2MBFA

Solution structure of the forkhead domain of brugia malayi daf-16a
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
101
structure length
101
Chain Sequence
NPWGAESYSDLIAKALKSTFDGRMRLNEIYNWFASNVPYFGNRTSQEQSAGWKNSIRHNLSLHSRFMRIQNEGAGKSSWWVINPDAKPGRNPRRQRSATLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Fork head domain containing protein
publication title The solution structure of the forkhead box-O DNA binding domain of Brugia malayi DAF-16a.
pubmed doi rcsb
source organism Brugia malayi
total genus 24
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-07-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2mbfA01
1IXCA 5DD8A 2C6YA 1IXSB 5KK1A 3Q9VA 2BEOA 1LDDA 3G73A 1LDJA 2IA2A 3FM5A 5J8CA 3TDUC 1KQ0A 1HSJA 1I27A 3KE2A 2E7XA 2D1HA 4HDVA 2BBYA 1WKMA 2YR2A 3F8FA 4RB2C 2UWMA 2MA3A 2JPCA 4U88A 4F7ZA 3JW4A 1WSUA 3GZ5A 5LBQA 2B0LA 1SD7A 2A68F 5HLHA 3OOPA 1LQ1A 2H27A 2DLLA 3QPHA 5CYVA 1FBSA 2KIMA 5E8IA 1HW5A 2ACJA 3B02A 1LDKB 2XAGA 4HBLA 2QQBA 3DEUA 4CYDA 3VFZA 4XSZF 3LA2A 4HAMA 2ZMEB 4R1HA 5D6FA 1QGPA 3GWZA 3KFWX 2XAHA 1K7AA 2CYYA 2EFQA 4O3MA 3WU0A 1D8KA 2NYXA 3GO5A 4LD5A 3DQVC 3RPQA 4WXHA 3TOBA 2HGCA 1YQAA 1YO5C 2P7VB 2P4WA 4Q47A 2DK8A 3RDIA 2HTSA 5LRSA 4HYEA 3V7RA 1PP7U 5LRRA 2HQRA 5K1YA 4ZYGA 3VODA 3LA3A 3WODF 2Q8KA 2RN7A 4MGRA 3J81Z 3I53A 3F6VA 1TLHB 3HTUA 4OIRF 3C7JA 3KZZA 5L3GA 5AIPA 2EA2A 4A6DA 3GZ6A 1FOKA 5ILSA 1FWZA 3BJOA 1R5GA 1IZ1A 2VE8A 4U7DA 1TNTA 1K6OA 2LF8A 4RB3C 1G3TA 1T2KA 3ZMSA 4IJAA 3CO7C 4LJZF 2M1BA 2FA5A 2GA1A 3NEUA 1IW7F 4CDGA 5CVUA 2FBIA 1BC8C 4MQVA 2IJLA 4N9HA 2CQKA 4D0PA 3RYRA 4UNOA 4HLYA 5IT3A 3SZPA 1FC3A 1O3QA 3VEPA 1LEBA 4ENKA 1UHMA 3H3ZA 4A5NA 4HF1A 3MZHA 3DFGA 1BI3A 2A6HF 5LEJA 5FFXA 4BQAA 1XGSA 3IL2A 2GWRA 4XRFA 2Z9OA 1USSA 3P9KA 2G9WA 2D2WA 3TOAA 4MEYF 5BPDA 1ONVA 2XROA 3LSTA 2JTVA 2DW4A 2HFHA 1LEAA 1Z9CA 4JK1X 2A69F 1OYIA 3V7CA 3HUGA 1H9GA 1BC7C 3R4KA 5KVRA 2EJRA 4A0YA 4HQEA 1QNTA 1IRFA 5IT9K 4M72A 2ZMEA 1OMIA 1MDMB 3C3WA 1J75A 2HQNA 2LKPA 2PLYA 2D1VA 1QQIA 5D6EA 2Q2EA 1CGPA 5K5QA 3KEQA 3PFIA 3WTZA 2VONA 4CXFA 2MLKA 1JGSA 3KLNA 2STTA 2GAUA 1XDUA 3F8BA 2XRNA 3DF8A 3WTUC 5FD5A 4I0AA 4WX9A 5J8FA 1DUXC 2HWVA 1STZA 5ILVA 1QBJA 2HKXA 3DP7A 4ASNA 4EGZA 3ISPA 3TQNA 3K1NA 1FP2A 1KU9A 4GGGA 1J0RA 1KU3A 4MNUA 2LDUA 3NRVA 1I6XA 5DYMA 4A6EA 1BIAA 2H6CA 1ZAOA 5BPIA 4YIFA 3WTVC 2HOEA 1OYWA 2L4MA 4I0BA 4EM2A 5FD6A 1MD0A 3BROA 1ZN2A 3BOQA 2HS5A 2RNJA 3QU6A 1FYMA 5HS7A 4ZYEA 3HSRA 1YS6A 3KP5A 2V1DA 3RI4A 2MLGA 4KIGA 3TKYA 3HSEA 3CO6C 4IRIA 4KYWA 1FT9A 2VE9A 4KFCA 2MH9A 3M1EA 1BI1A 3WTSC 1XCBA 2L02A 3EUHA 2IVMA 2MH2A 3KP4A 1I1GA 4Y15A 2XHKA 1BM9A 4HX4A 3CLOA 4QLCU 2P5LC 3I0TA 3EYIA 2XV4S 1QZYA 3KP7A 2DFIA 1RZ4A 1DPRA 1ZGJA 1GXQA 2Z99A 1DDNA 1D5VA 1O57A 1Y0UA 1L0OC 2OBPA 4LMYA 2ZKZA 2O0YA 3I71A 3JAMK 3FXRA 3QAHA 4S05A 3K9TA 3P9IA 2ZCWA 3VOEA 3O6BB 1ZG5A 3Q9SA 1WWXA 3V8JA 4G7OF 4P96A 4LGWA 2VOPA 4K2EA 5FB2A 2VN2A 3L09A 5A2QK 1IN7A 2GXGA 2EA4A 2XUBA 1R5HA 2KJCA 2NNYA 4G9YA 4AD9A 3ERED 3KP6A 1O3TA 4ZZLA 1U5TB 3IRRA 1ZG1A 1FZPB 4R79A 4A2UA 2FQ3A 4EJWA 3ULQB 1DPUA 3HOTA 3L2CA 2DO7A 1PUEE 3EYYA 4ETSA 3RYPA 3L00A 5BOXA 2OQGA 2E1NA 3K1PA 3COAC 1VTNC 5LGUA 3DKWA 2L4AA 3GEZA 4DNCA 4RAYA 2ESHA 1LNWA 5DCMA 1KU2A 2M8EA 1YS7A 2FBKA 3WE2A 3HSFA 4P55A 2BYVE 5CJ9A 1I1SA 2STWA 5EEHA 3F8NA 4BXUA 3ZQ7A 1HBXG 1WRJA 2OA4A 1USTA 3F72A 1PP8F 1KYZA 5HLIA 1GHCA 1R22A 3R6SA 3GUDA 2Y48A 3DXJF 3JTGA 2H94A 3E6MA 4L9NA 2PN6A 2ZO4A 2DQRA 2JPBA 1YW7A 2J5PA 1X3UA 2OD5A 4WF2A 3CUQB 4Z2YA 1JHHA 4L9VA 3CJNA 5FLXK 1SD6A 2MBFA 2DPUA 2RQPA 2Z33A 2R7DA 2OAZA 5HDNA 1FBUA 1ZLJA 1RNLA 1TQMA 3JTHA 2XAQA 4N0BA 3GFMA 1AWCA 3DV8A 3HIFA 5AIQA 1QZZA 3MFKA 2EWNA 3U1DA 2PFBA 3O2PE 4AWXB 1KU7A 4DQ2A 1BJAA 4KT5C 1IN5A 2PQ8A 5IT9Z 1ZREA 2DQLA 4EVIA 1HW1A 3ZMZA 2K27A 3W6KB 3LAJA 2O3FA 2HYFA 4L9JA 3TO7A 1LVAA 4RGUA 3F23A 5EEGA 3CUOA 4H0EA 2IW5A 2W25A 3FXQA 3ML6A 4Q4ZF 4BH9A 4I09A 1XGMA 4ESBA 5HVQC 4A0XA 1B4AA 1DP7P 4R8HA 1CF7A 2IA1A 2Z3YA 3IRQA 2VOOA 3M8FA 2EK5A 2Y0MA 1B1BA 3E5UA 4UV9A 3WGIA 4LK0F 2A5YB 2F2EA 4U0YA 1R1TA 1S3JA 2RC4A 2V6CA 4CGZA 4RAZA 3FM3A 3EETA 1YW9A 1QPMA 3GX4X 4L0ZB 1B9MA 4BNCA 3R61A 1J9IA 1T39A 1Z1DA 1NHAA 2NRAC 3SHFA 5BS6A 3FF5A 1HKSA 3F8MA 2XAJA 1IN6A 1J2XA 1FYLA 1P92A 3MAJA 1ZARA 4I7HA 3ZN0A 1ZGAA 2UXXA 3E5XA 4HW0A 1B9NA 3E5QA 1FY7A 1TNSA 5L3CA 5D5VB 4EJVA 3LQQA 5ED4A 3Q5FA 4PGGA 4NB5A 1FYKA 3R0JA 2ETHA 2RDPA 3G3ZA 3HHGA 5E18F 3F22A 1K78A 4G6QA 1TQPA 2OQRA 2XGXA 1ZRDA 4HF0A 4ZYHA 1O3RA 4OMYA 2KIUA 1HW2A 4A0ZA 1MKMA 4HQMA 1R1UA 2FNPA 4EV0A 3GW2A 2ADUA 3ROUA 2FRHA 2X0LA 1FP1D 2P5KA 3GFLA 2VODA 2QBYA 4E70A 2ZNZA 1FLIA 3BPXA 2VBYA 3WG9A 1R1VA 5LGNA 3LQRA 1KA8A 4B09A 2V1UA 4HF2A 4CO8A 3J80K 4ZYDA 1XMKA 5CVVA 4P9FA 5K5RA 2JT1A 3ELKA 4G7ZF 2K02A 2PJPA 1FPQA 1SMYF 4HX7A 1YIOA 3HHHA 1T0FA 2F5EA 4IPAA 3GFJA 5F6FA 4WXDA 3RTRA 2O6GE 1O7FA 4RGRA 4HA8A 3D0SA 1T38A 2HEOA 1T98A 2LSOA 1F9NA 4BHPA 1Z7UA 3GVAA 1FSEA 4EGYA 2DI3A 1HSTA 2QLZA 4OU0A 4LLLA 4LG0B 1XMAA 4ZH4F 3RKWA 4ZZDA 2X4HA 1MJAA 2A6EF 2XIGA 1P4AA 3SQNA 4MQ9F 5FFZA 3ZMTA 2JRTA 3V4GA 2OZUA 5DDGA 4WK8F 2E7WA 3KZYA 4KA4A 3BZ6A 2EFNA 2F5FA 4KMFA 4O5VA 3FHZA 3FX3A 4M71A 4M6YA 5HS9A 5CVIA 3WTXC 1XB4A 2F5DA 2LNBA 3ABTA 1ZG3A 3IWZA 3K1MA 1G4DA 4EJOA 1XSXA 2ELHA 1ZHFA 4A12A 4FT8A 2O03A 1YYVA 4RS8A 1ZH5A 1GXPA 4IHSA 4YFNF 1EH6A 4LFUA 4UVCA 1UFMA 2NS0A 1TTYA 2VBWA 2VT2A 2QYOA 1O7LA 2W84A 3RKXA 2K7LA 3ZPLA 4G7HF 2LF7A 5K5OA 1J59A 2VBZA 2V79A 4CZZA 4RB1A 1XSVA 2P7CB 4M6XA 2ZXJA 2HYGD 3J81K 5AONA 1OPCA 2A61A 4ENMA 5D8KB 1G6NA 3QU3A 5BQTA 1ZLKA 4HX8A 3SXYA 1YG2A 5L3BA 5ICGA 5HDGA 2L01A 4G8XA 3GYHX 4YG2F 4PGHA 4UVAA 2HTJA 5D5UB 1Z6TA 3QP6A 1LB2A 1U6GA 2ISYA 1H0MA 1BBYA 4IHTA 1S29A 3B73A 4M9XA 4AIKA 2CW0F 4EJTA 4YFXF 4EM0B 4OIPF 4EQQA 4KN4X 3WTTC 3RIRA 4O6JA 2PG4A 3FXUA 3U2RA 4ON0A 3IC7A 4M73A 1SMTA 3I64A 2KJBA 4LK1F 2FMLA 2BV6A 2PEXA 5DD4A 3ZMUA 4Y13A 2BGCA 2AXLA 2QZ8A 5J6XA 2O8XA 2IRFG 2NAZA 3V8KA 1JXSA 3KLOA 3GLXA 1I5ZA 1YW8A 5H6QA 4N9IA 3HRTA 3T1BA 3ECHA 4UVBA 4S04A 3GXOA 4P5OA 3BDDA 2FEZA 1F5TA 4Q48A 2KRFA 3MWMA 3SFZA 2IA0A 4WCGA 2PMHA 3QP5A 3F3XA 2BE5F 3M8EA 1E2XA 4Y17A 1MDMA 3FMQA 4PDKA 1ULYA 3H3UA 4XBFA 3FMSA 3L9FA 2VXZA 5ERIA 2FE3A 3L7WA 1U8RA 2WTEA 1S7OA 1J5YA 3D5LA 1U2WA 4YFKF 4M9ZA 1R36A 3VB2A 2M45A 4AVPA 2COMA 3K2ZA 2DU9A 4FX4A 1XSDA 1W5TA 2XVCA 2L54A 3BWGA 2MD5A 1V4RA 1P4WA 2GZWA 3HOSA 2ZNYA 5ICCA 2UXNA 1L3LA 2QVOA 1W5SA 3ECOA 2VC1A 1D3YA 2D45A 2XKPA 2QQ9A 1Z05A 4LLGF 4IXAA 3MZYA 3U9GA 4M9SA 2EV0A 1KGSA 5FGMA 4U7BA 1TQIA 4BYYA 1HKQA 2DBBA 2L3DA 1C0WA 1RIOH 4IVNA 2HZTA 3LA7A 1XN7A 1FSHA 1G3WA 1P4XA 3QPTA 1IN4A 3BP8A 1QO0D 1HKTA 4AIHA 5JI6A 3KP2A 3V7SA 2OZ6A 4L9TA 5LHGA 2IP2A 4BAYA 4BHCA 4KNYA 1E17A 1FNNA 3BY6A 2R3SA 3NQOA 3O3KA 4GXOA 4GYIA 3KP3A 4NQWA 5F64A 3EQLF 1U5TC 2EFWA 3ABUA 1H9TA 2M30A 2K4BA 4FX0A 5E20A 3ZN1A 3HRSA 4L18B 1LJ9A 1R58A 2RVCA 2EV5A 5DV5A 4I01A 2CGPA 1R23A 2JSCA 3GF2A 5JFRA 2IT0A 4MTEA 3FMRA 5LLQA 3R60A 3ZP5A 2EV6A 2YPRA 3REOA 5L3DA 1W7PB 2YX7A 4B8XA 4M74A 4FHTA 1B6AA 1SFUA 3MQ0A 2DAOA 2VT3A 5E17F 3BJ6A 3F6OA 3N4MA 5TJJA 4G94A 1YLFA 2CG4A 5LGTA 2QENA 1IUYA 1RI7A 4L0YB 2G7HA 3HTSB 5ILUA 1HQCA 3I59B 1F1ZA 1S6LA 1U5TA 3S2WA 1IRGA 4UV8A 4GYGA 3E6DA 1REPC 3CUQC 4HDUA 3HRMA 2ZFWA 4L5JA 2CO5A 1RUNA 2F5CA 2W85A 4GCVA 3SZTA 6PAXA 2E1CA 1D8JA 1ON1A 2V9VA 2QM3A 2P6TA 3LFKA 3TO6A 4PZJA 1KQ8A 3WU1B 3F8CA 4RB0A 1SFXA 2DTRA 4OMZA 3K0LA 3EDPA 1W4MA 4CHUA 3T5XA 2MC3A 3K69A 1FX7A 3ZMDA 1IAWA 3PQJA 2VC0A 1WQ2A 1RUOA 1TBXA 4YIIA 2HDCA 1TW2A 4WXCA 1Z6RA 3JAMZ 5D5WB 3WTWC 4JQFA 1W7PD 2H09A 1BIBA 2CWEA 3WGGA 3J7AO 2ZJ2A 3F21A 1R7JA 1XGNA 3CUQA 1XD7A 1EV7A 3IKVA 1MZBA 3T8TA 2Q0OA 2M5WA 2J5OA 5FO5A 4ESJA 5E8GA 3MCZA 5DUIA 1AOYA 5A2QZ 5DCFA 1UCRA 1ODDA 3T0YA 4OOIA 1T6SA 2JZYA 1MJBA 5ICEA 2PI0A 2FMYA 2FU4A 2DPDA 5E1XA 3TO9A 5JHUA 4HOBA 2WV0A 2H6BA 3I4PA 3WE3A 2QQAA 1B59A 2FNAA 3E3VA 5HOOA 3BJAA 2KKOA 4XLNF 3CDHA 1IF1A 2DT5A 2WWYA 2PBIA 3M9AA 5F1RA 3BPVA 1KYWA 2W24A 3KETA 4KICA 2A07F 1W7PA 2WC2A 5CVRA 1BI0A 3JSOA 1FBQA 4JBAA 4KIBA 2XKOA 2RGVA 4KMUX 4Q5SF 2Y75A 5JVTA 3IHUA 5ICFA 4MEXF 5E1ZB 4HLXA 2O61A 5CVJA 5HLGA 3I54A 5DCMB 3HRUA 5TRDA 2FBHA 5DUKA 4I98B 2RKHA 1A04A 4RGSA 1S7AA 1IN8A 2P5VA 1YTYA 4OIOF 3M7GA 3RPUA 2G7UA 4I02A 3KEOA 3I59A 3JSPA 3E97A 3HYIA 5FLXZ 2ESNA 2R7FA 1ZRFA 3IKTA 3LAPA 1IXRC 1JHFA 2YU3A 1G3SA 4IF4A 3T8RA 1S8NA 1XCVA 3LWFA 1ON2A 1UB9A 1YFHA 1JE8A 2FSWA 4ESFA 3FZVA 1EH7A 2KIFA 3AAFA 1SD4A 2K4JA 1BI2A 4KIFA 1G3YA 4OIQF 1Z91A 2PMUA 5L3EA 4UXNA 3W6JB 1P2FA 4XSXF 2YX4A 3FWEA 3C18A 5D4SA 5D4RA 2EFPA 4LLNA 1PDNC 2M87A 4MHGA 5LHIA 1K79A 5D5XB 2QUFA 3I5UA 4I2OA 1OR7A 3OV8A 2EFOA 2FXAA 2FOKA 1MJ9A 2QWWA 3KCCA 4HZFA 2GQQA 1Q1HA 4GO1A 5HS8A 4EM1A 4LB5A 1TW3A 2TDXA 3RKYA 3R0AA 3TDZC 2IPQX 4ENNA 5CLSA 4KN7X 5LEKA 4BHBA 1MGTA 2GIVA 1GVJA 4A5MA 1XGOA 5L3FA 4U0VA 1BN5A 4UHTA 3I58A 4OINF 4WWCA 2CSOA 4KDPA 2XASA 1UHWA 2YSRA 4HV5A 5E1WA 2P6SA 2GA2A 1SAXA 1O3SA 2CFXA 3MEXA 4CICA 3P7NA 3N97A 3IWFA 4G6DA 1HXDA 1P6RA 3P9CA 1CF7B 1ZRCA 2ZBKA 3WTYC 1OYYA 1KQ9A 1OKRA 2W57A 1BOAA 3H92A 2A3SA 4AIJA 4L5IA 3QOPA 4ENJA 2RV8A 3V8LA 2OU2A 3TGNA 1XDSA 1SD5A 1SFEA 2HR3A 2HKOA 4NHJA 3WGHA 4UUVA 4PCQA 2DK5A 4LG0A 5H6RA 2XAFA 3DPLC 5JR3A 2UZKA 5BMZA 3CTAA 2FF4A 2P8TA 4QWQA 2K86A 4P9UA 1ZYRF 1V3FA 3RJPA 2NNNA 4U0WA 2ISZA 2EB7A 3E6BA 4IRGA 3PQKA 4RGXA 1K78B 1WI9A 4KUMA 2Z5UA 1F4KA 1U78A 4EMSA 5LHHA 4LB6B 4HV6A 5DEQA 3J80Z 3C1DA 4MTDA 4XLPF 2V1XA 5H20A 2VBXA 3DPTA 3GFIA 3QRFF 5D8LB 1R00A 3E6CC 4TV7A 1J7KA 5HDKA 1EH8A 2AS5F 2QBYB 2GXBA 4IRHA 3ZMVA 4EJUA 1U3EM
chains in the Genus database with same CATH superfamily
1IXCA 5DD8A 2C6YA 1IXSB 5KHDA 1T08B 5KK1A 3UR3C 5C3EJ 4D9JA 3EPZA 1X1BA 2HXIA 2R93J 3IP4B 3Q9VA 2BEOA 1RPWA 1LDDA 1IV8A 3G73A 1GUUA 1LDJA 2L9NA 4BKXA 2IA2A 3FM5A 4B1RA 5JLWA 3PM1A 5J8CA 5FLVA 4CYCB 3TDUC 1KQ0A 1HSJA 3GMEA 1I27A 3KE2A 2E7XA 2D1HA 2KRHA 2NS7A 4HDVA 2BBYA 2V1NA 4QTRA 1WKMA 2YR2A 3F8FA 4RB2C 2XSDC 4C30A 1Y0NA 2UWMA 2CQNA 2MA3A 4XMYA 2JPCA 2A6TA 4U88A 1N77A 4F7ZA 2A05A 3JW4A 1B8IB 1WSUA 3OR1C 2V6EA 2DT7B 3GZ5A 3BR3A 5LBQA 3KEYA 2B0LA 1SD7A 2A68F 5HLHA 2HDDA 3OOPA 2K9LA 1LQ1A 1LFBA 4PFOA 2H27A 2DLLA 2LY9A 2NXNB 1RKTA 3QPHA 5CYVA 1BR2A 1Z7LA 1FBSA 2KIMA 5E8IA 1HW5A 2ACJA 1QZEA 1YIJI 3B02A 4XLEA 1LDKB 2XAGA 4HBLA 2QQBA 1E3PA 3DEUA 3IH2A 1UG2A 4CYDA 3BG5A 3VFZA 1Y8QB 3BC8A 4XSZF 3LA2A 2L7KA 4D1QA 1JUMA 3MZ8A 4KT6A 4HAMA 2DMTA 2ZMEB 4R1HA 1MBFA 3PSIA 4XOTA 2QSHX 5D6FA 1XS9A 3OYNA 4HRIA 3BG3A 3FKIJ 1QGPA 1XMXA 3GWZA 4IQ4A 1JKPC 3BLYA 3KFWX 2XAHA 2N8GA 2Q2EB 4XIDA 2JK3A 2ZSIB 1K7AA 4V19K 2CYYA 2EFQA 4I99C 4O3MA 3X2QH 2H1LA 3WU0A 5TISC 1D8KA 2NYXA 3GO5A 1A31A 4JYKA 4LD5A 3DQVC 3RPQA 2AQFA 2NS8A 4WXHA 3TOBA 2AQEA 2HGCA 3ERMA 1YQAA 2KT0A 1YO5C 2P7VB 2P4WA 3G4SI 4Q47A 4C3IJ 2DK8A 2XB0X 4XKVA 3RDIA 3VYRB 4M6VA 2HTSA 5LRSA 2QGUA 3OIOA 2CV0A 2RREA 3C2BA 4HYEA 2OCCH 3V7RA 1S9HA 4UB6C 3I9V2 1PP7U 5LRRA 3KYCB 2HQRA 5K1YA 2Y0SN 2YUSA 1DGWY 4ZYGA 3VODA 3LA3A 1ZGWA 3WODF 1T56A 2Q8KA 5J47A 2RN7A 1SEUA 4MGRA 1RC9A 2K9QA 2LBFB 4C2TA 2A5WA 3WHBA 2F5VA 3FHNA 3J81Z 3I53A 3F6VA 1D0XA 1TLHB 3HTUA 4OIRF 3C7JA 2DA1A 3KZZA 4D7MA 5L3GA 5AIPA 2EA2A 4I6ZA 4A6DA 3GZ6A 2VL8A 1QVUA 1FOKA 5ILSA 4C9YA 3N05A 1X1AA 3DTKA 3FISA 4A3EJ 1FWZA 2XF7A 3BJOA 1R5GA 3BTCA 3PNYA 1ETQA 2UUZA 4PK4A 1IZ1A 2VE8A 4U7DA 3S17J 3A2KA 1TNTA 1K6OA 2LF8A 4F52A 4RB3C 1V54H 4ZDPA 1G3TA 1T2KA 3ZMSA 4MLOA 4IJAA 3OYKA 3CO7C 1TWHJ 4LJZF 2M1BA 2DTZA 3S1MJ 2IGNA 2ELKA 4HNVA 2FA5A 2GA1A 1YRNB 3AL0B 2CW8A 1IW7F 3NEUA 3DBRB 4CDGA 4ZJZA 2L9SA 4UUSA 4OAYA 5CVUA 1MBKA 1FMVA 2FBIA 2R92J 1BC8C 4MQVA 2IJLA 5EEAA 4N9HA 3CCSI 2CQKA 4GRIA 3J7ZI 2NVYJ 4D0PA 3LL7A 3RYRA 4UNOA 2WADA 3RQIA 4HLYA 1WHUA 1D1BA 3S16J 5IT3A 2KZGA 1F43A 3U1KA 3SZPA 2M7BA 1FC3A 1O3QA 3VEPA 1LEBA 4ENKA 4A93J 4XRSA 3MKZA 3LSIA 1UHMA 3H3ZA 5FRNA 4A5NA 5KAIC 4A3CJ 4X1EA 1LFUP 3QPSA 4HF1A 4CCJA 4BUPA 4BJ5C 3MZHA 2CW7A 1MW7A 3CP2A 2VIXA 3DFGA 3CJTB 1BI3A 5JLXA 2A6HF 3DEEA 3H5NA 4J01A 5LEJA 2BW3B 2DOFA 2KMUA 5FFXA 3FXMA 1XGSA 2DODA 3LSHA 3IL2A 4BQAA 1GV5A 2GWRA 4Y52J 4XRFA 1O4XA 2Z9OA 1USSA 3MKWB 3MD2A 4OWRB 2ZJRF 4B3AA 1QRYA 3P9KA 3OL3A 1QA6A 2G9WA 2D2WA 3TOAA 3UKGA 4MEYF 5BPDA 1ONVA 3LSTA 2XROA 2JTVA 2DW4A 2HFHA 2I8DA 2LLKA 1LEAA 1MNEA 4ZYAA 4IHXA 2VKHA 3DU6A 2XPWA 4B4CA 1Z9CA 4JK1X 3NARA 3JRDA 1AKHB 3S93A 1JKOC 1FIAA 2A69F 1OYIA 3V7CA 3HUGA 1H9GA 3LMMA 2GXAA 5GPAA 2CUEA 1BC7C 1Z21A 1WI3A 1F36A 3R4KA 3H9JA 2WB1N 2JA8J 1WJDA 5H2FC 2OTJI 2DA2A 3BR5A 5KVRA 4M3FA 4BBRJ 2EJRA 1I3QJ 5FROA 4A0YA 2AO9A 3DEWA 4HQEA 5E3OA 1ZELA 3CJQB 1QNTA 5BNGA 1IRFA 5IT9K 4AVZA 4M72A 4S0HB 2ZMEA 5DM6F 2E71A 1OMIA 5IOZA 3DU5A 1MDMB 2VKVA 4RBOA 2ELJA 2ZXIA 3C3WA 4C2MJ 4M3GA 4A3GJ 1J75A 4XLFA 4ZC3A 2OCEA 2HQNA 4BQNA 2LKPA 2PLYA 2D1VA 1QQIA 2HI3A 4AUXA 3HOWJ 5D6EA 2Q2EA 4RLQA 3ZGKA 2AHQA 1EA3A 1NK2P 1CGPA 5K5QA 1G2HA 2L7MP 3KEQA 3PFIA 2LR8A 3WTZA 2VONA 3K4CA 1MMNA 4CXFA 3HEFA 1VI0A 2MLKA 2X85A 4Y33A 1JGSA 2X51A 2DA4A 3FXOA 1LE8B 3KLNA 2STTA 2GAUA 4PJJA 1XDUA 3F8BA 4RAGA 3TL4X 2XC7A 1K4TA 3FBNB 1VQKI 2MFZA 4BBSJ 1OR7C 3UNGC 2XRNA 3F9KA 5JVGF 1R4MB 4F91B 1XX5A 3DF8A 5GAEJ 3G6EI 3EUHC 2BY3A 1Y6IA 3WTUC 4DYQA 5FD5A 1VFCA 2ECBA 2W4SA 3MN2A 4I0AA 4WX9A 5J8FA 1DUXC 2EZLA 1X1PA 2HWVA 1STZA 2QF7A 3HJEA 1CQTA 2CJJA 1PUFA 5ILVA 1QBJA 3CCMI 2HKXA 3DP7A 4ASNA 4EGZA 3S3MA 3ISPA 3RKQA 2JN6A 3HZJA 3TQNA 2LBFA 3FDYA 1NH3A 3K1NA 1FP2A 1KU9A 3IAM2 4GGGA 1J0RA 3FIWA 3TMOA 1KU3A 2BHYA 4MNUA 2BOLA 4IZZA 3D5RC 1WZ2A 2LDUA 3NRVA 1I6XA 4UUTA 5DYMA 4A6EA 4XLCA 1BIAA 2H6CA 1ZAOA 3G71I 2E1OA 2M7AA 3OYBA 4YIFA 5BPIA 3WTVC 2HOEA 1OYWA 2L4MA 1MNDA 2JVGA 5M5XJ 4I0BA 2MG4A 4EM2A 5FD6A 3BQZA 1MD0A 5IP7J 3BROA 3K70D 1ZN2A 2B9SA 3BOQA 3K10A 2PMZA 2HS5A 2RNJA 5GPCA 1XTAA 3QU6A 1FYMA 5HS7A 4ZYEA 3HSRA 2DA6A 1YS6A 3KP5A 2V1DA 4BEHB 2MLGA 3RI4A 4KIGA 3TKYA 3BT9A 3HSEA 3HPGA 4IHWA 2WY8Q 2PX9A 4F3QA 5E3NA 2B7EA 4XK4A 3CO6C 4IRIA 4KYWA 1IO2A 3FXJA 2K9MA 1FT9A 4HG2A 2VE9A 2F6CA 3OYAA 3S32A 4KFCA 2LVSA 2MH9A 2ID6A 1R49A 2JSPA 3CMYA 2JA5J 3M1EA 1BI1A 3WTSC 3CDIA 1XCBA 5IP9J 2DDBA 2L02A 2LTPA 3EUHA 3OY9A 3HXLA 2IVMA 2MH2A 5F0CA 1U0JA 2M34A 2JA7J 3KP4A 2IS1A 3HBLA 4BE1A 1I1GA 3RZDJ 4Y15A 2XHKA 1BM9A 2IBDA 4HX4A 1ZR4A 3CLOA 1Z77A 4QLCU 3FKJA 2P5LC 3I0TA 5B66C 3EYIA 2E2JJ 2XV4S 1QZYA 3M4OJ 3BG9A 3KP7A 2DFIA 3FK6A 2O7OA 3PFYA 1V55H 1RZ4A 1DPRA 4BL0B 1TL8A 4BGDA 1ZGJA 1GXQA 1JTYA 2GOXB 2Z99A 1DDNA 2BY0A 1H88C 1MIJA 1D5VA 1O57A 1Y0UA 1L0OC 2OBPA 4LMYA 2ZKZA 2R7RA 2O0YA 4Y7NJ 2BVLA 3I71A 4UB8C 3JAMK 2ME6A 2DYRH 3FXRA 2QSFX 2L7ZA 3QAHA 3HG9A 3BCAA 1YHQI 2RQQA 4S05A 3K9TA 1APLC 2BW3A 3DBLB 2KP6A 3GCMA 3P9IA 2Y2ZA 4H4KC 5IYCJ 2ZCWA 3VOEA 3O6BB 3PJRA 1ZG5A 3S1QJ 2VKEA 3DWLE 2VI6A 2VPLA 3Q9SA 1WWXA 1N75A 3V8JA 4G7OF 3KX2A 4P96A 4LGWA 1ETYA 2VKDA 5FKNA 3DLLF 2VOPA 4K2EA 5FB2A 3GTQJ 1UJ8A 2VN2A 1ETXA 3L09A 3H1CA 5A2QK 1IN7A 3HDDA 1VQ9I 1Y56A 4QIWN 2Y9ZA 1IUFA 5DS9A 1FJLA 2GXGA 2W48A 2XPUA 2EA4A 4XKBA 1OFCX 2XUBA 1R5HA 1UAAA 5DTDA 2KJCA 1JT0A 2NNYA 1ACIA 5GADJ 1DU0A 4G9YA 4AD9A 3ERED 1I50J 3KP6A 2EIJH 4V2GA 1O3TA 3J7AY 3JRBA 4PSWA 4ZZLA 1U5TB 1VF9A 3H0DA 3IRRA 2DOAA 1ZG1A 1FZPB 4R79A 2Z16A 5C4JJ 4A2UA 1YJNI 3RSNA 1OISA 2LH9A 2FQ3A 4EJWA 3ULQB 4XQFA 1DPUA 1ETKA 4QPQA 2VJIA 3HOTA 1RKWA 2ICWG 2X1CA 3L2CA 2DO7A 4QPOA 2E5ZA 1PUEE 3EYYA 2EQRA 2ZB9A 4ETSA 3RYPA 1T33A 3QYFA 3L00A 3JR9A 5BOXA 2OQGA 2JUCA 2E1NA 3K1PA 3COAC 1VTNC 3ZQHA 5K7HA 3DKWA 2L4AA 3GEZA 5LGUA 4DNCA 5M3FJ 4A3JJ 2Y69H 3IAS2 2JJ7A 2WV1A 3W2VA 4BJ6C 4RAYA 3PIPF 3L2WA 2ESHA 2XDVA 1LNWA 3W2WA 5DCMA 3BTJA 4M3EA 3NWSA 3M8JA 1KU2A 3CCJI 2M8EA 3HOUJ 3A4CA 1YS7A 1LE8A 2VXDA 5HNFA 4BDYA 4A3KJ 2FBKA 3WE2A 3HSFA 1K83J 4P55A 1FTTA 2BYVE 1SFKA 5CJ9A 1I1SA 2STWA 3ABMH 3AG4H 3QPLA 5EEHA 3BZCA 3F8NA 4D7NA 1I39A 1TWCJ 4BXUA 1UELB 4D5CA 3ZQ7A 4HSRA 2LY2A 3OL4A 3TW6A 3HOYJ 3H3VK 1HBXG 1WRJA 4DJAA 2OA4A 4ZTJA 1USTA 1VNDA 3F72A 1PP8F 3VWBA 1VQ8I 4DW6A 1KYZA 2R5ZB 1FMWA 3Q0WA 5HLIA 3CC2I 1GHCA 2WAQN 1R22A 3R6SA 5GAGJ 5IOYA 3GUDA 2LP0A 2Y48A 2IS4A 3DXJF 2D5VA 3JTGA 2IEKA 2V9PA 3CMMA 4XRSG 2H94A 3E6MA 4L9NA 2PN6A 2ZO4A 2DQRA 2JPBA 1YW7A 2MABA 5B1BH 2J5PA 1A36A 5F27A 1X3UA 2DFHA 3Q3SA 2XAUA 1J09A 2OD5A 1X4PA 3OR2C 4E7HA 4WF2A 1GLNA 1VQ4I 3CUQB 4Z2YA 1JHHA 1MMGA 2EH3A 4L9VA 5FLMJ 3CJNA 1ZR2A 5FLXK 1UG0A 1ERDA 1SD6A 2MBFA 2DPUA 2L7FP 2RQPA 4NUBA 2Z33A 2R7DA 2OAZA 5HDNA 4JX4A 1FBUA 3I56I 1ZLJA 1WJAA 1RNLA 1TQMA 2R7WA 3JTHA 1RETA 4RM3A 2XAQA 4N0BA 2F48A 1NG6A 3GFMA 4LIVA 3ESWB 4E4HA 1AWCA 3DV8A 5HODA 3JCUC 5K7FA 3HIFA 5AIQA 1QZZA 3MFKA 4IO9F 2X6YA 2FUG2 1QPIA 2EWNA 3U1DA 3FBIB 2PFBA 3O2PE 2W1OA 3HGYA 4AWXB 1KU7A 4PJMA 4J00A 4DQ2A 4DZPA 1A6IA 1BJAA 4KT5C 2OUMA 1YOVB 2PJRA 1IN5A 4UY8I 1BW5A 2PQ8A 1YITI 1K61A 3CC4I 4MIMA 5IT9Z 2VLAA 1ZREA 2VQCA 2H8WA 2BVMA 2M9HA 3HB9A 2WBMA 4FTHA 1JJ6C 2DQLA 4EVIA 5EDNA 3K6GA 1HW1A 2DDAA 3CJRB 3ZMZA 1MBHA 2K27A 2MSYA 1OCCH 3W6KB 1PYVA 3OYDA 2ZSHB 3LAJA 3HOXJ 4BDZA 2O3FA 4C3HJ 2DFEA 3L2QA 4HEA2 2HYFA 4B47A 4L9JA 2M8GX 4E7SA 1ZQ3P 3TW7A 4KJZA 1GDTA 2R7QA 3TO7A 2HXOA 1LVAA 4RGUA 3F23A 2VJ5A 5EEGA 9ANTA 3CUOA 1X19A 4H0EA 3A01A 2IW5A 2X1EA 2W25A 2CRGA 2IS6A 3K4MA 2ZJQF 2GM4A 2V26A 1S5LC 2CQQA 3FXQA 3ML6A 4BY7J 4Q4ZF 2ZXHA 4YEJA 4BH9A 2M4GA 4I09A 1XGMA 4ESBA 5HVQC 4FQGA 5FRMA 5FJ8J 3K4JA 2RNGA 4A0XA 2R7ZJ 1B4AA 1DP7P 2IS2A 4R8HA 5CPRB 1CF7A 2IA1A 2Z3YA 3IRQA 2VOOA 2V4JC 3RZOJ 3M8FA 2EK5A 2Y0MA 1B1BA 3E5UA 4UV9A 5EZHA 3WGIA 2VQGA 4IQJA 1JJ8C 4LOCA 4LK0F 2A5YB 2F2EA 4U0YA 1R1TA 1XC5A 1S3JA 2RC4A 2V6CA 5TGTA 4RAZA 1PJRA 4CCNA 4CGZA 3FM3A 4XNFA 3GTKJ 3IH3A 3EETA 1VQ6I 1YW9A 1QPMA 3G1OA 2XGCA 3GX4X 1JGGA 4L0ZB 1JT6A 1B9MA 1PVEA 3OYCA 4BNCA 3R61A 1QHHD 3K2AA 1WH5A 2MYSA 2QKMB 3JRGA 1T39A 1J9IA 1WJ5A 3PUFA 5EYRA 5EG0B 1Z1DA 1NHAA 4NBQA 5B5EC 5KAFC 2NRAC 3SHFA 5BS6A 2KIQA 3H9QA 2KRCA 3SJMA 4E6KG 3FF5A 1HKSA 3F8MA 2XAJA 1IN6A 1J2XA 4BS9A 1FYLA 1KONA 1P92A 3MAJA 3OSGA 1X4OA 2L0KA 1IV6A 1ZARA 2BXZA 4I7HA 1NG7A 1UZCA 3ZN0A 4XN3A 5HLTA 4BY1J 1ZGAA 2UXXA 3E5XA 4HW0A 1B9NA 3E5QA 1SVLA 1IRXA 1FY7A 1TNSA 5L3CA 5D5VB 2GIZA 1TWGJ 3L1PA 4EJVA 1M1EB 3LQQA 1TWAJ 2E34A 5ED4A 2HVSA 3Q5FA 3SDGA 4PGGA 4NB5A 4CCOA 1FYKA 2JRMA 2DCEA 3BCBA 3R0JA 2ETHA 2RDPA 1A35A 1D1CA 3G3ZA 1MBJA 3HHGA 5E18F 3F22A 1K78A 4G6QA 2NVXJ 1TQPA 2Z1DA 1S72I 1YJ9I 2OQRA 2XGXA 4IHYA 1ZRDA 1GVDA 4M3BA 4HF0A 4A3BJ 4ZYHA 2TRTA 1O3RA 4OMYA 2KIUA 1W1WE 4I76A 1HW2A 1OJLA 4A0ZA 3S3NA 1MKMA 4NNJA 4HQMA 1R1UA 2FNPA 4EV0A 3GW2A 3DLAA 2WAEA 2R5ZA 2NVQJ 1IDZA 3BG7A 2ADUA 2ZJPF 4A3LJ 2ZMEC 2GOMA 3ROUA 2FRHA 2X0LA 1FP1D 2P5KA 3GFLA 3AKZA 2VODA 2QBYA 3C2GA 4E70A 2ZNZA 2CV2A 1FLIA 2LOOA 3BPXA 3RCOA 2VBYA 2EBIA 2Y0SA 3WG9A 1R1VA 5LGNA 3LQRA 2F4IA 1KA8A 5J40A 1DGRM 1VQMI 3G1LA 3CMEI 2Y30A 3CQZJ 1U8BA 4B09A 1B72B 3OS0A 2V1UA 4HF2A 4AU7A 2VUMJ 4CO8A 3J80K 2R0QC 2EINH 2DMQA 3MKYB 4ZYDA 1XMKA 5CVVA 4CYCA 2W7NA 1MSFC 2JQ7A 2EIKH 4P9FA 1A6QA 5K5RA 2JT1A 1FOYA 3ELKA 4G7ZF 2K02A 3CDLA 2PJPA 1FPQA 1SMYF 3G1MA 4HX7A 2P81A 1UHSA 4HSTA 1YIOA 3RPUD 1B8IA 1R6RA 3NWTA 3HHHA 4B48A 1ORKA 1T0FA 2F5EA 4IPAA 3GFJA 3HKZN 2DA3A 5F6FA 3ASOH 1MSEC 2E35A 4WXDA 3RTRA 2B63J 2O6GE 1O7FA 3FXKA 2BY2A 4RGRA 4HA8A 1Z3XA 3D0SA 1T38A 2HEOA 4PJ0C 1T98A 2EIMH 2LSOA 1F9NA 4BHPA 5FKLA 2DYSH 1Z7UA 3GVAA 4DBRA 4F93B 3OYIA 1FSEA 1MBGA 3E1SA 3S8PA 4EGYA 2K9NA 2DI3A 1HSTA 2QLZA 4W1UA 4RDUA 3LSPA 2E2IJ 2R7VA 1QHGA 4OU0A 4LLLA 4LG0B 1XMAA 3BTLA 4ZH4F 3RKWA 3PO3J 4XKCA 4ZZDA 2X4HA 1MJAA 2A6EF 2XIGA 1P4AA 3SQNA 4MQ9F 3ZQFA 5FFZA 3ZMTA 1JKQC 2JRTA 3V4GA 2OZUA 5DDGA 4WK8F 1MMSA 1R9TJ 2E7WA 2OC6A 3KZYA 2BHZA 2CQXA 3LNQA 3ABKH 4Y4RA 4KA4A 3BZ6A 2EFNA 2K40A 2Q1ZB 4A3MJ 4CSWA 3AL0C 3L2RA 2F5FA 4MO7A 4KMFA 4O5VA 1Z3YA 3FHZA 3FX3A 3MVPA 4M71A 2XGDA 4LG3A 4M6YA 5HS9A 5CVIA 3WTXC 1XB4A 2F5DA 2NOGA 3DCFA 2LNBA 3SEZA 3CCVI 3ABTA 1ZG3A 2EZHA 2HDWA 3IWZA 3K1MA 3D1NI 3SDBA 3O8HA 3LSMA 2OJED 4EJOA 1XSXA 2ELHA 1G4DA 2XGEA 1ZHFA 4C3JJ 2HYJA 2X9DA 4IX7A 4A12A 3SYTA 4FT8A 2O03A 1YYVA 4RS8A 4CCMA 1ZH5A 1GXPA 4IHSA 4YFNF 1EH6A 1XPXA 4LFUA 4UVCA 5E79C 1UFMA 2LRDA 1KZHA 3H9GA 2NS0A 1WJCA 1TTYA 2VBWA 2VT2A 5IY5H 2QYOA 1O7LA 2W84A 4BXXJ 2XF6A 2F4OB 3RKXA 1FOWA 2K7LA 3ZPLA 4G7HF 2LF7A 5K5OA 1J59A 4CCLA 2VBZA 2V79A 4CZZA 4RB1A 3OYHA 3A03A 3BTIA 5J4YA 2WB1A 1LKXA 4II2A 1XSVA 2ID3A 3CESA 3E7LA 1G59A 2P7CB 4M6XA 2O8KA 1D0ZA 2ZXJA 1RR7A 2HYGD 3J81K 5AONA 1OPCA 2A61A 4AYBN 2NVUB 4ENMA 5D8KB 1G6NA 3LSRA 4YELA 3K70C 3QU3A 3VSKA 1YRNA 5BQTA 4JP0A 1ZLKA 4HX8A 1BOBA 3SXYA 1YG2A 5L3BA 3ZXSA 3OSFA 5ICGA 5HDGA 2L01A 2E1MB 4G8XA 5E3LA 3FXLA 3GYHX 3SZGA 4PGHA 4YG2F 1X3ZB 4NQWB 1MMDA 4UVAA 1SVMA 2ZFUA 2HTJA 3JRAA 5D5UB 3GTOJ 4BXFA 4LITA 2R7UA 1ETOA 1Z6TA 2JMWA 3QP6A 4G12A 3L2UA 1BJZA 1LB2A 1U6GA 2ISYA 1RRJA 1H0MA 1BBYA 4IHTA 3ZCOA 1S29A 3LFUA 3B73A 3VPRA 5IYBJ 4M9XA 4AIKA 2LYCA 4W97A 3DPUA 2CW0F 5IPAA 1D1AA 2OPTA 4EJTA 4YFXF 4EM0B 2JA2A 1HLVA 4OIPF 4EQQA 2MC4A 5EZGA 4KN4X 4E7JA 1OLTA 2JA6J 3WTTC 4NDLA 3RIRA 4O6JA 2PG4A 3FXUA 4FISA 3U2RA 3CF5F 3CCLI 1SANA 4U87A 4ON0A 2ECCA 3DKXA 3QOEA 3BZKA 3IC7A 4M73A 2IGMA 1OCTC 1VQ7I 1SMTA 1S7EA 4Y3OA 3I64A 2KJBA 4FCYA 2QQ8A 3LSJA 4BE2A 1B72A 4LK1F 2R7SA 1FIPA 2FMLA 1FOXA 2BV6A 2PEXA 5DD4A 3ZMUA 4Y13A 3KZIC 2BGCA 2AXLA 1D5YA 2FX0A 1E0EA 3PSFA 3M3YJ 2QZ8A 5J6XA 2O8XA 2LKSA 3IUOA 1BA5A 2IRFG 1K6YA 1FTZA 2NAZA 3PL8A 3V8KA 2NVTJ 3JRIA 1JXSA 3KLOA 1AKHA 3GLXA 1I5ZA 2V9KA 1YW8A 1JTXA 5H6QA 4N9IA 5M3MJ 3HRTA 3T1BA 3ZQGA 3AG3H 3ECHA 4UVBA 3ZQQA 1W0TA 4S04A 1LFPA 3GXOA 4P5OA 3BDDA 2FEZA 1WGXA 4X0GA 3GTLJ 1AHDP 1F5TA 3ZQIA 4Q48A 2KRFA 3MWMA 4PFPA 3SFZA 1W36D 2IA0A 2MD0A 4WCGA 3S15J 2PMHA 3QP5A 4F55A 3F3XA 1UMQA 4DYCA 4BE0A 2FD5A 5FKOA 4CUGA 2BE5F 3H5AA 3M8EA 2V7FA 2EILH 3ABLH 3PUBA 1E2XA 3WG7H 4Y17A 2H1KA 1MDMA 3FMQA 3LSKA 2MGQA 4PDKA 1ULYA 2DXIA 3H3UA 2TCTA 4XBFA 4JOMA 1T8IA 2O9LA 3FMSA 3L9FA 1AU7A 2VXZA 5ERIA 3QWLA 2FE3A 3L7WA 2AXTC 1U8RA 2WTEA 3CC7I 1S7OA 1J5YA 3D5LA 2X6XA 1U2WA 4YFKF 4M9ZA 2L2OA 1R36A 3K7AJ 1X58A 2M45A 3VB2A 5GP9A 4AVPA 1EF4A 5GTIC 1X3WB 2COMA 3K2ZA 2DU9A 4FX4A 1XSDA 1VZ0A 1W5TA 1HDDC 3DBHB 1LPQA 2XVCA 2L54A 2XPVA 3BWGA 2MD5A 1V4RA 1X1CA 1P4WA 4NC7A 2GZWA 3HOSA 2ZNYA 5ICCA 2UXNA 1L3LA 2X1DA 2KFDA 2QVOA 4YIRX 1W5SA 3ECOA 3W3CA 1I6HJ 2VC1A 1D3YA 3CLQA 2D45A 2XKPA 2QQ9A 1Z05A 3H5RA 4LLGF 4IXAA 2M3AA 3MZYA 4DYRA 3O8GA 1ETVA 3Q0UA 3U9GA 4M9SA 2EV0A 1KGSA 5J1RA 5FGMA 4U7BA 1TQIA 3ZOBA 1IG7A 4XR6A 4BYYA 3DTIA 1P7JA 1HKQA 2K3FA 3SEQA 2DBBA 2L3DA 1C0WA 1RIOH 4IVNA 1EJ9A 2HZTA 3LA7A 4CA0A 4KISA 1XN7A 1FSHA 1G3WA 2OTLI 1P4XA 5B3SH 4AM3A 3QPTA 2CS3A 1Y8RB 5B1AH 2KLOA 1IN4A 3BP8A 3I3LA 2COBA 1QO0D 2VJJA 2HOAA 3HPHA 4ZDLA 5J1UA 3C2HA 1HKTA 3QQAA 2HPMA 2Y9YA 4AIHA 4BEHA 5JI6A 3KP2A 3V7SA 2OZ6A 3TP3A 4L9TA 5LHGA 2IP2A 4BAYA 4BHCA 4KNYA 1E17A 2HQAA 1FNNA 1V5FA 3BY6A 2R3SA 2W00A 4M3DA 3NQOA 4KITB 3KPHA 3O3KA 4GXOA 4GYIA 3OS2A 1VQNI 3KP3A 2P0WA 3G2BA 1N25A 5GAHJ 2FQ4A 4NQWA 4A69C 2LK2A 5F64A 2QKLB 3BG6A 3EQLF 1HDPA 2R7OA 3K4BA 2KPMA 1U5TC 2GBYA 2EFWA 3ABUA 1FEXA 3S2HJ 1H9TA 1P7IA 1H8AC 2R7XA 3HUGB 4E7IA 4PJLA 2X48A 2M30A 3S1NJ 2K4BA 1SVOA 4FX0A 5E20A 3ZN1A 3HRSA 4L18B 3GTGJ 1LJ9A 4F92B 4J19A 1R58A 2RVCA 2EV5A 5DV5A 4I01A 2CGPA 3KYLA 5C44J 1R23A 2JSCA 3GF2A 2UV1A 5IP6A 4IEJA 2HOTA 3IH4A 3MMYB 4XICA 5JFRA 2IT0A 2BY1A 1OCZH 4MTEA 3FMRA 1NK3P 5LLQA 3R60A 3CP8A 2WAQA 3ZP5A 2EV6A 2YPRA 1VQLI 2JVHA 3AFHA 1HCRA 1Y1WJ 3REOA 5L3DA 1W7PB 2YX7A 4B8XA 4M74A 1IRZA 4D5FA 2WY7Q 4FHTA 4N4NB 3SFIA 1I3AA 1B6AA 3VYTB 1SFUA 2E2HJ 2M2EA 3MQ0A 2DAOA 2VT3A 1TT5B 5E17F 3BJ6A 1LUJB 3VYUB 3F6OA 3N4MA 4PSXA 5TJJA 4G94A 1YLFA 2CG4A 1YX3A 3A02A 3LSGA 2BZTA 1DP3A 1MMAA 3JRCA 3B6CA 3HM5A 3S2DJ 5LGTA 2QENA 1IUYA 2LMDA 1LVKA 1RI7A 4L0YB 4BQQA 4FASD 2DN0A 1A5JA 2G7HA 4CZCA 2CUZA 3F0CA 3HTSB 5ILUA 1SFOJ 1HQCA 3I59B 1Y39A 3S1RJ 1F1ZA 2KISA 4RM2A 4EEFG 3W6VA 2MW8A 4PUSA 2IGOA 5HNHA 1S6LA 1U5TA 5IYDJ 3S2WA 1ZTRA 1IRGA 2LY1A 4A3FJ 4UV8A 2KQRA 1PUFB 4GYGA 4MFDA 3CZ6A 3TEDA 3E6DA 1REPC 3CUQC 1WJFA 5EGOB 3HRMA 4HDUA 3S3OA 1SAUA 2ZFWA 3ZQLA 4L5JA 5EJCA 2CO5A 1RUNA 2F5CA 2W85A 4FE7A 4GCVA 1MH3A 3SZTA 6PAXA 2E1CA 1MNMC 1D8JA 1ON1A 1E3HA 2V9VA 1TWFJ 4RLFA 1H89C 2QM3A 2RAEA 3MKLA 2P6TA 3U21A 3LFKA 3TO6A 4A3IJ 2G0EA 1WCMJ 4PZJA 1KQ8A 2E36A 1P9QC 3WU1B 2QEXI 3L2VA 3GLLA 3F8CA 3ONQA 3I4MJ 4RB0A 1SFXA 1T0FC 2DTRA 3OYGA 4OMZA 3JRHA 3JREA 4GDFA 3K0LA 1BL0A 2EZIA 3EDPA 1W4MA 1YE9A 1Y1VJ 4CHUA 3T5XA 2DOEA 3H35A 2LC2A 2LREA 2MC3A 3PIOF 3K69A 2E60A 4ABZA 4AIDA 1FX7A 2DT6A 4CH7A 4Z6YA 1K4SA 3CF2A 1YX5A 4B3XA 2DMUA 1V5GA 3ZMDA 3A0HC 3PQJA 1IAWA 2DJNA 1Z67A 2VC0A 1WQ2A 3TBIA 1TBXA 1RUOA 2DMNA 4FETA 4YIIA 2HDCA 2K3PA 4JX5A 3V42A 1TW2A 5F0FA 4WXCA 5LD2C 1Z6RA 2E19A 3JAMZ 5D5WB 3BR6A 3WTWC 4JQFA 2R4GA 1W7PD 2H09A 3K4LA 1BIBA 4HNTA 5DM7F 2CWEA 1QVTA 5F1JA 3CCRI 3WGGA 3J7AO 2ZJ2A 2QSGX 2VPRA 1GT0C 3F21A 4ANJA 1R7JA 3PNVA 1XGNA 3CUQA 2FJ1A 1XD7A 2X6WA 1EV7A 3IKVA 1MZBA 3T8TA 1WPKA 3IV5A 1W0UA 1D0YA 2Q0OA 2M5WA 2J5OA 5FO5A 3OYLA 4ESJA 1HF0A 2OF7A 3OMYA 3MCZA 5E8GA 5DUIA 2YU9J 5A2QZ 1AOYA 1WJBA 4E7LA 1MH4A 5DCFA 1UCRA 1ODDA 2M4KA 3T0YA 4OOIA 1NTCA 1T6SA 2IXSA 2JZYA 4DIQA 1MJBA 2WAFA 5ICEA 2PI0A 1ZK8A 3PNTA 3EUAA 3PO2J 2FMYA 2Z2SB 2FU4A 2DPDA 5E1XA 3TO9A 5JHUA 3OYMA 3P5JA 1JUSA 2O5RA 3E0JB 4DBQA 3W2AA 3KIOA 4HOBA 2WV0A 1POGA 2DA5A 3FK7A 3ASNH 5CKTA 2H6BA 3I4PA 4IKFA 2LG4A 4L5EA 4E7ZA 2CMPA 2KDOA 2ZC2A 3DTEA 2HQ5A 3WE3A 2QQAA 5CQGA 3I55I 3CMAI 1IGNA 4BJTA 5M5WJ 1B59A 1JUPA 4IL6C 2XSJC 2FNAA 3E3VA 5HOOA 3BJAA 5GTHC 4ITVA 2KKOA 4XLNF 3CDHA 1IF1A 2PMZN 4BQOA 2OV7A 2DT5A 2WWYA 2PBIA 3M9AA 5F1RA 2LKXA 1X2MA 2XRLA 3BPVA 1KYWA 4RMNA 2W24A 3KETA 3BQYA 4KICA 4P1WA 2A07F 2CH0A 3BR1A 3K4NA 4G6TB 1W7PA 2WC2A 5CVRA 1BI0A 3OIPA 1ITYA 3D5SC 3JSOA 1FBQA 3H0GJ 4JBAA 4KIBA 2XKOA 2K5CA 1W5CC 2RGVA 3OOUA 4KMUX 4Q5SF 2Y75A 3IHUA 3LOCA 5ICFA 5JVTA 3CCEI 5E1ZB 4MEXF 4HLXA 2O61A 2IAIA 5CVJA 5HLGA 4EATA 1OCPA 3I54A 3AG2H 5DCMB 1HA8A 3HRUA 5J3LA 2DJIA 2CUFA 5TRDA 2Y31A 2FBHA 5DUKA 3M1CA 4I98B 2L9RA 4NC8A 4DZJA 4GFBA 2W82A 2RKHA 1A04A 2E5NA 4RGSA 1S7AA 1IN8A 2R5YB 2P5VA 1YTYA 4OIOF 3QYEA 4JX6A 3M7GA 1Q1VA 3VSLA 3RPUA 2G7UA 4I02A 4XN0A 3KEOA 3I59A 3JSPA 3E97A 3HYIA 5FLXZ 2IGKA 2ESNA 2M0CA 5FKKA 4AC0A 2R7FA 4IOAF 1BR1A 5EG0A 1ZRFA 3IKTA 3LAPA 1IXRC 1JHFA 1WJEA 3OIQA 3NAUA 2YU3A 3Q0VA 1G3SA 4N4OB 1HC8A 2XB5A 4IF4A 4XLHA 3T8RA 1VQPI 3JRFA 1S8NA 3HKZA 3CCUI 1XCVA 4X6AJ 3LWFA 3CCQI 1ON2A 1UB9A 5EGOA 1YFHA 1JE8A 1TZLA 2FSWA 4IHVA 2EPFA 1E3OC 2HNHA 4ESFA 1T95A 3FZVA 2DMPA 4A3DJ 4ZDOA 1EH7A 2I10A 4RA2A 3RQ4A 2F4MB 2KIFA 3AAFA 5F04A 1SD4A 2QA4I 2K4JA 3ZQCA 1BI2A 3QYBA 2H8RA 4KIFA 1G3YA 4OIQF 2VASA 1Z91A 2PMUA 3S14J 3HGGA 1IJWC 4ZTFA 5L3EA 3H36A 4UXNA 3W6JB 1P2FA 4FE4A 2YS9A 2YX4A 4XSXF 3FWEA 3C18A 5D4SA 1DU6A 4RAFA 5D4RA 3HL2A 2EFPA 1SC7A 4LLNA 3GZNB 2KHMA 5J4VA 3BR2A 5CQEA 2HZDA 5M5YJ 1PDNC 4C2UA 3ZRGA 2JWTA 4YRVA 2M87A 2K9SA 5K7ZA 4MHGA 5LHIA 4V2FA 1K79A 2CFOA 2CUJA 1HOMA 5D5XB 2QUFA 3I5UA 4HPQA 2CV1A 4I2OA 1OR7A 1X2NA 3OV8A 2EFOA 2FXAA 1JKRC 2FOKA 1JI8A 2K85A 1YI2I 1MJ9A 2QWWA 3KCCA 2XF5A 2PJRB 4HZFA 5KCMA 4DOZA 2GQQA 4XLAA 2LD5A 1Q1HA 4GO1A 5HS8A 3K4KA 4EM1A 4LB5A 4HNUA 1TW3A 2TDXA 2I5UA 3R0AA 4PJNA 3RKYA 3TDZC 2IPQX 3OYFA 4ENNA 5CLSA 2KDZA 4KN7X 5LEKA 4BHBA 4XRMA 4CCKA 4XOPA 1AA7A 1MGTA 2GIVA 3WHCA 2HOSA 3HOZJ 4OAZA 5C4XJ 4MFEA 1GVJA 1G8XA 3CCYA 4A5MA 1N78A 1TP4A 1XGOA 2KL4A 5L3FA 5LFAA 3A01B 2R7TA 2ZXWH 2QCOA 5F08A 4U0VA 1IC8A 1MBEA 1BN5A 4UHTA 3I58A 4OINF 4WWCA 2CSOA 3GTJJ 1VQ5I 4KDPA 2EZKA 2XASA 3M07A 1UHWA 2KZVA 2VJ4A 2YSRA 1RESA 4HV5A 2HVRA 5E1WA 2P6SA 2GA2A 3ZR8X 1IDYA 1SAXA 1O3SA 2CFXA 1EKEA 3MEXA 4CICA 3P7NA 3N97A 3IWFA 4G6DA 2HVQA 2CQ7A 1HXDA 1ETWA 1P6RA 1XG1A 4XM3A 3P9CA 1CF7B 1ZRCA 1WFXA 2ZBKA 3WTYC 3QODA 1OYYA 1KQ9A 5J1YA 1GV2A 4LIUA 1OKRA 2VB6A 2W57A 1BOAA 5F0HA 3H92A 2A3SA 2CU7A 3TP0A 4AYBA 4AIJA 4L5IA 3QOPA 2VQHA 1R5ID 4ENJA 5JHFA 2L9VA 2RV8A 3V8LA 2OU2A 3TGNA 3GTPJ 1XDSA 1SD5A 2DA7A 1SFEA 1DQUA 1OCOH 4XL9A 1RR8C 3DKYA 3EUKL 2HR3A 2HKOA 4XONA 2GLOA 1W36C 1OQYA 4XKWA 3WGHA 4NHJA 4UUVA 4PCQA 2DK5A 4LG0A 3B6AA 5H6RA 4IOCF 2XAFA 1R71A 3DPLC 5JR3A 2UZKA 5BMZA 1ZKGA 2HU9A 1Z0XA 3CTAA 2BXYA 2FF4A 2NOJB 3OS1A 2P8TA 4QWQA 1TC3C 2K86A 3GTMJ 1R4NB 4II3A 4P9UA 5E3MA 1V5EA 4NC6A 1ZYRF 1V3FA 1X1DA 2WA0A 4XORA 1QU3A 1U9NA 3CD6I 1ENHA 3RJPA 1BR4A 1BW6A 2NNNA 4B44A 4BU2A 2E1MC 3AG1H 2HPIA 4E7KA 4QSHA 4U0WA 4DGWB 2ISZA 3OWTA 2X6OA 5KNLA 2EB7A 1WVRA 4BACA 2DFFA 1TT0A 3E6BA 3J7YJ 3OYEA 3GBGA 1VQOI 2VQLA 5FKMA 2M0MA 4IRGA 4UUSB 3A1YA 1U9OA 3PQKA 4B43A 2R5YA 1YJWI 4RGXA 1K78B 1WI9A 4KUMA 2LFBA 3WU2C 3BR0A 2ME0A 3VYSB 3KYDB 3VDXA 2JUGA 2Z5UA 1F4KA 1U78A 1OCRH 4EMSA 5LHHA 4LB6B 4HV6A 1WH7A 5DEQA 3J80Z 3C1DA 4MTDA 4XLPF 3HOVJ 2V1XA 5H20A 2VBXA 3DPTA 3GFIA 3QRFF 5D8LB 2L5QA 1R00A 3E6CC 4TV7A 1J7KA 3I4NJ 5HDKA 3OYJA 1EH8A 2AS5F 2FOWA 2QBYB 3HC7A 2GXBA 4IRHA 3ZMVA 4EJUA 5EF6A 1U3EM 3A0BC
chains in the Genus database with same CATH topology
1IXCA 5DD8A 2C6YA 1IXSB 5KK1A 3Q9VA 2BEOA 1LDDA 3G73A 1LDJA 2IA2A 3FM5A 5J8CA 3TDUC 1KQ0A 1HSJA 1I27A 3KE2A 2E7XA 2D1HA 4HDVA 2BBYA 1WKMA 2YR2A 3F8FA 4RB2C 2UWMA 2MA3A 2JPCA 4U88A 4F7ZA 3JW4A 1WSUA 3GZ5A 5LBQA 2B0LA 1SD7A 2A68F 5HLHA 3OOPA 1LQ1A 2H27A 2DLLA 3QPHA 5CYVA 1FBSA 2KIMA 5E8IA 1HW5A 2ACJA 3B02A 1LDKB 2XAGA 4HBLA 2QQBA 3DEUA 4CYDA 3VFZA 4XSZF 3LA2A 4HAMA 2ZMEB 4R1HA 5D6FA 1QGPA 3GWZA 3KFWX 2XAHA 1K7AA 2CYYA 2EFQA 4O3MA 3WU0A 1D8KA 2NYXA 3GO5A 4LD5A 3DQVC 3RPQA 4WXHA 3TOBA 2HGCA 1YQAA 1YO5C 2P7VB 2P4WA 4Q47A 2DK8A 3RDIA 2HTSA 5LRSA 4HYEA 3V7RA 1PP7U 5LRRA 2HQRA 5K1YA 4ZYGA 3VODA 3LA3A 3WODF 2Q8KA 2RN7A 4MGRA 3J81Z 3I53A 3F6VA 1TLHB 3HTUA 4OIRF 3C7JA 3KZZA 5L3GA 5AIPA 2EA2A 4A6DA 3GZ6A 1FOKA 5ILSA 1FWZA 3BJOA 1R5GA 1IZ1A 2VE8A 4U7DA 1TNTA 1K6OA 2LF8A 4RB3C 1G3TA 1T2KA 3ZMSA 4IJAA 3CO7C 4LJZF 2M1BA 2FA5A 2GA1A 3NEUA 1IW7F 4CDGA 5CVUA 2FBIA 1BC8C 4MQVA 2IJLA 4N9HA 2CQKA 4D0PA 3RYRA 4UNOA 4HLYA 5IT3A 3SZPA 1FC3A 1O3QA 3VEPA 1LEBA 4ENKA 1UHMA 3H3ZA 4A5NA 4HF1A 3MZHA 3DFGA 1BI3A 2A6HF 5LEJA 5FFXA 4BQAA 1XGSA 3IL2A 2GWRA 4XRFA 2Z9OA 1USSA 3P9KA 2G9WA 2D2WA 3TOAA 4MEYF 5BPDA 1ONVA 2XROA 3LSTA 2JTVA 2DW4A 2HFHA 1LEAA 1Z9CA 4JK1X 2A69F 1OYIA 3V7CA 3HUGA 1H9GA 1BC7C 3R4KA 5KVRA 2EJRA 4A0YA 4HQEA 1QNTA 1IRFA 5IT9K 4M72A 2ZMEA 1OMIA 1MDMB 3C3WA 1J75A 2HQNA 2LKPA 2PLYA 2D1VA 1QQIA 5D6EA 2Q2EA 1CGPA 5K5QA 3KEQA 3PFIA 3WTZA 2VONA 4CXFA 2MLKA 1JGSA 3KLNA 2STTA 2GAUA 1XDUA 3F8BA 2XRNA 3DF8A 3WTUC 5FD5A 4I0AA 4WX9A 5J8FA 1DUXC 2HWVA 1STZA 5ILVA 1QBJA 2HKXA 3DP7A 4ASNA 4EGZA 3ISPA 3TQNA 3K1NA 1FP2A 1KU9A 4GGGA 1J0RA 1KU3A 4MNUA 2LDUA 3NRVA 1I6XA 5DYMA 4A6EA 1BIAA 2H6CA 1ZAOA 5BPIA 4YIFA 3WTVC 2HOEA 1OYWA 2L4MA 4I0BA 4EM2A 5FD6A 1MD0A 3BROA 1ZN2A 3BOQA 2HS5A 2RNJA 3QU6A 1FYMA 5HS7A 4ZYEA 3HSRA 1YS6A 3KP5A 2V1DA 3RI4A 2MLGA 4KIGA 3TKYA 3HSEA 3CO6C 4IRIA 4KYWA 1FT9A 2VE9A 4KFCA 2MH9A 3M1EA 1BI1A 3WTSC 1XCBA 2L02A 3EUHA 2IVMA 2MH2A 3KP4A 1I1GA 4Y15A 2XHKA 1BM9A 4HX4A 3CLOA 4QLCU 2P5LC 3I0TA 3EYIA 2XV4S 1QZYA 3KP7A 2DFIA 1RZ4A 1DPRA 1ZGJA 1GXQA 2Z99A 1DDNA 1D5VA 1O57A 1Y0UA 1L0OC 2OBPA 4LMYA 2ZKZA 2O0YA 3I71A 3JAMK 3FXRA 3QAHA 4S05A 3K9TA 3P9IA 2ZCWA 3VOEA 3O6BB 1ZG5A 3Q9SA 1WWXA 3V8JA 4G7OF 4P96A 4LGWA 2VOPA 4K2EA 5FB2A 2VN2A 3L09A 5A2QK 1IN7A 2GXGA 2EA4A 2XUBA 1R5HA 2KJCA 2NNYA 4G9YA 4AD9A 3ERED 3KP6A 1O3TA 4ZZLA 1U5TB 3IRRA 1ZG1A 1FZPB 4R79A 4A2UA 2FQ3A 4EJWA 3ULQB 1DPUA 3HOTA 3L2CA 2DO7A 1PUEE 3EYYA 4ETSA 3RYPA 3L00A 5BOXA 2OQGA 2E1NA 3K1PA 3COAC 1VTNC 5LGUA 3DKWA 2L4AA 3GEZA 4DNCA 4RAYA 2ESHA 1LNWA 5DCMA 1KU2A 2M8EA 1YS7A 2FBKA 3WE2A 3HSFA 4P55A 2BYVE 5CJ9A 1I1SA 2STWA 5EEHA 3F8NA 4BXUA 3ZQ7A 1HBXG 1WRJA 2OA4A 1USTA 3F72A 1PP8F 1KYZA 5HLIA 1GHCA 1R22A 3R6SA 3GUDA 2Y48A 3DXJF 3JTGA 2H94A 3E6MA 4L9NA 2PN6A 2ZO4A 2DQRA 2JPBA 1YW7A 2J5PA 1X3UA 2OD5A 4WF2A 3CUQB 4Z2YA 1JHHA 4L9VA 3CJNA 5FLXK 1SD6A 2MBFA 2DPUA 2RQPA 2Z33A 2R7DA 2OAZA 5HDNA 1FBUA 1ZLJA 1RNLA 1TQMA 3JTHA 2XAQA 4N0BA 3GFMA 1AWCA 3DV8A 3HIFA 5AIQA 1QZZA 3MFKA 2EWNA 3U1DA 2PFBA 3O2PE 4AWXB 1KU7A 4DQ2A 1BJAA 4KT5C 1IN5A 2PQ8A 5IT9Z 1ZREA 2DQLA 4EVIA 1HW1A 3ZMZA 2K27A 3W6KB 3LAJA 2O3FA 2HYFA 4L9JA 3TO7A 1LVAA 4RGUA 3F23A 5EEGA 3CUOA 4H0EA 2IW5A 2W25A 3FXQA 3ML6A 4Q4ZF 4BH9A 4I09A 1XGMA 4ESBA 5HVQC 4A0XA 1B4AA 1DP7P 4R8HA 1CF7A 2IA1A 2Z3YA 3IRQA 2VOOA 3M8FA 2EK5A 2Y0MA 1B1BA 3E5UA 4UV9A 3WGIA 4LK0F 2A5YB 2F2EA 4U0YA 1R1TA 1S3JA 2RC4A 2V6CA 4CGZA 4RAZA 3FM3A 3EETA 1YW9A 1QPMA 3GX4X 4L0ZB 1B9MA 4BNCA 3R61A 1J9IA 1T39A 1Z1DA 1NHAA 2NRAC 3SHFA 5BS6A 3FF5A 1HKSA 3F8MA 2XAJA 1IN6A 1J2XA 1FYLA 1P92A 3MAJA 1ZARA 4I7HA 3ZN0A 1ZGAA 2UXXA 3E5XA 4HW0A 1B9NA 3E5QA 1FY7A 1TNSA 5L3CA 5D5VB 4EJVA 3LQQA 5ED4A 3Q5FA 4PGGA 4NB5A 1FYKA 3R0JA 2ETHA 2RDPA 3G3ZA 3HHGA 5E18F 3F22A 1K78A 4G6QA 1TQPA 2OQRA 2XGXA 1ZRDA 4HF0A 4ZYHA 1O3RA 4OMYA 2KIUA 1HW2A 4A0ZA 1MKMA 4HQMA 1R1UA 2FNPA 4EV0A 3GW2A 2ADUA 3ROUA 2FRHA 2X0LA 1FP1D 2P5KA 3GFLA 2VODA 2QBYA 4E70A 2ZNZA 1FLIA 3BPXA 2VBYA 3WG9A 1R1VA 5LGNA 3LQRA 1KA8A 4B09A 2V1UA 4HF2A 4CO8A 3J80K 4ZYDA 1XMKA 5CVVA 4P9FA 5K5RA 2JT1A 3ELKA 4G7ZF 2K02A 2PJPA 1FPQA 1SMYF 4HX7A 1YIOA 3HHHA 1T0FA 2F5EA 4IPAA 3GFJA 5F6FA 4WXDA 3RTRA 2O6GE 1O7FA 4RGRA 4HA8A 3D0SA 1T38A 2HEOA 1T98A 2LSOA 1F9NA 4BHPA 1Z7UA 3GVAA 1FSEA 4EGYA 2DI3A 1HSTA 2QLZA 4OU0A 4LLLA 4LG0B 1XMAA 4ZH4F 3RKWA 4ZZDA 2X4HA 1MJAA 2A6EF 2XIGA 1P4AA 3SQNA 4MQ9F 5FFZA 3ZMTA 2JRTA 3V4GA 2OZUA 5DDGA 4WK8F 2E7WA 3KZYA 4KA4A 3BZ6A 2EFNA 2F5FA 4KMFA 4O5VA 3FHZA 3FX3A 4M71A 4M6YA 5HS9A 5CVIA 3WTXC 1XB4A 2F5DA 2LNBA 3ABTA 1ZG3A 3IWZA 3K1MA 1G4DA 4EJOA 1XSXA 2ELHA 1ZHFA 4A12A 4FT8A 2O03A 1YYVA 4RS8A 1ZH5A 1GXPA 4IHSA 4YFNF 1EH6A 4LFUA 4UVCA 1UFMA 2NS0A 1TTYA 2VBWA 2VT2A 2QYOA 1O7LA 2W84A 3RKXA 2K7LA 3ZPLA 4G7HF 2LF7A 5K5OA 1J59A 2VBZA 2V79A 4CZZA 4RB1A 1XSVA 2P7CB 4M6XA 2ZXJA 2HYGD 3J81K 5AONA 1OPCA 2A61A 4ENMA 5D8KB 1G6NA 3QU3A 5BQTA 1ZLKA 4HX8A 3SXYA 1YG2A 5L3BA 5ICGA 5HDGA 2L01A 4G8XA 3GYHX 4YG2F 4PGHA 4UVAA 2HTJA 5D5UB 1Z6TA 3QP6A 1LB2A 1U6GA 2ISYA 1H0MA 1BBYA 4IHTA 1S29A 3B73A 4M9XA 4AIKA 2CW0F 4EJTA 4YFXF 4EM0B 4OIPF 4EQQA 4KN4X 3WTTC 3RIRA 4O6JA 2PG4A 3FXUA 3U2RA 4ON0A 3IC7A 4M73A 1SMTA 3I64A 2KJBA 4LK1F 2FMLA 2BV6A 2PEXA 5DD4A 3ZMUA 4Y13A 2BGCA 2AXLA 2QZ8A 5J6XA 2O8XA 2IRFG 2NAZA 3V8KA 1JXSA 3KLOA 3GLXA 1I5ZA 1YW8A 5H6QA 4N9IA 3HRTA 3T1BA 3ECHA 4UVBA 4S04A 3GXOA 4P5OA 3BDDA 2FEZA 1F5TA 4Q48A 2KRFA 3MWMA 3SFZA 2IA0A 4WCGA 2PMHA 3QP5A 3F3XA 2BE5F 3M8EA 1E2XA 4Y17A 1MDMA 3FMQA 4PDKA 1ULYA 3H3UA 4XBFA 3FMSA 3L9FA 2VXZA 5ERIA 2FE3A 3L7WA 1U8RA 2WTEA 1S7OA 1J5YA 3D5LA 1U2WA 4YFKF 4M9ZA 1R36A 3VB2A 2M45A 4AVPA 2COMA 3K2ZA 2DU9A 4FX4A 1XSDA 1W5TA 2XVCA 2L54A 3BWGA 2MD5A 1V4RA 1P4WA 2GZWA 3HOSA 2ZNYA 5ICCA 2UXNA 1L3LA 2QVOA 1W5SA 3ECOA 2VC1A 1D3YA 2D45A 2XKPA 2QQ9A 1Z05A 4LLGF 4IXAA 3MZYA 3U9GA 4M9SA 2EV0A 1KGSA 5FGMA 4U7BA 1TQIA 4BYYA 1HKQA 2DBBA 2L3DA 1C0WA 1RIOH 4IVNA 2HZTA 3LA7A 1XN7A 1FSHA 1G3WA 1P4XA 3QPTA 1IN4A 3BP8A 1QO0D 1HKTA 4AIHA 5JI6A 3KP2A 3V7SA 2OZ6A 4L9TA 5LHGA 2IP2A 4BAYA 4BHCA 4KNYA 1E17A 1FNNA 3BY6A 2R3SA 3NQOA 3O3KA 4GXOA 4GYIA 3KP3A 4NQWA 5F64A 3EQLF 1U5TC 2EFWA 3ABUA 1H9TA 2M30A 2K4BA 4FX0A 5E20A 3ZN1A 3HRSA 4L18B 1LJ9A 1R58A 2RVCA 2EV5A 5DV5A 4I01A 2CGPA 1R23A 2JSCA 3GF2A 5JFRA 2IT0A 4MTEA 3FMRA 5LLQA 3R60A 3ZP5A 2EV6A 2YPRA 3REOA 5L3DA 1W7PB 2YX7A 4B8XA 4M74A 4FHTA 1B6AA 1SFUA 3MQ0A 2DAOA 2VT3A 5E17F 3BJ6A 3F6OA 3N4MA 5TJJA 4G94A 1YLFA 2CG4A 5LGTA 2QENA 1IUYA 1RI7A 4L0YB 2G7HA 3HTSB 5ILUA 1HQCA 3I59B 1F1ZA 1S6LA 1U5TA 3S2WA 1IRGA 4UV8A 4GYGA 3E6DA 1REPC 3CUQC 4HDUA 3HRMA 2ZFWA 4L5JA 2CO5A 1RUNA 2F5CA 2W85A 4GCVA 3SZTA 6PAXA 2E1CA 1D8JA 1ON1A 2V9VA 2QM3A 2P6TA 3LFKA 3TO6A 4PZJA 1KQ8A 3WU1B 3F8CA 4RB0A 1SFXA 2DTRA 4OMZA 3K0LA 3EDPA 1W4MA 4CHUA 3T5XA 2MC3A 3K69A 1FX7A 3ZMDA 1IAWA 3PQJA 2VC0A 1WQ2A 1RUOA 1TBXA 4YIIA 2HDCA 1TW2A 4WXCA 1Z6RA 3JAMZ 5D5WB 3WTWC 4JQFA 1W7PD 2H09A 1BIBA 2CWEA 3WGGA 3J7AO 2ZJ2A 3F21A 1R7JA 1XGNA 3CUQA 1XD7A 1EV7A 3IKVA 1MZBA 3T8TA 2Q0OA 2M5WA 2J5OA 5FO5A 4ESJA 5E8GA 3MCZA 5DUIA 1AOYA 5A2QZ 5DCFA 1UCRA 1ODDA 3T0YA 4OOIA 1T6SA 2JZYA 1MJBA 5ICEA 2PI0A 2FMYA 2FU4A 2DPDA 5E1XA 3TO9A 5JHUA 4HOBA 2WV0A 2H6BA 3I4PA 3WE3A 2QQAA 1B59A 2FNAA 3E3VA 5HOOA 3BJAA 2KKOA 4XLNF 3CDHA 1IF1A 2DT5A 2WWYA 2PBIA 3M9AA 5F1RA 3BPVA 1KYWA 2W24A 3KETA 4KICA 2A07F 1W7PA 2WC2A 5CVRA 1BI0A 3JSOA 1FBQA 4JBAA 4KIBA 2XKOA 2RGVA 4KMUX 4Q5SF 2Y75A 5JVTA 3IHUA 5ICFA 4MEXF 5E1ZB 4HLXA 2O61A 5CVJA 5HLGA 3I54A 5DCMB 3HRUA 5TRDA 2FBHA 5DUKA 4I98B 2RKHA 1A04A 4RGSA 1S7AA 1IN8A 2P5VA 1YTYA 4OIOF 3M7GA 3RPUA 2G7UA 4I02A 3KEOA 3I59A 3JSPA 3E97A 3HYIA 5FLXZ 2ESNA 2R7FA 1ZRFA 3IKTA 3LAPA 1IXRC 1JHFA 2YU3A 1G3SA 4IF4A 3T8RA 1S8NA 1XCVA 3LWFA 1ON2A 1UB9A 1YFHA 1JE8A 2FSWA 4ESFA 3FZVA 1EH7A 2KIFA 3AAFA 1SD4A 2K4JA 1BI2A 4KIFA 1G3YA 4OIQF 1Z91A 2PMUA 5L3EA 4UXNA 3W6JB 1P2FA 4XSXF 2YX4A 3FWEA 3C18A 5D4SA 5D4RA 2EFPA 4LLNA 1PDNC 2M87A 4MHGA 5LHIA 1K79A 5D5XB 2QUFA 3I5UA 4I2OA 1OR7A 3OV8A 2EFOA 2FXAA 2FOKA 1MJ9A 2QWWA 3KCCA 4HZFA 2GQQA 1Q1HA 4GO1A 5HS8A 4EM1A 4LB5A 1TW3A 2TDXA 3RKYA 3R0AA 3TDZC 2IPQX 4ENNA 5CLSA 4KN7X 5LEKA 4BHBA 1MGTA 2GIVA 1GVJA 4A5MA 1XGOA 5L3FA 4U0VA 1BN5A 4UHTA 3I58A 4OINF 4WWCA 2CSOA 4KDPA 2XASA 1UHWA 2YSRA 4HV5A 5E1WA 2P6SA 2GA2A 1SAXA 1O3SA 2CFXA 3MEXA 4CICA 3P7NA 3N97A 3IWFA 4G6DA 1HXDA 1P6RA 3P9CA 1CF7B 1ZRCA 2ZBKA 3WTYC 1OYYA 1KQ9A 1OKRA 2W57A 1BOAA 3H92A 2A3SA 4AIJA 4L5IA 3QOPA 4ENJA 2RV8A 3V8LA 2OU2A 3TGNA 1XDSA 1SD5A 1SFEA 2HR3A 2HKOA 4NHJA 3WGHA 4UUVA 4PCQA 2DK5A 4LG0A 5H6RA 2XAFA 3DPLC 5JR3A 2UZKA 5BMZA 3CTAA 2FF4A 2P8TA 4QWQA 2K86A 4P9UA 1ZYRF 1V3FA 3RJPA 2NNNA 4U0WA 2ISZA 2EB7A 3E6BA 4IRGA 3PQKA 4RGXA 1K78B 1WI9A 4KUMA 2Z5UA 1F4KA 1U78A 4EMSA 5LHHA 4LB6B 4HV6A 5DEQA 3J80Z 3C1DA 4MTDA 4XLPF 2V1XA 5H20A 2VBXA 3DPTA 3GFIA 3QRFF 5D8LB 1R00A 3E6CC 4TV7A 1J7KA 5HDKA 1EH8A 2AS5F 2QBYB 2GXBA 4IRHA 3ZMVA 4EJUA 1U3EM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IXC A;  5DD8 A;  2C6Y A;  1IXS B;  5KK1 A;  3Q9V A;  2BEO A;  1LDD A;  3G73 A;  1LDJ A;  2IA2 A;  3FM5 A;  5J8C A;  3TDU C;  1KQ0 A;  1HSJ A;  1I27 A;  3KE2 A;  2E7X A;  2D1H A;  4HDV A;  2BBY A;  1WKM A;  2YR2 A;  3F8F A;  4RB2 C;  2UWM A;  2MA3 A;  2JPC A;  4U88 A;  4F7Z A;  3JW4 A;  1WSU A;  3GZ5 A;  5LBQ A;  2B0L A;  1SD7 A;  2A68 F;  5HLH A;  3OOP A;  1LQ1 A;  2H27 A;  2DLL A;  3QPH A;  5CYV A;  1FBS A;  2KIM A;  5E8I A;  1HW5 A;  2ACJ A;  3B02 A;  1LDK B;  2XAG A;  4HBL A;  2QQB A;  3DEU A;  4CYD A;  3VFZ A;  4XSZ F;  3LA2 A;  4HAM A;  2ZME B;  4R1H A;  5D6F A;  1QGP A;  3GWZ A;  3KFW X;  2XAH A;  1K7A A;  2CYY A;  2EFQ A;  4O3M A;  3WU0 A;  1D8K A;  2NYX A;  3GO5 A;  4LD5 A;  3DQV C;  3RPQ A;  4WXH A;  3TOB A;  2HGC A;  1YQA A;  1YO5 C;  2P7V B;  2P4W A;  4Q47 A;  2DK8 A;  3RDI A;  2HTS A;  5LRS A;  4HYE A;  3V7R A;  1PP7 U;  5LRR A;  2HQR A;  5K1Y A;  4ZYG A;  3VOD A;  3LA3 A;  3WOD F;  2Q8K A;  2RN7 A;  4MGR A;  3J81 Z;  3I53 A;  3F6V A;  1TLH B;  3HTU A;  4OIR F;  3C7J A;  3KZZ A;  5L3G A;  5AIP A;  2EA2 A;  4A6D A;  3GZ6 A;  1FOK A;  5ILS A;  1FWZ A;  3BJO A;  1R5G A;  1IZ1 A;  2VE8 A;  4U7D A;  1TNT A;  1K6O A;  2LF8 A;  4RB3 C;  1G3T A;  1T2K A;  3ZMS A;  4IJA A;  3CO7 C;  4LJZ F;  2M1B A;  2FA5 A;  2GA1 A;  3NEU A;  1IW7 F;  4CDG A;  5CVU A;  2FBI A;  1BC8 C;  4MQV A;  2IJL A;  4N9H A;  2CQK A;  4D0P A;  3RYR A;  4UNO A;  4HLY A;  5IT3 A;  3SZP A;  1FC3 A;  1O3Q A;  3VEP A;  1LEB A;  4ENK A;  1UHM A;  3H3Z A;  4A5N A;  4HF1 A;  3MZH A;  3DFG A;  1BI3 A;  2A6H F;  5LEJ A;  5FFX A;  4BQA A;  1XGS A;  3IL2 A;  2GWR A;  4XRF A;  2Z9O A;  1USS A;  3P9K A;  2G9W A;  2D2W A;  3TOA A;  4MEY F;  5BPD A;  1ONV A;  2XRO A;  3LST A;  2JTV A;  2DW4 A;  2HFH A;  1LEA A;  1Z9C A;  4JK1 X;  2A69 F;  1OYI A;  3V7C A;  3HUG A;  1H9G A;  1BC7 C;  3R4K A;  5KVR A;  2EJR A;  4A0Y A;  4HQE A;  1QNT A;  1IRF A;  5IT9 K;  4M72 A;  2ZME A;  1OMI A;  1MDM B;  3C3W A;  1J75 A;  2HQN A;  2LKP A;  2PLY A;  2D1V A;  1QQI A;  5D6E A;  2Q2E A;  1CGP A;  5K5Q A;  3KEQ A;  3PFI A;  3WTZ A;  2VON A;  4CXF A;  2MLK A;  1JGS A;  3KLN A;  2STT A;  2GAU A;  1XDU A;  3F8B A;  2XRN A;  3DF8 A;  3WTU C;  5FD5 A;  4I0A A;  4WX9 A;  5J8F A;  1DUX C;  2HWV A;  1STZ A;  5ILV A;  1QBJ A;  2HKX A;  3DP7 A;  4ASN A;  4EGZ A;  3ISP A;  3TQN A;  3K1N A;  1FP2 A;  1KU9 A;  4GGG A;  1J0R A;  1KU3 A;  4MNU A;  2LDU A;  3NRV A;  1I6X A;  5DYM A;  4A6E A;  1BIA A;  2H6C A;  1ZAO A;  5BPI A;  4YIF A;  3WTV C;  2HOE A;  1OYW A;  2L4M A;  4I0B A;  4EM2 A;  5FD6 A;  1MD0 A;  3BRO A;  1ZN2 A;  3BOQ A;  2HS5 A;  2RNJ A;  3QU6 A;  1FYM A;  5HS7 A;  4ZYE A;  3HSR A;  1YS6 A;  3KP5 A;  2V1D A;  3RI4 A;  2MLG A;  4KIG A;  3TKY A;  3HSE A;  3CO6 C;  4IRI A;  4KYW A;  1FT9 A;  2VE9 A;  4KFC A;  2MH9 A;  3M1E A;  1BI1 A;  3WTS C;  1XCB A;  2L02 A;  3EUH A;  2IVM A;  2MH2 A;  3KP4 A;  1I1G A;  4Y15 A;  2XHK A;  1BM9 A;  4HX4 A;  3CLO A;  4QLC U;  2P5L C;  3I0T A;  3EYI A;  2XV4 S;  1QZY A;  3KP7 A;  2DFI A;  1RZ4 A;  1DPR A;  1ZGJ A;  1GXQ A;  2Z99 A;  1DDN A;  1D5V A;  1O57 A;  1Y0U A;  1L0O C;  2OBP A;  4LMY A;  2ZKZ A;  2O0Y A;  3I71 A;  3JAM K;  3FXR A;  3QAH A;  4S05 A;  3K9T A;  3P9I A;  2ZCW A;  3VOE A;  3O6B B;  1ZG5 A;  3Q9S A;  1WWX A;  3V8J A;  4G7O F;  4P96 A;  4LGW A;  2VOP A;  4K2E A;  5FB2 A;  2VN2 A;  3L09 A;  5A2Q K;  1IN7 A;  2GXG A;  2EA4 A;  2XUB A;  1R5H A;  2KJC A;  2NNY A;  4G9Y A;  4AD9 A;  3ERE D;  3KP6 A;  1O3T A;  4ZZL A;  1U5T B;  3IRR A;  1ZG1 A;  1FZP B;  4R79 A;  4A2U A;  2FQ3 A;  4EJW A;  3ULQ B;  1DPU A;  3HOT A;  3L2C A;  2DO7 A;  1PUE E;  3EYY A;  4ETS A;  3RYP A;  3L00 A;  5BOX A;  2OQG A;  2E1N A;  3K1P A;  3COA C;  1VTN C;  5LGU A;  3DKW A;  2L4A A;  3GEZ A;  4DNC A;  4RAY A;  2ESH A;  1LNW A;  5DCM A;  1KU2 A;  2M8E A;  1YS7 A;  2FBK A;  3WE2 A;  3HSF A;  4P55 A;  2BYV E;  5CJ9 A;  1I1S A;  2STW A;  5EEH A;  3F8N A;  4BXU A;  3ZQ7 A;  1HBX G;  1WRJ A;  2OA4 A;  1UST A;  3F72 A;  1PP8 F;  1KYZ A;  5HLI A;  1GHC A;  1R22 A;  3R6S A;  3GUD A;  2Y48 A;  3DXJ F;  3JTG A;  2H94 A;  3E6M A;  4L9N A;  2PN6 A;  2ZO4 A;  2DQR A;  2JPB A;  1YW7 A;  2J5P A;  1X3U A;  2OD5 A;  4WF2 A;  3CUQ B;  4Z2Y A;  1JHH A;  4L9V A;  3CJN A;  5FLX K;  1SD6 A;  2MBF A;  2DPU A;  2RQP A;  2Z33 A;  2R7D A;  2OAZ A;  5HDN A;  1FBU A;  1ZLJ A;  1RNL A;  1TQM A;  3JTH A;  2XAQ A;  4N0B A;  3GFM A;  1AWC A;  3DV8 A;  3HIF A;  5AIQ A;  1QZZ A;  3MFK A;  2EWN A;  3U1D A;  2PFB A;  3O2P E;  4AWX B;  1KU7 A;  4DQ2 A;  1BJA A;  4KT5 C;  1IN5 A;  2PQ8 A;  5IT9 Z;  1ZRE A;  2DQL A;  4EVI A;  1HW1 A;  3ZMZ A;  2K27 A;  3W6K B;  3LAJ A;  2O3F A;  2HYF A;  4L9J A;  3TO7 A;  1LVA A;  4RGU A;  3F23 A;  5EEG A;  3CUO A;  4H0E A;  2IW5 A;  2W25 A;  3FXQ A;  3ML6 A;  4Q4Z F;  4BH9 A;  4I09 A;  1XGM A;  4ESB A;  5HVQ C;  4A0X A;  1B4A A;  1DP7 P;  4R8H A;  1CF7 A;  2IA1 A;  2Z3Y A;  3IRQ A;  2VOO A;  3M8F A;  2EK5 A;  2Y0M A;  1B1B A;  3E5U A;  4UV9 A;  3WGI A;  4LK0 F;  2A5Y B;  2F2E A;  4U0Y A;  1R1T A;  1S3J A;  2RC4 A;  2V6C A;  4CGZ A;  4RAZ A;  3FM3 A;  3EET A;  1YW9 A;  1QPM A;  3GX4 X;  4L0Z B;  1B9M A;  4BNC A;  3R61 A;  1J9I A;  1T39 A;  1Z1D A;  1NHA A;  2NRA C;  3SHF A;  5BS6 A;  3FF5 A;  1HKS A;  3F8M A;  2XAJ A;  1IN6 A;  1J2X A;  1FYL A;  1P92 A;  3MAJ A;  1ZAR A;  4I7H A;  3ZN0 A;  1ZGA A;  2UXX A;  3E5X A;  4HW0 A;  1B9N A;  3E5Q A;  1FY7 A;  1TNS A;  5L3C A;  5D5V B;  4EJV A;  3LQQ A;  5ED4 A;  3Q5F A;  4PGG A;  4NB5 A;  1FYK A;  3R0J A;  2ETH A;  2RDP A;  3G3Z A;  3HHG A;  5E18 F;  3F22 A;  1K78 A;  4G6Q A;  1TQP A;  2OQR A;  2XGX A;  1ZRD A;  4HF0 A;  4ZYH A;  1O3R A;  4OMY A;  2KIU A;  1HW2 A;  4A0Z A;  1MKM A;  4HQM A;  1R1U A;  2FNP A;  4EV0 A;  3GW2 A;  2ADU A;  3ROU A;  2FRH A;  2X0L A;  1FP1 D;  2P5K A;  3GFL A;  2VOD A;  2QBY A;  4E70 A;  2ZNZ A;  1FLI A;  3BPX A;  2VBY A;  3WG9 A;  1R1V A;  5LGN A;  3LQR A;  1KA8 A;  4B09 A;  2V1U A;  4HF2 A;  4CO8 A;  3J80 K;  4ZYD A;  1XMK A;  5CVV A;  4P9F A;  5K5R A;  2JT1 A;  3ELK A;  4G7Z F;  2K02 A;  2PJP A;  1FPQ A;  1SMY F;  4HX7 A;  1YIO A;  3HHH A;  1T0F A;  2F5E A;  4IPA A;  3GFJ A;  5F6F A;  4WXD A;  3RTR A;  2O6G E;  1O7F A;  4RGR A;  4HA8 A;  3D0S A;  1T38 A;  2HEO A;  1T98 A;  2LSO A;  1F9N A;  4BHP A;  1Z7U A;  3GVA A;  1FSE A;  4EGY A;  2DI3 A;  1HST A;  2QLZ A;  4OU0 A;  4LLL A;  4LG0 B;  1XMA A;  4ZH4 F;  3RKW A;  4ZZD A;  2X4H A;  1MJA A;  2A6E F;  2XIG A;  1P4A A;  3SQN A;  4MQ9 F;  5FFZ A;  3ZMT A;  2JRT A;  3V4G A;  2OZU A;  5DDG A;  4WK8 F;  2E7W A;  3KZY A;  4KA4 A;  3BZ6 A;  2EFN A;  2F5F A;  4KMF A;  4O5V A;  3FHZ A;  3FX3 A;  4M71 A;  4M6Y A;  5HS9 A;  5CVI A;  3WTX C;  1XB4 A;  2F5D A;  2LNB A;  3ABT A;  1ZG3 A;  3IWZ A;  3K1M A;  1G4D A;  4EJO A;  1XSX A;  2ELH A;  1ZHF A;  4A12 A;  4FT8 A;  2O03 A;  1YYV A;  4RS8 A;  1ZH5 A;  1GXP A;  4IHS A;  4YFN F;  1EH6 A;  4LFU A;  4UVC A;  1UFM A;  2NS0 A;  1TTY A;  2VBW A;  2VT2 A;  2QYO A;  1O7L A;  2W84 A;  3RKX A;  2K7L A;  3ZPL A;  4G7H F;  2LF7 A;  5K5O A;  1J59 A;  2VBZ A;  2V79 A;  4CZZ A;  4RB1 A;  1XSV A;  2P7C B;  4M6X A;  2ZXJ A;  2HYG D;  3J81 K;  5AON A;  1OPC A;  2A61 A;  4ENM A;  5D8K B;  1G6N A;  3QU3 A;  5BQT A;  1ZLK A;  4HX8 A;  3SXY A;  1YG2 A;  5L3B A;  5ICG A;  5HDG A;  2L01 A;  4G8X A;  3GYH X;  4YG2 F;  4PGH A;  4UVA A;  2HTJ A;  5D5U B;  1Z6T A;  3QP6 A;  1LB2 A;  1U6G A;  2ISY A;  1H0M A;  1BBY A;  4IHT A;  1S29 A;  3B73 A;  4M9X A;  4AIK A;  2CW0 F;  4EJT A;  4YFX F;  4EM0 B;  4OIP F;  4EQQ A;  4KN4 X;  3WTT C;  3RIR A;  4O6J A;  2PG4 A;  3FXU A;  3U2R A;  4ON0 A;  3IC7 A;  4M73 A;  1SMT A;  3I64 A;  2KJB A;  4LK1 F;  2FML A;  2BV6 A;  2PEX A;  5DD4 A;  3ZMU A;  4Y13 A;  2BGC A;  2AXL A;  2QZ8 A;  5J6X A;  2O8X A;  2IRF G;  2NAZ A;  3V8K A;  1JXS A;  3KLO A;  3GLX A;  1I5Z A;  1YW8 A;  5H6Q A;  4N9I A;  3HRT A;  3T1B A;  3ECH A;  4UVB A;  4S04 A;  3GXO A;  4P5O A;  3BDD A;  2FEZ A;  1F5T A;  4Q48 A;  2KRF A;  3MWM A;  3SFZ A;  2IA0 A;  4WCG A;  2PMH A;  3QP5 A;  3F3X A;  2BE5 F;  3M8E A;  1E2X A;  4Y17 A;  1MDM A;  3FMQ A;  4PDK A;  1ULY A;  3H3U A;  4XBF A;  3FMS A;  3L9F A;  2VXZ A;  5ERI A;  2FE3 A;  3L7W A;  1U8R A;  2WTE A;  1S7O A;  1J5Y A;  3D5L A;  1U2W A;  4YFK F;  4M9Z A;  1R36 A;  3VB2 A;  2M45 A;  4AVP A;  2COM A;  3K2Z A;  2DU9 A;  4FX4 A;  1XSD A;  1W5T A;  2XVC A;  2L54 A;  3BWG A;  2MD5 A;  1V4R A;  1P4W A;  2GZW A;  3HOS A;  2ZNY A;  5ICC A;  2UXN A;  1L3L A;  2QVO A;  1W5S A;  3ECO A;  2VC1 A;  1D3Y A;  2D45 A;  2XKP A;  2QQ9 A;  1Z05 A;  4LLG F;  4IXA A;  3MZY A;  3U9G A;  4M9S A;  2EV0 A;  1KGS A;  5FGM A;  4U7B A;  1TQI A;  4BYY A;  1HKQ A;  2DBB A;  2L3D A;  1C0W A;  1RIO H;  4IVN A;  2HZT A;  3LA7 A;  1XN7 A;  1FSH A;  1G3W A;  1P4X A;  3QPT A;  1IN4 A;  3BP8 A;  1QO0 D;  1HKT A;  4AIH A;  5JI6 A;  3KP2 A;  3V7S A;  2OZ6 A;  4L9T A;  5LHG A;  2IP2 A;  4BAY A;  4BHC A;  4KNY A;  1E17 A;  1FNN A;  3BY6 A;  2R3S A;  3NQO A;  3O3K A;  4GXO A;  4GYI A;  3KP3 A;  4NQW A;  5F64 A;  3EQL F;  1U5T C;  2EFW A;  3ABU A;  1H9T A;  2M30 A;  2K4B A;  4FX0 A;  5E20 A;  3ZN1 A;  3HRS A;  4L18 B;  1LJ9 A;  1R58 A;  2RVC A;  2EV5 A;  5DV5 A;  4I01 A;  2CGP A;  1R23 A;  2JSC A;  3GF2 A;  5JFR A;  2IT0 A;  4MTE A;  3FMR A;  5LLQ A;  3R60 A;  3ZP5 A;  2EV6 A;  2YPR A;  3REO A;  5L3D A;  1W7P B;  2YX7 A;  4B8X A;  4M74 A;  4FHT A;  1B6A A;  1SFU A;  3MQ0 A;  2DAO A;  2VT3 A;  5E17 F;  3BJ6 A;  3F6O A;  3N4M A;  5TJJ A;  4G94 A;  1YLF A;  2CG4 A;  5LGT A;  2QEN A;  1IUY A;  1RI7 A;  4L0Y B;  2G7H A;  3HTS B;  5ILU A;  1HQC A;  3I59 B;  1F1Z A;  1S6L A;  1U5T A;  3S2W A;  1IRG A;  4UV8 A;  4GYG A;  3E6D A;  1REP C;  3CUQ C;  4HDU A;  3HRM A;  2ZFW A;  4L5J A;  2CO5 A;  1RUN A;  2F5C A;  2W85 A;  4GCV A;  3SZT A;  6PAX A;  2E1C A;  1D8J A;  1ON1 A;  2V9V A;  2QM3 A;  2P6T A;  3LFK A;  3TO6 A;  4PZJ A;  1KQ8 A;  3WU1 B;  3F8C A;  4RB0 A;  1SFX A;  2DTR A;  4OMZ A;  3K0L A;  3EDP A;  1W4M A;  4CHU A;  3T5X A;  2MC3 A;  3K69 A;  1FX7 A;  3ZMD A;  1IAW A;  3PQJ A;  2VC0 A;  1WQ2 A;  1RUO A;  1TBX A;  4YII A;  2HDC A;  1TW2 A;  4WXC A;  1Z6R A;  3JAM Z;  5D5W B;  3WTW C;  4JQF A;  1W7P D;  2H09 A;  1BIB A;  2CWE A;  3WGG A;  3J7A O;  2ZJ2 A;  3F21 A;  1R7J A;  1XGN A;  3CUQ A;  1XD7 A;  1EV7 A;  3IKV A;  1MZB A;  3T8T A;  2Q0O A;  2M5W A;  2J5O A;  5FO5 A;  4ESJ A;  5E8G A;  3MCZ A;  5DUI A;  1AOY A;  5A2Q Z;  5DCF A;  1UCR A;  1ODD A;  3T0Y A;  4OOI A;  1T6S A;  2JZY A;  1MJB A;  5ICE A;  2PI0 A;  2FMY A;  2FU4 A;  2DPD A;  5E1X A;  3TO9 A;  5JHU A;  4HOB A;  2WV0 A;  2H6B A;  3I4P A;  3WE3 A;  2QQA A;  1B59 A;  2FNA A;  3E3V A;  5HOO A;  3BJA A;  2KKO A;  4XLN F;  3CDH A;  1IF1 A;  2DT5 A;  2WWY A;  2PBI A;  3M9A A;  5F1R A;  3BPV A;  1KYW A;  2W24 A;  3KET A;  4KIC A;  2A07 F;  1W7P A;  2WC2 A;  5CVR A;  1BI0 A;  3JSO A;  1FBQ A;  4JBA A;  4KIB A;  2XKO A;  2RGV A;  4KMU X;  4Q5S F;  2Y75 A;  5JVT A;  3IHU A;  5ICF A;  4MEX F;  5E1Z B;  4HLX A;  2O61 A;  5CVJ A;  5HLG A;  3I54 A;  5DCM B;  3HRU A;  5TRD A;  2FBH A;  5DUK A;  4I98 B;  2RKH A;  1A04 A;  4RGS A;  1S7A A;  1IN8 A;  2P5V A;  1YTY A;  4OIO F;  3M7G A;  3RPU A;  2G7U A;  4I02 A;  3KEO A;  3I59 A;  3JSP A;  3E97 A;  3HYI A;  5FLX Z;  2ESN A;  2R7F A;  1ZRF A;  3IKT A;  3LAP A;  1IXR C;  1JHF A;  2YU3 A;  1G3S A;  4IF4 A;  3T8R A;  1S8N A;  1XCV A;  3LWF A;  1ON2 A;  1UB9 A;  1YFH A;  1JE8 A;  2FSW A;  4ESF A;  3FZV A;  1EH7 A;  2KIF A;  3AAF A;  1SD4 A;  2K4J A;  1BI2 A;  4KIF A;  1G3Y A;  4OIQ F;  1Z91 A;  2PMU A;  5L3E A;  4UXN A;  3W6J B;  1P2F A;  4XSX F;  2YX4 A;  3FWE A;  3C18 A;  5D4S A;  5D4R A;  2EFP A;  4LLN A;  1PDN C;  2M87 A;  4MHG A;  5LHI A;  1K79 A;  5D5X B;  2QUF A;  3I5U A;  4I2O A;  1OR7 A;  3OV8 A;  2EFO A;  2FXA A;  2FOK A;  1MJ9 A;  2QWW A;  3KCC A;  4HZF A;  2GQQ A;  1Q1H A;  4GO1 A;  5HS8 A;  4EM1 A;  4LB5 A;  1TW3 A;  2TDX A;  3RKY A;  3R0A A;  3TDZ C;  2IPQ X;  4ENN A;  5CLS A;  4KN7 X;  5LEK A;  4BHB A;  1MGT A;  2GIV A;  1GVJ A;  4A5M A;  1XGO A;  5L3F A;  4U0V A;  1BN5 A;  4UHT A;  3I58 A;  4OIN F;  4WWC A;  2CSO A;  4KDP A;  2XAS A;  1UHW A;  2YSR A;  4HV5 A;  5E1W A;  2P6S A;  2GA2 A;  1SAX A;  1O3S A;  2CFX A;  3MEX A;  4CIC A;  3P7N A;  3N97 A;  3IWF A;  4G6D A;  1HXD A;  1P6R A;  3P9C A;  1CF7 B;  1ZRC A;  2ZBK A;  3WTY C;  1OYY A;  1KQ9 A;  1OKR A;  2W57 A;  1BOA A;  3H92 A;  2A3S A;  4AIJ A;  4L5I A;  3QOP A;  4ENJ A;  2RV8 A;  3V8L A;  2OU2 A;  3TGN A;  1XDS A;  1SD5 A;  1SFE A;  2HR3 A;  2HKO A;  4NHJ A;  3WGH A;  4UUV A;  4PCQ A;  2DK5 A;  4LG0 A;  5H6R A;  2XAF A;  3DPL C;  5JR3 A;  2UZK A;  5BMZ A;  3CTA A;  2FF4 A;  2P8T A;  4QWQ A;  2K86 A;  4P9U A;  1ZYR F;  1V3F A;  3RJP A;  2NNN A;  4U0W A;  2ISZ A;  2EB7 A;  3E6B A;  4IRG A;  3PQK A;  4RGX A;  1K78 B;  1WI9 A;  4KUM A;  2Z5U A;  1F4K A;  1U78 A;  4EMS A;  5LHH A;  4LB6 B;  4HV6 A;  5DEQ A;  3J80 Z;  3C1D A;  4MTD A;  4XLP F;  2V1X A;  5H20 A;  2VBX A;  3DPT A;  3GFI A;  3QRF F;  5D8L B;  1R00 A;  3E6C C;  4TV7 A;  1J7K A;  5HDK A;  1EH8 A;  2AS5 F;  2QBY B;  2GXB A;  4IRH A;  3ZMV A;  4EJU A;  1U3E M; 
#chains in the Genus database with same CATH topology
 1IXC A;  5DD8 A;  2C6Y A;  1IXS B;  5KHD A;  1T08 B;  5KK1 A;  3UR3 C;  5C3E J;  4D9J A;  3EPZ A;  1X1B A;  2HXI A;  2R93 J;  3IP4 B;  3Q9V A;  2BEO A;  1RPW A;  1LDD A;  1IV8 A;  3G73 A;  1GUU A;  1LDJ A;  2L9N A;  4BKX A;  2IA2 A;  3FM5 A;  4B1R A;  5JLW A;  3PM1 A;  5J8C A;  5FLV A;  4CYC B;  3TDU C;  1KQ0 A;  1HSJ A;  3GME A;  1I27 A;  3KE2 A;  2E7X A;  2D1H A;  2KRH A;  2NS7 A;  4HDV A;  2BBY A;  2V1N A;  4QTR A;  1WKM A;  2YR2 A;  3F8F A;  4RB2 C;  2XSD C;  4C30 A;  1Y0N A;  2UWM A;  2CQN A;  2MA3 A;  4XMY A;  2JPC A;  2A6T A;  4U88 A;  1N77 A;  4F7Z A;  2A05 A;  3JW4 A;  1B8I B;  1WSU A;  3OR1 C;  2V6E A;  2DT7 B;  3GZ5 A;  3BR3 A;  5LBQ A;  3KEY A;  2B0L A;  1SD7 A;  2A68 F;  5HLH A;  2HDD A;  3OOP A;  2K9L A;  1LQ1 A;  1LFB A;  4PFO A;  2H27 A;  2DLL A;  2LY9 A;  2NXN B;  1RKT A;  3QPH A;  5CYV A;  1BR2 A;  1Z7L A;  1FBS A;  2KIM A;  5E8I A;  1HW5 A;  2ACJ A;  1QZE A;  1YIJ I;  3B02 A;  4XLE A;  1LDK B;  2XAG A;  4HBL A;  2QQB A;  1E3P A;  3DEU A;  3IH2 A;  1UG2 A;  4CYD A;  3BG5 A;  3VFZ A;  1Y8Q B;  3BC8 A;  4XSZ F;  3LA2 A;  2L7K A;  4D1Q A;  1JUM A;  3MZ8 A;  4KT6 A;  4HAM A;  2DMT A;  2ZME B;  4R1H A;  1MBF A;  3PSI A;  4XOT A;  2QSH X;  5D6F A;  1XS9 A;  3OYN A;  4HRI A;  3BG3 A;  3FKI J;  1QGP A;  1XMX A;  3GWZ A;  4IQ4 A;  1JKP C;  3BLY A;  3KFW X;  2XAH A;  2N8G A;  2Q2E B;  4XID A;  2JK3 A;  2ZSI B;  1K7A A;  4V19 K;  2CYY A;  2EFQ A;  4I99 C;  4O3M A;  3X2Q H;  2H1L A;  3WU0 A;  5TIS C;  1D8K A;  2NYX A;  3GO5 A;  1A31 A;  4JYK A;  4LD5 A;  3DQV C;  3RPQ A;  2AQF A;  2NS8 A;  4WXH A;  3TOB A;  2AQE A;  2HGC A;  3ERM A;  1YQA A;  2KT0 A;  1YO5 C;  2P7V B;  2P4W A;  3G4S I;  4Q47 A;  4C3I J;  2DK8 A;  2XB0 X;  4XKV A;  3RDI A;  3VYR B;  4M6V A;  2HTS A;  5LRS A;  2QGU A;  3OIO A;  2CV0 A;  2RRE A;  3C2B A;  4HYE A;  2OCC H;  3V7R A;  1S9H A;  4UB6 C;  3I9V 2;  1PP7 U;  5LRR A;  3KYC B;  2HQR A;  5K1Y A;  2Y0S N;  2YUS A;  1DGW Y;  4ZYG A;  3VOD A;  3LA3 A;  1ZGW A;  3WOD F;  1T56 A;  2Q8K A;  5J47 A;  2RN7 A;  1SEU A;  4MGR A;  1RC9 A;  2K9Q A;  2LBF B;  4C2T A;  2A5W A;  3WHB A;  2F5V A;  3FHN A;  3J81 Z;  3I53 A;  3F6V A;  1D0X A;  1TLH B;  3HTU A;  4OIR F;  3C7J A;  2DA1 A;  3KZZ A;  4D7M A;  5L3G A;  5AIP A;  2EA2 A;  4I6Z A;  4A6D A;  3GZ6 A;  2VL8 A;  1QVU A;  1FOK A;  5ILS A;  4C9Y A;  3N05 A;  1X1A A;  3DTK A;  3FIS A;  4A3E J;  1FWZ A;  2XF7 A;  3BJO A;  1R5G A;  3BTC A;  3PNY A;  1ETQ A;  2UUZ A;  4PK4 A;  1IZ1 A;  2VE8 A;  4U7D A;  3S17 J;  3A2K A;  1TNT A;  1K6O A;  2LF8 A;  4F52 A;  4RB3 C;  1V54 H;  4ZDP A;  1G3T A;  1T2K A;  3ZMS A;  4MLO A;  4IJA A;  3OYK A;  3CO7 C;  1TWH J;  4LJZ F;  2M1B A;  2DTZ A;  3S1M J;  2IGN A;  2ELK A;  4HNV A;  2FA5 A;  2GA1 A;  1YRN B;  3AL0 B;  2CW8 A;  1IW7 F;  3NEU A;  3DBR B;  4CDG A;  4ZJZ A;  2L9S A;  4UUS A;  4OAY A;  5CVU A;  1MBK A;  1FMV A;  2FBI A;  2R92 J;  1BC8 C;  4MQV A;  2IJL A;  5EEA A;  4N9H A;  3CCS I;  2CQK A;  4GRI A;  3J7Z I;  2NVY J;  4D0P A;  3LL7 A;  3RYR A;  4UNO A;  2WAD A;  3RQI A;  4HLY A;  1WHU A;  1D1B A;  3S16 J;  5IT3 A;  2KZG A;  1F43 A;  3U1K A;  3SZP A;  2M7B A;  1FC3 A;  1O3Q A;  3VEP A;  1LEB A;  4ENK A;  4A93 J;  4XRS A;  3MKZ A;  3LSI A;  1UHM A;  3H3Z A;  5FRN A;  4A5N A;  5KAI C;  4A3C J;  4X1E A;  1LFU P;  3QPS A;  4HF1 A;  4CCJ A;  4BUP A;  4BJ5 C;  3MZH A;  2CW7 A;  1MW7 A;  3CP2 A;  2VIX A;  3DFG A;  3CJT B;  1BI3 A;  5JLX A;  2A6H F;  3DEE A;  3H5N A;  4J01 A;  5LEJ A;  2BW3 B;  2DOF A;  2KMU A;  5FFX A;  3FXM A;  1XGS A;  2DOD A;  3LSH A;  3IL2 A;  4BQA A;  1GV5 A;  2GWR A;  4Y52 J;  4XRF A;  1O4X A;  2Z9O A;  1USS A;  3MKW B;  3MD2 A;  4OWR B;  2ZJR F;  4B3A A;  1QRY A;  3P9K A;  3OL3 A;  1QA6 A;  2G9W A;  2D2W A;  3TOA A;  3UKG A;  4MEY F;  5BPD A;  1ONV A;  3LST A;  2XRO A;  2JTV A;  2DW4 A;  2HFH A;  2I8D A;  2LLK A;  1LEA A;  1MNE A;  4ZYA A;  4IHX A;  2VKH A;  3DU6 A;  2XPW A;  4B4C A;  1Z9C A;  4JK1 X;  3NAR A;  3JRD A;  1AKH B;  3S93 A;  1JKO C;  1FIA A;  2A69 F;  1OYI A;  3V7C A;  3HUG A;  1H9G A;  3LMM A;  2GXA A;  5GPA A;  2CUE A;  1BC7 C;  1Z21 A;  1WI3 A;  1F36 A;  3R4K A;  3H9J A;  2WB1 N;  2JA8 J;  1WJD A;  5H2F C;  2OTJ I;  2DA2 A;  3BR5 A;  5KVR A;  4M3F A;  4BBR J;  2EJR A;  1I3Q J;  5FRO A;  4A0Y A;  2AO9 A;  3DEW A;  4HQE A;  5E3O A;  1ZEL A;  3CJQ B;  1QNT A;  5BNG A;  1IRF A;  5IT9 K;  4AVZ A;  4M72 A;  4S0H B;  2ZME A;  5DM6 F;  2E71 A;  1OMI A;  5IOZ A;  3DU5 A;  1MDM B;  2VKV A;  4RBO A;  2ELJ A;  2ZXI A;  3C3W A;  4C2M J;  4M3G A;  4A3G J;  1J75 A;  4XLF A;  4ZC3 A;  2OCE A;  2HQN A;  4BQN A;  2LKP A;  2PLY A;  2D1V A;  1QQI A;  2HI3 A;  4AUX A;  3HOW J;  5D6E A;  2Q2E A;  4RLQ A;  3ZGK A;  2AHQ A;  1EA3 A;  1NK2 P;  1CGP A;  5K5Q A;  1G2H A;  2L7M P;  3KEQ A;  3PFI A;  2LR8 A;  3WTZ A;  2VON A;  3K4C A;  1MMN A;  4CXF A;  3HEF A;  1VI0 A;  2MLK A;  2X85 A;  4Y33 A;  1JGS A;  2X51 A;  2DA4 A;  3FXO A;  1LE8 B;  3KLN A;  2STT A;  2GAU A;  4PJJ A;  1XDU A;  3F8B A;  4RAG A;  3TL4 X;  2XC7 A;  1K4T A;  3FBN B;  1VQK I;  2MFZ A;  4BBS J;  1OR7 C;  3UNG C;  2XRN A;  3F9K A;  5JVG F;  1R4M B;  4F91 B;  1XX5 A;  3DF8 A;  5GAE J;  3G6E I;  3EUH C;  2BY3 A;  1Y6I A;  3WTU C;  4DYQ A;  5FD5 A;  1VFC A;  2ECB A;  2W4S A;  3MN2 A;  4I0A A;  4WX9 A;  5J8F A;  1DUX C;  2EZL A;  1X1P A;  2HWV A;  1STZ A;  2QF7 A;  3HJE A;  1CQT A;  2CJJ A;  1PUF A;  5ILV A;  1QBJ A;  3CCM I;  2HKX A;  3DP7 A;  4ASN A;  4EGZ A;  3S3M A;  3ISP A;  3RKQ A;  2JN6 A;  3HZJ A;  3TQN A;  2LBF A;  3FDY A;  1NH3 A;  3K1N A;  1FP2 A;  1KU9 A;  3IAM 2;  4GGG A;  1J0R A;  3FIW A;  3TMO A;  1KU3 A;  2BHY A;  4MNU A;  2BOL A;  4IZZ A;  3D5R C;  1WZ2 A;  2LDU A;  3NRV A;  1I6X A;  4UUT A;  5DYM A;  4A6E A;  4XLC A;  1BIA A;  2H6C A;  1ZAO A;  3G71 I;  2E1O A;  2M7A A;  3OYB A;  4YIF A;  5BPI A;  3WTV C;  2HOE A;  1OYW A;  2L4M A;  1MND A;  2JVG A;  5M5X J;  4I0B A;  2MG4 A;  4EM2 A;  5FD6 A;  3BQZ A;  1MD0 A;  5IP7 J;  3BRO A;  3K70 D;  1ZN2 A;  2B9S A;  3BOQ A;  3K10 A;  2PMZ A;  2HS5 A;  2RNJ A;  5GPC A;  1XTA A;  3QU6 A;  1FYM A;  5HS7 A;  4ZYE A;  3HSR A;  2DA6 A;  1YS6 A;  3KP5 A;  2V1D A;  4BEH B;  2MLG A;  3RI4 A;  4KIG A;  3TKY A;  3BT9 A;  3HSE A;  3HPG A;  4IHW A;  2WY8 Q;  2PX9 A;  4F3Q A;  5E3N A;  2B7E A;  4XK4 A;  3CO6 C;  4IRI A;  4KYW A;  1IO2 A;  3FXJ A;  2K9M A;  1FT9 A;  4HG2 A;  2VE9 A;  2F6C A;  3OYA A;  3S32 A;  4KFC A;  2LVS A;  2MH9 A;  2ID6 A;  1R49 A;  2JSP A;  3CMY A;  2JA5 J;  3M1E A;  1BI1 A;  3WTS C;  3CDI A;  1XCB A;  5IP9 J;  2DDB A;  2L02 A;  2LTP A;  3EUH A;  3OY9 A;  3HXL A;  2IVM A;  2MH2 A;  5F0C A;  1U0J A;  2M34 A;  2JA7 J;  3KP4 A;  2IS1 A;  3HBL A;  4BE1 A;  1I1G A;  3RZD J;  4Y15 A;  2XHK A;  1BM9 A;  2IBD A;  4HX4 A;  1ZR4 A;  3CLO A;  1Z77 A;  4QLC U;  3FKJ A;  2P5L C;  3I0T A;  5B66 C;  3EYI A;  2E2J J;  2XV4 S;  1QZY A;  3M4O J;  3BG9 A;  3KP7 A;  2DFI A;  3FK6 A;  2O7O A;  3PFY A;  1V55 H;  1RZ4 A;  1DPR A;  4BL0 B;  1TL8 A;  4BGD A;  1ZGJ A;  1GXQ A;  1JTY A;  2GOX B;  2Z99 A;  1DDN A;  2BY0 A;  1H88 C;  1MIJ A;  1D5V A;  1O57 A;  1Y0U A;  1L0O C;  2OBP A;  4LMY A;  2ZKZ A;  2R7R A;  2O0Y A;  4Y7N J;  2BVL A;  3I71 A;  4UB8 C;  3JAM K;  2ME6 A;  2DYR H;  3FXR A;  2QSF X;  2L7Z A;  3QAH A;  3HG9 A;  3BCA A;  1YHQ I;  2RQQ A;  4S05 A;  3K9T A;  1APL C;  2BW3 A;  3DBL B;  2KP6 A;  3GCM A;  3P9I A;  2Y2Z A;  4H4K C;  5IYC J;  2ZCW A;  3VOE A;  3O6B B;  3PJR A;  1ZG5 A;  3S1Q J;  2VKE A;  3DWL E;  2VI6 A;  2VPL A;  3Q9S A;  1WWX A;  1N75 A;  3V8J A;  4G7O F;  3KX2 A;  4P96 A;  4LGW A;  1ETY A;  2VKD A;  5FKN A;  3DLL F;  2VOP A;  4K2E A;  5FB2 A;  3GTQ J;  1UJ8 A;  2VN2 A;  1ETX A;  3L09 A;  3H1C A;  5A2Q K;  1IN7 A;  3HDD A;  1VQ9 I;  1Y56 A;  4QIW N;  2Y9Z A;  1IUF A;  5DS9 A;  1FJL A;  2GXG A;  2W48 A;  2XPU A;  2EA4 A;  4XKB A;  1OFC X;  2XUB A;  1R5H A;  1UAA A;  5DTD A;  2KJC A;  1JT0 A;  2NNY A;  1ACI A;  5GAD J;  1DU0 A;  4G9Y A;  4AD9 A;  3ERE D;  1I50 J;  3KP6 A;  2EIJ H;  4V2G A;  1O3T A;  3J7A Y;  3JRB A;  4PSW A;  4ZZL A;  1U5T B;  1VF9 A;  3H0D A;  3IRR A;  2DOA A;  1ZG1 A;  1FZP B;  4R79 A;  2Z16 A;  5C4J J;  4A2U A;  1YJN I;  3RSN A;  1OIS A;  2LH9 A;  2FQ3 A;  4EJW A;  3ULQ B;  4XQF A;  1DPU A;  1ETK A;  4QPQ A;  2VJI A;  3HOT A;  1RKW A;  2ICW G;  2X1C A;  3L2C A;  2DO7 A;  4QPO A;  2E5Z A;  1PUE E;  3EYY A;  2EQR A;  2ZB9 A;  4ETS A;  3RYP A;  1T33 A;  3QYF A;  3L00 A;  3JR9 A;  5BOX A;  2OQG A;  2JUC A;  2E1N A;  3K1P A;  3COA C;  1VTN C;  3ZQH A;  5K7H A;  3DKW A;  2L4A A;  3GEZ A;  5LGU A;  4DNC A;  5M3F J;  4A3J J;  2Y69 H;  3IAS 2;  2JJ7 A;  2WV1 A;  3W2V A;  4BJ6 C;  4RAY A;  3PIP F;  3L2W A;  2ESH A;  2XDV A;  1LNW A;  3W2W A;  5DCM A;  3BTJ A;  4M3E A;  3NWS A;  3M8J A;  1KU2 A;  3CCJ I;  2M8E A;  3HOU J;  3A4C A;  1YS7 A;  1LE8 A;  2VXD A;  5HNF A;  4BDY A;  4A3K J;  2FBK A;  3WE2 A;  3HSF A;  1K83 J;  4P55 A;  1FTT A;  2BYV E;  1SFK A;  5CJ9 A;  1I1S A;  2STW A;  3ABM H;  3AG4 H;  3QPL A;  5EEH A;  3BZC A;  3F8N A;  4D7N A;  1I39 A;  1TWC J;  4BXU A;  1UEL B;  4D5C A;  3ZQ7 A;  4HSR A;  2LY2 A;  3OL4 A;  3TW6 A;  3HOY J;  3H3V K;  1HBX G;  1WRJ A;  4DJA A;  2OA4 A;  4ZTJ A;  1UST A;  1VND A;  3F72 A;  1PP8 F;  3VWB A;  1VQ8 I;  4DW6 A;  1KYZ A;  2R5Z B;  1FMW A;  3Q0W A;  5HLI A;  3CC2 I;  1GHC A;  2WAQ N;  1R22 A;  3R6S A;  5GAG J;  5IOY A;  3GUD A;  2LP0 A;  2Y48 A;  2IS4 A;  3DXJ F;  2D5V A;  3JTG A;  2IEK A;  2V9P A;  3CMM A;  4XRS G;  2H94 A;  3E6M A;  4L9N A;  2PN6 A;  2ZO4 A;  2DQR A;  2JPB A;  1YW7 A;  2MAB A;  5B1B H;  2J5P A;  1A36 A;  5F27 A;  1X3U A;  2DFH A;  3Q3S A;  2XAU A;  1J09 A;  2OD5 A;  1X4P A;  3OR2 C;  4E7H A;  4WF2 A;  1GLN A;  1VQ4 I;  3CUQ B;  4Z2Y A;  1JHH A;  1MMG A;  2EH3 A;  4L9V A;  5FLM J;  3CJN A;  1ZR2 A;  5FLX K;  1UG0 A;  1ERD A;  1SD6 A;  2MBF A;  2DPU A;  2L7F P;  2RQP A;  4NUB A;  2Z33 A;  2R7D A;  2OAZ A;  5HDN A;  4JX4 A;  1FBU A;  3I56 I;  1ZLJ A;  1WJA A;  1RNL A;  1TQM A;  2R7W A;  3JTH A;  1RET A;  4RM3 A;  2XAQ A;  4N0B A;  2F48 A;  1NG6 A;  3GFM A;  4LIV A;  3ESW B;  4E4H A;  1AWC A;  3DV8 A;  5HOD A;  3JCU C;  5K7F A;  3HIF A;  5AIQ A;  1QZZ A;  3MFK A;  4IO9 F;  2X6Y A;  2FUG 2;  1QPI A;  2EWN A;  3U1D A;  3FBI B;  2PFB A;  3O2P E;  2W1O A;  3HGY A;  4AWX B;  1KU7 A;  4PJM A;  4J00 A;  4DQ2 A;  4DZP A;  1A6I A;  1BJA A;  4KT5 C;  2OUM A;  1YOV B;  2PJR A;  1IN5 A;  4UY8 I;  1BW5 A;  2PQ8 A;  1YIT I;  1K61 A;  3CC4 I;  4MIM A;  5IT9 Z;  2VLA A;  1ZRE A;  2VQC A;  2H8W A;  2BVM A;  2M9H A;  3HB9 A;  2WBM A;  4FTH A;  1JJ6 C;  2DQL A;  4EVI A;  5EDN A;  3K6G A;  1HW1 A;  2DDA A;  3CJR B;  3ZMZ A;  1MBH A;  2K27 A;  2MSY A;  1OCC H;  3W6K B;  1PYV A;  3OYD A;  2ZSH B;  3LAJ A;  3HOX J;  4BDZ A;  2O3F A;  4C3H J;  2DFE A;  3L2Q A;  4HEA 2;  2HYF A;  4B47 A;  4L9J A;  2M8G X;  4E7S A;  1ZQ3 P;  3TW7 A;  4KJZ A;  1GDT A;  2R7Q A;  3TO7 A;  2HXO A;  1LVA A;  4RGU A;  3F23 A;  2VJ5 A;  5EEG A;  9ANT A;  3CUO A;  1X19 A;  4H0E A;  3A01 A;  2IW5 A;  2X1E A;  2W25 A;  2CRG A;  2IS6 A;  3K4M A;  2ZJQ F;  2GM4 A;  2V26 A;  1S5L C;  2CQQ A;  3FXQ A;  3ML6 A;  4BY7 J;  4Q4Z F;  2ZXH A;  4YEJ A;  4BH9 A;  2M4G A;  4I09 A;  1XGM A;  4ESB A;  5HVQ C;  4FQG A;  5FRM A;  5FJ8 J;  3K4J A;  2RNG A;  4A0X A;  2R7Z J;  1B4A A;  1DP7 P;  2IS2 A;  4R8H A;  5CPR B;  1CF7 A;  2IA1 A;  2Z3Y A;  3IRQ A;  2VOO A;  2V4J C;  3RZO J;  3M8F A;  2EK5 A;  2Y0M A;  1B1B A;  3E5U A;  4UV9 A;  5EZH A;  3WGI A;  2VQG A;  4IQJ A;  1JJ8 C;  4LOC A;  4LK0 F;  2A5Y B;  2F2E A;  4U0Y A;  1R1T A;  1XC5 A;  1S3J A;  2RC4 A;  2V6C A;  5TGT A;  4RAZ A;  1PJR A;  4CCN A;  4CGZ A;  3FM3 A;  4XNF A;  3GTK J;  3IH3 A;  3EET A;  1VQ6 I;  1YW9 A;  1QPM A;  3G1O A;  2XGC A;  3GX4 X;  1JGG A;  4L0Z B;  1JT6 A;  1B9M A;  1PVE A;  3OYC A;  4BNC A;  3R61 A;  1QHH D;  3K2A A;  1WH5 A;  2MYS A;  2QKM B;  3JRG A;  1T39 A;  1J9I A;  1WJ5 A;  3PUF A;  5EYR A;  5EG0 B;  1Z1D A;  1NHA A;  4NBQ A;  5B5E C;  5KAF C;  2NRA C;  3SHF A;  5BS6 A;  2KIQ A;  3H9Q A;  2KRC A;  3SJM A;  4E6K G;  3FF5 A;  1HKS A;  3F8M A;  2XAJ A;  1IN6 A;  1J2X A;  4BS9 A;  1FYL A;  1KON A;  1P92 A;  3MAJ A;  3OSG A;  1X4O A;  2L0K A;  1IV6 A;  1ZAR A;  2BXZ A;  4I7H A;  1NG7 A;  1UZC A;  3ZN0 A;  4XN3 A;  5HLT A;  4BY1 J;  1ZGA A;  2UXX A;  3E5X A;  4HW0 A;  1B9N A;  3E5Q A;  1SVL A;  1IRX A;  1FY7 A;  1TNS A;  5L3C A;  5D5V B;  2GIZ A;  1TWG J;  3L1P A;  4EJV A;  1M1E B;  3LQQ A;  1TWA J;  2E34 A;  5ED4 A;  2HVS A;  3Q5F A;  3SDG A;  4PGG A;  4NB5 A;  4CCO A;  1FYK A;  2JRM A;  2DCE A;  3BCB A;  3R0J A;  2ETH A;  2RDP A;  1A35 A;  1D1C A;  3G3Z A;  1MBJ A;  3HHG A;  5E18 F;  3F22 A;  1K78 A;  4G6Q A;  2NVX J;  1TQP A;  2Z1D A;  1S72 I;  1YJ9 I;  2OQR A;  2XGX A;  4IHY A;  1ZRD A;  1GVD A;  4M3B A;  4HF0 A;  4A3B J;  4ZYH A;  2TRT A;  1O3R A;  4OMY A;  2KIU A;  1W1W E;  4I76 A;  1HW2 A;  1OJL A;  4A0Z A;  3S3N A;  1MKM A;  4NNJ A;  4HQM A;  1R1U A;  2FNP A;  4EV0 A;  3GW2 A;  3DLA A;  2WAE A;  2R5Z A;  2NVQ J;  1IDZ A;  3BG7 A;  2ADU A;  2ZJP F;  4A3L J;  2ZME C;  2GOM A;  3ROU A;  2FRH A;  2X0L A;  1FP1 D;  2P5K A;  3GFL A;  3AKZ A;  2VOD A;  2QBY A;  3C2G A;  4E70 A;  2ZNZ A;  2CV2 A;  1FLI A;  2LOO A;  3BPX A;  3RCO A;  2VBY A;  2EBI A;  2Y0S A;  3WG9 A;  1R1V A;  5LGN A;  3LQR A;  2F4I A;  1KA8 A;  5J40 A;  1DGR M;  1VQM I;  3G1L A;  3CME I;  2Y30 A;  3CQZ J;  1U8B A;  4B09 A;  1B72 B;  3OS0 A;  2V1U A;  4HF2 A;  4AU7 A;  2VUM J;  4CO8 A;  3J80 K;  2R0Q C;  2EIN H;  2DMQ A;  3MKY B;  4ZYD A;  1XMK A;  5CVV A;  4CYC A;  2W7N A;  1MSF C;  2JQ7 A;  2EIK H;  4P9F A;  1A6Q A;  5K5R A;  2JT1 A;  1FOY A;  3ELK A;  4G7Z F;  2K02 A;  3CDL A;  2PJP A;  1FPQ A;  1SMY F;  3G1M A;  4HX7 A;  2P81 A;  1UHS A;  4HST A;  1YIO A;  3RPU D;  1B8I A;  1R6R A;  3NWT A;  3HHH A;  4B48 A;  1ORK A;  1T0F A;  2F5E A;  4IPA A;  3GFJ A;  3HKZ N;  2DA3 A;  5F6F A;  3ASO H;  1MSE C;  2E35 A;  4WXD A;  3RTR A;  2B63 J;  2O6G E;  1O7F A;  3FXK A;  2BY2 A;  4RGR A;  4HA8 A;  1Z3X A;  3D0S A;  1T38 A;  2HEO A;  4PJ0 C;  1T98 A;  2EIM H;  2LSO A;  1F9N A;  4BHP A;  5FKL A;  2DYS H;  1Z7U A;  3GVA A;  4DBR A;  4F93 B;  3OYI A;  1FSE A;  1MBG A;  3E1S A;  3S8P A;  4EGY A;  2K9N A;  2DI3 A;  1HST A;  2QLZ A;  4W1U A;  4RDU A;  3LSP A;  2E2I J;  2R7V A;  1QHG A;  4OU0 A;  4LLL A;  4LG0 B;  1XMA A;  3BTL A;  4ZH4 F;  3RKW A;  3PO3 J;  4XKC A;  4ZZD A;  2X4H A;  1MJA A;  2A6E F;  2XIG A;  1P4A A;  3SQN A;  4MQ9 F;  3ZQF A;  5FFZ A;  3ZMT A;  1JKQ C;  2JRT A;  3V4G A;  2OZU A;  5DDG A;  4WK8 F;  1MMS A;  1R9T J;  2E7W A;  2OC6 A;  3KZY A;  2BHZ A;  2CQX A;  3LNQ A;  3ABK H;  4Y4R A;  4KA4 A;  3BZ6 A;  2EFN A;  2K40 A;  2Q1Z B;  4A3M J;  4CSW A;  3AL0 C;  3L2R A;  2F5F A;  4MO7 A;  4KMF A;  4O5V A;  1Z3Y A;  3FHZ A;  3FX3 A;  3MVP A;  4M71 A;  2XGD A;  4LG3 A;  4M6Y A;  5HS9 A;  5CVI A;  3WTX C;  1XB4 A;  2F5D A;  2NOG A;  3DCF A;  2LNB A;  3SEZ A;  3CCV I;  3ABT A;  1ZG3 A;  2EZH A;  2HDW A;  3IWZ A;  3K1M A;  3D1N I;  3SDB A;  3O8H A;  3LSM A;  2OJE D;  4EJO A;  1XSX A;  2ELH A;  1G4D A;  2XGE A;  1ZHF A;  4C3J J;  2HYJ A;  2X9D A;  4IX7 A;  4A12 A;  3SYT A;  4FT8 A;  2O03 A;  1YYV A;  4RS8 A;  4CCM A;  1ZH5 A;  1GXP A;  4IHS A;  4YFN F;  1EH6 A;  1XPX A;  4LFU A;  4UVC A;  5E79 C;  1UFM A;  2LRD A;  1KZH A;  3H9G A;  2NS0 A;  1WJC A;  1TTY A;  2VBW A;  2VT2 A;  5IY5 H;  2QYO A;  1O7L A;  2W84 A;  4BXX J;  2XF6 A;  2F4O B;  3RKX A;  1FOW A;  2K7L A;  3ZPL A;  4G7H F;  2LF7 A;  5K5O A;  1J59 A;  4CCL A;  2VBZ A;  2V79 A;  4CZZ A;  4RB1 A;  3OYH A;  3A03 A;  3BTI A;  5J4Y A;  2WB1 A;  1LKX A;  4II2 A;  1XSV A;  2ID3 A;  3CES A;  3E7L A;  1G59 A;  2P7C B;  4M6X A;  2O8K A;  1D0Z A;  2ZXJ A;  1RR7 A;  2HYG D;  3J81 K;  5AON A;  1OPC A;  2A61 A;  4AYB N;  2NVU B;  4ENM A;  5D8K B;  1G6N A;  3LSR A;  4YEL A;  3K70 C;  3QU3 A;  3VSK A;  1YRN A;  5BQT A;  4JP0 A;  1ZLK A;  4HX8 A;  1BOB A;  3SXY A;  1YG2 A;  5L3B A;  3ZXS A;  3OSF A;  5ICG A;  5HDG A;  2L01 A;  2E1M B;  4G8X A;  5E3L A;  3FXL A;  3GYH X;  3SZG A;  4PGH A;  4YG2 F;  1X3Z B;  4NQW B;  1MMD A;  4UVA A;  1SVM A;  2ZFU A;  2HTJ A;  3JRA A;  5D5U B;  3GTO J;  4BXF A;  4LIT A;  2R7U A;  1ETO A;  1Z6T A;  2JMW A;  3QP6 A;  4G12 A;  3L2U A;  1BJZ A;  1LB2 A;  1U6G A;  2ISY A;  1RRJ A;  1H0M A;  1BBY A;  4IHT A;  3ZCO A;  1S29 A;  3LFU A;  3B73 A;  3VPR A;  5IYB J;  4M9X A;  4AIK A;  2LYC A;  4W97 A;  3DPU A;  2CW0 F;  5IPA A;  1D1A A;  2OPT A;  4EJT A;  4YFX F;  4EM0 B;  2JA2 A;  1HLV A;  4OIP F;  4EQQ A;  2MC4 A;  5EZG A;  4KN4 X;  4E7J A;  1OLT A;  2JA6 J;  3WTT C;  4NDL A;  3RIR A;  4O6J A;  2PG4 A;  3FXU A;  4FIS A;  3U2R A;  3CF5 F;  3CCL I;  1SAN A;  4U87 A;  4ON0 A;  2ECC A;  3DKX A;  3QOE A;  3BZK A;  3IC7 A;  4M73 A;  2IGM A;  1OCT C;  1VQ7 I;  1SMT A;  1S7E A;  4Y3O A;  3I64 A;  2KJB A;  4FCY A;  2QQ8 A;  3LSJ A;  4BE2 A;  1B72 A;  4LK1 F;  2R7S A;  1FIP A;  2FML A;  1FOX A;  2BV6 A;  2PEX A;  5DD4 A;  3ZMU A;  4Y13 A;  3KZI C;  2BGC A;  2AXL A;  1D5Y A;  2FX0 A;  1E0E A;  3PSF A;  3M3Y J;  2QZ8 A;  5J6X A;  2O8X A;  2LKS A;  3IUO A;  1BA5 A;  2IRF G;  1K6Y A;  1FTZ A;  2NAZ A;  3PL8 A;  3V8K A;  2NVT J;  3JRI A;  1JXS A;  3KLO A;  1AKH A;  3GLX A;  1I5Z A;  2V9K A;  1YW8 A;  1JTX A;  5H6Q A;  4N9I A;  5M3M J;  3HRT A;  3T1B A;  3ZQG A;  3AG3 H;  3ECH A;  4UVB A;  3ZQQ A;  1W0T A;  4S04 A;  1LFP A;  3GXO A;  4P5O A;  3BDD A;  2FEZ A;  1WGX A;  4X0G A;  3GTL J;  1AHD P;  1F5T A;  3ZQI A;  4Q48 A;  2KRF A;  3MWM A;  4PFP A;  3SFZ A;  1W36 D;  2IA0 A;  2MD0 A;  4WCG A;  3S15 J;  2PMH A;  3QP5 A;  4F55 A;  3F3X A;  1UMQ A;  4DYC A;  4BE0 A;  2FD5 A;  5FKO A;  4CUG A;  2BE5 F;  3H5A A;  3M8E A;  2V7F A;  2EIL H;  3ABL H;  3PUB A;  1E2X A;  3WG7 H;  4Y17 A;  2H1K A;  1MDM A;  3FMQ A;  3LSK A;  2MGQ A;  4PDK A;  1ULY A;  2DXI A;  3H3U A;  2TCT A;  4XBF A;  4JOM A;  1T8I A;  2O9L A;  3FMS A;  3L9F A;  1AU7 A;  2VXZ A;  5ERI A;  3QWL A;  2FE3 A;  3L7W A;  2AXT C;  1U8R A;  2WTE A;  3CC7 I;  1S7O A;  1J5Y A;  3D5L A;  2X6X A;  1U2W A;  4YFK F;  4M9Z A;  2L2O A;  1R36 A;  3K7A J;  1X58 A;  2M45 A;  3VB2 A;  5GP9 A;  4AVP A;  1EF4 A;  5GTI C;  1X3W B;  2COM A;  3K2Z A;  2DU9 A;  4FX4 A;  1XSD A;  1VZ0 A;  1W5T A;  1HDD C;  3DBH B;  1LPQ A;  2XVC A;  2L54 A;  2XPV A;  3BWG A;  2MD5 A;  1V4R A;  1X1C A;  1P4W A;  4NC7 A;  2GZW A;  3HOS A;  2ZNY A;  5ICC A;  2UXN A;  1L3L A;  2X1D A;  2KFD A;  2QVO A;  4YIR X;  1W5S A;  3ECO A;  3W3C A;  1I6H J;  2VC1 A;  1D3Y A;  3CLQ A;  2D45 A;  2XKP A;  2QQ9 A;  1Z05 A;  3H5R A;  4LLG F;  4IXA A;  2M3A A;  3MZY A;  4DYR A;  3O8G A;  1ETV A;  3Q0U A;  3U9G A;  4M9S A;  2EV0 A;  1KGS A;  5J1R A;  5FGM A;  4U7B A;  1TQI A;  3ZOB A;  1IG7 A;  4XR6 A;  4BYY A;  3DTI A;  1P7J A;  1HKQ A;  2K3F A;  3SEQ A;  2DBB A;  2L3D A;  1C0W A;  1RIO H;  4IVN A;  1EJ9 A;  2HZT A;  3LA7 A;  4CA0 A;  4KIS A;  1XN7 A;  1FSH A;  1G3W A;  2OTL I;  1P4X A;  5B3S H;  4AM3 A;  3QPT A;  2CS3 A;  1Y8R B;  5B1A H;  2KLO A;  1IN4 A;  3BP8 A;  3I3L A;  2COB A;  1QO0 D;  2VJJ A;  2HOA A;  3HPH A;  4ZDL A;  5J1U A;  3C2H A;  1HKT A;  3QQA A;  2HPM A;  2Y9Y A;  4AIH A;  4BEH A;  5JI6 A;  3KP2 A;  3V7S A;  2OZ6 A;  3TP3 A;  4L9T A;  5LHG A;  2IP2 A;  4BAY A;  4BHC A;  4KNY A;  1E17 A;  2HQA A;  1FNN A;  1V5F A;  3BY6 A;  2R3S A;  2W00 A;  4M3D A;  3NQO A;  4KIT B;  3KPH A;  3O3K A;  4GXO A;  4GYI A;  3OS2 A;  1VQN I;  3KP3 A;  2P0W A;  3G2B A;  1N25 A;  5GAH J;  2FQ4 A;  4NQW A;  4A69 C;  2LK2 A;  5F64 A;  2QKL B;  3BG6 A;  3EQL F;  1HDP A;  2R7O A;  3K4B A;  2KPM A;  1U5T C;  2GBY A;  2EFW A;  3ABU A;  1FEX A;  3S2H J;  1H9T A;  1P7I A;  1H8A C;  2R7X A;  3HUG B;  4E7I A;  4PJL A;  2X48 A;  2M30 A;  3S1N J;  2K4B A;  1SVO A;  4FX0 A;  5E20 A;  3ZN1 A;  3HRS A;  4L18 B;  3GTG J;  1LJ9 A;  4F92 B;  4J19 A;  1R58 A;  2RVC A;  2EV5 A;  5DV5 A;  4I01 A;  2CGP A;  3KYL A;  5C44 J;  1R23 A;  2JSC A;  3GF2 A;  2UV1 A;  5IP6 A;  4IEJ A;  2HOT A;  3IH4 A;  3MMY B;  4XIC A;  5JFR A;  2IT0 A;  2BY1 A;  1OCZ H;  4MTE A;  3FMR A;  1NK3 P;  5LLQ A;  3R60 A;  3CP8 A;  2WAQ A;  3ZP5 A;  2EV6 A;  2YPR A;  1VQL I;  2JVH A;  3AFH A;  1HCR A;  1Y1W J;  3REO A;  5L3D A;  1W7P B;  2YX7 A;  4B8X A;  4M74 A;  1IRZ A;  4D5F A;  2WY7 Q;  4FHT A;  4N4N B;  3SFI A;  1I3A A;  1B6A A;  3VYT B;  1SFU A;  2E2H J;  2M2E A;  3MQ0 A;  2DAO A;  2VT3 A;  1TT5 B;  5E17 F;  3BJ6 A;  1LUJ B;  3VYU B;  3F6O A;  3N4M A;  4PSX A;  5TJJ A;  4G94 A;  1YLF A;  2CG4 A;  1YX3 A;  3A02 A;  3LSG A;  2BZT A;  1DP3 A;  1MMA A;  3JRC A;  3B6C A;  3HM5 A;  3S2D J;  5LGT A;  2QEN A;  1IUY A;  2LMD A;  1LVK A;  1RI7 A;  4L0Y B;  4BQQ A;  4FAS D;  2DN0 A;  1A5J A;  2G7H A;  4CZC A;  2CUZ A;  3F0C A;  3HTS B;  5ILU A;  1SFO J;  1HQC A;  3I59 B;  1Y39 A;  3S1R J;  1F1Z A;  2KIS A;  4RM2 A;  4EEF G;  3W6V A;  2MW8 A;  4PUS A;  2IGO A;  5HNH A;  1S6L A;  1U5T A;  5IYD J;  3S2W A;  1ZTR A;  1IRG A;  2LY1 A;  4A3F J;  4UV8 A;  2KQR A;  1PUF B;  4GYG A;  4MFD A;  3CZ6 A;  3TED A;  3E6D A;  1REP C;  3CUQ C;  1WJF A;  5EGO B;  3HRM A;  4HDU A;  3S3O A;  1SAU A;  2ZFW A;  3ZQL A;  4L5J A;  5EJC A;  2CO5 A;  1RUN A;  2F5C A;  2W85 A;  4FE7 A;  4GCV A;  1MH3 A;  3SZT A;  6PAX A;  2E1C A;  1MNM C;  1D8J A;  1ON1 A;  1E3H A;  2V9V A;  1TWF J;  4RLF A;  1H89 C;  2QM3 A;  2RAE A;  3MKL A;  2P6T A;  3U21 A;  3LFK A;  3TO6 A;  4A3I J;  2G0E A;  1WCM J;  4PZJ A;  1KQ8 A;  2E36 A;  1P9Q C;  3WU1 B;  2QEX I;  3L2V A;  3GLL A;  3F8C A;  3ONQ A;  3I4M J;  4RB0 A;  1SFX A;  1T0F C;  2DTR A;  3OYG A;  4OMZ A;  3JRH A;  3JRE A;  4GDF A;  3K0L A;  1BL0 A;  2EZI A;  3EDP A;  1W4M A;  1YE9 A;  1Y1V J;  4CHU A;  3T5X A;  2DOE A;  3H35 A;  2LC2 A;  2LRE A;  2MC3 A;  3PIO F;  3K69 A;  2E60 A;  4ABZ A;  4AID A;  1FX7 A;  2DT6 A;  4CH7 A;  4Z6Y A;  1K4S A;  3CF2 A;  1YX5 A;  4B3X A;  2DMU A;  1V5G A;  3ZMD A;  3A0H C;  3PQJ A;  1IAW A;  2DJN A;  1Z67 A;  2VC0 A;  1WQ2 A;  3TBI A;  1TBX A;  1RUO A;  2DMN A;  4FET A;  4YII A;  2HDC A;  2K3P A;  4JX5 A;  3V42 A;  1TW2 A;  5F0F A;  4WXC A;  5LD2 C;  1Z6R A;  2E19 A;  3JAM Z;  5D5W B;  3BR6 A;  3WTW C;  4JQF A;  2R4G A;  1W7P D;  2H09 A;  3K4L A;  1BIB A;  4HNT A;  5DM7 F;  2CWE A;  1QVT A;  5F1J A;  3CCR I;  3WGG A;  3J7A O;  2ZJ2 A;  2QSG X;  2VPR A;  1GT0 C;  3F21 A;  4ANJ A;  1R7J A;  3PNV A;  1XGN A;  3CUQ A;  2FJ1 A;  1XD7 A;  2X6W A;  1EV7 A;  3IKV A;  1MZB A;  3T8T A;  1WPK A;  3IV5 A;  1W0U A;  1D0Y A;  2Q0O A;  2M5W A;  2J5O A;  5FO5 A;  3OYL A;  4ESJ A;  1HF0 A;  2OF7 A;  3OMY A;  3MCZ A;  5E8G A;  5DUI A;  2YU9 J;  5A2Q Z;  1AOY A;  1WJB A;  4E7L A;  1MH4 A;  5DCF A;  1UCR A;  1ODD A;  2M4K A;  3T0Y A;  4OOI A;  1NTC A;  1T6S A;  2IXS A;  2JZY A;  4DIQ A;  1MJB A;  2WAF A;  5ICE A;  2PI0 A;  1ZK8 A;  3PNT A;  3EUA A;  3PO2 J;  2FMY A;  2Z2S B;  2FU4 A;  2DPD A;  5E1X A;  3TO9 A;  5JHU A;  3OYM A;  3P5J A;  1JUS A;  2O5R A;  3E0J B;  4DBQ A;  3W2A A;  3KIO A;  4HOB A;  2WV0 A;  1POG A;  2DA5 A;  3FK7 A;  3ASN H;  5CKT A;  2H6B A;  3I4P A;  4IKF A;  2LG4 A;  4L5E A;  4E7Z A;  2CMP A;  2KDO A;  2ZC2 A;  3DTE A;  2HQ5 A;  3WE3 A;  2QQA A;  5CQG A;  3I55 I;  3CMA I;  1IGN A;  4BJT A;  5M5W J;  1B59 A;  1JUP A;  4IL6 C;  2XSJ C;  2FNA A;  3E3V A;  5HOO A;  3BJA A;  5GTH C;  4ITV A;  2KKO A;  4XLN F;  3CDH A;  1IF1 A;  2PMZ N;  4BQO A;  2OV7 A;  2DT5 A;  2WWY A;  2PBI A;  3M9A A;  5F1R A;  2LKX A;  1X2M A;  2XRL A;  3BPV A;  1KYW A;  4RMN A;  2W24 A;  3KET A;  3BQY A;  4KIC A;  4P1W A;  2A07 F;  2CH0 A;  3BR1 A;  3K4N A;  4G6T B;  1W7P A;  2WC2 A;  5CVR A;  1BI0 A;  3OIP A;  1ITY A;  3D5S C;  3JSO A;  1FBQ A;  3H0G J;  4JBA A;  4KIB A;  2XKO A;  2K5C A;  1W5C C;  2RGV A;  3OOU A;  4KMU X;  4Q5S F;  2Y75 A;  3IHU A;  3LOC A;  5ICF A;  5JVT A;  3CCE I;  5E1Z B;  4MEX F;  4HLX A;  2O61 A;  2IAI A;  5CVJ A;  5HLG A;  4EAT A;  1OCP A;  3I54 A;  3AG2 H;  5DCM B;  1HA8 A;  3HRU A;  5J3L A;  2DJI A;  2CUF A;  5TRD A;  2Y31 A;  2FBH A;  5DUK A;  3M1C A;  4I98 B;  2L9R A;  4NC8 A;  4DZJ A;  4GFB A;  2W82 A;  2RKH A;  1A04 A;  2E5N A;  4RGS A;  1S7A A;  1IN8 A;  2R5Y B;  2P5V A;  1YTY A;  4OIO F;  3QYE A;  4JX6 A;  3M7G A;  1Q1V A;  3VSL A;  3RPU A;  2G7U A;  4I02 A;  4XN0 A;  3KEO A;  3I59 A;  3JSP A;  3E97 A;  3HYI A;  5FLX Z;  2IGK A;  2ESN A;  2M0C A;  5FKK A;  4AC0 A;  2R7F A;  4IOA F;  1BR1 A;  5EG0 A;  1ZRF A;  3IKT A;  3LAP A;  1IXR C;  1JHF A;  1WJE A;  3OIQ A;  3NAU A;  2YU3 A;  3Q0V A;  1G3S A;  4N4O B;  1HC8 A;  2XB5 A;  4IF4 A;  4XLH A;  3T8R A;  1VQP I;  3JRF A;  1S8N A;  3HKZ A;  3CCU I;  1XCV A;  4X6A J;  3LWF A;  3CCQ I;  1ON2 A;  1UB9 A;  5EGO A;  1YFH A;  1JE8 A;  1TZL A;  2FSW A;  4IHV A;  2EPF A;  1E3O C;  2HNH A;  4ESF A;  1T95 A;  3FZV A;  2DMP A;  4A3D J;  4ZDO A;  1EH7 A;  2I10 A;  4RA2 A;  3RQ4 A;  2F4M B;  2KIF A;  3AAF A;  5F04 A;  1SD4 A;  2QA4 I;  2K4J A;  3ZQC A;  1BI2 A;  3QYB A;  2H8R A;  4KIF A;  1G3Y A;  4OIQ F;  2VAS A;  1Z91 A;  2PMU A;  3S14 J;  3HGG A;  1IJW C;  4ZTF A;  5L3E A;  3H36 A;  4UXN A;  3W6J B;  1P2F A;  4FE4 A;  2YS9 A;  2YX4 A;  4XSX F;  3FWE A;  3C18 A;  5D4S A;  1DU6 A;  4RAF A;  5D4R A;  3HL2 A;  2EFP A;  1SC7 A;  4LLN A;  3GZN B;  2KHM A;  5J4V A;  3BR2 A;  5CQE A;  2HZD A;  5M5Y J;  1PDN C;  4C2U A;  3ZRG A;  2JWT A;  4YRV A;  2M87 A;  2K9S A;  5K7Z A;  4MHG A;  5LHI A;  4V2F A;  1K79 A;  2CFO A;  2CUJ A;  1HOM A;  5D5X B;  2QUF A;  3I5U A;  4HPQ A;  2CV1 A;  4I2O A;  1OR7 A;  1X2N A;  3OV8 A;  2EFO A;  2FXA A;  1JKR C;  2FOK A;  1JI8 A;  2K85 A;  1YI2 I;  1MJ9 A;  2QWW A;  3KCC A;  2XF5 A;  2PJR B;  4HZF A;  5KCM A;  4DOZ A;  2GQQ A;  4XLA A;  2LD5 A;  1Q1H A;  4GO1 A;  5HS8 A;  3K4K A;  4EM1 A;  4LB5 A;  4HNU A;  1TW3 A;  2TDX A;  2I5U A;  3R0A A;  4PJN A;  3RKY A;  3TDZ C;  2IPQ X;  3OYF A;  4ENN A;  5CLS A;  2KDZ A;  4KN7 X;  5LEK A;  4BHB A;  4XRM A;  4CCK A;  4XOP A;  1AA7 A;  1MGT A;  2GIV A;  3WHC A;  2HOS A;  3HOZ J;  4OAZ A;  5C4X J;  4MFE A;  1GVJ A;  1G8X A;  3CCY A;  4A5M A;  1N78 A;  1TP4 A;  1XGO A;  2KL4 A;  5L3F A;  5LFA A;  3A01 B;  2R7T A;  2ZXW H;  2QCO A;  5F08 A;  4U0V A;  1IC8 A;  1MBE A;  1BN5 A;  4UHT A;  3I58 A;  4OIN F;  4WWC A;  2CSO A;  3GTJ J;  1VQ5 I;  4KDP A;  2EZK A;  2XAS A;  3M07 A;  1UHW A;  2KZV A;  2VJ4 A;  2YSR A;  1RES A;  4HV5 A;  2HVR A;  5E1W A;  2P6S A;  2GA2 A;  3ZR8 X;  1IDY A;  1SAX A;  1O3S A;  2CFX A;  1EKE A;  3MEX A;  4CIC A;  3P7N A;  3N97 A;  3IWF A;  4G6D A;  2HVQ A;  2CQ7 A;  1HXD A;  1ETW A;  1P6R A;  1XG1 A;  4XM3 A;  3P9C A;  1CF7 B;  1ZRC A;  1WFX A;  2ZBK A;  3WTY C;  3QOD A;  1OYY A;  1KQ9 A;  5J1Y A;  1GV2 A;  4LIU A;  1OKR A;  2VB6 A;  2W57 A;  1BOA A;  5F0H A;  3H92 A;  2A3S A;  2CU7 A;  3TP0 A;  4AYB A;  4AIJ A;  4L5I A;  3QOP A;  2VQH A;  1R5I D;  4ENJ A;  5JHF A;  2L9V A;  2RV8 A;  3V8L A;  2OU2 A;  3TGN A;  3GTP J;  1XDS A;  1SD5 A;  2DA7 A;  1SFE A;  1DQU A;  1OCO H;  4XL9 A;  1RR8 C;  3DKY A;  3EUK L;  2HR3 A;  2HKO A;  4XON A;  2GLO A;  1W36 C;  1OQY A;  4XKW A;  3WGH A;  4NHJ A;  4UUV A;  4PCQ A;  2DK5 A;  4LG0 A;  3B6A A;  5H6R A;  4IOC F;  2XAF A;  1R71 A;  3DPL C;  5JR3 A;  2UZK A;  5BMZ A;  1ZKG A;  2HU9 A;  1Z0X A;  3CTA A;  2BXY A;  2FF4 A;  2NOJ B;  3OS1 A;  2P8T A;  4QWQ A;  1TC3 C;  2K86 A;  3GTM J;  1R4N B;  4II3 A;  4P9U A;  5E3M A;  1V5E A;  4NC6 A;  1ZYR F;  1V3F A;  1X1D A;  2WA0 A;  4XOR A;  1QU3 A;  1U9N A;  3CD6 I;  1ENH A;  3RJP A;  1BR4 A;  1BW6 A;  2NNN A;  4B44 A;  4BU2 A;  2E1M C;  3AG1 H;  2HPI A;  4E7K A;  4QSH A;  4U0W A;  4DGW B;  2ISZ A;  3OWT A;  2X6O A;  5KNL A;  2EB7 A;  1WVR A;  4BAC A;  2DFF A;  1TT0 A;  3E6B A;  3J7Y J;  3OYE A;  3GBG A;  1VQO I;  2VQL A;  5FKM A;  2M0M A;  4IRG A;  4UUS B;  3A1Y A;  1U9O A;  3PQK A;  4B43 A;  2R5Y A;  1YJW I;  4RGX A;  1K78 B;  1WI9 A;  4KUM A;  2LFB A;  3WU2 C;  3BR0 A;  2ME0 A;  3VYS B;  3KYD B;  3VDX A;  2JUG A;  2Z5U A;  1F4K A;  1U78 A;  1OCR H;  4EMS A;  5LHH A;  4LB6 B;  4HV6 A;  1WH7 A;  5DEQ A;  3J80 Z;  3C1D A;  4MTD A;  4XLP F;  3HOV J;  2V1X A;  5H20 A;  2VBX A;  3DPT A;  3GFI A;  3QRF F;  5D8L B;  2L5Q A;  1R00 A;  3E6C C;  4TV7 A;  1J7K A;  3I4N J;  5HDK A;  3OYJ A;  1EH8 A;  2AS5 F;  2FOW A;  2QBY B;  3HC7 A;  2GXB A;  4IRH A;  3ZMV A;  4EJU A;  5EF6 A;  1U3E M;  3A0B C; 
#chains in the Genus database with same CATH homology
 1IXC A;  5DD8 A;  2C6Y A;  1IXS B;  5KK1 A;  3Q9V A;  2BEO A;  1LDD A;  3G73 A;  1LDJ A;  2IA2 A;  3FM5 A;  5J8C A;  3TDU C;  1KQ0 A;  1HSJ A;  1I27 A;  3KE2 A;  2E7X A;  2D1H A;  4HDV A;  2BBY A;  1WKM A;  2YR2 A;  3F8F A;  4RB2 C;  2UWM A;  2MA3 A;  2JPC A;  4U88 A;  4F7Z A;  3JW4 A;  1WSU A;  3GZ5 A;  5LBQ A;  2B0L A;  1SD7 A;  2A68 F;  5HLH A;  3OOP A;  1LQ1 A;  2H27 A;  2DLL A;  3QPH A;  5CYV A;  1FBS A;  2KIM A;  5E8I A;  1HW5 A;  2ACJ A;  3B02 A;  1LDK B;  2XAG A;  4HBL A;  2QQB A;  3DEU A;  4CYD A;  3VFZ A;  4XSZ F;  3LA2 A;  4HAM A;  2ZME B;  4R1H A;  5D6F A;  1QGP A;  3GWZ A;  3KFW X;  2XAH A;  1K7A A;  2CYY A;  2EFQ A;  4O3M A;  3WU0 A;  1D8K A;  2NYX A;  3GO5 A;  4LD5 A;  3DQV C;  3RPQ A;  4WXH A;  3TOB A;  2HGC A;  1YQA A;  1YO5 C;  2P7V B;  2P4W A;  4Q47 A;  2DK8 A;  3RDI A;  2HTS A;  5LRS A;  4HYE A;  3V7R A;  1PP7 U;  5LRR A;  2HQR A;  5K1Y A;  4ZYG A;  3VOD A;  3LA3 A;  3WOD F;  2Q8K A;  2RN7 A;  4MGR A;  3J81 Z;  3I53 A;  3F6V A;  1TLH B;  3HTU A;  4OIR F;  3C7J A;  3KZZ A;  5L3G A;  5AIP A;  2EA2 A;  4A6D A;  3GZ6 A;  1FOK A;  5ILS A;  1FWZ A;  3BJO A;  1R5G A;  1IZ1 A;  2VE8 A;  4U7D A;  1TNT A;  1K6O A;  2LF8 A;  4RB3 C;  1G3T A;  1T2K A;  3ZMS A;  4IJA A;  3CO7 C;  4LJZ F;  2M1B A;  2FA5 A;  2GA1 A;  3NEU A;  1IW7 F;  4CDG A;  5CVU A;  2FBI A;  1BC8 C;  4MQV A;  2IJL A;  4N9H A;  2CQK A;  4D0P A;  3RYR A;  4UNO A;  4HLY A;  5IT3 A;  3SZP A;  1FC3 A;  1O3Q A;  3VEP A;  1LEB A;  4ENK A;  1UHM A;  3H3Z A;  4A5N A;  4HF1 A;  3MZH A;  3DFG A;  1BI3 A;  2A6H F;  5LEJ A;  5FFX A;  4BQA A;  1XGS A;  3IL2 A;  2GWR A;  4XRF A;  2Z9O A;  1USS A;  3P9K A;  2G9W A;  2D2W A;  3TOA A;  4MEY F;  5BPD A;  1ONV A;  2XRO A;  3LST A;  2JTV A;  2DW4 A;  2HFH A;  1LEA A;  1Z9C A;  4JK1 X;  2A69 F;  1OYI A;  3V7C A;  3HUG A;  1H9G A;  1BC7 C;  3R4K A;  5KVR A;  2EJR A;  4A0Y A;  4HQE A;  1QNT A;  1IRF A;  5IT9 K;  4M72 A;  2ZME A;  1OMI A;  1MDM B;  3C3W A;  1J75 A;  2HQN A;  2LKP A;  2PLY A;  2D1V A;  1QQI A;  5D6E A;  2Q2E A;  1CGP A;  5K5Q A;  3KEQ A;  3PFI A;  3WTZ A;  2VON A;  4CXF A;  2MLK A;  1JGS A;  3KLN A;  2STT A;  2GAU A;  1XDU A;  3F8B A;  2XRN A;  3DF8 A;  3WTU C;  5FD5 A;  4I0A A;  4WX9 A;  5J8F A;  1DUX C;  2HWV A;  1STZ A;  5ILV A;  1QBJ A;  2HKX A;  3DP7 A;  4ASN A;  4EGZ A;  3ISP A;  3TQN A;  3K1N A;  1FP2 A;  1KU9 A;  4GGG A;  1J0R A;  1KU3 A;  4MNU A;  2LDU A;  3NRV A;  1I6X A;  5DYM A;  4A6E A;  1BIA A;  2H6C A;  1ZAO A;  5BPI A;  4YIF A;  3WTV C;  2HOE A;  1OYW A;  2L4M A;  4I0B A;  4EM2 A;  5FD6 A;  1MD0 A;  3BRO A;  1ZN2 A;  3BOQ A;  2HS5 A;  2RNJ A;  3QU6 A;  1FYM A;  5HS7 A;  4ZYE A;  3HSR A;  1YS6 A;  3KP5 A;  2V1D A;  3RI4 A;  2MLG A;  4KIG A;  3TKY A;  3HSE A;  3CO6 C;  4IRI A;  4KYW A;  1FT9 A;  2VE9 A;  4KFC A;  2MH9 A;  3M1E A;  1BI1 A;  3WTS C;  1XCB A;  2L02 A;  3EUH A;  2IVM A;  2MH2 A;  3KP4 A;  1I1G A;  4Y15 A;  2XHK A;  1BM9 A;  4HX4 A;  3CLO A;  4QLC U;  2P5L C;  3I0T A;  3EYI A;  2XV4 S;  1QZY A;  3KP7 A;  2DFI A;  1RZ4 A;  1DPR A;  1ZGJ A;  1GXQ A;  2Z99 A;  1DDN A;  1D5V A;  1O57 A;  1Y0U A;  1L0O C;  2OBP A;  4LMY A;  2ZKZ A;  2O0Y A;  3I71 A;  3JAM K;  3FXR A;  3QAH A;  4S05 A;  3K9T A;  3P9I A;  2ZCW A;  3VOE A;  3O6B B;  1ZG5 A;  3Q9S A;  1WWX A;  3V8J A;  4G7O F;  4P96 A;  4LGW A;  2VOP A;  4K2E A;  5FB2 A;  2VN2 A;  3L09 A;  5A2Q K;  1IN7 A;  2GXG A;  2EA4 A;  2XUB A;  1R5H A;  2KJC A;  2NNY A;  4G9Y A;  4AD9 A;  3ERE D;  3KP6 A;  1O3T A;  4ZZL A;  1U5T B;  3IRR A;  1ZG1 A;  1FZP B;  4R79 A;  4A2U A;  2FQ3 A;  4EJW A;  3ULQ B;  1DPU A;  3HOT A;  3L2C A;  2DO7 A;  1PUE E;  3EYY A;  4ETS A;  3RYP A;  3L00 A;  5BOX A;  2OQG A;  2E1N A;  3K1P A;  3COA C;  1VTN C;  5LGU A;  3DKW A;  2L4A A;  3GEZ A;  4DNC A;  4RAY A;  2ESH A;  1LNW A;  5DCM A;  1KU2 A;  2M8E A;  1YS7 A;  2FBK A;  3WE2 A;  3HSF A;  4P55 A;  2BYV E;  5CJ9 A;  1I1S A;  2STW A;  5EEH A;  3F8N A;  4BXU A;  3ZQ7 A;  1HBX G;  1WRJ A;  2OA4 A;  1UST A;  3F72 A;  1PP8 F;  1KYZ A;  5HLI A;  1GHC A;  1R22 A;  3R6S A;  3GUD A;  2Y48 A;  3DXJ F;  3JTG A;  2H94 A;  3E6M A;  4L9N A;  2PN6 A;  2ZO4 A;  2DQR A;  2JPB A;  1YW7 A;  2J5P A;  1X3U A;  2OD5 A;  4WF2 A;  3CUQ B;  4Z2Y A;  1JHH A;  4L9V A;  3CJN A;  5FLX K;  1SD6 A;  2MBF A;  2DPU A;  2RQP A;  2Z33 A;  2R7D A;  2OAZ A;  5HDN A;  1FBU A;  1ZLJ A;  1RNL A;  1TQM A;  3JTH A;  2XAQ A;  4N0B A;  3GFM A;  1AWC A;  3DV8 A;  3HIF A;  5AIQ A;  1QZZ A;  3MFK A;  2EWN A;  3U1D A;  2PFB A;  3O2P E;  4AWX B;  1KU7 A;  4DQ2 A;  1BJA A;  4KT5 C;  1IN5 A;  2PQ8 A;  5IT9 Z;  1ZRE A;  2DQL A;  4EVI A;  1HW1 A;  3ZMZ A;  2K27 A;  3W6K B;  3LAJ A;  2O3F A;  2HYF A;  4L9J A;  3TO7 A;  1LVA A;  4RGU A;  3F23 A;  5EEG A;  3CUO A;  4H0E A;  2IW5 A;  2W25 A;  3FXQ A;  3ML6 A;  4Q4Z F;  4BH9 A;  4I09 A;  1XGM A;  4ESB A;  5HVQ C;  4A0X A;  1B4A A;  1DP7 P;  4R8H A;  1CF7 A;  2IA1 A;  2Z3Y A;  3IRQ A;  2VOO A;  3M8F A;  2EK5 A;  2Y0M A;  1B1B A;  3E5U A;  4UV9 A;  3WGI A;  4LK0 F;  2A5Y B;  2F2E A;  4U0Y A;  1R1T A;  1S3J A;  2RC4 A;  2V6C A;  4CGZ A;  4RAZ A;  3FM3 A;  3EET A;  1YW9 A;  1QPM A;  3GX4 X;  4L0Z B;  1B9M A;  4BNC A;  3R61 A;  1J9I A;  1T39 A;  1Z1D A;  1NHA A;  2NRA C;  3SHF A;  5BS6 A;  3FF5 A;  1HKS A;  3F8M A;  2XAJ A;  1IN6 A;  1J2X A;  1FYL A;  1P92 A;  3MAJ A;  1ZAR A;  4I7H A;  3ZN0 A;  1ZGA A;  2UXX A;  3E5X A;  4HW0 A;  1B9N A;  3E5Q A;  1FY7 A;  1TNS A;  5L3C A;  5D5V B;  4EJV A;  3LQQ A;  5ED4 A;  3Q5F A;  4PGG A;  4NB5 A;  1FYK A;  3R0J A;  2ETH A;  2RDP A;  3G3Z A;  3HHG A;  5E18 F;  3F22 A;  1K78 A;  4G6Q A;  1TQP A;  2OQR A;  2XGX A;  1ZRD A;  4HF0 A;  4ZYH A;  1O3R A;  4OMY A;  2KIU A;  1HW2 A;  4A0Z A;  1MKM A;  4HQM A;  1R1U A;  2FNP A;  4EV0 A;  3GW2 A;  2ADU A;  3ROU A;  2FRH A;  2X0L A;  1FP1 D;  2P5K A;  3GFL A;  2VOD A;  2QBY A;  4E70 A;  2ZNZ A;  1FLI A;  3BPX A;  2VBY A;  3WG9 A;  1R1V A;  5LGN A;  3LQR A;  1KA8 A;  4B09 A;  2V1U A;  4HF2 A;  4CO8 A;  3J80 K;  4ZYD A;  1XMK A;  5CVV A;  4P9F A;  5K5R A;  2JT1 A;  3ELK A;  4G7Z F;  2K02 A;  2PJP A;  1FPQ A;  1SMY F;  4HX7 A;  1YIO A;  3HHH A;  1T0F A;  2F5E A;  4IPA A;  3GFJ A;  5F6F A;  4WXD A;  3RTR A;  2O6G E;  1O7F A;  4RGR A;  4HA8 A;  3D0S A;  1T38 A;  2HEO A;  1T98 A;  2LSO A;  1F9N A;  4BHP A;  1Z7U A;  3GVA A;  1FSE A;  4EGY A;  2DI3 A;  1HST A;  2QLZ A;  4OU0 A;  4LLL A;  4LG0 B;  1XMA A;  4ZH4 F;  3RKW A;  4ZZD A;  2X4H A;  1MJA A;  2A6E F;  2XIG A;  1P4A A;  3SQN A;  4MQ9 F;  5FFZ A;  3ZMT A;  2JRT A;  3V4G A;  2OZU A;  5DDG A;  4WK8 F;  2E7W A;  3KZY A;  4KA4 A;  3BZ6 A;  2EFN A;  2F5F A;  4KMF A;  4O5V A;  3FHZ A;  3FX3 A;  4M71 A;  4M6Y A;  5HS9 A;  5CVI A;  3WTX C;  1XB4 A;  2F5D A;  2LNB A;  3ABT A;  1ZG3 A;  3IWZ A;  3K1M A;  1G4D A;  4EJO A;  1XSX A;  2ELH A;  1ZHF A;  4A12 A;  4FT8 A;  2O03 A;  1YYV A;  4RS8 A;  1ZH5 A;  1GXP A;  4IHS A;  4YFN F;  1EH6 A;  4LFU A;  4UVC A;  1UFM A;  2NS0 A;  1TTY A;  2VBW A;  2VT2 A;  2QYO A;  1O7L A;  2W84 A;  3RKX A;  2K7L A;  3ZPL A;  4G7H F;  2LF7 A;  5K5O A;  1J59 A;  2VBZ A;  2V79 A;  4CZZ A;  4RB1 A;  1XSV A;  2P7C B;  4M6X A;  2ZXJ A;  2HYG D;  3J81 K;  5AON A;  1OPC A;  2A61 A;  4ENM A;  5D8K B;  1G6N A;  3QU3 A;  5BQT A;  1ZLK A;  4HX8 A;  3SXY A;  1YG2 A;  5L3B A;  5ICG A;  5HDG A;  2L01 A;  4G8X A;  3GYH X;  4YG2 F;  4PGH A;  4UVA A;  2HTJ A;  5D5U B;  1Z6T A;  3QP6 A;  1LB2 A;  1U6G A;  2ISY A;  1H0M A;  1BBY A;  4IHT A;  1S29 A;  3B73 A;  4M9X A;  4AIK A;  2CW0 F;  4EJT A;  4YFX F;  4EM0 B;  4OIP F;  4EQQ A;  4KN4 X;  3WTT C;  3RIR A;  4O6J A;  2PG4 A;  3FXU A;  3U2R A;  4ON0 A;  3IC7 A;  4M73 A;  1SMT A;  3I64 A;  2KJB A;  4LK1 F;  2FML A;  2BV6 A;  2PEX A;  5DD4 A;  3ZMU A;  4Y13 A;  2BGC A;  2AXL A;  2QZ8 A;  5J6X A;  2O8X A;  2IRF G;  2NAZ A;  3V8K A;  1JXS A;  3KLO A;  3GLX A;  1I5Z A;  1YW8 A;  5H6Q A;  4N9I A;  3HRT A;  3T1B A;  3ECH A;  4UVB A;  4S04 A;  3GXO A;  4P5O A;  3BDD A;  2FEZ A;  1F5T A;  4Q48 A;  2KRF A;  3MWM A;  3SFZ A;  2IA0 A;  4WCG A;  2PMH A;  3QP5 A;  3F3X A;  2BE5 F;  3M8E A;  1E2X A;  4Y17 A;  1MDM A;  3FMQ A;  4PDK A;  1ULY A;  3H3U A;  4XBF A;  3FMS A;  3L9F A;  2VXZ A;  5ERI A;  2FE3 A;  3L7W A;  1U8R A;  2WTE A;  1S7O A;  1J5Y A;  3D5L A;  1U2W A;  4YFK F;  4M9Z A;  1R36 A;  3VB2 A;  2M45 A;  4AVP A;  2COM A;  3K2Z A;  2DU9 A;  4FX4 A;  1XSD A;  1W5T A;  2XVC A;  2L54 A;  3BWG A;  2MD5 A;  1V4R A;  1P4W A;  2GZW A;  3HOS A;  2ZNY A;  5ICC A;  2UXN A;  1L3L A;  2QVO A;  1W5S A;  3ECO A;  2VC1 A;  1D3Y A;  2D45 A;  2XKP A;  2QQ9 A;  1Z05 A;  4LLG F;  4IXA A;  3MZY A;  3U9G A;  4M9S A;  2EV0 A;  1KGS A;  5FGM A;  4U7B A;  1TQI A;  4BYY A;  1HKQ A;  2DBB A;  2L3D A;  1C0W A;  1RIO H;  4IVN A;  2HZT A;  3LA7 A;  1XN7 A;  1FSH A;  1G3W A;  1P4X A;  3QPT A;  1IN4 A;  3BP8 A;  1QO0 D;  1HKT A;  4AIH A;  5JI6 A;  3KP2 A;  3V7S A;  2OZ6 A;  4L9T A;  5LHG A;  2IP2 A;  4BAY A;  4BHC A;  4KNY A;  1E17 A;  1FNN A;  3BY6 A;  2R3S A;  3NQO A;  3O3K A;  4GXO A;  4GYI A;  3KP3 A;  4NQW A;  5F64 A;  3EQL F;  1U5T C;  2EFW A;  3ABU A;  1H9T A;  2M30 A;  2K4B A;  4FX0 A;  5E20 A;  3ZN1 A;  3HRS A;  4L18 B;  1LJ9 A;  1R58 A;  2RVC A;  2EV5 A;  5DV5 A;  4I01 A;  2CGP A;  1R23 A;  2JSC A;  3GF2 A;  5JFR A;  2IT0 A;  4MTE A;  3FMR A;  5LLQ A;  3R60 A;  3ZP5 A;  2EV6 A;  2YPR A;  3REO A;  5L3D A;  1W7P B;  2YX7 A;  4B8X A;  4M74 A;  4FHT A;  1B6A A;  1SFU A;  3MQ0 A;  2DAO A;  2VT3 A;  5E17 F;  3BJ6 A;  3F6O A;  3N4M A;  5TJJ A;  4G94 A;  1YLF A;  2CG4 A;  5LGT A;  2QEN A;  1IUY A;  1RI7 A;  4L0Y B;  2G7H A;  3HTS B;  5ILU A;  1HQC A;  3I59 B;  1F1Z A;  1S6L A;  1U5T A;  3S2W A;  1IRG A;  4UV8 A;  4GYG A;  3E6D A;  1REP C;  3CUQ C;  4HDU A;  3HRM A;  2ZFW A;  4L5J A;  2CO5 A;  1RUN A;  2F5C A;  2W85 A;  4GCV A;  3SZT A;  6PAX A;  2E1C A;  1D8J A;  1ON1 A;  2V9V A;  2QM3 A;  2P6T A;  3LFK A;  3TO6 A;  4PZJ A;  1KQ8 A;  3WU1 B;  3F8C A;  4RB0 A;  1SFX A;  2DTR A;  4OMZ A;  3K0L A;  3EDP A;  1W4M A;  4CHU A;  3T5X A;  2MC3 A;  3K69 A;  1FX7 A;  3ZMD A;  1IAW A;  3PQJ A;  2VC0 A;  1WQ2 A;  1RUO A;  1TBX A;  4YII A;  2HDC A;  1TW2 A;  4WXC A;  1Z6R A;  3JAM Z;  5D5W B;  3WTW C;  4JQF A;  1W7P D;  2H09 A;  1BIB A;  2CWE A;  3WGG A;  3J7A O;  2ZJ2 A;  3F21 A;  1R7J A;  1XGN A;  3CUQ A;  1XD7 A;  1EV7 A;  3IKV A;  1MZB A;  3T8T A;  2Q0O A;  2M5W A;  2J5O A;  5FO5 A;  4ESJ A;  5E8G A;  3MCZ A;  5DUI A;  1AOY A;  5A2Q Z;  5DCF A;  1UCR A;  1ODD A;  3T0Y A;  4OOI A;  1T6S A;  2JZY A;  1MJB A;  5ICE A;  2PI0 A;  2FMY A;  2FU4 A;  2DPD A;  5E1X A;  3TO9 A;  5JHU A;  4HOB A;  2WV0 A;  2H6B A;  3I4P A;  3WE3 A;  2QQA A;  1B59 A;  2FNA A;  3E3V A;  5HOO A;  3BJA A;  2KKO A;  4XLN F;  3CDH A;  1IF1 A;  2DT5 A;  2WWY A;  2PBI A;  3M9A A;  5F1R A;  3BPV A;  1KYW A;  2W24 A;  3KET A;  4KIC A;  2A07 F;  1W7P A;  2WC2 A;  5CVR A;  1BI0 A;  3JSO A;  1FBQ A;  4JBA A;  4KIB A;  2XKO A;  2RGV A;  4KMU X;  4Q5S F;  2Y75 A;  5JVT A;  3IHU A;  5ICF A;  4MEX F;  5E1Z B;  4HLX A;  2O61 A;  5CVJ A;  5HLG A;  3I54 A;  5DCM B;  3HRU A;  5TRD A;  2FBH A;  5DUK A;  4I98 B;  2RKH A;  1A04 A;  4RGS A;  1S7A A;  1IN8 A;  2P5V A;  1YTY A;  4OIO F;  3M7G A;  3RPU A;  2G7U A;  4I02 A;  3KEO A;  3I59 A;  3JSP A;  3E97 A;  3HYI A;  5FLX Z;  2ESN A;  2R7F A;  1ZRF A;  3IKT A;  3LAP A;  1IXR C;  1JHF A;  2YU3 A;  1G3S A;  4IF4 A;  3T8R A;  1S8N A;  1XCV A;  3LWF A;  1ON2 A;  1UB9 A;  1YFH A;  1JE8 A;  2FSW A;  4ESF A;  3FZV A;  1EH7 A;  2KIF A;  3AAF A;  1SD4 A;  2K4J A;  1BI2 A;  4KIF A;  1G3Y A;  4OIQ F;  1Z91 A;  2PMU A;  5L3E A;  4UXN A;  3W6J B;  1P2F A;  4XSX F;  2YX4 A;  3FWE A;  3C18 A;  5D4S A;  5D4R A;  2EFP A;  4LLN A;  1PDN C;  2M87 A;  4MHG A;  5LHI A;  1K79 A;  5D5X B;  2QUF A;  3I5U A;  4I2O A;  1OR7 A;  3OV8 A;  2EFO A;  2FXA A;  2FOK A;  1MJ9 A;  2QWW A;  3KCC A;  4HZF A;  2GQQ A;  1Q1H A;  4GO1 A;  5HS8 A;  4EM1 A;  4LB5 A;  1TW3 A;  2TDX A;  3RKY A;  3R0A A;  3TDZ C;  2IPQ X;  4ENN A;  5CLS A;  4KN7 X;  5LEK A;  4BHB A;  1MGT A;  2GIV A;  1GVJ A;  4A5M A;  1XGO A;  5L3F A;  4U0V A;  1BN5 A;  4UHT A;  3I58 A;  4OIN F;  4WWC A;  2CSO A;  4KDP A;  2XAS A;  1UHW A;  2YSR A;  4HV5 A;  5E1W A;  2P6S A;  2GA2 A;  1SAX A;  1O3S A;  2CFX A;  3MEX A;  4CIC A;  3P7N A;  3N97 A;  3IWF A;  4G6D A;  1HXD A;  1P6R A;  3P9C A;  1CF7 B;  1ZRC A;  2ZBK A;  3WTY C;  1OYY A;  1KQ9 A;  1OKR A;  2W57 A;  1BOA A;  3H92 A;  2A3S A;  4AIJ A;  4L5I A;  3QOP A;  4ENJ A;  2RV8 A;  3V8L A;  2OU2 A;  3TGN A;  1XDS A;  1SD5 A;  1SFE A;  2HR3 A;  2HKO A;  4NHJ A;  3WGH A;  4UUV A;  4PCQ A;  2DK5 A;  4LG0 A;  5H6R A;  2XAF A;  3DPL C;  5JR3 A;  2UZK A;  5BMZ A;  3CTA A;  2FF4 A;  2P8T A;  4QWQ A;  2K86 A;  4P9U A;  1ZYR F;  1V3F A;  3RJP A;  2NNN A;  4U0W A;  2ISZ A;  2EB7 A;  3E6B A;  4IRG A;  3PQK A;  4RGX A;  1K78 B;  1WI9 A;  4KUM A;  2Z5U A;  1F4K A;  1U78 A;  4EMS A;  5LHH A;  4LB6 B;  4HV6 A;  5DEQ A;  3J80 Z;  3C1D A;  4MTD A;  4XLP F;  2V1X A;  5H20 A;  2VBX A;  3DPT A;  3GFI A;  3QRF F;  5D8L B;  1R00 A;  3E6C C;  4TV7 A;  1J7K A;  5HDK A;  1EH8 A;  2AS5 F;  2QBY B;  2GXB A;  4IRH A;  3ZMV A;  4EJU A;  1U3E M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...