3H5RA

Crystal structure of e. coli mccb + succinimide
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
348
structure length
340
Chain Sequence
MDYILGRYVKIARYGSGGLVGGGGKEQYVENLVLWENIIKTAYCFITPSSYTAALETANIPEKDFSNCFRFLKENFFIIPGEYNNSTENNRYSRNFLHYQSYGANPVLVQDKLKNAKVVILGCGGIGNHVSVILATSGIGEIILIDNDQIENTNLTRQVLFSEDDVGKNKTEVIKRELLKRNSEISVSEIALNINDYTDLHKVPEADIWVVSADHPFNLINWVNKYCVRANQPYINAGYVNDIAVFGPLYVPGKTGCYECQKVKENIDHKIKLINSRFKPATFAPVNNVAAALCAADVIKFIGKYSEPLSLNKRIGIWSDEIKIHSQNMGRSPVCSVCGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MccB protein
publication title How the MccB bacterial ancestor of ubiquitin E1 initiates biosynthesis of the microcin C7 antibiotic.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/antibiotic
total genus 110
structure length 340
sequence length 348
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00899 ThiF ThiF family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1160 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3h5rA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3h5rA02
1EVYA 5DZSA 2RIRA 1HWYA 2EERA 1FXSA 1NNUA 2JCVA 3JQ7A 1SZJG 1NYTA 2PY6A 3GY0A 2JCYA 1C0LA 4U5QA 3RVDA 1KC1A 1E0DA 3TWOA 1HZJA 1EEHA 1WPQA 3MOIA 4IDCA 3UUWA 5T64A 2WWRA 2HSDA 5JFOA 4EI2A 4ZQHA 3RKUA 1XDWA 3NJ8A 5JAIA 4AJHA 3IDSA 4UVHA 2QX7A 3VKUA 1GUYA 4BO4A 4FS3A 1YQDA 1ZH8A 2HAEA 2IEBA 5JLAA 1I33A 4YT2A 4P22A 4RCVA 3ROPA 3ONFA 4RDHA 4U8GA 3WQRA 4Z6KA 5JE8A 2OMEA 3D64A 1XA0A 3I83A 5FYDA 4Q3DA 2DLDA 4R54A 3GNSA 4GWKA 4O59O 5ENVA 2QG4A 1IYZA 4P4LA 3UN1A 3I4CA 5F1KA 3VH3A 1X14A 3IKVA 4ND1A 3UOGA 3DEYX 5JNLA 2ZB8A 1NVGA 3QJ5A 1U8XX 5DBIA 3RUCA 1H0KA 1X13A 4DYVA 1PL6A 5BSHA 4LVCA 4BNMA 1E7YA 1ZW1A 4CMEA 3ZU5A 3G17A 4FCCA 3UICA 5L4SA 1VRWA 4YWJA 4MIYA 4OH1A 3KZVA 3PFFA 3DZFA 3F46A 3IKTA 3WGHA 1NWHA 1LSJA 1OI7A 3BXXA 3D7LA 1DAPA 3INTA 5G0VA 5IDYA 3AUTA 3BMCA 1WW8A 3BMNB 4Y6PA 4XRGA 5JYDA 2YQ4A 1RM0A 1B8VA 1NM5A 1NVTA 3L0DA 3VTFA 2A4KA 2G1UA 3LC7O 3UCXA 2PK3A 4BKOA 4E30A 3E18A 3GVIA 2BD0A 3BZUA 4J1NA 3D3WB 1OC4A 3NDJA 4QFDA 4Z9FA 4CM6A 1ZZEA 2HK7A 1LU9A 1J6UA 3RJ5A 1E6WA 5KIAA 2VT2A 4HUJA 1PJTA 4FFRA 3A06A 1P1FA 3C1OA 3WWZA 1IULA 5ER6A 4NPCA 4NMHA 4RQUA 5JCJD 4DRYA 1XWFA 1WDLA 3I5MA 1W73A 3JQGB 1ZSNA 4A0SA 2PKQO 1LC0A 4G2NA 3LF1A 1PIWA 3G1TA 2HMWA 4DYDA 2NTJA 5IN5A 4BOYA 2I3GA 1T4DA 2Y99A 3JTMA 1EFLA 5FFFA 2GERA 3M2PA 1IY8A 1SCUA 1E1LA 3D1LA 5G2OA 3UHAA 4D43A 2QYTA 1QR6A 3QRWA 1N92A 3WGGA 3EW7A 4WNCA 1GR0A 1IHYA 3H65A 5IXSA 1ZMOA 2D5CA 3DZGA 1R0SA 1V0JA 3ADOA 3I9KA 3TZ6A 2QZZA 1WNTA 1I3MA 4XYGA 4RQTA 1A7KA 1EQUA 3PTZA 4HFJA 4LW8A 4M86A 2QIOA 1OAAA 1U4SA 2P68A 2O3QA 1FK8A 4BKRA 5IZ4A 3TZKA 4JBIA 1F17A 5J23A 2PWZA 2X6TA 2D4AA 3OEYA 5I7EA 1Y8QB 3EYWA 3GN2A 4J16A 3PDUA 4AICA 2HUNA 2I5PO 4YEDA 2HKIA 4WE3A 4NFHA 2H9IA 1GCOA 3WGOA 2FPPA 5DOVA 1KVQA 4OSPA 4DWVA 3E5RA 3ZH2A 1W6UA 5C7IO 3E9NA 1UXKA 5JDCA 3ZWCA 1PQWA 4BNKA 1Z74A 3JQAB 2HMUA 1UXIA 1HT0A 2GSDA 4YBZA 5GZ1A 4NQZA 4I5FA 2IYPA 2Y1DA 2HO5A 5CDYA 4R69A 4ZQGA 1N1EA 5JDIC 2WYWA 5F1OA 2C07A 1NPTO 2X4GA 4IIUA 1IUKA 1B15A 4M87A 1BDBA 1D8AA 1LDBA 3A28A 3WSVA 1PJ3A 2ZYDA 1LRKA 2NVUA 5F3RA 1ZK0A 4DQXA 2VT3A 4D79A 1MFZA 4B7CA 1E6UA 2B69A 2DKNA 2Y1FA 2VZ8A 4GX5A 4IQGA 4MKXA 4CLDA 2FPIA 3EC7A 1X7DA 3DBRB 4LISA 4E0BA 1NHWA 3NJ4A 4Q3NA 4BNUA 5L9AA 3SJ7A 4DC0A 3IP3A 4MP6A 3GPDG 5COAA 1E77A 1LRJA 4D0RA 2W2KB 3RQSA 3ENKA 3FNEA 2P91A 4Y98A 2PTGA 1DO8A 5CPBA 1BXGA 1G6KA 4D45A 2O2YA 4B7XA 4WLEA 4YR9A 1R4NB 4E5NA 3WMXA 1P0FA 1UXHA 3B1KA 4IDFA 5G0TA 1VL6A 2WYUA 4N5NA 4F3YA 5IF3A 3ANMA 4NDNE 4FJ2A 3GMSA 3JQ9C 1PS8A 4CQMA 4XJTA 4H15A 4BKPA 1H93A 3NGXA 2BFPA 1W4ZA 2B35A 1PU2A 3PXXA 1I24A 1Q2XA 3Q11A 4F6LA 1U7TA 3NKLA 3WFJA 1K6IA 2X0RA 2XXJA 1U8FO 3OQ6A 2R2GA 4KOAA 1JU9A 2X0IA 4KUHA 5CPFA 3V8BA 4OKNA 3K8ZA 1Z6ZA 3ZWWA 2LDBA 3L9XA 1BMDA 5JMPA 1QYCA 1HF3A 5COBA 3PJGA 4GMGA 1IZ0A 3DBLB 4PZDA 3TZHA 1M76A 1KEVA 3B1FA 1JAYA 4ZN6A 4GMFA 5BNIA 2B5VA 3H5NA 1T26A 3ZV5A 2EGGA 4WLOA 2OZPA 3U62A 2JHGA 2YHIA 4XYEA 4CM7A 3ROQA 2E49A 2GGSA 3AM4A 2QW8A 3JQCA 1YOVB 1IZ9A 1U3VA 2AEFA 2IDZA 3FD8A 4OSOA 4ZA2A 1P33A 3AI2A 4NBVA 1NXQA 4Z9YA 3DHEA 1R0LA 2ZK7A 2ZYGA 1T2DA 5IDXA 1Y8RB 2VN8A 3V2GA 4A5OA 2GO1A 1YB5A 2GCGA 5THKA 4XRRA 3W8DA 3SEFA 5JY6A 1DJQA 1V3TA 2X23A 3GFGA 3RUEA 1SEPA 3ITDA 3AY3A 3ZWPA 3LT1A 3FR7A 2J3JA 4IY1A 1J5PA 1HDOA 3TZCA 3E8XA 4CM1A 3D4OA 3SLGA 4ILKA 2O3RA 2UV8A 3PWSA 4BGIA 2NADA 3RC7A 5KNLA 2Y67A 5B4TA 4YJFA 1U3UA 3ZGYA 5T5QA 4M1QA 1KYQA 3CXRA 2PH5A 4CLOB 1XR3A 3KOUA 3AI3A 4WGGA 1DEHA 1T2FA 2D0IA 4UUMA 2FPGA 1GQYA 3WGZA 2Q1SA 4Q3BA 1G1AA 1E3EA 2NQTA 4L4XA 4F6CA 3R3JA 5EQDA 1FDUA 3JQ6A 4TROA 2V6BA 3B70A 3W8FA 3WLFA 2NUAA 2B0JA 2PZMA 4CJXA 2VYVA 3ONEA 2BF7A 3K2BA 2C54A 4YRAA 5CEEA 2EEZA 1OMOA 4XEHA 3GFBA 3MTJA 3I9JA 4J0FA 4PLYA 4U6SA 3OJEA 3BTUA 4GX0A 5IDWA 2GYYA 1PGNA 1PSDA 3GDGA 5K6AC 3DB2A 4RV9A 4GX1A 1Q0LA 2G82A 3I9LA 4FFMA 3FHLA 3W1VA 5A9SA 2NSDA 1DIRA 1YH3A 1EFKA 4CMEC 5DOZA 4ZD6A 2SCUA 2P2SA 2I9PA 3FNHA 4UREA 4PRKA 1ADGA 2BFMA 1N5DA 4FGSA 5EPOA 2OP0A 3H2ZA 1ZUD1 3OIGA 2I66A 3OJ0A 4AJPA 1E3WA 3D3EA 4CL8A 4ZJUA 3WIDA 5EJ2A 4ZU3A 3RBZA 4L0QA 3ZWVA 4B4WA 3ZN2A 4GPD1 4M8SA 3UF0A 4OAQA 4I1IA 5GMOA 3T4XA 2DTEA 1LA2A 3W4JA 2G17A 1GYQA 1O6ZA 1P1HA 1DLJA 1X7HA 5TSDA 4ZQBA 5C3MA 3JQFA 4DPKA 3S2GA 2O48X 4OKIA 4CQLB 2BGKA 1NFFA 4YDRA 4Z9XA 3ULKA 4MJLA 2FR1A 3OJLA 1DC6A 1W0CA 5EMHA 2IE0A 2X5OA 4FFPA 3KEOA 3CH6A 1DJNA 4G65A 4DPLA 4W7HA 1WAMA 2GPTA 3NDRA 3WTCA 1QP8A 4RPGA 1C0PA 3GDFA 3EY4A 3ZWNA 2DTXA 3EUWA 4YJFB 3F1KA 5A5FA 5U9CA 5A3JA 2VRCA 4DMLA 1PGPA 4B7UA 3VZPA 3SLKA 2VHYA 3H9JA 3NUGA 1LNQA 1DB3A 1K2WA 2B4RO 3PHIA 1LSUA 3C8MA 5L51A 3PHJA 3QV1A 5JCXA 1WMAA 1JKFA 2GLXA 3G3EA 4FD3A 4GLLA 3K96A 4FW8A 4BNXA 3ZV6A 2CVZA 2X5JO 4N18A 2D1YA 4NHEA 4QO7A 3GAFA 2LDXA 4AJLA 2PD3A 4PLVA 3RWBA 2VOJA 3JYQA 3MCVA 1PJSA 1NWCA 4J1QA 1YL5A 4B3JA 3ZWAA 3PQEA 2OL4A 4MVJH 5IJZA 2FHSA 1EVZA 3I6QA 1Q0QA 4KWHA 3TFQA 3WNQA 3DHNA 4NFSA 1PX0A 2Q4EA 4F46A 3ROMA 5ER9A 3L77A 1EQ2A 1GYPA 3EZYA 2VUTA 2Q50A 3PDJA 2QZ9A 3DR3A 3PZBA 1ONPA 2VHXA 3KLPX 4ALIA 1U9JA 3ZCXA 3CPSA 4HNHA 3WS7A 5L7TA 2G5CA 1XG5A 4ALMA 5JDCC 3MTGA 2TMGA 5TLSA 1RYEA 2AE2A 2POQX 4BKUA 3DZIA 4Y9DA 1Y9AA 2ZIZA 3LT4A 4AVYA 4DC1A 4BVAA 4NK4A 2OXIA 4UAGA 3A14A 5DCUA 1E7QA 4GVXA 3F4LA 1I10A 5IZCA 4EYEA 4JP3A 5HS6A 3I4FA 1FJHA 3CTMA 2WD8A 5BNTA 4II3A 1Y9EA 1PS0A 1I01A 1LDEA 4NNJA 2RAFA 5L3ZA 1U2GA 4Z0HO 4FFNA 4E6PA 2NV6A 5DP1A 3DWFA 4ZRNA 5HA5A 4C7JA 4GAEA 1F8GA 3TL3A 1ZFNA 2NNLD 5C7OO 5AYVA 4BO1A 5ITWA 2ZYAA 5ILGA 1ONNA 3KYCA 3OF2A 4YAJA 4NJMB 3RSHA 1OC2A 3UKOA 1A4UA 1JAXA 4LN1A 2J3KA 4WJZA 4CMIB 1QYVA 1EUCA 2W2LD 3UH1A 4EITA 3AWDA 5JW6A 3NT2A 1VJ1A 1F12A 1U5CA 2AA3A 3RU9A 1O0SA 4TZTA 1Y5RA 3WBBA 2XOXA 1LLCA 3O26A 3Q2IA 3OECA 4NI5A 5L7WA 2CZCA 3VKVA 3OQ1A 3S1LA 1ZK4A 3PJFA 2GDZA 2NU7A 4FQ8A 4R16A 4AJEA 4JJFA 3W4KA 5DBGA 2BKAA 5KJ1A 3LT0A 2V6GA 3ASVA 2CD9A 3HN2A 3CE6A 1EDOA 2Y68A 2AE1A 3QP9A 5G0SA 1T2EA 4IDDA 4IM7A 1LX6A 1C1DB 3HDQA 5EINA 2GNAA 3FRJA 2CNBA 2NTNA 4KQXA 4OGWA 4GX2A 2J5KA 5EQFA 7MDHA 4ZGWA 5A05A 2AMFA 1B8UA 1CIVA 2NLOA 1IOLA 2DPGA 2FP4A 1NX6A 1N7GA 1X1TA 2Q1UA 2QRLA 5BT9A 4INAA 5JAZA 5AXAA 2EV9A 3PHLA 4P4GA 2Q49A 4FFOA 3CMCO 4IZIA 4CODB 1D1SA 4BNJA 1YO6A 1VC2A 4J6FA 1FDTA 3GG2A 4BGVA 2B4QA 2NQ8A 1GUZA 5JO9A 5G4LA 2W90A 4CMKA 1EE9A 3DAGA 1O95A 3PWKA 4JQCA 5C5IA 1WLYA 1UJMA 4GL4A 1IB6A 4WLNA 4WEOA 4NR0A 5A5EA 1Z7EA 4UUPA 3GMDA 1I32A 4Y8VA 4XQEA 2VNAA 1ZCJA 3S2IA 2DVMA 2YYYA 4NZ9A 3TL2A 1EVIA 1LI4A 4R1NA 3X2EA 5A04A 1Y7TA 1TT5B 3MJVA 3GVHA 3TRIA 2BFAA 3JYNA 2BI8A 4IJUA 4EJ0A 1AUPA 2HMTA 1DHRA 3KYBA 3P2OA 2G76A 1JN0A 4NFYA 4DIOA 4RDIA 2HMSA 3FNFA 3KYCB 5CDGA 2CVQA 5I8WA 3GGOA 3X2FA 2P4HX 2AQ8A 1E3SA 3DHYA 5ILOA 2NU9A 3HDHA 4XQGA 3TF5A 4WUVA 1ISMA 1BDMA 3ETDA 4XX0A 1J4AA 2YV3A 1NQAO 1GZ4A 1UXJA 1GUFA 3AY7A 3MJSA 4H3VA 4XGNA 1GPJA 1GEGA 4RZIA 3O9ZA 2O7SA 3MJTA 4WECA 4BNNA 5AOVA 1DDOA 5GZ6A 1JWAB 4B8ZA 3EAGA 1ENZA 3ZV3A 1CJCA 1K6XA 1P45A 4Z0PA 4R4JA 4PGFA 2AQHA 3H8VA 1QV6A 2EIHA 4TRJA 2X58A 3AOEA 3RBXA 2C20A 4BQPA 4PG7A 3RI3A 3BMNA 3ZU4A 4GKBA 2IZ1A 4Y6SA 5KKCA 1XELA 2GF2A 3HG7A 4JROA 5I7FA 4CR7A 1JVSA 3HB4X 4RORA 5KVSA 2YFQA 2XAAA 1I2BA 3DOCA 3U9LA 4J0EA 4D46A 1DBVO 3D3WA 4J4HA 5TF4A 1DOHA 1ZMTA 3LSYA 1BXZA 2YDYA 2VHVA 5T67A 2Y1GA 3I9MA 3ENNA 3DMYA 4Q3AA 5FI3A 4DREA 2VWHA 5KVCA 2UAGA 3GHYA 1H94A 4XDZA 4PLHA 3GRPA 3RUAA 1HE5A 2E82A 1HETA 5ICSA 5EERA 1ZIDA 1ZVMA 5EESA 3PJDA 3JQGA 1CQJA 4CM9A 3JQFC 1Q7GA 5JAMA 1E5QA 4FIZA 3LK7A 3FWZA 3OIDA 4D42A 3GGGA 2J5QA 3U4CA 4K26A 1CWUA 1YBAA 3INRA 3O03A 4DXHA 2C5EA 2J3HA 2O3SA 1ZNQO 3RFXA 4J7CA 1MC4A 2NVWA 1SEVA 4I9HA 1ONOA 2E6UX 4R68A 4UVEA 3AUSA 2NACA 4GQAA 2J3IA 3FN4A 4FJ1A 4J90A 2JL1A 3OSUA 3H6KA 1VJTA 3FPCA 3VPSA 4CUZA 2CUKA 4E5KA 1Y8QA 3A4VA 4BV8A 3HQ4O 1UDAA 2BGMA 4CMGA 3DL2A 1E3LA 4FC7A 3WMWA 1MA0A 4QEDA 1D4FA 1A5ZA 1EK5A 2HQ1A 3ETEA 1KS9A 3OP4A 5K6AA 4OO3A 4UEKA 2H63A 3ABIA 1Q7BA 1YL6A 3ZHZA 4TKLA 4B4UA 4CM4B 3OQBA 1O5IA 3JQAA 3FF4A 4R3WA 4HV4A 2ZTUA 4YT5A 2I99A 1GQ2A 4NBRA 3VC7A 3ETGA 3MJCA 4EZBA 1SO8A 2X1HA 5MGBA 4CV3A 1VL0A 4IQ8A 1BHSA 5FEUA 4ND5A 3DZKA 4J9UE 3IP1A 3N7UA 4QUKA 4O1MA 3WGTA 3GOHA 3VHRA 4CLHA 3BMQA 2B4TO 5G0WA 4II2A 4QO8A 3O4RA 4BNHA 1RYDA 1PR9A 4WK6A 1ZEJA 3S2FA 2RBEA 4ALLA 1AGNA 1EDZA 1E3JA 3QWIA 4M55A 4MINA 4RF5A 1F06A 1TEHA 3F47A 4MVJE 3U49A 3VTZA 1XCBA 2DBVO 2DBZA 1IHXA 3DBRA 2Q4BA 2VQ3A 2WSBA 5IZCC 3PYLA 3E48A 4CUJA 4DQUA 2HU2A 1B3RA 5GZ3A 3RBVA 3K5PA 2W2KA 3PLNA 2O3UA 2B5WA 3ZWOA 3H5AA 2AQKA 4PG5A 4XQCA 3H3JA 3ZDFA 3M1LA 4E3ZA 1ISHA 1GV0A 1R4NA 4J2HA 3K92A 2EW2A 4WCFB 4XGKA 4ITUA 3WQQA 2RH8A 4G81A 3A9WA 1LQUA 4PG8A 3IJPA 3NV9A 3PJEA 3KV3O 5B4VA 3Q9NA 1B3BA 1UDBA 3E9QA 3WDSA 3U3XA 4DIBA 4J4BA 5DCWA 4IGFA 2VWQA 3W8EA 2Z95A 2YFHA 4IBOA 2JFFA 4N54A 4AJNA 4EJMA 2BELA 3N74A 1H9BA 1T24A 4BL5A 3LLVA 4RF4A 4U0KA 4WLUA 4GBJA 4GGPA 4O0LA 4DVJA 3EZLA 1F0YA 2QQ5A 2WYVA 3DBLA 4JBHA 4ZQEA 4PLTA 2YW9A 4PG4A 4BO6A 1BVUA 1UZMA 3QSGA 1LDYA 3MWDB 1FMCA 4DLBA 4HKTA 5JMWA 1P9LA 4URFA 4WNIA 3VPHA 4DIFA 1E92A 3MJ4A 4IIVA 3GT0A 5BSEA 1M2WA 1K6JA 1YOVA 4HNGA 4CR6A 1SOWA 3LZ6A 3QIVA 1VM6A 4IMRA 3NT4A 4G5HA 2GZ1A 3QWAA 1Y8RA 4EW6A 4IXTA 1KERA 3G1UA 1PR3A 3V1YA 2AW5A 4BGUA 1JWBB 4CV1A 4BO5A 1MXFA 2CFCA 4YTEA 3BMQB 4R1TA 1ID1A 3AUUA 4M89A 4MDHA 4OHUA 1RKXA 4BO2A 1C0KA 1LDNA 3NAQA 1L1FA 3TPCA 1KBZA 2ET6A 3H4VA 5GY7A 2E37A 1YONA 1Y81A 2EKPA 2OBYA 3EDMA 1Y6JA 4NBWA 4CLOA 3MWEB 4D41A 1HE4A 5ITVA 2PGDA 5I7VA 1UAGA 4YAGA 3OEWA 3OICA 1LBEA 1GU7A 1ZEMA 2ZB7A 5HBRA 1V8BA 2CDCA 4PLWA 3K2EA 3F5QA 4GI2A 4UEOA 5C37A 5CDTA 4BNIA 3EGOA 1V9LA 2FSSA 1BG6A 2HMVA 4KDFA 1XGKA 1DFIA 3V1UA 3JQEA 4EDFA 1HRDA 5BNFA 4E12A 1XU7A 1YJQA 2AEJA 4XB2A 1QMGA 1LSOA 1IL0A 4PLPA 1DFHA 4K6FA 2OFPA 4LMRA 1DSSG 1YB4A 4NU5A 5F5LA 2HLPA 3SBOA 2H5LA 3V5NA 3JYOA 3VZRA 1KETA 1GADO 2EP7A 4FOSA 3WGQA 1CF2O 4OXYA 2GZ3A 3JCZA 1GYRA 1MLDA 3LVFO 4FGWA 1YS4A 2DBQA 4BQRA 5TX7A 3DZHA 4XCVA 1I36A 2YQ5A 4O6VA 3PEFA 1KEWA 4CQMD 1D7OA 3AOEC 5KTKA 1H2HA 2D59A 4EJ6A 4E21A 3WTBA 1DIBA 4RLHA 4D3DA 2PH3A 4BB6A 1YL7A 4W4TA 3GEMA 4IXWA 5CAEA 1AXEA 2WDZA 4CQLA 4FBGA 4TRRA 3NTOA 5I9LA 1XHLA 1ADBA 2WD7B 2GUGA 3OA0A 5EIOA 5JXWA 1U28A 4Z0TA 1IE3A 3GRKA 3H9EO 2VWGA 4YJGB 2PR2A 3VPGA 3EHEA 4S1VA 1DIHA 3HFGA 2CVOA 2Y1CA 3ST7A 3V2UA 5JSFA 4DPMA 2EWMA 4H16A 4YACA 1KVSA 3WSWA 3GUCA 4WCFC 3WG9A 1I0ZA 3F4BA 3PRJA 1LDMA 3O8QB 2B37A 4LMPA 1XQ1A 1K0UA 2EGHA 4DQVA 4AJKA 4UULA 3GVXA 2P9GA 4ID9A 1U3WA 6ADHA 3FTPA 4RPHA 2D8AA 1B16A 3DBVO 2V65A 2FRDA 5AXCA 1PJ4A 4H7PA 2IZ0A 2E4AA 2C7GA 4DLLA 5BR7A 3QQPA 3ZNOA 5JC8A 1A72A 2IODA 1NPDA 4OIMA 1R4MB 4E4YA 3S2EA 5KOIA 5A9TA 4XGIA 1P1JA 4XA8A 4CMHA 2I76A 3CKYA 4MVJP 1JKJA 1HYHA 3P5SA 2NM0A 5FWNA 5CG2A 2DBRA 3QY9A 1ZJZA 8LDHA 3QWHA 1RM4A 3RROA 4CMCA 4YT4A 1Z82A 4LVUA 4CM8A 4AJJA 3TN7A 3CMMA 1EBUA 2FOIA 3AK4A 3W6ZA 5I9NA 1FDSA 1H6CA 1QRRA 3G49A 3AM5A 2VYVD 3IL2A 1EUZA 1QYWA 4BO3A 3FTNA 4UVDA 3TNLA 5A1TA 3PLRA 1E7RA 1YKFA 2C2XA 2DTDA 3GVCA 4RVUA 2X22A 3QW2A 3KYDB 2CSUA 2OBNA 1WZIA 3HNPA 2EHDA 3FWNA 3FBGA 1LTHR 1VI2A 2OUIA 4WLFA 5C7LO 2X0JA 4TVBA 1R37A 4XR4A 4LGVA 4E13A 1U4OA 2P5YA 5F21A 2O7QA 5THQA 4EEXA 3WFIA 3WX0A 4BO7A 4KZPA 3G0OA 1BWSA 4NJMA 4CMBA 4CLRB 1KEPA 2ZJ0A 1Y1PA 4IS3A 4WEQA 5DN9A 1QXSA 3H9QA 4IJWA 3QVWA 4CMIA 5I7SA 4PIVA 4O5OA 1DC4A 4J2OA 3WYBA 3D4NA 4HX5A 1LUAA 1UP7A 2EW8A 2P4QA 4IPTA 3JQBC 1PEDA 7ADHA 4N7RA 2A94A 2YV2A 3E1KA 3R0IA 4DBVO 2VTDA 4AJ4A 1NAIA 3L4BC 1DRUA 1GFSA 4PLFA 5IDQA 2Y0CA 1EUDA 2QRJA 3Q0EA 2YDXA 3RUDA 1WWKA 1MG5A 4K28A 2VZ0A 4GKVA 2IXBA 4ONEA 3BA1A 3Q1LA 4I9UA 3VDQA 2Q2VA 1ADFA 1C1DA 3NX4A 4PG6A 1EMDA 3VH1A 1XYGA 1MXHA 4BB5A 4D7AA 3R6DA 3IUSA 4YAKA 1MGOA 1Z73A 1GZ3A 4K1LA 2VRCD 4HFNA 1WDMA 3WBFA 1H6DA 3WLEA 3DFZA 5K9ZA 4R1SA 3QVXA 2Y0DA 4ALJA 4PLGA 1GV1A 4FR5A 4J7UA 4CM5A 1U1IA 2OOSA 3I3OA 3CIFA 1ML3A 3L07A 3JQ8B 4WPGA 4CM8B 2RHRA 4BO9A 3I1JA 4EBFA 1N2SA 1YE3A 4XZ3A 1LLUA 3E82A 1QLJA 2CDBA 1H5QA 4A03A 1E5LA 3WGIA 4YB8A 2GZ2A 2GD1O 4LRTB 4I5EA 4RPJA 3DOOA 1F14A 2V7PA 1JQBA 2O3TA 1SNYA 3JV7A 4UVGA 4XR9A 4Q9NA 4BNYA 5MDHA 3PGXA 2YV1A 2GR9A 5TT1A 3GEGA 4CLXA 1TT5A 3PGJA 3W6UA 4JN6B 2JD1A 3JD3A 5L40A 2PGJA 3F5SA 2I67A 4YAEA 4MVJG 4IJKA 5B4UA 1V6AA 2FN7A 2WJPA 1G0NA 4FB5A 4QXMA 2DFDA 1TA4A 2R00C 1NFRA 3NTQA 4L74A 1WP4A 2Y66A 1S6YA 5ADHA 4XYMA 3HADA 4Z3DA 2VOEA 1C0IA 2DC1A 3PVZA 4J4TA 3LDHA 3ONDA 4CLEA 1XLTA 2BFOA 3M1AA 5G0UA 1ZSYA 5KKAA 2DUWA 1LC3A 5KJEA 1YVEI 5CFZA 4PLZA 3DO5A 3L4SO 2VUUA 2X5KO 3LC2O 4I5DA 1E3IA 1L7EA 1KOLA 2DQ4A 2C7VA 2FSVA 3BHMA 1NP3A 2AQIA 3GEDA 4X54A 4EUEA 1ADCA 4XYBA 1ZO8A 5DCYA 2VUSA 4XDYA 3ICCA 3ZI0A 1DFGA 1R6DA 3OIFA 5K0ZA 4YA6A 5TJ9A 4BS9A 3OJOA 3G79A 1LEHA 3BTVA 1YDWA 2O4CA 4N5MA 4YYZA 2AEMA 1L7DA 1PJ2A 1BTOA 4HP8A 1N8KA 3ADPA 3OFSA 4QFCA 2WM3A 3PK0A 4XIYA 3VAZA 2XPCA 4EGFA 4ZICA 1P44A 4LSMA 3U4DA 1XIVA 5T8KC 5FF9A 3OETA 4A10A 3CINA 4C4OA 3VZSA 3HZZA 1K89A 4MVJM 5L53A 4JXKA 1X15A 4BNWA 4BIIA 3F9IA 2BHLA 2PKRA 2EG9A 1LLDA 1YBVA 3GK3A 3DZJA 4LCJA 4LCEA 4U7WA 4FC6A 2UVDA 1DIGA 1M67A 2VYNA 4HWKA 3VH2A 4TZKA 4JJGA 5ES3A 4TRNA 2UDPA 5G4KB 1HE3A 3GN1A 2ZTLA 4J49A 4YCAA 1ZK2A 2X9VA 4QT0A 1I2CA 1DAOA 4GWGA 2NWQA 3L9WA 1TI7A 4B3HA 3BTOA 3MZ0A 3DXFA 5L45A 3D5QA 4R51A 3Q3CA 3EK2A 1KVUA 2AG5A 3HHPA 1DLIA 5TJHA 1PL7A 5HTOA 1WMBA 4J1TA 5TRTA 4LK3A 4AJ1A 4Y67A 3LC1O 4R41A 5EL0A 1N9GB 1BXKA 2EKLA 2EJVA 2FR8A 4KTVE 4QQRA 3UAGA 4DLAA 3JD1A 3JSAA 3VZQA 1IPEA 3C3XA 5KCZA 2O2SA 3RC9A 2A9FA 1PQUA 1Q1NA 1HDGO 3SC6A 3AFNA 3ASUA 4ALKA 1BW9B 3W4IA 2ZTVA 4CM4A 1N1GA 4YRBA 1U2DA 1HL3A 4L73A 3C24A 1P1KA 5CDUA 4MVJD 2WE8A 4MO2A 2P9CA 3DBHB 2IZZA 3HWRA 4B8WA 3BHJA 2JFHA 4W9NC 2VNSA 1T2AA 1SPXA 1D3AA 3LLSA 1UDCA 4W82A 3HN7A 2UUOA 1P1IA 1K3TA 3SVTA 1YRLA 3RFVA 1OFGA 2ZATA 4I5GA 3H3FA 5L95A 3V2HA 1QKIA 3E03A 3AJRA 2RCYA 3IIEA 5HWSA 2BRUA 3WOHA 1R66A 2ZQZA 4S3MA 2NTVA 1DIAA 3V1TC 4U0JA 1PWXA 2Q99A 4JLWA 2QYSA 5LC1A 1GDHA 3A1NA 1AHIA 4TQGA 4E5MA 2OORA 2P9EA 1DC5A 4NG5A 8ADHA 1U3TA 2TMDA 4MVJF 4CV0A 1PGJA 9LDBA 4AG3A 3JYLA 1U7HA 3P19A 2HRBA 1TVEA 3GC6A 2DAPA 1KEUA 4WCFA 2A35A 2HK9A 2FZEA 3E6AA 2BGLA 3H2SA 2UUPA 4GVLA 4DMMA 3QVOA 2DUUA 3AY6A 3BMOB 4CPDA 4GSKA 3RU7A 4TRMA 4IDAA 3DAFA 5A06A 1H6BA 4JBGA 3PWZA 1VSVA 2G0TA 1Z75A 1QG6A 3LQFA 4E5YA 4MIEA 1MUUA 1VLLA 3VH4A 1GEEA 2HCTA 2CY0A 4R01A 5KJCA 1XKQA 4BHTA 3DMTC 2W8ZA 3MEQA 3JQDA 4BNFA 3FCOA 5AVOA 1TXGA 4K9DA 4RLSA 4CM9D 1J49A 4UUNA 1I8TA 3PIIA 4B4OA 3OJFA 4IUYA 3RIHA 3NEPX 3WJAA 2AXQA 2Q2QA 4MPDA 1QSGA 5H83A 2WE7A 2OO5A 4YRDA 3HSKA 4CMAA 4RJTA 5JY1A 1FDVA 4J7XA 1HXHA 2P5UA 1Z45A 1R12A 1SAYA 2C0CA 5IG2A 5LDHA 1KVRA 4UUOA 1IPFA 1KVTA 3DTYA 3GG9A 1JA9A 2EXXA 2YHUA 1ZXBA 1RM3A 3C85A 1C1XA 1PL8A 3PYXA 4CV2A 1ZJYA 5CP8A 3AFMA 5AXBA 4YJHB 3UCEA 1MFPA 3JD0A 2GRAA 2Z1MA 4RZHA 1A9YA 2ZB3A 3FR8A 3TOXA 5CEFA 2O50A 3ANNA 5U4QA 1KIFA 3KSUA 1HDXA 4XQ9A 3CUKA 1CEQA 2X86A 5AQ1A 4FN4A 1VJ0A 1TLTA 1SC6A 1T1SA 4W6ZA 1OZAA 3JQAD 1RJWA 2X9GA 2Y1OA 1KY4A 1X7GA 5JCJA 1P0CA 2FZWA 4ND2A 2PZKA 1HSOA 4L76A 4R3NA 5DBFA 1P1RA 1T1RA 2PV7A 4RVDA 3JYPA 3RASA 4RVSA 6LDHA 1A4IA 2ZCUA 4BO8A 4Q3CA 3RUHA 1P74A 4EUFA 2DM6A 2PA3A 1YQGA 3JQ7B 3OMLA 4L75A 4E31A 4YQZA 1I5RA 3DTTA 4HXYA 3JQBA 3NGLA 1ZXLA 1R0KA 1NFQA 4FOOA 1GD1O 1ZBQA 3JD2A 3L4BA 2Q1WA 2BLLA 1R16A 1J0XO 4J3FA 3C7DB 4KTTE 3TFOA 1MC5A 2IYOA 1QORA 3QWFA 1ISIA 3DQPA 3MOGA 3I9NA 4XIJA 3GH3A 1R15A 2C5AA 4A26A 4YJDA 4RF3A 1EBFA 1HLDA 1NVMB 3UW3A 3GVPA 5JS6A 3LYLA 2OGUA 2YUTA 2IXAA 1CQIA 1OBFO 2PFGA 3FSRA 4R9SA 1B8PA 3AI1A 3PHGA 1JTVA 2C29D 1UH5A 1YDEA 3CZRA 5T6BA 3ZW8A 4CL3A 1CYDA 2I65A 5T57A 1PJQA 2JAHA 1V35A 3RKRA 4Q39A 1WZEA 2ZB4A 3RCBA 4IDEA 2WMDA 3JD4A 3K73O 4RPKA 3RUIA 2ZTMA 1NR7A 1B26A 4JIGA 3OH8A 3VPXA 4BNZA 1FDWA 4P8RA 3ANLA 1PGQA 4L4RA 1MX3A 2D5AA 3DAPA 2D3TA 4E33A 2ZQYA 3PIDA 1VKNA 4KWIA 4D44A 3F3SA 3ZW9A 1X0VA 2GN6A 4EUHA 4IS2A 1NQOA 4E32A 2X7HA 1YJ8A 2OP1A 3ICPA 1MG0A 1C1XB 1PGOA 3QE3A 1PJBA 3KSDO 3BIOA 3GQVA 3GZ4A 3VOSA 3ZNNA 2AHRA 2C59A 4XD2A 3INGA 4BNGA 4DTIA 1YWGO 2JAPA 3C1TA 3P2YA 2WD7A 3Q2KA 2VWPA 1SB8A 2O4UX 3QHAA 3ZU2A 4DBZA 2GASA 4BNTA 3K9QO 2F00A 3GF4A 2HJSA 1PJLA 1E1NA 4MVJI 4R9RA 4ZQFA 3IJRA 4YJGA 2PD6A 5I8ZA 4OXKA 1PZFA 4J91A 5IXYA 4A2CA 1HYEA 2A92A 3DDNA 3BMCB 4U6QA 3ZWBA 1KC3A 3HUDA 3NRCA 2R00A 3SX2A 4BUCA 2Y0EA 2GN9A 1GL3A 3STHA 1SBYA 5HS4A 3KETA 1PZEA 2HRZA 1K5HA 1MV8A 2PGLA 3O8QA 3QVSA 1M66A 3RD5A 4HFRA 3TZQA 1A9ZA 1GY8A 1I3LA 4F45A 1BSVA 3K6JA 1CRWG 2WEKA 4P4NA 3BTSA 3B1JA 4XB1A 1MB4A 4OOEA 4OXNA 1LJ8A 4FDAA 1B7GO 3EVNA 1HEUA 3HJAA 1R4MA 2FY8A 2JJYA 1PZGA 1W8DA 4OM8A 3IOYA 3FNGA 3EMKA 3IQDB 1UZLA 4JJIA 4E5PA 1E1MA 3WYCA 2E48A 2VRBA 2X9NA 4FJ0A 5TQVA 3T7EA 5T8KA 2IRWA 2NU6A 4J9VA 5ICMA 5DDIP 1NTOA 1UP6A 4FFLA 3MJEA 3E5MA 4BKQA 4BMSA 3KEQA 3PI7A 2VHZA 1HDZA 3F1LA 4I8XA 1EE2A 5A02A 2V6MA 2CMDA 5IFLA 3DZBA 5KJFA 4XKJA 3VDRA 2BH9A 1QV7A 3KTDA 2BMAA 4TKMA 2YZ7A 1DHTA 1Q0HA 3KYDA 1XU9A 1HDCA 1HDYA 2VZ9A 4R5HA 5CG1A 1ZK3A 3C1AA 1SMKA 4TWRA 1ZK1A 1O9BA 2PZJA 1BVRA 4OYRA 1UUFA 4BV9A 4GGOA 4JP2A 2DPHA 5L7YA 3D4PA 1E1KA 4WCDA 3H9UA 3NT5A 1AHHA 2Y1EA 3F6YA 3VVCA 4BO0A 1HYGA 1H2BA 2O3JA 3KB6A 4BNLA 2JCXA 4IINA 4CLRA 4ND4A 5B37A 4HFMA 1ENOA 1RPNA 3M2TA 1VE9A 2Y05A 1AE1A 1E7SA 1EZ4A 3BYZA 2PD4A 3KO8A 1HLPA 1KY5A 3R1IA 4KUGA 5TNXA 1PZHA 4PVCA 1A27A 1ZKMA 2PNFA 3M6IA 4FSHA 1LQTA 2NVUB 3PP8A 5L4NA 1UAYA 1ISGA 3FBTA 3L6EA 3RAJA 5KJ6A 5DP2A 3GPIA 1GZ6A 2ZCVA 1GCUA 1E7WA 3ORFA 4CR8A 4ND3A 4GH5A 3KLMX 2W4QA 4NK5A 1AXGA 5JAQA 3WGYA 3BAZA 3GDOA 4IZHA 3ZHBA 1UP4A 1PS9A 4W9NA 3HFSA 1HTBA 3ITKA 3KBOA 4C7KA 1M6HA 3AOGA 2DT5A 1NQ5A 4HBGA 4PLCA 4QX6A 4OQZA 3GGPA 1BXGB 2NU8A 2ZJ1A 1TB4A 1HSZA 2RHCA 5LCXA 3GAZA 4FPXA 4KP7A 1ULUA 2Z1NA 4GLOA 1B14A 2VCYA 4WKGA 1YBMA 3GNTA 1QYXA 3IC5A 1YB1A 3NTRA 3JQ8A 4CQMB 4E2XA 1Y5MA 5CEJA 3DC2A 4RVFA 3I23A 3KHUA 1EVJA 3QLJA 1I3NA 1O89A 2CDAA 5IAAA 3E9MA 4QECA 3TSCA 1I3KA 3ROKA 4NIMA 5BSGA 3CZMA 2CF6A 2BI7A 1LLQA 4GSLA 1DRWA 3B6ZA 1PQPA 1PJCA 4RF2A 4DA9A 3FPLA 5JBIA 4B79A 1B2LA 4CM3A 1UR5A 4WOJA 1GQQA 3RC2A 2QRKA 3NDIA 4P38A 1PWZA 3KXDA 3QWBA 1QYDA 3U4IA 5H82A 3TQHA 2OHXA 1NASA 2W98A 3P7MA 3DFUA 4I08A 4MOWA 2YHIB 1NPYA 3ZNQA 9LDTA 2QHXA 1E6EA 4DL9A 2RH4A 4Q3EA 1BRMA 5HM8A 3IUPA 3NYWA 4Y6RA 1QLHA 3K30A 1T4BA 3Q9UA 1E7MA 3DMTA 4IGEA 1WDKA 5KVQA 4NU6A 4KMSA 3D5TA 3WB9A 2Q2WA 3UGKA 4E2YA 4Z3KA 4BMNA 3TJRA 1PTJA 1Z7BA 1VPDA 1X0XA 3RC1A 5CDSA 3U0BA 3KM0A 4W99A 2YJZA 5JPIA 3T4EA 1JKIA 3TDKA 4E2WA 2DU8A 3KRTA 4WASA 5A4DA 3TOZA 2ILTA 4RGBA 3ZHXA 4OJNA 1NQTA 3CSDA 4QTZA 3T7CA 4AL4A 3LT2A 4IDGA 4HY3A 4OL9A 2O23A 4I9NA 3WNVA 1GPDG 3DONA 3B20A 3KSZO 1A7AA 1VKOA 1XQ6A 2XXBA 5JYEA 3DOJA 1ARZA 2H6EA 1JVBA 4IJVA 3WYEA 1NR1A 4JNKA 2FMUA 4M49A 3GZNA 5ENDA 2HK8A 4OQYA 3K31A 1RWBA 2VTEA 4YQYA 1S7CA 3ZHYA 5B1YA 3ZWYA 1NAHA 3EVTA 1CDOA 3COSA 2JHFA 1ORRA 4NH4A 1LDGA 1BGVA 2EP5A 4RVHA 1NHGA 3WJ7A 2C2YA 2Q46A 3HB5X 3RUFA 2Q1TA 3WXBA 1WVGA 4MP3A 1OOEA 3IS3A 4TSKA 5TGDA 1EK6A 1X1EA 4YVFA 1RM5A 4NBTA 4AJ2A 4D3SA 4XWYA 3OM9A 4CUKA 3AUAA 3RJ9A 4E2ZA 5G4KA 3PQFA 3R3SA 3D0OA 4L8VA 2EF1A 4A73A 2HJRA 4OMUA 3H7AA 3LU1A 5U1PA 3L6DA 4A27A 2JKVA 5A9SB 5TC4A 4J43A 2EKQA 1H6AA 1M75A 5DT9A 1I30A 4R1UA 1DXYA 1AN9A 4ZRMA 1A71A 1E3WB 2J5RA 3OBBA 1O94A 2YY7A 4QSMA 4IQ0A 1N9GA 3QVTA 4WLVA 1ZSVA 2W2LA 4NBUA 3UXYA 1ISFA 5HRUA 1V3UA 4IMPA 1I2ZA 4KQWA 3GNQA 3WICA 3PFWO 4YXFA 4PZEA 4K6CA 5L4LA 1F8FA 3RFTA 4ZVVA 4MIOA 1U5AA 4XYLA 1C3VA 3GUYA 4UVIA 1BW9A 1D1TA 2GN8A 4JX8A 5F1PA 2V6FA 3AU9A 3I52A 1WXDA 1DRVA 1G0OA 1LRLA 3DBHA 4O63O 5B12A 3HE3A 5TT0A 2HDHA 3ZU3A 1P31A 4RVGA 1M6WA 1XEAA 3GHHA 1VL8A 4PFJA 4PVDA 3AW9A 3OHSX 2FWMX 3ZWXA 2J6IA 3GZNB 2VHWA 4CMJA 5KVVA 1GAEO 4YPOA 1JLLA 2DFVA 4LRSB 3ZWMA 3GLQA 1C14A 4L4SA 5DF1A 4RL6A 1P3DA 3VPFA 3FI9A 3GA0A 3AU8A 3HDYA 2R6JA 3O38A 4MKRA 1LXCA 1Q7CA 4WOKA 3ZV4A 4ESOA 3AM3A 2PLAA 1T25A 3WIEA 1ENPA 4BGEA 5BQFA 3PZRA 1H9AA 4MP8A 3VVBA 3WR5A 3CEAA 3UFXA 5IN4A 2J8ZA 3L6OO 4JCOA 4B3IA 5H81A 4RPLA 2JFGA 4PCVA 3WQSB 4W7IA 5JDIA 2Q3EA 4PZCA 2C82A 4PN3A 2F1KA 2I3AA 4DGSA 4YAIA 5CHEA 4ALNA 4BNVA 2AG8A 3LF2A 1N7HA 2B83A 3IMFA 1LSSA 3OA2A 3PPIA 1B0AA 2PZLA 1HDRA 1V3VA 3BHIA 5I9MA 3BMOA 5F5NA 5JO0A 5A9RA 3I9OA 4L9RA 1ENYA 4KDEA 5DNAA 3PHHA 3WWYA 3ZZNA 1P77A 3PQDA 1T2CA 4HADA 3UVEA 2EJWA 3S55A 4R5MA 4EEZA 4RO0A 4IDBA 2VYND 2NVBA 2H1SA 4J1SA 3ZNPA 3U4HA 3HDJA 4BMVA 4MKZA 3H5RA 1UZNA 1MP0A 2PKQP 1CETA 5A03A 1YQXA 1XSEA 2FR0A 4ZHSA 2XF8A 4JK3A 4KUEA 5DULA 5EN4A 2D2IA 1JW9B 1SB9A 5AXDA 4D3FA 3N58A 4JGBA 2UYYA 4YT8A 3SJUA 2X8LA 2Z5LA 2GN4A 1YXMA 2WTBA 3ON5A 4MVJA 4TVOA 5A3VA 5TS3A 2JD0A 2IEDA 3Q6IA 4N5LA 2JD2A 1VSUA 3JQ9A 3KUXA 1ULSA 4OOFA 5BSFA 2Q45A 1HKUA 5LDGA 4LSWA 4DUPA 2Y93A 3H9GA 4M54A 5COQA 1DC3A 4ROSA 2ZKLA 3UCFA 4PRLA 1NBOA 2B36A 3C7CB 3C7AA 4XJSA 3U09A 1O8CA 4A7PA 4D0SA 1HE2A 4YJHA 1TT7A 3QA9A 4UEJA 4AJIA 5KWEA 3U5TA 1FF9A 1GTMA 3SXPA 3IAHA 1SOVA 1DPGA 3I6IA 1UXGA 3GR6A 1JDJA 1CERA 4B4VA 2CF5A 5TIIA 1HZZA 2I6TA 3PYMA 2X0NA 4AFNA 3S8MA 1ISJA 3KVOA 4AJOA 5JC1A 4TMFA 4NJOA 1YGYA 5FI5A 3SC4A
chains in the Genus database with same CATH superfamily
1EVYA 2EERA 2NSHA 4HPXB 5CM2Z 1NYTA 1QPGA 1YA6A 1C0LA 1VLJA 3KDAA 1M73E 4JCCA 3TWOA 3KP4A 4F8YA 1XQXA 5HSGA 2KISA 5IJ9A 3CMYA 4XTRA 3RHSA 4FYJA 5KDLA 3JZMA 3F97A 1EFAA 1PR2A 4CF5A 1FLAA 2NZWA 3RVQA 4U8GA 4ZQIA 1LBIA 5IKPA 1OAOA 1LI7A 1TYBE 2L7ZA 4Q3DA 4AXXA 2OCLA 4OUKX 2QG4A 1PZXA 3I4CA 2JIDA 2Q2EA 3T5DA 2VP3A 3DEYX 4YUYA 4G5RA 2I4LA 1N7IA 3FI0A 4DLTA 1F48A 3JAMK 1QKKA 3KCNA 3HHHA 4CA0A 2ZJ3A 5DE3A 3WGHA 2VA9A 3M9XA 2QPTA 3OOWA 1UK6A 5F1JA 1S2GA 2ZJ5A 4MV8A 1XZFA 1W4LA 4BKOA 2D0OB 2QE7D 4QFDA 4DRXA 4AG6A 1Q17A 1II8B 5DK6A 3GLHA 1QX4A 4N8EA 1H85A 3TW4A 4DM3A 3R3XA 3VU0A 4KSYA 3OFVA 2C84A 3LF1A 4MYTA 3NHLA 5IN5A 2Y99A 3D1LA 2QYTA 1QR6A 4I4CA 2Z99A 1MORA 1U5TC 3DXYA 1SCAA 4EA8A 3VR4H 3ZZUA 2D4AA 2DA3A 5BV1A 1Y80A 4GI1A 2FPPA 3E5RA 1G20B 4AN4A 3KDPA 1GA4A 2FUCA 1YW9A 2PU7A 1KP9A 3X43A 1HFJA 2HYDA 4G1MB 1ORDA 1XNJA 5DDGA 2HWUA 4O4HB 2CVHA 4N76A 1Z2NX 1OI3A 2MR6A 3JATB 4B7CA 3U0VA 4M9XA 4IHYA 1GZUA 1NHWA 4D8YA 3ENKA 1E2JA 3FUVA 1G6KA 3GX4X 3B1KA 1VE5A 3DFGA 3CW9A 1Y4ZA 1JLRA 3C39A 1APLC 4TZ6A 2HW8A 1L7VC 5CPFA 2HIMA 4EY6A 4A0ZA 4MGEA 2NSLA 1QIFA 3EXIB 1QGPA 3PJGA 2C9CA 1CE8B 4BP8A 4GMFA 2FUG1 4G6DA 1VFCA 3ZE2B 3L00A 1DAMA 3B7GA 4KR6A 1YOVB 1FDIA 1U3VA 2BFDB 5KC8A 3AI2A 4ZODA 4M0DA 3N0VA 3FDZB 1K8ZB 5KTMA 1JHPA 4LDZA 2XEXA 3D59A 1Z5OA 3TDNA 1CUUA 1HFEL 2BFCA 5JAUA 2H2DA 1J5PA 5IT5A 2DFFA 3KTOA 3NBFA 5EHQA 1QK4A 1JZQA 1W5FA 5SICE 1KA8A 4P9FA 4WGGA 1VGQA 1NUPA 1DBSA 5ICGA 3STVA 4QZVA 1ODLA 4HOYA 3M89A 2PMHA 2H1KA 4MV0A 1JEEA 5TVKA 3KE9A 2JAWA 4K3UA 4X24A 1KYYA 2KJQA 4RV9A 2G82A 3W1VA 4RNDB 1K6YA 5FUMA 4PRKA 2BFMA 4BASA 3BG5A 4W5HA 3BERA 4RTNA 1QQIA 4M8SA 4MGYR 4N3AA 1KZGB 4I1IA 4RY0A 1Z8NA 3E7PA 1U1CA 1CUIA 4EABA 3ZDQA 3FZQA 3QI7A 1S9DA 1Z07A 3DOHA 1FNNA 1NW6A 4W7HA 6REQA 3PC2A 2LUOA 4BEWA 3WTCA 1I3QJ 2V4ZA 5ICEA 5U9CA 4B7UA 3AL2A 4QLCU 4QA9A 1NVKA 2ZDQA 4NHEA 1YI0A 3DFMA 4G0YA 3I71A 2GK7A 1KBOA 3AETB 2DWCA 4C0KA 4M9CA 1Q0QA 3C3WA 5DGIA 1Y3AA 3CX6A 4HNHA 4BVFA 4YLGA 4ALMA 4Y13A 5KMGB 1M6VA 5EHGA 4NCKA 4K1XA 4BVAA 2PZGA 3UWDA 4O4IF 3NIDB 1YULA 2CGEA 1FUYB 4G97A 1D2HA 3RIGA 1PEYA 3QSYA 4H1TA 1W87A 4UU7A 2P2NA 2VTBB 1X3ZB 1MRNA 3HPQA 4JUIA 4P55A 4WJZA 4CMIB 5KQRA 3QKSA 1S5PA 1P5FA 2XOXA 1P5JA 3O1HB 3DJYA 4LG0B 4L0CA 2OB1A 4ZVPA 1ORWA 2RK4A 3WYGA 5ALNA 4N82A 1LK0A 1SRRA 5B6JA 3VSCA 3EF3A 3SC2A 2H16A 1GLGA 3K2AA 1E17A 3G0CA 4KQXA 4MQFB 3R4KA 3DVLA 1RRGA 3LS2A 3RU3A 2XRMA 1QZZA 3LVBA 5F2KA 1JUPA 4NX2A 1KH1A 1TTTA 4CODB 2IEIA 4M53A 3I34X 2A05A 2YFKA 5DHFA 2W90A 3TO5A 4CMKA 1NXSA 1W25A 3TCNA 1WLYA 3ZHOA 2XA9A 5AJVB 1P2FA 3D43A 1ZCJA 2DVMA 4NZ9A 3OI7A 5A04A 1BA3A 2P5KA 3PB3A 2H85A 1UWLA 5A5DA 2G76A 3WTYC 2Z4SA 2DQRA 1BQ4A 4BBPA 3H19A 1GO2A 3JVVA 2UXBB 4PK4A 4MI1A 1TGVA 3AF3A 2YV3A 1GZ4A 4H3VA 3ZUGA 1GLVA 3F9RA 1DDOA 2BM0A 2RHJA 3DAYA 3O84A 2F8LA 3ISTA 5J1UA 5JHUA 1QV6A 2EIHA 1FEXA 5BN4B 4DQKA 4Y6SA 4HH1A 4P2GA 3V55A 1M7BA 3MQFA 3NEUA 2IBDA 1VZ0A 3ESBA 4RB1A 5KHDA 2VZLA 3LHFA 3K0EA 4J4HA 1II8A 4DREA 4BRZA 3JWPA 4XDZA 4LHXA 1E1QA 3OAAD 1BIBA 3RUPA 2RGXA 2H1OA 1OX5A 3LMMA 1ZCZA 1E5QA 3WA6A 1SULA 1YBAA 2WU3A 3VR5D 1ZNQO 4LS3A 5ELLA 5E3OA 3W5VA 1SUEA 1Y6FA 1ZREA 3E0JB 3FBNB 3BE4A 2RB4A 2BGMA 4H77A 3AIOA 4IQJA 5CVEA 4HDCA 1F20A 4HN2A 4HV4A 3QPBA 3OPXA 4S12A 1G5TA 1XLVA 4KODA 4EZBA 1ZRCA 4IQ8A 4R7ZA 5EIBC 4BU0A 1M2EA 5BW4A 1E62A 4B5KA 4EGZA 3VVMA 3LXUX 4O4HA 1RYDA 4BLOA 4EFMA 4XN0A 3S2FA 5E3MA 3JATA 4BX8A 4PPQA 1AGNA 3TBFA 3VJKA 4MVJE 1XCBA 5A1JA 4G0ZA 2JEOA 3L7AA 1ZCAA 3RBVA 3KKMA 1A5TA 4UUBA 3G59A 1GZ5A 4BBSJ 3G9XA 1Y56A 4O4LB 2B8TA 5JCOA 3SF8B 1A9PA 3AVWA 3ZMDA 2C1EA 2JVIA 4GVPA 2JEYA 4AJNA 2JFFA 4D5FA 3ZDXB 2Y69H 1PHPA 1BVUA 2GX6A 3NORA 5AT1A 2AIRA 4DLNA 3T9EA 1E92A 4NV1A 1WJDA 3P9ZA 3RTBA 1YOVA 1VM6A 1U63A 1FRQA 3X1YA 2CYCA 1RRVA 1JDVA 1IRFA 4CV1A 1KH3A 4JLPA 3IXQA 1P18A 4P81A 4M89A 5A3QA 3ZY3A 1ZP6A 1KFJB 2EKPA 2ELHA 2RIPA 1HE4A 3QUCA 3OCCA 4JLBA 1O58A 5HBRA 1TAHA 6AT1A 2BJWA 1G9SA 4QUGA 3CRVA 3L1PA 1P4WA 2EFDB 5K7ZA 4AF6A 3ZXSA 4EATA 2PUDA 2F1HA 1K61A 2C2KA 3JCZA 1UBJS 5LOVF 3RV4A 4BQRA 3KEFA 3PEFA 1KEWA 4Q12A 2FV8A 2PRYA 4LRYA 3K0LA 3DEUA 2D59A 3AFGA 2GEVA 4WWCA 3IELA 4PPGA 2GYUA 3I3SR 5TGTA 5ALOA 1AXEA 1BA5A 3D6TB 2WLSA 2IKQA 1P62B 1U28A 1RI3A 1K7CA 3HCBA 4XUEA 2IY9A 2PR2A 4LFBB 4WXRA 4ACBA 4CCAA 4EJWA 3I73A 4NEHB 4DPMA 2IUEA 1T8TA 3BQZA 3RF7A 3T34A 2PGIA 1G21B 2EGHA 3AHDA 4WXHA 4S1PA 3ZN1A 4GPEA 2V65A 3AETA 4ENMA 1VG9B 1NPDA 5KOIA 5A9TA 1MENA 5JSHA 1VI6A 2L9VA 4BMOB 5JRZA 1LEBA 1Z3YA 3RJTA 2ZSDA 2MSCB 4FOLA 3WC4A 2H94A 1ZNWA 4I02A 3CE9A 4I81A 3VSBA 1E63A 3GVCA 4IVPA 2WBMA 3FWNA 4W5RA 3R3VA 2FMIA 3LFTA 2FSFA 4E13A 2HYJA 4BJ5C 4KZPA 2QUBA 1LGYA 4BDYA 2VTBA 1UFQA 1KQ0A 1Z38A 2D2FA 4CMIA 1GAQA 3L4EA 1K92A 1FX7A 4WBSA 7ADHA 4IPTA 4M0LA 1H3NA 5EGSA 4OXIA 1EWTA 2G1AA 5E2IA 3LHIA 3BBPA 4B0OA 1UDXA 2WKWA 4ZYDA 2L0XA 4US0R 1T8RA 3FW1A 3WIVA 4G6ZA 3ADDA 3VV2A 2Q2VA 1K7XB 2XCQA 3CKMA 5LPNA 1MGOA 1TVMA 4D0LB 3QVXA 3NV7A 3WE3A 3LTEA 3QUTA 4IIBA 4M1EA 3IAUA 3CIFA 3L1UA 1G7CA 3PUIA 1UHSA 1ZD8A 2ZUVA 1E5LA 1BR4A 3S32A 2V79A 3DL4A 1F14A 4DZZA 3D6AA 2JIPA 5E8RA 3PGJA 3BD8A 2IOYA 2H2IA 1NC1A 5FFXA 2HCJB 5FWDA 3UZUA 5E8GA 5CB4F 1XDGA 1L7BA 3MQ0A 5ADHA 2ONZA 5G0UA 2Q6LA 4HTFB 3LC2O 3TRFA 2FSVA 4RXMA 4K9RA 1J90A 4YQEA 2W70A 3SS7X 2R8RA 2PX6A 3IEIA 5BN4A 1XPOA 1STZA 3R3WA 3RTDA 3RNLA 3WMGA 3GPLA 1VLVA 3FWPA 1RJ9B 4N39A 4A10A 2VPXA 4LGCA 3VZSA 4KE8A 4UTVA 1K89A 4JXKA 5CIWA 1WHTB 2OV2A 3BGDA 3WL3A 5ALWA 4GPIB 4QT0A 3L9WA 3IX7A 4UVAA 2O0HA 2W7TA 1IXRC 3T5PA 6ABPA 2W1OA 3I1YA 1WMBA 3HUFA 4FYHA 3LC1O 3BDVA 5AW2A 3JD1A 3CVWA 3PEVA 4QU5A 3CR8A 4MVWA 4ND7A 3TR5A 5FD8A 2D7CA 4MICA 2I2XB 1Q1VA 1NYQA 2ZTVA 2C9ZA 1E89A 3BHJA 3DEZA 6PAXA 3LZCA 1NLZA 3BRWA 2ZATA 2H65A 3FUTA 1HLVA 1MT0A 4M7RA 1JLLB 3PQ3A 2NTVA 3ZWDA 5KTOA 3FMSA 3FTDA 2ZFUA 3OYGA 3CO6C 4CV0A 1SANA 2H11A 1Z91A 4IO0A 1TWGJ 4EB3A 4X3CA 4HGNA 4GVLA 3VR6D 2UWMA 3SF8A 1HYQA 1ND5A 2NZVG 5GJWC 2HSEA 5ES4B 1FX0B 5TQ2B 5DCMB 3KHTA 2VATA 1MAAA 2WYHA 1F2DA 4EYQA 3LSRA 4UUNA 1SUDA 1RZVA 1N2JA 4G1EB 4OQMA 4X71A 3ZLVA 3GLFB 4C0BA 1FDVA 5LXTF 2V03A 3IDZA 1E9EA 1KVTA 3GG9A 3DKYA 2R8EA 3O95A 4YFYA 1FTWA 4OIPF 3QU9A 2EX0A 2ZCJA 1SC6A 5LQDA 4EMTA 1KY4A 3PR3A 2INGX 3DTNA 4C3JJ 2NO0A 4OGFA 3LVRE 4L75A 3TDZC 3H4TA 5KQMA 1SOUA 1NFQA 1CEYA 1YIDA 3HC7A 2E1OA 1RHJA 1JMVA 5CA1F 1RYFA 4A26A 4TTRA 5FO1A 5JJBA 4FUQA 2ZUTA 3CUUA 2ZB4A 4NE9A 2NYAA 1JJAA 3I2JA 4JIGA 3OH8A 4A3SA 2WB1N 4YHHB 3ANLA 3SHTA 4WN3A 3F3SA 1XZPA 1U8AA 1PGOA 1CHDA 2E19A 1JFVA 4NDAA 5BWMA 3SYTA 3BM5A 5LQAA 3QHAA 4Y2TA 4BTVA 2H7YA 4FXPA 4XBFA 2W24A 2WA1A 3BWEA 2J46A 1OISA 2HYFA 1J97A 2GN9A 1XCPA 1OFVA 3JRGA 2VQ6A 1G21A 3TZQA 2WEKA 3EFOB 4P32A 4OOEA 1RVDA 221PA 1DOZA 1VYHA 5LP6F 2O0MA 1H0RA 1C80A 2BEJA 2IXGA 2YVAA 4N47A 4L7QA 5KEIA 3EMKA 3ZGVA 6GPBA 3I9V1 2C61A 5AKKA 4C4SA 1BBYA 4J9VA 2DT7B 3E3LA 4LYEA 2G7HA 1FDOA 3KTDA 1GVNB 3T9CA 1XZLA 1P7ZA 1ZGWA 3ZQKA 1OFHA 3A04A 1DC8A 2VLAA 4NUBA 1HZZC 3JTEA 3WB2A 3B89A 4RE5A 1TEVA 1YZ3A 1E3TA 4MTLA 3NALA 2O52A 1EZ4A 5ALGA 5BV2P 4B76A 1KU0A 4E3WA 4PVCA 1M5TA 5C1OA 3RG2A 4P34A 2JASA 5EMNA 5SV2A 1ZM9A 3AW8A 1AXGA 4E7IA 2YOFA 1T4GA 3W6VA 1CEXA 2O8VA 2PUFA 1QG2A 1T13A 2WILA 5GINE 1T56A 4RAGA 3I39X 4BAGA 1M8GA 1MC8A 4MA0A 3P9YA 4Q4HB 2RAUA 3GO4A 1I3KA 2IHTA 3BWMA 3KQOA 1ORHA 1RHMA 2PN6A 1KJNA 4IWYA 5F23A 4KWEA 3OZXA 2HA3A 3J80K 5JBIA 4B79A 1B2LA 2PX0A 1GQQA 4DCSA 3PNPA 4Z8XA 2E71A 4AKSA 2X8AA 9LDTA 4RDXA 1RCUA 3DE1X 3MKLA 4IGEA 4HAUA 4E2YA 2A7QA 4HTFA 2VHTA 5FWXB 2A9PA 2C83A 3R0AA 3T4EA 1QDLB 2YIVX 3A10A 1YB6A 3C48A 3T7CA 4QTZA 4YY3B 1EVKA 3COJA 2Y9YA 1IBCA 1Y1RA 5JYEA 4HW0A 4AX8A 1XTBA 2HK8A 2CMGA 3NZEA 1SUSA 5FB3A 2IY8A 2X0KA 1V1JA 1RJ9A 3COSA 2QUHA 2R4QA 1BWQA 1EK6A 3FCAA 4NBTA 4BQAA 4D3SA 3G6WA 2IUUA 1Q11A 3IILA 3W04A 4Y2RA 2EKQA 5M04A 4KN9S 1W4AA 4F0JA 3WP0A 3F3XA 3GNQA 2E1MB 5JCZA 3L02A 5DK4A 3FWEA 2ID3A 1AUVA 1WXDA 2QAGA 4F72A 1SKUA 4HF7A 4M7PA 4RGRA 5DGDA 1KEZA 1JR2A 2B7LA 3TTYA 5JQGF 2XBUA 1JLLA 3EGEA 4LRSB 2XJ9A 4C6SA 3AM3A 2C9BA 4BVEA 4DXAA 4DXDA 1KI3A 1M8KA 4JBAA 1DDNA 1FBNA 3BFKA 4RPLA 3WQSB 2XTAA 4PZCA 4R81A 7YASA 2VG8A 1N5RA 4BNVA 1Y8AA 3PPIA 1AKNA 4LJKA 4MW6A 1X42A 4PEVA 4DA6A 5EXSA 2J9ZB 1FX0A 5TQ2A 3HY4A 1YW8A 5DCMA 3DBOB 1WHSA 4IDBA 4J1SA 1R6XA 1T35A 5A03A 1IXZA 3JRIA 3KSAC 5CXUA 3GLFA 1S8AA 4LG1A 3MIIA 4RMIA 8OHMA 3PQKA 1WS6A 1LQ2A 4N8DA 1A8QA 3QE4A 3NS7A 2XVMA 1FMFA 1CERA 3UQYS 2D3WA 3TNYA 3S8MA 1ZVJA 4AJOA 2D06A 1AS3A 4RTSA 5REQA 2ZI5A 2AR7A 3VNUA 1SZJG 2JEZA 1Y9DA 3P9SA 1E0DA 3ESWB 4NQWB 2PIAA 4ZQHA 1RLMA 1A3CA 5KNBA 1YQDA 2XF7A 3LUPA 3ES9A 1S89A 2Q6OA 2WAAA 3SOZA 5K4GA 4BX2A 2K85A 4BUPA 2FN9A 3HA5A 1LFAA 1RWWA 4JBLA 3OT5A 5AKIA 1I4WA 3F8BA 4PN7A 2ESNA 4WFKA 1SVNA 2IZ6A 3OZWA 2A5GA 4FCCA 3UICA 3C16C 3IIIA 4F7WA 1VLZA 1ETKA 1PUEE 3F46A 4HQLA 3F73A 4QDJA 2Q6IA 5FTMA 2HJGA 4MLOA 3BMNB 4UATA 2B9VA 1NVTA 5G1PA 3FM3A 4ARUA 3R7WB 4LECA 3O8HA 3BDIA 3ELKA 1RC1A 1CUJA 4BL0B 3NIFB 1T3GA 3N8IA 5KIAA 3EFOA 4UHHA 1GM5A 3ADBA 3X0DA 3I12A 2Y27A 4ZDLA 5GGYA 3FM9A 1T3TA 2J3QA 4EAQA 1ZG1A 5J1RA 2DA7A 1V0JA 5DXFA 1QOZA 4PHHA 3G68A 1P29A 4EUSA 1GUBA 1VHWA 5J23A 2MYPA 4DV0B 1JPUA 5M3FJ 3I5AA 1FU7A 2MC4A 1EVLA 2FOXA 1YQAA 3RTEA 4FTHA 1XLWA 3E9NA 1OKKD 2HMUA 1HT0A 5GZ1A 3F8NA 4R69A 3PIOF 4ZQGA 1OQAA 1S7OA 1CIJA 1IUKA 4OHYA 2DOKA 4Y6GB 4E09A 4GS5A 3BX1A 1LRKA 1TK2A 2ZJ7A 3G88A 1E9DA 3NEJA 4A92A 3IP3A 2B4AA 1E77A 2F3TA 1BMFD 2J5PA 4D0RA 5H3HA 4KFSA 1W94A 4Y98A 4U2DA 1GGMA 1NSTA 2IU3A 4LQLA 1D6JA 2GXAA 3EBLA 1PS8A 1EB9A 1SEUA 5JD3A 2R9VA 2NVQJ 4Q4HA 3STYA 1PE0A 4KUHA 4B40A 4KN4X 1V16A 5AKXA 4LXQA 3VR0A 1M76A 2HF9A 1UINA 3QUQA 2IUYA 1D5YA 3QU5A 5JFGA 1PP8F 1DS6A 2Q6TA 2NZ2A 3HK2A 2Q3BA 3QOYA 3HGGA 1NXQA 1D1BA 5IDXA 4HX2A 5DMHA 2IV3A 3W8DA 1USTA 3SEFA 3PQ2A 5FWXA 3ZWPA 1CY2A 1B76A 3UAOA 3GJYA 1FVFA 5D3KA 4ILKA 3L7DA 2ZSUA 1C30B 1W4MA 3FPKA 4CLOB 3KOUA 4LZWA 3N0WA 4GMHA 4WOPA 4LGMA 4KBFA 2Q5CA 1G5PA 4BY1J 1BYIA 3C2HA 4PC3A 3H2JA 3DT9A 1HR0B 2HGSA 5EAIA 3LV8A 1PG2A 3HSEA 4KPGA 1QP0A 5CM8B 1LTQA 2WIDA 5CVJA 1U9CA 3EWSA 1AKUA 4IF4A 4HDUA 4JZKA 4GX1A 2MSNA 3KYJB 5GGXA 4UUSB 3ZI7A 1YFHA 2WDPA 1ZUD1 4CL8A 4HEA1 5I7HA 4G67A 3QX3A 4P92A 3TSWA 3GGJA 3LSMA 4KXLA 2UZ0A 2YPRA 1I0IA 4I7HA 4KXUA 1QTNA 5HDGA 2BN4A 4FGJA 3QEMA 2Y77A 1JTYA 3W2TA 4BVJA 2G1PA 1GTVA 3JWIA 1QP8A 2WYOA 2QR2A 1V5FA 4LJYA 4PICA 3KFXA 4EG0A 3UJDA 2HEOA 5FUVA 5LRRA 1YVDA 1ZXXA 1AHPA 3OT1B 1JKFA 3L46A 3K96A 1E2IA 3GAFA 1T9AA 5C7YA 1G5HA 5J4KA 2RHDA 1NWCA 4J1QA 3V4ZA 4UBLA 3GH1A 3KKOA 1KWGA 3E3OA 2C3UA 2OHOA 2G5CA 5I9TA 1DWUA 1P1BA 2E3JA 4OI1A 5AM5A 3K4JA 5F7JA 3LQRA 5PNTA 3DZIA 4AVYA 2ESHA 2A07F 5C4MA 1J2YA 4RV4A 4QL3A 3CTMA 2FFBA 4DUZB 1LDEA 1U8CB 5DP1A 1J8VA 3I32A 4NC7A 4XVQA 3NHZA 3RSHA 3O6BB 2V3CC 1SH7A 1QYVA 2ZWVA 3IUJA 3TQQA 5KNBH 2D74A 3QPWA 3PDCA 2F6RA 3HHEA 4FQ8A 1SXQA 3W4KA 3K9HA 1Z6XA 4IM7A 3ZBUA 3FRJA 1TU0A 3JVEA 4FCTA 4OGWA 1JYFA 3ER6A 4ZGWA 4UNRA 2W57A 2J87A 3VR2A 1E2BA 1Q1HA 1IK6A 1N7GA 2X48A 4DWWA 5BT9A 2WSSD 3NTUA 2QROA 1R1DA 1VC2A 4F38A 2R7RA 3LUJA 2H5IA 1YQUA 5KNDH 1RXEA 1TTQB 1R9JA 3IC7A 2FJ0A 2ZBGA 4GL4A 4WEOA 4NR0A 3GW8A 5DNUA 2ZYIA 4CKBA 3TL2A 2WNSA 3KZYA 3X2EA 4QLOA 3FFTA 2BFAA 2XZLA 4QBHA 1JN0A 2ZI7A 3FBIB 1WMDA 4R1HA 4RDIA 3VXKA 2HMSA 4DBLC 5H59A 2GAUA 1YASA 3U1KA 4C0WA 1EP2B 3BQNB 3BILA 5I5GA 3V7YA 3ETDA 3S3NA 4XGNA 2ETXA 3UB2A 4JMPA 2XI4A 2OK7A 3GJQA 3PSFA 1FMTA 1K6XA 4I4TF 5AK0A 1HF0A 5F33A 4ZDKA 1DAIA 1DAEA 5EE5B 5KUTA 3BMNA 4GKBA 2P9BA 5KKCA 3FYDA 1YACA 2GM5A 3R6GA 3R7WA 4J0EA 2YV4A 1OX4B 2HB6A 1ZMTA 1CBUA 5IH3A 4ROTA 2VWHA 2KRFA 1HK7A 1WCV1 1ZM3A 5JI2E 3JQFC 4C76A 3CU5A 2QYHA 4EF5A 3TO6A 5EZHA 3OIDA 2J5QA 2OCEA 2OESA 3R5HA 1YR3A 3EG9B 3MMPA 3QNUA 2PL5A 2WIGA 5FPYA 3ACDA 5CLHA 1GPAA 4JI7B 4CMGA 4HAYA 1E3LA 3NP7A 4BFLA 1KMMA 3ABMH 4B4UA 2O5VA 1H4SA 4FOTA 4DCPA 3UK7A 1F8YA 1I3AA 2CL7X 3VHRA 1Y3FE 5KWJA 2B4TO 5G0WA 4QO8A 2IA5A 3VJLA 3VTZA 5HKKD 2ZNZA 2VQ3A 4B45A 4DQUA 1QHIA 4TYNA 1Z0KA 1F7UA 2XMZA 1SCNE 2OAZA 1N5KA 2Y2VA 4QDXA 2H0QA 4W5NA 4TPKA 3PPXA 4ITUA 2QT1A 1N75A 3AP1A 3PS9A 1AIPA 3IQZA 5AM1A 2AXNA 1X1CA 2C99A 2XOEA 2OC4A 4P0TA 1IRXA 1TQ8A 3LQQA 4OXQA 2HLDD 5LP1A 4UTPA 2F5FA 2GA9A 3GLGE 4YFKF 3FSJX 3JQQA 3MWDB 4DLBA 5JANA 5JMWA 1KIMA 3S7ZA 5I7AA 2J9RA 2D6FA 1JFTA 2B6NA 4J94A 1LW7A 1KDTA 3SJBA 4EW6A 2A1TR 3PQ8A 3X1MA 4D92A 3AF4A 2OD9A 4KQFA 2JLYA 3BFJA 2Q2NA 5SYNA 2HREA 3ONWA 3EDMA 2WU0A 1OH7A 2WG0A 4NBWA 5JHFA 5FWYB 4CLOA 2V98A 4P5PA 5I7VA 1LD3A 1ZEMA 2CDCA 3SMQA 4K2EA 3V1UA 4HATA 1UOEA 4ARCA 2KIFA 1SU8A 1HBXG 2W85A 2OFPA 2QUJA 1YB4A 4HMQA 2OG1A 3MN1A 4Y7NJ 4C21A 5GOTA 3HB1A 4N5IX 3QXSA 2H17A 4PBSA 3GRYA 3ER8A 1HTWA 5LA6B 4UUSA 1GOTA 2B1GA 1D1CA 4EJ6A 3WTBA 4RLHA 3GEMA 2HYIC 4D2IA 4PCUA 2M4KA 2Y1XA 2QSJA 2GUGA 1ZX1A 4AY4A 1L4BA 2L82A 3S2SA 1AQJA 5J2UF 1TVCA 5JSFA 3B1ZA 1ZI6A 3QQ5A 2DOEA 2F64A 4WMLA 3ZX4A 5KYGA 3OT1A 1NUAA 1XQ1A 3F67A 3QG1A 4DQVA 3H3XA 1H88C 2P9GA 4ID9A 4KJXA 1Q77A 4DCCA 1CZHA 2CHVA 3U37A 4POOA 5IT9A 5EKTA 1BAPA 2VJMA 5EPEA 3EZNA 3I0ZA 3TQRA 1KL7A 1B23P 4UJ5A 4ON0A 1MKYA 2KMLA 5I9NA 2NXCA 4EELA 3DDWA 2D13A 1MVNA 2GAAA 1XU4A 2AQEA 1Q0RA 1Z9BA 2OBNA 2VPQA 4NCNA 4AG5A 4WLFA 3DKXA 3OYFA 5THQA 4BO7A 3SHOA 2CLIB 2J3LA 2WPNA 5C9ZA 3DE3X 1DC4A 2C1ZA 2CBZA 1UP7A 2P4QA 3ITNA 3K5IA 1KP2A 1U3EM 3FUUA 3JSOA 4KQGA 2G1JA 4ONEA 1MIOB 4IICA 1MXHA 1XNHA 4H7HA 1GZ3A 4HFNA 1ZOOA 3ZDZB 1Q1EA 1EFCA 2WJVA 2Y75A 2FKAA 3I3OA 4B3GA 3UJ7A 4ZTUB 3ND6A 1YE3A 5HGJA 2XB8A 5BSWA 2DA5A 3V1LA 4DJFC 2QVCA 2GD1O 5BR1A 3BZKA 1IH8A 3DOOA 5EIBD 1HM5A 2AOVA 3RHTA 2NNYA 5AKYA 3D8SA 2R7KA 4UPEA 5B4UA 1LFDB 1CVRA 1G0NA 5BPIA 2OHHA 5K3CA 2J67A 2O8XA 4Z3DA 4J4TA 3LDHA 4DR4B 1A98A 2IEYA 4EHAA 2JGNA 2DQ4A 2OXTA 4CHUA 4QGFA 3BTVA 3RK0A 3WYNA 1EFRD 2G71A 4HP8A 3LTNC 3ESYA 2ESRA 2R7VA 4QFCA 4M3GA 2KRCA 4PRYA 1OX4A 4LSMA 2RONA 4REOA 2VQHA 3PE6A 3IIKA 1R7RA 4YECA 3ZE7A 1BNCA 1T08B 2IQ5A 2Q28A 3K16A 3UENA 2XXAA 1VIYA 1N3BA 4V1CB 3D5QA 2PDAA 1AKQA 4LC9A 4KDCA 3LDAA 4IXNA 5HTOA 3EG9A 4AJ1A 4OXRA 4Y67A 5IUJC 5EL0A 3KOXA 3A6KA 3C3XA 1NV9A 4LXIA 4JYCA 4ZC1A 2FPXA 5ALMA 4PNHA 3ASUA 2JZYA 4FHZA 2O3FA 3KKPA 1A1SA 1R0YA 2GXUA 4PPFA 5K2OA 4OG2A 5JNRA 3GCGA 1D3AA 3EODA 4W82A 3SVTA 5BSUA 4F7ZA 3N97A 4LRQA 3RVLA 4A93J 4BZQA 2AHQA 4A3BJ 5KWSA 2QLLA 2BUCA 1OCPA 4MZDA 2XSZA 1IN7A 1ZYUA 4TYMA 4Q02A 3A6DA 3AR6A 3RYTC 3M34A 2IPNA 3LY7A 3F5FA 2PNJA 4DMMA 3BMOB 3SF0A 3D5RC 4I8DA 1PR5A 3ED5A 1WL8A 1Z75A 3M6FA 4R01A 1EK1A 4BHTA 2CW0F 3M6AA 4J07A 3PXDA 2ZSIB 1Y7HA 5H4GA 4MFEA 3RIHA 1JG1A 1LB1B 3F9KA 5JFRA 3MWDA 3PXUA 1VBFA 4ENRA 4J3JA 1RZRD 1NG7A 4I01A 1ESNA 5LJLA 1MCZA 2Z1MA 1E5XA 4E7KA 3TOXA 5U4QA 1OR8A 3UMRA 4YMVA 3JZAA 1IG0A 1XXLA 5GTDA 3DTEA 2Y6VA 1R5HA 2ZCUA 3ZXUB 4NWIA 5F3DA 1Z33A 1R0KA 1FYEA 5JWOA 1W5EA 1ZBQA 3T7RA 1U81A 2AS0A 4GRIA 5KOJB 1A31A 5KNCD 4Z51A 4CIBA 5D86A 2Y8EA 5AMXA 3TGWA 2PFGA 2PYIA 2JJ8A 1JTVA 4CL3A 1P7WA 4UV9A 3AVYA 2H1HA 5CGQB 1Z28A 5LA6A 3H5IA 3JD4A 4CQNA 1OPXA 3DLTA 5FPKA 4TVKA 3VMMA 3BR0A 3TUJC 3PIDA 1B1AA 3O4JA 2QU7A 2XOKA 2P0EA 2HDWA 2Y4OA 4ZU6X 2C7OA 2H8RA 1F2VA 1E20A 3UKGA 3A4MA 5KYUA 1KH2A 4ZYYA 2GASA 5FBRB 1X4PA 4BC1A 1PZFA 1MDMB 1WCXA 2R8PA 3ZI4A 1JBKA 3F5DA 2GAIA 4D81A 3CH5A 4C3ZA 1SBYA 1PZEA 1U98A 2PGLA 1TCUA 3OQIB 3WQHA 3EYAA 2JI9A 5ILQA 1MW7A 3Q9SA 3EVNA 3KR9A 3BWGA 2C2GA 2XGSA 4D9CA 2M2EA 3FBWA 4LY9A 5EJ5A 2XB4A 1A8IA 3KXKA 4I99A 1RQ7A 1HBJA 2XUDA 4C5AA 5LEJA 5JS8A 1QHHD 3K4NA 1GRRA 4RJIA 5G41A 2WAYA 1GAWA 2VHUA 4R5HA 4TWRA 4R1LA 5EZ6B 4BTLA 4DUGA 2AVDA 4IINA 5E1BA 4BDTA 4PXAA 4YRQA 4M0FA 3H1BA 1CQXA 4O8ZA 1KQ9A 3R1IA 3IAS2 3E1SA 1GRQA 2H48A 4G3XA 3FBTA 4FHFA 1TZBA 1CQTA 3DF7A 3IVMA 4CR8A 2DMNA 2DFHA 3DOEA 3KBOA 3DVRX 2OBBA 4DLRA 1X87A 3WGUA 1U2PA 1MMDA 1E69A 3OMYA 3GNTA 5DTMA 4RBNA 3T0YA 3T54A 3CF4G 4MCHA 1A8PA 1M0WA 4KZKA 4RNCA 4C43A 4Z1MD 1NF9A 2XMCA 3THWA 2VJJA 4D82A 4D1QA 2XAFA 2W98A 5EWLA 3DFUA 3O8CA 3SKYA 3A2LA 5EP2A 1U9NA 3F2VA 1XN1A 1WCMJ 1T4BA 1PT8A 4A8TA 2OILA 1RXVA 2FPRA 4JP1A 1IEWA 2I55A 5EMJA 1AWCA 1GUAA 1U0NA 5A4DA 2ILTA 3WADA 2O2GA 3LT2A 3W6JB 1IZYA 3WNVA 1GPDG 4K05A 3HYLA 4A3MJ 1MAWA 1RWBA 4WK2B 1KAGA 5T4FA 4KB5A 2JVGA 1WJBA 3IAS1 4TSKA 2PIDA 1RJGA 5BMVF 2JFBA 4LBYA 3BCUA 5HDQA 4D5CA 2WZQA 4A27A 3WTZA 5A9SB 4IQ4A 1H6AA 1C7IA 4V1CA 2COBA 3AJDA 2F9FA 4Z9BA 5C5DA 3LO5A 4IQ0A 3QVTA 1ZSVA 1V3UA 2ACWA 4IMPA 5A4MS 1PQYA 1XJ5A 1DPFA 1VG0B 3PFWO 1V8FA 4JI6B 1RI5A 2PQ2A 2I6UA 1FSGA 1C3VA 3MTEA 5EP4A 4KR3A 3I76A 3CO0S 5G53C 1DCFA 4EG6A 3GQBB 4FZ5A 2P6TA 4YPOA 3ZWMA 3EUHC 4TL7A 2X8WA 1KORA 3AU8A 2PLAA 1BS1A 5FPSA 5B53A 1GITA 1FX1A 5FPPA 1FU8A 4NBQA 4CCOA 1MC1A 2PFSA 2I8DA 2CLKB 4FX5A 4WAUA 1JTXA 4G1BA 5E8JA 2C7PA 4EARA 2ZR0A 3BMOA 3UC9A 2QCOA 3OS1A 4N65A 3PFGA 4ZT5A 1S72I 2JFXA 5CB0A 2ZSIA 3C3DA 4KQJA 3GBSA 1X3SA 3JAMZ 4BVLA 2YINC 3ANSA 3CWZA 2GESA 3JRNA 1WEHA 1ULSA 4OOFA 1YRWA 5BSFA 1U1EA 4PX5A 4C0HA 2IPLA 2IY7A 1S3IA 4V2FA 4LRWA 4AJIA 4K9OA 4TQAA 4UBKA 1IUPA 1TO6A 5KQLA 1O7JA 2IGBA 1YKGA 2X0NA 1V25A 3MYRA 3D5LA 2ZMEB 2STTA 2A6PA 3C5EA 1YC5A 4BTEA 4MUJA 1DQPA 4U5XA 1EEHA 1SQSA 1SUCA 4H6VA 2XR1A 1K78B 1I7NA 5JD5A 4DV5B 5KOJA 5E1WA 4ZO7A 4UVHA 4BO4A 2QLMA 3I2FA 2D4HA 3KT0A 3ROPA 1Z17A 1I6LA 4PR0A 1DJLA 1XA0A 1K27A 3QPVA 1IYZA 2BCGY 1X14A 3VNVA 4JVOA 3VDXA 4J76A 1G8HA 5DBIA 3HDDA 1A8HA 1N2CE 4G0MA 2QM8A 3S8YA 1G20A 3G17A 3IULA 2IA2A 3SZ3A 5BQ3A 1MDMA 5C1BA 3I09A 1DAPA 4HWGA 4KL8S 4UEQA 1D5CA 1Q0PA 2DOAA 1TEZA 3VTFA 4YASA 4OJYA 1SIOA 4E30A 2QZPA 3OYEA 4BLUA 3OQIA 3TO9A 1RLTA 3IVCA 3OV8A 4PSAA 4DJTA 3DU6A 4JB3A 3VEPA 4KIJA 4FFRA 3DPTA 3WWZA 1P6QA 5ER6A 1BGXT 4DRYA 1ZU5A 1BMTA 1IM5A 2F1OA 4DYDA 3H2HA 1T4DA 4UOEA 3LSJA 2C5HA 3S1SA 5EGNA 3T06B 2XNCA 4QAQA 2QUFA 2O8DB 4XYGA 4X8OA 3RTAA 2ZR7A 4OU4A 2KS6A 3ZD7A 1KFKB 2B6HA 3OEYA 3GZTB 3EXIA 5J58A 3O7WA 1CE8A 2XA2A 4I4NA 4R8MA 1JKXA 4OSPA 3GCXA 1PRYA 5A4IS 3QVVA 4BNKA 3MT9A 1YI8A 1FQJA 5CVIA 2BFDA 3AHJA 1CRQA 3CTAA 3NH9A 2OV1A 1Z12A 2QTFA 3D1JA 5I9IA 1EUYA 4GEGA 3FDZA 3T8YA 4IIUA 2CLFB 3O90A 5TE9A 2ZITA 1SOMA 2VT3A 2Z3YA 2B69A 2D62A 2DKNA 3G73A 4WXMA 3JAMA 1NDHA 1X7DA 2R8OA 3MKWB 1W0JA 1J2EA 2P91A 2Z57A 1YBHA 2YHAA 3SQMA 2J9XB 2JATA 5FT9A 4BMPB 4ZEVA 2H4ZA 3GMSA 2BFPA 4MXDA 2HOEA 3CSUA 1QYRA 2FSWA 2X5NA 3FPSA 4X97A 1JSZA 5IVHA 2LDBA 1CT9A 2E5LB 1AHDP 2P6UA 5ALJA 3H9BA 1JAYA 3UNGC 3CLTD 3MGGA 3SEZA 1W88B 2FVYA 3RRBA 4AO8A 2L4MA 3A3NA 1NBMA 5DI9A 1ZMRA 3KHSA 4NBVA 1TU3A 2ZR9A 2HJHA 2DJ5A 4A5OA 5H68A 2VDVE 5FNVF 4TYYA 1LWNA 5I01A 1L5RA 4UHJA 4CM1A 2M1ZA 3CUWA 3MAAC 1XTUA 1N0IA 3AR9A 3HWWA 3JWGA 1WSWA 3DPLC 4O8CA 2VVTA 4DMCA 1Y6QA 4WKPA 1L3CA 4DNQA 2OSVA 2P2LA 3ONEA 4MPJA 4UQPA 2W2TA 1UT6A 3I9FA 3WQBA 4LIVA 2V8OA 3IA7A 1JQLB 3DB2A 3LPCA 2VUMJ 2K5UA 1SBQA 5A9SA 1BFKA 5KMGA 1W48A 5F9HA 2PSSA 4DSNA 3WIDA 4MKFA 2ROQA 3BF8A 4GPD1 4LB6B 4OAQA 2AFRA 2P1ZA 3G9UA 3M6VA 3TTWA 4WZBE 3ZEAA 2XHEA 4OLHA 1VDMA 3GYHX 1DKPA 3CS3A 4EW3A 3SEAA 4FFDA 2SICE 4MEBA 3TDUC 2P9ZA 2X14A 2JIZD 3GDFA 5GAEJ 1ONVA 2XW6A 2ZS8A 1ABFA 4QICA 2QG6A 2OQIA 1DB3A 3C8MA 4LG0A 1FMLA 4LJ4A 1K3FA 4GLLA 4N18A 5GWXA 1WA5A 3EZFA 2PD3A 1QCDA 3ABRB 3MCTA 3P9XA 1GNSA 4KQ2A 5F12A 2RK3A 4F46A 2BBWA 2I2DA 5DGCA 4MQFA 1FLVA 1AKTA 2W82A 3AJ8A 1IGNA 4L5BA 1XG5A 2OZVA 2EA4A 4DDMA 5TLSA 1O87A 3N4MA 4Y9DA 4B3SB 5E38A 4ED9A 2EIXA 4WINA 2BW0A 1ACMA 3E6BA 1QZ3A 5HS6A 3OLYA 1XZ8A 2WF9A 4YQFA 1Y9EA 2YRFA 3VUFA 3H1FA 5LUBA 3W2WA 5ELXA 1ZFNA