3H5RA

Crystal structure of e. coli mccb + succinimide
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
348
structure length
340
Chain Sequence
MDYILGRYVKIARYGSGGLVGGGGKEQYVENLVLWENIIKTAYCFITPSSYTAALETANIPEKDFSNCFRFLKENFFIIPGEYNNSTENNRYSRNFLHYQSYGANPVLVQDKLKNAKVVILGCGGIGNHVSVILATSGIGEIILIDNDQIENTNLTRQVLFSEDDVGKNKTEVIKRELLKRNSEISVSEIALNINDYTDLHKVPEADIWVVSADHPFNLINWVNKYCVRANQPYINAGYVNDIAVFGPLYVPGKTGCYECQKVKENIDHKIKLINSRFKPATFAPVNNVAAALCAADVIKFIGKYSEPLSLNKRIGIWSDEIKIHSQNMGRSPVCSVCGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/antibiotic
molecule keywords MccB protein
publication title How the MccB bacterial ancestor of ubiquitin E1 initiates biosynthesis of the microcin C7 antibiotic.
pubmed doi rcsb
source organism Escherichia coli
total genus 110
structure length 340
sequence length 348
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00899 ThiF ThiF family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1160 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3h5rA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3h5rA02
2EKLA 3ZWNA 1Z7EA 1KEPA 1ISJA 4WCDA 4I5FA 1P1HA 4FQ8A 1YBVA 2JL1A 1RM3A 1O8CA 1U3TA 3E03A 2BI8A 4HP8A 3Q3CA 4CQLB 4NFYA 1BDBA 4BNTA 4ZICA 3L6EA 3CEAA 5DT9A 4WKGA 1LEHA 2E6UX 5ITWA 2ZQZA 1ID1A 1UJMA 4B3HA 3W4KA 3QWBA 3P7MA 2P91A 3I9LA 1R0SA 3HN2A 1ZXLA 3GEGA 2Y1CA 3JQ7B 4YAJA 3H9UA 1M67A 2PH5A 3ENKA 4YAKA 1SEVA 4AJOA 1P33A 3BTUA 3MJ4A 3WJ7A 5I8ZA 1PL6A 1I10A 3K73O 5ENDA 4N7RA 4FDAA 4I1IA 2BMAA 3SLGA 4B3IA 3O8QA 2PH3A 3QQPA 2AMFA 3S2IA 3LQFA 3F47A 5TJ9A 3DZKA 3SBOA 3TZCA 4B8ZA 3WB9A 5IDYA 2YYYA 4O63O 3E6AA 4IDAA 1Q7GA 4DC1A 4RF5A 4R16A 1YJQA 3GNTA 5A3VA 3W6ZA 4CM6A 2HRZA 3JQFA 4D3DA 1VE9A 4BIIA 1D1SA 1R12A 5TSDA 4AJKA 4BGEA 3X2EA 3DO5A 1RKXA 4UAGA 1E3WA 5A03A 5HM8A 4HY3A 1DIGA 1YDWA 4MOWA 4FW8A 4N18A 1B3BA 2BFOA 3FWNA 3LC2O 3HFSA 5BT9A 2BGMA 3RFVA 4GSLA 3VAZA 3KO8A 1E1NA 1PJSA 1EQUA 1YH3A 1GR0A 1NAIA 3X2FA 5T8KA 2FRDA 2VOEA 1G0OA 1I8TA 1T26A 4ZD6A 2PKQP 2VHWA 4DGSA 3G79A 3F6YA 5EQFA 4DQXA 2QYSA 1MFZA 3IQDB 5DDIP 5CDYA 2W2LA 3ROMA 3DBLB 4ESOA 3BTOA 1D1TA 1NNUA 1YQGA 5CAEA 5IN5A 5TS3A 3RUDA 4WE3A 3L9WA 2GPTA 2QZ9A 1Y81A 5GZ6A 3BXXA 3WTBA 5IAAA 3MCVA 1ADFA 3GG9A 1YQXA 2VHVA 4Y6PA 3AOGA 4MIYA 2GERA 2DBRA 4ALNA 4IMRA 2X58A 1SPXA 4DMLA 5BSHA 3SC6A 4CLRB 1PTJA 4YBZA 5A4DA 2CUKA 3EDMA 4IDDA 4Z0PA 1G0NA 1PJCA 3QHAA 1NX6A 2QZZA 4Z9XA 1E3SA 2DUUA 2UYYA 4YT2A 4OSOA 5CDTA 3A14A 4HWKA 5BR7A 4QEDA 5G0SA 4L75A 3LK7A 4XGKA 3AOEC 4EUHA 4IMPA 5CEFA 3A4VA 4II3A 1C0PA 4K28A 4W6ZA 3MEQA 1PR3A 4GMGA 4KTTE 3C7DB 2PA3A 3NTOA 1LRLA 2QHXA 1KC3A 2I9PA 4BB5A 4BNJA 5AQ1A 1GPDG 1MC4A 3E82A 3MJCA 3UAGA 5K6AA 1F17A 3E9QA 3JQAD 1DB3A 1ZK2A 3RI3A 4LRTB 4ND5A 3K9QO 1E5LA 4INAA 3C1AA 1H9BA 4B4VA 2VUSA 4ZHSA 1F06A 2PKQO 1E6EA 3NYWA 1YVEI 2AA3A 3OJ0A 1KERA 5LDHA 3DQPA 3GAFA 4ND4A 4HFMA 2X5KO 4EUFA 4W7IA 2C54A 3QJ5A 1GADO 1B8UA 2POQX 1ISIA 2FPGA 1X14A 4DMMA 1ZK1A 1ZKMA 2GYYA 1WXDA 3NRCA 1IE3A 5L51A 2FSVA 1DFHA 3ICPA 2DFVA 2Y99A 4PVDA 3ROQA 1LX6A 1J4AA 1L7EA 4ITUA 4JBHA 1E7RA 3TN7A 4L74A 2Y1EA 3QA9A 4FR5A 3H6KA 2Q2WA 3OA0A 1P1FA 5GZ1A 4NJOA 4WCFC 4WLUA 2G0TA 1LU9A 2DU8A 1A72A 2X6TA 2PR2A 1EVZA 3QVXA 3GEMA 5DF1A 3ZWPA 5TC4A 1H6DA 1HXHA 2HKIA 4NBVA 4PLYA 3TWOA 5A5FA 4BKRA 3IJPA 3ZWOA 1XQ6A 1Q7CA 4L9RA 2WD7A 1QORA 2NU9A 1KIFA 3IMFA 3QV1A 2DM6A 5A9SB 4CV1A 2FPPA 1XG5A 2NTNA 4G5HA 3JYOA 2NU6A 5U9CA 2YDXA 1W0CA 3AY6A 4FFOA 3WLFA 4MVJG 2ZCUA 1WWKA 5JCJD 3KHUA 3IKTA 4TMFA 1HEUA 1EFLA 1YWGO 2BRUA 3ZU4A 1Y8RA 1L1FA 1HDYA 5T6BA 4NZ9A 3BMOA 1R16A 3QWFA 3RC1A 3PRJA 1ZIDA 3BHMA 4R3WA 1E7MA 3GZ4A 5TNXA 1HWYA 4GWGA 2JCYA 2EV9A 4PG4A 3LC1O 2ZKLA 4AJNA 1E1KA 1T1SA 1U7HA 2AW5A 2GD1O 3AI3A 3FBTA 1VJTA 1ARZA 1OOEA 1UZNA 3P5SA 4W99A 4CR8A 1R4MA 2NQTA 5HTOA 4TSKA 5EERA 1D8AA 4J1NA 4E32A 5A9TA 4P4GA 4X54A 4CQLA 2TMGA 3O03A 3DAGA 1XDWA 1A4IA 1PIWA 2HO5A 3VDRA 2OP1A 2XOXA 4A73A 5G0TA 2JHGA 2G1UA 3GH3A 3UOGA 3WGOA 3PYLA 4LCEA 3UKOA 3W4IA 1C1XB 3PXXA 2ZJ1A 3VTFA 4BS9A 2AQHA 2ZQYA 3TZKA 1MXFA 3C8MA 1LQTA 4KOAA 1MFPA 4E5YA 1DHRA 4M1QA 4J3FA 4FSHA 2NU7A 5TGDA 1YL5A 3FBGA 1I3LA 2PLAA 3ZHBA 4GAEA 3JSAA 4FFNA 4DBVO 1GZ6A 4Y6SA 3VZPA 3WBFA 2GASA 2GN8A 2CVQA 2V6FA 2W2KB 1QYWA 2FZEA 4I9HA 2VRCA 1PZHA 2IXAA 1BWSA 1DRVA 4WCFB 1IYZA 1VM6A 2PZLA 3RUHA 2O50A 2DT5A 1EBUA 3VZRA 2FP4A 3WJAA 1TB4A 2Q46A 5DCWA 1AUPA 1EBFA 2CF6A 2ZB4A 4ROSA 5CPBA 5FI5A 1BTOA 1ZFNA 5IJZA 5FI3A 4FS3A 1UDAA 1ZEMA 1Z73A 2A94A 4M54A 4J7XA 4BOYA 3I9MA 4BNMA 2B0JA 4AJHA 2FR1A 2EW2A 2B69A 3I9NA 4FOOA 5JE8A 4IJVA 1YBAA 3PFFA 1SB8A 4TWRA 5KVSA 2UDPA 4GGOA 3CKYA 3FNFA 2Y1OA 3PJDA 3B1FA 1C1DB 1GQQA 4KQXA 4TROA 1XQ1A 4E2XA 4WOKA 3WGQA 5BNTA 5FEUA 2B4QA 1MGOA 3PIDA 3JQDA 4E13A 3JQAB 1DC6A 1GDHA 1N1GA 1A4UA 1V3TA 1XA0A 2X1HA 3HQ4O 4BO6A 3TZHA 4P38A 5L7TA 1V0JA 4LVCA 3INRA 2BFPA 5CHEA 3RSHA 5G0VA 1NM5A 4KDFA 4Q3AA 4YJHA 1LJ8A 2QQ5A 3NDIA 3DMTA 2CVZA 5CEJA 4R68A 1I2BA 2OBNA 3N7UA 3KYDA 4BO8A 1P9LA 4PG8A 1X13A 1HYHA 1LSSA 2O3JA 4D7AA 1EFKA 4FC6A 1GQ2A 2NVUB 4E2YA 3A06A 1E3JA 3GUYA 1ISGA 2VNAA 2OBYA 3Q11A 4L4SA 1ZVMA 3JQCA 3NKLA 4AVYA 3GDGA 3MTJA 2DTEA 3E9NA 3ENNA 2AE2A 3OP4A 1T2CA 1K5HA 3ABIA 1AGNA 5A02A 1PEDA 1ZH8A 4G81A 4XB1A 3F4LA 3W6UA 3BMQB 3PHIA 3ZU5A 4WOJA 3AU8A 3AI2A 4CUKA 5CDSA 5C7OO 1X1EA 3BMCB 1RJWA 4IUYA 3BMNB 3H7AA 3GN1A 3WGIA 4QFCA 1UXIA 3WICA 5L4SA 4K26A 2WMDA 1KC1A 1VLLA 2B35A 2VZ8A 4NQZA 3SLKA 4YEDA 4BNIA 5EN4A 3I4FA 3VH2A 4CJXA 3I3OA 1X0XA 3DEYX 4FGWA 5A9RA 1M66A 1PGOA 3UFXA 4TVOA 2LDBA 4OH1A 5H83A 2GN4A 2BD0A 2OOSA 3I9KA 7ADHA 3EW7A 4WLEA 2YHIA 4E5MA 1V3UA 2E49A 2VQ3A 3KXDA 4M89A 4LW8A 4YT4A 3OQ6A 4IZHA 4FBGA 4QO8A 5A9SA 1RYDA 4PRLA 1LRJA 4TKLA 2Z1MA 1HE4A 2NNLD 4XQCA 1HDGO 2W98A 4AJ1A 3VC7A 3ZWXA 4R9SA 3C24A 4E2WA 1B8VA 3CMCO 1A27A 3I5MA 1A5ZA 4DIBA 1EK5A 4R54A 2DBQA 2ILTA 5DNAA 3VH3A 4XKJA 4J43A 2P5YA 4O59O 3C3XA 1HE3A 3A28A 3Q9UA 3VVBA 3KLPX 1H2BA 4J2HA 4EJ6A 1Z82A 1TT5B 3WQRA 4Q9NA 2AQ8A 2QRLA 4BNXA 3TL3A 2AQKA 3WSVA 3UHAA 3WYBA 2O23A 1YBMA 4XZ3A 4ALLA 2BI7A 2GLXA 4S3MA 5KTKA 4M86A 5JO0A 3HN7A 4YAGA 4GI2A 4A27A 1TXGA 4CV0A 3ZI0A 4JP2A 4RVDA 1JKJA 4CLEA 1HLDA 8ADHA 1R37A 2AQIA 3ZU3A 5IDXA 5L7WA 3NX4A 5L4LA 2VHXA 4AICA 1ULSA 5F1PA 5ADHA 3U09A 3I4CA 2EKQA 1JTVA 3U4DA 1CWUA 1U3WA 1LDYA 4XX0A 2DFDA 3PLNA 2IODA 2CSUA 4II2A 2CDBA 3EZYA 3DZBA 5LCXA 3VKUA 1YDEA 3NDJA 1UXJA 4ZU3A 2CFCA 5HWSA 2FWMX 4U5QA 4F3YA 1YOVB 4GL4A 4Q3CA 2HK8A 3FTNA 2W2KA 4Q39A 3OEYA 1NVGA 3ONEA 3CINA 3Q0EA 4EW6A 3PK0A 3KETA 3SC4A 3ETEA 2A92A 4JIGA 1VI2A 1WP4A 1DC3A 3JD1A 2C7GA 1NR7A 2CY0A 4RF4A 3F5QA 4PVCA 4D44A 2A9FA 3D5QA 1DEHA 1NR1A 3Q1LA 1EDZA 1H2HA 4MP3A 2R00A 5HS4A 4RQTA 1JDJA 2XXJA 2Q4BA 1CEQA 4H16A 3TFQA 3PGJA 1WAMA 3TQHA 4IJWA 3GVXA 4A03A 2VN8A 3JCZA 4LGVA 2O2YA 2W8ZA 4XYLA 2YJZA 2IYOA 3FR7A 4BO4A 3QVOA 3M2TA 4R5HA 2X0NA 3CE6A 4XIYA 1QG6A 3DOOA 8LDHA 1I3NA 1GEEA 5KIAA 4MIOA 4DQUA 1NHWA 1Z75A 3FPCA 4MVJP 3H5RA 3DL2A 1FF9A 2BH9A 4CM3A 4NU5A 1ENOA 4XYGA 3JQAA 5JSFA 3CPSA 4D0SA 1T2FA 3KSZO 1OMOA 1HDZA 3GZNB 5AOVA 5I7VA 1JVSA 3PLRA 2AG5A 2X0IA 1V6AA 1H6AA 5JDIC 1I24A 4B4WA 1E3EA 4GLLA 2OZPA 1GYRA 2GF2A 4R69A 1GUYA 3BTVA 1QV7A 4O1MA 3NEPX 1NWHA 4DC0A 1A9ZA 5T67A 1LDGA 2YZ7A 1R15A 4FJ0A 4RVFA 3HZZA 2OUIA 4I9UA 2P2SA 2H9IA 1BDMA 4OQZA 1HT0A 3JYPA 2O3SA 3AUUA 6ADHA 4XWYA 1W8DA 3RKRA 3RIHA 2GDZA 4RO0A 2NVUA 1N92A 4LCJA 3QLJA 2C07A 2GSDA 2B83A 2H63A 5I7SA 4CMKA 1M75A 2PGJA 5A3JA 4XQEA 2IZ0A 4IDBA 4J1TA 3ROPA 4D45A 3DBRB 5BNIA 3QWHA 3WYCA 4BNVA 3NJ8A 5JDCC 4QT0A 1IHXA 3GA0A 3IL2A 4L8VA 3WGTA 2DTXA 4KUGA 1LUAA 4WNIA 3BMCA 2NVWA 4UVHA 1ZSVA 2VHYA 4JK3A 1Y5MA 4Q3DA 3GVCA 1A7AA 2O2SA 3ONDA 3QW2A 4MP6A 4NBWA 3WX0A 3MJTA 3TRIA 4TRJA 1XLTA 4J91A 4Y8VA 4ALJA 4YJDA 4CM8B 4DIOA 2ZATA 4JLWA 1ZMTA 2ZIZA 3K5PA 3D4OA 2Q45A 2PD6A 3WG9A 1XKQA 2NTVA 3PYMA 4H15A 4BO1A 2HMSA 3OM9A 4NU6A 3K30A 1UXHA 5CPFA 4A26A 3WWYA 4CV2A 4TRNA 1GL3A 3M1AA 3N58A 3UVEA 1RM5A 3G0OA 1U3UA 1XGKA 3A1NA 5I9NA 3ITDA 3ON5A 4DREA 2I99A 5F5NA 3GC6A 2CD9A 1TLTA 4UVIA 4UUMA 3PHGA 2X8LA 3PEFA 1MB4A 3DTTA 4L0QA 3HDHA 4PLGA 3KVOA 2VT2A 4RDHA 1H5QA 3VPFA 1OC2A 4PZDA 3ZV4A 4BO2A 1LC0A 3L0DA 3H9GA 2C5EA 2CDAA 4D3FA 1P31A 3FSRA 4KTVE 3RQSA 1SBYA 4MP8A 1P0CA 4XYBA 3NTQA 3W1VA 4FFRA 1QP8A 2P5UA 4GGPA 2AE1A 3WXBA 9LDBA 2HRBA 4JJGA 3HB5X 3PQEA 3AUTA 3ZW9A 3ZWYA 3L4BC 3V2HA 1TT5A 4DA9A 3DONA 4IDEA 3WDSA 1XCBA 2VWPA 1U7TA 4NHEA 1BSVA 1T1RA 5U4QA 4R4JA 5BNFA 1B0AA 4NFHA 2DBZA 2O4CA 3SJ7A 4GPD1 3D3WB 2FR8A 5DULA 2JD0A 4MVJH 2PGLA 5DCYA 2IXBA 4CMEC 3R0IA 4DVJA 2PTGA 3QWIA 1PS9A 3ZNPA 1U9JA 4KUHA 4NPCA 5JAIA 1X7GA 3P2OA 5F1OA 3U49A 4L76A 1DPGA 3JQ8A 2BFMA 1N9GB 1PWZA 4MINA 1DC4A 3GDOA 1OC4A 4PLVA 3CTMA 1QKIA 4OQYA 3VTZA 3BHJA 4BKUA 2I67A 3E5RA 4RVGA 3D4NA 1GCUA 4JBGA 2AXQA 3U3XA 4DQVA 4Z0TA 2PZMA 3EUWA 1PJLA 1K3TA 2WYVA 3DZGA 1HDCA 1XHLA 4W9NA 4E3ZA 5IZCC 3GDFA 2VUUA 3JQ9A 4XGIA 3WMXA 2EHDA 4I08A 1YXMA 4JJFA 5F21A 2SCUA 3QVWA 4N5LA 4BGVA 4QSMA 1MC5A 5TIIA 1KBZA 1MA0A 1P3DA 3RD5A 4EITA 1D4FA 1N7HA 5H81A 2E4AA 2PWZA 1FJHA 3GF4A 5AXBA 5COBA 1FXSA 1DHTA 3DMYA 1HE5A 4OXNA 1KEUA 1X15A 3KLMX 2NU8A 4CQMD 4DL9A 2GN9A 5HRUA 3W8EA 1PQUA 4KWIA 3E1KA 4MVJI 4RZIA 3KSUA 5KJEA 2NLOA 2Q49A 1FDUA 2ZTUA 4TKMA 3S2GA 3WQQA 4XIJA 2EKPA 4ILKA 5EMHA 4WLFA 1BW9A 4GX5A 7MDHA 1E7QA 1Z6ZA 5DN9A 2X9GA 5C7LO 4E0BA 2VYND 4WK6A 5IF3A 3H3FA 1SCUA 4AJEA 4EYEA 4NIMA 3WGHA 1U3VA 1YL6A 1S6YA 4AJIA 1SB9A 2I3AA 4IIVA 3ZW8A 4N5NA 2Z1NA 2R6JA 2DLDA 4YT5A 4GKVA 3JD3A 3HG7A 5DCUA 4PN3A 2V65A 3AW9A 2D3TA 5ILGA 1PGNA 2WJPA 3QVTA 1M6HA 2RIRA 4J7CA 1U2DA 3GGOA 3I9OA 4RPLA 1Z7BA 2O4UX 1JN0A 5ER6A 3HWRA 4BMVA 1DC5A 1PWXA 3SEFA 4KMSA 3LC7O 1VL0A 2ZB3A 2I5PO 1JLLA 3IUSA 4HV4A 1NPYA 4URFA 5KVQA 2YW9A 2CMDA 5ILOA 1BXGA 1KVRA 1VSVA 1ZO8A 3S8MA 4BNGA 2DAPA 1EUZA 5H82A 1CJCA 4NNJA 1LDMA 1T2AA 2G76A 2E82A 3L6DA 2IZZA 3DBRA 2EWMA 4MKZA 4ND3A 1ZW1A 3IAHA 3V2UA 5AXCA 4ID9A 3T4XA 1ZNQO 3F1LA 5DP1A 4J4BA 3QWAA 3V5NA 4RLHA 1ULUA 2NM0A 1BHSA 1GD1O 1XIVA 3LZ6A 3IP1A 1XEAA 4QTZA 4CM8A 1ZZEA 2J5QA 3H8VA 3U0BA 4PCVA 4UEJA 1SZJG 4YVFA 3NV9A 2I66A 3UH1A 2NQ8A 4PLZA 3B6ZA 3BIOA 3G1UA 3ROKA 1C14A 4D46A 3DB2A 3QE3A 1HETA 3AM4A 5DZSA 1VPDA 2IE0A 4A10A 2EEZA 2Q99A 3DBHB 1HF3A 1LXCA 4YPOA 4CV3A 5C7IO 4E6PA 1PL7A 4W82A 1P44A 1SOVA 1HL3A 1CQJA 1K89A 1RWBA 2Y0EA 1ENZA 1S7CA 1T24A 2Y68A 4B7CA 3Q9NA 5I8WA 2OO5A 3JQ7A 1IULA 3KYCB 5GY7A 5CP8A 3PJFA 3HFGA 2J8ZA 4NJMB 2OXIA 3V1YA 1VL6A 2PFGA 5JY6A 5MDHA 2J3KA 1WLYA 3QVSA 3RUCA 2IDZA 2QG4A 4A5OA 3WR5A 3F4BA 5A05A 3PI7A 3U4IA 1AHHA 4RZHA 1EQ2A 1RM0A 3K96A 4ZRMA 2Z95A 1PZFA 1WMBA 3TL2A 1ADGA 1G1AA 1F14A 3OA2A 4L4RA 3TZ6A 4IDFA 3CXRA 3VDQA 3DXFA 1QSGA 4PGFA 5L53A 4OKIA 3OETA 3JQ6A 2D4AA 1ZSYA 2HU2A 2EP7A 3L77A 4B7XA 2P4QA 3TSCA 2WYWA 4UVEA 3E18A 4Q3NA 4XD2A 1MXHA 1ISHA 4BNHA 1R6DA 4AJLA 2AHRA 1ZSNA 3M1LA 4R3NA 1H93A 4RPJA 3I52A 5EL0A 1NXQA 5KJ6A 2VHZA 5L95A 4ZRNA 2VT3A 1IHYA 2Q50A 2AG8A 1SAYA 3ASUA 5FF9A 1LLDA 1DRUA 3GGGA 4P4NA 5THQA 1E7SA 1NVMB 4CLXA 3NDRA 5T57A 1Q0QA 3D5TA 2FR0A 2EGGA 1PS8A 4YRBA 4FCCA 3GMDA 1WMAA 2VWGA 2VWHA 3DBLA 3DBVO 5ICSA 4HBGA 4HNGA 3UCFA 2FZWA 4OO3A 3KM0A 2W2LD 2P9EA 4PLWA 1N9GA 1O9BA 2VRBA 3RROA 2QX7A 1UXKA 3K92A 1DOHA 4PZCA 4RF3A 1B7GO 3WOHA 5CDUA 2OMEA 1GV1A 2YFQA 2H6EA 4PLPA 4CQMB 5TLSA 1QMGA 4CLRA 4XJSA 4BGIA 1NFFA 5B4TA 1V9LA 1ENYA 4TZKA 5G4LA 2LDXA 3HUDA 1KETA 2RHRA 3RC7A 4IM7A 3LT2A 4DXHA 2ZTMA 1HKUA 5JAQA 9LDTA 2HMTA 5ITVA 4XQGA 2VYVD 1YQDA 1K6IA 3GQVA 3KTDA 5GMOA 4EDFA 1OZAA 5C3MA 4KQWA 3OIFA 1I2CA 2H1SA 5A5EA 1M6WA 2NVBA 3ANLA 3CSDA 1DIHA 3O9ZA 4Y67A 1JQBA 3GVPA 1R4NB 4XGNA 4CUJA 2JD2A 1D7OA 3VPHA 3JQFC 1JA9A 3FNEA 4PLCA 4YRDA 4EGFA 2D8AA 4M55A 1UP7A 1GFSA 3RWBA 1YJ8A 3RUIA 3CMMA 3GLQA 4RVUA 2I6TA 4IXWA 3VVCA 3H3JA 2B37A 2WM3A 1UP6A 2GNAA 2W4QA 3OMLA 4BNNA 1Y9AA 2C20A 4M49A 2XPCA 3DAFA 1BMDA 2E37A 1GCOA 4YQYA 4CM1A 3LDHA 3LVFO 3EMKA 5T8KC 4R51A 4ZQGA 1RM4A 1KS9A 3NGXA 2DPHA 2O48X 3ZNNA 3ZGYA 3JQGB 3PTZA 4U6QA 1EVYA 4UEKA 1PZGA 3MWEB 3RUAA 1QR6A 4AL4A 3VKVA 4JX8A 4E30A 1H9AA 1F8FA 2G5CA 1J5PA 4XR9A 1B2LA 1SOWA 4I5GA 4BNLA 3QIVA 1IB6A 5JAMA 1P1RA 1PJ2A 4JJIA 5TJHA 5JFOA 3DHNA 4W9NC 1MLDA 4UUPA 1ZUD1 1DLJA 2XF8A 4O0LA 5DBGA 2D0IA 3ANNA 3FTPA 5FFFA 3NT4A 2VOJA 4J4TA 2DKNA 4XRGA 4S1VA 1PS0A 1ZEJA 3DAPA 5KWEA 2O7SA 3RU9A 1HDOA 1IUKA 2Q3EA 4DWVA 4JP3A 5L45A 1NTOA 2P9GA 3WGZA 4XRRA 3E8XA 1CYDA 4XDYA 1LDBA 2DPGA 5EESA 3AOEA 4CMHA 5L9AA 3S2FA 4C7KA 4J0FA 3VH4A 5K6AC 1QYCA 4J6FA 4FC7A 4J49A 1UAYA 3GNSA 4RGBA 5T64A 4ZGWA 1U8XX 1I32A 5TT0A 1Q0LA 3PGXA 1DAPA 1Y8QB 3OF2A 5B1YA 1IY8A 1GU7A 3OHSX 4RLSA 3O26A 1XU7A 2IRWA 3VPSA 3HE3A 1K0UA 3DBHA 5B4UA 2VZ9A 3VHRA 4RPGA 4CM7A 1SO8A 3RBXA 5EPOA 4NK5A 1B14A 4R5MA 4TQGA 4PLHA 4WEOA 3OICA 1BXKA 3OEWA 1P74A 2OORA 3Q6IA 5F5LA 1C1XA 1KEVA 2QIOA 1JWBB 1K6XA 2PY6A 2Y1FA 3KYCA 4M8SA 3WSWA 1YL7A 2PZJA 4IDCA 2QYTA 1QYXA 3I83A 4NBUA 3T7EA 1FDWA 1JKFA 4YJFB 4ZQHA 1P1IA 1U2GA 3DHYA 4LRSB 3D3EA 1EDOA 4EUEA 3G3EA 2JAHA 3D4PA 3C7CB 4GH5A 4MVJM 4HX5A 3WTCA 2X9VA 1OFGA 3GUCA 3RU7A 4BKQA 4CPDA 3O4RA 2Q2QA 3GK3A 3GRKA 3W4JA 2D5CA 3EYWA 3PDUA 3S2EA 1UUFA 4Z3DA 4YCAA 1ZK3A 4J2OA 3ZZNA 3AM3A 4WECA 5LC1A 1HSOA 3JQBA 1NQAO 1OI7A 2Q4EA 3KRTA 3TPCA 1NP3A 3IIEA 1A9YA 4WCFA 5F3RA 1WDMA 3DZIA 1V35A 4EI2A 1DIBA 4DYDA 5KNLA 4YRAA 4OKNA 2HMUA 5IDQA 3F1KA 3AUAA 4QXMA 1FDTA 4OGWA 5DBIA 6LDHA 5JC8A 5JYDA 5JBIA 4BL5A 1LSUA 1NQTA 4ZVVA 1GPJA 3FNHA 4BNFA 2CDCA 1GAEO 3MTGA 4IQ8A 4XB2A 4C4OA 4DBZA 4DRYA 1PX0A 1U4OA 2H5LA 2YV1A 2Q1TA 3ADPA 1N8KA 1AE1A 2PK3A 4HADA 1ADCA 1J49A 4K6FA 2YHUA 1MG5A 2FY8A 2DBVO 1B15A 1X7DA 3TJRA 3VPGA 3GN2A 2UUOA 4BO3A 4CR6A 1C1DA 2V6BA 1HDXA 1ML3A 2W90A 4DLLA 2YFHA 3V1UA 4N54A 1B3RA 1ORRA 2YQ5A 3OECA 4IJKA 5TX7A 4CQMA 4KP7A 2QRKA 2X5OA 1Q1NA 3NJ4A 4H7PA 4YAIA 2OL4A 1XSEA 3VH1A 3FRJA 1EEHA 1MV8A 1O6ZA 1F8GA 4RF2A 4KZPA 3B70A 4RQUA 3OJLA 3D64A 3QP9A 2PZKA 3JQEA 3VZQA 1P45A 5JCXA 1UH5A 2RAFA 1PJ3A 3UXYA 2D2IA 4WNCA 3D1LA 2R2GA 3GFBA 4CR7A 1JKIA 2PGDA 3OJEA 4G2NA 2EXXA 5CG1A 5I9LA 5AYVA 1MG0A 1EK6A 2IZ1A 2YQ4A 4YACA 3NT2A 3ZWVA 2VWQA 2WYUA 1E1MA 1R66A 4BKOA 4AJPA 5CG2A 1IZ0A 1R4NA 4HNHA 3VZSA 1TA4A 3FHLA 3UICA 1HLPA 1MP0A 1O94A 1TEHA 2TMDA 4GX2A 4NK4A 1LLUA 4LN1A 3FWZA 2AEJA 4OOEA 3ULKA 1YKFA 3C7AA 3R1IA 3CUKA 1C0LA 3AI1A 5L4NA 1XU9A 1WDLA 1JAYA 1CIVA 3E5MA 3GMSA 4FD3A 3LT4A 1U8FO 2HQ1A 3BMQA 3W8DA 2HAEA 2Q1UA 3LLVA 3GPDG 4W7HA 1E3IA 1AHIA 1LLQA 3ASVA 3G49A 4KDEA 3SJUA 3V1TC 5IZ4A 3BMNA 4EJMA 2F1KA 2O3RA 1BVUA 4Y9DA 3BA1A 3I1JA 3ETDA 2BHLA 4IJUA 1GV0A 2Q1SA 4YA6A 3JQGA 3ONFA 5JCJA 3DHEA 4GX1A 5TQVA 1I3KA 1N7GA 1LI4A 3NAQA 5G4KB 3I6QA 5EIOA 2NTJA 2Y66A 3LU1A 4FFPA 2WDZA 4JROA 4YQZA 2UAGA 4IGFA 4P8RA 2YUTA 4J16A 3BMOB 4P4LA 4HKTA 1EUCA 2VTEA 3GG2A 3OQ1A 1CF2O 3PZBA 2Y93A 2GO1A 4Z6KA 2C5AA 4LISA 5KJFA 4F6CA 3GHYA 4BO0A 3HDJA 5IXSA 3PIIA 4OHUA 2JCVA 4YJGB 3ZWBA 4IQGA 1TVEA 3Q2IA 1R4MB 1QRRA 1MUUA 1YS4A 3CZMA 3RUFA 4ZQBA 4G65A 3ZWWA 1Y5RA 3GT0A 3JD2A 1IPEA 5MGBA 1DJQA 4OM8A 5JMWA 1V8BA 3OJFA 2JD1A 3DMTC 4J7UA 5COAA 3ZNQA 3JYNA 1Q2XA 4B4UA 1LDNA 1BGVA 1UP4A 5B12A 4D41A 4E31A 5JNLA 5C37A 3UCXA 3DFZA 2VZ0A 3LLSA 1ONOA 4IGEA 4NBRA 3H5AA 2HSDA 1HSZA 4PG7A 3T4EA 1HZJA 3CIFA 1Y8QA 5I9MA 2EW8A 2RH4A 1DAOA 5KJCA 2O3TA 4WEQA 2Y67A 3TOZA 1YONA 3AY7A 2ET6A 2EF1A 3AUSA 2B4TO 3PWZA 5CDGA 2C82A 3L07A 1PSDA 1YB5A 3KEQA 4ALMA 2J3IA 3EAGA 1UDCA 4RL6A 1AXGA 5L40A 3JYLA 4OYRA 4YJFA 3WGYA 4I5DA 2ZYAA 3STHA 5K9ZA 2YV3A 1F12A 5JAZA 2GZ1A 4GMFA 1LTHR 2ZB8A 3MOIA 3MOGA 3ZHYA 4OOFA 1H0KA 3JYQA 2HJRA 1U5CA 4DUPA 2PD4A 1GQYA 4CM4B 3C1TA 1E92A 2UVDA 4GQAA 3OSUA 5JS6A 2J6IA 2ZK7A 3HB4X 4FPXA 1EUDA 4TZTA 3U5TA 3QRWA 1SC6A 1YOVA 3DFUA 3NT5A 1YB4A 1NYTA 2DC1A 4CMGA 1E6UA 4AJ2A 3OBBA 4HFRA 4BNKA 1CETA 1U4SA 2HMWA 3OIDA 3D7LA 2F00A 2Y05A 4U0JA 4IS3A 4RORA 3ITKA 2IEDA 2EIHA 3DOJA 1ZK4A 1CRWG 3PHLA 1NVTA 1W6UA 5I7EA 5L7YA 5G2OA 1T4BA 4JCOA 4FOSA 4Z0HO 2EJWA 1F0YA 3L9XA 3UW3A 3RJ5A 4R1UA 2JFGA 3B1JA 1FK8A 3INGA 5HS6A 3WMWA 4BNZA 3GRPA 3IS3A 2Y0DA 4XJTA 1E7WA 2WWRA 5ER9A 3HSKA 1ZXBA 2VCYA 3SVTA 2JFHA 1E7YA 1ZJZA 4LVUA 3ZV3A 4ALIA 1DLIA 4I8XA 2FMUA 4CM9D 2C59A 2IEBA 2VYVA 1NFRA 1JWAB 3FCOA 3KOUA 2HK9A 1ONNA 3BTSA 4J1QA 4UVGA 3ZDFA 3GVHA 1ZJYA 3P2YA 4UVDA 4YJHB 5JLAA 4JGBA 1PJTA 3RBZA 2ZCVA 1U5AA 1PGQA 3MJSA 4YB8A 2BLLA 3CH6A 3IUPA 1I36A 4Q3EA 1EE2A 3KYDB 4OXYA 4BMSA 2AEFA 4GBJA 1D3AA 3RC2A 1RYEA 3OIGA 2ZJ0A 4PFJA 3GZNA 3I23A 3U62A 3KUXA 1HYGA 1OBFO 3I9JA 5G0UA 4R41A 3O38A 1NAHA 2GN6A 3N74A 2J5KA 4MVJF 5EINA 4PLTA 1GUFA 3R3JA 4AJJA 3SXPA 4F45A 4PLFA 4NFSA 3TNLA 5I7FA 2C0CA 2FPIA 2WEKA 3GFGA 4FB5A 3ZHXA 3FI9A 4XQ9A 1ISFA 1HZZA 3W8FA 3WQSB 2X4GA 2DQ4A 1ZK0A 4HFJA 4R1NA 5ENVA 3AJRA 4XDZA 4PIVA 5CEEA 1KVQA 5JMPA 1MX3A 4FN4A 5B37A 4CMJA 1DRWA 4FIZA 5EQDA 1TI7A 3IDSA 5JO9A 3TOXA 3WS7A 1KVUA 3JQBC 4MPDA 4U7WA 4NR0A 4YYZA 4R1TA 4IDGA 3PPIA 2QRJA 4MVJD 1GY8A 3FN4A 5TRTA 3EVNA 4TVBA 3CZRA 1HDRA 2NWQA 3ZN2A 2CVOA 5AXAA 2YHIB 3ZWMA 1UZLA 3DR3A 3H9QA 1FDVA 1WW8A 3RJ9A 3DC2A 4E5NA 1WVGA 3DOCA 1XELA 2R00C 3U4HA 2CF5A 1L7DA 1PJ4A 2UV8A 1JAXA 1KVSA 2WTBA 1Y7TA 2GCGA 3DZFA 1IZ9A 1DDOA 1V3VA 2J3HA 1QXSA 5G4KA 2G82A 3HHPA 1RPNA 2IYPA 4GWKA 5U1PA 2WE7A 1NQ5A 4RPKA 2RBEA 4R9RA 5DP2A 4EEXA 4NI5A 4QX6A 1NBOA 2J3JA 2X0RA 3BYZA 4WLOA 3GR6A 2UUPA 1E3LA 3ADOA 4NG5A 4ONEA 4WGGA 2OHXA 2JKVA 2FHSA 1P0FA 4ALKA 1K6JA 3H2SA 4E33A 3IJRA 4IPTA 1DJNA 2HK7A 2X86A 1ISMA 3PZRA 2HMVA 1CQIA 4DPKA 1JW9B 2JAPA 2RHCA 2A4KA 2RCYA 4YJGA 1PU2A 4U0KA 2WD8A 2X5JO 4R1SA 3JD0A 2FSSA 4J90A 4YT8A 5COQA 1T2EA 4OMUA 4NH4A 3FNGA 4GVLA 5JY1A 3Q2KA 1BRMA 2X22A 4CMIB 1DIRA 2HJSA 1OAAA 3IKVA 2V6MA 4WLNA 4BO5A 4ZA2A 5JDIA 2GGSA 5JW6A 3RFTA 3RVDA 4U6SA 1PZEA 2BF7A 4PRKA 1KY5A 2O3UA 2EJVA 4R01A 4IINA 4CMAA 3ANMA 1H94A 1GZ4A 1AXEA 2C29D 2I3GA 3GNQA 1HYEA 4LSMA 5CFZA 2BKAA 3ZV6A 3AFMA 3KEOA 3RUEA 4BQRA 3LT1A 3UN1A 1SNYA 3D3WA 4PG6A 5G0WA 2EG9A 5IN4A 4XCVA 1R0LA 1QYDA 4MJLA 1WZIA 5IG2A 1O5IA 4B3JA 4Z3KA 4DPMA 4RJTA 3L4SO 4E4YA 3P19A 1DBVO 1VL8A 2ZYGA 5A1TA 1VC2A 3HDYA 1PJQA 3IC5A 3SX2A 4OSPA 2XXBA 3FPLA 1JU9A 1Q0HA 2DUWA 2WSBA 2DTDA 4PZEA 3WFJA 4K9DA 1A71A 1QYVA 3T7CA 1EVJA 2V7PA 2EP5A 4A0SA 5JDCA 1FDSA 4QUKA 4D79A 2P68A 3GOHA 4IQ0A 1J6UA 2CNBA 4N5MA 2D5AA 4UULA 4CM4A 5GZ3A 3LF2A 4CLHA 3TFOA 4YR9A 2C2YA 3M2PA 3ZH2A 3FD8A 3H2ZA 4QFDA 5HBRA 4LSWA 3NGLA 3ZU2A 3PWKA 4QECA 1U1IA 4BB6A 4E21A 3C85A 1GZ3A 4TRMA 4A2CA 3MWDB 4KWHA 4MKRA 4D3SA 3H9JA 2BGKA 3HADA 5L3ZA 3OH8A 1PJBA 1I0ZA 1Q7BA 1VRWA 1NASA 2NSDA 2NUAA 4XA8A 3S1LA 3UUWA 3QY9A 1T2DA 2C2XA 3R6DA 2BELA 3QSGA 4Z9YA 4MIEA 1I33A 2FN7A 1EZ4A 1GYQA 3JD4A 4NBTA 4YDRA 3K6JA 4AFNA 4UUNA 5BQFA 3LF1A 1GUZA 2V6GA 3PJEA 1Z74A 2ZTVA 3COSA 4YWJA 3PHJA 4IBOA 2O3QA 3UF0A 3GVIA 3PVZA 1DFGA 4J9VA 1JVBA 3BHIA 5HA5A 1XR3A 1WPQA 2D1YA 1I30A 1Y1PA 3F3SA 4B8WA 1PR9A 4BKPA 3GAZA 4OIMA 4E5PA 3NUGA 1KVTA 3AY3A 4D42A 5THKA 3ZCXA 2HCTA 4DLAA 5KVCA 3DZHA 1H6CA 4DIFA 1HRDA 4F6LA 1EE9A 3AK4A 3U4CA 3L4BA 3LYLA 3ZV5A 4F46A 1K2WA 1YGYA 3IOYA 1VKNA 1I3MA 4WJZA 2Q1WA 1M76A 4DLBA 3F5SA 1CERA 1E77A 3KSDO 1VKOA 5IFLA 3D0OA 4BO9A 5DBFA 1I2ZA 3WWZA 4DTIA 2BFAA 5IDWA 2WE8A 4RDIA 1C0KA 2JFFA 3MJEA 3WYEA 3VPXA 2Y1DA 1EMDA 1KYQA 2B36A 4CMEA 3WFIA 3ICCA 1NWCA 5DOVA 1NHGA 3U9LA 4LK3A 4UEOA 4E2ZA 3TZQA 4ZQEA 2I65A 3M6IA 3GEDA 2AEMA 1PQWA 1M2WA 5KKCA 3A9WA 3EHEA 1QLHA 5DOZA 3EK2A 4BUCA 3AM5A 2YV2A 2O7QA 2ZB7A 3DTYA 1EVIA 4CL8A 1QV6A 5T5QA 4OAQA 4CLOB 4J9UE 1IOLA 2I76A 3LSYA 3GPIA 5FYDA 3BAZA 3JQ9C 3PHHA 2YDYA 4BNYA 1LLCA 1AN9A 1H6BA 1XWFA 2OFPA 3FR8A 3EY4A 4CMBA 2Z5LA 4XYEA 4BQPA 5IZCA 3VOSA 4BNWA 5ICMA 1YB1A 1P77A 5JYEA 4OL9A 5KVVA 4GX0A 3HDQA 2DVMA 2Y0CA 1SEPA 3GY0A 4FJ2A 2QW8A 4GKBA 5AXDA 1KEWA 3V2GA 3H9EO 2GR9A 3BZUA 4B79A 1NQOA 5KOIA 1B16A 3RKUA 1J0XO 1U28A 3B1KA 3KZVA 1YE3A 2PV7A 3WIEA 2X0JA 2NV6A 3AFNA 1ADBA 4JNKA 1NPDA 3F9IA 4ND2A 4RVHA 1GYPA 3O8QB 1ZMOA 4XYMA 4JBIA 4AG3A 1LSOA 1E0DA 2Y1GA 4MKXA 4FFLA 4NMHA 4IIUA 3WGGA 1UAGA 1I01A 1O89A 4HFNA 5AVOA 4BHTA 4CL3A 1YRLA 2A35A 1LRKA 1R0KA 5LDGA 2P4HX 5ES3A 2NACA 4QO7A 3DZJA 2X9NA 2JHFA 5BSEA 1E1LA 1N1EA 5EJ2A 4KUEA 1BVRA 1E3WB 2VUTA 1FMCA 4DYVA 1HTBA 4HUJA 4CMCA 5IXYA 1UDBA 4NJMA 4YXFA 3E9MA 4B7UA 4MDHA 3K2EA 1LSJA 2PNFA 3GGPA 3ORFA 5A06A 4YTEA 4CMIA 4RCVA 3K2BA 1E5QA 5JPIA 1T4DA 4GVXA 4GLOA 2B5VA 4GSKA 5TF4A 2J5RA 1QLJA 1ZCJA 3GHHA 4BV8A 2B5WA 4EEZA 3E48A 4UUOA 1Y9EA 1YO6A 3WNVA 4PG5A 3TDKA 2X23A 1B26A 3I6IA 1WZEA 4LMPA 3V8BA 1W73A 4MVJE 2VNSA 3JQ8B 3WNQA 4BNUA 2BGLA 4XEHA 3UGKA 3INTA 2VRCD 4U8GA 4L73A 4XR4A 4EJ0A 1O95A 3PQFA 1CDOA 4Z9FA 4BO7A 2HUNA 4J4HA 3UCEA 4TRRA 3ZWCA 4OXKA 1T25A 4FFMA 1LBEA 2HDHA 4BMNA 5J23A 1Y6JA 1VJ1A 1C3VA 1NFQA 3ZWAA 4O6VA 1P1KA 4ZQFA 2B4RO 3WBBA 3K8ZA 5KCZA 4WLVA 4FGSA 3JTMA 1HE2A 2HLPA 4BVAA 3JV7A 1VJ0A 5JXWA 1WDKA 3ZNOA 1GEGA 4ZJUA 1KOLA 3H65A 4J1SA 4IXTA 4OJNA 2PD3A 2D59A 2X7HA 5BSGA 1ONPA 3ST7A 5FWNA 4RVSA 4CLDA 1IL0A 3ETGA 4CM9A 1DFIA 4RV9A 4D43A 4W4TA 5KJ1A 1TT7A 1X0VA 1UXGA 1P1JA 5BSFA 5TT1A 2CZCA 4I9NA 4MO2A 3FF4A 4IY1A 4K1LA 3S55A 3AU9A 3NTRA 1IPFA 1DSSG 1SMKA 3DWFA 3PP8A 2C7VA 2EERA 1BW9B 2VYNA 3PDJA 1LNQA 4WPGA 3EGOA 1PGPA 1Z45A 3G17A 1PL8A 4BV9A 3K31A 1DXYA 3G1TA 4CODB 2NADA 2RH8A 4NDNE 5KKAA 3KV3O 4B4OA 4QQRA 5C5IA 2GRAA 2ZTLA 1VSUA 1PQPA 3F46A 5F1KA 4A7PA 5A04A 2OGUA 3PWSA 4Y98A 4CM5A 2OP0A 3RC9A 3L6OO 1KY4A 1GTMA 3C1OA 4O5OA 1N5DA 4IS2A 4C7JA 4JXKA 4WUVA 1DIAA 4P22A 1I5RA 1PGJA 4LMRA 1LDEA 2PKRA 3R3SA 5B4VA 3HNPA 4I5EA 3ZHZA 3OJOA 4CUZA 3LT0A 4H3VA 2VTDA 1NPTO 1XYGA 4HXYA 2EGHA 4L4XA 2JCXA 4AJ4A 4EZBA 1B8PA 3RASA 1DO8A 3OFSA 2GZ2A 3EC7A 2ZYDA 1UR5A 3RFXA 3EZLA 3KB6A 1N2SA 3PYXA 4DPLA 4RPHA 4Q3BA 2GZ3A 3WLEA 3OQBA 3PJGA 2Q2VA 4WASA 3WIDA 4ZN6A 1LA2A 2WD7B 2XAAA 1O0SA 4D0RA 4EBFA 2YY7A 4J0EA 4JQCA 1X7HA 3PQDA 4ND1A 1BXGB 4M87A 1BG6A 1LQUA 4MVJA 1BXZA 3KBOA 1E6WA 4YAEA 3HJAA 1LC3A 3TF5A 3KYBA 3MJVA 4UREA 4Y6RA 5K0ZA 4FJ1A 1ENPA 4K6CA 1ZBQA 4JN6B 2E48A 1UZMA 1Y8RB 3RBVA 2P9CA 2G17A 1WNTA 1C0IA 1G6KA 1A7KA 2JJYA 1W4ZA 3RCBA 3AWDA 3PFWO 4BGUA 3H5NA 2FOIA 3RAJA 3IP3A 5JC1A 4E12A 2GUGA 4E5KA 3EVTA 4IZIA 3DDNA 3H4VA 4CLOA 1X1TA 3B20A 3MZ0A
chains in the Genus database with same CATH superfamily
2EGUA 3DPUA 1KEEA 5DTIA 2IPMA 1R8JA 3AHCA 3D8UA 3L6EA 2WSSA 2LCFA 4BJ5C 4IZOA 1XNRB 1ID1A 4B3HA 4QBTA 1ZGWA 1ZI8A 3VYSB 1H23A 2NU7B 3UYKA 3S2IA 1QE5A 1RPTA 3DZKA 3PRKE 2YYYA 2XWPA 1Q7GA 4U2BA 1S6LA 4OX9Y 1D1SA 3R61A 4BGEA 1P0PA 3GLFE 4NFLA 4NARA 3X1YA 3WLSA 4G8JA 1NBME 4NE2A 3L9FA 1FTTA 1JFFA 2HNAA 4G2TA 5UKDA 3F6YA 3FMQA 5EQFA 5DX8A 5FRMA 1WJEA 1D1TA 5CAEA 1OZFA 2PJUA 1U94A 4NDZA 3U7EB 2FNPA 3V8JA 1PTJA 3EA5A 5A4DA 2CUKA 3HOYJ 1EX6A 1YDHA 1KARA 2A05A 1JIXA 4NCJA 1L8AA 3OT5A 1Q6ZA 3SZOA 4W6ZA 4KTTE 3DQZA 2ZM6B 3R8FA 4IJAA 2BC9A 2HIMA 3IULA 1T29A 3NKVA 5B5SA 3DNFA 3CBGA 2I2XB 3ISVA 3L93A 3JWJA 1RTTA 4RELA 1AQYA 2P2CA 3H11B 3QJ5A 2IGBA 1W2GA 3PENA 4BYMA 1E2EA 3NRCA 4WV3A 3DOUA 4IKPA 5DYTA 3DDOA 3MF4A 1LX6A 2VQSA 3FCCA 4ABTA 3OCXA 3S40A 3DSRA 2QT1A 1QIHA 1TOAA 2I2FA 4TS9A 3PE3A 1SFXA 1KIFA 2X6RA 2HU7A 1SQ6A 2NU6A 2Z5VA 2OQVA 3LAWA 3WLFA 4KPFC 3GT4A 2PUJA 3UH0A 3WZMA 1I13A 1R16A 4RHEA 1GCIA 5TNXA 4GWGA 2BN4A 5BN4A 1X1PA 2EEPA 3FBTA 2AW5A 3AI3A 4W99A 1UZNA 4B48A 4TSKA 3FZGA 3CF4G 5A9TA 2A1UA 4CQLA 4QT4A 3I73A 5DDGA 3T41A 3WGOA 2DMUA 5AKYA 1TADA 2APJA 2MINB 2VBIA 2QMHA 5DNWA 1O94C 4A8PA 2P0AA 5LUAA 1USTA 2X1CA 2EAUA 3QP6A 4JLNA 5FOTA 1VM6A 3A3OA 3RUHA 5ALOA 1V1JA 1ZG1A 1MAHA 1EBUA 1TB4A 2Q46A 3VUFA 1YQUA 4J7XA 2OOKA 2W2TA 3TOVA 1ZN8A 5KVSA 3QEAZ 1EG7A 4E2XA 4CQJA 4XWGA 5LQSA 3WGQA 3JQAB 2WVGA 1NW9B 4JCCA 4C7MA 3RTBA 3TZHA 1RRCA 4ZHQF 3NPAA 5DNYB 3GIWA 4UNOA 1E61A 2L69A 3GLXA 5CEJA 4R68A 4ZZ2A 3BJRA 2CLIB 4KRYA 2CV1A 4D7AA 2IEKA 2CJFA 2NO1A 5F12A 1P7VA 2YWRA 3MTJA 1BA3A 2QVZX 3IEKA 4EECA 4E15A 2COEA 4PINA 3G13A 2QEQA 2BV3A 2R1TA 1RJWA 4IUYA 2FX0A 3GN1A 1VLLA 1M8JA 2NAPA 2F3TA 2IZOA 3K8YA 1UKEA 4W1PA 3L8YA 1HLFA 1RLIA 2JFQA 3BXOA 1OPRA 2OOSA 2A1TS 5HLTA 1QM5A 1XAHA 4MGZR 4D82A 4QO8A 4YJKA 1EHCA 3AZOA 5JLXA 1RYDA 1XD8A 3OLYA 4XQCA 3T7RA 3ZCOA 1EK2A 4DIBA 4F4JA 4EYGA 1RAFA 4F2DA 3C3XA 4LJLA 3OX4A 2KIFA 1OA1A 1AN0A 1SU6A 1W96A 1TT5B 4CYDA 2G6TA 2H1CA 2MSKA 3AR6A 5DYMA 2JCGA 4DADA 1U2WA 1K98A 4JOSA 3FMGA 4RC9A 3ZGXA 4TLEA 3FPJA 3E0JB 3H19A 2X2FA 4G0QA 1N2OA 4E03A 3S7TA 5KNCA 2XRLA 2AN5A 3DCFA 3VHQA 2A9RA 2VK8A 1GG5A 3RSFA 1YASA 4JL6A 2H8KA 3QITA 4AWAA 3NMUF 2H4WA 1QQIA 2ZWVA 4UHTA 1NR1A 4TM7A 2MLKA 1CK4A 1HY3A 1WAMA 3NFRA 5JASA 1QFXA 1ZN7A 5ANRB 1KORA 5TR9A 3KVVA 3DOOA 2BFFB 3GJQA 4U2CA 1VQ9I 4MVJP 1E1DA 3ENQA 3K1MA 4OPMA 3LMKA 4BP8A 4BBSJ 4EM2A 4HX8A 4YRMA 3RPEA 3DHVA 2OCBA 1JIKA 5DH9A 2X8WA 3HJNA 2RNGA 2XPVA 2WMNB 1P3Y1 2R7OA 4GPIB 4DDVA 5KWIA 2D1FA 3OFND 3J7YJ 3TTWA 4I4TA 2YSRA 5LMNB 2OCXA 3LA8A 3LHIA 5EIBD 3BERA 5HF6A 3GLHE 4J91A 4Y8VA 3SS7X 4V39A 2NXWA 1C7JA 3WYNA 2WB2A 3PUVA 3K53A 4BVGA 4CV2A 4G0VA 1RM5A 5I9NA 1U3UA 5LQRA 5EZGA 3J81Z 1Z08A 4FGJA 3MMNA 1J8FA 4Q82A 4MEAA 1YQ9A 1HQCA 3NAMA 4FOLA 5JYCA 2QTFA 5KINB 3U6BA 3V48A 1BAPA 1ZLKA 4KTVE 1IM8A 5LQKA 4FFRA 1K86A 4DG5A 9LDBA 5KNBD 4V0OA 3IYLW 1U7TA 1M6YA 1PW5A 3RRZA 1EE1A 2VH2A 1GOTA 3K2AA 5DCYA 1CP3A 2J9FA 4RSRA 2B5OA 2XMDA 2RSLA 1JMVA 4NABA 1YR1A 3B02A 1M0SA 1BX0A 1LX7A 1N1MA 3TCNA 3AFGA 3ZMTA 2PUCA 4UE6A 2I67A 2J41A 3KL4A 4EJSA 5AUNB 3NAZA 2QVCA 2X6OA 3R4VA 1O2DA 4MV0A 1MBGA 4BKXA 2ISYA 4C9BA 2VP6A 1MT3A 4ZZIA 1RAHA 1HE5A 4UUSB 4J07A 1X15A 1X58A 3F22A 3Q8XB 3RKYA 3HCNA 3QEMA 4ZKDA 1LY1A 4LNHA 1Z6PA 2IL1A 3MCWA 3H3FA 2F1RA 2G5PA 521PA 4Z7NB 5FFMA 2DH6A 4B3XA 4U8HA 2GXQA 3DPSA 1TL7C 2OQGA 4KAAA 4B43A 1RPAA 5HF9A 4DQDA 1RYFA 4EQ6A 4C4TA 2DPDA 1D04A 2XUDA 4HCJA 1L3IA 1L7AA 5JNUA 2FMTA 5CITA 3S8MA 1WBBA 2QG9A 4NNJA 2OHJA 5KO2A 1P4GA 1CR1A 2C2BA 5K1YA 2DY1A 4XD7A 1XNQB 1ODKA 3IP1A 1DEAA 4DA0A 4L6IA 4ZPJA 5A3QA 3EGVA 3BCRA 1FE8A 5K3BA 5FO0A 4I36A 3O8OA 1HF3A 1J0EA 5FUMA 3HKCA 4FMCB 3MN2A 2EOAA 1ENZA 5JPCA 3WI7A 4P5DA 2WIAA 5HMLA 3NM4A 4OBWA 4A5OA 1ZL0A 4ZU6X 2R6AA 3U4IA 3NO4A 4GBGA 4N12A 1G1AA 1XMAA 2ZYVX 3DS8A 4R40A 1A77A 3T0FA 2R4GA 3EIEA 4XD2A 2E5ZA 4MUBA 4RHUA 1ZSNA 4HA8A 4Q7MB 4W9MC 4DW8A 2BVNA 4BAYA 4FVTA 4XLPF 3U0VA 3A01B 3MLEA 4XJXA 1XD9A 3KX2A 5LU8A 1RZRD 5D7BA 2XB4A 5B4TA 2QAGA 1V9LA 3BCHA 2PRJA 1BGWA 2XKPA 1RPZA 5GMOA 3UXHA 2XE7A 3NV7A 2FK8A 2H1SA 5A5EA 2NVBA 1KYZA 4E7LA 4PJJA 4K0RA 4UBJA 4ER7A 3RPUD 2JGLA 4LC9A 1Z9CA 3PPYA 4Q5IA 3IIIA 4M55A 2ERCA 2BEKA 2ID6A 1JTXA 4EARA 1GQFA 4AKHA 4EW3A 3HM9A 3DLLF 3EIQA 4N3AA 2D7JA 4XX1A 2MBFA 4GQBA 2ABWA 1M34B 2XGMA 4I09A 3EMKA 4R51A 2FRDC 4HAXA 1AUQA 2L42A 1EJ9A 3T5DA 2QQEA 3HOTA 1G8SA 2DJ5A 3SKVA 4E5UA 4GXQA 1SY7A 3PF8A 4QL3A 1J8DA 1O03A 3VKVA 3U81A 3ET4A 2L2OA 2DDBA 1YFKA 4JP1A 5EJ8A 2BAGA 2OV8A 4RIFA 1RNLA 5JAMA 1TM5E 3DHNA 4XFJA 2VJ4A 5LA6A 4UUPA 4JLDA 4O29A 3IQFA 1FS4A 3KXLA 2V6IA 4XRGA 4G5YA 4QLBA 1HA3A 2CLSA 3A9SA 3KFWX 1FIAA 4ESEA 4AYBA 3LSGA 5L9AA 4XGQA 1KFJB 3GNSA 4AY3A 3X1XA 4RLSA 4JBXA 5AVKA 3LQ2A 3DBHA 2VZ9A 4RPGA 3QBJA 1NK3P 4ZARA 5FA6A 1K6XA 4N9IA 1DKUA 1P1IA 1U2GA 4AY2A 4FETA 5EJIA 3SE7A 1IXKA 2QQAA 4HX5A 4QVIA 1Q3KA 2GKOA 1XTVA 4XOUA 5FT9A 1BKDR 2XKOA 3UAYA 2WKQA 1YVDA 3HM5A 1V35A 4ARZA 3O73A 2WUWE 1MD0A 4NYJQ 3FJOA 1NQTA 3ITEA 5AT1A 1P0QA 4DBZA 3STVA 1V7CA 4ICIA 4BXOB 1ZVVA 3KAKA 2Q1TA 1N8KA 4U00A 4IHXA 4UFNA 4PAWA 5IT9K 5LFAA 2CLOB 3UWOA 4BO3A 4WZAE 5IJAA 2IWRA 4QUJA 2J1LA 3WTVC 2X0LA 1X3WB 2BBWA 2H1KA 1ZG5A 1F8GA 2Q2EA 1FQOA 2ZITA 2AYZA 4INOA 3X1MA 2RAFA 4IF6A 4UUQA 3O2PE 3KZXA 1XE3A 2Z2YA 1TKCA 5AW7A 1E1MA 4PXYA 4AJPA 1FEZA 3RS3A 5J58A 2F8TA 3ETHA 5HLGA 2TMDA 2WQ6A 3ICQB 1YKFA 4QGBA 4F9FA 1R9JA 5L4NA 2O8DA 1N4DA 3IFSA 4W7HA 4KDEA 4EG1A 1UPBA 3HGGA 3S6JA 4YA6A 5EIOA 4ZAXA 4CFYA 4KZKA 4H6WA 4B9AA 4Z6KA 1M1NB 4FDLA 5AHWA 4LITA 3RIGA 1JDPA 1TAHA 1J1IA 5AVRA 1YZLA 2RHJA 4V0MA 4IWNA 4R2MA 3IVXA 5JMWA 2QTCA 3HYRA 3ZNQA 4ETSA 5AVWA 5KZMB 5C37A 4QTRA 2ECFA 5F5XA 1YCDA 5CCBA 1ULBA 4MTLA 2V8OA 3AC0A 2NXEA 5E79C 3ADDA 2DXIA 4P35A 4U5XA 3KPYA 1KDOA 1QH9A 4YJ3A 1UIMA 3EZFA 1UDCA 3V55A 1CT9A 1UEXC 1DUXC 3KXKA 4KN6A 3C1TA 1GAQA 4JJ8A 3AVWA 2Y1LA 1TZ2A 4HX9A 2J7PA 1ZI9A 3S99A 2HQAA 3FIJA 2HI3A 1QZXA 1ISRA 1YNSA 2IEDA 3A10A 5K2MA 2DWUA 5EKXA 1IHPA 4D3XA 3K4KA 2QTNA 2YR2A 4IO9F 4RSHA 2EVWX 2PM8A 2VCYA 1E1YA 5FRDA 1QGUA 2FMUA 1ONNA 3OTOB 4FE4A 4YJHB 5JLAA 1F5SA 5KREA 3BJIC 3DVAB 3A3YA 2BLLA 5E7QA 5M5BA 1W4BA 4U3JA 4LK0F 1SG0A 4YLYA 4PPGA 1N34B 2POCA 3HY4A 3KUXA 2H94A 3TUZC 5GM2A 4I8IA 2XAGA 5JS1A 1T9BA 2WK1A 4Y9RA 3EFOA 3VUEA 3I5UA 4U0WA 1TI7A 2MSWA 2O0JA 3TOXA 1KVUA 3CNLA 5EIWA 4KYWA 1JR3A 2B1RA 2DHQA 2ZZNA 2Y27A 3DR3A 3CO0S 4FYVA 4YP9A 1A04A 1R27A 5A5GA 2B21A 3FVWA 1ZWLA 4MQ4A 1MO6A 5E6RB 1NQ5A 5I7UA 4I1OA 4R9RA 5CIYA 2OXFA 3KFVA 2V7QA 3ZU6A 4Q1EA 1PVDA 1E9FA 1CQIA 3A1WA 3P0FA 3RHTA 2F8MA 3E3LA 4RACA 3OWTA 2M30A 1KK1A 4AQDA 2ZE8A 2C4HA 2P2DA 3DTVB 1TQ6A 4NCKA 2VPTA 3ZHRA 3GTQJ 3ACCA 4ZZ3A 3G73A 1ETHA 1V1MB 4QLCU 5HIKA 4O3FA 2WIBA 1HM5A 1EBBA 2BKAA 3DE2X 2G07A 3G0IA 4P0PB 2AK3A 1JJIA 1SNYA 3TSOA 2QT9A 3G6WA 1PG5A 1RKWA 3ETJA 1N9ZA 3WV5A 4U2FA 5CX1B 1C41A 3MSXA 3AP1A 1CY4A 5EZ6B 2XITA 3M33A 2HJVA 4QECA 2HBZA 4HDQB 4GI7A 4BRSA 4MW6A 5I7AA 4ZYAA 1GM5A 3JRCA 3COWA 2NUAA 3QY9A 4ZOQI 2BEOA 4LQLA 4NBTA 2UYCA 4YDRA 4F4HA 1ZD4A 8OHMA 3CLHA 1QIGA 4UTVA 3ABOB 3W6NA 1SD4A 1L5HB 3PVZA 3HXOA 4M72A 2VDWA 1WHTB 1U8CB 3ILYA 4JKOA 2NZXA 2VQDA 4DIFA 4PXSA 3TLEA 1PDVA 1XYVA 4XWWA 3A8TA 2FFJA 2R96A 2G88A 4WJZA 1M33A 1VKOA 821PA 4YCMA 5LBQA 4OB6A 3RYCB 2V6EA 4RDIA 1CE8B 3IP9A 1AKQA 1CUDA 5DXJA 4IHJA 5J40A 3AHJA 1XF9A 1Z0FA 5JFTA 3UJ3X 5BYBA 3ET5A 3GEDA 2KRFA 1DCFA 2XH8A 4MR7A 2QG6A 1D1PA 1R6VA 5T5QA 4I3HA 5ALQA 2P9BA 2C0QA 1XQWA 3FE2A 2ETHA 2Z5LA 2D2WA 1R6TA 1NMEA 2QW8A 3V2GA 3HL4A 4IIEA 5IASA 1LPSA 2GBCA 3WIEA 4M1SA 4B6FA 3F9IA 3LX8A 4RENA 3UJ9A 5E8GA 1E0DA 4FWIB 4LDRA 2A35A 1QPMA 1JUMA 2F7SA 4D26A 4G9GA 1H9TA 3GL9A 4A1FA 3ER8A 4B7UA 3NWOA 3K2EA 3GGPA 2JUCA 1SBNE 3K2BA 4C5BA 5JPIA 1T4DA 2HXYA 1QLJA 4M71A 1XZ8A 3BN3A 2A5WA 5KSOA 2C9CA 2PX8A 4H7KA 3TDKA 4BNUA 1L8LA 2YQZA 3F6OA 4U8GA 1K8XB 3I8XA 1W35A 1CDOA 3WU1B 2FEZA 1E2LA 4NNPA 5LEJA 1QNTA 4J2TA 4KI7A 3PDIA 1IZ7A 1LEAA 3OWHA 1WDKA 3CNNA 1MENA 3ZJYA 2IGNA 4N40A 2JFVA 2P1DA 1QC5A 1MQAA 4EM0B 2J0EA 2O2DA 3VFZA 3RSLA 2WIGA 4JLPA 4NQWB 1DP4A 1BW9B 2HLHA 2ZTLA 4RDUA 3OHPA 3QFSA 4ZVQA 2PLWA 4X64B 1DU0A 1OYIA 4C7OA 1B8IA 3X0DA 1QH1B 1QBGA 2FZVA 3PCTA 2XYHA 2Z3WA 4XUDA 2HL6A 4A69C 1VDMA 2BGGA 3E3AA 1D4ZA 3CWZA 5HGJA 2OESA 1BXRA 1NXTA 1O0SA 3HOWJ 4DDMA 5DM6F 1E0EA 5D3KA 4BBZA 4W5QA 4M87A 4ZVSA 4EMBA 4DSTA 1LC3A 1BVHA 2NP6A 4FJ1A 1MX1A 4S2UA 1WXQA 1DAIA 5IT3A 3RAJA 1YZKA 4LPSA 1N57A 4N76A 2ZDHA 4L16A 4NCXA 4X71A 1DTEA 2AC7A 2WBMA 2D1VA 2UUCB 3W5BA 1T9DA 3S81A 2BI8A 2LD4A 2WYOA 2OCIA 1Z0UA 3IVRA 4ZICA 2I2BA 3HBNA 1N0WA 1KSGA 1ODTC 4B44A 3ENKA 3ILXA 4P0QB 1R50A 4PZUA 4LFBB 3H2HA 1C9NA 4FYKA 4F5DA 2CW7A 3F47A 3FVRA 3WB9A 1WSAA 1U1DA 4QTTB 2YOHA 3HOXJ 2AWOA 1K9VF 1M2HA 3BR6A 5C8XA 16PKA 1YMQA 1DMRA 1LFDB 3LC2O 5BT9A 1Z3IX 3VAZA 5AIPA 4U7JA 3X2FA 4C0KA 1I8TA 1FCJA 3QUQA 3UUFA 5EJ4A 3SYMA 1ZUIA 3R74A 1YC2A 3GT3A 4L28A 1W7PA 2UXBB 4TT3D 4KKVA 4ALNA 1TTYA 3C2GA 5TQ2A 4GKAA 2WVAA 1I3OA 1NX6A 4P2BA 4YT2A 1YFLA 4P5PA 2C7BA 2IHBA 4MWZA 2SKEA 2IK8A 2YNMA 1RI2A 1FA9A 5D8LB 4OHMA 2O0KA 3EFEA 4JVLA 5ALNA 3JQAD 4EHIA 1IBRA 1SCIA 4ND5A 2VF8A 1I2DA 4WZBB 1RFGE 1G2HA 4PBTA 1TKAA 1KERA 4MGHA 4M46A 2X5KO 4HXFB 2HSWA 5ALMA 5J2UB 4C0SA 5J3JA 2CN1A 3AB7A 1VECA 3QTBA 5HDQA 3ROQA 4C87A 3W3CA 1HQDA 1V5IA 3GTGJ 3HYNA 1J8MF 2B7LA 4NJOA 1J9ZA 5FRNA 4AKSA 1FU8A 2A0UA 3ANXA 3ZWOA 2ZJ5A 1ICEA 3EPRA 3IKLA 3E7LA 3EVDA 1UT6A 2IPQX 1YJWI 3WWCA 4AKGA 4HF0A 1DRJA 1WOMA 1UK8A 3AL3A 3OLVA 1L4EA 3ZIDA 4Y4RA 3LCUA 4DNQA 2WWXA 4MAMA 5F2NA 2ZE5A 4INPA 5DSZA 1ARZA 1R5HA 3WK4A 3K4NA 5BOXA 1WDWB 1EDEA 3CRVA 1A4IA 2ZRDA 2OP1A 1HW5A 3WE7A 2AQHA 4A91A 2ZNYA 3IV6A 1SU8A 5TE9A 4NCAA 4IDNA 4QBFA 3EQZA 4PONA 2O57A 4FWBA 4P33A 3WLKX 2KX7A 4AN0A 1E94E 2V4ZA 1ZREA 4EA6A 3DP9A 1T6ZA 3O8CA 3SY8A 5TV2A 4WINA 1AUPA 1X9IA 2ZB4A 3F49S 1B00A 4D8YA 4A36A 1FRVA 2PYIA 2BMFA 4MMYB 1WH5A 4EHBA 3N70A 4FOOA 5C81A 3ABUA 4TWRA 3SQOA 1SC3A 3Q5FA 3FNFA 3B1FA 4KQXA 1OIXA 1DXHA 4X7RA 1I4TD 4A3CJ 2ZB2A 1GUAA 4E13A 2PR7A 3FRIA 3A3NA 3X1DA 1P8JA 2X1HA 3HQ4O 4BO6A 1CJBA 2GSWA 3DT8A 5M5WJ 4C0JA 2DR0A 5CM8B 4P4SB 4Q9KA 3JRHA 2VBZA 3K4PA 4DOZA 1CUJA 4B46A 2G9WA 4BFYA 1LSSA 4ZDJA 1BE6A 1E3HA 1UF9A 2P4WA 1GQ2A 3A06A 1ISGA 2D2EA 4AVYA 2DTEA 2WIKA 1OIWA 3OP4A 1XA3A 5KYXB 2NV0A 1SIUA 3CR3C 2PJPA 2GDJA 3FCUB 3AI2A 4CUKA 2QF7A 4MRAA 5FA8A 3R7NA 1V5GA 5MN5A 3KOZA 5AW3A 2AX4A 3OEEA 2DZDA 2LDBA 2OV3A 1U8RA 4ENSA 3LK6A 1AOYA 4RE6A 2IBSA 1EH7A 2CSOA 4XKJA 2VBWA 1C3JA 3Q9UA 5M3FJ 2Q0SA 3A26A 2ICWG 1SKYB 1KU9A 2AQKA 3B82A 4BEJA 5CJ2A 4FMDF 5KDLA 3CLTD 3C7TA 4AX4A 1S3IA 1CNEA 1R37A 3RF6A 3OV8A 4PYKA 1HZZC 3EYIA 3FHZA 3GROA 2CXSA 1J07A 2OFXA 3WL8A 2QR3A 3VRHA 4LXHA 5EEGA 3K69A 3MT8A 3F9CA 5B36A 4IFTA 2VHEA 3B7GA 4EFMA 1NVGA 4NWIA 1ZVKA 1MVNA 1D8KA 1TU4A 3SJMA 3PFHA 1XQVA 1Y6FA 2FQ1A 4S04A 3I71A 3A0HC 1XCGB 5A3RA 2DJNA 4E1VA 1BL0A 2X0NA 4GXNA 2BEWA 2H0RA 5DWDA 5KIAA 2XSDC 1HDDC 1G4UR 4TV8B 4D0SA 3PLRA 1CCWA 3HGQA 4O4IB 1DDGA 4B4WA 3OKCA 4G0PA 4ZIRB 4P82A 3UWPA 2XUPA 4AAYA 4XTCS 3QEJA 2VONA 2P6UA 4DE5A 4QAJA 3NC0C 4FXOA 1DX4A 1XSVA 6ADHA 1Z56C 1JLLB 2BJHA 4BEVA 3TAHA 3HSRA 5ADVA 2QUFA 2M8EA 3WMFA 3NNNA 1N6PA 5FTMA 3WISA 2PGJA 3LHKA 2X0KA 3DULA 4YUXA 2QD4A 2E71A 2QD5A 3QG1A 4D45A 3DBRB 2JKYA 3ZKWA 3NOOA 4BXFA 2G1AA 3UHJA 2PUGA 1SM4A 2BSQA 1X2EA 3N5KA 1I4EB 3KSBC 3ONDA 4MP6A 5ALTA 2ZATA 4D9JA 3WG9A 4ES6A 2OYSA 1GDTA 1CDEA 4QD3A 4A26A 1NNEA 1R7RA 3N58A 4Q4JB 4I6JA 4DREA 1LLFA 5BQOA 4UVIA 4LOJA 1QV9A 1MB4A 1FUYB 2VT2A 3HOUJ 2Q4DA 3IHUA 4YJ2B 1XJCA 4MP8A 1X8XA 2AE1A 3LI2A 1KQNA 4OUDB 4L9TA 3D31A 2FUG1 1XCBA 1OXMA 1XC7A 1R3DA 4NZNA 1IEXA 4FFBB 2DBZA 2IJGX 2N8GA 3G2LA 5K01A 1UZAA 4B71A 2RN7A 1TMYA 1EQAA 5JAIA 1XRQA 2O6LA 1BMFD 2VP0A 5F1OA 3CG0A 4OGGA 4AZTA 1PWZA 5AVTA 2EFOA 3ZVRA 1XZCA 4OQYA 1XPRA 1ZRHA 4YHHB 1BN6A 1FSHA 1XPUA 4XUEA 4JBGA 4ZYXA 1G9SA 1PJLA 3GDFA 3P2IA 3JQ9A 2JLRA 3WMXA 3UMYA 3O4GA 1YACA 1MC5A 2HIGA 2YJ3A 3N2YA 3GF4A 3BJAA 3WTYC 4IIBA 4F86A 1ETVA 5C1OA 3KPVA 4UBIA 2PGOA 3QENA 3S2GA 3LSPA 2HWYA 4EG8A 5DN9A 4S0HB 1Y5IA 1NLZA 1ZA1A 4EATA 2RAPA 1BJAA 4FN5A 3ZW8A 1W48A 1Y0UA 3G71I 5C7YA 4WK2B 4M7OA 5LGNA 1I0IA 4BVHA 2WJPA 2BY1A 1PHRA 2O1EA 1FP4A 4AIHA 3JTHA 3DUFA 2YN4A 2XNHA 3ZHSA 2YR0A 2I5PO 4URFA 3J80Z 2ZE6A 1KVRA 2B4AA 1CRLA 2VF2A 5AH0A 4D1YA 3ZD7A 3QFTA 3VV3A 2WF5A 2ZAOA 3KUDA 3VKHA 3RK4A 2VT6A 2ZJ4A 3PUIA 3X43A 2ZSIB 5B1SA 4PCVA 4G97A 3LSKA 1W5FA 2NQ8A 4V2FA 3IRVA 3QE3A 2HV9A 1YIAA 4EY8A 3GB9A 3RE1A 1MMGA 4CV3A 1OBOA 3NBZC 4LJ6A 2WU8A 4X95A 3OYCA 2OSVA 5H4HA 1K89A 2EV5A 2WJAA 4X1IB 3C5VA 3ILSA 3L1JA 3L6BA 1YO5C 3QYAA 1ZJJA 3UA3A 5A05A 1G18A 2KBEA 2LNBA 1F6BA 2FCRA 1RCTE 1QSGA 3GJ0A 5H1YA 4BTVA 3V4FA 3STTA 3VR6A 4OMDA 3UJPA 1ISPA 3ILHA 4R3NA 3UG7A 1H93A 5KJ6A 2X0FA 1WZNA 1D1QA 5FX2A 2KZVA 5EMLA 1FIPA 2E2WA 3EXFA 3NDRA 4JI4B 4KGVA 2VWGA 2VSQA 3DBVO 4RTLA 4MRPA 4R84A 2ZYUX 4RF3A 1MIOA 3K92A 4X1KB 1Y5LA 4CQMB 4OG2A 1HKTA 5FJ8J 4JLOA 4P54A 4PYMA 2DP4E 2VP3A 2FEPA 1S8FA 1F1ZA 2LNDA 1M2EA 4CH7A 2GJAA 1JDBC 1FZQA 3L2WA 2H06A 1ZU5A 2H4ZA 1UWVA 2JPBA 3Q98A 2AI1A 1JHXA 2JT1A 5AKIA 2EZHA 5K1ZA 5E4FA 3CE9A 3QUAA 4Q7QA 1SA0B 4C30A 4Y6QA 4BJHB 1G3UA 4IR7A 3ZLUA 4HAUA 4QVKA 3V7SA 4WOBA 3T5CA 4HN9A 4P7GA 4M9UA 2JS7A 2AUTA 4LXGA 3JQGB 4BLOA 1NI4B 2CXXA 3ZUPA 5KQPA 1MAUA 2BFDB 2V7TA 1CEXA 2V7VA 4URYR 1CUXA 4INZA 1PW7A 1GRRA 2CLFB 4PTYA 5TJHA 2NN3C 4CSWA 5P21A 2WICA 2DFTA 4LGMA 3AXTA 1SFRA 3NZEA 2P9GA 5CBPA 5CVDA 1W44A 1TMGE 1ZITA 3E58A 1XHEA 4JASB 1ODDA 3TRKA 4H31A 1TQPA 3U3OA 1WQ2A 4LWPA 3ASYA 1XU7A 3VPSA 3WL7A 3V7FA 5EPOA 1FUIA 4CIXA 3AG1H 2FQ3A 1P5JA 4BVFA 3T7EA 4WUTA 1VCHA 3DXXA 3FAZA 5JXGA 1SXJA 3UFBA 4OQQA 3V4RA 1I6MA 5C4XJ 1TLFA 1G8PA 3ZZNA 4TUYB 1TWHJ 2Q5FA 4AP5A 1NP3A 5E3NA 1Z4PX 4HGRA 2CLMB 3AUAA 4HQMA 4OGWA 3KKLA 1Y63A 4N82A 1NE7A 1I6WA 3F8SA 3R9KA 1YCGA 3WJ1A 3TLGA 3JY6A 5HK9A 1HURA 4HADA 2PU5A 3ZQ4A 1NJ2A 4UAUA 3FOFC 4N6NA 3VSLA 4FZJA 2QN1A 4X7PA 1C1DA 2GJSA 3MWFA 4DOMA 4PWYA 2VPWA 1J20A 1XSEA 2NYVA 1L2TA 1A2OA 2QV0A 3NXKA 3Q0TA 4DNXA 3D64A 3QP9A 2DWOA 4YAWA 3OF5A 3TD9A 1RABA 2F43B 3RADC 4NV0A 3D1LA 3GFBA 4G2NA 5FV7A 2FZ5A 3DEKA 1I7QB 2VRNA 4Q3OA 3IPXA 2NVTJ 4YACA 4ZO8A 3DF7A 2GK3A 5K3AA 1BW6A 4EJVA 2C4TA 2I2DA 1Q3TA 1G21E 4YMSA 2WQZA 4OOEA 2HZ7A 3ESAA 2IHKA 3IAAA 1YUMA 3BMQA 2WNSA 3EOBI 5EJAA 2QE7D 5ARDA 2E1OA 5HIMA 2O3RA 4ZVUA 1ZBDA 2HIHA 5FB2A 4ESJA 3TP0A 4EB0A 2GZAA 3TNFA 1EUCA 4PFQA 2H85A 2OT3B 4TVSA 3V8RA 5GAHJ 2Y93A 2C5AA 3GHYA 3DEWA 4RD1A 5GADJ 3RUFA 1POWA 2R86A 2LGJA 2HF7A 2BP7A 2XVZA 4L8GA 1UL1X 5HCNA 1QCDA 4JUCA 2NYRA 3JYNA 3SYKA 4ITVA 4XEUA 4PC1A 1BGVA 2W8BA 4D41A 2DPXA 4ZEWA 4CHTA 3N2KB 2WAQA 2BT4A 3CIFA 5ALJA 2MW8A 1JG6A 2Y67A 5JU6A 2ZUUA 3N7TA 2JW5A 2AFIB 1G5HA 4DB4A 4ZOLA 4FEEA 3JYLA 2OK8A 5FBRB 1BQ3A 3LHDA 1X1BA 4OL0A 5IK2D 2EIJH 4IJQA 3F4KA 3N0WA 4AMYA 1F0NA 1P4AA 1Z4KA 1DI0A 2F00A 1K6MA 3V33A 1W6UA 4MLDA 4JCOA 5ICGA 1T9KA 3LTNC 3DW1X 3DDUA 4TSFA 1FK8A 3O0TA 2CYAA 3EWAA 4C7BA 2VJOA 2OC9A 3BGOS 2JEYA 3CZ9A 3KSAC 4J1QA 4KQIA 4YASA 3GVHA 2CBGA 3LGSA 4CYMA 3TQQA 1SK9A 1PGQA 2JGJA 1E1RD 1CZOA 4EKDA 3C3CA 2AEFA 2FUKA 3RC2A 3R0XA 4JQZA 1T6XA 5LLSA 4DR7B 4B81A 4YP7A 2O8FA 2JSPA 2JJMA 4FX5A 1Q1ZA 2GVNA 1SVOA 2XPUA 2B2NA 2P1RA 1OSNA 4FN4A 1GLGA 3OPVA 4ZWNA 4PAGA 3B12A 1TL8A 4U7WA 2VPZA 1L8XA 2RC6A 1WD5A 2NWQA 1D5CA 5KX5A 2C9BA 1QHEA 3FIWA 2A6EF 1B1AA 1S01A 3U4HA 1JDUA 2UV8A 3HCFA 1JAXA 1KVSA 1V3VA 2ZKZA 2WE7A 4CIWA 1RP7A 1YBHA 1RDFA 2HYIC 1U63A 3EF1A 5AKZA 3UBTA 5AI4A 4D6PA 3ZN1A 1U0OC 5K7HA 3KJEA 2I8LA 2FWNA 5COQA 1H1TA 1T2EA 2LBFB 1LFPA 3FNGA 4ENTA 2XCTB 2VJ5A 1BRMA 3KC2A 5K3CA 2HJSA 4LKOA 5LP1A 4G1UC 2D5VA 4OYHA 2HZBA 3DKWA 1CQPA 3OE4A 3RUEA 1F8XA 4B34A 1M1ZA 2BF4A 3UN1A 1TZMA 2DWPA 3M34A 4J1TC 4DPMA 5E1DA 4BE4A 5CU7A 1NBAA 3IC5A 3FZNA 5DMXA 2WV9A 2BW3B 2OCPA 4YRJA 1EVJA 2V7PA 1UBJS 2CFTA 2ZANA 2P68A 4CM4A 2CNBA 3FYUC 5KDDA 1O6BA 5LB4A 3BH0A 1Q0RA 4V19K 4IG4A 2QTAA 3EYYA 4UVAA 1UBTS 1KHHA 2WM9B 3ZP5A 4FSXA 3ZZMA 4ITRC 2P65A 1OCCH 4II7A 2R47A 3KR1A 1GYQA 4JIMA 2B6NA 2FDCA 3BOSA 4J9VA 2JGEA 4PGGA 1LJUA 1QIIA 2GRUA 5FTNA 3ZCXA 1KQPA 2UVPA 3R3UA 4DLAA 5KVCA 4AMGA 2P5LC 3OPNA 3D9QX 4G7ZF 5EIHA 3NJRA 3HZOA 4IHTA 2E34A 1U80A 2BFAA 3FUUA 1S9HA 1EMDA 2B36A 1G5TA 5F9MA 1NHGA 4P3OA 3M6IA 4Z7QB 1PQWA 1R0YA 1OD6A 3CX7A 4PPYA 4E46A 3EJ6A 4UNNA 2XNJA 1F3LA 4OAQA 1RAAA 4DA8A 4LTMA 1AN9A 2VQEB 1D2NA 1OVGA 5IZCA 1BHO1 2ODWA 3VSAA 1LKZA 4DLZA 1MH1A 2P4UA 1EUYA 2X0JA 4QASA 4EY3A 3MELA 2A9KA 4BCCA 2XNCA 3K0HA 3WJ2A 5CVRA 2CHQA 1V11B 2V7WA 5H70A 4HFNA 3VFDA 2P4HX 3N2GB 1R5BA 4LWQA 3UJ8A 1BWPA 1T1GA 3JASA 4HMOA 3ONQA 1RMYA 1V8DA 1IN7A 2QPOA 2NO4A 3B36A 5LLQA 5LXTF 4BV8A 2NNNA 4O4JB 1UWCA 5BW5A 2VYQA 3L0CA 3AEXA 3DZDA 3TQIA 2FFBA 3CA8A 4OLFA 3PNYA 2CXTA 4QYMA 4DWJA 3PC3A 1Y6JA 2EH3A 3EWIA 3ABMH 1D2CA 5FH9A 3GAAA 2TCTA 3SMQA 2MMGA 3JTMA 1I1SA 2E18A 3L2VA 4OYLA 4MUXA 5A2QA 3Q6NA 2IYUA 1QP7A 5FL7A 1S72I 2D59A 2PKEA 4P96A 2XMPA 4CM9A 3A31A 3PC8C 1XZDA 3UQZA 4PWZA 2VYCA 2VDMB 2Q7XA 1CIPA 5KNBH 2GB4A 1IPFA 4G1MB 3P9XA 1T56A 2M0MA 1JKQC 1PGPA 2XBUA 3K31A 1YVRA 1Z4OA 2ZBKA 3DYVA 4AUKA 2HCFA 2QQ8A 1G6OA 3MIIA 4G0ZA 5KEIA 5GIOE 2PMCA 2IXDA 2XA2A 3GLFB 4GEGA 3SFTA 2PKRA 4C0WA 5B4VA 2NT3A 5HUJA 4WL0A 4AJ4A 4TLLB 3NBAA 4PX2A 1U31A 1NNLA 5C32A 1WZ2A 4WASA 3TO5A 3RTGA 3EUHA 5EE1A 1QUEA 1BXZA 3KBOA 4YAEA 3E3NA 2PE5A 4Y6RA 1G8AA 2P40A 4F4UA 4MWDA 3RCBA 3JZAA 3H5NA 2PFSA 5JC1A 4BC1A 5IYCJ 2OZ6A 3ZY5A 3AR2A 3UG6A 3LY5A 1P1HA 3CNEA 3L09A 3RK1A 4KMFA 4Y9SA 5IJ9A 1JA0A 4J19A 2BUBA 2X9LA 2DWQA 2QTVB 3GRAA 3EN0A 2W2MA 4G84A 4AJOA 4F5YA 1TJNA 4QDKA 1T9ZA 4JI3B 4FEYA 3F74A 2O7RA 2K9NA 2QYHA 3LA3A 5FEMA 3SBOA 4JB0A 4CEIB 4RF5A 5KK1A 2M8GX 5KYWA 4XAQA 5HM8A 2PCLA 3MCZA 2BFOA 4EI7A 1NRWA 1ZARA 3PR3A 4LZAA 4QA9A 4ZKEA 4UM7A 3AUYA 2FPOA 4JOBA 5DTJA 3UYLA 4NC9A 4C01A 5CDYA 2YU3A 4DZZA 2XHKA 1Z39A 5CJPA 3L9WA 1JHMA 3WTBA 1ADFA 3AVUA 5CVCA 4MA0A 4WN9A 5ERXA 3J80K 2GX6A 3S29A 4M0MA 2QZZA 3OYDA 1Q7EA 2Z4RA 4IQFA 4WX2B 4B80A 4L75A 2H1VA 4JK1X 2Z8YM 3VJLA 4JLVA 3A4VA 4WWCA 2HX1A 5TPZD 4O8ZA 2VE9A 3CZCA 3WMRA 1GPDG 1NC3A 3OQJA 3PQJA 3WU2C 2H6BA 1BROA 2GF9A 2CBXA 4I1RA 1F06A 2FUCA 4RNCA 4MEYF 1YVEI 1NVAA 4DRXA 1PUXA 4W7IA 5DNEA 1ISIA 2VAVA 4YAFA 5L51A 1G3WA 2Y99A 4PVDA 2DLCX 5C1DA 2Z2SB 5TXGA 4NAVA 4FHTA 1EEXB 2A9VA 1NKSA 1EFRD 5A5FA 4DM7A 4MJ7A 5AM0A 4P32A 4PM4A 5BP7A 2WD7A 1D2MA 7AT1A 1NATA 4OH7A 1W5EA 4F04A 5CT5A 4RAFA 5L3EA 1TIPA 3PRJA 2VCHA 4L95C 2FLKA 1G16A 4BQAA 4J94A 2ZKLA 3D8SA 5JADA 3SC3A 5CVJA 1TC1A 5EERA 2XUKA 2PYZA 1UFMA 5G0TA 2Y4OA 3HVKA 1GZ5A 4KFTA 3R7BA 3UJ6A 4M1QA 3OYFA 2WTMA 5TGDA 4WBNF 4C78A 4J01A 1UHSA 1AB5A 2GEFA 1RHQA 1MNDA 5AHRA 5KTPA 3C2HA 3SS8A 2DMTA 2ZBGA 3V7YA 2ZFWA 5B55A 4F2GA 3VZCA 2O2CA 3HU2A 5SZIA 1X8KA 5IJZA 1MO3A 2N3ZA 1ADYA 2FR1A 1XO1A 5K51A 3ACDA 1J5YA 4BLVA 3Q87B 4TSRA 2ZRPA 3PUXA 3UK6A 2RI0A 2V3WA 5IY5H 1A97A 1E99A 3N2ZB 2BE5F 2R7ZJ 2W48A 1MGOA 2HBRA 1YR9A 1D9XA 4IRUB 4IOLA 1YS7A 5TRDA 1DAGA 2HWKA 3DV8A 4LXUA 4EL0A 3BT7A 1F51E 3I4LA 4X44A 3K0FA 4UM5A 2IGTA 1TNTA 3VSEA 3KYDA 3TOBA 4BO8A 2E5LB 3PIOF 3A1UA 3GEHA 4L07A 4JQFA 1VHJA 3NKLA 5EWJB 1CNMA 1NBIA 5E6SB 4DMUB 3ABIA 5C1IA 3OKPA 2D1RA 4KRGA 1EGAA 3FWEA 1BOOA 4I3FA 2REOA 4K26A 4YIHA 4IOCF 1KJWA 5K4HA 5EN4A 4NU0A 3QBVA 1RCUA 5CVEA 3MT0A 3LO5A 4EM1A 2E19A 1W0JD 4D25A 3B3AA 1K66A 3L8HA 5A9SA 4OQLA 5AUPB 3ED5A 4TMZA 4UBLA