1VQOI

The structure of ccpmn bound to the large ribosomal subunit haloarcula marismortui
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
total genus 17
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 1vqoI00
1VQOI 1VQ4I 2NXNB 3G4SI 3I55I 3CCVI 1YJ9I 5DM6F 2JQ7A 1S72I 3CCSI 5GADJ 2E34A 3CCJI 3G6EI 3CCRI 1QA6A 1HC8A 1FOWA 3I56I 1FOXA 3CCLI 2ZJRF 1VQLI 2H8WA 1Y39A 3CC2I 1MMSA 2K3FA 3CCMI 4V19K 3CCQI 3CC4I 2E35A 3CCEI 1YHQI 1YITI 3CD6I 5GAHJ 5GAEJ 3DLLF 3G71I 3J7YJ 1YIJI 1VQ6I 2OTLI 3J7ZI 1VQ9I 1VQMI 3PIOF 3CMEI 4IOAF 1YI2I 2OTJI 1VQKI 1VQNI 1VQPI 2E36A 5GAGJ 2QA4I 1VQ8I 1VQ5I 3CCUI 3CMAI 4UY8I 4IO9F 1FOYA 5JVGF 1ACIA 2ZJQF 2FOWA 1YJNI 3CJTB 3PIPF 4IOCF 1VQ7I 2QEXI 3CC7I 5DM7F 2ZJPF 1YJWI 3CF5F
chains in the Genus database with same CATH superfamily
1QPMA 5F27A 1EKEA 1OYYA 3H9QA 3GFJA 5LRRA 4M6VA 3VYTB 5HLTA 3HDDA 1YRNA 4Q5SF 1GUUA 1J59A 3C7JA 4G6TB 3S1NJ 3P7NA 1ETQA 1U5TC 5D5WB 2AXTC 3WHCA 4AM3A 5E1XA 1QPIA 4CA0A 1GV2A 5ICGA 3I59B 1UB9A 2MLKA 4GYIA 1OCZH 4V2GA 4DIQA 4IZZA 5FD6A 2O5RA 2M8EA 3F8FA 3LSJA 4BE0A 2KJCA 2A5YB 2DA3A 4HX4A 2G7HA 2EILH 1IN5A 3BR3A 2STTA 3FHNA 2CMPA 4DYCA 3ZQQA 1Y0UA 4RAGA 3ISPA 5ERIA 2QUFA 4XQFA 3OYHA 4AD9A 3I59A 3U9GA 4N0BA 3ULQB 2FQ3A 3W6JB 3QU3A 2X9DA 3OS0A 3OS2A 1ZGAA 2V26A 1S29A 3I56I 4U7DA 4HRIA 1XMXA 3MKLA 1IUYA 3MKZA 4UUSB 3VFZA 4ITVA 5FB2A 1RI7A 3NQOA 4B3AA 2R7SA 4I98B 4KIFA 3OSFA 2ZXJA 3BY6A 4HQMA 2BOLA 3K4JA 3GWZA 3CMYA 3AL0C 2KLOA 3DXJF 2E1CA 2CV2A 2IW5A 4UUSA 4AIJA 2ZNZA 3I4PA 1FBQA 3MWMA 2BY2A 2K40A 1IRFA 2L9NA 3PIOF 4FE7A 1IXSB 3EUHC 1VQKI 1T56A 2ELKA 2LK2A 2R7OA 4OIPF 2UUZA 1LFPA 3VEPA 1FJLA 4C2TA 1XN7A 2MGQA 3KZYA 4BQQA 1FX7A 4LITA 4M71A 3JRHA 2GM4A 2VKHA 3QP5A 1U8BA 2R7DA 2M0MA 1OQYA 1W5TA 5FRMA 2CW7A 1IXCA 4G94A 3L1PA 1QZEA 1EV7A 3RYPA 4HOBA 2BHZA 4G7ZF 5M3FJ 2FEZA 4EGZA 2VE8A 5D5XB 2XVCA 1TQIA 2PQ8A 1G3TA 1M1EB 1FOYA 3WTSC 3MVPA 2A6HF 3K4KA 2PLYA 2FXAA 2CS3A 3HTUA 3PFYA 1LJ9A 1X19A 2JWTA 2LC2A 3C3WA 5F64A 2NNYA 1SD7A 4XRSG 3KCCA 4XRFA 2L02A 2R5ZB 2J5PA 3GLLA 1R49A 3L2UA 2Y9ZA 5K5QA 2RGVA 3BTJA 3M8EA 2VJ5A 4YIFA 2BY3A 3PNVA 4BEHB 1ZRCA 3F3XA 4WWCA 2IVMA 1KQ9A 2XASA 1X1AA 4QPOA 4XKCA 4F7ZA 5GTHC 4IRGA 3GTLJ 5TISC 2R5ZA 4FTHA 4Y13A 4WX9A 2UWMA 3LWFA 1U3EM 5GP9A 3TP0A 1V4RA 2HOAA 4BEHA 3KP4A 2VC0A 1HA8A 4IVNA 3JAMK 1IN7A 2DMPA 4A3MJ 2D1VA 2W84A 1APLC 3CMMA 3S2DJ 5DTDA 3ABLH 1R23A 2HU9A 2VOOA 4AVZA 4A3DJ 2EZLA 2NOJB 2GIVA 3ZCOA 5B1AH 2ZJRF 2YPRA 3BTLA 4CCOA 4L0ZB 5E18F 2LF7A 4IF4A 3HIFA 5IP9J 2ZXIA 2K02A 3HOUJ 2OA4A 3HM5A 2WAQN 3O6BB 2ZBKA 5E1ZB 2GZWA 5GAHJ 2OQGA 3WG9A 2V1XA 4S05A 1JXSA 5IYBJ 4FE4A 4KA4A 2R93J 5GPCA 1T8IA 2HDCA 1FP2A 3TOAA 2E1OA 1JE8A 2EZHA 1VQMI 1LEBA 4E7JA 4JX6A 1W5SA 2VKEA 4NC6A 1YI2I 4XOTA 5JLXA 2CFOA 1WKMA 1TQMA 1O3TA 2ECCA 4I0AA 2CH0A 3CF2A 3HB9A 1ZG3A 1JJ6C 1VQPI 3HRTA 3BPVA 2XKOA 4M9XA 5E3NA 3D5SC 2VKVA 3KP5A 2JZYA 2QQ9A 5H6RA 3FXLA 3RKXA 3EETA 3QODA 1V5GA 3OOPA 5JFRA 2DMUA 3EQLF 4XNFA 2WBMA 1UG0A 2PFBA 2XKPA 5DD4A 4LIVA 1ZH5A 3WE2A 2NVUB 2D45A 2W7NA 2E1NA 2O03A 5JVGF 4M72A 3PM1A 5FKNA 3CDIA 1XS9A 1QZYA 4W1UA 1LDJA 2TCTA 5HOOA 4NB5A 1I5ZA 2NVYJ 4XLNF 4WXHA 1NH3A 2OCCH 3IRRA 2LP0A 2H09A 3K4NA 1MZBA 4AYBN 1F5TA 3W2VA 5CKTA 1P6RA 4LLLA 3OV8A 1E17A 2R7XA 3IKVA 1YYVA 1U8RA 3LA2A 1Y8RB 2F48A 1EH6A 1LVKA 4XOPA 4FETA 4PJJA 5LEJA 1J0RA 2FMYA 3DU5A 1JUPA 3L09A 3DBLB 2Z5UA 2UXNA 2HTSA 2O9LA 4A2UA 1Q1HA 4OMYA 2DT7B 5BMZA 1R6RA 4IXAA 4MQ9F 4BY7J 2X4HA 4KYWA 3LMMA 2CUFA 4BBSJ 1O7LA 1FIPA 1IDYA 1YW7A 3ZXSA 2H1LA 4PDKA 2LY2A 2R7ZJ 1ZYRF 2OPTA 2EINH 2QYOA 1FYMA 4KDPA 4HNTA 3QQAA 4N9HA 5LLQA 5HNFA 1TNSA 2BVLA 3E5UA 2IRFG 2KKOA 3JR9A 5FKKA 3B73A 3ECHA 3I54A 4KIBA 1TWHJ 3JRFA 2VLAA 1QO0D 4PJ0C 2IGOA 1F36A 2JT1A 4BE2A 2QSFX 2E19A 1B72B 1FMVA 3ML6A 4XM3A 3FM5A 1YG2A 2JTVA 4XR6A 4M3GA 1ITYA 1A5JA 1QQIA 3H5NA 2RQQA 1VQ9I 2BY1A 2R3SA 1R58A 2HPIA 3BTCA 4IHYA 5K5RA 2LFBA 3O3KA 4E4HA 4BHCA 4RGUA 3IRQA 1SAUA 2QLZA 4KICA 3PQKA 1B72A 2X0LA 4IHWA 2JVGA 1JHHA 4LJZF 4YFKF 5J8FA 4E7KA 5DS9A 2VE9A 5A2QZ 4IHXA 2DW4A 3H1CA 5GAGJ 3E6CC 3B02A 1P7JA 3ESWB 1TC3C 2XUBA 4I0BA 4PJLA 4BXFA 4D9JA 3HL2A 4XICA 1OYWA 4KN4X 4UY8I 5E8GA 5E20A 2IA1A 1POGA 5ILSA 2W57A 2H94A 3BG7A 3C1DA 2LF8A 1SFXA 1WPKA 4OIQF 1XC5A 5EJCA 3WE3A 2E1MC 1W7PD 3HKZA 3RKWA 4A3EJ 3TOBA 2JVHA 1UCRA 3CJQB 4EJOA 2MC4A 5FLVA 4LMYA 3JRCA 2M4GA 2M4KA 3TEDA 1MH4A 4BUPA 1P7IA 3NAUA 2E2HJ 1XX5A 3O8GA 3EPZA 3T0YA 2KPMA 4HDVA 1SFEA 3HXLA 3PSFA 2VUMJ 4A3LJ 2XF7A 1D8JA 1G2HA 4L18B 1HKSA 3ZP5A 3IH3A 1YJ9I 1TLHB 1W0UA 1OR7A 1X1DA 3O2PE 4J00A 2DFEA 2FOKA 5IT9Z 2VASA 1N78A 2BXYA 1BR4A 3QPHA 1ETWA 5DCFA 4UV9A 4BHPA 2DTZA 4I6ZA 1FC3A 1UJ8A 2IXSA 2PJRB 5FLXZ 1D8KA 4BE1A 2A69F 4M3BA 3GUDA 5FD5A 2QVOA 2DDAA 3RQIA 3L2QA 3FK7A 5L3FA 1R9TJ 2WV1A 3LA3A 2B9SA 4NNJA 1D1AA 2LDUA 4AC0A 1IRZA 3H3UA 5IOYA 2BHYA 2HDWA 4EMSA 4DBRA 3IV5A 3FHZA 2PJRA 1B4AA 9ANTA 5D5VB 2FQ4A 1VQLI 4D0PA 4HAMA 4DZPA 4L9VA 1ZLKA 2KT0A 1Y8QB 3E5QA 4CGZA 1IG7A 4M74A 3LSRA 2Y2ZA 1S8NA 2G7UA 1ZLJA 3ZOBA 3SXYA 3SFZA 3N97A 3FXOA 3A0BC 4XLEA 5F04A 2JA7J 2Y75A 1TBXA 4BGDA 2YUSA 5DYMA 2L9RA 1HCRA 3J7ZI 3FK6A 2CJJA 2LBFB 2VI6A 4D5CA 5IP7J 3KP7A 3S2WA 1JUSA 1KU3A 4X6AJ 2IS4A 3QPLA 4RAFA 4U88A 3TL4X 5JI6A 3S3NA 2DMNA 2KP6A 1UAAA 1USTA 4IPAA 1VQNI 4BQOA 2HYJA 5K7HA 2VBYA 1STZA 2DJNA 2LBFA 3LAPA 2HOTA 2E2IJ 3M7GA 2F4IA 4XKWA 1V3FA 3W6VA 4BJTA 2COBA 5FFZA 3C18A 3E6DA 3B6AA 3SZGA 1BC7C 2A05A 1FT9A 1A35A 2BY0A 3FKIJ 4RM2A 3FISA 4TV7A 3ZMUA 3MZYA 3K1PA 4UB6C 3W2WA 4ZYDA 3DKXA 4Y7NJ 1MMAA 4M6XA 2L2OA 1ZG5A 1ACIA 3ZN1A 2L7KA 2ZFUA 2F4OB 2HOSA 3QOEA 2M7AA 1RNLA 1OYIA 3BDDA 2MLGA 2DCEA 1JKPC 2LG4A 1Z05A 1LB2A 1R36A 1LVAA 1WHUA 5K5OA 4CZZA 1WJ5A 2HKXA 1Z21A 3L00A 1LFBA 5HLIA 3Q0WA 4BYYA 3ABTA 3P9IA 4OIOF 5JLWA 2VQLA 3OY9A 4X0GA 1VTNC 4D1QA 4PJMA 5GADJ 3D5LA 3BROA 2Z16A 1N77A 4PZJA 1VNDA 3PL8A 1ORKA 3WODF 5HS8A 1BIAA 4O6JA 2X6XA 2XPVA 5EGOB 2VXZA 1H9GA 4A12A 4G6QA 4QWQA 1DPRA 5D6FA 2V79A 5LHIA 2LKSA 3OYDA 1SVMA 1DQUA 1D1CA 2VJ4A 3GZ5A 5EGOA 2O0YA 4XN0A 2XRNA 2EV6A 2DFIA 1MIJA 2Y0SA 4HZFA 4HEA2 2PMZA 4EATA 5CVJA 2WA0A 4JK1X 3JRBA 3CC4I 4IHTA 4UUVA 1XB4A 4CHUA 4LLNA 2EBIA 2STWA 5DEQA 1OISA 3WHBA 2DDBA 2XGXA 2HVRA 2K7LA 4A0XA 4B1RA 3CD6I 4IQ4A 3K70D 3TDZC 3DKWA 2YR2A 5FKOA 4EJWA 2DN0A 3GW2A 4H0EA 3KZIC 2GOMA 2FBHA 3H36A 3ONQA 1QVTA 2PEXA 1IF1A 3RZDJ 4UUTA 4GO1A 1SVOA 1N75A 4ASNA 1D1BA 2JN6A 2M2EA 3U1DA 4O3MA 3OR1C 3CMEI 1FLIA 1R71A 4KNYA 3MCZA 2M45A 2OTJI 5FFXA 1YFHA 1HDPA 3BQZA 5FLMJ 2IAIA 2M8GX 1GHCA 1T6SA 2JJ7A 3IUOA 3OIQA 2RKHA 2ZXHA 4UHTA 2E5ZA 2QA4I 1W36C 3QPTA 2LREA 2LVSA 1RESA 3J7AO 1YS7A 2FUG2 1O3SA 1EH8A 2EIKH 2EV5A 3ROUA 3E7LA 3DEEA 2Q2EB 2YS9A 3E6MA 3BPXA 3TW6A 4U0VA 4G8XA 3RPQA 1MW7A 3GCMA 2K3PA 4GDFA 3HYIA 5CPRB 3K9TA 5C4XJ 1HDDC 1KYWA 1W5CC 3BR0A 3H0GJ 1Z91A 3G1LA 1QU3A 4OAZA 3VDXA 1NG6A 3Q0UA 2DBBA 2Q2EA 1F9NA 4XONA 3CC7I 2P81A 3OYJA 2ZCWA 2QBYA 1ZELA 1YLFA 3F72A 5L3BA 2FJ1A 3N4MA 5LHHA 2XAQA 3UNGC 4I01A 3K10A 2IA2A 3GTMJ 2KHMA 2PJPA 4B3XA 1ZR2A 5F1RA 5B66C 3TO9A 5HLGA 4RDUA 2E71A 3PO2J 3JSOA 4LLGF 1MNMC 3CCJI 2Z33A 3S14J 3LA7A 3I4NJ 2HVQA 4MHGA 1Z67A 1SFOJ 2WWYA 4L5JA 2N8GA 4Y15A 2R7UA 4M9ZA 3BWGA 2IP2A 1FOXA 1LE8B 2K27A 2CQXA 1KZHA 4DJAA 1V55H 3VPRA 3H5AA 2H6CA 1EA3A 1TWAJ 5H6QA 4A93J 2VQGA 2P5KA 2LLKA 4XSZF 2M9HA 1Z7LA 1X4OA 4V19K 4JQFA 3HPGA 2E5NA 3KLNA 1LE8A 2UV1A 2Y48A 5EG0B 1O3RA 4KMUX 4HG2A 1BJAA 1PYVA 1DP3A 5GAEJ 3RJPA 4S04A 3VYUB 3J7YJ 4BAYA 3BJAA 3LSGA 1YIJI 3F8NA 1IGNA 3A1YA 3CUQB 2CYYA 4FCYA 4DOZA 4C2MJ 3SHFA 3IH4A 5EG0A 1RUNA 1Y1WJ 3ZQIA 4A3FJ 4C9YA 1NK2P 3ZQ7A 2TRTA 3PUBA 4PSWA 2RVCA 3UR3C 4KITB 3O8HA 4BQAA 2QM3A 2R7FA 1JKRC 4ESBA 4IX7A 2E36A 3OIPA 3MD2A 3MKWB 4A3KJ 3PFIA 1R1VA 4EJUA 2DOFA 2FE3A 3HGYA 3ZN0A 2VC1A 3I58A 3TO6A 3H5RA 1WJCA 3RTRA 2KIFA 4KN7X 3J7AY 4OMZA 4A3GJ 3S3OA 1X58A 2Y31A 3TQNA 3GZNB 2GQQA 3I71A 1AU7A 3F9KA 1D3YA 5E79C 1IDZA 1ZGJA 2IPQX 2G0EA 4G9YA 3FIWA 3HSFA 4LFUA 4RGSA 1FY7A 1PUEE 2ZMEB 1X2MA 2KIMA 3KEYA 3NWSA 4IOCF 5CVUA 2CSOA 4I02A 4F93B 4BKXA 3GTQJ 3K6GA 1BA5A 2L01A 2R7WA 2R7QA 1D5VA 1B9MA 1YX5A 3M8FA 5BOXA 1ZR4A 5KNLA 4A3IJ 2ZKZA 4P9FA 2ZMEA 3FXKA 1VZ0A 2HI3A 1VQ4I 2VBZA 4AIKA 4BJ6C 2BVMA 3I55I 5L3CA 1ZN2A 3D0SA 5LRSA 2JRMA 4RB0A 4FQGA 1T95A 2JUGA 2WB1A 5HNHA 2HVSA 2JMWA 2XGDA 2XSJC 1ZKGA 2MC3A 4IQJA 3FKJA 4EQQA 1RR8C 1JTYA 1WI9A 4ZDLA 1NK3P 3L2WA 3OSGA 3W3CA 4MEXF 1WH5A 2XPWA 3HOWJ 2V1UA 3KYLA 4KMFA 2ELJA 4L9NA 1IAWA 5B5EC 5JHFA 4A3JJ 3VYSB 2V6EA 2DI3A 1J2XA 1ONVA 1D0XA 3Q5FA 3RI4A 4U0WA 4OWRB 2BZTA 2EA2A 5LEKA 4ESJA 2OF7A 3HOTA 3BP8A 4A5NA 3BC8A 4NBQA 3HG9A 1V5EA 5A2QK 2EZIA 2QENA 3K7AJ 1YW8A 2Y30A 3S32A 1Y0NA 3BCAA 1JKQC 2X6WA 3T8RA 4CUGA 1FTTA 3IC7A 4BY1J 1MMNA 4L5IA 5E3MA 4D7NA 4DNCA 4J19A 2P6SA 1K6YA 2FNPA 4YG2F 2HNHA 2NVTJ 2OAZA 1S7EA 2HXIA 4I7HA 2ZB9A 3E6BA 1U2WA 5J1RA 5ILVA 4HNVA 4BACA 2NNNA 2A07F 3WGIA 1GVDA 2LY9A 4B8XA 4EM1A 1MSEC 5E3LA 4F3QA 1PUFB 1XSVA 1RC9A 4P96A 2MH9A 3LSIA 5IYDJ 2L4MA 2IGKA 5F0FA 3V7SA 1T0FA 3QRFF 2BEOA 2WAFA 2H6BA 3FXUA 4G6DA 2XGEA 4BNCA 1J75A 4DQ2A 2QSHX 4IO9F 1TTYA 5IT9K 2XAUA 5FGMA 3WTWC 4GFBA 1L0OC 1ENHA 2DT6A 3KP2A 1C0WA 5TRDA 2BGCA 1HW2A 5FLXK 1K79A 3SDBA 5F0HA 1DGRM 2AQEA 5IYCJ 3ZQGA 3CF5F 4BDYA 1JGGA 1DU0A 1FBSA 1LDKB 1TZLA 4HV5A 1H0MA 2W48A 3CJRB 3CP2A 3HSEA 4HNUA 2VQHA 2OBPA 1DDNA 3G4SI 2K4BA 2XB0X 4RBOA 3K0LA 2L3DA 5ICCA 1S9HA 5DM6F 4A6DA 2JQ7A 1UHMA 4KIGA 3VODA 1I3QJ 1G3SA 3CCSI 2ISYA 3A0HC 1LNWA 2M30A 2R7TA 3BG5A 2CQ7A 2CRGA 2HGCA 4EJVA 3WTTC 4II3A 1LUJB 2XAJA 3GTJJ 3J81Z 2E34A 3LNQA 2K4JA 2P4WA 2EWNA 3FXMA 4B09A 2O6GE 1FMWA 2ESNA 4A6EA 3RCOA 5GPAA 4ZH4F 2HEOA 2HZDA 3V4GA 3ZRGA 5IP6A 3DFGA 4UV8A 1IN6A 2CQNA 3F6VA 3PQJA 4ZC3A 4RA2A 4BU2A 1QNTA 2PI0A 3KIOA 2K9LA 2JPBA 1FEXA 1FYLA 1HF0A 3FX3A 4ENJA 1TT0A 5J40A 1MJ9A 1O4XA 1TW3A 1JUMA 4Y17A 3MZHA 2RV8A 4CCJA 2D2WA 2P7VB 1YHQI 2F5FA 3GTGJ 1X3UA 2DK5A 5E17F 3DLLF 2QKLB 1YIOA 3ABKH 2CW8A 2MG4A 1MD0A 3ZMTA 2EZKA 1U9NA 3CP8A 4FISA 5JVTA 1YX3A 4ENNA 2R7RA 5C44J 3M07A 4LK0F 2ECBA 1Y1VJ 3ASOH 1FIAA 4JOMA 3PO3J 4PJNA 2COMA 2R0QC 2NOGA 3GFIA 2Z1DA 3S1RJ 4Y52J 3OMYA 3JTHA 2WC2A 3A2KA 3FMRA 3SYTA 2XSDC 1J9IA 1HLVA 3GVAA 2JUCA 3JSPA 3HRMA 3BJ6A 3R6SA 1IUFA 1ZAOA 1IJWC 1E2XA 4ON0A 2GOXB 1RETA 4ZTJA 3G1OA 3KFWX 2W24A 1RZ4A 1ZRDA 3CMAI 4IRHA 1WSUA 4WXCA 1TWCJ 1USSA 2VL8A 2ZSIB 4JBAA 2VT3A 4HDUA 4PGHA 5D8KB 1G8XA 2F2EA 1ERDA 4LG3A 4BQNA 1LEAA 2EFPA 4DYRA 3F0CA 4A0ZA 1ZGWA 1OJLA 1FOKA 1XTAA 1QHGA 1PJRA 4XSXF 3OYNA 1KU7A 2Y0SN 3S16J 3GLXA 1R5ID 2PMZN 4R8HA 3WTZA 3OYIA 6PAXA 2DOEA 1XCBA 2YX7A 4B44A 2IBDA 4DW6A 3WTVC 2QZ8A 3BZ6A 4DYQA 1H89C 1ZREA 4HV6A 4XLPF 2JSPA 4FX4A 3JREA 1UFMA 1JJ8C 2DMQA 3K4MA 4C3JJ 5CJ9A 4E7LA 1EH7A 1O3QA 4P9UA 3QOPA 4L9JA 5ILUA 2WTEA 2LYCA 3S1QJ 5BPDA 3Q3SA 2NYXA 4I2OA 2FX0A 5DDGA 4HF1A 5HDGA 2EIMH 3E3VA 1BW5A 1JI8A 3BOQA 1S6LA 3REOA 4DBQA 3HZJA 1B59A 2KRHA 2JA8J 2EIJH 2EFOA 3RKYA 3R0JA 4EM0B 5KHDA 2EK5A 5TGTA 5IOZA 3DTIA 2RC4A 4MIMA 2RDPA 4I99C 1PVEA 2A68F 3V42A 4MNUA 2HQNA 3SFIA 1EJ9A 4RAYA 1Z6TA 1YO5C 2ICWG 3EDPA 3LSPA 3BJOA 4CCMA 3TMOA 5D4SA 4XN3A 3RYRA 4RM3A 3TDUC 2NS8A 3H0DA 2KZGA 3ZR8X 3GTPJ 1VQ6I 4N9IA 4IRIA 2JA6J 4CICA 4RB1A 5C3EJ 1KYZA 2L5QA 4NQWB 4WCGA 2X1EA 4LIUA 4OOIA 5DD8A 4NC8A 2DA6A 3H3ZA 3WG7H 1FPQA 2VPRA 2WAEA 3OL3A 3WGHA 3WTUC 1OCPA 1QRYA 3BR6A 3EUKL 3F8CA 1U5TB 4XK4A 3TW7A 4M6YA 3ZQLA 1X1PA 2J5OA 3L7WA 2F4MB 4RGXA 4IHSA 3RQ4A 3WU0A 2KDZA 1D5YA 2W4SA 1AOYA 3K70C 1OCOH 1IXRC 1WVRA 2VOPA 1BBYA 3CCUI 3M3YJ 2X85A 3RPUA 4E7IA 1BL0A 1SEUA 1E3OC 1OCCH 1U5TA 1ZK8A 3WTYC 2GLOA 1JHFA 3GF2A 1G59A 4AIDA 1TW2A 1YJNI 2VBXA 5DCMB 3ZQFA 1A6IA 3WU2C 4JX5A 1ETKA 1HKQA 5DUKA 4WK8F 1SD6A 3KEOA 4RLQA 5DUIA 4QTRA 3JCUC 3V7RA 3AL0B 2RN7A 5IPAA 1MBFA 3FDYA 4XORA 1S72I 3TKYA 3CTAA 1K4SA 2WADA 2EV0A 5B3SH 5H20A 4MTEA 2IEKA 1RR7A 2IT0A 3KZZA 2L0KA 3H3VK 1BIBA 1XPXA 2R7VA 4KISA 2QQAA 4PFPA 2GXAA 2BE5F 1T2KA 2I8DA 2XROA 1HC8A 2ESHA 2DYRH 1RKTA 2HYFA 2EJRA 2VQCA 4HF0A 5EEGA 1A6QA 4GCVA 2K85A 2R5YB 4HQEA 2OJED 3IH2A 1IRXA 1PP7U 4ZYEA 4CYCB 3HSRA 3HOYJ 3EUHA 3NWTA 2XPUA 2MW8A 4HPQA 1SD5A 1V5FA 4XKVA 3CCMI 1U0JA 4CDGA 4LGWA 2E35A 1GDTA 3M9AA 3S15J 2P0WA 4CYCA 1K61A 1U9OA 2KIUA 3DKYA 4LD5A 3E1SA 1B8IB 3HEFA 2CV0A 1E3HA 1SVLA 2VONA 2MSYA 4IEJA 1BR2A 2Z2SB 1MNEA 3DCFA 1SFUA 2O8KA 2BV6A 2KFDA 3DPLC 3G3ZA 2B7EA 3H92A 3K2ZA 5F1JA 4RB3C 3JTGA 1NG7A 3V8LA 1UELB 4LOCA 2MBFA 1XSXA 2F5EA 5J3LA 3B6CA 4F55A 4PCQA 1XGNA 1XSDA 1F4KA 2IS2A 2JA2A 3LOCA 5B1BH 3TP3A 4BDZA 1ZHFA 2DO7A 3DPTA 3NARA 2HFHA 2PG4A 2PBIA 1ZG1A 1F1ZA 3K4CA 2FNAA 5LBQA 3BT9A 3FXQA 1Q1VA 2BYVE 2M34A 3FMSA 1P4AA 3HHGA 4BH9A 1X4PA 2PX9A 3OS1A 3FBIB 2VIXA 2ZJQF 4MQVA 2FOWA 3I4MJ 5CVVA 3JW4A 4P1WA 3ECOA 3ERMA 2K5CA 2GIZA 1ZTRA 2QKMB 1WWXA 4XLHA 2BXZA 5F0CA 2ZC2A 2M87A 4GYGA 3ABUA 4C30A 4ZZDA 5LFAA 2LKXA 3JRGA 4L5EA 2Q1ZB 1J09A 5J6XA 3QP6A 1UZCA 1OFCX 1FSEA 4MTDA 3SZPA 2O8XA 2NXNB 1TNTA 2D1HA 1WJEA 4N4NB 4UNOA 3I0TA 4ZZLA 1FBUA 4BBRJ 3T5XA 3EYYA 2Q8KA 2DA7A 4MLOA 1R1TA 2V4JC 4EEFG 1YOVB 1SAXA 2ME6A 2XAFA 2YSRA 2AO9A 2CUEA 2ZXWH 3LSTA 3AG3H 3BR1A 1S7OA 3H9JA 4B48A 3CCRI 4H4KC 1IN4A 3D1NI 4M9SA 3KEQA 2ID6A 2Y9YA 2HS5A 2FD5A 3VB2A 3MKYB 1R22A 1LPQA 1WZ2A 2KRFA 1KQ8A 3FF5A 1AWCA 2HWVA 3DTKA 1VI0A 4R1HA 5ICFA 3CC2I 1OR7C 4Q47A 2KQRA 5KVRA 2GBYA 2MFZA 2PMUA 2F5CA 4NDLA 2VJIA 5FKLA 1WFXA 4LG0B 2XHKA 2KRCA 2LTPA 2LY1A 2W82A 1P4WA 2DA5A 2EQRA 4PFOA 3CDHA 4OIRF 5LGUA 2VB6A 2CFXA 2NS0A 1GT0C 4HW0A 4ZYAA 3ZQHA 4ZDPA 1H8AC 2OD5A 2P7CB 4LG0A 5L3DA 4UB8C 1ON1A 1YTYA 1I1SA 1RRJA 1P4XA 3U2RA 1B6AA 2ID3A 3CZ6A 1P9QC 1Y6IA 4CO8A 4HF2A 2HKOA 3OYFA 4C3IJ 1KQ0A 3C2GA 4BJ5C 2IGMA 5BS6A 1UHWA 3I3LA 4KJZA 3AG4H 4DZJA 3FZVA 1FWZA 1ZARA 2DA4A 5TJJA 1LKXA 1SMYF 3BG9A 3BCBA 1R1UA 2L4AA 1YE9A 1OCRH 4XLFA 3K1MA 4M3EA 2K9NA 2CO5A 2RREA 3DEUA 3Q9VA 1I6HJ 3L2VA 1I3AA 1P92A 2NS7A 5DV5A 2XF6A 5ED4A 1K78B 1TQPA 4UXNA 2IS6A 4XL9A 2PMHA 4NHJA 2X48A 1D0ZA 4Z6YA 3J81K 4XRSA 5KAIC 3CUQA 4YEJA 3VSKA 1S5LC 1KU2A 4UVCA 2AXLA 2KMUA 1K78A 1WJFA 2M1BA 5K1YA 3LFUA 1OKRA 1ETYA 3J80Z 3CUOA 3GTKJ 3WU1B 4G12A 1WGXA 4FHTA 3BLYA 1QZZA 2WY8Q 2ETHA 1MJAA 1G6NA 1R7JA 5IY5H 3V8KA 3HOXJ 2B63J 1MBEA 1MH3A 1O7FA 4F92B 2ZJ2A 3I53A 2DODA 1OPCA 2VBWA 1E3PA 3FXRA 5HVQC 4QLCU 1W36D 5CVIA 3P9CA 1WH7A 2X6OA 3FBNB 4MEYF 4AWXB 1CGPA 1PDNC 2CQQA 2K9MA 3CO7C 3EYIA 3DWLE 1DPUA 3U21A 4X1EA 5IT3A 5EF6A 2A6TA 3BG3A 2FRHA 2KL4A 2VKDA 1GXPA 1MBJA 4XIDA 3F21A 2ELHA 2W25A 2DPUA 2GXGA 4M73A 3SQNA 1KU9A 4S0HB 1H9TA 3DQVC 1BI2A 1HXDA 3GZ6A 5FRNA 2ZFWA 2RNGA 2RNJA 3GYHX 1FYKA 3IKTA 1KGSA 1FZPB 2HQAA 3I9V2 2QGUA 1YITI 3KE2A 4Y33A 1WJDA 2HZTA 3LFKA 2E1MB 5BQTA 2MD0A 3PUFA 1LDDA 5HODA 3ZQCA 2CQKA 4A3CJ 3VOEA 4MGRA 5M5XJ 1Z6RA 4IL6C 2HYGD 2OTLI 2EH3A 1NHAA 4I09A 2DOAA 2NVXJ 2DQRA 2JSCA 3KYCB 4E70A 1QVUA 2HXOA 3A4CA 4XMYA 2IJLA 2DA1A 4M3DA 4EM2A 1D0YA 2Q0OA 4YRVA 3IAM2 4IJAA 4XLCA 1X1BA 2DK8A 3I5UA 1HQCA 4RAZA 1QHHD 3DV8A 5K7ZA 2CGPA 3HKZN 3I64A 2CW0F 5E1WA 5CYVA 2A61A 2P5LC 5J4YA 1TT5B 1W1WE 2ME0A 4DGWB 3OYMA 1ETOA 4YELA 4XBFA 2UXXA 2L7FP 3RPUD 5CQEA 1DP7P 1IZ1A 2AHQA 4XLAA 1X3WB 3EUAA 5LGNA 1J5YA 1Z3XA 2VN2A 3OYKA 2UZKA 2R4GA 2OU2A 2H27A 4XKBA 1HW5A 2D5VA 3Q9SA 1RPWA 5D8LB 4R79A 2ACJA 3QYBA 3AKZA 1VQ7I 1K83J 5D4RA 4WXDA 2FSWA 2ISZA 1GXQA 2ZJPF 4M3FA 2F6CA 2KIQA 2DMTA 1B1BA 5HLHA 3E97A 2FMLA 4AIHA 2RQPA 4AU7A 3UKGA 1HOMA 3CCVI 1SMTA 4KT5C 2GXBA 1J7KA 1PUFA 1S3JA 2YU9J 2NVQJ 3MZ8A 3GTOJ 1Z9CA 3HHHA 4E6KG 2CV1A 4J01A 1H88C 1ON2A 2A6EF 3TGNA 2KISA 5LD2C 3G6EI 2JA5J 1EF4A 3F6OA 5KAFC 1UHSA 3L9FA 1S7AA 2CU7A 1IRGA 2G9WA 2QQ8A 3H9GA 2NRAC 1RKWA 2B0LA 3GXOA 3DEWA 2XDVA 1QBJA 4PUSA 2V9PA 2O61A 1GV5A 3U1KA 5E3OA 3M4OJ 2X51A 3G2BA 3KP6A 5AIPA 3ZPLA 2V9KA 3M1CA 4P55A 2EFWA 2GA1A 1O57A 3BZCA 3E0JB 4ENKA 3CCEI 1MBHA 3LSKA 1QGPA 1G3WA 4B47A 5BNGA 1YS6A 3V8JA 1FP1D 4ZYGA 3JRDA 4MFDA 2E7WA 3CLOA 3IWZA 1AA7A 3LAJA 2P6TA 1TWFJ 1MBGA 4FX0A 2DT5A 2WV0A 2MABA 1KONA 2L54A 2ZO4A 4IOAF 2CUZA 3HGGA 3LQRA 4LB6B 2CWEA 5F6FA 3IHUA 3AG2H 2DLLA 2OZUA 1Z7UA 3NEUA 5J4VA 3MMYB 2IA0A 1A36A 2XAHA 3DLAA 1BOAA 1X3ZB 3CJNA 1R5HA 2L9SA 1V54H 4HX7A 2OCEA 3KPHA 3GO5A 3JRAA 2E60A 2DQLA 3MQ0A 3KLOA 2EA4A 2I10A 1T38A 2Z9OA 1VQ5I 3TO7A 3DBHB 1HSTA 1ZQ3P 4L9TA 1JT6A 3BQYA 1LFUP 2VJJA 1FTZA 3RDIA 3QYEA 5HS7A 2KJBA 2C6YA 2QSGX 3ZGKA 2QF7A 3BZKA 3L2RA 4HA8A 3PIPF 1A31A 2IS1A 3HBLA 4KT6A 2JK3A 1E0EA 3VSLA 2QEXI 3CUQC 3MFKA 1SC7A 1NTCA 3PSIA 3K1NA 5AONA 2V9VA 1YJWI 3G73A 2X1CA 4HBLA 2DFHA 5E8IA 2A3SA 2XIGA 4P5OA 1BC8C 4LB5A 3OYEA 1VQOI 1DGWY 2RAEA 4A5MA 4BXXJ 3OYGA 3FM3A 2L7ZA 4CZCA 2JPCA 4K2EA 4EJTA 5LHGA 4QPQA 1SANA 1XGSA 3CDLA 4HSTA 1R4MB 4B4CA 1YW9A 3S93A 3COAC 3SDGA 3HOSA 3RIRA 1G4DA 1DU6A 2JRTA 2ZNYA 5L3EA 2DU9A 3HRUA 3VYRB 3ZMDA 2BBYA 2HR3A 3BTIA 2I5UA 3OYAA 1QA6A 4OINF 2LMDA 2FU4A 2DFFA 2DJIA 3HOZJ 3K69A 1DUXC 2W85A 1FOWA 2ZMEC 1IV8A 2EFNA 3CCLI 4GGGA 2F5DA 1TP4A 3WGGA 2QCOA 4O5VA 3M8JA 3LL7A 2EB7A 4EV0A 5J1YA 3FXJA 5BPIA 4YIIA 1OCTC 4PSXA 4NUBA 2NAZA 2V1DA 2EFQA 2GA2A 5J47A 3CCQI 4JYKA 4ZTFA 2HTJA 3CCYA 4XRMA 2E2JJ 5M5WJ 2Y0MA 2V1NA 2MD5A 3DTEA 4V2FA 3JAMZ 4OAYA 5L3GA 3G71I 2M7BA 1IO2A 1JT0A 3GMEA 1G3YA 4I76A 1JTXA 3S2HJ 1T98A 1JGSA 2Z3YA 3X2QH 3S17J 1BM9A 5EEAA 3C2HA 4D5FA 4U0YA 4JP0A 4QIWN 4QSHA 3QWLA 3ZMSA 5F08A 3KP3A 1MMDA 1T39A 2XGCA 2Y69H 3R61A 4Q48A 3E5XA 2DYSH 4FASD 4YFXF 1B9NA 3ASNH 2HPMA 4CCNA 2MH2A 4JX4A 2HQ5A 2O7OA 3BR5A 3IL2A 4W97A 1KA8A 1OMIA 2M5WA 2CUJA 1HSJA 2DTRA 3HJEA 1ZRFA 4EGYA 3CLQA 3W6KB 4PGGA 3QAHA 2A5WA 3RKQA 1L3LA 2WAQA 1Z0XA 4PK4A 1XDUA 3R4KA 3A01B 1PP8F 3CJTB 2DAOA 2EPFA 4E7HA 2LSOA 3HOVJ 3GFMA 3MEXA 1XCVA 3QU6A 1I6XA 4NQWA 5K7FA 1K4TA 2H8RA 1T0FC 1ETXA 3A01A 2K86A 3S3MA 4BL0B 4RLFA 1XMKA 2OUMA 3DPUA 3PJRA 4G7OF 3S8PA 1JKOC 3D5RC 1T33A 3LQQA 4LK1F 1SD4A 5CQGA 5CLSA 2AQFA 1CF7B 4RS8A 2XC7A 4HX8A 2MYSA 2XB5A 1W0TA 1BI1A 2X1DA 1U78A 3IP4B 4U7BA 1P2FA 3KX2A 3MAJA 4GRIA 3SEZA 4ABZA 1TL8A 4F91B 3OL4A 2WY7Q 1CF7A 2VXDA 3F8MA 5JHUA 5LGTA 5DCMA 5GTIC 4AVPA 3DF8A 4NC7A 4C2UA 1BI0A 4CYDA 4MO7A 4ZDOA 1XD7A 2OC6A 2H8WA 1Y39A 3IWFA 3M1EA 1IV6A 2P5VA 4BHBA 4A3BJ 1ODDA 1YQAA 4ZJZA 3CO6C 4D7MA 4CXFA 3V7CA 2VPLA 1I27A 4UVBA 3SEQA 4WF2A 2W1OA 2PN6A 4AYBA 2IGNA 5FO5A 5KK1A 3HC7A 1R5GA 1BI3A 2LKPA 4CCKA 2M3AA 5KCMA 4G7HF 5JR3A 2DA2A 1X1CA 1UMQA 2OZ6A 1BJZA 4FT8A 2V7FA 1R4NB 1XG1A 1XDSA 3F23A 1BW6A 2R5YA 1I50J 4IHVA 4ANJA 3TBIA 1HBXG 1MKMA 1RUOA 1MGTA 1K7AA 2H1KA 2QQBA 3DBRB 3R60A 3P9KA 4CCLA 3P5JA 3J80K 1VQ8I 2W00A 1I39A 3AG1H 2E7XA 2MA3A 4ETSA 3W2AA 1WJAA 4Z2YA 1B8IA 1MDMB 2Z99A 4IKFA 1MMGA 1XMAA 3FWEA 1RIOH 2L7MP 2V6CA 5J8CA 5HDNA 1A04A 1GVJA 2WB1N 3CESA 4BXUA 3KYDB 1VF9A 3ELKA 1XGOA 3HTSB 3C2BA 2DPDA 5M5YJ 1WJBA 3CQZJ 3BG6A 1MDMA 3OOUA 1MSFC 4N4OB 4L0YB 1AHDP 1K6OA 1IW7F 4RGRA 4U87A 2R92J 3QPSA 1IN8A 4KFCA 1AKHB 1Z1DA 3ZMZA 1VFCA 3T8TA 2KZVA 2OV7A 3IAS2 4EVIA 3ZMVA 3ERED 3HUGB 5ICEA 3GBGA 1HW1A 4ZYHA 3MN2A 5FROA 5FJ8J 4HLYA 3OYLA 2FA5A 5M3MJ 1TWGJ 2GWRA 1X2NA 3F8BA 5EZGA 4HSRA 3F22A 1AKHA 1SFKA 1BR1A 3L2CA 4HLXA 4Y4RA 2XV4S 2K9SA 3DP7A 1I1GA 4B43A 3AAFA 3KETA 3HUGA 2LD5A 1MJBA 1ULYA 5CVRA 3K4BA 2VODA 1WRJA 4A69C 4AUXA 2AS5F 2BW3B 2K9QA 3GX4X 3HPHA 1BOBA 1MMSA 2QWWA 5FKMA 2K3FA 5EDNA 4A0YA 2M0CA 1Y56A 3NRVA 5EZHA 1WCMJ 1WQ2A 1LQ1A 1FSHA 3G1MA 2HQRA 4YIRX 2FF4A 3SJMA 2LH9A 2BW3A 3R0AA 5HDKA 1OLTA 2KDOA 3Q0VA 1Z3YA 3A02A 3PNYA 4RB2C 2HOEA 3VWBA 1GLNA 4Q4ZF 2LR8A 1REPC 2TDXA 1ETVA 2LRDA 5EYRA 3OR2C 2YX4A 2P8TA 3FMQA 3WTXC 1MNDA 4II2A 2FBIA 4KUMA 2QBYB 3OIOA 2OQRA 4RMNA 2ZSHB 3OYCA 3K4LA 3A03A 2YU3A 4E7ZA 3GFLA 3JRIA 3RSNA 2VT2A 2DXIA 4CH7A 3AFHA 3BR2A 2LNBA 4F52A 1F43A 5C4JJ 5J1UA 5D5UB 1T08B 3S1MJ 5HS9A 2FBKA 1FNNA 4Y3OA 1N25A 3QYFA 1Z77A 1W7PB 2LOOA 2XAGA 4YFNF 3GEZA 2GAUA 1HKTA 4ESFA 1CQTA 3H35A 4HYEA 4UVAA 3OYBA 1WI3A 2HDDA 4C3HJ 3PNTA 1U6GA 3N05A 4ENMA 5H2FC 3DU6A 3OWTA 3LSMA 2X6YA 2L9VA 4BS9A 1W7PA 3RZOJ 4OU0A 5D6EA 5EEHA 1BN5A 3K2AA 1IC8A 1YRNB 4GXOA 3HRSA 2XRLA 2ADUA 2CG4A 1XGMA 1R00A 2F5VA 4MFEA 2XF5A 3SZTA 1MBKA 5AIQA 4CSWA 4E7SA 3ABMH 2O3FA 1W4MA 5DM7F 1UG2A 3T1BA 3LSHA
chains in the Genus database with same CATH topology
1VQOI 1VQ4I 2NXNB 3G4SI 3I55I 3CCVI 1YJ9I 5DM6F 2JQ7A 1S72I 3CCSI 5GADJ 2E34A 3CCJI 3G6EI 3CCRI 1QA6A 1HC8A 1FOWA 3I56I 1FOXA 3CCLI 2ZJRF 1VQLI 2H8WA 1Y39A 3CC2I 1MMSA 2K3FA 3CCMI 4V19K 3CCQI 3CC4I 2E35A 3CCEI 1YHQI 1YITI 3CD6I 5GAHJ 5GAEJ 3DLLF 3G71I 3J7YJ 1YIJI 1VQ6I 2OTLI 3J7ZI 1VQ9I 1VQMI 3PIOF 3CMEI 4IOAF 1YI2I 2OTJI 1VQKI 1VQNI 1VQPI 2E36A 5GAGJ 2QA4I 1VQ8I 1VQ5I 3CCUI 3CMAI 4UY8I 4IO9F 1FOYA 5JVGF 1ACIA 2ZJQF 2FOWA 1YJNI 3CJTB 3PIPF 4IOCF 1VQ7I 2QEXI 3CC7I 5DM7F 2ZJPF 1YJWI 3CF5F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQO I;  1VQ4 I;  2NXN B;  3G4S I;  3I55 I;  3CCV I;  1YJ9 I;  5DM6 F;  2JQ7 A;  1S72 I;  3CCS I;  5GAD J;  2E34 A;  3CCJ I;  3G6E I;  3CCR I;  1QA6 A;  1HC8 A;  1FOW A;  3I56 I;  1FOX A;  3CCL I;  2ZJR F;  1VQL I;  2H8W A;  1Y39 A;  3CC2 I;  1MMS A;  2K3F A;  3CCM I;  4V19 K;  3CCQ I;  3CC4 I;  2E35 A;  3CCE I;  1YHQ I;  1YIT I;  3CD6 I;  5GAH J;  5GAE J;  3DLL F;  3G71 I;  3J7Y J;  1YIJ I;  1VQ6 I;  2OTL I;  3J7Z I;  1VQ9 I;  1VQM I;  3PIO F;  3CME I;  4IOA F;  1YI2 I;  2OTJ I;  1VQK I;  1VQN I;  1VQP I;  2E36 A;  5GAG J;  2QA4 I;  1VQ8 I;  1VQ5 I;  3CCU I;  3CMA I;  4UY8 I;  4IO9 F;  1FOY A;  5JVG F;  1ACI A;  2ZJQ F;  2FOW A;  1YJN I;  3CJT B;  3PIP F;  4IOC F;  1VQ7 I;  2QEX I;  3CC7 I;  5DM7 F;  2ZJP F;  1YJW I;  3CF5 F; 
#chains in the Genus database with same CATH topology
 1QPM A;  5F27 A;  1EKE A;  1OYY A;  3H9Q A;  3GFJ A;  5LRR A;  4M6V A;  3VYT B;  5HLT A;  3HDD A;  1YRN A;  4Q5S F;  1GUU A;  1J59 A;  3C7J A;  4G6T B;  3S1N J;  3P7N A;  1ETQ A;  1U5T C;  5D5W B;  2AXT C;  3WHC A;  4AM3 A;  5E1X A;  1QPI A;  4CA0 A;  1GV2 A;  5ICG A;  3I59 B;  1UB9 A;  2MLK A;  4GYI A;  1OCZ H;  4V2G A;  4DIQ A;  4IZZ A;  5FD6 A;  2O5R A;  2M8E A;  3F8F A;  3LSJ A;  4BE0 A;  2KJC A;  2A5Y B;  2DA3 A;  4HX4 A;  2G7H A;  2EIL H;  1IN5 A;  3BR3 A;  2STT A;  3FHN A;  2CMP A;  4DYC A;  3ZQQ A;  1Y0U A;  4RAG A;  3ISP A;  5ERI A;  2QUF A;  4XQF A;  3OYH A;  4AD9 A;  3I59 A;  3U9G A;  4N0B A;  3ULQ B;  2FQ3 A;  3W6J B;  3QU3 A;  2X9D A;  3OS0 A;  3OS2 A;  1ZGA A;  2V26 A;  1S29 A;  3I56 I;  4U7D A;  4HRI A;  1XMX A;  3MKL A;  1IUY A;  3MKZ A;  4UUS B;  3VFZ A;  4ITV A;  5FB2 A;  1RI7 A;  3NQO A;  4B3A A;  2R7S A;  4I98 B;  4KIF A;  3OSF A;  2ZXJ A;  3BY6 A;  4HQM A;  2BOL A;  3K4J A;  3GWZ A;  3CMY A;  3AL0 C;  2KLO A;  3DXJ F;  2E1C A;  2CV2 A;  2IW5 A;  4UUS A;  4AIJ A;  2ZNZ A;  3I4P A;  1FBQ A;  3MWM A;  2BY2 A;  2K40 A;  1IRF A;  2L9N A;  3PIO F;  4FE7 A;  1IXS B;  3EUH C;  1VQK I;  1T56 A;  2ELK A;  2LK2 A;  2R7O A;  4OIP F;  2UUZ A;  1LFP A;  3VEP A;  1FJL A;  4C2T A;  1XN7 A;  2MGQ A;  3KZY A;  4BQQ A;  1FX7 A;  4LIT A;  4M71 A;  3JRH A;  2GM4 A;  2VKH A;  3QP5 A;  1U8B A;  2R7D A;  2M0M A;  1OQY A;  1W5T A;  5FRM A;  2CW7 A;  1IXC A;  4G94 A;  3L1P A;  1QZE A;  1EV7 A;  3RYP A;  4HOB A;  2BHZ A;  4G7Z F;  5M3F J;  2FEZ A;  4EGZ A;  2VE8 A;  5D5X B;  2XVC A;  1TQI A;  2PQ8 A;  1G3T A;  1M1E B;  1FOY A;  3WTS C;  3MVP A;  2A6H F;  3K4K A;  2PLY A;  2FXA A;  2CS3 A;  3HTU A;  3PFY A;  1LJ9 A;  1X19 A;  2JWT A;  2LC2 A;  3C3W A;  5F64 A;  2NNY A;  1SD7 A;  4XRS G;  3KCC A;  4XRF A;  2L02 A;  2R5Z B;  2J5P A;  3GLL A;  1R49 A;  3L2U A;  2Y9Z A;  5K5Q A;  2RGV A;  3BTJ A;  3M8E A;  2VJ5 A;  4YIF A;  2BY3 A;  3PNV A;  4BEH B;  1ZRC A;  3F3X A;  4WWC A;  2IVM A;  1KQ9 A;  2XAS A;  1X1A A;  4QPO A;  4XKC A;  4F7Z A;  5GTH C;  4IRG A;  3GTL J;  5TIS C;  2R5Z A;  4FTH A;  4Y13 A;  4WX9 A;  2UWM A;  3LWF A;  1U3E M;  5GP9 A;  3TP0 A;  1V4R A;  2HOA A;  4BEH A;  3KP4 A;  2VC0 A;  1HA8 A;  4IVN A;  3JAM K;  1IN7 A;  2DMP A;  4A3M J;  2D1V A;  2W84 A;  1APL C;  3CMM A;  3S2D J;  5DTD A;  3ABL H;  1R23 A;  2HU9 A;  2VOO A;  4AVZ A;  4A3D J;  2EZL A;  2NOJ B;  2GIV A;  3ZCO A;  5B1A H;  2ZJR F;  2YPR A;  3BTL A;  4CCO A;  4L0Z B;  5E18 F;  2LF7 A;  4IF4 A;  3HIF A;  5IP9 J;  2ZXI A;  2K02 A;  3HOU J;  2OA4 A;  3HM5 A;  2WAQ N;  3O6B B;  2ZBK A;  5E1Z B;  2GZW A;  5GAH J;  2OQG A;  3WG9 A;  2V1X A;  4S05 A;  1JXS A;  5IYB J;  4FE4 A;  4KA4 A;  2R93 J;  5GPC A;  1T8I A;  2HDC A;  1FP2 A;  3TOA A;  2E1O A;  1JE8 A;  2EZH A;  1VQM I;  1LEB A;  4E7J A;  4JX6 A;  1W5S A;  2VKE A;  4NC6 A;  1YI2 I;  4XOT A;  5JLX A;  2CFO A;  1WKM A;  1TQM A;  1O3T A;  2ECC A;  4I0A A;  2CH0 A;  3CF2 A;  3HB9 A;  1ZG3 A;  1JJ6 C;  1VQP I;  3HRT A;  3BPV A;  2XKO A;  4M9X A;  5E3N A;  3D5S C;  2VKV A;  3KP5 A;  2JZY A;  2QQ9 A;  5H6R A;  3FXL A;  3RKX A;  3EET A;  3QOD A;  1V5G A;  3OOP A;  5JFR A;  2DMU A;  3EQL F;  4XNF A;  2WBM A;  1UG0 A;  2PFB A;  2XKP A;  5DD4 A;  4LIV A;  1ZH5 A;  3WE2 A;  2NVU B;  2D45 A;  2W7N A;  2E1N A;  2O03 A;  5JVG F;  4M72 A;  3PM1 A;  5FKN A;  3CDI A;  1XS9 A;  1QZY A;  4W1U A;  1LDJ A;  2TCT A;  5HOO A;  4NB5 A;  1I5Z A;  2NVY J;  4XLN F;  4WXH A;  1NH3 A;  2OCC H;  3IRR A;  2LP0 A;  2H09 A;  3K4N A;  1MZB A;  4AYB N;  1F5T A;  3W2V A;  5CKT A;  1P6R A;  4LLL A;  3OV8 A;  1E17 A;  2R7X A;  3IKV A;  1YYV A;  1U8R A;  3LA2 A;  1Y8R B;  2F48 A;  1EH6 A;  1LVK A;  4XOP A;  4FET A;  4PJJ A;  5LEJ A;  1J0R A;  2FMY A;  3DU5 A;  1JUP A;  3L09 A;  3DBL B;  2Z5U A;  2UXN A;  2HTS A;  2O9L A;  4A2U A;  1Q1H A;  4OMY A;  2DT7 B;  5BMZ A;  1R6R A;  4IXA A;  4MQ9 F;  4BY7 J;  2X4H A;  4KYW A;  3LMM A;  2CUF A;  4BBS J;  1O7L A;  1FIP A;  1IDY A;  1YW7 A;  3ZXS A;  2H1L A;  4PDK A;  2LY2 A;  2R7Z J;  1ZYR F;  2OPT A;  2EIN H;  2QYO A;  1FYM A;  4KDP A;  4HNT A;  3QQA A;  4N9H A;  5LLQ A;  5HNF A;  1TNS A;  2BVL A;  3E5U A;  2IRF G;  2KKO A;  3JR9 A;  5FKK A;  3B73 A;  3ECH A;  3I54 A;  4KIB A;  1TWH J;  3JRF A;  2VLA A;  1QO0 D;  4PJ0 C;  2IGO A;  1F36 A;  2JT1 A;  4BE2 A;  2QSF X;  2E19 A;  1B72 B;  1FMV A;  3ML6 A;  4XM3 A;  3FM5 A;  1YG2 A;  2JTV A;  4XR6 A;  4M3G A;  1ITY A;  1A5J A;  1QQI A;  3H5N A;  2RQQ A;  1VQ9 I;  2BY1 A;  2R3S A;  1R58 A;  2HPI A;  3BTC A;  4IHY A;  5K5R A;  2LFB A;  3O3K A;  4E4H A;  4BHC A;  4RGU A;  3IRQ A;  1SAU A;  2QLZ A;  4KIC A;  3PQK A;  1B72 A;  2X0L A;  4IHW A;  2JVG A;  1JHH A;  4LJZ F;  4YFK F;  5J8F A;  4E7K A;  5DS9 A;  2VE9 A;  5A2Q Z;  4IHX A;  2DW4 A;  3H1C A;  5GAG J;  3E6C C;  3B02 A;  1P7J A;  3ESW B;  1TC3 C;  2XUB A;  4I0B A;  4PJL A;  4BXF A;  4D9J A;  3HL2 A;  4XIC A;  1OYW A;  4KN4 X;  4UY8 I;  5E8G A;  5E20 A;  2IA1 A;  1POG A;  5ILS A;  2W57 A;  2H94 A;  3BG7 A;  3C1D A;  2LF8 A;  1SFX A;  1WPK A;  4OIQ F;  1XC5 A;  5EJC A;  3WE3 A;  2E1M C;  1W7P D;  3HKZ A;  3RKW A;  4A3E J;  3TOB A;  2JVH A;  1UCR A;  3CJQ B;  4EJO A;  2MC4 A;  5FLV A;  4LMY A;  3JRC A;  2M4G A;  2M4K A;  3TED A;  1MH4 A;  4BUP A;  1P7I A;  3NAU A;  2E2H J;  1XX5 A;  3O8G A;  3EPZ A;  3T0Y A;  2KPM A;  4HDV A;  1SFE A;  3HXL A;  3PSF A;  2VUM J;  4A3L J;  2XF7 A;  1D8J A;  1G2H A;  4L18 B;  1HKS A;  3ZP5 A;  3IH3 A;  1YJ9 I;  1TLH B;  1W0U A;  1OR7 A;  1X1D A;  3O2P E;  4J00 A;  2DFE A;  2FOK A;  5IT9 Z;  2VAS A;  1N78 A;  2BXY A;  1BR4 A;  3QPH A;  1ETW A;  5DCF A;  4UV9 A;  4BHP A;  2DTZ A;  4I6Z A;  1FC3 A;  1UJ8 A;  2IXS A;  2PJR B;  5FLX Z;  1D8K A;  4BE1 A;  2A69 F;  4M3B A;  3GUD A;  5FD5 A;  2QVO A;  2DDA A;  3RQI A;  3L2Q A;  3FK7 A;  5L3F A;  1R9T J;  2WV1 A;  3LA3 A;  2B9S A;  4NNJ A;  1D1A A;  2LDU A;  4AC0 A;  1IRZ A;  3H3U A;  5IOY A;  2BHY A;  2HDW A;  4EMS A;  4DBR A;  3IV5 A;  3FHZ A;  2PJR A;  1B4A A;  9ANT A;  5D5V B;  2FQ4 A;  1VQL I;  4D0P A;  4HAM A;  4DZP A;  4L9V A;  1ZLK A;  2KT0 A;  1Y8Q B;  3E5Q A;  4CGZ A;  1IG7 A;  4M74 A;  3LSR A;  2Y2Z A;  1S8N A;  2G7U A;  1ZLJ A;  3ZOB A;  3SXY A;  3SFZ A;  3N97 A;  3FXO A;  3A0B C;  4XLE A;  5F04 A;  2JA7 J;  2Y75 A;  1TBX A;  4BGD A;  2YUS A;  5DYM A;  2L9R A;  1HCR A;  3J7Z I;  3FK6 A;  2CJJ A;  2LBF B;  2VI6 A;  4D5C A;  5IP7 J;  3KP7 A;  3S2W A;  1JUS A;  1KU3 A;  4X6A J;  2IS4 A;  3QPL A;  4RAF A;  4U88 A;  3TL4 X;  5JI6 A;  3S3N A;  2DMN A;  2KP6 A;  1UAA A;  1UST A;  4IPA A;  1VQN I;  4BQO A;  2HYJ A;  5K7H A;  2VBY A;  1STZ A;  2DJN A;  2LBF A;  3LAP A;  2HOT A;  2E2I J;  3M7G A;  2F4I A;  4XKW A;  1V3F A;  3W6V A;  4BJT A;  2COB A;  5FFZ A;  3C18 A;  3E6D A;  3B6A A;  3SZG A;  1BC7 C;  2A05 A;  1FT9 A;  1A35 A;  2BY0 A;  3FKI J;  4RM2 A;  3FIS A;  4TV7 A;  3ZMU A;  3MZY A;  3K1P A;  4UB6 C;  3W2W A;  4ZYD A;  3DKX A;  4Y7N J;  1MMA A;  4M6X A;  2L2O A;  1ZG5 A;  1ACI A;  3ZN1 A;  2L7K A;  2ZFU A;  2F4O B;  2HOS A;  3QOE A;  2M7A A;  1RNL A;  1OYI A;  3BDD A;  2MLG A;  2DCE A;  1JKP C;  2LG4 A;  1Z05 A;  1LB2 A;  1R36 A;  1LVA A;  1WHU A;  5K5O A;  4CZZ A;  1WJ5 A;  2HKX A;  1Z21 A;  3L00 A;  1LFB A;  5HLI A;  3Q0W A;  4BYY A;  3ABT A;  3P9I A;  4OIO F;  5JLW A;  2VQL A;  3OY9 A;  4X0G A;  1VTN C;  4D1Q A;  4PJM A;  5GAD J;  3D5L A;  3BRO A;  2Z16 A;  1N77 A;  4PZJ A;  1VND A;  3PL8 A;  1ORK A;  3WOD F;  5HS8 A;  1BIA A;  4O6J A;  2X6X A;  2XPV A;  5EGO B;  2VXZ A;  1H9G A;  4A12 A;  4G6Q A;  4QWQ A;  1DPR A;  5D6F A;  2V79 A;  5LHI A;  2LKS A;  3OYD A;  1SVM A;  1DQU A;  1D1C A;  2VJ4 A;  3GZ5 A;  5EGO A;  2O0Y A;  4XN0 A;  2XRN A;  2EV6 A;  2DFI A;  1MIJ A;  2Y0S A;  4HZF A;  4HEA 2;  2PMZ A;  4EAT A;  5CVJ A;  2WA0 A;  4JK1 X;  3JRB A;  3CC4 I;  4IHT A;  4UUV A;  1XB4 A;  4CHU A;  4LLN A;  2EBI A;  2STW A;  5DEQ A;  1OIS A;  3WHB A;  2DDB A;  2XGX A;  2HVR A;  2K7L A;  4A0X A;  4B1R A;  3CD6 I;  4IQ4 A;  3K70 D;  3TDZ C;  3DKW A;  2YR2 A;  5FKO A;  4EJW A;  2DN0 A;  3GW2 A;  4H0E A;  3KZI C;  2GOM A;  2FBH A;  3H36 A;  3ONQ A;  1QVT A;  2PEX A;  1IF1 A;  3RZD J;  4UUT A;  4GO1 A;  1SVO A;  1N75 A;  4ASN A;  1D1B A;  2JN6 A;  2M2E A;  3U1D A;  4O3M A;  3OR1 C;  3CME I;  1FLI A;  1R71 A;  4KNY A;  3MCZ A;  2M45 A;  2OTJ I;  5FFX A;  1YFH A;  1HDP A;  3BQZ A;  5FLM J;  2IAI A;  2M8G X;  1GHC A;  1T6S A;  2JJ7 A;  3IUO A;  3OIQ A;  2RKH A;  2ZXH A;  4UHT A;  2E5Z A;  2QA4 I;  1W36 C;  3QPT A;  2LRE A;  2LVS A;  1RES A;  3J7A O;  1YS7 A;  2FUG 2;  1O3S A;  1EH8 A;  2EIK H;  2EV5 A;  3ROU A;  3E7L A;  3DEE A;  2Q2E B;  2YS9 A;  3E6M A;  3BPX A;  3TW6 A;  4U0V A;  4G8X A;  3RPQ A;  1MW7 A;  3GCM A;  2K3P A;  4GDF A;  3HYI A;  5CPR B;  3K9T A;  5C4X J;  1HDD C;  1KYW A;  1W5C C;  3BR0 A;  3H0G J;  1Z91 A;  3G1L A;  1QU3 A;  4OAZ A;  3VDX A;  1NG6 A;  3Q0U A;  2DBB A;  2Q2E A;  1F9N A;  4XON A;  3CC7 I;  2P81 A;  3OYJ A;  2ZCW A;  2QBY A;  1ZEL A;  1YLF A;  3F72 A;  5L3B A;  2FJ1 A;  3N4M A;  5LHH A;  2XAQ A;  3UNG C;  4I01 A;  3K10 A;  2IA2 A;  3GTM J;  2KHM A;  2PJP A;  4B3X A;  1ZR2 A;  5F1R A;  5B66 C;  3TO9 A;  5HLG A;  4RDU A;  2E71 A;  3PO2 J;  3JSO A;  4LLG F;  1MNM C;  3CCJ I;  2Z33 A;  3S14 J;  3LA7 A;  3I4N J;  2HVQ A;  4MHG A;  1Z67 A;  1SFO J;  2WWY A;  4L5J A;  2N8G A;  4Y15 A;  2R7U A;  4M9Z A;  3BWG A;  2IP2 A;  1FOX A;  1LE8 B;  2K27 A;  2CQX A;  1KZH A;  4DJA A;  1V55 H;  3VPR A;  3H5A A;  2H6C A;  1EA3 A;  1TWA J;  5H6Q A;  4A93 J;  2VQG A;  2P5K A;  2LLK A;  4XSZ F;  2M9H A;  1Z7L A;  1X4O A;  4V19 K;  4JQF A;  3HPG A;  2E5N A;  3KLN A;  1LE8 A;  2UV1 A;  2Y48 A;  5EG0 B;  1O3R A;  4KMU X;  4HG2 A;  1BJA A;  1PYV A;  1DP3 A;  5GAE J;  3RJP A;  4S04 A;  3VYU B;  3J7Y J;  4BAY A;  3BJA A;  3LSG A;  1YIJ I;  3F8N A;  1IGN A;  3A1Y A;  3CUQ B;  2CYY A;  4FCY A;  4DOZ A;  4C2M J;  3SHF A;  3IH4 A;  5EG0 A;  1RUN A;  1Y1W J;  3ZQI A;  4A3F J;  4C9Y A;  1NK2 P;  3ZQ7 A;  2TRT A;  3PUB A;  4PSW A;  2RVC A;  3UR3 C;  4KIT B;  3O8H A;  4BQA A;  2QM3 A;  2R7F A;  1JKR C;  4ESB A;  4IX7 A;  2E36 A;  3OIP A;  3MD2 A;  3MKW B;  4A3K J;  3PFI A;  1R1V A;  4EJU A;  2DOF A;  2FE3 A;  3HGY A;  3ZN0 A;  2VC1 A;  3I58 A;  3TO6 A;  3H5R A;  1WJC A;  3RTR A;  2KIF A;  4KN7 X;  3J7A Y;  4OMZ A;  4A3G J;  3S3O A;  1X58 A;  2Y31 A;  3TQN A;  3GZN B;  2GQQ A;  3I71 A;  1AU7 A;  3F9K A;  1D3Y A;  5E79 C;  1IDZ A;  1ZGJ A;  2IPQ X;  2G0E A;  4G9Y A;  3FIW A;  3HSF A;  4LFU A;  4RGS A;  1FY7 A;  1PUE E;  2ZME B;  1X2M A;  2KIM A;  3KEY A;  3NWS A;  4IOC F;  5CVU A;  2CSO A;  4I02 A;  4F93 B;  4BKX A;  3GTQ J;  3K6G A;  1BA5 A;  2L01 A;  2R7W A;  2R7Q A;  1D5V A;  1B9M A;  1YX5 A;  3M8F A;  5BOX A;  1ZR4 A;  5KNL A;  4A3I J;  2ZKZ A;  4P9F A;  2ZME A;  3FXK A;  1VZ0 A;  2HI3 A;  1VQ4 I;  2VBZ A;  4AIK A;  4BJ6 C;  2BVM A;  3I55 I;  5L3C A;  1ZN2 A;  3D0S A;  5LRS A;  2JRM A;  4RB0 A;  4FQG A;  1T95 A;  2JUG A;  2WB1 A;  5HNH A;  2HVS A;  2JMW A;  2XGD A;  2XSJ C;  1ZKG A;  2MC3 A;  4IQJ A;  3FKJ A;  4EQQ A;  1RR8 C;  1JTY A;  1WI9 A;  4ZDL A;  1NK3 P;  3L2W A;  3OSG A;  3W3C A;  4MEX F;  1WH5 A;  2XPW A;  3HOW J;  2V1U A;  3KYL A;  4KMF A;  2ELJ A;  4L9N A;  1IAW A;  5B5E C;  5JHF A;  4A3J J;  3VYS B;  2V6E A;  2DI3 A;  1J2X A;  1ONV A;  1D0X A;  3Q5F A;  3RI4 A;  4U0W A;  4OWR B;  2BZT A;  2EA2 A;  5LEK A;  4ESJ A;  2OF7 A;  3HOT A;  3BP8 A;  4A5N A;  3BC8 A;  4NBQ A;  3HG9 A;  1V5E A;  5A2Q K;  2EZI A;  2QEN A;  3K7A J;  1YW8 A;  2Y30 A;  3S32 A;  1Y0N A;  3BCA A;  1JKQ C;  2X6W A;  3T8R A;  4CUG A;  1FTT A;  3IC7 A;  4BY1 J;  1MMN A;  4L5I A;  5E3M A;  4D7N A;  4DNC A;  4J19 A;  2P6S A;  1K6Y A;  2FNP A;  4YG2 F;  2HNH A;  2NVT J;  2OAZ A;  1S7E A;  2HXI A;  4I7H A;  2ZB9 A;  3E6B A;  1U2W A;  5J1R A;  5ILV A;  4HNV A;  4BAC A;  2NNN A;  2A07 F;  3WGI A;  1GVD A;  2LY9 A;  4B8X A;  4EM1 A;  1MSE C;  5E3L A;  4F3Q A;  1PUF B;  1XSV A;  1RC9 A;  4P96 A;  2MH9 A;  3LSI A;  5IYD J;  2L4M A;  2IGK A;  5F0F A;  3V7S A;  1T0F A;  3QRF F;  2BEO A;  2WAF A;  2H6B A;  3FXU A;  4G6D A;  2XGE A;  4BNC A;  1J75 A;  4DQ2 A;  2QSH X;  4IO9 F;  1TTY A;  5IT9 K;  2XAU A;  5FGM A;  3WTW C;  4GFB A;  1L0O C;  1ENH A;  2DT6 A;  3KP2 A;  1C0W A;  5TRD A;  2BGC A;  1HW2 A;  5FLX K;  1K79 A;  3SDB A;  5F0H A;  1DGR M;  2AQE A;  5IYC J;  3ZQG A;  3CF5 F;  4BDY A;  1JGG A;  1DU0 A;  1FBS A;  1LDK B;  1TZL A;  4HV5 A;  1H0M A;  2W48 A;  3CJR B;  3CP2 A;  3HSE A;  4HNU A;  2VQH A;  2OBP A;  1DDN A;  3G4S I;  2K4B A;  2XB0 X;  4RBO A;  3K0L A;  2L3D A;  5ICC A;  1S9H A;  5DM6 F;  4A6D A;  2JQ7 A;  1UHM A;  4KIG A;  3VOD A;  1I3Q J;  1G3S A;  3CCS I;  2ISY A;  3A0H C;  1LNW A;  2M30 A;  2R7T A;  3BG5 A;  2CQ7 A;  2CRG A;  2HGC A;  4EJV A;  3WTT C;  4II3 A;  1LUJ B;  2XAJ A;  3GTJ J;  3J81 Z;  2E34 A;  3LNQ A;  2K4J A;  2P4W A;  2EWN A;  3FXM A;  4B09 A;  2O6G E;  1FMW A;  2ESN A;  4A6E A;  3RCO A;  5GPA A;  4ZH4 F;  2HEO A;  2HZD A;  3V4G A;  3ZRG A;  5IP6 A;  3DFG A;  4UV8 A;  1IN6 A;  2CQN A;  3F6V A;  3PQJ A;  4ZC3 A;  4RA2 A;  4BU2 A;  1QNT A;  2PI0 A;  3KIO A;  2K9L A;  2JPB A;  1FEX A;  1FYL A;  1HF0 A;  3FX3 A;  4ENJ A;  1TT0 A;  5J40 A;  1MJ9 A;  1O4X A;  1TW3 A;  1JUM A;  4Y17 A;  3MZH A;  2RV8 A;  4CCJ A;  2D2W A;  2P7V B;  1YHQ I;  2F5F A;  3GTG J;  1X3U A;  2DK5 A;  5E17 F;  3DLL F;  2QKL B;  1YIO A;  3ABK H;  2CW8 A;  2MG4 A;  1MD0 A;  3ZMT A;  2EZK A;  1U9N A;  3CP8 A;  4FIS A;  5JVT A;  1YX3 A;  4ENN A;  2R7R A;  5C44 J;  3M07 A;  4LK0 F;  2ECB A;  1Y1V J;  3ASO H;  1FIA A;  4JOM A;  3PO3 J;  4PJN A;  2COM A;  2R0Q C;  2NOG A;  3GFI A;  2Z1D A;  3S1R J;  4Y52 J;  3OMY A;  3JTH A;  2WC2 A;  3A2K A;  3FMR A;  3SYT A;  2XSD C;  1J9I A;  1HLV A;  3GVA A;  2JUC A;  3JSP A;  3HRM A;  3BJ6 A;  3R6S A;  1IUF A;  1ZAO A;  1IJW C;  1E2X A;  4ON0 A;  2GOX B;  1RET A;  4ZTJ A;  3G1O A;  3KFW X;  2W24 A;  1RZ4 A;  1ZRD A;  3CMA I;  4IRH A;  1WSU A;  4WXC A;  1TWC J;  1USS A;  2VL8 A;  2ZSI B;  4JBA A;  2VT3 A;  4HDU A;  4PGH A;  5D8K B;  1G8X A;  2F2E A;  1ERD A;  4LG3 A;  4BQN A;  1LEA A;  2EFP A;  4DYR A;  3F0C A;  4A0Z A;  1ZGW A;  1OJL A;  1FOK A;  1XTA A;  1QHG A;  1PJR A;  4XSX F;  3OYN A;  1KU7 A;  2Y0S N;  3S16 J;  3GLX A;  1R5I D;  2PMZ N;  4R8H A;  3WTZ A;  3OYI A;  6PAX A;  2DOE A;  1XCB A;  2YX7 A;  4B44 A;  2IBD A;  4DW6 A;  3WTV C;  2QZ8 A;  3BZ6 A;  4DYQ A;  1H89 C;  1ZRE A;  4HV6 A;  4XLP F;  2JSP A;  4FX4 A;  3JRE A;  1UFM A;  1JJ8 C;  2DMQ A;  3K4M A;  4C3J J;  5CJ9 A;  4E7L A;  1EH7 A;  1O3Q A;  4P9U A;  3QOP A;  4L9J A;  5ILU A;  2WTE A;  2LYC A;  3S1Q J;  5BPD A;  3Q3S A;  2NYX A;  4I2O A;  2FX0 A;  5DDG A;  4HF1 A;  5HDG A;  2EIM H;  3E3V A;  1BW5 A;  1JI8 A;  3BOQ A;  1S6L A;  3REO A;  4DBQ A;  3HZJ A;  1B59 A;  2KRH A;  2JA8 J;  2EIJ H;  2EFO A;  3RKY A;  3R0J A;  4EM0 B;  5KHD A;  2EK5 A;  5TGT A;  5IOZ A;  3DTI A;  2RC4 A;  4MIM A;  2RDP A;  4I99 C;  1PVE A;  2A68 F;  3V42 A;  4MNU A;  2HQN A;  3SFI A;  1EJ9 A;  4RAY A;  1Z6T A;  1YO5 C;  2ICW G;  3EDP A;  3LSP A;  3BJO A;  4CCM A;  3TMO A;  5D4S A;  4XN3 A;  3RYR A;  4RM3 A;  3TDU C;  2NS8 A;  3H0D A;  2KZG A;  3ZR8 X;  3GTP J;  1VQ6 I;  4N9I A;  4IRI A;  2JA6 J;  4CIC A;  4RB1 A;  5C3E J;  1KYZ A;  2L5Q A;  4NQW B;  4WCG A;  2X1E A;  4LIU A;  4OOI A;  5DD8 A;  4NC8 A;  2DA6 A;  3H3Z A;  3WG7 H;  1FPQ A;  2VPR A;  2WAE A;  3OL3 A;  3WGH A;  3WTU C;  1OCP A;  1QRY A;  3BR6 A;  3EUK L;  3F8C A;  1U5T B;  4XK4 A;  3TW7 A;  4M6Y A;  3ZQL A;  1X1P A;  2J5O A;  3L7W A;  2F4M B;  4RGX A;  4IHS A;  3RQ4 A;  3WU0 A;  2KDZ A;  1D5Y A;  2W4S A;  1AOY A;  3K70 C;  1OCO H;  1IXR C;  1WVR A;  2VOP A;  1BBY A;  3CCU I;  3M3Y J;  2X85 A;  3RPU A;  4E7I A;  1BL0 A;  1SEU A;  1E3O C;  1OCC H;  1U5T A;  1ZK8 A;  3WTY C;  2GLO A;  1JHF A;  3GF2 A;  1G59 A;  4AID A;  1TW2 A;  1YJN I;  2VBX A;  5DCM B;  3ZQF A;  1A6I A;  3WU2 C;  4JX5 A;  1ETK A;  1HKQ A;  5DUK A;  4WK8 F;  1SD6 A;  3KEO A;  4RLQ A;  5DUI A;  4QTR A;  3JCU C;  3V7R A;  3AL0 B;  2RN7 A;  5IPA A;  1MBF A;  3FDY A;  4XOR A;  1S72 I;  3TKY A;  3CTA A;  1K4S A;  2WAD A;  2EV0 A;  5B3S H;  5H20 A;  4MTE A;  2IEK A;  1RR7 A;  2IT0 A;  3KZZ A;  2L0K A;  3H3V K;  1BIB A;  1XPX A;  2R7V A;  4KIS A;  2QQA A;  4PFP A;  2GXA A;  2BE5 F;  1T2K A;  2I8D A;  2XRO A;  1HC8 A;  2ESH A;  2DYR H;  1RKT A;  2HYF A;  2EJR A;  2VQC A;  4HF0 A;  5EEG A;  1A6Q A;  4GCV A;  2K85 A;  2R5Y B;  4HQE A;  2OJE D;  3IH2 A;  1IRX A;  1PP7 U;  4ZYE A;  4CYC B;  3HSR A;  3HOY J;  3EUH A;  3NWT A;  2XPU A;  2MW8 A;  4HPQ A;  1SD5 A;  1V5F A;  4XKV A;  3CCM I;  1U0J A;  4CDG A;  4LGW A;  2E35 A;  1GDT A;  3M9A A;  3S15 J;  2P0W A;  4CYC A;  1K61 A;  1U9O A;  2KIU A;  3DKY A;  4LD5 A;  3E1S A;  1B8I B;  3HEF A;  2CV0 A;  1E3H A;  1SVL A;  2VON A;  2MSY A;  4IEJ A;  1BR2 A;  2Z2S B;  1MNE A;  3DCF A;  1SFU A;  2O8K A;  2BV6 A;  2KFD A;  3DPL C;  3G3Z A;  2B7E A;  3H92 A;  3K2Z A;  5F1J A;  4RB3 C;  3JTG A;  1NG7 A;  3V8L A;  1UEL B;  4LOC A;  2MBF A;  1XSX A;  2F5E A;  5J3L A;  3B6C A;  4F55 A;  4PCQ A;  1XGN A;  1XSD A;  1F4K A;  2IS2 A;  2JA2 A;  3LOC A;  5B1B H;  3TP3 A;  4BDZ A;  1ZHF A;  2DO7 A;  3DPT A;  3NAR A;  2HFH A;  2PG4 A;  2PBI A;  1ZG1 A;  1F1Z A;  3K4C A;  2FNA A;  5LBQ A;  3BT9 A;  3FXQ A;  1Q1V A;  2BYV E;  2M34 A;  3FMS A;  1P4A A;  3HHG A;  4BH9 A;  1X4P A;  2PX9 A;  3OS1 A;  3FBI B;  2VIX A;  2ZJQ F;  4MQV A;  2FOW A;  3I4M J;  5CVV A;  3JW4 A;  4P1W A;  3ECO A;  3ERM A;  2K5C A;  2GIZ A;  1ZTR A;  2QKM B;  1WWX A;  4XLH A;  2BXZ A;  5F0C A;  2ZC2 A;  2M87 A;  4GYG A;  3ABU A;  4C30 A;  4ZZD A;  5LFA A;  2LKX A;  3JRG A;  4L5E A;  2Q1Z B;  1J09 A;  5J6X A;  3QP6 A;  1UZC A;  1OFC X;  1FSE A;  4MTD A;  3SZP A;  2O8X A;  2NXN B;  1TNT A;  2D1H A;  1WJE A;  4N4N B;  4UNO A;  3I0T A;  4ZZL A;  1FBU A;  4BBR J;  3T5X A;  3EYY A;  2Q8K A;  2DA7 A;  4MLO A;  1R1T A;  2V4J C;  4EEF G;  1YOV B;  1SAX A;  2ME6 A;  2XAF A;  2YSR A;  2AO9 A;  2CUE A;  2ZXW H;  3LST A;  3AG3 H;  3BR1 A;  1S7O A;  3H9J A;  4B48 A;  3CCR I;  4H4K C;  1IN4 A;  3D1N I;  4M9S A;  3KEQ A;  2ID6 A;  2Y9Y A;  2HS5 A;  2FD5 A;  3VB2 A;  3MKY B;  1R22 A;  1LPQ A;  1WZ2 A;  2KRF A;  1KQ8 A;  3FF5 A;  1AWC A;  2HWV A;  3DTK A;  1VI0 A;  4R1H A;  5ICF A;  3CC2 I;  1OR7 C;  4Q47 A;  2KQR A;  5KVR A;  2GBY A;  2MFZ A;  2PMU A;  2F5C A;  4NDL A;  2VJI A;  5FKL A;  1WFX A;  4LG0 B;  2XHK A;  2KRC A;  2LTP A;  2LY1 A;  2W82 A;  1P4W A;  2DA5 A;  2EQR A;  4PFO A;  3CDH A;  4OIR F;  5LGU A;  2VB6 A;  2CFX A;  2NS0 A;  1GT0 C;  4HW0 A;  4ZYA A;  3ZQH A;  4ZDP A;  1H8A C;  2OD5 A;  2P7C B;  4LG0 A;  5L3D A;  4UB8 C;  1ON1 A;  1YTY A;  1I1S A;  1RRJ A;  1P4X A;  3U2R A;  1B6A A;  2ID3 A;  3CZ6 A;  1P9Q C;  1Y6I A;  4CO8 A;  4HF2 A;  2HKO A;  3OYF A;  4C3I J;  1KQ0 A;  3C2G A;  4BJ5 C;  2IGM A;  5BS6 A;  1UHW A;  3I3L A;  4KJZ A;  3AG4 H;  4DZJ A;  3FZV A;  1FWZ A;  1ZAR A;  2DA4 A;  5TJJ A;  1LKX A;  1SMY F;  3BG9 A;  3BCB A;  1R1U A;  2L4A A;  1YE9 A;  1OCR H;  4XLF A;  3K1M A;  4M3E A;  2K9N A;  2CO5 A;  2RRE A;  3DEU A;  3Q9V A;  1I6H J;  3L2V A;  1I3A A;  1P92 A;  2NS7 A;  5DV5 A;  2XF6 A;  5ED4 A;  1K78 B;  1TQP A;  4UXN A;  2IS6 A;  4XL9 A;  2PMH A;  4NHJ A;  2X48 A;  1D0Z A;  4Z6Y A;  3J81 K;  4XRS A;  5KAI C;  3CUQ A;  4YEJ A;  3VSK A;  1S5L C;  1KU2 A;  4UVC A;  2AXL A;  2KMU A;  1K78 A;  1WJF A;  2M1B A;  5K1Y A;  3LFU A;  1OKR A;  1ETY A;  3J80 Z;  3CUO A;  3GTK J;  3WU1 B;  4G12 A;  1WGX A;  4FHT A;  3BLY A;  1QZZ A;  2WY8 Q;  2ETH A;  1MJA A;  1G6N A;  1R7J A;  5IY5 H;  3V8K A;  3HOX J;  2B63 J;  1MBE A;  1MH3 A;  1O7F A;  4F92 B;  2ZJ2 A;  3I53 A;  2DOD A;  1OPC A;  2VBW A;  1E3P A;  3FXR A;  5HVQ C;  4QLC U;  1W36 D;  5CVI A;  3P9C A;  1WH7 A;  2X6O A;  3FBN B;  4MEY F;  4AWX B;  1CGP A;  1PDN C;  2CQQ A;  2K9M A;  3CO7 C;  3EYI A;  3DWL E;  1DPU A;  3U21 A;  4X1E A;  5IT3 A;  5EF6 A;  2A6T A;  3BG3 A;  2FRH A;  2KL4 A;  2VKD A;  1GXP A;  1MBJ A;  4XID A;  3F21 A;  2ELH A;  2W25 A;  2DPU A;  2GXG A;  4M73 A;  3SQN A;  1KU9 A;  4S0H B;  1H9T A;  3DQV C;  1BI2 A;  1HXD A;  3GZ6 A;  5FRN A;  2ZFW A;  2RNG A;  2RNJ A;  3GYH X;  1FYK A;  3IKT A;  1KGS A;  1FZP B;  2HQA A;  3I9V 2;  2QGU A;  1YIT I;  3KE2 A;  4Y33 A;  1WJD A;  2HZT A;  3LFK A;  2E1M B;  5BQT A;  2MD0 A;  3PUF A;  1LDD A;  5HOD A;  3ZQC A;  2CQK A;  4A3C J;  3VOE A;  4MGR A;  5M5X J;  1Z6R A;  4IL6 C;  2HYG D;  2OTL I;  2EH3 A;  1NHA A;  4I09 A;  2DOA A;  2NVX J;  2DQR A;  2JSC A;  3KYC B;  4E70 A;  1QVU A;  2HXO A;  3A4C A;  4XMY A;  2IJL A;  2DA1 A;  4M3D A;  4EM2 A;  1D0Y A;  2Q0O A;  4YRV A;  3IAM 2;  4IJA A;  4XLC A;  1X1B A;  2DK8 A;  3I5U A;  1HQC A;  4RAZ A;  1QHH D;  3DV8 A;  5K7Z A;  2CGP A;  3HKZ N;  3I64 A;  2CW0 F;  5E1W A;  5CYV A;  2A61 A;  2P5L C;  5J4Y A;  1TT5 B;  1W1W E;  2ME0 A;  4DGW B;  3OYM A;  1ETO A;  4YEL A;  4XBF A;  2UXX A;  2L7F P;  3RPU D;  5CQE A;  1DP7 P;  1IZ1 A;  2AHQ A;  4XLA A;  1X3W B;  3EUA A;  5LGN A;  1J5Y A;  1Z3X A;  2VN2 A;  3OYK A;  2UZK A;  2R4G A;  2OU2 A;  2H27 A;  4XKB A;  1HW5 A;  2D5V A;  3Q9S A;  1RPW A;  5D8L B;  4R79 A;  2ACJ A;  3QYB A;  3AKZ A;  1VQ7 I;  1K83 J;  5D4R A;  4WXD A;  2FSW A;  2ISZ A;  1GXQ A;  2ZJP F;  4M3F A;  2F6C A;  2KIQ A;  2DMT A;  1B1B A;  5HLH A;  3E97 A;  2FML A;  4AIH A;  2RQP A;  4AU7 A;  3UKG A;  1HOM A;  3CCV I;  1SMT A;  4KT5 C;  2GXB A;  1J7K A;  1PUF A;  1S3J A;  2YU9 J;  2NVQ J;  3MZ8 A;  3GTO J;  1Z9C A;  3HHH A;  4E6K G;  2CV1 A;  4J01 A;  1H88 C;  1ON2 A;  2A6E F;  3TGN A;  2KIS A;  5LD2 C;  3G6E I;  2JA5 J;  1EF4 A;  3F6O A;  5KAF C;  1UHS A;  3L9F A;  1S7A A;  2CU7 A;  1IRG A;  2G9W A;  2QQ8 A;  3H9G A;  2NRA C;  1RKW A;  2B0L A;  3GXO A;  3DEW A;  2XDV A;  1QBJ A;  4PUS A;  2V9P A;  2O61 A;  1GV5 A;  3U1K A;  5E3O A;  3M4O J;  2X51 A;  3G2B A;  3KP6 A;  5AIP A;  3ZPL A;  2V9K A;  3M1C A;  4P55 A;  2EFW A;  2GA1 A;  1O57 A;  3BZC A;  3E0J B;  4ENK A;  3CCE I;  1MBH A;  3LSK A;  1QGP A;  1G3W A;  4B47 A;  5BNG A;  1YS6 A;  3V8J A;  1FP1 D;  4ZYG A;  3JRD A;  4MFD A;  2E7W A;  3CLO A;  3IWZ A;  1AA7 A;  3LAJ A;  2P6T A;  1TWF J;  1MBG A;  4FX0 A;  2DT5 A;  2WV0 A;  2MAB A;  1KON A;  2L54 A;  2ZO4 A;  4IOA F;  2CUZ A;  3HGG A;  3LQR A;  4LB6 B;  2CWE A;  5F6F A;  3IHU A;  3AG2 H;  2DLL A;  2OZU A;  1Z7U A;  3NEU A;  5J4V A;  3MMY B;  2IA0 A;  1A36 A;  2XAH A;  3DLA A;  1BOA A;  1X3Z B;  3CJN A;  1R5H A;  2L9S A;  1V54 H;  4HX7 A;  2OCE A;  3KPH A;  3GO5 A;  3JRA A;  2E60 A;  2DQL A;  3MQ0 A;  3KLO A;  2EA4 A;  2I10 A;  1T38 A;  2Z9O A;  1VQ5 I;  3TO7 A;  3DBH B;  1HST A;  1ZQ3 P;  4L9T A;  1JT6 A;  3BQY A;  1LFU P;  2VJJ A;  1FTZ A;  3RDI A;  3QYE A;  5HS7 A;  2KJB A;  2C6Y A;  2QSG X;  3ZGK A;  2QF7 A;  3BZK A;  3L2R A;  4HA8 A;  3PIP F;  1A31 A;  2IS1 A;  3HBL A;  4KT6 A;  2JK3 A;  1E0E A;  3VSL A;  2QEX I;  3CUQ C;  3MFK A;  1SC7 A;  1NTC A;  3PSI A;  3K1N A;  5AON A;  2V9V A;  1YJW I;  3G73 A;  2X1C A;  4HBL A;  2DFH A;  5E8I A;  2A3S A;  2XIG A;  4P5O A;  1BC8 C;  4LB5 A;  3OYE A;  1VQO I;  1DGW Y;  2RAE A;  4A5M A;  4BXX J;  3OYG A;  3FM3 A;  2L7Z A;  4CZC A;  2JPC A;  4K2E A;  4EJT A;  5LHG A;  4QPQ A;  1SAN A;  1XGS A;  3CDL A;  4HST A;  1R4M B;  4B4C A;  1YW9 A;  3S93 A;  3COA C;  3SDG A;  3HOS A;  3RIR A;  1G4D A;  1DU6 A;  2JRT A;  2ZNY A;  5L3E A;  2DU9 A;  3HRU A;  3VYR B;  3ZMD A;  2BBY A;  2HR3 A;  3BTI A;  2I5U A;  3OYA A;  1QA6 A;  4OIN F;  2LMD A;  2FU4 A;  2DFF A;  2DJI A;  3HOZ J;  3K69 A;  1DUX C;  2W85 A;  1FOW A;  2ZME C;  1IV8 A;  2EFN A;  3CCL I;  4GGG A;  2F5D A;  1TP4 A;  3WGG A;  2QCO A;  4O5V A;  3M8J A;  3LL7 A;  2EB7 A;  4EV0 A;  5J1Y A;  3FXJ A;  5BPI A;  4YII A;  1OCT C;  4PSX A;  4NUB A;  2NAZ A;  2V1D A;  2EFQ A;  2GA2 A;  5J47 A;  3CCQ I;  4JYK A;  4ZTF A;  2HTJ A;  3CCY A;  4XRM A;  2E2J J;  5M5W J;  2Y0M A;  2V1N A;  2MD5 A;  3DTE A;  4V2F A;  3JAM Z;  4OAY A;  5L3G A;  3G71 I;  2M7B A;  1IO2 A;  1JT0 A;  3GME A;  1G3Y A;  4I76 A;  1JTX A;  3S2H J;  1T98 A;  1JGS A;  2Z3Y A;  3X2Q H;  3S17 J;  1BM9 A;  5EEA A;  3C2H A;  4D5F A;  4U0Y A;  4JP0 A;  4QIW N;  4QSH A;  3QWL A;  3ZMS A;  5F08 A;  3KP3 A;  1MMD A;  1T39 A;  2XGC A;  2Y69 H;  3R61 A;  4Q48 A;  3E5X A;  2DYS H;  4FAS D;  4YFX F;  1B9N A;  3ASN H;  2HPM A;  4CCN A;  2MH2 A;  4JX4 A;  2HQ5 A;  2O7O A;  3BR5 A;  3IL2 A;  4W97 A;  1KA8 A;  1OMI A;  2M5W A;  2CUJ A;  1HSJ A;  2DTR A;  3HJE A;  1ZRF A;  4EGY A;  3CLQ A;  3W6K B;  4PGG A;  3QAH A;  2A5W A;  3RKQ A;  1L3L A;  2WAQ A;  1Z0X A;  4PK4 A;  1XDU A;  3R4K A;  3A01 B;  1PP8 F;  3CJT B;  2DAO A;  2EPF A;  4E7H A;  2LSO A;  3HOV J;  3GFM A;  3MEX A;  1XCV A;  3QU6 A;  1I6X A;  4NQW A;  5K7F A;  1K4T A;  2H8R A;  1T0F C;  1ETX A;  3A01 A;  2K86 A;  3S3M A;  4BL0 B;  4RLF A;  1XMK A;  2OUM A;  3DPU A;  3PJR A;  4G7O F;  3S8P A;  1JKO C;  3D5R C;  1T33 A;  3LQQ A;  4LK1 F;  1SD4 A;  5CQG A;  5CLS A;  2AQF A;  1CF7 B;  4RS8 A;  2XC7 A;  4HX8 A;  2MYS A;  2XB5 A;  1W0T A;  1BI1 A;  2X1D A;  1U78 A;  3IP4 B;  4U7B A;  1P2F A;  3KX2 A;  3MAJ A;  4GRI A;  3SEZ A;  4ABZ A;  1TL8 A;  4F91 B;  3OL4 A;  2WY7 Q;  1CF7 A;  2VXD A;  3F8M A;  5JHU A;  5LGT A;  5DCM A;  5GTI C;  4AVP A;  3DF8 A;  4NC7 A;  4C2U A;  1BI0 A;  4CYD A;  4MO7 A;  4ZDO A;  1XD7 A;  2OC6 A;  2H8W A;  1Y39 A;  3IWF A;  3M1E A;  1IV6 A;  2P5V A;  4BHB A;  4A3B J;  1ODD A;  1YQA A;  4ZJZ A;  3CO6 C;  4D7M A;  4CXF A;  3V7C A;  2VPL A;  1I27 A;  4UVB A;  3SEQ A;  4WF2 A;  2W1O A;  2PN6 A;  4AYB A;  2IGN A;  5FO5 A;  5KK1 A;  3HC7 A;  1R5G A;  1BI3 A;  2LKP A;  4CCK A;  2M3A A;  5KCM A;  4G7H F;  5JR3 A;  2DA2 A;  1X1C A;  1UMQ A;  2OZ6 A;  1BJZ A;  4FT8 A;  2V7F A;  1R4N B;  1XG1 A;  1XDS A;  3F23 A;  1BW6 A;  2R5Y A;  1I50 J;  4IHV A;  4ANJ A;  3TBI A;  1HBX G;  1MKM A;  1RUO A;  1MGT A;  1K7A A;  2H1K A;  2QQB A;  3DBR B;  3R60 A;  3P9K A;  4CCL A;  3P5J A;  3J80 K;  1VQ8 I;  2W00 A;  1I39 A;  3AG1 H;  2E7X A;  2MA3 A;  4ETS A;  3W2A A;  1WJA A;  4Z2Y A;  1B8I A;  1MDM B;  2Z99 A;  4IKF A;  1MMG A;  1XMA A;  3FWE A;  1RIO H;  2L7M P;  2V6C A;  5J8C A;  5HDN A;  1A04 A;  1GVJ A;  2WB1 N;  3CES A;  4BXU A;  3KYD B;  1VF9 A;  3ELK A;  1XGO A;  3HTS B;  3C2B A;  2DPD A;  5M5Y J;  1WJB A;  3CQZ J;  3BG6 A;  1MDM A;  3OOU A;  1MSF C;  4N4O B;  4L0Y B;  1AHD P;  1K6O A;  1IW7 F;  4RGR A;  4U87 A;  2R92 J;  3QPS A;  1IN8 A;  4KFC A;  1AKH B;  1Z1D A;  3ZMZ A;  1VFC A;  3T8T A;  2KZV A;  2OV7 A;  3IAS 2;  4EVI A;  3ZMV A;  3ERE D;  3HUG B;  5ICE A;  3GBG A;  1HW1 A;  4ZYH A;  3MN2 A;  5FRO A;  5FJ8 J;  4HLY A;  3OYL A;  2FA5 A;  5M3M J;  1TWG J;  2GWR A;  1X2N A;  3F8B A;  5EZG A;  4HSR A;  3F22 A;  1AKH A;  1SFK A;  1BR1 A;  3L2C A;  4HLX A;  4Y4R A;  2XV4 S;  2K9S A;  3DP7 A;  1I1G A;  4B43 A;  3AAF A;  3KET A;  3HUG A;  2LD5 A;  1MJB A;  1ULY A;  5CVR A;  3K4B A;  2VOD A;  1WRJ A;  4A69 C;  4AUX A;  2AS5 F;  2BW3 B;  2K9Q A;  3GX4 X;  3HPH A;  1BOB A;  1MMS A;  2QWW A;  5FKM A;  2K3F A;  5EDN A;  4A0Y A;  2M0C A;  1Y56 A;  3NRV A;  5EZH A;  1WCM J;  1WQ2 A;  1LQ1 A;  1FSH A;  3G1M A;  2HQR A;  4YIR X;  2FF4 A;  3SJM A;  2LH9 A;  2BW3 A;  3R0A A;  5HDK A;  1OLT A;  2KDO A;  3Q0V A;  1Z3Y A;  3A02 A;  3PNY A;  4RB2 C;  2HOE A;  3VWB A;  1GLN A;  4Q4Z F;  2LR8 A;  1REP C;  2TDX A;  1ETV A;  2LRD A;  5EYR A;  3OR2 C;  2YX4 A;  2P8T A;  3FMQ A;  3WTX C;  1MND A;  4II2 A;  2FBI A;  4KUM A;  2QBY B;  3OIO A;  2OQR A;  4RMN A;  2ZSH B;  3OYC A;  3K4L A;  3A03 A;  2YU3 A;  4E7Z A;  3GFL A;  3JRI A;  3RSN A;  2VT2 A;  2DXI A;  4CH7 A;  3AFH A;  3BR2 A;  2LNB A;  4F52 A;  1F43 A;  5C4J J;  5J1U A;  5D5U B;  1T08 B;  3S1M J;  5HS9 A;  2FBK A;  1FNN A;  4Y3O A;  1N25 A;  3QYF A;  1Z77 A;  1W7P B;  2LOO A;  2XAG A;  4YFN F;  3GEZ A;  2GAU A;  1HKT A;  4ESF A;  1CQT A;  3H35 A;  4HYE A;  4UVA A;  3OYB A;  1WI3 A;  2HDD A;  4C3H J;  3PNT A;  1U6G A;  3N05 A;  4ENM A;  5H2F C;  3DU6 A;  3OWT A;  3LSM A;  2X6Y A;  2L9V A;  4BS9 A;  1W7P A;  3RZO J;  4OU0 A;  5D6E A;  5EEH A;  1BN5 A;  3K2A A;  1IC8 A;  1YRN B;  4GXO A;  3HRS A;  2XRL A;  2ADU A;  2CG4 A;  1XGM A;  1R00 A;  2F5V A;  4MFE A;  2XF5 A;  3SZT A;  1MBK A;  5AIQ A;  4CSW A;  4E7S A;  3ABM H;  2O3F A;  1W4M A;  5DM7 F;  1UG2 A;  3T1B A;  3LSH A; 
#chains in the Genus database with same CATH homology
 1VQO I;  1VQ4 I;  2NXN B;  3G4S I;  3I55 I;  3CCV I;  1YJ9 I;  5DM6 F;  2JQ7 A;  1S72 I;  3CCS I;  5GAD J;  2E34 A;  3CCJ I;  3G6E I;  3CCR I;  1QA6 A;  1HC8 A;  1FOW A;  3I56 I;  1FOX A;  3CCL I;  2ZJR F;  1VQL I;  2H8W A;  1Y39 A;  3CC2 I;  1MMS A;  2K3F A;  3CCM I;  4V19 K;  3CCQ I;  3CC4 I;  2E35 A;  3CCE I;  1YHQ I;  1YIT I;  3CD6 I;  5GAH J;  5GAE J;  3DLL F;  3G71 I;  3J7Y J;  1YIJ I;  1VQ6 I;  2OTL I;  3J7Z I;  1VQ9 I;  1VQM I;  3PIO F;  3CME I;  4IOA F;  1YI2 I;  2OTJ I;  1VQK I;  1VQN I;  1VQP I;  2E36 A;  5GAG J;  2QA4 I;  1VQ8 I;  1VQ5 I;  3CCU I;  3CMA I;  4UY8 I;  4IO9 F;  1FOY A;  5JVG F;  1ACI A;  2ZJQ F;  2FOW A;  1YJN I;  3CJT B;  3PIP F;  4IOC F;  1VQ7 I;  2QEX I;  3CC7 I;  5DM7 F;  2ZJP F;  1YJW I;  3CF5 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...