2MBFA

Solution structure of the forkhead domain of brugia malayi daf-16a
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
101
structure length
101
Chain Sequence
NPWGAESYSDLIAKALKSTFDGRMRLNEIYNWFASNVPYFGNRTSQEQSAGWKNSIRHNLSLHSRFMRIQNEGAGKSSWWVINPDAKPGRNPRRQRSATLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The solution structure of the forkhead box-O DNA binding domain of Brugia malayi DAF-16a.
pubmed doi rcsb
source organism Brugia malayi
molecule tags Transcription
molecule keywords Fork head domain containing protein
total genus 24
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-07-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2mbfA01
4I01A 1IN7A 2L01A 3F6OA 4BH9A 3RJPA 1J0RA 3MCZA 3VB2A 4YFKF 1T0FA 1IUYA 3IKVA 3L2CA 3KFWX 3MAJA 4G7ZF 3F21A 3ZMUA 3I0TA 4FX0A 2J5OA 4ASNA 5LHGA 5JR3A 5ICEA 4MHGA 3HRSA 5FD6A 3TGNA 2Z99A 2ISZA 1P6RA 2V1DA 4P96A 1UCRA 2VC0A 4ZYDA 3BROA 1TW2A 3I59A 3COAC 3FM5A 1G3YA 4PGHA 4RB0A 2P6TA 1Z9CA 3HUGA 4S04A 2LF7A 3L7WA 1J5YA 1R5GA 4N0BA 4AD9A 2ESHA 3FXRA 1LQ1A 1I27A 2XAFA 2ZCWA 3MEXA 5JI6A 5K1YA 2A68F 4I0BA 2XV4S 3J81Z 1F1ZA 2CG4A 1OMIA 4G7OF 5L3GA 2PN6A 2VC1A 4UVAA 3KP3A 1BI2A 3U1DA 3RDIA 2L4AA 3U9GA 4EM2A 4Y17A 5DDGA 3GLXA 5KVRA 2Z5UA 4RB2C 1E2XA 1XMKA 1ZARA 5IT9K 2VT2A 2O3FA 1BIAA 5D4RA 3C7JA 2WV0A 2HGCA 1WWXA 4LMYA 3HTSB 2AS5F 1ZLJA 4RGRA 2RQPA 1PP7U 4N9IA 4HDVA 3FWEA 4Q4ZF 1U78A 3HSFA 1G3WA 1QPMA 3V7SA 4EV0A 5L3EA 1DP7P 2Y48A 3E6DA 3AAFA 3ZMVA 1UFMA 4GGGA 5FLXK 2F5CA 1J75A 3ZMZA 2O03A 3V7RA 4CDGA 3R60A 2CO5A 1ZN2A 2HTJA 3R6SA 1U3EM 3JSPA 4ENMA 2D45A 4CYDA 1S7AA 1EH8A 3HOTA 1JHFA 5HDKA 5L3BA 2HTSA 3E5XA 3HOSA 3BP8A 2L3DA 4YIFA 2RVCA 3DP7A 2OQGA 3TO6A 2PG4A 3EQLF 1S8NA 2K27A 2H09A 4KUMA 2EFWA 4XSXF 3BY6A 2IP2A 3GZ5A 5LHHA 5H6RA 2QQBA 1R7JA 3OV8A 4U0YA 1LDKB 1ZH5A 1VTNC 1KQ0A 4HQMA 1F9NA 1JE8A 4OIQF 1OYWA 3WGIA 1YFHA 1L3LA 4IXAA 3F8CA 2XHKA 2RNJA 2PJPA 2X0LA 2KJCA 2LSOA 1ZAOA 4EM1A 4EGYA 1T39A 1FWZA 4L9VA 2JTVA 1FX7A 2NNYA 1MJBA 1ULYA 1O3SA 3ZMTA 3KP4A 3RIRA 4RAZA 4ZZLA 2GIVA 2RC4A 4RGSA 4EJVA 4FX4A 4MNUA 5LGNA 4HF2A 1IN5A 2W84A 3K9TA 1S29A 4RS8A 5J6XA 1FC3A 2VN2A 1Z6RA 1WKMA 4UUVA 3DPTA 4UVBA 1FZPB 4ESBA 1W7PA 5K5OA 2KIMA 2V1XA 1K6OA 1B9MA 1REPC 3R4KA 4IRIA 1TNTA 1D8KA 4RB1A 2HFHA 3K69A 3IRRA 2P5LC 1B9NA 2IA2A 5JFRA 1LJ9A 4CHUA 2MC3A 3P9IA 3CO6C 1KQ8A 3GFIA 1FP1D 4M72A 3IL2A 3E3VA 1ODDA 2XIGA 3GEZA 1LEAA 5HDNA 4WX9A 4P9UA 2ZFWA 3I71A 3LQRA 3I54A 3NQOA 3QRFF 3T1BA 4LG0B 1ZGAA 4Z2YA 1KQ9A 3HSRA 3MZYA 3JAMK 2D1VA 1D8JA 4EVIA 2Y75A 3SFZA 2G9WA 2FXAA 3P9KA 2MD5A 6PAXA 3ZN1A 1O7LA 3ERED 2FMLA 2VBZA 1R1VA 3TO9A 2EV5A 1SFXA 1W7PD 3J81K 2MLGA 3DQVC 4ENJA 1IN4A 1XCBA 4B8XA 3KE2A 4S05A 3F8MA 1QQIA 4LK0F 1FLIA 1R22A 4M73A 1QZYA 1KA8A 5E1ZB 1D5VA 1IW7F 1ZG5A 2IRFG 1R1TA 4BHBA 4FHTA 2ZMEA 1LVAA 2IW5A 2UXXA 1SFEA 2P5VA 2MLKA 2HYGD 2XGXA 3V8KA 2QLZA 1XGSA 2KJBA 4N9HA 4A6EA 4DQ2A 1YS7A 1HBXG 4HZFA 4Y13A 5LEJA 2O61A 4EJWA 1HQCA 2EFOA 4KIBA 5FGMA 1B1BA 3BJ6A 2LNBA 2NRAC 3I5UA 3JSOA 3P7NA 5J8CA 5A2QZ 4UV8A 1W4MA 2P7VB 2A5YB 1H0MA 4RB3C 2HOEA 3RI4A 5D5XB 1RNLA 3PQJA 1FSHA 2QBYA 2M45A 2DTRA 3VEPA 3WE3A 2IT0A 4NHJA 1S3JA 2CQKA 2XKOA 3F22A 2OU2A 5ILSA 2DAOA 3C3WA 4L0ZB 2HQNA 3EYIA 4HX4A 2A61A 3H3UA 1QNTA 1T2KA 3RKYA 2Z33A 5BPIA 5LLQA 2YX4A 2O6GE 1ZG3A 5E8GA 3ZPLA 1RZ4A 2UWMA 5BS6A 4LLLA 2L54A 5E17F 1HSTA 1NHAA 5CVIA 2QWWA 4LB6B 1FSEA 4EGZA 1GHCA 4LG0A 3JTGA 3KLOA 4A2UA 4G6DA 3DF8A 1KU3A 2HEOA 4L18B 3EDPA 5BPDA 3WU1B 1XSDA 3ZP5A 1TBXA 1OPCA 3WE2A 1IZ1A 3C1DA 3E5UA 3KLNA 2NAZA 2OAZA 1B4AA 1OYIA 3D0SA 3CDHA 2MBFA 2E1NA 2XROA 2EJRA 3GFJA 2W24A 1KU9A 5LGUA 2VBYA 4HQEA 3ECHA 2P4WA 4KT5C 4O6JA 3LFKA 4WXDA 3HYIA 2FRHA 4G94A 4IHSA 4LD5A 3WTYC 3FXUA 1O3RA 2AXLA 3F8NA 3NEUA 2P7CB 2PQ8A 1AWCA 3ISPA 2W25A 2MH9A 3L09A 2J5PA 2VODA 3WODF 3K1PA 5E8IA 1J2XA 3LAPA 3QU6A 1HSJA 3FMRA 2RDPA 2OD5A 3T5XA 2VONA 5DYMA 2FNAA 2A07F 4IHTA 3GWZA 4XLNF 3KEOA 4YIIA 4WK8F 4BHPA 2QVOA 4OU0A 4M71A 2H27A 3TOAA 1A04A 1BI0A 1X3UA 2BYVE 2OBPA 2K4BA 1FP2A 1SMTA 1T98A 3CJNA 1ON1A 5H20A 3K1NA 4WXCA 1E17A 1HXDA 3SQNA 3RKWA 4HOBA 3TDZC 4U7DA 3SXYA 2R7DA 2GA1A 3RYPA 1KYZA 1MJAA 5D5VB 1WI9A 3E5QA 1WRJA 3IWZA 3WGHA 2FOKA 4OIPF 4E70A 1FYKA 3F3XA 1Z05A 2JT1A 5BQTA 4JBAA 4EJUA 3ECOA 4RGUA 5DCMB 4BYYA 1YO5C 2BV6A 1XSVA 3JW4A 1G4DA 4PCQA 4UNOA 2A6HF 3F8FA 1R36A 4R1HA 2Z9OA 1WSUA 3NRVA 2DO7A 3L9FA 1F5TA 1BI3A 2RN7A 5LEKA 3DKWA 2QZ8A 2GXGA 4KA4A 5D6FA 4ON0A 4OIRF 3ML6A 1U5TC 4IPAA 3DPLC 5CYVA 1R58A 1LDJA 3KP2A 2KIFA 1YTYA 3FHZA 1P4WA 3T0YA 3M9AA 2H6BA 4LLNA 1W5SA 2F5EA 2QM3A 1EV7A 2JPCA 4BXUA 1U6GA 1J7KA 3T8RA 4EQQA 2G7UA 4IRGA 2EA2A 1ZRDA 2EV0A 4M6XA 3GFMA 4WCGA 1KYWA 1BJAA 2YR2A 2CWEA 2ZJ2A 4WF2A 1L0OC 1XN7A 3E6CC 2E1CA 1YQAA 3CUQC 1MJ9A 1U5TA 1KU2A 3I4PA 1I5ZA 2DK8A 4HX8A 1U2WA 3K2ZA 2O8XA 4JK1X 4ENNA 1OR7A 2F2EA 1JHHA 1STZA 5DV5A 2FMYA 1Z6TA 4UHTA 5FD5A 2H6CA 3H3ZA 5JVTA 2BBYA 1V4RA 4M6YA 1DUXC 5F6FA 3F8BA 4F7ZA 4WXHA 2OQRA 5DUIA 4MTEA 4A5NA 3EYYA 1FOKA 2G7HA 2EV6A 4PGGA 2WC2A 5CLSA 1XGMA 3KCCA 3J80K 2VBWA 4XRFA 5BOXA 2FU4A 2FEZA 4AWXB 1QO0D 3I59B 5FFZA 1SMYF 5K5QA 2XVCA 3HRMA 5CVRA 3WTSC 2QYOA 4ESFA 3V8JA 2STTA 1Z7UA 1J59A 3QP6A 2DW4A 3FXQA 4LK1F 4HV5A 1FYMA 5HLHA 2EK5A 4R79A 4AIKA 2MA3A 3KP5A 5H6QA 3BWGA 3HSEA 3WU0A 5HS8A 4HW0A 2M8EA 3O2PE 4HYEA 2P6SA 1SD5A 1H9GA 3BJAA 2E7XA 2IJLA 4QWQA 2RKHA 3LA3A 2Y0MA 2YPRA 1RUOA 3TQNA 1ON2A 3VODA 1IAWA 4FT8A 1XDSA 1CGPA 5F1RA 2XKPA 2QBYB 3I58A 1S6LA 2DPDA 4A12A 3TDUC 1U8RA 1O57A 1H9TA 2K02A 3BPVA 3CO7C 1MKMA 2P8TA 2NS0A 1FT9A 1LNWA 1XGOA 1ZYRF 1OKRA 4NQWA 4I0AA 4UXNA 3I53A 4HLYA 1W7PB 1G3SA 4LB5A 4LFUA 1SD4A 1CF7B 3LA7A 1XSXA 2FA5A 1MDMA 3L00A 1LB2A 1TNSA 3HTUA 1RIOH 4OMYA 1HKTA 1P92A 2ESNA 4EM0B 1GVJA 2ZKZA 2ZNZA 4Q48A 2DPUA 2ZNYA 3G73A 1K79A 2OZUA 2VBXA 2HYFA 5LBQA 3J80Z 3ZQ7A 2HWVA 1J9IA 4L9JA 1G3TA 5FFXA 4CXFA 4AIJA 5K5RA 2V1UA 3RYRA 2DT5A 3TO7A 3GZ6A 1MGTA 4MQVA 4CO8A 2DLLA 1BC8C 2L02A 3P9CA 1IRGA 5A2QK 5BMZA 2M1BA 4KMUX 4BQAA 3W6JB 4CGZA 4O3MA 2DU9A 3S2WA 1HKQA 4L5JA 3QU3A 3FM3A 2COMA 4KMFA 2XAHA 1SFUA 1D3YA 2ISYA 4IF4A 4KIGA 5CJ9A 5D6EA 3EUHA 3R0JA 2F5DA 5FO5A 4KIFA 1USTA 2B0LA 3DFGA 4ENKA 4M74A 2X4HA 5LHIA 3D5LA 1O3QA 4IVNA 2EWNA 1IF1A 5EEHA 4CZZA 1I1GA 5E20A 2DK5A 3QOPA 2XUBA 3KEQA 5ERIA 3IHUA 1TW3A 5ED4A 2HKXA 4I98B 1IXCA 3FMSA 2YSRA 3RKXA 5ICCA 1C0WA 1DDNA 1HKSA 1DPUA 1HW5A 3IRQA 4ZYEA 3Q9SA 1KGSA 1V3FA 2PMUA 3KP6A 2JPBA 2XASA 1XB4A 4Y15A 3ABUA 3ABTA 4GYGA 1S7OA 2FQ3A 2R7FA 1FY7A 3WTTC 4DNCA 4UV9A 2JRTA 1BM9A 3F72A 5ILVA 1TQPA 2FBHA 2LF8A 3RTRA 3GXOA 4MQ9F 3KZZA 4KDPA 5DD4A 5AONA 2HS5A 2FBIA 3J7AO 4U88A 3HRTA 1Q1HA 4I02A 3TKYA 2W85A 4A0YA 4PDKA 2VOPA 3C18A 3FF5A 4HA8A 5D5WB 4HDUA 4JQFA 1ZGJA 4HV6A 2CW0F 5CVUA 4HLXA 2D1HA 3ZMDA 2TDXA 4D0PA 3R61A 3WTWC 3K1MA 3M7GA 3SZPA 4BAYA 2GZWA 4EMSA 3RPUA 4QLCU 4Q5SF 4G8XA 5EEGA 2Q0OA 4YFXF 4UVCA 4H0EA 3EETA 5D8LB 1YW7A 4BNCA 2V6CA 3W6KB 3DXJF 3LQQA 4I09A 3LA2A 1IRFA 4M9XA 1YLFA 2W57A 1TQIA 3V8LA 2WWYA 2UXNA 1YW9A 4MGRA 1K78A 3M8EA 2PLYA 2BEOA 3PFIA 3CUQA 1FPQA 1QBJA 2QQAA 3KZYA 1IXRC 5IT9Z 2V9VA 4GO1A 5DCFA 1I6XA 3MQ0A 1IXSB 1ONVA 3WTVC 1TLHB 2ZO4A 4HX7A 5D4SA 4OIOF 1QGPA 2K7LA 1RI7A 3ZMSA 2V79A 4WWCA 4KN7X 4XBFA 2GXBA 2ETHA 3CTAA 3LWFA 1K78B 2HDCA 1YG2A 4GXOA 1UB9A 3BJOA 1GXPA 3WTUC 1XMAA 2E7WA 4OMZA 2Q8KA 5LRSA 2A6EF 1HW1A 1JGSA 1YYVA 1P4XA 2K86A 2ZBKA 1BOAA 4ETSA 2DI3A 2KRFA 2CYYA 2PMHA 1MDMB 4ZZDA 1JXSA 2OA4A 3DV8A 5J8FA 4XSZF 5DCMA 1R1UA 4A5MA 4EJOA 4ESJA 1OYYA 2O0YA 5DEQA 5LGTA 5JHUA 2H94A 2RV8A 4L9TA 2DBBA 2GA2A 1FYLA 2EFPA 4CICA 3BOQA 2M30A 1YW8A 2K4JA 3HIFA 2CFXA 4Q47A 4ZYGA 4A0ZA 2EA4A 3U2RA 1Z91A 2P5KA 1G6NA 3ULQB 5D8KB 3KETA 2JZYA 3RPQA 3I64A 3OOPA 1ZRCA 2ADUA 4R8HA 4TV7A 1B59A 1SD6A 1FBSA 2KKOA 2Q2EA 1AOYA 4AIHA 2EFQA 2GWRA 1BN5A 3F23A 4RGXA 1MZBA 4EJTA 3GO5A 5HVQC 3GF2A 2XAJA 4P5OA 3IKTA 5AIPA 4M9SA 2VOOA 3MWMA 2ZXJA 5IT3A 3BZ6A 2PEXA 1P4AA 3PQKA 1USSA 1SAXA 2ELHA 2ZMEB 3SHFA 3N97A 4OINF 2DQRA 3ZN0A 3CUOA 5TRDA 2PFBA 3LSTA 4IRHA 2YU3A 2VE9A 5HLIA 4A0XA 4LJZF 2A3SA 1ZLKA 3DEUA 1XGNA 3QPHA 4YG2F 2KIUA 1FBQA 3HRUA 1T38A 3FZVA 1BI1A 1P2FA 2DFIA 3REOA 4MEYF 4YFNF 1BBYA 3IWFA 5E1WA 2LKPA 1TTYA 1LEBA 5HDGA 1YS6A 2LDUA 1W5TA 4G9YA 2RGVA 3E97A 2HKOA 1ZHFA 2CGPA 4P55A 5F64A 4KN4X 4O5VA 1U5TB 1IN6A 5HLGA 3ROUA 3GX4X 5DUKA 5HS9A 2BE5F 2VE8A 3VFZA 4A6DA 2WTEA 4LLGF 2A69F 3GVAA 1QZZA 2C6YA 5E18F 2D2WA 4L0YB 2XAGA 2UZKA 1Y0UA 2NNNA 4HF0A 2VT3A 1ZG1A 2XAQA 1YIOA 2IPQX 4ZYHA 4M9ZA 3N4MA 1B6AA 3HHHA 2IA1A 3QPTA 4ZH4F 4BHCA 4KNYA 5HOOA 5LRRA 3B73A 3GYHX 4U0VA 5D5UB 4L5IA 2Z3YA 3R0AA 4RAYA 1MD0A 1DPRA 3LAJA 4GYIA 2HZTA 2MH2A 4I7HA 4IJAA 1Z1DA 2FNPA 4U0WA 3H92A 2M5WA 1EH6A 3Q9VA 2HQRA 5FLXZ 2QQ9A 3F6VA 3WTZA 4U7BA 5TJJA 3JTHA 3TOBA 2GQQA 5L3CA 1ZREA 1XDUA 5ICGA 1UHMA 3IC7A 2STWA 4KFCA 3WTXC 1CF7A 2EFNA 2HR3A 2EB7A 1O7FA 5E1XA 4GCVA 3E6BA 2GAUA 3QAHA 2JSCA 3Q5FA 4K2EA 5CVJA 5DD8A 3BDDA 2DQLA 1K7AA 1FBUA 3GW2A 3HHGA 4HBLA 2M87A 2PBIA 4XLPF 2FBKA 1T6SA 3KP7A 3QP5A 1GXQA 4KYWA 3V7CA 1UHWA 2XRNA 3FMQA 2CSOA 4HAMA 2PI0A 3M1EA 3K0LA 4P9FA 2FSWA 1R5HA 2L4MA 4MEXF 1PUEE 3V4GA 3MZHA 3ELKA 3SZTA 2FE3A 1WQ2A 4L9NA 1ZRFA 3E6MA 4I2OA 5AIQA 3GUDA 4LGWA 3BPXA 3WG9A 1PP8F 3GFLA 3B02A 1F4KA 4G7HF 2IVMA 1KU7A 2R3SA 5ILUA 1HW2A 3G3ZA 3M8FA 1R23A 2ACJA 3FX3A 1PDNC 1R00A 1XCVA 1I1SA 2QENA 5KK1A 3VOEA 4G6QA 3JAMZ 2YX7A 1TQMA 4PZJA 1EH7A 2OZ6A 2F5FA 2IA0A 4B09A 2QUFA 2VXZA 4OOIA 3O6BB 1IN8A 1O3TA 5L3FA 1XD7A 3WGGA 5ICFA 1LDDA 3T8TA 1FNNA 3CUQB 4MTDA 5FB2A 2FF4A 5CVVA 4AVPA 3O3KA 1BC7C 2NYXA 4HF1A 3CLOA 1SD7A 3MFKA 1BIBA 4NB5A 5L3DA 5HS7A 1RUNA 2BGCA 4KICA
chains in the Genus database with same CATH superfamily
2X9DA 4I01A 1IN7A 2BZTA 4PJNA 2L01A 3F6OA 4BH9A 3RJPA 1J0RA 3HB9A 2R0QC 1D1BA 3MCZA 2Y2ZA 3BG3A 3OYCA 1AKHA 3VB2A 3W2VA 4YFKF 1HF0A 2WAFA 2WAQA 4BGDA 5F04A 1LUJB 1PVEA 2VQHA 4ABZA 1T0FA 5EEAA 3AG1H 1IUYA 5FKKA 3IKVA 3L2CA 2ZSIB 3FBNB 3KFWX 3NARA 4JX5A 2VKEA 3PL8A 1MMNA 3MAJA 2CJJA 4X0GA 3PIPF 3C2HA 4G7ZF 2B63J 4BJ6C 2KQRA 2DFEA 3ZMUA 3F21A 3I0TA 3BT9A 2J5OA 4FX0A 4ASNA 3PO3J 1EJ9A 5LHGA 5JR3A 2FD5A 1T08B 2NS8A 1S7EA 2BVLA 2O7OA 5ICEA 4MHGA 1XMXA 3HRSA 1K6YA 2HNHA 3ZOBA 5FD6A 4CH7A 3TGNA 1X1CA 2Z99A 2XGDA 1P7JA 2ISZA 1P6RA 2L9SA 3AG3H 2V1DA 4P96A 1UCRA 2VC0A 1WJDA 4ZYDA 3BROA 5KAIC 1VF9A 1ZKGA 2MG4A 1TW2A 3I59A 3COAC 3FM5A 1G3YA 4PGHA 4BKXA 4YRVA 2XGCA 4HG2A 4RB0A 2P6TA 1Z9CA 3CF5F 3HUGA 4S04A 3BCBA 2LF7A 3L7WA 1J5YA 1R5GA 4N0BA 4AD9A 2ESHA 3FXRA 3K6GA 1I27A 2XAFA 1OFCX 2ZCWA 3MEXA 1LQ1A 4BBSJ 2K3FA 5JI6A 5FLMJ 2R7SA 5K1YA 2A68F 3ZR8X 4I0BA 5EGOB 2XV4S 3J81Z 3M8JA 1F1ZA 2CG4A 1OMIA 4JP0A 4G7OF 5L3GA 2PN6A 2VC1A 5FJ8J 3OYAA 3K4JA 2EH3A 1UZCA 4PJMA 4UVAA 4IX7A 3KP3A 1BI2A 1OCTC 3U1DA 3RDIA 3IAM2 1HA8A 1ETKA 3VDXA 2L4AA 3U9GA 3DLLF 1MBKA 4A3IJ 4HNVA 4BY1J 2B7EA 4M3BA 3HC7A 2JSPA 4NC8A 4EM2A 3HGYA 2LH9A 2BOLA 3IUOA 4Y17A 4IKFA 5DDGA 3D1NI 4JX4A 3GLXA 4DYQA 3EUHC 1DU6A 5KVRA 2Z5UA 3DLAA 4RB2C 1E2XA 1XMKA 1ZARA 3KYLA 2KFDA 5IT9K 2VT2A 2F5VA 1LE8B 2O3FA 1BIAA 2JJ7A 5D4RA 3C7JA 3GTLJ 2WV0A 2HGCA 4BS9A 1WWXA 4XKVA 1ITYA 2IS6A 4LMYA 3HTSB 2AS5F 2QKLB 1ZLJA 4RGRA 2CV0A 2RQPA 1GV2A 1PP7U 4N9IA 1MBFA 1ACIA 4HDVA 4NC7A 3QOEA 4IOCF 2DMPA 3HPGA 1JKQC 1VQKI 3FWEA 3LSHA 3HDDA 4Q4ZF 1U78A 3HSFA 4I6ZA 4BBRJ 1ETOA 4HRIA 4CCNA 1G3WA 1QPMA 3V7SA 2M8GX 4EV0A 1WZ2A 1ZTRA 4P1WA 5L3EA 1DP7P 3TMOA 3A02A 2Y48A 3E6DA 3AAFA 3ZMVA 1UFMA 4GGGA 2DYSH 1EA3A 2BY1A 5FLXK 2F5CA 4CYCA 1J75A 2DMNA 3CP8A 3ZMZA 5F0HA 9ANTA 2O03A 3V7RA 1SVMA 3HEFA 2KZGA 2YUSA 3S3MA 1ERDA 4CDGA 2EINH 3S1MJ 3JRIA 3R60A 2CO5A 1ZN2A 4BU2A 2HTJA 2VB6A 3R6SA 3K7AJ 1U3EM 3JSPA 3RQIA 4ENMA 2D45A 4ZJZA 4CYDA 2JA5J 1S7AA 3HUGB 1EH8A 2HPIA 4BACA 3HOTA 1JHFA 5HDKA 4E7IA 2I8DA 5L3BA 1Y39A 3KZIC 2PX9A 2HTSA 1SFOJ 3E5XA 2IXSA 4AVZA 3OYEA 3HOSA 1U0JA 3S16J 3BP8A 3SDBA 2L3DA 4YIFA 2RVCA 2VKHA 2LOOA 3DP7A 2OQGA 2P81A 3IH2A 4RLFA 3TO6A 2PG4A 3EQLF 1S8NA 2R7TA 2M9HA 1YOVB 4DBRA 2K27A 3FK7A 3E1SA 2H09A 4XOPA 2IBDA 2AQEA 4KUMA 2EFWA 1VQ8I 4XSXF 3BY6A 5JLXA 1SVLA 2IP2A 2MD0A 2KRHA 2ID3A 3GZ5A 5LHHA 5H6RA 2QQBA 1BW5A 3H5RA 2KIQA 5FRNA 3CCQI 1R7JA 1T33A 3OV8A 2R7QA 4U0YA 1LDKB 3FKJA 1OCRH 2CV2A 2EIKH 3LSMA 4F3QA 3HM5A 1ZH5A 1VTNC 2OCEA 4AM3A 1KQ0A 4HQMA 2WV1A 1F9NA 2LR8A 1JE8A 4BL0B 5C4XJ 2NS7A 1OYWA 3WGIA 1YFHA 5J1YA 4OIQF 3JCUC 4B3XA 1L3LA 4IXAA 4BE2A 5E3MA 2LC2A 1X19A 3F8CA 2XHKA 5K7ZA 3S15J 1H89C 2RNJA 1FOXA 2PJPA 2I5UA 2X0LA 3LSPA 2KJCA 3IH3A 2LSOA 4A3MJ 1ZAOA 2EIMH 3GBGA 4EM1A 4EGYA 1YRNA 3M07A 1D1AA 2BVMA 5C4JJ 2QA4I 3HL2A 3OOUA 1T39A 5EZGA 1FWZA 4IHWA 3OY9A 1IG7A 1T56A 3HXLA 4L9VA 4RM2A 3K70D 1MMSA 2JTVA 1FX7A 4LG3A 2NNYA 2JRMA 2X1CA 1MJBA 1ULYA 1JUPA 3BQYA 1O3SA 3ZMTA 2WAQN 3KP4A 1A5JA 2VQGA 3RIRA 4RAZA 4ZZLA 1ORKA 2GIVA 4XR6A 2RC4A 4RGSA 2M4GA 4EJVA 4FX4A 3BQZA 3OL4A 1X2NA 4MNUA 3D5RC 2JA2A 3OYHA 5LGNA 4HF2A 4NUBA 4DYRA 1IN5A 2W84A 1Y6IA 3K9TA 2HDDA 2DA5A 1S29A 4RS8A 5J6XA 1GT0C 3JRHA 3CZ6A 4A3DJ 1FC3A 2VN2A 3B6AA 5BNGA 1Z6RA 2NOJB 4FQGA 1WKMA 1RETA 3FISA 3DPTA 4UUVA 4UVBA 1FZPB 1QHGA 4ESBA 1W7PA 5K5OA 2KIMA 5F27A 2V1XA 5H2FC 1OQYA 1B8IA 1QVUA 1K6OA 1B9MA 1REPC 2NVTJ 4J01A 2E1MC 4XMYA 3PNTA 2ZJQF 3R4KA 1V55H 3P5JA 4IRIA 1TNTA 2M2EA 1D8KA 4RB1A 3JRDA 2HFHA 2RREA 3BTLA 1GDTA 1I50J 3K69A 3IRRA 2P5LC 4XLFA 1PUFB 1B9NA 2IA2A 5JFRA 1LJ9A 1OJLA 2MC3A 4CHUA 4UUSA 2HXOA 3P9IA 3CO6C 3OYKA 1KQ8A 1G2HA 1SVOA 4EATA 3GFIA 3CC2I 1ZGWA 1FP1D 4M72A 2TCTA 3GTOJ 1WH5A 3IL2A 4PFOA 3SJMA 2CW8A 3MKZA 3E3VA 3FHNA 2QQ8A 2LK2A 1ODDA 2MC4A 3BTIA 2XIGA 3GEZA 1LEAA 5HDNA 4WX9A 1GLNA 2ECBA 4P9UA 2R5ZA 2DT7B 2ZFWA 2EQRA 3I71A 2HXIA 1ZELA 3LQRA 3CQZJ 3I54A 3NQOA 3QRFF 3T1BA 4LG0B 4AC0A 2VJ4A 1VQMI 1ZGAA 3PSFA 4Z2YA 1U9NA 1KQ9A 3HSRA 3MZYA 3JAMK 2D1VA 1D8JA 4EVIA 2Y75A 3SFZA 2CUEA 2G9WA 4FE4A 4DW6A 4HSTA 3OL3A 3WU2C 4XLHA 2FXAA 3OMYA 2HZDA 3P9KA 2MD5A 3CDLA 2OPTA 6PAXA 3ZN1A 1O7LA 3ERED 2FMLA 2VBZA 1R1VA 3TO9A 2LYCA 2GLOA 3M1CA 2EV5A 2GIZA 4RAFA 1SFXA 4XRMA 2BY0A 1W7PD 3J81K 2MLGA 2R92J 1AU7A 1WJ5A 3DQVC 4ENJA 2XAUA 1IN4A 1UJ8A 1XCBA 1OCCH 1RESA 3ZGKA 4CCKA 1BR4A 1VQ6I 4B8XA 3KE2A 4BQNA 4S05A 2DOAA 5B1BH 3ASOH 3F8MA 3JRGA 1QQIA 2MW8A 1LKXA 4LK0F 1PJRA 3H36A 1FLIA 1R22A 4M73A 1QZYA 1HLVA 2E2IJ 3QYFA 1JT6A 1KA8A 5E1ZB 1GV5A 1IW7F 3GCMA 1D5VA 1ZG5A 2IRFG 2E1OA 1R1TA 4BHBA 4FHTA 2ZMEA 3FXMA 2XB0X 1LVAA 4F92B 2JA6J 2IW5A 2UXXA 1SFEA 2R5YA 2P5VA 2MLKA 2HYGD 2XGXA 3V8KA 1YRNB 3H5NA 2QLZA 1XGSA 2KJBA 3FKIJ 4N9HA 5DM7F 4E7KA 1N77A 4A6EA 1VQ5I 3J7ZI 1TWGJ 3BTCA 4DQ2A 1YS7A 1WJEA 1FMVA 1HBXG 1VQ9I 4KJZA 4XKWA 1TT0A 2QEXI 3RCOA 4HZFA 3BG5A 1WI3A 4PK4A 4DGWB 1WJBA 4Y13A 5LEJA 4IO9F 2O61A 4EJWA 4XN0A 1HQCA 2LY9A 4FTHA 3NAUA 2EFOA 2H1LA 4KIBA 2M4KA 3HJEA 5J47A 5FGMA 1B1BA 3BJ6A 1WJFA 2LNBA 2X6OA 2NRAC 3I5UA 3JSOA 1JTYA 2M0CA 3P7NA 5J8CA 1LE8A 2F6CA 2CW7A 3MKYB 5B1AH 4MIMA 4II3A 5A2QZ 4UV8A 4RM3A 2BXYA 2ZXIA 3FXOA 1W4MA 2P7VB 2VQLA 2A5YB 4FETA 2W4SA 5GPAA 3PJRA 3K4BA 3SYTA 1H0MA 4RB3C 1TWAJ 1FJLA 2HOEA 3RI4A 5D5XB 2KP6A 1RNLA 3PQJA 1FSHA 2QBYA 4C3HJ 2M45A 2DA7A 5KHDA 2DTRA 3VEPA 3WE3A 1W36C 3CMMA 5J40A 2IT0A 1YX3A 4V19K 4NHJA 1S3JA 2CQKA 2XKOA 3F22A 2OU2A 5ILSA 4E7SA 2DAOA 3PO2J 3C3WA 2PJRA 4L0ZB 2HQNA 2K9MA 3U21A 3K4KA 3EYIA 4HX4A 2A61A 3H3UA 1QNTA 1T2KA 5IYDJ 3CLQA 3RKYA 4AUXA 1MMGA 2Z33A 3S17J 5BPIA 5LLQA 5F1JA 2YX4A 2O6GE 3QQAA 1ZG3A 5E8GA 3LL7A 3O8GA 5HNFA 3ZPLA 1RZ4A 2UWMA 5BS6A 4LLLA 2L54A 5E17F 3LNQA 1HSTA 1H88C 3GTPJ 1NHAA 2V4JC 5CVIA 2QWWA 3PNYA 4LB6B 1FSEA 3FXJA 3TW6A 1Y8RB 3AG2H 4M3FA 1V5FA 1MMDA 3S1NJ 4EGZA 1QRYA 1GHCA 1DQUA 4LG0A 3JTGA 1XC5A 3MN2A 3KLOA 5FRMA 4A2UA 3L2QA 4C2TA 4G6DA 4JYKA 2LBFB 3DF8A 1KU3A 2Z16A 2HEOA 3CJRB 3EDPA 4L18B 5BPDA 5M3MJ 3FXLA 3JRBA 4PJ0C 2A05A 2DFFA 4M3EA 4QIWN 3WU1B 4KISA 1XSDA 2K9NA 3ZP5A 1TBXA 5HLTA 1OPCA 5JVGF 1ETYA 3WE2A 1IZ1A 4Y52J 1DGWY 4W97A 4XK4A 1Y1VJ 2KRCA 3C1DA 5EJCA 4FASD 2LKSA 3E5UA 2EZLA 4J19A 4V2FA 4XONA 3KLNA 1R49A 2NAZA 2OAZA 3BTJA 1B4AA 4M3GA 2L0KA 3CMYA 2L9NA 1OYIA 2W82A 3D0SA 3CDHA 2MBFA 1UAAA 3PSIA 2E1NA 2G0EA 2XROA 2B9SA 2EJRA 2ZFUA 3GFJA 3HKZA 3ZQGA 1JJ8C 1XX5A 2W24A 3K2AA 1KU9A 3LMMA 2NVUB 1HCRA 5LGUA 2VBYA 4Y7NJ 2CUFA 2Y69H 1FTZA 4HQEA 1NTCA 2QGUA 3ECHA 4B44A 2V6EA 2P4WA 4KT5C 2Y30A 4PJLA 3OYDA 2DOFA 4O6JA 2L5QA 3CCEI 3OSGA 3LFKA 4WXDA 2CFOA 3OYJA 2EPFA 2FRHA 3HYIA 2DYRH 4G94A 4LIVA 3ZQHA 3OS1A 4IHSA 1HDPA 3AG4H 4LD5A 3OS2A 3WTYC 3ZQQA 2X6XA 3FXUA 1O3RA 2AXLA 2HDWA 4RA2A 3U1KA 3F8NA 2HOAA 4JX6A 3I4NJ 5DS9A 3ZXSA 3NEUA 2P7CB 1AKHB 4IQ4A 1YX5A 2PQ8A 2FJ1A 1AWCA 3S2HJ 3ISPA 5JLWA 4J00A 2W25A 5JHFA 5HNHA 4B47A 3K4CA 2MH9A 3L09A 5GAEJ 3OYIA 1FTTA 3H0GJ 2J5PA 1YI2I 2X6WA 1BJZA 2VODA 1XS9A 1PYVA 3WODF 4GFBA 3K1PA 2MABA 5E8IA 1J2XA 3I3LA 2HOSA 3LAPA 3QU6A 5KAFC 3L1PA 1HSJA 3FMRA 2BY3A 2IAIA 2RDPA 2OD5A 5FKLA 4CUGA 3T5XA 2VONA 5DYMA 2FNAA 2A07F 4IHTA 3GWZA 1PUFA 4XLNF 3KEOA 2VASA 2JVHA 4YIIA 4WK8F 3MD2A 1TT5B 4NBQA 4BHPA 4IHYA 2KZVA 2QVOA 4OU0A 1WVRA 2KPMA 4B1RA 4M71A 3OYGA 2H27A 2K9LA 3TOAA 1A04A 1BI0A 1X3UA 2BYVE 2OBPA 1OCOH 2K4BA 2LVSA 1FP2A 4MO7A 3OR2C 4XICA 1SMTA 1T98A 3CJNA 3QYEA 1ON1A 5KNLA 2DTZA 5H20A 3K1NA 4WXCA 4ZTFA 1G59A 2XSJC 1E17A 1HXDA 5GTIC 3SQNA 3RKWA 3HG9A 1FMWA 3BLYA 4HOBA 2KDOA 3TDZC 4U7DA 3SXYA 4JOMA 3M3YJ 2R7DA 2GA1A 2LG4A 3RYPA 1KYZA 2L7KA 1QU3A 4A3BJ 1MJAA 2JWTA 2YS9A 1WI9A 5D5VB 3QPLA 3E5QA 4XLEA 1WRJA 4BJ5C 2E19A 1RRJA 2E35A 3IWZA 2DCEA 3WGHA 4UY8I 2FOKA 4E70A 1FYKA 4OIPF 4ZDOA 4RMNA 1ENHA 3F3XA 1Z05A 1WCMJ 2JT1A 2JVGA 3CCRI 5BQTA 3AL0B 4JBAA 3HOUJ 4EJUA 1HC8A 1SFKA 2FX0A 3ECOA 3ZQLA 3RPUD 1X1PA 2OTJI 3TBIA 4RGUA 1A36A 5DCMB 4BYYA 1YO5C 1WPKA 4LITA 2BV6A 3BG9A 3CCVI 1XSVA 3JW4A 1G4DA 5J4YA 2X6YA 4PCQA 4Y3OA 4UNOA 1Y0NA 2E36A 4BXFA 2A6HF 3F8FA 2LD5A 2CQ7A 1R36A 2CUJA 4R1HA 2XSDC 5K7FA 4G12A 2Z9OA 1WSUA 4NQWB 2R7RA 3PIOF 3NRVA 3GTJJ 2DO7A 3L9FA 2DA4A 1F5TA 1BI3A 2RN7A 4YEJA 5LEKA 3J7AY 3ASNH 3DKWA 2AHQA 1RR7A 2OF7A 3G1MA 2QZ8A 5CQGA 2GXGA 3ZQCA 2LLKA 4KA4A 4HPQA 5D6FA 1WJCA 4ON0A 4OIRF 2GOMA 1X3WB 2P0WA 2LRDA 3ML6A 3S93A 1U5TC 4IPAA 1K83J 3DPLC 5CYVA 2DFHA 3H9GA 3UNGC 1R58A 1T95A 5DM6F 3JREA 4PJJA 2XC7A 1Y8QB 1JUMA 4OWRB 2Y9YA 2V9KA 1LDJA 3KP2A 2KIFA 4Y4RA 3S3OA 3FHZA 1YTYA 1P4WA 2R7ZJ 5M5YJ 2GBYA 4YIRX 1T0FC 1YITI 3T0YA 3M4OJ 3M9AA 2H6BA 1UELB 2JUGA 3E0JB 3DTIA 1M1EB 3LOCA 4LLNA 2HU9A 1W5SA 2F5EA 3CDIA 2QM3A 1EV7A 2JPCA 3C2BA 3JRFA 4BXUA 1U6GA 1J7KA 3A03A 3T8RA 1X58A 4EQQA 3G4SI 2DN0A 2G7UA 4IRGA 2EA2A 1ZRDA 2EV0A 4M6XA 3GFMA 2UUZA 3V42A 4WCGA 1IC8A 1XG1A 1KYWA 1BJAA 3CC4I 2YR2A 2CWEA 2ZJ2A 4WF2A 1L0OC 3KIOA 1XN7A 3E6CC 2E1CA 1YQAA 2ME6A 1X1AA 3CUQC 1MJ9A 1U5TA 1KU2A 1SANA 3I4PA 1I5ZA 2DK8A 4HX8A 2DXIA 1RC9A 2VPRA 1U2WA 4XLCA 4C30A 3K2ZA 2O8XA 4JK1X 4E7ZA 4ENNA 2LKXA 1OR7A 2CQNA 2F2EA 1JHHA 4PFPA 3BG7A 1STZA 1NG7A 2FMYA 3DWLE 5DV5A 1Z6TA 4YELA 4S0HB 1I3AA 4UHTA 2FQ4A 5FD5A 2H6CA 1YHQI 4D7NA 1IO2A 1LFBA 2KHMA 4V2GA 1WH7A 3BR0A 1LFUP 3H3ZA 5JVTA 3JRAA 2X85A 3CCSI 1IV6A 2BBYA 3L2WA 1V4RA 2ZC2A 4M6YA 4RAGA 1DUXC 5F6FA 3LSKA 3F8BA 1ZR2A 4F7ZA 1Q1VA 4H4KC 4WXHA 2OQRA 5DUIA 4MTEA 4A5NA 1ZK8A 3BCAA 3EYYA 2XPUA 4ITVA 2EIJH 1TWCJ 1FOKA 2G7HA 2EV6A 1JT0A 4PGGA 2WC2A 5F0FA 4AYBA 5CLSA 1XGMA 3KCCA 3J80K 2VBWA 4XRFA 4U87A 5BOXA 3K10A 5IYBJ 4XRSA 3HOWJ 1MBJA 3PNVA 4ZTJA 4BE0A 4A3KJ 2FU4A 5FKMA 3BZCA 2IS4A 1LPQA 2FEZA 5FLVA 2DMQA 4AWXB 1QO0D 3I59B 5FFZA 1SMYF 4C3JJ 5K5QA 3G1OA 2NVQJ 1VFCA 1NK3P 2XVCA 3HRMA 2MGQA 2F48A 5CVRA 5DTDA 3QYBA 3WTSC 2QYOA 2E60A 3V8JA 4ESFA 1YJNI 4PSWA 2STTA 1Z7UA 2VJJA 5EZHA 1J59A 3ZRGA 3QP6A 2JK3A 2DW4A 2EZHA 3FXQA 4LK1F 4HV5A 1FYMA 5HLHA 2EK5A 2DA6A 2E5NA 4R79A 4AIKA 2MA3A 2PMZA 3KP5A 5H6QA 1VQ4I 3BWGA 3HSEA 4KT6A 3WU0A 4E4HA 5HS8A 4HW0A 3LSJA 2M8EA 5C3EJ 1W0TA 3O2PE 4BJTA 4HYEA 4Y33A 1BA5A 2P6SA 5F08A 5IP9J 4N4OB 1SD5A 2ELKA 4DJAA 1H9GA 2CV1A 3BJAA 5HODA 2E7XA 3A0BC 4IL6C 3GTMJ 1JJ6C 2IJLA 4QWQA 4X1EA 2RKHA 3SZGA 2OC6A 5EGOA 3LA3A 3WHBA 2Y0MA 2YPRA 1RUOA 3TQNA 1ON2A 3VODA 1IAWA 3RQ4A 5B5EC 2PJRB 3DBHB 4FT8A 4AYBN 1W36D 1XDSA 1CGPA 2ICWG 4HNUA 5K7HA 2M3AA 2R7OA 3OYBA 3DPUA 5F1RA 3F0CA 2XGEA 2XKPA 3MMYB 2QBYB 2Y0SN 1S6LA 3I58A 2DPDA 4A12A 3TDUC 5E3LA 1X3ZB 1O57A 1U8RA 2LTPA 3EUAA 2EILH 1H9TA 2K02A 4CYCB 3ESWB 5GTHC 3BPVA 3CO7C 1Y56A 3ERMA 2CU7A 1MKMA 2P8TA 1QA6A 2NS0A 1FT9A 3AKZA 1LNWA 1XGOA 4D1QA 4M3DA 2V1NA 1ZYRF 2VJIA 1ETXA 1OKRA 4NQWA 3TL4X 2ID6A 3F9KA 4I0AA 5IP6A 4UXNA 3I53A 3VPRA 4HLYA 2Y0SA 1W7PB 2IGOA 1G3SA 2WBMA 4LB5A 4LFUA 4A93J 3BR2A 1SD4A 4BXXJ 3OWTA 2QSGX 1CF7B 4PSXA 1UMQA 3QPSA 3LA7A 1XSXA 2FA5A 3W2AA 1MDMA 3S14J 1YE9A 2Y31A 3L00A 1NG6A 1LB2A 2IGNA 1TNSA 3RZOJ 3HTUA 2BW3A 1BW6A 1RIOH 4HSRA 3I55I 4OMYA 1HKTA 1JUSA 1P92A 2ESNA 4BEHB 1P7IA 4EM0B 1GVJA 2ZKZA 2ZNZA 2K85A 5LFAA 3OYLA 5EDNA 3IV5A 5IY5H 1MSEC 4Q48A 2DPUA 2ZNYA 1YJ9I 5J1UA 3G73A 1K79A 2CRGA 2OZUA 2VBXA 2HYFA 4BDZA 5LBQA 3J80Z 4A3JJ 3ZQ7A 3KYCB 1YIJI 2IGKA 1LVKA 2HWVA 1J9IA 3SDGA 4L9JA 1G3TA 5FFXA 4CXFA 4AIJA 2OV7A 3UKGA 2VLAA 5J3LA 5K5RA 2V1UA 3RYRA 1SC7A 2DT5A 3HGGA 1F43A 2E5ZA 3TO7A 3GZ6A 1B8IB 1MGTA 2BW3B 4MQVA 4XIDA 3TEDA 2LFBA 4CO8A 5M3FJ 2DLLA 1UG0A 4IOAF 1BC8C 1NK2P 2RNGA 3JRCA 3KEYA 2JA8J 2NVYJ 2ZJRF 2L02A 3P9CA 1IRGA 5A2QK 5BMZA 2M1BA 4KMUX 4BQAA 3W6JB 4B3AA 4CGZA 3GLLA 4F52A 2K5CA 4O3MA 3VSKA 1SEUA 2VI6A 2DU9A 3S2WA 1HKQA 4L5JA 5IPAA 2WAEA 3QU3A 2OTLI 1V54H 3FM3A 5GP9A 1VQPI 2COMA 2F4MB 4C2MJ 4KMFA 4DYCA 2XAHA 2JMWA 1BL0A 3BR3A 1SFUA 1D3YA 1EF4A 2O8KA 2L9VA 3VYSB 2ISYA 4IF4A 4KIGA 5CJ9A 4W1UA 5D6EA 4BE1A 3EUHA 3KPHA 2K9SA 3R0JA 2F5DA 2COBA 5FO5A 1B72A 4ZDPA 2WB1N 4KIFA 2Q2EB 2LY1A 1USTA 2B0LA 2CH0A 3DFGA 3S32A 1JGGA 3VYUB 4ENKA 4M74A 2AQFA 2X51A 2X1EA 2E34A 3RZDJ 2X4HA 5LHIA 3D5LA 1QPIA 2QSHX 3CESA 4IVNA 1O3QA 2EWNA 1IF1A 5EEHA 1Z3XA 4CZZA 1I1GA 2L7MP 5E20A 1MW7A 5TISC 2FOWA 3KYDB 4ZC3A 3ZQIA 4KITB 2BXZA 2DK5A 3QOPA 1NH3A 1DU0A 2XUBA 3KEQA 3FBIB 2M7BA 5ERIA 3IHUA 4BUPA 1TW3A 5ED4A 3CP2A 3L2RA 4M6VA 2HKXA 3QWLA 4I98B 1IXCA 3CCMI 4C9YA 3FMSA 3G71I 2YSRA 4XRSG 1A35A 3RKXA 1E3HA 5ICCA 3HOYJ 1C0WA 3H35A 1HKSA 1DDNA 1DPUA 3H9JA 1HW5A 3IRQA 3RKQA 4ZYEA 2EZKA 1MH4A 3H1CA 1OLTA 1A6QA 3Q9SA 1T8IA 1KGSA 1MBHA 1V3FA 2LY2A 5CQEA 2PMUA 4QPQA 3KP6A 3I4MJ 1R5ID 2JPBA 2XASA 4DZJA 1ZQ3P 1XB4A 3AFHA 2JN6A 4Y15A 3ABUA 1POGA 3ABTA 2K40A 1E3OC 4GYGA 1S7OA 2FQ3A 2KT0A 1X1DA 1RR8C 1QHHD 2R7FA 3MVPA 1FY7A 3WTTC 2PMZN 3MKLA 2R5ZB 4N4NB 2HQAA 4DNCA 4UV9A 3J7YJ 2E2JJ 2JRTA 1BM9A 3F72A 1I6HJ 1RKTA 2LBFA 5ILVA 1TQPA 2FBHA 4IZZA 2LF8A 2VXDA 3GXOA 5KCMA 3RTRA 4MQ9F 2V7FA 3KZZA 4KDPA 5DD4A 5AONA 2HS5A 2FBIA 2DODA 2XF7A 4EEFG 2VUMJ 3J7AO 4B48A 4U88A 3HRTA 4ANJA 1BR1A 2A6TA 1MSFC 1Q1HA 3I56I 3OYNA 3DTKA 2LREA 4I02A 3TKYA 2W85A 4A0YA 4MFEA 3VYRB 3GTKJ 1F36A 1K61A 2VL8A 4PDKA 2VOPA 3C18A 4F93B 1VQOI 3FF5A 5IP7J 4RBOA 3GMEA 4HA8A 2XF5A 5FKNA 5D5WB 4HDUA 4JQFA 1ZGJA 4HV6A 2CW0F 2XDVA 2H8WA 1B72B 5CVUA 4HLXA 3S3NA 2D1HA 3ZMDA 2TDXA 1MH3A 4D0PA 4XOTA 4XN3A 1DP3A 3R61A 3WTWC 5EF6A 1J09A 3K1MA 1OCZH 2WB1A 3CCYA 3M7GA 3SZPA 4BAYA 2GZWA 1W1WE 2AXTC 2IS1A 3DU6A 3SFIA 4EMSA 5LD2C 3CD6I 3RPUA 4QLCU 2V9PA 3ABKH 2HOTA 3VSLA 4Q5SF 1RPWA 4G8XA 4XKCA 5EEGA 2Q0OA 1G8XA 4B43A 4YFXF 3G6EI 2WADA 2TRTA 4UVCA 3DEEA 3FXKA 1LFPA 3LSIA 5M5XJ 1Z67A 4H0EA 1K4SA 3HPHA 3DTEA 3EETA 1JKPC 5D8LB 3KX2A 2YU9J 3CF2A 4BDYA 1YW7A 4BNCA 1XTAA 2V6CA 2JUCA 3CMEI 2ZSHB 2ZMEC 4CA0A 4GDFA 3WG7H 4Z6YA 3W6KB 3HOXJ 3SEQA 3DXJF 1CQTA 3LQQA 4I09A 3LA2A 1FOYA 4D5CA 1IRFA 4M9XA 1YLFA 3NWSA 2W57A 2CS3A 2M7AA 1BOBA 1TQIA 3V8LA 1ETQA 2WWYA 1JKRC 2UXNA 5EYRA 1YW9A 4MGRA 1K78A 3M8EA 2PLYA 2BEOA 5F0CA 3HBLA 5GADJ 3PFIA 2JQ7A 2X48A 1MMAA 3CUQA 1FPQA 1QBJA 2QQAA 3KZYA 1YJWI 1IXRC 2DDAA 4CCOA 5IT9Z 2DJIA 4D7MA 1Z77A 2E2HJ 2OJED 2V9VA 4GO1A 3OSFA 4A3CJ 5DCFA 1I6XA 3MQ0A 1IXSB 3CMAI 1ONVA 5C44J 1OR7C 3LSGA 4DOZA 3WTVC 1TC3C 4I99C 2W00A 3IH4A 4BQQA 1TLHB 3O8HA 1WGXA 2ZO4A 3OR1C 4HX7A 2ELJA 5D4SA 3JR9A 4IHVA 4OIOF 3OYFA 2L9RA 5E3OA 1QGPA 2K7LA 1N78A 2HYJA 1RI7A 3ZMSA 2V79A 2R7XA 2RQQA 2E1MB 4E7LA 4WWCA 2WY7Q 4KN7X 4XBFA 2GXBA 3BR1A 4HNTA 2ETHA 2A5WA 2EBIA 3CTAA 2VPLA 3LWFA 1K78B 2HDCA 3ONQA 2ME0A 4XKBA 1YG2A 3DEWA 4GXOA 3C2GA 3GZNB 1S9HA 1UB9A 3BJOA 1GXPA 3WTUC 2CQXA 1AA7A 5E79C 1XMAA 2L7ZA 2E7WA 2F4OB 2DA2A 2IGMA 4OMZA 1IRZA 2ZXHA 2Q8KA 5LRSA 1X1BA 2A6EF 1HW1A 1JGSA 1YYVA 1P4XA 2K86A 4IQJA 2ZBKA 1D0YA 1BOAA 4ETSA 2DI3A 2KRFA 2CYYA 2PMHA 4CCJA 2OUMA 4ZZDA 1MDMB 2DMTA 2Q1ZB 1JXSA 3FK6A 2OA4A 3DV8A 5J8FA 4XSZF 2Z1DA 5DCMA 1V5EA 1DGRM 2X1DA 4ZDLA 4B4CA 3HOZJ 1R1UA 3MKWB 4A5MA 4EJOA 4ESJA 1OYYA 2O0YA 5DEQA 3HOVJ 5LGTA 5JHUA 1MNDA 4CCMA 2H94A 2RV8A 1E3PA 1V5GA 3WHCA 4OAYA 4L9TA 2DBBA 2GA2A 1IJWC 3S2DJ 4UUSB 1X4OA 1D5YA 2E71A 2QKMB 5B3SH 1FYLA 1U9OA 2DJNA 2EFPA 3ZCOA 4CICA 2XRLA 3CCJI 3A0HC 3W6VA 3BOQA 2M30A 1YW8A 2K4JA 3HIFA 2CFXA 1VI0A 4Q47A 4ZYGA 1QVTA 3W2WA 2EA4A 4A0ZA 1HDDC 3U2RA 1Z91A 2P5KA 4FCYA 1Y1WJ 1G6NA 2IEKA 2WY8Q 1E0EA 2Z2SB 3ULQB 1MNMC 5D8KB 3KETA 2JZYA 3RPQA 3I64A 3OOPA 1ZRCA 2ADUA 4R8HA 2M0MA 3CJQB 4TV7A 1OCPA 1B59A 1SD6A 2QCOA 1FBSA 3LSRA 2KKOA 2Q2EA 2L2OA 2VKDA 2R93J 1AOYA 3AL0C 4AIHA 3A1YA 2ECCA 1I3QJ 2EFQA 3TP3A 1MBEA 3K4MA 2GWRA 1BN5A 3F23A 4RGXA 1MZBA 4EJTA 2GOXB 3VYTB 3GO5A 5HVQC 2V26A 3GF2A 2XAJA 4P5OA 3IKTA 2VIXA 4M9SA 5AIPA 2DDBA 5B66C 2VOOA 3MWMA 5CPRB 3ABMH 2ZXJA 5IT3A 3PM1A 3A01B 2KMUA 3BZ6A 4XORA 2PEXA 1P4AA 3PQKA 1USSA 3BZKA 4DIQA 1SAXA 2ELHA 4RDUA 3CJTB 3BG6A 2DOEA 1IUFA 4D9JA 2ZMEB 5GAGJ 3SHFA 1WJAA 3PFYA 3N97A 3X2QH 2H1KA 4OINF 1S72I 2DQRA 1UHSA 4I76A 3ZN0A 3CUOA 5TRDA 2O9LA 2PFBA 2W1OA 3LSTA 2O5RA 1S5LC 2DMUA 4IRHA 4A3FJ 2YU3A 2NOGA 3TW7A 1WHUA 5HLIA 2VE9A 2UV1A 1ZR4A 1TWHJ 2AO9A 4A0XA 2CQQA 3PUBA 1SAUA 3H3VK 4E7HA 4LJZF 1MIJA 1A6IA 2A3SA 1ZLKA 2ZB9A 3DEUA 1XGNA 2D5VA 3QPHA 4XL9A 4YG2F 1VZ0A 2W7NA 3S1QJ 2KIUA 3UR3C 1FBQA 3HRUA 4ZYAA 1T38A 1FIAA 3FZVA 1QZEA 4CZCA 1BI1A 1P2FA 4RLQA 2DFIA 4XNFA 3REOA 3L2VA 4UB8C 3DCFA 1FIPA 4PUSA 4MEYF 4NC6A 4YFNF 3DBRB 1BBYA 3MZ8A 4F55A 1D1CA 3IWFA 5E1WA 2R7VA 1FEXA 2LKPA 2QSFX 1TTYA 2BHYA 4NNJA 1LEBA 5HDGA 1Z7LA 1YS6A 2LDUA 1W5TA 4A3EJ 2N8GA 4G9YA 3E7LA 2L7FP 2NVXJ 2RGVA 3DU5A 5GAHJ 3E97A 2HKOA 1ZHFA 1IDZA 2CGPA 1WFXA 4P55A 5F64A 2IS2A 1VNDA 4KN4X 3CCUI 3W3CA 4O5VA 1U5TB 4FE7A 1IN6A 4II2A 5HLGA 2HVSA 3ROUA 5CKTA 5DUKA 3GX4X 5HS9A 2BE5F 4CCLA 2VE8A 4HEA2 3B6CA 5J1RA 4E7JA 2KDZA 4BQOA 4CSWA 4GRIA 3LFUA 3OS0A 3VFZA 2XF6A 4A6DA 1U8BA 1A31A 2JA7J 2WTEA 3I9V2 1VQLI 3H9QA 3ABLH 4A3GJ 4AU7A 4LLGF 2A69F 3DBLB 4UUTA 3GVAA 1QZZA 4D5FA 3OYMA 3Q0WA 3S1RJ 2C6YA 5E18F 1R6RA 2CMPA 2D2WA 1R9TJ 3K4NA 4L5EA 4L0YB 2XAGA 2K3PA 2QF7A 2UZKA 1Y0UA 3IP4B 5FROA 2NNNA 4HF0A 2VT3A 1ZG1A 2XAQA 1YIOA 2IPQX 4ZYHA 2MFZA 2HPMA 1GUUA 1X4PA 4M9ZA 2HQ5A 3N4MA 1B6AA 3EPZA 4MFDA 3HHHA 2IA1A 3Q0UA 2WA0A 3QPTA 5M5WJ 4ZH4F 4BHCA 2HI3A 4KNYA 3VWBA 1Z3YA 3BC8A 3K70C 3FIWA 3DKYA 2R5YB 5HOOA 5LRRA 3B73A 1KONA 1APLC 4NDLA 3CCLI 2EZIA 3GYHX 3H5AA 4LOCA 4U0VA 5D5UB 4L5IA 1HOMA 1TZLA 2Z3YA 3R0AA 1D0ZA 3K4LA 4RAYA 3GTGJ 5J4VA 1MD0A 2HVQA 2NXNB 1DPRA 3A4CA 3LAJA 5TGTA 4GYIA 2HZTA 2GM4A 2MH2A 4I7HA 4IJAA 1Z1DA 5EG0B 2GXAA 2FNPA 3DKXA 4U0WA 3H92A 2M5WA 1EH6A 1RKWA 3Q9VA 2HQRA 5FLXZ 2QQ9A 3F6VA 2DA1A 3WTZA 4U7BA 5TJJA 3EUKL 5GPCA 1VQNI 1MBGA 1N25A 3BR6A 3JTHA 3TOBA 3CC7I 2GQQA 2KL4A 5L3CA 1ZREA 1XDUA 3G1LA 5FKOA 5ICGA 1UHMA 3IC7A 3S8PA 2STWA 4KFCA 1AHDP 3WTXC 3QODA 1N75A 2Y9ZA 1O4XA 2EFNA 2HR3A 2EB7A 2XPVA 1O7FA 4QTRA 1CF7A 1KZHA 1K4TA 3IAS2 5E1XA 4BY7J 4GCVA 3N05A 3E6BA 4FISA 4XQFA 2VKVA 2F4IA 2GAUA 2ZXWH 3QAHA 2JSCA 3Q5FA 1ETVA 1H8AC 1TWFJ 4K2EA 5CVJA 5DD8A 3BDDA 1P9QC 2DT6A 1R71A 2DQLA 1K7AA 1FBUA 1UG2A 3GW2A 3HHGA 4HBLA 4E6KG 2M87A 4G6TB 2MYSA 4OAZA 3PUFA 2LP0A 1Z0XA 2PBIA 4MLOA 3ZQFA 4XLPF 2FBKA 2OCCH 1T6SA 5IYCJ 4IEJA 2VJ5A 3KP7A 3QP5A 2KLOA 1GXQA 4KYWA 1XPXA 1W0UA 1I39A 3V7CA 1UHWA 3OIOA 2XRNA 3FMQA 2CSOA 2KISA 4HAMA 4BEHA 2XPWA 3L2UA 2PI0A 3M1EA 2XB5A 3K0LA 2DA3A 4P9FA 2FSWA 1R5HA 2L4MA 4MEXF 4A69C 1PUEE 3V4GA 3MZHA 3ELKA 3SZTA 1D0XA 2FE3A 3OIPA 1WQ2A 1JI8A 4L9NA 1ZRFA 1OISA 3E6MA 4I2OA 5AIQA 3GUDA 2R4GA 3A2KA 4LGWA 1GVDA 3BPXA 3WG9A 1PP8F 2K9QA 3G2BA 3GFLA 2CUZA 4F91B 4X6AJ 3B02A 3D5SC 1JTXA 1F4KA 2RAEA 4QPOA 2IVMA 4G7HF 1KU7A 2R3SA 5ILUA 3Q3SA 1HW2A 3G3ZA 1IDYA 2VQCA 3M8FA 2BY2A 1R23A 4DZPA 2ACJA 4A3LJ 1BR2A 2H8RA 3FX3A 5EG0A 1IGNA 1PDNC 1R00A 1XCVA 2BHZA 1I1SA 4QSHA 1EKEA 2QENA 4DBQA 1W5CC 1JKOC 5KK1A 5E3NA 3VOEA 5IOZA 4G6QA 3GTQJ 1R4NB 3JAMZ 2R7WA 3OIQA 2YX7A 1VQ7I 2MSYA 1TQMA 4PZJA 1EH7A 3NWTA 2OZ6A 2F5FA 2IA0A 2W48A 4B09A 2QUFA 2VXZA 4OOIA 3O6BB 2R7UA 1IN8A 4AIDA 1TL8A 4C3IJ 4XLAA 3TP0A 1O3TA 3BR5A 4C2UA 5L3FA 3SEZA 2M34A 1XD7A 2ZJPF 3WGGA 5ICFA 4XM3A 1LDDA 2I10A 3T8TA 1FNNA 3CUQB 4MTDA 5FB2A 2FF4A 3HZJA 2FUG2 5CVVA 4IHXA 1ETWA 4AVPA 3O3KA 1BC7C 2NYXA 3FDYA 2HVRA 4HF1A 1R4MB 1IV8A 1FOWA 3HKZN 1Z21A 4UB6C 3H0DA 3CLOA 5IOYA 3Q0VA 4LIUA 3RSNA 2LMDA 1SD7A 1X2MA 3A01A 3MFKA 1TP4A 1BIBA 4NB5A 5L3DA 5HS7A 1RUNA 1IRXA 2BGCA 4KICA 1MNEA
chains in the Genus database with same CATH topology
4I01A 1IN7A 2L01A 3F6OA 4BH9A 3RJPA 1J0RA 3MCZA 3VB2A 4YFKF 1T0FA 1IUYA 3IKVA 3L2CA 3KFWX 3MAJA 4G7ZF 3F21A 3ZMUA 3I0TA 4FX0A 2J5OA 4ASNA 5LHGA 5JR3A 5ICEA 4MHGA 3HRSA 5FD6A 3TGNA 2Z99A 2ISZA 1P6RA 2V1DA 4P96A 1UCRA 2VC0A 4ZYDA 3BROA 1TW2A 3I59A 3COAC 3FM5A 1G3YA 4PGHA 4RB0A 2P6TA 1Z9CA 3HUGA 4S04A 2LF7A 3L7WA 1J5YA 1R5GA 4N0BA 4AD9A 2ESHA 3FXRA 1LQ1A 1I27A 2XAFA 2ZCWA 3MEXA 5JI6A 5K1YA 2A68F 4I0BA 2XV4S 3J81Z 1F1ZA 2CG4A 1OMIA 4G7OF 5L3GA 2PN6A 2VC1A 4UVAA 3KP3A 1BI2A 3U1DA 3RDIA 2L4AA 3U9GA 4EM2A 4Y17A 5DDGA 3GLXA 5KVRA 2Z5UA 4RB2C 1E2XA 1XMKA 1ZARA 5IT9K 2VT2A 2O3FA 1BIAA 5D4RA 3C7JA 2WV0A 2HGCA 1WWXA 4LMYA 3HTSB 2AS5F 1ZLJA 4RGRA 2RQPA 1PP7U 4N9IA 4HDVA 3FWEA 4Q4ZF 1U78A 3HSFA 1G3WA 1QPMA 3V7SA 4EV0A 5L3EA 1DP7P 2Y48A 3E6DA 3AAFA 3ZMVA 1UFMA 4GGGA 5FLXK 2F5CA 1J75A 3ZMZA 2O03A 3V7RA 4CDGA 3R60A 2CO5A 1ZN2A 2HTJA 3R6SA 1U3EM 3JSPA 4ENMA 2D45A 4CYDA 1S7AA 1EH8A 3HOTA 1JHFA 5HDKA 5L3BA 2HTSA 3E5XA 3HOSA 3BP8A 2L3DA 4YIFA 2RVCA 3DP7A 2OQGA 3TO6A 2PG4A 3EQLF 1S8NA 2K27A 2H09A 4KUMA 2EFWA 4XSXF 3BY6A 2IP2A 3GZ5A 5LHHA 5H6RA 2QQBA 1R7JA 3OV8A 4U0YA 1LDKB 1ZH5A 1VTNC 1KQ0A 4HQMA 1F9NA 1JE8A 4OIQF 1OYWA 3WGIA 1YFHA 1L3LA 4IXAA 3F8CA 2XHKA 2RNJA 2PJPA 2X0LA 2KJCA 2LSOA 1ZAOA 4EM1A 4EGYA 1T39A 1FWZA 4L9VA 2JTVA 1FX7A 2NNYA 1MJBA 1ULYA 1O3SA 3ZMTA 3KP4A 3RIRA 4RAZA 4ZZLA 2GIVA 2RC4A 4RGSA 4EJVA 4FX4A 4MNUA 5LGNA 4HF2A 1IN5A 2W84A 3K9TA 1S29A 4RS8A 5J6XA 1FC3A 2VN2A 1Z6RA 1WKMA 4UUVA 3DPTA 4UVBA 1FZPB 4ESBA 1W7PA 5K5OA 2KIMA 2V1XA 1K6OA 1B9MA 1REPC 3R4KA 4IRIA 1TNTA 1D8KA 4RB1A 2HFHA 3K69A 3IRRA 2P5LC 1B9NA 2IA2A 5JFRA 1LJ9A 4CHUA 2MC3A 3P9IA 3CO6C 1KQ8A 3GFIA 1FP1D 4M72A 3IL2A 3E3VA 1ODDA 2XIGA 3GEZA 1LEAA 5HDNA 4WX9A 4P9UA 2ZFWA 3I71A 3LQRA 3I54A 3NQOA 3QRFF 3T1BA 4LG0B 1ZGAA 4Z2YA 1KQ9A 3HSRA 3MZYA 3JAMK 2D1VA 1D8JA 4EVIA 2Y75A 3SFZA 2G9WA 2FXAA 3P9KA 2MD5A 6PAXA 3ZN1A 1O7LA 3ERED 2FMLA 2VBZA 1R1VA 3TO9A 2EV5A 1SFXA 1W7PD 3J81K 2MLGA 3DQVC 4ENJA 1IN4A 1XCBA 4B8XA 3KE2A 4S05A 3F8MA 1QQIA 4LK0F 1FLIA 1R22A 4M73A 1QZYA 1KA8A 5E1ZB 1D5VA 1IW7F 1ZG5A 2IRFG 1R1TA 4BHBA 4FHTA 2ZMEA 1LVAA 2IW5A 2UXXA 1SFEA 2P5VA 2MLKA 2HYGD 2XGXA 3V8KA 2QLZA 1XGSA 2KJBA 4N9HA 4A6EA 4DQ2A 1YS7A 1HBXG 4HZFA 4Y13A 5LEJA 2O61A 4EJWA 1HQCA 2EFOA 4KIBA 5FGMA 1B1BA 3BJ6A 2LNBA 2NRAC 3I5UA 3JSOA 3P7NA 5J8CA 5A2QZ 4UV8A 1W4MA 2P7VB 2A5YB 1H0MA 4RB3C 2HOEA 3RI4A 5D5XB 1RNLA 3PQJA 1FSHA 2QBYA 2M45A 2DTRA 3VEPA 3WE3A 2IT0A 4NHJA 1S3JA 2CQKA 2XKOA 3F22A 2OU2A 5ILSA 2DAOA 3C3WA 4L0ZB 2HQNA 3EYIA 4HX4A 2A61A 3H3UA 1QNTA 1T2KA 3RKYA 2Z33A 5BPIA 5LLQA 2YX4A 2O6GE 1ZG3A 5E8GA 3ZPLA 1RZ4A 2UWMA 5BS6A 4LLLA 2L54A 5E17F 1HSTA 1NHAA 5CVIA 2QWWA 4LB6B 1FSEA 4EGZA 1GHCA 4LG0A 3JTGA 3KLOA 4A2UA 4G6DA 3DF8A 1KU3A 2HEOA 4L18B 3EDPA 5BPDA 3WU1B 1XSDA 3ZP5A 1TBXA 1OPCA 3WE2A 1IZ1A 3C1DA 3E5UA 3KLNA 2NAZA 2OAZA 1B4AA 1OYIA 3D0SA 3CDHA 2MBFA 2E1NA 2XROA 2EJRA 3GFJA 2W24A 1KU9A 5LGUA 2VBYA 4HQEA 3ECHA 2P4WA 4KT5C 4O6JA 3LFKA 4WXDA 3HYIA 2FRHA 4G94A 4IHSA 4LD5A 3WTYC 3FXUA 1O3RA 2AXLA 3F8NA 3NEUA 2P7CB 2PQ8A 1AWCA 3ISPA 2W25A 2MH9A 3L09A 2J5PA 2VODA 3WODF 3K1PA 5E8IA 1J2XA 3LAPA 3QU6A 1HSJA 3FMRA 2RDPA 2OD5A 3T5XA 2VONA 5DYMA 2FNAA 2A07F 4IHTA 3GWZA 4XLNF 3KEOA 4YIIA 4WK8F 4BHPA 2QVOA 4OU0A 4M71A 2H27A 3TOAA 1A04A 1BI0A 1X3UA 2BYVE 2OBPA 2K4BA 1FP2A 1SMTA 1T98A 3CJNA 1ON1A 5H20A 3K1NA 4WXCA 1E17A 1HXDA 3SQNA 3RKWA 4HOBA 3TDZC 4U7DA 3SXYA 2R7DA 2GA1A 3RYPA 1KYZA 1MJAA 5D5VB 1WI9A 3E5QA 1WRJA 3IWZA 3WGHA 2FOKA 4OIPF 4E70A 1FYKA 3F3XA 1Z05A 2JT1A 5BQTA 4JBAA 4EJUA 3ECOA 4RGUA 5DCMB 4BYYA 1YO5C 2BV6A 1XSVA 3JW4A 1G4DA 4PCQA 4UNOA 2A6HF 3F8FA 1R36A 4R1HA 2Z9OA 1WSUA 3NRVA 2DO7A 3L9FA 1F5TA 1BI3A 2RN7A 5LEKA 3DKWA 2QZ8A 2GXGA 4KA4A 5D6FA 4ON0A 4OIRF 3ML6A 1U5TC 4IPAA 3DPLC 5CYVA 1R58A 1LDJA 3KP2A 2KIFA 1YTYA 3FHZA 1P4WA 3T0YA 3M9AA 2H6BA 4LLNA 1W5SA 2F5EA 2QM3A 1EV7A 2JPCA 4BXUA 1U6GA 1J7KA 3T8RA 4EQQA 2G7UA 4IRGA 2EA2A 1ZRDA 2EV0A 4M6XA 3GFMA 4WCGA 1KYWA 1BJAA 2YR2A 2CWEA 2ZJ2A 4WF2A 1L0OC 1XN7A 3E6CC 2E1CA 1YQAA 3CUQC 1MJ9A 1U5TA 1KU2A 3I4PA 1I5ZA 2DK8A 4HX8A 1U2WA 3K2ZA 2O8XA 4JK1X 4ENNA 1OR7A 2F2EA 1JHHA 1STZA 5DV5A 2FMYA 1Z6TA 4UHTA 5FD5A 2H6CA 3H3ZA 5JVTA 2BBYA 1V4RA 4M6YA 1DUXC 5F6FA 3F8BA 4F7ZA 4WXHA 2OQRA 5DUIA 4MTEA 4A5NA 3EYYA 1FOKA 2G7HA 2EV6A 4PGGA 2WC2A 5CLSA 1XGMA 3KCCA 3J80K 2VBWA 4XRFA 5BOXA 2FU4A 2FEZA 4AWXB 1QO0D 3I59B 5FFZA 1SMYF 5K5QA 2XVCA 3HRMA 5CVRA 3WTSC 2QYOA 4ESFA 3V8JA 2STTA 1Z7UA 1J59A 3QP6A 2DW4A 3FXQA 4LK1F 4HV5A 1FYMA 5HLHA 2EK5A 4R79A 4AIKA 2MA3A 3KP5A 5H6QA 3BWGA 3HSEA 3WU0A 5HS8A 4HW0A 2M8EA 3O2PE 4HYEA 2P6SA 1SD5A 1H9GA 3BJAA 2E7XA 2IJLA 4QWQA 2RKHA 3LA3A 2Y0MA 2YPRA 1RUOA 3TQNA 1ON2A 3VODA 1IAWA 4FT8A 1XDSA 1CGPA 5F1RA 2XKPA 2QBYB 3I58A 1S6LA 2DPDA 4A12A 3TDUC 1U8RA 1O57A 1H9TA 2K02A 3BPVA 3CO7C 1MKMA 2P8TA 2NS0A 1FT9A 1LNWA 1XGOA 1ZYRF 1OKRA 4NQWA 4I0AA 4UXNA 3I53A 4HLYA 1W7PB 1G3SA 4LB5A 4LFUA 1SD4A 1CF7B 3LA7A 1XSXA 2FA5A 1MDMA 3L00A 1LB2A 1TNSA 3HTUA 1RIOH 4OMYA 1HKTA 1P92A 2ESNA 4EM0B 1GVJA 2ZKZA 2ZNZA 4Q48A 2DPUA 2ZNYA 3G73A 1K79A 2OZUA 2VBXA 2HYFA 5LBQA 3J80Z 3ZQ7A 2HWVA 1J9IA 4L9JA 1G3TA 5FFXA 4CXFA 4AIJA 5K5RA 2V1UA 3RYRA 2DT5A 3TO7A 3GZ6A 1MGTA 4MQVA 4CO8A 2DLLA 1BC8C 2L02A 3P9CA 1IRGA 5A2QK 5BMZA 2M1BA 4KMUX 4BQAA 3W6JB 4CGZA 4O3MA 2DU9A 3S2WA 1HKQA 4L5JA 3QU3A 3FM3A 2COMA 4KMFA 2XAHA 1SFUA 1D3YA 2ISYA 4IF4A 4KIGA 5CJ9A 5D6EA 3EUHA 3R0JA 2F5DA 5FO5A 4KIFA 1USTA 2B0LA 3DFGA 4ENKA 4M74A 2X4HA 5LHIA 3D5LA 1O3QA 4IVNA 2EWNA 1IF1A 5EEHA 4CZZA 1I1GA 5E20A 2DK5A 3QOPA 2XUBA 3KEQA 5ERIA 3IHUA 1TW3A 5ED4A 2HKXA 4I98B 1IXCA 3FMSA 2YSRA 3RKXA 5ICCA 1C0WA 1DDNA 1HKSA 1DPUA 1HW5A 3IRQA 4ZYEA 3Q9SA 1KGSA 1V3FA 2PMUA 3KP6A 2JPBA 2XASA 1XB4A 4Y15A 3ABUA 3ABTA 4GYGA 1S7OA 2FQ3A 2R7FA 1FY7A 3WTTC 4DNCA 4UV9A 2JRTA 1BM9A 3F72A 5ILVA 1TQPA 2FBHA 2LF8A 3RTRA 3GXOA 4MQ9F 3KZZA 4KDPA 5DD4A 5AONA 2HS5A 2FBIA 3J7AO 4U88A 3HRTA 1Q1HA 4I02A 3TKYA 2W85A 4A0YA 4PDKA 2VOPA 3C18A 3FF5A 4HA8A 5D5WB 4HDUA 4JQFA 1ZGJA 4HV6A 2CW0F 5CVUA 4HLXA 2D1HA 3ZMDA 2TDXA 4D0PA 3R61A 3WTWC 3K1MA 3M7GA 3SZPA 4BAYA 2GZWA 4EMSA 3RPUA 4QLCU 4Q5SF 4G8XA 5EEGA 2Q0OA 4YFXF 4UVCA 4H0EA 3EETA 5D8LB 1YW7A 4BNCA 2V6CA 3W6KB 3DXJF 3LQQA 4I09A 3LA2A 1IRFA 4M9XA 1YLFA 2W57A 1TQIA 3V8LA 2WWYA 2UXNA 1YW9A 4MGRA 1K78A 3M8EA 2PLYA 2BEOA 3PFIA 3CUQA 1FPQA 1QBJA 2QQAA 3KZYA 1IXRC 5IT9Z 2V9VA 4GO1A 5DCFA 1I6XA 3MQ0A 1IXSB 1ONVA 3WTVC 1TLHB 2ZO4A 4HX7A 5D4SA 4OIOF 1QGPA 2K7LA 1RI7A 3ZMSA 2V79A 4WWCA 4KN7X 4XBFA 2GXBA 2ETHA 3CTAA 3LWFA 1K78B 2HDCA 1YG2A 4GXOA 1UB9A 3BJOA 1GXPA 3WTUC 1XMAA 2E7WA 4OMZA 2Q8KA 5LRSA 2A6EF 1HW1A 1JGSA 1YYVA 1P4XA 2K86A 2ZBKA 1BOAA 4ETSA 2DI3A 2KRFA 2CYYA 2PMHA 1MDMB 4ZZDA 1JXSA 2OA4A 3DV8A 5J8FA 4XSZF 5DCMA 1R1UA 4A5MA 4EJOA 4ESJA 1OYYA 2O0YA 5DEQA 5LGTA 5JHUA 2H94A 2RV8A 4L9TA 2DBBA 2GA2A 1FYLA 2EFPA 4CICA 3BOQA 2M30A 1YW8A 2K4JA 3HIFA 2CFXA 4Q47A 4ZYGA 4A0ZA 2EA4A 3U2RA 1Z91A 2P5KA 1G6NA 3ULQB 5D8KB 3KETA 2JZYA 3RPQA 3I64A 3OOPA 1ZRCA 2ADUA 4R8HA 4TV7A 1B59A 1SD6A 1FBSA 2KKOA 2Q2EA 1AOYA 4AIHA 2EFQA 2GWRA 1BN5A 3F23A 4RGXA 1MZBA 4EJTA 3GO5A 5HVQC 3GF2A 2XAJA 4P5OA 3IKTA 5AIPA 4M9SA 2VOOA 3MWMA 2ZXJA 5IT3A 3BZ6A 2PEXA 1P4AA 3PQKA 1USSA 1SAXA 2ELHA 2ZMEB 3SHFA 3N97A 4OINF 2DQRA 3ZN0A 3CUOA 5TRDA 2PFBA 3LSTA 4IRHA 2YU3A 2VE9A 5HLIA 4A0XA 4LJZF 2A3SA 1ZLKA 3DEUA 1XGNA 3QPHA 4YG2F 2KIUA 1FBQA 3HRUA 1T38A 3FZVA 1BI1A 1P2FA 2DFIA 3REOA 4MEYF 4YFNF 1BBYA 3IWFA 5E1WA 2LKPA 1TTYA 1LEBA 5HDGA 1YS6A 2LDUA 1W5TA 4G9YA 2RGVA 3E97A 2HKOA 1ZHFA 2CGPA 4P55A 5F64A 4KN4X 4O5VA 1U5TB 1IN6A 5HLGA 3ROUA 3GX4X 5DUKA 5HS9A 2BE5F 2VE8A 3VFZA 4A6DA 2WTEA 4LLGF 2A69F 3GVAA 1QZZA 2C6YA 5E18F 2D2WA 4L0YB 2XAGA 2UZKA 1Y0UA 2NNNA 4HF0A 2VT3A 1ZG1A 2XAQA 1YIOA 2IPQX 4ZYHA 4M9ZA 3N4MA 1B6AA 3HHHA 2IA1A 3QPTA 4ZH4F 4BHCA 4KNYA 5HOOA 5LRRA 3B73A 3GYHX 4U0VA 5D5UB 4L5IA 2Z3YA 3R0AA 4RAYA 1MD0A 1DPRA 3LAJA 4GYIA 2HZTA 2MH2A 4I7HA 4IJAA 1Z1DA 2FNPA 4U0WA 3H92A 2M5WA 1EH6A 3Q9VA 2HQRA 5FLXZ 2QQ9A 3F6VA 3WTZA 4U7BA 5TJJA 3JTHA 3TOBA 2GQQA 5L3CA 1ZREA 1XDUA 5ICGA 1UHMA 3IC7A 2STWA 4KFCA 3WTXC 1CF7A 2EFNA 2HR3A 2EB7A 1O7FA 5E1XA 4GCVA 3E6BA 2GAUA 3QAHA 2JSCA 3Q5FA 4K2EA 5CVJA 5DD8A 3BDDA 2DQLA 1K7AA 1FBUA 3GW2A 3HHGA 4HBLA 2M87A 2PBIA 4XLPF 2FBKA 1T6SA 3KP7A 3QP5A 1GXQA 4KYWA 3V7CA 1UHWA 2XRNA 3FMQA 2CSOA 4HAMA 2PI0A 3M1EA 3K0LA 4P9FA 2FSWA 1R5HA 2L4MA 4MEXF 1PUEE 3V4GA 3MZHA 3ELKA 3SZTA 2FE3A 1WQ2A 4L9NA 1ZRFA 3E6MA 4I2OA 5AIQA 3GUDA 4LGWA 3BPXA 3WG9A 1PP8F 3GFLA 3B02A 1F4KA 4G7HF 2IVMA 1KU7A 2R3SA 5ILUA 1HW2A 3G3ZA 3M8FA 1R23A 2ACJA 3FX3A 1PDNC 1R00A 1XCVA 1I1SA 2QENA 5KK1A 3VOEA 4G6QA 3JAMZ 2YX7A 1TQMA 4PZJA 1EH7A 2OZ6A 2F5FA 2IA0A 4B09A 2QUFA 2VXZA 4OOIA 3O6BB 1IN8A 1O3TA 5L3FA 1XD7A 3WGGA 5ICFA 1LDDA 3T8TA 1FNNA 3CUQB 4MTDA 5FB2A 2FF4A 5CVVA 4AVPA 3O3KA 1BC7C 2NYXA 4HF1A 3CLOA 1SD7A 3MFKA 1BIBA 4NB5A 5L3DA 5HS7A 1RUNA 2BGCA 4KICA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I01 A;  1IN7 A;  2L01 A;  3F6O A;  4BH9 A;  3RJP A;  1J0R A;  3MCZ A;  3VB2 A;  4YFK F;  1T0F A;  1IUY A;  3IKV A;  3L2C A;  3KFW X;  3MAJ A;  4G7Z F;  3F21 A;  3ZMU A;  3I0T A;  4FX0 A;  2J5O A;  4ASN A;  5LHG A;  5JR3 A;  5ICE A;  4MHG A;  3HRS A;  5FD6 A;  3TGN A;  2Z99 A;  2ISZ A;  1P6R A;  2V1D A;  4P96 A;  1UCR A;  2VC0 A;  4ZYD A;  3BRO A;  1TW2 A;  3I59 A;  3COA C;  3FM5 A;  1G3Y A;  4PGH A;  4RB0 A;  2P6T A;  1Z9C A;  3HUG A;  4S04 A;  2LF7 A;  3L7W A;  1J5Y A;  1R5G A;  4N0B A;  4AD9 A;  2ESH A;  3FXR A;  1LQ1 A;  1I27 A;  2XAF A;  2ZCW A;  3MEX A;  5JI6 A;  5K1Y A;  2A68 F;  4I0B A;  2XV4 S;  3J81 Z;  1F1Z A;  2CG4 A;  1OMI A;  4G7O F;  5L3G A;  2PN6 A;  2VC1 A;  4UVA A;  3KP3 A;  1BI2 A;  3U1D A;  3RDI A;  2L4A A;  3U9G A;  4EM2 A;  4Y17 A;  5DDG A;  3GLX A;  5KVR A;  2Z5U A;  4RB2 C;  1E2X A;  1XMK A;  1ZAR A;  5IT9 K;  2VT2 A;  2O3F A;  1BIA A;  5D4R A;  3C7J A;  2WV0 A;  2HGC A;  1WWX A;  4LMY A;  3HTS B;  2AS5 F;  1ZLJ A;  4RGR A;  2RQP A;  1PP7 U;  4N9I A;  4HDV A;  3FWE A;  4Q4Z F;  1U78 A;  3HSF A;  1G3W A;  1QPM A;  3V7S A;  4EV0 A;  5L3E A;  1DP7 P;  2Y48 A;  3E6D A;  3AAF A;  3ZMV A;  1UFM A;  4GGG A;  5FLX K;  2F5C A;  1J75 A;  3ZMZ A;  2O03 A;  3V7R A;  4CDG A;  3R60 A;  2CO5 A;  1ZN2 A;  2HTJ A;  3R6S A;  1U3E M;  3JSP A;  4ENM A;  2D45 A;  4CYD A;  1S7A A;  1EH8 A;  3HOT A;  1JHF A;  5HDK A;  5L3B A;  2HTS A;  3E5X A;  3HOS A;  3BP8 A;  2L3D A;  4YIF A;  2RVC A;  3DP7 A;  2OQG A;  3TO6 A;  2PG4 A;  3EQL F;  1S8N A;  2K27 A;  2H09 A;  4KUM A;  2EFW A;  4XSX F;  3BY6 A;  2IP2 A;  3GZ5 A;  5LHH A;  5H6R A;  2QQB A;  1R7J A;  3OV8 A;  4U0Y A;  1LDK B;  1ZH5 A;  1VTN C;  1KQ0 A;  4HQM A;  1F9N A;  1JE8 A;  4OIQ F;  1OYW A;  3WGI A;  1YFH A;  1L3L A;  4IXA A;  3F8C A;  2XHK A;  2RNJ A;  2PJP A;  2X0L A;  2KJC A;  2LSO A;  1ZAO A;  4EM1 A;  4EGY A;  1T39 A;  1FWZ A;  4L9V A;  2JTV A;  1FX7 A;  2NNY A;  1MJB A;  1ULY A;  1O3S A;  3ZMT A;  3KP4 A;  3RIR A;  4RAZ A;  4ZZL A;  2GIV A;  2RC4 A;  4RGS A;  4EJV A;  4FX4 A;  4MNU A;  5LGN A;  4HF2 A;  1IN5 A;  2W84 A;  3K9T A;  1S29 A;  4RS8 A;  5J6X A;  1FC3 A;  2VN2 A;  1Z6R A;  1WKM A;  4UUV A;  3DPT A;  4UVB A;  1FZP B;  4ESB A;  1W7P A;  5K5O A;  2KIM A;  2V1X A;  1K6O A;  1B9M A;  1REP C;  3R4K A;  4IRI A;  1TNT A;  1D8K A;  4RB1 A;  2HFH A;  3K69 A;  3IRR A;  2P5L C;  1B9N A;  2IA2 A;  5JFR A;  1LJ9 A;  4CHU A;  2MC3 A;  3P9I A;  3CO6 C;  1KQ8 A;  3GFI A;  1FP1 D;  4M72 A;  3IL2 A;  3E3V A;  1ODD A;  2XIG A;  3GEZ A;  1LEA A;  5HDN A;  4WX9 A;  4P9U A;  2ZFW A;  3I71 A;  3LQR A;  3I54 A;  3NQO A;  3QRF F;  3T1B A;  4LG0 B;  1ZGA A;  4Z2Y A;  1KQ9 A;  3HSR A;  3MZY A;  3JAM K;  2D1V A;  1D8J A;  4EVI A;  2Y75 A;  3SFZ A;  2G9W A;  2FXA A;  3P9K A;  2MD5 A;  6PAX A;  3ZN1 A;  1O7L A;  3ERE D;  2FML A;  2VBZ A;  1R1V A;  3TO9 A;  2EV5 A;  1SFX A;  1W7P D;  3J81 K;  2MLG A;  3DQV C;  4ENJ A;  1IN4 A;  1XCB A;  4B8X A;  3KE2 A;  4S05 A;  3F8M A;  1QQI A;  4LK0 F;  1FLI A;  1R22 A;  4M73 A;  1QZY A;  1KA8 A;  5E1Z B;  1D5V A;  1IW7 F;  1ZG5 A;  2IRF G;  1R1T A;  4BHB A;  4FHT A;  2ZME A;  1LVA A;  2IW5 A;  2UXX A;  1SFE A;  2P5V A;  2MLK A;  2HYG D;  2XGX A;  3V8K A;  2QLZ A;  1XGS A;  2KJB A;  4N9H A;  4A6E A;  4DQ2 A;  1YS7 A;  1HBX G;  4HZF A;  4Y13 A;  5LEJ A;  2O61 A;  4EJW A;  1HQC A;  2EFO A;  4KIB A;  5FGM A;  1B1B A;  3BJ6 A;  2LNB A;  2NRA C;  3I5U A;  3JSO A;  3P7N A;  5J8C A;  5A2Q Z;  4UV8 A;  1W4M A;  2P7V B;  2A5Y B;  1H0M A;  4RB3 C;  2HOE A;  3RI4 A;  5D5X B;  1RNL A;  3PQJ A;  1FSH A;  2QBY A;  2M45 A;  2DTR A;  3VEP A;  3WE3 A;  2IT0 A;  4NHJ A;  1S3J A;  2CQK A;  2XKO A;  3F22 A;  2OU2 A;  5ILS A;  2DAO A;  3C3W A;  4L0Z B;  2HQN A;  3EYI A;  4HX4 A;  2A61 A;  3H3U A;  1QNT A;  1T2K A;  3RKY A;  2Z33 A;  5BPI A;  5LLQ A;  2YX4 A;  2O6G E;  1ZG3 A;  5E8G A;  3ZPL A;  1RZ4 A;  2UWM A;  5BS6 A;  4LLL A;  2L54 A;  5E17 F;  1HST A;  1NHA A;  5CVI A;  2QWW A;  4LB6 B;  1FSE A;  4EGZ A;  1GHC A;  4LG0 A;  3JTG A;  3KLO A;  4A2U A;  4G6D A;  3DF8 A;  1KU3 A;  2HEO A;  4L18 B;  3EDP A;  5BPD A;  3WU1 B;  1XSD A;  3ZP5 A;  1TBX A;  1OPC A;  3WE2 A;  1IZ1 A;  3C1D A;  3E5U A;  3KLN A;  2NAZ A;  2OAZ A;  1B4A A;  1OYI A;  3D0S A;  3CDH A;  2MBF A;  2E1N A;  2XRO A;  2EJR A;  3GFJ A;  2W24 A;  1KU9 A;  5LGU A;  2VBY A;  4HQE A;  3ECH A;  2P4W A;  4KT5 C;  4O6J A;  3LFK A;  4WXD A;  3HYI A;  2FRH A;  4G94 A;  4IHS A;  4LD5 A;  3WTY C;  3FXU A;  1O3R A;  2AXL A;  3F8N A;  3NEU A;  2P7C B;  2PQ8 A;  1AWC A;  3ISP A;  2W25 A;  2MH9 A;  3L09 A;  2J5P A;  2VOD A;  3WOD F;  3K1P A;  5E8I A;  1J2X A;  3LAP A;  3QU6 A;  1HSJ A;  3FMR A;  2RDP A;  2OD5 A;  3T5X A;  2VON A;  5DYM A;  2FNA A;  2A07 F;  4IHT A;  3GWZ A;  4XLN F;  3KEO A;  4YII A;  4WK8 F;  4BHP A;  2QVO A;  4OU0 A;  4M71 A;  2H27 A;  3TOA A;  1A04 A;  1BI0 A;  1X3U A;  2BYV E;  2OBP A;  2K4B A;  1FP2 A;  1SMT A;  1T98 A;  3CJN A;  1ON1 A;  5H20 A;  3K1N A;  4WXC A;  1E17 A;  1HXD A;  3SQN A;  3RKW A;  4HOB A;  3TDZ C;  4U7D A;  3SXY A;  2R7D A;  2GA1 A;  3RYP A;  1KYZ A;  1MJA A;  5D5V B;  1WI9 A;  3E5Q A;  1WRJ A;  3IWZ A;  3WGH A;  2FOK A;  4OIP F;  4E70 A;  1FYK A;  3F3X A;  1Z05 A;  2JT1 A;  5BQT A;  4JBA A;  4EJU A;  3ECO A;  4RGU A;  5DCM B;  4BYY A;  1YO5 C;  2BV6 A;  1XSV A;  3JW4 A;  1G4D A;  4PCQ A;  4UNO A;  2A6H F;  3F8F A;  1R36 A;  4R1H A;  2Z9O A;  1WSU A;  3NRV A;  2DO7 A;  3L9F A;  1F5T A;  1BI3 A;  2RN7 A;  5LEK A;  3DKW A;  2QZ8 A;  2GXG A;  4KA4 A;  5D6F A;  4ON0 A;  4OIR F;  3ML6 A;  1U5T C;  4IPA A;  3DPL C;  5CYV A;  1R58 A;  1LDJ A;  3KP2 A;  2KIF A;  1YTY A;  3FHZ A;  1P4W A;  3T0Y A;  3M9A A;  2H6B A;  4LLN A;  1W5S A;  2F5E A;  2QM3 A;  1EV7 A;  2JPC A;  4BXU A;  1U6G A;  1J7K A;  3T8R A;  4EQQ A;  2G7U A;  4IRG A;  2EA2 A;  1ZRD A;  2EV0 A;  4M6X A;  3GFM A;  4WCG A;  1KYW A;  1BJA A;  2YR2 A;  2CWE A;  2ZJ2 A;  4WF2 A;  1L0O C;  1XN7 A;  3E6C C;  2E1C A;  1YQA A;  3CUQ C;  1MJ9 A;  1U5T A;  1KU2 A;  3I4P A;  1I5Z A;  2DK8 A;  4HX8 A;  1U2W A;  3K2Z A;  2O8X A;  4JK1 X;  4ENN A;  1OR7 A;  2F2E A;  1JHH A;  1STZ A;  5DV5 A;  2FMY A;  1Z6T A;  4UHT A;  5FD5 A;  2H6C A;  3H3Z A;  5JVT A;  2BBY A;  1V4R A;  4M6Y A;  1DUX C;  5F6F A;  3F8B A;  4F7Z A;  4WXH A;  2OQR A;  5DUI A;  4MTE A;  4A5N A;  3EYY A;  1FOK A;  2G7H A;  2EV6 A;  4PGG A;  2WC2 A;  5CLS A;  1XGM A;  3KCC A;  3J80 K;  2VBW A;  4XRF A;  5BOX A;  2FU4 A;  2FEZ A;  4AWX B;  1QO0 D;  3I59 B;  5FFZ A;  1SMY F;  5K5Q A;  2XVC A;  3HRM A;  5CVR A;  3WTS C;  2QYO A;  4ESF A;  3V8J A;  2STT A;  1Z7U A;  1J59 A;  3QP6 A;  2DW4 A;  3FXQ A;  4LK1 F;  4HV5 A;  1FYM A;  5HLH A;  2EK5 A;  4R79 A;  4AIK A;  2MA3 A;  3KP5 A;  5H6Q A;  3BWG A;  3HSE A;  3WU0 A;  5HS8 A;  4HW0 A;  2M8E A;  3O2P E;  4HYE A;  2P6S A;  1SD5 A;  1H9G A;  3BJA A;  2E7X A;  2IJL A;  4QWQ A;  2RKH A;  3LA3 A;  2Y0M A;  2YPR A;  1RUO A;  3TQN A;  1ON2 A;  3VOD A;  1IAW A;  4FT8 A;  1XDS A;  1CGP A;  5F1R A;  2XKP A;  2QBY B;  3I58 A;  1S6L A;  2DPD A;  4A12 A;  3TDU C;  1U8R A;  1O57 A;  1H9T A;  2K02 A;  3BPV A;  3CO7 C;  1MKM A;  2P8T A;  2NS0 A;  1FT9 A;  1LNW A;  1XGO A;  1ZYR F;  1OKR A;  4NQW A;  4I0A A;  4UXN A;  3I53 A;  4HLY A;  1W7P B;  1G3S A;  4LB5 A;  4LFU A;  1SD4 A;  1CF7 B;  3LA7 A;  1XSX A;  2FA5 A;  1MDM A;  3L00 A;  1LB2 A;  1TNS A;  3HTU A;  1RIO H;  4OMY A;  1HKT A;  1P92 A;  2ESN A;  4EM0 B;  1GVJ A;  2ZKZ A;  2ZNZ A;  4Q48 A;  2DPU A;  2ZNY A;  3G73 A;  1K79 A;  2OZU A;  2VBX A;  2HYF A;  5LBQ A;  3J80 Z;  3ZQ7 A;  2HWV A;  1J9I A;  4L9J A;  1G3T A;  5FFX A;  4CXF A;  4AIJ A;  5K5R A;  2V1U A;  3RYR A;  2DT5 A;  3TO7 A;  3GZ6 A;  1MGT A;  4MQV A;  4CO8 A;  2DLL A;  1BC8 C;  2L02 A;  3P9C A;  1IRG A;  5A2Q K;  5BMZ A;  2M1B A;  4KMU X;  4BQA A;  3W6J B;  4CGZ A;  4O3M A;  2DU9 A;  3S2W A;  1HKQ A;  4L5J A;  3QU3 A;  3FM3 A;  2COM A;  4KMF A;  2XAH A;  1SFU A;  1D3Y A;  2ISY A;  4IF4 A;  4KIG A;  5CJ9 A;  5D6E A;  3EUH A;  3R0J A;  2F5D A;  5FO5 A;  4KIF A;  1UST A;  2B0L A;  3DFG A;  4ENK A;  4M74 A;  2X4H A;  5LHI A;  3D5L A;  1O3Q A;  4IVN A;  2EWN A;  1IF1 A;  5EEH A;  4CZZ A;  1I1G A;  5E20 A;  2DK5 A;  3QOP A;  2XUB A;  3KEQ A;  5ERI A;  3IHU A;  1TW3 A;  5ED4 A;  2HKX A;  4I98 B;  1IXC A;  3FMS A;  2YSR A;  3RKX A;  5ICC A;  1C0W A;  1DDN A;  1HKS A;  1DPU A;  1HW5 A;  3IRQ A;  4ZYE A;  3Q9S A;  1KGS A;  1V3F A;  2PMU A;  3KP6 A;  2JPB A;  2XAS A;  1XB4 A;  4Y15 A;  3ABU A;  3ABT A;  4GYG A;  1S7O A;  2FQ3 A;  2R7F A;  1FY7 A;  3WTT C;  4DNC A;  4UV9 A;  2JRT A;  1BM9 A;  3F72 A;  5ILV A;  1TQP A;  2FBH A;  2LF8 A;  3RTR A;  3GXO A;  4MQ9 F;  3KZZ A;  4KDP A;  5DD4 A;  5AON A;  2HS5 A;  2FBI A;  3J7A O;  4U88 A;  3HRT A;  1Q1H A;  4I02 A;  3TKY A;  2W85 A;  4A0Y A;  4PDK A;  2VOP A;  3C18 A;  3FF5 A;  4HA8 A;  5D5W B;  4HDU A;  4JQF A;  1ZGJ A;  4HV6 A;  2CW0 F;  5CVU A;  4HLX A;  2D1H A;  3ZMD A;  2TDX A;  4D0P A;  3R61 A;  3WTW C;  3K1M A;  3M7G A;  3SZP A;  4BAY A;  2GZW A;  4EMS A;  3RPU A;  4QLC U;  4Q5S F;  4G8X A;  5EEG A;  2Q0O A;  4YFX F;  4UVC A;  4H0E A;  3EET A;  5D8L B;  1YW7 A;  4BNC A;  2V6C A;  3W6K B;  3DXJ F;  3LQQ A;  4I09 A;  3LA2 A;  1IRF A;  4M9X A;  1YLF A;  2W57 A;  1TQI A;  3V8L A;  2WWY A;  2UXN A;  1YW9 A;  4MGR A;  1K78 A;  3M8E A;  2PLY A;  2BEO A;  3PFI A;  3CUQ A;  1FPQ A;  1QBJ A;  2QQA A;  3KZY A;  1IXR C;  5IT9 Z;  2V9V A;  4GO1 A;  5DCF A;  1I6X A;  3MQ0 A;  1IXS B;  1ONV A;  3WTV C;  1TLH B;  2ZO4 A;  4HX7 A;  5D4S A;  4OIO F;  1QGP A;  2K7L A;  1RI7 A;  3ZMS A;  2V79 A;  4WWC A;  4KN7 X;  4XBF A;  2GXB A;  2ETH A;  3CTA A;  3LWF A;  1K78 B;  2HDC A;  1YG2 A;  4GXO A;  1UB9 A;  3BJO A;  1GXP A;  3WTU C;  1XMA A;  2E7W A;  4OMZ A;  2Q8K A;  5LRS A;  2A6E F;  1HW1 A;  1JGS A;  1YYV A;  1P4X A;  2K86 A;  2ZBK A;  1BOA A;  4ETS A;  2DI3 A;  2KRF A;  2CYY A;  2PMH A;  1MDM B;  4ZZD A;  1JXS A;  2OA4 A;  3DV8 A;  5J8F A;  4XSZ F;  5DCM A;  1R1U A;  4A5M A;  4EJO A;  4ESJ A;  1OYY A;  2O0Y A;  5DEQ A;  5LGT A;  5JHU A;  2H94 A;  2RV8 A;  4L9T A;  2DBB A;  2GA2 A;  1FYL A;  2EFP A;  4CIC A;  3BOQ A;  2M30 A;  1YW8 A;  2K4J A;  3HIF A;  2CFX A;  4Q47 A;  4ZYG A;  4A0Z A;  2EA4 A;  3U2R A;  1Z91 A;  2P5K A;  1G6N A;  3ULQ B;  5D8K B;  3KET A;  2JZY A;  3RPQ A;  3I64 A;  3OOP A;  1ZRC A;  2ADU A;  4R8H A;  4TV7 A;  1B59 A;  1SD6 A;  1FBS A;  2KKO A;  2Q2E A;  1AOY A;  4AIH A;  2EFQ A;  2GWR A;  1BN5 A;  3F23 A;  4RGX A;  1MZB A;  4EJT A;  3GO5 A;  5HVQ C;  3GF2 A;  2XAJ A;  4P5O A;  3IKT A;  5AIP A;  4M9S A;  2VOO A;  3MWM A;  2ZXJ A;  5IT3 A;  3BZ6 A;  2PEX A;  1P4A A;  3PQK A;  1USS A;  1SAX A;  2ELH A;  2ZME B;  3SHF A;  3N97 A;  4OIN F;  2DQR A;  3ZN0 A;  3CUO A;  5TRD A;  2PFB A;  3LST A;  4IRH A;  2YU3 A;  2VE9 A;  5HLI A;  4A0X A;  4LJZ F;  2A3S A;  1ZLK A;  3DEU A;  1XGN A;  3QPH A;  4YG2 F;  2KIU A;  1FBQ A;  3HRU A;  1T38 A;  3FZV A;  1BI1 A;  1P2F A;  2DFI A;  3REO A;  4MEY F;  4YFN F;  1BBY A;  3IWF A;  5E1W A;  2LKP A;  1TTY A;  1LEB A;  5HDG A;  1YS6 A;  2LDU A;  1W5T A;  4G9Y A;  2RGV A;  3E97 A;  2HKO A;  1ZHF A;  2CGP A;  4P55 A;  5F64 A;  4KN4 X;  4O5V A;  1U5T B;  1IN6 A;  5HLG A;  3ROU A;  3GX4 X;  5DUK A;  5HS9 A;  2BE5 F;  2VE8 A;  3VFZ A;  4A6D A;  2WTE A;  4LLG F;  2A69 F;  3GVA A;  1QZZ A;  2C6Y A;  5E18 F;  2D2W A;  4L0Y B;  2XAG A;  2UZK A;  1Y0U A;  2NNN A;  4HF0 A;  2VT3 A;  1ZG1 A;  2XAQ A;  1YIO A;  2IPQ X;  4ZYH A;  4M9Z A;  3N4M A;  1B6A A;  3HHH A;  2IA1 A;  3QPT A;  4ZH4 F;  4BHC A;  4KNY A;  5HOO A;  5LRR A;  3B73 A;  3GYH X;  4U0V A;  5D5U B;  4L5I A;  2Z3Y A;  3R0A A;  4RAY A;  1MD0 A;  1DPR A;  3LAJ A;  4GYI A;  2HZT A;  2MH2 A;  4I7H A;  4IJA A;  1Z1D A;  2FNP A;  4U0W A;  3H92 A;  2M5W A;  1EH6 A;  3Q9V A;  2HQR A;  5FLX Z;  2QQ9 A;  3F6V A;  3WTZ A;  4U7B A;  5TJJ A;  3JTH A;  3TOB A;  2GQQ A;  5L3C A;  1ZRE A;  1XDU A;  5ICG A;  1UHM A;  3IC7 A;  2STW A;  4KFC A;  3WTX C;  1CF7 A;  2EFN A;  2HR3 A;  2EB7 A;  1O7F A;  5E1X A;  4GCV A;  3E6B A;  2GAU A;  3QAH A;  2JSC A;  3Q5F A;  4K2E A;  5CVJ A;  5DD8 A;  3BDD A;  2DQL A;  1K7A A;  1FBU A;  3GW2 A;  3HHG A;  4HBL A;  2M87 A;  2PBI A;  4XLP F;  2FBK A;  1T6S A;  3KP7 A;  3QP5 A;  1GXQ A;  4KYW A;  3V7C A;  1UHW A;  2XRN A;  3FMQ A;  2CSO A;  4HAM A;  2PI0 A;  3M1E A;  3K0L A;  4P9F A;  2FSW A;  1R5H A;  2L4M A;  4MEX F;  1PUE E;  3V4G A;  3MZH A;  3ELK A;  3SZT A;  2FE3 A;  1WQ2 A;  4L9N A;  1ZRF A;  3E6M A;  4I2O A;  5AIQ A;  3GUD A;  4LGW A;  3BPX A;  3WG9 A;  1PP8 F;  3GFL A;  3B02 A;  1F4K A;  4G7H F;  2IVM A;  1KU7 A;  2R3S A;  5ILU A;  1HW2 A;  3G3Z A;  3M8F A;  1R23 A;  2ACJ A;  3FX3 A;  1PDN C;  1R00 A;  1XCV A;  1I1S A;  2QEN A;  5KK1 A;  3VOE A;  4G6Q A;  3JAM Z;  2YX7 A;  1TQM A;  4PZJ A;  1EH7 A;  2OZ6 A;  2F5F A;  2IA0 A;  4B09 A;  2QUF A;  2VXZ A;  4OOI A;  3O6B B;  1IN8 A;  1O3T A;  5L3F A;  1XD7 A;  3WGG A;  5ICF A;  1LDD A;  3T8T A;  1FNN A;  3CUQ B;  4MTD A;  5FB2 A;  2FF4 A;  5CVV A;  4AVP A;  3O3K A;  1BC7 C;  2NYX A;  4HF1 A;  3CLO A;  1SD7 A;  3MFK A;  1BIB A;  4NB5 A;  5L3D A;  5HS7 A;  1RUN A;  2BGC A;  4KIC A; 
#chains in the Genus database with same CATH topology
 2X9D A;  4I01 A;  1IN7 A;  2BZT A;  4PJN A;  2L01 A;  3F6O A;  4BH9 A;  3RJP A;  1J0R A;  3HB9 A;  2R0Q C;  1D1B A;  3MCZ A;  2Y2Z A;  3BG3 A;  3OYC A;  1AKH A;  3VB2 A;  3W2V A;  4YFK F;  1HF0 A;  2WAF A;  2WAQ A;  4BGD A;  5F04 A;  1LUJ B;  1PVE A;  2VQH A;  4ABZ A;  1T0F A;  5EEA A;  3AG1 H;  1IUY A;  5FKK A;  3IKV A;  3L2C A;  2ZSI B;  3FBN B;  3KFW X;  3NAR A;  4JX5 A;  2VKE A;  3PL8 A;  1MMN A;  3MAJ A;  2CJJ A;  4X0G A;  3PIP F;  3C2H A;  4G7Z F;  2B63 J;  4BJ6 C;  2KQR A;  2DFE A;  3ZMU A;  3F21 A;  3I0T A;  3BT9 A;  2J5O A;  4FX0 A;  4ASN A;  3PO3 J;  1EJ9 A;  5LHG A;  5JR3 A;  2FD5 A;  1T08 B;  2NS8 A;  1S7E A;  2BVL A;  2O7O A;  5ICE A;  4MHG A;  1XMX A;  3HRS A;  1K6Y A;  2HNH A;  3ZOB A;  5FD6 A;  4CH7 A;  3TGN A;  1X1C A;  2Z99 A;  2XGD A;  1P7J A;  2ISZ A;  1P6R A;  2L9S A;  3AG3 H;  2V1D A;  4P96 A;  1UCR A;  2VC0 A;  1WJD A;  4ZYD A;  3BRO A;  5KAI C;  1VF9 A;  1ZKG A;  2MG4 A;  1TW2 A;  3I59 A;  3COA C;  3FM5 A;  1G3Y A;  4PGH A;  4BKX A;  4YRV A;  2XGC A;  4HG2 A;  4RB0 A;  2P6T A;  1Z9C A;  3CF5 F;  3HUG A;  4S04 A;  3BCB A;  2LF7 A;  3L7W A;  1J5Y A;  1R5G A;  4N0B A;  4AD9 A;  2ESH A;  3FXR A;  3K6G A;  1I27 A;  2XAF A;  1OFC X;  2ZCW A;  3MEX A;  1LQ1 A;  4BBS J;  2K3F A;  5JI6 A;  5FLM J;  2R7S A;  5K1Y A;  2A68 F;  3ZR8 X;  4I0B A;  5EGO B;  2XV4 S;  3J81 Z;  3M8J A;  1F1Z A;  2CG4 A;  1OMI A;  4JP0 A;  4G7O F;  5L3G A;  2PN6 A;  2VC1 A;  5FJ8 J;  3OYA A;  3K4J A;  2EH3 A;  1UZC A;  4PJM A;  4UVA A;  4IX7 A;  3KP3 A;  1BI2 A;  1OCT C;  3U1D A;  3RDI A;  3IAM 2;  1HA8 A;  1ETK A;  3VDX A;  2L4A A;  3U9G A;  3DLL F;  1MBK A;  4A3I J;  4HNV A;  4BY1 J;  2B7E A;  4M3B A;  3HC7 A;  2JSP A;  4NC8 A;  4EM2 A;  3HGY A;  2LH9 A;  2BOL A;  3IUO A;  4Y17 A;  4IKF A;  5DDG A;  3D1N I;  4JX4 A;  3GLX A;  4DYQ A;  3EUH C;  1DU6 A;  5KVR A;  2Z5U A;  3DLA A;  4RB2 C;  1E2X A;  1XMK A;  1ZAR A;  3KYL A;  2KFD A;  5IT9 K;  2VT2 A;  2F5V A;  1LE8 B;  2O3F A;  1BIA A;  2JJ7 A;  5D4R A;  3C7J A;  3GTL J;  2WV0 A;  2HGC A;  4BS9 A;  1WWX A;  4XKV A;  1ITY A;  2IS6 A;  4LMY A;  3HTS B;  2AS5 F;  2QKL B;  1ZLJ A;  4RGR A;  2CV0 A;  2RQP A;  1GV2 A;  1PP7 U;  4N9I A;  1MBF A;  1ACI A;  4HDV A;  4NC7 A;  3QOE A;  4IOC F;  2DMP A;  3HPG A;  1JKQ C;  1VQK I;  3FWE A;  3LSH A;  3HDD A;  4Q4Z F;  1U78 A;  3HSF A;  4I6Z A;  4BBR J;  1ETO A;  4HRI A;  4CCN A;  1G3W A;  1QPM A;  3V7S A;  2M8G X;  4EV0 A;  1WZ2 A;  1ZTR A;  4P1W A;  5L3E A;  1DP7 P;  3TMO A;  3A02 A;  2Y48 A;  3E6D A;  3AAF A;  3ZMV A;  1UFM A;  4GGG A;  2DYS H;  1EA3 A;  2BY1 A;  5FLX K;  2F5C A;  4CYC A;  1J75 A;  2DMN A;  3CP8 A;  3ZMZ A;  5F0H A;  9ANT A;  2O03 A;  3V7R A;  1SVM A;  3HEF A;  2KZG A;  2YUS A;  3S3M A;  1ERD A;  4CDG A;  2EIN H;  3S1M J;  3JRI A;  3R60 A;  2CO5 A;  1ZN2 A;  4BU2 A;  2HTJ A;  2VB6 A;  3R6S A;  3K7A J;  1U3E M;  3JSP A;  3RQI A;  4ENM A;  2D45 A;  4ZJZ A;  4CYD A;  2JA5 J;  1S7A A;  3HUG B;  1EH8 A;  2HPI A;  4BAC A;  3HOT A;  1JHF A;  5HDK A;  4E7I A;  2I8D A;  5L3B A;  1Y39 A;  3KZI C;  2PX9 A;  2HTS A;  1SFO J;  3E5X A;  2IXS A;  4AVZ A;  3OYE A;  3HOS A;  1U0J A;  3S16 J;  3BP8 A;  3SDB A;  2L3D A;  4YIF A;  2RVC A;  2VKH A;  2LOO A;  3DP7 A;  2OQG A;  2P81 A;  3IH2 A;  4RLF A;  3TO6 A;  2PG4 A;  3EQL F;  1S8N A;  2R7T A;  2M9H A;  1YOV B;  4DBR A;  2K27 A;  3FK7 A;  3E1S A;  2H09 A;  4XOP A;  2IBD A;  2AQE A;  4KUM A;  2EFW A;  1VQ8 I;  4XSX F;  3BY6 A;  5JLX A;  1SVL A;  2IP2 A;  2MD0 A;  2KRH A;  2ID3 A;  3GZ5 A;  5LHH A;  5H6R A;  2QQB A;  1BW5 A;  3H5R A;  2KIQ A;  5FRN A;  3CCQ I;  1R7J A;  1T33 A;  3OV8 A;  2R7Q A;  4U0Y A;  1LDK B;  3FKJ A;  1OCR H;  2CV2 A;  2EIK H;  3LSM A;  4F3Q A;  3HM5 A;  1ZH5 A;  1VTN C;  2OCE A;  4AM3 A;  1KQ0 A;  4HQM A;  2WV1 A;  1F9N A;  2LR8 A;  1JE8 A;  4BL0 B;  5C4X J;  2NS7 A;  1OYW A;  3WGI A;  1YFH A;  5J1Y A;  4OIQ F;  3JCU C;  4B3X A;  1L3L A;  4IXA A;  4BE2 A;  5E3M A;  2LC2 A;  1X19 A;  3F8C A;  2XHK A;  5K7Z A;  3S15 J;  1H89 C;  2RNJ A;  1FOX A;  2PJP A;  2I5U A;  2X0L A;  3LSP A;  2KJC A;  3IH3 A;  2LSO A;  4A3M J;  1ZAO A;  2EIM H;  3GBG A;  4EM1 A;  4EGY A;  1YRN A;  3M07 A;  1D1A A;  2BVM A;  5C4J J;  2QA4 I;  3HL2 A;  3OOU A;  1T39 A;  5EZG A;  1FWZ A;  4IHW A;  3OY9 A;  1IG7 A;  1T56 A;  3HXL A;  4L9V A;  4RM2 A;  3K70 D;  1MMS A;  2JTV A;  1FX7 A;  4LG3 A;  2NNY A;  2JRM A;  2X1C A;  1MJB A;  1ULY A;  1JUP A;  3BQY A;  1O3S A;  3ZMT A;  2WAQ N;  3KP4 A;  1A5J A;  2VQG A;  3RIR A;  4RAZ A;  4ZZL A;  1ORK A;  2GIV A;  4XR6 A;  2RC4 A;  4RGS A;  2M4G A;  4EJV A;  4FX4 A;  3BQZ A;  3OL4 A;  1X2N A;  4MNU A;  3D5R C;  2JA2 A;  3OYH A;  5LGN A;  4HF2 A;  4NUB A;  4DYR A;  1IN5 A;  2W84 A;  1Y6I A;  3K9T A;  2HDD A;  2DA5 A;  1S29 A;  4RS8 A;  5J6X A;  1GT0 C;  3JRH A;  3CZ6 A;  4A3D J;  1FC3 A;  2VN2 A;  3B6A A;  5BNG A;  1Z6R A;  2NOJ B;  4FQG A;  1WKM A;  1RET A;  3FIS A;  3DPT A;  4UUV A;  4UVB A;  1FZP B;  1QHG A;  4ESB A;  1W7P A;  5K5O A;  2KIM A;  5F27 A;  2V1X A;  5H2F C;  1OQY A;  1B8I A;  1QVU A;  1K6O A;  1B9M A;  1REP C;  2NVT J;  4J01 A;  2E1M C;  4XMY A;  3PNT A;  2ZJQ F;  3R4K A;  1V55 H;  3P5J A;  4IRI A;  1TNT A;  2M2E A;  1D8K A;  4RB1 A;  3JRD A;  2HFH A;  2RRE A;  3BTL A;  1GDT A;  1I50 J;  3K69 A;  3IRR A;  2P5L C;  4XLF A;  1PUF B;  1B9N A;  2IA2 A;  5JFR A;  1LJ9 A;  1OJL A;  2MC3 A;  4CHU A;  4UUS A;  2HXO A;  3P9I A;  3CO6 C;  3OYK A;  1KQ8 A;  1G2H A;  1SVO A;  4EAT A;  3GFI A;  3CC2 I;  1ZGW A;  1FP1 D;  4M72 A;  2TCT A;  3GTO J;  1WH5 A;  3IL2 A;  4PFO A;  3SJM A;  2CW8 A;  3MKZ A;  3E3V A;  3FHN A;  2QQ8 A;  2LK2 A;  1ODD A;  2MC4 A;  3BTI A;  2XIG A;  3GEZ A;  1LEA A;  5HDN A;  4WX9 A;  1GLN A;  2ECB A;  4P9U A;  2R5Z A;  2DT7 B;  2ZFW A;  2EQR A;  3I71 A;  2HXI A;  1ZEL A;  3LQR A;  3CQZ J;  3I54 A;  3NQO A;  3QRF F;  3T1B A;  4LG0 B;  4AC0 A;  2VJ4 A;  1VQM I;  1ZGA A;  3PSF A;  4Z2Y A;  1U9N A;  1KQ9 A;  3HSR A;  3MZY A;  3JAM K;  2D1V A;  1D8J A;  4EVI A;  2Y75 A;  3SFZ A;  2CUE A;  2G9W A;  4FE4 A;  4DW6 A;  4HST A;  3OL3 A;  3WU2 C;  4XLH A;  2FXA A;  3OMY A;  2HZD A;  3P9K A;  2MD5 A;  3CDL A;  2OPT A;  6PAX A;  3ZN1 A;  1O7L A;  3ERE D;  2FML A;  2VBZ A;  1R1V A;  3TO9 A;  2LYC A;  2GLO A;  3M1C A;  2EV5 A;  2GIZ A;  4RAF A;  1SFX A;  4XRM A;  2BY0 A;  1W7P D;  3J81 K;  2MLG A;  2R92 J;  1AU7 A;  1WJ5 A;  3DQV C;  4ENJ A;  2XAU A;  1IN4 A;  1UJ8 A;  1XCB A;  1OCC H;  1RES A;  3ZGK A;  4CCK A;  1BR4 A;  1VQ6 I;  4B8X A;  3KE2 A;  4BQN A;  4S05 A;  2DOA A;  5B1B H;  3ASO H;  3F8M A;  3JRG A;  1QQI A;  2MW8 A;  1LKX A;  4LK0 F;  1PJR A;  3H36 A;  1FLI A;  1R22 A;  4M73 A;  1QZY A;  1HLV A;  2E2I J;  3QYF A;  1JT6 A;  1KA8 A;  5E1Z B;  1GV5 A;  1IW7 F;  3GCM A;  1D5V A;  1ZG5 A;  2IRF G;  2E1O A;  1R1T A;  4BHB A;  4FHT A;  2ZME A;  3FXM A;  2XB0 X;  1LVA A;  4F92 B;  2JA6 J;  2IW5 A;  2UXX A;  1SFE A;  2R5Y A;  2P5V A;  2MLK A;  2HYG D;  2XGX A;  3V8K A;  1YRN B;  3H5N A;  2QLZ A;  1XGS A;  2KJB A;  3FKI J;  4N9H A;  5DM7 F;  4E7K A;  1N77 A;  4A6E A;  1VQ5 I;  3J7Z I;  1TWG J;  3BTC A;  4DQ2 A;  1YS7 A;  1WJE A;  1FMV A;  1HBX G;  1VQ9 I;  4KJZ A;  4XKW A;  1TT0 A;  2QEX I;  3RCO A;  4HZF A;  3BG5 A;  1WI3 A;  4PK4 A;  4DGW B;  1WJB A;  4Y13 A;  5LEJ A;  4IO9 F;  2O61 A;  4EJW A;  4XN0 A;  1HQC A;  2LY9 A;  4FTH A;  3NAU A;  2EFO A;  2H1L A;  4KIB A;  2M4K A;  3HJE A;  5J47 A;  5FGM A;  1B1B A;  3BJ6 A;  1WJF A;  2LNB A;  2X6O A;  2NRA C;  3I5U A;  3JSO A;  1JTY A;  2M0C A;  3P7N A;  5J8C A;  1LE8 A;  2F6C A;  2CW7 A;  3MKY B;  5B1A H;  4MIM A;  4II3 A;  5A2Q Z;  4UV8 A;  4RM3 A;  2BXY A;  2ZXI A;  3FXO A;  1W4M A;  2P7V B;  2VQL A;  2A5Y B;  4FET A;  2W4S A;  5GPA A;  3PJR A;  3K4B A;  3SYT A;  1H0M A;  4RB3 C;  1TWA J;  1FJL A;  2HOE A;  3RI4 A;  5D5X B;  2KP6 A;  1RNL A;  3PQJ A;  1FSH A;  2QBY A;  4C3H J;  2M45 A;  2DA7 A;  5KHD A;  2DTR A;  3VEP A;  3WE3 A;  1W36 C;  3CMM A;  5J40 A;  2IT0 A;  1YX3 A;  4V19 K;  4NHJ A;  1S3J A;  2CQK A;  2XKO A;  3F22 A;  2OU2 A;  5ILS A;  4E7S A;  2DAO A;  3PO2 J;  3C3W A;  2PJR A;  4L0Z B;  2HQN A;  2K9M A;  3U21 A;  3K4K A;  3EYI A;  4HX4 A;  2A61 A;  3H3U A;  1QNT A;  1T2K A;  5IYD J;  3CLQ A;  3RKY A;  4AUX A;  1MMG A;  2Z33 A;  3S17 J;  5BPI A;  5LLQ A;  5F1J A;  2YX4 A;  2O6G E;  3QQA A;  1ZG3 A;  5E8G A;  3LL7 A;  3O8G A;  5HNF A;  3ZPL A;  1RZ4 A;  2UWM A;  5BS6 A;  4LLL A;  2L54 A;  5E17 F;  3LNQ A;  1HST A;  1H88 C;  3GTP J;  1NHA A;  2V4J C;  5CVI A;  2QWW A;  3PNY A;  4LB6 B;  1FSE A;  3FXJ A;  3TW6 A;  1Y8R B;  3AG2 H;  4M3F A;  1V5F A;  1MMD A;  3S1N J;  4EGZ A;  1QRY A;  1GHC A;  1DQU A;  4LG0 A;  3JTG A;  1XC5 A;  3MN2 A;  3KLO A;  5FRM A;  4A2U A;  3L2Q A;  4C2T A;  4G6D A;  4JYK A;  2LBF B;  3DF8 A;  1KU3 A;  2Z16 A;  2HEO A;  3CJR B;  3EDP A;  4L18 B;  5BPD A;  5M3M J;  3FXL A;  3JRB A;  4PJ0 C;  2A05 A;  2DFF A;  4M3E A;  4QIW N;  3WU1 B;  4KIS A;  1XSD A;  2K9N A;  3ZP5 A;  1TBX A;  5HLT A;  1OPC A;  5JVG F;  1ETY A;  3WE2 A;  1IZ1 A;  4Y52 J;  1DGW Y;  4W97 A;  4XK4 A;  1Y1V J;  2KRC A;  3C1D A;  5EJC A;  4FAS D;  2LKS A;  3E5U A;  2EZL A;  4J19 A;  4V2F A;  4XON A;  3KLN A;  1R49 A;  2NAZ A;  2OAZ A;  3BTJ A;  1B4A A;  4M3G A;  2L0K A;  3CMY A;  2L9N A;  1OYI A;  2W82 A;  3D0S A;  3CDH A;  2MBF A;  1UAA A;  3PSI A;  2E1N A;  2G0E A;  2XRO A;  2B9S A;  2EJR A;  2ZFU A;  3GFJ A;  3HKZ A;  3ZQG A;  1JJ8 C;  1XX5 A;  2W24 A;  3K2A A;  1KU9 A;  3LMM A;  2NVU B;  1HCR A;  5LGU A;  2VBY A;  4Y7N J;  2CUF A;  2Y69 H;  1FTZ A;  4HQE A;  1NTC A;  2QGU A;  3ECH A;  4B44 A;  2V6E A;  2P4W A;  4KT5 C;  2Y30 A;  4PJL A;  3OYD A;  2DOF A;  4O6J A;  2L5Q A;  3CCE I;  3OSG A;  3LFK A;  4WXD A;  2CFO A;  3OYJ A;  2EPF A;  2FRH A;  3HYI A;  2DYR H;  4G94 A;  4LIV A;  3ZQH A;  3OS1 A;  4IHS A;  1HDP A;  3AG4 H;  4LD5 A;  3OS2 A;  3WTY C;  3ZQQ A;  2X6X A;  3FXU A;  1O3R A;  2AXL A;  2HDW A;  4RA2 A;  3U1K A;  3F8N A;  2HOA A;  4JX6 A;  3I4N J;  5DS9 A;  3ZXS A;  3NEU A;  2P7C B;  1AKH B;  4IQ4 A;  1YX5 A;  2PQ8 A;  2FJ1 A;  1AWC A;  3S2H J;  3ISP A;  5JLW A;  4J00 A;  2W25 A;  5JHF A;  5HNH A;  4B47 A;  3K4C A;  2MH9 A;  3L09 A;  5GAE J;  3OYI A;  1FTT A;  3H0G J;  2J5P A;  1YI2 I;  2X6W A;  1BJZ A;  2VOD A;  1XS9 A;  1PYV A;  3WOD F;  4GFB A;  3K1P A;  2MAB A;  5E8I A;  1J2X A;  3I3L A;  2HOS A;  3LAP A;  3QU6 A;  5KAF C;  3L1P A;  1HSJ A;  3FMR A;  2BY3 A;  2IAI A;  2RDP A;  2OD5 A;  5FKL A;  4CUG A;  3T5X A;  2VON A;  5DYM A;  2FNA A;  2A07 F;  4IHT A;  3GWZ A;  1PUF A;  4XLN F;  3KEO A;  2VAS A;  2JVH A;  4YII A;  4WK8 F;  3MD2 A;  1TT5 B;  4NBQ A;  4BHP A;  4IHY A;  2KZV A;  2QVO A;  4OU0 A;  1WVR A;  2KPM A;  4B1R A;  4M71 A;  3OYG A;  2H27 A;  2K9L A;  3TOA A;  1A04 A;  1BI0 A;  1X3U A;  2BYV E;  2OBP A;  1OCO H;  2K4B A;  2LVS A;  1FP2 A;  4MO7 A;  3OR2 C;  4XIC A;  1SMT A;  1T98 A;  3CJN A;  3QYE A;  1ON1 A;  5KNL A;  2DTZ A;  5H20 A;  3K1N A;  4WXC A;  4ZTF A;  1G59 A;  2XSJ C;  1E17 A;  1HXD A;  5GTI C;  3SQN A;  3RKW A;  3HG9 A;  1FMW A;  3BLY A;  4HOB A;  2KDO A;  3TDZ C;  4U7D A;  3SXY A;  4JOM A;  3M3Y J;  2R7D A;  2GA1 A;  2LG4 A;  3RYP A;  1KYZ A;  2L7K A;  1QU3 A;  4A3B J;  1MJA A;  2JWT A;  2YS9 A;  1WI9 A;  5D5V B;  3QPL A;  3E5Q A;  4XLE A;  1WRJ A;  4BJ5 C;  2E19 A;  1RRJ A;  2E35 A;  3IWZ A;  2DCE A;  3WGH A;  4UY8 I;  2FOK A;  4E70 A;  1FYK A;  4OIP F;  4ZDO A;  4RMN A;  1ENH A;  3F3X A;  1Z05 A;  1WCM J;  2JT1 A;  2JVG A;  3CCR I;  5BQT A;  3AL0 B;  4JBA A;  3HOU J;  4EJU A;  1HC8 A;  1SFK A;  2FX0 A;  3ECO A;  3ZQL A;  3RPU D;  1X1P A;  2OTJ I;  3TBI A;  4RGU A;  1A36 A;  5DCM B;  4BYY A;  1YO5 C;  1WPK A;  4LIT A;  2BV6 A;  3BG9 A;  3CCV I;  1XSV A;  3JW4 A;  1G4D A;  5J4Y A;  2X6Y A;  4PCQ A;  4Y3O A;  4UNO A;  1Y0N A;  2E36 A;  4BXF A;  2A6H F;  3F8F A;  2LD5 A;  2CQ7 A;  1R36 A;  2CUJ A;  4R1H A;  2XSD C;  5K7F A;  4G12 A;  2Z9O A;  1WSU A;  4NQW B;  2R7R A;  3PIO F;  3NRV A;  3GTJ J;  2DO7 A;  3L9F A;  2DA4 A;  1F5T A;  1BI3 A;  2RN7 A;  4YEJ A;  5LEK A;  3J7A Y;  3ASN H;  3DKW A;  2AHQ A;  1RR7 A;  2OF7 A;  3G1M A;  2QZ8 A;  5CQG A;  2GXG A;  3ZQC A;  2LLK A;  4KA4 A;  4HPQ A;  5D6F A;  1WJC A;  4ON0 A;  4OIR F;  2GOM A;  1X3W B;  2P0W A;  2LRD A;  3ML6 A;  3S93 A;  1U5T C;  4IPA A;  1K83 J;  3DPL C;  5CYV A;  2DFH A;  3H9G A;  3UNG C;  1R58 A;  1T95 A;  5DM6 F;  3JRE A;  4PJJ A;  2XC7 A;  1Y8Q B;  1JUM A;  4OWR B;  2Y9Y A;  2V9K A;  1LDJ A;  3KP2 A;  2KIF A;  4Y4R A;  3S3O A;  3FHZ A;  1YTY A;  1P4W A;  2R7Z J;  5M5Y J;  2GBY A;  4YIR X;  1T0F C;  1YIT I;  3T0Y A;  3M4O J;  3M9A A;  2H6B A;  1UEL B;  2JUG A;  3E0J B;  3DTI A;  1M1E B;  3LOC A;  4LLN A;  2HU9 A;  1W5S A;  2F5E A;  3CDI A;  2QM3 A;  1EV7 A;  2JPC A;  3C2B A;  3JRF A;  4BXU A;  1U6G A;  1J7K A;  3A03 A;  3T8R A;  1X58 A;  4EQQ A;  3G4S I;  2DN0 A;  2G7U A;  4IRG A;  2EA2 A;  1ZRD A;  2EV0 A;  4M6X A;  3GFM A;  2UUZ A;  3V42 A;  4WCG A;  1IC8 A;  1XG1 A;  1KYW A;  1BJA A;  3CC4 I;  2YR2 A;  2CWE A;  2ZJ2 A;  4WF2 A;  1L0O C;  3KIO A;  1XN7 A;  3E6C C;  2E1C A;  1YQA A;  2ME6 A;  1X1A A;  3CUQ C;  1MJ9 A;  1U5T A;  1KU2 A;  1SAN A;  3I4P A;  1I5Z A;  2DK8 A;  4HX8 A;  2DXI A;  1RC9 A;  2VPR A;  1U2W A;  4XLC A;  4C30 A;  3K2Z A;  2O8X A;  4JK1 X;  4E7Z A;  4ENN A;  2LKX A;  1OR7 A;  2CQN A;  2F2E A;  1JHH A;  4PFP A;  3BG7 A;  1STZ A;  1NG7 A;  2FMY A;  3DWL E;  5DV5 A;  1Z6T A;  4YEL A;  4S0H B;  1I3A A;  4UHT A;  2FQ4 A;  5FD5 A;  2H6C A;  1YHQ I;  4D7N A;  1IO2 A;  1LFB A;  2KHM A;  4V2G A;  1WH7 A;  3BR0 A;  1LFU P;  3H3Z A;  5JVT A;  3JRA A;  2X85 A;  3CCS I;  1IV6 A;  2BBY A;  3L2W A;  1V4R A;  2ZC2 A;  4M6Y A;  4RAG A;  1DUX C;  5F6F A;  3LSK A;  3F8B A;  1ZR2 A;  4F7Z A;  1Q1V A;  4H4K C;  4WXH A;  2OQR A;  5DUI A;  4MTE A;  4A5N A;  1ZK8 A;  3BCA A;  3EYY A;  2XPU A;  4ITV A;  2EIJ H;  1TWC J;  1FOK A;  2G7H A;  2EV6 A;  1JT0 A;  4PGG A;  2WC2 A;  5F0F A;  4AYB A;  5CLS A;  1XGM A;  3KCC A;  3J80 K;  2VBW A;  4XRF A;  4U87 A;  5BOX A;  3K10 A;  5IYB J;  4XRS A;  3HOW J;  1MBJ A;  3PNV A;  4ZTJ A;  4BE0 A;  4A3K J;  2FU4 A;  5FKM A;  3BZC A;  2IS4 A;  1LPQ A;  2FEZ A;  5FLV A;  2DMQ A;  4AWX B;  1QO0 D;  3I59 B;  5FFZ A;  1SMY F;  4C3J J;  5K5Q A;  3G1O A;  2NVQ J;  1VFC A;  1NK3 P;  2XVC A;  3HRM A;  2MGQ A;  2F48 A;  5CVR A;  5DTD A;  3QYB A;  3WTS C;  2QYO A;  2E60 A;  3V8J A;  4ESF A;  1YJN I;  4PSW A;  2STT A;  1Z7U A;  2VJJ A;  5EZH A;  1J59 A;  3ZRG A;  3QP6 A;  2JK3 A;  2DW4 A;  2EZH A;  3FXQ A;  4LK1 F;  4HV5 A;  1FYM A;  5HLH A;  2EK5 A;  2DA6 A;  2E5N A;  4R79 A;  4AIK A;  2MA3 A;  2PMZ A;  3KP5 A;  5H6Q A;  1VQ4 I;  3BWG A;  3HSE A;  4KT6 A;  3WU0 A;  4E4H A;  5HS8 A;  4HW0 A;  3LSJ A;  2M8E A;  5C3E J;  1W0T A;  3O2P E;  4BJT A;  4HYE A;  4Y33 A;  1BA5 A;  2P6S A;  5F08 A;  5IP9 J;  4N4O B;  1SD5 A;  2ELK A;  4DJA A;  1H9G A;  2CV1 A;  3BJA A;  5HOD A;  2E7X A;  3A0B C;  4IL6 C;  3GTM J;  1JJ6 C;  2IJL A;  4QWQ A;  4X1E A;  2RKH A;  3SZG A;  2OC6 A;  5EGO A;  3LA3 A;  3WHB A;  2Y0M A;  2YPR A;  1RUO A;  3TQN A;  1ON2 A;  3VOD A;  1IAW A;  3RQ4 A;  5B5E C;  2PJR B;  3DBH B;  4FT8 A;  4AYB N;  1W36 D;  1XDS A;  1CGP A;  2ICW G;  4HNU A;  5K7H A;  2M3A A;  2R7O A;  3OYB A;  3DPU A;  5F1R A;  3F0C A;  2XGE A;  2XKP A;  3MMY B;  2QBY B;  2Y0S N;  1S6L A;  3I58 A;  2DPD A;  4A12 A;  3TDU C;  5E3L A;  1X3Z B;  1O57 A;  1U8R A;  2LTP A;  3EUA A;  2EIL H;  1H9T A;  2K02 A;  4CYC B;  3ESW B;  5GTH C;  3BPV A;  3CO7 C;  1Y56 A;  3ERM A;  2CU7 A;  1MKM A;  2P8T A;  1QA6 A;  2NS0 A;  1FT9 A;  3AKZ A;  1LNW A;  1XGO A;  4D1Q A;  4M3D A;  2V1N A;  1ZYR F;  2VJI A;  1ETX A;  1OKR A;  4NQW A;  3TL4 X;  2ID6 A;  3F9K A;  4I0A A;  5IP6 A;  4UXN A;  3I53 A;  3VPR A;  4HLY A;  2Y0S A;  1W7P B;  2IGO A;  1G3S A;  2WBM A;  4LB5 A;  4LFU A;  4A93 J;  3BR2 A;  1SD4 A;  4BXX J;  3OWT A;  2QSG X;  1CF7 B;  4PSX A;  1UMQ A;  3QPS A;  3LA7 A;  1XSX A;  2FA5 A;  3W2A A;  1MDM A;  3S14 J;  1YE9 A;  2Y31 A;  3L00 A;  1NG6 A;  1LB2 A;  2IGN A;  1TNS A;  3RZO J;  3HTU A;  2BW3 A;  1BW6 A;  1RIO H;  4HSR A;  3I55 I;  4OMY A;  1HKT A;  1JUS A;  1P92 A;  2ESN A;  4BEH B;  1P7I A;  4EM0 B;  1GVJ A;  2ZKZ A;  2ZNZ A;  2K85 A;  5LFA A;  3OYL A;  5EDN A;  3IV5 A;  5IY5 H;  1MSE C;  4Q48 A;  2DPU A;  2ZNY A;  1YJ9 I;  5J1U A;  3G73 A;  1K79 A;  2CRG A;  2OZU A;  2VBX A;  2HYF A;  4BDZ A;  5LBQ A;  3J80 Z;  4A3J J;  3ZQ7 A;  3KYC B;  1YIJ I;  2IGK A;  1LVK A;  2HWV A;  1J9I A;  3SDG A;  4L9J A;  1G3T A;  5FFX A;  4CXF A;  4AIJ A;  2OV7 A;  3UKG A;  2VLA A;  5J3L A;  5K5R A;  2V1U A;  3RYR A;  1SC7 A;  2DT5 A;  3HGG A;  1F43 A;  2E5Z A;  3TO7 A;  3GZ6 A;  1B8I B;  1MGT A;  2BW3 B;  4MQV A;  4XID A;  3TED A;  2LFB A;  4CO8 A;  5M3F J;  2DLL A;  1UG0 A;  4IOA F;  1BC8 C;  1NK2 P;  2RNG A;  3JRC A;  3KEY A;  2JA8 J;  2NVY J;  2ZJR F;  2L02 A;  3P9C A;  1IRG A;  5A2Q K;  5BMZ A;  2M1B A;  4KMU X;  4BQA A;  3W6J B;  4B3A A;  4CGZ A;  3GLL A;  4F52 A;  2K5C A;  4O3M A;  3VSK A;  1SEU A;  2VI6 A;  2DU9 A;  3S2W A;  1HKQ A;  4L5J A;  5IPA A;  2WAE A;  3QU3 A;  2OTL I;  1V54 H;  3FM3 A;  5GP9 A;  1VQP I;  2COM A;  2F4M B;  4C2M J;  4KMF A;  4DYC A;  2XAH A;  2JMW A;  1BL0 A;  3BR3 A;  1SFU A;  1D3Y A;  1EF4 A;  2O8K A;  2L9V A;  3VYS B;  2ISY A;  4IF4 A;  4KIG A;  5CJ9 A;  4W1U A;  5D6E A;  4BE1 A;  3EUH A;  3KPH A;  2K9S A;  3R0J A;  2F5D A;  2COB A;  5FO5 A;  1B72 A;  4ZDP A;  2WB1 N;  4KIF A;  2Q2E B;  2LY1 A;  1UST A;  2B0L A;  2CH0 A;  3DFG A;  3S32 A;  1JGG A;  3VYU B;  4ENK A;  4M74 A;  2AQF A;  2X51 A;  2X1E A;  2E34 A;  3RZD J;  2X4H A;  5LHI A;  3D5L A;  1QPI A;  2QSH X;  3CES A;  4IVN A;  1O3Q A;  2EWN A;  1IF1 A;  5EEH A;  1Z3X A;  4CZZ A;  1I1G A;  2L7M P;  5E20 A;  1MW7 A;  5TIS C;  2FOW A;  3KYD B;  4ZC3 A;  3ZQI A;  4KIT B;  2BXZ A;  2DK5 A;  3QOP A;  1NH3 A;  1DU0 A;  2XUB A;  3KEQ A;  3FBI B;  2M7B A;  5ERI A;  3IHU A;  4BUP A;  1TW3 A;  5ED4 A;  3CP2 A;  3L2R A;  4M6V A;  2HKX A;  3QWL A;  4I98 B;  1IXC A;  3CCM I;  4C9Y A;  3FMS A;  3G71 I;  2YSR A;  4XRS G;  1A35 A;  3RKX A;  1E3H A;  5ICC A;  3HOY J;  1C0W A;  3H35 A;  1HKS A;  1DDN A;  1DPU A;  3H9J A;  1HW5 A;  3IRQ A;  3RKQ A;  4ZYE A;  2EZK A;  1MH4 A;  3H1C A;  1OLT A;  1A6Q A;  3Q9S A;  1T8I A;  1KGS A;  1MBH A;  1V3F A;  2LY2 A;  5CQE A;  2PMU A;  4QPQ A;  3KP6 A;  3I4M J;  1R5I D;  2JPB A;  2XAS A;  4DZJ A;  1ZQ3 P;  1XB4 A;  3AFH A;  2JN6 A;  4Y15 A;  3ABU A;  1POG A;  3ABT A;  2K40 A;  1E3O C;  4GYG A;  1S7O A;  2FQ3 A;  2KT0 A;  1X1D A;  1RR8 C;  1QHH D;  2R7F A;  3MVP A;  1FY7 A;  3WTT C;  2PMZ N;  3MKL A;  2R5Z B;  4N4N B;  2HQA A;  4DNC A;  4UV9 A;  3J7Y J;  2E2J J;  2JRT A;  1BM9 A;  3F72 A;  1I6H J;  1RKT A;  2LBF A;  5ILV A;  1TQP A;  2FBH A;  4IZZ A;  2LF8 A;  2VXD A;  3GXO A;  5KCM A;  3RTR A;  4MQ9 F;  2V7F A;  3KZZ A;  4KDP A;  5DD4 A;  5AON A;  2HS5 A;  2FBI A;  2DOD A;  2XF7 A;  4EEF G;  2VUM J;  3J7A O;  4B48 A;  4U88 A;  3HRT A;  4ANJ A;  1BR1 A;  2A6T A;  1MSF C;  1Q1H A;  3I56 I;  3OYN A;  3DTK A;  2LRE A;  4I02 A;  3TKY A;  2W85 A;  4A0Y A;  4MFE A;  3VYR B;  3GTK J;  1F36 A;  1K61 A;  2VL8 A;  4PDK A;  2VOP A;  3C18 A;  4F93 B;  1VQO I;  3FF5 A;  5IP7 J;  4RBO A;  3GME A;  4HA8 A;  2XF5 A;  5FKN A;  5D5W B;  4HDU A;  4JQF A;  1ZGJ A;  4HV6 A;  2CW0 F;  2XDV A;  2H8W A;  1B72 B;  5CVU A;  4HLX A;  3S3N A;  2D1H A;  3ZMD A;  2TDX A;  1MH3 A;  4D0P A;  4XOT A;  4XN3 A;  1DP3 A;  3R61 A;  3WTW C;  5EF6 A;  1J09 A;  3K1M A;  1OCZ H;  2WB1 A;  3CCY A;  3M7G A;  3SZP A;  4BAY A;  2GZW A;  1W1W E;  2AXT C;  2IS1 A;  3DU6 A;  3SFI A;  4EMS A;  5LD2 C;  3CD6 I;  3RPU A;  4QLC U;  2V9P A;  3ABK H;  2HOT A;  3VSL A;  4Q5S F;  1RPW A;  4G8X A;  4XKC A;  5EEG A;  2Q0O A;  1G8X A;  4B43 A;  4YFX F;  3G6E I;  2WAD A;  2TRT A;  4UVC A;  3DEE A;  3FXK A;  1LFP A;  3LSI A;  5M5X J;  1Z67 A;  4H0E A;  1K4S A;  3HPH A;  3DTE A;  3EET A;  1JKP C;  5D8L B;  3KX2 A;  2YU9 J;  3CF2 A;  4BDY A;  1YW7 A;  4BNC A;  1XTA A;  2V6C A;  2JUC A;  3CME I;  2ZSH B;  2ZME C;  4CA0 A;  4GDF A;  3WG7 H;  4Z6Y A;  3W6K B;  3HOX J;  3SEQ A;  3DXJ F;  1CQT A;  3LQQ A;  4I09 A;  3LA2 A;  1FOY A;  4D5C A;  1IRF A;  4M9X A;  1YLF A;  3NWS A;  2W57 A;  2CS3 A;  2M7A A;  1BOB A;  1TQI A;  3V8L A;  1ETQ A;  2WWY A;  1JKR C;  2UXN A;  5EYR A;  1YW9 A;  4MGR A;  1K78 A;  3M8E A;  2PLY A;  2BEO A;  5F0C A;  3HBL A;  5GAD J;  3PFI A;  2JQ7 A;  2X48 A;  1MMA A;  3CUQ A;  1FPQ A;  1QBJ A;  2QQA A;  3KZY A;  1YJW I;  1IXR C;  2DDA A;  4CCO A;  5IT9 Z;  2DJI A;  4D7M A;  1Z77 A;  2E2H J;  2OJE D;  2V9V A;  4GO1 A;  3OSF A;  4A3C J;  5DCF A;  1I6X A;  3MQ0 A;  1IXS B;  3CMA I;  1ONV A;  5C44 J;  1OR7 C;  3LSG A;  4DOZ A;  3WTV C;  1TC3 C;  4I99 C;  2W00 A;  3IH4 A;  4BQQ A;  1TLH B;  3O8H A;  1WGX A;  2ZO4 A;  3OR1 C;  4HX7 A;  2ELJ A;  5D4S A;  3JR9 A;  4IHV A;  4OIO F;  3OYF A;  2L9R A;  5E3O A;  1QGP A;  2K7L A;  1N78 A;  2HYJ A;  1RI7 A;  3ZMS A;  2V79 A;  2R7X A;  2RQQ A;  2E1M B;  4E7L A;  4WWC A;  2WY7 Q;  4KN7 X;  4XBF A;  2GXB A;  3BR1 A;  4HNT A;  2ETH A;  2A5W A;  2EBI A;  3CTA A;  2VPL A;  3LWF A;  1K78 B;  2HDC A;  3ONQ A;  2ME0 A;  4XKB A;  1YG2 A;  3DEW A;  4GXO A;  3C2G A;  3GZN B;  1S9H A;  1UB9 A;  3BJO A;  1GXP A;  3WTU C;  2CQX A;  1AA7 A;  5E79 C;  1XMA A;  2L7Z A;  2E7W A;  2F4O B;  2DA2 A;  2IGM A;  4OMZ A;  1IRZ A;  2ZXH A;  2Q8K A;  5LRS A;  1X1B A;  2A6E F;  1HW1 A;  1JGS A;  1YYV A;  1P4X A;  2K86 A;  4IQJ A;  2ZBK A;  1D0Y A;  1BOA A;  4ETS A;  2DI3 A;  2KRF A;  2CYY A;  2PMH A;  4CCJ A;  2OUM A;  4ZZD A;  1MDM B;  2DMT A;  2Q1Z B;  1JXS A;  3FK6 A;  2OA4 A;  3DV8 A;  5J8F A;  4XSZ F;  2Z1D A;  5DCM A;  1V5E A;  1DGR M;  2X1D A;  4ZDL A;  4B4C A;  3HOZ J;  1R1U A;  3MKW B;  4A5M A;  4EJO A;  4ESJ A;  1OYY A;  2O0Y A;  5DEQ A;  3HOV J;  5LGT A;  5JHU A;  1MND A;  4CCM A;  2H94 A;  2RV8 A;  1E3P A;  1V5G A;  3WHC A;  4OAY A;  4L9T A;  2DBB A;  2GA2 A;  1IJW C;  3S2D J;  4UUS B;  1X4O A;  1D5Y A;  2E71 A;  2QKM B;  5B3S H;  1FYL A;  1U9O A;  2DJN A;  2EFP A;  3ZCO A;  4CIC A;  2XRL A;  3CCJ I;  3A0H C;  3W6V A;  3BOQ A;  2M30 A;  1YW8 A;  2K4J A;  3HIF A;  2CFX A;  1VI0 A;  4Q47 A;  4ZYG A;  1QVT A;  3W2W A;  2EA4 A;  4A0Z A;  1HDD C;  3U2R A;  1Z91 A;  2P5K A;  4FCY A;  1Y1W J;  1G6N A;  2IEK A;  2WY8 Q;  1E0E A;  2Z2S B;  3ULQ B;  1MNM C;  5D8K B;  3KET A;  2JZY A;  3RPQ A;  3I64 A;  3OOP A;  1ZRC A;  2ADU A;  4R8H A;  2M0M A;  3CJQ B;  4TV7 A;  1OCP A;  1B59 A;  1SD6 A;  2QCO A;  1FBS A;  3LSR A;  2KKO A;  2Q2E A;  2L2O A;  2VKD A;  2R93 J;  1AOY A;  3AL0 C;  4AIH A;  3A1Y A;  2ECC A;  1I3Q J;  2EFQ A;  3TP3 A;  1MBE A;  3K4M A;  2GWR A;  1BN5 A;  3F23 A;  4RGX A;  1MZB A;  4EJT A;  2GOX B;  3VYT B;  3GO5 A;  5HVQ C;  2V26 A;  3GF2 A;  2XAJ A;  4P5O A;  3IKT A;  2VIX A;  4M9S A;  5AIP A;  2DDB A;  5B66 C;  2VOO A;  3MWM A;  5CPR B;  3ABM H;  2ZXJ A;  5IT3 A;  3PM1 A;  3A01 B;  2KMU A;  3BZ6 A;  4XOR A;  2PEX A;  1P4A A;  3PQK A;  1USS A;  3BZK A;  4DIQ A;  1SAX A;  2ELH A;  4RDU A;  3CJT B;  3BG6 A;  2DOE A;  1IUF A;  4D9J A;  2ZME B;  5GAG J;  3SHF A;  1WJA A;  3PFY A;  3N97 A;  3X2Q H;  2H1K A;  4OIN F;  1S72 I;  2DQR A;  1UHS A;  4I76 A;  3ZN0 A;  3CUO A;  5TRD A;  2O9L A;  2PFB A;  2W1O A;  3LST A;  2O5R A;  1S5L C;  2DMU A;  4IRH A;  4A3F J;  2YU3 A;  2NOG A;  3TW7 A;  1WHU A;  5HLI A;  2VE9 A;  2UV1 A;  1ZR4 A;  1TWH J;  2AO9 A;  4A0X A;  2CQQ A;  3PUB A;  1SAU A;  3H3V K;  4E7H A;  4LJZ F;  1MIJ A;  1A6I A;  2A3S A;  1ZLK A;  2ZB9 A;  3DEU A;  1XGN A;  2D5V A;  3QPH A;  4XL9 A;  4YG2 F;  1VZ0 A;  2W7N A;  3S1Q J;  2KIU A;  3UR3 C;  1FBQ A;  3HRU A;  4ZYA A;  1T38 A;  1FIA A;  3FZV A;  1QZE A;  4CZC A;  1BI1 A;  1P2F A;  4RLQ A;  2DFI A;  4XNF A;  3REO A;  3L2V A;  4UB8 C;  3DCF A;  1FIP A;  4PUS A;  4MEY F;  4NC6 A;  4YFN F;  3DBR B;  1BBY A;  3MZ8 A;  4F55 A;  1D1C A;  3IWF A;  5E1W A;  2R7V A;  1FEX A;  2LKP A;  2QSF X;  1TTY A;  2BHY A;  4NNJ A;  1LEB A;  5HDG A;  1Z7L A;  1YS6 A;  2LDU A;  1W5T A;  4A3E J;  2N8G A;  4G9Y A;  3E7L A;  2L7F P;  2NVX J;  2RGV A;  3DU5 A;  5GAH J;  3E97 A;  2HKO A;  1ZHF A;  1IDZ A;  2CGP A;  1WFX A;  4P55 A;  5F64 A;  2IS2 A;  1VND A;  4KN4 X;  3CCU I;  3W3C A;  4O5V A;  1U5T B;  4FE7 A;  1IN6 A;  4II2 A;  5HLG A;  2HVS A;  3ROU A;  5CKT A;  5DUK A;  3GX4 X;  5HS9 A;  2BE5 F;  4CCL A;  2VE8 A;  4HEA 2;  3B6C A;  5J1R A;  4E7J A;  2KDZ A;  4BQO A;  4CSW A;  4GRI A;  3LFU A;  3OS0 A;  3VFZ A;  2XF6 A;  4A6D A;  1U8B A;  1A31 A;  2JA7 J;  2WTE A;  3I9V 2;  1VQL I;  3H9Q A;  3ABL H;  4A3G J;  4AU7 A;  4LLG F;  2A69 F;  3DBL B;  4UUT A;  3GVA A;  1QZZ A;  4D5F A;  3OYM A;  3Q0W A;  3S1R J;  2C6Y A;  5E18 F;  1R6R A;  2CMP A;  2D2W A;  1R9T J;  3K4N A;  4L5E A;  4L0Y B;  2XAG A;  2K3P A;  2QF7 A;  2UZK A;  1Y0U A;  3IP4 B;  5FRO A;  2NNN A;  4HF0 A;  2VT3 A;  1ZG1 A;  2XAQ A;  1YIO A;  2IPQ X;  4ZYH A;  2MFZ A;  2HPM A;  1GUU A;  1X4P A;  4M9Z A;  2HQ5 A;  3N4M A;  1B6A A;  3EPZ A;  4MFD A;  3HHH A;  2IA1 A;  3Q0U A;  2WA0 A;  3QPT A;  5M5W J;  4ZH4 F;  4BHC A;  2HI3 A;  4KNY A;  3VWB A;  1Z3Y A;  3BC8 A;  3K70 C;  3FIW A;  3DKY A;  2R5Y B;  5HOO A;  5LRR A;  3B73 A;  1KON A;  1APL C;  4NDL A;  3CCL I;  2EZI A;  3GYH X;  3H5A A;  4LOC A;  4U0V A;  5D5U B;  4L5I A;  1HOM A;  1TZL A;  2Z3Y A;  3R0A A;  1D0Z A;  3K4L A;  4RAY A;  3GTG J;  5J4V A;  1MD0 A;  2HVQ A;  2NXN B;  1DPR A;  3A4C A;  3LAJ A;  5TGT A;  4GYI A;  2HZT A;  2GM4 A;  2MH2 A;  4I7H A;  4IJA A;  1Z1D A;  5EG0 B;  2GXA A;  2FNP A;  3DKX A;  4U0W A;  3H92 A;  2M5W A;  1EH6 A;  1RKW A;  3Q9V A;  2HQR A;  5FLX Z;  2QQ9 A;  3F6V A;  2DA1 A;  3WTZ A;  4U7B A;  5TJJ A;  3EUK L;  5GPC A;  1VQN I;  1MBG A;  1N25 A;  3BR6 A;  3JTH A;  3TOB A;  3CC7 I;  2GQQ A;  2KL4 A;  5L3C A;  1ZRE A;  1XDU A;  3G1L A;  5FKO A;  5ICG A;  1UHM A;  3IC7 A;  3S8P A;  2STW A;  4KFC A;  1AHD P;  3WTX C;  3QOD A;  1N75 A;  2Y9Z A;  1O4X A;  2EFN A;  2HR3 A;  2EB7 A;  2XPV A;  1O7F A;  4QTR A;  1CF7 A;  1KZH A;  1K4T A;  3IAS 2;  5E1X A;  4BY7 J;  4GCV A;  3N05 A;  3E6B A;  4FIS A;  4XQF A;  2VKV A;  2F4I A;  2GAU A;  2ZXW H;  3QAH A;  2JSC A;  3Q5F A;  1ETV A;  1H8A C;  1TWF J;  4K2E A;  5CVJ A;  5DD8 A;  3BDD A;  1P9Q C;  2DT6 A;  1R71 A;  2DQL A;  1K7A A;  1FBU A;  1UG2 A;  3GW2 A;  3HHG A;  4HBL A;  4E6K G;  2M87 A;  4G6T B;  2MYS A;  4OAZ A;  3PUF A;  2LP0 A;  1Z0X A;  2PBI A;  4MLO A;  3ZQF A;  4XLP F;  2FBK A;  2OCC H;  1T6S A;  5IYC J;  4IEJ A;  2VJ5 A;  3KP7 A;  3QP5 A;  2KLO A;  1GXQ A;  4KYW A;  1XPX A;  1W0U A;  1I39 A;  3V7C A;  1UHW A;  3OIO A;  2XRN A;  3FMQ A;  2CSO A;  2KIS A;  4HAM A;  4BEH A;  2XPW A;  3L2U A;  2PI0 A;  3M1E A;  2XB5 A;  3K0L A;  2DA3 A;  4P9F A;  2FSW A;  1R5H A;  2L4M A;  4MEX F;  4A69 C;  1PUE E;  3V4G A;  3MZH A;  3ELK A;  3SZT A;  1D0X A;  2FE3 A;  3OIP A;  1WQ2 A;  1JI8 A;  4L9N A;  1ZRF A;  1OIS A;  3E6M A;  4I2O A;  5AIQ A;  3GUD A;  2R4G A;  3A2K A;  4LGW A;  1GVD A;  3BPX A;  3WG9 A;  1PP8 F;  2K9Q A;  3G2B A;  3GFL A;  2CUZ A;  4F91 B;  4X6A J;  3B02 A;  3D5S C;  1JTX A;  1F4K A;  2RAE A;  4QPO A;  2IVM A;  4G7H F;  1KU7 A;  2R3S A;  5ILU A;  3Q3S A;  1HW2 A;  3G3Z A;  1IDY A;  2VQC A;  3M8F A;  2BY2 A;  1R23 A;  4DZP A;  2ACJ A;  4A3L J;  1BR2 A;  2H8R A;  3FX3 A;  5EG0 A;  1IGN A;  1PDN C;  1R00 A;  1XCV A;  2BHZ A;  1I1S A;  4QSH A;  1EKE A;  2QEN A;  4DBQ A;  1W5C C;  1JKO C;  5KK1 A;  5E3N A;  3VOE A;  5IOZ A;  4G6Q A;  3GTQ J;  1R4N B;  3JAM Z;  2R7W A;  3OIQ A;  2YX7 A;  1VQ7 I;  2MSY A;  1TQM A;  4PZJ A;  1EH7 A;  3NWT A;  2OZ6 A;  2F5F A;  2IA0 A;  2W48 A;  4B09 A;  2QUF A;  2VXZ A;  4OOI A;  3O6B B;  2R7U A;  1IN8 A;  4AID A;  1TL8 A;  4C3I J;  4XLA A;  3TP0 A;  1O3T A;  3BR5 A;  4C2U A;  5L3F A;  3SEZ A;  2M34 A;  1XD7 A;  2ZJP F;  3WGG A;  5ICF A;  4XM3 A;  1LDD A;  2I10 A;  3T8T A;  1FNN A;  3CUQ B;  4MTD A;  5FB2 A;  2FF4 A;  3HZJ A;  2FUG 2;  5CVV A;  4IHX A;  1ETW A;  4AVP A;  3O3K A;  1BC7 C;  2NYX A;  3FDY A;  2HVR A;  4HF1 A;  1R4M B;  1IV8 A;  1FOW A;  3HKZ N;  1Z21 A;  4UB6 C;  3H0D A;  3CLO A;  5IOY A;  3Q0V A;  4LIU A;  3RSN A;  2LMD A;  1SD7 A;  1X2M A;  3A01 A;  3MFK A;  1TP4 A;  1BIB A;  4NB5 A;  5L3D A;  5HS7 A;  1RUN A;  1IRX A;  2BGC A;  4KIC A;  1MNE A; 
#chains in the Genus database with same CATH homology
 4I01 A;  1IN7 A;  2L01 A;  3F6O A;  4BH9 A;  3RJP A;  1J0R A;  3MCZ A;  3VB2 A;  4YFK F;  1T0F A;  1IUY A;  3IKV A;  3L2C A;  3KFW X;  3MAJ A;  4G7Z F;  3F21 A;  3ZMU A;  3I0T A;  4FX0 A;  2J5O A;  4ASN A;  5LHG A;  5JR3 A;  5ICE A;  4MHG A;  3HRS A;  5FD6 A;  3TGN A;  2Z99 A;  2ISZ A;  1P6R A;  2V1D A;  4P96 A;  1UCR A;  2VC0 A;  4ZYD A;  3BRO A;  1TW2 A;  3I59 A;  3COA C;  3FM5 A;  1G3Y A;  4PGH A;  4RB0 A;  2P6T A;  1Z9C A;  3HUG A;  4S04 A;  2LF7 A;  3L7W A;  1J5Y A;  1R5G A;  4N0B A;  4AD9 A;  2ESH A;  3FXR A;  1LQ1 A;  1I27 A;  2XAF A;  2ZCW A;  3MEX A;  5JI6 A;  5K1Y A;  2A68 F;  4I0B A;  2XV4 S;  3J81 Z;  1F1Z A;  2CG4 A;  1OMI A;  4G7O F;  5L3G A;  2PN6 A;  2VC1 A;  4UVA A;  3KP3 A;  1BI2 A;  3U1D A;  3RDI A;  2L4A A;  3U9G A;  4EM2 A;  4Y17 A;  5DDG A;  3GLX A;  5KVR A;  2Z5U A;  4RB2 C;  1E2X A;  1XMK A;  1ZAR A;  5IT9 K;  2VT2 A;  2O3F A;  1BIA A;  5D4R A;  3C7J A;  2WV0 A;  2HGC A;  1WWX A;  4LMY A;  3HTS B;  2AS5 F;  1ZLJ A;  4RGR A;  2RQP A;  1PP7 U;  4N9I A;  4HDV A;  3FWE A;  4Q4Z F;  1U78 A;  3HSF A;  1G3W A;  1QPM A;  3V7S A;  4EV0 A;  5L3E A;  1DP7 P;  2Y48 A;  3E6D A;  3AAF A;  3ZMV A;  1UFM A;  4GGG A;  5FLX K;  2F5C A;  1J75 A;  3ZMZ A;  2O03 A;  3V7R A;  4CDG A;  3R60 A;  2CO5 A;  1ZN2 A;  2HTJ A;  3R6S A;  1U3E M;  3JSP A;  4ENM A;  2D45 A;  4CYD A;  1S7A A;  1EH8 A;  3HOT A;  1JHF A;  5HDK A;  5L3B A;  2HTS A;  3E5X A;  3HOS A;  3BP8 A;  2L3D A;  4YIF A;  2RVC A;  3DP7 A;  2OQG A;  3TO6 A;  2PG4 A;  3EQL F;  1S8N A;  2K27 A;  2H09 A;  4KUM A;  2EFW A;  4XSX F;  3BY6 A;  2IP2 A;  3GZ5 A;  5LHH A;  5H6R A;  2QQB A;  1R7J A;  3OV8 A;  4U0Y A;  1LDK B;  1ZH5 A;  1VTN C;  1KQ0 A;  4HQM A;  1F9N A;  1JE8 A;  4OIQ F;  1OYW A;  3WGI A;  1YFH A;  1L3L A;  4IXA A;  3F8C A;  2XHK A;  2RNJ A;  2PJP A;  2X0L A;  2KJC A;  2LSO A;  1ZAO A;  4EM1 A;  4EGY A;  1T39 A;  1FWZ A;  4L9V A;  2JTV A;  1FX7 A;  2NNY A;  1MJB A;  1ULY A;  1O3S A;  3ZMT A;  3KP4 A;  3RIR A;  4RAZ A;  4ZZL A;  2GIV A;  2RC4 A;  4RGS A;  4EJV A;  4FX4 A;  4MNU A;  5LGN A;  4HF2 A;  1IN5 A;  2W84 A;  3K9T A;  1S29 A;  4RS8 A;  5J6X A;  1FC3 A;  2VN2 A;  1Z6R A;  1WKM A;  4UUV A;  3DPT A;  4UVB A;  1FZP B;  4ESB A;  1W7P A;  5K5O A;  2KIM A;  2V1X A;  1K6O A;  1B9M A;  1REP C;  3R4K A;  4IRI A;  1TNT A;  1D8K A;  4RB1 A;  2HFH A;  3K69 A;  3IRR A;  2P5L C;  1B9N A;  2IA2 A;  5JFR A;  1LJ9 A;  4CHU A;  2MC3 A;  3P9I A;  3CO6 C;  1KQ8 A;  3GFI A;  1FP1 D;  4M72 A;  3IL2 A;  3E3V A;  1ODD A;  2XIG A;  3GEZ A;  1LEA A;  5HDN A;  4WX9 A;  4P9U A;  2ZFW A;  3I71 A;  3LQR A;  3I54 A;  3NQO A;  3QRF F;  3T1B A;  4LG0 B;  1ZGA A;  4Z2Y A;  1KQ9 A;  3HSR A;  3MZY A;  3JAM K;  2D1V A;  1D8J A;  4EVI A;  2Y75 A;  3SFZ A;  2G9W A;  2FXA A;  3P9K A;  2MD5 A;  6PAX A;  3ZN1 A;  1O7L A;  3ERE D;  2FML A;  2VBZ A;  1R1V A;  3TO9 A;  2EV5 A;  1SFX A;  1W7P D;  3J81 K;  2MLG A;  3DQV C;  4ENJ A;  1IN4 A;  1XCB A;  4B8X A;  3KE2 A;  4S05 A;  3F8M A;  1QQI A;  4LK0 F;  1FLI A;  1R22 A;  4M73 A;  1QZY A;  1KA8 A;  5E1Z B;  1D5V A;  1IW7 F;  1ZG5 A;  2IRF G;  1R1T A;  4BHB A;  4FHT A;  2ZME A;  1LVA A;  2IW5 A;  2UXX A;  1SFE A;  2P5V A;  2MLK A;  2HYG D;  2XGX A;  3V8K A;  2QLZ A;  1XGS A;  2KJB A;  4N9H A;  4A6E A;  4DQ2 A;  1YS7 A;  1HBX G;  4HZF A;  4Y13 A;  5LEJ A;  2O61 A;  4EJW A;  1HQC A;  2EFO A;  4KIB A;  5FGM A;  1B1B A;  3BJ6 A;  2LNB A;  2NRA C;  3I5U A;  3JSO A;  3P7N A;  5J8C A;  5A2Q Z;  4UV8 A;  1W4M A;  2P7V B;  2A5Y B;  1H0M A;  4RB3 C;  2HOE A;  3RI4 A;  5D5X B;  1RNL A;  3PQJ A;  1FSH A;  2QBY A;  2M45 A;  2DTR A;  3VEP A;  3WE3 A;  2IT0 A;  4NHJ A;  1S3J A;  2CQK A;  2XKO A;  3F22 A;  2OU2 A;  5ILS A;  2DAO A;  3C3W A;  4L0Z B;  2HQN A;  3EYI A;  4HX4 A;  2A61 A;  3H3U A;  1QNT A;  1T2K A;  3RKY A;  2Z33 A;  5BPI A;  5LLQ A;  2YX4 A;  2O6G E;  1ZG3 A;  5E8G A;  3ZPL A;  1RZ4 A;  2UWM A;  5BS6 A;  4LLL A;  2L54 A;  5E17 F;  1HST A;  1NHA A;  5CVI A;  2QWW A;  4LB6 B;  1FSE A;  4EGZ A;  1GHC A;  4LG0 A;  3JTG A;  3KLO A;  4A2U A;  4G6D A;  3DF8 A;  1KU3 A;  2HEO A;  4L18 B;  3EDP A;  5BPD A;  3WU1 B;  1XSD A;  3ZP5 A;  1TBX A;  1OPC A;  3WE2 A;  1IZ1 A;  3C1D A;  3E5U A;  3KLN A;  2NAZ A;  2OAZ A;  1B4A A;  1OYI A;  3D0S A;  3CDH A;  2MBF A;  2E1N A;  2XRO A;  2EJR A;  3GFJ A;  2W24 A;  1KU9 A;  5LGU A;  2VBY A;  4HQE A;  3ECH A;  2P4W A;  4KT5 C;  4O6J A;  3LFK A;  4WXD A;  3HYI A;  2FRH A;  4G94 A;  4IHS A;  4LD5 A;  3WTY C;  3FXU A;  1O3R A;  2AXL A;  3F8N A;  3NEU A;  2P7C B;  2PQ8 A;  1AWC A;  3ISP A;  2W25 A;  2MH9 A;  3L09 A;  2J5P A;  2VOD A;  3WOD F;  3K1P A;  5E8I A;  1J2X A;  3LAP A;  3QU6 A;  1HSJ A;  3FMR A;  2RDP A;  2OD5 A;  3T5X A;  2VON A;  5DYM A;  2FNA A;  2A07 F;  4IHT A;  3GWZ A;  4XLN F;  3KEO A;  4YII A;  4WK8 F;  4BHP A;  2QVO A;  4OU0 A;  4M71 A;  2H27 A;  3TOA A;  1A04 A;  1BI0 A;  1X3U A;  2BYV E;  2OBP A;  2K4B A;  1FP2 A;  1SMT A;  1T98 A;  3CJN A;  1ON1 A;  5H20 A;  3K1N A;  4WXC A;  1E17 A;  1HXD A;  3SQN A;  3RKW A;  4HOB A;  3TDZ C;  4U7D A;  3SXY A;  2R7D A;  2GA1 A;  3RYP A;  1KYZ A;  1MJA A;  5D5V B;  1WI9 A;  3E5Q A;  1WRJ A;  3IWZ A;  3WGH A;  2FOK A;  4OIP F;  4E70 A;  1FYK A;  3F3X A;  1Z05 A;  2JT1 A;  5BQT A;  4JBA A;  4EJU A;  3ECO A;  4RGU A;  5DCM B;  4BYY A;  1YO5 C;  2BV6 A;  1XSV A;  3JW4 A;  1G4D A;  4PCQ A;  4UNO A;  2A6H F;  3F8F A;  1R36 A;  4R1H A;  2Z9O A;  1WSU A;  3NRV A;  2DO7 A;  3L9F A;  1F5T A;  1BI3 A;  2RN7 A;  5LEK A;  3DKW A;  2QZ8 A;  2GXG A;  4KA4 A;  5D6F A;  4ON0 A;  4OIR F;  3ML6 A;  1U5T C;  4IPA A;  3DPL C;  5CYV A;  1R58 A;  1LDJ A;  3KP2 A;  2KIF A;  1YTY A;  3FHZ A;  1P4W A;  3T0Y A;  3M9A A;  2H6B A;  4LLN A;  1W5S A;  2F5E A;  2QM3 A;  1EV7 A;  2JPC A;  4BXU A;  1U6G A;  1J7K A;  3T8R A;  4EQQ A;  2G7U A;  4IRG A;  2EA2 A;  1ZRD A;  2EV0 A;  4M6X A;  3GFM A;  4WCG A;  1KYW A;  1BJA A;  2YR2 A;  2CWE A;  2ZJ2 A;  4WF2 A;  1L0O C;  1XN7 A;  3E6C C;  2E1C A;  1YQA A;  3CUQ C;  1MJ9 A;  1U5T A;  1KU2 A;  3I4P A;  1I5Z A;  2DK8 A;  4HX8 A;  1U2W A;  3K2Z A;  2O8X A;  4JK1 X;  4ENN A;  1OR7 A;  2F2E A;  1JHH A;  1STZ A;  5DV5 A;  2FMY A;  1Z6T A;  4UHT A;  5FD5 A;  2H6C A;  3H3Z A;  5JVT A;  2BBY A;  1V4R A;  4M6Y A;  1DUX C;  5F6F A;  3F8B A;  4F7Z A;  4WXH A;  2OQR A;  5DUI A;  4MTE A;  4A5N A;  3EYY A;  1FOK A;  2G7H A;  2EV6 A;  4PGG A;  2WC2 A;  5CLS A;  1XGM A;  3KCC A;  3J80 K;  2VBW A;  4XRF A;  5BOX A;  2FU4 A;  2FEZ A;  4AWX B;  1QO0 D;  3I59 B;  5FFZ A;  1SMY F;  5K5Q A;  2XVC A;  3HRM A;  5CVR A;  3WTS C;  2QYO A;  4ESF A;  3V8J A;  2STT A;  1Z7U A;  1J59 A;  3QP6 A;  2DW4 A;  3FXQ A;  4LK1 F;  4HV5 A;  1FYM A;  5HLH A;  2EK5 A;  4R79 A;  4AIK A;  2MA3 A;  3KP5 A;  5H6Q A;  3BWG A;  3HSE A;  3WU0 A;  5HS8 A;  4HW0 A;  2M8E A;  3O2P E;  4HYE A;  2P6S A;  1SD5 A;  1H9G A;  3BJA A;  2E7X A;  2IJL A;  4QWQ A;  2RKH A;  3LA3 A;  2Y0M A;  2YPR A;  1RUO A;  3TQN A;  1ON2 A;  3VOD A;  1IAW A;  4FT8 A;  1XDS A;  1CGP A;  5F1R A;  2XKP A;  2QBY B;  3I58 A;  1S6L A;  2DPD A;  4A12 A;  3TDU C;  1U8R A;  1O57 A;  1H9T A;  2K02 A;  3BPV A;  3CO7 C;  1MKM A;  2P8T A;  2NS0 A;  1FT9 A;  1LNW A;  1XGO A;  1ZYR F;  1OKR A;  4NQW A;  4I0A A;  4UXN A;  3I53 A;  4HLY A;  1W7P B;  1G3S A;  4LB5 A;  4LFU A;  1SD4 A;  1CF7 B;  3LA7 A;  1XSX A;  2FA5 A;  1MDM A;  3L00 A;  1LB2 A;  1TNS A;  3HTU A;  1RIO H;  4OMY A;  1HKT A;  1P92 A;  2ESN A;  4EM0 B;  1GVJ A;  2ZKZ A;  2ZNZ A;  4Q48 A;  2DPU A;  2ZNY A;  3G73 A;  1K79 A;  2OZU A;  2VBX A;  2HYF A;  5LBQ A;  3J80 Z;  3ZQ7 A;  2HWV A;  1J9I A;  4L9J A;  1G3T A;  5FFX A;  4CXF A;  4AIJ A;  5K5R A;  2V1U A;  3RYR A;  2DT5 A;  3TO7 A;  3GZ6 A;  1MGT A;  4MQV A;  4CO8 A;  2DLL A;  1BC8 C;  2L02 A;  3P9C A;  1IRG A;  5A2Q K;  5BMZ A;  2M1B A;  4KMU X;  4BQA A;  3W6J B;  4CGZ A;  4O3M A;  2DU9 A;  3S2W A;  1HKQ A;  4L5J A;  3QU3 A;  3FM3 A;  2COM A;  4KMF A;  2XAH A;  1SFU A;  1D3Y A;  2ISY A;  4IF4 A;  4KIG A;  5CJ9 A;  5D6E A;  3EUH A;  3R0J A;  2F5D A;  5FO5 A;  4KIF A;  1UST A;  2B0L A;  3DFG A;  4ENK A;  4M74 A;  2X4H A;  5LHI A;  3D5L A;  1O3Q A;  4IVN A;  2EWN A;  1IF1 A;  5EEH A;  4CZZ A;  1I1G A;  5E20 A;  2DK5 A;  3QOP A;  2XUB A;  3KEQ A;  5ERI A;  3IHU A;  1TW3 A;  5ED4 A;  2HKX A;  4I98 B;  1IXC A;  3FMS A;  2YSR A;  3RKX A;  5ICC A;  1C0W A;  1DDN A;  1HKS A;  1DPU A;  1HW5 A;  3IRQ A;  4ZYE A;  3Q9S A;  1KGS A;  1V3F A;  2PMU A;  3KP6 A;  2JPB A;  2XAS A;  1XB4 A;  4Y15 A;  3ABU A;  3ABT A;  4GYG A;  1S7O A;  2FQ3 A;  2R7F A;  1FY7 A;  3WTT C;  4DNC A;  4UV9 A;  2JRT A;  1BM9 A;  3F72 A;  5ILV A;  1TQP A;  2FBH A;  2LF8 A;  3RTR A;  3GXO A;  4MQ9 F;  3KZZ A;  4KDP A;  5DD4 A;  5AON A;  2HS5 A;  2FBI A;  3J7A O;  4U88 A;  3HRT A;  1Q1H A;  4I02 A;  3TKY A;  2W85 A;  4A0Y A;  4PDK A;  2VOP A;  3C18 A;  3FF5 A;  4HA8 A;  5D5W B;  4HDU A;  4JQF A;  1ZGJ A;  4HV6 A;  2CW0 F;  5CVU A;  4HLX A;  2D1H A;  3ZMD A;  2TDX A;  4D0P A;  3R61 A;  3WTW C;  3K1M A;  3M7G A;  3SZP A;  4BAY A;  2GZW A;  4EMS A;  3RPU A;  4QLC U;  4Q5S F;  4G8X A;  5EEG A;  2Q0O A;  4YFX F;  4UVC A;  4H0E A;  3EET A;  5D8L B;  1YW7 A;  4BNC A;  2V6C A;  3W6K B;  3DXJ F;  3LQQ A;  4I09 A;  3LA2 A;  1IRF A;  4M9X A;  1YLF A;  2W57 A;  1TQI A;  3V8L A;  2WWY A;  2UXN A;  1YW9 A;  4MGR A;  1K78 A;  3M8E A;  2PLY A;  2BEO A;  3PFI A;  3CUQ A;  1FPQ A;  1QBJ A;  2QQA A;  3KZY A;  1IXR C;  5IT9 Z;  2V9V A;  4GO1 A;  5DCF A;  1I6X A;  3MQ0 A;  1IXS B;  1ONV A;  3WTV C;  1TLH B;  2ZO4 A;  4HX7 A;  5D4S A;  4OIO F;  1QGP A;  2K7L A;  1RI7 A;  3ZMS A;  2V79 A;  4WWC A;  4KN7 X;  4XBF A;  2GXB A;  2ETH A;  3CTA A;  3LWF A;  1K78 B;  2HDC A;  1YG2 A;  4GXO A;  1UB9 A;  3BJO A;  1GXP A;  3WTU C;  1XMA A;  2E7W A;  4OMZ A;  2Q8K A;  5LRS A;  2A6E F;  1HW1 A;  1JGS A;  1YYV A;  1P4X A;  2K86 A;  2ZBK A;  1BOA A;  4ETS A;  2DI3 A;  2KRF A;  2CYY A;  2PMH A;  1MDM B;  4ZZD A;  1JXS A;  2OA4 A;  3DV8 A;  5J8F A;  4XSZ F;  5DCM A;  1R1U A;  4A5M A;  4EJO A;  4ESJ A;  1OYY A;  2O0Y A;  5DEQ A;  5LGT A;  5JHU A;  2H94 A;  2RV8 A;  4L9T A;  2DBB A;  2GA2 A;  1FYL A;  2EFP A;  4CIC A;  3BOQ A;  2M30 A;  1YW8 A;  2K4J A;  3HIF A;  2CFX A;  4Q47 A;  4ZYG A;  4A0Z A;  2EA4 A;  3U2R A;  1Z91 A;  2P5K A;  1G6N A;  3ULQ B;  5D8K B;  3KET A;  2JZY A;  3RPQ A;  3I64 A;  3OOP A;  1ZRC A;  2ADU A;  4R8H A;  4TV7 A;  1B59 A;  1SD6 A;  1FBS A;  2KKO A;  2Q2E A;  1AOY A;  4AIH A;  2EFQ A;  2GWR A;  1BN5 A;  3F23 A;  4RGX A;  1MZB A;  4EJT A;  3GO5 A;  5HVQ C;  3GF2 A;  2XAJ A;  4P5O A;  3IKT A;  5AIP A;  4M9S A;  2VOO A;  3MWM A;  2ZXJ A;  5IT3 A;  3BZ6 A;  2PEX A;  1P4A A;  3PQK A;  1USS A;  1SAX A;  2ELH A;  2ZME B;  3SHF A;  3N97 A;  4OIN F;  2DQR A;  3ZN0 A;  3CUO A;  5TRD A;  2PFB A;  3LST A;  4IRH A;  2YU3 A;  2VE9 A;  5HLI A;  4A0X A;  4LJZ F;  2A3S A;  1ZLK A;  3DEU A;  1XGN A;  3QPH A;  4YG2 F;  2KIU A;  1FBQ A;  3HRU A;  1T38 A;  3FZV A;  1BI1 A;  1P2F A;  2DFI A;  3REO A;  4MEY F;  4YFN F;  1BBY A;  3IWF A;  5E1W A;  2LKP A;  1TTY A;  1LEB A;  5HDG A;  1YS6 A;  2LDU A;  1W5T A;  4G9Y A;  2RGV A;  3E97 A;  2HKO A;  1ZHF A;  2CGP A;  4P55 A;  5F64 A;  4KN4 X;  4O5V A;  1U5T B;  1IN6 A;  5HLG A;  3ROU A;  3GX4 X;  5DUK A;  5HS9 A;  2BE5 F;  2VE8 A;  3VFZ A;  4A6D A;  2WTE A;  4LLG F;  2A69 F;  3GVA A;  1QZZ A;  2C6Y A;  5E18 F;  2D2W A;  4L0Y B;  2XAG A;  2UZK A;  1Y0U A;  2NNN A;  4HF0 A;  2VT3 A;  1ZG1 A;  2XAQ A;  1YIO A;  2IPQ X;  4ZYH A;  4M9Z A;  3N4M A;  1B6A A;  3HHH A;  2IA1 A;  3QPT A;  4ZH4 F;  4BHC A;  4KNY A;  5HOO A;  5LRR A;  3B73 A;  3GYH X;  4U0V A;  5D5U B;  4L5I A;  2Z3Y A;  3R0A A;  4RAY A;  1MD0 A;  1DPR A;  3LAJ A;  4GYI A;  2HZT A;  2MH2 A;  4I7H A;  4IJA A;  1Z1D A;  2FNP A;  4U0W A;  3H92 A;  2M5W A;  1EH6 A;  3Q9V A;  2HQR A;  5FLX Z;  2QQ9 A;  3F6V A;  3WTZ A;  4U7B A;  5TJJ A;  3JTH A;  3TOB A;  2GQQ A;  5L3C A;  1ZRE A;  1XDU A;  5ICG A;  1UHM A;  3IC7 A;  2STW A;  4KFC A;  3WTX C;  1CF7 A;  2EFN A;  2HR3 A;  2EB7 A;  1O7F A;  5E1X A;  4GCV A;  3E6B A;  2GAU A;  3QAH A;  2JSC A;  3Q5F A;  4K2E A;  5CVJ A;  5DD8 A;  3BDD A;  2DQL A;  1K7A A;  1FBU A;  3GW2 A;  3HHG A;  4HBL A;  2M87 A;  2PBI A;  4XLP F;  2FBK A;  1T6S A;  3KP7 A;  3QP5 A;  1GXQ A;  4KYW A;  3V7C A;  1UHW A;  2XRN A;  3FMQ A;  2CSO A;  4HAM A;  2PI0 A;  3M1E A;  3K0L A;  4P9F A;  2FSW A;  1R5H A;  2L4M A;  4MEX F;  1PUE E;  3V4G A;  3MZH A;  3ELK A;  3SZT A;  2FE3 A;  1WQ2 A;  4L9N A;  1ZRF A;  3E6M A;  4I2O A;  5AIQ A;  3GUD A;  4LGW A;  3BPX A;  3WG9 A;  1PP8 F;  3GFL A;  3B02 A;  1F4K A;  4G7H F;  2IVM A;  1KU7 A;  2R3S A;  5ILU A;  1HW2 A;  3G3Z A;  3M8F A;  1R23 A;  2ACJ A;  3FX3 A;  1PDN C;  1R00 A;  1XCV A;  1I1S A;  2QEN A;  5KK1 A;  3VOE A;  4G6Q A;  3JAM Z;  2YX7 A;  1TQM A;  4PZJ A;  1EH7 A;  2OZ6 A;  2F5F A;  2IA0 A;  4B09 A;  2QUF A;  2VXZ A;  4OOI A;  3O6B B;  1IN8 A;  1O3T A;  5L3F A;  1XD7 A;  3WGG A;  5ICF A;  1LDD A;  3T8T A;  1FNN A;  3CUQ B;  4MTD A;  5FB2 A;  2FF4 A;  5CVV A;  4AVP A;  3O3K A;  1BC7 C;  2NYX A;  4HF1 A;  3CLO A;  1SD7 A;  3MFK A;  1BIB A;  4NB5 A;  5L3D A;  5HS7 A;  1RUN A;  2BGC A;  4KIC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...