3H5RA

Crystal structure of e. coli mccb + succinimide
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
348
structure length
340
Chain Sequence
MDYILGRYVKIARYGSGGLVGGGGKEQYVENLVLWENIIKTAYCFITPSSYTAALETANIPEKDFSNCFRFLKENFFIIPGEYNNSTENNRYSRNFLHYQSYGANPVLVQDKLKNAKVVILGCGGIGNHVSVILATSGIGEIILIDNDQIENTNLTRQVLFSEDDVGKNKTEVIKRELLKRNSEISVSEIALNINDYTDLHKVPEADIWVVSADHPFNLINWVNKYCVRANQPYINAGYVNDIAVFGPLYVPGKTGCYECQKVKENIDHKIKLINSRFKPATFAPVNNVAAALCAADVIKFIGKYSEPLSLNKRIGIWSDEIKIHSQNMGRSPVCSVCGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MccB protein
publication title How the MccB bacterial ancestor of ubiquitin E1 initiates biosynthesis of the microcin C7 antibiotic.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/antibiotic
total genus 110
structure length 340
sequence length 348
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00899 ThiF ThiF family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1160 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3h5rA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3h5rA02
1SZJG 4Y8VA 2OOSA 4B8ZA 4IQ0A 2I99A 3WDSA 4ND3A 4DRYA 1UZMA 4CM8A 1SB9A 1ZBQA 1P0CA 2R00A 3HUDA 5JBIA 1HF3A 4L76A 1C0KA 3H7AA 1WZEA 3S2GA 3JQ7A 1DB3A 3BXXA 1VSUA 4RQTA 2DBRA 5IDYA 2G76A 4OXKA 4BGVA 4MPDA 4IMPA 2I3GA 5GY7A 3GF4A 3INGA 4UUPA 2JKVA 4CODB 4ALJA 1LLQA 1R4NA 2FRDA 2FOIA 3GEDA 4NQZA 5K6AC 5JFOA 2IXBA 4U5QA 1PZGA 1SCUA 4GL4A 5EN4A 1LDYA 4FD3A 4E5MA 1FDTA 4NJOA 4YAIA 3DZHA 5IDWA 3EHEA 4RVSA 3JYNA 1LI4A 1YDEA 4XGIA 2YY7A 2J3HA 1ISFA 2ZIZA 1SOVA 2AHRA 4Q3NA 2C2XA 3AUUA 3SLKA 2QZ9A 4XJSA 3RC9A 4MIEA 2V7PA 4MIYA 4HWKA 1WXDA 4EUEA 4CLRA 4UUOA 4IDAA 4JP2A 1GU7A 4KTTE 5L45A 3DL2A 3GG9A 2CZCA 1BW9B 1PR3A 5L9AA 1VE9A 1YL7A 2PH5A 2CMDA 4BNUA 3L6EA 3PEFA 4MINA 1GAEO 3H65A 4EUFA 4WCFA 3HHPA 1LSUA 1V0JA 5DNAA 1VLLA 5JAMA 1N7HA 4N5MA 3I9LA 3Q9NA 1Y9EA 3ZWWA 4FSHA 3HE3A 3TFOA 5CDSA 4G5HA 3W6UA 3L0DA 1YGYA 4OXNA 5C37A 1U7HA 3P19A 2V6BA 4RPLA 3F1KA 1NFFA 3RBXA 3WQRA 2HDHA 1CJCA 2PKRA 1KVUA 2C5AA 4ZQHA 1BGVA 2QW8A 3ON5A 3ZH2A 4PLWA 2YHUA 4QXMA 1M75A 4XYMA 1NYTA 3JYQA 2BMAA 1DC6A 3MZ0A 2DTDA 3JYLA 3UXYA 4BNKA 1GQ2A 3PP8A 4RF2A 3ADPA 5KOIA 5K0ZA 5L4LA 4MKXA 2EKQA 3JQBA 4BNZA 4DC1A 3JQFC 5JCJA 1EK5A 4FFOA 4R3WA 4UUNA 5L7WA 5JY6A 1DIAA 3A28A 4J3FA 5L95A 4FGWA 4DPKA 1GZ4A 1F17A 1SMKA 4RF5A 1TA4A 2FSVA 1YONA 5BNFA 4IGEA 4RGBA 1Q0HA 1RM5A 2ZTUA 3AUAA 2HSDA 2C07A 2WM3A 4U7WA 3OQ6A 5CHEA 3NJ4A 1UJMA 2PZKA 1FMCA 3ZWOA 4CR7A 1CQIA 2RH4A 4PG7A 1FDUA 4YYZA 1DBVO 3ROPA 3K8ZA 1GYPA 5ILOA 1QLJA 4LGVA 4AJOA 4W6ZA 4D42A 1PL6A 4YAGA 3EGOA 1UP4A 1HYHA 3SX2A 2QRJA 1DRWA 1PGOA 5AOVA 1LX6A 2Q1SA 1YBMA 4WLOA 3BMOA 1PJCA 1HDRA 5A05A 4TRNA 1C1DB 4CLEA 1W73A 1MXFA 3PJFA 1ZW1A 5K6AA 1QKIA 2H6EA 5F5NA 4DQUA 4RO0A 2D59A 2IYOA 3NDRA 5IF3A 1P3DA 4EI2A 1UZLA 4HNGA 3CMMA 1LC0A 1ENOA 4I9UA 4JJFA 1HRDA 3HFGA 3RU7A 3U4DA 2I3AA 3OFSA 3RUCA 3IP1A 2JHGA 3WGZA 2HRBA 1HSOA 2I65A 1YQXA 5IDQA 1NVMB 1DFIA 2QYTA 3L9XA 4E2YA 1QYWA 3OHSX 4TQGA 4E2ZA 4R4JA 1Y1PA 5EINA 5JS6A 1PTJA 3K96A 2JHFA 2D0IA 2X4GA 4BB6A 3D3WA 1ZSYA 2Y0DA 5KJEA 3H9QA 2JFFA 4D3DA 4KTVE 4CM9A 3OH8A 1QRRA 2OGUA 3C1AA 1U5AA 1XYGA 3OIGA 4OJNA 3V5NA 1HDXA 4CMCA 2JJYA 5B1YA 4YVFA 4IDFA 3H3JA 2YHIA 5HBRA 1DFGA 2Y1GA 4O5OA 3TRIA 4E4YA 3IP3A 1DRUA 1NBOA 2HQ1A 5FF9A 4CMIA 1AN9A 1UDAA 4J1NA 4NFYA 3L9WA 5DOZA 5T67A 4CUJA 1T2CA 4KUEA 5TLSA 1DIBA 1ISJA 3QVTA 5JE8A 1N9GB 2EW8A 4PLFA 5A1TA 2NU6A 4LVCA 3LYLA 2EF1A 3HDQA 3VPXA 1F14A 4CM5A 3OMLA 2V6GA 2DPGA 2B5WA 1DIRA 1PJ2A 3FRJA 3IDSA 3DBVO 2Y99A 3W8DA 4YAKA 1LRLA 2PGLA 3IL2A 4GBJA 3VPHA 3JQFA 1E92A 4ITUA 4TKMA 2GYYA 5TQVA 1M66A 1GDHA 3PYLA 1MA0A 1JWBB 3NKLA 3L07A 4IDBA 1PJ3A 2PZMA 4DLBA 1QMGA 4HP8A 1P74A 1NP3A 5HS6A 3CE6A 5TT0A 3GT0A 4EJ6A 4E33A 4R3NA 1ZCJA 1C1DA 5IJZA 1GYRA 3VH4A 1IHXA 3U49A 1ZXBA 1ZXLA 3IMFA 2JCVA 1Q7CA 1YRLA 1G6KA 5FI5A 1JKFA 2HU2A 4MKZA 4XIYA 3VZPA 1HLPA 3AI2A 2YYYA 4QEDA 2VWPA 2YV1A 3IAHA 4A26A 4M1QA 1OFGA 1ZIDA 2GR9A 3BTUA 4CUKA 5L53A 3WJ7A 4H3VA 2GASA 4RLHA 5BSHA 3WGIA 1NQTA 2QQ5A 3JQCA 3KBOA 1CYDA 2VT3A 3NV9A 2VYVA 2BFPA 6ADHA 1YL5A 5K9ZA 2RBEA 3I6QA 4NBUA 3SC4A 4JK3A 1U4OA 1PJLA 5A5EA 3GLQA 4OQYA 2PNFA 1I2BA 5H82A 1PGNA 5BSGA 4FOSA 3H2ZA 3ZI0A 3FTNA 3I9OA 3NT5A 4M89A 3QWHA 4R69A 2GGSA 3HDJA 1RPNA 2EJWA 1ZEJA 4CQLA 3MJTA 1XG5A 3H5RA 3GVPA 4J43A 4J2OA 4RF4A 3ZWVA 3TZQA 3QY9A 1DLJA 5BSEA 3EW7A 3H4VA 5IFLA 1GYQA 2Y0CA 3DMYA 4J91A 3ZWMA 1OBFO 2XF8A 1N9GA 4AJNA 3QIVA 3AJRA 5DBFA 4Y6RA 3UH1A 3UUWA 3FR7A 2YW9A 1NFRA 1WAMA 2C82A 3L4SO 1GTMA 3QWAA 1EZ4A 1YB5A 4AJ4A 4IJVA 4J49A 3FHLA 1T2AA 4BV8A 3AFNA 1KVRA 1Z6ZA 5T5QA 2W2LD 3WR5A 3ZU4A 4CJXA 4ND2A 1PQPA 1J6UA 4PLZA 2A92A 4RDIA 3E9NA 3HNPA 5JSFA 1WDMA 5A9RA 1E1MA 3D0OA 3GR6A 1T24A 3WNVA 2ZTLA 4FPXA 3WTCA 3K2BA 5G0WA 5DP1A 3NTOA 5KKCA 2ZTMA 1LSOA 5A9TA 4ALKA 3UF0A 2C2YA 4WASA 4ALNA 3DTYA 1GUFA 4FCCA 3BHJA 1ULSA 4BO6A 1PWXA 4FDAA 4GMFA 4XRRA 3U09A 1CQJA 1NM5A 2B83A 3MJEA 2XPCA 1E3WA 4NBTA 4AJIA 1XDWA 1V9LA 1VJTA 1E6EA 1K0UA 4ZRMA 1IOLA 4FFRA 3C24A 3AFMA 2B4QA 2DUWA 2HAEA 1ULUA 2B4RO 3BYZA 3JQ9C 4JBGA 4WECA 3B70A 1ISMA 4MP8A 4GWKA 3FF4A 4R1SA 5TT1A 4CM7A 1TI7A 5JCJD 3TN7A 2CD9A 3R3SA 1N8KA 2WJPA 2HKIA 3F1LA 3GG2A 4JROA 1ZO8A 3GHYA 4AJHA 4E6PA 1I32A 2W2KB 1EVIA 2VRBA 1ZUD1 4KWHA 3DHYA 1JLLA 1U2GA 4CLDA 1QR6A 4L4XA 5TNXA 2O23A 3ZU5A 1NVTA 2ZJ0A 3U0BA 5L7TA 1LTHR 4B4WA 3QRWA 2P9CA 5G0TA 4J16A 2W4QA 1UUFA 5KTKA 4TZTA 4R01A 1G1AA 1V3VA 1HDOA 4QFCA 4C4OA 1XR3A 4BVAA 1WDLA 3PPIA 4ZD6A 4Z6KA 1Y9AA 5MGBA 2AW5A 4D43A 3X2FA 1BDMA 3HG7A 1MG0A 1FJHA 3N58A 4JNKA 2IYPA 3ENKA 5TC4A 2X0RA 4RF3A 2FP4A 2CDBA 1PJ4A 3PXXA 1GCOA 4GKVA 3AY6A 4E2WA 3GNQA 3DBLA 4XA8A 3V8BA 1NHGA 2JAHA 4URFA 4AJKA 4AFNA 2ZCUA 1ZMOA 1O89A 2I6TA 1YH3A 1LSJA 4NU6A 1UAGA 3FD8A 2IEBA 1G0NA 5CEJA 1EUDA 2QG4A 1FF9A 2NLOA 4OSPA 5U1PA 4PLCA 4ALIA 1QG6A 3VHRA 4CQMB 3PJGA 4FC7A 4RLSA 1PJTA 4QECA 5LDHA 1AHHA 3GDGA 4YJFB 3KB6A 4AJPA 1JW9B 2YDYA 1LC3A 1X7HA 4DMMA 4DIBA 2ZYGA 2FSSA 3RFVA 4BL5A 4CM9D 3UKOA 4IDEA 4BNVA 4J7UA 3OQ1A 4II3A 5B4UA 1T25A 2EIHA 1PS9A 4MVJH 2UVDA 3RROA 4WNCA 4N18A 3U9LA 4NJMA 4FOOA 2DBVO 3HSKA 4RPHA 3S55A 3SBOA 2EERA 3KRTA 3PYMA 4FJ1A 3ONDA 1TEHA 4IQGA 1K89A 4A27A 1PZFA 4BKOA 5IAAA 3ZW8A 3PHIA 3I52A 2AEFA 2DPHA 4DA9A 1LEHA 2ET6A 4BMNA 2ZB7A 3DZGA 4IIUA 2QYSA 2FY8A 3PJEA 1JDJA 3VVCA 4B4OA 5GZ1A 2W2KA 4Q3EA 4R68A 3T4XA 3W1VA 4BNYA 1K2WA 1IY8A 2GZ3A 2WSBA 2EJVA 2HRZA 3Q3CA 1UAYA 5ADHA 4B7XA 5A06A 3LSYA 3U62A 3JQ9A 4TVBA 4G65A 2GZ2A 5DP2A 4ZHSA 2DFDA 3BHIA 3OJEA 1PJBA 3OJ0A 3RBZA 1YL6A 4GX5A 5EL0A 2C7GA 4EJ0A 5ITWA 3MJCA 1V3UA 3RSHA 2I66A 4XQEA 4EW6A 1L7DA 1VSVA 4PLVA 2J5QA 5DULA 1SOWA 1GL3A 1HE5A 4YCAA 3I9NA 3M1LA 3DZJA 5COBA 4I8XA 4YA6A 4XRGA 4AL4A 2NACA 2QHXA 2SCUA 3GAZA 3KHUA 1E5QA 3PLNA 1TB4A 4BO5A 4LK3A 4PCVA 5G4KA 5JAQA 4IJKA 5C3MA 1PQWA 3M1AA 3ZNQA 2W8ZA 5JMPA 1YQGA 4YWJA 4S3MA 4JGBA 4LRTB 5A9SA 1GR0A 2Q1UA 3RUFA 1RKXA 4FN4A 1QV6A 2X7HA 1MLDA 3KXDA 2V65A 4W4TA 4B8WA 5KJ6A 1VL0A 2E48A 3GOHA 4UVGA 1EE9A 5L4SA 3V1YA 3DTTA 3DZKA 4XR9A 1ONOA 3HDYA 1R4MB 3R6DA 4KDEA 3TSCA 3X2EA 4BNIA 4CL3A 4I08A 3WLFA 2GSDA 4J1QA 3DAGA 4PLYA 1UDCA 2GRAA 1NPDA 4BO0A 4CQMA 4D0RA 1R16A 1H6BA 1A9YA 4NIMA 4IJUA 5TGDA 3NX4A 3T4EA 1R12A 4PVDA 1DHRA 1NPYA 2PD6A 2Y1CA 5TIIA 2UUOA 1SO8A 3CKYA 1OOEA 2VRCD 2H9IA 2YQ4A 2DBQA 4I5GA 2VUTA 1KBZA 1BTOA 1F8FA 3BA1A 4DTIA 1PZEA 3IJPA 2TMDA 4R1UA 4YAEA 3LC2O 2JFGA 2Q1TA 2GUGA 3RBVA 3E6AA 1ZFNA 4BO3A 2P9GA 3O03A 1UXKA 1EE2A 2Y1DA 3F3SA 5I7SA 4E13A 1Q2XA 2YJZA 3S2IA 3UOGA 1E3IA 1Y8RB 2ZQZA 4K6CA 5BNIA 2X8LA 4BV9A 4YQZA 2OUIA 4W7IA 2GD1O 3OETA 3OA0A 3GGOA 5TSDA 2AG5A 1P9LA 1ONPA 5G4LA 4ZA2A 4JLWA 3ZW9A 4XDZA 4PZDA 2BFOA 3AI1A 1KEWA 4BO1A 1NFQA 3PHHA 2IEDA 3MTJA 2FZEA 2YZ7A 2X22A 1I8TA 3VTZA 3W4JA 1A5ZA 4W7HA 1FDVA 2G1UA 5DOVA 1E1LA 3A9WA 4WOJA 1D8AA 3IQDB 1B26A 2C20A 2QRLA 4GAEA 4YJDA 3DMTC 3U3XA 5AXAA 1KEUA 1N92A 1WMAA 4RPJA 3ZWAA 4DBZA 2Z1NA 1EBUA 1SAYA 3I6IA 1B0AA 4NBWA 2VWHA 4ZICA 4I5FA 1WZIA 1CIVA 4N5NA 3GGGA 1HKUA 3R3JA 5KJCA 4R9RA 4NBVA 4LSMA 1K5HA 1BG6A 4J1TA 4UEJA 2VHZA 1ISGA 5CP8A 3JQGB 5ENVA 4L4SA 4BIIA 3VAZA 1PEDA 3V1TC 4FS3A 1Z45A 1LLCA 3RFXA 2Y66A 5DZSA 4CLXA 2FPGA 3JQ6A 2J3KA 4DWVA 5I9NA 1E3SA 3FBTA 2EXXA 2WD7B 5KVQA 1XA0A 3GZ4A 1TT7A 1WNTA 1WDKA 3L4BC 1UDBA 4GX1A 4PN3A 2HK9A 5I9LA 1OC4A 4P4LA 4DL9A 5A5FA 5ITVA 4CMHA 3QVOA 3OP4A 3OIFA 4M8SA 4MKRA 3IKTA 5COAA 4ZRNA 3LQFA 2A35A 3DC2A 1X7GA 3KV3O 1R37A 3JD1A 2JFHA 2W2LA 1DFHA 3VTFA 1R0LA 4A2CA 4MVJD 4EGFA 1BMDA 3NUGA 2E4AA 5ICSA 3WGOA 1Y8RA 1I33A 4XQCA 1EVJA 1WP4A 2GERA 1B8UA 1D1TA 4NFSA 3EUWA 1KERA 1VJ1A 1GFSA 5IN5A 2CDAA 1AXGA 3OJFA 4IBOA 3D4NA 3OM9A 4IY1A 4E32A 1O9BA 4OSOA 3GK3A 4XGNA 4AVYA 4YRDA 4MO2A 1Q7GA 3DDNA 3ETDA 3NYWA 4OH1A 3GN1A 3RC2A 3DAFA 1P1KA 3IUPA 4IINA 3WQQA 4Y9DA 5KWEA 4WLUA 2PK3A 4NHEA 2NNLD 1PJQA 3SC6A 3EVNA 3ZNNA 1ID1A 3GVHA 4GSLA 4DYVA 4PG4A 1XIVA 4KDFA 5HWSA 4QX6A 3BHMA 1CRWG 5A04A 4UULA 3AW9A 1UR5A 4TRRA 3BTVA 2X6TA 3WBBA 4XYEA 1RYDA 3RC7A 2DLDA 4PG8A 4RORA 2AQHA 2VQ3A 2DT5A 2X9NA 3NJ8A 5G0VA 1HT0A 5JLAA 3DMTA 3CIFA 3FR8A 3ASUA 4UVEA 1X1TA 4IPTA 1DC4A 1B3BA 2QIOA 3AK4A 4OQZA 5KCZA 2HCTA 1MG5A 2FR8A 5F1PA 3WTBA 2VOEA 2BD0A 3OECA 1O95A 2O3RA 1KETA 2UUPA 3R0IA 4G2NA 1A7KA 1WLYA 4PLPA 4N54A 1E1KA 4JN6B 4N5LA 5CG1A 1H2BA 1K6IA 1NX6A 1T2FA 1NHWA 4A10A 3FPCA 3EYWA 3MOIA 3OEWA 3NTQA 1J4AA 4NZ9A 1LRKA 1C1XB 3NT2A 3JCZA 4IGFA 1ZSVA 1PJSA 1IB6A 3ZU2A 1DLIA 3F4LA 5HA5A 3ICPA 3S1LA 2PZLA 1BW9A 1GEGA 3BAZA 3L4BA 1MGOA 1HDGO 2AQKA 3PWKA 3LC7O 1PSDA 3K92A 2OHXA 2VUUA 2W98A 3ZCXA 2C29D 4K28A 2VOJA 1E1NA 1MUUA 3HZZA 4ND4A 2YV2A 3KYDB 1E7RA 4HNHA 3HN7A 3C85A 1EVYA 3KSDO 2YUTA 4BKPA 1XU9A 4BKRA 3HB5X 4LSWA 2NVUB 3VPFA 4BNFA 2D1YA 3I1JA 3HB4X 3VOSA 4RVUA 2Q49A 2QRKA 3H6KA 3DB2A 5L7YA 3VPGA 4MDHA 4JBIA 4J1SA 3D5TA 1EMDA 1N7GA 3P7MA 3OEYA 3PTZA 3WS7A 5T6BA 1W6UA 5FEUA 3C3XA 2AE1A 2D5CA 1ZKMA 3RJ9A 3JSAA 5TJ9A 1EQUA 3AM4A 1HETA 2X0JA 1JVBA 1OC2A 3DBHB 1I2CA 2O3QA 3UCXA 3LZ6A 3K31A 2AXQA 5CDUA 2VWQA 3C7AA 4P4NA 3V2GA 1A71A 3GVIA 1U4SA 4EBFA 4CQMD 5I9MA 3G3EA 3P2OA 1SEVA 3INRA 3OF2A 5L4NA 3ST7A 1VKOA 1Q7BA 4NU5A 1T2DA 3EMKA 4YT8A 3LLVA 1B3RA 1ZEMA 3CPSA 1LQUA 1LBEA 1BSVA 4B4UA 2NQ8A 4D41A 2RCYA 1EDOA 4Z0PA 5AXDA 4W82A 3EY4A 3ZWBA 2JD1A 2EHDA 5KIAA 5CG2A 4M49A 1FDWA 2CVOA 4OO3A 3CUKA 1GADO 3DFZA 3F9IA 3JYPA 4GX0A 3OJLA 4KZPA 1J5PA 2HJSA 1YKFA 3HN2A 2UAGA 4KQWA 3D4OA 4WNIA 2WE7A 2X9VA 4IM7A 2AQIA 2Z5LA 4CV2A 3F6YA 2IDZA 4IDGA 4CV3A 3S2FA 4JCOA 1JWAB 4RL6A 1BXZA 1O8CA 5ICMA 3TZHA 1ISIA 3D4PA 4IXTA 3SJUA 3GEGA 1C1XA 1I3MA 4BNMA 1U9JA 3B1KA 3E1KA 4XWYA 3PHJA 1GUYA 3FWNA 4JP3A 3KOUA 2Q50A 4K26A 3ITKA 3OJOA 4NK5A 4CV0A 2BH9A 3G49A 3EK2A 4IJWA 3VVBA 3WFIA 1HLDA 4IDCA 4Z3KA 4Z0TA 1TLTA 3EZLA 2RHRA 4KOAA 4GLOA 1IUKA 2JCXA 5L40A 2Q4EA 4CLOB 3KYDA 3FNHA 4YT2A 5GZ6A 2I9PA 1Z82A 3DQPA 4J6FA 2F00A 1Y81A 2NVUA 4FC6A 2UV8A 2J3JA 1HYEA 5BT9A 1V8BA 2O4CA 5LC1A 3OIDA 5JDIC 4XJTA 3I4FA 1YB4A 4YRBA 1F0YA 4MVJP 4W9NC 3K2EA 1IE3A 2Y93A 2HK8A 1Z75A 3RUIA 1E0DA 3NT4A 2VRCA 3LU1A 1XQ6A 5FI3A 1E7SA 3PQDA 4U6SA 4CPDA 2WWRA 1VRWA 1PX0A 1QYXA 4JIGA 3ZHXA 1DIGA 3ETGA 4I5EA 1JN0A 4NMHA 4NPCA 1AHIA 3MCVA 5I7VA 3KYBA 3JQEA 4AJJA 3DBHA 3ROKA 4E5PA 1M67A 2XAAA 5MDHA 1YDWA 1BVRA 1EEHA 3UN1A 5JDCC 4RZHA 5AYVA 3RUHA 2WYUA 3I9JA 4RVFA 2B35A 1GEEA 4RVDA 1W4ZA 1LDMA 3EC7A 4KUHA 2D3TA 3SJ7A 5BR7A 1H9BA 3GAFA 2Y67A 5G2OA 4YXFA 1XU7A 2VZ0A 4B7UA 3ANMA 3GUYA 3UGKA 1ORRA 1BWSA 1EUCA 3PQFA 3GC6A 4YJGB 2IXAA 1LDEA 1U8FO 2O2SA 1E3JA 4XDYA 3SLGA 4ND5A 3WICA 1MFPA 3T7EA 3ABIA 4F45A 1SB8A 8LDHA 1MC5A 2DM6A 2VHVA 1CERA 2Q2WA 3IJRA 2BI8A 3JQAB 5JYEA 2O3SA 4ESOA 1P1HA 2H5LA 5DT9A 4PVCA 5DN9A 5BSFA 3ZN2A 1D1SA 4ZQEA 3ZV4A 1U3VA 3V1UA 2CF6A 2QX7A 1YS4A 3IC5A 1XEAA 3EVTA 3JQ8B 3VDRA 1QYVA 2DC1A 3PFFA 4MVJF 4U6QA 3AU9A 1Q0LA 3WGQA 2E37A 3CZRA 3C8MA 3PYXA 1H6AA 4Z3DA 3E18A 4WEQA 1C0IA 1U7TA 3M6IA 3DFUA 5EQDA 4S1VA 5AXCA 3HADA 2YQ5A 1ARZA 4HFRA 4N7RA 1IPFA 3OSUA 3V2HA 3ZU3A 1NTOA 2CVQA 3JD0A 3LT2A 3PFWO 1UP6A 2YFQA 3FI9A 4XQGA 4I5DA 3OBBA 4H16A 5G0SA 2VCYA 3WYEA 2GDZA 4U8GA 3W8EA 2Y1EA 3Q2KA 1B16A 1GY8A 2EV9A 1ENYA 3D64A 1OMOA 1UXGA 2I76A 5CDTA 4J7XA 3RUAA 1H0KA 1T1RA 1Z74A 3K73O 4L8VA 4RQUA 3S2EA 4EEXA 5B12A 2UDPA 2ZB4A 3MTGA 4JX8A 1R15A 4ONEA 3DXFA 2FHSA 3TL2A 3RASA 1R6DA 5AQ1A 2EKPA 1NQAO 3KM0A 2NU7A 2VYND 2X0NA 1GZ6A 4AJ2A 1X0XA 4ZQGA 3SEFA 3FNGA 5F1KA 5H83A 1HDYA 4MVJA 4J4HA 1E6WA 3ZV5A 4FW8A 5JDIA 3TNLA 3O38A 5CPBA 4B7CA 3PDUA 2HMTA 4W9NA 2XXBA 3GRPA 4J0EA 2Y0EA 5KVCA 3ONEA 2DTXA 1T4BA 1EVZA 2VTEA 2VT2A 1DRVA 4UVIA 3UCEA 5F21A 1IYZA 3HFSA 4OL9A 1FK8A 4EJMA 2PKQO 1YJ8A 4PFJA 4WLNA 4BUCA 1W8DA 2RHCA 3B6ZA 4YJGA 3WOHA 4X54A 3R1IA 5B37A 4M54A 1P33A 2EP5A 3RUDA 5IXYA 5HRUA 4L74A 2DU8A 5JDCA 3Q2IA 1PU2A 2OP1A 3JD3A 2YDXA 1KS9A 1LUAA 2OORA 4I9HA 1J49A 3O8QB 4WGGA 3COSA 3E5RA 4DREA 1VC2A 1N2SA 3CH6A 4AJ1A 1HEUA 1JVSA 4OGWA 5TF4A 3WBFA 3TL3A 5IDXA 4RCVA 3PLRA 4J2HA 4EITA 2OO5A 1U8XX 1EFKA 3PI7A 1Y7TA 2J6IA 5F3RA 4BHTA 3LF2A 1H6DA 5GZ3A 3WX0A 4XYLA 1U3TA 2Q99A 4CV1A 3WMWA 1SC6A 4CMBA 1K6XA 4J4TA 1IZ9A 3ITDA 4R16A 2J8ZA 3M2TA 1LQTA 4HUJA 4Z9XA 2X5KO 2X1HA 4O63O 1J0XO 3K6JA 5A3VA 4GX2A 3WGGA 1AXEA 2XOXA 2FN7A 3L77A 4UVDA 4CMAA 3GVXA 1JAXA 4WEOA 4E5KA 2X9GA 4EYEA 4YT5A 1VKNA 4DBVO 4RV9A 5DCUA 4BMVA 7ADHA 5I7FA 3KETA 4M55A 3Q6IA 2HUNA 1L1FA 5TJHA 1UH5A 5GMOA 3I9MA 4E3ZA 3H8VA 1LLDA 1ZJZA 1HSZA 3ZNPA 1JAYA 3I9KA 4DUPA 4BGUA 4DVJA 2Z1MA 4JXKA 5BNTA 4WLVA 1FDSA 4BKQA 4TSKA 4JJIA 4GGOA 1W0CA 3GFBA 4MP3A 2E82A 2G5CA 4OOFA 1HXHA 3TDKA 4QUKA 1TT5B 1AUPA 2WEKA 3KYCB 3TFQA 5JAZA 1VI2A 1YQDA 1VM6A 1LDNA 1M6WA 5JO9A 2NU8A 1I2ZA 2EEZA 4QFDA 4HV4A 3VPSA 5B4TA 1ADBA 2C54A 3QSGA 1XSEA 3GH3A 3O9ZA 2O3UA 3H9EO 1P0FA 2DUUA 4LRSB 1Z7BA 5TRTA 3NDIA 3WIDA 1M76A 1LXCA 4R5MA 1GQQA 3L6DA 2FPIA 3O8QA 4R9SA 4A73A 2VTDA 4DYDA 4UREA 4GWGA 3QLJA 4CM8B 2VZ8A 5THKA 4BNXA 1E7MA 2VN8A 2JD2A 4Q3AA 1A4UA 3H9JA 2DBZA 2WE8A 3SXPA 1N5DA 2DAPA 3PDJA 2DVMA 2V6FA 1QORA 4YJFA 4CLHA 3RU9A 3U5TA 3CXRA 1I3KA 2CY0A 4C7JA 1S7CA 3EAGA 3JYOA 3ORFA 5THQA 2OP0A 2RIRA 5HS4A 1GD1O 3GN2A 4PRKA 1R4NB 1ZVMA 1YOVB 4YDRA 1ZK4A 3ZWCA 4IZHA 3E9QA 3KO8A 3P5SA 1ENPA 4YR9A 4RDHA 2NUAA 1DDOA 2PWZA 3WIEA 1GCUA 3GFGA 2ZATA 4GMGA 2E49A 3AOGA 1H94A 1XWFA 4NNJA 1FXSA 2F1KA 4IUYA 4BO4A 2EGHA 2ZB8A 1WMBA 2Q2VA 4OKIA 4ZGWA 4TRMA 1EBFA 4WUVA 3TOXA 4ALLA 4F3YA 4DPLA 4CLRB 2JAPA 3WNQA 1QV7A 1NAHA 1X14A 1Z73A 2D8AA 3W4IA 1ADCA 3GHHA 4E2XA 2POQX 5CFZA 4BO7A 1KY5A 4BB5A 1NNUA 2Q45A 1E7QA 3ROQA 4K9DA 1H6CA 3E82A 4IS2A 2PD4A 1I10A 1MP0A 2ZYAA 3I83A 3TJRA 3U4CA 3RAJA 1U3UA 1YVEI 3D5QA 1PS8A 3AUTA 4TVOA 5F1OA 3UHAA 1PZHA 4WCFB 3ZDFA 1R66A 1T26A 1BRMA 1YWGO 3FNFA 2ZB3A 3WYCA 2WTBA 2B0JA 3WFJA 3GPIA 4UAGA 1IZ0A 2Y68A 3W4KA 4WOKA 3E48A 3KYCA 1EQ2A 3F5SA 3CINA 3GGPA 1DC3A 1TXGA 2BGLA 3TQHA 4A0SA 2W90A 4RZIA 1D4FA 2JL1A 3N74A 3GDOA 4BO9A 3GVCA 1D7OA 2LDXA 2VHYA 3GRKA 4D3SA 1KY4A 3UFXA 3ENNA 4KQXA 1P1IA 4DGSA 3NGXA 2NTVA 3QJ5A 2PTGA 2P9EA 5IG2A 2FR1A 3N7UA 4HFMA 4A03A 2J5RA 3KEQA 3DZFA 5I7EA 1HE3A 4TROA 3DBRB 2NADA 2JD0A 3Q0EA 4PLGA 3K9QO 3I4CA 1KEPA 3DHNA 3TOZA 1OZAA 2XXJA 1R4MA 1F8GA 4A7PA 4DC0A 5CEEA 5EJ2A 4O6VA 4OHUA 4B79A 5EQFA 4JBHA 3PRJA 1RM4A 3BMQB 3BMCB 1GPJA 4KMSA 2H1SA 1DAOA 3LK7A 7MDHA 3DAPA 1I5RA 3BZUA 5DF1A 4CM1A 3VZQA 1B15A 2CVZA 4Q3DA 4L73A 4O59O 4BNGA 1DHTA 1ZK2A 1A7AA 1YOVA 4E5YA 1SEPA 4MIOA 3LVFO 4LMRA 2DKNA 4Z9FA 4MVJE 3VZSA 5DCWA 1ML3A 4II2A 1I01A 4FFLA 4PLTA 1HYGA 3AY7A 4FJ2A 2O7SA 2WD8A 4MJLA 4DQVA 2Q2QA 2HMVA 1GV1A 3BMOB 4XCVA 1XGKA 3CSDA 3ZV3A 3DOOA 5EIOA 2P4HX 5EERA 1I3LA 2Y1FA 3C7DB 1P44A 4OAQA 3DO5A 1B8PA 1UP7A 4TKLA 3AOEC 5LDGA 2PY6A 2O4UX 1XHLA 3ROMA 4LVUA 2OL4A 4GLLA 1HDCA 1XLTA 5EESA 5ES3A 2PZJA 4ZQBA 1E5LA 2OBNA 4NDNE 1X0VA 1A9ZA 3VH3A 6LDHA 1DAPA 4BQRA 1X15A 1JKIA 4I9NA 4ZVVA 4D0SA 3AU8A 3CEAA 4OOEA 2AMFA 2Q46A 3IIEA 3JQAD 2PFGA 1LNQA 1H93A 2GF2A 2P91A 3D3WB 3FPLA 3TZCA 3LT4A 2NM0A 3VKUA 3VDQA 4IS3A 3RI3A 4IQ8A 1YB1A 1HZJA 3VH1A 1GZ3A 2O3JA 1I24A 2AA3A 3JQGA 1ZH8A 3G1UA 1MXHA 1YBAA 2VYNA 2YHIB 4BGEA 4D46A 3DBRA 4TZKA 3QHAA 3WXBA 1ZJYA 4NBRA 1BVUA 4J7CA 4Y6PA 4CMIB 3RJ5A 5JW6A 1QP8A 4GVLA 1DO8A 1P1FA 4AJLA 3INTA 1MV8A 1LU9A 2WD7A 4XYBA 3NEPX 4L0QA 3UW3A 3ZWXA 1KOLA 3FBGA 4W99A 1AGNA 1MFZA 3B1FA 3BMCA 3BMQA 3FTPA 2C0CA 2AEMA 4PG6A 4J9UE 4O0LA 3EDMA 2HMWA 1PGQA 3NAQA 1KC1A 3ULKA 1R0SA 1NVGA 3C1OA 4P38A 1CETA 5DDIP 1PL8A 2PKQP 4EZBA 2IZZA 2BF7A 3LT0A 4XIJA 1N1GA 3MWDB 1QYCA 1OAAA 3GMDA 3QW2A 9LDTA 1PQUA 4BKUA 5C7IO 2NTJA 4J90A 1QLHA 3U4IA 2JCYA 4F6CA 1YBVA 1NPTO 2OXIA 1EK6A 4YT4A 3IKVA 1Y5RA 3AWDA 5IN4A 4KUGA 3GZNB 1VJ0A 1Y6JA 3RUEA 3QP9A 4C7KA 1P31A 3QQPA 3D3EA 3Q1LA 3VZRA 5KJ1A 5DCYA 3LT1A 5C7LO 4XGKA 3L6OO 5KJFA 3QVWA 1Y5MA 4MP6A 3WQSB 5G0UA 4FFNA 3TWOA 3OQBA 3M2PA 3FCOA 4RVHA 4J0FA 2GPTA 3ZNOA 3GY0A 3MJSA 3WMXA 1A72A 3JTMA 4CM3A 2Q4BA 2P68A 3Q9UA 4BNHA 1L7EA 2WYWA 4LN1A 3GDFA 1DSSG 4DQXA 3UCFA 4LMPA 3IOYA 2VUSA 3GPDG 3ZHZA 3KLPX 4D45A 1H9AA 3WGTA 1QXSA 1Y8QB 2X58A 1R0KA 3W8FA 3ZGYA 1V35A 4K6FA 4YAJA 1O94A 3A1NA 3I3OA 3AOEA 4GH5A 4DIFA 5F5LA 2X86A 1UXHA 1O0SA 1K3TA 4TMFA 4TWRA 1F12A 5TX7A 3CZMA 1DPGA 4CL8A 4H7PA 5CAEA 5JC1A 1HL3A 4QTZA 2CF5A 3E9MA 2DTEA 4QT0A 4YBZA 4CQLB 5A4DA 1U5CA 2OMEA 4HADA 4F6LA 4KWIA 2CFCA 2Z95A 4YACA 1BXKA 4EEZA 5JMWA 4PZCA 5U9CA 2UYYA 4Y6SA 4Q39A 5T57A 2ILTA 5L51A 4GGPA 3H9GA 1WWKA 1QYDA 2DQ4A 3PHGA 3D1LA 3QV1A 1RWBA 1LJ8A 2BKAA 4PRLA 1WPQA 4YRAA 1LDBA 1X7DA 1DXYA 1C0LA 2HLPA 3ZHBA 4DLLA 3RKRA 4RJTA 4CM4B 1GV0A 3A4VA 4L75A 3STHA 3E5MA 4KP7A 3OICA 4CUZA 3RKUA 4G81A 3GZNA 3ZWNA 3HWRA 1NAIA 2R6JA 1NWCA 4M86A 5JO0A 4B3JA 3NGLA 3DHEA 3PZBA 2EP7A 2O7QA 4IXWA 4JJGA 3WLEA 2Q3EA 2X5JO 4HKTA 1BXGB 1YJQA 3DONA 5ER9A 4PIVA 5KVSA 1ADGA 2GO1A 3FNEA 1EUZA 3PGJA 4NFHA 4BGIA 1E3WB 3ICCA 4XB1A 3UICA 4XX0A 4JQCA 3NRCA 4NK4A 1B2LA 1VL6A 3OA2A 2BFAA 3BTOA 2PLAA 2D2IA 1CEQA 4AJEA 2PGDA 1ZZEA 3LLSA 2H63A 2VWGA 2VNSA 2NVWA 4LISA 4BNTA 4WJZA 5U4QA 2AQ8A 1PWZA 4D79A 3ANNA 1AE1A 4WCDA 2VHXA 3RCBA 2PD3A 2BI7A 2FR0A 5JPIA 4B3HA 4EDFA 5JY1A 1KC3A 1XELA 1Y8QA 1YE3A 2NQTA 1KIFA 4WPGA 1KVQA 3ZZNA 4M87A 5BQFA 4FJ0A 1EFLA 1V3TA 1T2EA 2B69A 4Q3BA 3SVTA 4CR8A 4GPD1 2BRUA 1HDZA 4YB8A 3PIIA 1UXJA 3WWYA 5CDYA 3F47A 5I8WA 3QVXA 3AM3A 3WSWA 3F5QA 5CEFA 4OYRA 2GZ1A 1B7GO 4GSKA 4R41A 5JNLA 4TRJA 3QA9A 4R1NA 4A5OA 3T7CA 4DPMA 3EZYA 1K6JA 3CMCO 3MEQA 4FBGA 1C3VA 5L3ZA 3H5AA 2QZZA 3I5MA 3H2SA 2HJRA 3G17A 2TMGA 1JQBA 2A9FA 3RWBA 5I8ZA 4GQAA 5IZCC 2VNAA 2PH3A 4ID9A 3WWZA 1ZK1A 1TVEA 4ZU3A 2G82A 4QO7A 3W6ZA 4Z0HO 2GN8A 4PG5A 1B14A 3E03A 4BNLA 4CMEC 1X13A 2DFVA 3D7LA 1HE4A 1Q1NA 1V6AA 4CM4A 3DR3A 3H5NA 1I30A 4OMUA 3DBLB 3PWSA 1VL8A 3JQDA 1SPXA 2O2YA 5B4VA 4P8RA 3FSRA 1F06A 3B1JA 3F46A 5KKAA 3DZBA 3K30A 4NI5A 1E3EA 1CDOA 2D4AA 3DZIA 4XKJA 4CMKA 3LF1A 2GN6A 1U3WA 1B8VA 1CWUA 1I0ZA 4BNNA 4CLOA 4NG5A 4YPOA 2OBYA 2FWMX 3HDHA 3S8MA 2X5OA 4DXHA 4BNWA 1PIWA 3RC1A 2FPPA 1BXGA 1JTVA 5ER6A 3BMNB 2A94A 5TS3A 2NV6A 2CSUA 3UAGA 3KZVA 3GA0A 4BO2A 3V2UA 4BNJA 1HZZA 1Q0QA 3A14A 1E7YA 3RD5A 5HTOA 3HQ4O 4PGFA 4YJHB 1ONNA 3GQVA 3QWIA 2PV7A 5ENDA 2FZWA 2X0IA 3WJAA 4B4VA 3JD2A 3DWFA 1I36A 4FR5A 4Q9NA 3NTRA 2BELA 4NJMB 1JKJA 3U4HA 4BMSA 2V6MA 5A03A 4IZIA 5COQA 1M2WA 3E8XA 3G1TA 1LSSA 3GUCA 1BHSA 4ND1A 3PJDA 3GMSA 4ILKA 4MVJM 1U2DA 5AVOA 2BGKA 3WG9A 3MJ4A 3WGYA 1T4DA 4CMJA 3K5PA 4ZJUA 2BLLA 2ZJ1A 4XQ9A 1S6YA 5T8KC 4HFNA 3RQSA 3WYBA 4HFJA 2BHLA 3NDJA 1WVGA 3ZV6A 2NSDA 1HWYA 2EGGA 4HX5A 3JD4A 2IRWA 4UVHA 2O3TA 4GI2A 3KTDA 4J9VA 4YTEA 5T64A 3TZKA 4DIOA 3LC1O 1DIHA 4BS9A 3TPCA 1MB4A 2J5KA 4E31A 2ZKLA 4HXYA 4CR6A 1UZNA 3FWZA 4BOYA 2G0TA 2PR2A 5AXBA 1PGJA 4IDDA 1YXMA 3JQAA 4EUHA 2IODA 4P4GA 5JAIA 5G4KB 4FB5A 2EWMA 3QWBA 5JYDA 1SNYA 1XKQA 3I23A 2ZYDA 3PVZA 5EMHA 1E3LA 1KVSA 2J3IA 4CM6A 1RJWA 5A9SB 4MOWA 4PLHA 2O50A 3CTMA 4R5HA 1LDGA 4BQPA 3JQ8A 2YV3A 3C7CB 4INAA 1WW8A 4FIZA 2HMSA 4NH4A 4D3FA 5JCXA 1NQOA 4LCEA 1VPDA 1YO6A 4OM8A 4YQYA 4XD2A 4E5NA 3DOJA 3PWZA 2G17A 1UXIA 4QQRA 5CPFA 4U0KA 3ETEA 4RPKA 5IZCA 2EG9A 4CMGA 1G0OA 2IZ1A 2BGMA 4XYGA 4WKGA 5FYDA 1LRJA 4H15A 2WDZA 4CMEA 4GKBA 4MVJG 3TZ6A 3TF5A 4IIVA 4ZN6A 3BMNA 2P2SA 3DEYX 1DC5A 4L4RA 3AUSA 4ROSA 1ZK3A 4YJHA 2ZTVA 5HM8A 1BDBA 4I1IA 3H9UA 3IUSA 1P77A 4WE3A 2OZPA 4AICA 1C14A 3G0OA 5KNLA 5LCXA 4XR4A 5C7OO 4F46A 4GVXA 4UEOA 2B5VA 2EKLA 3WSVA 2D5AA 2WMDA 4OXYA 2A4KA 1E6UA 2HMUA 3WGHA 5FFFA 1PR9A 3KUXA 4QO8A 5DBIA 4FQ8A 4U0JA 2GNAA 1P1RA 4QSMA 4E0BA 1GPDG 4OIMA 1P45A 2ZCVA 3GNTA 4ALMA 1JU9A 1NR1A 2B4TO 3DOCA 4ZQFA 5FWNA 3RVDA 1U28A 1IHYA 1HE2A 3RIHA 2B36A 1M6HA 2E6UX 4XEHA 2R00C 4B3IA 3PK0A 2PA3A 3FN4A 3ZWPA 4WLEA 1NWHA 4E30A 5A02A 4R54A 3VH2A 1NXQA 1H5QA 1ZMTA 1N1EA 2FMUA 3C1TA 3RFTA 1ZK0A 5C5IA 2VHWA 2GN4A 1O6ZA 3KSUA 4HY3A 1NQ5A 3VC7A 5IXSA 1A27A 4Q3CA 5A3JA 1ZSNA 2YFHA 1DJQA 2HO5A 1PL7A 4UUMA 4XB2A 5ILGA 8ADHA 2P4QA 1LA2A 2C7VA 2BFMA 2P5UA 3ADOA 1LLUA 5T8KA 2AE2A 1XQ1A 1DOHA 4WK6A 2OFPA 1CF2O 2Q1WA 1ISHA 4FFPA 4YEDA 4OKNA 4FGSA 1D3AA 3Q11A 3MOGA 1RM3A 3JQ7B 4BO8A 3BIOA 3P2YA 1RYEA 1DEHA 5H81A 2C5EA 3B20A 1I3NA 2VZ9A 1GQYA 3BTSA 2AG8A 4E21A 4IMRA 4J4BA 2C59A 3H3FA 2HK7A 4Z9YA 1ENZA 4NR0A 1ADFA 1IPEA 1U1IA 1IULA 4P22A 4AG3A 1MC4A 3F4BA 4Y98A 2I5PO 3KVOA 5JXWA 5EPOA 4WLFA 3ZHYA 3MJVA 1P1JA 3PGXA 4RVGA 4K1LA 2CDCA 3AY3A 2VYVD 2CUKA 1KYQA 4L9RA 2NVBA 3QVSA 4DLAA 3MWEB 4LCJA 2GLXA 2O48X 5J23A 1X1EA 3GNSA 2ZQYA 3LDHA 4RPGA 1C0PA 3ANLA 1DJNA 4WCFC 3HJAA 2IE0A 2X23A 1KVTA 5CDGA 4MVJI 5JC8A 1QSGA 2Y1OA 3O26A 3PQEA 4HBGA 4E12A 2NU9A 1RM0A 4Y67A 1ZNQO 3IS3A 3WB9A 1O5IA 2R2GA 4O1MA 1E77A 4UEKA 4D7AA 1XCBA 4LW8A 2B37A 1OI7A 2ZK7A 5DBGA 3GEMA 2EW2A 1KEVA 2PGJA 2NWQA 1EDZA 1NR7A 5IZ4A 3PHLA 1T1SA 4R51A 2IZ0A 3ASVA 3A06A 3KSZO 3ONFA 1A4IA 2I67A 2CNBA 3JV7A 3PIDA 5KVVA 2Y05A 4D44A 2RH8A 1TT5A 1H2HA 3O4RA 3AI3A 2LDBA 4R1TA 3JQBC 4FFMA 2GCGA 9LDBA 3UVEA 2AEJA 2NTNA 3KLMX 1IL0A 1PS0A 3AM5A 3PZRA 3VKVA 1JA9A 1GUZA 2GN9A 3G79A 3QWFA 1HTBA 4DMLA 2P5YA 1PGPA 1SBYA 4XZ3A 1Z7EA 2WYVA 1E7WA 1MX3A 3QE3A 4PZEA 3KEOA 3ZWYA 2RAFA 1NASA
chains in the Genus database with same CATH superfamily
2P75A 1AU7A 1UOQA 3HUDA 1Z5VA 4L16A 1A1SA 2H52A 5EJ7A 3TNDA 3I71A 2XRNA 1G8HA 4B6PA 3BXFA 1XV5A 5CM2Z 5FRMA 2OBPA 4B6JA 3EXAA 3N3BC 8ATCA 2C4MA 4FNAA 4R7ZA 4GPTA 2AFIA 1TTHA 4Q02A 2YY7A 3AONB 4MNTA 3SLKA 2DUJA 2GQQA 1B6RA 4EUEA 4CLRA 2JC3A 3EQZA 3DL2A 4EF6A 4IG4A 3MBIA 1ZYUA 4PY2A 5BW6B 3I9LA 3QYPA 1JEDA 4OLBA 3AI7A 4A3JJ 2HDHA 1R5ID 1G4UR 4D6PA 1M75A 3HSSA 3G3ZA 4A2WA 3EBOA 4L0YB 4G3XA 3U40A 3OL4A 1MQ9A 5L4LA 4BNZA 3C41J 2GFHA 4LV5B 3TAUA 3RIYA 4FI3C 3BD7A 5BNFA 2NRAC 1GU1A 2V0NA 3A3NA 1UJMA 3FCSB 3FNRA 2X2OA 1QDEA 3U37A 2QENA 1KYTA 3KPJA 2WTNA 2QRJA 4HZFA 3I30X 2D0PB 2BONA 2ZYRA 3LCMA 5EVJA 5SICE 4F60A 3IPCA 1VG9B 5AVVA 1Z4LA 3TM5A 5H16A 3FDZA 5KINB 3AJEA 2PQMA 3L9XA 1PTJA 4O8CA 3VSBA 2X4GA 4M6XA 3RO7A 2QRHA 2Y0DA 5EHGA 1SWVA 3UG7A 2RIPA 4OJNA 3V5NA 1RYNA 2D8MA 1F2TA 3PQCA 3T3IA 1O5TA 3VHXB 4MUEA 4E94A 5FF9A 4NFYA 4BIMA 5DOZA 4KUEA 1HT1E 3HSEA 2Q4RA 4I3HA 3AHIA 3HDQA 5EMMA 2G9WA 1SPBS 2R7DA 4JJ7A 1PJ2A 3T94A 5AIQA 4NV0A 1DKNA 3X0DA 3IQHX 4TKMA 3B9BA 1GKLA 2VA9A 4TT3D 1ODCA 1J2UA 2HADA 3QYFA 4FEAA 3WMFA 2YVLA 1X7YA 4UQLA 3OU7A 3ZCPA 4AZVA 1A2KC 2A33A 2MBFA 1ML4A 3JZFA 3W77A 3BTUA 2WVJA 5BSHA 1CF9A 5FNZA 4MDEA 3CCMI 2DT7B 2YVAA 3KQMA 1AKWA 3I6QA 2ODNA 2QI9F 4XSHA 3AF3A 1NW5A 1CC1S 3TOCA 2E4VA 5G1OA 4NPHA 4CQLA 3VHXA 3L1VA 1EK0A 4MYDA 5LXTB 2XRFA 1CE8B 1JIQA 1G4AE 1YK0A 2ZETA 3UWMA 4XN0A 2C82A 5ALNA 3QWAA 1EZ4A 4ROTA 4FE3A 4AJ4A 3H4IA 1QVRA 4PONA 4DCNA 3ZJVA 1SAXA 2XUZA 4ND2A 1G1MA 2QSJA 3G82C 3GFVA 1S5LC 2ZI3A 3J81K 3KZOA 4PWZA 4DEXA 1Z17A 3X1YA 4OFXA 2C2YA 1NM5A 1WB9A 2VAXA 4AJIA 1E5TA 3PNBA 2B4QA 2HAEA 4GRIA 3AO0B 3UV3A 2VKTA 4F38A 3SYLA 1KF0A 2LMDA 3KYIB 5B1BH 4RAZA 2OHGA 4X5OA 1HTTA 1DXHA 3GYBA 1SUAA 4KNWA 2ZJ0A 3SIRA 5KPDA 4R2HA 2WQZA 2ZE5A 2IYLD 2QRNA 1H2RS 1CE8A 2VJ4A 4IWXA 4ZALA 1V3VA 4I4NA 1QVAA 5DJ5A 3V8VA 3VU0A 1RPTA 1KTVA 3ESWB 1KQ9A 5T3UA 2JAHA 3KZKA 2ZCUA 3GPLA 3VNQA 4CKWB 2QSUA 1KI3A 4XX1A 5D51S 3OC0A 4AU1A 1KH1A 5BR1A 3C6QA 3EVBA 4MVJH 2IXDA 2EZHA 2FMKA 5L3CA 3ZWKA 4EELA 3M9AA 1T1EA 3QPDA 5HNHA 5BRAA 2AEFA 1M6VA 3R6LA 2ZB7A 2WIJA 2QYSA 1EG7A 3T4XA 4BNYA 3LXRA 3BHIA 4JEUA 3S1QJ 1YL6A 4X63A 5JS7A 1Q77A 2APJA 3V2IA 2GOXB 3J7AY 1VSVA 2J5QA 3B3AA 5DNYB 1PQ4A 4MEBA 3PBKA 4EX6A 1E5QA 3ABQB 2GWRA 4Q3OA 3DKRA 2JJMA 2IRFG 3WMEA 3OURA 4HB3A 3JSPA 1FYVA 2QV7A 1XO1A 2W58A 1N8TA 4CKWA 3V8LA 1AKUA 3IEXA 3K6SB 3H8WA 2ZPTX 1XDDA 3MLEA 3CUEF 2QT0A 1SIUA 1RWOA 2D54A 5UKDA 3E23A 3BA1A 1NBIA 4ZYWA 4BO3A 1XCJA 5KDLA 3MSCA 3CVVA 2C8JA 1A7UA 1VBMA 1NF3A 3LZDA 5IM5A 2AG5A 2GHIA 3CP8A 2PSSA 3AI1A 1KEWA 4FYMA 2XF7A 2W0SA 1A5ZA 3FHZA 3LJKA 3DCFA 4UUVA 4GOND 3THOA 3OOHA 1KZ9A 3LMKA 1A50B 5FOVA 3WLNA 3LPCA 1JGTA 4OGLA 4PNZA 4EPRA 5ENVA 4P5OA 4PJMA 2NS7A 1JUDA 3VM6A 2MD5A 1LLCA 1U0NA 4JI1B 3U44B 1CUXA 5BMVF 1XAIA 3FOWA 3K6SA 2GCEA 1Z8FA 4DL9A 1K5PA 3MA0A 1JHXA 5FWAA 1ZVKA 3O75A 3HU2A 3B1VA 3UG6A 3U56A 2E21A 1JI3A 2OYRA 1GZ7A 1SXHA 4M7RA 3T7AA 5ALXA 5J4VA 3JVUA 1GFSA 2VE9A 1VL1A 1Y7PA 3FOCA 3U16A 3MFQA 5BV0A 5IKPA 1IN4A 4O4LA 4IINA 1LV7A 1IDYA 5A2QA 5KNBD 2OSBA 1S2GA 4XCXA 2HV8A 5HFJA 3A1WA 2DKOA 5TARA 1TMYA 1UR5A 1A3CA 4F1KA 2X6TA 3K4KA 3I04M 4QPQA 4WY8A 1WVRA 3CDLA 1FDRA 2XIJA 1FMVA 3UUFA 4BC1A 4G4SO 1EA5A 3QY0A 1R0XA 1KGDA 1ETQA 3DO6A 1TUBA 3U44A 4JBAA 3T9CA 1QIJA 2W7TA 4QXOA 3FPJA 1Q50A 1XTRA 4A10A 3FPCA 5KQSA 5DKFA 3U5ZB 4IGFA 1DLIA 4LOCA 3OAAD 3ZDEA 3M1CA 5IT0A 1E1NA 4RAGA 1K3UB 4RE6A 1LBIA 4WZ6A 3PNPA 2BHSA 3QAHA 5L7YA 3VPGA 3ICEA 3OY9A 4J1SA 5C5CA 3BF7A 1UPTA 3E3LA 4YV0A 2DH6A 4UU1A 5DV5A 2O3QA 1AM4D 4XH9B 1SUCA 5CIQA 3BCAA 1JJ7A 4UCXA 3G3EA 5JCOA 1RKTA 1FTSA 1NBHA 2FXVA 4CN9A 2C2WA 3UQYS 3EY4A 2J5BA 2WJIA 4NCNA 3DD5A 3PD7A 2OHOA 4WNIA 3I59B 1KZGB 1NBMA 5FD6A 3GBVA 3UJ8A 3FWNA 1II8B 3KOUA 3MTIA 1WS6A 2QR3A 3MJFA 1U9YA 3Q7QA 3T99A 3LA2A 1KAEA 1P39A 5DT2A 4ZEMA 1TW3A 4XLCA 3R7FA 3L4EA 4D4GA 3DEEA 4I7EA 4L85A 4BLOA 3HNRA 4NB5A 4PCAA 2CQKA 3UV7A 5K1ZA 4YIHA 5AKEA 3AFGA 1S7AA 1T1GA 1WCMJ 3JQEA 4PJLA 2QP3A 4E5PA 1PFWA 1RWVA 3GJSA 1EEHA 1NZFA 4L0ZB 3TMKA 1WMFA 1PVVA 2D3TA 5IT3A 2SKEA 3TI9A 4EI9A 2ZRJA 4CHTA 1ZD2P 5CTAA 4AF8A 5IH7A 1JDBB 2NO0A 1RMTA 5AK0A 3T7EA 1RWXA 8LDHA 1CERA 1RC8A 3OIQA 4A0HA 4ZQEA 4EMBA 1GGVA 3V8MA 2N1MA 4MAFA 5IF9A 3K72B 4BKMA 3AU9A 1II8A 1PK8A 3UBMA 4Z3DA 1C0IA 2VPWA 3LOUA 4AYWA 4PC1A 1P4GA 3CG4A 4DSTA 4M1ZA 4XQGA 5G0SA 4O25A 4U8GA 5JPDA 5J5VA 3FPSA 3NEAA 1MEOA 5LRRA 3U9SA 5B12A 3E7XA 3A6PC 2CCJA 5K7ZA 4QLBA 1W46A 5KSPA 1VBNA 1KK0A 5F1KA 4GYWA 4HLUA 1YE8A 4J4HA 4R31A 4GVPA 5JDIA 2QMYA 5IJAA 3OZTA 4J0EA 2Y9PB 3GXOA 2Y0EA 3J7ZI 2QVZX 5GJWC 3HYCA 4Y1RB 5F21A 1TO1E 1IYZA 3ZLUA 1OXTA 1G8FA 2I4IA 2GCIA 4JR1A 3LX5A 5IXYA 1ODJA 4DQ2A 5JDCA 3LQ2A 2OORA 1TIBA 3MMYB 4KH1A 3R61A 1Y82A 3PNTA 1VIDA 1JVSA 2FZ4A 4WXPA 1YK1A 2F9FA 4PZAA 2VPPA 2PZGA 1HV8A 4KPYA 1RBZA 4Y18A 3TTTA 1VHWA 1ZKGA 1JI8A 4U3JB 4C4YA 1NG6A 1MHTA 2YU9J 3FCXA 1VE3A 2CO5A 1VLMA 2I4RA 2W4MA 2CKMA 2B92A 1YGPA 5I7FA 1B00A 4E3ZA 3TEMA 3RRBA 1BCRA 4M6WB 2OBLA 2C3YA 1WXHA 1EHCA 4N39A 3NASA 5I4CA 3CVJA 3FSGD 4OBWA 3IHKA 2ZIUB 4ED9A 2C54A 4ASUD 1K79A 1JFTA 4UUBA 3C1UA 3WFZA 4G85A 1K92A 2RKBA 2NN3C 1PG5A 3WIDA 2VPYA 1U5BA 2QVYX 2VTDA 3F6BX 1O7LA 3FCYA 2VDVE 1QTRA 3U5TA 1I3KA 4DM3A 3ORFA 1X70A 2JA1A 4UD6A 1ZVMA 5P21A 1ZD4A 3E9QA 1CF4A 4U3JA 5LHHA 4RSMA 1ILWA 4OK6A 3UGJA 1PJZA 3E8MA 4IUYA 2Q2VA 4ZGWA 4IRIA 4WUVA 4ZMSA 1BJRE 2K85A 5E1XA 1OSNA 1ADCA 3H16A 2QQBA 2POQX 3NOOA 1Z0KA 1KWGA 4B81A 2ZUBA 2X4LA 2Y6VA 5AJVB 4US0R 4KT6A 4YFNF 2VJKA 3M6AA 1A2QA 3W2WA 2FHPA 4XLAA 1I7NA 4I9FA 3B52X 4CDMA 3JR3A 1FSZA 3TG2A 3ENNA 1L7AA 5H9VA 5E95A 4BX0A 4A03A 2G0NA 4EJUA 4R1MA 4PICA 2EDAA 4NWIA 4IV8A 4A7PA 3GW8A 3QYJA 2E5ZA 1SHUX 4ZYUA 1UBHS 4U0VA 4YMWA 2MWMA 2R62A 4CCYA 4IMJB 1O6CA 2E6KA 5C8XA 3KQKA 5K0JA 5B1HA 5ALVA 4O59O 3G0IA 3DTEA 2VJPA 4AYXA 1XKTA 1Y1TA 1UDXA 4RY8A 2Y2UA 3UH0A 5EI5A 3IQWA 2AR0A 3HMQA 5DI9A 2M6LA 2J48A 4E07A 2CYYA 2BKVA 1K6OA 1UCRA 4W9MC 2MYPA 2XUQA 2AN3A 3R23A 2AIRA 4NC6A 3GGJA 3AVVA 3S2ZA 4YI5A 4OOEA 4IUBS 4LBVA 4Z9AA 3TZCA 4EHKA 1BCSB 3TW8B 1GZ3A 2QD5A 4L9JA 2FF5A 5LIPA 1IBKB 3ZGKA 5ALPA 5K3SA 2W2OA 2JFUA 3I8OA 1EX9A 4QOSA 3UW3A 1C0EA 4QTXA 1EFVB 3FGNA 3SZLA 3D7KA 2G28A 3EZFA 4KVFA 4MTLA 5F23A 5FA8A 5BN5B 5FFMA 3GJQA 5FBWB 3FCEA 3VZDA 4GMKA 3F6SA 1WX1A 5IY5H 4CYMA 2PXCA 5JXJA 3EQ7A 4RHTA 1S0UA 3MJSA 1Z5PA 3WMXA 1WPGA 3AJDA 2WYWA 2MH2A 4ARVA 2YSRA 4D97A 3ZHZA 2DUNA 4PSKA 4CE6A 1S7EA 2AD1A 3TW8A 2O54A 1ZN7A 1EJBA 2DHQA 2Y76A 4H3KB 2F5VA 2OMEA 2PSDA 2PMFA 2QJWA 4PZCA 2IEKA 4FWTA 5EKXA 2AEEA 3UWKA 2MSKA 1H5NA 1USGA 5IC6A 1E2DA 2GCNA 1QIHA 4YN3A 2BYTA 3CKMA 3OI7A 3BQ9A 1M2HA 3Q3GE 1PNQA 3BWMA 3ZZ0A 2O7QA 3NHYA 3UJPA 4HLUC 4TV7A 5EHQA 4YREA 4BGIA 4WN9A 2PV0A 3OA2A 1BQEA 5U4QA 1ZH5A 2QNBA 2LLKA 4WZAB 2ZANA 4E7PA 5DM70 8GPBA 2P6NA 4UFPA 3C18A 4QYMA 3VHLB 1JDBC 2QW1A 3TNYA 2JFPA 5FWYA 2C78A 5G3ZA 1SBHA 4QOGA 3NALA 3GCDA 3OPVA 3QQ5A 1AMNA 1K6MA 5CYPA 3KP3A 3L0PA 3MCTA 2Q3DA 4BN5A 3OYMA 2QR2A 3BL5A 1TWAJ 2UYOA 3W6ZA 1LJ9A 4ZYEA 5BQPA 1HE4A 1BYUA 2WA0A 1H0RA 2YWRA 1V8ZA 1MH1A 4CF3A 3GJZA 2LH9A 2YXNA 3BWDD 3VNRA 3DZBA 2XJ4A 3CIOA 4N0EA 4AULA 1VG0B 1L5ZA 3VO2A 4C7XA 4DXHA 1H42A 4MJXA 2ONJA 1XEWX 1EVKA 4P9FA 4P81A 3KOXA 3MTDA 3NHMA 1W36B 1JIVA 2H85A 4ZOLF 3GBGA 4PWYA 1PDNC 4WZAA 4ZO9A 3BCHA 3HVRA 1UKEA 2CLDX 4UU0A 3AB3A 3AF1A 1Z6QA 2ZBVA 3EAQA 3VX4A 4DEVA 3H0CA 3H5VA 1FP4B 3JREA 5SZHB 1Y1KE 3PDCA 4UHDA 3OIVA 3EA0A 2YJTD 2VQSA 3JQAA 2H1VA 4FB5A 3I6MA 1LV8A 5HP4A 3PVZA 3VPBA 1WRBA 3JXEA 4LXQA 4BQPA 2OY0A 4INAA 1SUPA 2DJ5A 2EGUA 3PWZA 4NP6A 3FOFC 3PDWA 4LMAA 4CMGA 4E70A 2CXUA 1EFTA 3KD3A 2ALJA 4QQ8A 3K8QA 2ODTX 1QQAA 4MVJG 1YIOA 4HDKB 1AGXA 1QAQA 3Q7TA 2C5FA 3UT6A 1FNNA 2OBFA 4ADSG 4DYHA 2UKDA 2ZJQF 1YR6A 3WSVA 3MD9A 2JJ2D 1XZJA 3ZY6A 1GRQA 4YMVA 4ZQFA 3LRPA 2P0AA 3GROA 4WLEA 4R54A 2VSNA 1ZK0A 4URHA 5F7XA 1SMTA 4Q3CA 2ECOA 1HOXA 1R9GA 3VU1A 1IXZA 2OFPA 4LJAA 4MA4A 1KI2A 1JDPA 3BT9A 2WWTA 3DEUA 3Q11A 2WJYA 4JLJA 1OE0A 3JWEA 3HL4A 5AKIA 4O2LA 4IMRA 4UNNA 1H9TA 4Q12A 4G7ZF 1ZJWA 1IULA 4P22A 3KOZA 1QGYA 3KVNA 3WGNA 3MJVA 4HGQA 4IEFB 1J42A 3RYRA 4LCJA 3PIOF 3AUFA 4HDKA 1EG2A 1SHZA 2IE0A 3OKFA 5L3EA 4QFBA 5FNVA 1E1CA 2D45A 1PYOA 3IS3A 1GN9A 4QOFA 3PGVA 1IBLB 1ZESA 2PN6A 2RHOA 3FCCA 4XFJA 2VSFA 1VSBA 2FUNB 3SVLA 1XZDA 1D9ZA 3O4RA 5HLTA 4ZXFA 4PFPA 5IP6A 1PS0A 5EXEA 2JFQA 1YMUA 1XCPA 3I28A 4BDTA 2JNWA 2RAFA 4JGGA 5JYCA 2WIBA 5LZ7A 3PKIA 3DWEX 4X00A 4CM8A 1SB9A 1P0CA 5JD4A 1C0KA 3TW6A 4Z4HA 2V1XA 3MWGA 4QXPA 4A6XA 4DCCA 1DQRA 2P3QA 2E4YA 4OXKA 3UV6A 3ND6A 2Q3JA 2FMXA 1TCBA 1ZARA 4UHTA 3N70A 4GL4A 2IGKA 3FK7A 4IDNA 2WWIA 2HEOA 1IBSA 2AHRA 5I9IA 3PC3A 1UC4B 2J3DA 3FUCA 4JQSA 2IK8A 3S2WA 2IYTA 1XL1A 4C5CA 3KQYA 4MINA 2IY8A 1P7ZA 4HWSA 5E0KB 1JHRA 1N7HA 5IS2A 3KQTA 2L9NA 1Z4IA 3TI7A 1HLFA 3BE4A 3GDWA 3RBXA 3E9RA 5E0OA 5IBPA 3PGLA 5BPIA 3MZ0A 5DEQA 4MPTA 5JG7A 3AHHA 1KJ8A 1FUIA 5IBCA 5AVJA 4EL0A 4QRIA 1NSYA 4CIWA 1W59A 1MAVA 1XJQA 3QLTA 3ETNA 1ZAKA 1O0BA 3ROPA 3HSYA 2BMJA 4CQNA 1X38A 1GA4A 3HZJA 4HSEA 3OP1A 1UP4A 3OY7A 5CLIA 2PGXA 1PX2A 3LPMA 1LX6A 5JI2E 1PJCA 5F3WB 1QK4A 4JKOA 3S2YA 2IX9A 3ROXA 1YCDA 2AK3A 2D59A 2IYOA 4BRWA 1DG3A 2I7DA 4GFBA 4F4DA 1WOYA 3HU1A 2YQZA 4RE5A 4A8JB 2WSMA 2BR5A 5DBHX 1T9ZA 4ZIRA 4BRZA 2JW5A 4BJ6A 3TL6A 4D5GA 2GZAA 4C9YA 2C42A 2OV1A 5GGYA 4HQRA 3G1LA 4C3UA 4DLXA 1C1YA 1XP5A 4JC8A 1TA0A 1JV2B 4CMIA 4EW1A 5T67A 1J8VA 1Y34E 4RKEA 5JE8A 3B1XA 2EW8A 4JEIA 3I9V6 1DCFA 1F14A 2V5UA 1SUDA 3FRJA 3IDSA 2VKQA 2HU9A 5BQXA 4HF2A 2XZTA 5G1PA 3PNOA 1V1RB 3JQFA 4TN5A 5LP6F 1M66A 2DHCA 5CLSA 4FKBA 2JJ1D 5MGNA 3IB6A 4BBZA 1CR1A 3TQIA 4G4JA 5TT0A 1A8PA 2KFDA 4R3NA 3DEIA 1ZXLA 3C8HA 4BUPA 5JQGF 5J1YA 3ZHQA 2X15A 3DKYA 2YV1A 3CH4B 4YK7A 2GR9A 2G1PA 1OGJA 1Z6RA 1NVVR 2HA0A 4Z4IA 4BBJA 4H3VA 4DSZA 4CCOA 2V8BA 3KBOA 2WT4A 2VT3A 2VYVA 5IYCJ 2IEAA 3GLQA 2PNFA 1GSIA 1LE8B 4OBEA 5DTRA 1G21E 4AUKA 1JLLB 3O7WA 3I76A 4OIQF 3DLHA 1AGPA 1XVAA 5DX0A 1IC6A 4N76A 5FBLB 1X8LA 4YC7A 1KK1A 1SOMA 1UJ6A 2NO6A 4K87A 4ZT4A 1DL5A 2PT7A 2WAEA 4OJYA 2WF7A 1NFRA 3WODF 2XE6A 2EATA 5GM1A 3RU3A 1U0JA 4R71A 3BD6A 1E2XA 4Q4CA 4CCJA 1UJ4A 3ESDA 3F5FA 4ER7A 4F3TA 1E1MA 4L18B 1U0RA 2ZTMA 5DXFA 3TG8A 2IP2A 3ESAA 4B31A 5F33A 3TEFA 2QA5A 2P9ZA 5CB4B 1B23P 2HOEA 3AFMA 4TXJA 1U94A 2PPVA 3MT7A 1PD0A 2VPRA 3MAJA 4EEKA 1SQ6A 4JROA 2W2KB 2ZBQA 3HNOA 1WKCA 1JLLA 1P62B 5GAHJ 3R8CA 4TV9A 3MBOA 4B4WA 1NRJB 2QUBA 5KTKA 2OZ6A 2QDXA 1ACMA 3DW1X 4B1RA 4L9AA 4WRRA 3ZJTA 3GFSA 1TW2A 4HX8A 3EH1A 4KI0A 1UPXA 2G1KA 5DM1A 2IH4A 3I01A 4Q9JA 5GQSA 3FVWA 2Q8KA 4QYXA 1HL7A 4QULA 3L06A 2WMNB 1X7HA 4UE2A 3VI4B 2VNJA 3ZMUA 1JHFA 5ALEA 3CEPB 2ES4A 3ZW8A 1DWQA 1N0VC 4MQUA 4IIUA 2H27A 1ESDA 2W2KA 4XJXA 1DBIA 4DWOA 2HRZA 3ZRGA 4UBJA 3Q8LA 2STTA 3VR3A 3F67A 1HFWA 4J1TC 2C7GA 5HFNA 4DR3B 4ZCIA 3IP6A 2HXSA 3B38A 5JAQA 4IJKA 1PQWA 5JMPA 3BX1A 3W2AA 5IUJC 2Z9DA 1SURA 3EZ9A 3E84A 1VL0A 5IVPA 3FMQA 2J33A 3TSCA 2ECBA 4Q5IA 5FD5A 4C4RA 2GRAA 1H6BA 3N2LA 3SDSA 1P7IA 4RGUA 3T9FA 4OH7A 1I6KA 5JISA 3D6VA 2YQ4A 4F5ZA 2O8FB 2JI6A 4LHYA 1RMQA 3R74A 2PSJA 4LHWA 3L41A 3MYRA 5L3VA 2Y1DA 2GPAA 4LOKA 1PBNA 5KBYA 5DDGA 1E3IA 3GEZA 4LI0A 1KYZA 3S2DJ 3R8FA 2E9SA 1JJAA 4BV9A 1GILA 1MOQA 1JT9A 2R84A 4BX8A 2Z8XA 4GKAA 4S35A 4R9NA 3HCNA 4DWWA 4AY6A 4MIKA 5BNGA 3GJRA 2OF7A 5LQCA 4LIPD 3NFYA 3I6IA 3MEXA 1Y7IA 4F97A 1WZIA 1SU8A 4D56A 2YY5A 1EWTA 4E14A 4WKCA 1WY7A 4EX7A 5DNEA 1PEDA 4Y2XA 4F21A 3R0QA 3MCUA 4CLXA 2AV6A 1NNLA 5I9NA 2QVLA 2H0RA 2P6PA 2FEPA 5A5FA 2JA7J 2WSSD 1LGYA 5EWLB 2PGAA 4C0WA 3EZ6A 4KWTA 5CTJA 3ZHUA 1A2BA 4ESHA 3S5JA 1QIDA 4XQCA 3WLPA 3RIEA 1ZOIA 2VYFA 4Y3OA 2COMA 3ETDA 4CXFA 3PENA 1O0CA 2V97A 2DU9A 2WV7A 2QZ8A 3IE2A 3RC2A 3IUPA 3OX2A 1LS1A 1RJDA 2WFLA 3LHDA 3TIGA 3WKDA 2FMLA 4X3OA 1DMSA 4KDFA 2Q1ZB 1IJKA 2XWBF 4C0XA 1XF1A 4OHYA 1QCZA 2ZCJA 4RORA 3IAM2 3HVHA 1Z5ZA 1VIMA 4UNQA 1B6AA 4MQMA 3WTBA 1TUIA 4G2NA 1ZTRA 5K1YA 3P4XA 3P26A 3RK1A 4N54A 2R7FA 1RI1A 4N5LA 3BK1A 2K2QB 1JEYA 4BBAA 5ARDA 4A8JC 1XTVA 5EWLA 4P33A 4EZEA 1UF9A 4RK7A 4IOJA 3GJTA 4PZ0A 4YNBA 4PYQA 2BLNA 3LW7A 4DCSA 4KMOA 3THRA 2AQEA 1FMFA 3SHWA 1LEAA 3KSDO 2IYAA 3HB5X 3C2QA 4PHCA 3R09A 3IP8A 4IFTA 4GPIB 5FEUA 3JAMK 4Y1GA 2XB5A 3ULQB 3CJRB 4E51A 1VLHA 1YA6A 1KONA 2PAFA 1U4SA 3VR4D 4OFBA 1ZAOA 1FFWA 5ESWA 1USSA 3ZN0A 1U0GA 4BV2A 1QP4A 2XVAA 1C3OA 3LSJA 2H08A 4W82A 4IZ6A 4DBLE 1O96B 3CUKA 4EM0B 1FP1D 2UZAA 4PPYA 2Z5LA 3W9SA 4XUCA 5HNFA 3QMPA 1XZKA 2PBZA 5FQOA 5CW2A 1I3MA 5KYXB 3OCYA 4YO7A 3OJOA 4OV6B 2BH9A 3SXUB 3IDOA 2GVZC 2KS6A 3IAS1 1Y6IA 2C9ZA 1P0MA 4FKMA 1ESEA 3QTBA 1JJ8C 4TLAA 4WNYA 1FX7A 1BEEA 2FPPB 4J6FA 4RNCA 2O4CA 2VPXA 3VKWA 1FFCA 3K2EA 3TO5A 3UAWA 4COKA 1E3MA 1DIGA 4I5EA 4NPCA 3MCVA 3CJRA 3QLUA 2M8GX 2H0AA 1LD3A 2AXLA 2WTMA 1JF8A 1PF7E 3NAMA 4ND5A 1RWMA 1O96A 4FM9A 1SQGA 1XZCA 4RACA 2QTNA 1WPXA 1DCTA 3JR9A 3FOAA 2DHEA 2DA6A 5KYXA 2M1XA 1XHEA 3PR1A 3SXUA 5FI1B 4P4SA 3DH0A 3L7OA 1XZLA 3MS7A 1BDHA 4YRCA 2CNWD 4J6EA 1UBEA 4Z8YA 2Z9BA 1GY8A 2EV9A 4OMZA 2I76A 1FVXA 5FBKA 2XI4A 1ZPDA 1Z74A 3K73O 2QRMA 5JZBA 1ZNWA 3LUFA 4GDFA 1DEAA 3L93A 3LX6A 1P1BA 1KDVA 2NU7A 3L0SA 1GZ6A 2XMBA 5JMTA 3DG9A 1BX0A 4B45A 2A5DA 2PMHA 3ZV5A 1O3QA 1JQKA 4K1XA 3VAAA 3FH0A 1MN6A 5AKGA 4ZO4A 1T4BA 2H06A 3P9CA 1USVA 3AL3A 2NPOA 4H59A 4KVAA 3OYNA 2QTVB 2DU8A 3WKEA 2KRCA 1VC2A 1XQVA 4RGXA 3DW3X 2QG6A 2DYKA 4ZWNA 3AM1A 3H05A 3SQMA 3KVVA 3SJBA 3HEBA 4LK0F 3AVWA 4BZPA 4U9HS 5DW0A 1C7IA 4Z9XA 2ZBFA 4B2YA 1T8SA 2VHTA 4U7TB 2Q0XA 1E4YA 1QC5B 1DE0A 5J40A 2RI6A 1UJBA 1RS0A 2E5FA 1I3AA 2R6FA 1CB7A 4INJA 4C2AA 3S81A 1R3DA 1AUPA 1NONA 4X8MA 3E61A 5JO9A 3ZTYA 1M6EX 3QITA 3FPHA 4F4IA 4Q9KA 1R1DA 1JE8A 2QTVA 4H35A 1GQQA 5DCMB 5DN6A 2E1CA 2JD2A 1A4UA 3CRQA 3T5XA 2EX4A 1IXKA 4HB2A 2OO3A 5KK1A 2Q6OA 3ZWCA 4NQWA 5DYYA 1G66A 5FUXA 1LBTA 4ZDJA 4ZTZB 2D5BA 3TLBA 4ITRC 3ANSA 4N8EA 2IXTA 1TYDE 1VLVA 1IY0A 1QC5A 3CR7A 4CLRB 2JAPA 1X14A 3KX2A 3NPAA 4P36A 2KIMA 3PXBA 3S27A 5JTUA 1VJGA 5AJHA 4KQ6A 1R6UA 3R0JA 3T3HA 3MKWB 2JK0A 2XWQA 2H4WA 4PX9A 1OHHA 4D3SA 2VHYA 1XAJA 3QNMA 2EBUA 3SKVA 2REQA 1UWVA 2NZJA 3VR0A 5DCMA 2LR0A 1CCWA 4PYJA 2W6ID 4W7SA 1H5UA 2ZYHA 3PRJA 4BEVA 4KODA 3FG9A 3LK7A 3L79A 4Z5XA 7MDHA 1MZPA 3DLBA 2OTLI 2AZXA 4M9UA 1FLNA 1W34A 5EQTA 1KPIA 3LVFO 1TGYA 4RSHA 2PJUA 4HMQA 1G9SA 3PXEA 1AUQA 1Z15A 3C6KA 1U0HC 2FOXA 1UWCA 1R8JA 1V4RA 1WHTB 3DO5A 5LDGA 2PY6A 1YOBA 3MUEA 3FDZB 5BYJA 1N2IA 2E7ZA 4O8ZA 3HHEA 2PKWA 4ZVVA 4D4JA 3CRZA 1UOPA 4H60A 1UB9A 4M3DA 1I24A 4PBSA 4CEJB 2AA3A 2AMVA 5JASA 1F2TB 3ER6A 4Y2TA 3PLAE 1N6KA 3HCEA 2VP3A 1DO8A 4R84A 4LC9A 3OCZA 3Q8MA 3L46A 4LAFA 4CL2A 1AGNA 1IC8A 4BTVA 4NYJR 4P38A 2K3PA 3LT0A 4XIJA 3GMDA 4HPQA 2K27A 4K8OA 1MOPA 2Z8ZA 2ODQA 3DLIA 2F1IA 3GIDA 3AWDA 1KO7A 1Y6JA 4C7KA 2WDPA 2X1VA 1X7YB 1U3FA 2WHPB 3OKAA 2XAGA 4MP6A 4AS3A 1OJ7A 3GF2A 4ZTUB 1QUEA 1WHTA 1JHMA 1SC1A 2ZWMA 2ERCA 4XIIA 2YOHA 3N0XA 2CL0X 4XMYA 1NV9A 2BGCA 1G17A 1JG2A 3IOYA 4QPZA 2ZULA 1FA9A 4D5EA 3W8FA 3R3YA 1XWWA 4XRSG 1D3YA 3WTYC 5EGSA 4CEJA 3EVZA 5CAEA 4CQLB 2V0CA 3U3RA 4RKQA 3W05A 1RXYA 3WU1B 1NVXQ 4X8LA 3HK2A 3AV3A 2CMFA 4KQKA 5FPKA 2C2BA 4YHHB 2VC1A 5CFRA 2FMHA 2O7OA 4DLLA 3RKRA 3AKEA 4Q1DA 2QM3A 4L75A 3E5MA 2XBUA 1MTOA 1MENA 2CMPA 1D1AA 1ONBA 3HOUJ 3WLEA 1EPUA 2WHPA 4JLVA 4LGCA 3UICA 4JQCA 3HKZN 1P0IA 2VJYA 5LQMA 1DQYA 3QVKA 3A05A 1JKJB 2XZDA 2J9XB 4A15A 1OU4A 4RAYA 4EDFA 3OTWA 3L5OA 1KIFA 3BXZA 3AUKA 1FFEA 3B8EA 4XUGB 4MV1A 1U90A 2BRUA 2J6BA 4IX9A 3SSOA 1U31A 2Y1KA 4G4GA 1I1HA 3V1NA 3MF4A 2O52A 3H04A 4RTLA 1K6JA 1Z47A 1L7NA 2E18A 1Z6TA 1P9WA 3FHNA 1ZJ5A 1KIMA 2LD4A 4ID9A 3QW4B 2ZBDA 3QHQA 2L69A 3LKBA 4ZQIA 5IT9A 3NNSA 1VYUA 5TR9A 3ELYA 2Z8YM 2EQRA 5EWMA 1MIHA 4EG6A 3F46A 2P2YA 4HLQB 1JZTA 1ZY2A 2WQ6A 4P7GA 3UXEA 3BMNB 4N5HX 1WMEA 2ATEA 5FBZA 1P80A 3QWIA 2FZWA 5BR8B 3WJAA 4BYYA 4W5OA 1JKJA 1VCMA 5I8PA 3G85A 5BRJA 1DJLA 1AB5A 5BO5A 3CMEI 3GMSA 1LNZA 5HDKA 1M6VB 3RWMB 4ES6A 4A3EJ 3OQVA 5C8ZA 3ERMA 3L0YA 2OKCA 2C04A 2BLLA 1S6YA 1NVBA 2E71A 4ENRA 3KPVA 5LD2B 1A69A 2L7KA 4WXCA 4F8EA 2KJCA 3KTDA 2WMOB 4N4OB 3LC1O 3ONWA 4BS9A 2F8LA 4RAFA 4LY0A 5K01A 2QA4I 5FWDA 4AMUA 3TNFA 2FEMA 3G7SA 4P55A 4OAPA 2HYDA 3WGJA 1PLKA 1CJTC 2HOQA 2AOXA 4KR3A 1BE0A 4N3GA 2BZTA 4H0FA 2IOFK 2Q1XA 4Y9TA 5HCIA 3NBFA 3OO0A 3WYNA 2O8EA 3U3DA 5JNSA 4XD2A 3BCBA 3DOJA 1RPZA 5FJJA 2XQFA 4WKGA 2WA2A 5GTIC 4GW3A 2EFCB 3QX7A 3BMNA 3ZJ5A 1Q20A 5EJGA 1YV9A 2OXFA 1RKUA 4PSAA 4DADA 4BJ5C 1YULA 3TPFA 5EZYF 4ZYVA 1Z6GA 2JJQA 1ORIA 2A4KA 4LFAB 4MWCA 1NKTA 4QO8A 4E0BA 1W75A 4HSTA 4OIMA 2J9FB 3DOCA 2OYSA 5DUKA 2E6UX 4M1TA 1S89A 1CIJA 1I0IA 2VHWA 1JSXA 1PTKA 3OQOA 4XB2A 2BFMA 3A0BC 2P5UA 1YBHA 3QMWA 4UUTA 3JZIA 3THYB 1MRNA 2H8RA 3W5UA 3JQ7B 1ZIYA 1T9GS 1D07A 3BR1A 3LBYA 4NR0A 4QBTA 1TIKA 3K9FC 2O2ZA 3U7GA 1PVDA 5JXWA 4WLFA 3E3NA 2ZTSA 1U0OC 2C8KA 2VQLA 3OCCA 3QBEA 4JELA 2FPKA 2Q3MA 2HQSA 3FM9A 4HBGA 1XVIA 1RM0A 1T2VA 3N6XA 3ODGA 5JS2A 3S17J 1YR8A 4ND6A 1SVUA 4JA0A 4BLRA 5ESXA 1G9XA 1EDEA 1JEEA 2J9FA 5BT8A 4R1TA 3PEVA 3ZY3A 1QH1B 2XMSA 3KLMX 4O4LB 1HTBA 3CRRA 3BFPA 3L7KA 2GK4A 3ZWYA 4F7WA 5LMNB 1TVKA 3QKWA 3DGFC 3THYA 1IK4A 3UGTA 3WYDA 3S2GA 3JQ7A 3RT7A 3VSKA 1KEEA 3EIOA 1SVOA 2WABA 2HMYB 5GONF 5BW8A 3GF4A 1KRWA 1FNBA 4P80A 3CSSA 3GD7A 1LTQA 1BKYA 1XP8A 2EHJA 1TUBB 2BM1A 1CJVC 3TM4A 1YDEA 4XGIA 2JH8A 1IXYA 1XALA 1PTJC 4Q4ZF 1N32B 4JLUA 4K46A 1ECGA 5L3BA 2JTVA 5KNCA 4M7PA 1GXSA 3ZDYB 5DNAA 2WY8Q 2K7ZA 1MMDA 3QPSA 4R1QA 4QDKA 4RTOA 4TUYA 1XPXA 1QH1A 2V6BA 2P6MA 3CCVI 4MQ9F 1WJ5A 2WJ3A 4ETMA 5K0ZA 1DC7A 2EKQA 1LPOA 4IXMA 3L8FA 4M74A 3R7SA 2VDQB 4AY2A 1IEVA 1Z8HA 2DSNA 2PBIA 3BJRA 3WLQA 2VLAA 1IZ1A 1GTG1 1WTCA 2B1JA 5ALRA 1CUEA 4HRAA 1NXPA 4RZXA 3A1EA 3P9XA 1V48A 5K5RA 1JG4A 3F8SA 1YBMA 4CLEA 2V0GA 3S32A 1QKIA 3ES9A 4RHCA 5F5NA 1W4CA 2WWWA 4I9UA 1GVNB 3HFGA 1H2WA 3RUCA 2CSXA 1UK6A 2GILA 3HKCB 3OZCA 2WTUA 2D0IA 4GLFA 1WI3A 4H0NA 4D3DA 2X0DA 1NJ8A 3LUAA 4LDZA 5LBUA 3V4SA 2BBYA 3ZIDA 4ZODA 1V16A 3IP3A 1UDAA 3SIXA 2XCOA 2UXCB 1BVHA 5TLSA 1DG9A 1YZNA 5EG5A 1KO1A 2X1LA 3F97A 1R0RE 2IVFA 3CX8A 3P71T 2A1IA 3V9PA 3SM9A 4MTCA 1MPXA 1XAGA 3BJMA 5CIWA 4TTPA 4F2HA 4NENA 4AQ7A 1NM5C 4IDBA 4MDYA 2M8EA 5HS6A 3CJNA 5AUPB 4EJ6A 3SFTA 4Y3UA 3TMYA 3VH4A 2X2PA 3IMFA 2R6AA 2LKXA 3VZPA 4ECEA 2VWPA 4MICA 3P94A 1Y80A 1Z0IA 2R7MA 1N34B 1RJEA 3HKCA 3QVLA 1BO6A 1NQVA 4BCCA 1WP9A 2DCUA 3DE1X 4FHFA 3H2ZA 1WO8A 3NT5A 2GGSA 1XQYA 1XG5A 4JITA 2PZBA 1QO0D 3DM5A 4W5NA 1W29A 4AJNA 5JXIA 4AXXA 1D2CA 5IH3A 1U3DA 4XPZA 4H4DA 3L4SO 2H2WA 4G9BA 4H1TA 3H8SA 1NBAA 3R3XA 4XORA 4Z1MD 2I8LA 3WR5A 4G0UA 2A92A 1WDMA 4TM8A 1EUDB 4Y0VA 4FPXA 4HF0A 3ZHVA 5C53B 4YMSA 5FUWA 4HEJA 1E59A 3UF0A 1EK1A 4Q7EA 1CQJA 5KVAA 4BL0B 3BMXA 3H5WA 1GGHA 3LMMA 4MP8A 1N6RA 3D0SA 1SKMA 1NVKA 1L5WA 1DRKA 3NIFB 3ELBA 1J75A 4MW1A 2YN2A 3I39X 2PU7A 2FKNA 4WF2A 3JS5A 2ID8A 4EA7A 3A32A 5J3LA 4CLDA 3U4GA 5JUWA 1K8RA 5TNXA 1BCRB 4NULA 4FMDF 3TTWA 1OR8A 2R60A 1UEIA 4R01A 4BU1A 5C1OA 1Q1QA 4QFCA 5EJFA 4E1AA 2Q2OA 3AB7A 2KDOA 4Z6KA 3CC7I 3O9MA 4D43A 3C15C 1P0QA 1R7JA 3ENKA 2PLFA 4E6KG 4RIGA 3P2EA 1U5BB 3LY5A 3W7VA 4OATA 5KWSA 1QRTA 1EUDA 5F98A 1F48A 3PJGA 4FC7A 4HVAA 4KO4S 3MMPA 3R5TA 5DGIA 5EJCA 2YPRA 4FUTA 1PYGA 1NIPA 1LY1A 3E7LA 1OLXB 2P0WA 4J7UA 4BWVA 4R1OA 4IHJB 4ZZDA 3BB4A 4AY5A 1P9OA 2R1UA 1TQMA 2XODA 1NLZA 1LFBA 2UXNA 4FX2A 3S0JA 3BD8A 2AWOA 1S8OA 1K27A 1ZGBA 4NBSA 1LH0A 2EJVA 3D2CA 4B7XA 3U62A 4AQYB 2GZ2A 4O1HA 3FYHA