3H5RA

Crystal structure of e. coli mccb + succinimide
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
348
structure length
340
Chain Sequence
b'MDYILGRYVKIARYGSGGLVGGGGKEQYVENLVLWENIIKTAYCFITPSSYTAALETANIPEKDFSNCFRFLKENFFIIPGEYNNSTENNRYSRNFLHYQSYGANPVLVQDKLKNAKVVILGCGGIGNHVSVILATSGIGEIILIDNDQIENTNLTRQVLFSEDDVGKNKTEVIKRELLKRNSEISVSEIALNINDYTDLHKVPEADIWVVSADHPFNLINWVNKYCVRANQPYINAGYVNDIAVFGPLYVPGKTGCYECQKVKENIDHKIKLINSRFKPATFAPVNNVAAALCAADVIKFIGKYSEPLSLNKRIGIWSDEIKIHSQNMGRSPVCSVCGN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MccB protein
publication title How the MccB bacterial ancestor of ubiquitin E1 initiates biosynthesis of the microcin C7 antibiotic.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/antibiotic
total genus 110
structure length 340
sequence length 348
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00899 ThiF ThiF family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1160 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3h5rA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3h5rA02
2P9GA 4TRRA 4BNVA 1JAYA 2FSSA 4ZQBA 1PJSA 3VKUA 4D79A 1JLLA 4UUOA 4XCVA 3WYEA 5JO0A 4R54A 2HO5A 1N8KA 1WNTA 5CHEA 4I5DA 4FB5A 4PG6A 1ZK3A 2V6BA 4KUHA 5IFLA 1PEDA 1LTHR 3ZCXA 5KKCA 3H5AA 1YE3A 1T2AA 1C0KA 2BELA 4W4TA 4A10A 4CMEC 3QIVA 3OECA 3GK3A 5AXCA 2HRBA 5G4KA 4CMJA 3DWFA 1VJTA 4C4OA 2YHIA 5G0TA 4M49A 1PR9A 2O3RA 5A04A 4FIZA 1X1EA 5BSEA 3KETA 3AU9A 2GF2A 4Q3NA 4U7WA 3LF2A 1BGVA 2X8LA 3K8ZA 3M2PA 4XYMA 1MV8A 4R69A 3BMNA 5CG2A 3HDHA 4IDDA 4P38A 4CQLB 2AE2A 3C1TA 3WS7A 1Y5MA 4L0QA 2ZYGA 5THQA 5AXBA 5ICSA 1KEVA 5IDQA 3MTGA 3HDJA 5DP2A 2Q49A 4Y6RA 1WXDA 4FJ1A 2VN8A 2NVUA 4JN6B 2Q1WA 5DCYA 2CDCA 3C3XA 3F1LA 5I7SA 2X0NA 3RJ9A 4CLEA 2X9NA 3VVBA 1NTOA 1MP0A 3IJRA 1XSEA 4P4GA 5DF1A 1LQUA 4CLRA 1NQ5A 2GNAA 3A9WA 1KVUA 2UUOA 4RLSA 1Y8QA 3R3SA 4X54A 2QIOA 1MG0A 4Z0PA 1N5DA 1LDGA 5BT9A 3QWFA 1EE2A 2OUIA 3ANLA 4RF5A 2D1YA 3RUFA 2HKIA 2NU7A 1R4NA 4J1NA 2BD0A 3OJ0A 4DMLA 4I5FA 1ZCJA 1SBYA 4TRJA 4B4VA 1WP4A 3LLVA 2NTJA 3FTPA 1XR3A 1Y9EA 3PYXA 5GZ6A 1B8VA 4GH5A 2X5KO 2QG4A 4YXFA 1GD1O 2VUTA 1HLPA 5THKA 4TRMA 3KYCB 4MINA 2PZKA 2VWQA 1B8PA 3SJ7A 1ZEMA 1UJMA 1HRDA 1BWSA 1R0LA 2RAFA 2VUSA 1ADGA 3O9ZA 2PV7A 5I9MA 5JYEA 4CM1A 3WB9A 3E18A 4BO8A 3QVWA 4MIYA 5LC1A 4E2XA 2JCXA 3EMKA 1Z82A 4N18A 2HJRA 4BQRA 2Y99A 1WVGA 3GAFA 4A7PA 1PGQA 1XQ6A 2X5JO 5L4SA 4BNWA 1ISJA 3GVHA 2JFHA 4BO1A 3IP1A 4OJNA 5L4NA 5IJZA 3RC7A 2DPGA 1GYRA 3MTJA 4INAA 4AJNA 1R66A 2O4CA 4BGEA 1SPXA 4LCJA 4CQMA 3VZRA 5KCZA 3H8VA 1QSGA 2W98A 4I9NA 4OKNA 3P2OA 1VI2A 4DMMA 3SLGA 1R15A 1V8BA 2B0JA 4DVJA 4W6ZA 2A92A 2WE7A 4CMIB 4HUJA 3DBLA 2OOSA 3E5RA 4K28A 1CRWG 2TMDA 3IUSA 3NJ8A 2PY6A 3CIFA 4PVDA 1EVYA 4NNJA 4QT0A 4O63O 3QVXA 4UEJA 5JDIC 3U09A 3WXBA 1P1JA 1QR6A 3VPXA 4IQ0A 4J9UE 4G65A 3Q3CA 4BO7A 1I8TA 3TZ6A 3R0IA 4CMAA 1P0CA 4B8ZA 2Y1OA 3DXFA 3H9EO 4UVDA 2XXJA 4AJPA 3DL2A 4J49A 3PJDA 3DO5A 1P1RA 4CM9D 3D1LA 3ORFA 4CM8A 3CSDA 2BFPA 2NM0A 3GVCA 3DZGA 3HFSA 3MJVA 3WGYA 1QYVA 2QZ9A 1R12A 3WTBA 4CMGA 2C7GA 4GL4A 3FTNA 4N5MA 1BVUA 3WX0A 3F47A 3OSUA 4XJSA 2XAAA 4OXKA 4XKJA 2NVWA 3DZIA 3G0OA 4WCFA 2XPCA 4H15A 1X7HA 3T7CA 4AJ4A 3VDQA 4LVUA 1U3VA 4FGWA 3PJFA 1ZVMA 4ND2A 2ZQYA 1LSSA 1ZH8A 1HE5A 3IOYA 5KJ6A 3B1JA 4J43A 3WJ7A 1GFSA 2Q2WA 2RHRA 1KVRA 4L9RA 2PD4A 3PP8A 4CJXA 5B4UA 4NR0A 2WD7A 4ZQGA 3FD8A 4FFMA 1X13A 2BGKA 2Y66A 4O1MA 4AJ2A 3ROPA 3BMCA 2H6EA 3F5QA 2QYTA 3GNQA 4KP7A 4JBGA 4PLPA 5COQA 4P22A 1PZEA 2W90A 3PDUA 4E21A 4ILKA 3SXPA 4GQAA 1YL6A 2NTNA 3RFTA 1SOWA 2AEFA 4CM4B 5KIAA 5IZCA 1A4IA 3AJRA 2V65A 3RD5A 3IJPA 3JQCA 3EC7A 1L7DA 3D3WA 2DBQA 1U8FO 2GN8A 3ZWMA 1FDSA 4LCEA 4IZIA 1P45A 4BKUA 1DIRA 4FPXA 4Z9YA 1AXEA 1LRLA 1D8AA 2BHLA 1MX3A 2YFQA 4HFNA 4YJGA 1UXIA 2RCYA 1IYZA 2HMWA 3NTQA 1H93A 3QY9A 3JQAD 1MXHA 3ANNA 4IXWA 4FGSA 5JDCC 3PTZA 3L9WA 4AVYA 1PJLA 2RH4A 5CEFA 4IS3A 3AM3A 2ZB4A 2ZYAA 4R1SA 5H83A 1DOHA 4F45A 1NX6A 3K30A 1PIWA 2EKPA 2ZQZA 3TF5A 4PZDA 5IDYA 1KEWA 1IUKA 2O7QA 4LSWA 1V6AA 3MWDB 3DBRB 4CMHA 3NGXA 1LSJA 1ONOA 4YDRA 3PJEA 4HWKA 5J23A 3AOEC 4AJ1A 3Q11A 3EUWA 3UHAA 4P4LA 1XGKA 3ZHBA 4NDNE 3V8BA 2ZIZA 2HMTA 3JQ6A 4NIMA 3CPSA 2ZJ0A 4Y6SA 4EUFA 2CY0A 3JQFA 3WSWA 1T1SA 4BNLA 4RVHA 1PJQA 5JLAA 4CR8A 2NU6A 1NFQA 2D3TA 1I5RA 3PK0A 2NSDA 4XGNA 3TSCA 3WSVA 4AJOA 1GPDG 3W8FA 3SC6A 3GGPA 3D0OA 1KY4A 1ULUA 2EKQA 3DONA 4IIUA 2W2LD 5JXWA 2ZJ1A 2NADA 1YBVA 5G4KB 4WGGA 4BO5A 4PIVA 3G79A 3I83A 1YB4A 4EDFA 2G0TA 2YHIB 2G5CA 5IZ4A 1E7QA 3KM0A 1GYQA 2ZTUA 4Y6PA 2J5KA 1B3BA 4E5MA 2BH9A 1U9JA 4DQUA 4RCVA 1E1LA 2WYVA 3BMOB 4WLVA 3BMNB 3RUHA 3H9QA 2PH5A 2XF8A 3CMCO 4RQTA 1YQGA 2O48X 3ZNQA 4EEXA 4MP8A 4EUEA 2BKAA 3IKVA 2DTEA 3V2UA 4R3NA 2IYOA 1SAYA 2G76A 4JNKA 1F12A 1C0LA 2CMDA 5G0SA 1NFRA 3GN1A 2NVUB 2O4UX 4MVJD 4RDHA 2BRUA 1A7KA 2PK3A 4Y98A 3JQAA 3TDKA 4Q39A 3NGLA 1P31A 4BIIA 5CPFA 4XRGA 3GGGA 4CLRB 1HF3A 2DVMA 2NV6A 4G2NA 1WDMA 3HADA 4QX6A 3WLFA 7ADHA 1HE3A 1LU9A 4G5HA 1EVJA 3TZHA 5L7YA 1DC3A 2W4QA 3OBBA 5JCJA 3U0BA 5CDYA 1SCUA 3H6KA 1O0SA 2X1HA 3H7AA 1UZMA 4FR5A 1D3AA 1Y7TA 2RBEA 5TC4A 3RKRA 2O3QA 1I3NA 3WQQA 1RM3A 3RIHA 2DBZA 3OA2A 4EJ6A 1DB3A 1QYWA 1LBEA 5JE8A 1HETA 3DDNA 1M66A 3FPCA 3KBOA 4XQGA 4K6CA 4Q9NA 2J3KA 1AHIA 5HM8A 1VJ0A 5IDXA 1O8CA 3GDGA 1IZ9A 2NVBA 1LJ8A 3AFMA 3GEGA 2X22A 3RCBA 1UP6A 4GGOA 5CDTA 3A1NA 1DRWA 3SEFA 3ZN2A 2OBYA 1I3LA 2C82A 1ONPA 2PGLA 4Y9DA 3QVOA 3UKOA 2ZK7A 4JJIA 3TL3A 4CR7A 5IN5A 2BFOA 2V7PA 4PCVA 2XXBA 4R9RA 1Q7GA 1R4MA 3FNEA 3DAGA 1NNUA 4CQLA 1YS4A 4PG5A 1I36A 3HUDA 2EEZA 1P1KA 4BV9A 2B4RO 3C1AA 5EERA 5T67A 5IN4A 2W2LA 2WMDA 2X9VA 4CUZA 4BUCA 2UAGA 2P91A 3OJLA 1HE4A 4CQMB 1A71A 3R1IA 4E2YA 1E6UA 3WBBA 1M2WA 3X2FA 3KZVA 3S2GA 2OORA 3OM9A 1BXGA 4YAKA 3ZWWA 3F5SA 3PIDA 5DN9A 3TN7A 4AJIA 2DPHA 3DBLB 1ID1A 2HUNA 3C7DB 3UICA 5K6AC 1IPFA 1V0JA 2AQ8A 4MVJA 2FN7A 1K89A 5JNLA 2QZZA 3LQFA 3PEFA 1J5PA 1LDEA 4J3FA 4QSMA 4J2OA 3LC1O 3MWEB 2H63A 1YQXA 3EGOA 4FFNA 1XQ1A 3P5SA 3VPSA 4H16A 4CL8A 2GSDA 4XGIA 1HDGO 1V9LA 3GEDA 3B6ZA 5BNFA 4NFYA 4MKRA 4GAEA 4D3FA 3INTA 3FNGA 1HDZA 4AICA 3KLPX 4HX5A 4F46A 2JAPA 4CM8B 1ZXBA 3Q9UA 1P77A 4XQCA 1QV7A 4BKPA 3HN7A 4J9VA 1E77A 2R00C 2VYVD 4H3VA 1C1XB 5L3ZA 1PS9A 5K6AA 3H5RA 4KDEA 4M86A 4OGWA 4CV3A 2VTEA 1TB4A 4ZA2A 3ZWNA 3TZQA 2NU9A 4WCFB 3IS3A 5CEJA 3GR6A 1KEUA 4YR9A 5T8KA 3UCXA 3UXYA 3E8XA 2I76A 2PH3A 3GG2A 4CLOA 5JY6A 1C0IA 4BGUA 4YRBA 1H6CA 1QG6A 1B14A 1DJQA 3D5TA 3DZFA 4TWRA 4XYEA 3MJEA 1LUAA 4JIGA 1NM5A 1V3UA 1JKIA 4YB8A 1MLDA 1QORA 1VL8A 4OXYA 1EQ2A 3WBFA 3LK7A 1ULSA 1PZGA 3HDYA 3E9NA 1FDTA 4UAGA 1WMAA 3BMCB 1XIVA 4M54A 3UOGA 3GGOA 1YBMA 3ITKA 1W0CA 3ZU4A 3ICPA 3ZV4A 4JXKA 3ST7A 1K0UA 2BF7A 4LRSB 3JQ8A 3GFBA 3JQBA 4H7PA 1YVEI 4NU5A 3IUPA 2ZB3A 1EK6A 5A02A 4XQEA 3L6DA 4M89A 1RKXA 5L45A 3D3WB 2UDPA 4BL5A 1TT7A 2OO5A 1LX6A 4PLTA 1K6IA 1PL8A 3N58A 3ZWCA 1VJ1A 1XYGA 4YJGB 4BOYA 1LDMA 5G0VA 3VZQA 1HE2A 3ZWYA 3CE6A 1CERA 3SJUA 3FNFA 4WE3A 1KY5A 1ZSVA 1U2GA 3N74A 5AOVA 3L6OO 4WCDA 3I6QA 3EY4A 4E2WA 1DC5A 1OC4A 4IDEA 4W9NA 5L53A 2C54A 1SOVA 5CP8A 1W73A 4D46A 1E5LA 3D4OA 5BSFA 1QYXA 3NDIA 4IGEA 4K26A 3W4IA 4TZTA 1NASA 4WLNA 5DULA 2CDBA 2I67A 1J4AA 2PFGA 3JD0A 1Y5RA 4AJJA 1YDEA 5JAQA 2POQX 1H2HA 4RVGA 4ALJA 5FWNA 4QUKA 4YPOA 2HQ1A 9LDBA 5C7OO 1AN9A 4FW8A 2VYVA 4R5HA 1H94A 4B7XA 2Y1CA 4XB2A 1YB5A 1Z75A 2WYWA 4N5LA 4GVXA 4E31A 3VDRA 3OEYA 4YYZA 4B3HA 4JJGA 5EIOA 5T6BA 3HFGA 3C7AA 2YW9A 1AGNA 4RF2A 4OO3A 3GNSA 5COBA 4EITA 4A73A 2VWGA 5C37A 4ND5A 2VOEA 1YRLA 2FMUA 4BNMA 1B15A 5ER6A 5BSGA 1S6YA 4NZ9A 4R1TA 2JCVA 3L6EA 1Y1PA 2D4AA 4OYRA 3VOSA 4D42A 1KVQA 2X0IA 5L4LA 1FK8A 1NAIA 4B4WA 4RVUA 4UUPA 3U4DA 2O23A 3G1TA 2BGMA 4IJKA 1E3WA 3GT0A 3JYQA 3LF1A 3ENKA 3JSAA 4NMHA 4JQCA 2PKQO 1FF9A 4DREA 1DRUA 4KOAA 4B7UA 2QYSA 1I2BA 2HK8A 1XWFA 2ZTVA 3S2FA 1GQ2A 5TRTA 2I3GA 2GD1O 1ENOA 1YL5A 1Z45A 1IZ0A 3NUGA 3F4BA 5TIIA 1VKNA 1PJTA 3NX4A 1D4FA 5HWSA 2D5CA 4WPGA 1FDVA 3GAZA 1NQTA 1QYDA 1DEHA 4WASA 1GAEO 3DBRA 1ZKMA 1WZIA 3Q2IA 1B0AA 4LW8A 4R51A 1NWCA 3LC2O 2IZ1A 2JCYA 5KTKA 3AW9A 3IQDB 3JYOA 4A2CA 1W4ZA 1RM5A 3GY0A 5KKAA 4E3ZA 4OOEA 1EUCA 4KWHA 4BB6A 1YXMA 4ESOA 1XEAA 1WLYA 5A3JA 4XGKA 2WYUA 4YA6A 5F5LA 5EPOA 5JBIA 1N9GB 2Y68A 4DXHA 1EVIA 3K5PA 2SCUA 1RYEA 4E4YA 3EZLA 1X14A 3WIEA 3WTCA 4MVJM 1E1MA 1NHWA 1BDBA 3HB5X 2CDAA 4U0JA 5A5FA 4RV9A 3AY3A 1TVEA 1W8DA 1CIVA 3F3SA 1I3MA 3I1JA 2B4QA 2IZZA 3PIIA 4R3WA 4WJZA 3WGTA 3DTYA 3U49A 1OZAA 4CQMD 4Z9FA 2YQ5A 3U4CA 1JN0A 3AOGA 3EYWA 3S2EA 4A27A 4DLBA 2I9PA 3NJ4A 3AU8A 2VZ8A 1JWAB 2IYPA 4OL9A 5KJ1A 3BMOA 4XR4A 2UVDA 4D45A 1MC5A 2X0RA 1R4MB 1E7YA 5H81A 3CMMA 4FN4A 1GUFA 4BHTA 2X23A 2PD6A 2VWPA 2JAHA 3DBHA 4GLOA 4J0EA 1SC6A 2Y0DA 9LDTA 5IXYA 1B26A 5EINA 2Q1UA 3C7CB 3PZBA 5CDGA 5KNLA 1PL7A 3BTUA 5I8WA 3FF4A 5F1KA 2DFVA 4QEDA 3IC5A 3ZNOA 3QWBA 4NG5A 4ZU3A 5KJEA 2WWRA 3VAZA 1BXGB 3ONEA 5EN4A 1LC0A 4FFPA 3UH1A 3DMYA 1GV1A 1N92A 1G1AA 1GUYA 4F6CA 4J16A 3UAGA 1DSSG 4YJFA 1UXGA 5JY1A 3CTMA 1NBOA 4CPDA 1N7HA 3O8QA 1HEUA 5L7TA 1XLTA 4YJDA 3WGQA 4D3SA 3P7MA 5TNXA 5F1OA 4RPHA 1XKQA 2GERA 1GEEA 1LNQA 2OMEA 4NPCA 3AY7A 4UVGA 4N54A 5IDWA 5MDHA 3BYZA 2ILTA 3HE3A 3IDSA 3LC7O 4R01A 4B79A 3E6AA 3ZWBA 4GX5A 1YOVA 3ZW8A 2HSDA 4EZBA 5C7LO 1YWGO 3NEPX 1D1SA 3KVOA 3K31A 4MPDA 5AVOA 1LQTA 5I7EA 1D7OA 4D0RA 4J4BA 4JLWA 4KZPA 5F21A 4N5NA 1M6WA 2P68A 4O5OA 1TLTA 1Y81A 3GMDA 3BMQA 3D3EA 3GOHA 1E7SA 4DPMA 2VHYA 1VC2A 1HDXA 3C1OA 1NWHA 4XRRA 4Z3DA 1YH3A 1LRKA 3FRJA 1DIAA 4PFJA 4AFNA 4CLOB 3VPFA 3PI7A 3V2HA 1DRVA 4MKZA 4BMNA 4RL6A 2PKQP 1EUDA 4CM3A 4FOOA 3QHAA 1VE9A 5CG1A 1JKJA 4Q3CA 5LDGA 2VUUA 4IXTA 1ENYA 2Q1TA 3WQSB 3JQ9A 3QSGA 2PNFA 2WJPA 3O4RA 3STHA 1QP8A 3K9QO 3GHHA 3V2GA 3JQ8B 4DIFA 1E6EA 4ALKA 1IHYA 1N1GA 1ZEJA 2I65A 4YCAA 3NT2A 3ZNPA 4A5OA 2CNBA 2YUTA 1MB4A 3ENNA 3GG9A 4L4SA 3DZKA 1EK5A 4IDAA 1N1EA 3AI2A 1O94A 3RU7A 2NTVA 4L76A 2PGDA 4IDGA 2QHXA 1KC3A 4TMFA 4BO2A 3PDJA 1I33A 1SZJG 4YEDA 3VZPA 4HADA 3CXRA 2Y93A 4WEOA 3C24A 1C1XA 1BW9A 3K6JA 1P9LA 3OHSX 1ZK2A 1ARZA 3RU9A 4GBJA 1GTMA 4PLFA 2JHFA 3JV7A 4B3IA 6LDHA 2R00A 3AM4A 3RUAA 3WQRA 4E5YA 2NLOA 4L73A 4BNIA 4WLFA 3H9UA 1Q0HA 3OIDA 3ONFA 4DL9A 1DBVO 4UVEA 1A27A 3N7UA 4KWIA 4TKMA 1NR7A 4FOSA 4XEHA 4MP3A 1NFFA 5T57A 3AFNA 3DBVO 1Z7BA 3T4XA 1UP4A 4PZEA 4F6LA 2O2SA 4MIOA 4TROA 1JWBB 2FHSA 3GEMA 1E3SA 4J90A 2NU8A 3P2YA 4BB5A 1AXGA 4YRDA 4GX1A 5TLSA 3L4BC 3KYDA 2VT3A 3COSA 5IAAA 4NBTA 4E5PA 1G6KA 5GMOA 4FJ2A 3PWZA 3K73O 2DQ4A 5TJ9A 1NVMB 5TF4A 1I24A 1UAGA 1WW8A 3JQ7A 2CVOA 5A06A 4FBGA 3IL2A 1BRMA 5JFOA 3ZWXA 2WSBA 4GKVA 2IE0A 3ETEA 2X6TA 4OMUA 5EQFA 3PJGA 3PYMA 3PHJA 1E3WB 1Q2XA 3SC4A 5BNIA 3DR3A 3GZNA 4J2HA 3HDQA 3C8MA 3LVFO 2R6JA 4CL3A 1CETA 2ZATA 2G17A 3WLEA 3BHMA 2Q99A 2YV3A 1PZHA 2AHRA 1Y8RA 2AW5A 2I3AA 3G3EA 5T5QA 1PGJA 4JP3A 5B4VA 3U4IA 5JCJD 5CDSA 1R0KA 1FDWA 4YQZA 1PJCA 5HTOA 4J6FA 3UCEA 2RIRA 2NWQA 1TA4A 3OIFA 4PGFA 1D1TA 2VQ3A 1UXJA 3O03A 4BNFA 4E2ZA 1ZBQA 1MUUA 3LYLA 1H2BA 4Q3BA 1HDRA 2H9IA 5HS6A 4KDFA 1V3VA 3VTZA 1YO6A 3MZ0A 1PQUA 1LDBA 4G81A 4XWYA 3RQSA 5ICMA 2YY7A 4GVLA 4RO0A 1ZK4A 3QVSA 4HV4A 4E13A 3WICA 4ZRMA 3VHRA 4MVJE 1EE9A 1P3DA 1DAOA 4WKGA 3W1VA 4PN3A 3IIEA 1EDZA 3INRA 4RLHA 3GDFA 2OFPA 4XYLA 3OJOA 3JD1A 3Q6IA 4NK4A 1T1RA 1SEVA 4HFMA 3I4FA 2B4TO 3W8EA 1G0OA 2GZ1A 4PG4A 1L1FA 3MJCA 3Q9NA 5C5IA 1K6JA 1OOEA 4YRAA 4XB1A 1HL3A 1KVSA 4K6FA 3VH2A 1ISIA 1RM4A 2GASA 1DHTA 4U8GA 1BG6A 3TQHA 4GGPA 4Q3AA 1LSUA 2GO1A 3AUSA 4PZCA 4E5NA 1Q0LA 2C2YA 1F14A 4RPKA 2HRZA 3ZI0A 2GZ3A 2VRCA 3DBHB 3DZJA 3OFSA 4TVOA 2J3HA 4D3DA 3ZHZA 5IG2A 5ENDA 2Z1NA 2EKLA 2AEJA 4DTIA 4B4UA 1U5AA 4IIVA 2YZ7A 1H9AA 4IM7A 4PVCA 4DQXA 1SB9A 4AJLA 1H6DA 1YB1A 4I8XA 5DBGA 3VPHA 3ZU5A 2QX7A 3GLQA 3NDRA 1BXKA 4YAGA 3FBTA 5L7WA 3WGOA 4ND3A 1ISHA 1E3LA 1NPYA 1SMKA 4YJFB 2A94A 1MFPA 2HMSA 4BVAA 3B70A 5GZ1A 3O8QB 1N9GA 4J4TA 4CUKA 3PPIA 4CLXA 3QWIA 1ZZEA 2EWMA 2ZKLA 3ZWPA 2YV1A 2JD2A 2O2YA 3MJSA 2NACA 1PJBA 4R41A 3PLNA 4ZRNA 1TI7A 4URFA 2HMVA 5A9TA 2VCYA 4ZD6A 1KBZA 2FY8A 2JJYA 1A5ZA 1BDMA 2Q46A 3D4PA 4IINA 3K92A 4BNHA 4OQZA 3ZV5A 1YOVB 4YT5A 5EL0A 4CMEA 4OHUA 1P1HA 5DBIA 2Y1EA 4CUJA 2DUWA 3ZV3A 1DC4A 1GYPA 4FFRA 4ZICA 5KJCA 1PGOA 5G4LA 3JYNA 1U3TA 1E5QA 4WNIA 2WM3A 2FPIA 2PWZA 3BA1A 4R4JA 1X0VA 2VHZA 3TFOA 4FQ8A 3BIOA 4J1SA 3SLKA 1A72A 3SX2A 5CDUA 2C20A 1UDBA 3ADOA 5KVSA 2C7VA 5I7VA 3MCVA 1UP7A 1GU7A 2HDHA 4NJMB 3V1UA 3BMQB 4D7AA 1I30A 1QMGA 3ZW9A 1TXGA 2P9EA 3NDJA 5A9SA 3L4SO 1K3TA 2VZ0A 4LRTB 4Q3DA 4E33A 5F5NA 2QQ5A 2ZTLA 5JC8A 1LDNA 3QA9A 3GPIA 3WGGA 4B4OA 3QJ5A 8LDHA 1EBUA 3GC6A 3WDSA 2NQ8A 3TOXA 2G82A 3ASVA 3IKTA 1XDWA 3GH3A 1XELA 1PSDA 3GF4A 3H3FA 1O89A 1GCUA 3HSKA 1ORRA 5AXAA 4DA9A 5TSDA 4E5KA 2Y0CA 4ID9A 3GPDG 1PJ4A 2X0JA 3HZZA 1BTOA 1BMDA 1QLHA 4XQ9A 1NPTO 3G1UA 2CF5A 1F06A 4M87A 4UULA 2EGHA 2Y0EA 3PQEA 3LLSA 2VT2A 3GN2A 3RFXA 1WZEA 4UVIA 3CUKA 3ICCA 4BGIA 1XU7A 2P2SA 3KRTA 1Q1NA 4DC1A 1CQIA 1T4DA 4XZ3A 2JL1A 1EEHA 4ITUA 3NAQA 3F4LA 2PD3A 1P0FA 2AXQA 1LEHA 4FCCA 2P5YA 3I6IA 1C1DA 3IMFA 3WWYA 4JJFA 3NTRA 4NBWA 4GSLA 3DZHA 4Z9XA 3NKLA 2DFDA 4UUNA 5L9AA 4J1TA 4OIMA 5A5EA 3AUTA 4BNZA 4NHEA 1YQDA 3RUDA 4KQWA 5I9LA 3PWKA 1U4OA 3E03A 1BW9B 3GUCA 4D44A 4MVJG 3Q2KA 3LDHA 1E7WA 2DT5A 3FR7A 5MGBA 3DAFA 1LDYA 4QFCA 1ZSNA 5LDHA 3ZNNA 4PRLA 5B12A 3OQ1A 2J5QA 4GKBA 4K9DA 1P1FA 3VVCA 4HFJA 2OL4A 3VPGA 3GQVA 2Y05A 3E48A 4ZGWA 4FSHA 5EJ2A 3DMTC 2Y1FA 3NYWA 4YT4A 1YL7A 3AK4A 4YWJA 2WDZA 2Z5LA 4WCFC 1EMDA 1M6HA 1DHRA 4NI5A 2EW8A 2H1SA 2LDXA 1PJ3A 2FR8A 2ZCUA 4GMFA 3U3XA 5G2OA 1F8FA 1GEGA 1GQQA 1JDJA 1DFIA 1U3WA 2Z1MA 2VRBA 4CLDA 4S3MA 4W7HA 3KYDB 4J7CA 2GLXA 1PJ2A 2O3TA 2PR2A 3CINA 3CZMA 1K6XA 1U28A 2PZLA 4KQXA 3JQ7B 4WLEA 3UFXA 3I9OA 3UW3A 4M8SA 1NVGA 5JDIA 4OXNA 5FYDA 3WYCA 1LC3A 3WNQA 1H5QA 1C3VA 3BTOA 2E48A 1Y9AA 5IZCC 3RROA 3GZNB 3WGHA 2VNAA 1KIFA 1VLLA 1ZW1A 4HNHA 5DCWA 4ZVVA 2EF1A 5BNTA 2ZCVA 3GRKA 3RUEA 2GZ2A 1Y8RB 2IXAA 4MDHA 1KS9A 4RPJA 1GV0A 4RORA 4QTZA 5KWEA 3GNTA 2AQHA 4DGSA 1U5CA 3PYLA 1I2ZA 1J6UA 4GX0A 4DIBA 1U2DA 1Z7EA 4NH4A 3DZBA 2UV8A 2Q3EA 1VSUA 1JAXA 4GLLA 4TKLA 4RPGA 3M6IA 5HRUA 2PKRA 5LCXA 1KETA 2JHGA 3KXDA 2GN9A 3X2EA 3P19A 1RM0A 4Z0HO 2O3UA 5I9NA 4MVJF 3GA0A 1IULA 1E7MA 3GVXA 1PWZA 3CKYA 4GPD1 3ZGYA 3QW2A 5CFZA 4DPKA 4BKRA 1RPNA 4NFHA 1PWXA 2C59A 3HB4X 3O38A 3OQ6A 3JQEA 1O5IA 4PLHA 3H3JA 3PHGA 2UUPA 1HDYA 4YT8A 1EBFA 1CEQA 1U7HA 1WDKA 5DDIP 4BO9A 2J3JA 2YFHA 3VTFA 4ALNA 3L4BA 4O6VA 5TQVA 2AA3A 4OAQA 2IXBA 2E49A 4NJOA 1IB6A 3EDMA 3JQGA 4M1QA 3W4KA 3V1TC 1HDOA 4IQ8A 4K1LA 1HTBA 1CJCA 3E1KA 3OETA 4ROSA 3FWNA 2OHXA 3VH3A 1NPDA 5I7FA 1Z74A 2E82A 3KLMX 2O3JA 4CM7A 2IZ0A 2EG9A 3JYLA 3LT1A 4WOJA 1QRRA 3MJTA 2HK7A 4NBUA 3RAJA 3WIDA 3ZV6A 1R37A 4ZQFA 4YACA 4BNTA 3WNVA 1ZMOA 3ULKA 4TQGA 3NV9A 5JDCA 4LSMA 1GDHA 3TL2A 4BS9A 1ZFNA 3ZHYA 5K0ZA 3KTDA 4RQUA 5JPIA 5ILOA 4FD3A 2CVQA 4L75A 1LA2A 4BKOA 4IDCA 1QLJA 2VNSA 4FJ0A 3OICA 4II2A 3PGXA 2C5AA 3EVNA 2J8ZA 1BXZA 4DRYA 3LZ6A 1V35A 4R1NA 2P4HX 3BZUA 4OH1A 4DUPA 4EYEA 3ABIA 3D64A 4NQZA 1O9BA 3EK2A 4HXYA 2DTDA 3DAPA 4OKIA 2AE1A 3AOEA 3JD4A 3PRJA 3ZWVA 3ZWAA 5JC1A 3EAGA 4P4NA 3S1LA 1R6DA 1Q7BA 4IUYA 3PHLA 5ENVA 3ANMA 3NTOA 1DC6A 4Z0TA 4JK3A 1X1TA 1EUZA 5DBFA 3OMLA 1PQWA 2BI8A 4XD2A 1VL6A 4FFLA 3VC7A 3FPLA 4WOKA 3H9GA 3PZRA 4RF3A 4OSOA 1PS8A 4ZQEA 3LT2A 2FWMX 1P44A 4R5MA 2LDBA 3QV1A 4XDZA 4IMPA 1MXFA 2A35A 4P8RA 4OQYA 4IQGA 2DBRA 4YJHB 2B36A 4PLGA 1PX0A 2DBVO 2VHXA 3L0DA 5AXDA 3H2SA 2BMAA 3I4CA 1E7RA 3R6DA 5T64A 3HWRA 1PGNA 1PU2A 4L4XA 3D5QA 1A4UA 2WTBA 1ZUD1 3K96A 5L51A 5B4TA 1W6UA 4II3A 4I5GA 1X0XA 5A9SB 3OEWA 1U3UA 4BO3A 3NT5A 2QRJA 1ISFA 1OC2A 2ZB7A 1PS0A 1E3JA 1WMBA 2CD9A 4BO0A 1HLDA 3DB2A 4Y67A 1EQUA 4PLWA 3ETDA 1PQPA 4W82A 3ZDFA 1N2SA 1Y6JA 5H82A 3EHEA 1UZNA 2CUKA 3NT4A 1PL6A 4BKQA 3EW7A 3PQDA 3I9MA 4MP6A 3ZU2A 2FZWA 4EBFA 2C5EA 3ZU3A 2UYYA 2EGGA 1B2LA 2P5UA 4BNKA 4D41A 3HJAA 3RUIA 1X7DA 4LN1A 1NXQA 3B1KA 1XU9A 2DM6A 4WECA 3WGZA 2DUUA 2GUGA 2Q45A 7MDHA 3GFGA 1I01A 5C3MA 4U5QA 3QQPA 3PHHA 3F9IA 3SVTA 4UUMA 3FWZA 3FR8A 3W6ZA 4YAJA 3WFJA 1I0ZA 1U7TA 1JVBA 5L40A 4TRNA 1ZXLA 4RVFA 5U1PA 1C1DB 4BNNA 4HBGA 2DU8A 4R1UA 4E6PA 4R16A 1P1IA 1K2WA 2YHUA 1HKUA 2G1UA 5ADHA 1DLJA 3PVZA 2H5LA 1H6AA 1NP3A 2ZB8A 1T2EA 3HG7A 3ONDA 1O6ZA 1B7GO 4IJVA 2X58A 4ZN6A 5BSHA 3EVTA 3S2IA 2EIHA 3BTVA 4A0SA 4JROA 4NJMA 5JAZA 1KERA 5TGDA 1IHXA 5DOVA 4DYDA 3DFZA 3U62A 5COAA 1M75A 4BNXA 1DAPA 2B37A 3GUYA 3RI3A 5HS4A 3K2EA 3VKVA 5JAMA 2GPTA 4MJLA 4LISA 3H2ZA 4AJKA 1WPQA 5I8ZA 3PXXA 1SEPA 4RVDA 1B8UA 4QFDA 2J6IA 4CV1A 2NUAA 3AM5A 4R9SA 1MGOA 1MG5A 2P4QA 4LK3A 3HHPA 3CH6A 5T8KC 2PGJA 1J49A 3EZYA 3QE3A 4JCOA 1F8GA 1JW9B 1T26A 2PLAA 2VZ9A 4BO4A 1KYQA 4ONEA 5FI5A 4YAEA 3DC2A 4A26A 4JGBA 1AUPA 1T2CA 2EXXA 2EW2A 1KEPA 4WLOA 1ZK1A 3I9LA 2NQTA 5JO9A 2ET6A 1IPEA 3AUUA 1DPGA 1NAHA 3JD2A 5GZ3A 4ZJUA 1I10A 4D0SA 1JKFA 3GZ4A 5L95A 2I66A 3WGIA 4MVJP 2Q2QA 4RZIA 3JQBC 3I23A 2W2KA 3WR5A 3KYBA 4O59O 2BFMA 1HSZA 4DYVA 1YJ8A 4J0FA 4FS3A 1GZ3A 1OMOA 3GVIA 2D0IA 5G0UA 1NHGA 2VWHA 2FOIA 3R3JA 4MVJI 3A4VA 1HZZA 4KTVE 4W9NC 2B83A 4KMSA 1JQBA 2B5WA 1H0KA 1YGYA 1ZNQO 5A3VA 5U4QA 1ISMA 1XG5A 1YKFA 1YBAA 3MOIA 1GZ6A 5A03A 4DPLA 1PGPA 1X15A 3KUXA 3HQ4O 2E37A 1DXYA 3RBZA 4CR6A 4PLVA 4ZHSA 3PQFA 3WYBA 1U8XX 4JX8A 5KVQA 5A1TA 1ZO8A 3GHYA 3QWAA 3IAHA 4I9HA 4UVHA 4B8WA 1HYGA 4PG8A 2E4AA 3DMTA 2IDZA 4E0BA 3TZKA 1UXHA 4LMPA 3M2TA 2RH8A 1H9BA 2HCTA 3AI1A 3I3OA 4GI2A 4PLCA 4UREA 1ZK0A 2YDXA 1OAAA 5U9CA 3RFVA 4IS2A 2QRKA 4GX2A 3I52A 1EVZA 4I9UA 5K9ZA 4IY1A 1IY8A 4BMSA 4LGVA 4DLAA 2D8AA 2CVZA 3CZRA 2VRCD 4N7RA 3JQGB 1VRWA 5TT0A 5JAIA 1QV6A 4TVBA 4DLLA 4J7UA 3L77A 4CMBA 1ZJYA 1PZFA 4GWKA 4AG3A 3SBOA 1S7CA 2WD8A 4RVSA 1JU9A 2WEKA 1RJWA 5FEUA 3DOCA 2CZCA 1R0SA 2VHWA 4UEKA 3G17A 4RZHA 2BFAA 1ENPA 3BAZA 1NQAO 2D2IA 3V5NA 4MIEA 4CV2A 2IODA 3GVPA 1DO8A 4L8VA 1MA0A 1OI7A 4JBIA 1XA0A 1DIGA 2EP5A 1M67A 3QVTA 2DTXA 4EJMA 5B1YA 1GZ4A 4EW6A 3RKUA 3U5TA 3PLRA 1LLQA 5A4DA 3O26A 3DHYA 5KVVA 2YYYA 5ITVA 1TT5A 2Q4BA 3ZH2A 4LMRA 3E9MA 4DBVO 4O0LA 1F0YA 4U6SA 3ZHXA 4XYGA 3U9LA 3KSZO 3VH4A 3QLJA 2X9GA 1KVTA 1ML3A 3B20A 2X4GA 4TZKA 5DP1A 1GY8A 4J7XA 4OM8A 4CM9A 4IGFA 5GY7A 1ONNA 5EMHA 2OP0A 2X86A 5JCXA 2JD1A 1HT0A 3KOUA 3U4HA 3WMXA 1CYDA 4ALMA 1PTJA 1IOLA 4IMRA 2R2GA 3OJEA 3KV3O 1ZJZA 2I5PO 4DC0A 3FI9A 2CF6A 2X5OA 5CEEA 1IE3A 1ADBA 4W7IA 3E9QA 1LSOA 1SB8A 2DC1A 4WLUA 3RC9A 3PGJA 4MVJH 4PLYA 1JTVA 1K5HA 5JMPA 2OGUA 1T4BA 3JD3A 3C85A 5F1PA 1DJNA 4IDFA 4DIOA 3D4NA 3RBVA 1HYEA 3RWBA 4RDIA 1LLUA 5A05A 3OF2A 1J0XO 1DFGA 5TJHA 4QO8A 1VSVA 3TNLA 2AQKA 2Y67A 2BI7A 3H65A 1ADCA 4OOFA 4JBHA 2A4KA 4CMKA 2O3SA 2BGLA 1KOLA 4BNGA 4YAIA 1UUFA 3KEOA 2CSUA 4MKXA 2HMUA 4OSPA 3G49A 4CODB 1UXKA 2IEDA 4CV0A 3B1FA 1LLCA 4HP8A 3WG9A 2FZEA 3BHJA 4PLZA 2I6TA 4TSKA 2VOJA 4I5EA 1C0PA 2IRWA 4A03A 4DQVA 4ZQHA 1U4SA 3FCOA 1QXSA 2DAPA 3I9KA 1HDCA 3Q0EA 3H4VA 3JYPA 2HU2A 3FBGA 2E6UX 1CF2O 1B3RA 1HZJA 4LVCA 3D7LA 4GMGA 5IXSA 1NQOA 3F1KA 3A06A 2X7HA 3DHEA 1UAYA 2JKVA 1G0NA 3S55A 3UUWA 1FJHA 1F17A 2JD0A 5CAEA 1Y8QB 3W8DA 1OFGA 1MFZA 4WNCA 4MO2A 2GDZA 1Z73A 3TPCA 1ZIDA 1QYCA 1R4NB 1N7GA 1GUZA 5JS6A 2VTDA 3ON5A 1A9ZA 2PZMA 3LSYA 4YJHA 3QRWA 4DBZA 1RWBA 1LRJA 2FRDA 2RHCA 3DOJA 3FHLA 4S1VA 4YBZA 1R16A 4DWVA 5DCUA 1V3TA 3K2BA 1C14A 1T2FA 2FPPA 3QP9A 3TOZA 1GPJA 3ZWOA 1ZMTA 5DT9A 4PG7A 1B16A 5A9RA 3RUCA 4EEZA 1GL3A 3HNPA 4KUGA 3M1AA 3TWOA 4CMCA 1CWUA 3DFUA 3L9XA 4AJEA 1A7AA 1ENZA 1JVSA 2GRAA 2V6MA 5AYVA 2GCGA 5EQDA 3BXXA 4E12A 4BNUA 4RJTA 4FC7A 1CDOA 1E6WA 1FXSA 5B37A 5TX7A 1P33A 1Q0QA 2PZJA 4WUVA 2EP7A 1DIBA 2Q4EA 3DEYX 4I08A 1H6BA 2WE8A 4YQYA 5AQ1A 2GYYA 4KUEA 3BTSA 1QKIA 2I99A 1Q7CA 2D5AA 2B5VA 4Q3EA 2J3IA 1ZSYA 2GR9A 2FPGA 4I1IA 1ISGA 2OZPA 4R68A 3VH1A 8ADHA 5HA5A 4BNJA 1FDUA 4BNYA 3GDOA 4J91A 3H9JA 1CQJA 3KO8A 1T24A 4YT2A 3T4EA 3QWHA 4IJWA 5FI3A 3DHNA 1GQYA 3TJRA 2V6GA 1XHLA 3JQ9C 4M55A 1E0DA 1XCBA 4L4RA 3TFQA 4CM6A 2EHDA 1E1KA 3FSRA 2FSVA 5IF3A 5KJFA 3E5MA 1BHSA 2JFGA 1T2DA 1SO8A 2AG5A 3DTTA 4BO6A 3RSHA 1BVRA 2W2KB 4NBVA 4RF4A 2CFCA 3ITDA 2F00A 5BR7A 5FF9A 4B7CA 1SNYA 2Y1GA 2O7SA 1HYHA 2BLLA 4ND1A 3WMWA 3OP4A 1I32A 3KYCA 5C7IO 3AWDA 3LU1A 3ASUA 1HWYA 2DKNA 2W8ZA 3RC1A 1TEHA 2J5RA 4HKTA 3S8MA 3KHUA 3WFIA 1HSOA 5TS3A 4E30A 2NNLD 1L7EA 2DLDA 5G0WA 3T7EA 4PRKA 3PWSA 3UGKA 3TZCA 2QW8A 4HNGA 1M76A 2VHVA 5HBRA 4EGFA 1UR5A 4MOWA 2A9FA 5CPBA 2V6FA 3Q1LA 4BGVA 1E3IA 3AUAA 4NFSA 1DDOA 2OP1A 5F3RA 4BMVA 1AHHA 5ER9A 2C0CA 2EV9A 3AY6A 3FN4A 3WJAA 1WAMA 4XX0A 1T25A 3JTMA 1BSVA 2VYND 3HN2A 3NRCA 2F1KA 3I9JA 3F46A 3ADPA 4JP2A 4CLHA 5JMWA 1EZ4A 1FMCA 2C07A 4L74A 3PFFA 3KSDO 2WD7B 4IJUA 5ES3A 3UCFA 4YTEA 2HAEA 4Z3KA 4CMIA 1NR1A 4AJHA 2OXIA 4QXMA 1E1NA 4XA8A 3UN1A 1P74A 3LT4A 2Z95A 2HK9A 5KVCA 3GMSA 4W99A 4KTTE 5JW6A 2EJWA 3E82A 1Z6ZA 3ZZNA 3I5MA 2FR1A 2EERA 3L07A 1WWKA 1A9YA 3WWZA 4HY3A 4U0KA 2PA3A 2OBNA 4RPLA 4F3YA 1VL0A 1I3KA 2GN6A 4NK5A 4D43A 3UF0A 1AE1A 4NU6A 4ALIA 4EJ0A 1GADO 2HJSA 2JFFA 4CM5A 2AQIA 2EJVA 1VPDA 3A28A 4FC6A 1TT5B 3MJ4A 3FNHA 5ITWA 3M1LA 4BQPA 1LXCA 3RJ5A 2XOXA 1DFHA 3ETGA 5ILGA 4XDYA 3CEAA 3LT0A 5JSFA 4EI2A 1EDOA 3OJFA 3W4JA 1KC1A 3MEQA 2Q2VA 4YVFA 1EFLA 1U1IA 2B69A 4XJTA 3PHIA 1NVTA 1UDAA 4NBRA 1X7GA 5DOZA 4BV8A 2YQ4A 4AL4A 3BHIA 3W6UA 4IDBA 2AEMA 3RC2A 3DOOA 3INGA 3JQFC 4GWGA 4J1QA 2YV2A 1E3EA 1YDWA 1VKOA 3VZSA 1DIHA 4GSKA 1GCOA 1EFKA 1IL0A 1LLDA 2B35A 4IBOA 3H5NA 3UVEA 1JA9A 3DQPA 4HFRA 2GGSA 4J4HA 4U6QA 6ADHA 2HLPA 3TRIA 3OQBA 4XIJA 4XR9A 4Y8VA 3ROKA 2PTGA 3KB6A 4XIYA 3JQDA 4EUHA 5DZSA 4CM4A 1PR3A 2Q1SA 2P9CA 3ROQA 4C7JA 1YJQA 1YONA 2VYNA 2IEBA 2YJZA 3I9NA 3IP3A 4B3JA 3OH8A 4FFOA 5DNAA 3MOGA 3GRPA 3RVDA 1I2CA 2ZYDA 4RGBA 1HXHA 2O50A 4UEOA 1OBFO 2ZTMA 1MC4A 1GR0A 4QECA 1E92A 2Y1DA 1UH5A 1UDCA 2C29D 2C2XA 1UZLA 3F6YA 3KEQA 3RBXA 4WK6A 3AI3A 4ALLA 4WEQA 2GN4A 5EESA 3V1YA 3OIGA 5BQFA 3OA0A 1VM6A 5JYDA 4IPTA 3ROMA 1RYDA 2AG8A 5FFFA 1WDLA 3PFWO 2QRLA 2TMGA 4ND4A 2YDYA 1ADFA 2AMFA 3KSUA 4QQRA 5KOIA 4C7KA 3WOHA 4E32A 3JCZA 3A14A 2Q50A 2FR0A 5TT1A 2D59A 4XYBA 3JQAB 1O95A 4QO7A 4FDAA 1DLIA 4Z6KA 3RASA 2FP4A 4IZHA 1LI4A 1NYTA
chains in the Genus database with same CATH superfamily
1X8LA 3CF4G 2XRFA 4R54A 2HO5A 5C7YA 3TCXB 2C5FA 1XTVA 2M98A 3COPA 5DNEA 5A4IS 5IFLA 1LTHR 4WT7A 1FBUA 4HD8A 3A4NA 3E27A 4LNUA 1ZCBA 5E6RA 5KYXB 1L3CA 1CQTA 4RC9A 1XDUA 4KB5A 3AU9A 3G23A 4XYMA 3A1YA 4FQGA 1DARA 2EFYA 2PX8A 1DJOA 1PEAA 1YQQA 5IDQA 3HDJA 2HVRA 2Q1WA 2X0NA 3H8JA 3VVBA 5AUQA 1MP0A 4NAVA 3BFKA 4EYOA 2GJ9A 1XSEA 1MOZA 2UUOA 3CW2A 1GV2A 2WHRA 1ZG5A 2X2FA 1ZN7A 3T1TA 4TRJA 1TU4A 1Z0FA 3CONA 5IKXA 2X5KO 2VUTA 3RDIA 3UMSA 2EZLA 3RYTC 1SR8A 3I3SR 1IHPA 1UJMA 2XMQA 4I55B 4BQFA 4U2EA 2LWIA 1DWQA 4BQRA 4YRCA 5HGXA 2GLTA 1X6VA 3G88A 3T54A 2DPGA 2RHWA 4AJNA 2O4CA 4CN9A 5C80A 3B1WA 3FWHA 1YVPA 3BD7A 2UZ4A 1KO4A 4TV8B 3EWAA 2XAUA 4LD5A 3TL6A 2LMDA 5CA1A 4LY9A 1JIQA 1JJIA 4K28A 3DL4A 2QVGA 1GXPA 5AJYA 5FL3A 3U09A 4BO7A 3G13A 4D8WA 1L4YA 2D2VA 4G0UA 3KQTA 1SFOJ 2B8JA 2GEFA 3J7AC 1DDIA 4EB3A 1JRLA 4UHTA 3JALB 2OFOA 5J6XA 1PFQA 1H05A 2OM2A 5ES4B 4LFUA 3OM1A 5AVJA 3JRFA 2XF7A 4LVUA 2VPXA 1V41E 3LOCA 3KPWA 2ZQYA 4BUJA 5F3WB 1M2VB 3KQNA 1JIUA 4AJ2A 2DLCX 5D4RA 3AHJA 5BSUA 5CB4F 4AF8A 4P22A 3AIKA 3N39C 3SXPA 4AKEA 4I7EA 4H4EA 4LCEA 3G8CA 2BGUA 3R6TA 1GNPA 2HMWA 3IT2A 1MJBA 2WR8A 5JJBA 1UKVY 4BZQA 3LBNA 5K7SA 1ZHOA 2A0UA 1QE5A 3FA2A 5CEFA 4M3FA 3L1PA 1OH7A 1ZJ6A 2DH6A 3A1WA 1NX6A 1M83A 2EKPA 1E2JA 1M2KA 3HDDA 4BPBA 3VTKA 2CL7X 3GLGE 2R9VA 4BKMA 2A30A 3ORQA 5FORA 1T39A 3FXRA 4KNVA 1VIYA 5KX5B 1ZAKA 1V4VA 2EGUA 1PV2A 2G1AA 1NFQA 4MV8A 2CV2A 4G5FA 4AJOA 1GVHA 1LFAA 5EHNA 3G79A 4O4LA 2WMYA 4EARA 3KZZA 1KWKA 5HIIA 2R7MA 4WLVA 4PX2A 1IM8A 3LTEA 3I5XA 3H9QA 2XF8A 3WOVA 5EG5A 2QUHA 1P1BA 5G0SA 3OFJA 3E15A 1A7KA 4HTFA 2CFIA 3TDKA 1YS1X 2EJUA 1O87A 1PV4A 5CNKA 2LKSA 3QVUA 4QX6A 1LU9A 1R1TA 4JP8A 3CLRD 2PLYA 3I37X 3VHXA 5AK3A 5JD4A 5KAMA 2WIJA 3WQQA 4HDAA 1ZM3A 4UNNA 4EM2A 1ETQA 4DCMA 2K7FA 1EJ2A 3FPCA 1J0RA 4OHOA 3ZHQA 3D1NI 1FUEA 4QLAA 2JLZA 1GVDA 3RCBA 3VZDA 2KJBA 2JFNA 1ZD9A 3BS4A 1R4MA 3HJUA 1YS4A 4GKKB 1NXOA 2EEZA 1VE6A 3B73A 3D6JA 4LIUA 5JNTA 5DHAA 4F7WA 5BURA 3WK7A 1R74A 4O4IF 1M2WA 3FBIB 1BI1A 1CNEA 1Z8NA 3GJ3A 3O0TA 4YAKA 1P73A 3JTHA 2I0FA 3C7DB 1YAJA 3NKVA 4FYIA 1YQXA 4H16A 2OB2A 1GCIA 3HXLA 5J47A 3RIEA 3X1XA 3QPUA 2F3SA 2OD5A 2H1WA 4CU5A 1DUXC 2QM0A 3RSNA 3RRNA 1ZHHA 1H9CA 1HZZC 1WCIB 3TL4X 3DW1X 3NC1C 2NU9A 2L3DA 1EK0A 5T8KA 4C29A 4CLOA 5JY6A 3C5CA 3LY5A 2C8JA 3ND6A 2ZYUX 4UKDA 3H2GA 2GKSA 3RK1A 1LVKA 1XPXA 4ZC1A 1JECA 4GPTA 1CT9A 4JXKA 4ZCIA 4W63A 1YVEI 3IUPA 5A02A 1H4QA 5L45A 4BBZA 3HEBA 1LX6A 3G82C 1ORIA 4OHXA 2ZSHA 4G8XA 3CE6A 2L4MA 3IWFA 3SJUA 3NTUA 1KY5A 1U2GA 3N74A 5TR9A 3L05A 3EY4A 3KJZA 1W73A 2TMKA 3JPYA 1N7JA 3U44B 4RBOA 1Z8HA 3W5UA 3NVAA 3SIPA 4ALJA 5FWNA 3TQFA 1TGYA 1L4FA 2VSYA 5F0HA 3OWTA 3IH2A 1SA0A 3OEYA 5FJIA 2Z2KA 5EPUA 4P31A 4XM0A 1XO1A 2ATIA 4EITA 2VOEA 3QQAA 3RYFB 4BJ5C 2OWEA 4KR0A 2OUKA 1FOXA 4Y9TA 2GEVA 4GYJA 3FZVA 3FXKA 3WIVA 2PA0A 1A0OA 3SQMA 4IFBA 3K4BA 1E4OA 4HAZA 5F2EA 3LKBA 2PKQO 4AP5A 1EVQA 4QBTA 4A0QA 5FHQA 3QOPA 5HK8A 5DI9A 2CFXA 1PJTA 3TTSA 3EJWA 1ODDA 4G0ZA 2DUMA 2OHJA 4S0ZA 3OSFA 4Y33A 1AK2A 3CUEF 2E3JA 5JSKA 1C50A 3IXLA 2VQSA 3F49S 4L9TA 3IQDB 1OA0A 1GPUA 3RODA 5KKAA 5CBPB 4OOEA 2ISQA 4BB6A 3TLZA 5G53C 3KKMA 5EPOA 4DXHA 1NUAA 2BP7A 4NU0A 4Q16A 4KJXA 1QG0A 5A5FA 1NG9A 3JYHA 1PWYE 2QMOA 1I3MA 3K0EA 4U7JA 4ZGGA 1TC3C 1ATZA 5KJ1A 3BMOA 4MAMA 3SMVA 4ZV4A 1NF8A 4KE9A 2D0DA 3KSBC 5B1HA 4HWPA 4PO3X 4BE9A 2REQA 1Q5PA 3ULQB 1N92A 5ALIA 1O94D 4YRVA 4J16A 3PSFA 4YJFA 1BX3A 5H3HA 2DT7B 2ICAA 3AHEA 5EQTA 5IP7J 3BXPA 1WD5A 5IDWA 2ILTA 3OEHD 5C44J 1KSGA 5H9WA 4F8YA 1ODJA 4ZEVA 3BR5A 1FUYB 2QN9A 4ZCSA 3BL8A 3T1YB 2CVPA 1F3LA 3GMDA 3RLFA 1JGSA 2VHYA 1HDXA 3C1OA 4XRRA 3BTLA 2K3PA 3TEFA 1USUA 4X8HA 4FOOA 1RWWA 4KA4A 3P1JA 5E0OA 4EJVA 1W7AA 4G3XA 3OG9A 3MINB 1BW6A 521PA 5EIXA 2XB6A 4QPOA 1QQAA 1G20A 1M5TA 4FR2A 4B6QA 5HXAA 1YR9A 1GZDA 4UV9A 3NT2A 1MB4A 2QLMA 4K9LA 1O94A 3G5AA 4WCVA 2J7PD 4MZXA 3GCGA 1OREA 2ZBFA 2GAOA 3ZTWA 4UQPA 4PPFA 2FTKE 1MB9A 3AM4A 1L4UA 2HM7A 2ZRIA 4NYIR 3OIDA 4DL9A 2CNOA 5EEGA 2CL5A 3F98A 4HQNA 2ZUBA 5JXIA 1FFSA 4G9EA 5FTNA 3PUXA 1GAWA 5IAAA 4NBTA 5GMOA 3WZMA 1MIOB 3EFHA 2KLBA 3RKYA 1NVMB 4EW3A 2IH5A 5C53B 4EMTA 5EUCA 3ZWXA 5IFKA 1Q2XA 3CBQA 3TZEA 5G1PA 4EMBA 4N9IA 2GBIA 2R2AA 5B6IA 3G3EA 4YV1A 1PGJA 5F04A 1A9TA 1Z4QA 3G6EI 3IQWA 5B4VA 5LHHA 5CDSA 3NM6B 2CCGA 4ATNA 4WTOA 1TZCA 3N2GB 4EK9A 2MSKA 3N2ZB 3GEHA 5EGNA 2P4EA 3OUTA 3UPUA 2OXCA 1UDRA 4QPJC 3CM0A 3OPQA 4G81A 1UBGA 3OV8A 2WHEA 3VHRA 1EE9A 1IBCA 3SX4A 3CCBA 3W1VA 3CRVA 4DG8A 1GTZA 4NK4A 2BFDA 3ZMDA 3PC7A 4UHBA 4ODIA 1VBKA 1ZISA 3PQ3A 4LJSA 4WZBE 2CUNA 2OEPA 3AVWA 3UT5A 2BOLA 1CZKA 4KNWA 4COKA 1CUAA 4LE1A 4Q48A 3DZJA 4W8HA 2W0SA 4TS1A 4FTHA 4G26A 4YRFA 4S35A 2RCNA 5EJ5A 3ML1A 1H9AA 3E9EA 3IALA 1U0RA 1YB1A 4YMGA 3DV9A 1BXKA 5LQDA 5D8KB 5AHKA 1PYGA 1V25A 4J4TA 3BXHA 4L8FA 1HGXA 3X3HA 2K87A 3MTIA 2GCIA 1TI7A 4CSWA 3OUZA 2R4TA 4ZICA 4GZ5A 3L7KA 3GRFA 1E5QA 3BA1A 2HU7A 4BE2A 3ZQHA 1A72A 5CDUA 4IZOA 1WXIA 4RA6B 3GJ8A 2M45A 2ODQA 2P9EA 1JHHA 3CWCA 5FO0A 3OWOA 2D00A 2XZLA 3H3FA 3QITA 3CJNA 5BPFA 1P29A 4F7ZA 3HC7A 1KRHA 3EUHC 3HUUA 1QLHA 4YCNA 1X74A 3D0KA 5IVDA 1QIEA 4ERXA 4O4LF 4IAOA 4BGIA 1HKSA 3ABKH 1ISPA 3IOCA 1T4DA 4W1SA 1JH9A 4BP9A 3AXTA 1G7CA 2O7OA 3NTRA 3HFRA 1P4HA 2ZSKA 4K0RA 1YQDA 1U7OA 3HU3A 1C7EA 3PCXA 2Q6VA 2NG1A 5SYAA 3JRWA 2ODBA 4F04A 3AF2A 3EDRA 4M9SA 4EV0A 1OBOA 3BWVA 2OECA 3ROFA 2J3MA 2O9JA 2H9YA 4YWJA 4EF4A 4JSTA 1M6HA 4XLAA 4Q01A 4FT8A 1VQ1A 1Q7RA 1T10A 3D2CA 2XVCA 2QMQA 1RXYA 2V7QA 4M0PA 2HT6A 4NBSA 1G9SA 3UMFA 2VF8A 1CDZA 4NS1A 3V8NA 1W0JD 2Q5HA 1R1VA 3OCVA 2HTJA 3DF7A 1II0A 5E1WA 2EF1A 5CM2Z 5ADWA 3DTKA 2CNNA 2QW1A 1XXHE 1XD7A 1GV0A 4QTZA 1GGKA 5FBLB 1DPFA 2UV8A 1Q57A 1NBMD 4WVFA 1IGNA 1KMQA 2XYHA 4CKZA 2FSGA 5CFZA 1XZPA 5KPJA 3N05A 3PKIA 1CRPA 4EOGA 4F5ZA 3GWZA 1A76A 4HSGA 5LQAA 3H3JA 4YT8A 4G7HF 3CU5A 2QROA 4M0LA 1ISSA 4ALNA 1NIPA 4B3FX 2VNJA 2CXSA 2Q5LA 1C0WA 4PYLA 3RUPA 2Q0XA 5I7FA 3LI2A 5HZMA 1FYEA 3NW9A 3LT1A 4TKZA 5FI0B 2XHZA 1BE6A 4ZQFA 1HLFA 3GBSA 5JJKA 4OJMX 1W0JA 4BS9A 3SZRA 5DCFA 1OY1A 1UANA 4QDXA 5CTAA 1ONVA 2H6BA 1WXQA 5C8VA 2LYCA 1QZ3A 5UKDA 3ER8A 3PRJA 5JC1A 3CT6A 3UV3A 1LZKA 2OFFA 1MBGA 5ENVA 5K5EA 3RSGA 4Z0TA 1ZH2A 1FDIA 3DZ8A 1UFRA 1J8FA 1NBMA 3H9GA 3QE0A 4OSOA 4OMYA 3RYHB 5DGXA 1U0TA 2CB9A 4HLXA 3VU9A 2P2NA 1T5SA 5AXDA 5DWDA 3A2KA 2FPPB 5D6EA 1PGNA 4L4XA 4MAAA 2ZKIA 3K96A 4EGZA 3CQ9A 4TV9B 3OEWA 2HSJA 2QNIA 3KXPA 2NUBA 4BATA 1PL6A 3ND9A 4BMPB 2YCLA 1QH1A 3UWPA 2OBLA 3F9IA 1C4XA 4O2AA 1I0ZA 1MIHA 1AN0A 3E6CC 1ZXLA 4RVFA 4MCJA 4R16A 5EJFA 4GSYA 1Y39A 1I80A 4PR3A 3WB1A 2ME6A 1DAPA 3SLRA 1JJVA 3LO8A 1I6XA 5EWMB 4MUNA 2OT3B 3OURA 1D8KA 4LGWA 1UOOA 4X94A 2VZ9A 2VH5R 5B2EA 1NM5C 4P3YA 4KWEA 4NNPA 3KLNA 1R6TA 4FZJA 1V5EA 2OUMA 4I01A 1TM2A 3WR5A 3KYBA 5I7UA 3FCXA 2BFMA 2Y76A 1W36C 1KMHA 1KR5A 4C89A 4J0FA 4FS3A 1OMOA 5G0UA 2OFXA 4G1FA 3O21A 4MCIA 3R5SA 1HZZA 4ER7A 4LHYA 4MMXB 1M1YA 1NVXQ 5A3VA 1XG5A 2GM5A 3PC8C 5GAJA 1X15A 4WFIA 3AR3A 1YK1A 4JX8A 4B71A 1JFTA 2XF6A 1FFXA 4KQMA 5LP1A 4LMPA 3M2TA 3I3OA 5CLGA 3QBJA 2FW1A 4JT9A 4AYBA 1IY8A 3NIBA 3FTDA 2CVZA 2DHCA 1M2JA 2GHIA 3DKKA 4FX4A 1NJ5A 5IRCD 1OXBB 1ENHA 4AG3A 3TM4A 2I54A 2A68F 4ANFA 1EXVA 1T91A 1EKEA 3VKHA 3K70C 4NPHA 3HJBA 2VOPA 1ZN2A 4UTZA 2VJ5A 1KQ9A 5C4IA 2ZS8A 3PXGA 1CS0B 4JI3B 5CQGA 3Q5DA 4PM4A 2MABA 2G7HA 2GWRA 5JCXA 2BTOA 2K5UA 2BN4A 4Q05A 3I2YX 2R2GA 4QLBA 2XBUA 2FMYA 1Y5IA 4BJ5A 2B30A 3R76A 2QD3A 1ZESA 3CB2A 4DIOA 3OYDA 1HYEA 2E1OA 1DFGA 1D4OA 1XALA 3AEUA 1JYSA 1NOJA 4TMKA 4CMKA 4NC8A 1IG3A 1Z2NX 4PV7A 3QOXA 1N2HA 3B8HA 4BRZA 2VNKA 1CQWA 2BM9A 2VOJA 1YG2A 2D7DA 3HKZA 3JYPA 1SC1A 4I2VA 1GZSA 4G84A 2LIPA 1T38A 1NNSA 3GRUA 3CO7C 4JI4B 1B4AA 4WNCA 1TFUA 2ZI9A 4NOLA 4YJHA 4D74A 2YTZA 3DTVD 4S1VA 3EEFA 3F6OA 3D6FA 5DT9A 4PG7A 5BW6B 3L6BA 3WDLA 4CXMA 4AJEA 3LFKA 3QHPA 4PHHA 1N5MA 5GM2A 4H0NA 2PZJA 1UM9A 2WE8A 1R71A 4YLGA 1ZI9A 3BTSA 1G2HA 1NDUA 3BG7A 2HXIA 4FT2A 3P9YA 4IJWA 2QTFA 2IKQA 5FI3A 4ZYLA 3AFHA 2VSXA 5FPTA 3C16C 5ALHA 3TFQA 3BREA 1U1CA 1CUHA 1Y4SA 2H2WA 3P97A 3NWPA 4G8CA 1Z6AA 3KKEA 1TLFA 1CUDA 2Y1GA 3I8SA 4LJ7A 4N6OA 2GJAA 4PYRA 3SXUB 5EUQB 2QAIA 3G2PA 3JAKA 3ZLUA 2DXIA 4U3JA 5EE5B 3IDAA 2QRUA 3DTVA 4CIWA 4E1VA 4IRMA 2EC5A 1FT9A 5F73A 1QG2A 4D92A 1YFKA 4EVIA 4F93B 1OBVA 1ZMXA 1XE3A 4OI0A 4F2PA 3BCHA 2COMA 3L7MA 4L2IB 2HXSA 2GWHA 3G9QA 5H7XA 5EGOB 2QTMA 3EXG2 3GJ5A 5D3ZA 3DM9B 1K7AA 4YMUA 3GPLA 4K9QA 1Z6ZA 3KE8A 4CYDA 2WG0A 2A07F 3TRHA 3QLVC 1KEEA 2DFPA 2D54A 3RT1A 1RWKA 1MEEA 1FRVA 2ZBVA 2VT7A 1M2OB 2AZMA 4JZKA 1WXXA 2I6XA 4XJXA 2B2CA 4DJFC 4KPFC 1V1RB 1DWPA 5AR1A 8ABPA 3T0IA 5FR2A 1TRKA 3RC2A 3CY6A 1OGYA 3K7EA 4F5YA 1AIPA 1PFKA 2GGSA 221PA 3DDCA 4PZYA 4XOIA 6YASA 2NQ2C 8AT1A 2IU0A 3I9NA 2IEBA 1IC6A 4I9GA 2QVXX 1SC4A 4LVOA 1ZAOA 2XRYA 2ZDQA 3F6YA 3ZGLA 4PFPA 2PZGA 4IPTA 2W2VA 4ZO4A 1RYDA 2RGGA 1SHZA 3ANXA 1IY2A 3GB9A 2JSCA 1JHYA 1DLIA 1YW8A 5DD4A 2O8FB 4JYZA 1NYTA 3K4HA 4MR7A 5K3OA 3QE2A 1PJSA 4J94A 2JQ7A 3CMYA 3KT8A 4MR8A 2E1PA 2IYLD 1FC0A 4LTMA 5H1YA 5CX1A 3H5AA 2WB1A 2CYYA 3BG5A 3HA7A 2EV0A 5FFXA 4JHXA 3RCOA 3GO5A 3KETA 4Q3NA 4U7WA 5C34B 2EF0A 2HI0A 2XDYA 3KR0A 821PA 3WTUC 1T8PA 3WS7A 4F0JA 4OAZA 1IIRA 2Q3BA 1XC5A 3JRAA 5BV8A 4TN5A 1JI8A 1BN7A 5DF1A 3FTEA 5ILUA 1Y8QA 4K2EA 3GLGB 2QMUA 3DE4X 1KSFX 4O1IA 1JG1A 2BJHA 2HQOA 4L27A 4YXWD 2OKGA 2IPAB 4Q34A 4XOTA 1DGQA 1EHYA 5CVUA 1E60A 1JQJC 1XNRB 2AZXA 1RZUA 2FUCA 3SZLA 5I9BA 1YJXA 1I9GA 1B8NA 5L4NA 1XF1A 1FMTA 1X9IA 2Q8QA 4EH1A 2IOQA 1QSGA 2W98A 2QZPA 3WLOA 2QQ9A 4H59A 1K75A 1SHJA 3JAMA 4N8DA 2A5GA 5CLFA 1RXCA 4M3GA 2VEDA 4D5CA 5L3FA 3L4KA 3AGPA 5HM6A 3C6QA 4R6XA 4TTTS 4J9UE 1IK4A 3DG9A 3H9EO 4UVDA 2ZE5A 5BR8B 4EHLA 3FMIA 2DLLA 2HFKA 4YXWA 3H1EA 3MJVA 3A1CA 1GVNB 4ZXPA 4G1MB 4LE0A 4B4KA 2IUYA 1S3GA 4PDKA 1YFZA 1OCZH 4J43A 2Q2WA 2FE1A 3O3NB 2QY9A 1A8SA 4ZVLA 3S15J 3GJ0A 3ZK8A 1N6NA 3DNPA 3IELA 3PDUA 2P9HA 5C51B 1YL6A 5KIAA 4JC4A 4R2XA 3DT8A 3D3WA 4C30A 4R83A 3J81k 1H3FA 1CP3A 3EZ2A 2IPOA 4MQ9F 1MXHA 3OU2A 3ANNA 5IAOA 5JDCC 1IIBA 1TTHA 1HNNA 1DOHA 2OOKA 5E3MA 3TF5A 1RRFA 3RYCA 5BUZA 3O8DA 4YDRA 2FP4B 4TL9A 3UHAA 1UBNA 4P4LA 4MUGA 1KU2A 3JRGA 4GICA 3CPEA 2YFKA 5K3FA 3DB1A 3HEAA 3CV3A 3TSCA 2IYVA 2IHNA 5IEJA 4DSOA 1HYQA 4MFEA 2A1IA 2ISYA 1TJYA 1Z5WA 2PH5A 1MBKA 2XB8A 1UBJS 5DWQA 2G76A 1F12A 3H4TA 2CMDA 2EIMH 3QQ5A 3T0YA 1O3YA 8MHTA 2FMTA 3S1SA 5LZ2A 1MJNA 1GNRA 2O2XA 4KXLA 3KXLA 3HABA 2DVMA 2XCOA 4L0YB 3AR9A 2IQIA 3EIUA 3WADA 2F90A 1ES9A 3MRTA 2JFPA 4RV4A 1I3NA 3VR6H 4BRWA 2XKAA 1FW6A 2FQWA 1C41A 5B2FA 4RLQA 1HETA 1OU4A 4K6CA 1AHIA 1PHRA 1Y6IA 3G9TA 2VNIA 2FEMA 4QULA 1PX2A 4G9YA 1N33B 3QVOA 2B4KA 3VHQA 1L8AA 4BV9A 2H7VA 3C1AA 3IQHX 4CUZA 1E6UA 2CJYA 4K7JA 5KK1A 3L02A 1FX1A 1S7AA 4AQDA 1G6NA 2DY1A 1W36D 4LRQA 4B3TB 1QH8A 1X7WA 3DR5A 3UICA 1IPFA 3B38A 2AQ8A 4C4SA 2X4IA 2L9NA 1I6MA 1BR4A 4H0CA 1FUIA 4HGNA 4CZZA 4CO8A 1RC0A 2E1MC 1N0VC 3MT8A 1H23A 2LCFA 3UB4A 3GLFA 2CJJA 4FWIB 2M3AA 2WY7Q 1IY1A 3FXJA 1X7XA 4WCFB 1DO0A 2I34A 3IS3A 3GR6A 4MPTA 2QJFA 3CUVA 5AW0A 3CP2A 3BK2A 4RXTA 4XWOA 1V6CA 4PR0A 5HDGA 1NM5A 1V3UA 3I8OA 3E9NA 1RZVA 3V55A 3C6ZA 1V54H 1VQ4I 4ECAA 3ZQ6A 4IEIA 4NBKA 1IRZA 3LPMA 4P4UA 2ZUEA 4X0EA 2FUG2 1BHQ1 2FMXA 3G0IA 4F7DA 5AOVA 4DCPA 3FMRA 1SOVA 3KVNA 4JJAA 3PC8A 1NASA 2DA4A 2CDBA 3MJDA 2QE6A 4YPOA 1QO0A 2O0YA 1X94A 3W2TA 1Z75A 5A0TA 5GV7A 5CJ9A 2YW9A 2CYAA 1YRLA 5D3MA 6Q21A 4JI6B 4NMMA 5ER6A 3JAWB 1BR1A 1Y1PA 3KYIB 3TB6A 4GI1A 2BC9A 1DAFA 1J1IA 3GAMA 1JHFA 1SIWA 5H4GA 2BMEA 4N0QA 3ZLBA 4CF5A 4N3AA 1GAEO 4MQ4A 2OQ2A 1W9MA 3L0YA 2LV8A 4QPNA 3JCUC 1FNMA 5HIMA 4P35A 4E3ZA 4KWHA 3VJRA 1KR2A 2ZXWH 2I4NA 5LJLA 2R7QA 4EHBA 4IOCF 5GAGJ 4BVBA 1DUSA 2W6CX 4RV9A 1TVEA 1W8DA 3WGTA 1ICEA 2VN2A 3B3AA 1G8AA 4GRIA 4HDOB 3ASOH 4PZUA 1V8DA 2X23A 2W37A 2CQNA 3K2AA 1SC6A 3B9QA 3EGXA 5EINA 3TLKA 4HRXA 2F3UA 4QEDA 2C4MA 5TPWA 6ABPA 3QYJA 3VAZA 4BVEA 1R4AA 1BA2A 4EYKA 2VDLB 2Q9BA 4O2LA 2FXIA 1M8KA 4MV4A 5TNXA 2YZMA 1KO7A 4RPHA 4MYUA 3JW8A 4IZ6A 1RXWA 3ZW8A 1DT5A 3W5IA 4NJEA 1LVUA 5D6OA 4N47A 5CT8A 4WZBB 4AXXA 2L69A 1LQTA 1W581 4M88A 1Q1GA 5E7IA 4AN4A 3T9CA 4UMDA 1ZUNB 1PDOA 3SP1A 4TKUB 5KCMA 5K05A 2FLVA 4IV8A 121PA 1YI1A 1OI4A 1TWHJ 2VYQA 1M54A 2XY4A 2MCFA 3KYLA 1N1GA 3ZNPA 1ANKA 2WA2A 1XTBA 1EK5A 3CPJB 1DEOA 2QHXA 2R92J 3MELA 5G02A 3A6ZA 5A4MS 3K6SB 4AY2A 2WJAA 4UTVA 1Z2PX 4ZI3A 1DBVO 4C0BA 4TKMA 4XEHA 2LK2A 2GMWA 4FOSA 1RP1A 5HFAA 3OZTA 3T4XA 3H83A 3I01M 1OYWA 1TC1A 4M38A 1E3SA 2ID6A 2HZ7A 3L82B 5CB0A 4A69C 4KQKA 2ID4A 3KYDA 4KSYA 1ESCA 2XRMA 1I24A 2X5XA 4GLFA 4GO1A 1Z0DA 2IE0A 2AR0A 4L0ZB 1IMJA 5EQFA 5F51A 1G6Q1 2A5WA 2Q99A 2YV3A 3QLVA 2VQFB 2OGWA 4P9FA 3CZ5A 3EDCA 4PCQA 5GJBA 1ACMA 2XIJA 3M8FA 2RIRA 2VQ3A 1UXJA 2CFTA 2XC7A 4GGMX 3ZMZA 4K81B 3IQFA 2YCBA 2DTRA 4E13A 3M4JA 1A2QA 1PG2A 1ZH4A 1C30A 2WWVD 5H6RA 4ZTZB 1EDZA 1CJSA 2PG3A 3NVDA 2A05A 4RAOA 2QLNA 3OJOA 5EIFA 5ERGB 2VHTA 1FZPB 1US8B 3FCEA 4O4IA 4F9EA 4ZZ0A 1G3QA 4OAOA 1JNXX 1XOIA 1TU0A 3FCUB 1OXTA 4PZCA 3OCZA 1XXHB 4WERA 4OATA 1YC5A 3H3ZA 3I39X 3B9PA 5MFZA 1GGEA 1XROA 2C9MA 5CQEA 3QFRA 2DH5A 3MILA 2IA1A 4WF2A 3GEEA 5GV8A 2ZPAA 5DBGA 3VR3D 3GLIA 4ND3A 2IL1A 3IP8A 2ISCA 4AU1A 3B70A 4CRWB 2AS0A 3QWIA 4MQEB 1NTRA 3C4VA 1N8TA 3DKXA 2AD5A 1KYIA 4HGQA 1E2BA 2EKBA 1UF9A 1E58A 3JWGA 5EDNA 1DU4A 3GROA 4R4JA 2BW3A 4JA2A 3I5UA 1KZ1A 4H1VA 4ZAVA 4HBZA 3NB0A 3QUTA 1T3ZA 1ST2A 3BCBA 2ZI6A 1F5SA 1QUFA 3C6KA 1R7RA 8LDHA 3V48A 4BVLA 3GH3A 1XELA 4KCGA 2W58A 3MZHA 3QODA 4U87A 1JKJB 5KYKA 3PQJA 1ODCA 5EMJA 1T8SA 3K1PA 2W2QA 4M87A 4NENA 2CQXA 5ICEA 1PKEA 4RE6A 3FFXA 4Z53A 1RACA 3KRTA 5K09A 3ASYA 5LEJA 3VR3A 3DHWC 3AH8A 3SDGA 3UJDA 5L9AA 4DDWA 5FHRA 5JJLA 2HNKA 3AR4A 1SC7A 2W57A 1RLTA 4LSGA 4QFCA 4Z9BA 3ZXYA 5I8PA 2X1VA 3ZNNA 2PPVA 1WH7A 3DEKA 2FOLA 2XMSA 3ANTA 4EG7A 3FW1A 1Q14A 4TVKA 1EMDA 3EIWA 3UAVA 4TKVB 4F3KA 1JDJA 2WPDD 2GLXA 3IUMA 5AESA 1FLIA 4B4CA 5EA2A 2D74A 3I9OA 3U13A 5JRDS 3ME5A 1ZCFA 5G1OA 1ZYRF 4MICA 1Q6YA 3GZNB 1ORWA 2WF8A 2IP1A 1XA3A 2NSJA 4RPJA 1DUVG 1FYLA 5ALOA 3TIXB 2VF7A 2XYGA 4A5SA 4GX0A 3O74A 1Z7EA 4NH4A 3DZBA 2OK7A 2R48A 2GN9A 4XRFA 1WHSB 2ZM5A 1NMXA 1PWZA 2W0MA 1AF4A 1ZH5A 2O57A 1MDFA 1E8DA 2EBHX 1ZGCA 3OE4A 3LCUA 1PYVA 4D9MA 1NA5A 3QU5A 6GPBA 4PTZA 3L4BA 2AA3A 4LMBA 3NHJA 4J75A 2VZLA 4K1LA 2W6OA 3E1KA 1KYVA 4KXNA 1K08A 3RM3A 1QYIA 1Z74A 2XADA 2EG9A 2V26A 1S4QA 1RQ2A 4BNTA 5BP7A 3L8MA 5JDCA 3HPGA 2A14A 1ZFNA 3JZIA 3GDHA 2HOSA 2GAAA 2Q5OA 3IQIX 2C5AA 4QAQA 1UCRA 5KSPA 1OI3A 2P4HX 2UZ1A 3I2JA 4HXYA 2BRUC 1F2TB 2AE1A 1V1JA 5LBIA 3KOMA 1RYFA 4HJXA 1R6DA 2Z6QA 2XYVA 2N8GA 1VECA 1HBJA 3CJQA 1AKMA 1BH2A 1H3EA 4D97A 4DR6B 5BV1A 2MIIA 2F1HA 1MH3A 2WOOA 4ZDKA 3JR7A 3UW1A 2ECCA 4RNCA 1QGPA 3VBEA 1QZUA 2Q2NA 4PLGA 2QTVA 4V0MA 5JTUA 4YPVA 5BN5B 4OB8A 3PLAE 3E9YA 3ACDA 4MWBA 3M8EA 1MAHA 4YRMA 2QENA 2O1XA 3IDOA 1OC2A 2IIVA 3L00A 4D6YA 1LV8A 3CG4A 4PAOA 2C9DA 4W82A 5IT3A 2XUPA 2CUKA 5DNYB 1Q0ZA 2Z43A 1VJGA 4MP6A 3ZU2A 1B2LA 1XMVA 3B1KA 3CZAA 5P8WA 2R3SA 3SMQA 1XT6A 1D2NA 1QAMA 4KBFA 2WLSA 1FC3A 3QQPA 1ZG3A 1CQIB 3SCZA 2QM7A 3WK5A 3FYHA 1L5ZA 3EE6A 4EGJA 4G5OA 4QRDA 3DVAA 1SCAA 2YHUA 4FDLA 5J8CA 1OZHA 1YW7A 3KQVA 1TCUA 5LWHA 3EVTA 2C1ZA 1H85A 3ZHVA 4KPGA 3PRYA 1TW2A 2FZKA 4LJ8A 3GUYA 4Y9RA 2GPTA 4MJLA 3WK8A 4AJKA 2YXPX 4WW0A 1TKRA 4XOPA 3REOA 2H52A 2QTNA 4CKCB 2ACVA 4OHYA 3MWJA 2IJGX 2NZVG 3DC2A 4LMYA 5ARDA 3R7WA 2ODEA 3NV7A 1MJGA 2DJNA 2ONCA 4AM3A 1YJ5A 1QHHD 4KYUA 2XOEA 1II9A 4UDYX 3EW9A 3TLBA 1VPWA 3GVIA 2VWHA 2XPVA 4CTJA 3AEYA 2F4VB 3IUYA 4GQBA 3KEYA 3LGAA 5DNUA 1EWTA 5LBUA 4TLDA 1U8XX 4WWCA 3LUGA 1HYGA 1V4RA 4B6JA 1JDSA 4Z54A 3TZKA 2GK4A 4UREA 4Y13A 2YDXA 2IXSA 4Q82A 5DI3B 5EEAA 3FNRA 2D8AA 2VRCD 2UUCB 2EATA 2FWBA 3TECE 1PZFA 3KQMA 4RDXA 1JU9A 2ERCA 1RJWA 4RFLA 5FEUA 3TQQA 4U88A 1GQRA 1ENPA 5CDFA 2AH5A 4ZDIA 3ZGNA 1SOAA 3BB1A 3OLCX 2QW0X 4DSAA 4FBMA 4KQIA 4KO4S 1DAKA 1R5HA 3PLRA 5FTKA 2AGVA 5ITVA 2ZJPF 2Q4BA 3CN7A 5IX8A 3U9LA 1U0GA 3KSZO 2OAP1 1ML3A 4PC1A 5DP1A 1KK2A 4M9RA 3QX9A 1KQGA 4X93A 4J7XA 4EECA 5GY7A 1VXRA 2Y48A 1IXSB 3U4HA 2I91A 4TMZA 2JK0A 4C4PA 5LBQA 4DC0A 4PFOA 2FU5C 4B40A 2W2PA 1X42A 3NEUA 4MVJH 2FYTA 5GVRA 3JD3A 4IDFA 5I7AA 1NJ6A 2FWPA 3H13A 1H69A 2D1QA 4S1WA 4AMVA 3TNLA 3HY4A 3IDZA 5JAPA 2A4KA 4RH1A 5HDBB 3SU8A 2GZMA 5BUQA 5IKEA 4G4GA 3EPKA 4MKXA 3L41A 3WV4A 1LLCA 4L5BA 2GZWA 3T7AA 1XAIA 1U4SA 1U3DA 4DMGA 3I9KA 3ERED 1UB9A 1Y8ZA 3C7JA 4QIHA 2QM3A 4LOJA 3A06A 4MTDA 3TTTA 5DYNA 3B5IA 2WPNA 2EBWA 1OFGA 1DMSA 3BN3A 2R1VB 4KICA 2H48A 5HVQC 2M34A 2B9VA 4BWFB 2IWRA 1N34B 1OTYA 4KYVA 4P7FA 1TWGJ 1Q0QA 3ER6A 1KQNA 1JWLA 1BE0A 2I99A 3K7AJ 5B1AH 4FEAA 1ISGA 3BY6A 1XL0A 4HMPA 3TINA 7AT1A 1YBFA 3WNBA 2DQZA 4Q9HA 3MTBA 1FP4A 5AW3A 3R75A 4EKDA 4NBLA 3H4IA 2WILA 4D1QA 1SVUA 1P80A 2VPQA 2BEUB 2FLWA 3JR3A 2XGMA 1EKXA 1W5AA 5ECGC 2DSNA 3BQMB 5CYOA 2XE4A 3WWCA 4ASUD 3CCYA 2FZLA 2JA8J 3QKSB 2DLDA 4B6FA 4RK5A 4NCIA 3UQZA 2VHVA 2JZYA 3NKFA 3BE8A 1A5BB 4YWHA 3KP6A 4BMVA 4HDVA 3O1HB 1YHZA 4LOIA 3HCEA 1MZPA 1FMCA 3KYJB 2CLIB 4QTUB 4ARIA 2OXIA 1ZP6A 2JF0A 1YB2A 3RT7A 3HJCA 2VHEA 4WBNB 1YJBA 2H54A 4KR7A 3B85A 4KKXB 1JEOA 3QMVA 1UJCA 2RD2A 2PMUA 4U0KA 4AY5A 4DF3A 4B6RA 1M1ZA 2E4WA 2PMEA 3OWXA 4YO8A 3I4MJ 3CRMA 2X41A 2H11A 3IRUA 3N3BC 3NWBA 1PLJA 1WSDA 3VOEA 2QGFA 3ETGA 5F9MA 4XDYA 1LVHA 1E9FA 2OR3A 1EDOA 2NV2B 1XD2A 1UBOS 4FGJA 2XCRB 5HF5A 3TRJA 5F52A 4DLUA 2Q29A 3NHMA 3FFWA 5I7WA 4CEHA 4XIYA 1G7SA 2JFQA 2LR0A 2QIPA 2G28A 3UMJA 1YONA 2M1ZA 4FFOA 2HC9A 1Z63A 3HV2A 2UZKA 4JA0A 3TW8B 4UBMA 2J09A 1UH5A 3ETJA 3OOPA 4Z6YA 5FAXA 4IXDA 4YMTA 3MQ4A 4AG5A 5FNZA 2QTCA 5KOIA 1B0PA 1C8KA 4E32A 3UXMA 4RABA 3JQAB 4JELA 2J0VA 2PL5A 5HSGA 3RASA 1D8JA 1U9OA 1LI4A 2WAQA 2PBIA 3OE7D 4ESJA 3U9TA 3S32A 3CZ9A 2O8XA 2H18A 4ZZ1A 1N8KA 1WNTA 3QYAA 2FUNB 3THOA 4W5NA 3L06A 3P4UA 2VXBA 4BDZA 1J0AA 4HI0E 1N7IA 2O7RA 1NC3A 3GT4A 2ZRMA 5AI9A 1RLMA 2QQFA 4J8PA 1UEIA 3I59B 2RB5A 4I6EA 2GIVA 4YFXF 4B8XA 4B3GA 2LF8A 1GPH1 5CG2A 3BMNA 3DW3X 3M1EA 3KWFA 3LCMA 1GTJ1 1TWAJ 3ZY2A 1IOZA 5DP2A 3F1LA 2AWOA 4BZWA 2RHOA 4I81A 3FUCA 4EP1A 3FLBA 1FBTA 1QVUA 3OU7A 5JAOA 2NU7A 1R4NA 2BD0A 1QIKA 2Z2YA 2NTJA 1N2GA 1SC3A 1GD1O 1WPXA 4TRMA 3M9AA 1V43A 3OE7A 1EV7A 4NB5A 4DZPA 1T0IA 4WFJA 1R0LA 5JQGB 4TMXA 4LF9B 1Z82A 3SN6A 1O97D 4BNWA 3T3HA 3RC7A 1R66A 1RUOA 4DGQA 5KCZA 3KZXA 2GD2A 4OKNA 4ZVTA 4QYWA 4IEJA 1E5TA 1R36A 2B0JA 2A1TR 3ESBA 1MBEA 4W6ZA 2HMAA 2GETA 3PBKA 3TDMA 1EVYA 4YAWA 3OR1C 1R9JA 4O63O 1P7IA 3DFFA 4IQ0A 4BMOB 3Q3CA 4I3FA 1I8TA 3TZ6A 2XHKA 3DE1X 1X77A 3A05A 3QUAA 4QGSA 1KNXA 1TDJA 4J49A 1A9QA 5IF9A 3KAQA 2BFPA 4QOGA 3HFSA 2PLRA 2X6WA 1ZNYA 1RKBA 4JT4A 1E2PA 1NW9B 3MT9A 2VSQA 1FP7A 3OEHA 3KOZA 2XPCA 1X7HA 5KQPA 1U0NA 1T2NA 4KI7A 3U4MA 2XGJA 4EMSA 1JG7A 1GPKA 3A1VA 2PD4A 2K9QA 1U0BB 4KN5A 5LYYA 2Y66A 4KR9A 4GWLA 3OHPA 1JLRA 2NTEA 1OLUA 2W90A 3CX6A 1T0BA 1NVEA 4FMBB 1DKMA 5H4HA 1SOWA 1QP0A 4DHEA 4XPZA 2CO5A 5K3AA 4YUWA 2GN8A 3ZG6A 1SURA 4Z9YA 2FG7C 1AXEA 2X6RA 2BHLA 4OQLA 3DFKA 2UZAA 3ZHRA 1OX4B 2BT4A 2RJOA 2DBYA 1FSFA 4Y2GA 2C92A 4BMXA 1GAJA 2J9XB 2HFJA 1I4TD 4MGIR 4Q7QA 4GOND 3N87A 1NMYA 4U7PB 3FF1A 3D4LA 1LK0A 5E0KB 3QI2A 5ALZA 3DBRB 3NGXA 2ZRAA 4R8HA 5I5GA 2J7PA 2NUPA 3KPYA 3KJHA 2OCIA 3Q11A 4I66A 1HEIA 1DU6A 3RVOA 5IH3A 1VGVA 4H3HB 3WSWA 4RZ3A 3V2IA 1PJQA 2E7WA 1OVMA 5JU6A 1U3GA 3GGPA 3OYLA 2XTZA 2FSUA 2H1KA 2AW3A 1GYQA 2NO5A 4Q4HB 3TVDA 5EMMA 3RS9A 1DQYA 2GZSA 4H7JA