3H5RA

Crystal structure of e. coli mccb + succinimide
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
348
structure length
340
Chain Sequence
MDYILGRYVKIARYGSGGLVGGGGKEQYVENLVLWENIIKTAYCFITPSSYTAALETANIPEKDFSNCFRFLKENFFIIPGEYNNSTENNRYSRNFLHYQSYGANPVLVQDKLKNAKVVILGCGGIGNHVSVILATSGIGEIILIDNDQIENTNLTRQVLFSEDDVGKNKTEVIKRELLKRNSEISVSEIALNINDYTDLHKVPEADIWVVSADHPFNLINWVNKYCVRANQPYINAGYVNDIAVFGPLYVPGKTGCYECQKVKENIDHKIKLINSRFKPATFAPVNNVAAALCAADVIKFIGKYSEPLSLNKRIGIWSDEIKIHSQNMGRSPVCSVCGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title How the MccB bacterial ancestor of ubiquitin E1 initiates biosynthesis of the microcin C7 antibiotic.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/antibiotic
molecule keywords MccB protein
total genus 110
structure length 340
sequence length 348
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00899 ThiF ThiF family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1160 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3h5rA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3h5rA02
3MWDB 4WCDA 3R3SA 1V3TA 4DMMA 3TSCA 1R12A 3OH8A 3TZQA 4BO3A 3DHNA 1P1FA 5DT9A 2EV9A 1FDUA 2HK7A 5AVOA 2G17A 4C4OA 5K0ZA 1SB8A 1H9AA 2VQ3A 2ZYGA 4CMJA 2FR0A 3ZH2A 4LCJA 3HB4X 3ZNQA 3MJCA 5L7YA 1WZIA 1PZHA 4NZ9A 1D1TA 4KZPA 4YJGB 2IODA 3AY7A 3UCFA 1U8XX 3I9JA 4GH5A 2X5OA 4Q3EA 1H2HA 3CE6A 3KHUA 2CMDA 1ZUD1 3V2GA 1VSVA 1S6YA 2Q2QA 2AE2A 4U5QA 5T5QA 5A02A 5DCYA 4OH1A 3W6UA 3ZWPA 1LJ8A 4YJDA 3X2FA 4XJSA 1NHWA 4I08A 4C7JA 4XWYA 4JQCA 3KLPX 2JAPA 3S2FA 4O59O 4CPDA 4YEDA 2I65A 1EK5A 4IMPA 3G1TA 4RL6A 1IL0A 1LSUA 3PHIA 3AY6A 3JQBC 1JN0A 3OJLA 5DDIP 4MVJF 1HDRA 4FJ2A 5IXSA 3CMCO 3PIDA 5TRTA 3E03A 1IUKA 3VDRA 1OBFO 3QVTA 2DBZA 4L8VA 4BKQA 4BNHA 4CUZA 3QVXA 4ALLA 3QWBA 5KKCA 3D7LA 3OQ6A 4CMEC 2NUAA 3NYWA 3H9QA 2BGKA 1ZW1A 3UCEA 4P8RA 1GUFA 1XKQA 1GR0A 2EJVA 3GK3A 5AXDA 4B4VA 1H6CA 4HV4A 1OFGA 4XYLA 1E92A 4MVJG 3KSZO 1DIHA 2YZ7A 4BOYA 3U4IA 5DCUA 2VTEA 1B3RA 1HT0A 5T8KC 4BO6A 4MINA 4BGUA 1ENOA 2X0JA 3PQDA 3LVFO 1DC6A 4Z6KA 2Y1DA 5CDTA 1EDOA 4RF2A 2DM6A 4WEQA 1O5IA 3PP8A 4ND2A 2C5AA 2NLOA 1B26A 1EUCA 4WE3A 4Y9DA 1HYHA 1IHXA 3I1JA 4J0FA 4RCVA 2X6TA 2Y0EA 3L77A 1JVBA 4TVOA 2QRLA 4TMFA 3ZHYA 5JCJD 2Y99A 1LSJA 4Q3BA 1UJMA 4E2XA 2C59A 2CSUA 1E1MA 2ZB3A 4J1QA 1OAAA 4J4BA 4KWIA 3H2ZA 1PZEA 1E7MA 5HBRA 4D44A 1H9BA 1XWFA 4FN4A 4PG4A 3R1IA 3GVIA 3UN1A 1LQUA 4KDFA 1WDKA 3IJRA 4ALKA 3UICA 3WBFA 3PZBA 3UCXA 4CMGA 1FMCA 5ICSA 3WTBA 5A9TA 5HTOA 1YE3A 3H2SA 3Q11A 3H65A 5CPFA 4XGNA 1TT5B 3GDGA 3DAGA 1B8PA 1WZEA 1P1JA 3GVHA 2YJZA 3JQBA 1C14A 2EW8A 1X15A 1UDAA 2V7PA 2QQ5A 2AEJA 2FPGA 3LLSA 1IOLA 4AL4A 5GZ6A 5KJ1A 4R01A 1X0VA 2C2XA 3L9WA 3D4OA 2P9CA 2FPIA 4XR4A 1V3VA 1PS8A 4G5HA 2X5KO 1Z6ZA 4GAEA 4N5NA 4YBZA 3PI7A 2X9NA 4MVJE 1L1FA 4UVGA 5C7IO 4J9VA 1GZ4A 4RVFA 2FSVA 4RZHA 3FBTA 3GGOA 3I83A 2Y1FA 1MV8A 4BKUA 1ADCA 2ZTVA 5K9ZA 4PLYA 3PHHA 1DOHA 3PK0A 3IOYA 3ZNOA 3F5QA 1HRDA 5CPBA 1DBVO 3FRJA 4CMIA 1P1RA 1UAGA 4FBGA 2ZIZA 3ZHXA 3ASUA 4XD2A 3ETDA 2FR1A 1SCUA 1FF9A 1K6IA 1LI4A 5CG2A 4J6FA 4B4WA 4RV9A 3SVTA 3PJEA 4NJMB 5LC1A 1I32A 5KJEA 2D59A 1ENYA 4U6QA 2XF8A 2B5WA 3I9KA 4FW8A 2Q1TA 1QP8A 5T64A 3QA9A 3VZSA 1UP7A 2EEZA 4RPKA 4YDRA 3U0BA 1T26A 1WWKA 3GDFA 5IG2A 4G2NA 5KWEA 1M6WA 2NU6A 4R4JA 4RVHA 2NQTA 5AOVA 4MIOA 3RC7A 4MP6A 2OBNA 3EK2A 5IDXA 3ONDA 3LF2A 5JMWA 1KC3A 1E6UA 3AU8A 1NWCA 4IXWA 2NSDA 2X1HA 2BELA 1P1HA 1DSSG 2BD0A 3PGXA 3V2UA 4DGSA 2HO5A 1PJLA 4CM8A 1SEPA 1PJQA 1IPEA 1WMAA 3GUYA 3DZKA 3WS7A 2Q1WA 3DWFA 3RUHA 4HFMA 5JYEA 5BSFA 1NYTA 4U0JA 3E18A 2HUNA 3RD5A 3K73O 2VNAA 2X0IA 3IAHA 1JA9A 4B3JA 1ISGA 2HDHA 3D64A 1P77A 5JFOA 4L74A 1WW8A 1ZK3A 4KMSA 2B0JA 1K0UA 1SC6A 3JYNA 3NV9A 2Y0DA 2J5KA 3D3WA 3WMXA 4NBUA 4E4YA 8LDHA 1R16A 2VHXA 2JFHA 2VUUA 3AK4A 1HKUA 2PD6A 1CDOA 2BFOA 2I3AA 4CM5A 3DBHA 4AJIA 1Z73A 3HN7A 3O8QA 4K9DA 2PZMA 3F4LA 4ND3A 4RZIA 4AJLA 1U7HA 2YFQA 1I24A 4K6FA 4DQVA 1E6EA 4GBJA 2YQ5A 4NPCA 5A3JA 3HQ4O 1Y7TA 1A7KA 4XQGA 5B37A 2AMFA 2PZLA 1D7OA 2VWQA 2XPCA 1Z82A 1U4OA 1X7GA 2C7VA 4R51A 3GVXA 4CLOB 4FB5A 1O94A 1E3EA 5L9AA 4NG5A 3PDJA 4AFNA 1SOWA 1V8BA 3I6QA 1RM3A 1QV7A 4YAJA 4B4OA 1BWSA 3OMLA 1U9JA 3ZWVA 2HMWA 3UKOA 3DHYA 4GVXA 2OBYA 3FTNA 4J43A 3MOIA 3H5RA 1DRWA 4GX1A 2W8ZA 5JCJA 5IJZA 4ZJUA 1I2CA 1F17A 4GKBA 4FC6A 4XYBA 2ZJ0A 3QY9A 2G0TA 2ILTA 5IAAA 5BSEA 4RO0A 3DBVO 2P2SA 2AEFA 3U4DA 2GZ2A 4AJ2A 3HSKA 4R1SA 3D4NA 3GOHA 2FMUA 2G1UA 1BXGB 2PH3A 4DMLA 4LMRA 5CDYA 2VHYA 4XQ9A 2YY7A 4UAGA 1DC3A 3U3XA 3ZW8A 3RUEA 4M54A 1NHGA 1JWAB 1N7GA 4YT5A 1M2WA 5TNXA 4AJKA 4ND1A 4J16A 3L4BC 1ADGA 3I9NA 1CQJA 3C8MA 2O7SA 4DLBA 3GNSA 2ZQYA 3EUWA 5G0TA 1O0SA 3RU7A 1E7QA 4MVJH 3GEGA 3ST7A 2Z1NA 1MFPA 3BMOA 4XKJA 4D46A 4ZVVA 4FGWA 5LCXA 1TB4A 4W82A 4D43A 1HYGA 4GX2A 5JO9A 3PHLA 4QTZA 4XB1A 3P2YA 2FPPA 3BMCA 5ADHA 3RUDA 4BNIA 1ML3A 4WASA 4BNWA 3MJVA 3F4BA 1NFFA 3G3EA 4CQMD 5GZ3A 1V3UA 3M1AA 3GMDA 2W2KA 2PA3A 3DMYA 5JY6A 1B14A 1XQ1A 1Y6JA 3JSAA 2NWQA 2V6FA 1EZ4A 4YTEA 5ICMA 1KBZA 1EQ2A 4I9HA 3EZYA 1YH3A 2GZ3A 1E7SA 4CODB 5FFFA 1T25A 4IZIA 3P19A 5DN9A 4Q9NA 3U4HA 4J7XA 3OJOA 4MKXA 1XGKA 2YDXA 3ITDA 5A1TA 3SJ7A 2HMSA 4BKPA 4RVSA 4ALMA 3WOHA 4CUKA 1A7AA 3NDRA 4PLPA 4YVFA 3G17A 4GMFA 4CR8A 3HE3A 3DQPA 5A9SB 1UZNA 1F0YA 4ZQGA 1PGPA 3VDQA 5MGBA 1YOVB 4GPD1 2VN8A 3DBRB 4OAQA 1LUAA 3F3SA 4O6VA 3MJTA 5JAIA 1R4NA 3W4IA 4EUEA 3PWKA 1WVGA 5F21A 2DT5A 3F9IA 3KB6A 1I36A 5COQA 2O3JA 3BTSA 4FFLA 3RAJA 1YL7A 3NT2A 1PJ3A 1ZK1A 3RJ5A 3NRCA 4UUNA 2RIRA 2B4TO 2C82A 1LLDA 1N7HA 4L9RA 2WE7A 4BNXA 5AXBA 1VPDA 1VKNA 4B8ZA 3OIGA 2R2GA 3ROMA 3WIDA 3KSDO 3KTDA 4J9UE 3W4JA 3D5TA 4IDEA 3VVCA 4BNVA 2ZQZA 2OMEA 4R54A 2O3QA 1JLLA 1SOVA 1H93A 3NDIA 3ZWAA 1E3LA 1I01A 2JFFA 3OEYA 2BF7A 3ROKA 3C85A 1GU7A 3WGIA 1ZSNA 4Z9FA 1LDBA 1UP4A 3GMSA 4MPDA 3WBBA 1BW9B 3MCVA 5G0VA 3WFIA 4R41A 1D1SA 1Q7GA 1KEUA 4BMVA 3L9XA 1ONPA 1PJ2A 2QZZA 2EHDA 4JGBA 4I5EA 2JJYA 3KXDA 4ALNA 3MJEA 5JC8A 2NM0A 5LDHA 4IJUA 4E2WA 1R4NB 3G0OA 1FDWA 4ONEA 2DFDA 4AJEA 1G6KA 4DBVO 4EUFA 3RFTA 3GPDG 4XZ3A 4LGVA 2YFHA 4Z0HO 2IXAA 3BTVA 5FWNA 3RFXA 2DPHA 4YJGA 1LRJA 2P9EA 4DBZA 1W4ZA 3DONA 1DJNA 4PZDA 3RIHA 4RF5A 3ZDFA 3JQ8B 5T67A 2LDXA 3WICA 4Q3CA 4M49A 1C1DA 3FWNA 2O3UA 5F5LA 3H9JA 4M1QA 3GGGA 1U28A 4EBFA 1NQTA 4FIZA 4QO8A 5L7WA 5LDGA 1KVQA 5DBFA 4FFNA 3TQHA 3UW3A 1VLLA 2GR9A 5BR7A 4NU6A 4YJHB 1EUDA 1YB1A 3T4EA 3AWDA 4XRRA 4PLHA 2CVZA 2I67A 1GQ2A 4DLLA 2DTEA 4HNHA 4DYDA 3ZWCA 4CMHA 3EDMA 1EE2A 5JXWA 3DFZA 3E9NA 2DFVA 2I5PO 3DBLA 4DXHA 1J5PA 4MVJP 1ISIA 3GC6A 3RFVA 3CIFA 5L4LA 3CTMA 4OKIA 3HUDA 4BO4A 1X13A 2X86A 4ZRMA 5ENVA 5ILGA 1RKXA 3ZWOA 4IJVA 3WIEA 4IQ0A 1GDHA 5FI3A 5G2OA 4M86A 3ITKA 3PHGA 1MA0A 1JAXA 2XOXA 1ORRA 3HDHA 1YRLA 3S55A 1XYGA 2OUIA 1C1XA 1LDGA 1ZNQO 2GGSA 3Q3CA 2QW8A 3OICA 3GN1A 3ROQA 2P9GA 3RU9A 3BXXA 1J4AA 4XIYA 1MUUA 4U8GA 5BSHA 1V0JA 1ZK4A 4HP8A 5TT1A 4JJFA 4ZICA 2GRAA 1ZFNA 1N9GB 2HCTA 1H94A 4W99A 5THKA 5IN4A 3FHLA 1KEVA 2GO1A 1GAEO 5TX7A 1UXIA 3RUIA 3VPSA 5GY7A 3ETGA 2Y66A 2PV7A 1S7CA 5FI5A 5B4TA 1HSOA 3RKRA 4OHUA 1P3DA 4PLVA 5GZ1A 1C0KA 3JV7A 1HSZA 2VWGA 2BFPA 1X0XA 1GCUA 3I9MA 4J1SA 1H2BA 3SLKA 2CY0A 5HWSA 3MEQA 1BVUA 2O3RA 3AUTA 4E5MA 4BV9A 4OMUA 3DOOA 5F3RA 1ENPA 1P9LA 2Q45A 4KQWA 2Q3EA 1Z45A 4WLOA 1PS9A 4E2ZA 1T2CA 2D1YA 1PR3A 4FFMA 3PQEA 1NQAO 4XDZA 4Q3NA 4JBGA 1F12A 4XYMA 4JLWA 3QVWA 4QX6A 4CL8A 2VYND 2O3TA 5G4KB 3VC7A 2X9VA 4WJZA 1ZZEA 2W4QA 3HWRA 2VT3A 2POQX 2ZB8A 4B8WA 3LC7O 4IY1A 3HFSA 4IDAA 3TOZA 3WSVA 2GN9A 3WQSB 1E7YA 1GFSA 1X1TA 3STHA 1G0NA 4L0QA 5I9NA 3NUGA 1DAPA 3GDOA 4J3FA 1P0CA 1YO6A 4MVJA 4F6CA 3DZJA 4L73A 3RUFA 4UEKA 1D8AA 4ZQBA 3HDJA 2J3HA 2Y93A 3WXBA 1DPGA 3IQDB 1YOVA 3V5NA 3CH6A 4JROA 4EW6A 2DAPA 3FBGA 4YACA 1I2BA 4G81A 4CLEA 3MTGA 4TRJA 3PJGA 3PLNA 4X54A 1GV0A 1GD1O 1LBEA 1MP0A 3FNGA 5A05A 1QXSA 3ICCA 4CV0A 3KBOA 3F46A 4B7XA 4QSMA 5EL0A 4XB2A 1G1AA 1A9ZA 3GNQA 3OEWA 1QLJA 1JW9B 3FD8A 1BTOA 3L6DA 1DFHA 4TRNA 4LMPA 1XCBA 3RBVA 3VZRA 4CMBA 1I3NA 3E1KA 4FC7A 2X9GA 4E3ZA 5JMPA 1WXDA 2VTDA 4W6ZA 4C7KA 1IZ9A 3JQEA 3FTPA 4YAKA 4E13A 3WGTA 3AI3A 4DTIA 1SBYA 2CF6A 4ZQEA 4PG8A 1CWUA 3GAFA 1ULSA 5F5NA 3VPXA 3LT1A 5CG1A 1CYDA 6ADHA 1MFZA 1WDMA 3DHEA 5BT9A 4A26A 4NK4A 3RSHA 2EKPA 5I9MA 2NU9A 1K89A 1U7TA 3CXRA 1UDCA 5JW6A 3WTCA 2NVWA 4JN6B 1PJSA 3WGZA 3VVBA 4CQLB 4CL3A 5J23A 1PGJA 1CEQA 3TZCA 3O4RA 1VL8A 3PPIA 2BGLA 2DLDA 4NBRA 1QYDA 1HDYA 1UXKA 1QYVA 1GYRA 4WUVA 4QEDA 4CQMB 1QG6A 2DUUA 3TPCA 3ICPA 3K5PA 5CDSA 3U5TA 4CLRB 1PQUA 3VKVA 4OKNA 2QYSA 4QO7A 4EI2A 3RC2A 4E5YA 3ZI0A 2VZ0A 1E1KA 5EPOA 5AXAA 3QWFA 3FN4A 2ZB7A 3PRJA 2AHRA 4RF3A 3P5SA 1BRMA 4ZQFA 3TNLA 4D42A 1SNYA 2RH8A 5JAZA 5C37A 4BNYA 3ANMA 4OOFA 4R69A 1NFRA 3JD1A 4CM6A 2P4HX 4D41A 4PZEA 2GPTA 4QXMA 1R0KA 2C20A 4QQRA 3JQAD 1H0KA 1PSDA 1JTVA 1T1RA 3PZRA 3VPFA 4BO1A 2GERA 1C1XB 3GHYA 4IZHA 1E5LA 1U8FO 4H15A 4AJJA 4O5OA 1PJCA 2OXIA 5CEEA 3KYBA 4HUJA 4PFJA 1VE9A 1Y9AA 3PVZA 5ILOA 3AFMA 3QW2A 4WLNA 3JQ6A 2VZ9A 2QX7A 3JD4A 1RYEA 3EY4A 4XDYA 1LC0A 1KVTA 1LU9A 2X58A 3QVSA 4P4NA 3GQVA 1Q7BA 2C0CA 3DXFA 2VHVA 3I52A 5K6AC 1N92A 3DAPA 5BNFA 1T4DA 4AJHA 4CM9A 2C5EA 2Q4EA 3IKVA 1E0DA 2J6IA 1T1SA 4YAEA 4Y6PA 3LSYA 4UREA 2VT2A 4TROA 3PLRA 1VL0A 1C0PA 1YQDA 1AHHA 2QIOA 4BGIA 1E5QA 3ZU5A 2WD7B 1P74A 2DBQA 4I5GA 1GYQA 4NBTA 2CDBA 2DQ4A 2ZYAA 4GX0A 1LQTA 2WM3A 4PZCA 4E2YA 2O2YA 1YDEA 5U9CA 3WWZA 1SAYA 1HDZA 3WDSA 3AOEC 4HWKA 1DDOA 1HDOA 1FXSA 1R37A 3COSA 5C7OO 3TDKA 3B6ZA 3WYCA 1P33A 1EK6A 4RF4A 4CLOA 4R3NA 4NNJA 4TZKA 2BI8A 5IDWA 1HZZA 2F1KA 1B15A 1EE9A 3KM0A 1X7DA 3ZZNA 3RROA 3SEFA 2A35A 4OYRA 5B1YA 3WJAA 1Z7BA 3RC9A 4RQTA 7MDHA 1JDJA 5L3ZA 2QRKA 3WYBA 2X0NA 1U2DA 1D4FA 3C3XA 2Y1GA 2HK8A 4N5MA 1IE3A 2CDAA 4FOOA 4PCVA 4PRLA 1EDZA 2P91A 5JNLA 2GN8A 3D0OA 4OM8A 3SBOA 1W8DA 1IYZA 4QFCA 4E21A 1IHYA 1Q1NA 1UH5A 4BO5A 2P4QA 1DC5A 1GL3A 2NU8A 1A27A 5K6AA 5KTKA 4DPLA 2HJSA 4LVUA 4MDHA 3ZWNA 1RJWA 3UF0A 2E82A 4CM7A 4PLGA 1P1KA 1E3WB 4F46A 2OOSA 2QYTA 3MJ4A 2B5VA 1PU2A 1TT7A 1LTHR 4JCOA 4MO2A 2IDZA 3ZV4A 4BNFA 1R0SA 2W98A 2JD0A 3F6YA 1HYEA 4TKLA 3EGOA 1ID1A 3QQPA 3JYOA 3KYCA 4F3YA 4RVDA 4O0LA 3PFWO 2BHLA 5C7LO 5A9SA 3DZGA 1O89A 2Q99A 1K5HA 3ZV5A 3DL2A 3T7EA 5A4DA 4MP8A 4CM4A 4KOAA 1OOEA 3W6ZA 1LDMA 4DQXA 3UHAA 4I9UA 2J5RA 1OI7A 3O38A 5C3MA 1NX6A 5F1OA 2PGLA 1U3VA 3AM4A 1PL8A 1N1GA 4J2OA 3N7UA 1VM6A 1QKIA 1PS0A 1HEUA 2PD4A 3KSUA 1VJ0A 2Z5LA 3IP1A 1PZFA 5FYDA 6LDHA 1P44A 3V1YA 3K2EA 3FR8A 1NVTA 2JD1A 3VTZA 3LT0A 1U3TA 1HE3A 2QHXA 1B8UA 2BFAA 3ETEA 4ID9A 2JD2A 4IJKA 4AJ4A 5A9RA 3PDUA 2J8ZA 3OQBA 4GGPA 4Q3DA 1CETA 1XEAA 4CMIB 1YL6A 1Y9EA 4Y8VA 5C5IA 1IY8A 1UDBA 4E30A 4YT8A 4IIUA 4NHEA 2NVUB 3WGYA 3ZWXA 2DBRA 4D3DA 2HK9A 4WOJA 3B70A 1U1IA 2HJRA 3C7AA 3GF4A 1OC4A 2ZB4A 4E33A 3GH3A 4H16A 2YYYA 3OHSX 3QWAA 4DPKA 4JJGA 5F1KA 1NPTO 4XGKA 5AQ1A 1Z74A 4N18A 4W9NA 2OORA 4IGEA 4S3MA 5L4SA 4IXTA 2ZKLA 4UVHA 3KEOA 5CEJA 4NI5A 4CMAA 1KS9A 3VH4A 5DP2A 4HBGA 2BGMA 2PH5A 5JDIC 2ZTUA 4LN1A 1Y8QA 4CLXA 4WLEA 1HE2A 2C07A 2ZTMA 2JHFA 2D0IA 3LK7A 4HFNA 1ZSYA 4W9NC 3TJRA 3GEDA 3W4KA 1DC4A 3GFBA 3W8FA 3ZN2A 4CM3A 2CZCA 5I7EA 2PGJA 3GHHA 2J3KA 4OJNA 4NFYA 2I76A 3E9MA 1JKFA 1T2DA 3LC2O 3WR5A 2E37A 4YYZA 2RCYA 4WNIA 1U2GA 1SO8A 3FR7A 4OL9A 1YQXA 2WEKA 4BGVA 3QVOA 3CZMA 4R3WA 2AE1A 4UEJA 1UZMA 3TZ6A 3IKTA 1ISFA 2O3SA 3FI9A 4PG7A 4ILKA 1VKOA 4E0BA 2G5CA 1K6JA 2H6EA 3EW7A 1HETA 4KQXA 2X4GA 1J6UA 4XRGA 1NVMB 1DIRA 4MP3A 1Y8RB 4BIIA 3TZKA 3TN7A 4Z9YA 4LVCA 1R15A 4PG6A 2X7HA 4IDFA 4E5KA 4K26A 2ZATA 4TZTA 3HDQA 1G0OA 1YBAA 1EVIA 3LF1A 3WGQA 5EESA 1UP6A 2E48A 4ALIA 5A04A 4YXFA 1QSGA 1ZMOA 4WLUA 4GSLA 3W1VA 4J0EA 5U4QA 4R1NA 4IM7A 3D3WB 5IZCA 2PNFA 1KIFA 4E5PA 5ER6A 3QLJA 4WK6A 4NBVA 5JE8A 5H82A 1LNQA 5CDUA 1YWGO 2Z95A 4YQYA 2BI7A 3OJEA 4ND5A 2EKLA 5AXCA 4BV8A 1ULUA 2AQKA 3ZV6A 4A0SA 3PYLA 1B7GO 4RPJA 1K2WA 1YB4A 1A71A 5EMHA 4BNTA 2B35A 2C2YA 3L6OO 4Y6SA 4BB6A 1SPXA 2E6UX 3ZNPA 1T2AA 2A92A 3I23A 4AJ1A 5CP8A 2J3JA 1JU9A 1UXGA 3DEYX 1NQ5A 3BMCB 4MKRA 3QSGA 1XR3A 1XA0A 8ADHA 1N1EA 3IC5A 4NFHA 3GUCA 2EERA 1Q2XA 3B1JA 5L95A 4YPOA 4JX8A 1EUZA 1WNTA 2WMDA 2R6JA 4IGFA 2RAFA 4FDAA 3WNQA 1ONOA 5HM8A 3EVNA 3VZQA 3L4SO 4K1LA 4OGWA 1XG5A 3KLMX 5HRUA 1UAYA 3WX0A 3X2EA 3A28A 1BXZA 2C7GA 3ASVA 1N2SA 3A9WA 3CINA 1ISJA 4FFPA 4BQRA 5TLSA 5ER9A 1LC3A 4OXKA 1PTJA 3AUUA 1AUPA 4NJOA 1NVGA 3DZFA 4N54A 3HN2A 4FJ0A 5KOIA 2CF5A 2IEBA 4BB5A 1GZ3A 4YRAA 1TXGA 1QYXA 1ZIDA 1TEHA 3PTZA 1EVZA 3ANLA 3OIFA 2OHXA 3RVDA 1IB6A 2FZWA 4YWJA 3RQSA 4YQZA 4IMRA 4LSMA 3C7DB 1YXMA 3FCOA 3H9EO 3DOCA 5HS6A 1FDSA 2Q1SA 4YB8A 4J90A 2PK3A 1W0CA 4GI2A 3KO8A 4XQCA 4XCVA 5KVCA 3U4CA 2EKQA 4IDDA 4HXYA 4PGFA 3FSRA 3BAZA 2I66A 5TJHA 1DEHA 3UXYA 1U5CA 1TT5A 4JIGA 4CMCA 4WKGA 4CLDA 3ADOA 4TQGA 4A2CA 1DIAA 4P4LA 4RLSA 1A4IA 4BNNA 4MOWA 1HE4A 1ZXLA 2CDCA 3DTYA 3ONFA 4ZQHA 1BDMA 5A3VA 1NAHA 1M67A 4II3A 4NJMA 4GQAA 1SB9A 4KTVE 2Q2VA 4BL5A 4R9RA 1H6AA 5IFLA 1HL3A 3NT5A 1FK8A 1XQ6A 3GVPA 3UOGA 1I30A 3BIOA 5KKAA 1MC4A 1UXJA 1NM5A 1EQUA 2JL1A 3S2IA 4BGEA 1E3SA 3ORFA 1OC2A 3TFQA 4DRYA 4Z3KA 1GQYA 5I7FA 1Y8QB 1QR6A 4NDNE 3JQFC 2XXJA 1B2LA 3GEMA 5KVQA 4D3FA 4GVLA 3GVCA 2Q2WA 3D3EA 4R5HA 4A5OA 1OZAA 2O2SA 3OJFA 3WMWA 4B3HA 3EAGA 7ADHA 4Q3AA 4UUOA 1EVYA 1A9YA 2YHUA 1C1DB 1T2EA 2WE8A 2YV1A 4K6CA 4Q39A 4AJOA 1Y8RA 3AY3A 3JYQA 4URFA 1LLUA 2NADA 2PKQP 3BMQA 1I10A 4CM8B 2W2KB 3JQAA 3RUCA 1KEWA 3BMNA 5JPIA 1DO8A 3PHJA 3DC2A 4I1IA 5JC1A 3H3JA 3A4VA 4BUCA 3JYLA 4XYGA 1ADBA 4UULA 4JP2A 3WQQA 1KYQA 4J1TA 4A10A 2YQ4A 4JNKA 1MXFA 5JAQA 3OQ1A 4BHTA 5DF1A 3ZWMA 1CQIA 1NPYA 2WWRA 1C3VA 1IPFA 2DC1A 2OP0A 3H8VA 3RBZA 3JCZA 1BW9A 3V8BA 4N5LA 4B7UA 5ITVA 2VHWA 3Q9NA 5L7TA 4GWKA 1PJBA 4LISA 5GMOA 3H3FA 5T57A 3PEFA 1SZJG 3SC6A 2W2LA 3AM5A 3AJRA 1DLJA 2IZ0A 5G4KA 2HRBA 1Z7EA 1E7WA 3GG9A 3KEQA 2BRUA 4Y98A 1NAIA 3AW9A 3INGA 1SMKA 5THQA 4IIVA 4D7AA 2YUTA 2FSSA 4BNZA 4J2HA 3ZNNA 3KYDB 3ENKA 3K31A 5EJ2A 9LDTA 2PZJA 4A7PA 4YRDA 4PN3A 3DBHB 4FFRA 4AJNA 2FOIA 4BMNA 3F1LA 3OIDA 1PJTA 1K3TA 4J1NA 4B7CA 4DQUA 2PFGA 3WGOA 4EZBA 4J7CA 2NVUA 3VZPA 3DDNA 2VYVA 3E6AA 4FGSA 4IDBA 1Y5RA 5JDIA 2IZZA 1GV1A 2VRCD 5H81A 4FQ8A 2O48X 2O23A 4WCFB 4NFSA 3ZU3A 1ZEMA 1ZVMA 4XA8A 5G4LA 1MC5A 3AM3A 1O9BA 3NKLA 4LRSB 3M2TA 1KEPA 1A72A 3QP9A 3CSDA 3F47A 4MVJM 5EQDA 4R9SA 3C1AA 3HB5X 4AG3A 5TGDA 4E32A 5IF3A 2FHSA 4GSKA 3ONEA 4PRKA 4E12A 1JWBB 4O1MA 4R1TA 5ITWA 1R66A 2IEDA 4XIJA 5JY1A 2JCYA 3M2PA 3JQCA 4FPXA 1DFGA 3RBXA 5BNTA 4DUPA 1GCOA 3ON5A 1IULA 3OM9A 1DRUA 2R00A 1EEHA 1LEHA 1O95A 3D5QA 5ENDA 4ZN6A 5KJFA 5KVSA 3WLEA 2V65A 2GN4A 3IIEA 5JAMA 3SXPA 5DOZA 3GGPA 3SJUA 4DPMA 1KY4A 2GD1O 4XX0A 3TZHA 4L4SA 1NR7A 1QYCA 1JKIA 3EYWA 3GRPA 1U4SA 2VCYA 3TWOA 4WLVA 1E1NA 1N5DA 4YJHA 3BZUA 4JXKA 4RDIA 1BG6A 1DFIA 2NQ8A 1HDXA 3OJ0A 4DA9A 1VL6A 1V6AA 5BSGA 1XHLA 4LRTB 5T6BA 3JQAB 2X0RA 3AOEA 4NH4A 3ZU2A 2EGHA 1ZH8A 3KETA 3VTFA 2GUGA 2ET6A 4YCAA 1QRRA 2UDPA 4GKVA 4PVCA 5DOVA 4BO0A 1LDEA 4I9NA 3AI2A 2VYNA 3PFFA 1NBOA 3I3OA 3HHPA 1W6UA 1DJQA 2YDYA 4O63O 1F8FA 3ZHBA 5B4VA 1I3LA 2W90A 4JP3A 3GRKA 4NU5A 2B69A 1LSSA 2JKVA 5AYVA 3U62A 4UUPA 4RLHA 4B4UA 5I7VA 3SC4A 2JAHA 3TF5A 2E49A 3FWZA 1XLTA 2UV8A 1KERA 4RGBA 5CHEA 1NTOA 1XU7A 1R6DA 3C24A 2XXBA 2EP5A 4Z0TA 2GLXA 3GNTA 2D8AA 1BHSA 1CF2O 3OFSA 2DTDA 1M75A 3OSUA 1P45A 4OQZA 3VKUA 1D3AA 1Y1PA 2AEMA 3Q9UA 3L0DA 2WTBA 3HJAA 4RVUA 2GCGA 2QZ9A 2Y67A 5U1PA 2YV2A 4ND4A 5DBGA 1YQGA 3H9UA 3L07A 1L7DA 3ULKA 1B3BA 2J5QA 1ZJYA 4HKTA 4DVJA 4ITUA 1ZEJA 4M55A 1R4MA 1WLYA 4AJPA 2DKNA 4W4TA 3BA1A 1ZXBA 1TA4A 4BNMA 2WYWA 4BS9A 4FR5A 3W8DA 1KY5A 3KYCB 2RH4A 3UAGA 4YR9A 3PJFA 2X23A 2EG9A 5KCZA 2DTXA 4BMSA 4GGOA 4BKRA 3GR6A 5G0SA 1EFKA 4BVAA 2NTVA 2EF1A 3OA0A 4WLFA 2HQ1A 2WJPA 3K8ZA 1DRVA 2AQHA 1P1IA 1YJ8A 1HE5A 2HRZA 2UYYA 3CKYA 3GN2A 2A4KA 3WSWA 5A5EA 5A5FA 5L40A 2Y1OA 4WCFA 3NX4A 1E3JA 3GPIA 5BQFA 1WPQA 2BMAA 1TI7A 3AI1A 1I8TA 1MG0A 5A06A 4Z9XA 5I9LA 4BKOA 1NWHA 5JBIA 1RM4A 3K9QO 2AG5A 2D3TA 3E82A 3GZ4A 4L4XA 3ZHZA 2NACA 1NXQA 1ADFA 1Y5MA 2GYYA 4B3IA 5DZSA 3VH3A 2PLAA 3FNFA 3CZRA 1M76A 3NTQA 4CM9D 4P4GA 2J3IA 1LX6A 2IYOA 4WOKA 5TJ9A 4EEXA 2RBEA 3PQFA 5T8KA 3QWIA 3HNPA 3RKUA 3H4VA 5TT0A 1IZ0A 2AXQA 2FY8A 3KZVA 4CJXA 2VWPA 1P0FA 4PLTA 3S2GA 3VH1A 1PGOA 4TRRA 1AGNA 2Y1EA 3H7AA 9LDBA 3A1NA 4J49A 3I6IA 4UVEA 3NJ8A 2WYVA 5CAEA 1QYWA 5IN5A 5COAA 1YDWA 2EXXA 3BYZA 3U9LA 5TQVA 2NTNA 2YHIA 3RC1A 3FPCA 3I4CA 3JQGB 3Q0EA 2PKQO 1Z75A 2O4CA 3QE3A 1F8GA 2HLPA 2JFGA 2VHZA 4DYVA 3DOJA 4EYEA 5F1PA 1JVSA 1HDCA 2H1SA 4H7PA 3AUAA 1CIVA 3M6IA 4TWRA 4YJFB 4XYEA 2HSDA 4PLZA 3OETA 1L7EA 1RYDA 3BHIA 2R00C 4KTTE 1PL6A 5BNIA 4CQMA 1DIGA 2JCXA 4OSOA 3TL2A 1W73A 1XU9A 1LLCA 2HMVA 3GFGA 4NMHA 4WNCA 4E5NA 2AG8A 5MDHA 2O7QA 3LT2A 2WD7A 2GNAA 3ANNA 3HFGA 2PKRA 5TF4A 4FS3A 1ONNA 4KUGA 1KOLA 1E3WA 1JQBA 3PYMA 1PZGA 3DZIA 4CR7A 2VUSA 2Y1CA 3PGJA 3IUPA 3Q1LA 1FJHA 4UVIA 5KNLA 4OIMA 5FF9A 5IDQA 2LDBA 4DLAA 4LSWA 3QHAA 1X1EA 1GPDG 3AFNA 4EGFA 2Q1UA 4Y6RA 5HS4A 1LA2A 2D2IA 2VRCA 4KUHA 4NQZA 3ZV3A 1QMGA 4RDHA 3R3JA 4CV1A 3DR3A 2WSBA 5JLAA 4U0KA 4H3VA 1NFQA 3OA2A 1PJ4A 2CUKA 3QWHA 3JD3A 4M8SA 4L76A 3RCBA 5KVVA 2OGUA 3IL2A 3NGLA 3P7MA 4BNUA 4IPTA 2RHCA 1KC1A 1X7HA 1YKFA 5DULA 5KJ6A 5IZ4A 4IS3A 3DZBA 4Z3DA 3U09A 2B4RO 3G1UA 2OL4A 4ALJA 2EW2A 1XSEA 4EJMA 1KVRA 2BFMA 4CLRA 3F1KA 4YAIA 4KUEA 5TC4A 4HFJA 4NIMA 3DB2A 4J4TA 4IINA 4RQUA 4JBIA 1M66A 2OP1A 4ROSA 3UUWA 5I7SA 1LSOA 1O8CA 1WDLA 3EC7A 1YBMA 2UUPA 3INTA 2CD9A 1NPDA 5IDYA 1DXYA 2NNLD 4HADA 1B16A 2CFCA 3MWEB 4W7HA 4BNKA 1A4UA 1HWYA 1ZJZA 2WD8A 2X8LA 3BHMA 3JTMA 3VAZA 1TLTA 1J49A 3RASA 4G65A 4A27A 4D0SA 3H9GA 5DCWA 2X22A 1QV6A 3E8XA 2DPGA 1U3WA 1PQWA 4IBOA 1H6DA 3NT4A 3UH1A 4QT0A 4ZU3A 4NR0A 1ISMA 1UUFA 2IE0A 3WQRA 4FD3A 3JQ9A 2AW5A 3A14A 2F00A 3LDHA 4RPHA 3EMKA 4CUJA 1KETA 1UXHA 3E9QA 4FFOA 2VUTA 2GF2A 4R1UA 4FJ1A 2WDZA 2B37A 1FDTA 1Q0LA 3JQ7B 1GYPA 2A9FA 2PD3A 1WMBA 3L6EA 3UGKA 3W8EA 1DB3A 4DIBA 3IMFA 4YRBA 3JD0A 3QIVA 2FP4A 4WEOA 1H6BA 3O03A 5A03A 3CMMA 4CMKA 2HMUA 4HNGA 4PIVA 3I4FA 3PYXA 4PLFA 4P38A 2ZCVA 3DMTC 4PLCA 1DIBA 3GT0A 3L4BA 2NU7A 4JJIA 3WJ7A 1AN9A 1I3KA 2VNSA 3VHRA 3PXXA 3QRWA 3BTOA 1GZ6A 5L45A 2D5AA 4DIOA 5I8WA 1KVSA 3H5AA 4IDGA 2D5CA 2IZ1A 3ROPA 5IZCC 1PX0A 3RUAA 5L51A 1ZO8A 4GLOA 1V9LA 2FZEA 4KP7A 3UFXA 4CLHA 3INRA 2VOJA 1B0AA 5CFZA 5JYDA 2G82A 4GMGA 3CPSA 3OF2A 2EJWA 2Q49A 3B1KA 5B12A 1T4BA 3IS3A 1PL7A 4DC0A 1VC2A 3DMTA 3EHEA 2EIHA 2I3GA 2PZKA 1JKJA 4WECA 4FCCA 3A06A 1GUZA 4CR6A 5TIIA 5FEUA 2E4AA 1RM0A 3H6KA 1VRWA 2H63A 1U5AA 4UVDA 1M6HA 4WPGA 3NEPX 3K92A 4YA6A 2EP7A 1YB5A 5I8ZA 4OQYA 1PQPA 4ESOA 1KVUA 1F06A 3JQ9C 4BO2A 3ZU4A 4XQEA 4Y67A 2ZK7A 3AUSA 4IQ8A 2GASA 4WCFC 3M1LA 4OOEA 2IRWA 2PTGA 4IS2A 5EIOA 1AXGA 2HKIA 3O9ZA 1ZSVA 2QG4A 4XEHA 4XGIA 3V1UA 2Z1MA 1ISHA 4D79A 1SEVA 4FSHA 4HY3A 1NP3A 1MB4A 1C0LA 4BNLA 1HZJA 4KDEA 2YW9A 4CM4B 1PGNA 3GG2A 3JQ8A 3AU9A 4NBWA 3NJ4A 4EJ0A 4A73A 2P5YA 3NGXA 1H5QA 1YJQA 2IYPA 4U7WA 3PWSA 4DREA 1PWXA 2BH9A 2VYVD 3JQDA 4RVGA 4CQLA 4EDFA 3DBRA 3VPHA 2H9IA 2VRBA 3EZLA 2A94A 3ZW9A 1EMDA 1A5ZA 5COBA 4E31A 2SCUA 3PJDA 5L53A 4M89A 1R4MB 2ZTLA 1PGQA 3B20A 3CUKA 1YS4A 3O26A 3K6JA 4IJWA 4U6SA 3WGGA 2G76A 1LRLA 3KUXA 2PGDA 4IDCA 2VZ8A 2QRJA 4RPLA 3GY0A 3KVOA 3WYEA 3LYLA 2CNBA 4UEOA 3TFOA 4I5FA 2B4QA 2Q4BA 3KOUA 2O4UX 4EJ6A 1ENZA 1ZK0A 3V2HA 1C0IA 1MG5A 3K96A 3NDJA 3JQ7A 2TMDA 4TKMA 1HTBA 2TMGA 3IP3A 3TOXA 1Y81A 1VSUA 4D45A 3FNHA 1TVEA 3N58A 1WAMA 1YBVA 1I0ZA 1ZCJA 3OECA 3OBBA 2UVDA 4OXNA 4BQPA 1ZMTA 3GZNA 3I5MA 3O8QB 3IDSA 4BNJA 1E6WA 1PIWA 4LCEA 4ZA2A 3V1TC 3F5SA 2EGGA 2V6GA 3MOGA 3VH2A 4GX5A 1T2FA 2JCVA 1BGVA 1F14A 3TRIA 3PIIA 4RJTA 1Q7CA 2BKAA 4K28A 2DU8A 2UUOA 4W7IA 2BLLA 3T7CA 5HA5A 2ZJ1A 1LXCA 3EVTA 4CV3A 4IUYA 4II2A 1NR1A 3LC1O 1EBFA 3JYPA 2IXBA 1ZK2A 5DP1A 2OZPA 4ZHSA 2AA3A 2ZCUA 4R16A 1I2ZA 1MGOA 2JHGA 3RWBA 5ES3A 2DUWA 4N7RA 4AICA 3LU1A 3RJ9A 1YL5A 5IXYA 3PWZA 3RI3A 4M87A 1FDVA 1PWZA 2UAGA 3GAZA 3K30A 5JSFA 2Y0CA 4P22A 3ZGYA 4XR9A 3FPLA 3WFJA 4JK3A 2YHIB 3E48A 2GDZA 2Y68A 1HLPA 4LW8A 1HF3A 1RWBA 4OSPA 5JDCA 3K2BA 4LK3A 1BDBA 1GY8A 1NQOA 1XIVA 3N74A 2ZYDA 5L4NA 3QJ5A 4MVJI 4QUKA 1MXHA 1X14A 4FOSA 2X5JO 3JQFA 1EBUA 1BMDA 4B79A 3MZ0A 4CMEA 4ZRNA 3Q2IA 4MIEA 2VOEA 2CVOA 4DIFA 4GWGA 3ADPA 1P31A 4ZD6A 2FR8A 3C1TA 3U49A 4J91A 5DNAA 5EN4A 4PG5A 3TL3A 2FN7A 3NTRA 4Z0PA 3T4XA 3KV3O 5KIAA 1I3MA 1BSVA 3G79A 2Q46A 4I5DA 1DHRA 4J7UA 1WP4A 3DFUA 3BMQB 5G0UA 4OO3A 4RORA 3WB9A 4WGGA 3VPGA 4DC1A 3ZCXA 4GL4A 1YVEI 4YT4A 3ABIA 1XDWA 1J0XO 3SLGA 1HDGO 1GEEA 2D4AA 4YJFA 4EEZA 3H5NA 1DHTA 3LZ6A 4DL9A 1CRWG 4L75A 4BO8A 4EITA 3CEAA 4CV2A 3AOGA 2P68A 3WWYA 4D3SA 4CM1A 1N9GA 2PR2A 3Q6IA 1EVJA 1LLQA 1Q0QA 1VJ1A 1K6XA 2YV3A 3FNEA 3NTOA 1HLDA 1DLIA 1VI2A 1V35A 2Y05A 1UZLA 5B4UA 3HADA 3BTUA 1BXKA 3P2OA 1CJCA 3IUSA 4QFDA 1QLHA 3DBLB 4RPGA 3GZNB 4HX5A 5TSDA 3S1LA 1YGYA 4BO7A 1R0LA 3S2EA 1NNUA 4DWVA 1RM5A 2VWHA 3LQFA 3MTJA 2B83A 3WNVA 5JS6A 3OP4A 5EQFA 1E1LA 1AHIA 4YT2A 2NV6A 1LDNA 4MIYA 3E5RA 4NK5A 4BO9A 3SX2A 3I9LA 1GADO 3BMNB 1LDYA 1ARZA 2PY6A 1DAOA 2DBVO 2NVBA 3GA0A 3JD2A 3LLVA 5DBIA 1CERA 4A03A 4BNGA 2I99A 2AQIA 5JDCC 2PWZA 1O6ZA 1OMOA 3WLFA 3HDYA 2B36A 3Q2KA 2OO5A 4UUMA 5H83A 1BXGA 2W2LD 2FRDA 2GZ1A 2I9PA 3DZHA 4J4HA 4MJLA 3S8MA 3HZZA 2FWMX 4S1VA 3NAQA 4PVDA 4R5MA 2AQ8A 3WG9A 1B8VA 5EINA 2V6MA 4INAA 2I6TA 3ENNA 3C1OA 4TRMA 4XJTA 3D4PA 3DAFA 3VOSA 2O50A 1BVRA 2HMTA 5EERA 2C54A 1HXHA 2XAAA 3FF4A 4QECA 3KYDA 2H5LA 2C29D 2Q50A 4EUHA 3WGHA 4F45A 1LRKA 3MJSA 5CEFA 5KJCA 1EFLA 1T24A 1ZKMA 4E6PA 4YAGA 3ZWWA 5JO0A 1RPNA 1VJTA 3UVEA 1GUYA 5JCXA 1YONA 3DTTA 1Q0HA 3I9OA 4JBHA 4MVJD 1MLDA 2GN6A 3QV1A 1I5RA 4D0RA 1AXEA 1GTMA 2WYUA 3HG7A 2EWMA 1NASA 4MKZA 3KRTA 1QORA 3ZWYA 4AVYA 1E7RA 2GSDA 3C7CB 1AE1A 3R0IA 4PLWA 2HU2A 3B1FA 3G49A 5TS3A 4L4RA 4HFRA 4TVBA 1JAYA 4TSKA 1I33A 4ZGWA 4F6LA 3JQGA 1GEGA 1GPJA 2HAEA 3BHJA 3IJPA 5G0WA 1PR9A 1U3UA 1PEDA 3GLQA 2OFPA 3R6DA 4KWHA 1UR5A 3E5MA 1N8KA 1ZBQA 2CVQA 4GLLA 3D1LA 3ZWBA 4R68A 4IQGA 2P5UA 1XELA 4I8XA 2NTJA 1GQQA 2V6BA 3BMOB 4OXYA 2RHRA 5CDGA 1MX3A 1E77A 2DVMA 1E3IA 3LT4A 3DO5A
chains in the Genus database with same CATH superfamily
4BGDA 2OBFA 4AIRA 3GPCA 3FM3A 3TSCA 4YXWA 1G5TA 3VU3A 4GVPA 3ABTA 4HDAA 3JRAA 1E0SA 3TZQA 3ZBPA 1U31A 3S2WA 3HJTA 1YIJI 3DV0A 4TN1A 3DHNA 2CWDA 2FPLA 3BJRA 4AD9A 2WBLC 4KR3A 2H8WA 3UC5A 4RAZA 1SB8A 1W1IA 1H9AA 1RLMA 3DE1X 1T3ZA 1VQ9I 2ZYGA 3EXFA 1UWLA 3L8GA 4CMJA 4HZGA 1R3DA 2VVTA 2C3UA 2WIBA 4INPA 2FPWA 4L07A 4LCJA 4QA9A 5GONA 13PKA 5IVHA 2DFFA 1D6JA 4HDCA 1S7GA 4BECA 1XJQA 1D1TA 4YJGB 3KAKA 4X8MA 1V4BA 2FWRA 5TMDA 3V9PA 5ISMA 4C2MJ 4NCKA 3QPTA 3KHUA 3PKIA 5DTRA 3M5DA 2F17A 4Q4LA 2Q2QA 4U5QA 3SX0A 5T5QA 2GBLA 4G5FA 3UB2A 1RLUA 2QD4A 5FR1A 3V7FA 4HWTA 3ZWPA 2WSIA 1FPMA 3CZCA 2GILA 4X1OA 1IWPB 1D9ZA 2RHWA 4IFBA 1JQDA 5BOSA 3K4KA 3QOXA 1L3CA 4XJSA 3K6SA 4XLPF 3DG9A 3NHKA 2JA5J 1JIQA 1Z12A 4XWYA 1OLOA 3E97A 3LIPA 2PMEA 4XRSA 4G1CA 5JNVA 1FNNA 1OX4A 1P7JA 4IQ4A 5AMXA 4FNAA 2P9BA 4FDUA 4AG6A 3EA0A 3G1TA 2WJGA 4LHSA 1IL0A 4MCIA 1LSUA 1HW1A 1YHNA 2G6TA 1QG4A 3AY6A 3ETLA 4I55B 1M2EA 1JN0A 2FG5A 2VA8A 3O8DA 4Q4CA 4UCWA 5IXSA 2BEOA 3MWJA 4O4LA 1K9SA 4ANJA 3E03A 2JLAA 2C78A 2CXUA 1OBFO 2B7BA 3CZ5A 1DG3A 1EX7A 4L8VA 3QXJA 3QVXA 3NEJA 5K0NA 3F72A 1C7FA 1IHPA 1S8OA 3ETHA 5U4XA 1TQ4A 2W2QA 2NRAC 4PN7A 1Y4ZA 2CLKB 1T0UA 2G9VA 3K2QA 4PX5A 3OQ6A 4D4KA 1U8TA 4CMEC 2AF4C 4V2GA 2ACKA 7AT1A 2BGKA 2OZLA 3DDHA 3PCXA 1ZAOA 2R7FA 4EM1A 5HODA 2JQ7A 5AXDA 3GK3A 4CUJA 5HFAA 5K4AA 4UNQA 2IGKA 4TM8A 1C3OA 1E92A 1TL8A 1LE8A 2DWCA 1FU7A 1PNQA 1Y6RA 2YZ7A 3KSZO 4BOYA 2BHZA 3U4IA 3LPAA 4FISA 5DCUA 3VKWA 2VTEA 3O3MB 5T8KC 5EF6A 1ENOA 2I3DA 3FWPA 4KAJA 4KQMA 1D2MA 4LOCA 3AV3A 3FUCA 3VJMA 1EDOA 4RF2A 3AXTA 3LUAA 1NLYA 2TYSB 3PP8A 4ND2A 2VE9A 4JEMA 5ED4A 1S7AA 1NBWB 5JCOA 3STYA 4YUWA 2IUEA 4WE3A 3K6GA 5LRRA 4XTCS 5L3VA 4F71A 2PL3A 3U60B 4KREA 4RCVA 2WICA 1G9SA 3N0RA 2BJVA 4N6OA 4J2TA 2IEZA 3TTXA 1P9NA 1FLVA 2X4IA 2XB4A 3ZY4A 1QZXA 2QRLA 3Q7SA 3GW8A 1MB0A 3HSYA 4LY9A 5JCJD 2BW3A 3NVDA 3U19A 3MTAA 2VJKA 2A59A 2QW0X 1Y6IA 4WUTA 1V1RA 3BG7A 1MO4A 4KWIA 4GP9A 4ZZ0A 2E4ZA 2LRDA 1LW7A 2ZETA 2FZ4A 3G2JA 4LOIA 2CYYA 1VE7A 5FH9A 3QBTA 2ZJ5A 4PYNA 1XWFA 4BJ3A 5DVZA 1LEAA 3R1IA 1VIYA 1ETYA 4IDHA 4PG4A 5LR6A 2FI1A 4QVGA 4TQAA 1EP1B 1TJ5A 3QMMA 4Q9IA 4JBWA 2H1FA 2BCEA 3RYHB 1A9RA 3UA4A 4BDTA 2GTIA 2FZKA 1WHTA 1JLHA 1WDKA 4OXRA 4RIGA 5K3CA 1T2NA 1U2SA 1YQQA 3PZBA 3G0DA 1QBJA 3RDIA 2P9TA 4P33A 4C3OB 1XJWA 5JFRA 5A4JA 5PNTA 5HTOA 2HI3A 4N5DA 3Q11A 4B2YA 2V5UA 2AI1A 1NW4A 2P79A 1CVRA 2W8BB 2YJZA 3DEKA 3FDIA 3JQBA 2EW8A 1OQAA 4HQFA 4LGCA 4UC0A 2QQ5A 3WDLA 4BBJA 2IYQA 1TEVA 3HXQA 2FPGA 2QZSA 5LLSA 4OFXA 4DQLA 1NBIA 4DMCA 5KJ1A 3O1LA 5KQGA 4B80A 1X94A 3C39A 2JGDB 3D4OA 3Q40A 4S2UA 2P5KA 1XDGA 2FPIA 2HBZA 2I6FA 1V3VA 2VPQA 3MSCA 2FGKA 2J0EA 3KIPA 1GPLA 1Z6ZA 4GAEA 4KE8A 3PI7A 4S0XA 3P94A 4MVJE 1MO5A 2HEIA 1L1FA 2YASA 1TT0A 1RSZA 5J1YA 1TZKA 2O52A 4J9VA 2LCQA 4JFAA 3RE1A 4URVR 4V1CA 3EW9A 5CDFE 4G0NA 4W5TA 3ZGKA 3N0TA 4NDAA 5JSHA 2ST1A 1KU6A 2BW3B 4O3MA 1OV6A 1VIAA 3NYQA 2Y1FA 4LUCA 3SXUA 4D26A 3CNHA 2ZTVA 3UGTA 1Z0IA 2PFBA 2R1VB 3HGYA 2JFZA 3PK0A 7ABPA 3NO4A 3HV0A 2RHBA 5CYGA 2B1JA 1VHWA 4L9SA 1JAIA 4C0WA 4ER0A 1BWRA 4ZAZA 4P83A 821PA 2IOFA 2ZVQX 5J5CA 1Y82A 3HKBB 3V7UA 2L2QA 4G4JA 1EM6A 4CCJA 1H8EA 1X7YA 1L0OC 2O2HA 4FYMA 4JQZA 4XD2A 4XUEA 4BLSA 2FF5A 2X1MA 3M6AA 5CG2A 5KQMA 3LSPA 1XT6A 4RV9A 3OEHA 4Y2GA 4KPFC 1I32A 2ZYWX 1T91A 4U6QA 4UHJA 5KJEA 1FNMA 2XF8A 2B5WA 3QVVA 4FW8A 4O25A 3ROGA 2OPBA 2Q1TA 2UV1A 2VPXA 3VODA 4Z3OA 2ZSAA 1ENHA 1CJKC 3AHEA 4C0HA 1QVUA 2EATA 3CMYA 3B2EA 3QA9A 4ZCIA 1UP7A 4CKWA 1II0A 5JHFA 3ILHA 4O4IF 4RPKA 1DG9A 1WWKA 9MHTA 2F4IA 3M1CA 1M6WA 1T13A 4TQ9A 2XTMA 5A4KA 3BTCA 4RVHA 3UIEA 5DNCA 5CYPA 4AMUA 5KYYA 2OBNA 2VI5A 2C7QA 1GPAA 5IDXA 1VPEA 3PNYA 3DMFA 4MWGA 3TBKA 1B6TA 1E2GA 2BVMA 1OD6A 1YJCA 4JC0A 1EM8A 5GY7A 4EF5A 3HFJA 1DQUA 2B34A 2DA2A 2OVBA 4V38A 1F4KA 1H0SA 3MT7A 4LFAB 1ICIA 1QF7A 1V8FA 3V2UA 1KI1A 4E51A 3ED1A 5A5VA 2EZ4A 1XL1A 4PIPA 4CM8A 1G20A 1L5MA 3IUQA 2B1GA 3KQUA 1IPEA 3MCWA 2IZ7A 3PEEA 5EYPB 3CB4A 3RSNA 5AVKA 3DWFA 3CEJA 3RUHA 4HFMA 1KYZA 3ZYCA 1SC1A 1EUCB 1MV5A 4PQGA 1V16A 2OBXA 3QF7A 1L7RA 2E9SA 1NBME 4HG2A 3TOAA 2N1BA 2R4UA 4QKQA 1O5OA 2PT5A 3OE5A 2XDQA 3K73O 4FK8A 3RD5A 5EIAA 1T8IA 2P5VA 4NDLA 3GTKJ 3I4MJ 3BICA 3IAHA 4K2HA 3T8RA 1ZM9A 2XVMA 4FYXA 1GTG1 3B78A 4L74A 4QLOA 1YS1X 2SKCA 5GOZA 2OFFA 4AU1A 4HLNA 2ZDHA 4B9EA 4Q3OA 1K0UA 1Y63A 4CEHA 3JYNA 2X8WA 2AZDA 1LTQA 4BDZA 2PRJA 2R86A 4BBPA 3M9AA 8LDHA 1J90A 3E22B 5LRSA 3P9XA 1NVXQ 4OQEA 1J2JA 4Z53A 1BVYF 4G4SO 1A4XA 4E4TA 1BX3A 1HKUA 2C31A 2B8EA 2WFMA 4CM5A 2VAPA 2JANA 4H0FA 1GGNA 1IZ1A 1MAWA 2X2FA 4AJIA 3TI9A 1QE3A 1Z73A 3SFTA 2VQEB 1OCRH 2QTWB 4DGWB 3ZQQA 1KI9A 2NAPA 2XTJA 1GDDA 1E2QA 3ZZUA 3BJMA 4EJ2A 4EEKA 1RABA 1CY6A 1TM4E 5ARBA 4IZ6A 3GFIA 1GTVA 2GEUA 2VHCA 3I6YA 1NZDA 5FUBA 2FQ1A 3OX2A 1JKRC 4NPCA 5A3JA 1N77A 1JKMA 2A9PA 3EAFA 5KDOA 3H35A 1R6AA 3GJ6A 3MKWB 1Z8FA 4P34A 1UK8A 2B5OA 2PZLA 2XPCA 1BA2A 1NOIA 2XCSB 1AO3A 2OV6A 2QYHA 1WJ5A 5CXUA 2K2QB 1X7GA 2C7VA 2Q8KA 2YFYA 4FB5A 4Z54A 1XLVA 2FMKA 3QUQA 2I22A 5AO9A 2D2VA 5D6OA 5FA5A 5FOTA 1KE1A 4NG5A 4AFNA 4BQQA 1E2FA 4H1UA 5BPHA 3LA7A 1DELA 2B0LA 4IIBA 2Q3CA 2BHRA 3N86A 5ILSA 2CFRA 4CDNA 3NBAA 3IE1A 1CKEA 2HMWA 2ZI4A 5AHWA 3DHYA 5D4RA 1P7WA 1QANA 4GEKA 3NHJA 2OBYA 4XH9B 3FTNA 5I7WA 4J43A 4ZP1A 5JCJA 1J2RA 3SZPA 3CUQB 4U9IS 4ZJUA 5KVAA 3LHFA 2JVKA 4ODIA 4FC6A 3E7FA 2QLZA 5DCMB 3U1VA 2G0TA 1TM1E 4RO0A 1C9JA 3AL2A 4UXHA 2AN9A 3BTIA 4MR8B 1X58A 1WXFA 1I4WA 2AK3A 2V54A 4Y9SA 5HQTA 1A97A 5HOQA 2J0QA 2C8JA 2P2SA 2GZ2A 1HKSA 1X9IA 2ID4A 1J1ZA 1I1HA 3CV3A 1KK1A 1VXRA 2VKQA 2QZ8A 2B8TA 3D4NA 3MAAC 3NNDA 4FHCA 1I7QB 3G3ZA 1BXGB 4R2KA 3C74A 3ZXSA 3KWFA 2VHYA 4MWBA 1CUYA 2QRGA 4UAGA 4C6RA 5AM3A 4MAAA 3U3KA 1RP7A 1ZJJA 3NHWA 3ZW8A 3RUEA 1FYEA 3TQQA 5LQDA 3AVXA 2I1LA 4C78A 2HV8A 3HOYJ 1Z2CA 1OYIA 2PL9A 1JWAB 1N7GA 2BDTA 2WADA 4AJKA 4CT4B 1PT9A 4FYIA 4ND1A 4C1NA 3Q41A 1O8BA 4OBXA 2I8LA 3J7ZI 3I9NA 3LSMA 4LX8A 1CQJA 5BW4A 1JTEA 3S44A 3OSGA 3HLYA 1THTA 2XIQA 1QJ4A 2O7SA 1ISRA 1ODIA 1ZH5A 2VDUE 4AY4A 2ZAGA 5J2UA 3H83A 3KSBC 4QEKA 1U3EM 3VAYA 5DU2A 4EG0A 1BE0A 1RCUA 1WEKA 1DPRA 4CUGA 3PSHA 2HW8A 3C3EA 1M5RA 2WWHA 3LBIA 2H29A 2VYFA 3ZQJA 3WGMA 3ST7A 3TOBA 2OCAA 4FEYA 2Z6UA 1F1BA 1OFCX 1X1QA 3BMOA 1KI6B 1T34A 5FKMA 2IKQA 2PWBA 2XE4A 1TB4A 2CLMB 2ZJQF 1UJ8A 3IT0A 1RESA 1HYGA 2QA4I 1E4YA 5JO9A 3GLFE 2A5LA 1P4AA 2H65A 4QTZA 4XB1A 2X4HA 1DIOB 1OSNA 2AG1A 2FPMA 1QGDA 1TQ6A 1V1JA 3AF5A 4BNWA 2ZSIB 1R71A 1VHDA 2SHKA 3MJVA 3O8LA 3TDNA 3F4BA 1NFFA 4CQMD 4LF6B 4KN8A 1EX1A 3HO8A 2W2KA 5CIQA 5DN6A 3WRVA 1S1MA 2AI3A 5CA1F 1XQ1A 1Y6JA 1G8GA 2HDNB 5BPDA 4MQVA 1MDMB 1S8AA 4FFVA 4UM7A 1IM8A 1DCKA 1CUVA 1YH3A 5DLEA 1E7SA 4LI0A 3IPYA 1IXCA 4UBMA 3ZGVA 4CODB 4B4CA 1B1CA 2VP3A 2DAOA 3U4HA 3CJTA 3OJOA 3C8ZA 4RY2A 4YPFA 1AUOA 4F11A 2VS1A 2HMSA 1PUFA 1IFXA 1CB0A 1OYOA 3B8HA 2QD1A 2OY0A 1A7AA 3WOHA 3O8OB 3G17A 2Z3YA 3SXJA 3LFUA 1ZRDA 1D6MA 2DFTA 2WHRA 1XCVA 2O8KA 1ETHA 2FSGA 2UYGA 1NVEA 2R7TA 2JRCA 3MMPA 2FV8A 3OLZA 1F0YA 2P6TA 1G6NA 3VDQA 5MGBA 2ODTX 4D8TA 2YVAA 2QP4A 3X44A 5A6VA 1LUAA 2JVIA 3MJTA 2BM0A 1R4NA 3WLQA 3LXRA 2M30A 2DOEA 4L16A 3TXXA 2XIGA 1I36A 1NVBA 2YJ5A 2FRXA 2O3JA 1E5DA 3BG3A 3AO0B 3BTSA 4PAOA 2KHZA 1DX6A 3GUHA 1ZK1A 3DEHA 4EMTA 3IO3A 3GRCA 3SWWA 3L2UA 1SC9A 2WJ6A 1UEIA 4R83A 2OB1A 3NRCA 3Q0IA 1NMYA 2CJJA 2GM9A 3DEUA 1DV2A 4R1MA 4DJ5X 2B4TO 5FPHA 3M3PA 1AV6A 1N7HA 2PCJA 2AG6A 1OCTC 1KXZA 4L9RA 5EP3A 4C5AA 4DCPA 4BNXA 2MOKA 1K4KA 3BCAA 4RKQA 1VKNA 4FUQA 3R61A 1DJMA 3OIGA 4E09A 2ZNZA 3GFVA 2XMSA 3W4JA 1K78A 3VVCA 2HB6A 2QSHX 3RU3A 3PGA1 1HX7A 2OMEA 3CZPA 4UFPA 1EIWA 3GRVA 1E89A 4Q4JA 2QJOA 2VUHB 3NEYA 4C2BA 1H93A 3UWSA 1I01A 2JFFA 3RPUA 5B64A 2J41A 1G3QA 1K8ZB 1ZRSA 1UOEA 3CXUA 4Z9FA 5F35A 3C4JA 3X2SA 2YC4C 2CB0A 2VJAA 2IWHA 3M49A 3NFRA 2NZUG 5EXEA 5G0VA 3K0HA 3WFIA 5EUMA 1RKWA 1VMAA 4KODA 4PZ9A 5EMNA 3PI6A 4HNAB 3KT6A 1MENA 5E2IA 3P52A 4JGBA 3HDGA 3UT6A 3C5VA 1RXWA 4M7RA 3F7OA 2XITA 4ALNA 4N41A 4ZQIA 4GOKA 3IO5A 1Y89A 4N9QA 2V7QD 3BSYA 1QRAA 4KO4S 3HWWA 4ONEA 2DFDA 3ILYA 4ZGGA 4YRIA 5I01A 4P08A 2PMZN 1YZTA 1QQ6A 5DUIA 1L5YA 3KYIB 1VHLA 2QIPA 2GCIA 1G21A 1NBAA 2EILH 1T5OA 2KIFA 2YFHA 1GNTA 2Z0MA 3BTVA 3FUTA 2V1NA 4JJ6A 4DBRA 1SVUA 2RKWA 3RFXA 3C2HA 1LRJA 5FWNA 4Y2SA 3S2DJ 3GLIB 2W83A 4LY0A 4UMDA 3U3DA 3OZGA 1SK9A 3A9UA 4FI3F 1U99A 5FO0A 4M49A 3AIMA 4PRYA 1STZA 4NE9A 4MUKA 4EGCB 2HYGD 4OTZA 1P9QC 2C3PA 3E7XA 4EBFA 1FMJA 1OI4A 4QO8A 5LDGA 2Y2ZA 1KFBB 1KVQA 4FFNA 4M7WA 2BBYA 4HQNA 4JWKA 4TV8A 3RRXA 3TQHA 5BR7A 3P26A 1MJ9A 1SUCA 4YJHB 1EUDA 4R8KA 3VR5H 1OJLA 4NRDA 1UKEA 1L8OA 2HUPA 1P9RA 3UJ9A 4PLHA 3MPUA 4ZTBA 4AM8A 1XPRA 2DTEA 4FILA 5EP4A 3S29A 1EFTA 4B6GA 4HNTA 2KL4A 4RY0A 4EX7A 1JJ7A 2A9VA 1YS9A 1I6WA 3BBPA 3K6KA 4MPRA 5JXWA 1JHDA 2Z57A 3AILA 5SZIA 1ZBDA 4Y1RB 4HSEA 4I19A 4ETIA 3HB7A 4L7VA 1S9HA 2WW8A 2YV5A 4BP1A 1U6KA 5SYNA 3UAXA 2W2OA 2CW0F 3H0EA 3RFVA 4MKHA 1L4LA 4JBNA 1GGVA 4N8EA 4EARA 3LCCA 4BO4A 2UVQA 5HIKA 3DO8A 1JTFA 2CEAA 2DRIA 2YH2A 3OQPA 2Q5FA 4I4TB 5ILGA 4EV0A 3ZWOA 5I9TA 4IQ0A 3SJMA 5JPCA 2QBYA 1VBMA 3IE0A 5EQTA 5K8IA 1R9TJ 4YP7A 2RBKA 1WFXA 2SCUB 1Q84A 3UANA 4IGKA 1GA1A 4RY8A 1TWCJ 1SUSA 3WP1B 3RKYA 3OICA 4MK4A 3ROQA 4C0LA 3CF4G 1SAXA 2DSNA 4M8IA 1J4AA 3MT0A 4YJ2B 1FT9A 1QHHB 2VYCA 3E9CA 4AU7A 2PI0A 3ELYA 3FYTA 4HP8A 4U8GA 5BSHA 3W5SA 3AEKA 1VJGA 1A9TA 3IXQA 3FTFA 2J5BA 2MWMA 2Y6VA 4ZICA 2QENA 2GRAA 4KT6A 3IKJA 1PYGA 3EZGA 4MRNA 4X0GA 3JVVA 4R05A 4BACA 1YFHA 1XYYA 4MV6A 4W99A 3ANSA 2NVQJ 2GUWA 2ZRQA 2WWVD 1FOYA 4RSHA 5BQXA 5G1NA 2BF4A 1GPYA 3DV2A 2FG7C 1VG0B 3JS5A 1YASA 1TA9A 3OLXA 4RZ3A 3WIOA 1PFVA 2CXOA 3MXTA 1S6LA 4OHUA 3OL4A 4G84A 2M3AA 1OF1A 1BE6A 2SECE 4RTKA 3R8FA 4F2PA 2MLKA 1ACIA 4L0YB 1NTRA 3I9MA 5BN3B 3HP4A 5HWSA 1JKQC 2ZYRA 5B1DA 2P41A 1J07A 1G8AA 2ZW9A 3NIWA 4IIJA 4C0QC 4FDMA 2OB2A 4E5MA 1YW9A 3BD7A 3V9AA 3O84A 1I14A 4GBMA 4EO7A 5JCZA 3K5WA 3L7YA 5GJWC 5AVVA 1E0JA 1NNLA 3MG9A 4GYJA 1M2JA 1YNOA 2Q45A 4N6GA 4OMYA 1Z45A 5H16A 2VNJA 2VPRA 4U7DA 4G85A 1T2CA 4EY4A 3F8CA 3RHSA 2AXLA 4A6DA 2FLWA 2WF8A 4JODA 5DCLA 2C9ZA 2DKFA 4JBGA 2IX3A 3ZKAA 4XYMA 3EPZA 3BXFA 4JLWA 1M72A 5KWVA 3ZDZB 1WZNA 1SKMA 1LFPA 1NW9B 1RYMA 3TM5A 4Z7NB 4C3HJ 1NRXA 1K7XB 3KSRA 3SSMA 1SANA 4XNFA 2WV0A 5F0CA 3N0VA 2XCTB 4WJZA 3ZKWA 4AY2A 3HSSA 3GNLA 3HWRA 2XGXA 2XQJA 5BWNA 4LF8B 2ZBRA 4F2DA 3B02A 2REQB 1ZD5A 1VZ0A 3D3NA 5AI8A 3STHA 4PC3A 3FWKA 2LG4A 1G0NA 4L0QA 2P65A 1GZSA 4RIFA 2L9NA 3O4HA 5FOWA 5E18F 4Q16A 5LU9A 4M2LA 5E6SB 1RMYA 4FMDF 3UKGA 3MKLA 4UEKA 3WO1A 3FJ1A 3SGLA 1D8AA 1DEXA 2C2HA 4ZQBA 4CNBA 2H4FA 5KC8A 3NIBA 2Z4RA 3G2PA 1J5EB 4L0CA 1FW6A 3CH6A 3OAAD 2CG4A 4EW6A 2P67A 3IPCA 2UZ1B 2O6HA 4JBAA 3AUJB 2XLBA 1C3LA 2DQSA 3FCCA 3SE0A 1OZGA 3QVKA 3EF0A 3EYAA 1U9IA 4ZT7A 3V42A 2SBTA 3OEEA 5B6PA 2QQ9A 3HVKA 1AGPA 2R5WA 3CMAI 3KSMA 4UU8A 3OFKA 2AFHE 1HEYA 3PLNA 4RAFA 1HT3A 3CKKA 4MV5A 3RS3A 3IEUA 1PP7U 3BEDA 3MTBA 3QFHA 4HH0A 3WRXC 1KAQA 4CV0A 3M3YJ 1D7AA 1ORVA 4I3HA 5IF9A 3ASNH 4B7XA 4DY4A 4QSMA 2G8NA 2BFEB 4ENTA 1TRKA 3Q7EA 4DR4B 1FA9A 1M0EA 1G2PA 3D6NB 4Q3LA 5JNTA 4KR2A 4FHEA 2OCPA 4U2EA 4KMRA 4EKGA 2IKSA 4FE3A 3OYNA 1JW9B 1YDMA 4KGVA 1WWXA 5AP9A 3HM9A 2F55A 3L6DA 4QUIA 3VX3A 5A4FS 1T6ZA 2XF7A 1ERDA 3JWGA 2VXDA 4D25A 2QWWA 4HSGA 3VZRA 4HEA6 3N6VA 1QWSA 3AXSA 4AN4A 2VSOA 5JMPA 1FXWF 1GUAA 5I9BA 1IZ9A 2OEPA 2EV0A 3FTPA 3JQEA 4RNDB 3BGVA 4UHCA 2QX4A 3IQIX 3OLQA 4V0LA 2FW9A 1JFFB 3DMNA 4UFOA 5CDFA 3AI3A 3WLAA 5BUZA 5LOVF 3T1TA 4QOHA 2AKAB 5SYAA 4DTIA 3D2AA 1NG6A 1ZGGA 3CU5A 1P0QA 4TT3D 4BEVA 4E15A 4WKNA 4Q0MA 4XRSG 3DW3X 4MHOA 3WIUA 4EF4A 5ADUS 5JECA 4H4KC 4NPAA 4MYSA 1ULSA 2JJ1A 4OFWA 4QOFA 3TSAA 3LT1A 4LYEA 4DR3B 3T35A 3VPBA 2YS6A 2Z09A 1GG2A 2GXSA 6ADHA 1MFZA 1WDMA 3ZMTA 3DW1X 4JX9A 2CMGA 1Y1RA 4LE0A 3RIMA 3FY4A 4GOXA 3ZS9A 2QLTA 2PX4A 2NU9A 1K89A 1O3SA 5I9MA 3T9AA 2BP7B 3V8JA 3LK6A 1UDCA 2A8YA 4V3BA 3FCYA 3PKZA 2GA2A 3ZQIA 4Z4FA 3F7TA 2JJ2D 1HC8A 2E2IJ 3WGZA 4CQLB 1IRFA 4I4IA 4CL3A 3S8YA 3IODA 5K3FB 3R0QA 5G41A 5C9ZA 3OOWA 1VL8A 3P9KA 2LF8A 1AUXA 1RWOA 2DLDA 2PCLA 2DYSH 4CCOA 2XWQA 4S1TA 4F85A 2OAEA 3MXOA 2BKLA 3RQ4A 3EZFA 3L7LA 3OT5A 4WUVA 2R25B 3BE4A 4ZOEA 4CF3A 1QG6A 3MQ4A 5A1JA 3WHBA 2DUUA 3OZCA 2Q4RA 3ICPA 1GLGA 2V6IA 4MARA 3SQWA 2OILA 4A93J 3UK7A 4B4DA 1TU4A 4RMIA 3VKVA 3KEFA 2JZYA 3NI2A 1DTWB 3V4RA 1OXTA 1XNJA 2QYSA 3CQ9A 1OA0A 3RFUA 4EI2A 3GGSA 4GR4A 1MMGA 3ZI0A 5EPOA 2H4YA 3DLBA 1GNPA 2IJLA 2PX6A 1VYVA 5E95A 5IVIA 4U2FA 2RAPA 1G3TA 2RHMA 4RF3A 5BOVA 2BT4A 2QPTA 3PDHA 1BRMA 1U7DA 4IVNA 4G07A 1RJFA 1L5HB 1P3JA 2RH8A 2FRVA 1CFJA 2OV3A 5AONA 1G7RA 4HZFA 4D42A 5I8PA 2WLSA 3OD5A 3IUEA 3ANMA 3AJDA 1FNBA 1NFRA 1VB3A 3SQNA 5EE5B 4PNZA 3UKJA 4BZXA 4D41A 4LJ4A 4EUSA 3GI1A 4MJXA 2L3DA 1XI2A 1BOFA 4K9KA 1OWNA 5TMEA 4QVKA 2CUNA 2BSXA 4EVQA 2WIGA 3VEPA 4I6JA 5ELXA 1JHVA 3JQAD 4B3GA 1FBNA 2DWQA 4KSCA 4HGYA 4YQEA 3VPFA 1DEKA 2RB4A 5BUQA 5DT2A 2LWIA 3RM3A 1B42A 1C1XB 1P0IA 4IZHA 1E5LA 1U8FO 4ESBA 4RVCA 2ELKA 4PHTA 3USCS 3FDJA 2OXIA 2YUSA 3KYBA 3VPCA 1NA5A 2DQYA 2Q27A 5FB2A 4HUJA 3MKYB 2ZPAA 1J8QA 5HDNA 3D5EA 4AD8A 2LP4Y 2GFHA 2QL6A 3IRRA 1DO2A 4KN6A 3N8HA 2QX7A 3JASB 2XGCA 3EY4A 2Y30A 1H89C 3B36A 4AXBA 5DFAA 1SXPA 4XDYA 2H08A 1IMJA 1RWQA 1Z07A 5LL6P 3OQVA 2PJPA 2GJKA 3GQVA 1Q7BA 1YA4A 4N9HA 2MMGA 4R9UC 4QATA 1N92A 1HI9A 4M0PA 5KREA 3IEXA 4CM9A 1M1EB 2R5YA 2C5EA 1PK7A 3DEFA 4EY6A 1EI9A 1EUQA 2BTQA 3GJQA 2AQEA 4P81A 2BMEA 4RTMA 2QTFA 2W2MA 3I2KA 4OJMX 3ZDBA 1OU4A 1IRIA 3H2HA 5AJVB 1DX9A 4LWQA 2VXOA 2PBLA 1UCFA 1YU9A 4Y1FA 2YNMA 4GHWA 3OCJA 4LZAA 4MW5A 2FEAA 1UMQA 4WNAB 4PXAA 3W5HA 4JXKA 3DEWA 4TTVA 3FBIB 2XMCA 2XVZA 4G1BA 1FFDA 3T3IA 3UQZA 3LPMA 3ZDYB 3DLHA 4TKVB 3C43A 1FY7A 3RTEA 3O3NB 1UM9B 4TXLA 3G1OA 3ZU5A 2WD7B 3IKLA 3IDFA 3TD2A 1K6EA 4I5GA 3EQZA 1GYQA 4X0EA 1GTL1 2CDBA 5CT8A 4K8RB 1HOMA 2ZSEA 2VL8A 3O31A 4P53A 3WWCA 1LQTA 3TVDA 3K1PA 4AYWA 5JD5A 2OSBA 2WM3A 3EIXA 3Q12A 4UHKA 4D4JA 5HFJA 5KYWA 3W5JA 4FFBA 1Y1WJ 4ZMRA 3OO0A 2BEJA 5ECGC 1P19A 2IOQA 3SYNA 1POGA 2IV7A 5HDGA 4IXMA 1R6RA 1KR2A 2N3ZA 3GD7A 4CETA 1JE8A 1DDOA 2PM8A 4K03A 1FXSA 5C7OO 1TMYA 3EF1A 5CTJA 2AO9A 4XLCA 4I0BA 3RV4A 3B6ZA 3TDKA 3MMZA 4RF4A 1QHFA 4GO1A 1Z39A 1AZWA 1UINA 1F38A 3OKAA 4TZKA 4WBNF 3W77A 3GFRA 2ADOA 2BP7A 1HZZA 3ER6A 2DHDA 4BQAA 1M7BA 2F1KA 1O77A 3U31A 1COZA 1EE9A 2WBMA 4R8LA 4XFKA 3ORYA 3BREA 5AVYA 1FX0A 4L8YA 4JOMA 4I8IA 2BY0A 4KV9A 7MDHA 4JUDX 3D0RA 2D8MA 4OHXA 5K99A 1JG6A 1CHDA 4IX9A 5L3ZA 3VM6A 4FTWA 2NXNB 1U2DA 2GEKA 5ADVA 2Y1GA 2HK8A 3E6BA 1UMCA 2FE4A 1AO0A 3QRFF 4U87A 3AP3A 2R6R1 3GLRA 1CQPA 2M32A 4FOOA 4G86A 1TECE 3IVMA 2YXNA 4PCVA 2O0MA 3S4YA 4PRLA 4RM3A 4FLMA 4O2BF 2PUHA 1G5QA 1VCMA 1JFFA 4MW6A 5D86A 4E22A 1N6OA 2FH5B 3GTJJ 1VP9A 5LM3A 2QR2A 4L5IA 1G6HA 5LQSA 5DX1A 1IYZA 1RKVA 1U2ZA 3HKBA 5LEKA 4E21A 1XCLA 3MFKA 2PMBA 1A2BA 1QQ7A 1GL3A 1Q0PA 3LQRA 4Q9KA 4QDJA 2HJSA 4KK3A 4LVUA 4IX7A 2F64A 3WNDA 2E82A 1N0VC 2PIDA 1K6MA 1PVEA 4IRIA 4PYMA 1QHNA 4HLQB 1H22A 2FPOA 4KE9A 5FWXA 1DT3A 4DWOA 3P5JA 1NM5C 3EFOB 3OLWA 1MBZA 5LQKA 2GA9A 2C9OA 2OGTA 2Y6UA 4NZZA 2OR3A 3KR2A 2DFIA 2W98A 3W05A 3ZV4A 4BNFA 2NP7A 2K9LA 1WCYA 1CV2A 1C41A 2HEGA 2NT3A 2P2NA 4KFSA 3IPAA 4COKA 2K27A 1YS7A 1U02A 4TKLA 3FHZA 5DWVA 3DWLE 2V1XA 3COYA 4H0CA 1JU3A 2XRZA 2F8TA 3R76A 4F3YA 3K9HA 4O0LA 5JAZA 1KBQA 2BHLA 4GYGA 2YR2A 3UAWA 3BJ6A 2DPMA 3IQFA 2PG3A 2X1LA 1KQ9A 3PB3A 3DL2A 1QS0A 3ECAA 5A4DA 1TQDA 1C9YA 1IDN1 4DG8A 3RW9A 2VP0A 4W1PA 2J5RA 3Q9SA 1H1LA 4DM3A 3O38A 3KVVA 3T99A 4XWGA 2HA4A 5EZYA 1FFWA 3V80A 4ENQA 4V39A 1UFQA 1SKBA 4KWEA 2PGLA 1XTIA 3LNCA 2WAYA 3E23A 4QAJA 2CLHB 5FBQB 5LUBA 2GQ0A 3ICEA 3CZQA 4J2OA 3NHUA 4G36A 2DPYA 2CJFA 4RZQA 3C6MA 3D6JA 4EY3A 5F64A 1FLDA 5ILUA 2RI6A 1VJ0A 3HEBA 3Q3HA 4S1PA 1YE5A 3IP1A 4CM3A 1CZKA 5FYDA 1ACMA 2WAFA 1AURA 6LDHA 1JQEA 3G7NA 4QOEA 2X42A 3V1YA 2IHVA 4B5KA 3K09C 1U3TA 2J0UB 1ORDA 1MW8X 1JZQA 2REBA 5J9FA 2ZTHA 5A9RA 2LIVA 2AC2A 5HJ5A 2PWPA 3TAUA 1T8UA 1JXMA 1N3LA 1DQPA 1CETA 1SIBE 1ZJ5A 1FW8A 2FXVA 3W79A 4QUEA 1W7PB 1YI0A 1EAYA 3RVLA 3V55A 3WGYA 5G3YA 4ZEVA 3R6GA 5JJLA 2JGNA 4WOJA 3B70A 5KSOA 2EWNA 5F4BA 1KWGA 2C92A 3EDOA 4Q34A 5CB4B 2K7LA 4OGFA 4XKVA 1VHQA 3EGVA 1VI5A 5D5QA 5BPIA 3FMPB 4DMRA 4DPKA 3K70B 3OYAA 1FVHA 1NPTO 5AQ1A 4ZVQA 4LRWA 3QMPA 1Z74A 4N18A 3V8RA 4PQRA 2VPIA 2ZS8A 4W9NA 4XX0B 4CYCA 4BCDA 3LBYA 5L4SA 3THYA 4PO9A 4NX2A 3A3YA 2RQPA 3KJHA 4UVHA 3WODF 3TQOA 1UJBA 4NI5A 3K94A 5L3BA 1ZN7A 4PK4A 3ONVA 4JQOA 1QOPB 2HJ9A 2J0VA 1KS9A 4I2OA 2MSKA 2I03A 4DBLC 1YR2A 5HDQA 3ONWA 3DLIA 5FLXZ 2ZTUA 4MO7A 1XRLA 1ZU4A 4X6UA 4CLXA 2P1RA 2C07A 4HFNA 4U7JA 3W4KA 4RLQA 4CF7A 1OXVA 3GFBA 4MITA 3ZN2A 4KDCA 1AA9A 2CZCA 2V7UA 1NI3A 2BEWB 2MC4A 1RAEA 4NFYA 5THXA 3WDMA 2WTUA 2FLVA 1FFGA 2CZQA 4FMCF 4JZKA 5DLPA 4ZT6A 2EV5A 3LKBA 1JKFA 2ASEA 4HAXA 1KQGA 4GZ5A 4J0JA 4COOA 3CTAA 3LL7A 3SBXA 4YYZA 3O83A 5TARA 3NQOA 2ZP1A 3EGXA 4AZVA 3ELUA 3CZMA 2JA7J 5AW4A 3CUSA 1WZ2A 3F6OA 2GNOA 3BS4A 1ISFA 1C29B 2O3SA 3TPZA 1W85A 4ANFA 1E18A 1CS0B 1VKOA 4ILKA 4Q4JB 2GH1A 1ULYA 3A1TA 3SF8B 1P92A 2WVGA 3RAPR 3V8MA 3VMFA 3ZWQA 2Q28A 3ABZA 1HETA 3RPQA 1KK3A 4KQXA 1T8WA 1HH4A 4L08A 3VVLA 5JVDF 1AHDP 2GHQA 2MT9A 1SU6A 1NVMB 5B5EC 4MP3A 1RR6A 3P2MA 2X6YA 3TN7A 1GTZA 2A78A 2Z5FA 5LIPA 4OXIA 4PG6A 5K0CA 1EPUA 1MJFA 4IDFA 2Y0SN 4UPDA 5ALTA 2Z6AA 4W5RA 2ZATA 1MX9A 2X8JB 4LDRA 1LV8A 1JT6A 2JFQA 1G1MA 1HZZC 3GCMA 1UP6A 3FPAA 3P1JA 5EPEA 1P18A 1QSGA 3L04A 1HGXA 3B7PA 1U78A 4ACBA 3L02A 4BTVA 5FWYA 4K05A 3CLOA 3IT1A 5IANA 4DV1B 5U4QA 2HYFA 4IG4A 1N5RA 4IM7A 3D3WB 4WCGA 4DRXB 2VAXA 1P73A 1XLWA 3QJYA 5EZSA 1FQWA 5DLQC 3DOUA 4CCWA 3GP8A 1QPMA 3U7FB 5ER6A 2CXNA 3D7NA 1ONSA 3QLJA 1Z4OA 4RWZA 3IEKA 1GITA 4O2AB 4P1ZA 4PAQA 1TDJA 3WNZA 5HM6A 3CCEI 1E4OA 3D3JA 5CDUA 3DPLC 1YWGO 3T5AA 3KJNA 3IGFA 2A30A 1AQUA 3PUKA 3ZDQA 5EJGA 4Z51A 4H7KA 1TO2E 5AXCA 2HTJA 4XICA 1U0OC 1T8RA 3RF7A 4GXRA 3B6EA 2P75A 3EB9A 3EWSA 4GW3A 4DW8A 4UTOA 3O9VA 3I4LA 2LUOA 2REOA 4WFJA 2PKYX 2YXBA 1BQ3A 3AEUA 1RKQA 3C15C 3L6OO 4MMXB 3OZFA 4Q4HB 3WLMA 5HF8A 1TU3A 4BB6A 5KINB 2E6UX 3W6NA 3ZNPA 1T2AA 5JVGF 2A2ZA 2A92A 2HF9A 3QX9A 4CBVA 2LBPA 1JU9A 3E7LA 1W93A 3KD3A 2IFTA 3L2CA 5LHHA 1YQEA 4REMA 4HAWA 3UK6A 1GFWA 1XR3A 2IXFA 1FX7A 2XQKA 1WHSA 2Q3LA 3Q3IA 3QSGA 1RBQA 3NETA 4I6EA 4LJ9A 2EERA 1ZKDA 3L6CA 4HNQA 4J7AA 2W2VA 4OPMA 4NENA 1OT3A 8ABPA 5AI4A 1FSSA 1E1CB 1GJRA 2ZPUA 1RAAA 2IXEA 5KI6A 3U13A 3GVAA 4IGFA 4XB6B 3KQPA 2QKYA 4JI3B 4TMVA 3VR2D 1R1TA 2PXAA 2RGCA 3EVNA 1XSDA 1JDPA 3DS8A 2AJBA 3P97A 3QLVA 2VXBA 3JTEA 3CHYA 4G6QA 2V79A 4REOA 4PS0A 4ARZB 4B34A 4MV3A 4AC0A 4LNAA 4E5UA 2GJSA 3H11B 2FUG2 3IEIA 3BRWA 3IUJA 1DAHA 2C1XA 3O94A 1UG0A 5FOUA 3COWA 4FLFA 1UMDA 5K3BA 1T3SA 4XPIA 2X6QA 3ZN1A 2QLNA 2CL5A 4MUNA 4ZDIA 3BXZA 4HXFB 4KQCA 3GW2A 5FKJA 3SHVA 1IQ0A 4P96A 1W0JD 3I53A 3HN2A 1AHPA 3PGKA 5AOBA 3FLBA 4WRRA 1RMTA 3MWLA 1GVNB 3H4MA 3H6HA 3QPVA 4FBLA 5FUYA 2QS9A 1WB9A 4Z86A 3MWFA 4KEAA 2H59A 4B3DA 3PTZA 2AX3A 1E1RA 1ODSA 3ANLA 4B17A 2OHXA 1QOZA 2BEVA 2CKDA 2NXEA 4HPXB 3RVDA 2JK1A 3SNHA 1OH5A 1HYQA 1HLFA 2FZWA 4KMMA 2F1OA 1K4TA 4ZZ2A 1QP7A 1NUAA 1NKTA 1JHXA 1YJAA 2MIIA 3AKDA 3DTEA 4OQDA 1ACLA 1BWQA 1NUHA 2PX8A 2C83A 4HS9A 4E07A 2R79A 4J90A 3QX3A 1L5RA 3LZCA 4IYJA 4A2PA 4TLAA 2TMKA 3FXRA 1I1OA 3DBOB 4FHDA 1UFMA 4B81A 1GUDA 4P3YA 3ZGLA 2C9CA 3MERA 1OLTA 3QYEA 1J59A 4LQLA 2XT9A 3RTAA 3U4CA 3UNXA 2XB6A 2ME6A 1CQIB 4PGFA 3VO8A 3FSRA 4CKEA