1VQOI

The structure of ccpmn bound to the large ribosomal subunit haloarcula marismortui
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
70
structure length
70
Chain Sequence
b'GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 17
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 1vqoI00
3CMEI 3CC7I 1VQPI 4V19K 5GAEJ 1VQ7I 3CCMI 3PIPF 2H8WA 2QA4I 1YJWI 1QA6A 1YI2I 3G71I 1VQ5I 4IOAF 2NXNB 3CCJI 5GADJ 3CCVI 3CCUI 1Y39A 3CC4I 1HC8A 2E35A 2E34A 3CCSI 5GAHJ 2ZJRF 3CCLI 4IO9F 2FOWA 3DLLF 3CCRI 3J7YJ 1YIJI 1YITI 3CMAI 1ACIA 1VQNI 5DM7F 3CJTB 1YJNI 1MMSA 1S72I 5DM6F 1YJ9I 2E36A 3I56I 1FOWA 1FOYA 1VQOI 2OTLI 1VQ4I 1YHQI 1VQLI 3CCEI 2QEXI 3CF5F 1VQ9I 3CCQI 1VQMI 2JQ7A 3CC2I 5JVGF 5GAGJ 3I55I 3CD6I 3PIOF 1VQKI 4UY8I 3G6EI 2OTJI 2ZJQF 1VQ8I 2ZJPF 3J7ZI 1VQ6I 4IOCF 3G4SI 1FOXA 2K3FA
chains in the Genus database with same CATH superfamily
3ASOH 1VQPI 1JHHA 5DDGA 1R4NB 1RC9A 3M8FA 3QRFF 2XAFA 3ZMSA 2P7CB 2WWYA 3ZQIA 5IYCJ 3F8CA 4UVCA 5LGTA 1ON2A 5BPIA 3KP4A 4LG0A 4W1UA 3VB2A 2BV6A 3OY9A 4I01A 3WODF 1UG2A 3W6VA 3R4KA 3BR2A 2DDBA 5GADJ 4ZYEA 2QSHX 3ABKH 3ZQGA 5HDGA 1YS7A 2LF8A 3QODA 3VYRB 4A0YA 2OF7A 2EZIA 3PFIA 1J9IA 2A68F 3MKYB 3RPUA 3CCSI 4RB3C 2ZO4A 3K4MA 2RQPA 5GAHJ 3K7AJ 2GBYA 3FMRA 4U7BA 4DBQA 4A3LJ 3G1LA 1QPMA 1S5LC 3FXQA 1R49A 3V8LA 2P0WA 1FTTA 4IQ4A 3RPQA 1V4RA 2R7QA 2ZMEA 3OMYA 1ON1A 1WVRA 2XGCA 1BI0A 3I3LA 4OIRF 5FRMA 1ETOA 2M0CA 4I76A 2QYOA 1X1BA 3H3UA 2TCTA 3I56I 2IPQX 4HG2A 3SEQA 3COAC 1F1ZA 3WG7H 5FLXZ 3GZNB 1USTA 3EDPA 3OYEA 2D2WA 2DBBA 3ULQB 1VQMI 3IHUA 3LA3A 5AIPA 3I55I 3F21A 1QNTA 3DPUA 2LK2A 2XHKA 2V9PA 4YIIA 3ABLH 4QPQA 5GPAA 2O61A 1W7PA 1ZG3A 3GO5A 5B5EC 2CV2A 4CHUA 2PJPA 1WJDA 1PUEE 3BZCA 1AOYA 1SMTA 2ADUA 2YUSA 5FGMA 1A6IA 2FXAA 3K69A 2BGCA 1U9OA 4FTHA 2VJ4A 3S1MJ 4XR6A 3ERED 4KIFA 1U2WA 4AUXA 1ETXA 4R79A 3A01A 1D0XA 3F6VA 1T0FA 1IZ1A 1MBGA 2JVHA 5F27A 4ENMA 3LSTA 2R0QC 2GAUA 2WAQA 2LKXA 3HZJA 2KL4A 4IRGA 4BJ5C 5A2QK 1MIJA 4RM3A 5IOYA 3JCUC 4M3EA 3CMEI 1POGA 5KK1A 3HB9A 1QZZA 2HKOA 2CFOA 3RCOA 1T38A 2QLZA 5EYRA 2YU3A 3FXJA 1Z91A 2HZTA 1IC8A 2R5ZA 1TTYA 3BJOA 1JE8A 1KYWA 4LJZF 3J81Z 1YJWI 1UAAA 4P55A 5IOZA 2HZDA 1U5TC 1GV5A 1CQTA 1RKWA 2XAUA 2CUZA 1NG7A 1ZGWA 3OYGA 4II2A 3KZZA 2DQRA 4E4HA 2Z5UA 3EYYA 4F52A 3MZHA 1RR7A 3HSFA 3ZQQA 1G8XA 1J0RA 2IEKA 2LP0A 1XCBA 2Q2EB 3OL3A 2KPMA 2R7XA 4XORA 4IQJA 1H0MA 1WQ2A 3DCFA 2CW7A 2W00A 2NYXA 2CW0F 4GO1A 4M3DA 4EEFG 2XKOA 4XKVA 3FXKA 3B73A 1FYMA 5KVRA 1S7EA 3C3WA 3M07A 2K40A 3CMAI 2BE5F 2HWVA 3ASNH 4BQAA 5DM7F 3ZPLA 3OYHA 4XNFA 4NDLA 2FBKA 1DPUA 1WI3A 3MEXA 2VE8A 4JQFA 3WE2A 2B9SA 1O3TA 1RZ4A 1BC8C 3QWLA 4C2MJ 3K9TA 3FXMA 4HF1A 2ELKA 2V1NA 3GFIA 2PQ8A 3H9QA 3KYCB 3KX2A 4ESBA 3KP6A 1D0ZA 2BVMA 3REOA 4LG0B 1GT0C 1NG6A 1BBYA 1JXSA 1BL0A 2JRMA 1P6RA 2DFFA 2VI6A 3ZN0A 2R7UA 2QQBA 5GAGJ 2R92J 1ZELA 2DT6A 3OL4A 2ME0A 2W82A 2W24A 3OYFA 3I59A 3JRCA 3QQAA 4NBQA 2I8DA 3HKZN 4PGHA 3CUQA 3VYSB 5EF6A 4CCKA 2F5CA 4BE1A 2ZBKA 2BY1A 2ICWG 3H0GJ 1T8IA 4XQFA 1MMAA 4I2OA 3L2CA 2ZMEB 3K70C 2CH0A 1G2HA 3PSFA 1R5HA 2EILH 1OCRH 2DA7A 1BI3A 1HSJA 1H9GA 2VKDA 4O5VA 3V8JA 1NHAA 3OYDA 4LITA 4WCGA 2M4KA 3S15J 3VYTB 2DODA 2F5EA 2LBFA 2JRTA 3ONQA 3FHZA 2GIZA 3ESWB 1TWGJ 3N97A 2RN7A 3JRBA 1F5TA 3K70D 1XD7A 5FB2A 3TO7A 1BJAA 2CQNA 4G6DA 4AVZA 2OQRA 4P1WA 1P9QC 3J80Z 1QO0D 3G71I 4P5OA 2D1HA 5E8IA 5C3EJ 1MBFA 1WH5A 3CCJI 3IP4B 1MSFC 2MBFA 2KIFA 1XDSA 3KE2A 1XSDA 3CCUI 2DMPA 4B09A 1W7PB 4BH9A 2PLYA 3HUGA 4WF2A 3LSIA 5DUKA 2OC6A 2MYSA 1RRJA 2M87A 1FWZA 2FSWA 2DMUA 2HTJA 1KQ9A 3A01B 1X4PA 2PG4A 3JW4A 2L54A 2HFHA 2VQCA 1C0WA 2L5QA 4MQ9F 3HPGA 1TBXA 2ZB9A 4XRSA 4QTRA 2PJRA 1GV2A 3S8PA 2X4HA 1SAXA 5FKMA 2H8RA 1I1SA 2W4SA 1KONA 4DYQA 2JN6A 2R5ZB 1BI2A 4UUTA 5HOOA 3CESA 3CCYA 3BG9A 3LQQA 1HQCA 3LSGA 2L7FP 3JRIA 5CYVA 1XG1A 3L9FA 4AU7A 2JQ7A 1WWXA 2W1OA 2FNAA 2JA8J 3OV8A 4E7ZA 4M9SA 5D4SA 3FXLA 4BKXA 2M45A 2DMTA 2A69F 3BCBA 4N0BA 3SZPA 4LIUA 3X2QH 4UUSA 1AU7A 4RAZA 4NNJA 1N77A 3S2HJ 3TW6A 4U0YA 3H5AA 3G1MA 4EM0B 1VQ8I 2X9DA 1LFUP 2DAOA 2GWRA 3DBHB 3RQ4A 5FLMJ 3HXLA 1D3YA 2VONA 3RYPA 4A6DA 1YW8A 2CUEA 2XAHA 2KZVA 2ZXJA 4UHTA 5M5XJ 1B72A 1U6GA 2LH9A 4HX4A 4BXXJ 2VB6A 1V3FA 2KT0A 3FX3A 2H09A 1W36D 4PK4A 1H9TA 4EMSA 1FBUA 4V19K 4IHYA 4O3MA 4BNCA 3ABMH 3HGYA 2DU9A 5J47A 1OISA 3FKJA 3FIWA 1ORKA 1KU7A 1T95A 3RQIA 1RR8C 1SEUA 2VBWA 4GCVA 1BJZA 3DF8A 5L3DA 5IT3A 1YI2I 2FNPA 5FKLA 4MTDA 3K2AA 4CCNA 3GTLJ 1W1WE 1CGPA 2KHMA 5C44J 4BL0B 2NNNA 2PBIA 4LLGF 2VL8A 4YEJA 2LRDA 3P9KA 3I59B 3KFWX 2YPRA 3WGGA 1GXQA 4BHPA 1V5GA 1OQYA 1ITYA 5M5YJ 1TP4A 4L18B 3CUQB 1IN4A 4RMNA 5HLGA 4A3EJ 1NTCA 4A3GJ 1MH4A 4M3BA 3PJRA 3PUFA 1A6QA 2HYFA 2QGUA 2BXYA 5FKOA 3GZ5A 1SFEA 4A3DJ 1U9NA 1A36A 2B0LA 3GWZA 3ZRGA 5K7HA 3GLLA 3BPVA 5B3SH 1K4TA 4JYKA 2EIKH 1WH7A 1XGOA 3NRVA 4W97A 2YX7A 2MD0A 2EFWA 2X6YA 3ELKA 1KU2A 2E71A 1LB2A 2P4WA 5D5UB 4G6TB 2OUMA 2EFNA 3HM5A 1QPIA 3HIFA 3IH3A 2LBFB 3RKYA 1Y8QB 2KLOA 2O6GE 1GVJA 2YX4A 5E1XA 3B6CA 2K27A 2R7DA 4JK1X 4C3JJ 4HSTA 1Y56A 3TMOA 4U7DA 4BBRJ 5FROA 3IUOA 2KQRA 2I10A 3M9AA 4EQQA 3GTKJ 1BW5A 1PP7U 2WB1A 2XGXA 4CCMA 4IRIA 1BC7C 2F6CA 4ETSA 3FF5A 2YSRA 2EV5A 1XMXA 2LR8A 3KEOA 1JUMA 1WJCA 1Y0NA 3CCQI 1P2FA 9ANTA 3AG2H 1FT9A 2P5VA 3D1NI 1WJEA 1PJRA 2DMQA 2JZYA 4II3A 5LHHA 2FE3A 2LSOA 3HUGB 3E3VA 1G3YA 1HKTA 1JT0A 1OCCH 4NB5A 5CVRA 2NVUB 3S3NA 1V5FA 1ZARA 3IC7A 1MJAA 2IS2A 2M1BA 4C3HJ 3V8KA 1KU9A 1QHHD 2AO9A 5KNLA 3OIPA 1SD7A 2Y69H 2K86A 4B1RA 1RKTA 3FISA 2CFXA 4L5IA 3GXOA 2H94A 2HEOA 2M5WA 2R4GA 3TQNA 1TQMA 2PJRB 3WGIA 3I4MJ 4X1EA 3WU2C 5FO5A 4HA8A 1R9TJ 5CQEA 5GAEJ 2FMYA 1QHGA 2FA5A 2RQQA 3RTRA 4PJNA 4BQQA 3S2WA 3G1OA 3KEQA 2R7ZJ 1ERDA 4ZZDA 4HRIA 3Q0UA 1SVMA 4A93J 2LKSA 1OCZH 2Z3YA 5ERIA 1AA7A 5KAIC 3OOPA 5IT9K 5E17F 2E60A 2HOSA 3H35A 1JT6A 3U2RA 4BUPA 3CCVI 4J00A 4ZTJA 4KITB 4UUSB 2DN0A 3LFKA 1KQ0A 2HNHA 5D6FA 2MA3A 2COBA 3KP5A 5LBQA 1RESA 1EH7A 1BR1A 1SC7A 3BG6A 2LD5A 4HV5A 3LFUA 4KYWA 3TDUC 2XSJC 1B72B 5BPDA 4HEA2 1JKRC 1IRGA 3HHGA 2A07F 2AQFA 2OBPA 1PP8F 2DPDA 5EZHA 2GM4A 3PO2J 2O7OA 2E1CA 2Y0SN 4B3AA 5F64A 4X6AJ 4GRIA 1BR4A 4OAZA 1A31A 1X3WB 3RIRA 1IN5A 2QEXI 3EPZA 1Z9CA 4Q4ZF 4RAGA 1I27A 1VFCA 3AL0B 5LLQA 4I02A 4HV6A 3B02A 5BOXA 4WXCA 5JR3A 2M3AA 1BI1A 3PL8A 3HOWJ 3K4BA 2FJ1A 2LG4A 2MG4A 3T1BA 4ESFA 2YU9J 3SJMA 3LSPA 5K7ZA 2PMUA 1SFXA 2XRNA 1TW3A 1O3RA 2WB1N 4G7OF 3M3YJ 2FX0A 2LREA 4LGWA 1FSEA 4FX4A 1IRXA 1WFXA 2LKPA 3I71A 1A35A 1FMVA 1TWFJ 4AM3A 1MBHA 5HLTA 4P9FA 4NQWB 1Z6RA 2W7NA 2MW8A 2R7WA 3BOQA 3L7WA 1H89C 1TC3C 1UJ8A 3S93A 3E5XA 4WX9A 3JREA 1AHDP 3KP2A 2CSOA 2VKVA 2AS5F 3DTEA 3OYBA 3QYFA 3MD2A 2R7FA 1ZK8A 3HG9A 4PJJA 2HDDA 1U5TA 5CVVA 1IV6A 2OPTA 2F4IA 1ZH5A 3WGHA 3CF2A 4I99C 2JJ7A 1UHMA 4L9JA 1B59A 5J1RA 2HVRA 3BR5A 4M3GA 3DKYA 4CH7A 1X1AA 2PI0A 2TRTA 1Z3YA 4Q48A 3GEZA 1H88C 4XSZF 1VQ5I 4Z6YA 4HNTA 3BCAA 4CYDA 4RB2C 4J01A 3EUHA 1N75A 4PUSA 4D7MA 3HOXJ 1B6AA 4XOTA 5D4RA 5ILSA 3ZXSA 2LC2A 3HYIA 1J5YA 4N4OB 1Y0UA 2PMZA 1S8NA 3BY6A 5CJ9A 5E20A 4BE0A 3TO6A 1L3LA 1WRJA 4ENJA 2KP6A 1ZREA 2XUBA 3E6DA 2FOWA 3TL4X 1STZA 3SYTA 1FIAA 2NOJB 1MNDA 3UKGA 2VOOA 4MEXF 3H1CA 4G94A 1KU3A 2GZWA 4KMFA 2K02A 4HAMA 3FM3A 2CG4A 4M73A 3LQRA 2ETHA 1OPCA 4IHXA 3ZMDA 1OYYA 2IA1A 4BU2A 1WJAA 2P5KA 3OYJA 3FBNB 4PDKA 2VN2A 2OTLI 1VQ4I 4MLOA 3ZGKA 4G7HF 3HTUA 4QSHA 2CV1A 2EQRA 1T08B 1X2NA 2WY8Q 1EJ9A 1FSHA 3L2RA 1VQ9I 2M2EA 2JA5J 1KGSA 1RUOA 2WA0A 2XV4S 2IP2A 2G0EA 2UWMA 4B43A 4DQ2A 3DLAA 1LDDA 1RETA 2L9SA 2XIGA 3ZQCA 4BE2A 2QSGX 3OIQA 1XGSA 2CQ7A 4DBRA 3FXOA 1OFCX 2MFZA 2VPRA 3W3CA 5FLXK 2W48A 1S3JA 5JLXA 3MMYB 4RGRA 4LLLA 3KLNA 4EJUA 4IHSA 1HF0A 1FZPB 2IAIA 2EIMH 5ICCA 4D5CA 2O0YA 4EATA 2VC1A 3A1YA 4BGDA 1OYIA 3GCMA 4YFXF 5FKKA 2V9VA 3WTXC 2W25A 5JI6A 3KIOA 3HGGA 2QVOA 1J59A 2BEOA 3G4SI 3GTOJ 1XC5A 2CRGA 1O57A 2IA2A 4EJWA 4OU0A 4QWQA 3DTIA 5E3LA 3BZKA 4AYBA 3QOPA 3K4CA 1SANA 1E3PA 1WI9A 3K0LA 2VPLA 3OS1A 4AIHA 1R36A 3R0JA 2P6SA 3HOTA 2PEXA 3LOCA 4XLHA 4BY7J 2MD5A 3BR3A 5GP9A 5CVJA 1P4WA 2FBIA 2VOPA 3H0DA 3WTZA 3LAJA 4IPAA 4D7NA 5ILUA 3IV5A 4MHGA 4KFCA 3HJEA 2F5VA 1Y39A 2A5YB 4N9IA 1EV7A 1FIPA 1W5TA 2E35A 2XPVA 2HPMA 2CGPA 3GUDA 2X1CA 1MH3A 2E34A 2FD5A 4PSXA 2K5CA 2XKPA 3DPLC 5F04A 2KMUA 1ODDA 3GW2A 2IJLA 4E6KG 2QZ8A 1QZEA 3ZOBA 3CJQB 3MWMA 5F0HA 1RIOH 1A5JA 3EUKL 2OA4A 3OSFA 1BN5A 2XRLA 2ZFUA 2GXBA 1S29A 3F22A 2NOGA 2J5OA 4PJMA 3BROA 4XRMA 4M9XA 2PMZN 2QKLB 2QF7A 1X58A 2CWEA 4YFKF 3RYRA 2JA2A 2Z2SB 5GPCA 5DUIA 5A2QZ 1U5TB 2JPBA 2DDAA 2FQ3A 1IXSB 2DA3A 2E36A 2DFHA 1ZLKA 2K9MA 5D8KB 3NEUA 4PFPA 2R7TA 1BM9A 4EVIA 5DCFA 2UXNA 2STWA 3BT9A 2AXLA 2M0MA 4FISA 1R1VA 2HYJA 1OMIA 4ABZA 1FMWA 1MBJA 3CTAA 2D1VA 3Q3SA 3D5LA 5GTIC 3FMQA 1I6XA 4HYEA 2YS9A 1IDYA 4MGRA 3IH4A 4LFUA 1SD4A 4RGSA 2Q1ZB 5DYMA 2VJJA 1GUUA 3PIOF 1JKPC 1KA8A 3DKWA 2GOXB 3VOEA 3L00A 1P4XA 2F5FA 2M8EA 1X3ZB 1XN7A 4QPOA 3F3XA 1T0FC 3BG5A 2CQXA 1MKMA 1D1BA 4KT6A 1XPXA 4RLFA 3BDDA 3O8HA 1LE8A 2BYVE 3CP2A 1IDZA 4D1QA 4FETA 3HRUA 1ETQA 3F23A 2G9WA 3T8TA 3E7LA 4YRVA 2IA0A 1WHUA 4Z2YA 3RKWA 3Q9SA 2LDUA 4ITVA 4IL6C 2BHYA 3WTUC 2DOFA 3CQZJ 2UXXA 4JX6A 3L2VA 2V26A 3QU6A 4DYCA 4M71A 2JK3A 1BIBA 5E18F 4XM3A 1WKMA 1OCOH 1U0JA 3FK6A 4AWXB 4Y17A 5LD2C 2X0LA 4PFOA 2JWTA 1VZ0A 1UCRA 1ZAOA 2QUFA 3MAJA 3DFGA 1MDMA 3LSKA 3KYLA 5CQGA 3OYKA 1X1CA 2JMWA 4EM1A 1TQPA 4ZDOA 1MSEC 3WG9A 2HVSA 2CJJA 1O7FA 3F8MA 1K79A 1Y8RB 4AYBN 4XOPA 5E8GA 3PQKA 1X1PA 1B4AA 5LEJA 2QM3A 2MC3A 5F0CA 1ZGJA 2IS4A 4YG2F 1IUFA 3VSLA 5D5XB 2ZJRF 2EK5A 3IRRA 3S1QJ 4IRHA 4Y4RA 3PFYA 2HU9A 1R1TA 2FOKA 4I0AA 4C3IJ 2RNGA 4IHWA 1WGXA 1FTZA 3CZ6A 2WAQN 1ETYA 3HRSA 4ZYDA 1YJNI 1IRFA 2VQLA 1UHWA 4NUBA 5ED4A 2M34A 3BTCA 3MKWB 2IVMA 3R0AA 2IS6A 1V55H 3DKXA 2ECCA 4ZH4F 4HNUA 2MH9A 3IAS2 4QIWN 2DT5A 4AIJA 2JUGA 2V6EA 1FOYA 2E1OA 5BQTA 1WCMJ 1YX5A 4DZPA 1KZHA 2DOAA 1VQLI 3SHFA 3S1NJ 1P7IA 2KDOA 3CF5F 2OAZA 4CYCA 2KIUA 1D8KA 2XPWA 3I0TA 3TOBA 5HS8A 5J4VA 1OR7C 2E2HJ 1HDDC 2A61A 4ESJA 4MQVA 1R00A 1IG7A 3F8NA 1U3EM 2PFBA 3M7GA 2XROA 5ICEA 3I54A 2ZNYA 4LMYA 3SDGA 4WXDA 1FX7A 4OMZA 3CJRB 4GYGA 4BJTA 4BXUA 5FRNA 3RI4A 1H8AC 5LGUA 3SFIA 2KRCA 1Z6TA 2FF4A 4GGGA 3TW7A 4DW6A 5KHDA 3NWSA 4L9NA 4YELA 4FE7A 1SFUA 4M9ZA 3QYBA 5JHFA 1RNLA 2QBYA 3I9V2 3BJ6A 3VSKA 2HXIA 1D8JA 2NS8A 1R71A 3OIOA 2L4AA 2DT7B 3CDIA 3L1PA 4L5JA 2EBIA 3K4JA 4UVAA 3PO3J 1LVAA 2QA4I 4F55A 2Z16A 3U9GA 4ZYAA 1WZ2A 4EJTA 3W6JB 2CV0A 1D5VA 3PUBA 1IF1A 3FBIB 1DPRA 1LJ9A 1ZGAA 3QU3A 3S32A 1QRYA 4ZDLA 4XKBA 3V7SA 4DYRA 1XMKA 2C6YA 1TT5B 2XAJA 2BW3A 3ROUA 1K83J 2X51A 1ZG5A 2ME6A 1L0OC 3DQVC 2ZSIB 4BYYA 1R5GA 2JA7J 1TWAJ 2E1MB 4UXNA 3FDYA 1LE8B 4C2UA 3CCLI 2KJCA 4DGWB 4E7JA 2IXSA 2MSYA 4RB1A 4IO9F 1P92A 1WPKA 2W84A 2X6XA 2XAGA 3S1RJ 4G9YA 3FKIJ 5FLVA 5E3MA 4XLCA 2F2EA 1ACIA 1QU3A 1IXRC 2EFPA 2L0KA 1B9MA 3AG1H 3U21A 2M9HA 4DNCA 2HQRA 2OZ6A 3CDLA 3R60A 2HVQA 2CQQA 2OCEA 4C2TA 3QYEA 2Z9OA 2KIMA 2KJBA 4HSRA 5F1JA 4A3MJ 5JVTA 4WWCA 5HS7A 1OYWA 3A0HC 2XC7A 4KA4A 2KIQA 2VODA 4IEJA 4R8HA 3CP8A 1FPQA 3LA2A 4XLNF 4BAYA 3WU0A 2LYCA 5HDKA 3CCEI 1MDMB 3ECOA 2DQLA 3NWTA 3ZN1A 1Z7UA 3RDIA 2JSCA 3ZMZA 4R1HA 2ISZA 3CC2I 2AQEA 5HVQC 1JKOC 3CLQA 3QAHA 5K1YA 3DWLE 2E5NA 4XKCA 1JGSA 3CD6I 2ZC2A 2DK5A 2DK8A 1QBJA 1OCPA 4EM2A 1B8IA 2W57A 3GTGJ 2V1UA 2BY2A 1YX3A 3M8EA 4PJ0C 5D8LB 1YRNA 1BOBA 2NRAC 5LHGA 3EQLF 4E7KA 1V54H 4N4NB 4WXHA 1G3SA 3SZGA 3LAPA 3SXYA 1HXDA 2IGMA 4AIDA 3OWTA 1W0TA 3G73A 5LFAA 1KYZA 2R7VA 3EYIA 4CCJA 2K9LA 2ID6A 5K7FA 3QP6A 4A0XA 1ULYA 3QPSA 2WAFA 1ZQ3P 3OYCA 4M6XA 4RAFA 4RS8A 2Y30A 4HF2A 4D0PA 4CCOA 4U0VA 3K1MA 1K4SA 1HLVA 1D0YA 1I6HJ 2MH2A 3OYNA 3GTMJ 5EG0A 2EJRA 3H92A 3GZ6A 4A2UA 3FM5A 2B7EA 5AIQA 1FJLA 1MBEA 5LGNA 1U78A 1ZR2A 2EZLA 2O5RA 4I0BA 4MO7A 3U1KA 4XIDA 4MFEA 3ZCOA 4CYCB 2HPIA 3OS2A 3GX4X 4OWRB 2J5PA 2DYSH 2O9LA 1HA8A 1ZRFA 2EV6A 4PSWA 1I5ZA 1QVTA 3ISPA 4E7IA 1A04A 1IN6A 3GLXA 1SAUA 4E7HA 3E5UA 3I4NJ 4CXFA 1TNTA 3DU6A 4S04A 1S7OA 4XMYA 2K9NA 1XTAA 1CF7A 2XF6A 5TRDA 3KLOA 1D1AA 5M3FJ 2M7AA 2EA2A 2KKOA 4A69C 1ZYRF 3WTTC 3S2DJ 3M8JA 3L09A 3MVPA 3EUAA 3SFZA 1E2XA 4GDFA 4BACA 5H2FC 3RSNA 2MLKA 4KISA 5JHUA 1VQNI 2OQGA 4KN7X 4FHTA 4I98B 2RREA 2QBYB 2HR3A 1S72I 3OYAA 2LY9A 2VQGA 2Z33A 1I39A 4F7ZA 2XGDA 1JTYA 3CUOA 2CUFA 3ABTA 1B1BA 3K10A 1YJ9I 4L0YB 4CCLA 1IN8A 2CMPA 4G6QA 2NAZA 1DQUA 4MTEA 2ELJA 1FOWA 3KP3A 5HLIA 1MMDA 1J75A 4IX7A 4OIQF 3LWFA 1I3QJ 4V2FA 3K6GA 1JI8A 3TO9A 2K3PA 3HEFA 3F6OA 3HHHA 5E1ZB 5H6RA 1JJ8C 1WSUA 2DPUA 1Z1DA 2AHQA 4BS9A 5JVGF 1HW1A 1Y1WJ 3DBRB 5IT9Z 3BZ6A 3IKVA 4UB8C 3JRGA 2LOOA 1R4MB 4IKFA 4JP0A 2FRHA 2VJIA 2DA1A 2GOMA 4CGZA 4B47A 2JTVA 2XB5A 1Y6IA 4MIMA 3JSOA 2XF5A 3AAFA 2LMDA 3IWZA 4UB6C 1IO2A 3L2QA 5C4XJ 3FWEA 4LD5A 2LFBA 2COMA 4A6EA 3J7ZI 1XS9A 3SZTA 3GTPJ 5DS9A 4UUVA 1YO5C 3BTIA 1MMNA 3V7RA 3A0BC 2LF7A 2E2IJ 2XF7A 3FMSA 2HQNA 3H9GA 4B8XA 2IGKA 2VXZA 4HQEA 1YLFA 2ZSHB 3BG7A 1FEXA 2VQHA 3CC7I 2STTA 3AL0C 4B3XA 5IP7J 3BC8A 1Q1HA 3ZR8X 3D0SA 1DUXC 1VQ7I 5HNHA 1FYLA 3CCMI 3WTVC 4ON0A 4BXFA 3WTWC 3E0JB 6PAXA 2RNJA 1IAWA 2R7RA 2QCOA 2QQ8A 1P4AA 4XN3A 2DFIA 4Y33A 5J6XA 1W5SA 1W0UA 1DU0A 4Q5SF 2L9VA 2MGQA 3JAMK 1NK3P 3G3ZA 1B8IB 3ZQHA 5LRRA 1YRNB 4LK1F 5B1AH 3R6SA 3D5RC 2NVTJ 3OYIA 2KISA 3DTKA 4XBFA 4UV9A 4HLYA 3TBIA 1NH3A 1BA5A 3TEDA 2A05A 5HDNA 4RDUA 2L2OA 3O3KA 5FFZA 1P7JA 2E1NA 2Y75A 1TZLA 4Y15A 4A3IJ 3CCRI 4FX0A 3J7YJ 3IL2A 1R22A 4YIRX 2L01A 3ZMTA 3GFLA 2E2JJ 1S7AA 1UELB 4KT5C 2MLGA 1YW7A 4Y3OA 4OINF 3ZMUA 3HDDA 2RAEA 5GTHC 1SFKA 2R93J 3WE3A 3MCZA 4BHCA 1HCRA 1E3HA 1TNSA 2BY3A 1K7AA 1YOVB 1ZTRA 3WHCA 1IJWC 3OR2C 3LMMA 4BY1J 5EG0B 4ENKA 1MNMC 3UNGC 1Z3XA 1ZHFA 2E7WA 4NHJA 2DA5A 2QQ9A 1APLC 3R61A 1X19A 3MFKA 4MNUA 2O03A 1ONVA 2DJIA 4ZJZA 3HPHA 3FK7A 3I64A 2P6TA 2O3FA 3W6KB 2JUCA 1DGRM 4K2EA 2A6TA 4JX4A 2LNBA 1JGGA 1K6OA 4G12A 1R1UA 5ICGA 2L3DA 5ILVA 1CF7B 1HOMA 1O7LA 1JHFA 2YR2A 4KMUX 2KRFA 1YYVA 2V7FA 2JSPA 3BQYA 4Y13A 3A03A 1S9HA 4RLQA 3JTGA 2OTJI 3LSRA 2H6BA 5D5WB 3A02A 1ZR4A 2DFEA 1W4MA 3DV8A 3TP0A 3SDBA 4WK8F 1KQ8A 2R3SA 2V79A 1OKRA 1EH6A 2DMNA 1N78A 2V1XA 2XPUA 3JTHA 2UZKA 2XSDC 4D9JA 1SMYF 3P5JA 3HOSA 3P9CA 3WU1B 1K78A 3ECHA 2RC4A 2M8GX 3FXRA 4XL9A 3AKZA 1R5ID 1WJ5A 5EEGA 1Z7LA 1TW2A 2L7ZA 1LQ1A 4IZZA 2Y48A 3F9KA 4P96A 4KJZA 3GTJJ 4XLFA 1LUJB 4PJLA 1QA6A 1MMGA 3MKZA 1TWHJ 4KNYA 1DP7P 1IRZA 2CQKA 2K4JA 2ZCWA 3QPHA 3SEZA 2WY7Q 2A6EF 4CA0A 5K5OA 1G3WA 4U87A 4ASNA 5L3EA 4A3CJ 1O3SA 2GLOA 3NARA 4MEYF 4ZYHA 1I3AA 5KAFC 3S17J 4A3BJ 1MZBA 1T6SA 1T33A 3O2PE 1OLTA 1IGNA 2NNYA 3W2AA 2KRHA 2EV0A 5DV5A 4OIOF 2HXOA 2RKHA 2HYGD 1G4DA 2OCCH 1ZG1A 3HKZA 3BPXA 2BBYA 2DI3A 2VXDA 4F91B 2Y2ZA 2E5ZA 1QQIA 3DLLF 3RZDJ 1YTYA 3G2BA 3ZMVA 1YIJI 1YITI 4ANJA 4NC7A 2L02A 4HDUA 4ZC3A 2K9SA 3V42A 1SVLA 1DU6A 3CDHA 5DTDA 3MZYA 1T98A 3P7NA 4RGUA 3RKQA 4LB5A 5IY5H 2IBDA 3KYDB 1AWCA 3KP7A 1TL8A 4HQMA 3M1EA 2G7UA 4IHVA 2O8XA 5EEAA 4CUGA 1XGNA 2VBXA 3J81K 1E0EA 2NVXJ 3PQJA 3AG3H 1OR7A 1GHCA 3T8RA 2EPFA 2WTEA 3IRQA 1T39A 3DP7A 1FBQA 2KDZA 4IJAA 1PUFA 1XMAA 4FT8A 1TQIA 3LA7A 2KZGA 5D6EA 1F36A 5BMZA 4PZJA 2KFDA 3CJNA 2A5WA 4U0WA 3TGNA 2IT0A 4KIGA 2R7SA 2QWWA 1LPQA 2UUZA 4EGZA 3ERMA 2OZUA 2CYYA 1JKQC 3ZP5A 3U1DA 2GIVA 3E97A 3K2ZA 4A5MA 4HNVA 2V6CA 1YG2A 2EZHA 2TDXA 2ZJQF 2FU4A 5M5WJ 1FC3A 2HOEA 3BTLA 1GLNA 3IH2A 5IP6A 1N25A 2F4OB 2IS1A 3WTYC 4EV0A 4Y7NJ 4LLNA 2XAQA 4P9UA 4X0GA 3DEWA 4L5EA 4N9HA 5IYBJ 2R5YA 3EUHC 5DEQA 3HTSB 2JPCA 1MNEA 4MFDA 4XKWA 3PIPF 2Y9YA 3GBGA 5F1RA 2L7KA 3ML6A 1FP1D 2LTPA 3K4NA 1ETKA 1HKQA 3F8BA 2K4BA 1EF4A 3KZYA 3M4OJ 3E6MA 2CU7A 3BJAA 3CO6C 5C4JJ 1WJBA 1K6YA 1LVKA 3KCCA 2VBYA 3TKYA 2RGVA 1VTNC 4HDVA 3CC4I 3EETA 4ENNA 3GVAA 2V1DA 5DD4A 3DU5A 3K4KA 5EDNA 2H27A 2B63J 3NQOA 2VLAA 2GA1A 5J8FA 3QOEA 2LVSA 4HW0A 4AD9A 2WC2A 2ZXHA 3IAM2 2GQQA 5EJCA 4KDPA 2HS5A 5KCMA 5H6QA 4V2GA 1TT0A 3MN2A 1K78B 2F5DA 1DGWY 4CSWA 1GVDA 3CLOA 4CICA 1ZN2A 2DO7A 4DZJA 3I5UA 3PM1A 5M3MJ 3Q9VA 2M4GA 1GDTA 5H20A 1F4KA 2G7HA 1ZLJA 3GFMA 5E3NA 2ZMEC 5E3OA 2P81A 4JX5A 4XN0A 1PYVA 1U8BA 4OMYA 2P7VB 3GTQJ 2FBHA 2FQ4A 2L7MP 1JTXA 3RPUD 2DA6A 5HLHA 2ELHA 3J80K 4H0EA 1USSA 3LSHA 5JLWA 2BZTA 1RUNA 2WV0A 4XLPF 2ZXIA 5FKNA 3S14J 5B66C 2ZJ2A 4HF0A 3A2KA 1R6RA 2BHZA 3HOZJ 2JVGA 3SQNA 4M74A 5E1WA 4FE4A 1MJBA 4H4KC 1FNNA 2X48A 2BY0A 1R7JA 1BR2A 5EGOA 4RBOA 4LB6B 3G6EI 3NAUA 2PMHA 3KEYA 3LL7A 2BVLA 1G6NA 3S16J 5J3LA 3GMEA 3N05A 2MABA 1NK2P 2NS0A 4A12A 2Z99A 5LRSA 2L9NA 3ZQFA 3RJPA 1LEAA 4RB0A 2AXTC 1PVEA 4CO8A 3A4CA 1OJLA 2FMLA 1Z67A 5DCMA 5JFRA 1XSVA 3S3OA 5IP9J 1FOXA 4XRSG 4HPQA 4JOMA 5IYDJ 4HZFA 2VC0A 4C30A 3K4LA 3KPHA 1BOAA 4A3KJ 1W7PD 5F0FA 3JR9A 3BQZA 2ESHA 1LEBA 4HBLA 4DIQA 3WTSC 2GXAA 2GXGA 4M3FA 2BOLA 4IF4A 4KN4X 1PUFB 4B44A 1U8RA 5J4YA 2HDCA 4G8XA 1UG0A 3J7AO 1UHSA 4IOAF 1BIAA 1LKXA 2NXNB 3BLYA 3B6AA 3RKXA 3HOUJ 3VYUB 3H5NA 3V4GA 4LIVA 4A5NA 3O8GA 1HW2A 1AKHA 2LY2A 1J2XA 3I53A 3H3ZA 4BBSJ 2XB0X 2DLLA 2VIXA 3VWBA 2DJNA 3Q5FA 2VASA 3D5SC 3DEUA 3MQ0A 1ETWA 4BDZA 2LY1A 3ABUA 1ETVA 5FFXA 2X1DA 2DTRA 5ICFA 4RAYA 2EH3A 4D5FA 1WJFA 4UV8A 4KIBA 4LK0F 2EZKA 1Y1VJ 1O4XA 1HKSA 3HRTA 4RGXA 5LEKA 2LLKA 3I58A 1R58A 5B1BH 2IGNA 2HGCA 4XSXF 1YQAA 4PGGA 3LSMA 4YFNF 2R5YB 1O3QA 2ACJA 3K1PA 3QPLA 5DM6F 4L0ZB 1BW6A 1ENHA 3C7JA 3HSEA 3DBLB 1FYKA 1DP3A 3T0YA 1W36C 2HTSA 5J1UA 4BQOA 5J8CA 1VQOI 3BR1A 4CZZA 4L9TA 2VBZA 3M1CA 1VNDA 4XK4A 2CW8A 5K5RA 1FBSA 4XLAA 4PCQA 1YHQI 3JRDA 4AIKA 3BG3A 3MZ8A 1IV8A 4LG3A 2E1MC 4JBAA 3HRMA 1JUSA 1I50J 2F48A 1J09A 1TWCJ 1V5EA 2UV1A 5CVIA 2EINH 3TOAA 4M6YA 1FOKA 3BTJA 3C2BA 4BQNA 4Q47A 1EH8A 1XDUA 2E7XA 1LDKB 2OJED 3F0CA 2VUMJ 4EJVA 5CPRB 1LFBA 1SD6A 4UY8I 2WAEA 4IXAA 3T5XA 1JUPA 1YFHA 1UMQA 2D45A 3Q0WA 3JRAA 2HI3A 4BEHA 2DA4A 5D5VB 1X1DA 2DW4A 4NC6A 1LNWA 5TGTA 1VQ6I 3L2UA 3CUQC 4S0HB 3JRFA 1E17A 5F08A 4XLEA 1YIOA 1HDPA 4DOZA 3OSGA 1XB4A 3IKTA 2XDVA 2QQAA 4GYIA 2V9KA 3V7CA 3DPTA 1Z05A 4FASD 3JRHA 2VKHA 4ZTFA 2A6HF 4I09A 3AFHA 1X4OA 3UR3C 2PX9A 2H8WA 2VT2A 4HX7A 1SD5A 4Y52J 2Y0SA 2ZNZA 2HQAA 3H3VK 3HOYJ 3ZQLA 5L3GA 4NQWA 1F43A 5HS9A 4B4CA 1Z77A 3VDXA 1W5CC 3RZOJ 1ZKGA 2QSFX 5EGOB 5FD5A 3LNQA 4A3JJ 3MKLA 5CLSA 1HC8A 1GXPA 2HOTA 2EFQA 3PNVA 3QP5A 1FLIA 4A0ZA 2Y31A 2JA6J 1UFMA 3OYLA 4G7ZF 1IUYA 3GYHX 4J19A 2MC4A 2Q0OA 4XONA 2Y0MA 2VJ5A 1T2KA 3JSPA 4OOIA 5HNFA 2ID3A 4M72A 5DCMB 5DD8A 4BHBA 2DTZA 4TV7A 2O8KA 2NVQJ 2VE9A 3QPTA 3BP8A 4CDGA 3H36A 2DOEA 2XGEA 1UB9A 1HW5A 1YW9A 4F3QA 4GFBA 4ZDPA 5L3FA 2RVCA 5CKTA 1IXCA 3O6BB 1F9NA 1HSTA 1YS6A 2ISYA 2NS7A 4YIFA 2GA2A 3PNYA 3OR1C 2ECBA 1RPWA 1ZRCA 5J1YA 2M30A 3Q0VA 1MD0A 2W85A 4UVBA 3CMYA 2VT3A 2P5LC 1UZCA 3C2HA 2R7OA 4OAYA 1AKHB 3I4PA 3C2GA 3PNTA 4KICA 4ZZLA 4FQGA 4M6VA 2HKXA 5FJ8J 2FEZA 1IN7A 2EWNA 3E1SA 2Q8KA 1TLHB 2OD5A 4XRFA 2X6WA 5BS6A 1G59A 3FXUA 1VF9A 1M1EB 2WBMA 2HOAA 1QZYA 4A3FJ 4DJAA 3P9IA 4EJOA 3PSIA 1X2MA 1D1CA 5LHIA 2CS3A 3H9JA 2PN6A 1G3TA 1B9NA 1Q1VA 2QKMB 4E7SA 1R23A 2BW3B 2V4JC 2ZXWH 2X1EA 1MBKA 1J7KA 2OU2A 3VEPA 2XASA 3K1NA 2DA2A 1MW7A 3ZQ7A 2EIJH 2RDPA 5E79C 5F6FA 4ZYGA 5IPAA 2EFOA 2K7LA 2OV7A 4GXOA 1REPC 2DYRH 1SVOA 3C1DA 3OOUA 4E7LA 1Z21A 3TP3A 5AONA 1SFOJ 1DDNA 4L9VA 2WADA 1EKEA 1LDJA 2X6OA 2H1LA 3DEEA 1VI0A 4LOCA 3OS0A 5HODA 3E6BA 3E5QA 5L3BA 3GF2A 1S6LA 2H1KA 3J7AY 1IW7F 2CUJA 3TDZC 4AVPA 4I6ZA 4B48A 1K61A 3VPRA 1FY7A 1HBXG 5FD6A 1MJ9A 2Z1DA 1XX5A 5CVUA 2ESNA 4NC8A 3HBLA 3HL2A 4BEHB 3OYMA 2EA4A 2RV8A 4IHTA 3BR6A 3FZVA 5BNGA 3KZIC 3W2WA 2DXIA 3HSRA 2F4MB 3CJTB 4BDYA 1MMSA 1EA3A 3F8FA 4E70A 3FHNA 1D5YA 3HC7A 1XGMA 3IWFA 1JJ6C 4KUMA 4AC0A 1XSXA 4F92B 4UNOA 4QLCU 3AG4H 2IRFG 4EGYA 4HLXA 2D5VA 1XCVA 1FP2A 3BR0A 5L3CA 4BJ6C 2XVCA 3CO7C 2HQ5A 2WV1A 4S05A 4CZCA 4IVNA 3DXJF 2X85A 1LFPA 1MGTA 2HDWA 4OIPF 1E3OC 1QVUA 4HOBA 3VODA 3BWGA 2K85A 4HX8A 2IW5A 2EB7A 3H5RA 2Y9ZA 5K5QA 5TISC 1PDNC 4C9YA 3CMMA 5EZGA 4F93B 3LSJA 5TJJA 2BXZA 2P8TA 4U88A 3JAMZ 2ZFWA 1RI7A 2DCEA 1VQKI 2QENA 2K9QA 2Q2EA 2M7BA 4O6JA 2ZKZA 2L9RA 4XICA 1ZRDA 1OCTC 2L4MA 3KETA 3L2WA 2NVYJ 3N4MA 2I5UA 3WHBA 4RM2A 2ZJPF 2JT1A 5J40A 3HOVJ 2FUG2 2VKEA 3C18A 1YE9A 1I1GA 3VFZA 1X3UA 4FCYA 4RA2A 2A3SA 3W2VA 2N8GA 2CO5A 3E6CC 1Z0XA 1T56A 3S3MA 2E19A 4IOCF 1QGPA 4I7HA 3GFJA 5EEHA 2H6CA 2K3FA 2IGOA 3F72A
chains in the Genus database with same CATH topology
3CMEI 3CC7I 1VQPI 4V19K 5GAEJ 1VQ7I 3CCMI 3PIPF 2H8WA 2QA4I 1YJWI 1QA6A 1YI2I 3G71I 1VQ5I 4IOAF 2NXNB 3CCJI 5GADJ 3CCVI 3CCUI 1Y39A 3CC4I 1HC8A 2E35A 2E34A 3CCSI 5GAHJ 2ZJRF 3CCLI 4IO9F 2FOWA 3DLLF 3CCRI 3J7YJ 1YIJI 1YITI 3CMAI 1ACIA 1VQNI 5DM7F 3CJTB 1YJNI 1MMSA 1S72I 5DM6F 1YJ9I 2E36A 3I56I 1FOWA 1FOYA 1VQOI 2OTLI 1VQ4I 1YHQI 1VQLI 3CCEI 2QEXI 3CF5F 1VQ9I 3CCQI 1VQMI 2JQ7A 3CC2I 5JVGF 5GAGJ 3I55I 3CD6I 3PIOF 1VQKI 4UY8I 3G6EI 2OTJI 2ZJQF 1VQ8I 2ZJPF 3J7ZI 1VQ6I 4IOCF 3G4SI 1FOXA 2K3FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CME I;  3CC7 I;  1VQP I;  4V19 K;  5GAE J;  1VQ7 I;  3CCM I;  3PIP F;  2H8W A;  2QA4 I;  1YJW I;  1QA6 A;  1YI2 I;  3G71 I;  1VQ5 I;  4IOA F;  2NXN B;  3CCJ I;  5GAD J;  3CCV I;  3CCU I;  1Y39 A;  3CC4 I;  1HC8 A;  2E35 A;  2E34 A;  3CCS I;  5GAH J;  2ZJR F;  3CCL I;  4IO9 F;  2FOW A;  3DLL F;  3CCR I;  3J7Y J;  1YIJ I;  1YIT I;  3CMA I;  1ACI A;  1VQN I;  5DM7 F;  3CJT B;  1YJN I;  1MMS A;  1S72 I;  5DM6 F;  1YJ9 I;  2E36 A;  3I56 I;  1FOW A;  1FOY A;  1VQO I;  2OTL I;  1VQ4 I;  1YHQ I;  1VQL I;  3CCE I;  2QEX I;  3CF5 F;  1VQ9 I;  3CCQ I;  1VQM I;  2JQ7 A;  3CC2 I;  5JVG F;  5GAG J;  3I55 I;  3CD6 I;  3PIO F;  1VQK I;  4UY8 I;  3G6E I;  2OTJ I;  2ZJQ F;  1VQ8 I;  2ZJP F;  3J7Z I;  1VQ6 I;  4IOC F;  3G4S I;  1FOX A;  2K3F A; 
#chains in the Genus database with same CATH topology
 3ASO H;  1VQP I;  1JHH A;  5DDG A;  1R4N B;  1RC9 A;  3M8F A;  3QRF F;  2XAF A;  3ZMS A;  2P7C B;  2WWY A;  3ZQI A;  5IYC J;  3F8C A;  4UVC A;  5LGT A;  1ON2 A;  5BPI A;  3KP4 A;  4LG0 A;  4W1U A;  3VB2 A;  2BV6 A;  3OY9 A;  4I01 A;  3WOD F;  1UG2 A;  3W6V A;  3R4K A;  3BR2 A;  2DDB A;  5GAD J;  4ZYE A;  2QSH X;  3ABK H;  3ZQG A;  5HDG A;  1YS7 A;  2LF8 A;  3QOD A;  3VYR B;  4A0Y A;  2OF7 A;  2EZI A;  3PFI A;  1J9I A;  2A68 F;  3MKY B;  3RPU A;  3CCS I;  4RB3 C;  2ZO4 A;  3K4M A;  2RQP A;  5GAH J;  3K7A J;  2GBY A;  3FMR A;  4U7B A;  4DBQ A;  4A3L J;  3G1L A;  1QPM A;  1S5L C;  3FXQ A;  1R49 A;  3V8L A;  2P0W A;  1FTT A;  4IQ4 A;  3RPQ A;  1V4R A;  2R7Q A;  2ZME A;  3OMY A;  1ON1 A;  1WVR A;  2XGC A;  1BI0 A;  3I3L A;  4OIR F;  5FRM A;  1ETO A;  2M0C A;  4I76 A;  2QYO A;  1X1B A;  3H3U A;  2TCT A;  3I56 I;  2IPQ X;  4HG2 A;  3SEQ A;  3COA C;  1F1Z A;  3WG7 H;  5FLX Z;  3GZN B;  1UST A;  3EDP A;  3OYE A;  2D2W A;  2DBB A;  3ULQ B;  1VQM I;  3IHU A;  3LA3 A;  5AIP A;  3I55 I;  3F21 A;  1QNT A;  3DPU A;  2LK2 A;  2XHK A;  2V9P A;  4YII A;  3ABL H;  4QPQ A;  5GPA A;  2O61 A;  1W7P A;  1ZG3 A;  3GO5 A;  5B5E C;  2CV2 A;  4CHU A;  2PJP A;  1WJD A;  1PUE E;  3BZC A;  1AOY A;  1SMT A;  2ADU A;  2YUS A;  5FGM A;  1A6I A;  2FXA A;  3K69 A;  2BGC A;  1U9O A;  4FTH A;  2VJ4 A;  3S1M J;  4XR6 A;  3ERE D;  4KIF A;  1U2W A;  4AUX A;  1ETX A;  4R79 A;  3A01 A;  1D0X A;  3F6V A;  1T0F A;  1IZ1 A;  1MBG A;  2JVH A;  5F27 A;  4ENM A;  3LST A;  2R0Q C;  2GAU A;  2WAQ A;  2LKX A;  3HZJ A;  2KL4 A;  4IRG A;  4BJ5 C;  5A2Q K;  1MIJ A;  4RM3 A;  5IOY A;  3JCU C;  4M3E A;  3CME I;  1POG A;  5KK1 A;  3HB9 A;  1QZZ A;  2HKO A;  2CFO A;  3RCO A;  1T38 A;  2QLZ A;  5EYR A;  2YU3 A;  3FXJ A;  1Z91 A;  2HZT A;  1IC8 A;  2R5Z A;  1TTY A;  3BJO A;  1JE8 A;  1KYW A;  4LJZ F;  3J81 Z;  1YJW I;  1UAA A;  4P55 A;  5IOZ A;  2HZD A;  1U5T C;  1GV5 A;  1CQT A;  1RKW A;  2XAU A;  2CUZ A;  1NG7 A;  1ZGW A;  3OYG A;  4II2 A;  3KZZ A;  2DQR A;  4E4H A;  2Z5U A;  3EYY A;  4F52 A;  3MZH A;  1RR7 A;  3HSF A;  3ZQQ A;  1G8X A;  1J0R A;  2IEK A;  2LP0 A;  1XCB A;  2Q2E B;  3OL3 A;  2KPM A;  2R7X A;  4XOR A;  4IQJ A;  1H0M A;  1WQ2 A;  3DCF A;  2CW7 A;  2W00 A;  2NYX A;  2CW0 F;  4GO1 A;  4M3D A;  4EEF G;  2XKO A;  4XKV A;  3FXK A;  3B73 A;  1FYM A;  5KVR A;  1S7E A;  3C3W A;  3M07 A;  2K40 A;  3CMA I;  2BE5 F;  2HWV A;  3ASN H;  4BQA A;  5DM7 F;  3ZPL A;  3OYH A;  4XNF A;  4NDL A;  2FBK A;  1DPU A;  1WI3 A;  3MEX A;  2VE8 A;  4JQF A;  3WE2 A;  2B9S A;  1O3T A;  1RZ4 A;  1BC8 C;  3QWL A;  4C2M J;  3K9T A;  3FXM A;  4HF1 A;  2ELK A;  2V1N A;  3GFI A;  2PQ8 A;  3H9Q A;  3KYC B;  3KX2 A;  4ESB A;  3KP6 A;  1D0Z A;  2BVM A;  3REO A;  4LG0 B;  1GT0 C;  1NG6 A;  1BBY A;  1JXS A;  1BL0 A;  2JRM A;  1P6R A;  2DFF A;  2VI6 A;  3ZN0 A;  2R7U A;  2QQB A;  5GAG J;  2R92 J;  1ZEL A;  2DT6 A;  3OL4 A;  2ME0 A;  2W82 A;  2W24 A;  3OYF A;  3I59 A;  3JRC A;  3QQA A;  4NBQ A;  2I8D A;  3HKZ N;  4PGH A;  3CUQ A;  3VYS B;  5EF6 A;  4CCK A;  2F5C A;  4BE1 A;  2ZBK A;  2BY1 A;  2ICW G;  3H0G J;  1T8I A;  4XQF A;  1MMA A;  4I2O A;  3L2C A;  2ZME B;  3K70 C;  2CH0 A;  1G2H A;  3PSF A;  1R5H A;  2EIL H;  1OCR H;  2DA7 A;  1BI3 A;  1HSJ A;  1H9G A;  2VKD A;  4O5V A;  3V8J A;  1NHA A;  3OYD A;  4LIT A;  4WCG A;  2M4K A;  3S15 J;  3VYT B;  2DOD A;  2F5E A;  2LBF A;  2JRT A;  3ONQ A;  3FHZ A;  2GIZ A;  3ESW B;  1TWG J;  3N97 A;  2RN7 A;  3JRB A;  1F5T A;  3K70 D;  1XD7 A;  5FB2 A;  3TO7 A;  1BJA A;  2CQN A;  4G6D A;  4AVZ A;  2OQR A;  4P1W A;  1P9Q C;  3J80 Z;  1QO0 D;  3G71 I;  4P5O A;  2D1H A;  5E8I A;  5C3E J;  1MBF A;  1WH5 A;  3CCJ I;  3IP4 B;  1MSF C;  2MBF A;  2KIF A;  1XDS A;  3KE2 A;  1XSD A;  3CCU I;  2DMP A;  4B09 A;  1W7P B;  4BH9 A;  2PLY A;  3HUG A;  4WF2 A;  3LSI A;  5DUK A;  2OC6 A;  2MYS A;  1RRJ A;  2M87 A;  1FWZ A;  2FSW A;  2DMU A;  2HTJ A;  1KQ9 A;  3A01 B;  1X4P A;  2PG4 A;  3JW4 A;  2L54 A;  2HFH A;  2VQC A;  1C0W A;  2L5Q A;  4MQ9 F;  3HPG A;  1TBX A;  2ZB9 A;  4XRS A;  4QTR A;  2PJR A;  1GV2 A;  3S8P A;  2X4H A;  1SAX A;  5FKM A;  2H8R A;  1I1S A;  2W4S A;  1KON A;  4DYQ A;  2JN6 A;  2R5Z B;  1BI2 A;  4UUT A;  5HOO A;  3CES A;  3CCY A;  3BG9 A;  3LQQ A;  1HQC A;  3LSG A;  2L7F P;  3JRI A;  5CYV A;  1XG1 A;  3L9F A;  4AU7 A;  2JQ7 A;  1WWX A;  2W1O A;  2FNA A;  2JA8 J;  3OV8 A;  4E7Z A;  4M9S A;  5D4S A;  3FXL A;  4BKX A;  2M45 A;  2DMT A;  2A69 F;  3BCB A;  4N0B A;  3SZP A;  4LIU A;  3X2Q H;  4UUS A;  1AU7 A;  4RAZ A;  4NNJ A;  1N77 A;  3S2H J;  3TW6 A;  4U0Y A;  3H5A A;  3G1M A;  4EM0 B;  1VQ8 I;  2X9D A;  1LFU P;  2DAO A;  2GWR A;  3DBH B;  3RQ4 A;  5FLM J;  3HXL A;  1D3Y A;  2VON A;  3RYP A;  4A6D A;  1YW8 A;  2CUE A;  2XAH A;  2KZV A;  2ZXJ A;  4UHT A;  5M5X J;  1B72 A;  1U6G A;  2LH9 A;  4HX4 A;  4BXX J;  2VB6 A;  1V3F A;  2KT0 A;  3FX3 A;  2H09 A;  1W36 D;  4PK4 A;  1H9T A;  4EMS A;  1FBU A;  4V19 K;  4IHY A;  4O3M A;  4BNC A;  3ABM H;  3HGY A;  2DU9 A;  5J47 A;  1OIS A;  3FKJ A;  3FIW A;  1ORK A;  1KU7 A;  1T95 A;  3RQI A;  1RR8 C;  1SEU A;  2VBW A;  4GCV A;  1BJZ A;  3DF8 A;  5L3D A;  5IT3 A;  1YI2 I;  2FNP A;  5FKL A;  4MTD A;  3K2A A;  4CCN A;  3GTL J;  1W1W E;  1CGP A;  2KHM A;  5C44 J;  4BL0 B;  2NNN A;  2PBI A;  4LLG F;  2VL8 A;  4YEJ A;  2LRD A;  3P9K A;  3I59 B;  3KFW X;  2YPR A;  3WGG A;  1GXQ A;  4BHP A;  1V5G A;  1OQY A;  1ITY A;  5M5Y J;  1TP4 A;  4L18 B;  3CUQ B;  1IN4 A;  4RMN A;  5HLG A;  4A3E J;  1NTC A;  4A3G J;  1MH4 A;  4M3B A;  3PJR A;  3PUF A;  1A6Q A;  2HYF A;  2QGU A;  2BXY A;  5FKO A;  3GZ5 A;  1SFE A;  4A3D J;  1U9N A;  1A36 A;  2B0L A;  3GWZ A;  3ZRG A;  5K7H A;  3GLL A;  3BPV A;  5B3S H;  1K4T A;  4JYK A;  2EIK H;  1WH7 A;  1XGO A;  3NRV A;  4W97 A;  2YX7 A;  2MD0 A;  2EFW A;  2X6Y A;  3ELK A;  1KU2 A;  2E71 A;  1LB2 A;  2P4W A;  5D5U B;  4G6T B;  2OUM A;  2EFN A;  3HM5 A;  1QPI A;  3HIF A;  3IH3 A;  2LBF B;  3RKY A;  1Y8Q B;  2KLO A;  2O6G E;  1GVJ A;  2YX4 A;  5E1X A;  3B6C A;  2K27 A;  2R7D A;  4JK1 X;  4C3J J;  4HST A;  1Y56 A;  3TMO A;  4U7D A;  4BBR J;  5FRO A;  3IUO A;  2KQR A;  2I10 A;  3M9A A;  4EQQ A;  3GTK J;  1BW5 A;  1PP7 U;  2WB1 A;  2XGX A;  4CCM A;  4IRI A;  1BC7 C;  2F6C A;  4ETS A;  3FF5 A;  2YSR A;  2EV5 A;  1XMX A;  2LR8 A;  3KEO A;  1JUM A;  1WJC A;  1Y0N A;  3CCQ I;  1P2F A;  9ANT A;  3AG2 H;  1FT9 A;  2P5V A;  3D1N I;  1WJE A;  1PJR A;  2DMQ A;  2JZY A;  4II3 A;  5LHH A;  2FE3 A;  2LSO A;  3HUG B;  3E3V A;  1G3Y A;  1HKT A;  1JT0 A;  1OCC H;  4NB5 A;  5CVR A;  2NVU B;  3S3N A;  1V5F A;  1ZAR A;  3IC7 A;  1MJA A;  2IS2 A;  2M1B A;  4C3H J;  3V8K A;  1KU9 A;  1QHH D;  2AO9 A;  5KNL A;  3OIP A;  1SD7 A;  2Y69 H;  2K86 A;  4B1R A;  1RKT A;  3FIS A;  2CFX A;  4L5I A;  3GXO A;  2H94 A;  2HEO A;  2M5W A;  2R4G A;  3TQN A;  1TQM A;  2PJR B;  3WGI A;  3I4M J;  4X1E A;  3WU2 C;  5FO5 A;  4HA8 A;  1R9T J;  5CQE A;  5GAE J;  2FMY A;  1QHG A;  2FA5 A;  2RQQ A;  3RTR A;  4PJN A;  4BQQ A;  3S2W A;  3G1O A;  3KEQ A;  2R7Z J;  1ERD A;  4ZZD A;  4HRI A;  3Q0U A;  1SVM A;  4A93 J;  2LKS A;  1OCZ H;  2Z3Y A;  5ERI A;  1AA7 A;  5KAI C;  3OOP A;  5IT9 K;  5E17 F;  2E60 A;  2HOS A;  3H35 A;  1JT6 A;  3U2R A;  4BUP A;  3CCV I;  4J00 A;  4ZTJ A;  4KIT B;  4UUS B;  2DN0 A;  3LFK A;  1KQ0 A;  2HNH A;  5D6F A;  2MA3 A;  2COB A;  3KP5 A;  5LBQ A;  1RES A;  1EH7 A;  1BR1 A;  1SC7 A;  3BG6 A;  2LD5 A;  4HV5 A;  3LFU A;  4KYW A;  3TDU C;  2XSJ C;  1B72 B;  5BPD A;  4HEA 2;  1JKR C;  1IRG A;  3HHG A;  2A07 F;  2AQF A;  2OBP A;  1PP8 F;  2DPD A;  5EZH A;  2GM4 A;  3PO2 J;  2O7O A;  2E1C A;  2Y0S N;  4B3A A;  5F64 A;  4X6A J;  4GRI A;  1BR4 A;  4OAZ A;  1A31 A;  1X3W B;  3RIR A;  1IN5 A;  2QEX I;  3EPZ A;  1Z9C A;  4Q4Z F;  4RAG A;  1I27 A;  1VFC A;  3AL0 B;  5LLQ A;  4I02 A;  4HV6 A;  3B02 A;  5BOX A;  4WXC A;  5JR3 A;  2M3A A;  1BI1 A;  3PL8 A;  3HOW J;  3K4B A;  2FJ1 A;  2LG4 A;  2MG4 A;  3T1B A;  4ESF A;  2YU9 J;  3SJM A;  3LSP A;  5K7Z A;  2PMU A;  1SFX A;  2XRN A;  1TW3 A;  1O3R A;  2WB1 N;  4G7O F;  3M3Y J;  2FX0 A;  2LRE A;  4LGW A;  1FSE A;  4FX4 A;  1IRX A;  1WFX A;  2LKP A;  3I71 A;  1A35 A;  1FMV A;  1TWF J;  4AM3 A;  1MBH A;  5HLT A;  4P9F A;  4NQW B;  1Z6R A;  2W7N A;  2MW8 A;  2R7W A;  3BOQ A;  3L7W A;  1H89 C;  1TC3 C;  1UJ8 A;  3S93 A;  3E5X A;  4WX9 A;  3JRE A;  1AHD P;  3KP2 A;  2CSO A;  2VKV A;  2AS5 F;  3DTE A;  3OYB A;  3QYF A;  3MD2 A;  2R7F A;  1ZK8 A;  3HG9 A;  4PJJ A;  2HDD A;  1U5T A;  5CVV A;  1IV6 A;  2OPT A;  2F4I A;  1ZH5 A;  3WGH A;  3CF2 A;  4I99 C;  2JJ7 A;  1UHM A;  4L9J A;  1B59 A;  5J1R A;  2HVR A;  3BR5 A;  4M3G A;  3DKY A;  4CH7 A;  1X1A A;  2PI0 A;  2TRT A;  1Z3Y A;  4Q48 A;  3GEZ A;  1H88 C;  4XSZ F;  1VQ5 I;  4Z6Y A;  4HNT A;  3BCA A;  4CYD A;  4RB2 C;  4J01 A;  3EUH A;  1N75 A;  4PUS A;  4D7M A;  3HOX J;  1B6A A;  4XOT A;  5D4R A;  5ILS A;  3ZXS A;  2LC2 A;  3HYI A;  1J5Y A;  4N4O B;  1Y0U A;  2PMZ A;  1S8N A;  3BY6 A;  5CJ9 A;  5E20 A;  4BE0 A;  3TO6 A;  1L3L A;  1WRJ A;  4ENJ A;  2KP6 A;  1ZRE A;  2XUB A;  3E6D A;  2FOW A;  3TL4 X;  1STZ A;  3SYT A;  1FIA A;  2NOJ B;  1MND A;  3UKG A;  2VOO A;  4MEX F;  3H1C A;  4G94 A;  1KU3 A;  2GZW A;  4KMF A;  2K02 A;  4HAM A;  3FM3 A;  2CG4 A;  4M73 A;  3LQR A;  2ETH A;  1OPC A;  4IHX A;  3ZMD A;  1OYY A;  2IA1 A;  4BU2 A;  1WJA A;  2P5K A;  3OYJ A;  3FBN B;  4PDK A;  2VN2 A;  2OTL I;  1VQ4 I;  4MLO A;  3ZGK A;  4G7H F;  3HTU A;  4QSH A;  2CV1 A;  2EQR A;  1T08 B;  1X2N A;  2WY8 Q;  1EJ9 A;  1FSH A;  3L2R A;  1VQ9 I;  2M2E A;  2JA5 J;  1KGS A;  1RUO A;  2WA0 A;  2XV4 S;  2IP2 A;  2G0E A;  2UWM A;  4B43 A;  4DQ2 A;  3DLA A;  1LDD A;  1RET A;  2L9S A;  2XIG A;  3ZQC A;  4BE2 A;  2QSG X;  3OIQ A;  1XGS A;  2CQ7 A;  4DBR A;  3FXO A;  1OFC X;  2MFZ A;  2VPR A;  3W3C A;  5FLX K;  2W48 A;  1S3J A;  5JLX A;  3MMY B;  4RGR A;  4LLL A;  3KLN A;  4EJU A;  4IHS A;  1HF0 A;  1FZP B;  2IAI A;  2EIM H;  5ICC A;  4D5C A;  2O0Y A;  4EAT A;  2VC1 A;  3A1Y A;  4BGD A;  1OYI A;  3GCM A;  4YFX F;  5FKK A;  2V9V A;  3WTX C;  2W25 A;  5JI6 A;  3KIO A;  3HGG A;  2QVO A;  1J59 A;  2BEO A;  3G4S I;  3GTO J;  1XC5 A;  2CRG A;  1O57 A;  2IA2 A;  4EJW A;  4OU0 A;  4QWQ A;  3DTI A;  5E3L A;  3BZK A;  4AYB A;  3QOP A;  3K4C A;  1SAN A;  1E3P A;  1WI9 A;  3K0L A;  2VPL A;  3OS1 A;  4AIH A;  1R36 A;  3R0J A;  2P6S A;  3HOT A;  2PEX A;  3LOC A;  4XLH A;  4BY7 J;  2MD5 A;  3BR3 A;  5GP9 A;  5CVJ A;  1P4W A;  2FBI A;  2VOP A;  3H0D A;  3WTZ A;  3LAJ A;  4IPA A;  4D7N A;  5ILU A;  3IV5 A;  4MHG A;  4KFC A;  3HJE A;  2F5V A;  1Y39 A;  2A5Y B;  4N9I A;  1EV7 A;  1FIP A;  1W5T A;  2E35 A;  2XPV A;  2HPM A;  2CGP A;  3GUD A;  2X1C A;  1MH3 A;  2E34 A;  2FD5 A;  4PSX A;  2K5C A;  2XKP A;  3DPL C;  5F04 A;  2KMU A;  1ODD A;  3GW2 A;  2IJL A;  4E6K G;  2QZ8 A;  1QZE A;  3ZOB A;  3CJQ B;  3MWM A;  5F0H A;  1RIO H;  1A5J A;  3EUK L;  2OA4 A;  3OSF A;  1BN5 A;  2XRL A;  2ZFU A;  2GXB A;  1S29 A;  3F22 A;  2NOG A;  2J5O A;  4PJM A;  3BRO A;  4XRM A;  4M9X A;  2PMZ N;  2QKL B;  2QF7 A;  1X58 A;  2CWE A;  4YFK F;  3RYR A;  2JA2 A;  2Z2S B;  5GPC A;  5DUI A;  5A2Q Z;  1U5T B;  2JPB A;  2DDA A;  2FQ3 A;  1IXS B;  2DA3 A;  2E36 A;  2DFH A;  1ZLK A;  2K9M A;  5D8K B;  3NEU A;  4PFP A;  2R7T A;  1BM9 A;  4EVI A;  5DCF A;  2UXN A;  2STW A;  3BT9 A;  2AXL A;  2M0M A;  4FIS A;  1R1V A;  2HYJ A;  1OMI A;  4ABZ A;  1FMW A;  1MBJ A;  3CTA A;  2D1V A;  3Q3S A;  3D5L A;  5GTI C;  3FMQ A;  1I6X A;  4HYE A;  2YS9 A;  1IDY A;  4MGR A;  3IH4 A;  4LFU A;  1SD4 A;  4RGS A;  2Q1Z B;  5DYM A;  2VJJ A;  1GUU A;  3PIO F;  1JKP C;  1KA8 A;  3DKW A;  2GOX B;  3VOE A;  3L00 A;  1P4X A;  2F5F A;  2M8E A;  1X3Z B;  1XN7 A;  4QPO A;  3F3X A;  1T0F C;  3BG5 A;  2CQX A;  1MKM A;  1D1B A;  4KT6 A;  1XPX A;  4RLF A;  3BDD A;  3O8H A;  1LE8 A;  2BYV E;  3CP2 A;  1IDZ A;  4D1Q A;  4FET A;  3HRU A;  1ETQ A;  3F23 A;  2G9W A;  3T8T A;  3E7L A;  4YRV A;  2IA0 A;  1WHU A;  4Z2Y A;  3RKW A;  3Q9S A;  2LDU A;  4ITV A;  4IL6 C;  2BHY A;  3WTU C;  2DOF A;  3CQZ J;  2UXX A;  4JX6 A;  3L2V A;  2V26 A;  3QU6 A;  4DYC A;  4M71 A;  2JK3 A;  1BIB A;  5E18 F;  4XM3 A;  1WKM A;  1OCO H;  1U0J A;  3FK6 A;  4AWX B;  4Y17 A;  5LD2 C;  2X0L A;  4PFO A;  2JWT A;  1VZ0 A;  1UCR A;  1ZAO A;  2QUF A;  3MAJ A;  3DFG A;  1MDM A;  3LSK A;  3KYL A;  5CQG A;  3OYK A;  1X1C A;  2JMW A;  4EM1 A;  1TQP A;  4ZDO A;  1MSE C;  3WG9 A;  2HVS A;  2CJJ A;  1O7F A;  3F8M A;  1K79 A;  1Y8R B;  4AYB N;  4XOP A;  5E8G A;  3PQK A;  1X1P A;  1B4A A;  5LEJ A;  2QM3 A;  2MC3 A;  5F0C A;  1ZGJ A;  2IS4 A;  4YG2 F;  1IUF A;  3VSL A;  5D5X B;  2ZJR F;  2EK5 A;  3IRR A;  3S1Q J;  4IRH A;  4Y4R A;  3PFY A;  2HU9 A;  1R1T A;  2FOK A;  4I0A A;  4C3I J;  2RNG A;  4IHW A;  1WGX A;  1FTZ A;  3CZ6 A;  2WAQ N;  1ETY A;  3HRS A;  4ZYD A;  1YJN I;  1IRF A;  2VQL A;  1UHW A;  4NUB A;  5ED4 A;  2M34 A;  3BTC A;  3MKW B;  2IVM A;  3R0A A;  2IS6 A;  1V55 H;  3DKX A;  2ECC A;  4ZH4 F;  4HNU A;  2MH9 A;  3IAS 2;  4QIW N;  2DT5 A;  4AIJ A;  2JUG A;  2V6E A;  1FOY A;  2E1O A;  5BQT A;  1WCM J;  1YX5 A;  4DZP A;  1KZH A;  2DOA A;  1VQL I;  3SHF A;  3S1N J;  1P7I A;  2KDO A;  3CF5 F;  2OAZ A;  4CYC A;  2KIU A;  1D8K A;  2XPW A;  3I0T A;  3TOB A;  5HS8 A;  5J4V A;  1OR7 C;  2E2H J;  1HDD C;  2A61 A;  4ESJ A;  4MQV A;  1R00 A;  1IG7 A;  3F8N A;  1U3E M;  2PFB A;  3M7G A;  2XRO A;  5ICE A;  3I54 A;  2ZNY A;  4LMY A;  3SDG A;  4WXD A;  1FX7 A;  4OMZ A;  3CJR B;  4GYG A;  4BJT A;  4BXU A;  5FRN A;  3RI4 A;  1H8A C;  5LGU A;  3SFI A;  2KRC A;  1Z6T A;  2FF4 A;  4GGG A;  3TW7 A;  4DW6 A;  5KHD A;  3NWS A;  4L9N A;  4YEL A;  4FE7 A;  1SFU A;  4M9Z A;  3QYB A;  5JHF A;  1RNL A;  2QBY A;  3I9V 2;  3BJ6 A;  3VSK A;  2HXI A;  1D8J A;  2NS8 A;  1R71 A;  3OIO A;  2L4A A;  2DT7 B;  3CDI A;  3L1P A;  4L5J A;  2EBI A;  3K4J A;  4UVA A;  3PO3 J;  1LVA A;  2QA4 I;  4F55 A;  2Z16 A;  3U9G A;  4ZYA A;  1WZ2 A;  4EJT A;  3W6J B;  2CV0 A;  1D5V A;  3PUB A;  1IF1 A;  3FBI B;  1DPR A;  1LJ9 A;  1ZGA A;  3QU3 A;  3S32 A;  1QRY A;  4ZDL A;  4XKB A;  3V7S A;  4DYR A;  1XMK A;  2C6Y A;  1TT5 B;  2XAJ A;  2BW3 A;  3ROU A;  1K83 J;  2X51 A;  1ZG5 A;  2ME6 A;  1L0O C;  3DQV C;  2ZSI B;  4BYY A;  1R5G A;  2JA7 J;  1TWA J;  2E1M B;  4UXN A;  3FDY A;  1LE8 B;  4C2U A;  3CCL I;  2KJC A;  4DGW B;  4E7J A;  2IXS A;  2MSY A;  4RB1 A;  4IO9 F;  1P92 A;  1WPK A;  2W84 A;  2X6X A;  2XAG A;  3S1R J;  4G9Y A;  3FKI J;  5FLV A;  5E3M A;  4XLC A;  2F2E A;  1ACI A;  1QU3 A;  1IXR C;  2EFP A;  2L0K A;  1B9M A;  3AG1 H;  3U21 A;  2M9H A;  4DNC A;  2HQR A;  2OZ6 A;  3CDL A;  3R60 A;  2HVQ A;  2CQQ A;  2OCE A;  4C2T A;  3QYE A;  2Z9O A;  2KIM A;  2KJB A;  4HSR A;  5F1J A;  4A3M J;  5JVT A;  4WWC A;  5HS7 A;  1OYW A;  3A0H C;  2XC7 A;  4KA4 A;  2KIQ A;  2VOD A;  4IEJ A;  4R8H A;  3CP8 A;  1FPQ A;  3LA2 A;  4XLN F;  4BAY A;  3WU0 A;  2LYC A;  5HDK A;  3CCE I;  1MDM B;  3ECO A;  2DQL A;  3NWT A;  3ZN1 A;  1Z7U A;  3RDI A;  2JSC A;  3ZMZ A;  4R1H A;  2ISZ A;  3CC2 I;  2AQE A;  5HVQ C;  1JKO C;  3CLQ A;  3QAH A;  5K1Y A;  3DWL E;  2E5N A;  4XKC A;  1JGS A;  3CD6 I;  2ZC2 A;  2DK5 A;  2DK8 A;  1QBJ A;  1OCP A;  4EM2 A;  1B8I A;  2W57 A;  3GTG J;  2V1U A;  2BY2 A;  1YX3 A;  3M8E A;  4PJ0 C;  5D8L B;  1YRN A;  1BOB A;  2NRA C;  5LHG A;  3EQL F;  4E7K A;  1V54 H;  4N4N B;  4WXH A;  1G3S A;  3SZG A;  3LAP A;  3SXY A;  1HXD A;  2IGM A;  4AID A;  3OWT A;  1W0T A;  3G73 A;  5LFA A;  1KYZ A;  2R7V A;  3EYI A;  4CCJ A;  2K9L A;  2ID6 A;  5K7F A;  3QP6 A;  4A0X A;  1ULY A;  3QPS A;  2WAF A;  1ZQ3 P;  3OYC A;  4M6X A;  4RAF A;  4RS8 A;  2Y30 A;  4HF2 A;  4D0P A;  4CCO A;  4U0V A;  3K1M A;  1K4S A;  1HLV A;  1D0Y A;  1I6H J;  2MH2 A;  3OYN A;  3GTM J;  5EG0 A;  2EJR A;  3H92 A;  3GZ6 A;  4A2U A;  3FM5 A;  2B7E A;  5AIQ A;  1FJL A;  1MBE A;  5LGN A;  1U78 A;  1ZR2 A;  2EZL A;  2O5R A;  4I0B A;  4MO7 A;  3U1K A;  4XID A;  4MFE A;  3ZCO A;  4CYC B;  2HPI A;  3OS2 A;  3GX4 X;  4OWR B;  2J5P A;  2DYS H;  2O9L A;  1HA8 A;  1ZRF A;  2EV6 A;  4PSW A;  1I5Z A;  1QVT A;  3ISP A;  4E7I A;  1A04 A;  1IN6 A;  3GLX A;  1SAU A;  4E7H A;  3E5U A;  3I4N J;  4CXF A;  1TNT A;  3DU6 A;  4S04 A;  1S7O A;  4XMY A;  2K9N A;  1XTA A;  1CF7 A;  2XF6 A;  5TRD A;  3KLO A;  1D1A A;  5M3F J;  2M7A A;  2EA2 A;  2KKO A;  4A69 C;  1ZYR F;  3WTT C;  3S2D J;  3M8J A;  3L09 A;  3MVP A;  3EUA A;  3SFZ A;  1E2X A;  4GDF A;  4BAC A;  5H2F C;  3RSN A;  2MLK A;  4KIS A;  5JHU A;  1VQN I;  2OQG A;  4KN7 X;  4FHT A;  4I98 B;  2RRE A;  2QBY B;  2HR3 A;  1S72 I;  3OYA A;  2LY9 A;  2VQG A;  2Z33 A;  1I39 A;  4F7Z A;  2XGD A;  1JTY A;  3CUO A;  2CUF A;  3ABT A;  1B1B A;  3K10 A;  1YJ9 I;  4L0Y B;  4CCL A;  1IN8 A;  2CMP A;  4G6Q A;  2NAZ A;  1DQU A;  4MTE A;  2ELJ A;  1FOW A;  3KP3 A;  5HLI A;  1MMD A;  1J75 A;  4IX7 A;  4OIQ F;  3LWF A;  1I3Q J;  4V2F A;  3K6G A;  1JI8 A;  3TO9 A;  2K3P A;  3HEF A;  3F6O A;  3HHH A;  5E1Z B;  5H6R A;  1JJ8 C;  1WSU A;  2DPU A;  1Z1D A;  2AHQ A;  4BS9 A;  5JVG F;  1HW1 A;  1Y1W J;  3DBR B;  5IT9 Z;  3BZ6 A;  3IKV A;  4UB8 C;  3JRG A;  2LOO A;  1R4M B;  4IKF A;  4JP0 A;  2FRH A;  2VJI A;  2DA1 A;  2GOM A;  4CGZ A;  4B47 A;  2JTV A;  2XB5 A;  1Y6I A;  4MIM A;  3JSO A;  2XF5 A;  3AAF A;  2LMD A;  3IWZ A;  4UB6 C;  1IO2 A;  3L2Q A;  5C4X J;  3FWE A;  4LD5 A;  2LFB A;  2COM A;  4A6E A;  3J7Z I;  1XS9 A;  3SZT A;  3GTP J;  5DS9 A;  4UUV A;  1YO5 C;  3BTI A;  1MMN A;  3V7R A;  3A0B C;  2LF7 A;  2E2I J;  2XF7 A;  3FMS A;  2HQN A;  3H9G A;  4B8X A;  2IGK A;  2VXZ A;  4HQE A;  1YLF A;  2ZSH B;  3BG7 A;  1FEX A;  2VQH A;  3CC7 I;  2STT A;  3AL0 C;  4B3X A;  5IP7 J;  3BC8 A;  1Q1H A;  3ZR8 X;  3D0S A;  1DUX C;  1VQ7 I;  5HNH A;  1FYL A;  3CCM I;  3WTV C;  4ON0 A;  4BXF A;  3WTW C;  3E0J B;  6PAX A;  2RNJ A;  1IAW A;  2R7R A;  2QCO A;  2QQ8 A;  1P4A A;  4XN3 A;  2DFI A;  4Y33 A;  5J6X A;  1W5S A;  1W0U A;  1DU0 A;  4Q5S F;  2L9V A;  2MGQ A;  3JAM K;  1NK3 P;  3G3Z A;  1B8I B;  3ZQH A;  5LRR A;  1YRN B;  4LK1 F;  5B1A H;  3R6S A;  3D5R C;  2NVT J;  3OYI A;  2KIS A;  3DTK A;  4XBF A;  4UV9 A;  4HLY A;  3TBI A;  1NH3 A;  1BA5 A;  3TED A;  2A05 A;  5HDN A;  4RDU A;  2L2O A;  3O3K A;  5FFZ A;  1P7J A;  2E1N A;  2Y75 A;  1TZL A;  4Y15 A;  4A3I J;  3CCR I;  4FX0 A;  3J7Y J;  3IL2 A;  1R22 A;  4YIR X;  2L01 A;  3ZMT A;  3GFL A;  2E2J J;  1S7A A;  1UEL B;  4KT5 C;  2MLG A;  1YW7 A;  4Y3O A;  4OIN F;  3ZMU A;  3HDD A;  2RAE A;  5GTH C;  1SFK A;  2R93 J;  3WE3 A;  3MCZ A;  4BHC A;  1HCR A;  1E3H A;  1TNS A;  2BY3 A;  1K7A A;  1YOV B;  1ZTR A;  3WHC A;  1IJW C;  3OR2 C;  3LMM A;  4BY1 J;  5EG0 B;  4ENK A;  1MNM C;  3UNG C;  1Z3X A;  1ZHF A;  2E7W A;  4NHJ A;  2DA5 A;  2QQ9 A;  1APL C;  3R61 A;  1X19 A;  3MFK A;  4MNU A;  2O03 A;  1ONV A;  2DJI A;  4ZJZ A;  3HPH A;  3FK7 A;  3I64 A;  2P6T A;  2O3F A;  3W6K B;  2JUC A;  1DGR M;  4K2E A;  2A6T A;  4JX4 A;  2LNB A;  1JGG A;  1K6O A;  4G12 A;  1R1U A;  5ICG A;  2L3D A;  5ILV A;  1CF7 B;  1HOM A;  1O7L A;  1JHF A;  2YR2 A;  4KMU X;  2KRF A;  1YYV A;  2V7F A;  2JSP A;  3BQY A;  4Y13 A;  3A03 A;  1S9H A;  4RLQ A;  3JTG A;  2OTJ I;  3LSR A;  2H6B A;  5D5W B;  3A02 A;  1ZR4 A;  2DFE A;  1W4M A;  3DV8 A;  3TP0 A;  3SDB A;  4WK8 F;  1KQ8 A;  2R3S A;  2V79 A;  1OKR A;  1EH6 A;  2DMN A;  1N78 A;  2V1X A;  2XPU A;  3JTH A;  2UZK A;  2XSD C;  4D9J A;  1SMY F;  3P5J A;  3HOS A;  3P9C A;  3WU1 B;  1K78 A;  3ECH A;  2RC4 A;  2M8G X;  3FXR A;  4XL9 A;  3AKZ A;  1R5I D;  1WJ5 A;  5EEG A;  1Z7L A;  1TW2 A;  2L7Z A;  1LQ1 A;  4IZZ A;  2Y48 A;  3F9K A;  4P96 A;  4KJZ A;  3GTJ J;  4XLF A;  1LUJ B;  4PJL A;  1QA6 A;  1MMG A;  3MKZ A;  1TWH J;  4KNY A;  1DP7 P;  1IRZ A;  2CQK A;  2K4J A;  2ZCW A;  3QPH A;  3SEZ A;  2WY7 Q;  2A6E F;  4CA0 A;  5K5O A;  1G3W A;  4U87 A;  4ASN A;  5L3E A;  4A3C J;  1O3S A;  2GLO A;  3NAR A;  4MEY F;  4ZYH A;  1I3A A;  5KAF C;  3S17 J;  4A3B J;  1MZB A;  1T6S A;  1T33 A;  3O2P E;  1OLT A;  1IGN A;  2NNY A;  3W2A A;  2KRH A;  2EV0 A;  5DV5 A;  4OIO F;  2HXO A;  2RKH A;  2HYG D;  1G4D A;  2OCC H;  1ZG1 A;  3HKZ A;  3BPX A;  2BBY A;  2DI3 A;  2VXD A;  4F91 B;  2Y2Z A;  2E5Z A;  1QQI A;  3DLL F;  3RZD J;  1YTY A;  3G2B A;  3ZMV A;  1YIJ I;  1YIT I;  4ANJ A;  4NC7 A;  2L02 A;  4HDU A;  4ZC3 A;  2K9S A;  3V42 A;  1SVL A;  1DU6 A;  3CDH A;  5DTD A;  3MZY A;  1T98 A;  3P7N A;  4RGU A;  3RKQ A;  4LB5 A;  5IY5 H;  2IBD A;  3KYD B;  1AWC A;  3KP7 A;  1TL8 A;  4HQM A;  3M1E A;  2G7U A;  4IHV A;  2O8X A;  5EEA A;  4CUG A;  1XGN A;  2VBX A;  3J81 K;  1E0E A;  2NVX J;  3PQJ A;  3AG3 H;  1OR7 A;  1GHC A;  3T8R A;  2EPF A;  2WTE A;  3IRQ A;  1T39 A;  3DP7 A;  1FBQ A;  2KDZ A;  4IJA A;  1PUF A;  1XMA A;  4FT8 A;  1TQI A;  3LA7 A;  2KZG A;  5D6E A;  1F36 A;  5BMZ A;  4PZJ A;  2KFD A;  3CJN A;  2A5W A;  4U0W A;  3TGN A;  2IT0 A;  4KIG A;  2R7S A;  2QWW A;  1LPQ A;  2UUZ A;  4EGZ A;  3ERM A;  2OZU A;  2CYY A;  1JKQ C;  3ZP5 A;  3U1D A;  2GIV A;  3E97 A;  3K2Z A;  4A5M A;  4HNV A;  2V6C A;  1YG2 A;  2EZH A;  2TDX A;  2ZJQ F;  2FU4 A;  5M5W J;  1FC3 A;  2HOE A;  3BTL A;  1GLN A;  3IH2 A;  5IP6 A;  1N25 A;  2F4O B;  2IS1 A;  3WTY C;  4EV0 A;  4Y7N J;  4LLN A;  2XAQ A;  4P9U A;  4X0G A;  3DEW A;  4L5E A;  4N9H A;  5IYB J;  2R5Y A;  3EUH C;  5DEQ A;  3HTS B;  2JPC A;  1MNE A;  4MFD A;  4XKW A;  3PIP F;  2Y9Y A;  3GBG A;  5F1R A;  2L7K A;  3ML6 A;  1FP1 D;  2LTP A;  3K4N A;  1ETK A;  1HKQ A;  3F8B A;  2K4B A;  1EF4 A;  3KZY A;  3M4O J;  3E6M A;  2CU7 A;  3BJA A;  3CO6 C;  5C4J J;  1WJB A;  1K6Y A;  1LVK A;  3KCC A;  2VBY A;  3TKY A;  2RGV A;  1VTN C;  4HDV A;  3CC4 I;  3EET A;  4ENN A;  3GVA A;  2V1D A;  5DD4 A;  3DU5 A;  3K4K A;  5EDN A;  2H27 A;  2B63 J;  3NQO A;  2VLA A;  2GA1 A;  5J8F A;  3QOE A;  2LVS A;  4HW0 A;  4AD9 A;  2WC2 A;  2ZXH A;  3IAM 2;  2GQQ A;  5EJC A;  4KDP A;  2HS5 A;  5KCM A;  5H6Q A;  4V2G A;  1TT0 A;  3MN2 A;  1K78 B;  2F5D A;  1DGW Y;  4CSW A;  1GVD A;  3CLO A;  4CIC A;  1ZN2 A;  2DO7 A;  4DZJ A;  3I5U A;  3PM1 A;  5M3M J;  3Q9V A;  2M4G A;  1GDT A;  5H20 A;  1F4K A;  2G7H A;  1ZLJ A;  3GFM A;  5E3N A;  2ZME C;  5E3O A;  2P81 A;  4JX5 A;  4XN0 A;  1PYV A;  1U8B A;  4OMY A;  2P7V B;  3GTQ J;  2FBH A;  2FQ4 A;  2L7M P;  1JTX A;  3RPU D;  2DA6 A;  5HLH A;  2ELH A;  3J80 K;  4H0E A;  1USS A;  3LSH A;  5JLW A;  2BZT A;  1RUN A;  2WV0 A;  4XLP F;  2ZXI A;  5FKN A;  3S14 J;  5B66 C;  2ZJ2 A;  4HF0 A;  3A2K A;  1R6R A;  2BHZ A;  3HOZ J;  2JVG A;  3SQN A;  4M74 A;  5E1W A;  4FE4 A;  1MJB A;  4H4K C;  1FNN A;  2X48 A;  2BY0 A;  1R7J A;  1BR2 A;  5EGO A;  4RBO A;  4LB6 B;  3G6E I;  3NAU A;  2PMH A;  3KEY A;  3LL7 A;  2BVL A;  1G6N A;  3S16 J;  5J3L A;  3GME A;  3N05 A;  2MAB A;  1NK2 P;  2NS0 A;  4A12 A;  2Z99 A;  5LRS A;  2L9N A;  3ZQF A;  3RJP A;  1LEA A;  4RB0 A;  2AXT C;  1PVE A;  4CO8 A;  3A4C A;  1OJL A;  2FML A;  1Z67 A;  5DCM A;  5JFR A;  1XSV A;  3S3O A;  5IP9 J;  1FOX A;  4XRS G;  4HPQ A;  4JOM A;  5IYD J;  4HZF A;  2VC0 A;  4C30 A;  3K4L A;  3KPH A;  1BOA A;  4A3K J;  1W7P D;  5F0F A;  3JR9 A;  3BQZ A;  2ESH A;  1LEB A;  4HBL A;  4DIQ A;  3WTS C;  2GXA A;  2GXG A;  4M3F A;  2BOL A;  4IF4 A;  4KN4 X;  1PUF B;  4B44 A;  1U8R A;  5J4Y A;  2HDC A;  4G8X A;  1UG0 A;  3J7A O;  1UHS A;  4IOA F;  1BIA A;  1LKX A;  2NXN B;  3BLY A;  3B6A A;  3RKX A;  3HOU J;  3VYU B;  3H5N A;  3V4G A;  4LIV A;  4A5N A;  3O8G A;  1HW2 A;  1AKH A;  2LY2 A;  1J2X A;  3I53 A;  3H3Z A;  4BBS J;  2XB0 X;  2DLL A;  2VIX A;  3VWB A;  2DJN A;  3Q5F A;  2VAS A;  3D5S C;  3DEU A;  3MQ0 A;  1ETW A;  4BDZ A;  2LY1 A;  3ABU A;  1ETV A;  5FFX A;  2X1D A;  2DTR A;  5ICF A;  4RAY A;  2EH3 A;  4D5F A;  1WJF A;  4UV8 A;  4KIB A;  4LK0 F;  2EZK A;  1Y1V J;  1O4X A;  1HKS A;  3HRT A;  4RGX A;  5LEK A;  2LLK A;  3I58 A;  1R58 A;  5B1B H;  2IGN A;  2HGC A;  4XSX F;  1YQA A;  4PGG A;  3LSM A;  4YFN F;  2R5Y B;  1O3Q A;  2ACJ A;  3K1P A;  3QPL A;  5DM6 F;  4L0Z B;  1BW6 A;  1ENH A;  3C7J A;  3HSE A;  3DBL B;  1FYK A;  1DP3 A;  3T0Y A;  1W36 C;  2HTS A;  5J1U A;  4BQO A;  5J8C A;  1VQO I;  3BR1 A;  4CZZ A;  4L9T A;  2VBZ A;  3M1C A;  1VND A;  4XK4 A;  2CW8 A;  5K5R A;  1FBS A;  4XLA A;  4PCQ A;  1YHQ I;  3JRD A;  4AIK A;  3BG3 A;  3MZ8 A;  1IV8 A;  4LG3 A;  2E1M C;  4JBA A;  3HRM A;  1JUS A;  1I50 J;  2F48 A;  1J09 A;  1TWC J;  1V5E A;  2UV1 A;  5CVI A;  2EIN H;  3TOA A;  4M6Y A;  1FOK A;  3BTJ A;  3C2B A;  4BQN A;  4Q47 A;  1EH8 A;  1XDU A;  2E7X A;  1LDK B;  2OJE D;  3F0C A;  2VUM J;  4EJV A;  5CPR B;  1LFB A;  1SD6 A;  4UY8 I;  2WAE A;  4IXA A;  3T5X A;  1JUP A;  1YFH A;  1UMQ A;  2D45 A;  3Q0W A;  3JRA A;  2HI3 A;  4BEH A;  2DA4 A;  5D5V B;  1X1D A;  2DW4 A;  4NC6 A;  1LNW A;  5TGT A;  1VQ6 I;  3L2U A;  3CUQ C;  4S0H B;  3JRF A;  1E17 A;  5F08 A;  4XLE A;  1YIO A;  1HDP A;  4DOZ A;  3OSG A;  1XB4 A;  3IKT A;  2XDV A;  2QQA A;  4GYI A;  2V9K A;  3V7C A;  3DPT A;  1Z05 A;  4FAS D;  3JRH A;  2VKH A;  4ZTF A;  2A6H F;  4I09 A;  3AFH A;  1X4O A;  3UR3 C;  2PX9 A;  2H8W A;  2VT2 A;  4HX7 A;  1SD5 A;  4Y52 J;  2Y0S A;  2ZNZ A;  2HQA A;  3H3V K;  3HOY J;  3ZQL A;  5L3G A;  4NQW A;  1F43 A;  5HS9 A;  4B4C A;  1Z77 A;  3VDX A;  1W5C C;  3RZO J;  1ZKG A;  2QSF X;  5EGO B;  5FD5 A;  3LNQ A;  4A3J J;  3MKL A;  5CLS A;  1HC8 A;  1GXP A;  2HOT A;  2EFQ A;  3PNV A;  3QP5 A;  1FLI A;  4A0Z A;  2Y31 A;  2JA6 J;  1UFM A;  3OYL A;  4G7Z F;  1IUY A;  3GYH X;  4J19 A;  2MC4 A;  2Q0O A;  4XON A;  2Y0M A;  2VJ5 A;  1T2K A;  3JSP A;  4OOI A;  5HNF A;  2ID3 A;  4M72 A;  5DCM B;  5DD8 A;  4BHB A;  2DTZ A;  4TV7 A;  2O8K A;  2NVQ J;  2VE9 A;  3QPT A;  3BP8 A;  4CDG A;  3H36 A;  2DOE A;  2XGE A;  1UB9 A;  1HW5 A;  1YW9 A;  4F3Q A;  4GFB A;  4ZDP A;  5L3F A;  2RVC A;  5CKT A;  1IXC A;  3O6B B;  1F9N A;  1HST A;  1YS6 A;  2ISY A;  2NS7 A;  4YIF A;  2GA2 A;  3PNY A;  3OR1 C;  2ECB A;  1RPW A;  1ZRC A;  5J1Y A;  2M30 A;  3Q0V A;  1MD0 A;  2W85 A;  4UVB A;  3CMY A;  2VT3 A;  2P5L C;  1UZC A;  3C2H A;  2R7O A;  4OAY A;  1AKH B;  3I4P A;  3C2G A;  3PNT A;  4KIC A;  4ZZL A;  4FQG A;  4M6V A;  2HKX A;  5FJ8 J;  2FEZ A;  1IN7 A;  2EWN A;  3E1S A;  2Q8K A;  1TLH B;  2OD5 A;  4XRF A;  2X6W A;  5BS6 A;  1G59 A;  3FXU A;  1VF9 A;  1M1E B;  2WBM A;  2HOA A;  1QZY A;  4A3F J;  4DJA A;  3P9I A;  4EJO A;  3PSI A;  1X2M A;  1D1C A;  5LHI A;  2CS3 A;  3H9J A;  2PN6 A;  1G3T A;  1B9N A;  1Q1V A;  2QKM B;  4E7S A;  1R23 A;  2BW3 B;  2V4J C;  2ZXW H;  2X1E A;  1MBK A;  1J7K A;  2OU2 A;  3VEP A;  2XAS A;  3K1N A;  2DA2 A;  1MW7 A;  3ZQ7 A;  2EIJ H;  2RDP A;  5E79 C;  5F6F A;  4ZYG A;  5IPA A;  2EFO A;  2K7L A;  2OV7 A;  4GXO A;  1REP C;  2DYR H;  1SVO A;  3C1D A;  3OOU A;  4E7L A;  1Z21 A;  3TP3 A;  5AON A;  1SFO J;  1DDN A;  4L9V A;  2WAD A;  1EKE A;  1LDJ A;  2X6O A;  2H1L A;  3DEE A;  1VI0 A;  4LOC A;  3OS0 A;  5HOD A;  3E6B A;  3E5Q A;  5L3B A;  3GF2 A;  1S6L A;  2H1K A;  3J7A Y;  1IW7 F;  2CUJ A;  3TDZ C;  4AVP A;  4I6Z A;  4B48 A;  1K61 A;  3VPR A;  1FY7 A;  1HBX G;  5FD6 A;  1MJ9 A;  2Z1D A;  1XX5 A;  5CVU A;  2ESN A;  4NC8 A;  3HBL A;  3HL2 A;  4BEH B;  3OYM A;  2EA4 A;  2RV8 A;  4IHT A;  3BR6 A;  3FZV A;  5BNG A;  3KZI C;  3W2W A;  2DXI A;  3HSR A;  2F4M B;  3CJT B;  4BDY A;  1MMS A;  1EA3 A;  3F8F A;  4E70 A;  3FHN A;  1D5Y A;  3HC7 A;  1XGM A;  3IWF A;  1JJ6 C;  4KUM A;  4AC0 A;  1XSX A;  4F92 B;  4UNO A;  4QLC U;  3AG4 H;  2IRF G;  4EGY A;  4HLX A;  2D5V A;  1XCV A;  1FP2 A;  3BR0 A;  5L3C A;  4BJ6 C;  2XVC A;  3CO7 C;  2HQ5 A;  2WV1 A;  4S05 A;  4CZC A;  4IVN A;  3DXJ F;  2X85 A;  1LFP A;  1MGT A;  2HDW A;  4OIP F;  1E3O C;  1QVU A;  4HOB A;  3VOD A;  3BWG A;  2K85 A;  4HX8 A;  2IW5 A;  2EB7 A;  3H5R A;  2Y9Z A;  5K5Q A;  5TIS C;  1PDN C;  4C9Y A;  3CMM A;  5EZG A;  4F93 B;  3LSJ A;  5TJJ A;  2BXZ A;  2P8T A;  4U88 A;  3JAM Z;  2ZFW A;  1RI7 A;  2DCE A;  1VQK I;  2QEN A;  2K9Q A;  2Q2E A;  2M7B A;  4O6J A;  2ZKZ A;  2L9R A;  4XIC A;  1ZRD A;  1OCT C;  2L4M A;  3KET A;  3L2W A;  2NVY J;  3N4M A;  2I5U A;  3WHB A;  4RM2 A;  2ZJP F;  2JT1 A;  5J40 A;  3HOV J;  2FUG 2;  2VKE A;  3C18 A;  1YE9 A;  1I1G A;  3VFZ A;  1X3U A;  4FCY A;  4RA2 A;  2A3S A;  3W2V A;  2N8G A;  2CO5 A;  3E6C C;  1Z0X A;  1T56 A;  3S3M A;  2E19 A;  4IOC F;  1QGP A;  4I7H A;  3GFJ A;  5EEH A;  2H6C A;  2K3F A;  2IGO A;  3F72 A; 
#chains in the Genus database with same CATH homology
 3CME I;  3CC7 I;  1VQP I;  4V19 K;  5GAE J;  1VQ7 I;  3CCM I;  3PIP F;  2H8W A;  2QA4 I;  1YJW I;  1QA6 A;  1YI2 I;  3G71 I;  1VQ5 I;  4IOA F;  2NXN B;  3CCJ I;  5GAD J;  3CCV I;  3CCU I;  1Y39 A;  3CC4 I;  1HC8 A;  2E35 A;  2E34 A;  3CCS I;  5GAH J;  2ZJR F;  3CCL I;  4IO9 F;  2FOW A;  3DLL F;  3CCR I;  3J7Y J;  1YIJ I;  1YIT I;  3CMA I;  1ACI A;  1VQN I;  5DM7 F;  3CJT B;  1YJN I;  1MMS A;  1S72 I;  5DM6 F;  1YJ9 I;  2E36 A;  3I56 I;  1FOW A;  1FOY A;  1VQO I;  2OTL I;  1VQ4 I;  1YHQ I;  1VQL I;  3CCE I;  2QEX I;  3CF5 F;  1VQ9 I;  3CCQ I;  1VQM I;  2JQ7 A;  3CC2 I;  5JVG F;  5GAG J;  3I55 I;  3CD6 I;  3PIO F;  1VQK I;  4UY8 I;  3G6E I;  2OTJ I;  2ZJQ F;  1VQ8 I;  2ZJP F;  3J7Z I;  1VQ6 I;  4IOC F;  3G4S I;  1FOX A;  2K3F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...