2MBFA

Solution structure of the forkhead domain of brugia malayi daf-16a
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
101
structure length
101
Chain Sequence
NPWGAESYSDLIAKALKSTFDGRMRLNEIYNWFASNVPYFGNRTSQEQSAGWKNSIRHNLSLHSRFMRIQNEGAGKSSWWVINPDAKPGRNPRRQRSATLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The solution structure of the forkhead box-O DNA binding domain of Brugia malayi DAF-16a.
pubmed doi rcsb
source organism Brugia malayi
molecule tags Transcription
molecule keywords Fork head domain containing protein
total genus 24
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-07-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2mbfA01
3T8RA 4H0EA 1G4DA 4OIPF 5H6RA 2ZCWA 3VOEA 2VT3A 5CVIA 4RB0A 2NRAC 1HSJA 2OZUA 1XCVA 3OV8A 4B8XA 2O03A 2W85A 3TOBA 5J8CA 5IT9Z 1R1VA 4R79A 3FMSA 3CUQB 5HDGA 3P9KA 4BQAA 2JPCA 5FFZA 4YIFA 1XDSA 1R1UA 3KP5A 5K5RA 5ILSA 4BHBA 3E3VA 4LLLA 2XIGA 4PDKA 2DBBA 2V1UA 2O8XA 3L2CA 1KGSA 1U6GA 1F5TA 2GQQA 1FLIA 4KFCA 1V4RA 4ZYHA 4PCQA 3R0JA 4HW0A 2WC2A 3HRMA 4P55A 3F8FA 3M8FA 1R00A 4AD9A 2FNPA 3F8CA 1ZN2A 4EVIA 2R7FA 3HYIA 5L3EA 2E7WA 5AONA 2COMA 2OU2A 4S05A 4HQEA 4RGXA 5DD4A 4ESJA 3CTAA 1FYKA 1SMTA 5HDKA 5JI6A 4K2EA 4Y13A 1DP7P 1XSXA 1KU7A 2ETHA 2GWRA 3ECOA 4DQ2A 4EMSA 3WTZA 4IJAA 1SD5A 3BY6A 3BZ6A 4FX0A 4U0WA 3GLXA 3K2ZA 1K78B 3GEZA 1YTYA 5DCMA 1R23A 1R5HA 3F8MA 2GXGA 5FO5A 2CSOA 3REOA 2KJCA 2MH2A 1LVAA 1IZ1A 4ETSA 3K1PA 3LQQA 3RTRA 2ZBKA 3ZMUA 1JGSA 1S6LA 4L9NA 2DU9A 2H09A 3ZQ7A 4L5JA 2Z9OA 3TKYA 3W6KB 1ZREA 2Y48A 2GXBA 2FXAA 1T6SA 1UHWA 4L5IA 2EV0A 4A12A 4LG0A 2A69F 4KUMA 1NHAA 3T0YA 4BYYA 1U5TC 2DO7A 3QP6A 3NEUA 1BI3A 1XCBA 4OIRF 2L4MA 3BROA 2P6SA 1XGSA 1XGNA 1YS7A 3R6SA 4KMUX 2M45A 5LEJA 2QM3A 1ON2A 4WWCA 4L9TA 2WV0A 5BPDA 1HW2A 4L0YB 3FWEA 2M87A 1T2KA 1R5GA 5A2QK 3K1NA 2ISZA 3CJNA 2QENA 5K1YA 3AAFA 4ENJA 1YO5C 5FFXA 3JSOA 1FX7A 2AS5F 1K7AA 1OMIA 1Z7UA 2STTA 3L9FA 4IVNA 3DFGA 2IT0A 4LMYA 1H0MA 1USTA 1ZGJA 2B0LA 1H9GA 2KIMA 3L00A 2JPBA 1R58A 3V7RA 3W6JB 1JE8A 2XV4S 1K79A 1E2XA 4UV9A 3IC7A 1XDUA 1BI0A 2HR3A 2GIVA 3HUGA 1BC7C 3MZHA 3GFMA 2YPRA 4HOBA 4HF2A 3J7AO 4HA8A 4AIKA 3BDDA 1O7FA 2FMYA 1HXDA 2DAOA 2EWNA 2RKHA 3PQJA 4HX7A 5DV5A 4OIOF 1OPCA 1J2XA 4O6JA 1BJAA 3ERED 1IN6A 3C18A 5DD8A 1FY7A 4UVBA 4LB6B 4HYEA 3RPUA 4EQQA 2VBZA 4M71A 3SZTA 4R8HA 3F72A 2MH9A 1FOKA 2W57A 1YLFA 3CDHA 5CVUA 2MD5A 2KKOA 4I01A 4HBLA 3FXUA 4NQWA 3H92A 4G9YA 2DI3A 1H9TA 2VOPA 3QAHA 2G9WA 2YX4A 4Q5SF 2IVMA 2LF7A 3WU0A 1G3YA 2W25A 3ELKA 2W84A 1IRFA 2XAJA 5HOOA 1O3TA 3RKWA 4LLGF 1STZA 1HKSA 4P9FA 1OKRA 2KIUA 2HTSA 4G94A 3HOSA 3I4PA 1EH6A 3JAMZ 3Q9VA 3RPQA 2X0LA 5JVTA 5E18F 2QLZA 1D5VA 4Y17A 5EEHA 2OD5A 2NNYA 4LJZF 2OBPA 3KP2A 2OQGA 2V9VA 3FMRA 4LK1F 2QWWA 3F23A 4ZZDA 1F9NA 2YX7A 4EV0A 2NYXA 4IRIA 3E6DA 1D8KA 2RN7A 1FSEA 1TLHB 1ZGAA 2EA2A 4MGRA 1PP7U 1YIOA 4O5VA 4S04A 4IXAA 3ROUA 3ZMDA 5K5OA 5ICCA 1KU9A 5HDNA 4MNUA 3FHZA 2EJRA 1IRGA 1Q1HA 4JQFA 3KCCA 4RB1A 2Z33A 1FT9A 4KA4A 4U7BA 2V1XA 4A0YA 4HF1A 3V4GA 2HWVA 4L9VA 5HLIA 2P7VB 2P6TA 3HIFA 2CQKA 2XAHA 4ENNA 2V1DA 2O0YA 4LG0B 1LDJA 3ZMTA 4HQMA 5LLQA 5ERIA 1P2FA 4P5OA 2K86A 1CF7B 2DTRA 2JZYA 4ZZLA 1ZG3A 4Q48A 1KYZA 2M1BA 2PEXA 2VBWA 4P96A 2IP2A 3GXOA 3Q9SA 3RDIA 1MD0A 3HRUA 5LHGA 1IN5A 2FRHA 2HKOA 1O7LA 4ASNA 1MKMA 5JFRA 2K4JA 4M73A 4B09A 5E8IA 1KQ9A 3DQVC 2ZNZA 3ZMVA 2EFPA 4U0VA 1L3LA 2RGVA 4RGRA 2RV8A 2MA3A 3LA2A 3BOQA 4G7OF 1J7KA 1FP2A 1W7PB 2FF4A 5D4SA 2PG4A 4GCVA 5E17F 1MJAA 3HOTA 5D8KB 2M8EA 4GYGA 3WTXC 1XN7A 3K9TA 5H6QA 4A6DA 1BIBA 1U8RA 5LRRA 3K0LA 2FBIA 5TJJA 3KEQA 1W7PD 2CYYA 3WTYC 5FLXZ 3CLOA 1XD7A 2R3SA 2Z5UA 1HKTA 1IXSB 1FZPB 3I5UA 2CWEA 1P4AA 3V8KA 3EUHA 4BAYA 3MEXA 3WE2A 1F1ZA 2K4BA 1IXRC 4L9JA 1B9MA 2H94A 4HZFA 1ZYRF 2ZXJA 1I5ZA 2VBYA 2BGCA 1FBUA 4I98B 4JBAA 1KQ8A 1UFMA 4D0PA 5IT3A 3TQNA 3E5UA 3R60A 2GZWA 4ZYEA 1SD6A 2YR2A 3CO7C 2VONA 2Q2EA 3HHGA 3DEUA 3WODF 2XAQA 3HRTA 3R4KA 3MFKA 2HFHA 2ESNA 3E97A 4YFKF 2KRFA 3RJPA 2DPUA 5D5UB 2IW5A 4XSZF 4CO8A 1BI1A 5FGMA 2W24A 2VBXA 5D8LB 4ESFA 1BI2A 2VE9A 2XKPA 4RB2C 3MQ0A 3C3WA 4YFXF 3U2RA 2QBYA 2JSCA 5HVQC 2A3SA 3HSFA 4HV6A 4M9SA 3L7WA 1U78A 1WKMA 3E5QA 5DYMA 2PMHA 3KP6A 4WXHA 3WG9A 2L54A 1LEAA 5FB2A 3SXYA 2ZFWA 1ZG1A 1FYLA 4HF0A 3WE3A 3Q5FA 1T0FA 3HRSA 3F6VA 2PI0A 2F2EA 2L3DA 2XROA 4G7ZF 2DPDA 5L3BA 1FBQA 4UNOA 2VN2A 1IN7A 2LKPA 3P9IA 2GA2A 3VB2A 2MC3A 2RQPA 2HYFA 4IHSA 3LAJA 1V3FA 3ECHA 3WTVC 1FSHA 2PMUA 1T39A 2A6HF 1AWCA 3WGIA 3QRFF 5CVRA 3IRRA 2JT1A 3B73A 5AIPA 4RGSA 2JRTA 1GHCA 4HX8A 4LFUA 2FBKA 1HW1A 4WCGA 1ZRDA 4N9HA 4TV7A 1YW7A 2ACJA 2ZMEA 1QO0D 1P6RA 3G73A 1C0WA 3ZN1A 1F4KA 1PDNC 5FLXK 2IPQX 1S29A 2FU4A 4A0ZA 2A6EF 2G7HA 1B1BA 1VTNC 2EFQA 5J8FA 4BH9A 1B6AA 3C1DA 3I59A 4EM1A 2A5YB 2LDUA 3GF2A 1D3YA 4WXCA 3KLOA 4OU0A 3KP7A 2BBYA 3JTGA 3E5XA 5CVJA 4PZJA 5ILUA 1JHFA 3O2PE 1IN4A 1K6OA 2R7DA 1REPC 1W4MA 4R1HA 1QBJA 3U1DA 1OYIA 5J6XA 1WWXA 2KIFA 1T98A 2E1NA 4KT5C 1RUNA 3CUQA 5TRDA 4NHJA 3GZ6A 1RIOH 3IRQA 3VODA 4CZZA 4KIGA 3CO6C 3V7CA 1Z1DA 4XSXF 3F3XA 1I1SA 4RAZA 3I53A 3K1MA 3DKWA 4EM0B 4EJTA 1I6XA 2QQBA 5E8GA 1LDDA 1I27A 4PGGA 5HLHA 4CXFA 3QU6A 3IL2A 1IXCA 4JK1X 2EV6A 1SFXA 4G6QA 2ZO4A 2P5KA 2X4HA 3HSRA 4KICA 1MZBA 2EFNA 2A61A 4LGWA 5D5WB 1KYWA 1FBSA 2V79A 4CICA 4I0BA 1J0RA 3RYPA 5E20A 4I7HA 2GAUA 3GW2A 1TNTA 2L4AA 2H6CA 1YW8A 2CW0F 4IPAA 2DW4A 2DQLA 3ABUA 1GXQA 2ESHA 2EFOA 3RYRA 1R7JA 3ZN0A 2WWYA 2YSRA 3T1BA 3R0AA 1LJ9A 3LSTA 4G8XA 2HQNA 4I02A 1TW2A 2P7CB 4Q4ZF 2H27A 4KN7X 4RS8A 2M30A 3GFLA 2EB7A 1KA8A 2VC0A 1FC3A 3M1EA 1YFHA 1EV7A 3SHFA 4M72A 3HSEA 5LHHA 4AVPA 3FM5A 4F7ZA 2XASA 4ZYDA 4KN4X 2F5FA 1WI9A 1B4AA 3BPVA 3PQKA 2F5EA 2J5PA 3N4MA 4N9IA 4M9ZA 5CJ9A 3DPLC 4MQVA 3V7SA 5E1XA 3F22A 4EGZA 2PLYA 4UHTA 2XHKA 1XGMA 1RNLA 1CGPA 4ENKA 1L0OC 1P4XA 2OZ6A 5BOXA 2E1CA 1PP8F 3ML6A 5CLSA 4HDUA 1MDMA 3EYYA 3V8JA 4UXNA 2MLGA 3RIRA 4Q47A 2OAZA 3VFZA 1FPQA 1SD7A 3EDPA 3QOPA 2QUFA 4A5NA 2HGCA 3J81Z 1ODDA 1O3SA 2CG4A 3C7JA 2BE5F 1SMYF 2EK5A 5HLGA 3ZPLA 5D5VB 4GYIA 5ICEA 3LA3A 1OR7A 2O6GE 4KNYA 3E6BA 4EJUA 1OYWA 1YYVA 3JSPA 1CF7A 2KJBA 1TQMA 1DDNA 3O3KA 2K7LA 2EFWA 4QLCU 4MTDA 1UHMA 4ZYGA 1R22A 3JTHA 4HLYA 2P5LC 1W5TA 4XBFA 3KE2A 3WTTC 4N0BA 4XLNF 4AIHA 5KK1A 1FYMA 1T38A 3TO9A 5DEQA 3DPTA 1GXPA 3S2WA 3M8EA 4GO1A 4YIIA 2FEZA 1MGTA 3B02A 1GVJA 4HAMA 3KZZA 2ISYA 4QWQA 2HOEA 2Q8KA 3GYHX 3TO7A 1W7PA 4XRFA 2XUBA 5LGUA 2HQRA 2HZTA 1OYYA 3MWMA 3G3ZA 4RB3C 4U0YA 2L01A 1FNNA 2PN6A 3TO6A 3WTWC 3WTSC 3DP7A 1P92A 3E6CC 4HV5A 3ZP5A 4CHUA 4HX4A 3KLNA 1ZHFA 4IHTA 3GO5A 5D6FA 4WXDA 2ZKZA 1LDKB 4LD5A 5LHIA 3BWGA 3QP5A 2UXNA 2QQAA 1HSTA 1ZARA 4UVCA 4A0XA 5H20A 2Y75A 4NB5A 1E17A 1QNTA 3MCZA 3VEPA 2ELHA 3GUDA 1LNWA 1B59A 2EA4A 3SZPA 3MAJA 2GA1A 2TDXA 1Z91A 4E70A 4KIBA 4M74A 4G7HF 1A04A 1Z05A 1J9IA 3J81K 5D6EA 4BXUA 5L3GA 1W5SA 4MQ9F 4U88A 2D1HA 4EM2A 4EGYA 4HDVA 4CYDA 4OINF 3OOPA 1XB4A 2OQRA 5LBQA 1O3RA 3QPTA 2F5DA 3TOAA 3IWZA 3WGGA 3I64A 2JTVA 3SQNA 1ONVA 2AXLA 2VOOA 5LGTA 3F6OA 1YG2A 1TTYA 5F1RA 2PQ8A 1RZ4A 1AOYA 3H3ZA 5DUKA 3LFKA 2BV6A 3ISPA 3GVAA 3HTSB 4AWXB 1KQ0A 2ZNYA 1U5TA 2DLLA 1LB2A 3COAC 2MBFA 5E1ZB 1QQIA 3IKVA 4M6XA 2Z99A 5IT9K 1BBYA 3O6BB 1DUXC 4BHCA 2FA5A 3R61A 4OMYA 1EH8A 2CGPA 2HTJA 1HW5A 1BIAA 1J59A 1EH7A 2V6CA 3ZMSA 1FWZA 2PJPA 4G6DA 1XMAA 1IUYA 2XKOA 4IRGA 4EJOA 2H6BA 1I1GA 1U5TB 2EV5A 5ED4A 3GFJA 3GX4X 5ILVA 4PGHA 2UXXA 2VT2A 3N97A 1TW3A 2RDPA 2P8TA 5KVRA 1P4WA 2YU3A 1QPMA 2XGXA 1DPUA 3RI4A 3WU1B 2VE8A 1FP1D 1S7AA 3DV8A 3KFWX 3P7NA 1HQCA 1MJ9A 3RKXA 2E7XA 1PUEE 4UV8A 1G6NA 2XAFA 2PFBA 4WF2A 2STWA 3T8TA 4A2UA 4LLNA 4KIFA 4A5MA 4WK8F 2A07F 1U3EM 3GWZA 3L09A 5EEGA 2FMLA 4DNCA 3TDUC 4Y15A 2HEOA 1O57A 1Z9CA 5DCMB 3FXQA 2QYOA 1X3UA 4ESBA 4KYWA 3I58A 5E1WA 2NNNA 2DK8A 1IN8A 1RUOA 1ZLKA 1XSVA 4MEXF 1TBXA 3D0SA 3HTUA 3EYIA 4A6EA 1K78A 2VXZA 2BYVE 5D5XB 3LQRA 2VC1A 1LEBA 2D2WA 5BQTA 1BM9A 2D1VA 1SAXA 2LSOA 3FM3A 1J75A 4RGUA 1ON1A 2VODA 1KU2A 3BJOA 1ZAOA 1SFUA 2XRNA 1HKQA 2QZ8A 4RAYA 3SFZA 1BC8C 1IF1A 1G3TA 3KETA 3KP3A 2FOKA 5L3DA 2QVOA 5HS7A 5JR3A 5LGNA 1TQPA 1S7OA 4UVAA 3QU3A 3LWFA 1TQIA 2ZMEB 3EQLF 1Z6TA 4I2OA 3P9CA 5AIQA 4BNCA 1JHHA 3J80K 3DXJF 3FF5A 4I0AA 1ZG5A 4M6YA 2K02A 5ICGA 4EJVA 2UZKA 2FBHA 1YS6A 2FQ3A 5HS9A 3GZ5A 1WQ2A 3ABTA 3KEOA 4YFNF 4XLPF 3IWFA 4AIJA 5F64A 2HS5A 4LK0F 1JXSA 2Q0OA 3JW4A 4BHPA 1R1TA 1RI7A 1XMKA 1ZRFA 3H3UA 2RVCA 1WSUA 1Z6RA 2FNAA 5D4RA 2OA4A 4FT8A 4ZH4F 5ICFA 3K69A 3KZYA 3TDZC 1XSDA 3FXRA 2RC4A 2Y0MA 4IRHA 1J5YA 2O61A 2HDCA 5DCFA 3KP4A 1TNSA 3DF8A 2FSWA 2WTEA 3BP8A 2XAGA 3F8NA 1USSA 1QGPA 4CDGA 3BJAA 3FX3A 4IF4A 3I54A 1SD4A 2G7UA 1B9NA 3GFIA 5DUIA 2DFIA 3E6MA 2CO5A 3ULQB 3BJ6A 1XGOA 3D5LA 4FX4A 2XVCA 4Z2YA 2ADUA 2P5VA 3M9AA 4M9XA 2DQRA 1ZLJA 2IRFG 5JHUA 2MLKA 3JAMK 3CUQC 3J80Z 1KU3A 5FD5A 2BEOA 2P4WA 4OOIA 3T5XA 2M5WA 3EETA 5L3FA 5CVVA 5HS8A 2QBYB 2HKXA 2CFXA 1IAWA 1BOAA 6PAXA 4YG2F 1MDMB 2DK5A 3BPXA 5DDGA 4UUVA 4KMFA 3CUOA 3HHHA 1HBXG 3TGNA 3I0TA 4GGGA 1UCRA 5L3CA 3IKTA 1ZRCA 2RNJA 4L0ZB 1QZZA 5BS6A 3RKYA 1ULYA 3ZMZA 3I59B 4O3MA 1G3SA 1O3QA 3MZYA 3NQOA 4MTEA 5FD6A 4OMZA 2LF8A 3FZVA 4EJWA 2NAZA 2IA1A 2IA0A 4GXOA 4WX9A 4U7DA 3V8LA 1QZYA 4LB5A 3FMQA 1G3WA 1BN5A 3U9GA 4L18B 3LA7A 5BPIA 3QPHA 2O3FA 5CYVA 2K27A 1WRJA 1R36A 4KDPA 1Y0UA 4CGZA 4HLXA 3F8BA 4ENMA 3M7GA 4MEYF 2DT5A 1D8JA 2IJLA 2D45A 4MHGA 2L02A 3WGHA 2Z3YA 5K5QA 3WTUC 5LEKA 2FE3A 3LAPA 1S3JA 4P9UA 1DPRA 1IW7F 2A68F 4OIQF 3NRVA 1YQAA 1SFEA 2J5OA 1UB9A 5A2QZ 1ZH5A 4FHTA 2UWMA 1LQ1A 3IHUA 5F6FA 2PBIA 2IA2A 1MJBA 5BMZA 3F21A 4I09A 2HYGD 4ON0A 1YW9A 3PFIA 2LNBA 1U2WA 5LRSA 3I71A 2ZJ2A 2C6YA 1S8NA 2QQ9A 2F5CA 2NS0A
chains in the Genus database with same CATH superfamily
1YITI 3T8RA 2XDVA 3Q0UA 4QIWN 2NVYJ 2MFZA 3CCYA 1OCCH 4H0EA 1G4DA 4OIPF 5H6RA 2ZCWA 3VOEA 5B3SH 2VT3A 5CVIA 3VDXA 4RB0A 2NRAC 1HSJA 3DEWA 4JX5A 2L7KA 2A05A 2JA5J 4V19K 3BCAA 1JTYA 2OZUA 3CZ6A 4FTHA 4CCKA 1XCVA 3DPUA 3OV8A 4B8XA 2HDWA 3K4CA 2O03A 1ENHA 1W0TA 2W85A 3TOBA 2KDZA 5J8CA 5IT9Z 1R1VA 4R79A 3FXMA 3FMSA 3CUQB 1APLC 1FMVA 2HDDA 3OYJA 5HDGA 3P9KA 4BQAA 1GLNA 3WU2C 2JPCA 5FFZA 5J4YA 4B48A 2LREA 4KITB 4YIFA 1XDSA 2LR8A 1Z3YA 3IP4B 3HDDA 2CW8A 1R1UA 3KP5A 2Y0SN 4ITVA 5K5RA 3CQZJ 5ILSA 4RM3A 1M1EB 5FKMA 4BHBA 3UNGC 3K4KA 4E7LA 4F92B 3AG2H 3E3VA 1X4PA 3CDIA 4LLLA 2XIGA 2A6TA 2M8GX 1XG1A 3TW7A 4DIQA 3OYGA 3QYBA 4PDKA 2HPMA 4A3LJ 2F4OB 2V4JC 4UB8C 2IS4A 2DBBA 2V1UA 2O8XA 2V6EA 2JA8J 2R7XA 3L2CA 1KGSA 1U6GA 1F5TA 2GQQA 1FLIA 3AFHA 4KFCA 4M3DA 1WJDA 1V4RA 4JP0A 2L2OA 4ZYHA 4E7JA 4PCQA 3R0JA 3LL7A 4HW0A 2GOMA 2WC2A 3HRMA 2VKEA 3H5AA 1U0JA 5EG0B 4P55A 2ECCA 3F8FA 5CQEA 3M8FA 1R00A 4AD9A 2FNPA 3F8CA 1Y8QB 1ZN2A 1W36D 1WH5A 4EVIA 3OYNA 1G8XA 1QHHD 1MIJA 1HDDC 2R7FA 3HYIA 4IO9F 3WHBA 1SAUA 5L3EA 3FXLA 2E7WA 5AONA 2COMA 2OU2A 2VQGA 4S05A 4HQEA 2K5CA 4RGXA 5DD4A 4ESJA 5GAHJ 3CTAA 3OS2A 2JJ7A 1FYKA 1HOMA 1SMTA 5HDKA 1S9HA 1Y6IA 5JI6A 4K2EA 3CCMI 4Y13A 2LKSA 4I99C 1DP7P 1XSXA 1ZTRA 4PJJA 1RKTA 3HPGA 1KU7A 2ETHA 2GWRA 3ECOA 4DQ2A 4EMSA 4A69C 3WTZA 4IJAA 3CMMA 1VF9A 1SD5A 3KX2A 3S16J 1K83J 3BY6A 3BZ6A 2Y9YA 4FX0A 4U0WA 2IEKA 3I55I 4Y52J 3LSKA 1V5FA 2Y30A 2O8KA 1JTXA 2Y69H 3GLXA 4HPQA 3K2ZA 1K78B 3IH4A 3GEZA 2UV1A 1JJ6C 1YTYA 5DCMA 3HOWJ 1R23A 1R5HA 3F8MA 3PL8A 2X6YA 3NAUA 2GXGA 5B5EC 5FO5A 4RBOA 1X1CA 2CSOA 2K9QA 2OV7A 1PUFB 3REOA 2EIKH 2KJCA 2MH2A 3FXJA 5FKKA 2WAQN 1VQMI 4J19A 1YI2I 4CCNA 1LVAA 1IZ1A 2ZXIA 4PUSA 3VYRB 1X2NA 2AQFA 1UAAA 4ETSA 2IGOA 3K1PA 3LQQA 3RTRA 2ZBKA 3ZMUA 1JGSA 1S6LA 4L9NA 1VFCA 2DU9A 2H09A 2FOWA 3ZQ7A 4L5JA 1WJFA 4DJAA 2Z9OA 3G1MA 3TKYA 3DBLB 3KYDB 2B9SA 3W6KB 1ZREA 2Y48A 2GXBA 3VSLA 1U8BA 3H9QA 3FK7A 2FXAA 2KQRA 1T6SA 1UHWA 4L5IA 2V9KA 1MMNA 2EV0A 4A12A 2COBA 4LG0A 4Y4RA 2A69F 4KUMA 5IYDJ 1NHAA 3T0YA 4BYYA 3L1PA 1KONA 1XS9A 1U5TC 2DO7A 1MH4A 3QP6A 2NVXJ 3NEUA 1BI3A 1B72B 5KNLA 1XCBA 3KYCB 4IX7A 4E4HA 4OIRF 5IP6A 2L4MA 3BROA 2P6SA 1XGSA 1VQLI 1JI8A 1XGNA 1YS7A 4C2MJ 2LG4A 2XGCA 3R6SA 2L9NA 4KMUX 2M45A 5LEJA 3BG3A 2QM3A 1ON2A 4WWCA 1ETYA 3K4JA 4L9TA 2I10A 3CJTB 2WV0A 5BPDA 1HW2A 4ANJA 4L0YB 1GV5A 3SEQA 2KISA 3ZQGA 3DTEA 2DYSH 4E7IA 3FWEA 2PMZA 4ZDPA 2M87A 1T2KA 5K7ZA 2H8WA 3HOUJ 1R5GA 5A2QK 3K1NA 2ISZA 3CJNA 2QENA 5K1YA 3AAFA 4ENJA 1YO5C 1MNDA 5FFXA 3JSOA 1Y39A 1FX7A 2AS5F 2BXZA 4PJLA 4IZZA 3HBLA 1YJ9I 1K7AA 1OMIA 4DZPA 4J01A 1Z7UA 2HOSA 4YEJA 2STTA 3L9FA 4IVNA 3DFGA 2IT0A 1TZLA 3EUKL 1YE9A 1USTA 2QF7A 4LMYA 1H0MA 1ZGJA 2B0LA 1H9GA 2KIMA 3K10A 3L00A 2JPBA 1R58A 3V7RA 4UB6C 1FEXA 1TC3C 3W6JB 1JE8A 2XV4S 2EZKA 1K79A 3A03A 2CUFA 2R4GA 2VJ5A 1MBEA 1E2XA 4UV9A 3IC7A 5F0CA 1XDUA 2X6XA 1BI0A 2HR3A 1X3ZB 2GIVA 3HUGA 1BC7C 2P0WA 3MZHA 3GFMA 2YPRA 3MZ8A 1Z0XA 4HOBA 4D5CA 4CCMA 4HF2A 4LIUA 2EZHA 4HA8A 3J7AO 4AIKA 1IV8A 5EDNA 3BDDA 3CC7I 1O7FA 3FKJA 2FMYA 3MKWB 1HXDA 2DAOA 3FXKA 4XRSG 3P5JA 4B47A 2EWNA 2RKHA 3PQJA 4HX7A 3BTIA 5DV5A 4OIOF 1OPCA 3BTCA 1J2XA 4O6JA 1BJAA 2H8RA 3ERED 1X2MA 1DU0A 5B1BH 1IN6A 3C18A 2DOFA 2K9SA 3KIOA 5DD8A 1WJAA 1FY7A 4UVBA 4HNUA 4MFEA 4HYEA 4LB6B 2E2IJ 2EILH 3RPUA 4EQQA 1N78A 2VBZA 1T0FC 1RR8C 2D5VA 1R4NB 4M71A 1QA6A 1UELB 2LOOA 3SZTA 2WV1A 4CZCA 3GTLJ 1I3AA 4R8HA 3F72A 2VJ4A 3OYCA 2IGKA 3JRAA 1ZQ3P 2MH9A 2OJED 5F04A 2W57A 1FOKA 1YLFA 3CDHA 3D1NI 5CVUA 2MD5A 3GMEA 2KKOA 2DMNA 2LVSA 3H35A 1PVEA 4I01A 4HBLA 3FXUA 3QQAA 2LBFB 1TWCJ 1HA8A 4NQWA 3ESWB 3H92A 3LSRA 2ZXWH 3GZNB 4G9YA 4AYBA 3E1SA 1T56A 2XF7A 2DA2A 1MBKA 2DI3A 3GTOJ 1UHSA 2DA6A 1H9TA 2VOPA 3OSFA 3QAHA 2G9WA 2YX4A 4Q5SF 2IVMA 1BJZA 2DCEA 2LF7A 3WU0A 2R7VA 1G3YA 2R7UA 2W25A 4MLOA 2V1NA 3ELKA 2W84A 1IRFA 4XLFA 2ZJRF 2XAJA 5HOOA 4XN0A 1O3TA 3RKWA 4LLGF 1STZA 5FLVA 1HKSA 4P9FA 1OKRA 2KIUA 4JYKA 2HTSA 4G94A 3HOSA 3I4PA 1K6YA 2L9SA 1TWAJ 1EH6A 2W00A 3JAMZ 2V9PA 3Q9VA 3RPQA 3S1MJ 2X0LA 3PIOF 3C2GA 2EZLA 5JVTA 4A3KJ 5E18F 4BE1A 2QLZA 3DCFA 3CJQB 2HOAA 3G2BA 1D5VA 4AUXA 1OCPA 1DU6A 2DT6A 4Y17A 5EEHA 2OD5A 2DA4A 2NNYA 4F93B 2O9LA 1PUEE 3DTKA 1JGGA 4LJZF 1OLTA 2OBPA 3KP2A 2OQGA 3C2BA 3CD6I 2K9MA 2V9VA 1YIJI 1WHUA 1WPKA 3FMRA 4LK1F 4HNVA 3RKQA 2QWWA 3F23A 3B6AA 5F0FA 1WJEA 4XK4A 3AG3H 4ZZDA 1IUFA 1F9NA 2YX7A 4EV0A 1AU7A 2NYXA 3VYSB 1IC8A 4IRIA 3E6DA 1A31A 1D8KA 2RN7A 1ETQA 1Q1VA 1FSEA 1TLHB 1ZGAA 2EA2A 4MGRA 4XQFA 1PP7U 1VQ6I 4W1UA 3DU5A 4XKCA 1YRNA 5M3MJ 1YIOA 4O5VA 4S04A 3DKYA 4IXAA 3ROUA 4F3QA 1LFBA 3ZMDA 3W2WA 2KT0A 1CQTA 4BQOA 2NS7A 5K5OA 1IV6A 5CKTA 4YELA 4FE7A 1KU9A 5ICCA 5HDNA 3Q0VA 4MNUA 4NUBA 2DMUA 3FHZA 2EJRA 1IRGA 1Q1HA 3PIPF 4JQFA 2HYJA 3KCCA 4RB1A 1Y8RB 2W4SA 2Z33A 1FT9A 4NC8A 4KA4A 4AC0A 1F43A 4EEFG 4U7BA 3OYEA 1NG7A 2V1XA 5LFAA 4A0YA 4HF1A 4NQWB 3V4GA 1TP4A 3TBIA 4BE0A 2OC6A 2HOTA 3KYLA 1TWGJ 1Z3XA 2HWVA 4L9VA 5HLIA 4JX6A 5B1AH 1VQ5I 4RM2A 2P7VB 2A5WA 2P6TA 3HIFA 2CQKA 4LG3A 2XAHA 4ENNA 3U21A 2V1DA 2O0YA 4LG0B 2BW3A 1LDJA 3ZMTA 4HQMA 5LLQA 1I6HJ 4YRVA 3CP2A 5ERIA 1P2FA 1X4OA 5HODA 1QZEA 3S14J 4P5OA 2K86A 2GIZA 4RLFA 4G12A 3KZIC 1CF7B 2DTRA 2M3AA 2JZYA 2M0MA 3BR0A 4ZZLA 1VZ0A 1ZG3A 3EPZA 4Q48A 1KYZA 2M1BA 1WH7A 2PEXA 2XF5A 2VBWA 4P96A 2IP2A 3GXOA 4BY1J 2ZB9A 3Q9SA 3RDIA 1MD0A 1X1DA 2JWTA 3K70D 1IJWC 3HRUA 2WB1A 4AM3A 5LHGA 1IN5A 2FRHA 4E6KG 4IOAF 2HKOA 2K9LA 1O7LA 2F4MB 1MKMA 4ASNA 4BQQA 2E60A 2VKDA 2MD0A 5JFRA 5C4JJ 2K4JA 2QA4I 4M73A 4B09A 5E8IA 1HC8A 2EH3A 1KQ9A 3DQVC 1WJBA 4IQJA 2KRCA 2ZNZA 4PJ0C 3ZMVA 3DBHB 2EFPA 4U0VA 2BW3B 1L3LA 2RGVA 1WI3A 1V5GA 2K40A 4RGRA 1MBHA 2RV8A 2MA3A 3LA2A 3BOQA 4G7OF 1J7KA 2XGEA 1FP2A 1W7PB 2IS1A 2FF4A 4XR6A 2LKXA 5D4SA 2PG4A 2XPVA 3VYUB 4GCVA 5E17F 1MJAA 3HOTA 3LSJA 2WB1N 5D8KB 2M8EA 1N75A 2DFHA 4DYCA 2MC4A 3LSIA 2VXDA 4GYGA 3WTXC 1XN7A 3K9TA 5H6QA 3K7AJ 2DDAA 4A6DA 3PSIA 4FE4A 1BIBA 1U8RA 5LRRA 3QYEA 2EBIA 5KAFC 2IGNA 4BE2A 5J1YA 2CMPA 3K0LA 3RZOJ 1H8AC 1FOWA 1RRJA 2FBIA 5TJJA 3KEQA 1W7PD 2CYYA 3WTYC 2X48A 2QKLB 3OIQA 5FLXZ 3IV5A 3CLOA 1XD7A 4DOZA 5K7FA 2VJIA 4N4NB 2R3SA 2Z5UA 3MVPA 1HKTA 1IXSB 3CCLI 4AIDA 1FZPB 2CQQA 3I5UA 2V7FA 2CWEA 1P4AA 3V8KA 3EUHA 3TEDA 4LOCA 4P1WA 4BAYA 4E7KA 3MEXA 3PNTA 3WE2A 1ORKA 4IKFA 2Z1DA 1FTTA 1F1ZA 2K4BA 1IXRC 3K70C 4L9JA 2XAUA 1B9MA 2H94A 4CCJA 4DYRA 3CCUI 4HZFA 1TWHJ 1ZYRF 2ZXJA 1I5ZA 2VBYA 2BGCA 1EA3A 3FBIB 1FBUA 3CCSI 4I98B 4PK4A 4JBAA 3OMYA 4PFPA 3HKZA 1KQ8A 4QSHA 3SZGA 1VQNI 1UFMA 4D0PA 5IT3A 5F08A 3TQNA 4XL9A 3TP3A 3E5UA 3R60A 3GBGA 2KHMA 2GZWA 2KP6A 2K9NA 2GBYA 3S1NJ 2XSJC 1SD6A 4ZYEA 2YR2A 3CO7C 2X51A 2VKHA 2VONA 2Q2EA 4N4OB 1FIAA 3HHGA 3DEUA 3WODF 2XAQA 4IHYA 2Y9ZA 3S2HJ 3HRTA 3M1CA 3R4KA 3MFKA 2HFHA 2HVRA 2VKVA 4A3EJ 2ESNA 3E97A 1OISA 3M8JA 1UMQA 2DMQA 1W5CC 4YFKF 3GTJJ 2DXIA 2KRFA 3RJPA 2YS9A 3L2WA 2DPUA 1IRZA 3OYIA 2RQQA 4E7SA 3K4MA 4AYBN 2IW5A 5D5UB 3D5RC 3FDYA 4XSZF 2QQ8A 3FKIJ 4CO8A 1BI1A 3QOEA 1SFOJ 2BXYA 5FGMA 2W24A 2DDBA 2VBXA 1ETVA 1H89C 4M3GA 5D8LB 4ESFA 1BI2A 4M3FA 2VE9A 2XKPA 3ZOBA 4RB2C 4DZJA 3MQ0A 3C3WA 5E79C 4YFXF 5CQGA 1YX5A 3U2RA 5GAEJ 2QBYA 3TW6A 2E1MB 4CH7A 2LMDA 5EZGA 2HI3A 2JSCA 5HVQC 2A3SA 2LH9A 3HSFA 4HV6A 4M9SA 2JA2A 4J00A 3L7WA 4HEA2 1U78A 1NK2P 2QSHX 1WKMA 1FTZA 3HGYA 2MABA 3JRCA 1T33A 3E5QA 5DYMA 2PMHA 3KP6A 3IAM2 3EUAA 4WXHA 3WG9A 2L54A 1XC5A 1LEAA 2DT7B 3PNVA 5FB2A 5IPAA 1IRXA 3SXYA 2ZFWA 2LY9A 1ZG1A 1FYLA 4HF0A 3WE3A 1Y1VJ 1SVMA 3Q3SA 3Q5FA 1T0FA 3HRSA 3F6VA 2PI0A 1LPQA 2F2EA 2L3DA 2XROA 4G7ZF 2DPDA 1NG6A 1FBQA 1ETKA 4OAZA 5L3BA 2VN2A 4UNOA 2R5ZA 4XKBA 2L7ZA 1IN7A 3S32A 1GVDA 1A5JA 2LKPA 3P9IA 2GA2A 4Y7NJ 3VB2A 2MC3A 3WG7H 2DTZA 2RQPA 2HYFA 4IHSA 1UG2A 3LAJA 1V3FA 3ECHA 2E34A 3WTVC 1FSHA 2PMUA 1T39A 4XN3A 2A6HF 1B8IB 1AWCA 3WGIA 4BY7J 3QRFF 5CVRA 4A3FJ 3IRRA 2JT1A 3B73A 5AIPA 1Y0NA 3LSPA 4DYQA 4RGSA 2IS2A 2JRTA 1GHCA 4HX8A 2HZDA 1U9OA 1HW1A 2FBKA 2ME0A 4LFUA 4WCGA 5JVGF 1HF0A 1ZRDA 4N9HA 4OWRB 4TV7A 2DMTA 1DQUA 1YW7A 3RPUD 2ACJA 2E35A 2ZMEA 1QO0D 1Z7LA 1P6RA 3ZXSA 5FLMJ 3G73A 4GFBA 1C0WA 4XLAA 3ZN1A 4MFDA 4BS9A 1F4KA 1PDNC 5FLXK 2IPQX 4CA0A 1S29A 1KZHA 2FU4A 4A0ZA 3TL4X 4QPQA 2A6EF 2L7MP 4F91B 2G7HA 1B1BA 1T08B 1Z77A 1VTNC 4AVZA 2EFQA 2V26A 2UUZA 3BR6A 5J8FA 4BH9A 1NH3A 2OF7A 3JRFA 4A3IJ 1X3WB 1B6AA 3C1DA 3I59A 2M7BA 4EM1A 1QPIA 2A5YB 3ONQA 3OYMA 1R4MB 2LDUA 4PJNA 3GF2A 2L0KA 1MMSA 1D3YA 4WXCA 3KLOA 2LFBA 4OU0A 3KP7A 1JKOC 2BBYA 3J7YJ 5J4VA 5GTIC 3E5XA 3JTGA 5CVJA 4PZJA 3RQ4A 1MBGA 1I39A 1QRYA 1BW5A 5EG0A 1NTCA 5ILUA 1JHFA 4PSXA 4BU2A 2R92J 4C3HJ 4CSWA 2ZFUA 3O2PE 3UKGA 1IN4A 4CYCB 1K6OA 1K4SA 2R7DA 1W4MA 4R1HA 1REPC 1QBJA 4UUSB 5JLWA 3U1DA 2QSGX 2X9DA 1OYIA 5J6XA 1WWXA 3JRIA 1OCZH 2KIFA 2X1CA 1T98A 2E1NA 3DU6A 3PFYA 1R71A 1QU3A 4KT5C 4L5EA 2R0QC 1RUNA 3CUQA 1BR1A 5TRDA 4NHJA 3GZ6A 1HLVA 1ZGWA 3WHCA 5F1JA 1RIOH 1T95A 4FISA 3CF2A 2LK2A 3IRQA 3VODA 3CDLA 1E3PA 4CZZA 4KIGA 3CO6C 2VJJA 1D0YA 3V7CA 1Z1DA 4XSXF 4XRMA 1OJLA 3F3XA 1I1SA 3H9GA 4RAZA 5FKNA 3I53A 3K1MA 3H5NA 3DKWA 4EM0B 4EJTA 1I6XA 2QQBA 5E8GA 1LDDA 1I27A 2X1EA 3DKXA 4PGGA 5HLHA 4CXFA 3QU6A 3BG9A 2B63J 3M07A 2K3FA 2LLKA 3IL2A 3ZCOA 2FX0A 3F9KA 1IXCA 2DA3A 5K7HA 1Y56A 3A4CA 3AL0B 3NWTA 4JK1X 2EV6A 4BL0B 1SFXA 4G6QA 2ZO4A 3CC2I 2FD5A 3DTIA 3ZQCA 2P5KA 2X4HA 3HSRA 4D7NA 3OWTA 4KICA 1MZBA 2EFNA 2A61A 4LGWA 5D5WB 3L2RA 1KYWA 4HNTA 3PM1A 1FBSA 2V79A 4CICA 2GXAA 4I0BA 3MKYB 3DLLF 4DBQA 5EGOA 5EF6A 1J0RA 3RYPA 5E20A 1Y1WJ 4I7HA 1SFKA 4XNFA 2GAUA 4V2GA 1BL0A 3GW2A 1TNTA 2L4AA 2TRTA 2L7FP 1W0UA 2H6CA 1DGWY 1PYVA 2ELKA 1F36A 1YW8A 2CW0F 4IPAA 5KAIC 2DW4A 2DQLA 3ABUA 1GXQA 3NARA 2R7WA 5CPRB 3PUBA 2ESHA 2EFOA 2XSDC 3RYRA 1R7JA 3ZN0A 3A1YA 2WWYA 2YSRA 2Z16A 3HOVJ 3VPRA 4FASD 2JVHA 3R0AA 3T1BA 3MD2A 2HPIA 3TP0A 1LJ9A 2W82A 3AL0C 2LYCA 3LSTA 2B7EA 3GCMA 4G8XA 2HQNA 4NC6A 1J09A 4I02A 2EINH 1TW2A 2P7CB 3LMMA 2GM4A 2Z2SB 3OR1C 4Q4ZF 2CV1A 2H27A 3HOZJ 4KN7X 4RS8A 2M30A 1HDPA 3GFLA 2EB7A 4V2FA 3V42A 1KA8A 2VC0A 1FC3A 2H1LA 3M1EA 1YFHA 1EV7A 4LIVA 2PJRB 3SHFA 4E7HA 2VQLA 4M72A 3HSEA 5LHHA 1RETA 4AVPA 1GT0C 3OYLA 1D1CA 3FM5A 4E7ZA 3BCBA 4F7ZA 4A3DJ 2XASA 4UUTA 4ZYDA 4XKWA 4KN4X 2F5FA 2NS8A 3LSHA 4BXFA 1WI9A 1YJWI 1B4AA 1VQ8I 3BPVA 3PQKA 4W97A 4XM3A 2F5EA 2J5PA 4XOTA 3N4MA 4N9IA 2TCTA 4M9ZA 3OL3A 3W6VA 4BXXJ 3I4MJ 2WBMA 1VQPI 3S15J 5CJ9A 4D5FA 3QPLA 3PJRA 2IXSA 5IOZA 2M2EA 1WJ5A 1ZKGA 3DPLC 4MQVA 1IDYA 3V7SA 2W7NA 5IYBJ 5E1XA 4C9YA 5M5XJ 3F22A 5J40A 1R9TJ 1VQ7I 1X58A 4EGZA 2PLYA 4UHTA 2KZGA 2XHKA 2BY2A 2VPLA 1XGMA 2KLOA 1RNLA 2R7TA 1CGPA 3AKZA 3JRDA 4B3XA 2LC2A 4ENKA 4C3IJ 3JRBA 2Q1ZB 1L0OC 3ASOH 1MMDA 1P4XA 4LITA 1IO2A 1WZ2A 2OZ6A 5BOXA 3S3MA 2ZJPF 1PP8F 2E1CA 2BY3A 3ML6A 5CLSA 4HDUA 1IGNA 1MDMA 4BDZA 1P9QC 3EYYA 3V8JA 4UXNA 2MLGA 3RIRA 2WAEA 1OCRH 4D9JA 4Q47A 2OAZA 3VFZA 1FPQA 1YHQI 1D0ZA 1DP3A 1SD7A 3EDPA 3QOPA 2QUFA 1OCTC 4A5NA 2YUSA 4B43A 2HGCA 2E19A 3ZQHA 1MBFA 3J81Z 1ODDA 1O3SA 1TT0A 1VI0A 2VQCA 2CG4A 3C7JA 3ZQFA 1QVUA 2BE5F 1SMYF 2EK5A 1FJLA 5C44J 5HLGA 3ZPLA 5D5VB 4GYIA 4IHWA 5ICEA 2X1DA 3LA3A 2XF6A 2PX9A 2BY1A 1OR7A 3K6GA 3LOCA 3OY9A 3BR2A 2O6GE 4KNYA 2R5ZB 3E6BA 4EJUA 3J7ZI 1OYWA 1YYVA 3JSPA 1VQ4I 1ACIA 3LSGA 1K61A 2EZIA 1CF7A 1X1AA 2KJBA 1TQMA 4XLHA 2WA0A 3HL2A 1DDNA 4MO7A 3CCJI 3OIPA 5HNHA 3O3KA 2K7LA 2EFWA 4QLCU 3CCRI 4MTDA 1UHMA 3M4OJ 4ZYGA 1R22A 2MG4A 3JTHA 3H5RA 3ZGKA 4HLYA 2P5LC 1W5TA 4XBFA 4PJMA 3KE2A 3OOUA 4XICA 3WTTC 3H0GJ 3BTLA 4N0BA 4XLNF 4AIHA 1AKHB 5KK1A 4CCOA 1FYMA 1T38A 2KRHA 1MBJA 1R5ID 1TWFJ 3TO9A 5DEQA 3PUFA 2FQ4A 3KEYA 3DPTA 1GXPA 3S2WA 2RREA 3M8EA 3CLQA 4GO1A 4QTRA 3GTKJ 2X6WA 4YIIA 3VWBA 2FEZA 1MGTA 3B02A 2P81A 4BEHB 3BG6A 3AG1H 1JKQC 1GVJA 4HAMA 2R7OA 3KZZA 3A01B 2ISYA 4CUGA 4A3BJ 2CW7A 4QWQA 2HOEA 2Q8KA 3GYHX 3TO7A 1W7PA 4XRFA 2XUBA 5E3OA 5LGUA 1EKEA 2HQRA 2HZTA 5DS9A 1BW6A 1OYYA 1PJRA 3MWMA 3G3ZA 4RB3C 4U0YA 2L01A 2L5QA 3DWLE 1FNNA 2PN6A 2Y2ZA 2NVUB 3G1LA 2CQ7A 5FRNA 3BLYA 3TO6A 4HG2A 3S93A 3WTWC 5FKLA 3RSNA 3WTSC 4C2TA 3DP7A 2AQEA 2ZSHB 2JMWA 3ABLH 2CH0A 3U1KA 5F0HA 1P92A 1LKXA 3AG4H 3E6CC 4HV5A 1FOXA 1ITYA 3RZDJ 1S7EA 3I56I 3ZP5A 3W2VA 4HX4A 4CHUA 3BR3A 3KLNA 5GPAA 1ZHFA 3OYAA 4IHTA 4IQ4A 2IBDA 3GO5A 1D0XA 2DA7A 5D6FA 1IDZA 4XLCA 3S2DJ 4WXDA 2F48A 2ZKZA 3CP8A 3PO3J 1MSFC 4ZC3A 3ZQQA 1LDKB 4LD5A 5LHIA 3BWGA 1E3OC 1BA5A 2DODA 3QP5A 3O8HA 2UXNA 5E3LA 2QQAA 1HSTA 1X19A 1ZARA 2QCOA 4UVCA 4A0XA 1LVKA 1B8IA 2N8GA 2IGMA 5H20A 2Y75A 4NB5A 2AO9A 1E17A 4X6AJ 1QNTA 3MCZA 3VEPA 2ELHA 2E71A 4YIRX 1D1AA 5GPCA 3GUDA 1LNWA 1B59A 2EA4A 3L2QA 4HSTA 3SZPA 3JREA 3MAJA 2CRGA 4IEJA 2GA1A 2TDXA 3A0BC 1Z91A 4E70A 4KIBA 4M74A 4G7HF 3FK6A 2E2HJ 1A04A 1Z05A 2M4GA 2MSYA 1J9IA 1XTAA 4BJ6C 2FJ1A 1EJ9A 1QVTA 1ZK8A 2KPMA 1MNMC 3J81K 5D6EA 1GUUA 2MGQA 3BC8A 2NOJB 5HLTA 2ZMEC 3OYFA 2ELJA 4BXUA 5L3GA 1W5SA 4XRSA 2E5ZA 4BQNA 3J7AY 4MQ9F 4U88A 2D1HA 4EM2A 4Z6YA 4EGYA 4HDVA 2NXNB 4CYDA 2YU9J 4OINF 4X0GA 3PO2J 1XMXA 3OOPA 1Z67A 4IL6C 4NBQA 1XB4A 2OQRA 2CJJA 2E2JJ 3Q0WA 5LBQA 2XC7A 3QPTA 3A01A 1O3RA 3W2AA 2F5DA 1ZR2A 4A3CJ 3TOAA 5B66C 3O8GA 2EPFA 4BJ5C 5C3EJ 1SC7A 3S3OA 3G6EI 2QGUA 3IWZA 3WGGA 2I5UA 1JT0A 3I64A 2ZSIB 5IP7J 2FUG2 1MMGA 2JTVA 3SQNA 5FJ8J 1Z21A 1ONVA 2AXLA 2VOOA 1R6RA 5LGTA 3F6OA 5GTHC 1GV2A 4D1QA 2E36A 1YG2A 1X1BA 1TTYA 3CCQI 3VYTB 2F5VA 5F1RA 2PQ8A 1RZ4A 1BOBA 2E1MC 3MKLA 3JR9A 3H3ZA 1AOYA 2HQ5A 5DUKA 2DJNA 2PMZN 3OL4A 3LFKA 5FROA 2X6OA 2BV6A 3ISPA 3GVAA 3NWSA 3HTSB 2K3PA 1VQKI 4AWXB 1KQ0A 2KIQA 3HUGB 2ZNYA 2E1OA 1U5TA 3FHNA 2CUJA 2IAIA 3HOYJ 4A3MJ 2DLLA 1LB2A 4RAGA 3COAC 1YRNB 4HSRA 4HRIA 1QHGA 3H0DA 2MBFA 4C2UA 1R49A 3MKZA 3ZR8X 5J1UA 5E1ZB 1QQIA 3IKVA 5J1RA 5GAGJ 4M6XA 2JRMA 1N25A 2Z99A 4NC7A 1MSEC 5IT9K 4GRIA 1BBYA 3O6BB 1DUXC 4BHCA 2KMUA 2FA5A 2O7OA 3R61A 4OMYA 2ICWG 5BNGA 3HPHA 1EH8A 2CGPA 5KHDA 2HTJA 2RNGA 2WY7Q 1HW5A 2LY1A 1BIAA 4DBRA 1J59A 1SANA 1AA7A 1EH7A 3QYFA 4GDFA 2V6CA 3ZMSA 1MMAA 3X2QH 4BACA 1FWZA 2PJPA 4KT6A 4G6DA 1XMAA 1YOVB 1IUYA 2XKOA 3DEEA 5EZHA 2BVMA 4IRGA 4BDYA 4EJOA 5FRMA 4ZDLA 2BOLA 3OYDA 2H6BA 1I1GA 2MYSA 2ZJQF 5IY5H 1U5TB 3M3YJ 1WCMJ 4XKVA 3BQZA 2EV5A 4XORA 3GFJA 5ED4A 3LNQA 3GX4X 1MNEA 5ILVA 2NVTJ 4PGHA 2R7RA 2XPWA 3I4NJ 2Y31A 2UXXA 2VT2A 3N97A 1TW3A 3K4BA 2RDPA 3PNYA 3OYBA 2P8TA 5KVRA 1A6IA 1P4WA 5EGOB 5DTDA 4FQGA 2YU3A 1G59A 4ZTFA 1QPMA 3G71I 1LUJB 2HNHA 2XGXA 1DPUA 4EATA 4B4CA 1RR7A 5KCMA 3RI4A 3WU1B 2HXIA 2QKMB 2DOAA 3BR5A 2VE8A 3CMYA 2CV0A 3BZKA 1FP1D 1EF4A 2BVLA 2JA6J 1S7AA 3DV8A 2LP0A 3KFWX 3P7NA 1HQCA 2VUMJ 1MJ9A 3RKXA 2E7XA 1RESA 4UV8A 1BR4A 1G6NA 2VL8A 2XAFA 2PFBA 1JKRC 4WF2A 1W36C 2H1KA 2STWA 3CESA 3T8TA 5E3MA 3UR3C 2M7AA 3HKZN 4A2UA 4LLNA 2CS3A 3IAS2 1NK3P 4KIFA 4A5MA 4WK8F 2A07F 1U3EM 4JOMA 2M34A 1LFPA 2WY8Q 3GWZA 3L09A 3SEZA 5EEGA 2FMLA 3ERMA 4DNCA 3SJMA 3TDUC 4BBSJ 4Y15A 3ABKH 1XX5A 4S0HB 2HEOA 3GTPJ 3LFUA 1O57A 1S5LC 1Z9CA 2ID6A 5DCMB 3FXQA 2LD5A 2HQAA 2QYOA 2HVSA 1X3UA 4ESBA 4KYWA 3I58A 2XB0X 4I76A 5E1WA 4AU7A 2NNNA 2DK8A 1E0EA 1IN8A 4B1RA 1RUOA 3FIWA 1ZLKA 5J3LA 5FKOA 2DN0A 1RPWA 4RLQA 2JVGA 1XSVA 4H4KC 4MEXF 1TBXA 3B6CA 5EJCA 3D0SA 3HTUA 2DFEA 3EYIA 4A6EA 5IP9J 2E5NA 2WAFA 1JJ8C 1K78A 1V5EA 2DYRH 5DM7F 1UG0A 4CYCA 2AXTC 3N05A 2VXZA 2LBFA 2BYVE 4G6TB 5D5XB 3SDBA 3LQRA 2HU9A 2VC1A 4IOCF 4MIMA 1LEBA 2D2WA 2ZXHA 3DLAA 5BQTA 3L2VA 2HVQA 1BM9A 4Y3OA 4UY8I 3RQIA 2D1VA 2O5RA 5LD2C 1SAXA 3HGGA 2LSOA 3CJRB 3FM3A 3OS0A 1J75A 5EEAA 2G0EA 4RGUA 1OFCX 1ON1A 1WVRA 3CMEI 2VODA 1KU2A 3BJOA 1ZAOA 1SFUA 2XRNA 1HKQA 2QZ8A 3BQYA 3IH3A 4JX4A 5F27A 2VIXA 3SYTA 4RAYA 2IS6A 3K2AA 3F0CA 5GP9A 3SFZA 3CF5F 4A3JJ 3S1RJ 4BKXA 4M6VA 3JRHA 1BC8C 1IF1A 1G3TA 3KETA 1HCRA 1DGRM 3KP3A 2FOKA 3I3LA 5L3DA 2R7SA 2QVOA 1RC9A 5HS7A 3SFIA 1BR2A 5JR3A 1TQPA 5LGNA 1S7OA 4UVAA 4XOPA 2ME6A 3QU3A 3LWFA 2F4IA 4C3JJ 3S8PA 4PSWA 1TQIA 3GLLA 5E3NA 1A6QA 2GOXB 2VB6A 2L9RA 2ZMEB 3EQLF 1N77A 1Z6TA 4I2OA 1V55H 5JLXA 2KZVA 4FETA 3P9CA 2L9VA 5AIQA 4B3AA 4BNCA 1TT5B 4QPOA 1JHHA 3J80K 3DXJF 4A3GJ 4PFOA 3FF5A 4I0AA 3HOXJ 4M6YA 1ZG5A 1JT6A 4BEHA 2K02A 2RAEA 3TMOA 5ICGA 3VSKA 4EJVA 4RAFA 2UZKA 2FBHA 1YS6A 4BJTA 3JCUC 2FQ3A 3L2UA 5HS9A 2HXOA 3IH2A 3GZ5A 1WQ2A 5IYCJ 3A02A 2OUMA 2QSFX 3CCVI 3ABTA 3BR1A 3KEOA 3HM5A 4YFNF 3OYKA 1UZCA 4XLPF 1WFXA 1FOYA 3IWFA 2KL4A 4AIJA 5F64A 2LY2A 3A0HC 3H9JA 2HS5A 2VQHA 4LK0F 1JXSA 3HEFA 2Q0OA 3OIOA 5TGTA 2QEXI 1G2HA 2DOEA 3JW4A 4BHPA 2DJIA 1R1TA 1RI7A 1XMKA 4DGWB 1JKPC 1ZRFA 3H3UA 2RVCA 1WSUA 2JQ7A 1Z6RA 3BG5A 2FNAA 2MW8A 5D4RA 2OA4A 4FT8A 4C30A 4ZH4F 1RKWA 5ICFA 2XGDA 2JK3A 2CV2A 3K4LA 3K69A 3KZYA 3TDZC 1XSDA 3FXRA 3HG9A 4UUSA 3FISA 2RC4A 3HZJA 2Y0MA 4IRHA 3QODA 1J5YA 2O61A 4F52A 2HDCA 1MH3A 3HJEA 5DCFA 3KP4A 2K85A 3RCOA 1TNSA 3DF8A 2FSWA 2WTEA 3S1QJ 2M9HA 2VPRA 3QPSA 3BP8A 1ZR4A 2XAGA 2ZC2A 5M5WJ 5TISC 4ABZA 3F8NA 1AKHA 4I6ZA 1E3HA 1USSA 4XIDA 1QGPA 4CDGA 1D1BA 3BJAA 3FX3A 4IF4A 3I54A 2GLOA 2JA7J 4ZDOA 1B72A 5J47A 4DW6A 1SD4A 2I8DA 3H1CA 2OPTA 3HC7A 2G7UA 3IUOA 1B9NA 3GFIA 1H88C 5DUIA 2DFIA 3E6MA 2CO5A 3ZQLA 2VI6A 2VASA 3ULQB 3BJ6A 1XGOA 1O4XA 3HB9A 3D5LA 2CUEA 1PUFA 4RA2A 2DA1A 1S72I 4FX4A 2KFDA 3S3NA 4NNJA 2XVCA 4XMYA 4Z2YA 2WAQA 2ADUA 1TL8A 5M5YJ 2W48A 3H36A 2P5VA 3M9AA 5EYRA 4M9XA 3W3CA 4FCYA 2CFOA 2DQRA 1ZLJA 2BHYA 5JHUA 2IRFG 3GTMJ 3OSGA 2MLKA 2OCEA 3CUQC 3JAMK 2PJRA 3J80Z 1FMWA 1KU3A 5FD5A 2BEOA 1ERDA 2P4WA 2DA5A 4OOIA 2CU7A 2XRLA 3T5XA 2KDOA 2M5WA 3MMYB 2Y0SA 3EETA 2BHZA 5L3FA 2WADA 2EIJH 1T8IA 1LFUP 5CVVA 5HS8A 3G4SI 1I50J 2F6CA 4ZYAA 2EIMH 2EQRA 2QBYB 1W1WE 2HKXA 2CFXA 1IAWA 1BOAA 6PAXA 4YG2F 1ETOA 4CCLA 1MDMB 2DK5A 3BPXA 4F55A 5DDGA 3CC4I 4UUVA 4KMFA 4NDLA 3CUOA 2LRDA 3EUHC 1P7IA 3CMAI 3HHHA 5C4XJ 3ABMH 1JUMA 2DFFA 1HBXG 3TGNA 3I0TA 3G1OA 5HNFA 2W1OA 3BTJA 4U87A 1SVLA 5DM6F 3HXLA 1ETWA 3BG7A 4GGGA 1UCRA 2OTLI 4IHVA 4M3EA 5L3CA 2M0CA 4Y33A 1LE8A 1MW7A 3ZQIA 4XONA 3IKTA 1ZRCA 1JUPA 3K4NA 2RNJA 1VNDA 1LE8B 1AHDP 4L0ZB 4A93J 5M3FJ 1QZZA 5BS6A 5H2FC 4IHXA 3RKYA 3E7LA 1ULYA 3ZMZA 5GADJ 3I59B 4O3MA 4BGDA 1G3SA 1O3QA 2JUCA 3I9V2 3MZYA 3NQOA 3QWLA 2NOGA 2R7QA 4MTEA 3S17J 1OR7C 4BUPA 5FD6A 4OMZA 4KISA 3C2HA 1V54H 2LF8A 3FZVA 3PSFA 4EJWA 2NAZA 3ZRGA 2OCCH 2IA1A 2IA0A 4GXOA 2X85A 5IOYA 2JUGA 4WX9A 3GTQJ 4U7DA 3OS1A 3V8LA 4XLEA 1A35A 3OYHA 1QZYA 3KPHA 4LB5A 3FMQA 1G3WA 4B44A 3FXOA 1BN5A 1POGA 3U9GA 4L18B 3LA7A 5BPIA 3QPHA 2DMPA 2CQNA 2O3FA 5CYVA 3SDGA 3CCEI 2K27A 1WRJA 1I3QJ 3LSMA 1R36A 4KDPA 1Y0UA 4CGZA 1UJ8A 4HLXA 1JUSA 3F8BA 3MN2A 2M4KA 4ENMA 2XB5A 3M7GA 4MEYF 9ANTA 4X1EA 2DT5A 1D8JA 1D5YA 2IJLA 1GDTA 2D45A 4MHGA 2L02A 1SVOA 3WGHA 2Z3YA 1IG7A 1FIPA 4OAYA 5K5QA 1K4TA 3WTUC 3BZCA 2BZTA 2Q2EB 5LEKA 2FE3A 1ZELA 3LAPA 1S3JA 2AHQA 4P9UA 1DPRA 1IW7F 2A68F 3OR2C 1YJNI 4OIQF 3NRVA 2LTPA 1YQAA 1SFEA 2BY0A 1VQOI 3E0JB 2JSPA 2J5OA 3H3VK 2ID3A 2CUZA 1UB9A 5A2QZ 1ZH5A 2ECBA 4FHTA 2UWMA 1YX3A 1LQ1A 2OTJI 2R93J 3IHUA 2JN6A 5F6FA 4ZTJA 4ZJZA 3DBRB 1XPXA 4M3BA 2PBIA 2IA2A 1MJBA 4RMNA 5BMZA 3F21A 1OQYA 3A2KA 3BT9A 4I09A 2HYGD 3JRGA 1OCOH 3GTGJ 4ON0A 1X1PA 1U9NA 4KJZA 4II3A 3ASNH 1WJCA 1YW9A 3PFIA 4BBRJ 2VLAA 4D7MA 1VQ9I 2LNBA 2R5YB 4II2A 1A36A 1U2WA 2CQXA 3D5SC 5LRSA 3FBNB 1P7JA 2R5YA 1WGXA 3I71A 2ZJ2A 2C6YA 2NVQJ 1S8NA 2QQ9A 2XPUA 5JHFA 2F5CA 2R7ZJ 1ETXA 2NS0A 1SEUA 4RDUA
chains in the Genus database with same CATH topology
3T8RA 4H0EA 1G4DA 4OIPF 5H6RA 2ZCWA 3VOEA 2VT3A 5CVIA 4RB0A 2NRAC 1HSJA 2OZUA 1XCVA 3OV8A 4B8XA 2O03A 2W85A 3TOBA 5J8CA 5IT9Z 1R1VA 4R79A 3FMSA 3CUQB 5HDGA 3P9KA 4BQAA 2JPCA 5FFZA 4YIFA 1XDSA 1R1UA 3KP5A 5K5RA 5ILSA 4BHBA 3E3VA 4LLLA 2XIGA 4PDKA 2DBBA 2V1UA 2O8XA 3L2CA 1KGSA 1U6GA 1F5TA 2GQQA 1FLIA 4KFCA 1V4RA 4ZYHA 4PCQA 3R0JA 4HW0A 2WC2A 3HRMA 4P55A 3F8FA 3M8FA 1R00A 4AD9A 2FNPA 3F8CA 1ZN2A 4EVIA 2R7FA 3HYIA 5L3EA 2E7WA 5AONA 2COMA 2OU2A 4S05A 4HQEA 4RGXA 5DD4A 4ESJA 3CTAA 1FYKA 1SMTA 5HDKA 5JI6A 4K2EA 4Y13A 1DP7P 1XSXA 1KU7A 2ETHA 2GWRA 3ECOA 4DQ2A 4EMSA 3WTZA 4IJAA 1SD5A 3BY6A 3BZ6A 4FX0A 4U0WA 3GLXA 3K2ZA 1K78B 3GEZA 1YTYA 5DCMA 1R23A 1R5HA 3F8MA 2GXGA 5FO5A 2CSOA 3REOA 2KJCA 2MH2A 1LVAA 1IZ1A 4ETSA 3K1PA 3LQQA 3RTRA 2ZBKA 3ZMUA 1JGSA 1S6LA 4L9NA 2DU9A 2H09A 3ZQ7A 4L5JA 2Z9OA 3TKYA 3W6KB 1ZREA 2Y48A 2GXBA 2FXAA 1T6SA 1UHWA 4L5IA 2EV0A 4A12A 4LG0A 2A69F 4KUMA 1NHAA 3T0YA 4BYYA 1U5TC 2DO7A 3QP6A 3NEUA 1BI3A 1XCBA 4OIRF 2L4MA 3BROA 2P6SA 1XGSA 1XGNA 1YS7A 3R6SA 4KMUX 2M45A 5LEJA 2QM3A 1ON2A 4WWCA 4L9TA 2WV0A 5BPDA 1HW2A 4L0YB 3FWEA 2M87A 1T2KA 1R5GA 5A2QK 3K1NA 2ISZA 3CJNA 2QENA 5K1YA 3AAFA 4ENJA 1YO5C 5FFXA 3JSOA 1FX7A 2AS5F 1K7AA 1OMIA 1Z7UA 2STTA 3L9FA 4IVNA 3DFGA 2IT0A 4LMYA 1H0MA 1USTA 1ZGJA 2B0LA 1H9GA 2KIMA 3L00A 2JPBA 1R58A 3V7RA 3W6JB 1JE8A 2XV4S 1K79A 1E2XA 4UV9A 3IC7A 1XDUA 1BI0A 2HR3A 2GIVA 3HUGA 1BC7C 3MZHA 3GFMA 2YPRA 4HOBA 4HF2A 3J7AO 4HA8A 4AIKA 3BDDA 1O7FA 2FMYA 1HXDA 2DAOA 2EWNA 2RKHA 3PQJA 4HX7A 5DV5A 4OIOF 1OPCA 1J2XA 4O6JA 1BJAA 3ERED 1IN6A 3C18A 5DD8A 1FY7A 4UVBA 4LB6B 4HYEA 3RPUA 4EQQA 2VBZA 4M71A 3SZTA 4R8HA 3F72A 2MH9A 1FOKA 2W57A 1YLFA 3CDHA 5CVUA 2MD5A 2KKOA 4I01A 4HBLA 3FXUA 4NQWA 3H92A 4G9YA 2DI3A 1H9TA 2VOPA 3QAHA 2G9WA 2YX4A 4Q5SF 2IVMA 2LF7A 3WU0A 1G3YA 2W25A 3ELKA 2W84A 1IRFA 2XAJA 5HOOA 1O3TA 3RKWA 4LLGF 1STZA 1HKSA 4P9FA 1OKRA 2KIUA 2HTSA 4G94A 3HOSA 3I4PA 1EH6A 3JAMZ 3Q9VA 3RPQA 2X0LA 5JVTA 5E18F 2QLZA 1D5VA 4Y17A 5EEHA 2OD5A 2NNYA 4LJZF 2OBPA 3KP2A 2OQGA 2V9VA 3FMRA 4LK1F 2QWWA 3F23A 4ZZDA 1F9NA 2YX7A 4EV0A 2NYXA 4IRIA 3E6DA 1D8KA 2RN7A 1FSEA 1TLHB 1ZGAA 2EA2A 4MGRA 1PP7U 1YIOA 4O5VA 4S04A 4IXAA 3ROUA 3ZMDA 5K5OA 5ICCA 1KU9A 5HDNA 4MNUA 3FHZA 2EJRA 1IRGA 1Q1HA 4JQFA 3KCCA 4RB1A 2Z33A 1FT9A 4KA4A 4U7BA 2V1XA 4A0YA 4HF1A 3V4GA 2HWVA 4L9VA 5HLIA 2P7VB 2P6TA 3HIFA 2CQKA 2XAHA 4ENNA 2V1DA 2O0YA 4LG0B 1LDJA 3ZMTA 4HQMA 5LLQA 5ERIA 1P2FA 4P5OA 2K86A 1CF7B 2DTRA 2JZYA 4ZZLA 1ZG3A 4Q48A 1KYZA 2M1BA 2PEXA 2VBWA 4P96A 2IP2A 3GXOA 3Q9SA 3RDIA 1MD0A 3HRUA 5LHGA 1IN5A 2FRHA 2HKOA 1O7LA 4ASNA 1MKMA 5JFRA 2K4JA 4M73A 4B09A 5E8IA 1KQ9A 3DQVC 2ZNZA 3ZMVA 2EFPA 4U0VA 1L3LA 2RGVA 4RGRA 2RV8A 2MA3A 3LA2A 3BOQA 4G7OF 1J7KA 1FP2A 1W7PB 2FF4A 5D4SA 2PG4A 4GCVA 5E17F 1MJAA 3HOTA 5D8KB 2M8EA 4GYGA 3WTXC 1XN7A 3K9TA 5H6QA 4A6DA 1BIBA 1U8RA 5LRRA 3K0LA 2FBIA 5TJJA 3KEQA 1W7PD 2CYYA 3WTYC 5FLXZ 3CLOA 1XD7A 2R3SA 2Z5UA 1HKTA 1IXSB 1FZPB 3I5UA 2CWEA 1P4AA 3V8KA 3EUHA 4BAYA 3MEXA 3WE2A 1F1ZA 2K4BA 1IXRC 4L9JA 1B9MA 2H94A 4HZFA 1ZYRF 2ZXJA 1I5ZA 2VBYA 2BGCA 1FBUA 4I98B 4JBAA 1KQ8A 1UFMA 4D0PA 5IT3A 3TQNA 3E5UA 3R60A 2GZWA 4ZYEA 1SD6A 2YR2A 3CO7C 2VONA 2Q2EA 3HHGA 3DEUA 3WODF 2XAQA 3HRTA 3R4KA 3MFKA 2HFHA 2ESNA 3E97A 4YFKF 2KRFA 3RJPA 2DPUA 5D5UB 2IW5A 4XSZF 4CO8A 1BI1A 5FGMA 2W24A 2VBXA 5D8LB 4ESFA 1BI2A 2VE9A 2XKPA 4RB2C 3MQ0A 3C3WA 4YFXF 3U2RA 2QBYA 2JSCA 5HVQC 2A3SA 3HSFA 4HV6A 4M9SA 3L7WA 1U78A 1WKMA 3E5QA 5DYMA 2PMHA 3KP6A 4WXHA 3WG9A 2L54A 1LEAA 5FB2A 3SXYA 2ZFWA 1ZG1A 1FYLA 4HF0A 3WE3A 3Q5FA 1T0FA 3HRSA 3F6VA 2PI0A 2F2EA 2L3DA 2XROA 4G7ZF 2DPDA 5L3BA 1FBQA 4UNOA 2VN2A 1IN7A 2LKPA 3P9IA 2GA2A 3VB2A 2MC3A 2RQPA 2HYFA 4IHSA 3LAJA 1V3FA 3ECHA 3WTVC 1FSHA 2PMUA 1T39A 2A6HF 1AWCA 3WGIA 3QRFF 5CVRA 3IRRA 2JT1A 3B73A 5AIPA 4RGSA 2JRTA 1GHCA 4HX8A 4LFUA 2FBKA 1HW1A 4WCGA 1ZRDA 4N9HA 4TV7A 1YW7A 2ACJA 2ZMEA 1QO0D 1P6RA 3G73A 1C0WA 3ZN1A 1F4KA 1PDNC 5FLXK 2IPQX 1S29A 2FU4A 4A0ZA 2A6EF 2G7HA 1B1BA 1VTNC 2EFQA 5J8FA 4BH9A 1B6AA 3C1DA 3I59A 4EM1A 2A5YB 2LDUA 3GF2A 1D3YA 4WXCA 3KLOA 4OU0A 3KP7A 2BBYA 3JTGA 3E5XA 5CVJA 4PZJA 5ILUA 1JHFA 3O2PE 1IN4A 1K6OA 2R7DA 1REPC 1W4MA 4R1HA 1QBJA 3U1DA 1OYIA 5J6XA 1WWXA 2KIFA 1T98A 2E1NA 4KT5C 1RUNA 3CUQA 5TRDA 4NHJA 3GZ6A 1RIOH 3IRQA 3VODA 4CZZA 4KIGA 3CO6C 3V7CA 1Z1DA 4XSXF 3F3XA 1I1SA 4RAZA 3I53A 3K1MA 3DKWA 4EM0B 4EJTA 1I6XA 2QQBA 5E8GA 1LDDA 1I27A 4PGGA 5HLHA 4CXFA 3QU6A 3IL2A 1IXCA 4JK1X 2EV6A 1SFXA 4G6QA 2ZO4A 2P5KA 2X4HA 3HSRA 4KICA 1MZBA 2EFNA 2A61A 4LGWA 5D5WB 1KYWA 1FBSA 2V79A 4CICA 4I0BA 1J0RA 3RYPA 5E20A 4I7HA 2GAUA 3GW2A 1TNTA 2L4AA 2H6CA 1YW8A 2CW0F 4IPAA 2DW4A 2DQLA 3ABUA 1GXQA 2ESHA 2EFOA 3RYRA 1R7JA 3ZN0A 2WWYA 2YSRA 3T1BA 3R0AA 1LJ9A 3LSTA 4G8XA 2HQNA 4I02A 1TW2A 2P7CB 4Q4ZF 2H27A 4KN7X 4RS8A 2M30A 3GFLA 2EB7A 1KA8A 2VC0A 1FC3A 3M1EA 1YFHA 1EV7A 3SHFA 4M72A 3HSEA 5LHHA 4AVPA 3FM5A 4F7ZA 2XASA 4ZYDA 4KN4X 2F5FA 1WI9A 1B4AA 3BPVA 3PQKA 2F5EA 2J5PA 3N4MA 4N9IA 4M9ZA 5CJ9A 3DPLC 4MQVA 3V7SA 5E1XA 3F22A 4EGZA 2PLYA 4UHTA 2XHKA 1XGMA 1RNLA 1CGPA 4ENKA 1L0OC 1P4XA 2OZ6A 5BOXA 2E1CA 1PP8F 3ML6A 5CLSA 4HDUA 1MDMA 3EYYA 3V8JA 4UXNA 2MLGA 3RIRA 4Q47A 2OAZA 3VFZA 1FPQA 1SD7A 3EDPA 3QOPA 2QUFA 4A5NA 2HGCA 3J81Z 1ODDA 1O3SA 2CG4A 3C7JA 2BE5F 1SMYF 2EK5A 5HLGA 3ZPLA 5D5VB 4GYIA 5ICEA 3LA3A 1OR7A 2O6GE 4KNYA 3E6BA 4EJUA 1OYWA 1YYVA 3JSPA 1CF7A 2KJBA 1TQMA 1DDNA 3O3KA 2K7LA 2EFWA 4QLCU 4MTDA 1UHMA 4ZYGA 1R22A 3JTHA 4HLYA 2P5LC 1W5TA 4XBFA 3KE2A 3WTTC 4N0BA 4XLNF 4AIHA 5KK1A 1FYMA 1T38A 3TO9A 5DEQA 3DPTA 1GXPA 3S2WA 3M8EA 4GO1A 4YIIA 2FEZA 1MGTA 3B02A 1GVJA 4HAMA 3KZZA 2ISYA 4QWQA 2HOEA 2Q8KA 3GYHX 3TO7A 1W7PA 4XRFA 2XUBA 5LGUA 2HQRA 2HZTA 1OYYA 3MWMA 3G3ZA 4RB3C 4U0YA 2L01A 1FNNA 2PN6A 3TO6A 3WTWC 3WTSC 3DP7A 1P92A 3E6CC 4HV5A 3ZP5A 4CHUA 4HX4A 3KLNA 1ZHFA 4IHTA 3GO5A 5D6FA 4WXDA 2ZKZA 1LDKB 4LD5A 5LHIA 3BWGA 3QP5A 2UXNA 2QQAA 1HSTA 1ZARA 4UVCA 4A0XA 5H20A 2Y75A 4NB5A 1E17A 1QNTA 3MCZA 3VEPA 2ELHA 3GUDA 1LNWA 1B59A 2EA4A 3SZPA 3MAJA 2GA1A 2TDXA 1Z91A 4E70A 4KIBA 4M74A 4G7HF 1A04A 1Z05A 1J9IA 3J81K 5D6EA 4BXUA 5L3GA 1W5SA 4MQ9F 4U88A 2D1HA 4EM2A 4EGYA 4HDVA 4CYDA 4OINF 3OOPA 1XB4A 2OQRA 5LBQA 1O3RA 3QPTA 2F5DA 3TOAA 3IWZA 3WGGA 3I64A 2JTVA 3SQNA 1ONVA 2AXLA 2VOOA 5LGTA 3F6OA 1YG2A 1TTYA 5F1RA 2PQ8A 1RZ4A 1AOYA 3H3ZA 5DUKA 3LFKA 2BV6A 3ISPA 3GVAA 3HTSB 4AWXB 1KQ0A 2ZNYA 1U5TA 2DLLA 1LB2A 3COAC 2MBFA 5E1ZB 1QQIA 3IKVA 4M6XA 2Z99A 5IT9K 1BBYA 3O6BB 1DUXC 4BHCA 2FA5A 3R61A 4OMYA 1EH8A 2CGPA 2HTJA 1HW5A 1BIAA 1J59A 1EH7A 2V6CA 3ZMSA 1FWZA 2PJPA 4G6DA 1XMAA 1IUYA 2XKOA 4IRGA 4EJOA 2H6BA 1I1GA 1U5TB 2EV5A 5ED4A 3GFJA 3GX4X 5ILVA 4PGHA 2UXXA 2VT2A 3N97A 1TW3A 2RDPA 2P8TA 5KVRA 1P4WA 2YU3A 1QPMA 2XGXA 1DPUA 3RI4A 3WU1B 2VE8A 1FP1D 1S7AA 3DV8A 3KFWX 3P7NA 1HQCA 1MJ9A 3RKXA 2E7XA 1PUEE 4UV8A 1G6NA 2XAFA 2PFBA 4WF2A 2STWA 3T8TA 4A2UA 4LLNA 4KIFA 4A5MA 4WK8F 2A07F 1U3EM 3GWZA 3L09A 5EEGA 2FMLA 4DNCA 3TDUC 4Y15A 2HEOA 1O57A 1Z9CA 5DCMB 3FXQA 2QYOA 1X3UA 4ESBA 4KYWA 3I58A 5E1WA 2NNNA 2DK8A 1IN8A 1RUOA 1ZLKA 1XSVA 4MEXF 1TBXA 3D0SA 3HTUA 3EYIA 4A6EA 1K78A 2VXZA 2BYVE 5D5XB 3LQRA 2VC1A 1LEBA 2D2WA 5BQTA 1BM9A 2D1VA 1SAXA 2LSOA 3FM3A 1J75A 4RGUA 1ON1A 2VODA 1KU2A 3BJOA 1ZAOA 1SFUA 2XRNA 1HKQA 2QZ8A 4RAYA 3SFZA 1BC8C 1IF1A 1G3TA 3KETA 3KP3A 2FOKA 5L3DA 2QVOA 5HS7A 5JR3A 5LGNA 1TQPA 1S7OA 4UVAA 3QU3A 3LWFA 1TQIA 2ZMEB 3EQLF 1Z6TA 4I2OA 3P9CA 5AIQA 4BNCA 1JHHA 3J80K 3DXJF 3FF5A 4I0AA 1ZG5A 4M6YA 2K02A 5ICGA 4EJVA 2UZKA 2FBHA 1YS6A 2FQ3A 5HS9A 3GZ5A 1WQ2A 3ABTA 3KEOA 4YFNF 4XLPF 3IWFA 4AIJA 5F64A 2HS5A 4LK0F 1JXSA 2Q0OA 3JW4A 4BHPA 1R1TA 1RI7A 1XMKA 1ZRFA 3H3UA 2RVCA 1WSUA 1Z6RA 2FNAA 5D4RA 2OA4A 4FT8A 4ZH4F 5ICFA 3K69A 3KZYA 3TDZC 1XSDA 3FXRA 2RC4A 2Y0MA 4IRHA 1J5YA 2O61A 2HDCA 5DCFA 3KP4A 1TNSA 3DF8A 2FSWA 2WTEA 3BP8A 2XAGA 3F8NA 1USSA 1QGPA 4CDGA 3BJAA 3FX3A 4IF4A 3I54A 1SD4A 2G7UA 1B9NA 3GFIA 5DUIA 2DFIA 3E6MA 2CO5A 3ULQB 3BJ6A 1XGOA 3D5LA 4FX4A 2XVCA 4Z2YA 2ADUA 2P5VA 3M9AA 4M9XA 2DQRA 1ZLJA 2IRFG 5JHUA 2MLKA 3JAMK 3CUQC 3J80Z 1KU3A 5FD5A 2BEOA 2P4WA 4OOIA 3T5XA 2M5WA 3EETA 5L3FA 5CVVA 5HS8A 2QBYB 2HKXA 2CFXA 1IAWA 1BOAA 6PAXA 4YG2F 1MDMB 2DK5A 3BPXA 5DDGA 4UUVA 4KMFA 3CUOA 3HHHA 1HBXG 3TGNA 3I0TA 4GGGA 1UCRA 5L3CA 3IKTA 1ZRCA 2RNJA 4L0ZB 1QZZA 5BS6A 3RKYA 1ULYA 3ZMZA 3I59B 4O3MA 1G3SA 1O3QA 3MZYA 3NQOA 4MTEA 5FD6A 4OMZA 2LF8A 3FZVA 4EJWA 2NAZA 2IA1A 2IA0A 4GXOA 4WX9A 4U7DA 3V8LA 1QZYA 4LB5A 3FMQA 1G3WA 1BN5A 3U9GA 4L18B 3LA7A 5BPIA 3QPHA 2O3FA 5CYVA 2K27A 1WRJA 1R36A 4KDPA 1Y0UA 4CGZA 4HLXA 3F8BA 4ENMA 3M7GA 4MEYF 2DT5A 1D8JA 2IJLA 2D45A 4MHGA 2L02A 3WGHA 2Z3YA 5K5QA 3WTUC 5LEKA 2FE3A 3LAPA 1S3JA 4P9UA 1DPRA 1IW7F 2A68F 4OIQF 3NRVA 1YQAA 1SFEA 2J5OA 1UB9A 5A2QZ 1ZH5A 4FHTA 2UWMA 1LQ1A 3IHUA 5F6FA 2PBIA 2IA2A 1MJBA 5BMZA 3F21A 4I09A 2HYGD 4ON0A 1YW9A 3PFIA 2LNBA 1U2WA 5LRSA 3I71A 2ZJ2A 2C6YA 1S8NA 2QQ9A 2F5CA 2NS0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T8R A;  4H0E A;  1G4D A;  4OIP F;  5H6R A;  2ZCW A;  3VOE A;  2VT3 A;  5CVI A;  4RB0 A;  2NRA C;  1HSJ A;  2OZU A;  1XCV A;  3OV8 A;  4B8X A;  2O03 A;  2W85 A;  3TOB A;  5J8C A;  5IT9 Z;  1R1V A;  4R79 A;  3FMS A;  3CUQ B;  5HDG A;  3P9K A;  4BQA A;  2JPC A;  5FFZ A;  4YIF A;  1XDS A;  1R1U A;  3KP5 A;  5K5R A;  5ILS A;  4BHB A;  3E3V A;  4LLL A;  2XIG A;  4PDK A;  2DBB A;  2V1U A;  2O8X A;  3L2C A;  1KGS A;  1U6G A;  1F5T A;  2GQQ A;  1FLI A;  4KFC A;  1V4R A;  4ZYH A;  4PCQ A;  3R0J A;  4HW0 A;  2WC2 A;  3HRM A;  4P55 A;  3F8F A;  3M8F A;  1R00 A;  4AD9 A;  2FNP A;  3F8C A;  1ZN2 A;  4EVI A;  2R7F A;  3HYI A;  5L3E A;  2E7W A;  5AON A;  2COM A;  2OU2 A;  4S05 A;  4HQE A;  4RGX A;  5DD4 A;  4ESJ A;  3CTA A;  1FYK A;  1SMT A;  5HDK A;  5JI6 A;  4K2E A;  4Y13 A;  1DP7 P;  1XSX A;  1KU7 A;  2ETH A;  2GWR A;  3ECO A;  4DQ2 A;  4EMS A;  3WTZ A;  4IJA A;  1SD5 A;  3BY6 A;  3BZ6 A;  4FX0 A;  4U0W A;  3GLX A;  3K2Z A;  1K78 B;  3GEZ A;  1YTY A;  5DCM A;  1R23 A;  1R5H A;  3F8M A;  2GXG A;  5FO5 A;  2CSO A;  3REO A;  2KJC A;  2MH2 A;  1LVA A;  1IZ1 A;  4ETS A;  3K1P A;  3LQQ A;  3RTR A;  2ZBK A;  3ZMU A;  1JGS A;  1S6L A;  4L9N A;  2DU9 A;  2H09 A;  3ZQ7 A;  4L5J A;  2Z9O A;  3TKY A;  3W6K B;  1ZRE A;  2Y48 A;  2GXB A;  2FXA A;  1T6S A;  1UHW A;  4L5I A;  2EV0 A;  4A12 A;  4LG0 A;  2A69 F;  4KUM A;  1NHA A;  3T0Y A;  4BYY A;  1U5T C;  2DO7 A;  3QP6 A;  3NEU A;  1BI3 A;  1XCB A;  4OIR F;  2L4M A;  3BRO A;  2P6S A;  1XGS A;  1XGN A;  1YS7 A;  3R6S A;  4KMU X;  2M45 A;  5LEJ A;  2QM3 A;  1ON2 A;  4WWC A;  4L9T A;  2WV0 A;  5BPD A;  1HW2 A;  4L0Y B;  3FWE A;  2M87 A;  1T2K A;  1R5G A;  5A2Q K;  3K1N A;  2ISZ A;  3CJN A;  2QEN A;  5K1Y A;  3AAF A;  4ENJ A;  1YO5 C;  5FFX A;  3JSO A;  1FX7 A;  2AS5 F;  1K7A A;  1OMI A;  1Z7U A;  2STT A;  3L9F A;  4IVN A;  3DFG A;  2IT0 A;  4LMY A;  1H0M A;  1UST A;  1ZGJ A;  2B0L A;  1H9G A;  2KIM A;  3L00 A;  2JPB A;  1R58 A;  3V7R A;  3W6J B;  1JE8 A;  2XV4 S;  1K79 A;  1E2X A;  4UV9 A;  3IC7 A;  1XDU A;  1BI0 A;  2HR3 A;  2GIV A;  3HUG A;  1BC7 C;  3MZH A;  3GFM A;  2YPR A;  4HOB A;  4HF2 A;  3J7A O;  4HA8 A;  4AIK A;  3BDD A;  1O7F A;  2FMY A;  1HXD A;  2DAO A;  2EWN A;  2RKH A;  3PQJ A;  4HX7 A;  5DV5 A;  4OIO F;  1OPC A;  1J2X A;  4O6J A;  1BJA A;  3ERE D;  1IN6 A;  3C18 A;  5DD8 A;  1FY7 A;  4UVB A;  4LB6 B;  4HYE A;  3RPU A;  4EQQ A;  2VBZ A;  4M71 A;  3SZT A;  4R8H A;  3F72 A;  2MH9 A;  1FOK A;  2W57 A;  1YLF A;  3CDH A;  5CVU A;  2MD5 A;  2KKO A;  4I01 A;  4HBL A;  3FXU A;  4NQW A;  3H92 A;  4G9Y A;  2DI3 A;  1H9T A;  2VOP A;  3QAH A;  2G9W A;  2YX4 A;  4Q5S F;  2IVM A;  2LF7 A;  3WU0 A;  1G3Y A;  2W25 A;  3ELK A;  2W84 A;  1IRF A;  2XAJ A;  5HOO A;  1O3T A;  3RKW A;  4LLG F;  1STZ A;  1HKS A;  4P9F A;  1OKR A;  2KIU A;  2HTS A;  4G94 A;  3HOS A;  3I4P A;  1EH6 A;  3JAM Z;  3Q9V A;  3RPQ A;  2X0L A;  5JVT A;  5E18 F;  2QLZ A;  1D5V A;  4Y17 A;  5EEH A;  2OD5 A;  2NNY A;  4LJZ F;  2OBP A;  3KP2 A;  2OQG A;  2V9V A;  3FMR A;  4LK1 F;  2QWW A;  3F23 A;  4ZZD A;  1F9N A;  2YX7 A;  4EV0 A;  2NYX A;  4IRI A;  3E6D A;  1D8K A;  2RN7 A;  1FSE A;  1TLH B;  1ZGA A;  2EA2 A;  4MGR A;  1PP7 U;  1YIO A;  4O5V A;  4S04 A;  4IXA A;  3ROU A;  3ZMD A;  5K5O A;  5ICC A;  1KU9 A;  5HDN A;  4MNU A;  3FHZ A;  2EJR A;  1IRG A;  1Q1H A;  4JQF A;  3KCC A;  4RB1 A;  2Z33 A;  1FT9 A;  4KA4 A;  4U7B A;  2V1X A;  4A0Y A;  4HF1 A;  3V4G A;  2HWV A;  4L9V A;  5HLI A;  2P7V B;  2P6T A;  3HIF A;  2CQK A;  2XAH A;  4ENN A;  2V1D A;  2O0Y A;  4LG0 B;  1LDJ A;  3ZMT A;  4HQM A;  5LLQ A;  5ERI A;  1P2F A;  4P5O A;  2K86 A;  1CF7 B;  2DTR A;  2JZY A;  4ZZL A;  1ZG3 A;  4Q48 A;  1KYZ A;  2M1B A;  2PEX A;  2VBW A;  4P96 A;  2IP2 A;  3GXO A;  3Q9S A;  3RDI A;  1MD0 A;  3HRU A;  5LHG A;  1IN5 A;  2FRH A;  2HKO A;  1O7L A;  4ASN A;  1MKM A;  5JFR A;  2K4J A;  4M73 A;  4B09 A;  5E8I A;  1KQ9 A;  3DQV C;  2ZNZ A;  3ZMV A;  2EFP A;  4U0V A;  1L3L A;  2RGV A;  4RGR A;  2RV8 A;  2MA3 A;  3LA2 A;  3BOQ A;  4G7O F;  1J7K A;  1FP2 A;  1W7P B;  2FF4 A;  5D4S A;  2PG4 A;  4GCV A;  5E17 F;  1MJA A;  3HOT A;  5D8K B;  2M8E A;  4GYG A;  3WTX C;  1XN7 A;  3K9T A;  5H6Q A;  4A6D A;  1BIB A;  1U8R A;  5LRR A;  3K0L A;  2FBI A;  5TJJ A;  3KEQ A;  1W7P D;  2CYY A;  3WTY C;  5FLX Z;  3CLO A;  1XD7 A;  2R3S A;  2Z5U A;  1HKT A;  1IXS B;  1FZP B;  3I5U A;  2CWE A;  1P4A A;  3V8K A;  3EUH A;  4BAY A;  3MEX A;  3WE2 A;  1F1Z A;  2K4B A;  1IXR C;  4L9J A;  1B9M A;  2H94 A;  4HZF A;  1ZYR F;  2ZXJ A;  1I5Z A;  2VBY A;  2BGC A;  1FBU A;  4I98 B;  4JBA A;  1KQ8 A;  1UFM A;  4D0P A;  5IT3 A;  3TQN A;  3E5U A;  3R60 A;  2GZW A;  4ZYE A;  1SD6 A;  2YR2 A;  3CO7 C;  2VON A;  2Q2E A;  3HHG A;  3DEU A;  3WOD F;  2XAQ A;  3HRT A;  3R4K A;  3MFK A;  2HFH A;  2ESN A;  3E97 A;  4YFK F;  2KRF A;  3RJP A;  2DPU A;  5D5U B;  2IW5 A;  4XSZ F;  4CO8 A;  1BI1 A;  5FGM A;  2W24 A;  2VBX A;  5D8L B;  4ESF A;  1BI2 A;  2VE9 A;  2XKP A;  4RB2 C;  3MQ0 A;  3C3W A;  4YFX F;  3U2R A;  2QBY A;  2JSC A;  5HVQ C;  2A3S A;  3HSF A;  4HV6 A;  4M9S A;  3L7W A;  1U78 A;  1WKM A;  3E5Q A;  5DYM A;  2PMH A;  3KP6 A;  4WXH A;  3WG9 A;  2L54 A;  1LEA A;  5FB2 A;  3SXY A;  2ZFW A;  1ZG1 A;  1FYL A;  4HF0 A;  3WE3 A;  3Q5F A;  1T0F A;  3HRS A;  3F6V A;  2PI0 A;  2F2E A;  2L3D A;  2XRO A;  4G7Z F;  2DPD A;  5L3B A;  1FBQ A;  4UNO A;  2VN2 A;  1IN7 A;  2LKP A;  3P9I A;  2GA2 A;  3VB2 A;  2MC3 A;  2RQP A;  2HYF A;  4IHS A;  3LAJ A;  1V3F A;  3ECH A;  3WTV C;  1FSH A;  2PMU A;  1T39 A;  2A6H F;  1AWC A;  3WGI A;  3QRF F;  5CVR A;  3IRR A;  2JT1 A;  3B73 A;  5AIP A;  4RGS A;  2JRT A;  1GHC A;  4HX8 A;  4LFU A;  2FBK A;  1HW1 A;  4WCG A;  1ZRD A;  4N9H A;  4TV7 A;  1YW7 A;  2ACJ A;  2ZME A;  1QO0 D;  1P6R A;  3G73 A;  1C0W A;  3ZN1 A;  1F4K A;  1PDN C;  5FLX K;  2IPQ X;  1S29 A;  2FU4 A;  4A0Z A;  2A6E F;  2G7H A;  1B1B A;  1VTN C;  2EFQ A;  5J8F A;  4BH9 A;  1B6A A;  3C1D A;  3I59 A;  4EM1 A;  2A5Y B;  2LDU A;  3GF2 A;  1D3Y A;  4WXC A;  3KLO A;  4OU0 A;  3KP7 A;  2BBY A;  3JTG A;  3E5X A;  5CVJ A;  4PZJ A;  5ILU A;  1JHF A;  3O2P E;  1IN4 A;  1K6O A;  2R7D A;  1REP C;  1W4M A;  4R1H A;  1QBJ A;  3U1D A;  1OYI A;  5J6X A;  1WWX A;  2KIF A;  1T98 A;  2E1N A;  4KT5 C;  1RUN A;  3CUQ A;  5TRD A;  4NHJ A;  3GZ6 A;  1RIO H;  3IRQ A;  3VOD A;  4CZZ A;  4KIG A;  3CO6 C;  3V7C A;  1Z1D A;  4XSX F;  3F3X A;  1I1S A;  4RAZ A;  3I53 A;  3K1M A;  3DKW A;  4EM0 B;  4EJT A;  1I6X A;  2QQB A;  5E8G A;  1LDD A;  1I27 A;  4PGG A;  5HLH A;  4CXF A;  3QU6 A;  3IL2 A;  1IXC A;  4JK1 X;  2EV6 A;  1SFX A;  4G6Q A;  2ZO4 A;  2P5K A;  2X4H A;  3HSR A;  4KIC A;  1MZB A;  2EFN A;  2A61 A;  4LGW A;  5D5W B;  1KYW A;  1FBS A;  2V79 A;  4CIC A;  4I0B A;  1J0R A;  3RYP A;  5E20 A;  4I7H A;  2GAU A;  3GW2 A;  1TNT A;  2L4A A;  2H6C A;  1YW8 A;  2CW0 F;  4IPA A;  2DW4 A;  2DQL A;  3ABU A;  1GXQ A;  2ESH A;  2EFO A;  3RYR A;  1R7J A;  3ZN0 A;  2WWY A;  2YSR A;  3T1B A;  3R0A A;  1LJ9 A;  3LST A;  4G8X A;  2HQN A;  4I02 A;  1TW2 A;  2P7C B;  4Q4Z F;  2H27 A;  4KN7 X;  4RS8 A;  2M30 A;  3GFL A;  2EB7 A;  1KA8 A;  2VC0 A;  1FC3 A;  3M1E A;  1YFH A;  1EV7 A;  3SHF A;  4M72 A;  3HSE A;  5LHH A;  4AVP A;  3FM5 A;  4F7Z A;  2XAS A;  4ZYD A;  4KN4 X;  2F5F A;  1WI9 A;  1B4A A;  3BPV A;  3PQK A;  2F5E A;  2J5P A;  3N4M A;  4N9I A;  4M9Z A;  5CJ9 A;  3DPL C;  4MQV A;  3V7S A;  5E1X A;  3F22 A;  4EGZ A;  2PLY A;  4UHT A;  2XHK A;  1XGM A;  1RNL A;  1CGP A;  4ENK A;  1L0O C;  1P4X A;  2OZ6 A;  5BOX A;  2E1C A;  1PP8 F;  3ML6 A;  5CLS A;  4HDU A;  1MDM A;  3EYY A;  3V8J A;  4UXN A;  2MLG A;  3RIR A;  4Q47 A;  2OAZ A;  3VFZ A;  1FPQ A;  1SD7 A;  3EDP A;  3QOP A;  2QUF A;  4A5N A;  2HGC A;  3J81 Z;  1ODD A;  1O3S A;  2CG4 A;  3C7J A;  2BE5 F;  1SMY F;  2EK5 A;  5HLG A;  3ZPL A;  5D5V B;  4GYI A;  5ICE A;  3LA3 A;  1OR7 A;  2O6G E;  4KNY A;  3E6B A;  4EJU A;  1OYW A;  1YYV A;  3JSP A;  1CF7 A;  2KJB A;  1TQM A;  1DDN A;  3O3K A;  2K7L A;  2EFW A;  4QLC U;  4MTD A;  1UHM A;  4ZYG A;  1R22 A;  3JTH A;  4HLY A;  2P5L C;  1W5T A;  4XBF A;  3KE2 A;  3WTT C;  4N0B A;  4XLN F;  4AIH A;  5KK1 A;  1FYM A;  1T38 A;  3TO9 A;  5DEQ A;  3DPT A;  1GXP A;  3S2W A;  3M8E A;  4GO1 A;  4YII A;  2FEZ A;  1MGT A;  3B02 A;  1GVJ A;  4HAM A;  3KZZ A;  2ISY A;  4QWQ A;  2HOE A;  2Q8K A;  3GYH X;  3TO7 A;  1W7P A;  4XRF A;  2XUB A;  5LGU A;  2HQR A;  2HZT A;  1OYY A;  3MWM A;  3G3Z A;  4RB3 C;  4U0Y A;  2L01 A;  1FNN A;  2PN6 A;  3TO6 A;  3WTW C;  3WTS C;  3DP7 A;  1P92 A;  3E6C C;  4HV5 A;  3ZP5 A;  4CHU A;  4HX4 A;  3KLN A;  1ZHF A;  4IHT A;  3GO5 A;  5D6F A;  4WXD A;  2ZKZ A;  1LDK B;  4LD5 A;  5LHI A;  3BWG A;  3QP5 A;  2UXN A;  2QQA A;  1HST A;  1ZAR A;  4UVC A;  4A0X A;  5H20 A;  2Y75 A;  4NB5 A;  1E17 A;  1QNT A;  3MCZ A;  3VEP A;  2ELH A;  3GUD A;  1LNW A;  1B59 A;  2EA4 A;  3SZP A;  3MAJ A;  2GA1 A;  2TDX A;  1Z91 A;  4E70 A;  4KIB A;  4M74 A;  4G7H F;  1A04 A;  1Z05 A;  1J9I A;  3J81 K;  5D6E A;  4BXU A;  5L3G A;  1W5S A;  4MQ9 F;  4U88 A;  2D1H A;  4EM2 A;  4EGY A;  4HDV A;  4CYD A;  4OIN F;  3OOP A;  1XB4 A;  2OQR A;  5LBQ A;  1O3R A;  3QPT A;  2F5D A;  3TOA A;  3IWZ A;  3WGG A;  3I64 A;  2JTV A;  3SQN A;  1ONV A;  2AXL A;  2VOO A;  5LGT A;  3F6O A;  1YG2 A;  1TTY A;  5F1R A;  2PQ8 A;  1RZ4 A;  1AOY A;  3H3Z A;  5DUK A;  3LFK A;  2BV6 A;  3ISP A;  3GVA A;  3HTS B;  4AWX B;  1KQ0 A;  2ZNY A;  1U5T A;  2DLL A;  1LB2 A;  3COA C;  2MBF A;  5E1Z B;  1QQI A;  3IKV A;  4M6X A;  2Z99 A;  5IT9 K;  1BBY A;  3O6B B;  1DUX C;  4BHC A;  2FA5 A;  3R61 A;  4OMY A;  1EH8 A;  2CGP A;  2HTJ A;  1HW5 A;  1BIA A;  1J59 A;  1EH7 A;  2V6C A;  3ZMS A;  1FWZ A;  2PJP A;  4G6D A;  1XMA A;  1IUY A;  2XKO A;  4IRG A;  4EJO A;  2H6B A;  1I1G A;  1U5T B;  2EV5 A;  5ED4 A;  3GFJ A;  3GX4 X;  5ILV A;  4PGH A;  2UXX A;  2VT2 A;  3N97 A;  1TW3 A;  2RDP A;  2P8T A;  5KVR A;  1P4W A;  2YU3 A;  1QPM A;  2XGX A;  1DPU A;  3RI4 A;  3WU1 B;  2VE8 A;  1FP1 D;  1S7A A;  3DV8 A;  3KFW X;  3P7N A;  1HQC A;  1MJ9 A;  3RKX A;  2E7X A;  1PUE E;  4UV8 A;  1G6N A;  2XAF A;  2PFB A;  4WF2 A;  2STW A;  3T8T A;  4A2U A;  4LLN A;  4KIF A;  4A5M A;  4WK8 F;  2A07 F;  1U3E M;  3GWZ A;  3L09 A;  5EEG A;  2FML A;  4DNC A;  3TDU C;  4Y15 A;  2HEO A;  1O57 A;  1Z9C A;  5DCM B;  3FXQ A;  2QYO A;  1X3U A;  4ESB A;  4KYW A;  3I58 A;  5E1W A;  2NNN A;  2DK8 A;  1IN8 A;  1RUO A;  1ZLK A;  1XSV A;  4MEX F;  1TBX A;  3D0S A;  3HTU A;  3EYI A;  4A6E A;  1K78 A;  2VXZ A;  2BYV E;  5D5X B;  3LQR A;  2VC1 A;  1LEB A;  2D2W A;  5BQT A;  1BM9 A;  2D1V A;  1SAX A;  2LSO A;  3FM3 A;  1J75 A;  4RGU A;  1ON1 A;  2VOD A;  1KU2 A;  3BJO A;  1ZAO A;  1SFU A;  2XRN A;  1HKQ A;  2QZ8 A;  4RAY A;  3SFZ A;  1BC8 C;  1IF1 A;  1G3T A;  3KET A;  3KP3 A;  2FOK A;  5L3D A;  2QVO A;  5HS7 A;  5JR3 A;  5LGN A;  1TQP A;  1S7O A;  4UVA A;  3QU3 A;  3LWF A;  1TQI A;  2ZME B;  3EQL F;  1Z6T A;  4I2O A;  3P9C A;  5AIQ A;  4BNC A;  1JHH A;  3J80 K;  3DXJ F;  3FF5 A;  4I0A A;  1ZG5 A;  4M6Y A;  2K02 A;  5ICG A;  4EJV A;  2UZK A;  2FBH A;  1YS6 A;  2FQ3 A;  5HS9 A;  3GZ5 A;  1WQ2 A;  3ABT A;  3KEO A;  4YFN F;  4XLP F;  3IWF A;  4AIJ A;  5F64 A;  2HS5 A;  4LK0 F;  1JXS A;  2Q0O A;  3JW4 A;  4BHP A;  1R1T A;  1RI7 A;  1XMK A;  1ZRF A;  3H3U A;  2RVC A;  1WSU A;  1Z6R A;  2FNA A;  5D4R A;  2OA4 A;  4FT8 A;  4ZH4 F;  5ICF A;  3K69 A;  3KZY A;  3TDZ C;  1XSD A;  3FXR A;  2RC4 A;  2Y0M A;  4IRH A;  1J5Y A;  2O61 A;  2HDC A;  5DCF A;  3KP4 A;  1TNS A;  3DF8 A;  2FSW A;  2WTE A;  3BP8 A;  2XAG A;  3F8N A;  1USS A;  1QGP A;  4CDG A;  3BJA A;  3FX3 A;  4IF4 A;  3I54 A;  1SD4 A;  2G7U A;  1B9N A;  3GFI A;  5DUI A;  2DFI A;  3E6M A;  2CO5 A;  3ULQ B;  3BJ6 A;  1XGO A;  3D5L A;  4FX4 A;  2XVC A;  4Z2Y A;  2ADU A;  2P5V A;  3M9A A;  4M9X A;  2DQR A;  1ZLJ A;  2IRF G;  5JHU A;  2MLK A;  3JAM K;  3CUQ C;  3J80 Z;  1KU3 A;  5FD5 A;  2BEO A;  2P4W A;  4OOI A;  3T5X A;  2M5W A;  3EET A;  5L3F A;  5CVV A;  5HS8 A;  2QBY B;  2HKX A;  2CFX A;  1IAW A;  1BOA A;  6PAX A;  4YG2 F;  1MDM B;  2DK5 A;  3BPX A;  5DDG A;  4UUV A;  4KMF A;  3CUO A;  3HHH A;  1HBX G;  3TGN A;  3I0T A;  4GGG A;  1UCR A;  5L3C A;  3IKT A;  1ZRC A;  2RNJ A;  4L0Z B;  1QZZ A;  5BS6 A;  3RKY A;  1ULY A;  3ZMZ A;  3I59 B;  4O3M A;  1G3S A;  1O3Q A;  3MZY A;  3NQO A;  4MTE A;  5FD6 A;  4OMZ A;  2LF8 A;  3FZV A;  4EJW A;  2NAZ A;  2IA1 A;  2IA0 A;  4GXO A;  4WX9 A;  4U7D A;  3V8L A;  1QZY A;  4LB5 A;  3FMQ A;  1G3W A;  1BN5 A;  3U9G A;  4L18 B;  3LA7 A;  5BPI A;  3QPH A;  2O3F A;  5CYV A;  2K27 A;  1WRJ A;  1R36 A;  4KDP A;  1Y0U A;  4CGZ A;  4HLX A;  3F8B A;  4ENM A;  3M7G A;  4MEY F;  2DT5 A;  1D8J A;  2IJL A;  2D45 A;  4MHG A;  2L02 A;  3WGH A;  2Z3Y A;  5K5Q A;  3WTU C;  5LEK A;  2FE3 A;  3LAP A;  1S3J A;  4P9U A;  1DPR A;  1IW7 F;  2A68 F;  4OIQ F;  3NRV A;  1YQA A;  1SFE A;  2J5O A;  1UB9 A;  5A2Q Z;  1ZH5 A;  4FHT A;  2UWM A;  1LQ1 A;  3IHU A;  5F6F A;  2PBI A;  2IA2 A;  1MJB A;  5BMZ A;  3F21 A;  4I09 A;  2HYG D;  4ON0 A;  1YW9 A;  3PFI A;  2LNB A;  1U2W A;  5LRS A;  3I71 A;  2ZJ2 A;  2C6Y A;  1S8N A;  2QQ9 A;  2F5C A;  2NS0 A; 
#chains in the Genus database with same CATH topology
 1YIT I;  3T8R A;  2XDV A;  3Q0U A;  4QIW N;  2NVY J;  2MFZ A;  3CCY A;  1OCC H;  4H0E A;  1G4D A;  4OIP F;  5H6R A;  2ZCW A;  3VOE A;  5B3S H;  2VT3 A;  5CVI A;  3VDX A;  4RB0 A;  2NRA C;  1HSJ A;  3DEW A;  4JX5 A;  2L7K A;  2A05 A;  2JA5 J;  4V19 K;  3BCA A;  1JTY A;  2OZU A;  3CZ6 A;  4FTH A;  4CCK A;  1XCV A;  3DPU A;  3OV8 A;  4B8X A;  2HDW A;  3K4C A;  2O03 A;  1ENH A;  1W0T A;  2W85 A;  3TOB A;  2KDZ A;  5J8C A;  5IT9 Z;  1R1V A;  4R79 A;  3FXM A;  3FMS A;  3CUQ B;  1APL C;  1FMV A;  2HDD A;  3OYJ A;  5HDG A;  3P9K A;  4BQA A;  1GLN A;  3WU2 C;  2JPC A;  5FFZ A;  5J4Y A;  4B48 A;  2LRE A;  4KIT B;  4YIF A;  1XDS A;  2LR8 A;  1Z3Y A;  3IP4 B;  3HDD A;  2CW8 A;  1R1U A;  3KP5 A;  2Y0S N;  4ITV A;  5K5R A;  3CQZ J;  5ILS A;  4RM3 A;  1M1E B;  5FKM A;  4BHB A;  3UNG C;  3K4K A;  4E7L A;  4F92 B;  3AG2 H;  3E3V A;  1X4P A;  3CDI A;  4LLL A;  2XIG A;  2A6T A;  2M8G X;  1XG1 A;  3TW7 A;  4DIQ A;  3OYG A;  3QYB A;  4PDK A;  2HPM A;  4A3L J;  2F4O B;  2V4J C;  4UB8 C;  2IS4 A;  2DBB A;  2V1U A;  2O8X A;  2V6E A;  2JA8 J;  2R7X A;  3L2C A;  1KGS A;  1U6G A;  1F5T A;  2GQQ A;  1FLI A;  3AFH A;  4KFC A;  4M3D A;  1WJD A;  1V4R A;  4JP0 A;  2L2O A;  4ZYH A;  4E7J A;  4PCQ A;  3R0J A;  3LL7 A;  4HW0 A;  2GOM A;  2WC2 A;  3HRM A;  2VKE A;  3H5A A;  1U0J A;  5EG0 B;  4P55 A;  2ECC A;  3F8F A;  5CQE A;  3M8F A;  1R00 A;  4AD9 A;  2FNP A;  3F8C A;  1Y8Q B;  1ZN2 A;  1W36 D;  1WH5 A;  4EVI A;  3OYN A;  1G8X A;  1QHH D;  1MIJ A;  1HDD C;  2R7F A;  3HYI A;  4IO9 F;  3WHB A;  1SAU A;  5L3E A;  3FXL A;  2E7W A;  5AON A;  2COM A;  2OU2 A;  2VQG A;  4S05 A;  4HQE A;  2K5C A;  4RGX A;  5DD4 A;  4ESJ A;  5GAH J;  3CTA A;  3OS2 A;  2JJ7 A;  1FYK A;  1HOM A;  1SMT A;  5HDK A;  1S9H A;  1Y6I A;  5JI6 A;  4K2E A;  3CCM I;  4Y13 A;  2LKS A;  4I99 C;  1DP7 P;  1XSX A;  1ZTR A;  4PJJ A;  1RKT A;  3HPG A;  1KU7 A;  2ETH A;  2GWR A;  3ECO A;  4DQ2 A;  4EMS A;  4A69 C;  3WTZ A;  4IJA A;  3CMM A;  1VF9 A;  1SD5 A;  3KX2 A;  3S16 J;  1K83 J;  3BY6 A;  3BZ6 A;  2Y9Y A;  4FX0 A;  4U0W A;  2IEK A;  3I55 I;  4Y52 J;  3LSK A;  1V5F A;  2Y30 A;  2O8K A;  1JTX A;  2Y69 H;  3GLX A;  4HPQ A;  3K2Z A;  1K78 B;  3IH4 A;  3GEZ A;  2UV1 A;  1JJ6 C;  1YTY A;  5DCM A;  3HOW J;  1R23 A;  1R5H A;  3F8M A;  3PL8 A;  2X6Y A;  3NAU A;  2GXG A;  5B5E C;  5FO5 A;  4RBO A;  1X1C A;  2CSO A;  2K9Q A;  2OV7 A;  1PUF B;  3REO A;  2EIK H;  2KJC A;  2MH2 A;  3FXJ A;  5FKK A;  2WAQ N;  1VQM I;  4J19 A;  1YI2 I;  4CCN A;  1LVA A;  1IZ1 A;  2ZXI A;  4PUS A;  3VYR B;  1X2N A;  2AQF A;  1UAA A;  4ETS A;  2IGO A;  3K1P A;  3LQQ A;  3RTR A;  2ZBK A;  3ZMU A;  1JGS A;  1S6L A;  4L9N A;  1VFC A;  2DU9 A;  2H09 A;  2FOW A;  3ZQ7 A;  4L5J A;  1WJF A;  4DJA A;  2Z9O A;  3G1M A;  3TKY A;  3DBL B;  3KYD B;  2B9S A;  3W6K B;  1ZRE A;  2Y48 A;  2GXB A;  3VSL A;  1U8B A;  3H9Q A;  3FK7 A;  2FXA A;  2KQR A;  1T6S A;  1UHW A;  4L5I A;  2V9K A;  1MMN A;  2EV0 A;  4A12 A;  2COB A;  4LG0 A;  4Y4R A;  2A69 F;  4KUM A;  5IYD J;  1NHA A;  3T0Y A;  4BYY A;  3L1P A;  1KON A;  1XS9 A;  1U5T C;  2DO7 A;  1MH4 A;  3QP6 A;  2NVX J;  3NEU A;  1BI3 A;  1B72 B;  5KNL A;  1XCB A;  3KYC B;  4IX7 A;  4E4H A;  4OIR F;  5IP6 A;  2L4M A;  3BRO A;  2P6S A;  1XGS A;  1VQL I;  1JI8 A;  1XGN A;  1YS7 A;  4C2M J;  2LG4 A;  2XGC A;  3R6S A;  2L9N A;  4KMU X;  2M45 A;  5LEJ A;  3BG3 A;  2QM3 A;  1ON2 A;  4WWC A;  1ETY A;  3K4J A;  4L9T A;  2I10 A;  3CJT B;  2WV0 A;  5BPD A;  1HW2 A;  4ANJ A;  4L0Y B;  1GV5 A;  3SEQ A;  2KIS A;  3ZQG A;  3DTE A;  2DYS H;  4E7I A;  3FWE A;  2PMZ A;  4ZDP A;  2M87 A;  1T2K A;  5K7Z A;  2H8W A;  3HOU J;  1R5G A;  5A2Q K;  3K1N A;  2ISZ A;  3CJN A;  2QEN A;  5K1Y A;  3AAF A;  4ENJ A;  1YO5 C;  1MND A;  5FFX A;  3JSO A;  1Y39 A;  1FX7 A;  2AS5 F;  2BXZ A;  4PJL A;  4IZZ A;  3HBL A;  1YJ9 I;  1K7A A;  1OMI A;  4DZP A;  4J01 A;  1Z7U A;  2HOS A;  4YEJ A;  2STT A;  3L9F A;  4IVN A;  3DFG A;  2IT0 A;  1TZL A;  3EUK L;  1YE9 A;  1UST A;  2QF7 A;  4LMY A;  1H0M A;  1ZGJ A;  2B0L A;  1H9G A;  2KIM A;  3K10 A;  3L00 A;  2JPB A;  1R58 A;  3V7R A;  4UB6 C;  1FEX A;  1TC3 C;  3W6J B;  1JE8 A;  2XV4 S;  2EZK A;  1K79 A;  3A03 A;  2CUF A;  2R4G A;  2VJ5 A;  1MBE A;  1E2X A;  4UV9 A;  3IC7 A;  5F0C A;  1XDU A;  2X6X A;  1BI0 A;  2HR3 A;  1X3Z B;  2GIV A;  3HUG A;  1BC7 C;  2P0W A;  3MZH A;  3GFM A;  2YPR A;  3MZ8 A;  1Z0X A;  4HOB A;  4D5C A;  4CCM A;  4HF2 A;  4LIU A;  2EZH A;  4HA8 A;  3J7A O;  4AIK A;  1IV8 A;  5EDN A;  3BDD A;  3CC7 I;  1O7F A;  3FKJ A;  2FMY A;  3MKW B;  1HXD A;  2DAO A;  3FXK A;  4XRS G;  3P5J A;  4B47 A;  2EWN A;  2RKH A;  3PQJ A;  4HX7 A;  3BTI A;  5DV5 A;  4OIO F;  1OPC A;  3BTC A;  1J2X A;  4O6J A;  1BJA A;  2H8R A;  3ERE D;  1X2M A;  1DU0 A;  5B1B H;  1IN6 A;  3C18 A;  2DOF A;  2K9S A;  3KIO A;  5DD8 A;  1WJA A;  1FY7 A;  4UVB A;  4HNU A;  4MFE A;  4HYE A;  4LB6 B;  2E2I J;  2EIL H;  3RPU A;  4EQQ A;  1N78 A;  2VBZ A;  1T0F C;  1RR8 C;  2D5V A;  1R4N B;  4M71 A;  1QA6 A;  1UEL B;  2LOO A;  3SZT A;  2WV1 A;  4CZC A;  3GTL J;  1I3A A;  4R8H A;  3F72 A;  2VJ4 A;  3OYC A;  2IGK A;  3JRA A;  1ZQ3 P;  2MH9 A;  2OJE D;  5F04 A;  2W57 A;  1FOK A;  1YLF A;  3CDH A;  3D1N I;  5CVU A;  2MD5 A;  3GME A;  2KKO A;  2DMN A;  2LVS A;  3H35 A;  1PVE A;  4I01 A;  4HBL A;  3FXU A;  3QQA A;  2LBF B;  1TWC J;  1HA8 A;  4NQW A;  3ESW B;  3H92 A;  3LSR A;  2ZXW H;  3GZN B;  4G9Y A;  4AYB A;  3E1S A;  1T56 A;  2XF7 A;  2DA2 A;  1MBK A;  2DI3 A;  3GTO J;  1UHS A;  2DA6 A;  1H9T A;  2VOP A;  3OSF A;  3QAH A;  2G9W A;  2YX4 A;  4Q5S F;  2IVM A;  1BJZ A;  2DCE A;  2LF7 A;  3WU0 A;  2R7V A;  1G3Y A;  2R7U A;  2W25 A;  4MLO A;  2V1N A;  3ELK A;  2W84 A;  1IRF A;  4XLF A;  2ZJR F;  2XAJ A;  5HOO A;  4XN0 A;  1O3T A;  3RKW A;  4LLG F;  1STZ A;  5FLV A;  1HKS A;  4P9F A;  1OKR A;  2KIU A;  4JYK A;  2HTS A;  4G94 A;  3HOS A;  3I4P A;  1K6Y A;  2L9S A;  1TWA J;  1EH6 A;  2W00 A;  3JAM Z;  2V9P A;  3Q9V A;  3RPQ A;  3S1M J;  2X0L A;  3PIO F;  3C2G A;  2EZL A;  5JVT A;  4A3K J;  5E18 F;  4BE1 A;  2QLZ A;  3DCF A;  3CJQ B;  2HOA A;  3G2B A;  1D5V A;  4AUX A;  1OCP A;  1DU6 A;  2DT6 A;  4Y17 A;  5EEH A;  2OD5 A;  2DA4 A;  2NNY A;  4F93 B;  2O9L A;  1PUE E;  3DTK A;  1JGG A;  4LJZ F;  1OLT A;  2OBP A;  3KP2 A;  2OQG A;  3C2B A;  3CD6 I;  2K9M A;  2V9V A;  1YIJ I;  1WHU A;  1WPK A;  3FMR A;  4LK1 F;  4HNV A;  3RKQ A;  2QWW A;  3F23 A;  3B6A A;  5F0F A;  1WJE A;  4XK4 A;  3AG3 H;  4ZZD A;  1IUF A;  1F9N A;  2YX7 A;  4EV0 A;  1AU7 A;  2NYX A;  3VYS B;  1IC8 A;  4IRI A;  3E6D A;  1A31 A;  1D8K A;  2RN7 A;  1ETQ A;  1Q1V A;  1FSE A;  1TLH B;  1ZGA A;  2EA2 A;  4MGR A;  4XQF A;  1PP7 U;  1VQ6 I;  4W1U A;  3DU5 A;  4XKC A;  1YRN A;  5M3M J;  1YIO A;  4O5V A;  4S04 A;  3DKY A;  4IXA A;  3ROU A;  4F3Q A;  1LFB A;  3ZMD A;  3W2W A;  2KT0 A;  1CQT A;  4BQO A;  2NS7 A;  5K5O A;  1IV6 A;  5CKT A;  4YEL A;  4FE7 A;  1KU9 A;  5ICC A;  5HDN A;  3Q0V A;  4MNU A;  4NUB A;  2DMU A;  3FHZ A;  2EJR A;  1IRG A;  1Q1H A;  3PIP F;  4JQF A;  2HYJ A;  3KCC A;  4RB1 A;  1Y8R B;  2W4S A;  2Z33 A;  1FT9 A;  4NC8 A;  4KA4 A;  4AC0 A;  1F43 A;  4EEF G;  4U7B A;  3OYE A;  1NG7 A;  2V1X A;  5LFA A;  4A0Y A;  4HF1 A;  4NQW B;  3V4G A;  1TP4 A;  3TBI A;  4BE0 A;  2OC6 A;  2HOT A;  3KYL A;  1TWG J;  1Z3X A;  2HWV A;  4L9V A;  5HLI A;  4JX6 A;  5B1A H;  1VQ5 I;  4RM2 A;  2P7V B;  2A5W A;  2P6T A;  3HIF A;  2CQK A;  4LG3 A;  2XAH A;  4ENN A;  3U21 A;  2V1D A;  2O0Y A;  4LG0 B;  2BW3 A;  1LDJ A;  3ZMT A;  4HQM A;  5LLQ A;  1I6H J;  4YRV A;  3CP2 A;  5ERI A;  1P2F A;  1X4O A;  5HOD A;  1QZE A;  3S14 J;  4P5O A;  2K86 A;  2GIZ A;  4RLF A;  4G12 A;  3KZI C;  1CF7 B;  2DTR A;  2M3A A;  2JZY A;  2M0M A;  3BR0 A;  4ZZL A;  1VZ0 A;  1ZG3 A;  3EPZ A;  4Q48 A;  1KYZ A;  2M1B A;  1WH7 A;  2PEX A;  2XF5 A;  2VBW A;  4P96 A;  2IP2 A;  3GXO A;  4BY1 J;  2ZB9 A;  3Q9S A;  3RDI A;  1MD0 A;  1X1D A;  2JWT A;  3K70 D;  1IJW C;  3HRU A;  2WB1 A;  4AM3 A;  5LHG A;  1IN5 A;  2FRH A;  4E6K G;  4IOA F;  2HKO A;  2K9L A;  1O7L A;  2F4M B;  1MKM A;  4ASN A;  4BQQ A;  2E60 A;  2VKD A;  2MD0 A;  5JFR A;  5C4J J;  2K4J A;  2QA4 I;  4M73 A;  4B09 A;  5E8I A;  1HC8 A;  2EH3 A;  1KQ9 A;  3DQV C;  1WJB A;  4IQJ A;  2KRC A;  2ZNZ A;  4PJ0 C;  3ZMV A;  3DBH B;  2EFP A;  4U0V A;  2BW3 B;  1L3L A;  2RGV A;  1WI3 A;  1V5G A;  2K40 A;  4RGR A;  1MBH A;  2RV8 A;  2MA3 A;  3LA2 A;  3BOQ A;  4G7O F;  1J7K A;  2XGE A;  1FP2 A;  1W7P B;  2IS1 A;  2FF4 A;  4XR6 A;  2LKX A;  5D4S A;  2PG4 A;  2XPV A;  3VYU B;  4GCV A;  5E17 F;  1MJA A;  3HOT A;  3LSJ A;  2WB1 N;  5D8K B;  2M8E A;  1N75 A;  2DFH A;  4DYC A;  2MC4 A;  3LSI A;  2VXD A;  4GYG A;  3WTX C;  1XN7 A;  3K9T A;  5H6Q A;  3K7A J;  2DDA A;  4A6D A;  3PSI A;  4FE4 A;  1BIB A;  1U8R A;  5LRR A;  3QYE A;  2EBI A;  5KAF C;  2IGN A;  4BE2 A;  5J1Y A;  2CMP A;  3K0L A;  3RZO J;  1H8A C;  1FOW A;  1RRJ A;  2FBI A;  5TJJ A;  3KEQ A;  1W7P D;  2CYY A;  3WTY C;  2X48 A;  2QKL B;  3OIQ A;  5FLX Z;  3IV5 A;  3CLO A;  1XD7 A;  4DOZ A;  5K7F A;  2VJI A;  4N4N B;  2R3S A;  2Z5U A;  3MVP A;  1HKT A;  1IXS B;  3CCL I;  4AID A;  1FZP B;  2CQQ A;  3I5U A;  2V7F A;  2CWE A;  1P4A A;  3V8K A;  3EUH A;  3TED A;  4LOC A;  4P1W A;  4BAY A;  4E7K A;  3MEX A;  3PNT A;  3WE2 A;  1ORK A;  4IKF A;  2Z1D A;  1FTT A;  1F1Z A;  2K4B A;  1IXR C;  3K70 C;  4L9J A;  2XAU A;  1B9M A;  2H94 A;  4CCJ A;  4DYR A;  3CCU I;  4HZF A;  1TWH J;  1ZYR F;  2ZXJ A;  1I5Z A;  2VBY A;  2BGC A;  1EA3 A;  3FBI B;  1FBU A;  3CCS I;  4I98 B;  4PK4 A;  4JBA A;  3OMY A;  4PFP A;  3HKZ A;  1KQ8 A;  4QSH A;  3SZG A;  1VQN I;  1UFM A;  4D0P A;  5IT3 A;  5F08 A;  3TQN A;  4XL9 A;  3TP3 A;  3E5U A;  3R60 A;  3GBG A;  2KHM A;  2GZW A;  2KP6 A;  2K9N A;  2GBY A;  3S1N J;  2XSJ C;  1SD6 A;  4ZYE A;  2YR2 A;  3CO7 C;  2X51 A;  2VKH A;  2VON A;  2Q2E A;  4N4O B;  1FIA A;  3HHG A;  3DEU A;  3WOD F;  2XAQ A;  4IHY A;  2Y9Z A;  3S2H J;  3HRT A;  3M1C A;  3R4K A;  3MFK A;  2HFH A;  2HVR A;  2VKV A;  4A3E J;  2ESN A;  3E97 A;  1OIS A;  3M8J A;  1UMQ A;  2DMQ A;  1W5C C;  4YFK F;  3GTJ J;  2DXI A;  2KRF A;  3RJP A;  2YS9 A;  3L2W A;  2DPU A;  1IRZ A;  3OYI A;  2RQQ A;  4E7S A;  3K4M A;  4AYB N;  2IW5 A;  5D5U B;  3D5R C;  3FDY A;  4XSZ F;  2QQ8 A;  3FKI J;  4CO8 A;  1BI1 A;  3QOE A;  1SFO J;  2BXY A;  5FGM A;  2W24 A;  2DDB A;  2VBX A;  1ETV A;  1H89 C;  4M3G A;  5D8L B;  4ESF A;  1BI2 A;  4M3F A;  2VE9 A;  2XKP A;  3ZOB A;  4RB2 C;  4DZJ A;  3MQ0 A;  3C3W A;  5E79 C;  4YFX F;  5CQG A;  1YX5 A;  3U2R A;  5GAE J;  2QBY A;  3TW6 A;  2E1M B;  4CH7 A;  2LMD A;  5EZG A;  2HI3 A;  2JSC A;  5HVQ C;  2A3S A;  2LH9 A;  3HSF A;  4HV6 A;  4M9S A;  2JA2 A;  4J00 A;  3L7W A;  4HEA 2;  1U78 A;  1NK2 P;  2QSH X;  1WKM A;  1FTZ A;  3HGY A;  2MAB A;  3JRC A;  1T33 A;  3E5Q A;  5DYM A;  2PMH A;  3KP6 A;  3IAM 2;  3EUA A;  4WXH A;  3WG9 A;  2L54 A;  1XC5 A;  1LEA A;  2DT7 B;  3PNV A;  5FB2 A;  5IPA A;  1IRX A;  3SXY A;  2ZFW A;  2LY9 A;  1ZG1 A;  1FYL A;  4HF0 A;  3WE3 A;  1Y1V J;  1SVM A;  3Q3S A;  3Q5F A;  1T0F A;  3HRS A;  3F6V A;  2PI0 A;  1LPQ A;  2F2E A;  2L3D A;  2XRO A;  4G7Z F;  2DPD A;  1NG6 A;  1FBQ A;  1ETK A;  4OAZ A;  5L3B A;  2VN2 A;  4UNO A;  2R5Z A;  4XKB A;  2L7Z A;  1IN7 A;  3S32 A;  1GVD A;  1A5J A;  2LKP A;  3P9I A;  2GA2 A;  4Y7N J;  3VB2 A;  2MC3 A;  3WG7 H;  2DTZ A;  2RQP A;  2HYF A;  4IHS A;  1UG2 A;  3LAJ A;  1V3F A;  3ECH A;  2E34 A;  3WTV C;  1FSH A;  2PMU A;  1T39 A;  4XN3 A;  2A6H F;  1B8I B;  1AWC A;  3WGI A;  4BY7 J;  3QRF F;  5CVR A;  4A3F J;  3IRR A;  2JT1 A;  3B73 A;  5AIP A;  1Y0N A;  3LSP A;  4DYQ A;  4RGS A;  2IS2 A;  2JRT A;  1GHC A;  4HX8 A;  2HZD A;  1U9O A;  1HW1 A;  2FBK A;  2ME0 A;  4LFU A;  4WCG A;  5JVG F;  1HF0 A;  1ZRD A;  4N9H A;  4OWR B;  4TV7 A;  2DMT A;  1DQU A;  1YW7 A;  3RPU D;  2ACJ A;  2E35 A;  2ZME A;  1QO0 D;  1Z7L A;  1P6R A;  3ZXS A;  5FLM J;  3G73 A;  4GFB A;  1C0W A;  4XLA A;  3ZN1 A;  4MFD A;  4BS9 A;  1F4K A;  1PDN C;  5FLX K;  2IPQ X;  4CA0 A;  1S29 A;  1KZH A;  2FU4 A;  4A0Z A;  3TL4 X;  4QPQ A;  2A6E F;  2L7M P;  4F91 B;  2G7H A;  1B1B A;  1T08 B;  1Z77 A;  1VTN C;  4AVZ A;  2EFQ A;  2V26 A;  2UUZ A;  3BR6 A;  5J8F A;  4BH9 A;  1NH3 A;  2OF7 A;  3JRF A;  4A3I J;  1X3W B;  1B6A A;  3C1D A;  3I59 A;  2M7B A;  4EM1 A;  1QPI A;  2A5Y B;  3ONQ A;  3OYM A;  1R4M B;  2LDU A;  4PJN A;  3GF2 A;  2L0K A;  1MMS A;  1D3Y A;  4WXC A;  3KLO A;  2LFB A;  4OU0 A;  3KP7 A;  1JKO C;  2BBY A;  3J7Y J;  5J4V A;  5GTI C;  3E5X A;  3JTG A;  5CVJ A;  4PZJ A;  3RQ4 A;  1MBG A;  1I39 A;  1QRY A;  1BW5 A;  5EG0 A;  1NTC A;  5ILU A;  1JHF A;  4PSX A;  4BU2 A;  2R92 J;  4C3H J;  4CSW A;  2ZFU A;  3O2P E;  3UKG A;  1IN4 A;  4CYC B;  1K6O A;  1K4S A;  2R7D A;  1W4M A;  4R1H A;  1REP C;  1QBJ A;  4UUS B;  5JLW A;  3U1D A;  2QSG X;  2X9D A;  1OYI A;  5J6X A;  1WWX A;  3JRI A;  1OCZ H;  2KIF A;  2X1C A;  1T98 A;  2E1N A;  3DU6 A;  3PFY A;  1R71 A;  1QU3 A;  4KT5 C;  4L5E A;  2R0Q C;  1RUN A;  3CUQ A;  1BR1 A;  5TRD A;  4NHJ A;  3GZ6 A;  1HLV A;  1ZGW A;  3WHC A;  5F1J A;  1RIO H;  1T95 A;  4FIS A;  3CF2 A;  2LK2 A;  3IRQ A;  3VOD A;  3CDL A;  1E3P A;  4CZZ A;  4KIG A;  3CO6 C;  2VJJ A;  1D0Y A;  3V7C A;  1Z1D A;  4XSX F;  4XRM A;  1OJL A;  3F3X A;  1I1S A;  3H9G A;  4RAZ A;  5FKN A;  3I53 A;  3K1M A;  3H5N A;  3DKW A;  4EM0 B;  4EJT A;  1I6X A;  2QQB A;  5E8G A;  1LDD A;  1I27 A;  2X1E A;  3DKX A;  4PGG A;  5HLH A;  4CXF A;  3QU6 A;  3BG9 A;  2B63 J;  3M07 A;  2K3F A;  2LLK A;  3IL2 A;  3ZCO A;  2FX0 A;  3F9K A;  1IXC A;  2DA3 A;  5K7H A;  1Y56 A;  3A4C A;  3AL0 B;  3NWT A;  4JK1 X;  2EV6 A;  4BL0 B;  1SFX A;  4G6Q A;  2ZO4 A;  3CC2 I;  2FD5 A;  3DTI A;  3ZQC A;  2P5K A;  2X4H A;  3HSR A;  4D7N A;  3OWT A;  4KIC A;  1MZB A;  2EFN A;  2A61 A;  4LGW A;  5D5W B;  3L2R A;  1KYW A;  4HNT A;  3PM1 A;  1FBS A;  2V79 A;  4CIC A;  2GXA A;  4I0B A;  3MKY B;  3DLL F;  4DBQ A;  5EGO A;  5EF6 A;  1J0R A;  3RYP A;  5E20 A;  1Y1W J;  4I7H A;  1SFK A;  4XNF A;  2GAU A;  4V2G A;  1BL0 A;  3GW2 A;  1TNT A;  2L4A A;  2TRT A;  2L7F P;  1W0U A;  2H6C A;  1DGW Y;  1PYV A;  2ELK A;  1F36 A;  1YW8 A;  2CW0 F;  4IPA A;  5KAI C;  2DW4 A;  2DQL A;  3ABU A;  1GXQ A;  3NAR A;  2R7W A;  5CPR B;  3PUB A;  2ESH A;  2EFO A;  2XSD C;  3RYR A;  1R7J A;  3ZN0 A;  3A1Y A;  2WWY A;  2YSR A;  2Z16 A;  3HOV J;  3VPR A;  4FAS D;  2JVH A;  3R0A A;  3T1B A;  3MD2 A;  2HPI A;  3TP0 A;  1LJ9 A;  2W82 A;  3AL0 C;  2LYC A;  3LST A;  2B7E A;  3GCM A;  4G8X A;  2HQN A;  4NC6 A;  1J09 A;  4I02 A;  2EIN H;  1TW2 A;  2P7C B;  3LMM A;  2GM4 A;  2Z2S B;  3OR1 C;  4Q4Z F;  2CV1 A;  2H27 A;  3HOZ J;  4KN7 X;  4RS8 A;  2M30 A;  1HDP A;  3GFL A;  2EB7 A;  4V2F A;  3V42 A;  1KA8 A;  2VC0 A;  1FC3 A;  2H1L A;  3M1E A;  1YFH A;  1EV7 A;  4LIV A;  2PJR B;  3SHF A;  4E7H A;  2VQL A;  4M72 A;  3HSE A;  5LHH A;  1RET A;  4AVP A;  1GT0 C;  3OYL A;  1D1C A;  3FM5 A;  4E7Z A;  3BCB A;  4F7Z A;  4A3D J;  2XAS A;  4UUT A;  4ZYD A;  4XKW A;  4KN4 X;  2F5F A;  2NS8 A;  3LSH A;  4BXF A;  1WI9 A;  1YJW I;  1B4A A;  1VQ8 I;  3BPV A;  3PQK A;  4W97 A;  4XM3 A;  2F5E A;  2J5P A;  4XOT A;  3N4M A;  4N9I A;  2TCT A;  4M9Z A;  3OL3 A;  3W6V A;  4BXX J;  3I4M J;  2WBM A;  1VQP I;  3S15 J;  5CJ9 A;  4D5F A;  3QPL A;  3PJR A;  2IXS A;  5IOZ A;  2M2E A;  1WJ5 A;  1ZKG A;  3DPL C;  4MQV A;  1IDY A;  3V7S A;  2W7N A;  5IYB J;  5E1X A;  4C9Y A;  5M5X J;  3F22 A;  5J40 A;  1R9T J;  1VQ7 I;  1X58 A;  4EGZ A;  2PLY A;  4UHT A;  2KZG A;  2XHK A;  2BY2 A;  2VPL A;  1XGM A;  2KLO A;  1RNL A;  2R7T A;  1CGP A;  3AKZ A;  3JRD A;  4B3X A;  2LC2 A;  4ENK A;  4C3I J;  3JRB A;  2Q1Z B;  1L0O C;  3ASO H;  1MMD A;  1P4X A;  4LIT A;  1IO2 A;  1WZ2 A;  2OZ6 A;  5BOX A;  3S3M A;  2ZJP F;  1PP8 F;  2E1C A;  2BY3 A;  3ML6 A;  5CLS A;  4HDU A;  1IGN A;  1MDM A;  4BDZ A;  1P9Q C;  3EYY A;  3V8J A;  4UXN A;  2MLG A;  3RIR A;  2WAE A;  1OCR H;  4D9J A;  4Q47 A;  2OAZ A;  3VFZ A;  1FPQ A;  1YHQ I;  1D0Z A;  1DP3 A;  1SD7 A;  3EDP A;  3QOP A;  2QUF A;  1OCT C;  4A5N A;  2YUS A;  4B43 A;  2HGC A;  2E19 A;  3ZQH A;  1MBF A;  3J81 Z;  1ODD A;  1O3S A;  1TT0 A;  1VI0 A;  2VQC A;  2CG4 A;  3C7J A;  3ZQF A;  1QVU A;  2BE5 F;  1SMY F;  2EK5 A;  1FJL A;  5C44 J;  5HLG A;  3ZPL A;  5D5V B;  4GYI A;  4IHW A;  5ICE A;  2X1D A;  3LA3 A;  2XF6 A;  2PX9 A;  2BY1 A;  1OR7 A;  3K6G A;  3LOC A;  3OY9 A;  3BR2 A;  2O6G E;  4KNY A;  2R5Z B;  3E6B A;  4EJU A;  3J7Z I;  1OYW A;  1YYV A;  3JSP A;  1VQ4 I;  1ACI A;  3LSG A;  1K61 A;  2EZI A;  1CF7 A;  1X1A A;  2KJB A;  1TQM A;  4XLH A;  2WA0 A;  3HL2 A;  1DDN A;  4MO7 A;  3CCJ I;  3OIP A;  5HNH A;  3O3K A;  2K7L A;  2EFW A;  4QLC U;  3CCR I;  4MTD A;  1UHM A;  3M4O J;  4ZYG A;  1R22 A;  2MG4 A;  3JTH A;  3H5R A;  3ZGK A;  4HLY A;  2P5L C;  1W5T A;  4XBF A;  4PJM A;  3KE2 A;  3OOU A;  4XIC A;  3WTT C;  3H0G J;  3BTL A;  4N0B A;  4XLN F;  4AIH A;  1AKH B;  5KK1 A;  4CCO A;  1FYM A;  1T38 A;  2KRH A;  1MBJ A;  1R5I D;  1TWF J;  3TO9 A;  5DEQ A;  3PUF A;  2FQ4 A;  3KEY A;  3DPT A;  1GXP A;  3S2W A;  2RRE A;  3M8E A;  3CLQ A;  4GO1 A;  4QTR A;  3GTK J;  2X6W A;  4YII A;  3VWB A;  2FEZ A;  1MGT A;  3B02 A;  2P81 A;  4BEH B;  3BG6 A;  3AG1 H;  1JKQ C;  1GVJ A;  4HAM A;  2R7O A;  3KZZ A;  3A01 B;  2ISY A;  4CUG A;  4A3B J;  2CW7 A;  4QWQ A;  2HOE A;  2Q8K A;  3GYH X;  3TO7 A;  1W7P A;  4XRF A;  2XUB A;  5E3O A;  5LGU A;  1EKE A;  2HQR A;  2HZT A;  5DS9 A;  1BW6 A;  1OYY A;  1PJR A;  3MWM A;  3G3Z A;  4RB3 C;  4U0Y A;  2L01 A;  2L5Q A;  3DWL E;  1FNN A;  2PN6 A;  2Y2Z A;  2NVU B;  3G1L A;  2CQ7 A;  5FRN A;  3BLY A;  3TO6 A;  4HG2 A;  3S93 A;  3WTW C;  5FKL A;  3RSN A;  3WTS C;  4C2T A;  3DP7 A;  2AQE A;  2ZSH B;  2JMW A;  3ABL H;  2CH0 A;  3U1K A;  5F0H A;  1P92 A;  1LKX A;  3AG4 H;  3E6C C;  4HV5 A;  1FOX A;  1ITY A;  3RZD J;  1S7E A;  3I56 I;  3ZP5 A;  3W2V A;  4HX4 A;  4CHU A;  3BR3 A;  3KLN A;  5GPA A;  1ZHF A;  3OYA A;  4IHT A;  4IQ4 A;  2IBD A;  3GO5 A;  1D0X A;  2DA7 A;  5D6F A;  1IDZ A;  4XLC A;  3S2D J;  4WXD A;  2F48 A;  2ZKZ A;  3CP8 A;  3PO3 J;  1MSF C;  4ZC3 A;  3ZQQ A;  1LDK B;  4LD5 A;  5LHI A;  3BWG A;  1E3O C;  1BA5 A;  2DOD A;  3QP5 A;  3O8H A;  2UXN A;  5E3L A;  2QQA A;  1HST A;  1X19 A;  1ZAR A;  2QCO A;  4UVC A;  4A0X A;  1LVK A;  1B8I A;  2N8G A;  2IGM A;  5H20 A;  2Y75 A;  4NB5 A;  2AO9 A;  1E17 A;  4X6A J;  1QNT A;  3MCZ A;  3VEP A;  2ELH A;  2E71 A;  4YIR X;  1D1A A;  5GPC A;  3GUD A;  1LNW A;  1B59 A;  2EA4 A;  3L2Q A;  4HST A;  3SZP A;  3JRE A;  3MAJ A;  2CRG A;  4IEJ A;  2GA1 A;  2TDX A;  3A0B C;  1Z91 A;  4E70 A;  4KIB A;  4M74 A;  4G7H F;  3FK6 A;  2E2H J;  1A04 A;  1Z05 A;  2M4G A;  2MSY A;  1J9I A;  1XTA A;  4BJ6 C;  2FJ1 A;  1EJ9 A;  1QVT A;  1ZK8 A;  2KPM A;  1MNM C;  3J81 K;  5D6E A;  1GUU A;  2MGQ A;  3BC8 A;  2NOJ B;  5HLT A;  2ZME C;  3OYF A;  2ELJ A;  4BXU A;  5L3G A;  1W5S A;  4XRS A;  2E5Z A;  4BQN A;  3J7A Y;  4MQ9 F;  4U88 A;  2D1H A;  4EM2 A;  4Z6Y A;  4EGY A;  4HDV A;  2NXN B;  4CYD A;  2YU9 J;  4OIN F;  4X0G A;  3PO2 J;  1XMX A;  3OOP A;  1Z67 A;  4IL6 C;  4NBQ A;  1XB4 A;  2OQR A;  2CJJ A;  2E2J J;  3Q0W A;  5LBQ A;  2XC7 A;  3QPT A;  3A01 A;  1O3R A;  3W2A A;  2F5D A;  1ZR2 A;  4A3C J;  3TOA A;  5B66 C;  3O8G A;  2EPF A;  4BJ5 C;  5C3E J;  1SC7 A;  3S3O A;  3G6E I;  2QGU A;  3IWZ A;  3WGG A;  2I5U A;  1JT0 A;  3I64 A;  2ZSI B;  5IP7 J;  2FUG 2;  1MMG A;  2JTV A;  3SQN A;  5FJ8 J;  1Z21 A;  1ONV A;  2AXL A;  2VOO A;  1R6R A;  5LGT A;  3F6O A;  5GTH C;  1GV2 A;  4D1Q A;  2E36 A;  1YG2 A;  1X1B A;  1TTY A;  3CCQ I;  3VYT B;  2F5V A;  5F1R A;  2PQ8 A;  1RZ4 A;  1BOB A;  2E1M C;  3MKL A;  3JR9 A;  3H3Z A;  1AOY A;  2HQ5 A;  5DUK A;  2DJN A;  2PMZ N;  3OL4 A;  3LFK A;  5FRO A;  2X6O A;  2BV6 A;  3ISP A;  3GVA A;  3NWS A;  3HTS B;  2K3P A;  1VQK I;  4AWX B;  1KQ0 A;  2KIQ A;  3HUG B;  2ZNY A;  2E1O A;  1U5T A;  3FHN A;  2CUJ A;  2IAI A;  3HOY J;  4A3M J;  2DLL A;  1LB2 A;  4RAG A;  3COA C;  1YRN B;  4HSR A;  4HRI A;  1QHG A;  3H0D A;  2MBF A;  4C2U A;  1R49 A;  3MKZ A;  3ZR8 X;  5J1U A;  5E1Z B;  1QQI A;  3IKV A;  5J1R A;  5GAG J;  4M6X A;  2JRM A;  1N25 A;  2Z99 A;  4NC7 A;  1MSE C;  5IT9 K;  4GRI A;  1BBY A;  3O6B B;  1DUX C;  4BHC A;  2KMU A;  2FA5 A;  2O7O A;  3R61 A;  4OMY A;  2ICW G;  5BNG A;  3HPH A;  1EH8 A;  2CGP A;  5KHD A;  2HTJ A;  2RNG A;  2WY7 Q;  1HW5 A;  2LY1 A;  1BIA A;  4DBR A;  1J59 A;  1SAN A;  1AA7 A;  1EH7 A;  3QYF A;  4GDF A;  2V6C A;  3ZMS A;  1MMA A;  3X2Q H;  4BAC A;  1FWZ A;  2PJP A;  4KT6 A;  4G6D A;  1XMA A;  1YOV B;  1IUY A;  2XKO A;  3DEE A;  5EZH A;  2BVM A;  4IRG A;  4BDY A;  4EJO A;  5FRM A;  4ZDL A;  2BOL A;  3OYD A;  2H6B A;  1I1G A;  2MYS A;  2ZJQ F;  5IY5 H;  1U5T B;  3M3Y J;  1WCM J;  4XKV A;  3BQZ A;  2EV5 A;  4XOR A;  3GFJ A;  5ED4 A;  3LNQ A;  3GX4 X;  1MNE A;  5ILV A;  2NVT J;  4PGH A;  2R7R A;  2XPW A;  3I4N J;  2Y31 A;  2UXX A;  2VT2 A;  3N97 A;  1TW3 A;  3K4B A;  2RDP A;  3PNY A;  3OYB A;  2P8T A;  5KVR A;  1A6I A;  1P4W A;  5EGO B;  5DTD A;  4FQG A;  2YU3 A;  1G59 A;  4ZTF A;  1QPM A;  3G71 I;  1LUJ B;  2HNH A;  2XGX A;  1DPU A;  4EAT A;  4B4C A;  1RR7 A;  5KCM A;  3RI4 A;  3WU1 B;  2HXI A;  2QKM B;  2DOA A;  3BR5 A;  2VE8 A;  3CMY A;  2CV0 A;  3BZK A;  1FP1 D;  1EF4 A;  2BVL A;  2JA6 J;  1S7A A;  3DV8 A;  2LP0 A;  3KFW X;  3P7N A;  1HQC A;  2VUM J;  1MJ9 A;  3RKX A;  2E7X A;  1RES A;  4UV8 A;  1BR4 A;  1G6N A;  2VL8 A;  2XAF A;  2PFB A;  1JKR C;  4WF2 A;  1W36 C;  2H1K A;  2STW A;  3CES A;  3T8T A;  5E3M A;  3UR3 C;  2M7A A;  3HKZ N;  4A2U A;  4LLN A;  2CS3 A;  3IAS 2;  1NK3 P;  4KIF A;  4A5M A;  4WK8 F;  2A07 F;  1U3E M;  4JOM A;  2M34 A;  1LFP A;  2WY8 Q;  3GWZ A;  3L09 A;  3SEZ A;  5EEG A;  2FML A;  3ERM A;  4DNC A;  3SJM A;  3TDU C;  4BBS J;  4Y15 A;  3ABK H;  1XX5 A;  4S0H B;  2HEO A;  3GTP J;  3LFU A;  1O57 A;  1S5L C;  1Z9C A;  2ID6 A;  5DCM B;  3FXQ A;  2LD5 A;  2HQA A;  2QYO A;  2HVS A;  1X3U A;  4ESB A;  4KYW A;  3I58 A;  2XB0 X;  4I76 A;  5E1W A;  4AU7 A;  2NNN A;  2DK8 A;  1E0E A;  1IN8 A;  4B1R A;  1RUO A;  3FIW A;  1ZLK A;  5J3L A;  5FKO A;  2DN0 A;  1RPW A;  4RLQ A;  2JVG A;  1XSV A;  4H4K C;  4MEX F;  1TBX A;  3B6C A;  5EJC A;  3D0S A;  3HTU A;  2DFE A;  3EYI A;  4A6E A;  5IP9 J;  2E5N A;  2WAF A;  1JJ8 C;  1K78 A;  1V5E A;  2DYR H;  5DM7 F;  1UG0 A;  4CYC A;  2AXT C;  3N05 A;  2VXZ A;  2LBF A;  2BYV E;  4G6T B;  5D5X B;  3SDB A;  3LQR A;  2HU9 A;  2VC1 A;  4IOC F;  4MIM A;  1LEB A;  2D2W A;  2ZXH A;  3DLA A;  5BQT A;  3L2V A;  2HVQ A;  1BM9 A;  4Y3O A;  4UY8 I;  3RQI A;  2D1V A;  2O5R A;  5LD2 C;  1SAX A;  3HGG A;  2LSO A;  3CJR B;  3FM3 A;  3OS0 A;  1J75 A;  5EEA A;  2G0E A;  4RGU A;  1OFC X;  1ON1 A;  1WVR A;  3CME I;  2VOD A;  1KU2 A;  3BJO A;  1ZAO A;  1SFU A;  2XRN A;  1HKQ A;  2QZ8 A;  3BQY A;  3IH3 A;  4JX4 A;  5F27 A;  2VIX A;  3SYT A;  4RAY A;  2IS6 A;  3K2A A;  3F0C A;  5GP9 A;  3SFZ A;  3CF5 F;  4A3J J;  3S1R J;  4BKX A;  4M6V A;  3JRH A;  1BC8 C;  1IF1 A;  1G3T A;  3KET A;  1HCR A;  1DGR M;  3KP3 A;  2FOK A;  3I3L A;  5L3D A;  2R7S A;  2QVO A;  1RC9 A;  5HS7 A;  3SFI A;  1BR2 A;  5JR3 A;  1TQP A;  5LGN A;  1S7O A;  4UVA A;  4XOP A;  2ME6 A;  3QU3 A;  3LWF A;  2F4I A;  4C3J J;  3S8P A;  4PSW A;  1TQI A;  3GLL A;  5E3N A;  1A6Q A;  2GOX B;  2VB6 A;  2L9R A;  2ZME B;  3EQL F;  1N77 A;  1Z6T A;  4I2O A;  1V55 H;  5JLX A;  2KZV A;  4FET A;  3P9C A;  2L9V A;  5AIQ A;  4B3A A;  4BNC A;  1TT5 B;  4QPO A;  1JHH A;  3J80 K;  3DXJ F;  4A3G J;  4PFO A;  3FF5 A;  4I0A A;  3HOX J;  4M6Y A;  1ZG5 A;  1JT6 A;  4BEH A;  2K02 A;  2RAE A;  3TMO A;  5ICG A;  3VSK A;  4EJV A;  4RAF A;  2UZK A;  2FBH A;  1YS6 A;  4BJT A;  3JCU C;  2FQ3 A;  3L2U A;  5HS9 A;  2HXO A;  3IH2 A;  3GZ5 A;  1WQ2 A;  5IYC J;  3A02 A;  2OUM A;  2QSF X;  3CCV I;  3ABT A;  3BR1 A;  3KEO A;  3HM5 A;  4YFN F;  3OYK A;  1UZC A;  4XLP F;  1WFX A;  1FOY A;  3IWF A;  2KL4 A;  4AIJ A;  5F64 A;  2LY2 A;  3A0H C;  3H9J A;  2HS5 A;  2VQH A;  4LK0 F;  1JXS A;  3HEF A;  2Q0O A;  3OIO A;  5TGT A;  2QEX I;  1G2H A;  2DOE A;  3JW4 A;  4BHP A;  2DJI A;  1R1T A;  1RI7 A;  1XMK A;  4DGW B;  1JKP C;  1ZRF A;  3H3U A;  2RVC A;  1WSU A;  2JQ7 A;  1Z6R A;  3BG5 A;  2FNA A;  2MW8 A;  5D4R A;  2OA4 A;  4FT8 A;  4C30 A;  4ZH4 F;  1RKW A;  5ICF A;  2XGD A;  2JK3 A;  2CV2 A;  3K4L A;  3K69 A;  3KZY A;  3TDZ C;  1XSD A;  3FXR A;  3HG9 A;  4UUS A;  3FIS A;  2RC4 A;  3HZJ A;  2Y0M A;  4IRH A;  3QOD A;  1J5Y A;  2O61 A;  4F52 A;  2HDC A;  1MH3 A;  3HJE A;  5DCF A;  3KP4 A;  2K85 A;  3RCO A;  1TNS A;  3DF8 A;  2FSW A;  2WTE A;  3S1Q J;  2M9H A;  2VPR A;  3QPS A;  3BP8 A;  1ZR4 A;  2XAG A;  2ZC2 A;  5M5W J;  5TIS C;  4ABZ A;  3F8N A;  1AKH A;  4I6Z A;  1E3H A;  1USS A;  4XID A;  1QGP A;  4CDG A;  1D1B A;  3BJA A;  3FX3 A;  4IF4 A;  3I54 A;  2GLO A;  2JA7 J;  4ZDO A;  1B72 A;  5J47 A;  4DW6 A;  1SD4 A;  2I8D A;  3H1C A;  2OPT A;  3HC7 A;  2G7U A;  3IUO A;  1B9N A;  3GFI A;  1H88 C;  5DUI A;  2DFI A;  3E6M A;  2CO5 A;  3ZQL A;  2VI6 A;  2VAS A;  3ULQ B;  3BJ6 A;  1XGO A;  1O4X A;  3HB9 A;  3D5L A;  2CUE A;  1PUF A;  4RA2 A;  2DA1 A;  1S72 I;  4FX4 A;  2KFD A;  3S3N A;  4NNJ A;  2XVC A;  4XMY A;  4Z2Y A;  2WAQ A;  2ADU A;  1TL8 A;  5M5Y J;  2W48 A;  3H36 A;  2P5V A;  3M9A A;  5EYR A;  4M9X A;  3W3C A;  4FCY A;  2CFO A;  2DQR A;  1ZLJ A;  2BHY A;  5JHU A;  2IRF G;  3GTM J;  3OSG A;  2MLK A;  2OCE A;  3CUQ C;  3JAM K;  2PJR A;  3J80 Z;  1FMW A;  1KU3 A;  5FD5 A;  2BEO A;  1ERD A;  2P4W A;  2DA5 A;  4OOI A;  2CU7 A;  2XRL A;  3T5X A;  2KDO A;  2M5W A;  3MMY B;  2Y0S A;  3EET A;  2BHZ A;  5L3F A;  2WAD A;  2EIJ H;  1T8I A;  1LFU P;  5CVV A;  5HS8 A;  3G4S I;  1I50 J;  2F6C A;  4ZYA A;  2EIM H;  2EQR A;  2QBY B;  1W1W E;  2HKX A;  2CFX A;  1IAW A;  1BOA A;  6PAX A;  4YG2 F;  1ETO A;  4CCL A;  1MDM B;  2DK5 A;  3BPX A;  4F55 A;  5DDG A;  3CC4 I;  4UUV A;  4KMF A;  4NDL A;  3CUO A;  2LRD A;  3EUH C;  1P7I A;  3CMA I;  3HHH A;  5C4X J;  3ABM H;  1JUM A;  2DFF A;  1HBX G;  3TGN A;  3I0T A;  3G1O A;  5HNF A;  2W1O A;  3BTJ A;  4U87 A;  1SVL A;  5DM6 F;  3HXL A;  1ETW A;  3BG7 A;  4GGG A;  1UCR A;  2OTL I;  4IHV A;  4M3E A;  5L3C A;  2M0C A;  4Y33 A;  1LE8 A;  1MW7 A;  3ZQI A;  4XON A;  3IKT A;  1ZRC A;  1JUP A;  3K4N A;  2RNJ A;  1VND A;  1LE8 B;  1AHD P;  4L0Z B;  4A93 J;  5M3F J;  1QZZ A;  5BS6 A;  5H2F C;  4IHX A;  3RKY A;  3E7L A;  1ULY A;  3ZMZ A;  5GAD J;  3I59 B;  4O3M A;  4BGD A;  1G3S A;  1O3Q A;  2JUC A;  3I9V 2;  3MZY A;  3NQO A;  3QWL A;  2NOG A;  2R7Q A;  4MTE A;  3S17 J;  1OR7 C;  4BUP A;  5FD6 A;  4OMZ A;  4KIS A;  3C2H A;  1V54 H;  2LF8 A;  3FZV A;  3PSF A;  4EJW A;  2NAZ A;  3ZRG A;  2OCC H;  2IA1 A;  2IA0 A;  4GXO A;  2X85 A;  5IOY A;  2JUG A;  4WX9 A;  3GTQ J;  4U7D A;  3OS1 A;  3V8L A;  4XLE A;  1A35 A;  3OYH A;  1QZY A;  3KPH A;  4LB5 A;  3FMQ A;  1G3W A;  4B44 A;  3FXO A;  1BN5 A;  1POG A;  3U9G A;  4L18 B;  3LA7 A;  5BPI A;  3QPH A;  2DMP A;  2CQN A;  2O3F A;  5CYV A;  3SDG A;  3CCE I;  2K27 A;  1WRJ A;  1I3Q J;  3LSM A;  1R36 A;  4KDP A;  1Y0U A;  4CGZ A;  1UJ8 A;  4HLX A;  1JUS A;  3F8B A;  3MN2 A;  2M4K A;  4ENM A;  2XB5 A;  3M7G A;  4MEY F;  9ANT A;  4X1E A;  2DT5 A;  1D8J A;  1D5Y A;  2IJL A;  1GDT A;  2D45 A;  4MHG A;  2L02 A;  1SVO A;  3WGH A;  2Z3Y A;  1IG7 A;  1FIP A;  4OAY A;  5K5Q A;  1K4T A;  3WTU C;  3BZC A;  2BZT A;  2Q2E B;  5LEK A;  2FE3 A;  1ZEL A;  3LAP A;  1S3J A;  2AHQ A;  4P9U A;  1DPR A;  1IW7 F;  2A68 F;  3OR2 C;  1YJN I;  4OIQ F;  3NRV A;  2LTP A;  1YQA A;  1SFE A;  2BY0 A;  1VQO I;  3E0J B;  2JSP A;  2J5O A;  3H3V K;  2ID3 A;  2CUZ A;  1UB9 A;  5A2Q Z;  1ZH5 A;  2ECB A;  4FHT A;  2UWM A;  1YX3 A;  1LQ1 A;  2OTJ I;  2R93 J;  3IHU A;  2JN6 A;  5F6F A;  4ZTJ A;  4ZJZ A;  3DBR B;  1XPX A;  4M3B A;  2PBI A;  2IA2 A;  1MJB A;  4RMN A;  5BMZ A;  3F21 A;  1OQY A;  3A2K A;  3BT9 A;  4I09 A;  2HYG D;  3JRG A;  1OCO H;  3GTG J;  4ON0 A;  1X1P A;  1U9N A;  4KJZ A;  4II3 A;  3ASN H;  1WJC A;  1YW9 A;  3PFI A;  4BBR J;  2VLA A;  4D7M A;  1VQ9 I;  2LNB A;  2R5Y B;  4II2 A;  1A36 A;  1U2W A;  2CQX A;  3D5S C;  5LRS A;  3FBN B;  1P7J A;  2R5Y A;  1WGX A;  3I71 A;  2ZJ2 A;  2C6Y A;  2NVQ J;  1S8N A;  2QQ9 A;  2XPU A;  5JHF A;  2F5C A;  2R7Z J;  1ETX A;  2NS0 A;  1SEU A;  4RDU A; 
#chains in the Genus database with same CATH homology
 3T8R A;  4H0E A;  1G4D A;  4OIP F;  5H6R A;  2ZCW A;  3VOE A;  2VT3 A;  5CVI A;  4RB0 A;  2NRA C;  1HSJ A;  2OZU A;  1XCV A;  3OV8 A;  4B8X A;  2O03 A;  2W85 A;  3TOB A;  5J8C A;  5IT9 Z;  1R1V A;  4R79 A;  3FMS A;  3CUQ B;  5HDG A;  3P9K A;  4BQA A;  2JPC A;  5FFZ A;  4YIF A;  1XDS A;  1R1U A;  3KP5 A;  5K5R A;  5ILS A;  4BHB A;  3E3V A;  4LLL A;  2XIG A;  4PDK A;  2DBB A;  2V1U A;  2O8X A;  3L2C A;  1KGS A;  1U6G A;  1F5T A;  2GQQ A;  1FLI A;  4KFC A;  1V4R A;  4ZYH A;  4PCQ A;  3R0J A;  4HW0 A;  2WC2 A;  3HRM A;  4P55 A;  3F8F A;  3M8F A;  1R00 A;  4AD9 A;  2FNP A;  3F8C A;  1ZN2 A;  4EVI A;  2R7F A;  3HYI A;  5L3E A;  2E7W A;  5AON A;  2COM A;  2OU2 A;  4S05 A;  4HQE A;  4RGX A;  5DD4 A;  4ESJ A;  3CTA A;  1FYK A;  1SMT A;  5HDK A;  5JI6 A;  4K2E A;  4Y13 A;  1DP7 P;  1XSX A;  1KU7 A;  2ETH A;  2GWR A;  3ECO A;  4DQ2 A;  4EMS A;  3WTZ A;  4IJA A;  1SD5 A;  3BY6 A;  3BZ6 A;  4FX0 A;  4U0W A;  3GLX A;  3K2Z A;  1K78 B;  3GEZ A;  1YTY A;  5DCM A;  1R23 A;  1R5H A;  3F8M A;  2GXG A;  5FO5 A;  2CSO A;  3REO A;  2KJC A;  2MH2 A;  1LVA A;  1IZ1 A;  4ETS A;  3K1P A;  3LQQ A;  3RTR A;  2ZBK A;  3ZMU A;  1JGS A;  1S6L A;  4L9N A;  2DU9 A;  2H09 A;  3ZQ7 A;  4L5J A;  2Z9O A;  3TKY A;  3W6K B;  1ZRE A;  2Y48 A;  2GXB A;  2FXA A;  1T6S A;  1UHW A;  4L5I A;  2EV0 A;  4A12 A;  4LG0 A;  2A69 F;  4KUM A;  1NHA A;  3T0Y A;  4BYY A;  1U5T C;  2DO7 A;  3QP6 A;  3NEU A;  1BI3 A;  1XCB A;  4OIR F;  2L4M A;  3BRO A;  2P6S A;  1XGS A;  1XGN A;  1YS7 A;  3R6S A;  4KMU X;  2M45 A;  5LEJ A;  2QM3 A;  1ON2 A;  4WWC A;  4L9T A;  2WV0 A;  5BPD A;  1HW2 A;  4L0Y B;  3FWE A;  2M87 A;  1T2K A;  1R5G A;  5A2Q K;  3K1N A;  2ISZ A;  3CJN A;  2QEN A;  5K1Y A;  3AAF A;  4ENJ A;  1YO5 C;  5FFX A;  3JSO A;  1FX7 A;  2AS5 F;  1K7A A;  1OMI A;  1Z7U A;  2STT A;  3L9F A;  4IVN A;  3DFG A;  2IT0 A;  4LMY A;  1H0M A;  1UST A;  1ZGJ A;  2B0L A;  1H9G A;  2KIM A;  3L00 A;  2JPB A;  1R58 A;  3V7R A;  3W6J B;  1JE8 A;  2XV4 S;  1K79 A;  1E2X A;  4UV9 A;  3IC7 A;  1XDU A;  1BI0 A;  2HR3 A;  2GIV A;  3HUG A;  1BC7 C;  3MZH A;  3GFM A;  2YPR A;  4HOB A;  4HF2 A;  3J7A O;  4HA8 A;  4AIK A;  3BDD A;  1O7F A;  2FMY A;  1HXD A;  2DAO A;  2EWN A;  2RKH A;  3PQJ A;  4HX7 A;  5DV5 A;  4OIO F;  1OPC A;  1J2X A;  4O6J A;  1BJA A;  3ERE D;  1IN6 A;  3C18 A;  5DD8 A;  1FY7 A;  4UVB A;  4LB6 B;  4HYE A;  3RPU A;  4EQQ A;  2VBZ A;  4M71 A;  3SZT A;  4R8H A;  3F72 A;  2MH9 A;  1FOK A;  2W57 A;  1YLF A;  3CDH A;  5CVU A;  2MD5 A;  2KKO A;  4I01 A;  4HBL A;  3FXU A;  4NQW A;  3H92 A;  4G9Y A;  2DI3 A;  1H9T A;  2VOP A;  3QAH A;  2G9W A;  2YX4 A;  4Q5S F;  2IVM A;  2LF7 A;  3WU0 A;  1G3Y A;  2W25 A;  3ELK A;  2W84 A;  1IRF A;  2XAJ A;  5HOO A;  1O3T A;  3RKW A;  4LLG F;  1STZ A;  1HKS A;  4P9F A;  1OKR A;  2KIU A;  2HTS A;  4G94 A;  3HOS A;  3I4P A;  1EH6 A;  3JAM Z;  3Q9V A;  3RPQ A;  2X0L A;  5JVT A;  5E18 F;  2QLZ A;  1D5V A;  4Y17 A;  5EEH A;  2OD5 A;  2NNY A;  4LJZ F;  2OBP A;  3KP2 A;  2OQG A;  2V9V A;  3FMR A;  4LK1 F;  2QWW A;  3F23 A;  4ZZD A;  1F9N A;  2YX7 A;  4EV0 A;  2NYX A;  4IRI A;  3E6D A;  1D8K A;  2RN7 A;  1FSE A;  1TLH B;  1ZGA A;  2EA2 A;  4MGR A;  1PP7 U;  1YIO A;  4O5V A;  4S04 A;  4IXA A;  3ROU A;  3ZMD A;  5K5O A;  5ICC A;  1KU9 A;  5HDN A;  4MNU A;  3FHZ A;  2EJR A;  1IRG A;  1Q1H A;  4JQF A;  3KCC A;  4RB1 A;  2Z33 A;  1FT9 A;  4KA4 A;  4U7B A;  2V1X A;  4A0Y A;  4HF1 A;  3V4G A;  2HWV A;  4L9V A;  5HLI A;  2P7V B;  2P6T A;  3HIF A;  2CQK A;  2XAH A;  4ENN A;  2V1D A;  2O0Y A;  4LG0 B;  1LDJ A;  3ZMT A;  4HQM A;  5LLQ A;  5ERI A;  1P2F A;  4P5O A;  2K86 A;  1CF7 B;  2DTR A;  2JZY A;  4ZZL A;  1ZG3 A;  4Q48 A;  1KYZ A;  2M1B A;  2PEX A;  2VBW A;  4P96 A;  2IP2 A;  3GXO A;  3Q9S A;  3RDI A;  1MD0 A;  3HRU A;  5LHG A;  1IN5 A;  2FRH A;  2HKO A;  1O7L A;  4ASN A;  1MKM A;  5JFR A;  2K4J A;  4M73 A;  4B09 A;  5E8I A;  1KQ9 A;  3DQV C;  2ZNZ A;  3ZMV A;  2EFP A;  4U0V A;  1L3L A;  2RGV A;  4RGR A;  2RV8 A;  2MA3 A;  3LA2 A;  3BOQ A;  4G7O F;  1J7K A;  1FP2 A;  1W7P B;  2FF4 A;  5D4S A;  2PG4 A;  4GCV A;  5E17 F;  1MJA A;  3HOT A;  5D8K B;  2M8E A;  4GYG A;  3WTX C;  1XN7 A;  3K9T A;  5H6Q A;  4A6D A;  1BIB A;  1U8R A;  5LRR A;  3K0L A;  2FBI A;  5TJJ A;  3KEQ A;  1W7P D;  2CYY A;  3WTY C;  5FLX Z;  3CLO A;  1XD7 A;  2R3S A;  2Z5U A;  1HKT A;  1IXS B;  1FZP B;  3I5U A;  2CWE A;  1P4A A;  3V8K A;  3EUH A;  4BAY A;  3MEX A;  3WE2 A;  1F1Z A;  2K4B A;  1IXR C;  4L9J A;  1B9M A;  2H94 A;  4HZF A;  1ZYR F;  2ZXJ A;  1I5Z A;  2VBY A;  2BGC A;  1FBU A;  4I98 B;  4JBA A;  1KQ8 A;  1UFM A;  4D0P A;  5IT3 A;  3TQN A;  3E5U A;  3R60 A;  2GZW A;  4ZYE A;  1SD6 A;  2YR2 A;  3CO7 C;  2VON A;  2Q2E A;  3HHG A;  3DEU A;  3WOD F;  2XAQ A;  3HRT A;  3R4K A;  3MFK A;  2HFH A;  2ESN A;  3E97 A;  4YFK F;  2KRF A;  3RJP A;  2DPU A;  5D5U B;  2IW5 A;  4XSZ F;  4CO8 A;  1BI1 A;  5FGM A;  2W24 A;  2VBX A;  5D8L B;  4ESF A;  1BI2 A;  2VE9 A;  2XKP A;  4RB2 C;  3MQ0 A;  3C3W A;  4YFX F;  3U2R A;  2QBY A;  2JSC A;  5HVQ C;  2A3S A;  3HSF A;  4HV6 A;  4M9S A;  3L7W A;  1U78 A;  1WKM A;  3E5Q A;  5DYM A;  2PMH A;  3KP6 A;  4WXH A;  3WG9 A;  2L54 A;  1LEA A;  5FB2 A;  3SXY A;  2ZFW A;  1ZG1 A;  1FYL A;  4HF0 A;  3WE3 A;  3Q5F A;  1T0F A;  3HRS A;  3F6V A;  2PI0 A;  2F2E A;  2L3D A;  2XRO A;  4G7Z F;  2DPD A;  5L3B A;  1FBQ A;  4UNO A;  2VN2 A;  1IN7 A;  2LKP A;  3P9I A;  2GA2 A;  3VB2 A;  2MC3 A;  2RQP A;  2HYF A;  4IHS A;  3LAJ A;  1V3F A;  3ECH A;  3WTV C;  1FSH A;  2PMU A;  1T39 A;  2A6H F;  1AWC A;  3WGI A;  3QRF F;  5CVR A;  3IRR A;  2JT1 A;  3B73 A;  5AIP A;  4RGS A;  2JRT A;  1GHC A;  4HX8 A;  4LFU A;  2FBK A;  1HW1 A;  4WCG A;  1ZRD A;  4N9H A;  4TV7 A;  1YW7 A;  2ACJ A;  2ZME A;  1QO0 D;  1P6R A;  3G73 A;  1C0W A;  3ZN1 A;  1F4K A;  1PDN C;  5FLX K;  2IPQ X;  1S29 A;  2FU4 A;  4A0Z A;  2A6E F;  2G7H A;  1B1B A;  1VTN C;  2EFQ A;  5J8F A;  4BH9 A;  1B6A A;  3C1D A;  3I59 A;  4EM1 A;  2A5Y B;  2LDU A;  3GF2 A;  1D3Y A;  4WXC A;  3KLO A;  4OU0 A;  3KP7 A;  2BBY A;  3JTG A;  3E5X A;  5CVJ A;  4PZJ A;  5ILU A;  1JHF A;  3O2P E;  1IN4 A;  1K6O A;  2R7D A;  1REP C;  1W4M A;  4R1H A;  1QBJ A;  3U1D A;  1OYI A;  5J6X A;  1WWX A;  2KIF A;  1T98 A;  2E1N A;  4KT5 C;  1RUN A;  3CUQ A;  5TRD A;  4NHJ A;  3GZ6 A;  1RIO H;  3IRQ A;  3VOD A;  4CZZ A;  4KIG A;  3CO6 C;  3V7C A;  1Z1D A;  4XSX F;  3F3X A;  1I1S A;  4RAZ A;  3I53 A;  3K1M A;  3DKW A;  4EM0 B;  4EJT A;  1I6X A;  2QQB A;  5E8G A;  1LDD A;  1I27 A;  4PGG A;  5HLH A;  4CXF A;  3QU6 A;  3IL2 A;  1IXC A;  4JK1 X;  2EV6 A;  1SFX A;  4G6Q A;  2ZO4 A;  2P5K A;  2X4H A;  3HSR A;  4KIC A;  1MZB A;  2EFN A;  2A61 A;  4LGW A;  5D5W B;  1KYW A;  1FBS A;  2V79 A;  4CIC A;  4I0B A;  1J0R A;  3RYP A;  5E20 A;  4I7H A;  2GAU A;  3GW2 A;  1TNT A;  2L4A A;  2H6C A;  1YW8 A;  2CW0 F;  4IPA A;  2DW4 A;  2DQL A;  3ABU A;  1GXQ A;  2ESH A;  2EFO A;  3RYR A;  1R7J A;  3ZN0 A;  2WWY A;  2YSR A;  3T1B A;  3R0A A;  1LJ9 A;  3LST A;  4G8X A;  2HQN A;  4I02 A;  1TW2 A;  2P7C B;  4Q4Z F;  2H27 A;  4KN7 X;  4RS8 A;  2M30 A;  3GFL A;  2EB7 A;  1KA8 A;  2VC0 A;  1FC3 A;  3M1E A;  1YFH A;  1EV7 A;  3SHF A;  4M72 A;  3HSE A;  5LHH A;  4AVP A;  3FM5 A;  4F7Z A;  2XAS A;  4ZYD A;  4KN4 X;  2F5F A;  1WI9 A;  1B4A A;  3BPV A;  3PQK A;  2F5E A;  2J5P A;  3N4M A;  4N9I A;  4M9Z A;  5CJ9 A;  3DPL C;  4MQV A;  3V7S A;  5E1X A;  3F22 A;  4EGZ A;  2PLY A;  4UHT A;  2XHK A;  1XGM A;  1RNL A;  1CGP A;  4ENK A;  1L0O C;  1P4X A;  2OZ6 A;  5BOX A;  2E1C A;  1PP8 F;  3ML6 A;  5CLS A;  4HDU A;  1MDM A;  3EYY A;  3V8J A;  4UXN A;  2MLG A;  3RIR A;  4Q47 A;  2OAZ A;  3VFZ A;  1FPQ A;  1SD7 A;  3EDP A;  3QOP A;  2QUF A;  4A5N A;  2HGC A;  3J81 Z;  1ODD A;  1O3S A;  2CG4 A;  3C7J A;  2BE5 F;  1SMY F;  2EK5 A;  5HLG A;  3ZPL A;  5D5V B;  4GYI A;  5ICE A;  3LA3 A;  1OR7 A;  2O6G E;  4KNY A;  3E6B A;  4EJU A;  1OYW A;  1YYV A;  3JSP A;  1CF7 A;  2KJB A;  1TQM A;  1DDN A;  3O3K A;  2K7L A;  2EFW A;  4QLC U;  4MTD A;  1UHM A;  4ZYG A;  1R22 A;  3JTH A;  4HLY A;  2P5L C;  1W5T A;  4XBF A;  3KE2 A;  3WTT C;  4N0B A;  4XLN F;  4AIH A;  5KK1 A;  1FYM A;  1T38 A;  3TO9 A;  5DEQ A;  3DPT A;  1GXP A;  3S2W A;  3M8E A;  4GO1 A;  4YII A;  2FEZ A;  1MGT A;  3B02 A;  1GVJ A;  4HAM A;  3KZZ A;  2ISY A;  4QWQ A;  2HOE A;  2Q8K A;  3GYH X;  3TO7 A;  1W7P A;  4XRF A;  2XUB A;  5LGU A;  2HQR A;  2HZT A;  1OYY A;  3MWM A;  3G3Z A;  4RB3 C;  4U0Y A;  2L01 A;  1FNN A;  2PN6 A;  3TO6 A;  3WTW C;  3WTS C;  3DP7 A;  1P92 A;  3E6C C;  4HV5 A;  3ZP5 A;  4CHU A;  4HX4 A;  3KLN A;  1ZHF A;  4IHT A;  3GO5 A;  5D6F A;  4WXD A;  2ZKZ A;  1LDK B;  4LD5 A;  5LHI A;  3BWG A;  3QP5 A;  2UXN A;  2QQA A;  1HST A;  1ZAR A;  4UVC A;  4A0X A;  5H20 A;  2Y75 A;  4NB5 A;  1E17 A;  1QNT A;  3MCZ A;  3VEP A;  2ELH A;  3GUD A;  1LNW A;  1B59 A;  2EA4 A;  3SZP A;  3MAJ A;  2GA1 A;  2TDX A;  1Z91 A;  4E70 A;  4KIB A;  4M74 A;  4G7H F;  1A04 A;  1Z05 A;  1J9I A;  3J81 K;  5D6E A;  4BXU A;  5L3G A;  1W5S A;  4MQ9 F;  4U88 A;  2D1H A;  4EM2 A;  4EGY A;  4HDV A;  4CYD A;  4OIN F;  3OOP A;  1XB4 A;  2OQR A;  5LBQ A;  1O3R A;  3QPT A;  2F5D A;  3TOA A;  3IWZ A;  3WGG A;  3I64 A;  2JTV A;  3SQN A;  1ONV A;  2AXL A;  2VOO A;  5LGT A;  3F6O A;  1YG2 A;  1TTY A;  5F1R A;  2PQ8 A;  1RZ4 A;  1AOY A;  3H3Z A;  5DUK A;  3LFK A;  2BV6 A;  3ISP A;  3GVA A;  3HTS B;  4AWX B;  1KQ0 A;  2ZNY A;  1U5T A;  2DLL A;  1LB2 A;  3COA C;  2MBF A;  5E1Z B;  1QQI A;  3IKV A;  4M6X A;  2Z99 A;  5IT9 K;  1BBY A;  3O6B B;  1DUX C;  4BHC A;  2FA5 A;  3R61 A;  4OMY A;  1EH8 A;  2CGP A;  2HTJ A;  1HW5 A;  1BIA A;  1J59 A;  1EH7 A;  2V6C A;  3ZMS A;  1FWZ A;  2PJP A;  4G6D A;  1XMA A;  1IUY A;  2XKO A;  4IRG A;  4EJO A;  2H6B A;  1I1G A;  1U5T B;  2EV5 A;  5ED4 A;  3GFJ A;  3GX4 X;  5ILV A;  4PGH A;  2UXX A;  2VT2 A;  3N97 A;  1TW3 A;  2RDP A;  2P8T A;  5KVR A;  1P4W A;  2YU3 A;  1QPM A;  2XGX A;  1DPU A;  3RI4 A;  3WU1 B;  2VE8 A;  1FP1 D;  1S7A A;  3DV8 A;  3KFW X;  3P7N A;  1HQC A;  1MJ9 A;  3RKX A;  2E7X A;  1PUE E;  4UV8 A;  1G6N A;  2XAF A;  2PFB A;  4WF2 A;  2STW A;  3T8T A;  4A2U A;  4LLN A;  4KIF A;  4A5M A;  4WK8 F;  2A07 F;  1U3E M;  3GWZ A;  3L09 A;  5EEG A;  2FML A;  4DNC A;  3TDU C;  4Y15 A;  2HEO A;  1O57 A;  1Z9C A;  5DCM B;  3FXQ A;  2QYO A;  1X3U A;  4ESB A;  4KYW A;  3I58 A;  5E1W A;  2NNN A;  2DK8 A;  1IN8 A;  1RUO A;  1ZLK A;  1XSV A;  4MEX F;  1TBX A;  3D0S A;  3HTU A;  3EYI A;  4A6E A;  1K78 A;  2VXZ A;  2BYV E;  5D5X B;  3LQR A;  2VC1 A;  1LEB A;  2D2W A;  5BQT A;  1BM9 A;  2D1V A;  1SAX A;  2LSO A;  3FM3 A;  1J75 A;  4RGU A;  1ON1 A;  2VOD A;  1KU2 A;  3BJO A;  1ZAO A;  1SFU A;  2XRN A;  1HKQ A;  2QZ8 A;  4RAY A;  3SFZ A;  1BC8 C;  1IF1 A;  1G3T A;  3KET A;  3KP3 A;  2FOK A;  5L3D A;  2QVO A;  5HS7 A;  5JR3 A;  5LGN A;  1TQP A;  1S7O A;  4UVA A;  3QU3 A;  3LWF A;  1TQI A;  2ZME B;  3EQL F;  1Z6T A;  4I2O A;  3P9C A;  5AIQ A;  4BNC A;  1JHH A;  3J80 K;  3DXJ F;  3FF5 A;  4I0A A;  1ZG5 A;  4M6Y A;  2K02 A;  5ICG A;  4EJV A;  2UZK A;  2FBH A;  1YS6 A;  2FQ3 A;  5HS9 A;  3GZ5 A;  1WQ2 A;  3ABT A;  3KEO A;  4YFN F;  4XLP F;  3IWF A;  4AIJ A;  5F64 A;  2HS5 A;  4LK0 F;  1JXS A;  2Q0O A;  3JW4 A;  4BHP A;  1R1T A;  1RI7 A;  1XMK A;  1ZRF A;  3H3U A;  2RVC A;  1WSU A;  1Z6R A;  2FNA A;  5D4R A;  2OA4 A;  4FT8 A;  4ZH4 F;  5ICF A;  3K69 A;  3KZY A;  3TDZ C;  1XSD A;  3FXR A;  2RC4 A;  2Y0M A;  4IRH A;  1J5Y A;  2O61 A;  2HDC A;  5DCF A;  3KP4 A;  1TNS A;  3DF8 A;  2FSW A;  2WTE A;  3BP8 A;  2XAG A;  3F8N A;  1USS A;  1QGP A;  4CDG A;  3BJA A;  3FX3 A;  4IF4 A;  3I54 A;  1SD4 A;  2G7U A;  1B9N A;  3GFI A;  5DUI A;  2DFI A;  3E6M A;  2CO5 A;  3ULQ B;  3BJ6 A;  1XGO A;  3D5L A;  4FX4 A;  2XVC A;  4Z2Y A;  2ADU A;  2P5V A;  3M9A A;  4M9X A;  2DQR A;  1ZLJ A;  2IRF G;  5JHU A;  2MLK A;  3JAM K;  3CUQ C;  3J80 Z;  1KU3 A;  5FD5 A;  2BEO A;  2P4W A;  4OOI A;  3T5X A;  2M5W A;  3EET A;  5L3F A;  5CVV A;  5HS8 A;  2QBY B;  2HKX A;  2CFX A;  1IAW A;  1BOA A;  6PAX A;  4YG2 F;  1MDM B;  2DK5 A;  3BPX A;  5DDG A;  4UUV A;  4KMF A;  3CUO A;  3HHH A;  1HBX G;  3TGN A;  3I0T A;  4GGG A;  1UCR A;  5L3C A;  3IKT A;  1ZRC A;  2RNJ A;  4L0Z B;  1QZZ A;  5BS6 A;  3RKY A;  1ULY A;  3ZMZ A;  3I59 B;  4O3M A;  1G3S A;  1O3Q A;  3MZY A;  3NQO A;  4MTE A;  5FD6 A;  4OMZ A;  2LF8 A;  3FZV A;  4EJW A;  2NAZ A;  2IA1 A;  2IA0 A;  4GXO A;  4WX9 A;  4U7D A;  3V8L A;  1QZY A;  4LB5 A;  3FMQ A;  1G3W A;  1BN5 A;  3U9G A;  4L18 B;  3LA7 A;  5BPI A;  3QPH A;  2O3F A;  5CYV A;  2K27 A;  1WRJ A;  1R36 A;  4KDP A;  1Y0U A;  4CGZ A;  4HLX A;  3F8B A;  4ENM A;  3M7G A;  4MEY F;  2DT5 A;  1D8J A;  2IJL A;  2D45 A;  4MHG A;  2L02 A;  3WGH A;  2Z3Y A;  5K5Q A;  3WTU C;  5LEK A;  2FE3 A;  3LAP A;  1S3J A;  4P9U A;  1DPR A;  1IW7 F;  2A68 F;  4OIQ F;  3NRV A;  1YQA A;  1SFE A;  2J5O A;  1UB9 A;  5A2Q Z;  1ZH5 A;  4FHT A;  2UWM A;  1LQ1 A;  3IHU A;  5F6F A;  2PBI A;  2IA2 A;  1MJB A;  5BMZ A;  3F21 A;  4I09 A;  2HYG D;  4ON0 A;  1YW9 A;  3PFI A;  2LNB A;  1U2W A;  5LRS A;  3I71 A;  2ZJ2 A;  2C6Y A;  1S8N A;  2QQ9 A;  2F5C A;  2NS0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...