1YX3A

Nmr structure of allochromatium vinosum dsrc: northeast structural genomics consortium target op4
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
112
structure length
112
Chain Sequence
b'MADTIEVDGKQFAVDEEGYLSNLNDWVPGVADVMAKQDNLELTEEHWDIINFLREYYEEYQIAPAVRVLTKAVGKKLGKEKGNSKYLYSLFPYGPAKQACRFAGLPKPTGCV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein DsrC
publication title Allochromatium vinosum DsrC: solution-state NMR structure, redox properties, and interaction with DsrEFH, a protein essential for purple sulfur bacterial sulfur oxidation.
pubmed doi rcsb
source organism Allochromatium vinosum
molecule tags Structural genomics, unknown function
total genus 31
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2005-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04358 DsrC DsrC like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.370 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1yx3A02
3.30.1420.10 Alpha Beta 2-Layer Sandwich Dissimilatory Siroheme-sulfite Reductase; Chain: A; domain 1 Dissimilatory Siroheme-sulfite Reductase; Chain: A; domain 1 1yx3A01
2A5WA 3OR1C 1YX3A 1SAUA 3OR2C 2V4JC 2XSJC 1JI8A
chains in the Genus database with same CATH superfamily
3IP4B 1U5TC 1QQIA 2JQ7A 4CICA 1VQMI 1TW2A 1E2XA 3UNGC 2VIXA 2V9VA 1QNTA 2JK3A 3WGIA 1Z05A 4J01A 2IS1A 1IV8A 4FETA 3GTGJ 1HSTA 2KKOA 1V55H 1L3LA 1FSEA 2X1EA 3K4BA 4CH7A 3LSHA 2IS2A 3LOCA 1IO2A 2OD5A 2IA1A 4AD9A 1MNDA 2V4JC 2H1LA 1YJWI 1NTCA 5ICFA 2IT0A 1XSXA 2RDPA 2Y0MA 3ULQB 2XB5A 1RR7A 3BJ6A 2A5YB 3KLNA 1U6GA 4IHSA 2HTJA 1W7PA 2QEXI 1W7PB 3HBLA 4CYCA 1MNEA 4HA8A 3ZN0A 2Y9ZA 4PSXA 4XMYA 4BACA 2WB1A 5LHHA 1JUPA 5C44J 1U9NA 3OYNA 2CQNA 1PUEE 5ILVA 1G3WA 4UVCA 1R1TA 2A5WA 2F5EA 3ERMA 1S29A 1TWAJ 4IPAA 5E1XA 2M1BA 2YU3A 5DCMA 4HQMA 5DCMB 1G3TA 2VBXA 3H1CA 2ZXJA 3H5AA 5DTDA 2KJBA 3M3YJ 3F22A 1ETOA 3G3ZA 2KLOA 4EJWA 5HNFA 1B9MA 1ZH5A 2F6CA 2HYJA 1Z77A 2QM3A 3SEZA 4LG3A 5KAIC 2R5YA 1X4PA 2P6SA 1I1GA 1BBYA 3BCBA 1HA8A 2D1HA 2ME6A 1E3PA 2M45A 1WPKA 2VBWA 4D5CA 1VQNI 3AG3H 5JHUA 4XM3A 4XLHA 3SDGA 1H89C 2DK8A 4M73A 4PGHA 1ZLKA 5HLHA 3M9AA 1EH8A 3ABMH 4TV7A 3JSOA 4IEJA 1YJ9I 4OINF 3GZ6A 1MSEC 4IRIA 3HGGA 3JCUC 4XOTA 3K9TA 1JTXA 1FNNA 2LLKA 1S7EA 1B72A 1B72B 3ABTA 4BEHA 2BXYA 3DCFA 4N4NB 1QO0D 1ZG3A 2AXTC 3E5QA 3PFYA 3BR2A 1CQTA 2QKLB 3N05A 2JPBA 4EEFG 1FIPA 1BI3A 2EFPA 3AG4H 5E79C 2IW5A 4EGYA 1SVOA 1GV2A 2ID3A 2NVYJ 1ON1A 1MH4A 4HNVA 2X48A 2H1KA 1YI2I 3MKLA 2LY9A 1MBHA 5LGTA 1Y1VJ 2D2WA 4FQGA 3GBGA 2DO7A 1X3UA 1ACIA 3NQOA 3HSFA 3OIOA 1AWCA 3CMYA 4E7LA 2KP6A 4OIQF 2X6YA 1UHWA 3RPUA 3M8EA 3S1QJ 2QCOA 1YS7A 3RZOJ 1MBKA 1RC9A 1Z3XA 2TRTA 2WC2A 1XB4A 2XV4S 1ZN2A 5D8KB 1FIAA 4L9TA 3DF8A 2Y69H 4EM2A 3CMMA 4ZTFA 1F5TA 4EJVA 1QZZA 5CVVA 2A07F 2QYOA 4MQVA 4ETSA 2EIJH 1KYZA 2IGNA 2PEXA 1Z9CA 1IG7A 3SZGA 1VQLI 2P7VB 2KHMA 1ZGAA 5FLXK 5LLQA 1W36C 1OPCA 1XC5A 3C2GA 1AKHA 1AKHB 2MBFA 2MC4A 3I4NJ 3RKWA 2WWYA 2EB7A 1EH7A 2EIKH 1SFUA 4P5OA 2GA2A 4XLAA 2PMZN 3QPHA 1JXSA 1MJAA 1WJAA 2V1UA 3FXJA 2V79A 1WKMA 3E5XA 2HXIA 3WTWC 3SJMA 1E0EA 2XF5A 4IL6C 1X1PA 2HYGD 2OCCH 3ML6A 1WJCA 2QKMB 4WXCA 5JI6A 4PJLA 1EA3A 4Q47A 1MMNA 5AIQA 4HLYA 2IBDA 4KIBA 1SANA 2NS7A 3F9KA 1DQUA 2MLKA 1MBJA 1JGSA 1I3AA 1QVUA 5J3LA 1AA7A 3ECHA 4BHCA 1BJAA 4RGUA 2Y75A 2KT0A 3IWZA 2JZYA 4R1HA 3FM3A 4M6XA 4F92B 2HZTA 2CS3A 3EUHA 3RTRA 1SFOJ 3V7CA 4JOMA 2HEOA 1I50J 4LIVA 5FRNA 2EIMH 3B6AA 2LF8A 3GYHX 1K83J 3W6KB 2V1XA 2V9PA 3H35A 3M07A 4A6EA 1A04A 5DD4A 3OYJA 3OR2C 2W84A 5HDNA 4IHVA 1A36A 2CQ7A 3MCZA 3PQKA 1OCOH 3A01A 2PMZA 5GTIC 2KPMA 3WE2A 4JP0A 4UY8I 1FLIA 1BN5A 5D4RA 3H0GJ 2QA4I 2HDWA 3WTXC 5IPAA 2DBBA 2AQFA 2EA2A 3IHUA 2DXIA 1RIOH 1MD0A 3O3KA 2NNNA 4HEA2 1ZR2A 5HS7A 3HL2A 3S8PA 4UUSB 5E3OA 3WTTC 3TO7A 1K4SA 1J59A 1RZ4A 1VI0A 5FKNA 2HS5A 4O3MA 2VC0A 1W36D 2QSGX 1IZ1A 3C18A 4YELA 2ZKZA 4D7MA 4BXUA 3WTVC 3S17J 4BE2A 4O5VA 3S15J 1V5GA 2R7DA 2E5NA 4IKFA 3K0LA 2F48A 5CVUA 3LSPA 1MMSA 3BG3A 3CZ6A 2BVMA 1KU7A 4E7HA 2GXBA 2CRGA 4KJZA 3TW7A 1BR2A 3GEZA 3F8BA 3WU1B 1BJZA 3ZR8X 3F6VA 1QPMA 3S3OA 4M9SA 3V4GA 2BXZA 4C2MJ 4OAYA 2BHYA 1FEXA 3V7RA 4ESJA 3U9GA 2ZJQF 3KP6A 4V19K 3HC7A 4XNFA 3L9FA 5ICEA 1T56A 2EQRA 3F8FA 2RAEA 1FJLA 3KETA 2VKHA 2CW0F 4M3EA 1WJ5A 3TMOA 4P55A 3FZVA 4UUTA 2PJRA 2V7FA 3GVAA 3DU5A 1BR1A 4KICA 1H0MA 3P9IA 5JLXA 1S5LC 2CV0A 3LA7A 3HGYA 1YO5C 4BUPA 2XDVA 3QYBA 3I53A 3F23A 2CWEA 4M6VA 2HQNA 2PI0A 4GXOA 4AU7A 4MEXF 2O5RA 3L7WA 3AKZA 2P5KA 3FMRA 1TZLA 2IA0A 2IGMA 1O7LA 3HRSA 3Q0UA 5B5EC 3WU0A 3KP2A 2GIZA 3O8GA 3S1NJ 1WI3A 3HYIA 4C3JJ 1Z3YA 2TCTA 5EF6A 1YW8A 2W48A 3SZPA 1T0FC 3NRVA 3ABUA 4F91B 3HOUJ 1YE9A 5FKLA 5BOXA 3EYIA 4HRIA 2ZC2A 3J80K 1G4DA 1NK3P 3K4KA 5L3FA 3KP3A 4J00A 1H9TA 1QZEA 3LL7A 3BPVA 1FOYA 4M3GA 5J47A 3F8MA 1WRJA 3I55I 5E17F 1UZCA 4XIDA 3I3LA 2WADA 4XK4A 4YIIA 2STWA 2O8XA 2RREA 4CXFA 4X0GA 3VODA 3CMEI 2TDXA 4FT8A 3KIOA 2CUFA 3WE3A 2FE3A 3N4MA 5HLIA 1D5YA 1BOBA 1YX3A 3CQZJ 5BNGA 5CPRB 1ETQA 3JRCA 3PNTA 3VB2A 1HOMA 2W00A 3LSMA 4CUGA 2YR2A 2E5ZA 4GGGA 3FIWA 1S3JA 1IN4A 2BBYA 4HDVA 2L4AA 3E97A 3DPUA 4OIPF 1ZRFA 2KIQA 4PFPA 2Y31A 1WHUA 3OIQA 4XLEA 1ZTRA 1N75A 4PJJA 2JA8J 4I7HA 2ZXWH 3IAM2 1DDNA 5C4XJ 2FBKA 3OYHA 2XUBA 1ZARA 2NXNB 2VQHA 3I9V2 3TL4X 1POGA 1K78A 3HSEA 3IH4A 1K78B 2EFNA 3E6MA 2R7UA 1XMAA 5E1WA 1UJ8A 2P8TA 2G7HA 4IQJA 2CQKA 4QIWN 2M4KA 1D0XA 3S14J 3ZMDA 2Z3YA 3ELKA 2O7OA 2R7QA 4JQFA 2E7WA 3K1MA 2DODA 2L5QA 2QQ9A 4KT6A 1B8IB 3CJTB 4X6AJ 3DKWA 3G2BA 3A4CA 1TQPA 2DMUA 5HDKA 5HODA 1ZAOA 3MKYB 2DA2A 1BL0A 3ZQ7A 2NNYA 3HSRA 4E7JA 3D5LA 1OCZH 1D3YA 2HNHA 1TQIA 5D8LB 4HF2A 4DBRA 3J7YJ 2GM4A 3H92A 2NOJB 3ESWB 3BPXA 1RNLA 4AIKA 1L0OC 2HOAA 2LR8A 4KN4X 2QQ8A 4ITVA 3Q3SA 2F2EA 4A3IJ 3L00A 3OOPA 2CO5A 1WJEA 2IAIA 4U88A 2FNAA 2VPRA 1MMDA 3B02A 2DYSH 4Y3OA 1HKQA 1OCPA 1AOYA 2KQRA 3K70C 1FMWA 2JUCA 1RUOA 2KDZA 1WZ2A 2DMNA 5E20A 2ZJ2A 4MO7A 5GPCA 2MH9A 4CSWA 2QQAA 4WF2A 3HOYJ 2LDUA 3JREA 1G6NA 2L54A 4RS8A 1YS6A 2EINH 2OZUA 4NBQA 4M3DA 3CCRI 5LGNA 1Y6IA 3CP8A 2K9NA 1IDYA 2WAQN 4ZDPA 2MD0A 3WHCA 2BV6A 1XMXA 4U0VA 1X2NA 4ZYGA 3D5RC 3U2RA 4PJNA 4GDFA 4MTDA 2QBYA 4R79A 3ZN1A 2GQQA 4D7NA 3CCYA 3M7GA 2H6BA 5KVRA 4ANJA 2A6HF 1RI7A 3FHNA 1ZELA 5FKMA 1Z21A 2JTVA 4WK8F 3EETA 5GADJ 1S7OA 4M71A 5DCFA 2CJJA 5F27A 1NG6A 3FXQA 1KZHA 4XKBA 2M2EA 5J1UA 4CGZA 2VODA 3BTLA 3HDDA 2W24A 4II3A 2MC3A 2YPRA 5CVJA 1FY7A 3CJNA 1O3TA 2ISYA 3G1LA 3ZRGA 4A3BJ 3QPSA 4MQ9F 2LH9A 3CTAA 3U1DA 2LSOA 4L18B 3K69A 3H3ZA 1U8RA 2GXAA 2COMA 4QPOA 3LSJA 2W82A 1IN7A 2FEZA 3K1PA 1T38A 2JMWA 1JKQC 5TISC 4BQQA 1FOXA 4D1QA 1HXDA 2JRMA 5IP6A 4G94A 1GDTA 4IHTA 2N8GA 2V9KA 3MKZA 2WAQA 3RJPA 1RR8C 4YEJA 4IOCF 2LMDA 3T8RA 3OYAA 2B63J 2R92J 1J9IA 3RPQA 3GW2A 3JRIA 3REOA 2VJ4A 4CO8A 4BH9A 3F6OA 5EGOA 5EGOB 1ZRDA 4OU0A 2COBA 3K70D 1UFMA 4Y15A 2H09A 3JAMK 2XROA 3OYKA 1T95A 3H5NA 4MIMA 5JVTA 2FBIA 2E2HJ 2A68F 2Z9OA 4RGXA 1B9NA 2KIMA 2KL4A 2OAZA 3JRHA 3K6GA 4AIHA 1A31A 3H3VK 3FXMA 3L1PA 4KA4A 1YOVB 1R22A 2DPUA 3HOSA 2W85A 3W2AA 3KEOA 3LSKA 1I39A 2PN6A 5E3MA 2VLAA 2YUSA 2NRAC 3OYDA 1F36A 5D5WB 2ZNYA 2Y9YA 4P96A 4ZC3A 2KJCA 2NS8A 2VOOA 3AL0B 4GYIA 1HW5A 2CSOA 2DA5A 4HLXA 4S0HB 3HOZJ 2WV0A 3DKYA 4IJAA 2FBHA 1W4MA 5LGUA 1IN6A 1M1EB 3OYIA 2DA7A 1HDPA 2RN7A 2FQ3A 3TP3A 4AM3A 3PIOF 2ADUA 2M5WA 2ME0A 3I58A 1XDUA 4DGWB 4EV0A 1HLVA 1Y1WJ 3VPRA 1UG0A 1W7PD 2CUEA 2PMHA 3LA3A 3BQZA 5E8GA 4RB2C 1T8IA 1YITI 3ZMTA 1KU2A 3ZGKA 3G6EI 2BW3A 2WB1N 1A6IA 3KYDB 3ASOH 2M4GA 4I0BA 3WG9A 1N77A 4Q5SF 3DXJF 2MSYA 2L01A 1W5CC 2ZXIA 2LBFA 4C2UA 1LDJA 5BS6A 1ZLJA 3DU6A 2LKSA 3SFIA 2A61A 5TGTA 3M1CA 2DCEA 2HZDA 4KDPA 4KITB 2CFXA 4Q4ZF 3DTIA 3GZNB 4R8HA 3T1BA 3QU6A 1O3RA 1Y0NA 4YIRX 2V1NA 4BU2A 3OS0A 4ON0A 2R7XA 3S3MA 2K40A 4F7ZA 1WSUA 1VQ5I 2LRDA 2XF6A 3CDIA 3CESA 4D5FA 5IOYA 1JI8A 3IH2A 2VQGA 3FMSA 1OCCH 2DN0A 3BZ6A 1DP7P 3JTHA 2K3PA 2WAFA 1YHQI 1HKTA 3MZYA 2R0QC 3OYLA 2XVCA 1FSHA 2ESHA 2K02A 1U9OA 2HI3A 4H0EA 4CYCB 1S72I 1Y8RB 3CCUI 4L0ZB 3A03A 2VQLA 1ZKGA 3HPGA 5FROA 3RQ4A 2M8EA 2O6GE 2X9DA 3MZ8A 4PJMA 4G6TB 1QZYA 3ZMSA 1U2WA 2FXAA 4BBSJ 1TP4A 3GTMJ 4M3FA 2ECBA 1TTYA 3GFMA 3Q9VA 5EZHA 1FC3A 1FP1D 2I8DA 4G7OF 1D1CA 2ICWG 3HRTA 2BY0A 1YYVA 3PL8A 1Q1VA 2O8KA 3CLOA 2JJ7A 3LA2A 1OR7A 3S2DJ 4FCYA 5FO5A 2XPUA 3Q0WA 1JTYA 2M7BA 5IT3A 1HC8A 3EUHC 3D5SC 3HIFA 2PFBA 1U78A 2K4BA 4XN3A 4BNCA 4A69C 1PUFA 3HTUA 5CQGA 2ZNZA 2R5YB 2JPCA 5ILUA 1SAXA 2E1OA 2HKOA 5EJCA 5J6XA 3JRBA 3GX4X 3FBIB 2DU9A 2CGPA 4UV8A 4B1RA 2ZMEA 1G3SA 1QVTA 5EEGA 5C3EJ 4IHWA 1VQKI 3CC2I 2AQEA 2V1DA 1RESA 2VXDA 4FASD 4DYQA 3RPUD 4U7BA 2H27A 4LIUA 1GLNA 1ETVA 1WJBA 1P4AA 4LJZF 4MGRA 2Q1ZB 3MFKA 1IF1A 2ZJPF 3KE2A 4A3GJ 2F5CA 1I6HJ 3SHFA 5K1YA 3MKWB 4MTEA 2OBPA 4BEHB 3A0HC 4BY7J 4J19A 2RV8A 1WWXA 3TW6A 4DYCA 1WFXA 1J0RA 3GFJA 4PGGA 5IT9Z 4EMSA 3OYBA 5D6FA 2DDBA 2WTEA 4D0PA 2R93J 3MQ0A 2V6CA 3MMYB 4GRIA 3QOEA 4IOAF 4LLNA 2LNBA 2BEOA 2RGVA 2EFWA 4B09A 3PO3J 4NDLA 9ANTA 3ZQGA 1T33A 3F8NA 5F0CA 3ZMZA 3E7LA 5CYVA 2JN6A 1R49A 1KQ8A 1V4RA 1CF7A 2B0LA 4UV9A 4OOIA 2R7TA 1I27A 2DOAA 2R7VA 5CJ9A 2DMPA 1QHHD 1R7JA 4XQFA 2A6EF 1SFKA 3E1SA 5J8FA 2GLOA 3OL4A 4I6ZA 3R60A 5AIPA 1FT9A 5FD5A 5F08A 4EJUA 1LEAA 2G9WA 3COAC 5IP7J 2JUGA 1MJBA 3T5XA 2ELHA 2L9SA 3BWGA 3ROUA 2W1OA 1W5TA 2MH2A 1H9GA 4BDZA 1TW3A 3K4NA 2CQXA 2ELJA 1TT5B 4BQAA 2CUZA 3OYGA 4ZDOA 2F4IA 2JA7J 3ZQIA 5F6FA 1OISA 4L9VA 1YTYA 1IDZA 3NWSA 1G59A 1GV5A 1P9QC 1Z6TA 3C7JA 2VPLA 1XN7A 4RM3A 3LQQA 4M72A 1IGNA 4FE7A 5HOOA 3AAFA 1EJ9A 1LPQA 1O4XA 5TRDA 2ESNA 2HGCA 4DW6A 3IRQA 1U5TA 1UAAA 4I2OA 1J2XA 3WGHA 1QPIA 2P7CB 1Z6RA 2HQRA 2PX9A 1RKTA 2B7EA 2E1MB 2XSJC 3FXUA 3H9QA 5LBQA 3L2VA 4BDYA 4MFDA 2DFIA 2LYCA 2RKHA 2MA3A 3HZJA 2RQQA 1UHMA 1TC3C 2DYRH 3RI4A 3ABKH 3OSFA 1I5ZA 4AYBN 4ENNA 3ONQA 1OCTC 4XICA 3ZQHA 2MG4A 3QWLA 3HEFA 3F72A 1X1CA 1JGGA 2UUZA 3C1DA 4OMYA 4Q48A 5FRMA 5ERIA 1SD5A 3CLQA 4CCKA 4B3AA 1LB2A 3MN2A 3VFZA 3DPLC 1GXPA 5F0HA 1YQAA 5B1AH 2DJNA 3GZ5A 1E17A 4MLOA 2VJJA 3N97A 3BY6A 2Z5UA 2OC6A 4E70A 1Z91A 3BR3A 5FFXA 4ZTJA 1OJLA 1LE8A 4I76A 1LE8B 2BY1A 2M87A 4BY1J 3DFGA 2IGKA 3HB9A 2MW8A 3PUFA 4Z6YA 1O3SA 3FF5A 4XRSG 1D8KA 5F04A 1OYWA 2KDOA 1X1AA 5LRRA 2R5ZA 3TO9A 2D45A 3I0TA 3A01B 5J1RA 1WJDA 2P81A 3G1OA 3BZKA 5M5YJ 2IXSA 5IP9J 1IRXA 1X4OA 5K7HA 6PAXA 2XIGA 4AYBA 1VZ0A 4PUSA 2KISA 3EDPA 4A6DA 3H0DA 3QYEA 2A69F 4BBRJ 1YG2A 4LFUA 3DQVC 1OKRA 5DM7F 4I98B 2HFHA 4KIGA 5CKTA 1D0ZA 4RMNA 3V42A 4Y4RA 1LNWA 1WVRA 3AG1H 2B9SA 2M30A 3MZHA 2DMQA 3I4PA 3VYUB 1EF4A 3ECOA 3PUBA 1UHSA 4QPQA 1APLC 5B3SH 3PQJA 4CZCA 1MMGA 2BVLA 4BJ5C 1H88C 3HHGA 4N4OB 5EDNA 2R7ZJ 1UMQA 3BG5A 2FU4A 1E3OC 1S7AA 1BOAA 2DQLA 1C0WA 1FYKA 5E1ZB 5EZGA 3DBRB 3K4LA 3S2HJ 3QP6A 1XMKA 3GF2A 3J7AO 3X2QH 1YJNI 3RDIA 3KZYA 1ZHFA 2VE9A 2FQ4A 3F8CA 4CCMA 3P9CA 4RAFA 3BG7A 3I64A 1BC8C 4KYWA 1AU7A 1P6RA 1XD7A 4KMFA 4XR6A 4I99C 1RRJA 2PJRB 3E5UA 3E3VA 2R3SA 2FJ1A 5CLSA 1IV6A 2DT6A 3MAJA 2WA0A 4JYKA 5HVQC 2EV6A 4LGWA 5HDGA 5EG0A 3SQNA 2I10A 2Y2ZA 3KPHA 1IJWC 3FISA 3GUDA 3K4JA 5D5XB 1EV7A 2KIFA 4DNCA 1F9NA 3S32A 3DLLF 2UXXA 3SDBA 4ESFA 2UZKA 3A02A 1KA8A 3VSLA 1MMAA 2K9SA 4L5IA 4A3JJ 2ZO4A 2DA1A 4I09A 1LDKB 2KMUA 5DV5A 4ZZLA 4PZJA 5B66C 3KP5A 4B43A 3Q5FA 2OTJI 1HW2A 2KRHA 2JA6J 1A6QA 1QHGA 4C9YA 2O3FA 5K5QA 4XKVA 4E7KA 1MSFC 1LVAA 2OV7A 1ZYRF 2DK5A 1GT0C 2V26A 1ZG5A 4XN0A 1VQ4I 2LTPA 2R4GA 4XONA 3TBIA 2FRHA 4G12A 1B1BA 5KNLA 2EV0A 1SD7A 3QP5A 3BDDA 2PG4A 3LSIA 2Q2EA 2LY1A 2Q2EB 3IC7A 3E6CC 2MLGA 3R0AA 4IHYA 1MZBA 4KUMA 1J7KA 4AVPA 2XKPA 3CJQB 4G6DA 4YRVA 4IRGA 4RA2A 2IS6A 2X6XA 4BJ6C 4HNTA 1D1AA 1J09A 1BR4A 3RCOA 1LKXA 1K61A 1W0UA 3FXLA 3L2RA 1XPXA 5IYBJ 1XGNA 2VOPA 1KQ0A 2VC1A 4ZYEA 5E18F 2UV1A 2VUMJ 1I1SA 2LKPA 2XGEA 1TWCJ 3I59A 3NEUA 2HTSA 1DP3A 3V8KA 2EZIA 4UB8C 5F1JA 3CMAI 2GA1A 1MBGA 3DKXA 1LFPA 3WTZA 2WV1A 4B47A 3OV8A 4XLPF 2EPFA 4F52A 4LK1F 1MJ9A 1JT6A 4EQQA 3EYYA 4V2FA 1VQPI 2FSWA 2K7LA 1PDNC 2QGUA 4KIFA 4RM2A 3GMEA 2DT7B 4N0BA 1K79A 1ERDA 2DA4A 2DMTA 5IY5H 1VFCA 4XKCA 3VDXA 5L3EA 1R6RA 1KU9A 2JSPA 2K9LA 2HVSA 4IZZA 3R61A 2EBIA 3QYFA 4GCVA 5JFRA 1VF9A 1TQMA 4G6QA 2VONA 1B6AA 3DEWA 1ZGWA 4H4KC 1Y39A 2E2IJ 1MNMC 4OWRB 3GFLA 4NUBA 3CDHA 1NK2P 2Y48A 3AL0C 2F5VA 1U3EM 2DPDA 4CCLA 3BTCA 5IYDJ 1T98A 1ON2A 3BJOA 1PYVA 1OFCX 1WH5A 4CA0A 4WWCA 1ITYA 2K5CA 3HUGA 4W1UA 3VOEA 4RB3C 4CHUA 1D8JA 1IRFA 2VKEA 3NAUA 3QODA 3QRFF 1ETYA 2CUJA 1D5VA 3K2AA 2EZKA 1P7IA 1QBJA 3OS2A 2E19A 2PLYA 1OYYA 1OQYA 2P4WA 2IPQX 1XCVA 4P1WA 3CUQA 3CUQB 4U7DA 1LUJB 1F43A 2YSRA 3FXOA 1OCRH 5IOZA 1O7FA 2O61A 1SFXA 2DAOA 1RPWA 2NYXA 2Z99A 2CV2A 3A1YA 2MFZA 4IX7A 1USSA 2L02A 2H8RA 2OUMA 3KCCA 3K10A 1R00A 1CGPA 2QBYB 1P92A 1X3ZB 3AG2H 3FDYA 4F93B 3JRFA 1VQOI 4A3LJ 2E34A 2Y0SA 4C3IJ 2QENA 1H8AC 1OLTA 1XCBA 2BOLA 2E71A 3RZDJ 3FM5A 3LAJA 2DFFA 2PJPA 2IEKA 2PMUA 3GFIA 2L9NA 1FBUA 2LOOA 2XAHA 3D1NI 4L5JA 1MBEA 3FKIJ 5L3GA 2VQCA 4DOZA 2HR3A 2VKDA 4ZYDA 2O9LA 4S04A 4JX5A 3GTKJ 1BIAA 1T0FA 5LHGA 2ISZA 1G8XA 2EZHA 3E0JB 3CDLA 4NB5A 3ERED 1T6SA 1FTTA 4LOCA 4PFOA 3RKXA 1FOWA 2OQRA 1Z1DA 4HDUA 1W0TA 1ETWA 1KQ9A 3HRMA 4BS9A 1DU0A 1GHCA 2QLZA 4NQWA 5DYMA 3TDZC 3I4MJ 1Z7LA 3U1KA 4A3DJ 3Q0VA 1ZG1A 4G8XA 3QOPA 3RYRA 2NVTJ 4E7IA 1DGRM 3FWEA 3A2KA 1SFEA 1MGTA 4JK1X 4XOPA 4QSHA 1HF0A 2ZJRF 2JVGA 1R1UA 1RKWA 2GIVA 4U0YA 4RGSA 3PJRA 2HYFA 2FNPA 1TWHJ 3TQNA 4AIJA 3LFKA 5M3MJ 2AXLA 3GTQJ 1RETA 2EZLA 3WODF 2DI3A 4HW0A 3CF5F 3LAPA 5L3CA 2XHKA 3QPLA 3L2CA 5HS9A 1KGSA 3DTKA 1X19A 1LVKA 2JWTA 2LF7A 1IXCA 4Y7NJ 4NHJA 3HKZA 3HXLA 3QU3A 2DDAA 2VBYA 5ICCA 3GTLJ 4A5NA 4HZFA 1R23A 3CF2A 5H20A 3VYSB 3CCVI 3BG6A 2BYVE 1O3QA 4KFCA 3S1MJ 2H6CA 3BR5A 3RQIA 3DEEA 1FOKA 2X6OA 3DBHB 3BZCA 4ZYHA 2YX4A 2HQ5A 1K6YA 5D5UB 3ASNH 3ZQFA 3H9GA 3B73A 3ZCOA 4A3MJ 4MEYF 4B8XA 5KAFC 2WY7Q 5EYRA 4OIRF 5BQTA 4U0WA 4BYYA 2X1CA 3KLOA 1SAUA 2LVSA 2VKVA 5FKKA 3G73A 2NVQJ 4XSXF 1S6LA 2F5FA 4LMYA 2OCEA 1HBXG 3HOWJ 2XRLA 1P4WA 4HV5A 3VEPA 4LITA 1HSJA 2XSDC 1PP7U 2BW3B 5KHDA 3AFHA 3IRRA 4A3FJ 2EK5A 2X0LA 2A3SA 3CC4I 4BE0A 2LBFB 2KZGA 1N25A 1SD6A 4QLCU 3CD6I 4G9YA 3IKTA 2E1NA 3H5RA 4I02A 2Z33A 1HDDC 1SVLA 3CJRB 1SEUA 2BZTA 3HTSB 1W5SA 2HKXA 3DP7A 4DQ2A 3VWBA 2HOEA 1TBXA 1WH7A 2RQPA 3U21A 2EWNA 3VYTB 5A2QK 3CO6C 2P6TA 4RAZA 2VXZA 2P5VA 3OOUA 1XSDA 2NVXJ 3W3CA 3P5JA 4A3EJ 4AC0A 5A2QZ 4Y33A 4XSZF 4P9UA 2XAFA 3O2PE 1LEBA 1BW5A 2L7MP 1XGOA 4WXDA 3KZZA 1WJFA 2E1MC 2M3AA 2R7FA 5LD2C 3GLLA 2DJIA 2ZSIB 4KMUX 1ULYA 5K7FA 3O6BB 1JKPC 3W6VA 4XLFA 2R7OA 4XLNF 2LP0A 1JKRC 3FHZA 3BT9A 5E3NA 1KYWA 1S9HA 1WCMJ 4CCNA 2VBZA 3ZQCA 3LSGA 4B44A 3HRUA 5FFZA 3LSTA 4U87A 4HSRA 5L3BA 3LFUA 5K5RA 1Z7UA 4V2GA 1DPRA 4M6YA 4HPQA 2G0EA 2FMYA 2YX7A 5DUKA 2LG4A 4JX4A 1GXQA 4OIOF 2FOKA 1PUFB 1NHAA 3BR6A 1R1VA 2CW8A 1K6OA 1DPUA 1IRZA 2P5LC 3ZQQA 1YLFA 2ZMEB 2L2OA 2VJIA 1UB9A 3I54A 3JRDA 2HDCA 1V5EA 2CG4A 2STTA 2WBMA 4I0AA 3IWFA 2G7UA 4LD5A 5BPDA 4DZJA 2XF7A 4HBLA 3FK7A 2F5DA 3OY9A 5DDGA 3WHBA 5GAEJ 5EEAA 4EATA 5IT9K 2GOXB 3WTYC 1TNTA 4BQNA 1NG7A 4UHTA 4A0ZA 2HOSA 4XRSA 4A0XA 2GZWA 3OYCA 4EGZA 4ENJA 2DA6A 3TO6A 1IN5A 2M8GX 3ZOBA 1BI1A 4P9FA 1J5YA 2K86A 1SC7A 4XKWA 3TKYA 4II2A 4B4CA 1WQ2A 1Y0UA 4L5EA 5K5OA 2OTLI 2DTZA 1SMTA 3K4MA 4CZZA 3I56I 3GO5A 3JRAA 5DD8A 5M3FJ 3CCEI 1CF7B 3V8LA 3EPZA 3KFWX 4XL9A 5E8IA 3KYLA 5BPIA 4W97A 2CYYA 2DOEA 4RAGA 4YIFA 2IRFG 2Y30A 4QWQA 2HPMA 2OPTA 3S2WA 3DEUA 5JVGF 4ASNA 3OIPA 1BI0A 3JRGA 2VASA 1W1WE 3IKVA 3H36A 4LLLA 5ED4A 1T08B 4JX6A 1ONVA 3K2ZA 5BMZA 1AHDP 1VQ7I 3I71A 5J4YA 2W4SA 3WU2C 1KU3A 4EJTA 1XGMA 4AWXB 4HF1A 4G7HF 4A5MA 3FK6A 3D0SA 1MH3A 1U0JA 4XLCA 1VNDA 1FX7A 2DTRA 2JVHA 3IUOA 2ECCA 2FX0A 4FISA 5GAGJ 1FWZA 2CW7A 4CDGA 1R58A 3H9JA 3IAS2 5F0FA 1OMIA 5GPAA 1U5TB 4IRHA 1D0YA 2L3DA 4RB0A 5EEHA 4YG2F 3LMMA 1ETKA 3MVPA 4D9JA 3LQRA 3JW4A 3NWTA 2IJLA 4IF4A 2MABA 4PDKA 3MEXA 1DUXC 4RDUA 3GWZA 5FB2A 3PSFA 4XRFA 2KRCA 1ODDA 4L9JA 1ZR4A 2MD5A 1TWGJ 3OS1A 1WGXA 3BLYA 4B3XA 2XASA 3K1NA 2ELKA 1VQ8I 4DYRA 3PFIA 5LEKA 4I01A 3BP8A 5FLXZ 1LQ1A 4FX0A 1O57A 2M34A 3VSKA 1YFHA 3M1EA 3CCQI 3RKQA 2L7ZA 4LLGF 3KP7A 2LFBA 2O0YA 4L0YB 2E7XA 2JA5J 3TOAA 1JUSA 3IV5A 2OU2A 2CFOA 5TJJA 4IO9F 1IC8A 3PNVA 1PP8F 1HCRA 4UUVA 1XGSA 4XBFA 4BHBA 1R5ID 1FTZA 2ZXHA 1VQ6I 2E36A 2VJ5A 4C3HJ 2ZFUA 1V54H 3SEQA 2IS4A 4XORA 4LB5A 5FGMA 3FMQA 2XPWA 2ZSHB 2R5ZB 2WAEA 2F4MB 1KONA 4ENMA 1X2MA 5GP9A 4WXHA 3QPTA 2UXNA 3GTOJ 2ZCWA 3C3WA 3CCMI 2YS9A 1UG2A 5E3LA 4ZH4F 4LK0F 3SXYA 1JUMA 3P7NA 4DZPA 2KRFA 4ZZDA 2CV1A 4ABZA 4RLQA 1GUUA 4M9ZA 4BQOA 4MHGA 2PBIA 3BTJA 4XRMA 2OQGA 4UXNA 2DFHA 2FMLA 3T8TA 3SYTA 2Q0OA 1FYLA 5LHIA 1B4AA 1UCRA 4ZDLA 4AVZA 2Z1DA 4FHTA 4RB1A 3V8JA 1Z0XA 2NS0A 3TDUC 3HG9A 3KYCB 3OSGA 3TEDA 2XC7A 2EFQA 4M9XA 1QRYA 1V3FA 3I5UA 4LG0A 3OMYA 3UR3C 4YFKF 4UUSA 4PCQA 4LG0B 1IUYA 2XGCA 2EFOA 2EA4A 2X51A 5HLTA 2W7NA 2I5UA 2BE5F 1FYMA 2QSHX 3BQYA 2VB6A 1ZK8A 1ZGJA 1EKEA 2NAZA 4OAZA 4PK4A 4EM1A 4UB6C 5CVRA 3W2VA 3S93A 2X6WA 2K4JA 2AHQA 2IP2A 4WCGA 4K2EA 4CYDA 3HPHA 2XGXA 5HNHA 3DV8A 1BC7C 2O03A 3EQLF 5D6EA 3JR9A 2K9QA 1I6XA 1XG1A 1ZREA 2HOTA 4NC6A 3RKYA 4A0YA 4EM0B 3ZMUA 1G2HA 3E6DA 1N78A 2E2JJ 2L9VA 1IN8A 2R7WA 1X58A 4IXAA 2E35A 2IVMA 2VE8A 4A93J 1A35A 3F3XA 3GTJJ 4C2TA 4RBOA 1IXRC 3S1RJ 3ZQLA 1R5HA 2K85A 2FA5A 5EG0B 1X1BA 1BW6A 4Y52J 3CUQC 2XGDA 3W2WA 2E1CA 3KEYA 5DUIA 2JRTA 2DQRA 3LSRA 3OYFA 1Z67A 1S8NA 3A0BC 4M3BA 3BOQA 4HF0A 1TNSA 2CU7A 3R0JA 2UWMA 1QA6A 3OYEA 2HPIA 1USTA 4EVIA 1SD4A 1BIBA 3DBLB 3PM1A 4JBAA 5DS9A 2YU9J 4ZJZA 1F4KA 4AIDA 2GOMA 3EUKL 5HS8A 2DFEA 2LREA 3KX2A 4RAYA 2OA4A 5C4JJ 5B1BH 5J8CA 3KP4A 4A3KJ 1FMVA 4MNUA 4WX9A 2HXOA 2KZVA 2Q8KA 1PVEA 2BY2A 2VT2A 3TGNA 1T2KA 2XKOA 1Y8QB 1WI9A 3WTUC 4GYGA 4Y13A 4GFBA 3H3UA 4Y17A 4BJTA 1ENHA 2D1VA 5DM6F 4CCJA 4HAMA 4FTHA 3PNYA 5K7ZA 2ZB9A 3VYRB 2ZFWA 2ACJA 5LEJA 4ZYAA 3J80Z 1XTAA 2V6EA 1LFBA 1REPC 2L7KA 3LNQA 2A6TA 2XAJA 2CH0A 1K7AA 3OR1C 2Z16A 5HLGA 3WG7H 2W57A 3BR0A 3RSNA 2HVRA 2MYSA 4ESBA 3I59B 1YIOA 2K9MA 1P4XA 4HX4A 2K3FA 4NNJA 1IRGA 4BE1A 1XS9A 3K7AJ 3L2WA 2L0KA 5JHFA 3L2UA 1IXSB 2LKXA 5LRSA 4OMZA 2XAGA 1FP2A 3B6CA 4HOBA 2XRNA 4CCOA 5JLWA 3OYMA 3BTIA 3ABLH 4QTRA 2DOFA 2FD5A 1TWFJ 5LFAA 2K27A 5DEQA 1XDSA 2LY2A 4A3CJ 4HX8A 4NC8A 3M8FA 1FZPB 4HV6A 3CUOA 3MD2A 3HHHA 3C2HA 2MGQA 1R36A 1DGWY 5KK1A 1MDMA 1MDMB 2DA3A 3G4SI 1T39A 1IW7F 5D5VB 4BGDA 3DTEA 1FBQA 3QQAA 2A05A 1X1DA 2FOWA 2X4HA 3M4OJ 1R71A 2LK2A 4IVNA 2NVUB 2AO9A 3T0YA 2RVCA 2QZ8A 3SFZA 5FD6A 3IL2A 2VN2A 1BA5A 5H2FC 4UVBA 2Y0SN 2QUFA 3J7ZI 3TOBA 3LWFA 3FX3A 1ZRCA 2GXGA 3PO2J 5J40A 3DLAA 3WGGA 2HQAA 1HKSA 1B8IA 2GAUA 3BJAA 4MFEA 1U8BA 1XSVA 2L9RA 2XPVA 2FUG2 3RYPA 2JA2A 5H6QA 4KISA 2Z2SB 4PJ0C 3HUGB 3F0CA 2ID6A 4DBQA 1SMYF 2GWRA 4EJOA 3CO7C 3G1MA 4BL0B 2J5OA 1GVDA 2CQQA 4UNOA 2KFDA 5ILSA 2WY8Q 2KIUA 2VT3A 4RLFA 1FPQA 3J7AY 5D4SA 2H94A 2DLLA 4BXFA 5M5WJ 1RUNA 5F1RA 5J4VA 3TP0A 2EV5A 4KN7X 1R9TJ 3GXOA 1F1ZA 5M5XJ 4S05A 3ISPA 4HX7A 1VQ9I 3ZMVA 3MWMA 3BR1A 3CCSI 2CMPA 3EUAA 4BKXA 3O8HA 4E6KG 1OYIA 2E60A 2XAUA 4KT5C 2DW4A 3HJEA 4BHPA 5L3DA 4HYEA 3BG9A 2PQ8A 1JJ6C 2RNGA 4PSWA 4BAYA 3GCMA 4Z2YA 4KNYA 3PIPF 2EJRA 1TLHB 2JT1A 2L7FP 5FLMJ 2LD5A 3S3NA 3CC7I 1GVJA 4NC7A 5FKOA 3FKJA 1K4TA 1BM9A 1FBSA 2BHZA 1YW9A 1B59A 1PJRA 2OF7A 4IQ4A 1I3QJ 1QU3A 2M9HA 2HDDA 4B48A 4DIQA 3OWTA 2H8WA 4BXXJ 2OJED 2X85A 4C30A 3HOTA 1JJ8C 3HKZN 4M74A 2F4OB 4AUXA 4HQEA 1Q1HA 3GLXA 3DPTA 2IA2A 2QWWA 2QVOA 3FBNB 2XB0X 3RIRA 2GBYA 2VL8A 3K4CA 3ZP5A 1YIJI 4NQWB 1LJ9A 5JR3A 3HOVJ 3UKGA 5KCMA 1UELB 1JE8A 2HU9A 1P7JA 1XX5A 4HNUA 5CQEA 2W25A 4IHXA 5FJ8J 1OR7C 1MKMA 4N9IA 5AONA 2VI6A 1YX5A 1Y56A 2L4MA 2P0WA 2QF7A 3S16J 3CCJI 1ORKA 4HSTA 5FLVA 3PSIA 1MIJA 3KZIC 2BGCA 2M0MA 4LB6B 1R5GA 2AS5F 1R4MB 1X3WB 4A12A 1LFUP 3C2BA 2DT5A 2FF4A 3E6BA 3KEQA 2EILH 2X1DA 1YRNB 1YRNA 4GO1A 2LC2A 2ZMEC 1JT0A 4RGRA 3R6SA 2RNJA 3FXKA 1LDDA 2J5PA 1V5FA 3CP2A 5GTHC 5F64A 3FXRA 1TT0A 3Q9SA 1IUFA 2C6YA 4L9NA 2ETHA 3WTSC 2HWVA 4E7SA 1P2FA 3P9KA 1ETXA 2IGOA 4X1EA 3L2QA 4F55A 1STZA 3OL3A 3JTGA 1MW7A 1HW1A 3JAMZ 3JSPA 4E7ZA 2NOGA 3G71I 4FE4A 3SZTA 4F3QA 4UVAA 2XAQA 3F21A 1YW7A 3R4KA 3ZXSA 4YFXF 1JKOC 1IAWA 4DJAA 2D5VA 1ZQ3P 3GTPJ 3BC8A 3J81K 2R7RA 1NH3A 1DU6A 1D1BA 1BI2A 1R4NB 2M0CA 3J81Z 5H6RA 1JHHA 2BY3A 5ICGA 5IYCJ 1J75A 4A2UA 3IH3A 3V7SA 4FX4A 1A5JA 4HG2A 2ZBKA 1VTNC 1EH6A 1JHFA 4YFNF 4O6JA 3QAHA 1QGPA 2EH3A 2R7SA 5J1YA 2QSFX 4N9HA 4ENKA 3L09A 2M7AA 3HOXJ 1HQCA 2RC4A 1TL8A 3M8JA 4E4HA 4G7ZF 5GAHJ 3ZPLA 1G3YA 2OZ6A 3BCAA 1MBFA 3W6JB 2QQBA 2HVQA 3CCLI 3DWLE 3HM5A 1SVMA 1E3HA 5CVIA 2JSCA 3BROA 3NARA
chains in the Genus database with same CATH topology
3LMMA 3IP4B 3S32A 3D5RC 3SDBA 4D9JA 3NWTA 1MMAA 3VSLA 4PJNA 3UNGC 2MABA 4R79A 2VIXA 3PSFA 2KRCA 1LDKB 2KMUA 4J01A 2IS1A 4ANJA 4B43A 4FETA 3FHNA 3OS1A 1ZELA 2KRHA 3BLYA 4B3XA 1Z21A 1QHGA 4C9YA 2X1EA 4XKVA 3K4BA 4E7KA 4CH7A 3LSHA 2IS2A 2OV7A 1NG6A 4XKBA 2V26A 4XN0A 4II3A 1MNDA 2V4JC 2R4GA 4XONA 3TBIA 5KNLA 3ZRGA 3VSKA 2LH9A 3LSIA 1MNEA 2LY1A 2Q2EB 2CFOA 4PSXA 4XMYA 3PNVA 4BACA 2WB1A 4QPOA 2W82A 3OYNA 4BQQA 3CJQB 4D1QA 4YRVA 2ZXHA 2A5WA 2VJ5A 2IS6A 2X6XA 2ZFUA 4BJ6C 4HNTA 1D1AA 1J09A 1BR4A 3RCOA 1LKXA 2V9KA 3SEQA 2WAQA 3MKZA 2IS4A 4XORA 4YEJA 3L2RA 3OYAA 2ZSHB 3H5AA 2WAEA 1KONA 2UV1A 2KLOA 2VJ4A 5HNFA 1DP3A 2F6CA 3SEZA 4LG3A 3DKXA 3K70D 1LFPA 1X4PA 4B47A 2CV1A 3BCBA 3OYKA 4RLQA 1HA8A 1T95A 3H5NA 4BQOA 4F52A 2KL4A 4XM3A 4XLHA 3K6GA 3SYTA 4RM2A 4ZDLA 2DT7B 2Z1DA 4AVZA 1ERDA 3HOSA 3HG9A 4XKCA 3VDXA 3W2AA 1R6RA 2JSPA 3LSKA 2K9LA 4XOTA 2XC7A 2HVSA 4IZZA 3UR3C 3OMYA 2VLAA 3OYDA 4BEHA 3QYFA 4ZC3A 2X51A 4H4KC 3AL0B 5HLTA 2W7NA 4N4NB 3PFYA 4OWRB 2VB6A 4NUBA 3DKYA 2QKLB 3AL0C 3N05A 4OAZA 2F5VA 4PK4A 3W2VA 3S93A 2X6WA 3OYIA 3HPHA 4CCLA 5HNHA 1PYVA 4CA0A 2K5CA 3GBGA 1N78A 2R7WA 4DGWB 3QODA 1UG0A 2CUJA 4E7LA 2KP6A 3OS2A 3ZGKA 2BW3A 2X6YA 4C2TA 1N77A 2M4GA 4P1WA 1Z3XA 1X1BA 2ZXIA 2LBFA 4C2UA 3W2WA 2CV2A 3KEYA 3A1YA 2MFZA 3DU6A 4IX7A 5TGTA 3CMMA 4ZTFA 3M1CA 2DCEA 3OYFA 2HZDA 2OUMA 4KITB 3K10A 3DTIA 2UWMA 3FDYA 4F93B 3OYEA 2IGNA 3SZGA 2HPIA 2Y0SA 2V1NA 4BU2A 3OS0A 2R7XA 3S3MA 2KHMA 4ZJZA 2LRDA 1OLTA 2GOMA 2XF6A 2BOLA 3EUKL 1W36C 2LREA 3CESA 1JI8A 3C2GA 3KX2A 2L9NA 2VQGA 2MC4A 2LOOA 2K3PA 2WAFA 1FMVA 2VQCA 4DOZA 2VKDA 4P5OA 4XLAA 3OYLA 1WJAA 1G8XA 2KZVA 3E0JB 1E0EA 4PFOA 2XF5A 2VQLA 3HPGA 5FROA 3RQ4A 1WJCA 2QKMB 4PJMA 4G6TB 4PJLA 4BJTA 1EA3A 1MMNA 4CCJA 3PNYA 3F9KA 1DQUA 3VYRB 4BS9A 4ZYAA 2V6EA 1AA7A 2L7KA 1Z7LA 2I8DA 1D1CA 2A6TA 4F92B 3PL8A 2CH0A 2CS3A 3RTRA 4E7IA 3OR1C 2Z16A 1DGRM 4JOMA 3A2KA 2M7BA 4LIVA 4XOPA 3EUHC 5FRNA 3D5SC 3RSNA 2HVRA 2MYSA 4XN3A 2JVGA 2K9MA 4NNJA 4BE1A 3H35A 5CQGA 3PJRA 3L2WA 3OYJA 5JHFA 3OR2C 3L2UA 4CCOA 3FBIB 3OYMA 2PMZA 2KPMA 5LFAA 2AQEA 2LY2A 2VXDA 4FASD 4NC8A 3RPUD 4U7BA 2HDWA 3DTKA 1X19A 3MD2A 2AQFA 1LVKA 4LIUA 1GLNA 3C2HA 1WJBA 3HKZA 3HXLA 1DGWY 2DXIA 2Q1ZB 4HEA2 3HL2A 4BGDA 3S8PA 3DTEA 1X1DA 3MKWB 4BEHB 3CF2A 3VYSB 3BG6A 1WFXA 3DEEA 3OYBA 1W36D 3MMYB 4YELA 4GRIA 1K6YA 3QOEA 3DLAA 2HQAA 4BE2A 3H9GA 1V5GA 3ZCOA 2E5NA 2WY7Q 4IKFA 2FUG2 2JA2A 4KISA 2X1CA 2R7TA 2Z2SB 1SAUA 2DOAA 2R7VA 3HUGB 3CZ6A 2BVMA 4E7HA 1QHHD 4DBQA 4KJZA 4XQFA 1BR2A 3E1SA 1SFKA 4BL0B 3OL4A 4LITA 3ZR8X 3S3OA 2BW3B 5KHDA 3AFHA 4OAYA 2WY8Q 2JUGA 4BE0A 2L9SA 4RLFA 2W1OA 3HC7A 4XNFA 2LBFB 3J7AY 4BDZA 3K4NA 2ELJA 4BXFA 2VKHA 2CUZA 3H5RA 3OYGA 4ZDOA 1WJ5A 2F4IA 3TMOA 3CJRB 2PJRA 2V7FA 2CMPA 1BR1A 3DU5A 3EUAA 4E6KG 3NWSA 1G59A 2CV0A 1P9QC 2E60A 2VPLA 2XAUA 4RM3A 4BUPA 2XDVA 3QYBA 5HOOA 3VWBA 3VYTB 3U21A 4AU7A 2O5RA 2RNGA 4PSWA 2VXZA 3OOUA 3AKZA 1UAAA 3W3CA 1TZLA 2IGMA 3S3NA 4NC7A 3FKJA 2XSJC 4Y33A 3H9QA 2E1MB 4BDYA 3L2VA 2LYCA 1Z3YA 2RQQA 1WJFA 2E1MC 2M3AA 5LD2C 1PJRA 4IQ4A 1QU3A 2DJIA 4B48A 2ZSIB 3OWTA 1T0FC 4DIQA 4F91B 1YE9A 2X85A 4C30A 3ONQA 3HOTA 4XLFA 2R7OA 4HRIA 3DPTA 1X1CA 2UUZA 5FRMA 3K4KA 4J00A 4CCKA 3FBNB 1S9HA 4CCNA 3LL7A 3DPLC 2VL8A 3K4CA 3LSGA 4B44A 4NQWB 3I3LA 2WADA 4U87A 4HSRA 4MLOA 2VJJA 2RREA 3LFUA 5KCMA 4X0GA 2OC6A 1UELB 4HPQA 2HU9A 4HNUA 5CQEA 1BOBA 1OR7C 2LG4A 4ZTJA 1YX3A 1YX5A 5CPRB 1Y56A 3PNTA 2P0WA 2W00A 3LSMA 4CUGA 2E5ZA 4HSTA 2IGKA 3PSIA 2CW8A 2M0MA 3ZQQA 3DPUA 2KDOA 1X1AA 2L2OA 2VJIA 1WJDA 4PFPA 2X1DA 2IXSA 2LC2A 3OIQA 4XLEA 1N75A 1IRXA 1V5EA 1X4OA 4PJJA 3IAM2 2WBMA 1V5FA 4AYBA 1VZ0A 4PUSA 3CP2A 2VQHA 3I9V2 3OYHA 1TT0A 3TL4X 3H0DA 2XF7A 3QYEA 3OY9A 4EATA 2GOXB 4E7SA 4BQNA 1NG7A 2R7UA 3DQVC 3OYCA 2IGOA 5CKTA 3V42A 1D0ZA 4RMNA 4F55A 4Y4RA 3L2QA 4IQJA 2M4KA 1D0XA 1MW7A 3OL3A 3VYUB 4XKWA 4II2A 3PUBA 4E7ZA 4QPQA 2R7QA 4JQFA 4CZCA 2L5QA 1MMGA 2BVLA 4KT6A 4BJ5C 3G2BA 3K4MA 4N4OB 4F3QA 3A4CA 3ZXSA 3MKYB 4DJAA 3BC8A 2R7RA 3EPZA 4XL9A 3KYLA 4E7JA 3D5LA 2HNHA 1D1BA 3K4LA 4DBRA 2HPMA 2NOJB 3OIPA 2VASA 4ITVA 4HG2A 1WJEA 2W4SA 4CCMA 1MMDA 3BG7A 4Y3OA 4XR6A 2R7SA 2KQRA 1U0JA 3K70C 4XLCA 1FMWA 2PJRB 2JVHA 3IUOA 4CSWA 2M7AA 2DT6A 2WA0A 5HVQC 3M8JA 4E4HA 2CW7A 3BCAA 3H9JA 3IAS2 2HVQA 3DWLE 1Y6IA 3K4JA 3CP8A 1D0YA 4ZDPA 2MD0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A5W A;  3OR1 C;  1YX3 A;  1SAU A;  3OR2 C;  2V4J C;  2XSJ C;  1JI8 A; 
#chains in the Genus database with same CATH topology
 3IP4 B;  1U5T C;  1QQI A;  2JQ7 A;  4CIC A;  1VQM I;  1TW2 A;  1E2X A;  3UNG C;  2VIX A;  2V9V A;  1QNT A;  2JK3 A;  3WGI A;  1Z05 A;  4J01 A;  2IS1 A;  1IV8 A;  4FET A;  3GTG J;  1HST A;  2KKO A;  1V55 H;  1L3L A;  1FSE A;  2X1E A;  3K4B A;  4CH7 A;  3LSH A;  2IS2 A;  3LOC A;  1IO2 A;  2OD5 A;  2IA1 A;  4AD9 A;  1MND A;  2V4J C;  2H1L A;  1YJW I;  1NTC A;  5ICF A;  2IT0 A;  1XSX A;  2RDP A;  2Y0M A;  3ULQ B;  2XB5 A;  1RR7 A;  3BJ6 A;  2A5Y B;  3KLN A;  1U6G A;  4IHS A;  2HTJ A;  1W7P A;  2QEX I;  1W7P B;  3HBL A;  4CYC A;  1MNE A;  4HA8 A;  3ZN0 A;  2Y9Z A;  4PSX A;  4XMY A;  4BAC A;  2WB1 A;  5LHH A;  1JUP A;  5C44 J;  1U9N A;  3OYN A;  2CQN A;  1PUE E;  5ILV A;  1G3W A;  4UVC A;  1R1T A;  2A5W A;  2F5E A;  3ERM A;  1S29 A;  1TWA J;  4IPA A;  5E1X A;  2M1B A;  2YU3 A;  5DCM A;  4HQM A;  5DCM B;  1G3T A;  2VBX A;  3H1C A;  2ZXJ A;  3H5A A;  5DTD A;  2KJB A;  3M3Y J;  3F22 A;  1ETO A;  3G3Z A;  2KLO A;  4EJW A;  5HNF A;  1B9M A;  1ZH5 A;  2F6C A;  2HYJ A;  1Z77 A;  2QM3 A;  3SEZ A;  4LG3 A;  5KAI C;  2R5Y A;  1X4P A;  2P6S A;  1I1G A;  1BBY A;  3BCB A;  1HA8 A;  2D1H A;  2ME6 A;  1E3P A;  2M45 A;  1WPK A;  2VBW A;  4D5C A;  1VQN I;  3AG3 H;  5JHU A;  4XM3 A;  4XLH A;  3SDG A;  1H89 C;  2DK8 A;  4M73 A;  4PGH A;  1ZLK A;  5HLH A;  3M9A A;  1EH8 A;  3ABM H;  4TV7 A;  3JSO A;  4IEJ A;  1YJ9 I;  4OIN F;  3GZ6 A;  1MSE C;  4IRI A;  3HGG A;  3JCU C;  4XOT A;  3K9T A;  1JTX A;  1FNN A;  2LLK A;  1S7E A;  1B72 A;  1B72 B;  3ABT A;  4BEH A;  2BXY A;  3DCF A;  4N4N B;  1QO0 D;  1ZG3 A;  2AXT C;  3E5Q A;  3PFY A;  3BR2 A;  1CQT A;  2QKL B;  3N05 A;  2JPB A;  4EEF G;  1FIP A;  1BI3 A;  2EFP A;  3AG4 H;  5E79 C;  2IW5 A;  4EGY A;  1SVO A;  1GV2 A;  2ID3 A;  2NVY J;  1ON1 A;  1MH4 A;  4HNV A;  2X48 A;  2H1K A;  1YI2 I;  3MKL A;  2LY9 A;  1MBH A;  5LGT A;  1Y1V J;  2D2W A;  4FQG A;  3GBG A;  2DO7 A;  1X3U A;  1ACI A;  3NQO A;  3HSF A;  3OIO A;  1AWC A;  3CMY A;  4E7L A;  2KP6 A;  4OIQ F;  2X6Y A;  1UHW A;  3RPU A;  3M8E A;  3S1Q J;  2QCO A;  1YS7 A;  3RZO J;  1MBK A;  1RC9 A;  1Z3X A;  2TRT A;  2WC2 A;  1XB4 A;  2XV4 S;  1ZN2 A;  5D8K B;  1FIA A;  4L9T A;  3DF8 A;  2Y69 H;  4EM2 A;  3CMM A;  4ZTF A;  1F5T A;  4EJV A;  1QZZ A;  5CVV A;  2A07 F;  2QYO A;  4MQV A;  4ETS A;  2EIJ H;  1KYZ A;  2IGN A;  2PEX A;  1Z9C A;  1IG7 A;  3SZG A;  1VQL I;  2P7V B;  2KHM A;  1ZGA A;  5FLX K;  5LLQ A;  1W36 C;  1OPC A;  1XC5 A;  3C2G A;  1AKH A;  1AKH B;  2MBF A;  2MC4 A;  3I4N J;  3RKW A;  2WWY A;  2EB7 A;  1EH7 A;  2EIK H;  1SFU A;  4P5O A;  2GA2 A;  4XLA A;  2PMZ N;  3QPH A;  1JXS A;  1MJA A;  1WJA A;  2V1U A;  3FXJ A;  2V79 A;  1WKM A;  3E5X A;  2HXI A;  3WTW C;  3SJM A;  1E0E A;  2XF5 A;  4IL6 C;  1X1P A;  2HYG D;  2OCC H;  3ML6 A;  1WJC A;  2QKM B;  4WXC A;  5JI6 A;  4PJL A;  1EA3 A;  4Q47 A;  1MMN A;  5AIQ A;  4HLY A;  2IBD A;  4KIB A;  1SAN A;  2NS7 A;  3F9K A;  1DQU A;  2MLK A;  1MBJ A;  1JGS A;  1I3A A;  1QVU A;  5J3L A;  1AA7 A;  3ECH A;  4BHC A;  1BJA A;  4RGU A;  2Y75 A;  2KT0 A;  3IWZ A;  2JZY A;  4R1H A;  3FM3 A;  4M6X A;  4F92 B;  2HZT A;  2CS3 A;  3EUH A;  3RTR A;  1SFO J;  3V7C A;  4JOM A;  2HEO A;  1I50 J;  4LIV A;  5FRN A;  2EIM H;  3B6A A;  2LF8 A;  3GYH X;  1K83 J;  3W6K B;  2V1X A;  2V9P A;  3H35 A;  3M07 A;  4A6E A;  1A04 A;  5DD4 A;  3OYJ A;  3OR2 C;  2W84 A;  5HDN A;  4IHV A;  1A36 A;  2CQ7 A;  3MCZ A;  3PQK A;  1OCO H;  3A01 A;  2PMZ A;  5GTI C;  2KPM A;  3WE2 A;  4JP0 A;  4UY8 I;  1FLI A;  1BN5 A;  5D4R A;  3H0G J;  2QA4 I;  2HDW A;  3WTX C;  5IPA A;  2DBB A;  2AQF A;  2EA2 A;  3IHU A;  2DXI A;  1RIO H;  1MD0 A;  3O3K A;  2NNN A;  4HEA 2;  1ZR2 A;  5HS7 A;  3HL2 A;  3S8P A;  4UUS B;  5E3O A;  3WTT C;  3TO7 A;  1K4S A;  1J59 A;  1RZ4 A;  1VI0 A;  5FKN A;  2HS5 A;  4O3M A;  2VC0 A;  1W36 D;  2QSG X;  1IZ1 A;  3C18 A;  4YEL A;  2ZKZ A;  4D7M A;  4BXU A;  3WTV C;  3S17 J;  4BE2 A;  4O5V A;  3S15 J;  1V5G A;  2R7D A;  2E5N A;  4IKF A;  3K0L A;  2F48 A;  5CVU A;  3LSP A;  1MMS A;  3BG3 A;  3CZ6 A;  2BVM A;  1KU7 A;  4E7H A;  2GXB A;  2CRG A;  4KJZ A;  3TW7 A;  1BR2 A;  3GEZ A;  3F8B A;  3WU1 B;  1BJZ A;  3ZR8 X;  3F6V A;  1QPM A;  3S3O A;  4M9S A;  3V4G A;  2BXZ A;  4C2M J;  4OAY A;  2BHY A;  1FEX A;  3V7R A;  4ESJ A;  3U9G A;  2ZJQ F;  3KP6 A;  4V19 K;  3HC7 A;  4XNF A;  3L9F A;  5ICE A;  1T56 A;  2EQR A;  3F8F A;  2RAE A;  1FJL A;  3KET A;  2VKH A;  2CW0 F;  4M3E A;  1WJ5 A;  3TMO A;  4P55 A;  3FZV A;  4UUT A;  2PJR A;  2V7F A;  3GVA A;  3DU5 A;  1BR1 A;  4KIC A;  1H0M A;  3P9I A;  5JLX A;  1S5L C;  2CV0 A;  3LA7 A;  3HGY A;  1YO5 C;  4BUP A;  2XDV A;  3QYB A;  3I53 A;  3F23 A;  2CWE A;  4M6V A;  2HQN A;  2PI0 A;  4GXO A;  4AU7 A;  4MEX F;  2O5R A;  3L7W A;  3AKZ A;  2P5K A;  3FMR A;  1TZL A;  2IA0 A;  2IGM A;  1O7L A;  3HRS A;  3Q0U A;  5B5E C;  3WU0 A;  3KP2 A;  2GIZ A;  3O8G A;  3S1N J;  1WI3 A;  3HYI A;  4C3J J;  1Z3Y A;  2TCT A;  5EF6 A;  1YW8 A;  2W48 A;  3SZP A;  1T0F C;  3NRV A;  3ABU A;  4F91 B;  3HOU J;  1YE9 A;  5FKL A;  5BOX A;  3EYI A;  4HRI A;  2ZC2 A;  3J80 K;  1G4D A;  1NK3 P;  3K4K A;  5L3F A;  3KP3 A;  4J00 A;  1H9T A;  1QZE A;  3LL7 A;  3BPV A;  1FOY A;  4M3G A;  5J47 A;  3F8M A;  1WRJ A;  3I55 I;  5E17 F;  1UZC A;  4XID A;  3I3L A;  2WAD A;  4XK4 A;  4YII A;  2STW A;  2O8X A;  2RRE A;  4CXF A;  4X0G A;  3VOD A;  3CME I;  2TDX A;  4FT8 A;  3KIO A;  2CUF A;  3WE3 A;  2FE3 A;  3N4M A;  5HLI A;  1D5Y A;  1BOB A;  1YX3 A;  3CQZ J;  5BNG A;  5CPR B;  1ETQ A;  3JRC A;  3PNT A;  3VB2 A;  1HOM A;  2W00 A;  3LSM A;  4CUG A;  2YR2 A;  2E5Z A;  4GGG A;  3FIW A;  1S3J A;  1IN4 A;  2BBY A;  4HDV A;  2L4A A;  3E97 A;  3DPU A;  4OIP F;  1ZRF A;  2KIQ A;  4PFP A;  2Y31 A;  1WHU A;  3OIQ A;  4XLE A;  1ZTR A;  1N75 A;  4PJJ A;  2JA8 J;  4I7H A;  2ZXW H;  3IAM 2;  1DDN A;  5C4X J;  2FBK A;  3OYH A;  2XUB A;  1ZAR A;  2NXN B;  2VQH A;  3I9V 2;  3TL4 X;  1POG A;  1K78 A;  3HSE A;  3IH4 A;  1K78 B;  2EFN A;  3E6M A;  2R7U A;  1XMA A;  5E1W A;  1UJ8 A;  2P8T A;  2G7H A;  4IQJ A;  2CQK A;  4QIW N;  2M4K A;  1D0X A;  3S14 J;  3ZMD A;  2Z3Y A;  3ELK A;  2O7O A;  2R7Q A;  4JQF A;  2E7W A;  3K1M A;  2DOD A;  2L5Q A;  2QQ9 A;  4KT6 A;  1B8I B;  3CJT B;  4X6A J;  3DKW A;  3G2B A;  3A4C A;  1TQP A;  2DMU A;  5HDK A;  5HOD A;  1ZAO A;  3MKY B;  2DA2 A;  1BL0 A;  3ZQ7 A;  2NNY A;  3HSR A;  4E7J A;  3D5L A;  1OCZ H;  1D3Y A;  2HNH A;  1TQI A;  5D8L B;  4HF2 A;  4DBR A;  3J7Y J;  2GM4 A;  3H92 A;  2NOJ B;  3ESW B;  3BPX A;  1RNL A;  4AIK A;  1L0O C;  2HOA A;  2LR8 A;  4KN4 X;  2QQ8 A;  4ITV A;  3Q3S A;  2F2E A;  4A3I J;  3L00 A;  3OOP A;  2CO5 A;  1WJE A;  2IAI A;  4U88 A;  2FNA A;  2VPR A;  1MMD A;  3B02 A;  2DYS H;  4Y3O A;  1HKQ A;  1OCP A;  1AOY A;  2KQR A;  3K70 C;  1FMW A;  2JUC A;  1RUO A;  2KDZ A;  1WZ2 A;  2DMN A;  5E20 A;  2ZJ2 A;  4MO7 A;  5GPC A;  2MH9 A;  4CSW A;  2QQA A;  4WF2 A;  3HOY J;  2LDU A;  3JRE A;  1G6N A;  2L54 A;  4RS8 A;  1YS6 A;  2EIN H;  2OZU A;  4NBQ A;  4M3D A;  3CCR I;  5LGN A;  1Y6I A;  3CP8 A;  2K9N A;  1IDY A;  2WAQ N;  4ZDP A;  2MD0 A;  3WHC A;  2BV6 A;  1XMX A;  4U0V A;  1X2N A;  4ZYG A;  3D5R C;  3U2R A;  4PJN A;  4GDF A;  4MTD A;  2QBY A;  4R79 A;  3ZN1 A;  2GQQ A;  4D7N A;  3CCY A;  3M7G A;  2H6B A;  5KVR A;  4ANJ A;  2A6H F;  1RI7 A;  3FHN A;  1ZEL A;  5FKM A;  1Z21 A;  2JTV A;  4WK8 F;  3EET A;  5GAD J;  1S7O A;  4M71 A;  5DCF A;  2CJJ A;  5F27 A;  1NG6 A;  3FXQ A;  1KZH A;  4XKB A;  2M2E A;  5J1U A;  4CGZ A;  2VOD A;  3BTL A;  3HDD A;  2W24 A;  4II3 A;  2MC3 A;  2YPR A;  5CVJ A;  1FY7 A;  3CJN A;  1O3T A;  2ISY A;  3G1L A;  3ZRG A;  4A3B J;  3QPS A;  4MQ9 F;  2LH9 A;  3CTA A;  3U1D A;  2LSO A;  4L18 B;  3K69 A;  3H3Z A;  1U8R A;  2GXA A;  2COM A;  4QPO A;  3LSJ A;  2W82 A;  1IN7 A;  2FEZ A;  3K1P A;  1T38 A;  2JMW A;  1JKQ C;  5TIS C;  4BQQ A;  1FOX A;  4D1Q A;  1HXD A;  2JRM A;  5IP6 A;  4G94 A;  1GDT A;  4IHT A;  2N8G A;  2V9K A;  3MKZ A;  2WAQ A;  3RJP A;  1RR8 C;  4YEJ A;  4IOC F;  2LMD A;  3T8R A;  3OYA A;  2B63 J;  2R92 J;  1J9I A;  3RPQ A;  3GW2 A;  3JRI A;  3REO A;  2VJ4 A;  4CO8 A;  4BH9 A;  3F6O A;  5EGO A;  5EGO B;  1ZRD A;  4OU0 A;  2COB A;  3K70 D;  1UFM A;  4Y15 A;  2H09 A;  3JAM K;  2XRO A;  3OYK A;  1T95 A;  3H5N A;  4MIM A;  5JVT A;  2FBI A;  2E2H J;  2A68 F;  2Z9O A;  4RGX A;  1B9N A;  2KIM A;  2KL4 A;  2OAZ A;  3JRH A;  3K6G A;  4AIH A;  1A31 A;  3H3V K;  3FXM A;  3L1P A;  4KA4 A;  1YOV B;  1R22 A;  2DPU A;  3HOS A;  2W85 A;  3W2A A;  3KEO A;  3LSK A;  1I39 A;  2PN6 A;  5E3M A;  2VLA A;  2YUS A;  2NRA C;  3OYD A;  1F36 A;  5D5W B;  2ZNY A;  2Y9Y A;  4P96 A;  4ZC3 A;  2KJC A;  2NS8 A;  2VOO A;  3AL0 B;  4GYI A;  1HW5 A;  2CSO A;  2DA5 A;  4HLX A;  4S0H B;  3HOZ J;  2WV0 A;  3DKY A;  4IJA A;  2FBH A;  1W4M A;  5LGU A;  1IN6 A;  1M1E B;  3OYI A;  2DA7 A;  1HDP A;  2RN7 A;  2FQ3 A;  3TP3 A;  4AM3 A;  3PIO F;  2ADU A;  2M5W A;  2ME0 A;  3I58 A;  1XDU A;  4DGW B;  4EV0 A;  1HLV A;  1Y1W J;  3VPR A;  1UG0 A;  1W7P D;  2CUE A;  2PMH A;  3LA3 A;  3BQZ A;  5E8G A;  4RB2 C;  1T8I A;  1YIT I;  3ZMT A;  1KU2 A;  3ZGK A;  3G6E I;  2BW3 A;  2WB1 N;  1A6I A;  3KYD B;  3ASO H;  2M4G A;  4I0B A;  3WG9 A;  1N77 A;  4Q5S F;  3DXJ F;  2MSY A;  2L01 A;  1W5C C;  2ZXI A;  2LBF A;  4C2U A;  1LDJ A;  5BS6 A;  1ZLJ A;  3DU6 A;  2LKS A;  3SFI A;  2A61 A;  5TGT A;  3M1C A;  2DCE A;  2HZD A;  4KDP A;  4KIT B;  2CFX A;  4Q4Z F;  3DTI A;  3GZN B;  4R8H A;  3T1B A;  3QU6 A;  1O3R A;  1Y0N A;  4YIR X;  2V1N A;  4BU2 A;  3OS0 A;  4ON0 A;  2R7X A;  3S3M A;  2K40 A;  4F7Z A;  1WSU A;  1VQ5 I;  2LRD A;  2XF6 A;  3CDI A;  3CES A;  4D5F A;  5IOY A;  1JI8 A;  3IH2 A;  2VQG A;  3FMS A;  1OCC H;  2DN0 A;  3BZ6 A;  1DP7 P;  3JTH A;  2K3P A;  2WAF A;  1YHQ I;  1HKT A;  3MZY A;  2R0Q C;  3OYL A;  2XVC A;  1FSH A;  2ESH A;  2K02 A;  1U9O A;  2HI3 A;  4H0E A;  4CYC B;  1S72 I;  1Y8R B;  3CCU I;  4L0Z B;  3A03 A;  2VQL A;  1ZKG A;  3HPG A;  5FRO A;  3RQ4 A;  2M8E A;  2O6G E;  2X9D A;  3MZ8 A;  4PJM A;  4G6T B;  1QZY A;  3ZMS A;  1U2W A;  2FXA A;  4BBS J;  1TP4 A;  3GTM J;  4M3F A;  2ECB A;  1TTY A;  3GFM A;  3Q9V A;  5EZH A;  1FC3 A;  1FP1 D;  2I8D A;  4G7O F;  1D1C A;  2ICW G;  3HRT A;  2BY0 A;  1YYV A;  3PL8 A;  1Q1V A;  2O8K A;  3CLO A;  2JJ7 A;  3LA2 A;  1OR7 A;  3S2D J;  4FCY A;  5FO5 A;  2XPU A;  3Q0W A;  1JTY A;  2M7B A;  5IT3 A;  1HC8 A;  3EUH C;  3D5S C;  3HIF A;  2PFB A;  1U78 A;  2K4B A;  4XN3 A;  4BNC A;  4A69 C;  1PUF A;  3HTU A;  5CQG A;  2ZNZ A;  2R5Y B;  2JPC A;  5ILU A;  1SAX A;  2E1O A;  2HKO A;  5EJC A;  5J6X A;  3JRB A;  3GX4 X;  3FBI B;  2DU9 A;  2CGP A;  4UV8 A;  4B1R A;  2ZME A;  1G3S A;  1QVT A;  5EEG A;  5C3E J;  4IHW A;  1VQK I;  3CC2 I;  2AQE A;  2V1D A;  1RES A;  2VXD A;  4FAS D;  4DYQ A;  3RPU D;  4U7B A;  2H27 A;  4LIU A;  1GLN A;  1ETV A;  1WJB A;  1P4A A;  4LJZ F;  4MGR A;  2Q1Z B;  3MFK A;  1IF1 A;  2ZJP F;  3KE2 A;  4A3G J;  2F5C A;  1I6H J;  3SHF A;  5K1Y A;  3MKW B;  4MTE A;  2OBP A;  4BEH B;  3A0H C;  4BY7 J;  4J19 A;  2RV8 A;  1WWX A;  3TW6 A;  4DYC A;  1WFX A;  1J0R A;  3GFJ A;  4PGG A;  5IT9 Z;  4EMS A;  3OYB A;  5D6F A;  2DDB A;  2WTE A;  4D0P A;  2R93 J;  3MQ0 A;  2V6C A;  3MMY B;  4GRI A;  3QOE A;  4IOA F;  4LLN A;  2LNB A;  2BEO A;  2RGV A;  2EFW A;  4B09 A;  3PO3 J;  4NDL A;  9ANT A;  3ZQG A;  1T33 A;  3F8N A;  5F0C A;  3ZMZ A;  3E7L A;  5CYV A;  2JN6 A;  1R49 A;  1KQ8 A;  1V4R A;  1CF7 A;  2B0L A;  4UV9 A;  4OOI A;  2R7T A;  1I27 A;  2DOA A;  2R7V A;  5CJ9 A;  2DMP A;  1QHH D;  1R7J A;  4XQF A;  2A6E F;  1SFK A;  3E1S A;  5J8F A;  2GLO A;  3OL4 A;  4I6Z A;  3R60 A;  5AIP A;  1FT9 A;  5FD5 A;  5F08 A;  4EJU A;  1LEA A;  2G9W A;  3COA C;  5IP7 J;  2JUG A;  1MJB A;  3T5X A;  2ELH A;  2L9S A;  3BWG A;  3ROU A;  2W1O A;  1W5T A;  2MH2 A;  1H9G A;  4BDZ A;  1TW3 A;  3K4N A;  2CQX A;  2ELJ A;  1TT5 B;  4BQA A;  2CUZ A;  3OYG A;  4ZDO A;  2F4I A;  2JA7 J;  3ZQI A;  5F6F A;  1OIS A;  4L9V A;  1YTY A;  1IDZ A;  3NWS A;  1G59 A;  1GV5 A;  1P9Q C;  1Z6T A;  3C7J A;  2VPL A;  1XN7 A;  4RM3 A;  3LQQ A;  4M72 A;  1IGN A;  4FE7 A;  5HOO A;  3AAF A;  1EJ9 A;  1LPQ A;  1O4X A;  5TRD A;  2ESN A;  2HGC A;  4DW6 A;  3IRQ A;  1U5T A;  1UAA A;  4I2O A;  1J2X A;  3WGH A;  1QPI A;  2P7C B;  1Z6R A;  2HQR A;  2PX9 A;  1RKT A;  2B7E A;  2E1M B;  2XSJ C;  3FXU A;  3H9Q A;  5LBQ A;  3L2V A;  4BDY A;  4MFD A;  2DFI A;  2LYC A;  2RKH A;  2MA3 A;  3HZJ A;  2RQQ A;  1UHM A;  1TC3 C;  2DYR H;  3RI4 A;  3ABK H;  3OSF A;  1I5Z A;  4AYB N;  4ENN A;  3ONQ A;  1OCT C;  4XIC A;  3ZQH A;  2MG4 A;  3QWL A;  3HEF A;  3F72 A;  1X1C A;  1JGG A;  2UUZ A;  3C1D A;  4OMY A;  4Q48 A;  5FRM A;  5ERI A;  1SD5 A;  3CLQ A;  4CCK A;  4B3A A;  1LB2 A;  3MN2 A;  3VFZ A;  3DPL C;  1GXP A;  5F0H A;  1YQA A;  5B1A H;  2DJN A;  3GZ5 A;  1E17 A;  4MLO A;  2VJJ A;  3N97 A;  3BY6 A;  2Z5U A;  2OC6 A;  4E70 A;  1Z91 A;  3BR3 A;  5FFX A;  4ZTJ A;  1OJL A;  1LE8 A;  4I76 A;  1LE8 B;  2BY1 A;  2M87 A;  4BY1 J;  3DFG A;  2IGK A;  3HB9 A;  2MW8 A;  3PUF A;  4Z6Y A;  1O3S A;  3FF5 A;  4XRS G;  1D8K A;  5F04 A;  1OYW A;  2KDO A;  1X1A A;  5LRR A;  2R5Z A;  3TO9 A;  2D45 A;  3I0T A;  3A01 B;  5J1R A;  1WJD A;  2P81 A;  3G1O A;  3BZK A;  5M5Y J;  2IXS A;  5IP9 J;  1IRX A;  1X4O A;  5K7H A;  6PAX A;  2XIG A;  4AYB A;  1VZ0 A;  4PUS A;  2KIS A;  3EDP A;  4A6D A;  3H0D A;  3QYE A;  2A69 F;  4BBR J;  1YG2 A;  4LFU A;  3DQV C;  1OKR A;  5DM7 F;  4I98 B;  2HFH A;  4KIG A;  5CKT A;  1D0Z A;  4RMN A;  3V42 A;  4Y4R A;  1LNW A;  1WVR A;  3AG1 H;  2B9S A;  2M30 A;  3MZH A;  2DMQ A;  3I4P A;  3VYU B;  1EF4 A;  3ECO A;  3PUB A;  1UHS A;  4QPQ A;  1APL C;  5B3S H;  3PQJ A;  4CZC A;  1MMG A;  2BVL A;  4BJ5 C;  1H88 C;  3HHG A;  4N4O B;  5EDN A;  2R7Z J;  1UMQ A;  3BG5 A;  2FU4 A;  1E3O C;  1S7A A;  1BOA A;  2DQL A;  1C0W A;  1FYK A;  5E1Z B;  5EZG A;  3DBR B;  3K4L A;  3S2H J;  3QP6 A;  1XMK A;  3GF2 A;  3J7A O;  3X2Q H;  1YJN I;  3RDI A;  3KZY A;  1ZHF A;  2VE9 A;  2FQ4 A;  3F8C A;  4CCM A;  3P9C A;  4RAF A;  3BG7 A;  3I64 A;  1BC8 C;  4KYW A;  1AU7 A;  1P6R A;  1XD7 A;  4KMF A;  4XR6 A;  4I99 C;  1RRJ A;  2PJR B;  3E5U A;  3E3V A;  2R3S A;  2FJ1 A;  5CLS A;  1IV6 A;  2DT6 A;  3MAJ A;  2WA0 A;  4JYK A;  5HVQ C;  2EV6 A;  4LGW A;  5HDG A;  5EG0 A;  3SQN A;  2I10 A;  2Y2Z A;  3KPH A;  1IJW C;  3FIS A;  3GUD A;  3K4J A;  5D5X B;  1EV7 A;  2KIF A;  4DNC A;  1F9N A;  3S32 A;  3DLL F;  2UXX A;  3SDB A;  4ESF A;  2UZK A;  3A02 A;  1KA8 A;  3VSL A;  1MMA A;  2K9S A;  4L5I A;  4A3J J;  2ZO4 A;  2DA1 A;  4I09 A;  1LDK B;  2KMU A;  5DV5 A;  4ZZL A;  4PZJ A;  5B66 C;  3KP5 A;  4B43 A;  3Q5F A;  2OTJ I;  1HW2 A;  2KRH A;  2JA6 J;  1A6Q A;  1QHG A;  4C9Y A;  2O3F A;  5K5Q A;  4XKV A;  4E7K A;  1MSF C;  1LVA A;  2OV7 A;  1ZYR F;  2DK5 A;  1GT0 C;  2V26 A;  1ZG5 A;  4XN0 A;  1VQ4 I;  2LTP A;  2R4G A;  4XON A;  3TBI A;  2FRH A;  4G12 A;  1B1B A;  5KNL A;  2EV0 A;  1SD7 A;  3QP5 A;  3BDD A;  2PG4 A;  3LSI A;  2Q2E A;  2LY1 A;  2Q2E B;  3IC7 A;  3E6C C;  2MLG A;  3R0A A;  4IHY A;  1MZB A;  4KUM A;  1J7K A;  4AVP A;  2XKP A;  3CJQ B;  4G6D A;  4YRV A;  4IRG A;  4RA2 A;  2IS6 A;  2X6X A;  4BJ6 C;  4HNT A;  1D1A A;  1J09 A;  1BR4 A;  3RCO A;  1LKX A;  1K61 A;  1W0U A;  3FXL A;  3L2R A;  1XPX A;  5IYB J;  1XGN A;  2VOP A;  1KQ0 A;  2VC1 A;  4ZYE A;  5E18 F;  2UV1 A;  2VUM J;  1I1S A;  2LKP A;  2XGE A;  1TWC J;  3I59 A;  3NEU A;  2HTS A;  1DP3 A;  3V8K A;  2EZI A;  4UB8 C;  5F1J A;  3CMA I;  2GA1 A;  1MBG A;  3DKX A;  1LFP A;  3WTZ A;  2WV1 A;  4B47 A;  3OV8 A;  4XLP F;  2EPF A;  4F52 A;  4LK1 F;  1MJ9 A;  1JT6 A;  4EQQ A;  3EYY A;  4V2F A;  1VQP I;  2FSW A;  2K7L A;  1PDN C;  2QGU A;  4KIF A;  4RM2 A;  3GME A;  2DT7 B;  4N0B A;  1K79 A;  1ERD A;  2DA4 A;  2DMT A;  5IY5 H;  1VFC A;  4XKC A;  3VDX A;  5L3E A;  1R6R A;  1KU9 A;  2JSP A;  2K9L A;  2HVS A;  4IZZ A;  3R61 A;  2EBI A;  3QYF A;  4GCV A;  5JFR A;  1VF9 A;  1TQM A;  4G6Q A;  2VON A;  1B6A A;  3DEW A;  1ZGW A;  4H4K C;  1Y39 A;  2E2I J;  1MNM C;  4OWR B;  3GFL A;  4NUB A;  3CDH A;  1NK2 P;  2Y48 A;  3AL0 C;  2F5V A;  1U3E M;  2DPD A;  4CCL A;  3BTC A;  5IYD J;  1T98 A;  1ON2 A;  3BJO A;  1PYV A;  1OFC X;  1WH5 A;  4CA0 A;  4WWC A;  1ITY A;  2K5C A;  3HUG A;  4W1U A;  3VOE A;  4RB3 C;  4CHU A;  1D8J A;  1IRF A;  2VKE A;  3NAU A;  3QOD A;  3QRF F;  1ETY A;  2CUJ A;  1D5V A;  3K2A A;  2EZK A;  1P7I A;  1QBJ A;  3OS2 A;  2E19 A;  2PLY A;  1OYY A;  1OQY A;  2P4W A;  2IPQ X;  1XCV A;  4P1W A;  3CUQ A;  3CUQ B;  4U7D A;  1LUJ B;  1F43 A;  2YSR A;  3FXO A;  1OCR H;  5IOZ A;  1O7F A;  2O61 A;  1SFX A;  2DAO A;  1RPW A;  2NYX A;  2Z99 A;  2CV2 A;  3A1Y A;  2MFZ A;  4IX7 A;  1USS A;  2L02 A;  2H8R A;  2OUM A;  3KCC A;  3K10 A;  1R00 A;  1CGP A;  2QBY B;  1P92 A;  1X3Z B;  3AG2 H;  3FDY A;  4F93 B;  3JRF A;  1VQO I;  4A3L J;  2E34 A;  2Y0S A;  4C3I J;  2QEN A;  1H8A C;  1OLT A;  1XCB A;  2BOL A;  2E71 A;  3RZD J;  3FM5 A;  3LAJ A;  2DFF A;  2PJP A;  2IEK A;  2PMU A;  3GFI A;  2L9N A;  1FBU A;  2LOO A;  2XAH A;  3D1N I;  4L5J A;  1MBE A;  3FKI J;  5L3G A;  2VQC A;  4DOZ A;  2HR3 A;  2VKD A;  4ZYD A;  2O9L A;  4S04 A;  4JX5 A;  3GTK J;  1BIA A;  1T0F A;  5LHG A;  2ISZ A;  1G8X A;  2EZH A;  3E0J B;  3CDL A;  4NB5 A;  3ERE D;  1T6S A;  1FTT A;  4LOC A;  4PFO A;  3RKX A;  1FOW A;  2OQR A;  1Z1D A;  4HDU A;  1W0T A;  1ETW A;  1KQ9 A;  3HRM A;  4BS9 A;  1DU0 A;  1GHC A;  2QLZ A;  4NQW A;  5DYM A;  3TDZ C;  3I4M J;  1Z7L A;  3U1K A;  4A3D J;  3Q0V A;  1ZG1 A;  4G8X A;  3QOP A;  3RYR A;  2NVT J;  4E7I A;  1DGR M;  3FWE A;  3A2K A;  1SFE A;  1MGT A;  4JK1 X;  4XOP A;  4QSH A;  1HF0 A;  2ZJR F;  2JVG A;  1R1U A;  1RKW A;  2GIV A;  4U0Y A;  4RGS A;  3PJR A;  2HYF A;  2FNP A;  1TWH J;  3TQN A;  4AIJ A;  3LFK A;  5M3M J;  2AXL A;  3GTQ J;  1RET A;  2EZL A;  3WOD F;  2DI3 A;  4HW0 A;  3CF5 F;  3LAP A;  5L3C A;  2XHK A;  3QPL A;  3L2C A;  5HS9 A;  1KGS A;  3DTK A;  1X19 A;  1LVK A;  2JWT A;  2LF7 A;  1IXC A;  4Y7N J;  4NHJ A;  3HKZ A;  3HXL A;  3QU3 A;  2DDA A;  2VBY A;  5ICC A;  3GTL J;  4A5N A;  4HZF A;  1R23 A;  3CF2 A;  5H20 A;  3VYS B;  3CCV I;  3BG6 A;  2BYV E;  1O3Q A;  4KFC A;  3S1M J;  2H6C A;  3BR5 A;  3RQI A;  3DEE A;  1FOK A;  2X6O A;  3DBH B;  3BZC A;  4ZYH A;  2YX4 A;  2HQ5 A;  1K6Y A;  5D5U B;  3ASN H;  3ZQF A;  3H9G A;  3B73 A;  3ZCO A;  4A3M J;  4MEY F;  4B8X A;  5KAF C;  2WY7 Q;  5EYR A;  4OIR F;  5BQT A;  4U0W A;  4BYY A;  2X1C A;  3KLO A;  1SAU A;  2LVS A;  2VKV A;  5FKK A;  3G73 A;  2NVQ J;  4XSX F;  1S6L A;  2F5F A;  4LMY A;  2OCE A;  1HBX G;  3HOW J;  2XRL A;  1P4W A;  4HV5 A;  3VEP A;  4LIT A;  1HSJ A;  2XSD C;  1PP7 U;  2BW3 B;  5KHD A;  3AFH A;  3IRR A;  4A3F J;  2EK5 A;  2X0L A;  2A3S A;  3CC4 I;  4BE0 A;  2LBF B;  2KZG A;  1N25 A;  1SD6 A;  4QLC U;  3CD6 I;  4G9Y A;  3IKT A;  2E1N A;  3H5R A;  4I02 A;  2Z33 A;  1HDD C;  1SVL A;  3CJR B;  1SEU A;  2BZT A;  3HTS B;  1W5S A;  2HKX A;  3DP7 A;  4DQ2 A;  3VWB A;  2HOE A;  1TBX A;  1WH7 A;  2RQP A;  3U21 A;  2EWN A;  3VYT B;  5A2Q K;  3CO6 C;  2P6T A;  4RAZ A;  2VXZ A;  2P5V A;  3OOU A;  1XSD A;  2NVX J;  3W3C A;  3P5J A;  4A3E J;  4AC0 A;  5A2Q Z;  4Y33 A;  4XSZ F;  4P9U A;  2XAF A;  3O2P E;  1LEB A;  1BW5 A;  2L7M P;  1XGO A;  4WXD A;  3KZZ A;  1WJF A;  2E1M C;  2M3A A;  2R7F A;  5LD2 C;  3GLL A;  2DJI A;  2ZSI B;  4KMU X;  1ULY A;  5K7F A;  3O6B B;  1JKP C;  3W6V A;  4XLF A;  2R7O A;  4XLN F;  2LP0 A;  1JKR C;  3FHZ A;  3BT9 A;  5E3N A;  1KYW A;  1S9H A;  1WCM J;  4CCN A;  2VBZ A;  3ZQC A;  3LSG A;  4B44 A;  3HRU A;  5FFZ A;  3LST A;  4U87 A;  4HSR A;  5L3B A;  3LFU A;  5K5R A;  1Z7U A;  4V2G A;  1DPR A;  4M6Y A;  4HPQ A;  2G0E A;  2FMY A;  2YX7 A;  5DUK A;  2LG4 A;  4JX4 A;  1GXQ A;  4OIO F;  2FOK A;  1PUF B;  1NHA A;  3BR6 A;  1R1V A;  2CW8 A;  1K6O A;  1DPU A;  1IRZ A;  2P5L C;  3ZQQ A;  1YLF A;  2ZME B;  2L2O A;  2VJI A;  1UB9 A;  3I54 A;  3JRD A;  2HDC A;  1V5E A;  2CG4 A;  2STT A;  2WBM A;  4I0A A;  3IWF A;  2G7U A;  4LD5 A;  5BPD A;  4DZJ A;  2XF7 A;  4HBL A;  3FK7 A;  2F5D A;  3OY9 A;  5DDG A;  3WHB A;  5GAE J;  5EEA A;  4EAT A;  5IT9 K;  2GOX B;  3WTY C;  1TNT A;  4BQN A;  1NG7 A;  4UHT A;  4A0Z A;  2HOS A;  4XRS A;  4A0X A;  2GZW A;  3OYC A;  4EGZ A;  4ENJ A;  2DA6 A;  3TO6 A;  1IN5 A;  2M8G X;  3ZOB A;  1BI1 A;  4P9F A;  1J5Y A;  2K86 A;  1SC7 A;  4XKW A;  3TKY A;  4II2 A;  4B4C A;  1WQ2 A;  1Y0U A;  4L5E A;  5K5O A;  2OTL I;  2DTZ A;  1SMT A;  3K4M A;  4CZZ A;  3I56 I;  3GO5 A;  3JRA A;  5DD8 A;  5M3F J;  3CCE I;  1CF7 B;  3V8L A;  3EPZ A;  3KFW X;  4XL9 A;  5E8I A;  3KYL A;  5BPI A;  4W97 A;  2CYY A;  2DOE A;  4RAG A;  4YIF A;  2IRF G;  2Y30 A;  4QWQ A;  2HPM A;  2OPT A;  3S2W A;  3DEU A;  5JVG F;  4ASN A;  3OIP A;  1BI0 A;  3JRG A;  2VAS A;  1W1W E;  3IKV A;  3H36 A;  4LLL A;  5ED4 A;  1T08 B;  4JX6 A;  1ONV A;  3K2Z A;  5BMZ A;  1AHD P;  1VQ7 I;  3I71 A;  5J4Y A;  2W4S A;  3WU2 C;  1KU3 A;  4EJT A;  1XGM A;  4AWX B;  4HF1 A;  4G7H F;  4A5M A;  3FK6 A;  3D0S A;  1MH3 A;  1U0J A;  4XLC A;  1VND A;  1FX7 A;  2DTR A;  2JVH A;  3IUO A;  2ECC A;  2FX0 A;  4FIS A;  5GAG J;  1FWZ A;  2CW7 A;  4CDG A;  1R58 A;  3H9J A;  3IAS 2;  5F0F A;  1OMI A;  5GPA A;  1U5T B;  4IRH A;  1D0Y A;  2L3D A;  4RB0 A;  5EEH A;  4YG2 F;  3LMM A;  1ETK A;  3MVP A;  4D9J A;  3LQR A;  3JW4 A;  3NWT A;  2IJL A;  4IF4 A;  2MAB A;  4PDK A;  3MEX A;  1DUX C;  4RDU A;  3GWZ A;  5FB2 A;  3PSF A;  4XRF A;  2KRC A;  1ODD A;  4L9J A;  1ZR4 A;  2MD5 A;  1TWG J;  3OS1 A;  1WGX A;  3BLY A;  4B3X A;  2XAS A;  3K1N A;  2ELK A;  1VQ8 I;  4DYR A;  3PFI A;  5LEK A;  4I01 A;  3BP8 A;  5FLX Z;  1LQ1 A;  4FX0 A;  1O57 A;  2M34 A;  3VSK A;  1YFH A;  3M1E A;  3CCQ I;  3RKQ A;  2L7Z A;  4LLG F;  3KP7 A;  2LFB A;  2O0Y A;  4L0Y B;  2E7X A;  2JA5 J;  3TOA A;  1JUS A;  3IV5 A;  2OU2 A;  2CFO A;  5TJJ A;  4IO9 F;  1IC8 A;  3PNV A;  1PP8 F;  1HCR A;  4UUV A;  1XGS A;  4XBF A;  4BHB A;  1R5I D;  1FTZ A;  2ZXH A;  1VQ6 I;  2E36 A;  2VJ5 A;  4C3H J;  2ZFU A;  1V54 H;  3SEQ A;  2IS4 A;  4XOR A;  4LB5 A;  5FGM A;  3FMQ A;  2XPW A;  2ZSH B;  2R5Z B;  2WAE A;  2F4M B;  1KON A;  4ENM A;  1X2M A;  5GP9 A;  4WXH A;  3QPT A;  2UXN A;  3GTO J;  2ZCW A;  3C3W A;  3CCM I;  2YS9 A;  1UG2 A;  5E3L A;  4ZH4 F;  4LK0 F;  3SXY A;  1JUM A;  3P7N A;  4DZP A;  2KRF A;  4ZZD A;  2CV1 A;  4ABZ A;  4RLQ A;  1GUU A;  4M9Z A;  4BQO A;  4MHG A;  2PBI A;  3BTJ A;  4XRM A;  2OQG A;  4UXN A;  2DFH A;  2FML A;  3T8T A;  3SYT A;  2Q0O A;  1FYL A;  5LHI A;  1B4A A;  1UCR A;  4ZDL A;  4AVZ A;  2Z1D A;  4FHT A;  4RB1 A;  3V8J A;  1Z0X A;  2NS0 A;  3TDU C;  3HG9 A;  3KYC B;  3OSG A;  3TED A;  2XC7 A;  2EFQ A;  4M9X A;  1QRY A;  1V3F A;  3I5U A;  4LG0 A;  3OMY A;  3UR3 C;  4YFK F;  4UUS A;  4PCQ A;  4LG0 B;  1IUY A;  2XGC A;  2EFO A;  2EA4 A;  2X51 A;  5HLT A;  2W7N A;  2I5U A;  2BE5 F;  1FYM A;  2QSH X;  3BQY A;  2VB6 A;  1ZK8 A;  1ZGJ A;  1EKE A;  2NAZ A;  4OAZ A;  4PK4 A;  4EM1 A;  4UB6 C;  5CVR A;  3W2V A;  3S93 A;  2X6W A;  2K4J A;  2AHQ A;  2IP2 A;  4WCG A;  4K2E A;  4CYD A;  3HPH A;  2XGX A;  5HNH A;  3DV8 A;  1BC7 C;  2O03 A;  3EQL F;  5D6E A;  3JR9 A;  2K9Q A;  1I6X A;  1XG1 A;  1ZRE A;  2HOT A;  4NC6 A;  3RKY A;  4A0Y A;  4EM0 B;  3ZMU A;  1G2H A;  3E6D A;  1N78 A;  2E2J J;  2L9V A;  1IN8 A;  2R7W A;  1X58 A;  4IXA A;  2E35 A;  2IVM A;  2VE8 A;  4A93 J;  1A35 A;  3F3X A;  3GTJ J;  4C2T A;  4RBO A;  1IXR C;  3S1R J;  3ZQL A;  1R5H A;  2K85 A;  2FA5 A;  5EG0 B;  1X1B A;  1BW6 A;  4Y52 J;  3CUQ C;  2XGD A;  3W2W A;  2E1C A;  3KEY A;  5DUI A;  2JRT A;  2DQR A;  3LSR A;  3OYF A;  1Z67 A;  1S8N A;  3A0B C;  4M3B A;  3BOQ A;  4HF0 A;  1TNS A;  2CU7 A;  3R0J A;  2UWM A;  1QA6 A;  3OYE A;  2HPI A;  1UST A;  4EVI A;  1SD4 A;  1BIB A;  3DBL B;  3PM1 A;  4JBA A;  5DS9 A;  2YU9 J;  4ZJZ A;  1F4K A;  4AID A;  2GOM A;  3EUK L;  5HS8 A;  2DFE A;  2LRE A;  3KX2 A;  4RAY A;  2OA4 A;  5C4J J;  5B1B H;  5J8C A;  3KP4 A;  4A3K J;  1FMV A;  4MNU A;  4WX9 A;  2HXO A;  2KZV A;  2Q8K A;  1PVE A;  2BY2 A;  2VT2 A;  3TGN A;  1T2K A;  2XKO A;  1Y8Q B;  1WI9 A;  3WTU C;  4GYG A;  4Y13 A;  4GFB A;  3H3U A;  4Y17 A;  4BJT A;  1ENH A;  2D1V A;  5DM6 F;  4CCJ A;  4HAM A;  4FTH A;  3PNY A;  5K7Z A;  2ZB9 A;  3VYR B;  2ZFW A;  2ACJ A;  5LEJ A;  4ZYA A;  3J80 Z;  1XTA A;  2V6E A;  1LFB A;  1REP C;  2L7K A;  3LNQ A;  2A6T A;  2XAJ A;  2CH0 A;  1K7A A;  3OR1 C;  2Z16 A;  5HLG A;  3WG7 H;  2W57 A;  3BR0 A;  3RSN A;  2HVR A;  2MYS A;  4ESB A;  3I59 B;  1YIO A;  2K9M A;  1P4X A;  4HX4 A;  2K3F A;  4NNJ A;  1IRG A;  4BE1 A;  1XS9 A;  3K7A J;  3L2W A;  2L0K A;  5JHF A;  3L2U A;  1IXS B;  2LKX A;  5LRS A;  4OMZ A;  2XAG A;  1FP2 A;  3B6C A;  4HOB A;  2XRN A;  4CCO A;  5JLW A;  3OYM A;  3BTI A;  3ABL H;  4QTR A;  2DOF A;  2FD5 A;  1TWF J;  5LFA A;  2K27 A;  5DEQ A;  1XDS A;  2LY2 A;  4A3C J;  4HX8 A;  4NC8 A;  3M8F A;  1FZP B;  4HV6 A;  3CUO A;  3MD2 A;  3HHH A;  3C2H A;  2MGQ A;  1R36 A;  1DGW Y;  5KK1 A;  1MDM A;  1MDM B;  2DA3 A;  3G4S I;  1T39 A;  1IW7 F;  5D5V B;  4BGD A;  3DTE A;  1FBQ A;  3QQA A;  2A05 A;  1X1D A;  2FOW A;  2X4H A;  3M4O J;  1R71 A;  2LK2 A;  4IVN A;  2NVU B;  2AO9 A;  3T0Y A;  2RVC A;  2QZ8 A;  3SFZ A;  5FD6 A;  3IL2 A;  2VN2 A;  1BA5 A;  5H2F C;  4UVB A;  2Y0S N;  2QUF A;  3J7Z I;  3TOB A;  3LWF A;  3FX3 A;  1ZRC A;  2GXG A;  3PO2 J;  5J40 A;  3DLA A;  3WGG A;  2HQA A;  1HKS A;  1B8I A;  2GAU A;  3BJA A;  4MFE A;  1U8B A;  1XSV A;  2L9R A;  2XPV A;  2FUG 2;  3RYP A;  2JA2 A;  5H6Q A;  4KIS A;  2Z2S B;  4PJ0 C;  3HUG B;  3F0C A;  2ID6 A;  4DBQ A;  1SMY F;  2GWR A;  4EJO A;  3CO7 C;  3G1M A;  4BL0 B;  2J5O A;  1GVD A;  2CQQ A;  4UNO A;  2KFD A;  5ILS A;  2WY8 Q;  2KIU A;  2VT3 A;  4RLF A;  1FPQ A;  3J7A Y;  5D4S A;  2H94 A;  2DLL A;  4BXF A;  5M5W J;  1RUN A;  5F1R A;  5J4V A;  3TP0 A;  2EV5 A;  4KN7 X;  1R9T J;  3GXO A;  1F1Z A;  5M5X J;  4S05 A;  3ISP A;  4HX7 A;  1VQ9 I;  3ZMV A;  3MWM A;  3BR1 A;  3CCS I;  2CMP A;  3EUA A;  4BKX A;  3O8H A;  4E6K G;  1OYI A;  2E60 A;  2XAU A;  4KT5 C;  2DW4 A;  3HJE A;  4BHP A;  5L3D A;  4HYE A;  3BG9 A;  2PQ8 A;  1JJ6 C;  2RNG A;  4PSW A;  4BAY A;  3GCM A;  4Z2Y A;  4KNY A;  3PIP F;  2EJR A;  1TLH B;  2JT1 A;  2L7F P;  5FLM J;  2LD5 A;  3S3N A;  3CC7 I;  1GVJ A;  4NC7 A;  5FKO A;  3FKJ A;  1K4T A;  1BM9 A;  1FBS A;  2BHZ A;  1YW9 A;  1B59 A;  1PJR A;  2OF7 A;  4IQ4 A;  1I3Q J;  1QU3 A;  2M9H A;  2HDD A;  4B48 A;  4DIQ A;  3OWT A;  2H8W A;  4BXX J;  2OJE D;  2X85 A;  4C30 A;  3HOT A;  1JJ8 C;  3HKZ N;  4M74 A;  2F4O B;  4AUX A;  4HQE A;  1Q1H A;  3GLX A;  3DPT A;  2IA2 A;  2QWW A;  2QVO A;  3FBN B;  2XB0 X;  3RIR A;  2GBY A;  2VL8 A;  3K4C A;  3ZP5 A;  1YIJ I;  4NQW B;  1LJ9 A;  5JR3 A;  3HOV J;  3UKG A;  5KCM A;  1UEL B;  1JE8 A;  2HU9 A;  1P7J A;  1XX5 A;  4HNU A;  5CQE A;  2W25 A;  4IHX A;  5FJ8 J;  1OR7 C;  1MKM A;  4N9I A;  5AON A;  2VI6 A;  1YX5 A;  1Y56 A;  2L4M A;  2P0W A;  2QF7 A;  3S16 J;  3CCJ I;  1ORK A;  4HST A;  5FLV A;  3PSI A;  1MIJ A;  3KZI C;  2BGC A;  2M0M A;  4LB6 B;  1R5G A;  2AS5 F;  1R4M B;  1X3W B;  4A12 A;  1LFU P;  3C2B A;  2DT5 A;  2FF4 A;  3E6B A;  3KEQ A;  2EIL H;  2X1D A;  1YRN B;  1YRN A;  4GO1 A;  2LC2 A;  2ZME C;  1JT0 A;  4RGR A;  3R6S A;  2RNJ A;  3FXK A;  1LDD A;  2J5P A;  1V5F A;  3CP2 A;  5GTH C;  5F64 A;  3FXR A;  1TT0 A;  3Q9S A;  1IUF A;  2C6Y A;  4L9N A;  2ETH A;  3WTS C;  2HWV A;  4E7S A;  1P2F A;  3P9K A;  1ETX A;  2IGO A;  4X1E A;  3L2Q A;  4F55 A;  1STZ A;  3OL3 A;  3JTG A;  1MW7 A;  1HW1 A;  3JAM Z;  3JSP A;  4E7Z A;  2NOG A;  3G71 I;  4FE4 A;  3SZT A;  4F3Q A;  4UVA A;  2XAQ A;  3F21 A;  1YW7 A;  3R4K A;  3ZXS A;  4YFX F;  1JKO C;  1IAW A;  4DJA A;  2D5V A;  1ZQ3 P;  3GTP J;  3BC8 A;  3J81 K;  2R7R A;  1NH3 A;  1DU6 A;  1D1B A;  1BI2 A;  1R4N B;  2M0C A;  3J81 Z;  5H6R A;  1JHH A;  2BY3 A;  5ICG A;  5IYC J;  1J75 A;  4A2U A;  3IH3 A;  3V7S A;  4FX4 A;  1A5J A;  4HG2 A;  2ZBK A;  1VTN C;  1EH6 A;  1JHF A;  4YFN F;  4O6J A;  3QAH A;  1QGP A;  2EH3 A;  2R7S A;  5J1Y A;  2QSF X;  4N9H A;  4ENK A;  3L09 A;  2M7A A;  3HOX J;  1HQC A;  2RC4 A;  1TL8 A;  3M8J A;  4E4H A;  4G7Z F;  5GAH J;  3ZPL A;  1G3Y A;  2OZ6 A;  3BCA A;  1MBF A;  3W6J B;  2QQB A;  2HVQ A;  3CCL I;  3DWL E;  3HM5 A;  1SVM A;  1E3H A;  5CVI A;  2JSC A;  3BRO A;  3NAR A; 
#chains in the Genus database with same CATH homology
 3LMM A;  3IP4 B;  3S32 A;  3D5R C;  3SDB A;  4D9J A;  3NWT A;  1MMA A;  3VSL A;  4PJN A;  3UNG C;  2MAB A;  4R79 A;  2VIX A;  3PSF A;  2KRC A;  1LDK B;  2KMU A;  4J01 A;  2IS1 A;  4ANJ A;  4B43 A;  4FET A;  3FHN A;  3OS1 A;  1ZEL A;  2KRH A;  3BLY A;  4B3X A;  1Z21 A;  1QHG A;  4C9Y A;  2X1E A;  4XKV A;  3K4B A;  4E7K A;  4CH7 A;  3LSH A;  2IS2 A;  2OV7 A;  1NG6 A;  4XKB A;  2V26 A;  4XN0 A;  4II3 A;  1MND A;  2V4J C;  2R4G A;  4XON A;  3TBI A;  5KNL A;  3ZRG A;  3VSK A;  2LH9 A;  3LSI A;  1MNE A;  2LY1 A;  2Q2E B;  2CFO A;  4PSX A;  4XMY A;  3PNV A;  4BAC A;  2WB1 A;  4QPO A;  2W82 A;  3OYN A;  4BQQ A;  3CJQ B;  4D1Q A;  4YRV A;  2ZXH A;  2A5W A;  2VJ5 A;  2IS6 A;  2X6X A;  2ZFU A;  4BJ6 C;  4HNT A;  1D1A A;  1J09 A;  1BR4 A;  3RCO A;  1LKX A;  2V9K A;  3SEQ A;  2WAQ A;  3MKZ A;  2IS4 A;  4XOR A;  4YEJ A;  3L2R A;  3OYA A;  2ZSH B;  3H5A A;  2WAE A;  1KON A;  2UV1 A;  2KLO A;  2VJ4 A;  5HNF A;  1DP3 A;  2F6C A;  3SEZ A;  4LG3 A;  3DKX A;  3K70 D;  1LFP A;  1X4P A;  4B47 A;  2CV1 A;  3BCB A;  3OYK A;  4RLQ A;  1HA8 A;  1T95 A;  3H5N A;  4BQO A;  4F52 A;  2KL4 A;  4XM3 A;  4XLH A;  3K6G A;  3SYT A;  4RM2 A;  4ZDL A;  2DT7 B;  2Z1D A;  4AVZ A;  1ERD A;  3HOS A;  3HG9 A;  4XKC A;  3VDX A;  3W2A A;  1R6R A;  2JSP A;  3LSK A;  2K9L A;  4XOT A;  2XC7 A;  2HVS A;  4IZZ A;  3UR3 C;  3OMY A;  2VLA A;  3OYD A;  4BEH A;  3QYF A;  4ZC3 A;  2X51 A;  4H4K C;  3AL0 B;  5HLT A;  2W7N A;  4N4N B;  3PFY A;  4OWR B;  2VB6 A;  4NUB A;  3DKY A;  2QKL B;  3AL0 C;  3N05 A;  4OAZ A;  2F5V A;  4PK4 A;  3W2V A;  3S93 A;  2X6W A;  3OYI A;  3HPH A;  4CCL A;  5HNH A;  1PYV A;  4CA0 A;  2K5C A;  3GBG A;  1N78 A;  2R7W A;  4DGW B;  3QOD A;  1UG0 A;  2CUJ A;  4E7L A;  2KP6 A;  3OS2 A;  3ZGK A;  2BW3 A;  2X6Y A;  4C2T A;  1N77 A;  2M4G A;  4P1W A;  1Z3X A;  1X1B A;  2ZXI A;  2LBF A;  4C2U A;  3W2W A;  2CV2 A;  3KEY A;  3A1Y A;  2MFZ A;  3DU6 A;  4IX7 A;  5TGT A;  3CMM A;  4ZTF A;  3M1C A;  2DCE A;  3OYF A;  2HZD A;  2OUM A;  4KIT B;  3K10 A;  3DTI A;  2UWM A;  3FDY A;  4F93 B;  3OYE A;  2IGN A;  3SZG A;  2HPI A;  2Y0S A;  2V1N A;  4BU2 A;  3OS0 A;  2R7X A;  3S3M A;  2KHM A;  4ZJZ A;  2LRD A;  1OLT A;  2GOM A;  2XF6 A;  2BOL A;  3EUK L;  1W36 C;  2LRE A;  3CES A;  1JI8 A;  3C2G A;  3KX2 A;  2L9N A;  2VQG A;  2MC4 A;  2LOO A;  2K3P A;  2WAF A;  1FMV A;  2VQC A;  4DOZ A;  2VKD A;  4P5O A;  4XLA A;  3OYL A;  1WJA A;  1G8X A;  2KZV A;  3E0J B;  1E0E A;  4PFO A;  2XF5 A;  2VQL A;  3HPG A;  5FRO A;  3RQ4 A;  1WJC A;  2QKM B;  4PJM A;  4G6T B;  4PJL A;  4BJT A;  1EA3 A;  1MMN A;  4CCJ A;  3PNY A;  3F9K A;  1DQU A;  3VYR B;  4BS9 A;  4ZYA A;  2V6E A;  1AA7 A;  2L7K A;  1Z7L A;  2I8D A;  1D1C A;  2A6T A;  4F92 B;  3PL8 A;  2CH0 A;  2CS3 A;  3RTR A;  4E7I A;  3OR1 C;  2Z16 A;  1DGR M;  4JOM A;  3A2K A;  2M7B A;  4LIV A;  4XOP A;  3EUH C;  5FRN A;  3D5S C;  3RSN A;  2HVR A;  2MYS A;  4XN3 A;  2JVG A;  2K9M A;  4NNJ A;  4BE1 A;  3H35 A;  5CQG A;  3PJR A;  3L2W A;  3OYJ A;  5JHF A;  3OR2 C;  3L2U A;  4CCO A;  3FBI B;  3OYM A;  2PMZ A;  2KPM A;  5LFA A;  2AQE A;  2LY2 A;  2VXD A;  4FAS D;  4NC8 A;  3RPU D;  4U7B A;  2HDW A;  3DTK A;  1X19 A;  3MD2 A;  2AQF A;  1LVK A;  4LIU A;  1GLN A;  3C2H A;  1WJB A;  3HKZ A;  3HXL A;  1DGW Y;  2DXI A;  2Q1Z B;  4HEA 2;  3HL2 A;  4BGD A;  3S8P A;  3DTE A;  1X1D A;  3MKW B;  4BEH B;  3CF2 A;  3VYS B;  3BG6 A;  1WFX A;  3DEE A;  3OYB A;  1W36 D;  3MMY B;  4YEL A;  4GRI A;  1K6Y A;  3QOE A;  3DLA A;  2HQA A;  4BE2 A;  3H9G A;  1V5G A;  3ZCO A;  2E5N A;  2WY7 Q;  4IKF A;  2FUG 2;  2JA2 A;  4KIS A;  2X1C A;  2R7T A;  2Z2S B;  1SAU A;  2DOA A;  2R7V A;  3HUG B;  3CZ6 A;  2BVM A;  4E7H A;  1QHH D;  4DBQ A;  4KJZ A;  4XQF A;  1BR2 A;  3E1S A;  1SFK A;  4BL0 B;  3OL4 A;  4LIT A;  3ZR8 X;  3S3O A;  2BW3 B;  5KHD A;  3AFH A;  4OAY A;  2WY8 Q;  2JUG A;  4BE0 A;  2L9S A;  4RLF A;  2W1O A;  3HC7 A;  4XNF A;  2LBF B;  3J7A Y;  4BDZ A;  3K4N A;  2ELJ A;  4BXF A;  2VKH A;  2CUZ A;  3H5R A;  3OYG A;  4ZDO A;  1WJ5 A;  2F4I A;  3TMO A;  3CJR B;  2PJR A;  2V7F A;  2CMP A;  1BR1 A;  3DU5 A;  3EUA A;  4E6K G;  3NWS A;  1G59 A;  2CV0 A;  1P9Q C;  2E60 A;  2VPL A;  2XAU A;  4RM3 A;  4BUP A;  2XDV A;  3QYB A;  5HOO A;  3VWB A;  3VYT B;  3U21 A;  4AU7 A;  2O5R A;  2RNG A;  4PSW A;  2VXZ A;  3OOU A;  3AKZ A;  1UAA A;  3W3C A;  1TZL A;  2IGM A;  3S3N A;  4NC7 A;  3FKJ A;  2XSJ C;  4Y33 A;  3H9Q A;  2E1M B;  4BDY A;  3L2V A;  2LYC A;  1Z3Y A;  2RQQ A;  1WJF A;  2E1M C;  2M3A A;  5LD2 C;  1PJR A;  4IQ4 A;  1QU3 A;  2DJI A;  4B48 A;  2ZSI B;  3OWT A;  1T0F C;  4DIQ A;  4F91 B;  1YE9 A;  2X85 A;  4C30 A;  3ONQ A;  3HOT A;  4XLF A;  2R7O A;  4HRI A;  3DPT A;  1X1C A;  2UUZ A;  5FRM A;  3K4K A;  4J00 A;  4CCK A;  3FBN B;  1S9H A;  4CCN A;  3LL7 A;  3DPL C;  2VL8 A;  3K4C A;  3LSG A;  4B44 A;  4NQW B;  3I3L A;  2WAD A;  4U87 A;  4HSR A;  4MLO A;  2VJJ A;  2RRE A;  3LFU A;  5KCM A;  4X0G A;  2OC6 A;  1UEL B;  4HPQ A;  2HU9 A;  4HNU A;  5CQE A;  1BOB A;  1OR7 C;  2LG4 A;  4ZTJ A;  1YX3 A;  1YX5 A;  5CPR B;  1Y56 A;  3PNT A;  2P0W A;  2W00 A;  3LSM A;  4CUG A;  2E5Z A;  4HST A;  2IGK A;  3PSI A;  2CW8 A;  2M0M A;  3ZQQ A;  3DPU A;  2KDO A;  1X1A A;  2L2O A;  2VJI A;  1WJD A;  4PFP A;  2X1D A;  2IXS A;  2LC2 A;  3OIQ A;  4XLE A;  1N75 A;  1IRX A;  1V5E A;  1X4O A;  4PJJ A;  3IAM 2;  2WBM A;  1V5F A;  4AYB A;  1VZ0 A;  4PUS A;  3CP2 A;  2VQH A;  3I9V 2;  3OYH A;  1TT0 A;  3TL4 X;  3H0D A;  2XF7 A;  3QYE A;  3OY9 A;  4EAT A;  2GOX B;  4E7S A;  4BQN A;  1NG7 A;  2R7U A;  3DQV C;  3OYC A;  2IGO A;  5CKT A;  3V42 A;  1D0Z A;  4RMN A;  4F55 A;  4Y4R A;  3L2Q A;  4IQJ A;  2M4K A;  1D0X A;  1MW7 A;  3OL3 A;  3VYU B;  4XKW A;  4II2 A;  3PUB A;  4E7Z A;  4QPQ A;  2R7Q A;  4JQF A;  4CZC A;  2L5Q A;  1MMG A;  2BVL A;  4KT6 A;  4BJ5 C;  3G2B A;  3K4M A;  4N4O B;  4F3Q A;  3A4C A;  3ZXS A;  3MKY B;  4DJA A;  3BC8 A;  2R7R A;  3EPZ A;  4XL9 A;  3KYL A;  4E7J A;  3D5L A;  2HNH A;  1D1B A;  3K4L A;  4DBR A;  2HPM A;  2NOJ B;  3OIP A;  2VAS A;  4ITV A;  4HG2 A;  1WJE A;  2W4S A;  4CCM A;  1MMD A;  3BG7 A;  4Y3O A;  4XR6 A;  2R7S A;  2KQR A;  1U0J A;  3K70 C;  4XLC A;  1FMW A;  2PJR B;  2JVH A;  3IUO A;  4CSW A;  2M7A A;  2DT6 A;  2WA0 A;  5HVQ C;  3M8J A;  4E4H A;  2CW7 A;  3BCA A;  3H9J A;  3IAS 2;  2HVQ A;  3DWL E;  1Y6I A;  3K4J A;  3CP8 A;  1D0Y A;  4ZDP A;  2MD0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...