3H5RA

Crystal structure of e. coli mccb + succinimide
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
348
structure length
340
Chain Sequence
MDYILGRYVKIARYGSGGLVGGGGKEQYVENLVLWENIIKTAYCFITPSSYTAALETANIPEKDFSNCFRFLKENFFIIPGEYNNSTENNRYSRNFLHYQSYGANPVLVQDKLKNAKVVILGCGGIGNHVSVILATSGIGEIILIDNDQIENTNLTRQVLFSEDDVGKNKTEVIKRELLKRNSEISVSEIALNINDYTDLHKVPEADIWVVSADHPFNLINWVNKYCVRANQPYINAGYVNDIAVFGPLYVPGKTGCYECQKVKENIDHKIKLINSRFKPATFAPVNNVAAALCAADVIKFIGKYSEPLSLNKRIGIWSDEIKIHSQNMGRSPVCSVCGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title How the MccB bacterial ancestor of ubiquitin E1 initiates biosynthesis of the microcin C7 antibiotic.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/antibiotic
molecule keywords MccB protein
total genus 110
structure length 340
sequence length 348
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00899 ThiF ThiF family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1160 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3h5rA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3h5rA02
1C0IA 1DSSG 4R54A 5TNXA 3MEQA 5EN4A 1DAOA 2BGKA 4TZTA 3ZHBA 3HQ4O 3RUAA 4EJ0A 5LDHA 1VM6A 1U5AA 4K1LA 1B3BA 1Z82A 1K89A 2PFGA 3EW7A 3JQ9A 1O8CA 2HLPA 4WCFA 2FWMX 4CMBA 3WNQA 3UN1A 1FXSA 3HFSA 3ZV4A 2HJRA 4TKLA 1N5DA 1CDOA 3C85A 1MX3A 1YS4A 4AVYA 1T2FA 2DPGA 1GD1O 1LC0A 3PJFA 1LSSA 3WDSA 4JJGA 3PWZA 3B1FA 4Z9YA 3FHLA 1PQUA 1MA0A 1E7MA 4XYBA 3R0IA 1Q0QA 4QX6A 4CM9A 3JQAD 1CERA 3Q3CA 3OSUA 4BO8A 1ENOA 2IZ0A 1UR5A 1ZSVA 4TRRA 3GFGA 3JQEA 4HFRA 2XOXA 3RIHA 2GN6A 1N1EA 1RPNA 2A4KA 3MTGA 1DPGA 4AJKA 1QLHA 4CQMD 2ZB7A 4QEDA 2UV8A 5G0UA 2OGUA 2X58A 1NX6A 1IY8A 3OETA 3RJ9A 3DHNA 3FSRA 3LYLA 1BTOA 1OC4A 3GA0A 4BNIA 1KBZA 5TGDA 3ONFA 5L45A 3I9OA 1HDCA 1O95A 1LQUA 1ISMA 5DCWA 3VKUA 1F06A 3WOHA 3P7MA 3U0BA 9LDBA 1GQYA 5JAZA 2CY0A 3L4BC 3DO5A 2TMDA 3RBVA 4JLWA 4NG5A 5J23A 1Y5RA 2R6JA 3DOJA 4J49A 5G0VA 3RBXA 4GLOA 3JQ8B 2EW8A 5KWEA 1Q7GA 3OJFA 3I23A 1GEGA 3EDMA 1LDYA 4RPHA 5A02A 5BT9A 4OL9A 4W99A 5KVQA 4TVBA 3WSVA 4AJ4A 3UH1A 1DRVA 1VPDA 1VSUA 4IMPA 4P8RA 4CM5A 3UOGA 1U4OA 1QYDA 4D0RA 4J1SA 4OYRA 4M49A 4GMFA 4L4SA 2W2KA 4NJMA 2Q2QA 3GQVA 3HUDA 2OO5A 5A9TA 1SEPA 3PHHA 4E3ZA 1VI2A 2WMDA 2AQ8A 3OQBA 5LCXA 4R3NA 4II2A 3AUUA 3C7AA 1F8FA 4EBFA 3WNVA 5JMPA 3GR6A 4BO7A 5F1OA 5TRTA 5JW6A 4PLZA 3TZKA 3VVCA 2FSVA 2RIRA 1LDNA 1YWGO 2D2IA 3AUSA 3UUWA 1MC5A 1V35A 3ZWOA 3GHYA 2B83A 4MINA 3P2OA 5I9MA 1PJBA 3HG7A 2BH9A 2W2LA 1NNUA 1E6EA 3DEYX 1EE9A 1TB4A 4ND3A 4YB8A 4NU6A 3QHAA 4JX8A 4TZKA 4GMGA 3H5NA 3RFXA 3WR5A 2ZQZA 3W1VA 5L4SA 3KXDA 3L6DA 3B1JA 5KKAA 1VRWA 1VL0A 3KO8A 4S3MA 5ADHA 5I9LA 3D4OA 2J5KA 4CLRB 1ARZA 2H63A 3FTPA 4DYVA 3IUPA 4R41A 4WUVA 4YYZA 1WDLA 3IIEA 3ON5A 1IYZA 3GY0A 2WYVA 1JKJA 1LC3A 4UEJA 3I4CA 5DNAA 1EDZA 1FJHA 4BNLA 5ER9A 4IQGA 1HE4A 4FFMA 4Z6KA 3VPXA 5IDQA 4A2CA 1HZZA 4J2OA 4CJXA 4A27A 1CRWG 4FFNA 1PWXA 3HNPA 1HTBA 3OH8A 8LDHA 2VUUA 1HDZA 1GCUA 1UDAA 1MC4A 3EYWA 4CUKA 3D3WA 7ADHA 2C2YA 5JPIA 2AQHA 3DBLB 2WD7A 3VTZA 4BVAA 4CQMA 5T64A 1HRDA 4TWRA 3BMQB 1A4UA 5L7YA 2C54A 3GAFA 3HHPA 3G1UA 3H2SA 3PDJA 3GRPA 4MVJG 2GGSA 3MJVA 1P44A 3C7CB 3IUSA 4RPKA 4PZEA 1Q7CA 4RZIA 1NFQA 1QMGA 4A10A 1YJ8A 3KYCA 3U09A 4KDFA 4ZQEA 3I1JA 1OMOA 3F4LA 4FJ0A 5TQVA 5MDHA 1UDBA 2X5OA 1E7WA 1BWSA 3JQCA 3GH3A 4JCOA 3W8DA 1BXZA 3PP8A 5KVCA 3DBHA 3ADOA 4D45A 2C5EA 4MOWA 4NQZA 4WLNA 1N9GB 3RSHA 3ZWXA 4XRGA 2PGLA 3WYEA 4CMEA 3DTTA 5HS4A 1HETA 3TOZA 4YRBA 1U5CA 3NUGA 4GPD1 4DXHA 2P5YA 2Q45A 1YDWA 3H3JA 3WMWA 2Q46A 2JJYA 2ZB8A 4J4TA 4WOJA 3TFOA 4YVFA 2HSDA 2IXBA 3WBFA 4F46A 1G6KA 1CQJA 1QV7A 1PL7A 3WGZA 2CVOA 3K9QO 1E6WA 2O7SA 4CLXA 2GASA 1PGQA 4DPLA 3WJAA 3GVHA 3ULKA 2O3JA 1B15A 2AE2A 2HO5A 4LISA 1XEAA 2E82A 1JN0A 4B4VA 1BGVA 1UP4A 2OOSA 3OEYA 2IODA 1U8FO 1FDWA 3SJUA 2VUSA 1X7HA 4PG5A 1U3TA 1Y8RA 5JAQA 3BTOA 5HS6A 1HXHA 4CV0A 2JKVA 5CHEA 3WQQA 1Q2XA 4BMSA 3ZW9A 3MJTA 4NR0A 3DBRB 1NQOA 1V8BA 4RF2A 3MJCA 3OQ1A 8ADHA 5F1PA 2PKQP 2POQX 3QVOA 4YPOA 4O5OA 3ITKA 3JQFA 2RH8A 4RF4A 3WBBA 2YHIB 2VT3A 1Z45A 3JYOA 4BNWA 4UUMA 1SMKA 4ND2A 4INAA 2C7VA 4DA9A 4A26A 4WCDA 4XJSA 1X7GA 3NAQA 1UAYA 1C0LA 3I3OA 1P77A 3PYMA 5KVVA 3A1NA 2HAEA 2YQ4A 4KUHA 1QYXA 1QV6A 2ZK7A 4GI2A 1XLTA 3GVIA 5DCYA 1VLLA 4QO7A 4LCJA 3RC7A 4WOKA 5HTOA 5JO0A 2VHVA 1ZCJA 3W4JA 4BO1A 1XGKA 3G1TA 4GH5A 4MDHA 4CUJA 2JD1A 3RVDA 5KVSA 3L6EA 3ZWVA 1GYPA 5C7LO 1RM5A 4GKVA 4HUJA 3ROQA 1QKIA 4YJHB 5IN5A 3VZPA 3ANLA 4NBWA 3PLRA 1YE3A 1IHYA 4U0JA 4ESOA 5COBA 1TLTA 1DIGA 4FFRA 5L7TA 4CM9D 4JXKA 3JQDA 3LC1O 2R2GA 4W7IA 4NBRA 1GL3A 2O48X 1SB8A 4DQVA 4BKOA 1P0CA 4YXFA 5EIOA 3ICPA 1NFRA 1E1MA 3H9UA 4RVDA 3X2EA 2C29D 2YY7A 1E92A 7MDHA 1SB9A 3GC6A 3JQ8A 1W4ZA 5AYVA 3WYCA 4BNFA 3UAGA 2B5WA 5BQFA 3AU8A 2PZJA 2ET6A 3TL2A 3KRTA 1HYEA 1HEUA 2W2LD 2XF8A 3AY3A 4PLGA 5EERA 5AXDA 3LQFA 3NTRA 5DP1A 3OEWA 4DWVA 3F6YA 3Q0EA 4PRKA 1KVSA 4KQXA 4DL9A 4CLDA 5CEEA 2EIHA 1O6ZA 1MV8A 3VH2A 4NBTA 3K2BA 5LDGA 4L4RA 2DTXA 2DKNA 3I9JA 1XR3A 4HY3A 2A35A 3ZHXA 1OAAA 2OMEA 4OXYA 3RASA 4DYDA 3Q1LA 1AHHA 3VDQA 2GERA 2ZATA 2Y1FA 3PXXA 5H81A 4A7PA 4NH4A 2QG4A 1E77A 3E82A 4WK6A 3RC9A 1LX6A 1Y8RB 3GK3A 1ZSYA 1LJ8A 3BXXA 1ZSNA 3FF4A 4RCVA 5TS3A 4DBZA 3CZRA 3WGYA 3AUTA 1BDMA 2VRCA 4PG4A 1KS9A 2VUTA 4I9NA 3RWBA 5FI5A 4L76A 4CMAA 5ITWA 4ITUA 1XHLA 1ADGA 2CF5A 3VHRA 4R9SA 1E5QA 4E4YA 1DB3A 2Z1MA 1ZJYA 2P9EA 4KOAA 1I8TA 2JCVA 4MKRA 1HSOA 3TSCA 2W98A 2NU8A 1N1GA 2P2SA 3E5MA 1HDGO 4IM7A 4ZICA 3UICA 4CMIA 1UZMA 4FR5A 4G5HA 5TT1A 3M2PA 2HMSA 1WZIA 2WE8A 5A3JA 4OXKA 4LSMA 3K6JA 3PVZA 3RC1A 4FPXA 1ZK1A 2Q1SA 4RL6A 6LDHA 1R4NA 3D0OA 4B4WA 1DFGA 1WLYA 2EV9A 4ZD6A 4LK3A 4MVJA 5L95A 5U9CA 2WWRA 1L1FA 5L4NA 4UUPA 3L4SO 4JNKA 4UVIA 9LDTA 4XIYA 2J3KA 1R16A 2O3TA 3JV7A 1I2BA 4C4OA 1I0ZA 3IS3A 4DC1A 2VWPA 1X15A 2GCGA 2O2SA 2JFHA 4XZ3A 3VPSA 2BF7A 4HV4A 5THKA 5KIAA 4NFSA 3VH3A 3DBHB 1E3EA 1B7GO 4D41A 5JAMA 1KYQA 4M1QA 1I33A 4FSHA 3BMCA 3ZHYA 3SC6A 4DIFA 5A4DA 4YT5A 4RQTA 1QP8A 4WCFB 5IDYA 1GYRA 5JC1A 1CWUA 2VT2A 3I5MA 3PWKA 5AOVA 4CMEC 1NAIA 2D5AA 4YCAA 5AXCA 3FPLA 1H6DA 3JQAB 5H82A 3E9MA 1LRKA 1DC5A 1GEEA 2BFPA 2HK8A 4PLCA 4EI2A 3O8QA 2X23A 4QFCA 3ZH2A 2YYYA 2I3AA 4ND1A 4WE3A 5DZSA 5A9RA 3E48A 3PRJA 2GR9A 4B7CA 1GPDG 1EFKA 4DMMA 3BTSA 2G17A 3DC2A 4N5LA 1AXEA 1TEHA 3DBLA 3GGOA 4YAEA 3HADA 4Z9XA 5FWNA 2YV1A 3DQPA 4B7UA 1PWZA 1KETA 1KEPA 2C7GA 4R5MA 3QV1A 4NDNE 1Y7TA 3DZBA 3JD4A 5JNLA 3FBTA 5G0TA 4CM7A 2BHLA 1N2SA 1EK6A 5T6BA 1YL6A 2AMFA 1DC4A 1P33A 2NVUB 3K92A 3L9WA 3EVNA 5FEUA 4K26A 1GAEO 2QQ5A 2QYSA 4JP3A 1K3TA 1HE3A 3TZ6A 4D43A 3BAZA 2QW8A 3R3SA 1FDTA 4ZQGA 4IIVA 4MVJP 2AE1A 3WLFA 4MKXA 5KJ6A 5I7SA 4ZJUA 1E7QA 4JBGA 4TMFA 2GRAA 4DLBA 2Q1TA 3LZ6A 4XD2A 3F47A 4DPMA 3UCFA 1PGPA 1B8UA 2DTDA 3H2ZA 4DPKA 4R1NA 3IJRA 3O9ZA 4E2XA 4NZ9A 2ZTVA 3AM5A 4ZQHA 2EGGA 4KTVE 5TJHA 4TRMA 5JLAA 5H83A 3WX0A 1RYEA 3KYBA 2Y67A 5KNLA 3JQ7B 3WFJA 3BYZA 5F3RA 3ETGA 4FDAA 4OM8A 1N8KA 5FI3A 5EMHA 1PL8A 2W4QA 3Q2KA 2GDZA 4NHEA 3GHHA 1K5HA 1P31A 4GWKA 2HMVA 3ORFA 5IZ4A 3PJGA 2AHRA 4PLYA 1NPTO 4P38A 3V2GA 1FDUA 1A9YA 2O4UX 2X5KO 3VDRA 3EHEA 1XWFA 4IDEA 4RVUA 4WPGA 3KVOA 3NTQA 2CF6A 1MXFA 4Q39A 4J9UE 3WG9A 1JWBB 2OP0A 3GDFA 5JDCC 3Q11A 3MCVA 1YL5A 2V6GA 4AJ2A 2D5CA 3H4VA 4FOSA 1DLIA 3WIEA 4G2NA 4Z9FA 5COAA 1V9LA 4W9NC 1JDJA 4Z3DA 4XDZA 2ZQYA 3HDYA 3FNFA 4R1SA 1KC3A 2EGHA 4PZDA 3QJ5A 3GT0A 3EMKA 4IDGA 4NK5A 4F6CA 3WYBA 2ZTLA 2OL4A 1D1SA 2Q49A 4I5FA 1PZHA 5JC8A 1LLUA 2HKIA 3AM3A 3GN2A 4B4OA 1A9ZA 5CPFA 2P68A 1SC6A 3D5TA 3AK4A 2H9IA 1N7GA 3DZFA 4M55A 4MO2A 3AOGA 4PG8A 1P1JA 1NFFA 2P9GA 5TIIA 1E3WA 2HJSA 3D7LA 1I3MA 1ZXBA 4MIOA 3L77A 2C2XA 2VWQA 2Y93A 2WEKA 4FS3A 5I8ZA 4BKRA 5I7EA 3HB5X 2XXBA 4LGVA 1V6AA 2PA3A 3TL3A 2EXXA 4PZCA 4ZRMA 4FCCA 4DRYA 4CQMB 4MIEA 3S55A 3DWFA 1W8DA 3KYDA 1UZNA 4WGGA 2ZJ1A 3I9KA 2J6IA 4LSWA 4B8WA 5B37A 4X54A 4UAGA 3K8ZA 3PZBA 2YQ5A 4IIUA 2VYNA 2H5LA 4E5YA 4KP7A 2FOIA 2X5JO 3MJEA 1KVTA 1ZK4A 3GOHA 1PIWA 5DT9A 1PR9A 1FK8A 4G65A 5ES3A 1NHWA 3D3WB 1GPJA 1UP6A 2X0IA 3OA0A 5DBGA 2VHZA 4I8XA 4NBVA 2DU8A 1VL6A 2BI7A 5CFZA 1PJCA 3GPIA 3UKOA 2OBNA 4EJMA 2J3IA 1I3KA 1P1FA 1J5PA 1TT7A 1UZLA 2PR2A 3S2EA 1NPDA 1DFHA 1GUYA 4K6CA 1EVZA 4B7XA 1A4IA 1GQ2A 1TVEA 3WJ7A 2EW2A 1DIHA 1UAGA 2YDXA 5BSEA 3RJ5A 1DAPA 1B0AA 4GGPA 2JD0A 3NEPX 3KBOA 1AN9A 3M6IA 4YJFB 3T4EA 4AICA 2ZTMA 2A94A 1ZXLA 3VTFA 3DOCA 4GX5A 1PEDA 2JAPA 3TF5A 1R15A 1E1NA 4CM3A 1YL7A 4I08A 3EUWA 1UDCA 3Q9UA 1KEWA 3AW9A 4YAJA 4D7AA 3SBOA 5JCJD 3BTUA 1LDMA 1YKFA 1NWHA 3MOGA 4AL4A 5CDTA 5JDIC 4LRSB 5BSGA 4J7UA 3OBBA 4AG3A 1E7SA 2X4GA 4RZHA 2DTEA 1E3LA 5CP8A 3ZI0A 4YJHA 1NASA 1J6UA 2EWMA 2OXIA 3S2IA 1D8AA 1XQ6A 5A1TA 3SVTA 2RHRA 2R00A 4EUEA 1LTHR 3LDHA 1UXJA 4UREA 1CQIA 2P5UA 2NU7A 5ILGA 1IULA 3WICA 1JAXA 1V3TA 3T7CA 3RUIA 3UGKA 2PWZA 4O59O 3QWBA 2W2KB 1H9BA 4J1QA 1XA0A 5B1YA 2ZYDA 2DBRA 2O2YA 3FRJA 3ZNNA 4IJWA 2GZ2A 3N58A 3EZLA 3ASUA 1KVQA 4KTTE 3WIDA 4BO2A 4II3A 2ZIZA 3A4VA 2CDCA 2WJPA 4IPTA 4FIZA 1L7EA 2IDZA 4BO6A 3JYQA 3LLSA 2NV6A 3BHMA 4WLEA 3WWYA 1TXGA 4XRRA 4L0QA 3M1AA 3ZW8A 4BKPA 3C3XA 1R66A 1AE1A 2PH3A 1C3VA 4KUEA 1DEHA 3FWNA 4RPJA 1X14A 4ZQFA 1IE3A 4WLFA 3FNGA 5GMOA 1ML3A 2V6BA 3G0OA 2ZCVA 4ND4A 1ULSA 2UVDA 3RU7A 1DBVO 2YFHA 5B4UA 3INGA 1M75A 2QZ9A 2WYUA 4LW8A 3ROPA 3PPIA 4L75A 2G82A 1TI7A 2Q50A 4RQUA 4MP3A 3PGJA 5FYDA 2PZMA 4IBOA 3D1LA 1EDOA 2Y0EA 4QO8A 1P3DA 3KOUA 4UUNA 1PGNA 5ER6A 1I5RA 1IB6A 1N92A 5K9ZA 2CVZA 4RO0A 4CMIB 4ZRNA 2JCXA 2AEMA 3LVFO 4L4XA 3NT5A 4PLTA 1A7KA 3W4IA 4DVJA 4W9NA 2I76A 4PLFA 3BMCB 3K5PA 2G1UA 4I9HA 4RLSA 1UJMA 4GX1A 2JAHA 5B4TA 4WLOA 5CG1A 3AOEA 3SLKA 4ZN6A 1SZJG 2PD3A 1R12A 3PYLA 1IUKA 4E33A 3GEGA 5KCZA 3GZNA 1ORRA 1GUZA 2P4HX 1HE5A 2VYVD 1Q1NA 1BVUA 3LT1A 3RI3A 1YXMA 4YWJA 4BB6A 4OOEA 3GNTA 4EUHA 2WD7B 1P1HA 1IL0A 4R3WA 1JW9B 2HCTA 3C7DB 3WTCA 1I3NA 2DBVO 4E5PA 1A5ZA 3HSKA 3WGOA 3EK2A 1U3WA 4YEDA 4Z0HO 5JY1A 4J1NA 5THQA 4Y6PA 1ZUD1 2H1SA 4HWKA 4GAEA 1V3UA 1SEVA 4MVJM 1HSZA 5L3ZA 3QP9A 4NK4A 4E13A 5CDUA 3ITDA 3KLPX 2VQ3A 3Q2IA 1MLDA 2CFCA 4HXYA 1K0UA 4IGEA 1YGYA 4RVGA 5CDGA 2OBYA 3UVEA 2O7QA 4TRNA 4O0LA 2NU9A 4BNKA 4UUOA 1GADO 2BFOA 2I9PA 1U4SA 5A05A 4NFYA 4GSKA 1TT5B 2YV2A 2B5VA 3S8MA 4QUKA 2VOEA 4CM4B 1B3RA 3PIDA 4DQUA 3S2FA 3V2HA 1JWAB 3I9NA 5ITVA 1ZZEA 3JYLA 1ADBA 4OO3A 1RWBA 3AOEC 3EC7A 3RBZA 1QYWA 1DIAA 5I9NA 5ICSA 1LI4A 2GNAA 3IQDB 3OJOA 5CPBA 5FFFA 3NDRA 2E48A 1W6UA 1C0KA 4P4GA 3NGLA 3HB4X 4HX5A 3VH4A 5CEJA 1V0JA 4U6SA 4ZQBA 4B3HA 5T67A 4BQRA 2V6FA 3PYXA 2GN9A 4EYEA 3GFBA 4RLHA 3MTJA 5TF4A 4D3SA 3RFVA 4KWHA 1Z7BA 4OHUA 4RV9A 2TMGA 1J4AA 3P19A 2Y1CA 3ADPA 4NJOA 2Y99A 3G17A 4KUGA 3BMOB 1LLCA 3KSDO 3DZKA 5F5NA 3A06A 1T26A 4J43A 4E6PA 5COQA 3DZGA 1D4FA 3IMFA 4IJUA 3W6UA 1PTJA 1QR6A 2EHDA 1KC1A 4FC6A 3FCOA 4EITA 3JSAA 1ZNQO 1PZEA 3CEAA 1Q7BA 3AY7A 3LSYA 2EKLA 2X9GA 3H65A 5TLSA 5HM8A 2UUPA 2BGLA 3SX2A 1SCUA 4ALLA 3JD2A 4DQXA 3B6ZA 4CM4A 1NVMB 4ALJA 4LVCA 4TRJA 3NKLA 3NT2A 4CM8B 2CVQA 3UXYA 3ZNPA 4FJ2A 4XEHA 3ST7A 4CR7A 3GEMA 4EUFA 2WYWA 4Q3EA 2CDBA 3N74A 3V1YA 3WGQA 2VYVA 2C59A 4MP8A 3VZRA 2C20A 1GYQA 1K6XA 2Q2WA 1OI7A 3EY4A 3UCEA 5BNIA 1H2BA 1F8GA 2X0RA 4ZVVA 3SXPA 4Q9NA 2NVWA 4W4TA 3JYNA 1E3JA 2PNFA 1H6BA 4PG6A 1I36A 1MG0A 1JVBA 1H0KA 2X0NA 2Q99A 2LDBA 3TNLA 3IP1A 3W8FA 1T25A 1T4BA 1ZVMA 1NP3A 2FPIA 4Q3AA 4NPCA 4OSPA 4DLLA 4CL8A 3JQ9C 1ADFA 4OAQA 1U1IA 2FZEA 4FOOA 1C1DA 4JBIA 1AHIA 3B70A 1WMBA 1AGNA 2ILTA 3I9LA 3KLMX 1GUFA 1VJ0A 1ZFNA 3TZCA 5JYDA 2CNBA 1PJSA 3I83A 3NYWA 2IE0A 4FBGA 5KJEA 2PD6A 3JQGB 4PIVA 2SCUA 3F3SA 1TT5A 1P74A 3K96A 3D5QA 2NNLD 4FC7A 1Z7EA 1PSDA 5F1KA 1M6HA 3Q6IA 1IOLA 1DJNA 1LSJA 1PS8A 4W7HA 5DBFA 4BO9A 3D4NA 5IG2A 3AI1A 3HN7A 2Y1OA 4AJLA 1YBMA 5ENDA 4RF3A 2HQ1A 1B14A 1LA2A 2HMUA 1B16A 3KYDB 4AJOA 4BNJA 2VHWA 2JL1A 1DXYA 1GU7A 1BDBA 4FGWA 1E3WB 1YDEA 4PGFA 3SEFA 3ZWPA 1N7HA 4L73A 4H16A 5EJ2A 2DVMA 1BMDA 3I6IA 4CM6A 2XPCA 2AXQA 3IKVA 3NRCA 1Q0LA 3QWIA 3L07A 1SPXA 3G3EA 4IJVA 2HMTA 2O3RA 4XWYA 3WSWA 1Z75A 3OM9A 2PGDA 3CE6A 3RUEA 1AUPA 4ND5A 2E37A 3TQHA 3B20A 1VKOA 4IJKA 4XQCA 2DBZA 2Y1GA 4HP8A 4XYLA 1H9AA 4U5QA 1PZFA 1YO6A 3WQSB 1H6AA 4Z3KA 1HDOA 3R6DA 3GMSA 3BMQA 1ZO8A 4CR6A 3NDJA 4J4HA 1YBVA 1YB1A 4ROSA 4XB2A 4AJJA 4CQLA 4CV3A 2GN4A 4YDRA 2IXAA 1JKIA 3BA1A 3BHIA 3PJDA 4NFHA 3ZWCA 4WASA 5JCJA 2X7HA 3PGXA 4GQAA 5EINA 4D3FA 3KEQA 3EAGA 1K6JA 2OFPA 4NMHA 3EZYA 4P22A 3CMCO 3HWRA 4GX0A 4DBVO 1YVEI 2QX7A 1HYGA 1WW8A 1H5QA 2V7PA 3QA9A 5C37A 3KSZO 3DZIA 5GZ3A 1RYDA 3H3FA 1XELA 2C07A 1UP7A 2UYYA 4NIMA 5F5LA 2Y66A 5HBRA 2Z1NA 4WLVA 4URFA 1T4DA 1NXQA 2YJZA 1FF9A 2GUGA 3V1TC 4BNTA 2O23A 3FPCA 1X1TA 4U6QA 4BQPA 2D8AA 4MVJE 1DRUA 2F00A 2NM0A 4UEKA 5DBIA 1XIVA 2BLLA 5G4KB 5TJ9A 4D44A 5IDWA 2VZ8A 3DAGA 2G5CA 1O5IA 1E1LA 1E3IA 4NU5A 4XQGA 3QWHA 4CM8A 4KQWA 3OECA 1PGOA 1LSUA 2PGJA 3JQFC 1A72A 4XQEA 4Q3CA 4CLEA 4YJGB 1U7HA 1QXSA 5JBIA 4ALNA 1LRLA 5IXYA 4GSLA 3FNEA 2PTGA 5L51A 2X9NA 5T5QA 3A14A 1DC6A 5JXWA 2EERA 2J5QA 4CUZA 3U4DA 4A03A 4E31A 3AI3A 1ONOA 4CLOA 1T1SA 3IOYA 3WGTA 4ONEA 4N5NA 4OMUA 4IDCA 2CMDA 4ZU3A 3ZU5A 5IAAA 4DMLA 2X8LA 3O4RA 3WWZA 3K2EA 1QYCA 3LK7A 4GGOA 5GZ1A 3MJSA 2QHXA 3TDKA 2NQ8A 3TPCA 4I5EA 2GF2A 1VE9A 1WPQA 4BL5A 1ZMOA 2GZ3A 1WDKA 2YFQA 3SJ7A 1XU9A 3CTMA 1HKUA 1E6UA 3BMOA 2B37A 4YJGA 1UUFA 3TRIA 3KEOA 3PHJA 1LLDA 2I67A 1JU9A 2JCYA 1BSVA 3DMTA 5IJZA 1GV0A 4GVXA 1KVUA 2EG9A 3H6KA 4NI5A 4IY1A 4K6FA 2QIOA 4FFPA 2GD1O 2I99A 1BXGB 2JFGA 2ZJ0A 3OF2A 1NAHA 1RM3A 2BKAA 3PHGA 4IDAA 5GY7A 2NLOA 3W8EA 2VCYA 1LDGA 4KMSA 5JE8A 4CV1A 1FDVA 1U8XX 1E0DA 4DGSA 1LDBA 4OXNA 3GZ4A 2NADA 3DBRA 3TZQA 3GDOA 3ZDFA 1KVRA 4EGFA 3RFTA 1I01A 4IDDA 5HWSA 3GUCA 1LQTA 4IDFA 1KOLA 3DFUA 3L6OO 2WTBA 3ZU3A 3PK0A 1DHTA 3M2TA 3F5QA 5JO9A 4N5MA 1GTMA 1NQTA 1XQ1A 1LDEA 1C14A 4RPLA 1YJQA 2G76A 5KKCA 4R68A 4CQLB 1WNTA 1DIBA 4JGBA 4DUPA 1E5LA 3KTDA 3NDIA 5I8WA 2I5PO 4E30A 1PJQA 1Q0HA 4RVFA 3M1LA 1A71A 3VOSA 3RAJA 2YHIA 1PS0A 2BI8A 3WGGA 1LUAA 4Y6RA 3COSA 2NU6A 2RCYA 2Q4BA 3NJ8A 2FPGA 4IXTA 2HRZA 2GYYA 3TJRA 2BFMA 3JD1A 1MGOA 4BO5A 4D3DA 1Z6ZA 2Z5LA 4WNIA 2CD9A 4GLLA 4LMRA 2ZKLA 3CKYA 3GNSA 1S7CA 4W82A 3GVPA 1U2GA 2VN8A 1NBOA 4R1UA 1T2AA 4Y9DA 1H93A 1ZW1A 4R01A 2IEDA 1VJTA 4EDFA 1WXDA 2WD8A 4J7CA 4BNGA 1JAYA 2O3SA 2QRKA 1OZAA 4FD3A 1EFLA 3DTYA 2EKQA 2VNSA 1M2WA 5A5FA 1NQ5A 1JA9A 1ULUA 2G0TA 3UHAA 1KIFA 2B69A 3AY6A 3ZWWA 1PL6A 4IINA 2DUWA 1Y8QB 4TSKA 4QTZA 2RHCA 2IRWA 4CM1A 4JBHA 4DTIA 4LN1A 3BMNA 2EP7A 3PHIA 4N18A 3RKRA 1MFPA 2EF1A 1Z74A 1P1IA 3KSUA 3SC4A 1U7TA 1MUUA 3JQ6A 1B26A 1BRMA 5KJCA 4BNVA 3JD3A 4I1IA 4I9UA 4MPDA 4YQYA 3RKUA 5EQFA 4R69A 4B8ZA 3CH6A 4FN4A 1OOEA 2PY6A 2E49A 3MWDB 4HKTA 3QWFA 4YRAA 5ILOA 3F9IA 1PR3A 3BIOA 2IEBA 4BV9A 2YV3A 1M76A 3DB2A 4E2YA 1H94A 4WCFC 4GBJA 5IZCC 1CEQA 2Q1WA 1PU2A 2VHXA 5TC4A 3ZU2A 2EEZA 4Q3DA 2WSBA 3ONEA 2GN8A 3AU9A 2B35A 1IZ9A 1PJTA 3LC2O 4RDIA 2PD4A 1MFZA 4IS3A 2O3QA 3VH1A 1HYHA 1RJWA 3I6QA 4BS9A 1X0VA 4NNJA 5T8KC 4L9RA 4OOFA 3X2FA 1O89A 1U2DA 4D46A 4OKIA 1H2HA 1PZGA 1MP0A 3IAHA 1WZEA 1HLDA 2W8ZA 1B8PA 3HN2A 4CMGA 5KOIA 3W6ZA 4QXMA 3IC5A 1JKFA 1BXGA 5DOVA 2OHXA 1G1AA 2LDXA 3WMXA 3OIGA 2NUAA 4ILKA 4PLHA 1HWYA 3D3EA 3ZV3A 4BGVA 4W6ZA 2AG8A 1OFGA 1UXIA 3PFWO 2B36A 2OUIA 4XR4A 1YB4A 1BW9B 1JLLA 4U0KA 1IPEA 1BHSA 3NT4A 4J90A 4AFNA 4H3VA 1NVTA 5A3VA 1CIVA 4GKBA 3C1OA 3IP3A 4E12A 1QYVA 3E6AA 3P2YA 3K31A 4GVLA 2GZ1A 3E1KA 1NWCA 3DDNA 4TVOA 3ROMA 1EMDA 3T4XA 4YTEA 4E2ZA 2D1YA 3KETA 1DJQA 3ZNQA 2NVUA 3GG9A 1VSVA 2FP4A 4IXWA 5G0WA 1HDRA 3WGIA 3D4PA 4EEXA 4HFMA 1XYGA 4UEOA 4NJMB 3QIVA 3DHYA 2Z95A 4E32A 2RH4A 4B3JA 1VC2A 1QG6A 3G79A 4CODB 3NX4A 3VC7A 2B4RO 2HMWA 4WJZA 1EQ2A 3O8QB 4WKGA 3I4FA 5B12A 2PZLA 4S1VA 5BNTA 3HDQA 4E2WA 5KTKA 1HLPA 1RKXA 2YHUA 3UFXA 1ISIA 5I7VA 3ZCXA 4MVJI 1UXKA 3QY9A 1WDMA 3GF4A 3GGPA 1HDXA 1F14A 5KJFA 1EUCA 3E5RA 3ABIA 5JFOA 4GX2A 5TSDA 1ZEJA 1EZ4A 2Q3EA 1M66A 2ZCUA 3I9MA 3U3XA 5C7IO 2NTJA 2OORA 3RC2A 1P0FA 5IN4A 3QSGA 1R6DA 2BD0A 1J49A 1ZJZA 2B4TO 1GCOA 1C1XA 1ISJA 1I3LA 3DHEA 3STHA 3QRWA 1XG5A 1IHXA 1HZJA 3CUKA 3ROKA 4J9VA 2CZCA 2FMUA 1EE2A 4CL3A 2O4CA 1P1RA 4QT0A 5AXBA 1GY8A 3H7AA 1DLJA 1ID1A 3IJPA 3CPSA 1D3AA 4XCVA 1GFSA 2D4AA 1NYTA 4WNCA 4XGNA 4Q3BA 4BNNA 1EUDA 2FZWA 2BGMA 3PLNA 1F17A 3JTMA 1EVIA 1P9LA 3C24A 1K6IA 4CMJA 2Q4EA 3F5SA 3OHSX 1I32A 1JTVA 4M86A 4J16A 4QSMA 5CEFA 1I2CA 4GWGA 1R0LA 3PWSA 1EEHA 1M6WA 1XSEA 3ZN2A 1Z73A 4Y98A 4E21A 2RBEA 4MVJD 5TX7A 4XR9A 1F12A 5ICMA 2VZ0A 1EUZA 4L74A 3LC7O 1GV1A 1JQBA 3D64A 4HNHA 2NSDA 3FR8A 4OSOA 4P4LA 2A92A 3VPHA 3BZUA 1U28A 4CLRA 3ANNA 5CDYA 4WEQA 1DC3A 2A9FA 1QRRA 2VRBA 2FHSA 3GRKA 4IQ8A 4WECA 3PI7A 4I5DA 1NTOA 3E9NA 4CMKA 4DLAA 4YAGA 5TT0A 1PJ4A 5F21A 4I5GA 2YZ7A 3GUYA 3QW2A 4B4UA 1KERA 1PJLA 4BGEA 3GLQA 4HFJA 3HFGA 3Q9NA 2UUOA 3H5RA 2JHGA 3WLEA 4XGKA 2BRUA 4YRDA 4ZGWA 1F0YA 2X1HA 2X86A 3AFNA 3N7UA 2I65A 4MKZA 4RGBA 5B4VA 2NVBA 2X22A 2FR1A 3LT2A 1BXKA 2E4AA 2IZ1A 3DONA 3JQBA 4YBZA 3RROA 5JAIA 4HBGA 3VPFA 4E5MA 1B2LA 2AA3A 4PVDA 3KV3O 3ZU4A 1D1TA 3PFFA 1M67A 3QVSA 4EW6A 3DOOA 3UCXA 3FNHA 5EESA 3ZWAA 4J91A 1EBFA 3DXFA 2FN7A 5K6AC 4OQYA 3ZNOA 1PJ2A 4YT2A 3DMTC 4BHTA 3TN7A 2C5AA 1D7OA 1H6CA 2AEJA 4GL4A 1R0KA 3OA2A 1G0OA 4F3YA 3FN4A 4CMHA 3DFZA 1NR7A 1WVGA 3CMMA 3AJRA 1ZMTA 1I30A 2BELA 1A27A 2EP5A 3WXBA 2CUKA 3ETEA 1NR1A 4JIGA 2EJWA 4BMVA 3R3JA 3KUXA 3H9JA 3GG2A 4BKQA 4HNGA 1KEUA 3TOXA 2BFAA 2V6MA 3A28A 3W4KA 4FJ1A 2AQIA 1IZ0A 3RUCA 1I10A 2QZZA 2VWGA 2DT5A 4BO3A 1X13A 3P5SA 1P1KA 4XIJA 5L7WA 3BMNB 3DAPA 2CDAA 5EPOA 4YR9A 2VZ9A 1ZK0A 2Q2VA 3C8MA 3H9EO 4R51A 1Y9EA 1RM0A 1SBYA 2I6TA 4MJLA 4BNUA 2FY8A 3JQAA 5JMWA 1OBFO 3U49A 1ZEMA 2JD2A 1LRJA 3GPDG 3NTOA 4YJFA 1JVSA 4JN6B 2UDPA 1Y5MA 4LRTB 4Z0PA 1U3UA 1SAYA 4JQCA 1T2EA 1Y9AA 4K9DA 5JYEA 4ALIA 3FI9A 5L40A 3U4IA 4EEZA 4UULA 4BNHA 1HE2A 4ALMA 1RM4A 1AXGA 4PCVA 1ISFA 2HU2A 1E3SA 3DL2A 2HK9A 4PFJA 5K0ZA 2Y1DA 3RUHA 2VRCD 3INTA 4BB5A 5DF1A 5DULA 4BMNA 1LXCA 1ENYA 1X1EA 4YAIA 3ZWNA 3F4BA 3L4BA 4UVHA 4CR8A 3CZMA 2FRDA 3F1LA 4B79A 2ZYGA 5AQ1A 4O6VA 1YB5A 3OJEA 4Y8VA 1EVJA 3OMLA 4XQ9A 1R37A 1R4NB 6ADHA 1Y8QA 3OFSA 4BNMA 3H5AA 4XYGA 4BGUA 3O38A 2D59A 2PH5A 4P4NA 4DREA 1CYDA 2AW5A 4A0SA 2XXJA 3ZV6A 4K28A 4CMCA 1VKNA 2Y1EA 1C0PA 3KHUA 2PV7A 1KY5A 3CINA 4E5KA 3CXRA 2GLXA 1BVRA 5A03A 2DUUA 5BSFA 3V2UA 1LEHA 3TWOA 1OC2A 1N9GA 4F45A 4UVGA 1FMCA 1MB4A 4AJEA 1LSOA 3PZRA 1A7AA 2ZTUA 3AM4A 3QVWA 1NM5A 1XDWA 4XX0A 5U4QA 1PGJA 3R1IA 3DR3A 4G81A 1IPFA 1W73A 3H8VA 2Y0DA 2DBQA 2OZPA 3A9WA 5JS6A 3WFIA 4ZHSA 5CDSA 1PQWA 3L0DA 4PLPA 4XB1A 3K73O 5FF9A 1R0SA 4LCEA 3MJ4A 3TZHA 3INRA 4BO0A 4PLWA 3IKTA 3QLJA 3K30A 1GZ3A 4R4JA 4R9RA 2B0JA 4M8SA 5L53A 3O03A 3FR7A 3LT0A 4FW8A 2DAPA 4J0FA 2R00C 3DZHA 1I24A 1BW9A 1WWKA 3V5NA 3RUDA 3RUFA 4FB5A 3EVTA 4U8GA 1Y6JA 3PQEA 1DRWA 2W90A 3BHJA 4XKJA 4QFDA 3ZV5A 2GPTA 4ZA2A 2VNAA 1GDHA 4DIOA 2P4QA 4AJIA 5JDIA 5A04A 3FWZA 5T8KA 4HFNA 2ZYAA 2DFVA 1YOVB 2VHYA 4RJTA 4YT8A 2IYPA 4LMPA 4C7JA 4KZPA 4J3FA 2AG5A 4XGIA 4OIMA 4O63O 3JQ7A 3ICCA 4ALKA 4FFLA 4XDYA 3LT4A 4YT4A 3CSDA 3U4CA 2X9VA 3U62A 2JFFA 2VTDA 2FR0A 1DFIA 2NWQA 5C3MA 5IZCA 1ZK2A 1CJCA 4J0EA 3IDSA 1NPYA 2BMAA 2DC1A 3GEDA 1T2DA 1U9JA 4WLUA 4RVHA 1YH3A 5AXAA 3AWDA 4BV8A 4E5NA 3EGOA 3C1TA 3GN1A 5JDCA 5JY6A 5BSHA 2GO1A 4MP6A 1FDSA 2I3GA 2YW9A 2NQTA 2J3JA 3CIFA 4J1TA 4MVJH 4MVJF 4WEOA 1ZH8A 2NACA 4CLOB 3AUAA 1LLQA 3PHLA 5DN9A 4PG7A 4CLHA 3NGXA 3VKVA 1XKQA 3HJAA 4F6LA 3GDGA 5AVOA 4BNXA 3AFMA 2CSUA 4PRLA 3JCZA 1UH5A 5DP2A 4D42A 3OQ6A 1P45A 4BIIA 4B3IA 1YOVA 3WS7A 2ZB4A 2PKQO 3MWEB 3RD5A 2P91A 4KDEA 5G0SA 2DLDA 1BG6A 5A06A 1G0NA 2VWHA 4A73A 4M89A 2JHFA 1PS9A 3I52A 1O9BA 4R5HA 4BUCA 2FSSA 2J5RA 4XYEA 1KY4A 1SOWA 1HF3A 1ONPA 1X0XA 4PLVA 3QVXA 3E8XA 3OIFA 4XJTA 3VAZA 3PDUA 3QVTA 4E0BA 1DO8A 1T1RA 2XAAA 1EBUA 2O50A 3RCBA 2DQ4A 1XCBA 3F1KA 1Y81A 4XYMA 4YQZA 4J6FA 4XA8A 3RQSA 3GGGA 1E7RA 4OJNA 3HDJA 5A5EA 2H6EA 1ZIDA 3WGHA 3U4HA 4Y6SA 3PTZA 2QRLA 3HDHA 4BOYA 1B8VA 1I2ZA 4IUYA 3WTBA 3DAFA 4HADA 4FQ8A 5DDIP 2EJVA 1ISGA 3V8BA 1E7YA 2FPPA 3VPGA 3ZHZA 4JJIA 4YAKA 1MG5A 2Y68A 4Z0TA 1DIRA 2HK7A 1XU7A 1PQPA 1GZ4A 4RF5A 5EL0A 3GVCA 2HRBA 1YQXA 3QQPA 1UXHA 1PJ3A 2FR8A 4U7WA 4AJ1A 3S1LA 5G4LA 3VZSA 1GZ6A 2OP1A 4YJDA 3U9LA 2NTNA 3GAZA 5T57A 1LU9A 1W0CA 1NQAO 1T2CA 4J4BA 3ENKA 2C82A 4UVEA 1X7DA 1J0XO 3MOIA 4IZIA 2YUTA 1YBAA 1K2WA 2Q1UA 3S2GA 2J8ZA 1Y1PA 3VZQA 1YQGA 2GSDA 2D3TA 3JQGA 3ENNA 3QE3A 2F1KA 3ZWYA 2DM6A 4TQGA 1TA4A 2AEFA 4R1TA 4AJNA 3OJLA 2B4QA 2Y0CA 1C1XB 3G49A 4UVDA 3PEFA 3FBGA 4RORA 5JSFA 2QYTA 3PIIA 4RDHA 1UXGA 1GQQA 3KM0A 3ASVA 3OJ0A 1YRLA 4IZHA 4KWIA 4FFOA 2VYND 5K6AA 3ZWMA 1HL3A 1WMAA 4J7XA 3GNQA 4CPDA 3O26A 1O94A 3ZWBA 5CAEA 1SO8A 2HUNA 3TFQA 1U3VA 5HA5A 5G2OA 3VVBA 1HT0A 3E18A 5IDXA 4A5OA 5JCXA 2DFDA 4M54A 5A9SA 1YQDA 5MGBA 3JQBC 4LVUA 3U5TA 1LNQA 2C0CA 1VL8A 3GMDA 4DIBA 2DPHA 3ZGYA 1YONA 4RVSA 2QRJA 1HDYA 5DCUA 2ZB3A 5U1PA 4JJFA 4R16A 1S6YA 3LF1A 3B1KA 1NHGA 3LLVA 4PN3A 1KEVA 2IZZA 1WP4A 4OKNA 2X0JA 3WB9A 5IF3A 1C1DB 5CG2A 3OIDA 1CETA 5C5IA 1E1KA 1EQUA 2D0IA 4FGSA 4C7KA 3ONDA 1ZK3A 1T24A 3PQFA 1ENPA 4JROA 4O1MA 4BKUA 5HRUA 3LU1A 4BO4A 3NV9A 3PJEA 5LC1A 2PZKA 4OQZA 1QSGA 1LBEA 3KB6A 1SNYA 3HZZA 5IFLA 1L7DA 4M87A 4D0SA 5ENVA 3L9XA 3FD8A 2Y05A 4DC0A 3OP4A 1GR0A 2RAFA 4Q3NA 2WE7A 3H9GA 2I66A 4L8VA 3DBVO 4H7PA 4BNYA 1DHRA 1ZKMA 3UW3A 2IYOA 4IQ0A 4JP2A 3SLGA 3ANMA 4QECA 1R4MB 4IMRA 1ZBQA 1O0SA 1R4MA 1MXHA 2X6TA 1ADCA 3BTVA 4J2HA 2VOJA 4Y67A 4H15A 1EK5A 1ENZA 3KZVA 5EQDA 2P9CA 2J3HA 3MZ0A 3RU9A 3PQDA 3WQRA 4QQRA 4IGFA 2AQKA 3DZJA 3E03A 5BNFA 4EZBA 3NJ4A 5C7OO 3IL2A 1NVGA 5IXSA 2E6UX 3JYPA 4PVCA 4D79A 3FTNA 3OICA 5DOZA 1EVYA 2V65A 1WAMA 4N54A 2PKRA 4N7RA 4NBUA 3DMYA 2EKPA 2PLAA 2YDYA 3T7EA 4YACA 2UAGA 4EJ6A 4IDBA 4OH1A 1PX0A 2PK3A 5G4KA 1DDOA 4IS2A 4OGWA 2O3UA 4BNZA 5I7FA 5GZ6A 2HDHA 4JK3A 4RPGA 3V1UA 3GVXA 1DOHA 1QLJA 3LF2A 3QWAA 1ISHA 3AI2A 4ID9A 4AJPA 5KJ1A 3F46A 3ETDA 4MIYA 3HE3A 4YA6A 1VJ1A 3JD0A 4TKMA 4CV2A 2WM3A 5L4LA 3C1AA 2VTEA 5BR7A 5L9AA 1QORA 3E9QA 4TROA 1CF2O 1V3VA 2NTVA 4BGIA 4AJHA 3H9QA 1ONNA 1SOVA 3ZZNA 3UF0A 3KYCB 2WDZA 5A9SB 3GZNB
chains in the Genus database with same CATH superfamily
5A62A 7AT1A 1C0IA 5FOWA 4LY3A 4OU4A 5JOQA 2VL8A 3OL3A 2QVZX 1X4OA 5EN4A 4ISBA 1MO4A 4PJMA 1X38A 1KH2A 1EVEA 1WD7A 2LH9A 4L5JA 4K1LA 4QWWA 5LDHA 1EFPA 2CQKA 1HSJA 3H92A 1Z82A 1UK7A 4D25A 2JVJA 2ODTX 4ZYXA 2ECKA 3JQ9A 1JJVA 1AOXA 3ITEA 3N76A 1O8CA 4CKEA 2FWMX 1Z0IA 3WNQA 1O77A 3C45A 1REPC 3OOSA 5L6MB 2X8BA 2BZ0A 3PUHA 3GWZA 4C76A 5LD2B 2R79A 4IW3B 3OOYA 4Y1GA 5KTNA 2PBIA 1CDOA 4KU4A 4QJ4A 1MX3A 4MV0A 1V1RB 3EC2A 3ZMUA 2X4HA 1VMDA 2R9VA 1CX9B 3RIRA 1AKQA 1QBKC 5BMVF 3PJFA 1LSSA 1OZHA 3BEOA 1WQ2A 5EG0B 5LA6A 3LSRA 3WJ1A 2ZRFA 1C9NA 1MA0A 1E7MA 1FMVA 1Q0QA 3D6FA 3RABA 1IZ8A 3OSUA 4TV7A 3B2NA 3CZQA 4M1KA 1HTTA 5ERGB 2HVQA 3FKIJ 3JZAA 1VL2A 3R5HA 3UK2A 2JIRA 4EJWA 1ZSVA 5CXXA 1W0KA 1NOIA 3GFGA 2XOXA 3PS9A 4BU1A 3ZZ1A 4HEA6 5IC4A 1KMIY 4JLVA 1N1EA 4PJNA 3QFFA 3BR2A 1MF7A 4TMKA 1DPGA 1M0TA 4PWZA 4BJ5C 2PUHA 1ZPDA 4IRGA 3IRRA 2DY1A 1F2VA 1JQLB 2HHCA 3AR8A 4RHTA 5DGTA 1BOBA 1YB2A 2ECPA 2ZJ6A 5IAGA 1Y3CE 3ZTTA 2IS2A 3DTVA 2IYQA 2Z4SA 4FKMA 2WZDA 2RDMA 2X58A 3L1HA 5REQB 4HG2A 4Z7OB 3BB1A 2AI2A 4NCXA 4DVGA 5INTA 1H9CA 3ZJ4A 3RJ9A 5F6FA 2QUZA 1EWQA 3FSRA 3ZK7A 1FWZA 2B5OA 1BTOA 5KVAA 3W2EA 3NBAA 1F8YA 4CNBA 4MKGA 4NYJQ 4A3BJ 1RMTA 4B4DA 4XIDA 3RRNA 2PO5A 5L45A 3U9GA 3NI2A 3ICQB 1K92A 1Z56C 2DCUA 1O95A 2HQBA 3ROFA 1LQUA 2A0UA 5DCWA 2OZUA 1F06A 1WCV1 2GBGA 1BCSB 4J8PA 3U0BA 2YNMC 4QUIA 1GQYA 3A6FA 3HIFA 2CY0A 3KB2A 3L4BC 3PQ3A 4H60A 3EVZA 3H2GA 1UKEA 4UBNA 2YYAA 2JHCA 1EH6A 5KO2A 4BASA 4JLWA 1W5SA 2QAGA 1OT3A 5FCDA 3DMRA 2VT7A 1OCZH 4HPXB 3RBXA 3PGA1 3CSUA 1AIPA 1C8VB 1CUGA 1DTWA 1K7FB 2AL7A 3JQ8B 4Y2HA 5CFLA 4IHVA 1Q7GA 2GSWA 1GA6A 4X7MA 4DDMA 2ZTHA 4RPHA 2PAAA 4Z4QA 4OL9A 4Y2SA 3CH7A 3KP1A 4W99A 4D82A 3GYHX 4TVBA 3T0GA 3PDHA 1S5PA 3QBDA 4RC9A 4UARA 2R8EA 1TZCA 3UOGA 2I1LA 3WU0A 1VCOA 4NESA 1QWSA 1JMVA 2WG2A 1H2AS 4M49A 2HO4A 3QOEA 2P69A 1W0JA 4BTLA 3WGJA 5BMOA 4HX7A 3RQ4A 1GPUA 2PFBA 1YI1A 3ILHA 3OQIA 3WE7A 3J7AC 2R6HA 3G71I 4P4SA 3N07A 3Q12A 3A01B 3FMGA 1WI9A 1ZUWA 2VPYA 2AQ8A 3GBVA 3N75A 1NKSA 1RYBA 3F9CA 3QUTA 5E3IA 4R3NA 2NUAB 5FJJA 3CGWA 4QKQA 3DTVD 4KLZA 4YMWA 4II2A 4ZC8A 3E35A 4U5XA 1ZI6A 3M4OJ 4KITB 2I1VB 3FPHA 3GR6A 3QVGA 3K4JA 5F1OA 4XRSG 5JMPA 4A15A 3K0KA 1RWWA 5FKMA 1T8TA 1X7ZB 3JRXA 3JXEA 2GVZC 3M7GA 2FSVA 3TZKA 4PX3A 2RIRA 3VVCA 2HR1A 3QY0A 1ZM3A 2OILA 2PA0A 3IVXA 4X65B 1JDUA 2VJMB 1V35A 4WBNF 1RRVA 2GPAA 1SFKA 1N4AA 3S29A 1Z4PX 3AILA 3P2OA 4WZ6A 2YUSA 4V0SA 5L3SA 3HG7A 5EKDA 4A23A 4EJTA 1SPBS 3F0TA 3IXQA 4JC8A 1Y8AA 2JHAA 4YB8A 3Q3GE 1U0BB 5JS8A 5IKMA 4NU6A 1D2AA 3QHAA 1UAAA 4KSCA 4RKWA 3V8EA 4PQEA 2WTMA 3MWKA 4ZMSA 5EVJA 1BE8A 2XUZA 3JY6A 1I2AA 2HSEA 2LE0A 2IVFA 4FYXA 3ZZMA 2B4KA 3L6DA 4X7BA 5DXJA 3TX2A 4FMDB 2AOXA 3D7KA 4I50F 4M3NA 4XLPF 5K3CA 5AJVB 3PEYA 2YX4A 3DEKA 3IVRA 3OD1A 5EIBD 1NBMA 3JVVA 2E6KA 3TTTA 1NUAA 2HR3A 5CCEA 5H6RA 3O4IA 1V45E 4CHGA 4X1EA 1UC5B 3OIVA 4AP9A 4C0KA 3R5XA 1WG8A 5DU2A 4E7PA 1WDLA 2CEAA 3IIEA 4OVKA 2X77A 5EHIA 5LQMA 3LK7A 2CCGA 5EG0A 1T4CA 3A7EA 1MORA 3K0EA 3QX7A 1ETWA 2PXAA 3TQFA 1WV0A 2PQ8A 4KIUA 2QMYA 1P6QA 2Z3VA 3SQMA 4J2OA 4CJXA 2H1WA 3P9PA 1FCJA 1CUUA 1HG0A 1QPBA 3HNPA 3KCCA 4FFNA 3OH8A 5EP1A 3TSOA 3MMYB 2VUUA 2PSDA 4PDKA 3S15J 4PBRA 5HS8A 4E7JA 2QMOA 2CH0A 4IAOA 1FLAA 1V8PA 5L3CA 1IK6A 4MYUA 4BVAA 1NG6A 4JOMA 1Y7IA 1JBEA 2HPAA 2M2IA 2VC0A 3M5DA 1ZOPA 4UC0A 3GRYA 1A4UA 4XJXA 5L7YA 2G9ZA 4V0NA 5IDVA 4XIIA 2QQ9A 4MVXA 4NCHA 4ZWNA 4IFTA 3FZVA 3QIAA 4F2GA 2DGDA 2NVXJ 2AFVA 2HQOA 1IM5A 4MVJG 5ILUA 2WB1N 1XZBA 4KR7A 4ZT7A 2PSSA 1TLHB 5E4FA 4UUTA 2AZMA 4A10A 4F7WA 2ZVQX 4HN2A 1LTQA 2XDQB 3MJFA 3RGWS 3K8YA 3MHPA 4KDFA 4EY8A 1SRQA 4NENB 3A05A 1VL5A 4D81A 2ZMEB 1DXHA 3I9V2 4UBKA 1IRXA 3ZMSA 3HWX1 5IEBA 5E0KB 3VMMA 4Z9AA 1HEIA 2VRNA 1AU7A 2OYRA 5ECYA 4CNQA 2WAYA 4RB0A 3JQCA 4ZCIA 4CZCA 2BTEA 4FDTA 5KVCA 1AV7A 2W37A 3P2KA 2C5EA 4DNQA 3EXFB 2ZJQF 3EXIB 1G6Q1 3GLGB 3QX8A 5HF9A 3GFFA 3PQJA 3A1UA 1OFIA 2LVSA 2PGLA 3RVJA 3PVSA 2H2IA 4YRBA 2A68F 2R5YB 1U5CA 3GAAA 3NUGA 4IH9A 2Q45A 4M0MA 3DPLC 3AHHA 3H1CA 3H3JA 1LBHA 5JARA 4IRHA 4J4TA 2QR5A 1A8QA 2HSDA 3PR1A 4MLPA 3GDHA 1TGYA 4CEIA 2C92A 1TMGE 3BD8A 2AUMA 5JVGF 2V4UA 3BB4A 3G0BA 4LDAA 2DCEA 2AR9A 2IUUA 4CLXA 3L1JA 5CFMA 1C7JA 4L78A 3CCYA 3ULKA 1PV4A 1A76A 1NXTA 1U3CA 2HO5A 4AKTA 2CXUA 2AYYA 1G41A 4EM6A 4B4VA 1XZKA 5CT9A 5BSMA 3ZD9A 2FW8A 2QVCA 2XB2A 1R5GA 1G7CA 1MGTA 2DBYA 3H0GJ 1NA5A 2MOKA 2XNSA 4QXOA 1TCCA 3MAJA 2VUSA 1JAHA 1X7HA 1UOOA 2EKZA 1LUJB 2W6JD 3HS3A 3HXOA 4F3NA 2LY2A 3A0RB 3PC8A 5K0GA 1EESA 2HMAA 2DK8A 1OGYA 2REXB 3PDIA 1KIMA 2I2DA 3GWGA 3ZW9A 3OLXA 1SR8A 3QU6A 3FMOB 3OFKA 3Q3IA 2LKDA 3ZCPA 3MINA 2XAFA 4EJOA 3KCNA 4ADSG 3ZE2B 2K9SA 3DHVA 5A3RA 3DDOA 1QYIA 2ZRMA 1Z08A 2X8AA 2WWYA 3KOZA 1MVNA 4DSOA 2IPQX 5BYKA 3WBBA 2YHIB 1T3TA 2WWVD 3DFIA 3PXGA 3L5OA 1ELOA 1SMKA 2WKPA 4GICA 2P6PA 2SKEA 2FUG1 4ND2A 5FPTA 4B40A 4OX9B 4XGRA 4A26A 3O8NA 3R09A 4WCDA 4XJSA 1UAYA 4JUBA 2B78A 2G67A 5DBOA 5EI5A 5C31A 4PC3A 4CEHB 1OF1A 1IOZA 4UD6A 1QV6A 1GNPA 2DFIA 1P5ZB 3HA7A 5F77A 2JLZA 1XLTA 2Y8EA 1MBFA 1NT2A 5CYFA 5C8VA 3G7SA 3NXKA 4G97A 3H4TA 2VHVA 5JO0A 2XWJI 5NULA 4BO1A 2QJRA 4MUXA 4MDHA 3S6JA 3OIUA 4CUJA 2H57A 2JD1A 2R85A 2EBWA 2RAEA 2FWIA 2G70A 2VDJA 1GYPA 1U9IC 1DCTA 2VLBA 3NPMA 4OMDA 4LYYA 4CU2A 3CEMA 5IN5A 2O8EA 1IM8A 1P6RA 2EOAA 2STWA 3K6KA 5AJWA 3PLRA 3HTXA 1YE3A 2QVYX 4FWTA 3B6MA 3BWXA 4PPFA 4ESOA 2HCRA 1DIGA 4FFRA 5FA8A 5DWVA 1DX4A 1P17A 2NO0A 4CM9D 2OD5A 5FUBA 1N0UA 4UU8A 5KOHB 2PGOA 2ZE7A 2TMKA 1OR8A 4FLFA 5DTMA 2LP0A 3FOBA 3KFXA 3E6BA 1P0CA 1AU9A 3FNQA 4BKOA 1NFRA 3H9UA 4YXFA 7MDHA 2JRMA 2YY7A 3EGCA 4I8IA 5K7SA 1VQKI 3GC6A 5JCPA 1V5FA 1W4ZA 5AYVA 3HZJA 1T10A 3HU5A 2X9LA 2O2XA 3AU8A 3OFJA 2IPXA 1BYIA 5FPHA 3NAUA 3HZOA 2XCUA 3MIIA 4RULA 2ZBVA 2JJ1A 3MZHA 2JQ7A 1G64A 3HB1A 1B4DA 3QTLA 5AXDA 5JAPA 2XNJA 3WWCA 4DWVA 4OY3A 2O0LA 1OFUA 3C3BA 3FWPA 2C3UA 3SHOA 5IYCJ 3AJ9A 4PRKA 4K6HA 1BO6A 4E03A 1K08A 1AF4A 4JVMA 4RMHA 3KSBC 1R1VA 4L2IB 1QFJA 2Z5FA 3BJMA 1Y7LA 4I4TA 1S5LC 2V7WA 2G72A 4Q4JA 1T6NA 4NBTA 2FUKA 3VEPA 1TUBB 2JGNA 3UAOA 1XZGA 1EM8B 4BVGA 4L4RA 2A9KA 5J3JA 3JPWA 4HMOA 3GNLA 3CCBA 4N7MA 3ZHXA 1K66A 1OAAA 2OMEA 3UBMA 3WYGA 4DYDA 3Q1LA 1CU1A 4YR7A 1ETVA 1IFXA 3VDQA 4N0BA 5I9BA 2Y1FA 4OGGA 3U61B 3QHPA 4RH3A 3TL4X 5K7ZA 1JGTA 2SKDA 1O3QA 3RC9A 5EFZA 1LX6A 2WICA 1RQPA 2CW5A 3BSWA 4JJEA 5ECDA 5DCFA 4I1RA 3OESA 5D5QA 1E9RA 4P9NA 1LJ8A 5TS3A 5IOYA 1RXIA 3E5UA 2DY0A 2FRDC 4G0OA 2ZYHA 4H6VA 4MEJA 4BQOA 1EA5A 1ZGWA 1JLKA 1TQDA 4PG4A 1NF2A 3CM0A 4UXJA 2VK1A 1KEEB 2QRQA 2VUTA 3MK31 2IU3A 2AG6A 2Z04A 3H8JA 4I9NA 4L76A 2WJ4A 4YJ2F 3P0EA 5B6PA 3MILA 2VSQA 2R11A 1L5FA 3IB6A 4LXTA 2JVKA 2HZTA 2LV8A 1AUOA 2L3DA 1ZN8A 2R47A 2X76A 1LTKA 2UZKA 1JE8A 3PC2A 2ECCA 3DKIA 1YZFA 2EIKH 2Z99A 3DE1X 3VU9B 1SKUA 1VPTA 3W3AH 2FSGA 2Z1MA 1JX6A 1ZJYA 5GJCA 3WKCA 4AMGA 3IQIX 1MJFA 2JCVA 4X41A 4A2UA 4QLBA 5AM4A 2KT0A 2VQCA 2ZUUA 1D0VA 5HJ2A 3AEQB 2ESRA 3CBQA 3ESQA 2Q4RA 3E5MA 3NCHA 1YA6A 1G5FA 1Q6ZA 1USIA 3VC2A 4WZBB 3SBXA 4R2MA 3TTYA 3CW8X 1LK0A 1UZMA 1WE2A 5TT1A 1IK4A 2PLWA 1JSRA 3M2PA 1EJ0A 1IWBB 4KYIB 5DM0A 5G1PA 4DM7A 4YCNA 1EXDA 4OXKA 1TT0A 4KMUX 1QPIA 1US8B 4FPXA 3MGBA 1VTKA 2JFBA 5J47A 3VR6H 2EV9A 3ZDBA 2VI6A 4LK3A 5DKFA 1QFMA 1Z0SA 2XSZD 3DQZA 1NRJB 1XTRA 5CH3A 4YRFA 2CXTA 3O2JA 4A6XA 3L2CA 4UUPA 3ERCA 3E15A 1VIAA 3DO6A 3L4SO 3FNRA 4IXDA 5HMLA 2ZUVA 3IIJA 1R16A 3FDYA 1CZKA 4XIYA 1F9AA 2QA5A 3JV7A 1XXHB 2D1RA 2DCMA 3GF2A 2RONA 4IH1A 3IS3A 4C4OA 4OHMA 1WCIB 3PBKA 5ARBA 1HH4A 4RPCA 3AH8A 1BX1A 4MFDA 1RHQA 2OZLB 4HV4A 4DLRA 4XSHA 1XZCA 2QENA 4YCBA 1FYKA 5TQ2A 4BN0A 5I9IA 3DBHB 1XSDA 3MKZA 2LNBA 1EX9A 4E7HA 3GA5A 1FNDA 1OLSB 5IANA 1I33A 4D8XA 2LSOA 5F1RA 1OW3B 5CFNA 4HJXA 2ZRLA 1OCCH 2STTA 3CH4B 4UNNA 4K9NA 4DIFA 4L85A 2ZWOA 3AZOA 5KQSA 1CWUA 5AOVA 4Y9RA 3TLJA 3B6JA 4CMEC 1NAIA 2P3QA 3BBLA 1JYSA 3FPLA 3KELA 3NBKA 1G20A 2YJ3A 3O1HB 5JQGF 3LSKA 2A2ZA 1Y89A 4JLBA 5EHXA 4YRCA 1GEEA 5FKLA 3CNLA 4DAEA 5EGOA 2OJED 4EI2A 1ULAA 1HKQA 3DVLA 2X23A 3ZH2A 3SR3A 2YYYA 4INOA 1KBOA 2HWVA 1Q0PA 2BH2A 3E48A 1EFKA 1ST2A 3BTSA 2MCFA 4UCFA 2ZJRF 1BI3A 4K9MA 3AG2H 1E2MA 2G17A 4N5LA 4F12A 1AXEA 1TTTA 2BGCA 1H3NA 3HADA 1QFYA 4C6HA 2EFWA 4I46A 2FDRA 2VJ4A 3LJKA 4Z9XA 3I6ZA 3BDDA 5FWNA 3L0YA 3PNKA 1W4BA 4B7UA 3W5HA 5IBCA 1PWZA 1TLFA 1VQ8I 1YFZA 1XG1A 1KETA 2CMHA 4IWNA 4KVZA 4KH1A 1CJMA 1E8MA 2DA2A 3RJTA 3N2LA 3LL4A 3QV1A 2DQYA 3DZBA 1A2OA 2OKGA 2OGTA 1MZBA 1E4YA 2PJRB 1P73A 2Q4TA 4CM7A 4M60A 2BHLA 1R5JA 5J1RA 2ZI5A 3IA2A 5M34A 1T5HX 1QKKA 2AOVA 5J2TA 4RQAA 1QHEA 4TGLA 5HLTA 3GJ8A 4ZVLA 4F72A 3TOSA 2NVUB 3K92A 3L9WA 4M9CA 4K8OA 2K9QA 1XTUA 5LOVB 1BDHA 1GAEO 2DDAA 2W00A 3DA8A 1Z29A 3ISVA 1Y7HA 1K3TA 1OJLA 3BZBA 1RCUA 1OROA 2UUCB 3BAZA 3LLUA 2Q7DA 3DS8A 4HH0A 3MS7A 4JBNA 3BDVA 3ZI7A 5BSVA 5LNK1 3R9WA 1CUEA 2YZNA 3USZA 5DYTA 1E7QA 4DLBA 3S2GA 2Q1TA 4PK4A 3GLIB 4F52A 3VYTB 1G21E 2C5FA 1NUSA 3A2NA 1GP2A 2CSXA 4KE9A 2F59A 1NX9A 1PGPA 1BRTA 3ILVA 3CH5A 3MD2A 3H2ZA 1W75A 3DUFB 3K4MA 1LW6E 5H5JA 4DPKA 4E4HA 3CNEA 3LVRE 1HDPA 3IJRA 4B4CA 4RLFA 1HORA 2A59A 3LBNA 4U7TB 3COZA 2PWAA 3M1IA 3O9ZA 4QE3A 1NU6A 1S0UA 3H1AA 4AVPA 2H9AA 2OA4A 4G0WA 3KZZA 4LHSA 5TEWA 2EV0A 4IHTA 4Q9AA 3IMEA 1B0ZA 1U0OC 3HYCA 3SU8A 3D6MA 4MI1A 2YVAA 4W1RA 3WX0A 5IASA 1I3AA 2AMVA 3KYBA 3DWEX 4PFKA 1R6TA 1QANA 3UMSA 1CUWA 3JQ7B 3WFJA 1ZGHA 3OYLA 3F6CA 3TTXA 4FDAA 3PFCA 2XQKA 3V9AA 4AJ4A 4UBIA 1TADA 3CUUA 1I6WA 2BFEA 4MYTA 2H27A 1UPTA 3CKMA 4PSXA 1T9AA 3HGMA 2PMFA 3WE3A 1I2DA 3GHHA 1T0FC 1JUSA 1K5HA 1P31A 2GYWA 1ESMA 4KZKA 2HXGA 4GWKA 4XRGA 2J9ZB 4JQFA 2HMVA 1ZNXA 3OMYA 3WTSC 2VEDA 2XV1A 3ORFA 5IZ4A 5E7QA 3DTIA 1TF7A 4KLNA 1IRZA 4IYRA 4XARA 1LE8A 5EJ7A 1FDUA 3IVCA 4A0ZA 2XF2A 3SSNA 4D9EA 4ZYWA 1P4XA 3HUEA 1T1EA 3ZQJA 2DTZA 4EM1A 5KX5A 1T6SA 1NNI1 3EHEA 2XYGA 2AN3A 2QLLA 2LF7A 3IULA 3KVOA 3W2WA 3PNOA 4IDEA 4Y1RB 2HTFA 2H07A 4Q4HA 4IEIA 3WG9A 3NUZA 4J9UE 1A5AB 2O6GE 1L3CA 1ZRMA 2PL5A 4L02A 5LM3A 2JGDA 2DYSH 1JWBB 4FFBA 1XD8A 2ZGVA 1L4UA 5DW3A 2I7CA 2JPBA 4CGZA 5JDCC 2KPMA 3Q11A 1R1TA 3MB5A 2E5WA 2QVOA 4AJ2A 4EUFA 1VHWA 2D5CA 2FQ1A 3OIQA 2EFCB 4FOSA 2E4UA 3GD7A 4J07A 1PJZA 5COAA 2ZRCA 2X2OA 1GKIA 1PK9A 4W9NC 3V4VB 1W47A 1TL8A 4HJRA 2ZQYA 5EWLB 3I6MA 3P9RA 3DXJF 1V1MA 4YRAA 3HRUA 4ZVTA 2VXCA 1ABFA 4PZDA 1KPIA 3QJ5A 1TQ8A 1KJYA 2HYFA 4KWEA 4RYLA 3U7QB 3GT0A 4NK5A 3V1KA 4B35A 5FEMA 1T0HB 4XH9B 4B74A 4AAYA 1BJZA 1P1BA 1P4SA 4F6CA 4OI0A 3ZYCA 2Q49A 4ZVKA 1PZHA 1BH2A 2AOUB 1NBMD 2SICE 4B4OA 4ZO7A 5CPFA 1N34B 1EWKA 4ZI3A 3R60A 4H6PA 1USWA 4QTXA 1SC6A 1KZ6A 1C0EA 3D5TA 1CNEA 4ESFA 4O6JA 1B41A 1HBXG 1N7GA 2BGIA 4IKPA 1BGXT 3NANA 4WZAB 2B6NA 3EAQA 3RWOA 1FSPA 5DIFA 1M33A 2HJSA 3N97A 4W5TA 4J3JA 4HDVA 1UWKA 4TZ6A 4ETWA 3AY0A 4LK2A 2WIFA 1SUWA 4P80A 4HB4A 1K79A 2VCEA 1J2XA 1E64A 2WM2A 4N39A 3HB5X 3ZEAA 1SHJA 2PA3A 1GTRA 1Q22A 1CV2A 2A67A 2YN2A 4LOKA 4FCCA 4PZCA 4QOIA 1S7AA 1RKUA 2KWIA 5CLQA 1KMCA 5JAOA 4CQMB 5JXHA 4X97A 1W8DA 3KYDA 4XKVA 1U8UA 3CQ9A 3GW8A 2J6IA 2ZAOA 3D2BA 3EFOA 2LKCA 4N1AA 4WGGA 4B8WA 3PZBA 4X1YB 2VYNA 4JGGA 4I55A 2CXHA 1DKRA 2O1XA 2X5JO 1ZK4A 1XK6A 3R5FA 2H31A 4KR2A 3DTKA 1CPYA 1PIWA 1W19A 4EJSC 4PO3X 3LY9A 3W5VA 1NHWA 1GPJA 1SBTA 3JQQA 4RGYA 5FPYA 3F7NA 5IXYA 3GB9A 2DKFA 1D1PA 1PJCA 1B72B 4JGIA 3G3ZA 1W34A 1I3KA 1P1FA 3HA5A 5M3FJ 1DINA 3MNFA 3OCZA 3WRYC 3AFIA 1TT7A 5E9JA 4IGIA 5TQJA 4D2IA 1FC3A 1V25A 2XE6A 3IP8A 2W6MA 1EVZA 5D1HA 4O4IB 4EJSA 3BPSA 3ZVKA 1V26A 2JI6A 4FGJA 4IHKA 1UFQA 3B6KA 3C6MA 3H9CA 1UAGA 2IGOA 4C6TA 4YMLA 3OIOA 2YDXA 5BSEA 4CWAA 2WSLA 2RI0A 5HGJA 1BD4A 3KXLA 5A4FS 2ZRKA 1OX5A 5FV7A 1AN9A 4YJFB 5HQ3B 2ZTMA 2A94A 4UNRA 4L6AA 3ULQB 1PR5A 1ZXLA 4B17A 1IY9A 5K3SA 3X43A 4GX5A 2EFJA 1T5DX 2TS1A 2WR8A 5HEKA 4OGFA 3RIMA 1R15A 1ZRNA 3C3KA 4WXYB 4EGYA 4F5YA 1JPJA 3EUWA 4CDGA 1UDCA 1E20A 1XNGA 4D5GA 4HX2A 1P60A 3OYIA 4E6KG 3NC4A 1JKOC 1A8PA 1WBJB 4L5IA 3BTUA 2NO6A 1TP4A 1ZUIA 4M6VA 2C6YA 2PYIA 4N9QA 4M36A 5D6NA 1DUSA 3OBBA 4AQDA 3KJHA 3TOBA 1ZRHA 2WUFA 2X4GA 3HTUA 4PC6A 4AG3A 2LFBA 1LS6A 1E3LA 1POXA 2A0YA 3M3DA 1H89C 3OYBA 4M0EA 4WN9A 1KDRA 4YJHA 3RSLA 3U1BA 4B2IA 3K0FA 1QLWA 4Q1VA 3U44A 2QQ0A 1JHPA 1O96A 3C3WA 4F55A 5CB4B 3FRIA 3PUXA 3TLMA 1GNSA 1KRXA 4GOND 3OPYB 4EUEA 4HUTA 2VTDA 3DJFA 3A1DA 3R5JA 1UFVA 4JJKA 4GMHA 5A5GA 1PSWA 5AVYA 1QQAA 4AIKA 1SVWA 1BMTA 1JG3A 2Y9YA 1RI1A 4G5RA 1G8KA 1XCOA 4KPUB 1OX6A 4ZV7A 3RJMA 3T7CA 2BR4A 1TECE 5FAXA 3NOOA 3UGKA 4CIWA 4WA7A 1YE9A 3HA3A 2OLKA 3CRMA 2EFEB 2ZYDA 4B9AA 2DBRA 3WWPA 1H4TA 3DL0A 5AVSA 5AUPB 1Q3KA 2O1WA 5TB5A 4UFPA 2IS1A 1QX3A 4DV4B 2HU8A 2W2NA 2YCBA 4NZOA 4YRSA 5K20A 1NM5C 3DOHA 2XGJA 3BLYA 4MUYA 2J32A 4IPTA 2GHQA 2XMGA 5KBYA 3C5EA 3D8UA 4LC9A 4OEHA 5HZMA 3LM8A 2FN4A 4PGMA 4FIZA 1Z4NA 2ZSIA 4MV8A 5TARA 4BO6A 2YWRA 1JKPC 3JYQA 2TMYA 1DEKA 2ZSFA 3LLSA 3M6VA 4E7KA 4AW9A 4D9KA 3TLGB 2B61A 3T7IA 3LXMA 3QITA 1DBSA 2MIIA 3R40A 4FDLA 4L0QA 3PHCA 1PV2A 1C3VA 3VSAA 3T4UA 3H8SA 4OOIA 5IU6A 3JAWB 4H0CA 1Q77A 1DEHA 2GF0A 3FMFA 4JJAA 2WBMA 4ND7A 2DMPA 4TTPA 4RGSA 4UOZA 1Q15A 2FN9A 5GMOA 1ML3A 2CFIA 2NT3A 4YCSA 2BE9A 4ND4A 2ZCVA 5ERIA 1Y39A 1ULSA 3HEFA 3KJFA 1BQ4A 2UVDA 4WZZA 5F35A 5HKOA 4DYRA 3RU7A 1XMJA 1WO8A 3INGA 1F1JA 1KZ7B 2QZ9A 2WYUA 1DADA 1O1YA 1MAAA 4G0MA 4M9UA 3ROPA 2HWYA 4HNRA 3KAJA 1H5NA 3ND8A 3AHIA 2KJQA 3PPIA 2CBXA 1TI7A 4UNOA 2Q50A 5BSRA 3V4OA 4BMZA 4O2BA 1B23P 4EPXA 4GEKA 4YRNA 2QBYB 4PRZA 4Q4DA 1T2UA 2Y0BA 3F6EX 5DEQA 3DGEC 2XMPA 3U6KA 1RU3A 4EUKA 3LSHA 4TYPA 3IDQA 1T13A 1MO5A 4MV7A 2P6MA 2XGOA 2HWWA 2GBIA 1OXUA 1SXJB 2W11A 1IEQA 4RO0A 1SKBA 2C77A 5JUWA 2GCOB 3JQRA 2B20A 2JCXA 2B92A 4V0ME 5FLKA 3SG0A 2ZETA 4DILA 2PMHA 5I48A 2XUHA 1K2VN 3NT5A 1JL3A 3ABTA 3FWEA 4DJAA 1L4KA 1L5QA 4LSZA 3C7TA 4DVJA 4NCAA 4A6EA 1R0CA 2WVGA 3GLIE 3HR4A 3VSBA 4CG1A 4QARA 4JVNA 2I76A 4RPIA 1XC7A 4CIVA 1KZHA 2WJZB 3JR3A 3T94A 3K5PA 3HH8A 2C9DA 4M0FA 1G21A 4EAAA 4N0EA 1QIDA 2A5FA 2OBBA 3M3HA 4EL0A 2JAHA 1YR9A 3SZGA 1Z1DA 4ESBA 2WNSA 5CNJA 5DTJA 4ER0A 4F7DA 1G4DA 1L4FA 2Q4DA 3SLKA 4BP1A 2PD3A 1MJHA 2OAGA 1BE6A 3L05A 3MMZA 3OKFA 3ZOKA 3S99A 1S2GA 1AURA 2MDTA 3UFXB 1MX9A 3GEGA 1HOTA 2CB0A 1M2HA 3GZNA 2EV5A 2X15A 1LFAA 4A92A 1KY3A 5BYBA 4KGXA 1HE5A 4UHBA 1NRIA 1XTIA 3AVQA 2ETHA 1G4UR 1OHHA 2VYVD 1BVUA 4O3FA 1U02A 4ZVVA 4OA8A 3SD7A 2BGRA 3URMA 5K7HA 2EJCA 3G1OA 2O52A 3LZCA 2HKOA 4BB6A 5LGNA 2QXUA 3I2YX 4OOEA 4DXAA 5KNDH 1YBHA 1ZICA 1C9YA 1W2HA 2WD7B 2Z3ZA 5BWBA 1Q21A 1ZA2A 2JZCA 3EF0A 1GQFA 1JW9B 1AVTA 3PQ4A 3U7HB 1A69A 4HATA 3D7RA 4MMXB 4MS1A 1KEZA 5A7FA 4EGJA 4JUCA 2CXXA 4D9JA 2B7BA 3EK2A 4YEDA 5BV8A 3BG9A 1DELA 1S2NA 1SHZA 2PZEA 3B1YA 3OY7A 4HAYA 4J1NA 3HV2A 2FBIA 3STVA 2E5NA 1ZUD1 3BFKA 2H18A 1K83J 2B9VA 3AV0B 3M82A 4CHUA 1TYAE 2GN0A 4HWKA 4LDJA 4JT9A 4ZT5A 3TNDA 3WMGA 3NH9A 2G9QA 3VKGA 2WYHA 3WQBA 7REQA 4KQGA 4U7DA 2QKLB 2HVRA 3H1GA 3R5KA 3ITDA 4I1VA 4E08A 2XTZA 1TRHA 3VUEA 4LG0B 1MLDA 2DA4A 2CFCA 2P81A 4XXHA 2VNHA 4I98B 621PA 1Q7EA 4O08A 2FTKE 1CRQA 1T6YA 3FA2A 5CDGA 5AH0A 4FDMA 3MOSA 2MSEB 4H3HB 4N3BA 3QXSA 1WB9A 2ZAIA 3N5CA 1FQOA 3GGJA 4JQZA 1M0SA 3EMDA 1OBHA 4O0LA 1Z6PA 3ROXA 2JLAA 2UZ0A 4MWOA 3RE1A 1GADO 3KK0A 2DMQA 2L4MA 2BFOA 3KYIB 1U4SA 3MAGA 5JU6A 2HDOA 2ZNZA 1QCCA 3QEBZ 1X39A 3L02A 4H7KA 4W9RA 1LFPA 3KP6A 2WA0A 1ONSA 1QFXA 2A0WA 2Z5VA 5IUKC 2C7OA 2EWNA 3S2FA 5H20A 1L5HB 1ZZEA 2RHDA 1FIAA 1ADBA 3JYLA 3ESRA 1GPH1 2AD5A 5ITVA 1N33B 2M4GA 3U6BA 5LN1A 4PZ9A 2PCJA 2GNAA 4V38A 2IUFA 3OJOA 3Q0VA 3HB4X 1P0MA 4HX5A 3OOWA 1ODCA 3C87A 3IT0A 2DT7B 4QA9A 4YRLA 1V0JA 5EXSA 5CEJA 4U6SA 2BT4A 4B3HA 1RRGA 4F4JA 2QBYA 2CMGA 2J41A 3I56I 5C5DA 3TMAA 5C4GB 3ZE1B 5C1BA 1RP7A 4YP7A 5TF4A 5D5XB 1DAMA 2DQLA 1QUEA 4OXIA 2EKBA 3DD5A 2EU8A 4GYIA 3H1FA 2J9RA 2JKZA 3AESB 4QL3A 4RFLA 1AQYA 1TM4E 4TMXA 3UZUA 1FPQA 1NW3A 4QT4A 5FRNA 1E62A 1IN8A 3P19A 4Z6YA 4XDHA 4YP5A 4FOLA 2Y99A 3CIOA 4KUGA 1CZOA 3FUWA 1T26A 3TD6A 4Z2YA 1FOEB 2GEVA 4J43A 3OQNA 3HA2A 3QKUA 2RVCA 4F4CA 4GXOA 1PTJA 2OLJA 4FC6A 4BKMA 1W30A 4KR3A 1IU9A 3PPVA 4V0KA 3FCOA 5IAKA 1E8NA 3ZCVA 5E8RA 1BIAA 1N75A 1ZNQO 3F3KA 1PZEA 3L43A 1UPAA 4IDQA 4A8JB 4KAXA 3H65A 4QNMA 2VDKB 4FQ7A 5D8DA 5AD1A 3PNVA 5CXSA 4KPGA 1BBYA 1FZPB 2O07A 1SCUA 5LOVA 3D0KA 2PQ6A 5BV1A 1NVBA 3PFNA 2QPLA 5BN4B 2J5OA 4CM4A 4RK7A 2ZI3A 2GRJA 1HT1E 3AF0A 4ALJA 1RRCA 3K0AA 3DCNA 3FXLA 3VO8A 5EJ4A 3FCXA 1I7SB 1SG6A 3BG5A 4MUHA 5JD4A 3MLBA 3GEMA 3KOMA 3D7NA 4HXEB 2FJUA 1VHLA 2QIPA 1UEJA 3FKQA 1DTWB 5L3QB 1VHTA 3GLTA 5JTTA 3PVCA 4GZ3A 1YZHA 2C59A 2HIMA 2F5DA 3A3NA 3D5RC 1K6XA 2R7AA 3K20A 1YZGA 2OG2A 1KMHB 1LNZA 4KN7X 5DUIA 1PG0A 1Z8HA 2C2ZA 3CO0S 3MLEA 3NIWA 4FEYA 3MTQA 1VGVA 1QNFA 5FL7D 3VV3A 5C3EJ 3W8NA 2C5GA 2K3PA 3HUTA 4GM4A 2M6KA 4BLTA 1E3JA 2CGPA 1H6BA 2GPJA 2OUMA 3IVGA 2CLCX 5IFKA 4P54A 2LDBA 3PPYA 5BNGA 3RARA 3BP8A 3QE2A 2BMJA 3W8FA 1ZVMA 1XTSA 1XLWA 4IGAA 2ADOA 4LHVA 4CL8A 3FOFC 2G9WA 2IYTA 3KKZA 4DQ0A 2J0UB 3NG1A 2V8BA 4JNCA 2FZEA 3M70A 2XGGA 4M0UA 1TAGA 1FT9A 3L7KA 3EDOA 3Q87B 5K3DA 1SC1A 2ILTA 4C0HA 3KLMX 3LDAA 3QU7A 4O4LB 5B53A 5JYDA 2NS7A 1WHUA 4H7JA 2C8VA 2DRIA 4L6IA 1MOSA 3P2MA 4E1AA 4FBGA 3RAGA 3EDYA 3VPHA 2M1ZA 2SCUA 3F3SA 1P74A 5JZVA 4KHPB 1NVDA 1PSDA 1V16A 3ESYA 2C2KA 3BRWD 5F1KA 2I2AA 4FOTA 1LSJA 1DJNA 1PS8A 1K3UB 3R3XA 5HZKA 2WQ7A 3AI1A 1VBMA 2Y1OA 2D1SA 1XLTC 1HA8A 4PYLA 1M0EA 2R1ZA 1DI0A 2P6TA 1YBMA 1GL7A 4O4LF 10MHA 3FHTA 3TAXA 1C9KA 4RF3A 3ZGKA 2HMUA 1XDBA 1GPLA 2XZLA 1B1BA 2HBRA 2WRZA 1GDTA 3ZVLA 1RAEA 3F5FA 2ODNA 2VSNA 1UKAA 2XE4A 4IIBA 1E3WB 4Z4EA 1I4OA 5DK4A 3ZWPA 3GLXA 4B3XA 3G5TA 2O6HA 4L73A 1JXAA 2D7JA 2DVMA 1BMDA 3HKEA 3NYQA 4BZZA 3LY5A 2XCSB 4HQEA 4IMJB 4EI9A 1ZM7A 4U7HA 3A70A 3L07A 4K81B 1RQ2A 3G3EA 1G8HA 2CG4A 1OXTA 4IJVA 4TTVA 1CGPA 1N5RA 2BKEA 2NZ8A 3BIJA 4TKVA 1Z75A 1YYVA 3U7QA 1G1MA 4YIKA 4L0DA 3ROGA 4JX4A 3QKIA 3RUEA 4YI5A 2PRSA 4ND5A 3WZLA 1JLHA 3M83A 4JEIA 4HPWA 3K1TA 2XB5A 1J25A 1ODFA 4HX8A 4IJKA 4WIAA 2DBZA 2JFQA 1CE8B 5EMLA 3SSMA 3IAM2 2Y1GA 4KK3A 5KUTA 4ZI5A 4OUKX 4AY2A 2VJAA 4RK5A 2DPYA 3VB2A 1GVDA 1PZFA 3IUBA 3LA2A 1VZ3A 1YO6A 2OV1A 2WJGA 4KQHA 4Q6WA 2HOQA 3OMWA 4ZEMA 2W6JA 3PD7A 3A7DA 4G8BA 1BDIA 3HSRA 1Z4OA 4J4HA 4QXRA 4BNCA 1KFEB 3KQYA 3N2NA 1T6ZA 4GG1A 2GN4A 1OYVA 4KSYA 4XB2A 1JKIA 4QU5A 1KWGA 3LUKA 3OVMA 5EZQA 3WDLA 1WTAA 1CLEA 1S2MA 5GTDA 1VQ1A 5HKLA 1JXQA 3CX6A 3R8XA 4W8HA 5EINA 2PXCA 4DW8A 3S1MJ 2VPQA 1FNSA 2OFPA 4XIFA 3K0CA 3EZYA 5L3QA 3U60B 5FFXA 4DBVO 5I7RA 1M9NA 3QA9A 4F97A 4LA4A 1H5QA 3V4FA 1J42A 1S6LA 4OI4A 2EFHB 2ZSBA 3SZ3A 2IOYA 2IA1A 4MYHA 1U2DC 5K8UA 2ZRPA 3KSZO 4OGKA 4KNVA 3H3FA 2JAWA 2IPLA 4TLBA 1T0IA 1YTLA 3VNBA 1XLVA 4PYKA 3JAKB 2JK3A 4URFA 1T4DA 2X4IA 3ZHQA 2YJZA 4PZAA 4A3IJ 4PF1A 3V1TC 3I2GA 3ESXA 3M5CA 3OZBA 2C2HA 4TV9B 3WK5A 3HYIA 2D8AA 2Y30A 3WU1B 1DRUA 1P4GA 1SC4A 5D3KA 5I4CA 1XIVA 5JT1A 2OFXA 3OQOA 3SP1A 3T7TA 3S32A 4BFSA 4TZ0A 1DGWY 1QB8A 4KA4A 3LMMA 1VKZA 2Q2OA 2EDAA 4X00A 5HTKA 4UM9B 3OYDA 3W5IA 2GETA 3BE5A 2X19A 3NQ41 1E3IA 3I0ZA 5CH5A 2Q2NA 1AC5A 4KQWA 1QRYA 2WV1A 3V8KA 1PGOA 2OFWA 3IMGA 3K1JA 3SGLA 5KHAA 3DL7A 4ARZA 2XVCA 4XQEA 4Z7NB 2DT8A 3ENWA 1J0RA 1KDVA 4YJGB 4ARUA 4Z4FA 5ALMA 1AK1A 3W6OA 2GEUA 2J59A 2H5IA 1ZGZA 2ZRJA 1NDUA 2X9NA 3LBFA 3A14A 1YI2I 1DC6A 2LCIA 3PCRB 1YB6A 4OB8A 2PMZA 4CUZA 2K9NA 2CCJA 3CUTA 3BRQA 4DCNA 5FOVA 4BX2A 4E31A 5E1OA 1N32B 1XD7A 5FRMA 3MUFA 2W83A 1U2SA 2NUTB 4ONEA 4OMUA 3TTSA 2HJGA 2CMDA 2F90A 4IDCA 2I03A 2NS8A 4DMLA 4DRXA 2X8LA 3COJA 3QUCA 4KN6A