2R5YB

Structure of scr/exd complex bound to a consensus hox-exd site
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
59
structure length
59
Chain Sequence
RRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIRYKKNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*DAP*DCP*DTP*DCP*DTP*DAP*DTP*DGP*DAP*DTP*DTP*DTP*D
publication title Functional specificity of a Hox protein mediated by the recognition of minor groove structure
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription/dna
total genus 22
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2007-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2r5yB00
5F0CA 5FLMJ 2E1OA 3JRFA 1RESA 5FLVA 3ZQIA 2E2JJ 3LOCA 4B3AA 1IG7A 2XGEA 1A5JA 2E19A 3A01A 1I3QJ 4A3DJ 2LKXA 4IHVA 2DMTA 2K9NA 1JT0A 1JT6A 1MH3A 2NS8A 1AHDP 4DYCA 1ETXA 2CUEA 1JJ8C 5GPCA 3LSPA 2VPRA 2R92J 2FJ1A 2DA7A 3CQZJ 2DJNA 1SANA 2RAEA 1VF9A 3JR9A 2XPVA 2LP0A 3E7LA 2L7ZA 1LFUP 1JTYA 2GM4A 1MSEC 1MH4A 2KDZA 3OIOA 4JP0A 3S15J 1ETQA 5IP6A 2EZHA 3GTPJ 3I4NJ 4X6AJ 3S1QJ 3NARA 3H3VK 1DU6A 1IC8A 1U8BA 2Y30A 4S0HB 2R7ZJ 1FIPA 3SDGA 4XRSG 1NK2P 4CYCA 1U78A 3F0CA 1ITYA 1ETKA 2P81A 2I10A 4QIWN 3GTLJ 4G12A 2IEKA 5E3LA 1I50J 2CJJA 4FE4A 5EZGA 2DA6A 2ELKA 2X9DA 3K2AA 1JTXA 3O8GA 3HOXJ 2K9QA 1RPWA 4M3GA 2DMNA 2R5YB 1ETVA 2EQRA 3HOZJ 1ZK8A 1F43A 5E3MA 4EEFG 2NS7A 3IH4A 1XG1A 3SFIA 3HM5A 2OF7A 2WV1A 1RR7A 3HGYA 2R5ZB 1RKWA 1BJZA 1MNMC 4BBSJ 3RQIA 3OSFA 1PUFA 2XRLA 3JRHA 5HODA 2LR8A 3K7AJ 2XB0X 4A69C 3CDLA 1QPIA 4FISA 3HGGA 4DYQA 4XK4A 1R9TJ 3BG3A 2H8RA 1YRNA 4A3EJ 2VUMJ 2E2HJ 1X2NA 1X58A 2LFBA 3S1RJ 4D5CA 3ZQLA 2EZLA 1WH5A 1Y1WJ 1NTCA 4A3FJ 2ECBA 2QCOA 5J1YA 2NVYJ 2JJ7A 3NAUA 3GTMJ 2CQQA 2ME6A 1B8IB 5EG0A 5M3FJ 2ID6A 3MN2A 1E3OC 4JX4A 3HOUJ 2FD5A 3QPSA 1MSFC 1RKTA 1QRYA 1WH7A 4JX5A 1IDYA 2IBDA 5EGOA 4AC0A 4A3KJ 4A3GJ 1MBFA 5M5WJ 3FIWA 1LE8B 2ME0A 2DTZA 3FISA 1ENHA 3FKIJ 1VI0A 4B1RA 4XIDA 2XPUA 3MKLA 2Y9YA 4MO7A 1APLC 2K9SA 3GBGA 1HDDC 4JX6A 3IV5A 4ABZA 2O8KA 1QVTA 5GPAA 5IYCJ 2D5VA 3HEFA 4QSHA 1QVUA 4W97A 5F1JA 1ETWA 2HYJA 2Y31A 4BY7J 2M9HA 2HDDA 5EDNA 4D7MA 2XPWA 3WHBA 3G1LA 4FTHA 1GT0C 5IPAA 2HI3A 3QQAA 2Y9ZA 3S1NJ 2JA7J 3IH2A 1JKQC 1X2MA 3B6CA 3DCFA 4NDLA 3QPLA 1ZGWA 3S2HJ 4GFBA 3C2BA 2JA8J 1JUSA 3JRAA 4A3IJ 1H88C 2TCTA 2W48A 2H1KA 4M3BA 4C2MJ 1OFCX 1OJLA 2L7MP 2VI6A 1DU0A 1JUPA 2NVQJ 1Z77A 5E3NA 1WCMJ 1GDTA 2HXOA 3BTCA 2COBA 3FK6A 1GV2A 1MBGA 2NOGA 5C44J 4AUXA 1ZTRA 1HCRA 3L1PA 3MVPA 1TWGJ 2LVSA 3HOWJ 4D7NA 3G1MA 3HDDA 5FKNA 4CYCB 1U9OA 2LD5A 1IRZA 3TEDA 1BW5A 4B4CA 2O9LA 3BR6A 1U9NA 2QF7A 5BNGA 3RZOJ 4XRSA 5EEAA 5IOZA 2B63J 4A3CJ 1Q1VA 2DA1A 2DA5A 3LSJA 4QTRA 3S17J 2XGDA 5IOYA 2YUSA 3S16J 3Q0WA 4A93J 4DW6A 1W0TA 3ZQCA 1MBEA 2G0EA 1OCTC 2HOTA 1B72B 1UG2A 3LSRA 2R5YA 4IHWA 4BKXA 3O8HA 1UHSA 3H0GJ 1O4XA 2VKEA 3RZDJ 3BT9A 1EF4A 2HQ5A 2CU7A 3GTQJ 2ZB9A 4BXXJ 1HF0A 2EZIA 1JKOC 3JREA 4XICA 1K61A 2E2IJ 3Q0UA 4C3IJ 1AKHB 2JA5J 1TWHJ 4IHXA 4V2FA 5J1UA 3S14J 4DZJA 3ZQGA 3BR5A 5GP9A 1POGA 5M3MJ 1D5YA 1G2HA 3JRBA 5EG0B 3JRGA 2M8GX 1XC5A 2R93J 1XS9A 1Y1VJ 1HOMA 2TRTA 1A6IA 3BR2A 1TWFJ 4BY1J 5FKMA 3BTLA 1VNDA 3S1MJ 4UUTA 1FTZA 4UUSA 3LNQA 4FCYA 2VKVA 2R0QC 1W0UA 1JKPC 2ID3A 3BG9A 5EYRA 1T33A 2JA6J 5F04A 1IDZA 4A3LJ 3I4MJ 5IYDJ 4MFDA 5F27A 1JGGA 3DEWA 9ANTA 5JLXA 5EF6A 1T56A 4Y52J 4C3JJ 1LE8A 1H89C 2N8GA 2OPTA 3S2DJ 4M3DA 1IV6A 4M3FA 2O7OA 2EBIA 5J1RA 2CUFA 3A01B 1F36A 3JRCA 5FKKA 2LY9A 1WI3A 5F08A 3OOUA 2L0KA 2DA3A 1K83J 3HKZN 3TW6A 3BTJA 5JLWA 3M4OJ 2DA2A 3BQZA 2Y0SN 5DS9A 1ZKGA 5IYBJ 4X1EA 2M2EA 2MSYA 2JWTA 3D1NI 1JUMA 3TP3A 1OCPA 3RKQA 1TC3C 4V2GA 2FQ4A 2LLKA 1GVDA 2M0CA 5IP9J 3A03A 4MFEA 3BTIA 2AHQA 3CCYA 2PMZN 4IEJA 3GTOJ 5J3LA 2DA4A 4DYRA 1ZR2A 1I6HJ 5C3EJ 1WGXA 3PO3J 2EZKA 2LTPA 2X6OA 3ZQHA 1FJLA 1IUFA 3VPRA 5M5XJ 3JRIA 1MBHA 2MW8A 4IHYA 3HOVJ 3Q3SA 4M3EA 4C3HJ 2GBYA 3OSGA 4DZPA 3PO2J 3W6VA 5EZHA 4A3MJ 4RBOA 1BA5A 1ZQ3P 1UMQA 1WPKA 3TP0A 1ETOA 2FX0A 2M34A 2Y2ZA 2GLOA 2DMUA 3M3YJ 1IJWC 2DN0A 2X48A 4RDUA 1TWAJ 3CMYA 4W1UA 1HDPA 1TWCJ 5DTDA 3LSGA 3WHCA 2CQXA 4I6ZA 1ETYA 1PUFB 4AYBN 1JKRC 3GTKJ 1MBJA 4MLOA 2HOSA 4Y7NJ 5FJ8J 1GUUA 3HOYJ 1SFOJ 1YRNB 2AO9A 4D5FA 2L7FP 2R5ZA 1ORKA 2JK3A 2HXIA 2EH3A 2YS9A 2DMQA 1NK3P 3G1OA 3BR1A 5E3OA 4FE7A 1B72A 1BW6A 4A3BJ 3HBLA 3FK7A 1AU7A 2NVTJ 3TW7A 5C4JJ 3IH3A 4I76A 4M6VA 1IGNA 2NVXJ 2IAIA 1FIAA 3PM1A 3ZOBA 2DMPA 5F0FA 2MGQA 3UKGA 1HLVA 2MG4A 4HNVA 3GTJJ 4JYKA 5K7HA 3B6AA 1FTTA 2L9RA 4L5EA 3Q0VA 5EGOB 2HOAA 1AKHA 5C4XJ 1FEXA 4BBRJ 2JN6A 3HB9A 2YU9J 1Z0XA 1P7IA 5M5YJ 4XRMA 1B8IA 2XGCA 4UUSB 1H8AC 1ZR4A 5FKOA 2LK2A 3BR3A 5K7FA 4LOCA 3SJMA 5FKLA 3ZQFA 4J19A 1S7EA 1GV5A 2WB1N 1MBKA 1JJ6C 1LFBA 3BG5A 2ECCA 1VFCA 1P7JA 5F0HA 1BL0A 2KT0A 4MIMA 3A02A 3JRDA 1RETA 5IP7J 3GTGJ 2XB5A 2K40A 4A3JJ 2WAQN 2CRGA 5K7ZA 2JMWA 3BQYA 3BR0A 2XSDC 1CQTA
chains in the Genus database with same CATH superfamily
2K7LA 2JPBA 4LK0F 2IA0A 3C3WA 3R4KA 4ASNA 3ZQIA 2E2JJ 4DGWB 2MA3A 4N4NB 1IG7A 2XGEA 2X1CA 2Q1ZB 1T0FC 2EFOA 3L2WA 3JTHA 4RM2A 1W5SA 4MNUA 4RGRA 1JT6A 2EFPA 3ZQ7A 1J2XA 2V1XA 2ZNZA 1FBQA 2FE3A 4R1HA 4KUMA 5GPCA 2ZSHB 3OYLA 3FXRA 3KEQA 2MC4A 1XGSA 4DIQA 2XPVA 3WTVC 4CZCA 1P4XA 4IHTA 1A35A 1MH4A 5GADJ 2OZUA 2E34A 1ETQA 2FOKA 4X6AJ 1HA8A 1UAAA 3W2VA 4ANJA 1U8BA 1D8KA 4OAYA 3V8KA 2JSPA 1VZ0A 1Z6TA 2WTEA 4HDVA 1G3YA 5CPRB 2EILH 3G2BA 2CQNA 3DU5A 3F0CA 2M5WA 4OIOF 2LYCA 1E3HA 5E20A 4A0XA 2KDOA 2MH9A 3BPVA 3DPUA 3TDUC 4NHJA 1LDKB 3BDDA 2IEKA 4G6QA 1MW7A 4I0AA 4OIPF 3CCMI 1XMXA 5EZGA 2DA6A 4N9HA 4E7LA 1JTXA 3O8GA 5JFRA 2YU3A 4M3GA 1R22A 2EQRA 2A6HF 3HPHA 5DCMA 1ZG3A 1QO0D 1ZG1A 3K4KA 4CCNA 3LAJA 1F43A 1XSDA 3DWLE 3J7ZI 1Q1HA 5B1BH 1NG6A 5TGTA 4BAYA 1IV8A 3ASNH 4EM1A 3F3XA 1MNMC 2VB6A 3JRHA 2QQ8A 3E5QA 3H9JA 4XRFA 1MMGA 4KT5C 3L2RA 3HOTA 1FZPB 3GFLA 1FWZA 5CVRA 4O3MA 2YX7A 2NVUB 2H8RA 1YRNA 4A3EJ 2VUMJ 1XN7A 1R1TA 2COMA 2LFBA 1X58A 3OMYA 3S1RJ 3ZQLA 2PMZA 2HTSA 1QZYA 4WF2A 5HS8A 2V1UA 5CVVA 3MKWB 2ME6A 2BY1A 1C0WA 1SD6A 4JX4A 1BOBA 2FD5A 2VJJA 3QPSA 1RKTA 3FBNB 1MSFC 2VXDA 4LGWA 3HG9A 2CUJA 3HTSB 1IDYA 5EGOA 4UVBA 5HDKA 4GXOA 1YX3A 3CCRI 1MBFA 2VASA 2KMUA 4F92B 1SFUA 2DPDA 4DBQA 1B1BA 3FISA 2W24A 2K4JA 3M07A 2K3FA 4BEHB 2HVRA 1I39A 4EVIA 3L09A 3MKLA 2OQRA 4GO1A 3RCOA 3G71I 3CC7I 2E60A 2KIUA 3QU3A 1K6YA 2LKPA 4ABZA 5J4YA 2D5VA 3DEUA 3HEFA 2MABA 1QVUA 3J7AO 1FSEA 4FASD 2NNNA 4HNUA 3ABMH 5DM6F 3U9GA 2VT2A 4ZDPA 3E6BA 1XPXA 3OYDA 1BIBA 4XBFA 1X1CA 2MYSA 1TNTA 2PBIA 3G1LA 1F1ZA 3OL4A 4IRHA 5IPAA 2E7WA 2Z3YA 1D1CA 3S1NJ 2FMLA 1ON2A 3GW2A 1JKQC 3B6CA 1ACIA 3DCFA 4NNJA 2PMUA 2PI0A 3C2BA 5JI6A 2UXXA 1DP3A 4BXUA 1YI2I 2FBKA 4H0EA 2GXBA 1KA8A 2IA1A 2VJIA 1H9TA 1K79A 1DU0A 1JUPA 2NVQJ 2P7VB 3F8CA 5K1YA 3H3UA 4GYIA 1X3UA 4V19K 3QU6A 2STWA 3C1DA 3KP6A 1VQNI 4I01A 4AUXA 1ZTRA 4U0VA 1LEAA 2H1LA 3MVPA 4D7NA 2MFZA 2VOPA 4IPAA 1S6LA 2ZFUA 2CMPA 3S93A 4Z6YA 4M9ZA 4RA2A 4B4CA 3QYFA 3FXUA 5K5OA 3BG6A 3LFKA 6PAXA 1BR4A 2QF7A 5DUIA 5CJ9A 2DQRA 1T0FA 5EEAA 2HYFA 1N78A 1Q1VA 3CJTB 4OMZA 4HV5A 4NQWA 2CV0A 3N05A 3S17J 2XGDA 4RB1A 1UCRA 1T95A 4E70A 4LK1F 3WGIA 3DPLC 5D4SA 1IZ1A 4A93J 4FQGA 1R7JA 1MBEA 2G0EA 2D45A 4BYYA 4RGXA 2H94A 5BQTA 4WXDA 3LSRA 2W1OA 3P9CA 1UHSA 3H0GJ 1P9QC 4PZJA 3J80K 3V8LA 2VKEA 2LY1A 3KZZA 3QWLA 3CMMA 4LJZF 2HQ5A 2ADUA 4LD5A 1UELB 3AG1H 4XKVA 3ZXSA 3GZNB 4XORA 2PMHA 2JA5J 2F4IA 4ZYHA 4EATA 1OYYA 1EV7A 1GXPA 5J1UA 3S14J 2CO5A 2STTA 4CXFA 1POGA 4J00A 1HXDA 1X3WB 2FMYA 1G2HA 2L54A 3WTXC 5EG0B 5ED4A 4DBRA 2M8GX 4LG3A 1ZRFA 4BACA 1B6AA 1QZZA 1LUJB 1Y1VJ 3WU0A 3MAJA 1HOMA 2M45A 3DTKA 5FROA 2VLAA 2TRTA 1A6IA 2XVCA 2L2OA 1TWFJ 5TJJA 4BY1J 2O61A 5E18F 1OR7C 4UVAA 2DK8A 5TISC 3Q5FA 2ZXWH 3ESWB 3BROA 3G6EI 1IXSB 4YFKF 4FCYA 3MCZA 5HDNA 2RQQA 3QPTA 2R0QC 1W0UA 5ICFA 2I5UA 4U7BA 1YW8A 5EYRA 1T33A 1WSUA 1TQMA 4CSWA 3I4MJ 2M4GA 5D5WB 2CV2A 2FUG2 2X6WA 4MFDA 1YOVB 3E5UA 5JLXA 4Y52J 1O7LA 1T56A 4C3JJ 4UNOA 2HQRA 1N77A 2OPTA 3KE2A 3FMRA 2R4GA 1UHMA 2A05A 4DNCA 1JE8A 1MJBA 2EBIA 3BY6A 4HX7A 4F55A 3CD6I 2XROA 3BJ6A 4BL0B 4HQEA 2X6YA 3J80Z 1R5HA 2XAHA 5F08A 1HSJA 2CWEA 3C2HA 4P1WA 4P5OA 5HLGA 2K5CA 3BQZA 2M0MA 4X1EA 1RNLA 1J59A 1BR2A 3RDIA 3QYEA 1JUMA 1XCBA 4LLGF 3K4BA 4V2GA 1TC3C 2FQ4A 1B59A 5DD4A 2IW5A 2M0CA 5B1AH 5IP9J 4IQJA 3DLAA 4R8HA 4D9JA 4MFEA 4L9NA 4BQQA 5KHDA 1PP8F 3BTIA 2DBBA 3RKXA 3FXOA 2O3FA 1UFMA 3Q9VA 1G3SA 4EJTA 4FETA 3OS2A 2R7TA 3HTUA 2EZKA 3I5UA 2HEOA 2DYSH 1YHQI 4CCJA 5HNHA 1F9NA 4M3EA 1IRFA 1EA3A 4DZPA 5ILSA 4TV7A 1FOWA 1YS6A 1YE9A 3FWEA 1WPKA 5IT3A 2FX0A 4KN4X 3WTTC 5DCMB 4A5NA 4E4HA 1QNTA 4IQ4A 1Y39A 2P6SA 1HC8A 2DN0A 1VQLI 1H0MA 2OZ6A 3JSOA 1IN7A 5CQGA 2E36A 3WTYC 1JGSA 1N75A 2F4OB 4HLXA 4DJAA 1HDPA 3OOPA 2V6CA 3WHCA 4I6ZA 1OCRH 4AYBN 1SD4A 3H9GA 1WJEA 4PFOA 3HHGA 4BQNA 1SFOJ 1YRNB 2AO9A 2VODA 3UNGC 3CJNA 2GXAA 3OYFA 1K4TA 1ZGAA 5J4VA 4S05A 1CF7B 1B72A 4A3BJ 5BMZA 4YIFA 4IJAA 1TBXA 1IXCA 2XF5A 2NVTJ 4I76A 4KA4A 1WRJA 3D5LA 3S3MA 1ZRCA 3D5SC 1DUXC 3EETA 1ZLKA 3A2KA 2DLLA 1E17A 2EV0A 1SD7A 4CZZA 4EJWA 3ZR8X 1GLNA 2V9KA 2IP2A 3V42A 4FX4A 2EV5A 3U21A 4ITVA 5FO5A 4HNVA 4AIDA 1J7KA 2E5ZA 5EGOB 3MZHA 2YX4A 5C4XJ 5E79C 3RYPA 1FEXA 4OOIA 2Z9OA 2DI3A 2KRCA 1EH8A 4M74A 5M5YJ 4XRMA 3QOPA 1G4DA 5JHFA 4UUSB 1EH6A 3QODA 5LGTA 2XGXA 2K9LA 3D5RC 5CYVA 1GVJA 5J47A 1YYVA 5K7FA 2LK2A 3OYJA 2VQHA 5FLXK 3V7CA 1LFBA 1WJ5A 3GF2A 1D8JA 2HFHA 3V7SA 5F0HA 1S8NA 2UZKA 3S2WA 4RGUA 5LFAA 2LKSA 2XHKA 4CDGA 3FXKA 3HUGA 1HW2A 1VQ9I 2P5KA 2KIMA 2CRGA 2W85A 3VYTB 2V9VA 3OR2C 4XM3A 1ZLJA 2XSDC 3ZMZA 1ZH5A 2ESHA 2XAUA 3I59A 4A6DA 2XRNA 4A5MA 1R1VA 2DTRA 4LLLA 3LOCA 3BJOA 3I4PA 2C6YA 5JVTA 5TRDA 2DMTA 2K9NA 4PJ0C 1LNWA 2CW8A 2NYXA 1MH3A 4MHGA 1RZ4A 4DYCA 1ETXA 1QA6A 1XMAA 1PJRA 3O2PE 2VPRA 2ZJRF 2R92J 1KU3A 2H09A 2I8DA 1VQ8I 4GDFA 4NC6A 1XTAA 2RAEA 3HSFA 2LNBA 3WE3A 3RKYA 4IF4A 2DT6A 2L7ZA 3A1YA 4RAZA 4RB2C 3S15J 3OIOA 2M7AA 4BQOA 4BE0A 4KJZA 1T6SA 3V4GA 2HU9A 3NARA 5FLXZ 3H3VK 2JA2A 3BOQA 4UXNA 4XRSG 1UZCA 1U78A 4NQWB 3KEYA 1ETKA 2QQBA 4FHTA 4DOZA 1TLHB 2FNPA 2DDBA 2P81A 4XLFA 1OPCA 3T0YA 2DW4A 3DP7A 5KVRA 1IN5A 4PJJA 4G9YA 5JVGF 4R79A 1YITI 2X9DA 4N9IA 3K2AA 3FBIB 3NEUA 4ESBA 2DMNA 3FX3A 1B9NA 4RB3C 4P9UA 3BP8A 1QZEA 5E3MA 4EEFG 3HOSA 5ERIA 4QPQA 2NS7A 1ULYA 2LRDA 3IH4A 4U0WA 2OCCH 3SFIA 3HKZA 4F93B 3E6CC 2OF7A 4G8XA 4ON0A 3K70C 3TBIA 3HGYA 2CW7A 4II3A 5H6RA 3S3NA 4BBSJ 2EPFA 2MLKA 1WKMA 5HODA 1NHAA 4A69C 4G7OF 3CDLA 2JUGA 2ZMEB 3H5NA 3H1CA 4FISA 3IWZA 2Y75A 4BDZA 5KK1A 3ZMDA 2RREA 3BCAA 1WH5A 1X4OA 4Y33A 3K4NA 4OINF 1S29A 3M7GA 2ZXIA 2JJ7A 3GTMJ 2CQQA 4XLCA 5EG0A 1AOYA 5M3FJ 1R23A 2DAOA 3RIRA 1ZELA 1E3OC 4PSWA 4OU0A 2ESNA 1S7AA 2EB7A 4S04A 2IBDA 2BHYA 3E5XA 4O6JA 3UR3C 4A3GJ 4PGHA 1MD0A 1OMIA 4YELA 2CQ7A 1ENHA 4MQ9F 4B1RA 2XPUA 4LB5A 2XAJA 2KKOA 3B73A 4MO7A 1APLC 3WTUC 3IV5A 2O8KA 1X1BA 2JSCA 4QSHA 1SEUA 2CFXA 4W97A 2GIVA 1VQOI 2Y31A 3JTGA 3G73A 2M9HA 5L3CA 2HDDA 4YIIA 1FPQA 1GT0C 5H6QA 4K2EA 2PG4A 2ICWG 4HA8A 4L0ZB 1LEBA 3QQAA 2DDAA 2VE9A 2L5QA 2RKHA 2JA7J 5D6EA 2EINH 4QWQA 2KZGA 4NDLA 2LY2A 3QPLA 4HPQA 3I55I 3R60A 1ZGWA 3F8BA 4GFBA 2FBIA 1JUSA 2WAFA 1D3YA 3CZ6A 2TCTA 2W48A 2H1KA 4Y3OA 1OFCX 2MLGA 1Z77A 2ZCWA 1RIOH 4FX0A 3K4LA 5KAIC 2QGUA 1WCMJ 3T8TA 1YS7A 4PJNA 5LHIA 2HXOA 5JHUA 1MBGA 1IW7F 2FEZA 3OL3A 5A2QK 1Z7UA 2LVSA 2VJ5A 3PQJA 2GOMA 3AG4H 3G1MA 4BNCA 1IRGA 5FKNA 1HSTA 2EK5A 3DU6A 4CYCB 4M9XA 1IN8A 1U9OA 1WJAA 3VDXA 2LD5A 1XCVA 4ENKA 4XOPA 2WB1A 2ZMEC 3I9V2 1BW5A 2VC0A 3DXJF 3P9IA 2O9LA 3PJRA 4YG2F 2LG4A 2Z2SB 3LSMA 2X0LA 2VIXA 4EM2A 3VEPA 3PUFA 4CUGA 2R7QA 1X1PA 3AL0B 4XRSA 3QOEA 1IUYA 1KYWA 2TDXA 1R4NB 3ZP5A 5H2FC 2R7RA 2VBWA 3LSJA 4QTRA 3F6VA 2V7FA 1UJ8A 2JRTA 2EIMH 2YR2A 1JXSA 1VQMI 2CS3A 2WAQA 2G7UA 4HEA2 4II2A 1MMSA 2KJBA 4DW6A 2R3SA 1OCTC 3KZYA 1B72B 3HRUA 2GAUA 3ERMA 3KYDB 5D4RA 1O4XA 3CJQB 2OUMA 4BJTA 1LFPA 3BT9A 4KMUX 1EF4A 2GA1A 5BPDA 2KHMA 1HF0A 1MZBA 3VSKA 2IVMA 1HBXG 4BHBA 5HDGA 1VQ7I 4XICA 1K61A 1CF7A 4C3IJ 3GUDA 2XASA 1U3EM 2L7KA 2P8TA 3HYIA 4IHXA 3K4CA 1TW2A 4V2FA 3ZQGA 1MGTA 1RC9A 2L9NA 2HNHA 2NXNB 3EUAA 3JRGA 5A2QZ 1FSHA 1NH3A 1KQ9A 1YG2A 1XS9A 4ZZLA 3A4CA 1U0JA 4CYDA 3S1MJ 1W4MA 3FF5A 1V5FA 1FTZA 3N97A 4UV8A 2XV4S 3LQRA 1BI0A 4UUSA 4M72A 2DJIA 3T8RA 3OIQA 2K27A 1U8RA 1MKMA 1JKPC 3EYIA 2ID3A 3TO9A 2OBPA 3BCBA 2JA6J 3U2RA 1IDZA 3HUGB 4A3LJ 2BGCA 1N25A 5LRRA 2IGOA 1JGGA 2VJ4A 3DEWA 2ZJQF 4MTDA 2X4HA 3S2DJ 1P6RA 4M3DA 2UV1A 4EM0B 5L3BA 1Y8QB 3I59B 2O7OA 4I02A 3OS0A 2OA4A 4HLYA 3NWSA 3JRCA 5IT9K 5FKKA 2X1DA 1LJ9A 5KNLA 3W2WA 1UG0A 1WZ2A 4KDPA 3LA7A 2L0KA 3OOUA 5JLWA 1K83J 1Z91A 4HSRA 3TW6A 3M4OJ 5LBQA 2DA2A 2F5FA 5DS9A 2EFQA 2RVCA 2MSYA 1JI8A 1T39A 1T98A 3TL4X 3RKQA 1DPUA 3GLXA 1R00A 3AL0C 3GX4X 2CFOA 1TZLA 3S8PA 2QEXI 3F6OA 3W6KB 3NQOA 4KICA 3ABLH 2OAZA 3LA2A 4RAYA 2BE5F 1V5EA 2H6BA 5GTHC 3OYCA 1SC7A 1YW7A 3H92A 2A68F 3S3OA 1ZR2A 1R58A 3ZGKA 2K9MA 4RLQA 5C3EJ 4MQVA 2LTPA 2X6OA 1A31A 3ZQHA 1FJLA 1MBHA 5E8IA 4XLNF 1P92A 4BE1A 3OSGA 3ASOH 4GGGA 5EZHA 4A3MJ 3K2ZA 3HL2A 1UMQA 3L00A 1KZHA 3JAMK 3TP0A 2EJRA 4IL6C 5DUKA 3F72A 3CCQI 3RYRA 1S9HA 2M34A 1BI3A 2E7XA 2GLOA 3WU1B 2DMUA 2M3AA 5D5XB 2BY3A 1BIAA 1F5TA 2JVHA 2X48A 5EEGA 4RDUA 2CSOA 3KP7A 1TWAJ 3LL7A 4PDKA 3IC7A 4G6DA 3CMYA 3KLOA 4HNTA 5IT9Z 2L3DA 2PFBA 4HX8A 3ABTA 2HKXA 3BLYA 2QKMB 3F9KA 3JW4A 3FM3A 3KCCA 5DTDA 1BC7C 5HLIA 2L4MA 2HQAA 2QYOA 4BS9A 2HVQA 2R7SA 4I98B 2HOSA 1J9IA 1XSXA 3SHFA 1Y56A 3HOYJ 1D5VA 5CQEA 4D5FA 2JK3A 4QPOA 1RUOA 2YS9A 2O6GE 2F48A 1NK3P 2IXSA 2ZBKA 2FQ3A 2PQ8A 2OV7A 2VT3A 3FK7A 1AU7A 1DPRA 3K6GA 2FNAA 2WADA 3FMSA 3TO7A 1AWCA 2OCEA 3CUOA 4M6XA 2WV0A 2ZMEA 3P5JA 4JQFA 2RV8A 2GWRA 2AQFA 5LHHA 1P4WA 2PEXA 4KFCA 3ZOBA 2WBMA 4H4KC 3UKGA 1HLVA 2MG4A 1FBSA 2KIFA 4JYKA 4O5VA 4F52A 1V55H 3EPZA 1R1UA 2L9RA 4L5EA 2HZTA 1XDSA 2HOAA 4WK8F 1I3AA 2JN6A 4ZDOA 4CICA 4CO8A 3HB9A 1GXQA 5KAFC 1O3SA 2YU9J 4B44A 1GHCA 2X1EA 1FT9A 3ABKH 3R61A 3D0SA 3ABUA 3SEZA 4J01A 3JAMZ 2EWNA 1MJ9A 3VYRB 4GRIA 3RQ4A 2IS4A 1K78B 2Z16A 4NC7A 3QRFF 5FKOA 3BR3A 3GCMA 2VN2A 3ZQFA 1D0YA 1GV5A 3DBRB 1MBKA 3MEXA 2W25A 2K02A 2OD5A 3BG5A 2V1DA 2DOFA 4B8XA 1VFCA 3J7AY 2MBFA 3R6SA 2GZWA 2VONA 4BUPA 1PYVA 2W57A 3GTGJ 4ENMA 3GEZA 2XAQA 1KQ0A 3A0HC 1YJNI 2VBXA 4YEJA 3O6BB 1SVOA 3IRRA 3ZN0A 4Y4RA 1WJFA 2F5DA 1QGPA 2HS5A 4Q48A 3LAPA 3IWFA 3P9KA 3DV8A 1JHHA 1IXRC 5K7ZA 2V1NA 3LQQA 4YIRX 1TP4A 3E1SA 3CTAA 3E0JB 5D8LB 5ICGA 1QQIA 5FLMJ 3JRFA 2B9SA 4Q47A 4YRVA 3KPHA 2NS0A 4U0YA 1A5JA 3BJAA 4AIKA 4ZC3A 4A3DJ 4AD9A 4UUVA 1U2WA 2EA4A 2LKXA 5LRSA 2HPIA 2WC2A 1IRXA 4B3XA 2QQ9A 1JT0A 4HV6A 4U87A 3NWTA 2NS8A 3FHNA 5FRMA 4PK4A 3P7NA 5LEKA 2F2EA 4BXFA 1KYZA 2O03A 3LSPA 1X3ZB 3J7YJ 2FJ1A 3RKWA 1UHWA 3CQZJ 2DJNA 3EUHA 4LB6B 4LIUA 3TGNA 3FDYA 5KCMA 3ZRGA 1LFUP 2PN6A 1JTYA 3VWBA 3HSRA 1IN4A 4PJMA 5CVIA 1VQPI 2ELJA 1W5CC 5IP6A 4EGZA 1EH7A 4UY8I 1XGNA 4M9SA 4KISA 2P0WA 3IAS2 1OCZH 2KL4A 4S0HB 4CCMA 2QWWA 4EQQA 3WGHA 1Z67A 1FIPA 3SDGA 2V6EA 2CYYA 3E6MA 1IF1A 1NK2P 4CYCA 2W00A 3CCEI 3DKWA 1Y6IA 1ITYA 5B3SH 2I10A 5EJCA 2H6CA 3F21A 1YX5A 2H27A 3GTLJ 4G12A 2QUFA 4BHPA 2LC2A 2CJJA 3Q9SA 3R0JA 2CV1A 3ROUA 4FE4A 3LSHA 1FMWA 2ELKA 4BDYA 4YFNF 3DTEA 1ETVA 4FT8A 4HX4A 1SFKA 2Z99A 2JUCA 2E1CA 1VQ4I 2F5EA 2M1BA 1KQ8A 2YSRA 3BC8A 3GFMA 1MMDA 2NOJB 3HM5A 4KN7X 1FC3A 3IKVA 1RR7A 3QP6A 3E3VA 1HKQA 2QSHX 1G6NA 3OY9A 1RKWA 4B09A 1LVKA 2BVMA 2A69F 2XC7A 5ILUA 2X6XA 2LR8A 1T08B 1D1BA 1QPIA 2XF7A 3WTWC 2KRHA 1R9TJ 3OYBA 3K1NA 4IKFA 1ERDA 4LITA 2E2HJ 1CGPA 4D5CA 2EZLA 5EEHA 1NTCA 2ECBA 2FA5A 4XSZF 3OWTA 2QCOA 3KETA 5J1YA 1Z9CA 4HQMA 2NVYJ 1BI1A 3NAUA 2WA0A 1LVAA 2RQPA 2G9WA 2ID6A 3MN2A 3CMAI 3RI4A 3F8MA 3HOUJ 2K3PA 2QQAA 3DTIA 1W7PD 5J8CA 2UWMA 3DLLF 3WG9A 2VKHA 1EKEA 1LB2A 5LLQA 3E6DA 4CCLA 2X51A 2BOLA 3MKYB 2VBZA 2M7BA 1FY7A 1D1AA 3N4MA 3CESA 3FKIJ 1O3RA 1TTYA 2Z33A 2MC3A 3LFUA 4XIDA 2BY0A 4LFUA 4NBQA 2A6TA 2WY8Q 2K9SA 1HDDC 4RAGA 1E0EA 4JX6A 2RNJA 2ZNYA 5GPAA 5IYCJ 4X0GA 5DDGA 1T38A 3RPUD 1KONA 2E5NA 2HQNA 1LKXA 2DU9A 3FM5A 3KFWX 1ETWA 2ZXHA 4AYBA 4BY7J 3DQVC 4HSTA 3MKZA 2P5VA 3IAM2 5GAEJ 4GCVA 4FTHA 2XPWA 2BHZA 3L7WA 3WHBA 4BQAA 2HVSA 4C2TA 1DGWY 4YFXF 3EUKL 2HI3A 2Y9ZA 4OIQF 3CCVI 3R0AA 3TKYA 3SQNA 2WAEA 2HKOA 1X2MA 4RGSA 3A0BC 3O3KA 2L9VA 1RR8C 2A61A 2NRAC 2IS2A 1HQCA 4ESFA 2JA8J 3FKJA 1AA7A 1H88C 3LMMA 4M3BA 4C2MJ 1DDNA 2CGPA 1DP7P 2L7MP 2VI6A 2OTLI 4RLFA 2ISZA 3OIPA 1VQ5I 3OYNA 3PSIA 2B7EA 2HDWA 3OYMA 3LSKA 4UV9A 4G7HF 3FK6A 1YQAA 3OR1C 5C44J 1K6OA 1O3TA 1HCRA 2DOEA 2O8XA 3AG3H 3HOWJ 1MMAA 5AONA 3TDZC 3HDDA 3SZTA 1TQIA 3ZPLA 2DFEA 1IRZA 3QYBA 2V4JC 5J6XA 2HTJA 2IS1A 4HF1A 1FOYA 1YTYA 3DBLB 4ETSA 3CC2I 5E17F 3BR6A 3F8FA 1K4SA 3KYCB 1D0XA 3H3ZA 5CVJA 1OCCH 3CF2A 5BNGA 5GAHJ 1EJ9A 1XDUA 3RZOJ 1LQ1A 5IOZA 1XD7A 4ZJZA 4A3CJ 3PIPF 4XMYA 1SMTA 2DA5A 1WJCA 3QAHA 3KIOA 1Z05A 1H9GA 1OYWA 4MGRA 4A12A 3S16J 1FBUA 3Q0WA 3ZQCA 3DPTA 2WWYA 2HOTA 3CCLI 5LGUA 2R5YA 2QKLB 4QLCU 3ZMTA 4E7JA 2VQLA 4BKXA 3O8HA 4C30A 2IA2A 4BJ6C 5HS7A 1U6GA 4IRIA 3K4JA 2KIQA 4P55A 3GTQJ 4BHCA 2L01A 2ZB9A 4BXXJ 2OC6A 4M71A 3OYIA 3SYTA 1Z6RA 2G7HA 4WX9A 3JREA 2Q8KA 1JKOC 2UXNA 2HOEA 4XKCA 2E2IJ 3MZ8A 4A0YA 3Q0UA 1TWHJ 1XGOA 2PLYA 3HRSA 4DZJA 3BR5A 3K70D 4NB5A 3H5AA 3FXMA 3HC7A 3QP5A 2QSGX 2E1NA 2LSOA 3WU2C 1I1SA 1XC5A 4EV0A 2R93J 2KQRA 3NRVA 3PNTA 4G94A 4P96A 3ZN1A 3L2VA 1KU7A 3C7JA 5BS6A 4G6TB 4UUTA 4PGGA 1J75A 1I27A 3LNQA 4MTEA 3CO7C 5K5RA 4AVPA 4D1QA 1YIOA 1USSA 4F3QA 4DQ2A 1K78A 2HGCA 3BG9A 1W7PA 5F04A 4C9YA 1F4KA 4XOTA 2ZJPF 1MNEA 5BOXA 5IYDJ 3E97A 1V5GA 5F27A 4WXHA 1W36C 1R4MB 5EF6A 5H20A 5FFXA 1LE8A 1TL8A 1IV6A 4G7ZF 4M3FA 2CG4A 3TOAA 1LDJA 2ZJ2A 2FSWA 3F8NA 3IRQA 3DFGA 2QA4I 2VL8A 2CUFA 5J1RA 1FYKA 1XX5A 3ECHA 2OJED 1FX7A 3EYYA 1WI3A 1ZREA 2OQGA 3H5RA 2BZTA 2M4KA 2JPCA 2ZXJA 3KEOA 1O7FA 1ZKGA 4RM3A 5IYBJ 3L2CA 2M2EA 2XUBA 1YIJI 3RPUA 1K7AA 1SAUA 5J40A 1QPMA 5E8GA 3D1NI 3TP3A 1ZN2A 1J0RA 3L9FA 3J81K 1L0OC 2LLKA 2XAFA 3KP5A 1W36D 2GA2A 4EGYA 3A03A 4XLPF 5DM7F 3IP4B 3K0LA 2H8WA 1WVRA 3SXYA 5B5EC 2PMZN 4IEJA 1L3LA 3K9TA 3GTOJ 3ELKA 3CUQC 5J3LA 3BWGA 4EJOA 3OYKA 4DYRA 1OLTA 1I6HJ 3GWZA 1TW3A 2LF8A 4E6KG 5HVQC 3M8JA 3PO3J 2PJRB 2J5PA 4BU2A 3PFIA 4F7ZA 5M5XJ 3AG2H 1A36A 2BYVE 4N4OB 5F64A 2GBYA 3W6VA 2XSJC 1LPQA 1PUEE 4RBOA 1BA5A 1ZQ3P 4F91B 3HRMA 4BGDA 4E7HA 4OIRF 1R5GA 4A6EA 4AU7A 4Q5SF 2VXZA 4HG2A 4I2OA 1Z3YA 5DV5A 1ETOA 1MIJA 3CDIA 2BEOA 2Y2ZA 4KITB 3JCUC 1SMYF 1BJAA 3M3YJ 2QBYB 3BZCA 3TQNA 1MDMA 1SD5A 3CCJI 1G3TA 1Y0UA 2KJCA 1B9MA 3CLQA 2DT5A 4W1UA 1WJDA 3DF8A 3BG7A 1X1AA 1Z3XA 4OAZA 4PJLA 1JHFA 3LSGA 4L0YB 1FMVA 2CQXA 4XLHA 1R36A 3C18A 2NNYA 1MBJA 2E35A 3WODF 1QHHD 2XKOA 4MLOA 3ISPA 1T2KA 2IJLA 4Y7NJ 2VQGA 1MJAA 1GUUA 5FJ8J 3J81Z 3VYUB 1ORKA 3PQKA 2R7DA 3SZPA 2EH3A 3G1OA 4CCOA 4RAFA 1I6XA 2AQEA 3HBLA 2LBFB 1YFHA 2LDUA 1DGRM 1ZHFA 5C4JJ 2QLZA 3DKXA 3IH3A 4WXCA 1IGNA 2HWVA 3HPGA 5J8FA 1QBJA 1D0ZA 2NVXJ 3DKYA 3PL8A 3VYSB 1FIAA 4ZYDA 2QSFX 1X19A 2DMPA 3HIFA 2ZSIB 5F0FA 3GTJJ 3ML6A 2P7CB 5K7HA 4E7IA 2GXGA 1X1DA 3Q0VA 4IZZA 1AKHA 3EDPA 3ONQA 4BBRJ 2Y69H 4N0BA 2BVLA 3PNYA 3W3CA 1P7IA 2RGVA 2KPMA 2Q0OA 2CW0F 2M87A 2P6TA 3PNVA 2R7WA 2KLOA 2F6CA 1R71A 5LGNA 1ZR4A 2MD5A 2EV6A 2FRHA 3EUHC 4HYEA 1HW1A 2DFHA 2KFDA 2KRFA 4E7ZA 2XF6A 1W1WE 4J19A 3CLOA 1G3WA 1JJ6C 1YJWI 5AIQA 3GZ5A 2ECCA 1UB9A 3H0DA 1P7JA 2Q2EA 4IOAF 1BM9A 2V26A 2KT0A 4MIMA 3A02A 1VQ6I 4JOMA 3KP2A 3CCUI 5IP7J 4XQFA 4M73A 4CH7A 1G59A 4D0PA 1FYMA 3KX2A 2R7XA 2BXYA 4XN3A 2K40A 4CA0A 3SFZA 1ZRDA 1PVEA 5CVUA 4AVZA 2P5LC 5FGMA 1BC8C 4HDUA 2BV6A 1ONVA 3FHZA 4MEXF 4I0BA 2FOWA 2V9PA 5F6FA 2A5WA 5LEJA 5E1WA 5F0CA 5D5VB 2DXIA 2E1OA 2ZKZA 1RESA 2ISYA 2FU4A 3K10A 3GZ6A 5FLVA 2RDPA 4B3AA 2V79A 4BE2A 4ZDLA 2E19A 3A01A 1I3QJ 2R7FA 2FXAA 4MEYF 4KIBA 5FB2A 4IHVA 2R7UA 4I7HA 2RN7A 5GAGJ 3ULQB 1AHDP 3S32A 5D6FA 2CUEA 3HZJA 1O3QA 1JJ8C 2W7NA 1V3FA 2DA7A 1PDNC 1SANA 3I64A 1VF9A 1Z7LA 2KISA 3JR9A 3REOA 2F5VA 5E1XA 1XB4A 2LP0A 5GTIC 3E7LA 2GQQA 2GM4A 1MSEC 3CJRB 1DQUA 5HOOA 4JP0A 2KDZA 1YO5C 1FOXA 2EZHA 3GTPJ 2YPRA 3I4NJ 4EMSA 3S1QJ 4HF2A 1DU6A 1IC8A 2Y30A 2R7ZJ 4HOBA 1WJBA 1W5TA 4LG0A 4IHSA 3CP2A 3F23A 3HRTA 3QPHA 1VTNC 2K4BA 4KYWA 2E1MB 3CDHA 4QIWN 1KGSA 1ZAOA 3T1BA 4HF0A 3M1EA 5E3LA 1I50J 3SZGA 2IS6A 3GMEA 4HAMA 4EJVA 3HOXJ 2FF4A 2K9QA 1RPWA 1SVMA 3TMOA 2R5YB 4KMFA 3FXQA 3HOZJ 4P9FA 2IRFG 4HBLA 1ZK8A 2K86A 4KNYA 3H9QA 4CGZA 3CUQA 1XG1A 1FNNA 2WV1A 1SFEA 1WHUA 4RMNA 3V8JA 2QM3A 2R5ZB 1HW5A 1WI9A 1BJZA 2D2WA 1FP1D 2KZVA 1B4AA 3RQIA 3OSFA 1PUFA 1SFXA 2XRLA 5DYMA 2ELHA 2LMDA 3MFKA 4B47A 3K7AJ 2XB0X 3DEEA 4XR6A 3HGGA 4WCGA 4DYQA 4XK4A 3BG3A 4OWRB 1OISA 2XDVA 1U5TB 1X2NA 2BW3B 4HZFA 2X85A 1REPC 1ZARA 3OS1A 3EQLF 1Y1WJ 1WWXA 4A3FJ 3LSTA 5L3GA 3CCSI 2DODA 3MMYB 2Z5UA 5DEQA 1WFXA 3TO6A 2EFNA 2HYGD 5FFZA 2A3SA 1QU3A 2CH0A 1B8IB 3GO5A 4IX7A 3SEQA 3M1CA 4L9VA 2F5CA 2A07F 1J09A 3WTSC 3G3ZA 1QRYA 1WH7A 2DCEA 4JX5A 2OTJI 1W7PB 2D1HA 3K4MA 3ZCOA 2MD0A 4AC0A 4Y17A 4A3KJ 1Y0NA 4EJUA 5M5WJ 4U88A 4BJ5C 3FIWA 4ZH4F 2ME0A 1LE8B 4Y13A 2DTZA 1NG7A 2RNGA 3PIOF 1ODDA 5LD2C 1QHGA 1VI0A 3ZMVA 3WG7H 5HLTA 1OCOH 1BR1A 2O5RA 2Y9YA 1S7OA 3IUOA 3GBGA 2VE8A 3G4SI 1PP7U 1QVTA 1RI7A 2JRMA 4OMYA 3M8FA 2ETHA 2IGKA 2DQLA 2ZC2A 4XNFA 4XL9A 5F1JA 4XKBA 1ZYRF 2HYJA 1I1GA 5CLSA 3H36A 5ICCA 1YW9A 2DYRH 5EDNA 1IAWA 4D7MA 2GIZA 4AIHA 4LIVA 4KIGA 2L9SA 1M1EB 3WGGA 1XSVA 1MNDA 2R7OA 2NAZA 1XGMA 2E1MC 3IH2A 1Z1DA 2QVOA 3U1KA 3I54A 2VPLA 2XKPA 4AIJA 1SVLA 3WTZA 3S2HJ 4IO9F 3ECOA 5D8KB 2W4SA 5BPIA 4ZYEA 5L3EA 3JRAA 4XSXF 4A3IJ 1A04A 3HSEA 3HXLA 2UUZA 1OJLA 4Y15A 5E1ZB 2JVGA 5E3NA 4NC8A 1RUNA 1FLIA 1GDTA 2QENA 3TOBA 2DFFA 3BTCA 2COBA 2JZYA 1IN6A 1GV2A 2NOGA 2ZO4A 3PSFA 3L1PA 1TWGJ 4PUSA 2PJRA 4UHTA 2JT1A 2QZ8A 2O0YA 3I3LA 4JBAA 3VODA 3W2AA 4I09A 1V54H 2LOOA 3U1DA 3TEDA 2P4WA 1MDMB 3RPQA 1TNSA 5HLHA 1U9NA 3BZKA 5D5UB 2A5YB 4HRIA 1U5TC 5JR3A 2Y0MA 1SAXA 2EFWA 4ZZDA 5DD8A 2WY7Q 2B63J 1WQ2A 2DA1A 4LMYA 2FBHA 2BXZA 2EIKH 2R7VA 2ZFWA 2QBYA 2VC1A 5IOYA 1A6QA 3GFJA 2YUSA 2IGNA 2OU2A 3MQ0A 5K5QA 4RB0A 1W0TA 2B0LA 3CP8A 5HS9A 3K69A 4PFPA 1UG2A 2HZDA 4L5JA 3HHHA 3FMQA 4IHWA 2VKDA 3ZMUA 1OQYA 3RZDJ 2IT0A 2JTVA 4PCQA 3W6JB 2CU7A 1HKSA 2EZIA 2LH9A 1AKHB 2LBFA 2VBYA 3MD2A 3OYEA 3PUBA 4XLEA 1VQKI 5GP9A 5FD6A 5M3MJ 3CO6C 1D5YA 4WWCA 3JRBA 4I99C 3AAFA 2EA2A 1USTA 2J5OA 4KIFA 1TT5B 2JQ7A 3BR2A 5FKMA 3BTLA 1S72I 1VNDA 5CKTA 4U7DA 1R49A 3AKZA 4GYGA 2Q2EB 1BN5A 3WE2A 4LLNA 3L2QA 4NUBA 2VKVA 1T8IA 2Y48A 1O57A 4Z2YA 1TQPA 3CF5F 2M8EA 4ZYGA 1MMNA 2F4MB 4E7SA 9ANTA 2IPQX 4IVNA 2PJPA 1H89C 2N8GA 3ZMSA 5IY5H 1G8XA 3BZ6A 5F1RA 3COAC 3FZVA 1FOKA 5LHGA 4BEHA 3LSIA 2DFIA 1BI2A 1J5YA 2ACJA 3A01B 2K85A 1F36A 1YJ9I 3KP3A 4ENJA 2EIJH 2LY9A 3K1MA 2Z1DA 3LWFA 4L9TA 2DA3A 3HKZN 3BTJA 2DOAA 3IKTA 4E7KA 2VQCA 1ZGJA 2Y0SN 4B43A 3RTRA 2JWTA 1X4PA 1RRJA 1OCPA 1BOAA 3B02A 1GVDA 2XAGA 4A2UA 1OR7A 5L3FA 3DBHB 3HJEA 4Q4ZF 3C2GA 2AHQA 4ZTJA 3JSPA 2DPUA 3CCYA 1XMKA 2MH2A 3BPXA 2DA4A 1ZG5A 2DK5A 5FRNA 3IL2A 5ILVA 3L2UA 3GYHX 1IO2A 2DT7B 1WGXA 3FXJA 3ZQQA 4LG0B 2VOOA 1IUFA 3VPRA 3JRIA 2MW8A 5FD5A 3FXLA 4IHYA 3GLLA 3HOVJ 3Q3SA 4C3HJ 3PO2J 4IOCF 1OKRA 2A6EF 3KP4A 1Z21A 3V7RA 3MWMA 4C2UA 1KU9A 2RC4A 1R6RA 3RJPA 2LREA 1OYIA 4PSXA 3OV8A 1IJWC 3K1PA 3M8EA 4XKWA 3CUQB 2GOXB 4XN0A 5DCFA 2L4AA 3OYHA 2W84A 3IHUA 1TWCJ 3I58A 4CCKA 3VSLA 1ETYA 1PUFB 1TT0A 2IGMA 1JKRC 1KU2A 3H35A 3GTKJ 2AS5F 3LA3A 4JK1X 3OYAA 2HPMA 4L18B 1LDDA 1P4AA 5ICEA 3VB2A 4BH9A 5HNFA 2LF7A 2L7FP 2R5ZA 2HXIA 2DMQA 2Y0SA 3VOEA 1V4RA 3BR1A 5E3OA 4FE7A 4UB8C 1BW6A 5B66C 4L9JA 3M9AA 1STZA 3KLNA 1FYLA 3TW7A 1E3PA 3AFHA 4M6VA 3SDBA 1R5ID 3F22A 2PX9A 3I0TA 2IAIA 4XLAA 3PM1A 4IRGA 2MGQA 1S5LC 4B48A 1U5TA 4M6YA 4HW0A 2BW3A 2E71A 4IXAA 3B6AA 1FTTA 3X2QH 2HDCA 3T5XA 3I71A 4L5IA 5AIPA 4ZTFA 3KYLA 2D1VA 3OYGA 1HKTA 2DO7A 2W82A 1Z0XA 3GVAA 1B8IA 4ENNA 2M30A 2XGCA 2CUZA 3CMEI 1H8AC 1I5ZA 2L02A 4AWXB 4LOCA 3VFZA 3SJMA 5FKLA 1S7EA 2WB1N 4AM3A 1E2XA 4KT6A 4XONA 2HR3A 3MZYA 3PFYA 4ESJA 1BL0A 3I56I 3JRDA 1RETA 1BBYA 1ON1A 2AXTC 2CQKA 2KP6A 1P2FA 3I53A 2BBYA 2XB5A 4A0ZA 4CHUA 2XIGA 4ZYAA 3ERED 3RSNA 3CC4I 4RS8A 3GFIA 2AXLA 3KZIC 4UVCA 5L3DA 4A3JJ 2BY2A 2WAQN 4UB6C 1YLFA 2JMWA 3BQYA 3BR0A 1S3JA 1Y8RB 3GXOA 1FP2A 1CQTA
chains in the Genus database with same CATH topology
5F0CA 5FLMJ 2E1OA 3JRFA 1RESA 5FLVA 3ZQIA 2E2JJ 3LOCA 4B3AA 1IG7A 2XGEA 1A5JA 2E19A 3A01A 1I3QJ 4A3DJ 2LKXA 4IHVA 2DMTA 2K9NA 1JT0A 1JT6A 1MH3A 2NS8A 1AHDP 4DYCA 1ETXA 2CUEA 1JJ8C 5GPCA 3LSPA 2VPRA 2R92J 2FJ1A 2DA7A 3CQZJ 2DJNA 1SANA 2RAEA 1VF9A 3JR9A 2XPVA 2LP0A 3E7LA 2L7ZA 1LFUP 1JTYA 2GM4A 1MSEC 1MH4A 2KDZA 3OIOA 4JP0A 3S15J 1ETQA 5IP6A 2EZHA 3GTPJ 3I4NJ 4X6AJ 3S1QJ 3NARA 3H3VK 1DU6A 1IC8A 1U8BA 2Y30A 4S0HB 2R7ZJ 1FIPA 3SDGA 4XRSG 1NK2P 4CYCA 1U78A 3F0CA 1ITYA 1ETKA 2P81A 2I10A 4QIWN 3GTLJ 4G12A 2IEKA 5E3LA 1I50J 2CJJA 4FE4A 5EZGA 2DA6A 2ELKA 2X9DA 3K2AA 1JTXA 3O8GA 3HOXJ 2K9QA 1RPWA 4M3GA 2DMNA 2R5YB 1ETVA 2EQRA 3HOZJ 1ZK8A 1F43A 5E3MA 4EEFG 2NS7A 3IH4A 1XG1A 3SFIA 3HM5A 2OF7A 2WV1A 1RR7A 3HGYA 2R5ZB 1RKWA 1BJZA 1MNMC 4BBSJ 3RQIA 3OSFA 1PUFA 2XRLA 3JRHA 5HODA 2LR8A 3K7AJ 2XB0X 4A69C 3CDLA 1QPIA 4FISA 3HGGA 4DYQA 4XK4A 1R9TJ 3BG3A 2H8RA 1YRNA 4A3EJ 2VUMJ 2E2HJ 1X2NA 1X58A 2LFBA 3S1RJ 4D5CA 3ZQLA 2EZLA 1WH5A 1Y1WJ 1NTCA 4A3FJ 2ECBA 2QCOA 5J1YA 2NVYJ 2JJ7A 3NAUA 3GTMJ 2CQQA 2ME6A 1B8IB 5EG0A 5M3FJ 2ID6A 3MN2A 1E3OC 4JX4A 3HOUJ 2FD5A 3QPSA 1MSFC 1RKTA 1QRYA 1WH7A 4JX5A 1IDYA 2IBDA 5EGOA 4AC0A 4A3KJ 4A3GJ 1MBFA 5M5WJ 3FIWA 1LE8B 2ME0A 2DTZA 3FISA 1ENHA 3FKIJ 1VI0A 4B1RA 4XIDA 2XPUA 3MKLA 2Y9YA 4MO7A 1APLC 2K9SA 3GBGA 1HDDC 4JX6A 3IV5A 4ABZA 2O8KA 1QVTA 5GPAA 5IYCJ 2D5VA 3HEFA 4QSHA 1QVUA 4W97A 5F1JA 1ETWA 2HYJA 2Y31A 4BY7J 2M9HA 2HDDA 5EDNA 4D7MA 2XPWA 3WHBA 3G1LA 4FTHA 1GT0C 5IPAA 2HI3A 3QQAA 2Y9ZA 3S1NJ 2JA7J 3IH2A 1JKQC 1X2MA 3B6CA 3DCFA 4NDLA 3QPLA 1ZGWA 3S2HJ 4GFBA 3C2BA 2JA8J 1JUSA 3JRAA 4A3IJ 1H88C 2TCTA 2W48A 2H1KA 4M3BA 4C2MJ 1OFCX 1OJLA 2L7MP 2VI6A 1DU0A 1JUPA 2NVQJ 1Z77A 5E3NA 1WCMJ 1GDTA 2HXOA 3BTCA 2COBA 3FK6A 1GV2A 1MBGA 2NOGA 5C44J 4AUXA 1ZTRA 1HCRA 3L1PA 3MVPA 1TWGJ 2LVSA 3HOWJ 4D7NA 3G1MA 3HDDA 5FKNA 4CYCB 1U9OA 2LD5A 1IRZA 3TEDA 1BW5A 4B4CA 2O9LA 3BR6A 1U9NA 2QF7A 5BNGA 3RZOJ 4XRSA 5EEAA 5IOZA 2B63J 4A3CJ 1Q1VA 2DA1A 2DA5A 3LSJA 4QTRA 3S17J 2XGDA 5IOYA 2YUSA 3S16J 3Q0WA 4A93J 4DW6A 1W0TA 3ZQCA 1MBEA 2G0EA 1OCTC 2HOTA 1B72B 1UG2A 3LSRA 2R5YA 4IHWA 4BKXA 3O8HA 1UHSA 3H0GJ 1O4XA 2VKEA 3RZDJ 3BT9A 1EF4A 2HQ5A 2CU7A 3GTQJ 2ZB9A 4BXXJ 1HF0A 2EZIA 1JKOC 3JREA 4XICA 1K61A 2E2IJ 3Q0UA 4C3IJ 1AKHB 2JA5J 1TWHJ 4IHXA 4V2FA 5J1UA 3S14J 4DZJA 3ZQGA 3BR5A 5GP9A 1POGA 5M3MJ 1D5YA 1G2HA 3JRBA 5EG0B 3JRGA 2M8GX 1XC5A 2R93J 1XS9A 1Y1VJ 1HOMA 2TRTA 1A6IA 3BR2A 1TWFJ 4BY1J 5FKMA 3BTLA 1VNDA 3S1MJ 4UUTA 1FTZA 4UUSA 3LNQA 4FCYA 2VKVA 2R0QC 1W0UA 1JKPC 2ID3A 3BG9A 5EYRA 1T33A 2JA6J 5F04A 1IDZA 4A3LJ 3I4MJ 5IYDJ 4MFDA 5F27A 1JGGA 3DEWA 9ANTA 5JLXA 5EF6A 1T56A 4Y52J 4C3JJ 1LE8A 1H89C 2N8GA 2OPTA 3S2DJ 4M3DA 1IV6A 4M3FA 2O7OA 2EBIA 5J1RA 2CUFA 3A01B 1F36A 3JRCA 5FKKA 2LY9A 1WI3A 5F08A 3OOUA 2L0KA 2DA3A 1K83J 3HKZN 3TW6A 3BTJA 5JLWA 3M4OJ 2DA2A 3BQZA 2Y0SN 5DS9A 1ZKGA 5IYBJ 4X1EA 2M2EA 2MSYA 2JWTA 3D1NI 1JUMA 3TP3A 1OCPA 3RKQA 1TC3C 4V2GA 2FQ4A 2LLKA 1GVDA 2M0CA 5IP9J 3A03A 4MFEA 3BTIA 2AHQA 3CCYA 2PMZN 4IEJA 3GTOJ 5J3LA 2DA4A 4DYRA 1ZR2A 1I6HJ 5C3EJ 1WGXA 3PO3J 2EZKA 2LTPA 2X6OA 3ZQHA 1FJLA 1IUFA 3VPRA 5M5XJ 3JRIA 1MBHA 2MW8A 4IHYA 3HOVJ 3Q3SA 4M3EA 4C3HJ 2GBYA 3OSGA 4DZPA 3PO2J 3W6VA 5EZHA 4A3MJ 4RBOA 1BA5A 1ZQ3P 1UMQA 1WPKA 3TP0A 1ETOA 2FX0A 2M34A 2Y2ZA 2GLOA 2DMUA 3M3YJ 1IJWC 2DN0A 2X48A 4RDUA 1TWAJ 3CMYA 4W1UA 1HDPA 1TWCJ 5DTDA 3LSGA 3WHCA 2CQXA 4I6ZA 1ETYA 1PUFB 4AYBN 1JKRC 3GTKJ 1MBJA 4MLOA 2HOSA 4Y7NJ 5FJ8J 1GUUA 3HOYJ 1SFOJ 1YRNB 2AO9A 4D5FA 2L7FP 2R5ZA 1ORKA 2JK3A 2HXIA 2EH3A 2YS9A 2DMQA 1NK3P 3G1OA 3BR1A 5E3OA 4FE7A 1B72A 1BW6A 4A3BJ 3HBLA 3FK7A 1AU7A 2NVTJ 3TW7A 5C4JJ 3IH3A 4I76A 4M6VA 1IGNA 2NVXJ 2IAIA 1FIAA 3PM1A 3ZOBA 2DMPA 5F0FA 2MGQA 3UKGA 1HLVA 2MG4A 4HNVA 3GTJJ 4JYKA 5K7HA 3B6AA 1FTTA 2L9RA 4L5EA 3Q0VA 5EGOB 2HOAA 1AKHA 5C4XJ 1FEXA 4BBRJ 2JN6A 3HB9A 2YU9J 1Z0XA 1P7IA 5M5YJ 4XRMA 1B8IA 2XGCA 4UUSB 1H8AC 1ZR4A 5FKOA 2LK2A 3BR3A 5K7FA 4LOCA 3SJMA 5FKLA 3ZQFA 4J19A 1S7EA 1GV5A 2WB1N 1MBKA 1JJ6C 1LFBA 3BG5A 2ECCA 1VFCA 1P7JA 5F0HA 1BL0A 2KT0A 4MIMA 3A02A 3JRDA 1RETA 5IP7J 3GTGJ 2XB5A 2K40A 4A3JJ 2WAQN 2CRGA 5K7ZA 2JMWA 3BQYA 3BR0A 2XSDC 1CQTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F0C A;  5FLM J;  2E1O A;  3JRF A;  1RES A;  5FLV A;  3ZQI A;  2E2J J;  3LOC A;  4B3A A;  1IG7 A;  2XGE A;  1A5J A;  2E19 A;  3A01 A;  1I3Q J;  4A3D J;  2LKX A;  4IHV A;  2DMT A;  2K9N A;  1JT0 A;  1JT6 A;  1MH3 A;  2NS8 A;  1AHD P;  4DYC A;  1ETX A;  2CUE A;  1JJ8 C;  5GPC A;  3LSP A;  2VPR A;  2R92 J;  2FJ1 A;  2DA7 A;  3CQZ J;  2DJN A;  1SAN A;  2RAE A;  1VF9 A;  3JR9 A;  2XPV A;  2LP0 A;  3E7L A;  2L7Z A;  1LFU P;  1JTY A;  2GM4 A;  1MSE C;  1MH4 A;  2KDZ A;  3OIO A;  4JP0 A;  3S15 J;  1ETQ A;  5IP6 A;  2EZH A;  3GTP J;  3I4N J;  4X6A J;  3S1Q J;  3NAR A;  3H3V K;  1DU6 A;  1IC8 A;  1U8B A;  2Y30 A;  4S0H B;  2R7Z J;  1FIP A;  3SDG A;  4XRS G;  1NK2 P;  4CYC A;  1U78 A;  3F0C A;  1ITY A;  1ETK A;  2P81 A;  2I10 A;  4QIW N;  3GTL J;  4G12 A;  2IEK A;  5E3L A;  1I50 J;  2CJJ A;  4FE4 A;  5EZG A;  2DA6 A;  2ELK A;  2X9D A;  3K2A A;  1JTX A;  3O8G A;  3HOX J;  2K9Q A;  1RPW A;  4M3G A;  2DMN A;  2R5Y B;  1ETV A;  2EQR A;  3HOZ J;  1ZK8 A;  1F43 A;  5E3M A;  4EEF G;  2NS7 A;  3IH4 A;  1XG1 A;  3SFI A;  3HM5 A;  2OF7 A;  2WV1 A;  1RR7 A;  3HGY A;  2R5Z B;  1RKW A;  1BJZ A;  1MNM C;  4BBS J;  3RQI A;  3OSF A;  1PUF A;  2XRL A;  3JRH A;  5HOD A;  2LR8 A;  3K7A J;  2XB0 X;  4A69 C;  3CDL A;  1QPI A;  4FIS A;  3HGG A;  4DYQ A;  4XK4 A;  1R9T J;  3BG3 A;  2H8R A;  1YRN A;  4A3E J;  2VUM J;  2E2H J;  1X2N A;  1X58 A;  2LFB A;  3S1R J;  4D5C A;  3ZQL A;  2EZL A;  1WH5 A;  1Y1W J;  1NTC A;  4A3F J;  2ECB A;  2QCO A;  5J1Y A;  2NVY J;  2JJ7 A;  3NAU A;  3GTM J;  2CQQ A;  2ME6 A;  1B8I B;  5EG0 A;  5M3F J;  2ID6 A;  3MN2 A;  1E3O C;  4JX4 A;  3HOU J;  2FD5 A;  3QPS A;  1MSF C;  1RKT A;  1QRY A;  1WH7 A;  4JX5 A;  1IDY A;  2IBD A;  5EGO A;  4AC0 A;  4A3K J;  4A3G J;  1MBF A;  5M5W J;  3FIW A;  1LE8 B;  2ME0 A;  2DTZ A;  3FIS A;  1ENH A;  3FKI J;  1VI0 A;  4B1R A;  4XID A;  2XPU A;  3MKL A;  2Y9Y A;  4MO7 A;  1APL C;  2K9S A;  3GBG A;  1HDD C;  4JX6 A;  3IV5 A;  4ABZ A;  2O8K A;  1QVT A;  5GPA A;  5IYC J;  2D5V A;  3HEF A;  4QSH A;  1QVU A;  4W97 A;  5F1J A;  1ETW A;  2HYJ A;  2Y31 A;  4BY7 J;  2M9H A;  2HDD A;  5EDN A;  4D7M A;  2XPW A;  3WHB A;  3G1L A;  4FTH A;  1GT0 C;  5IPA A;  2HI3 A;  3QQA A;  2Y9Z A;  3S1N J;  2JA7 J;  3IH2 A;  1JKQ C;  1X2M A;  3B6C A;  3DCF A;  4NDL A;  3QPL A;  1ZGW A;  3S2H J;  4GFB A;  3C2B A;  2JA8 J;  1JUS A;  3JRA A;  4A3I J;  1H88 C;  2TCT A;  2W48 A;  2H1K A;  4M3B A;  4C2M J;  1OFC X;  1OJL A;  2L7M P;  2VI6 A;  1DU0 A;  1JUP A;  2NVQ J;  1Z77 A;  5E3N A;  1WCM J;  1GDT A;  2HXO A;  3BTC A;  2COB A;  3FK6 A;  1GV2 A;  1MBG A;  2NOG A;  5C44 J;  4AUX A;  1ZTR A;  1HCR A;  3L1P A;  3MVP A;  1TWG J;  2LVS A;  3HOW J;  4D7N A;  3G1M A;  3HDD A;  5FKN A;  4CYC B;  1U9O A;  2LD5 A;  1IRZ A;  3TED A;  1BW5 A;  4B4C A;  2O9L A;  3BR6 A;  1U9N A;  2QF7 A;  5BNG A;  3RZO J;  4XRS A;  5EEA A;  5IOZ A;  2B63 J;  4A3C J;  1Q1V A;  2DA1 A;  2DA5 A;  3LSJ A;  4QTR A;  3S17 J;  2XGD A;  5IOY A;  2YUS A;  3S16 J;  3Q0W A;  4A93 J;  4DW6 A;  1W0T A;  3ZQC A;  1MBE A;  2G0E A;  1OCT C;  2HOT A;  1B72 B;  1UG2 A;  3LSR A;  2R5Y A;  4IHW A;  4BKX A;  3O8H A;  1UHS A;  3H0G J;  1O4X A;  2VKE A;  3RZD J;  3BT9 A;  1EF4 A;  2HQ5 A;  2CU7 A;  3GTQ J;  2ZB9 A;  4BXX J;  1HF0 A;  2EZI A;  1JKO C;  3JRE A;  4XIC A;  1K61 A;  2E2I J;  3Q0U A;  4C3I J;  1AKH B;  2JA5 J;  1TWH J;  4IHX A;  4V2F A;  5J1U A;  3S14 J;  4DZJ A;  3ZQG A;  3BR5 A;  5GP9 A;  1POG A;  5M3M J;  1D5Y A;  1G2H A;  3JRB A;  5EG0 B;  3JRG A;  2M8G X;  1XC5 A;  2R93 J;  1XS9 A;  1Y1V J;  1HOM A;  2TRT A;  1A6I A;  3BR2 A;  1TWF J;  4BY1 J;  5FKM A;  3BTL A;  1VND A;  3S1M J;  4UUT A;  1FTZ A;  4UUS A;  3LNQ A;  4FCY A;  2VKV A;  2R0Q C;  1W0U A;  1JKP C;  2ID3 A;  3BG9 A;  5EYR A;  1T33 A;  2JA6 J;  5F04 A;  1IDZ A;  4A3L J;  3I4M J;  5IYD J;  4MFD A;  5F27 A;  1JGG A;  3DEW A;  9ANT A;  5JLX A;  5EF6 A;  1T56 A;  4Y52 J;  4C3J J;  1LE8 A;  1H89 C;  2N8G A;  2OPT A;  3S2D J;  4M3D A;  1IV6 A;  4M3F A;  2O7O A;  2EBI A;  5J1R A;  2CUF A;  3A01 B;  1F36 A;  3JRC A;  5FKK A;  2LY9 A;  1WI3 A;  5F08 A;  3OOU A;  2L0K A;  2DA3 A;  1K83 J;  3HKZ N;  3TW6 A;  3BTJ A;  5JLW A;  3M4O J;  2DA2 A;  3BQZ A;  2Y0S N;  5DS9 A;  1ZKG A;  5IYB J;  4X1E A;  2M2E A;  2MSY A;  2JWT A;  3D1N I;  1JUM A;  3TP3 A;  1OCP A;  3RKQ A;  1TC3 C;  4V2G A;  2FQ4 A;  2LLK A;  1GVD A;  2M0C A;  5IP9 J;  3A03 A;  4MFE A;  3BTI A;  2AHQ A;  3CCY A;  2PMZ N;  4IEJ A;  3GTO J;  5J3L A;  2DA4 A;  4DYR A;  1ZR2 A;  1I6H J;  5C3E J;  1WGX A;  3PO3 J;  2EZK A;  2LTP A;  2X6O A;  3ZQH A;  1FJL A;  1IUF A;  3VPR A;  5M5X J;  3JRI A;  1MBH A;  2MW8 A;  4IHY A;  3HOV J;  3Q3S A;  4M3E A;  4C3H J;  2GBY A;  3OSG A;  4DZP A;  3PO2 J;  3W6V A;  5EZH A;  4A3M J;  4RBO A;  1BA5 A;  1ZQ3 P;  1UMQ A;  1WPK A;  3TP0 A;  1ETO A;  2FX0 A;  2M34 A;  2Y2Z A;  2GLO A;  2DMU A;  3M3Y J;  1IJW C;  2DN0 A;  2X48 A;  4RDU A;  1TWA J;  3CMY A;  4W1U A;  1HDP A;  1TWC J;  5DTD A;  3LSG A;  3WHC A;  2CQX A;  4I6Z A;  1ETY A;  1PUF B;  4AYB N;  1JKR C;  3GTK J;  1MBJ A;  4MLO A;  2HOS A;  4Y7N J;  5FJ8 J;  1GUU A;  3HOY J;  1SFO J;  1YRN B;  2AO9 A;  4D5F A;  2L7F P;  2R5Z A;  1ORK A;  2JK3 A;  2HXI A;  2EH3 A;  2YS9 A;  2DMQ A;  1NK3 P;  3G1O A;  3BR1 A;  5E3O A;  4FE7 A;  1B72 A;  1BW6 A;  4A3B J;  3HBL A;  3FK7 A;  1AU7 A;  2NVT J;  3TW7 A;  5C4J J;  3IH3 A;  4I76 A;  4M6V A;  1IGN A;  2NVX J;  2IAI A;  1FIA A;  3PM1 A;  3ZOB A;  2DMP A;  5F0F A;  2MGQ A;  3UKG A;  1HLV A;  2MG4 A;  4HNV A;  3GTJ J;  4JYK A;  5K7H A;  3B6A A;  1FTT A;  2L9R A;  4L5E A;  3Q0V A;  5EGO B;  2HOA A;  1AKH A;  5C4X J;  1FEX A;  4BBR J;  2JN6 A;  3HB9 A;  2YU9 J;  1Z0X A;  1P7I A;  5M5Y J;  4XRM A;  1B8I A;  2XGC A;  4UUS B;  1H8A C;  1ZR4 A;  5FKO A;  2LK2 A;  3BR3 A;  5K7F A;  4LOC A;  3SJM A;  5FKL A;  3ZQF A;  4J19 A;  1S7E A;  1GV5 A;  2WB1 N;  1MBK A;  1JJ6 C;  1LFB A;  3BG5 A;  2ECC A;  1VFC A;  1P7J A;  5F0H A;  1BL0 A;  2KT0 A;  4MIM A;  3A02 A;  3JRD A;  1RET A;  5IP7 J;  3GTG J;  2XB5 A;  2K40 A;  4A3J J;  2WAQ N;  2CRG A;  5K7Z A;  2JMW A;  3BQY A;  3BR0 A;  2XSD C;  1CQT A; 
#chains in the Genus database with same CATH topology
 2K7L A;  2JPB A;  4LK0 F;  2IA0 A;  3C3W A;  3R4K A;  4ASN A;  3ZQI A;  2E2J J;  4DGW B;  2MA3 A;  4N4N B;  1IG7 A;  2XGE A;  2X1C A;  2Q1Z B;  1T0F C;  2EFO A;  3L2W A;  3JTH A;  4RM2 A;  1W5S A;  4MNU A;  4RGR A;  1JT6 A;  2EFP A;  3ZQ7 A;  1J2X A;  2V1X A;  2ZNZ A;  1FBQ A;  2FE3 A;  4R1H A;  4KUM A;  5GPC A;  2ZSH B;  3OYL A;  3FXR A;  3KEQ A;  2MC4 A;  1XGS A;  4DIQ A;  2XPV A;  3WTV C;  4CZC A;  1P4X A;  4IHT A;  1A35 A;  1MH4 A;  5GAD J;  2OZU A;  2E34 A;  1ETQ A;  2FOK A;  4X6A J;  1HA8 A;  1UAA A;  3W2V A;  4ANJ A;  1U8B A;  1D8K A;  4OAY A;  3V8K A;  2JSP A;  1VZ0 A;  1Z6T A;  2WTE A;  4HDV A;  1G3Y A;  5CPR B;  2EIL H;  3G2B A;  2CQN A;  3DU5 A;  3F0C A;  2M5W A;  4OIO F;  2LYC A;  1E3H A;  5E20 A;  4A0X A;  2KDO A;  2MH9 A;  3BPV A;  3DPU A;  3TDU C;  4NHJ A;  1LDK B;  3BDD A;  2IEK A;  4G6Q A;  1MW7 A;  4I0A A;  4OIP F;  3CCM I;  1XMX A;  5EZG A;  2DA6 A;  4N9H A;  4E7L A;  1JTX A;  3O8G A;  5JFR A;  2YU3 A;  4M3G A;  1R22 A;  2EQR A;  2A6H F;  3HPH A;  5DCM A;  1ZG3 A;  1QO0 D;  1ZG1 A;  3K4K A;  4CCN A;  3LAJ A;  1F43 A;  1XSD A;  3DWL E;  3J7Z I;  1Q1H A;  5B1B H;  1NG6 A;  5TGT A;  4BAY A;  1IV8 A;  3ASN H;  4EM1 A;  3F3X A;  1MNM C;  2VB6 A;  3JRH A;  2QQ8 A;  3E5Q A;  3H9J A;  4XRF A;  1MMG A;  4KT5 C;  3L2R A;  3HOT A;  1FZP B;  3GFL A;  1FWZ A;  5CVR A;  4O3M A;  2YX7 A;  2NVU B;  2H8R A;  1YRN A;  4A3E J;  2VUM J;  1XN7 A;  1R1T A;  2COM A;  2LFB A;  1X58 A;  3OMY A;  3S1R J;  3ZQL A;  2PMZ A;  2HTS A;  1QZY A;  4WF2 A;  5HS8 A;  2V1U A;  5CVV A;  3MKW B;  2ME6 A;  2BY1 A;  1C0W A;  1SD6 A;  4JX4 A;  1BOB A;  2FD5 A;  2VJJ A;  3QPS A;  1RKT A;  3FBN B;  1MSF C;  2VXD A;  4LGW A;  3HG9 A;  2CUJ A;  3HTS B;  1IDY A;  5EGO A;  4UVB A;  5HDK A;  4GXO A;  1YX3 A;  3CCR I;  1MBF A;  2VAS A;  2KMU A;  4F92 B;  1SFU A;  2DPD A;  4DBQ A;  1B1B A;  3FIS A;  2W24 A;  2K4J A;  3M07 A;  2K3F A;  4BEH B;  2HVR A;  1I39 A;  4EVI A;  3L09 A;  3MKL A;  2OQR A;  4GO1 A;  3RCO A;  3G71 I;  3CC7 I;  2E60 A;  2KIU A;  3QU3 A;  1K6Y A;  2LKP A;  4ABZ A;  5J4Y A;  2D5V A;  3DEU A;  3HEF A;  2MAB A;  1QVU A;  3J7A O;  1FSE A;  4FAS D;  2NNN A;  4HNU A;  3ABM H;  5DM6 F;  3U9G A;  2VT2 A;  4ZDP A;  3E6B A;  1XPX A;  3OYD A;  1BIB A;  4XBF A;  1X1C A;  2MYS A;  1TNT A;  2PBI A;  3G1L A;  1F1Z A;  3OL4 A;  4IRH A;  5IPA A;  2E7W A;  2Z3Y A;  1D1C A;  3S1N J;  2FML A;  1ON2 A;  3GW2 A;  1JKQ C;  3B6C A;  1ACI A;  3DCF A;  4NNJ A;  2PMU A;  2PI0 A;  3C2B A;  5JI6 A;  2UXX A;  1DP3 A;  4BXU A;  1YI2 I;  2FBK A;  4H0E A;  2GXB A;  1KA8 A;  2IA1 A;  2VJI A;  1H9T A;  1K79 A;  1DU0 A;  1JUP A;  2NVQ J;  2P7V B;  3F8C A;  5K1Y A;  3H3U A;  4GYI A;  1X3U A;  4V19 K;  3QU6 A;  2STW A;  3C1D A;  3KP6 A;  1VQN I;  4I01 A;  4AUX A;  1ZTR A;  4U0V A;  1LEA A;  2H1L A;  3MVP A;  4D7N A;  2MFZ A;  2VOP A;  4IPA A;  1S6L A;  2ZFU A;  2CMP A;  3S93 A;  4Z6Y A;  4M9Z A;  4RA2 A;  4B4C A;  3QYF A;  3FXU A;  5K5O A;  3BG6 A;  3LFK A;  6PAX A;  1BR4 A;  2QF7 A;  5DUI A;  5CJ9 A;  2DQR A;  1T0F A;  5EEA A;  2HYF A;  1N78 A;  1Q1V A;  3CJT B;  4OMZ A;  4HV5 A;  4NQW A;  2CV0 A;  3N05 A;  3S17 J;  2XGD A;  4RB1 A;  1UCR A;  1T95 A;  4E70 A;  4LK1 F;  3WGI A;  3DPL C;  5D4S A;  1IZ1 A;  4A93 J;  4FQG A;  1R7J A;  1MBE A;  2G0E A;  2D45 A;  4BYY A;  4RGX A;  2H94 A;  5BQT A;  4WXD A;  3LSR A;  2W1O A;  3P9C A;  1UHS A;  3H0G J;  1P9Q C;  4PZJ A;  3J80 K;  3V8L A;  2VKE A;  2LY1 A;  3KZZ A;  3QWL A;  3CMM A;  4LJZ F;  2HQ5 A;  2ADU A;  4LD5 A;  1UEL B;  3AG1 H;  4XKV A;  3ZXS A;  3GZN B;  4XOR A;  2PMH A;  2JA5 J;  2F4I A;  4ZYH A;  4EAT A;  1OYY A;  1EV7 A;  1GXP A;  5J1U A;  3S14 J;  2CO5 A;  2STT A;  4CXF A;  1POG A;  4J00 A;  1HXD A;  1X3W B;  2FMY A;  1G2H A;  2L54 A;  3WTX C;  5EG0 B;  5ED4 A;  4DBR A;  2M8G X;  4LG3 A;  1ZRF A;  4BAC A;  1B6A A;  1QZZ A;  1LUJ B;  1Y1V J;  3WU0 A;  3MAJ A;  1HOM A;  2M45 A;  3DTK A;  5FRO A;  2VLA A;  2TRT A;  1A6I A;  2XVC A;  2L2O A;  1TWF J;  5TJJ A;  4BY1 J;  2O61 A;  5E18 F;  1OR7 C;  4UVA A;  2DK8 A;  5TIS C;  3Q5F A;  2ZXW H;  3ESW B;  3BRO A;  3G6E I;  1IXS B;  4YFK F;  4FCY A;  3MCZ A;  5HDN A;  2RQQ A;  3QPT A;  2R0Q C;  1W0U A;  5ICF A;  2I5U A;  4U7B A;  1YW8 A;  5EYR A;  1T33 A;  1WSU A;  1TQM A;  4CSW A;  3I4M J;  2M4G A;  5D5W B;  2CV2 A;  2FUG 2;  2X6W A;  4MFD A;  1YOV B;  3E5U A;  5JLX A;  4Y52 J;  1O7L A;  1T56 A;  4C3J J;  4UNO A;  2HQR A;  1N77 A;  2OPT A;  3KE2 A;  3FMR A;  2R4G A;  1UHM A;  2A05 A;  4DNC A;  1JE8 A;  1MJB A;  2EBI A;  3BY6 A;  4HX7 A;  4F55 A;  3CD6 I;  2XRO A;  3BJ6 A;  4BL0 B;  4HQE A;  2X6Y A;  3J80 Z;  1R5H A;  2XAH A;  5F08 A;  1HSJ A;  2CWE A;  3C2H A;  4P1W A;  4P5O A;  5HLG A;  2K5C A;  3BQZ A;  2M0M A;  4X1E A;  1RNL A;  1J59 A;  1BR2 A;  3RDI A;  3QYE A;  1JUM A;  1XCB A;  4LLG F;  3K4B A;  4V2G A;  1TC3 C;  2FQ4 A;  1B59 A;  5DD4 A;  2IW5 A;  2M0C A;  5B1A H;  5IP9 J;  4IQJ A;  3DLA A;  4R8H A;  4D9J A;  4MFE A;  4L9N A;  4BQQ A;  5KHD A;  1PP8 F;  3BTI A;  2DBB A;  3RKX A;  3FXO A;  2O3F A;  1UFM A;  3Q9V A;  1G3S A;  4EJT A;  4FET A;  3OS2 A;  2R7T A;  3HTU A;  2EZK A;  3I5U A;  2HEO A;  2DYS H;  1YHQ I;  4CCJ A;  5HNH A;  1F9N A;  4M3E A;  1IRF A;  1EA3 A;  4DZP A;  5ILS A;  4TV7 A;  1FOW A;  1YS6 A;  1YE9 A;  3FWE A;  1WPK A;  5IT3 A;  2FX0 A;  4KN4 X;  3WTT C;  5DCM B;  4A5N A;  4E4H A;  1QNT A;  4IQ4 A;  1Y39 A;  2P6S A;  1HC8 A;  2DN0 A;  1VQL I;  1H0M A;  2OZ6 A;  3JSO A;  1IN7 A;  5CQG A;  2E36 A;  3WTY C;  1JGS A;  1N75 A;  2F4O B;  4HLX A;  4DJA A;  1HDP A;  3OOP A;  2V6C A;  3WHC A;  4I6Z A;  1OCR H;  4AYB N;  1SD4 A;  3H9G A;  1WJE A;  4PFO A;  3HHG A;  4BQN A;  1SFO J;  1YRN B;  2AO9 A;  2VOD A;  3UNG C;  3CJN A;  2GXA A;  3OYF A;  1K4T A;  1ZGA A;  5J4V A;  4S05 A;  1CF7 B;  1B72 A;  4A3B J;  5BMZ A;  4YIF A;  4IJA A;  1TBX A;  1IXC A;  2XF5 A;  2NVT J;  4I76 A;  4KA4 A;  1WRJ A;  3D5L A;  3S3M A;  1ZRC A;  3D5S C;  1DUX C;  3EET A;  1ZLK A;  3A2K A;  2DLL A;  1E17 A;  2EV0 A;  1SD7 A;  4CZZ A;  4EJW A;  3ZR8 X;  1GLN A;  2V9K A;  2IP2 A;  3V42 A;  4FX4 A;  2EV5 A;  3U21 A;  4ITV A;  5FO5 A;  4HNV A;  4AID A;  1J7K A;  2E5Z A;  5EGO B;  3MZH A;  2YX4 A;  5C4X J;  5E79 C;  3RYP A;  1FEX A;  4OOI A;  2Z9O A;  2DI3 A;  2KRC A;  1EH8 A;  4M74 A;  5M5Y J;  4XRM A;  3QOP A;  1G4D A;  5JHF A;  4UUS B;  1EH6 A;  3QOD A;  5LGT A;  2XGX A;  2K9L A;  3D5R C;  5CYV A;  1GVJ A;  5J47 A;  1YYV A;  5K7F A;  2LK2 A;  3OYJ A;  2VQH A;  5FLX K;  3V7C A;  1LFB A;  1WJ5 A;  3GF2 A;  1D8J A;  2HFH A;  3V7S A;  5F0H A;  1S8N A;  2UZK A;  3S2W A;  4RGU A;  5LFA A;  2LKS A;  2XHK A;  4CDG A;  3FXK A;  3HUG A;  1HW2 A;  1VQ9 I;  2P5K A;  2KIM A;  2CRG A;  2W85 A;  3VYT B;  2V9V A;  3OR2 C;  4XM3 A;  1ZLJ A;  2XSD C;  3ZMZ A;  1ZH5 A;  2ESH A;  2XAU A;  3I59 A;  4A6D A;  2XRN A;  4A5M A;  1R1V A;  2DTR A;  4LLL A;  3LOC A;  3BJO A;  3I4P A;  2C6Y A;  5JVT A;  5TRD A;  2DMT A;  2K9N A;  4PJ0 C;  1LNW A;  2CW8 A;  2NYX A;  1MH3 A;  4MHG A;  1RZ4 A;  4DYC A;  1ETX A;  1QA6 A;  1XMA A;  1PJR A;  3O2P E;  2VPR A;  2ZJR F;  2R92 J;  1KU3 A;  2H09 A;  2I8D A;  1VQ8 I;  4GDF A;  4NC6 A;  1XTA A;  2RAE A;  3HSF A;  2LNB A;  3WE3 A;  3RKY A;  4IF4 A;  2DT6 A;  2L7Z A;  3A1Y A;  4RAZ A;  4RB2 C;  3S15 J;  3OIO A;  2M7A A;  4BQO A;  4BE0 A;  4KJZ A;  1T6S A;  3V4G A;  2HU9 A;  3NAR A;  5FLX Z;  3H3V K;  2JA2 A;  3BOQ A;  4UXN A;  4XRS G;  1UZC A;  1U78 A;  4NQW B;  3KEY A;  1ETK A;  2QQB A;  4FHT A;  4DOZ A;  1TLH B;  2FNP A;  2DDB A;  2P81 A;  4XLF A;  1OPC A;  3T0Y A;  2DW4 A;  3DP7 A;  5KVR A;  1IN5 A;  4PJJ A;  4G9Y A;  5JVG F;  4R79 A;  1YIT I;  2X9D A;  4N9I A;  3K2A A;  3FBI B;  3NEU A;  4ESB A;  2DMN A;  3FX3 A;  1B9N A;  4RB3 C;  4P9U A;  3BP8 A;  1QZE A;  5E3M A;  4EEF G;  3HOS A;  5ERI A;  4QPQ A;  2NS7 A;  1ULY A;  2LRD A;  3IH4 A;  4U0W A;  2OCC H;  3SFI A;  3HKZ A;  4F93 B;  3E6C C;  2OF7 A;  4G8X A;  4ON0 A;  3K70 C;  3TBI A;  3HGY A;  2CW7 A;  4II3 A;  5H6R A;  3S3N A;  4BBS J;  2EPF A;  2MLK A;  1WKM A;  5HOD A;  1NHA A;  4A69 C;  4G7O F;  3CDL A;  2JUG A;  2ZME B;  3H5N A;  3H1C A;  4FIS A;  3IWZ A;  2Y75 A;  4BDZ A;  5KK1 A;  3ZMD A;  2RRE A;  3BCA A;  1WH5 A;  1X4O A;  4Y33 A;  3K4N A;  4OIN F;  1S29 A;  3M7G A;  2ZXI A;  2JJ7 A;  3GTM J;  2CQQ A;  4XLC A;  5EG0 A;  1AOY A;  5M3F J;  1R23 A;  2DAO A;  3RIR A;  1ZEL A;  1E3O C;  4PSW A;  4OU0 A;  2ESN A;  1S7A A;  2EB7 A;  4S04 A;  2IBD A;  2BHY A;  3E5X A;  4O6J A;  3UR3 C;  4A3G J;  4PGH A;  1MD0 A;  1OMI A;  4YEL A;  2CQ7 A;  1ENH A;  4MQ9 F;  4B1R A;  2XPU A;  4LB5 A;  2XAJ A;  2KKO A;  3B73 A;  4MO7 A;  1APL C;  3WTU C;  3IV5 A;  2O8K A;  1X1B A;  2JSC A;  4QSH A;  1SEU A;  2CFX A;  4W97 A;  2GIV A;  1VQO I;  2Y31 A;  3JTG A;  3G73 A;  2M9H A;  5L3C A;  2HDD A;  4YII A;  1FPQ A;  1GT0 C;  5H6Q A;  4K2E A;  2PG4 A;  2ICW G;  4HA8 A;  4L0Z B;  1LEB A;  3QQA A;  2DDA A;  2VE9 A;  2L5Q A;  2RKH A;  2JA7 J;  5D6E A;  2EIN H;  4QWQ A;  2KZG A;  4NDL A;  2LY2 A;  3QPL A;  4HPQ A;  3I55 I;  3R60 A;  1ZGW A;  3F8B A;  4GFB A;  2FBI A;  1JUS A;  2WAF A;  1D3Y A;  3CZ6 A;  2TCT A;  2W48 A;  2H1K A;  4Y3O A;  1OFC X;  2MLG A;  1Z77 A;  2ZCW A;  1RIO H;  4FX0 A;  3K4L A;  5KAI C;  2QGU A;  1WCM J;  3T8T A;  1YS7 A;  4PJN A;  5LHI A;  2HXO A;  5JHU A;  1MBG A;  1IW7 F;  2FEZ A;  3OL3 A;  5A2Q K;  1Z7U A;  2LVS A;  2VJ5 A;  3PQJ A;  2GOM A;  3AG4 H;  3G1M A;  4BNC A;  1IRG A;  5FKN A;  1HST A;  2EK5 A;  3DU6 A;  4CYC B;  4M9X A;  1IN8 A;  1U9O A;  1WJA A;  3VDX A;  2LD5 A;  1XCV A;  4ENK A;  4XOP A;  2WB1 A;  2ZME C;  3I9V 2;  1BW5 A;  2VC0 A;  3DXJ F;  3P9I A;  2O9L A;  3PJR A;  4YG2 F;  2LG4 A;  2Z2S B;  3LSM A;  2X0L A;  2VIX A;  4EM2 A;  3VEP A;  3PUF A;  4CUG A;  2R7Q A;  1X1P A;  3AL0 B;  4XRS A;  3QOE A;  1IUY A;  1KYW A;  2TDX A;  1R4N B;  3ZP5 A;  5H2F C;  2R7R A;  2VBW A;  3LSJ A;  4QTR A;  3F6V A;  2V7F A;  1UJ8 A;  2JRT A;  2EIM H;  2YR2 A;  1JXS A;  1VQM I;  2CS3 A;  2WAQ A;  2G7U A;  4HEA 2;  4II2 A;  1MMS A;  2KJB A;  4DW6 A;  2R3S A;  1OCT C;  3KZY A;  1B72 B;  3HRU A;  2GAU A;  3ERM A;  3KYD B;  5D4R A;  1O4X A;  3CJQ B;  2OUM A;  4BJT A;  1LFP A;  3BT9 A;  4KMU X;  1EF4 A;  2GA1 A;  5BPD A;  2KHM A;  1HF0 A;  1MZB A;  3VSK A;  2IVM A;  1HBX G;  4BHB A;  5HDG A;  1VQ7 I;  4XIC A;  1K61 A;  1CF7 A;  4C3I J;  3GUD A;  2XAS A;  1U3E M;  2L7K A;  2P8T A;  3HYI A;  4IHX A;  3K4C A;  1TW2 A;  4V2F A;  3ZQG A;  1MGT A;  1RC9 A;  2L9N A;  2HNH A;  2NXN B;  3EUA A;  3JRG A;  5A2Q Z;  1FSH A;  1NH3 A;  1KQ9 A;  1YG2 A;  1XS9 A;  4ZZL A;  3A4C A;  1U0J A;  4CYD A;  3S1M J;  1W4M A;  3FF5 A;  1V5F A;  1FTZ A;  3N97 A;  4UV8 A;  2XV4 S;  3LQR A;  1BI0 A;  4UUS A;  4M72 A;  2DJI A;  3T8R A;  3OIQ A;  2K27 A;  1U8R A;  1MKM A;  1JKP C;  3EYI A;  2ID3 A;  3TO9 A;  2OBP A;  3BCB A;  2JA6 J;  3U2R A;  1IDZ A;  3HUG B;  4A3L J;  2BGC A;  1N25 A;  5LRR A;  2IGO A;  1JGG A;  2VJ4 A;  3DEW A;  2ZJQ F;  4MTD A;  2X4H A;  3S2D J;  1P6R A;  4M3D A;  2UV1 A;  4EM0 B;  5L3B A;  1Y8Q B;  3I59 B;  2O7O A;  4I02 A;  3OS0 A;  2OA4 A;  4HLY A;  3NWS A;  3JRC A;  5IT9 K;  5FKK A;  2X1D A;  1LJ9 A;  5KNL A;  3W2W A;  1UG0 A;  1WZ2 A;  4KDP A;  3LA7 A;  2L0K A;  3OOU A;  5JLW A;  1K83 J;  1Z91 A;  4HSR A;  3TW6 A;  3M4O J;  5LBQ A;  2DA2 A;  2F5F A;  5DS9 A;  2EFQ A;  2RVC A;  2MSY A;  1JI8 A;  1T39 A;  1T98 A;  3TL4 X;  3RKQ A;  1DPU A;  3GLX A;  1R00 A;  3AL0 C;  3GX4 X;  2CFO A;  1TZL A;  3S8P A;  2QEX I;  3F6O A;  3W6K B;  3NQO A;  4KIC A;  3ABL H;  2OAZ A;  3LA2 A;  4RAY A;  2BE5 F;  1V5E A;  2H6B A;  5GTH C;  3OYC A;  1SC7 A;  1YW7 A;  3H92 A;  2A68 F;  3S3O A;  1ZR2 A;  1R58 A;  3ZGK A;  2K9M A;  4RLQ A;  5C3E J;  4MQV A;  2LTP A;  2X6O A;  1A31 A;  3ZQH A;  1FJL A;  1MBH A;  5E8I A;  4XLN F;  1P92 A;  4BE1 A;  3OSG A;  3ASO H;  4GGG A;  5EZH A;  4A3M J;  3K2Z A;  3HL2 A;  1UMQ A;  3L00 A;  1KZH A;  3JAM K;  3TP0 A;  2EJR A;  4IL6 C;  5DUK A;  3F72 A;  3CCQ I;  3RYR A;  1S9H A;  2M34 A;  1BI3 A;  2E7X A;  2GLO A;  3WU1 B;  2DMU A;  2M3A A;  5D5X B;  2BY3 A;  1BIA A;  1F5T A;  2JVH A;  2X48 A;  5EEG A;  4RDU A;  2CSO A;  3KP7 A;  1TWA J;  3LL7 A;  4PDK A;  3IC7 A;  4G6D A;  3CMY A;  3KLO A;  4HNT A;  5IT9 Z;  2L3D A;  2PFB A;  4HX8 A;  3ABT A;  2HKX A;  3BLY A;  2QKM B;  3F9K A;  3JW4 A;  3FM3 A;  3KCC A;  5DTD A;  1BC7 C;  5HLI A;  2L4M A;  2HQA A;  2QYO A;  4BS9 A;  2HVQ A;  2R7S A;  4I98 B;  2HOS A;  1J9I A;  1XSX A;  3SHF A;  1Y56 A;  3HOY J;  1D5V A;  5CQE A;  4D5F A;  2JK3 A;  4QPO A;  1RUO A;  2YS9 A;  2O6G E;  2F48 A;  1NK3 P;  2IXS A;  2ZBK A;  2FQ3 A;  2PQ8 A;  2OV7 A;  2VT3 A;  3FK7 A;  1AU7 A;  1DPR A;  3K6G A;  2FNA A;  2WAD A;  3FMS A;  3TO7 A;  1AWC A;  2OCE A;  3CUO A;  4M6X A;  2WV0 A;  2ZME A;  3P5J A;  4JQF A;  2RV8 A;  2GWR A;  2AQF A;  5LHH A;  1P4W A;  2PEX A;  4KFC A;  3ZOB A;  2WBM A;  4H4K C;  3UKG A;  1HLV A;  2MG4 A;  1FBS A;  2KIF A;  4JYK A;  4O5V A;  4F52 A;  1V55 H;  3EPZ A;  1R1U A;  2L9R A;  4L5E A;  2HZT A;  1XDS A;  2HOA A;  4WK8 F;  1I3A A;  2JN6 A;  4ZDO A;  4CIC A;  4CO8 A;  3HB9 A;  1GXQ A;  5KAF C;  1O3S A;  2YU9 J;  4B44 A;  1GHC A;  2X1E A;  1FT9 A;  3ABK H;  3R61 A;  3D0S A;  3ABU A;  3SEZ A;  4J01 A;  3JAM Z;  2EWN A;  1MJ9 A;  3VYR B;  4GRI A;  3RQ4 A;  2IS4 A;  1K78 B;  2Z16 A;  4NC7 A;  3QRF F;  5FKO A;  3BR3 A;  3GCM A;  2VN2 A;  3ZQF A;  1D0Y A;  1GV5 A;  3DBR B;  1MBK A;  3MEX A;  2W25 A;  2K02 A;  2OD5 A;  3BG5 A;  2V1D A;  2DOF A;  4B8X A;  1VFC A;  3J7A Y;  2MBF A;  3R6S A;  2GZW A;  2VON A;  4BUP A;  1PYV A;  2W57 A;  3GTG J;  4ENM A;  3GEZ A;  2XAQ A;  1KQ0 A;  3A0H C;  1YJN I;  2VBX A;  4YEJ A;  3O6B B;  1SVO A;  3IRR A;  3ZN0 A;  4Y4R A;  1WJF A;  2F5D A;  1QGP A;  2HS5 A;  4Q48 A;  3LAP A;  3IWF A;  3P9K A;  3DV8 A;  1JHH A;  1IXR C;  5K7Z A;  2V1N A;  3LQQ A;  4YIR X;  1TP4 A;  3E1S A;  3CTA A;  3E0J B;  5D8L B;  5ICG A;  1QQI A;  5FLM J;  3JRF A;  2B9S A;  4Q47 A;  4YRV A;  3KPH A;  2NS0 A;  4U0Y A;  1A5J A;  3BJA A;  4AIK A;  4ZC3 A;  4A3D J;  4AD9 A;  4UUV A;  1U2W A;  2EA4 A;  2LKX A;  5LRS A;  2HPI A;  2WC2 A;  1IRX A;  4B3X A;  2QQ9 A;  1JT0 A;  4HV6 A;  4U87 A;  3NWT A;  2NS8 A;  3FHN A;  5FRM A;  4PK4 A;  3P7N A;  5LEK A;  2F2E A;  4BXF A;  1KYZ A;  2O03 A;  3LSP A;  1X3Z B;  3J7Y J;  2FJ1 A;  3RKW A;  1UHW A;  3CQZ J;  2DJN A;  3EUH A;  4LB6 B;  4LIU A;  3TGN A;  3FDY A;  5KCM A;  3ZRG A;  1LFU P;  2PN6 A;  1JTY A;  3VWB A;  3HSR A;  1IN4 A;  4PJM A;  5CVI A;  1VQP I;  2ELJ A;  1W5C C;  5IP6 A;  4EGZ A;  1EH7 A;  4UY8 I;  1XGN A;  4M9S A;  4KIS A;  2P0W A;  3IAS 2;  1OCZ H;  2KL4 A;  4S0H B;  4CCM A;  2QWW A;  4EQQ A;  3WGH A;  1Z67 A;  1FIP A;  3SDG A;  2V6E A;  2CYY A;  3E6M A;  1IF1 A;  1NK2 P;  4CYC A;  2W00 A;  3CCE I;  3DKW A;  1Y6I A;  1ITY A;  5B3S H;  2I10 A;  5EJC A;  2H6C A;  3F21 A;  1YX5 A;  2H27 A;  3GTL J;  4G12 A;  2QUF A;  4BHP A;  2LC2 A;  2CJJ A;  3Q9S A;  3R0J A;  2CV1 A;  3ROU A;  4FE4 A;  3LSH A;  1FMW A;  2ELK A;  4BDY A;  4YFN F;  3DTE A;  1ETV A;  4FT8 A;  4HX4 A;  1SFK A;  2Z99 A;  2JUC A;  2E1C A;  1VQ4 I;  2F5E A;  2M1B A;  1KQ8 A;  2YSR A;  3BC8 A;  3GFM A;  1MMD A;  2NOJ B;  3HM5 A;  4KN7 X;  1FC3 A;  3IKV A;  1RR7 A;  3QP6 A;  3E3V A;  1HKQ A;  2QSH X;  1G6N A;  3OY9 A;  1RKW A;  4B09 A;  1LVK A;  2BVM A;  2A69 F;  2XC7 A;  5ILU A;  2X6X A;  2LR8 A;  1T08 B;  1D1B A;  1QPI A;  2XF7 A;  3WTW C;  2KRH A;  1R9T J;  3OYB A;  3K1N A;  4IKF A;  1ERD A;  4LIT A;  2E2H J;  1CGP A;  4D5C A;  2EZL A;  5EEH A;  1NTC A;  2ECB A;  2FA5 A;  4XSZ F;  3OWT A;  2QCO A;  3KET A;  5J1Y A;  1Z9C A;  4HQM A;  2NVY J;  1BI1 A;  3NAU A;  2WA0 A;  1LVA A;  2RQP A;  2G9W A;  2ID6 A;  3MN2 A;  3CMA I;  3RI4 A;  3F8M A;  3HOU J;  2K3P A;  2QQA A;  3DTI A;  1W7P D;  5J8C A;  2UWM A;  3DLL F;  3WG9 A;  2VKH A;  1EKE A;  1LB2 A;  5LLQ A;  3E6D A;  4CCL A;  2X51 A;  2BOL A;  3MKY B;  2VBZ A;  2M7B A;  1FY7 A;  1D1A A;  3N4M A;  3CES A;  3FKI J;  1O3R A;  1TTY A;  2Z33 A;  2MC3 A;  3LFU A;  4XID A;  2BY0 A;  4LFU A;  4NBQ A;  2A6T A;  2WY8 Q;  2K9S A;  1HDD C;  4RAG A;  1E0E A;  4JX6 A;  2RNJ A;  2ZNY A;  5GPA A;  5IYC J;  4X0G A;  5DDG A;  1T38 A;  3RPU D;  1KON A;  2E5N A;  2HQN A;  1LKX A;  2DU9 A;  3FM5 A;  3KFW X;  1ETW A;  2ZXH A;  4AYB A;  4BY7 J;  3DQV C;  4HST A;  3MKZ A;  2P5V A;  3IAM 2;  5GAE J;  4GCV A;  4FTH A;  2XPW A;  2BHZ A;  3L7W A;  3WHB A;  4BQA A;  2HVS A;  4C2T A;  1DGW Y;  4YFX F;  3EUK L;  2HI3 A;  2Y9Z A;  4OIQ F;  3CCV I;  3R0A A;  3TKY A;  3SQN A;  2WAE A;  2HKO A;  1X2M A;  4RGS A;  3A0B C;  3O3K A;  2L9V A;  1RR8 C;  2A61 A;  2NRA C;  2IS2 A;  1HQC A;  4ESF A;  2JA8 J;  3FKJ A;  1AA7 A;  1H88 C;  3LMM A;  4M3B A;  4C2M J;  1DDN A;  2CGP A;  1DP7 P;  2L7M P;  2VI6 A;  2OTL I;  4RLF A;  2ISZ A;  3OIP A;  1VQ5 I;  3OYN A;  3PSI A;  2B7E A;  2HDW A;  3OYM A;  3LSK A;  4UV9 A;  4G7H F;  3FK6 A;  1YQA A;  3OR1 C;  5C44 J;  1K6O A;  1O3T A;  1HCR A;  2DOE A;  2O8X A;  3AG3 H;  3HOW J;  1MMA A;  5AON A;  3TDZ C;  3HDD A;  3SZT A;  1TQI A;  3ZPL A;  2DFE A;  1IRZ A;  3QYB A;  2V4J C;  5J6X A;  2HTJ A;  2IS1 A;  4HF1 A;  1FOY A;  1YTY A;  3DBL B;  4ETS A;  3CC2 I;  5E17 F;  3BR6 A;  3F8F A;  1K4S A;  3KYC B;  1D0X A;  3H3Z A;  5CVJ A;  1OCC H;  3CF2 A;  5BNG A;  5GAH J;  1EJ9 A;  1XDU A;  3RZO J;  1LQ1 A;  5IOZ A;  1XD7 A;  4ZJZ A;  4A3C J;  3PIP F;  4XMY A;  1SMT A;  2DA5 A;  1WJC A;  3QAH A;  3KIO A;  1Z05 A;  1H9G A;  1OYW A;  4MGR A;  4A12 A;  3S16 J;  1FBU A;  3Q0W A;  3ZQC A;  3DPT A;  2WWY A;  2HOT A;  3CCL I;  5LGU A;  2R5Y A;  2QKL B;  4QLC U;  3ZMT A;  4E7J A;  2VQL A;  4BKX A;  3O8H A;  4C30 A;  2IA2 A;  4BJ6 C;  5HS7 A;  1U6G A;  4IRI A;  3K4J A;  2KIQ A;  4P55 A;  3GTQ J;  4BHC A;  2L01 A;  2ZB9 A;  4BXX J;  2OC6 A;  4M71 A;  3OYI A;  3SYT A;  1Z6R A;  2G7H A;  4WX9 A;  3JRE A;  2Q8K A;  1JKO C;  2UXN A;  2HOE A;  4XKC A;  2E2I J;  3MZ8 A;  4A0Y A;  3Q0U A;  1TWH J;  1XGO A;  2PLY A;  3HRS A;  4DZJ A;  3BR5 A;  3K70 D;  4NB5 A;  3H5A A;  3FXM A;  3HC7 A;  3QP5 A;  2QSG X;  2E1N A;  2LSO A;  3WU2 C;  1I1S A;  1XC5 A;  4EV0 A;  2R93 J;  2KQR A;  3NRV A;  3PNT A;  4G94 A;  4P96 A;  3ZN1 A;  3L2V A;  1KU7 A;  3C7J A;  5BS6 A;  4G6T B;  4UUT A;  4PGG A;  1J75 A;  1I27 A;  3LNQ A;  4MTE A;  3CO7 C;  5K5R A;  4AVP A;  4D1Q A;  1YIO A;  1USS A;  4F3Q A;  4DQ2 A;  1K78 A;  2HGC A;  3BG9 A;  1W7P A;  5F04 A;  4C9Y A;  1F4K A;  4XOT A;  2ZJP F;  1MNE A;  5BOX A;  5IYD J;  3E97 A;  1V5G A;  5F27 A;  4WXH A;  1W36 C;  1R4M B;  5EF6 A;  5H20 A;  5FFX A;  1LE8 A;  1TL8 A;  1IV6 A;  4G7Z F;  4M3F A;  2CG4 A;  3TOA A;  1LDJ A;  2ZJ2 A;  2FSW A;  3F8N A;  3IRQ A;  3DFG A;  2QA4 I;  2VL8 A;  2CUF A;  5J1R A;  1FYK A;  1XX5 A;  3ECH A;  2OJE D;  1FX7 A;  3EYY A;  1WI3 A;  1ZRE A;  2OQG A;  3H5R A;  2BZT A;  2M4K A;  2JPC A;  2ZXJ A;  3KEO A;  1O7F A;  1ZKG A;  4RM3 A;  5IYB J;  3L2C A;  2M2E A;  2XUB A;  1YIJ I;  3RPU A;  1K7A A;  1SAU A;  5J40 A;  1QPM A;  5E8G A;  3D1N I;  3TP3 A;  1ZN2 A;  1J0R A;  3L9F A;  3J81 K;  1L0O C;  2LLK A;  2XAF A;  3KP5 A;  1W36 D;  2GA2 A;  4EGY A;  3A03 A;  4XLP F;  5DM7 F;  3IP4 B;  3K0L A;  2H8W A;  1WVR A;  3SXY A;  5B5E C;  2PMZ N;  4IEJ A;  1L3L A;  3K9T A;  3GTO J;  3ELK A;  3CUQ C;  5J3L A;  3BWG A;  4EJO A;  3OYK A;  4DYR A;  1OLT A;  1I6H J;  3GWZ A;  1TW3 A;  2LF8 A;  4E6K G;  5HVQ C;  3M8J A;  3PO3 J;  2PJR B;  2J5P A;  4BU2 A;  3PFI A;  4F7Z A;  5M5X J;  3AG2 H;  1A36 A;  2BYV E;  4N4O B;  5F64 A;  2GBY A;  3W6V A;  2XSJ C;  1LPQ A;  1PUE E;  4RBO A;  1BA5 A;  1ZQ3 P;  4F91 B;  3HRM A;  4BGD A;  4E7H A;  4OIR F;  1R5G A;  4A6E A;  4AU7 A;  4Q5S F;  2VXZ A;  4HG2 A;  4I2O A;  1Z3Y A;  5DV5 A;  1ETO A;  1MIJ A;  3CDI A;  2BEO A;  2Y2Z A;  4KIT B;  3JCU C;  1SMY F;  1BJA A;  3M3Y J;  2QBY B;  3BZC A;  3TQN A;  1MDM A;  1SD5 A;  3CCJ I;  1G3T A;  1Y0U A;  2KJC A;  1B9M A;  3CLQ A;  2DT5 A;  4W1U A;  1WJD A;  3DF8 A;  3BG7 A;  1X1A A;  1Z3X A;  4OAZ A;  4PJL A;  1JHF A;  3LSG A;  4L0Y B;  1FMV A;  2CQX A;  4XLH A;  1R36 A;  3C18 A;  2NNY A;  1MBJ A;  2E35 A;  3WOD F;  1QHH D;  2XKO A;  4MLO A;  3ISP A;  1T2K A;  2IJL A;  4Y7N J;  2VQG A;  1MJA A;  1GUU A;  5FJ8 J;  3J81 Z;  3VYU B;  1ORK A;  3PQK A;  2R7D A;  3SZP A;  2EH3 A;  3G1O A;  4CCO A;  4RAF A;  1I6X A;  2AQE A;  3HBL A;  2LBF B;  1YFH A;  2LDU A;  1DGR M;  1ZHF A;  5C4J J;  2QLZ A;  3DKX A;  3IH3 A;  4WXC A;  1IGN A;  2HWV A;  3HPG A;  5J8F A;  1QBJ A;  1D0Z A;  2NVX J;  3DKY A;  3PL8 A;  3VYS B;  1FIA A;  4ZYD A;  2QSF X;  1X19 A;  2DMP A;  3HIF A;  2ZSI B;  5F0F A;  3GTJ J;  3ML6 A;  2P7C B;  5K7H A;  4E7I A;  2GXG A;  1X1D A;  3Q0V A;  4IZZ A;  1AKH A;  3EDP A;  3ONQ A;  4BBR J;  2Y69 H;  4N0B A;  2BVL A;  3PNY A;  3W3C A;  1P7I A;  2RGV A;  2KPM A;  2Q0O A;  2CW0 F;  2M87 A;  2P6T A;  3PNV A;  2R7W A;  2KLO A;  2F6C A;  1R71 A;  5LGN A;  1ZR4 A;  2MD5 A;  2EV6 A;  2FRH A;  3EUH C;  4HYE A;  1HW1 A;  2DFH A;  2KFD A;  2KRF A;  4E7Z A;  2XF6 A;  1W1W E;  4J19 A;  3CLO A;  1G3W A;  1JJ6 C;  1YJW I;  5AIQ A;  3GZ5 A;  2ECC A;  1UB9 A;  3H0D A;  1P7J A;  2Q2E A;  4IOA F;  1BM9 A;  2V26 A;  2KT0 A;  4MIM A;  3A02 A;  1VQ6 I;  4JOM A;  3KP2 A;  3CCU I;  5IP7 J;  4XQF A;  4M73 A;  4CH7 A;  1G59 A;  4D0P A;  1FYM A;  3KX2 A;  2R7X A;  2BXY A;  4XN3 A;  2K40 A;  4CA0 A;  3SFZ A;  1ZRD A;  1PVE A;  5CVU A;  4AVZ A;  2P5L C;  5FGM A;  1BC8 C;  4HDU A;  2BV6 A;  1ONV A;  3FHZ A;  4MEX F;  4I0B A;  2FOW A;  2V9P A;  5F6F A;  2A5W A;  5LEJ A;  5E1W A;  5F0C A;  5D5V B;  2DXI A;  2E1O A;  2ZKZ A;  1RES A;  2ISY A;  2FU4 A;  3K10 A;  3GZ6 A;  5FLV A;  2RDP A;  4B3A A;  2V79 A;  4BE2 A;  4ZDL A;  2E19 A;  3A01 A;  1I3Q J;  2R7F A;  2FXA A;  4MEY F;  4KIB A;  5FB2 A;  4IHV A;  2R7U A;  4I7H A;  2RN7 A;  5GAG J;  3ULQ B;  1AHD P;  3S32 A;  5D6F A;  2CUE A;  3HZJ A;  1O3Q A;  1JJ8 C;  2W7N A;  1V3F A;  2DA7 A;  1PDN C;  1SAN A;  3I64 A;  1VF9 A;  1Z7L A;  2KIS A;  3JR9 A;  3REO A;  2F5V A;  5E1X A;  1XB4 A;  2LP0 A;  5GTI C;  3E7L A;  2GQQ A;  2GM4 A;  1MSE C;  3CJR B;  1DQU A;  5HOO A;  4JP0 A;  2KDZ A;  1YO5 C;  1FOX A;  2EZH A;  3GTP J;  2YPR A;  3I4N J;  4EMS A;  3S1Q J;  4HF2 A;  1DU6 A;  1IC8 A;  2Y30 A;  2R7Z J;  4HOB A;  1WJB A;  1W5T A;  4LG0 A;  4IHS A;  3CP2 A;  3F23 A;  3HRT A;  3QPH A;  1VTN C;  2K4B A;  4KYW A;  2E1M B;  3CDH A;  4QIW N;  1KGS A;  1ZAO A;  3T1B A;  4HF0 A;  3M1E A;  5E3L A;  1I50 J;  3SZG A;  2IS6 A;  3GME A;  4HAM A;  4EJV A;  3HOX J;  2FF4 A;  2K9Q A;  1RPW A;  1SVM A;  3TMO A;  2R5Y B;  4KMF A;  3FXQ A;  3HOZ J;  4P9F A;  2IRF G;  4HBL A;  1ZK8 A;  2K86 A;  4KNY A;  3H9Q A;  4CGZ A;  3CUQ A;  1XG1 A;  1FNN A;  2WV1 A;  1SFE A;  1WHU A;  4RMN A;  3V8J A;  2QM3 A;  2R5Z B;  1HW5 A;  1WI9 A;  1BJZ A;  2D2W A;  1FP1 D;  2KZV A;  1B4A A;  3RQI A;  3OSF A;  1PUF A;  1SFX A;  2XRL A;  5DYM A;  2ELH A;  2LMD A;  3MFK A;  4B47 A;  3K7A J;  2XB0 X;  3DEE A;  4XR6 A;  3HGG A;  4WCG A;  4DYQ A;  4XK4 A;  3BG3 A;  4OWR B;  1OIS A;  2XDV A;  1U5T B;  1X2N A;  2BW3 B;  4HZF A;  2X85 A;  1REP C;  1ZAR A;  3OS1 A;  3EQL F;  1Y1W J;  1WWX A;  4A3F J;  3LST A;  5L3G A;  3CCS I;  2DOD A;  3MMY B;  2Z5U A;  5DEQ A;  1WFX A;  3TO6 A;  2EFN A;  2HYG D;  5FFZ A;  2A3S A;  1QU3 A;  2CH0 A;  1B8I B;  3GO5 A;  4IX7 A;  3SEQ A;  3M1C A;  4L9V A;  2F5C A;  2A07 F;  1J09 A;  3WTS C;  3G3Z A;  1QRY A;  1WH7 A;  2DCE A;  4JX5 A;  2OTJ I;  1W7P B;  2D1H A;  3K4M A;  3ZCO A;  2MD0 A;  4AC0 A;  4Y17 A;  4A3K J;  1Y0N A;  4EJU A;  5M5W J;  4U88 A;  4BJ5 C;  3FIW A;  4ZH4 F;  2ME0 A;  1LE8 B;  4Y13 A;  2DTZ A;  1NG7 A;  2RNG A;  3PIO F;  1ODD A;  5LD2 C;  1QHG A;  1VI0 A;  3ZMV A;  3WG7 H;  5HLT A;  1OCO H;  1BR1 A;  2O5R A;  2Y9Y A;  1S7O A;  3IUO A;  3GBG A;  2VE8 A;  3G4S I;  1PP7 U;  1QVT A;  1RI7 A;  2JRM A;  4OMY A;  3M8F A;  2ETH A;  2IGK A;  2DQL A;  2ZC2 A;  4XNF A;  4XL9 A;  5F1J A;  4XKB A;  1ZYR F;  2HYJ A;  1I1G A;  5CLS A;  3H36 A;  5ICC A;  1YW9 A;  2DYR H;  5EDN A;  1IAW A;  4D7M A;  2GIZ A;  4AIH A;  4LIV A;  4KIG A;  2L9S A;  1M1E B;  3WGG A;  1XSV A;  1MND A;  2R7O A;  2NAZ A;  1XGM A;  2E1M C;  3IH2 A;  1Z1D A;  2QVO A;  3U1K A;  3I54 A;  2VPL A;  2XKP A;  4AIJ A;  1SVL A;  3WTZ A;  3S2H J;  4IO9 F;  3ECO A;  5D8K B;  2W4S A;  5BPI A;  4ZYE A;  5L3E A;  3JRA A;  4XSX F;  4A3I J;  1A04 A;  3HSE A;  3HXL A;  2UUZ A;  1OJL A;  4Y15 A;  5E1Z B;  2JVG A;  5E3N A;  4NC8 A;  1RUN A;  1FLI A;  1GDT A;  2QEN A;  3TOB A;  2DFF A;  3BTC A;  2COB A;  2JZY A;  1IN6 A;  1GV2 A;  2NOG A;  2ZO4 A;  3PSF A;  3L1P A;  1TWG J;  4PUS A;  2PJR A;  4UHT A;  2JT1 A;  2QZ8 A;  2O0Y A;  3I3L A;  4JBA A;  3VOD A;  3W2A A;  4I09 A;  1V54 H;  2LOO A;  3U1D A;  3TED A;  2P4W A;  1MDM B;  3RPQ A;  1TNS A;  5HLH A;  1U9N A;  3BZK A;  5D5U B;  2A5Y B;  4HRI A;  1U5T C;  5JR3 A;  2Y0M A;  1SAX A;  2EFW A;  4ZZD A;  5DD8 A;  2WY7 Q;  2B63 J;  1WQ2 A;  2DA1 A;  4LMY A;  2FBH A;  2BXZ A;  2EIK H;  2R7V A;  2ZFW A;  2QBY A;  2VC1 A;  5IOY A;  1A6Q A;  3GFJ A;  2YUS A;  2IGN A;  2OU2 A;  3MQ0 A;  5K5Q A;  4RB0 A;  1W0T A;  2B0L A;  3CP8 A;  5HS9 A;  3K69 A;  4PFP A;  1UG2 A;  2HZD A;  4L5J A;  3HHH A;  3FMQ A;  4IHW A;  2VKD A;  3ZMU A;  1OQY A;  3RZD J;  2IT0 A;  2JTV A;  4PCQ A;  3W6J B;  2CU7 A;  1HKS A;  2EZI A;  2LH9 A;  1AKH B;  2LBF A;  2VBY A;  3MD2 A;  3OYE A;  3PUB A;  4XLE A;  1VQK I;  5GP9 A;  5FD6 A;  5M3M J;  3CO6 C;  1D5Y A;  4WWC A;  3JRB A;  4I99 C;  3AAF A;  2EA2 A;  1UST A;  2J5O A;  4KIF A;  1TT5 B;  2JQ7 A;  3BR2 A;  5FKM A;  3BTL A;  1S72 I;  1VND A;  5CKT A;  4U7D A;  1R49 A;  3AKZ A;  4GYG A;  2Q2E B;  1BN5 A;  3WE2 A;  4LLN A;  3L2Q A;  4NUB A;  2VKV A;  1T8I A;  2Y48 A;  1O57 A;  4Z2Y A;  1TQP A;  3CF5 F;  2M8E A;  4ZYG A;  1MMN A;  2F4M B;  4E7S A;  9ANT A;  2IPQ X;  4IVN A;  2PJP A;  1H89 C;  2N8G A;  3ZMS A;  5IY5 H;  1G8X A;  3BZ6 A;  5F1R A;  3COA C;  3FZV A;  1FOK A;  5LHG A;  4BEH A;  3LSI A;  2DFI A;  1BI2 A;  1J5Y A;  2ACJ A;  3A01 B;  2K85 A;  1F36 A;  1YJ9 I;  3KP3 A;  4ENJ A;  2EIJ H;  2LY9 A;  3K1M A;  2Z1D A;  3LWF A;  4L9T A;  2DA3 A;  3HKZ N;  3BTJ A;  2DOA A;  3IKT A;  4E7K A;  2VQC A;  1ZGJ A;  2Y0S N;  4B43 A;  3RTR A;  2JWT A;  1X4P A;  1RRJ A;  1OCP A;  1BOA A;  3B02 A;  1GVD A;  2XAG A;  4A2U A;  1OR7 A;  5L3F A;  3DBH B;  3HJE A;  4Q4Z F;  3C2G A;  2AHQ A;  4ZTJ A;  3JSP A;  2DPU A;  3CCY A;  1XMK A;  2MH2 A;  3BPX A;  2DA4 A;  1ZG5 A;  2DK5 A;  5FRN A;  3IL2 A;  5ILV A;  3L2U A;  3GYH X;  1IO2 A;  2DT7 B;  1WGX A;  3FXJ A;  3ZQQ A;  4LG0 B;  2VOO A;  1IUF A;  3VPR A;  3JRI A;  2MW8 A;  5FD5 A;  3FXL A;  4IHY A;  3GLL A;  3HOV J;  3Q3S A;  4C3H J;  3PO2 J;  4IOC F;  1OKR A;  2A6E F;  3KP4 A;  1Z21 A;  3V7R A;  3MWM A;  4C2U A;  1KU9 A;  2RC4 A;  1R6R A;  3RJP A;  2LRE A;  1OYI A;  4PSX A;  3OV8 A;  1IJW C;  3K1P A;  3M8E A;  4XKW A;  3CUQ B;  2GOX B;  4XN0 A;  5DCF A;  2L4A A;  3OYH A;  2W84 A;  3IHU A;  1TWC J;  3I58 A;  4CCK A;  3VSL A;  1ETY A;  1PUF B;  1TT0 A;  2IGM A;  1JKR C;  1KU2 A;  3H35 A;  3GTK J;  2AS5 F;  3LA3 A;  4JK1 X;  3OYA A;  2HPM A;  4L18 B;  1LDD A;  1P4A A;  5ICE A;  3VB2 A;  4BH9 A;  5HNF A;  2LF7 A;  2L7F P;  2R5Z A;  2HXI A;  2DMQ A;  2Y0S A;  3VOE A;  1V4R A;  3BR1 A;  5E3O A;  4FE7 A;  4UB8 C;  1BW6 A;  5B66 C;  4L9J A;  3M9A A;  1STZ A;  3KLN A;  1FYL A;  3TW7 A;  1E3P A;  3AFH A;  4M6V A;  3SDB A;  1R5I D;  3F22 A;  2PX9 A;  3I0T A;  2IAI A;  4XLA A;  3PM1 A;  4IRG A;  2MGQ A;  1S5L C;  4B48 A;  1U5T A;  4M6Y A;  4HW0 A;  2BW3 A;  2E71 A;  4IXA A;  3B6A A;  1FTT A;  3X2Q H;  2HDC A;  3T5X A;  3I71 A;  4L5I A;  5AIP A;  4ZTF A;  3KYL A;  2D1V A;  3OYG A;  1HKT A;  2DO7 A;  2W82 A;  1Z0X A;  3GVA A;  1B8I A;  4ENN A;  2M30 A;  2XGC A;  2CUZ A;  3CME I;  1H8A C;  1I5Z A;  2L02 A;  4AWX B;  4LOC A;  3VFZ A;  3SJM A;  5FKL A;  1S7E A;  2WB1 N;  4AM3 A;  1E2X A;  4KT6 A;  4XON A;  2HR3 A;  3MZY A;  3PFY A;  4ESJ A;  1BL0 A;  3I56 I;  3JRD A;  1RET A;  1BBY A;  1ON1 A;  2AXT C;  2CQK A;  2KP6 A;  1P2F A;  3I53 A;  2BBY A;  2XB5 A;  4A0Z A;  4CHU A;  2XIG A;  4ZYA A;  3ERE D;  3RSN A;  3CC4 I;  4RS8 A;  3GFI A;  2AXL A;  3KZI C;  4UVC A;  5L3D A;  4A3J J;  2BY2 A;  2WAQ N;  4UB6 C;  1YLF A;  2JMW A;  3BQY A;  3BR0 A;  1S3J A;  1Y8R B;  3GXO A;  1FP2 A;  1CQT A; 
#chains in the Genus database with same CATH homology
 5F0C A;  5FLM J;  2E1O A;  3JRF A;  1RES A;  5FLV A;  3ZQI A;  2E2J J;  3LOC A;  4B3A A;  1IG7 A;  2XGE A;  1A5J A;  2E19 A;  3A01 A;  1I3Q J;  4A3D J;  2LKX A;  4IHV A;  2DMT A;  2K9N A;  1JT0 A;  1JT6 A;  1MH3 A;  2NS8 A;  1AHD P;  4DYC A;  1ETX A;  2CUE A;  1JJ8 C;  5GPC A;  3LSP A;  2VPR A;  2R92 J;  2FJ1 A;  2DA7 A;  3CQZ J;  2DJN A;  1SAN A;  2RAE A;  1VF9 A;  3JR9 A;  2XPV A;  2LP0 A;  3E7L A;  2L7Z A;  1LFU P;  1JTY A;  2GM4 A;  1MSE C;  1MH4 A;  2KDZ A;  3OIO A;  4JP0 A;  3S15 J;  1ETQ A;  5IP6 A;  2EZH A;  3GTP J;  3I4N J;  4X6A J;  3S1Q J;  3NAR A;  3H3V K;  1DU6 A;  1IC8 A;  1U8B A;  2Y30 A;  4S0H B;  2R7Z J;  1FIP A;  3SDG A;  4XRS G;  1NK2 P;  4CYC A;  1U78 A;  3F0C A;  1ITY A;  1ETK A;  2P81 A;  2I10 A;  4QIW N;  3GTL J;  4G12 A;  2IEK A;  5E3L A;  1I50 J;  2CJJ A;  4FE4 A;  5EZG A;  2DA6 A;  2ELK A;  2X9D A;  3K2A A;  1JTX A;  3O8G A;  3HOX J;  2K9Q A;  1RPW A;  4M3G A;  2DMN A;  2R5Y B;  1ETV A;  2EQR A;  3HOZ J;  1ZK8 A;  1F43 A;  5E3M A;  4EEF G;  2NS7 A;  3IH4 A;  1XG1 A;  3SFI A;  3HM5 A;  2OF7 A;  2WV1 A;  1RR7 A;  3HGY A;  2R5Z B;  1RKW A;  1BJZ A;  1MNM C;  4BBS J;  3RQI A;  3OSF A;  1PUF A;  2XRL A;  3JRH A;  5HOD A;  2LR8 A;  3K7A J;  2XB0 X;  4A69 C;  3CDL A;  1QPI A;  4FIS A;  3HGG A;  4DYQ A;  4XK4 A;  1R9T J;  3BG3 A;  2H8R A;  1YRN A;  4A3E J;  2VUM J;  2E2H J;  1X2N A;  1X58 A;  2LFB A;  3S1R J;  4D5C A;  3ZQL A;  2EZL A;  1WH5 A;  1Y1W J;  1NTC A;  4A3F J;  2ECB A;  2QCO A;  5J1Y A;  2NVY J;  2JJ7 A;  3NAU A;  3GTM J;  2CQQ A;  2ME6 A;  1B8I B;  5EG0 A;  5M3F J;  2ID6 A;  3MN2 A;  1E3O C;  4JX4 A;  3HOU J;  2FD5 A;  3QPS A;  1MSF C;  1RKT A;  1QRY A;  1WH7 A;  4JX5 A;  1IDY A;  2IBD A;  5EGO A;  4AC0 A;  4A3K J;  4A3G J;  1MBF A;  5M5W J;  3FIW A;  1LE8 B;  2ME0 A;  2DTZ A;  3FIS A;  1ENH A;  3FKI J;  1VI0 A;  4B1R A;  4XID A;  2XPU A;  3MKL A;  2Y9Y A;  4MO7 A;  1APL C;  2K9S A;  3GBG A;  1HDD C;  4JX6 A;  3IV5 A;  4ABZ A;  2O8K A;  1QVT A;  5GPA A;  5IYC J;  2D5V A;  3HEF A;  4QSH A;  1QVU A;  4W97 A;  5F1J A;  1ETW A;  2HYJ A;  2Y31 A;  4BY7 J;  2M9H A;  2HDD A;  5EDN A;  4D7M A;  2XPW A;  3WHB A;  3G1L A;  4FTH A;  1GT0 C;  5IPA A;  2HI3 A;  3QQA A;  2Y9Z A;  3S1N J;  2JA7 J;  3IH2 A;  1JKQ C;  1X2M A;  3B6C A;  3DCF A;  4NDL A;  3QPL A;  1ZGW A;  3S2H J;  4GFB A;  3C2B A;  2JA8 J;  1JUS A;  3JRA A;  4A3I J;  1H88 C;  2TCT A;  2W48 A;  2H1K A;  4M3B A;  4C2M J;  1OFC X;  1OJL A;  2L7M P;  2VI6 A;  1DU0 A;  1JUP A;  2NVQ J;  1Z77 A;  5E3N A;  1WCM J;  1GDT A;  2HXO A;  3BTC A;  2COB A;  3FK6 A;  1GV2 A;  1MBG A;  2NOG A;  5C44 J;  4AUX A;  1ZTR A;  1HCR A;  3L1P A;  3MVP A;  1TWG J;  2LVS A;  3HOW J;  4D7N A;  3G1M A;  3HDD A;  5FKN A;  4CYC B;  1U9O A;  2LD5 A;  1IRZ A;  3TED A;  1BW5 A;  4B4C A;  2O9L A;  3BR6 A;  1U9N A;  2QF7 A;  5BNG A;  3RZO J;  4XRS A;  5EEA A;  5IOZ A;  2B63 J;  4A3C J;  1Q1V A;  2DA1 A;  2DA5 A;  3LSJ A;  4QTR A;  3S17 J;  2XGD A;  5IOY A;  2YUS A;  3S16 J;  3Q0W A;  4A93 J;  4DW6 A;  1W0T A;  3ZQC A;  1MBE A;  2G0E A;  1OCT C;  2HOT A;  1B72 B;  1UG2 A;  3LSR A;  2R5Y A;  4IHW A;  4BKX A;  3O8H A;  1UHS A;  3H0G J;  1O4X A;  2VKE A;  3RZD J;  3BT9 A;  1EF4 A;  2HQ5 A;  2CU7 A;  3GTQ J;  2ZB9 A;  4BXX J;  1HF0 A;  2EZI A;  1JKO C;  3JRE A;  4XIC A;  1K61 A;  2E2I J;  3Q0U A;  4C3I J;  1AKH B;  2JA5 J;  1TWH J;  4IHX A;  4V2F A;  5J1U A;  3S14 J;  4DZJ A;  3ZQG A;  3BR5 A;  5GP9 A;  1POG A;  5M3M J;  1D5Y A;  1G2H A;  3JRB A;  5EG0 B;  3JRG A;  2M8G X;  1XC5 A;  2R93 J;  1XS9 A;  1Y1V J;  1HOM A;  2TRT A;  1A6I A;  3BR2 A;  1TWF J;  4BY1 J;  5FKM A;  3BTL A;  1VND A;  3S1M J;  4UUT A;  1FTZ A;  4UUS A;  3LNQ A;  4FCY A;  2VKV A;  2R0Q C;  1W0U A;  1JKP C;  2ID3 A;  3BG9 A;  5EYR A;  1T33 A;  2JA6 J;  5F04 A;  1IDZ A;  4A3L J;  3I4M J;  5IYD J;  4MFD A;  5F27 A;  1JGG A;  3DEW A;  9ANT A;  5JLX A;  5EF6 A;  1T56 A;  4Y52 J;  4C3J J;  1LE8 A;  1H89 C;  2N8G A;  2OPT A;  3S2D J;  4M3D A;  1IV6 A;  4M3F A;  2O7O A;  2EBI A;  5J1R A;  2CUF A;  3A01 B;  1F36 A;  3JRC A;  5FKK A;  2LY9 A;  1WI3 A;  5F08 A;  3OOU A;  2L0K A;  2DA3 A;  1K83 J;  3HKZ N;  3TW6 A;  3BTJ A;  5JLW A;  3M4O J;  2DA2 A;  3BQZ A;  2Y0S N;  5DS9 A;  1ZKG A;  5IYB J;  4X1E A;  2M2E A;  2MSY A;  2JWT A;  3D1N I;  1JUM A;  3TP3 A;  1OCP A;  3RKQ A;  1TC3 C;  4V2G A;  2FQ4 A;  2LLK A;  1GVD A;  2M0C A;  5IP9 J;  3A03 A;  4MFE A;  3BTI A;  2AHQ A;  3CCY A;  2PMZ N;  4IEJ A;  3GTO J;  5J3L A;  2DA4 A;  4DYR A;  1ZR2 A;  1I6H J;  5C3E J;  1WGX A;  3PO3 J;  2EZK A;  2LTP A;  2X6O A;  3ZQH A;  1FJL A;  1IUF A;  3VPR A;  5M5X J;  3JRI A;  1MBH A;  2MW8 A;  4IHY A;  3HOV J;  3Q3S A;  4M3E A;  4C3H J;  2GBY A;  3OSG A;  4DZP A;  3PO2 J;  3W6V A;  5EZH A;  4A3M J;  4RBO A;  1BA5 A;  1ZQ3 P;  1UMQ A;  1WPK A;  3TP0 A;  1ETO A;  2FX0 A;  2M34 A;  2Y2Z A;  2GLO A;  2DMU A;  3M3Y J;  1IJW C;  2DN0 A;  2X48 A;  4RDU A;  1TWA J;  3CMY A;  4W1U A;  1HDP A;  1TWC J;  5DTD A;  3LSG A;  3WHC A;  2CQX A;  4I6Z A;  1ETY A;  1PUF B;  4AYB N;  1JKR C;  3GTK J;  1MBJ A;  4MLO A;  2HOS A;  4Y7N J;  5FJ8 J;  1GUU A;  3HOY J;  1SFO J;  1YRN B;  2AO9 A;  4D5F A;  2L7F P;  2R5Z A;  1ORK A;  2JK3 A;  2HXI A;  2EH3 A;  2YS9 A;  2DMQ A;  1NK3 P;  3G1O A;  3BR1 A;  5E3O A;  4FE7 A;  1B72 A;  1BW6 A;  4A3B J;  3HBL A;  3FK7 A;  1AU7 A;  2NVT J;  3TW7 A;  5C4J J;  3IH3 A;  4I76 A;  4M6V A;  1IGN A;  2NVX J;  2IAI A;  1FIA A;  3PM1 A;  3ZOB A;  2DMP A;  5F0F A;  2MGQ A;  3UKG A;  1HLV A;  2MG4 A;  4HNV A;  3GTJ J;  4JYK A;  5K7H A;  3B6A A;  1FTT A;  2L9R A;  4L5E A;  3Q0V A;  5EGO B;  2HOA A;  1AKH A;  5C4X J;  1FEX A;  4BBR J;  2JN6 A;  3HB9 A;  2YU9 J;  1Z0X A;  1P7I A;  5M5Y J;  4XRM A;  1B8I A;  2XGC A;  4UUS B;  1H8A C;  1ZR4 A;  5FKO A;  2LK2 A;  3BR3 A;  5K7F A;  4LOC A;  3SJM A;  5FKL A;  3ZQF A;  4J19 A;  1S7E A;  1GV5 A;  2WB1 N;  1MBK A;  1JJ6 C;  1LFB A;  3BG5 A;  2ECC A;  1VFC A;  1P7J A;  5F0H A;  1BL0 A;  2KT0 A;  4MIM A;  3A02 A;  3JRD A;  1RET A;  5IP7 J;  3GTG J;  2XB5 A;  2K40 A;  4A3J J;  2WAQ N;  2CRG A;  5K7Z A;  2JMW A;  3BQY A;  3BR0 A;  2XSD C;  1CQT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...