2MBFA

Solution structure of the forkhead domain of brugia malayi daf-16a
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
101
structure length
101
Chain Sequence
NPWGAESYSDLIAKALKSTFDGRMRLNEIYNWFASNVPYFGNRTSQEQSAGWKNSIRHNLSLHSRFMRIQNEGAGKSSWWVINPDAKPGRNPRRQRSATLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fork head domain containing protein
publication title The solution structure of the forkhead box-O DNA binding domain of Brugia malayi DAF-16a.
pubmed doi rcsb
source organism Brugia malayi
molecule tags Transcription
total genus 24
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-07-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2mbfA01
1PP8F 2QVOA 2A07F 3VOEA 3L2CA 2XAGA 2XAJA 3DFGA 4EM2A 2A6HF 3HIFA 4PCQA 4RB0A 5CVVA 2Z33A 3R4KA 4MEYF 4M6YA 2QM3A 1IN5A 2HKOA 1HQCA 2FOKA 4HAMA 5A2QZ 1OKRA 4L18B 2PBIA 2PI0A 1ODDA 4YIFA 1HSTA 1FPQA 2PJPA 3R0AA 4D0PA 2P6SA 4LLGF 3KP5A 3P9IA 1LB2A 1AOYA 5LGUA 4UHTA 1SAXA 4OIPF 5DD4A 1FYKA 3RKWA 2HDCA 4ENNA 4PGHA 4IRIA 1YLFA 3I5UA 2FXAA 4KA4A 3EETA 3GXOA 3ZMZA 2WV0A 3GFLA 2P5KA 4KN4X 1AWCA 2CG4A 4UVBA 5HLIA 4IHTA 2LSOA 3N4MA 2XKPA 2GAUA 4HQMA 3P9KA 2NS0A 2G9WA 2DTRA 4MNUA 1T98A 2XKOA 4L9TA 2BYVE 2HFHA 4HBLA 1E2XA 3LA7A 4HDUA 1LDJA 1UB9A 4M72A 3GZ5A 5J8FA 2OAZA 3J81K 3HOTA 2DU9A 4R8HA 1R36A 1O3QA 4FX4A 1JXSA 4MTEA 1PP7U 4RB1A 3GYHX 2XIGA 3HUGA 5TJJA 3RDIA 3HTUA 3QPHA 1HBXG 1KGSA 3WU0A 4LFUA 4L5IA 2CQKA 3Q9VA 1HKQA 2EV0A 2H6BA 2B0LA 4QWQA 3LA3A 2HTSA 4GGGA 3M7GA 4QLCU 3PQJA 2QBYB 4A6EA 5LRSA 2M5WA 5JFRA 1ZAOA 4OOIA 4HDVA 5FGMA 1SD6A 2NAZA 2Y48A 1P4WA 3ECHA 4ESBA 1YTYA 1Y0UA 4EVIA 5E1WA 5LHHA 3IKTA 2F5EA 1XSVA 3R60A 3QU6A 2M45A 3CUQA 2K86A 3P7NA 1B9MA 2HQRA 3K2ZA 4YIIA 1IZ1A 4L0ZB 1ZARA 3FHZA 1BI0A 2JT1A 3M8FA 1K7AA 3DPLC 2A6EF 4G7OF 1F5TA 3KFWX 4R79A 2Z5UA 1SD4A 4EJVA 4P96A 1TQMA 3ZP5A 5DUIA 4WCGA 1IXCA 3FMQA 1QGPA 1IN6A 5K5RA 3F6OA 4UVAA 4L5JA 2L4MA 4PZJA 3QAHA 1BBYA 1EH6A 4Z2YA 1HXDA 5BS6A 3R0JA 2QBYA 1OMIA 1WI9A 2IP2A 1J9IA 3FMRA 2TDXA 4IRGA 1ZG1A 1DPUA 3I58A 2ISZA 1LJ9A 1HKTA 2STTA 4CZZA 4FHTA 2RNJA 2RN7A 4XLPF 2O6GE 5LEJA 4B09A 1V4RA 5J8CA 2CW0F 1HW5A 5K5OA 2EFPA 4IF4A 1F1ZA 2YX7A 3KLOA 1BJAA 4RGXA 2PEXA 3F8FA 4UVCA 1ONVA 3CTAA 1GHCA 5D8KB 3TDZC 3FF5A 1DDNA 4HX8A 2CSOA 3D0SA 4HV6A 3WE3A 5IT9Z 4MGRA 3KP2A 1MGTA 4BH9A 1RUOA 3FMSA 1E17A 3U1DA 3NEUA 4UV9A 1O3SA 3KP7A 3L7WA 3BP8A 2G7HA 4M6XA 3JTHA 4I2OA 1SFXA 4DNCA 4RB2C 1SD5A 5ILUA 1J0RA 1TW3A 1LNWA 2M87A 1UCRA 2P4WA 3IHUA 2Z99A 3HRSA 2WTEA 2W84A 4GCVA 1WRJA 1K78A 2XROA 1U6GA 1IW7F 5A2QK 3L00A 3RKXA 3BWGA 1EH7A 1YO5C 2OBPA 3QPTA 1R1UA 4LJZF 1GXQA 1NHAA 1O7LA 2FBIA 3MZHA 4CHUA 2FNPA 4O3MA 3HSFA 5E1XA 5LRRA 3RPQA 2MH2A 2GIVA 5E17F 1FBUA 3K69A 5HS9A 5LBQA 5HS8A 3AAFA 4JK1X 3WTZA 2DFIA 3NRVA 4NB5A 2ESNA 2QENA 3WGIA 3DF8A 3D5LA 2EA2A 2YR2A 1QBJA 1RI7A 2PMUA 5ICFA 2HYFA 1XMKA 2LF8A 4XLNF 4U7DA 2L54A 3GX4X 2RDPA 5ILVA 1Z7UA 2FEZA 1ZG5A 4EJWA 5BMZA 1F9NA 2FBKA 1XSDA 4KMUX 2W24A 2HR3A 1W7PB 3QP6A 2HKXA 2HYGD 2UXNA 1TBXA 3ZN0A 4HX4A 5FO5A 1JE8A 5HDGA 3F6VA 2D2WA 3CO7C 1ZREA 3H92A 2MC3A 4Y15A 4A0YA 4OIRF 1LDKB 2QWWA 1V3FA 5E18F 2C6YA 5D5XB 1FT9A 2MA3A 4LG0B 2J5PA 1DUXC 4L9NA 5CVUA 2FA5A 2ETHA 4ASNA 1J59A 3FWEA 3IWFA 4KUMA 1H9TA 3DQVC 1UHWA 2VE9A 4ZYGA 2QYOA 4CO8A 4U0VA 1ON1A 3WTUC 3HRMA 4HZFA 2VT2A 2EK5A 4A6DA 1FP2A 2VBXA 1XDUA 2IRFG 1RIOH 1DPRA 2Z9OA 1MKMA 5DD8A 2EV6A 3TKYA 4ENJA 1YS6A 3HHGA 1FY7A 5D6EA 1TNSA 2JZYA 4IVNA 1FBQA 3HRUA 2OD5A 5ERIA 3O3KA 2NRAC 4DQ2A 4OIOF 3VODA 1BIBA 2L01A 3E6CC 3K0LA 1LVAA 3SXYA 4M9ZA 1REPC 5F1RA 3F8CA 2DW4A 4BYYA 3TO6A 2VC1A 4EGYA 3ABUA 2RVCA 2ELHA 2P7VB 1Q1HA 4MHGA 2V1DA 5DCMB 1BC7C 4KIBA 2M1BA 1TTYA 4ZZLA 3T8TA 3OOPA 2K27A 3ZMDA 2YPRA 3ZMSA 4UNOA 3KZZA 4KT5C 1C0WA 3GFJA 4Q4ZF 4LG0A 2XRNA 3ZQ7A 1FSHA 5HOOA 1IN7A 4NHJA 2AS5F 1J7KA 3VEPA 4AIHA 4EGZA 4EM0B 1XDSA 5DYMA 4KNYA 3Q5FA 1KU7A 2MLKA 2E7XA 4AD9A 2PN6A 2ZO4A 1BI3A 5ICGA 2O03A 1I27A 4ETSA 2Q0OA 2ZJ2A 3K1PA 3LSTA 2VBZA 2ZKZA 2ZCWA 4ZYDA 3GF2A 6PAXA 5DEQA 2O3FA 1U8RA 1EV7A 3OV8A 1FSEA 3WODF 4EJUA 3GUDA 2NNNA 4WF2A 2MBFA 4UXNA 4EV0A 2H27A 3CUQB 2R7DA 4H0EA 1ZGAA 4YFNF 5IT9K 4WXCA 1BC8C 2FBHA 3KP6A 3GO5A 4BHCA 4RS8A 4RB3C 2KKOA 1U5TB 5DCMA 4S05A 3C3WA 2CWEA 4FT8A 5AONA 3V7RA 2KIFA 1XCVA 2ADUA 4G8XA 3E5XA 4YG2F 1OYYA 5JVTA 1FLIA 4RGRA 2BBYA 3I64A 1KYZA 3ERED 4I98B 3MEXA 5D4RA 4G7HF 3RIRA 4LLNA 1KU3A 1YIOA 2UWMA 3ZMVA 1VTNC 4Y13A 2RGVA 2FF4A 1I1GA 4WXDA 4KYWA 5AIPA 2X4HA 1I1SA 3T5XA 3I54A 4XSZF 2OU2A 5E1ZB 1U78A 2YU3A 3HTSB 1O3RA 3GEZA 2V9VA 2NYXA 2DLLA 3BROA 3IC7A 1G3WA 3N97A 2V6CA 5CYVA 3GFIA 4P5OA 3TGNA 2PG4A 5FLXK 2D1HA 3GZ6A 3MQ0A 2RV8A 2P5VA 2A5YB 3QU3A 1P2FA 3COAC 1P4XA 1G3TA 3HSRA 3MZYA 5D6FA 1G3SA 3R6SA 5CVJA 3SZTA 2OQGA 1G6NA 1KQ0A 1J2XA 5E8GA 1OPCA 1YG2A 4YFKF 2JTVA 5F6FA 1OR7A 3RYRA 4BHPA 2K4BA 1U5TA 2VE8A 2FRHA 2PFBA 5F64A 3EUHA 3LFKA 4BXUA 2A69F 1OYWA 3E6MA 2OZ6A 1IAWA 4M71A 2WC2A 5CLSA 3IRQA 4GYIA 1B1BA 3BPVA 2O61A 5FD5A 5L3GA 5K5QA 3DXJF 4IRHA 3BPXA 1IRGA 1GVJA 2ZFWA 5CVRA 4XSXF 3LA2A 3TDUC 4IHSA 3F8MA 2XV4S 5HVQC 3K1NA 1K78B 2BEOA 1QO0D 2GA2A 3DP7A 3I53A 3FXUA 2P6TA 4L0YB 1XN7A 3LAJA 3V8LA 4FX0A 3MCZA 1FOKA 2H6CA 3EYIA 1FYLA 5HLGA 3BJ6A 4ZYHA 4HX7A 2HOEA 4S04A 2KJBA 2UZKA 1TQIA 2XAQA 3F23A 3SZPA 2CYYA 3MAJA 1IF1A 4ON0A 2HS5A 2OZUA 1U3EM 4I01A 2EFWA 4KIFA 1RUNA 4WXHA 4K2EA 1BOAA 4L9JA 3CDHA 4GYGA 2X0LA 1F4KA 1X3UA 3IKVA 4BQAA 2EFNA 4OINF 5L3BA 1R00A 2IVMA 3G3ZA 1R58A 3E97A 1YQAA 1FWZA 2XGXA 2WWYA 5H20A 3BZ6A 2ZBKA 3F22A 1GXPA 3SQNA 2K7LA 2FMLA 2A68F 4A0ZA 5ED4A 5ILSA 2P5LC 3P9CA 2AXLA 1B59A 2W85A 3T1BA 2OQRA 5JHUA 1UFMA 4EJOA 1H9GA 2KJCA 1XD7A 4AWXB 1HW2A 2QQAA 1XGSA 1P4AA 4RAZA 2PMHA 1LQ1A 2FSWA 2DO7A 3WTSC 2O8XA 2XAFA 2IA1A 1ZYRF 3WE2A 5J6XA 5L3EA 1MJBA 4MQ9F 4I02A 3WG9A 2HZTA 1HKSA 1W5SA 2H94A 2RC4A 4MTDA 1KYWA 1R23A 3LAPA 3QRFF 2QUFA 1R1TA 2P8TA 2ESHA 5DUKA 1S3JA 3ML6A 4HYEA 4GO1A 2G7UA 2M30A 2HWVA 3GW2A 3ZN1A 1R5HA 1J75A 5LGNA 1ZHFA 2QQBA 1HW1A 3QOPA 3DKWA 4UUVA 1H0MA 2L02A 4Q47A 3T0YA 2V1XA 4A5MA 5IT3A 3BY6A 3JAMZ 3KP4A 3KETA 3ULQB 1SFEA 1OYIA 1JHFA 3BDDA 2D1VA 3RI4A 2VOPA 2HTJA 4XRFA 5D5VB 1XGNA 1KA8A 1EH8A 4U0YA 3F8NA 3F3XA 1YW9A 5EEHA 1WWXA 1CF7B 3MWMA 2ZNYA 1TW2A 4HF0A 1ZLKA 3GWZA 1IXRC 1JHHA 2KIMA 3WTYC 1QZYA 4E70A 4M73A 4EM1A 4M9XA 4LD5A 4B8XA 2LF7A 2EWNA 5DCFA 5LHGA 5H6QA 4G9YA 1USSA 3REOA 3WGGA 2DT5A 4P55A 1B4AA 1KQ9A 3TO7A 3S2WA 4I7HA 2GQQA 2EB7A 4PGGA 4M9SA 1O57A 3C18A 4XBFA 4LB6B 4I0BA 4YFXF 1R5GA 2O0YA 2R3SA 1XGMA 4A2UA 1T0FA 1T6SA 3V8JA 3VFZA 1IN8A 3CJNA 3KP3A 3SFZA 2BV6A 5D8LB 3F21A 4HLXA 3CUQC 3Q9SA 2GXGA 4OMYA 1B6AA 2E1NA 4ZYEA 1S8NA 3E6BA 3HSEA 2MLGA 2DPDA 2VONA 2DK8A 4I0AA 2RQPA 1CF7A 2D45A 1U5TC 4JBAA 1XGOA 5TRDA 4LK1F 5CJ9A 5H6RA 1LEBA 4TV7A 4O6JA 1FC3A 4Q5SF 2DAOA 4CICA 1QNTA 2DI3A 3J80Z 1BN5A 4HF2A 4BAYA 3GFMA 1YW7A 2E7WA 3W6KB 1T2KA 1U2WA 2LDUA 3H3ZA 3DPTA 3KEQA 3JSPA 3ISPA 2JSCA 3KE2A 3E5UA 1ZG3A 1KU2A 2V79A 4HW0A 4JQFA 4G94A 4F7ZA 2QZ8A 3HYIA 3I71A 2IJLA 1YW8A 2FMYA 2VOOA 1W5TA 1FX7A 1A04A 4WWCA 2VC0A 3WTWC 3MFKA 1Z9CA 2DQLA 1BIAA 3BOQA 4A12A 4HF1A 4O5VA 2L4AA 4AIJA 3FX3A 4EJTA 3ECOA 1KQ8A 3QP5A 1S7OA 3U9GA 3LQRA 2COMA 4RAYA 3V7SA 1IRFA 3V4GA 2QLZA 2EJRA 2A3SA 3M9AA 4MQVA 3W6JB 2YX4A 4NQWA 2QQ9A 3IRRA 5BQTA 2ZMEB 4WK8F 5DDGA 3B73A 3RKYA 4L9VA 4OMZA 2XAHA 2OA4A 4KFCA 2GWRA 4HOBA 4CXFA 3JW4A 4PDKA 1B9NA 2PQ8A 4HA8A 3HOSA 1D5VA 3DV8A 3K1MA 5HLHA 3TQNA 1LDDA 2F2EA 4G6QA 1USTA 1UHMA 1YYVA 3C1DA 4LMYA 1LEAA 2CO5A 2IW5A 3TOAA 2VBYA 2DBBA 3E3VA 5D5WB 4IPAA 4G7ZF 2XVCA 1D3YA 2FE3A 5K1YA 4HLYA 3TOBA 4AVPA 4ENKA 4ENMA 1FYMA 1K6OA 5D4SA 3M8EA 1O3TA 2ZXJA 1FZPB 1T38A 1SFUA 1FBSA 1Z1DA 4IJAA 2Y0MA 4A5NA 3B02A 3IL2A 3V8KA 2HEOA 1Z6RA 5ICCA 1RZ4A 2ZMEA 1I6XA 5FFXA 3ABTA 2RKHA 4U88A 2LKPA 3G73A 3KCCA 5LHIA 1WSUA 3RTRA 1SMTA 2XASA 1MJAA 1SMYF 4ZH4F 3ELKA 2GZWA 3GVAA 1R7JA 5AIQA 2Z3YA 3BJAA 3PFIA 3ROUA 4OU0A 3GLXA 2DQRA 2W25A 3F72A 2EA4A 3JAMK 1ULYA 1Z91A 3ZMUA 4HV5A 5JI6A 1G4DA 3U2RA 3KLNA 3F8BA 2F5FA 3CLOA 1P92A 5BPDA 1P6RA 1R1VA 4AIKA 2NNYA 4EMSA 4LB5A 3KEOA 3O6BB 3RPUA 5BPIA 4Y17A 2JPBA 2Q2EA 3HRTA 1QPMA 2A61A 3EQLF 3IWZA 4N9HA 3WGHA 1IN4A 4KICA 2JRTA 4UV8A 1PUEE 2IA0A 3I59B 4RGSA 2DK5A 3WTTC 2VXZA 1ZLJA 4G6DA 1ON2A 2BGCA 1Z6TA 3BJOA 4HQEA 1L3LA 5L3DA 3VB2A 2PLYA 4CGZA 4BHBA 3LQQA 1W4MA 2R7FA 2F5CA 4ESJA 1MDMB 2FU4A 2K4JA 2V1UA 2F5DA 3EYYA 3JTGA 1WQ2A 1S7AA 4U7BA 1XMAA 5ICEA 2DPUA 3KZYA 3SHFA 2ACJA 3J81Z 2MH9A 5L3CA 1ZRCA 1Z05A 3TO9A 3HHHA 5KK1A 3LWFA 1BI1A 1RNLA 4GXOA 3C7JA 1YS7A 2EFQA 1HSJA 4IXAA 1XCBA 5D5UB 1TNTA 5BOXA 3CUOA 2EV5A 3E6DA 5KVRA 1L0OC 2FQ3A 5FFZA 2VN2A 3EDPA 1XSXA 3J80K 1ZRDA 3I59A 2W57A 1J5YA 1K79A 1S29A 2CFXA 3ZPLA 2H09A 5CVIA 2XHKA 4KDPA 3RJPA 2HGCA 1ZH5A 1ZGJA 1O7FA 5FB2A 2GA1A 4A0XA 1CGPA 1MDMA 1FNNA 2L3DA 5FLXZ 4R1HA 1FP1D 3E5QA 1JGSA 1ZRFA 4KMFA 2K02A 2KRFA 4RGUA 2GXBA 1G3YA 1KU9A 2E1CA 2VT3A 3I0TA 2BE5F 3FXRA 4M74A 2ZNZA 4OIQF 2KIUA 3J7AO 2Q8KA 1T39A 3FM5A 3PQKA 4MEXF 4Q48A 2UXXA 3WTXC 4P9UA 1I5ZA 5E8IA 1XB4A 4U0WA 3FXQA 2MD5A 3V7CA 4EQQA 1MZBA 4LLLA 1S6LA 3T8RA 1DP7P 1R22A 1QQIA 2HQNA 4LGWA 4ESFA 3FM3A 3K9TA 3O2PE 3R61A 2ISYA 4KIGA 2P7CB 1IXSB 5HDNA 3WU1B 1SD7A 4WX9A 1PDNC 3CO6C 4LK0F 4BNCA 5DV5A 1TLHB 2LNBA 3JSOA 2IA2A 3FZVA 4ZZDA 5HS7A 2J5OA 3RYPA 3ZMTA 2VBWA 4N0BA 3NQOA 2VODA 2IPQX 2Y75A 3M1EA 1STZA 1TQPA 5LLQA 3DEUA 1BM9A 4KN7X 4P9FA 5JR3A 5E20A 2YSRA 5L3FA 1MJ9A 1QZZA 2CGPA 1YFHA 2STWA 5EEGA 4CDGA 5FD6A 2FNAA 1BI2A 5HDKA 1IUYA 2JPCA 1D8JA 2EFOA 2XUBA 5LEKA 1W7PD 1D8KA 3I4PA 3L09A 4I09A 4CYDA 2M8EA 2IT0A 3WTVC 3L9FA 3H3UA 1ZN2A 4N9IA 5LGTA 1W7PA 1MD0A 1WKMA
chains in the Genus database with same CATH superfamily
2LFBA 1PP8F 2VKVA 2DT6A 3FK7A 2QVOA 2A07F 4BL0B 3VOEA 3L2CA 4RLQA 3NAUA 2XAGA 2XAJA 3DFGA 4EM2A 4A3KJ 2BW3B 2Y31A 2A6HF 3HIFA 4PCQA 4RB0A 5CVVA 2Z33A 1S9HA 3R4KA 4MEYF 4NUBA 1E3OC 4M6YA 3PNVA 2ZJQF 4HNUA 3AL0C 2QM3A 2CQQA 2HQ5A 2XSJC 1IN5A 2HKOA 1HQCA 2FOKA 3AFHA 4AIDA 5EGOA 4HAMA 2DA2A 5A2QZ 1OKRA 4L18B 3BG9A 3X2QH 4AYBN 2VKHA 3H9JA 3S1RJ 2XAUA 2WAFA 3HPGA 3K4MA 3MKLA 2PBIA 3PSIA 2LLKA 4ZDOA 2PI0A 3ZQCA 4XONA 5GPCA 1ODDA 4YIFA 1D1BA 1HSTA 2VXDA 1FPQA 1X1DA 2ELJA 2PJPA 2IBDA 3DWLE 3QYFA 3R0AA 4D0PA 4XICA 2P6SA 4LLGF 3S14J 3KP5A 2DYRH 3P9IA 1LB2A 1AOYA 5LGUA 4II2A 4UHTA 2LMDA 1SAXA 3MD2A 4OIPF 4P1WA 4E7ZA 5DD4A 1FYKA 3HG9A 3M1CA 3RKWA 1N78A 4NC8A 2HDCA 4ENNA 1BW5A 3I56I 4PGHA 4BJ5C 2F4IA 1ETXA 3HC7A 2DFFA 4M6VA 4IRIA 1YLFA 2EH3A 1LE8B 3I5UA 2FXAA 4KA4A 2H1KA 3EETA 3GXOA 3ZMZA 2WV0A 3ASNH 3GFLA 5EEAA 1KZHA 2P5KA 1RRJA 4KN4X 1AWCA 2CG4A 4A93J 4UVBA 5HLIA 4IHTA 2LSOA 3N4MA 2JJ7A 3C2HA 3M4OJ 2E60A 2XKPA 1FMVA 2GAUA 4A3FJ 4CYCB 2R93J 1AHDP 4HQMA 1Y0NA 3P9KA 2NS0A 2HZDA 2G9WA 2DTRA 1MSEC 4MNUA 1T98A 2XKOA 4E7SA 4FE7A 4L9TA 5FRMA 2OPTA 2DJIA 4IOAF 1W1WE 1PVEA 1NTCA 2XGEA 3BR2A 1WZ2A 2BYVE 2H8RA 2HFHA 4HBLA 2L2OA 1E2XA 2R7TA 3LA7A 1XTAA 2O8KA 3E0JB 4HDUA 3S1NJ 1MMAA 3OSGA 1LDJA 1UB9A 4M72A 3GZ5A 5J8FA 2OAZA 3J81K 9ANTA 3HOTA 1MIJA 4EATA 4XLAA 2DU9A 3OS1A 4R8HA 3GMEA 1R36A 1O3QA 2GXAA 1IO2A 2BOLA 4FX4A 1XC5A 1JXSA 4MTEA 1PP7U 4XN3A 4RB1A 3GYHX 1G59A 2QKMB 2KRHA 1POGA 2XIGA 4OAZA 2F4OB 2R7VA 1D5YA 3HUGA 5TJJA 3RDIA 3HTUA 3QPHA 1HBXG 3W6VA 3HOVJ 4BGDA 1KGSA 3WU0A 1E3PA 4XQFA 4LFUA 4L5IA 3H36A 2CQKA 3Q9VA 2QGUA 4XLFA 1YRNB 3MN2A 2Y69H 1HKQA 2EV0A 2H6BA 2B0LA 3RSNA 4QWQA 3LA3A 2HTSA 4GGGA 4BJ6C 3LMMA 5FROA 3RZOJ 3M7GA 4CCOA 5B3SH 4XKVA 4QLCU 2K9LA 2V9KA 3D5RC 3PQJA 1BR4A 2QBYB 3CCQI 2EZLA 1OCOH 4A6EA 1SFKA 2JQ7A 3JRHA 1MMNA 2Z2SB 3DU5A 2MABA 4QIWN 3CCYA 4ZJZA 5LRSA 2CUZA 2E1OA 1LE8A 3GTQJ 4LOCA 2M8GX 2M5WA 4I76A 4PSXA 5JFRA 1ZAOA 1MNMC 4OOIA 4HDVA 5FGMA 2KDOA 4A3CJ 1SD6A 2NAZA 2Y48A 1P4WA 3ECHA 3I4NJ 1WI3A 3TW6A 4ESBA 3AG4H 1YTYA 2HDDA 1Y0UA 3ZR8X 1IG7A 2R7QA 2IGNA 2E35A 1RR7A 2A05A 3G6EI 4EVIA 5E1WA 5F0CA 3UNGC 5LHHA 4C30A 1MSFC 4CUGA 3IKTA 2F5EA 2M4KA 1XSVA 3R60A 3QU6A 3CUQA 2M45A 2Y0SA 3LSMA 2K86A 4QPQA 3P7NA 1B9MA 2HQRA 3K2ZA 1VQ4I 4YIIA 1IZ1A 4L0ZB 3GTMJ 1ZARA 3FHZA 1J09A 4E7JA 1BI0A 2ZC2A 2JT1A 3M8FA 1K7AA 3DPLC 1RETA 3RCOA 4C3IJ 3ESWB 2LD5A 2A6EF 2HDWA 4G7OF 1MMSA 1R4NB 2CH0A 4XN0A 1F5TA 5K7HA 2IGKA 1V5GA 3KFWX 4R79A 2Z5UA 1SD4A 3QPSA 4EJVA 5DTDA 1Z21A 2DJNA 1P9QC 4P96A 3FXJA 4UUSB 2WY7Q 1TQMA 3ZP5A 5DUIA 1APLC 5FKNA 1MW7A 4WCGA 1X1PA 1IXCA 3FMQA 1QGPA 2ID3A 1UAAA 1IN6A 5K5RA 3F6OA 2CV2A 5BNGA 4UVAA 2BVMA 3C2GA 4A3EJ 4D5CA 4L5JA 2L4MA 2HVRA 3BG6A 2JUGA 4PZJA 2HOSA 3QAHA 5E3MA 1BBYA 1EH6A 3LOCA 4Z2YA 1HXDA 5BS6A 2DFHA 3R0JA 5JLXA 2QBYA 3AG2H 1OMIA 3MKYB 1JGGA 1WI9A 2ZXWH 2IP2A 3GTOJ 2VPLA 2E2JJ 3KYLA 1J9IA 1ZKGA 3FMRA 1YOVB 3DEEA 5GPAA 2TDXA 4PSWA 3G1OA 4L5EA 4IRGA 1ZG1A 1DPUA 2MSYA 3I58A 4RA2A 3CCMI 2MC4A 4W97A 2OCEA 4HEA2 2E34A 2ISZA 1LJ9A 4A3BJ 3NWTA 1SANA 2CRGA 3FBIB 1HKTA 2STTA 3A0HC 3SDGA 2VJ4A 4CZZA 2BY2A 4FHTA 2RNJA 2K3PA 3HGYA 4IL6C 2RN7A 1XG1A 3DEWA 3CCLI 4XLPF 2O6GE 4MLOA 1GUUA 4M3DA 1UG2A 5LEJA 3CCUI 4ITVA 4B09A 1FOXA 1D1CA 3B6AA 3JCUC 1XPXA 1V4RA 2W82A 1JKPC 5J8CA 2CW0F 1HW5A 5K5OA 3VDXA 2QEXI 2EFPA 3TEDA 1ETYA 3FBNB 1MBJA 3PFYA 4IF4A 1F1ZA 2YX7A 1X3ZB 5IPAA 3H5RA 3KLOA 1BJAA 2ZSHB 4RGXA 1MNEA 3CJRB 2PEXA 3F8FA 4UVCA 1ONVA 4ZDPA 3GLLA 3CTAA 3BCAA 1GHCA 5D8KB 2TRTA 3TDZC 3OYAA 3FF5A 1DDNA 4HX8A 3KIOA 1DU6A 2JVGA 2GOMA 2CSOA 3QPLA 2FQ4A 3D0SA 1ACIA 1T0FC 4HV6A 5F27A 3WE3A 1OCTC 4DYQA 5E79C 5IT9Z 2ELKA 4MGRA 3KP2A 3U1KA 1MGTA 4BH9A 3ASOH 1RUOA 3FMSA 3HEFA 1E17A 2CV1A 3U1DA 1Y1WJ 3NEUA 3NARA 4UV9A 1O3SA 1WJCA 3BR6A 3KP7A 3L7WA 2WB1A 3BP8A 2WAQN 3OR2C 2G7HA 4M6XA 3JTHA 4I2OA 1Z0XA 2M9HA 1DGRM 1SFOJ 1SFXA 2BY3A 2HU9A 4DNCA 4RB2C 1SVMA 1SD5A 4F91B 5ILUA 1J0RA 1TW3A 1LNWA 2M87A 1UCRA 3Q0WA 2R7SA 1QRYA 2P4WA 3IHUA 2Z99A 3PUFA 3HOXJ 3HRSA 2R7XA 2WTEA 4NDLA 2W84A 2NS8A 4FETA 4GCVA 1WRJA 3BCBA 3ERMA 5M3MJ 1LVKA 1VI0A 2DA5A 1K78A 3LL7A 2DOFA 2XROA 3JR9A 2PMZA 5F08A 1ETOA 3VSKA 3ZOBA 4E6KG 1U6GA 1IW7F 4XLHA 5TISC 5A2QK 1HF0A 1T95A 1R6RA 1X1CA 3L00A 3GTGJ 2F48A 3RKXA 3BWGA 1EH7A 1W36D 3BG3A 2OBPA 1YO5C 2HPIA 3QPTA 1AA7A 5IY5H 1ZELA 3CC4I 1R1UA 4LJZF 1IRXA 1GXQA 2K40A 1NHAA 1O7LA 2FBIA 2WA0A 5IOYA 2AQFA 3MZHA 3L2VA 4CHUA 2CS3A 3DKYA 2FNPA 4DBQA 4O3MA 2B63J 4A3LJ 3IH3A 3HSFA 2L7MP 4UB8C 3SDBA 3BR5A 1N25A 5E1XA 5LRRA 4ZYAA 3RPQA 2MH2A 2Y30A 2X6YA 1VQOI 2GIVA 1F36A 4D5FA 5E17F 1Y6IA 2DTZA 2X6XA 5CQEA 1FBUA 3D1NI 5J4YA 3K69A 4IOCF 2LTPA 5HS9A 4S0HB 1EF4A 5LBQA 4ZTJA 1LKXA 5HS8A 3A03A 3AAFA 4JK1X 1Y8RB 3WTZA 2DFIA 3NRVA 1BL0A 3PSFA 4NB5A 3CP8A 2ESNA 1VQ8I 4FASD 1WJ5A 2QENA 1HA8A 3WGIA 3DF8A 3D5LA 2EA2A 2YR2A 1T33A 4CCNA 3ZQHA 5B66C 2IGMA 1QBJA 1RI7A 3PNTA 2XPUA 2PMUA 5ICFA 3DCFA 3Q0VA 2HYFA 1NK2P 1XMKA 2LF8A 1YJWI 4XLNF 2LOOA 2F4MB 4U7DA 2L54A 3GX4X 2RDPA 5ILVA 1Z7UA 4BY7J 2FEZA 1ZG5A 1I6HJ 3KEYA 3CJQB 5KAIC 4EJWA 3OIPA 3GCMA 4DIQA 1Y8QB 5BMZA 3QQAA 3K7AJ 1F9NA 2FBKA 2JWTA 1XSDA 3ABKH 1DU0A 1ORKA 2L5QA 1YJ9I 4KMUX 2R7ZJ 3FK6A 1RKTA 3SJMA 1ETWA 2W24A 2HR3A 1W7PB 3OYJA 1IJWC 4A3JJ 3S1MJ 3QP6A 2EQRA 3K4LA 2EPFA 2HKXA 3QYBA 2HYGD 2UXNA 4M3GA 3P5JA 2NS7A 1X3WB 1TBXA 4F3QA 3ZN0A 4CSWA 1JKQC 3B6CA 3JREA 4HX4A 5FO5A 1JE8A 5HDGA 3OYEA 3F6VA 5C4JJ 2D2WA 4CCKA 3CO7C 1ZREA 2DCEA 3H92A 2MC3A 4Y15A 3DBHB 2DA7A 2MFZA 3TBIA 1SVLA 4DZJA 4A0YA 2CQ7A 1DP3A 2GM4A 1EKEA 3ZQFA 4OIRF 3OL3A 1LDKB 4B4CA 1OJLA 2QWWA 2ZXHA 1V3FA 3KYDB 2DMPA 5E18F 1JT0A 2C6YA 5D5XB 5B1AH 1FT9A 2JA6J 2MA3A 3ABLH 4LG0B 2J5PA 1DUXC 4L9NA 5CVUA 2FA5A 2D5VA 2ETHA 4RMNA 3I4MJ 2DT7B 4ASNA 3SYTA 1J59A 3FWEA 3CDIA 3IWFA 4KUMA 3JRCA 1H9TA 2DYSH 3DQVC 4PFOA 1UHWA 2ZSIB 2VE9A 4E7HA 2AXTC 2QYOA 4ZYGA 1TZLA 4IHXA 2XSDC 4CO8A 4U0VA 3CP2A 1ON1A 3IUOA 3WTUC 2BY0A 1K83J 2V7FA 3HRMA 4HZFA 1JUSA 2VT2A 2EK5A 4A6DA 1FP2A 2VBXA 1XDUA 1I3QJ 5DM6F 2IRFG 3A02A 1RIOH 3CDLA 1N77A 3BG7A 1DPRA 2OTLI 1V5EA 4B44A 2Z9OA 1MKMA 5DD8A 2EV6A 3TKYA 4ENJA 1YS6A 3S93A 3HHGA 1FY7A 1ETKA 5D6EA 1TNSA 1D0ZA 2JZYA 3K4CA 5CQGA 3W3CA 4IVNA 1FBQA 1OCPA 4I99C 3CCJI 3HRUA 2IS6A 2KZGA 2OD5A 3K4JA 1MBGA 5ERIA 3O3KA 3RZDJ 3LSHA 2NRAC 4DQ2A 4OIOF 3ZCOA 1VQNI 2DMTA 3VODA 3VYTB 1BIBA 3GTJJ 2L01A 3E6CC 3K0LA 1LVAA 2M34A 2M2EA 5FJ8J 3SXYA 4M9ZA 1REPC 4Z6YA 5F1RA 4RDUA 2LKSA 3F8CA 2DW4A 4PJJA 2HNHA 5JVGF 4BYYA 3TO6A 2VC1A 3O8HA 4EGYA 4HNTA 3ABUA 5M5XJ 4RLFA 1K6YA 2RVCA 5GADJ 3W2AA 2ELHA 2P7VB 1JJ8C 4RM2A 1Q1HA 4MHGA 1BW6A 1Y56A 2V1DA 3H0GJ 4KIBA 5DCMB 2M1BA 4CCJA 1H8AC 1TTYA 1BC7C 4ZZLA 3T8TA 3OOPA 2K27A 3ZMDA 2E5NA 4DZPA 2YPRA 3ZMSA 3HUGB 4UNOA 2H1LA 3KZZA 4KT5C 5FKOA 1C0WA 3GFJA 4Q4ZF 4LG0A 2XRNA 3ZQ7A 1FSHA 5HOOA 1IN7A 3S3MA 4NHJA 2IAIA 2AS5F 1J7KA 2DA3A 3HGGA 3VEPA 4AIHA 4EGZA 4KT6A 4EM0B 1XDSA 2E2IJ 5DYMA 4KNYA 3Q5FA 1Z3YA 1KU7A 3F0CA 2MLKA 3ONQA 1LFUP 5E3LA 3DBLB 4G6TB 1TT5B 2VJIA 4RM3A 4LIVA 2E7XA 4AD9A 2PN6A 2ZO4A 2JA7J 3CCVI 2XGDA 1BI3A 5ICGA 3TW7A 1HLVA 2O03A 1JKRC 1I27A 1M1EB 1TWHJ 4ETSA 1VQPI 2Q0OA 4H4KC 1U9OA 2ZJ2A 3I9V2 3K1PA 1UHSA 3LSTA 2VBZA 2Z1DA 4BS9A 2JK3A 2ZKZA 2ZCWA 4V2FA 4F92B 2LKXA 3PJRA 4ZYDA 3GF2A 1U0JA 3L2RA 1ETQA 5K7FA 6PAXA 3DTEA 5DEQA 2O3FA 4XK4A 1U8RA 1NK3P 1EV7A 1B72B 3LSGA 3OV8A 1FSEA 3WODF 4EJUA 3GUDA 2NNNA 4WF2A 2MBFA 2HXOA 4UXNA 1WGXA 3IH2A 4DYCA 5J3LA 3JRDA 4EV0A 3M07A 3FIWA 2H27A 2I5UA 3CUQB 1P7IA 5LFAA 2R7DA 1HOMA 4XMYA 2DA6A 4UB6C 2XB5A 2EIJH 1A31A 2EIMH 4H0EA 5F04A 1Y39A 4MFEA 3S3OA 1QVTA 1ZGAA 4YFNF 2EINH 1A6IA 3ABMH 1PJRA 4WXCA 4BBRJ 5IT9K 1V54H 3HXLA 3CJTB 1BC8C 2FBHA 3KP6A 2MD0A 2JRMA 3GO5A 3UR3C 3OYBA 4BHCA 2XF7A 2XPVA 3HOYJ 2ID6A 2BZTA 3MMYB 3OIOA 4RS8A 4RB3C 2KKOA 1U5TB 2I8DA 5DCMA 5F0HA 3C3WA 4S05A 4YRVA 3BZKA 5GTHC 2CWEA 4FT8A 5AONA 2MGQA 3V7RA 2KIFA 1XCVA 1QHHD 2ADUA 4G8XA 2Y2ZA 3E5XA 5EZGA 4YG2F 1OYYA 4B3AA 5JVTA 1FLIA 2CUEA 4RGRA 2BBYA 5C3EJ 3IAM2 3I64A 1UJ8A 1VF9A 1G2HA 3QOEA 1KYZA 5J1UA 3ERED 1QVUA 2KT0A 1BJZA 4Y4RA 5IP7J 3H0DA 4I98B 3MEXA 1OCCH 5D4RA 4G7HF 3RIRA 2CUJA 4LLNA 1KU3A 1YIOA 1FOYA 2UWMA 4IQJA 1Z67A 2F5VA 3G1MA 4PFPA 4IZZA 3ZMVA 4XOTA 2JMWA 1VTNC 2X1EA 1K4SA 2V1NA 4Y13A 4BUPA 3BQZA 3CMMA 2RGVA 2CJJA 2FF4A 1I1GA 3J7AY 4WXDA 4B47A 2DN0A 1AKHA 1V55H 2RNGA 1O4XA 4KYWA 2CUFA 5AIPA 2CV0A 2X4HA 4Y52J 1I1SA 2HOTA 3T5XA 3I54A 4XSZF 3LSJA 1FOWA 2OU2A 5E1ZB 2BY1A 2XF6A 3VSLA 1U78A 2YU3A 3HTSB 1O3RA 3GEZA 2V9VA 2NYXA 2DLLA 3RKQA 1JUPA 3BROA 3IC7A 1G3WA 3N97A 1KONA 1DQUA 3PIOF 1B72A 2V6CA 5CYVA 1W36C 3GFIA 2CFOA 4P5OA 3TGNA 1FJLA 2Z16A 2PG4A 5FLXK 2D1HA 4AU7A 3GZ6A 3MQ0A 1AU7A 4AC0A 2RV8A 2P5VA 2A5YB 3QU3A 2PJRB 1P2FA 1D0YA 3COAC 1P4XA 1G3TA 3HSRA 3MZYA 4BACA 5D6FA 1R71A 1G3SA 3R6SA 1GV2A 3MKZA 5CVJA 3SZTA 2OQGA 1G6NA 1KQ0A 1J2XA 5E8GA 2V26A 1OPCA 3SEZA 4QTRA 1YG2A 4YFKF 2JTVA 5F6FA 1OR7A 2E36A 3RYRA 2R7WA 2VJ5A 4BHPA 2K4BA 1U5TA 2VE8A 1R4MB 4F93B 4FE4A 1GDTA 1N75A 2FRHA 4LIUA 4B48A 4J01A 2PFBA 4IEJA 5F64A 3EUHA 2CW7A 3LFKA 4BXUA 2A69F 3RQ4A 3HKZA 1OYWA 3E6MA 3CLQA 2OZ6A 5J47A 3DTIA 3MZ8A 1XS9A 1IAWA 2G0EA 2VIXA 4M71A 2KDZA 2WC2A 3LSPA 5CLSA 2HI3A 3IRQA 2VASA 4JX5A 1TWGJ 4GYIA 4BKXA 1B1BA 3BPVA 1ZR4A 2O61A 4I6ZA 5FD5A 4X6AJ 5L3GA 2R0QC 4II3A 5K5QA 3A1YA 4BEHA 4A3GJ 4C2MJ 2E19A 3DXJF 4IRHA 1MBKA 3BPXA 1IRGA 1GVJA 1X19A 2ZFWA 5CVRA 4XSXF 3LA2A 3TDUC 4G12A 2DXIA 3OYHA 2B9SA 4IHSA 1FIPA 3CD6I 1VQKI 3F8MA 1LPQA 3OS2A 2XV4S 5HVQC 2NOGA 3K1NA 2W7NA 4A3MJ 1K78B 2BEOA 3QODA 1QO0D 1I50J 4XRSA 1OCZH 2IS1A 2MW8A 2GA2A 3DP7A 2EILH 3I53A 1SVOA 3OYIA 3FXLA 3FXUA 2P6TA 4L0YB 1XN7A 3LAJA 3V8LA 4QPOA 1RPWA 3ZQGA 4FX0A 3MCZA 3JRGA 1FOKA 3BT9A 2GIZA 2H6CA 3EYIA 5EZHA 1U9NA 4IX7A 1FYLA 1MBEA 3BJ6A 5HLGA 4ZYHA 4PUSA 4HX7A 2HOEA 2CU7A 4S04A 2KJBA 2UZKA 3H9GA 3N05A 1TQIA 2XAQA 1T56A 3F23A 1SEUA 2OUMA 2GOXB 3SZPA 2PJRA 1YX5A 2CYYA 1HDDC 2GBYA 3MAJA 1IF1A 4ON0A 2HS5A 2OZUA 5EYRA 1U3EM 4I01A 2EFWA 4CA0A 2VKEA 2XPWA 4KIFA 1RUNA 4WXHA 2VB6A 4K2EA 4D7MA 1UMQA 1BOAA 2DFEA 1FIAA 1IRZA 2M7AA 2JA2A 3VYUB 4L9JA 3CDHA 4GYGA 2X0LA 1VQ9I 4HRIA 1F4KA 4JOMA 1SC7A 1WCMJ 1VFCA 1X3UA 3IKVA 5H2FC 4AM3A 4BQAA 2K5CA 2LH9A 1E0EA 5M5WJ 2EFNA 4OINF 5L3BA 1B8IA 1WH7A 1UELB 1R00A 2QSGX 4Y33A 2IVMA 3G3ZA 2DA1A 1R58A 3G4SI 2E1MB 3E97A 2HQAA 1YQAA 2R7OA 3G1LA 3FKIJ 5IOZA 1FWZA 4HG2A 1R5ID 3OSFA 3HB9A 3HDDA 3OIQA 1OFCX 2XGXA 2WWYA 1IV8A 3OMYA 5H20A 5FLMJ 3BZ6A 2ZBKA 3F22A 4BBSJ 4FQGA 1GXPA 4RAGA 3SQNA 2K7LA 3OR1C 2MYSA 2FMLA 2A68F 3CMEI 3E1SA 3CF5F 3ZQIA 4A0ZA 5ED4A 4XIDA 2KRCA 3FHNA 2COBA 1VQMI 5ILSA 4YEJA 2P5LC 3P9CA 2L7ZA 2AXLA 4C3JJ 4XOPA 1HCRA 1B59A 1X4PA 4UUTA 2HOAA 2W85A 3T1BA 4AYBA 2OQRA 5JHUA 1GT0C 1UFMA 4EJOA 2M0MA 3VWBA 1H9GA 5EF6A 1JJ6C 3LSIA 2L9SA 2Y9YA 3VYSB 1I3AA 4E4HA 2KJCA 2M0CA 5EJCA 1XD7A 4AWXB 1HW2A 2QQAA 4BQQA 1XGSA 1P4AA 2X1CA 2ECCA 4RAZA 1JKOC 2PMHA 1LQ1A 2FSWA 2DO7A 3FISA 2ME6A 1WHUA 2KMUA 5KHDA 3WTSC 2O8XA 2XAFA 2IA1A 1ZYRF 3WE2A 1K4TA 3RQIA 3ZRGA 2AO9A 5J6XA 5L3EA 4N4OB 1MJBA 4MQ9F 4I02A 2L9VA 4NBQA 3WG9A 2HZTA 1HKSA 3ZGKA 2L7FP 1W5SA 2H94A 2RC4A 5TGTA 1KYWA 4MTDA 1R23A 3L2UA 3LAPA 3QRFF 2K9MA 5M5YJ 2XDVA 2N8GA 4NC6A 2QUFA 2Y0SN 1R1TA 4HSTA 2P8TA 2DOEA 2ESHA 5DUKA 1S3JA 3ML6A 4HYEA 4GO1A 2G7UA 2M30A 3S3NA 2DMNA 4XRMA 2HWVA 3GW2A 3ZN1A 1R5HA 2NVUB 4BQOA 1QA6A 2LP0A 1J75A 2R5YB 4LITA 5LGNA 1TC3C 1EJ9A 2K9SA 1GV5A 1T8IA 1JI8A 1WJEA 2V6EA 4BE1A 1YHQI 1ZHFA 1TP4A 5F0FA 2QQBA 1HW1A 2QSHX 2CQXA 3QOPA 2YU9J 3DKWA 5B5EC 3CC7I 4UUVA 4CCLA 2L02A 2R4GA 1H0MA 4Q47A 2QQ8A 3QYEA 4V19K 3CQZJ 2E5ZA 3T0YA 4DJAA 2V1XA 4A5MA 5IT3A 3BY6A 3JAMZ 3KP4A 2LBFA 3KETA 3ULQB 1TWFJ 1SFEA 1ZQ3P 1OYIA 1JHFA 2LY9A 3BDDA 2D1VA 5JLWA 3RI4A 2XC7A 2HTJA 2VOPA 2K85A 4XRFA 5D5VB 1XGNA 1KA8A 1EH8A 1PUFB 2WBMA 3A01A 1WFXA 4U0YA 3F8NA 3NWSA 5J1RA 3F3XA 1YW9A 5EEHA 2VQLA 3KX2A 3UKGA 1WWXA 1MH3A 4ANJA 5KAFC 1CF7B 3MWMA 2ZNYA 3GTLJ 1MH4A 1TW2A 4HF0A 2LK2A 3EPZA 1ZLKA 3GWZA 1IXRC 1JHHA 1X58A 3TP0A 2KIMA 3WTYC 3HL2A 5DS9A 1QZYA 4E70A 4M73A 3BR0A 4EM1A 4M9XA 3SFIA 4LD5A 4B8XA 2LF7A 2EWNA 4BDZA 4BE0A 2KPMA 5DCFA 5LHGA 5H6QA 4G9YA 3LFUA 2V9PA 4A69C 1GLNA 4C2UA 2V4JC 1LFPA 4XLEA 3HPHA 2LRDA 4M3BA 3K70D 2RQQA 3DKXA 1LFBA 1USSA 3REOA 1V5FA 3WGGA 5IP6A 2X6WA 2DT5A 4P55A 1B4AA 3OY9A 4RAFA 1KQ9A 3TO7A 3S2WA 4I7HA 3TP3A 2GQQA 1TWCJ 2EB7A 1RESA 4PGGA 5EG0A 3C2BA 4M9SA 3FXMA 3BC8A 1DGWY 3GZNB 1O57A 3FKJA 3C18A 4XBFA 5GAEJ 2GLOA 4LB6B 4I0BA 4YFXF 1R5GA 4M3FA 2R5YA 2O0YA 2FJ1A 2K3FA 5KNLA 2OV7A 2R3SA 2W48A 1XGMA 4A2UA 4DGWB 3CC2I 1T0FA 1T6SA 2X48A 1NG6A 2FOWA 3V8JA 3CMAI 3VFZA 1FMWA 5FRNA 1IN8A 3CJNA 1R9TJ 3KP3A 2VPRA 2BV6A 3SFZA 2XRLA 5D8LB 1NH3A 3HZJA 5B1BH 5HODA 3F21A 4FISA 2VQHA 4HLXA 1XX5A 1Z7LA 3OYMA 3CUQC 1D1AA 3Q9SA 2GXGA 4OMYA 2W1OA 1HC8A 2XF5A 1B6AA 3DU6A 2M7BA 1P7JA 3AG3H 2E1NA 4ZYEA 1S8NA 3A4CA 2WB1N 3E6BA 4FCYA 1PUFA 4NQWB 5F1JA 3HSEA 3WHCA 2MLGA 2DPDA 2VONA 2DK8A 1GVDA 4JX6A 4XKWA 3FXOA 4I0AA 4XNFA 1OR7C 1XMXA 2RQPA 1CF7A 1VZ0A 2D45A 1U5TC 3KYCB 4JBAA 1XGOA 5TRDA 4A3IJ 3BG5A 4LK1F 5CJ9A 5H6RA 2QKLB 3EUHC 1LEBA 4TV7A 1VQ5I 1FTZA 4O6JA 4PJLA 1FC3A 4Q5SF 1YX3A 2DAOA 4CICA 3CCRI 1QNTA 2DI3A 3J80Z 2XB0X 2PMZN 1X2NA 4DYRA 1BN5A 2DOAA 2WADA 4HF2A 4BAYA 5JHFA 3GFMA 1YW7A 2E7WA 5GP9A 3W6KB 1T2KA 1U2WA 2LDUA 3H3ZA 2QCOA 3DPTA 2OJED 3KEQA 3HBLA 3JRFA 1U8BA 3JSPA 3ISPA 2JSCA 2BXZA 4XLCA 3KE2A 3E5UA 1ZG3A 1KU2A 2KISA 4E7KA 2L9NA 2V79A 4HW0A 3S32A 4JQFA 1A6QA 3S17J 4G94A 3S15J 4GDFA 4BXXJ 4F7ZA 2QZ8A 3HYIA 5CPRB 3K10A 3I71A 1A5JA 5E3NA 2JVHA 3GBGA 3WG7H 2IGOA 3ZQQA 3U21A 2IJLA 2O7OA 1YW8A 5IP9J 2FMYA 1AKHB 2VI6A 2X85A 2VOOA 1W5TA 5C4XJ 1FX7A 1A04A 3CCSI 4WWCA 2VC0A 1YITI 1W5CC 3G71I 3WTWC 2W00A 3CESA 4X0GA 3MFKA 1Z9CA 2DQLA 1BIAA 3BTIA 4ABZA 4RBOA 3M3YJ 3VPRA 3BOQA 4JYKA 4B3XA 1MMDA 4HPQA 4A12A 4HF1A 2CQNA 4O5VA 4DOZA 2L4AA 4AIJA 3BLYA 3FX3A 3ECOA 4EJTA 3QP5A 2OCCH 1KQ8A 1S7OA 2X6OA 3U9GA 2RAEA 4HNVA 3LQRA 2COMA 4RAYA 2WAEA 3V7SA 1IRFA 3V4GA 1BOBA 2QLZA 2EJRA 2A3SA 3M9AA 4MQVA 3IH4A 3OL4A 3W6JB 2LY1A 2YX4A 3I3LA 1QHGA 2EBIA 1QU3A 4NQWA 4XKBA 2KQRA 2QQ9A 3IRRA 5BQTA 3F9KA 2ZMEB 4WK8F 1I39A 5DDGA 3B73A 1CQTA 5E3OA 1E3HA 3RKYA 4L9VA 4X1EA 4OMZA 2XAHA 3CF2A 1MNDA 2OA4A 2RREA 2O9LA 4KFCA 3CZ6A 2GWRA 3H5NA 4HOBA 3K4NA 4CXFA 3JW4A 4PDKA 1B9NA 1BA5A 2BW3A 2PQ8A 1JTXA 4HA8A 3HOSA 1D5VA 3DV8A 3K1MA 2WAQA 5HLHA 1YIJI 3TQNA 1LDDA 2F2EA 4BXFA 2Y9ZA 4G6QA 4GRIA 5J4VA 4KITB 3AL0B 1USTA 1UHMA 1A35A 2LR8A 1YYVA 2DMQA 4U87A 2A6TA 3C1DA 3ZXSA 4LMYA 1LEAA 1UZCA 2CO5A 2IW5A 3TOAA 4Y7NJ 3L2QA 1VQ7I 4BEHB 5K7ZA 1OCRH 3A0BC 4XM3A 2VBYA 3VYRB 3OYCA 4A3DJ 2DBBA 3E3VA 2NOJB 4PK4A 3JRAA 3S2DJ 5D5WB 5EDNA 3JRIA 4IPAA 1ZGWA 4G7ZF 1TWAJ 1RKWA 2XVCA 3Q3SA 1D3YA 2FE3A 3OYDA 5K1YA 4XORA 1G8XA 2BXYA 3V42A 2NVQJ 4HLYA 2UV1A 3H1CA 4YELA 3DBRB 3TOBA 1ZR2A 4AVPA 3OWTA 2Q2EB 4ENKA 2CMPA 1FTTA 4D7NA 4ENMA 1FYMA 1K6OA 5D4SA 4QSHA 1ZK8A 3M8EA 2DODA 1O3TA 2ZXJA 1FZPB 3LNQA 3H9QA 1T38A 4BQNA 3EUKL 1SFUA 1FBSA 1Z1DA 4XRSG 1JTYA 3PUBA 4IJAA 2Y0MA 3IV5A 3OYNA 4BE2A 3TL4X 3ZQLA 4A5NA 1WPKA 3B02A 4B43A 2R7UA 3IL2A 4CYCA 1W0TA 3V8KA 2HEOA 1Z6RA 2YUSA 5ICCA 2BHYA 5FKKA 1RZ4A 2ZMEA 1YJNI 1ETVA 1I6XA 5FFXA 4BDYA 2EZKA 3ABTA 2RKHA 4BJTA 4ZTFA 2JA5J 1ZTRA 2AQEA 4U88A 1WVRA 2LKPA 2LVSA 3G73A 2JUCA 3KCCA 2X9DA 1A36A 5LHIA 4J19A 1WSUA 2NVYJ 2LC2A 1SMTA 1IUFA 3RTRA 5J1YA 2XASA 1MJAA 1OLTA 1SMYF 4ZH4F 3ELKA 2GZWA 4MFDA 2E71A 3K4KA 4IHYA 3GVAA 1R7JA 5AIQA 2FX0A 1B8IB 2Z3YA 3BJAA 3IAS2 3OYKA 3PFIA 2X1DA 4XR6A 3ROUA 2E1MC 4OU0A 2X51A 4F52A 3GLXA 3BR1A 2DQRA 2W25A 3F72A 2EA4A 3PNYA 3CMYA 2VUMJ 1NG7A 3JAMK 3QWLA 2KZVA 4V2GA 4ZC3A 1ENHA 1ULYA 1Z91A 3ZMUA 4YIRX 4HV5A 5JI6A 1RC9A 1G4DA 3U2RA 4XKCA 2VKDA 3KLNA 3F8BA 2F5FA 3RPUD 4CH7A 3CLOA 3FXKA 1P92A 5HNFA 5FLVA 2FUG2 4C9YA 1YRNA 2OC6A 1P6RA 5BPDA 3LSRA 4MO7A 4IHWA 3OS0A 1R1VA 4OAYA 3S8PA 2NNYA 4AIKA 5GAHJ 4EMSA 4LB5A 3DPUA 3KPHA 3KEOA 3BTLA 2TCTA 3O6BB 1UG0A 3RPUA 5BPIA 4Y17A 2JPBA 2PX9A 2Q2EA 3HRTA 3L2WA 1QPMA 3PIPF 3S2HJ 2A61A 3EQLF 2LY2A 3IWZA 4N9HA 3EUAA 3WGHA 1IN4A 4KICA 2JRTA 2QA4I 2WV1A 2P81A 4LG3A 4UV8A 2ZJRF 1PUEE 3DLAA 4IHVA 2KL4A 4E7IA 3L1PA 2IA0A 3I59B 4RGSA 2H8WA 2DK5A 4KJZA 5DM7F 3WTTC 1IV6A 2VXZA 2IS4A 1ZLJA 1WJBA 2L7KA 4G6DA 1ON2A 2BGCA 3BTCA 5GAGJ 4D9JA 1Z6TA 3BJOA 2L0KA 4HQEA 1L3LA 3HM5A 1VNDA 5L3DA 4BY1J 3VB2A 2PLYA 1JUMA 4CGZA 1WJFA 4BHBA 1X2MA 2ZJPF 3DTKA 3LQQA 2VQGA 1MBHA 3TMOA 3G2BA 2Q1ZB 3S1QJ 4PJNA 1W4MA 2R7FA 4F55A 3K70C 2F5CA 3IP4B 4ESJA 1MDMB 3MVPA 1ERDA 2FU4A 2VL8A 2R92J 2K4JA 2VJJA 4OWRB 2CW8A 2HVQA 3BZCA 2V1UA 5KCMA 2BHZA 2F5DA 2VLAA 2K9NA 3BQYA 1WJAA 3EYYA 4C2TA 3JTGA 1WQ2A 2F6CA 3SEQA 1S7AA 2I10A 3W2VA 4U7BA 1XMAA 5ICEA 3PL8A 2DPUA 4DW6A 2DDBA 2UUZA 3K4BA 3KZYA 1Z3XA 3SHFA 2ACJA 2HVSA 2NVTJ 3J81Z 2MH9A 5L3CA 1ZRCA 1Z05A 3TO9A 4UUSA 3K6GA 4KISA 3HHHA 5KK1A 3BTJA 3AKZA 1OISA 3LWFA 1BI1A 1RNLA 4GXOA 2KLOA 3C7JA 1YS7A 2BVLA 2LBFB 3J7ZI 2EFQA 2O5RA 1HSJA 1OQYA 4IXAA 1XCBA 5D5UB 2ME0A 3W2WA 1BR1A 2LG4A 4EEFG 1TNTA 5BOXA 3CUOA 2EV5A 3E6DA 5KVRA 4NC7A 5LD2C 1L0OC 2FQ3A 5FFZA 1TL8A 2VN2A 3A01B 2B7EA 3DLLF 2EIKH 3EDPA 1XSXA 5CKTA 3J80K 4CZCA 1ZRDA 3I59A 2IXSA 1EA3A 5FKLA 2W57A 2R7RA 3A2KA 3HOUJ 1J5YA 1K79A 4IKFA 1S29A 2WY8Q 2CFXA 3OYFA 3ZPLA 2H09A 5CVIA 1MBFA 2XHKA 4KDPA 3RJPA 2HGCA 1H89C 3H5AA 1ZH5A 5J40A 3BR3A 1ZGJA 1IDZA 1JT6A 4MIMA 2ZB9A 3HOZJ 1S7EA 2ICWG 1O7FA 2DMUA 3SZGA 5FB2A 2QSFX 2HPMA 2GA1A 4PJMA 5M3FJ 4A0XA 1MMGA 1TT0A 1CGPA 1PYVA 3S16J 4AUXA 1MDMA 1FNNA 2L3DA 5EG0B 1LUJB 2R5ZB 5FLXZ 4R1HA 1Y1VJ 2ZFUA 1FP1D 5HLTA 1ITYA 2KP6A 2LREA 3E5QA 3OOUA 1JGSA 1R49A 1ZRFA 1D0XA 3PO3J 3I55I 4KMFA 5IYCJ 4GFBA 2ZXIA 2M3AA 2KIQA 3D5SC 2K02A 5FKMA 2KRFA 3E7LA 2AHQA 3OYLA 2P0WA 5GTIC 4ZDLA 4RGUA 4E7LA 1YI2I 2GXBA 1G3YA 1KU9A 2E1CA 2XGCA 2E2HJ 2VT3A 3I0TA 4IO9F 2BE5F 3FXRA 4M74A 3WHBA 2ZNZA 2HYJA 4XL9A 4OIQF 2NVXJ 4JP0A 2KIUA 3J7AO 2Q8KA 3HKZN 1T39A 3FM5A 3PQKA 4MEXF 3MKWB 4Q48A 3H35A 3HOWJ 2UXXA 3WTXC 4J00A 1VQ6I 2LYCA 4P9UA 1I5ZA 4HSRA 5E8IA 4AVZA 2JSPA 1XB4A 2MG4A 1QPIA 3K2AA 1H88C 4U0WA 3FXQA 4NNJA 2MD5A 3AG1H 3V7CA 2NXNB 4EQQA 1IDYA 2KHMA 1MZBA 3PO2J 1FEXA 4LLLA 1S6LA 3T8RA 1DP7P 2IEKA 1BR2A 1R22A 4JX4A 1QQIA 2HQNA 4LGWA 4ESFA 3JRBA 2L9RA 3FM3A 3K9TA 3O2PE 3R61A 2ISYA 5HNHA 4UY8I 4KIGA 4BU2A 2P7CB 1IXSB 5HDNA 5C44J 3PM1A 3WU1B 1SD7A 1VQLI 2M4GA 4WX9A 4D1QA 3CO6C 1WJDA 1PDNC 4W1UA 4LK0F 4BNCA 5DV5A 1TLHB 2LNBA 5IYDJ 5EGOB 4CCMA 2DDAA 3JSOA 2IA2A 1WH5A 3FZVA 4ZZDA 3KZIC 1IGNA 5HS7A 2J5OA 3RYPA 3ZMTA 2VBWA 4N0BA 3FDYA 3NQOA 2OF7A 2VODA 3GTKJ 3J7YJ 1X1AA 2IPQX 2Y75A 2VQCA 3M1EA 3H3VK 2R5ZA 1HDPA 1Z77A 1STZA 1TQPA 2ECBA 5LLQA 3DEUA 1BM9A 4M3EA 2K9QA 1X4OA 1YE9A 2EZIA 4KN7X 1S72I 3M8JA 4P9FA 1K61A 3WU2C 5JR3A 5E20A 3CCEI 2A5WA 2JA8J 3GTPJ 2YSRA 5L3FA 4B1RA 1MJ9A 2KFDA 1QZZA 2CGPA 1YFHA 4N4NB 5EEGA 2STWA 4C3HJ 4CDGA 5FD6A 1RR8C 2JN6A 2YS9A 2HXIA 5IYBJ 3Q0UA 1T08B 2FNAA 1BI2A 1S5LC 3O8GA 4PJ0C 2QF7A 5HDKA 1W0UA 2IS2A 1IUYA 2JPCA 1D8JA 4IQ4A 4FTHA 2EFOA 3HJEA 1Q1VA 2XUBA 5LEKA 1QZEA 2EZHA 1W7PD 1D8KA 3I4PA 2OTJI 3L09A 4I09A 4CYDA 2DA4A 1SAUA 2M8EA 2IT0A 3LSKA 3WTVC 3L9FA 3H3UA 2ZMEC 1ZN2A 3OYGA 4N9IA 5LGTA 1W7PA 2W4SA 4DBRA 1MD0A 1F43A 2FD5A 1X1BA 1WKMA 1IC8A 4Y3OA
chains in the Genus database with same CATH topology
1PP8F 2QVOA 2A07F 3VOEA 3L2CA 2XAGA 2XAJA 3DFGA 4EM2A 2A6HF 3HIFA 4PCQA 4RB0A 5CVVA 2Z33A 3R4KA 4MEYF 4M6YA 2QM3A 1IN5A 2HKOA 1HQCA 2FOKA 4HAMA 5A2QZ 1OKRA 4L18B 2PBIA 2PI0A 1ODDA 4YIFA 1HSTA 1FPQA 2PJPA 3R0AA 4D0PA 2P6SA 4LLGF 3KP5A 3P9IA 1LB2A 1AOYA 5LGUA 4UHTA 1SAXA 4OIPF 5DD4A 1FYKA 3RKWA 2HDCA 4ENNA 4PGHA 4IRIA 1YLFA 3I5UA 2FXAA 4KA4A 3EETA 3GXOA 3ZMZA 2WV0A 3GFLA 2P5KA 4KN4X 1AWCA 2CG4A 4UVBA 5HLIA 4IHTA 2LSOA 3N4MA 2XKPA 2GAUA 4HQMA 3P9KA 2NS0A 2G9WA 2DTRA 4MNUA 1T98A 2XKOA 4L9TA 2BYVE 2HFHA 4HBLA 1E2XA 3LA7A 4HDUA 1LDJA 1UB9A 4M72A 3GZ5A 5J8FA 2OAZA 3J81K 3HOTA 2DU9A 4R8HA 1R36A 1O3QA 4FX4A 1JXSA 4MTEA 1PP7U 4RB1A 3GYHX 2XIGA 3HUGA 5TJJA 3RDIA 3HTUA 3QPHA 1HBXG 1KGSA 3WU0A 4LFUA 4L5IA 2CQKA 3Q9VA 1HKQA 2EV0A 2H6BA 2B0LA 4QWQA 3LA3A 2HTSA 4GGGA 3M7GA 4QLCU 3PQJA 2QBYB 4A6EA 5LRSA 2M5WA 5JFRA 1ZAOA 4OOIA 4HDVA 5FGMA 1SD6A 2NAZA 2Y48A 1P4WA 3ECHA 4ESBA 1YTYA 1Y0UA 4EVIA 5E1WA 5LHHA 3IKTA 2F5EA 1XSVA 3R60A 3QU6A 2M45A 3CUQA 2K86A 3P7NA 1B9MA 2HQRA 3K2ZA 4YIIA 1IZ1A 4L0ZB 1ZARA 3FHZA 1BI0A 2JT1A 3M8FA 1K7AA 3DPLC 2A6EF 4G7OF 1F5TA 3KFWX 4R79A 2Z5UA 1SD4A 4EJVA 4P96A 1TQMA 3ZP5A 5DUIA 4WCGA 1IXCA 3FMQA 1QGPA 1IN6A 5K5RA 3F6OA 4UVAA 4L5JA 2L4MA 4PZJA 3QAHA 1BBYA 1EH6A 4Z2YA 1HXDA 5BS6A 3R0JA 2QBYA 1OMIA 1WI9A 2IP2A 1J9IA 3FMRA 2TDXA 4IRGA 1ZG1A 1DPUA 3I58A 2ISZA 1LJ9A 1HKTA 2STTA 4CZZA 4FHTA 2RNJA 2RN7A 4XLPF 2O6GE 5LEJA 4B09A 1V4RA 5J8CA 2CW0F 1HW5A 5K5OA 2EFPA 4IF4A 1F1ZA 2YX7A 3KLOA 1BJAA 4RGXA 2PEXA 3F8FA 4UVCA 1ONVA 3CTAA 1GHCA 5D8KB 3TDZC 3FF5A 1DDNA 4HX8A 2CSOA 3D0SA 4HV6A 3WE3A 5IT9Z 4MGRA 3KP2A 1MGTA 4BH9A 1RUOA 3FMSA 1E17A 3U1DA 3NEUA 4UV9A 1O3SA 3KP7A 3L7WA 3BP8A 2G7HA 4M6XA 3JTHA 4I2OA 1SFXA 4DNCA 4RB2C 1SD5A 5ILUA 1J0RA 1TW3A 1LNWA 2M87A 1UCRA 2P4WA 3IHUA 2Z99A 3HRSA 2WTEA 2W84A 4GCVA 1WRJA 1K78A 2XROA 1U6GA 1IW7F 5A2QK 3L00A 3RKXA 3BWGA 1EH7A 1YO5C 2OBPA 3QPTA 1R1UA 4LJZF 1GXQA 1NHAA 1O7LA 2FBIA 3MZHA 4CHUA 2FNPA 4O3MA 3HSFA 5E1XA 5LRRA 3RPQA 2MH2A 2GIVA 5E17F 1FBUA 3K69A 5HS9A 5LBQA 5HS8A 3AAFA 4JK1X 3WTZA 2DFIA 3NRVA 4NB5A 2ESNA 2QENA 3WGIA 3DF8A 3D5LA 2EA2A 2YR2A 1QBJA 1RI7A 2PMUA 5ICFA 2HYFA 1XMKA 2LF8A 4XLNF 4U7DA 2L54A 3GX4X 2RDPA 5ILVA 1Z7UA 2FEZA 1ZG5A 4EJWA 5BMZA 1F9NA 2FBKA 1XSDA 4KMUX 2W24A 2HR3A 1W7PB 3QP6A 2HKXA 2HYGD 2UXNA 1TBXA 3ZN0A 4HX4A 5FO5A 1JE8A 5HDGA 3F6VA 2D2WA 3CO7C 1ZREA 3H92A 2MC3A 4Y15A 4A0YA 4OIRF 1LDKB 2QWWA 1V3FA 5E18F 2C6YA 5D5XB 1FT9A 2MA3A 4LG0B 2J5PA 1DUXC 4L9NA 5CVUA 2FA5A 2ETHA 4ASNA 1J59A 3FWEA 3IWFA 4KUMA 1H9TA 3DQVC 1UHWA 2VE9A 4ZYGA 2QYOA 4CO8A 4U0VA 1ON1A 3WTUC 3HRMA 4HZFA 2VT2A 2EK5A 4A6DA 1FP2A 2VBXA 1XDUA 2IRFG 1RIOH 1DPRA 2Z9OA 1MKMA 5DD8A 2EV6A 3TKYA 4ENJA 1YS6A 3HHGA 1FY7A 5D6EA 1TNSA 2JZYA 4IVNA 1FBQA 3HRUA 2OD5A 5ERIA 3O3KA 2NRAC 4DQ2A 4OIOF 3VODA 1BIBA 2L01A 3E6CC 3K0LA 1LVAA 3SXYA 4M9ZA 1REPC 5F1RA 3F8CA 2DW4A 4BYYA 3TO6A 2VC1A 4EGYA 3ABUA 2RVCA 2ELHA 2P7VB 1Q1HA 4MHGA 2V1DA 5DCMB 1BC7C 4KIBA 2M1BA 1TTYA 4ZZLA 3T8TA 3OOPA 2K27A 3ZMDA 2YPRA 3ZMSA 4UNOA 3KZZA 4KT5C 1C0WA 3GFJA 4Q4ZF 4LG0A 2XRNA 3ZQ7A 1FSHA 5HOOA 1IN7A 4NHJA 2AS5F 1J7KA 3VEPA 4AIHA 4EGZA 4EM0B 1XDSA 5DYMA 4KNYA 3Q5FA 1KU7A 2MLKA 2E7XA 4AD9A 2PN6A 2ZO4A 1BI3A 5ICGA 2O03A 1I27A 4ETSA 2Q0OA 2ZJ2A 3K1PA 3LSTA 2VBZA 2ZKZA 2ZCWA 4ZYDA 3GF2A 6PAXA 5DEQA 2O3FA 1U8RA 1EV7A 3OV8A 1FSEA 3WODF 4EJUA 3GUDA 2NNNA 4WF2A 2MBFA 4UXNA 4EV0A 2H27A 3CUQB 2R7DA 4H0EA 1ZGAA 4YFNF 5IT9K 4WXCA 1BC8C 2FBHA 3KP6A 3GO5A 4BHCA 4RS8A 4RB3C 2KKOA 1U5TB 5DCMA 4S05A 3C3WA 2CWEA 4FT8A 5AONA 3V7RA 2KIFA 1XCVA 2ADUA 4G8XA 3E5XA 4YG2F 1OYYA 5JVTA 1FLIA 4RGRA 2BBYA 3I64A 1KYZA 3ERED 4I98B 3MEXA 5D4RA 4G7HF 3RIRA 4LLNA 1KU3A 1YIOA 2UWMA 3ZMVA 1VTNC 4Y13A 2RGVA 2FF4A 1I1GA 4WXDA 4KYWA 5AIPA 2X4HA 1I1SA 3T5XA 3I54A 4XSZF 2OU2A 5E1ZB 1U78A 2YU3A 3HTSB 1O3RA 3GEZA 2V9VA 2NYXA 2DLLA 3BROA 3IC7A 1G3WA 3N97A 2V6CA 5CYVA 3GFIA 4P5OA 3TGNA 2PG4A 5FLXK 2D1HA 3GZ6A 3MQ0A 2RV8A 2P5VA 2A5YB 3QU3A 1P2FA 3COAC 1P4XA 1G3TA 3HSRA 3MZYA 5D6FA 1G3SA 3R6SA 5CVJA 3SZTA 2OQGA 1G6NA 1KQ0A 1J2XA 5E8GA 1OPCA 1YG2A 4YFKF 2JTVA 5F6FA 1OR7A 3RYRA 4BHPA 2K4BA 1U5TA 2VE8A 2FRHA 2PFBA 5F64A 3EUHA 3LFKA 4BXUA 2A69F 1OYWA 3E6MA 2OZ6A 1IAWA 4M71A 2WC2A 5CLSA 3IRQA 4GYIA 1B1BA 3BPVA 2O61A 5FD5A 5L3GA 5K5QA 3DXJF 4IRHA 3BPXA 1IRGA 1GVJA 2ZFWA 5CVRA 4XSXF 3LA2A 3TDUC 4IHSA 3F8MA 2XV4S 5HVQC 3K1NA 1K78B 2BEOA 1QO0D 2GA2A 3DP7A 3I53A 3FXUA 2P6TA 4L0YB 1XN7A 3LAJA 3V8LA 4FX0A 3MCZA 1FOKA 2H6CA 3EYIA 1FYLA 5HLGA 3BJ6A 4ZYHA 4HX7A 2HOEA 4S04A 2KJBA 2UZKA 1TQIA 2XAQA 3F23A 3SZPA 2CYYA 3MAJA 1IF1A 4ON0A 2HS5A 2OZUA 1U3EM 4I01A 2EFWA 4KIFA 1RUNA 4WXHA 4K2EA 1BOAA 4L9JA 3CDHA 4GYGA 2X0LA 1F4KA 1X3UA 3IKVA 4BQAA 2EFNA 4OINF 5L3BA 1R00A 2IVMA 3G3ZA 1R58A 3E97A 1YQAA 1FWZA 2XGXA 2WWYA 5H20A 3BZ6A 2ZBKA 3F22A 1GXPA 3SQNA 2K7LA 2FMLA 2A68F 4A0ZA 5ED4A 5ILSA 2P5LC 3P9CA 2AXLA 1B59A 2W85A 3T1BA 2OQRA 5JHUA 1UFMA 4EJOA 1H9GA 2KJCA 1XD7A 4AWXB 1HW2A 2QQAA 1XGSA 1P4AA 4RAZA 2PMHA 1LQ1A 2FSWA 2DO7A 3WTSC 2O8XA 2XAFA 2IA1A 1ZYRF 3WE2A 5J6XA 5L3EA 1MJBA 4MQ9F 4I02A 3WG9A 2HZTA 1HKSA 1W5SA 2H94A 2RC4A 4MTDA 1KYWA 1R23A 3LAPA 3QRFF 2QUFA 1R1TA 2P8TA 2ESHA 5DUKA 1S3JA 3ML6A 4HYEA 4GO1A 2G7UA 2M30A 2HWVA 3GW2A 3ZN1A 1R5HA 1J75A 5LGNA 1ZHFA 2QQBA 1HW1A 3QOPA 3DKWA 4UUVA 1H0MA 2L02A 4Q47A 3T0YA 2V1XA 4A5MA 5IT3A 3BY6A 3JAMZ 3KP4A 3KETA 3ULQB 1SFEA 1OYIA 1JHFA 3BDDA 2D1VA 3RI4A 2VOPA 2HTJA 4XRFA 5D5VB 1XGNA 1KA8A 1EH8A 4U0YA 3F8NA 3F3XA 1YW9A 5EEHA 1WWXA 1CF7B 3MWMA 2ZNYA 1TW2A 4HF0A 1ZLKA 3GWZA 1IXRC 1JHHA 2KIMA 3WTYC 1QZYA 4E70A 4M73A 4EM1A 4M9XA 4LD5A 4B8XA 2LF7A 2EWNA 5DCFA 5LHGA 5H6QA 4G9YA 1USSA 3REOA 3WGGA 2DT5A 4P55A 1B4AA 1KQ9A 3TO7A 3S2WA 4I7HA 2GQQA 2EB7A 4PGGA 4M9SA 1O57A 3C18A 4XBFA 4LB6B 4I0BA 4YFXF 1R5GA 2O0YA 2R3SA 1XGMA 4A2UA 1T0FA 1T6SA 3V8JA 3VFZA 1IN8A 3CJNA 3KP3A 3SFZA 2BV6A 5D8LB 3F21A 4HLXA 3CUQC 3Q9SA 2GXGA 4OMYA 1B6AA 2E1NA 4ZYEA 1S8NA 3E6BA 3HSEA 2MLGA 2DPDA 2VONA 2DK8A 4I0AA 2RQPA 1CF7A 2D45A 1U5TC 4JBAA 1XGOA 5TRDA 4LK1F 5CJ9A 5H6RA 1LEBA 4TV7A 4O6JA 1FC3A 4Q5SF 2DAOA 4CICA 1QNTA 2DI3A 3J80Z 1BN5A 4HF2A 4BAYA 3GFMA 1YW7A 2E7WA 3W6KB 1T2KA 1U2WA 2LDUA 3H3ZA 3DPTA 3KEQA 3JSPA 3ISPA 2JSCA 3KE2A 3E5UA 1ZG3A 1KU2A 2V79A 4HW0A 4JQFA 4G94A 4F7ZA 2QZ8A 3HYIA 3I71A 2IJLA 1YW8A 2FMYA 2VOOA 1W5TA 1FX7A 1A04A 4WWCA 2VC0A 3WTWC 3MFKA 1Z9CA 2DQLA 1BIAA 3BOQA 4A12A 4HF1A 4O5VA 2L4AA 4AIJA 3FX3A 4EJTA 3ECOA 1KQ8A 3QP5A 1S7OA 3U9GA 3LQRA 2COMA 4RAYA 3V7SA 1IRFA 3V4GA 2QLZA 2EJRA 2A3SA 3M9AA 4MQVA 3W6JB 2YX4A 4NQWA 2QQ9A 3IRRA 5BQTA 2ZMEB 4WK8F 5DDGA 3B73A 3RKYA 4L9VA 4OMZA 2XAHA 2OA4A 4KFCA 2GWRA 4HOBA 4CXFA 3JW4A 4PDKA 1B9NA 2PQ8A 4HA8A 3HOSA 1D5VA 3DV8A 3K1MA 5HLHA 3TQNA 1LDDA 2F2EA 4G6QA 1USTA 1UHMA 1YYVA 3C1DA 4LMYA 1LEAA 2CO5A 2IW5A 3TOAA 2VBYA 2DBBA 3E3VA 5D5WB 4IPAA 4G7ZF 2XVCA 1D3YA 2FE3A 5K1YA 4HLYA 3TOBA 4AVPA 4ENKA 4ENMA 1FYMA 1K6OA 5D4SA 3M8EA 1O3TA 2ZXJA 1FZPB 1T38A 1SFUA 1FBSA 1Z1DA 4IJAA 2Y0MA 4A5NA 3B02A 3IL2A 3V8KA 2HEOA 1Z6RA 5ICCA 1RZ4A 2ZMEA 1I6XA 5FFXA 3ABTA 2RKHA 4U88A 2LKPA 3G73A 3KCCA 5LHIA 1WSUA 3RTRA 1SMTA 2XASA 1MJAA 1SMYF 4ZH4F 3ELKA 2GZWA 3GVAA 1R7JA 5AIQA 2Z3YA 3BJAA 3PFIA 3ROUA 4OU0A 3GLXA 2DQRA 2W25A 3F72A 2EA4A 3JAMK 1ULYA 1Z91A 3ZMUA 4HV5A 5JI6A 1G4DA 3U2RA 3KLNA 3F8BA 2F5FA 3CLOA 1P92A 5BPDA 1P6RA 1R1VA 4AIKA 2NNYA 4EMSA 4LB5A 3KEOA 3O6BB 3RPUA 5BPIA 4Y17A 2JPBA 2Q2EA 3HRTA 1QPMA 2A61A 3EQLF 3IWZA 4N9HA 3WGHA 1IN4A 4KICA 2JRTA 4UV8A 1PUEE 2IA0A 3I59B 4RGSA 2DK5A 3WTTC 2VXZA 1ZLJA 4G6DA 1ON2A 2BGCA 1Z6TA 3BJOA 4HQEA 1L3LA 5L3DA 3VB2A 2PLYA 4CGZA 4BHBA 3LQQA 1W4MA 2R7FA 2F5CA 4ESJA 1MDMB 2FU4A 2K4JA 2V1UA 2F5DA 3EYYA 3JTGA 1WQ2A 1S7AA 4U7BA 1XMAA 5ICEA 2DPUA 3KZYA 3SHFA 2ACJA 3J81Z 2MH9A 5L3CA 1ZRCA 1Z05A 3TO9A 3HHHA 5KK1A 3LWFA 1BI1A 1RNLA 4GXOA 3C7JA 1YS7A 2EFQA 1HSJA 4IXAA 1XCBA 5D5UB 1TNTA 5BOXA 3CUOA 2EV5A 3E6DA 5KVRA 1L0OC 2FQ3A 5FFZA 2VN2A 3EDPA 1XSXA 3J80K 1ZRDA 3I59A 2W57A 1J5YA 1K79A 1S29A 2CFXA 3ZPLA 2H09A 5CVIA 2XHKA 4KDPA 3RJPA 2HGCA 1ZH5A 1ZGJA 1O7FA 5FB2A 2GA1A 4A0XA 1CGPA 1MDMA 1FNNA 2L3DA 5FLXZ 4R1HA 1FP1D 3E5QA 1JGSA 1ZRFA 4KMFA 2K02A 2KRFA 4RGUA 2GXBA 1G3YA 1KU9A 2E1CA 2VT3A 3I0TA 2BE5F 3FXRA 4M74A 2ZNZA 4OIQF 2KIUA 3J7AO 2Q8KA 1T39A 3FM5A 3PQKA 4MEXF 4Q48A 2UXXA 3WTXC 4P9UA 1I5ZA 5E8IA 1XB4A 4U0WA 3FXQA 2MD5A 3V7CA 4EQQA 1MZBA 4LLLA 1S6LA 3T8RA 1DP7P 1R22A 1QQIA 2HQNA 4LGWA 4ESFA 3FM3A 3K9TA 3O2PE 3R61A 2ISYA 4KIGA 2P7CB 1IXSB 5HDNA 3WU1B 1SD7A 4WX9A 1PDNC 3CO6C 4LK0F 4BNCA 5DV5A 1TLHB 2LNBA 3JSOA 2IA2A 3FZVA 4ZZDA 5HS7A 2J5OA 3RYPA 3ZMTA 2VBWA 4N0BA 3NQOA 2VODA 2IPQX 2Y75A 3M1EA 1STZA 1TQPA 5LLQA 3DEUA 1BM9A 4KN7X 4P9FA 5JR3A 5E20A 2YSRA 5L3FA 1MJ9A 1QZZA 2CGPA 1YFHA 2STWA 5EEGA 4CDGA 5FD6A 2FNAA 1BI2A 5HDKA 1IUYA 2JPCA 1D8JA 2EFOA 2XUBA 5LEKA 1W7PD 1D8KA 3I4PA 3L09A 4I09A 4CYDA 2M8EA 2IT0A 3WTVC 3L9FA 3H3UA 1ZN2A 4N9IA 5LGTA 1W7PA 1MD0A 1WKMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PP8 F;  2QVO A;  2A07 F;  3VOE A;  3L2C A;  2XAG A;  2XAJ A;  3DFG A;  4EM2 A;  2A6H F;  3HIF A;  4PCQ A;  4RB0 A;  5CVV A;  2Z33 A;  3R4K A;  4MEY F;  4M6Y A;  2QM3 A;  1IN5 A;  2HKO A;  1HQC A;  2FOK A;  4HAM A;  5A2Q Z;  1OKR A;  4L18 B;  2PBI A;  2PI0 A;  1ODD A;  4YIF A;  1HST A;  1FPQ A;  2PJP A;  3R0A A;  4D0P A;  2P6S A;  4LLG F;  3KP5 A;  3P9I A;  1LB2 A;  1AOY A;  5LGU A;  4UHT A;  1SAX A;  4OIP F;  5DD4 A;  1FYK A;  3RKW A;  2HDC A;  4ENN A;  4PGH A;  4IRI A;  1YLF A;  3I5U A;  2FXA A;  4KA4 A;  3EET A;  3GXO A;  3ZMZ A;  2WV0 A;  3GFL A;  2P5K A;  4KN4 X;  1AWC A;  2CG4 A;  4UVB A;  5HLI A;  4IHT A;  2LSO A;  3N4M A;  2XKP A;  2GAU A;  4HQM A;  3P9K A;  2NS0 A;  2G9W A;  2DTR A;  4MNU A;  1T98 A;  2XKO A;  4L9T A;  2BYV E;  2HFH A;  4HBL A;  1E2X A;  3LA7 A;  4HDU A;  1LDJ A;  1UB9 A;  4M72 A;  3GZ5 A;  5J8F A;  2OAZ A;  3J81 K;  3HOT A;  2DU9 A;  4R8H A;  1R36 A;  1O3Q A;  4FX4 A;  1JXS A;  4MTE A;  1PP7 U;  4RB1 A;  3GYH X;  2XIG A;  3HUG A;  5TJJ A;  3RDI A;  3HTU A;  3QPH A;  1HBX G;  1KGS A;  3WU0 A;  4LFU A;  4L5I A;  2CQK A;  3Q9V A;  1HKQ A;  2EV0 A;  2H6B A;  2B0L A;  4QWQ A;  3LA3 A;  2HTS A;  4GGG A;  3M7G A;  4QLC U;  3PQJ A;  2QBY B;  4A6E A;  5LRS A;  2M5W A;  5JFR A;  1ZAO A;  4OOI A;  4HDV A;  5FGM A;  1SD6 A;  2NAZ A;  2Y48 A;  1P4W A;  3ECH A;  4ESB A;  1YTY A;  1Y0U A;  4EVI A;  5E1W A;  5LHH A;  3IKT A;  2F5E A;  1XSV A;  3R60 A;  3QU6 A;  2M45 A;  3CUQ A;  2K86 A;  3P7N A;  1B9M A;  2HQR A;  3K2Z A;  4YII A;  1IZ1 A;  4L0Z B;  1ZAR A;  3FHZ A;  1BI0 A;  2JT1 A;  3M8F A;  1K7A A;  3DPL C;  2A6E F;  4G7O F;  1F5T A;  3KFW X;  4R79 A;  2Z5U A;  1SD4 A;  4EJV A;  4P96 A;  1TQM A;  3ZP5 A;  5DUI A;  4WCG A;  1IXC A;  3FMQ A;  1QGP A;  1IN6 A;  5K5R A;  3F6O A;  4UVA A;  4L5J A;  2L4M A;  4PZJ A;  3QAH A;  1BBY A;  1EH6 A;  4Z2Y A;  1HXD A;  5BS6 A;  3R0J A;  2QBY A;  1OMI A;  1WI9 A;  2IP2 A;  1J9I A;  3FMR A;  2TDX A;  4IRG A;  1ZG1 A;  1DPU A;  3I58 A;  2ISZ A;  1LJ9 A;  1HKT A;  2STT A;  4CZZ A;  4FHT A;  2RNJ A;  2RN7 A;  4XLP F;  2O6G E;  5LEJ A;  4B09 A;  1V4R A;  5J8C A;  2CW0 F;  1HW5 A;  5K5O A;  2EFP A;  4IF4 A;  1F1Z A;  2YX7 A;  3KLO A;  1BJA A;  4RGX A;  2PEX A;  3F8F A;  4UVC A;  1ONV A;  3CTA A;  1GHC A;  5D8K B;  3TDZ C;  3FF5 A;  1DDN A;  4HX8 A;  2CSO A;  3D0S A;  4HV6 A;  3WE3 A;  5IT9 Z;  4MGR A;  3KP2 A;  1MGT A;  4BH9 A;  1RUO A;  3FMS A;  1E17 A;  3U1D A;  3NEU A;  4UV9 A;  1O3S A;  3KP7 A;  3L7W A;  3BP8 A;  2G7H A;  4M6X A;  3JTH A;  4I2O A;  1SFX A;  4DNC A;  4RB2 C;  1SD5 A;  5ILU A;  1J0R A;  1TW3 A;  1LNW A;  2M87 A;  1UCR A;  2P4W A;  3IHU A;  2Z99 A;  3HRS A;  2WTE A;  2W84 A;  4GCV A;  1WRJ A;  1K78 A;  2XRO A;  1U6G A;  1IW7 F;  5A2Q K;  3L00 A;  3RKX A;  3BWG A;  1EH7 A;  1YO5 C;  2OBP A;  3QPT A;  1R1U A;  4LJZ F;  1GXQ A;  1NHA A;  1O7L A;  2FBI A;  3MZH A;  4CHU A;  2FNP A;  4O3M A;  3HSF A;  5E1X A;  5LRR A;  3RPQ A;  2MH2 A;  2GIV A;  5E17 F;  1FBU A;  3K69 A;  5HS9 A;  5LBQ A;  5HS8 A;  3AAF A;  4JK1 X;  3WTZ A;  2DFI A;  3NRV A;  4NB5 A;  2ESN A;  2QEN A;  3WGI A;  3DF8 A;  3D5L A;  2EA2 A;  2YR2 A;  1QBJ A;  1RI7 A;  2PMU A;  5ICF A;  2HYF A;  1XMK A;  2LF8 A;  4XLN F;  4U7D A;  2L54 A;  3GX4 X;  2RDP A;  5ILV A;  1Z7U A;  2FEZ A;  1ZG5 A;  4EJW A;  5BMZ A;  1F9N A;  2FBK A;  1XSD A;  4KMU X;  2W24 A;  2HR3 A;  1W7P B;  3QP6 A;  2HKX A;  2HYG D;  2UXN A;  1TBX A;  3ZN0 A;  4HX4 A;  5FO5 A;  1JE8 A;  5HDG A;  3F6V A;  2D2W A;  3CO7 C;  1ZRE A;  3H92 A;  2MC3 A;  4Y15 A;  4A0Y A;  4OIR F;  1LDK B;  2QWW A;  1V3F A;  5E18 F;  2C6Y A;  5D5X B;  1FT9 A;  2MA3 A;  4LG0 B;  2J5P A;  1DUX C;  4L9N A;  5CVU A;  2FA5 A;  2ETH A;  4ASN A;  1J59 A;  3FWE A;  3IWF A;  4KUM A;  1H9T A;  3DQV C;  1UHW A;  2VE9 A;  4ZYG A;  2QYO A;  4CO8 A;  4U0V A;  1ON1 A;  3WTU C;  3HRM A;  4HZF A;  2VT2 A;  2EK5 A;  4A6D A;  1FP2 A;  2VBX A;  1XDU A;  2IRF G;  1RIO H;  1DPR A;  2Z9O A;  1MKM A;  5DD8 A;  2EV6 A;  3TKY A;  4ENJ A;  1YS6 A;  3HHG A;  1FY7 A;  5D6E A;  1TNS A;  2JZY A;  4IVN A;  1FBQ A;  3HRU A;  2OD5 A;  5ERI A;  3O3K A;  2NRA C;  4DQ2 A;  4OIO F;  3VOD A;  1BIB A;  2L01 A;  3E6C C;  3K0L A;  1LVA A;  3SXY A;  4M9Z A;  1REP C;  5F1R A;  3F8C A;  2DW4 A;  4BYY A;  3TO6 A;  2VC1 A;  4EGY A;  3ABU A;  2RVC A;  2ELH A;  2P7V B;  1Q1H A;  4MHG A;  2V1D A;  5DCM B;  1BC7 C;  4KIB A;  2M1B A;  1TTY A;  4ZZL A;  3T8T A;  3OOP A;  2K27 A;  3ZMD A;  2YPR A;  3ZMS A;  4UNO A;  3KZZ A;  4KT5 C;  1C0W A;  3GFJ A;  4Q4Z F;  4LG0 A;  2XRN A;  3ZQ7 A;  1FSH A;  5HOO A;  1IN7 A;  4NHJ A;  2AS5 F;  1J7K A;  3VEP A;  4AIH A;  4EGZ A;  4EM0 B;  1XDS A;  5DYM A;  4KNY A;  3Q5F A;  1KU7 A;  2MLK A;  2E7X A;  4AD9 A;  2PN6 A;  2ZO4 A;  1BI3 A;  5ICG A;  2O03 A;  1I27 A;  4ETS A;  2Q0O A;  2ZJ2 A;  3K1P A;  3LST A;  2VBZ A;  2ZKZ A;  2ZCW A;  4ZYD A;  3GF2 A;  6PAX A;  5DEQ A;  2O3F A;  1U8R A;  1EV7 A;  3OV8 A;  1FSE A;  3WOD F;  4EJU A;  3GUD A;  2NNN A;  4WF2 A;  2MBF A;  4UXN A;  4EV0 A;  2H27 A;  3CUQ B;  2R7D A;  4H0E A;  1ZGA A;  4YFN F;  5IT9 K;  4WXC A;  1BC8 C;  2FBH A;  3KP6 A;  3GO5 A;  4BHC A;  4RS8 A;  4RB3 C;  2KKO A;  1U5T B;  5DCM A;  4S05 A;  3C3W A;  2CWE A;  4FT8 A;  5AON A;  3V7R A;  2KIF A;  1XCV A;  2ADU A;  4G8X A;  3E5X A;  4YG2 F;  1OYY A;  5JVT A;  1FLI A;  4RGR A;  2BBY A;  3I64 A;  1KYZ A;  3ERE D;  4I98 B;  3MEX A;  5D4R A;  4G7H F;  3RIR A;  4LLN A;  1KU3 A;  1YIO A;  2UWM A;  3ZMV A;  1VTN C;  4Y13 A;  2RGV A;  2FF4 A;  1I1G A;  4WXD A;  4KYW A;  5AIP A;  2X4H A;  1I1S A;  3T5X A;  3I54 A;  4XSZ F;  2OU2 A;  5E1Z B;  1U78 A;  2YU3 A;  3HTS B;  1O3R A;  3GEZ A;  2V9V A;  2NYX A;  2DLL A;  3BRO A;  3IC7 A;  1G3W A;  3N97 A;  2V6C A;  5CYV A;  3GFI A;  4P5O A;  3TGN A;  2PG4 A;  5FLX K;  2D1H A;  3GZ6 A;  3MQ0 A;  2RV8 A;  2P5V A;  2A5Y B;  3QU3 A;  1P2F A;  3COA C;  1P4X A;  1G3T A;  3HSR A;  3MZY A;  5D6F A;  1G3S A;  3R6S A;  5CVJ A;  3SZT A;  2OQG A;  1G6N A;  1KQ0 A;  1J2X A;  5E8G A;  1OPC A;  1YG2 A;  4YFK F;  2JTV A;  5F6F A;  1OR7 A;  3RYR A;  4BHP A;  2K4B A;  1U5T A;  2VE8 A;  2FRH A;  2PFB A;  5F64 A;  3EUH A;  3LFK A;  4BXU A;  2A69 F;  1OYW A;  3E6M A;  2OZ6 A;  1IAW A;  4M71 A;  2WC2 A;  5CLS A;  3IRQ A;  4GYI A;  1B1B A;  3BPV A;  2O61 A;  5FD5 A;  5L3G A;  5K5Q A;  3DXJ F;  4IRH A;  3BPX A;  1IRG A;  1GVJ A;  2ZFW A;  5CVR A;  4XSX F;  3LA2 A;  3TDU C;  4IHS A;  3F8M A;  2XV4 S;  5HVQ C;  3K1N A;  1K78 B;  2BEO A;  1QO0 D;  2GA2 A;  3DP7 A;  3I53 A;  3FXU A;  2P6T A;  4L0Y B;  1XN7 A;  3LAJ A;  3V8L A;  4FX0 A;  3MCZ A;  1FOK A;  2H6C A;  3EYI A;  1FYL A;  5HLG A;  3BJ6 A;  4ZYH A;  4HX7 A;  2HOE A;  4S04 A;  2KJB A;  2UZK A;  1TQI A;  2XAQ A;  3F23 A;  3SZP A;  2CYY A;  3MAJ A;  1IF1 A;  4ON0 A;  2HS5 A;  2OZU A;  1U3E M;  4I01 A;  2EFW A;  4KIF A;  1RUN A;  4WXH A;  4K2E A;  1BOA A;  4L9J A;  3CDH A;  4GYG A;  2X0L A;  1F4K A;  1X3U A;  3IKV A;  4BQA A;  2EFN A;  4OIN F;  5L3B A;  1R00 A;  2IVM A;  3G3Z A;  1R58 A;  3E97 A;  1YQA A;  1FWZ A;  2XGX A;  2WWY A;  5H20 A;  3BZ6 A;  2ZBK A;  3F22 A;  1GXP A;  3SQN A;  2K7L A;  2FML A;  2A68 F;  4A0Z A;  5ED4 A;  5ILS A;  2P5L C;  3P9C A;  2AXL A;  1B59 A;  2W85 A;  3T1B A;  2OQR A;  5JHU A;  1UFM A;  4EJO A;  1H9G A;  2KJC A;  1XD7 A;  4AWX B;  1HW2 A;  2QQA A;  1XGS A;  1P4A A;  4RAZ A;  2PMH A;  1LQ1 A;  2FSW A;  2DO7 A;  3WTS C;  2O8X A;  2XAF A;  2IA1 A;  1ZYR F;  3WE2 A;  5J6X A;  5L3E A;  1MJB A;  4MQ9 F;  4I02 A;  3WG9 A;  2HZT A;  1HKS A;  1W5S A;  2H94 A;  2RC4 A;  4MTD A;  1KYW A;  1R23 A;  3LAP A;  3QRF F;  2QUF A;  1R1T A;  2P8T A;  2ESH A;  5DUK A;  1S3J A;  3ML6 A;  4HYE A;  4GO1 A;  2G7U A;  2M30 A;  2HWV A;  3GW2 A;  3ZN1 A;  1R5H A;  1J75 A;  5LGN A;  1ZHF A;  2QQB A;  1HW1 A;  3QOP A;  3DKW A;  4UUV A;  1H0M A;  2L02 A;  4Q47 A;  3T0Y A;  2V1X A;  4A5M A;  5IT3 A;  3BY6 A;  3JAM Z;  3KP4 A;  3KET A;  3ULQ B;  1SFE A;  1OYI A;  1JHF A;  3BDD A;  2D1V A;  3RI4 A;  2VOP A;  2HTJ A;  4XRF A;  5D5V B;  1XGN A;  1KA8 A;  1EH8 A;  4U0Y A;  3F8N A;  3F3X A;  1YW9 A;  5EEH A;  1WWX A;  1CF7 B;  3MWM A;  2ZNY A;  1TW2 A;  4HF0 A;  1ZLK A;  3GWZ A;  1IXR C;  1JHH A;  2KIM A;  3WTY C;  1QZY A;  4E70 A;  4M73 A;  4EM1 A;  4M9X A;  4LD5 A;  4B8X A;  2LF7 A;  2EWN A;  5DCF A;  5LHG A;  5H6Q A;  4G9Y A;  1USS A;  3REO A;  3WGG A;  2DT5 A;  4P55 A;  1B4A A;  1KQ9 A;  3TO7 A;  3S2W A;  4I7H A;  2GQQ A;  2EB7 A;  4PGG A;  4M9S A;  1O57 A;  3C18 A;  4XBF A;  4LB6 B;  4I0B A;  4YFX F;  1R5G A;  2O0Y A;  2R3S A;  1XGM A;  4A2U A;  1T0F A;  1T6S A;  3V8J A;  3VFZ A;  1IN8 A;  3CJN A;  3KP3 A;  3SFZ A;  2BV6 A;  5D8L B;  3F21 A;  4HLX A;  3CUQ C;  3Q9S A;  2GXG A;  4OMY A;  1B6A A;  2E1N A;  4ZYE A;  1S8N A;  3E6B A;  3HSE A;  2MLG A;  2DPD A;  2VON A;  2DK8 A;  4I0A A;  2RQP A;  1CF7 A;  2D45 A;  1U5T C;  4JBA A;  1XGO A;  5TRD A;  4LK1 F;  5CJ9 A;  5H6R A;  1LEB A;  4TV7 A;  4O6J A;  1FC3 A;  4Q5S F;  2DAO A;  4CIC A;  1QNT A;  2DI3 A;  3J80 Z;  1BN5 A;  4HF2 A;  4BAY A;  3GFM A;  1YW7 A;  2E7W A;  3W6K B;  1T2K A;  1U2W A;  2LDU A;  3H3Z A;  3DPT A;  3KEQ A;  3JSP A;  3ISP A;  2JSC A;  3KE2 A;  3E5U A;  1ZG3 A;  1KU2 A;  2V79 A;  4HW0 A;  4JQF A;  4G94 A;  4F7Z A;  2QZ8 A;  3HYI A;  3I71 A;  2IJL A;  1YW8 A;  2FMY A;  2VOO A;  1W5T A;  1FX7 A;  1A04 A;  4WWC A;  2VC0 A;  3WTW C;  3MFK A;  1Z9C A;  2DQL A;  1BIA A;  3BOQ A;  4A12 A;  4HF1 A;  4O5V A;  2L4A A;  4AIJ A;  3FX3 A;  4EJT A;  3ECO A;  1KQ8 A;  3QP5 A;  1S7O A;  3U9G A;  3LQR A;  2COM A;  4RAY A;  3V7S A;  1IRF A;  3V4G A;  2QLZ A;  2EJR A;  2A3S A;  3M9A A;  4MQV A;  3W6J B;  2YX4 A;  4NQW A;  2QQ9 A;  3IRR A;  5BQT A;  2ZME B;  4WK8 F;  5DDG A;  3B73 A;  3RKY A;  4L9V A;  4OMZ A;  2XAH A;  2OA4 A;  4KFC A;  2GWR A;  4HOB A;  4CXF A;  3JW4 A;  4PDK A;  1B9N A;  2PQ8 A;  4HA8 A;  3HOS A;  1D5V A;  3DV8 A;  3K1M A;  5HLH A;  3TQN A;  1LDD A;  2F2E A;  4G6Q A;  1UST A;  1UHM A;  1YYV A;  3C1D A;  4LMY A;  1LEA A;  2CO5 A;  2IW5 A;  3TOA A;  2VBY A;  2DBB A;  3E3V A;  5D5W B;  4IPA A;  4G7Z F;  2XVC A;  1D3Y A;  2FE3 A;  5K1Y A;  4HLY A;  3TOB A;  4AVP A;  4ENK A;  4ENM A;  1FYM A;  1K6O A;  5D4S A;  3M8E A;  1O3T A;  2ZXJ A;  1FZP B;  1T38 A;  1SFU A;  1FBS A;  1Z1D A;  4IJA A;  2Y0M A;  4A5N A;  3B02 A;  3IL2 A;  3V8K A;  2HEO A;  1Z6R A;  5ICC A;  1RZ4 A;  2ZME A;  1I6X A;  5FFX A;  3ABT A;  2RKH A;  4U88 A;  2LKP A;  3G73 A;  3KCC A;  5LHI A;  1WSU A;  3RTR A;  1SMT A;  2XAS A;  1MJA A;  1SMY F;  4ZH4 F;  3ELK A;  2GZW A;  3GVA A;  1R7J A;  5AIQ A;  2Z3Y A;  3BJA A;  3PFI A;  3ROU A;  4OU0 A;  3GLX A;  2DQR A;  2W25 A;  3F72 A;  2EA4 A;  3JAM K;  1ULY A;  1Z91 A;  3ZMU A;  4HV5 A;  5JI6 A;  1G4D A;  3U2R A;  3KLN A;  3F8B A;  2F5F A;  3CLO A;  1P92 A;  5BPD A;  1P6R A;  1R1V A;  4AIK A;  2NNY A;  4EMS A;  4LB5 A;  3KEO A;  3O6B B;  3RPU A;  5BPI A;  4Y17 A;  2JPB A;  2Q2E A;  3HRT A;  1QPM A;  2A61 A;  3EQL F;  3IWZ A;  4N9H A;  3WGH A;  1IN4 A;  4KIC A;  2JRT A;  4UV8 A;  1PUE E;  2IA0 A;  3I59 B;  4RGS A;  2DK5 A;  3WTT C;  2VXZ A;  1ZLJ A;  4G6D A;  1ON2 A;  2BGC A;  1Z6T A;  3BJO A;  4HQE A;  1L3L A;  5L3D A;  3VB2 A;  2PLY A;  4CGZ A;  4BHB A;  3LQQ A;  1W4M A;  2R7F A;  2F5C A;  4ESJ A;  1MDM B;  2FU4 A;  2K4J A;  2V1U A;  2F5D A;  3EYY A;  3JTG A;  1WQ2 A;  1S7A A;  4U7B A;  1XMA A;  5ICE A;  2DPU A;  3KZY A;  3SHF A;  2ACJ A;  3J81 Z;  2MH9 A;  5L3C A;  1ZRC A;  1Z05 A;  3TO9 A;  3HHH A;  5KK1 A;  3LWF A;  1BI1 A;  1RNL A;  4GXO A;  3C7J A;  1YS7 A;  2EFQ A;  1HSJ A;  4IXA A;  1XCB A;  5D5U B;  1TNT A;  5BOX A;  3CUO A;  2EV5 A;  3E6D A;  5KVR A;  1L0O C;  2FQ3 A;  5FFZ A;  2VN2 A;  3EDP A;  1XSX A;  3J80 K;  1ZRD A;  3I59 A;  2W57 A;  1J5Y A;  1K79 A;  1S29 A;  2CFX A;  3ZPL A;  2H09 A;  5CVI A;  2XHK A;  4KDP A;  3RJP A;  2HGC A;  1ZH5 A;  1ZGJ A;  1O7F A;  5FB2 A;  2GA1 A;  4A0X A;  1CGP A;  1MDM A;  1FNN A;  2L3D A;  5FLX Z;  4R1H A;  1FP1 D;  3E5Q A;  1JGS A;  1ZRF A;  4KMF A;  2K02 A;  2KRF A;  4RGU A;  2GXB A;  1G3Y A;  1KU9 A;  2E1C A;  2VT3 A;  3I0T A;  2BE5 F;  3FXR A;  4M74 A;  2ZNZ A;  4OIQ F;  2KIU A;  3J7A O;  2Q8K A;  1T39 A;  3FM5 A;  3PQK A;  4MEX F;  4Q48 A;  2UXX A;  3WTX C;  4P9U A;  1I5Z A;  5E8I A;  1XB4 A;  4U0W A;  3FXQ A;  2MD5 A;  3V7C A;  4EQQ A;  1MZB A;  4LLL A;  1S6L A;  3T8R A;  1DP7 P;  1R22 A;  1QQI A;  2HQN A;  4LGW A;  4ESF A;  3FM3 A;  3K9T A;  3O2P E;  3R61 A;  2ISY A;  4KIG A;  2P7C B;  1IXS B;  5HDN A;  3WU1 B;  1SD7 A;  4WX9 A;  1PDN C;  3CO6 C;  4LK0 F;  4BNC A;  5DV5 A;  1TLH B;  2LNB A;  3JSO A;  2IA2 A;  3FZV A;  4ZZD A;  5HS7 A;  2J5O A;  3RYP A;  3ZMT A;  2VBW A;  4N0B A;  3NQO A;  2VOD A;  2IPQ X;  2Y75 A;  3M1E A;  1STZ A;  1TQP A;  5LLQ A;  3DEU A;  1BM9 A;  4KN7 X;  4P9F A;  5JR3 A;  5E20 A;  2YSR A;  5L3F A;  1MJ9 A;  1QZZ A;  2CGP A;  1YFH A;  2STW A;  5EEG A;  4CDG A;  5FD6 A;  2FNA A;  1BI2 A;  5HDK A;  1IUY A;  2JPC A;  1D8J A;  2EFO A;  2XUB A;  5LEK A;  1W7P D;  1D8K A;  3I4P A;  3L09 A;  4I09 A;  4CYD A;  2M8E A;  2IT0 A;  3WTV C;  3L9F A;  3H3U A;  1ZN2 A;  4N9I A;  5LGT A;  1W7P A;  1MD0 A;  1WKM A; 
#chains in the Genus database with same CATH topology
 2LFB A;  1PP8 F;  2VKV A;  2DT6 A;  3FK7 A;  2QVO A;  2A07 F;  4BL0 B;  3VOE A;  3L2C A;  4RLQ A;  3NAU A;  2XAG A;  2XAJ A;  3DFG A;  4EM2 A;  4A3K J;  2BW3 B;  2Y31 A;  2A6H F;  3HIF A;  4PCQ A;  4RB0 A;  5CVV A;  2Z33 A;  1S9H A;  3R4K A;  4MEY F;  4NUB A;  1E3O C;  4M6Y A;  3PNV A;  2ZJQ F;  4HNU A;  3AL0 C;  2QM3 A;  2CQQ A;  2HQ5 A;  2XSJ C;  1IN5 A;  2HKO A;  1HQC A;  2FOK A;  3AFH A;  4AID A;  5EGO A;  4HAM A;  2DA2 A;  5A2Q Z;  1OKR A;  4L18 B;  3BG9 A;  3X2Q H;  4AYB N;  2VKH A;  3H9J A;  3S1R J;  2XAU A;  2WAF A;  3HPG A;  3K4M A;  3MKL A;  2PBI A;  3PSI A;  2LLK A;  4ZDO A;  2PI0 A;  3ZQC A;  4XON A;  5GPC A;  1ODD A;  4YIF A;  1D1B A;  1HST A;  2VXD A;  1FPQ A;  1X1D A;  2ELJ A;  2PJP A;  2IBD A;  3DWL E;  3QYF A;  3R0A A;  4D0P A;  4XIC A;  2P6S A;  4LLG F;  3S14 J;  3KP5 A;  2DYR H;  3P9I A;  1LB2 A;  1AOY A;  5LGU A;  4II2 A;  4UHT A;  2LMD A;  1SAX A;  3MD2 A;  4OIP F;  4P1W A;  4E7Z A;  5DD4 A;  1FYK A;  3HG9 A;  3M1C A;  3RKW A;  1N78 A;  4NC8 A;  2HDC A;  4ENN A;  1BW5 A;  3I56 I;  4PGH A;  4BJ5 C;  2F4I A;  1ETX A;  3HC7 A;  2DFF A;  4M6V A;  4IRI A;  1YLF A;  2EH3 A;  1LE8 B;  3I5U A;  2FXA A;  4KA4 A;  2H1K A;  3EET A;  3GXO A;  3ZMZ A;  2WV0 A;  3ASN H;  3GFL A;  5EEA A;  1KZH A;  2P5K A;  1RRJ A;  4KN4 X;  1AWC A;  2CG4 A;  4A93 J;  4UVB A;  5HLI A;  4IHT A;  2LSO A;  3N4M A;  2JJ7 A;  3C2H A;  3M4O J;  2E60 A;  2XKP A;  1FMV A;  2GAU A;  4A3F J;  4CYC B;  2R93 J;  1AHD P;  4HQM A;  1Y0N A;  3P9K A;  2NS0 A;  2HZD A;  2G9W A;  2DTR A;  1MSE C;  4MNU A;  1T98 A;  2XKO A;  4E7S A;  4FE7 A;  4L9T A;  5FRM A;  2OPT A;  2DJI A;  4IOA F;  1W1W E;  1PVE A;  1NTC A;  2XGE A;  3BR2 A;  1WZ2 A;  2BYV E;  2H8R A;  2HFH A;  4HBL A;  2L2O A;  1E2X A;  2R7T A;  3LA7 A;  1XTA A;  2O8K A;  3E0J B;  4HDU A;  3S1N J;  1MMA A;  3OSG A;  1LDJ A;  1UB9 A;  4M72 A;  3GZ5 A;  5J8F A;  2OAZ A;  3J81 K;  9ANT A;  3HOT A;  1MIJ A;  4EAT A;  4XLA A;  2DU9 A;  3OS1 A;  4R8H A;  3GME A;  1R36 A;  1O3Q A;  2GXA A;  1IO2 A;  2BOL A;  4FX4 A;  1XC5 A;  1JXS A;  4MTE A;  1PP7 U;  4XN3 A;  4RB1 A;  3GYH X;  1G59 A;  2QKM B;  2KRH A;  1POG A;  2XIG A;  4OAZ A;  2F4O B;  2R7V A;  1D5Y A;  3HUG A;  5TJJ A;  3RDI A;  3HTU A;  3QPH A;  1HBX G;  3W6V A;  3HOV J;  4BGD A;  1KGS A;  3WU0 A;  1E3P A;  4XQF A;  4LFU A;  4L5I A;  3H36 A;  2CQK A;  3Q9V A;  2QGU A;  4XLF A;  1YRN B;  3MN2 A;  2Y69 H;  1HKQ A;  2EV0 A;  2H6B A;  2B0L A;  3RSN A;  4QWQ A;  3LA3 A;  2HTS A;  4GGG A;  4BJ6 C;  3LMM A;  5FRO A;  3RZO J;  3M7G A;  4CCO A;  5B3S H;  4XKV A;  4QLC U;  2K9L A;  2V9K A;  3D5R C;  3PQJ A;  1BR4 A;  2QBY B;  3CCQ I;  2EZL A;  1OCO H;  4A6E A;  1SFK A;  2JQ7 A;  3JRH A;  1MMN A;  2Z2S B;  3DU5 A;  2MAB A;  4QIW N;  3CCY A;  4ZJZ A;  5LRS A;  2CUZ A;  2E1O A;  1LE8 A;  3GTQ J;  4LOC A;  2M8G X;  2M5W A;  4I76 A;  4PSX A;  5JFR A;  1ZAO A;  1MNM C;  4OOI A;  4HDV A;  5FGM A;  2KDO A;  4A3C J;  1SD6 A;  2NAZ A;  2Y48 A;  1P4W A;  3ECH A;  3I4N J;  1WI3 A;  3TW6 A;  4ESB A;  3AG4 H;  1YTY A;  2HDD A;  1Y0U A;  3ZR8 X;  1IG7 A;  2R7Q A;  2IGN A;  2E35 A;  1RR7 A;  2A05 A;  3G6E I;  4EVI A;  5E1W A;  5F0C A;  3UNG C;  5LHH A;  4C30 A;  1MSF C;  4CUG A;  3IKT A;  2F5E A;  2M4K A;  1XSV A;  3R60 A;  3QU6 A;  3CUQ A;  2M45 A;  2Y0S A;  3LSM A;  2K86 A;  4QPQ A;  3P7N A;  1B9M A;  2HQR A;  3K2Z A;  1VQ4 I;  4YII A;  1IZ1 A;  4L0Z B;  3GTM J;  1ZAR A;  3FHZ A;  1J09 A;  4E7J A;  1BI0 A;  2ZC2 A;  2JT1 A;  3M8F A;  1K7A A;  3DPL C;  1RET A;  3RCO A;  4C3I J;  3ESW B;  2LD5 A;  2A6E F;  2HDW A;  4G7O F;  1MMS A;  1R4N B;  2CH0 A;  4XN0 A;  1F5T A;  5K7H A;  2IGK A;  1V5G A;  3KFW X;  4R79 A;  2Z5U A;  1SD4 A;  3QPS A;  4EJV A;  5DTD A;  1Z21 A;  2DJN A;  1P9Q C;  4P96 A;  3FXJ A;  4UUS B;  2WY7 Q;  1TQM A;  3ZP5 A;  5DUI A;  1APL C;  5FKN A;  1MW7 A;  4WCG A;  1X1P A;  1IXC A;  3FMQ A;  1QGP A;  2ID3 A;  1UAA A;  1IN6 A;  5K5R A;  3F6O A;  2CV2 A;  5BNG A;  4UVA A;  2BVM A;  3C2G A;  4A3E J;  4D5C A;  4L5J A;  2L4M A;  2HVR A;  3BG6 A;  2JUG A;  4PZJ A;  2HOS A;  3QAH A;  5E3M A;  1BBY A;  1EH6 A;  3LOC A;  4Z2Y A;  1HXD A;  5BS6 A;  2DFH A;  3R0J A;  5JLX A;  2QBY A;  3AG2 H;  1OMI A;  3MKY B;  1JGG A;  1WI9 A;  2ZXW H;  2IP2 A;  3GTO J;  2VPL A;  2E2J J;  3KYL A;  1J9I A;  1ZKG A;  3FMR A;  1YOV B;  3DEE A;  5GPA A;  2TDX A;  4PSW A;  3G1O A;  4L5E A;  4IRG A;  1ZG1 A;  1DPU A;  2MSY A;  3I58 A;  4RA2 A;  3CCM I;  2MC4 A;  4W97 A;  2OCE A;  4HEA 2;  2E34 A;  2ISZ A;  1LJ9 A;  4A3B J;  3NWT A;  1SAN A;  2CRG A;  3FBI B;  1HKT A;  2STT A;  3A0H C;  3SDG A;  2VJ4 A;  4CZZ A;  2BY2 A;  4FHT A;  2RNJ A;  2K3P A;  3HGY A;  4IL6 C;  2RN7 A;  1XG1 A;  3DEW A;  3CCL I;  4XLP F;  2O6G E;  4MLO A;  1GUU A;  4M3D A;  1UG2 A;  5LEJ A;  3CCU I;  4ITV A;  4B09 A;  1FOX A;  1D1C A;  3B6A A;  3JCU C;  1XPX A;  1V4R A;  2W82 A;  1JKP C;  5J8C A;  2CW0 F;  1HW5 A;  5K5O A;  3VDX A;  2QEX I;  2EFP A;  3TED A;  1ETY A;  3FBN B;  1MBJ A;  3PFY A;  4IF4 A;  1F1Z A;  2YX7 A;  1X3Z B;  5IPA A;  3H5R A;  3KLO A;  1BJA A;  2ZSH B;  4RGX A;  1MNE A;  3CJR B;  2PEX A;  3F8F A;  4UVC A;  1ONV A;  4ZDP A;  3GLL A;  3CTA A;  3BCA A;  1GHC A;  5D8K B;  2TRT A;  3TDZ C;  3OYA A;  3FF5 A;  1DDN A;  4HX8 A;  3KIO A;  1DU6 A;  2JVG A;  2GOM A;  2CSO A;  3QPL A;  2FQ4 A;  3D0S A;  1ACI A;  1T0F C;  4HV6 A;  5F27 A;  3WE3 A;  1OCT C;  4DYQ A;  5E79 C;  5IT9 Z;  2ELK A;  4MGR A;  3KP2 A;  3U1K A;  1MGT A;  4BH9 A;  3ASO H;  1RUO A;  3FMS A;  3HEF A;  1E17 A;  2CV1 A;  3U1D A;  1Y1W J;  3NEU A;  3NAR A;  4UV9 A;  1O3S A;  1WJC A;  3BR6 A;  3KP7 A;  3L7W A;  2WB1 A;  3BP8 A;  2WAQ N;  3OR2 C;  2G7H A;  4M6X A;  3JTH A;  4I2O A;  1Z0X A;  2M9H A;  1DGR M;  1SFO J;  1SFX A;  2BY3 A;  2HU9 A;  4DNC A;  4RB2 C;  1SVM A;  1SD5 A;  4F91 B;  5ILU A;  1J0R A;  1TW3 A;  1LNW A;  2M87 A;  1UCR A;  3Q0W A;  2R7S A;  1QRY A;  2P4W A;  3IHU A;  2Z99 A;  3PUF A;  3HOX J;  3HRS A;  2R7X A;  2WTE A;  4NDL A;  2W84 A;  2NS8 A;  4FET A;  4GCV A;  1WRJ A;  3BCB A;  3ERM A;  5M3M J;  1LVK A;  1VI0 A;  2DA5 A;  1K78 A;  3LL7 A;  2DOF A;  2XRO A;  3JR9 A;  2PMZ A;  5F08 A;  1ETO A;  3VSK A;  3ZOB A;  4E6K G;  1U6G A;  1IW7 F;  4XLH A;  5TIS C;  5A2Q K;  1HF0 A;  1T95 A;  1R6R A;  1X1C A;  3L00 A;  3GTG J;  2F48 A;  3RKX A;  3BWG A;  1EH7 A;  1W36 D;  3BG3 A;  2OBP A;  1YO5 C;  2HPI A;  3QPT A;  1AA7 A;  5IY5 H;  1ZEL A;  3CC4 I;  1R1U A;  4LJZ F;  1IRX A;  1GXQ A;  2K40 A;  1NHA A;  1O7L A;  2FBI A;  2WA0 A;  5IOY A;  2AQF A;  3MZH A;  3L2V A;  4CHU A;  2CS3 A;  3DKY A;  2FNP A;  4DBQ A;  4O3M A;  2B63 J;  4A3L J;  3IH3 A;  3HSF A;  2L7M P;  4UB8 C;  3SDB A;  3BR5 A;  1N25 A;  5E1X A;  5LRR A;  4ZYA A;  3RPQ A;  2MH2 A;  2Y30 A;  2X6Y A;  1VQO I;  2GIV A;  1F36 A;  4D5F A;  5E17 F;  1Y6I A;  2DTZ A;  2X6X A;  5CQE A;  1FBU A;  3D1N I;  5J4Y A;  3K69 A;  4IOC F;  2LTP A;  5HS9 A;  4S0H B;  1EF4 A;  5LBQ A;  4ZTJ A;  1LKX A;  5HS8 A;  3A03 A;  3AAF A;  4JK1 X;  1Y8R B;  3WTZ A;  2DFI A;  3NRV A;  1BL0 A;  3PSF A;  4NB5 A;  3CP8 A;  2ESN A;  1VQ8 I;  4FAS D;  1WJ5 A;  2QEN A;  1HA8 A;  3WGI A;  3DF8 A;  3D5L A;  2EA2 A;  2YR2 A;  1T33 A;  4CCN A;  3ZQH A;  5B66 C;  2IGM A;  1QBJ A;  1RI7 A;  3PNT A;  2XPU A;  2PMU A;  5ICF A;  3DCF A;  3Q0V A;  2HYF A;  1NK2 P;  1XMK A;  2LF8 A;  1YJW I;  4XLN F;  2LOO A;  2F4M B;  4U7D A;  2L54 A;  3GX4 X;  2RDP A;  5ILV A;  1Z7U A;  4BY7 J;  2FEZ A;  1ZG5 A;  1I6H J;  3KEY A;  3CJQ B;  5KAI C;  4EJW A;  3OIP A;  3GCM A;  4DIQ A;  1Y8Q B;  5BMZ A;  3QQA A;  3K7A J;  1F9N A;  2FBK A;  2JWT A;  1XSD A;  3ABK H;  1DU0 A;  1ORK A;  2L5Q A;  1YJ9 I;  4KMU X;  2R7Z J;  3FK6 A;  1RKT A;  3SJM A;  1ETW A;  2W24 A;  2HR3 A;  1W7P B;  3OYJ A;  1IJW C;  4A3J J;  3S1M J;  3QP6 A;  2EQR A;  3K4L A;  2EPF A;  2HKX A;  3QYB A;  2HYG D;  2UXN A;  4M3G A;  3P5J A;  2NS7 A;  1X3W B;  1TBX A;  4F3Q A;  3ZN0 A;  4CSW A;  1JKQ C;  3B6C A;  3JRE A;  4HX4 A;  5FO5 A;  1JE8 A;  5HDG A;  3OYE A;  3F6V A;  5C4J J;  2D2W A;  4CCK A;  3CO7 C;  1ZRE A;  2DCE A;  3H92 A;  2MC3 A;  4Y15 A;  3DBH B;  2DA7 A;  2MFZ A;  3TBI A;  1SVL A;  4DZJ A;  4A0Y A;  2CQ7 A;  1DP3 A;  2GM4 A;  1EKE A;  3ZQF A;  4OIR F;  3OL3 A;  1LDK B;  4B4C A;  1OJL A;  2QWW A;  2ZXH A;  1V3F A;  3KYD B;  2DMP A;  5E18 F;  1JT0 A;  2C6Y A;  5D5X B;  5B1A H;  1FT9 A;  2JA6 J;  2MA3 A;  3ABL H;  4LG0 B;  2J5P A;  1DUX C;  4L9N A;  5CVU A;  2FA5 A;  2D5V A;  2ETH A;  4RMN A;  3I4M J;  2DT7 B;  4ASN A;  3SYT A;  1J59 A;  3FWE A;  3CDI A;  3IWF A;  4KUM A;  3JRC A;  1H9T A;  2DYS H;  3DQV C;  4PFO A;  1UHW A;  2ZSI B;  2VE9 A;  4E7H A;  2AXT C;  2QYO A;  4ZYG A;  1TZL A;  4IHX A;  2XSD C;  4CO8 A;  4U0V A;  3CP2 A;  1ON1 A;  3IUO A;  3WTU C;  2BY0 A;  1K83 J;  2V7F A;  3HRM A;  4HZF A;  1JUS A;  2VT2 A;  2EK5 A;  4A6D A;  1FP2 A;  2VBX A;  1XDU A;  1I3Q J;  5DM6 F;  2IRF G;  3A02 A;  1RIO H;  3CDL A;  1N77 A;  3BG7 A;  1DPR A;  2OTL I;  1V5E A;  4B44 A;  2Z9O A;  1MKM A;  5DD8 A;  2EV6 A;  3TKY A;  4ENJ A;  1YS6 A;  3S93 A;  3HHG A;  1FY7 A;  1ETK A;  5D6E A;  1TNS A;  1D0Z A;  2JZY A;  3K4C A;  5CQG A;  3W3C A;  4IVN A;  1FBQ A;  1OCP A;  4I99 C;  3CCJ I;  3HRU A;  2IS6 A;  2KZG A;  2OD5 A;  3K4J A;  1MBG A;  5ERI A;  3O3K A;  3RZD J;  3LSH A;  2NRA C;  4DQ2 A;  4OIO F;  3ZCO A;  1VQN I;  2DMT A;  3VOD A;  3VYT B;  1BIB A;  3GTJ J;  2L01 A;  3E6C C;  3K0L A;  1LVA A;  2M34 A;  2M2E A;  5FJ8 J;  3SXY A;  4M9Z A;  1REP C;  4Z6Y A;  5F1R A;  4RDU A;  2LKS A;  3F8C A;  2DW4 A;  4PJJ A;  2HNH A;  5JVG F;  4BYY A;  3TO6 A;  2VC1 A;  3O8H A;  4EGY A;  4HNT A;  3ABU A;  5M5X J;  4RLF A;  1K6Y A;  2RVC A;  5GAD J;  3W2A A;  2ELH A;  2P7V B;  1JJ8 C;  4RM2 A;  1Q1H A;  4MHG A;  1BW6 A;  1Y56 A;  2V1D A;  3H0G J;  4KIB A;  5DCM B;  2M1B A;  4CCJ A;  1H8A C;  1TTY A;  1BC7 C;  4ZZL A;  3T8T A;  3OOP A;  2K27 A;  3ZMD A;  2E5N A;  4DZP A;  2YPR A;  3ZMS A;  3HUG B;  4UNO A;  2H1L A;  3KZZ A;  4KT5 C;  5FKO A;  1C0W A;  3GFJ A;  4Q4Z F;  4LG0 A;  2XRN A;  3ZQ7 A;  1FSH A;  5HOO A;  1IN7 A;  3S3M A;  4NHJ A;  2IAI A;  2AS5 F;  1J7K A;  2DA3 A;  3HGG A;  3VEP A;  4AIH A;  4EGZ A;  4KT6 A;  4EM0 B;  1XDS A;  2E2I J;  5DYM A;  4KNY A;  3Q5F A;  1Z3Y A;  1KU7 A;  3F0C A;  2MLK A;  3ONQ A;  1LFU P;  5E3L A;  3DBL B;  4G6T B;  1TT5 B;  2VJI A;  4RM3 A;  4LIV A;  2E7X A;  4AD9 A;  2PN6 A;  2ZO4 A;  2JA7 J;  3CCV I;  2XGD A;  1BI3 A;  5ICG A;  3TW7 A;  1HLV A;  2O03 A;  1JKR C;  1I27 A;  1M1E B;  1TWH J;  4ETS A;  1VQP I;  2Q0O A;  4H4K C;  1U9O A;  2ZJ2 A;  3I9V 2;  3K1P A;  1UHS A;  3LST A;  2VBZ A;  2Z1D A;  4BS9 A;  2JK3 A;  2ZKZ A;  2ZCW A;  4V2F A;  4F92 B;  2LKX A;  3PJR A;  4ZYD A;  3GF2 A;  1U0J A;  3L2R A;  1ETQ A;  5K7F A;  6PAX A;  3DTE A;  5DEQ A;  2O3F A;  4XK4 A;  1U8R A;  1NK3 P;  1EV7 A;  1B72 B;  3LSG A;  3OV8 A;  1FSE A;  3WOD F;  4EJU A;  3GUD A;  2NNN A;  4WF2 A;  2MBF A;  2HXO A;  4UXN A;  1WGX A;  3IH2 A;  4DYC A;  5J3L A;  3JRD A;  4EV0 A;  3M07 A;  3FIW A;  2H27 A;  2I5U A;  3CUQ B;  1P7I A;  5LFA A;  2R7D A;  1HOM A;  4XMY A;  2DA6 A;  4UB6 C;  2XB5 A;  2EIJ H;  1A31 A;  2EIM H;  4H0E A;  5F04 A;  1Y39 A;  4MFE A;  3S3O A;  1QVT A;  1ZGA A;  4YFN F;  2EIN H;  1A6I A;  3ABM H;  1PJR A;  4WXC A;  4BBR J;  5IT9 K;  1V54 H;  3HXL A;  3CJT B;  1BC8 C;  2FBH A;  3KP6 A;  2MD0 A;  2JRM A;  3GO5 A;  3UR3 C;  3OYB A;  4BHC A;  2XF7 A;  2XPV A;  3HOY J;  2ID6 A;  2BZT A;  3MMY B;  3OIO A;  4RS8 A;  4RB3 C;  2KKO A;  1U5T B;  2I8D A;  5DCM A;  5F0H A;  3C3W A;  4S05 A;  4YRV A;  3BZK A;  5GTH C;  2CWE A;  4FT8 A;  5AON A;  2MGQ A;  3V7R A;  2KIF A;  1XCV A;  1QHH D;  2ADU A;  4G8X A;  2Y2Z A;  3E5X A;  5EZG A;  4YG2 F;  1OYY A;  4B3A A;  5JVT A;  1FLI A;  2CUE A;  4RGR A;  2BBY A;  5C3E J;  3IAM 2;  3I64 A;  1UJ8 A;  1VF9 A;  1G2H A;  3QOE A;  1KYZ A;  5J1U A;  3ERE D;  1QVU A;  2KT0 A;  1BJZ A;  4Y4R A;  5IP7 J;  3H0D A;  4I98 B;  3MEX A;  1OCC H;  5D4R A;  4G7H F;  3RIR A;  2CUJ A;  4LLN A;  1KU3 A;  1YIO A;  1FOY A;  2UWM A;  4IQJ A;  1Z67 A;  2F5V A;  3G1M A;  4PFP A;  4IZZ A;  3ZMV A;  4XOT A;  2JMW A;  1VTN C;  2X1E A;  1K4S A;  2V1N A;  4Y13 A;  4BUP A;  3BQZ A;  3CMM A;  2RGV A;  2CJJ A;  2FF4 A;  1I1G A;  3J7A Y;  4WXD A;  4B47 A;  2DN0 A;  1AKH A;  1V55 H;  2RNG A;  1O4X A;  4KYW A;  2CUF A;  5AIP A;  2CV0 A;  2X4H A;  4Y52 J;  1I1S A;  2HOT A;  3T5X A;  3I54 A;  4XSZ F;  3LSJ A;  1FOW A;  2OU2 A;  5E1Z B;  2BY1 A;  2XF6 A;  3VSL A;  1U78 A;  2YU3 A;  3HTS B;  1O3R A;  3GEZ A;  2V9V A;  2NYX A;  2DLL A;  3RKQ A;  1JUP A;  3BRO A;  3IC7 A;  1G3W A;  3N97 A;  1KON A;  1DQU A;  3PIO F;  1B72 A;  2V6C A;  5CYV A;  1W36 C;  3GFI A;  2CFO A;  4P5O A;  3TGN A;  1FJL A;  2Z16 A;  2PG4 A;  5FLX K;  2D1H A;  4AU7 A;  3GZ6 A;  3MQ0 A;  1AU7 A;  4AC0 A;  2RV8 A;  2P5V A;  2A5Y B;  3QU3 A;  2PJR B;  1P2F A;  1D0Y A;  3COA C;  1P4X A;  1G3T A;  3HSR A;  3MZY A;  4BAC A;  5D6F A;  1R71 A;  1G3S A;  3R6S A;  1GV2 A;  3MKZ A;  5CVJ A;  3SZT A;  2OQG A;  1G6N A;  1KQ0 A;  1J2X A;  5E8G A;  2V26 A;  1OPC A;  3SEZ A;  4QTR A;  1YG2 A;  4YFK F;  2JTV A;  5F6F A;  1OR7 A;  2E36 A;  3RYR A;  2R7W A;  2VJ5 A;  4BHP A;  2K4B A;  1U5T A;  2VE8 A;  1R4M B;  4F93 B;  4FE4 A;  1GDT A;  1N75 A;  2FRH A;  4LIU A;  4B48 A;  4J01 A;  2PFB A;  4IEJ A;  5F64 A;  3EUH A;  2CW7 A;  3LFK A;  4BXU A;  2A69 F;  3RQ4 A;  3HKZ A;  1OYW A;  3E6M A;  3CLQ A;  2OZ6 A;  5J47 A;  3DTI A;  3MZ8 A;  1XS9 A;  1IAW A;  2G0E A;  2VIX A;  4M71 A;  2KDZ A;  2WC2 A;  3LSP A;  5CLS A;  2HI3 A;  3IRQ A;  2VAS A;  4JX5 A;  1TWG J;  4GYI A;  4BKX A;  1B1B A;  3BPV A;  1ZR4 A;  2O61 A;  4I6Z A;  5FD5 A;  4X6A J;  5L3G A;  2R0Q C;  4II3 A;  5K5Q A;  3A1Y A;  4BEH A;  4A3G J;  4C2M J;  2E19 A;  3DXJ F;  4IRH A;  1MBK A;  3BPX A;  1IRG A;  1GVJ A;  1X19 A;  2ZFW A;  5CVR A;  4XSX F;  3LA2 A;  3TDU C;  4G12 A;  2DXI A;  3OYH A;  2B9S A;  4IHS A;  1FIP A;  3CD6 I;  1VQK I;  3F8M A;  1LPQ A;  3OS2 A;  2XV4 S;  5HVQ C;  2NOG A;  3K1N A;  2W7N A;  4A3M J;  1K78 B;  2BEO A;  3QOD A;  1QO0 D;  1I50 J;  4XRS A;  1OCZ H;  2IS1 A;  2MW8 A;  2GA2 A;  3DP7 A;  2EIL H;  3I53 A;  1SVO A;  3OYI A;  3FXL A;  3FXU A;  2P6T A;  4L0Y B;  1XN7 A;  3LAJ A;  3V8L A;  4QPO A;  1RPW A;  3ZQG A;  4FX0 A;  3MCZ A;  3JRG A;  1FOK A;  3BT9 A;  2GIZ A;  2H6C A;  3EYI A;  5EZH A;  1U9N A;  4IX7 A;  1FYL A;  1MBE A;  3BJ6 A;  5HLG A;  4ZYH A;  4PUS A;  4HX7 A;  2HOE A;  2CU7 A;  4S04 A;  2KJB A;  2UZK A;  3H9G A;  3N05 A;  1TQI A;  2XAQ A;  1T56 A;  3F23 A;  1SEU A;  2OUM A;  2GOX B;  3SZP A;  2PJR A;  1YX5 A;  2CYY A;  1HDD C;  2GBY A;  3MAJ A;  1IF1 A;  4ON0 A;  2HS5 A;  2OZU A;  5EYR A;  1U3E M;  4I01 A;  2EFW A;  4CA0 A;  2VKE A;  2XPW A;  4KIF A;  1RUN A;  4WXH A;  2VB6 A;  4K2E A;  4D7M A;  1UMQ A;  1BOA A;  2DFE A;  1FIA A;  1IRZ A;  2M7A A;  2JA2 A;  3VYU B;  4L9J A;  3CDH A;  4GYG A;  2X0L A;  1VQ9 I;  4HRI A;  1F4K A;  4JOM A;  1SC7 A;  1WCM J;  1VFC A;  1X3U A;  3IKV A;  5H2F C;  4AM3 A;  4BQA A;  2K5C A;  2LH9 A;  1E0E A;  5M5W J;  2EFN A;  4OIN F;  5L3B A;  1B8I A;  1WH7 A;  1UEL B;  1R00 A;  2QSG X;  4Y33 A;  2IVM A;  3G3Z A;  2DA1 A;  1R58 A;  3G4S I;  2E1M B;  3E97 A;  2HQA A;  1YQA A;  2R7O A;  3G1L A;  3FKI J;  5IOZ A;  1FWZ A;  4HG2 A;  1R5I D;  3OSF A;  3HB9 A;  3HDD A;  3OIQ A;  1OFC X;  2XGX A;  2WWY A;  1IV8 A;  3OMY A;  5H20 A;  5FLM J;  3BZ6 A;  2ZBK A;  3F22 A;  4BBS J;  4FQG A;  1GXP A;  4RAG A;  3SQN A;  2K7L A;  3OR1 C;  2MYS A;  2FML A;  2A68 F;  3CME I;  3E1S A;  3CF5 F;  3ZQI A;  4A0Z A;  5ED4 A;  4XID A;  2KRC A;  3FHN A;  2COB A;  1VQM I;  5ILS A;  4YEJ A;  2P5L C;  3P9C A;  2L7Z A;  2AXL A;  4C3J J;  4XOP A;  1HCR A;  1B59 A;  1X4P A;  4UUT A;  2HOA A;  2W85 A;  3T1B A;  4AYB A;  2OQR A;  5JHU A;  1GT0 C;  1UFM A;  4EJO A;  2M0M A;  3VWB A;  1H9G A;  5EF6 A;  1JJ6 C;  3LSI A;  2L9S A;  2Y9Y A;  3VYS B;  1I3A A;  4E4H A;  2KJC A;  2M0C A;  5EJC A;  1XD7 A;  4AWX B;  1HW2 A;  2QQA A;  4BQQ A;  1XGS A;  1P4A A;  2X1C A;  2ECC A;  4RAZ A;  1JKO C;  2PMH A;  1LQ1 A;  2FSW A;  2DO7 A;  3FIS A;  2ME6 A;  1WHU A;  2KMU A;  5KHD A;  3WTS C;  2O8X A;  2XAF A;  2IA1 A;  1ZYR F;  3WE2 A;  1K4T A;  3RQI A;  3ZRG A;  2AO9 A;  5J6X A;  5L3E A;  4N4O B;  1MJB A;  4MQ9 F;  4I02 A;  2L9V A;  4NBQ A;  3WG9 A;  2HZT A;  1HKS A;  3ZGK A;  2L7F P;  1W5S A;  2H94 A;  2RC4 A;  5TGT A;  1KYW A;  4MTD A;  1R23 A;  3L2U A;  3LAP A;  3QRF F;  2K9M A;  5M5Y J;  2XDV A;  2N8G A;  4NC6 A;  2QUF A;  2Y0S N;  1R1T A;  4HST A;  2P8T A;  2DOE A;  2ESH A;  5DUK A;  1S3J A;  3ML6 A;  4HYE A;  4GO1 A;  2G7U A;  2M30 A;  3S3N A;  2DMN A;  4XRM A;  2HWV A;  3GW2 A;  3ZN1 A;  1R5H A;  2NVU B;  4BQO A;  1QA6 A;  2LP0 A;  1J75 A;  2R5Y B;  4LIT A;  5LGN A;  1TC3 C;  1EJ9 A;  2K9S A;  1GV5 A;  1T8I A;  1JI8 A;  1WJE A;  2V6E A;  4BE1 A;  1YHQ I;  1ZHF A;  1TP4 A;  5F0F A;  2QQB A;  1HW1 A;  2QSH X;  2CQX A;  3QOP A;  2YU9 J;  3DKW A;  5B5E C;  3CC7 I;  4UUV A;  4CCL A;  2L02 A;  2R4G A;  1H0M A;  4Q47 A;  2QQ8 A;  3QYE A;  4V19 K;  3CQZ J;  2E5Z A;  3T0Y A;  4DJA A;  2V1X A;  4A5M A;  5IT3 A;  3BY6 A;  3JAM Z;  3KP4 A;  2LBF A;  3KET A;  3ULQ B;  1TWF J;  1SFE A;  1ZQ3 P;  1OYI A;  1JHF A;  2LY9 A;  3BDD A;  2D1V A;  5JLW A;  3RI4 A;  2XC7 A;  2HTJ A;  2VOP A;  2K85 A;  4XRF A;  5D5V B;  1XGN A;  1KA8 A;  1EH8 A;  1PUF B;  2WBM A;  3A01 A;  1WFX A;  4U0Y A;  3F8N A;  3NWS A;  5J1R A;  3F3X A;  1YW9 A;  5EEH A;  2VQL A;  3KX2 A;  3UKG A;  1WWX A;  1MH3 A;  4ANJ A;  5KAF C;  1CF7 B;  3MWM A;  2ZNY A;  3GTL J;  1MH4 A;  1TW2 A;  4HF0 A;  2LK2 A;  3EPZ A;  1ZLK A;  3GWZ A;  1IXR C;  1JHH A;  1X58 A;  3TP0 A;  2KIM A;  3WTY C;  3HL2 A;  5DS9 A;  1QZY A;  4E70 A;  4M73 A;  3BR0 A;  4EM1 A;  4M9X A;  3SFI A;  4LD5 A;  4B8X A;  2LF7 A;  2EWN A;  4BDZ A;  4BE0 A;  2KPM A;  5DCF A;  5LHG A;  5H6Q A;  4G9Y A;  3LFU A;  2V9P A;  4A69 C;  1GLN A;  4C2U A;  2V4J C;  1LFP A;  4XLE A;  3HPH A;  2LRD A;  4M3B A;  3K70 D;  2RQQ A;  3DKX A;  1LFB A;  1USS A;  3REO A;  1V5F A;  3WGG A;  5IP6 A;  2X6W A;  2DT5 A;  4P55 A;  1B4A A;  3OY9 A;  4RAF A;  1KQ9 A;  3TO7 A;  3S2W A;  4I7H A;  3TP3 A;  2GQQ A;  1TWC J;  2EB7 A;  1RES A;  4PGG A;  5EG0 A;  3C2B A;  4M9S A;  3FXM A;  3BC8 A;  1DGW Y;  3GZN B;  1O57 A;  3FKJ A;  3C18 A;  4XBF A;  5GAE J;  2GLO A;  4LB6 B;  4I0B A;  4YFX F;  1R5G A;  4M3F A;  2R5Y A;  2O0Y A;  2FJ1 A;  2K3F A;  5KNL A;  2OV7 A;  2R3S A;  2W48 A;  1XGM A;  4A2U A;  4DGW B;  3CC2 I;  1T0F A;  1T6S A;  2X48 A;  1NG6 A;  2FOW A;  3V8J A;  3CMA I;  3VFZ A;  1FMW A;  5FRN A;  1IN8 A;  3CJN A;  1R9T J;  3KP3 A;  2VPR A;  2BV6 A;  3SFZ A;  2XRL A;  5D8L B;  1NH3 A;  3HZJ A;  5B1B H;  5HOD A;  3F21 A;  4FIS A;  2VQH A;  4HLX A;  1XX5 A;  1Z7L A;  3OYM A;  3CUQ C;  1D1A A;  3Q9S A;  2GXG A;  4OMY A;  2W1O A;  1HC8 A;  2XF5 A;  1B6A A;  3DU6 A;  2M7B A;  1P7J A;  3AG3 H;  2E1N A;  4ZYE A;  1S8N A;  3A4C A;  2WB1 N;  3E6B A;  4FCY A;  1PUF A;  4NQW B;  5F1J A;  3HSE A;  3WHC A;  2MLG A;  2DPD A;  2VON A;  2DK8 A;  1GVD A;  4JX6 A;  4XKW A;  3FXO A;  4I0A A;  4XNF A;  1OR7 C;  1XMX A;  2RQP A;  1CF7 A;  1VZ0 A;  2D45 A;  1U5T C;  3KYC B;  4JBA A;  1XGO A;  5TRD A;  4A3I J;  3BG5 A;  4LK1 F;  5CJ9 A;  5H6R A;  2QKL B;  3EUH C;  1LEB A;  4TV7 A;  1VQ5 I;  1FTZ A;  4O6J A;  4PJL A;  1FC3 A;  4Q5S F;  1YX3 A;  2DAO A;  4CIC A;  3CCR I;  1QNT A;  2DI3 A;  3J80 Z;  2XB0 X;  2PMZ N;  1X2N A;  4DYR A;  1BN5 A;  2DOA A;  2WAD A;  4HF2 A;  4BAY A;  5JHF A;  3GFM A;  1YW7 A;  2E7W A;  5GP9 A;  3W6K B;  1T2K A;  1U2W A;  2LDU A;  3H3Z A;  2QCO A;  3DPT A;  2OJE D;  3KEQ A;  3HBL A;  3JRF A;  1U8B A;  3JSP A;  3ISP A;  2JSC A;  2BXZ A;  4XLC A;  3KE2 A;  3E5U A;  1ZG3 A;  1KU2 A;  2KIS A;  4E7K A;  2L9N A;  2V79 A;  4HW0 A;  3S32 A;  4JQF A;  1A6Q A;  3S17 J;  4G94 A;  3S15 J;  4GDF A;  4BXX J;  4F7Z A;  2QZ8 A;  3HYI A;  5CPR B;  3K10 A;  3I71 A;  1A5J A;  5E3N A;  2JVH A;  3GBG A;  3WG7 H;  2IGO A;  3ZQQ A;  3U21 A;  2IJL A;  2O7O A;  1YW8 A;  5IP9 J;  2FMY A;  1AKH B;  2VI6 A;  2X85 A;  2VOO A;  1W5T A;  5C4X J;  1FX7 A;  1A04 A;  3CCS I;  4WWC A;  2VC0 A;  1YIT I;  1W5C C;  3G71 I;  3WTW C;  2W00 A;  3CES A;  4X0G A;  3MFK A;  1Z9C A;  2DQL A;  1BIA A;  3BTI A;  4ABZ A;  4RBO A;  3M3Y J;  3VPR A;  3BOQ A;  4JYK A;  4B3X A;  1MMD A;  4HPQ A;  4A12 A;  4HF1 A;  2CQN A;  4O5V A;  4DOZ A;  2L4A A;  4AIJ A;  3BLY A;  3FX3 A;  3ECO A;  4EJT A;  3QP5 A;  2OCC H;  1KQ8 A;  1S7O A;  2X6O A;  3U9G A;  2RAE A;  4HNV A;  3LQR A;  2COM A;  4RAY A;  2WAE A;  3V7S A;  1IRF A;  3V4G A;  1BOB A;  2QLZ A;  2EJR A;  2A3S A;  3M9A A;  4MQV A;  3IH4 A;  3OL4 A;  3W6J B;  2LY1 A;  2YX4 A;  3I3L A;  1QHG A;  2EBI A;  1QU3 A;  4NQW A;  4XKB A;  2KQR A;  2QQ9 A;  3IRR A;  5BQT A;  3F9K A;  2ZME B;  4WK8 F;  1I39 A;  5DDG A;  3B73 A;  1CQT A;  5E3O A;  1E3H A;  3RKY A;  4L9V A;  4X1E A;  4OMZ A;  2XAH A;  3CF2 A;  1MND A;  2OA4 A;  2RRE A;  2O9L A;  4KFC A;  3CZ6 A;  2GWR A;  3H5N A;  4HOB A;  3K4N A;  4CXF A;  3JW4 A;  4PDK A;  1B9N A;  1BA5 A;  2BW3 A;  2PQ8 A;  1JTX A;  4HA8 A;  3HOS A;  1D5V A;  3DV8 A;  3K1M A;  2WAQ A;  5HLH A;  1YIJ I;  3TQN A;  1LDD A;  2F2E A;  4BXF A;  2Y9Z A;  4G6Q A;  4GRI A;  5J4V A;  4KIT B;  3AL0 B;  1UST A;  1UHM A;  1A35 A;  2LR8 A;  1YYV A;  2DMQ A;  4U87 A;  2A6T A;  3C1D A;  3ZXS A;  4LMY A;  1LEA A;  1UZC A;  2CO5 A;  2IW5 A;  3TOA A;  4Y7N J;  3L2Q A;  1VQ7 I;  4BEH B;  5K7Z A;  1OCR H;  3A0B C;  4XM3 A;  2VBY A;  3VYR B;  3OYC A;  4A3D J;  2DBB A;  3E3V A;  2NOJ B;  4PK4 A;  3JRA A;  3S2D J;  5D5W B;  5EDN A;  3JRI A;  4IPA A;  1ZGW A;  4G7Z F;  1TWA J;  1RKW A;  2XVC A;  3Q3S A;  1D3Y A;  2FE3 A;  3OYD A;  5K1Y A;  4XOR A;  1G8X A;  2BXY A;  3V42 A;  2NVQ J;  4HLY A;  2UV1 A;  3H1C A;  4YEL A;  3DBR B;  3TOB A;  1ZR2 A;  4AVP A;  3OWT A;  2Q2E B;  4ENK A;  2CMP A;  1FTT A;  4D7N A;  4ENM A;  1FYM A;  1K6O A;  5D4S A;  4QSH A;  1ZK8 A;  3M8E A;  2DOD A;  1O3T A;  2ZXJ A;  1FZP B;  3LNQ A;  3H9Q A;  1T38 A;  4BQN A;  3EUK L;  1SFU A;  1FBS A;  1Z1D A;  4XRS G;  1JTY A;  3PUB A;  4IJA A;  2Y0M A;  3IV5 A;  3OYN A;  4BE2 A;  3TL4 X;  3ZQL A;  4A5N A;  1WPK A;  3B02 A;  4B43 A;  2R7U A;  3IL2 A;  4CYC A;  1W0T A;  3V8K A;  2HEO A;  1Z6R A;  2YUS A;  5ICC A;  2BHY A;  5FKK A;  1RZ4 A;  2ZME A;  1YJN I;  1ETV A;  1I6X A;  5FFX A;  4BDY A;  2EZK A;  3ABT A;  2RKH A;  4BJT A;  4ZTF A;  2JA5 J;  1ZTR A;  2AQE A;  4U88 A;  1WVR A;  2LKP A;  2LVS A;  3G73 A;  2JUC A;  3KCC A;  2X9D A;  1A36 A;  5LHI A;  4J19 A;  1WSU A;  2NVY J;  2LC2 A;  1SMT A;  1IUF A;  3RTR A;  5J1Y A;  2XAS A;  1MJA A;  1OLT A;  1SMY F;  4ZH4 F;  3ELK A;  2GZW A;  4MFD A;  2E71 A;  3K4K A;  4IHY A;  3GVA A;  1R7J A;  5AIQ A;  2FX0 A;  1B8I B;  2Z3Y A;  3BJA A;  3IAS 2;  3OYK A;  3PFI A;  2X1D A;  4XR6 A;  3ROU A;  2E1M C;  4OU0 A;  2X51 A;  4F52 A;  3GLX A;  3BR1 A;  2DQR A;  2W25 A;  3F72 A;  2EA4 A;  3PNY A;  3CMY A;  2VUM J;  1NG7 A;  3JAM K;  3QWL A;  2KZV A;  4V2G A;  4ZC3 A;  1ENH A;  1ULY A;  1Z91 A;  3ZMU A;  4YIR X;  4HV5 A;  5JI6 A;  1RC9 A;  1G4D A;  3U2R A;  4XKC A;  2VKD A;  3KLN A;  3F8B A;  2F5F A;  3RPU D;  4CH7 A;  3CLO A;  3FXK A;  1P92 A;  5HNF A;  5FLV A;  2FUG 2;  4C9Y A;  1YRN A;  2OC6 A;  1P6R A;  5BPD A;  3LSR A;  4MO7 A;  4IHW A;  3OS0 A;  1R1V A;  4OAY A;  3S8P A;  2NNY A;  4AIK A;  5GAH J;  4EMS A;  4LB5 A;  3DPU A;  3KPH A;  3KEO A;  3BTL A;  2TCT A;  3O6B B;  1UG0 A;  3RPU A;  5BPI A;  4Y17 A;  2JPB A;  2PX9 A;  2Q2E A;  3HRT A;  3L2W A;  1QPM A;  3PIP F;  3S2H J;  2A61 A;  3EQL F;  2LY2 A;  3IWZ A;  4N9H A;  3EUA A;  3WGH A;  1IN4 A;  4KIC A;  2JRT A;  2QA4 I;  2WV1 A;  2P81 A;  4LG3 A;  4UV8 A;  2ZJR F;  1PUE E;  3DLA A;  4IHV A;  2KL4 A;  4E7I A;  3L1P A;  2IA0 A;  3I59 B;  4RGS A;  2H8W A;  2DK5 A;  4KJZ A;  5DM7 F;  3WTT C;  1IV6 A;  2VXZ A;  2IS4 A;  1ZLJ A;  1WJB A;  2L7K A;  4G6D A;  1ON2 A;  2BGC A;  3BTC A;  5GAG J;  4D9J A;  1Z6T A;  3BJO A;  2L0K A;  4HQE A;  1L3L A;  3HM5 A;  1VND A;  5L3D A;  4BY1 J;  3VB2 A;  2PLY A;  1JUM A;  4CGZ A;  1WJF A;  4BHB A;  1X2M A;  2ZJP F;  3DTK A;  3LQQ A;  2VQG A;  1MBH A;  3TMO A;  3G2B A;  2Q1Z B;  3S1Q J;  4PJN A;  1W4M A;  2R7F A;  4F55 A;  3K70 C;  2F5C A;  3IP4 B;  4ESJ A;  1MDM B;  3MVP A;  1ERD A;  2FU4 A;  2VL8 A;  2R92 J;  2K4J A;  2VJJ A;  4OWR B;  2CW8 A;  2HVQ A;  3BZC A;  2V1U A;  5KCM A;  2BHZ A;  2F5D A;  2VLA A;  2K9N A;  3BQY A;  1WJA A;  3EYY A;  4C2T A;  3JTG A;  1WQ2 A;  2F6C A;  3SEQ A;  1S7A A;  2I10 A;  3W2V A;  4U7B A;  1XMA A;  5ICE A;  3PL8 A;  2DPU A;  4DW6 A;  2DDB A;  2UUZ A;  3K4B A;  3KZY A;  1Z3X A;  3SHF A;  2ACJ A;  2HVS A;  2NVT J;  3J81 Z;  2MH9 A;  5L3C A;  1ZRC A;  1Z05 A;  3TO9 A;  4UUS A;  3K6G A;  4KIS A;  3HHH A;  5KK1 A;  3BTJ A;  3AKZ A;  1OIS A;  3LWF A;  1BI1 A;  1RNL A;  4GXO A;  2KLO A;  3C7J A;  1YS7 A;  2BVL A;  2LBF B;  3J7Z I;  2EFQ A;  2O5R A;  1HSJ A;  1OQY A;  4IXA A;  1XCB A;  5D5U B;  2ME0 A;  3W2W A;  1BR1 A;  2LG4 A;  4EEF G;  1TNT A;  5BOX A;  3CUO A;  2EV5 A;  3E6D A;  5KVR A;  4NC7 A;  5LD2 C;  1L0O C;  2FQ3 A;  5FFZ A;  1TL8 A;  2VN2 A;  3A01 B;  2B7E A;  3DLL F;  2EIK H;  3EDP A;  1XSX A;  5CKT A;  3J80 K;  4CZC A;  1ZRD A;  3I59 A;  2IXS A;  1EA3 A;  5FKL A;  2W57 A;  2R7R A;  3A2K A;  3HOU J;  1J5Y A;  1K79 A;  4IKF A;  1S29 A;  2WY8 Q;  2CFX A;  3OYF A;  3ZPL A;  2H09 A;  5CVI A;  1MBF A;  2XHK A;  4KDP A;  3RJP A;  2HGC A;  1H89 C;  3H5A A;  1ZH5 A;  5J40 A;  3BR3 A;  1ZGJ A;  1IDZ A;  1JT6 A;  4MIM A;  2ZB9 A;  3HOZ J;  1S7E A;  2ICW G;  1O7F A;  2DMU A;  3SZG A;  5FB2 A;  2QSF X;  2HPM A;  2GA1 A;  4PJM A;  5M3F J;  4A0X A;  1MMG A;  1TT0 A;  1CGP A;  1PYV A;  3S16 J;  4AUX A;  1MDM A;  1FNN A;  2L3D A;  5EG0 B;  1LUJ B;  2R5Z B;  5FLX Z;  4R1H A;  1Y1V J;  2ZFU A;  1FP1 D;  5HLT A;  1ITY A;  2KP6 A;  2LRE A;  3E5Q A;  3OOU A;  1JGS A;  1R49 A;  1ZRF A;  1D0X A;  3PO3 J;  3I55 I;  4KMF A;  5IYC J;  4GFB A;  2ZXI A;  2M3A A;  2KIQ A;  3D5S C;  2K02 A;  5FKM A;  2KRF A;  3E7L A;  2AHQ A;  3OYL A;  2P0W A;  5GTI C;  4ZDL A;  4RGU A;  4E7L A;  1YI2 I;  2GXB A;  1G3Y A;  1KU9 A;  2E1C A;  2XGC A;  2E2H J;  2VT3 A;  3I0T A;  4IO9 F;  2BE5 F;  3FXR A;  4M74 A;  3WHB A;  2ZNZ A;  2HYJ A;  4XL9 A;  4OIQ F;  2NVX J;  4JP0 A;  2KIU A;  3J7A O;  2Q8K A;  3HKZ N;  1T39 A;  3FM5 A;  3PQK A;  4MEX F;  3MKW B;  4Q48 A;  3H35 A;  3HOW J;  2UXX A;  3WTX C;  4J00 A;  1VQ6 I;  2LYC A;  4P9U A;  1I5Z A;  4HSR A;  5E8I A;  4AVZ A;  2JSP A;  1XB4 A;  2MG4 A;  1QPI A;  3K2A A;  1H88 C;  4U0W A;  3FXQ A;  4NNJ A;  2MD5 A;  3AG1 H;  3V7C A;  2NXN B;  4EQQ A;  1IDY A;  2KHM A;  1MZB A;  3PO2 J;  1FEX A;  4LLL A;  1S6L A;  3T8R A;  1DP7 P;  2IEK A;  1BR2 A;  1R22 A;  4JX4 A;  1QQI A;  2HQN A;  4LGW A;  4ESF A;  3JRB A;  2L9R A;  3FM3 A;  3K9T A;  3O2P E;  3R61 A;  2ISY A;  5HNH A;  4UY8 I;  4KIG A;  4BU2 A;  2P7C B;  1IXS B;  5HDN A;  5C44 J;  3PM1 A;  3WU1 B;  1SD7 A;  1VQL I;  2M4G A;  4WX9 A;  4D1Q A;  3CO6 C;  1WJD A;  1PDN C;  4W1U A;  4LK0 F;  4BNC A;  5DV5 A;  1TLH B;  2LNB A;  5IYD J;  5EGO B;  4CCM A;  2DDA A;  3JSO A;  2IA2 A;  1WH5 A;  3FZV A;  4ZZD A;  3KZI C;  1IGN A;  5HS7 A;  2J5O A;  3RYP A;  3ZMT A;  2VBW A;  4N0B A;  3FDY A;  3NQO A;  2OF7 A;  2VOD A;  3GTK J;  3J7Y J;  1X1A A;  2IPQ X;  2Y75 A;  2VQC A;  3M1E A;  3H3V K;  2R5Z A;  1HDP A;  1Z77 A;  1STZ A;  1TQP A;  2ECB A;  5LLQ A;  3DEU A;  1BM9 A;  4M3E A;  2K9Q A;  1X4O A;  1YE9 A;  2EZI A;  4KN7 X;  1S72 I;  3M8J A;  4P9F A;  1K61 A;  3WU2 C;  5JR3 A;  5E20 A;  3CCE I;  2A5W A;  2JA8 J;  3GTP J;  2YSR A;  5L3F A;  4B1R A;  1MJ9 A;  2KFD A;  1QZZ A;  2CGP A;  1YFH A;  4N4N B;  5EEG A;  2STW A;  4C3H J;  4CDG A;  5FD6 A;  1RR8 C;  2JN6 A;  2YS9 A;  2HXI A;  5IYB J;  3Q0U A;  1T08 B;  2FNA A;  1BI2 A;  1S5L C;  3O8G A;  4PJ0 C;  2QF7 A;  5HDK A;  1W0U A;  2IS2 A;  1IUY A;  2JPC A;  1D8J A;  4IQ4 A;  4FTH A;  2EFO A;  3HJE A;  1Q1V A;  2XUB A;  5LEK A;  1QZE A;  2EZH A;  1W7P D;  1D8K A;  3I4P A;  2OTJ I;  3L09 A;  4I09 A;  4CYD A;  2DA4 A;  1SAU A;  2M8E A;  2IT0 A;  3LSK A;  3WTV C;  3L9F A;  3H3U A;  2ZME C;  1ZN2 A;  3OYG A;  4N9I A;  5LGT A;  1W7P A;  2W4S A;  4DBR A;  1MD0 A;  1F43 A;  2FD5 A;  1X1B A;  1WKM A;  1IC8 A;  4Y3O A; 
#chains in the Genus database with same CATH homology
 1PP8 F;  2QVO A;  2A07 F;  3VOE A;  3L2C A;  2XAG A;  2XAJ A;  3DFG A;  4EM2 A;  2A6H F;  3HIF A;  4PCQ A;  4RB0 A;  5CVV A;  2Z33 A;  3R4K A;  4MEY F;  4M6Y A;  2QM3 A;  1IN5 A;  2HKO A;  1HQC A;  2FOK A;  4HAM A;  5A2Q Z;  1OKR A;  4L18 B;  2PBI A;  2PI0 A;  1ODD A;  4YIF A;  1HST A;  1FPQ A;  2PJP A;  3R0A A;  4D0P A;  2P6S A;  4LLG F;  3KP5 A;  3P9I A;  1LB2 A;  1AOY A;  5LGU A;  4UHT A;  1SAX A;  4OIP F;  5DD4 A;  1FYK A;  3RKW A;  2HDC A;  4ENN A;  4PGH A;  4IRI A;  1YLF A;  3I5U A;  2FXA A;  4KA4 A;  3EET A;  3GXO A;  3ZMZ A;  2WV0 A;  3GFL A;  2P5K A;  4KN4 X;  1AWC A;  2CG4 A;  4UVB A;  5HLI A;  4IHT A;  2LSO A;  3N4M A;  2XKP A;  2GAU A;  4HQM A;  3P9K A;  2NS0 A;  2G9W A;  2DTR A;  4MNU A;  1T98 A;  2XKO A;  4L9T A;  2BYV E;  2HFH A;  4HBL A;  1E2X A;  3LA7 A;  4HDU A;  1LDJ A;  1UB9 A;  4M72 A;  3GZ5 A;  5J8F A;  2OAZ A;  3J81 K;  3HOT A;  2DU9 A;  4R8H A;  1R36 A;  1O3Q A;  4FX4 A;  1JXS A;  4MTE A;  1PP7 U;  4RB1 A;  3GYH X;  2XIG A;  3HUG A;  5TJJ A;  3RDI A;  3HTU A;  3QPH A;  1HBX G;  1KGS A;  3WU0 A;  4LFU A;  4L5I A;  2CQK A;  3Q9V A;  1HKQ A;  2EV0 A;  2H6B A;  2B0L A;  4QWQ A;  3LA3 A;  2HTS A;  4GGG A;  3M7G A;  4QLC U;  3PQJ A;  2QBY B;  4A6E A;  5LRS A;  2M5W A;  5JFR A;  1ZAO A;  4OOI A;  4HDV A;  5FGM A;  1SD6 A;  2NAZ A;  2Y48 A;  1P4W A;  3ECH A;  4ESB A;  1YTY A;  1Y0U A;  4EVI A;  5E1W A;  5LHH A;  3IKT A;  2F5E A;  1XSV A;  3R60 A;  3QU6 A;  2M45 A;  3CUQ A;  2K86 A;  3P7N A;  1B9M A;  2HQR A;  3K2Z A;  4YII A;  1IZ1 A;  4L0Z B;  1ZAR A;  3FHZ A;  1BI0 A;  2JT1 A;  3M8F A;  1K7A A;  3DPL C;  2A6E F;  4G7O F;  1F5T A;  3KFW X;  4R79 A;  2Z5U A;  1SD4 A;  4EJV A;  4P96 A;  1TQM A;  3ZP5 A;  5DUI A;  4WCG A;  1IXC A;  3FMQ A;  1QGP A;  1IN6 A;  5K5R A;  3F6O A;  4UVA A;  4L5J A;  2L4M A;  4PZJ A;  3QAH A;  1BBY A;  1EH6 A;  4Z2Y A;  1HXD A;  5BS6 A;  3R0J A;  2QBY A;  1OMI A;  1WI9 A;  2IP2 A;  1J9I A;  3FMR A;  2TDX A;  4IRG A;  1ZG1 A;  1DPU A;  3I58 A;  2ISZ A;  1LJ9 A;  1HKT A;  2STT A;  4CZZ A;  4FHT A;  2RNJ A;  2RN7 A;  4XLP F;  2O6G E;  5LEJ A;  4B09 A;  1V4R A;  5J8C A;  2CW0 F;  1HW5 A;  5K5O A;  2EFP A;  4IF4 A;  1F1Z A;  2YX7 A;  3KLO A;  1BJA A;  4RGX A;  2PEX A;  3F8F A;  4UVC A;  1ONV A;  3CTA A;  1GHC A;  5D8K B;  3TDZ C;  3FF5 A;  1DDN A;  4HX8 A;  2CSO A;  3D0S A;  4HV6 A;  3WE3 A;  5IT9 Z;  4MGR A;  3KP2 A;  1MGT A;  4BH9 A;  1RUO A;  3FMS A;  1E17 A;  3U1D A;  3NEU A;  4UV9 A;  1O3S A;  3KP7 A;  3L7W A;  3BP8 A;  2G7H A;  4M6X A;  3JTH A;  4I2O A;  1SFX A;  4DNC A;  4RB2 C;  1SD5 A;  5ILU A;  1J0R A;  1TW3 A;  1LNW A;  2M87 A;  1UCR A;  2P4W A;  3IHU A;  2Z99 A;  3HRS A;  2WTE A;  2W84 A;  4GCV A;  1WRJ A;  1K78 A;  2XRO A;  1U6G A;  1IW7 F;  5A2Q K;  3L00 A;  3RKX A;  3BWG A;  1EH7 A;  1YO5 C;  2OBP A;  3QPT A;  1R1U A;  4LJZ F;  1GXQ A;  1NHA A;  1O7L A;  2FBI A;  3MZH A;  4CHU A;  2FNP A;  4O3M A;  3HSF A;  5E1X A;  5LRR A;  3RPQ A;  2MH2 A;  2GIV A;  5E17 F;  1FBU A;  3K69 A;  5HS9 A;  5LBQ A;  5HS8 A;  3AAF A;  4JK1 X;  3WTZ A;  2DFI A;  3NRV A;  4NB5 A;  2ESN A;  2QEN A;  3WGI A;  3DF8 A;  3D5L A;  2EA2 A;  2YR2 A;  1QBJ A;  1RI7 A;  2PMU A;  5ICF A;  2HYF A;  1XMK A;  2LF8 A;  4XLN F;  4U7D A;  2L54 A;  3GX4 X;  2RDP A;  5ILV A;  1Z7U A;  2FEZ A;  1ZG5 A;  4EJW A;  5BMZ A;  1F9N A;  2FBK A;  1XSD A;  4KMU X;  2W24 A;  2HR3 A;  1W7P B;  3QP6 A;  2HKX A;  2HYG D;  2UXN A;  1TBX A;  3ZN0 A;  4HX4 A;  5FO5 A;  1JE8 A;  5HDG A;  3F6V A;  2D2W A;  3CO7 C;  1ZRE A;  3H92 A;  2MC3 A;  4Y15 A;  4A0Y A;  4OIR F;  1LDK B;  2QWW A;  1V3F A;  5E18 F;  2C6Y A;  5D5X B;  1FT9 A;  2MA3 A;  4LG0 B;  2J5P A;  1DUX C;  4L9N A;  5CVU A;  2FA5 A;  2ETH A;  4ASN A;  1J59 A;  3FWE A;  3IWF A;  4KUM A;  1H9T A;  3DQV C;  1UHW A;  2VE9 A;  4ZYG A;  2QYO A;  4CO8 A;  4U0V A;  1ON1 A;  3WTU C;  3HRM A;  4HZF A;  2VT2 A;  2EK5 A;  4A6D A;  1FP2 A;  2VBX A;  1XDU A;  2IRF G;  1RIO H;  1DPR A;  2Z9O A;  1MKM A;  5DD8 A;  2EV6 A;  3TKY A;  4ENJ A;  1YS6 A;  3HHG A;  1FY7 A;  5D6E A;  1TNS A;  2JZY A;  4IVN A;  1FBQ A;  3HRU A;  2OD5 A;  5ERI A;  3O3K A;  2NRA C;  4DQ2 A;  4OIO F;  3VOD A;  1BIB A;  2L01 A;  3E6C C;  3K0L A;  1LVA A;  3SXY A;  4M9Z A;  1REP C;  5F1R A;  3F8C A;  2DW4 A;  4BYY A;  3TO6 A;  2VC1 A;  4EGY A;  3ABU A;  2RVC A;  2ELH A;  2P7V B;  1Q1H A;  4MHG A;  2V1D A;  5DCM B;  1BC7 C;  4KIB A;  2M1B A;  1TTY A;  4ZZL A;  3T8T A;  3OOP A;  2K27 A;  3ZMD A;  2YPR A;  3ZMS A;  4UNO A;  3KZZ A;  4KT5 C;  1C0W A;  3GFJ A;  4Q4Z F;  4LG0 A;  2XRN A;  3ZQ7 A;  1FSH A;  5HOO A;  1IN7 A;  4NHJ A;  2AS5 F;  1J7K A;  3VEP A;  4AIH A;  4EGZ A;  4EM0 B;  1XDS A;  5DYM A;  4KNY A;  3Q5F A;  1KU7 A;  2MLK A;  2E7X A;  4AD9 A;  2PN6 A;  2ZO4 A;  1BI3 A;  5ICG A;  2O03 A;  1I27 A;  4ETS A;  2Q0O A;  2ZJ2 A;  3K1P A;  3LST A;  2VBZ A;  2ZKZ A;  2ZCW A;  4ZYD A;  3GF2 A;  6PAX A;  5DEQ A;  2O3F A;  1U8R A;  1EV7 A;  3OV8 A;  1FSE A;  3WOD F;  4EJU A;  3GUD A;  2NNN A;  4WF2 A;  2MBF A;  4UXN A;  4EV0 A;  2H27 A;  3CUQ B;  2R7D A;  4H0E A;  1ZGA A;  4YFN F;  5IT9 K;  4WXC A;  1BC8 C;  2FBH A;  3KP6 A;  3GO5 A;  4BHC A;  4RS8 A;  4RB3 C;  2KKO A;  1U5T B;  5DCM A;  4S05 A;  3C3W A;  2CWE A;  4FT8 A;  5AON A;  3V7R A;  2KIF A;  1XCV A;  2ADU A;  4G8X A;  3E5X A;  4YG2 F;  1OYY A;  5JVT A;  1FLI A;  4RGR A;  2BBY A;  3I64 A;  1KYZ A;  3ERE D;  4I98 B;  3MEX A;  5D4R A;  4G7H F;  3RIR A;  4LLN A;  1KU3 A;  1YIO A;  2UWM A;  3ZMV A;  1VTN C;  4Y13 A;  2RGV A;  2FF4 A;  1I1G A;  4WXD A;  4KYW A;  5AIP A;  2X4H A;  1I1S A;  3T5X A;  3I54 A;  4XSZ F;  2OU2 A;  5E1Z B;  1U78 A;  2YU3 A;  3HTS B;  1O3R A;  3GEZ A;  2V9V A;  2NYX A;  2DLL A;  3BRO A;  3IC7 A;  1G3W A;  3N97 A;  2V6C A;  5CYV A;  3GFI A;  4P5O A;  3TGN A;  2PG4 A;  5FLX K;  2D1H A;  3GZ6 A;  3MQ0 A;  2RV8 A;  2P5V A;  2A5Y B;  3QU3 A;  1P2F A;  3COA C;  1P4X A;  1G3T A;  3HSR A;  3MZY A;  5D6F A;  1G3S A;  3R6S A;  5CVJ A;  3SZT A;  2OQG A;  1G6N A;  1KQ0 A;  1J2X A;  5E8G A;  1OPC A;  1YG2 A;  4YFK F;  2JTV A;  5F6F A;  1OR7 A;  3RYR A;  4BHP A;  2K4B A;  1U5T A;  2VE8 A;  2FRH A;  2PFB A;  5F64 A;  3EUH A;  3LFK A;  4BXU A;  2A69 F;  1OYW A;  3E6M A;  2OZ6 A;  1IAW A;  4M71 A;  2WC2 A;  5CLS A;  3IRQ A;  4GYI A;  1B1B A;  3BPV A;  2O61 A;  5FD5 A;  5L3G A;  5K5Q A;  3DXJ F;  4IRH A;  3BPX A;  1IRG A;  1GVJ A;  2ZFW A;  5CVR A;  4XSX F;  3LA2 A;  3TDU C;  4IHS A;  3F8M A;  2XV4 S;  5HVQ C;  3K1N A;  1K78 B;  2BEO A;  1QO0 D;  2GA2 A;  3DP7 A;  3I53 A;  3FXU A;  2P6T A;  4L0Y B;  1XN7 A;  3LAJ A;  3V8L A;  4FX0 A;  3MCZ A;  1FOK A;  2H6C A;  3EYI A;  1FYL A;  5HLG A;  3BJ6 A;  4ZYH A;  4HX7 A;  2HOE A;  4S04 A;  2KJB A;  2UZK A;  1TQI A;  2XAQ A;  3F23 A;  3SZP A;  2CYY A;  3MAJ A;  1IF1 A;  4ON0 A;  2HS5 A;  2OZU A;  1U3E M;  4I01 A;  2EFW A;  4KIF A;  1RUN A;  4WXH A;  4K2E A;  1BOA A;  4L9J A;  3CDH A;  4GYG A;  2X0L A;  1F4K A;  1X3U A;  3IKV A;  4BQA A;  2EFN A;  4OIN F;  5L3B A;  1R00 A;  2IVM A;  3G3Z A;  1R58 A;  3E97 A;  1YQA A;  1FWZ A;  2XGX A;  2WWY A;  5H20 A;  3BZ6 A;  2ZBK A;  3F22 A;  1GXP A;  3SQN A;  2K7L A;  2FML A;  2A68 F;  4A0Z A;  5ED4 A;  5ILS A;  2P5L C;  3P9C A;  2AXL A;  1B59 A;  2W85 A;  3T1B A;  2OQR A;  5JHU A;  1UFM A;  4EJO A;  1H9G A;  2KJC A;  1XD7 A;  4AWX B;  1HW2 A;  2QQA A;  1XGS A;  1P4A A;  4RAZ A;  2PMH A;  1LQ1 A;  2FSW A;  2DO7 A;  3WTS C;  2O8X A;  2XAF A;  2IA1 A;  1ZYR F;  3WE2 A;  5J6X A;  5L3E A;  1MJB A;  4MQ9 F;  4I02 A;  3WG9 A;  2HZT A;  1HKS A;  1W5S A;  2H94 A;  2RC4 A;  4MTD A;  1KYW A;  1R23 A;  3LAP A;  3QRF F;  2QUF A;  1R1T A;  2P8T A;  2ESH A;  5DUK A;  1S3J A;  3ML6 A;  4HYE A;  4GO1 A;  2G7U A;  2M30 A;  2HWV A;  3GW2 A;  3ZN1 A;  1R5H A;  1J75 A;  5LGN A;  1ZHF A;  2QQB A;  1HW1 A;  3QOP A;  3DKW A;  4UUV A;  1H0M A;  2L02 A;  4Q47 A;  3T0Y A;  2V1X A;  4A5M A;  5IT3 A;  3BY6 A;  3JAM Z;  3KP4 A;  3KET A;  3ULQ B;  1SFE A;  1OYI A;  1JHF A;  3BDD A;  2D1V A;  3RI4 A;  2VOP A;  2HTJ A;  4XRF A;  5D5V B;  1XGN A;  1KA8 A;  1EH8 A;  4U0Y A;  3F8N A;  3F3X A;  1YW9 A;  5EEH A;  1WWX A;  1CF7 B;  3MWM A;  2ZNY A;  1TW2 A;  4HF0 A;  1ZLK A;  3GWZ A;  1IXR C;  1JHH A;  2KIM A;  3WTY C;  1QZY A;  4E70 A;  4M73 A;  4EM1 A;  4M9X A;  4LD5 A;  4B8X A;  2LF7 A;  2EWN A;  5DCF A;  5LHG A;  5H6Q A;  4G9Y A;  1USS A;  3REO A;  3WGG A;  2DT5 A;  4P55 A;  1B4A A;  1KQ9 A;  3TO7 A;  3S2W A;  4I7H A;  2GQQ A;  2EB7 A;  4PGG A;  4M9S A;  1O57 A;  3C18 A;  4XBF A;  4LB6 B;  4I0B A;  4YFX F;  1R5G A;  2O0Y A;  2R3S A;  1XGM A;  4A2U A;  1T0F A;  1T6S A;  3V8J A;  3VFZ A;  1IN8 A;  3CJN A;  3KP3 A;  3SFZ A;  2BV6 A;  5D8L B;  3F21 A;  4HLX A;  3CUQ C;  3Q9S A;  2GXG A;  4OMY A;  1B6A A;  2E1N A;  4ZYE A;  1S8N A;  3E6B A;  3HSE A;  2MLG A;  2DPD A;  2VON A;  2DK8 A;  4I0A A;  2RQP A;  1CF7 A;  2D45 A;  1U5T C;  4JBA A;  1XGO A;  5TRD A;  4LK1 F;  5CJ9 A;  5H6R A;  1LEB A;  4TV7 A;  4O6J A;  1FC3 A;  4Q5S F;  2DAO A;  4CIC A;  1QNT A;  2DI3 A;  3J80 Z;  1BN5 A;  4HF2 A;  4BAY A;  3GFM A;  1YW7 A;  2E7W A;  3W6K B;  1T2K A;  1U2W A;  2LDU A;  3H3Z A;  3DPT A;  3KEQ A;  3JSP A;  3ISP A;  2JSC A;  3KE2 A;  3E5U A;  1ZG3 A;  1KU2 A;  2V79 A;  4HW0 A;  4JQF A;  4G94 A;  4F7Z A;  2QZ8 A;  3HYI A;  3I71 A;  2IJL A;  1YW8 A;  2FMY A;  2VOO A;  1W5T A;  1FX7 A;  1A04 A;  4WWC A;  2VC0 A;  3WTW C;  3MFK A;  1Z9C A;  2DQL A;  1BIA A;  3BOQ A;  4A12 A;  4HF1 A;  4O5V A;  2L4A A;  4AIJ A;  3FX3 A;  4EJT A;  3ECO A;  1KQ8 A;  3QP5 A;  1S7O A;  3U9G A;  3LQR A;  2COM A;  4RAY A;  3V7S A;  1IRF A;  3V4G A;  2QLZ A;  2EJR A;  2A3S A;  3M9A A;  4MQV A;  3W6J B;  2YX4 A;  4NQW A;  2QQ9 A;  3IRR A;  5BQT A;  2ZME B;  4WK8 F;  5DDG A;  3B73 A;  3RKY A;  4L9V A;  4OMZ A;  2XAH A;  2OA4 A;  4KFC A;  2GWR A;  4HOB A;  4CXF A;  3JW4 A;  4PDK A;  1B9N A;  2PQ8 A;  4HA8 A;  3HOS A;  1D5V A;  3DV8 A;  3K1M A;  5HLH A;  3TQN A;  1LDD A;  2F2E A;  4G6Q A;  1UST A;  1UHM A;  1YYV A;  3C1D A;  4LMY A;  1LEA A;  2CO5 A;  2IW5 A;  3TOA A;  2VBY A;  2DBB A;  3E3V A;  5D5W B;  4IPA A;  4G7Z F;  2XVC A;  1D3Y A;  2FE3 A;  5K1Y A;  4HLY A;  3TOB A;  4AVP A;  4ENK A;  4ENM A;  1FYM A;  1K6O A;  5D4S A;  3M8E A;  1O3T A;  2ZXJ A;  1FZP B;  1T38 A;  1SFU A;  1FBS A;  1Z1D A;  4IJA A;  2Y0M A;  4A5N A;  3B02 A;  3IL2 A;  3V8K A;  2HEO A;  1Z6R A;  5ICC A;  1RZ4 A;  2ZME A;  1I6X A;  5FFX A;  3ABT A;  2RKH A;  4U88 A;  2LKP A;  3G73 A;  3KCC A;  5LHI A;  1WSU A;  3RTR A;  1SMT A;  2XAS A;  1MJA A;  1SMY F;  4ZH4 F;  3ELK A;  2GZW A;  3GVA A;  1R7J A;  5AIQ A;  2Z3Y A;  3BJA A;  3PFI A;  3ROU A;  4OU0 A;  3GLX A;  2DQR A;  2W25 A;  3F72 A;  2EA4 A;  3JAM K;  1ULY A;  1Z91 A;  3ZMU A;  4HV5 A;  5JI6 A;  1G4D A;  3U2R A;  3KLN A;  3F8B A;  2F5F A;  3CLO A;  1P92 A;  5BPD A;  1P6R A;  1R1V A;  4AIK A;  2NNY A;  4EMS A;  4LB5 A;  3KEO A;  3O6B B;  3RPU A;  5BPI A;  4Y17 A;  2JPB A;  2Q2E A;  3HRT A;  1QPM A;  2A61 A;  3EQL F;  3IWZ A;  4N9H A;  3WGH A;  1IN4 A;  4KIC A;  2JRT A;  4UV8 A;  1PUE E;  2IA0 A;  3I59 B;  4RGS A;  2DK5 A;  3WTT C;  2VXZ A;  1ZLJ A;  4G6D A;  1ON2 A;  2BGC A;  1Z6T A;  3BJO A;  4HQE A;  1L3L A;  5L3D A;  3VB2 A;  2PLY A;  4CGZ A;  4BHB A;  3LQQ A;  1W4M A;  2R7F A;  2F5C A;  4ESJ A;  1MDM B;  2FU4 A;  2K4J A;  2V1U A;  2F5D A;  3EYY A;  3JTG A;  1WQ2 A;  1S7A A;  4U7B A;  1XMA A;  5ICE A;  2DPU A;  3KZY A;  3SHF A;  2ACJ A;  3J81 Z;  2MH9 A;  5L3C A;  1ZRC A;  1Z05 A;  3TO9 A;  3HHH A;  5KK1 A;  3LWF A;  1BI1 A;  1RNL A;  4GXO A;  3C7J A;  1YS7 A;  2EFQ A;  1HSJ A;  4IXA A;  1XCB A;  5D5U B;  1TNT A;  5BOX A;  3CUO A;  2EV5 A;  3E6D A;  5KVR A;  1L0O C;  2FQ3 A;  5FFZ A;  2VN2 A;  3EDP A;  1XSX A;  3J80 K;  1ZRD A;  3I59 A;  2W57 A;  1J5Y A;  1K79 A;  1S29 A;  2CFX A;  3ZPL A;  2H09 A;  5CVI A;  2XHK A;  4KDP A;  3RJP A;  2HGC A;  1ZH5 A;  1ZGJ A;  1O7F A;  5FB2 A;  2GA1 A;  4A0X A;  1CGP A;  1MDM A;  1FNN A;  2L3D A;  5FLX Z;  4R1H A;  1FP1 D;  3E5Q A;  1JGS A;  1ZRF A;  4KMF A;  2K02 A;  2KRF A;  4RGU A;  2GXB A;  1G3Y A;  1KU9 A;  2E1C A;  2VT3 A;  3I0T A;  2BE5 F;  3FXR A;  4M74 A;  2ZNZ A;  4OIQ F;  2KIU A;  3J7A O;  2Q8K A;  1T39 A;  3FM5 A;  3PQK A;  4MEX F;  4Q48 A;  2UXX A;  3WTX C;  4P9U A;  1I5Z A;  5E8I A;  1XB4 A;  4U0W A;  3FXQ A;  2MD5 A;  3V7C A;  4EQQ A;  1MZB A;  4LLL A;  1S6L A;  3T8R A;  1DP7 P;  1R22 A;  1QQI A;  2HQN A;  4LGW A;  4ESF A;  3FM3 A;  3K9T A;  3O2P E;  3R61 A;  2ISY A;  4KIG A;  2P7C B;  1IXS B;  5HDN A;  3WU1 B;  1SD7 A;  4WX9 A;  1PDN C;  3CO6 C;  4LK0 F;  4BNC A;  5DV5 A;  1TLH B;  2LNB A;  3JSO A;  2IA2 A;  3FZV A;  4ZZD A;  5HS7 A;  2J5O A;  3RYP A;  3ZMT A;  2VBW A;  4N0B A;  3NQO A;  2VOD A;  2IPQ X;  2Y75 A;  3M1E A;  1STZ A;  1TQP A;  5LLQ A;  3DEU A;  1BM9 A;  4KN7 X;  4P9F A;  5JR3 A;  5E20 A;  2YSR A;  5L3F A;  1MJ9 A;  1QZZ A;  2CGP A;  1YFH A;  2STW A;  5EEG A;  4CDG A;  5FD6 A;  2FNA A;  1BI2 A;  5HDK A;  1IUY A;  2JPC A;  1D8J A;  2EFO A;  2XUB A;  5LEK A;  1W7P D;  1D8K A;  3I4P A;  3L09 A;  4I09 A;  4CYD A;  2M8E A;  2IT0 A;  3WTV C;  3L9F A;  3H3U A;  1ZN2 A;  4N9I A;  5LGT A;  1W7P A;  1MD0 A;  1WKM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...