1KU7A

Crystal structure of thermus aquatics rna polymerase sigmaa subunit region 4 bound to-35 element dna
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
73
structure length
73
Chain Sequence
SEELEKALSKLSEREAMVLKMRKGLIDGREHTLEEVGAYFGVTRERIRQIENKALRKLKYHESRTRKLRDFLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(*CP*CP*TP*TP*GP*AP*CP*AP*AP*AP*G)-3'
publication title Structure of the bacterial RNA polymerase promoter specificity sigma subunit.
pubmed doi rcsb
source organism Thermus aquaticus
molecule tags Transcription/dna
total genus 28
structure length 73
sequence length 73
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04545 Sigma70_r4 Sigma-70, region 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1ku7A00
3NQOA 2H6CA 2Q0OA 5IT3A 3ZMTA 1J75A 1ZG1A 1P92A 4G9YA 3TOAA 3GFJA 1U3EM 3WTXC 2OD5A 4I0AA 4CDGA 5JFRA 3DFGA 1XDUA 4GCVA 3VOEA 5BPIA 1XSDA 3T5XA 5BQTA 4QWQA 2NNYA 2OQGA 3QAHA 4JBAA 3K2ZA 3I0TA 3R60A 5D5VB 2K86A 2HEOA 2F5DA 1STZA 2PMUA 5AIPA 4HDVA 5LGNA 4HV6A 4UV8A 4Q5SF 2EK5A 3U1DA 3HIFA 1SFEA 2FU4A 2RC4A 1EH8A 3HOTA 5J6XA 2LF7A 2Z5UA 4E70A 5D6EA 4Z2YA 3WGGA 5FFZA 2Z33A 1XCVA 2IA1A 4RGUA 1E17A 2CFXA 2R7FA 1YW9A 4IPAA 4G6QA 1ON2A 3JTGA 4MTDA 3CO6C 3T1BA 3KP3A 2XV4S 2RNJA 4I01A 1LDDA 1IXSB 2FRHA 4ZZDA 2F5FA 4A0YA 1ZGJA 1J9IA 3OV8A 2XAJA 2FNAA 5BPDA 4MGRA 1HW1A 5CVIA 1ZRDA 2YR2A 4Q4ZF 1GXPA 2XAQA 3QOPA 3RKXA 2V1UA 1Z1DA 2C6YA 1SD7A 5L3FA 3IRRA 1J2XA 3MCZA 4CZZA 3WODF 3FZVA 5E1WA 5HS7A 1XGSA 4RAYA 3WU1B 1LB2A 1W5TA 2HZTA 4U0WA 3WTVC 2QUFA 4GGGA 2HOEA 3RTRA 2PMHA 4Y13A 5A2QK 1O3RA 3VODA 1ODDA 1SMTA 5D5UB 2EFOA 4HX8A 3V7CA 4MQ9F 3H3UA 1SFUA 1R1UA 5KK1A 3ECHA 1MD0A 3NEUA 4OIPF 2ETHA 1ZLJA 5IT9Z 1LJ9A 3E5XA 3LAPA 3WGHA 2V79A 3M8EA 2KIMA 3PQJA 1XMAA 3JSOA 4G7HF 5LRRA 4ZYGA 4HV5A 4U7DA 4N9HA 3TDZC 3LSTA 3MWMA 1EH6A 4O6JA 3GZ6A 3DP7A 3F8CA 3I54A 5AIQA 2OU2A 4AIHA 1D3YA 1L0OC 3KLNA 2MBFA 1HKTA 2BBYA 2VXZA 1U78A 5F64A 2ZMEB 3K1MA 3ZMVA 3DKWA 4LGWA 2RV8A 4HZFA 4U7BA 1LDKB 3H92A 2JTVA 2DPUA 2IA2A 3I71A 3LA2A 4EM2A 1QPMA 3KZZA 2CW0F 1TBXA 1C0WA 3J81K 3KEQA 1R23A 2UZKA 1IRGA 2K02A 4OIRF 3DQVC 2HFHA 5ED4A 1R1TA 2RQPA 1J0RA 2PI0A 3FMSA 2ZBKA 4K2EA 1DPRA 4YIFA 1B4AA 3GEZA 1ZARA 3WTUC 3MZHA 2IP2A 3S2WA 3FXUA 3R0JA 4OMYA 2XAHA 1FYLA 3LA3A 1KQ9A 2P4WA 3P9IA 3FMQA 1R5HA 3ZP5A 2MH2A 4EGYA 5D8KB 3GF2A 5HLHA 3BPXA 2G9WA 3TKYA 3HTSB 1QQIA 2EFPA 4UV9A 4TV7A 2QQBA 1XMKA 3QPHA 3LA7A 4FHTA 1SAXA 3V8LA 5LRSA 2W57A 1T0FA 3TOBA 5E17F 4CHUA 1YLFA 4ESJA 1IN5A 2QBYA 2DTRA 5D8LB 5ICEA 4Q47A 3K0LA 1B6AA 4Y15A 3HUGA 2F2EA 1F1ZA 3WG9A 5JHUA 4CYDA 1QO0D 1SMYF 4XBFA 5BMZA 3RI4A 1BC8C 5LHGA 2V6CA 4MHGA 1I27A 3ZMSA 2HWVA 1WRJA 3TGNA 1T2KA 1B9NA 2FBHA 3MZYA 2MH9A 2ZFWA 1HSTA 2MD5A 4RB2C 1FY7A 4PZJA 2HTSA 3RYPA 1WWXA 4P5OA 1KU2A 4F7ZA 2A6EF 2LNBA 4EJOA 1LNWA 3M9AA 3ULQB 2HYGD 1S3JA 5E8GA 1K78B 3I59A 5ERIA 3F6OA 3GX4X 3W6KB 3IRQA 3OOPA 4AIKA 4M9SA 3MFKA 1SD6A 2VOOA 1P4XA 1Z6TA 1J5YA 2BEOA 1TLHB 2ZJ2A 5DDGA 1USTA 3ABUA 4HLYA 5EEGA 2DW4A 3GLXA 4KIFA 2IPQX 2LKPA 3COAC 3E6DA 1YS7A 3F6VA 1ZN2A 2EV6A 3Q9VA 4ZH4F 1T38A 1QZZA 2FOKA 5CVUA 1XD7A 5F1RA 3FXQA 1FLIA 2Q8KA 4L5IA 2WC2A 3GFIA 3KETA 3HHGA 2NS0A 4KUMA 2UXNA 4IHTA 1YQAA 3O6BB 4KN4X 3JSPA 4LB5A 2V1XA 3C1DA 2ZNYA 2RKHA 4P55A 2CO5A 2X4HA 3NRVA 3BDDA 3C18A 1ZYRF 3KFWX 1FBUA 4G7OF 1KQ0A 4ENMA 1G3TA 2MLGA 2VONA 2DT5A 4ENKA 1OKRA 2DAOA 3V7SA 3J80Z 2VBXA 1YIOA 4BH9A 4KFCA 2W84A 2QZ8A 2QQ9A 2AXLA 2R7DA 3C7JA 3SXYA 3EYIA 2FSWA 2K4JA 5FD6A 1G4DA 4HYEA 3R61A 3FX3A 3CUQC 1QGPA 2EFWA 4KNYA 1X3UA 1I1GA 3HRSA 2DK8A 5TRDA 3J80K 4D0PA 1R00A 5LEKA 4EGZA 1W7PD 5FB2A 3FHZA 1FYKA 1W7PB 2L3DA 1I1SA 3BZ6A 3GYHX 2NYXA 2IW5A 2A3SA 2ZNZA 1BJAA 3HSFA 2P5KA 3DF8A 1MZBA 1FBSA 5L3DA 2VT2A 1LDJA 5D5XB 2ESNA 4KT5C 2WWYA 4HF1A 3SQNA 3ZN0A 1KYZA 4XLNF 4EJTA 3GW2A 1UHMA 4WXCA 1BIAA 1JHHA 5K5RA 4JQFA 2UXXA 1ZLKA 2PBIA 1ZAOA 1IXCA 1O57A 4ETSA 1FSHA 1IN7A 3BP8A 2NRAC 2D1HA 5CLSA 3O2PE 2HQNA 1RZ4A 5AONA 2XRNA 2DFIA 2P6TA 3TO9A 2L02A 1XDSA 3TQNA 1I6XA 3BY6A 5A2QZ 2EV5A 4RB0A 1JGSA 3TO7A 2F5CA 2VOPA 2FEZA 2DPDA 2Z3YA 3WTTC 4G7ZF 2Y75A 1NHAA 2XAGA 3N97A 5FGMA 3E6CC 3RPQA 4CGZA 3MAJA 3ZMUA 4I0BA 3GUDA 4UXNA 2M8EA 2CG4A 5CVVA 3F23A 5HVQC 4L18B 4HQEA 4HX7A 2ADUA 2EFNA 2CSOA 1WSUA 4U88A 3M7GA 3FWEA 4HAMA 3E97A 2JSCA 2KIFA 2P6SA 2VODA 5DD4A 1O3TA 1BI3A 3LQRA 3BPVA 4LLLA 3EETA 3K69A 2QWWA 4PCQA 5ILSA 5FFXA 5ICGA 2E7WA 1UFMA 3B73A 3PQKA 2EJRA 3CJNA 1BM9A 4ESBA 4HOBA 2RDPA 1F5TA 4FX0A 2YX7A 5K5QA 1RIOH 1FT9A 2ZXJA 3R6SA 4P9FA 3ERED 4L0YB 5HS8A 2A07F 2M87A 2ISYA 2DO7A 3I4PA 4HA8A 3BJOA 1UHWA 3PFIA 3H3ZA 2J5PA 2R3SA 2UWMA 1KU3A 3HOSA 3E5QA 3J81Z 1AWCA 3ZPLA 2CQKA 2J5OA 1MDMA 1KU9A 4BHBA 3IL2A 5E1ZB 4M6YA 3M8FA 1FPQA 1W5SA 6PAXA 2IRFG 1TQMA 1TQIA 3WTZA 3C3WA 3ROUA 1FC3A 4LK0F 4XSXF 2P7VB 3K9TA 1FWZA 4AIJA 2OZUA 2PLYA 4S04A 1ZREA 2PEXA 4O5VA 1ZHFA 2LDUA 3JAMK 2GZWA 1R1VA 1ZRFA 4HBLA 2EA2A 2FA5A 2QQAA 3L00A 2AS5F 2RVCA 3QP5A 4RGSA 4IRGA 3E6MA 3R4KA 2QYOA 4WK8F 3B02A 2YU3A 3IKTA 4QLCU 2IA0A 1HW5A 1ZH5A 1WKMA 3FMRA 4EMSA 2JPBA 2KRFA 5FLXZ 1QZYA 1S8NA 3ZMZA 3KP6A 5D4RA 2HR3A 5L3EA 1U5TA 4RB3C 3QU3A 4EV0A 5DEQA 3KP7A 1KU7A 2HKXA 3IHUA 4HF0A 4ASNA 3E3VA 3CTAA 2IT0A 1J59A 4OU0A 4CO8A 3ABTA 2XASA 1DDNA 2DBBA 2P7CB 2K4BA 1K7AA 1FBQA 5FLXK 2E7XA 3I58A 4HDUA 1S7OA 4I7HA 1D5VA 4GXOA 1RNLA 4BXUA 1R5GA 5E8IA 4EJVA 3F8BA 2H09A 4P9UA 2FF4A 4HF2A 2GA2A 1HKQA 2IJLA 2EV0A 1CF7A 3G73A 1TNSA 4UVBA 1USSA 2JPCA 5LHHA 3E5UA 1B1BA 3R0AA 3WU0A 2FBKA 3F8NA 3Q9SA 1XSVA 3BROA 5JI6A 2OQRA 4A0XA 1Z7UA 5CJ9A 1S29A 5DCMA 2DU9A 5HDGA 2QBYB 1YTYA 2V1DA 3ISPA 5E1XA 5L3GA 4RGRA 2ELHA 5HLGA 2D2WA 1U5TC 3VB2A 5TJJA 1HQCA 1TNTA 1S6LA 3GVAA 3F8MA 4L9NA 2GAUA 3WE2A 1B59A 4GO1A 2VE8A 2VC0A 1IW7F 1UCRA 3JW4A 4EVIA 1ZRCA 4HX4A 1VTNC 3CO7C 3G3ZA 2EA4A 2VBYA 3HTUA 3RIRA 3L7WA 3RDIA 2STTA 2XIGA 2VBWA 3VFZA 2LSOA 2TDXA 1WI9A 1OYYA 2VBZA 1IUYA 4N9IA 3GZ5A 2ZCWA 2M30A 3CUQA 3D5LA 4LG0A 1DUXC 1TW2A 3L09A 1R36A 3AAFA 4ESFA 3I59B 4S05A 3GO5A 1B9MA 3DPTA 2HTJA 3BWGA 1GHCA 3BOQA 2STWA 1G3WA 2DK5A 4I2OA 4L0ZB 2O8XA 2H6BA 1AOYA 4R8HA 2M5WA 4RS8A 3I53A 2Q2EA 3SZPA 2A6HF 4R79A 1Y0UA 1BI2A 3T8RA 1BI1A 3KP5A 2EFQA 4CXFA 2A69F 1Z05A 3IWZA 2GIVA 4PDKA 4WX9A 5DCFA 1WQ2A 1D8KA 2KJCA 3GWZA 3CUQB 2KKOA 1BOAA 1P6RA 3RPUA 1O7FA 2FQ3A 2QLZA 2HYFA 4M73A 2KIUA 4B8XA 3U9GA 4LFUA 5L3CA 3D0SA 1XCBA 4M74A 2K7LA 2Y0MA 4ZZLA 3O3KA 5FD5A 1OPCA 3QP6A 3WTSC 5CYVA 1V3FA 3W6JB 3ZN1A 4L5JA 5HLIA 2O3FA 1I5ZA 1T6SA 2GQQA 1K79A 1MGTA 2DQLA 4BAYA 5DV5A 3SZTA 4CICA 1V4RA 4XSZF 1K6OA 5E18F 1DPUA 2HDCA 1FSEA 4HQMA 3QU6A 3DV8A 3EDPA 4KN7X 2FMLA 3MEXA 1IXRC 4ENJA 3MQ0A 1BI0A 5H6QA 3SHFA 4EM1A 3FM3A 4UUVA 1R7JA 4KDPA 4WCGA 2DLLA 1FYMA 5HS9A 1PP7U 3T8TA 4I09A 5L3BA 1LQ1A 1ON1A 2FXAA 3F3XA 3HRTA 2FMYA 3I5UA 4KICA 1T98A 4LD5A 5CVRA 3TO6A 5E20A 2NAZA 2Z9OA 3F72A 2VC1A 2VN2A 1Z9CA 2NNNA 1KGSA 3GFMA 2BV6A 3WE3A 2L4AA 3T0YA 2X0LA 1GXQA 2XVCA 4MEYF 4R1HA 4XLPF 2YSRA 3HSEA 1HSJA 1FP2A 2XROA 3RYRA 2D1VA 5J8FA 3E6BA 2BE5F 2CYYA 4LB6B 1FOKA 4EJUA 3EUHA 3K1PA 3KP4A 1RUOA 4B09A 1MJAA 4GYIA 4UVCA 3LAJA 1OR7A 2RGVA 4IF4A 2JZYA 5DD8A 3V8JA 2O61A 1LEBA 2A68F 2COMA 4M6XA 4AD9A 4UHTA 1RUNA 2H94A 4I02A 3FF5A 5D5WB 3ML6A 2QENA 3RKYA 1MJBA 1IN8A 4OMZA 3LFKA 4ZYEA 3BJ6A 1ONVA 4O3MA 4MQVA 5DYMA 4BYYA 2M1BA 1P4WA 2GXBA 1EH7A 1OMIA 1TTYA 3JTHA 4EJWA 4A5NA 3QPTA 2EB7A 2A61A 1G3SA 3F8FA 2XAFA 2D45A 5K1YA 2P5VA 4UVAA 5H20A 2P8TA 3IC7A 3RJPA 4RAZA 2P5LC 4L9TA 5DUKA 3RKWA 2H27A 2OA4A 1XGMA 4L9VA 4G94A 1HW2A 4JK1X 4G8XA 1G3YA 1RI7A 4WF2A 3V7RA 4EQQA 3I64A 2OBPA 3DXJF 1R22A 4N0BA 1YS6A 1IN4A 4LJZF 4NQWA 5LBQA 2O6GE 5EEHA 3KE2A 4G6DA 2YPRA 1JE8A 4LMYA 1SD5A 1BBYA 2FBIA 1F4KA 2GA1A 3KCCA 2L4MA 4M72A 3WGIA 4EM0B 4UNOA 2L54A 2ZMEA 1SFXA 4U0YA 1FX7A 2W25A 1J7KA 3ZMDA 3CDHA 3JAMZ 1UB9A 5LEJA 2K27A 4Y17A 4LK1F 2PN6A 3ZQ7A 1U6GA 5ICFA 4IVNA 1O7LA 1LEAA 5IT9K 4KMUX 2LF8A 2B0LA 1O3QA 1ZG5A 2PFBA 4IHSA 1TW3A 2Y48A 5BS6A 5FO5A 1GVJA 1DP7P 3KLOA 3L9FA 4M9ZA 1ZG3A 4A0ZA 4PGGA 2OAZA 4AVPA 1U8RA 1MDMB 2MC3A 5H6RA 4IJAA 2O03A 4DNCA 3M1EA 3CLOA 2L01A 1YFHA 1JHFA 2ACJA 2XHKA 4Q48A 4A5MA 4PGHA 3CUOA 2WV0A 4L9JA 1CGPA 4H0EA 2JRTA 4A6DA 3P9CA 5F6FA 5J8CA 4YFKF 1YO5C 1JXSA 5LGTA 2RN7A 2A5YB 3DEUA 4WXDA 1PDNC 4P96A 1IF1A 2ZO4A 3P7NA 3L2CA 3BJAA 1YG2A 3J7AO 1LVAA 3ECOA 1ZGAA 3EYYA 1BC7C 1MJ9A 1A04A 4NB5A 2ESHA 1XN7A 3V4GA 1REPC 2W24A 3HHHA 4ENNA 1BIBA 1OYWA 1PP8F 1PUEE 3LQQA 1KQ8A 2ISZA 1HXDA 3FM5A 4XRFA 2HS5A 4MNUA 2V9VA 5DUIA 2VE9A 1IRFA 1U5TB 1BN5A 4HW0A 2O0YA 4WWCA 4OIOF 4KYWA 3FXRA 1EV7A 2YX4A 4IRHA 4BNCA 3VEPA 4OIQF 1U2WA 3F21A 3IKVA 2JT1A 4FX4A 4ZYDA 4KIBA 3N4MA 3KP2A 2ZKZA 4DQ2A 2F5EA 2PG4A 2Z99A 1O3SA 4IRIA 3WTYC 4I98B 3WTWC 2DQRA 1XB4A 2M45A 1YYVA 3EQLF 1QNTA 2HQRA 1IN6A 2BYVE 2XKOA 4MTEA 4YG2F 4A12A 4YFNF 2DI3A 2GWRA 1Z6RA 3KZYA 1K78A 1FZPB 1CF7B 2G7HA 4M71A 4FT8A 1XGNA 4KIGA 5D6FA 2VT3A 5ICCA 4A2UA 2FE3A 3REOA 5KVRA 3TDUC 4RB1A 5CVJA 5LHIA 3IWFA 1P4AA 5LGUA 4A6EA 4BHCA 4U0VA 2QM3A 4KMFA 2QVOA 4LLGF 4ON0A 4YIIA 3Q5FA 5HDNA 5DCMB 4HLXA 1F9NA 4M9XA 4GYGA 2BGCA 2CGPA 3V8KA 3DPLC 3GXOA 2XGXA 1FNNA 2FNPA 4OOIA 4KA4A 5HOOA 3U2RA 2MLKA 2G7UA 4BQAA 1ULYA 1HBXG 3SFZA 3HSRA 1R58A 2PQ8A 1YW8A 1IAWA 3KEOA 4OINF 1TQPA 4YFXF 5LLQA 2EWNA 2HGCA 4ZYHA 1HKSA 1MKMA 5HDKA 2E1CA 4WXHA 5D4SA 2IVMA 1QBJA 3HRUA 1SD4A 5ILUA 1E2XA 5K5OA 2GXGA 3QRFF 2W85A 2MA3A 3K1NA 1IZ1A 1H9TA 4NHJA 4IXAA 1G6NA 4LLNA 2WTEA 3GFLA 1Q1HA 3P9KA 4LG0B 2KJBA 3HYIA 1T39A 3F22A 2PJPA 1KYWA 5ILVA 1H9GA 3HRMA 1XSXA 1H0MA 1OYIA 1KA8A 5JVTA 2E1NA 1FP1D 1D8JA 3ELKA 3LWFA 1S7AA 4BHPA 4RGXA 1L3LA 1P2FA 1XGOA 1Z91A 4MEXF 5BOXA 2HKOA 1YW7A 2CWEA 5JR3A 2OZ6A 2XUBA 4AWXB 2XKPA 1W7PA 1W4MA
chains in the Genus database with same CATH superfamily
1VQOI 2JVGA 1UMQA 4A3MJ 3NQOA 2H6CA 2Q0OA 1YE9A 2IBDA 5IT3A 3ZMTA 1J75A 1R5ID 1ZG1A 1P92A 1WVRA 3SZGA 4MFEA 4G9YA 3TOAA 3GFJA 1U3EM 4JP0A 4A3KJ 3WTXC 2GXAA 2I8DA 2OD5A 4I0AA 4CDGA 2NS8A 5JFRA 3DFGA 1XDUA 3QPLA 2M0MA 1X1AA 3H5AA 2IS1A 4GCVA 4XRSA 3VOEA 2K85A 5BPIA 1F36A 4E7SA 1XSDA 5GTHC 3T5XA 5BQTA 3JRAA 4QWQA 2NNYA 2OQGA 5FRNA 2BVLA 3QAHA 3SFIA 1VQ6I 4JBAA 3A03A 2CU7A 1SANA 2DJIA 3K2ZA 4Z6YA 3K70C 1T8IA 4H4KC 3CCUI 3I0TA 3R60A 3HM5A 3JRIA 3S1RJ 5D5VB 2K86A 1AKHA 2HEOA 2XPWA 2F5DA 3FHNA 1STZA 1IGNA 2PMUA 5AIPA 4HDVA 4JYKA 5LGNA 2LYCA 1RC9A 2DFEA 4HV6A 4UV8A 1W36C 4MLOA 2EK5A 4Q5SF 4NBQA 3U1DA 3HIFA 1SFEA 2FU4A 2RC4A 4D5FA 1RRJA 2KFDA 2JA5J 2X9DA 1T08B 5GAEJ 3LSJA 2R4GA 1EH8A 1ORKA 3QWLA 4CA0A 3HOTA 5J6XA 4BEHA 2LF7A 2Z5UA 4E70A 2HI3A 5D6EA 4Z2YA 2LBFA 3WGGA 2LRDA 5FFZA 5GPAA 4NC8A 3JRGA 2Z33A 1XCVA 2IA1A 2Z2SB 4RGUA 1E17A 2CFXA 2VPLA 3FXJA 1HC8A 1D0XA 2R7FA 4KISA 1YW9A 4IPAA 4G6QA 2DA3A 4FE7A 1JKOC 1ON2A 3CCYA 3JTGA 3GTKJ 4MTDA 1AKHB 3CO6C 5EGOA 3GBGA 3DU6A 4HG2A 4D7NA 3HL2A 1MW7A 3T1BA 2OCCH 5J4VA 3KP3A 3CC7I 2ICWG 2XV4S 2RNJA 4I01A 1LDDA 1P7JA 5LD2C 4A3FJ 1IXSB 2FRHA 2M7BA 2KISA 2F5FA 4A0YA 4ZZDA 4HNTA 1ZGJA 1J9IA 3OV8A 2VQHA 3KIOA 2XAJA 2FNAA 5BPDA 4MGRA 1HW1A 3FKIJ 2R7ZJ 2BY1A 5CVIA 1R49A 3BR3A 4C2MJ 2WY8Q 3KZIC 5GAHJ 2EPFA 5HODA 4A3JJ 1ZRDA 3GCMA 3C2BA 2YR2A 4Q4ZF 1GXPA 2XAQA 3QOPA 3RKXA 2V1UA 2ZSIB 5GADJ 3W2WA 1OCZH 3PIPF 1WJCA 2OUMA 1Z1DA 2C6YA 1OQYA 1SD7A 2IGKA 5L3FA 3IRRA 1J2XA 4C30A 3BLYA 3MCZA 4CZZA 2LK2A 3WODF 3FZVA 5E1WA 5EG0B 1LVKA 5HS7A 1N78A 1VNDA 1XGSA 3ZQLA 4RAYA 2VJ5A 3WU1B 3OSFA 1LB2A 1W5TA 2HZTA 3CCQI 3J7AY 4U0WA 3WTVC 2QUFA 4GGGA 1TWAJ 2E5NA 2HOEA 2GLOA 3RTRA 5F0FA 2EIMH 2BW3B 1D1AA 2PMHA 4CZCA 1HCRA 5TGTA 3ABMH 2JUCA 2R5ZA 4Y13A 2IXSA 5A2QK 4IL6C 1O3RA 2HDDA 3D1NI 3VODA 4A3LJ 1ODDA 4RMNA 1SMTA 5D5UB 2EFOA 4A3BJ 4Y7NJ 4HX8A 3V7CA 4MQ9F 3H3UA 1SFUA 1IDZA 4AYBN 2E2JJ 1R1UA 5KK1A 2XPVA 2K5CA 3ECHA 3KYCB 1MD0A 3GTLJ 3NEUA 3PNTA 4OIPF 1LPQA 2JA8J 2OF7A 2ETHA 1R6RA 4XIDA 4IQ4A 1ZLJA 3FK7A 5IT9Z 3CMAI 4BJ5C 1LJ9A 3JRHA 2W4SA 3E5XA 5LFAA 2DA5A 2K9LA 3LAPA 4RA2A 3WGHA 1T95A 1W0UA 1TL8A 3OR2C 2V79A 3M8EA 2KIMA 3PQJA 3BR0A 1XMAA 2XB5A 3K4KA 3JSOA 1QZEA 4G7HF 4BE2A 2ZB9A 4JX5A 4KITB 4MIMA 5LRRA 4ZYGA 3IH2A 4HV5A 4U7DA 4N9HA 2H8RA 3TDZC 3LSTA 1A35A 3MWMA 1EH6A 4NQWB 4O6JA 3HOUJ 4HPQA 3GZ6A 2ZXIA 2JA7J 2ZXWH 4B4CA 1HLVA 3DP7A 1HA8A 3F8CA 3I54A 2DOEA 5AIQA 1DU6A 2OU2A 1BW5A 1MNEA 2L7FP 4AIHA 1D3YA 2LY2A 4JX6A 4LIVA 1L0OC 3KLNA 2MBFA 1SFKA 1HKTA 3ZQCA 2BBYA 2X51A 1JTYA 2VXZA 2R7XA 1U78A 5F64A 2ZMEB 3K1MA 2K9QA 4I6ZA 3ZMVA 4AUXA 3DKWA 3ZRGA 1FOXA 5FKLA 4LGWA 1WGXA 2RV8A 4HZFA 4U7BA 1LDKB 1MIJA 3H92A 2JTVA 2DPUA 2P0WA 2IA2A 3I71A 2LR8A 3NWSA 2E2IJ 2M4GA 2VASA 4YEJA 2F4MB 3LA2A 4EM2A 2WAFA 1QPMA 2VQLA 3KZZA 3ASOH 5EZHA 3HPGA 2CW0F 1TBXA 1GV2A 3DCFA 1C0WA 3J81K 3KEQA 2AQFA 3NARA 1R23A 1MBEA 2UZKA 4RM3A 1J09A 1X4PA 4I99C 4BKXA 4IOAF 1IRGA 1ITYA 2K02A 5CQEA 3DQVC 4OIRF 2HFHA 5F27A 5ED4A 3DKXA 5JHFA 2ZJPF 1RKTA 1R1TA 2RQPA 1TWFJ 2LP0A 2XF5A 1ZGWA 3IUOA 1J0RA 2DMQA 3TMOA 2PI0A 3FMSA 2ZBKA 4K2EA 1DPRA 4YIFA 1B4AA 1YIJI 1MMGA 2H1LA 2QCOA 3GEZA 2W00A 1ZARA 3WTUC 4HSRA 3MZHA 4IHXA 1MMSA 3HZJA 4BBRJ 2IP2A 3S2WA 4A3CJ 3FXUA 3L2QA 3OYHA 5K7HA 3R0JA 3LSIA 4ZDLA 4OMYA 2XAHA 1FYLA 3LA3A 1T56A 1KQ9A 2P4WA 3P9IA 3FMQA 3OYEA 1R5HA 3BTLA 3A01A 3ZP5A 4B3AA 3O8HA 2MH2A 2ELKA 3GTPJ 2BY2A 5FKNA 4EGYA 2R93J 5D8KB 3GF2A 5HLHA 3BPXA 2KPMA 3S1MJ 2G9WA 4FCYA 1MH4A 3TKYA 1I39A 3HTSB 1QQIA 2VQCA 3BQYA 3LSHA 2DDAA 4XKWA 3BQZA 2EFPA 1JT0A 1Y39A 1P9QC 2QEXI 4BDYA 4UV9A 4TV7A 2AXTC 2WAQA 2QQBA 2LH9A 1XMKA 1GDTA 3QPHA 2GOMA 5J47A 2CUJA 2JUGA 3LA7A 4FHTA 4MFDA 3SEZA 1SAXA 1R71A 3V8LA 5LRSA 2W57A 3G2BA 1QPIA 4BQNA 1T0FA 3TOBA 3LL7A 3LSMA 1UZCA 3AL0B 1FMVA 5E17F 2NOGA 4MO7A 4XL9A 4CHUA 1YLFA 4ESJA 1IN5A 2QBYA 2KDZA 2QQ8A 4AM3A 2DTRA 3PSFA 5D8LB 5ICEA 1JGGA 4Q47A 1DGWY 2QKLB 4XN0A 4M3DA 3K0LA 1B6AA 3ZR8X 3DLLF 4Y15A 3S1NJ 2MFZA 3HUGA 1ZK8A 3WHBA 2F2EA 1F1ZA 3WG9A 5JHUA 5FLMJ 2M3AA 3OYNA 4CYDA 4AU7A 3PM1A 1QO0D 5K7ZA 1U9OA 3K4JA 3I4MJ 3W3CA 1SMYF 1NG7A 4IKFA 4XBFA 4UUSA 2EINH 5BMZA 2VJIA 3RI4A 1BC8C 5LHGA 3M4OJ 2V6CA 2V1NA 4MHGA 4E7JA 1I27A 3CLQA 3DBRB 3D5SC 3ZMSA 2HWVA 1SVMA 1QRYA 4L5EA 5HLTA 2L5QA 2RREA 1WRJA 3TGNA 1T2KA 2DA4A 1B9NA 1Z7LA 2FBHA 2DOAA 1MMDA 2ELJA 3MZYA 2MH9A 1GT0C 2ZFWA 1HSTA 2MD5A 3ZGKA 5IP9J 4RB2C 4A3EJ 1FY7A 3LSPA 4PZJA 2HTSA 3RYPA 1B72A 3KEYA 3M07A 2MW8A 1R9TJ 1Z3YA 1GLNA 2WB1A 5BNGA 1G59A 2DFFA 1FOWA 1WWXA 3ABKH 3MN2A 4XLFA 4V2FA 2L7MP 4P5OA 3S93A 3OR1C 1KU2A 4F7ZA 2A6EF 2LNBA 2QGUA 2TCTA 1U0JA 4EJOA 1LNWA 1QVTA 1X4OA 3M9AA 3ULQB 2HYGD 1S3JA 1E3HA 3H1CA 5CQGA 5E8GA 1NH3A 2GOXB 4B48A 5E3OA 3L2RA 1RETA 1K78B 2XB0X 1B8IA 3I59A 5ERIA 3F6OA 1TZLA 2KRCA 3GX4X 3W6KB 4V2GA 3IRQA 3CCJI 4ZDOA 3OOPA 4AIKA 4M9SA 3MFKA 3G71I 1SD6A 3PUBA 1OFCX 2VOOA 1P4XA 1Z6TA 4CYCA 1J5YA 2BEOA 1TLHB 5EDNA 1B72B 1T0FC 1DU0A 5EJCA 2E36A 2ZJ2A 5DDGA 1USTA 3ABUA 2X1DA 4HLYA 5EEGA 2DW4A 3GLXA 2RAEA 5FLVA 4KIFA 2IPQX 3OS0A 2NVXJ 2LKPA 2LD5A 4S0HB 1ETKA 1LE8B 3LOCA 3COAC 3A4CA 3E6DA 5E3LA 1YS7A 1IJWC 3OWTA 3F6VA 1ZN2A 2EV6A 3OMYA 3CCLI 3Q9VA 3TBIA 3BTJA 4ZH4F 4C2UA 1T38A 1XTAA 1SVLA 2VQGA 3QYEA 1I50J 1QZZA 1X3ZB 3PO3J 1IV8A 2FOKA 5CVUA 3I55I 1XD7A 5F1RA 4RLFA 2E71A 3FXQA 2X48A 2Y9ZA 3E1SA 1FLIA 3HBLA 5TISC 2Q8KA 4L5IA 2XPUA 2WC2A 3CZ6A 1MNDA 2QSGX 3GFIA 3MZ8A 3KETA 3HHGA 2NS0A 2N8GA 3CMYA 4J01A 2BHZA 4D7MA 4KUMA 1VQ7I 4CCJA 2BOLA 1X1PA 2K40A 2UXNA 4QSHA 2M2EA 1YQAA 4IHTA 3O6BB 4KN4X 2M7AA 4J19A 3LMMA 2CW7A 4DYCA 1EF4A 2CUZA 3JSPA 2ZC2A 4G6TB 5E3NA 3DWLE 4LB5A 2V1XA 4DZJA 3C1DA 2ZNYA 2RKHA 4P55A 2CO5A 2MD0A 2X4HA 3NRVA 1KZHA 3BDDA 3C18A 1ZYRF 4HEA2 2JVHA 3KFWX 1FBUA 3RZDJ 2EQRA 4G7OF 4B43A 2PMZA 2MYSA 1KQ0A 2UUZA 1E3OC 4ENMA 1W5CC 1G3TA 2OPTA 3A2KA 1ZKGA 2ME0A 2MLGA 1AU7A 2VONA 1R4MB 2DT5A 2E1MC 4ENKA 4XORA 1SFOJ 3RPUD 2WAEA 3OL3A 4X6AJ 2LTPA 1OKRA 2DAOA 3V7SA 3J80Z 3CCVI 4C3IJ 2BXZA 5FROA 3LSKA 2VBXA 1RR7A 1YIOA 1ERDA 3PL8A 4BH9A 3RQIA 4KFCA 2W84A 2QZ8A 2QQ9A 2AXLA 3MD2A 2R7DA 3C7JA 3SXYA 1PUFB 3I56I 3EYIA 2FSWA 2K4JA 5FD6A 2COBA 1G4DA 1BR2A 2KRHA 4HYEA 3R61A 3FX3A 3CUQC 1QGPA 2E35A 1HF0A 2EFWA 4KNYA 1X3UA 4XLAA 1I1GA 2W7NA 3HRSA 2DK8A 3OL4A 5TRDA 2HPMA 3UNGC 5IY5H 4A93J 3J80K 2EZIA 2DMPA 2V26A 5KAIC 4D1QA 4D0PA 1RR8C 2V9PA 3CCRI 1R00A 2A5WA 3JRFA 1APLC 3HGYA 5LEKA 3ERMA 4EGZA 1T33A 1W7PD 2BVMA 3M1CA 2YS9A 1TT0A 3ZOBA 5FB2A 4QTRA 1WH5A 3FHZA 1W7PB 1FYKA 2KQRA 2L3DA 4M3EA 1I1SA 1ZTRA 3BZ6A 3GYHX 2NYXA 2IW5A 2A3SA 2ZNZA 1UG2A 1BJAA 1JT6A 3HSFA 2P5KA 4PK4A 3DF8A 1MZBA 3FK6A 2GM4A 1FBSA 3GZNB 3VSLA 3MKLA 5L3DA 1VQLI 2VT2A 1LDJA 5D5XB 2ESNA 4KT5C 2JQ7A 2WWYA 2XGDA 4HF1A 3SQNA 3ZN0A 1KYZA 1POGA 4XLNF 4EJTA 2HXIA 3GW2A 1UHMA 3K4BA 3IH3A 1XC5A 4WXCA 1BIAA 3S3NA 4BL0B 1JHHA 5K5RA 1E3PA 3L1PA 4JQFA 2M4KA 2UXXA 1ZLKA 2PBIA 1ZAOA 3H3VK 1IXCA 4IHYA 1O57A 1X1BA 3CMMA 3ZQHA 3QOEA 4ETSA 3DBHB 3L2UA 3FXOA 4PSWA 4FTHA 1FSHA 1IN7A 3CP2A 3BP8A 5EYRA 4DJAA 4DOZA 4E4HA 2NRAC 3OYCA 2D1HA 2FQ4A 2WV1A 5CLSA 3H9GA 4CUGA 3O2PE 4B47A 2HQNA 1RZ4A 2XRNA 2DFIA 2P6TA 5AONA 3TO9A 2L02A 2KZVA 5IP7J 2PJRA 1XDSA 2LOOA 3TQNA 1I6XA 2MGQA 3BY6A 1MMNA 4BEHB 5A2QZ 3A1YA 2EV5A 4RB0A 1JGSA 3TO7A 2F5CA 5C4JJ 2VOPA 2LBFB 2FEZA 2DPDA 3BTCA 2Z3YA 3WTTC 4G7ZF 2BY3A 1A6IA 4PJMA 2Y75A 1NHAA 4II2A 1YX5A 2XAGA 3GTOJ 3N97A 4A3IJ 2IGNA 5FGMA 3E6CC 5EGOB 3RPQA 2VI6A 4CGZA 4QPOA 3MAJA 3ZMUA 2M8GX 2B9SA 3A0HC 4I0BA 3GUDA 3A02A 2Y31A 2NOJB 1D5YA 2IAIA 4UXNA 1W1WE 2LLKA 2CG4A 2M8EA 3BG7A 4RAGA 5CVVA 3F23A 5HVQC 4L18B 4KT6A 4HQEA 4HX7A 2ADUA 2EFNA 2PJRB 2CSOA 1WSUA 4U88A 3M7GA 3FWEA 4HAMA 3S17J 2CV2A 3E97A 3OYDA 2JSCA 2KIFA 1N75A 2P6SA 3O8GA 2VODA 5DD4A 1O3TA 1BI3A 2HYJA 3LQRA 3BPVA 4F92B 2DA6A 4LLLA 3EETA 1HDDC 3K69A 2QWWA 2A05A 2I5UA 4FISA 2Y9YA 4PCQA 5FFXA 5ILSA 5ICGA 2E7WA 1WCMJ 1Y1WJ 2DN0A 1UFMA 3B73A 1A36A 2R7OA 2ZXHA 3PQKA 2EJRA 5IPAA 3SEQA 1TC3C 3S1QJ 1MBKA 2DOFA 3H0DA 4ABZA 4ZYAA 3CJNA 2XSJC 4IQJA 1BM9A 4ESBA 1PYVA 3OOUA 1VF9A 4RM2A 3EUHC 2X85A 4HOBA 2RDPA 2KZGA 1F5TA 4FX0A 3RKQA 2YX7A 1MBJA 4E7IA 2IGMA 5K5QA 1RIOH 1FT9A 2R5ZB 2ZXJA 3R6SA 1JUPA 5KNLA 1OR7C 2K9SA 3AG2H 2XSDC 1HDPA 4P9FA 3ERED 3H9QA 1Q1VA 2ZFUA 4L0YB 5HS8A 2A07F 1TWCJ 4RDUA 3IH4A 1D0YA 2M87A 2ISYA 2DO7A 4PSXA 3I4PA 4HA8A 3BJOA 1UHWA 1VI0A 3ESWB 3PFIA 5GP9A 3H3ZA 5F04A 2J5PA 2R3SA 1JKRC 1PVEA 2UWMA 2FOWA 1BA5A 1KU3A 2WA0A 1ACIA 3HOSA 3E5QA 3OIQA 2DFHA 3J81Z 3L2WA 2DMNA 1AWCA 3VDXA 3ZPLA 2CQKA 2J5OA 4A69C 1MDMA 2VUMJ 1KU9A 4BHBA 5B3SH 3IL2A 1I3AA 2EZHA 2YUSA 4M6YA 5E1ZB 3M8FA 3DTEA 1FPQA 2XC7A 3CF5F 1W5SA 6PAXA 2IS2A 1YJ9I 2IRFG 1TQMA 3JRBA 1TQIA 3WTZA 1U9NA 3C3WA 2ID6A 1WJDA 4C3HJ 5DS9A 3ROUA 1FC3A 1V5FA 4LK0F 3QPSA 4XSXF 2E34A 2HVRA 2JA2A 2L9RA 2LC2A 2P7VB 3K9TA 2E19A 2QKMB 1VQ8I 3H5RA 1WI3A 1FWZA 3ZQGA 4A3DJ 2V9KA 4AIJA 4NDLA 1JI8A 5EEAA 2OZUA 2PLYA 1NG6A 4S04A 1VQPI 1ZREA 3V42A 4FASD 1JKPC 2PEXA 4O5VA 1IV6A 1ZHFA 1FJLA 2LDUA 5F1JA 2R7QA 2GZWA 3JAMK 1R1VA 3QYBA 3D5RC 1ZRFA 4HBLA 2EA2A 3F0CA 2FA5A 2QQAA 3L00A 2AS5F 3SJMA 4BY1J 2RVCA 3QP5A 4RGSA 4XLCA 1N25A 2VKVA 3SDGA 4ZJZA 4IRGA 4W97A 3E6MA 2WBMA 3ZQIA 2QYOA 3R4KA 1EJ9A 4ANJA 1E0EA 4WK8F 3B02A 1UHSA 2YU3A 4C3JJ 3ZQFA 4QLCU 2IA0A 1HW5A 3IKTA 1ZH5A 3KPHA 1V55H 1YI2I 1WKMA 3FMRA 4EMSA 2JPBA 2IEKA 2KRFA 5FLXZ 1ZR4A 1OCCH 3DBLB 1QZYA 1S8NA 2O5RA 3ZMZA 2QSHX 2HDWA 3KP6A 3U21A 5D4RA 5E79C 2HR3A 1R4NB 4OAZA 5L3EA 1U5TA 4RB3C 1F43A 3QU3A 4EV0A 5DEQA 5M3MJ 3KP7A 1KU7A 2HKXA 3IHUA 4HF0A 4ASNA 3E3VA 5EF6A 3CTAA 2IT0A 1J59A 4OU0A 5JLXA 3CC4I 4CO8A 2ECCA 3ABTA 2XASA 2CQQA 3W2VA 5KHDA 1DDNA 2DBBA 2P7CB 2L0KA 2K4BA 3MVPA 1FBQA 4XOPA 1K7AA 3CD6I 2P81A 2AHQA 2RNGA 5C4XJ 5FLXK 3HKZN 5JLWA 4XK4A 2E1OA 2E7XA 1X58A 3I58A 4HDUA 1IRZA 1S7OA 4I7HA 1IDYA 1D5VA 1Y56A 4GXOA 2L9SA 1K6YA 1RNLA 3G4SI 5H2FC 4BXUA 1R5GA 4HRIA 2DA7A 2X6OA 3RQ4A 5E8IA 4EJVA 3F8BA 2H09A 4P9UA 2FF4A 1GV5A 1V5GA 4B44A 4HF2A 2GA2A 3K4LA 3HPHA 1GUUA 4XLHA 1HKQA 2IJLA 2EV0A 2F4OB 3A01B 2IS6A 5FKKA 1TT5B 1YJNI 5IYDJ 2Y0SN 1CF7A 2K3FA 3G73A 1TNSA 4UVBA 3EPZA 1USSA 2JPCA 5LHHA 3E5UA 1B1BA 1OISA 3R0AA 4QPQA 3WU0A 5F0CA 5J3LA 5F08A 2ID3A 3I3LA 2WAQN 2WY7Q 2FBKA 3F8NA 3Q9SA 4XN3A 2X6YA 2LREA 3RZOJ 4Y33A 4IOCF 1ETYA 1XSVA 4E7ZA 5IOZA 3BROA 3FBNB 3OYLA 2HOAA 5JI6A 1W0TA 2OQRA 3BR6A 5J1RA 5K7FA 1LFPA 4A0XA 4XLEA 3OIOA 1Z7UA 5B66C 5CJ9A 1S29A 5DCMA 3CJRB 2DU9A 4XNFA 5HDGA 3TW7A 2WADA 2QBYB 2M0CA 2EIKH 1YTYA 1SEUA 2V1DA 3ISPA 5E1XA 1YRNA 5L3GA 3HUGB 4A3GJ 4RGRA 3VYRB 2ELHA 3M3YJ 5HLGA 2D2WA 1U5TC 3VB2A 2DDBA 2DODA 5DTDA 2EH3A 3HC7A 3TP0A 5TJJA 2E2HJ 1HQCA 1MBHA 3CDIA 1TNTA 4M6VA 1S6LA 4UUSB 3GVAA 2CQXA 3F8MA 4L9NA 2GAUA 3WE2A 3PUFA 1B59A 4GO1A 1XX5A 2VE8A 3DLAA 1FMWA 1IW7F 1UCRA 2VC0A 3B6CA 3JW4A 3AL0C 3S8PA 4EVIA 3WU2C 1ZRCA 1K4TA 1VQNI 4HX4A 2NXNB 4DYRA 3DU5A 4PFOA 1VTNC 3CO7C 2VLAA 3G3ZA 2ZSHB 3M8JA 2NVYJ 5M5WJ 2EA4A 4ZDPA 2L2OA 2VBYA 4XR6A 2LVSA 4Y4RA 2W1OA 1QHHD 3HTUA 1TP4A 4N4OB 3S2DJ 3RIRA 2CRGA 3L7WA 1BR4A 4PJJA 2BHYA 1WJBA 3RDIA 1SC7A 2STTA 2XIGA 2VBWA 2R7WA 2Y69H 4NNJA 1WJ5A 3VFZA 2DMUA 4BJ6C 2LSOA 2TDXA 2BY0A 1WI9A 1OYYA 2VBZA 1YHQI 3NWTA 3VPRA 1IUYA 4N9IA 3GZ5A 2ZCWA 4KJZA 2M30A 3CUQA 3D5LA 1XS9A 2VB6A 4LG0A 1DUXC 1TW2A 2O7OA 3L09A 2KHMA 1R36A 3AAFA 4ESFA 4ITVA 2M9HA 1B8IB 3I59B 4S05A 1WPKA 3GO5A 2E1MB 1B9MA 3FISA 3DPTA 3BR5A 3Q0WA 2HTJA 3BWGA 4M3GA 1GHCA 2VJ4A 3BOQA 3EUKL 2STWA 1G3WA 2CJJA 2DK5A 4I2OA 4GRIA 4CYCB 2HOSA 4L0ZB 2E5ZA 2O8XA 3TEDA 3CCSI 2H6BA 4DBRA 5J1YA 4BBSJ 3BR2A 1A6QA 1AOYA 4R8HA 2M5WA 3CQZJ 4RS8A 4BACA 3I53A 2Q2EA 3SZPA 2A6HF 2KT0A 4R79A 3DTIA 1Y0UA 1BI2A 3T8RA 5HNFA 4RLQA 2VIXA 2VXDA 1BI1A 3KP5A 2EFQA 4CXFA 2A69F 1Z05A 3JRCA 2VKDA 2CQNA 2GIVA 2B7EA 3IWZA 4PDKA 4WX9A 4F91B 1JJ8C 4HNUA 1QA6A 1MBGA 5DCFA 3GTGJ 1WQ2A 4BGDA 1DGRM 1IO2A 2LMDA 1D8KA 2KJCA 2XAUA 3GWZA 2KL4A 3CUQB 2KKOA 1BOAA 1P6RA 3RPUA 3C2HA 2HVSA 1O7FA 2FQ3A 2QLZA 4LG3A 2HYFA 4M73A 4QIWN 2RQQA 4G12A 2KIUA 3CJTB 4B8XA 3U9GA 4CCKA 1FTTA 4LFUA 5L3CA 3D0SA 1XCBA 3FBIB 4BQQA 4M74A 2K7LA 2Y0MA 1OJLA 4ZZLA 3K70D 3O3KA 5FD5A 1OPCA 3QP6A 3WTSC 4II3A 5CYVA 4DIQA 1V3FA 3MMYB 3W6JB 3ZN1A 3OYMA 4L5JA 3BG6A 5HLIA 2CUEA 4J00A 3S16J 3GLLA 4XKVA 2O3FA 1I5ZA 1T6SA 4PJNA 4BE1A 2R7TA 1JUMA 2GQQA 1K79A 2FJ1A 4IEJA 1MGTA 1W36D 1O4XA 2X6XA 5GAGJ 4PFPA 2EBIA 4XRSG 1X2MA 2DQLA 3ABLH 3PSIA 4XONA 5DV5A 4BAYA 3SZTA 4CICA 1V4RA 4XSZF 1K6OA 5E18F 3BG3A 3OS1A 3P5JA 1DPUA 3TL4X 2HDCA 4FQGA 1FSEA 2XF6A 1EKEA 4HQMA 1XMXA 4IO9F 3QU6A 3DV8A 3EDPA 4KN7X 3BT9A 3E7LA 1S9HA 2FMLA 3MEXA 5IYBJ 3LSRA 1IXRC 4B3XA 2L7ZA 3OS2A 4ENJA 3MQ0A 1V54H 1BI0A 3AKZA 5H6QA 3SHFA 4EM1A 5FJ8J 3FM3A 2CV0A 2O9LA 4UUVA 1R7JA 4KDPA 2L9NA 4WCGA 5J1UA 5C3EJ 2V6EA 2DLLA 3HOZJ 1FYMA 4IHWA 1VZ0A 1VQ5I 5HS9A 2KLOA 2MG4A 3FDYA 1PP7U 2DTZA 3H5NA 3T8TA 2NVQJ 4I09A 5IYCJ 3GMEA 1DQUA 4DYQA 5L3BA 1LQ1A 1ON1A 2FXAA 3F3XA 3HRTA 2FMYA 2HNHA 3I5UA 4KICA 1T98A 2AO9A 4LD5A 2H8WA 5CVRA 3TO6A 3VYTB 4I76A 3CC2I 5E20A 4CCMA 2NAZA 2Z9OA 3F72A 2VC1A 3HXLA 3F9KA 2VN2A 4N4NB 2CUFA 4F55A 4CSWA 1Z9CA 2NNNA 2E60A 1KGSA 3GFMA 2BV6A 3WE3A 1Y8RB 4B1RA 2R7VA 2L4AA 4YELA 3T0YA 2X0LA 3S15J 1GXQA 2XVCA 4MEYF 4R1HA 2MC4A 2M34A 1BOBA 4PUSA 4XLPF 2YSRA 3HSEA 1X3WB 1HSJA 1FP2A 2XROA 3RYRA 4U87A 1MH3A 2AQEA 2D1VA 5J8FA 3E6BA 2BE5F 2CYYA 4LB6B 3RSNA 1NK2P 1RPWA 1FOKA 4EJUA 3EUHA 3K1PA 3KP4A 3MKWB 1RUOA 1Z21A 3LFUA 1LFBA 4B09A 1KONA 1MJAA 4XKCA 4GYIA 4UVCA 1LFUP 3CMEI 3LAJA 1LKXA 3VWBA 1G2HA 3OY9A 2Y2ZA 5FKMA 2Y30A 3OIPA 1OR7A 2RGVA 4IF4A 2JZYA 4Y3OA 5DD8A 5M5YJ 1OCOH 3V8JA 2O61A 3HG9A 4ZC3A 1LEBA 2A68F 5CKTA 2COMA 4PJLA 1S7EA 4DBQA 4M6XA 5KCMA 4AD9A 3PO2J 1X1CA 5IOYA 1RKWA 5EG0A 1ZELA 3HGGA 2HPIA 4UHTA 1RUNA 2H94A 3DPUA 3X2QH 1Y6IA 4I02A 2R0QC 3FF5A 5D5WB 3ML6A 2HQAA 2QENA 4XMYA 3K4NA 3MKZA 3RKYA 2BW3A 1MJBA 1AHDP 1IN8A 4OMZA 4IHVA 3WG7H 3LFKA 3IV5A 4ZYEA 3BJ6A 1OCTC 3DTKA 2R92J 1ONVA 4O3MA 2BZTA 4MQVA 5DYMA 2LG4A 4BYYA 1VQ9I 2ZJQF 2UV1A 1Y8QB 2G0EA 1P4WA 1LUJB 2M1BA 2GXBA 5M5XJ 1EH7A 2LKXA 1OMIA 1RESA 1TTYA 3OYAA 3QODA 2X6WA 1P7IA 4IX7A 1FOYA 1K83J 3JTHA 4AYBA 4EJWA 1K61A 2K3PA 4W1UA 4A5NA 3QPTA 2EB7A 3JCUC 4JX4A 2A61A 1G3SA 3CF2A 3HOWJ 3F8FA 2XAFA 2D45A 2K9NA 3HJEA 3SDBA 3PIOF 2Q1ZB 3K4CA 5K1YA 2P5VA 1MSFC 4UVAA 2Z1DA 5H20A 2P8TA 3IC7A 1CQTA 2JA6J 3IAS2 3RJPA 5J4YA 2MABA 3W2AA 5CPRB 2I10A 3C2GA 1ENHA 2H1KA 2R5YA 4RAZA 3S3MA 2P5LC 4L9TA 4CH7A 5DUKA 1VQMI 3RKWA 3AG3H 2KIQA 2H27A 2OA4A 4F3QA 1XGMA 1QHGA 4RBOA 4DGWB 4L9VA 4G94A 1HW2A 3K7AJ 4JK1X 1HOMA 1H88C 3E0JB 4G8XA 1G3YA 1I6HJ 1RI7A 4WF2A 3V7RA 2NVUB 5DM6F 2HU9A 4EQQA 5GPCA 3I64A 2OBPA 3DXJF 3RCOA 2DYRH 4M3BA 1FIPA 1R22A 4N0BA 1YS6A 1IN4A 4LJZF 4NQWA 1BJZA 1VFCA 5B5EC 3LNQA 4Y52J 5LBQA 4AC0A 2O6GE 4UY8I 1QU3A 1MBFA 2IGOA 3KE2A 4G6DA 5EEHA 2YPRA 1JE8A 3CJQB 5B1AH 9ANTA 4LMYA 1SD5A 1ETXA 3VSKA 3S2HJ 2XDVA 1BBYA 2XGCA 1JJ6C 2FBIA 4NC6A 1JTXA 2FX0A 4M3FA 1F4KA 2GA1A 3GTQJ 2R5YB 3KCCA 2L4MA 4M72A 3WGIA 4EM0B 3JREA 4UNOA 2ZMEA 2L54A 2LY9A 2DT7B 2D5VA 1V5EA 1SFXA 1Z77A 4E6KG 1FX7A 4U0YA 2ECBA 4BUPA 2EZLA 2W25A 1J7KA 4V19K 4LITA 1U8BA 2JN6A 3ZMDA 2YU9J 3CDHA 5JVGF 2XRLA 3JAMZ 1UB9A 5LEJA 2K27A 4Y17A 4LK1F 2KDOA 1YX3A 2PN6A 2OJED 1U6GA 3FXKA 5ICFA 3ZQ7A 4EATA 3GTJJ 5C44J 2F48A 4IVNA 1O7LA 2F6CA 2LY1A 3A0BC 2DYSH 3H36A 3OYJA 3K6GA 4GFBA 1LEAA 2DCEA 3VYSB 3N05A 5IT9K 2JMWA 4KMUX 1A5JA 3OYKA 2LF8A 2B0LA 1O3QA 1ZG5A 2PFBA 4IHSA 1TW3A 4C9YA 2Y48A 5BS6A 5FRMA 4EEFG 5FO5A 1GVJA 4CCOA 2EZKA 3KLOA 3ZQQA 1DP7P 1DP3A 3L9FA 4DZPA 2XGEA 4M9ZA 3H0GJ 2QF7A 4HNVA 2FUG2 1ZG3A 3WHCA 4A0ZA 4PGGA 3FXLA 1JUSA 2CMPA 4BXXJ 2V7FA 2OAZA 4AVPA 2IS4A 2OTLI 1U8RA 1XG1A 1WH7A 1MDMB 1YOVB 2MC3A 2QSFX 4IJAA 5H6RA 2DA1A 2O03A 3AG4H 5GTIC 2W82A 2NS7A 3M1EA 3CLOA 4DNCA 3JRDA 1FTZA 2L01A 1YFHA 1JHFA 1BR1A 1D1CA 1AA7A 2ACJA 2XHKA 4Q48A 5FKOA 1Z3XA 4A5MA 4PGHA 3CUOA 2WV0A 4RAFA 4L9JA 1CGPA 2XF7A 4UUTA 4H0EA 2JRTA 1MSEC 4XOTA 1D0ZA 3CCMI 4A6DA 1VQKI 3P9CA 5F6FA 4YIRX 5J8CA 4YFKF 3B6AA 1XPXA 1YO5C 5EZGA 3I4NJ 1JXSA 2CQ7A 3K4MA 5LGTA 3UKGA 1IRXA 4D9JA 3UR3C 2RN7A 1ZR2A 2A5YB 3DEUA 4WXDA 4LOCA 1PDNC 2W48A 3HKZA 4P96A 1PJRA 1YJWI 4BE0A 1IF1A 2ZO4A 3P7NA 4P1WA 3L2CA 3BJAA 1YG2A 3J7AO 2FD5A 3LSGA 1LVAA 2ZMEC 3ECOA 1UELB 1ZGAA 3EYYA 4CCLA 2DA2A 1BC7C 3Q3SA 1MJ9A 1A04A 4NB5A 1JKQC 2ESHA 1XN7A 3BTIA 1X19A 5KAFC 2R7SA 4IZZA 3V4GA 3S14J 1REPC 2W24A 4CCNA 3HHHA 1I3QJ 4ENNA 1BIBA 3BC8A 1OYWA 1PP8F 2JSPA 1PUEE 3LQQA 2VKEA 1KQ8A 2Y0SA 3G6EI 2ISZA 1HXDA 3CP8A 3FM5A 4XRFA 2HS5A 1GVDA 4MNUA 3BG5A 3I9V2 1WHUA 1S5LC 2V9VA 1OCRH 3HOVJ 3FKJA 5DUIA 3Q0VA 3KYLA 2VE9A 1IRFA 1TWGJ 1U5TB 1BN5A 4HW0A 1WJFA 5IP6A 2O0YA 1IG7A 3H35A 2JWTA 3DKYA 2HOTA 4WWCA 2DMTA 4OIOF 4HSTA 3J7YJ 4KYWA 3FXRA 1EV7A 5DM7F 2KMUA 2YX4A 1BL0A 4IRHA 4X0GA 3CCEI 2PX9A 2DT6A 3QQAA 2ME6A 3HOXJ 4BNCA 3KYDB 3VEPA 4OAYA 4OIQF 1U2WA 1UG0A 2MSYA 3F21A 2F5VA 4BXFA 1EA3A 2JT1A 2HVQA 3IKVA 4FX4A 2LKSA 4ZYDA 1SVOA 1OCPA 4KIBA 3DEWA 2VKHA 3DEEA 3N4MA 3KP2A 1X1DA 1M1EB 2HQ5A 2ZKZA 4DQ2A 1G8XA 1OLTA 2F5EA 3SYTA 2PG4A 3MKYB 3HOYJ 3EUAA 2Z99A 4ZTJA 1O3SA 4UB8C 1WZ2A 3S32A 4IRIA 3WTWC 4I98B 3WTYC 2DQRA 1XB4A 2M45A 1YYVA 3EQLF 3G1LA 1QNTA 2HQRA 1IN6A 2BYVE 1S72I 2XKOA 1ETOA 4MTEA 4YG2F 4A12A 1UJ8A 4E7HA 4YFNF 2DI3A 3PFYA 2A6TA 2GWRA 2CH0A 1Z6RA 3KZYA 3OYGA 1K78A 1FZPB 1CF7B 2G7HA 4M71A 1WJAA 2CW8A 1Z0XA 1MMAA 3BCAA 3FXMA 3QYFA 4FT8A 1XGNA 4KIGA 5D6FA 2VT3A 2L7KA 4BY7J 2KP6A 5ICCA 4A2UA 2FE3A 3REOA 3CDLA 3K10A 3ASNH 5J40A 5KVRA 3TDUC 2OCEA 4RB1A 2BXYA 2OC6A 5CVJA 5LHIA 1ZQ3P 4UB6C 3IWFA 1P4AA 3BR1A 5LGUA 4A6EA 2EILH 4F93B 2Z16A 4BHCA 4U0VA 2QM3A 4KMFA 2OV7A 3JR9A 2QVOA 4LLGF 4ON0A 4YIIA 3BG9A 1X2NA 4AVZA 3Q5FA 1BW6A 3U1KA 5HDNA 1WFXA 1LE8A 5DCMB 4HLXA 1F9NA 3AFHA 2NVTJ 4M9XA 4GYGA 2O8KA 4E7KA 1YITI 2BGCA 1H89C 4FETA 3NAUA 2CGPA 2GBYA 3V8KA 4XQFA 2WB1N 3DPLC 1YRNB 1ETVA 3AG1H 3GXOA 2XGXA 1MNMC 1FNNA 2CV1A 2FNPA 4OOIA 4BJTA 4KA4A 2VJJA 2V4JC 5HOOA 1FIAA 2X1CA 2EIJH 2GIZA 1ETQA 3BCBA 3IP4B 3U2RA 3BZCA 2VPRA 3L2VA 1WJEA 3KX2A 4AIDA 2MLKA 2G7UA 5B1BH 4BU2A 4BQAA 2B63J 1VQ4I 1ULYA 1ETWA 3K2AA 1HBXG 4XRMA 2R7UA 3HDDA 3SFZA 3HSRA 1QVUA 1R58A 3HB9A 2PQ8A 3OSGA 1YW8A 1IAWA 3KEOA 4OINF 1TQPA 4YFXF 5LLQA 4ZTFA 3VYUB 2EWNA 4X1EA 2HGCA 1K4SA 4ZYHA 1HKSA 1MKMA 5HDKA 2E1CA 4WXHA 4E7LA 4XM3A 5D4SA 2IVMA 3PNVA 1QBJA 4LIUA 1Y0NA 3ONQA 3HRUA 1SD4A 5ILUA 1SAUA 3H9JA 2X1EA 3S3OA 1UAAA 1E2XA 1Y1VJ 2CS3A 5K5OA 1D1BA 2GXGA 4D5CA 3QRFF 2W85A 4DW6A 2MA3A 3K1NA 3PNYA 4OWRB 4NUBA 1IZ1A 2R7RA 1Z67A 4YRVA 3G1OA 2DJNA 4PJ0C 1NTCA 1H9TA 3ZCOA 4GDFA 4NC7A 2DXIA 4XKBA 4BQOA 4NHJA 4IXAA 3OYFA 3OYIA 1G6NA 4LLNA 3BZKA 2WTEA 3GFLA 1Q1HA 3IAM2 2HXOA 3CESA 3HEFA 3P9KA 4LG0B 2KJBA 3HYIA 1T39A 3F22A 2PJPA 3OYBA 2CFOA 1KYWA 1NK3P 2OTJI 5F0HA 5ILVA 5HNHA 3FIWA 3Q0UA 4JOMA 1H9GA 3HRMA 1XSXA 1H0MA 1OYIA 3TP3A 3GTMJ 1PUFA 2QA4I 1KA8A 1TWHJ 5JVTA 4BS9A 2E1NA 2JRMA 2Q2EB 2LFBA 1FP1D 1D8JA 3ZXSA 2JK3A 4F52A 4C2TA 3ELKA 1IUFA 3G1MA 3LWFA 2JJ7A 4XICA 1S7AA 2L9VA 4BHPA 2F4IA 4RGXA 1FEXA 3J7ZI 1L3LA 1P2FA 1XGOA 1Z91A 2ZJRF 5M3FJ 5E3MA 4MEXF 1A31A 5BOXA 2HKOA 1YW7A 2CWEA 5JR3A 2TRTA 2HZDA 2OZ6A 2XUBA 3TW6A 1N77A 3W6VA 3PJRA 2PMZN 2VL8A 2K9MA 4AWXB 1H8AC 4FE4A 2XKPA 1W7PA 1IC8A 4BDZA 1W4MA
chains in the Genus database with same CATH topology
3NQOA 2H6CA 2Q0OA 5IT3A 3ZMTA 1J75A 1ZG1A 1P92A 4G9YA 3TOAA 3GFJA 1U3EM 3WTXC 2OD5A 4I0AA 4CDGA 5JFRA 3DFGA 1XDUA 4GCVA 3VOEA 5BPIA 1XSDA 3T5XA 5BQTA 4QWQA 2NNYA 2OQGA 3QAHA 4JBAA 3K2ZA 3I0TA 3R60A 5D5VB 2K86A 2HEOA 2F5DA 1STZA 2PMUA 5AIPA 4HDVA 5LGNA 4HV6A 4UV8A 4Q5SF 2EK5A 3U1DA 3HIFA 1SFEA 2FU4A 2RC4A 1EH8A 3HOTA 5J6XA 2LF7A 2Z5UA 4E70A 5D6EA 4Z2YA 3WGGA 5FFZA 2Z33A 1XCVA 2IA1A 4RGUA 1E17A 2CFXA 2R7FA 1YW9A 4IPAA 4G6QA 1ON2A 3JTGA 4MTDA 3CO6C 3T1BA 3KP3A 2XV4S 2RNJA 4I01A 1LDDA 1IXSB 2FRHA 4ZZDA 2F5FA 4A0YA 1ZGJA 1J9IA 3OV8A 2XAJA 2FNAA 5BPDA 4MGRA 1HW1A 5CVIA 1ZRDA 2YR2A 4Q4ZF 1GXPA 2XAQA 3QOPA 3RKXA 2V1UA 1Z1DA 2C6YA 1SD7A 5L3FA 3IRRA 1J2XA 3MCZA 4CZZA 3WODF 3FZVA 5E1WA 5HS7A 1XGSA 4RAYA 3WU1B 1LB2A 1W5TA 2HZTA 4U0WA 3WTVC 2QUFA 4GGGA 2HOEA 3RTRA 2PMHA 4Y13A 5A2QK 1O3RA 3VODA 1ODDA 1SMTA 5D5UB 2EFOA 4HX8A 3V7CA 4MQ9F 3H3UA 1SFUA 1R1UA 5KK1A 3ECHA 1MD0A 3NEUA 4OIPF 2ETHA 1ZLJA 5IT9Z 1LJ9A 3E5XA 3LAPA 3WGHA 2V79A 3M8EA 2KIMA 3PQJA 1XMAA 3JSOA 4G7HF 5LRRA 4ZYGA 4HV5A 4U7DA 4N9HA 3TDZC 3LSTA 3MWMA 1EH6A 4O6JA 3GZ6A 3DP7A 3F8CA 3I54A 5AIQA 2OU2A 4AIHA 1D3YA 1L0OC 3KLNA 2MBFA 1HKTA 2BBYA 2VXZA 1U78A 5F64A 2ZMEB 3K1MA 3ZMVA 3DKWA 4LGWA 2RV8A 4HZFA 4U7BA 1LDKB 3H92A 2JTVA 2DPUA 2IA2A 3I71A 3LA2A 4EM2A 1QPMA 3KZZA 2CW0F 1TBXA 1C0WA 3J81K 3KEQA 1R23A 2UZKA 1IRGA 2K02A 4OIRF 3DQVC 2HFHA 5ED4A 1R1TA 2RQPA 1J0RA 2PI0A 3FMSA 2ZBKA 4K2EA 1DPRA 4YIFA 1B4AA 3GEZA 1ZARA 3WTUC 3MZHA 2IP2A 3S2WA 3FXUA 3R0JA 4OMYA 2XAHA 1FYLA 3LA3A 1KQ9A 2P4WA 3P9IA 3FMQA 1R5HA 3ZP5A 2MH2A 4EGYA 5D8KB 3GF2A 5HLHA 3BPXA 2G9WA 3TKYA 3HTSB 1QQIA 2EFPA 4UV9A 4TV7A 2QQBA 1XMKA 3QPHA 3LA7A 4FHTA 1SAXA 3V8LA 5LRSA 2W57A 1T0FA 3TOBA 5E17F 4CHUA 1YLFA 4ESJA 1IN5A 2QBYA 2DTRA 5D8LB 5ICEA 4Q47A 3K0LA 1B6AA 4Y15A 3HUGA 2F2EA 1F1ZA 3WG9A 5JHUA 4CYDA 1QO0D 1SMYF 4XBFA 5BMZA 3RI4A 1BC8C 5LHGA 2V6CA 4MHGA 1I27A 3ZMSA 2HWVA 1WRJA 3TGNA 1T2KA 1B9NA 2FBHA 3MZYA 2MH9A 2ZFWA 1HSTA 2MD5A 4RB2C 1FY7A 4PZJA 2HTSA 3RYPA 1WWXA 4P5OA 1KU2A 4F7ZA 2A6EF 2LNBA 4EJOA 1LNWA 3M9AA 3ULQB 2HYGD 1S3JA 5E8GA 1K78B 3I59A 5ERIA 3F6OA 3GX4X 3W6KB 3IRQA 3OOPA 4AIKA 4M9SA 3MFKA 1SD6A 2VOOA 1P4XA 1Z6TA 1J5YA 2BEOA 1TLHB 2ZJ2A 5DDGA 1USTA 3ABUA 4HLYA 5EEGA 2DW4A 3GLXA 4KIFA 2IPQX 2LKPA 3COAC 3E6DA 1YS7A 3F6VA 1ZN2A 2EV6A 3Q9VA 4ZH4F 1T38A 1QZZA 2FOKA 5CVUA 1XD7A 5F1RA 3FXQA 1FLIA 2Q8KA 4L5IA 2WC2A 3GFIA 3KETA 3HHGA 2NS0A 4KUMA 2UXNA 4IHTA 1YQAA 3O6BB 4KN4X 3JSPA 4LB5A 2V1XA 3C1DA 2ZNYA 2RKHA 4P55A 2CO5A 2X4HA 3NRVA 3BDDA 3C18A 1ZYRF 3KFWX 1FBUA 4G7OF 1KQ0A 4ENMA 1G3TA 2MLGA 2VONA 2DT5A 4ENKA 1OKRA 2DAOA 3V7SA 3J80Z 2VBXA 1YIOA 4BH9A 4KFCA 2W84A 2QZ8A 2QQ9A 2AXLA 2R7DA 3C7JA 3SXYA 3EYIA 2FSWA 2K4JA 5FD6A 1G4DA 4HYEA 3R61A 3FX3A 3CUQC 1QGPA 2EFWA 4KNYA 1X3UA 1I1GA 3HRSA 2DK8A 5TRDA 3J80K 4D0PA 1R00A 5LEKA 4EGZA 1W7PD 5FB2A 3FHZA 1FYKA 1W7PB 2L3DA 1I1SA 3BZ6A 3GYHX 2NYXA 2IW5A 2A3SA 2ZNZA 1BJAA 3HSFA 2P5KA 3DF8A 1MZBA 1FBSA 5L3DA 2VT2A 1LDJA 5D5XB 2ESNA 4KT5C 2WWYA 4HF1A 3SQNA 3ZN0A 1KYZA 4XLNF 4EJTA 3GW2A 1UHMA 4WXCA 1BIAA 1JHHA 5K5RA 4JQFA 2UXXA 1ZLKA 2PBIA 1ZAOA 1IXCA 1O57A 4ETSA 1FSHA 1IN7A 3BP8A 2NRAC 2D1HA 5CLSA 3O2PE 2HQNA 1RZ4A 5AONA 2XRNA 2DFIA 2P6TA 3TO9A 2L02A 1XDSA 3TQNA 1I6XA 3BY6A 5A2QZ 2EV5A 4RB0A 1JGSA 3TO7A 2F5CA 2VOPA 2FEZA 2DPDA 2Z3YA 3WTTC 4G7ZF 2Y75A 1NHAA 2XAGA 3N97A 5FGMA 3E6CC 3RPQA 4CGZA 3MAJA 3ZMUA 4I0BA 3GUDA 4UXNA 2M8EA 2CG4A 5CVVA 3F23A 5HVQC 4L18B 4HQEA 4HX7A 2ADUA 2EFNA 2CSOA 1WSUA 4U88A 3M7GA 3FWEA 4HAMA 3E97A 2JSCA 2KIFA 2P6SA 2VODA 5DD4A 1O3TA 1BI3A 3LQRA 3BPVA 4LLLA 3EETA 3K69A 2QWWA 4PCQA 5ILSA 5FFXA 5ICGA 2E7WA 1UFMA 3B73A 3PQKA 2EJRA 3CJNA 1BM9A 4ESBA 4HOBA 2RDPA 1F5TA 4FX0A 2YX7A 5K5QA 1RIOH 1FT9A 2ZXJA 3R6SA 4P9FA 3ERED 4L0YB 5HS8A 2A07F 2M87A 2ISYA 2DO7A 3I4PA 4HA8A 3BJOA 1UHWA 3PFIA 3H3ZA 2J5PA 2R3SA 2UWMA 1KU3A 3HOSA 3E5QA 3J81Z 1AWCA 3ZPLA 2CQKA 2J5OA 1MDMA 1KU9A 4BHBA 3IL2A 5E1ZB 4M6YA 3M8FA 1FPQA 1W5SA 6PAXA 2IRFG 1TQMA 1TQIA 3WTZA 3C3WA 3ROUA 1FC3A 4LK0F 4XSXF 2P7VB 3K9TA 1FWZA 4AIJA 2OZUA 2PLYA 4S04A 1ZREA 2PEXA 4O5VA 1ZHFA 2LDUA 3JAMK 2GZWA 1R1VA 1ZRFA 4HBLA 2EA2A 2FA5A 2QQAA 3L00A 2AS5F 2RVCA 3QP5A 4RGSA 4IRGA 3E6MA 3R4KA 2QYOA 4WK8F 3B02A 2YU3A 3IKTA 4QLCU 2IA0A 1HW5A 1ZH5A 1WKMA 3FMRA 4EMSA 2JPBA 2KRFA 5FLXZ 1QZYA 1S8NA 3ZMZA 3KP6A 5D4RA 2HR3A 5L3EA 1U5TA 4RB3C 3QU3A 4EV0A 5DEQA 3KP7A 1KU7A 2HKXA 3IHUA 4HF0A 4ASNA 3E3VA 3CTAA 2IT0A 1J59A 4OU0A 4CO8A 3ABTA 2XASA 1DDNA 2DBBA 2P7CB 2K4BA 1K7AA 1FBQA 5FLXK 2E7XA 3I58A 4HDUA 1S7OA 4I7HA 1D5VA 4GXOA 1RNLA 4BXUA 1R5GA 5E8IA 4EJVA 3F8BA 2H09A 4P9UA 2FF4A 4HF2A 2GA2A 1HKQA 2IJLA 2EV0A 1CF7A 3G73A 1TNSA 4UVBA 1USSA 2JPCA 5LHHA 3E5UA 1B1BA 3R0AA 3WU0A 2FBKA 3F8NA 3Q9SA 1XSVA 3BROA 5JI6A 2OQRA 4A0XA 1Z7UA 5CJ9A 1S29A 5DCMA 2DU9A 5HDGA 2QBYB 1YTYA 2V1DA 3ISPA 5E1XA 5L3GA 4RGRA 2ELHA 5HLGA 2D2WA 1U5TC 3VB2A 5TJJA 1HQCA 1TNTA 1S6LA 3GVAA 3F8MA 4L9NA 2GAUA 3WE2A 1B59A 4GO1A 2VE8A 2VC0A 1IW7F 1UCRA 3JW4A 4EVIA 1ZRCA 4HX4A 1VTNC 3CO7C 3G3ZA 2EA4A 2VBYA 3HTUA 3RIRA 3L7WA 3RDIA 2STTA 2XIGA 2VBWA 3VFZA 2LSOA 2TDXA 1WI9A 1OYYA 2VBZA 1IUYA 4N9IA 3GZ5A 2ZCWA 2M30A 3CUQA 3D5LA 4LG0A 1DUXC 1TW2A 3L09A 1R36A 3AAFA 4ESFA 3I59B 4S05A 3GO5A 1B9MA 3DPTA 2HTJA 3BWGA 1GHCA 3BOQA 2STWA 1G3WA 2DK5A 4I2OA 4L0ZB 2O8XA 2H6BA 1AOYA 4R8HA 2M5WA 4RS8A 3I53A 2Q2EA 3SZPA 2A6HF 4R79A 1Y0UA 1BI2A 3T8RA 1BI1A 3KP5A 2EFQA 4CXFA 2A69F 1Z05A 3IWZA 2GIVA 4PDKA 4WX9A 5DCFA 1WQ2A 1D8KA 2KJCA 3GWZA 3CUQB 2KKOA 1BOAA 1P6RA 3RPUA 1O7FA 2FQ3A 2QLZA 2HYFA 4M73A 2KIUA 4B8XA 3U9GA 4LFUA 5L3CA 3D0SA 1XCBA 4M74A 2K7LA 2Y0MA 4ZZLA 3O3KA 5FD5A 1OPCA 3QP6A 3WTSC 5CYVA 1V3FA 3W6JB 3ZN1A 4L5JA 5HLIA 2O3FA 1I5ZA 1T6SA 2GQQA 1K79A 1MGTA 2DQLA 4BAYA 5DV5A 3SZTA 4CICA 1V4RA 4XSZF 1K6OA 5E18F 1DPUA 2HDCA 1FSEA 4HQMA 3QU6A 3DV8A 3EDPA 4KN7X 2FMLA 3MEXA 1IXRC 4ENJA 3MQ0A 1BI0A 5H6QA 3SHFA 4EM1A 3FM3A 4UUVA 1R7JA 4KDPA 4WCGA 2DLLA 1FYMA 5HS9A 1PP7U 3T8TA 4I09A 5L3BA 1LQ1A 1ON1A 2FXAA 3F3XA 3HRTA 2FMYA 3I5UA 4KICA 1T98A 4LD5A 5CVRA 3TO6A 5E20A 2NAZA 2Z9OA 3F72A 2VC1A 2VN2A 1Z9CA 2NNNA 1KGSA 3GFMA 2BV6A 3WE3A 2L4AA 3T0YA 2X0LA 1GXQA 2XVCA 4MEYF 4R1HA 4XLPF 2YSRA 3HSEA 1HSJA 1FP2A 2XROA 3RYRA 2D1VA 5J8FA 3E6BA 2BE5F 2CYYA 4LB6B 1FOKA 4EJUA 3EUHA 3K1PA 3KP4A 1RUOA 4B09A 1MJAA 4GYIA 4UVCA 3LAJA 1OR7A 2RGVA 4IF4A 2JZYA 5DD8A 3V8JA 2O61A 1LEBA 2A68F 2COMA 4M6XA 4AD9A 4UHTA 1RUNA 2H94A 4I02A 3FF5A 5D5WB 3ML6A 2QENA 3RKYA 1MJBA 1IN8A 4OMZA 3LFKA 4ZYEA 3BJ6A 1ONVA 4O3MA 4MQVA 5DYMA 4BYYA 2M1BA 1P4WA 2GXBA 1EH7A 1OMIA 1TTYA 3JTHA 4EJWA 4A5NA 3QPTA 2EB7A 2A61A 1G3SA 3F8FA 2XAFA 2D45A 5K1YA 2P5VA 4UVAA 5H20A 2P8TA 3IC7A 3RJPA 4RAZA 2P5LC 4L9TA 5DUKA 3RKWA 2H27A 2OA4A 1XGMA 4L9VA 4G94A 1HW2A 4JK1X 4G8XA 1G3YA 1RI7A 4WF2A 3V7RA 4EQQA 3I64A 2OBPA 3DXJF 1R22A 4N0BA 1YS6A 1IN4A 4LJZF 4NQWA 5LBQA 2O6GE 5EEHA 3KE2A 4G6DA 2YPRA 1JE8A 4LMYA 1SD5A 1BBYA 2FBIA 1F4KA 2GA1A 3KCCA 2L4MA 4M72A 3WGIA 4EM0B 4UNOA 2L54A 2ZMEA 1SFXA 4U0YA 1FX7A 2W25A 1J7KA 3ZMDA 3CDHA 3JAMZ 1UB9A 5LEJA 2K27A 4Y17A 4LK1F 2PN6A 3ZQ7A 1U6GA 5ICFA 4IVNA 1O7LA 1LEAA 5IT9K 4KMUX 2LF8A 2B0LA 1O3QA 1ZG5A 2PFBA 4IHSA 1TW3A 2Y48A 5BS6A 5FO5A 1GVJA 1DP7P 3KLOA 3L9FA 4M9ZA 1ZG3A 4A0ZA 4PGGA 2OAZA 4AVPA 1U8RA 1MDMB 2MC3A 5H6RA 4IJAA 2O03A 4DNCA 3M1EA 3CLOA 2L01A 1YFHA 1JHFA 2ACJA 2XHKA 4Q48A 4A5MA 4PGHA 3CUOA 2WV0A 4L9JA 1CGPA 4H0EA 2JRTA 4A6DA 3P9CA 5F6FA 5J8CA 4YFKF 1YO5C 1JXSA 5LGTA 2RN7A 2A5YB 3DEUA 4WXDA 1PDNC 4P96A 1IF1A 2ZO4A 3P7NA 3L2CA 3BJAA 1YG2A 3J7AO 1LVAA 3ECOA 1ZGAA 3EYYA 1BC7C 1MJ9A 1A04A 4NB5A 2ESHA 1XN7A 3V4GA 1REPC 2W24A 3HHHA 4ENNA 1BIBA 1OYWA 1PP8F 1PUEE 3LQQA 1KQ8A 2ISZA 1HXDA 3FM5A 4XRFA 2HS5A 4MNUA 2V9VA 5DUIA 2VE9A 1IRFA 1U5TB 1BN5A 4HW0A 2O0YA 4WWCA 4OIOF 4KYWA 3FXRA 1EV7A 2YX4A 4IRHA 4BNCA 3VEPA 4OIQF 1U2WA 3F21A 3IKVA 2JT1A 4FX4A 4ZYDA 4KIBA 3N4MA 3KP2A 2ZKZA 4DQ2A 2F5EA 2PG4A 2Z99A 1O3SA 4IRIA 3WTYC 4I98B 3WTWC 2DQRA 1XB4A 2M45A 1YYVA 3EQLF 1QNTA 2HQRA 1IN6A 2BYVE 2XKOA 4MTEA 4YG2F 4A12A 4YFNF 2DI3A 2GWRA 1Z6RA 3KZYA 1K78A 1FZPB 1CF7B 2G7HA 4M71A 4FT8A 1XGNA 4KIGA 5D6FA 2VT3A 5ICCA 4A2UA 2FE3A 3REOA 5KVRA 3TDUC 4RB1A 5CVJA 5LHIA 3IWFA 1P4AA 5LGUA 4A6EA 4BHCA 4U0VA 2QM3A 4KMFA 2QVOA 4LLGF 4ON0A 4YIIA 3Q5FA 5HDNA 5DCMB 4HLXA 1F9NA 4M9XA 4GYGA 2BGCA 2CGPA 3V8KA 3DPLC 3GXOA 2XGXA 1FNNA 2FNPA 4OOIA 4KA4A 5HOOA 3U2RA 2MLKA 2G7UA 4BQAA 1ULYA 1HBXG 3SFZA 3HSRA 1R58A 2PQ8A 1YW8A 1IAWA 3KEOA 4OINF 1TQPA 4YFXF 5LLQA 2EWNA 2HGCA 4ZYHA 1HKSA 1MKMA 5HDKA 2E1CA 4WXHA 5D4SA 2IVMA 1QBJA 3HRUA 1SD4A 5ILUA 1E2XA 5K5OA 2GXGA 3QRFF 2W85A 2MA3A 3K1NA 1IZ1A 1H9TA 4NHJA 4IXAA 1G6NA 4LLNA 2WTEA 3GFLA 1Q1HA 3P9KA 4LG0B 2KJBA 3HYIA 1T39A 3F22A 2PJPA 1KYWA 5ILVA 1H9GA 3HRMA 1XSXA 1H0MA 1OYIA 1KA8A 5JVTA 2E1NA 1FP1D 1D8JA 3ELKA 3LWFA 1S7AA 4BHPA 4RGXA 1L3LA 1P2FA 1XGOA 1Z91A 4MEXF 5BOXA 2HKOA 1YW7A 2CWEA 5JR3A 2OZ6A 2XUBA 4AWXB 2XKPA 1W7PA 1W4MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NQO A;  2H6C A;  2Q0O A;  5IT3 A;  3ZMT A;  1J75 A;  1ZG1 A;  1P92 A;  4G9Y A;  3TOA A;  3GFJ A;  1U3E M;  3WTX C;  2OD5 A;  4I0A A;  4CDG A;  5JFR A;  3DFG A;  1XDU A;  4GCV A;  3VOE A;  5BPI A;  1XSD A;  3T5X A;  5BQT A;  4QWQ A;  2NNY A;  2OQG A;  3QAH A;  4JBA A;  3K2Z A;  3I0T A;  3R60 A;  5D5V B;  2K86 A;  2HEO A;  2F5D A;  1STZ A;  2PMU A;  5AIP A;  4HDV A;  5LGN A;  4HV6 A;  4UV8 A;  4Q5S F;  2EK5 A;  3U1D A;  3HIF A;  1SFE A;  2FU4 A;  2RC4 A;  1EH8 A;  3HOT A;  5J6X A;  2LF7 A;  2Z5U A;  4E70 A;  5D6E A;  4Z2Y A;  3WGG A;  5FFZ A;  2Z33 A;  1XCV A;  2IA1 A;  4RGU A;  1E17 A;  2CFX A;  2R7F A;  1YW9 A;  4IPA A;  4G6Q A;  1ON2 A;  3JTG A;  4MTD A;  3CO6 C;  3T1B A;  3KP3 A;  2XV4 S;  2RNJ A;  4I01 A;  1LDD A;  1IXS B;  2FRH A;  4ZZD A;  2F5F A;  4A0Y A;  1ZGJ A;  1J9I A;  3OV8 A;  2XAJ A;  2FNA A;  5BPD A;  4MGR A;  1HW1 A;  5CVI A;  1ZRD A;  2YR2 A;  4Q4Z F;  1GXP A;  2XAQ A;  3QOP A;  3RKX A;  2V1U A;  1Z1D A;  2C6Y A;  1SD7 A;  5L3F A;  3IRR A;  1J2X A;  3MCZ A;  4CZZ A;  3WOD F;  3FZV A;  5E1W A;  5HS7 A;  1XGS A;  4RAY A;  3WU1 B;  1LB2 A;  1W5T A;  2HZT A;  4U0W A;  3WTV C;  2QUF A;  4GGG A;  2HOE A;  3RTR A;  2PMH A;  4Y13 A;  5A2Q K;  1O3R A;  3VOD A;  1ODD A;  1SMT A;  5D5U B;  2EFO A;  4HX8 A;  3V7C A;  4MQ9 F;  3H3U A;  1SFU A;  1R1U A;  5KK1 A;  3ECH A;  1MD0 A;  3NEU A;  4OIP F;  2ETH A;  1ZLJ A;  5IT9 Z;  1LJ9 A;  3E5X A;  3LAP A;  3WGH A;  2V79 A;  3M8E A;  2KIM A;  3PQJ A;  1XMA A;  3JSO A;  4G7H F;  5LRR A;  4ZYG A;  4HV5 A;  4U7D A;  4N9H A;  3TDZ C;  3LST A;  3MWM A;  1EH6 A;  4O6J A;  3GZ6 A;  3DP7 A;  3F8C A;  3I54 A;  5AIQ A;  2OU2 A;  4AIH A;  1D3Y A;  1L0O C;  3KLN A;  2MBF A;  1HKT A;  2BBY A;  2VXZ A;  1U78 A;  5F64 A;  2ZME B;  3K1M A;  3ZMV A;  3DKW A;  4LGW A;  2RV8 A;  4HZF A;  4U7B A;  1LDK B;  3H92 A;  2JTV A;  2DPU A;  2IA2 A;  3I71 A;  3LA2 A;  4EM2 A;  1QPM A;  3KZZ A;  2CW0 F;  1TBX A;  1C0W A;  3J81 K;  3KEQ A;  1R23 A;  2UZK A;  1IRG A;  2K02 A;  4OIR F;  3DQV C;  2HFH A;  5ED4 A;  1R1T A;  2RQP A;  1J0R A;  2PI0 A;  3FMS A;  2ZBK A;  4K2E A;  1DPR A;  4YIF A;  1B4A A;  3GEZ A;  1ZAR A;  3WTU C;  3MZH A;  2IP2 A;  3S2W A;  3FXU A;  3R0J A;  4OMY A;  2XAH A;  1FYL A;  3LA3 A;  1KQ9 A;  2P4W A;  3P9I A;  3FMQ A;  1R5H A;  3ZP5 A;  2MH2 A;  4EGY A;  5D8K B;  3GF2 A;  5HLH A;  3BPX A;  2G9W A;  3TKY A;  3HTS B;  1QQI A;  2EFP A;  4UV9 A;  4TV7 A;  2QQB A;  1XMK A;  3QPH A;  3LA7 A;  4FHT A;  1SAX A;  3V8L A;  5LRS A;  2W57 A;  1T0F A;  3TOB A;  5E17 F;  4CHU A;  1YLF A;  4ESJ A;  1IN5 A;  2QBY A;  2DTR A;  5D8L B;  5ICE A;  4Q47 A;  3K0L A;  1B6A A;  4Y15 A;  3HUG A;  2F2E A;  1F1Z A;  3WG9 A;  5JHU A;  4CYD A;  1QO0 D;  1SMY F;  4XBF A;  5BMZ A;  3RI4 A;  1BC8 C;  5LHG A;  2V6C A;  4MHG A;  1I27 A;  3ZMS A;  2HWV A;  1WRJ A;  3TGN A;  1T2K A;  1B9N A;  2FBH A;  3MZY A;  2MH9 A;  2ZFW A;  1HST A;  2MD5 A;  4RB2 C;  1FY7 A;  4PZJ A;  2HTS A;  3RYP A;  1WWX A;  4P5O A;  1KU2 A;  4F7Z A;  2A6E F;  2LNB A;  4EJO A;  1LNW A;  3M9A A;  3ULQ B;  2HYG D;  1S3J A;  5E8G A;  1K78 B;  3I59 A;  5ERI A;  3F6O A;  3GX4 X;  3W6K B;  3IRQ A;  3OOP A;  4AIK A;  4M9S A;  3MFK A;  1SD6 A;  2VOO A;  1P4X A;  1Z6T A;  1J5Y A;  2BEO A;  1TLH B;  2ZJ2 A;  5DDG A;  1UST A;  3ABU A;  4HLY A;  5EEG A;  2DW4 A;  3GLX A;  4KIF A;  2IPQ X;  2LKP A;  3COA C;  3E6D A;  1YS7 A;  3F6V A;  1ZN2 A;  2EV6 A;  3Q9V A;  4ZH4 F;  1T38 A;  1QZZ A;  2FOK A;  5CVU A;  1XD7 A;  5F1R A;  3FXQ A;  1FLI A;  2Q8K A;  4L5I A;  2WC2 A;  3GFI A;  3KET A;  3HHG A;  2NS0 A;  4KUM A;  2UXN A;  4IHT A;  1YQA A;  3O6B B;  4KN4 X;  3JSP A;  4LB5 A;  2V1X A;  3C1D A;  2ZNY A;  2RKH A;  4P55 A;  2CO5 A;  2X4H A;  3NRV A;  3BDD A;  3C18 A;  1ZYR F;  3KFW X;  1FBU A;  4G7O F;  1KQ0 A;  4ENM A;  1G3T A;  2MLG A;  2VON A;  2DT5 A;  4ENK A;  1OKR A;  2DAO A;  3V7S A;  3J80 Z;  2VBX A;  1YIO A;  4BH9 A;  4KFC A;  2W84 A;  2QZ8 A;  2QQ9 A;  2AXL A;  2R7D A;  3C7J A;  3SXY A;  3EYI A;  2FSW A;  2K4J A;  5FD6 A;  1G4D A;  4HYE A;  3R61 A;  3FX3 A;  3CUQ C;  1QGP A;  2EFW A;  4KNY A;  1X3U A;  1I1G A;  3HRS A;  2DK8 A;  5TRD A;  3J80 K;  4D0P A;  1R00 A;  5LEK A;  4EGZ A;  1W7P D;  5FB2 A;  3FHZ A;  1FYK A;  1W7P B;  2L3D A;  1I1S A;  3BZ6 A;  3GYH X;  2NYX A;  2IW5 A;  2A3S A;  2ZNZ A;  1BJA A;  3HSF A;  2P5K A;  3DF8 A;  1MZB A;  1FBS A;  5L3D A;  2VT2 A;  1LDJ A;  5D5X B;  2ESN A;  4KT5 C;  2WWY A;  4HF1 A;  3SQN A;  3ZN0 A;  1KYZ A;  4XLN F;  4EJT A;  3GW2 A;  1UHM A;  4WXC A;  1BIA A;  1JHH A;  5K5R A;  4JQF A;  2UXX A;  1ZLK A;  2PBI A;  1ZAO A;  1IXC A;  1O57 A;  4ETS A;  1FSH A;  1IN7 A;  3BP8 A;  2NRA C;  2D1H A;  5CLS A;  3O2P E;  2HQN A;  1RZ4 A;  5AON A;  2XRN A;  2DFI A;  2P6T A;  3TO9 A;  2L02 A;  1XDS A;  3TQN A;  1I6X A;  3BY6 A;  5A2Q Z;  2EV5 A;  4RB0 A;  1JGS A;  3TO7 A;  2F5C A;  2VOP A;  2FEZ A;  2DPD A;  2Z3Y A;  3WTT C;  4G7Z F;  2Y75 A;  1NHA A;  2XAG A;  3N97 A;  5FGM A;  3E6C C;  3RPQ A;  4CGZ A;  3MAJ A;  3ZMU A;  4I0B A;  3GUD A;  4UXN A;  2M8E A;  2CG4 A;  5CVV A;  3F23 A;  5HVQ C;  4L18 B;  4HQE A;  4HX7 A;  2ADU A;  2EFN A;  2CSO A;  1WSU A;  4U88 A;  3M7G A;  3FWE A;  4HAM A;  3E97 A;  2JSC A;  2KIF A;  2P6S A;  2VOD A;  5DD4 A;  1O3T A;  1BI3 A;  3LQR A;  3BPV A;  4LLL A;  3EET A;  3K69 A;  2QWW A;  4PCQ A;  5ILS A;  5FFX A;  5ICG A;  2E7W A;  1UFM A;  3B73 A;  3PQK A;  2EJR A;  3CJN A;  1BM9 A;  4ESB A;  4HOB A;  2RDP A;  1F5T A;  4FX0 A;  2YX7 A;  5K5Q A;  1RIO H;  1FT9 A;  2ZXJ A;  3R6S A;  4P9F A;  3ERE D;  4L0Y B;  5HS8 A;  2A07 F;  2M87 A;  2ISY A;  2DO7 A;  3I4P A;  4HA8 A;  3BJO A;  1UHW A;  3PFI A;  3H3Z A;  2J5P A;  2R3S A;  2UWM A;  1KU3 A;  3HOS A;  3E5Q A;  3J81 Z;  1AWC A;  3ZPL A;  2CQK A;  2J5O A;  1MDM A;  1KU9 A;  4BHB A;  3IL2 A;  5E1Z B;  4M6Y A;  3M8F A;  1FPQ A;  1W5S A;  6PAX A;  2IRF G;  1TQM A;  1TQI A;  3WTZ A;  3C3W A;  3ROU A;  1FC3 A;  4LK0 F;  4XSX F;  2P7V B;  3K9T A;  1FWZ A;  4AIJ A;  2OZU A;  2PLY A;  4S04 A;  1ZRE A;  2PEX A;  4O5V A;  1ZHF A;  2LDU A;  3JAM K;  2GZW A;  1R1V A;  1ZRF A;  4HBL A;  2EA2 A;  2FA5 A;  2QQA A;  3L00 A;  2AS5 F;  2RVC A;  3QP5 A;  4RGS A;  4IRG A;  3E6M A;  3R4K A;  2QYO A;  4WK8 F;  3B02 A;  2YU3 A;  3IKT A;  4QLC U;  2IA0 A;  1HW5 A;  1ZH5 A;  1WKM A;  3FMR A;  4EMS A;  2JPB A;  2KRF A;  5FLX Z;  1QZY A;  1S8N A;  3ZMZ A;  3KP6 A;  5D4R A;  2HR3 A;  5L3E A;  1U5T A;  4RB3 C;  3QU3 A;  4EV0 A;  5DEQ A;  3KP7 A;  1KU7 A;  2HKX A;  3IHU A;  4HF0 A;  4ASN A;  3E3V A;  3CTA A;  2IT0 A;  1J59 A;  4OU0 A;  4CO8 A;  3ABT A;  2XAS A;  1DDN A;  2DBB A;  2P7C B;  2K4B A;  1K7A A;  1FBQ A;  5FLX K;  2E7X A;  3I58 A;  4HDU A;  1S7O A;  4I7H A;  1D5V A;  4GXO A;  1RNL A;  4BXU A;  1R5G A;  5E8I A;  4EJV A;  3F8B A;  2H09 A;  4P9U A;  2FF4 A;  4HF2 A;  2GA2 A;  1HKQ A;  2IJL A;  2EV0 A;  1CF7 A;  3G73 A;  1TNS A;  4UVB A;  1USS A;  2JPC A;  5LHH A;  3E5U A;  1B1B A;  3R0A A;  3WU0 A;  2FBK A;  3F8N A;  3Q9S A;  1XSV A;  3BRO A;  5JI6 A;  2OQR A;  4A0X A;  1Z7U A;  5CJ9 A;  1S29 A;  5DCM A;  2DU9 A;  5HDG A;  2QBY B;  1YTY A;  2V1D A;  3ISP A;  5E1X A;  5L3G A;  4RGR A;  2ELH A;  5HLG A;  2D2W A;  1U5T C;  3VB2 A;  5TJJ A;  1HQC A;  1TNT A;  1S6L A;  3GVA A;  3F8M A;  4L9N A;  2GAU A;  3WE2 A;  1B59 A;  4GO1 A;  2VE8 A;  2VC0 A;  1IW7 F;  1UCR A;  3JW4 A;  4EVI A;  1ZRC A;  4HX4 A;  1VTN C;  3CO7 C;  3G3Z A;  2EA4 A;  2VBY A;  3HTU A;  3RIR A;  3L7W A;  3RDI A;  2STT A;  2XIG A;  2VBW A;  3VFZ A;  2LSO A;  2TDX A;  1WI9 A;  1OYY A;  2VBZ A;  1IUY A;  4N9I A;  3GZ5 A;  2ZCW A;  2M30 A;  3CUQ A;  3D5L A;  4LG0 A;  1DUX C;  1TW2 A;  3L09 A;  1R36 A;  3AAF A;  4ESF A;  3I59 B;  4S05 A;  3GO5 A;  1B9M A;  3DPT A;  2HTJ A;  3BWG A;  1GHC A;  3BOQ A;  2STW A;  1G3W A;  2DK5 A;  4I2O A;  4L0Z B;  2O8X A;  2H6B A;  1AOY A;  4R8H A;  2M5W A;  4RS8 A;  3I53 A;  2Q2E A;  3SZP A;  2A6H F;  4R79 A;  1Y0U A;  1BI2 A;  3T8R A;  1BI1 A;  3KP5 A;  2EFQ A;  4CXF A;  2A69 F;  1Z05 A;  3IWZ A;  2GIV A;  4PDK A;  4WX9 A;  5DCF A;  1WQ2 A;  1D8K A;  2KJC A;  3GWZ A;  3CUQ B;  2KKO A;  1BOA A;  1P6R A;  3RPU A;  1O7F A;  2FQ3 A;  2QLZ A;  2HYF A;  4M73 A;  2KIU A;  4B8X A;  3U9G A;  4LFU A;  5L3C A;  3D0S A;  1XCB A;  4M74 A;  2K7L A;  2Y0M A;  4ZZL A;  3O3K A;  5FD5 A;  1OPC A;  3QP6 A;  3WTS C;  5CYV A;  1V3F A;  3W6J B;  3ZN1 A;  4L5J A;  5HLI A;  2O3F A;  1I5Z A;  1T6S A;  2GQQ A;  1K79 A;  1MGT A;  2DQL A;  4BAY A;  5DV5 A;  3SZT A;  4CIC A;  1V4R A;  4XSZ F;  1K6O A;  5E18 F;  1DPU A;  2HDC A;  1FSE A;  4HQM A;  3QU6 A;  3DV8 A;  3EDP A;  4KN7 X;  2FML A;  3MEX A;  1IXR C;  4ENJ A;  3MQ0 A;  1BI0 A;  5H6Q A;  3SHF A;  4EM1 A;  3FM3 A;  4UUV A;  1R7J A;  4KDP A;  4WCG A;  2DLL A;  1FYM A;  5HS9 A;  1PP7 U;  3T8T A;  4I09 A;  5L3B A;  1LQ1 A;  1ON1 A;  2FXA A;  3F3X A;  3HRT A;  2FMY A;  3I5U A;  4KIC A;  1T98 A;  4LD5 A;  5CVR A;  3TO6 A;  5E20 A;  2NAZ A;  2Z9O A;  3F72 A;  2VC1 A;  2VN2 A;  1Z9C A;  2NNN A;  1KGS A;  3GFM A;  2BV6 A;  3WE3 A;  2L4A A;  3T0Y A;  2X0L A;  1GXQ A;  2XVC A;  4MEY F;  4R1H A;  4XLP F;  2YSR A;  3HSE A;  1HSJ A;  1FP2 A;  2XRO A;  3RYR A;  2D1V A;  5J8F A;  3E6B A;  2BE5 F;  2CYY A;  4LB6 B;  1FOK A;  4EJU A;  3EUH A;  3K1P A;  3KP4 A;  1RUO A;  4B09 A;  1MJA A;  4GYI A;  4UVC A;  3LAJ A;  1OR7 A;  2RGV A;  4IF4 A;  2JZY A;  5DD8 A;  3V8J A;  2O61 A;  1LEB A;  2A68 F;  2COM A;  4M6X A;  4AD9 A;  4UHT A;  1RUN A;  2H94 A;  4I02 A;  3FF5 A;  5D5W B;  3ML6 A;  2QEN A;  3RKY A;  1MJB A;  1IN8 A;  4OMZ A;  3LFK A;  4ZYE A;  3BJ6 A;  1ONV A;  4O3M A;  4MQV A;  5DYM A;  4BYY A;  2M1B A;  1P4W A;  2GXB A;  1EH7 A;  1OMI A;  1TTY A;  3JTH A;  4EJW A;  4A5N A;  3QPT A;  2EB7 A;  2A61 A;  1G3S A;  3F8F A;  2XAF A;  2D45 A;  5K1Y A;  2P5V A;  4UVA A;  5H20 A;  2P8T A;  3IC7 A;  3RJP A;  4RAZ A;  2P5L C;  4L9T A;  5DUK A;  3RKW A;  2H27 A;  2OA4 A;  1XGM A;  4L9V A;  4G94 A;  1HW2 A;  4JK1 X;  4G8X A;  1G3Y A;  1RI7 A;  4WF2 A;  3V7R A;  4EQQ A;  3I64 A;  2OBP A;  3DXJ F;  1R22 A;  4N0B A;  1YS6 A;  1IN4 A;  4LJZ F;  4NQW A;  5LBQ A;  2O6G E;  5EEH A;  3KE2 A;  4G6D A;  2YPR A;  1JE8 A;  4LMY A;  1SD5 A;  1BBY A;  2FBI A;  1F4K A;  2GA1 A;  3KCC A;  2L4M A;  4M72 A;  3WGI A;  4EM0 B;  4UNO A;  2L54 A;  2ZME A;  1SFX A;  4U0Y A;  1FX7 A;  2W25 A;  1J7K A;  3ZMD A;  3CDH A;  3JAM Z;  1UB9 A;  5LEJ A;  2K27 A;  4Y17 A;  4LK1 F;  2PN6 A;  3ZQ7 A;  1U6G A;  5ICF A;  4IVN A;  1O7L A;  1LEA A;  5IT9 K;  4KMU X;  2LF8 A;  2B0L A;  1O3Q A;  1ZG5 A;  2PFB A;  4IHS A;  1TW3 A;  2Y48 A;  5BS6 A;  5FO5 A;  1GVJ A;  1DP7 P;  3KLO A;  3L9F A;  4M9Z A;  1ZG3 A;  4A0Z A;  4PGG A;  2OAZ A;  4AVP A;  1U8R A;  1MDM B;  2MC3 A;  5H6R A;  4IJA A;  2O03 A;  4DNC A;  3M1E A;  3CLO A;  2L01 A;  1YFH A;  1JHF A;  2ACJ A;  2XHK A;  4Q48 A;  4A5M A;  4PGH A;  3CUO A;  2WV0 A;  4L9J A;  1CGP A;  4H0E A;  2JRT A;  4A6D A;  3P9C A;  5F6F A;  5J8C A;  4YFK F;  1YO5 C;  1JXS A;  5LGT A;  2RN7 A;  2A5Y B;  3DEU A;  4WXD A;  1PDN C;  4P96 A;  1IF1 A;  2ZO4 A;  3P7N A;  3L2C A;  3BJA A;  1YG2 A;  3J7A O;  1LVA A;  3ECO A;  1ZGA A;  3EYY A;  1BC7 C;  1MJ9 A;  1A04 A;  4NB5 A;  2ESH A;  1XN7 A;  3V4G A;  1REP C;  2W24 A;  3HHH A;  4ENN A;  1BIB A;  1OYW A;  1PP8 F;  1PUE E;  3LQQ A;  1KQ8 A;  2ISZ A;  1HXD A;  3FM5 A;  4XRF A;  2HS5 A;  4MNU A;  2V9V A;  5DUI A;  2VE9 A;  1IRF A;  1U5T B;  1BN5 A;  4HW0 A;  2O0Y A;  4WWC A;  4OIO F;  4KYW A;  3FXR A;  1EV7 A;  2YX4 A;  4IRH A;  4BNC A;  3VEP A;  4OIQ F;  1U2W A;  3F21 A;  3IKV A;  2JT1 A;  4FX4 A;  4ZYD A;  4KIB A;  3N4M A;  3KP2 A;  2ZKZ A;  4DQ2 A;  2F5E A;  2PG4 A;  2Z99 A;  1O3S A;  4IRI A;  3WTY C;  4I98 B;  3WTW C;  2DQR A;  1XB4 A;  2M45 A;  1YYV A;  3EQL F;  1QNT A;  2HQR A;  1IN6 A;  2BYV E;  2XKO A;  4MTE A;  4YG2 F;  4A12 A;  4YFN F;  2DI3 A;  2GWR A;  1Z6R A;  3KZY A;  1K78 A;  1FZP B;  1CF7 B;  2G7H A;  4M71 A;  4FT8 A;  1XGN A;  4KIG A;  5D6F A;  2VT3 A;  5ICC A;  4A2U A;  2FE3 A;  3REO A;  5KVR A;  3TDU C;  4RB1 A;  5CVJ A;  5LHI A;  3IWF A;  1P4A A;  5LGU A;  4A6E A;  4BHC A;  4U0V A;  2QM3 A;  4KMF A;  2QVO A;  4LLG F;  4ON0 A;  4YII A;  3Q5F A;  5HDN A;  5DCM B;  4HLX A;  1F9N A;  4M9X A;  4GYG A;  2BGC A;  2CGP A;  3V8K A;  3DPL C;  3GXO A;  2XGX A;  1FNN A;  2FNP A;  4OOI A;  4KA4 A;  5HOO A;  3U2R A;  2MLK A;  2G7U A;  4BQA A;  1ULY A;  1HBX G;  3SFZ A;  3HSR A;  1R58 A;  2PQ8 A;  1YW8 A;  1IAW A;  3KEO A;  4OIN F;  1TQP A;  4YFX F;  5LLQ A;  2EWN A;  2HGC A;  4ZYH A;  1HKS A;  1MKM A;  5HDK A;  2E1C A;  4WXH A;  5D4S A;  2IVM A;  1QBJ A;  3HRU A;  1SD4 A;  5ILU A;  1E2X A;  5K5O A;  2GXG A;  3QRF F;  2W85 A;  2MA3 A;  3K1N A;  1IZ1 A;  1H9T A;  4NHJ A;  4IXA A;  1G6N A;  4LLN A;  2WTE A;  3GFL A;  1Q1H A;  3P9K A;  4LG0 B;  2KJB A;  3HYI A;  1T39 A;  3F22 A;  2PJP A;  1KYW A;  5ILV A;  1H9G A;  3HRM A;  1XSX A;  1H0M A;  1OYI A;  1KA8 A;  5JVT A;  2E1N A;  1FP1 D;  1D8J A;  3ELK A;  3LWF A;  1S7A A;  4BHP A;  4RGX A;  1L3L A;  1P2F A;  1XGO A;  1Z91 A;  4MEX F;  5BOX A;  2HKO A;  1YW7 A;  2CWE A;  5JR3 A;  2OZ6 A;  2XUB A;  4AWX B;  2XKP A;  1W7P A;  1W4M A; 
#chains in the Genus database with same CATH topology
 1VQO I;  2JVG A;  1UMQ A;  4A3M J;  3NQO A;  2H6C A;  2Q0O A;  1YE9 A;  2IBD A;  5IT3 A;  3ZMT A;  1J75 A;  1R5I D;  1ZG1 A;  1P92 A;  1WVR A;  3SZG A;  4MFE A;  4G9Y A;  3TOA A;  3GFJ A;  1U3E M;  4JP0 A;  4A3K J;  3WTX C;  2GXA A;  2I8D A;  2OD5 A;  4I0A A;  4CDG A;  2NS8 A;  5JFR A;  3DFG A;  1XDU A;  3QPL A;  2M0M A;  1X1A A;  3H5A A;  2IS1 A;  4GCV A;  4XRS A;  3VOE A;  2K85 A;  5BPI A;  1F36 A;  4E7S A;  1XSD A;  5GTH C;  3T5X A;  5BQT A;  3JRA A;  4QWQ A;  2NNY A;  2OQG A;  5FRN A;  2BVL A;  3QAH A;  3SFI A;  1VQ6 I;  4JBA A;  3A03 A;  2CU7 A;  1SAN A;  2DJI A;  3K2Z A;  4Z6Y A;  3K70 C;  1T8I A;  4H4K C;  3CCU I;  3I0T A;  3R60 A;  3HM5 A;  3JRI A;  3S1R J;  5D5V B;  2K86 A;  1AKH A;  2HEO A;  2XPW A;  2F5D A;  3FHN A;  1STZ A;  1IGN A;  2PMU A;  5AIP A;  4HDV A;  4JYK A;  5LGN A;  2LYC A;  1RC9 A;  2DFE A;  4HV6 A;  4UV8 A;  1W36 C;  4MLO A;  2EK5 A;  4Q5S F;  4NBQ A;  3U1D A;  3HIF A;  1SFE A;  2FU4 A;  2RC4 A;  4D5F A;  1RRJ A;  2KFD A;  2JA5 J;  2X9D A;  1T08 B;  5GAE J;  3LSJ A;  2R4G A;  1EH8 A;  1ORK A;  3QWL A;  4CA0 A;  3HOT A;  5J6X A;  4BEH A;  2LF7 A;  2Z5U A;  4E70 A;  2HI3 A;  5D6E A;  4Z2Y A;  2LBF A;  3WGG A;  2LRD A;  5FFZ A;  5GPA A;  4NC8 A;  3JRG A;  2Z33 A;  1XCV A;  2IA1 A;  2Z2S B;  4RGU A;  1E17 A;  2CFX A;  2VPL A;  3FXJ A;  1HC8 A;  1D0X A;  2R7F A;  4KIS A;  1YW9 A;  4IPA A;  4G6Q A;  2DA3 A;  4FE7 A;  1JKO C;  1ON2 A;  3CCY A;  3JTG A;  3GTK J;  4MTD A;  1AKH B;  3CO6 C;  5EGO A;  3GBG A;  3DU6 A;  4HG2 A;  4D7N A;  3HL2 A;  1MW7 A;  3T1B A;  2OCC H;  5J4V A;  3KP3 A;  3CC7 I;  2ICW G;  2XV4 S;  2RNJ A;  4I01 A;  1LDD A;  1P7J A;  5LD2 C;  4A3F J;  1IXS B;  2FRH A;  2M7B A;  2KIS A;  2F5F A;  4A0Y A;  4ZZD A;  4HNT A;  1ZGJ A;  1J9I A;  3OV8 A;  2VQH A;  3KIO A;  2XAJ A;  2FNA A;  5BPD A;  4MGR A;  1HW1 A;  3FKI J;  2R7Z J;  2BY1 A;  5CVI A;  1R49 A;  3BR3 A;  4C2M J;  2WY8 Q;  3KZI C;  5GAH J;  2EPF A;  5HOD A;  4A3J J;  1ZRD A;  3GCM A;  3C2B A;  2YR2 A;  4Q4Z F;  1GXP A;  2XAQ A;  3QOP A;  3RKX A;  2V1U A;  2ZSI B;  5GAD J;  3W2W A;  1OCZ H;  3PIP F;  1WJC A;  2OUM A;  1Z1D A;  2C6Y A;  1OQY A;  1SD7 A;  2IGK A;  5L3F A;  3IRR A;  1J2X A;  4C30 A;  3BLY A;  3MCZ A;  4CZZ A;  2LK2 A;  3WOD F;  3FZV A;  5E1W A;  5EG0 B;  1LVK A;  5HS7 A;  1N78 A;  1VND A;  1XGS A;  3ZQL A;  4RAY A;  2VJ5 A;  3WU1 B;  3OSF A;  1LB2 A;  1W5T A;  2HZT A;  3CCQ I;  3J7A Y;  4U0W A;  3WTV C;  2QUF A;  4GGG A;  1TWA J;  2E5N A;  2HOE A;  2GLO A;  3RTR A;  5F0F A;  2EIM H;  2BW3 B;  1D1A A;  2PMH A;  4CZC A;  1HCR A;  5TGT A;  3ABM H;  2JUC A;  2R5Z A;  4Y13 A;  2IXS A;  5A2Q K;  4IL6 C;  1O3R A;  2HDD A;  3D1N I;  3VOD A;  4A3L J;  1ODD A;  4RMN A;  1SMT A;  5D5U B;  2EFO A;  4A3B J;  4Y7N J;  4HX8 A;  3V7C A;  4MQ9 F;  3H3U A;  1SFU A;  1IDZ A;  4AYB N;  2E2J J;  1R1U A;  5KK1 A;  2XPV A;  2K5C A;  3ECH A;  3KYC B;  1MD0 A;  3GTL J;  3NEU A;  3PNT A;  4OIP F;  1LPQ A;  2JA8 J;  2OF7 A;  2ETH A;  1R6R A;  4XID A;  4IQ4 A;  1ZLJ A;  3FK7 A;  5IT9 Z;  3CMA I;  4BJ5 C;  1LJ9 A;  3JRH A;  2W4S A;  3E5X A;  5LFA A;  2DA5 A;  2K9L A;  3LAP A;  4RA2 A;  3WGH A;  1T95 A;  1W0U A;  1TL8 A;  3OR2 C;  2V79 A;  3M8E A;  2KIM A;  3PQJ A;  3BR0 A;  1XMA A;  2XB5 A;  3K4K A;  3JSO A;  1QZE A;  4G7H F;  4BE2 A;  2ZB9 A;  4JX5 A;  4KIT B;  4MIM A;  5LRR A;  4ZYG A;  3IH2 A;  4HV5 A;  4U7D A;  4N9H A;  2H8R A;  3TDZ C;  3LST A;  1A35 A;  3MWM A;  1EH6 A;  4NQW B;  4O6J A;  3HOU J;  4HPQ A;  3GZ6 A;  2ZXI A;  2JA7 J;  2ZXW H;  4B4C A;  1HLV A;  3DP7 A;  1HA8 A;  3F8C A;  3I54 A;  2DOE A;  5AIQ A;  1DU6 A;  2OU2 A;  1BW5 A;  1MNE A;  2L7F P;  4AIH A;  1D3Y A;  2LY2 A;  4JX6 A;  4LIV A;  1L0O C;  3KLN A;  2MBF A;  1SFK A;  1HKT A;  3ZQC A;  2BBY A;  2X51 A;  1JTY A;  2VXZ A;  2R7X A;  1U78 A;  5F64 A;  2ZME B;  3K1M A;  2K9Q A;  4I6Z A;  3ZMV A;  4AUX A;  3DKW A;  3ZRG A;  1FOX A;  5FKL A;  4LGW A;  1WGX A;  2RV8 A;  4HZF A;  4U7B A;  1LDK B;  1MIJ A;  3H92 A;  2JTV A;  2DPU A;  2P0W A;  2IA2 A;  3I71 A;  2LR8 A;  3NWS A;  2E2I J;  2M4G A;  2VAS A;  4YEJ A;  2F4M B;  3LA2 A;  4EM2 A;  2WAF A;  1QPM A;  2VQL A;  3KZZ A;  3ASO H;  5EZH A;  3HPG A;  2CW0 F;  1TBX A;  1GV2 A;  3DCF A;  1C0W A;  3J81 K;  3KEQ A;  2AQF A;  3NAR A;  1R23 A;  1MBE A;  2UZK A;  4RM3 A;  1J09 A;  1X4P A;  4I99 C;  4BKX A;  4IOA F;  1IRG A;  1ITY A;  2K02 A;  5CQE A;  3DQV C;  4OIR F;  2HFH A;  5F27 A;  5ED4 A;  3DKX A;  5JHF A;  2ZJP F;  1RKT A;  1R1T A;  2RQP A;  1TWF J;  2LP0 A;  2XF5 A;  1ZGW A;  3IUO A;  1J0R A;  2DMQ A;  3TMO A;  2PI0 A;  3FMS A;  2ZBK A;  4K2E A;  1DPR A;  4YIF A;  1B4A A;  1YIJ I;  1MMG A;  2H1L A;  2QCO A;  3GEZ A;  2W00 A;  1ZAR A;  3WTU C;  4HSR A;  3MZH A;  4IHX A;  1MMS A;  3HZJ A;  4BBR J;  2IP2 A;  3S2W A;  4A3C J;  3FXU A;  3L2Q A;  3OYH A;  5K7H A;  3R0J A;  3LSI A;  4ZDL A;  4OMY A;  2XAH A;  1FYL A;  3LA3 A;  1T56 A;  1KQ9 A;  2P4W A;  3P9I A;  3FMQ A;  3OYE A;  1R5H A;  3BTL A;  3A01 A;  3ZP5 A;  4B3A A;  3O8H A;  2MH2 A;  2ELK A;  3GTP J;  2BY2 A;  5FKN A;  4EGY A;  2R93 J;  5D8K B;  3GF2 A;  5HLH A;  3BPX A;  2KPM A;  3S1M J;  2G9W A;  4FCY A;  1MH4 A;  3TKY A;  1I39 A;  3HTS B;  1QQI A;  2VQC A;  3BQY A;  3LSH A;  2DDA A;  4XKW A;  3BQZ A;  2EFP A;  1JT0 A;  1Y39 A;  1P9Q C;  2QEX I;  4BDY A;  4UV9 A;  4TV7 A;  2AXT C;  2WAQ A;  2QQB A;  2LH9 A;  1XMK A;  1GDT A;  3QPH A;  2GOM A;  5J47 A;  2CUJ A;  2JUG A;  3LA7 A;  4FHT A;  4MFD A;  3SEZ A;  1SAX A;  1R71 A;  3V8L A;  5LRS A;  2W57 A;  3G2B A;  1QPI A;  4BQN A;  1T0F A;  3TOB A;  3LL7 A;  3LSM A;  1UZC A;  3AL0 B;  1FMV A;  5E17 F;  2NOG A;  4MO7 A;  4XL9 A;  4CHU A;  1YLF A;  4ESJ A;  1IN5 A;  2QBY A;  2KDZ A;  2QQ8 A;  4AM3 A;  2DTR A;  3PSF A;  5D8L B;  5ICE A;  1JGG A;  4Q47 A;  1DGW Y;  2QKL B;  4XN0 A;  4M3D A;  3K0L A;  1B6A A;  3ZR8 X;  3DLL F;  4Y15 A;  3S1N J;  2MFZ A;  3HUG A;  1ZK8 A;  3WHB A;  2F2E A;  1F1Z A;  3WG9 A;  5JHU A;  5FLM J;  2M3A A;  3OYN A;  4CYD A;  4AU7 A;  3PM1 A;  1QO0 D;  5K7Z A;  1U9O A;  3K4J A;  3I4M J;  3W3C A;  1SMY F;  1NG7 A;  4IKF A;  4XBF A;  4UUS A;  2EIN H;  5BMZ A;  2VJI A;  3RI4 A;  1BC8 C;  5LHG A;  3M4O J;  2V6C A;  2V1N A;  4MHG A;  4E7J A;  1I27 A;  3CLQ A;  3DBR B;  3D5S C;  3ZMS A;  2HWV A;  1SVM A;  1QRY A;  4L5E A;  5HLT A;  2L5Q A;  2RRE A;  1WRJ A;  3TGN A;  1T2K A;  2DA4 A;  1B9N A;  1Z7L A;  2FBH A;  2DOA A;  1MMD A;  2ELJ A;  3MZY A;  2MH9 A;  1GT0 C;  2ZFW A;  1HST A;  2MD5 A;  3ZGK A;  5IP9 J;  4RB2 C;  4A3E J;  1FY7 A;  3LSP A;  4PZJ A;  2HTS A;  3RYP A;  1B72 A;  3KEY A;  3M07 A;  2MW8 A;  1R9T J;  1Z3Y A;  1GLN A;  2WB1 A;  5BNG A;  1G59 A;  2DFF A;  1FOW A;  1WWX A;  3ABK H;  3MN2 A;  4XLF A;  4V2F A;  2L7M P;  4P5O A;  3S93 A;  3OR1 C;  1KU2 A;  4F7Z A;  2A6E F;  2LNB A;  2QGU A;  2TCT A;  1U0J A;  4EJO A;  1LNW A;  1QVT A;  1X4O A;  3M9A A;  3ULQ B;  2HYG D;  1S3J A;  1E3H A;  3H1C A;  5CQG A;  5E8G A;  1NH3 A;  2GOX B;  4B48 A;  5E3O A;  3L2R A;  1RET A;  1K78 B;  2XB0 X;  1B8I A;  3I59 A;  5ERI A;  3F6O A;  1TZL A;  2KRC A;  3GX4 X;  3W6K B;  4V2G A;  3IRQ A;  3CCJ I;  4ZDO A;  3OOP A;  4AIK A;  4M9S A;  3MFK A;  3G71 I;  1SD6 A;  3PUB A;  1OFC X;  2VOO A;  1P4X A;  1Z6T A;  4CYC A;  1J5Y A;  2BEO A;  1TLH B;  5EDN A;  1B72 B;  1T0F C;  1DU0 A;  5EJC A;  2E36 A;  2ZJ2 A;  5DDG A;  1UST A;  3ABU A;  2X1D A;  4HLY A;  5EEG A;  2DW4 A;  3GLX A;  2RAE A;  5FLV A;  4KIF A;  2IPQ X;  3OS0 A;  2NVX J;  2LKP A;  2LD5 A;  4S0H B;  1ETK A;  1LE8 B;  3LOC A;  3COA C;  3A4C A;  3E6D A;  5E3L A;  1YS7 A;  1IJW C;  3OWT A;  3F6V A;  1ZN2 A;  2EV6 A;  3OMY A;  3CCL I;  3Q9V A;  3TBI A;  3BTJ A;  4ZH4 F;  4C2U A;  1T38 A;  1XTA A;  1SVL A;  2VQG A;  3QYE A;  1I50 J;  1QZZ A;  1X3Z B;  3PO3 J;  1IV8 A;  2FOK A;  5CVU A;  3I55 I;  1XD7 A;  5F1R A;  4RLF A;  2E71 A;  3FXQ A;  2X48 A;  2Y9Z A;  3E1S A;  1FLI A;  3HBL A;  5TIS C;  2Q8K A;  4L5I A;  2XPU A;  2WC2 A;  3CZ6 A;  1MND A;  2QSG X;  3GFI A;  3MZ8 A;  3KET A;  3HHG A;  2NS0 A;  2N8G A;  3CMY A;  4J01 A;  2BHZ A;  4D7M A;  4KUM A;  1VQ7 I;  4CCJ A;  2BOL A;  1X1P A;  2K40 A;  2UXN A;  4QSH A;  2M2E A;  1YQA A;  4IHT A;  3O6B B;  4KN4 X;  2M7A A;  4J19 A;  3LMM A;  2CW7 A;  4DYC A;  1EF4 A;  2CUZ A;  3JSP A;  2ZC2 A;  4G6T B;  5E3N A;  3DWL E;  4LB5 A;  2V1X A;  4DZJ A;  3C1D A;  2ZNY A;  2RKH A;  4P55 A;  2CO5 A;  2MD0 A;  2X4H A;  3NRV A;  1KZH A;  3BDD A;  3C18 A;  1ZYR F;  4HEA 2;  2JVH A;  3KFW X;  1FBU A;  3RZD J;  2EQR A;  4G7O F;  4B43 A;  2PMZ A;  2MYS A;  1KQ0 A;  2UUZ A;  1E3O C;  4ENM A;  1W5C C;  1G3T A;  2OPT A;  3A2K A;  1ZKG A;  2ME0 A;  2MLG A;  1AU7 A;  2VON A;  1R4M B;  2DT5 A;  2E1M C;  4ENK A;  4XOR A;  1SFO J;  3RPU D;  2WAE A;  3OL3 A;  4X6A J;  2LTP A;  1OKR A;  2DAO A;  3V7S A;  3J80 Z;  3CCV I;  4C3I J;  2BXZ A;  5FRO A;  3LSK A;  2VBX A;  1RR7 A;  1YIO A;  1ERD A;  3PL8 A;  4BH9 A;  3RQI A;  4KFC A;  2W84 A;  2QZ8 A;  2QQ9 A;  2AXL A;  3MD2 A;  2R7D A;  3C7J A;  3SXY A;  1PUF B;  3I56 I;  3EYI A;  2FSW A;  2K4J A;  5FD6 A;  2COB A;  1G4D A;  1BR2 A;  2KRH A;  4HYE A;  3R61 A;  3FX3 A;  3CUQ C;  1QGP A;  2E35 A;  1HF0 A;  2EFW A;  4KNY A;  1X3U A;  4XLA A;  1I1G A;  2W7N A;  3HRS A;  2DK8 A;  3OL4 A;  5TRD A;  2HPM A;  3UNG C;  5IY5 H;  4A93 J;  3J80 K;  2EZI A;  2DMP A;  2V26 A;  5KAI C;  4D1Q A;  4D0P A;  1RR8 C;  2V9P A;  3CCR I;  1R00 A;  2A5W A;  3JRF A;  1APL C;  3HGY A;  5LEK A;  3ERM A;  4EGZ A;  1T33 A;  1W7P D;  2BVM A;  3M1C A;  2YS9 A;  1TT0 A;  3ZOB A;  5FB2 A;  4QTR A;  1WH5 A;  3FHZ A;  1W7P B;  1FYK A;  2KQR A;  2L3D A;  4M3E A;  1I1S A;  1ZTR A;  3BZ6 A;  3GYH X;  2NYX A;  2IW5 A;  2A3S A;  2ZNZ A;  1UG2 A;  1BJA A;  1JT6 A;  3HSF A;  2P5K A;  4PK4 A;  3DF8 A;  1MZB A;  3FK6 A;  2GM4 A;  1FBS A;  3GZN B;  3VSL A;  3MKL A;  5L3D A;  1VQL I;  2VT2 A;  1LDJ A;  5D5X B;  2ESN A;  4KT5 C;  2JQ7 A;  2WWY A;  2XGD A;  4HF1 A;  3SQN A;  3ZN0 A;  1KYZ A;  1POG A;  4XLN F;  4EJT A;  2HXI A;  3GW2 A;  1UHM A;  3K4B A;  3IH3 A;  1XC5 A;  4WXC A;  1BIA A;  3S3N A;  4BL0 B;  1JHH A;  5K5R A;  1E3P A;  3L1P A;  4JQF A;  2M4K A;  2UXX A;  1ZLK A;  2PBI A;  1ZAO A;  3H3V K;  1IXC A;  4IHY A;  1O57 A;  1X1B A;  3CMM A;  3ZQH A;  3QOE A;  4ETS A;  3DBH B;  3L2U A;  3FXO A;  4PSW A;  4FTH A;  1FSH A;  1IN7 A;  3CP2 A;  3BP8 A;  5EYR A;  4DJA A;  4DOZ A;  4E4H A;  2NRA C;  3OYC A;  2D1H A;  2FQ4 A;  2WV1 A;  5CLS A;  3H9G A;  4CUG A;  3O2P E;  4B47 A;  2HQN A;  1RZ4 A;  2XRN A;  2DFI A;  2P6T A;  5AON A;  3TO9 A;  2L02 A;  2KZV A;  5IP7 J;  2PJR A;  1XDS A;  2LOO A;  3TQN A;  1I6X A;  2MGQ A;  3BY6 A;  1MMN A;  4BEH B;  5A2Q Z;  3A1Y A;  2EV5 A;  4RB0 A;  1JGS A;  3TO7 A;  2F5C A;  5C4J J;  2VOP A;  2LBF B;  2FEZ A;  2DPD A;  3BTC A;  2Z3Y A;  3WTT C;  4G7Z F;  2BY3 A;  1A6I A;  4PJM A;  2Y75 A;  1NHA A;  4II2 A;  1YX5 A;  2XAG A;  3GTO J;  3N97 A;  4A3I J;  2IGN A;  5FGM A;  3E6C C;  5EGO B;  3RPQ A;  2VI6 A;  4CGZ A;  4QPO A;  3MAJ A;  3ZMU A;  2M8G X;  2B9S A;  3A0H C;  4I0B A;  3GUD A;  3A02 A;  2Y31 A;  2NOJ B;  1D5Y A;  2IAI A;  4UXN A;  1W1W E;  2LLK A;  2CG4 A;  2M8E A;  3BG7 A;  4RAG A;  5CVV A;  3F23 A;  5HVQ C;  4L18 B;  4KT6 A;  4HQE A;  4HX7 A;  2ADU A;  2EFN A;  2PJR B;  2CSO A;  1WSU A;  4U88 A;  3M7G A;  3FWE A;  4HAM A;  3S17 J;  2CV2 A;  3E97 A;  3OYD A;  2JSC A;  2KIF A;  1N75 A;  2P6S A;  3O8G A;  2VOD A;  5DD4 A;  1O3T A;  1BI3 A;  2HYJ A;  3LQR A;  3BPV A;  4F92 B;  2DA6 A;  4LLL A;  3EET A;  1HDD C;  3K69 A;  2QWW A;  2A05 A;  2I5U A;  4FIS A;  2Y9Y A;  4PCQ A;  5FFX A;  5ILS A;  5ICG A;  2E7W A;  1WCM J;  1Y1W J;  2DN0 A;  1UFM A;  3B73 A;  1A36 A;  2R7O A;  2ZXH A;  3PQK A;  2EJR A;  5IPA A;  3SEQ A;  1TC3 C;  3S1Q J;  1MBK A;  2DOF A;  3H0D A;  4ABZ A;  4ZYA A;  3CJN A;  2XSJ C;  4IQJ A;  1BM9 A;  4ESB A;  1PYV A;  3OOU A;  1VF9 A;  4RM2 A;  3EUH C;  2X85 A;  4HOB A;  2RDP A;  2KZG A;  1F5T A;  4FX0 A;  3RKQ A;  2YX7 A;  1MBJ A;  4E7I A;  2IGM A;  5K5Q A;  1RIO H;  1FT9 A;  2R5Z B;  2ZXJ A;  3R6S A;  1JUP A;  5KNL A;  1OR7 C;  2K9S A;  3AG2 H;  2XSD C;  1HDP A;  4P9F A;  3ERE D;  3H9Q A;  1Q1V A;  2ZFU A;  4L0Y B;  5HS8 A;  2A07 F;  1TWC J;  4RDU A;  3IH4 A;  1D0Y A;  2M87 A;  2ISY A;  2DO7 A;  4PSX A;  3I4P A;  4HA8 A;  3BJO A;  1UHW A;  1VI0 A;  3ESW B;  3PFI A;  5GP9 A;  3H3Z A;  5F04 A;  2J5P A;  2R3S A;  1JKR C;  1PVE A;  2UWM A;  2FOW A;  1BA5 A;  1KU3 A;  2WA0 A;  1ACI A;  3HOS A;  3E5Q A;  3OIQ A;  2DFH A;  3J81 Z;  3L2W A;  2DMN A;  1AWC A;  3VDX A;  3ZPL A;  2CQK A;  2J5O A;  4A69 C;  1MDM A;  2VUM J;  1KU9 A;  4BHB A;  5B3S H;  3IL2 A;  1I3A A;  2EZH A;  2YUS A;  4M6Y A;  5E1Z B;  3M8F A;  3DTE A;  1FPQ A;  2XC7 A;  3CF5 F;  1W5S A;  6PAX A;  2IS2 A;  1YJ9 I;  2IRF G;  1TQM A;  3JRB A;  1TQI A;  3WTZ A;  1U9N A;  3C3W A;  2ID6 A;  1WJD A;  4C3H J;  5DS9 A;  3ROU A;  1FC3 A;  1V5F A;  4LK0 F;  3QPS A;  4XSX F;  2E34 A;  2HVR A;  2JA2 A;  2L9R A;  2LC2 A;  2P7V B;  3K9T A;  2E19 A;  2QKM B;  1VQ8 I;  3H5R A;  1WI3 A;  1FWZ A;  3ZQG A;  4A3D J;  2V9K A;  4AIJ A;  4NDL A;  1JI8 A;  5EEA A;  2OZU A;  2PLY A;  1NG6 A;  4S04 A;  1VQP I;  1ZRE A;  3V42 A;  4FAS D;  1JKP C;  2PEX A;  4O5V A;  1IV6 A;  1ZHF A;  1FJL A;  2LDU A;  5F1J A;  2R7Q A;  2GZW A;  3JAM K;  1R1V A;  3QYB A;  3D5R C;  1ZRF A;  4HBL A;  2EA2 A;  3F0C A;  2FA5 A;  2QQA A;  3L00 A;  2AS5 F;  3SJM A;  4BY1 J;  2RVC A;  3QP5 A;  4RGS A;  4XLC A;  1N25 A;  2VKV A;  3SDG A;  4ZJZ A;  4IRG A;  4W97 A;  3E6M A;  2WBM A;  3ZQI A;  2QYO A;  3R4K A;  1EJ9 A;  4ANJ A;  1E0E A;  4WK8 F;  3B02 A;  1UHS A;  2YU3 A;  4C3J J;  3ZQF A;  4QLC U;  2IA0 A;  1HW5 A;  3IKT A;  1ZH5 A;  3KPH A;  1V55 H;  1YI2 I;  1WKM A;  3FMR A;  4EMS A;  2JPB A;  2IEK A;  2KRF A;  5FLX Z;  1ZR4 A;  1OCC H;  3DBL B;  1QZY A;  1S8N A;  2O5R A;  3ZMZ A;  2QSH X;  2HDW A;  3KP6 A;  3U21 A;  5D4R A;  5E79 C;  2HR3 A;  1R4N B;  4OAZ A;  5L3E A;  1U5T A;  4RB3 C;  1F43 A;  3QU3 A;  4EV0 A;  5DEQ A;  5M3M J;  3KP7 A;  1KU7 A;  2HKX A;  3IHU A;  4HF0 A;  4ASN A;  3E3V A;  5EF6 A;  3CTA A;  2IT0 A;  1J59 A;  4OU0 A;  5JLX A;  3CC4 I;  4CO8 A;  2ECC A;  3ABT A;  2XAS A;  2CQQ A;  3W2V A;  5KHD A;  1DDN A;  2DBB A;  2P7C B;  2L0K A;  2K4B A;  3MVP A;  1FBQ A;  4XOP A;  1K7A A;  3CD6 I;  2P81 A;  2AHQ A;  2RNG A;  5C4X J;  5FLX K;  3HKZ N;  5JLW A;  4XK4 A;  2E1O A;  2E7X A;  1X58 A;  3I58 A;  4HDU A;  1IRZ A;  1S7O A;  4I7H A;  1IDY A;  1D5V A;  1Y56 A;  4GXO A;  2L9S A;  1K6Y A;  1RNL A;  3G4S I;  5H2F C;  4BXU A;  1R5G A;  4HRI A;  2DA7 A;  2X6O A;  3RQ4 A;  5E8I A;  4EJV A;  3F8B A;  2H09 A;  4P9U A;  2FF4 A;  1GV5 A;  1V5G A;  4B44 A;  4HF2 A;  2GA2 A;  3K4L A;  3HPH A;  1GUU A;  4XLH A;  1HKQ A;  2IJL A;  2EV0 A;  2F4O B;  3A01 B;  2IS6 A;  5FKK A;  1TT5 B;  1YJN I;  5IYD J;  2Y0S N;  1CF7 A;  2K3F A;  3G73 A;  1TNS A;  4UVB A;  3EPZ A;  1USS A;  2JPC A;  5LHH A;  3E5U A;  1B1B A;  1OIS A;  3R0A A;  4QPQ A;  3WU0 A;  5F0C A;  5J3L A;  5F08 A;  2ID3 A;  3I3L A;  2WAQ N;  2WY7 Q;  2FBK A;  3F8N A;  3Q9S A;  4XN3 A;  2X6Y A;  2LRE A;  3RZO J;  4Y33 A;  4IOC F;  1ETY A;  1XSV A;  4E7Z A;  5IOZ A;  3BRO A;  3FBN B;  3OYL A;  2HOA A;  5JI6 A;  1W0T A;  2OQR A;  3BR6 A;  5J1R A;  5K7F A;  1LFP A;  4A0X A;  4XLE A;  3OIO A;  1Z7U A;  5B66 C;  5CJ9 A;  1S29 A;  5DCM A;  3CJR B;  2DU9 A;  4XNF A;  5HDG A;  3TW7 A;  2WAD A;  2QBY B;  2M0C A;  2EIK H;  1YTY A;  1SEU A;  2V1D A;  3ISP A;  5E1X A;  1YRN A;  5L3G A;  3HUG B;  4A3G J;  4RGR A;  3VYR B;  2ELH A;  3M3Y J;  5HLG A;  2D2W A;  1U5T C;  3VB2 A;  2DDB A;  2DOD A;  5DTD A;  2EH3 A;  3HC7 A;  3TP0 A;  5TJJ A;  2E2H J;  1HQC A;  1MBH A;  3CDI A;  1TNT A;  4M6V A;  1S6L A;  4UUS B;  3GVA A;  2CQX A;  3F8M A;  4L9N A;  2GAU A;  3WE2 A;  3PUF A;  1B59 A;  4GO1 A;  1XX5 A;  2VE8 A;  3DLA A;  1FMW A;  1IW7 F;  1UCR A;  2VC0 A;  3B6C A;  3JW4 A;  3AL0 C;  3S8P A;  4EVI A;  3WU2 C;  1ZRC A;  1K4T A;  1VQN I;  4HX4 A;  2NXN B;  4DYR A;  3DU5 A;  4PFO A;  1VTN C;  3CO7 C;  2VLA A;  3G3Z A;  2ZSH B;  3M8J A;  2NVY J;  5M5W J;  2EA4 A;  4ZDP A;  2L2O A;  2VBY A;  4XR6 A;  2LVS A;  4Y4R A;  2W1O A;  1QHH D;  3HTU A;  1TP4 A;  4N4O B;  3S2D J;  3RIR A;  2CRG A;  3L7W A;  1BR4 A;  4PJJ A;  2BHY A;  1WJB A;  3RDI A;  1SC7 A;  2STT A;  2XIG A;  2VBW A;  2R7W A;  2Y69 H;  4NNJ A;  1WJ5 A;  3VFZ A;  2DMU A;  4BJ6 C;  2LSO A;  2TDX A;  2BY0 A;  1WI9 A;  1OYY A;  2VBZ A;  1YHQ I;  3NWT A;  3VPR A;  1IUY A;  4N9I A;  3GZ5 A;  2ZCW A;  4KJZ A;  2M30 A;  3CUQ A;  3D5L A;  1XS9 A;  2VB6 A;  4LG0 A;  1DUX C;  1TW2 A;  2O7O A;  3L09 A;  2KHM A;  1R36 A;  3AAF A;  4ESF A;  4ITV A;  2M9H A;  1B8I B;  3I59 B;  4S05 A;  1WPK A;  3GO5 A;  2E1M B;  1B9M A;  3FIS A;  3DPT A;  3BR5 A;  3Q0W A;  2HTJ A;  3BWG A;  4M3G A;  1GHC A;  2VJ4 A;  3BOQ A;  3EUK L;  2STW A;  1G3W A;  2CJJ A;  2DK5 A;  4I2O A;  4GRI A;  4CYC B;  2HOS A;  4L0Z B;  2E5Z A;  2O8X A;  3TED A;  3CCS I;  2H6B A;  4DBR A;  5J1Y A;  4BBS J;  3BR2 A;  1A6Q A;  1AOY A;  4R8H A;  2M5W A;  3CQZ J;  4RS8 A;  4BAC A;  3I53 A;  2Q2E A;  3SZP A;  2A6H F;  2KT0 A;  4R79 A;  3DTI A;  1Y0U A;  1BI2 A;  3T8R A;  5HNF A;  4RLQ A;  2VIX A;  2VXD A;  1BI1 A;  3KP5 A;  2EFQ A;  4CXF A;  2A69 F;  1Z05 A;  3JRC A;  2VKD A;  2CQN A;  2GIV A;  2B7E A;  3IWZ A;  4PDK A;  4WX9 A;  4F91 B;  1JJ8 C;  4HNU A;  1QA6 A;  1MBG A;  5DCF A;  3GTG J;  1WQ2 A;  4BGD A;  1DGR M;  1IO2 A;  2LMD A;  1D8K A;  2KJC A;  2XAU A;  3GWZ A;  2KL4 A;  3CUQ B;  2KKO A;  1BOA A;  1P6R A;  3RPU A;  3C2H A;  2HVS A;  1O7F A;  2FQ3 A;  2QLZ A;  4LG3 A;  2HYF A;  4M73 A;  4QIW N;  2RQQ A;  4G12 A;  2KIU A;  3CJT B;  4B8X A;  3U9G A;  4CCK A;  1FTT A;  4LFU A;  5L3C A;  3D0S A;  1XCB A;  3FBI B;  4BQQ A;  4M74 A;  2K7L A;  2Y0M A;  1OJL A;  4ZZL A;  3K70 D;  3O3K A;  5FD5 A;  1OPC A;  3QP6 A;  3WTS C;  4II3 A;  5CYV A;  4DIQ A;  1V3F A;  3MMY B;  3W6J B;  3ZN1 A;  3OYM A;  4L5J A;  3BG6 A;  5HLI A;  2CUE A;  4J00 A;  3S16 J;  3GLL A;  4XKV A;  2O3F A;  1I5Z A;  1T6S A;  4PJN A;  4BE1 A;  2R7T A;  1JUM A;  2GQQ A;  1K79 A;  2FJ1 A;  4IEJ A;  1MGT A;  1W36 D;  1O4X A;  2X6X A;  5GAG J;  4PFP A;  2EBI A;  4XRS G;  1X2M A;  2DQL A;  3ABL H;  3PSI A;  4XON A;  5DV5 A;  4BAY A;  3SZT A;  4CIC A;  1V4R A;  4XSZ F;  1K6O A;  5E18 F;  3BG3 A;  3OS1 A;  3P5J A;  1DPU A;  3TL4 X;  2HDC A;  4FQG A;  1FSE A;  2XF6 A;  1EKE A;  4HQM A;  1XMX A;  4IO9 F;  3QU6 A;  3DV8 A;  3EDP A;  4KN7 X;  3BT9 A;  3E7L A;  1S9H A;  2FML A;  3MEX A;  5IYB J;  3LSR A;  1IXR C;  4B3X A;  2L7Z A;  3OS2 A;  4ENJ A;  3MQ0 A;  1V54 H;  1BI0 A;  3AKZ A;  5H6Q A;  3SHF A;  4EM1 A;  5FJ8 J;  3FM3 A;  2CV0 A;  2O9L A;  4UUV A;  1R7J A;  4KDP A;  2L9N A;  4WCG A;  5J1U A;  5C3E J;  2V6E A;  2DLL A;  3HOZ J;  1FYM A;  4IHW A;  1VZ0 A;  1VQ5 I;  5HS9 A;  2KLO A;  2MG4 A;  3FDY A;  1PP7 U;  2DTZ A;  3H5N A;  3T8T A;  2NVQ J;  4I09 A;  5IYC J;  3GME A;  1DQU A;  4DYQ A;  5L3B A;  1LQ1 A;  1ON1 A;  2FXA A;  3F3X A;  3HRT A;  2FMY A;  2HNH A;  3I5U A;  4KIC A;  1T98 A;  2AO9 A;  4LD5 A;  2H8W A;  5CVR A;  3TO6 A;  3VYT B;  4I76 A;  3CC2 I;  5E20 A;  4CCM A;  2NAZ A;  2Z9O A;  3F72 A;  2VC1 A;  3HXL A;  3F9K A;  2VN2 A;  4N4N B;  2CUF A;  4F55 A;  4CSW A;  1Z9C A;  2NNN A;  2E60 A;  1KGS A;  3GFM A;  2BV6 A;  3WE3 A;  1Y8R B;  4B1R A;  2R7V A;  2L4A A;  4YEL A;  3T0Y A;  2X0L A;  3S15 J;  1GXQ A;  2XVC A;  4MEY F;  4R1H A;  2MC4 A;  2M34 A;  1BOB A;  4PUS A;  4XLP F;  2YSR A;  3HSE A;  1X3W B;  1HSJ A;  1FP2 A;  2XRO A;  3RYR A;  4U87 A;  1MH3 A;  2AQE A;  2D1V A;  5J8F A;  3E6B A;  2BE5 F;  2CYY A;  4LB6 B;  3RSN A;  1NK2 P;  1RPW A;  1FOK A;  4EJU A;  3EUH A;  3K1P A;  3KP4 A;  3MKW B;  1RUO A;  1Z21 A;  3LFU A;  1LFB A;  4B09 A;  1KON A;  1MJA A;  4XKC A;  4GYI A;  4UVC A;  1LFU P;  3CME I;  3LAJ A;  1LKX A;  3VWB A;  1G2H A;  3OY9 A;  2Y2Z A;  5FKM A;  2Y30 A;  3OIP A;  1OR7 A;  2RGV A;  4IF4 A;  2JZY A;  4Y3O A;  5DD8 A;  5M5Y J;  1OCO H;  3V8J A;  2O61 A;  3HG9 A;  4ZC3 A;  1LEB A;  2A68 F;  5CKT A;  2COM A;  4PJL A;  1S7E A;  4DBQ A;  4M6X A;  5KCM A;  4AD9 A;  3PO2 J;  1X1C A;  5IOY A;  1RKW A;  5EG0 A;  1ZEL A;  3HGG A;  2HPI A;  4UHT A;  1RUN A;  2H94 A;  3DPU A;  3X2Q H;  1Y6I A;  4I02 A;  2R0Q C;  3FF5 A;  5D5W B;  3ML6 A;  2HQA A;  2QEN A;  4XMY A;  3K4N A;  3MKZ A;  3RKY A;  2BW3 A;  1MJB A;  1AHD P;  1IN8 A;  4OMZ A;  4IHV A;  3WG7 H;  3LFK A;  3IV5 A;  4ZYE A;  3BJ6 A;  1OCT C;  3DTK A;  2R92 J;  1ONV A;  4O3M A;  2BZT A;  4MQV A;  5DYM A;  2LG4 A;  4BYY A;  1VQ9 I;  2ZJQ F;  2UV1 A;  1Y8Q B;  2G0E A;  1P4W A;  1LUJ B;  2M1B A;  2GXB A;  5M5X J;  1EH7 A;  2LKX A;  1OMI A;  1RES A;  1TTY A;  3OYA A;  3QOD A;  2X6W A;  1P7I A;  4IX7 A;  1FOY A;  1K83 J;  3JTH A;  4AYB A;  4EJW A;  1K61 A;  2K3P A;  4W1U A;  4A5N A;  3QPT A;  2EB7 A;  3JCU C;  4JX4 A;  2A61 A;  1G3S A;  3CF2 A;  3HOW J;  3F8F A;  2XAF A;  2D45 A;  2K9N A;  3HJE A;  3SDB A;  3PIO F;  2Q1Z B;  3K4C A;  5K1Y A;  2P5V A;  1MSF C;  4UVA A;  2Z1D A;  5H20 A;  2P8T A;  3IC7 A;  1CQT A;  2JA6 J;  3IAS 2;  3RJP A;  5J4Y A;  2MAB A;  3W2A A;  5CPR B;  2I10 A;  3C2G A;  1ENH A;  2H1K A;  2R5Y A;  4RAZ A;  3S3M A;  2P5L C;  4L9T A;  4CH7 A;  5DUK A;  1VQM I;  3RKW A;  3AG3 H;  2KIQ A;  2H27 A;  2OA4 A;  4F3Q A;  1XGM A;  1QHG A;  4RBO A;  4DGW B;  4L9V A;  4G94 A;  1HW2 A;  3K7A J;  4JK1 X;  1HOM A;  1H88 C;  3E0J B;  4G8X A;  1G3Y A;  1I6H J;  1RI7 A;  4WF2 A;  3V7R A;  2NVU B;  5DM6 F;  2HU9 A;  4EQQ A;  5GPC A;  3I64 A;  2OBP A;  3DXJ F;  3RCO A;  2DYR H;  4M3B A;  1FIP A;  1R22 A;  4N0B A;  1YS6 A;  1IN4 A;  4LJZ F;  4NQW A;  1BJZ A;  1VFC A;  5B5E C;  3LNQ A;  4Y52 J;  5LBQ A;  4AC0 A;  2O6G E;  4UY8 I;  1QU3 A;  1MBF A;  2IGO A;  3KE2 A;  4G6D A;  5EEH A;  2YPR A;  1JE8 A;  3CJQ B;  5B1A H;  9ANT A;  4LMY A;  1SD5 A;  1ETX A;  3VSK A;  3S2H J;  2XDV A;  1BBY A;  2XGC A;  1JJ6 C;  2FBI A;  4NC6 A;  1JTX A;  2FX0 A;  4M3F A;  1F4K A;  2GA1 A;  3GTQ J;  2R5Y B;  3KCC A;  2L4M A;  4M72 A;  3WGI A;  4EM0 B;  3JRE A;  4UNO A;  2ZME A;  2L54 A;  2LY9 A;  2DT7 B;  2D5V A;  1V5E A;  1SFX A;  1Z77 A;  4E6K G;  1FX7 A;  4U0Y A;  2ECB A;  4BUP A;  2EZL A;  2W25 A;  1J7K A;  4V19 K;  4LIT A;  1U8B A;  2JN6 A;  3ZMD A;  2YU9 J;  3CDH A;  5JVG F;  2XRL A;  3JAM Z;  1UB9 A;  5LEJ A;  2K27 A;  4Y17 A;  4LK1 F;  2KDO A;  1YX3 A;  2PN6 A;  2OJE D;  1U6G A;  3FXK A;  5ICF A;  3ZQ7 A;  4EAT A;  3GTJ J;  5C44 J;  2F48 A;  4IVN A;  1O7L A;  2F6C A;  2LY1 A;  3A0B C;  2DYS H;  3H36 A;  3OYJ A;  3K6G A;  4GFB A;  1LEA A;  2DCE A;  3VYS B;  3N05 A;  5IT9 K;  2JMW A;  4KMU X;  1A5J A;  3OYK A;  2LF8 A;  2B0L A;  1O3Q A;  1ZG5 A;  2PFB A;  4IHS A;  1TW3 A;  4C9Y A;  2Y48 A;  5BS6 A;  5FRM A;  4EEF G;  5FO5 A;  1GVJ A;  4CCO A;  2EZK A;  3KLO A;  3ZQQ A;  1DP7 P;  1DP3 A;  3L9F A;  4DZP A;  2XGE A;  4M9Z A;  3H0G J;  2QF7 A;  4HNV A;  2FUG 2;  1ZG3 A;  3WHC A;  4A0Z A;  4PGG A;  3FXL A;  1JUS A;  2CMP A;  4BXX J;  2V7F A;  2OAZ A;  4AVP A;  2IS4 A;  2OTL I;  1U8R A;  1XG1 A;  1WH7 A;  1MDM B;  1YOV B;  2MC3 A;  2QSF X;  4IJA A;  5H6R A;  2DA1 A;  2O03 A;  3AG4 H;  5GTI C;  2W82 A;  2NS7 A;  3M1E A;  3CLO A;  4DNC A;  3JRD A;  1FTZ A;  2L01 A;  1YFH A;  1JHF A;  1BR1 A;  1D1C A;  1AA7 A;  2ACJ A;  2XHK A;  4Q48 A;  5FKO A;  1Z3X A;  4A5M A;  4PGH A;  3CUO A;  2WV0 A;  4RAF A;  4L9J A;  1CGP A;  2XF7 A;  4UUT A;  4H0E A;  2JRT A;  1MSE C;  4XOT A;  1D0Z A;  3CCM I;  4A6D A;  1VQK I;  3P9C A;  5F6F A;  4YIR X;  5J8C A;  4YFK F;  3B6A A;  1XPX A;  1YO5 C;  5EZG A;  3I4N J;  1JXS A;  2CQ7 A;  3K4M A;  5LGT A;  3UKG A;  1IRX A;  4D9J A;  3UR3 C;  2RN7 A;  1ZR2 A;  2A5Y B;  3DEU A;  4WXD A;  4LOC A;  1PDN C;  2W48 A;  3HKZ A;  4P96 A;  1PJR A;  1YJW I;  4BE0 A;  1IF1 A;  2ZO4 A;  3P7N A;  4P1W A;  3L2C A;  3BJA A;  1YG2 A;  3J7A O;  2FD5 A;  3LSG A;  1LVA A;  2ZME C;  3ECO A;  1UEL B;  1ZGA A;  3EYY A;  4CCL A;  2DA2 A;  1BC7 C;  3Q3S A;  1MJ9 A;  1A04 A;  4NB5 A;  1JKQ C;  2ESH A;  1XN7 A;  3BTI A;  1X19 A;  5KAF C;  2R7S A;  4IZZ A;  3V4G A;  3S14 J;  1REP C;  2W24 A;  4CCN A;  3HHH A;  1I3Q J;  4ENN A;  1BIB A;  3BC8 A;  1OYW A;  1PP8 F;  2JSP A;  1PUE E;  3LQQ A;  2VKE A;  1KQ8 A;  2Y0S A;  3G6E I;  2ISZ A;  1HXD A;  3CP8 A;  3FM5 A;  4XRF A;  2HS5 A;  1GVD A;  4MNU A;  3BG5 A;  3I9V 2;  1WHU A;  1S5L C;  2V9V A;  1OCR H;  3HOV J;  3FKJ A;  5DUI A;  3Q0V A;  3KYL A;  2VE9 A;  1IRF A;  1TWG J;  1U5T B;  1BN5 A;  4HW0 A;  1WJF A;  5IP6 A;  2O0Y A;  1IG7 A;  3H35 A;  2JWT A;  3DKY A;  2HOT A;  4WWC A;  2DMT A;  4OIO F;  4HST A;  3J7Y J;  4KYW A;  3FXR A;  1EV7 A;  5DM7 F;  2KMU A;  2YX4 A;  1BL0 A;  4IRH A;  4X0G A;  3CCE I;  2PX9 A;  2DT6 A;  3QQA A;  2ME6 A;  3HOX J;  4BNC A;  3KYD B;  3VEP A;  4OAY A;  4OIQ F;  1U2W A;  1UG0 A;  2MSY A;  3F21 A;  2F5V A;  4BXF A;  1EA3 A;  2JT1 A;  2HVQ A;  3IKV A;  4FX4 A;  2LKS A;  4ZYD A;  1SVO A;  1OCP A;  4KIB A;  3DEW A;  2VKH A;  3DEE A;  3N4M A;  3KP2 A;  1X1D A;  1M1E B;  2HQ5 A;  2ZKZ A;  4DQ2 A;  1G8X A;  1OLT A;  2F5E A;  3SYT A;  2PG4 A;  3MKY B;  3HOY J;  3EUA A;  2Z99 A;  4ZTJ A;  1O3S A;  4UB8 C;  1WZ2 A;  3S32 A;  4IRI A;  3WTW C;  4I98 B;  3WTY C;  2DQR A;  1XB4 A;  2M45 A;  1YYV A;  3EQL F;  3G1L A;  1QNT A;  2HQR A;  1IN6 A;  2BYV E;  1S72 I;  2XKO A;  1ETO A;  4MTE A;  4YG2 F;  4A12 A;  1UJ8 A;  4E7H A;  4YFN F;  2DI3 A;  3PFY A;  2A6T A;  2GWR A;  2CH0 A;  1Z6R A;  3KZY A;  3OYG A;  1K78 A;  1FZP B;  1CF7 B;  2G7H A;  4M71 A;  1WJA A;  2CW8 A;  1Z0X A;  1MMA A;  3BCA A;  3FXM A;  3QYF A;  4FT8 A;  1XGN A;  4KIG A;  5D6F A;  2VT3 A;  2L7K A;  4BY7 J;  2KP6 A;  5ICC A;  4A2U A;  2FE3 A;  3REO A;  3CDL A;  3K10 A;  3ASN H;  5J40 A;  5KVR A;  3TDU C;  2OCE A;  4RB1 A;  2BXY A;  2OC6 A;  5CVJ A;  5LHI A;  1ZQ3 P;  4UB6 C;  3IWF A;  1P4A A;  3BR1 A;  5LGU A;  4A6E A;  2EIL H;  4F93 B;  2Z16 A;  4BHC A;  4U0V A;  2QM3 A;  4KMF A;  2OV7 A;  3JR9 A;  2QVO A;  4LLG F;  4ON0 A;  4YII A;  3BG9 A;  1X2N A;  4AVZ A;  3Q5F A;  1BW6 A;  3U1K A;  5HDN A;  1WFX A;  1LE8 A;  5DCM B;  4HLX A;  1F9N A;  3AFH A;  2NVT J;  4M9X A;  4GYG A;  2O8K A;  4E7K A;  1YIT I;  2BGC A;  1H89 C;  4FET A;  3NAU A;  2CGP A;  2GBY A;  3V8K A;  4XQF A;  2WB1 N;  3DPL C;  1YRN B;  1ETV A;  3AG1 H;  3GXO A;  2XGX A;  1MNM C;  1FNN A;  2CV1 A;  2FNP A;  4OOI A;  4BJT A;  4KA4 A;  2VJJ A;  2V4J C;  5HOO A;  1FIA A;  2X1C A;  2EIJ H;  2GIZ A;  1ETQ A;  3BCB A;  3IP4 B;  3U2R A;  3BZC A;  2VPR A;  3L2V A;  1WJE A;  3KX2 A;  4AID A;  2MLK A;  2G7U A;  5B1B H;  4BU2 A;  4BQA A;  2B63 J;  1VQ4 I;  1ULY A;  1ETW A;  3K2A A;  1HBX G;  4XRM A;  2R7U A;  3HDD A;  3SFZ A;  3HSR A;  1QVU A;  1R58 A;  3HB9 A;  2PQ8 A;  3OSG A;  1YW8 A;  1IAW A;  3KEO A;  4OIN F;  1TQP A;  4YFX F;  5LLQ A;  4ZTF A;  3VYU B;  2EWN A;  4X1E A;  2HGC A;  1K4S A;  4ZYH A;  1HKS A;  1MKM A;  5HDK A;  2E1C A;  4WXH A;  4E7L A;  4XM3 A;  5D4S A;  2IVM A;  3PNV A;  1QBJ A;  4LIU A;  1Y0N A;  3ONQ A;  3HRU A;  1SD4 A;  5ILU A;  1SAU A;  3H9J A;  2X1E A;  3S3O A;  1UAA A;  1E2X A;  1Y1V J;  2CS3 A;  5K5O A;  1D1B A;  2GXG A;  4D5C A;  3QRF F;  2W85 A;  4DW6 A;  2MA3 A;  3K1N A;  3PNY A;  4OWR B;  4NUB A;  1IZ1 A;  2R7R A;  1Z67 A;  4YRV A;  3G1O A;  2DJN A;  4PJ0 C;  1NTC A;  1H9T A;  3ZCO A;  4GDF A;  4NC7 A;  2DXI A;  4XKB A;  4BQO A;  4NHJ A;  4IXA A;  3OYF A;  3OYI A;  1G6N A;  4LLN A;  3BZK A;  2WTE A;  3GFL A;  1Q1H A;  3IAM 2;  2HXO A;  3CES A;  3HEF A;  3P9K A;  4LG0 B;  2KJB A;  3HYI A;  1T39 A;  3F22 A;  2PJP A;  3OYB A;  2CFO A;  1KYW A;  1NK3 P;  2OTJ I;  5F0H A;  5ILV A;  5HNH A;  3FIW A;  3Q0U A;  4JOM A;  1H9G A;  3HRM A;  1XSX A;  1H0M A;  1OYI A;  3TP3 A;  3GTM J;  1PUF A;  2QA4 I;  1KA8 A;  1TWH J;  5JVT A;  4BS9 A;  2E1N A;  2JRM A;  2Q2E B;  2LFB A;  1FP1 D;  1D8J A;  3ZXS A;  2JK3 A;  4F52 A;  4C2T A;  3ELK A;  1IUF A;  3G1M A;  3LWF A;  2JJ7 A;  4XIC A;  1S7A A;  2L9V A;  4BHP A;  2F4I A;  4RGX A;  1FEX A;  3J7Z I;  1L3L A;  1P2F A;  1XGO A;  1Z91 A;  2ZJR F;  5M3F J;  5E3M A;  4MEX F;  1A31 A;  5BOX A;  2HKO A;  1YW7 A;  2CWE A;  5JR3 A;  2TRT A;  2HZD A;  2OZ6 A;  2XUB A;  3TW6 A;  1N77 A;  3W6V A;  3PJR A;  2PMZ N;  2VL8 A;  2K9M A;  4AWX B;  1H8A C;  4FE4 A;  2XKP A;  1W7P A;  1IC8 A;  4BDZ A;  1W4M A; 
#chains in the Genus database with same CATH homology
 3NQO A;  2H6C A;  2Q0O A;  5IT3 A;  3ZMT A;  1J75 A;  1ZG1 A;  1P92 A;  4G9Y A;  3TOA A;  3GFJ A;  1U3E M;  3WTX C;  2OD5 A;  4I0A A;  4CDG A;  5JFR A;  3DFG A;  1XDU A;  4GCV A;  3VOE A;  5BPI A;  1XSD A;  3T5X A;  5BQT A;  4QWQ A;  2NNY A;  2OQG A;  3QAH A;  4JBA A;  3K2Z A;  3I0T A;  3R60 A;  5D5V B;  2K86 A;  2HEO A;  2F5D A;  1STZ A;  2PMU A;  5AIP A;  4HDV A;  5LGN A;  4HV6 A;  4UV8 A;  4Q5S F;  2EK5 A;  3U1D A;  3HIF A;  1SFE A;  2FU4 A;  2RC4 A;  1EH8 A;  3HOT A;  5J6X A;  2LF7 A;  2Z5U A;  4E70 A;  5D6E A;  4Z2Y A;  3WGG A;  5FFZ A;  2Z33 A;  1XCV A;  2IA1 A;  4RGU A;  1E17 A;  2CFX A;  2R7F A;  1YW9 A;  4IPA A;  4G6Q A;  1ON2 A;  3JTG A;  4MTD A;  3CO6 C;  3T1B A;  3KP3 A;  2XV4 S;  2RNJ A;  4I01 A;  1LDD A;  1IXS B;  2FRH A;  4ZZD A;  2F5F A;  4A0Y A;  1ZGJ A;  1J9I A;  3OV8 A;  2XAJ A;  2FNA A;  5BPD A;  4MGR A;  1HW1 A;  5CVI A;  1ZRD A;  2YR2 A;  4Q4Z F;  1GXP A;  2XAQ A;  3QOP A;  3RKX A;  2V1U A;  1Z1D A;  2C6Y A;  1SD7 A;  5L3F A;  3IRR A;  1J2X A;  3MCZ A;  4CZZ A;  3WOD F;  3FZV A;  5E1W A;  5HS7 A;  1XGS A;  4RAY A;  3WU1 B;  1LB2 A;  1W5T A;  2HZT A;  4U0W A;  3WTV C;  2QUF A;  4GGG A;  2HOE A;  3RTR A;  2PMH A;  4Y13 A;  5A2Q K;  1O3R A;  3VOD A;  1ODD A;  1SMT A;  5D5U B;  2EFO A;  4HX8 A;  3V7C A;  4MQ9 F;  3H3U A;  1SFU A;  1R1U A;  5KK1 A;  3ECH A;  1MD0 A;  3NEU A;  4OIP F;  2ETH A;  1ZLJ A;  5IT9 Z;  1LJ9 A;  3E5X A;  3LAP A;  3WGH A;  2V79 A;  3M8E A;  2KIM A;  3PQJ A;  1XMA A;  3JSO A;  4G7H F;  5LRR A;  4ZYG A;  4HV5 A;  4U7D A;  4N9H A;  3TDZ C;  3LST A;  3MWM A;  1EH6 A;  4O6J A;  3GZ6 A;  3DP7 A;  3F8C A;  3I54 A;  5AIQ A;  2OU2 A;  4AIH A;  1D3Y A;  1L0O C;  3KLN A;  2MBF A;  1HKT A;  2BBY A;  2VXZ A;  1U78 A;  5F64 A;  2ZME B;  3K1M A;  3ZMV A;  3DKW A;  4LGW A;  2RV8 A;  4HZF A;  4U7B A;  1LDK B;  3H92 A;  2JTV A;  2DPU A;  2IA2 A;  3I71 A;  3LA2 A;  4EM2 A;  1QPM A;  3KZZ A;  2CW0 F;  1TBX A;  1C0W A;  3J81 K;  3KEQ A;  1R23 A;  2UZK A;  1IRG A;  2K02 A;  4OIR F;  3DQV C;  2HFH A;  5ED4 A;  1R1T A;  2RQP A;  1J0R A;  2PI0 A;  3FMS A;  2ZBK A;  4K2E A;  1DPR A;  4YIF A;  1B4A A;  3GEZ A;  1ZAR A;  3WTU C;  3MZH A;  2IP2 A;  3S2W A;  3FXU A;  3R0J A;  4OMY A;  2XAH A;  1FYL A;  3LA3 A;  1KQ9 A;  2P4W A;  3P9I A;  3FMQ A;  1R5H A;  3ZP5 A;  2MH2 A;  4EGY A;  5D8K B;  3GF2 A;  5HLH A;  3BPX A;  2G9W A;  3TKY A;  3HTS B;  1QQI A;  2EFP A;  4UV9 A;  4TV7 A;  2QQB A;  1XMK A;  3QPH A;  3LA7 A;  4FHT A;  1SAX A;  3V8L A;  5LRS A;  2W57 A;  1T0F A;  3TOB A;  5E17 F;  4CHU A;  1YLF A;  4ESJ A;  1IN5 A;  2QBY A;  2DTR A;  5D8L B;  5ICE A;  4Q47 A;  3K0L A;  1B6A A;  4Y15 A;  3HUG A;  2F2E A;  1F1Z A;  3WG9 A;  5JHU A;  4CYD A;  1QO0 D;  1SMY F;  4XBF A;  5BMZ A;  3RI4 A;  1BC8 C;  5LHG A;  2V6C A;  4MHG A;  1I27 A;  3ZMS A;  2HWV A;  1WRJ A;  3TGN A;  1T2K A;  1B9N A;  2FBH A;  3MZY A;  2MH9 A;  2ZFW A;  1HST A;  2MD5 A;  4RB2 C;  1FY7 A;  4PZJ A;  2HTS A;  3RYP A;  1WWX A;  4P5O A;  1KU2 A;  4F7Z A;  2A6E F;  2LNB A;  4EJO A;  1LNW A;  3M9A A;  3ULQ B;  2HYG D;  1S3J A;  5E8G A;  1K78 B;  3I59 A;  5ERI A;  3F6O A;  3GX4 X;  3W6K B;  3IRQ A;  3OOP A;  4AIK A;  4M9S A;  3MFK A;  1SD6 A;  2VOO A;  1P4X A;  1Z6T A;  1J5Y A;  2BEO A;  1TLH B;  2ZJ2 A;  5DDG A;  1UST A;  3ABU A;  4HLY A;  5EEG A;  2DW4 A;  3GLX A;  4KIF A;  2IPQ X;  2LKP A;  3COA C;  3E6D A;  1YS7 A;  3F6V A;  1ZN2 A;  2EV6 A;  3Q9V A;  4ZH4 F;  1T38 A;  1QZZ A;  2FOK A;  5CVU A;  1XD7 A;  5F1R A;  3FXQ A;  1FLI A;  2Q8K A;  4L5I A;  2WC2 A;  3GFI A;  3KET A;  3HHG A;  2NS0 A;  4KUM A;  2UXN A;  4IHT A;  1YQA A;  3O6B B;  4KN4 X;  3JSP A;  4LB5 A;  2V1X A;  3C1D A;  2ZNY A;  2RKH A;  4P55 A;  2CO5 A;  2X4H A;  3NRV A;  3BDD A;  3C18 A;  1ZYR F;  3KFW X;  1FBU A;  4G7O F;  1KQ0 A;  4ENM A;  1G3T A;  2MLG A;  2VON A;  2DT5 A;  4ENK A;  1OKR A;  2DAO A;  3V7S A;  3J80 Z;  2VBX A;  1YIO A;  4BH9 A;  4KFC A;  2W84 A;  2QZ8 A;  2QQ9 A;  2AXL A;  2R7D A;  3C7J A;  3SXY A;  3EYI A;  2FSW A;  2K4J A;  5FD6 A;  1G4D A;  4HYE A;  3R61 A;  3FX3 A;  3CUQ C;  1QGP A;  2EFW A;  4KNY A;  1X3U A;  1I1G A;  3HRS A;  2DK8 A;  5TRD A;  3J80 K;  4D0P A;  1R00 A;  5LEK A;  4EGZ A;  1W7P D;  5FB2 A;  3FHZ A;  1FYK A;  1W7P B;  2L3D A;  1I1S A;  3BZ6 A;  3GYH X;  2NYX A;  2IW5 A;  2A3S A;  2ZNZ A;  1BJA A;  3HSF A;  2P5K A;  3DF8 A;  1MZB A;  1FBS A;  5L3D A;  2VT2 A;  1LDJ A;  5D5X B;  2ESN A;  4KT5 C;  2WWY A;  4HF1 A;  3SQN A;  3ZN0 A;  1KYZ A;  4XLN F;  4EJT A;  3GW2 A;  1UHM A;  4WXC A;  1BIA A;  1JHH A;  5K5R A;  4JQF A;  2UXX A;  1ZLK A;  2PBI A;  1ZAO A;  1IXC A;  1O57 A;  4ETS A;  1FSH A;  1IN7 A;  3BP8 A;  2NRA C;  2D1H A;  5CLS A;  3O2P E;  2HQN A;  1RZ4 A;  5AON A;  2XRN A;  2DFI A;  2P6T A;  3TO9 A;  2L02 A;  1XDS A;  3TQN A;  1I6X A;  3BY6 A;  5A2Q Z;  2EV5 A;  4RB0 A;  1JGS A;  3TO7 A;  2F5C A;  2VOP A;  2FEZ A;  2DPD A;  2Z3Y A;  3WTT C;  4G7Z F;  2Y75 A;  1NHA A;  2XAG A;  3N97 A;  5FGM A;  3E6C C;  3RPQ A;  4CGZ A;  3MAJ A;  3ZMU A;  4I0B A;  3GUD A;  4UXN A;  2M8E A;  2CG4 A;  5CVV A;  3F23 A;  5HVQ C;  4L18 B;  4HQE A;  4HX7 A;  2ADU A;  2EFN A;  2CSO A;  1WSU A;  4U88 A;  3M7G A;  3FWE A;  4HAM A;  3E97 A;  2JSC A;  2KIF A;  2P6S A;  2VOD A;  5DD4 A;  1O3T A;  1BI3 A;  3LQR A;  3BPV A;  4LLL A;  3EET A;  3K69 A;  2QWW A;  4PCQ A;  5ILS A;  5FFX A;  5ICG A;  2E7W A;  1UFM A;  3B73 A;  3PQK A;  2EJR A;  3CJN A;  1BM9 A;  4ESB A;  4HOB A;  2RDP A;  1F5T A;  4FX0 A;  2YX7 A;  5K5Q A;  1RIO H;  1FT9 A;  2ZXJ A;  3R6S A;  4P9F A;  3ERE D;  4L0Y B;  5HS8 A;  2A07 F;  2M87 A;  2ISY A;  2DO7 A;  3I4P A;  4HA8 A;  3BJO A;  1UHW A;  3PFI A;  3H3Z A;  2J5P A;  2R3S A;  2UWM A;  1KU3 A;  3HOS A;  3E5Q A;  3J81 Z;  1AWC A;  3ZPL A;  2CQK A;  2J5O A;  1MDM A;  1KU9 A;  4BHB A;  3IL2 A;  5E1Z B;  4M6Y A;  3M8F A;  1FPQ A;  1W5S A;  6PAX A;  2IRF G;  1TQM A;  1TQI A;  3WTZ A;  3C3W A;  3ROU A;  1FC3 A;  4LK0 F;  4XSX F;  2P7V B;  3K9T A;  1FWZ A;  4AIJ A;  2OZU A;  2PLY A;  4S04 A;  1ZRE A;  2PEX A;  4O5V A;  1ZHF A;  2LDU A;  3JAM K;  2GZW A;  1R1V A;  1ZRF A;  4HBL A;  2EA2 A;  2FA5 A;  2QQA A;  3L00 A;  2AS5 F;  2RVC A;  3QP5 A;  4RGS A;  4IRG A;  3E6M A;  3R4K A;  2QYO A;  4WK8 F;  3B02 A;  2YU3 A;  3IKT A;  4QLC U;  2IA0 A;  1HW5 A;  1ZH5 A;  1WKM A;  3FMR A;  4EMS A;  2JPB A;  2KRF A;  5FLX Z;  1QZY A;  1S8N A;  3ZMZ A;  3KP6 A;  5D4R A;  2HR3 A;  5L3E A;  1U5T A;  4RB3 C;  3QU3 A;  4EV0 A;  5DEQ A;  3KP7 A;  1KU7 A;  2HKX A;  3IHU A;  4HF0 A;  4ASN A;  3E3V A;  3CTA A;  2IT0 A;  1J59 A;  4OU0 A;  4CO8 A;  3ABT A;  2XAS A;  1DDN A;  2DBB A;  2P7C B;  2K4B A;  1K7A A;  1FBQ A;  5FLX K;  2E7X A;  3I58 A;  4HDU A;  1S7O A;  4I7H A;  1D5V A;  4GXO A;  1RNL A;  4BXU A;  1R5G A;  5E8I A;  4EJV A;  3F8B A;  2H09 A;  4P9U A;  2FF4 A;  4HF2 A;  2GA2 A;  1HKQ A;  2IJL A;  2EV0 A;  1CF7 A;  3G73 A;  1TNS A;  4UVB A;  1USS A;  2JPC A;  5LHH A;  3E5U A;  1B1B A;  3R0A A;  3WU0 A;  2FBK A;  3F8N A;  3Q9S A;  1XSV A;  3BRO A;  5JI6 A;  2OQR A;  4A0X A;  1Z7U A;  5CJ9 A;  1S29 A;  5DCM A;  2DU9 A;  5HDG A;  2QBY B;  1YTY A;  2V1D A;  3ISP A;  5E1X A;  5L3G A;  4RGR A;  2ELH A;  5HLG A;  2D2W A;  1U5T C;  3VB2 A;  5TJJ A;  1HQC A;  1TNT A;  1S6L A;  3GVA A;  3F8M A;  4L9N A;  2GAU A;  3WE2 A;  1B59 A;  4GO1 A;  2VE8 A;  2VC0 A;  1IW7 F;  1UCR A;  3JW4 A;  4EVI A;  1ZRC A;  4HX4 A;  1VTN C;  3CO7 C;  3G3Z A;  2EA4 A;  2VBY A;  3HTU A;  3RIR A;  3L7W A;  3RDI A;  2STT A;  2XIG A;  2VBW A;  3VFZ A;  2LSO A;  2TDX A;  1WI9 A;  1OYY A;  2VBZ A;  1IUY A;  4N9I A;  3GZ5 A;  2ZCW A;  2M30 A;  3CUQ A;  3D5L A;  4LG0 A;  1DUX C;  1TW2 A;  3L09 A;  1R36 A;  3AAF A;  4ESF A;  3I59 B;  4S05 A;  3GO5 A;  1B9M A;  3DPT A;  2HTJ A;  3BWG A;  1GHC A;  3BOQ A;  2STW A;  1G3W A;  2DK5 A;  4I2O A;  4L0Z B;  2O8X A;  2H6B A;  1AOY A;  4R8H A;  2M5W A;  4RS8 A;  3I53 A;  2Q2E A;  3SZP A;  2A6H F;  4R79 A;  1Y0U A;  1BI2 A;  3T8R A;  1BI1 A;  3KP5 A;  2EFQ A;  4CXF A;  2A69 F;  1Z05 A;  3IWZ A;  2GIV A;  4PDK A;  4WX9 A;  5DCF A;  1WQ2 A;  1D8K A;  2KJC A;  3GWZ A;  3CUQ B;  2KKO A;  1BOA A;  1P6R A;  3RPU A;  1O7F A;  2FQ3 A;  2QLZ A;  2HYF A;  4M73 A;  2KIU A;  4B8X A;  3U9G A;  4LFU A;  5L3C A;  3D0S A;  1XCB A;  4M74 A;  2K7L A;  2Y0M A;  4ZZL A;  3O3K A;  5FD5 A;  1OPC A;  3QP6 A;  3WTS C;  5CYV A;  1V3F A;  3W6J B;  3ZN1 A;  4L5J A;  5HLI A;  2O3F A;  1I5Z A;  1T6S A;  2GQQ A;  1K79 A;  1MGT A;  2DQL A;  4BAY A;  5DV5 A;  3SZT A;  4CIC A;  1V4R A;  4XSZ F;  1K6O A;  5E18 F;  1DPU A;  2HDC A;  1FSE A;  4HQM A;  3QU6 A;  3DV8 A;  3EDP A;  4KN7 X;  2FML A;  3MEX A;  1IXR C;  4ENJ A;  3MQ0 A;  1BI0 A;  5H6Q A;  3SHF A;  4EM1 A;  3FM3 A;  4UUV A;  1R7J A;  4KDP A;  4WCG A;  2DLL A;  1FYM A;  5HS9 A;  1PP7 U;  3T8T A;  4I09 A;  5L3B A;  1LQ1 A;  1ON1 A;  2FXA A;  3F3X A;  3HRT A;  2FMY A;  3I5U A;  4KIC A;  1T98 A;  4LD5 A;  5CVR A;  3TO6 A;  5E20 A;  2NAZ A;  2Z9O A;  3F72 A;  2VC1 A;  2VN2 A;  1Z9C A;  2NNN A;  1KGS A;  3GFM A;  2BV6 A;  3WE3 A;  2L4A A;  3T0Y A;  2X0L A;  1GXQ A;  2XVC A;  4MEY F;  4R1H A;  4XLP F;  2YSR A;  3HSE A;  1HSJ A;  1FP2 A;  2XRO A;  3RYR A;  2D1V A;  5J8F A;  3E6B A;  2BE5 F;  2CYY A;  4LB6 B;  1FOK A;  4EJU A;  3EUH A;  3K1P A;  3KP4 A;  1RUO A;  4B09 A;  1MJA A;  4GYI A;  4UVC A;  3LAJ A;  1OR7 A;  2RGV A;  4IF4 A;  2JZY A;  5DD8 A;  3V8J A;  2O61 A;  1LEB A;  2A68 F;  2COM A;  4M6X A;  4AD9 A;  4UHT A;  1RUN A;  2H94 A;  4I02 A;  3FF5 A;  5D5W B;  3ML6 A;  2QEN A;  3RKY A;  1MJB A;  1IN8 A;  4OMZ A;  3LFK A;  4ZYE A;  3BJ6 A;  1ONV A;  4O3M A;  4MQV A;  5DYM A;  4BYY A;  2M1B A;  1P4W A;  2GXB A;  1EH7 A;  1OMI A;  1TTY A;  3JTH A;  4EJW A;  4A5N A;  3QPT A;  2EB7 A;  2A61 A;  1G3S A;  3F8F A;  2XAF A;  2D45 A;  5K1Y A;  2P5V A;  4UVA A;  5H20 A;  2P8T A;  3IC7 A;  3RJP A;  4RAZ A;  2P5L C;  4L9T A;  5DUK A;  3RKW A;  2H27 A;  2OA4 A;  1XGM A;  4L9V A;  4G94 A;  1HW2 A;  4JK1 X;  4G8X A;  1G3Y A;  1RI7 A;  4WF2 A;  3V7R A;  4EQQ A;  3I64 A;  2OBP A;  3DXJ F;  1R22 A;  4N0B A;  1YS6 A;  1IN4 A;  4LJZ F;  4NQW A;  5LBQ A;  2O6G E;  5EEH A;  3KE2 A;  4G6D A;  2YPR A;  1JE8 A;  4LMY A;  1SD5 A;  1BBY A;  2FBI A;  1F4K A;  2GA1 A;  3KCC A;  2L4M A;  4M72 A;  3WGI A;  4EM0 B;  4UNO A;  2L54 A;  2ZME A;  1SFX A;  4U0Y A;  1FX7 A;  2W25 A;  1J7K A;  3ZMD A;  3CDH A;  3JAM Z;  1UB9 A;  5LEJ A;  2K27 A;  4Y17 A;  4LK1 F;  2PN6 A;  3ZQ7 A;  1U6G A;  5ICF A;  4IVN A;  1O7L A;  1LEA A;  5IT9 K;  4KMU X;  2LF8 A;  2B0L A;  1O3Q A;  1ZG5 A;  2PFB A;  4IHS A;  1TW3 A;  2Y48 A;  5BS6 A;  5FO5 A;  1GVJ A;  1DP7 P;  3KLO A;  3L9F A;  4M9Z A;  1ZG3 A;  4A0Z A;  4PGG A;  2OAZ A;  4AVP A;  1U8R A;  1MDM B;  2MC3 A;  5H6R A;  4IJA A;  2O03 A;  4DNC A;  3M1E A;  3CLO A;  2L01 A;  1YFH A;  1JHF A;  2ACJ A;  2XHK A;  4Q48 A;  4A5M A;  4PGH A;  3CUO A;  2WV0 A;  4L9J A;  1CGP A;  4H0E A;  2JRT A;  4A6D A;  3P9C A;  5F6F A;  5J8C A;  4YFK F;  1YO5 C;  1JXS A;  5LGT A;  2RN7 A;  2A5Y B;  3DEU A;  4WXD A;  1PDN C;  4P96 A;  1IF1 A;  2ZO4 A;  3P7N A;  3L2C A;  3BJA A;  1YG2 A;  3J7A O;  1LVA A;  3ECO A;  1ZGA A;  3EYY A;  1BC7 C;  1MJ9 A;  1A04 A;  4NB5 A;  2ESH A;  1XN7 A;  3V4G A;  1REP C;  2W24 A;  3HHH A;  4ENN A;  1BIB A;  1OYW A;  1PP8 F;  1PUE E;  3LQQ A;  1KQ8 A;  2ISZ A;  1HXD A;  3FM5 A;  4XRF A;  2HS5 A;  4MNU A;  2V9V A;  5DUI A;  2VE9 A;  1IRF A;  1U5T B;  1BN5 A;  4HW0 A;  2O0Y A;  4WWC A;  4OIO F;  4KYW A;  3FXR A;  1EV7 A;  2YX4 A;  4IRH A;  4BNC A;  3VEP A;  4OIQ F;  1U2W A;  3F21 A;  3IKV A;  2JT1 A;  4FX4 A;  4ZYD A;  4KIB A;  3N4M A;  3KP2 A;  2ZKZ A;  4DQ2 A;  2F5E A;  2PG4 A;  2Z99 A;  1O3S A;  4IRI A;  3WTY C;  4I98 B;  3WTW C;  2DQR A;  1XB4 A;  2M45 A;  1YYV A;  3EQL F;  1QNT A;  2HQR A;  1IN6 A;  2BYV E;  2XKO A;  4MTE A;  4YG2 F;  4A12 A;  4YFN F;  2DI3 A;  2GWR A;  1Z6R A;  3KZY A;  1K78 A;  1FZP B;  1CF7 B;  2G7H A;  4M71 A;  4FT8 A;  1XGN A;  4KIG A;  5D6F A;  2VT3 A;  5ICC A;  4A2U A;  2FE3 A;  3REO A;  5KVR A;  3TDU C;  4RB1 A;  5CVJ A;  5LHI A;  3IWF A;  1P4A A;  5LGU A;  4A6E A;  4BHC A;  4U0V A;  2QM3 A;  4KMF A;  2QVO A;  4LLG F;  4ON0 A;  4YII A;  3Q5F A;  5HDN A;  5DCM B;  4HLX A;  1F9N A;  4M9X A;  4GYG A;  2BGC A;  2CGP A;  3V8K A;  3DPL C;  3GXO A;  2XGX A;  1FNN A;  2FNP A;  4OOI A;  4KA4 A;  5HOO A;  3U2R A;  2MLK A;  2G7U A;  4BQA A;  1ULY A;  1HBX G;  3SFZ A;  3HSR A;  1R58 A;  2PQ8 A;  1YW8 A;  1IAW A;  3KEO A;  4OIN F;  1TQP A;  4YFX F;  5LLQ A;  2EWN A;  2HGC A;  4ZYH A;  1HKS A;  1MKM A;  5HDK A;  2E1C A;  4WXH A;  5D4S A;  2IVM A;  1QBJ A;  3HRU A;  1SD4 A;  5ILU A;  1E2X A;  5K5O A;  2GXG A;  3QRF F;  2W85 A;  2MA3 A;  3K1N A;  1IZ1 A;  1H9T A;  4NHJ A;  4IXA A;  1G6N A;  4LLN A;  2WTE A;  3GFL A;  1Q1H A;  3P9K A;  4LG0 B;  2KJB A;  3HYI A;  1T39 A;  3F22 A;  2PJP A;  1KYW A;  5ILV A;  1H9G A;  3HRM A;  1XSX A;  1H0M A;  1OYI A;  1KA8 A;  5JVT A;  2E1N A;  1FP1 D;  1D8J A;  3ELK A;  3LWF A;  1S7A A;  4BHP A;  4RGX A;  1L3L A;  1P2F A;  1XGO A;  1Z91 A;  4MEX F;  5BOX A;  2HKO A;  1YW7 A;  2CWE A;  5JR3 A;  2OZ6 A;  2XUB A;  4AWX B;  2XKP A;  1W7P A;  1W4M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...