1YX3A

Nmr structure of allochromatium vinosum dsrc: northeast structural genomics consortium target op4
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
112
structure length
112
Chain Sequence
MADTIEVDGKQFAVDEEGYLSNLNDWVPGVADVMAKQDNLELTEEHWDIINFLREYYEEYQIAPAVRVLTKAVGKKLGKEKGNSKYLYSLFPYGPAKQACRFAGLPKPTGCV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein DsrC
publication title Allochromatium vinosum DsrC: solution-state NMR structure, redox properties, and interaction with DsrEFH, a protein essential for purple sulfur bacterial sulfur oxidation.
pubmed doi rcsb
source organism Allochromatium vinosum
molecule tags Structural genomics, unknown function
total genus 31
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2005-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04358 DsrC DsrC like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.370 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1yx3A02
3.30.1420.10 Alpha Beta 2-Layer Sandwich Dissimilatory Siroheme-sulfite Reductase; Chain: A; domain 1 Dissimilatory Siroheme-sulfite Reductase; Chain: A; domain 1 1yx3A01
3OR1C 2V4JC 2XSJC 2A5WA 1YX3A 3OR2C 1JI8A 1SAUA
chains in the Genus database with same CATH superfamily
4AM3A 2XF6A 2H8WA 1HA8A 3PUFA 2FJ1A 1R49A 2VBYA 1BM9A 5D4RA 1O4XA 3LSMA 1F1ZA 2KZVA 2OAZA 4AD9A 1FWZA 4A93J 1O3TA 3FXOA 3F72A 4HNUA 5LGNA 1UCRA 3GTLJ 2F48A 2PMZA 3S1NJ 4FHTA 2Y9ZA 5LGTA 2DA7A 4CHUA 4UUSA 4KN4X 4XSXF 3HDDA 1G3YA 1W0TA 3QAHA 3H92A 5IYDJ 2W48A 2VE9A 5L3GA 1WH5A 3TL4X 2VLAA 4ESBA 4C3IJ 4ZYAA 3WTSC 4G12A 2KRFA 2OBPA 4AC0A 5LHIA 2KQRA 1K6OA 2EV6A 5D6FA 5IY5H 2GXGA 2X48A 2ZC2A 3QPHA 1D8KA 4HQEA 3MZHA 3ZQGA 1HF0A 1F43A 1ZRDA 2DA2A 5IYBJ 2K4BA 3GTKJ 3C3WA 2HXIA 2R3SA 1ZREA 2W7NA 1K61A 1GVJA 4UUTA 4YG2F 2KISA 2LKPA 4PJLA 3L1PA 2NVYJ 1HQCA 2EZLA 1GLNA 5K1YA 1WHUA 3I0TA 4HZFA 2DBBA 2L7FP 4CUGA 4M3GA 4PCQA 3PL8A 4ENNA 2CQKA 2ZBKA 3CD6I 5K5QA 2OA4A 2RC4A 3ASNH 1X2NA 5HVQC 5HS7A 4G7HF 4NBQA 2DFIA 1FT9A 3JRIA 2M2EA 3M3YJ 4QIWN 3Q0UA 1J5YA 2V1DA 2Y75A 2R7DA 4W97A 2LVSA 2RVCA 3CO7C 3SEQA 1MBGA 1T08B 2HNHA 1VQPI 1IW7F 3W6VA 2IXSA 4O5VA 5HNFA 3ABKH 3LSTA 2OQRA 4L0YB 3JW4A 3PIPF 3CP8A 2MBFA 1IC8A 2ZMEA 4UV8A 2E2JJ 3OYKA 1GT0C 2CQQA 3ABMH 3AG2H 1U3EM 1MBKA 2PX9A 2EIMH 4FE7A 1MBJA 2DMPA 2JA2A 2VONA 1IRXA 3PFIA 2V1NA 1XMXA 3BG5A 1VTNC 1UHSA 1TW2A 4KNYA 5K5OA 5D5WB 5E17F 4FT8A 3E7LA 2IGNA 5CQGA 2VBWA 1B6AA 2M3AA 1O7FA 2ELKA 2LF7A 4XRSG 3J7ZI 1DUXC 3IRQA 4M72A 2IA0A 1K78A 4L9NA 1SAUA 1XC5A 5LD2C 3K10A 3LAJA 5FRNA 5C44J 3K9TA 2G7UA 1HCRA 4N9HA 1FOXA 1QA6A 4II3A 5BOXA 2KIUA 3SDGA 2LF8A 1YJNI 1R71A 2MFZA 4YRVA 3E6DA 3FWEA 4EM2A 2Y9YA 3I59A 4BJTA 5DV5A 3JSPA 3H0GJ 4H4KC 3H35A 3ZP5A 4FQGA 1YE9A 4L0ZB 3HUGA 1T56A 1A35A 3CF2A 1XSXA 2XPWA 1SFOJ 1B4AA 5DM7F 3ZR8X 4MEYF 5B66C 1AU7A 5J6XA 2FNAA 4M9XA 2H6BA 2E1NA 2NVUB 1HDDC 4PJ0C 2VKHA 1LFPA 4FX4A 1VQOI 3X2QH 3H3VK 5E1WA 2HGCA 2R5YB 3GBGA 4ZTFA 1RUOA 1HXDA 2DPUA 2VJJA 3QWLA 5K7ZA 5IP6A 4I98B 3J7YJ 1GXPA 4BL0B 3HG9A 4BE0A 3N4MA 1GUUA 1TNSA 2PBIA 4KJZA 1O3QA 1NTCA 4CGZA 3J81Z 4KICA 3CC4I 1QQIA 1LDKB 4HX4A 4XIDA 5FLXZ 3FZVA 3GFJA 5FLVA 2BVMA 3L7WA 2PMZN 3DV8A 3CCJI 3M8JA 2YU3A 4II2A 3TQNA 4HF2A 3R4KA 2OJED 2H8RA 2BHYA 2KP6A 5E3OA 1CF7B 2CGPA 1ZAOA 1VFCA 1D0ZA 2DOEA 4W1UA 1GHCA 1IV8A 2W00A 2VI6A 1WSUA 1RPWA 1IN5A 1Z7LA 2OTJI 4ESJA 1A36A 3WODF 2VASA 1DP7P 5LGUA 3SJMA 2K9SA 3BJOA 1K83J 3CDIA 2VIXA 4FE4A 1FMWA 3HB9A 3CZ6A 2EINH 4DW6A 3WTXC 3DTKA 2X1CA 4MIMA 4IHTA 4EJWA 1TP4A 2MD5A 3KP2A 5IOZA 3K70D 1BI1A 3UNGC 3A01A 2HZDA 4QSHA 3U1KA 1MGTA 3D5LA 2J5PA 2EWNA 2VC1A 1BA5A 3K70C 3ML6A 5D5VB 2ZJ2A 3JRGA 3HOWJ 1NG6A 2EILH 3BOQA 3O8HA 1JGGA 4HV6A 1BC7C 3F6VA 4LLNA 2P0WA 1FBSA 1R6RA 4LK1F 2HYFA 1H8AC 1PDNC 1WH7A 2BY1A 3QOPA 3IRRA 1FZPB 4XN0A 1BIBA 2K40A 4A0YA 3B73A 4RB2C 4E7HA 3ZOBA 4RAGA 1Z91A 3DLAA 4LIUA 5EG0A 5GTIC 3P5JA 4EV0A 1JHFA 2XPVA 1ZQ3P 2PEXA 3HKZA 3E6MA 2OF7A 1ZH5A 2DLLA 2FA5A 3RQIA 3MEXA 2BW3B 5J1YA 4AU7A 4LLGF 1TWGJ 2MYSA 1YS6A 1FC3A 3ONQA 6PAXA 3DXJF 5F08A 4AIKA 3LL7A 1MKMA 3WHBA 4NUBA 3CC2I 5CVRA 1S3JA 3ERED 3TOBA 2EFOA 1UZCA 4HQMA 3ZRGA 3A02A 3A0BC 2L9RA 3CJQB 2X6XA 1ZKGA 1X3WB 2W25A 3CCSI 4RDUA 1LDDA 3S3OA 3V8LA 2XAHA 4EGZA 2VXDA 2V9VA 2X51A 4LJZF 1W36C 4L5EA 3PNYA 3KZIC 2M4GA 3BP8A 1U8BA 1T39A 3AAFA 1P4WA 3S2HJ 5BQTA 1TNTA 2DA1A 2ZNZA 3KEQA 3LFKA 2GQQA 1TQIA 1WVRA 3CC7I 2NNNA 5HDKA 2M4KA 1IV6A 5IYCJ 3SEZA 5IOYA 2BXZA 3GF2A 1DGRM 1T0FA 4H0EA 1VQ9I 3IHUA 2XDVA 2VOOA 4XKVA 1IN6A 2NRAC 1XTAA 5J47A 1L3LA 2FBIA 1SD6A 2DFEA 3PIOF 1BI0A 2O8XA 2FSWA 3WTVC 1SVMA 5LEJA 2JQ7A 1SEUA 2HYJA 1I50J 2V6CA 2NS0A 2XV4S 2XAJA 4S05A 3SFIA 5LHGA 3I4PA 3G73A 3GTJJ 1O3RA 2ZSIB 1ZARA 1UELB 5M3FJ 3FX3A 2F4MB 1Y56A 1QZZA 3GFMA 2E2HJ 1E0EA 4EJVA 4MTDA 2R7FA 4WX9A 4OIRF 1RKTA 2QLZA 4V2GA 3HTUA 3V8JA 1VNDA 1Y1VJ 2KFDA 3VB2A 4DZPA 1I3AA 3DBHB 3OWTA 5F64A 3JAMK 4WWCA 4K2EA 4P96A 1HSJA 3FIWA 4PGHA 2EH3A 2QBYA 4UB8C 3I64A 1SVOA 3N05A 1JTYA 1QPMA 3GUDA 2ZKZA 3CCQI 4HPQA 1X58A 2MGQA 3DU6A 3CMMA 5E3LA 2F6CA 3PUBA 2LKXA 4Y13A 1F5TA 3QP5A 4ANJA 1RNLA 2M1BA 3F9KA 2VB6A 5JFRA 2M5WA 3KP4A 1MZBA 1JE8A 2PG4A 1LQ1A 4NC7A 4BEHA 5DM6F 3K2AA 4RGXA 4I2OA 1MD0A 2OCCH 1LVKA 3K69A 2IGOA 5M3MJ 2E71A 3HHHA 2H1KA 4N4NB 2JMWA 2RAEA 3HSFA 2BEOA 3MMYB 3NEUA 4NC8A 5CKTA 3H5AA 4AVPA 4CYCB 3GTQJ 1J09A 2L7KA 2Y0SA 5GAEJ 4CCMA 1MDMA 2O7OA 1QNTA 2I5UA 4J01A 2IAIA 2GM4A 4GGGA 2OCEA 3R0JA 1P7JA 4B44A 1R5HA 3L09A 1NH3A 2QSGX 3DEEA 2QWWA 3D5SC 3RCOA 2VPLA 2KPMA 4IVNA 5E1ZB 1GVDA 3LSGA 2LBFB 1J2XA 4D0PA 4A3JJ 3ZGKA 2HXOA 2VJ5A 3OMYA 1HLVA 4X0GA 1W7PB 1I6XA 2OZUA 4UV9A 1WI9A 4EJTA 3F3XA 1OYYA 2O3FA 3M07A 4XOPA 1QBJA 4GDFA 4ITVA 5D4SA 1X3ZB 3HKZN 2XSDC 1BJAA 3WE2A 3I54A 3G1OA 4G7OF 2E34A 1X1AA 1ENHA 1V5FA 4DYQA 2ECBA 3H0DA 4XNFA 3CO6C 2HU9A 4UUSB 2W24A 3BJ6A 2DJIA 3BTLA 1SFKA 4FX0A 5DEQA 3VSLA 2HDWA 2MC4A 3VFZA 2VQCA 4WF2A 1UMQA 2E2IJ 5E8IA 5FLMJ 4UY8I 3K2ZA 3IC7A 2CW0F 4HX8A 4XKWA 2P5VA 3G2BA 2KJBA 3IKVA 2R0QC 2JWTA 2GBYA 4CSWA 4A6EA 5LFAA 5EJCA 5CLSA 1ZRCA 2F5DA 2P6TA 2DK8A 4RGRA 3HYIA 4KIFA 1UFMA 1WWXA 4JK1X 4Y4RA 4A12A 3S17J 2R7TA 1KYWA 2XGCA 3OIQA 4WCGA 4KMUX 3FK6A 2FXAA 2OU2A 1GV2A 1I5ZA 3IAS2 3BDDA 3DEWA 1R58A 1BL0A 2KKOA 2AS5F 1VQ8I 1EF4A 1Z9CA 5TGTA 2F5CA 2ZXIA 5D5UB 3J80Z 1NK3P 5CQEA 4F91B 3WTUC 2ZMEC 3L2VA 2VKVA 3FXQA 3IL2A 1XGMA 1VQNI 2CW8A 3JRDA 1RR8C 1XX5A 2LSOA 5K7FA 2Y31A 1IGNA 1MBHA 1TT5B 2JSCA 1HSTA 2P5KA 3BJAA 3LNQA 4RAZA 1E17A 1LNWA 1S72I 4IOAF 2L0KA 2P4WA 3S2DJ 3KP7A 3LSPA 1Z05A 5ILSA 3LSKA 4BACA 4N9IA 5K5RA 2V26A 3W3CA 3I56I 5F0CA 1N25A 4A69C 1QVUA 4NC6A 2VQHA 3GEZA 3LSIA 2ESHA 3WGIA 3VSKA 1YHQI 2DODA 2ME6A 2B9SA 1QHHD 2P7CB 2WV0A 1OYWA 1XG1A 5FD6A 4A3FJ 4I7HA 1XGSA 1OCZH 4IEJA 2WC2A 1SANA 2CQ7A 5IT9K 1KQ8A 2W82A 4I0AA 1XD7A 1TW3A 2X1DA 1BOAA 1YW8A 3M1EA 1DPUA 3N97A 3OOUA 3PNTA 4CH7A 2E1OA 1NG7A 5DS9A 1TL8A 4IX7A 5JHUA 1Y0NA 1XDUA 2KT0A 3O3KA 4MO7A 2NOJB 3RKXA 3MKZA 1SMYF 5DCMA 1XGOA 1EA3A 2HPIA 4EM0B 4PSXA 3ZQLA 4AIDA 5JR3A 1FYMA 3HM5A 2EPFA 1X4PA 2DW4A 4JBAA 4RB1A 3HOZJ 4IHVA 3KETA 2A5WA 3ABLH 2BY3A 3B6AA 3SQNA 3RDIA 3U1DA 4L9JA 4B3AA 3G71I 1H88C 3CUQA 3EUAA 2ESNA 2JT1A 2YX7A 3GFLA 1FMVA 2EFQA 2ID3A 4FETA 1ETOA 4XKCA 5FJ8J 5J4VA 1YLFA 3MZ8A 2D1HA 2FF4A 2Z16A 5J40A 1IG7A 1JGSA 3BCAA 1WJDA 2HDCA 2P81A 2VODA 1VI0A 2Y0SN 1D0YA 2R7ZJ 2R7XA 2CV0A 3ZQHA 3HUGB 2P8TA 1X1DA 3RSNA 3WGGA 1Y39A 3P7NA 2LK2A 5EEGA 3KIOA 2D2WA 4R1HA 3LSJA 2R7WA 1XSDA 2EQRA 3M4OJ 1E3HA 1S29A 3G1MA 1FY7A 3GTOJ 3JTGA 4A3KJ 1ZRFA 2OZ6A 2YPRA 4KMFA 1U5TB 1MSEC 3KFWX 4BNCA 2COBA 2MW8A 2IS2A 4XONA 3S1MJ 1UG2A 3EQLF 3DKYA 4RBOA 3BG6A 3CJRB 3GZ6A 3BZCA 2STWA 4HSTA 3HRSA 2BXYA 2WV1A 4NNJA 1OLTA 3HOYJ 1ERDA 4C2UA 4U0VA 4EEFG 2IGKA 3TO6A 3RZDJ 1SC7A 2PI0A 1U6GA 4HA8A 5GPCA 5FGMA 1ZR4A 2ZNYA 5L3BA 3HGYA 1Z1DA 1ITYA 2EIKH 4C3HJ 1D8JA 3OYCA 4MHGA 3CCEI 3J81K 2HVQA 1K4TA 5IP9J 5FKKA 2HKXA 2ZO4A 4IQ4A 2CV2A 2HI3A 3ZMZA 2K85A 3S1RJ 5FLXK 1JKQC 4KISA 3Q0WA 2IS1A 3HSEA 4XL9A 2VOPA 5ICGA 1LE8A 5H20A 2ID6A 4E7KA 3H9GA 1F4KA 2IT0A 3E5QA 4KA4A 2BYVE 3CLOA 4B48A 1IRGA 1QO0D 2VUMJ 4YFXF 2QYOA 3G3ZA 3HBLA 2BZTA 2HVRA 3HJEA 2C6YA 1G4DA 1JT6A 1TTYA 4M9SA 3OYAA 4MQVA 1YQAA 4ZDOA 2Q2EA 3DLLF 1KU2A 1OR7A 3BG9A 2CS3A 4N0BA 1B1BA 4B3XA 1FPQA 2FBHA 3CCLI 2MH2A 4G6QA 2ZCWA 2ZJRF 1A04A 3KEYA 3OY9A 4N4OB 5IPAA 1UHMA 1ETQA 3KCCA 1O7LA 4IKFA 2MH9A 3DBLB 3CUOA 1B72A 3F0CA 1IO2A 2WBMA 5JVGF 1S9HA 2RNGA 2GXAA 2O8KA 2E1MC 4XLPF 5HDNA 5IT9Z 2K02A 1BR2A 2CMPA 2HOAA 2VE8A 5D8LB 3IV5A 3QYEA 4U7BA 2LP0A 4BHBA 3JRAA 4BYYA 1K79A 1MH4A 4C9YA 2W4SA 3E0JB 4GYIA 2A6TA 2L7ZA 1MMDA 2XHKA 5B1AH 3IWZA 3F8NA 2DDBA 3M1CA 1U9NA 4F52A 3W2AA 3TO9A 3WU0A 4OIQF 3DQVC 5EG0B 4R8HA 4LK0F 5BS6A 3OS2A 1IDYA 2BV6A 2ECCA 2Y48A 2XF5A 4YIIA 1VZ0A 4QWQA 4PJNA 1XN7A 3DU5A 3JRHA 2JK3A 2O6GE 4RAFA 4BY7J 1X1PA 5FKLA 5FFZA 3M7GA 4BJ5C 1TQMA 1FTTA 4XSZF 2X0LA 3PFYA 1OYIA 2L4AA 4Q4ZF 2HFHA 3RPQA 3I55I 2QENA 3HEFA 1T8IA 4XRFA 5FKNA 2RV8A 1YFHA 1T0FC 2QSHX 2ZXHA 1DQUA 2IEKA 3FBNB 3GZNB 2QCOA 1ZGJA 2IP2A 3FXLA 3H3UA 3OL4A 3S32A 3A0HC 5ERIA 5LLQA 2JA5J 3A2KA 4XLEA 3R60A 1I1SA 2J5OA 3TW6A 1WJCA 5H6RA 1VQ7I 2RGVA 3EYIA 3QQAA 1IJWC 2JUCA 2HDDA 3FF5A 3J7AO 3SZGA 2A61A 2XGEA 3P9IA 5CVUA 4M6VA 5HLHA 3DFGA 1YRNA 2A07F 5DD8A 2VPRA 1SD7A 2DPDA 1S5LC 1YX3A 2A69F 3T5XA 3AL0C 1TBXA 3DKWA 4J19A 4ZC3A 1GDTA 5DD4A 2M34A 3BG7A 4B4CA 2HS5A 2K9LA 4FTHA 3M8EA 3KP6A 4YFNF 2YS9A 5M5XJ 3I9V2 1UHWA 4UHTA 2R5ZA 4LG0B 3T8TA 1H0MA 4LGWA 4LIVA 3IP4B 2QQAA 4PJMA 3NQOA 5FRMA 4A3CJ 3FMSA 5HNHA 3GVAA 4MTEA 2K5CA 1R23A 2HKOA 1WPKA 1P6RA 1M1EB 2O0YA 5F04A 3LSHA 3FXMA 3JREA 4MGRA 3S2WA 2JVHA 4B47A 4BJ6C 1IXSB 3G1LA 5H2FC 3WTWC 3KEOA 4DYRA 4YIRX 4B43A 3T1BA 1W5CC 4I0BA 5L3EA 1MNEA 1USTA 1ZYRF 4OMZA 4BXUA 2HOEA 4DJAA 4QTRA 4F55A 4BGDA 2ACJA 2XAFA 3HOXJ 1QHGA 2P7VB 3GFIA 1FEXA 5KAFC 3WU1B 4LMYA 3IH3A 5DDGA 1U0JA 4UVBA 1QZYA 4C3JJ 2CFXA 3HIFA 1LFBA 2ICWG 3UKGA 3GX4X 3CJNA 2GLOA 2PJPA 4NDLA 2K3FA 3M9AA 2QBYB 4MFEA 1AHDP 1TWAJ 5E3NA 3H1CA 2R7OA 3ZQFA 1WJFA 1KGSA 1R4MB 4JX6A 4KFCA 3HTSB 2DYSH 1NHAA 2A6HF 1W4MA 2RQQA 4AIHA 3BR3A 2TCTA 2OV7A 1FBUA 5H6QA 5GAGJ 5LBQA 1MBFA 2GAUA 2XKPA 4DOZA 3AG1H 3DPTA 3RKWA 1KYZA 4G6TB 4G9YA 1SD5A 5AIQA 4ZYHA 1YW7A 2K27A 2OPTA 4ZYGA 2HR3A 1BN5A 1WCMJ 5J4YA 4BQNA 2HEOA 3MKWB 2GOXB 1ZGAA 2A6EF 2LDUA 1OCPA 3ABTA 5KCMA 1HOMA 2FOKA 3FHNA 4ABZA 3CMEI 1IN4A 3KP3A 1ZG1A 4A3DJ 3C2BA 2L2OA 9ANTA 4PFPA 2W85A 2R7SA 3GCMA 4V2FA 3HOVJ 2LFBA 3BTIA 2E60A 2LH9A 2EA2A 2OD5A 4I01A 2TRTA 2W1OA 3A1YA 4XRSA 1LDJA 3HOTA 3JRFA 3SYTA 1W5TA 5F0FA 3CCVI 5B1BH 3OIOA 5GADJ 1JT0A 3WE3A 1RRJA 4P1WA 3MKLA 2QKLB 3FMQA 3Q3SA 1KQ9A 4L18B 3FDYA 5CPRB 3F8MA 4BQOA 2LMDA 2ZSHB 1Z21A 1KZHA 1Z7UA 5C3EJ 2XF7A 2XROA 3NWSA 3HOUJ 4G94A 2DA4A 2FNPA 1F36A 3BQYA 5FKOA 1T38A 1D5VA 1DGWY 1YS7A 3FXRA 1J75A 1W36D 3ISPA 1WJAA 3I4NJ 4IJAA 2IS4A 2P6SA 1ZELA 2IA1A 2ZFWA 4XLHA 4Y3OA 3TP0A 1WZ2A 4L9VA 3L2CA 1BI3A 1FTZA 2ETHA 2WTEA 2XB0X 4UB6C 4XR6A 4BS9A 1TWCJ 2TDXA 4UNOA 4D5CA 2G7HA 3LSRA 4MQ9F 2VC0A 3WTYC 3GLXA 2COMA 2PMUA 1HDPA 1DDNA 5FKMA 4X1EA 4A2UA 4F7ZA 5E1XA 4XKBA 2GZWA 3BPVA 4DYCA 3GXOA 2D5VA 4I02A 1ZLJA 4XORA 1UJ8A 4HG2A 5BPDA 2CH0A 3F23A 1U8RA 2FRHA 3RIRA 4E70A 1YTYA 1JUPA 1A6QA 3O2PE 2XKOA 4WXCA 3FM5A 2GXBA 1MBEA 3P9KA 1I6HJ 3CMYA 2E19A 2FU4A 2W57A 3ASOH 5L3FA 2K7LA 2CRGA 3J80K 4OU0A 3L2QA 3J7AY 2V1XA 3C7JA 3VYUB 4GXOA 2L54A 2UV1A 4Y52J 2BY2A 3OYNA 2FQ3A 2UXNA 4ZDLA 1Y8QB 1OJLA 4C30A 3CUQC 4KUMA 4A0ZA 3BZKA 1FOYA 5FROA 4BBSJ 3D0SA 2EJRA 2AXLA 2XRNA 4HDVA 2VT2A 4LLLA 2V9KA 4FISA 1V5EA 3WTTC 3ABUA 3ECHA 4U0YA 4DBRA 1CGPA 2JJ7A 2DFHA 4P9UA 4BDZA 2M0CA 3MAJA 4A3LJ 2EFWA 2LY2A 1CF7A 5L3DA 2STTA 2PJRA 3QODA 3K1PA 2XC7A 1ETWA 4ENMA 2E5ZA 2E1CA 3DBRB 5J1UA 3C2GA 5BNGA 3FK7A 4RLQA 1ORKA 1WQ2A 2ZFUA 4DGWB 1TLHB 4IF4A 1YO5C 4HNTA 3S1QJ 1RKWA 3KYDB 1X19A 3DTIA 2DTRA 4U0WA 4RGSA 1PP7U 5KK1A 3DPLC 2VXZA 2X85A 2DT6A 4G8XA 3ZMUA 1B9NA 1H89C 1OPCA 5ILUA 4RM3A 5CVIA 1B8IB 2A5YB 4CZCA 4IHWA 2IRFG 3ZQCA 5EZHA 2DOAA 3Q5FA 2HQAA 2HWVA 4S04A 2R7UA 4BHPA 2M9HA 1P92A 3HRMA 2HPMA 2JRTA 2NOGA 4BUPA 3EUHA 4E6KG 1FOKA 1X1BA 4R79A 1HW2A 3DKXA 3L2WA 3QP6A 3CCYA 1Y8RB 3BZ6A 1H9GA 1R00A 4CCLA 1PJRA 1YJ9I 1V5GA 1J9IA 2RN7A 2WY7Q 4A3IJ 1ETXA 1FIPA 2KDZA 4XM3A 3K4MA 1WJ5A 4M3DA 3KPHA 2Z99A 1Y6IA 1HW5A 1OFCX 4PDKA 2JSPA 3QU3A 1SD4A 3IAM2 1WFXA 5FB2A 2FEZA 3A03A 2W84A 3SXYA 4L5IA 2BOLA 3QYFA 3OYDA 1X3UA 3LAPA 5D5XB 1EJ9A 3K1MA 3BTCA 4LOCA 2NVQJ 4D9JA 1IN7A 1OISA 2MSYA 1OR7C 4KIGA 3UR3C 2L9NA 4O3MA 3B6CA 3WTZA 2GWRA 2L01A 2YX4A 3DWLE 4OOIA 4Y7NJ 1HKSA 4D1QA 4DNCA 4DQ2A 3K4JA 4G6DA 2EZKA 4JX4A 1XGNA 2WWYA 3A4CA 4DBQA 3K4LA 2D1VA 3RTRA 3LQQA 4A3BJ 2YU9J 5B5EC 1GV5A 5A2QZ 1Z6RA 1I39A 4Y15A 4HV5A 3G6EI 2Z9OA 1FOWA 1G3WA 2Z5UA 2FE3A 1HW1A 5DCFA 4IPAA 3QPLA 2FUG2 2MLGA 2KIFA 1XPXA 1OKRA 1ZR2A 1S8NA 3QU6A 4GYGA 4KITB 1ULYA 1RETA 3OYGA 4NQWA 4XQFA 2V7FA 3G4SI 1Y1WJ 4AYBA 1SVLA 1USSA 2L9VA 1JKRC 1R22A 3R61A 1X2MA 1I3QJ 3ULQB 3E3VA 2EIJH 4XRMA 4XN3A 4EGYA 1R36A 2L9SA 3BG3A 4ASNA 3PO3J 4RGUA 4ZTJA 1MSFC 3SHFA 2X1EA 2M0MA 2L7MP 5FO5A 1D3YA 2MG4A 2VL8A 4V19K 3K4BA 4M73A 2NNYA 2IA2A 2LOOA 3PSFA 1LVAA 4EM1A 1R1UA 2EK5A 2CO5A 4CCKA 3S93A 1JUMA 2CUJA 2LLKA 3V4GA 3CF5F 2V4JC 3MKYB 4M6XA 4X6AJ 2Y69H 3VYSB 1ZN2A 2ZMEB 3ROUA 4LG3A 4UVCA 2RDPA 2E35A 3DTEA 5TISC 5E79C 3BROA 1JI8A 1PP8F 2XAUA 2HQNA 4ESFA 1KU3A 1LEBA 3TP3A 2XAQA 2XVCA 2DA6A 1S7AA 2LRDA 4RLFA 2X6OA 4A5NA 2QGUA 2DN0A 3TOAA 3DEUA 1RESA 1Z67A 4A0XA 1K78B 2XSJC 1FLIA 3GW2A 1KU9A 1N75A 3TBIA 1D5YA 3AG3H 2M7AA 3B02A 1ZG3A 1JKPC 2XUBA 3U21A 1BR1A 3DP7A 1ON2A 2DDAA 2L02A 2IBDA 4HNVA 5JLWA 3I59B 3WG7H 4IZZA 2OC6A 3COAC 2D45A 4UXNA 2QA4I 4EJUA 1RIOH 5EGOA 4M3BA 3NWTA 2ZB9A 3FXJA 2KMUA 2L4MA 2R7VA 2DU9A 1A31A 2F5VA 3REOA 1YRNB 1J7KA 4CYCA 2DO7A 2ME0A 2LD5A 3F8CA 5JVTA 2H27A 1MNDA 2K86A 2M8GX 2H1LA 2AHQA 3R6SA 3T8RA 3JTHA 2UWMA 4IRIA 1Z3XA 4MNUA 1ZHFA 2FD5A 1BW5A 4BDYA 1AKHA 3TMOA 1O57A 2B7EA 3LWFA 4XICA 1D1AA 4M3FA 2AXTC 4LD5A 3MVPA 1QZEA 2JUGA 4EVIA 2LBFA 1ZG5A 1ZGWA 1CQTA 3ZMDA 1W5SA 1W7PA 4M71A 1IZ1A 2X6YA 2XASA 3FHZA 3L2UA 4XLAA 5ICFA 2QKMB 1BJZA 2LYCA 1STZA 2VQGA 1JJ8C 4I09A 4KDPA 4UVAA 2DQRA 5J8CA 3E6CC 2XAGA 3TDUC 3I5UA 4HLYA 3DCFA 2CYYA 1IUFA 5D8KB 1B9MA 5EEHA 1IUYA 1JJ6C 4BH9A 4I6ZA 4XLFA 3CQZJ 1JTXA 2Y2ZA 2EZHA 5JHFA 3C2HA 1FIAA 2R92J 3WGHA 1YW9A 1P4XA 4EMSA 2N8GA 3KX2A 2HZTA 1H9TA 3W2VA 2LC2A 1HKQA 3KLOA 4BE2A 4OMYA 3S16J 2MC3A 1EH8A 4PUSA 3PQJA 4BU2A 2VKDA 1TZLA 1WKMA 3AG4H 3BY6A 2X9DA 3A01B 3HSRA 4MLOA 4CCOA 3HL2A 4BBRJ 3L00A 1P4AA 4LB5A 1RZ4A 3MWMA 3OR1C 4B8XA 2CW7A 2QF7A 3F6OA 4M6YA 1VQ5I 4IQJA 3ZQIA 1Q1HA 1MJAA 2A68F 3VYTB 4BQQA 1BC8C 2KIQA 1PUEE 3OYFA 3CLQA 1VQKI 2LKSA 3ZQ7A 5IP7J 4RB3C 3GLLA 3V8KA 2FMYA 2NVXJ 2XGXA 4AYBN 2A3SA 4ZZLA 4QPQA 2Y0MA 4I76A 5CVVA 1Q1VA 1E3OC 5E20A 3W6KB 4CICA 4CCJA 4PSWA 1R4NB 2X6WA 3W6JB 3ZN0A 1MNMC 1YOVB 4AWXB 2XGDA 2E7XA 5TRDA 2M87A 5IT3A 4RAYA 4CYDA 3RZOJ 2DMTA 5E3MA 4IO9F 2EFNA 4M74A 2JVGA 3RPUA 2F4OB 4RB0A 3TW7A 2O61A 1G2HA 5J8FA 1AWCA 1E2XA 2UUZA 1L0OC 5M5WJ 5KAIC 5K7HA 1PUFA 2NVTJ 3DPUA 3E5XA 2WY8Q 2VKEA 3AKZA 3QPTA 3HPHA 2ZJQF 3U2RA 2KRCA 3ZN1A 2V1UA 2DA5A 4O6JA 2OQGA 2NYXA 2E1MB 2F4IA 2V6EA 4A3GJ 1OCRH 3HRTA 2WB1N 3CDLA 2VBZA 3IKTA 1SFUA 1VQMI 4IXAA 2WA0A 1G6NA 3SZPA 4CDGA 1UG0A 2CFOA 5DUKA 3LQRA 3K4KA 3CJTB 3OOPA 4BY1J 2ELJA 3KLNA 1LPQA 3BT9A 4RM2A 5GPAA 3WHCA 2WAEA 2BY0A 3LOCA 3LMMA 4XK4A 1GXQA 1YI2I 2KL4A 4AVZA 3KP5A 1RC9A 5HLIA 4WXDA 4L5JA 3LA2A 2FOWA 3GO5A 3ZQQA 4GRIA 3GTGJ 1TT0A 1WGXA 3RQ4A 1R9TJ 2CWEA 1A6IA 3VPRA 3WG9A 4BAYA 1ETVA 4S0HB 4HF0A 2HYGD 2IVMA 1V3FA 2KRHA 3BCBA 3O8GA 3TO7A 3C18A 3GMEA 3SZTA 1FSHA 4E7ZA 3KZZA 4IRGA 2ZXWH 1N77A 1QGPA 3OYHA 5AONA 3OS1A 2YSRA 3I53A 4OWRB 3L9FA 4KT5C 3RYPA 3CMAI 2UXXA 2E7WA 3L2RA 4IHXA 2CG4A 1ETYA 3VDXA 4EQQA 2HTJA 4C2TA 2LREA 4PZJA 5HDGA 4BXFA 3ELKA 4UUVA 4E7SA 3IWFA 2KLOA 2DJNA 2H6CA 5LRSA 3K4NA 3V42A 4EATA 2G9WA 3S8PA 1XSVA 3VOEA 4PK4A 2JPCA 3E1SA 4LITA 1U5TA 1OCCH 4HAMA 3TGNA 1VQLI 2V9PA 3E97A 3AL0B 3JR9A 4L9TA 4U7DA 2AO9A 2M45A 1MIJA 2Y30A 3R0AA 4BHCA 4A3MJ 1T33A 3H36A 4HOBA 5J1RA 3FMRA 3H5NA 3I3LA 3GTPJ 4BXXJ 1XS9A 2MABA 3Q9SA 3BR5A 2F5EA 1T6SA 1JUSA 1V55H 1R1TA 2HOSA 2CUFA 2DQLA 2DI3A 2QZ8A 3FM3A 4E7IA 2QM3A 3ERMA 3EYYA 4RMNA 4P9FA 1JKOC 3K4CA 2XRLA 2PJRB 3PJRA 2DA3A 2JPBA 3EUHC 2ZJPF 4U88A 4YFKF 4BQAA 1BR4A 2RQPA 2Z3YA 3MN2A 5DYMA 2FMLA 3QYBA 4BEHB 1IAWA 5D6EA 2JTVA 4RA2A 4CCNA 2R7RA 3BQZA 1LB2A 3PSIA 1XB4A 3BC8A 1ODDA 3K0LA 4QLCU 2Q8KA 5ED4A 4XMYA 1IF1A 4HBLA 1BBYA 2OTLI 5JLXA 1EH7A 4KT6A 2L5QA 1WJBA 3JRBA 5ICCA 1MDMB 2K9NA 5KVRA 2CV1A 1SMTA 3OYJA 2M8EA 1G59A 4HF1A 1OQYA 1EV7A 5EYRA 2WADA 2EFPA 4YEJA 5HS8A 1U78A 5HLTA 1QVTA 1Z77A 2EA4A 1FP1D 2P5LC 4EJOA 1EKEA 1MMAA 2E5NA 3PM1A 2DK5A 1VQ6I 4WXHA 1FBQA 1EH6A 3EDPA 3IUOA 1QPIA 1ZK8A 1AOYA 3AFHA 3BR2A 4ZYDA 5GTHC 1Z6TA 2Z2SB 4D5FA 3K6GA 3I58A 3WU2C 2CJJA 3JRCA 3HOSA 5F6FA 3EETA 2LNBA 2NS7A 3RJPA 1TWFJ 2V79A 1IRZA 5F1JA 1YG2A 3HPGA 2DMUA 1U9OA 3LA3A 5AIPA 1FNNA 2WAQA 2IW5A 3HRUA 4Y33A 3V7SA 1XCVA 2Z1DA 3OYIA 1XDSA 3I71A 3SDBA 1Z0XA 2CU7A 2ISYA 3C1DA 2H09A 1E3PA 2HQRA 1D1BA 5EZGA 5CVJA 3QOEA 5ILVA 4JYKA 3D5RC 4WK8F 4IOCF 1OMIA 2IGMA 2DCEA 3BR6A 1XCBA 1LEAA 5CJ9A 4F3QA 2DAOA 2YUSA 4OIPF 2XIGA 5DTDA 2O9LA 5GAHJ 2CUEA 2YR2A 2I10A 2GOMA 3K1NA 2NS8A 1I27A 1S7OA 1HBXG 1K6YA 4BE1A 1RUNA 1F9NA 5B3SH 4DZJA 2MD0A 1POGA 2AQEA 3FISA 4E4HA 4Y17A 5A2QK 5TJJA 5KNLA 1FYKA 3IH4A 3KZYA 3F22A 2Z33A 1FYLA 1ZTRA 4XLCA 3CDHA 4ZZDA 2VT3A 3W2WA 4NQWB 1XMAA 5HLGA 1S6LA 2BGCA 2DMQA 2KHMA 1MJ9A 3OSGA 4ZDPA 4NB5A 4ENKA 1R1VA 3LA7A 4CXFA 3CCUI 3BLYA 4QPOA 4OAZA 3OIPA 4A6DA 1YIJI 3JSOA 3GWZA 2ZXJA 2R5YA 1B59A 1MMNA 4LG0A 4E7LA 3OYEA 2QEXI 2VQLA 3F8BA 3VWBA 2DT5A 1W1WE 4E7JA 4XOTA 1KA8A 5L3CA 3E6BA 3RYRA 4M9ZA 1J59A 4HW0A 1OCOH 2BVLA 4Q48A 1IN8A 4AIJA 2EZIA 3MZYA 2FX0A 3GYHX 2RREA 5HODA 4IHYA 1IXCA 1UB9A 1S7EA 2UZKA 1YJWI 3KYLA 3EUKL 2JA7J 2K9QA 3MCZA 1LUJB 5EDNA 2K3PA 1FP2A 2A05A 2FBKA 5BMZA 4HYEA 5F1RA 1MW7A 1TWHJ 5DCMB 3OYLA 1SAXA 4A3EJ 3S3MA 5KHDA 4Z6YA 1KONA 3V7CA 4ENJA 3ZCOA 2DMNA 4G7ZF 4GCVA 2K4JA 3PO2J 3CUQB 1MMGA 3ESWB 5J3LA 1BIAA 3MD2A 3PQKA 2VN2A 3GTMJ 2LY9A 3OSFA 2IJLA 3BWGA 3HXLA 3ZPLA 4PGGA 4HDUA 2KIMA 2DFFA 3F21A 4JX5A 1LJ9A 4Q47A 1W7PD 5BPIA 4J00A 1T95A 1Z3YA 3CTAA 2K9MA 2ELHA 5EGOB 2LG4A 2QSFX 1FSEA 1HC8A 2CQXA 5ICEA 3CESA 4PFOA 3OV8A 1ON1A 1K4SA 2M30A 2NAZA 2H94A 4Q5SF 5GP9A 1WJEA 2BHZA 5F0HA 2I8DA 2HVSA 2GIZA 2PMHA 3BR0A 1MH3A 4IRHA 3OYMA 1AKHB 4NHJA 2EBIA 3H9JA 1SFEA 4YIFA 4JP0A 4KYWA 2B63J 5DUIA 4ETSA 5F27A 2B0LA 2HTSA 1R5ID 1XMKA 1N78A 2CUZA 4IL6C 5E8GA 4D7NA 1BW6A 2WAFA 2R7QA 2E36A 1V4RA 1JHHA 3MFKA 1LFUP 3NRVA 3RKYA 3NARA 2HQ5A 2KDOA 1YIOA 2EV0A 2WAQN 1QRYA 1DPRA 3V7RA 2BW3A 1G3SA 2PN6A 4OIOF 1ETKA 2CQNA 3O6BB 4MFDA 4MEXF 2Q0OA 3ECOA 2DT7B 2DOFA 2GA1A 2LTPA 1BI2A 2ADUA 4LB6B 2HOTA 2Q1ZB 3FXUA 2AQFA 4HLXA 3KE2A 1U2WA 3P9CA 1LKXA 2IS6A 1LE8B 2O5RA 4M3EA 2PFBA 4P55A 2O03A 3K7AJ 2IPQX 2F5FA 4JQFA 3VEPA 2KJCA 3OYBA 3H3ZA 2GIVA 1D1CA 5EEAA 2JA6J 3RI4A 1G3TA 3RPUD 1P7IA 2RKHA 5LRRA 1I1GA 2JZYA 3OS0A 2EV5A 2Q2EB 3H5RA 4A5MA 3Q0VA 3ZMVA 3FBIB 3TDZC 1UAAA 3LFUA 3I4MJ 1JXSA 2BBYA 1O3SA 2BE5F 1DP3A 3F8FA 1PVEA 2CSOA 2L3DA 1PYVA 2JRMA 1RI7A 3BTJA 2QQBA 1B72B 1APLC 4BKXA 1REPC 3NAUA 2QQ9A 1IXRC 4FCYA 3HZJA 5LEKA 3CCRI 1FX7A 2NXNB 4LFUA 2XB5A 4CZZA 1TC3C 2JA8J 3U9GA 3FXKA 2PLYA 2X4HA 3MQ0A 4CO8A 1QU3A 1C0WA 1RR7A 2DYRH 3M8FA 4IHSA 1OCTC 3ZMTA 4C2MJ 3H9QA 4AUXA 1IDZA 3HGGA 2R93J 1SFXA 4OINF 2FQ4A 1V54H 1KU7A 3Q9VA 1YYVA 5JI6A 2M7BA 3JAMZ 1BOBA 2LR8A 4OAYA 1ACIA 3CP2A 1ZLKA 1KQ0A 2PQ8A 1PUFB 2WB1A 4I99C 1MMSA 1VQ4I 4D7MA 4CA0A 3D1NI 1WRJA 3ZMSA 1VF9A 1A5JA 4YELA 3S14J 2DTZA 2MA3A 3OR2C 3T0YA 3GZ5A 4XLNF 2G0EA 1P2FA 3IH2A 5CYVA 1NK2P 3HC7A 1HKTA 2QVOA 4ZJZA 1YITI 1R7JA 3ZXSA 3BPXA 3EPZA 3CCMI 5HS9A 2VJIA 3FKJA 3SFZA 4GFBA 2OUMA 3S3NA 2RNJA 4ZYEA 5M5YJ 5FD5A 3OL3A 4KN7X 5E18F 2MLKA 5LHHA 3PNVA 4F93B 4P5OA 5C4JJ 2QQ8A 4FASD 2KZGA 4KIBA 3VODA 1IRFA 3RKQA 4ON0A 3BR1A 2VJ4A 4HEA2 5HOOA 4JOMA 1AA7A 3E5UA 1TQPA 3DF8A 2VBXA 1YX5A 2ISZA 1Y0UA 4ZH4F 1G8XA 4DIQA 3QRFF 2JN6A 3HHGA 4HSRA 1U5TC 3S15J 1X1CA 1P9QC 4F92B 1MJBA 3QPSA 4U87A 5FFXA 3VYRB 2GA2A 1B8IA 4HRIA 4TV7A 3TEDA 4B09A 1ONVA 2LY1A 2DXIA 1W0UA 3TKYA 4GO1A 4HX7A 1T2KA 3JCUC 1DU6A 1J0RA 2R5ZB 1DU0A 2EB7A 2XPUA 3FKIJ 1X4OA 1R5GA 4PJJA 2F2EA 2QUFA 1K7AA 1D0XA 1T98A 1WI3A 4RS8A 5EF6A 1FJLA 5C4XJ 2R4GA 4Z2YA 4XBFA 3KYCB 4B1RA
chains in the Genus database with same CATH topology
2XF6A 3H0DA 4OWRB 4XNFA 2HU9A 3L2RA 1HA8A 3VDXA 2DJIA 3VSLA 1SFKA 3LSMA 2HDWA 2KZVA 4C2TA 2MC4A 2LREA 4BXFA 2VQCA 4HNUA 4E7SA 2KLOA 2PMZA 4XKBA 3K4NA 4XKWA 3G2BA 3V42A 4EATA 3S8PA 4CSWA 4PK4A 5LFAA 3E1SA 4XORA 4LITA 4HG2A 2CH0A 4Y4RA 3AL0B 2R7TA 3TL4X 3OIQA 2VLAA 4ZYAA 2KQRA 3IAS2 5TGTA 3H5NA 3I3LA 3L2QA 2ZXIA 3J7AY 5CQEA 4F91B 3VYUB 2MABA 2UV1A 3L2VA 3OYNA 4ZDLA 4E7IA 2CW8A 4C30A 4RMNA 5FROA 2W7NA 3K4CA 2PJRB 3PJRA 4PJLA 3EUHC 2V9KA 1GLNA 1V5EA 4CUGA 1BR4A 3LSKA 3PL8A 4DBRA 4BACA 2V26A 3W3CA 4BDZA 3QYBA 4BEHB 5HVQC 2VQHA 3LSIA 2LY2A 4CCNA 2R7RA 3VSKA 3PSIA 2PJRA 3BC8A 3QODA 1QHHD 4XMYA 2XC7A 2E5ZA 4KT6A 2L5QA 1WJBA 2W82A 3C2GA 4RLQA 2X1DA 2ZFUA 4DGWB 3SEQA 2CV1A 2HNHA 3OOUA 3OYJA 3PNTA 4CH7A 1G59A 1NG7A 4HNTA 4IX7A 1X19A 2WADA 2IXSA 3DTIA 2NOJB 3MKZA 4YEJA 5HNFA 3DPLC 1EA3A 2VXZA 2X85A 2DT6A 2HPIA 5HLTA 4PSXA 4RM3A 4CZCA 1X4PA 3CP8A 1MMAA 2E5NA 2DOAA 3OYKA 2HQAA 2A5WA 2R7UA 3IUOA 2HPMA 3EUAA 3AFHA 2JA2A 1IRXA 2V1NA 2Z2SB 1FMVA 3K6GA 4BUPA 4E6KG 1X1BA 4FETA 2IGNA 4XKCA 5CQGA 4R79A 3HOSA 3DKXA 3L2WA 2M3AA 4CCLA 1PJRA 2Z16A 1V5GA 3BCAA 3HPGA 1WJDA 2WY7Q 2WAQA 3OYIA 1SAUA 4Y33A 2Z1DA 4XM3A 1D0YA 3K10A 3K4MA 1WJ5A 5LD2C 5FRNA 2R7XA 2CV0A 3SDBA 1Y6IA 3HUGB 1X1DA 3RSNA 4II3A 2JSPA 1D1BA 3IAM2 1WFXA 3QOEA 2MFZA 4YRVA 3D5RC 2R7WA 2IGMA 2BOLA 3QYFA 2DCEA 3OYDA 4BJTA 4F3QA 4H4KC 3H35A 1YE9A 4D9JA 2IS2A 1OR7C 4XONA 3UR3C 2L9NA 3CF2A 3DKYA 3DWLE 3BG6A 4D1QA 2GOMA 3CJRB 3ZR8X 3K4JA 4HSTA 1K6YA 4BE1A 4NNJA 1OLTA 2VKHA 3A4CA 3K4LA 2MD0A 4DBQA 4C2UA 1LFPA 2IGKA 3RTRA 1ERDA 2AQEA 3GBGA 4E4HA 5KNLA 4ZTFA 2VJJA 4XLCA 3W2WA 4NQWB 2KHMA 4BL0B 3HG9A 4ZDPA 3OYCA 4BE0A 4KJZA 2HVQA 2FUG2 4IQ4A 3BLYA 4QPOA 2CV2A 4OAZA 3OIPA 1LDKB 4KISA 1MMNA 4E7LA 2BVMA 2IS1A 4XL9A 4KITB 2VQLA 3OYEA 3VWBA 3M8JA 4II2A 3OYGA 4XQFA 2V7FA 4E7JA 4AYBA 4XOTA 3H9GA 2KP6A 4E7KA 4B48A 2BVLA 1D0ZA 2HVRA 2RREA 4XN3A 3OYAA 2W00A 4ZDOA 2L9SA 1Z7LA 2CS3A 3KYLA 3EUKL 4B3XA 3OS1A 4ZTJA 2X1EA 2M0MA 2VASA 2VL8A 3K4BA 2K3PA 2LOOA 3KEYA 3PSFA 3OY9A 4N4OB 2VIXA 1MW7A 3OYLA 4IKFA 1FMWA 3CZ6A 4CCKA 3S3MA 5KHDA 3DTKA 3S93A 2CUJA 2X1CA 2WBMA 2V4JC 3MKYB 1S9HA 2RNGA 3VYSB 3K70D 1KONA 2E1MC 3UNGC 3ZCOA 1BR2A 2CMPA 2HZDA 3QYEA 4LG3A 4U7BA 3D5LA 3DTEA 1MMGA 4C9YA 2W4SA 3E0JB 1JI8A 3K70C 2XAUA 3MD2A 2A6TA 1NG6A 1MMDA 3HXLA 3M1CA 4F52A 2LRDA 4RLFA 3W2AA 3DQVC 4J00A 3OS2A 1T95A 1Z3YA 2K9MA 2P0WA 2XF5A 1VZ0A 2LG4A 1R6RA 2XSJC 4PJNA 3DU5A 1N75A 3TBIA 3CESA 4PFOA 2M7AA 4XN0A 3U21A 1BR1A 4BJ5C 4E7HA 3OYHA 3DLAA 1WJEA 4LIUA 4F93B 3PFYA 4IZZA 2I8DA 2OC6A 2HVSA 3NWTA 3OYMA 3HKZA 2KMUA 2R7VA 3H9JA 1T0FC 2ZXHA 1DQUA 3FBNB 2F5VA 3OL4A 1MNDA 3S32A 2BW3B 4AU7A 1N78A 2CUZA 2MYSA 3A2KA 4XLEA 2UWMA 3ONQA 2WAFA 1Z3XA 2R7QA 1WJCA 3LL7A 4BDYA 4NUBA 3TMOA 3SZGA 2KDOA 3ZRGA 1D1AA 3CJQB 2X6XA 2BW3A 1YX3A 3S3OA 3AL0C 2VXDA 2JUGA 2X51A 1W36C 2LBFA 4ZC3A 3PNYA 2DT7B 3BG7A 2M4GA 2K9LA 2X6YA 2Q1ZB 2AQFA 3I9V2 3L2UA 4XLAA 2QKMB 1LKXA 2LYCA 2VQGA 2O5RA 3IP4B 4LIVA 4PJMA 5FRMA 2IS6A 4JQFA 5HNHA 3OYBA 2K5CA 1D1CA 2M4KA 3SEZA 3RPUD 3LSHA 3OS0A 1DGRM 2JVHA 2Q2EB 4XLFA 4B47A 3H5RA 4BJ6C 2XDVA 4XKVA 5JHFA 3C2HA 4B43A 1MNEA 3FBIB 1UAAA 3KX2A 3LFUA 4DJAA 1DP3A 3W2VA 2LC2A 4BE2A 4F55A 4BGDA 1PYVA 1QHGA 4PUSA 4BU2A 2VKDA 1TZLA 1U0JA 2ZSIB 4MLOA 4CCOA 1UELB 3HL2A 1QU3A 3OR1C 2CW7A 1Y56A 2R7OA 4IQJA 1WJFA 3H9QA 1E0EA 3VYTB 4BQQA 3OYFA 2RQQA 3OWTA 2OV7A 2M7BA 4DOZA 1BOBA 4OAYA 3DPTA 4QPQA 3CP2A 4G6TB 3N05A 4CCJA 2WB1A 4PSWA 2X6WA 4HPQA 4CA0A 3DU6A 3CMMA 4YELA 2F6CA 3PUBA 4BQNA 3OR2C 3MKWB 4ANJA 2GOXB 3HC7A 2JVGA 3F9KA 5KCMA 4ZJZA 3ZXSA 2VB6A 3EPZA 2UUZA 2VJIA 3FHNA 4NC7A 3FKJA 4BEHA 2OUMA 3DPUA 3S3NA 2WY8Q 1LVKA 2L2OA 3AKZA 2IGOA 3HPHA 4PFPA 3OL3A 2KRCA 2R7SA 4N4NB 2LH9A 2E60A 3MMYB 3PNVA 4NC8A 3H5AA 4P5OA 5CKTA 2E1MB 1J09A 2F4IA 2V6EA 2W1OA 4FASD 2L7KA 3A1YA 2Y0SA 3HOTA 4CCMA 3SYTA 2VJ4A 4HEA2 5HOOA 4JOMA 1AA7A 2WA0A 1YX5A 4J01A 1UG0A 1G8XA 2CFOA 4B44A 4DIQA 3K4KA 4P1WA 4HSRA 3DEEA 2ELJA 3D5SC 3RCOA 1X1CA 2QKLB 4RM2A 1P9QC 2KPMA 2VPLA 4F92B 2WAEA 3FDYA 3LMMA 5CPRB 4U87A 3VYRB 4BQOA 2ZSHB 1Z21A 4HRIA 2KL4A 3LSGA 4AVZA 2LY1A 2DXIA 2LBFB 2XF7A 3ZGKA 3ZQQA 4GRIA 2VJ5A 1TT0A 3OMYA 3RQ4A 3NWSA 4X0GA 1DGWY 4XOPA 1W36D 1X4OA 4PJJA 1WJAA 4ITVA 2KRHA 3BCBA 2IS4A 1ZELA 4XLHA 4Y3OA 1D0XA 4E7ZA 2R4GA 1N77A 1X1AA 4XR6A 4BS9A 1V5FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OR1 C;  2V4J C;  2XSJ C;  2A5W A;  1YX3 A;  3OR2 C;  1JI8 A;  1SAU A; 
#chains in the Genus database with same CATH topology
 4AM3 A;  2XF6 A;  2H8W A;  1HA8 A;  3PUF A;  2FJ1 A;  1R49 A;  2VBY A;  1BM9 A;  5D4R A;  1O4X A;  3LSM A;  1F1Z A;  2KZV A;  2OAZ A;  4AD9 A;  1FWZ A;  4A93 J;  1O3T A;  3FXO A;  3F72 A;  4HNU A;  5LGN A;  1UCR A;  3GTL J;  2F48 A;  2PMZ A;  3S1N J;  4FHT A;  2Y9Z A;  5LGT A;  2DA7 A;  4CHU A;  4UUS A;  4KN4 X;  4XSX F;  3HDD A;  1G3Y A;  1W0T A;  3QAH A;  3H92 A;  5IYD J;  2W48 A;  2VE9 A;  5L3G A;  1WH5 A;  3TL4 X;  2VLA A;  4ESB A;  4C3I J;  4ZYA A;  3WTS C;  4G12 A;  2KRF A;  2OBP A;  4AC0 A;  5LHI A;  2KQR A;  1K6O A;  2EV6 A;  5D6F A;  5IY5 H;  2GXG A;  2X48 A;  2ZC2 A;  3QPH A;  1D8K A;  4HQE A;  3MZH A;  3ZQG A;  1HF0 A;  1F43 A;  1ZRD A;  2DA2 A;  5IYB J;  2K4B A;  3GTK J;  3C3W A;  2HXI A;  2R3S A;  1ZRE A;  2W7N A;  1K61 A;  1GVJ A;  4UUT A;  4YG2 F;  2KIS A;  2LKP A;  4PJL A;  3L1P A;  2NVY J;  1HQC A;  2EZL A;  1GLN A;  5K1Y A;  1WHU A;  3I0T A;  4HZF A;  2DBB A;  2L7F P;  4CUG A;  4M3G A;  4PCQ A;  3PL8 A;  4ENN A;  2CQK A;  2ZBK A;  3CD6 I;  5K5Q A;  2OA4 A;  2RC4 A;  3ASN H;  1X2N A;  5HVQ C;  5HS7 A;  4G7H F;  4NBQ A;  2DFI A;  1FT9 A;  3JRI A;  2M2E A;  3M3Y J;  4QIW N;  3Q0U A;  1J5Y A;  2V1D A;  2Y75 A;  2R7D A;  4W97 A;  2LVS A;  2RVC A;  3CO7 C;  3SEQ A;  1MBG A;  1T08 B;  2HNH A;  1VQP I;  1IW7 F;  3W6V A;  2IXS A;  4O5V A;  5HNF A;  3ABK H;  3LST A;  2OQR A;  4L0Y B;  3JW4 A;  3PIP F;  3CP8 A;  2MBF A;  1IC8 A;  2ZME A;  4UV8 A;  2E2J J;  3OYK A;  1GT0 C;  2CQQ A;  3ABM H;  3AG2 H;  1U3E M;  1MBK A;  2PX9 A;  2EIM H;  4FE7 A;  1MBJ A;  2DMP A;  2JA2 A;  2VON A;  1IRX A;  3PFI A;  2V1N A;  1XMX A;  3BG5 A;  1VTN C;  1UHS A;  1TW2 A;  4KNY A;  5K5O A;  5D5W B;  5E17 F;  4FT8 A;  3E7L A;  2IGN A;  5CQG A;  2VBW A;  1B6A A;  2M3A A;  1O7F A;  2ELK A;  2LF7 A;  4XRS G;  3J7Z I;  1DUX C;  3IRQ A;  4M72 A;  2IA0 A;  1K78 A;  4L9N A;  1SAU A;  1XC5 A;  5LD2 C;  3K10 A;  3LAJ A;  5FRN A;  5C44 J;  3K9T A;  2G7U A;  1HCR A;  4N9H A;  1FOX A;  1QA6 A;  4II3 A;  5BOX A;  2KIU A;  3SDG A;  2LF8 A;  1YJN I;  1R71 A;  2MFZ A;  4YRV A;  3E6D A;  3FWE A;  4EM2 A;  2Y9Y A;  3I59 A;  4BJT A;  5DV5 A;  3JSP A;  3H0G J;  4H4K C;  3H35 A;  3ZP5 A;  4FQG A;  1YE9 A;  4L0Z B;  3HUG A;  1T56 A;  1A35 A;  3CF2 A;  1XSX A;  2XPW A;  1SFO J;  1B4A A;  5DM7 F;  3ZR8 X;  4MEY F;  5B66 C;  1AU7 A;  5J6X A;  2FNA A;  4M9X A;  2H6B A;  2E1N A;  2NVU B;  1HDD C;  4PJ0 C;  2VKH A;  1LFP A;  4FX4 A;  1VQO I;  3X2Q H;  3H3V K;  5E1W A;  2HGC A;  2R5Y B;  3GBG A;  4ZTF A;  1RUO A;  1HXD A;  2DPU A;  2VJJ A;  3QWL A;  5K7Z A;  5IP6 A;  4I98 B;  3J7Y J;  1GXP A;  4BL0 B;  3HG9 A;  4BE0 A;  3N4M A;  1GUU A;  1TNS A;  2PBI A;  4KJZ A;  1O3Q A;  1NTC A;  4CGZ A;  3J81 Z;  4KIC A;  3CC4 I;  1QQI A;  1LDK B;  4HX4 A;  4XID A;  5FLX Z;  3FZV A;  3GFJ A;  5FLV A;  2BVM A;  3L7W A;  2PMZ N;  3DV8 A;  3CCJ I;  3M8J A;  2YU3 A;  4II2 A;  3TQN A;  4HF2 A;  3R4K A;  2OJE D;  2H8R A;  2BHY A;  2KP6 A;  5E3O A;  1CF7 B;  2CGP A;  1ZAO A;  1VFC A;  1D0Z A;  2DOE A;  4W1U A;  1GHC A;  1IV8 A;  2W00 A;  2VI6 A;  1WSU A;  1RPW A;  1IN5 A;  1Z7L A;  2OTJ I;  4ESJ A;  1A36 A;  3WOD F;  2VAS A;  1DP7 P;  5LGU A;  3SJM A;  2K9S A;  3BJO A;  1K83 J;  3CDI A;  2VIX A;  4FE4 A;  1FMW A;  3HB9 A;  3CZ6 A;  2EIN H;  4DW6 A;  3WTX C;  3DTK A;  2X1C A;  4MIM A;  4IHT A;  4EJW A;  1TP4 A;  2MD5 A;  3KP2 A;  5IOZ A;  3K70 D;  1BI1 A;  3UNG C;  3A01 A;  2HZD A;  4QSH A;  3U1K A;  1MGT A;  3D5L A;  2J5P A;  2EWN A;  2VC1 A;  1BA5 A;  3K70 C;  3ML6 A;  5D5V B;  2ZJ2 A;  3JRG A;  3HOW J;  1NG6 A;  2EIL H;  3BOQ A;  3O8H A;  1JGG A;  4HV6 A;  1BC7 C;  3F6V A;  4LLN A;  2P0W A;  1FBS A;  1R6R A;  4LK1 F;  2HYF A;  1H8A C;  1PDN C;  1WH7 A;  2BY1 A;  3QOP A;  3IRR A;  1FZP B;  4XN0 A;  1BIB A;  2K40 A;  4A0Y A;  3B73 A;  4RB2 C;  4E7H A;  3ZOB A;  4RAG A;  1Z91 A;  3DLA A;  4LIU A;  5EG0 A;  5GTI C;  3P5J A;  4EV0 A;  1JHF A;  2XPV A;  1ZQ3 P;  2PEX A;  3HKZ A;  3E6M A;  2OF7 A;  1ZH5 A;  2DLL A;  2FA5 A;  3RQI A;  3MEX A;  2BW3 B;  5J1Y A;  4AU7 A;  4LLG F;  1TWG J;  2MYS A;  1YS6 A;  1FC3 A;  3ONQ A;  6PAX A;  3DXJ F;  5F08 A;  4AIK A;  3LL7 A;  1MKM A;  3WHB A;  4NUB A;  3CC2 I;  5CVR A;  1S3J A;  3ERE D;  3TOB A;  2EFO A;  1UZC A;  4HQM A;  3ZRG A;  3A02 A;  3A0B C;  2L9R A;  3CJQ B;  2X6X A;  1ZKG A;  1X3W B;  2W25 A;  3CCS I;  4RDU A;  1LDD A;  3S3O A;  3V8L A;  2XAH A;  4EGZ A;  2VXD A;  2V9V A;  2X51 A;  4LJZ F;  1W36 C;  4L5E A;  3PNY A;  3KZI C;  2M4G A;  3BP8 A;  1U8B A;  1T39 A;  3AAF A;  1P4W A;  3S2H J;  5BQT A;  1TNT A;  2DA1 A;  2ZNZ A;  3KEQ A;  3LFK A;  2GQQ A;  1TQI A;  1WVR A;  3CC7 I;  2NNN A;  5HDK A;  2M4K A;  1IV6 A;  5IYC J;  3SEZ A;  5IOY A;  2BXZ A;  3GF2 A;  1DGR M;  1T0F A;  4H0E A;  1VQ9 I;  3IHU A;  2XDV A;  2VOO A;  4XKV A;  1IN6 A;  2NRA C;  1XTA A;  5J47 A;  1L3L A;  2FBI A;  1SD6 A;  2DFE A;  3PIO F;  1BI0 A;  2O8X A;  2FSW A;  3WTV C;  1SVM A;  5LEJ A;  2JQ7 A;  1SEU A;  2HYJ A;  1I50 J;  2V6C A;  2NS0 A;  2XV4 S;  2XAJ A;  4S05 A;  3SFI A;  5LHG A;  3I4P A;  3G73 A;  3GTJ J;  1O3R A;  2ZSI B;  1ZAR A;  1UEL B;  5M3F J;  3FX3 A;  2F4M B;  1Y56 A;  1QZZ A;  3GFM A;  2E2H J;  1E0E A;  4EJV A;  4MTD A;  2R7F A;  4WX9 A;  4OIR F;  1RKT A;  2QLZ A;  4V2G A;  3HTU A;  3V8J A;  1VND A;  1Y1V J;  2KFD A;  3VB2 A;  4DZP A;  1I3A A;  3DBH B;  3OWT A;  5F64 A;  3JAM K;  4WWC A;  4K2E A;  4P96 A;  1HSJ A;  3FIW A;  4PGH A;  2EH3 A;  2QBY A;  4UB8 C;  3I64 A;  1SVO A;  3N05 A;  1JTY A;  1QPM A;  3GUD A;  2ZKZ A;  3CCQ I;  4HPQ A;  1X58 A;  2MGQ A;  3DU6 A;  3CMM A;  5E3L A;  2F6C A;  3PUB A;  2LKX A;  4Y13 A;  1F5T A;  3QP5 A;  4ANJ A;  1RNL A;  2M1B A;  3F9K A;  2VB6 A;  5JFR A;  2M5W A;  3KP4 A;  1MZB A;  1JE8 A;  2PG4 A;  1LQ1 A;  4NC7 A;  4BEH A;  5DM6 F;  3K2A A;  4RGX A;  4I2O A;  1MD0 A;  2OCC H;  1LVK A;  3K69 A;  2IGO A;  5M3M J;  2E71 A;  3HHH A;  2H1K A;  4N4N B;  2JMW A;  2RAE A;  3HSF A;  2BEO A;  3MMY B;  3NEU A;  4NC8 A;  5CKT A;  3H5A A;  4AVP A;  4CYC B;  3GTQ J;  1J09 A;  2L7K A;  2Y0S A;  5GAE J;  4CCM A;  1MDM A;  2O7O A;  1QNT A;  2I5U A;  4J01 A;  2IAI A;  2GM4 A;  4GGG A;  2OCE A;  3R0J A;  1P7J A;  4B44 A;  1R5H A;  3L09 A;  1NH3 A;  2QSG X;  3DEE A;  2QWW A;  3D5S C;  3RCO A;  2VPL A;  2KPM A;  4IVN A;  5E1Z B;  1GVD A;  3LSG A;  2LBF B;  1J2X A;  4D0P A;  4A3J J;  3ZGK A;  2HXO A;  2VJ5 A;  3OMY A;  1HLV A;  4X0G A;  1W7P B;  1I6X A;  2OZU A;  4UV9 A;  1WI9 A;  4EJT A;  3F3X A;  1OYY A;  2O3F A;  3M07 A;  4XOP A;  1QBJ A;  4GDF A;  4ITV A;  5D4S A;  1X3Z B;  3HKZ N;  2XSD C;  1BJA A;  3WE2 A;  3I54 A;  3G1O A;  4G7O F;  2E34 A;  1X1A A;  1ENH A;  1V5F A;  4DYQ A;  2ECB A;  3H0D A;  4XNF A;  3CO6 C;  2HU9 A;  4UUS B;  2W24 A;  3BJ6 A;  2DJI A;  3BTL A;  1SFK A;  4FX0 A;  5DEQ A;  3VSL A;  2HDW A;  2MC4 A;  3VFZ A;  2VQC A;  4WF2 A;  1UMQ A;  2E2I J;  5E8I A;  5FLM J;  4UY8 I;  3K2Z A;  3IC7 A;  2CW0 F;  4HX8 A;  4XKW A;  2P5V A;  3G2B A;  2KJB A;  3IKV A;  2R0Q C;  2JWT A;  2GBY A;  4CSW A;  4A6E A;  5LFA A;  5EJC A;  5CLS A;  1ZRC A;  2F5D A;  2P6T A;  2DK8 A;  4RGR A;  3HYI A;  4KIF A;  1UFM A;  1WWX A;  4JK1 X;  4Y4R A;  4A12 A;  3S17 J;  2R7T A;  1KYW A;  2XGC A;  3OIQ A;  4WCG A;  4KMU X;  3FK6 A;  2FXA A;  2OU2 A;  1GV2 A;  1I5Z A;  3IAS 2;  3BDD A;  3DEW A;  1R58 A;  1BL0 A;  2KKO A;  2AS5 F;  1VQ8 I;  1EF4 A;  1Z9C A;  5TGT A;  2F5C A;  2ZXI A;  5D5U B;  3J80 Z;  1NK3 P;  5CQE A;  4F91 B;  3WTU C;  2ZME C;  3L2V A;  2VKV A;  3FXQ A;  3IL2 A;  1XGM A;  1VQN I;  2CW8 A;  3JRD A;  1RR8 C;  1XX5 A;  2LSO A;  5K7F A;  2Y31 A;  1IGN A;  1MBH A;  1TT5 B;  2JSC A;  1HST A;  2P5K A;  3BJA A;  3LNQ A;  4RAZ A;  1E17 A;  1LNW A;  1S72 I;  4IOA F;  2L0K A;  2P4W A;  3S2D J;  3KP7 A;  3LSP A;  1Z05 A;  5ILS A;  3LSK A;  4BAC A;  4N9I A;  5K5R A;  2V26 A;  3W3C A;  3I56 I;  5F0C A;  1N25 A;  4A69 C;  1QVU A;  4NC6 A;  2VQH A;  3GEZ A;  3LSI A;  2ESH A;  3WGI A;  3VSK A;  1YHQ I;  2DOD A;  2ME6 A;  2B9S A;  1QHH D;  2P7C B;  2WV0 A;  1OYW A;  1XG1 A;  5FD6 A;  4A3F J;  4I7H A;  1XGS A;  1OCZ H;  4IEJ A;  2WC2 A;  1SAN A;  2CQ7 A;  5IT9 K;  1KQ8 A;  2W82 A;  4I0A A;  1XD7 A;  1TW3 A;  2X1D A;  1BOA A;  1YW8 A;  3M1E A;  1DPU A;  3N97 A;  3OOU A;  3PNT A;  4CH7 A;  2E1O A;  1NG7 A;  5DS9 A;  1TL8 A;  4IX7 A;  5JHU A;  1Y0N A;  1XDU A;  2KT0 A;  3O3K A;  4MO7 A;  2NOJ B;  3RKX A;  3MKZ A;  1SMY F;  5DCM A;  1XGO A;  1EA3 A;  2HPI A;  4EM0 B;  4PSX A;  3ZQL A;  4AID A;  5JR3 A;  1FYM A;  3HM5 A;  2EPF A;  1X4P A;  2DW4 A;  4JBA A;  4RB1 A;  3HOZ J;  4IHV A;  3KET A;  2A5W A;  3ABL H;  2BY3 A;  3B6A A;  3SQN A;  3RDI A;  3U1D A;  4L9J A;  4B3A A;  3G71 I;  1H88 C;  3CUQ A;  3EUA A;  2ESN A;  2JT1 A;  2YX7 A;  3GFL A;  1FMV A;  2EFQ A;  2ID3 A;  4FET A;  1ETO A;  4XKC A;  5FJ8 J;  5J4V A;  1YLF A;  3MZ8 A;  2D1H A;  2FF4 A;  2Z16 A;  5J40 A;  1IG7 A;  1JGS A;  3BCA A;  1WJD A;  2HDC A;  2P81 A;  2VOD A;  1VI0 A;  2Y0S N;  1D0Y A;  2R7Z J;  2R7X A;  2CV0 A;  3ZQH A;  3HUG B;  2P8T A;  1X1D A;  3RSN A;  3WGG A;  1Y39 A;  3P7N A;  2LK2 A;  5EEG A;  3KIO A;  2D2W A;  4R1H A;  3LSJ A;  2R7W A;  1XSD A;  2EQR A;  3M4O J;  1E3H A;  1S29 A;  3G1M A;  1FY7 A;  3GTO J;  3JTG A;  4A3K J;  1ZRF A;  2OZ6 A;  2YPR A;  4KMF A;  1U5T B;  1MSE C;  3KFW X;  4BNC A;  2COB A;  2MW8 A;  2IS2 A;  4XON A;  3S1M J;  1UG2 A;  3EQL F;  3DKY A;  4RBO A;  3BG6 A;  3CJR B;  3GZ6 A;  3BZC A;  2STW A;  4HST A;  3HRS A;  2BXY A;  2WV1 A;  4NNJ A;  1OLT A;  3HOY J;  1ERD A;  4C2U A;  4U0V A;  4EEF G;  2IGK A;  3TO6 A;  3RZD J;  1SC7 A;  2PI0 A;  1U6G A;  4HA8 A;  5GPC A;  5FGM A;  1ZR4 A;  2ZNY A;  5L3B A;  3HGY A;  1Z1D A;  1ITY A;  2EIK H;  4C3H J;  1D8J A;  3OYC A;  4MHG A;  3CCE I;  3J81 K;  2HVQ A;  1K4T A;  5IP9 J;  5FKK A;  2HKX A;  2ZO4 A;  4IQ4 A;  2CV2 A;  2HI3 A;  3ZMZ A;  2K85 A;  3S1R J;  5FLX K;  1JKQ C;  4KIS A;  3Q0W A;  2IS1 A;  3HSE A;  4XL9 A;  2VOP A;  5ICG A;  1LE8 A;  5H20 A;  2ID6 A;  4E7K A;  3H9G A;  1F4K A;  2IT0 A;  3E5Q A;  4KA4 A;  2BYV E;  3CLO A;  4B48 A;  1IRG A;  1QO0 D;  2VUM J;  4YFX F;  2QYO A;  3G3Z A;  3HBL A;  2BZT A;  2HVR A;  3HJE A;  2C6Y A;  1G4D A;  1JT6 A;  1TTY A;  4M9S A;  3OYA A;  4MQV A;  1YQA A;  4ZDO A;  2Q2E A;  3DLL F;  1KU2 A;  1OR7 A;  3BG9 A;  2CS3 A;  4N0B A;  1B1B A;  4B3X A;  1FPQ A;  2FBH A;  3CCL I;  2MH2 A;  4G6Q A;  2ZCW A;  2ZJR F;  1A04 A;  3KEY A;  3OY9 A;  4N4O B;  5IPA A;  1UHM A;  1ETQ A;  3KCC A;  1O7L A;  4IKF A;  2MH9 A;  3DBL B;  3CUO A;  1B72 A;  3F0C A;  1IO2 A;  2WBM A;  5JVG F;  1S9H A;  2RNG A;  2GXA A;  2O8K A;  2E1M C;  4XLP F;  5HDN A;  5IT9 Z;  2K02 A;  1BR2 A;  2CMP A;  2HOA A;  2VE8 A;  5D8L B;  3IV5 A;  3QYE A;  4U7B A;  2LP0 A;  4BHB A;  3JRA A;  4BYY A;  1K79 A;  1MH4 A;  4C9Y A;  2W4S A;  3E0J B;  4GYI A;  2A6T A;  2L7Z A;  1MMD A;  2XHK A;  5B1A H;  3IWZ A;  3F8N A;  2DDB A;  3M1C A;  1U9N A;  4F52 A;  3W2A A;  3TO9 A;  3WU0 A;  4OIQ F;  3DQV C;  5EG0 B;  4R8H A;  4LK0 F;  5BS6 A;  3OS2 A;  1IDY A;  2BV6 A;  2ECC A;  2Y48 A;  2XF5 A;  4YII A;  1VZ0 A;  4QWQ A;  4PJN A;  1XN7 A;  3DU5 A;  3JRH A;  2JK3 A;  2O6G E;  4RAF A;  4BY7 J;  1X1P A;  5FKL A;  5FFZ A;  3M7G A;  4BJ5 C;  1TQM A;  1FTT A;  4XSZ F;  2X0L A;  3PFY A;  1OYI A;  2L4A A;  4Q4Z F;  2HFH A;  3RPQ A;  3I55 I;  2QEN A;  3HEF A;  1T8I A;  4XRF A;  5FKN A;  2RV8 A;  1YFH A;  1T0F C;  2QSH X;  2ZXH A;  1DQU A;  2IEK A;  3FBN B;  3GZN B;  2QCO A;  1ZGJ A;  2IP2 A;  3FXL A;  3H3U A;  3OL4 A;  3S32 A;  3A0H C;  5ERI A;  5LLQ A;  2JA5 J;  3A2K A;  4XLE A;  3R60 A;  1I1S A;  2J5O A;  3TW6 A;  1WJC A;  5H6R A;  1VQ7 I;  2RGV A;  3EYI A;  3QQA A;  1IJW C;  2JUC A;  2HDD A;  3FF5 A;  3J7A O;  3SZG A;  2A61 A;  2XGE A;  3P9I A;  5CVU A;  4M6V A;  5HLH A;  3DFG A;  1YRN A;  2A07 F;  5DD8 A;  2VPR A;  1SD7 A;  2DPD A;  1S5L C;  1YX3 A;  2A69 F;  3T5X A;  3AL0 C;  1TBX A;  3DKW A;  4J19 A;  4ZC3 A;  1GDT A;  5DD4 A;  2M34 A;  3BG7 A;  4B4C A;  2HS5 A;  2K9L A;  4FTH A;  3M8E A;  3KP6 A;  4YFN F;  2YS9 A;  5M5X J;  3I9V 2;  1UHW A;  4UHT A;  2R5Z A;  4LG0 B;  3T8T A;  1H0M A;  4LGW A;  4LIV A;  3IP4 B;  2QQA A;  4PJM A;  3NQO A;  5FRM A;  4A3C J;  3FMS A;  5HNH A;  3GVA A;  4MTE A;  2K5C A;  1R23 A;  2HKO A;  1WPK A;  1P6R A;  1M1E B;  2O0Y A;  5F04 A;  3LSH A;  3FXM A;  3JRE A;  4MGR A;  3S2W A;  2JVH A;  4B47 A;  4BJ6 C;  1IXS B;  3G1L A;  5H2F C;  3WTW C;  3KEO A;  4DYR A;  4YIR X;  4B43 A;  3T1B A;  1W5C C;  4I0B A;  5L3E A;  1MNE A;  1UST A;  1ZYR F;  4OMZ A;  4BXU A;  2HOE A;  4DJA A;  4QTR A;  4F55 A;  4BGD A;  2ACJ A;  2XAF A;  3HOX J;  1QHG A;  2P7V B;  3GFI A;  1FEX A;  5KAF C;  3WU1 B;  4LMY A;  3IH3 A;  5DDG A;  1U0J A;  4UVB A;  1QZY A;  4C3J J;  2CFX A;  3HIF A;  1LFB A;  2ICW G;  3UKG A;  3GX4 X;  3CJN A;  2GLO A;  2PJP A;  4NDL A;  2K3F A;  3M9A A;  2QBY B;  4MFE A;  1AHD P;  1TWA J;  5E3N A;  3H1C A;  2R7O A;  3ZQF A;  1WJF A;  1KGS A;  1R4M B;  4JX6 A;  4KFC A;  3HTS B;  2DYS H;  1NHA A;  2A6H F;  1W4M A;  2RQQ A;  4AIH A;  3BR3 A;  2TCT A;  2OV7 A;  1FBU A;  5H6Q A;  5GAG J;  5LBQ A;  1MBF A;  2GAU A;  2XKP A;  4DOZ A;  3AG1 H;  3DPT A;  3RKW A;  1KYZ A;  4G6T B;  4G9Y A;  1SD5 A;  5AIQ A;  4ZYH A;  1YW7 A;  2K27 A;  2OPT A;  4ZYG A;  2HR3 A;  1BN5 A;  1WCM J;  5J4Y A;  4BQN A;  2HEO A;  3MKW B;  2GOX B;  1ZGA A;  2A6E F;  2LDU A;  1OCP A;  3ABT A;  5KCM A;  1HOM A;  2FOK A;  3FHN A;  4ABZ A;  3CME I;  1IN4 A;  3KP3 A;  1ZG1 A;  4A3D J;  3C2B A;  2L2O A;  9ANT A;  4PFP A;  2W85 A;  2R7S A;  3GCM A;  4V2F A;  3HOV J;  2LFB A;  3BTI A;  2E60 A;  2LH9 A;  2EA2 A;  2OD5 A;  4I01 A;  2TRT A;  2W1O A;  3A1Y A;  4XRS A;  1LDJ A;  3HOT A;  3JRF A;  3SYT A;  1W5T A;  5F0F A;  3CCV I;  5B1B H;  3OIO A;  5GAD J;  1JT0 A;  3WE3 A;  1RRJ A;  4P1W A;  3MKL A;  2QKL B;  3FMQ A;  3Q3S A;  1KQ9 A;  4L18 B;  3FDY A;  5CPR B;  3F8M A;  4BQO A;  2LMD A;  2ZSH B;  1Z21 A;  1KZH A;  1Z7U A;  5C3E J;  2XF7 A;  2XRO A;  3NWS A;  3HOU J;  4G94 A;  2DA4 A;  2FNP A;  1F36 A;  3BQY A;  5FKO A;  1T38 A;  1D5V A;  1DGW Y;  1YS7 A;  3FXR A;  1J75 A;  1W36 D;  3ISP A;  1WJA A;  3I4N J;  4IJA A;  2IS4 A;  2P6S A;  1ZEL A;  2IA1 A;  2ZFW A;  4XLH A;  4Y3O A;  3TP0 A;  1WZ2 A;  4L9V A;  3L2C A;  1BI3 A;  1FTZ A;  2ETH A;  2WTE A;  2XB0 X;  4UB6 C;  4XR6 A;  4BS9 A;  1TWC J;  2TDX A;  4UNO A;  4D5C A;  2G7H A;  3LSR A;  4MQ9 F;  2VC0 A;  3WTY C;  3GLX A;  2COM A;  2PMU A;  1HDP A;  1DDN A;  5FKM A;  4X1E A;  4A2U A;  4F7Z A;  5E1X A;  4XKB A;  2GZW A;  3BPV A;  4DYC A;  3GXO A;  2D5V A;  4I02 A;  1ZLJ A;  4XOR A;  1UJ8 A;  4HG2 A;  5BPD A;  2CH0 A;  3F23 A;  1U8R A;  2FRH A;  3RIR A;  4E70 A;  1YTY A;  1JUP A;  1A6Q A;  3O2P E;  2XKO A;  4WXC A;  3FM5 A;  2GXB A;  1MBE A;  3P9K A;  1I6H J;  3CMY A;  2E19 A;  2FU4 A;  2W57 A;  3ASO H;  5L3F A;  2K7L A;  2CRG A;  3J80 K;  4OU0 A;  3L2Q A;  3J7A Y;  2V1X A;  3C7J A;  3VYU B;  4GXO A;  2L54 A;  2UV1 A;  4Y52 J;  2BY2 A;  3OYN A;  2FQ3 A;  2UXN A;  4ZDL A;  1Y8Q B;  1OJL A;  4C30 A;  3CUQ C;  4KUM A;  4A0Z A;  3BZK A;  1FOY A;  5FRO A;  4BBS J;  3D0S A;  2EJR A;  2AXL A;  2XRN A;  4HDV A;  2VT2 A;  4LLL A;  2V9K A;  4FIS A;  1V5E A;  3WTT C;  3ABU A;  3ECH A;  4U0Y A;  4DBR A;  1CGP A;  2JJ7 A;  2DFH A;  4P9U A;  4BDZ A;  2M0C A;  3MAJ A;  4A3L J;  2EFW A;  2LY2 A;  1CF7 A;  5L3D A;  2STT A;  2PJR A;  3QOD A;  3K1P A;  2XC7 A;  1ETW A;  4ENM A;  2E5Z A;  2E1C A;  3DBR B;  5J1U A;  3C2G A;  5BNG A;  3FK7 A;  4RLQ A;  1ORK A;  1WQ2 A;  2ZFU A;  4DGW B;  1TLH B;  4IF4 A;  1YO5 C;  4HNT A;  3S1Q J;  1RKW A;  3KYD B;  1X19 A;  3DTI A;  2DTR A;  4U0W A;  4RGS A;  1PP7 U;  5KK1 A;  3DPL C;  2VXZ A;  2X85 A;  2DT6 A;  4G8X A;  3ZMU A;  1B9N A;  1H89 C;  1OPC A;  5ILU A;  4RM3 A;  5CVI A;  1B8I B;  2A5Y B;  4CZC A;  4IHW A;  2IRF G;  3ZQC A;  5EZH A;  2DOA A;  3Q5F A;  2HQA A;  2HWV A;  4S04 A;  2R7U A;  4BHP A;  2M9H A;  1P92 A;  3HRM A;  2HPM A;  2JRT A;  2NOG A;  4BUP A;  3EUH A;  4E6K G;  1FOK A;  1X1B A;  4R79 A;  1HW2 A;  3DKX A;  3L2W A;  3QP6 A;  3CCY A;  1Y8R B;  3BZ6 A;  1H9G A;  1R00 A;  4CCL A;  1PJR A;  1YJ9 I;  1V5G A;  1J9I A;  2RN7 A;  2WY7 Q;  4A3I J;  1ETX A;  1FIP A;  2KDZ A;  4XM3 A;  3K4M A;  1WJ5 A;  4M3D A;  3KPH A;  2Z99 A;  1Y6I A;  1HW5 A;  1OFC X;  4PDK A;  2JSP A;  3QU3 A;  1SD4 A;  3IAM 2;  1WFX A;  5FB2 A;  2FEZ A;  3A03 A;  2W84 A;  3SXY A;  4L5I A;  2BOL A;  3QYF A;  3OYD A;  1X3U A;  3LAP A;  5D5X B;  1EJ9 A;  3K1M A;  3BTC A;  4LOC A;  2NVQ J;  4D9J A;  1IN7 A;  1OIS A;  2MSY A;  1OR7 C;  4KIG A;  3UR3 C;  2L9N A;  4O3M A;  3B6C A;  3WTZ A;  2GWR A;  2L01 A;  2YX4 A;  3DWL E;  4OOI A;  4Y7N J;  1HKS A;  4D1Q A;  4DNC A;  4DQ2 A;  3K4J A;  4G6D A;  2EZK A;  4JX4 A;  1XGN A;  2WWY A;  3A4C A;  4DBQ A;  3K4L A;  2D1V A;  3RTR A;  3LQQ A;  4A3B J;  2YU9 J;  5B5E C;  1GV5 A;  5A2Q Z;  1Z6R A;  1I39 A;  4Y15 A;  4HV5 A;  3G6E I;  2Z9O A;  1FOW A;  1G3W A;  2Z5U A;  2FE3 A;  1HW1 A;  5DCF A;  4IPA A;  3QPL A;  2FUG 2;  2MLG A;  2KIF A;  1XPX A;  1OKR A;  1ZR2 A;  1S8N A;  3QU6 A;  4GYG A;  4KIT B;  1ULY A;  1RET A;  3OYG A;  4NQW A;  4XQF A;  2V7F A;  3G4S I;  1Y1W J;  4AYB A;  1SVL A;  1USS A;  2L9V A;  1JKR C;  1R22 A;  3R61 A;  1X2M A;  1I3Q J;  3ULQ B;  3E3V A;  2EIJ H;  4XRM A;  4XN3 A;  4EGY A;  1R36 A;  2L9S A;  3BG3 A;  4ASN A;  3PO3 J;  4RGU A;  4ZTJ A;  1MSF C;  3SHF A;  2X1E A;  2M0M A;  2L7M P;  5FO5 A;  1D3Y A;  2MG4 A;  2VL8 A;  4V19 K;  3K4B A;  4M73 A;  2NNY A;  2IA2 A;  2LOO A;  3PSF A;  1LVA A;  4EM1 A;  1R1U A;  2EK5 A;  2CO5 A;  4CCK A;  3S93 A;  1JUM A;  2CUJ A;  2LLK A;  3V4G A;  3CF5 F;  2V4J C;  3MKY B;  4M6X A;  4X6A J;  2Y69 H;  3VYS B;  1ZN2 A;  2ZME B;  3ROU A;  4LG3 A;  4UVC A;  2RDP A;  2E35 A;  3DTE A;  5TIS C;  5E79 C;  3BRO A;  1JI8 A;  1PP8 F;  2XAU A;  2HQN A;  4ESF A;  1KU3 A;  1LEB A;  3TP3 A;  2XAQ A;  2XVC A;  2DA6 A;  1S7A A;  2LRD A;  4RLF A;  2X6O A;  4A5N A;  2QGU A;  2DN0 A;  3TOA A;  3DEU A;  1RES A;  1Z67 A;  4A0X A;  1K78 B;  2XSJ C;  1FLI A;  3GW2 A;  1KU9 A;  1N75 A;  3TBI A;  1D5Y A;  3AG3 H;  2M7A A;  3B02 A;  1ZG3 A;  1JKP C;  2XUB A;  3U21 A;  1BR1 A;  3DP7 A;  1ON2 A;  2DDA A;  2L02 A;  2IBD A;  4HNV A;  5JLW A;  3I59 B;  3WG7 H;  4IZZ A;  2OC6 A;  3COA C;  2D45 A;  4UXN A;  2QA4 I;  4EJU A;  1RIO H;  5EGO A;  4M3B A;  3NWT A;  2ZB9 A;  3FXJ A;  2KMU A;  2L4M A;  2R7V A;  2DU9 A;  1A31 A;  2F5V A;  3REO A;  1YRN B;  1J7K A;  4CYC A;  2DO7 A;  2ME0 A;  2LD5 A;  3F8C A;  5JVT A;  2H27 A;  1MND A;  2K86 A;  2M8G X;  2H1L A;  2AHQ A;  3R6S A;  3T8R A;  3JTH A;  2UWM A;  4IRI A;  1Z3X A;  4MNU A;  1ZHF A;  2FD5 A;  1BW5 A;  4BDY A;  1AKH A;  3TMO A;  1O57 A;  2B7E A;  3LWF A;  4XIC A;  1D1A A;  4M3F A;  2AXT C;  4LD5 A;  3MVP A;  1QZE A;  2JUG A;  4EVI A;  2LBF A;  1ZG5 A;  1ZGW A;  1CQT A;  3ZMD A;  1W5S A;  1W7P A;  4M71 A;  1IZ1 A;  2X6Y A;  2XAS A;  3FHZ A;  3L2U A;  4XLA A;  5ICF A;  2QKM B;  1BJZ A;  2LYC A;  1STZ A;  2VQG A;  1JJ8 C;  4I09 A;  4KDP A;  4UVA A;  2DQR A;  5J8C A;  3E6C C;  2XAG A;  3TDU C;  3I5U A;  4HLY A;  3DCF A;  2CYY A;  1IUF A;  5D8K B;  1B9M A;  5EEH A;  1IUY A;  1JJ6 C;  4BH9 A;  4I6Z A;  4XLF A;  3CQZ J;  1JTX A;  2Y2Z A;  2EZH A;  5JHF A;  3C2H A;  1FIA A;  2R92 J;  3WGH A;  1YW9 A;  1P4X A;  4EMS A;  2N8G A;  3KX2 A;  2HZT A;  1H9T A;  3W2V A;  2LC2 A;  1HKQ A;  3KLO A;  4BE2 A;  4OMY A;  3S16 J;  2MC3 A;  1EH8 A;  4PUS A;  3PQJ A;  4BU2 A;  2VKD A;  1TZL A;  1WKM A;  3AG4 H;  3BY6 A;  2X9D A;  3A01 B;  3HSR A;  4MLO A;  4CCO A;  3HL2 A;  4BBR J;  3L00 A;  1P4A A;  4LB5 A;  1RZ4 A;  3MWM A;  3OR1 C;  4B8X A;  2CW7 A;  2QF7 A;  3F6O A;  4M6Y A;  1VQ5 I;  4IQJ A;  3ZQI A;  1Q1H A;  1MJA A;  2A68 F;  3VYT B;  4BQQ A;  1BC8 C;  2KIQ A;  1PUE E;  3OYF A;  3CLQ A;  1VQK I;  2LKS A;  3ZQ7 A;  5IP7 J;  4RB3 C;  3GLL A;  3V8K A;  2FMY A;  2NVX J;  2XGX A;  4AYB N;  2A3S A;  4ZZL A;  4QPQ A;  2Y0M A;  4I76 A;  5CVV A;  1Q1V A;  1E3O C;  5E20 A;  3W6K B;  4CIC A;  4CCJ A;  4PSW A;  1R4N B;  2X6W A;  3W6J B;  3ZN0 A;  1MNM C;  1YOV B;  4AWX B;  2XGD A;  2E7X A;  5TRD A;  2M87 A;  5IT3 A;  4RAY A;  4CYD A;  3RZO J;  2DMT A;  5E3M A;  4IO9 F;  2EFN A;  4M74 A;  2JVG A;  3RPU A;  2F4O B;  4RB0 A;  3TW7 A;  2O61 A;  1G2H A;  5J8F A;  1AWC A;  1E2X A;  2UUZ A;  1L0O C;  5M5W J;  5KAI C;  5K7H A;  1PUF A;  2NVT J;  3DPU A;  3E5X A;  2WY8 Q;  2VKE A;  3AKZ A;  3QPT A;  3HPH A;  2ZJQ F;  3U2R A;  2KRC A;  3ZN1 A;  2V1U A;  2DA5 A;  4O6J A;  2OQG A;  2NYX A;  2E1M B;  2F4I A;  2V6E A;  4A3G J;  1OCR H;  3HRT A;  2WB1 N;  3CDL A;  2VBZ A;  3IKT A;  1SFU A;  1VQM I;  4IXA A;  2WA0 A;  1G6N A;  3SZP A;  4CDG A;  1UG0 A;  2CFO A;  5DUK A;  3LQR A;  3K4K A;  3CJT B;  3OOP A;  4BY1 J;  2ELJ A;  3KLN A;  1LPQ A;  3BT9 A;  4RM2 A;  5GPA A;  3WHC A;  2WAE A;  2BY0 A;  3LOC A;  3LMM A;  4XK4 A;  1GXQ A;  1YI2 I;  2KL4 A;  4AVZ A;  3KP5 A;  1RC9 A;  5HLI A;  4WXD A;  4L5J A;  3LA2 A;  2FOW A;  3GO5 A;  3ZQQ A;  4GRI A;  3GTG J;  1TT0 A;  1WGX A;  3RQ4 A;  1R9T J;  2CWE A;  1A6I A;  3VPR A;  3WG9 A;  4BAY A;  1ETV A;  4S0H B;  4HF0 A;  2HYG D;  2IVM A;  1V3F A;  2KRH A;  3BCB A;  3O8G A;  3TO7 A;  3C18 A;  3GME A;  3SZT A;  1FSH A;  4E7Z A;  3KZZ A;  4IRG A;  2ZXW H;  1N77 A;  1QGP A;  3OYH A;  5AON A;  3OS1 A;  2YSR A;  3I53 A;  4OWR B;  3L9F A;  4KT5 C;  3RYP A;  3CMA I;  2UXX A;  2E7W A;  3L2R A;  4IHX A;  2CG4 A;  1ETY A;  3VDX A;  4EQQ A;  2HTJ A;  4C2T A;  2LRE A;  4PZJ A;  5HDG A;  4BXF A;  3ELK A;  4UUV A;  4E7S A;  3IWF A;  2KLO A;  2DJN A;  2H6C A;  5LRS A;  3K4N A;  3V42 A;  4EAT A;  2G9W A;  3S8P A;  1XSV A;  3VOE A;  4PK4 A;  2JPC A;  3E1S A;  4LIT A;  1U5T A;  1OCC H;  4HAM A;  3TGN A;  1VQL I;  2V9P A;  3E97 A;  3AL0 B;  3JR9 A;  4L9T A;  4U7D A;  2AO9 A;  2M45 A;  1MIJ A;  2Y30 A;  3R0A A;  4BHC A;  4A3M J;  1T33 A;  3H36 A;  4HOB A;  5J1R A;  3FMR A;  3H5N A;  3I3L A;  3GTP J;  4BXX J;  1XS9 A;  2MAB A;  3Q9S A;  3BR5 A;  2F5E A;  1T6S A;  1JUS A;  1V55 H;  1R1T A;  2HOS A;  2CUF A;  2DQL A;  2DI3 A;  2QZ8 A;  3FM3 A;  4E7I A;  2QM3 A;  3ERM A;  3EYY A;  4RMN A;  4P9F A;  1JKO C;  3K4C A;  2XRL A;  2PJR B;  3PJR A;  2DA3 A;  2JPB A;  3EUH C;  2ZJP F;  4U88 A;  4YFK F;  4BQA A;  1BR4 A;  2RQP A;  2Z3Y A;  3MN2 A;  5DYM A;  2FML A;  3QYB A;  4BEH B;  1IAW A;  5D6E A;  2JTV A;  4RA2 A;  4CCN A;  2R7R A;  3BQZ A;  1LB2 A;  3PSI A;  1XB4 A;  3BC8 A;  1ODD A;  3K0L A;  4QLC U;  2Q8K A;  5ED4 A;  4XMY A;  1IF1 A;  4HBL A;  1BBY A;  2OTL I;  5JLX A;  1EH7 A;  4KT6 A;  2L5Q A;  1WJB A;  3JRB A;  5ICC A;  1MDM B;  2K9N A;  5KVR A;  2CV1 A;  1SMT A;  3OYJ A;  2M8E A;  1G59 A;  4HF1 A;  1OQY A;  1EV7 A;  5EYR A;  2WAD A;  2EFP A;  4YEJ A;  5HS8 A;  1U78 A;  5HLT A;  1QVT A;  1Z77 A;  2EA4 A;  1FP1 D;  2P5L C;  4EJO A;  1EKE A;  1MMA A;  2E5N A;  3PM1 A;  2DK5 A;  1VQ6 I;  4WXH A;  1FBQ A;  1EH6 A;  3EDP A;  3IUO A;  1QPI A;  1ZK8 A;  1AOY A;  3AFH A;  3BR2 A;  4ZYD A;  5GTH C;  1Z6T A;  2Z2S B;  4D5F A;  3K6G A;  3I58 A;  3WU2 C;  2CJJ A;  3JRC A;  3HOS A;  5F6F A;  3EET A;  2LNB A;  2NS7 A;  3RJP A;  1TWF J;  2V79 A;  1IRZ A;  5F1J A;  1YG2 A;  3HPG A;  2DMU A;  1U9O A;  3LA3 A;  5AIP A;  1FNN A;  2WAQ A;  2IW5 A;  3HRU A;  4Y33 A;  3V7S A;  1XCV A;  2Z1D A;  3OYI A;  1XDS A;  3I71 A;  3SDB A;  1Z0X A;  2CU7 A;  2ISY A;  3C1D A;  2H09 A;  1E3P A;  2HQR A;  1D1B A;  5EZG A;  5CVJ A;  3QOE A;  5ILV A;  4JYK A;  3D5R C;  4WK8 F;  4IOC F;  1OMI A;  2IGM A;  2DCE A;  3BR6 A;  1XCB A;  1LEA A;  5CJ9 A;  4F3Q A;  2DAO A;  2YUS A;  4OIP F;  2XIG A;  5DTD A;  2O9L A;  5GAH J;  2CUE A;  2YR2 A;  2I10 A;  2GOM A;  3K1N A;  2NS8 A;  1I27 A;  1S7O A;  1HBX G;  1K6Y A;  4BE1 A;  1RUN A;  1F9N A;  5B3S H;  4DZJ A;  2MD0 A;  1POG A;  2AQE A;  3FIS A;  4E4H A;  4Y17 A;  5A2Q K;  5TJJ A;  5KNL A;  1FYK A;  3IH4 A;  3KZY A;  3F22 A;  2Z33 A;  1FYL A;  1ZTR A;  4XLC A;  3CDH A;  4ZZD A;  2VT3 A;  3W2W A;  4NQW B;  1XMA A;  5HLG A;  1S6L A;  2BGC A;  2DMQ A;  2KHM A;  1MJ9 A;  3OSG A;  4ZDP A;  4NB5 A;  4ENK A;  1R1V A;  3LA7 A;  4CXF A;  3CCU I;  3BLY A;  4QPO A;  4OAZ A;  3OIP A;  4A6D A;  1YIJ I;  3JSO A;  3GWZ A;  2ZXJ A;  2R5Y A;  1B59 A;  1MMN A;  4LG0 A;  4E7L A;  3OYE A;  2QEX I;  2VQL A;  3F8B A;  3VWB A;  2DT5 A;  1W1W E;  4E7J A;  4XOT A;  1KA8 A;  5L3C A;  3E6B A;  3RYR A;  4M9Z A;  1J59 A;  4HW0 A;  1OCO H;  2BVL A;  4Q48 A;  1IN8 A;  4AIJ A;  2EZI A;  3MZY A;  2FX0 A;  3GYH X;  2RRE A;  5HOD A;  4IHY A;  1IXC A;  1UB9 A;  1S7E A;  2UZK A;  1YJW I;  3KYL A;  3EUK L;  2JA7 J;  2K9Q A;  3MCZ A;  1LUJ B;  5EDN A;  2K3P A;  1FP2 A;  2A05 A;  2FBK A;  5BMZ A;  4HYE A;  5F1R A;  1MW7 A;  1TWH J;  5DCM B;  3OYL A;  1SAX A;  4A3E J;  3S3M A;  5KHD A;  4Z6Y A;  1KON A;  3V7C A;  4ENJ A;  3ZCO A;  2DMN A;  4G7Z F;  4GCV A;  2K4J A;  3PO2 J;  3CUQ B;  1MMG A;  3ESW B;  5J3L A;  1BIA A;  3MD2 A;  3PQK A;  2VN2 A;  3GTM J;  2LY9 A;  3OSF A;  2IJL A;  3BWG A;  3HXL A;  3ZPL A;  4PGG A;  4HDU A;  2KIM A;  2DFF A;  3F21 A;  4JX5 A;  1LJ9 A;  4Q47 A;  1W7P D;  5BPI A;  4J00 A;  1T95 A;  1Z3Y A;  3CTA A;  2K9M A;  2ELH A;  5EGO B;  2LG4 A;  2QSF X;  1FSE A;  1HC8 A;  2CQX A;  5ICE A;  3CES A;  4PFO A;  3OV8 A;  1ON1 A;  1K4S A;  2M30 A;  2NAZ A;  2H94 A;  4Q5S F;  5GP9 A;  1WJE A;  2BHZ A;  5F0H A;  2I8D A;  2HVS A;  2GIZ A;  2PMH A;  3BR0 A;  1MH3 A;  4IRH A;  3OYM A;  1AKH B;  4NHJ A;  2EBI A;  3H9J A;  1SFE A;  4YIF A;  4JP0 A;  4KYW A;  2B63 J;  5DUI A;  4ETS A;  5F27 A;  2B0L A;  2HTS A;  1R5I D;  1XMK A;  1N78 A;  2CUZ A;  4IL6 C;  5E8G A;  4D7N A;  1BW6 A;  2WAF A;  2R7Q A;  2E36 A;  1V4R A;  1JHH A;  3MFK A;  1LFU P;  3NRV A;  3RKY A;  3NAR A;  2HQ5 A;  2KDO A;  1YIO A;  2EV0 A;  2WAQ N;  1QRY A;  1DPR A;  3V7R A;  2BW3 A;  1G3S A;  2PN6 A;  4OIO F;  1ETK A;  2CQN A;  3O6B B;  4MFD A;  4MEX F;  2Q0O A;  3ECO A;  2DT7 B;  2DOF A;  2GA1 A;  2LTP A;  1BI2 A;  2ADU A;  4LB6 B;  2HOT A;  2Q1Z B;  3FXU A;  2AQF A;  4HLX A;  3KE2 A;  1U2W A;  3P9C A;  1LKX A;  2IS6 A;  1LE8 B;  2O5R A;  4M3E A;  2PFB A;  4P55 A;  2O03 A;  3K7A J;  2IPQ X;  2F5F A;  4JQF A;  3VEP A;  2KJC A;  3OYB A;  3H3Z A;  2GIV A;  1D1C A;  5EEA A;  2JA6 J;  3RI4 A;  1G3T A;  3RPU D;  1P7I A;  2RKH A;  5LRR A;  1I1G A;  2JZY A;  3OS0 A;  2EV5 A;  2Q2E B;  3H5R A;  4A5M A;  3Q0V A;  3ZMV A;  3FBI B;  3TDZ C;  1UAA A;  3LFU A;  3I4M J;  1JXS A;  2BBY A;  1O3S A;  2BE5 F;  1DP3 A;  3F8F A;  1PVE A;  2CSO A;  2L3D A;  1PYV A;  2JRM A;  1RI7 A;  3BTJ A;  2QQB A;  1B72 B;  1APL C;  4BKX A;  1REP C;  3NAU A;  2QQ9 A;  1IXR C;  4FCY A;  3HZJ A;  5LEK A;  3CCR I;  1FX7 A;  2NXN B;  4LFU A;  2XB5 A;  4CZZ A;  1TC3 C;  2JA8 J;  3U9G A;  3FXK A;  2PLY A;  2X4H A;  3MQ0 A;  4CO8 A;  1QU3 A;  1C0W A;  1RR7 A;  2DYR H;  3M8F A;  4IHS A;  1OCT C;  3ZMT A;  4C2M J;  3H9Q A;  4AUX A;  1IDZ A;  3HGG A;  2R93 J;  1SFX A;  4OIN F;  2FQ4 A;  1V54 H;  1KU7 A;  3Q9V A;  1YYV A;  5JI6 A;  2M7B A;  3JAM Z;  1BOB A;  2LR8 A;  4OAY A;  1ACI A;  3CP2 A;  1ZLK A;  1KQ0 A;  2PQ8 A;  1PUF B;  2WB1 A;  4I99 C;  1MMS A;  1VQ4 I;  4D7M A;  4CA0 A;  3D1N I;  1WRJ A;  3ZMS A;  1VF9 A;  1A5J A;  4YEL A;  3S14 J;  2DTZ A;  2MA3 A;  3OR2 C;  3T0Y A;  3GZ5 A;  4XLN F;  2G0E A;  1P2F A;  3IH2 A;  5CYV A;  1NK2 P;  3HC7 A;  1HKT A;  2QVO A;  4ZJZ A;  1YIT I;  1R7J A;  3ZXS A;  3BPX A;  3EPZ A;  3CCM I;  5HS9 A;  2VJI A;  3FKJ A;  3SFZ A;  4GFB A;  2OUM A;  3S3N A;  2RNJ A;  4ZYE A;  5M5Y J;  5FD5 A;  3OL3 A;  4KN7 X;  5E18 F;  2MLK A;  5LHH A;  3PNV A;  4F93 B;  4P5O A;  5C4J J;  2QQ8 A;  4FAS D;  2KZG A;  4KIB A;  3VOD A;  1IRF A;  3RKQ A;  4ON0 A;  3BR1 A;  2VJ4 A;  4HEA 2;  5HOO A;  4JOM A;  1AA7 A;  3E5U A;  1TQP A;  3DF8 A;  2VBX A;  1YX5 A;  2ISZ A;  1Y0U A;  4ZH4 F;  1G8X A;  4DIQ A;  3QRF F;  2JN6 A;  3HHG A;  4HSR A;  1U5T C;  3S15 J;  1X1C A;  1P9Q C;  4F92 B;  1MJB A;  3QPS A;  4U87 A;  5FFX A;  3VYR B;  2GA2 A;  1B8I A;  4HRI A;  4TV7 A;  3TED A;  4B09 A;  1ONV A;  2LY1 A;  2DXI A;  1W0U A;  3TKY A;  4GO1 A;  4HX7 A;  1T2K A;  3JCU C;  1DU6 A;  1J0R A;  2R5Z B;  1DU0 A;  2EB7 A;  2XPU A;  3FKI J;  1X4O A;  1R5G A;  4PJJ A;  2F2E A;  2QUF A;  1K7A A;  1D0X A;  1T98 A;  1WI3 A;  4RS8 A;  5EF6 A;  1FJL A;  5C4X J;  2R4G A;  4Z2Y A;  4XBF A;  3KYC B;  4B1R A; 
#chains in the Genus database with same CATH homology
 2XF6 A;  3H0D A;  4OWR B;  4XNF A;  2HU9 A;  3L2R A;  1HA8 A;  3VDX A;  2DJI A;  3VSL A;  1SFK A;  3LSM A;  2HDW A;  2KZV A;  4C2T A;  2MC4 A;  2LRE A;  4BXF A;  2VQC A;  4HNU A;  4E7S A;  2KLO A;  2PMZ A;  4XKB A;  3K4N A;  4XKW A;  3G2B A;  3V42 A;  4EAT A;  3S8P A;  4CSW A;  4PK4 A;  5LFA A;  3E1S A;  4XOR A;  4LIT A;  4HG2 A;  2CH0 A;  4Y4R A;  3AL0 B;  2R7T A;  3TL4 X;  3OIQ A;  2VLA A;  4ZYA A;  2KQR A;  3IAS 2;  5TGT A;  3H5N A;  3I3L A;  3L2Q A;  2ZXI A;  3J7A Y;  5CQE A;  4F91 B;  3VYU B;  2MAB A;  2UV1 A;  3L2V A;  3OYN A;  4ZDL A;  4E7I A;  2CW8 A;  4C30 A;  4RMN A;  5FRO A;  2W7N A;  3K4C A;  2PJR B;  3PJR A;  4PJL A;  3EUH C;  2V9K A;  1GLN A;  1V5E A;  4CUG A;  1BR4 A;  3LSK A;  3PL8 A;  4DBR A;  4BAC A;  2V26 A;  3W3C A;  4BDZ A;  3QYB A;  4BEH B;  5HVQ C;  2VQH A;  3LSI A;  2LY2 A;  4CCN A;  2R7R A;  3VSK A;  3PSI A;  2PJR A;  3BC8 A;  3QOD A;  1QHH D;  4XMY A;  2XC7 A;  2E5Z A;  4KT6 A;  2L5Q A;  1WJB A;  2W82 A;  3C2G A;  4RLQ A;  2X1D A;  2ZFU A;  4DGW B;  3SEQ A;  2CV1 A;  2HNH A;  3OOU A;  3OYJ A;  3PNT A;  4CH7 A;  1G59 A;  1NG7 A;  4HNT A;  4IX7 A;  1X19 A;  2WAD A;  2IXS A;  3DTI A;  2NOJ B;  3MKZ A;  4YEJ A;  5HNF A;  3DPL C;  1EA3 A;  2VXZ A;  2X85 A;  2DT6 A;  2HPI A;  5HLT A;  4PSX A;  4RM3 A;  4CZC A;  1X4P A;  3CP8 A;  1MMA A;  2E5N A;  2DOA A;  3OYK A;  2HQA A;  2A5W A;  2R7U A;  3IUO A;  2HPM A;  3EUA A;  3AFH A;  2JA2 A;  1IRX A;  2V1N A;  2Z2S B;  1FMV A;  3K6G A;  4BUP A;  4E6K G;  1X1B A;  4FET A;  2IGN A;  4XKC A;  5CQG A;  4R79 A;  3HOS A;  3DKX A;  3L2W A;  2M3A A;  4CCL A;  1PJR A;  2Z16 A;  1V5G A;  3BCA A;  3HPG A;  1WJD A;  2WY7 Q;  2WAQ A;  3OYI A;  1SAU A;  4Y33 A;  2Z1D A;  4XM3 A;  1D0Y A;  3K10 A;  3K4M A;  1WJ5 A;  5LD2 C;  5FRN A;  2R7X A;  2CV0 A;  3SDB A;  1Y6I A;  3HUG B;  1X1D A;  3RSN A;  4II3 A;  2JSP A;  1D1B A;  3IAM 2;  1WFX A;  3QOE A;  2MFZ A;  4YRV A;  3D5R C;  2R7W A;  2IGM A;  2BOL A;  3QYF A;  2DCE A;  3OYD A;  4BJT A;  4F3Q A;  4H4K C;  3H35 A;  1YE9 A;  4D9J A;  2IS2 A;  1OR7 C;  4XON A;  3UR3 C;  2L9N A;  3CF2 A;  3DKY A;  3DWL E;  3BG6 A;  4D1Q A;  2GOM A;  3CJR B;  3ZR8 X;  3K4J A;  4HST A;  1K6Y A;  4BE1 A;  4NNJ A;  1OLT A;  2VKH A;  3A4C A;  3K4L A;  2MD0 A;  4DBQ A;  4C2U A;  1LFP A;  2IGK A;  3RTR A;  1ERD A;  2AQE A;  3GBG A;  4E4H A;  5KNL A;  4ZTF A;  2VJJ A;  4XLC A;  3W2W A;  4NQW B;  2KHM A;  4BL0 B;  3HG9 A;  4ZDP A;  3OYC A;  4BE0 A;  4KJZ A;  2HVQ A;  2FUG 2;  4IQ4 A;  3BLY A;  4QPO A;  2CV2 A;  4OAZ A;  3OIP A;  1LDK B;  4KIS A;  1MMN A;  4E7L A;  2BVM A;  2IS1 A;  4XL9 A;  4KIT B;  2VQL A;  3OYE A;  3VWB A;  3M8J A;  4II2 A;  3OYG A;  4XQF A;  2V7F A;  4E7J A;  4AYB A;  4XOT A;  3H9G A;  2KP6 A;  4E7K A;  4B48 A;  2BVL A;  1D0Z A;  2HVR A;  2RRE A;  4XN3 A;  3OYA A;  2W00 A;  4ZDO A;  2L9S A;  1Z7L A;  2CS3 A;  3KYL A;  3EUK L;  4B3X A;  3OS1 A;  4ZTJ A;  2X1E A;  2M0M A;  2VAS A;  2VL8 A;  3K4B A;  2K3P A;  2LOO A;  3KEY A;  3PSF A;  3OY9 A;  4N4O B;  2VIX A;  1MW7 A;  3OYL A;  4IKF A;  1FMW A;  3CZ6 A;  4CCK A;  3S3M A;  5KHD A;  3DTK A;  3S93 A;  2CUJ A;  2X1C A;  2WBM A;  2V4J C;  3MKY B;  1S9H A;  2RNG A;  3VYS B;  3K70 D;  1KON A;  2E1M C;  3UNG C;  3ZCO A;  1BR2 A;  2CMP A;  2HZD A;  3QYE A;  4LG3 A;  4U7B A;  3D5L A;  3DTE A;  1MMG A;  4C9Y A;  2W4S A;  3E0J B;  1JI8 A;  3K70 C;  2XAU A;  3MD2 A;  2A6T A;  1NG6 A;  1MMD A;  3HXL A;  3M1C A;  4F52 A;  2LRD A;  4RLF A;  3W2A A;  3DQV C;  4J00 A;  3OS2 A;  1T95 A;  1Z3Y A;  2K9M A;  2P0W A;  2XF5 A;  1VZ0 A;  2LG4 A;  1R6R A;  2XSJ C;  4PJN A;  3DU5 A;  1N75 A;  3TBI A;  3CES A;  4PFO A;  2M7A A;  4XN0 A;  3U21 A;  1BR1 A;  4BJ5 C;  4E7H A;  3OYH A;  3DLA A;  1WJE A;  4LIU A;  4F93 B;  3PFY A;  4IZZ A;  2I8D A;  2OC6 A;  2HVS A;  3NWT A;  3OYM A;  3HKZ A;  2KMU A;  2R7V A;  3H9J A;  1T0F C;  2ZXH A;  1DQU A;  3FBN B;  2F5V A;  3OL4 A;  1MND A;  3S32 A;  2BW3 B;  4AU7 A;  1N78 A;  2CUZ A;  2MYS A;  3A2K A;  4XLE A;  2UWM A;  3ONQ A;  2WAF A;  1Z3X A;  2R7Q A;  1WJC A;  3LL7 A;  4BDY A;  4NUB A;  3TMO A;  3SZG A;  2KDO A;  3ZRG A;  1D1A A;  3CJQ B;  2X6X A;  2BW3 A;  1YX3 A;  3S3O A;  3AL0 C;  2VXD A;  2JUG A;  2X51 A;  1W36 C;  2LBF A;  4ZC3 A;  3PNY A;  2DT7 B;  3BG7 A;  2M4G A;  2K9L A;  2X6Y A;  2Q1Z B;  2AQF A;  3I9V 2;  3L2U A;  4XLA A;  2QKM B;  1LKX A;  2LYC A;  2VQG A;  2O5R A;  3IP4 B;  4LIV A;  4PJM A;  5FRM A;  2IS6 A;  4JQF A;  5HNH A;  3OYB A;  2K5C A;  1D1C A;  2M4K A;  3SEZ A;  3RPU D;  3LSH A;  3OS0 A;  1DGR M;  2JVH A;  2Q2E B;  4XLF A;  4B47 A;  3H5R A;  4BJ6 C;  2XDV A;  4XKV A;  5JHF A;  3C2H A;  4B43 A;  1MNE A;  3FBI B;  1UAA A;  3KX2 A;  3LFU A;  4DJA A;  1DP3 A;  3W2V A;  2LC2 A;  4BE2 A;  4F55 A;  4BGD A;  1PYV A;  1QHG A;  4PUS A;  4BU2 A;  2VKD A;  1TZL A;  1U0J A;  2ZSI B;  4MLO A;  4CCO A;  1UEL B;  3HL2 A;  1QU3 A;  3OR1 C;  2CW7 A;  1Y56 A;  2R7O A;  4IQJ A;  1WJF A;  3H9Q A;  1E0E A;  3VYT B;  4BQQ A;  3OYF A;  2RQQ A;  3OWT A;  2OV7 A;  2M7B A;  4DOZ A;  1BOB A;  4OAY A;  3DPT A;  4QPQ A;  3CP2 A;  4G6T B;  3N05 A;  4CCJ A;  2WB1 A;  4PSW A;  2X6W A;  4HPQ A;  4CA0 A;  3DU6 A;  3CMM A;  4YEL A;  2F6C A;  3PUB A;  4BQN A;  3OR2 C;  3MKW B;  4ANJ A;  2GOX B;  3HC7 A;  2JVG A;  3F9K A;  5KCM A;  4ZJZ A;  3ZXS A;  2VB6 A;  3EPZ A;  2UUZ A;  2VJI A;  3FHN A;  4NC7 A;  3FKJ A;  4BEH A;  2OUM A;  3DPU A;  3S3N A;  2WY8 Q;  1LVK A;  2L2O A;  3AKZ A;  2IGO A;  3HPH A;  4PFP A;  3OL3 A;  2KRC A;  2R7S A;  4N4N B;  2LH9 A;  2E60 A;  3MMY B;  3PNV A;  4NC8 A;  3H5A A;  4P5O A;  5CKT A;  2E1M B;  1J09 A;  2F4I A;  2V6E A;  2W1O A;  4FAS D;  2L7K A;  3A1Y A;  2Y0S A;  3HOT A;  4CCM A;  3SYT A;  2VJ4 A;  4HEA 2;  5HOO A;  4JOM A;  1AA7 A;  2WA0 A;  1YX5 A;  4J01 A;  1UG0 A;  1G8X A;  2CFO A;  4B44 A;  4DIQ A;  3K4K A;  4P1W A;  4HSR A;  3DEE A;  2ELJ A;  3D5S C;  3RCO A;  1X1C A;  2QKL B;  4RM2 A;  1P9Q C;  2KPM A;  2VPL A;  4F92 B;  2WAE A;  3FDY A;  3LMM A;  5CPR B;  4U87 A;  3VYR B;  4BQO A;  2ZSH B;  1Z21 A;  4HRI A;  2KL4 A;  3LSG A;  4AVZ A;  2LY1 A;  2DXI A;  2LBF B;  2XF7 A;  3ZGK A;  3ZQQ A;  4GRI A;  2VJ5 A;  1TT0 A;  3OMY A;  3RQ4 A;  3NWS A;  4X0G A;  1DGW Y;  4XOP A;  1W36 D;  1X4O A;  4PJJ A;  1WJA A;  4ITV A;  2KRH A;  3BCB A;  2IS4 A;  1ZEL A;  4XLH A;  4Y3O A;  1D0X A;  4E7Z A;  2R4G A;  1N77 A;  1X1A A;  4XR6 A;  4BS9 A;  1V5F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...