1VQOI

The structure of ccpmn bound to the large ribosomal subunit haloarcula marismortui
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 17
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 1vqoI00
2NXNB 1VQKI 1ACIA 1YJ9I 1FOXA 1VQMI 1VQ6I 4IO9F 3CC4I 3CCSI 1QA6A 4IOAF 1VQ5I 2ZJQF 2QEXI 1VQPI 1YIJI 1MMSA 3CC7I 1YJWI 1YHQI 1VQNI 5DM6F 5JVGF 3CCEI 3G4SI 3CCVI 1VQ7I 3I55I 4V19K 1VQOI 1S72I 1VQLI 3CMAI 3PIPF 2H8WA 1VQ4I 3CCMI 3CMEI 1VQ9I 1YJNI 2ZJRF 2E35A 3G6EI 2ZJPF 2E36A 3CD6I 3CCRI 2K3FA 5DM7F 3CCQI 3PIOF 1Y39A 3G71I 3CCUI 3DLLF 2JQ7A 1YITI 3CF5F 2QA4I 3CC2I 3J7ZI 4IOCF 5GAEJ 3CCLI 1HC8A 3CCJI 3I56I 2OTJI 5GADJ 1FOYA 4UY8I 2E34A 2FOWA 2OTLI 1VQ8I 3J7YJ 3CJTB 1FOWA 1YI2I 5GAGJ 5GAHJ
chains in the Genus database with same CATH superfamily
2V1UA 3H3UA 2XAJA 3NEUA 3M4OJ 3CP2A 1KA8A 2XF7A 3VODA 4ETSA 2XVCA 2F5DA 3FHZA 1BI2A 5D5XB 2DFHA 5KCMA 1OCCH 1BOBA 2KRCA 1WRJA 5CPRB 3IV5A 3L2RA 2H1KA 1P7IA 2VQGA 3HB9A 3O8GA 4JX6A 5D8KB 3F8FA 3BTLA 4H0EA 1XMXA 4M3EA 4HNTA 4ESFA 1LB2A 1U3EM 3DPUA 4XN0A 4C3IJ 2A05A 2JVGA 2O6GE 2HXIA 2QCOA 4WX9A 3OYGA 1TNTA 2ZMEA 4XRSG 2VKHA 1PUFB 1WI9A 3FXUA 5B1BH 3ASOH 1MJ9A 2P8TA 3IUOA 2HVQA 4IQ4A 5DEQA 1A31A 4V19K 5M5XJ 1D5VA 3TO7A 3HGYA 5BNGA 2LK2A 3DFGA 1U5TA 3EPZA 1S9HA 1HKQA 3KEYA 4ESJA 3G1MA 4M3GA 2KMUA 3R0AA 5ICCA 2CQXA 3MZHA 3QPSA 1WJ5A 3LL7A 4M3FA 2EA2A 2IGKA 1KU3A 4RAZA 3DEWA 5DUKA 4X6AJ 1TWGJ 3S3NA 4LLLA 3HUGA 3LSPA 2K40A 2PJRB 3FMQA 5A2QK 2ZJPF 2Z9OA 3AFHA 5HNHA 1ZLKA 2LNBA 1IZ1A 2BY0A 2CJJA 2JK3A 4J19A 3K69A 1LDKB 3CCQI 2M2EA 4I0AA 1SVOA 4A3GJ 4IZZA 3BZKA 3F72A 2CUJA 3OS1A 2F5EA 1MNMC 4M6XA 4M9XA 5M3FJ 2X4HA 1PYVA 1IDZA 4V2GA 1U9NA 1UG0A 1CF7B 2BY2A 2NVYJ 2LKPA 4PJLA 4OWRB 1MW7A 4KFCA 3RTRA 3AKZA 1Y1WJ 2OTJI 2NS8A 1QVUA 4LIUA 2OBPA 2XF6A 3B73A 1TC3C 1SMYF 1MNEA 4KNYA 1QU3A 3PL8A 2LSOA 1LDDA 3KLNA 4N4NB 5F27A 4K2EA 4NC8A 3EYYA 1HSTA 1SMTA 2YPRA 5IP6A 3P9IA 5HLHA 2XSDC 2E5NA 1T33A 3DXJF 4HNUA 3BR5A 4BQQA 2COMA 1YJ9I 2R7DA 4EMSA 1MD0A 2PI0A 1N78A 2EFNA 4RB3C 5LFAA 3VOEA 4HA8A 3TP3A 3U2RA 4A3CJ 3C2HA 5D4RA 4HAMA 1PJRA 2DCEA 4XOPA 1HDPA 5HVQC 3AAFA 2Y9YA 2ETHA 3BROA 2VUMJ 3E6DA 4XLAA 4QWQA 5J1RA 2BY3A 5HODA 2ZXHA 3GTLJ 2L4MA 2JWTA 1BIAA 2LRDA 4GO1A 4AD9A 3AG3H 2DQLA 3OYNA 2Z99A 3OYEA 4IHTA 5EZHA 2L02A 3CLQA 3F8BA 5E1XA 1FBUA 3DPTA 4G6TB 1G8XA 2A61A 1E3PA 2DK8A 4AVZA 3QOEA 1I27A 2Q0OA 4M71A 3RQIA 3MKWB 1K61A 2LC2A 2IW5A 4KICA 4S05A 3OR1C 4HLXA 3HBLA 3L2CA 4OOIA 2O0YA 3NRVA 4PFOA 4F92B 4GRIA 1MSEC 1X2NA 2RC4A 3QPHA 2M5WA 1YYVA 4IVNA 4DYRA 4WXDA 5FB2A 3SEZA 3ZQIA 3ABUA 3WTYC 4W97A 3ZN0A 2L9VA 5BPIA 3TP0A 3FM5A 3D5RC 4L5EA 5JLXA 4YFNF 3KZZA 1DU0A 3E0JB 3GFIA 3T0YA 5FLVA 2OQRA 3L00A 3J80K 1D1BA 4Y33A 1MBFA 2DT5A 3RKQA 3WTZA 2HOSA 2HI3A 3CUOA 4JBAA 4LLGF 5ILVA 2UZKA 1TL8A 1GV2A 3ZPLA 2H8RA 4RAGA 3GZNB 5H20A 3CCUI 3FKIJ 2XB0X 3H9JA 5E79C 4XLPF 3WE3A 3IC7A 1EH8A 1KQ9A 2XV4S 2Y75A 3I54A 5HS8A 2HTSA 3BDDA 4HX7A 2N8GA 5F08A 3L2VA 5JI6A 1LKXA 3HKZN 3JCUC 3CCLI 4A69C 2X9DA 4B47A 2P5KA 1ITYA 5HDNA 1FOYA 1G3SA 4PCQA 3Q9SA 3VWBA 1LDJA 4CZCA 2JN6A 2BVLA 3K4BA 2ZSHB 3VYRB 3B6AA 5KAIC 5C44J 3HSEA 1WJEA 3K6GA 2ADUA 3OV8A 2JPCA 2QYOA 4W1UA 3FM3A 3P9KA 3V8JA 5E1ZB 1K78B 3PUBA 3RPUD 3DTIA 2OF7A 4FX4A 1IRFA 4P1WA 3FK7A 1IF1A 2M1BA 2A6TA 4UUSA 1R36A 4FHTA 1UHWA 5JR3A 1JKQC 2EB7A 3R61A 2VBYA 4HF0A 3LAPA 2QM3A 2ZJQF 3F6VA 1VQPI 5FLXK 2ZB9A 4XNFA 1DP3A 1DGRM 2ZKZA 3MCZA 4IL6C 4BJ5C 3OY9A 4AVPA 3K70C 5EGOA 2B9SA 4I98B 1X19A 1HXDA 1WPKA 3W6JB 1ZR2A 3OYMA 2EWNA 2FXAA 5EJCA 3F23A 1SVLA 5IYBJ 2R93J 1J75A 2F6CA 4MEYF 4E7LA 4XSXF 4AM3A 4BXFA 3JRIA 1BA5A 4GGGA 1R4NB 1YO5C 1B6AA 2GA2A 4PJJA 3NWTA 1E3OC 1TQPA 5J4VA 4X1EA 4F55A 3GZ6A 1AU7A 4AYBN 1R6RA 2L01A 2WAQA 1LE8B 2M0MA 4ZTJA 4LB5A 4E7HA 1RESA 4B44A 2CYYA 1EKEA 3IH4A 2LD5A 1TWHJ 2FNAA 3LA2A 5CKTA 3DKXA 3UKGA 2XPUA 3E6MA 2FUG2 2E35A 2DT6A 3Q0WA 3I5UA 4EATA 3G6EI 3TW6A 3HOSA 2HDWA 3C2BA 4IHVA 2QF7A 3V8LA 3VDXA 1TWCJ 2Y2ZA 2IBDA 1ZTRA 1R5HA 5DM7F 5ICEA 3DP7A 4LG3A 1MMAA 3SHFA 1ZN2A 4FE7A 4BS9A 1FIPA 4AIDA 4XKVA 2W48A 3BTJA 1XS9A 1ON2A 4BY7J 2W1OA 3RI4A 2O9LA 3OS0A 3HOUJ 2X1CA 1CGPA 2MD5A 2FX0A 3CF5F 2CGPA 2PJRA 3JR9A 2VBXA 2R7OA 2RAEA 1Z21A 4BL0B 4OU0A 2J5PA 2XF5A 2E2IJ 1TT0A 1HC8A 3CCJI 2IJLA 3B6CA 3DBLB 4G6DA 3IWFA 3VSKA 3GLXA 3NWSA 3WGGA 2HR3A 1I1SA 2D5VA 5FKMA 1G59A 2ECCA 2Q8KA 1YTYA 1GDTA 1LFBA 4I0BA 2FEZA 4RGXA 3H9QA 3RPQA 3VB2A 2DYRH 1K7AA 4G7HF 5HS7A 4KMFA 2OJED 1CF7A 1HSJA 1VQ8I 2K85A 4MNUA 4L5JA 2D1HA 3AG1H 4BQAA 2K02A 1FOWA 1OCPA 1TLHB 2F2EA 3QWLA 4D7MA 1X1DA 2R7SA 3BTCA 4CO8A 2W24A 3RKYA 3V8KA 3MN2A 1J0RA 5FKOA 5J8FA 4I76A 3I71A 4ZC3A 3HHGA 3K9TA 4DZJA 2GLOA 1WH7A 3IHUA 2F48A 1W7PA 2KQRA 1STZA 3S32A 2VODA 3L2QA 1Z05A 2IAIA 2PQ8A 1X58A 2V9PA 2PG4A 4YIRX 1WSUA 1O3SA 1D0YA 3VYUB 4GFBA 1IXSB 2MG4A 1R23A 3CCEI 2EZHA 3GTMJ 3H5RA 1OLTA 3BT9A 2R92J 3CO6C 1YW7A 3M3YJ 3LAJA 3I3LA 3S3OA 2E19A 4IX7A 4CYCB 1TW2A 4UXNA 3BPVA 3AL0C 2MH9A 2FQ3A 3C3WA 3R60A 4M6VA 4ZDPA 2R7QA 3A4CA 5LEJA 4KDPA 1B4AA 3ABMH 3JAMZ 5FROA 3ZP5A 2ESHA 3W3CA 1NH3A 2JRMA 1R00A 1ONVA 2G7UA 4YFXF 1O7LA 1V5GA 4P96A 4D1QA 4ANJA 2FSWA 3A0BC 4ZDOA 4IJAA 4OIOF 2PEXA 2PBIA 3HXLA 1W0UA 4IF4A 2YU3A 3WTXC 4YG2F 3GYHX 2RQPA 3GBGA 3RYRA 1MMGA 4EJVA 4ZZLA 3DF8A 2IT0A 1J09A 3HYIA 2DFEA 4JK1X 5JHUA 4LMYA 3F0CA 1SFUA 1UMQA 1T2KA 5IT9Z 3SDGA 4LFUA 2EILH 3FDYA 4HOBA 1JGSA 2P4WA 4HF1A 1IRGA 2ELKA 5TGTA 1ZH5A 2YS9A 4M9ZA 1A6IA 2H6CA 1EF4A 1YITI 1E0EA 3ZMUA 2DYSH 2R7WA 1IDYA 3WTTC 1QNTA 5GTIC 3BLYA 3E97A 1U9OA 2HTJA 2K9MA 2KIQA 3J7AO 5B1AH 4Y3OA 3OR2C 3BG5A 4BY1J 2CWEA 1KYWA 2PLYA 2KISA 2M3AA 3S1QJ 5K7ZA 1FJLA 1USTA 4RM2A 2BBYA 4RB0A 1RR8C 5C4XJ 3OIPA 4UVCA 2A5WA 5EEAA 1FBQA 2HVSA 2HOTA 3AL0B 2Y0MA 1BR2A 3FXKA 1IRXA 3TDZC 1QRYA 4DQ2A 3ONQA 2DU9A 1JTYA 1V54H 3FBNB 4PUSA 2BW3B 3FHNA 2XC7A 2DJIA 2VL8A 2L2OA 3J81Z 1VQ5I 5EEHA 1P4XA 4G8XA 2Z16A 4KITB 2WWYA 2DAOA 2I8DA 2ISYA 4XRMA 3OYDA 1HCRA 3TDUC 1OJLA 2Z33A 2ZJ2A 1G6NA 3GFMA 4UV8A 5HLIA 2EPFA 4BEHB 1K78A 1OR7C 4G12A 2EZIA 4FT8A 3TBIA 1R4MB 3QODA 2ME6A 4Q48A 2VLAA 1FMWA 2X6WA 3KZYA 2HYFA 1TBXA 2P0WA 1VTNC 4RBOA 1S5LC 4ZYHA 2LVSA 2O8KA 3A02A 3HZJA 2JSPA 4CHUA 3S17J 2FU4A 2Z1DA 4FCYA 3HPHA 3Q3SA 1N25A 2FRHA 2E1CA 1OQYA 4HPQA 4N0BA 2FBIA 2KL4A 4A6EA 1L0OC 2JRTA 1TNSA 2ZFWA 5EYRA 1XCBA 4HSTA 1HW5A 3HRSA 1UHMA 1WVRA 2NOJB 4KYWA 3HOTA 4RLFA 4BJ6C 3IRQA 2NVXJ 2HOAA 2LY1A 1HKSA 2DA7A 2MC4A 1DPRA 4MQVA 2OZ6A 3IP4B 1RUOA 1Z0XA 3OOUA 5DCFA 2IA2A 1TQMA 3TW7A 1LE8A 4C9YA 4BH9A 4A93J 1FIAA 2K3FA 4OIRF 5F04A 4C3HJ 1SANA 3H9GA 2W84A 4XIDA 1AWCA 4RMNA 2PFBA 2VB6A 1ZLJA 4IEJA 1MBKA 3H0DA 1MMDA 2CW0F 4DGWB 2FF4A 4MTEA 1XC5A 1BI3A 1EV7A 1FSHA 1YS7A 2ZFUA 3BG7A 5CLSA 3K10A 1X1AA 2KT0A 3D5SC 5GAEJ 3EYIA 4ENNA 4EQQA 4M9SA 4Z6YA 1JKRC 5D5WB 3N97A 5HDGA 5M3MJ 3IL2A 2A6HF 2AQEA 2L9NA 3OL4A 2ZNYA 4KIFA 1HBXG 2JA5J 2O8XA 4HSRA 5ILUA 5E18F 2HKXA 3NARA 5BS6A 2F4MB 1FZPB 5CQEA 2K3PA 3VFZA 1UG2A 3FMRA 4ZYEA 5L3BA 1GV5A 3MKZA 5DD8A 2MC3A 3BR2A 4A3FJ 1ZRDA 4PK4A 3K4MA 3ZQ7A 2IPQX 4D0PA 4ABZA 2OCCH 4HDUA 1PDNC 3RZOJ 2LFBA 3M7GA 2LREA 5LRSA 1FC3A 4E7JA 4M3DA 2CV2A 2IS1A 1X3WB 2QGUA 5FRNA 3GO5A 1HW2A 2ID6A 2L9RA 2E2HJ 5GP9A 3REOA 1HQCA 2VXZA 2EA4A 2KRFA 4ZJZA 1PP8F 3OIQA 5C3EJ 3ABTA 1YJWI 1ZREA 5LGNA 1DDNA 4JYKA 5J3LA 1G4DA 2IEKA 5IP9J 1A6QA 1X3UA 1JXSA 2XHKA 1J59A 2XDVA 1W5TA 3QYBA 3KP6A 1ZK8A 2VC1A 3KYCB 4B4CA 2BVMA 2EFQA 1UJ8A 3J7AY 3GXOA 4NNJA 5L3DA 5FLMJ 2E1OA 3DBHB 1QBJA 2YSRA 3BC8A 4LK0F 2CS3A 4WF2A 1R5ID 4XN3A 1A04A 2IGOA 5H2FC 2LF7A 1Y8QB 2K4BA 3BR0A 4XRSA 1MBEA 2VQLA 1VQLI 2LH9A 1EH7A 3PIPF 4L0YB 4P9FA 1N77A 2OD5A 3BP8A 2AS5F 1VQ9I 3SZPA 3BG6A 1VI0A 2VJJA 1XX5A 4CYCA 1LVAA 1ZRCA 1RNLA 2VJ4A 4EGYA 2HYGD 3SFIA 2YX4A 4DOZA 1JJ8C 1ZARA 3QAHA 4BBSJ 4AC0A 3ZCOA 3HRTA 3JRFA 4MFEA 5IT3A 2F5FA 2R7TA 1IAWA 3HEFA 2L4AA 2P7CB 3L1PA 3ERED 3BG3A 3K2ZA 3KP2A 3CD6I 2QZ8A 1IUYA 2FBHA 2ZBKA 4JP0A 5EEGA 3S15J 2IS6A 1BW5A 1GVJA 1V55H 3G3ZA 4LB6B 2WB1N 3V7RA 4II2A 3I0TA 2EFPA 3WGHA 1H88C 3GTKJ 2NOGA 1HW1A 1MGTA 3BCAA 2UUZA 3FXJA 3E6CC 1QPMA 1V5EA 3HG9A 4GDFA 2MSYA 3PUFA 3I56I 1VFCA 1JHHA 2JA2A 3KP3A 4ON0A 3VEPA 1V3FA 1Z3XA 1WJAA 4XORA 3CJQB 3CLOA 4HEA2 2I5UA 4Y15A 1YE9A 3HHHA 5CVJA 4IHYA 2OTLI 1ETXA 4FETA 1D3YA 3ECOA 3ROUA 3BOQA 2M30A 3N4MA 2UXNA 2WA0A 1U6GA 3I58A 2KZGA 1YI2I 3ULQB 3OYJA 2DODA 1SD7A 3GW2A 3CESA 3BR3A 2NVUB 1A36A 2K27A 4PGHA 2HDCA 5H6RA 2EH3A 4Q4ZF 2V1DA 3CCSI 2CQNA 1TTYA 1NTCA 4NQWB 3WHBA 4MLOA 5LD2C 5K5RA 3WU1B 4G7OF 3V4GA 4DW6A 2ZXWH 5LEKA 1FP1D 5FD5A 2B0LA 2MFZA 3O6BB 2JA6J 4D9JA 2DTZA 5E8IA 2WV0A 3IAM2 4LJZF 4HG2A 1FWZA 1R71A 2BW3A 4V2FA 4A12A 3KE2A 5D6EA 1WKMA 2CRGA 2DTRA 3K4NA 3KEOA 5CYVA 1P92A 1TT5B 2OC6A 4KIGA 1C0WA 4H4KC 3E5XA 3T5XA 1ZG5A 2H09A 2NVQJ 2HFHA 2KIFA 1UAAA 5B5EC 5K1YA 1W0TA 1HLVA 2XGDA 1S72I 2V4JC 3BQYA 4BEHA 1ON1A 4R1HA 2QKMB 3BY6A 4J00A 5A2QZ 2BYVE 3UNGC 1VQ4I 4ZYAA 2WBMA 3LSHA 4O3MA 4E7ZA 4UB8C 1UFMA 1P7JA 1D5YA 1TZLA 4I7HA 2EQRA 3B02A 1ETWA 3JRGA 5ERIA 2OU2A 2HGCA 2VPRA 4NC7A 4N4OB 4E7KA 3RKWA 2A6EF 5D8LB 4UVBA 1YOVB 5TJJA 3H36A 4L9JA 4HX4A 3SJMA 1XG1A 4HLYA 1B72B 2LR8A 4DBQA 1R9TJ 2JA7J 1LEAA 2HU9A 1MSFC 2DFIA 1RETA 4KA4A 3ZN1A 2J5OA 4ESBA 1R22A 1P4WA 1QHGA 2Y48A 1O3QA 4UVAA 3H35A 2DDAA 2BZTA 5F6FA 1FEXA 4XSZF 1RI7A 3HDDA 1APLC 2HS5A 4PJMA 4A5NA 1Z6TA 4EM2A 1W5CC 1U0JA 4QPOA 1B1BA 4LLNA 4KN7X 2E34A 2JVHA 3PFIA 2VBWA 1E3HA 3I53A 5JFRA 4I2OA 2FQ4A 1ZELA 5JLWA 2KHMA 2MBFA 2XROA 3QRFF 2K5CA 3DPLC 3O3KA 1UHSA 4UV9A 5E3MA 1OKRA 3U1KA 3CP8A 3I4NJ 3K7AJ 4XOTA 1XGNA 4XLCA 2CFOA 3P5JA 1R58A 1QZEA 1GT0C 3K4LA 3JRAA 2L7KA 2KZVA 1WGXA 1FOXA 1OR7A 1SFOJ 3CC4I 3QPTA 2E5ZA 3GUDA 2COBA 2E2JJ 1R1TA 4XRFA 1W36D 4CSWA 3JSPA 1O7FA 2RREA 2IGNA 4CA0A 4NBQA 5L3FA 2CG4A 4FX0A 2P81A 2WAFA 2BXYA 3TMOA 1T39A 2HQAA 2R5YB 3S3MA 5KK1A 4IRGA 5DCMB 1G3TA 3O2PE 4A3DJ 3NAUA 1UB9A 1OYWA 4WCGA 2F4IA 2CH0A 2HQ5A 3UR3C 4N9IA 4A0YA 3CMAI 5E17F 2ECBA 2OPTA 3J80Z 1OCRH 2LP0A 4RGSA 5HS9A 3IH2A 3OOPA 4LIVA 2VKDA 2W7NA 2HWVA 2ZJRF 3PO2J 2TDXA 4S04A 5TRDA 2R4GA 5HLGA 1W7PD 2ACJA 4IQJA 4PFPA 3RQ4A 2TCTA 2QQ8A 1FOKA 2E1MC 3M07A 5IOYA 4LOCA 1IJWC 3CCRI 5KNLA 2GWRA 3SZGA 2EFOA 1FTZA 2GOXB 5DD4A 2IA1A 2OUMA 4B43A 4B8XA 1BBYA 2G0EA 1FNNA 4I09A 3SYTA 4UB6C 1SD6A 3KZIC 4OAZA 2QSFX 3C2GA 4PJNA 4YEJA 4D5CA 1U8BA 1XCVA 2KLOA 2M7BA 2RGVA 3TGNA 2P6TA 3JRCA 2IGMA 3CC2I 3OSFA 1PUFA 1WJBA 1HDDC 3WE2A 2H6BA 3LSKA 3BG9A 4RDUA 1ETKA 1T98A 4PSXA 5FJ8J 2F5CA 3IH3A 3TOBA 3V7SA 1Z1DA 1RUNA 1ZR4A 1X4OA 3JTHA 3LSGA 1WZ2A 1F36A 1LNWA 2ME0A 3SEQA 2X85A 3ZMZA 1FLIA 1IO2A 5FLXZ 5GAHJ 2EIMH 3I4PA 4ZYGA 1EJ9A 3HC7A 1JUMA 3FIWA 1IN7A 2VIXA 2L7FP 3FBIB 1KU2A 4BQNA 3FISA 1JTXA 2VN2A 2DJNA 2W00A 4IOAF 2X6OA 2E60A 3K1NA 1QO0D 3ZQGA 2QEXI 2ZXJA 2B63J 4KT6A 4NB5A 1MMSA 3BWGA 2STTA 2DFFA 1XSVA 4X0GA 2WADA 2HOEA 5HNFA 1O3RA 1YFHA 3WGIA 3ERMA 1IN4A 3JRHA 4HYEA 1YQAA 1ZAOA 2L7ZA 1WFXA 1LFUP 3GX4X 2CUEA 1BL0A 2E1MB 2JSCA 1VNDA 3PSFA 5FRMA 2E71A 4NQWA 4XKWA 5CVVA 1D8JA 1D0XA 4U7BA 2HYJA 1W1WE 5IOZA 1IN8A 4PZJA 5AIQA 1UELB 2XGXA 2XPVA 2V79A 2WTEA 2CU7A 3KEQA 3PM1A 4U88A 3LNQA 1T0FC 3P9CA 3OYCA 3BZCA 1MMNA 4XICA 3H3VK 6PAXA 4Y4RA 3GCMA 3RYPA 5CVIA 1OCZH 2YUSA 3GVAA 4IHWA 3EUHC 1D1AA 2RDPA 5GTHC 1XB4A 5E3NA 2Z5UA 3FXQA 3MZ8A 1ODDA 1MBGA 1FYMA 1S7EA 4HX8A 2X6YA 1XDSA 1JUPA 4JX4A 4BDZA 2MW8A 3MEXA 3BCBA 2MLKA 2HXOA 2CO5A 1S6LA 4D5FA 2VJ5A 3RZDJ 3V7CA 2OV7A 4XLFA 3LOCA 1FTTA 1BW6A 2HQNA 3I64A 2X1EA 1KU9A 2X1DA 1R5GA 2E7WA 2W85A 4XLHA 2O3FA 5F0FA 2ZCWA 2XSJC 1WQ2A 2P5VA 3KX2A 2KDZA 4B1RA 3G1OA 2OCEA 4E7IA 4CICA 4CGZA 3ZQCA 3CDHA 3ZMVA 1OPCA 2EV6A 1RZ4A 2KIUA 3QP6A 2NYXA 4RAFA 2KPMA 5F64A 3J7YJ 3WU2C 4E70A 3OYAA 1FX7A 4Y7NJ 3I9V2 2NXNB 3LSMA 2AXTC 4HV5A 4BACA 2C6YA 1ACIA 4IRHA 3FX3A 1R1UA 1P4AA 2DMQA 1RR7A 1IUFA 2DOAA 5IP7J 4HF2A 3OL3A 1A5JA 5KAFC 2Q2EB 4Q5SF 4UUVA 2ZSIB 4BUPA 3GTOJ 1E17A 1BR1A 1YIJI 2QVOA 3KP7A 3S2DJ 4AWXB 3CJRB 5AONA 4KJZA 1S29A 2L7MP 3HJEA 4CZZA 1H0MA 2WAQN 3E5UA 3A01B 1PP7U 4ITVA 1BC8C 2BEOA 2KDOA 2Z2SB 2PN6A 5JVGF 3QU6A 4IHSA 4A3LJ 1BN5A 1B8IB 3G1LA 4XM3A 3DEUA 3Q0UA 3CTAA 3VSLA 3OYHA 3MFKA 5FKNA 2V6EA 4IKFA 2MGQA 2XKOA 3TQNA 3IWZA 4CYDA 2V7FA 3I55I 1IRZA 3OYBA 1L3LA 4BKXA 1DU6A 3RCOA 1B9MA 1MZBA 2E7XA 3IKTA 2YX7A 1FSEA 1AHDP 1FT9A 1D8KA 3KYLA 1TWAJ 3CMEI 5CVRA 3K70D 2ISZA 3HOZJ 1OISA 3OS2A 1IXRC 1WJFA 2R5YA 1VF9A 5DCMA 5CVUA 5FFXA 1GXQA 3IAS2 3AG2H 3X2QH 2HPIA 4HQMA 3CF2A 2E36A 2JJ7A 2R7ZJ 3E5QA 4XQFA 5D4SA 3A0HC 4ENJA 3LA7A 1BJAA 1X1PA 4FE4A 2NS7A 1WWXA 3CJNA 3IKVA 3JSOA 3G71I 1O4XA 1W5SA 5FGMA 4EM1A 4LD5A 3WG9A 2EZLA 3EUAA 3ZGKA 3Q0VA 2DMNA 4B3XA 3BJAA 1USSA 2LMDA 3C18A 4IOCF 3BJ6A 2ELHA 1Z9CA 3F22A 2DPDA 1EA3A 2L3DA 3KIOA 4XKBA 1SD4A 5K7HA 3P7NA 2PMZN 5D5VB 4U7DA 1T38A 2L54A 2DMUA 4RLQA 4BGDA 3IRRA 4A0ZA 2LKXA 4I99C 3H0GJ 1UCRA 1ZGJA 1RC9A 4IHXA 2DW4A 1G3WA 5FO5A 2RNJA 4YFKF 1BR4A 2YU9J 2Y0SN 2KIMA 3TOAA 1REPC 4A3MJ 2GA1A 2DQRA 1FYKA 1MH4A 1QZYA 2UV1A 5GAGJ 4AIJA 1J5YA 5ICGA 3KPHA 3DTKA 1JHFA 3PFYA 1N75A 2EINH 4AIHA 4KT5C 3LQQA 4L9TA 5JHFA 3L7WA 3ECHA 1B9NA 3MVPA 2WY8Q 4IO9F 1QA6A 3GWZA 1SFXA 3ML6A 2L0KA 2CV1A 1J2XA 1MJAA 3FF5A 4XMYA 2QQAA 1AA7A 1KZHA 2M34A 5E1WA 1SVMA 2Y30A 4UUTA 3DWLE 1AOYA 4MGRA 3CO7C 3M8FA 2R5ZB 1ZGWA 4OINF 2JZYA 4Y13A 1H8AC 3OYIA 1RKWA 1H9GA 3H5NA 1Z67A 2Q1ZB 3M1CA 2Y9ZA 3FWEA 4ZH4F 1SC7A 2M0CA 2FMLA 5KHDA 5LHHA 3BTIA 3OYKA 1HOMA 4BE0A 1LPQA 5DV5A 2FD5A 3LWFA 4DIQA 1SAUA 2FBKA 2H8WA 3DU6A 1X1BA 1RKTA 1IG7A 3JREA 2QSHX 3LSIA 1G3YA 2K9QA 2EIKH 3SXYA 3VYTB 1SAXA 1AKHB 4BAYA 4CCMA 1W4MA 4E6KG 1A35A 2IP2A 1Y0UA 1JKPC 3CMYA 4L9VA 5L3CA 3M8EA 5E20A 3U9GA 2VBZA 3S93A 4MQ9F 2JMWA 4DBRA 5IYDJ 3L9FA 4RM3A 4ZDLA 2A5YB 1IN5A 3DLLF 4Y17A 1DQUA 3K4CA 2EBIA 5F0CA 4LK1F 4C2UA 3OYLA 2GM4A 4PJ0C 4RGUA 1MDMB 3I59B 4C2MJ 5DUIA 1IV6A 4DZPA 1XN7A 5FD6A 4A6DA 2LYCA 2EFWA 4RS8A 3DKYA 2M87A 4OIPF 1BI0A 2VT3A 3WG7H 1K4SA 3LSRA 2DK5A 5IY5H 2M8GX 4XKCA 2HZTA 1FYLA 2GIVA 4Y52J 1BC7C 2EJRA 2UXXA 2R7RA 4BE1A 1F1ZA 3HKZA 3LA3A 1NK3P 2VASA 3OWTA 1T08B 2BGCA 3U1DA 4AU7A 3ZMSA 2DN0A 5C4JJ 3K4KA 1LJ9A 3JW4A 3PNVA 2FA5A 2CUZA 1VQMI 3BZ6A 1I5ZA 2ID3A 2BHZA 2R7VA 2CV0A 2DMPA 3E7LA 1YG2A 2QKLB 1CQTA 2VC0A 1XGSA 3KCCA 3E6BA 2R0QC 3GTQJ 1BJZA 3VPRA 1WH5A 1TWFJ 4ZYDA 2QUFA 3S14J 1D0ZA 4C30A 2DOFA 4G7ZF 4OIQF 4Z2YA 1DP7P 2CSOA 3MZYA 5K7FA 1QQIA 3L09A 2PMUA 1YW9A 4EM0B 3D1NI 2CMPA 4DYCA 2Q2EA 1T0FA 1NG7A 2DPUA 2V9KA 1IW7F 1XDUA 4L18B 5M5YJ 3WTUC 5F1JA 2MYSA 2A3SA 3MWMA 4WXCA 4KN4X 3A01A 2JA8J 2W25A 3EUHA 4CCNA 4JOMA 2FNPA 3CCMI 1B8IA 1GHCA 3DLAA 1YJNI 2LG4A 3DCFA 3FMSA 3ZMTA 1K79A 2GAUA 2R3SA 2WY7Q 1T8IA 2BE5F 4O5VA 3W2AA 4C3JJ 2RVCA 2DLLA 3OIOA 4AYBA 1OCOH 2ICWG 2ZNZA 4G6QA 2A68F 1I3AA 1LFPA 1XGOA 3GEZA 4A2UA 3QOPA 1I6HJ 3A03A 1W7PB 2D1VA 3R0JA 4QIWN 2NNYA 3CCYA 3ISPA 5LGTA 1F9NA 1OFCX 3HOYJ 3F21A 1XSDA 1XGMA 3GTPJ 1WHUA 2IVMA 2K86A 2KRHA 3J7ZI 3ZQLA 2A07F 1T6SA 3CDIA 1JUSA 4MIMA 4M73A 4U87A 5LHIA 4NHJA 1OYYA 1MIJA 4A0XA 2HQRA 3KYDB 2Y31A 2IA0A 2R7UA 4MHGA 3K2AA 3HM5A 3ABKH 3WTVC 3S16J 2FOWA 3DBRB 1X4PA 5LGUA 2M45A 3F8NA 2IRFG 1P2FA 4OMYA 2DA5A 4F91B 1B59A 1IXCA 4PSWA 1QHHD 3H5AA 3JRBA 1LQ1A 1YRNB 3BQZA 1WI3A 4J01A 4IRIA 1JE8A 4FISA 1X3ZB 4EJWA 3HOXJ 1J9IA 4EJOA 2QLZA 3CZ6A 1ZG1A 4A5MA 4BDYA 2DA4A 2ZO4A 2V1XA 3JTGA 3WU0A 2VPLA 1BM9A 4G9YA 4CCLA 5TISC 4GXOA 2XAHA 5D6FA 4CH7A 3CQZJ 4UNOA 3EUKL 4HZFA 3ZOBA 1SFKA 2Y69H 3E3VA 1Q1VA 1ZKGA 4ASNA 1BI1A 5LLQA 2K9LA 2M8EA 4RB2C 5HDKA 3MKYB 1DPUA 4BNCA 3G4SI 4LGWA 2GXBA 1F5TA 4O6JA 4G94A 2M9HA 1YIOA 4PDKA 2WAEA 1MNDA 5FFZA 3GZ5A 1FP2A 2A69F 1YLFA 4S0HB 4EJUA 5J4YA 5HLTA 1FY7A 2RQQA 4WK8F 2R7XA 1QPIA 2H94A 2R5ZA 3W6KB 4BJTA 3KP4A 3S2WA 2L5QA 4C2TA 1K6OA 2XAGA 1O3TA 5J1YA 1RPWA 1KONA 3QYFA 3S8PA 5LRRA 3DQVC 3S2HJ 1ETOA 2DO7A 2O7OA 3OSGA 1K83J 2BV6A 1JJ6C 2R7FA 2DA6A 1R7JA 2EK5A 2RKHA 5J1UA 3VYSB 1U2WA 2IXSA 1KYZA 2HKOA 4MEXF 1XMAA 2LKSA 2O5RA 1Y1VJ 1I50J 1R49A 2K9SA 3KETA 1ETVA 4KIBA 1DGWY 2H27A 3C7JA 3W6VA 2GZWA 2EV5A 2GXGA 4EVIA 1IGNA 4YELA 3RDIA 5IYCJ 3PIOF 2XUBA 5LBQA 1AKHA 4KISA 3EDPA 1V4RA 4L5IA 5K5OA 3WTSC 3F6OA 3LFKA 3SZTA 2DI3A 3WODF 4F3QA 5BQTA 2JQ7A 3O8HA 3F8MA 4YIFA 1Z77A 5E3LA 1Y56A 2XAFA 3AG4H 1V5FA 3PSIA 3LFUA 2XKPA 2V26A 2CUFA 3KLOA 3S1NJ 1KQ0A 1ULYA 4EGZA 4A3KJ 3FXOA 2NRAC 4NC6A 2X51A 1PUEE 1YS6A 2K4JA 2WC2A 2K7LA 4JQFA 4HW0A 2PX9A 3ZQFA 2BOLA 1KGSA 1O57A 4M72A 4AIKA 5K5QA 2LF8A 1T95A 2OAZA 3TO6A 1MJBA 2W4SA 1MDMA 3I59A 2QBYB 4RGRA 1MBJA 2MABA 5L3GA 4OAYA 4ENMA 2DT7B 3CUQC 3ZR8X 1M1EB 1QZZA 1FMVA 3G2BA 3TEDA 3HTSB 5M5WJ 5GPCA 3ZMDA 1Z3YA 2K9NA 3HTUA 4ZTFA 1WJCA 2XASA 2ZXIA 1LUJB 2UWMA 3M1EA 5E8GA 1ZYRF 2XPWA 3K4JA 3KFWX 2GXAA 1XTAA 3GF2A 3W2WA 3HRMA 5LHGA 1VQNI 4MO7A 4F7ZA 3D0SA 4EJTA 1X2MA 1XSXA 2VJIA 4R8HA 5EF6A 4EV0A 5ED4A 3R6SA 1JI8A 3CCVI 3RKXA 1ZQ3P 2KKOA 4XLNF 4F93B 4P55A 5B3SH 4WWCA 3GLLA 2CW7A 1JGGA 2AXLA 2XAQA 2P5LC 2H1LA 3GTGJ 4P5OA 3HRUA 2JPBA 2KJCA 4GYIA 2LBFB 2KJBA 3PNTA 1QGPA 2GQQA 2ZMEC 2STWA 1ETYA 3ABLH 3DTEA 4QTRA 2HZDA 2VONA 1G2HA 2JUGA 4BU2A 2DDBA 1YW8A 2L9SA 4NUBA 1U5TC 2CQKA 2F5VA 3JAMK 1I39A 3EETA 3T8RA 3CDLA 3WTWC 3ZXSA 2DA2A 2O03A 3PJRA 3HGGA 3PO3J 4LG0B 3RPUA 2HDDA 5D5UB 1XD7A 1MKMA 4HDVA 1VZ0A 1GUUA 1I3QJ 3QU3A 4BQOA 4CCKA 1Y39A 1JKOC 3ZRGA 4IPAA 2WV1A 4A3IJ 1NK2P 1ORKA 3CUQB 3SFZA 5EG0B 2D45A 2PMZA 1NHAA 2VKEA 4WXHA 2AQFA 2AO9A 3C1DA 2QWWA 5IT9K 1E2XA 5DDGA 5EDNA 2DMTA 2ESNA 1DUXC 1FPQA 3F3XA 3A1YA 1WCMJ 3MKLA 4CCOA 1QVTA 4YIIA 2EV0A 1Y8RB 4CXFA 2CQQA 4UY8I 2Y0SA 2VT2A 3QQAA 4QSHA 2HPMA 3NQOA 4UHTA 3LMMA 1BOAA 1MH3A 2EIJH 2GOMA 2XIGA 3PQJA 4Q47A 3BPXA 4NDLA 5AIPA 3K1MA 2JUCA 3A2KA 2VE9A 3T8TA 4GYGA 2X6XA 3GMEA 2LOOA 5DTDA 1VQKI 2FOKA 3V42A 5BMZA 2D2WA 2W57A 4XBFA 1VQ6I 1HF0A 3G73A 3F9KA 4HBLA 1B72A 4CDGA 1Z7UA 2DXIA 4GCVA 4II3A 3PNYA 1LEBA 1YX5A 2ZMEB 4EEFG 3ASNH 1H9TA 2BXZA 1YRNA 4QPQA 3I4MJ 5BPDA 1JT6A 1S7AA 1U5TB 5DM6F 3FK6A 4F52A 1JT0A 3HPGA 4HRIA 2KP6A 3K1PA 3J81K 3FKJA 5FKLA 2F4OB 4FTHA 3MAJA 2O61A 4BYYA 1RRJA 5HOOA 2HEOA 2XRNA 2AHQA 3Q9VA 4M6YA 5J8CA 3HSFA 3KP5A 5ICFA 4CUGA 4A3JJ 1UZCA 2VI6A 3HUGB 3COAC 4ENKA 4L0ZB 1K4TA 4E4HA 4MTDA 1Q1HA 2X48A 1U78A 1X1CA 1LVKA 3HSRA 2MLGA 5FKKA 3RJPA 1PVEA 3QPLA 1ERDA 2X0LA 1Y6IA 4DNCA 5DYMA 2CFXA 4HQEA 2OA4A 3GFJA 1WJDA 3S1MJ 5CQGA 5CJ9A 2BY1A 4N9HA 2M4KA 1HKTA 2VQCA 1ZGAA 2NNNA 5B66C 1IV8A 3TL4X 1NG6A 2ZC2A 3OYFA 2VOOA 2QSGX 3HOWJ 3H3ZA 4AUXA 4CCJA 4U0WA 1T56A 2V6CA 3DEEA 4BXXJ 4R79A 3U21A 3N05A 3E1SA 3HL2A 2CQ7A 3FXRA 4I01A 3BJOA 4A3BJ 1MBHA 2OQGA 1FBSA 2RN7A 1Y0NA 2G7HA 4BE2A 5BOXA 3ESWB 3BR1A 4B3AA 1K6YA 4HNVA 3RIRA 1EH6A 2VKVA 4XR6A 1GVDA 5ILSA 3K0LA 1S3JA 1RIOH 2GIZA 4BHCA 2G9WA 1P9QC 4JX5A 3GTJJ 2WB1A 3R4KA 2E1NA 2I10A 4I6ZA 2TRTA 2RV8A 2M4GA 4M74A 2XGEA 4PGGA 1P6RA 2XGCA 4BHBA 4RB1A 2VOPA 1ZHFA 1OYIA 1XMKA 2CW8A 4IXAA 3WHCA 2HNHA 4HV6A 4DYQA 4B09A 3L2WA 3D5LA 2B7EA 2LLKA 4KMUX 3T1BA 2BHYA 5J47A 1S8NA 2FMYA 5L3EA 1TP4A 4M3BA 3DV8A 1TW3A 3CC7I 1I6XA 1S7OA 3SDBA 1Z7LA 2VXDA 3HIFA 3ELKA 1F4KA 2PJPA 2V9VA 1YHQI 1IC8A 1OCTC 4XK4A 4YRVA 2QBYA 1POGA 4E7SA 3DKWA 2QQBA 2XRLA 5E3OA 3H1CA 3OMYA 5EZGA 4A3EJ 4BXUA 2NVTJ 1KU7A 2Z3YA 1TQIA 1GXPA 2IS4A 3GFLA 2LTPA 4XONA 5F0HA 2JTVA 2KFDA 1ZRFA 1VQ7I 2LY2A 1BIBA 9ANTA 3MMYB 2OZUA 1VQOI 3W2VA 3LQRA 2YR2A 1GLNA 2W82A 3M9AA 1ZG3A 4KUMA 1KQ8A 4U0YA 1D1CA 3PQKA 1Z6RA 2QENA 3M8JA 3ZQHA 1OMIA 4ZZDA 2XB5A 2VE8A 4DJAA 2MD0A 2VQHA 2DOEA 2P7VB 5J6XA 3QYEA 3JRDA 3Q5FA 5KVRA 3EQLF 5GPAA 2XAUA 1R1VA 1Z91A 2LDUA 4XLEA 1HA8A 1ENHA 1IN6A 2MA3A 4MFDA 3CMMA 4RA2A 3MD2A 2HVRA 1F43A 2NAZA 4D7NA 2EZKA 2LBFA 3QP5A 4FASD 3L2UA 2FJ1A 3F8CA 2P6SA 4QLCU 4RAYA 4XL9A 1ETQA 5IPAA 5JVTA 3FXMA 3FXLA 3LSJA 3RSNA 4OMZA 2ELJA 3H92A 1I1GA 3MQ0A 3FZVA 2V1NA 4P9UA 1XPXA 1SEUA 2IS2A 2QA4I 2FE3A 5J40A 4BHPA 3SQNA 4BBRJ 2GBYA 3LSTA 2RNGA 3ZQQA 4LG0A 1SFEA 4L9NA 1YX3A 1SD5A 2JT1A 3TKYA 5GADJ 2PMHA 2DBBA 2NS0A 3DU5A 4FQGA 4LITA 4U0VA 3S1RJ 4UUSB 3BR6A 4I02A 1H89C 4B48A 1W36C 5F1RA 2LY9A 3CUQA 4TV7A 5EG0A 1J7KA 3TO9A 5DS9A 2QQ9A 3CJTB 3HOVJ 5H6QA 2DA1A 2DA3A 2MH2A 1U8RA 2M7AA 5EGOB
chains in the Genus database with same CATH topology
2NXNB 1VQKI 1ACIA 1YJ9I 1FOXA 1VQMI 1VQ6I 4IO9F 3CC4I 3CCSI 1QA6A 4IOAF 1VQ5I 2ZJQF 2QEXI 1VQPI 1YIJI 1MMSA 3CC7I 1YJWI 1YHQI 1VQNI 5DM6F 5JVGF 3CCEI 3G4SI 3CCVI 1VQ7I 3I55I 4V19K 1VQOI 1S72I 1VQLI 3CMAI 3PIPF 2H8WA 1VQ4I 3CCMI 3CMEI 1VQ9I 1YJNI 2ZJRF 2E35A 3G6EI 2ZJPF 2E36A 3CD6I 3CCRI 2K3FA 5DM7F 3CCQI 3PIOF 1Y39A 3G71I 3CCUI 3DLLF 2JQ7A 1YITI 3CF5F 2QA4I 3CC2I 3J7ZI 4IOCF 5GAEJ 3CCLI 1HC8A 3CCJI 3I56I 2OTJI 5GADJ 1FOYA 4UY8I 2E34A 2FOWA 2OTLI 1VQ8I 3J7YJ 3CJTB 1FOWA 1YI2I 5GAGJ 5GAHJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NXN B;  1VQK I;  1ACI A;  1YJ9 I;  1FOX A;  1VQM I;  1VQ6 I;  4IO9 F;  3CC4 I;  3CCS I;  1QA6 A;  4IOA F;  1VQ5 I;  2ZJQ F;  2QEX I;  1VQP I;  1YIJ I;  1MMS A;  3CC7 I;  1YJW I;  1YHQ I;  1VQN I;  5DM6 F;  5JVG F;  3CCE I;  3G4S I;  3CCV I;  1VQ7 I;  3I55 I;  4V19 K;  1VQO I;  1S72 I;  1VQL I;  3CMA I;  3PIP F;  2H8W A;  1VQ4 I;  3CCM I;  3CME I;  1VQ9 I;  1YJN I;  2ZJR F;  2E35 A;  3G6E I;  2ZJP F;  2E36 A;  3CD6 I;  3CCR I;  2K3F A;  5DM7 F;  3CCQ I;  3PIO F;  1Y39 A;  3G71 I;  3CCU I;  3DLL F;  2JQ7 A;  1YIT I;  3CF5 F;  2QA4 I;  3CC2 I;  3J7Z I;  4IOC F;  5GAE J;  3CCL I;  1HC8 A;  3CCJ I;  3I56 I;  2OTJ I;  5GAD J;  1FOY A;  4UY8 I;  2E34 A;  2FOW A;  2OTL I;  1VQ8 I;  3J7Y J;  3CJT B;  1FOW A;  1YI2 I;  5GAG J;  5GAH J; 
#chains in the Genus database with same CATH topology
 2V1U A;  3H3U A;  2XAJ A;  3NEU A;  3M4O J;  3CP2 A;  1KA8 A;  2XF7 A;  3VOD A;  4ETS A;  2XVC A;  2F5D A;  3FHZ A;  1BI2 A;  5D5X B;  2DFH A;  5KCM A;  1OCC H;  1BOB A;  2KRC A;  1WRJ A;  5CPR B;  3IV5 A;  3L2R A;  2H1K A;  1P7I A;  2VQG A;  3HB9 A;  3O8G A;  4JX6 A;  5D8K B;  3F8F A;  3BTL A;  4H0E A;  1XMX A;  4M3E A;  4HNT A;  4ESF A;  1LB2 A;  1U3E M;  3DPU A;  4XN0 A;  4C3I J;  2A05 A;  2JVG A;  2O6G E;  2HXI A;  2QCO A;  4WX9 A;  3OYG A;  1TNT A;  2ZME A;  4XRS G;  2VKH A;  1PUF B;  1WI9 A;  3FXU A;  5B1B H;  3ASO H;  1MJ9 A;  2P8T A;  3IUO A;  2HVQ A;  4IQ4 A;  5DEQ A;  1A31 A;  4V19 K;  5M5X J;  1D5V A;  3TO7 A;  3HGY A;  5BNG A;  2LK2 A;  3DFG A;  1U5T A;  3EPZ A;  1S9H A;  1HKQ A;  3KEY A;  4ESJ A;  3G1M A;  4M3G A;  2KMU A;  3R0A A;  5ICC A;  2CQX A;  3MZH A;  3QPS A;  1WJ5 A;  3LL7 A;  4M3F A;  2EA2 A;  2IGK A;  1KU3 A;  4RAZ A;  3DEW A;  5DUK A;  4X6A J;  1TWG J;  3S3N A;  4LLL A;  3HUG A;  3LSP A;  2K40 A;  2PJR B;  3FMQ A;  5A2Q K;  2ZJP F;  2Z9O A;  3AFH A;  5HNH A;  1ZLK A;  2LNB A;  1IZ1 A;  2BY0 A;  2CJJ A;  2JK3 A;  4J19 A;  3K69 A;  1LDK B;  3CCQ I;  2M2E A;  4I0A A;  1SVO A;  4A3G J;  4IZZ A;  3BZK A;  3F72 A;  2CUJ A;  3OS1 A;  2F5E A;  1MNM C;  4M6X A;  4M9X A;  5M3F J;  2X4H A;  1PYV A;  1IDZ A;  4V2G A;  1U9N A;  1UG0 A;  1CF7 B;  2BY2 A;  2NVY J;  2LKP A;  4PJL A;  4OWR B;  1MW7 A;  4KFC A;  3RTR A;  3AKZ A;  1Y1W J;  2OTJ I;  2NS8 A;  1QVU A;  4LIU A;  2OBP A;  2XF6 A;  3B73 A;  1TC3 C;  1SMY F;  1MNE A;  4KNY A;  1QU3 A;  3PL8 A;  2LSO A;  1LDD A;  3KLN A;  4N4N B;  5F27 A;  4K2E A;  4NC8 A;  3EYY A;  1HST A;  1SMT A;  2YPR A;  5IP6 A;  3P9I A;  5HLH A;  2XSD C;  2E5N A;  1T33 A;  3DXJ F;  4HNU A;  3BR5 A;  4BQQ A;  2COM A;  1YJ9 I;  2R7D A;  4EMS A;  1MD0 A;  2PI0 A;  1N78 A;  2EFN A;  4RB3 C;  5LFA A;  3VOE A;  4HA8 A;  3TP3 A;  3U2R A;  4A3C J;  3C2H A;  5D4R A;  4HAM A;  1PJR A;  2DCE A;  4XOP A;  1HDP A;  5HVQ C;  3AAF A;  2Y9Y A;  2ETH A;  3BRO A;  2VUM J;  3E6D A;  4XLA A;  4QWQ A;  5J1R A;  2BY3 A;  5HOD A;  2ZXH A;  3GTL J;  2L4M A;  2JWT A;  1BIA A;  2LRD A;  4GO1 A;  4AD9 A;  3AG3 H;  2DQL A;  3OYN A;  2Z99 A;  3OYE A;  4IHT A;  5EZH A;  2L02 A;  3CLQ A;  3F8B A;  5E1X A;  1FBU A;  3DPT A;  4G6T B;  1G8X A;  2A61 A;  1E3P A;  2DK8 A;  4AVZ A;  3QOE A;  1I27 A;  2Q0O A;  4M71 A;  3RQI A;  3MKW B;  1K61 A;  2LC2 A;  2IW5 A;  4KIC A;  4S05 A;  3OR1 C;  4HLX A;  3HBL A;  3L2C A;  4OOI A;  2O0Y A;  3NRV A;  4PFO A;  4F92 B;  4GRI A;  1MSE C;  1X2N A;  2RC4 A;  3QPH A;  2M5W A;  1YYV A;  4IVN A;  4DYR A;  4WXD A;  5FB2 A;  3SEZ A;  3ZQI A;  3ABU A;  3WTY C;  4W97 A;  3ZN0 A;  2L9V A;  5BPI A;  3TP0 A;  3FM5 A;  3D5R C;  4L5E A;  5JLX A;  4YFN F;  3KZZ A;  1DU0 A;  3E0J B;  3GFI A;  3T0Y A;  5FLV A;  2OQR A;  3L00 A;  3J80 K;  1D1B A;  4Y33 A;  1MBF A;  2DT5 A;  3RKQ A;  3WTZ A;  2HOS A;  2HI3 A;  3CUO A;  4JBA A;  4LLG F;  5ILV A;  2UZK A;  1TL8 A;  1GV2 A;  3ZPL A;  2H8R A;  4RAG A;  3GZN B;  5H20 A;  3CCU I;  3FKI J;  2XB0 X;  3H9J A;  5E79 C;  4XLP F;  3WE3 A;  3IC7 A;  1EH8 A;  1KQ9 A;  2XV4 S;  2Y75 A;  3I54 A;  5HS8 A;  2HTS A;  3BDD A;  4HX7 A;  2N8G A;  5F08 A;  3L2V A;  5JI6 A;  1LKX A;  3HKZ N;  3JCU C;  3CCL I;  4A69 C;  2X9D A;  4B47 A;  2P5K A;  1ITY A;  5HDN A;  1FOY A;  1G3S A;  4PCQ A;  3Q9S A;  3VWB A;  1LDJ A;  4CZC A;  2JN6 A;  2BVL A;  3K4B A;  2ZSH B;  3VYR B;  3B6A A;  5KAI C;  5C44 J;  3HSE A;  1WJE A;  3K6G A;  2ADU A;  3OV8 A;  2JPC A;  2QYO A;  4W1U A;  3FM3 A;  3P9K A;  3V8J A;  5E1Z B;  1K78 B;  3PUB A;  3RPU D;  3DTI A;  2OF7 A;  4FX4 A;  1IRF A;  4P1W A;  3FK7 A;  1IF1 A;  2M1B A;  2A6T A;  4UUS A;  1R36 A;  4FHT A;  1UHW A;  5JR3 A;  1JKQ C;  2EB7 A;  3R61 A;  2VBY A;  4HF0 A;  3LAP A;  2QM3 A;  2ZJQ F;  3F6V A;  1VQP I;  5FLX K;  2ZB9 A;  4XNF A;  1DP3 A;  1DGR M;  2ZKZ A;  3MCZ A;  4IL6 C;  4BJ5 C;  3OY9 A;  4AVP A;  3K70 C;  5EGO A;  2B9S A;  4I98 B;  1X19 A;  1HXD A;  1WPK A;  3W6J B;  1ZR2 A;  3OYM A;  2EWN A;  2FXA A;  5EJC A;  3F23 A;  1SVL A;  5IYB J;  2R93 J;  1J75 A;  2F6C A;  4MEY F;  4E7L A;  4XSX F;  4AM3 A;  4BXF A;  3JRI A;  1BA5 A;  4GGG A;  1R4N B;  1YO5 C;  1B6A A;  2GA2 A;  4PJJ A;  3NWT A;  1E3O C;  1TQP A;  5J4V A;  4X1E A;  4F55 A;  3GZ6 A;  1AU7 A;  4AYB N;  1R6R A;  2L01 A;  2WAQ A;  1LE8 B;  2M0M A;  4ZTJ A;  4LB5 A;  4E7H A;  1RES A;  4B44 A;  2CYY A;  1EKE A;  3IH4 A;  2LD5 A;  1TWH J;  2FNA A;  3LA2 A;  5CKT A;  3DKX A;  3UKG A;  2XPU A;  3E6M A;  2FUG 2;  2E35 A;  2DT6 A;  3Q0W A;  3I5U A;  4EAT A;  3G6E I;  3TW6 A;  3HOS A;  2HDW A;  3C2B A;  4IHV A;  2QF7 A;  3V8L A;  3VDX A;  1TWC J;  2Y2Z A;  2IBD A;  1ZTR A;  1R5H A;  5DM7 F;  5ICE A;  3DP7 A;  4LG3 A;  1MMA A;  3SHF A;  1ZN2 A;  4FE7 A;  4BS9 A;  1FIP A;  4AID A;  4XKV A;  2W48 A;  3BTJ A;  1XS9 A;  1ON2 A;  4BY7 J;  2W1O A;  3RI4 A;  2O9L A;  3OS0 A;  3HOU J;  2X1C A;  1CGP A;  2MD5 A;  2FX0 A;  3CF5 F;  2CGP A;  2PJR A;  3JR9 A;  2VBX A;  2R7O A;  2RAE A;  1Z21 A;  4BL0 B;  4OU0 A;  2J5P A;  2XF5 A;  2E2I J;  1TT0 A;  1HC8 A;  3CCJ I;  2IJL A;  3B6C A;  3DBL B;  4G6D A;  3IWF A;  3VSK A;  3GLX A;  3NWS A;  3WGG A;  2HR3 A;  1I1S A;  2D5V A;  5FKM A;  1G59 A;  2ECC A;  2Q8K A;  1YTY A;  1GDT A;  1LFB A;  4I0B A;  2FEZ A;  4RGX A;  3H9Q A;  3RPQ A;  3VB2 A;  2DYR H;  1K7A A;  4G7H F;  5HS7 A;  4KMF A;  2OJE D;  1CF7 A;  1HSJ A;  1VQ8 I;  2K85 A;  4MNU A;  4L5J A;  2D1H A;  3AG1 H;  4BQA A;  2K02 A;  1FOW A;  1OCP A;  1TLH B;  2F2E A;  3QWL A;  4D7M A;  1X1D A;  2R7S A;  3BTC A;  4CO8 A;  2W24 A;  3RKY A;  3V8K A;  3MN2 A;  1J0R A;  5FKO A;  5J8F A;  4I76 A;  3I71 A;  4ZC3 A;  3HHG A;  3K9T A;  4DZJ A;  2GLO A;  1WH7 A;  3IHU A;  2F48 A;  1W7P A;  2KQR A;  1STZ A;  3S32 A;  2VOD A;  3L2Q A;  1Z05 A;  2IAI A;  2PQ8 A;  1X58 A;  2V9P A;  2PG4 A;  4YIR X;  1WSU A;  1O3S A;  1D0Y A;  3VYU B;  4GFB A;  1IXS B;  2MG4 A;  1R23 A;  3CCE I;  2EZH A;  3GTM J;  3H5R A;  1OLT A;  3BT9 A;  2R92 J;  3CO6 C;  1YW7 A;  3M3Y J;  3LAJ A;  3I3L A;  3S3O A;  2E19 A;  4IX7 A;  4CYC B;  1TW2 A;  4UXN A;  3BPV A;  3AL0 C;  2MH9 A;  2FQ3 A;  3C3W A;  3R60 A;  4M6V A;  4ZDP A;  2R7Q A;  3A4C A;  5LEJ A;  4KDP A;  1B4A A;  3ABM H;  3JAM Z;  5FRO A;  3ZP5 A;  2ESH A;  3W3C A;  1NH3 A;  2JRM A;  1R00 A;  1ONV A;  2G7U A;  4YFX F;  1O7L A;  1V5G A;  4P96 A;  4D1Q A;  4ANJ A;  2FSW A;  3A0B C;  4ZDO A;  4IJA A;  4OIO F;  2PEX A;  2PBI A;  3HXL A;  1W0U A;  4IF4 A;  2YU3 A;  3WTX C;  4YG2 F;  3GYH X;  2RQP A;  3GBG A;  3RYR A;  1MMG A;  4EJV A;  4ZZL A;  3DF8 A;  2IT0 A;  1J09 A;  3HYI A;  2DFE A;  4JK1 X;  5JHU A;  4LMY A;  3F0C A;  1SFU A;  1UMQ A;  1T2K A;  5IT9 Z;  3SDG A;  4LFU A;  2EIL H;  3FDY A;  4HOB A;  1JGS A;  2P4W A;  4HF1 A;  1IRG A;  2ELK A;  5TGT A;  1ZH5 A;  2YS9 A;  4M9Z A;  1A6I A;  2H6C A;  1EF4 A;  1YIT I;  1E0E A;  3ZMU A;  2DYS H;  2R7W A;  1IDY A;  3WTT C;  1QNT A;  5GTI C;  3BLY A;  3E97 A;  1U9O A;  2HTJ A;  2K9M A;  2KIQ A;  3J7A O;  5B1A H;  4Y3O A;  3OR2 C;  3BG5 A;  4BY1 J;  2CWE A;  1KYW A;  2PLY A;  2KIS A;  2M3A A;  3S1Q J;  5K7Z A;  1FJL A;  1UST A;  4RM2 A;  2BBY A;  4RB0 A;  1RR8 C;  5C4X J;  3OIP A;  4UVC A;  2A5W A;  5EEA A;  1FBQ A;  2HVS A;  2HOT A;  3AL0 B;  2Y0M A;  1BR2 A;  3FXK A;  1IRX A;  3TDZ C;  1QRY A;  4DQ2 A;  3ONQ A;  2DU9 A;  1JTY A;  1V54 H;  3FBN B;  4PUS A;  2BW3 B;  3FHN A;  2XC7 A;  2DJI A;  2VL8 A;  2L2O A;  3J81 Z;  1VQ5 I;  5EEH A;  1P4X A;  4G8X A;  2Z16 A;  4KIT B;  2WWY A;  2DAO A;  2I8D A;  2ISY A;  4XRM A;  3OYD A;  1HCR A;  3TDU C;  1OJL A;  2Z33 A;  2ZJ2 A;  1G6N A;  3GFM A;  4UV8 A;  5HLI A;  2EPF A;  4BEH B;  1K78 A;  1OR7 C;  4G12 A;  2EZI A;  4FT8 A;  3TBI A;  1R4M B;  3QOD A;  2ME6 A;  4Q48 A;  2VLA A;  1FMW A;  2X6W A;  3KZY A;  2HYF A;  1TBX A;  2P0W A;  1VTN C;  4RBO A;  1S5L C;  4ZYH A;  2LVS A;  2O8K A;  3A02 A;  3HZJ A;  2JSP A;  4CHU A;  3S17 J;  2FU4 A;  2Z1D A;  4FCY A;  3HPH A;  3Q3S A;  1N25 A;  2FRH A;  2E1C A;  1OQY A;  4HPQ A;  4N0B A;  2FBI A;  2KL4 A;  4A6E A;  1L0O C;  2JRT A;  1TNS A;  2ZFW A;  5EYR A;  1XCB A;  4HST A;  1HW5 A;  3HRS A;  1UHM A;  1WVR A;  2NOJ B;  4KYW A;  3HOT A;  4RLF A;  4BJ6 C;  3IRQ A;  2NVX J;  2HOA A;  2LY1 A;  1HKS A;  2DA7 A;  2MC4 A;  1DPR A;  4MQV A;  2OZ6 A;  3IP4 B;  1RUO A;  1Z0X A;  3OOU A;  5DCF A;  2IA2 A;  1TQM A;  3TW7 A;  1LE8 A;  4C9Y A;  4BH9 A;  4A93 J;  1FIA A;  2K3F A;  4OIR F;  5F04 A;  4C3H J;  1SAN A;  3H9G A;  2W84 A;  4XID A;  1AWC A;  4RMN A;  2PFB A;  2VB6 A;  1ZLJ A;  4IEJ A;  1MBK A;  3H0D A;  1MMD A;  2CW0 F;  4DGW B;  2FF4 A;  4MTE A;  1XC5 A;  1BI3 A;  1EV7 A;  1FSH A;  1YS7 A;  2ZFU A;  3BG7 A;  5CLS A;  3K10 A;  1X1A A;  2KT0 A;  3D5S C;  5GAE J;  3EYI A;  4ENN A;  4EQQ A;  4M9S A;  4Z6Y A;  1JKR C;  5D5W B;  3N97 A;  5HDG A;  5M3M J;  3IL2 A;  2A6H F;  2AQE A;  2L9N A;  3OL4 A;  2ZNY A;  4KIF A;  1HBX G;  2JA5 J;  2O8X A;  4HSR A;  5ILU A;  5E18 F;  2HKX A;  3NAR A;  5BS6 A;  2F4M B;  1FZP B;  5CQE A;  2K3P A;  3VFZ A;  1UG2 A;  3FMR A;  4ZYE A;  5L3B A;  1GV5 A;  3MKZ A;  5DD8 A;  2MC3 A;  3BR2 A;  4A3F J;  1ZRD A;  4PK4 A;  3K4M A;  3ZQ7 A;  2IPQ X;  4D0P A;  4ABZ A;  2OCC H;  4HDU A;  1PDN C;  3RZO J;  2LFB A;  3M7G A;  2LRE A;  5LRS A;  1FC3 A;  4E7J A;  4M3D A;  2CV2 A;  2IS1 A;  1X3W B;  2QGU A;  5FRN A;  3GO5 A;  1HW2 A;  2ID6 A;  2L9R A;  2E2H J;  5GP9 A;  3REO A;  1HQC A;  2VXZ A;  2EA4 A;  2KRF A;  4ZJZ A;  1PP8 F;  3OIQ A;  5C3E J;  3ABT A;  1YJW I;  1ZRE A;  5LGN A;  1DDN A;  4JYK A;  5J3L A;  1G4D A;  2IEK A;  5IP9 J;  1A6Q A;  1X3U A;  1JXS A;  2XHK A;  1J59 A;  2XDV A;  1W5T A;  3QYB A;  3KP6 A;  1ZK8 A;  2VC1 A;  3KYC B;  4B4C A;  2BVM A;  2EFQ A;  1UJ8 A;  3J7A Y;  3GXO A;  4NNJ A;  5L3D A;  5FLM J;  2E1O A;  3DBH B;  1QBJ A;  2YSR A;  3BC8 A;  4LK0 F;  2CS3 A;  4WF2 A;  1R5I D;  4XN3 A;  1A04 A;  2IGO A;  5H2F C;  2LF7 A;  1Y8Q B;  2K4B A;  3BR0 A;  4XRS A;  1MBE A;  2VQL A;  1VQL I;  2LH9 A;  1EH7 A;  3PIP F;  4L0Y B;  4P9F A;  1N77 A;  2OD5 A;  3BP8 A;  2AS5 F;  1VQ9 I;  3SZP A;  3BG6 A;  1VI0 A;  2VJJ A;  1XX5 A;  4CYC A;  1LVA A;  1ZRC A;  1RNL A;  2VJ4 A;  4EGY A;  2HYG D;  3SFI A;  2YX4 A;  4DOZ A;  1JJ8 C;  1ZAR A;  3QAH A;  4BBS J;  4AC0 A;  3ZCO A;  3HRT A;  3JRF A;  4MFE A;  5IT3 A;  2F5F A;  2R7T A;  1IAW A;  3HEF A;  2L4A A;  2P7C B;  3L1P A;  3ERE D;  3BG3 A;  3K2Z A;  3KP2 A;  3CD6 I;  2QZ8 A;  1IUY A;  2FBH A;  2ZBK A;  4JP0 A;  5EEG A;  3S15 J;  2IS6 A;  1BW5 A;  1GVJ A;  1V55 H;  3G3Z A;  4LB6 B;  2WB1 N;  3V7R A;  4II2 A;  3I0T A;  2EFP A;  3WGH A;  1H88 C;  3GTK J;  2NOG A;  1HW1 A;  1MGT A;  3BCA A;  2UUZ A;  3FXJ A;  3E6C C;  1QPM A;  1V5E A;  3HG9 A;  4GDF A;  2MSY A;  3PUF A;  3I56 I;  1VFC A;  1JHH A;  2JA2 A;  3KP3 A;  4ON0 A;  3VEP A;  1V3F A;  1Z3X A;  1WJA A;  4XOR A;  3CJQ B;  3CLO A;  4HEA 2;  2I5U A;  4Y15 A;  1YE9 A;  3HHH A;  5CVJ A;  4IHY A;  2OTL I;  1ETX A;  4FET A;  1D3Y A;  3ECO A;  3ROU A;  3BOQ A;  2M30 A;  3N4M A;  2UXN A;  2WA0 A;  1U6G A;  3I58 A;  2KZG A;  1YI2 I;  3ULQ B;  3OYJ A;  2DOD A;  1SD7 A;  3GW2 A;  3CES A;  3BR3 A;  2NVU B;  1A36 A;  2K27 A;  4PGH A;  2HDC A;  5H6R A;  2EH3 A;  4Q4Z F;  2V1D A;  3CCS I;  2CQN A;  1TTY A;  1NTC A;  4NQW B;  3WHB A;  4MLO A;  5LD2 C;  5K5R A;  3WU1 B;  4G7O F;  3V4G A;  4DW6 A;  2ZXW H;  5LEK A;  1FP1 D;  5FD5 A;  2B0L A;  2MFZ A;  3O6B B;  2JA6 J;  4D9J A;  2DTZ A;  5E8I A;  2WV0 A;  3IAM 2;  4LJZ F;  4HG2 A;  1FWZ A;  1R71 A;  2BW3 A;  4V2F A;  4A12 A;  3KE2 A;  5D6E A;  1WKM A;  2CRG A;  2DTR A;  3K4N A;  3KEO A;  5CYV A;  1P92 A;  1TT5 B;  2OC6 A;  4KIG A;  1C0W A;  4H4K C;  3E5X A;  3T5X A;  1ZG5 A;  2H09 A;  2NVQ J;  2HFH A;  2KIF A;  1UAA A;  5B5E C;  5K1Y A;  1W0T A;  1HLV A;  2XGD A;  1S72 I;  2V4J C;  3BQY A;  4BEH A;  1ON1 A;  4R1H A;  2QKM B;  3BY6 A;  4J00 A;  5A2Q Z;  2BYV E;  3UNG C;  1VQ4 I;  4ZYA A;  2WBM A;  3LSH A;  4O3M A;  4E7Z A;  4UB8 C;  1UFM A;  1P7J A;  1D5Y A;  1TZL A;  4I7H A;  2EQR A;  3B02 A;  1ETW A;  3JRG A;  5ERI A;  2OU2 A;  2HGC A;  2VPR A;  4NC7 A;  4N4O B;  4E7K A;  3RKW A;  2A6E F;  5D8L B;  4UVB A;  1YOV B;  5TJJ A;  3H36 A;  4L9J A;  4HX4 A;  3SJM A;  1XG1 A;  4HLY A;  1B72 B;  2LR8 A;  4DBQ A;  1R9T J;  2JA7 J;  1LEA A;  2HU9 A;  1MSF C;  2DFI A;  1RET A;  4KA4 A;  3ZN1 A;  2J5O A;  4ESB A;  1R22 A;  1P4W A;  1QHG A;  2Y48 A;  1O3Q A;  4UVA A;  3H35 A;  2DDA A;  2BZT A;  5F6F A;  1FEX A;  4XSZ F;  1RI7 A;  3HDD A;  1APL C;  2HS5 A;  4PJM A;  4A5N A;  1Z6T A;  4EM2 A;  1W5C C;  1U0J A;  4QPO A;  1B1B A;  4LLN A;  4KN7 X;  2E34 A;  2JVH A;  3PFI A;  2VBW A;  1E3H A;  3I53 A;  5JFR A;  4I2O A;  2FQ4 A;  1ZEL A;  5JLW A;  2KHM A;  2MBF A;  2XRO A;  3QRF F;  2K5C A;  3DPL C;  3O3K A;  1UHS A;  4UV9 A;  5E3M A;  1OKR A;  3U1K A;  3CP8 A;  3I4N J;  3K7A J;  4XOT A;  1XGN A;  4XLC A;  2CFO A;  3P5J A;  1R58 A;  1QZE A;  1GT0 C;  3K4L A;  3JRA A;  2L7K A;  2KZV A;  1WGX A;  1FOX A;  1OR7 A;  1SFO J;  3CC4 I;  3QPT A;  2E5Z A;  3GUD A;  2COB A;  2E2J J;  1R1T A;  4XRF A;  1W36 D;  4CSW A;  3JSP A;  1O7F A;  2RRE A;  2IGN A;  4CA0 A;  4NBQ A;  5L3F A;  2CG4 A;  4FX0 A;  2P81 A;  2WAF A;  2BXY A;  3TMO A;  1T39 A;  2HQA A;  2R5Y B;  3S3M A;  5KK1 A;  4IRG A;  5DCM B;  1G3T A;  3O2P E;  4A3D J;  3NAU A;  1UB9 A;  1OYW A;  4WCG A;  2F4I A;  2CH0 A;  2HQ5 A;  3UR3 C;  4N9I A;  4A0Y A;  3CMA I;  5E17 F;  2ECB A;  2OPT A;  3J80 Z;  1OCR H;  2LP0 A;  4RGS A;  5HS9 A;  3IH2 A;  3OOP A;  4LIV A;  2VKD A;  2W7N A;  2HWV A;  2ZJR F;  3PO2 J;  2TDX A;  4S04 A;  5TRD A;  2R4G A;  5HLG A;  1W7P D;  2ACJ A;  4IQJ A;  4PFP A;  3RQ4 A;  2TCT A;  2QQ8 A;  1FOK A;  2E1M C;  3M07 A;  5IOY A;  4LOC A;  1IJW C;  3CCR I;  5KNL A;  2GWR A;  3SZG A;  2EFO A;  1FTZ A;  2GOX B;  5DD4 A;  2IA1 A;  2OUM A;  4B43 A;  4B8X A;  1BBY A;  2G0E A;  1FNN A;  4I09 A;  3SYT A;  4UB6 C;  1SD6 A;  3KZI C;  4OAZ A;  2QSF X;  3C2G A;  4PJN A;  4YEJ A;  4D5C A;  1U8B A;  1XCV A;  2KLO A;  2M7B A;  2RGV A;  3TGN A;  2P6T A;  3JRC A;  2IGM A;  3CC2 I;  3OSF A;  1PUF A;  1WJB A;  1HDD C;  3WE2 A;  2H6B A;  3LSK A;  3BG9 A;  4RDU A;  1ETK A;  1T98 A;  4PSX A;  5FJ8 J;  2F5C A;  3IH3 A;  3TOB A;  3V7S A;  1Z1D A;  1RUN A;  1ZR4 A;  1X4O A;  3JTH A;  3LSG A;  1WZ2 A;  1F36 A;  1LNW A;  2ME0 A;  3SEQ A;  2X85 A;  3ZMZ A;  1FLI A;  1IO2 A;  5FLX Z;  5GAH J;  2EIM H;  3I4P A;  4ZYG A;  1EJ9 A;  3HC7 A;  1JUM A;  3FIW A;  1IN7 A;  2VIX A;  2L7F P;  3FBI B;  1KU2 A;  4BQN A;  3FIS A;  1JTX A;  2VN2 A;  2DJN A;  2W00 A;  4IOA F;  2X6O A;  2E60 A;  3K1N A;  1QO0 D;  3ZQG A;  2QEX I;  2ZXJ A;  2B63 J;  4KT6 A;  4NB5 A;  1MMS A;  3BWG A;  2STT A;  2DFF A;  1XSV A;  4X0G A;  2WAD A;  2HOE A;  5HNF A;  1O3R A;  1YFH A;  3WGI A;  3ERM A;  1IN4 A;  3JRH A;  4HYE A;  1YQA A;  1ZAO A;  2L7Z A;  1WFX A;  1LFU P;  3GX4 X;  2CUE A;  1BL0 A;  2E1M B;  2JSC A;  1VND A;  3PSF A;  5FRM A;  2E71 A;  4NQW A;  4XKW A;  5CVV A;  1D8J A;  1D0X A;  4U7B A;  2HYJ A;  1W1W E;  5IOZ A;  1IN8 A;  4PZJ A;  5AIQ A;  1UEL B;  2XGX A;  2XPV A;  2V79 A;  2WTE A;  2CU7 A;  3KEQ A;  3PM1 A;  4U88 A;  3LNQ A;  1T0F C;  3P9C A;  3OYC A;  3BZC A;  1MMN A;  4XIC A;  3H3V K;  6PAX A;  4Y4R A;  3GCM A;  3RYP A;  5CVI A;  1OCZ H;  2YUS A;  3GVA A;  4IHW A;  3EUH C;  1D1A A;  2RDP A;  5GTH C;  1XB4 A;  5E3N A;  2Z5U A;  3FXQ A;  3MZ8 A;  1ODD A;  1MBG A;  1FYM A;  1S7E A;  4HX8 A;  2X6Y A;  1XDS A;  1JUP A;  4JX4 A;  4BDZ A;  2MW8 A;  3MEX A;  3BCB A;  2MLK A;  2HXO A;  2CO5 A;  1S6L A;  4D5F A;  2VJ5 A;  3RZD J;  3V7C A;  2OV7 A;  4XLF A;  3LOC A;  1FTT A;  1BW6 A;  2HQN A;  3I64 A;  2X1E A;  1KU9 A;  2X1D A;  1R5G A;  2E7W A;  2W85 A;  4XLH A;  2O3F A;  5F0F A;  2ZCW A;  2XSJ C;  1WQ2 A;  2P5V A;  3KX2 A;  2KDZ A;  4B1R A;  3G1O A;  2OCE A;  4E7I A;  4CIC A;  4CGZ A;  3ZQC A;  3CDH A;  3ZMV A;  1OPC A;  2EV6 A;  1RZ4 A;  2KIU A;  3QP6 A;  2NYX A;  4RAF A;  2KPM A;  5F64 A;  3J7Y J;  3WU2 C;  4E70 A;  3OYA A;  1FX7 A;  4Y7N J;  3I9V 2;  2NXN B;  3LSM A;  2AXT C;  4HV5 A;  4BAC A;  2C6Y A;  1ACI A;  4IRH A;  3FX3 A;  1R1U A;  1P4A A;  2DMQ A;  1RR7 A;  1IUF A;  2DOA A;  5IP7 J;  4HF2 A;  3OL3 A;  1A5J A;  5KAF C;  2Q2E B;  4Q5S F;  4UUV A;  2ZSI B;  4BUP A;  3GTO J;  1E17 A;  1BR1 A;  1YIJ I;  2QVO A;  3KP7 A;  3S2D J;  4AWX B;  3CJR B;  5AON A;  4KJZ A;  1S29 A;  2L7M P;  3HJE A;  4CZZ A;  1H0M A;  2WAQ N;  3E5U A;  3A01 B;  1PP7 U;  4ITV A;  1BC8 C;  2BEO A;  2KDO A;  2Z2S B;  2PN6 A;  5JVG F;  3QU6 A;  4IHS A;  4A3L J;  1BN5 A;  1B8I B;  3G1L A;  4XM3 A;  3DEU A;  3Q0U A;  3CTA A;  3VSL A;  3OYH A;  3MFK A;  5FKN A;  2V6E A;  4IKF A;  2MGQ A;  2XKO A;  3TQN A;  3IWZ A;  4CYD A;  2V7F A;  3I55 I;  1IRZ A;  3OYB A;  1L3L A;  4BKX A;  1DU6 A;  3RCO A;  1B9M A;  1MZB A;  2E7X A;  3IKT A;  2YX7 A;  1FSE A;  1AHD P;  1FT9 A;  1D8K A;  3KYL A;  1TWA J;  3CME I;  5CVR A;  3K70 D;  2ISZ A;  3HOZ J;  1OIS A;  3OS2 A;  1IXR C;  1WJF A;  2R5Y A;  1VF9 A;  5DCM A;  5CVU A;  5FFX A;  1GXQ A;  3IAS 2;  3AG2 H;  3X2Q H;  2HPI A;  4HQM A;  3CF2 A;  2E36 A;  2JJ7 A;  2R7Z J;  3E5Q A;  4XQF A;  5D4S A;  3A0H C;  4ENJ A;  3LA7 A;  1BJA A;  1X1P A;  4FE4 A;  2NS7 A;  1WWX A;  3CJN A;  3IKV A;  3JSO A;  3G71 I;  1O4X A;  1W5S A;  5FGM A;  4EM1 A;  4LD5 A;  3WG9 A;  2EZL A;  3EUA A;  3ZGK A;  3Q0V A;  2DMN A;  4B3X A;  3BJA A;  1USS A;  2LMD A;  3C18 A;  4IOC F;  3BJ6 A;  2ELH A;  1Z9C A;  3F22 A;  2DPD A;  1EA3 A;  2L3D A;  3KIO A;  4XKB A;  1SD4 A;  5K7H A;  3P7N A;  2PMZ N;  5D5V B;  4U7D A;  1T38 A;  2L54 A;  2DMU A;  4RLQ A;  4BGD A;  3IRR A;  4A0Z A;  2LKX A;  4I99 C;  3H0G J;  1UCR A;  1ZGJ A;  1RC9 A;  4IHX A;  2DW4 A;  1G3W A;  5FO5 A;  2RNJ A;  4YFK F;  1BR4 A;  2YU9 J;  2Y0S N;  2KIM A;  3TOA A;  1REP C;  4A3M J;  2GA1 A;  2DQR A;  1FYK A;  1MH4 A;  1QZY A;  2UV1 A;  5GAG J;  4AIJ A;  1J5Y A;  5ICG A;  3KPH A;  3DTK A;  1JHF A;  3PFY A;  1N75 A;  2EIN H;  4AIH A;  4KT5 C;  3LQQ A;  4L9T A;  5JHF A;  3L7W A;  3ECH A;  1B9N A;  3MVP A;  2WY8 Q;  4IO9 F;  1QA6 A;  3GWZ A;  1SFX A;  3ML6 A;  2L0K A;  2CV1 A;  1J2X A;  1MJA A;  3FF5 A;  4XMY A;  2QQA A;  1AA7 A;  1KZH A;  2M34 A;  5E1W A;  1SVM A;  2Y30 A;  4UUT A;  3DWL E;  1AOY A;  4MGR A;  3CO7 C;  3M8F A;  2R5Z B;  1ZGW A;  4OIN F;  2JZY A;  4Y13 A;  1H8A C;  3OYI A;  1RKW A;  1H9G A;  3H5N A;  1Z67 A;  2Q1Z B;  3M1C A;  2Y9Z A;  3FWE A;  4ZH4 F;  1SC7 A;  2M0C A;  2FML A;  5KHD A;  5LHH A;  3BTI A;  3OYK A;  1HOM A;  4BE0 A;  1LPQ A;  5DV5 A;  2FD5 A;  3LWF A;  4DIQ A;  1SAU A;  2FBK A;  2H8W A;  3DU6 A;  1X1B A;  1RKT A;  1IG7 A;  3JRE A;  2QSH X;  3LSI A;  1G3Y A;  2K9Q A;  2EIK H;  3SXY A;  3VYT B;  1SAX A;  1AKH B;  4BAY A;  4CCM A;  1W4M A;  4E6K G;  1A35 A;  2IP2 A;  1Y0U A;  1JKP C;  3CMY A;  4L9V A;  5L3C A;  3M8E A;  5E20 A;  3U9G A;  2VBZ A;  3S93 A;  4MQ9 F;  2JMW A;  4DBR A;  5IYD J;  3L9F A;  4RM3 A;  4ZDL A;  2A5Y B;  1IN5 A;  3DLL F;  4Y17 A;  1DQU A;  3K4C A;  2EBI A;  5F0C A;  4LK1 F;  4C2U A;  3OYL A;  2GM4 A;  4PJ0 C;  4RGU A;  1MDM B;  3I59 B;  4C2M J;  5DUI A;  1IV6 A;  4DZP A;  1XN7 A;  5FD6 A;  4A6D A;  2LYC A;  2EFW A;  4RS8 A;  3DKY A;  2M87 A;  4OIP F;  1BI0 A;  2VT3 A;  3WG7 H;  1K4S A;  3LSR A;  2DK5 A;  5IY5 H;  2M8G X;  4XKC A;  2HZT A;  1FYL A;  2GIV A;  4Y52 J;  1BC7 C;  2EJR A;  2UXX A;  2R7R A;  4BE1 A;  1F1Z A;  3HKZ A;  3LA3 A;  1NK3 P;  2VAS A;  3OWT A;  1T08 B;  2BGC A;  3U1D A;  4AU7 A;  3ZMS A;  2DN0 A;  5C4J J;  3K4K A;  1LJ9 A;  3JW4 A;  3PNV A;  2FA5 A;  2CUZ A;  1VQM I;  3BZ6 A;  1I5Z A;  2ID3 A;  2BHZ A;  2R7V A;  2CV0 A;  2DMP A;  3E7L A;  1YG2 A;  2QKL B;  1CQT A;  2VC0 A;  1XGS A;  3KCC A;  3E6B A;  2R0Q C;  3GTQ J;  1BJZ A;  3VPR A;  1WH5 A;  1TWF J;  4ZYD A;  2QUF A;  3S14 J;  1D0Z A;  4C30 A;  2DOF A;  4G7Z F;  4OIQ F;  4Z2Y A;  1DP7 P;  2CSO A;  3MZY A;  5K7F A;  1QQI A;  3L09 A;  2PMU A;  1YW9 A;  4EM0 B;  3D1N I;  2CMP A;  4DYC A;  2Q2E A;  1T0F A;  1NG7 A;  2DPU A;  2V9K A;  1IW7 F;  1XDU A;  4L18 B;  5M5Y J;  3WTU C;  5F1J A;  2MYS A;  2A3S A;  3MWM A;  4WXC A;  4KN4 X;  3A01 A;  2JA8 J;  2W25 A;  3EUH A;  4CCN A;  4JOM A;  2FNP A;  3CCM I;  1B8I A;  1GHC A;  3DLA A;  1YJN I;  2LG4 A;  3DCF A;  3FMS A;  3ZMT A;  1K79 A;  2GAU A;  2R3S A;  2WY7 Q;  1T8I A;  2BE5 F;  4O5V A;  3W2A A;  4C3J J;  2RVC A;  2DLL A;  3OIO A;  4AYB A;  1OCO H;  2ICW G;  2ZNZ A;  4G6Q A;  2A68 F;  1I3A A;  1LFP A;  1XGO A;  3GEZ A;  4A2U A;  3QOP A;  1I6H J;  3A03 A;  1W7P B;  2D1V A;  3R0J A;  4QIW N;  2NNY A;  3CCY A;  3ISP A;  5LGT A;  1F9N A;  1OFC X;  3HOY J;  3F21 A;  1XSD A;  1XGM A;  3GTP J;  1WHU A;  2IVM A;  2K86 A;  2KRH A;  3J7Z I;  3ZQL A;  2A07 F;  1T6S A;  3CDI A;  1JUS A;  4MIM A;  4M73 A;  4U87 A;  5LHI A;  4NHJ A;  1OYY A;  1MIJ A;  4A0X A;  2HQR A;  3KYD B;  2Y31 A;  2IA0 A;  2R7U A;  4MHG A;  3K2A A;  3HM5 A;  3ABK H;  3WTV C;  3S16 J;  2FOW A;  3DBR B;  1X4P A;  5LGU A;  2M45 A;  3F8N A;  2IRF G;  1P2F A;  4OMY A;  2DA5 A;  4F91 B;  1B59 A;  1IXC A;  4PSW A;  1QHH D;  3H5A A;  3JRB A;  1LQ1 A;  1YRN B;  3BQZ A;  1WI3 A;  4J01 A;  4IRI A;  1JE8 A;  4FIS A;  1X3Z B;  4EJW A;  3HOX J;  1J9I A;  4EJO A;  2QLZ A;  3CZ6 A;  1ZG1 A;  4A5M A;  4BDY A;  2DA4 A;  2ZO4 A;  2V1X A;  3JTG A;  3WU0 A;  2VPL A;  1BM9 A;  4G9Y A;  4CCL A;  5TIS C;  4GXO A;  2XAH A;  5D6F A;  4CH7 A;  3CQZ J;  4UNO A;  3EUK L;  4HZF A;  3ZOB A;  1SFK A;  2Y69 H;  3E3V A;  1Q1V A;  1ZKG A;  4ASN A;  1BI1 A;  5LLQ A;  2K9L A;  2M8E A;  4RB2 C;  5HDK A;  3MKY B;  1DPU A;  4BNC A;  3G4S I;  4LGW A;  2GXB A;  1F5T A;  4O6J A;  4G94 A;  2M9H A;  1YIO A;  4PDK A;  2WAE A;  1MND A;  5FFZ A;  3GZ5 A;  1FP2 A;  2A69 F;  1YLF A;  4S0H B;  4EJU A;  5J4Y A;  5HLT A;  1FY7 A;  2RQQ A;  4WK8 F;  2R7X A;  1QPI A;  2H94 A;  2R5Z A;  3W6K B;  4BJT A;  3KP4 A;  3S2W A;  2L5Q A;  4C2T A;  1K6O A;  2XAG A;  1O3T A;  5J1Y A;  1RPW A;  1KON A;  3QYF A;  3S8P A;  5LRR A;  3DQV C;  3S2H J;  1ETO A;  2DO7 A;  2O7O A;  3OSG A;  1K83 J;  2BV6 A;  1JJ6 C;  2R7F A;  2DA6 A;  1R7J A;  2EK5 A;  2RKH A;  5J1U A;  3VYS B;  1U2W A;  2IXS A;  1KYZ A;  2HKO A;  4MEX F;  1XMA A;  2LKS A;  2O5R A;  1Y1V J;  1I50 J;  1R49 A;  2K9S A;  3KET A;  1ETV A;  4KIB A;  1DGW Y;  2H27 A;  3C7J A;  3W6V A;  2GZW A;  2EV5 A;  2GXG A;  4EVI A;  1IGN A;  4YEL A;  3RDI A;  5IYC J;  3PIO F;  2XUB A;  5LBQ A;  1AKH A;  4KIS A;  3EDP A;  1V4R A;  4L5I A;  5K5O A;  3WTS C;  3F6O A;  3LFK A;  3SZT A;  2DI3 A;  3WOD F;  4F3Q A;  5BQT A;  2JQ7 A;  3O8H A;  3F8M A;  4YIF A;  1Z77 A;  5E3L A;  1Y56 A;  2XAF A;  3AG4 H;  1V5F A;  3PSI A;  3LFU A;  2XKP A;  2V26 A;  2CUF A;  3KLO A;  3S1N J;  1KQ0 A;  1ULY A;  4EGZ A;  4A3K J;  3FXO A;  2NRA C;  4NC6 A;  2X51 A;  1PUE E;  1YS6 A;  2K4J A;  2WC2 A;  2K7L A;  4JQF A;  4HW0 A;  2PX9 A;  3ZQF A;  2BOL A;  1KGS A;  1O57 A;  4M72 A;  4AIK A;  5K5Q A;  2LF8 A;  1T95 A;  2OAZ A;  3TO6 A;  1MJB A;  2W4S A;  1MDM A;  3I59 A;  2QBY B;  4RGR A;  1MBJ A;  2MAB A;  5L3G A;  4OAY A;  4ENM A;  2DT7 B;  3CUQ C;  3ZR8 X;  1M1E B;  1QZZ A;  1FMV A;  3G2B A;  3TED A;  3HTS B;  5M5W J;  5GPC A;  3ZMD A;  1Z3Y A;  2K9N A;  3HTU A;  4ZTF A;  1WJC A;  2XAS A;  2ZXI A;  1LUJ B;  2UWM A;  3M1E A;  5E8G A;  1ZYR F;  2XPW A;  3K4J A;  3KFW X;  2GXA A;  1XTA A;  3GF2 A;  3W2W A;  3HRM A;  5LHG A;  1VQN I;  4MO7 A;  4F7Z A;  3D0S A;  4EJT A;  1X2M A;  1XSX A;  2VJI A;  4R8H A;  5EF6 A;  4EV0 A;  5ED4 A;  3R6S A;  1JI8 A;  3CCV I;  3RKX A;  1ZQ3 P;  2KKO A;  4XLN F;  4F93 B;  4P55 A;  5B3S H;  4WWC A;  3GLL A;  2CW7 A;  1JGG A;  2AXL A;  2XAQ A;  2P5L C;  2H1L A;  3GTG J;  4P5O A;  3HRU A;  2JPB A;  2KJC A;  4GYI A;  2LBF B;  2KJB A;  3PNT A;  1QGP A;  2GQQ A;  2ZME C;  2STW A;  1ETY A;  3ABL H;  3DTE A;  4QTR A;  2HZD A;  2VON A;  1G2H A;  2JUG A;  4BU2 A;  2DDB A;  1YW8 A;  2L9S A;  4NUB A;  1U5T C;  2CQK A;  2F5V A;  3JAM K;  1I39 A;  3EET A;  3T8R A;  3CDL A;  3WTW C;  3ZXS A;  2DA2 A;  2O03 A;  3PJR A;  3HGG A;  3PO3 J;  4LG0 B;  3RPU A;  2HDD A;  5D5U B;  1XD7 A;  1MKM A;  4HDV A;  1VZ0 A;  1GUU A;  1I3Q J;  3QU3 A;  4BQO A;  4CCK A;  1Y39 A;  1JKO C;  3ZRG A;  4IPA A;  2WV1 A;  4A3I J;  1NK2 P;  1ORK A;  3CUQ B;  3SFZ A;  5EG0 B;  2D45 A;  2PMZ A;  1NHA A;  2VKE A;  4WXH A;  2AQF A;  2AO9 A;  3C1D A;  2QWW A;  5IT9 K;  1E2X A;  5DDG A;  5EDN A;  2DMT A;  2ESN A;  1DUX C;  1FPQ A;  3F3X A;  3A1Y A;  1WCM J;  3MKL A;  4CCO A;  1QVT A;  4YII A;  2EV0 A;  1Y8R B;  4CXF A;  2CQQ A;  4UY8 I;  2Y0S A;  2VT2 A;  3QQA A;  4QSH A;  2HPM A;  3NQO A;  4UHT A;  3LMM A;  1BOA A;  1MH3 A;  2EIJ H;  2GOM A;  2XIG A;  3PQJ A;  4Q47 A;  3BPX A;  4NDL A;  5AIP A;  3K1M A;  2JUC A;  3A2K A;  2VE9 A;  3T8T A;  4GYG A;  2X6X A;  3GME A;  2LOO A;  5DTD A;  1VQK I;  2FOK A;  3V42 A;  5BMZ A;  2D2W A;  2W57 A;  4XBF A;  1VQ6 I;  1HF0 A;  3G73 A;  3F9K A;  4HBL A;  1B72 A;  4CDG A;  1Z7U A;  2DXI A;  4GCV A;  4II3 A;  3PNY A;  1LEB A;  1YX5 A;  2ZME B;  4EEF G;  3ASN H;  1H9T A;  2BXZ A;  1YRN A;  4QPQ A;  3I4M J;  5BPD A;  1JT6 A;  1S7A A;  1U5T B;  5DM6 F;  3FK6 A;  4F52 A;  1JT0 A;  3HPG A;  4HRI A;  2KP6 A;  3K1P A;  3J81 K;  3FKJ A;  5FKL A;  2F4O B;  4FTH A;  3MAJ A;  2O61 A;  4BYY A;  1RRJ A;  5HOO A;  2HEO A;  2XRN A;  2AHQ A;  3Q9V A;  4M6Y A;  5J8C A;  3HSF A;  3KP5 A;  5ICF A;  4CUG A;  4A3J J;  1UZC A;  2VI6 A;  3HUG B;  3COA C;  4ENK A;  4L0Z B;  1K4T A;  4E4H A;  4MTD A;  1Q1H A;  2X48 A;  1U78 A;  1X1C A;  1LVK A;  3HSR A;  2MLG A;  5FKK A;  3RJP A;  1PVE A;  3QPL A;  1ERD A;  2X0L A;  1Y6I A;  4DNC A;  5DYM A;  2CFX A;  4HQE A;  2OA4 A;  3GFJ A;  1WJD A;  3S1M J;  5CQG A;  5CJ9 A;  2BY1 A;  4N9H A;  2M4K A;  1HKT A;  2VQC A;  1ZGA A;  2NNN A;  5B66 C;  1IV8 A;  3TL4 X;  1NG6 A;  2ZC2 A;  3OYF A;  2VOO A;  2QSG X;  3HOW J;  3H3Z A;  4AUX A;  4CCJ A;  4U0W A;  1T56 A;  2V6C A;  3DEE A;  4BXX J;  4R79 A;  3U21 A;  3N05 A;  3E1S A;  3HL2 A;  2CQ7 A;  3FXR A;  4I01 A;  3BJO A;  4A3B J;  1MBH A;  2OQG A;  1FBS A;  2RN7 A;  1Y0N A;  2G7H A;  4BE2 A;  5BOX A;  3ESW B;  3BR1 A;  4B3A A;  1K6Y A;  4HNV A;  3RIR A;  1EH6 A;  2VKV A;  4XR6 A;  1GVD A;  5ILS A;  3K0L A;  1S3J A;  1RIO H;  2GIZ A;  4BHC A;  2G9W A;  1P9Q C;  4JX5 A;  3GTJ J;  2WB1 A;  3R4K A;  2E1N A;  2I10 A;  4I6Z A;  2TRT A;  2RV8 A;  2M4G A;  4M74 A;  2XGE A;  4PGG A;  1P6R A;  2XGC A;  4BHB A;  4RB1 A;  2VOP A;  1ZHF A;  1OYI A;  1XMK A;  2CW8 A;  4IXA A;  3WHC A;  2HNH A;  4HV6 A;  4DYQ A;  4B09 A;  3L2W A;  3D5L A;  2B7E A;  2LLK A;  4KMU X;  3T1B A;  2BHY A;  5J47 A;  1S8N A;  2FMY A;  5L3E A;  1TP4 A;  4M3B A;  3DV8 A;  1TW3 A;  3CC7 I;  1I6X A;  1S7O A;  3SDB A;  1Z7L A;  2VXD A;  3HIF A;  3ELK A;  1F4K A;  2PJP A;  2V9V A;  1YHQ I;  1IC8 A;  1OCT C;  4XK4 A;  4YRV A;  2QBY A;  1POG A;  4E7S A;  3DKW A;  2QQB A;  2XRL A;  5E3O A;  3H1C A;  3OMY A;  5EZG A;  4A3E J;  4BXU A;  2NVT J;  1KU7 A;  2Z3Y A;  1TQI A;  1GXP A;  2IS4 A;  3GFL A;  2LTP A;  4XON A;  5F0H A;  2JTV A;  2KFD A;  1ZRF A;  1VQ7 I;  2LY2 A;  1BIB A;  9ANT A;  3MMY B;  2OZU A;  1VQO I;  3W2V A;  3LQR A;  2YR2 A;  1GLN A;  2W82 A;  3M9A A;  1ZG3 A;  4KUM A;  1KQ8 A;  4U0Y A;  1D1C A;  3PQK A;  1Z6R A;  2QEN A;  3M8J A;  3ZQH A;  1OMI A;  4ZZD A;  2XB5 A;  2VE8 A;  4DJA A;  2MD0 A;  2VQH A;  2DOE A;  2P7V B;  5J6X A;  3QYE A;  3JRD A;  3Q5F A;  5KVR A;  3EQL F;  5GPA A;  2XAU A;  1R1V A;  1Z91 A;  2LDU A;  4XLE A;  1HA8 A;  1ENH A;  1IN6 A;  2MA3 A;  4MFD A;  3CMM A;  4RA2 A;  3MD2 A;  2HVR A;  1F43 A;  2NAZ A;  4D7N A;  2EZK A;  2LBF A;  3QP5 A;  4FAS D;  3L2U A;  2FJ1 A;  3F8C A;  2P6S A;  4QLC U;  4RAY A;  4XL9 A;  1ETQ A;  5IPA A;  5JVT A;  3FXM A;  3FXL A;  3LSJ A;  3RSN A;  4OMZ A;  2ELJ A;  3H92 A;  1I1G A;  3MQ0 A;  3FZV A;  2V1N A;  4P9U A;  1XPX A;  1SEU A;  2IS2 A;  2QA4 I;  2FE3 A;  5J40 A;  4BHP A;  3SQN A;  4BBR J;  2GBY A;  3LST A;  2RNG A;  3ZQQ A;  4LG0 A;  1SFE A;  4L9N A;  1YX3 A;  1SD5 A;  2JT1 A;  3TKY A;  5GAD J;  2PMH A;  2DBB A;  2NS0 A;  3DU5 A;  4FQG A;  4LIT A;  4U0V A;  3S1R J;  4UUS B;  3BR6 A;  4I02 A;  1H89 C;  4B48 A;  1W36 C;  5F1R A;  2LY9 A;  3CUQ A;  4TV7 A;  5EG0 A;  1J7K A;  3TO9 A;  5DS9 A;  2QQ9 A;  3CJT B;  3HOV J;  5H6Q A;  2DA1 A;  2DA3 A;  2MH2 A;  1U8R A;  2M7A A;  5EGO B; 
#chains in the Genus database with same CATH homology
 2NXN B;  1VQK I;  1ACI A;  1YJ9 I;  1FOX A;  1VQM I;  1VQ6 I;  4IO9 F;  3CC4 I;  3CCS I;  1QA6 A;  4IOA F;  1VQ5 I;  2ZJQ F;  2QEX I;  1VQP I;  1YIJ I;  1MMS A;  3CC7 I;  1YJW I;  1YHQ I;  1VQN I;  5DM6 F;  5JVG F;  3CCE I;  3G4S I;  3CCV I;  1VQ7 I;  3I55 I;  4V19 K;  1VQO I;  1S72 I;  1VQL I;  3CMA I;  3PIP F;  2H8W A;  1VQ4 I;  3CCM I;  3CME I;  1VQ9 I;  1YJN I;  2ZJR F;  2E35 A;  3G6E I;  2ZJP F;  2E36 A;  3CD6 I;  3CCR I;  2K3F A;  5DM7 F;  3CCQ I;  3PIO F;  1Y39 A;  3G71 I;  3CCU I;  3DLL F;  2JQ7 A;  1YIT I;  3CF5 F;  2QA4 I;  3CC2 I;  3J7Z I;  4IOC F;  5GAE J;  3CCL I;  1HC8 A;  3CCJ I;  3I56 I;  2OTJ I;  5GAD J;  1FOY A;  4UY8 I;  2E34 A;  2FOW A;  2OTL I;  1VQ8 I;  3J7Y J;  3CJT B;  1FOW A;  1YI2 I;  5GAG J;  5GAH J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...