1KU7A

Crystal structure of thermus aquatics rna polymerase sigmaa subunit region 4 bound to-35 element dna
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
73
structure length
73
Chain Sequence
SEELEKALSKLSEREAMVLKMRKGLIDGREHTLEEVGAYFGVTRERIRQIENKALRKLKYHESRTRKLRDFLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the bacterial RNA polymerase promoter specificity sigma subunit.
pubmed doi rcsb
source organism Thermus aquaticus
molecule tags Transcription/dna
molecule keywords 5'-D(*CP*CP*TP*TP*GP*AP*CP*AP*AP*AP*G)-3'
total genus 28
structure length 73
sequence length 73
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04545 Sigma70_r4 Sigma-70, region 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1ku7A00
4ENKA 1UB9A 1HW1A 4KA4A 1YW7A 4MQVA 5CLSA 2QVOA 5TJJA 1UFMA 4Q4ZF 1FYKA 1XMKA 2VBZA 1I1SA 4OINF 3MFKA 2EV6A 2EFWA 2Y75A 2OA4A 2M1BA 3RPUA 3U2RA 4A12A 1MZBA 2W57A 2CGPA 1BM9A 4KFCA 4A6DA 1KQ8A 2V1DA 3ELKA 1ZN2A 1GHCA 5FLXZ 5IT9Z 1K7AA 1FX7A 3GFLA 4HLXA 1ZYRF 1FPQA 5DUIA 1SMTA 4BNCA 3B73A 1QQIA 2GQQA 5JFRA 1IN8A 2F5EA 3WGHA 2HS5A 4A0XA 2XAHA 4GYGA 2STWA 2Y48A 2JPCA 4EM1A 2NS0A 3GO5A 3HHHA 3QPTA 3I53A 2F2EA 2EA4A 1E17A 3SXYA 2OZ6A 2UXXA 1ODDA 2FNAA 2O3FA 1FBSA 4NHJA 1BC7C 3R0JA 3LFKA 2RV8A 4BHBA 1G4DA 3W6KB 2DT5A 4P96A 4ZYHA 3CDHA 2BE5F 2OQGA 5E1XA 2G7UA 3BROA 3FWEA 3KP5A 4U7DA 4U0WA 2H27A 3Q9VA 1U5TC 2FMYA 3GLXA 2H09A 4N9IA 3RKXA 3T8RA 1TQMA 2E1NA 1U8RA 1WQ2A 1P4XA 4MHGA 3S2WA 1WI9A 4AD9A 3KCCA 3LAPA 1R1UA 1RUNA 2E7XA 4XLPF 1S29A 2CYYA 3HSEA 1YW8A 3JTHA 2V1UA 4N0BA 1HBXG 2C6YA 4Z2YA 1DUXC 3DPLC 2GZWA 1FNNA 3HOSA 2PBIA 5D6EA 3MZHA 4BXUA 1JHFA 4A5MA 2W84A 3DV8A 1Z6RA 1ZRDA 2GAUA 2VT2A 2IA0A 2VBWA 3LA3A 2F5DA 2DLLA 4DNCA 3ZMVA 3V4GA 3QU3A 1IAWA 1B1BA 4BHCA 1YS7A 2JPBA 2O61A 1OR7A 2L4MA 1P6RA 5LRRA 1B4AA 4L5IA 1QPMA 3P7NA 3ZMDA 1OYIA 1FSHA 4EJWA 1RZ4A 2DQLA 4O6JA 3I64A 5LGNA 1FP1D 3P9KA 3I59B 3C18A 4HAMA 2H6CA 1USTA 2IRFG 3ZPLA 2XAQA 4AVPA 4WXCA 2XROA 4ZYDA 1XGSA 3HTSB 2KIFA 4KMFA 4MNUA 2QWWA 1UCRA 3DFGA 5FB2A 2UZKA 2EA2A 1MD0A 4ESBA 4ZYGA 4Q48A 2VXZA 4RGRA 4CHUA 2Z9OA 2GXGA 3F8NA 2Z5UA 4G6QA 3N97A 3SHFA 3QP6A 1XSVA 2M45A 4LK0F 2DTRA 3DQVC 5AIQA 4TV7A 1V3FA 4FX0A 3WU0A 2MD5A 2EV0A 2OZUA 5HDKA 4JQFA 2UXNA 1HW5A 4AWXB 2FBIA 4IPAA 1B59A 2ADUA 1W7PD 5FFXA 4GXOA 1RIOH 2XV4S 2CW0F 2DO7A 3U1DA 3M7GA 3WTWC 3WTUC 1YQAA 2ZXJA 1F4KA 1F1ZA 3L2CA 4EM2A 2DK5A 2HDCA 2ZFWA 3T8TA 5K1YA 1KYZA 2ZCWA 3GF2A 1O3QA 1LB2A 4RAZA 3KEQA 1ZRFA 3RYRA 2IA1A 4HQMA 2L01A 3K1PA 1JGSA 3KE2A 3F6VA 2ZJ2A 1XSDA 4HV5A 5E8GA 5BS6A 1CF7A 1HKQA 2B0LA 5LHHA 4LLLA 1T39A 5ILVA 4ZZDA 4EJUA 4M9ZA 2MH2A 4G94A 2DW4A 2NRAC 2BYVE 4ZH4F 1DP7P 5D5XB 1ZRCA 2FQ3A 3BJOA 2IT0A 1B6AA 2KIMA 2TDXA 3K1MA 2HYGD 1D5VA 3DXJF 4KT5C 1AWCA 3KZYA 5KK1A 2K4JA 3WTZA 5E20A 1QGPA 3MWMA 2IJLA 2ESHA 1U6GA 2VE8A 1Z05A 2F5CA 4OMZA 5L3CA 1BIBA 3IWFA 3IKVA 5D5WB 3E97A 4M6XA 5LLQA 4GGGA 3RI4A 2XGXA 4Q47A 4AIHA 2PMHA 2BGCA 3I59A 5KVRA 4OIOF 4EMSA 1I1GA 4G7HF 1OMIA 3H92A 5J8CA 1IN5A 2D45A 4RB1A 2GA2A 1QZYA 2QLZA 1KU9A 1YIOA 2ZNYA 1B9MA 4P5OA 3I71A 4KN7X 4LGWA 1JE8A 4IF4A 3QU6A 2H94A 3GVAA 3CO7C 1G3WA 3V8KA 3CUQC 4QLCU 4RAYA 5ICGA 5IT3A 4ENMA 1HQCA 4BQAA 3LWFA 1U2WA 2R3SA 3EUHA 2AXLA 4UVCA 1ZLKA 1SD5A 5DDGA 2QYOA 4EV0A 3KEOA 4ZZLA 3REOA 2DPDA 3TOAA 1FOKA 2V9VA 5FLXK 5IT9K 2O8XA 2XAJA 1YS6A 5DCMA 3H3UA 4U88A 3BPXA 4LB6B 1FYLA 3E5XA 3HTUA 3KFWX 2D1HA 1VTNC 4EVIA 5DYMA 3F8FA 1XCBA 3ZMSA 3GX4X 3NEUA 2RGVA 1E2XA 2ACJA 2HR3A 1P92A 3GZ5A 1HXDA 3FMSA 1TW2A 3CJNA 4I7HA 4A5NA 1Z9CA 2XRNA 1FLIA 3AAFA 3HIFA 3P9CA 4WX9A 4HF2A 2A07F 1J0RA 2V79A 5BQTA 3LQQA 1R1TA 2ZNZA 4R1HA 1YW9A 3MZYA 3ZMTA 4WXDA 5H20A 2PN6A 2FEZA 1QBJA 1WSUA 5D8KB 4RGXA 1R36A 2FF4A 3KP7A 4CYDA 3GFJA 4H0EA 3GZ6A 4YIFA 1K79A 2WC2A 5HOOA 3IHUA 2F5FA 1LVAA 4WF2A 2M5WA 2P5KA 2Z33A 3DP7A 1TLHB 5HLIA 3MQ0A 3E6BA 1XMAA 5DCMB 3V7SA 1O3RA 2YR2A 2P8TA 3HOTA 4MEXF 3DEUA 1TQPA 5DCFA 1KQ0A 4IJAA 1J2XA 5HDGA 3F21A 3M8EA 4Q5SF 4M72A 2QQBA 2QQAA 3FM5A 1NHAA 3SZTA 4HYEA 4IRIA 1ZHFA 1LNWA 2YU3A 2EFPA 1ULYA 2EFNA 4ON0A 1O57A 4KMUX 3HSFA 2MA3A 2VODA 1SAXA 3HHGA 5CVRA 1IN7A 1FY7A 3ZMZA 3WU1B 1R23A 1MJ9A 5ILUA 1SFEA 1KQ9A 3LA7A 1YTYA 1XDUA 3BDDA 1XCVA 4YFNF 5L3EA 4EQQA 2A68F 1BC8C 1Z91A 1L0OC 2KIUA 2VOOA 2KKOA 2QM3A 3C1DA 1Z1DA 3HSRA 1R1VA 1TNTA 3MCZA 2EV5A 3SQNA 3T1BA 4YFXF 4YFKF 1D3YA 3VFZA 1KU2A 3F22A 4UVBA 2DBBA 3L00A 3TKYA 1W4MA 3GW2A 5L3GA 4YIIA 4A0YA 2H6BA 3GFMA 3RYPA 4ESFA 5DD8A 2OAZA 3R61A 4RB3C 2J5OA 5E1ZB 2XIGA 2BBYA 4ENJA 1U5TA 4Y15A 4UV9A 4XBFA 3GYHX 1XGMA 3TO7A 5HS9A 2CO5A 3G3ZA 2X0LA 2XVCA 4L9VA 1I6XA 4PZJA 2OU2A 4I98B 4KICA 2XASA 3BP8A 4LB5A 3D5LA 1B9NA 3FX3A 4IRHA 2FNPA 2Z99A 1BOAA 1LDJA 1STZA 2Q2EA 5HDNA 1ZGJA 3ZQ7A 2E7WA 2VN2A 4HX7A 1F9NA 2DI3A 3ECHA 3PQJA 4BHPA 3BZ6A 4MTDA 5H6QA 3O2PE 3CO6C 1XGNA 2OQRA 3J7AO 2LKPA 3OV8A 3JAMZ 3TDZC 4I09A 1CF7B 2A69F 5ILSA 2WWYA 3BJ6A 2RNJA 5BMZA 3RTRA 4LK1F 1TW3A 1FBUA 1EH8A 2NNYA 1MDMB 2L4AA 3F3XA 1I5ZA 1H9GA 3R60A 1LDKB 4Y13A 2IP2A 2DK8A 5LBQA 4I0BA 1YG2A 2P6TA 3FXUA 4LD5A 1SD4A 2RQPA 5E17F 2K86A 1UHWA 3F8BA 1K6OA 2IPQX 4MEYF 2HOEA 5K5QA 1XN7A 4HX8A 2J5PA 5LGUA 5HS7A 1GVJA 2QUFA 4L5JA 5JI6A 2L02A 3I5UA 3R0AA 2WV0A 2W24A 2HGCA 1FZPB 2A5YB 1C0WA 1J5YA 1G3SA 2W25A 3BJAA 5FGMA 4O3MA 2O6GE 2O0YA 2QBYA 1EH6A 1LEAA 3J80K 4L9NA 1LQ1A 5AONA 1U5TB 1ZGAA 2HTJA 2QQ9A 4JK1X 1MJAA 5DUKA 1P4WA 3C7JA 1U78A 3TGNA 4G6DA 4N9HA 3IWZA 1T38A 4UVAA 2PFBA 3K9TA 2IA2A 1YLFA 3JTGA 4I0AA 2D2WA 3F8MA 2BEOA 3HRSA 3J80Z 1R58A 2MLKA 1MKMA 2RKHA 2Y0MA 4S05A 2EB7A 3WTXC 3DPTA 1IRGA 3QAHA 2ZMEB 3ECOA 3HRUA 1PP7U 1SMYF 2DFIA 4UHTA 5CVUA 5ICCA 1R7JA 4FHTA 3JSOA 2CQKA 4HV6A 2XAGA 3RPQA 2FE3A 2FRHA 4IXAA 3WE2A 1JXSA 2FA5A 1JHHA 1KU7A 5CJ9A 1FC3A 1BI1A 1DDNA 5F1RA 2QENA 5F64A 4MGRA 1IN6A 1RNLA 2FBKA 1OPCA 3KP3A 1L3LA 2XHKA 1W5SA 2K27A 3NQOA 5K5OA 5EEGA 5D4RA 3FHZA 4RS8A 2MH9A 1ZG3A 3FF5A 4U7BA 3WTYC 3T0YA 1GXPA 1FSEA 4XSZF 1Q1HA 5HLGA 3MEXA 3ZP5A 3FMQA 2PI0A 2PLYA 2CFXA 3LA2A 2LSOA 3RDIA 3KP2A 4E70A 4EGZA 4EGYA 4KIGA 3NRVA 1OYWA 3M1EA 3V8LA 4K2EA 1WRJA 4HF0A 4HDUA 2VOPA 4EJOA 3IRQA 3WTVC 1ZAOA 1K78B 3VEPA 1XB4A 2ISYA 3JSPA 5FD6A 2RVCA 4ETSA 3KLOA 4P9UA 4HDVA 3R6SA 4GCVA 2DQRA 4CO8A 1S7AA 1BN5A 1YFHA 1IN4A 2K4BA 2GIVA 2WTEA 1SFUA 1ZREA 1USSA 5E8IA 3EYYA 4AIJA 4B8XA 3E6MA 1BI2A 1YO5C 4IHSA 2P7VB 4HOBA 4GO1A 3TO6A 5BOXA 1R5GA 3I4PA 4CZZA 1I27A 3KLNA 2A3SA 5CVJA 4G7OF 1GXQA 4AIKA 2CG4A 4HBLA 3K1NA 5ICEA 2JZYA 1ZG5A 4KIFA 2NAZA 3K2ZA 5ED4A 2KJBA 5FFZA 1W7PB 4QWQA 1BIAA 4IRGA 1ON2A 2NNNA 3IKTA 2QZ8A 3V7RA 5E18F 2CSOA 3F6OA 2ZO4A 5D8LB 1FP2A 1DPRA 4M73A 4OIQF 2JT1A 3ULQB 2R7FA 1IUYA 1BBYA 1W5TA 5TRDA 1IZ1A 2EK5A 2JSCA 5D4SA 1HSJA 3KZZA 4R79A 3BOQA 2PMUA 4P55A 1H0MA 1WWXA 3BY6A 5LHGA 4G9YA 1S8NA 3LQRA 1LDDA 4HLYA 4MTEA 3E6CC 4DQ2A 4CXFA 3E3VA 3L9FA 2LF8A 5L3FA 3JAMK 3F8CA 3QPHA 3CUQA 4HQEA 2P4WA 2XAFA 2HFHA 4RGSA 3L7WA 2GXBA 1RI7A 1G3YA 3HRTA 1T0FA 2GWRA 3CUOA 2BV6A 3ROUA 3Q5FA 1SD7A 2VBXA 3V8JA 5LHIA 4UV8A 5LEKA 1XGOA 3VOEA 2Z3YA 4XLNF 4L18B 4M9SA 1G6NA 3B02A 4WXHA 5A2QK 4PCQA 3TOBA 2L54A 3COAC 3PFIA 5LRSA 1MDMA 1PP8F 1O7FA 1HKTA 2CWEA 1XD7A 3E6DA 2L3DA 4L0ZB 2Q8KA 4NB5A 1IW7F 4M74A 1BI3A 4LMYA 3O3KA 3ABUA 1R22A 3HYIA 2P5LC 1EV7A 1IRFA 5CVIA 5D5UB 5D6FA 3WTTC 2EWNA 2IVMA 2ZKZA 1S7OA 1QO0D 3BPVA 4HA8A 4IHTA 3T5XA 2DU9A 3GEZA 5FD5A 2GA1A 2ZBKA 1TQIA 2MC3A 2VT3A 3ZN1A 3QP5A 1BI0A 4HF1A 1V4RA 1OYYA 1J75A 3GWZA 1MJBA 4MQ9F 4U0VA 1J59A 4ESJA 2YX7A 3EETA 3OOPA 1DPUA 4PDKA 3TQNA 4I2OA 3WGGA 5ICFA 1HKSA 3W6JB 3DF8A 4OOIA 5CVVA 2X4HA 1KYWA 3TDUC 2ISZA 2HQNA 3FXRA 4OIPF 3ERED 5AIPA 3FXQA 3LAJA 4KUMA 1RUOA 5HLHA 3RJPA 2MLGA 1PUEE 4HW0A 5L3BA 1UHMA 3I58A 2HWVA 1D8KA 3J81Z 2EFQA 3CTAA 4KDPA 2EFOA 5LEJA 2PQ8A 2E1CA 3CUQB 1IXRC 4EM0B 4HX4A 2ELHA 4WWCA 2VE9A 3L09A 3ABTA 3ZN0A 5J8FA 1OKRA 1TTYA 4RB2C 4XRFA 1SD6A 5D5VB 2V6CA 3QRFF 6PAXA 2VC0A 4UNOA 2R7DA 2PEXA 2MBFA 4M9XA 1XDSA 5ERIA 2ESNA 2PG4A 1HSTA 2P6SA 4LFUA 5HS8A 3PQKA 5JVTA 5K5RA 3F23A 1T2KA 3HUGA 2KRFA 3IL2A 4BAYA 1J7KA 2ETHA 1W7PA 4IVNA 2PJPA 3KP6A 3GFIA 1TNSA 3K69A 2P7CB 1FBQA 2G7HA 2G9WA 2HEOA 5DV5A 2LNBA 3C3WA 1FYMA 4KNYA 2JRTA 5EEHA 1IXSB 3I54A 2RN7A 1T6SA 3BWGA 3KP4A 4KN4X 4HZFA 2HYFA 1U3EM 4EJTA 1CGPA 4UUVA 3FM3A 4O5VA 4OU0A 3WODF 2ZMEA 1O3TA 4M6YA 1IXCA 3QOPA 1MGTA 1R5HA 4KIBA 1T98A 2DAOA 3FZVA 4F7ZA 3IRRA 3LSTA 4FT8A 3CLOA 2VBYA 3F72A 1KGSA 1O7LA 4ENNA 2K7LA 3H3ZA 3U9GA 3G73A 2RDPA 4B09A 1ZLJA 1F5TA 3SFZA 3EYIA 2LDUA 1J9IA 1D8JA 1S3JA 1BJAA 3ISPA 3E5QA 4L9JA 3V7CA 1LJ9A 2OBPA 2FMLA 1O3SA 2O03A 4GYIA 1FT9A 3N4MA 2A6EF 1X3UA 2W85A 1ZARA 4UXNA 3EDPA 2EJRA 3R4KA 2AS5F 1YYVA 2Q0OA 2HZTA 4A0ZA 3RKWA 2FBHA 1EH7A 1REPC 4ASNA 4OMYA 2YPRA 1Y0UA 3DKWA 2LF7A 4RGUA 5H6RA 3FMRA 2STTA 2K02A 4I01A 4CGZA 5A2QZ 2UWMA 3MAJA 5E1WA 4YG2F 2RC4A 3WGIA 4PGGA 4JBAA 4NQWA 2JTVA 3WTSC 2XKOA 3K0LA 3O6BB 3GXOA 3SZPA 1QZZA 3ZMUA 3M9AA 4P9FA 4G8XA 1Z6TA 2FOKA 3GUDA 4CDGA 5FO5A 3HRMA 1XSXA 2M30A 3E5UA 5HVQC 4A2UA 1WKMA 3WE3A 1H9TA 3WG9A 3KETA 2HQRA 4EJVA 4OIRF 4ZYEA 5BPDA 4LG0A 3IC7A 5LGTA 3I0TA 4S04A 4PGHA 2D1VA 4RB0A 4I02A 4KYWA 4LG0B 2FXAA 2M8EA 1SFXA 3RIRA 3ML6A 4BYYA 4BH9A 1ONVA 4WCGA 2YSRA 3VB2A 2A61A 2HKOA 1Z7UA 2QBYB 5L3DA 1A04A 1FWZA 2M87A 3M8FA 1IF1A 4CICA 3JW4A 4FX4A 1KU3A 2YX4A 5J6XA 5JR3A 2P5VA 2FSWA 3EQLF 4Y17A 5JHUA 4M71A 1P4AA 1HW2A 4LLNA 3Q9SA 2HTSA 1LEBA 1ON1A 4XSXF 2HKXA 3D0SA 4U0YA 4G7ZF 1ZG1A 4WK8F 2NYXA 1S6LA 1TBXA 1AOYA 2VONA 2XKPA 5DD4A 1ZH5A 1P2FA 1G3TA 4L0YB 5CYVA 1KA8A 2A6HF 4R8HA 4LLGF 2V1XA 1R00A 2VC1A 2OD5A 4D0PA 4LJZF 2COMA 1QNTA 4A6EA 3VODA 1K78A 3J81K 5BPIA 5DEQA 2KJCA 5F6FA 2FU4A 2IW5A 3P9IA 3TO9A 2DPUA 1PDNC 4L9TA 2XUBA 3RKYA
chains in the Genus database with same CATH superfamily
4ENKA 1UB9A 2R93J 1HW1A 1FTZA 5J47A 4KA4A 1QPIA 1YW7A 4MQVA 4XIDA 5CLSA 2QVOA 2VKVA 5TJJA 1UFMA 2JWTA 4Q4ZF 3JRDA 2CW7A 1FYKA 4CYCB 3CCEI 4G12A 1XMKA 5IP6A 1DU0A 2VBZA 4ZDPA 1I1SA 4OINF 3MFKA 2EV6A 1TWAJ 4BXFA 3EPZA 1MMGA 2EFWA 4HSRA 3NARA 2Y75A 2OA4A 2JJ7A 2EPFA 4D5FA 2M1BA 1V5FA 3RPUA 2VIXA 2W00A 5CQEA 3CMYA 1D5YA 3U2RA 4CCJA 4A12A 1RKTA 1IV6A 1FOYA 4A3CJ 2ECCA 2VKHA 1W36C 3QQAA 3QPSA 1MZBA 2W57A 2CGPA 3H36A 3J7ZI 4FCYA 1BM9A 4KFCA 4A6DA 4RLQA 1KQ8A 1JTYA 3EUAA 2V1DA 3ELKA 1ZN2A 1GHCA 5FLXZ 5IT9Z 4CUGA 4A3EJ 1K7AA 4AM3A 1FTTA 3CDIA 2LR8A 1FX7A 1JKQC 2QSHX 1JI8A 3GFLA 2ZSIB 4HLXA 1ZYRF 1N75A 1FPQA 3L2RA 5DUIA 1SMTA 4BNCA 1OCCH 3B73A 1QQIA 2IXSA 2OUMA 2GQQA 5JFRA 1IN8A 2F5EA 3WGHA 4CCKA 2HS5A 4A0XA 2XAHA 4GYGA 3HC7A 2STWA 2Y48A 2JPCA 4EM1A 3OOUA 2F4OB 1S72I 2NS0A 3GO5A 5KAFC 3HHHA 2QCOA 3QPTA 3AL0C 3I53A 2HVQA 2F2EA 2FUG2 2M9HA 5K7FA 1N78A 2EA4A 1E17A 3SXYA 3HGYA 2OZ6A 5IOZA 4KISA 3BG6A 2UXXA 4JYKA 1ERDA 1ODDA 2FNAA 2O3FA 1FBSA 4NHJA 1BC7C 3R0JA 3LFKA 1XMXA 4MLOA 3DTEA 5FKMA 2COBA 2RV8A 4BHBA 1G4DA 4BACA 3W6KB 3A0BC 2DT5A 5BNGA 3OS2A 4P96A 4RM3A 5JLWA 2MABA 2BXYA 3VWBA 2E71A 4ZYHA 3LSHA 3CDHA 4NBQA 3H35A 2BE5F 2OQGA 5E1XA 2G7UA 3G6EI 3BROA 1ITYA 2XGDA 3FWEA 3KP5A 2L2OA 4U7DA 3L2QA 3NWTA 4U0WA 2FJ1A 2B9SA 2JA8J 2H27A 3Q9VA 5J3LA 1U5TC 2FMYA 3GLXA 3BR5A 2H09A 3E7LA 4N9IA 3RKXA 3T8RA 1LE8B 3PNTA 1TQMA 2XF7A 1R5ID 3MKYB 2E1NA 1BR4A 1U8RA 1WQ2A 1P4XA 3HBLA 5FKNA 4MHGA 3S2WA 1WI9A 4AD9A 2XB5A 1YIJI 2ID6A 3KCCA 1R1UA 3JRBA 3LAPA 1RUNA 2E7XA 4XLPF 1S29A 2CYYA 3HSEA 1UAAA 1ETXA 3H9QA 1YW8A 1TWHJ 1T8IA 3JTHA 2V1UA 4N0BA 1HBXG 1H88C 2C6YA 1FMVA 1NH3A 2VPLA 4Z2YA 4XNFA 3ZCOA 4ZC3A 1DUXC 5IYDJ 3DPLC 4IO9F 2EH3A 2GZWA 1SVMA 1FNNA 2DYRH 3HOSA 2PBIA 5D6EA 3O8GA 4BXUA 3MZHA 1JHFA 4KJZA 2OF7A 3H5RA 4A5MA 4DYQA 2HVSA 2W84A 3DV8A 1Z6RA 2KDOA 3TL4X 3M8JA 1BW6A 4ZTJA 1ZRDA 1HCRA 2XPWA 2GAUA 2VT2A 4UUTA 4A3GJ 3H9JA 1E3OC 4IOAF 2IA0A 3HB9A 2VBWA 3NWSA 1R6RA 2F5DA 2DLLA 3LA3A 3RCOA 4DNCA 1BW5A 4XKVA 2BOLA 4E6KG 3X2QH 1HDDC 3ZMVA 2KPMA 3V4GA 3QU3A 4BXXJ 2I8DA 1B1BA 1IAWA 2JA7J 5FKLA 4BHCA 2LD5A 1YS7A 1JKPC 3JRCA 2JPBA 2I5UA 2XC7A 2ME0A 2BW3A 2O61A 1OR7A 2ZXWH 1TZLA 2L4MA 1HLVA 1P6RA 4RAFA 3BTLA 3MN2A 5CKTA 3OSFA 5LRRA 3JREA 1RC9A 2ID3A 1B4AA 3ZR8X 4EATA 1TT5B 4L5IA 1QPMA 2XAUA 3P7NA 3ZMDA 2Z16A 2K3PA 1OYIA 2F48A 2IS6A 4EJWA 3TBIA 4XR6A 1RZ4A 1FSHA 2DQLA 1HA8A 2F4MB 4O6JA 3I64A 2G0EA 5LGNA 2D5VA 1FP1D 1R9TJ 3PFYA 1IDZA 3P9KA 2L5QA 1XX5A 4ZDOA 4HSTA 2Y9YA 3I59B 3C18A 2WB1A 2L9SA 4HAMA 2H6CA 1USTA 3GZNB 2IRFG 2KZVA 1RR7A 3ZQHA 1CQTA 3ZPLA 3DEEA 2XAQA 4AVPA 4WXCA 2XSJC 1BR2A 3SDGA 1B8IB 2XROA 4ZYDA 1B72A 2E34A 5M3MJ 2K3FA 1XGSA 2NVXJ 3HTSB 2HXIA 2KIFA 4KMFA 1POGA 3QOEA 4D7MA 4MNUA 1NG6A 5EZHA 1Y1VJ 2QWWA 1UCRA 5B3SH 2V7FA 1QVTA 5KCMA 4C2UA 4RMNA 3M1CA 3DFGA 5FB2A 2V9PA 1ZKGA 2X85A 2UZKA 2JSPA 2EA2A 1MD0A 1X1DA 1VQPI 4ESBA 4ZYGA 1VF9A 3OR1C 4Q48A 2VXZA 2WY8Q 3PUFA 4RGRA 2ICWG 1I50J 4CHUA 1SVOA 5E3OA 2FD5A 2Z9OA 2GXGA 4BL0B 3VPRA 3A01B 2K5CA 3F8NA 2Y0SA 1YJNI 2Z5UA 4G6QA 3N97A 3SHFA 3KYLA 3JRAA 4HNVA 3QP6A 4G6TB 1XSVA 4LITA 3S2DJ 3LL7A 2NVUB 2OC6A 3BCBA 2L9RA 1X2MA 2M45A 4LK0F 2DTRA 3DQVC 5AIQA 4TV7A 1V3FA 4FX0A 2MC4A 3WU0A 3L2VA 2MD5A 2EV0A 3D1NI 2M0MA 2OZUA 2X1EA 5HDKA 4JQFA 2UXNA 2ZC2A 3HKZN 1HW5A 4AWXB 3OYIA 1DGRM 2FBIA 1IC8A 4E7ZA 4IPAA 1B59A 4Y7NJ 3RQ4A 2ADUA 4IHVA 1W7PD 1WJ5A 4HNUA 2KP6A 5FFXA 1VQ9I 1A5JA 2TRTA 4GXOA 1RIOH 2XV4S 2CW0F 4V2FA 1VQMI 2DO7A 3U1DA 3M7GA 3WTWC 3WTUC 2VJJA 4DBQA 2M8GX 1YQAA 3ASOH 9ANTA 2ZXJA 5KNLA 2IS1A 1F4KA 1F1ZA 2H1KA 4BJ6C 1T08B 5F27A 3I3LA 3L2UA 3L2CA 2GM4A 4EM2A 3DTIA 2DK5A 2HDCA 4IHWA 2MG4A 2ZFWA 3T8TA 5K1YA 5JHFA 4E7SA 1KYZA 4ANJA 2ZCWA 3GF2A 3TP0A 1O3QA 1MBEA 4RAZA 3KEQA 3FXLA 1LB2A 2BHYA 1ZRFA 2GLOA 3RYRA 4QPQA 3LNQA 1JUMA 3QYBA 1MSEC 2IA1A 1O4XA 4HQMA 2CV1A 3BG3A 2L01A 3K1PA 3EUKL 1JGSA 1E3HA 1UMQA 1IDYA 3VYRB 3KE2A 5J4VA 3W2VA 3BG5A 3A03A 3F6VA 5KHDA 3OWTA 2BY1A 2ZJ2A 2H8WA 1XSDA 3KYDB 3ZGKA 4PJNA 4HV5A 4F92B 5E8GA 5BS6A 1CF7A 1HKQA 2B0LA 3HM5A 1H8AC 1JUSA 3H5NA 5LHHA 4LLLA 3K70C 2R7RA 5ILVA 1T39A 1VQ6I 4ZZDA 4EJUA 1GV5A 1WHUA 1QVUA 4M9ZA 2MH2A 5TGTA 1Y8RB 1JKOC 4G94A 2PMZA 2E2IJ 2DW4A 3S8PA 3BT9A 5K7HA 2BYVE 2IGKA 2NRAC 4Y33A 1GV2A 4ZH4F 3MVPA 1DP7P 1ACIA 5D5XB 1ETKA 1ZRCA 2FQ3A 2L9NA 3BJOA 3A2KA 3ZQLA 2IT0A 1ETVA 2Q2EB 1B6AA 3BZKA 2KIMA 4MO7A 2TDXA 1IUFA 2BHZA 3K1MA 4LG3A 5LD2C 2EZHA 1B72B 2CV2A 4BBSJ 4XQFA 2HYGD 1D5VA 4GDFA 3DXJF 4KT5C 1X4OA 4HPQA 1LVKA 2R7OA 1PYVA 2K4JA 3KZYA 5KK1A 1AWCA 3FXKA 3OYHA 2E1OA 3WTZA 2PJRB 3K4BA 5E20A 1QGPA 1M1EB 1UG0A 3MWMA 4XLCA 2L7ZA 2IJLA 3BTIA 2ESHA 1U6GA 2VE8A 2R5YA 1F43A 1Z05A 2F5CA 4OMZA 5L3CA 3HXLA 1BIBA 3IWFA 2WAQN 3H0GJ 3IKVA 5D5WB 3E97A 3PUBA 3OSGA 3CF2A 4M6XA 5LLQA 3GCMA 4GGGA 3K70D 3RI4A 2XGXA 1TP4A 4M3BA 4Q47A 4AIHA 2PMHA 2MYSA 3S93A 2BGCA 3I59A 2GBYA 5KVRA 4OIOF 2CRGA 4N4NB 4EMSA 1MH3A 1YJWI 2RQQA 1QHGA 5GAHJ 1I1GA 1IJWC 1T56A 4G7HF 2DFHA 1OMIA 3H92A 5J8CA 1LFUP 2DOEA 1Z67A 1IN5A 3MKZA 2HQ5A 2ME6A 2D45A 4RB1A 2GXAA 1X58A 2E5ZA 2GA2A 1YX3A 2LTPA 1QZYA 2QLZA 2W1OA 4N4OB 5FKKA 4BEHB 5GTIC 1VQNI 3AG2H 1KU9A 2F6CA 1YIOA 2DDBA 2ZNYA 4C3JJ 2JVHA 5DS9A 2QSGX 1B9MA 4P5OA 3DTKA 3HDDA 2ELJA 3I71A 5IP9J 2O8KA 4KN7X 4LGWA 1JE8A 3L1PA 4IF4A 3QU6A 2H94A 1QU3A 2FX0A 3GVAA 3CO7C 1G3WA 2WAFA 3FKJA 1OCTC 4I76A 3V8KA 1X1PA 2L9VA 2R5ZA 3CUQC 4QLCU 4RAYA 5ICGA 5IT3A 4ENMA 1HQCA 4BQAA 1WGXA 2KIQA 2LC2A 3LWFA 4BE2A 3EUHA 1U2WA 2R3SA 2AXLA 4DW6A 3PIOF 5HNFA 1T0FC 2KT0A 2LLKA 5C4XJ 4UVCA 2QF7A 1ZLKA 3OYDA 1WJCA 3ZRGA 1SD5A 2L7MP 5E3NA 5DDGA 2QYOA 4EV0A 2HNHA 1MBJA 2X1DA 3KEOA 4ZZLA 1OFCX 5TISC 3REOA 2DPDA 4DZPA 3TOAA 1FOKA 2V9VA 5FLXK 5IT9K 2O8XA 2XAJA 1YS6A 5DCMA 2LG4A 3H3UA 1K4TA 2DA5A 3CCLI 5GP9A 4U88A 3BPXA 4LB6B 1FYLA 3E5XA 3HTUA 3UR3C 3IAS2 5B66C 3I4NJ 4AYBA 1ETYA 5FRNA 3KFWX 2D1HA 3I9V2 5J1RA 1VTNC 4EVIA 5DYMA 3SYTA 2M4KA 4DGWB 2QGUA 3AG4H 3F8FA 2CUZA 3AG3H 4XRSG 1XCBA 4D1QA 1BOBA 3ZMSA 3GX4X 3NEUA 4FQGA 3CMAI 3FK7A 2RGVA 1E2XA 2ACJA 2CFOA 2HR3A 1P92A 3GZ5A 3HJEA 1TWGJ 1HXDA 3ERMA 1TW2A 3CJNA 3FMSA 3F9KA 4I7HA 4A5NA 3OY9A 1PJRA 1Z9CA 1JT0A 2KISA 3HG9A 2XRNA 4ITVA 1FLIA 3AAFA 3HIFA 3P9CA 4RM2A 4RDUA 4QTRA 1APLC 4WX9A 4HF2A 1VZ0A 2A07F 1J0RA 2V79A 5BQTA 3LQQA 1R1TA 3K6GA 1T33A 2KHMA 2ZNZA 2VQLA 4R1HA 1YW9A 2XPVA 3MZYA 3ZMTA 4WXDA 4FE7A 4J19A 5H20A 3OYAA 2PN6A 2LREA 2FEZA 3MD2A 1QBJA 2WBMA 1RESA 1Y6IA 2E35A 1SC7A 1WSUA 4PSXA 5D8KB 3PO3J 4RGXA 3FKIJ 1I3AA 1R36A 2FF4A 4Y4RA 2Y30A 2DOAA 3KP7A 4CYDA 1WH5A 3GFJA 1OCZH 4H0EA 3A0HC 3OYJA 3Q0WA 1D1BA 3GZ6A 3DKXA 4YIFA 2WC2A 5HOOA 1K79A 1SANA 2F5FA 3IHUA 1LVAA 4WF2A 4B47A 2M5WA 2P5KA 2Z33A 3DP7A 1W0UA 4PJ0C 1TLHB 5HLIA 3G1MA 4BQNA 1A35A 3MQ0A 3BR0A 1BA5A 3DU6A 4L5EA 3E6BA 5F04A 3S3NA 1XMAA 4AUXA 5DCMB 2DOFA 3V7SA 5CQGA 1LFPA 2KL4A 3SJMA 1O3RA 2YR2A 2P8TA 1K4SA 3HOTA 2LBFA 2LY1A 4MEXF 3ZQIA 3DEUA 1TQPA 5DCFA 3NAUA 1KQ0A 2MSYA 4IJAA 2R7ZJ 2CJJA 1J2XA 5HDGA 3F21A 3CCSI 3M8EA 4Q5SF 4M72A 2HPIA 3OIQA 2Y31A 2LY2A 2QQBA 3SEQA 3CQZJ 2QQAA 3FM5A 1NHAA 3SZTA 3W2AA 4HYEA 4IRIA 1ZHFA 1LNWA 2WAQA 2YU3A 2EFPA 1ULYA 2EFNA 4ON0A 5M5YJ 2O9LA 1O57A 4KMUX 5IYCJ 3U1KA 2KFDA 3HSFA 1LE8A 2MA3A 3DPUA 2VODA 2IAIA 1SAXA 2DN0A 3OL4A 3HHGA 1XTAA 5CVRA 2L7KA 1VNDA 2YU9J 1IN7A 2IEKA 1FY7A 3ZMZA 3WU1B 3PJRA 5M3FJ 1R23A 5GPCA 1MMDA 1MJ9A 5ILUA 2EBIA 2ELKA 1P9QC 3FDYA 4C3HJ 2VKDA 1WVRA 1HC8A 2BY2A 1SFEA 2X6WA 4FETA 1KQ9A 4A3JJ 3LA7A 1YTYA 3H5AA 5GADJ 4MIMA 4XK4A 3DLAA 1XDUA 2X6OA 2WADA 3BDDA 1XCVA 4PFOA 4YFNF 5L3EA 4EQQA 2A68F 1BC8C 1TT0A 2IGMA 1Z91A 2VASA 1L0OC 3HPGA 2KIUA 1ZQ3P 2VOOA 3FK6A 2FOWA 1QZEA 2VI6A 2KKOA 1TWCJ 4CCMA 2QM3A 1VQ4I 3C1DA 1MBGA 1Z1DA 3W6VA 3HSRA 1R1VA 1TNTA 1Z3XA 3MCZA 1OCRH 2EV5A 2RAEA 3SQNA 1QHHD 4IHXA 2RNGA 2E36A 2DMUA 4PJJA 3T1BA 4DZJA 4YFXF 4YFKF 1MNDA 1D3YA 2CU7A 3VFZA 1KU2A 1AU7A 3F22A 4UVBA 4XLHA 3LSKA 2DBBA 4XOPA 1H89C 3L00A 3TKYA 1W4MA 3GW2A 2V26A 4YIIA 1KZHA 5L3GA 2AHQA 3D5SC 3CCVI 3G1LA 4A0YA 2H6BA 3GFMA 5FROA 3RYPA 4ESFA 5DD8A 2OAZA 2VPRA 3JR9A 3R61A 1MSFC 4RB3C 2J5OA 2XIGA 2BBYA 5E1ZB 3CCRI 4ENJA 1U5TA 1YI2I 2JUCA 4UY8I 2XB0X 3FBIB 4Y15A 4UV9A 3HUGB 4XBFA 2WA0A 3OMYA 3GYHX 1XGMA 3CJRB 3MKLA 3TO7A 5HS9A 2CO5A 4NNJA 3G3ZA 2X0LA 2XVCA 4L9VA 1K61A 1JJ6C 5F0HA 2I10A 1I6XA 4PZJA 2B7EA 3IH2A 3WHCA 1DQUA 2OU2A 1Z77A 3TEDA 2VJIA 1MMSA 4I98B 2JK3A 4KICA 2XASA 3BP8A 4LB5A 3D5LA 2EQRA 1B9NA 3D5RC 5EGOA 3FX3A 1KONA 2W7NA 3B6CA 4IRHA 3GTGJ 1OJLA 3CDLA 2FNPA 2Z99A 1BOAA 2KQRA 2F5VA 1LDJA 4JX4A 1STZA 1ZTRA 2Q2EA 5B1AH 5HDNA 1ZGJA 2X51A 3ZQ7A 2E7WA 2VN2A 5B5EC 4HX7A 1F9NA 5CPRB 2QA4I 3S16J 3RZDJ 2EILH 4IQJA 2DI3A 3ECHA 3PQJA 2EINH 4BHPA 3BZ6A 4MTDA 5H6QA 4MFEA 3O2PE 2O7OA 2VQHA 5M5XJ 2R7SA 3CO6C 1XGNA 2OCEA 2OQRA 2K40A 3CC4I 3VSLA 3J7AO 4BQOA 1HDPA 2CQ7A 3IAM2 2LKPA 3OV8A 5F0CA 3DKYA 5JLXA 3JAMZ 3M4OJ 1EKEA 4I09A 3TDZC 4CCNA 1CF7B 2A69F 3BG7A 3PSFA 1FMWA 2NOGA 5ILSA 2WWYA 1YE9A 3BJ6A 2RNJA 3S14J 5BMZA 1X19A 2NOJB 3RTRA 1VI0A 2JRMA 1TW3A 1FBUA 3O8HA 4LK1F 4DYRA 4HNTA 4YELA 1EH8A 2NNYA 1MBHA 4AIDA 1MDMB 2L4AA 3F3XA 1I5ZA 1G8XA 2K9NA 1H9GA 3R60A 5E3LA 1LDKB 2EZKA 3K4JA 2YUSA 2X48A 4Y13A 2IP2A 4A3MJ 4RBOA 3VYUB 2KZGA 1I39A 2ZSHB 2DK8A 1ETOA 3FXMA 4I0BA 5LBQA 1YG2A 4M6VA 3ZQFA 1MW7A 2P6TA 4XN0A 3FXUA 1FIPA 2A5WA 4LD5A 5IP7J 3G2BA 1SD4A 2RQPA 5E17F 2MD0A 2K86A 1A36A 1UHWA 3F8BA 4PFPA 2WY7Q 2R4GA 1K6OA 5FJ8J 1I3QJ 2IPQX 2DYSH 3S1QJ 4MEYF 1XPXA 2HOEA 5K5QA 1XN7A 4HX8A 4IQ4A 1MBFA 1RKWA 2X1CA 2J5PA 1WH7A 5LGUA 3BTCA 2M7BA 3GMEA 3AL0B 5HS7A 2VQGA 2E60A 1GVJA 3CP2A 2QUFA 4GRIA 2JA5J 3A02A 1XC5A 2KRCA 4L5JA 2L02A 4Z6YA 5JI6A 3I5UA 1VQ7I 3CCMI 1IV8A 4BE1A 3CC7I 3R0AA 4V19K 1LPQA 3BQYA 2DODA 2WV0A 4PK4A 1Q1VA 1EA3A 4XN3A 2W24A 2HGCA 1FZPB 2Y0SN 2A5YB 3H9GA 2LBFB 2R0QC 1C0WA 3CLQA 2ZXHA 4PSWA 1J5YA 2F4IA 1G3SA 3C2HA 2FQ4A 2W25A 3BJAA 5FGMA 4O3MA 2O6GE 2O0YA 4IHYA 2QBYA 1EH6A 2BXZA 3CCYA 2CW8A 1LEAA 2R7QA 3J80K 3IH3A 4L9NA 2NVQJ 3HOYJ 1LQ1A 1RRJA 5FLMJ 2HVRA 5AONA 1U5TB 1YX5A 1ZGAA 2HTJA 2QQ9A 2QQ8A 2V4JC 4JK1X 4M3GA 1MJAA 5DUKA 1B8IA 1P4WA 3C7JA 1U78A 3TGNA 4ZYAA 3BR2A 4G6DA 4N9HA 4Y52J 4PUSA 2HQAA 3IWZA 4OAYA 1T38A 4UVAA 2PFBA 3K9TA 1RETA 2IA2A 5DM7F 2HU9A 1YLFA 3RPUD 3JTGA 2NVYJ 4I0AA 2JQ7A 2D2WA 1ENHA 4XLAA 3ZXSA 5DTDA 1SFOJ 2EZLA 2LVSA 3F8MA 2BEOA 3Q0UA 3HRSA 3J80Z 1VFCA 1R58A 2MLKA 3PO2J 1MKMA 2RKHA 2Y0MA 4S05A 2EB7A 3GLLA 3WTXC 3DPTA 1I6HJ 2XGEA 2R7UA 1IRGA 4UB6C 5DM6F 3CCQI 2HDDA 3QAHA 1Y1WJ 1R4MB 2ZMEB 3ECOA 3BQZA 1VQ8I 3HRUA 4CCLA 4RAGA 4C30A 1PP7U 1WI3A 2M0CA 1FOXA 2PMZN 2M4GA 1X3ZB 2XSDC 1SMYF 2DFIA 2V9KA 4UHTA 5CVUA 2JVGA 2EIMH 5ICCA 3Q3SA 1R7JA 4FHTA 3JSOA 2CQKA 4HV6A 5EG0B 2W48A 3HOXJ 2XAGA 3RPQA 2FE3A 2QKLB 2FRHA 1X2NA 4IXAA 3WE2A 2OV7A 3RQIA 1JXSA 3S1NJ 2VKEA 2FA5A 4PJLA 3I4MJ 1JHHA 1KU7A 5CJ9A 4DJAA 4BDYA 1FC3A 1BI1A 1SAUA 1DDNA 5F1RA 2QENA 3IH4A 5F64A 4MGRA 1IN6A 1RNLA 2FBKA 1OPCA 3KP3A 1L3LA 3DWLE 2XHKA 4IEJA 3PL8A 1W5SA 1YHQI 2K27A 3NQOA 1MBKA 5K5OA 5EEGA 2LYCA 3F0CA 4KT6A 5D4RA 3FHZA 4RS8A 4QPOA 2MH9A 1ZG3A 2JMWA 3FF5A 4U7BA 2BVLA 3WTYC 1Y0NA 2HI3A 3T0YA 4DYCA 3W3CA 1GXPA 1FSEA 2VL8A 4XSZF 1Q1HA 2M3AA 4C3IJ 5HLGA 3MEXA 3ZP5A 3FMQA 2PI0A 2PLYA 1JKRC 2CFXA 3LA2A 1IRZA 2LSOA 2M34A 1QRYA 2KMUA 3RDIA 1NK3P 3KP2A 4E70A 2LFBA 1WJAA 4EGZA 3GTJJ 3OYFA 3CMEI 4KIGA 4EGYA 2R92J 4S0HB 3NRVA 2E2HJ 1OYWA 3M1EA 4I6ZA 1V55H 1JTXA 3HPHA 3L2WA 2XPUA 3V8LA 4DOZA 5F1JA 2LMDA 2CQXA 3AG1H 3CMMA 3DU5A 1W5CC 3WU2C 4K2EA 1WRJA 4HF0A 4Y3OA 4HDUA 2VOPA 3KZIC 1N25A 1QA6A 4XONA 4EJOA 5EZGA 1MMNA 3IRQA 2VLAA 5HODA 3PNYA 3K4LA 3WTVC 3K2AA 1ZAOA 4BQQA 3HOUJ 1GT0C 1K78B 3VEPA 1XB4A 4A3FJ 1WJFA 2ISYA 3JSPA 5FD6A 2ZJPF 2RVCA 4ETSA 3KLOA 3HZJA 1RPWA 4P9UA 1OCPA 4HDVA 1TL8A 3R6SA 3QODA 4GCVA 3LSPA 5GTHC 2DQRA 4CO8A 2LP0A 2EIKH 1DGWY 4CZCA 1S7AA 2XF6A 3IUOA 1BN5A 1YFHA 4B4CA 3CCUI 1IN4A 2K4BA 3GTQJ 2GIVA 2ZJRF 3S2HJ 2WTEA 1SFUA 1FEXA 1ZREA 3TW6A 5EG0A 1USSA 5E8IA 3EYYA 2HPMA 5HLTA 4CCOA 4B44A 5IY5H 3S3MA 4B8XA 4AIJA 3E6MA 1BI2A 1YO5C 4IHSA 2P7VB 1U9OA 3LMMA 4HOBA 4GO1A 3TO6A 5BOXA 2DFFA 1R5GA 3I4PA 1SFKA 2CQQA 1I27A 4CZZA 4ZTFA 3OS1A 2PJRA 1D1CA 1X1AA 3KLNA 2A3SA 5CVJA 4AYBN 4G7OF 5C4JJ 2EIJH 5J1UA 2OCCH 2VUMJ 4LIUA 3CESA 1X3WB 3FHNA 4NC8A 4B43A 1GXQA 4AIKA 2CG4A 4FASD 4EEFG 4HBLA 3S1RJ 1S7EA 4BKXA 4F52A 5IOYA 1MMAA 4XORA 4A3IJ 3K1NA 4RLFA 5ICEA 3K4NA 3KIOA 2JZYA 3J7AY 3ESWB 4AC0A 1ZG5A 4KIFA 2NAZA 3UNGC 3K2ZA 1UHSA 1OCOH 5ED4A 2GOMA 2KJBA 4J00A 4OAZA 5FFZA 1W7PB 4QWQA 3AKZA 1Y39A 4CYCA 1BIAA 3BZCA 4DBRA 4GFBA 4BU2A 4IRGA 4UUSA 1ON2A 2NNNA 1D0YA 3IKTA 2QZ8A 3V7RA 5E18F 2CSOA 2DA4A 2P81A 1U9NA 1VQLI 3F6OA 2ZO4A 1P7IA 5D8LB 1FP2A 1DPRA 3OYMA 4M73A 4OIQF 2JN6A 2DCEA 2JT1A 2DXIA 3ULQB 2R7FA 2CV0A 1IUYA 4IX7A 1BBYA 1W5TA 2W4SA 4QSHA 5EDNA 3JRIA 5TRDA 1YRNB 2HOTA 3RZOJ 1IZ1A 1MNEA 2EK5A 1FIAA 2JSCA 5D4SA 1HSJA 3KZZA 3CJQB 4B1RA 3OYGA 4R79A 3BOQA 2PMUA 4P55A 1H0MA 1WWXA 4F55A 1AKHB 3BY6A 5LHGA 4G9YA 1S8NA 3LQRA 1LDDA 4M3FA 3HKZA 4HLYA 3VSKA 4MTEA 3E6CC 3S32A 4DQ2A 4CXFA 3E3VA 3L9FA 4AU7A 2LF8A 5L3FA 2M2EA 3C2BA 3JAMK 1A6QA 3F8CA 1K6YA 3OYLA 3QPHA 3CUQA 4HQEA 3GTLJ 2P4WA 2XAFA 3G1OA 1MIJA 2HFHA 3JRGA 4A3DJ 4RGSA 3L7WA 4BUPA 2M7AA 2GXBA 5FLVA 1WJDA 1RI7A 1G3YA 3HRTA 2JA6J 3I55I 1T0FA 1D0XA 2GWRA 3CUOA 4XM3A 4BEHA 2L7FP 2QEXI 3M07A 2BV6A 2GIZA 4D7NA 5HNHA 3ABLH 4BJTA 3ROUA 4IL6C 3Q5FA 1SD7A 2VBXA 3V8JA 3OYKA 4RA2A 5LHIA 1Y56A 4UV8A 4XLEA 5LEKA 1AA7A 1XGOA 3LSRA 3VOEA 2Z3YA 4XLNF 1YJ9I 2X6XA 4L18B 4M9SA 2UUZA 1G6NA 3B02A 3QWLA 4WXHA 3PIPF 2IS2A 4F91B 5A2QK 4PCQA 3TOBA 2L54A 3COAC 2R5YB 3PFIA 5LRSA 1MDMA 1ZK8A 1VQ5I 2RREA 1PP8F 1O7FA 1HKTA 2CWEA 1XD7A 2OTLI 3E6DA 3SDBA 2R7WA 2L3DA 4L0ZB 3S3OA 2Q8KA 4XKWA 4NB5A 4IZZA 3FBNB 1IW7F 1W0TA 4IKFA 3BR3A 4X0GA 4M74A 4E4HA 2VJ5A 1ETWA 2IGNA 2CMPA 1BI3A 2HOAA 2L0KA 4LMYA 3O3KA 3ABUA 1R22A 3OYEA 3HYIA 5EEAA 2P5LC 4BDZA 1Y8QB 5H2FC 1EV7A 1IRFA 3K7AJ 5CVIA 5D5UB 5D6FA 5EGOB 2K9MA 3WTTC 2OJED 2EWNA 2ZKZA 2IVMA 1V54H 1S7OA 4UB8C 4FTHA 2R7XA 2DA1A 1Z21A 1JT6A 1XG1A 1QO0D 3BPVA 3IP4B 4HA8A 1BL0A 4IHTA 1JGGA 5C3EJ 3T5XA 3DBLB 4AVZA 2E5NA 2KRHA 3CF5F 3M3YJ 1V5EA 3HGGA 4A69C 2DMPA 2DU9A 2QSFX 3GEZA 3K10A 2NS8A 5FD5A 2K85A 3BCAA 4BGDA 1W36D 2GA1A 3LSJA 2ZBKA 4F3QA 1GDTA 2JUGA 1TQIA 5GAEJ 2BVMA 2MC3A 3S1MJ 4XRMA 2KLOA 2HXOA 2VT3A 3ZN1A 5IPAA 3QP5A 3IV5A 1EJ9A 1BI0A 1ORKA 1FJLA 5EJCA 3H3VK 4HF1A 1V4RA 3OIOA 1OYYA 3TP3A 1J75A 4XMYA 3GWZA 1MJBA 4MQ9F 4U0VA 1J59A 3KEYA 2AQFA 2HDWA 4BY1J 4ESJA 2LKXA 3OYNA 3J7YJ 2YX7A 3BG9A 1YOVB 3EETA 3OOPA 1DPUA 4PDKA 1DU6A 3TQNA 5J40A 4A93J 4I2OA 3WGGA 2CS3A 1HKSA 5ICFA 3W6JB 3DF8A 2DTZA 2MGQA 1OR7C 4BBRJ 2OTJI 3JRHA 4J01A 1V5GA 4OOIA 4II3A 3K4KA 5CVVA 1A6IA 2IBDA 1KYWA 2X4HA 3TDUC 2ISZA 2R7VA 2HQNA 3FXRA 4OIPF 3ERED 2WV1A 5AIPA 1PVEA 1J09A 3BR6A 3FXQA 1BR1A 5M5WJ 4JX6A 3LAJA 4KUMA 3LFUA 5FRMA 5IYBJ 1RUOA 1ZR4A 5HLHA 3CC2I 3KPHA 2K9QA 3RJPA 5GPAA 3WHBA 4DIQA 2MLGA 4ZDLA 1PUEE 4HW0A 4B48A 3V42A 3E0JB 5L3BA 4A3KJ 3LSMA 4M3DA 5EF6A 1UHMA 3I58A 5C44J 1MH4A 2BW3B 2HWVA 2E2JJ 3H0DA 1D8KA 2CUEA 3HL2A 3J81Z 1NTCA 2EFQA 3CTAA 3ZOBA 2DMTA 3LSIA 2EFOA 5LEJA 4KDPA 3RKQA 2PQ8A 3Q0VA 5LFAA 2E1CA 4CH7A 3CUQB 3P5JA 1JJ8C 2DA7A 1IXRC 4KITB 3GBGA 4EM0B 4HX4A 2DMNA 1E3PA 2HYJA 2ELHA 1W1WE 4WWCA 2VE9A 1FOWA 3G71I 3GTMJ 1R49A 3L09A 3ABTA 3ZN0A 5J8FA 4E7HA 1OKRA 1AKHA 4C2TA 1TTYA 1LFBA 1Z0XA 3MMYB 1DP3A 4RB2C 2DDAA 4XRFA 3CZ6A 2KDZA 2H8RA 5F08A 2VB6A 1SD6A 4XLFA 5D5VB 2V6CA 3QRFF 4NUBA 6PAXA 2VC0A 4UNOA 1Z3YA 2R7DA 4BY7J 2PEXA 1HOMA 2MBFA 2VQCA 1XDSA 4M9XA 4V2GA 1U8BA 2BZTA 5ERIA 2ESNA 2PG4A 3ONQA 2CUJA 1HSTA 2OPTA 1G59A 2P6SA 4LFUA 3A01A 5HS8A 3PQKA 5JVTA 3HEFA 5K5RA 2X6YA 3F23A 1T2KA 3HUGA 5K7ZA 2KRFA 3H1CA 3IL2A 4BAYA 2NS7A 4UUSB 1J7KA 4B3AA 3QYFA 3S15J 4M3EA 2ETHA 1W7PA 3KYCB 4IVNA 2PJPA 1E0EA 1X1CA 2LY9A 3KP6A 2R5ZB 1WPKA 1R71A 3GFIA 2XRLA 1EF4A 1TNSA 3K69A 2BY3A 4NC6A 2V1NA 2VJ4A 2BY0A 4D9JA 1SEUA 2P7CB 1FBQA 2G9WA 2G7HA 2HEOA 2JA2A 4E7IA 5DV5A 2LNBA 1WJEA 3C3WA 3TW7A 1FYMA 4KNYA 1PUFA 2V6EA 2JRTA 2HZDA 1X4PA 4H4KC 2ZJQF 5EEHA 4A3LJ 1IXSB 3I54A 4MFDA 3TMOA 2RN7A 1T6SA 4JP0A 2WAEA 3ASNH 3BWGA 1Z7LA 2Y9ZA 3KP4A 4KN4X 2E19A 4HZFA 1PUFB 4D5CA 2HYFA 3GTKJ 2N8GA 1WFXA 1TWFJ 1U3EM 4B3XA 4EJTA 1CGPA 4UUVA 3FM3A 4O5VA 1SVLA 4OU0A 3WODF 1GLNA 2ZMEA 1XS9A 4NDLA 1O3TA 3OL3A 3K4CA 1IXCA 4M6YA 2CUFA 1HF0A 4W97A 2AXTC 3SFIA 4XOTA 2IS4A 3K4MA 2ECBA 3OS0A 3LSGA 3QOPA 1MGTA 1R5HA 2ZXIA 2TCTA 2MFZA 3DEWA 4KIBA 4E7KA 2P0WA 3PM1A 1T95A 2Z1DA 1T98A 2DAOA 2K9LA 2XDVA 3FZVA 2B63J 3PSIA 3FXOA 4F7ZA 1BJZA 1X1BA 3IRRA 3LSTA 4FT8A 2CH0A 2VBYA 3CLOA 3F72A 1KGSA 2AQEA 2DMQA 1O7LA 4ENNA 2AO9A 2K7LA 4YIRX 3H3ZA 3U9GA 3G73A 2RDPA 2PX9A 4B09A 1GUUA 1ZLJA 3CCJI 2LK2A 1UZCA 3SFZA 1F5TA 3EYIA 4JX5A 1N77A 2LDUA 1J9IA 3ZQGA 3JRFA 1D8JA 1S3JA 1BJAA 3ISPA 1YITI 3E5QA 2HOSA 4L9JA 3V7CA 1UG2A 3BC8A 1LJ9A 4XICA 2OBPA 2FMLA 1O3SA 4FISA 2YS9A 4LOCA 2O03A 2Y2ZA 4E7LA 4GYIA 2LH9A 5KAIC 1IRXA 4LIVA 3B6AA 1FT9A 3N4MA 1VQOI 1VQKI 2A6EF 1ETQA 1X3UA 2UV1A 4BE0A 2W85A 3E1SA 4XKCA 2Y69H 3DBRB 1ZARA 4UXNA 1IGNA 4XKBA 3CJTB 3EDPA 2EJRA 3A1YA 3AFHA 3R4KA 2XGCA 3G4SI 3HOVJ 2AS5F 1YYVA 2Q0OA 3CD6I 2HZTA 3OIPA 4A0ZA 3RKWA 1WZ2A 2FBHA 2GOXB 1EH7A 4C2MJ 1REPC 4ASNA 4OMYA 2YPRA 3GTOJ 1Y0UA 4YEJA 3DKWA 1UELB 2DA6A 2NXNB 2ZMEC 2LF7A 4RGUA 5H6RA 3FMRA 2STTA 2LRDA 2K02A 1LUJB 4C9YA 4I01A 4CGZA 2A05A 5A2QZ 2UWMA 3MAJA 5E1WA 4YG2F 2VXDA 4HEA2 3OYCA 1NG7A 3UKGA 4XRSA 2H1LA 3A4CA 3RSNA 3SZGA 2QKMB 2RC4A 3WGIA 1WCMJ 4PGGA 2DFEA 4JBAA 4NQWA 2JTVA 4CA0A 4F93B 3WTSC 5J4YA 2XKOA 5B1BH 1IO2A 1RR8C 3BTJA 3VYSB 5E79C 3K0LA 3PNVA 3O6BB 1IG7A 3GXOA 2K9SA 3SZPA 4IOCF 1MNMC 1QZZA 5J1YA 2DJIA 1P7JA 4NC7A 3ZMUA 4BJ5C 3M9AA 4P9FA 5GAGJ 4G8XA 1Z6TA 2FOKA 2ZB9A 3WG7H 3GUDA 1JUPA 1ZGWA 2LKSA 4CDGA 5FO5A 2CQNA 3HRMA 4ABZA 4BS9A 3FISA 3OR2C 1XSXA 1AHDP 2M30A 3ABMH 3E5UA 5HVQC 4A2UA 1WKMA 1ZELA 3WE3A 1H9TA 3LOCA 3ABKH 3WG9A 2E1MC 3VDXA 3EUHC 3KETA 2HQRA 4EJVA 3DBHB 2DT6A 4OIRF 4ZYEA 1YRNA 4YRVA 5BPDA 3CP8A 4LG0A 3S17J 4XL9A 3IC7A 5LGTA 2O5RA 3I0TA 4E7JA 4S04A 4PGHA 2D1VA 4RB0A 4I02A 2DJNA 2DA3A 4A3BJ 4KYWA 4LG0B 2FXAA 2M8EA 1SFXA 1ZR2A 2DT7B 1A31A 1GVDA 2E1MB 3RIRA 2XF5A 3ML6A 4BYYA 4HRIA 4BH9A 1F36A 1OQYA 1ONVA 4OWRB 4JOMA 4WCGA 2YSRA 3VB2A 2A61A 2HKOA 3BR1A 1WJBA 2W82A 1Z7UA 3W2WA 2QBYB 5L3DA 1A04A 2ZFUA 4II2A 2MW8A 2NVTJ 1FWZA 3SEZA 1UJ8A 4PJMA 2M87A 3N05A 3M8FA 2IGOA 1IF1A 4CICA 3JW4A 4FX4A 1KU3A 4CSWA 1OLTA 2YX4A 5J6XA 5JR3A 5F0FA 5JVGF 2P5VA 1U0JA 2FSWA 3EQLF 4Y17A 5JHUA 4M71A 1P4AA 1HW2A 4LLNA 3Q9SA 2HTSA 3JCUC 3U21A 3QPLA 1ON1A 1LEBA 4XSXF 2HKXA 1K83J 3D0SA 4U0YA 4G7ZF 3BLYA 1ZG1A 4WK8F 2NYXA 1S6LA 1TBXA 1AOYA 4HG2A 3VYTB 2VONA 1TC3C 2XKPA 3MZ8A 2LOOA 1R4NB 3KX2A 1NK2P 5DD4A 1ZH5A 1OISA 2R7TA 1P2FA 1G3TA 3HOWJ 4L0YB 4FE4A 1D1AA 5EYRA 5CYVA 2A6TA 1KA8A 4NQWB 4I99C 3I56I 2DA2A 2A6HF 4R8HA 4QIWN 4LLGF 2V1XA 1R00A 2VC1A 3GTPJ 3FIWA 1D0ZA 2OD5A 3ZQCA 3DCFA 4D0PA 3HOZJ 2X9DA 2Z2SB 4LJZF 2COMA 1QNTA 4P1WA 5FKOA 1S9HA 4A6EA 2EZIA 3MKWB 3VODA 5E3MA 1K78A 4ZJZA 3J81K 5BPIA 5DEQA 2KJCA 5F6FA 2FU4A 2IW5A 3C2GA 1LKXA 3P9IA 4W1UA 3TO9A 4X1EA 1S5LC 2WB1N 2Q1ZB 1PDNC 2DPUA 3DLLF 3ZQQA 4L9TA 3QYEA 3OYBA 3FXJA 4X6AJ 1G2HA 4U87A 2XUBA 3RKYA
chains in the Genus database with same CATH topology
4ENKA 1UB9A 1HW1A 4KA4A 1YW7A 4MQVA 5CLSA 2QVOA 5TJJA 1UFMA 4Q4ZF 1FYKA 1XMKA 2VBZA 1I1SA 4OINF 3MFKA 2EV6A 2EFWA 2Y75A 2OA4A 2M1BA 3RPUA 3U2RA 4A12A 1MZBA 2W57A 2CGPA 1BM9A 4KFCA 4A6DA 1KQ8A 2V1DA 3ELKA 1ZN2A 1GHCA 5FLXZ 5IT9Z 1K7AA 1FX7A 3GFLA 4HLXA 1ZYRF 1FPQA 5DUIA 1SMTA 4BNCA 3B73A 1QQIA 2GQQA 5JFRA 1IN8A 2F5EA 3WGHA 2HS5A 4A0XA 2XAHA 4GYGA 2STWA 2Y48A 2JPCA 4EM1A 2NS0A 3GO5A 3HHHA 3QPTA 3I53A 2F2EA 2EA4A 1E17A 3SXYA 2OZ6A 2UXXA 1ODDA 2FNAA 2O3FA 1FBSA 4NHJA 1BC7C 3R0JA 3LFKA 2RV8A 4BHBA 1G4DA 3W6KB 2DT5A 4P96A 4ZYHA 3CDHA 2BE5F 2OQGA 5E1XA 2G7UA 3BROA 3FWEA 3KP5A 4U7DA 4U0WA 2H27A 3Q9VA 1U5TC 2FMYA 3GLXA 2H09A 4N9IA 3RKXA 3T8RA 1TQMA 2E1NA 1U8RA 1WQ2A 1P4XA 4MHGA 3S2WA 1WI9A 4AD9A 3KCCA 3LAPA 1R1UA 1RUNA 2E7XA 4XLPF 1S29A 2CYYA 3HSEA 1YW8A 3JTHA 2V1UA 4N0BA 1HBXG 2C6YA 4Z2YA 1DUXC 3DPLC 2GZWA 1FNNA 3HOSA 2PBIA 5D6EA 3MZHA 4BXUA 1JHFA 4A5MA 2W84A 3DV8A 1Z6RA 1ZRDA 2GAUA 2VT2A 2IA0A 2VBWA 3LA3A 2F5DA 2DLLA 4DNCA 3ZMVA 3V4GA 3QU3A 1IAWA 1B1BA 4BHCA 1YS7A 2JPBA 2O61A 1OR7A 2L4MA 1P6RA 5LRRA 1B4AA 4L5IA 1QPMA 3P7NA 3ZMDA 1OYIA 1FSHA 4EJWA 1RZ4A 2DQLA 4O6JA 3I64A 5LGNA 1FP1D 3P9KA 3I59B 3C18A 4HAMA 2H6CA 1USTA 2IRFG 3ZPLA 2XAQA 4AVPA 4WXCA 2XROA 4ZYDA 1XGSA 3HTSB 2KIFA 4KMFA 4MNUA 2QWWA 1UCRA 3DFGA 5FB2A 2UZKA 2EA2A 1MD0A 4ESBA 4ZYGA 4Q48A 2VXZA 4RGRA 4CHUA 2Z9OA 2GXGA 3F8NA 2Z5UA 4G6QA 3N97A 3SHFA 3QP6A 1XSVA 2M45A 4LK0F 2DTRA 3DQVC 5AIQA 4TV7A 1V3FA 4FX0A 3WU0A 2MD5A 2EV0A 2OZUA 5HDKA 4JQFA 2UXNA 1HW5A 4AWXB 2FBIA 4IPAA 1B59A 2ADUA 1W7PD 5FFXA 4GXOA 1RIOH 2XV4S 2CW0F 2DO7A 3U1DA 3M7GA 3WTWC 3WTUC 1YQAA 2ZXJA 1F4KA 1F1ZA 3L2CA 4EM2A 2DK5A 2HDCA 2ZFWA 3T8TA 5K1YA 1KYZA 2ZCWA 3GF2A 1O3QA 1LB2A 4RAZA 3KEQA 1ZRFA 3RYRA 2IA1A 4HQMA 2L01A 3K1PA 1JGSA 3KE2A 3F6VA 2ZJ2A 1XSDA 4HV5A 5E8GA 5BS6A 1CF7A 1HKQA 2B0LA 5LHHA 4LLLA 1T39A 5ILVA 4ZZDA 4EJUA 4M9ZA 2MH2A 4G94A 2DW4A 2NRAC 2BYVE 4ZH4F 1DP7P 5D5XB 1ZRCA 2FQ3A 3BJOA 2IT0A 1B6AA 2KIMA 2TDXA 3K1MA 2HYGD 1D5VA 3DXJF 4KT5C 1AWCA 3KZYA 5KK1A 2K4JA 3WTZA 5E20A 1QGPA 3MWMA 2IJLA 2ESHA 1U6GA 2VE8A 1Z05A 2F5CA 4OMZA 5L3CA 1BIBA 3IWFA 3IKVA 5D5WB 3E97A 4M6XA 5LLQA 4GGGA 3RI4A 2XGXA 4Q47A 4AIHA 2PMHA 2BGCA 3I59A 5KVRA 4OIOF 4EMSA 1I1GA 4G7HF 1OMIA 3H92A 5J8CA 1IN5A 2D45A 4RB1A 2GA2A 1QZYA 2QLZA 1KU9A 1YIOA 2ZNYA 1B9MA 4P5OA 3I71A 4KN7X 4LGWA 1JE8A 4IF4A 3QU6A 2H94A 3GVAA 3CO7C 1G3WA 3V8KA 3CUQC 4QLCU 4RAYA 5ICGA 5IT3A 4ENMA 1HQCA 4BQAA 3LWFA 1U2WA 2R3SA 3EUHA 2AXLA 4UVCA 1ZLKA 1SD5A 5DDGA 2QYOA 4EV0A 3KEOA 4ZZLA 3REOA 2DPDA 3TOAA 1FOKA 2V9VA 5FLXK 5IT9K 2O8XA 2XAJA 1YS6A 5DCMA 3H3UA 4U88A 3BPXA 4LB6B 1FYLA 3E5XA 3HTUA 3KFWX 2D1HA 1VTNC 4EVIA 5DYMA 3F8FA 1XCBA 3ZMSA 3GX4X 3NEUA 2RGVA 1E2XA 2ACJA 2HR3A 1P92A 3GZ5A 1HXDA 3FMSA 1TW2A 3CJNA 4I7HA 4A5NA 1Z9CA 2XRNA 1FLIA 3AAFA 3HIFA 3P9CA 4WX9A 4HF2A 2A07F 1J0RA 2V79A 5BQTA 3LQQA 1R1TA 2ZNZA 4R1HA 1YW9A 3MZYA 3ZMTA 4WXDA 5H20A 2PN6A 2FEZA 1QBJA 1WSUA 5D8KB 4RGXA 1R36A 2FF4A 3KP7A 4CYDA 3GFJA 4H0EA 3GZ6A 4YIFA 1K79A 2WC2A 5HOOA 3IHUA 2F5FA 1LVAA 4WF2A 2M5WA 2P5KA 2Z33A 3DP7A 1TLHB 5HLIA 3MQ0A 3E6BA 1XMAA 5DCMB 3V7SA 1O3RA 2YR2A 2P8TA 3HOTA 4MEXF 3DEUA 1TQPA 5DCFA 1KQ0A 4IJAA 1J2XA 5HDGA 3F21A 3M8EA 4Q5SF 4M72A 2QQBA 2QQAA 3FM5A 1NHAA 3SZTA 4HYEA 4IRIA 1ZHFA 1LNWA 2YU3A 2EFPA 1ULYA 2EFNA 4ON0A 1O57A 4KMUX 3HSFA 2MA3A 2VODA 1SAXA 3HHGA 5CVRA 1IN7A 1FY7A 3ZMZA 3WU1B 1R23A 1MJ9A 5ILUA 1SFEA 1KQ9A 3LA7A 1YTYA 1XDUA 3BDDA 1XCVA 4YFNF 5L3EA 4EQQA 2A68F 1BC8C 1Z91A 1L0OC 2KIUA 2VOOA 2KKOA 2QM3A 3C1DA 1Z1DA 3HSRA 1R1VA 1TNTA 3MCZA 2EV5A 3SQNA 3T1BA 4YFXF 4YFKF 1D3YA 3VFZA 1KU2A 3F22A 4UVBA 2DBBA 3L00A 3TKYA 1W4MA 3GW2A 5L3GA 4YIIA 4A0YA 2H6BA 3GFMA 3RYPA 4ESFA 5DD8A 2OAZA 3R61A 4RB3C 2J5OA 5E1ZB 2XIGA 2BBYA 4ENJA 1U5TA 4Y15A 4UV9A 4XBFA 3GYHX 1XGMA 3TO7A 5HS9A 2CO5A 3G3ZA 2X0LA 2XVCA 4L9VA 1I6XA 4PZJA 2OU2A 4I98B 4KICA 2XASA 3BP8A 4LB5A 3D5LA 1B9NA 3FX3A 4IRHA 2FNPA 2Z99A 1BOAA 1LDJA 1STZA 2Q2EA 5HDNA 1ZGJA 3ZQ7A 2E7WA 2VN2A 4HX7A 1F9NA 2DI3A 3ECHA 3PQJA 4BHPA 3BZ6A 4MTDA 5H6QA 3O2PE 3CO6C 1XGNA 2OQRA 3J7AO 2LKPA 3OV8A 3JAMZ 3TDZC 4I09A 1CF7B 2A69F 5ILSA 2WWYA 3BJ6A 2RNJA 5BMZA 3RTRA 4LK1F 1TW3A 1FBUA 1EH8A 2NNYA 1MDMB 2L4AA 3F3XA 1I5ZA 1H9GA 3R60A 1LDKB 4Y13A 2IP2A 2DK8A 5LBQA 4I0BA 1YG2A 2P6TA 3FXUA 4LD5A 1SD4A 2RQPA 5E17F 2K86A 1UHWA 3F8BA 1K6OA 2IPQX 4MEYF 2HOEA 5K5QA 1XN7A 4HX8A 2J5PA 5LGUA 5HS7A 1GVJA 2QUFA 4L5JA 5JI6A 2L02A 3I5UA 3R0AA 2WV0A 2W24A 2HGCA 1FZPB 2A5YB 1C0WA 1J5YA 1G3SA 2W25A 3BJAA 5FGMA 4O3MA 2O6GE 2O0YA 2QBYA 1EH6A 1LEAA 3J80K 4L9NA 1LQ1A 5AONA 1U5TB 1ZGAA 2HTJA 2QQ9A 4JK1X 1MJAA 5DUKA 1P4WA 3C7JA 1U78A 3TGNA 4G6DA 4N9HA 3IWZA 1T38A 4UVAA 2PFBA 3K9TA 2IA2A 1YLFA 3JTGA 4I0AA 2D2WA 3F8MA 2BEOA 3HRSA 3J80Z 1R58A 2MLKA 1MKMA 2RKHA 2Y0MA 4S05A 2EB7A 3WTXC 3DPTA 1IRGA 3QAHA 2ZMEB 3ECOA 3HRUA 1PP7U 1SMYF 2DFIA 4UHTA 5CVUA 5ICCA 1R7JA 4FHTA 3JSOA 2CQKA 4HV6A 2XAGA 3RPQA 2FE3A 2FRHA 4IXAA 3WE2A 1JXSA 2FA5A 1JHHA 1KU7A 5CJ9A 1FC3A 1BI1A 1DDNA 5F1RA 2QENA 5F64A 4MGRA 1IN6A 1RNLA 2FBKA 1OPCA 3KP3A 1L3LA 2XHKA 1W5SA 2K27A 3NQOA 5K5OA 5EEGA 5D4RA 3FHZA 4RS8A 2MH9A 1ZG3A 3FF5A 4U7BA 3WTYC 3T0YA 1GXPA 1FSEA 4XSZF 1Q1HA 5HLGA 3MEXA 3ZP5A 3FMQA 2PI0A 2PLYA 2CFXA 3LA2A 2LSOA 3RDIA 3KP2A 4E70A 4EGZA 4EGYA 4KIGA 3NRVA 1OYWA 3M1EA 3V8LA 4K2EA 1WRJA 4HF0A 4HDUA 2VOPA 4EJOA 3IRQA 3WTVC 1ZAOA 1K78B 3VEPA 1XB4A 2ISYA 3JSPA 5FD6A 2RVCA 4ETSA 3KLOA 4P9UA 4HDVA 3R6SA 4GCVA 2DQRA 4CO8A 1S7AA 1BN5A 1YFHA 1IN4A 2K4BA 2GIVA 2WTEA 1SFUA 1ZREA 1USSA 5E8IA 3EYYA 4AIJA 4B8XA 3E6MA 1BI2A 1YO5C 4IHSA 2P7VB 4HOBA 4GO1A 3TO6A 5BOXA 1R5GA 3I4PA 4CZZA 1I27A 3KLNA 2A3SA 5CVJA 4G7OF 1GXQA 4AIKA 2CG4A 4HBLA 3K1NA 5ICEA 2JZYA 1ZG5A 4KIFA 2NAZA 3K2ZA 5ED4A 2KJBA 5FFZA 1W7PB 4QWQA 1BIAA 4IRGA 1ON2A 2NNNA 3IKTA 2QZ8A 3V7RA 5E18F 2CSOA 3F6OA 2ZO4A 5D8LB 1FP2A 1DPRA 4M73A 4OIQF 2JT1A 3ULQB 2R7FA 1IUYA 1BBYA 1W5TA 5TRDA 1IZ1A 2EK5A 2JSCA 5D4SA 1HSJA 3KZZA 4R79A 3BOQA 2PMUA 4P55A 1H0MA 1WWXA 3BY6A 5LHGA 4G9YA 1S8NA 3LQRA 1LDDA 4HLYA 4MTEA 3E6CC 4DQ2A 4CXFA 3E3VA 3L9FA 2LF8A 5L3FA 3JAMK 3F8CA 3QPHA 3CUQA 4HQEA 2P4WA 2XAFA 2HFHA 4RGSA 3L7WA 2GXBA 1RI7A 1G3YA 3HRTA 1T0FA 2GWRA 3CUOA 2BV6A 3ROUA 3Q5FA 1SD7A 2VBXA 3V8JA 5LHIA 4UV8A 5LEKA 1XGOA 3VOEA 2Z3YA 4XLNF 4L18B 4M9SA 1G6NA 3B02A 4WXHA 5A2QK 4PCQA 3TOBA 2L54A 3COAC 3PFIA 5LRSA 1MDMA 1PP8F 1O7FA 1HKTA 2CWEA 1XD7A 3E6DA 2L3DA 4L0ZB 2Q8KA 4NB5A 1IW7F 4M74A 1BI3A 4LMYA 3O3KA 3ABUA 1R22A 3HYIA 2P5LC 1EV7A 1IRFA 5CVIA 5D5UB 5D6FA 3WTTC 2EWNA 2IVMA 2ZKZA 1S7OA 1QO0D 3BPVA 4HA8A 4IHTA 3T5XA 2DU9A 3GEZA 5FD5A 2GA1A 2ZBKA 1TQIA 2MC3A 2VT3A 3ZN1A 3QP5A 1BI0A 4HF1A 1V4RA 1OYYA 1J75A 3GWZA 1MJBA 4MQ9F 4U0VA 1J59A 4ESJA 2YX7A 3EETA 3OOPA 1DPUA 4PDKA 3TQNA 4I2OA 3WGGA 5ICFA 1HKSA 3W6JB 3DF8A 4OOIA 5CVVA 2X4HA 1KYWA 3TDUC 2ISZA 2HQNA 3FXRA 4OIPF 3ERED 5AIPA 3FXQA 3LAJA 4KUMA 1RUOA 5HLHA 3RJPA 2MLGA 1PUEE 4HW0A 5L3BA 1UHMA 3I58A 2HWVA 1D8KA 3J81Z 2EFQA 3CTAA 4KDPA 2EFOA 5LEJA 2PQ8A 2E1CA 3CUQB 1IXRC 4EM0B 4HX4A 2ELHA 4WWCA 2VE9A 3L09A 3ABTA 3ZN0A 5J8FA 1OKRA 1TTYA 4RB2C 4XRFA 1SD6A 5D5VB 2V6CA 3QRFF 6PAXA 2VC0A 4UNOA 2R7DA 2PEXA 2MBFA 4M9XA 1XDSA 5ERIA 2ESNA 2PG4A 1HSTA 2P6SA 4LFUA 5HS8A 3PQKA 5JVTA 5K5RA 3F23A 1T2KA 3HUGA 2KRFA 3IL2A 4BAYA 1J7KA 2ETHA 1W7PA 4IVNA 2PJPA 3KP6A 3GFIA 1TNSA 3K69A 2P7CB 1FBQA 2G7HA 2G9WA 2HEOA 5DV5A 2LNBA 3C3WA 1FYMA 4KNYA 2JRTA 5EEHA 1IXSB 3I54A 2RN7A 1T6SA 3BWGA 3KP4A 4KN4X 4HZFA 2HYFA 1U3EM 4EJTA 1CGPA 4UUVA 3FM3A 4O5VA 4OU0A 3WODF 2ZMEA 1O3TA 4M6YA 1IXCA 3QOPA 1MGTA 1R5HA 4KIBA 1T98A 2DAOA 3FZVA 4F7ZA 3IRRA 3LSTA 4FT8A 3CLOA 2VBYA 3F72A 1KGSA 1O7LA 4ENNA 2K7LA 3H3ZA 3U9GA 3G73A 2RDPA 4B09A 1ZLJA 1F5TA 3SFZA 3EYIA 2LDUA 1J9IA 1D8JA 1S3JA 1BJAA 3ISPA 3E5QA 4L9JA 3V7CA 1LJ9A 2OBPA 2FMLA 1O3SA 2O03A 4GYIA 1FT9A 3N4MA 2A6EF 1X3UA 2W85A 1ZARA 4UXNA 3EDPA 2EJRA 3R4KA 2AS5F 1YYVA 2Q0OA 2HZTA 4A0ZA 3RKWA 2FBHA 1EH7A 1REPC 4ASNA 4OMYA 2YPRA 1Y0UA 3DKWA 2LF7A 4RGUA 5H6RA 3FMRA 2STTA 2K02A 4I01A 4CGZA 5A2QZ 2UWMA 3MAJA 5E1WA 4YG2F 2RC4A 3WGIA 4PGGA 4JBAA 4NQWA 2JTVA 3WTSC 2XKOA 3K0LA 3O6BB 3GXOA 3SZPA 1QZZA 3ZMUA 3M9AA 4P9FA 4G8XA 1Z6TA 2FOKA 3GUDA 4CDGA 5FO5A 3HRMA 1XSXA 2M30A 3E5UA 5HVQC 4A2UA 1WKMA 3WE3A 1H9TA 3WG9A 3KETA 2HQRA 4EJVA 4OIRF 4ZYEA 5BPDA 4LG0A 3IC7A 5LGTA 3I0TA 4S04A 4PGHA 2D1VA 4RB0A 4I02A 4KYWA 4LG0B 2FXAA 2M8EA 1SFXA 3RIRA 3ML6A 4BYYA 4BH9A 1ONVA 4WCGA 2YSRA 3VB2A 2A61A 2HKOA 1Z7UA 2QBYB 5L3DA 1A04A 1FWZA 2M87A 3M8FA 1IF1A 4CICA 3JW4A 4FX4A 1KU3A 2YX4A 5J6XA 5JR3A 2P5VA 2FSWA 3EQLF 4Y17A 5JHUA 4M71A 1P4AA 1HW2A 4LLNA 3Q9SA 2HTSA 1LEBA 1ON1A 4XSXF 2HKXA 3D0SA 4U0YA 4G7ZF 1ZG1A 4WK8F 2NYXA 1S6LA 1TBXA 1AOYA 2VONA 2XKPA 5DD4A 1ZH5A 1P2FA 1G3TA 4L0YB 5CYVA 1KA8A 2A6HF 4R8HA 4LLGF 2V1XA 1R00A 2VC1A 2OD5A 4D0PA 4LJZF 2COMA 1QNTA 4A6EA 3VODA 1K78A 3J81K 5BPIA 5DEQA 2KJCA 5F6FA 2FU4A 2IW5A 3P9IA 3TO9A 2DPUA 1PDNC 4L9TA 2XUBA 3RKYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ENK A;  1UB9 A;  1HW1 A;  4KA4 A;  1YW7 A;  4MQV A;  5CLS A;  2QVO A;  5TJJ A;  1UFM A;  4Q4Z F;  1FYK A;  1XMK A;  2VBZ A;  1I1S A;  4OIN F;  3MFK A;  2EV6 A;  2EFW A;  2Y75 A;  2OA4 A;  2M1B A;  3RPU A;  3U2R A;  4A12 A;  1MZB A;  2W57 A;  2CGP A;  1BM9 A;  4KFC A;  4A6D A;  1KQ8 A;  2V1D A;  3ELK A;  1ZN2 A;  1GHC A;  5FLX Z;  5IT9 Z;  1K7A A;  1FX7 A;  3GFL A;  4HLX A;  1ZYR F;  1FPQ A;  5DUI A;  1SMT A;  4BNC A;  3B73 A;  1QQI A;  2GQQ A;  5JFR A;  1IN8 A;  2F5E A;  3WGH A;  2HS5 A;  4A0X A;  2XAH A;  4GYG A;  2STW A;  2Y48 A;  2JPC A;  4EM1 A;  2NS0 A;  3GO5 A;  3HHH A;  3QPT A;  3I53 A;  2F2E A;  2EA4 A;  1E17 A;  3SXY A;  2OZ6 A;  2UXX A;  1ODD A;  2FNA A;  2O3F A;  1FBS A;  4NHJ A;  1BC7 C;  3R0J A;  3LFK A;  2RV8 A;  4BHB A;  1G4D A;  3W6K B;  2DT5 A;  4P96 A;  4ZYH A;  3CDH A;  2BE5 F;  2OQG A;  5E1X A;  2G7U A;  3BRO A;  3FWE A;  3KP5 A;  4U7D A;  4U0W A;  2H27 A;  3Q9V A;  1U5T C;  2FMY A;  3GLX A;  2H09 A;  4N9I A;  3RKX A;  3T8R A;  1TQM A;  2E1N A;  1U8R A;  1WQ2 A;  1P4X A;  4MHG A;  3S2W A;  1WI9 A;  4AD9 A;  3KCC A;  3LAP A;  1R1U A;  1RUN A;  2E7X A;  4XLP F;  1S29 A;  2CYY A;  3HSE A;  1YW8 A;  3JTH A;  2V1U A;  4N0B A;  1HBX G;  2C6Y A;  4Z2Y A;  1DUX C;  3DPL C;  2GZW A;  1FNN A;  3HOS A;  2PBI A;  5D6E A;  3MZH A;  4BXU A;  1JHF A;  4A5M A;  2W84 A;  3DV8 A;  1Z6R A;  1ZRD A;  2GAU A;  2VT2 A;  2IA0 A;  2VBW A;  3LA3 A;  2F5D A;  2DLL A;  4DNC A;  3ZMV A;  3V4G A;  3QU3 A;  1IAW A;  1B1B A;  4BHC A;  1YS7 A;  2JPB A;  2O61 A;  1OR7 A;  2L4M A;  1P6R A;  5LRR A;  1B4A A;  4L5I A;  1QPM A;  3P7N A;  3ZMD A;  1OYI A;  1FSH A;  4EJW A;  1RZ4 A;  2DQL A;  4O6J A;  3I64 A;  5LGN A;  1FP1 D;  3P9K A;  3I59 B;  3C18 A;  4HAM A;  2H6C A;  1UST A;  2IRF G;  3ZPL A;  2XAQ A;  4AVP A;  4WXC A;  2XRO A;  4ZYD A;  1XGS A;  3HTS B;  2KIF A;  4KMF A;  4MNU A;  2QWW A;  1UCR A;  3DFG A;  5FB2 A;  2UZK A;  2EA2 A;  1MD0 A;  4ESB A;  4ZYG A;  4Q48 A;  2VXZ A;  4RGR A;  4CHU A;  2Z9O A;  2GXG A;  3F8N A;  2Z5U A;  4G6Q A;  3N97 A;  3SHF A;  3QP6 A;  1XSV A;  2M45 A;  4LK0 F;  2DTR A;  3DQV C;  5AIQ A;  4TV7 A;  1V3F A;  4FX0 A;  3WU0 A;  2MD5 A;  2EV0 A;  2OZU A;  5HDK A;  4JQF A;  2UXN A;  1HW5 A;  4AWX B;  2FBI A;  4IPA A;  1B59 A;  2ADU A;  1W7P D;  5FFX A;  4GXO A;  1RIO H;  2XV4 S;  2CW0 F;  2DO7 A;  3U1D A;  3M7G A;  3WTW C;  3WTU C;  1YQA A;  2ZXJ A;  1F4K A;  1F1Z A;  3L2C A;  4EM2 A;  2DK5 A;  2HDC A;  2ZFW A;  3T8T A;  5K1Y A;  1KYZ A;  2ZCW A;  3GF2 A;  1O3Q A;  1LB2 A;  4RAZ A;  3KEQ A;  1ZRF A;  3RYR A;  2IA1 A;  4HQM A;  2L01 A;  3K1P A;  1JGS A;  3KE2 A;  3F6V A;  2ZJ2 A;  1XSD A;  4HV5 A;  5E8G A;  5BS6 A;  1CF7 A;  1HKQ A;  2B0L A;  5LHH A;  4LLL A;  1T39 A;  5ILV A;  4ZZD A;  4EJU A;  4M9Z A;  2MH2 A;  4G94 A;  2DW4 A;  2NRA C;  2BYV E;  4ZH4 F;  1DP7 P;  5D5X B;  1ZRC A;  2FQ3 A;  3BJO A;  2IT0 A;  1B6A A;  2KIM A;  2TDX A;  3K1M A;  2HYG D;  1D5V A;  3DXJ F;  4KT5 C;  1AWC A;  3KZY A;  5KK1 A;  2K4J A;  3WTZ A;  5E20 A;  1QGP A;  3MWM A;  2IJL A;  2ESH A;  1U6G A;  2VE8 A;  1Z05 A;  2F5C A;  4OMZ A;  5L3C A;  1BIB A;  3IWF A;  3IKV A;  5D5W B;  3E97 A;  4M6X A;  5LLQ A;  4GGG A;  3RI4 A;  2XGX A;  4Q47 A;  4AIH A;  2PMH A;  2BGC A;  3I59 A;  5KVR A;  4OIO F;  4EMS A;  1I1G A;  4G7H F;  1OMI A;  3H92 A;  5J8C A;  1IN5 A;  2D45 A;  4RB1 A;  2GA2 A;  1QZY A;  2QLZ A;  1KU9 A;  1YIO A;  2ZNY A;  1B9M A;  4P5O A;  3I71 A;  4KN7 X;  4LGW A;  1JE8 A;  4IF4 A;  3QU6 A;  2H94 A;  3GVA A;  3CO7 C;  1G3W A;  3V8K A;  3CUQ C;  4QLC U;  4RAY A;  5ICG A;  5IT3 A;  4ENM A;  1HQC A;  4BQA A;  3LWF A;  1U2W A;  2R3S A;  3EUH A;  2AXL A;  4UVC A;  1ZLK A;  1SD5 A;  5DDG A;  2QYO A;  4EV0 A;  3KEO A;  4ZZL A;  3REO A;  2DPD A;  3TOA A;  1FOK A;  2V9V A;  5FLX K;  5IT9 K;  2O8X A;  2XAJ A;  1YS6 A;  5DCM A;  3H3U A;  4U88 A;  3BPX A;  4LB6 B;  1FYL A;  3E5X A;  3HTU A;  3KFW X;  2D1H A;  1VTN C;  4EVI A;  5DYM A;  3F8F A;  1XCB A;  3ZMS A;  3GX4 X;  3NEU A;  2RGV A;  1E2X A;  2ACJ A;  2HR3 A;  1P92 A;  3GZ5 A;  1HXD A;  3FMS A;  1TW2 A;  3CJN A;  4I7H A;  4A5N A;  1Z9C A;  2XRN A;  1FLI A;  3AAF A;  3HIF A;  3P9C A;  4WX9 A;  4HF2 A;  2A07 F;  1J0R A;  2V79 A;  5BQT A;  3LQQ A;  1R1T A;  2ZNZ A;  4R1H A;  1YW9 A;  3MZY A;  3ZMT A;  4WXD A;  5H20 A;  2PN6 A;  2FEZ A;  1QBJ A;  1WSU A;  5D8K B;  4RGX A;  1R36 A;  2FF4 A;  3KP7 A;  4CYD A;  3GFJ A;  4H0E A;  3GZ6 A;  4YIF A;  1K79 A;  2WC2 A;  5HOO A;  3IHU A;  2F5F A;  1LVA A;  4WF2 A;  2M5W A;  2P5K A;  2Z33 A;  3DP7 A;  1TLH B;  5HLI A;  3MQ0 A;  3E6B A;  1XMA A;  5DCM B;  3V7S A;  1O3R A;  2YR2 A;  2P8T A;  3HOT A;  4MEX F;  3DEU A;  1TQP A;  5DCF A;  1KQ0 A;  4IJA A;  1J2X A;  5HDG A;  3F21 A;  3M8E A;  4Q5S F;  4M72 A;  2QQB A;  2QQA A;  3FM5 A;  1NHA A;  3SZT A;  4HYE A;  4IRI A;  1ZHF A;  1LNW A;  2YU3 A;  2EFP A;  1ULY A;  2EFN A;  4ON0 A;  1O57 A;  4KMU X;  3HSF A;  2MA3 A;  2VOD A;  1SAX A;  3HHG A;  5CVR A;  1IN7 A;  1FY7 A;  3ZMZ A;  3WU1 B;  1R23 A;  1MJ9 A;  5ILU A;  1SFE A;  1KQ9 A;  3LA7 A;  1YTY A;  1XDU A;  3BDD A;  1XCV A;  4YFN F;  5L3E A;  4EQQ A;  2A68 F;  1BC8 C;  1Z91 A;  1L0O C;  2KIU A;  2VOO A;  2KKO A;  2QM3 A;  3C1D A;  1Z1D A;  3HSR A;  1R1V A;  1TNT A;  3MCZ A;  2EV5 A;  3SQN A;  3T1B A;  4YFX F;  4YFK F;  1D3Y A;  3VFZ A;  1KU2 A;  3F22 A;  4UVB A;  2DBB A;  3L00 A;  3TKY A;  1W4M A;  3GW2 A;  5L3G A;  4YII A;  4A0Y A;  2H6B A;  3GFM A;  3RYP A;  4ESF A;  5DD8 A;  2OAZ A;  3R61 A;  4RB3 C;  2J5O A;  5E1Z B;  2XIG A;  2BBY A;  4ENJ A;  1U5T A;  4Y15 A;  4UV9 A;  4XBF A;  3GYH X;  1XGM A;  3TO7 A;  5HS9 A;  2CO5 A;  3G3Z A;  2X0L A;  2XVC A;  4L9V A;  1I6X A;  4PZJ A;  2OU2 A;  4I98 B;  4KIC A;  2XAS A;  3BP8 A;  4LB5 A;  3D5L A;  1B9N A;  3FX3 A;  4IRH A;  2FNP A;  2Z99 A;  1BOA A;  1LDJ A;  1STZ A;  2Q2E A;  5HDN A;  1ZGJ A;  3ZQ7 A;  2E7W A;  2VN2 A;  4HX7 A;  1F9N A;  2DI3 A;  3ECH A;  3PQJ A;  4BHP A;  3BZ6 A;  4MTD A;  5H6Q A;  3O2P E;  3CO6 C;  1XGN A;  2OQR A;  3J7A O;  2LKP A;  3OV8 A;  3JAM Z;  3TDZ C;  4I09 A;  1CF7 B;  2A69 F;  5ILS A;  2WWY A;  3BJ6 A;  2RNJ A;  5BMZ A;  3RTR A;  4LK1 F;  1TW3 A;  1FBU A;  1EH8 A;  2NNY A;  1MDM B;  2L4A A;  3F3X A;  1I5Z A;  1H9G A;  3R60 A;  1LDK B;  4Y13 A;  2IP2 A;  2DK8 A;  5LBQ A;  4I0B A;  1YG2 A;  2P6T A;  3FXU A;  4LD5 A;  1SD4 A;  2RQP A;  5E17 F;  2K86 A;  1UHW A;  3F8B A;  1K6O A;  2IPQ X;  4MEY F;  2HOE A;  5K5Q A;  1XN7 A;  4HX8 A;  2J5P A;  5LGU A;  5HS7 A;  1GVJ A;  2QUF A;  4L5J A;  5JI6 A;  2L02 A;  3I5U A;  3R0A A;  2WV0 A;  2W24 A;  2HGC A;  1FZP B;  2A5Y B;  1C0W A;  1J5Y A;  1G3S A;  2W25 A;  3BJA A;  5FGM A;  4O3M A;  2O6G E;  2O0Y A;  2QBY A;  1EH6 A;  1LEA A;  3J80 K;  4L9N A;  1LQ1 A;  5AON A;  1U5T B;  1ZGA A;  2HTJ A;  2QQ9 A;  4JK1 X;  1MJA A;  5DUK A;  1P4W A;  3C7J A;  1U78 A;  3TGN A;  4G6D A;  4N9H A;  3IWZ A;  1T38 A;  4UVA A;  2PFB A;  3K9T A;  2IA2 A;  1YLF A;  3JTG A;  4I0A A;  2D2W A;  3F8M A;  2BEO A;  3HRS A;  3J80 Z;  1R58 A;  2MLK A;  1MKM A;  2RKH A;  2Y0M A;  4S05 A;  2EB7 A;  3WTX C;  3DPT A;  1IRG A;  3QAH A;  2ZME B;  3ECO A;  3HRU A;  1PP7 U;  1SMY F;  2DFI A;  4UHT A;  5CVU A;  5ICC A;  1R7J A;  4FHT A;  3JSO A;  2CQK A;  4HV6 A;  2XAG A;  3RPQ A;  2FE3 A;  2FRH A;  4IXA A;  3WE2 A;  1JXS A;  2FA5 A;  1JHH A;  1KU7 A;  5CJ9 A;  1FC3 A;  1BI1 A;  1DDN A;  5F1R A;  2QEN A;  5F64 A;  4MGR A;  1IN6 A;  1RNL A;  2FBK A;  1OPC A;  3KP3 A;  1L3L A;  2XHK A;  1W5S A;  2K27 A;  3NQO A;  5K5O A;  5EEG A;  5D4R A;  3FHZ A;  4RS8 A;  2MH9 A;  1ZG3 A;  3FF5 A;  4U7B A;  3WTY C;  3T0Y A;  1GXP A;  1FSE A;  4XSZ F;  1Q1H A;  5HLG A;  3MEX A;  3ZP5 A;  3FMQ A;  2PI0 A;  2PLY A;  2CFX A;  3LA2 A;  2LSO A;  3RDI A;  3KP2 A;  4E70 A;  4EGZ A;  4EGY A;  4KIG A;  3NRV A;  1OYW A;  3M1E A;  3V8L A;  4K2E A;  1WRJ A;  4HF0 A;  4HDU A;  2VOP A;  4EJO A;  3IRQ A;  3WTV C;  1ZAO A;  1K78 B;  3VEP A;  1XB4 A;  2ISY A;  3JSP A;  5FD6 A;  2RVC A;  4ETS A;  3KLO A;  4P9U A;  4HDV A;  3R6S A;  4GCV A;  2DQR A;  4CO8 A;  1S7A A;  1BN5 A;  1YFH A;  1IN4 A;  2K4B A;  2GIV A;  2WTE A;  1SFU A;  1ZRE A;  1USS A;  5E8I A;  3EYY A;  4AIJ A;  4B8X A;  3E6M A;  1BI2 A;  1YO5 C;  4IHS A;  2P7V B;  4HOB A;  4GO1 A;  3TO6 A;  5BOX A;  1R5G A;  3I4P A;  4CZZ A;  1I27 A;  3KLN A;  2A3S A;  5CVJ A;  4G7O F;  1GXQ A;  4AIK A;  2CG4 A;  4HBL A;  3K1N A;  5ICE A;  2JZY A;  1ZG5 A;  4KIF A;  2NAZ A;  3K2Z A;  5ED4 A;  2KJB A;  5FFZ A;  1W7P B;  4QWQ A;  1BIA A;  4IRG A;  1ON2 A;  2NNN A;  3IKT A;  2QZ8 A;  3V7R A;  5E18 F;  2CSO A;  3F6O A;  2ZO4 A;  5D8L B;  1FP2 A;  1DPR A;  4M73 A;  4OIQ F;  2JT1 A;  3ULQ B;  2R7F A;  1IUY A;  1BBY A;  1W5T A;  5TRD A;  1IZ1 A;  2EK5 A;  2JSC A;  5D4S A;  1HSJ A;  3KZZ A;  4R79 A;  3BOQ A;  2PMU A;  4P55 A;  1H0M A;  1WWX A;  3BY6 A;  5LHG A;  4G9Y A;  1S8N A;  3LQR A;  1LDD A;  4HLY A;  4MTE A;  3E6C C;  4DQ2 A;  4CXF A;  3E3V A;  3L9F A;  2LF8 A;  5L3F A;  3JAM K;  3F8C A;  3QPH A;  3CUQ A;  4HQE A;  2P4W A;  2XAF A;  2HFH A;  4RGS A;  3L7W A;  2GXB A;  1RI7 A;  1G3Y A;  3HRT A;  1T0F A;  2GWR A;  3CUO A;  2BV6 A;  3ROU A;  3Q5F A;  1SD7 A;  2VBX A;  3V8J A;  5LHI A;  4UV8 A;  5LEK A;  1XGO A;  3VOE A;  2Z3Y A;  4XLN F;  4L18 B;  4M9S A;  1G6N A;  3B02 A;  4WXH A;  5A2Q K;  4PCQ A;  3TOB A;  2L54 A;  3COA C;  3PFI A;  5LRS A;  1MDM A;  1PP8 F;  1O7F A;  1HKT A;  2CWE A;  1XD7 A;  3E6D A;  2L3D A;  4L0Z B;  2Q8K A;  4NB5 A;  1IW7 F;  4M74 A;  1BI3 A;  4LMY A;  3O3K A;  3ABU A;  1R22 A;  3HYI A;  2P5L C;  1EV7 A;  1IRF A;  5CVI A;  5D5U B;  5D6F A;  3WTT C;  2EWN A;  2IVM A;  2ZKZ A;  1S7O A;  1QO0 D;  3BPV A;  4HA8 A;  4IHT A;  3T5X A;  2DU9 A;  3GEZ A;  5FD5 A;  2GA1 A;  2ZBK A;  1TQI A;  2MC3 A;  2VT3 A;  3ZN1 A;  3QP5 A;  1BI0 A;  4HF1 A;  1V4R A;  1OYY A;  1J75 A;  3GWZ A;  1MJB A;  4MQ9 F;  4U0V A;  1J59 A;  4ESJ A;  2YX7 A;  3EET A;  3OOP A;  1DPU A;  4PDK A;  3TQN A;  4I2O A;  3WGG A;  5ICF A;  1HKS A;  3W6J B;  3DF8 A;  4OOI A;  5CVV A;  2X4H A;  1KYW A;  3TDU C;  2ISZ A;  2HQN A;  3FXR A;  4OIP F;  3ERE D;  5AIP A;  3FXQ A;  3LAJ A;  4KUM A;  1RUO A;  5HLH A;  3RJP A;  2MLG A;  1PUE E;  4HW0 A;  5L3B A;  1UHM A;  3I58 A;  2HWV A;  1D8K A;  3J81 Z;  2EFQ A;  3CTA A;  4KDP A;  2EFO A;  5LEJ A;  2PQ8 A;  2E1C A;  3CUQ B;  1IXR C;  4EM0 B;  4HX4 A;  2ELH A;  4WWC A;  2VE9 A;  3L09 A;  3ABT A;  3ZN0 A;  5J8F A;  1OKR A;  1TTY A;  4RB2 C;  4XRF A;  1SD6 A;  5D5V B;  2V6C A;  3QRF F;  6PAX A;  2VC0 A;  4UNO A;  2R7D A;  2PEX A;  2MBF A;  4M9X A;  1XDS A;  5ERI A;  2ESN A;  2PG4 A;  1HST A;  2P6S A;  4LFU A;  5HS8 A;  3PQK A;  5JVT A;  5K5R A;  3F23 A;  1T2K A;  3HUG A;  2KRF A;  3IL2 A;  4BAY A;  1J7K A;  2ETH A;  1W7P A;  4IVN A;  2PJP A;  3KP6 A;  3GFI A;  1TNS A;  3K69 A;  2P7C B;  1FBQ A;  2G7H A;  2G9W A;  2HEO A;  5DV5 A;  2LNB A;  3C3W A;  1FYM A;  4KNY A;  2JRT A;  5EEH A;  1IXS B;  3I54 A;  2RN7 A;  1T6S A;  3BWG A;  3KP4 A;  4KN4 X;  4HZF A;  2HYF A;  1U3E M;  4EJT A;  1CGP A;  4UUV A;  3FM3 A;  4O5V A;  4OU0 A;  3WOD F;  2ZME A;  1O3T A;  4M6Y A;  1IXC A;  3QOP A;  1MGT A;  1R5H A;  4KIB A;  1T98 A;  2DAO A;  3FZV A;  4F7Z A;  3IRR A;  3LST A;  4FT8 A;  3CLO A;  2VBY A;  3F72 A;  1KGS A;  1O7L A;  4ENN A;  2K7L A;  3H3Z A;  3U9G A;  3G73 A;  2RDP A;  4B09 A;  1ZLJ A;  1F5T A;  3SFZ A;  3EYI A;  2LDU A;  1J9I A;  1D8J A;  1S3J A;  1BJA A;  3ISP A;  3E5Q A;  4L9J A;  3V7C A;  1LJ9 A;  2OBP A;  2FML A;  1O3S A;  2O03 A;  4GYI A;  1FT9 A;  3N4M A;  2A6E F;  1X3U A;  2W85 A;  1ZAR A;  4UXN A;  3EDP A;  2EJR A;  3R4K A;  2AS5 F;  1YYV A;  2Q0O A;  2HZT A;  4A0Z A;  3RKW A;  2FBH A;  1EH7 A;  1REP C;  4ASN A;  4OMY A;  2YPR A;  1Y0U A;  3DKW A;  2LF7 A;  4RGU A;  5H6R A;  3FMR A;  2STT A;  2K02 A;  4I01 A;  4CGZ A;  5A2Q Z;  2UWM A;  3MAJ A;  5E1W A;  4YG2 F;  2RC4 A;  3WGI A;  4PGG A;  4JBA A;  4NQW A;  2JTV A;  3WTS C;  2XKO A;  3K0L A;  3O6B B;  3GXO A;  3SZP A;  1QZZ A;  3ZMU A;  3M9A A;  4P9F A;  4G8X A;  1Z6T A;  2FOK A;  3GUD A;  4CDG A;  5FO5 A;  3HRM A;  1XSX A;  2M30 A;  3E5U A;  5HVQ C;  4A2U A;  1WKM A;  3WE3 A;  1H9T A;  3WG9 A;  3KET A;  2HQR A;  4EJV A;  4OIR F;  4ZYE A;  5BPD A;  4LG0 A;  3IC7 A;  5LGT A;  3I0T A;  4S04 A;  4PGH A;  2D1V A;  4RB0 A;  4I02 A;  4KYW A;  4LG0 B;  2FXA A;  2M8E A;  1SFX A;  3RIR A;  3ML6 A;  4BYY A;  4BH9 A;  1ONV A;  4WCG A;  2YSR A;  3VB2 A;  2A61 A;  2HKO A;  1Z7U A;  2QBY B;  5L3D A;  1A04 A;  1FWZ A;  2M87 A;  3M8F A;  1IF1 A;  4CIC A;  3JW4 A;  4FX4 A;  1KU3 A;  2YX4 A;  5J6X A;  5JR3 A;  2P5V A;  2FSW A;  3EQL F;  4Y17 A;  5JHU A;  4M71 A;  1P4A A;  1HW2 A;  4LLN A;  3Q9S A;  2HTS A;  1LEB A;  1ON1 A;  4XSX F;  2HKX A;  3D0S A;  4U0Y A;  4G7Z F;  1ZG1 A;  4WK8 F;  2NYX A;  1S6L A;  1TBX A;  1AOY A;  2VON A;  2XKP A;  5DD4 A;  1ZH5 A;  1P2F A;  1G3T A;  4L0Y B;  5CYV A;  1KA8 A;  2A6H F;  4R8H A;  4LLG F;  2V1X A;  1R00 A;  2VC1 A;  2OD5 A;  4D0P A;  4LJZ F;  2COM A;  1QNT A;  4A6E A;  3VOD A;  1K78 A;  3J81 K;  5BPI A;  5DEQ A;  2KJC A;  5F6F A;  2FU4 A;  2IW5 A;  3P9I A;  3TO9 A;  2DPU A;  1PDN C;  4L9T A;  2XUB A;  3RKY A; 
#chains in the Genus database with same CATH topology
 4ENK A;  1UB9 A;  2R93 J;  1HW1 A;  1FTZ A;  5J47 A;  4KA4 A;  1QPI A;  1YW7 A;  4MQV A;  4XID A;  5CLS A;  2QVO A;  2VKV A;  5TJJ A;  1UFM A;  2JWT A;  4Q4Z F;  3JRD A;  2CW7 A;  1FYK A;  4CYC B;  3CCE I;  4G12 A;  1XMK A;  5IP6 A;  1DU0 A;  2VBZ A;  4ZDP A;  1I1S A;  4OIN F;  3MFK A;  2EV6 A;  1TWA J;  4BXF A;  3EPZ A;  1MMG A;  2EFW A;  4HSR A;  3NAR A;  2Y75 A;  2OA4 A;  2JJ7 A;  2EPF A;  4D5F A;  2M1B A;  1V5F A;  3RPU A;  2VIX A;  2W00 A;  5CQE A;  3CMY A;  1D5Y A;  3U2R A;  4CCJ A;  4A12 A;  1RKT A;  1IV6 A;  1FOY A;  4A3C J;  2ECC A;  2VKH A;  1W36 C;  3QQA A;  3QPS A;  1MZB A;  2W57 A;  2CGP A;  3H36 A;  3J7Z I;  4FCY A;  1BM9 A;  4KFC A;  4A6D A;  4RLQ A;  1KQ8 A;  1JTY A;  3EUA A;  2V1D A;  3ELK A;  1ZN2 A;  1GHC A;  5FLX Z;  5IT9 Z;  4CUG A;  4A3E J;  1K7A A;  4AM3 A;  1FTT A;  3CDI A;  2LR8 A;  1FX7 A;  1JKQ C;  2QSH X;  1JI8 A;  3GFL A;  2ZSI B;  4HLX A;  1ZYR F;  1N75 A;  1FPQ A;  3L2R A;  5DUI A;  1SMT A;  4BNC A;  1OCC H;  3B73 A;  1QQI A;  2IXS A;  2OUM A;  2GQQ A;  5JFR A;  1IN8 A;  2F5E A;  3WGH A;  4CCK A;  2HS5 A;  4A0X A;  2XAH A;  4GYG A;  3HC7 A;  2STW A;  2Y48 A;  2JPC A;  4EM1 A;  3OOU A;  2F4O B;  1S72 I;  2NS0 A;  3GO5 A;  5KAF C;  3HHH A;  2QCO A;  3QPT A;  3AL0 C;  3I53 A;  2HVQ A;  2F2E A;  2FUG 2;  2M9H A;  5K7F A;  1N78 A;  2EA4 A;  1E17 A;  3SXY A;  3HGY A;  2OZ6 A;  5IOZ A;  4KIS A;  3BG6 A;  2UXX A;  4JYK A;  1ERD A;  1ODD A;  2FNA A;  2O3F A;  1FBS A;  4NHJ A;  1BC7 C;  3R0J A;  3LFK A;  1XMX A;  4MLO A;  3DTE A;  5FKM A;  2COB A;  2RV8 A;  4BHB A;  1G4D A;  4BAC A;  3W6K B;  3A0B C;  2DT5 A;  5BNG A;  3OS2 A;  4P96 A;  4RM3 A;  5JLW A;  2MAB A;  2BXY A;  3VWB A;  2E71 A;  4ZYH A;  3LSH A;  3CDH A;  4NBQ A;  3H35 A;  2BE5 F;  2OQG A;  5E1X A;  2G7U A;  3G6E I;  3BRO A;  1ITY A;  2XGD A;  3FWE A;  3KP5 A;  2L2O A;  4U7D A;  3L2Q A;  3NWT A;  4U0W A;  2FJ1 A;  2B9S A;  2JA8 J;  2H27 A;  3Q9V A;  5J3L A;  1U5T C;  2FMY A;  3GLX A;  3BR5 A;  2H09 A;  3E7L A;  4N9I A;  3RKX A;  3T8R A;  1LE8 B;  3PNT A;  1TQM A;  2XF7 A;  1R5I D;  3MKY B;  2E1N A;  1BR4 A;  1U8R A;  1WQ2 A;  1P4X A;  3HBL A;  5FKN A;  4MHG A;  3S2W A;  1WI9 A;  4AD9 A;  2XB5 A;  1YIJ I;  2ID6 A;  3KCC A;  1R1U A;  3JRB A;  3LAP A;  1RUN A;  2E7X A;  4XLP F;  1S29 A;  2CYY A;  3HSE A;  1UAA A;  1ETX A;  3H9Q A;  1YW8 A;  1TWH J;  1T8I A;  3JTH A;  2V1U A;  4N0B A;  1HBX G;  1H88 C;  2C6Y A;  1FMV A;  1NH3 A;  2VPL A;  4Z2Y A;  4XNF A;  3ZCO A;  4ZC3 A;  1DUX C;  5IYD J;  3DPL C;  4IO9 F;  2EH3 A;  2GZW A;  1SVM A;  1FNN A;  2DYR H;  3HOS A;  2PBI A;  5D6E A;  3O8G A;  4BXU A;  3MZH A;  1JHF A;  4KJZ A;  2OF7 A;  3H5R A;  4A5M A;  4DYQ A;  2HVS A;  2W84 A;  3DV8 A;  1Z6R A;  2KDO A;  3TL4 X;  3M8J A;  1BW6 A;  4ZTJ A;  1ZRD A;  1HCR A;  2XPW A;  2GAU A;  2VT2 A;  4UUT A;  4A3G J;  3H9J A;  1E3O C;  4IOA F;  2IA0 A;  3HB9 A;  2VBW A;  3NWS A;  1R6R A;  2F5D A;  2DLL A;  3LA3 A;  3RCO A;  4DNC A;  1BW5 A;  4XKV A;  2BOL A;  4E6K G;  3X2Q H;  1HDD C;  3ZMV A;  2KPM A;  3V4G A;  3QU3 A;  4BXX J;  2I8D A;  1B1B A;  1IAW A;  2JA7 J;  5FKL A;  4BHC A;  2LD5 A;  1YS7 A;  1JKP C;  3JRC A;  2JPB A;  2I5U A;  2XC7 A;  2ME0 A;  2BW3 A;  2O61 A;  1OR7 A;  2ZXW H;  1TZL A;  2L4M A;  1HLV A;  1P6R A;  4RAF A;  3BTL A;  3MN2 A;  5CKT A;  3OSF A;  5LRR A;  3JRE A;  1RC9 A;  2ID3 A;  1B4A A;  3ZR8 X;  4EAT A;  1TT5 B;  4L5I A;  1QPM A;  2XAU A;  3P7N A;  3ZMD A;  2Z16 A;  2K3P A;  1OYI A;  2F48 A;  2IS6 A;  4EJW A;  3TBI A;  4XR6 A;  1RZ4 A;  1FSH A;  2DQL A;  1HA8 A;  2F4M B;  4O6J A;  3I64 A;  2G0E A;  5LGN A;  2D5V A;  1FP1 D;  1R9T J;  3PFY A;  1IDZ A;  3P9K A;  2L5Q A;  1XX5 A;  4ZDO A;  4HST A;  2Y9Y A;  3I59 B;  3C18 A;  2WB1 A;  2L9S A;  4HAM A;  2H6C A;  1UST A;  3GZN B;  2IRF G;  2KZV A;  1RR7 A;  3ZQH A;  1CQT A;  3ZPL A;  3DEE A;  2XAQ A;  4AVP A;  4WXC A;  2XSJ C;  1BR2 A;  3SDG A;  1B8I B;  2XRO A;  4ZYD A;  1B72 A;  2E34 A;  5M3M J;  2K3F A;  1XGS A;  2NVX J;  3HTS B;  2HXI A;  2KIF A;  4KMF A;  1POG A;  3QOE A;  4D7M A;  4MNU A;  1NG6 A;  5EZH A;  1Y1V J;  2QWW A;  1UCR A;  5B3S H;  2V7F A;  1QVT A;  5KCM A;  4C2U A;  4RMN A;  3M1C A;  3DFG A;  5FB2 A;  2V9P A;  1ZKG A;  2X85 A;  2UZK A;  2JSP A;  2EA2 A;  1MD0 A;  1X1D A;  1VQP I;  4ESB A;  4ZYG A;  1VF9 A;  3OR1 C;  4Q48 A;  2VXZ A;  2WY8 Q;  3PUF A;  4RGR A;  2ICW G;  1I50 J;  4CHU A;  1SVO A;  5E3O A;  2FD5 A;  2Z9O A;  2GXG A;  4BL0 B;  3VPR A;  3A01 B;  2K5C A;  3F8N A;  2Y0S A;  1YJN I;  2Z5U A;  4G6Q A;  3N97 A;  3SHF A;  3KYL A;  3JRA A;  4HNV A;  3QP6 A;  4G6T B;  1XSV A;  4LIT A;  3S2D J;  3LL7 A;  2NVU B;  2OC6 A;  3BCB A;  2L9R A;  1X2M A;  2M45 A;  4LK0 F;  2DTR A;  3DQV C;  5AIQ A;  4TV7 A;  1V3F A;  4FX0 A;  2MC4 A;  3WU0 A;  3L2V A;  2MD5 A;  2EV0 A;  3D1N I;  2M0M A;  2OZU A;  2X1E A;  5HDK A;  4JQF A;  2UXN A;  2ZC2 A;  3HKZ N;  1HW5 A;  4AWX B;  3OYI A;  1DGR M;  2FBI A;  1IC8 A;  4E7Z A;  4IPA A;  1B59 A;  4Y7N J;  3RQ4 A;  2ADU A;  4IHV A;  1W7P D;  1WJ5 A;  4HNU A;  2KP6 A;  5FFX A;  1VQ9 I;  1A5J A;  2TRT A;  4GXO A;  1RIO H;  2XV4 S;  2CW0 F;  4V2F A;  1VQM I;  2DO7 A;  3U1D A;  3M7G A;  3WTW C;  3WTU C;  2VJJ A;  4DBQ A;  2M8G X;  1YQA A;  3ASO H;  9ANT A;  2ZXJ A;  5KNL A;  2IS1 A;  1F4K A;  1F1Z A;  2H1K A;  4BJ6 C;  1T08 B;  5F27 A;  3I3L A;  3L2U A;  3L2C A;  2GM4 A;  4EM2 A;  3DTI A;  2DK5 A;  2HDC A;  4IHW A;  2MG4 A;  2ZFW A;  3T8T A;  5K1Y A;  5JHF A;  4E7S A;  1KYZ A;  4ANJ A;  2ZCW A;  3GF2 A;  3TP0 A;  1O3Q A;  1MBE A;  4RAZ A;  3KEQ A;  3FXL A;  1LB2 A;  2BHY A;  1ZRF A;  2GLO A;  3RYR A;  4QPQ A;  3LNQ A;  1JUM A;  3QYB A;  1MSE C;  2IA1 A;  1O4X A;  4HQM A;  2CV1 A;  3BG3 A;  2L01 A;  3K1P A;  3EUK L;  1JGS A;  1E3H A;  1UMQ A;  1IDY A;  3VYR B;  3KE2 A;  5J4V A;  3W2V A;  3BG5 A;  3A03 A;  3F6V A;  5KHD A;  3OWT A;  2BY1 A;  2ZJ2 A;  2H8W A;  1XSD A;  3KYD B;  3ZGK A;  4PJN A;  4HV5 A;  4F92 B;  5E8G A;  5BS6 A;  1CF7 A;  1HKQ A;  2B0L A;  3HM5 A;  1H8A C;  1JUS A;  3H5N A;  5LHH A;  4LLL A;  3K70 C;  2R7R A;  5ILV A;  1T39 A;  1VQ6 I;  4ZZD A;  4EJU A;  1GV5 A;  1WHU A;  1QVU A;  4M9Z A;  2MH2 A;  5TGT A;  1Y8R B;  1JKO C;  4G94 A;  2PMZ A;  2E2I J;  2DW4 A;  3S8P A;  3BT9 A;  5K7H A;  2BYV E;  2IGK A;  2NRA C;  4Y33 A;  1GV2 A;  4ZH4 F;  3MVP A;  1DP7 P;  1ACI A;  5D5X B;  1ETK A;  1ZRC A;  2FQ3 A;  2L9N A;  3BJO A;  3A2K A;  3ZQL A;  2IT0 A;  1ETV A;  2Q2E B;  1B6A A;  3BZK A;  2KIM A;  4MO7 A;  2TDX A;  1IUF A;  2BHZ A;  3K1M A;  4LG3 A;  5LD2 C;  2EZH A;  1B72 B;  2CV2 A;  4BBS J;  4XQF A;  2HYG D;  1D5V A;  4GDF A;  3DXJ F;  4KT5 C;  1X4O A;  4HPQ A;  1LVK A;  2R7O A;  1PYV A;  2K4J A;  3KZY A;  5KK1 A;  1AWC A;  3FXK A;  3OYH A;  2E1O A;  3WTZ A;  2PJR B;  3K4B A;  5E20 A;  1QGP A;  1M1E B;  1UG0 A;  3MWM A;  4XLC A;  2L7Z A;  2IJL A;  3BTI A;  2ESH A;  1U6G A;  2VE8 A;  2R5Y A;  1F43 A;  1Z05 A;  2F5C A;  4OMZ A;  5L3C A;  3HXL A;  1BIB A;  3IWF A;  2WAQ N;  3H0G J;  3IKV A;  5D5W B;  3E97 A;  3PUB A;  3OSG A;  3CF2 A;  4M6X A;  5LLQ A;  3GCM A;  4GGG A;  3K70 D;  3RI4 A;  2XGX A;  1TP4 A;  4M3B A;  4Q47 A;  4AIH A;  2PMH A;  2MYS A;  3S93 A;  2BGC A;  3I59 A;  2GBY A;  5KVR A;  4OIO F;  2CRG A;  4N4N B;  4EMS A;  1MH3 A;  1YJW I;  2RQQ A;  1QHG A;  5GAH J;  1I1G A;  1IJW C;  1T56 A;  4G7H F;  2DFH A;  1OMI A;  3H92 A;  5J8C A;  1LFU P;  2DOE A;  1Z67 A;  1IN5 A;  3MKZ A;  2HQ5 A;  2ME6 A;  2D45 A;  4RB1 A;  2GXA A;  1X58 A;  2E5Z A;  2GA2 A;  1YX3 A;  2LTP A;  1QZY A;  2QLZ A;  2W1O A;  4N4O B;  5FKK A;  4BEH B;  5GTI C;  1VQN I;  3AG2 H;  1KU9 A;  2F6C A;  1YIO A;  2DDB A;  2ZNY A;  4C3J J;  2JVH A;  5DS9 A;  2QSG X;  1B9M A;  4P5O A;  3DTK A;  3HDD A;  2ELJ A;  3I71 A;  5IP9 J;  2O8K A;  4KN7 X;  4LGW A;  1JE8 A;  3L1P A;  4IF4 A;  3QU6 A;  2H94 A;  1QU3 A;  2FX0 A;  3GVA A;  3CO7 C;  1G3W A;  2WAF A;  3FKJ A;  1OCT C;  4I76 A;  3V8K A;  1X1P A;  2L9V A;  2R5Z A;  3CUQ C;  4QLC U;  4RAY A;  5ICG A;  5IT3 A;  4ENM A;  1HQC A;  4BQA A;  1WGX A;  2KIQ A;  2LC2 A;  3LWF A;  4BE2 A;  3EUH A;  1U2W A;  2R3S A;  2AXL A;  4DW6 A;  3PIO F;  5HNF A;  1T0F C;  2KT0 A;  2LLK A;  5C4X J;  4UVC A;  2QF7 A;  1ZLK A;  3OYD A;  1WJC A;  3ZRG A;  1SD5 A;  2L7M P;  5E3N A;  5DDG A;  2QYO A;  4EV0 A;  2HNH A;  1MBJ A;  2X1D A;  3KEO A;  4ZZL A;  1OFC X;  5TIS C;  3REO A;  2DPD A;  4DZP A;  3TOA A;  1FOK A;  2V9V A;  5FLX K;  5IT9 K;  2O8X A;  2XAJ A;  1YS6 A;  5DCM A;  2LG4 A;  3H3U A;  1K4T A;  2DA5 A;  3CCL I;  5GP9 A;  4U88 A;  3BPX A;  4LB6 B;  1FYL A;  3E5X A;  3HTU A;  3UR3 C;  3IAS 2;  5B66 C;  3I4N J;  4AYB A;  1ETY A;  5FRN A;  3KFW X;  2D1H A;  3I9V 2;  5J1R A;  1VTN C;  4EVI A;  5DYM A;  3SYT A;  2M4K A;  4DGW B;  2QGU A;  3AG4 H;  3F8F A;  2CUZ A;  3AG3 H;  4XRS G;  1XCB A;  4D1Q A;  1BOB A;  3ZMS A;  3GX4 X;  3NEU A;  4FQG A;  3CMA I;  3FK7 A;  2RGV A;  1E2X A;  2ACJ A;  2CFO A;  2HR3 A;  1P92 A;  3GZ5 A;  3HJE A;  1TWG J;  1HXD A;  3ERM A;  1TW2 A;  3CJN A;  3FMS A;  3F9K A;  4I7H A;  4A5N A;  3OY9 A;  1PJR A;  1Z9C A;  1JT0 A;  2KIS A;  3HG9 A;  2XRN A;  4ITV A;  1FLI A;  3AAF A;  3HIF A;  3P9C A;  4RM2 A;  4RDU A;  4QTR A;  1APL C;  4WX9 A;  4HF2 A;  1VZ0 A;  2A07 F;  1J0R A;  2V79 A;  5BQT A;  3LQQ A;  1R1T A;  3K6G A;  1T33 A;  2KHM A;  2ZNZ A;  2VQL A;  4R1H A;  1YW9 A;  2XPV A;  3MZY A;  3ZMT A;  4WXD A;  4FE7 A;  4J19 A;  5H20 A;  3OYA A;  2PN6 A;  2LRE A;  2FEZ A;  3MD2 A;  1QBJ A;  2WBM A;  1RES A;  1Y6I A;  2E35 A;  1SC7 A;  1WSU A;  4PSX A;  5D8K B;  3PO3 J;  4RGX A;  3FKI J;  1I3A A;  1R36 A;  2FF4 A;  4Y4R A;  2Y30 A;  2DOA A;  3KP7 A;  4CYD A;  1WH5 A;  3GFJ A;  1OCZ H;  4H0E A;  3A0H C;  3OYJ A;  3Q0W A;  1D1B A;  3GZ6 A;  3DKX A;  4YIF A;  2WC2 A;  5HOO A;  1K79 A;  1SAN A;  2F5F A;  3IHU A;  1LVA A;  4WF2 A;  4B47 A;  2M5W A;  2P5K A;  2Z33 A;  3DP7 A;  1W0U A;  4PJ0 C;  1TLH B;  5HLI A;  3G1M A;  4BQN A;  1A35 A;  3MQ0 A;  3BR0 A;  1BA5 A;  3DU6 A;  4L5E A;  3E6B A;  5F04 A;  3S3N A;  1XMA A;  4AUX A;  5DCM B;  2DOF A;  3V7S A;  5CQG A;  1LFP A;  2KL4 A;  3SJM A;  1O3R A;  2YR2 A;  2P8T A;  1K4S A;  3HOT A;  2LBF A;  2LY1 A;  4MEX F;  3ZQI A;  3DEU A;  1TQP A;  5DCF A;  3NAU A;  1KQ0 A;  2MSY A;  4IJA A;  2R7Z J;  2CJJ A;  1J2X A;  5HDG A;  3F21 A;  3CCS I;  3M8E A;  4Q5S F;  4M72 A;  2HPI A;  3OIQ A;  2Y31 A;  2LY2 A;  2QQB A;  3SEQ A;  3CQZ J;  2QQA A;  3FM5 A;  1NHA A;  3SZT A;  3W2A A;  4HYE A;  4IRI A;  1ZHF A;  1LNW A;  2WAQ A;  2YU3 A;  2EFP A;  1ULY A;  2EFN A;  4ON0 A;  5M5Y J;  2O9L A;  1O57 A;  4KMU X;  5IYC J;  3U1K A;  2KFD A;  3HSF A;  1LE8 A;  2MA3 A;  3DPU A;  2VOD A;  2IAI A;  1SAX A;  2DN0 A;  3OL4 A;  3HHG A;  1XTA A;  5CVR A;  2L7K A;  1VND A;  2YU9 J;  1IN7 A;  2IEK A;  1FY7 A;  3ZMZ A;  3WU1 B;  3PJR A;  5M3F J;  1R23 A;  5GPC A;  1MMD A;  1MJ9 A;  5ILU A;  2EBI A;  2ELK A;  1P9Q C;  3FDY A;  4C3H J;  2VKD A;  1WVR A;  1HC8 A;  2BY2 A;  1SFE A;  2X6W A;  4FET A;  1KQ9 A;  4A3J J;  3LA7 A;  1YTY A;  3H5A A;  5GAD J;  4MIM A;  4XK4 A;  3DLA A;  1XDU A;  2X6O A;  2WAD A;  3BDD A;  1XCV A;  4PFO A;  4YFN F;  5L3E A;  4EQQ A;  2A68 F;  1BC8 C;  1TT0 A;  2IGM A;  1Z91 A;  2VAS A;  1L0O C;  3HPG A;  2KIU A;  1ZQ3 P;  2VOO A;  3FK6 A;  2FOW A;  1QZE A;  2VI6 A;  2KKO A;  1TWC J;  4CCM A;  2QM3 A;  1VQ4 I;  3C1D A;  1MBG A;  1Z1D A;  3W6V A;  3HSR A;  1R1V A;  1TNT A;  1Z3X A;  3MCZ A;  1OCR H;  2EV5 A;  2RAE A;  3SQN A;  1QHH D;  4IHX A;  2RNG A;  2E36 A;  2DMU A;  4PJJ A;  3T1B A;  4DZJ A;  4YFX F;  4YFK F;  1MND A;  1D3Y A;  2CU7 A;  3VFZ A;  1KU2 A;  1AU7 A;  3F22 A;  4UVB A;  4XLH A;  3LSK A;  2DBB A;  4XOP A;  1H89 C;  3L00 A;  3TKY A;  1W4M A;  3GW2 A;  2V26 A;  4YII A;  1KZH A;  5L3G A;  2AHQ A;  3D5S C;  3CCV I;  3G1L A;  4A0Y A;  2H6B A;  3GFM A;  5FRO A;  3RYP A;  4ESF A;  5DD8 A;  2OAZ A;  2VPR A;  3JR9 A;  3R61 A;  1MSF C;  4RB3 C;  2J5O A;  2XIG A;  2BBY A;  5E1Z B;  3CCR I;  4ENJ A;  1U5T A;  1YI2 I;  2JUC A;  4UY8 I;  2XB0 X;  3FBI B;  4Y15 A;  4UV9 A;  3HUG B;  4XBF A;  2WA0 A;  3OMY A;  3GYH X;  1XGM A;  3CJR B;  3MKL A;  3TO7 A;  5HS9 A;  2CO5 A;  4NNJ A;  3G3Z A;  2X0L A;  2XVC A;  4L9V A;  1K61 A;  1JJ6 C;  5F0H A;  2I10 A;  1I6X A;  4PZJ A;  2B7E A;  3IH2 A;  3WHC A;  1DQU A;  2OU2 A;  1Z77 A;  3TED A;  2VJI A;  1MMS A;  4I98 B;  2JK3 A;  4KIC A;  2XAS A;  3BP8 A;  4LB5 A;  3D5L A;  2EQR A;  1B9N A;  3D5R C;  5EGO A;  3FX3 A;  1KON A;  2W7N A;  3B6C A;  4IRH A;  3GTG J;  1OJL A;  3CDL A;  2FNP A;  2Z99 A;  1BOA A;  2KQR A;  2F5V A;  1LDJ A;  4JX4 A;  1STZ A;  1ZTR A;  2Q2E A;  5B1A H;  5HDN A;  1ZGJ A;  2X51 A;  3ZQ7 A;  2E7W A;  2VN2 A;  5B5E C;  4HX7 A;  1F9N A;  5CPR B;  2QA4 I;  3S16 J;  3RZD J;  2EIL H;  4IQJ A;  2DI3 A;  3ECH A;  3PQJ A;  2EIN H;  4BHP A;  3BZ6 A;  4MTD A;  5H6Q A;  4MFE A;  3O2P E;  2O7O A;  2VQH A;  5M5X J;  2R7S A;  3CO6 C;  1XGN A;  2OCE A;  2OQR A;  2K40 A;  3CC4 I;  3VSL A;  3J7A O;  4BQO A;  1HDP A;  2CQ7 A;  3IAM 2;  2LKP A;  3OV8 A;  5F0C A;  3DKY A;  5JLX A;  3JAM Z;  3M4O J;  1EKE A;  4I09 A;  3TDZ C;  4CCN A;  1CF7 B;  2A69 F;  3BG7 A;  3PSF A;  1FMW A;  2NOG A;  5ILS A;  2WWY A;  1YE9 A;  3BJ6 A;  2RNJ A;  3S14 J;  5BMZ A;  1X19 A;  2NOJ B;  3RTR A;  1VI0 A;  2JRM A;  1TW3 A;  1FBU A;  3O8H A;  4LK1 F;  4DYR A;  4HNT A;  4YEL A;  1EH8 A;  2NNY A;  1MBH A;  4AID A;  1MDM B;  2L4A A;  3F3X A;  1I5Z A;  1G8X A;  2K9N A;  1H9G A;  3R60 A;  5E3L A;  1LDK B;  2EZK A;  3K4J A;  2YUS A;  2X48 A;  4Y13 A;  2IP2 A;  4A3M J;  4RBO A;  3VYU B;  2KZG A;  1I39 A;  2ZSH B;  2DK8 A;  1ETO A;  3FXM A;  4I0B A;  5LBQ A;  1YG2 A;  4M6V A;  3ZQF A;  1MW7 A;  2P6T A;  4XN0 A;  3FXU A;  1FIP A;  2A5W A;  4LD5 A;  5IP7 J;  3G2B A;  1SD4 A;  2RQP A;  5E17 F;  2MD0 A;  2K86 A;  1A36 A;  1UHW A;  3F8B A;  4PFP A;  2WY7 Q;  2R4G A;  1K6O A;  5FJ8 J;  1I3Q J;  2IPQ X;  2DYS H;  3S1Q J;  4MEY F;  1XPX A;  2HOE A;  5K5Q A;  1XN7 A;  4HX8 A;  4IQ4 A;  1MBF A;  1RKW A;  2X1C A;  2J5P A;  1WH7 A;  5LGU A;  3BTC A;  2M7B A;  3GME A;  3AL0 B;  5HS7 A;  2VQG A;  2E60 A;  1GVJ A;  3CP2 A;  2QUF A;  4GRI A;  2JA5 J;  3A02 A;  1XC5 A;  2KRC A;  4L5J A;  2L02 A;  4Z6Y A;  5JI6 A;  3I5U A;  1VQ7 I;  3CCM I;  1IV8 A;  4BE1 A;  3CC7 I;  3R0A A;  4V19 K;  1LPQ A;  3BQY A;  2DOD A;  2WV0 A;  4PK4 A;  1Q1V A;  1EA3 A;  4XN3 A;  2W24 A;  2HGC A;  1FZP B;  2Y0S N;  2A5Y B;  3H9G A;  2LBF B;  2R0Q C;  1C0W A;  3CLQ A;  2ZXH A;  4PSW A;  1J5Y A;  2F4I A;  1G3S A;  3C2H A;  2FQ4 A;  2W25 A;  3BJA A;  5FGM A;  4O3M A;  2O6G E;  2O0Y A;  4IHY A;  2QBY A;  1EH6 A;  2BXZ A;  3CCY A;  2CW8 A;  1LEA A;  2R7Q A;  3J80 K;  3IH3 A;  4L9N A;  2NVQ J;  3HOY J;  1LQ1 A;  1RRJ A;  5FLM J;  2HVR A;  5AON A;  1U5T B;  1YX5 A;  1ZGA A;  2HTJ A;  2QQ9 A;  2QQ8 A;  2V4J C;  4JK1 X;  4M3G A;  1MJA A;  5DUK A;  1B8I A;  1P4W A;  3C7J A;  1U78 A;  3TGN A;  4ZYA A;  3BR2 A;  4G6D A;  4N9H A;  4Y52 J;  4PUS A;  2HQA A;  3IWZ A;  4OAY A;  1T38 A;  4UVA A;  2PFB A;  3K9T A;  1RET A;  2IA2 A;  5DM7 F;  2HU9 A;  1YLF A;  3RPU D;  3JTG A;  2NVY J;  4I0A A;  2JQ7 A;  2D2W A;  1ENH A;  4XLA A;  3ZXS A;  5DTD A;  1SFO J;  2EZL A;  2LVS A;  3F8M A;  2BEO A;  3Q0U A;  3HRS A;  3J80 Z;  1VFC A;  1R58 A;  2MLK A;  3PO2 J;  1MKM A;  2RKH A;  2Y0M A;  4S05 A;  2EB7 A;  3GLL A;  3WTX C;  3DPT A;  1I6H J;  2XGE A;  2R7U A;  1IRG A;  4UB6 C;  5DM6 F;  3CCQ I;  2HDD A;  3QAH A;  1Y1W J;  1R4M B;  2ZME B;  3ECO A;  3BQZ A;  1VQ8 I;  3HRU A;  4CCL A;  4RAG A;  4C30 A;  1PP7 U;  1WI3 A;  2M0C A;  1FOX A;  2PMZ N;  2M4G A;  1X3Z B;  2XSD C;  1SMY F;  2DFI A;  2V9K A;  4UHT A;  5CVU A;  2JVG A;  2EIM H;  5ICC A;  3Q3S A;  1R7J A;  4FHT A;  3JSO A;  2CQK A;  4HV6 A;  5EG0 B;  2W48 A;  3HOX J;  2XAG A;  3RPQ A;  2FE3 A;  2QKL B;  2FRH A;  1X2N A;  4IXA A;  3WE2 A;  2OV7 A;  3RQI A;  1JXS A;  3S1N J;  2VKE A;  2FA5 A;  4PJL A;  3I4M J;  1JHH A;  1KU7 A;  5CJ9 A;  4DJA A;  4BDY A;  1FC3 A;  1BI1 A;  1SAU A;  1DDN A;  5F1R A;  2QEN A;  3IH4 A;  5F64 A;  4MGR A;  1IN6 A;  1RNL A;  2FBK A;  1OPC A;  3KP3 A;  1L3L A;  3DWL E;  2XHK A;  4IEJ A;  3PL8 A;  1W5S A;  1YHQ I;  2K27 A;  3NQO A;  1MBK A;  5K5O A;  5EEG A;  2LYC A;  3F0C A;  4KT6 A;  5D4R A;  3FHZ A;  4RS8 A;  4QPO A;  2MH9 A;  1ZG3 A;  2JMW A;  3FF5 A;  4U7B A;  2BVL A;  3WTY C;  1Y0N A;  2HI3 A;  3T0Y A;  4DYC A;  3W3C A;  1GXP A;  1FSE A;  2VL8 A;  4XSZ F;  1Q1H A;  2M3A A;  4C3I J;  5HLG A;  3MEX A;  3ZP5 A;  3FMQ A;  2PI0 A;  2PLY A;  1JKR C;  2CFX A;  3LA2 A;  1IRZ A;  2LSO A;  2M34 A;  1QRY A;  2KMU A;  3RDI A;  1NK3 P;  3KP2 A;  4E70 A;  2LFB A;  1WJA A;  4EGZ A;  3GTJ J;  3OYF A;  3CME I;  4KIG A;  4EGY A;  2R92 J;  4S0H B;  3NRV A;  2E2H J;  1OYW A;  3M1E A;  4I6Z A;  1V55 H;  1JTX A;  3HPH A;  3L2W A;  2XPU A;  3V8L A;  4DOZ A;  5F1J A;  2LMD A;  2CQX A;  3AG1 H;  3CMM A;  3DU5 A;  1W5C C;  3WU2 C;  4K2E A;  1WRJ A;  4HF0 A;  4Y3O A;  4HDU A;  2VOP A;  3KZI C;  1N25 A;  1QA6 A;  4XON A;  4EJO A;  5EZG A;  1MMN A;  3IRQ A;  2VLA A;  5HOD A;  3PNY A;  3K4L A;  3WTV C;  3K2A A;  1ZAO A;  4BQQ A;  3HOU J;  1GT0 C;  1K78 B;  3VEP A;  1XB4 A;  4A3F J;  1WJF A;  2ISY A;  3JSP A;  5FD6 A;  2ZJP F;  2RVC A;  4ETS A;  3KLO A;  3HZJ A;  1RPW A;  4P9U A;  1OCP A;  4HDV A;  1TL8 A;  3R6S A;  3QOD A;  4GCV A;  3LSP A;  5GTH C;  2DQR A;  4CO8 A;  2LP0 A;  2EIK H;  1DGW Y;  4CZC A;  1S7A A;  2XF6 A;  3IUO A;  1BN5 A;  1YFH A;  4B4C A;  3CCU I;  1IN4 A;  2K4B A;  3GTQ J;  2GIV A;  2ZJR F;  3S2H J;  2WTE A;  1SFU A;  1FEX A;  1ZRE A;  3TW6 A;  5EG0 A;  1USS A;  5E8I A;  3EYY A;  2HPM A;  5HLT A;  4CCO A;  4B44 A;  5IY5 H;  3S3M A;  4B8X A;  4AIJ A;  3E6M A;  1BI2 A;  1YO5 C;  4IHS A;  2P7V B;  1U9O A;  3LMM A;  4HOB A;  4GO1 A;  3TO6 A;  5BOX A;  2DFF A;  1R5G A;  3I4P A;  1SFK A;  2CQQ A;  1I27 A;  4CZZ A;  4ZTF A;  3OS1 A;  2PJR A;  1D1C A;  1X1A A;  3KLN A;  2A3S A;  5CVJ A;  4AYB N;  4G7O F;  5C4J J;  2EIJ H;  5J1U A;  2OCC H;  2VUM J;  4LIU A;  3CES A;  1X3W B;  3FHN A;  4NC8 A;  4B43 A;  1GXQ A;  4AIK A;  2CG4 A;  4FAS D;  4EEF G;  4HBL A;  3S1R J;  1S7E A;  4BKX A;  4F52 A;  5IOY A;  1MMA A;  4XOR A;  4A3I J;  3K1N A;  4RLF A;  5ICE A;  3K4N A;  3KIO A;  2JZY A;  3J7A Y;  3ESW B;  4AC0 A;  1ZG5 A;  4KIF A;  2NAZ A;  3UNG C;  3K2Z A;  1UHS A;  1OCO H;  5ED4 A;  2GOM A;  2KJB A;  4J00 A;  4OAZ A;  5FFZ A;  1W7P B;  4QWQ A;  3AKZ A;  1Y39 A;  4CYC A;  1BIA A;  3BZC A;  4DBR A;  4GFB A;  4BU2 A;  4IRG A;  4UUS A;  1ON2 A;  2NNN A;  1D0Y A;  3IKT A;  2QZ8 A;  3V7R A;  5E18 F;  2CSO A;  2DA4 A;  2P81 A;  1U9N A;  1VQL I;  3F6O A;  2ZO4 A;  1P7I A;  5D8L B;  1FP2 A;  1DPR A;  3OYM A;  4M73 A;  4OIQ F;  2JN6 A;  2DCE A;  2JT1 A;  2DXI A;  3ULQ B;  2R7F A;  2CV0 A;  1IUY A;  4IX7 A;  1BBY A;  1W5T A;  2W4S A;  4QSH A;  5EDN A;  3JRI A;  5TRD A;  1YRN B;  2HOT A;  3RZO J;  1IZ1 A;  1MNE A;  2EK5 A;  1FIA A;  2JSC A;  5D4S A;  1HSJ A;  3KZZ A;  3CJQ B;  4B1R A;  3OYG A;  4R79 A;  3BOQ A;  2PMU A;  4P55 A;  1H0M A;  1WWX A;  4F55 A;  1AKH B;  3BY6 A;  5LHG A;  4G9Y A;  1S8N A;  3LQR A;  1LDD A;  4M3F A;  3HKZ A;  4HLY A;  3VSK A;  4MTE A;  3E6C C;  3S32 A;  4DQ2 A;  4CXF A;  3E3V A;  3L9F A;  4AU7 A;  2LF8 A;  5L3F A;  2M2E A;  3C2B A;  3JAM K;  1A6Q A;  3F8C A;  1K6Y A;  3OYL A;  3QPH A;  3CUQ A;  4HQE A;  3GTL J;  2P4W A;  2XAF A;  3G1O A;  1MIJ A;  2HFH A;  3JRG A;  4A3D J;  4RGS A;  3L7W A;  4BUP A;  2M7A A;  2GXB A;  5FLV A;  1WJD A;  1RI7 A;  1G3Y A;  3HRT A;  2JA6 J;  3I55 I;  1T0F A;  1D0X A;  2GWR A;  3CUO A;  4XM3 A;  4BEH A;  2L7F P;  2QEX I;  3M07 A;  2BV6 A;  2GIZ A;  4D7N A;  5HNH A;  3ABL H;  4BJT A;  3ROU A;  4IL6 C;  3Q5F A;  1SD7 A;  2VBX A;  3V8J A;  3OYK A;  4RA2 A;  5LHI A;  1Y56 A;  4UV8 A;  4XLE A;  5LEK A;  1AA7 A;  1XGO A;  3LSR A;  3VOE A;  2Z3Y A;  4XLN F;  1YJ9 I;  2X6X A;  4L18 B;  4M9S A;  2UUZ A;  1G6N A;  3B02 A;  3QWL A;  4WXH A;  3PIP F;  2IS2 A;  4F91 B;  5A2Q K;  4PCQ A;  3TOB A;  2L54 A;  3COA C;  2R5Y B;  3PFI A;  5LRS A;  1MDM A;  1ZK8 A;  1VQ5 I;  2RRE A;  1PP8 F;  1O7F A;  1HKT A;  2CWE A;  1XD7 A;  2OTL I;  3E6D A;  3SDB A;  2R7W A;  2L3D A;  4L0Z B;  3S3O A;  2Q8K A;  4XKW A;  4NB5 A;  4IZZ A;  3FBN B;  1IW7 F;  1W0T A;  4IKF A;  3BR3 A;  4X0G A;  4M74 A;  4E4H A;  2VJ5 A;  1ETW A;  2IGN A;  2CMP A;  1BI3 A;  2HOA A;  2L0K A;  4LMY A;  3O3K A;  3ABU A;  1R22 A;  3OYE A;  3HYI A;  5EEA A;  2P5L C;  4BDZ A;  1Y8Q B;  5H2F C;  1EV7 A;  1IRF A;  3K7A J;  5CVI A;  5D5U B;  5D6F A;  5EGO B;  2K9M A;  3WTT C;  2OJE D;  2EWN A;  2ZKZ A;  2IVM A;  1V54 H;  1S7O A;  4UB8 C;  4FTH A;  2R7X A;  2DA1 A;  1Z21 A;  1JT6 A;  1XG1 A;  1QO0 D;  3BPV A;  3IP4 B;  4HA8 A;  1BL0 A;  4IHT A;  1JGG A;  5C3E J;  3T5X A;  3DBL B;  4AVZ A;  2E5N A;  2KRH A;  3CF5 F;  3M3Y J;  1V5E A;  3HGG A;  4A69 C;  2DMP A;  2DU9 A;  2QSF X;  3GEZ A;  3K10 A;  2NS8 A;  5FD5 A;  2K85 A;  3BCA A;  4BGD A;  1W36 D;  2GA1 A;  3LSJ A;  2ZBK A;  4F3Q A;  1GDT A;  2JUG A;  1TQI A;  5GAE J;  2BVM A;  2MC3 A;  3S1M J;  4XRM A;  2KLO A;  2HXO A;  2VT3 A;  3ZN1 A;  5IPA A;  3QP5 A;  3IV5 A;  1EJ9 A;  1BI0 A;  1ORK A;  1FJL A;  5EJC A;  3H3V K;  4HF1 A;  1V4R A;  3OIO A;  1OYY A;  3TP3 A;  1J75 A;  4XMY A;  3GWZ A;  1MJB A;  4MQ9 F;  4U0V A;  1J59 A;  3KEY A;  2AQF A;  2HDW A;  4BY1 J;  4ESJ A;  2LKX A;  3OYN A;  3J7Y J;  2YX7 A;  3BG9 A;  1YOV B;  3EET A;  3OOP A;  1DPU A;  4PDK A;  1DU6 A;  3TQN A;  5J40 A;  4A93 J;  4I2O A;  3WGG A;  2CS3 A;  1HKS A;  5ICF A;  3W6J B;  3DF8 A;  2DTZ A;  2MGQ A;  1OR7 C;  4BBR J;  2OTJ I;  3JRH A;  4J01 A;  1V5G A;  4OOI A;  4II3 A;  3K4K A;  5CVV A;  1A6I A;  2IBD A;  1KYW A;  2X4H A;  3TDU C;  2ISZ A;  2R7V A;  2HQN A;  3FXR A;  4OIP F;  3ERE D;  2WV1 A;  5AIP A;  1PVE A;  1J09 A;  3BR6 A;  3FXQ A;  1BR1 A;  5M5W J;  4JX6 A;  3LAJ A;  4KUM A;  3LFU A;  5FRM A;  5IYB J;  1RUO A;  1ZR4 A;  5HLH A;  3CC2 I;  3KPH A;  2K9Q A;  3RJP A;  5GPA A;  3WHB A;  4DIQ A;  2MLG A;  4ZDL A;  1PUE E;  4HW0 A;  4B48 A;  3V42 A;  3E0J B;  5L3B A;  4A3K J;  3LSM A;  4M3D A;  5EF6 A;  1UHM A;  3I58 A;  5C44 J;  1MH4 A;  2BW3 B;  2HWV A;  2E2J J;  3H0D A;  1D8K A;  2CUE A;  3HL2 A;  3J81 Z;  1NTC A;  2EFQ A;  3CTA A;  3ZOB A;  2DMT A;  3LSI A;  2EFO A;  5LEJ A;  4KDP A;  3RKQ A;  2PQ8 A;  3Q0V A;  5LFA A;  2E1C A;  4CH7 A;  3CUQ B;  3P5J A;  1JJ8 C;  2DA7 A;  1IXR C;  4KIT B;  3GBG A;  4EM0 B;  4HX4 A;  2DMN A;  1E3P A;  2HYJ A;  2ELH A;  1W1W E;  4WWC A;  2VE9 A;  1FOW A;  3G71 I;  3GTM J;  1R49 A;  3L09 A;  3ABT A;  3ZN0 A;  5J8F A;  4E7H A;  1OKR A;  1AKH A;  4C2T A;  1TTY A;  1LFB A;  1Z0X A;  3MMY B;  1DP3 A;  4RB2 C;  2DDA A;  4XRF A;  3CZ6 A;  2KDZ A;  2H8R A;  5F08 A;  2VB6 A;  1SD6 A;  4XLF A;  5D5V B;  2V6C A;  3QRF F;  4NUB A;  6PAX A;  2VC0 A;  4UNO A;  1Z3Y A;  2R7D A;  4BY7 J;  2PEX A;  1HOM A;  2MBF A;  2VQC A;  1XDS A;  4M9X A;  4V2G A;  1U8B A;  2BZT A;  5ERI A;  2ESN A;  2PG4 A;  3ONQ A;  2CUJ A;  1HST A;  2OPT A;  1G59 A;  2P6S A;  4LFU A;  3A01 A;  5HS8 A;  3PQK A;  5JVT A;  3HEF A;  5K5R A;  2X6Y A;  3F23 A;  1T2K A;  3HUG A;  5K7Z A;  2KRF A;  3H1C A;  3IL2 A;  4BAY A;  2NS7 A;  4UUS B;  1J7K A;  4B3A A;  3QYF A;  3S15 J;  4M3E A;  2ETH A;  1W7P A;  3KYC B;  4IVN A;  2PJP A;  1E0E A;  1X1C A;  2LY9 A;  3KP6 A;  2R5Z B;  1WPK A;  1R71 A;  3GFI A;  2XRL A;  1EF4 A;  1TNS A;  3K69 A;  2BY3 A;  4NC6 A;  2V1N A;  2VJ4 A;  2BY0 A;  4D9J A;  1SEU A;  2P7C B;  1FBQ A;  2G9W A;  2G7H A;  2HEO A;  2JA2 A;  4E7I A;  5DV5 A;  2LNB A;  1WJE A;  3C3W A;  3TW7 A;  1FYM A;  4KNY A;  1PUF A;  2V6E A;  2JRT A;  2HZD A;  1X4P A;  4H4K C;  2ZJQ F;  5EEH A;  4A3L J;  1IXS B;  3I54 A;  4MFD A;  3TMO A;  2RN7 A;  1T6S A;  4JP0 A;  2WAE A;  3ASN H;  3BWG A;  1Z7L A;  2Y9Z A;  3KP4 A;  4KN4 X;  2E19 A;  4HZF A;  1PUF B;  4D5C A;  2HYF A;  3GTK J;  2N8G A;  1WFX A;  1TWF J;  1U3E M;  4B3X A;  4EJT A;  1CGP A;  4UUV A;  3FM3 A;  4O5V A;  1SVL A;  4OU0 A;  3WOD F;  1GLN A;  2ZME A;  1XS9 A;  4NDL A;  1O3T A;  3OL3 A;  3K4C A;  1IXC A;  4M6Y A;  2CUF A;  1HF0 A;  4W97 A;  2AXT C;  3SFI A;  4XOT A;  2IS4 A;  3K4M A;  2ECB A;  3OS0 A;  3LSG A;  3QOP A;  1MGT A;  1R5H A;  2ZXI A;  2TCT A;  2MFZ A;  3DEW A;  4KIB A;  4E7K A;  2P0W A;  3PM1 A;  1T95 A;  2Z1D A;  1T98 A;  2DAO A;  2K9L A;  2XDV A;  3FZV A;  2B63 J;  3PSI A;  3FXO A;  4F7Z A;  1BJZ A;  1X1B A;  3IRR A;  3LST A;  4FT8 A;  2CH0 A;  2VBY A;  3CLO A;  3F72 A;  1KGS A;  2AQE A;  2DMQ A;  1O7L A;  4ENN A;  2AO9 A;  2K7L A;  4YIR X;  3H3Z A;  3U9G A;  3G73 A;  2RDP A;  2PX9 A;  4B09 A;  1GUU A;  1ZLJ A;  3CCJ I;  2LK2 A;  1UZC A;  3SFZ A;  1F5T A;  3EYI A;  4JX5 A;  1N77 A;  2LDU A;  1J9I A;  3ZQG A;  3JRF A;  1D8J A;  1S3J A;  1BJA A;  3ISP A;  1YIT I;  3E5Q A;  2HOS A;  4L9J A;  3V7C A;  1UG2 A;  3BC8 A;  1LJ9 A;  4XIC A;  2OBP A;  2FML A;  1O3S A;  4FIS A;  2YS9 A;  4LOC A;  2O03 A;  2Y2Z A;  4E7L A;  4GYI A;  2LH9 A;  5KAI C;  1IRX A;  4LIV A;  3B6A A;  1FT9 A;  3N4M A;  1VQO I;  1VQK I;  2A6E F;  1ETQ A;  1X3U A;  2UV1 A;  4BE0 A;  2W85 A;  3E1S A;  4XKC A;  2Y69 H;  3DBR B;  1ZAR A;  4UXN A;  1IGN A;  4XKB A;  3CJT B;  3EDP A;  2EJR A;  3A1Y A;  3AFH A;  3R4K A;  2XGC A;  3G4S I;  3HOV J;  2AS5 F;  1YYV A;  2Q0O A;  3CD6 I;  2HZT A;  3OIP A;  4A0Z A;  3RKW A;  1WZ2 A;  2FBH A;  2GOX B;  1EH7 A;  4C2M J;  1REP C;  4ASN A;  4OMY A;  2YPR A;  3GTO J;  1Y0U A;  4YEJ A;  3DKW A;  1UEL B;  2DA6 A;  2NXN B;  2ZME C;  2LF7 A;  4RGU A;  5H6R A;  3FMR A;  2STT A;  2LRD A;  2K02 A;  1LUJ B;  4C9Y A;  4I01 A;  4CGZ A;  2A05 A;  5A2Q Z;  2UWM A;  3MAJ A;  5E1W A;  4YG2 F;  2VXD A;  4HEA 2;  3OYC A;  1NG7 A;  3UKG A;  4XRS A;  2H1L A;  3A4C A;  3RSN A;  3SZG A;  2QKM B;  2RC4 A;  3WGI A;  1WCM J;  4PGG A;  2DFE A;  4JBA A;  4NQW A;  2JTV A;  4CA0 A;  4F93 B;  3WTS C;  5J4Y A;  2XKO A;  5B1B H;  1IO2 A;  1RR8 C;  3BTJ A;  3VYS B;  5E79 C;  3K0L A;  3PNV A;  3O6B B;  1IG7 A;  3GXO A;  2K9S A;  3SZP A;  4IOC F;  1MNM C;  1QZZ A;  5J1Y A;  2DJI A;  1P7J A;  4NC7 A;  3ZMU A;  4BJ5 C;  3M9A A;  4P9F A;  5GAG J;  4G8X A;  1Z6T A;  2FOK A;  2ZB9 A;  3WG7 H;  3GUD A;  1JUP A;  1ZGW A;  2LKS A;  4CDG A;  5FO5 A;  2CQN A;  3HRM A;  4ABZ A;  4BS9 A;  3FIS A;  3OR2 C;  1XSX A;  1AHD P;  2M30 A;  3ABM H;  3E5U A;  5HVQ C;  4A2U A;  1WKM A;  1ZEL A;  3WE3 A;  1H9T A;  3LOC A;  3ABK H;  3WG9 A;  2E1M C;  3VDX A;  3EUH C;  3KET A;  2HQR A;  4EJV A;  3DBH B;  2DT6 A;  4OIR F;  4ZYE A;  1YRN A;  4YRV A;  5BPD A;  3CP8 A;  4LG0 A;  3S17 J;  4XL9 A;  3IC7 A;  5LGT A;  2O5R A;  3I0T A;  4E7J A;  4S04 A;  4PGH A;  2D1V A;  4RB0 A;  4I02 A;  2DJN A;  2DA3 A;  4A3B J;  4KYW A;  4LG0 B;  2FXA A;  2M8E A;  1SFX A;  1ZR2 A;  2DT7 B;  1A31 A;  1GVD A;  2E1M B;  3RIR A;  2XF5 A;  3ML6 A;  4BYY A;  4HRI A;  4BH9 A;  1F36 A;  1OQY A;  1ONV A;  4OWR B;  4JOM A;  4WCG A;  2YSR A;  3VB2 A;  2A61 A;  2HKO A;  3BR1 A;  1WJB A;  2W82 A;  1Z7U A;  3W2W A;  2QBY B;  5L3D A;  1A04 A;  2ZFU A;  4II2 A;  2MW8 A;  2NVT J;  1FWZ A;  3SEZ A;  1UJ8 A;  4PJM A;  2M87 A;  3N05 A;  3M8F A;  2IGO A;  1IF1 A;  4CIC A;  3JW4 A;  4FX4 A;  1KU3 A;  4CSW A;  1OLT A;  2YX4 A;  5J6X A;  5JR3 A;  5F0F A;  5JVG F;  2P5V A;  1U0J A;  2FSW A;  3EQL F;  4Y17 A;  5JHU A;  4M71 A;  1P4A A;  1HW2 A;  4LLN A;  3Q9S A;  2HTS A;  3JCU C;  3U21 A;  3QPL A;  1ON1 A;  1LEB A;  4XSX F;  2HKX A;  1K83 J;  3D0S A;  4U0Y A;  4G7Z F;  3BLY A;  1ZG1 A;  4WK8 F;  2NYX A;  1S6L A;  1TBX A;  1AOY A;  4HG2 A;  3VYT B;  2VON A;  1TC3 C;  2XKP A;  3MZ8 A;  2LOO A;  1R4N B;  3KX2 A;  1NK2 P;  5DD4 A;  1ZH5 A;  1OIS A;  2R7T A;  1P2F A;  1G3T A;  3HOW J;  4L0Y B;  4FE4 A;  1D1A A;  5EYR A;  5CYV A;  2A6T A;  1KA8 A;  4NQW B;  4I99 C;  3I56 I;  2DA2 A;  2A6H F;  4R8H A;  4QIW N;  4LLG F;  2V1X A;  1R00 A;  2VC1 A;  3GTP J;  3FIW A;  1D0Z A;  2OD5 A;  3ZQC A;  3DCF A;  4D0P A;  3HOZ J;  2X9D A;  2Z2S B;  4LJZ F;  2COM A;  1QNT A;  4P1W A;  5FKO A;  1S9H A;  4A6E A;  2EZI A;  3MKW B;  3VOD A;  5E3M A;  1K78 A;  4ZJZ A;  3J81 K;  5BPI A;  5DEQ A;  2KJC A;  5F6F A;  2FU4 A;  2IW5 A;  3C2G A;  1LKX A;  3P9I A;  4W1U A;  3TO9 A;  4X1E A;  1S5L C;  2WB1 N;  2Q1Z B;  1PDN C;  2DPU A;  3DLL F;  3ZQQ A;  4L9T A;  3QYE A;  3OYB A;  3FXJ A;  4X6A J;  1G2H A;  4U87 A;  2XUB A;  3RKY A; 
#chains in the Genus database with same CATH homology
 4ENK A;  1UB9 A;  1HW1 A;  4KA4 A;  1YW7 A;  4MQV A;  5CLS A;  2QVO A;  5TJJ A;  1UFM A;  4Q4Z F;  1FYK A;  1XMK A;  2VBZ A;  1I1S A;  4OIN F;  3MFK A;  2EV6 A;  2EFW A;  2Y75 A;  2OA4 A;  2M1B A;  3RPU A;  3U2R A;  4A12 A;  1MZB A;  2W57 A;  2CGP A;  1BM9 A;  4KFC A;  4A6D A;  1KQ8 A;  2V1D A;  3ELK A;  1ZN2 A;  1GHC A;  5FLX Z;  5IT9 Z;  1K7A A;  1FX7 A;  3GFL A;  4HLX A;  1ZYR F;  1FPQ A;  5DUI A;  1SMT A;  4BNC A;  3B73 A;  1QQI A;  2GQQ A;  5JFR A;  1IN8 A;  2F5E A;  3WGH A;  2HS5 A;  4A0X A;  2XAH A;  4GYG A;  2STW A;  2Y48 A;  2JPC A;  4EM1 A;  2NS0 A;  3GO5 A;  3HHH A;  3QPT A;  3I53 A;  2F2E A;  2EA4 A;  1E17 A;  3SXY A;  2OZ6 A;  2UXX A;  1ODD A;  2FNA A;  2O3F A;  1FBS A;  4NHJ A;  1BC7 C;  3R0J A;  3LFK A;  2RV8 A;  4BHB A;  1G4D A;  3W6K B;  2DT5 A;  4P96 A;  4ZYH A;  3CDH A;  2BE5 F;  2OQG A;  5E1X A;  2G7U A;  3BRO A;  3FWE A;  3KP5 A;  4U7D A;  4U0W A;  2H27 A;  3Q9V A;  1U5T C;  2FMY A;  3GLX A;  2H09 A;  4N9I A;  3RKX A;  3T8R A;  1TQM A;  2E1N A;  1U8R A;  1WQ2 A;  1P4X A;  4MHG A;  3S2W A;  1WI9 A;  4AD9 A;  3KCC A;  3LAP A;  1R1U A;  1RUN A;  2E7X A;  4XLP F;  1S29 A;  2CYY A;  3HSE A;  1YW8 A;  3JTH A;  2V1U A;  4N0B A;  1HBX G;  2C6Y A;  4Z2Y A;  1DUX C;  3DPL C;  2GZW A;  1FNN A;  3HOS A;  2PBI A;  5D6E A;  3MZH A;  4BXU A;  1JHF A;  4A5M A;  2W84 A;  3DV8 A;  1Z6R A;  1ZRD A;  2GAU A;  2VT2 A;  2IA0 A;  2VBW A;  3LA3 A;  2F5D A;  2DLL A;  4DNC A;  3ZMV A;  3V4G A;  3QU3 A;  1IAW A;  1B1B A;  4BHC A;  1YS7 A;  2JPB A;  2O61 A;  1OR7 A;  2L4M A;  1P6R A;  5LRR A;  1B4A A;  4L5I A;  1QPM A;  3P7N A;  3ZMD A;  1OYI A;  1FSH A;  4EJW A;  1RZ4 A;  2DQL A;  4O6J A;  3I64 A;  5LGN A;  1FP1 D;  3P9K A;  3I59 B;  3C18 A;  4HAM A;  2H6C A;  1UST A;  2IRF G;  3ZPL A;  2XAQ A;  4AVP A;  4WXC A;  2XRO A;  4ZYD A;  1XGS A;  3HTS B;  2KIF A;  4KMF A;  4MNU A;  2QWW A;  1UCR A;  3DFG A;  5FB2 A;  2UZK A;  2EA2 A;  1MD0 A;  4ESB A;  4ZYG A;  4Q48 A;  2VXZ A;  4RGR A;  4CHU A;  2Z9O A;  2GXG A;  3F8N A;  2Z5U A;  4G6Q A;  3N97 A;  3SHF A;  3QP6 A;  1XSV A;  2M45 A;  4LK0 F;  2DTR A;  3DQV C;  5AIQ A;  4TV7 A;  1V3F A;  4FX0 A;  3WU0 A;  2MD5 A;  2EV0 A;  2OZU A;  5HDK A;  4JQF A;  2UXN A;  1HW5 A;  4AWX B;  2FBI A;  4IPA A;  1B59 A;  2ADU A;  1W7P D;  5FFX A;  4GXO A;  1RIO H;  2XV4 S;  2CW0 F;  2DO7 A;  3U1D A;  3M7G A;  3WTW C;  3WTU C;  1YQA A;  2ZXJ A;  1F4K A;  1F1Z A;  3L2C A;  4EM2 A;  2DK5 A;  2HDC A;  2ZFW A;  3T8T A;  5K1Y A;  1KYZ A;  2ZCW A;  3GF2 A;  1O3Q A;  1LB2 A;  4RAZ A;  3KEQ A;  1ZRF A;  3RYR A;  2IA1 A;  4HQM A;  2L01 A;  3K1P A;  1JGS A;  3KE2 A;  3F6V A;  2ZJ2 A;  1XSD A;  4HV5 A;  5E8G A;  5BS6 A;  1CF7 A;  1HKQ A;  2B0L A;  5LHH A;  4LLL A;  1T39 A;  5ILV A;  4ZZD A;  4EJU A;  4M9Z A;  2MH2 A;  4G94 A;  2DW4 A;  2NRA C;  2BYV E;  4ZH4 F;  1DP7 P;  5D5X B;  1ZRC A;  2FQ3 A;  3BJO A;  2IT0 A;  1B6A A;  2KIM A;  2TDX A;  3K1M A;  2HYG D;  1D5V A;  3DXJ F;  4KT5 C;  1AWC A;  3KZY A;  5KK1 A;  2K4J A;  3WTZ A;  5E20 A;  1QGP A;  3MWM A;  2IJL A;  2ESH A;  1U6G A;  2VE8 A;  1Z05 A;  2F5C A;  4OMZ A;  5L3C A;  1BIB A;  3IWF A;  3IKV A;  5D5W B;  3E97 A;  4M6X A;  5LLQ A;  4GGG A;  3RI4 A;  2XGX A;  4Q47 A;  4AIH A;  2PMH A;  2BGC A;  3I59 A;  5KVR A;  4OIO F;  4EMS A;  1I1G A;  4G7H F;  1OMI A;  3H92 A;  5J8C A;  1IN5 A;  2D45 A;  4RB1 A;  2GA2 A;  1QZY A;  2QLZ A;  1KU9 A;  1YIO A;  2ZNY A;  1B9M A;  4P5O A;  3I71 A;  4KN7 X;  4LGW A;  1JE8 A;  4IF4 A;  3QU6 A;  2H94 A;  3GVA A;  3CO7 C;  1G3W A;  3V8K A;  3CUQ C;  4QLC U;  4RAY A;  5ICG A;  5IT3 A;  4ENM A;  1HQC A;  4BQA A;  3LWF A;  1U2W A;  2R3S A;  3EUH A;  2AXL A;  4UVC A;  1ZLK A;  1SD5 A;  5DDG A;  2QYO A;  4EV0 A;  3KEO A;  4ZZL A;  3REO A;  2DPD A;  3TOA A;  1FOK A;  2V9V A;  5FLX K;  5IT9 K;  2O8X A;  2XAJ A;  1YS6 A;  5DCM A;  3H3U A;  4U88 A;  3BPX A;  4LB6 B;  1FYL A;  3E5X A;  3HTU A;  3KFW X;  2D1H A;  1VTN C;  4EVI A;  5DYM A;  3F8F A;  1XCB A;  3ZMS A;  3GX4 X;  3NEU A;  2RGV A;  1E2X A;  2ACJ A;  2HR3 A;  1P92 A;  3GZ5 A;  1HXD A;  3FMS A;  1TW2 A;  3CJN A;  4I7H A;  4A5N A;  1Z9C A;  2XRN A;  1FLI A;  3AAF A;  3HIF A;  3P9C A;  4WX9 A;  4HF2 A;  2A07 F;  1J0R A;  2V79 A;  5BQT A;  3LQQ A;  1R1T A;  2ZNZ A;  4R1H A;  1YW9 A;  3MZY A;  3ZMT A;  4WXD A;  5H20 A;  2PN6 A;  2FEZ A;  1QBJ A;  1WSU A;  5D8K B;  4RGX A;  1R36 A;  2FF4 A;  3KP7 A;  4CYD A;  3GFJ A;  4H0E A;  3GZ6 A;  4YIF A;  1K79 A;  2WC2 A;  5HOO A;  3IHU A;  2F5F A;  1LVA A;  4WF2 A;  2M5W A;  2P5K A;  2Z33 A;  3DP7 A;  1TLH B;  5HLI A;  3MQ0 A;  3E6B A;  1XMA A;  5DCM B;  3V7S A;  1O3R A;  2YR2 A;  2P8T A;  3HOT A;  4MEX F;  3DEU A;  1TQP A;  5DCF A;  1KQ0 A;  4IJA A;  1J2X A;  5HDG A;  3F21 A;  3M8E A;  4Q5S F;  4M72 A;  2QQB A;  2QQA A;  3FM5 A;  1NHA A;  3SZT A;  4HYE A;  4IRI A;  1ZHF A;  1LNW A;  2YU3 A;  2EFP A;  1ULY A;  2EFN A;  4ON0 A;  1O57 A;  4KMU X;  3HSF A;  2MA3 A;  2VOD A;  1SAX A;  3HHG A;  5CVR A;  1IN7 A;  1FY7 A;  3ZMZ A;  3WU1 B;  1R23 A;  1MJ9 A;  5ILU A;  1SFE A;  1KQ9 A;  3LA7 A;  1YTY A;  1XDU A;  3BDD A;  1XCV A;  4YFN F;  5L3E A;  4EQQ A;  2A68 F;  1BC8 C;  1Z91 A;  1L0O C;  2KIU A;  2VOO A;  2KKO A;  2QM3 A;  3C1D A;  1Z1D A;  3HSR A;  1R1V A;  1TNT A;  3MCZ A;  2EV5 A;  3SQN A;  3T1B A;  4YFX F;  4YFK F;  1D3Y A;  3VFZ A;  1KU2 A;  3F22 A;  4UVB A;  2DBB A;  3L00 A;  3TKY A;  1W4M A;  3GW2 A;  5L3G A;  4YII A;  4A0Y A;  2H6B A;  3GFM A;  3RYP A;  4ESF A;  5DD8 A;  2OAZ A;  3R61 A;  4RB3 C;  2J5O A;  5E1Z B;  2XIG A;  2BBY A;  4ENJ A;  1U5T A;  4Y15 A;  4UV9 A;  4XBF A;  3GYH X;  1XGM A;  3TO7 A;  5HS9 A;  2CO5 A;  3G3Z A;  2X0L A;  2XVC A;  4L9V A;  1I6X A;  4PZJ A;  2OU2 A;  4I98 B;  4KIC A;  2XAS A;  3BP8 A;  4LB5 A;  3D5L A;  1B9N A;  3FX3 A;  4IRH A;  2FNP A;  2Z99 A;  1BOA A;  1LDJ A;  1STZ A;  2Q2E A;  5HDN A;  1ZGJ A;  3ZQ7 A;  2E7W A;  2VN2 A;  4HX7 A;  1F9N A;  2DI3 A;  3ECH A;  3PQJ A;  4BHP A;  3BZ6 A;  4MTD A;  5H6Q A;  3O2P E;  3CO6 C;  1XGN A;  2OQR A;  3J7A O;  2LKP A;  3OV8 A;  3JAM Z;  3TDZ C;  4I09 A;  1CF7 B;  2A69 F;  5ILS A;  2WWY A;  3BJ6 A;  2RNJ A;  5BMZ A;  3RTR A;  4LK1 F;  1TW3 A;  1FBU A;  1EH8 A;  2NNY A;  1MDM B;  2L4A A;  3F3X A;  1I5Z A;  1H9G A;  3R60 A;  1LDK B;  4Y13 A;  2IP2 A;  2DK8 A;  5LBQ A;  4I0B A;  1YG2 A;  2P6T A;  3FXU A;  4LD5 A;  1SD4 A;  2RQP A;  5E17 F;  2K86 A;  1UHW A;  3F8B A;  1K6O A;  2IPQ X;  4MEY F;  2HOE A;  5K5Q A;  1XN7 A;  4HX8 A;  2J5P A;  5LGU A;  5HS7 A;  1GVJ A;  2QUF A;  4L5J A;  5JI6 A;  2L02 A;  3I5U A;  3R0A A;  2WV0 A;  2W24 A;  2HGC A;  1FZP B;  2A5Y B;  1C0W A;  1J5Y A;  1G3S A;  2W25 A;  3BJA A;  5FGM A;  4O3M A;  2O6G E;  2O0Y A;  2QBY A;  1EH6 A;  1LEA A;  3J80 K;  4L9N A;  1LQ1 A;  5AON A;  1U5T B;  1ZGA A;  2HTJ A;  2QQ9 A;  4JK1 X;  1MJA A;  5DUK A;  1P4W A;  3C7J A;  1U78 A;  3TGN A;  4G6D A;  4N9H A;  3IWZ A;  1T38 A;  4UVA A;  2PFB A;  3K9T A;  2IA2 A;  1YLF A;  3JTG A;  4I0A A;  2D2W A;  3F8M A;  2BEO A;  3HRS A;  3J80 Z;  1R58 A;  2MLK A;  1MKM A;  2RKH A;  2Y0M A;  4S05 A;  2EB7 A;  3WTX C;  3DPT A;  1IRG A;  3QAH A;  2ZME B;  3ECO A;  3HRU A;  1PP7 U;  1SMY F;  2DFI A;  4UHT A;  5CVU A;  5ICC A;  1R7J A;  4FHT A;  3JSO A;  2CQK A;  4HV6 A;  2XAG A;  3RPQ A;  2FE3 A;  2FRH A;  4IXA A;  3WE2 A;  1JXS A;  2FA5 A;  1JHH A;  1KU7 A;  5CJ9 A;  1FC3 A;  1BI1 A;  1DDN A;  5F1R A;  2QEN A;  5F64 A;  4MGR A;  1IN6 A;  1RNL A;  2FBK A;  1OPC A;  3KP3 A;  1L3L A;  2XHK A;  1W5S A;  2K27 A;  3NQO A;  5K5O A;  5EEG A;  5D4R A;  3FHZ A;  4RS8 A;  2MH9 A;  1ZG3 A;  3FF5 A;  4U7B A;  3WTY C;  3T0Y A;  1GXP A;  1FSE A;  4XSZ F;  1Q1H A;  5HLG A;  3MEX A;  3ZP5 A;  3FMQ A;  2PI0 A;  2PLY A;  2CFX A;  3LA2 A;  2LSO A;  3RDI A;  3KP2 A;  4E70 A;  4EGZ A;  4EGY A;  4KIG A;  3NRV A;  1OYW A;  3M1E A;  3V8L A;  4K2E A;  1WRJ A;  4HF0 A;  4HDU A;  2VOP A;  4EJO A;  3IRQ A;  3WTV C;  1ZAO A;  1K78 B;  3VEP A;  1XB4 A;  2ISY A;  3JSP A;  5FD6 A;  2RVC A;  4ETS A;  3KLO A;  4P9U A;  4HDV A;  3R6S A;  4GCV A;  2DQR A;  4CO8 A;  1S7A A;  1BN5 A;  1YFH A;  1IN4 A;  2K4B A;  2GIV A;  2WTE A;  1SFU A;  1ZRE A;  1USS A;  5E8I A;  3EYY A;  4AIJ A;  4B8X A;  3E6M A;  1BI2 A;  1YO5 C;  4IHS A;  2P7V B;  4HOB A;  4GO1 A;  3TO6 A;  5BOX A;  1R5G A;  3I4P A;  4CZZ A;  1I27 A;  3KLN A;  2A3S A;  5CVJ A;  4G7O F;  1GXQ A;  4AIK A;  2CG4 A;  4HBL A;  3K1N A;  5ICE A;  2JZY A;  1ZG5 A;  4KIF A;  2NAZ A;  3K2Z A;  5ED4 A;  2KJB A;  5FFZ A;  1W7P B;  4QWQ A;  1BIA A;  4IRG A;  1ON2 A;  2NNN A;  3IKT A;  2QZ8 A;  3V7R A;  5E18 F;  2CSO A;  3F6O A;  2ZO4 A;  5D8L B;  1FP2 A;  1DPR A;  4M73 A;  4OIQ F;  2JT1 A;  3ULQ B;  2R7F A;  1IUY A;  1BBY A;  1W5T A;  5TRD A;  1IZ1 A;  2EK5 A;  2JSC A;  5D4S A;  1HSJ A;  3KZZ A;  4R79 A;  3BOQ A;  2PMU A;  4P55 A;  1H0M A;  1WWX A;  3BY6 A;  5LHG A;  4G9Y A;  1S8N A;  3LQR A;  1LDD A;  4HLY A;  4MTE A;  3E6C C;  4DQ2 A;  4CXF A;  3E3V A;  3L9F A;  2LF8 A;  5L3F A;  3JAM K;  3F8C A;  3QPH A;  3CUQ A;  4HQE A;  2P4W A;  2XAF A;  2HFH A;  4RGS A;  3L7W A;  2GXB A;  1RI7 A;  1G3Y A;  3HRT A;  1T0F A;  2GWR A;  3CUO A;  2BV6 A;  3ROU A;  3Q5F A;  1SD7 A;  2VBX A;  3V8J A;  5LHI A;  4UV8 A;  5LEK A;  1XGO A;  3VOE A;  2Z3Y A;  4XLN F;  4L18 B;  4M9S A;  1G6N A;  3B02 A;  4WXH A;  5A2Q K;  4PCQ A;  3TOB A;  2L54 A;  3COA C;  3PFI A;  5LRS A;  1MDM A;  1PP8 F;  1O7F A;  1HKT A;  2CWE A;  1XD7 A;  3E6D A;  2L3D A;  4L0Z B;  2Q8K A;  4NB5 A;  1IW7 F;  4M74 A;  1BI3 A;  4LMY A;  3O3K A;  3ABU A;  1R22 A;  3HYI A;  2P5L C;  1EV7 A;  1IRF A;  5CVI A;  5D5U B;  5D6F A;  3WTT C;  2EWN A;  2IVM A;  2ZKZ A;  1S7O A;  1QO0 D;  3BPV A;  4HA8 A;  4IHT A;  3T5X A;  2DU9 A;  3GEZ A;  5FD5 A;  2GA1 A;  2ZBK A;  1TQI A;  2MC3 A;  2VT3 A;  3ZN1 A;  3QP5 A;  1BI0 A;  4HF1 A;  1V4R A;  1OYY A;  1J75 A;  3GWZ A;  1MJB A;  4MQ9 F;  4U0V A;  1J59 A;  4ESJ A;  2YX7 A;  3EET A;  3OOP A;  1DPU A;  4PDK A;  3TQN A;  4I2O A;  3WGG A;  5ICF A;  1HKS A;  3W6J B;  3DF8 A;  4OOI A;  5CVV A;  2X4H A;  1KYW A;  3TDU C;  2ISZ A;  2HQN A;  3FXR A;  4OIP F;  3ERE D;  5AIP A;  3FXQ A;  3LAJ A;  4KUM A;  1RUO A;  5HLH A;  3RJP A;  2MLG A;  1PUE E;  4HW0 A;  5L3B A;  1UHM A;  3I58 A;  2HWV A;  1D8K A;  3J81 Z;  2EFQ A;  3CTA A;  4KDP A;  2EFO A;  5LEJ A;  2PQ8 A;  2E1C A;  3CUQ B;  1IXR C;  4EM0 B;  4HX4 A;  2ELH A;  4WWC A;  2VE9 A;  3L09 A;  3ABT A;  3ZN0 A;  5J8F A;  1OKR A;  1TTY A;  4RB2 C;  4XRF A;  1SD6 A;  5D5V B;  2V6C A;  3QRF F;  6PAX A;  2VC0 A;  4UNO A;  2R7D A;  2PEX A;  2MBF A;  4M9X A;  1XDS A;  5ERI A;  2ESN A;  2PG4 A;  1HST A;  2P6S A;  4LFU A;  5HS8 A;  3PQK A;  5JVT A;  5K5R A;  3F23 A;  1T2K A;  3HUG A;  2KRF A;  3IL2 A;  4BAY A;  1J7K A;  2ETH A;  1W7P A;  4IVN A;  2PJP A;  3KP6 A;  3GFI A;  1TNS A;  3K69 A;  2P7C B;  1FBQ A;  2G7H A;  2G9W A;  2HEO A;  5DV5 A;  2LNB A;  3C3W A;  1FYM A;  4KNY A;  2JRT A;  5EEH A;  1IXS B;  3I54 A;  2RN7 A;  1T6S A;  3BWG A;  3KP4 A;  4KN4 X;  4HZF A;  2HYF A;  1U3E M;  4EJT A;  1CGP A;  4UUV A;  3FM3 A;  4O5V A;  4OU0 A;  3WOD F;  2ZME A;  1O3T A;  4M6Y A;  1IXC A;  3QOP A;  1MGT A;  1R5H A;  4KIB A;  1T98 A;  2DAO A;  3FZV A;  4F7Z A;  3IRR A;  3LST A;  4FT8 A;  3CLO A;  2VBY A;  3F72 A;  1KGS A;  1O7L A;  4ENN A;  2K7L A;  3H3Z A;  3U9G A;  3G73 A;  2RDP A;  4B09 A;  1ZLJ A;  1F5T A;  3SFZ A;  3EYI A;  2LDU A;  1J9I A;  1D8J A;  1S3J A;  1BJA A;  3ISP A;  3E5Q A;  4L9J A;  3V7C A;  1LJ9 A;  2OBP A;  2FML A;  1O3S A;  2O03 A;  4GYI A;  1FT9 A;  3N4M A;  2A6E F;  1X3U A;  2W85 A;  1ZAR A;  4UXN A;  3EDP A;  2EJR A;  3R4K A;  2AS5 F;  1YYV A;  2Q0O A;  2HZT A;  4A0Z A;  3RKW A;  2FBH A;  1EH7 A;  1REP C;  4ASN A;  4OMY A;  2YPR A;  1Y0U A;  3DKW A;  2LF7 A;  4RGU A;  5H6R A;  3FMR A;  2STT A;  2K02 A;  4I01 A;  4CGZ A;  5A2Q Z;  2UWM A;  3MAJ A;  5E1W A;  4YG2 F;  2RC4 A;  3WGI A;  4PGG A;  4JBA A;  4NQW A;  2JTV A;  3WTS C;  2XKO A;  3K0L A;  3O6B B;  3GXO A;  3SZP A;  1QZZ A;  3ZMU A;  3M9A A;  4P9F A;  4G8X A;  1Z6T A;  2FOK A;  3GUD A;  4CDG A;  5FO5 A;  3HRM A;  1XSX A;  2M30 A;  3E5U A;  5HVQ C;  4A2U A;  1WKM A;  3WE3 A;  1H9T A;  3WG9 A;  3KET A;  2HQR A;  4EJV A;  4OIR F;  4ZYE A;  5BPD A;  4LG0 A;  3IC7 A;  5LGT A;  3I0T A;  4S04 A;  4PGH A;  2D1V A;  4RB0 A;  4I02 A;  4KYW A;  4LG0 B;  2FXA A;  2M8E A;  1SFX A;  3RIR A;  3ML6 A;  4BYY A;  4BH9 A;  1ONV A;  4WCG A;  2YSR A;  3VB2 A;  2A61 A;  2HKO A;  1Z7U A;  2QBY B;  5L3D A;  1A04 A;  1FWZ A;  2M87 A;  3M8F A;  1IF1 A;  4CIC A;  3JW4 A;  4FX4 A;  1KU3 A;  2YX4 A;  5J6X A;  5JR3 A;  2P5V A;  2FSW A;  3EQL F;  4Y17 A;  5JHU A;  4M71 A;  1P4A A;  1HW2 A;  4LLN A;  3Q9S A;  2HTS A;  1LEB A;  1ON1 A;  4XSX F;  2HKX A;  3D0S A;  4U0Y A;  4G7Z F;  1ZG1 A;  4WK8 F;  2NYX A;  1S6L A;  1TBX A;  1AOY A;  2VON A;  2XKP A;  5DD4 A;  1ZH5 A;  1P2F A;  1G3T A;  4L0Y B;  5CYV A;  1KA8 A;  2A6H F;  4R8H A;  4LLG F;  2V1X A;  1R00 A;  2VC1 A;  2OD5 A;  4D0P A;  4LJZ F;  2COM A;  1QNT A;  4A6E A;  3VOD A;  1K78 A;  3J81 K;  5BPI A;  5DEQ A;  2KJC A;  5F6F A;  2FU4 A;  2IW5 A;  3P9I A;  3TO9 A;  2DPU A;  1PDN C;  4L9T A;  2XUB A;  3RKY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...