1OCRH

Bovine heart cytochrome c oxidase in the fully reduced state
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
79
structure length
79
Chain Sequence
KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords CYTOCHROME C OXIDASE
publication title Redox-coupled crystal structural changes in bovine heart cytochrome c oxidase.
pubmed doi rcsb
total genus 25
structure length 79
sequence length 79
chains with identical sequence U
ec nomenclature
pdb deposition date 1998-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 1ocrH00
2DYSH 3X2QH 1V54H 3AG3H 3AG1H 3ASNH 3ABMH 1OCRH 5B1BH 1OCZH 2DYRH 2EIMH 1OCOH 3AG2H 5B3SH 3AG4H 1OCCH 2ZXWH 2EIJH 1V55H 5B1AH 2EIKH 2EINH 2EILH 3ABLH 3WG7H 2OCCH 3ABKH 3ASOH 2Y69H 5IY5H
chains in the Genus database with same CATH superfamily
1IN8A 2QCOA 1O3QA 4L9JA 4AVZA 5C44J 2DT5A 3P7NA 2VT3A 1QO0D 4BBSJ 2R7VA 3I71A 3BQZA 4XLHA 2XAGA 1XDUA 2K9QA 1ZELA 1IO2A 1R5ID 5J1RA 1Z05A 2DK5A 4W97A 5H2FC 2ICWG 3H35A 3SHFA 3QAHA 2QENA 2ZMEC 3KE2A 1JHHA 3W6KB 1H88C 3BG9A 1J9IA 1KU9A 3A0BC 3TKYA 3SZPA 1GLNA 4ON0A 1WKMA 2JPCA 2BHZA 3ABKH 4ZYDA 5C4XJ 4CA0A 2IGKA 3FM5A 2KHMA 1TQIA 3CUQA 1T8IA 1P4AA 2R0QC 3Q0WA 2EA4A 1R7JA 3E6CC 3BT9A 3G3ZA 1ETWA 4BE2A 3OYNA 5D4SA 2DI3A 2GXGA 4G94A 3VODA 3MFKA 3V8LA 2HVSA 3K0LA 1SFKA 4B48A 2JA6J 3S3OA 5HLHA 2A69F 3LSIA 2UZKA 5M5WJ 2VODA 4E7JA 2EILH 1ZREA 2ID6A 2QGUA 4ZYEA 1Y8RB 5HS7A 1DGRM 4F3QA 3A2KA 2XAFA 4PK4A 4M3FA 1QHGA 5J1UA 2GBYA 2E71A 4E7LA 3DCFA 4IOCF 3LSTA 2VB6A 2HXIA 3I9V2 3OOPA 2ZSHB 4A3MJ 2DXIA 4JOMA 4ZYHA 1ZG1A 1VNDA 4PZJA 3DBHB 4HF0A 1QRYA 2VLAA 1YJNI 2FD5A 2JRMA 1XTAA 3IP4B 2CUEA 3V7SA 1Y39A 1F5TA 5L3DA 2XDVA 5DV5A 2ZMEA 4G7HF 1Y1VJ 1W7PA 3FXUA 2HGCA 2ZFWA 2M45A 3S2HJ 4KN7X 2JUGA 1IGNA 5M5YJ 3PM1A 1FMVA 2E1OA 1YFHA 2F48A 2QKLB 4X0GA 3BCAA 2VXDA 3QYFA 4GYGA 2KIFA 3H0DA 4PJMA 1O57A 1P4XA 1I1SA 1M1EB 5KVRA 2G7HA 2QSFX 4BAYA 1B1BA 4HW0A 2KZVA 2K9NA 2P5KA 1HW2A 2XGXA 2V79A 1IF1A 4R1HA 2VOOA 3S1QJ 2VASA 1WH7A 1K4SA 2LYCA 3ZGKA 3K4BA 4LITA 1YS6A 5C3EJ 4HNUA 2R7RA 2HTJA 3H5RA 1IAWA 3I3LA 4DBRA 2F5FA 1ON2A 2BXYA 2Y2ZA 4XLAA 1PUFA 1UAAA 3RCOA 2XSJC 4BHCA 4A0XA 2V1DA 3RTRA 3TOBA 4Z2YA 3A01B 4LG0A 2E34A 2LG4A 2XSDC 2ZXHA 5GTIC 4IO9F 1HKSA 4LLLA 1I1GA 1FJLA 1RZ4A 2FU4A 2GLOA 5CKTA 5KAIC 2LR8A 3DQVC 3ML6A 1WZ2A 2LK2A 4XORA 4Q5SF 3QU6A 4HEA2 2LF7A 4C3IJ 2DOEA 3JRDA 2PJRB 4XLNF 4Q4ZF 3W6JB 2B63J 5FLVA 3A1YA 3G1OA 2CQNA 3E3VA 4PDKA 3RKYA 3EUHA 2VPLA 1NHAA 5E79C 3QPSA 5D8KB 4BH9A 5DYMA 2ZKZA 4BYYA 4DOZA 4A3JJ 5IP6A 5KNLA 1ERDA 2O9LA 5M5XJ 3RSNA 4WX9A 4MLOA 1IRZA 2R7UA 1P7JA 2DN0A 3DPTA 4MO7A 4FX0A 3TO6A 3OSFA 1ZTRA 5F1JA 5HDNA 3R61A 5FRMA 3BR5A 4ANJA 1ZYRF 4EJWA 4XNFA 2RV8A 2F5DA 2GXBA 3AKZA 2CV2A 3MWMA 3IKTA 1KQ0A 3MEXA 1SMYF 2I5UA 3F6VA 4OOIA 2W4SA 1FTTA 2FQ4A 2BHYA 1V55H 3R60A 1D0YA 3ESWB 5K7ZA 3HGGA 3JTHA 3O8GA 2KJCA 2F6CA 5EGOB 1FOWA 1GDTA 2GIZA 3HB9A 3PUBA 1T0FC 1W0TA 3FKIJ 1YX5A 4RAYA 3RDIA 2E5ZA 5CVJA 1X4PA 1LQ1A 2ME0A 1DUXC 3OSGA 1IRXA 3S32A 4CYCA 2M87A 1MNEA 1VI0A 1J7KA 2A6HF 3HPGA 2VOPA 2YU9J 3L1PA 3D5LA 5K7FA 2FJ1A 4ZTFA 4YIFA 2E2JJ 2Q8KA 3H9JA 4AD9A 3OYMA 4LGWA 3JREA 4UVBA 2R5ZA 2CQQA 1QVUA 1MH3A 2VJIA 3TGNA 3BG6A 3DBRB 4RGSA 1RUOA 2M4KA 1YIOA 3MCZA 2DFIA 2ZO4A 5CVVA 2EV5A 2E1MC 4JX5A 4ZDOA 1XN7A 5BPIA 2DA1A 3KEYA 3ERED 3Q5FA 4IHTA 1R22A 4P1WA 1T38A 2WB1N 2HPIA 4P9UA 1OCTC 3IAM2 5LHIA 2FE3A 2F4IA 2LRDA 4V2FA 2G7UA 1ZHFA 3KP2A 2X0LA 3G4SI 1MJ9A 1J59A 2HKXA 1IN7A 1TBXA 5DUIA 5J4YA 3J7AO 4CCMA 1BN5A 2CYYA 4G6DA 1V5GA 4CH7A 3MZ8A 4KICA 1KONA 5IPAA 2BXZA 1S7AA 1X2MA 3U21A 3JCUC 2Y0MA 2BGCA 3ZMTA 1HOMA 3BR6A 4CYDA 2RAEA 2DMQA 3DLLF 3PQJA 1YRNA 1ZRDA 3BJ6A 1ITYA 1PP8F 4U0WA 1JTYA 2GM4A 5GTHC 4MTEA 2WV0A 3GX4X 2WB1A 3CO6C 1NG6A 4C2TA 2KQRA 1SEUA 2VQHA 2QUFA 3BP8A 3EUAA 2VIXA 1V5FA 1K78A 1ZGAA 1F4KA 2F5EA 1XGSA 3EYIA 2FEZA 4QTRA 2LC2A 4BQQA 5DCFA 4L18B 3PO3J 3NWSA 1GVJA 5BNGA 1VQKI 4WK8F 3FK6A 2NS8A 3IC7A 5GAGJ 4RB0A 2HKOA 3LFKA 2LKSA 1XMAA 4N4OB 1ZK8A 3JSOA 2GZWA 3BY6A 2PI0A 3S16J 4BUPA 3CC7I 1L0OC 1QU3A 4DYQA 4HF2A 4IQ4A 3GTKJ 3JW4A 1HSJA 4R8HA 4C2MJ 2LD5A 1FX7A 4HYEA 3OYGA 1D8JA 2HTSA 4X6AJ 4BJ5C 1W5CC 2EZHA 2JJ7A 1ORKA 1S29A 1ZARA 2XIGA 1J75A 2IXSA 2ELHA 2F5VA 2XF5A 3K4LA 3S2DJ 4D7NA 4HA8A 2JA8J 2VT2A 4B4CA 1LB2A 1RUNA 4BY1J 4QIWN 1TP4A 2P81A 4EQQA 1R49A 2GXAA 5BMZA 2GWRA 4C2UA 1W7PB 5JVGF 2VBWA 3K69A 3WTUC 2HFHA 1R00A 2D1VA 4GXOA 4KT5C 5ED4A 1FBQA 2RNJA 3EQLF 2GOMA 3IRQA 1D0XA 3CJRB 1OKRA 2MSYA 4N9IA 3RKXA 2MYSA 2OQGA 4XOPA 3PL8A 3ZQ7A 4A3FJ 1JUMA 1VZ0A 1OYIA 2R92J 3C3WA 4O5VA 1K79A 1P6RA 2VC0A 2DOAA 1S7OA 1G8XA 3J81Z 4MEXF 4ZC3A 1G59A 1HDDC 2D1HA 4DYCA 5F0HA 3LSJA 2R7DA 2R7QA 2EJRA 5K1YA 3IV5A 4HDVA 2CUZA 4A3LJ 4KFCA 3KIOA 1USTA 4I02A 1FSEA 1KU3A 4RMNA 4A3DJ 2A6EF 3WTZA 1ZR2A 1EF4A 2E7XA 2LKXA 5EJCA 1PP7U 1HLVA 4FT8A 1E0EA 2F4OB 3E1SA 3H5AA 5TGTA 1PUFB 5TRDA 1MGTA 4CCNA 3ABTA 4M9SA 1UMQA 3WTSC 2DU9A 2FBHA 5ICFA 3EDPA 4LG0B 3SXYA 4DGWB 4XICA 4IRGA 1D1BA 2DDAA 4M6VA 2IA0A 5CVIA 5BS6A 2VBZA 2FBKA 2GOXB 2NVQJ 1FSHA 5CVRA 5HOOA 5F27A 5DDGA 5EG0A 2CV0A 3ZP5A 2XAHA 4DZPA 1SFUA 3OL3A 1BR1A 1XCVA 1IDZA 2LNBA 1XSDA 4QPQA 1QBJA 2HOTA 2QVOA 2LSOA 4OIQF 1W4MA 2FUG2 3A02A 3MAJA 2DA5A 4MTDA 1G3YA 3H9QA 3W3CA 2XHKA 1LFUP 2MW8A 3RKWA 4BQOA 2OV7A 4N0BA 2VBYA 3UR3C 4HF1A 2CUJA 1T08B 2RNGA 2EFNA 1HDPA 5E8IA 1U9NA 3J81K 4A3CJ 3V4GA 2FQ3A 4NB5A 5FD6A 4U7DA 1EJ9A 3RIRA 4PCQA 1IXCA 1QPIA 1BBYA 4L5IA 6PAXA 4Y52J 1EH8A 3ZQHA 3IWZA 1OLTA 9ANTA 1SD5A 3H3VK 2FXAA 1W5TA 4A3BJ 1S8NA 2KIQA 2AXLA 3IKVA 2KIMA 3E6DA 1CGPA 2HDCA 4XMYA 4CCJA 1GV2A 5D5WB 4IZZA 4WWCA 4U87A 5FFZA 3HRUA 3KP5A 4PJNA 1VQLI 1JKQC 2NS0A 3E5QA 2R7TA 1IRGA 1TC3C 4RAFA 1A31A 5J47A 5KK1A 2IAIA 1I3AA 2L7MP 3FF5A 1JT6A 4LLGF 4CYCB 2V9KA 3KPHA 3GUDA 3I4PA 5ILSA 1BC7C 4ENJA 4GYIA 4U88A 2HOEA 2P8TA 4IHYA 5E3LA 4XRMA 3I5UA 2XC7A 2BOLA 2JN6A 1R58A 3GTLJ 3JTGA 3FMQA 4XR6A 3GWZA 4IKFA 2W85A 3BTCA 3TQNA 1TWAJ 1BM9A 2CW8A 2XRNA 4Y4RA 1MMSA 2LFBA 5LEJA 2E19A 2X48A 2R5ZB 4AUXA 1Z7UA 4CICA 4NBQA 1BW5A 2MABA 2ECCA 4B3XA 4CO8A 3HYIA 3NEUA 2PQ8A 1LNWA 4C9YA 2L4MA 2WAEA 2BBYA 5F0CA 2R4GA 2XF6A 3V7CA 3WHBA 2PMHA 3LAJA 1K6YA 1XPXA 4ESBA 4NC7A 4A93J 2PJPA 4NDLA 3OMYA 2Y75A 5LGNA 3A0HC 4IHXA 2STTA 3ZPLA 3SFIA 3O6BB 2DDBA 2O3FA 2EIMH 2EH3A 1U8RA 3REOA 4PFPA 2KJBA 1VQ9I 2MH9A 3DKYA 4W1UA 3BLYA 2EV0A 3HKZN 2RQPA 4S05A 4M6XA 4BXXJ 5M3MJ 1JJ8C 2AQFA 2L9NA 5F08A 2RVCA 3IHUA 4GDFA 1RIOH 3GYHX 1MBEA 2W1OA 2VQGA 4KISA 4HPQA 1H9GA 1Q1HA 4PSXA 3W2VA 3CCQI 1REPC 1LDJA 2M5WA 3M3YJ 4XOTA 3H9GA 3JR9A 2VJJA 2ZCWA 1K78B 1X1PA 3D5RC 4I98B 4UUSA 3L2CA 3L09A 3IH4A 4G8XA 4UV8A 3OYCA 1HKTA 2A5YB 4EJOA 4YELA 1O7FA 2DFFA 2OTJI 5FLMJ 3CP8A 3D0SA 1YOVB 2L9VA 3WU2C 2LKPA 1YW7A 1KYWA 3FXMA 3V42A 4I0AA 2VONA 3H3ZA 3QOEA 2X1DA 4ETSA 2OU2A 2KRCA 1JTXA 5D6EA 1OCOH 2DJIA 3HKZA 3BG7A 1OJLA 4Y7NJ 2V1XA 3ABUA 4G9YA 4A2UA 1KU2A 3MKYB 2DBBA 2HDWA 3T0YA 4YFKF 1EV7A 1XSXA 2XPUA 4A5NA 4IF4A 3RJPA 3JRFA 3C18A 4RGUA 4I99C 5ERIA 3FMSA 5GPCA 3SZGA 2BV6A 4QSHA 1O3RA 3PSFA 3E0JB 1UB9A 1I27A 1A36A 4PJLA 3DU5A 2Z3YA 2L7ZA 2Z16A 2X1CA 1V5EA 1K7AA 1L3LA 3C2HA 4XL9A 2IT0A 5HLGA 1GXQA 3C7JA 1T95A 2FOWA 2MGQA 2VJ4A 1T39A 2V1NA 3DKWA 2O7OA 3UNGC 4AWXB 4HSRA 1YI2I 1HSTA 3WE3A 3OYLA 2L0KA 4CGZA 3HHHA 1AOYA 3BR3A 4ZJZA 2BY1A 3HZJA 2OA4A 2DYSH 3TP3A 3B6CA 3FXRA 4Y3OA 4HQMA 3G1LA 4AYBN 4ITVA 1KZHA 3FBIB 2IRFG 2G9WA 4I7HA 2MG4A 1PUEE 3AG4H 3ZCOA 1SFOJ 5C4JJ 1U3EM 1BI3A 3L2QA 4E4HA 3FXKA 3KP7A 3NRVA 2XKOA 2A6TA 3FMRA 1BI0A 3KFWX 5ILVA 4TV7A 3WTYC 3VB2A 3S1MJ 4LIUA 3PNYA 2NVXJ 3F21A 4MQ9F 5J40A 1MBGA 4I6ZA 3F8NA 4KUMA 4S04A 1VQ6I 3VFZA 4BY7J 5CYVA 4E7ZA 3LA7A 5EG0B 1DDNA 5M3FJ 2VE8A 3RYRA 3RQIA 4EV0A 2JWTA 1JXSA 3BOQA 3K70C 3VOEA 3KLNA 2O8XA 1YIJI 1EKEA 4JQFA 4IQJA 1WJCA 2EINH 5D6FA 2W48A 1RC9A 4FE4A 4LK0F 2MBFA 3MN2A 4AYBA 3WE2A 1QQIA 3B02A 5K7HA 4O3MA 1R4NB 3F8FA 2HVRA 1SANA 3MZYA 4MHGA 1RR8C 4IL6C 3EUHC 3BTJA 3QODA 1HW1A 3HUGB 1TWHJ 3GFMA 3K1MA 4ENNA 4YFXF 2KT0A 2P4WA 1OR7A 2JMWA 3T8TA 1WJBA 3EYYA 3TO9A 4CCOA 2LMDA 5B1AH 4G7ZF 1TL8A 4UUTA 2Z9OA 2UUZA 2KRHA 1HQCA 3CJTB 2Q0OA 3DLAA 1IZ1A 2Y69H 4GGGA 4LJZF 3GFIA 3ECOA 2V9VA 4D0PA 4PGGA 2ESHA 5F04A 3CD6I 3I53A 5KCMA 2WAFA 2XKPA 3QYEA 2COMA 3KYLA 3H0GJ 1GVDA 2LDUA 5CPRB 5LHHA 3RPUD 2R7FA 2L5QA 1DPUA 4L9VA 1Y8QB 5K5OA 2L02A 3BC8A 5F0FA 4BDZA 3IAS2 4FETA 4BHBA 5AIPA 4XSXF 4YRVA 1Z91A 1LE8B 1VQ8I 5LHGA 2OC6A 4A3IJ 1HC8A 2GIVA 3QP5A 1F43A 2DPDA 2LTPA 3GLXA 3ABMH 2NOJB 5FB2A 4HX8A 3QPHA 1R9TJ 1X3UA 3HL2A 1GT0C 4G6TB 3GTOJ 3PFYA 3DTKA 1D3YA 3GTPJ 2A68F 4UVAA 3ZXSA 5B3SH 1FIPA 1DPRA 4N4NB 3QPLA 3K2AA 2MLGA 4F93B 1RRJA 2X6OA 3OYAA 2DMTA 2PN6A 2WAQN 2XRLA 1SD7A 2N8GA 2Y48A 4BQNA 5DCMB 4HV5A 4FASD 2KL4A 3ABLH 4QWQA 4KIGA 1JJ6C 2H8RA 2BY0A 2HVQA 1V54H 3R0JA 3AG1H 3U2RA 3QRFF 3OS1A 2FMLA 1WI9A 1DP7P 4BL0B 2HR3A 2AXTC 3FZVA 2BEOA 2LY2A 3ISPA 4B47A 1T2KA 2DT6A 4M6YA 2V4JC 4LMYA 5IYCJ 2I10A 2BVLA 5IT3A 2W25A 1VF9A 2JRTA 2KDZA 1FOXA 2DLLA 4CDGA 2ELKA 1FMWA 3ELKA 2CRGA 5CJ9A 2R3SA 1FY7A 3BQYA 4UB6C 1MNDA 3CCRI 1DU6A 3CF5F 3WHCA 3LSRA 3RKQA 1R23A 3HTSB 1ETKA 1SAXA 4BS9A 5B1BH 2L2OA 3HEFA 2VE9A 1Z1DA 5H20A 1LDDA 2QSGX 2XGDA 2STWA 1SVLA 3TDZC 4BE0A 5JLXA 3MQ0A 2O8KA 1D1AA 1J0RA 3ZQIA 4DJAA 1HCRA 4A6EA 2O5RA 4IHSA 1AA7A 4M3BA 4UV9A 3DBLB 4UUSB 4YFNF 1D8KA 2YX7A 2D5VA 1YW8A 1F1ZA 1RR7A 2ELJA 3CLOA 3FDYA 3LSGA 2KZGA 2H27A 4L0ZB 2L7KA 1ACIA 1D1CA 3GMEA 2EB7A 5E1ZB 1UZCA 4S0HB 4BJTA 4B1RA 2GAUA 3F0CA 2K4JA 2R7OA 5EF6A 1ZG3A 3H36A 5TISC 5JHFA 5H6RA 2NRAC 2ZXIA 3C2BA 4C3HJ 4OMYA 2FA5A 3BZKA 4F55A 4HNVA 1IN6A 2DA4A 1Y56A 3BPXA 3HOVJ 2CU7A 4M71A 3WG7H 2H09A 3ASOH 2JA5J 4N9HA 2HS5A 4DZJA 1B6AA 2DTZA 2D45A 1PDNC 4M74A 1ENHA 2JT1A 1SMTA 4ZH4F 5E3NA 1MSEC 4U0VA 2NVYJ 3CMMA 3CCYA 2YR2A 3GFLA 4CXFA 2R7ZJ 3W6VA 1TNTA 5JR3A 4Q48A 5E20A 4ZZDA 2HQRA 4BEHA 5HLTA 1XCBA 3ZN1A 5A2QZ 2W24A 4XLFA 4CHUA 1TWGJ 1E2XA 3IL2A 1N78A 1BA5A 2IGMA 2CGPA 4HLYA 4E70A 1IUYA 1KQ8A 2DT7B 1N25A 4D5FA 2K02A 2V6CA 1EA3A 2W57A 4F7ZA 3OR1C 1YW9A 2H6CA 3S8PA 3DEUA 2EFQA 5L3BA 1TW2A 4O6JA 3M1EA 1R71A 5AIQA 3DPLC 3E97A 1OCRH 4RS8A 1OYYA 2M8EA 4MFDA 1QZYA 5LGTA 5IOYA 4I0BA 3GVAA 2BYVE 2QSHX 3GTGJ 1IDYA 4E7KA 3N05A 1MMAA 3I4MJ 4P5OA 2M0MA 5KAFC 3MKLA 3WU0A 3CCVI 1CF7A 2PBIA 1ZR4A 3IUOA 1FEXA 2COBA 2PMUA 3VYTB 1LFPA 3J80Z 2VC1A 3GXOA 3G1MA 2Z33A 2F4MB 3HGYA 1XS9A 1JHFA 2MH2A 4L9NA 1HBXG 2VQCA 1NTCA 2M7AA 4OAYA 3M07A 1K61A 5IOZA 3OS2A 1U5TA 2M1BA 3QOPA 3GF2A 4XK4A 1MDMB 3L2VA 4Y13A 1E3OC 1YITI 1XGMA 3VSKA 5FKLA 3NWTA 3MKZA 1TQMA 4KIFA 3MD2A 3TMOA 1VQ5I 1MIJA 2VUMJ 2HXOA 3BR0A 5J1YA 3CCEI 1PYVA 5AONA 3KZZA 5A2QK 4RB3C 3G2BA 5FROA 3MMYB 4I09A 1J2XA 5ICGA 2HDDA 1UHMA 4ABZA 4LFUA 5D5VB 2QBYB 1FWZA 1G2HA 3ONQA 2EPFA 3S1NJ 4CUGA 3I4NJ 2NXNB 4RB2C 2DO7A 1X58A 1HF0A 3KLOA 2XVCA 4I76A 1FOKA 4J01A 4FTHA 1GUUA 3G73A 3Q0VA 4EJTA 1S5LC 1F9NA 4WXCA 3CCMI 2QLZA 1T6SA 3HTUA 2XPVA 4V19K 3VYUB 3DTEA 1KA8A 1FLIA 2CH0A 1S9HA 2WADA 4AM3A 5FO5A 1A35A 5D8LB 1XSVA 2ZNYA 4G6QA 2JQ7A 4BXUA 3X2QH 2GA1A 1IC8A 2IJLA 4EEFG 3FK7A 2P6TA 2MD5A 3J80K 3SDBA 3IWFA 4HDUA 2HI3A 4HBLA 1BI2A 3TDUC 3BZCA 1MSFC 1UHWA 3D5SC 5FLXZ 2OQRA 2A61A 2DMUA 4JP0A 1MZBA 2PG4A 1VQNI 2DFEA 1T33A 3BG3A 3JRCA 3SJMA 2CV1A 1WJDA 3F6OA 1R1UA 4WCGA 1ETVA 2JUCA 2TDXA 3T5XA 1YQAA 3TL4X 4F52A 5HS9A 1GV5A 4IRHA 4XRFA 1QNTA 2X9DA 5IT9K 1TNSA 2F2EA 1FOYA 2IS6A 3KYDB 2YS9A 2OTLI 4XRSG 3CMAI 1X3ZB 3DPUA 4ZZLA 1U8BA 2RGVA 2IGOA 2XGEA 4GO1A 1GHCA 1U6GA 1XGNA 2M7BA 1JGGA 1WJEA 2HYJA 3U9GA 1X3WB 2Y9YA 3CDIA 4KN4X 3EPZA 2QQ8A 4CZZA 4G12A 2ETHA 3CTAA 1D5YA 3LQRA 3VSLA 2CSOA 1TT0A 1ZH5A 1HW5A 4HX4A 1Y6IA 2DW4A 3K10A 3HUGA 4EM0B 1JKPC 5LBQA 2HZTA 3I58A 2NYXA 3DFGA 1A5JA 2RKHA 1WFXA 3AAFA 3LNQA 2KDOA 4YEJA 5HDGA 1ZKGA 3DXJF 1BJZA 4U7BA 4D1QA 1UHSA 1UCRA 2HQ5A 2IGNA 3KZIC 5LLQA 5LFAA 5FLXK 1R6RA 2W82A 2OCEA 2M4GA 2M8GX 3H5NA 3LSKA 2Y0SN 2EZIA 3HOYJ 2NVUB 1AKHA 1OCZH 4RAZA 5F6FA 4PFOA 1WJFA 4E7HA 2HPMA 3PIOF 3FXLA 2ECBA 4XKCA 5LRRA 3E5UA 3C1DA 3OR2C 3HOUJ 2HOSA 4PJJA 1LE8A 3HSRA 1W0UA 4YIIA 4A0YA 1D0ZA 1X2NA 1RKWA 1FIAA 3ZN0A 3GTQJ 3ZQGA 4KT6A 5HNFA 4M3DA 4RA2A 4CCLA 5FKNA 1FP1D 2NOGA 3Q3SA 5CQGA 1ZG5A 1I6XA 1OCPA 2P0WA 5HLIA 2O61A 3HHGA 2FBIA 1OPCA 1YS7A 2JPBA 1B59A 1HXDA 1P4WA 2K4BA 5DCMA 1U9OA 2AHQA 3OYDA 2DAOA 2K9MA 3I64A 1XG1A 2CW7A 2M0CA 3P9CA 2Y0SA 4IHVA 1A04A 2EFOA 1ZGWA 4KJZA 4RGXA 2QYOA 4LD5A 3ZOBA 5BPDA 4A69C 1G3TA 4P96A 4DW6A 2K27A 1R5GA 3A03A 2JZYA 4C30A 5E8GA 3ZQLA 3TBIA 3DEWA 4LIVA 2XAUA 4BEHB 2OPTA 5E3MA 2BY3A 2K86A 5FRNA 1RKTA 4RM2A 1XDSA 2RDPA 2L01A 2ADUA 1OFCX 1LVKA 1RPWA 1G6NA 4XKBA 1PVEA 1B72B 2DMNA 1TZLA 2LY1A 4M72A 3PUFA 4GRIA 3U1DA 2RQQA 3OYIA 1K4TA 4KA4A 4HZFA 1OMIA 1WJ5A 2M9HA 3H3UA 4IVNA 3BTIA 2WV1A 1TLHB 2E1NA 3B73A 1ONVA 3OYEA 1JGSA 2R5YB 5D5XB 2EV6A 3L7WA 2JSPA 2LREA 1XD7A 3GW2A 4FQGA 5IYDJ 4E7IA 2XGCA 1I3QJ 1LUJB 3J7ZI 1W7PD 2LBFA 5J6XA 1Z3XA 3K4KA 1S7EA 4A3KJ 4UY8I 2LY9A 1Z0XA 1CF7B 1LVAA 2OCCH 1IW7F 4OINF 1P9QC 3ZR8X 4OAZA 4ASNA 4BQAA 1QZEA 1VQ7I 2KP6A 2OF7A 4KDPA 1BOAA 1XGOA 5TJJA 3M4OJ 3M8FA 1R5HA 4EJUA 5DM6F 3GTJJ 3HBLA 3CDHA 2QA4I 3RZDJ 1U5TB 3LA2A 2EWNA 5ILUA 3NAUA 2RC4A 3FXQA 2H1LA 3MKWB 1R36A 5D5UB 1TQPA 2DPUA 5EZGA 2E60A 3RZOJ 3M8JA 2K7LA 5LD2C 3HOZJ 2IS2A 3FHNA 1YG2A 3ZQQA 1UG2A 1F36A 2E7WA 2L9RA 5FKKA 4Q47A 3BPVA 3S3MA 2H1KA 1DQUA 2FNPA 5GADJ 2XB5A 3AG3H 1T56A 1BIBA 5GPAA 2ACJA 1GXPA 3VYSB 3ZMDA 2L9SA 3FXOA 4AIJA 3M1CA 2ISZA 1IV8A 1LDKB 2IPQX 3CLQA 2DYRH 4LB6B 5EZHA 4A12A 3K70D 3WGIA 1R1TA 1Z67A 2D2WA 2XAJA 3RQ4A 5D4RA 3FXJA 3HRTA 4QLCU 1OCCH 1XMXA 3DP7A 2H6BA 2ZSIB 1WPKA 3F8MA 2DJNA 3C2GA 3QWLA 4OU0A 4A5MA 1QGPA 3CUOA 3K7AJ 1FPQA 2NAZA 3HRMA 4XKVA 3KETA 1ZRFA 3I56I 1SVOA 3ROUA 4EMSA 4Z6YA 2YPRA 1XMKA 1BIAA 3SQNA 2V26A 1B8IB 3I59A 1ZLJA 2KFDA 3W2WA 1IXSB 2R7WA 2E2HJ 3PQKA 3PIPF 4NQWA 3CQZJ 4B09A 4IRIA 1KGSA 2FSWA 1JI8A 1OR7C 1Z6TA 5EEHA 5IYBJ 1Q1VA 2CWEA 3FIWA 1B9NA 1BOBA 3FBNB 3JRBA 2KIUA 1E3HA 1I5ZA 1Z21A 3BDDA 4JX6A 5B66C 1O3TA 1LKXA 4HRIA 2MC4A 4IXAA 1IRFA 3QU3A 3CCJI 2GQQA 3FISA 1BL0A 1UG0A 3H92A 3CF2A 4XLCA 1MDMA 4LLNA 4HV6A 2UWMA 4LB5A 3KYCB 2K40A 1R4MB 3QYBA 2L3DA 3ULQB 3ECHA 4XIDA 2W00A 4MQVA 1MBHA 2YX4A 1X1BA 3LAPA 2LVSA 1Y1WJ 3WG9A 3GZNB 1QHHD 5JFRA 1KQ9A 2YU3A 3ZQCA 1BC8C 4FE7A 2X6YA 3KP3A 3SZTA 2EZLA 3HXLA 2B9SA 1C0WA 4L0YB 2DA7A 2L7FP 5LEKA 1ZLKA 1P7IA 2QBYA 2EBIA 2PFBA 4H4KC 2V6EA 4RM3A 5B5EC 3GLLA 2X6WA 3ZMZA 2P6SA 5JI6A 4RB1A 2K85A 4MIMA 3PNTA 2FX0A 2BVMA 2Q2EA 1MKMA 2RREA 2QKMB 5L3CA 4A0ZA 1ETQA 5L3GA 4FCYA 3CCLI 4KMFA 2JVHA 3ERMA 1U0JA 1BJAA 3K2ZA 3CZ6A 4MFEA 1LPQA 4BJ6C 2R7SA 4IOAF 4RAGA 2IP2A 3DKXA 2VI6A 3PO2J 2JK3A 3HJEA 4UVCA 4BE1A 3BR1A 1ON1A 2AS5F 3CC2I 5HVQC 2VN2A 2DMPA 1IG7A 2IW5A 5FKMA 3OV8A 1WWXA 3A4CA 1I6HJ 4IJAA 4AC0A 2JSCA 2LH9A 4B8XA 1J09A 1AKHB 3V8JA 1R1VA 2DQLA 2WC2A 3QPTA 5EEGA 4PSWA 2A05A 2VKVA 2CG4A 2XB0X 4AIDA 2CQKA 1ETOA 3FKJA 1YTYA 3L00A 5FGMA 5JHUA 5GAHJ 4EJVA 4OIOF 4CZCA 2OZ6A 3FM3A 2KPMA 2DK8A 1FP2A 4ENMA 5L3EA 4HAMA 3DTIA 2WBMA 2CS3A 2QEXI 4L9TA 3AG2H 2OAZA 2Z2SB 3SDGA 2J5PA 2CMPA 4XRSA 1LEBA 2ZB9A 1SAUA 3UKGA 4M9ZA 2IBDA 1U2WA 4B43A 1H0MA 2H8WA 3BTLA 2K9SA 2EIJH 4BACA 5DEQA 3F22A 5DD4A 3D1NI 3I55I 3OL4A 1D5VA 4IX7A 2E36A 2R7XA 4EVIA 3E6MA 1X1DA 1OISA 4NNJA 3O3KA 3BWGA 2O03A 3P9KA 4EM1A 1FTZA 3JRIA 4DQ2A 2F5CA 3F23A 4II3A 1ZRCA 2P7VB 1K6OA 3S93A 2QM3A 2L4AA 4J00A 2NVTJ 4BGDA 3M9AA 4AU7A 1TWFJ 2CO5A 1ETXA 2LF8A 2QQAA 1MBFA 1WRJA 2ZNZA 4E7SA 4QPOA 5DUKA 1IUFA 2IS4A 2ZJPF 2VJ5A 3LSPA 3JRGA 3F8CA 2OD5A 3S17J 5IP9J 2LOOA 2K3FA 1YJWI 4FX4A 1WJAA 2M30A 3VWBA 4IHWA 2OBPA 3KEQA 5JVTA 2WAQA 3T8RA 1FYMA 4AIKA 3F72A 5J3LA 1BI1A 3VPRA 4ESJA 3TP0A 3LOCA 4M73A 2EZKA 2KKOA 3K4MA 2LBFB 1KYZA 5E17F 4MEYF 1WGXA 2CFXA 3RPQA 4PGHA 4PUSA 2R93J 1NK3P 2GA2A 3KZYA 3S15J 3R6SA 3BZ6A 2CQ7A 2DA2A 1QZZA 3J7AY 2MA3A 5GAEJ 4RGRA 4XM3A 1RESA 1FNNA 1W1WE 3O2PE 4XKWA 1FZPB 3HSEA 3TO7A 3CDLA 4OMZA 1G3SA 2E1CA 3EUKL 1W36D 3DF8A 1WI3A 5DD8A 4ZYGA 4IPAA 2AQEA 4HSTA 2ZXJA 4EATA 3MZHA 2V1UA 1EH7A 1V3FA 5IP7J 3NARA 2G0EA 4DYRA 3TW6A 1X1CA 1B4AA 2UXXA 5KHDA 5JLWA 2BW3A 3WODF 3JRHA 3CO7C 1MMNA 3MVPA 5F1RA 1U5TC 4OIRF 2XPWA 3CP2A 1LFBA 3HDDA 1YHQI 1SC7A 2JA7J 3F3XA 2ISYA 2DFHA 3GEZA 2X51A 3OYHA 3K4JA 5DS9A 1NH3A 2V9PA 1YJ9I 2A5WA 2HOAA 4GCVA 3RI4A 3P5JA 5K5RA 3AL0B 3KEOA 2ZJ2A 1ETYA 3S1RJ 3RPUA 3FHZA 3R4KA 1B72A 1XX5A 1MH4A 3R0AA 2JVGA 4LOCA 1PJRA 1JKRC 3OYBA 1H89C 1T0FA 3IH2A 3LL7A 1N77A 4C3JJ 3OWTA 2DCEA 1IV6A 2HEOA 4Y17A 2R5YA 2EFPA 2KLOA 1MW7A 2Q1ZB 3N4MA 3BJAA 3QP6A 3VEPA 3JAMZ 2I8DA 3LQQA 3CJNA 2K5CA 3I59B 3KP6A 5E1WA 3K9TA 3TW7A 2PLYA 1G4DA 3OIPA 3CCUI 2Y9ZA 3OS0A 4NQWB 2PMZN 1Y0NA 3K1PA 1O7LA 2VKDA 3GCMA 4HNTA 4JYKA 1J5YA 3QQAA 1W36C 2EIKH 2ZFUA 2ZJQF 1P92A 1TTYA 3DU6A 2NNNA 1ZGJA 3CJQB 1VQPI 2W7NA 3T1BA 3CUQB 3KCCA 3SYTA 2WTEA 1USSA 4II2A 3J7YJ 3FWEA 3CMYA 2XASA 4DBQA 4R79A 1YYVA 3DV8A 4CSWA 3CC4I 5DM7F 5F64A 3G71I 4ZYAA 4RBOA 4H0EA 4M3EA 2WY7Q 2KMUA 3Q9SA 3OYFA 2NNYA 2HU9A 4UXNA 3GO5A 3OIQA 2CQXA 5IT9Z 2ESNA 3GZ5A 3GZ6A 3M8EA 1JUSA 3GBGA 1WCMJ 1B9MA 1H9TA 2P7CB 3Q9VA 1JKOC 3ZMUA 4I01A 1YLFA 2X1EA 4ZTJA 2PMZA 3E7LA 2EK5A 3HIFA 2Q2EB 3OIOA 2MC3A 1BR2A 5FKOA 2EQRA 2AO9A 4BU2A 1FBSA 1HKQA 4EGZA 4FHTA 3JAMK 3VYRB 2ZMEB 3JRAA 3HC7A 4UUVA 2IA1A 3NQOA 2FRHA 5HS8A 2B0LA 2YSRA 2HNHA 3LFUA 1LJ9A 1ZN2A 3GTMJ 3BR2A 4WF2A 4BBRJ 5HODA 1VQMI 3LMMA 2DOFA 2M34A 1B8IA 2OUMA 2UXNA 1QVTA 1LEAA 3VDXA 3TEDA 1SVMA 3M7GA 4ENKA 4BDYA 1NG7A 1XC5A 4PJ0C 2DODA 2P5LC 1FYKA 4YIRX 1SFEA 3L2RA 1DP3A 4RDUA 5H6QA 2IS1A 3I54A 1FC3A 2FMYA 3PSIA 1IJWC 2Z1DA 4ZDLA 4BKXA 1WH5A 5IY5H 5BOXA 3EETA 1P2FA 3S14J 3F8BA 2HZDA 2HQNA 2J5OA 4A3GJ 4Y15A 4U0YA 5J8CA 4FISA 1WHUA 2C6YA 1Y0UA 1VFCA 2TRTA 1BW6A 2DA6A 3HOTA 1KU7A 2QQ9A 3WTTC 4D7MA 3K4CA 4HOBA 4UNOA 3L2UA 1ULYA 1I50J 5FD5A 3G6EI 3KX2A 4HLXA 4A3EJ 3BCBA 1A6IA 3KP4A 4YG2F 5CLSA 1Z77A 4RLFA 3K6GA 3ZMSA 2PEXA 4JBAA 3OOUA 3IRRA 2Z99A 3SEZA 2YUSA 4DIQA 4XLPF 1MJBA 1UJ8A 2K9LA 2QF7A 2XUBA 1RI7A 3WTWC 4WXDA 4F92B 5EDNA 2WWYA 1SD4A 1YO5C 5E18F 3L9FA 3BROA 4IEJA 1OQYA 4BNCA 1MBJA 3OYJA 5L3FA 1MBKA 3V7RA 1Z7LA 2KRFA 3COAC 1APLC 4K2EA 4V2GA 4F91B 4LK1F 2BZTA 1Z6RA 1ODDA 2M3AA 2ME6A 1JE8A 1FYLA 1EH6A 3WGHA 2VPRA 1YE9A 2HYFA 5CQEA 5K5QA 5CVUA 3B6AA 1I39A 1RNLA 2OZUA 4G7OF 2E35A 4XONA 5ICCA 3HM5A 4D5CA 5DTDA 4P9FA 5EEAA 4DNCA 3E6BA 3L2WA 1RETA 4UHTA 2QQBA 2LLKA 3OY9A 1UELB 2DTRA 1G3WA 4P55A 5HNHA 1QPMA 2WA0A 4BHPA 4JX4A 2VKEA 1OYWA 1X19A 2UV1A 3LA3A 1WVRA 2Z5UA 4EGYA 3ZRGA 4BXFA 1O4XA 1AHDP 2X6XA 2FNAA 5FFXA 2KISA 1IN4A 4NC6A 4XBFA 2HQAA 2DQRA 2V7FA 3CESA 3IH3A 4MGRA 1AU7A 2PX9A 4NUBA 1X1AA 3FX3A 5FJ8J 1SD6A 3A01A 2A07F 4AVPA 3U1KA 5LRSA 2CW0F 4MNUA 1MD0A 3S3NA 2ZC2A 4LG3A 2L54A 1E17A 2W84A 1TT5B 2K3PA 4EM2A 3ZQFA 3BJOA 2CUFA 3E5XA 2XROA 4XSZF 3P9IA 1VQ4I 3PJRA 3HRSA 2FF4A 4XN3A 2PJRA 4OIPF 3N97A 5LGUA 1S6LA 3ASNH 2VL8A 4E6KG 4GFBA 2BW3B 3HOXJ 2NS7A 3O8HA 5BQTA 2EA2A 3LSMA 2B7EA 4NHJA 4KIBA 3HOWJ 3HG9A 2DA3A 2Y30A 4XLEA 4HX7A 2FOKA 2MLKA 1ZQ3P 2XF7A 2Y31A 2ID3A 1TW3A 1FT9A 3W2AA 1BR4A 1Z9CA 4ESFA 4XQFA 3LSHA 3H1CA 4B44A 1YX3A 2BE5F 3HOSA 3JSPA 1U78A 3Q0UA 4Y33A 1E3PA 5GP9A 1S3JA 3ZMVA 5J8FA 4I2OA 2XV4S 3HSFA 3AFHA 4KITB 2VXZA 4A6DA 2ZBKA 1Z3YA 5ICEA 3AL0C 2IEKA 3DEEA 4L5EA 1IN5A 2VQLA 1TWCJ 2IA2A 4UB8C 1JT0A 1VQOI 2E2IJ 1WSUA 5EGOA 3HPHA 4KMUX 4KNYA 1W5SA 1YRNB 2JTVA 3PFIA 1S72I 1DU0A 3K4NA 1UFMA 1A6QA 2HWVA 1HA8A 2X4HA 2E5NA 2MFZA 4J19A 2LP0A 5HDKA 3TOAA 1IXRC 1JUPA 2HYGD 2M2EA 2XAQA 2OJED 2E1MB 3WTVC 3SFZA 3CMEI 3OYKA 3CCSI 1QA6A 4M9XA 2BY2A 3F9KA 1MNMC 1O3SA 4CCKA 2QWWA 3PNVA 1MMDA 1ZAOA 4M3GA 1CQTA 4NC8A 3I0TA 2CFOA 4X1EA 1MJAA 5E3OA 1H8AC 3GFJA 1SFXA 3RYPA 2VBXA 4HQEA 1AWCA 5J4VA 2WY8Q 3LWFA 3WTXC 4D9JA 1POGA 2IVMA 1FBUA 1K83J 3WU1B 2TCTA 2JA2A 3BG5A 2O0YA 1WQ2A 3CUQC 4L5JA 3K1NA 4RLQA 1NK2P 3WGGA 1VTNC 4KYWA 4JK1X 2MD0A 2O6GE 1X4OA 2A3SA 1XB4A 4ZDPA 2QZ8A 1STZA 5EYRA 1MMGA 4B3AA 2H94A 5E1XA 3S2WA 1V4RA 2ZJRF 1T98A 3V8KA 2ZXWH 3DWLE 1N75A 4WXHA 4XN0A 3SEQA 2VKHA 2CJJA 4OWRB 2RN7A 1DGWY 4HG2A 4AIHA 2X85A 2EFWA 2P5VA
chains in the Genus database with same CATH topology
2DYSH 3X2QH 1V54H 3AG3H 3AG1H 3ASNH 3ABMH 1OCRH 5B1BH 1OCZH 2DYRH 2EIMH 1OCOH 3AG2H 5B3SH 3AG4H 1OCCH 2ZXWH 2EIJH 1V55H 5B1AH 2EIKH 2EINH 2EILH 3ABLH 3WG7H 2OCCH 3ABKH 3ASOH 2Y69H 5IY5H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DYS H;  3X2Q H;  1V54 H;  3AG3 H;  3AG1 H;  3ASN H;  3ABM H;  1OCR H;  5B1B H;  1OCZ H;  2DYR H;  2EIM H;  1OCO H;  3AG2 H;  5B3S H;  3AG4 H;  1OCC H;  2ZXW H;  2EIJ H;  1V55 H;  5B1A H;  2EIK H;  2EIN H;  2EIL H;  3ABL H;  3WG7 H;  2OCC H;  3ABK H;  3ASO H;  2Y69 H;  5IY5 H; 
#chains in the Genus database with same CATH topology
 1IN8 A;  2QCO A;  1O3Q A;  4L9J A;  4AVZ A;  5C44 J;  2DT5 A;  3P7N A;  2VT3 A;  1QO0 D;  4BBS J;  2R7V A;  3I71 A;  3BQZ A;  4XLH A;  2XAG A;  1XDU A;  2K9Q A;  1ZEL A;  1IO2 A;  1R5I D;  5J1R A;  1Z05 A;  2DK5 A;  4W97 A;  5H2F C;  2ICW G;  3H35 A;  3SHF A;  3QAH A;  2QEN A;  2ZME C;  3KE2 A;  1JHH A;  3W6K B;  1H88 C;  3BG9 A;  1J9I A;  1KU9 A;  3A0B C;  3TKY A;  3SZP A;  1GLN A;  4ON0 A;  1WKM A;  2JPC A;  2BHZ A;  3ABK H;  4ZYD A;  5C4X J;  4CA0 A;  2IGK A;  3FM5 A;  2KHM A;  1TQI A;  3CUQ A;  1T8I A;  1P4A A;  2R0Q C;  3Q0W A;  2EA4 A;  1R7J A;  3E6C C;  3BT9 A;  3G3Z A;  1ETW A;  4BE2 A;  3OYN A;  5D4S A;  2DI3 A;  2GXG A;  4G94 A;  3VOD A;  3MFK A;  3V8L A;  2HVS A;  3K0L A;  1SFK A;  4B48 A;  2JA6 J;  3S3O A;  5HLH A;  2A69 F;  3LSI A;  2UZK A;  5M5W J;  2VOD A;  4E7J A;  2EIL H;  1ZRE A;  2ID6 A;  2QGU A;  4ZYE A;  1Y8R B;  5HS7 A;  1DGR M;  4F3Q A;  3A2K A;  2XAF A;  4PK4 A;  4M3F A;  1QHG A;  5J1U A;  2GBY A;  2E71 A;  4E7L A;  3DCF A;  4IOC F;  3LST A;  2VB6 A;  2HXI A;  3I9V 2;  3OOP A;  2ZSH B;  4A3M J;  2DXI A;  4JOM A;  4ZYH A;  1ZG1 A;  1VND A;  4PZJ A;  3DBH B;  4HF0 A;  1QRY A;  2VLA A;  1YJN I;  2FD5 A;  2JRM A;  1XTA A;  3IP4 B;  2CUE A;  3V7S A;  1Y39 A;  1F5T A;  5L3D A;  2XDV A;  5DV5 A;  2ZME A;  4G7H F;  1Y1V J;  1W7P A;  3FXU A;  2HGC A;  2ZFW A;  2M45 A;  3S2H J;  4KN7 X;  2JUG A;  1IGN A;  5M5Y J;  3PM1 A;  1FMV A;  2E1O A;  1YFH A;  2F48 A;  2QKL B;  4X0G A;  3BCA A;  2VXD A;  3QYF A;  4GYG A;  2KIF A;  3H0D A;  4PJM A;  1O57 A;  1P4X A;  1I1S A;  1M1E B;  5KVR A;  2G7H A;  2QSF X;  4BAY A;  1B1B A;  4HW0 A;  2KZV A;  2K9N A;  2P5K A;  1HW2 A;  2XGX A;  2V79 A;  1IF1 A;  4R1H A;  2VOO A;  3S1Q J;  2VAS A;  1WH7 A;  1K4S A;  2LYC A;  3ZGK A;  3K4B A;  4LIT A;  1YS6 A;  5C3E J;  4HNU A;  2R7R A;  2HTJ A;  3H5R A;  1IAW A;  3I3L A;  4DBR A;  2F5F A;  1ON2 A;  2BXY A;  2Y2Z A;  4XLA A;  1PUF A;  1UAA A;  3RCO A;  2XSJ C;  4BHC A;  4A0X A;  2V1D A;  3RTR A;  3TOB A;  4Z2Y A;  3A01 B;  4LG0 A;  2E34 A;  2LG4 A;  2XSD C;  2ZXH A;  5GTI C;  4IO9 F;  1HKS A;  4LLL A;  1I1G A;  1FJL A;  1RZ4 A;  2FU4 A;  2GLO A;  5CKT A;  5KAI C;  2LR8 A;  3DQV C;  3ML6 A;  1WZ2 A;  2LK2 A;  4XOR A;  4Q5S F;  3QU6 A;  4HEA 2;  2LF7 A;  4C3I J;  2DOE A;  3JRD A;  2PJR B;  4XLN F;  4Q4Z F;  3W6J B;  2B63 J;  5FLV A;  3A1Y A;  3G1O A;  2CQN A;  3E3V A;  4PDK A;  3RKY A;  3EUH A;  2VPL A;  1NHA A;  5E79 C;  3QPS A;  5D8K B;  4BH9 A;  5DYM A;  2ZKZ A;  4BYY A;  4DOZ A;  4A3J J;  5IP6 A;  5KNL A;  1ERD A;  2O9L A;  5M5X J;  3RSN A;  4WX9 A;  4MLO A;  1IRZ A;  2R7U A;  1P7J A;  2DN0 A;  3DPT A;  4MO7 A;  4FX0 A;  3TO6 A;  3OSF A;  1ZTR A;  5F1J A;  5HDN A;  3R61 A;  5FRM A;  3BR5 A;  4ANJ A;  1ZYR F;  4EJW A;  4XNF A;  2RV8 A;  2F5D A;  2GXB A;  3AKZ A;  2CV2 A;  3MWM A;  3IKT A;  1KQ0 A;  3MEX A;  1SMY F;  2I5U A;  3F6V A;  4OOI A;  2W4S A;  1FTT A;  2FQ4 A;  2BHY A;  1V55 H;  3R60 A;  1D0Y A;  3ESW B;  5K7Z A;  3HGG A;  3JTH A;  3O8G A;  2KJC A;  2F6C A;  5EGO B;  1FOW A;  1GDT A;  2GIZ A;  3HB9 A;  3PUB A;  1T0F C;  1W0T A;  3FKI J;  1YX5 A;  4RAY A;  3RDI A;  2E5Z A;  5CVJ A;  1X4P A;  1LQ1 A;  2ME0 A;  1DUX C;  3OSG A;  1IRX A;  3S32 A;  4CYC A;  2M87 A;  1MNE A;  1VI0 A;  1J7K A;  2A6H F;  3HPG A;  2VOP A;  2YU9 J;  3L1P A;  3D5L A;  5K7F A;  2FJ1 A;  4ZTF A;  4YIF A;  2E2J J;  2Q8K A;  3H9J A;  4AD9 A;  3OYM A;  4LGW A;  3JRE A;  4UVB A;  2R5Z A;  2CQQ A;  1QVU A;  1MH3 A;  2VJI A;  3TGN A;  3BG6 A;  3DBR B;  4RGS A;  1RUO A;  2M4K A;  1YIO A;  3MCZ A;  2DFI A;  2ZO4 A;  5CVV A;  2EV5 A;  2E1M C;  4JX5 A;  4ZDO A;  1XN7 A;  5BPI A;  2DA1 A;  3KEY A;  3ERE D;  3Q5F A;  4IHT A;  1R22 A;  4P1W A;  1T38 A;  2WB1 N;  2HPI A;  4P9U A;  1OCT C;  3IAM 2;  5LHI A;  2FE3 A;  2F4I A;  2LRD A;  4V2F A;  2G7U A;  1ZHF A;  3KP2 A;  2X0L A;  3G4S I;  1MJ9 A;  1J59 A;  2HKX A;  1IN7 A;  1TBX A;  5DUI A;  5J4Y A;  3J7A O;  4CCM A;  1BN5 A;  2CYY A;  4G6D A;  1V5G A;  4CH7 A;  3MZ8 A;  4KIC A;  1KON A;  5IPA A;  2BXZ A;  1S7A A;  1X2M A;  3U21 A;  3JCU C;  2Y0M A;  2BGC A;  3ZMT A;  1HOM A;  3BR6 A;  4CYD A;  2RAE A;  2DMQ A;  3DLL F;  3PQJ A;  1YRN A;  1ZRD A;  3BJ6 A;  1ITY A;  1PP8 F;  4U0W A;  1JTY A;  2GM4 A;  5GTH C;  4MTE A;  2WV0 A;  3GX4 X;  2WB1 A;  3CO6 C;  1NG6 A;  4C2T A;  2KQR A;  1SEU A;  2VQH A;  2QUF A;  3BP8 A;  3EUA A;  2VIX A;  1V5F A;  1K78 A;  1ZGA A;  1F4K A;  2F5E A;  1XGS A;  3EYI A;  2FEZ A;  4QTR A;  2LC2 A;  4BQQ A;  5DCF A;  4L18 B;  3PO3 J;  3NWS A;  1GVJ A;  5BNG A;  1VQK I;  4WK8 F;  3FK6 A;  2NS8 A;  3IC7 A;  5GAG J;  4RB0 A;  2HKO A;  3LFK A;  2LKS A;  1XMA A;  4N4O B;  1ZK8 A;  3JSO A;  2GZW A;  3BY6 A;  2PI0 A;  3S16 J;  4BUP A;  3CC7 I;  1L0O C;  1QU3 A;  4DYQ A;  4HF2 A;  4IQ4 A;  3GTK J;  3JW4 A;  1HSJ A;  4R8H A;  4C2M J;  2LD5 A;  1FX7 A;  4HYE A;  3OYG A;  1D8J A;  2HTS A;  4X6A J;  4BJ5 C;  1W5C C;  2EZH A;  2JJ7 A;  1ORK A;  1S29 A;  1ZAR A;  2XIG A;  1J75 A;  2IXS A;  2ELH A;  2F5V A;  2XF5 A;  3K4L A;  3S2D J;  4D7N A;  4HA8 A;  2JA8 J;  2VT2 A;  4B4C A;  1LB2 A;  1RUN A;  4BY1 J;  4QIW N;  1TP4 A;  2P81 A;  4EQQ A;  1R49 A;  2GXA A;  5BMZ A;  2GWR A;  4C2U A;  1W7P B;  5JVG F;  2VBW A;  3K69 A;  3WTU C;  2HFH A;  1R00 A;  2D1V A;  4GXO A;  4KT5 C;  5ED4 A;  1FBQ A;  2RNJ A;  3EQL F;  2GOM A;  3IRQ A;  1D0X A;  3CJR B;  1OKR A;  2MSY A;  4N9I A;  3RKX A;  2MYS A;  2OQG A;  4XOP A;  3PL8 A;  3ZQ7 A;  4A3F J;  1JUM A;  1VZ0 A;  1OYI A;  2R92 J;  3C3W A;  4O5V A;  1K79 A;  1P6R A;  2VC0 A;  2DOA A;  1S7O A;  1G8X A;  3J81 Z;  4MEX F;  4ZC3 A;  1G59 A;  1HDD C;  2D1H A;  4DYC A;  5F0H A;  3LSJ A;  2R7D A;  2R7Q A;  2EJR A;  5K1Y A;  3IV5 A;  4HDV A;  2CUZ A;  4A3L J;  4KFC A;  3KIO A;  1UST A;  4I02 A;  1FSE A;  1KU3 A;  4RMN A;  4A3D J;  2A6E F;  3WTZ A;  1ZR2 A;  1EF4 A;  2E7X A;  2LKX A;  5EJC A;  1PP7 U;  1HLV A;  4FT8 A;  1E0E A;  2F4O B;  3E1S A;  3H5A A;  5TGT A;  1PUF B;  5TRD A;  1MGT A;  4CCN A;  3ABT A;  4M9S A;  1UMQ A;  3WTS C;  2DU9 A;  2FBH A;  5ICF A;  3EDP A;  4LG0 B;  3SXY A;  4DGW B;  4XIC A;  4IRG A;  1D1B A;  2DDA A;  4M6V A;  2IA0 A;  5CVI A;  5BS6 A;  2VBZ A;  2FBK A;  2GOX B;  2NVQ J;  1FSH A;  5CVR A;  5HOO A;  5F27 A;  5DDG A;  5EG0 A;  2CV0 A;  3ZP5 A;  2XAH A;  4DZP A;  1SFU A;  3OL3 A;  1BR1 A;  1XCV A;  1IDZ A;  2LNB A;  1XSD A;  4QPQ A;  1QBJ A;  2HOT A;  2QVO A;  2LSO A;  4OIQ F;  1W4M A;  2FUG 2;  3A02 A;  3MAJ A;  2DA5 A;  4MTD A;  1G3Y A;  3H9Q A;  3W3C A;  2XHK A;  1LFU P;  2MW8 A;  3RKW A;  4BQO A;  2OV7 A;  4N0B A;  2VBY A;  3UR3 C;  4HF1 A;  2CUJ A;  1T08 B;  2RNG A;  2EFN A;  1HDP A;  5E8I A;  1U9N A;  3J81 K;  4A3C J;  3V4G A;  2FQ3 A;  4NB5 A;  5FD6 A;  4U7D A;  1EJ9 A;  3RIR A;  4PCQ A;  1IXC A;  1QPI A;  1BBY A;  4L5I A;  6PAX A;  4Y52 J;  1EH8 A;  3ZQH A;  3IWZ A;  1OLT A;  9ANT A;  1SD5 A;  3H3V K;  2FXA A;  1W5T A;  4A3B J;  1S8N A;  2KIQ A;  2AXL A;  3IKV A;  2KIM A;  3E6D A;  1CGP A;  2HDC A;  4XMY A;  4CCJ A;  1GV2 A;  5D5W B;  4IZZ A;  4WWC A;  4U87 A;  5FFZ A;  3HRU A;  3KP5 A;  4PJN A;  1VQL I;  1JKQ C;  2NS0 A;  3E5Q A;  2R7T A;  1IRG A;  1TC3 C;  4RAF A;  1A31 A;  5J47 A;  5KK1 A;  2IAI A;  1I3A A;  2L7M P;  3FF5 A;  1JT6 A;  4LLG F;  4CYC B;  2V9K A;  3KPH A;  3GUD A;  3I4P A;  5ILS A;  1BC7 C;  4ENJ A;  4GYI A;  4U88 A;  2HOE A;  2P8T A;  4IHY A;  5E3L A;  4XRM A;  3I5U A;  2XC7 A;  2BOL A;  2JN6 A;  1R58 A;  3GTL J;  3JTG A;  3FMQ A;  4XR6 A;  3GWZ A;  4IKF A;  2W85 A;  3BTC A;  3TQN A;  1TWA J;  1BM9 A;  2CW8 A;  2XRN A;  4Y4R A;  1MMS A;  2LFB A;  5LEJ A;  2E19 A;  2X48 A;  2R5Z B;  4AUX A;  1Z7U A;  4CIC A;  4NBQ A;  1BW5 A;  2MAB A;  2ECC A;  4B3X A;  4CO8 A;  3HYI A;  3NEU A;  2PQ8 A;  1LNW A;  4C9Y A;  2L4M A;  2WAE A;  2BBY A;  5F0C A;  2R4G A;  2XF6 A;  3V7C A;  3WHB A;  2PMH A;  3LAJ A;  1K6Y A;  1XPX A;  4ESB A;  4NC7 A;  4A93 J;  2PJP A;  4NDL A;  3OMY A;  2Y75 A;  5LGN A;  3A0H C;  4IHX A;  2STT A;  3ZPL A;  3SFI A;  3O6B B;  2DDB A;  2O3F A;  2EIM H;  2EH3 A;  1U8R A;  3REO A;  4PFP A;  2KJB A;  1VQ9 I;  2MH9 A;  3DKY A;  4W1U A;  3BLY A;  2EV0 A;  3HKZ N;  2RQP A;  4S05 A;  4M6X A;  4BXX J;  5M3M J;  1JJ8 C;  2AQF A;  2L9N A;  5F08 A;  2RVC A;  3IHU A;  4GDF A;  1RIO H;  3GYH X;  1MBE A;  2W1O A;  2VQG A;  4KIS A;  4HPQ A;  1H9G A;  1Q1H A;  4PSX A;  3W2V A;  3CCQ I;  1REP C;  1LDJ A;  2M5W A;  3M3Y J;  4XOT A;  3H9G A;  3JR9 A;  2VJJ A;  2ZCW A;  1K78 B;  1X1P A;  3D5R C;  4I98 B;  4UUS A;  3L2C A;  3L09 A;  3IH4 A;  4G8X A;  4UV8 A;  3OYC A;  1HKT A;  2A5Y B;  4EJO A;  4YEL A;  1O7F A;  2DFF A;  2OTJ I;  5FLM J;  3CP8 A;  3D0S A;  1YOV B;  2L9V A;  3WU2 C;  2LKP A;  1YW7 A;  1KYW A;  3FXM A;  3V42 A;  4I0A A;  2VON A;  3H3Z A;  3QOE A;  2X1D A;  4ETS A;  2OU2 A;  2KRC A;  1JTX A;  5D6E A;  1OCO H;  2DJI A;  3HKZ A;  3BG7 A;  1OJL A;  4Y7N J;  2V1X A;  3ABU A;  4G9Y A;  4A2U A;  1KU2 A;  3MKY B;  2DBB A;  2HDW A;  3T0Y A;  4YFK F;  1EV7 A;  1XSX A;  2XPU A;  4A5N A;  4IF4 A;  3RJP A;  3JRF A;  3C18 A;  4RGU A;  4I99 C;  5ERI A;  3FMS A;  5GPC A;  3SZG A;  2BV6 A;  4QSH A;  1O3R A;  3PSF A;  3E0J B;  1UB9 A;  1I27 A;  1A36 A;  4PJL A;  3DU5 A;  2Z3Y A;  2L7Z A;  2Z16 A;  2X1C A;  1V5E A;  1K7A A;  1L3L A;  3C2H A;  4XL9 A;  2IT0 A;  5HLG A;  1GXQ A;  3C7J A;  1T95 A;  2FOW A;  2MGQ A;  2VJ4 A;  1T39 A;  2V1N A;  3DKW A;  2O7O A;  3UNG C;  4AWX B;  4HSR A;  1YI2 I;  1HST A;  3WE3 A;  3OYL A;  2L0K A;  4CGZ A;  3HHH A;  1AOY A;  3BR3 A;  4ZJZ A;  2BY1 A;  3HZJ A;  2OA4 A;  2DYS H;  3TP3 A;  3B6C A;  3FXR A;  4Y3O A;  4HQM A;  3G1L A;  4AYB N;  4ITV A;  1KZH A;  3FBI B;  2IRF G;  2G9W A;  4I7H A;  2MG4 A;  1PUE E;  3AG4 H;  3ZCO A;  1SFO J;  5C4J J;  1U3E M;  1BI3 A;  3L2Q A;  4E4H A;  3FXK A;  3KP7 A;  3NRV A;  2XKO A;  2A6T A;  3FMR A;  1BI0 A;  3KFW X;  5ILV A;  4TV7 A;  3WTY C;  3VB2 A;  3S1M J;  4LIU A;  3PNY A;  2NVX J;  3F21 A;  4MQ9 F;  5J40 A;  1MBG A;  4I6Z A;  3F8N A;  4KUM A;  4S04 A;  1VQ6 I;  3VFZ A;  4BY7 J;  5CYV A;  4E7Z A;  3LA7 A;  5EG0 B;  1DDN A;  5M3F J;  2VE8 A;  3RYR A;  3RQI A;  4EV0 A;  2JWT A;  1JXS A;  3BOQ A;  3K70 C;  3VOE A;  3KLN A;  2O8X A;  1YIJ I;  1EKE A;  4JQF A;  4IQJ A;  1WJC A;  2EIN H;  5D6F A;  2W48 A;  1RC9 A;  4FE4 A;  4LK0 F;  2MBF A;  3MN2 A;  4AYB A;  3WE2 A;  1QQI A;  3B02 A;  5K7H A;  4O3M A;  1R4N B;  3F8F A;  2HVR A;  1SAN A;  3MZY A;  4MHG A;  1RR8 C;  4IL6 C;  3EUH C;  3BTJ A;  3QOD A;  1HW1 A;  3HUG B;  1TWH J;  3GFM A;  3K1M A;  4ENN A;  4YFX F;  2KT0 A;  2P4W A;  1OR7 A;  2JMW A;  3T8T A;  1WJB A;  3EYY A;  3TO9 A;  4CCO A;  2LMD A;  5B1A H;  4G7Z F;  1TL8 A;  4UUT A;  2Z9O A;  2UUZ A;  2KRH A;  1HQC A;  3CJT B;  2Q0O A;  3DLA A;  1IZ1 A;  2Y69 H;  4GGG A;  4LJZ F;  3GFI A;  3ECO A;  2V9V A;  4D0P A;  4PGG A;  2ESH A;  5F04 A;  3CD6 I;  3I53 A;  5KCM A;  2WAF A;  2XKP A;  3QYE A;  2COM A;  3KYL A;  3H0G J;  1GVD A;  2LDU A;  5CPR B;  5LHH A;  3RPU D;  2R7F A;  2L5Q A;  1DPU A;  4L9V A;  1Y8Q B;  5K5O A;  2L02 A;  3BC8 A;  5F0F A;  4BDZ A;  3IAS 2;  4FET A;  4BHB A;  5AIP A;  4XSX F;  4YRV A;  1Z91 A;  1LE8 B;  1VQ8 I;  5LHG A;  2OC6 A;  4A3I J;  1HC8 A;  2GIV A;  3QP5 A;  1F43 A;  2DPD A;  2LTP A;  3GLX A;  3ABM H;  2NOJ B;  5FB2 A;  4HX8 A;  3QPH A;  1R9T J;  1X3U A;  3HL2 A;  1GT0 C;  4G6T B;  3GTO J;  3PFY A;  3DTK A;  1D3Y A;  3GTP J;  2A68 F;  4UVA A;  3ZXS A;  5B3S H;  1FIP A;  1DPR A;  4N4N B;  3QPL A;  3K2A A;  2MLG A;  4F93 B;  1RRJ A;  2X6O A;  3OYA A;  2DMT A;  2PN6 A;  2WAQ N;  2XRL A;  1SD7 A;  2N8G A;  2Y48 A;  4BQN A;  5DCM B;  4HV5 A;  4FAS D;  2KL4 A;  3ABL H;  4QWQ A;  4KIG A;  1JJ6 C;  2H8R A;  2BY0 A;  2HVQ A;  1V54 H;  3R0J A;  3AG1 H;  3U2R A;  3QRF F;  3OS1 A;  2FML A;  1WI9 A;  1DP7 P;  4BL0 B;  2HR3 A;  2AXT C;  3FZV A;  2BEO A;  2LY2 A;  3ISP A;  4B47 A;  1T2K A;  2DT6 A;  4M6Y A;  2V4J C;  4LMY A;  5IYC J;  2I10 A;  2BVL A;  5IT3 A;  2W25 A;  1VF9 A;  2JRT A;  2KDZ A;  1FOX A;  2DLL A;  4CDG A;  2ELK A;  1FMW A;  3ELK A;  2CRG A;  5CJ9 A;  2R3S A;  1FY7 A;  3BQY A;  4UB6 C;  1MND A;  3CCR I;  1DU6 A;  3CF5 F;  3WHC A;  3LSR A;  3RKQ A;  1R23 A;  3HTS B;  1ETK A;  1SAX A;  4BS9 A;  5B1B H;  2L2O A;  3HEF A;  2VE9 A;  1Z1D A;  5H20 A;  1LDD A;  2QSG X;  2XGD A;  2STW A;  1SVL A;  3TDZ C;  4BE0 A;  5JLX A;  3MQ0 A;  2O8K A;  1D1A A;  1J0R A;  3ZQI A;  4DJA A;  1HCR A;  4A6E A;  2O5R A;  4IHS A;  1AA7 A;  4M3B A;  4UV9 A;  3DBL B;  4UUS B;  4YFN F;  1D8K A;  2YX7 A;  2D5V A;  1YW8 A;  1F1Z A;  1RR7 A;  2ELJ A;  3CLO A;  3FDY A;  3LSG A;  2KZG A;  2H27 A;  4L0Z B;  2L7K A;  1ACI A;  1D1C A;  3GME A;  2EB7 A;  5E1Z B;  1UZC A;  4S0H B;  4BJT A;  4B1R A;  2GAU A;  3F0C A;  2K4J A;  2R7O A;  5EF6 A;  1ZG3 A;  3H36 A;  5TIS C;  5JHF A;  5H6R A;  2NRA C;  2ZXI A;  3C2B A;  4C3H J;  4OMY A;  2FA5 A;  3BZK A;  4F55 A;  4HNV A;  1IN6 A;  2DA4 A;  1Y56 A;  3BPX A;  3HOV J;  2CU7 A;  4M71 A;  3WG7 H;  2H09 A;  3ASO H;  2JA5 J;  4N9H A;  2HS5 A;  4DZJ A;  1B6A A;  2DTZ A;  2D45 A;  1PDN C;  4M74 A;  1ENH A;  2JT1 A;  1SMT A;  4ZH4 F;  5E3N A;  1MSE C;  4U0V A;  2NVY J;  3CMM A;  3CCY A;  2YR2 A;  3GFL A;  4CXF A;  2R7Z J;  3W6V A;  1TNT A;  5JR3 A;  4Q48 A;  5E20 A;  4ZZD A;  2HQR A;  4BEH A;  5HLT A;  1XCB A;  3ZN1 A;  5A2Q Z;  2W24 A;  4XLF A;  4CHU A;  1TWG J;  1E2X A;  3IL2 A;  1N78 A;  1BA5 A;  2IGM A;  2CGP A;  4HLY A;  4E70 A;  1IUY A;  1KQ8 A;  2DT7 B;  1N25 A;  4D5F A;  2K02 A;  2V6C A;  1EA3 A;  2W57 A;  4F7Z A;  3OR1 C;  1YW9 A;  2H6C A;  3S8P A;  3DEU A;  2EFQ A;  5L3B A;  1TW2 A;  4O6J A;  3M1E A;  1R71 A;  5AIQ A;  3DPL C;  3E97 A;  1OCR H;  4RS8 A;  1OYY A;  2M8E A;  4MFD A;  1QZY A;  5LGT A;  5IOY A;  4I0B A;  3GVA A;  2BYV E;  2QSH X;  3GTG J;  1IDY A;  4E7K A;  3N05 A;  1MMA A;  3I4M J;  4P5O A;  2M0M A;  5KAF C;  3MKL A;  3WU0 A;  3CCV I;  1CF7 A;  2PBI A;  1ZR4 A;  3IUO A;  1FEX A;  2COB A;  2PMU A;  3VYT B;  1LFP A;  3J80 Z;  2VC1 A;  3GXO A;  3G1M A;  2Z33 A;  2F4M B;  3HGY A;  1XS9 A;  1JHF A;  2MH2 A;  4L9N A;  1HBX G;  2VQC A;  1NTC A;  2M7A A;  4OAY A;  3M07 A;  1K61 A;  5IOZ A;  3OS2 A;  1U5T A;  2M1B A;  3QOP A;  3GF2 A;  4XK4 A;  1MDM B;  3L2V A;  4Y13 A;  1E3O C;  1YIT I;  1XGM A;  3VSK A;  5FKL A;  3NWT A;  3MKZ A;  1TQM A;  4KIF A;  3MD2 A;  3TMO A;  1VQ5 I;  1MIJ A;  2VUM J;  2HXO A;  3BR0 A;  5J1Y A;  3CCE I;  1PYV A;  5AON A;  3KZZ A;  5A2Q K;  4RB3 C;  3G2B A;  5FRO A;  3MMY B;  4I09 A;  1J2X A;  5ICG A;  2HDD A;  1UHM A;  4ABZ A;  4LFU A;  5D5V B;  2QBY B;  1FWZ A;  1G2H A;  3ONQ A;  2EPF A;  3S1N J;  4CUG A;  3I4N J;  2NXN B;  4RB2 C;  2DO7 A;  1X58 A;  1HF0 A;  3KLO A;  2XVC A;  4I76 A;  1FOK A;  4J01 A;  4FTH A;  1GUU A;  3G73 A;  3Q0V A;  4EJT A;  1S5L C;  1F9N A;  4WXC A;  3CCM I;  2QLZ A;  1T6S A;  3HTU A;  2XPV A;  4V19 K;  3VYU B;  3DTE A;  1KA8 A;  1FLI A;  2CH0 A;  1S9H A;  2WAD A;  4AM3 A;  5FO5 A;  1A35 A;  5D8L B;  1XSV A;  2ZNY A;  4G6Q A;  2JQ7 A;  4BXU A;  3X2Q H;  2GA1 A;  1IC8 A;  2IJL A;  4EEF G;  3FK7 A;  2P6T A;  2MD5 A;  3J80 K;  3SDB A;  3IWF A;  4HDU A;  2HI3 A;  4HBL A;  1BI2 A;  3TDU C;  3BZC A;  1MSF C;  1UHW A;  3D5S C;  5FLX Z;  2OQR A;  2A61 A;  2DMU A;  4JP0 A;  1MZB A;  2PG4 A;  1VQN I;  2DFE A;  1T33 A;  3BG3 A;  3JRC A;  3SJM A;  2CV1 A;  1WJD A;  3F6O A;  1R1U A;  4WCG A;  1ETV A;  2JUC A;  2TDX A;  3T5X A;  1YQA A;  3TL4 X;  4F52 A;  5HS9 A;  1GV5 A;  4IRH A;  4XRF A;  1QNT A;  2X9D A;  5IT9 K;  1TNS A;  2F2E A;  1FOY A;  2IS6 A;  3KYD B;  2YS9 A;  2OTL I;  4XRS G;  3CMA I;  1X3Z B;  3DPU A;  4ZZL A;  1U8B A;  2RGV A;  2IGO A;  2XGE A;  4GO1 A;  1GHC A;  1U6G A;  1XGN A;  2M7B A;  1JGG A;  1WJE A;  2HYJ A;  3U9G A;  1X3W B;  2Y9Y A;  3CDI A;  4KN4 X;  3EPZ A;  2QQ8 A;  4CZZ A;  4G12 A;  2ETH A;  3CTA A;  1D5Y A;  3LQR A;  3VSL A;  2CSO A;  1TT0 A;  1ZH5 A;  1HW5 A;  4HX4 A;  1Y6I A;  2DW4 A;  3K10 A;  3HUG A;  4EM0 B;  1JKP C;  5LBQ A;  2HZT A;  3I58 A;  2NYX A;  3DFG A;  1A5J A;  2RKH A;  1WFX A;  3AAF A;  3LNQ A;  2KDO A;  4YEJ A;  5HDG A;  1ZKG A;  3DXJ F;  1BJZ A;  4U7B A;  4D1Q A;  1UHS A;  1UCR A;  2HQ5 A;  2IGN A;  3KZI C;  5LLQ A;  5LFA A;  5FLX K;  1R6R A;  2W82 A;  2OCE A;  2M4G A;  2M8G X;  3H5N A;  3LSK A;  2Y0S N;  2EZI A;  3HOY J;  2NVU B;  1AKH A;  1OCZ H;  4RAZ A;  5F6F A;  4PFO A;  1WJF A;  4E7H A;  2HPM A;  3PIO F;  3FXL A;  2ECB A;  4XKC A;  5LRR A;  3E5U A;  3C1D A;  3OR2 C;  3HOU J;  2HOS A;  4PJJ A;  1LE8 A;  3HSR A;  1W0U A;  4YII A;  4A0Y A;  1D0Z A;  1X2N A;  1RKW A;  1FIA A;  3ZN0 A;  3GTQ J;  3ZQG A;  4KT6 A;  5HNF A;  4M3D A;  4RA2 A;  4CCL A;  5FKN A;  1FP1 D;  2NOG A;  3Q3S A;  5CQG A;  1ZG5 A;  1I6X A;  1OCP A;  2P0W A;  5HLI A;  2O61 A;  3HHG A;  2FBI A;  1OPC A;  1YS7 A;  2JPB A;  1B59 A;  1HXD A;  1P4W A;  2K4B A;  5DCM A;  1U9O A;  2AHQ A;  3OYD A;  2DAO A;  2K9M A;  3I64 A;  1XG1 A;  2CW7 A;  2M0C A;  3P9C A;  2Y0S A;  4IHV A;  1A04 A;  2EFO A;  1ZGW A;  4KJZ A;  4RGX A;  2QYO A;  4LD5 A;  3ZOB A;  5BPD A;  4A69 C;  1G3T A;  4P96 A;  4DW6 A;  2K27 A;  1R5G A;  3A03 A;  2JZY A;  4C30 A;  5E8G A;  3ZQL A;  3TBI A;  3DEW A;  4LIV A;  2XAU A;  4BEH B;  2OPT A;  5E3M A;  2BY3 A;  2K86 A;  5FRN A;  1RKT A;  4RM2 A;  1XDS A;  2RDP A;  2L01 A;  2ADU A;  1OFC X;  1LVK A;  1RPW A;  1G6N A;  4XKB A;  1PVE A;  1B72 B;  2DMN A;  1TZL A;  2LY1 A;  4M72 A;  3PUF A;  4GRI A;  3U1D A;  2RQQ A;  3OYI A;  1K4T A;  4KA4 A;  4HZF A;  1OMI A;  1WJ5 A;  2M9H A;  3H3U A;  4IVN A;  3BTI A;  2WV1 A;  1TLH B;  2E1N A;  3B73 A;  1ONV A;  3OYE A;  1JGS A;  2R5Y B;  5D5X B;  2EV6 A;  3L7W A;  2JSP A;  2LRE A;  1XD7 A;  3GW2 A;  4FQG A;  5IYD J;  4E7I A;  2XGC A;  1I3Q J;  1LUJ B;  3J7Z I;  1W7P D;  2LBF A;  5J6X A;  1Z3X A;  3K4K A;  1S7E A;  4A3K J;  4UY8 I;  2LY9 A;  1Z0X A;  1CF7 B;  1LVA A;  2OCC H;  1IW7 F;  4OIN F;  1P9Q C;  3ZR8 X;  4OAZ A;  4ASN A;  4BQA A;  1QZE A;  1VQ7 I;  2KP6 A;  2OF7 A;  4KDP A;  1BOA A;  1XGO A;  5TJJ A;  3M4O J;  3M8F A;  1R5H A;  4EJU A;  5DM6 F;  3GTJ J;  3HBL A;  3CDH A;  2QA4 I;  3RZD J;  1U5T B;  3LA2 A;  2EWN A;  5ILU A;  3NAU A;  2RC4 A;  3FXQ A;  2H1L A;  3MKW B;  1R36 A;  5D5U B;  1TQP A;  2DPU A;  5EZG A;  2E60 A;  3RZO J;  3M8J A;  2K7L A;  5LD2 C;  3HOZ J;  2IS2 A;  3FHN A;  1YG2 A;  3ZQQ A;  1UG2 A;  1F36 A;  2E7W A;  2L9R A;  5FKK A;  4Q47 A;  3BPV A;  3S3M A;  2H1K A;  1DQU A;  2FNP A;  5GAD J;  2XB5 A;  3AG3 H;  1T56 A;  1BIB A;  5GPA A;  2ACJ A;  1GXP A;  3VYS B;  3ZMD A;  2L9S A;  3FXO A;  4AIJ A;  3M1C A;  2ISZ A;  1IV8 A;  1LDK B;  2IPQ X;  3CLQ A;  2DYR H;  4LB6 B;  5EZH A;  4A12 A;  3K70 D;  3WGI A;  1R1T A;  1Z67 A;  2D2W A;  2XAJ A;  3RQ4 A;  5D4R A;  3FXJ A;  3HRT A;  4QLC U;  1OCC H;  1XMX A;  3DP7 A;  2H6B A;  2ZSI B;  1WPK A;  3F8M A;  2DJN A;  3C2G A;  3QWL A;  4OU0 A;  4A5M A;  1QGP A;  3CUO A;  3K7A J;  1FPQ A;  2NAZ A;  3HRM A;  4XKV A;  3KET A;  1ZRF A;  3I56 I;  1SVO A;  3ROU A;  4EMS A;  4Z6Y A;  2YPR A;  1XMK A;  1BIA A;  3SQN A;  2V26 A;  1B8I B;  3I59 A;  1ZLJ A;  2KFD A;  3W2W A;  1IXS B;  2R7W A;  2E2H J;  3PQK A;  3PIP F;  4NQW A;  3CQZ J;  4B09 A;  4IRI A;  1KGS A;  2FSW A;  1JI8 A;  1OR7 C;  1Z6T A;  5EEH A;  5IYB J;  1Q1V A;  2CWE A;  3FIW A;  1B9N A;  1BOB A;  3FBN B;  3JRB A;  2KIU A;  1E3H A;  1I5Z A;  1Z21 A;  3BDD A;  4JX6 A;  5B66 C;  1O3T A;  1LKX A;  4HRI A;  2MC4 A;  4IXA A;  1IRF A;  3QU3 A;  3CCJ I;  2GQQ A;  3FIS A;  1BL0 A;  1UG0 A;  3H92 A;  3CF2 A;  4XLC A;  1MDM A;  4LLN A;  4HV6 A;  2UWM A;  4LB5 A;  3KYC B;  2K40 A;  1R4M B;  3QYB A;  2L3D A;  3ULQ B;  3ECH A;  4XID A;  2W00 A;  4MQV A;  1MBH A;  2YX4 A;  1X1B A;  3LAP A;  2LVS A;  1Y1W J;  3WG9 A;  3GZN B;  1QHH D;  5JFR A;  1KQ9 A;  2YU3 A;  3ZQC A;  1BC8 C;  4FE7 A;  2X6Y A;  3KP3 A;  3SZT A;  2EZL A;  3HXL A;  2B9S A;  1C0W A;  4L0Y B;  2DA7 A;  2L7F P;  5LEK A;  1ZLK A;  1P7I A;  2QBY A;  2EBI A;  2PFB A;  4H4K C;  2V6E A;  4RM3 A;  5B5E C;  3GLL A;  2X6W A;  3ZMZ A;  2P6S A;  5JI6 A;  4RB1 A;  2K85 A;  4MIM A;  3PNT A;  2FX0 A;  2BVM A;  2Q2E A;  1MKM A;  2RRE A;  2QKM B;  5L3C A;  4A0Z A;  1ETQ A;  5L3G A;  4FCY A;  3CCL I;  4KMF A;  2JVH A;  3ERM A;  1U0J A;  1BJA A;  3K2Z A;  3CZ6 A;  4MFE A;  1LPQ A;  4BJ6 C;  2R7S A;  4IOA F;  4RAG A;  2IP2 A;  3DKX A;  2VI6 A;  3PO2 J;  2JK3 A;  3HJE A;  4UVC A;  4BE1 A;  3BR1 A;  1ON1 A;  2AS5 F;  3CC2 I;  5HVQ C;  2VN2 A;  2DMP A;  1IG7 A;  2IW5 A;  5FKM A;  3OV8 A;  1WWX A;  3A4C A;  1I6H J;  4IJA A;  4AC0 A;  2JSC A;  2LH9 A;  4B8X A;  1J09 A;  1AKH B;  3V8J A;  1R1V A;  2DQL A;  2WC2 A;  3QPT A;  5EEG A;  4PSW A;  2A05 A;  2VKV A;  2CG4 A;  2XB0 X;  4AID A;  2CQK A;  1ETO A;  3FKJ A;  1YTY A;  3L00 A;  5FGM A;  5JHU A;  5GAH J;  4EJV A;  4OIO F;  4CZC A;  2OZ6 A;  3FM3 A;  2KPM A;  2DK8 A;  1FP2 A;  4ENM A;  5L3E A;  4HAM A;  3DTI A;  2WBM A;  2CS3 A;  2QEX I;  4L9T A;  3AG2 H;  2OAZ A;  2Z2S B;  3SDG A;  2J5P A;  2CMP A;  4XRS A;  1LEB A;  2ZB9 A;  1SAU A;  3UKG A;  4M9Z A;  2IBD A;  1U2W A;  4B43 A;  1H0M A;  2H8W A;  3BTL A;  2K9S A;  2EIJ H;  4BAC A;  5DEQ A;  3F22 A;  5DD4 A;  3D1N I;  3I55 I;  3OL4 A;  1D5V A;  4IX7 A;  2E36 A;  2R7X A;  4EVI A;  3E6M A;  1X1D A;  1OIS A;  4NNJ A;  3O3K A;  3BWG A;  2O03 A;  3P9K A;  4EM1 A;  1FTZ A;  3JRI A;  4DQ2 A;  2F5C A;  3F23 A;  4II3 A;  1ZRC A;  2P7V B;  1K6O A;  3S93 A;  2QM3 A;  2L4A A;  4J00 A;  2NVT J;  4BGD A;  3M9A A;  4AU7 A;  1TWF J;  2CO5 A;  1ETX A;  2LF8 A;  2QQA A;  1MBF A;  1WRJ A;  2ZNZ A;  4E7S A;  4QPO A;  5DUK A;  1IUF A;  2IS4 A;  2ZJP F;  2VJ5 A;  3LSP A;  3JRG A;  3F8C A;  2OD5 A;  3S17 J;  5IP9 J;  2LOO A;  2K3F A;  1YJW I;  4FX4 A;  1WJA A;  2M30 A;  3VWB A;  4IHW A;  2OBP A;  3KEQ A;  5JVT A;  2WAQ A;  3T8R A;  1FYM A;  4AIK A;  3F72 A;  5J3L A;  1BI1 A;  3VPR A;  4ESJ A;  3TP0 A;  3LOC A;  4M73 A;  2EZK A;  2KKO A;  3K4M A;  2LBF B;  1KYZ A;  5E17 F;  4MEY F;  1WGX A;  2CFX A;  3RPQ A;  4PGH A;  4PUS A;  2R93 J;  1NK3 P;  2GA2 A;  3KZY A;  3S15 J;  3R6S A;  3BZ6 A;  2CQ7 A;  2DA2 A;  1QZZ A;  3J7A Y;  2MA3 A;  5GAE J;  4RGR A;  4XM3 A;  1RES A;  1FNN A;  1W1W E;  3O2P E;  4XKW A;  1FZP B;  3HSE A;  3TO7 A;  3CDL A;  4OMZ A;  1G3S A;  2E1C A;  3EUK L;  1W36 D;  3DF8 A;  1WI3 A;  5DD8 A;  4ZYG A;  4IPA A;  2AQE A;  4HST A;  2ZXJ A;  4EAT A;  3MZH A;  2V1U A;  1EH7 A;  1V3F A;  5IP7 J;  3NAR A;  2G0E A;  4DYR A;  3TW6 A;  1X1C A;  1B4A A;  2UXX A;  5KHD A;  5JLW A;  2BW3 A;  3WOD F;  3JRH A;  3CO7 C;  1MMN A;  3MVP A;  5F1R A;  1U5T C;  4OIR F;  2XPW A;  3CP2 A;  1LFB A;  3HDD A;  1YHQ I;  1SC7 A;  2JA7 J;  3F3X A;  2ISY A;  2DFH A;  3GEZ A;  2X51 A;  3OYH A;  3K4J A;  5DS9 A;  1NH3 A;  2V9P A;  1YJ9 I;  2A5W A;  2HOA A;  4GCV A;  3RI4 A;  3P5J A;  5K5R A;  3AL0 B;  3KEO A;  2ZJ2 A;  1ETY A;  3S1R J;  3RPU A;  3FHZ A;  3R4K A;  1B72 A;  1XX5 A;  1MH4 A;  3R0A A;  2JVG A;  4LOC A;  1PJR A;  1JKR C;  3OYB A;  1H89 C;  1T0F A;  3IH2 A;  3LL7 A;  1N77 A;  4C3J J;  3OWT A;  2DCE A;  1IV6 A;  2HEO A;  4Y17 A;  2R5Y A;  2EFP A;  2KLO A;  1MW7 A;  2Q1Z B;  3N4M A;  3BJA A;  3QP6 A;  3VEP A;  3JAM Z;  2I8D A;  3LQQ A;  3CJN A;  2K5C A;  3I59 B;  3KP6 A;  5E1W A;  3K9T A;  3TW7 A;  2PLY A;  1G4D A;  3OIP A;  3CCU I;  2Y9Z A;  3OS0 A;  4NQW B;  2PMZ N;  1Y0N A;  3K1P A;  1O7L A;  2VKD A;  3GCM A;  4HNT A;  4JYK A;  1J5Y A;  3QQA A;  1W36 C;  2EIK H;  2ZFU A;  2ZJQ F;  1P92 A;  1TTY A;  3DU6 A;  2NNN A;  1ZGJ A;  3CJQ B;  1VQP I;  2W7N A;  3T1B A;  3CUQ B;  3KCC A;  3SYT A;  2WTE A;  1USS A;  4II2 A;  3J7Y J;  3FWE A;  3CMY A;  2XAS A;  4DBQ A;  4R79 A;  1YYV A;  3DV8 A;  4CSW A;  3CC4 I;  5DM7 F;  5F64 A;  3G71 I;  4ZYA A;  4RBO A;  4H0E A;  4M3E A;  2WY7 Q;  2KMU A;  3Q9S A;  3OYF A;  2NNY A;  2HU9 A;  4UXN A;  3GO5 A;  3OIQ A;  2CQX A;  5IT9 Z;  2ESN A;  3GZ5 A;  3GZ6 A;  3M8E A;  1JUS A;  3GBG A;  1WCM J;  1B9M A;  1H9T A;  2P7C B;  3Q9V A;  1JKO C;  3ZMU A;  4I01 A;  1YLF A;  2X1E A;  4ZTJ A;  2PMZ A;  3E7L A;  2EK5 A;  3HIF A;  2Q2E B;  3OIO A;  2MC3 A;  1BR2 A;  5FKO A;  2EQR A;  2AO9 A;  4BU2 A;  1FBS A;  1HKQ A;  4EGZ A;  4FHT A;  3JAM K;  3VYR B;  2ZME B;  3JRA A;  3HC7 A;  4UUV A;  2IA1 A;  3NQO A;  2FRH A;  5HS8 A;  2B0L A;  2YSR A;  2HNH A;  3LFU A;  1LJ9 A;  1ZN2 A;  3GTM J;  3BR2 A;  4WF2 A;  4BBR J;  5HOD A;  1VQM I;  3LMM A;  2DOF A;  2M34 A;  1B8I A;  2OUM A;  2UXN A;  1QVT A;  1LEA A;  3VDX A;  3TED A;  1SVM A;  3M7G A;  4ENK A;  4BDY A;  1NG7 A;  1XC5 A;  4PJ0 C;  2DOD A;  2P5L C;  1FYK A;  4YIR X;  1SFE A;  3L2R A;  1DP3 A;  4RDU A;  5H6Q A;  2IS1 A;  3I54 A;  1FC3 A;  2FMY A;  3PSI A;  1IJW C;  2Z1D A;  4ZDL A;  4BKX A;  1WH5 A;  5IY5 H;  5BOX A;  3EET A;  1P2F A;  3S14 J;  3F8B A;  2HZD A;  2HQN A;  2J5O A;  4A3G J;  4Y15 A;  4U0Y A;  5J8C A;  4FIS A;  1WHU A;  2C6Y A;  1Y0U A;  1VFC A;  2TRT A;  1BW6 A;  2DA6 A;  3HOT A;  1KU7 A;  2QQ9 A;  3WTT C;  4D7M A;  3K4C A;  4HOB A;  4UNO A;  3L2U A;  1ULY A;  1I50 J;  5FD5 A;  3G6E I;  3KX2 A;  4HLX A;  4A3E J;  3BCB A;  1A6I A;  3KP4 A;  4YG2 F;  5CLS A;  1Z77 A;  4RLF A;  3K6G A;  3ZMS A;  2PEX A;  4JBA A;  3OOU A;  3IRR A;  2Z99 A;  3SEZ A;  2YUS A;  4DIQ A;  4XLP F;  1MJB A;  1UJ8 A;  2K9L A;  2QF7 A;  2XUB A;  1RI7 A;  3WTW C;  4WXD A;  4F92 B;  5EDN A;  2WWY A;  1SD4 A;  1YO5 C;  5E18 F;  3L9F A;  3BRO A;  4IEJ A;  1OQY A;  4BNC A;  1MBJ A;  3OYJ A;  5L3F A;  1MBK A;  3V7R A;  1Z7L A;  2KRF A;  3COA C;  1APL C;  4K2E A;  4V2G A;  4F91 B;  4LK1 F;  2BZT A;  1Z6R A;  1ODD A;  2M3A A;  2ME6 A;  1JE8 A;  1FYL A;  1EH6 A;  3WGH A;  2VPR A;  1YE9 A;  2HYF A;  5CQE A;  5K5Q A;  5CVU A;  3B6A A;  1I39 A;  1RNL A;  2OZU A;  4G7O F;  2E35 A;  4XON A;  5ICC A;  3HM5 A;  4D5C A;  5DTD A;  4P9F A;  5EEA A;  4DNC A;  3E6B A;  3L2W A;  1RET A;  4UHT A;  2QQB A;  2LLK A;  3OY9 A;  1UEL B;  2DTR A;  1G3W A;  4P55 A;  5HNH A;  1QPM A;  2WA0 A;  4BHP A;  4JX4 A;  2VKE A;  1OYW A;  1X19 A;  2UV1 A;  3LA3 A;  1WVR A;  2Z5U A;  4EGY A;  3ZRG A;  4BXF A;  1O4X A;  1AHD P;  2X6X A;  2FNA A;  5FFX A;  2KIS A;  1IN4 A;  4NC6 A;  4XBF A;  2HQA A;  2DQR A;  2V7F A;  3CES A;  3IH3 A;  4MGR A;  1AU7 A;  2PX9 A;  4NUB A;  1X1A A;  3FX3 A;  5FJ8 J;  1SD6 A;  3A01 A;  2A07 F;  4AVP A;  3U1K A;  5LRS A;  2CW0 F;  4MNU A;  1MD0 A;  3S3N A;  2ZC2 A;  4LG3 A;  2L54 A;  1E17 A;  2W84 A;  1TT5 B;  2K3P A;  4EM2 A;  3ZQF A;  3BJO A;  2CUF A;  3E5X A;  2XRO A;  4XSZ F;  3P9I A;  1VQ4 I;  3PJR A;  3HRS A;  2FF4 A;  4XN3 A;  2PJR A;  4OIP F;  3N97 A;  5LGU A;  1S6L A;  3ASN H;  2VL8 A;  4E6K G;  4GFB A;  2BW3 B;  3HOX J;  2NS7 A;  3O8H A;  5BQT A;  2EA2 A;  3LSM A;  2B7E A;  4NHJ A;  4KIB A;  3HOW J;  3HG9 A;  2DA3 A;  2Y30 A;  4XLE A;  4HX7 A;  2FOK A;  2MLK A;  1ZQ3 P;  2XF7 A;  2Y31 A;  2ID3 A;  1TW3 A;  1FT9 A;  3W2A A;  1BR4 A;  1Z9C A;  4ESF A;  4XQF A;  3LSH A;  3H1C A;  4B44 A;  1YX3 A;  2BE5 F;  3HOS A;  3JSP A;  1U78 A;  3Q0U A;  4Y33 A;  1E3P A;  5GP9 A;  1S3J A;  3ZMV A;  5J8F A;  4I2O A;  2XV4 S;  3HSF A;  3AFH A;  4KIT B;  2VXZ A;  4A6D A;  2ZBK A;  1Z3Y A;  5ICE A;  3AL0 C;  2IEK A;  3DEE A;  4L5E A;  1IN5 A;  2VQL A;  1TWC J;  2IA2 A;  4UB8 C;  1JT0 A;  1VQO I;  2E2I J;  1WSU A;  5EGO A;  3HPH A;  4KMU X;  4KNY A;  1W5S A;  1YRN B;  2JTV A;  3PFI A;  1S72 I;  1DU0 A;  3K4N A;  1UFM A;  1A6Q A;  2HWV A;  1HA8 A;  2X4H A;  2E5N A;  2MFZ A;  4J19 A;  2LP0 A;  5HDK A;  3TOA A;  1IXR C;  1JUP A;  2HYG D;  2M2E A;  2XAQ A;  2OJE D;  2E1M B;  3WTV C;  3SFZ A;  3CME I;  3OYK A;  3CCS I;  1QA6 A;  4M9X A;  2BY2 A;  3F9K A;  1MNM C;  1O3S A;  4CCK A;  2QWW A;  3PNV A;  1MMD A;  1ZAO A;  4M3G A;  1CQT A;  4NC8 A;  3I0T A;  2CFO A;  4X1E A;  1MJA A;  5E3O A;  1H8A C;  3GFJ A;  1SFX A;  3RYP A;  2VBX A;  4HQE A;  1AWC A;  5J4V A;  2WY8 Q;  3LWF A;  3WTX C;  4D9J A;  1POG A;  2IVM A;  1FBU A;  1K83 J;  3WU1 B;  2TCT A;  2JA2 A;  3BG5 A;  2O0Y A;  1WQ2 A;  3CUQ C;  4L5J A;  3K1N A;  4RLQ A;  1NK2 P;  3WGG A;  1VTN C;  4KYW A;  4JK1 X;  2MD0 A;  2O6G E;  1X4O A;  2A3S A;  1XB4 A;  4ZDP A;  2QZ8 A;  1STZ A;  5EYR A;  1MMG A;  4B3A A;  2H94 A;  5E1X A;  3S2W A;  1V4R A;  2ZJR F;  1T98 A;  3V8K A;  2ZXW H;  3DWL E;  1N75 A;  4WXH A;  4XN0 A;  3SEQ A;  2VKH A;  2CJJ A;  4OWR B;  2RN7 A;  1DGW Y;  4HG2 A;  4AIH A;  2X85 A;  2EFW A;  2P5V A; 
#chains in the Genus database with same CATH homology
 2DYS H;  3X2Q H;  1V54 H;  3AG3 H;  3AG1 H;  3ASN H;  3ABM H;  1OCR H;  5B1B H;  1OCZ H;  2DYR H;  2EIM H;  1OCO H;  3AG2 H;  5B3S H;  3AG4 H;  1OCC H;  2ZXW H;  2EIJ H;  1V55 H;  5B1A H;  2EIK H;  2EIN H;  2EIL H;  3ABL H;  3WG7 H;  2OCC H;  3ABK H;  3ASO H;  2Y69 H;  5IY5 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...