIN H;  2ZXI A;  4UUT A;  1KU7 A;  5M3M J;  3PIP F;  2IGN A;  3FKI J;  1ETX A;  3BLY A;  1LDD A;  2AS5 F;  2K85 A;  1J5Y A;  3CJR B;  3ABM H;  1ETQ A;  1R6R A;  1I3Q J;  2PX9 A;  3UKG A;  3CC7 I;  5CJ9 A;  2FNP A;  3BCB A;  1IXC A;  5E3L A;  3RKY A;  4BEH A;  4G7Z F;  3TED A;  2NVU B;  2YSR A;  2J5P A;  4E7Z A;  1P9Q C;  3OYE A;  1BI2 A;  4A3J J;  1U5T B;  2FNA A;  2LD5 A;  1QZY A;  1ODD A;  2LBF A;  1B9N A;  1XTA A;  2H27 A;  3MD2 A;  1ACI A;  3ABU A;  4XSX F;  1ITY A;  1XX5 A;  2YU9 J;  1YS6 A;  2VC1 A;  3QPL A;  3K6G A;  4EVI A;  2F4M B;  3BZ6 A;  4XRS G;  1YYV A;  1WJA A;  2XKP A;  1FTT A;  1PYV A;  2R3S A;  1G59 A;  2JA8 J;  3ROU A;  4Y13 A;  4ZC3 A;  3V8L A;  1OR7 A;  3LA7 A;  1O57 A;  2DBB A;  1DGR M;  1D1A A;  3JRG A;  3BR6 A;  3CJT B;  3FMQ A;  5HDG A;  3M1E A;  4F92 B;  4GO1 A;  1TNS A;  3ZQI A;  2M8E A;  4I7H A;  4PGH A;  1YLF A;  2LTP A;  4ZTJ A;  2R93 J;  3ABK H;  1MMA A;  1JKP C;  5JLW A;  3FIW A;  3W2W A;  3A0H C;  4A6E A;  2OAZ A;  3DBR B;  1O3R A;  2VOP A;  2EK5 A;  1SVO A;  2QVO A;  2K4J A;  1X1P A;  2Q8K A;  1BR2 A;  3JRF A;  3OL3 A;  1Z9C A;  1FYL A;  1OIS A;  1H9G A;  4ZH4 F;  5J40 A;  2HOT A;  3F3X A;  4CCL A;  5HOD A;  1RI7 A;  2NVQ J;  2MLG A;  2OJE D;  5IPA A;  2ZME A;  4OAZ A;  2EZL A;  4RB3 C;  3BJ6 A;  2HKO A;  1ZLJ A;  2QGU A;  1X4O A;  4RM2 A;  4G9Y A;  1HF0 A;  4ZDO A;  3IRQ A;  5A2Q Z;  3D0S A;  2R7W A;  2MW8 A;  2MAB A;  4M3G A;  2ZME C;  4N4O B;  4Y7N J;  3TDU C;  4N9I A;  4MO7 A;  1TWC J;  2IA2 A;  4GDF A;  1ETV A;  4IRG A;  3ISP A;  3C18 A;  2ZXJ A;  2DYS H;  3A01 B;  5ICE A;  1PDN C;  5DUI A;  3UNG C;  1FSH A;  4YIF A;  3K4L A;  2J5O A;  5FB2 A;  1Z0X A;  3ZMT A;  2DFI A;  4MEY F;  4I0A A;  4HPQ A;  4LIU A;  3TO6 A;  5ICC A;  1LE8 A;  5FRO A;  5M5W J;  3B6A A;  1BI1 A;  1RNL A;  4S0H B;  4BU2 A;  2RGV A;  5FFX A;  3FXJ A;  2P81 A;  3GEZ A;  4I76 A;  2CQX A;  1Z21 A;  2L01 A;  1ULY A;  5GPA A;  3S16 J;  4DBQ A;  2M5W A;  3HPH A;  2CG4 A;  1KYW A;  1FJL A;  3KEY A;  5M5Y J;  2LYC A;  1WVR A;  3TQN A;  4X6A J;  2W84 A;  2HZT A;  2VPL A;  3FHN A;  1WWX A;  5AON A;  2E1O A;  1UJ8 A;  2XRN A;  2BGC A;  2YX7 A;  1Z3X A;  4I99 C;  3LSK A;  4WCG A;  2XAH A;  3PL8 A;  2L9V A;  1XPX A;  2JA6 J;  3HOX J;  4IL6 C;  1XSD A;  3RZD J;  1O3Q A;  3U9G A;  2Q0O A;  3RPU A;  4RAZ A;  2N8G A;  3LOC A;  2MG4 A;  2W00 A;  4FIS A;  4HAM A;  2WY7 Q;  4A5M A;  3WU0 A;  5IT3 A;  5KAI C;  4E7H A;  2E7W A;  4KN4 X;  1W5S A;  1XSV A;  4JQF A;  4KMF A;  1IRZ A;  1UZC A;  4A6D A;  2W7N A;  3J81 K;  2OTJ I;  4F7Z A;  3O6B B;  2XAF A;  3ZQC A;  1TL8 A;  3DKW A;  2XF5 A;  1JTX A;  3H1C A;  2ID6 A;  1WFX A;  2XGE A;  3EQL F;  3HXL A;  5D4S A;  3U1K A;  2LKS A;  2P0W A;  3BZC A;  3E5Q A;  3C2H A;  3KLO A;  3JW4 A;  2JTV A;  4ETS A;  2WAF A;  3GZ6 A;  1JGG A;  4UVA A;  2R7F A;  3IAM 2;  3VPR A;  1MDM A;  1XGN A;  1LDK B;  3K69 A;  4F93 B;  1Z67 A;  1U5T A;  1Z77 A;  3F8F A;  5IYB J;  2VJI A;  4A0Y A;  1C0W A;  2HI3 A;  4BXF A;  1YJ9 I;  5ILV A;  4Z2Y A;  1EH8 A;  2FOK A;  2W25 A;  1FP1 D;  2GOM A;  4PK4 A;  2DQL A;  3TBI A;  4YIR X;  2JA5 J;  3P9I A;  1V54 H;  3FM5 A;  5H6R A;  1YX5 A;  3JAM K;  1R7J A;  2OUM A;  2XAS A;  4MTD A;  2VJ4 A;  1OCZ H;  4TV7 A;  1YJW I;  1FOK A;  2ZFW A;  5D6E A;  2WAD A;  1N25 A;  2DDA A;  4NHJ A;  4OMZ A;  2JSC A;  3PUF A;  4BHP A;  5J6X A;  3LNQ A;  2OTL I;  1PVE A;  5IT9 Z;  4P1W A;  3GTL J;  2KLO A;  5DS9 A;  3ZP5 A;  3I58 A;  1OLT A;  2JPC A;  4RMN A;  4MEX F;  3M1C A;  2DMU A;  3HTS B;  2CGP A;  3I0T A;  3ASO H;  3HOV J;  1OCP A;  2OC6 A;  4IJA A;  4IRI A;  1N78 A;  1CGP A;  1J09 A;  1MBK A;  4OMY A;  2ZO4 A;  1NG7 A;  4IHY A;  3H3Z A;  3AL0 C;  1FSE A;  4LG0 A;  4XRM A;  5LBQ A;  2M45 A;  1IDY A;  4C3I J;  4IHX A;  3O2P E;  4RAF A;  4MGR A;  3HOT A;  3J80 Z;  2JT1 A;  2E1M B;  2DPU A;  1NK2 P;  2BHZ A;  4BXX J;  3K4N A;  4ON0 A;  4E7S A;  1LQ1 A;  4UNO A;  2DA1 A;  3MKY B;  2EA4 A;  1T8I A;  1TW2 A;  3VSL A;  4AU7 A;  3HSF A;  4AVP A;  3CQZ J;  2V9K A;  3HIF A;  2CFX A;  2NNN A;  3A01 A;  3L2Q A;  1GXP A;  3DKX A;  2XAU A;  4JP0 A;  2NVT J;  1L3L A;  1NG6 A;  2VKH A;  2DXI A;  1SD4 A;  2EIL H;  1T0F A;  1R5I D;  3TDZ C;  5EG0 B;  2R5Z B;  1N77 A;  1MJB A;  3IHU A;  4AIK A;  2LH9 A;  1BI3 A;  3CJQ B;  3DFG A;  1TT5 B;  1Y8Q B;  4LD5 A;  2AO9 A;  2VBX A;  1OYI A;  5D6F A;  3WTU C;  1K4S A;  4HDV A;  4M6X A;  4ESF A;  2Z2S B;  3FXU A;  5LGT A;  4RA2 A;  2VJJ A;  4K2E A;  1U0J A;  3EUA A;  2L4M A;  2Y0S N;  4KYW A;  3SZP A;  5LEJ A;  1D8J A;  2JN6 A;  4CCM A;  3DPU A;  1EKE A;  2JVH A;  5DDG A;  2FUG 2;  3G71 I;  2ZFU A;  1U78 A;  3KZY A;  4FT8 A;  2UXN A;  4RB2 C;  3WE2 A;  2K5C A;  2HQN A;  3AFH A;  1IV8 A;  2PI0 A;  2AQE A;  2EV0 A;  2BBY A;  2FOW A;  2X4H A;  2WWY A;  3RPQ A;  4KT5 C;  1FMW A;  2ECC A;  4M3D A;  2DI3 A;  5F1J A;  2A6H F;  1KQ8 A;  2O3F A;  3ERE D;  2JWT A;  3BPX A;  4BH9 A;  2HEO A;  2IRF G;  5H2F C;  2UV1 A;  2X85 A;  3PO2 J;  2E1N A;  1K83 J;  2W82 A;  3CMA I;  1KQ0 A;  1RC9 A;  5HLI A;  2DPD A;  5DCM B;  1SMY F;  2CO5 A;  4HG2 A;  1Z05 A;  1X19 A;  4BE0 A;  4W1U A;  3BT9 A;  2DOF A;  2VE8 A;  3DTE A;  1VQM I;  4MFD A;  4M74 A;  2R7R A;  1UEL B;  3EUK L;  5E3O A;  3QQA A;  1OYY A;  2H8R A;  4KUM A;  1UG2 A;  4Y4R A;  2KRC A;  2O5R A;  3HSR A;  5LHI A;  2EIM H;  2ZB9 A;  3SHF A;  3SZT A;  3N05 A;  1ENH A;  2RNG A;  2KJC A;  1QQI A;  3K70 D;  1XGO A;  4ENM A;  4AYB A;  1XB4 A;  2VB6 A;  3S8P A;  1CQT A;  3DKY A;  4QIW N;  1S8N A;  4RGS A;  1FWZ A;  2HU9 A;  1A36 A;  2L7Z A;  3WOD F;  4A2U A;  4AVZ A;  3S15 J;  1HCR A;  4BNC A;  5D5X B;  3S1M J;  1OMI A;  5TIS C;  3F21 A;  5LHH A;  1HW1 A;  3CUQ A;  4A3E J;  1QHH D;  3ZMV A;  2ME6 A;  2F5V A;  1Q1V A;  4KFC A;  5K1Y A;  2D5V A;  3ZGK A;  3ZQG A;  3WTV C;  1PUF B;  3QPT A;  2XF7 A;  5GTI C;  3ZRG A;  3SZG A;  1HKT A;  1FP2 A;  3QP5 A;  1BC8 C;  2XUB A;  5KVR A;  1D8K A;  2ZCW A;  3IH2 A;  1BJZ A;  3WHC A;  4M6Y A;  2KIQ A;  1WH5 A;  4RM3 A;  1H88 C;  1F43 A;  2RVC A;  2K7L A;  2CQN A;  3MWM A;  4IO9 F;  1JE8 A;  1KU9 A;  5LRS A;  5IP9 J;  3BR1 A;  4JX4 A;  3CJN A;  3W2A A;  5JR3 A;  1YI2 I;  4CO8 A;  1MNM C;  1ZYR F;  2TCT A;  1Z3Y A;  4KN7 X;  5FRM A;  5E18 F;  5EG0 A;  2YUS A;  3LFU A;  3WTT C;  5TJJ A;  2A6E F;  1ZQ3 P;  3QAH A;  3PNT A;  2IEK A;  4P55 A;  1B8I B;  3PO3 J;  1YOV B;  1JXS A;  4RGX A;  3Q0W A;  2NVX J;  3HM5 A;  4II3 A;  3J7Z I;  1RPW A;  5LRR A;  1YS7 A;  1EA3 A;  4LOC A;  1TW3 A;  5JVT A;  1EJ9 A;  4IRH A;  3H3U A;  1IRG A;  4LLL A;  4XKC A;  3JAM Z;  1ZG5 A;  2DO7 A;  2EFQ A;  4G7H F;  4JOM A;  2E2H J;  1H8A C;  1GDT A;  4DOZ A;  2QKM B;  4BQN A;  5EDN A;  5BOX A;  1LVA A;  3G3Z A;  4KNY A;  2O9L A;  1JT0 A;  4ZDP A;  4IOA F;  1XGS A;  1ZHF A;  3PNV A;  1HDP A;  1VZ0 A;  4ZYG A;  4EJV A;  2VXZ A;  4WXD A;  1IDZ A;  4Y17 A;  5EF6 A;  4GRI A;  2F5C A;  3OS1 A;  3S17 J;  1BR4 A;  3L2U A;  2KIU A;  3OMY A;  1HST A;  1MSF C;  3CDI A;  3HUG B;  4P5O A;  3L00 A;  3ZQH A;  3HOZ J;  1YQA A;  4A3B J;  2IS1 A;  2HDC A;  2FRH A;  2QYO A;  5C4J J;  2NS0 A;  1G2H A;  3OYD A;  1FOY A;  1QPM A;  2GIZ A;  2BZT A;  4KT6 A;  4L0Y B;  1KU3 A;  3RI4 A;  1I1S A;  2NVY J;  1R49 A;  5DCM A;  5L3D A;  2HDD A;  1W36 D;  4CGZ A;  3LFK A;  1RKT A;  4AM3 A;  4M3B A;  1B72 A;  3M9A A;  1LB2 A;  5ERI A;  1LNW A;  3G1L A;  3K4C A;  3CDH A;  3KYC B;  4M9Z A;  1S9H A;  1J9I A;  3I5U A;  5D5W B;  3T1B A;  3B02 A;  1F4K A;  2VQL A;  3M07 A;  2FSW A;  3I4N J;  4C2M J;  5K7Z A;  3MAJ A;  1XMX A;  1D1C A;  4RB0 A;  2WC2 A;  2LNB A;  3MZ8 A;  2WB1 A;  2COM A;  3QYB A;  3VYU B;  1IUY A;  2FA5 A;  3ULQ B;  3ZXS A;  1XGM A;  2M30 A;  1ZAO A;  4H0E A;  4DJA A;  3ZMD A;  2QZ8 A;  5GPC A;  3PM1 A;  3NAR A;  3NRV A;  1O7F A;  5L3C A;  2ZJP F;  2BY0 A;  5BPD A;  4YG2 F;  2FU4 A;  3D5L A;  2XRL A;  5LGN A;  4DBR A;  4XOP A;  3TW7 A;  2OF7 A;  5L3B A;  2Z33 A;  1S7E A;  3RKW A;  4S04 A;  2P6T A;  3DLA A;  4UV8 A;  2LY1 A;  1X2M A;  1RR7 A;  1E0E A;  2X6O A;  1N75 A;  3BZK A;  3MZH A;  2R4G A;  3F8C A;  4XLP F;  2BW3 B;  1SFO J;  2XF6 A;  3JTG A;  4BKX A;  4MTE A;  2RKH A;  4O5V A;  3BG7 A;  2HTS A;  1Z6T A;  4B1R A;  3DU6 A;  2NAZ A;  1SVM A;  4Y3O A;  1R5G A;  3F8M A;  2ELJ A;  3V8K A;  1XDU A;  4EEF G;  3QYF A;  3KCC A;  3X2Q H;  1LFP A;  4HOB A;  2HR3 A;  2WAQ A;  3FBI B;  4BGD A;  3TO9 A;  4RS8 A;  4UB6 C;  4E4H A;  4BBR J;  4MIM A;  2P7V B;  4DZJ A;  2P8T A;  2VL8 A;  1O3T A;  1NHA A;  4II2 A;  2IJL A;  3RJP A;  5JFR A;  2VBY A;  3QOD A;  4I01 A;  3S2W A;  4BYY A;  1RZ4 A;  5E3N A;  5K5O A;  3FM3 A;  4YFX F;  4OIN F;  2YR2 A;  2I10 A;  1K61 A;  3E5U A;  1OCR H;  5E1Z B;  2DW4 A;  2LRE A;  3BDD A;  3I56 I;  2MGQ A;  2GM4 A;  4DYR A;  2QBY B;  3ESW B;  4LLN A;  1R22 A;  4IEJ A;  3I64 A;  1Y8R B;  2DOE A;  1REP C;  4D7N A;  5F1R A;  1KA8 A;  1WH7 A;  2ZJR F;  1WQ2 A;  4BQQ A;  1G3S A;  1QNT A;  4B48 A;  3QU6 A;  4YRV A;  2MC4 A;  4BY1 J;  1MH3 A;  2K4B A;  2X1E A;  3U1D A;  2FX0 A;  3CLO A;  1R4M B;  3N4M A;  1HBX G;  3I55 I;  2A5W A;  3OYL A;  2I8D A;  2ZKZ A;  4NUB A;  3KP3 A;  4CDG A;  2PMZ A;  3KIO A;  1H89 C;  2H6B A;  5CVJ A;  2BHY A;  2XB0 X;  3O8H A;  2DFH A;  3IC7 A;  3WG9 A;  3RIR A;  2M9H A;  2LG4 A;  3W3C A;  4F3Q A;  1Z7L A;  3KP4 A;  1JKR C;  1YO5 C;  4E6K G;  2CSO A;  5J8C A;  3G1M A;  1VTN C;  1SEU A;  1SVL A;  2E19 A;  4ZYE A;  3OSF A;  1JKO C;  1UAA A;  3F6V A;  4HEA 2;  1MMS A;  2GIV A;  3GF2 A;  3HUG A;  4ESB A;  2X6Y A;  2VON A;  5F27 A;  1WGX A;  2JK3 A;  3HRT A;  4MQ9 F;  2QQA A;  4OOI A;  4D1Q A;  2W24 A;  3DBH B;  3FBN B;  1P6R A;  4Q47 A;  2FQ4 A;  1VQ8 I;  2R7U A;  1QA6 A;  1TWG J;  2IXS A;  2OQG A;  1GHC A;  3JRB A;  3HL2 A;  1MMD A;  3CCJ I;  2IS4 A;  3HRM A;  1P7I A;  3CF2 A;  2ECB A;  4L9N A;  3K9T A;  5FGM A;  3S1Q J;  2FE3 A;  2CWE A;  2DA4 A;  3CO6 C;  3E0J B;  2XKO A;  4BY7 J;  3ELK A;  1OQY A;  4C3H J;  4FE7 A;  4OIQ F;  2Q1Z B;  4UV9 A;  1FX7 A;  2QQ8 A;  2CUJ A;  1IGN A;  3JRH A;  3P9C A;  2XPU A;  3E97 A;  3G2B A;  1D5Y A;  4XLA A;  5FKN A;  2CUF A;  5E8I A;  5C44 J;  3DLL F;  3IWZ A;  3K1P A;  3GTO J;  1ON2 A;  4A5N A;  3HYI A;  1OR7 C;  3C3W A;  4HQM A;  3OYB A;  1VF9 A;  3H36 A;  1XC5 A;  2BXZ A;  3IV5 A;  2DTR A;  2P4W A;  2GBY A;  5EGO B;  4A3M J;  2TDX A;  4PJJ A;  4BE1 A;  2AXT C;  3CD6 I;  3CCU I;  4WXC A;  4P9U A;  4BS9 A;  1V4R A;  1TQP A;  1FY7 A;  2BW3 A;  1MSE C;  2JQ7 A;  2VBZ A;  1MNE A;  5FD6 A;  3BCA A;  2VLA A;  4XID A;  3L2C A;  3JTH A;  4XOT A;  1FEX A;  5ED4 A;  4HF2 A;  3KEO A;  2DA7 A;  3VSK A;  2L9S A;  2Y75 A;  5E3M A;  3EUH A;  4KIC A;  1MMN A;  2P5K A;  2GWR A;  3HRU A;  1VQ7 I;  4BUP A;  3ZQL A;  2R7Q A;  2OU2 A;  2Y31 A;  2V9P A;  2K9N A;  3I59 B;  3J7A Y;  2HVQ A;  1G3W A;  2W85 A;  2X1C A;  2DT7 B;  3P7N A;  3BTC A;  5EEH A;  1X3W B;  3GUD A;  2VOD A;  2QQB A;  1IO2 A;  2PN6 A;  3L2R A;  1G6N A;  4QTR A;  2K9S A;  2DFE A;  1W0U A;  4PJN A;  2F5D A;  1FOW A;  4U87 A;  4A3I J;  3HOY J;  2DDB A;  1VQK I;  2QBY A;  3C2B A;  2V7F A;  2PJP A;  1E2X A;  1RR8 C;  1FT9 A;  4E7L A;  3GTP J;  3SFZ A;  4AIH A;  2FJ1 A;  2DMQ A;  2LMD A;  4ITV A;  2L7M P;  3WG7 H;  2I5U A;  3GTJ J;  1UHS A;  5F0H A;  1GUU A;  5JHF A;  4QLC U;  3CCM I;  4IHT A;  1G3Y A;  3PFI A;  4LJZ F;  4E7K A;  2Y9Y A;  3RPU D;  1G4D A;  2IGO A;  5D8L B;  4L9J A;  1R4N B;  2P6S A;  3PSI A;  5ICF A;  3TGN A;  1Q1H A;  3E3V A;  1FYM A;  2UWM A;  1DPR A;  3CC2 I;  3E1S A;  2Q2E A;  1HC8 A;  1GT0 C;  2M0M A;  3KP5 A;  1AKH A;  2CFO A;  3J7Y J;  3HZJ A;  1ZK8 A;  1RES A;  4AYB N;  4HW0 A;  1ZRD A;  1OCT C;  2DYR H;  3RZO J;  2BY2 A;  4OIO F;  3KYL A;  3E7L A;  1UHW A;  2KDZ A;  4DGW B;  3CCV I;  2IGK A;  5GAE J;  3NWS A;  5E20 A;  1Y1W J;  2HZD A;  3GWZ A;  3MVP A;  4CA0 A;  5J47 A;  3GLL A;  4GGG A;  3COA C;  1VFC A;  1R1T A;  2F4I A;  4XLF A;  3LSI A;  2CH0 A;  3KEQ A;  3OR1 C;  1YIO A;  4L5I A;  2DLL A;  4BHC A;  2LDU A;  3MKZ A;  1YE9 A;  2K86 A;  4E70 A;  1Y0U A;  2HOA A;  1FIA A;  5L3F A;  2W48 A;  1HLV A;  1ON1 A;  2LFB A;  1IUF A;  1RRJ A;  5F6F A;  4XKB A;  1U6G A;  2ZC2 A;  4QPQ A;  3H92 A;  4OAY A;  3QOE A;  4BAC A;  3ONQ A;  3TP3 A;  2UZK A;  1I3A A;  2XRO A;  2ISZ A;  4PGG A;  1GVD A;  2L2O A;  2CJJ A;  4HST A;  1ZRC A;  1U5T C;  2A05 A;  2QKL B;  1BOA A;  4CYC B;  4MHG A;  2R7O A;  2RN7 A;  3PJR A;  1ZH5 A;  1R58 A;  3I3L A;  3RQI A;  4EM1 A;  1GV5 A;  2LP0 A;  5C4X J;  1A04 A;  4XK4 A;  4DYC A;  4LMY A;  4CUG A;  4NQW B;  2M0C A;  3FXR A;  1AOY A;  4IPA A;  3KZZ A;  5CKT A;  5EGO A;  1XN7 A;  3GFJ A;  2MSY A;  1Z91 A;  1M1E B;  2F6C A;  3DEW A;  4F91 B;  2M1B A;  1LPQ A;  4I6Z A;  2XVC A;  4LFU A;  3OYG A;  5FKO A;  1ZGW A;  2NRA C;  1TP4 A;  3S3M A;  3S2H J;  4A3C J;  2VOO A;  3LQR A;  2EB7 A;  4IQJ A;  1FLI A;  1G8X A;  3BR2 A;  4MQV A;  1ZR4 A;  4L0Z B;  3F9K A;  4FET A;  4O6J A;  5JHU A;  1XS9 A;  1D5V A;  5E17 F;  3ZN1 A;  4EJU A;  1ETO A;  4B47 A;  1R36 A;  3IH3 A;  4F55 A;  4HNT A;  4M9X A;  3W6J B;  1NTC A;  4UUS B;  2RC4 A;  1OCO H;  2G7H A;  4AWX B;  3DEU A;  4XN0 A;  2DJI A;  4UUV A;  3AG4 H;  2WBM A;  3JCU C;  3ZQF A;  4RBO A;  5IOY A;  2KJB A;  1RUO A;  5FD5 A;  3Q0V A;  2KIF A;  1D0Z A;  4XKW A;  3FHZ A;  3BWG A;  2GA1 A;  5BMZ A;  4D5F A;  2LY2 A;  1FBU A;  4HSR A;  4AIJ A;  3P9K A;  3TW6 A;  5HS8 A;  2DT5 A;  2DCE A;  2PJR B;  3MQ0 A;  2X48 A;  2PFB A;  5AIQ A;  3OIO A;  2GAU A;  3PFY A;  2F5E A;  3GFI A;  3GCM A;  5ICG A;  2WTE A;  1T0F C;  3R0A A;  4Q48 A;  3VEP A;  3GW2 A;  2K40 A;  5K7H A;  2EIK H;  5CYV A;  1K7A A;  4CSW A;  1XCV A;  2E34 A;  4M3E A;  5BQT A;  4J01 A;  1J0R A;  3OS0 A;  2BY1 A;  5D8K B;  1U2W A;  1DPU A;  1SAN A;  2RNJ A;  3H5R A;  1BN5 A;  1POG A;  4WWC A;  2WB1 N;  3VOE A;  1U3E M;  3H35 A;  1V55 H;  5DM6 F;  4HF0 A;  2BVL A;  4CYD A;  5CVR A;  3FXM A;  4Q4Z F;  5GTH C;  1X3Z B;  5CLS A;  1ZLK A;  3ASN H;  2Y9Z A;  2K9L A;  4IX7 A;  2Y69 H;  3FF5 A;  4NC7 A;  6PAX A;  4PDK A;  3S1N J;  1XCB A;  3BY6 A;  3RQ4 A;  4ZYD A;  3WGI A;  3MN2 A;  4XLH A;  2DN0 A;  4HV6 A;  2IA1 A;  3ZMU A;  4A3D J;  2DAO A;  2KL4 A;  5EEA A;  3HGY A;  2ISY A;  4EM2 A;  5TGT A;  2GZW A;  3H9G A;  3CLQ A;  3KX2 A;  2VC0 A;  5K5R A;  3I4P A;  2K3P A;  3WTS C;  2QUF A;  2IAI A;  5DUK A;  2P5L C;  1FYK A;  4BJ5 C;  3K4M A;  3V7S A;  2WAQ N;  4E7I A;  5ILS A;  2EFN A;  3HC7 A;  5EZH A;  2EFP A;  2EZI A;  2R5Y B;  1Y6I A;  1YRN B;  1X58 A;  2GQQ A;  2DOA A;  5K7F A;  3OYM A;  4CYC A;  2CW7 A;  2A69 F;  2RDP A;  2H6C A;  1H0M A;  5EEG A;  2EBI A;  1KON A;  5CQE A;  1WJD A;  2ZJQ F;  4Q5S F;  3W6K B;  1J2X A;  3KFW X;  1IN5 A;  3BG6 A;  1VND A;  2M2E A;  2VT3 A;  3T5X A;  5L3E A;  4G7O F;  1WRJ A;  5LEK A;  3HRS A;  5HVQ C;  1LKX A;  2BVM A;  3P5J A;  1R71 A;  3HEF A;  1SD7 A;  3KP7 A;  3QPS A;  2PEX A;  2GOX B;  2QQ9 A;  2CV2 A;  1ZAR A;  3I4M J;  2CS3 A;  1FMV A;  4C2T A;  2H1L A;  1TWA J;  3E6D A;  2AXL A;  2DU9 A;  4I02 A;  3E5X A;  2XC7 A;  1QVT A;  4RLF A;  5E1W A;  2HWV A;  2M3A A;  3GVA A;  3R60 A;  5BPI A;  1SD6 A;  2HKX A;  2IBD A;  5CVU A;  3U2R A;  5LGU A;  5HNH A;  3S1R J;  2W57 A;  1E3P A;  1ZG3 A;  4QPO A;  3H5A A;  2KRF A;  3PUB A;  2HOS A;  4EJO A;  5FLM J;  3KE2 A;  5DEQ A;  5KHD A;  1DP3 A;  4G94 A;  3I54 A;  3VB2 A;  4HNV A;  1SFU A;  2LLK A;  5JLX A;  2V6C A;  3CUQ C;  1JTY A;  1WI9 A;  1R1U A;  2FEZ A;  4RAY A;  1WCM J;  2NOG A;  3U21 A;  1EH6 A;  4HBL A;  2ID3 A;  3V8J A;  3J81 Z;  1R1V A;  1Z7U A;  1B6A A;  4UUS A;  2XGX A;  2E2J J;  3T8T A;  5HNF A;  2D1H A;  2NS8 A;  1KGS A;  2H94 A;  5FLV A;  3HB9 A;  5J4Y A;  2JA2 A;  1X2N A;  2DK8 A;  4DQ2 A;  3LA2 A;  3K4J A;  3FKJ A;  1IN7 A;  2MH2 A;  3A1Y A;  3HOU J;  2KIM A;  2E1M C;  2TRT A;  1MBE A;  1S7O A;  4G12 A;  4R79 A;  5J8F A;  2E35 A;  1W5C C;  1J59 A;  2V1U A;  1YFH A;  3D5R C;  2WV0 A;  2R5Z A;  2KIS A;  2K9M A;  2KPM A;  2X9D A;  4DNC A;  3DCF A;  3OYF A;  3QRF F;  2HPM A;  1W1W E;  1R00 A;  2R0Q C;  2BEO A;  2IPQ X;  5DCF A;  3CCQ I;  1W7P B;  2BXY A;  1IN8 A;  3AKZ A;  3Q5F A;  2MFZ A;  4JX5 A;  1IG7 A;  5IY5 H;  3MKW B;  1VQ6 I;  2ESN A;  3E6M A;  1VQ4 I;  3F22 A;  1ZR2 A;  2PG4 A;  3KP2 A;  4BL0 B;  3CCR I;  3BTJ A;  3KPH A;  2Y0M A;  4L18 B;  1HDD C;  2VJ5 A;  3CDL A;  2D45 A;  1PP7 U;  1BR1 A;  3BQZ A;  4S05 A;  5J1Y A;  1X1C A;  3OSG A;  4GCV A;  2L5Q A;  4OWR B;  1A5J A;  2K27 A;  2EZK A;  2GXG A;  1DU0 A;  2HQ5 A;  2EPF A;  4M9S A;  4XKV A;  4C30 A;  3SFI A;  1JT6 A;  1O7L A;  2NYX A;  2HFH A;  5LLQ A;  1ZGA A;  2O8K A;  4I98 B;  4FCY A;  2ACJ A;  1BOB A;  4PJ0 C;  3NQO A;  1O3S A;  2JA7 J;  3Q9S A;  1FZP B;  1ERD A;  3F0C A;  4V2G A;  4EV0 A;  4RB1 A;  2OA4 A;  3IP4 B;  4B43 A;  1OPC A;  3BPV A;  3L2W A;  2HQA A;  5A2Q K;  1RKW A;  3OOP A;  3GTK J;  1HSJ A;  3F6O A;  3SEZ A;  2BE5 F;  5BNG A;  5EJC A;  3KYD B;  2LF7 A;  4L9V A;  3V7C A;  2L9N A;  1K4T A;  3ZQ7 A;  4R1H A;  4BEH B;  2X1D A;  2QM3 A;  3OYC A;  5IYC J;  3KET A;  3QWL A;  5DTD A;  4CCN A;  1Y39 A;  1YRN A;  3H5N A;  1WJE A;  2EWN A;  1ZKG A;  2V9V A;  4FAS D;  2QLZ A;  1PP8 F;  3GTG J;  2DQR A;  2HYG D;  2W4S A;  2DMN A;  4AD9 A;  2V6E A;  2LKP A;  2VKV A;  2LBF B;  1LFB A;  2IA0 A;  3HKZ A;  2G9W A;  2ZBK A;  3GLX A;  5L3G A;  2LOO A;  3QP6 A;  4OIR F;  2NXN B;  1MMG A;  2CQQ A;  2PMU A;  1FNN A;  1R23 A;  4U0V A;  1E3O C;  2JZY A;  4XMY A;  4L9T A;  3AG1 H;  5FJ8 J;  1BA5 A;  2FF4 A;  4R8H A;  4HLX A;  2BV6 A;  3TKY A;  1B1B A;  4HA8 A;  1UB9 A;  1A31 A;  2EFW A;  4RGU A;  1S72 I;  2KFD A;  2L0K A;  3J7A O;  1JUM A;  1W5T A;  2EV6 A;  3VDX A;  4CH7 A;  2VBW A;  3TL4 X;  1QO0 D;  3SJM A;  3BP8 A;  2ADU A;  1PUF A;  3BR3 A;  1SMT A;  3WE3 A;  2IS2 A;  3BRO A;  5J3L A;  2YX4 A;  3BG9 A;  3OOU A;  1OKR A;  3CCS I;  2XB5 A;  2KDO A;  4H4K C;  4KDP A;  4GFB A;  1SFK A;  3L09 A;  3GTQ J;  2CW8 A;  2QSG X;  4QSH A;  1WPK A;  4ZDL A;  3CTA A;  3HBL A;  2ZME B;  1UMQ A;  3VFZ A;  4AUX A;  3SXY A;  1DGW Y;  1XG1 A;  2RQP A;  2XPW A;  3ZMS A;  4P96 A;  1NH3 A;  1QVU A;  2EQR A;  5DV5 A;  1X1A A;  3R4K A;  2GXA A;  2Z16 A;  3LMM A;  3CF5 F;  4PSW A;  4D0P A;  1TWH J;  1APL C;  2R92 J;  4Y52 J;  1XD7 A;  4X1E A;  1IXR C;  2B0L A;  4NC8 A;  5CPR B;  4HRI A;  1B8I A;  3VYT B;  5CVI A;  4UHT A;  5GAH J;  4XQF A;  2O8X A;  2CV0 A;  2A6T A;  2VI6 A;  4IVN A;  1W7P A;  1YTY A;  3ZQQ A;  3JRE A;  1GV2 A;  3GME A;  3GXO A;  4XRF A;  3VYR B;  5J4V A;  1WSU A;  3HPG A;  4IZZ A;  1EV7 A;  4XBF A;  3GTM J;  5HLH A;  5HLT A;  3SDB A;  1LE8 B;  3ZOB A;  5FKL A;  4MLO A;  5IT9 K;  2UXX A;  3ERM A;  3KLN A;  1FOX A;  4LGW A;  1IF1 A;  2O03 A;  2KHM A;  3CCY A;  4PZJ A;  3FMR A;  1UG0 A;  5JVG F;  4HX8 A;  3K0L A;  1MJ9 A;  4HV5 A;  2XAG A;  2JPB A;  2KZG A;  2FXA A;  2VQC A;  2A3S A;  3K1M A;  4V19 K;  2KZV A;  4X0G A;  1JJ6 C;  2HYF A;  3VOD A;  2RV8 A;  5GAD J;  4YEJ A;  2MBF A;  4GYI A;  1LFU P;  4KIF A;  1FPQ A;  2F4O B;  1F9N A;  4A3G J;  3DP7 A;  1UCR A;  2E5Z A;  1XDS A;  2KMU A;  3WGG A;  1MND A;  1S6L A;  3BJO A;  3J80 K;  2Y2Z A;  4GYG A;  4UY8 I;  4G6D A;  4LIV A;  2C6Y A;  3QPH A;  2WAE A;  4BHB A;  1TBX A;  2ICW G;  2B63 J;  2R7Z J;  3AAF A;  1XSX A;  2YPR A;  4RAG A;  1YHQ I;  3A0B C;  2L7K A;  5LHG A;  1EH7 A;  2VAS A;  3HJE A;  3WU2 C;  1ZEL A;  2OD5 A;  1MDM B;  1YX3 A;  4D5C A;  4HDU A;  4FTH A;  5F08 A;  4NC6 A;  2ZXH A;  4E7J A;  4CZZ A;  1QBJ A;  3S3N A;  4XRS A;  2JVG A;  3JRI A;  1P4W A;  1GVJ A;  2KRH A;  4KIG A;  3BC8 A;  3JSO A;  2K3F A;  4CCK A;  1QZE A;  3DF8 A;  4MFE A;  1AHD P;  1F36 A;  1TQM A;  2QCO A;  2GXB A;  4WF2 A;  3A4C A;  2EFO A;  4BQA A;  1FBQ A;  3I71 A;  4YFK F;  4FX4 A;  3MEX A;  1UFM A;  3IUO A;  4KA4 A;  2R7X A;  1IAW A;  1JUS A;  4U88 A;  1QRY A;  1SAX A;  2DK5 A;  1SD5 A;  4N9H A;  1A6Q A;  5EYR A;  2XAJ A;  1MKM A;  1ETY A;  1MW7 A;  3DV8 A;  3A2K A;  2VN2 A;  1HKS A;  2BY3 A;  2XIG A;  4EMS A;  4NDL A;  5KAF C;  3MCZ A;  4B3X A;  4JX6 A;  3A03 A;  3DPT A;  4AID A;  1BIA A;  2Z99 A;  3AL0 B;  1QPI A;  1I5Z A;  4ANJ A;  1X4P A;  4UVC A;  2R7T A;  3M8J A;  5K5Q A;  3LAP A;  3BR5 A;  4U0Y A;  2HNH A;  3E6C C;  2E2I J;  4XM3 A;  4YFN F;  3F23 A;  5M5X J;  1U8R A;  2ZJ2 A;  1T6S A;  4A12 A;  1I27 A;  3IWF A;  3H3V K;  2XPV A;  3R6S A;  2A07 F;  4PFO A;  4M72 A;  4HX4 A;  2ZNZ A;  2HS5 A;  3EUH C;  2CUZ A;  5HS7 A;  1G3T A;  4LG0 B;  2M7A A;  3S32 A;  3HDD A;  3OIP A;  3LAJ A;  1OYW A;  3C7J A;  3OYA A;  2MC3 A;  4XR6 A;  5EZG A;  5FLX K;  4M6V A;  4HNU A;  2FMY A;  1LDJ A;  2MYS A;  3MKL A;  4Y15 A;  3QU3 A;  2PMH A;  1MJA A;  1MGT A;  3HGG A;  3OYH A;  1JI8 A;  4DYQ A;  3RKQ A;  1VQ5 I;  1VQO I;  1A6I A;  4A69 C;  1IZ1 A;  2DA3 A;  1D0X A;  4ZZD A;  2ME0 A;  3FIS A;  1L0O C;  5D4R A;  2DTZ A;  2XGC A;  3W6V A;  1MBF A;  4WK8 F;  3M7G A;  2H8W A;  2EJR A;  4PJL A;  3ZR8 X;  2HXO A;  5KNL A;  3SDG A;  2FBH A;  3W2V A;  3OY9 A;  3H0D A;  3O8G A;  3G6E I;  2L54 A;  5KK1 A;  1ZTR A;  4EAT A;  1I6X A;  2XHK A;  2HXI A;  3CMM A;  3OV8 A;  1S5L C;  3WTZ A;  3JSP A;  2X51 A;  5FKK A;  3EYI A;  1X3U A;  1TZL A;  2BOL A;  2UUZ A;  4G6Q A;  3M8F A;  4M73 A;  2RRE A;  3DTI A;  3GZN B;  2R7V A;  3CO7 C;  3OR2 C;  3HOS A;  1IXS B;  4ZYH A;  2CV1 A;  2NOJ B;  3N97 A;  1F1Z A;  2YS9 A;  4DW6 A;  3CZ6 A;  3H9J A;  2MD5 A;  1J7K A;  3RTR A;  2DA6 A;  2QA4 I;  9ANT A;  5BS6 A;  3R61 A;  3HG9 A;  3RYR A;  3OIQ A;  2WY8 Q;  1TQI A;  4PCQ A;  5IP6 A;  1FTZ A;  2CMP A;  3L7W A;  2ZNY A;  1WHU A;  3FK6 A;  5DM7 F;  3K1N A;  3RYP A;  1IW7 F;  1GXQ A;  1HW2 A;  2ELK A;  1WJB A;  4XL9 A;  2QF7 A;  2STT A;  1XMA A;  3K4K A;  4KMU X;  4QWQ A;  4RGR A;  5LFA A;  4EM0 B;  2VT2 A;  1GLN A;  1MIJ A;  2FBI A;  4XLC A;  2HVS A;  4NNJ A;  1QU3 A;  1H9T A;  3L1P A;  2VUM J;  4U7D A;  3E6B A;  2V79 A;  3LSM A;  2V26 A;  2OBP A;  4A93 J;  3B6C A;  3BQY A;  3CME I;  2DFF A;  2R7S A;  1WKM A;  1SC7 A;  3GBG A;  1JHH A;  4KJZ A;  4HLY A;  4FQG A;  5F0F A;  5E1X A;  5F64 A;  4BDY A;  4NBQ A;  1JKQ C;  2LRD A;  2V1X A;  1YIJ I;  2JMW A;  1IC8 A;  1E17 A;  4LK0 F;  1BM9 A;  1RIO H;  4A3K J;  3FWE A;  3K10 A;  1HQC A;  1STZ A;  2IW5 A;  5J1U A;  1FBS A;  1X1D A;  3IH4 A;  1TT0 A;  4HQE A;  4PFP A;  4ENK A;  1YJN I;  3F8N A;  2Z3Y A;  1AWC A;  1OCC H;  1T98 A;  2B9S A;  4BJT A;  1HW5 A;  2FML A;  3H9Q A;  3ECO A;  5B1B H;  4RLQ A;  3M3Y J;  2HGC A;  2DMP A;  2HYJ A;  3GYH X;  3S3O A;  4IXA A;  3IAS 2;  1AU7 A;  1T08 B;  5B66 C;  4IOC F;  2EA2 A;  4ZJZ A;  3V7R A;  3CUQ B;  1Z6R A;  4ZYA A;  2AQF A;  2JRM A;  2LF8 A;  3I59 A;  3LQQ A;  1YW8 A;  4F52 A;  3DU5 A;  2DA2 A;  2HVR A; 
#chains in the Genus database with same CATH homology
 5HDN A;  5JI6 A;  4I0B A;  3F72 A;  1CF7 B;  4P9F A;  2K02 A;  5H20 A;  5H6Q A;  2E7X A;  4KIB A;  3GZ5 A;  1P4A A;  2CYY A;  1RUN A;  4A0X A;  2PBI A;  1YG2 A;  1K78 B;  2G7U A;  3T0Y A;  3WTY C;  4HYE A;  4IHS A;  2Y48 A;  4FX0 A;  1TNT A;  1HXD A;  2A68 F;  4CHU A;  3GFL A;  5DYM A;  2GA2 A;  4EJW A;  1YW9 A;  1P2F A;  1P92 A;  2A5Y B;  2D1V A;  4L5J A;  4IF4 A;  3FXQ A;  1P4X A;  1S29 A;  1LEB A;  1SFX A;  3MZY A;  2Z9O A;  3SQN A;  1DUX C;  3GO5 A;  1Z1D A;  4JBA A;  1JHF A;  3F8B A;  2L4A A;  5FLX Z;  1QGP A;  4FHT A;  4ASN A;  4EGY A;  3HSE A;  1ZRE A;  3HHG A;  1R5H A;  5TRD A;  4ESJ A;  4B8X A;  1KU2 A;  5HDK A;  3L9F A;  4OIP F;  4NQW A;  2IVM A;  4LLG F;  4ZZL A;  2VE9 A;  1S3J A;  2A61 A;  1UST A;  1T39 A;  1T2K A;  4BXU A;  2O61 A;  2F5F A;  2BYV E;  2OQR A;  4N0B A;  2F2E A;  1BIB A;  1BBY A;  2X0L A;  4A0Z A;  5HS9 A;  2QEN A;  5HOO A;  3IKV A;  2L02 A;  2PQ8 A;  3GFM A;  3V4G A;  1LEA A;  2XV4 S;  1IN4 A;  1B9M A;  4B09 A;  4MNU A;  4JK1 X;  1CF7 A;  3FMS A;  4I09 A;  1JGS A;  3DPL C;  3HTU A;  5D5V B;  1ZG1 A;  2HOE A;  5FO5 A;  2STW A;  4EQQ A;  3EET A;  5HLG A;  1K78 A;  1MZB A;  1S7A A;  3LST A;  1SFE A;  4I2O A;  1UHM A;  1D3Y A;  2CQK A;  2LSO A;  2V1D A;  5D5U B;  3G73 A;  3IRR A;  4CIC A;  2MA3 A;  1W4M A;  1IN6 A;  1J75 A;  2IT0 A;  2HTJ A;  1KYZ A;  3ECH A;  3T8R A;  1IRF A;  3HHH A;  1ZN2 A;  2OZU A;  3GX4 X;  3IL2 A;  5FFZ A;  4GXO A;  4U0W A;  3TOB A;  1K6O A;  2PLY A;  3REO A;  2P7C B;  3ML6 A;  3IKT A;  3NEU A;  3TO7 A;  1B4A A;  4XSZ F;  3WTW C;  5AIP A;  3BJA A;  4CXF A;  2MLK A;  2M87 A;  3Q9V A;  4EGZ A;  2EV5 A;  3C1D A;  4WXH A;  2NNY A;  2L3D A;  2Z5U A;  4NB5 A;  3KP6 A;  2MH9 A;  2R7D A;  3WU1 B;  3EYY A;  3B73 A;  2IP2 A;  3FZV A;  2O0Y A;  2D2W A;  3ZMZ A;  1F5T A;  4LB5 A;  4M71 A;  1XMK A;  1HKQ A;  4ENJ A;  4WX9 A;  3TOA A;  2KKO A;  1T38 A;  3K2Z A;  4HF1 A;  1MD0 A;  3FX3 A;  1ONV A;  4U7B A;  2ETH A;  4G8X A;  1YW7 A;  3RKX A;  4HX7 A;  3M8E A;  4XLN F;  3ZN0 A;  1DP7 P;  1ZGJ A;  1DDN A;  3EDP A;  2ELH A;  2HQR A;  3ABT A;  1B59 A;  2OZ6 A;  2E1C A;  1KQ9 A;  4UXN A;  2ESH A;  3O3K A;  3WTX C;  2P5V A;  1W7P D;  1TLH B;  4O3M A;  3WGH A;  1FC3 A;  3MFK A;  2QWW A;  5DD4 A;  2H09 A;  3QOP A;  5DD8 A;  2CW0 F;  4YII A;  3LA3 A;  4OU0 A;  2XAQ A;  3RDI A;  5ILU A;  4LK1 F;  2FQ3 A;  1BC7 C;  4EJT A;  5E8G A;  1ZRF A;  3PQK A;  3CUO A;  1PUE E;  2FBK A;  1BI0 A;  3DQV C;  2O6G E;  3LWF A;  1BJA A;  4BAY A;  3PQJ A;  3R0J A;  3I53 A;  4LB6 B;  2JRT A;  1K79 A;  3BOQ A;  4ENN A;  4UVB A;  5CVV A;  1V3F A;  1LJ9 A;  1TTY A;  3DXJ F;  1QZZ A;  1USS A;  4HZF A;  3ZPL A;  2YU3 A;  1I1G A;  1KU7 A;  1LDD A;  2AS5 F;  1J5Y A;  5CJ9 A;  2FNP A;  1IXC A;  3RKY A;  4G7Z F;  2YSR A;  2J5P A;  1BI2 A;  1U5T B;  2FNA A;  1QZY A;  1ODD A;  1B9N A;  2H27 A;  3ABU A;  4XSX F;  1YS6 A;  2VC1 A;  4EVI A;  3BZ6 A;  1YYV A;  2XKP A;  2R3S A;  3ROU A;  4Y13 A;  3V8L A;  1OR7 A;  3LA7 A;  1O57 A;  2DBB A;  3FMQ A;  5HDG A;  3M1E A;  4GO1 A;  1TNS A;  2M8E A;  4I7H A;  4PGH A;  1YLF A;  4A6E A;  2OAZ A;  1O3R A;  2VOP A;  2EK5 A;  2QVO A;  2K4J A;  2Q8K A;  1Z9C A;  1FYL A;  4ZH4 F;  1H9G A;  3F3X A;  1RI7 A;  2MLG A;  2ZME A;  4RB3 C;  3BJ6 A;  2HKO A;  1ZLJ A;  4G9Y A;  3IRQ A;  5A2Q Z;  3D0S A;  3TDU C;  4N9I A;  2IA2 A;  4IRG A;  3ISP A;  3C18 A;  2ZXJ A;  5ICE A;  1PDN C;  5DUI A;  1FSH A;  4YIF A;  2J5O A;  5FB2 A;  3ZMT A;  2DFI A;  4MEY F;  4I0A A;  3TO6 A;  5ICC A;  1BI1 A;  1RNL A;  2RGV A;  5FFX A;  3GEZ A;  2L01 A;  1ULY A;  2M5W A;  2CG4 A;  1KYW A;  3TQN A;  2W84 A;  2HZT A;  1WWX A;  5AON A;  2XRN A;  2BGC A;  2YX7 A;  4WCG A;  2XAH A;  1XSD A;  1O3Q A;  3U9G A;  2Q0O A;  3RPU A;  4RAZ A;  4HAM A;  4A5M A;  3WU0 A;  5IT3 A;  2E7W A;  4KN4 X;  1W5S A;  1XSV A;  4JQF A;  4KMF A;  4A6D A;  3J81 K;  4F7Z A;  3O6B B;  2XAF A;  3DKW A;  3EQL F;  5D4S A;  3E5Q A;  3KLO A;  3JW4 A;  2JTV A;  4ETS A;  3GZ6 A;  4UVA A;  2R7F A;  1MDM A;  1XGN A;  1LDK B;  3K69 A;  1U5T A;  1C0W A;  3F8F A;  4A0Y A;  5ILV A;  4Z2Y A;  1EH8 A;  2FOK A;  2W25 A;  1FP1 D;  2DQL A;  3P9I A;  3FM5 A;  5H6R A;  3JAM K;  1R7J A;  2XAS A;  4MTD A;  4TV7 A;  1FOK A;  2ZFW A;  5D6E A;  4NHJ A;  4OMZ A;  2JSC A;  4BHP A;  5J6X A;  5IT9 Z;  3ZP5 A;  3I58 A;  2JPC A;  4MEX F;  3HTS B;  2CGP A;  3I0T A;  4IJA A;  4IRI A;  1CGP A;  4OMY A;  2ZO4 A;  3H3Z A;  1FSE A;  4LG0 A;  5LBQ A;  2M45 A;  3O2P E;  4MGR A;  3HOT A;  3J80 Z;  2JT1 A;  2DPU A;  4ON0 A;  1LQ1 A;  4UNO A;  2EA4 A;  1TW2 A;  3HSF A;  4AVP A;  3HIF A;  2CFX A;  2NNN A;  1GXP A;  1L3L A;  1SD4 A;  1T0F A;  3TDZ C;  1MJB A;  3IHU A;  4AIK A;  1BI3 A;  3DFG A;  4LD5 A;  2VBX A;  1OYI A;  5D6F A;  3WTU C;  4HDV A;  4M6X A;  4ESF A;  3FXU A;  5LGT A;  4K2E A;  2L4M A;  4KYW A;  3SZP A;  5LEJ A;  1D8J A;  5DDG A;  1U78 A;  3KZY A;  4FT8 A;  2UXN A;  4RB2 C;  3WE2 A;  2HQN A;  2PI0 A;  2EV0 A;  2BBY A;  2X4H A;  2WWY A;  3RPQ A;  4KT5 C;  2DI3 A;  2A6H F;  1KQ8 A;  2O3F A;  3ERE D;  3BPX A;  4BH9 A;  2HEO A;  2IRF G;  2E1N A;  1KQ0 A;  5HLI A;  2DPD A;  5DCM B;  1SMY F;  2CO5 A;  1Z05 A;  2VE8 A;  4M74 A;  1OYY A;  4KUM A;  3HSR A;  5LHI A;  3SHF A;  3SZT A;  2KJC A;  1QQI A;  1XGO A;  4ENM A;  1XB4 A;  1S8N A;  4RGS A;  1FWZ A;  3WOD F;  4A2U A;  4BNC A;  5D5X B;  1OMI A;  3F21 A;  5LHH A;  1HW1 A;  3CUQ A;  3ZMV A;  4KFC A;  5K1Y A;  3WTV C;  3QPT A;  1HKT A;  1FP2 A;  3QP5 A;  1BC8 C;  2XUB A;  5KVR A;  1D8K A;  2ZCW A;  4M6Y A;  2RVC A;  2K7L A;  3MWM A;  1JE8 A;  1KU9 A;  5LRS A;  3CJN A;  5JR3 A;  4CO8 A;  1ZYR F;  4KN7 X;  5E18 F;  3WTT C;  5TJJ A;  2A6E F;  3QAH A;  4P55 A;  1JXS A;  4RGX A;  5LRR A;  1YS7 A;  1TW3 A;  5JVT A;  1IRG A;  4IRH A;  3H3U A;  4LLL A;  3JAM Z;  1ZG5 A;  2DO7 A;  2EFQ A;  4G7H F;  5BOX A;  1LVA A;  3G3Z A;  4KNY A;  1XGS A;  1ZHF A;  4ZYG A;  4EJV A;  2VXZ A;  4WXD A;  4Y17 A;  2F5C A;  2KIU A;  1HST A;  4P5O A;  3L00 A;  1YQA A;  2HDC A;  2FRH A;  2QYO A;  2NS0 A;  1QPM A;  4L0Y B;  1KU3 A;  3RI4 A;  1I1S A;  5DCM A;  5L3D A;  4CGZ A;  3LFK A;  3M9A A;  1LB2 A;  5ERI A;  1LNW A;  3CDH A;  4M9Z A;  1J9I A;  3I5U A;  5D5W B;  3T1B A;  3B02 A;  1F4K A;  2FSW A;  3MAJ A;  4RB0 A;  2WC2 A;  2LNB A;  2COM A;  1IUY A;  2FA5 A;  3ULQ B;  1XGM A;  2M30 A;  1ZAO A;  4H0E A;  3ZMD A;  2QZ8 A;  3NRV A;  1O7F A;  5L3C A;  5BPD A;  4YG2 F;  2FU4 A;  3D5L A;  5LGN A;  2Z33 A;  5L3B A;  4S04 A;  3RKW A;  2P6T A;  4UV8 A;  3MZH A;  3F8C A;  4XLP F;  3JTG A;  4MTE A;  2RKH A;  4O5V A;  2HTS A;  1Z6T A;  2NAZ A;  1R5G A;  3F8M A;  3V8K A;  1XDU A;  3KCC A;  4HOB A;  2HR3 A;  3TO9 A;  4RS8 A;  2P7V B;  2P8T A;  1O3T A;  1NHA A;  2IJL A;  3RJP A;  5JFR A;  2VBY A;  4BYY A;  4I01 A;  3S2W A;  1RZ4 A;  5K5O A;  3FM3 A;  4YFX F;  4OIN F;  2YR2 A;  3E5U A;  5E1Z B;  2DW4 A;  3BDD A;  2QBY B;  4LLN A;  1R22 A;  3I64 A;  1REP C;  5F1R A;  1KA8 A;  1WQ2 A;  1G3S A;  1QNT A;  3QU6 A;  2K4B A;  3U1D A;  3CLO A;  3N4M A;  1HBX G;  2ZKZ A;  4CDG A;  3KP3 A;  2H6B A;  5CVJ A;  3IC7 A;  3WG9 A;  3RIR A;  3KP4 A;  1YO5 C;  2CSO A;  5J8C A;  1VTN C;  4ZYE A;  3F6V A;  2GIV A;  3GF2 A;  3HUG A;  4ESB A;  2VON A;  3HRT A;  4MQ9 F;  2QQA A;  4OOI A;  2W24 A;  1P6R A;  4Q47 A;  2OQG A;  1GHC A;  3HRM A;  4L9N A;  3K9T A;  5FGM A;  2FE3 A;  2CWE A;  3CO6 C;  2XKO A;  3ELK A;  4OIQ F;  4UV9 A;  1FX7 A;  3P9C A;  3E97 A;  5E8I A;  3IWZ A;  3K1P A;  1ON2 A;  4A5N A;  3HYI A;  3C3W A;  4HQM A;  2DTR A;  2P4W A;  2TDX A;  4WXC A;  4P9U A;  1V4R A;  1TQP A;  1FY7 A;  2VBZ A;  5FD6 A;  3L2C A;  3JTH A;  5ED4 A;  4HF2 A;  3KEO A;  2Y75 A;  3EUH A;  4KIC A;  2P5K A;  2GWR A;  3HRU A;  2OU2 A;  3I59 B;  1G3W A;  2W85 A;  3P7N A;  5EEH A;  3GUD A;  2VOD A;  2QQB A;  2PN6 A;  1G6N A;  2F5D A;  2QBY A;  2PJP A;  1E2X A;  1FT9 A;  3SFZ A;  4AIH A;  4QLC U;  4IHT A;  1G3Y A;  3PFI A;  4LJZ F;  1G4D A;  5D8L B;  4L9J A;  5ICF A;  2P6S A;  3TGN A;  1Q1H A;  3E3V A;  1FYM A;  2UWM A;  1DPR A;  2Q2E A;  3KP5 A;  4HW0 A;  1ZRD A;  4OIO F;  1UHW A;  5E20 A;  3GWZ A;  4GGG A;  3COA C;  1R1T A;  3KEQ A;  1YIO A;  4L5I A;  2DLL A;  4BHC A;  2LDU A;  2K86 A;  4E70 A;  1Y0U A;  5L3F A;  1ON1 A;  5F6F A;  1U6G A;  3H92 A;  2UZK A;  2XRO A;  2ISZ A;  4PGG A;  1ZRC A;  1U5T C;  1BOA A;  4MHG A;  2RN7 A;  1ZH5 A;  1R58 A;  4EM1 A;  1A04 A;  4LMY A;  3FXR A;  1AOY A;  4IPA A;  3KZZ A;  1XN7 A;  3GFJ A;  1Z91 A;  2M1B A;  2XVC A;  4LFU A;  2NRA C;  2VOO A;  3LQR A;  2EB7 A;  1FLI A;  4MQV A;  4L0Z B;  4O6J A;  5JHU A;  1D5V A;  5E17 F;  3ZN1 A;  4EJU A;  1R36 A;  4M9X A;  3W6J B;  2RC4 A;  2G7H A;  4AWX B;  3DEU A;  4UUV A;  2KJB A;  1RUO A;  5FD5 A;  2KIF A;  3FHZ A;  3BWG A;  2GA1 A;  5BMZ A;  1FBU A;  4AIJ A;  3P9K A;  5HS8 A;  2DT5 A;  3MQ0 A;  2PFB A;  5AIQ A;  2GAU A;  2F5E A;  3GFI A;  5ICG A;  2WTE A;  3R0A A;  4Q48 A;  3VEP A;  3GW2 A;  5CYV A;  1K7A A;  1XCV A;  5BQT A;  1J0R A;  5D8K B;  1U2W A;  1DPU A;  2RNJ A;  1BN5 A;  4WWC A;  3VOE A;  1U3E M;  4HF0 A;  4CYD A;  5CVR A;  4Q4Z F;  5CLS A;  1ZLK A;  3FF5 A;  6PAX A;  4PDK A;  1XCB A;  3BY6 A;  4ZYD A;  3WGI A;  4HV6 A;  2IA1 A;  3ZMU A;  2DAO A;  2ISY A;  4EM2 A;  2GZW A;  2VC0 A;  5K5R A;  3I4P A;  3WTS C;  2QUF A;  5DUK A;  2P5L C;  1FYK A;  3V7S A;  5ILS A;  2EFN A;  2EFP A;  2GQQ A;  2A69 F;  2RDP A;  2H6C A;  1H0M A;  5EEG A;  4Q5S F;  3W6K B;  1J2X A;  3KFW X;  1IN5 A;  2VT3 A;  3T5X A;  5L3E A;  4G7O F;  1WRJ A;  5LEK A;  3HRS A;  5HVQ C;  1SD7 A;  3KP7 A;  2PEX A;  2QQ9 A;  1ZAR A;  3E6D A;  2AXL A;  2DU9 A;  4I02 A;  3E5X A;  5E1W A;  2HWV A;  3GVA A;  3R60 A;  5BPI A;  1SD6 A;  2HKX A;  5CVU A;  3U2R A;  5LGU A;  2W57 A;  1ZG3 A;  2KRF A;  4EJO A;  3KE2 A;  5DEQ A;  4G94 A;  3I54 A;  3VB2 A;  1SFU A;  2V6C A;  3CUQ C;  1WI9 A;  2FEZ A;  4RAY A;  1R1U A;  4HBL A;  1EH6 A;  3V8J A;  3J81 Z;  1R1V A;  1Z7U A;  1B6A A;  2XGX A;  3T8T A;  2D1H A;  1KGS A;  2H94 A;  2DK8 A;  4DQ2 A;  3LA2 A;  1IN7 A;  2MH2 A;  2KIM A;  4R79 A;  1J59 A;  1S7O A;  5J8F A;  2V1U A;  1YFH A;  2WV0 A;  4DNC A;  3QRF F;  1R00 A;  2BEO A;  2IPQ X;  5DCF A;  1W7P B;  1IN8 A;  3Q5F A;  2ESN A;  3E6M A;  3F22 A;  2PG4 A;  3KP2 A;  2Y0M A;  4L18 B;  2D45 A;  1PP7 U;  4S05 A;  4GCV A;  2K27 A;  2GXG A;  4M9S A;  1O7L A;  2NYX A;  2HFH A;  5LLQ A;  1ZGA A;  4I98 B;  2ACJ A;  3NQO A;  1O3S A;  3Q9S A;  1FZP B;  4EV0 A;  4RB1 A;  2OA4 A;  1OPC A;  3BPV A;  5A2Q K;  3OOP A;  1HSJ A;  3F6O A;  2BE5 F;  2LF7 A;  4L9V A;  3V7C A;  3ZQ7 A;  4R1H A;  2QM3 A;  3KET A;  2EWN A;  2V9V A;  1PP8 F;  2QLZ A;  2DQR A;  2HYG D;  4AD9 A;  2LKP A;  2IA0 A;  2G9W A;  2ZBK A;  3GLX A;  5L3G A;  3QP6 A;  4OIR F;  2PMU A;  1FNN A;  1R23 A;  4U0V A;  2JZY A;  4L9T A;  2FF4 A;  4R8H A;  4HLX A;  2BV6 A;  3TKY A;  1B1B A;  4HA8 A;  1UB9 A;  2EFW A;  4RGU A;  3J7A O;  1W5T A;  2EV6 A;  2VBW A;  1QO0 D;  3BP8 A;  2ADU A;  1SMT A;  3WE3 A;  3BRO A;  2YX4 A;  1OKR A;  4KDP A;  3L09 A;  3CTA A;  2ZME B;  3VFZ A;  3SXY A;  2RQP A;  3ZMS A;  4P96 A;  5DV5 A;  3R4K A;  4D0P A;  1XD7 A;  1IXR C;  2B0L A;  5CVI A;  4UHT A;  2O8X A;  4IVN A;  1W7P A;  1YTY A;  3GXO A;  4XRF A;  1WSU A;  1EV7 A;  4XBF A;  5HLH A;  5IT9 K;  2UXX A;  3KLN A;  4LGW A;  1IF1 A;  2O03 A;  4PZJ A;  3FMR A;  4HX8 A;  3K0L A;  1MJ9 A;  4HV5 A;  2XAG A;  2JPB A;  2FXA A;  2A3S A;  3K1M A;  2HYF A;  3VOD A;  2RV8 A;  2MBF A;  4GYI A;  4KIF A;  1FPQ A;  1F9N A;  3DP7 A;  1UCR A;  1XDS A;  3WGG A;  1S6L A;  3BJO A;  3J80 K;  4GYG A;  4G6D A;  2C6Y A;  3QPH A;  4BHB A;  1TBX A;  3AAF A;  1XSX A;  2YPR A;  5LHG A;  1EH7 A;  2OD5 A;  1MDM B;  4HDU A;  4CZZ A;  1QBJ A;  1P4W A;  1GVJ A;  4KIG A;  3JSO A;  3DF8 A;  1TQM A;  2GXB A;  4WF2 A;  2EFO A;  4BQA A;  1FBQ A;  3I71 A;  4YFK F;  4FX4 A;  3MEX A;  1UFM A;  4KA4 A;  1IAW A;  4U88 A;  1SAX A;  2DK5 A;  1SD5 A;  4N9H A;  2XAJ A;  1MKM A;  3DV8 A;  2VN2 A;  1HKS A;  2XIG A;  4EMS A;  3MCZ A;  3DPT A;  1BIA A;  2Z99 A;  1I5Z A;  4UVC A;  5K5Q A;  3LAP A;  3E6C C;  4U0Y A;  3F23 A;  4YFN F;  1U8R A;  2ZJ2 A;  1T6S A;  4A12 A;  1I27 A;  3IWF A;  3R6S A;  2A07 F;  4M72 A;  4HX4 A;  2ZNZ A;  2HS5 A;  5HS7 A;  1G3T A;  4LG0 B;  3LAJ A;  1OYW A;  3C7J A;  2MC3 A;  5FLX K;  2FMY A;  1LDJ A;  4Y15 A;  3QU3 A;  2PMH A;  1MJA A;  1MGT A;  1IZ1 A;  4ZZD A;  1L0O C;  5D4R A;  4WK8 F;  3M7G A;  2EJR A;  2FBH A;  2L54 A;  5KK1 A;  1I6X A;  2XHK A;  3OV8 A;  3WTZ A;  3JSP A;  3EYI A;  1X3U A;  4G6Q A;  3M8F A;  4M73 A;  3CO7 C;  3HOS A;  1IXS B;  4ZYH A;  3N97 A;  1F1Z A;  2MD5 A;  1J7K A;  3RTR A;  5BS6 A;  3R61 A;  3RYR A;  1TQI A;  4PCQ A;  3L7W A;  2ZNY A;  3K1N A;  3RYP A;  1IW7 F;  1GXQ A;  1HW2 A;  2STT A;  1XMA A;  4KMU X;  4QWQ A;  4RGR A;  4EM0 B;  2VT2 A;  2FBI A;  1H9T A;  4U7D A;  3E6B A;  2V79 A;  2OBP A;  1WKM A;  1JHH A;  4HLY A;  5E1X A;  5F64 A;  2V1X A;  1E17 A;  4LK0 F;  1BM9 A;  1RIO H;  3FWE A;  1HQC A;  1STZ A;  2IW5 A;  1FBS A;  4HQE A;  4ENK A;  3F8N A;  2Z3Y A;  1AWC A;  1T98 A;  1HW5 A;  2FML A;  3ECO A;  2HGC A;  3GYH X;  4IXA A;  2EA2 A;  3V7R A;  3CUQ B;  1Z6R A;  2LF8 A;  3I59 A;  3LQQ A;  1YW8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...