2R5YB

Structure of scr/exd complex bound to a consensus hox-exd site
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
59
structure length
59
Chain Sequence
RRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIRYKKNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords DNA (5'-D(*DAP*DCP*DTP*DCP*DTP*DAP*DTP*DGP*DAP*DTP*DTP*DTP*D
publication title Functional specificity of a Hox protein mediated by the recognition of minor groove structure
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 22
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2007-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2r5yB00
2EZLA 3A03A 2DA7A 3GTMJ 2L7ZA 3OSFA 3PO3J 1HDPA 1RESA 4A69C 2XPVA 5M3FJ 1TWHJ 3HEFA 2JWTA 1PUFA 1H89C 2NVXJ 1QVTA 4BBSJ 3CCYA 1TWFJ 1WH5A 5E3MA 2AO9A 2N8GA 1K61A 3S1RJ 1JT6A 1JTXA 1H8AC 3JRBA 3GTPJ 3JR9A 1IRZA 4XK4A 1U8BA 5FJ8J 1FTTA 2ECBA 3IH4A 5GPAA 4FE4A 2XPWA 1Q1VA 5FLVA 3H0GJ 2WV1A 4DYRA 3ZQGA 4A3MJ 4A3EJ 3CDLA 1MBFA 4V2GA 1Y1WJ 3SJMA 4DW6A 2R5ZA 3ZQHA 5BNGA 4LOCA 5C44J 5C3EJ 1ITYA 2JN6A 3JRHA 3IV5A 3FK6A 4DYCA 5F27A 1UHSA 2TRTA 4Y7NJ 3G1MA 3RQIA 1RKTA 2FQ4A 4A3JJ 3WHBA 2RAEA 1MH3A 1B72B 1W0UA 1NK3P 2DMPA 3O8GA 4CYCA 3S16J 1P7JA 2DMTA 1IC8A 2IEKA 3JRFA 1DU0A 1HCRA 3A01A 4M3GA 4AUXA 1TWCJ 2CRGA 3LNQA 1XS9A 5M5YJ 1O4XA 3I4MJ 1HDDC 2DA6A 3Q0UA 1I6HJ 4D7MA 4IHXA 3HOUJ 4UUSA 1RR7A 2X6OA 2Y30A 3BR0A 5J3LA 2NS8A 3ZQFA 2LKXA 4XIDA 3LSGA 4UUTA 5FKLA 5DTDA 1ETWA 2DA4A 2XGEA 1OCPA 3BQZA 3W6VA 3NARA 5IYBJ 1UMQA 1S7EA 2O7OA 1XG1A 4C3IJ 4QTRA 4AC0A 1ZKGA 2Y9YA 1OJLA 1GVDA 2CUEA 1MBKA 2R5YA 4J19A 5J1YA 3S15J 2HQ5A 1X2NA 3O8HA 2CQQA 4C3JJ 2VUMJ 2YUSA 2HXIA 1MBGA 5EZHA 1T33A 3ZQIA 2EZKA 3TEDA 1AHDP 1MBHA 1X58A 2PMZN 1QPIA 4BY1J 4D5CA 1QRYA 3D1NI 2FD5A 3DEWA 4RBOA 2DTZA 5K7FA 3HOWJ 4MFEA 1BW6A 3FISA 3S2HJ 4MO7A 2CUFA 1WGXA 2P81A 2IBDA 3UKGA 4V2FA 1AKHA 3NAUA 2MW8A 1Y1VJ 3DCFA 1LE8A 1ZR2A 2E1OA 2DA3A 2M9HA 5F0FA 1NTCA 1FTZA 3TP3A 2JJ7A 1IDZA 3RZOJ 3B6AA 2VKEA 1JKRC 5IP9J 5EGOB 1Z0XA 4I76A 1RKWA 1B8IB 4A3KJ 3BR3A 2EBIA 3C2BA 3CQZJ 1ORKA 3HOXJ 2K9QA 5M3MJ 3TW6A 3VPRA 3RKQA 1RPWA 1IJWC 5C4XJ 5F04A 1BL0A 4S0HB 1F36A 5EF6A 4A93J 2M8GX 1A6IA 3LOCA 2JK3A 1GDTA 1WI3A 4FTHA 1FEXA 4B1RA 1YRNA 3MN2A 2ELKA 2XB5A 1EF4A 5EG0A 2L9RA 1DU6A 4ABZA 3S17J 4M6VA 3S14J 3IH2A 5HODA 4B4CA 4X6AJ 1BA5A 2L7MP 2KT0A 1ZTRA 2VI6A 3IH3A 2NS7A 2G0EA 5GP9A 2ECCA 2HOAA 5FKNA 2Y2ZA 2LVSA 3GTOJ 1ZR4A 4BKXA 3F0CA 1MSEC 1GV5A 5K7ZA 5FLMJ 3K2AA 2ZB9A 2M34A 4D5FA 3BTIA 2HXOA 3HB9A 2MG4A 1E3OC 3H3VK 1ETYA 1TC3C 1JJ6C 2B63J 4G12A 1VF9A 3JREA 2QF7A 3BQYA 5EGOA 4C2MJ 2EH3A 1ZQ3P 1JT0A 2H1KA 2GM4A 1ETQA 1T56A 2EZIA 1ETXA 4D7NA 3HM5A 3JRDA 1VFCA 1MSFC 5FKKA 1HOMA 4M3FA 3QPSA 2NVYJ 5IP7J 1I50J 5E3LA 2VKVA 1XC5A 1VI0A 1A5JA 1K83J 2XGDA 4GFBA 2IAIA 2ME0A 2Y0SN 2E2HJ 2FX0A 5DS9A 1AU7A 1POGA 2XB0X 1GV2A 1UG2A 1R9TJ 3GTJJ 2HOSA 3M4OJ 1TWGJ 3M3YJ 1IV6A 2M0CA 2DJNA 2VPRA 2H8RA 1JKQC 1VNDA 2MGQA 5F0HA 1JTYA 1JKPC 3JRIA 1MNMC 2D5VA 4DYQA 1ETKA 5K7HA 1W0TA 3Q3SA 3BG9A 3PO2J 2LLKA 3QPLA 1GT0C 1CQTA 3BG5A 4A3FJ 2O9LA 1PUFB 1ENHA 5IP6A 2X9DA 3OOUA 3K7AJ 3TW7A 3JRAA 2XPUA 4XRSG 3BR5A 2ID3A 4A3LJ 4DZJA 1SANA 2COBA 2JA8J 5F1JA 2HYJA 4A3BJ 3OSGA 2NVQJ 4XRMA 2E2IJ 1B72A 2R93J 3HGGA 3BTJA 4A3CJ 3JRGA 4A3DJ 2GBYA 3G1LA 3L1PA 3S1QJ 1MBEA 4A3GJ 1JUMA 4FE7A 2K9NA 5C4JJ 1ZGWA 2K9SA 5GPCA 3Q0WA 3SFIA 1BJZA 1IGNA 3B6CA 3A02A 3BT9A 1H88C 3S2DJ 4IHYA 2TCTA 2YS9A 1JJ8C 5F0CA 1FIAA 3FKIJ 1G2HA 2R5ZB 4RDUA 2DA5A 3LSRA 2DN0A 3GBGA 4BBRJ 2DMNA 2LD5A 1LFBA 1D5YA 3FK7A 2R92J 2LFBA 2DMQA 5JLWA 1WCMJ 3HDDA 5IYDJ 3PM1A 1QVUA 3HKZN 5J1UA 3BTLA 4MLOA 3GTLJ 1X2MA 4CYCB 2AHQA 1LFUP 2R0QC 4B3AA 1JGGA 4MIMA 1IUFA 4QSHA 4JX6A 4W1UA 3A01B 4NDLA 4BXXJ 3HOVJ 2JA7J 2CU7A 4UUSB 3BG3A 1ETOA 3RZDJ 1ETVA 3S1MJ 4JX4A 1SFOJ 2XGCA 2K40A 3HGYA 5J1RA 3E7LA 5M5XJ 3BTCA 1IDYA 1FIPA 4XRSA 2JA6J 5FKOA 3SDGA 5M5WJ 1Z77A 1B8IA 1BW5A 2R5YB 4X1EA 2DA1A 4MFDA 1U78A 1I3QJ 1IG7A 4Y52J 3LSPA 1NK2P 2JMWA 1MBJA 3BR1A 9ANTA 4M3BA 4IHWA 2CQXA 2YU9J 2OF7A 4XICA 1TWAJ 2LTPA 5EDNA 1HF0A 3ZQLA 2LP0A 5IPAA 2LY9A 5JLXA 2HDDA 2WB1N 3MVPA 1WPKA 2L0KA 4JX5A 2HOTA 2GLOA 1OFCX 2Y9ZA 3S1NJ 5F08A 3GTQJ 4FISA 4QIWN 4IHVA 1MH4A 1RETA 3MKLA 3HOYJ 3ZQCA 1FJLA 2M2EA 2NOGA 4EEFG 2E2JJ 1AKHB 1OCTC 3G1OA 5E3OA 1JUSA 2QCOA 4C3HJ 2OPTA 1LE8B 2O8KA 2ID6A 1U9NA 3WHCA 1WH7A 2E19A 5EYRA 2DA2A 4BY7J 2NVTJ 3BR6A 2XRLA 2Y31A 2L7FP 2DMUA 4M3DA 1P7IA 4DZPA 3HBLA 4M3EA 4L5EA 1GUUA 2FJ1A 3Q0VA 5IOZA 3GTGJ 2HI3A 3OIOA 4A3IJ 2KDZA 3QQAA 3JRCA 3GTKJ 4JP0A 4AYBN 1YRNB 1U9OA 2JA5J 4I6ZA 1APLC 2CJJA 2R7ZJ 2XSDC 2LK2A 4HNVA 5EG0B 3FIWA 3BR2A 2WAQN 1JUPA 4JYKA 2MSYA 2W48A 3I4NJ 1JKOC 2LR8A 3ZOBA 5IOYA 4W97A 1ZK8A 2X48A 5IYCJ 2EQRA 3LSJA 4FCYA 1F43A 5E3NA 3CMYA 1HLVA 2ME6A 5EEAA 2I10A 5EZGA 3TP0A 2EZHA 3HOZJ 4IEJA 5FKMA
chains in the Genus database with same CATH superfamily
3K70D 1U0JA 2EZLA 3A03A 3BJAA 2DA7A 3CMAI 2L7ZA 3GTMJ 3R0JA 4A2UA 1Y56A 4PFOA 1YG2A 1ERDA 1PVEA 4ESBA 1BI0A 2X6YA 2YU3A 3CCJI 4ESFA 1PUFA 1QVTA 3CCYA 5DD4A 2VE8A 4OMYA 1KQ8A 2EA4A 3L2RA 1WJDA 1TWFJ 1VQ9I 5J4YA 2N8GA 3CTAA 3TOAA 1K61A 1JTXA 4II2A 3AG2H 3OYKA 4HQMA 4IX7A 3QU6A 2E60A 3CUOA 5D6FA 1M1EB 2ECBA 2W25A 3D5LA 4XM3A 3E0JB 3IH4A 5GPAA 4J00A 4FE4A 2XPWA 1Q1VA 4BEHB 3TDUC 3H0GJ 2WV1A 4NBQA 4A3MJ 3ZN0A 1SC7A 1FYKA 3CJRB 5JI6A 2EIMH 1DQUA 3ZGKA 4KT6A 2HU9A 2VBWA 2KFDA 3DBHB 2GZWA 4LFUA 4HQEA 1Y1WJ 3IC7A 2R5ZA 3ZQHA 1HSJA 1HW2A 3OS0A 2V6EA 1D8JA 1FZPB 2CQ7A 2F5FA 5C44J 2PMZA 1ITYA 2JN6A 3JRHA 5ED4A 3FHNA 3ML6A 5E79C 3C2HA 4DYCA 4HF0A 1YJ9I 4Y7NJ 3S32A 4FASD 3G1MA 2WADA 2HZDA 3RQIA 1FBSA 4KITB 2LY1A 2VQLA 1RUNA 1NK3P 2DMPA 5EEHA 3BLYA 3S16J 1VQ8I 2X0LA 2HPIA 2IA1A 1KU3A 3RDIA 5GAEJ 4YRVA 1VQOI 4XONA 2DQRA 3I58A 3A01A 4M3GA 1W36D 2ZBKA 4RAZA 1LQ1A 1O4XA 4BXUA 2A68F 1PUEE 2FQ3A 4XRFA 1FMWA 3GZ5A 2QQ9A 5TJJA 2ZNZA 4IHXA 1FOXA 2DU9A 2ETHA 3ZQFA 2LKXA 4Z6YA 3LSGA 4UUTA 1X1AA 4AVPA 1ZG1A 1ETWA 1I3AA 1OCPA 3FXKA 2ZJPF 3H92A 5GTHC 3W6VA 5FD5A 2L3DA 1VZ0A 2HOEA 3WE3A 4IO9F 4I7HA 3BJOA 1OJLA 1GVDA 3IKTA 2CUEA 1H9GA 1ZRCA 5LGTA 4CH7A 5KHDA 3CCRI 3MEXA 2JZYA 2UUZA 3S15J 1X3ZB 2E1MC 5FRMA 3OYFA 3LQRA 4IXAA 3TMOA 2YUSA 1KQ9A 2HXIA 2RNGA 2YX4A 1UHMA 3TO7A 2OTLI 3Q9SA 2L54A 2A6HF 2E1NA 2M7AA 2BXZA 2ZFUA 3TBIA 2ZMEA 1F4KA 2ADUA 2EZKA 1AHDP 1MBHA 1QPIA 4BY1J 2M45A 1HA8A 2R7UA 5ICGA 1YS6A 3DEWA 3KLOA 3GUDA 2AXTC 3I5UA 1R7JA 3FISA 2CUJA 2HYFA 1W5CC 2VKDA 4MO7A 3EYIA 2CUFA 1WGXA 3FXMA 3RTRA 1XDSA 3L9FA 4V2FA 4EGYA 1Y1VJ 3I53A 2XDVA 2EV5A 2E1OA 2KKOA 5BS6A 4BGDA 2M9HA 4ZDLA 2VOPA 1FTZA 1O3QA 4U7BA 5FLXZ 4HYEA 2VKEA 5IP9J 2IRFG 2IT0A 5KCMA 4IHSA 1B9NA 3M07A 3FBIB 3PQJA 3RYPA 5CVUA 3C2BA 2DK8A 3LSTA 2K5CA 4MEXF 1DUXC 3J7AO 2HTSA 5M3MJ 1E17A 3TW6A 2W7NA 1IJWC 1H0MA 1ONVA 1BL0A 4LLNA 4CYDA 1F36A 2ELHA 3K10A 2M8GX 5E8GA 1A6IA 1ODDA 3U1DA 3LOCA 4OOIA 3H1CA 1ZG3A 1U6GA 5EG0A 2L9RA 2XHKA 4FHTA 1DU6A 1ULYA 4M6VA 3CCSI 2XROA 1BM9A 2L7MP 2D1VA 1BR1A 1W4MA 1HKSA 3DP7A 2QVOA 2VI6A 1IXSB 3PNVA 3D5RC 3DTKA 3TOBA 2JPCA 4KDPA 4OWRB 5LBQA 1EV7A 3U21A 1KONA 2IGNA 3SZPA 1QA6A 3DBLB 1SVOA 3DEEA 4G7OF 1GHCA 5FLMJ 1O3RA 1QNTA 1A6QA 3HPHA 4KISA 2DT5A 3BTIA 1YITI 4LD5A 4L5IA 1E3OC 2KIQA 1TC3C 3I0TA 3LFUA 1VF9A 5F64A 4IRHA 1R22A 5JVTA 2GM4A 3CJQB 4F7ZA 1ETXA 4F55A 3H0DA 3L2QA 5LFAA 3IP4B 1JI8A 2VT3A 2W4SA 3HM5A 2ZJ2A 4UB6C 1MSFC 4P96A 2FNPA 4IL6C 3EYYA 2L02A 1HOMA 2KHMA 3OYIA 1XC5A 4HNTA 4GFBA 4M6XA 5DS9A 4C9YA 2PMUA 1UG2A 4NQWA 1TWGJ 1G59A 1R1UA 3M3YJ 1Y39A 2VPRA 3OMYA 4GO1A 4CZZA 2UZKA 2MGQA 1YE9A 4XLNF 2HVSA 2P5KA 1ETKA 2L4AA 5K7HA 3GFLA 2Z99A 4QLCU 4V19K 3PO2J 3FMQA 4IRIA 4XOTA 1CQTA 4G9YA 2O9LA 3DPTA 3OYGA 5GADJ 4A5NA 1PUFB 3RKWA 1T08B 2AS5F 2VOOA 3WODF 2EV0A 2XPUA 4XRSG 4S04A 2ZXWH 2ID3A 2LH9A 1R1VA 2QQBA 4EVIA 2VN2A 2LNBA 3G2BA 3ZRGA 5A2QK 2ISZA 4G6QA 1IN4A 1FMVA 3BTJA 3RPQA 3G1LA 2F5DA 3S1QJ 3GLLA 3DPUA 1FSEA 2CS3A 1T0FC 5F6FA 2NNNA 3F8FA 2K9NA 4M74A 4U0WA 5C4JJ 1ZGWA 5D8LB 3SFIA 2L2OA 1PYVA 3K2ZA 5J6XA 3BT9A 3SHFA 3CD6I 4O6JA 2A6EF 2IXSA 2TCTA 2Y0MA 4KT5C 4E7LA 1I1SA 4A0XA 2KIFA 5D8KB 1JJ8C 1FIAA 2HYGD 4XOPA 2OD5A 1SAXA 2R5ZB 2CYYA 4RDUA 3REOA 3UR3C 3MZYA 4YG2F 3NRVA 2VIXA 2DT7B 2R7VA 2DN0A 3VYRB 2WB1A 1XD7A 5DCMA 3C2GA 2DCEA 3TO6A 1N25A 5DV5A 1Z21A 1J9IA 1XGOA 3JTGA 4JBAA 2GOMA 2WAFA 4UV9A 1QVUA 3HKZN 5K5OA 3GTLJ 4LGWA 2EFPA 1TBXA 5EJCA 5CQEA 4CO8A 1U8RA 4B3AA 1MW7A 3LQQA 3SDBA 1R6RA 4MIMA 4LB5A 1Y0NA 5L3BA 4QSHA 2K02A 4UVBA 3A01B 1TNSA 4ZYDA 1STZA 4F52A 4AIHA 3KEOA 3BPXA 4HEA2 4F3QA 1R71A 3RJPA 4AU7A 3HJEA 2L5QA 1PDNC 1TNTA 4ZZLA 2K40A 2A6TA 5JFRA 3K1NA 3F22A 1B1BA 1IW7F 4AYBA 4UUVA 2DDAA 1GXQA 3V42A 4CCJA 3WTVC 4MFDA 1DPUA 3H9QA 1IG7A 1U5TA 4BS9A 4Y52J 3QYEA 4U0YA 2OA4A 2R7WA 2WWYA 1SMTA 3H5RA 3I55I 4IHWA 2NS0A 2XRNA 2YU9J 1ZREA 3BP8A 2ZMEB 2MLKA 1D1BA 5JLXA 3WU2C 4KA4A 1XX5A 2HOTA 4DBQA 4BU2A 2VASA 3S1NJ 5BQTA 3CC7I 3GTQJ 3MZHA 1HW1A 1RETA 2WA0A 3MKLA 2VQCA 2M2EA 5HS8A 3CCMI 4EEFG 1AA7A 3G1OA 5D5UB 5E3OA 1LNWA 2BE5F 2V9PA 3IWZA 4CA0A 3WHCA 3GCMA 1Y8QB 2R7QA 4UVAA 4HSRA 5LEJA 2P7CB 2Y31A 2VJ5A 3KYLA 4OMZA 5GTIC 3W3CA 1YJWI 1K4TA 1S7AA 3CZ6A 1HXDA 1GUUA 2P6TA 2CFOA 1MMAA 3WGIA 1WRJA 3LAPA 2HVRA 3T8TA 1TW2A 3V8JA 3A1YA 2ICWG 2CG4A 1EH7A 3SXYA 3JRCA 3UNGC 1W5SA 1Z91A 4RAFA 5BPIA 1TQPA 5GAGJ 2R7ZJ 4LLGF 4I6ZA 2CJJA 1APLC 2XSDC 4M6YA 5EG0B 3VYUB 2PN6A 2VL8A 2YPRA 3HRSA 2IS6A 1JKOC 3T0YA 3AFHA 5HOOA 3Q5FA 3QP5A 2LYCA 4L9JA 3VB2A 2XAQA 1HLVA 4RGRA 3N05A 4JOMA 1KU9A 2JTVA 3HL2A 3TP0A 4HV6A 4LJZF 3OS2A 3N97A 1WJAA 3GZ6A 3HC7A 2FMLA 1Z6RA 5HS9A 3PO3J 2E5NA 1HDPA 3ASOH 4JK1X 2XPVA 3HEFA 4C2UA 1YLFA 2JWTA 1B4AA 1H89C 3OWTA 2CW8A 1NG6A 2FA5A 1IRGA 2XF5A 4KN7X 3LSKA 4G94A 2OZUA 1WH5A 3EUHA 4O5VA 1FYMA 1W1WE 2HPMA 3ABUA 3S1RJ 1H8AC 3S3NA 2LREA 1RI7A 3GTPJ 2Q2EB 5B66C 3JR9A 4XK4A 1BR4A 2HQAA 4HV5A 3HOTA 1U8BA 3VYTB 4NQWB 2GQQA 1FTTA 2DDBA 1G3YA 1AWCA 1YW9A 2J5PA 3F3XA 4P9UA 2V1DA 1X1CA 2LC2A 2LG4A 2QA4I 1X1PA 1OISA 4DYRA 1BI3A 4A3EJ 3OR1C 1MJAA 2CFXA 2W00A 1J7KA 3EETA 4DW6A 5ICCA 4IHTA 1Z7UA 1TT0A 3V7RA 1R23A 4XMYA 1SAUA 2Z33A 4HF1A 1HBXG 3E6DA 1OKRA 3A0BC 4RB3C 5E8IA 3W6KB 1V54H 2F48A 1UHSA 1UJ8A 2F2EA 5L3CA 2A5WA 4HOBA 5LRSA 2V1UA 1DPRA 5ILUA 2FQ4A 5KAFC 3TGNA 4A3JJ 1XPXA 1MH3A 3KP7A 1W0UA 1UB9A 2H1LA 4BNCA 5DM6F 3ZMZA 4CYCA 2V79A 1KYZA 1FOYA 1J2XA 1MZBA 4LB6B 1O57A 2DMTA 3VSKA 4AWXB 4HA8A 1IC8A 2IEKA 1DU0A 1MIJA 3V8LA 4E6KG 4AUXA 2HGCA 2CRGA 4FT8A 1OMIA 1LVAA 4AM3A 4MQVA 3HG9A 3P7NA 4D7MA 2Q8KA 4UUSA 2K4BA 3BR0A 2RREA 1JHHA 4NHJA 2JPBA 3DXJF 2QKLB 1K4SA 2DAOA 5CKTA 2LF7A 2GXGA 3BQZA 4C30A 2HKXA 1UMQA 1IN7A 2HZTA 2IP2A 4KIGA 1N77A 4AC0A 2Y9YA 4UVCA 5DCMB 3WG7H 2QLZA 3CJTB 4OIPF 1YYVA 4J19A 1XB4A 2ZXIA 2RDPA 2FBHA 3ZXSA 2XAFA 4O3MA 2HQ5A 2X1CA 1BIAA 1X2NA 2P0WA 2CQQA 4EM1A 3AG4H 4C3JJ 3VFZA 2VUMJ 3LWFA 1MBGA 4L0YB 2R7SA 1T33A 4II3A 3OYHA 5FGMA 1XGSA 4E7SA 3TEDA 3PIOF 4BQAA 1PP8F 1B6AA 4RAYA 1AOYA 3QOPA 2XAGA 4MFEA 1G3SA 3FXRA 4H4KC 3K4NA 4EV0A 5J4VA 1P4XA 1EA3A 5HLIA 2VE9A 1FOWA 3Q9VA 1IXCA 3ZMUA 1AKHA 2MW8A 3DCFA 1NHAA 4P5OA 5B1AH 2Z1DA 4E7IA 4OIQF 2JQ7A 3A0HC 5LGUA 2X6WA 1VQ6I 1S72I 3TP3A 2JJ7A 1IDZA 3B6AA 5ERIA 4A5MA 3J7AY 1KU2A 3ABMH 2R7DA 3M9AA 1Z0XA 4WCGA 1IXRC 1VQ7I 1OYIA 4KYWA 1RKWA 1O3TA 4MHGA 2V9VA 2DJIA 5D6EA 3ECHA 1U5TB 2EBIA 2QQAA 2ZC2A 1SD4A 3HOXJ 2K9QA 3L00A 1U3EM 2GAUA 3VPRA 2Q0OA 4FQGA 5J40A 4MNUA 2B7EA 4S0HB 3F21A 4BE0A 2PJRA 3KP3A 1K7AA 2GOXB 3KX2A 4ZDOA 4PSWA 2G9WA 2R7XA 1FEXA 5H6RA 4F91B 1YRNA 2ELKA 5IT3A 3BJ6A 4RB2C 4E7JA 4ABZA 3S17J 2XSJC 5HNHA 2VT2A 4A6DA 4NUBA 1BIBA 2QYOA 2X1EA 3OYDA 1LKXA 5LHGA 1DP3A 2MC3A 5LRRA 2CV1A 2ECCA 2HOAA 4LLLA 1FWZA 4RA2A 2RVCA 2M7BA 2VBXA 1ZR4A 4BKXA 1SD7A 2CW7A 2OTJI 2M34A 1ACIA 2Z2SB 3NQOA 2QEXI 1R4MB 3K1MA 1JJ6C 3H9GA 3PL8A 1K6OA 5KK1A 4PZJA 3JREA 4EJVA 4BDYA 2M4KA 5EGOA 1O7LA 4C2MJ 2EH3A 2KIUA 5KNLA 1S5LC 2VBZA 3TO9A 3DQVC 4UXNA 2K9MA 4P55A 3CCUI 2V9KA 4DGWB 4A6EA 2F5VA 4L9NA 5HDGA 1IO2A 4PJJA 4LMYA 2HDCA 1XSVA 5DYMA 3GZNB 4BJ5C 3CO6C 1Z05A 5DD8A 1I50J 4G7ZF 1TLHB 5DCFA 2DQLA 2D45A 2ME0A 2PJPA 4QPOA 4EJOA 3LAJA 1R49A 2XB0X 1OYWA 1J59A 3AL0B 3LMMA 2H94A 2OCEA 2QGUA 1Z9CA 3M4OJ 2DJNA 3PUFA 2FUG2 2VONA 4BHCA 2F6CA 4BE2A 4U0VA 2MFZA 5F0HA 1S6LA 2KIMA 2R3SA 3GEZA 3G71I 1ZHFA 3RI4A 4M9ZA 3HKZA 3Q3SA 3BG9A 4E4HA 4G7HF 4FETA 1SFUA 3QPLA 3IAS2 3BG7A 4B47A 3QPHA 1ENHA 5IP6A 4LK0F 2X9DA 3P5JA 3TW7A 1A31A 3L2VA 1SANA 2XASA 2QM3A 3F8CA 5F1JA 5K5QA 1HKTA 1IF1A 2DT6A 3OSGA 1B72A 3E6CC 4B48A 3HGGA 4A3DJ 2GBYA 4BHBA 3L1PA 4M9SA 3KETA 1MBEA 3QYFA 4HLYA 2M87A 5H20A 1U5TC 5FD6A 2IGMA 4XNFA 3ZPLA 5GPCA 2DW4A 4KICA 1XMAA 4DBRA 3J81Z 2HS5A 2O0YA 1DGRM 3VWBA 1H88C 1FBQA 3I9V2 3E97A 5F0CA 3VYSB 2XKOA 1MGTA 2CMPA 2OV7A 4QPQA 2BVMA 3NWSA 3ECOA 2RGVA 2EFWA 2DMNA 3K6GA 1LFBA 4HX8A 4CHUA 2LFBA 2DMQA 5JLWA 3HDDA 5LLQA 3RKYA 2KPMA 4ENJA 1OR7A 4CCMA 1EKEA 3JSOA 3O6BB 2V4JC 3BTLA 4MLOA 4NB5A 1QHHD 1ZAOA 5ILSA 4E7HA 3HUGA 4CYCB 2AHQA 3I59A 4KIBA 1ON2A 5FO5A 1LFUP 2R0QC 2BHZA 1PJRA 2NAZA 4MEYF 1MD0A 5E18F 2ZXHA 4W1UA 4NDLA 2X6XA 3BG6A 2H09A 1LEAA 3MD2A 3ZQ7A 4FX0A 1QHGA 3WTXC 2E35A 2VODA 3QYBA 3MCZA 2BZTA 4BACA 2XAHA 3BG3A 4UUSB 1P2FA 1ETOA 3R0AA 2DLLA 2XGCA 1UELB 2NNYA 4ZYAA 4YIFA 1KGSA 3DV8A 3HGYA 4DQ2A 3E7LA 2K27A 1RR8C 5M5XJ 1MMSA 1EH8A 4RGSA 2JA6J 1P9QC 2P6SA 1B8IA 3KEQA 2NYXA 4X1EA 1U78A 4ZDPA 3C3WA 3K4MA 3KCCA 3LSPA 1R4NB 1XGNA 1MBJA 1ZN2A 2DFEA 5D5WB 3ZP5A 3AL0C 9ANTA 4XKWA 2MLGA 2L01A 2OF7A 3CP2A 2LTPA 3OYLA 2XC7A 1IV8A 2M8EA 4B43A 1OLTA 5IPAA 1WJBA 2IS1A 2AXLA 2L0KA 4NC6A 3CCEI 1HW5A 2DPDA 2WY8Q 2Y9ZA 2MBFA 1IRXA 4G6TB 3KP2A 1YFHA 2LBFA 2FF4A 3QP6A 3CP8A 3HOYJ 2FRHA 1AKHB 1OCTC 3G3ZA 1JUSA 1J5YA 3ABLH 1WI9A 3MFKA 1QBJA 2O8KA 1V5FA 2ID6A 4MTEA 1XSDA 2V7FA 3BOQA 3V7CA 1BOAA 2KRCA 2L7FP 4Y17A 4ZZDA 3BCAA 1SFEA 2HKOA 3HXLA 2QBYA 1N78A 3KIOA 1I27A 4EMSA 4DZPA 4U7DA 3L7WA 1REPC 2FBIA 1R36A 5AIQA 2FJ1A 3QPTA 2VB6A 3ZCOA 3V4GA 1R00A 4LIVA 2YX7A 2KJCA 3ZR8X 2ZJQF 2PJRB 2M3AA 4C2TA 3CCVI 1YO5C 2L7KA 3QQAA 3MAJA 3GTKJ 3HSEA 3DLLF 4HBLA 3K4LA 2K9LA 3WTZA 1YRNB 2JA5J 4KIFA 1LVKA 4N0BA 2RNJA 4EJTA 2LK2A 3SZTA 4G8XA 1SFKA 1X19A 3F6OA 3BR2A 3GXOA 5FB2A 2WAQN 4K2EA 4AIDA 1DDNA 1MNDA 2R7FA 2IVMA 5BPDA 4L5JA 4I0BA 4RLQA 1ZK8A 2X48A 1T8IA 4OIOF 3BY6A 3K4KA 4FCYA 2YR2A 1F43A 3NWTA 1JGSA 2EWNA 3CMYA 1EH6A 4YIIA 2ME6A 5B1BH 2HNHA 1TL8A 5J8FA 5DEQA 4TV7A 5CPRB 2P8TA 2H6CA 4RAGA 4IEJA 1MJBA 1D1AA 4XR6A 3ASNH 1ZGAA 5HDKA 5FROA 2Z3YA 3RKXA 5JHFA 3RIRA 2VQGA 5F1RA 1FPQA 3GFIA 1TWHJ 3I54A 2M30A 3MKWB 3J7YJ 3WTTC 1WJCA 4B8XA 4OINF 2P7VB 5FFXA 4F93B 2AO9A 1X4OA 2X51A 3ULQB 3FM5A 2DOAA 1BC8C 2NVUB 3VODA 3O2PE 2L9VA 1B9MA 3P9IA 3W2AA 3JRBA 5KAIC 4UNOA 1J0RA 1TQIA 4D0PA 2COMA 2OCCH 3QWLA 1L0OC 2PBIA 3CF5F 3DU5A 3E1SA 3O3KA 2MYSA 1FP2A 2VC0A 3CLOA 4CCLA 3R61A 1YIOA 2KZGA 5TGTA 2Z9OA 4Z2YA 5ICEA 1XN7A 1V3FA 3OIQA 2EA2A 3E5XA 2RQPA 3T1BA 1MBFA 1V5EA 4MGRA 2E7WA 2D1HA 1UCRA 1VQLI 1ZH5A 3JAMZ 2CGPA 2F4IA 4LOCA 1OPCA 5C3EJ 4I02A 1D0XA 2LDUA 5F27A 2FBKA 1HQCA 3HSRA 4KN4X 2XV4S 2RAEA 1B72B 3BWGA 2EIKH 2FOKA 1BN5A 5BMZA 1T39A 1P7JA 4N4OB 2A07F 1NH3A 3ABTA 1D0ZA 2XAUA 3CJNA 1HCRA 4PJ0C 3LNQA 2O3FA 1G8XA 1HDDC 4XLAA 4XORA 2QSGX 2F5CA 1TZLA 1G3TA 3DTEA 3FDYA 3FXQA 4N9HA 3HOUJ 2X6OA 2Y30A 1RRJA 4XN0A 1Z7LA 2C6YA 5DDGA 2A69F 5HVQC 2PLYA 2DTRA 2H6BA 4B09A 3RPUA 3L09A 3KYDB 1KYWA 1XG1A 4C3IJ 4HF2A 2R5YA 2HTJA 3U2RA 3BROA 4I09A 4R8HA 1R1TA 4BJ6C 5J1YA 3GFJA 1UG0A 1WZ2A 2IS4A 3OL3A 3WTSC 3O8HA 3T8RA 1RZ4A 4IOAF 3HUGB 1QGPA 1LFPA 5EZHA 3DFGA 3J81K 2Y48A 3ZQIA 3GFMA 2PG4A 1X58A 1XGMA 1Y0UA 4D5CA 1FNNA 4E70A 2NOJB 2RV8A 1WKMA 4RBOA 2DTZA 5K7FA 3HOWJ 4RM2A 3KFWX 3LA2A 4GXOA 3S2HJ 1C0WA 2KP6A 5H2FC 2P81A 3H36A 1L3LA 3I3LA 3NAUA 4GRIA 1K6YA 1QZYA 4IRGA 3LFKA 3MQ0A 1LE8A 2VPLA 2OBPA 3OYMA 1DGWY 3RZOJ 4LG3A 1KA8A 2B9SA 1CGPA 3KP4A 4WK8F 2O5RA 1YHQI 3CMMA 1B8IB 4XKBA 3BR3A 3FXLA 1V5GA 3CQZJ 1ORKA 2RQQA 1V4RA 3BZKA 4GYIA 3PSIA 1RPWA 2DFIA 5F04A 1Y6IA 2O03A 1DP7P 3GVAA 5CLSA 1GDTA 2UWMA 3M1CA 5LD2C 2PEXA 1EJ9A 1EF4A 1LDJA 4CCKA 1W7PA 4IQJA 1D1CA 2LBFB 1WFXA 5IT9K 2G7HA 4GDFA 3S14J 3IH2A 1BA5A 1LDDA 4RB1A 3PIPF 1WWXA 2KT0A 1ZTRA 2BW3A 3IH3A 2QQ8A 2Z5UA 1S29A 3LL7A 2NS7A 2FE3A 2BV6A 2G0EA 2ZMEC 2XF7A 4ITVA 5FKNA 1JXSA 1IAWA 3GTOJ 1SD5A 1YTYA 4FX4A 1Z3YA 2L9NA 5BOXA 3W6JB 1MSEC 5K7ZA 4IPAA 4WX9A 3KZZA 3BZ6A 3N4MA 2WAEA 4D5FA 2EINH 5K1YA 2HXOA 1MMGA 1QZZA 2MG4A 4HDUA 2DODA 1ETYA 2CQKA 3C18A 3HYIA 3TDZC 1OCRH 1F1ZA 1WJ5A 1G6NA 1RC9A 1X3UA 2BHYA 1D8KA 4G12A 3CLQA 2KJBA 2H1KA 2MA3A 3H5AA 4U88A 5HLHA 1ETQA 1T56A 3RCOA 4BL0B 1FX7A 3ROUA 3ONQA 2JSCA 4CCOA 4XLEA 4BXFA 3JRDA 3HOSA 5DM7F 1VFCA 4HG2A 1RIOH 1F5TA 4M3FA 3QPSA 2NVYJ 3RSNA 5IP7J 5E3LA 2VKVA 4P9FA 4DOZA 2BY0A 3COAC 1A5JA 2XGDA 2ZNYA 2IAIA 2PQ8A 4KFCA 2FX0A 3CDHA 4CUGA 1POGA 1R9TJ 2QWWA 4EM0B 1LPQA 1ZARA 4RLFA 2HOSA 4CXFA 1OR7C 1IV6A 2M0CA 4OU0A 1JKPC 3JRIA 1LB2A 4XSXF 1SEUA 1YS7A 4DYQA 5J8CA 3ZMVA 2BEOA 2XVCA 3VEPA 5D5VB 4A12A 4A0ZA 1WHUA 2LLKA 3GWZA 3FXOA 1GT0C 1XMXA 4ZH4F 3KYCB 2B0LA 2IA0A 3BG5A 3LSMA 4CDGA 3BDDA 4N4NB 2H8WA 2ZO4A 4GGGA 3U9GA 2HEOA 4HX4A 4ASNA 3OOUA 3K7AJ 3JRAA 2GIZA 2DXIA 2LOOA 3HHGA 5JVGF 2EFQA 1GLNA 3MKZA 2DI3A 3VOEA 2COBA 3C1DA 3L2CA 1RNLA 4A3BJ 1S9HA 5H6QA 4XRMA 2NVQJ 2QSFX 2NRAC 2ZSIB 2OU2A 2VJJA 3ERED 2XAJA 4WF2A 3JRGA 4A3CJ 2JA2A 4X0GA 1PP7U 3WG9A 4ZC3A 3PSFA 3PJRA 2A5YB 1IN6A 2K9SA 2HQRA 4BHPA 2UXXA 3JTHA 5FFZA 1XDUA 2QSHX 2FU4A 2IPQX 3FMSA 3L2WA 4KNYA 1BJZA 2OUMA 5E1ZB 2KL4A 3A02A 2BY2A 2CUZA 1FY7A 2E1MB 1VQMI 4BYYA 2LMDA 4EGZA 4LK1F 3FKIJ 3QODA 4LIUA 4NNJA 5HDNA 2OAZA 3LSHA 2DA5A 3B02A 2ZKZA 2MH2A 5J47A 4OIRF 1FP1D 2R92J 3U1KA 4Y33A 1WCMJ 1IRFA 3PNTA 3FM3A 1WQ2A 1ZGJA 1BOBA 1Q1HA 3E6BA 3PM1A 2CV2A 3CDIA 1UHWA 1QO0D 3FZVA 1K78A 3M8FA 3LA3A 1SD6A 3IAM2 3EPZA 3H35A 3F23A 4JQFA 3AG1H 3HHHA 4ZYGA 1MNEA 2R7OA 2XIGA 3JAMK 5ICFA 2HQNA 3R60A 3M8JA 2KZVA 1ETVA 2VXDA 2PFBA 5CVIA 1LDKB 3KPHA 2EFNA 4R79A 2P5LC 1U2WA 3B73A 3FF5A 4WXHA 1T95A 3RQ4A 4PK4A 1YIJI 1JHFA 3K4JA 2PI0A 1FIPA 3DF8A 1A04A 2M1BA 5FKOA 3FXJA 4XRSA 1ZRDA 2R5YB 2DA1A 3G6EI 2GWRA 4AVZA 2WAQA 1XCBA 2DFFA 3BR1A 5D4SA 1JE8A 5HS7A 4BE1A 2IW5A 3I64A 3CCQI 2GXAA 3DPLC 4XICA 1TWAJ 2J5OA 3ABKH 1HF0A 2JVGA 2VC1A 4Y4RA 2LKPA 2OZ6A 2G7UA 2LY9A 2L4MA 2GA2A 3MVPA 4JX5A 5HNFA 1IN5A 4ZYEA 3HRUA 3F8BA 1OFCX 2GLOA 6PAXA 3S3OA 2CSOA 3IHUA 1TP4A 3AG3H 3S8PA 2H27A 2BY1A 2IGOA 3ZQCA 1BI1A 4XN3A 2RKHA 3WGGA 4L0ZB 2EIJH 3X2QH 2QCOA 4C3HJ 3L2UA 1LE8B 1BR2A 3K1PA 1U9NA 3VDXA 3BC8A 1WH7A 2E19A 3QAHA 5CVVA 2M4GA 3DTIA 3OS1A 2M0MA 2XRLA 5DUKA 2F5EA 1P7IA 4HSTA 4IOCF 3OR2C 3WTWC 1TTYA 3DWLE 4RB0A 3TQNA 5D4RA 5D5XB 4M71A 3HBLA 4M3EA 4DNCA 1A36A 4HAMA 5CVRA 4BAYA 2BBYA 3Q0VA 4MTDA 3GYHX 3EUAA 3V7SA 4HX7A 5IOZA 4XLFA 3GTGJ 2NXNB 3FWEA 2HI3A 4EJWA 2V26A 4XL9A 4PJLA 2X85A 1TT5B 2OC6A 3OV8A 3OIOA 2V1NA 2RC4A 2KDZA 4OAYA 1FC3A 1QQIA 2CO5A 2DO7A 5KVRA 1WJEA 5CYVA 3F72A 1H9TA 3F8MA 1U9OA 3KZYA 5LHHA 1Z67A 2JVHA 3CC2I 3KP6A 3H5NA 4XLHA 1W7PB 4HNVA 2L9SA 3FIWA 4PDKA 1BJAA 3KZIC 3JW4A 4IQ4A 3ERMA 4YFKF 4CZCA 4M72A 2VXZA 3K69A 3QU3A 4UB8C 3PFIA 3ISPA 2W48A 1G4DA 2BW3B 4ENNA 1KQ0A 1OQYA 2LF8A 4LITA 2MC4A 4W97A 1MKMA 3CUQA 4EM2A 1IUYA 2EQRA 3BPVA 2KQRA 2O8XA 2F4OB 3LSJA 1USTA 1ZLKA 2K86A 4PSXA 2K7LA 5EEAA 3J80Z 1T38A 4WXDA 2XGXA 3CESA 2I10A 3SFZA 5EZGA 2VBYA 2EZHA 2E71A 3HOZJ 2VJIA 5FKMA 1YX3A 2XF6A 2E36A 3HRTA 4IJAA 4RMNA 3C7JA 4PJMA 3OSFA 4RGUA 2CV0A 3QRFF 2EB7A 4CCNA 1RESA 5ILVA 2STTA 1E3HA 4A69C 5M3FJ 3DKWA 3PNYA 2NVXJ 4BBSJ 3J7ZI 1VQKI 4UV8A 2CW0F 2X4HA 2FEZA 5E3MA 4RS8A 1Z3XA 2Y0SA 1I39A 1KZHA 5B3SH 1X1BA 1JT6A 4F92B 1VQNI 1Y8RB 2DYSH 2TDXA 3KEYA 1IRZA 4HNUA 3H3ZA 4XLPF 2QENA 5FJ8J 1P92A 4ZTFA 2R7RA 5JR3A 3EQLF 5E17F 5IT9Z 2FMYA 3CF2A 4YELA 4BUPA 5FLVA 2CQNA 3MMYB 2A05A 1J09A 2O6GE 4B44A 1KU7A 3SEZA 3KE2A 3ZQGA 3CDLA 3IWFA 4ZYHA 2MD0A 4HZFA 3MWMA 4V2GA 4E7ZA 2LKSA 2FXAA 3SJMA 1MJ9A 3FXUA 3WTUC 5BNGA 1B59A 3WTYC 3OY9A 2P4WA 1P4WA 2QZ8A 3I71A 3IV5A 3FK6A 2W57A 4BQNA 3IRQA 2TRTA 2V1XA 2Z16A 3CO7C 3GF2A 5HLGA 3HZJA 1WSUA 1RKTA 1YQAA 3WHBA 3ZN1A 2WC2A 3O8GA 2K3FA 4MQ9F 3WU1B 3JRFA 5HLTA 5E1XA 5LHIA 2A3SA 1TWCJ 2ZXJA 3EDPA 1XS9A 3K4BA 5M5YJ 1RUOA 1CF7A 3EUHC 3I4MJ 2B63J 2E5ZA 1T2KA 2DA6A 2JSPA 3K9TA 3Q0UA 2Q2EA 1I6HJ 4AIKA 3OOPA 2ZCWA 3HRMA 3OYNA 1RR7A 1LJ9A 5J3LA 1TW3A 2DFHA 2NS8A 3HPGA 4XIDA 5FKLA 4Y15A 5DTDA 2DA4A 2XGEA 1T98A 1N75A 1R5ID 2K4JA 4RGXA 3F9KA 3NARA 4AIJA 5IYBJ 4XBFA 3H9JA 1Z6TA 1S7EA 1FSHA 5B5EC 2O7OA 3SEQA 4QTRA 2PMHA 1ZKGA 4L9VA 4M73A 1Z1DA 2JRMA 2W24A 2IS2A 1MBKA 4ZTJA 3OYJA 1GVJA 3FHZA 3ZMSA 5E1WA 1OYYA 5AONA 2YSRA 2CWEA 4EJUA 4J01A 3D0SA 5CJ9A 3K70C 2DPUA 1VQ5I 2BY3A 3KLNA 1MDMA 1K78B 4EATA 1YW8A 5EEGA 4BJTA 1LUJB 1SVMA 2PMZN 4ENMA 1QRYA 3D1NI 2FD5A 2KDOA 2IA2A 1BW6A 1SFXA 2HFHA 5LEKA 4S05A 4PJNA 2R4GA 4PUSA 2IBDA 3UKGA 2MABA 2RN7A 2HWVA 1X4PA 1ZR2A 2DA3A 1FT9A 3ZMDA 5F0FA 1NTCA 3HTSB 1W5TA 4PFPA 4CSWA 2V6CA 3E3VA 1JKRC 1X3WB 5EGOB 1FOKA 2EK5A 4GCVA 4I76A 2FNAA 4HDVA 3GW2A 4A3KJ 2BGCA 3S93A 4Q5SF 4BQOA 2PX9A 1D5VA 2Y75A 3JSPA 1USSA 3RKQA 1YOVB 3GLXA 4HPQA 4IZZA 2VKHA 3A4CA 3BCBA 4ON0A 5C4XJ 2DOEA 1ZLJA 5EF6A 1HSTA 4A93J 4ENKA 2QUFA 3OYCA 4I0AA 4KJZA 2JK3A 2JT1A 1WI3A 4FTHA 4B1RA 1G3WA 3MN2A 2XB5A 5LGNA 4DIQA 1YI2I 1FLIA 2CH0A 2W84A 5HODA 4B4CA 3AAFA 4X6AJ 4BH9A 4LG0A 2I5UA 3SQNA 1LEBA 1E0EA 3P9KA 2LY2A 3M1EA 2ZJRF 5FRNA 1ZELA 5GP9A 2UXNA 4G6DA 1S3JA 2Y2ZA 2LVSA 1W36C 2KLOA 3G73A 3F0CA 4YIRX 1GV5A 4KUMA 1BI2A 1I5ZA 4KMUX 3OYAA 3K2AA 2ZB9A 4DJAA 3E5UA 3HB9A 3H3VK 4OAZA 2F4MB 4ESJA 2QF7A 3BQYA 3PQKA 2X1DA 4D9JA 4L18B 1ZQ3P 2HVQA 4XQFA 1JT0A 1E2XA 2ISYA 1A35A 1D0YA 1SVLA 5CVJA 2KRFA 2EZIA 3FBNB 4D7NA 4XKVA 3DEUA 4IKFA 2BVLA 1V55H 5FKKA 3R6SA 1VI0A 3WU0A 2Q1ZB 1K83J 2JUCA 2BXYA 2Y0SN 2E2HJ 1AU7A 3CUQB 1GV2A 1FBUA 2GXBA 2ZSHB 1I6XA 3T5XA 3GTJJ 1MMDA 2H8RA 1NG7A 1R5HA 1JKQC 1VNDA 2O61A 1TQMA 4BEHA 1K79A 1JTYA 2KISA 4I2OA 2M5WA 2ESHA 3JCUC 1I1GA 4D1QA 1MNMC 1QPMA 2D5VA 3GO5A 4I98B 3HSFA 3IKVA 1W0TA 4HLXA 4NC7A 1YX5A 1YJNI 3BZCA 4AD9A 2FOWA 2E1CA 4A3FJ 1UFMA 3OYBA 2ELJA 2HR3A 3I59B 5AIPA 1OCCH 3IL2A 3LSIA 1GXPA 4ZJZA 4B3XA 3BR5A 1XMKA 2KMUA 2VQHA 4A3LJ 4DZJA 1OCOH 2JA8J 3E5QA 2HYJA 3IUOA 2XUBA 2E2IJ 4P1WA 2R93J 2A61A 3MZ8A 3J80K 3FMRA 3H3UA 2DOFA 1O7FA 1JUMA 4A3GJ 3HTUA 4FE7A 3FKJA 2LRDA 1XSXA 2W82A 3S3MA 5FLXK 3ELKA 3NEUA 3Q0WA 4I99C 3S2WA 2AQFA 2VJ4A 4KMFA 3SZGA 4PGGA 1MMNA 1IGNA 3B6CA 3S2DJ 3VSLA 3AKZA 4IHYA 4RM3A 5L3DA 2I8DA 5IY5H 2YS9A 1UAAA 3D5SC 1X1DA 1G2HA 4BDZA 4PCQA 3GMEA 3LSRA 2Y69H 3F6VA 4A0YA 2ACJA 5L3EA 3GBGA 4BBRJ 4R1HA 1YW7A 2LD5A 1D5YA 3CC4I 3TKYA 3FK7A 1ZG5A 5K5RA 2BYVE 2WY7Q 2XKPA 2MD5A 5DUIA 2E34A 1XCVA 1P4AA 5IYDJ 4PGHA 3W2WA 5J1UA 1X2MA 3A2KA 3DBRB 3MKYB 3F8NA 4YEJA 4QWQA 1JGGA 1HKQA 2BOLA 1IUFA 3WGHA 3OYEA 2JUGA 4JX6A 3LA7A 1R58A 2P5VA 5TRDA 4BXXJ 4YFNF 4H0EA 1CF7B 3HOVJ 2JA7J 2CU7A 1BBYA 1IN8A 2E7XA 3R4KA 5CQGA 2QBYB 4HW0A 4M9XA 1P6RA 3RZDJ 1ZYRF 2AQEA 3S1MJ 4JX4A 4E7KA 2D2WA 4XKCA 1SFOJ 4GYGA 2GA1A 5JHUA 3DKYA 5J1RA 1R5GA 4EQQA 3BTCA 1IDYA 1IZ1A 3SDGA 5M5WJ 1Z77A 1BW5A 1T0FA 4Y13A 1I3QJ 3K0LA 3M7GA 3CUQC 1NK2P 2JMWA 2DK5A 1UZCA 4M3BA 1E3PA 3CCLI 2CQXA 3RPUD 2DYRH 1MDMB 4UY8I 3W2VA 3PUBA 3E6MA 2ESNA 5EDNA 4HRIA 5E20A 3ZQLA 1F9NA 2JRTA 2LP0A 4U87A 3QOEA 2HDDA 2WBMA 1S7OA 4WXCA 2WB1N 3DLAA 1WPKA 3EUKL 2ZFWA 5F08A 4FISA 4QIWN 4IHVA 1MH4A 2KRHA 2STWA 1FJLA 2NOGA 3IRRA 4Q4ZF 2E2JJ 2OQRA 1T6SA 2IJLA 3P9CA 4BQQA 2OPTA 1J75A 1ON1A 4XSZF 4L9TA 1WVRA 3ZQQA 3ZMTA 2EPFA 5EYRA 3V8KA 5L3FA 2DA2A 4BY7J 4ETSA 3I56I 2NVTJ 3RYRA 2HDWA 2WTEA 3BR6A 2GIVA 4UHTA 5TISC 3G4SI 2DMUA 4M3DA 1O3SA 4CICA 2K85A 2VLAA 1FYLA 2LSOA 3TL4X 4L5EA 2OQGA 1ZRFA 2MH9A 2R7TA 2DBBA 3FX3A 2WV0A 4Q47A 1QU3A 4N9IA 3WE2A 2EILH 2EFOA 2FSWA 2EV6A 4A3IJ 5GAHJ 1VTNC 3CMEI 3OIPA 2QKMB 3DU6A 4JP0A 4AYBN 3DKXA 3HIFA 3SYTA 4Y3OA 1VQ4I 2W85A 4IF4A 4I01A 4YFXF 4Q48A 4IVNA 3K4CA 1BC7C 3KP5A 1JUPA 1XTAA 4NC8A 4JYKA 3I4PA 2MSYA 2IGKA 4LG0B 4CGZA 4XLCA 1HC8A 3GX4X 5L3GA 1D3YA 1SMYF 3I4NJ 2UV1A 2OJED 2LR8A 3ZOBA 1S8NA 5IOYA 1VQPI 1QZEA 5IYCJ 4WWCA 3PFYA 5A2QZ 1W7PD 3M8EA 4ANJA 3OL4A 5E3NA 2K3PA 1WJFA 1OCZH 2W1OA 3ESWB 2EJRA
chains in the Genus database with same CATH topology
2EZLA 3A03A 2DA7A 3GTMJ 2L7ZA 3OSFA 3PO3J 1HDPA 1RESA 4A69C 2XPVA 5M3FJ 1TWHJ 3HEFA 2JWTA 1PUFA 1H89C 2NVXJ 1QVTA 4BBSJ 3CCYA 1TWFJ 1WH5A 5E3MA 2AO9A 2N8GA 1K61A 3S1RJ 1JT6A 1JTXA 1H8AC 3JRBA 3GTPJ 3JR9A 1IRZA 4XK4A 1U8BA 5FJ8J 1FTTA 2ECBA 3IH4A 5GPAA 4FE4A 2XPWA 1Q1VA 5FLVA 3H0GJ 2WV1A 4DYRA 3ZQGA 4A3MJ 4A3EJ 3CDLA 1MBFA 4V2GA 1Y1WJ 3SJMA 4DW6A 2R5ZA 3ZQHA 5BNGA 4LOCA 5C44J 5C3EJ 1ITYA 2JN6A 3JRHA 3IV5A 3FK6A 4DYCA 5F27A 1UHSA 2TRTA 4Y7NJ 3G1MA 3RQIA 1RKTA 2FQ4A 4A3JJ 3WHBA 2RAEA 1MH3A 1B72B 1W0UA 1NK3P 2DMPA 3O8GA 4CYCA 3S16J 1P7JA 2DMTA 1IC8A 2IEKA 3JRFA 1DU0A 1HCRA 3A01A 4M3GA 4AUXA 1TWCJ 2CRGA 3LNQA 1XS9A 5M5YJ 1O4XA 3I4MJ 1HDDC 2DA6A 3Q0UA 1I6HJ 4D7MA 4IHXA 3HOUJ 4UUSA 1RR7A 2X6OA 2Y30A 3BR0A 5J3LA 2NS8A 3ZQFA 2LKXA 4XIDA 3LSGA 4UUTA 5FKLA 5DTDA 1ETWA 2DA4A 2XGEA 1OCPA 3BQZA 3W6VA 3NARA 5IYBJ 1UMQA 1S7EA 2O7OA 1XG1A 4C3IJ 4QTRA 4AC0A 1ZKGA 2Y9YA 1OJLA 1GVDA 2CUEA 1MBKA 2R5YA 4J19A 5J1YA 3S15J 2HQ5A 1X2NA 3O8HA 2CQQA 4C3JJ 2VUMJ 2YUSA 2HXIA 1MBGA 5EZHA 1T33A 3ZQIA 2EZKA 3TEDA 1AHDP 1MBHA 1X58A 2PMZN 1QPIA 4BY1J 4D5CA 1QRYA 3D1NI 2FD5A 3DEWA 4RBOA 2DTZA 5K7FA 3HOWJ 4MFEA 1BW6A 3FISA 3S2HJ 4MO7A 2CUFA 1WGXA 2P81A 2IBDA 3UKGA 4V2FA 1AKHA 3NAUA 2MW8A 1Y1VJ 3DCFA 1LE8A 1ZR2A 2E1OA 2DA3A 2M9HA 5F0FA 1NTCA 1FTZA 3TP3A 2JJ7A 1IDZA 3RZOJ 3B6AA 2VKEA 1JKRC 5IP9J 5EGOB 1Z0XA 4I76A 1RKWA 1B8IB 4A3KJ 3BR3A 2EBIA 3C2BA 3CQZJ 1ORKA 3HOXJ 2K9QA 5M3MJ 3TW6A 3VPRA 3RKQA 1RPWA 1IJWC 5C4XJ 5F04A 1BL0A 4S0HB 1F36A 5EF6A 4A93J 2M8GX 1A6IA 3LOCA 2JK3A 1GDTA 1WI3A 4FTHA 1FEXA 4B1RA 1YRNA 3MN2A 2ELKA 2XB5A 1EF4A 5EG0A 2L9RA 1DU6A 4ABZA 3S17J 4M6VA 3S14J 3IH2A 5HODA 4B4CA 4X6AJ 1BA5A 2L7MP 2KT0A 1ZTRA 2VI6A 3IH3A 2NS7A 2G0EA 5GP9A 2ECCA 2HOAA 5FKNA 2Y2ZA 2LVSA 3GTOJ 1ZR4A 4BKXA 3F0CA 1MSEC 1GV5A 5K7ZA 5FLMJ 3K2AA 2ZB9A 2M34A 4D5FA 3BTIA 2HXOA 3HB9A 2MG4A 1E3OC 3H3VK 1ETYA 1TC3C 1JJ6C 2B63J 4G12A 1VF9A 3JREA 2QF7A 3BQYA 5EGOA 4C2MJ 2EH3A 1ZQ3P 1JT0A 2H1KA 2GM4A 1ETQA 1T56A 2EZIA 1ETXA 4D7NA 3HM5A 3JRDA 1VFCA 1MSFC 5FKKA 1HOMA 4M3FA 3QPSA 2NVYJ 5IP7J 1I50J 5E3LA 2VKVA 1XC5A 1VI0A 1A5JA 1K83J 2XGDA 4GFBA 2IAIA 2ME0A 2Y0SN 2E2HJ 2FX0A 5DS9A 1AU7A 1POGA 2XB0X 1GV2A 1UG2A 1R9TJ 3GTJJ 2HOSA 3M4OJ 1TWGJ 3M3YJ 1IV6A 2M0CA 2DJNA 2VPRA 2H8RA 1JKQC 1VNDA 2MGQA 5F0HA 1JTYA 1JKPC 3JRIA 1MNMC 2D5VA 4DYQA 1ETKA 5K7HA 1W0TA 3Q3SA 3BG9A 3PO2J 2LLKA 3QPLA 1GT0C 1CQTA 3BG5A 4A3FJ 2O9LA 1PUFB 1ENHA 5IP6A 2X9DA 3OOUA 3K7AJ 3TW7A 3JRAA 2XPUA 4XRSG 3BR5A 2ID3A 4A3LJ 4DZJA 1SANA 2COBA 2JA8J 5F1JA 2HYJA 4A3BJ 3OSGA 2NVQJ 4XRMA 2E2IJ 1B72A 2R93J 3HGGA 3BTJA 4A3CJ 3JRGA 4A3DJ 2GBYA 3G1LA 3L1PA 3S1QJ 1MBEA 4A3GJ 1JUMA 4FE7A 2K9NA 5C4JJ 1ZGWA 2K9SA 5GPCA 3Q0WA 3SFIA 1BJZA 1IGNA 3B6CA 3A02A 3BT9A 1H88C 3S2DJ 4IHYA 2TCTA 2YS9A 1JJ8C 5F0CA 1FIAA 3FKIJ 1G2HA 2R5ZB 4RDUA 2DA5A 3LSRA 2DN0A 3GBGA 4BBRJ 2DMNA 2LD5A 1LFBA 1D5YA 3FK7A 2R92J 2LFBA 2DMQA 5JLWA 1WCMJ 3HDDA 5IYDJ 3PM1A 1QVUA 3HKZN 5J1UA 3BTLA 4MLOA 3GTLJ 1X2MA 4CYCB 2AHQA 1LFUP 2R0QC 4B3AA 1JGGA 4MIMA 1IUFA 4QSHA 4JX6A 4W1UA 3A01B 4NDLA 4BXXJ 3HOVJ 2JA7J 2CU7A 4UUSB 3BG3A 1ETOA 3RZDJ 1ETVA 3S1MJ 4JX4A 1SFOJ 2XGCA 2K40A 3HGYA 5J1RA 3E7LA 5M5XJ 3BTCA 1IDYA 1FIPA 4XRSA 2JA6J 5FKOA 3SDGA 5M5WJ 1Z77A 1B8IA 1BW5A 2R5YB 4X1EA 2DA1A 4MFDA 1U78A 1I3QJ 1IG7A 4Y52J 3LSPA 1NK2P 2JMWA 1MBJA 3BR1A 9ANTA 4M3BA 4IHWA 2CQXA 2YU9J 2OF7A 4XICA 1TWAJ 2LTPA 5EDNA 1HF0A 3ZQLA 2LP0A 5IPAA 2LY9A 5JLXA 2HDDA 2WB1N 3MVPA 1WPKA 2L0KA 4JX5A 2HOTA 2GLOA 1OFCX 2Y9ZA 3S1NJ 5F08A 3GTQJ 4FISA 4QIWN 4IHVA 1MH4A 1RETA 3MKLA 3HOYJ 3ZQCA 1FJLA 2M2EA 2NOGA 4EEFG 2E2JJ 1AKHB 1OCTC 3G1OA 5E3OA 1JUSA 2QCOA 4C3HJ 2OPTA 1LE8B 2O8KA 2ID6A 1U9NA 3WHCA 1WH7A 2E19A 5EYRA 2DA2A 4BY7J 2NVTJ 3BR6A 2XRLA 2Y31A 2L7FP 2DMUA 4M3DA 1P7IA 4DZPA 3HBLA 4M3EA 4L5EA 1GUUA 2FJ1A 3Q0VA 5IOZA 3GTGJ 2HI3A 3OIOA 4A3IJ 2KDZA 3QQAA 3JRCA 3GTKJ 4JP0A 4AYBN 1YRNB 1U9OA 2JA5J 4I6ZA 1APLC 2CJJA 2R7ZJ 2XSDC 2LK2A 4HNVA 5EG0B 3FIWA 3BR2A 2WAQN 1JUPA 4JYKA 2MSYA 2W48A 3I4NJ 1JKOC 2LR8A 3ZOBA 5IOYA 4W97A 1ZK8A 2X48A 5IYCJ 2EQRA 3LSJA 4FCYA 1F43A 5E3NA 3CMYA 1HLVA 2ME6A 5EEAA 2I10A 5EZGA 3TP0A 2EZHA 3HOZJ 4IEJA 5FKMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EZL A;  3A03 A;  2DA7 A;  3GTM J;  2L7Z A;  3OSF A;  3PO3 J;  1HDP A;  1RES A;  4A69 C;  2XPV A;  5M3F J;  1TWH J;  3HEF A;  2JWT A;  1PUF A;  1H89 C;  2NVX J;  1QVT A;  4BBS J;  3CCY A;  1TWF J;  1WH5 A;  5E3M A;  2AO9 A;  2N8G A;  1K61 A;  3S1R J;  1JT6 A;  1JTX A;  1H8A C;  3JRB A;  3GTP J;  3JR9 A;  1IRZ A;  4XK4 A;  1U8B A;  5FJ8 J;  1FTT A;  2ECB A;  3IH4 A;  5GPA A;  4FE4 A;  2XPW A;  1Q1V A;  5FLV A;  3H0G J;  2WV1 A;  4DYR A;  3ZQG A;  4A3M J;  4A3E J;  3CDL A;  1MBF A;  4V2G A;  1Y1W J;  3SJM A;  4DW6 A;  2R5Z A;  3ZQH A;  5BNG A;  4LOC A;  5C44 J;  5C3E J;  1ITY A;  2JN6 A;  3JRH A;  3IV5 A;  3FK6 A;  4DYC A;  5F27 A;  1UHS A;  2TRT A;  4Y7N J;  3G1M A;  3RQI A;  1RKT A;  2FQ4 A;  4A3J J;  3WHB A;  2RAE A;  1MH3 A;  1B72 B;  1W0U A;  1NK3 P;  2DMP A;  3O8G A;  4CYC A;  3S16 J;  1P7J A;  2DMT A;  1IC8 A;  2IEK A;  3JRF A;  1DU0 A;  1HCR A;  3A01 A;  4M3G A;  4AUX A;  1TWC J;  2CRG A;  3LNQ A;  1XS9 A;  5M5Y J;  1O4X A;  3I4M J;  1HDD C;  2DA6 A;  3Q0U A;  1I6H J;  4D7M A;  4IHX A;  3HOU J;  4UUS A;  1RR7 A;  2X6O A;  2Y30 A;  3BR0 A;  5J3L A;  2NS8 A;  3ZQF A;  2LKX A;  4XID A;  3LSG A;  4UUT A;  5FKL A;  5DTD A;  1ETW A;  2DA4 A;  2XGE A;  1OCP A;  3BQZ A;  3W6V A;  3NAR A;  5IYB J;  1UMQ A;  1S7E A;  2O7O A;  1XG1 A;  4C3I J;  4QTR A;  4AC0 A;  1ZKG A;  2Y9Y A;  1OJL A;  1GVD A;  2CUE A;  1MBK A;  2R5Y A;  4J19 A;  5J1Y A;  3S15 J;  2HQ5 A;  1X2N A;  3O8H A;  2CQQ A;  4C3J J;  2VUM J;  2YUS A;  2HXI A;  1MBG A;  5EZH A;  1T33 A;  3ZQI A;  2EZK A;  3TED A;  1AHD P;  1MBH A;  1X58 A;  2PMZ N;  1QPI A;  4BY1 J;  4D5C A;  1QRY A;  3D1N I;  2FD5 A;  3DEW A;  4RBO A;  2DTZ A;  5K7F A;  3HOW J;  4MFE A;  1BW6 A;  3FIS A;  3S2H J;  4MO7 A;  2CUF A;  1WGX A;  2P81 A;  2IBD A;  3UKG A;  4V2F A;  1AKH A;  3NAU A;  2MW8 A;  1Y1V J;  3DCF A;  1LE8 A;  1ZR2 A;  2E1O A;  2DA3 A;  2M9H A;  5F0F A;  1NTC A;  1FTZ A;  3TP3 A;  2JJ7 A;  1IDZ A;  3RZO J;  3B6A A;  2VKE A;  1JKR C;  5IP9 J;  5EGO B;  1Z0X A;  4I76 A;  1RKW A;  1B8I B;  4A3K J;  3BR3 A;  2EBI A;  3C2B A;  3CQZ J;  1ORK A;  3HOX J;  2K9Q A;  5M3M J;  3TW6 A;  3VPR A;  3RKQ A;  1RPW A;  1IJW C;  5C4X J;  5F04 A;  1BL0 A;  4S0H B;  1F36 A;  5EF6 A;  4A93 J;  2M8G X;  1A6I A;  3LOC A;  2JK3 A;  1GDT A;  1WI3 A;  4FTH A;  1FEX A;  4B1R A;  1YRN A;  3MN2 A;  2ELK A;  2XB5 A;  1EF4 A;  5EG0 A;  2L9R A;  1DU6 A;  4ABZ A;  3S17 J;  4M6V A;  3S14 J;  3IH2 A;  5HOD A;  4B4C A;  4X6A J;  1BA5 A;  2L7M P;  2KT0 A;  1ZTR A;  2VI6 A;  3IH3 A;  2NS7 A;  2G0E A;  5GP9 A;  2ECC A;  2HOA A;  5FKN A;  2Y2Z A;  2LVS A;  3GTO J;  1ZR4 A;  4BKX A;  3F0C A;  1MSE C;  1GV5 A;  5K7Z A;  5FLM J;  3K2A A;  2ZB9 A;  2M34 A;  4D5F A;  3BTI A;  2HXO A;  3HB9 A;  2MG4 A;  1E3O C;  3H3V K;  1ETY A;  1TC3 C;  1JJ6 C;  2B63 J;  4G12 A;  1VF9 A;  3JRE A;  2QF7 A;  3BQY A;  5EGO A;  4C2M J;  2EH3 A;  1ZQ3 P;  1JT0 A;  2H1K A;  2GM4 A;  1ETQ A;  1T56 A;  2EZI A;  1ETX A;  4D7N A;  3HM5 A;  3JRD A;  1VFC A;  1MSF C;  5FKK A;  1HOM A;  4M3F A;  3QPS A;  2NVY J;  5IP7 J;  1I50 J;  5E3L A;  2VKV A;  1XC5 A;  1VI0 A;  1A5J A;  1K83 J;  2XGD A;  4GFB A;  2IAI A;  2ME0 A;  2Y0S N;  2E2H J;  2FX0 A;  5DS9 A;  1AU7 A;  1POG A;  2XB0 X;  1GV2 A;  1UG2 A;  1R9T J;  3GTJ J;  2HOS A;  3M4O J;  1TWG J;  3M3Y J;  1IV6 A;  2M0C A;  2DJN A;  2VPR A;  2H8R A;  1JKQ C;  1VND A;  2MGQ A;  5F0H A;  1JTY A;  1JKP C;  3JRI A;  1MNM C;  2D5V A;  4DYQ A;  1ETK A;  5K7H A;  1W0T A;  3Q3S A;  3BG9 A;  3PO2 J;  2LLK A;  3QPL A;  1GT0 C;  1CQT A;  3BG5 A;  4A3F J;  2O9L A;  1PUF B;  1ENH A;  5IP6 A;  2X9D A;  3OOU A;  3K7A J;  3TW7 A;  3JRA A;  2XPU A;  4XRS G;  3BR5 A;  2ID3 A;  4A3L J;  4DZJ A;  1SAN A;  2COB A;  2JA8 J;  5F1J A;  2HYJ A;  4A3B J;  3OSG A;  2NVQ J;  4XRM A;  2E2I J;  1B72 A;  2R93 J;  3HGG A;  3BTJ A;  4A3C J;  3JRG A;  4A3D J;  2GBY A;  3G1L A;  3L1P A;  3S1Q J;  1MBE A;  4A3G J;  1JUM A;  4FE7 A;  2K9N A;  5C4J J;  1ZGW A;  2K9S A;  5GPC A;  3Q0W A;  3SFI A;  1BJZ A;  1IGN A;  3B6C A;  3A02 A;  3BT9 A;  1H88 C;  3S2D J;  4IHY A;  2TCT A;  2YS9 A;  1JJ8 C;  5F0C A;  1FIA A;  3FKI J;  1G2H A;  2R5Z B;  4RDU A;  2DA5 A;  3LSR A;  2DN0 A;  3GBG A;  4BBR J;  2DMN A;  2LD5 A;  1LFB A;  1D5Y A;  3FK7 A;  2R92 J;  2LFB A;  2DMQ A;  5JLW A;  1WCM J;  3HDD A;  5IYD J;  3PM1 A;  1QVU A;  3HKZ N;  5J1U A;  3BTL A;  4MLO A;  3GTL J;  1X2M A;  4CYC B;  2AHQ A;  1LFU P;  2R0Q C;  4B3A A;  1JGG A;  4MIM A;  1IUF A;  4QSH A;  4JX6 A;  4W1U A;  3A01 B;  4NDL A;  4BXX J;  3HOV J;  2JA7 J;  2CU7 A;  4UUS B;  3BG3 A;  1ETO A;  3RZD J;  1ETV A;  3S1M J;  4JX4 A;  1SFO J;  2XGC A;  2K40 A;  3HGY A;  5J1R A;  3E7L A;  5M5X J;  3BTC A;  1IDY A;  1FIP A;  4XRS A;  2JA6 J;  5FKO A;  3SDG A;  5M5W J;  1Z77 A;  1B8I A;  1BW5 A;  2R5Y B;  4X1E A;  2DA1 A;  4MFD A;  1U78 A;  1I3Q J;  1IG7 A;  4Y52 J;  3LSP A;  1NK2 P;  2JMW A;  1MBJ A;  3BR1 A;  9ANT A;  4M3B A;  4IHW A;  2CQX A;  2YU9 J;  2OF7 A;  4XIC A;  1TWA J;  2LTP A;  5EDN A;  1HF0 A;  3ZQL A;  2LP0 A;  5IPA A;  2LY9 A;  5JLX A;  2HDD A;  2WB1 N;  3MVP A;  1WPK A;  2L0K A;  4JX5 A;  2HOT A;  2GLO A;  1OFC X;  2Y9Z A;  3S1N J;  5F08 A;  3GTQ J;  4FIS A;  4QIW N;  4IHV A;  1MH4 A;  1RET A;  3MKL A;  3HOY J;  3ZQC A;  1FJL A;  2M2E A;  2NOG A;  4EEF G;  2E2J J;  1AKH B;  1OCT C;  3G1O A;  5E3O A;  1JUS A;  2QCO A;  4C3H J;  2OPT A;  1LE8 B;  2O8K A;  2ID6 A;  1U9N A;  3WHC A;  1WH7 A;  2E19 A;  5EYR A;  2DA2 A;  4BY7 J;  2NVT J;  3BR6 A;  2XRL A;  2Y31 A;  2L7F P;  2DMU A;  4M3D A;  1P7I A;  4DZP A;  3HBL A;  4M3E A;  4L5E A;  1GUU A;  2FJ1 A;  3Q0V A;  5IOZ A;  3GTG J;  2HI3 A;  3OIO A;  4A3I J;  2KDZ A;  3QQA A;  3JRC A;  3GTK J;  4JP0 A;  4AYB N;  1YRN B;  1U9O A;  2JA5 J;  4I6Z A;  1APL C;  2CJJ A;  2R7Z J;  2XSD C;  2LK2 A;  4HNV A;  5EG0 B;  3FIW A;  3BR2 A;  2WAQ N;  1JUP A;  4JYK A;  2MSY A;  2W48 A;  3I4N J;  1JKO C;  2LR8 A;  3ZOB A;  5IOY A;  4W97 A;  1ZK8 A;  2X48 A;  5IYC J;  2EQR A;  3LSJ A;  4FCY A;  1F43 A;  5E3N A;  3CMY A;  1HLV A;  2ME6 A;  5EEA A;  2I10 A;  5EZG A;  3TP0 A;  2EZH A;  3HOZ J;  4IEJ A;  5FKM A; 
#chains in the Genus database with same CATH topology
 3K70 D;  1U0J A;  2EZL A;  3A03 A;  3BJA A;  2DA7 A;  3CMA I;  2L7Z A;  3GTM J;  3R0J A;  4A2U A;  1Y56 A;  4PFO A;  1YG2 A;  1ERD A;  1PVE A;  4ESB A;  1BI0 A;  2X6Y A;  2YU3 A;  3CCJ I;  4ESF A;  1PUF A;  1QVT A;  3CCY A;  5DD4 A;  2VE8 A;  4OMY A;  1KQ8 A;  2EA4 A;  3L2R A;  1WJD A;  1TWF J;  1VQ9 I;  5J4Y A;  2N8G A;  3CTA A;  3TOA A;  1K61 A;  1JTX A;  4II2 A;  3AG2 H;  3OYK A;  4HQM A;  4IX7 A;  3QU6 A;  2E60 A;  3CUO A;  5D6F A;  1M1E B;  2ECB A;  2W25 A;  3D5L A;  4XM3 A;  3E0J B;  3IH4 A;  5GPA A;  4J00 A;  4FE4 A;  2XPW A;  1Q1V A;  4BEH B;  3TDU C;  3H0G J;  2WV1 A;  4NBQ A;  4A3M J;  3ZN0 A;  1SC7 A;  1FYK A;  3CJR B;  5JI6 A;  2EIM H;  1DQU A;  3ZGK A;  4KT6 A;  2HU9 A;  2VBW A;  2KFD A;  3DBH B;  2GZW A;  4LFU A;  4HQE A;  1Y1W J;  3IC7 A;  2R5Z A;  3ZQH A;  1HSJ A;  1HW2 A;  3OS0 A;  2V6E A;  1D8J A;  1FZP B;  2CQ7 A;  2F5F A;  5C44 J;  2PMZ A;  1ITY A;  2JN6 A;  3JRH A;  5ED4 A;  3FHN A;  3ML6 A;  5E79 C;  3C2H A;  4DYC A;  4HF0 A;  1YJ9 I;  4Y7N J;  3S32 A;  4FAS D;  3G1M A;  2WAD A;  2HZD A;  3RQI A;  1FBS A;  4KIT B;  2LY1 A;  2VQL A;  1RUN A;  1NK3 P;  2DMP A;  5EEH A;  3BLY A;  3S16 J;  1VQ8 I;  2X0L A;  2HPI A;  2IA1 A;  1KU3 A;  3RDI A;  5GAE J;  4YRV A;  1VQO I;  4XON A;  2DQR A;  3I58 A;  3A01 A;  4M3G A;  1W36 D;  2ZBK A;  4RAZ A;  1LQ1 A;  1O4X A;  4BXU A;  2A68 F;  1PUE E;  2FQ3 A;  4XRF A;  1FMW A;  3GZ5 A;  2QQ9 A;  5TJJ A;  2ZNZ A;  4IHX A;  1FOX A;  2DU9 A;  2ETH A;  3ZQF A;  2LKX A;  4Z6Y A;  3LSG A;  4UUT A;  1X1A A;  4AVP A;  1ZG1 A;  1ETW A;  1I3A A;  1OCP A;  3FXK A;  2ZJP F;  3H92 A;  5GTH C;  3W6V A;  5FD5 A;  2L3D A;  1VZ0 A;  2HOE A;  3WE3 A;  4IO9 F;  4I7H A;  3BJO A;  1OJL A;  1GVD A;  3IKT A;  2CUE A;  1H9G A;  1ZRC A;  5LGT A;  4CH7 A;  5KHD A;  3CCR I;  3MEX A;  2JZY A;  2UUZ A;  3S15 J;  1X3Z B;  2E1M C;  5FRM A;  3OYF A;  3LQR A;  4IXA A;  3TMO A;  2YUS A;  1KQ9 A;  2HXI A;  2RNG A;  2YX4 A;  1UHM A;  3TO7 A;  2OTL I;  3Q9S A;  2L54 A;  2A6H F;  2E1N A;  2M7A A;  2BXZ A;  2ZFU A;  3TBI A;  2ZME A;  1F4K A;  2ADU A;  2EZK A;  1AHD P;  1MBH A;  1QPI A;  4BY1 J;  2M45 A;  1HA8 A;  2R7U A;  5ICG A;  1YS6 A;  3DEW A;  3KLO A;  3GUD A;  2AXT C;  3I5U A;  1R7J A;  3FIS A;  2CUJ A;  2HYF A;  1W5C C;  2VKD A;  4MO7 A;  3EYI A;  2CUF A;  1WGX A;  3FXM A;  3RTR A;  1XDS A;  3L9F A;  4V2F A;  4EGY A;  1Y1V J;  3I53 A;  2XDV A;  2EV5 A;  2E1O A;  2KKO A;  5BS6 A;  4BGD A;  2M9H A;  4ZDL A;  2VOP A;  1FTZ A;  1O3Q A;  4U7B A;  5FLX Z;  4HYE A;  2VKE A;  5IP9 J;  2IRF G;  2IT0 A;  5KCM A;  4IHS A;  1B9N A;  3M07 A;  3FBI B;  3PQJ A;  3RYP A;  5CVU A;  3C2B A;  2DK8 A;  3LST A;  2K5C A;  4MEX F;  1DUX C;  3J7A O;  2HTS A;  5M3M J;  1E17 A;  3TW6 A;  2W7N A;  1IJW C;  1H0M A;  1ONV A;  1BL0 A;  4LLN A;  4CYD A;  1F36 A;  2ELH A;  3K10 A;  2M8G X;  5E8G A;  1A6I A;  1ODD A;  3U1D A;  3LOC A;  4OOI A;  3H1C A;  1ZG3 A;  1U6G A;  5EG0 A;  2L9R A;  2XHK A;  4FHT A;  1DU6 A;  1ULY A;  4M6V A;  3CCS I;  2XRO A;  1BM9 A;  2L7M P;  2D1V A;  1BR1 A;  1W4M A;  1HKS A;  3DP7 A;  2QVO A;  2VI6 A;  1IXS B;  3PNV A;  3D5R C;  3DTK A;  3TOB A;  2JPC A;  4KDP A;  4OWR B;  5LBQ A;  1EV7 A;  3U21 A;  1KON A;  2IGN A;  3SZP A;  1QA6 A;  3DBL B;  1SVO A;  3DEE A;  4G7O F;  1GHC A;  5FLM J;  1O3R A;  1QNT A;  1A6Q A;  3HPH A;  4KIS A;  2DT5 A;  3BTI A;  1YIT I;  4LD5 A;  4L5I A;  1E3O C;  2KIQ A;  1TC3 C;  3I0T A;  3LFU A;  1VF9 A;  5F64 A;  4IRH A;  1R22 A;  5JVT A;  2GM4 A;  3CJQ B;  4F7Z A;  1ETX A;  4F55 A;  3H0D A;  3L2Q A;  5LFA A;  3IP4 B;  1JI8 A;  2VT3 A;  2W4S A;  3HM5 A;  2ZJ2 A;  4UB6 C;  1MSF C;  4P96 A;  2FNP A;  4IL6 C;  3EYY A;  2L02 A;  1HOM A;  2KHM A;  3OYI A;  1XC5 A;  4HNT A;  4GFB A;  4M6X A;  5DS9 A;  4C9Y A;  2PMU A;  1UG2 A;  4NQW A;  1TWG J;  1G59 A;  1R1U A;  3M3Y J;  1Y39 A;  2VPR A;  3OMY A;  4GO1 A;  4CZZ A;  2UZK A;  2MGQ A;  1YE9 A;  4XLN F;  2HVS A;  2P5K A;  1ETK A;  2L4A A;  5K7H A;  3GFL A;  2Z99 A;  4QLC U;  4V19 K;  3PO2 J;  3FMQ A;  4IRI A;  4XOT A;  1CQT A;  4G9Y A;  2O9L A;  3DPT A;  3OYG A;  5GAD J;  4A5N A;  1PUF B;  3RKW A;  1T08 B;  2AS5 F;  2VOO A;  3WOD F;  2EV0 A;  2XPU A;  4XRS G;  4S04 A;  2ZXW H;  2ID3 A;  2LH9 A;  1R1V A;  2QQB A;  4EVI A;  2VN2 A;  2LNB A;  3G2B A;  3ZRG A;  5A2Q K;  2ISZ A;  4G6Q A;  1IN4 A;  1FMV A;  3BTJ A;  3RPQ A;  3G1L A;  2F5D A;  3S1Q J;  3GLL A;  3DPU A;  1FSE A;  2CS3 A;  1T0F C;  5F6F A;  2NNN A;  3F8F A;  2K9N A;  4M74 A;  4U0W A;  5C4J J;  1ZGW A;  5D8L B;  3SFI A;  2L2O A;  1PYV A;  3K2Z A;  5J6X A;  3BT9 A;  3SHF A;  3CD6 I;  4O6J A;  2A6E F;  2IXS A;  2TCT A;  2Y0M A;  4KT5 C;  4E7L A;  1I1S A;  4A0X A;  2KIF A;  5D8K B;  1JJ8 C;  1FIA A;  2HYG D;  4XOP A;  2OD5 A;  1SAX A;  2R5Z B;  2CYY A;  4RDU A;  3REO A;  3UR3 C;  3MZY A;  4YG2 F;  3NRV A;  2VIX A;  2DT7 B;  2R7V A;  2DN0 A;  3VYR B;  2WB1 A;  1XD7 A;  5DCM A;  3C2G A;  2DCE A;  3TO6 A;  1N25 A;  5DV5 A;  1Z21 A;  1J9I A;  1XGO A;  3JTG A;  4JBA A;  2GOM A;  2WAF A;  4UV9 A;  1QVU A;  3HKZ N;  5K5O A;  3GTL J;  4LGW A;  2EFP A;  1TBX A;  5EJC A;  5CQE A;  4CO8 A;  1U8R A;  4B3A A;  1MW7 A;  3LQQ A;  3SDB A;  1R6R A;  4MIM A;  4LB5 A;  1Y0N A;  5L3B A;  4QSH A;  2K02 A;  4UVB A;  3A01 B;  1TNS A;  4ZYD A;  1STZ A;  4F52 A;  4AIH A;  3KEO A;  3BPX A;  4HEA 2;  4F3Q A;  1R71 A;  3RJP A;  4AU7 A;  3HJE A;  2L5Q A;  1PDN C;  1TNT A;  4ZZL A;  2K40 A;  2A6T A;  5JFR A;  3K1N A;  3F22 A;  1B1B A;  1IW7 F;  4AYB A;  4UUV A;  2DDA A;  1GXQ A;  3V42 A;  4CCJ A;  3WTV C;  4MFD A;  1DPU A;  3H9Q A;  1IG7 A;  1U5T A;  4BS9 A;  4Y52 J;  3QYE A;  4U0Y A;  2OA4 A;  2R7W A;  2WWY A;  1SMT A;  3H5R A;  3I55 I;  4IHW A;  2NS0 A;  2XRN A;  2YU9 J;  1ZRE A;  3BP8 A;  2ZME B;  2MLK A;  1D1B A;  5JLX A;  3WU2 C;  4KA4 A;  1XX5 A;  2HOT A;  4DBQ A;  4BU2 A;  2VAS A;  3S1N J;  5BQT A;  3CC7 I;  3GTQ J;  3MZH A;  1HW1 A;  1RET A;  2WA0 A;  3MKL A;  2VQC A;  2M2E A;  5HS8 A;  3CCM I;  4EEF G;  1AA7 A;  3G1O A;  5D5U B;  5E3O A;  1LNW A;  2BE5 F;  2V9P A;  3IWZ A;  4CA0 A;  3WHC A;  3GCM A;  1Y8Q B;  2R7Q A;  4UVA A;  4HSR A;  5LEJ A;  2P7C B;  2Y31 A;  2VJ5 A;  3KYL A;  4OMZ A;  5GTI C;  3W3C A;  1YJW I;  1K4T A;  1S7A A;  3CZ6 A;  1HXD A;  1GUU A;  2P6T A;  2CFO A;  1MMA A;  3WGI A;  1WRJ A;  3LAP A;  2HVR A;  3T8T A;  1TW2 A;  3V8J A;  3A1Y A;  2ICW G;  2CG4 A;  1EH7 A;  3SXY A;  3JRC A;  3UNG C;  1W5S A;  1Z91 A;  4RAF A;  5BPI A;  1TQP A;  5GAG J;  2R7Z J;  4LLG F;  4I6Z A;  2CJJ A;  1APL C;  2XSD C;  4M6Y A;  5EG0 B;  3VYU B;  2PN6 A;  2VL8 A;  2YPR A;  3HRS A;  2IS6 A;  1JKO C;  3T0Y A;  3AFH A;  5HOO A;  3Q5F A;  3QP5 A;  2LYC A;  4L9J A;  3VB2 A;  2XAQ A;  1HLV A;  4RGR A;  3N05 A;  4JOM A;  1KU9 A;  2JTV A;  3HL2 A;  3TP0 A;  4HV6 A;  4LJZ F;  3OS2 A;  3N97 A;  1WJA A;  3GZ6 A;  3HC7 A;  2FML A;  1Z6R A;  5HS9 A;  3PO3 J;  2E5N A;  1HDP A;  3ASO H;  4JK1 X;  2XPV A;  3HEF A;  4C2U A;  1YLF A;  2JWT A;  1B4A A;  1H89 C;  3OWT A;  2CW8 A;  1NG6 A;  2FA5 A;  1IRG A;  2XF5 A;  4KN7 X;  3LSK A;  4G94 A;  2OZU A;  1WH5 A;  3EUH A;  4O5V A;  1FYM A;  1W1W E;  2HPM A;  3ABU A;  3S1R J;  1H8A C;  3S3N A;  2LRE A;  1RI7 A;  3GTP J;  2Q2E B;  5B66 C;  3JR9 A;  4XK4 A;  1BR4 A;  2HQA A;  4HV5 A;  3HOT A;  1U8B A;  3VYT B;  4NQW B;  2GQQ A;  1FTT A;  2DDB A;  1G3Y A;  1AWC A;  1YW9 A;  2J5P A;  3F3X A;  4P9U A;  2V1D A;  1X1C A;  2LC2 A;  2LG4 A;  2QA4 I;  1X1P A;  1OIS A;  4DYR A;  1BI3 A;  4A3E J;  3OR1 C;  1MJA A;  2CFX A;  2W00 A;  1J7K A;  3EET A;  4DW6 A;  5ICC A;  4IHT A;  1Z7U A;  1TT0 A;  3V7R A;  1R23 A;  4XMY A;  1SAU A;  2Z33 A;  4HF1 A;  1HBX G;  3E6D A;  1OKR A;  3A0B C;  4RB3 C;  5E8I A;  3W6K B;  1V54 H;  2F48 A;  1UHS A;  1UJ8 A;  2F2E A;  5L3C A;  2A5W A;  4HOB A;  5LRS A;  2V1U A;  1DPR A;  5ILU A;  2FQ4 A;  5KAF C;  3TGN A;  4A3J J;  1XPX A;  1MH3 A;  3KP7 A;  1W0U A;  1UB9 A;  2H1L A;  4BNC A;  5DM6 F;  3ZMZ A;  4CYC A;  2V79 A;  1KYZ A;  1FOY A;  1J2X A;  1MZB A;  4LB6 B;  1O57 A;  2DMT A;  3VSK A;  4AWX B;  4HA8 A;  1IC8 A;  2IEK A;  1DU0 A;  1MIJ A;  3V8L A;  4E6K G;  4AUX A;  2HGC A;  2CRG A;  4FT8 A;  1OMI A;  1LVA A;  4AM3 A;  4MQV A;  3HG9 A;  3P7N A;  4D7M A;  2Q8K A;  4UUS A;  2K4B A;  3BR0 A;  2RRE A;  1JHH A;  4NHJ A;  2JPB A;  3DXJ F;  2QKL B;  1K4S A;  2DAO A;  5CKT A;  2LF7 A;  2GXG A;  3BQZ A;  4C30 A;  2HKX A;  1UMQ A;  1IN7 A;  2HZT A;  2IP2 A;  4KIG A;  1N77 A;  4AC0 A;  2Y9Y A;  4UVC A;  5DCM B;  3WG7 H;  2QLZ A;  3CJT B;  4OIP F;  1YYV A;  4J19 A;  1XB4 A;  2ZXI A;  2RDP A;  2FBH A;  3ZXS A;  2XAF A;  4O3M A;  2HQ5 A;  2X1C A;  1BIA A;  1X2N A;  2P0W A;  2CQQ A;  4EM1 A;  3AG4 H;  4C3J J;  3VFZ A;  2VUM J;  3LWF A;  1MBG A;  4L0Y B;  2R7S A;  1T33 A;  4II3 A;  3OYH A;  5FGM A;  1XGS A;  4E7S A;  3TED A;  3PIO F;  4BQA A;  1PP8 F;  1B6A A;  4RAY A;  1AOY A;  3QOP A;  2XAG A;  4MFE A;  1G3S A;  3FXR A;  4H4K C;  3K4N A;  4EV0 A;  5J4V A;  1P4X A;  1EA3 A;  5HLI A;  2VE9 A;  1FOW A;  3Q9V A;  1IXC A;  3ZMU A;  1AKH A;  2MW8 A;  3DCF A;  1NHA A;  4P5O A;  5B1A H;  2Z1D A;  4E7I A;  4OIQ F;  2JQ7 A;  3A0H C;  5LGU A;  2X6W A;  1VQ6 I;  1S72 I;  3TP3 A;  2JJ7 A;  1IDZ A;  3B6A A;  5ERI A;  4A5M A;  3J7A Y;  1KU2 A;  3ABM H;  2R7D A;  3M9A A;  1Z0X A;  4WCG A;  1IXR C;  1VQ7 I;  1OYI A;  4KYW A;  1RKW A;  1O3T A;  4MHG A;  2V9V A;  2DJI A;  5D6E A;  3ECH A;  1U5T B;  2EBI A;  2QQA A;  2ZC2 A;  1SD4 A;  3HOX J;  2K9Q A;  3L00 A;  1U3E M;  2GAU A;  3VPR A;  2Q0O A;  4FQG A;  5J40 A;  4MNU A;  2B7E A;  4S0H B;  3F21 A;  4BE0 A;  2PJR A;  3KP3 A;  1K7A A;  2GOX B;  3KX2 A;  4ZDO A;  4PSW A;  2G9W A;  2R7X A;  1FEX A;  5H6R A;  4F91 B;  1YRN A;  2ELK A;  5IT3 A;  3BJ6 A;  4RB2 C;  4E7J A;  4ABZ A;  3S17 J;  2XSJ C;  5HNH A;  2VT2 A;  4A6D A;  4NUB A;  1BIB A;  2QYO A;  2X1E A;  3OYD A;  1LKX A;  5LHG A;  1DP3 A;  2MC3 A;  5LRR A;  2CV1 A;  2ECC A;  2HOA A;  4LLL A;  1FWZ A;  4RA2 A;  2RVC A;  2M7B A;  2VBX A;  1ZR4 A;  4BKX A;  1SD7 A;  2CW7 A;  2OTJ I;  2M34 A;  1ACI A;  2Z2S B;  3NQO A;  2QEX I;  1R4M B;  3K1M A;  1JJ6 C;  3H9G A;  3PL8 A;  1K6O A;  5KK1 A;  4PZJ A;  3JRE A;  4EJV A;  4BDY A;  2M4K A;  5EGO A;  1O7L A;  4C2M J;  2EH3 A;  2KIU A;  5KNL A;  1S5L C;  2VBZ A;  3TO9 A;  3DQV C;  4UXN A;  2K9M A;  4P55 A;  3CCU I;  2V9K A;  4DGW B;  4A6E A;  2F5V A;  4L9N A;  5HDG A;  1IO2 A;  4PJJ A;  4LMY A;  2HDC A;  1XSV A;  5DYM A;  3GZN B;  4BJ5 C;  3CO6 C;  1Z05 A;  5DD8 A;  1I50 J;  4G7Z F;  1TLH B;  5DCF A;  2DQL A;  2D45 A;  2ME0 A;  2PJP A;  4QPO A;  4EJO A;  3LAJ A;  1R49 A;  2XB0 X;  1OYW A;  1J59 A;  3AL0 B;  3LMM A;  2H94 A;  2OCE A;  2QGU A;  1Z9C A;  3M4O J;  2DJN A;  3PUF A;  2FUG 2;  2VON A;  4BHC A;  2F6C A;  4BE2 A;  4U0V A;  2MFZ A;  5F0H A;  1S6L A;  2KIM A;  2R3S A;  3GEZ A;  3G71 I;  1ZHF A;  3RI4 A;  4M9Z A;  3HKZ A;  3Q3S A;  3BG9 A;  4E4H A;  4G7H F;  4FET A;  1SFU A;  3QPL A;  3IAS 2;  3BG7 A;  4B47 A;  3QPH A;  1ENH A;  5IP6 A;  4LK0 F;  2X9D A;  3P5J A;  3TW7 A;  1A31 A;  3L2V A;  1SAN A;  2XAS A;  2QM3 A;  3F8C A;  5F1J A;  5K5Q A;  1HKT A;  1IF1 A;  2DT6 A;  3OSG A;  1B72 A;  3E6C C;  4B48 A;  3HGG A;  4A3D J;  2GBY A;  4BHB A;  3L1P A;  4M9S A;  3KET A;  1MBE A;  3QYF A;  4HLY A;  2M87 A;  5H20 A;  1U5T C;  5FD6 A;  2IGM A;  4XNF A;  3ZPL A;  5GPC A;  2DW4 A;  4KIC A;  1XMA A;  4DBR A;  3J81 Z;  2HS5 A;  2O0Y A;  1DGR M;  3VWB A;  1H88 C;  1FBQ A;  3I9V 2;  3E97 A;  5F0C A;  3VYS B;  2XKO A;  1MGT A;  2CMP A;  2OV7 A;  4QPQ A;  2BVM A;  3NWS A;  3ECO A;  2RGV A;  2EFW A;  2DMN A;  3K6G A;  1LFB A;  4HX8 A;  4CHU A;  2LFB A;  2DMQ A;  5JLW A;  3HDD A;  5LLQ A;  3RKY A;  2KPM A;  4ENJ A;  1OR7 A;  4CCM A;  1EKE A;  3JSO A;  3O6B B;  2V4J C;  3BTL A;  4MLO A;  4NB5 A;  1QHH D;  1ZAO A;  5ILS A;  4E7H A;  3HUG A;  4CYC B;  2AHQ A;  3I59 A;  4KIB A;  1ON2 A;  5FO5 A;  1LFU P;  2R0Q C;  2BHZ A;  1PJR A;  2NAZ A;  4MEY F;  1MD0 A;  5E18 F;  2ZXH A;  4W1U A;  4NDL A;  2X6X A;  3BG6 A;  2H09 A;  1LEA A;  3MD2 A;  3ZQ7 A;  4FX0 A;  1QHG A;  3WTX C;  2E35 A;  2VOD A;  3QYB A;  3MCZ A;  2BZT A;  4BAC A;  2XAH A;  3BG3 A;  4UUS B;  1P2F A;  1ETO A;  3R0A A;  2DLL A;  2XGC A;  1UEL B;  2NNY A;  4ZYA A;  4YIF A;  1KGS A;  3DV8 A;  3HGY A;  4DQ2 A;  3E7L A;  2K27 A;  1RR8 C;  5M5X J;  1MMS A;  1EH8 A;  4RGS A;  2JA6 J;  1P9Q C;  2P6S A;  1B8I A;  3KEQ A;  2NYX A;  4X1E A;  1U78 A;  4ZDP A;  3C3W A;  3K4M A;  3KCC A;  3LSP A;  1R4N B;  1XGN A;  1MBJ A;  1ZN2 A;  2DFE A;  5D5W B;  3ZP5 A;  3AL0 C;  9ANT A;  4XKW A;  2MLG A;  2L01 A;  2OF7 A;  3CP2 A;  2LTP A;  3OYL A;  2XC7 A;  1IV8 A;  2M8E A;  4B43 A;  1OLT A;  5IPA A;  1WJB A;  2IS1 A;  2AXL A;  2L0K A;  4NC6 A;  3CCE I;  1HW5 A;  2DPD A;  2WY8 Q;  2Y9Z A;  2MBF A;  1IRX A;  4G6T B;  3KP2 A;  1YFH A;  2LBF A;  2FF4 A;  3QP6 A;  3CP8 A;  3HOY J;  2FRH A;  1AKH B;  1OCT C;  3G3Z A;  1JUS A;  1J5Y A;  3ABL H;  1WI9 A;  3MFK A;  1QBJ A;  2O8K A;  1V5F A;  2ID6 A;  4MTE A;  1XSD A;  2V7F A;  3BOQ A;  3V7C A;  1BOA A;  2KRC A;  2L7F P;  4Y17 A;  4ZZD A;  3BCA A;  1SFE A;  2HKO A;  3HXL A;  2QBY A;  1N78 A;  3KIO A;  1I27 A;  4EMS A;  4DZP A;  4U7D A;  3L7W A;  1REP C;  2FBI A;  1R36 A;  5AIQ A;  2FJ1 A;  3QPT A;  2VB6 A;  3ZCO A;  3V4G A;  1R00 A;  4LIV A;  2YX7 A;  2KJC A;  3ZR8 X;  2ZJQ F;  2PJR B;  2M3A A;  4C2T A;  3CCV I;  1YO5 C;  2L7K A;  3QQA A;  3MAJ A;  3GTK J;  3HSE A;  3DLL F;  4HBL A;  3K4L A;  2K9L A;  3WTZ A;  1YRN B;  2JA5 J;  4KIF A;  1LVK A;  4N0B A;  2RNJ A;  4EJT A;  2LK2 A;  3SZT A;  4G8X A;  1SFK A;  1X19 A;  3F6O A;  3BR2 A;  3GXO A;  5FB2 A;  2WAQ N;  4K2E A;  4AID A;  1DDN A;  1MND A;  2R7F A;  2IVM A;  5BPD A;  4L5J A;  4I0B A;  4RLQ A;  1ZK8 A;  2X48 A;  1T8I A;  4OIO F;  3BY6 A;  3K4K A;  4FCY A;  2YR2 A;  1F43 A;  3NWT A;  1JGS A;  2EWN A;  3CMY A;  1EH6 A;  4YII A;  2ME6 A;  5B1B H;  2HNH A;  1TL8 A;  5J8F A;  5DEQ A;  4TV7 A;  5CPR B;  2P8T A;  2H6C A;  4RAG A;  4IEJ A;  1MJB A;  1D1A A;  4XR6 A;  3ASN H;  1ZGA A;  5HDK A;  5FRO A;  2Z3Y A;  3RKX A;  5JHF A;  3RIR A;  2VQG A;  5F1R A;  1FPQ A;  3GFI A;  1TWH J;  3I54 A;  2M30 A;  3MKW B;  3J7Y J;  3WTT C;  1WJC A;  4B8X A;  4OIN F;  2P7V B;  5FFX A;  4F93 B;  2AO9 A;  1X4O A;  2X51 A;  3ULQ B;  3FM5 A;  2DOA A;  1BC8 C;  2NVU B;  3VOD A;  3O2P E;  2L9V A;  1B9M A;  3P9I A;  3W2A A;  3JRB A;  5KAI C;  4UNO A;  1J0R A;  1TQI A;  4D0P A;  2COM A;  2OCC H;  3QWL A;  1L0O C;  2PBI A;  3CF5 F;  3DU5 A;  3E1S A;  3O3K A;  2MYS A;  1FP2 A;  2VC0 A;  3CLO A;  4CCL A;  3R61 A;  1YIO A;  2KZG A;  5TGT A;  2Z9O A;  4Z2Y A;  5ICE A;  1XN7 A;  1V3F A;  3OIQ A;  2EA2 A;  3E5X A;  2RQP A;  3T1B A;  1MBF A;  1V5E A;  4MGR A;  2E7W A;  2D1H A;  1UCR A;  1VQL I;  1ZH5 A;  3JAM Z;  2CGP A;  2F4I A;  4LOC A;  1OPC A;  5C3E J;  4I02 A;  1D0X A;  2LDU A;  5F27 A;  2FBK A;  1HQC A;  3HSR A;  4KN4 X;  2XV4 S;  2RAE A;  1B72 B;  3BWG A;  2EIK H;  2FOK A;  1BN5 A;  5BMZ A;  1T39 A;  1P7J A;  4N4O B;  2A07 F;  1NH3 A;  3ABT A;  1D0Z A;  2XAU A;  3CJN A;  1HCR A;  4PJ0 C;  3LNQ A;  2O3F A;  1G8X A;  1HDD C;  4XLA A;  4XOR A;  2QSG X;  2F5C A;  1TZL A;  1G3T A;  3DTE A;  3FDY A;  3FXQ A;  4N9H A;  3HOU J;  2X6O A;  2Y30 A;  1RRJ A;  4XN0 A;  1Z7L A;  2C6Y A;  5DDG A;  2A69 F;  5HVQ C;  2PLY A;  2DTR A;  2H6B A;  4B09 A;  3RPU A;  3L09 A;  3KYD B;  1KYW A;  1XG1 A;  4C3I J;  4HF2 A;  2R5Y A;  2HTJ A;  3U2R A;  3BRO A;  4I09 A;  4R8H A;  1R1T A;  4BJ6 C;  5J1Y A;  3GFJ A;  1UG0 A;  1WZ2 A;  2IS4 A;  3OL3 A;  3WTS C;  3O8H A;  3T8R A;  1RZ4 A;  4IOA F;  3HUG B;  1QGP A;  1LFP A;  5EZH A;  3DFG A;  3J81 K;  2Y48 A;  3ZQI A;  3GFM A;  2PG4 A;  1X58 A;  1XGM A;  1Y0U A;  4D5C A;  1FNN A;  4E70 A;  2NOJ B;  2RV8 A;  1WKM A;  4RBO A;  2DTZ A;  5K7F A;  3HOW J;  4RM2 A;  3KFW X;  3LA2 A;  4GXO A;  3S2H J;  1C0W A;  2KP6 A;  5H2F C;  2P81 A;  3H36 A;  1L3L A;  3I3L A;  3NAU A;  4GRI A;  1K6Y A;  1QZY A;  4IRG A;  3LFK A;  3MQ0 A;  1LE8 A;  2VPL A;  2OBP A;  3OYM A;  1DGW Y;  3RZO J;  4LG3 A;  1KA8 A;  2B9S A;  1CGP A;  3KP4 A;  4WK8 F;  2O5R A;  1YHQ I;  3CMM A;  1B8I B;  4XKB A;  3BR3 A;  3FXL A;  1V5G A;  3CQZ J;  1ORK A;  2RQQ A;  1V4R A;  3BZK A;  4GYI A;  3PSI A;  1RPW A;  2DFI A;  5F04 A;  1Y6I A;  2O03 A;  1DP7 P;  3GVA A;  5CLS A;  1GDT A;  2UWM A;  3M1C A;  5LD2 C;  2PEX A;  1EJ9 A;  1EF4 A;  1LDJ A;  4CCK A;  1W7P A;  4IQJ A;  1D1C A;  2LBF B;  1WFX A;  5IT9 K;  2G7H A;  4GDF A;  3S14 J;  3IH2 A;  1BA5 A;  1LDD A;  4RB1 A;  3PIP F;  1WWX A;  2KT0 A;  1ZTR A;  2BW3 A;  3IH3 A;  2QQ8 A;  2Z5U A;  1S29 A;  3LL7 A;  2NS7 A;  2FE3 A;  2BV6 A;  2G0E A;  2ZME C;  2XF7 A;  4ITV A;  5FKN A;  1JXS A;  1IAW A;  3GTO J;  1SD5 A;  1YTY A;  4FX4 A;  1Z3Y A;  2L9N A;  5BOX A;  3W6J B;  1MSE C;  5K7Z A;  4IPA A;  4WX9 A;  3KZZ A;  3BZ6 A;  3N4M A;  2WAE A;  4D5F A;  2EIN H;  5K1Y A;  2HXO A;  1MMG A;  1QZZ A;  2MG4 A;  4HDU A;  2DOD A;  1ETY A;  2CQK A;  3C18 A;  3HYI A;  3TDZ C;  1OCR H;  1F1Z A;  1WJ5 A;  1G6N A;  1RC9 A;  1X3U A;  2BHY A;  1D8K A;  4G12 A;  3CLQ A;  2KJB A;  2H1K A;  2MA3 A;  3H5A A;  4U88 A;  5HLH A;  1ETQ A;  1T56 A;  3RCO A;  4BL0 B;  1FX7 A;  3ROU A;  3ONQ A;  2JSC A;  4CCO A;  4XLE A;  4BXF A;  3JRD A;  3HOS A;  5DM7 F;  1VFC A;  4HG2 A;  1RIO H;  1F5T A;  4M3F A;  3QPS A;  2NVY J;  3RSN A;  5IP7 J;  5E3L A;  2VKV A;  4P9F A;  4DOZ A;  2BY0 A;  3COA C;  1A5J A;  2XGD A;  2ZNY A;  2IAI A;  2PQ8 A;  4KFC A;  2FX0 A;  3CDH A;  4CUG A;  1POG A;  1R9T J;  2QWW A;  4EM0 B;  1LPQ A;  1ZAR A;  4RLF A;  2HOS A;  4CXF A;  1OR7 C;  1IV6 A;  2M0C A;  4OU0 A;  1JKP C;  3JRI A;  1LB2 A;  4XSX F;  1SEU A;  1YS7 A;  4DYQ A;  5J8C A;  3ZMV A;  2BEO A;  2XVC A;  3VEP A;  5D5V B;  4A12 A;  4A0Z A;  1WHU A;  2LLK A;  3GWZ A;  3FXO A;  1GT0 C;  1XMX A;  4ZH4 F;  3KYC B;  2B0L A;  2IA0 A;  3BG5 A;  3LSM A;  4CDG A;  3BDD A;  4N4N B;  2H8W A;  2ZO4 A;  4GGG A;  3U9G A;  2HEO A;  4HX4 A;  4ASN A;  3OOU A;  3K7A J;  3JRA A;  2GIZ A;  2DXI A;  2LOO A;  3HHG A;  5JVG F;  2EFQ A;  1GLN A;  3MKZ A;  2DI3 A;  3VOE A;  2COB A;  3C1D A;  3L2C A;  1RNL A;  4A3B J;  1S9H A;  5H6Q A;  4XRM A;  2NVQ J;  2QSF X;  2NRA C;  2ZSI B;  2OU2 A;  2VJJ A;  3ERE D;  2XAJ A;  4WF2 A;  3JRG A;  4A3C J;  2JA2 A;  4X0G A;  1PP7 U;  3WG9 A;  4ZC3 A;  3PSF A;  3PJR A;  2A5Y B;  1IN6 A;  2K9S A;  2HQR A;  4BHP A;  2UXX A;  3JTH A;  5FFZ A;  1XDU A;  2QSH X;  2FU4 A;  2IPQ X;  3FMS A;  3L2W A;  4KNY A;  1BJZ A;  2OUM A;  5E1Z B;  2KL4 A;  3A02 A;  2BY2 A;  2CUZ A;  1FY7 A;  2E1M B;  1VQM I;  4BYY A;  2LMD A;  4EGZ A;  4LK1 F;  3FKI J;  3QOD A;  4LIU A;  4NNJ A;  5HDN A;  2OAZ A;  3LSH A;  2DA5 A;  3B02 A;  2ZKZ A;  2MH2 A;  5J47 A;  4OIR F;  1FP1 D;  2R92 J;  3U1K A;  4Y33 A;  1WCM J;  1IRF A;  3PNT A;  3FM3 A;  1WQ2 A;  1ZGJ A;  1BOB A;  1Q1H A;  3E6B A;  3PM1 A;  2CV2 A;  3CDI A;  1UHW A;  1QO0 D;  3FZV A;  1K78 A;  3M8F A;  3LA3 A;  1SD6 A;  3IAM 2;  3EPZ A;  3H35 A;  3F23 A;  4JQF A;  3AG1 H;  3HHH A;  4ZYG A;  1MNE A;  2R7O A;  2XIG A;  3JAM K;  5ICF A;  2HQN A;  3R60 A;  3M8J A;  2KZV A;  1ETV A;  2VXD A;  2PFB A;  5CVI A;  1LDK B;  3KPH A;  2EFN A;  4R79 A;  2P5L C;  1U2W A;  3B73 A;  3FF5 A;  4WXH A;  1T95 A;  3RQ4 A;  4PK4 A;  1YIJ I;  1JHF A;  3K4J A;  2PI0 A;  1FIP A;  3DF8 A;  1A04 A;  2M1B A;  5FKO A;  3FXJ A;  4XRS A;  1ZRD A;  2R5Y B;  2DA1 A;  3G6E I;  2GWR A;  4AVZ A;  2WAQ A;  1XCB A;  2DFF A;  3BR1 A;  5D4S A;  1JE8 A;  5HS7 A;  4BE1 A;  2IW5 A;  3I64 A;  3CCQ I;  2GXA A;  3DPL C;  4XIC A;  1TWA J;  2J5O A;  3ABK H;  1HF0 A;  2JVG A;  2VC1 A;  4Y4R A;  2LKP A;  2OZ6 A;  2G7U A;  2LY9 A;  2L4M A;  2GA2 A;  3MVP A;  4JX5 A;  5HNF A;  1IN5 A;  4ZYE A;  3HRU A;  3F8B A;  1OFC X;  2GLO A;  6PAX A;  3S3O A;  2CSO A;  3IHU A;  1TP4 A;  3AG3 H;  3S8P A;  2H27 A;  2BY1 A;  2IGO A;  3ZQC A;  1BI1 A;  4XN3 A;  2RKH A;  3WGG A;  4L0Z B;  2EIJ H;  3X2Q H;  2QCO A;  4C3H J;  3L2U A;  1LE8 B;  1BR2 A;  3K1P A;  1U9N A;  3VDX A;  3BC8 A;  1WH7 A;  2E19 A;  3QAH A;  5CVV A;  2M4G A;  3DTI A;  3OS1 A;  2M0M A;  2XRL A;  5DUK A;  2F5E A;  1P7I A;  4HST A;  4IOC F;  3OR2 C;  3WTW C;  1TTY A;  3DWL E;  4RB0 A;  3TQN A;  5D4R A;  5D5X B;  4M71 A;  3HBL A;  4M3E A;  4DNC A;  1A36 A;  4HAM A;  5CVR A;  4BAY A;  2BBY A;  3Q0V A;  4MTD A;  3GYH X;  3EUA A;  3V7S A;  4HX7 A;  5IOZ A;  4XLF A;  3GTG J;  2NXN B;  3FWE A;  2HI3 A;  4EJW A;  2V26 A;  4XL9 A;  4PJL A;  2X85 A;  1TT5 B;  2OC6 A;  3OV8 A;  3OIO A;  2V1N A;  2RC4 A;  2KDZ A;  4OAY A;  1FC3 A;  1QQI A;  2CO5 A;  2DO7 A;  5KVR A;  1WJE A;  5CYV A;  3F72 A;  1H9T A;  3F8M A;  1U9O A;  3KZY A;  5LHH A;  1Z67 A;  2JVH A;  3CC2 I;  3KP6 A;  3H5N A;  4XLH A;  1W7P B;  4HNV A;  2L9S A;  3FIW A;  4PDK A;  1BJA A;  3KZI C;  3JW4 A;  4IQ4 A;  3ERM A;  4YFK F;  4CZC A;  4M72 A;  2VXZ A;  3K69 A;  3QU3 A;  4UB8 C;  3PFI A;  3ISP A;  2W48 A;  1G4D A;  2BW3 B;  4ENN A;  1KQ0 A;  1OQY A;  2LF8 A;  4LIT A;  2MC4 A;  4W97 A;  1MKM A;  3CUQ A;  4EM2 A;  1IUY A;  2EQR A;  3BPV A;  2KQR A;  2O8X A;  2F4O B;  3LSJ A;  1UST A;  1ZLK A;  2K86 A;  4PSX A;  2K7L A;  5EEA A;  3J80 Z;  1T38 A;  4WXD A;  2XGX A;  3CES A;  2I10 A;  3SFZ A;  5EZG A;  2VBY A;  2EZH A;  2E71 A;  3HOZ J;  2VJI A;  5FKM A;  1YX3 A;  2XF6 A;  2E36 A;  3HRT A;  4IJA A;  4RMN A;  3C7J A;  4PJM A;  3OSF A;  4RGU A;  2CV0 A;  3QRF F;  2EB7 A;  4CCN A;  1RES A;  5ILV A;  2STT A;  1E3H A;  4A69 C;  5M3F J;  3DKW A;  3PNY A;  2NVX J;  4BBS J;  3J7Z I;  1VQK I;  4UV8 A;  2CW0 F;  2X4H A;  2FEZ A;  5E3M A;  4RS8 A;  1Z3X A;  2Y0S A;  1I39 A;  1KZH A;  5B3S H;  1X1B A;  1JT6 A;  4F92 B;  1VQN I;  1Y8R B;  2DYS H;  2TDX A;  3KEY A;  1IRZ A;  4HNU A;  3H3Z A;  4XLP F;  2QEN A;  5FJ8 J;  1P92 A;  4ZTF A;  2R7R A;  5JR3 A;  3EQL F;  5E17 F;  5IT9 Z;  2FMY A;  3CF2 A;  4YEL A;  4BUP A;  5FLV A;  2CQN A;  3MMY B;  2A05 A;  1J09 A;  2O6G E;  4B44 A;  1KU7 A;  3SEZ A;  3KE2 A;  3ZQG A;  3CDL A;  3IWF A;  4ZYH A;  2MD0 A;  4HZF A;  3MWM A;  4V2G A;  4E7Z A;  2LKS A;  2FXA A;  3SJM A;  1MJ9 A;  3FXU A;  3WTU C;  5BNG A;  1B59 A;  3WTY C;  3OY9 A;  2P4W A;  1P4W A;  2QZ8 A;  3I71 A;  3IV5 A;  3FK6 A;  2W57 A;  4BQN A;  3IRQ A;  2TRT A;  2V1X A;  2Z16 A;  3CO7 C;  3GF2 A;  5HLG A;  3HZJ A;  1WSU A;  1RKT A;  1YQA A;  3WHB A;  3ZN1 A;  2WC2 A;  3O8G A;  2K3F A;  4MQ9 F;  3WU1 B;  3JRF A;  5HLT A;  5E1X A;  5LHI A;  2A3S A;  1TWC J;  2ZXJ A;  3EDP A;  1XS9 A;  3K4B A;  5M5Y J;  1RUO A;  1CF7 A;  3EUH C;  3I4M J;  2B63 J;  2E5Z A;  1T2K A;  2DA6 A;  2JSP A;  3K9T A;  3Q0U A;  2Q2E A;  1I6H J;  4AIK A;  3OOP A;  2ZCW A;  3HRM A;  3OYN A;  1RR7 A;  1LJ9 A;  5J3L A;  1TW3 A;  2DFH A;  2NS8 A;  3HPG A;  4XID A;  5FKL A;  4Y15 A;  5DTD A;  2DA4 A;  2XGE A;  1T98 A;  1N75 A;  1R5I D;  2K4J A;  4RGX A;  3F9K A;  3NAR A;  4AIJ A;  5IYB J;  4XBF A;  3H9J A;  1Z6T A;  1S7E A;  1FSH A;  5B5E C;  2O7O A;  3SEQ A;  4QTR A;  2PMH A;  1ZKG A;  4L9V A;  4M73 A;  1Z1D A;  2JRM A;  2W24 A;  2IS2 A;  1MBK A;  4ZTJ A;  3OYJ A;  1GVJ A;  3FHZ A;  3ZMS A;  5E1W A;  1OYY A;  5AON A;  2YSR A;  2CWE A;  4EJU A;  4J01 A;  3D0S A;  5CJ9 A;  3K70 C;  2DPU A;  1VQ5 I;  2BY3 A;  3KLN A;  1MDM A;  1K78 B;  4EAT A;  1YW8 A;  5EEG A;  4BJT A;  1LUJ B;  1SVM A;  2PMZ N;  4ENM A;  1QRY A;  3D1N I;  2FD5 A;  2KDO A;  2IA2 A;  1BW6 A;  1SFX A;  2HFH A;  5LEK A;  4S05 A;  4PJN A;  2R4G A;  4PUS A;  2IBD A;  3UKG A;  2MAB A;  2RN7 A;  2HWV A;  1X4P A;  1ZR2 A;  2DA3 A;  1FT9 A;  3ZMD A;  5F0F A;  1NTC A;  3HTS B;  1W5T A;  4PFP A;  4CSW A;  2V6C A;  3E3V A;  1JKR C;  1X3W B;  5EGO B;  1FOK A;  2EK5 A;  4GCV A;  4I76 A;  2FNA A;  4HDV A;  3GW2 A;  4A3K J;  2BGC A;  3S93 A;  4Q5S F;  4BQO A;  2PX9 A;  1D5V A;  2Y75 A;  3JSP A;  1USS A;  3RKQ A;  1YOV B;  3GLX A;  4HPQ A;  4IZZ A;  2VKH A;  3A4C A;  3BCB A;  4ON0 A;  5C4X J;  2DOE A;  1ZLJ A;  5EF6 A;  1HST A;  4A93 J;  4ENK A;  2QUF A;  3OYC A;  4I0A A;  4KJZ A;  2JK3 A;  2JT1 A;  1WI3 A;  4FTH A;  4B1R A;  1G3W A;  3MN2 A;  2XB5 A;  5LGN A;  4DIQ A;  1YI2 I;  1FLI A;  2CH0 A;  2W84 A;  5HOD A;  4B4C A;  3AAF A;  4X6A J;  4BH9 A;  4LG0 A;  2I5U A;  3SQN A;  1LEB A;  1E0E A;  3P9K A;  2LY2 A;  3M1E A;  2ZJR F;  5FRN A;  1ZEL A;  5GP9 A;  2UXN A;  4G6D A;  1S3J A;  2Y2Z A;  2LVS A;  1W36 C;  2KLO A;  3G73 A;  3F0C A;  4YIR X;  1GV5 A;  4KUM A;  1BI2 A;  1I5Z A;  4KMU X;  3OYA A;  3K2A A;  2ZB9 A;  4DJA A;  3E5U A;  3HB9 A;  3H3V K;  4OAZ A;  2F4M B;  4ESJ A;  2QF7 A;  3BQY A;  3PQK A;  2X1D A;  4D9J A;  4L18 B;  1ZQ3 P;  2HVQ A;  4XQF A;  1JT0 A;  1E2X A;  2ISY A;  1A35 A;  1D0Y A;  1SVL A;  5CVJ A;  2KRF A;  2EZI A;  3FBN B;  4D7N A;  4XKV A;  3DEU A;  4IKF A;  2BVL A;  1V55 H;  5FKK A;  3R6S A;  1VI0 A;  3WU0 A;  2Q1Z B;  1K83 J;  2JUC A;  2BXY A;  2Y0S N;  2E2H J;  1AU7 A;  3CUQ B;  1GV2 A;  1FBU A;  2GXB A;  2ZSH B;  1I6X A;  3T5X A;  3GTJ J;  1MMD A;  2H8R A;  1NG7 A;  1R5H A;  1JKQ C;  1VND A;  2O61 A;  1TQM A;  4BEH A;  1K79 A;  1JTY A;  2KIS A;  4I2O A;  2M5W A;  2ESH A;  3JCU C;  1I1G A;  4D1Q A;  1MNM C;  1QPM A;  2D5V A;  3GO5 A;  4I98 B;  3HSF A;  3IKV A;  1W0T A;  4HLX A;  4NC7 A;  1YX5 A;  1YJN I;  3BZC A;  4AD9 A;  2FOW A;  2E1C A;  4A3F J;  1UFM A;  3OYB A;  2ELJ A;  2HR3 A;  3I59 B;  5AIP A;  1OCC H;  3IL2 A;  3LSI A;  1GXP A;  4ZJZ A;  4B3X A;  3BR5 A;  1XMK A;  2KMU A;  2VQH A;  4A3L J;  4DZJ A;  1OCO H;  2JA8 J;  3E5Q A;  2HYJ A;  3IUO A;  2XUB A;  2E2I J;  4P1W A;  2R93 J;  2A61 A;  3MZ8 A;  3J80 K;  3FMR A;  3H3U A;  2DOF A;  1O7F A;  1JUM A;  4A3G J;  3HTU A;  4FE7 A;  3FKJ A;  2LRD A;  1XSX A;  2W82 A;  3S3M A;  5FLX K;  3ELK A;  3NEU A;  3Q0W A;  4I99 C;  3S2W A;  2AQF A;  2VJ4 A;  4KMF A;  3SZG A;  4PGG A;  1MMN A;  1IGN A;  3B6C A;  3S2D J;  3VSL A;  3AKZ A;  4IHY A;  4RM3 A;  5L3D A;  2I8D A;  5IY5 H;  2YS9 A;  1UAA A;  3D5S C;  1X1D A;  1G2H A;  4BDZ A;  4PCQ A;  3GME A;  3LSR A;  2Y69 H;  3F6V A;  4A0Y A;  2ACJ A;  5L3E A;  3GBG A;  4BBR J;  4R1H A;  1YW7 A;  2LD5 A;  1D5Y A;  3CC4 I;  3TKY A;  3FK7 A;  1ZG5 A;  5K5R A;  2BYV E;  2WY7 Q;  2XKP A;  2MD5 A;  5DUI A;  2E34 A;  1XCV A;  1P4A A;  5IYD J;  4PGH A;  3W2W A;  5J1U A;  1X2M A;  3A2K A;  3DBR B;  3MKY B;  3F8N A;  4YEJ A;  4QWQ A;  1JGG A;  1HKQ A;  2BOL A;  1IUF A;  3WGH A;  3OYE A;  2JUG A;  4JX6 A;  3LA7 A;  1R58 A;  2P5V A;  5TRD A;  4BXX J;  4YFN F;  4H0E A;  1CF7 B;  3HOV J;  2JA7 J;  2CU7 A;  1BBY A;  1IN8 A;  2E7X A;  3R4K A;  5CQG A;  2QBY B;  4HW0 A;  4M9X A;  1P6R A;  3RZD J;  1ZYR F;  2AQE A;  3S1M J;  4JX4 A;  4E7K A;  2D2W A;  4XKC A;  1SFO J;  4GYG A;  2GA1 A;  5JHU A;  3DKY A;  5J1R A;  1R5G A;  4EQQ A;  3BTC A;  1IDY A;  1IZ1 A;  3SDG A;  5M5W J;  1Z77 A;  1BW5 A;  1T0F A;  4Y13 A;  1I3Q J;  3K0L A;  3M7G A;  3CUQ C;  1NK2 P;  2JMW A;  2DK5 A;  1UZC A;  4M3B A;  1E3P A;  3CCL I;  2CQX A;  3RPU D;  2DYR H;  1MDM B;  4UY8 I;  3W2V A;  3PUB A;  3E6M A;  2ESN A;  5EDN A;  4HRI A;  5E20 A;  3ZQL A;  1F9N A;  2JRT A;  2LP0 A;  4U87 A;  3QOE A;  2HDD A;  2WBM A;  1S7O A;  4WXC A;  2WB1 N;  3DLA A;  1WPK A;  3EUK L;  2ZFW A;  5F08 A;  4FIS A;  4QIW N;  4IHV A;  1MH4 A;  2KRH A;  2STW A;  1FJL A;  2NOG A;  3IRR A;  4Q4Z F;  2E2J J;  2OQR A;  1T6S A;  2IJL A;  3P9C A;  4BQQ A;  2OPT A;  1J75 A;  1ON1 A;  4XSZ F;  4L9T A;  1WVR A;  3ZQQ A;  3ZMT A;  2EPF A;  5EYR A;  3V8K A;  5L3F A;  2DA2 A;  4BY7 J;  4ETS A;  3I56 I;  2NVT J;  3RYR A;  2HDW A;  2WTE A;  3BR6 A;  2GIV A;  4UHT A;  5TIS C;  3G4S I;  2DMU A;  4M3D A;  1O3S A;  4CIC A;  2K85 A;  2VLA A;  1FYL A;  2LSO A;  3TL4 X;  4L5E A;  2OQG A;  1ZRF A;  2MH9 A;  2R7T A;  2DBB A;  3FX3 A;  2WV0 A;  4Q47 A;  1QU3 A;  4N9I A;  3WE2 A;  2EIL H;  2EFO A;  2FSW A;  2EV6 A;  4A3I J;  5GAH J;  1VTN C;  3CME I;  3OIP A;  2QKM B;  3DU6 A;  4JP0 A;  4AYB N;  3DKX A;  3HIF A;  3SYT A;  4Y3O A;  1VQ4 I;  2W85 A;  4IF4 A;  4I01 A;  4YFX F;  4Q48 A;  4IVN A;  3K4C A;  1BC7 C;  3KP5 A;  1JUP A;  1XTA A;  4NC8 A;  4JYK A;  3I4P A;  2MSY A;  2IGK A;  4LG0 B;  4CGZ A;  4XLC A;  1HC8 A;  3GX4 X;  5L3G A;  1D3Y A;  1SMY F;  3I4N J;  2UV1 A;  2OJE D;  2LR8 A;  3ZOB A;  1S8N A;  5IOY A;  1VQP I;  1QZE A;  5IYC J;  4WWC A;  3PFY A;  5A2Q Z;  1W7P D;  3M8E A;  4ANJ A;  3OL4 A;  5E3N A;  2K3P A;  1WJF A;  1OCZ H;  2W1O A;  3ESW B;  2EJR A; 
#chains in the Genus database with same CATH homology
 2EZL A;  3A03 A;  2DA7 A;  3GTM J;  2L7Z A;  3OSF A;  3PO3 J;  1HDP A;  1RES A;  4A69 C;  2XPV A;  5M3F J;  1TWH J;  3HEF A;  2JWT A;  1PUF A;  1H89 C;  2NVX J;  1QVT A;  4BBS J;  3CCY A;  1TWF J;  1WH5 A;  5E3M A;  2AO9 A;  2N8G A;  1K61 A;  3S1R J;  1JT6 A;  1JTX A;  1H8A C;  3JRB A;  3GTP J;  3JR9 A;  1IRZ A;  4XK4 A;  1U8B A;  5FJ8 J;  1FTT A;  2ECB A;  3IH4 A;  5GPA A;  4FE4 A;  2XPW A;  1Q1V A;  5FLV A;  3H0G J;  2WV1 A;  4DYR A;  3ZQG A;  4A3M J;  4A3E J;  3CDL A;  1MBF A;  4V2G A;  1Y1W J;  3SJM A;  4DW6 A;  2R5Z A;  3ZQH A;  5BNG A;  4LOC A;  5C44 J;  5C3E J;  1ITY A;  2JN6 A;  3JRH A;  3IV5 A;  3FK6 A;  4DYC A;  5F27 A;  1UHS A;  2TRT A;  4Y7N J;  3G1M A;  3RQI A;  1RKT A;  2FQ4 A;  4A3J J;  3WHB A;  2RAE A;  1MH3 A;  1B72 B;  1W0U A;  1NK3 P;  2DMP A;  3O8G A;  4CYC A;  3S16 J;  1P7J A;  2DMT A;  1IC8 A;  2IEK A;  3JRF A;  1DU0 A;  1HCR A;  3A01 A;  4M3G A;  4AUX A;  1TWC J;  2CRG A;  3LNQ A;  1XS9 A;  5M5Y J;  1O4X A;  3I4M J;  1HDD C;  2DA6 A;  3Q0U A;  1I6H J;  4D7M A;  4IHX A;  3HOU J;  4UUS A;  1RR7 A;  2X6O A;  2Y30 A;  3BR0 A;  5J3L A;  2NS8 A;  3ZQF A;  2LKX A;  4XID A;  3LSG A;  4UUT A;  5FKL A;  5DTD A;  1ETW A;  2DA4 A;  2XGE A;  1OCP A;  3BQZ A;  3W6V A;  3NAR A;  5IYB J;  1UMQ A;  1S7E A;  2O7O A;  1XG1 A;  4C3I J;  4QTR A;  4AC0 A;  1ZKG A;  2Y9Y A;  1OJL A;  1GVD A;  2CUE A;  1MBK A;  2R5Y A;  4J19 A;  5J1Y A;  3S15 J;  2HQ5 A;  1X2N A;  3O8H A;  2CQQ A;  4C3J J;  2VUM J;  2YUS A;  2HXI A;  1MBG A;  5EZH A;  1T33 A;  3ZQI A;  2EZK A;  3TED A;  1AHD P;  1MBH A;  1X58 A;  2PMZ N;  1QPI A;  4BY1 J;  4D5C A;  1QRY A;  3D1N I;  2FD5 A;  3DEW A;  4RBO A;  2DTZ A;  5K7F A;  3HOW J;  4MFE A;  1BW6 A;  3FIS A;  3S2H J;  4MO7 A;  2CUF A;  1WGX A;  2P81 A;  2IBD A;  3UKG A;  4V2F A;  1AKH A;  3NAU A;  2MW8 A;  1Y1V J;  3DCF A;  1LE8 A;  1ZR2 A;  2E1O A;  2DA3 A;  2M9H A;  5F0F A;  1NTC A;  1FTZ A;  3TP3 A;  2JJ7 A;  1IDZ A;  3RZO J;  3B6A A;  2VKE A;  1JKR C;  5IP9 J;  5EGO B;  1Z0X A;  4I76 A;  1RKW A;  1B8I B;  4A3K J;  3BR3 A;  2EBI A;  3C2B A;  3CQZ J;  1ORK A;  3HOX J;  2K9Q A;  5M3M J;  3TW6 A;  3VPR A;  3RKQ A;  1RPW A;  1IJW C;  5C4X J;  5F04 A;  1BL0 A;  4S0H B;  1F36 A;  5EF6 A;  4A93 J;  2M8G X;  1A6I A;  3LOC A;  2JK3 A;  1GDT A;  1WI3 A;  4FTH A;  1FEX A;  4B1R A;  1YRN A;  3MN2 A;  2ELK A;  2XB5 A;  1EF4 A;  5EG0 A;  2L9R A;  1DU6 A;  4ABZ A;  3S17 J;  4M6V A;  3S14 J;  3IH2 A;  5HOD A;  4B4C A;  4X6A J;  1BA5 A;  2L7M P;  2KT0 A;  1ZTR A;  2VI6 A;  3IH3 A;  2NS7 A;  2G0E A;  5GP9 A;  2ECC A;  2HOA A;  5FKN A;  2Y2Z A;  2LVS A;  3GTO J;  1ZR4 A;  4BKX A;  3F0C A;  1MSE C;  1GV5 A;  5K7Z A;  5FLM J;  3K2A A;  2ZB9 A;  2M34 A;  4D5F A;  3BTI A;  2HXO A;  3HB9 A;  2MG4 A;  1E3O C;  3H3V K;  1ETY A;  1TC3 C;  1JJ6 C;  2B63 J;  4G12 A;  1VF9 A;  3JRE A;  2QF7 A;  3BQY A;  5EGO A;  4C2M J;  2EH3 A;  1ZQ3 P;  1JT0 A;  2H1K A;  2GM4 A;  1ETQ A;  1T56 A;  2EZI A;  1ETX A;  4D7N A;  3HM5 A;  3JRD A;  1VFC A;  1MSF C;  5FKK A;  1HOM A;  4M3F A;  3QPS A;  2NVY J;  5IP7 J;  1I50 J;  5E3L A;  2VKV A;  1XC5 A;  1VI0 A;  1A5J A;  1K83 J;  2XGD A;  4GFB A;  2IAI A;  2ME0 A;  2Y0S N;  2E2H J;  2FX0 A;  5DS9 A;  1AU7 A;  1POG A;  2XB0 X;  1GV2 A;  1UG2 A;  1R9T J;  3GTJ J;  2HOS A;  3M4O J;  1TWG J;  3M3Y J;  1IV6 A;  2M0C A;  2DJN A;  2VPR A;  2H8R A;  1JKQ C;  1VND A;  2MGQ A;  5F0H A;  1JTY A;  1JKP C;  3JRI A;  1MNM C;  2D5V A;  4DYQ A;  1ETK A;  5K7H A;  1W0T A;  3Q3S A;  3BG9 A;  3PO2 J;  2LLK A;  3QPL A;  1GT0 C;  1CQT A;  3BG5 A;  4A3F J;  2O9L A;  1PUF B;  1ENH A;  5IP6 A;  2X9D A;  3OOU A;  3K7A J;  3TW7 A;  3JRA A;  2XPU A;  4XRS G;  3BR5 A;  2ID3 A;  4A3L J;  4DZJ A;  1SAN A;  2COB A;  2JA8 J;  5F1J A;  2HYJ A;  4A3B J;  3OSG A;  2NVQ J;  4XRM A;  2E2I J;  1B72 A;  2R93 J;  3HGG A;  3BTJ A;  4A3C J;  3JRG A;  4A3D J;  2GBY A;  3G1L A;  3L1P A;  3S1Q J;  1MBE A;  4A3G J;  1JUM A;  4FE7 A;  2K9N A;  5C4J J;  1ZGW A;  2K9S A;  5GPC A;  3Q0W A;  3SFI A;  1BJZ A;  1IGN A;  3B6C A;  3A02 A;  3BT9 A;  1H88 C;  3S2D J;  4IHY A;  2TCT A;  2YS9 A;  1JJ8 C;  5F0C A;  1FIA A;  3FKI J;  1G2H A;  2R5Z B;  4RDU A;  2DA5 A;  3LSR A;  2DN0 A;  3GBG A;  4BBR J;  2DMN A;  2LD5 A;  1LFB A;  1D5Y A;  3FK7 A;  2R92 J;  2LFB A;  2DMQ A;  5JLW A;  1WCM J;  3HDD A;  5IYD J;  3PM1 A;  1QVU A;  3HKZ N;  5J1U A;  3BTL A;  4MLO A;  3GTL J;  1X2M A;  4CYC B;  2AHQ A;  1LFU P;  2R0Q C;  4B3A A;  1JGG A;  4MIM A;  1IUF A;  4QSH A;  4JX6 A;  4W1U A;  3A01 B;  4NDL A;  4BXX J;  3HOV J;  2JA7 J;  2CU7 A;  4UUS B;  3BG3 A;  1ETO A;  3RZD J;  1ETV A;  3S1M J;  4JX4 A;  1SFO J;  2XGC A;  2K40 A;  3HGY A;  5J1R A;  3E7L A;  5M5X J;  3BTC A;  1IDY A;  1FIP A;  4XRS A;  2JA6 J;  5FKO A;  3SDG A;  5M5W J;  1Z77 A;  1B8I A;  1BW5 A;  2R5Y B;  4X1E A;  2DA1 A;  4MFD A;  1U78 A;  1I3Q J;  1IG7 A;  4Y52 J;  3LSP A;  1NK2 P;  2JMW A;  1MBJ A;  3BR1 A;  9ANT A;  4M3B A;  4IHW A;  2CQX A;  2YU9 J;  2OF7 A;  4XIC A;  1TWA J;  2LTP A;  5EDN A;  1HF0 A;  3ZQL A;  2LP0 A;  5IPA A;  2LY9 A;  5JLX A;  2HDD A;  2WB1 N;  3MVP A;  1WPK A;  2L0K A;  4JX5 A;  2HOT A;  2GLO A;  1OFC X;  2Y9Z A;  3S1N J;  5F08 A;  3GTQ J;  4FIS A;  4QIW N;  4IHV A;  1MH4 A;  1RET A;  3MKL A;  3HOY J;  3ZQC A;  1FJL A;  2M2E A;  2NOG A;  4EEF G;  2E2J J;  1AKH B;  1OCT C;  3G1O A;  5E3O A;  1JUS A;  2QCO A;  4C3H J;  2OPT A;  1LE8 B;  2O8K A;  2ID6 A;  1U9N A;  3WHC A;  1WH7 A;  2E19 A;  5EYR A;  2DA2 A;  4BY7 J;  2NVT J;  3BR6 A;  2XRL A;  2Y31 A;  2L7F P;  2DMU A;  4M3D A;  1P7I A;  4DZP A;  3HBL A;  4M3E A;  4L5E A;  1GUU A;  2FJ1 A;  3Q0V A;  5IOZ A;  3GTG J;  2HI3 A;  3OIO A;  4A3I J;  2KDZ A;  3QQA A;  3JRC A;  3GTK J;  4JP0 A;  4AYB N;  1YRN B;  1U9O A;  2JA5 J;  4I6Z A;  1APL C;  2CJJ A;  2R7Z J;  2XSD C;  2LK2 A;  4HNV A;  5EG0 B;  3FIW A;  3BR2 A;  2WAQ N;  1JUP A;  4JYK A;  2MSY A;  2W48 A;  3I4N J;  1JKO C;  2LR8 A;  3ZOB A;  5IOY A;  4W97 A;  1ZK8 A;  2X48 A;  5IYC J;  2EQR A;  3LSJ A;  4FCY A;  1F43 A;  5E3N A;  3CMY A;  1HLV A;  2ME6 A;  5EEA A;  2I10 A;  5EZG A;  3TP0 A;  2EZH A;  3HOZ J;  4IEJ A;  5FKM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...