1OCRH

Bovine heart cytochrome c oxidase in the fully reduced state
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
79
structure length
79
Chain Sequence
b'KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C OXIDASE
publication title Redox-coupled crystal structural changes in bovine heart cytochrome c oxidase.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 25
structure length 79
sequence length 79
chains with identical sequence U
ec nomenclature
pdb deposition date 1998-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 1ocrH00
3AG3H 3ABLH 3ASNH 3WG7H 1V54H 3ABMH 3AG1H 5B1BH 2Y69H 5B1AH 2ZXWH 5B3SH 3ASOH 3X2QH 1OCCH 3AG4H 1OCOH 2DYSH 3ABKH 2EIMH 2EILH 2EINH 1OCRH 1OCZH 1V55H 2OCCH 2EIJH 3AG2H 2DYRH 5IY5H 2EIKH
chains in the Genus database with same CATH superfamily
3O3KA 4RLFA 4LLLA 1U6GA 4HQEA 2X85A 3SZGA 2I10A 2LY1A 1PUFA 1IRFA 1KQ9A 3BG3A 3ZQIA 2EFOA 3A02A 3E3VA 3MVPA 3F72A 4NC8A 1FOYA 3O2PE 1J0RA 2R93J 1S29A 2IA0A 5HNFA 5K5RA 2XRNA 4IQ4A 3T1BA 1QO0D 5HDKA 2DT6A 1TW2A 2E60A 3ELKA 2LMDA 4UUSB 1YLFA 3KEYA 3MEXA 3OYLA 3CJQB 3RI4A 4HSTA 3OWTA 1XCVA 2QA4I 2BXZA 3WGGA 1YW7A 4ANJA 2E1MC 3HHGA 1UELB 4HQMA 4EQQA 2XGCA 3EYYA 1XGOA 2DO7A 1VI0A 2EA2A 4B48A 3VSKA 2RKHA 3G1OA 1D8KA 1X58A 2HFHA 2CV0A 3S1MJ 2MH9A 4LOCA 3HOSA 1VQMI 2O8XA 3EUAA 1BC8C 5E8GA 1V5GA 1S5LC 5LGNA 1P2FA 2KRFA 3F8MA 1BI2A 4GFBA 3CJNA 1USTA 3K2ZA 2VJJA 2W82A 3I55I 1YJ9I 3F8NA 4DOZA 3HKZN 5LFAA 2HQ5A 1X19A 4IHXA 2Y9ZA 3HUGB 2W25A 1YO5C 3K7AJ 1D0YA 2LREA 2K3PA 3F6VA 2AS5F 1JUPA 3Q0WA 2YU9J 1PDNC 4L9NA 2Y0SA 4KT5C 1ZQ3P 2O8KA 1LJ9A 2XRLA 3CDHA 3H3VK 4A93J 4Q48A 3I54A 3IAS2 2ZFWA 4UVBA 4BXUA 2JUGA 1G3WA 4CZZA 4DBQA 1MBJA 1POGA 1Z77A 3W3CA 1Z3YA 1OCCH 2PI0A 1J2XA 3EUHC 1JGGA 5E20A 1TQIA 4HLYA 5KVRA 3I5UA 4F7ZA 4NDLA 4YFXF 2R7WA 3H3ZA 1EF4A 1BR2A 3MQ0A 1GLNA 4M73A 4IHWA 1UZCA 2YU3A 4BQNA 4QSHA 1IDYA 4FISA 4LG3A 1A35A 2VOOA 5E3OA 2HVRA 4KYWA 1QGPA 1FWZA 1JXSA 3WTYC 1T0FA 3IRRA 5KHDA 1YFHA 3LNQA 3VYTB 3EQLF 3IWZA 1YRNB 3PUFA 4S04A 5IYDJ 3TW6A 3DU6A 3LA7A 1U3EM 2JK3A 2LY2A 2OBPA 3C18A 3E6BA 3J81K 3CMAI 3T8RA 2NS0A 2M34A 3TO7A 3VOEA 3LSPA 2Z9OA 2XV4S 3GFJA 4ZZDA 1MBEA 1SMTA 2EFQA 1W7PA 3HRSA 2KIQA 2HU9A 2DYRH 4JQFA 2CUEA 3VYUB 4CCOA 2D45A 3CC2I 4C2TA 1K78B 1H9GA 2P6SA 3MN2A 1AU7A 2Z16A 2IVMA 2XAFA 5DD4A 3BCAA 3HGYA 1YIOA 4B47A 3L2VA 4N9HA 3E1SA 4ZDLA 2HPMA 1B8IB 2IS2A 5B3SH 4RB1A 3OIOA 4E6KG 1WJDA 2HOSA 4OMZA 4UUSA 1WJ5A 4BDZA 3OYCA 4BY1J 4L0YB 1TT5B 4RMNA 1ETYA 4ESBA 3S3NA 1T6SA 1GT0C 1ORKA 2NS8A 2H1KA 1IO2A 3QPTA 3K4JA 4L5EA 2IA2A 3M8EA 5DUIA 5CQEA 4XOTA 3VYSB 1X1AA 2R7TA 1A04A 1QZZA 2Q0OA 4E7KA 5DCMA 2CUJA 1S72I 1MD0A 2IS4A 1FIPA 1YI2I 3A03A 2O5RA 4HF2A 2O9LA 1TP4A 3HXLA 1LNWA 2DLLA 4M72A 1OCRH 2CJJA 5F1JA 1JT6A 1KU9A 2HEOA 3BJOA 3D5SC 2V1NA 3ZN0A 5BPDA 5F0HA 5IP7J 1FSHA 2IGOA 3TP0A 3ZQHA 4QIWN 2H6CA 1SFEA 1OFCX 2GLOA 4BDYA 3ZMVA 1TNSA 2L9RA 1KONA 2OU2A 3HUGA 5HDGA 2EZKA 3GFLA 3IWFA 3A4CA 4XQFA 2OC6A 3CTAA 5LD2C 1RUNA 1OCOH 1VQ7I 3JRAA 3DLLF 2VBWA 3LSTA 5E8IA 1BC7C 4BE2A 1BIBA 1IV8A 1D3YA 1R4NB 2P5VA 4CUGA 1MH3A 2EZLA 4HF0A 3K2AA 2HZTA 3I53A 3B02A 1X2MA 3O8HA 5IY5H 3ECOA 2CW8A 4LLGF 3LL7A 3IKVA 1EKEA 3OYBA 2RVCA 4PJ0C 3S17J 2DA3A 2K9NA 4U87A 5AIPA 4BYYA 5BOXA 3GO5A 2E7XA 2ETHA 2W4SA 4ZYAA 3ZQFA 2O61A 1D5YA 1UHMA 2VN2A 4NQWB 1MMGA 1LEBA 3L00A 1XG1A 4BH9A 2OTJI 4U0VA 2X6YA 5GADJ 1Q1VA 1LUJB 4D1QA 4A3DJ 1P4AA 2O6GE 2VPRA 3WTUC 1YTYA 1RKWA 2YR2A 2PMHA 2EIKH 2P7CB 1UHSA 5F6FA 2BW3B 5IYCJ 2F48A 4KIBA 3GTGJ 5E1XA 4C9YA 2LNBA 3MKWB 2MGQA 3CO6C 4H0EA 1XSDA 1TTYA 1YRNA 2BY0A 1T08B 1I5ZA 3AG4H 3PIOF 1B59A 3CP2A 3JTHA 3U2RA 5J47A 4RLQA 3CCEI 2VT3A 5M3FJ 2HWVA 2K27A 1JHFA 1G3TA 1I27A 3I71A 1SEUA 2BVLA 1FTZA 4OAYA 2FD5A 2VXZA 3C2BA 4M3EA 3OYEA 4PZJA 3Q3SA 2BXYA 5B66C 1P6RA 1E3OC 5BMZA 5TJJA 3N4MA 5ICCA 5EJCA 1I6XA 1LFBA 2HOAA 2VC1A 2EFPA 3SFIA 1W5TA 2OV7A 1TW3A 1B8IA 3DPTA 2KQRA 3ZN1A 5B5EC 4G7ZF 4F55A 2V6EA 2ESHA 4A3BJ 1MNDA 2HQAA 2VJ5A 2DU9A 4BACA 1YE9A 1MZBA 1H88C 4MEXF 3PO2J 4HOBA 3G1LA 2QQ8A 1N25A 2QZ8A 3V7CA 2P7VB 4HDVA 1B1BA 3L9FA 4PCQA 4N4OB 2R0QC 3L1PA 4AM3A 5HS7A 2HR3A 4A0YA 1O4XA 4LLNA 1A31A 1F43A 2QKMB 4QLCU 1V4RA 2X0LA 4UVAA 3JSPA 2XAGA 4A3JJ 1P7IA 3RPQA 1DP3A 5D8LB 3ESWB 1CGPA 2OPTA 4ZTJA 4XRSG 5JVGF 3ZMTA 1YHQI 2FF4A 4Y7NJ 4S0HB 4HV6A 2A5WA 2DK5A 2M87A 4R1HA 5IYBJ 3P9CA 4M3GA 4WX9A 1LFUP 3VB2A 2X4HA 4A69C 3I56I 1HKSA 3MKZA 2DK8A 3DKXA 3C7JA 1RESA 1KZHA 4BJ6C 3NQOA 2WAEA 1O7FA 2H8WA 2LBFB 4DZPA 2PFBA 3BPXA 3V7SA 2OJED 2W1OA 1UHWA 2EWNA 4MQVA 2CH0A 1MIJA 2JA5J 1BOAA 1LKXA 4A3CJ 1LEAA 2LC2A 3FIWA 4W97A 1JKQC 3ZCOA 4GCVA 3FM5A 2QM3A 3CJRB 4L9VA 3R6SA 3OYHA 3OY9A 9ANTA 3GFMA 1FPQA 3CCVI 5HLTA 4FX0A 4OINF 3HKZA 3MWMA 1LDJA 1QVTA 1SMYF 2ISYA 2WBMA 3G1MA 3GZNB 4BHPA 1DP7P 4FQGA 4C2MJ 3J7AO 4UUTA 2E1OA 3DBLB 1Z7LA 1YOVB 3E5XA 1MJ9A 2K85A 1WRJA 1U78A 4NQWA 1G8XA 2WV0A 1ZGWA 4DW6A 3W2AA 3BR1A 4P5OA 2LKSA 1SFUA 4HLXA 3QPHA 3FMRA 1KU7A 2X51A 4XRFA 2FXAA 4UVCA 3KEOA 2BW3A 3BDDA 2ZMEC 2LYCA 5H20A 5HNHA 3WTVC 4L9JA 4I7HA 2CQXA 1D1BA 4XN0A 3P7NA 3OYJA 1ODDA 2MA3A 4HPQA 2E1CA 2IBDA 2X48A 2VUMJ 3RQIA 1PYVA 1WCMJ 4FTHA 3H1CA 3S32A 2E5ZA 1Z6TA 1I1GA 1ETXA 1MMAA 4MFDA 1DGRM 2A61A 4JBAA 3DU5A 2FA5A 2ZSHB 4BXFA 3IH4A 1T8IA 3HM5A 3NAUA 4D7MA 2LTPA 2E1NA 2LFBA 3O6BB 2DOEA 2X1DA 4DYQA 4EM2A 4M6VA 2NVYJ 2R7DA 1T33A 5J40A 2PLYA 4BJTA 3KETA 4RDUA 1ETOA 2K3FA 3RKXA 4MTEA 2R7FA 4JK1X 4KITB 1PP8F 4F52A 2CU7A 3C3WA 3DBRB 1X3ZB 2IPQX 1FBQA 2M3AA 1IXCA 1XGSA 3JRFA 3E6CC 1ENHA 5FKLA 2I5UA 3CO7C 4BHBA 1I50J 1ZN2A 3TO6A 1JTYA 3AFHA 3BR2A 3F8FA 3A1YA 4MO7A 1IXRC 1ZTRA 2COBA 5DS9A 2GXGA 2A3SA 4U88A 3MAJA 2NRAC 2F2EA 2WC2A 1R22A 3HSEA 1PUFB 3L2RA 4G6DA 3K4BA 3X2QH 3OS0A 4MGRA 2KRCA 1XX5A 2LVSA 3OYDA 2BHZA 5IOYA 4Z6YA 2QWWA 4Y4RA 1NG6A 2DA4A 4IL6C 1J75A 3D0SA 4GYGA 3DF8A 4IHVA 2XB0X 3WTXC 2F5EA 2JSCA 2RGVA 2HXOA 5E18F 4M9XA 2PMUA 3CMMA 4FE7A 2LBFA 2JA7J 2XSJC 2CQ7A 2D1VA 2YX7A 2E1MB 4XBFA 3OOUA 5B1AH 4LG0B 4II3A 2V1DA 2V7FA 3F0CA 3G3ZA 4XLEA 3CESA 4CH7A 1BA5A 4X1EA 1HDDC 3PNYA 5LHIA 4IQJA 3PL8A 4D9JA 1X1CA 2R92J 5HVQC 5IPAA 4A3KJ 4CYCB 1A5JA 2FX0A 3G71I 3OYGA 2CUFA 1Z0XA 4KIFA 5E3MA 1MJBA 3KYDB 1ZRCA 4E4HA 3TKYA 2W24A 5EF6A 4QTRA 3WTTC 5JVTA 1MSFC 2FNAA 1YW9A 1OJLA 2Y69H 2Y2ZA 4L0ZB 3I3LA 3S1RJ 3CDIA 2XKOA 3HYIA 4EEFG 2LY9A 3KP7A 3BY6A 4B4CA 3QODA 4M6YA 4MHGA 4XICA 1IN4A 4HAMA 5L3GA 1UFMA 3HHHA 3NARA 3DEUA 5LBQA 3QPLA 2KPMA 1R4MB 3H5NA 2W85A 3LA2A 3BJAA 3HRTA 4PSXA 1FOKA 3EPZA 4RAGA 1ERDA 2MD0A 4A5NA 4EV0A 1J59A 5EG0B 1UG0A 2JTVA 2KMUA 2VBZA 4JX5A 3H9JA 1IGNA 1U5TA 1I3AA 2FOWA 2OQRA 2M5WA 5F1RA 2YS9A 5DM7F 3HJEA 2B63J 1YQAA 2Q2EB 4UV8A 4FETA 1K83J 2F6CA 4GO1A 4XLNF 1Q1HA 1JI8A 3OYFA 4CICA 5EEGA 2KDZA 1SFXA 1R1TA 3GTPJ 3C2GA 1HKTA 2ELKA 5ERIA 4G94A 5F08A 1PVEA 2ZC2A 3WTZA 5DD8A 3REOA 2BY1A 2OAZA 2KT0A 2V9VA 1PJRA 2WAQN 4OIQF 2M8GX 4N4NB 2DFEA 3G2BA 5LHHA 2OCEA 1GV5A 2E36A 3IUOA 5EYRA 2HTJA 1QA6A 4RB2C 2L4AA 4PDKA 2LDUA 4UNOA 1TWHJ 2OZUA 3ZP5A 1W5CC 1O3RA 3ZQQA 2HVSA 4I6ZA 2L9VA 4HDUA 1XGNA 1K4SA 3VDXA 1JE8A 2Y0MA 1QZYA 1VQOI 1BBYA 4UXNA 1EH7A 4BAYA 3CCMI 2RV8A 3CP8A 3RJPA 4C3IJ 1WFXA 3CMYA 3F23A 4G7HF 2XUBA 5F04A 4AIKA 2ME0A 1KU2A 1B72A 2NVUB 1FMVA 1XMAA 4F91B 5GTHC 4I09A 3IKTA 5E1WA 3GVAA 4F93B 3H36A 2GM4A 2F4OB 3EUKL 5CYVA 5K5OA 3WHBA 5FGMA 5D5UB 3FHNA 3HOUJ 5GPAA 3WTWC 2KHMA 4M9ZA 4LG0A 2K4BA 3BQYA 2K40A 2HYGD 2OUMA 4A3MJ 4PGHA 2DA5A 5D4RA 1T98A 4XKVA 5DCMB 1WJEA 4IRIA 2TRTA 2O7OA 1ZELA 4BNCA 4L18B 1P7JA 1HBXG 4PJJA 3F21A 3BQZA 4NC7A 5EEHA 4CYCA 4EMSA 4LFUA 4A3IJ 2H09A 3TBIA 5FRMA 1VF9A 2PMZN 3FISA 3K1PA 4IOAF 2EBIA 3GF2A 1EJ9A 2P6TA 5DDGA 2P4WA 4PUSA 5JI6A 4LMYA 5HOOA 2WB1N 1QU3A 2F5CA 3ABMH 4FASD 3FXQA 4AYBN 5JLXA 2KLOA 5IP6A 5DEQA 1WVRA 3F8CA 2E19A 3CCLI 4XLFA 3WU1B 1OR7C 4B3AA 4KT6A 2W57A 4A3EJ 4OIOF 1IXSB 4GRIA 4ZYHA 2VT2A 1WZ2A 2VQCA 2GIZA 3I58A 3CCJI 1TT0A 1S7AA 1J5YA 4P55A 2VQGA 5ICFA 1Z3XA 1Z1DA 4XRMA 2GOXB 3MZYA 3VSLA 1KQ0A 3I0TA 4QPQA 3H35A 3I59A 4M74A 5EG0A 3F22A 3FXJA 2K9MA 2GOMA 3RZDJ 1GDTA 2CYYA 1G4DA 2WY8Q 2K86A 5B1BH 3BTCA 1IRZA 1ZGJA 4IXAA 1F4KA 3FBNB 2VI6A 2Q2EA 1Z21A 4ON0A 3S1NJ 3EUHA 2K9SA 1OYYA 1E3PA 1ZK8A 4CO8A 5ED4A 4KN4X 2JSPA 2UV1A 1T39A 3BZCA 4BJ5C 1X1DA 3OS2A 2FBIA 3ULQB 3J7YJ 1HLVA 2XGDA 3E5UA 4X0GA 4HBLA 2KZGA 4XLHA 4IOCF 4TV7A 1P9QC 2BBYA 3DPLC 3WTSC 1R7JA 2DOAA 4LB6B 5E1ZB 1YS7A 2MYSA 3MFKA 4Y33A 2R5ZB 4E70A 1IJWC 3M7GA 2XAQA 4BKXA 2M0CA 1QVUA 2GAUA 3CCRI 1SVLA 4AIHA 3GCMA 5D6EA 1PP7U 1USSA 2M30A 2JN6A 3HOWJ 2D2WA 2DDBA 3DQVC 5KK1A 3U9GA 3P9IA 3IHUA 1EH8A 3HOYJ 3K1MA 3KLOA 4HF1A 3HTSB 3LSRA 2UXNA 2R7XA 1VQ5I 2FJ1A 1UJ8A 1FNNA 5FRNA 4YRVA 2WV1A 1RETA 2LH9A 4P9UA 2D1HA 2ZXHA 5J4VA 3IC7A 5J1RA 1D5VA 5GPCA 4D7NA 2GA1A 4DJAA 2BVMA 1FP2A 1KYZA 1V5FA 4LGWA 5FLXZ 3QU3A 5M5WJ 2IGNA 4E7SA 3CZ6A 4NNJA 3C2HA 2CV2A 5HLHA 1Y8QB 3OIQA 4YIFA 1FLIA 5JFRA 1D1CA 1LVAA 3RPUD 4PJNA 1WSUA 1E3HA 2RAEA 1KA8A 3RKQA 2DFFA 3FMQA 2H1LA 1TLHB 1DU6A 2DXIA 1W4MA 2JA8J 1P4WA 3SYTA 3E0JB 3FXLA 1R36A 1IRXA 3H9QA 3KP4A 1PUEE 4ZYGA 3LOCA 2E2HJ 4HZFA 5F0CA 2IS6A 3ZR8X 4A5MA 4J00A 3CC7I 2VC0A 1HDPA 1O3SA 4L5IA 5EZHA 4IO9F 1MDMB 1TWFJ 2DMUA 3FXKA 1JJ6C 2LSOA 4LIUA 4A3FJ 3GW2A 2L54A 2DQRA 3RKYA 5L3BA 2CQKA 5D8KB 3CF5F 3DTEA 5J1UA 2LP0A 1JUSA 1SC7A 1JKOC 3QYFA 4AVPA 1Z91A 3OR1C 4OAZA 4LITA 2MC3A 3GMEA 2FU4A 3V7RA 1IG7A 1VQNI 3A2KA 4XN3A 3KP6A 1ZG1A 1QBJA 4CA0A 1I6HJ 2AXTC 1H8AC 1Y0NA 3GYHX 2WAFA 4A2UA 3BR5A 4CDGA 1MSEC 4OOIA 1WH7A 2JA2A 3S93A 2JVGA 1UCRA 3H0GJ 3I9V2 2F5FA 5K7ZA 1SFKA 3IL2A 3ZMSA 1TL8A 3GLXA 5J6XA 3KLNA 4ZDPA 1K6YA 1ZGAA 2XPWA 4CZCA 3OL4A 3TOBA 3OOPA 2W7NA 3K4MA 4B1RA 2HKXA 2ZJQF 3ML6A 1HSTA 1LQ1A 3K70D 2FMLA 4A3LJ 2L7MP 3CUQC 3K6GA 1ZREA 2ZJPF 2GXBA 4BQAA 3SXYA 3K4LA 2AQFA 6PAXA 2ZO4A 3E6DA 4MNUA 5BQTA 3PO3J 2NOJB 1Z67A 2LRDA 1ETWA 4RB3C 4NBQA 1IUYA 2MW8A 3AG2H 1YJNI 2GQQA 2LF8A 3MKYB 1KGSA 3KZZA 2IA1A 2MC4A 2ZJRF 1NG7A 1TWCJ 2HI3A 4I98B 2CWEA 4XSZF 4C30A 4HNUA 1ZR2A 1U9NA 2EPFA 3EETA 2ZMEB 3DLAA 3FXOA 3WE3A 2R5ZA 5BPIA 1UB9A 2DODA 3M1CA 2ZKZA 3DFGA 4J19A 2DN0A 1R00A 4ZTFA 2M2EA 2HOTA 2QKLB 1AWCA 2OA4A 4GDFA 2BY2A 2P81A 1Y39A 1QZEA 1RIOH 3KIOA 3ZMUA 1E17A 1B6AA 3J80Z 2VKDA 1NK2P 2E34A 1R71A 3I4NJ 4XNFA 3RIRA 1WJAA 3RTRA 3FKIJ 5IP9J 4IHYA 3DP7A 1WH5A 2UXXA 2MABA 2EH3A 1ZH5A 1K79A 2WAQA 2Z5UA 3OYMA 3HOTA 3R61A 3T0YA 3A0BC 3KZIC 5K1YA 4XORA 1WJFA 2OD5A 4EM1A 3LAPA 3K70C 5CPRB 4AU7A 2VXDA 1HKQA 2KZVA 2E5NA 2HDDA 4RAFA 1BOBA 4BE0A 1QPIA 4PFOA 1SAXA 4YG2F 3PIPF 3BG9A 4XKCA 3ISPA 3V42A 4YFNF 2EFWA 3S16J 3LSMA 2KIUA 3L7WA 1UAAA 3BC8A 3N05A 4HA8A 5FB2A 4JP0A 3PSIA 3D1NI 5HS8A 2HKOA 2CQQA 3DKWA 4MIMA 2EFNA 3C1DA 3PUBA 2Z33A 1U0JA 3ZQGA 3QYEA 4E7HA 2MSYA 4Q4ZF 1J9IA 4AIDA 3GZ5A 1H9TA 1ONVA 1I3QJ 2L02A 2DW4A 1AA7A 2MD5A 1FOXA 3K1NA 1A6IA 1S7EA 5KAFC 2ACJA 2IJLA 2YUSA 1R9TJ 1IUFA 1RI7A 2DOFA 2JPBA 2QVOA 4JX4A 1ZLJA 4A12A 2CMPA 2PQ8A 1TZLA 4PFPA 4EJWA 3BG5A 1MDMA 3G73A 1ETQA 3PFYA 4XSXF 2XDVA 1UG2A 4IHTA 4CCNA 1U8BA 3GTMJ 3FX3A 1XDSA 3AG3H 1FOWA 2EK5A 1HW2A 5FKNA 2NXNB 1GUUA 3WG7H 3AL0B 4BE1A 4BXXJ 3TP3A 5HLGA 1ZKGA 5GP9A 1ULYA 4KMFA 3E97A 1U2WA 2CSOA 2UUZA 1G3SA 3BJ6A 3P9KA 4KMUX 4ESFA 1Y1VJ 4B43A 1N75A 1W1WE 4M3BA 4RGRA 5DUKA 2V6CA 2VOPA 2M4KA 3L09A 5LEJA 2PMZA 2JRTA 2VBXA 3HSRA 5J1YA 2FEZA 2WB1A 3R4KA 3IRQA 1TQMA 2ID3A 4AYBA 3R60A 4V2FA 2IW5A 1MBGA 2RNJA 4KNYA 3VEPA 1SD7A 4ITVA 3JAMZ 3ROUA 5FLXK 3GX4X 4HW0A 4NB5A 4LD5A 5FD5A 1IW7F 2C6YA 1HXDA 1DQUA 4AC0A 3K4KA 5FJ8J 1NHAA 1XSXA 2B9SA 3OV8A 2Z99A 3IH2A 1REPC 2DMQA 2HYFA 2W48A 4BL0B 2JMWA 2IAIA 4Q5SF 5CJ9A 1WJCA 4DYRA 1YIJI 1HC8A 2DMPA 2ZMEA 1GHCA 2WTEA 3F3XA 3I4MJ 2E2JJ 4XLCA 4UHTA 1U5TB 4RS8A 5K5QA 3V8KA 3R0AA 3PFIA 2ESNA 4IPAA 3DEWA 4I01A 3JSOA 4ABZA 3FZVA 4JYKA 4I2OA 3QOEA 3PM1A 4MLOA 4D0PA 3Q0UA 3SQNA 1YITI 1DU0A 3RQ4A 2IS1A 3ZXSA 3K69A 2XSDC 2FNPA 3QPSA 4KA4A 1LE8B 4OMYA 4IRGA 2H6BA 2BE5F 2VQLA 1IZ1A 2G7HA 4YFKF 2STTA 1WHUA 4XLPF 2MLGA 4E7JA 1X3WB 2BHYA 3WODF 3JRIA 1R23A 2F5DA 3V8LA 2IP2A 3SZPA 1FTTA 1RR7A 5IT9Z 1F9NA 4CSWA 5KCMA 3ABKH 3L2CA 3V4GA 3WGHA 1Y56A 2DTZA 1VQ4I 1ZRDA 2VE8A 2PBIA 3L2UA 2CFXA 4HRIA 2JQ7A 3MZHA 4G7OF 2DMNA 2J5OA 5HDNA 2DFIA 2A69F 4M9SA 2HDCA 1UMQA 5ICEA 2G7UA 4E7ZA 2JJ7A 3OMYA 3TDZC 2FBKA 3I64A 4RBOA 4BQQA 5DV5A 1QNTA 4I0BA 1Y8RB 2R7UA 2JRMA 2JWTA 2EIMH 2N8GA 2EILH 4OIRF 4BY7J 3VPRA 1B72B 3F6OA 1LVKA 3W2VA 1RR8C 3BCBA 2FSWA 3FHZA 2DA2A 1JT0A 4IRHA 3ABUA 4X6AJ 2R7RA 2OF7A 1YS6A 2XF6A 1ON2A 3G6EI 3EYIA 4DQ2A 1O3QA 2KJCA 2KKOA 5C4XJ 4F92B 2KP6A 3OSFA 1MH4A 2KJBA 2PX9A 3EDPA 2VJIA 5LRRA 2V1UA 1YX5A 2DPUA 3KZYA 3AAFA 3J80K 2E2IJ 4DYCA 2XB5A 1VQ9I 4DNCA 3FK7A 1WWXA 4RM3A 3O8GA 2M4GA 3HPGA 2K02A 3SHFA 2PN6A 2GXAA 1WJBA 1C0WA 3SDBA 4B3XA 2ZXIA 1LFPA 3M8FA 3CLOA 2ADUA 4WXHA 3BT9A 3FDYA 1TNTA 4P96A 2LG4A 3OS1A 3A01B 2L9SA 4HNTA 5HODA 3T8TA 2K4JA 3JRDA 2XAJA 2M45A 4JX6A 3W6VA 2IGKA 2RREA 2LKXA 4GGGA 4DZJA 4K2EA 1W36D 1FP1D 2P5LC 5E17F 2L7KA 2XC7A 3S1QJ 3OL3A 1IF1A 4HX7A 1STZA 1DDNA 4HX4A 4CXFA 3I59B 3R0JA 1S9HA 4DGWB 3BTJA 3U21A 1SVOA 3WE2A 1SANA 3K9TA 4B44A 3DTIA 5CKTA 1I1SA 1NH3A 3HIFA 5CVIA 5JHFA 2HTSA 4ASNA 2CRGA 1ZG3A 2BV6A 1MKMA 1T56A 3WGIA 2CUZA 2A6TA 1XPXA 1GVJA 2A68F 1W0TA 3HDDA 1XSVA 5J8FA 1LE8A 4N0BA 2GZWA 5GAGJ 5LGTA 2JA6J 2QYOA 1L0OC 2VL8A 1BI3A 1BL0A 3QOPA 3GFIA 2FQ3A 2RDPA 4YELA 1HW1A 4G12A 3TMOA 2STWA 1YJWI 3JCUC 3FWEA 3D5LA 3KYLA 1QPMA 2RNGA 2VB6A 2EV5A 4U7BA 1K61A 1YG2A 1D8JA 2F4MB 4FHTA 3DTKA 3MMYB 1Y6IA 4XONA 4OU0A 3HC7A 4HEA2 4G6QA 1W36C 2VKEA 3H9GA 3COAC 2ICWG 5DYMA 4WXDA 5BNGA 3ASNH 1RNLA 1ZAOA 2P5KA 1BW5A 2KRHA 2CGPA 2A6HF 3FXMA 3LFKA 1SD6A 4ZYDA 2QSHX 4UV9A 3JAMK 3TW7A 4EJTA 4KJZA 4KUMA 4MQ9F 1G3YA 1MGTA 3IAM2 4IX7A 1KQ8A 4IVNA 5K7FA 3GEZA 2PJPA 3BR6A 2X1EA 3BR0A 2BY3A 4AD9A 2NOGA 2OCCH 5IT3A 2EIJH 4M3FA 4MFEA 3NWTA 3KP3A 1AKHB 4KN7X 4XRSA 4RB0A 2R5YB 4XL9A 4EVIA 5EGOB 3U1KA 1OCPA 4RAYA 4P9FA 2DFHA 3BG7A 2ELJA 2DBBA 2Q8KA 1Z7UA 2LOOA 1IN6A 4R79A 2OQGA 1BW6A 2CO5A 2R4GA 2QEXI 4CCMA 2AO9A 1O7LA 2V9KA 2VODA 4HV5A 1D1AA 5F0FA 1HA8A 5FKKA 1QQIA 1FZPB 2DAOA 4FCYA 4Y52J 5M5YJ 4IZZA 1OMIA 3GTKJ 1T2KA 1B9NA 2D5VA 2MH2A 2R7QA 4XLAA 1SD5A 2DTRA 3ABLH 2LD5A 1HOMA 4S05A 3BG6A 2CW7A 1CF7A 2EV0A 3TEDA 1XD7A 3KX2A 5IT9K 2HVQA 3A01A 3LSGA 3UNGC 1APLC 3E6MA 3RZOJ 3BTLA 2Z2SB 1OR7A 3FMSA 1M1EB 3M8JA 5KAIC 3BOQA 4V2GA 3HGGA 3IP4B 3P5JA 4C3HJ 4LK0F 4WF2A 3JREA 3J7ZI 2DDAA 3KPHA 3MCZA 5D5XB 1JKPC 2PJRB 3CC4I 2EB7A 2R7SA 2H27A 3PQJA 1MBHA 4XK4A 1RZ4A 1MMSA 3H92A 4RGXA 5CVUA 1JJ8C 4RM2A 3ECHA 4U0WA 3CUQB 1YW8A 2KISA 1HQCA 3VWBA 1RKTA 4NC6A 2DI3A 4EM0B 1W7PD 4A0XA 4ENKA 4N9IA 1Z05A 3NEUA 3KP2A 1E0EA 3RYRA 2DCEA 3QP6A 2KIMA 1X4OA 2EJRA 3S8PA 2WADA 2VBYA 5ICGA 3BP8A 2JUCA 4G9YA 3ZMDA 3JTGA 4I99C 4BU2A 5EZGA 4IEJA 1FBUA 3QQAA 1FYKA 3SJMA 2XIGA 2QLZA 4ENNA 5CLSA 3HOVJ 2PG4A 2Y9YA 2HQRA 3AKZA 5L3FA 5M5XJ 1EH6A 1LDDA 2A07F 2CV1A 1H0MA 1LPQA 3IV5A 2V9PA 3PQKA 3LMMA 1Z6RA 3ZGKA 3JRHA 4IF4A 4M6XA 3VYRB 2M1BA 4ZYEA 4HYEA 3JRBA 3HPHA 4H4KC 5ILVA 3QU6A 3HZJA 1IN7A 1T0FC 2CFOA 3FBIB 5HLIA 3SFZA 2J5PA 3LSJA 4ZZLA 5CVJA 2DYSH 3OYKA 3F9KA 3M9AA 3DEEA 5JHUA 3J7AY 2NVQJ 4EGYA 2QF7A 4FT8A 1K4TA 5TISC 2XVCA 4G6TB 3OIPA 1R5ID 3HSFA 2VKHA 4Y15A 1AKHA 1B9MA 2AXLA 4CYDA 2HPIA 2R5YA 1VFCA 5EGOA 2V1XA 1R5GA 5IOZA 5ILSA 3HEFA 2F5VA 2NNYA 2VQHA 3GZ6A 1SVMA 3K0LA 3FXRA 1QRYA 4CCJA 1LDKB 4MEYF 2E71A 3TQNA 1X1BA 1OCTC 2FBHA 4IKFA 5J8CA 5BS6A 1R1VA 2HGCA 2NYXA 2QQAA 1MW7A 2KIFA 4BQOA 4EJVA 1TBXA 1TQPA 5LHGA 4F3QA 2X6XA 5TGTA 1OLTA 3PNTA 4A6EA 3Q9VA 1GXQA 1X1PA 1XB4A 4WXCA 1LB2A 3VODA 2RQPA 3FM3A 1OYIA 4RGSA 4Y13A 2IXSA 3GTQJ 4GXOA 3ZOBA 1R6RA 4R8HA 3GTJJ 2ZBKA 4YIRX 3JRGA 2IEKA 1X4PA 4A3GJ 3OSGA 1JUMA 4HNVA 4ENJA 4QPOA 3GUDA 1J7KA 2Y30A 1V55H 2EZIA 2Y31A 4J01A 2AQEA 2ECBA 4DBRA 2NNNA 3ABTA 2PJRA 2QSFX 2ZSIB 1KYWA 4IHSA 3ZQ7A 1T38A 2R7ZJ 4A0ZA 2GA2A 5D6FA 2ELHA 2E7WA 5JR3A 5CVRA 1G59A 2RN7A 3RPUA 2UZKA 1OKRA 1CQTA 2HZDA 2VE9A 3LSHA 5KNLA 1N77A 3LSKA 3CUQA 4M3DA 2XPVA 3S14J 2NS7A 2YPRA 2YSRA 2TCTA 2M7AA 3T5XA 2EZHA 5K7HA 2Y75A 2BOLA 3LA3A 5EDNA 1FMWA 3BTIA 1G6NA 5GAEJ 3FXUA 2ZFUA 4G8XA 4FE4A 2HS5A 2XGXA 2ZCWA 2M7BA 2H94A 3MD2A 4E7LA 3L2WA 3TDUC 2RQQA 3RYPA 3AG1H 1I39A 3KE2A 1HF0A 1ZRFA 3WG9A 3NRVA 3KP5A 3UKGA 4M71A 3L2QA 1TC3C 4L9TA 1JHHA 4ZDOA 1Y0UA 1WI9A 2K9QA 4HSRA 1MNMC 5GAHJ 2M0MA 5ILUA 2GIVA 2DJNA 3S2DJ 2QENA 4U0YA 4RA2A 2IRFG 5D5WB 2A05A 2DMTA 1VQ8I 1XN7A 4NHJA 5LRSA 5A2QZ 1TWGJ 4XM3A 1RC9A 1DPUA 1D0XA 4FX4A 1BIAA 1RRJA 2QUFA 4EJUA 4D5FA 1EV7A 1BN5A 2ISZA 1FYMA 3H5RA 4AIJA 1VNDA 2FQ4A 4EATA 4AVZA 4XKWA 1R49A 2ZXJA 2EINH 1GV2A 3LFUA 3OR2C 4Q47A 3DBHB 3BZ6A 1IN8A 3MZ8A 3E7LA 2LLKA 2P8TA 3HB9A 1K78A 4OIPF 2M9HA 5L3CA 1B4AA 5E79C 4XR6A 1VQKI 1OPCA 2DT7B 2R7OA 3K4NA 3H0DA 2DA7A 5FLVA 3RDIA 4CGZA 3S15J 2B0LA 1BJAA 3ASOH 4HG2A 3HRUA 4WK8F 1DGWY 3KFWX 1ZYRF 3W6KB 1VQLI 4B09A 4YIIA 2JZYA 3G4SI 1JGSA 2L7ZA 2Q1ZB 3ZQCA 1ZR4A 2P0WA 1GXPA 2GWRA 4BEHB 5DM6F 4B8XA 2XPUA 5CVVA 1HCRA 4NUBA 4ZC3A 4QWQA 1VQPI 1IAWA 4ZJZA 2GBYA 5HS9A 1W0UA 2CS3A 4PJMA 4JOMA 2HYJA 3LQQA 4O6JA 2LR8A 3FK6A 2ID6A 2JVHA 3CLQA 2A6EF 3BWGA 3ZPLA 2H8RA 2QSGX 1MMDA 4ENMA 1DUXC 3DPUA 1WPKA 3OYAA 3LSIA 1BI0A 2Z1DA 2LF7A 2VIXA 5F64A 3A0HC 4RAZA 5C44J 2ECCA 3HTUA 2K7LA 3FKJA 2FRHA 4AWXB 5H6RA 1BR1A 1F36A 2F4IA 4LIVA 2FOKA 3M3YJ 3Q9SA 1FJLA 1MJAA 2QCOA 2VLAA 2MG4A 2KFDA 4PK4A 5E3LA 1O3TA 4HX8A 3PJRA 3CCQI 4BHCA 2X6WA 5H2FC 1AOYA 1FBSA 4EJOA 5L3EA 3ZRGA 2QQBA 1XTAA 1S7OA 4GYIA 1X2NA 1L3LA 3CD6I 1OCZH 5FD6A 3Q0VA 1A36A 5M3MJ 2NVXJ 3KEQA 5L3DA 1IDZA 3M4OJ 2K5CA 2Y0SN 2O0YA 1SAUA 2UWMA 4UUVA 3HG9A 2DA6A 5AIQA 2ME6A 4PJLA 4KISA 1J09A 5LLQA 4PSWA 3LWFA 2HOEA 2ZNZA 3GXOA 4KFCA 1S3JA 2EV6A 3PSFA 2XHKA 2L7FP 2XAHA 5FKOA 3WU2C 2R7VA 2ZNYA 3CQZJ 2QBYB 2HQNA 3CF2A 1MMNA 2CG4A 1P4XA 2OTLI 3QWLA 2LK2A 4I0AA 3W6JB 4LB5A 5D4SA 4UY8I 2VONA 3S2WA 3QAHA 1F1ZA 1V5EA 2TDXA 1A6QA 1E2XA 4BBRJ 3QRFF 2A5YB 2RC4A 1NTCA 2L3DA 2OZ6A 4XKBA 2R3SA 2XROA 5F27A 3FF5A 5DCFA 3ONQA 4I02A 4C3JJ 1ETVA 1GVDA 1ZLKA 1IC8A 1XGMA 4U7DA 2WY7Q 5FO5A 2O3FA 1OQYA 3U1DA 1K7AA 2DPDA 2AHQA 3HL2A 4W1UA 1DPRA 1BR4A 1BM9A 3BR3A 2W00A 2FMYA 3OYNA 5FROA 2CW0F 3KCCA 5D5VB 2ZJ2A 2X1CA 1WQ2A 2VASA 1F5TA 3NWSA 1K6OA 2JPCA 2ZXWH 1P92A 2G0EA 1WKMA 4O5VA 3SZTA 3TOAA 4CHUA 3GBGA 3UR3C 2XGEA 3SDGA 4C2UA 1FYLA 3BZKA 1ITYA 3SEZA 5FFZA 1S6LA 2Z3YA 3E5QA 3S2HJ 1H89C 1D0ZA 4A6DA 4BEHA 5FLMJ 5FFXA 3S3MA 1WI3A 2XF5A 2L9NA 3WHCA 4Y17A 4WWCA 2DJIA 1IRGA 4O3MA 4D5CA 4WCGA 3LQRA 4XIDA 1FC3A 3CDLA 1OYWA 2EQRA 2QGUA 4CCLA 1MBKA 3D5RC 5LGUA 2VJ4A 4OWRB 2W84A 1ZHFA 3K10A 1BI1A 2LKPA 1IN5A 1XC5A 2NAZA 1O57A 4V19K 3CMEI 3B6CA 2VPLA 2FE3A 2BGCA 3ZMZA 1V3FA 1ETKA 3BROA 2MFZA 3JW4A 3RSNA 5EEAA 1XDUA 1JTXA 2X6OA 1RPWA 1XMXA 1FIAA 2BYVE 3F8BA 5CQGA 5C3EJ 3RCOA 4LJZF 3HBLA 1S8NA 4LK1F 3DCFA 2PEXA 3GTLJ 1Z9CA 5A2QK 3RKWA 1SD4A 4RGUA 5TRDA 1MBFA 1XMKA 3AL0C 3DKYA 2HDWA 3GWZA 3N97A 2QQ9A 4KIGA 2YX4A 2ZB9A 1V54H 2IGMA 4BS9A 3DV8A 2DA1A 3CCUI 3MKLA 2XAUA 5LEKA 1CF7B 5AONA 2WWYA 2KL4A 2DT5A 3GLLA 2L5QA 3TGNA 3LAJA 3K4CA 3J81Z 2HXIA 3M07A 4XMYA 4ZH4F 1ZARA 2B7EA 3VFZA 2X9DA 3H5AA 3JRCA 1ON1A 2L0KA 2XF7A 4IJAA 3JR9A 3KYCB 4XOPA 1R58A 1ACIA 4UB6C 3S3OA 1VZ0A 2HNHA 4L5JA 3QP5A 3DWLE 2M8EA 3IH3A 1NK3P 5GTIC 2E35A 3QYBA 4ETSA 2QBYA 3B6AA 4DIQA 2L2OA 2BZTA 1FX7A 1X3UA 4EGZA 1Y1WJ 3M1EA 3ZQLA 4ESJA 3OYIA 1T95A 2CQNA 3ERMA 4I76A 3HOXJ 1R1UA 3CCSI 4BGDA 3I4PA 1FSEA 1FY7A 5C4JJ 2COMA 2FUG2 4KICA 4BBSJ 1KU3A 4II2A 2IT0A 1W5SA 2DQLA 2I8DA 1VQ6I 4Z2YA 1U5TC 2MBFA 3CJTB 3PNVA 3TL4X 5DTDA 1YYVA 1U8RA 4Y3OA 1FT9A 5FKMA 2XASA 5JLWA 4MTDA 4E7IA 4CCKA 3HOZJ 3BPVA 3SEQA 1OISA 1XS9A 1BJZA 3ERED 3W2WA 1XCBA 2V79A 4AUXA 3TO9A 1HSJA 1QHGA 2NVTJ 1EA3A 3DXJF 5J4YA 1AHDP 1YX3A 5J3LA 2WA0A 3B73A 2BEOA 1MNEA 2V4JC 3H3UA 2VKVA 3V8JA 3WU0A 4UB8C 1QHHD 2V26A 1IV6A 1RUOA 3GTOJ 1ZG5A 1N78A 4PGGA 2MLKA 2EA4A 4BUPA 2K9LA 3HRMA 5E3NA 1JKRC 4P1WA 4KDPA 1R5HA 5H6QA 2L4MA 1G2HA 2O03A 1WGXA 3BLYA 1SFOJ 2XKPA 2JT1A 2G9WA 3CUOA 2L01A 1HW5A 1W7PB 1VTNC 2KDOA 1TWAJ 1U9OA 4YEJA 3Q5FA 1FEXA 2Y48A 3CCYA
chains in the Genus database with same CATH topology
3AG3H 3ABLH 3ASNH 3WG7H 1V54H 3ABMH 3AG1H 5B1BH 2Y69H 5B1AH 2ZXWH 5B3SH 3ASOH 3X2QH 1OCCH 3AG4H 1OCOH 2DYSH 3ABKH 2EIMH 2EILH 2EINH 1OCRH 1OCZH 1V55H 2OCCH 2EIJH 3AG2H 2DYRH 5IY5H 2EIKH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AG3 H;  3ABL H;  3ASN H;  3WG7 H;  1V54 H;  3ABM H;  3AG1 H;  5B1B H;  2Y69 H;  5B1A H;  2ZXW H;  5B3S H;  3ASO H;  3X2Q H;  1OCC H;  3AG4 H;  1OCO H;  2DYS H;  3ABK H;  2EIM H;  2EIL H;  2EIN H;  1OCR H;  1OCZ H;  1V55 H;  2OCC H;  2EIJ H;  3AG2 H;  2DYR H;  5IY5 H;  2EIK H; 
#chains in the Genus database with same CATH topology
 3O3K A;  4RLF A;  4LLL A;  1U6G A;  4HQE A;  2X85 A;  3SZG A;  2I10 A;  2LY1 A;  1PUF A;  1IRF A;  1KQ9 A;  3BG3 A;  3ZQI A;  2EFO A;  3A02 A;  3E3V A;  3MVP A;  3F72 A;  4NC8 A;  1FOY A;  3O2P E;  1J0R A;  2R93 J;  1S29 A;  2IA0 A;  5HNF A;  5K5R A;  2XRN A;  4IQ4 A;  3T1B A;  1QO0 D;  5HDK A;  2DT6 A;  1TW2 A;  2E60 A;  3ELK A;  2LMD A;  4UUS B;  1YLF A;  3KEY A;  3MEX A;  3OYL A;  3CJQ B;  3RI4 A;  4HST A;  3OWT A;  1XCV A;  2QA4 I;  2BXZ A;  3WGG A;  1YW7 A;  4ANJ A;  2E1M C;  3HHG A;  1UEL B;  4HQM A;  4EQQ A;  2XGC A;  3EYY A;  1XGO A;  2DO7 A;  1VI0 A;  2EA2 A;  4B48 A;  3VSK A;  2RKH A;  3G1O A;  1D8K A;  1X58 A;  2HFH A;  2CV0 A;  3S1M J;  2MH9 A;  4LOC A;  3HOS A;  1VQM I;  2O8X A;  3EUA A;  1BC8 C;  5E8G A;  1V5G A;  1S5L C;  5LGN A;  1P2F A;  2KRF A;  3F8M A;  1BI2 A;  4GFB A;  3CJN A;  1UST A;  3K2Z A;  2VJJ A;  2W82 A;  3I55 I;  1YJ9 I;  3F8N A;  4DOZ A;  3HKZ N;  5LFA A;  2HQ5 A;  1X19 A;  4IHX A;  2Y9Z A;  3HUG B;  2W25 A;  1YO5 C;  3K7A J;  1D0Y A;  2LRE A;  2K3P A;  3F6V A;  2AS5 F;  1JUP A;  3Q0W A;  2YU9 J;  1PDN C;  4L9N A;  2Y0S A;  4KT5 C;  1ZQ3 P;  2O8K A;  1LJ9 A;  2XRL A;  3CDH A;  3H3V K;  4A93 J;  4Q48 A;  3I54 A;  3IAS 2;  2ZFW A;  4UVB A;  4BXU A;  2JUG A;  1G3W A;  4CZZ A;  4DBQ A;  1MBJ A;  1POG A;  1Z77 A;  3W3C A;  1Z3Y A;  1OCC H;  2PI0 A;  1J2X A;  3EUH C;  1JGG A;  5E20 A;  1TQI A;  4HLY A;  5KVR A;  3I5U A;  4F7Z A;  4NDL A;  4YFX F;  2R7W A;  3H3Z A;  1EF4 A;  1BR2 A;  3MQ0 A;  1GLN A;  4M73 A;  4IHW A;  1UZC A;  2YU3 A;  4BQN A;  4QSH A;  1IDY A;  4FIS A;  4LG3 A;  1A35 A;  2VOO A;  5E3O A;  2HVR A;  4KYW A;  1QGP A;  1FWZ A;  1JXS A;  3WTY C;  1T0F A;  3IRR A;  5KHD A;  1YFH A;  3LNQ A;  3VYT B;  3EQL F;  3IWZ A;  1YRN B;  3PUF A;  4S04 A;  5IYD J;  3TW6 A;  3DU6 A;  3LA7 A;  1U3E M;  2JK3 A;  2LY2 A;  2OBP A;  3C18 A;  3E6B A;  3J81 K;  3CMA I;  3T8R A;  2NS0 A;  2M34 A;  3TO7 A;  3VOE A;  3LSP A;  2Z9O A;  2XV4 S;  3GFJ A;  4ZZD A;  1MBE A;  1SMT A;  2EFQ A;  1W7P A;  3HRS A;  2KIQ A;  2HU9 A;  2DYR H;  4JQF A;  2CUE A;  3VYU B;  4CCO A;  2D45 A;  3CC2 I;  4C2T A;  1K78 B;  1H9G A;  2P6S A;  3MN2 A;  1AU7 A;  2Z16 A;  2IVM A;  2XAF A;  5DD4 A;  3BCA A;  3HGY A;  1YIO A;  4B47 A;  3L2V A;  4N9H A;  3E1S A;  4ZDL A;  2HPM A;  1B8I B;  2IS2 A;  5B3S H;  4RB1 A;  3OIO A;  4E6K G;  1WJD A;  2HOS A;  4OMZ A;  4UUS A;  1WJ5 A;  4BDZ A;  3OYC A;  4BY1 J;  4L0Y B;  1TT5 B;  4RMN A;  1ETY A;  4ESB A;  3S3N A;  1T6S A;  1GT0 C;  1ORK A;  2NS8 A;  2H1K A;  1IO2 A;  3QPT A;  3K4J A;  4L5E A;  2IA2 A;  3M8E A;  5DUI A;  5CQE A;  4XOT A;  3VYS B;  1X1A A;  2R7T A;  1A04 A;  1QZZ A;  2Q0O A;  4E7K A;  5DCM A;  2CUJ A;  1S72 I;  1MD0 A;  2IS4 A;  1FIP A;  1YI2 I;  3A03 A;  2O5R A;  4HF2 A;  2O9L A;  1TP4 A;  3HXL A;  1LNW A;  2DLL A;  4M72 A;  1OCR H;  2CJJ A;  5F1J A;  1JT6 A;  1KU9 A;  2HEO A;  3BJO A;  3D5S C;  2V1N A;  3ZN0 A;  5BPD A;  5F0H A;  5IP7 J;  1FSH A;  2IGO A;  3TP0 A;  3ZQH A;  4QIW N;  2H6C A;  1SFE A;  1OFC X;  2GLO A;  4BDY A;  3ZMV A;  1TNS A;  2L9R A;  1KON A;  2OU2 A;  3HUG A;  5HDG A;  2EZK A;  3GFL A;  3IWF A;  3A4C A;  4XQF A;  2OC6 A;  3CTA A;  5LD2 C;  1RUN A;  1OCO H;  1VQ7 I;  3JRA A;  3DLL F;  2VBW A;  3LST A;  5E8I A;  1BC7 C;  4BE2 A;  1BIB A;  1IV8 A;  1D3Y A;  1R4N B;  2P5V A;  4CUG A;  1MH3 A;  2EZL A;  4HF0 A;  3K2A A;  2HZT A;  3I53 A;  3B02 A;  1X2M A;  3O8H A;  5IY5 H;  3ECO A;  2CW8 A;  4LLG F;  3LL7 A;  3IKV A;  1EKE A;  3OYB A;  2RVC A;  4PJ0 C;  3S17 J;  2DA3 A;  2K9N A;  4U87 A;  5AIP A;  4BYY A;  5BOX A;  3GO5 A;  2E7X A;  2ETH A;  2W4S A;  4ZYA A;  3ZQF A;  2O61 A;  1D5Y A;  1UHM A;  2VN2 A;  4NQW B;  1MMG A;  1LEB A;  3L00 A;  1XG1 A;  4BH9 A;  2OTJ I;  4U0V A;  2X6Y A;  5GAD J;  1Q1V A;  1LUJ B;  4D1Q A;  4A3D J;  1P4A A;  2O6G E;  2VPR A;  3WTU C;  1YTY A;  1RKW A;  2YR2 A;  2PMH A;  2EIK H;  2P7C B;  1UHS A;  5F6F A;  2BW3 B;  5IYC J;  2F48 A;  4KIB A;  3GTG J;  5E1X A;  4C9Y A;  2LNB A;  3MKW B;  2MGQ A;  3CO6 C;  4H0E A;  1XSD A;  1TTY A;  1YRN A;  2BY0 A;  1T08 B;  1I5Z A;  3AG4 H;  3PIO F;  1B59 A;  3CP2 A;  3JTH A;  3U2R A;  5J47 A;  4RLQ A;  3CCE I;  2VT3 A;  5M3F J;  2HWV A;  2K27 A;  1JHF A;  1G3T A;  1I27 A;  3I71 A;  1SEU A;  2BVL A;  1FTZ A;  4OAY A;  2FD5 A;  2VXZ A;  3C2B A;  4M3E A;  3OYE A;  4PZJ A;  3Q3S A;  2BXY A;  5B66 C;  1P6R A;  1E3O C;  5BMZ A;  5TJJ A;  3N4M A;  5ICC A;  5EJC A;  1I6X A;  1LFB A;  2HOA A;  2VC1 A;  2EFP A;  3SFI A;  1W5T A;  2OV7 A;  1TW3 A;  1B8I A;  3DPT A;  2KQR A;  3ZN1 A;  5B5E C;  4G7Z F;  4F55 A;  2V6E A;  2ESH A;  4A3B J;  1MND A;  2HQA A;  2VJ5 A;  2DU9 A;  4BAC A;  1YE9 A;  1MZB A;  1H88 C;  4MEX F;  3PO2 J;  4HOB A;  3G1L A;  2QQ8 A;  1N25 A;  2QZ8 A;  3V7C A;  2P7V B;  4HDV A;  1B1B A;  3L9F A;  4PCQ A;  4N4O B;  2R0Q C;  3L1P A;  4AM3 A;  5HS7 A;  2HR3 A;  4A0Y A;  1O4X A;  4LLN A;  1A31 A;  1F43 A;  2QKM B;  4QLC U;  1V4R A;  2X0L A;  4UVA A;  3JSP A;  2XAG A;  4A3J J;  1P7I A;  3RPQ A;  1DP3 A;  5D8L B;  3ESW B;  1CGP A;  2OPT A;  4ZTJ A;  4XRS G;  5JVG F;  3ZMT A;  1YHQ I;  2FF4 A;  4Y7N J;  4S0H B;  4HV6 A;  2A5W A;  2DK5 A;  2M87 A;  4R1H A;  5IYB J;  3P9C A;  4M3G A;  4WX9 A;  1LFU P;  3VB2 A;  2X4H A;  4A69 C;  3I56 I;  1HKS A;  3MKZ A;  2DK8 A;  3DKX A;  3C7J A;  1RES A;  1KZH A;  4BJ6 C;  3NQO A;  2WAE A;  1O7F A;  2H8W A;  2LBF B;  4DZP A;  2PFB A;  3BPX A;  3V7S A;  2OJE D;  2W1O A;  1UHW A;  2EWN A;  4MQV A;  2CH0 A;  1MIJ A;  2JA5 J;  1BOA A;  1LKX A;  4A3C J;  1LEA A;  2LC2 A;  3FIW A;  4W97 A;  1JKQ C;  3ZCO A;  4GCV A;  3FM5 A;  2QM3 A;  3CJR B;  4L9V A;  3R6S A;  3OYH A;  3OY9 A;  9ANT A;  3GFM A;  1FPQ A;  3CCV I;  5HLT A;  4FX0 A;  4OIN F;  3HKZ A;  3MWM A;  1LDJ A;  1QVT A;  1SMY F;  2ISY A;  2WBM A;  3G1M A;  3GZN B;  4BHP A;  1DP7 P;  4FQG A;  4C2M J;  3J7A O;  4UUT A;  2E1O A;  3DBL B;  1Z7L A;  1YOV B;  3E5X A;  1MJ9 A;  2K85 A;  1WRJ A;  1U78 A;  4NQW A;  1G8X A;  2WV0 A;  1ZGW A;  4DW6 A;  3W2A A;  3BR1 A;  4P5O A;  2LKS A;  1SFU A;  4HLX A;  3QPH A;  3FMR A;  1KU7 A;  2X51 A;  4XRF A;  2FXA A;  4UVC A;  3KEO A;  2BW3 A;  3BDD A;  2ZME C;  2LYC A;  5H20 A;  5HNH A;  3WTV C;  4L9J A;  4I7H A;  2CQX A;  1D1B A;  4XN0 A;  3P7N A;  3OYJ A;  1ODD A;  2MA3 A;  4HPQ A;  2E1C A;  2IBD A;  2X48 A;  2VUM J;  3RQI A;  1PYV A;  1WCM J;  4FTH A;  3H1C A;  3S32 A;  2E5Z A;  1Z6T A;  1I1G A;  1ETX A;  1MMA A;  4MFD A;  1DGR M;  2A61 A;  4JBA A;  3DU5 A;  2FA5 A;  2ZSH B;  4BXF A;  3IH4 A;  1T8I A;  3HM5 A;  3NAU A;  4D7M A;  2LTP A;  2E1N A;  2LFB A;  3O6B B;  2DOE A;  2X1D A;  4DYQ A;  4EM2 A;  4M6V A;  2NVY J;  2R7D A;  1T33 A;  5J40 A;  2PLY A;  4BJT A;  3KET A;  4RDU A;  1ETO A;  2K3F A;  3RKX A;  4MTE A;  2R7F A;  4JK1 X;  4KIT B;  1PP8 F;  4F52 A;  2CU7 A;  3C3W A;  3DBR B;  1X3Z B;  2IPQ X;  1FBQ A;  2M3A A;  1IXC A;  1XGS A;  3JRF A;  3E6C C;  1ENH A;  5FKL A;  2I5U A;  3CO7 C;  4BHB A;  1I50 J;  1ZN2 A;  3TO6 A;  1JTY A;  3AFH A;  3BR2 A;  3F8F A;  3A1Y A;  4MO7 A;  1IXR C;  1ZTR A;  2COB A;  5DS9 A;  2GXG A;  2A3S A;  4U88 A;  3MAJ A;  2NRA C;  2F2E A;  2WC2 A;  1R22 A;  3HSE A;  1PUF B;  3L2R A;  4G6D A;  3K4B A;  3X2Q H;  3OS0 A;  4MGR A;  2KRC A;  1XX5 A;  2LVS A;  3OYD A;  2BHZ A;  5IOY A;  4Z6Y A;  2QWW A;  4Y4R A;  1NG6 A;  2DA4 A;  4IL6 C;  1J75 A;  3D0S A;  4GYG A;  3DF8 A;  4IHV A;  2XB0 X;  3WTX C;  2F5E A;  2JSC A;  2RGV A;  2HXO A;  5E18 F;  4M9X A;  2PMU A;  3CMM A;  4FE7 A;  2LBF A;  2JA7 J;  2XSJ C;  2CQ7 A;  2D1V A;  2YX7 A;  2E1M B;  4XBF A;  3OOU A;  5B1A H;  4LG0 B;  4II3 A;  2V1D A;  2V7F A;  3F0C A;  3G3Z A;  4XLE A;  3CES A;  4CH7 A;  1BA5 A;  4X1E A;  1HDD C;  3PNY A;  5LHI A;  4IQJ A;  3PL8 A;  4D9J A;  1X1C A;  2R92 J;  5HVQ C;  5IPA A;  4A3K J;  4CYC B;  1A5J A;  2FX0 A;  3G71 I;  3OYG A;  2CUF A;  1Z0X A;  4KIF A;  5E3M A;  1MJB A;  3KYD B;  1ZRC A;  4E4H A;  3TKY A;  2W24 A;  5EF6 A;  4QTR A;  3WTT C;  5JVT A;  1MSF C;  2FNA A;  1YW9 A;  1OJL A;  2Y69 H;  2Y2Z A;  4L0Z B;  3I3L A;  3S1R J;  3CDI A;  2XKO A;  3HYI A;  4EEF G;  2LY9 A;  3KP7 A;  3BY6 A;  4B4C A;  3QOD A;  4M6Y A;  4MHG A;  4XIC A;  1IN4 A;  4HAM A;  5L3G A;  1UFM A;  3HHH A;  3NAR A;  3DEU A;  5LBQ A;  3QPL A;  2KPM A;  1R4M B;  3H5N A;  2W85 A;  3LA2 A;  3BJA A;  3HRT A;  4PSX A;  1FOK A;  3EPZ A;  4RAG A;  1ERD A;  2MD0 A;  4A5N A;  4EV0 A;  1J59 A;  5EG0 B;  1UG0 A;  2JTV A;  2KMU A;  2VBZ A;  4JX5 A;  3H9J A;  1IGN A;  1U5T A;  1I3A A;  2FOW A;  2OQR A;  2M5W A;  5F1R A;  2YS9 A;  5DM7 F;  3HJE A;  2B63 J;  1YQA A;  2Q2E B;  4UV8 A;  4FET A;  1K83 J;  2F6C A;  4GO1 A;  4XLN F;  1Q1H A;  1JI8 A;  3OYF A;  4CIC A;  5EEG A;  2KDZ A;  1SFX A;  1R1T A;  3GTP J;  3C2G A;  1HKT A;  2ELK A;  5ERI A;  4G94 A;  5F08 A;  1PVE A;  2ZC2 A;  3WTZ A;  5DD8 A;  3REO A;  2BY1 A;  2OAZ A;  2KT0 A;  2V9V A;  1PJR A;  2WAQ N;  4OIQ F;  2M8G X;  4N4N B;  2DFE A;  3G2B A;  5LHH A;  2OCE A;  1GV5 A;  2E36 A;  3IUO A;  5EYR A;  2HTJ A;  1QA6 A;  4RB2 C;  2L4A A;  4PDK A;  2LDU A;  4UNO A;  1TWH J;  2OZU A;  3ZP5 A;  1W5C C;  1O3R A;  3ZQQ A;  2HVS A;  4I6Z A;  2L9V A;  4HDU A;  1XGN A;  1K4S A;  3VDX A;  1JE8 A;  2Y0M A;  1QZY A;  1VQO I;  1BBY A;  4UXN A;  1EH7 A;  4BAY A;  3CCM I;  2RV8 A;  3CP8 A;  3RJP A;  4C3I J;  1WFX A;  3CMY A;  3F23 A;  4G7H F;  2XUB A;  5F04 A;  4AIK A;  2ME0 A;  1KU2 A;  1B72 A;  2NVU B;  1FMV A;  1XMA A;  4F91 B;  5GTH C;  4I09 A;  3IKT A;  5E1W A;  3GVA A;  4F93 B;  3H36 A;  2GM4 A;  2F4O B;  3EUK L;  5CYV A;  5K5O A;  3WHB A;  5FGM A;  5D5U B;  3FHN A;  3HOU J;  5GPA A;  3WTW C;  2KHM A;  4M9Z A;  4LG0 A;  2K4B A;  3BQY A;  2K40 A;  2HYG D;  2OUM A;  4A3M J;  4PGH A;  2DA5 A;  5D4R A;  1T98 A;  4XKV A;  5DCM B;  1WJE A;  4IRI A;  2TRT A;  2O7O A;  1ZEL A;  4BNC A;  4L18 B;  1P7J A;  1HBX G;  4PJJ A;  3F21 A;  3BQZ A;  4NC7 A;  5EEH A;  4CYC A;  4EMS A;  4LFU A;  4A3I J;  2H09 A;  3TBI A;  5FRM A;  1VF9 A;  2PMZ N;  3FIS A;  3K1P A;  4IOA F;  2EBI A;  3GF2 A;  1EJ9 A;  2P6T A;  5DDG A;  2P4W A;  4PUS A;  5JI6 A;  4LMY A;  5HOO A;  2WB1 N;  1QU3 A;  2F5C A;  3ABM H;  4FAS D;  3FXQ A;  4AYB N;  5JLX A;  2KLO A;  5IP6 A;  5DEQ A;  1WVR A;  3F8C A;  2E19 A;  3CCL I;  4XLF A;  3WU1 B;  1OR7 C;  4B3A A;  4KT6 A;  2W57 A;  4A3E J;  4OIO F;  1IXS B;  4GRI A;  4ZYH A;  2VT2 A;  1WZ2 A;  2VQC A;  2GIZ A;  3I58 A;  3CCJ I;  1TT0 A;  1S7A A;  1J5Y A;  4P55 A;  2VQG A;  5ICF A;  1Z3X A;  1Z1D A;  4XRM A;  2GOX B;  3MZY A;  3VSL A;  1KQ0 A;  3I0T A;  4QPQ A;  3H35 A;  3I59 A;  4M74 A;  5EG0 A;  3F22 A;  3FXJ A;  2K9M A;  2GOM A;  3RZD J;  1GDT A;  2CYY A;  1G4D A;  2WY8 Q;  2K86 A;  5B1B H;  3BTC A;  1IRZ A;  1ZGJ A;  4IXA A;  1F4K A;  3FBN B;  2VI6 A;  2Q2E A;  1Z21 A;  4ON0 A;  3S1N J;  3EUH A;  2K9S A;  1OYY A;  1E3P A;  1ZK8 A;  4CO8 A;  5ED4 A;  4KN4 X;  2JSP A;  2UV1 A;  1T39 A;  3BZC A;  4BJ5 C;  1X1D A;  3OS2 A;  2FBI A;  3ULQ B;  3J7Y J;  1HLV A;  2XGD A;  3E5U A;  4X0G A;  4HBL A;  2KZG A;  4XLH A;  4IOC F;  4TV7 A;  1P9Q C;  2BBY A;  3DPL C;  3WTS C;  1R7J A;  2DOA A;  4LB6 B;  5E1Z B;  1YS7 A;  2MYS A;  3MFK A;  4Y33 A;  2R5Z B;  4E70 A;  1IJW C;  3M7G A;  2XAQ A;  4BKX A;  2M0C A;  1QVU A;  2GAU A;  3CCR I;  1SVL A;  4AIH A;  3GCM A;  5D6E A;  1PP7 U;  1USS A;  2M30 A;  2JN6 A;  3HOW J;  2D2W A;  2DDB A;  3DQV C;  5KK1 A;  3U9G A;  3P9I A;  3IHU A;  1EH8 A;  3HOY J;  3K1M A;  3KLO A;  4HF1 A;  3HTS B;  3LSR A;  2UXN A;  2R7X A;  1VQ5 I;  2FJ1 A;  1UJ8 A;  1FNN A;  5FRN A;  4YRV A;  2WV1 A;  1RET A;  2LH9 A;  4P9U A;  2D1H A;  2ZXH A;  5J4V A;  3IC7 A;  5J1R A;  1D5V A;  5GPC A;  4D7N A;  2GA1 A;  4DJA A;  2BVM A;  1FP2 A;  1KYZ A;  1V5F A;  4LGW A;  5FLX Z;  3QU3 A;  5M5W J;  2IGN A;  4E7S A;  3CZ6 A;  4NNJ A;  3C2H A;  2CV2 A;  5HLH A;  1Y8Q B;  3OIQ A;  4YIF A;  1FLI A;  5JFR A;  1D1C A;  1LVA A;  3RPU D;  4PJN A;  1WSU A;  1E3H A;  2RAE A;  1KA8 A;  3RKQ A;  2DFF A;  3FMQ A;  2H1L A;  1TLH B;  1DU6 A;  2DXI A;  1W4M A;  2JA8 J;  1P4W A;  3SYT A;  3E0J B;  3FXL A;  1R36 A;  1IRX A;  3H9Q A;  3KP4 A;  1PUE E;  4ZYG A;  3LOC A;  2E2H J;  4HZF A;  5F0C A;  2IS6 A;  3ZR8 X;  4A5M A;  4J00 A;  3CC7 I;  2VC0 A;  1HDP A;  1O3S A;  4L5I A;  5EZH A;  4IO9 F;  1MDM B;  1TWF J;  2DMU A;  3FXK A;  1JJ6 C;  2LSO A;  4LIU A;  4A3F J;  3GW2 A;  2L54 A;  2DQR A;  3RKY A;  5L3B A;  2CQK A;  5D8K B;  3CF5 F;  3DTE A;  5J1U A;  2LP0 A;  1JUS A;  1SC7 A;  1JKO C;  3QYF A;  4AVP A;  1Z91 A;  3OR1 C;  4OAZ A;  4LIT A;  2MC3 A;  3GME A;  2FU4 A;  3V7R A;  1IG7 A;  1VQN I;  3A2K A;  4XN3 A;  3KP6 A;  1ZG1 A;  1QBJ A;  4CA0 A;  1I6H J;  2AXT C;  1H8A C;  1Y0N A;  3GYH X;  2WAF A;  4A2U A;  3BR5 A;  4CDG A;  1MSE C;  4OOI A;  1WH7 A;  2JA2 A;  3S93 A;  2JVG A;  1UCR A;  3H0G J;  3I9V 2;  2F5F A;  5K7Z A;  1SFK A;  3IL2 A;  3ZMS A;  1TL8 A;  3GLX A;  5J6X A;  3KLN A;  4ZDP A;  1K6Y A;  1ZGA A;  2XPW A;  4CZC A;  3OL4 A;  3TOB A;  3OOP A;  2W7N A;  3K4M A;  4B1R A;  2HKX A;  2ZJQ F;  3ML6 A;  1HST A;  1LQ1 A;  3K70 D;  2FML A;  4A3L J;  2L7M P;  3CUQ C;  3K6G A;  1ZRE A;  2ZJP F;  2GXB A;  4BQA A;  3SXY A;  3K4L A;  2AQF A;  6PAX A;  2ZO4 A;  3E6D A;  4MNU A;  5BQT A;  3PO3 J;  2NOJ B;  1Z67 A;  2LRD A;  1ETW A;  4RB3 C;  4NBQ A;  1IUY A;  2MW8 A;  3AG2 H;  1YJN I;  2GQQ A;  2LF8 A;  3MKY B;  1KGS A;  3KZZ A;  2IA1 A;  2MC4 A;  2ZJR F;  1NG7 A;  1TWC J;  2HI3 A;  4I98 B;  2CWE A;  4XSZ F;  4C30 A;  4HNU A;  1ZR2 A;  1U9N A;  2EPF A;  3EET A;  2ZME B;  3DLA A;  3FXO A;  3WE3 A;  2R5Z A;  5BPI A;  1UB9 A;  2DOD A;  3M1C A;  2ZKZ A;  3DFG A;  4J19 A;  2DN0 A;  1R00 A;  4ZTF A;  2M2E A;  2HOT A;  2QKL B;  1AWC A;  2OA4 A;  4GDF A;  2BY2 A;  2P81 A;  1Y39 A;  1QZE A;  1RIO H;  3KIO A;  3ZMU A;  1E17 A;  1B6A A;  3J80 Z;  2VKD A;  1NK2 P;  2E34 A;  1R71 A;  3I4N J;  4XNF A;  3RIR A;  1WJA A;  3RTR A;  3FKI J;  5IP9 J;  4IHY A;  3DP7 A;  1WH5 A;  2UXX A;  2MAB A;  2EH3 A;  1ZH5 A;  1K79 A;  2WAQ A;  2Z5U A;  3OYM A;  3HOT A;  3R61 A;  3T0Y A;  3A0B C;  3KZI C;  5K1Y A;  4XOR A;  1WJF A;  2OD5 A;  4EM1 A;  3LAP A;  3K70 C;  5CPR B;  4AU7 A;  2VXD A;  1HKQ A;  2KZV A;  2E5N A;  2HDD A;  4RAF A;  1BOB A;  4BE0 A;  1QPI A;  4PFO A;  1SAX A;  4YG2 F;  3PIP F;  3BG9 A;  4XKC A;  3ISP A;  3V42 A;  4YFN F;  2EFW A;  3S16 J;  3LSM A;  2KIU A;  3L7W A;  1UAA A;  3BC8 A;  3N05 A;  4HA8 A;  5FB2 A;  4JP0 A;  3PSI A;  3D1N I;  5HS8 A;  2HKO A;  2CQQ A;  3DKW A;  4MIM A;  2EFN A;  3C1D A;  3PUB A;  2Z33 A;  1U0J A;  3ZQG A;  3QYE A;  4E7H A;  2MSY A;  4Q4Z F;  1J9I A;  4AID A;  3GZ5 A;  1H9T A;  1ONV A;  1I3Q J;  2L02 A;  2DW4 A;  1AA7 A;  2MD5 A;  1FOX A;  3K1N A;  1A6I A;  1S7E A;  5KAF C;  2ACJ A;  2IJL A;  2YUS A;  1R9T J;  1IUF A;  1RI7 A;  2DOF A;  2JPB A;  2QVO A;  4JX4 A;  1ZLJ A;  4A12 A;  2CMP A;  2PQ8 A;  1TZL A;  4PFP A;  4EJW A;  3BG5 A;  1MDM A;  3G73 A;  1ETQ A;  3PFY A;  4XSX F;  2XDV A;  1UG2 A;  4IHT A;  4CCN A;  1U8B A;  3GTM J;  3FX3 A;  1XDS A;  3AG3 H;  1FOW A;  2EK5 A;  1HW2 A;  5FKN A;  2NXN B;  1GUU A;  3WG7 H;  3AL0 B;  4BE1 A;  4BXX J;  3TP3 A;  5HLG A;  1ZKG A;  5GP9 A;  1ULY A;  4KMF A;  3E97 A;  1U2W A;  2CSO A;  2UUZ A;  1G3S A;  3BJ6 A;  3P9K A;  4KMU X;  4ESF A;  1Y1V J;  4B43 A;  1N75 A;  1W1W E;  4M3B A;  4RGR A;  5DUK A;  2V6C A;  2VOP A;  2M4K A;  3L09 A;  5LEJ A;  2PMZ A;  2JRT A;  2VBX A;  3HSR A;  5J1Y A;  2FEZ A;  2WB1 A;  3R4K A;  3IRQ A;  1TQM A;  2ID3 A;  4AYB A;  3R60 A;  4V2F A;  2IW5 A;  1MBG A;  2RNJ A;  4KNY A;  3VEP A;  1SD7 A;  4ITV A;  3JAM Z;  3ROU A;  5FLX K;  3GX4 X;  4HW0 A;  4NB5 A;  4LD5 A;  5FD5 A;  1IW7 F;  2C6Y A;  1HXD A;  1DQU A;  4AC0 A;  3K4K A;  5FJ8 J;  1NHA A;  1XSX A;  2B9S A;  3OV8 A;  2Z99 A;  3IH2 A;  1REP C;  2DMQ A;  2HYF A;  2W48 A;  4BL0 B;  2JMW A;  2IAI A;  4Q5S F;  5CJ9 A;  1WJC A;  4DYR A;  1YIJ I;  1HC8 A;  2DMP A;  2ZME A;  1GHC A;  2WTE A;  3F3X A;  3I4M J;  2E2J J;  4XLC A;  4UHT A;  1U5T B;  4RS8 A;  5K5Q A;  3V8K A;  3R0A A;  3PFI A;  2ESN A;  4IPA A;  3DEW A;  4I01 A;  3JSO A;  4ABZ A;  3FZV A;  4JYK A;  4I2O A;  3QOE A;  3PM1 A;  4MLO A;  4D0P A;  3Q0U A;  3SQN A;  1YIT I;  1DU0 A;  3RQ4 A;  2IS1 A;  3ZXS A;  3K69 A;  2XSD C;  2FNP A;  3QPS A;  4KA4 A;  1LE8 B;  4OMY A;  4IRG A;  2H6B A;  2BE5 F;  2VQL A;  1IZ1 A;  2G7H A;  4YFK F;  2STT A;  1WHU A;  4XLP F;  2MLG A;  4E7J A;  1X3W B;  2BHY A;  3WOD F;  3JRI A;  1R23 A;  2F5D A;  3V8L A;  2IP2 A;  3SZP A;  1FTT A;  1RR7 A;  5IT9 Z;  1F9N A;  4CSW A;  5KCM A;  3ABK H;  3L2C A;  3V4G A;  3WGH A;  1Y56 A;  2DTZ A;  1VQ4 I;  1ZRD A;  2VE8 A;  2PBI A;  3L2U A;  2CFX A;  4HRI A;  2JQ7 A;  3MZH A;  4G7O F;  2DMN A;  2J5O A;  5HDN A;  2DFI A;  2A69 F;  4M9S A;  2HDC A;  1UMQ A;  5ICE A;  2G7U A;  4E7Z A;  2JJ7 A;  3OMY A;  3TDZ C;  2FBK A;  3I64 A;  4RBO A;  4BQQ A;  5DV5 A;  1QNT A;  4I0B A;  1Y8R B;  2R7U A;  2JRM A;  2JWT A;  2EIM H;  2N8G A;  2EIL H;  4OIR F;  4BY7 J;  3VPR A;  1B72 B;  3F6O A;  1LVK A;  3W2V A;  1RR8 C;  3BCB A;  2FSW A;  3FHZ A;  2DA2 A;  1JT0 A;  4IRH A;  3ABU A;  4X6A J;  2R7R A;  2OF7 A;  1YS6 A;  2XF6 A;  1ON2 A;  3G6E I;  3EYI A;  4DQ2 A;  1O3Q A;  2KJC A;  2KKO A;  5C4X J;  4F92 B;  2KP6 A;  3OSF A;  1MH4 A;  2KJB A;  2PX9 A;  3EDP A;  2VJI A;  5LRR A;  2V1U A;  1YX5 A;  2DPU A;  3KZY A;  3AAF A;  3J80 K;  2E2I J;  4DYC A;  2XB5 A;  1VQ9 I;  4DNC A;  3FK7 A;  1WWX A;  4RM3 A;  3O8G A;  2M4G A;  3HPG A;  2K02 A;  3SHF A;  2PN6 A;  2GXA A;  1WJB A;  1C0W A;  3SDB A;  4B3X A;  2ZXI A;  1LFP A;  3M8F A;  3CLO A;  2ADU A;  4WXH A;  3BT9 A;  3FDY A;  1TNT A;  4P96 A;  2LG4 A;  3OS1 A;  3A01 B;  2L9S A;  4HNT A;  5HOD A;  3T8T A;  2K4J A;  3JRD A;  2XAJ A;  2M45 A;  4JX6 A;  3W6V A;  2IGK A;  2RRE A;  2LKX A;  4GGG A;  4DZJ A;  4K2E A;  1W36 D;  1FP1 D;  2P5L C;  5E17 F;  2L7K A;  2XC7 A;  3S1Q J;  3OL3 A;  1IF1 A;  4HX7 A;  1STZ A;  1DDN A;  4HX4 A;  4CXF A;  3I59 B;  3R0J A;  1S9H A;  4DGW B;  3BTJ A;  3U21 A;  1SVO A;  3WE2 A;  1SAN A;  3K9T A;  4B44 A;  3DTI A;  5CKT A;  1I1S A;  1NH3 A;  3HIF A;  5CVI A;  5JHF A;  2HTS A;  4ASN A;  2CRG A;  1ZG3 A;  2BV6 A;  1MKM A;  1T56 A;  3WGI A;  2CUZ A;  2A6T A;  1XPX A;  1GVJ A;  2A68 F;  1W0T A;  3HDD A;  1XSV A;  5J8F A;  1LE8 A;  4N0B A;  2GZW A;  5GAG J;  5LGT A;  2JA6 J;  2QYO A;  1L0O C;  2VL8 A;  1BI3 A;  1BL0 A;  3QOP A;  3GFI A;  2FQ3 A;  2RDP A;  4YEL A;  1HW1 A;  4G12 A;  3TMO A;  2STW A;  1YJW I;  3JCU C;  3FWE A;  3D5L A;  3KYL A;  1QPM A;  2RNG A;  2VB6 A;  2EV5 A;  4U7B A;  1K61 A;  1YG2 A;  1D8J A;  2F4M B;  4FHT A;  3DTK A;  3MMY B;  1Y6I A;  4XON A;  4OU0 A;  3HC7 A;  4HEA 2;  4G6Q A;  1W36 C;  2VKE A;  3H9G A;  3COA C;  2ICW G;  5DYM A;  4WXD A;  5BNG A;  3ASN H;  1RNL A;  1ZAO A;  2P5K A;  1BW5 A;  2KRH A;  2CGP A;  2A6H F;  3FXM A;  3LFK A;  1SD6 A;  4ZYD A;  2QSH X;  4UV9 A;  3JAM K;  3TW7 A;  4EJT A;  4KJZ A;  4KUM A;  4MQ9 F;  1G3Y A;  1MGT A;  3IAM 2;  4IX7 A;  1KQ8 A;  4IVN A;  5K7F A;  3GEZ A;  2PJP A;  3BR6 A;  2X1E A;  3BR0 A;  2BY3 A;  4AD9 A;  2NOG A;  2OCC H;  5IT3 A;  2EIJ H;  4M3F A;  4MFE A;  3NWT A;  3KP3 A;  1AKH B;  4KN7 X;  4XRS A;  4RB0 A;  2R5Y B;  4XL9 A;  4EVI A;  5EGO B;  3U1K A;  1OCP A;  4RAY A;  4P9F A;  2DFH A;  3BG7 A;  2ELJ A;  2DBB A;  2Q8K A;  1Z7U A;  2LOO A;  1IN6 A;  4R79 A;  2OQG A;  1BW6 A;  2CO5 A;  2R4G A;  2QEX I;  4CCM A;  2AO9 A;  1O7L A;  2V9K A;  2VOD A;  4HV5 A;  1D1A A;  5F0F A;  1HA8 A;  5FKK A;  1QQI A;  1FZP B;  2DAO A;  4FCY A;  4Y52 J;  5M5Y J;  4IZZ A;  1OMI A;  3GTK J;  1T2K A;  1B9N A;  2D5V A;  2MH2 A;  2R7Q A;  4XLA A;  1SD5 A;  2DTR A;  3ABL H;  2LD5 A;  1HOM A;  4S05 A;  3BG6 A;  2CW7 A;  1CF7 A;  2EV0 A;  3TED A;  1XD7 A;  3KX2 A;  5IT9 K;  2HVQ A;  3A01 A;  3LSG A;  3UNG C;  1APL C;  3E6M A;  3RZO J;  3BTL A;  2Z2S B;  1OR7 A;  3FMS A;  1M1E B;  3M8J A;  5KAI C;  3BOQ A;  4V2G A;  3HGG A;  3IP4 B;  3P5J A;  4C3H J;  4LK0 F;  4WF2 A;  3JRE A;  3J7Z I;  2DDA A;  3KPH A;  3MCZ A;  5D5X B;  1JKP C;  2PJR B;  3CC4 I;  2EB7 A;  2R7S A;  2H27 A;  3PQJ A;  1MBH A;  4XK4 A;  1RZ4 A;  1MMS A;  3H92 A;  4RGX A;  5CVU A;  1JJ8 C;  4RM2 A;  3ECH A;  4U0W A;  3CUQ B;  1YW8 A;  2KIS A;  1HQC A;  3VWB A;  1RKT A;  4NC6 A;  2DI3 A;  4EM0 B;  1W7P D;  4A0X A;  4ENK A;  4N9I A;  1Z05 A;  3NEU A;  3KP2 A;  1E0E A;  3RYR A;  2DCE A;  3QP6 A;  2KIM A;  1X4O A;  2EJR A;  3S8P A;  2WAD A;  2VBY A;  5ICG A;  3BP8 A;  2JUC A;  4G9Y A;  3ZMD A;  3JTG A;  4I99 C;  4BU2 A;  5EZG A;  4IEJ A;  1FBU A;  3QQA A;  1FYK A;  3SJM A;  2XIG A;  2QLZ A;  4ENN A;  5CLS A;  3HOV J;  2PG4 A;  2Y9Y A;  2HQR A;  3AKZ A;  5L3F A;  5M5X J;  1EH6 A;  1LDD A;  2A07 F;  2CV1 A;  1H0M A;  1LPQ A;  3IV5 A;  2V9P A;  3PQK A;  3LMM A;  1Z6R A;  3ZGK A;  3JRH A;  4IF4 A;  4M6X A;  3VYR B;  2M1B A;  4ZYE A;  4HYE A;  3JRB A;  3HPH A;  4H4K C;  5ILV A;  3QU6 A;  3HZJ A;  1IN7 A;  1T0F C;  2CFO A;  3FBI B;  5HLI A;  3SFZ A;  2J5P A;  3LSJ A;  4ZZL A;  5CVJ A;  2DYS H;  3OYK A;  3F9K A;  3M9A A;  3DEE A;  5JHU A;  3J7A Y;  2NVQ J;  4EGY A;  2QF7 A;  4FT8 A;  1K4T A;  5TIS C;  2XVC A;  4G6T B;  3OIP A;  1R5I D;  3HSF A;  2VKH A;  4Y15 A;  1AKH A;  1B9M A;  2AXL A;  4CYD A;  2HPI A;  2R5Y A;  1VFC A;  5EGO A;  2V1X A;  1R5G A;  5IOZ A;  5ILS A;  3HEF A;  2F5V A;  2NNY A;  2VQH A;  3GZ6 A;  1SVM A;  3K0L A;  3FXR A;  1QRY A;  4CCJ A;  1LDK B;  4MEY F;  2E71 A;  3TQN A;  1X1B A;  1OCT C;  2FBH A;  4IKF A;  5J8C A;  5BS6 A;  1R1V A;  2HGC A;  2NYX A;  2QQA A;  1MW7 A;  2KIF A;  4BQO A;  4EJV A;  1TBX A;  1TQP A;  5LHG A;  4F3Q A;  2X6X A;  5TGT A;  1OLT A;  3PNT A;  4A6E A;  3Q9V A;  1GXQ A;  1X1P A;  1XB4 A;  4WXC A;  1LB2 A;  3VOD A;  2RQP A;  3FM3 A;  1OYI A;  4RGS A;  4Y13 A;  2IXS A;  3GTQ J;  4GXO A;  3ZOB A;  1R6R A;  4R8H A;  3GTJ J;  2ZBK A;  4YIR X;  3JRG A;  2IEK A;  1X4P A;  4A3G J;  3OSG A;  1JUM A;  4HNV A;  4ENJ A;  4QPO A;  3GUD A;  1J7K A;  2Y30 A;  1V55 H;  2EZI A;  2Y31 A;  4J01 A;  2AQE A;  2ECB A;  4DBR A;  2NNN A;  3ABT A;  2PJR A;  2QSF X;  2ZSI B;  1KYW A;  4IHS A;  3ZQ7 A;  1T38 A;  2R7Z J;  4A0Z A;  2GA2 A;  5D6F A;  2ELH A;  2E7W A;  5JR3 A;  5CVR A;  1G59 A;  2RN7 A;  3RPU A;  2UZK A;  1OKR A;  1CQT A;  2HZD A;  2VE9 A;  3LSH A;  5KNL A;  1N77 A;  3LSK A;  3CUQ A;  4M3D A;  2XPV A;  3S14 J;  2NS7 A;  2YPR A;  2YSR A;  2TCT A;  2M7A A;  3T5X A;  2EZH A;  5K7H A;  2Y75 A;  2BOL A;  3LA3 A;  5EDN A;  1FMW A;  3BTI A;  1G6N A;  5GAE J;  3FXU A;  2ZFU A;  4G8X A;  4FE4 A;  2HS5 A;  2XGX A;  2ZCW A;  2M7B A;  2H94 A;  3MD2 A;  4E7L A;  3L2W A;  3TDU C;  2RQQ A;  3RYP A;  3AG1 H;  1I39 A;  3KE2 A;  1HF0 A;  1ZRF A;  3WG9 A;  3NRV A;  3KP5 A;  3UKG A;  4M71 A;  3L2Q A;  1TC3 C;  4L9T A;  1JHH A;  4ZDO A;  1Y0U A;  1WI9 A;  2K9Q A;  4HSR A;  1MNM C;  5GAH J;  2M0M A;  5ILU A;  2GIV A;  2DJN A;  3S2D J;  2QEN A;  4U0Y A;  4RA2 A;  2IRF G;  5D5W B;  2A05 A;  2DMT A;  1VQ8 I;  1XN7 A;  4NHJ A;  5LRS A;  5A2Q Z;  1TWG J;  4XM3 A;  1RC9 A;  1DPU A;  1D0X A;  4FX4 A;  1BIA A;  1RRJ A;  2QUF A;  4EJU A;  4D5F A;  1EV7 A;  1BN5 A;  2ISZ A;  1FYM A;  3H5R A;  4AIJ A;  1VND A;  2FQ4 A;  4EAT A;  4AVZ A;  4XKW A;  1R49 A;  2ZXJ A;  2EIN H;  1GV2 A;  3LFU A;  3OR2 C;  4Q47 A;  3DBH B;  3BZ6 A;  1IN8 A;  3MZ8 A;  3E7L A;  2LLK A;  2P8T A;  3HB9 A;  1K78 A;  4OIP F;  2M9H A;  5L3C A;  1B4A A;  5E79 C;  4XR6 A;  1VQK I;  1OPC A;  2DT7 B;  2R7O A;  3K4N A;  3H0D A;  2DA7 A;  5FLV A;  3RDI A;  4CGZ A;  3S15 J;  2B0L A;  1BJA A;  3ASO H;  4HG2 A;  3HRU A;  4WK8 F;  1DGW Y;  3KFW X;  1ZYR F;  3W6K B;  1VQL I;  4B09 A;  4YII A;  2JZY A;  3G4S I;  1JGS A;  2L7Z A;  2Q1Z B;  3ZQC A;  1ZR4 A;  2P0W A;  1GXP A;  2GWR A;  4BEH B;  5DM6 F;  4B8X A;  2XPU A;  5CVV A;  1HCR A;  4NUB A;  4ZC3 A;  4QWQ A;  1VQP I;  1IAW A;  4ZJZ A;  2GBY A;  5HS9 A;  1W0U A;  2CS3 A;  4PJM A;  4JOM A;  2HYJ A;  3LQQ A;  4O6J A;  2LR8 A;  3FK6 A;  2ID6 A;  2JVH A;  3CLQ A;  2A6E F;  3BWG A;  3ZPL A;  2H8R A;  2QSG X;  1MMD A;  4ENM A;  1DUX C;  3DPU A;  1WPK A;  3OYA A;  3LSI A;  1BI0 A;  2Z1D A;  2LF7 A;  2VIX A;  5F64 A;  3A0H C;  4RAZ A;  5C44 J;  2ECC A;  3HTU A;  2K7L A;  3FKJ A;  2FRH A;  4AWX B;  5H6R A;  1BR1 A;  1F36 A;  2F4I A;  4LIV A;  2FOK A;  3M3Y J;  3Q9S A;  1FJL A;  1MJA A;  2QCO A;  2VLA A;  2MG4 A;  2KFD A;  4PK4 A;  5E3L A;  1O3T A;  4HX8 A;  3PJR A;  3CCQ I;  4BHC A;  2X6W A;  5H2F C;  1AOY A;  1FBS A;  4EJO A;  5L3E A;  3ZRG A;  2QQB A;  1XTA A;  1S7O A;  4GYI A;  1X2N A;  1L3L A;  3CD6 I;  1OCZ H;  5FD6 A;  3Q0V A;  1A36 A;  5M3M J;  2NVX J;  3KEQ A;  5L3D A;  1IDZ A;  3M4O J;  2K5C A;  2Y0S N;  2O0Y A;  1SAU A;  2UWM A;  4UUV A;  3HG9 A;  2DA6 A;  5AIQ A;  2ME6 A;  4PJL A;  4KIS A;  1J09 A;  5LLQ A;  4PSW A;  3LWF A;  2HOE A;  2ZNZ A;  3GXO A;  4KFC A;  1S3J A;  2EV6 A;  3PSF A;  2XHK A;  2L7F P;  2XAH A;  5FKO A;  3WU2 C;  2R7V A;  2ZNY A;  3CQZ J;  2QBY B;  2HQN A;  3CF2 A;  1MMN A;  2CG4 A;  1P4X A;  2OTL I;  3QWL A;  2LK2 A;  4I0A A;  3W6J B;  4LB5 A;  5D4S A;  4UY8 I;  2VON A;  3S2W A;  3QAH A;  1F1Z A;  1V5E A;  2TDX A;  1A6Q A;  1E2X A;  4BBR J;  3QRF F;  2A5Y B;  2RC4 A;  1NTC A;  2L3D A;  2OZ6 A;  4XKB A;  2R3S A;  2XRO A;  5F27 A;  3FF5 A;  5DCF A;  3ONQ A;  4I02 A;  4C3J J;  1ETV A;  1GVD A;  1ZLK A;  1IC8 A;  1XGM A;  4U7D A;  2WY7 Q;  5FO5 A;  2O3F A;  1OQY A;  3U1D A;  1K7A A;  2DPD A;  2AHQ A;  3HL2 A;  4W1U A;  1DPR A;  1BR4 A;  1BM9 A;  3BR3 A;  2W00 A;  2FMY A;  3OYN A;  5FRO A;  2CW0 F;  3KCC A;  5D5V B;  2ZJ2 A;  2X1C A;  1WQ2 A;  2VAS A;  1F5T A;  3NWS A;  1K6O A;  2JPC A;  2ZXW H;  1P92 A;  2G0E A;  1WKM A;  4O5V A;  3SZT A;  3TOA A;  4CHU A;  3GBG A;  3UR3 C;  2XGE A;  3SDG A;  4C2U A;  1FYL A;  3BZK A;  1ITY A;  3SEZ A;  5FFZ A;  1S6L A;  2Z3Y A;  3E5Q A;  3S2H J;  1H89 C;  1D0Z A;  4A6D A;  4BEH A;  5FLM J;  5FFX A;  3S3M A;  1WI3 A;  2XF5 A;  2L9N A;  3WHC A;  4Y17 A;  4WWC A;  2DJI A;  1IRG A;  4O3M A;  4D5C A;  4WCG A;  3LQR A;  4XID A;  1FC3 A;  3CDL A;  1OYW A;  2EQR A;  2QGU A;  4CCL A;  1MBK A;  3D5R C;  5LGU A;  2VJ4 A;  4OWR B;  2W84 A;  1ZHF A;  3K10 A;  1BI1 A;  2LKP A;  1IN5 A;  1XC5 A;  2NAZ A;  1O57 A;  4V19 K;  3CME I;  3B6C A;  2VPL A;  2FE3 A;  2BGC A;  3ZMZ A;  1V3F A;  1ETK A;  3BRO A;  2MFZ A;  3JW4 A;  3RSN A;  5EEA A;  1XDU A;  1JTX A;  2X6O A;  1RPW A;  1XMX A;  1FIA A;  2BYV E;  3F8B A;  5CQG A;  5C3E J;  3RCO A;  4LJZ F;  3HBL A;  1S8N A;  4LK1 F;  3DCF A;  2PEX A;  3GTL J;  1Z9C A;  5A2Q K;  3RKW A;  1SD4 A;  4RGU A;  5TRD A;  1MBF A;  1XMK A;  3AL0 C;  3DKY A;  2HDW A;  3GWZ A;  3N97 A;  2QQ9 A;  4KIG A;  2YX4 A;  2ZB9 A;  1V54 H;  2IGM A;  4BS9 A;  3DV8 A;  2DA1 A;  3CCU I;  3MKL A;  2XAU A;  5LEK A;  1CF7 B;  5AON A;  2WWY A;  2KL4 A;  2DT5 A;  3GLL A;  2L5Q A;  3TGN A;  3LAJ A;  3K4C A;  3J81 Z;  2HXI A;  3M07 A;  4XMY A;  4ZH4 F;  1ZAR A;  2B7E A;  3VFZ A;  2X9D A;  3H5A A;  3JRC A;  1ON1 A;  2L0K A;  2XF7 A;  4IJA A;  3JR9 A;  3KYC B;  4XOP A;  1R58 A;  1ACI A;  4UB6 C;  3S3O A;  1VZ0 A;  2HNH A;  4L5J A;  3QP5 A;  3DWL E;  2M8E A;  3IH3 A;  1NK3 P;  5GTI C;  2E35 A;  3QYB A;  4ETS A;  2QBY A;  3B6A A;  4DIQ A;  2L2O A;  2BZT A;  1FX7 A;  1X3U A;  4EGZ A;  1Y1W J;  3M1E A;  3ZQL A;  4ESJ A;  3OYI A;  1T95 A;  2CQN A;  3ERM A;  4I76 A;  3HOX J;  1R1U A;  3CCS I;  4BGD A;  3I4P A;  1FSE A;  1FY7 A;  5C4J J;  2COM A;  2FUG 2;  4KIC A;  4BBS J;  1KU3 A;  4II2 A;  2IT0 A;  1W5S A;  2DQL A;  2I8D A;  1VQ6 I;  4Z2Y A;  1U5T C;  2MBF A;  3CJT B;  3PNV A;  3TL4 X;  5DTD A;  1YYV A;  1U8R A;  4Y3O A;  1FT9 A;  5FKM A;  2XAS A;  5JLW A;  4MTD A;  4E7I A;  4CCK A;  3HOZ J;  3BPV A;  3SEQ A;  1OIS A;  1XS9 A;  1BJZ A;  3ERE D;  3W2W A;  1XCB A;  2V79 A;  4AUX A;  3TO9 A;  1HSJ A;  1QHG A;  2NVT J;  1EA3 A;  3DXJ F;  5J4Y A;  1AHD P;  1YX3 A;  5J3L A;  2WA0 A;  3B73 A;  2BEO A;  1MNE A;  2V4J C;  3H3U A;  2VKV A;  3V8J A;  3WU0 A;  4UB8 C;  1QHH D;  2V26 A;  1IV6 A;  1RUO A;  3GTO J;  1ZG5 A;  1N78 A;  4PGG A;  2MLK A;  2EA4 A;  4BUP A;  2K9L A;  3HRM A;  5E3N A;  1JKR C;  4P1W A;  4KDP A;  1R5H A;  5H6Q A;  2L4M A;  1G2H A;  2O03 A;  1WGX A;  3BLY A;  1SFO J;  2XKP A;  2JT1 A;  2G9W A;  3CUO A;  2L01 A;  1HW5 A;  1W7P B;  1VTN C;  2KDO A;  1TWA J;  1U9O A;  4YEJ A;  3Q5F A;  1FEX A;  2Y48 A;  3CCY A; 
#chains in the Genus database with same CATH homology
 3AG3 H;  3ABL H;  3ASN H;  3WG7 H;  1V54 H;  3ABM H;  3AG1 H;  5B1B H;  2Y69 H;  5B1A H;  2ZXW H;  5B3S H;  3ASO H;  3X2Q H;  1OCC H;  3AG4 H;  1OCO H;  2DYS H;  3ABK H;  2EIM H;  2EIL H;  2EIN H;  1OCR H;  1OCZ H;  1V55 H;  2OCC H;  2EIJ H;  3AG2 H;  2DYR H;  5IY5 H;  2EIK H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...