1OCRH

Bovine heart cytochrome c oxidase in the fully reduced state
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
79
structure length
79
Chain Sequence
KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Redox-coupled crystal structural changes in bovine heart cytochrome c oxidase.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords CYTOCHROME C OXIDASE
total genus 25
structure length 79
sequence length 79
chains with identical sequence U
ec nomenclature
pdb deposition date 1998-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 1ocrH00
3ABLH 2EIMH 3ABKH 1OCOH 1V54H 3AG1H 3AG4H 2Y69H 5B1BH 5B1AH 5B3SH 3AG2H 1OCRH 1V55H 2EINH 2DYRH 3ABMH 3ASOH 5IY5H 3AG3H 2OCCH 1OCZH 2EIJH 2EIKH 2ZXWH 3WG7H 1OCCH 3X2QH 3ASNH 2DYSH 2EILH
chains in the Genus database with same CATH superfamily
1TL8A 1FOXA 1ZTRA 5J4VA 2ZC2A 1YS7A 2DDAA 2Z1DA 4M6YA 1DUXC 5ILSA 2M9HA 2XGXA 3ML6A 4RS8A 4EJVA 1QVUA 2TCTA 5LHHA 3M3YJ 2DA4A 3KLNA 2MLKA 2R7ZJ 3JSOA 5IP7J 4HW0A 2RREA 2IEKA 3ZRGA 1F4KA 3FF5A 2DOAA 2A6EF 5J6XA 1JGGA 3CJTB 1S7OA 4AUXA 4C2UA 4DW6A 2M5WA 4Y4RA 3VYRB 3KP2A 2W24A 4HF1A 4UUSB 4S05A 4MIMA 2VBZA 2VQGA 4HDUA 3RZDJ 4HQEA 1X3WB 1QBJA 3GFJA 1LE8B 1IN8A 1V4RA 2KDOA 4OAZA 1ENHA 5KAIC 3ZQFA 3DTIA 2D1VA 4MTDA 1BI0A 2HOTA 1YX3A 4BEHA 4X6AJ 2MSYA 3PUFA 4XOTA 2HPMA 4RLFA 2HEOA 4HRIA 2OU2A 1J9IA 4DGWB 4BDYA 4ESBA 3KYLA 4MEYF 3SFIA 2DPDA 2GIZA 4WCGA 1WGXA 4QSHA 3HZJA 2WY7Q 5E17F 3HTUA 1O4XA 3MKYB 5H20A 2LP0A 3DBHB 3FM3A 3WU0A 4RAGA 2QEXI 2HPIA 1I3QJ 1SVLA 1IAWA 2Q8KA 3OIQA 5LEKA 1MNEA 3V7CA 5D5VB 2KLOA 3M07A 3IH2A 5BS6A 5EZHA 2V9VA 3O8GA 2IT0A 5IOYA 3AL0B 2ZB9A 3SQNA 1J5YA 3JCUC 4XLEA 1G3TA 3IUOA 2XKOA 3IV5A 1IV6A 1NK2P 2IA1A 3PJRA 2IW5A 3ZOBA 4DYQA 3G73A 2HDDA 2L2OA 1RR7A 4BL0B 1Y0UA 3O6BB 3KP4A 1BBYA 4PSXA 2V1NA 2OCCH 2IPQX 3FM5A 1SFKA 1P9QC 3IL2A 4LIVA 3ECHA 2ZFWA 2OC6A 4KN7X 3S14J 3CESA 4ZJZA 2FJ1A 3FXJA 1RUOA 5FKOA 2FEZA 2FQ4A 2HTJA 4EJTA 5AIPA 3N05A 2Y75A 1FX7A 3I4NJ 4PJNA 1GVJA 1J75A 3BJAA 3DPUA 4G6TB 2LY1A 1G59A 2RNGA 1VQ6I 2LC2A 4FQGA 1EF4A 3G3ZA 1GXPA 3S1QJ 2P5KA 2L7MP 2ECCA 3BZKA 3ZMVA 5DCMA 4AVPA 4OINF 4MFDA 5HDNA 4F91B 5K5OA 3K4CA 2MFZA 3CMYA 1Z7LA 3PQJA 1KQ0A 1IGNA 2DN0A 2LTPA 4IOCF 4Q47A 2R7SA 2XKPA 1S7EA 2F4MB 2XF6A 5CVJA 1TQPA 2EV5A 4YEJA 1FIPA 5JHUA 5GAEJ 3BLYA 4KIBA 4BU2A 1H9GA 2E5NA 5HS9A 2MC4A 2PN6A 2KIMA 2KMUA 3J7AO 2BE5F 5DUKA 1O7FA 3F6OA 2EH3A 1SC7A 4AM3A 1G2HA 4O5VA 4BGDA 3CDLA 3K7AJ 2KHMA 2STTA 2V6EA 1D0YA 3D5RC 2HFHA 2ID6A 3UKGA 3TW6A 5KHDA 4N9HA 4A69C 1LPQA 3TO6A 2CV2A 4BXXJ 1ODDA 2GIVA 4H0EA 2E2JJ 3OL3A 5F64A 1DP3A 1UELB 4LG0A 4WK8F 3SHFA 2JPBA 2EV6A 1ETXA 2Z9OA 3OS0A 1FT9A 4ENJA 4A3KJ 2ZKZA 3HG9A 4RAZA 2PI0A 3S17J 1F43A 2R7DA 3F8FA 1QGPA 2X0LA 3LA3A 2TRTA 4CCKA 4C3HJ 3J80K 3DKXA 5L3FA 4MQ9F 1KA8A 1FBQA 4IL6C 5CJ9A 5FKKA 3KP5A 4HF2A 3BWGA 4N9IA 2KFDA 2AQFA 2K4JA 2QQ9A 1EA3A 3H36A 2CW8A 1TWAJ 2QM3A 2CQKA 5LRSA 3HHHA 3RIRA 3K1PA 4HF0A 2VPRA 4GYIA 4E4HA 3GW2A 2QSFX 3QOPA 4A3JJ 3SYTA 1ULYA 3RYPA 2DJIA 2EFOA 3CQZJ 1WRJA 2VODA 1BJZA 3F8CA 1GVDA 1OFCX 1HW2A 3LOCA 3H9GA 2EWNA 1U5TB 3M9AA 3U2RA 4J19A 1XMKA 4XKWA 2KIQA 2QKLB 1TNSA 4B3XA 1WJCA 2XVCA 3CMEI 5HLHA 1VZ0A 2K5CA 1F1ZA 2H6BA 2K3FA 3QWLA 3GFMA 1TWFJ 1I27A 2EFNA 1P92A 3OOUA 4PK4A 2GOXB 1K6YA 4RBOA 1V54H 3C3WA 4L0ZB 3K70C 4HEA2 5HODA 1YW9A 2I10A 4UUTA 3UR3C 3SDBA 4MEXF 4F93B 1Z9CA 3BC8A 5EZGA 3EQLF 1RESA 3OYKA 1A36A 1QPMA 4RAFA 2XV4S 2WADA 4A3CJ 1P4WA 4UXNA 3CUQA 5DD4A 3FK7A 1U2WA 4O6JA 3HTSB 3CMMA 3CCRI 4KDPA 4A6DA 3W6VA 3A2KA 1ORKA 2FMYA 4XQFA 2KKOA 4JBAA 4CUGA 4XRSG 3WTVC 2JA7J 1NH3A 3PIPF 5EEAA 2ZSHB 3CDIA 4AYBN 4IPAA 2QA4I 2YX4A 1UHSA 1ZGJA 5E1WA 1RUNA 3P9CA 4CH7A 1JKOC 3OV8A 2L9VA 2K7LA 2LKXA 2YPRA 3EUHA 1ZR4A 3CO6C 5IYCJ 1BW6A 2PX9A 2ELJA 1D8KA 2A5YB 1U0JA 4ESJA 2L7ZA 2V4JC 2XF5A 4II3A 4ZYHA 2VT3A 5FRMA 3MCZA 1KU7A 2ZNZA 1X4PA 4EGZA 3KEYA 1ZGAA 2VC0A 2OZ6A 4MO7A 3RQ4A 2XAFA 4NHJA 4I09A 2BY2A 1X1PA 2EIJH 2DA7A 5FFZA 5LRRA 3CO7C 3LSKA 4EVIA 4G9YA 5LGTA 1B6AA 2DAOA 4BUPA 1OISA 1O3RA 3JTGA 4E7LA 4BAYA 3ZMUA 3HHGA 2IGKA 1HOMA 1T6SA 5EG0B 2DA6A 3H5NA 4IOAF 4A3MJ 2VUMJ 5TRDA 3I56I 1ACIA 3DLAA 3GLXA 4LLGF 5D6FA 2M4GA 2XASA 1KU2A 3MWMA 4CCMA 2IP2A 3RYRA 3F23A 4Z6YA 3HOXJ 2O9LA 1F5TA 3GZNB 3GZ6A 5J1RA 2JA8J 3WTYC 2IS1A 3LQQA 3WG9A 1X1CA 2VE9A 4E6KG 2ISZA 2P4WA 3I58A 4II2A 2BV6A 1ZLJA 4U88A 3S3MA 3C2GA 3DCFA 1X1BA 1VI0A 3BTCA 2Z2SB 3W3CA 2CO5A 2XC7A 1MDMA 2B63J 3Q0UA 3S2HJ 2A69F 3L00A 2DFHA 2FXAA 4M3DA 4AIJA 3CC4I 5CVUA 2KISA 3RSNA 1U78A 4H4KC 1BR2A 1BI2A 4C2TA 1IUFA 2F5FA 3PNYA 1MGTA 2OQRA 1WJEA 2CJJA 2LBFB 1QZZA 3QYFA 1XCBA 1FSEA 5A2QK 5FRNA 2VASA 3ZQHA 3DLLF 3BY6A 2O7OA 5JI6A 1IW7F 1QZEA 2DMUA 1GHCA 2Z33A 1QPIA 2L7KA 5HDGA 2CYYA 1KQ9A 1SMTA 2L9RA 4CYCB 2ELHA 4MQVA 1PP8F 2IA0A 5TGTA 2FD5A 5L3CA 5CQGA 2JZYA 3L2WA 1IJWC 1XGOA 3LQRA 5LGUA 1FOKA 2BGCA 1MZBA 1MBJA 2VBWA 2Y2ZA 3KZYA 3L2CA 2IGNA 2CG4A 2CU7A 1R9TJ 4FX0A 4HOBA 3Q9SA 3I5UA 1RRJA 5J3LA 3OL4A 1W0TA 2QUFA 1F36A 3GFLA 4FETA 3OR1C 5E79C 4PJMA 2XGDA 2L0KA 2XROA 3CC7I 1XB4A 2HOEA 1UHWA 3BQZA 3TP0A 2F5DA 2NOJB 4JX4A 4ITVA 3FXKA 1R1VA 1V3FA 1B72B 2O8KA 4EM0B 4C30A 4XKCA 4LMYA 3BOQA 3RTRA 2LH9A 1ZH5A 3RKWA 2YX7A 2MD5A 1QRYA 5IOZA 1K79A 2O5RA 5GTHC 1T0FC 2DCEA 2EINH 1MBGA 1JXSA 4IEJA 3HSEA 2ICWG 1K61A 3QU6A 4E7KA 1KZHA 4MLOA 5JVTA 2QBYA 4HYEA 1RKTA 1PDNC 4ENNA 4XLPF 3L1PA 2ID3A 1A6QA 2R0QC 1O7LA 1ZG5A 4PJJA 2XPUA 1XTAA 2HOAA 2G9WA 5E3LA 5DCFA 1Z21A 3P9IA 2QQBA 3VFZA 1VQ9I 3LSIA 2HVRA 2ELKA 4IHSA 4Y3OA 1WPKA 1JTXA 3RPQA 4LGWA 4UUVA 5IYDJ 3VYSB 1ZG3A 2ESNA 2R7XA 3HEFA 3QYEA 3R6SA 4Y52J 2IA2A 4RA2A 2V6CA 2JSPA 1KU3A 4RM3A 5D4SA 3H35A 2RNJA 3WE3A 4WXCA 5K1YA 3ZPLA 1Z1DA 2P7CB 2NS7A 5F27A 1SD6A 2FSWA 4QLCU 3AFHA 5L3DA 5M5XJ 5J8FA 4CGZA 2X6XA 4V19K 3JRBA 5E20A 2X4HA 3F9KA 4FE4A 4UV9A 2FMLA 2D45A 1D1CA 4BACA 3PIOF 2FNAA 1OCZH 1R7JA 3WE2A 4ZZDA 3DFGA 3H92A 4BEHB 3OYEA 4HSRA 3Q3SA 3WHCA 3KLOA 1BW5A 4RGSA 3QP6A 4CHUA 2Q1ZB 5HNFA 2W4SA 3CLOA 4A3FJ 4XRSA 1SD5A 3P7NA 4HNUA 2D1HA 3TO7A 4N4OB 2A68F 1SMYF 1I6XA 2L01A 2E2IJ 4LK0F 1HKQA 3BQYA 2AXLA 5FFXA 3T0YA 5BPIA 2VLAA 3E3VA 2KZVA 3L2RA 2OQGA 1LJ9A 1Z91A 2BVMA 5LHIA 3DU5A 5FJ8J 2E60A 1J2XA 4FT8A 4RGRA 3S3OA 1ZR2A 1FLIA 2IS4A 2R4GA 4FCYA 3HPHA 2RQQA 3AKZA 3BPXA 1I1SA 2ZXJA 5ERIA 4A5NA 2VI6A 1LDJA 2IRFG 3H3UA 5FGMA 4M6XA 4A0YA 5DV5A 2COMA 4Y7NJ 3JRFA 1KONA 1EV7A 3FWEA 1LEAA 4M3EA 2IBDA 4B47A 5JHFA 1VQLI 1R1TA 2PG4A 3PFIA 4FE7A 5FLXZ 3QPLA 2DA1A 2O6GE 5CYVA 4MFEA 1OQYA 4U0VA 3JR9A 4AYBA 2WA0A 2A61A 3IP4B 4X0GA 1YRNA 2LFBA 1RPWA 2PFBA 4BNCA 1MBEA 2DMQA 3TOAA 3W6KB 2HZDA 2HKOA 3VPRA 2M1BA 3I54A 4BHCA 1R58A 2FNPA 2WAQN 2XAUA 3DQVC 3AG4H 4JK1X 1PYVA 1FSHA 3RPUA 3KP6A 1YQAA 4XICA 3H0GJ 2V9PA 2DI3A 4I0AA 4XONA 3ZN0A 3OYDA 4YG2F 2RDPA 5DM6F 1K4TA 5L3GA 2WBMA 3R0AA 2I8DA 4PDKA 4DYCA 1Y8RB 4EMSA 1ETQA 3DWLE 2LKSA 4YIFA 3GTGJ 2JPCA 1YE9A 2P6TA 4EGYA 1PUFA 4ZDLA 4B8XA 2DJNA 3LSHA 4KUMA 2BY1A 1BA5A 5CLSA 1KQ8A 3C2HA 4M9ZA 2QZ8A 5D4RA 3M8FA 3V7RA 2V1UA 2A5WA 2XUBA 1O3TA 1D5YA 2ESHA 4M3BA 3OSGA 3LAPA 2E1NA 3K4NA 2CWEA 1XD7A 2JUGA 2M8EA 3I71A 2DBBA 2VXDA 4E7IA 2VN2A 2F5CA 4I76A 1S5LC 1DPRA 4L9NA 3E5QA 3MZHA 1T2KA 1WCMJ 4XN3A 1Y1WJ 3BR0A 1W0UA 2XAJA 3WU1B 3L09A 4A3IJ 1WFXA 3BG3A 3GMEA 1IXRC 3B6CA 3CUQC 1N78A 3CCYA 1MIJA 3V7SA 2HQ5A 4XL9A 2JSCA 2VXZA 3TGNA 3FHZA 2KJBA 5IP6A 1STZA 3LL7A 5HLGA 2VKVA 1WI3A 2R7TA 4TV7A 2KQRA 5J40A 5F0CA 3JRDA 2E36A 1SFOJ 4KIFA 4A3EJ 3SZTA 4A3GJ 4XSXF 3W2VA 2NS0A 4OIRF 1JUPA 1VFCA 2ZBKA 2CQXA 2EZKA 2MLGA 1DGRM 4P96A 4M3FA 1LUJB 1FTZA 3DF8A 4JQFA 1CGPA 4OOIA 5D5XB 3HOUJ 5CQEA 1PVEA 3MMYB 3S32A 1ON2A 3A02A 3C7JA 1LB2A 2PJRB 1G3YA 2WTEA 4XM3A 2NS8A 1HSTA 1WKMA 2CH0A 2X6YA 4NUBA 5EEHA 4WXHA 3JRCA 1W7PD 2F48A 4BQQA 1ZHFA 3NQOA 2H09A 5J1YA 3ABKH 2M4KA 3WTWC 1P7JA 1R22A 4XSZF 3PUBA 3W2AA 1HKSA 3OIOA 1SVMA 4YFNF 4KIGA 5FLVA 2QYOA 3JAMK 3BCAA 4OIQF 2JRTA 4PGHA 2BY0A 2R3SA 2COBA 3KP3A 4IRIA 4UVCA 3NAUA 5LEJA 2I5UA 2ETHA 1OCCH 3DP7A 1B59A 2M45A 3WODF 4U7BA 2X6WA 2LG4A 3HBLA 1ZRCA 1RNLA 1P6RA 4C3JJ 1MNMC 1R71A 3WTZA 4RDUA 1JJ6C 1HW5A 2EIMH 4U0WA 2RV8A 4D0PA 3FISA 2CUJA 3FMSA 5FO5A 1IRFA 3ZP5A 3IRRA 2F4IA 5E3NA 3QOEA 1QZYA 1PJRA 3ERMA 2QCOA 1LEBA 4RLQA 4EJWA 4KT5C 2DDBA 2K86A 2MBFA 4V2FA 2X51A 3M1EA 3UNGC 3S2WA 3VYUB 4EEFG 4ETSA 4A12A 2ZJQF 4CCJA 5IPAA 4KYWA 1LDKB 2TDXA 2XIGA 2EA2A 3CP8A 2IJLA 1YITI 4B44A 4W97A 2XRLA 4HV6A 2JVHA 3A03A 3HPGA 1JTYA 1OR7A 2JTVA 3RCOA 3RDIA 4D7NA 4DNCA 3ABLH 3CCSI 2PJRA 1GV5A 2M7AA 3QP5A 1X58A 4M6VA 4HNVA 3ZN1A 1R23A 1H88C 1I1GA 1FC3A 1BOBA 3IH4A 2DYRH 1T56A 3DBRB 1T8IA 1LDDA 3F8MA 3DEEA 4OAYA 3LSMA 2LY2A 4ZDOA 4XR6A 1JKPC 1D1AA 2Y0MA 1MNDA 3HUGB 3BCBA 1IDYA 3S3NA 4HAMA 2HS5A 5ICGA 1CF7A 2H94A 4LB5A 2VQLA 5D6EA 1Y8QB 3HRUA 1BM9A 1VQ7I 3HOWJ 1U5TA 3S1NJ 2EBIA 3CDHA 1B72A 5B1BH 3WTXC 3EYIA 3HOZJ 1HF0A 4QTRA 1BIBA 3QPTA 5JVGF 5BQTA 1W4MA 1SFXA 4LK1F 4A2UA 5EG0A 3KIOA 3SEZA 2XAQA 1D3YA 1YS6A 3BTJA 1IN5A 1MSEC 1TW3A 1TP4A 3RQIA 4BH9A 3MAJA 3E7LA 2OV7A 2XGEA 1T39A 5IP9J 2OTJI 3ABTA 3FMQA 2IXSA 1MBKA 3HRMA 1HXDA 2VOPA 2AQEA 4G12A 1R5HA 2K40A 1WHUA 1Y0NA 2R5YA 1IV8A 1D1BA 2EFQA 3KETA 4RGUA 4A3BJ 5B5EC 2X6OA 4KITB 4HX4A 2R7RA 2P6SA 2MW8A 4HG2A 2HKXA 5HNHA 2DTRA 3E97A 3U1DA 4LFUA 2LLKA 3Q9VA 1K78B 1SAUA 1YJWI 5C44J 3OIPA 2KRCA 3JSPA 3GYHX 1XMXA 1U3EM 2JQ7A 1JKQC 5KVRA 1RI7A 4AC0A 5ICEA 2FUG2 3EUHC 4E7JA 2HI3A 1U9NA 2M30A 2G7HA 1YJ9I 3OYCA 2DOFA 1FNNA 1YW8A 2WAQA 2OZUA 1ZRFA 1XGNA 1W5TA 5KAFC 1FP1D 2EZIA 1BIAA 1ZRDA 2CV1A 2ZXWH 4I0BA 1E2XA 1VQ8I 4G7OF 2K9MA 3CUQB 1ZLKA 4MGRA 1XSDA 1I50J 2VPLA 5DDGA 3BTIA 1ETVA 1LQ1A 2KJCA 2AXTC 2R93J 1OYWA 1OCPA 2XSJC 3F0CA 4DBRA 3L7WA 3ZMDA 5ICCA 2GBYA 2XF7A 5C3EJ 1ZYRF 2YR2A 5DD8A 3IC7A 1B4AA 1V5FA 2M0CA 2RQPA 2HVQA 1ERDA 4XIDA 2CUEA 5GAGJ 1VQKI 5CKTA 2X1DA 1XN7A 4LG3A 4GXOA 4ZTJA 2DU9A 4I02A 2VBYA 4BQAA 2Y9YA 3L9FA 1LKXA 4BDZA 5F0FA 4JOMA 2HVSA 3GCMA 3NWSA 1WI9A 4UHTA 3FDYA 4WF2A 3ZQLA 1NG6A 4R8HA 4GRIA 5J4YA 2CRGA 3ASOH 3HJEA 4OWRB 2ZMEB 1RR8C 1W36C 2GZWA 1W7PA 5EDNA 1REPC 1IZ1A 5EF6A 4AVZA 4BQNA 1LVAA 2DLLA 3H1CA 3BZCA 3LSPA 1YOVB 4BXFA 1DU0A 2H8WA 4WWCA 3KZZA 4FX4A 2P5VA 2LRDA 4EQQA 1X1AA 2NXNB 1Q1HA 3HSRA 4S0HB 1R00A 4V2GA 2VONA 2FBKA 3ISPA 5HLTA 1WJFA 3QU3A 1FTTA 1RETA 2X48A 1Y6IA 4CYCA 2ZNYA 2DTZA 3KCCA 3CCQI 1D0ZA 1J59A 1DDNA 3ABUA 1WH7A 2JVGA 4AWXB 2PLYA 2ZSIB 4OMYA 3FHNA 2V1DA 2F5EA 3SFZA 3HL2A 4QPOA 2CS3A 3V4GA 1WSUA 2DFEA 4B3AA 2JA2A 3LAJA 3OYGA 2CQQA 2QSGX 2VOOA 1JT6A 2VL8A 1A6IA 3EUKL 2B9SA 3FIWA 1MMGA 4Q48A 2F2EA 4RB1A 2GWRA 2Y9ZA 2O0YA 3J81Z 3IAS2 2QWWA 2M3AA 2BW3A 2GOMA 2PEXA 1S29A 3CCJI 2L9NA 1ETKA 4CCNA 2FX0A 4HA8A 1EH7A 2BHYA 3A01B 1GXQA 3KYCB 1MSFC 2BY3A 2LYCA 4J01A 1LFBA 1SANA 1NTCA 3BT9A 1FWZA 2KPMA 1R1UA 3G4SI 2QBYB 1I3AA 4BE2A 3KEQA 2P81A 4N0BA 3GEZA 1PUEE 1HBXG 4YRVA 2R7QA 1BR4A 1LVKA 3M1CA 5HDKA 3ONQA 4LITA 3RKXA 4I6ZA 1RZ4A 1UFMA 2PMZA 1G6NA 2VKDA 2LR8A 5IY5H 1QU3A 3OYIA 4X1EA 3D1NI 2KRHA 1WJAA 2JMWA 3MVPA 3C2BA 2M87A 1XSVA 1CQTA 2H27A 4CA0A 4ZYAA 3OY9A 3SDGA 3BR5A 1TLHB 1KYWA 1NHAA 3HDDA 2NNYA 3ZGKA 4PUSA 4UV8A 1V55H 3ZXSA 5D8LB 1SEUA 4OIPF 5BNGA 5E1ZB 1U8BA 1YG2A 2GLOA 1K83J 4DZPA 5EGOB 1YTYA 3K4LA 3DV8A 1I39A 3JRGA 1OMIA 2LDUA 3H5RA 3U9GA 3S2DJ 4U0YA 2E1MB 1XC5A 1VTNC 1X3UA 1P4AA 1P7IA 3D5SC 2UUZA 4LIUA 4IZZA 3IWFA 5H6RA 5J47A 2KIFA 4Y17A 2ZJPF 2KDZA 3BJ6A 3DEWA 3FKIJ 5F6FA 3DKYA 4C2MJ 4EATA 2LF7A 3LSJA 3B02A 5F1JA 5K5QA 3EETA 4RM2A 2DFIA 3QODA 4M71A 3TP3A 2CUZA 3S1MJ 1JI8A 3L2VA 1S8NA 1YRNB 2BXZA 3FXRA 3P9KA 5F0HA 1U9OA 3K69A 2Y0SN 3ERED 3HGGA 1O3SA 2HQRA 3ASNH 4QPQA 1E3PA 5E3OA 3J7YJ 3QQAA 1R4NB 3JRHA 1HCRA 3HC7A 5BMZA 1Z6TA 3LFKA 3KE2A 2Q0OA 2Z5UA 2VJJA 3S15J 4YFKF 3VWBA 2M0MA 1TZLA 3RPUD 2VE8A 4XKBA 3PNTA 1ZN2A 3ZQ7A 1BL0A 4IF4A 3IHUA 4BJ6C 4NC6A 2HYFA 3CF2A 3KYDB 1X2NA 4XRMA 1UB9A 2F4OB 3W6JB 2MABA 3QYBA 2FRHA 5JLXA 2CFOA 1JKRC 1XSXA 3B6AA 2E7XA 2ISYA 4QIWN 3M7GA 1K6OA 1DQUA 2E1OA 2L02A 3CCVI 3VEPA 1XDSA 2QKMB 1UG0A 2W00A 3ROUA 4CO8A 2RVCA 2XSDC 1JGSA 1Z67A 1QO0D 1R4MB 2RN7A 3FXUA 4BKXA 4F52A 1ZQ3P 3CJNA 1GDTA 4CXFA 5IT9Z 2VT2A 3LNQA 2LD5A 2ECBA 4DQ2A 4KMUX 4IHVA 3VODA 2Q2EA 1OKRA 2JA6J 1S7AA 4F55A 3HGYA 2FQ3A 1J7KA 1I5ZA 3H3VK 2K9SA 3HOSA 4HPQA 1ZARA 3KZIC 1L3LA 2QGUA 5J8CA 2V7FA 1VF9A 1J09A 4Y15A 3ZMSA 3E6CC 3WU2C 4LLNA 2AO9A 1XG1A 3N4MA 2W48A 3NWTA 3H3ZA 2P5LC 1PUFB 3GTQJ 2ZFUA 4NQWB 4E70A 1IRZA 2R5ZA 2LOOA 1A35A 3OYNA 2UXXA 2WC2A 2DYSH 5M5YJ 3A0HC 3JREA 3Q0WA 4KNYA 1FYMA 2E2HJ 3G1LA 1JE8A 4A5MA 6PAXA 1OCTC 5DEQA 2DMPA 1OCOH 2DQLA 2JT1A 4KMFA 2E7WA 4PZJA 4L5IA 2HDCA 5AONA 1XPXA 1BR1A 4ON0A 2KIUA 1K7AA 1HA8A 5E8IA 3FXLA 2UV1A 3K2ZA 2CQ7A 5K7ZA 1U5TC 1JHHA 2HYGD 4KA4A 1S72I 2OJED 2HXIA 4P9UA 1FYKA 2MA3A 4G7ZF 4A6EA 5LGNA 1C0WA 2VQHA 3DPTA 4XK4A 2QVOA 1PP7U 2PMUA 4IKFA 3TMOA 2ME0A 4JYKA 4RAYA 4IVNA 1R49A 1IN4A 3F3XA 3T8RA 2WY8Q 1HW1A 2XRNA 3C1DA 1OYIA 4NB5A 3V42A 4IO9F 5E8GA 4XLAA 5IT3A 2STWA 2W85A 4DZJA 3DXJF 5LFAA 2R7WA 3GWZA 3GTOJ 2F6CA 2A6TA 2KZGA 4NQWA 5DM7F 2G0EA 2OA4A 3IWZA 1B9MA 2FOKA 1UCRA 1DU6A 2M34A 1FY7A 1EH6A 1FOYA 4AU7A 3CZ6A 4M74A 3BG9A 4LD5A 1RC9A 3M8EA 4FASD 1AKHB 3J7AY 3MZ8A 3F22A 4XLFA 3K0LA 3OYHA 2D5VA 2F5VA 1IRGA 1ZAOA 2UXNA 3MFKA 3I53A 4NDLA 4NNJA 4LB6B 3GZ5A 3R0JA 2E19A 2OUMA 4D1QA 3A0BC 1YW7A 1YIJI 5L3EA 2Y31A 4I98B 5K7HA 4BYYA 2UZKA 2EPFA 3G6EI 3BG5A 4BJ5C 3BJOA 3HSFA 2J5PA 1FMVA 2Z16A 1QA6A 4E7HA 2K9LA 4FTHA 1VQ4I 4AIHA 4P5OA 5L3BA 1MDMB 1NG7A 1G3WA 2HYJA 1Z3YA 1GLNA 2VQCA 4I01A 1Z0XA 2R7OA 1TQIA 3HUGA 2KL4A 2PMZN 4GYGA 5M3FJ 3VSKA 2MD0A 4M9SA 1IG7A 3VDXA 4IX7A 3ECOA 2XB5A 4NC7A 3SZGA 2G7UA 1G8XA 1TT0A 4HDVA 5A2QZ 4CCOA 4G6DA 2MGQA 2OF7A 4ZYGA 4KN4X 3SZPA 4IRGA 2A3SA 1A31A 4XBFA 2NVTJ 2P7VB 1TWHJ 2LF8A 2V79A 2BHZA 2N8GA 1FIAA 1XGMA 1ZKGA 3CF5F 2NVUB 1YFHA 1ZREA 2XPWA 3CTAA 5CPRB 3V8LA 3I59B 1OYYA 4CICA 1MMAA 1W1WE 1SFUA 1FMWA 4D7MA 1N75A 3GVAA 2ME6A 1QHGA 3DTKA 1MBFA 2DQRA 1XGSA 4M73A 3I64A 3LSRA 1IXCA 1ZGWA 3WGIA 4Q4ZF 3BR2A 2EQRA 2E5ZA 3OYBA 2BOLA 3GLLA 4IJAA 2M2EA 3F72A 5IT9K 2IVMA 3WTSC 4IHTA 1ETWA 1X4OA 2WV0A 1ZELA 1TBXA 4ZYDA 3ZCOA 1TT5B 3GFIA 2PQ8A 1ITYA 2J5OA 3GF2A 3F21A 3GTPJ 3GXOA 2BEOA 2LMDA 4PGGA 2NYXA 4P55A 4G94A 3K4JA 5GTIC 2Y0SA 1SVOA 3I9V2 4JX5A 2LK2A 2WB1A 1EJ9A 4L5JA 2MG4A 2NNNA 1FP2A 1HC8A 5EEGA 1KYZA 3K1MA 3TW7A 3GBGA 2NAZA 3FBNB 3ZMTA 4A0ZA 3G2BA 3PO2J 1YI2I 2M7BA 2MH2A 2CSOA 3E6BA 4B4CA 4DJAA 3AG3H 5FB2A 1E17A 4UVAA 1MJ9A 5GADJ 3QPHA 4HSTA 1FEXA 2E71A 1QVTA 3G1OA 1WVRA 1VQ5I 3TKYA 2V26A 4RGXA 3F8NA 2OTLI 4XN0A 3TO9A 4G6QA 1R6RA 5BPDA 2FOWA 5FKLA 1IO2A 4BBSJ 1FBSA 3L2UA 2MYSA 5D8KB 3BPVA 3H9QA 1XX5A 3GO5A 1AU7A 4UVBA 3RJPA 3KEOA 2K9QA 1W7PB 4ENMA 9ANTA 2UWMA 2X85A 3OMYA 1OJLA 4IQJA 2CW0F 1MH4A 5BOXA 2QF7A 5KK1A 4YELA 2XB0X 2WAFA 2E1CA 3HOVJ 4Y33A 1G3SA 3MQ0A 3CP2A 4ANJA 3MZYA 2R92J 4W1UA 4BS9A 5FKNA 2FBIA 3I59A 5EYRA 3ULQB 1TNTA 2E1MC 2NRAC 2HGCA 3K2AA 5D5WB 3I55I 3AAFA 1Q1VA 3OWTA 4RB2C 2KT0A 3OR2C 3PQKA 4E7SA 4HX7A 1BOAA 3O3KA 4UB8C 3PSIA 2JUCA 3GTJJ 4GGGA 1JUMA 1JHFA 3SXYA 3BZ6A 3BR1A 1OPCA 2W84A 4L9TA 4YIIA 3MKLA 2FE3A 1HDPA 1MW7A 2DOEA 3R4KA 3U21A 1BC8C 1H0MA 3ZQGA 1JUSA 2DW4A 1T08B 4HZFA 3M8JA 5CVRA 4HLYA 2CFXA 2B7EA 4ZTFA 1SAXA 3DBLB 4U7DA 3IH3A 4CZCA 4XLCA 2WV1A 3S8PA 1MMSA 1J0RA 4XLNF 2GA2A 1T98A 3K6GA 2H6CA 3WHBA 3ABMH 2NVQJ 3BDDA 2AHQA 1YX5A 1X1DA 2E35A 3FXOA 3T5XA 4Z2YA 2PBIA 1V5GA 4PFOA 3DPLC 4HQMA 2LKPA 2OAZA 3BROA 1KGSA 4B43A 5HOOA 1H8AC 3K4BA 3C18A 4M3GA 4BY7J 3F8BA 4IXAA 3OYJA 1HQCA 3ZQQA 2HU9A 2QQAA 2LBFA 1IF1A 4DOZA 1USSA 4IHWA 1H9TA 4D9JA 5GPCA 5GAHJ 2IGMA 3CMAI 3PSFA 1UJ8A 4XLHA 2QENA 3V8KA 2ADUA 1Z6RA 4P9FA 4ESFA 3HKZN 3HRSA 1IDZA 1WH5A 4GFBA 1N77A 3VSLA 1E3OC 1RKWA 1WJBA 4QWQA 1BI1A 3PFYA 2JA5J 5ICFA 4EM2A 1D8JA 1Y1VJ 3WG7H 1AOYA 3NARA 2MC3A 2CGPA 1I6HJ 2L4AA 1TW2A 1UMQA 2P0WA 3F6VA 3T8TA 3OYLA 1IXSB 4IHYA 2DPUA 3J80Z 3KP7A 4R1HA 1A04A 1V5EA 3LA7A 2GQQA 4IQ4A 1LFPA 4L9JA 4B48A 3I0TA 2HTSA 1ZG1A 1CF7B 2NOGA 2XPVA 2HZTA 3TDUC 3QRFF 2OPTA 1DP7P 1FBUA 1Y39A 3E1SA 2V9KA 3NRVA 1W36D 5H2FC 2W25A 3DEUA 4RMNA 3DKWA 5DUIA 1SFEA 2O3FA 3ZMZA 1DGWY 2EILH 3IKTA 2K4BA 3P5JA 1L0OC 5E18F 4YIRX 1XS9A 4MHGA 2Y30A 5AIQA 2XAHA 3KFWX 4BXUA 3V8JA 1X2MA 3K9TA 4CSWA 1VQOI 3E0JB 1MJAA 2BYVE 2E34A 3CCUI 1EH8A 3HOTA 1AWCA 1TWGJ 2QLZA 2GXAA 4IRHA 4BBRJ 1OLTA 2W82A 1UZCA 3BR3A 4LLLA 2QQ8A 2DT6A 4B1RA 2O61A 2DXIA 4WXDA 1B8IB 4OU0A 4XKVA 3O2PE 5C4XJ 3TDZC 3VOEA 4RB3C 4K2EA 3GUDA 1HDDC 1HSJA 3IAM2 4JP0A 1ON1A 3LA2A 2BXYA 2XAGA 3ESWB 5FLXK 3BR6A 3A1YA 2EA4A 1VQMI 3I3LA 1P4XA 1MBHA 3HYIA 5FROA 4EV0A 2K3PA 2PMHA 5EGOA 2LSOA 4BQOA 2W7NA 2OD5A 3OYMA 4UB6C 4ASNA 1FZPB 2JK3A 2IS2A 5HLIA 1NK3P 4M9XA 2OBPA 4BJTA 2HNHA 3FXMA 2B0LA 1IRXA 2AS5F 1R5GA 4O3MA 2EZHA 3EUAA 2DMTA 1YYVA 4F7ZA 2Q2EB 3W2WA 2BZTA 3G71I 3ZQCA 4Q5SF 4BHPA 4GO1A 4HX8A 2JRMA 3J81K 3HM5A 1LE8A 2JWTA 3E5XA 2HQAA 1P2FA 3COAC 2MH9A 4EJOA 3ELKA 5LD2C 3Q5FA 4PJ0C 5IYBJ 1T33A 4DBQA 2CMPA 4EJUA 1WQ2A 3E6DA 3LMMA 2H8RA 2XGCA 2L5QA 4U87A 1D0XA 2YU9J 2DODA 5M3MJ 2ZXHA 4PFPA 4HBLA 4EM1A 4IHXA 3M4OJ 3EPZA 1VQPI 5LLQA 2VJ5A 3MKWB 5DS9A 2DA3A 3H9JA 3S16J 5CVIA 5F08A 2ZJ2A 1VNDA 1AHDP 2K02A 3RZOJ 1GV2A 4PSWA 1JJ8C 4BY1J 1DPUA 4A0XA 1X3ZB 1WJ5A 5E1XA 4ZYEA 2VC1A 4G8XA 2WB1N 2P8TA 4WX9A 1RIOH 2VBXA 1Z3XA 3K10A 2X1EA 1IN7A 1XMAA 2R5ZB 3OOPA 5FD6A 2BW3B 3CJQB 3AL0C 1TWCJ 2YUSA 3I4MJ 2DT7B 1MH3A 1R36A 4ABZA 4KT6A 1T95A 3CCLI 1T0FA 2A6HF 1YHQI 3EYYA 1JT0A 3CC2I 1K78A 4LG0B 2M8GX 1KU9A 4UY8I 4Y13A 2L4MA 4AD9A 5LHGA 4P1WA 2D2WA 3D5LA 2O03A 3RKQA 2HQNA 2CW7A 2ZMEC 3BG7A 3PO3J 5DTDA 3QPSA 3E6MA 3AG1H 4R79A 2L54A 1ZK8A 1E0EA 4AIKA 3GTMJ 1G4DA 3HB9A 4XNFA 2A05A 3BP8A 2YSRA 2Z99A 3WTUC 5C4JJ 1B9NA 2EV0A 3QAHA 5M5WJ 2ZO4A 3T1BA 3TEDA 2DMNA 1QQIA 1FOWA 1S3JA 3VYTB 2X1CA 3FX3A 1UG2A 5ILVA 1MMDA 1GUUA 3HRTA 1B1BA 3HXLA 5FKMA 3H5AA 2FF4A 4GCVA 1FYLA 1BI3A 2K85A 1SD4A 2FBHA 1S9HA 4J00A 3CCMI 1Z77A 2VKEA 2IS6A 4DIQA 2DK8A 1FPQA 4ZC3A 1POGA 2CQNA 2R7UA 4MTEA 3CD6I 1QHHD 3CJRB 4S04A 4A3DJ 1X19A 3J7ZI 2HOSA 2RAEA 2GXBA 3MKZA 4XMYA 2DO7A 3KPHA 1A5JA 4FHTA 4KISA 5ILUA 3JAMZ 4DYRA 4BHBA 2EK5A 3G1MA 2DT5A 1O3QA 5F1RA 2LY9A 2Y69H 2LNBA 5B3SH 3EDPA 1R5ID 3LSGA 5FD5A 2ZMEA 1VQNI 2GA1A 4A3LJ 3H0DA 1QNTA 3K4KA 1U8RA 5K5RA 1HLVA 2EJRA 4M72A 2V1XA 3LWFA 2L9SA 3RKYA 4C3IJ 5JFRA 3FK6A 4LJZF 4CCLA 4ENKA 1SD7A 1BJAA 2EFPA 2K9NA 1K4SA 1XCVA 1B8IA 2ZXIA 4I99C 2XDVA 1Z7UA 3I4PA 1S6LA 4PJLA 3FXQA 2A07F 1Z05A 5B1AH 4HV5A 5FLMJ 1MKMA 4F3QA 4ZH4F 3JRAA 1OCRH 4D5FA 2H1KA 1H89C 3TOBA 3U1KA 2RGVA 3SJMA 5JLWA 4RB0A 2GAUA 5LBQA 2KRFA 1LNWA 4NBQA 2ACJA 3A01A 3S1RJ 3HKZA 2WAEA 3L2QA 1WJDA 3X2QH 3FBIB 1TC3C 3HOYJ 4A93J 3Q0VA 1AKHA 2YS9A 3BG6A 3FZVA 1TTYA 4FISA 4L18B 2R7VA 1APLC 3WGHA 2L7FP 4E7ZA 3OYAA 2K27A 3OS2A 2JJ7A 2VB6A 3R61A 3KX2A 5B66C 3DU6A 2C6YA 1WZ2A 5E3MA 3CLQA 2IGOA 3FMRA 3D0SA 2GXGA 1YO5C 3K1NA 3CCEI 2DA2A 2KP6A 5TJJA 3S93A 1EKEA 3REOA 2W1OA 2FA5A 2L3DA 3PL8A 4HNTA 3WTTC 3R60A 2Y48A 1ETYA 1D5VA 4LOCA 2NVXJ 2IAIA 2FU4A 2RKHA 3IKVA 4KJZA 2VJ4A 1MMNA 1UAAA 1W5CC 4I7HA 4NC8A 3BTLA 2EFWA 5JR3A 4ZZLA 1ETOA 2DA5A 4OMZA 5CVVA 3GTKJ 4UNOA 1OR7C 5H6QA 4ZDPA 1AA7A 4CDGA 1HKTA 3RI4A 4I2OA 5F04A 1GT0C 3O8HA 2LVSA 4OIOF 3A4CA 3TBIA 1N25A 5TISC 1XDUA 1O57A 4C9YA 2CUFA 2EB7A 3GX4X 4B09A 4BE0A 3PM1A 3WGGA 5KCMA 1MJBA 4CYDA 3NEUA 1MD0A 4JX6A 5GP9A 2QSHX 3GTLJ 4PCQA 2VJIA 1BC7C 4MNUA 2BBYA 1UHMA 2EZLA 3LSTA 4AIDA 4BE1A 3JTHA 3FKJA 4XRFA 1Y56A 2HDWA 2ZCWA 3PNVA 4N4NB 4KFCA 4L0YB 2O8XA 4HLXA 1ONVA 2Z3YA 4YFXF 5DYMA 4UUSA 3OYFA 3OSFA 2NVYJ 4CZZA 2XHKA 4L5EA 5GPAA 1USTA 2PJPA 3TQNA 2GM4A 1YIOA 3DTEA 3B73A 1F9NA 3JRIA 2BVLA 2JN6A 3TL4X 3LFUA 2YU3A 3SEQA 5ED4A 2ZJRF 1BN5A 2LREA 3MEXA 2VKHA 1IN6A 3N97A 3MD2A 3AG2H 3ZR8X 5J1UA 3HIFA 4G7HF 1FJLA 2X9DA 1U6GA 2DFFA 5EJCA 2OCEA 4D5CA 2EIKH 2CV0A 5HVQC 2WWYA 2H1LA 3ZQIA 2RC4A 3MN2A 3VB2A 1IC8A 2HWVA 5KNLA 2W57A 5D5UB 4KICA 1TQMA 4XORA 3CUOA 5HS8A 1LFUP 2DK5A 2R7FA 3K4MA 1W5SA 3IRQA 5HS7A 1IUYA 3K70D 1YLFA 3JW4A 4F92B 1T38A 1E3HA 4GDFA 2HXOA 1YJNI 1WWXA 2VIXA 2HR3A 5K7FA 5DCMB 4XOPA 3E5UA 3OS1A 1M1EB 2R5YB 4L9VA
chains in the Genus database with same CATH topology
3ABLH 2EIMH 3ABKH 1OCOH 1V54H 3AG1H 3AG4H 2Y69H 5B1BH 5B1AH 5B3SH 3AG2H 1OCRH 1V55H 2EINH 2DYRH 3ABMH 3ASOH 5IY5H 3AG3H 2OCCH 1OCZH 2EIJH 2EIKH 2ZXWH 3WG7H 1OCCH 3X2QH 3ASNH 2DYSH 2EILH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ABL H;  2EIM H;  3ABK H;  1OCO H;  1V54 H;  3AG1 H;  3AG4 H;  2Y69 H;  5B1B H;  5B1A H;  5B3S H;  3AG2 H;  1OCR H;  1V55 H;  2EIN H;  2DYR H;  3ABM H;  3ASO H;  5IY5 H;  3AG3 H;  2OCC H;  1OCZ H;  2EIJ H;  2EIK H;  2ZXW H;  3WG7 H;  1OCC H;  3X2Q H;  3ASN H;  2DYS H;  2EIL H; 
#chains in the Genus database with same CATH topology
 1TL8 A;  1FOX A;  1ZTR A;  5J4V A;  2ZC2 A;  1YS7 A;  2DDA A;  2Z1D A;  4M6Y A;  1DUX C;  5ILS A;  2M9H A;  2XGX A;  3ML6 A;  4RS8 A;  4EJV A;  1QVU A;  2TCT A;  5LHH A;  3M3Y J;  2DA4 A;  3KLN A;  2MLK A;  2R7Z J;  3JSO A;  5IP7 J;  4HW0 A;  2RRE A;  2IEK A;  3ZRG A;  1F4K A;  3FF5 A;  2DOA A;  2A6E F;  5J6X A;  1JGG A;  3CJT B;  1S7O A;  4AUX A;  4C2U A;  4DW6 A;  2M5W A;  4Y4R A;  3VYR B;  3KP2 A;  2W24 A;  4HF1 A;  4UUS B;  4S05 A;  4MIM A;  2VBZ A;  2VQG A;  4HDU A;  3RZD J;  4HQE A;  1X3W B;  1QBJ A;  3GFJ A;  1LE8 B;  1IN8 A;  1V4R A;  2KDO A;  4OAZ A;  1ENH A;  5KAI C;  3ZQF A;  3DTI A;  2D1V A;  4MTD A;  1BI0 A;  2HOT A;  1YX3 A;  4BEH A;  4X6A J;  2MSY A;  3PUF A;  4XOT A;  2HPM A;  4RLF A;  2HEO A;  4HRI A;  2OU2 A;  1J9I A;  4DGW B;  4BDY A;  4ESB A;  3KYL A;  4MEY F;  3SFI A;  2DPD A;  2GIZ A;  4WCG A;  1WGX A;  4QSH A;  3HZJ A;  2WY7 Q;  5E17 F;  3HTU A;  1O4X A;  3MKY B;  5H20 A;  2LP0 A;  3DBH B;  3FM3 A;  3WU0 A;  4RAG A;  2QEX I;  2HPI A;  1I3Q J;  1SVL A;  1IAW A;  2Q8K A;  3OIQ A;  5LEK A;  1MNE A;  3V7C A;  5D5V B;  2KLO A;  3M07 A;  3IH2 A;  5BS6 A;  5EZH A;  2V9V A;  3O8G A;  2IT0 A;  5IOY A;  3AL0 B;  2ZB9 A;  3SQN A;  1J5Y A;  3JCU C;  4XLE A;  1G3T A;  3IUO A;  2XKO A;  3IV5 A;  1IV6 A;  1NK2 P;  2IA1 A;  3PJR A;  2IW5 A;  3ZOB A;  4DYQ A;  3G73 A;  2HDD A;  2L2O A;  1RR7 A;  4BL0 B;  1Y0U A;  3O6B B;  3KP4 A;  1BBY A;  4PSX A;  2V1N A;  2OCC H;  2IPQ X;  3FM5 A;  1SFK A;  1P9Q C;  3IL2 A;  4LIV A;  3ECH A;  2ZFW A;  2OC6 A;  4KN7 X;  3S14 J;  3CES A;  4ZJZ A;  2FJ1 A;  3FXJ A;  1RUO A;  5FKO A;  2FEZ A;  2FQ4 A;  2HTJ A;  4EJT A;  5AIP A;  3N05 A;  2Y75 A;  1FX7 A;  3I4N J;  4PJN A;  1GVJ A;  1J75 A;  3BJA A;  3DPU A;  4G6T B;  2LY1 A;  1G59 A;  2RNG A;  1VQ6 I;  2LC2 A;  4FQG A;  1EF4 A;  3G3Z A;  1GXP A;  3S1Q J;  2P5K A;  2L7M P;  2ECC A;  3BZK A;  3ZMV A;  5DCM A;  4AVP A;  4OIN F;  4MFD A;  5HDN A;  4F91 B;  5K5O A;  3K4C A;  2MFZ A;  3CMY A;  1Z7L A;  3PQJ A;  1KQ0 A;  1IGN A;  2DN0 A;  2LTP A;  4IOC F;  4Q47 A;  2R7S A;  2XKP A;  1S7E A;  2F4M B;  2XF6 A;  5CVJ A;  1TQP A;  2EV5 A;  4YEJ A;  1FIP A;  5JHU A;  5GAE J;  3BLY A;  4KIB A;  4BU2 A;  1H9G A;  2E5N A;  5HS9 A;  2MC4 A;  2PN6 A;  2KIM A;  2KMU A;  3J7A O;  2BE5 F;  5DUK A;  1O7F A;  3F6O A;  2EH3 A;  1SC7 A;  4AM3 A;  1G2H A;  4O5V A;  4BGD A;  3CDL A;  3K7A J;  2KHM A;  2STT A;  2V6E A;  1D0Y A;  3D5R C;  2HFH A;  2ID6 A;  3UKG A;  3TW6 A;  5KHD A;  4N9H A;  4A69 C;  1LPQ A;  3TO6 A;  2CV2 A;  4BXX J;  1ODD A;  2GIV A;  4H0E A;  2E2J J;  3OL3 A;  5F64 A;  1DP3 A;  1UEL B;  4LG0 A;  4WK8 F;  3SHF A;  2JPB A;  2EV6 A;  1ETX A;  2Z9O A;  3OS0 A;  1FT9 A;  4ENJ A;  4A3K J;  2ZKZ A;  3HG9 A;  4RAZ A;  2PI0 A;  3S17 J;  1F43 A;  2R7D A;  3F8F A;  1QGP A;  2X0L A;  3LA3 A;  2TRT A;  4CCK A;  4C3H J;  3J80 K;  3DKX A;  5L3F A;  4MQ9 F;  1KA8 A;  1FBQ A;  4IL6 C;  5CJ9 A;  5FKK A;  3KP5 A;  4HF2 A;  3BWG A;  4N9I A;  2KFD A;  2AQF A;  2K4J A;  2QQ9 A;  1EA3 A;  3H36 A;  2CW8 A;  1TWA J;  2QM3 A;  2CQK A;  5LRS A;  3HHH A;  3RIR A;  3K1P A;  4HF0 A;  2VPR A;  4GYI A;  4E4H A;  3GW2 A;  2QSF X;  3QOP A;  4A3J J;  3SYT A;  1ULY A;  3RYP A;  2DJI A;  2EFO A;  3CQZ J;  1WRJ A;  2VOD A;  1BJZ A;  3F8C A;  1GVD A;  1OFC X;  1HW2 A;  3LOC A;  3H9G A;  2EWN A;  1U5T B;  3M9A A;  3U2R A;  4J19 A;  1XMK A;  4XKW A;  2KIQ A;  2QKL B;  1TNS A;  4B3X A;  1WJC A;  2XVC A;  3CME I;  5HLH A;  1VZ0 A;  2K5C A;  1F1Z A;  2H6B A;  2K3F A;  3QWL A;  3GFM A;  1TWF J;  1I27 A;  2EFN A;  1P92 A;  3OOU A;  4PK4 A;  2GOX B;  1K6Y A;  4RBO A;  1V54 H;  3C3W A;  4L0Z B;  3K70 C;  4HEA 2;  5HOD A;  1YW9 A;  2I10 A;  4UUT A;  3UR3 C;  3SDB A;  4MEX F;  4F93 B;  1Z9C A;  3BC8 A;  5EZG A;  3EQL F;  1RES A;  3OYK A;  1A36 A;  1QPM A;  4RAF A;  2XV4 S;  2WAD A;  4A3C J;  1P4W A;  4UXN A;  3CUQ A;  5DD4 A;  3FK7 A;  1U2W A;  4O6J A;  3HTS B;  3CMM A;  3CCR I;  4KDP A;  4A6D A;  3W6V A;  3A2K A;  1ORK A;  2FMY A;  4XQF A;  2KKO A;  4JBA A;  4CUG A;  4XRS G;  3WTV C;  2JA7 J;  1NH3 A;  3PIP F;  5EEA A;  2ZSH B;  3CDI A;  4AYB N;  4IPA A;  2QA4 I;  2YX4 A;  1UHS A;  1ZGJ A;  5E1W A;  1RUN A;  3P9C A;  4CH7 A;  1JKO C;  3OV8 A;  2L9V A;  2K7L A;  2LKX A;  2YPR A;  3EUH A;  1ZR4 A;  3CO6 C;  5IYC J;  1BW6 A;  2PX9 A;  2ELJ A;  1D8K A;  2A5Y B;  1U0J A;  4ESJ A;  2L7Z A;  2V4J C;  2XF5 A;  4II3 A;  4ZYH A;  2VT3 A;  5FRM A;  3MCZ A;  1KU7 A;  2ZNZ A;  1X4P A;  4EGZ A;  3KEY A;  1ZGA A;  2VC0 A;  2OZ6 A;  4MO7 A;  3RQ4 A;  2XAF A;  4NHJ A;  4I09 A;  2BY2 A;  1X1P A;  2EIJ H;  2DA7 A;  5FFZ A;  5LRR A;  3CO7 C;  3LSK A;  4EVI A;  4G9Y A;  5LGT A;  1B6A A;  2DAO A;  4BUP A;  1OIS A;  1O3R A;  3JTG A;  4E7L A;  4BAY A;  3ZMU A;  3HHG A;  2IGK A;  1HOM A;  1T6S A;  5EG0 B;  2DA6 A;  3H5N A;  4IOA F;  4A3M J;  2VUM J;  5TRD A;  3I56 I;  1ACI A;  3DLA A;  3GLX A;  4LLG F;  5D6F A;  2M4G A;  2XAS A;  1KU2 A;  3MWM A;  4CCM A;  2IP2 A;  3RYR A;  3F23 A;  4Z6Y A;  3HOX J;  2O9L A;  1F5T A;  3GZN B;  3GZ6 A;  5J1R A;  2JA8 J;  3WTY C;  2IS1 A;  3LQQ A;  3WG9 A;  1X1C A;  2VE9 A;  4E6K G;  2ISZ A;  2P4W A;  3I58 A;  4II2 A;  2BV6 A;  1ZLJ A;  4U88 A;  3S3M A;  3C2G A;  3DCF A;  1X1B A;  1VI0 A;  3BTC A;  2Z2S B;  3W3C A;  2CO5 A;  2XC7 A;  1MDM A;  2B63 J;  3Q0U A;  3S2H J;  2A69 F;  3L00 A;  2DFH A;  2FXA A;  4M3D A;  4AIJ A;  3CC4 I;  5CVU A;  2KIS A;  3RSN A;  1U78 A;  4H4K C;  1BR2 A;  1BI2 A;  4C2T A;  1IUF A;  2F5F A;  3PNY A;  1MGT A;  2OQR A;  1WJE A;  2CJJ A;  2LBF B;  1QZZ A;  3QYF A;  1XCB A;  1FSE A;  5A2Q K;  5FRN A;  2VAS A;  3ZQH A;  3DLL F;  3BY6 A;  2O7O A;  5JI6 A;  1IW7 F;  1QZE A;  2DMU A;  1GHC A;  2Z33 A;  1QPI A;  2L7K A;  5HDG A;  2CYY A;  1KQ9 A;  1SMT A;  2L9R A;  4CYC B;  2ELH A;  4MQV A;  1PP8 F;  2IA0 A;  5TGT A;  2FD5 A;  5L3C A;  5CQG A;  2JZY A;  3L2W A;  1IJW C;  1XGO A;  3LQR A;  5LGU A;  1FOK A;  2BGC A;  1MZB A;  1MBJ A;  2VBW A;  2Y2Z A;  3KZY A;  3L2C A;  2IGN A;  2CG4 A;  2CU7 A;  1R9T J;  4FX0 A;  4HOB A;  3Q9S A;  3I5U A;  1RRJ A;  5J3L A;  3OL4 A;  1W0T A;  2QUF A;  1F36 A;  3GFL A;  4FET A;  3OR1 C;  5E79 C;  4PJM A;  2XGD A;  2L0K A;  2XRO A;  3CC7 I;  1XB4 A;  2HOE A;  1UHW A;  3BQZ A;  3TP0 A;  2F5D A;  2NOJ B;  4JX4 A;  4ITV A;  3FXK A;  1R1V A;  1V3F A;  1B72 B;  2O8K A;  4EM0 B;  4C30 A;  4XKC A;  4LMY A;  3BOQ A;  3RTR A;  2LH9 A;  1ZH5 A;  3RKW A;  2YX7 A;  2MD5 A;  1QRY A;  5IOZ A;  1K79 A;  2O5R A;  5GTH C;  1T0F C;  2DCE A;  2EIN H;  1MBG A;  1JXS A;  4IEJ A;  3HSE A;  2ICW G;  1K61 A;  3QU6 A;  4E7K A;  1KZH A;  4MLO A;  5JVT A;  2QBY A;  4HYE A;  1RKT A;  1PDN C;  4ENN A;  4XLP F;  3L1P A;  2ID3 A;  1A6Q A;  2R0Q C;  1O7L A;  1ZG5 A;  4PJJ A;  2XPU A;  1XTA A;  2HOA A;  2G9W A;  5E3L A;  5DCF A;  1Z21 A;  3P9I A;  2QQB A;  3VFZ A;  1VQ9 I;  3LSI A;  2HVR A;  2ELK A;  4IHS A;  4Y3O A;  1WPK A;  1JTX A;  3RPQ A;  4LGW A;  4UUV A;  5IYD J;  3VYS B;  1ZG3 A;  2ESN A;  2R7X A;  3HEF A;  3QYE A;  3R6S A;  4Y52 J;  2IA2 A;  4RA2 A;  2V6C A;  2JSP A;  1KU3 A;  4RM3 A;  5D4S A;  3H35 A;  2RNJ A;  3WE3 A;  4WXC A;  5K1Y A;  3ZPL A;  1Z1D A;  2P7C B;  2NS7 A;  5F27 A;  1SD6 A;  2FSW A;  4QLC U;  3AFH A;  5L3D A;  5M5X J;  5J8F A;  4CGZ A;  2X6X A;  4V19 K;  3JRB A;  5E20 A;  2X4H A;  3F9K A;  4FE4 A;  4UV9 A;  2FML A;  2D45 A;  1D1C A;  4BAC A;  3PIO F;  2FNA A;  1OCZ H;  1R7J A;  3WE2 A;  4ZZD A;  3DFG A;  3H92 A;  4BEH B;  3OYE A;  4HSR A;  3Q3S A;  3WHC A;  3KLO A;  1BW5 A;  4RGS A;  3QP6 A;  4CHU A;  2Q1Z B;  5HNF A;  2W4S A;  3CLO A;  4A3F J;  4XRS A;  1SD5 A;  3P7N A;  4HNU A;  2D1H A;  3TO7 A;  4N4O B;  2A68 F;  1SMY F;  1I6X A;  2L01 A;  2E2I J;  4LK0 F;  1HKQ A;  3BQY A;  2AXL A;  5FFX A;  3T0Y A;  5BPI A;  2VLA A;  3E3V A;  2KZV A;  3L2R A;  2OQG A;  1LJ9 A;  1Z91 A;  2BVM A;  5LHI A;  3DU5 A;  5FJ8 J;  2E60 A;  1J2X A;  4FT8 A;  4RGR A;  3S3O A;  1ZR2 A;  1FLI A;  2IS4 A;  2R4G A;  4FCY A;  3HPH A;  2RQQ A;  3AKZ A;  3BPX A;  1I1S A;  2ZXJ A;  5ERI A;  4A5N A;  2VI6 A;  1LDJ A;  2IRF G;  3H3U A;  5FGM A;  4M6X A;  4A0Y A;  5DV5 A;  2COM A;  4Y7N J;  3JRF A;  1KON A;  1EV7 A;  3FWE A;  1LEA A;  4M3E A;  2IBD A;  4B47 A;  5JHF A;  1VQL I;  1R1T A;  2PG4 A;  3PFI A;  4FE7 A;  5FLX Z;  3QPL A;  2DA1 A;  2O6G E;  5CYV A;  4MFE A;  1OQY A;  4U0V A;  3JR9 A;  4AYB A;  2WA0 A;  2A61 A;  3IP4 B;  4X0G A;  1YRN A;  2LFB A;  1RPW A;  2PFB A;  4BNC A;  1MBE A;  2DMQ A;  3TOA A;  3W6K B;  2HZD A;  2HKO A;  3VPR A;  2M1B A;  3I54 A;  4BHC A;  1R58 A;  2FNP A;  2WAQ N;  2XAU A;  3DQV C;  3AG4 H;  4JK1 X;  1PYV A;  1FSH A;  3RPU A;  3KP6 A;  1YQA A;  4XIC A;  3H0G J;  2V9P A;  2DI3 A;  4I0A A;  4XON A;  3ZN0 A;  3OYD A;  4YG2 F;  2RDP A;  5DM6 F;  1K4T A;  5L3G A;  2WBM A;  3R0A A;  2I8D A;  4PDK A;  4DYC A;  1Y8R B;  4EMS A;  1ETQ A;  3DWL E;  2LKS A;  4YIF A;  3GTG J;  2JPC A;  1YE9 A;  2P6T A;  4EGY A;  1PUF A;  4ZDL A;  4B8X A;  2DJN A;  3LSH A;  4KUM A;  2BY1 A;  1BA5 A;  5CLS A;  1KQ8 A;  3C2H A;  4M9Z A;  2QZ8 A;  5D4R A;  3M8F A;  3V7R A;  2V1U A;  2A5W A;  2XUB A;  1O3T A;  1D5Y A;  2ESH A;  4M3B A;  3OSG A;  3LAP A;  2E1N A;  3K4N A;  2CWE A;  1XD7 A;  2JUG A;  2M8E A;  3I71 A;  2DBB A;  2VXD A;  4E7I A;  2VN2 A;  2F5C A;  4I76 A;  1S5L C;  1DPR A;  4L9N A;  3E5Q A;  3MZH A;  1T2K A;  1WCM J;  4XN3 A;  1Y1W J;  3BR0 A;  1W0U A;  2XAJ A;  3WU1 B;  3L09 A;  4A3I J;  1WFX A;  3BG3 A;  3GME A;  1IXR C;  3B6C A;  3CUQ C;  1N78 A;  3CCY A;  1MIJ A;  3V7S A;  2HQ5 A;  4XL9 A;  2JSC A;  2VXZ A;  3TGN A;  3FHZ A;  2KJB A;  5IP6 A;  1STZ A;  3LL7 A;  5HLG A;  2VKV A;  1WI3 A;  2R7T A;  4TV7 A;  2KQR A;  5J40 A;  5F0C A;  3JRD A;  2E36 A;  1SFO J;  4KIF A;  4A3E J;  3SZT A;  4A3G J;  4XSX F;  3W2V A;  2NS0 A;  4OIR F;  1JUP A;  1VFC A;  2ZBK A;  2CQX A;  2EZK A;  2MLG A;  1DGR M;  4P96 A;  4M3F A;  1LUJ B;  1FTZ A;  3DF8 A;  4JQF A;  1CGP A;  4OOI A;  5D5X B;  3HOU J;  5CQE A;  1PVE A;  3MMY B;  3S32 A;  1ON2 A;  3A02 A;  3C7J A;  1LB2 A;  2PJR B;  1G3Y A;  2WTE A;  4XM3 A;  2NS8 A;  1HST A;  1WKM A;  2CH0 A;  2X6Y A;  4NUB A;  5EEH A;  4WXH A;  3JRC A;  1W7P D;  2F48 A;  4BQQ A;  1ZHF A;  3NQO A;  2H09 A;  5J1Y A;  3ABK H;  2M4K A;  3WTW C;  1P7J A;  1R22 A;  4XSZ F;  3PUB A;  3W2A A;  1HKS A;  3OIO A;  1SVM A;  4YFN F;  4KIG A;  5FLV A;  2QYO A;  3JAM K;  3BCA A;  4OIQ F;  2JRT A;  4PGH A;  2BY0 A;  2R3S A;  2COB A;  3KP3 A;  4IRI A;  4UVC A;  3NAU A;  5LEJ A;  2I5U A;  2ETH A;  1OCC H;  3DP7 A;  1B59 A;  2M45 A;  3WOD F;  4U7B A;  2X6W A;  2LG4 A;  3HBL A;  1ZRC A;  1RNL A;  1P6R A;  4C3J J;  1MNM C;  1R71 A;  3WTZ A;  4RDU A;  1JJ6 C;  1HW5 A;  2EIM H;  4U0W A;  2RV8 A;  4D0P A;  3FIS A;  2CUJ A;  3FMS A;  5FO5 A;  1IRF A;  3ZP5 A;  3IRR A;  2F4I A;  5E3N A;  3QOE A;  1QZY A;  1PJR A;  3ERM A;  2QCO A;  1LEB A;  4RLQ A;  4EJW A;  4KT5 C;  2DDB A;  2K86 A;  2MBF A;  4V2F A;  2X51 A;  3M1E A;  3UNG C;  3S2W A;  3VYU B;  4EEF G;  4ETS A;  4A12 A;  2ZJQ F;  4CCJ A;  5IPA A;  4KYW A;  1LDK B;  2TDX A;  2XIG A;  2EA2 A;  3CP8 A;  2IJL A;  1YIT I;  4B44 A;  4W97 A;  2XRL A;  4HV6 A;  2JVH A;  3A03 A;  3HPG A;  1JTY A;  1OR7 A;  2JTV A;  3RCO A;  3RDI A;  4D7N A;  4DNC A;  3ABL H;  3CCS I;  2PJR A;  1GV5 A;  2M7A A;  3QP5 A;  1X58 A;  4M6V A;  4HNV A;  3ZN1 A;  1R23 A;  1H88 C;  1I1G A;  1FC3 A;  1BOB A;  3IH4 A;  2DYR H;  1T56 A;  3DBR B;  1T8I A;  1LDD A;  3F8M A;  3DEE A;  4OAY A;  3LSM A;  2LY2 A;  4ZDO A;  4XR6 A;  1JKP C;  1D1A A;  2Y0M A;  1MND A;  3HUG B;  3BCB A;  1IDY A;  3S3N A;  4HAM A;  2HS5 A;  5ICG A;  1CF7 A;  2H94 A;  4LB5 A;  2VQL A;  5D6E A;  1Y8Q B;  3HRU A;  1BM9 A;  1VQ7 I;  3HOW J;  1U5T A;  3S1N J;  2EBI A;  3CDH A;  1B72 A;  5B1B H;  3WTX C;  3EYI A;  3HOZ J;  1HF0 A;  4QTR A;  1BIB A;  3QPT A;  5JVG F;  5BQT A;  1W4M A;  1SFX A;  4LK1 F;  4A2U A;  5EG0 A;  3KIO A;  3SEZ A;  2XAQ A;  1D3Y A;  1YS6 A;  3BTJ A;  1IN5 A;  1MSE C;  1TW3 A;  1TP4 A;  3RQI A;  4BH9 A;  3MAJ A;  3E7L A;  2OV7 A;  2XGE A;  1T39 A;  5IP9 J;  2OTJ I;  3ABT A;  3FMQ A;  2IXS A;  1MBK A;  3HRM A;  1HXD A;  2VOP A;  2AQE A;  4G12 A;  1R5H A;  2K40 A;  1WHU A;  1Y0N A;  2R5Y A;  1IV8 A;  1D1B A;  2EFQ A;  3KET A;  4RGU A;  4A3B J;  5B5E C;  2X6O A;  4KIT B;  4HX4 A;  2R7R A;  2P6S A;  2MW8 A;  4HG2 A;  2HKX A;  5HNH A;  2DTR A;  3E97 A;  3U1D A;  4LFU A;  2LLK A;  3Q9V A;  1K78 B;  1SAU A;  1YJW I;  5C44 J;  3OIP A;  2KRC A;  3JSP A;  3GYH X;  1XMX A;  1U3E M;  2JQ7 A;  1JKQ C;  5KVR A;  1RI7 A;  4AC0 A;  5ICE A;  2FUG 2;  3EUH C;  4E7J A;  2HI3 A;  1U9N A;  2M30 A;  2G7H A;  1YJ9 I;  3OYC A;  2DOF A;  1FNN A;  1YW8 A;  2WAQ A;  2OZU A;  1ZRF A;  1XGN A;  1W5T A;  5KAF C;  1FP1 D;  2EZI A;  1BIA A;  1ZRD A;  2CV1 A;  2ZXW H;  4I0B A;  1E2X A;  1VQ8 I;  4G7O F;  2K9M A;  3CUQ B;  1ZLK A;  4MGR A;  1XSD A;  1I50 J;  2VPL A;  5DDG A;  3BTI A;  1ETV A;  1LQ1 A;  2KJC A;  2AXT C;  2R93 J;  1OYW A;  1OCP A;  2XSJ C;  3F0C A;  4DBR A;  3L7W A;  3ZMD A;  5ICC A;  2GBY A;  2XF7 A;  5C3E J;  1ZYR F;  2YR2 A;  5DD8 A;  3IC7 A;  1B4A A;  1V5F A;  2M0C A;  2RQP A;  2HVQ A;  1ERD A;  4XID A;  2CUE A;  5GAG J;  1VQK I;  5CKT A;  2X1D A;  1XN7 A;  4LG3 A;  4GXO A;  4ZTJ A;  2DU9 A;  4I02 A;  2VBY A;  4BQA A;  2Y9Y A;  3L9F A;  1LKX A;  4BDZ A;  5F0F A;  4JOM A;  2HVS A;  3GCM A;  3NWS A;  1WI9 A;  4UHT A;  3FDY A;  4WF2 A;  3ZQL A;  1NG6 A;  4R8H A;  4GRI A;  5J4Y A;  2CRG A;  3ASO H;  3HJE A;  4OWR B;  2ZME B;  1RR8 C;  1W36 C;  2GZW A;  1W7P A;  5EDN A;  1REP C;  1IZ1 A;  5EF6 A;  4AVZ A;  4BQN A;  1LVA A;  2DLL A;  3H1C A;  3BZC A;  3LSP A;  1YOV B;  4BXF A;  1DU0 A;  2H8W A;  4WWC A;  3KZZ A;  4FX4 A;  2P5V A;  2LRD A;  4EQQ A;  1X1A A;  2NXN B;  1Q1H A;  3HSR A;  4S0H B;  1R00 A;  4V2G A;  2VON A;  2FBK A;  3ISP A;  5HLT A;  1WJF A;  3QU3 A;  1FTT A;  1RET A;  2X48 A;  1Y6I A;  4CYC A;  2ZNY A;  2DTZ A;  3KCC A;  3CCQ I;  1D0Z A;  1J59 A;  1DDN A;  3ABU A;  1WH7 A;  2JVG A;  4AWX B;  2PLY A;  2ZSI B;  4OMY A;  3FHN A;  2V1D A;  2F5E A;  3SFZ A;  3HL2 A;  4QPO A;  2CS3 A;  3V4G A;  1WSU A;  2DFE A;  4B3A A;  2JA2 A;  3LAJ A;  3OYG A;  2CQQ A;  2QSG X;  2VOO A;  1JT6 A;  2VL8 A;  1A6I A;  3EUK L;  2B9S A;  3FIW A;  1MMG A;  4Q48 A;  2F2E A;  4RB1 A;  2GWR A;  2Y9Z A;  2O0Y A;  3J81 Z;  3IAS 2;  2QWW A;  2M3A A;  2BW3 A;  2GOM A;  2PEX A;  1S29 A;  3CCJ I;  2L9N A;  1ETK A;  4CCN A;  2FX0 A;  4HA8 A;  1EH7 A;  2BHY A;  3A01 B;  1GXQ A;  3KYC B;  1MSF C;  2BY3 A;  2LYC A;  4J01 A;  1LFB A;  1SAN A;  1NTC A;  3BT9 A;  1FWZ A;  2KPM A;  1R1U A;  3G4S I;  2QBY B;  1I3A A;  4BE2 A;  3KEQ A;  2P81 A;  4N0B A;  3GEZ A;  1PUE E;  1HBX G;  4YRV A;  2R7Q A;  1BR4 A;  1LVK A;  3M1C A;  5HDK A;  3ONQ A;  4LIT A;  3RKX A;  4I6Z A;  1RZ4 A;  1UFM A;  2PMZ A;  1G6N A;  2VKD A;  2LR8 A;  5IY5 H;  1QU3 A;  3OYI A;  4X1E A;  3D1N I;  2KRH A;  1WJA A;  2JMW A;  3MVP A;  3C2B A;  2M87 A;  1XSV A;  1CQT A;  2H27 A;  4CA0 A;  4ZYA A;  3OY9 A;  3SDG A;  3BR5 A;  1TLH B;  1KYW A;  1NHA A;  3HDD A;  2NNY A;  3ZGK A;  4PUS A;  4UV8 A;  1V55 H;  3ZXS A;  5D8L B;  1SEU A;  4OIP F;  5BNG A;  5E1Z B;  1U8B A;  1YG2 A;  2GLO A;  1K83 J;  4DZP A;  5EGO B;  1YTY A;  3K4L A;  3DV8 A;  1I39 A;  3JRG A;  1OMI A;  2LDU A;  3H5R A;  3U9G A;  3S2D J;  4U0Y A;  2E1M B;  1XC5 A;  1VTN C;  1X3U A;  1P4A A;  1P7I A;  3D5S C;  2UUZ A;  4LIU A;  4IZZ A;  3IWF A;  5H6R A;  5J47 A;  2KIF A;  4Y17 A;  2ZJP F;  2KDZ A;  3BJ6 A;  3DEW A;  3FKI J;  5F6F A;  3DKY A;  4C2M J;  4EAT A;  2LF7 A;  3LSJ A;  3B02 A;  5F1J A;  5K5Q A;  3EET A;  4RM2 A;  2DFI A;  3QOD A;  4M71 A;  3TP3 A;  2CUZ A;  3S1M J;  1JI8 A;  3L2V A;  1S8N A;  1YRN B;  2BXZ A;  3FXR A;  3P9K A;  5F0H A;  1U9O A;  3K69 A;  2Y0S N;  3ERE D;  3HGG A;  1O3S A;  2HQR A;  3ASN H;  4QPQ A;  1E3P A;  5E3O A;  3J7Y J;  3QQA A;  1R4N B;  3JRH A;  1HCR A;  3HC7 A;  5BMZ A;  1Z6T A;  3LFK A;  3KE2 A;  2Q0O A;  2Z5U A;  2VJJ A;  3S15 J;  4YFK F;  3VWB A;  2M0M A;  1TZL A;  3RPU D;  2VE8 A;  4XKB A;  3PNT A;  1ZN2 A;  3ZQ7 A;  1BL0 A;  4IF4 A;  3IHU A;  4BJ6 C;  4NC6 A;  2HYF A;  3CF2 A;  3KYD B;  1X2N A;  4XRM A;  1UB9 A;  2F4O B;  3W6J B;  2MAB A;  3QYB A;  2FRH A;  5JLX A;  2CFO A;  1JKR C;  1XSX A;  3B6A A;  2E7X A;  2ISY A;  4QIW N;  3M7G A;  1K6O A;  1DQU A;  2E1O A;  2L02 A;  3CCV I;  3VEP A;  1XDS A;  2QKM B;  1UG0 A;  2W00 A;  3ROU A;  4CO8 A;  2RVC A;  2XSD C;  1JGS A;  1Z67 A;  1QO0 D;  1R4M B;  2RN7 A;  3FXU A;  4BKX A;  4F52 A;  1ZQ3 P;  3CJN A;  1GDT A;  4CXF A;  5IT9 Z;  2VT2 A;  3LNQ A;  2LD5 A;  2ECB A;  4DQ2 A;  4KMU X;  4IHV A;  3VOD A;  2Q2E A;  1OKR A;  2JA6 J;  1S7A A;  4F55 A;  3HGY A;  2FQ3 A;  1J7K A;  1I5Z A;  3H3V K;  2K9S A;  3HOS A;  4HPQ A;  1ZAR A;  3KZI C;  1L3L A;  2QGU A;  5J8C A;  2V7F A;  1VF9 A;  1J09 A;  4Y15 A;  3ZMS A;  3E6C C;  3WU2 C;  4LLN A;  2AO9 A;  1XG1 A;  3N4M A;  2W48 A;  3NWT A;  3H3Z A;  2P5L C;  1PUF B;  3GTQ J;  2ZFU A;  4NQW B;  4E70 A;  1IRZ A;  2R5Z A;  2LOO A;  1A35 A;  3OYN A;  2UXX A;  2WC2 A;  2DYS H;  5M5Y J;  3A0H C;  3JRE A;  3Q0W A;  4KNY A;  1FYM A;  2E2H J;  3G1L A;  1JE8 A;  4A5M A;  6PAX A;  1OCT C;  5DEQ A;  2DMP A;  1OCO H;  2DQL A;  2JT1 A;  4KMF A;  2E7W A;  4PZJ A;  4L5I A;  2HDC A;  5AON A;  1XPX A;  1BR1 A;  4ON0 A;  2KIU A;  1K7A A;  1HA8 A;  5E8I A;  3FXL A;  2UV1 A;  3K2Z A;  2CQ7 A;  5K7Z A;  1U5T C;  1JHH A;  2HYG D;  4KA4 A;  1S72 I;  2OJE D;  2HXI A;  4P9U A;  1FYK A;  2MA3 A;  4G7Z F;  4A6E A;  5LGN A;  1C0W A;  2VQH A;  3DPT A;  4XK4 A;  2QVO A;  1PP7 U;  2PMU A;  4IKF A;  3TMO A;  2ME0 A;  4JYK A;  4RAY A;  4IVN A;  1R49 A;  1IN4 A;  3F3X A;  3T8R A;  2WY8 Q;  1HW1 A;  2XRN A;  3C1D A;  1OYI A;  4NB5 A;  3V42 A;  4IO9 F;  5E8G A;  4XLA A;  5IT3 A;  2STW A;  2W85 A;  4DZJ A;  3DXJ F;  5LFA A;  2R7W A;  3GWZ A;  3GTO J;  2F6C A;  2A6T A;  2KZG A;  4NQW A;  5DM7 F;  2G0E A;  2OA4 A;  3IWZ A;  1B9M A;  2FOK A;  1UCR A;  1DU6 A;  2M34 A;  1FY7 A;  1EH6 A;  1FOY A;  4AU7 A;  3CZ6 A;  4M74 A;  3BG9 A;  4LD5 A;  1RC9 A;  3M8E A;  4FAS D;  1AKH B;  3J7A Y;  3MZ8 A;  3F22 A;  4XLF A;  3K0L A;  3OYH A;  2D5V A;  2F5V A;  1IRG A;  1ZAO A;  2UXN A;  3MFK A;  3I53 A;  4NDL A;  4NNJ A;  4LB6 B;  3GZ5 A;  3R0J A;  2E19 A;  2OUM A;  4D1Q A;  3A0B C;  1YW7 A;  1YIJ I;  5L3E A;  2Y31 A;  4I98 B;  5K7H A;  4BYY A;  2UZK A;  2EPF A;  3G6E I;  3BG5 A;  4BJ5 C;  3BJO A;  3HSF A;  2J5P A;  1FMV A;  2Z16 A;  1QA6 A;  4E7H A;  2K9L A;  4FTH A;  1VQ4 I;  4AIH A;  4P5O A;  5L3B A;  1MDM B;  1NG7 A;  1G3W A;  2HYJ A;  1Z3Y A;  1GLN A;  2VQC A;  4I01 A;  1Z0X A;  2R7O A;  1TQI A;  3HUG A;  2KL4 A;  2PMZ N;  4GYG A;  5M3F J;  3VSK A;  2MD0 A;  4M9S A;  1IG7 A;  3VDX A;  4IX7 A;  3ECO A;  2XB5 A;  4NC7 A;  3SZG A;  2G7U A;  1G8X A;  1TT0 A;  4HDV A;  5A2Q Z;  4CCO A;  4G6D A;  2MGQ A;  2OF7 A;  4ZYG A;  4KN4 X;  3SZP A;  4IRG A;  2A3S A;  1A31 A;  4XBF A;  2NVT J;  2P7V B;  1TWH J;  2LF8 A;  2V79 A;  2BHZ A;  2N8G A;  1FIA A;  1XGM A;  1ZKG A;  3CF5 F;  2NVU B;  1YFH A;  1ZRE A;  2XPW A;  3CTA A;  5CPR B;  3V8L A;  3I59 B;  1OYY A;  4CIC A;  1MMA A;  1W1W E;  1SFU A;  1FMW A;  4D7M A;  1N75 A;  3GVA A;  2ME6 A;  1QHG A;  3DTK A;  1MBF A;  2DQR A;  1XGS A;  4M73 A;  3I64 A;  3LSR A;  1IXC A;  1ZGW A;  3WGI A;  4Q4Z F;  3BR2 A;  2EQR A;  2E5Z A;  3OYB A;  2BOL A;  3GLL A;  4IJA A;  2M2E A;  3F72 A;  5IT9 K;  2IVM A;  3WTS C;  4IHT A;  1ETW A;  1X4O A;  2WV0 A;  1ZEL A;  1TBX A;  4ZYD A;  3ZCO A;  1TT5 B;  3GFI A;  2PQ8 A;  1ITY A;  2J5O A;  3GF2 A;  3F21 A;  3GTP J;  3GXO A;  2BEO A;  2LMD A;  4PGG A;  2NYX A;  4P55 A;  4G94 A;  3K4J A;  5GTI C;  2Y0S A;  1SVO A;  3I9V 2;  4JX5 A;  2LK2 A;  2WB1 A;  1EJ9 A;  4L5J A;  2MG4 A;  2NNN A;  1FP2 A;  1HC8 A;  5EEG A;  1KYZ A;  3K1M A;  3TW7 A;  3GBG A;  2NAZ A;  3FBN B;  3ZMT A;  4A0Z A;  3G2B A;  3PO2 J;  1YI2 I;  2M7B A;  2MH2 A;  2CSO A;  3E6B A;  4B4C A;  4DJA A;  3AG3 H;  5FB2 A;  1E17 A;  4UVA A;  1MJ9 A;  5GAD J;  3QPH A;  4HST A;  1FEX A;  2E71 A;  1QVT A;  3G1O A;  1WVR A;  1VQ5 I;  3TKY A;  2V26 A;  4RGX A;  3F8N A;  2OTL I;  4XN0 A;  3TO9 A;  4G6Q A;  1R6R A;  5BPD A;  2FOW A;  5FKL A;  1IO2 A;  4BBS J;  1FBS A;  3L2U A;  2MYS A;  5D8K B;  3BPV A;  3H9Q A;  1XX5 A;  3GO5 A;  1AU7 A;  4UVB A;  3RJP A;  3KEO A;  2K9Q A;  1W7P B;  4ENM A;  9ANT A;  2UWM A;  2X85 A;  3OMY A;  1OJL A;  4IQJ A;  2CW0 F;  1MH4 A;  5BOX A;  2QF7 A;  5KK1 A;  4YEL A;  2XB0 X;  2WAF A;  2E1C A;  3HOV J;  4Y33 A;  1G3S A;  3MQ0 A;  3CP2 A;  4ANJ A;  3MZY A;  2R92 J;  4W1U A;  4BS9 A;  5FKN A;  2FBI A;  3I59 A;  5EYR A;  3ULQ B;  1TNT A;  2E1M C;  2NRA C;  2HGC A;  3K2A A;  5D5W B;  3I55 I;  3AAF A;  1Q1V A;  3OWT A;  4RB2 C;  2KT0 A;  3OR2 C;  3PQK A;  4E7S A;  4HX7 A;  1BOA A;  3O3K A;  4UB8 C;  3PSI A;  2JUC A;  3GTJ J;  4GGG A;  1JUM A;  1JHF A;  3SXY A;  3BZ6 A;  3BR1 A;  1OPC A;  2W84 A;  4L9T A;  4YII A;  3MKL A;  2FE3 A;  1HDP A;  1MW7 A;  2DOE A;  3R4K A;  3U21 A;  1BC8 C;  1H0M A;  3ZQG A;  1JUS A;  2DW4 A;  1T08 B;  4HZF A;  3M8J A;  5CVR A;  4HLY A;  2CFX A;  2B7E A;  4ZTF A;  1SAX A;  3DBL B;  4U7D A;  3IH3 A;  4CZC A;  4XLC A;  2WV1 A;  3S8P A;  1MMS A;  1J0R A;  4XLN F;  2GA2 A;  1T98 A;  3K6G A;  2H6C A;  3WHB A;  3ABM H;  2NVQ J;  3BDD A;  2AHQ A;  1YX5 A;  1X1D A;  2E35 A;  3FXO A;  3T5X A;  4Z2Y A;  2PBI A;  1V5G A;  4PFO A;  3DPL C;  4HQM A;  2LKP A;  2OAZ A;  3BRO A;  1KGS A;  4B43 A;  5HOO A;  1H8A C;  3K4B A;  3C18 A;  4M3G A;  4BY7 J;  3F8B A;  4IXA A;  3OYJ A;  1HQC A;  3ZQQ A;  2HU9 A;  2QQA A;  2LBF A;  1IF1 A;  4DOZ A;  1USS A;  4IHW A;  1H9T A;  4D9J A;  5GPC A;  5GAH J;  2IGM A;  3CMA I;  3PSF A;  1UJ8 A;  4XLH A;  2QEN A;  3V8K A;  2ADU A;  1Z6R A;  4P9F A;  4ESF A;  3HKZ N;  3HRS A;  1IDZ A;  1WH5 A;  4GFB A;  1N77 A;  3VSL A;  1E3O C;  1RKW A;  1WJB A;  4QWQ A;  1BI1 A;  3PFY A;  2JA5 J;  5ICF A;  4EM2 A;  1D8J A;  1Y1V J;  3WG7 H;  1AOY A;  3NAR A;  2MC3 A;  2CGP A;  1I6H J;  2L4A A;  1TW2 A;  1UMQ A;  2P0W A;  3F6V A;  3T8T A;  3OYL A;  1IXS B;  4IHY A;  2DPU A;  3J80 Z;  3KP7 A;  4R1H A;  1A04 A;  1V5E A;  3LA7 A;  2GQQ A;  4IQ4 A;  1LFP A;  4L9J A;  4B48 A;  3I0T A;  2HTS A;  1ZG1 A;  1CF7 B;  2NOG A;  2XPV A;  2HZT A;  3TDU C;  3QRF F;  2OPT A;  1DP7 P;  1FBU A;  1Y39 A;  3E1S A;  2V9K A;  3NRV A;  1W36 D;  5H2F C;  2W25 A;  3DEU A;  4RMN A;  3DKW A;  5DUI A;  1SFE A;  2O3F A;  3ZMZ A;  1DGW Y;  2EIL H;  3IKT A;  2K4B A;  3P5J A;  1L0O C;  5E18 F;  4YIR X;  1XS9 A;  4MHG A;  2Y30 A;  5AIQ A;  2XAH A;  3KFW X;  4BXU A;  3V8J A;  1X2M A;  3K9T A;  4CSW A;  1VQO I;  3E0J B;  1MJA A;  2BYV E;  2E34 A;  3CCU I;  1EH8 A;  3HOT A;  1AWC A;  1TWG J;  2QLZ A;  2GXA A;  4IRH A;  4BBR J;  1OLT A;  2W82 A;  1UZC A;  3BR3 A;  4LLL A;  2QQ8 A;  2DT6 A;  4B1R A;  2O61 A;  2DXI A;  4WXD A;  1B8I B;  4OU0 A;  4XKV A;  3O2P E;  5C4X J;  3TDZ C;  3VOE A;  4RB3 C;  4K2E A;  3GUD A;  1HDD C;  1HSJ A;  3IAM 2;  4JP0 A;  1ON1 A;  3LA2 A;  2BXY A;  2XAG A;  3ESW B;  5FLX K;  3BR6 A;  3A1Y A;  2EA4 A;  1VQM I;  3I3L A;  1P4X A;  1MBH A;  3HYI A;  5FRO A;  4EV0 A;  2K3P A;  2PMH A;  5EGO A;  2LSO A;  4BQO A;  2W7N A;  2OD5 A;  3OYM A;  4UB6 C;  4ASN A;  1FZP B;  2JK3 A;  2IS2 A;  5HLI A;  1NK3 P;  4M9X A;  2OBP A;  4BJT A;  2HNH A;  3FXM A;  2B0L A;  1IRX A;  2AS5 F;  1R5G A;  4O3M A;  2EZH A;  3EUA A;  2DMT A;  1YYV A;  4F7Z A;  2Q2E B;  3W2W A;  2BZT A;  3G71 I;  3ZQC A;  4Q5S F;  4BHP A;  4GO1 A;  4HX8 A;  2JRM A;  3J81 K;  3HM5 A;  1LE8 A;  2JWT A;  3E5X A;  2HQA A;  1P2F A;  3COA C;  2MH9 A;  4EJO A;  3ELK A;  5LD2 C;  3Q5F A;  4PJ0 C;  5IYB J;  1T33 A;  4DBQ A;  2CMP A;  4EJU A;  1WQ2 A;  3E6D A;  3LMM A;  2H8R A;  2XGC A;  2L5Q A;  4U87 A;  1D0X A;  2YU9 J;  2DOD A;  5M3M J;  2ZXH A;  4PFP A;  4HBL A;  4EM1 A;  4IHX A;  3M4O J;  3EPZ A;  1VQP I;  5LLQ A;  2VJ5 A;  3MKW B;  5DS9 A;  2DA3 A;  3H9J A;  3S16 J;  5CVI A;  5F08 A;  2ZJ2 A;  1VND A;  1AHD P;  2K02 A;  3RZO J;  1GV2 A;  4PSW A;  1JJ8 C;  4BY1 J;  1DPU A;  4A0X A;  1X3Z B;  1WJ5 A;  5E1X A;  4ZYE A;  2VC1 A;  4G8X A;  2WB1 N;  2P8T A;  4WX9 A;  1RIO H;  2VBX A;  1Z3X A;  3K10 A;  2X1E A;  1IN7 A;  1XMA A;  2R5Z B;  3OOP A;  5FD6 A;  2BW3 B;  3CJQ B;  3AL0 C;  1TWC J;  2YUS A;  3I4M J;  2DT7 B;  1MH3 A;  1R36 A;  4ABZ A;  4KT6 A;  1T95 A;  3CCL I;  1T0F A;  2A6H F;  1YHQ I;  3EYY A;  1JT0 A;  3CC2 I;  1K78 A;  4LG0 B;  2M8G X;  1KU9 A;  4UY8 I;  4Y13 A;  2L4M A;  4AD9 A;  5LHG A;  4P1W A;  2D2W A;  3D5L A;  2O03 A;  3RKQ A;  2HQN A;  2CW7 A;  2ZME C;  3BG7 A;  3PO3 J;  5DTD A;  3QPS A;  3E6M A;  3AG1 H;  4R79 A;  2L54 A;  1ZK8 A;  1E0E A;  4AIK A;  3GTM J;  1G4D A;  3HB9 A;  4XNF A;  2A05 A;  3BP8 A;  2YSR A;  2Z99 A;  3WTU C;  5C4J J;  1B9N A;  2EV0 A;  3QAH A;  5M5W J;  2ZO4 A;  3T1B A;  3TED A;  2DMN A;  1QQI A;  1FOW A;  1S3J A;  3VYT B;  2X1C A;  3FX3 A;  1UG2 A;  5ILV A;  1MMD A;  1GUU A;  3HRT A;  1B1B A;  3HXL A;  5FKM A;  3H5A A;  2FF4 A;  4GCV A;  1FYL A;  1BI3 A;  2K85 A;  1SD4 A;  2FBH A;  1S9H A;  4J00 A;  3CCM I;  1Z77 A;  2VKE A;  2IS6 A;  4DIQ A;  2DK8 A;  1FPQ A;  4ZC3 A;  1POG A;  2CQN A;  2R7U A;  4MTE A;  3CD6 I;  1QHH D;  3CJR B;  4S04 A;  4A3D J;  1X19 A;  3J7Z I;  2HOS A;  2RAE A;  2GXB A;  3MKZ A;  4XMY A;  2DO7 A;  3KPH A;  1A5J A;  4FHT A;  4KIS A;  5ILU A;  3JAM Z;  4DYR A;  4BHB A;  2EK5 A;  3G1M A;  2DT5 A;  1O3Q A;  5F1R A;  2LY9 A;  2Y69 H;  2LNB A;  5B3S H;  3EDP A;  1R5I D;  3LSG A;  5FD5 A;  2ZME A;  1VQN I;  2GA1 A;  4A3L J;  3H0D A;  1QNT A;  3K4K A;  1U8R A;  5K5R A;  1HLV A;  2EJR A;  4M72 A;  2V1X A;  3LWF A;  2L9S A;  3RKY A;  4C3I J;  5JFR A;  3FK6 A;  4LJZ F;  4CCL A;  4ENK A;  1SD7 A;  1BJA A;  2EFP A;  2K9N A;  1K4S A;  1XCV A;  1B8I A;  2ZXI A;  4I99 C;  2XDV A;  1Z7U A;  3I4P A;  1S6L A;  4PJL A;  3FXQ A;  2A07 F;  1Z05 A;  5B1A H;  4HV5 A;  5FLM J;  1MKM A;  4F3Q A;  4ZH4 F;  3JRA A;  1OCR H;  4D5F A;  2H1K A;  1H89 C;  3TOB A;  3U1K A;  2RGV A;  3SJM A;  5JLW A;  4RB0 A;  2GAU A;  5LBQ A;  2KRF A;  1LNW A;  4NBQ A;  2ACJ A;  3A01 A;  3S1R J;  3HKZ A;  2WAE A;  3L2Q A;  1WJD A;  3X2Q H;  3FBI B;  1TC3 C;  3HOY J;  4A93 J;  3Q0V A;  1AKH A;  2YS9 A;  3BG6 A;  3FZV A;  1TTY A;  4FIS A;  4L18 B;  2R7V A;  1APL C;  3WGH A;  2L7F P;  4E7Z A;  3OYA A;  2K27 A;  3OS2 A;  2JJ7 A;  2VB6 A;  3R61 A;  3KX2 A;  5B66 C;  3DU6 A;  2C6Y A;  1WZ2 A;  5E3M A;  3CLQ A;  2IGO A;  3FMR A;  3D0S A;  2GXG A;  1YO5 C;  3K1N A;  3CCE I;  2DA2 A;  2KP6 A;  5TJJ A;  3S93 A;  1EKE A;  3REO A;  2W1O A;  2FA5 A;  2L3D A;  3PL8 A;  4HNT A;  3WTT C;  3R60 A;  2Y48 A;  1ETY A;  1D5V A;  4LOC A;  2NVX J;  2IAI A;  2FU4 A;  2RKH A;  3IKV A;  4KJZ A;  2VJ4 A;  1MMN A;  1UAA A;  1W5C C;  4I7H A;  4NC8 A;  3BTL A;  2EFW A;  5JR3 A;  4ZZL A;  1ETO A;  2DA5 A;  4OMZ A;  5CVV A;  3GTK J;  4UNO A;  1OR7 C;  5H6Q A;  4ZDP A;  1AA7 A;  4CDG A;  1HKT A;  3RI4 A;  4I2O A;  5F04 A;  1GT0 C;  3O8H A;  2LVS A;  4OIO F;  3A4C A;  3TBI A;  1N25 A;  5TIS C;  1XDU A;  1O57 A;  4C9Y A;  2CUF A;  2EB7 A;  3GX4 X;  4B09 A;  4BE0 A;  3PM1 A;  3WGG A;  5KCM A;  1MJB A;  4CYD A;  3NEU A;  1MD0 A;  4JX6 A;  5GP9 A;  2QSH X;  3GTL J;  4PCQ A;  2VJI A;  1BC7 C;  4MNU A;  2BBY A;  1UHM A;  2EZL A;  3LST A;  4AID A;  4BE1 A;  3JTH A;  3FKJ A;  4XRF A;  1Y56 A;  2HDW A;  2ZCW A;  3PNV A;  4N4N B;  4KFC A;  4L0Y B;  2O8X A;  4HLX A;  1ONV A;  2Z3Y A;  4YFX F;  5DYM A;  4UUS A;  3OYF A;  3OSF A;  2NVY J;  4CZZ A;  2XHK A;  4L5E A;  5GPA A;  1UST A;  2PJP A;  3TQN A;  2GM4 A;  1YIO A;  3DTE A;  3B73 A;  1F9N A;  3JRI A;  2BVL A;  2JN6 A;  3TL4 X;  3LFU A;  2YU3 A;  3SEQ A;  5ED4 A;  2ZJR F;  1BN5 A;  2LRE A;  3MEX A;  2VKH A;  1IN6 A;  3N97 A;  3MD2 A;  3AG2 H;  3ZR8 X;  5J1U A;  3HIF A;  4G7H F;  1FJL A;  2X9D A;  1U6G A;  2DFF A;  5EJC A;  2OCE A;  4D5C A;  2EIK H;  2CV0 A;  5HVQ C;  2WWY A;  2H1L A;  3ZQI A;  2RC4 A;  3MN2 A;  3VB2 A;  1IC8 A;  2HWV A;  5KNL A;  2W57 A;  5D5U B;  4KIC A;  1TQM A;  4XOR A;  3CUO A;  5HS8 A;  1LFU P;  2DK5 A;  2R7F A;  3K4M A;  1W5S A;  3IRQ A;  5HS7 A;  1IUY A;  3K70 D;  1YLF A;  3JW4 A;  4F92 B;  1T38 A;  1E3H A;  4GDF A;  2HXO A;  1YJN I;  1WWX A;  2VIX A;  2HR3 A;  5K7F A;  5DCM B;  4XOP A;  3E5U A;  3OS1 A;  1M1E B;  2R5Y B;  4L9V A; 
#chains in the Genus database with same CATH homology
 3ABL H;  2EIM H;  3ABK H;  1OCO H;  1V54 H;  3AG1 H;  3AG4 H;  2Y69 H;  5B1B H;  5B1A H;  5B3S H;  3AG2 H;  1OCR H;  1V55 H;  2EIN H;  2DYR H;  3ABM H;  3ASO H;  5IY5 H;  3AG3 H;  2OCC H;  1OCZ H;  2EIJ H;  2EIK H;  2ZXW H;  3WG7 H;  1OCC H;  3X2Q H;  3ASN H;  2DYS H;  2EIL H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...