1YX3A

Nmr structure of allochromatium vinosum dsrc: northeast structural genomics consortium target op4
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
112
structure length
112
Chain Sequence
MADTIEVDGKQFAVDEEGYLSNLNDWVPGVADVMAKQDNLELTEEHWDIINFLREYYEEYQIAPAVRVLTKAVGKKLGKEKGNSKYLYSLFPYGPAKQACRFAGLPKPTGCV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein DsrC
publication title Allochromatium vinosum DsrC: solution-state NMR structure, redox properties, and interaction with DsrEFH, a protein essential for purple sulfur bacterial sulfur oxidation.
pubmed doi rcsb
source organism Allochromatium vinosum
total genus 31
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2005-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04358 DsrC DsrC like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.370 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1yx3A02
3.30.1420.10 Alpha Beta 2-Layer Sandwich Dissimilatory Siroheme-sulfite Reductase; Chain: A; domain 1 Dissimilatory Siroheme-sulfite Reductase; Chain: A; domain 1 1yx3A01
1JI8A 2V4JC 2A5WA 2XSJC 1YX3A 3OR1C 3OR2C 1SAUA
chains in the Genus database with same CATH superfamily
3QYEA 3H5RA 2ECBA 2Q2EA 1ETYA 3A02A 2OUMA 1X1BA 2M7AA 3HRMA 3M1CA 1MMSA 2DK5A 2HOEA 2HWVA 4MQVA 2R4GA 4XRSA 5ICFA 1ZG5A 3KIOA 1K83J 4MFDA 3BTLA 1WSUA 2GIZA 3K4BA 4RMNA 3PFIA 1O3SA 2LC2A 3QOPA 2BVLA 3ABUA 3MMYB 5GTHC 2E2IJ 3EDPA 2LDUA 3CQZJ 1CF7B 4I09A 1OYIA 2KIFA 2OQRA 4PJ0C 1IN7A 2H8RA 3BR6A 2ID6A 4X0GA 2MLGA 3CO7C 2B7EA 1MBKA 1WJCA 2R7TA 3CDIA 5F08A 1J59A 2M5WA 2V79A 1LDKB 2L9SA 2HDDA 1GVDA 3TQNA 1H9TA 1KYZA 4M6XA 2KZVA 2LH9A 2ZMEB 3DTIA 2HYGD 2R7WA 1LDDA 2W48A 3I58A 1BIAA 1I6XA 1VQOI 3OYEA 3ONQA 1JT0A 2O9LA 3BT9A 3V42A 3L2VA 5M3MJ 2M9HA 5K5QA 3ZQ7A 3G4SI 2DPUA 2P6TA 4I0AA 2HQRA 4RBOA 3LAPA 4KA4A 5E8IA 4YFKF 4L0ZB 4CCJA 3PO3J 3WTTC 4Y4RA 1G2HA 3S32A 2HYFA 3P7NA 3CC7I 1X1AA 1LFPA 2CUJA 4CYCB 2EB7A 1YRNA 1YYVA 5GTIC 3M8FA 1SD5A 3KP7A 3OYIA 4IHXA 2VOPA 1GT0C 4AIHA 3OYMA 3QODA 3CDHA 5CKTA 1GLNA 1G59A 2QZ8A 1G3WA 3IRQA 3MKYB 3CUQC 2RKHA 4G9YA 4BEHA 4N4OB 4BHCA 2I10A 3MQ0A 3OR2C 3O2PE 2J5OA 4CHUA 1Y56A 1VQKI 3ZP5A 4ENJA 3FM3A 1UHMA 3G1MA 4XN3A 5K7FA 1XSXA 4A69C 3CUOA 3NAUA 5ERIA 3V7RA 3GTMJ 2X6YA 2XKPA 4G12A 3JTGA 2ISZA 1K6YA 3H92A 2K9SA 1S8NA 3CJNA 3BC8A 4YFXF 2IXSA 3EQLF 2DN0A 2HU9A 4OAYA 1R36A 4L9NA 4Q47A 2F4MB 3M07A 2CUZA 2XKOA 2EIMH 2HZTA 4LIVA 2VT2A 3IUOA 3DCFA 3GXOA 3ZMSA 4G7ZF 3GCMA 4UUTA 2VE9A 3K10A 4U88A 2R5YA 1GDTA 2GXBA 1A6IA 3MVPA 2I8DA 3GW2A 1PVEA 2AXLA 3RZDJ 4R8HA 1MJ9A 1YLFA 1D1CA 2KL4A 1JKQC 5KHDA 2B63J 1IN8A 1UELB 4MTEA 4XR6A 4Y15A 1MW7A 2HKXA 3G2BA 5LEKA 3KP6A 2IEKA 5LFAA 1Q1VA 5BS6A 1R9TJ 3R0JA 1OJLA 3S93A 1XG1A 1HBXG 2VOOA 2VBXA 3Q0VA 2F5VA 1DP7P 5IYDJ 2CV1A 1YW9A 2LD5A 1B8IB 3VYTB 5BOXA 2LY9A 3CJRB 4BXUA 4OIPF 2FXAA 2Y30A 5JLWA 1Z67A 1PDNC 2DOAA 3HRSA 2A68F 4XKBA 2M8GX 3JCUC 1VQPI 1N77A 4U7DA 2HVRA 4NBQA 4YG2F 3HM5A 2EFQA 3GTGJ 2P0WA 1OFCX 3OIQA 4CCLA 1DUXC 5E79C 4QPQA 1Z6TA 1X2NA 2COBA 5CVVA 5FRNA 1MNDA 2WV0A 4AIKA 2DA6A 4RB0A 5CPRB 2L7ZA 1SC7A 1RR8C 1HLVA 5HLHA 1J0RA 2MD0A 3H5NA 4UV8A 1WI9A 1OQYA 3BJOA 3OMYA 1APLC 3F3XA 1SFXA 3DPTA 3SQNA 3CMAI 3I4NJ 4ESJA 3P9KA 4I7HA 3WGHA 3CCQI 3S1RJ 3C7JA 2KMUA 4XORA 2TRTA 2PX9A 1T95A 4ABZA 4A3FJ 2IT0A 2QCOA 3F8FA 3BG5A 5FFXA 4ETSA 4LIUA 1XD7A 4Y33A 2GXGA 1UCRA 1MDMB 1LEAA 3RKYA 2FMLA 3DEWA 3WTXC 4P9UA 3FKIJ 5H2FC 1ETWA 1N25A 1RIOH 2VJJA 1BOAA 1USSA 1Y8RB 2PMZN 4JX4A 4O5VA 5IP7J 5LD2C 4L0YB 2VUMJ 3L2WA 2KIQA 1E17A 5EEHA 4MFEA 1TBXA 2YUSA 3HYIA 4EATA 4RB2C 3COAC 4LLNA 3CCYA 1R5HA 4P5OA 2ZXWH 1H89C 2O0YA 1DGWY 1ZHFA 4CO8A 3HUGB 1LPQA 1VF9A 2K9NA 1DDNA 4X1EA 4L9TA 2EBIA 5DM7F 3U1KA 1E2XA 4BDZA 2DPDA 4BHPA 3SFIA 3F8MA 2H94A 3RZOJ 2ZSHB 4H0EA 2K9MA 3HTUA 2R7ZJ 2CUFA 3TP0A 2KDOA 5HVQC 5D5XB 4DIQA 1WJ5A 4IOAF 3TOBA 1ZRFA 2FF4A 3SDGA 2HZDA 2GM4A 2IS4A 4DOZA 2DQLA 2DFFA 4B3AA 4ZZLA 1XSVA 3OL3A 3SHFA 2CW8A 3ROUA 1E3PA 3JRAA 1Z3XA 2JT1A 3ZXSA 3J7YJ 1R4NB 3OS0A 3IRRA 2M45A 3LOCA 1SVMA 2FEZA 1AWCA 2ZXIA 4KUMA 2ZSIB 4M6VA 2L3DA 1FEXA 3QPHA 4NHJA 3TW6A 1ZQ3P 5J4VA 1WFXA 3LAJA 4HOBA 3LFKA 4IVNA 1JXSA 4YIIA 1A36A 3MKWB 1SAXA 1NG7A 5FKMA 5E3MA 4UUVA 3B73A 5CVRA 3R4KA 5K5OA 2EFNA 1HW5A 1RR7A 1SFOJ 1E3HA 4KITB 1YIOA 4BJTA 3U9GA 2HNHA 1POGA 2FOWA 4YFNF 2BHZA 3CCEI 1XPXA 1Q1HA 3DFGA 2Y69H 2MC4A 3PFYA 4HLXA 4XBFA 1EJ9A 2LKXA 4OU0A 2GLOA 4DGWB 1OCTC 2K4JA 4RGXA 1H9GA 3ZCOA 3CCVI 2QM3A 5J4YA 1HKTA 4UB8C 5IYCJ 4MNUA 2FRHA 1HDDC 5GPCA 1ZGAA 5GAHJ 3VOEA 4FISA 5E3LA 3CUQA 3OOPA 1ITYA 5ED4A 3H9QA 1BA5A 4JX5A 1Z6RA 3HRTA 3DBLB 5C4XJ 3FDYA 1X4PA 4LK1F 1V5GA 1T8IA 1U78A 1TC3C 3E7LA 2HEOA 2R3SA 2X1EA 3SYTA 2BW3A 2KJCA 4EJTA 4AWXB 2WAQA 4A0YA 3K2ZA 3D0SA 3WTWC 1IRXA 2ZMEA 2Q2EB 4CDGA 3ESWB 3M1EA 3J80K 3LSRA 2HI3A 3KFWX 3ERED 2ZO4A 2FSWA 1NG6A 2BXZA 2R7SA 1TNTA 1D8KA 2HQ5A 3ZOBA 4IKFA 4E7KA 3BPXA 4BGDA 3I4MJ 3RQ4A 3FK7A 5TGTA 4CGZA 3HOVJ 2DMTA 5FKLA 4ENMA 1PUEE 2YU9J 4C2TA 1A04A 1RI7A 2EPFA 3G6EI 1UFMA 3O8HA 4AYBN 2LLKA 5EJCA 2B0LA 1MMNA 3OYLA 3BCBA 4UV9A 1HSTA 1YG2A 2HS5A 3RCOA 1REPC 1JE8A 4N4NB 1W1WE 4BE0A 1QVUA 4P9FA 3IP4B 3RJPA 1HF0A 1ZR4A 4O3MA 1YO5C 1GUUA 3I4PA 3LQRA 4G6DA 1SFEA 3WG9A 2HR3A 1MMDA 2DLLA 3PM1A 3TBIA 1Z7UA 3ZQQA 2D1VA 5J1RA 3J7ZI 2LFBA 1KU7A 5D4SA 3OY9A 1KU9A 3FMQA 1PUFA 3OS2A 1F9NA 4I99C 2EFWA 3S16J 1U8RA 3KYCB 4GYGA 3L2RA 2BY0A 4LOCA 5CLSA 4Y13A 2G9WA 1YRNB 2P4WA 5FO5A 1L3LA 2G0EA 1FOKA 4OMYA 2RNGA 3K0LA 3TL4X 3DU6A 3E5UA 2ME6A 1K4TA 5LGTA 2XAQA 2RQPA 5CVJA 2FMYA 3LMMA 1D0XA 1MZBA 4ON0A 3UR3C 5FKOA 1D1BA 3CLOA 5LGUA 2BY3A 2E34A 4BEHB 4II3A 1STZA 4FHTA 4BNCA 2FNAA 2RQQA 1HKSA 4AD9A 2KKOA 3QPTA 2E19A 1PP7U 1VQMI 2UV1A 5DCMA 4RGUA 4IHSA 3SEQA 4GGGA 3H3UA 3I3LA 3S2DJ 2VXZA 4KIBA 3K2AA 4RGRA 2BEOA 2IJLA 1CQTA 2K40A 2STTA 4MHGA 4ANJA 1WI3A 5EDNA 2WA0A 4FASD 1MD0A 2BE5F 5AIQA 1FYKA 4UB6C 3UKGA 2QBYA 3WGIA 1ZAOA 2JA8J 3GMEA 4BKXA 3P5JA 2DDBA 5ILUA 3DXJF 5HS7A 2R5YB 1TL8A 4K2EA 1Y6IA 2IA2A 3TP3A 2F5DA 5DUKA 4M9XA 2BOLA 3G3ZA 1W36C 3IKTA 3IH4A 2EZLA 1XCBA 2A3SA 3FMRA 3BTJA 4IHYA 3DQVC 1XDUA 2WY7Q 4OIOF 1I50J 1ETOA 1RC9A 5FD6A 2R92J 5BPIA 2JA7J 1XGSA 2BY2A 5HLIA 5KK1A 3EUKL 1XSDA 2MYSA 3QP6A 4DNCA 4J01A 2LF7A 1BI0A 5JVGF 1T56A 4WK8F 2M87A 4RLQA 3S2WA 1Z7LA 4KT5C 4A2UA 2IS2A 5M5YJ 1GXQA 4DBQA 3ZR8X 2K02A 4HG2A 2FBKA 3IHUA 3QP5A 3HJEA 4S04A 4E7ZA 2PN6A 4X6AJ 1IXRC 3RKXA 3PSIA 1IN4A 1MBGA 4C3IJ 5J6XA 1FJLA 1I1SA 1N75A 3CLQA 4BDYA 4IJAA 3JTHA 3CP2A 3SZPA 3HOTA 3VYSB 4KFCA 2K4BA 4CCKA 4B8XA 2QGUA 4KIFA 2XASA 2JTVA 2QKLB 4GYIA 1FP1D 1I5ZA 2DQRA 2CMPA 1FYLA 1XS9A 2EIJH 3D5RC 1LJ9A 3CCLI 3GTOJ 1VTNC 4NC8A 5FKNA 4WWCA 1FBQA 2DI3A 5EZGA 3WHBA 1RUNA 2KJBA 4NNJA 1SANA 1TWCJ 2BXYA 2H1LA 2L9VA 3U2RA 1LFUP 3DTKA 2IAIA 2L7KA 2EILH 3GFIA 1UB9A 4DZPA 4S05A 2WTEA 2IS6A 3Q3SA 3B02A 4JP0A 1D3YA 2OZUA 1Z1DA 3BR2A 4KYWA 2UXXA 2CWEA 2K7LA 1W5TA 5LHGA 1X4OA 2JRMA 1FOWA 3R0AA 1OR7C 4UVBA 4HSTA 1ETVA 1ON1A 2PJRB 2DXIA 3CF2A 1EH7A 2Y0SA 1Z77A 4MGRA 2CV2A 5F27A 1K78B 3BR3A 3F72A 5M5WJ 3RYPA 1QZYA 1K61A 4ITVA 4LK0F 4U7BA 1MH3A 2CS3A 3GZ6A 4XICA 1B1BA 2OC6A 3PSFA 3CMYA 3FXQA 5E1XA 1VQ9I 1QPIA 2PMUA 4HX7A 3FXRA 1R6RA 3O6BB 5J1YA 3HG9A 2V1NA 1LB2A 2CU7A 5J1UA 3F6OA 1P4AA 4O6JA 2NRAC 3F21A 5F6FA 4B48A 2QUFA 2E71A 4PZJA 2JPCA 2DODA 2YR2A 2VKDA 2O61A 1R1UA 4LB6B 5E1ZB 4LB5A 4HF2A 4A12A 1WHUA 4WXDA 2C6YA 5EEAA 1ERDA 3HGYA 3PQKA 1S7EA 2UWMA 2CW7A 4I76A 4E7SA 2LY2A 4L9VA 1WH5A 3AL0C 1FPQA 2HOTA 2QWWA 1JHHA 3IWZA 5DTDA 4D1QA 4A3BJ 1JKOC 4PDKA 3HBLA 1R5GA 3HEFA 3K70C 2W00A 2FU4A 5F64A 2QA4I 3ZQLA 2L9NA 2NVXJ 1ONVA 3F8CA 2L54A 3IAM2 3AG1H 1O4XA 1QO0D 1FC3A 1G4DA 2FE3A 5BNGA 2VJ4A 1BM9A 2GOXB 2CFXA 2WB1A 1R4MB 3FWEA 1O3TA 3JR9A 1QPMA 2EK5A 4JYKA 4XQFA 4MTDA 2CGPA 1GVJA 3BG6A 3GFLA 1H0MA 3FMSA 1NHAA 5B5EC 3ABLH 3OSGA 3AG3H 3CUQB 2BY1A 3S3MA 2KZGA 3OL4A 1OYYA 3ECOA 3HC7A 4A3JJ 3HL2A 2UXNA 3M7GA 5L3DA 1B72B 2M7BA 1I6HJ 3FXMA 4XNFA 2K85A 2JN6A 2BW3B 2LSOA 4P1WA 1FIAA 4LLGF 3CJTB 3DU5A 4L5JA 4A0XA 3BROA 2A5WA 2OV7A 1YOVB 2L9RA 4N0BA 1RNLA 3PJRA 2EWNA 3IKVA 2JSPA 2XF6A 4A3EJ 2FA5A 2XGEA 1SVOA 3P9CA 3GZ5A 3HRUA 4AIJA 2KISA 2LREA 1DU6A 2KP6A 3A0BC 4XKWA 3HOYJ 2DFIA 3VPRA 1KZHA 3E6MA 1OCZH 4PFPA 4A3CJ 3I53A 1J7KA 2K9LA 3LSGA 3RPUD 5F0HA 1HKQA 4CCNA 2DFEA 5E17F 1WJEA 2DTZA 2ZB9A 5H6QA 2OBPA 3RPUA 4XMYA 3CCMI 1K7AA 2ZJPF 1C0WA 2LP0A 2CQKA 2K9QA 1W36D 2DT6A 2DOFA 3OIOA 2A6HF 2MW8A 5DYMA 4F91B 2JWTA 1JJ8C 1H8AC 1ENHA 3T0YA 2VJ5A 5LGNA 1FSEA 2CYYA 3GTJJ 2DYSH 3HOZJ 3OYJA 4CSWA 2E1MC 4EJWA 2Z33A 3NWTA 4M73A 1QVTA 4OINF 1QGPA 2ELHA 2MFZA 2OCCH 1BI1A 2JA5J 3F6VA 1V3FA 5FLVA 4DBRA 2JPBA 3AFHA 1PUFB 1XB4A 2Z16A 2HQNA 2PLYA 3MCZA 2A6TA 1DGRM 2A07F 5ICGA 2A5YB 1QHHD 1J2XA 1ZN2A 1FTZA 4LMYA 3LL7A 2HTSA 3D1NI 3BP8A 2CQNA 2FJ1A 4HPQA 4LFUA 1IV6A 5J47A 3A01A 2M2EA 3HB9A 4FX0A 5D4RA 1AKHA 1RKTA 3QYFA 1ZG3A 4LLLA 1B9NA 2NXNB 5LHIA 1XX5A 4RAZA 4TV7A 2AO9A 2X48A 2L7FP 5DS9A 2V7FA 3BJ6A 4AUXA 5L3EA 3E6CC 2NS8A 2DA5A 3Q9SA 4NB5A 3HSFA 1U9OA 5DCMB 3ULQB 4G7OF 1A5JA 3REOA 5AONA 1BIBA 5GAEJ 1UHWA 5D8KB 5DEQA 3ZRGA 1SD6A 3TKYA 4PSXA 1P2FA 2KLOA 2VC1A 1S29A 4MLOA 1OISA 1KU2A 4E4HA 2MC3A 2HXOA 3GZNB 2AS5F 3J80Z 2QBYB 4FETA 1LDJA 1HC8A 3HSEA 1OPCA 5E8GA 3ZMVA 2JMWA 4ESFA 1W5CC 2LRDA 2MA3A 1YQAA 1S72I 5FRMA 2ZKZA 3A1YA 1OR7A 4CCMA 3CC4I 2DJNA 4J19A 3ELKA 1WJFA 2RAEA 2DTRA 1T0FC 3LA7A 3DPLC 1FZPB 3QOEA 1U5TC 2TCTA 2JVGA 1WJAA 4N9HA 3V7SA 3TEDA 5FD5A 1X3WB 2GA2A 2L4MA 4ZDPA 2JRTA 2RN7A 1HCRA 1LEBA 3WU1B 2Q1ZB 1HSJA 4U0VA 2VKEA 1P9QC 2P7VB 2COMA 1JUSA 3BJAA 1WH7A 3K69A 3KYDB 1VI0A 2O8XA 1XC5A 2Z99A 1J75A 3LSJA 3PO2J 2O7OA 1JGSA 2E5NA 4EV0A 4M3BA 2JUGA 4RM2A 4M3FA 3E97A 3KEQA 1J09A 2QEXI 3PIOF 2F2EA 3SZGA 3BG9A 4EM0B 2ADUA 1BI3A 2FQ4A 5J8CA 1NTCA 1U6GA 3LSIA 5JVTA 3FM5A 3G1OA 2RDPA 4CH7A 1D5VA 2CG4A 4FCYA 4G6QA 4FE7A 4RLFA 5K7ZA 1SVLA 2YX7A 1OCPA 3ML6A 2PJRA 1DPUA 4DYRA 3KEOA 2X4HA 1J5YA 3PUFA 1K78A 2VQCA 4HSRA 2IA1A 3E6BA 1LVKA 3G73A 3CMEI 2W57A 5BQTA 1FBSA 4BQQA 5M3FJ 4HAMA 5HLGA 2DCEA 3C1DA 2DMNA 1FWZA 3ASOH 4U87A 4MEXF 1OCCH 1O57A 2MG4A 2R7VA 1IZ1A 4HYEA 2PJPA 1VZ0A 2Z2SB 4M9SA 4BJ6C 5IPAA 5HDNA 3ABKH 3MKLA 2Z1DA 4XOTA 1FIPA 1V4RA 1XGMA 2ETHA 4L18B 2ZCWA 3O3KA 3K4CA 5HNFA 2JZYA 5CQEA 4A5NA 2Q0OA 3RIRA 1QZZA 4LG3A 2GOMA 4KN4X 3F22A 3OS1A 1QA6A 4OIQF 2ZBKA 3JRDA 1AU7A 2BGCA 3K7AJ 1F4KA 3WTYC 2RREA 2X51A 4ZYAA 4XRSG 5FLXK 3R60A 2CQQA 1AA7A 2YX4A 2L4AA 1BBYA 5B66C 2X6XA 1FYMA 1F5TA 1HW2A 5HOOA 5C44J 1HQCA 2XRNA 3W2WA 3HTSB 2DDAA 2A69F 2IGMA 2X1CA 3PNTA 1YFHA 2HTJA 1DP3A 4BXXJ 3PQJA 2ME0A 3BQZA 4XKCA 3S2HJ 1O7FA 3I56I 3P9IA 3OYCA 1PJRA 2VKHA 2E2HJ 4EQQA 1IV8A 1G8XA 1MKMA 2V9KA 3VSLA 4IRIA 1NK3P 2EA4A 4M6YA 2XGCA 1QZEA 5JFRA 1VQNI 1Z91A 5BPDA 1HDPA 1WGXA 3DBRB 3Q9VA 3SZTA 3R6SA 3WU0A 3PUBA 3FK6A 4LD5A 2VQHA 3W6VA 3IH2A 3E6DA 2XSDC 3H36A 4IPAA 2LBFA 3K4LA 1B72A 2R7OA 3TW7A 3T8RA 4EEFG 3CMMA 2PI0A 4R1HA 3BY6A 1FMVA 1TQMA 2OA4A 4BHBA 1UZCA 5D8LB 1RPWA 4E7LA 5F04A 1IUFA 1IW7F 3BZKA 3RQIA 4Z6YA 2X9DA 1LFBA 2G7UA 5EEGA 2L7MP 3BTCA 1ZRDA 3S17J 1YS7A 2Y0MA 2VBWA 1I3AA 4KICA 2H6BA 2HDCA 4QTRA 4HV6A 5ILSA 3CC2I 1S9HA 1F36A 4IEJA 5BMZA 3KP3A 1X3UA 5D6EA 3OYFA 1IF1A 4I6ZA 3QAHA 1SMYF 2EV6A 2XC7A 1DQUA 2DO7A 3HXLA 2ZJRF 1X1PA 2NOGA 2ZXHA 3DF8A 2M0CA 4ZYGA 2E5ZA 4BQNA 4WXHA 2W24A 3MWMA 4UNOA 3HZJA 2KIMA 4Y7NJ 3OIPA 5EF6A 1F1ZA 2R5ZB 2VQGA 3ZMZA 2JUCA 2BZTA 3NWSA 1YITI 2NVYJ 4NQWB 2LOOA 2OJED 1J9IA 3H9GA 1X3ZB 1WJDA 3K4MA 4GRIA 2X6OA 1X2MA 3Q5FA 1JJ6C 4QWQA 1ZRCA 2CJJA 5E3OA 2XAHA 1TW2A 4AU7A 3ZQHA 4IO9F 4KN7X 1BW5A 2DK8A 3W2VA 1S7OA 2PFBA 2RV8A 4D7NA 2W82A 3M8EA 3MKZA 2DMUA 3OR1C 3ZMUA 5D5UB 4B4CA 4A3MJ 3S3OA 4M72A 1T0FA 4ZYHA 2QENA 1K79A 4XLHA 2WB1N 1K6OA 3C18A 1U5TA 5DDGA 4C2UA 4C30A 3WGGA 1IO2A 3ZMDA 2NVTJ 4MO7A 3T8TA 1IN5A 4EGYA 2VKVA 2V1UA 3CJQB 2D1HA 1RZ4A 1W7PD 3UNGC 3EYIA 5IT3A 3K4NA 1W7PA 5K5RA 4BE2A 4ZC3A 2NVUB 2LG4A 2OPTA 4G8XA 3TO9A 3TDZC 3GO5A 1R58A 2IRFG 4KMFA 4LGWA 4RAYA 4B44A 2D2WA 3KP2A 3M8JA 4AVZA 3S1QJ 4BY1J 5LEJA 5JR3A 1KU3A 5HODA 2CO5A 4IQ4A 2CQ7A 4XLFA 2VJIA 3LQQA 1YE9A 3BOQA 1T08B 2VPLA 2Y75A 3OYBA 4C3HJ 4BS9A 5FB2A 4RB3C 4IX7A 3V4GA 2DJIA 1BC7C 2ECCA 5B3SH 3A01B 1XN7A 1Z05A 1AKHB 4AM3A 3TDUC 1FOYA 3S8PA 3DTEA 2QVOA 1EA3A 5IYBJ 2W85A 3BTIA 4D5FA 2O5RA 2DT5A 2EV0A 3HHGA 4B47A 3BLYA 5F0FA 1IDYA 2QKMB 5LLQA 2EZKA 4KNYA 2PMZA 1IRZA 4HF0A 1ZYRF 1WPKA 3JRGA 5HDKA 3FXUA 3AAFA 3K1PA 1DU0A 1YX3A 2PQ8A 4BU2A 2R7QA 4M9ZA 4XLNF 3U21A 5A2QK 3ZGKA 1BR2A 1LE8A 3JRIA 2K3FA 1D1AA 2PBIA 2XAGA 3MN2A 3ZMTA 3FX3A 4BAYA 5FLMJ 4A3IJ 1V5FA 2IBDA 3OYNA 4HZFA 4Y17A 1RKWA 1ON2A 4ZJZA 4BUPA 5TISC 3GFMA 3HOSA 1ZH5A 5LRRA 2W7NA 3CDLA 1R71A 3OOUA 3VB2A 1EH6A 2K27A 1TQPA 3BQYA 3EUHC 4G7HF 2DFHA 2VI6A 1SFUA 4UY8I 1TT0A 2RNJA 2OF7A 5M5XJ 3KCCA 1FT9A 1L0OC 4B09A 3JRCA 1ZKGA 1IAWA 1RRJA 4HDVA 1MBFA 2F6CA 2Y9ZA 2XDVA 1YS6A 1CGPA 3KLNA 3JAMK 3ZQIA 3QPLA 4Y3OA 1MJBA 3DPUA 4RDUA 1JI8A 3FISA 5C3EJ 1YJNI 2WBMA 4UXNA 1W4MA 4PK4A 3RDIA 3S14J 3FKJA 3FZVA 1TT5B 1SMTA 3NRVA 4WCGA 2D45A 1IDZA 2V9VA 1TZLA 2KT0A 3OYAA 1QQIA 1ACIA 1BJZA 2FBIA 5L3FA 3FXOA 4I0BA 1S5LC 4IRHA 4BY7J 2XGDA 2WY8Q 3H0GJ 4BBSJ 2MD5A 2Z9OA 2XF5A 1WWXA 5ILVA 3KZYA 3N97A 2ACJA 2OU2A 2QSHX 3AL0B 2AQFA 3ERMA 4IOCF 1VQ6I 3SFZA 1U3EM 1R22A 2W84A 3CO6C 4HX8A 2V1DA 1P4XA 3FF5A 2E36A 2NS7A 4HLYA 2Z5UA 3HKZA 1MBHA 4KDPA 2NNYA 2BVMA 4BACA 4XLPF 4RS8A 1ULYA 1OCRH 2R93J 2R7FA 5B1AH 2EA2A 1ZREA 2VPRA 1ODDA 4ZZDA 1HW1A 1ORKA 4IHVA 2IPQX 5GP9A 2PMHA 1EF4A 1LUJB 3E0JB 4ASNA 4RAFA 1G3SA 4ZDOA 3VYUB 3QU6A 1KONA 1BW6A 2V9PA 4GO1A 3L00A 2JQ7A 3BR0A 2VQLA 2Z3YA 1OLTA 4A3DJ 5L3BA 3M3YJ 4ENKA 1USTA 1TW3A 5C4JJ 3SEZA 3KZIC 2KFDA 3ISPA 2A61A 3GTPJ 1EH8A 2YSRA 2XGXA 4HQMA 1HOMA 2OTLI 1SD7A 3H1CA 2CQXA 3OWTA 4FT8A 5DD8A 1ZELA 3I64A 2CSOA 1D8JA 3ZQCA 3E3VA 1S6LA 3BWGA 5DV5A 5ICEA 3IWFA 2NVQJ 4A3LJ 4XL9A 2M30A 1IXCA 2XHKA 2HOAA 1KQ8A 5HS8A 3G1LA 5DD4A 1D0YA 2JK3A 3OSFA 2MH9A 4BJ5C 3L9FA 1XMAA 1I3QJ 1O7LA 2ZC2A 2W25A 1D0ZA 1BJAA 2FUG2 3HDDA 2EQRA 2WAEA 4I98B 2VB6A 2QLZA 3NEUA 5CVIA 4UVCA 4NDLA 3I5UA 4RM3A 2CRGA 4JOMA 2MSYA 4LJZF 4CYDA 2WV1A 2M8EA 2XF7A 3D5SC 4LG0A 2KPMA 3ASNH 5ICCA 3IAS2 4E7IA 1PP8F 4CZZA 4XM3A 2DAOA 3K6GA 2OZ6A 2E1CA 5E20A 1QBJA 2EZHA 1O3RA 5IT9K 2LY1A 2E1MB 1U0JA 1Z3YA 1MSEC 2R7DA 3D5LA 4FE4A 3WG7H 3OYDA 3GUDA 2LBFB 2DA1A 2Y2ZA 4D0PA 2E1OA 2DMQA 5AIPA 2P6SA 3S15J 3W2AA 2CW0F 4XKVA 4MQ9F 2R5ZA 2DA2A 1KA8A 1X58A 2MBFA 4NQWA 4BQOA 2HPMA 1A35A 1XGNA 4C3JJ 1QHGA 2YU3A 4NUBA 3B6AA 1R49A 2NNNA 5HNHA 2AHQA 4F7ZA 1TWFJ 1K4SA 1MJAA 2RC4A 2Q8KA 1U8BA 3ZQGA 1EKEA 3L7WA 3K1NA 3GBGA 1FY7A 4BL0B 4D7MA 4DYCA 1MMGA 3EYYA 5FJ8J 3JRFA 5D5VB 2JSCA 2VE8A 2ELKA 4YRVA 1OKRA 4UUSA 2DU9A 1GV5A 4A3GJ 2V6CA 3F9KA 2ELJA 3WTVC 2H1KA 1R00A 3RSNA 1G6NA 4LITA 4HQEA 4Y52J 2ESHA 1JTYA 2JA6J 3GLXA 2QQBA 3KP4A 1Y1VJ 1XGOA 4PJJA 2LTPA 1RETA 3RYRA 5FLXZ 1TLHB 3VEPA 2DYRH 3BCAA 5EG0A 3M9AA 2WAQN 1VQLI 3EUHA 2F4IA 4H4KC 5K1YA 1S3JA 1MH4A 2XIGA 2MH2A 2YS9A 4G94A 3C3WA 3ZN0A 1U5TB 4KMUX 1OCOH 3V8KA 3DV8A 2XAJA 2RGVA 2L5QA 4A3KJ 4PJMA 4QSHA 2P7CB 1P7JA 4CCOA 2XB0X 2HQAA 2F5EA 3FHNA 2P81A 1E0EA 5HLTA 3IC7A 1UJ8A 2UUZA 1I39A 3MZYA 4E7HA 4DJAA 5TJJA 1W7PB 1WQ2A 1ZLKA 1H88C 1ETKA 3I71A 2ZMEC 2L0KA 5KAFC 3CF5F 2OD5A 3QPSA 4XLEA 2VASA 3RPQA 2WWYA 2A05A 2HKOA 5H20A 4YELA 3LA3A 4HW0A 4N9IA 2FX0A 1DPRA 3DP7A 1I27A 4HA8A 4IQJA 1ZG1A 2P5KA 4FX4A 3I54A 1GV2A 2LNBA 1VFCA 3ABTA 5E18F 3TO7A 2BHYA 3F0CA 3G71I 1NK2P 2XPUA 2X1DA 4I02A 2XRLA 3JREA 3H3VK 4RA2A 2HPIA 2LMDA 3WE2A 5GADJ 1B6AA 4E70A 2I5UA 3EPZA 1R7JA 2O3FA 2TDXA 3L2UA 3J81K 3MEXA 4HX4A 4XRFA 1FBUA 4YEJA 5FROA 1BL0A 4XN0A 4CA0A 4WF2A 5CJ9A 2E1NA 2R7XA 2ID3A 1IG7A 3GLLA 3I0TA 1LE8B 5JHFA 1YIJI 4I2OA 2JJ7A 3BZ6A 3KX2A 2QYOA 3KEYA 1P6RA 4U0WA 4CICA 3CESA 2XAUA 1V55H 1N78A 2F5CA 3GEZA 2VIXA 3H9JA 1HA8A 1UG2A 2KRFA 5EGOA 3A4CA 4C9YA 3JSPA 4EGZA 5F1JA 1VQ8I 1JUMA 2ZNYA 4CUGA 1XDSA 4FTHA 3J7AY 1FTTA 3WTZA 1WCMJ 4BE1A 2IVMA 1IUYA 3OV8A 4F52A 2VLAA 1IN6A 2E35A 3HIFA 4PUSA 4I01A 4QLCU 1T6SA 5JI6A 4HDUA 2VL8A 4RGSA 4XONA 2Y9YA 1S7AA 3MAJA 2OCEA 1B59A 3BZCA 1RESA 4KJZA 4HRIA 3K70D 4OAZA 4JQFA 1P7IA 1QNTA 1BR1A 2KDZA 3F8NA 1BN5A 2DBBA 3GX4X 3MD2A 4A93J 2LR8A 4B43A 1VQ5I 5JLXA 2E60A 1JT6A 3GFJA 1R23A 5H6RA 5D6FA 1T39A 3QU3A 2XVCA 3PNYA 5E3NA 5KNLA 3MFKA 3V7CA 3QYBA 3TOAA 3WU2C 1OMIA 2VBZA 3DEUA 1YHQI 4R79A 3I59A 3T1BA 3H0DA 5F0CA 2VC0A 3N4MA 3E5XA 2R7RA 2OQGA 3PNVA 3OYGA 3DKYA 5F1RA 3JSOA 3M4OJ 1ZGJA 3GTKJ 4WXCA 3LSKA 5B1BH 1JHFA 3QRFF 4PJLA 3SDBA 2KQRA 2WC2A 2DT7B 2JVHA 4AVPA 1JKRC 2ZJQF 2XUBA 2V1XA 4IRGA 1ETQA 2R0QC 3HOXJ 3CCJI 1ZR2A 4A5MA 1AHDP 1Y8QB 1YTYA 2DA3A 1SFKA 2NOJB 3FXKA 3ZPLA 3GVAA 2IP2A 2BBYA 1TWGJ 2NAZA 4P55A 2O8KA 4ZDLA 5LBQA 3A0HC 3VSKA 2HGCA 2ESNA 4XLCA 2PEXA 4F93B 4ZTJA 1WJBA 5GPAA 4XRMA 1IJWC 3CP8A 1X1DA 2K3PA 2QF7A 4UVAA 2XROA 1E3OC 3DWLE 2CFOA 2KIUA 3LA2A 3ECHA 2A6EF 5A2QZ 2HXIA 1WZ2A 2XPWA 3O8GA 3L2QA 4XLAA 3K9TA 1W5SA 3N05A 3AKZA 2XV4S 4BXFA 4DZJA 4YIRX 2B9SA 1JKPC 2H8WA 4V2FA 3B6CA 3LSMA 1X19A 2M34A 2X6WA 5LHHA 2HVSA 3MZ8A 2LK2A 1A31A 3JW4A 1TP4A 4G6TB 4C2MJ 3LSHA 3WODF 4UHTA 4EM1A 4IZZA 3OYKA 1ZGWA 3RKQA 3CCRI 4F3QA 2RVCA 2VT3A 3QQAA 3T5XA 5JHUA 2HDWA 4PSWA 1W0TA 2OAZA 4OMZA 2FD5A 2VN2A 1BC8C 2KHMA 2Y0SN 2LKSA 3HKZN 3CCSI 1IXSB 4II2A 3JAMZ 2F48A 1T2KA 2JA2A 3WTSC 2Y31A 2W4SA 2QSGX 3I9V2 2FNPA 5IP6A 1CF7A 4RB1A 2EIKH 1FMWA 2M0MA 4LG0B 1JGGA 1GXPA 1KQ0A 3KPHA 3VYRB 3KZZA 3BG7A 2IGKA 3HPGA 3PIPF 3FHZA 2WAFA 4KIGA 1AOYA 1WKMA 2OTJI 5HDGA 2E7WA 2FOKA 3KE2A 4Q48A 2QQ8A 4ZYEA 2GXAA 1G3TA 5E1WA 2LYCA 4EJUA 3GTLJ 5DM6F 3GYHX 2GWRA 2EZIA 5IP9J 1BR4A 2GA1A 5IOZA 1GHCA 4L5IA 4J00A 1FNNA 3S3NA 2V26A 3C2BA 2XPVA 1IC8A 1BOBA 2K86A 5IOYA 4NC6A 4V19K 1TQIA 4EM2A 4V2GA 1UG0A 5HS9A 3E5QA 3CZ6A 4BH9A 4M71A 2E7XA 3IV5A 3A2KA 2X85A 3FXJA 1A6QA 4CYCA 4MEYF 3F8BA 2E2JJ 4B3XA 1ETXA 4RAGA 3TMOA 2P5VA 2AQEA 2ZNZA 2XAFA 3VWBA 2Y48A 5GAGJ 4W97A 2F5FA 4GFBA 1YI2I 4M74A 2GIVA 4HNUA 3ABMH 3HGGA 1P92A 2PG4A 1MMAA 1ZTRA 2M1BA 3EETA 4UUSB 5KAIC 4QIWN 1G3YA 5L3GA 3LNQA 4PFOA 2M4KA 1XMKA 2ISYA 2L2OA 5EZHA 2DW4A 2J5PA 5EYRA 1JUPA 2DA7A 1Y1WJ 3TO6A 4F92B 4HV5A 1FSHA 2KRHA 4XOPA 3ZQFA 3DLAA 5EG0B 2DOEA 4HF1A 1TNSA 2VODA 4L5EA 5KVRA 1KYWA 3FBNB 3VODA 5D5WB 1FX7A 4P96A 1M1EB 1XTAA 5K7HA 4HBLA 2EH3A 3HHHA 1KQ9A 2YPRA 3BG3A 2FBHA 3BR1A 5FKKA 1Z9CA 1Z21A 2IA0A 3AG2H 3HOUJ 4M3EA 5J40A 1QRYA 4KISA 1TTYA 2H27A 2D5VA 2QSFX 9ANTA 4IL6C 3Q0UA 5LRSA 4AIDA 1WVRA 2H09A 4W1UA 3LSTA 3E1SA 4DYQA 3IL2A 3SJMA 5KCMA 2K5CA 5IT9Z 4EMSA 1FOXA 1FP2A 1Y0UA 1IGNA 3DKWA 1QU3A 3L2CA 3TGNA 4XSXF 3KYLA 2STWA 1R1VA 1MGTA 4HEA2 3RTRA 2N8GA 2MABA 4B1RA 4Z2YA 1B8IA 2CH0A 3HSRA 1IRFA 4GCVA 1HXDA 2P8TA 4ZH4F 1VQ4I 2CUEA 3H3ZA 4KT6A 1ZARA 1SD4A 1FLIA 4ESBA 2HFHA 3Q0WA 1U9NA 2R7UA 2MLKA 4HNVA 2QQAA 2VONA 3GTQJ 1R5ID 6PAXA 4BYYA 1IRGA 4JBAA 4ZTFA 3JRBA 3LWFA 3F23A 1YW8A 4JX6A 2QQ9A 4YIFA 3KETA 3KLOA 3U1DA 3H35A 3V8LA 3PL8A 3LSPA 5CYVA 1D5YA 3CD6I 3RKWA 4MIMA 1W0UA 4BQAA 4E6KG 1SAUA 2UZKA 4Q5SF 1U2WA 3KP5A 2FQ3A 3BPVA 1ZK8A 1MNEA 2ZFUA 1YX5A 1KGSA 4CZCA 3W6KB 4ENNA 3L1PA 2HYJA 3K4JA 2X0LA 2LVSA 5L3CA 4M3GA 3R61A 3HOWJ 2V4JC 1MDMA 4XIDA 2XB5A 3EUAA 4D9JA 1MNMC 2IS1A 3AG4H 1X1CA 2MGQA 4S0HB 1LVAA 2LF8A 1YJWI 2L02A 4DQ2A 1T38A 1LKXA 5DUIA 5EGOB 3DLLF 3IH3A 2DA4A 3LFUA 1LQ1A 2VXDA 2ZJ2A 3GF2A 4PCQA 2IW5A 3JRHA 2V6EA 1TWAJ 3DEEA 3H5AA 5CVUA 1T98A 3ZN1A 2DMPA 1WRJA 4ZYDA 5J8FA 2GZWA 1P4WA 3HUGA 4GDFA 1V54H 4E7JA 1I1GA 3C2HA 2L01A 2VBYA 5FGMA 1BI2A 3NQOA 1UAAA 1UHSA 4OIRF 1MIJA 1Y39A 2BV6A 3BR5A 1B4AA 2ICWG 4EJVA 2IGNA 1R1TA 1UMQA 2EJRA 3CTAA 3W3CA 2NS0A 2HOSA 2XSJC 5DCFA 4JK1X 3I55I 2KRCA 3HPHA 4IF4A 3VFZA 4IHWA 3DKXA 1V5EA 2GBYA 3CCUI 3I59B 4OOIA 1PYVA 1YJ9I 1Z0XA 2H6CA 3BDDA 2GAUA 2HVQA 4Q4ZF 3S1MJ 3VDXA 4OWRB 2CV0A 3A03A 1MBEA 3WE3A 2NYXA 1XMXA 1OYWA 1MBJA 2IGOA 1F43A 1O3QA 2G7HA 4PGHA 5J3LA 3MZHA 2EINH 3FXLA 4FQGA 5FFZA 1NH3A 5CQGA 2O03A 1T33A 2EFPA 4CXFA 1XCVA 3WHCA 4WX9A 1EV7A 1SEUA 4D5CA 1MSFC 4L9JA 1B9MA 4PJNA 3S1NJ 3V8JA 2O6GE 2ZFWA 1YW7A 2ZXJA 1ZLJA 4A6DA 5TRDA 3J81Z 2P5LC 1RUOA 4IHTA 3GWZA 4XSZF 4EVIA 4EJOA 2LKPA 4AYBA 3OYHA 3DBHB 4DW6A 2GQQA 3K1MA 3QWLA 4BBRJ 4A0ZA 4NC7A 3J7AO 3C2GA 3FIWA 4GXOA 4F55A 3NARA 4HNTA 5IY5H 3WTUC 4AC0A 2BYVE 1VNDA 3K4KA 3X2QH 2M3AA 2EV5A 3FBIB 4PGGA 1JTXA 1TWHJ 2F4OB 3W6JB 2W1OA 2AXTC 2EFOA 3SXYA 1VQ7I 4QPOA 4IXAA 2M4GA 4U0YA 3RI4A 4A6EA 4M3DA 1Y0NA 1LNWA 4XK4A 3L09A 2WADA
chains in the Genus database with same CATH topology
3CMMA 5FROA 3QYEA 3DQVC 3H5RA 2WY7Q 4XN0A 1FMVA 2OUMA 1X1BA 2M7AA 4CA0A 2R7XA 3M1CA 2R4GA 5JHFA 3EUKL 3KX2A 2MYSA 3KEYA 4E7LA 3K4BA 4RMNA 4J01A 3CESA 2XAUA 1N78A 2LC2A 4RLQA 1Z7LA 2BVLA 2VIXA 3H9JA 1HA8A 3MMYB 2IS2A 4DBQA 3ZR8X 4HG2A 3A4CA 4C9YA 1S9HA 4E7ZA 3PSIA 4X0GA 4CUGA 1N75A 3OYFA 4BDYA 1WJCA 3J7AY 2R7TA 3CP2A 2XC7A 1DQUA 3HOTA 3VYSB 4BE1A 4CCKA 3HXLA 1LDKB 2L9SA 4F52A 2VLAA 4PUSA 2ZXHA 2KZVA 2LH9A 2QKLB 2E5ZA 4BQNA 3DTIA 2VL8A 2R7WA 3OIPA 4XONA 2CMPA 4KJZA 4HRIA 2VQGA 3NWSA 3K70D 4NQWB 2LOOA 4OAZA 4JQFA 3H9GA 1BR1A 1WJDA 3D5RC 3K4MA 4GRIA 3OYEA 3ONQA 3V42A 3L2VA 3MD2A 4NC8A 4B43A 2E60A 4NNJA 4AU7A 4CCJA 4Y4RA 3S32A 3PNYA 3DTKA 3W2VA 2L7KA 1X1AA 5KNLA 1LFPA 3QYBA 2CUJA 2IS6A 2W82A 4R79A 3MKZA 3OR1C 3H0DA 3OYIA 3S3OA 2R7RA 3PNVA 3OYMA 3DKYA 3QODA 4XLHA 5CKTA 3OYGA 1GLNA 1G59A 4C2UA 3LSKA 1X4OA 4C30A 1OR7C 3MKYB 4HSTA 4PJLA 2PJRB 3SDBA 2KQRA 2DXIA 3CF2A 2DT7B 2JVHA 2Y0SA 4BEHA 4N4OB 2CV2A 3CJQB 3OR2C 3UNGC 1Y56A 4ITVA 4U7BA 3K4NA 4XN3A 4BE2A 2CS3A 1SFKA 2NOJB 4ZC3A 2LG4A 2OC6A 3PSFA 2X6YA 4ZDLA 1R6RA 1K6YA 3HG9A 4B44A 3VSKA 3M8JA 2V1NA 4AVZA 4XLCA 4F93B 4ZTJA 1WJBA 3BC8A 3CP8A 2IXSA 4IQ4A 1X1DA 4XLFA 2HU9A 2K3PA 2VJIA 4OAYA 1YE9A 4B48A 2VPLA 2CUZA 3DWLE 3OYBA 2CFOA 2VKDA 4LIVA 4BS9A 3IUOA 4IX7A 2DJIA 3L2QA 4XLAA 3K10A 3N05A 1ERDA 3AKZA 2I8DA 4BXFA 2UWMA 3S8PA 2CW7A 3DTEA 4E7SA 1EA3A 3LSMA 1D1CA 2KL4A 2O5RA 2LY2A 5KHDA 1X19A 4B47A 3BLYA 2X6WA 1UELB 2HVSA 3AL0C 4XR6A 1MW7A 2QKMB 3G2BA 4D1QA 2PMZA 5LFAA 4G6TB 3LSHA 4IZZA 3OYKA 3K70C 2W00A 3S93A 1YX3A 4F3QA 2L9NA 4BU2A 2R7QA 2HDWA 4PSWA 3U21A 2F5VA 3IAM2 3ZGKA 1BR2A 1D1AA 2KHMA 2VJ4A 2CV1A 1V5FA 4II2A 2GOXB 2WB1A 3OYNA 3VYTB 2JA2A 4ZJZA 2W4SA 4BUPA 3CJRB 3I9V2 3HOSA 4XQFA 1FMWA 2M0MA 2DOAA 3BG6A 3OOUA 2W7NA 4XKBA 2HVRA 1N77A 3VYRB 3S3MA 3EUHC 2P0WA 3BG7A 2IGKA 3HPGA 3OIQA 4CCLA 2WAFA 4QPQA 1TT0A 3OL4A 3HC7A 5FRNA 1MNDA 3HL2A 5CPRB 2MD0A 3H5NA 2M7BA 3OMYA 2LYCA 4XNFA 3DPTA 2F6CA 2BW3B 2XDVA 4P1WA 3DU5A 2A5WA 2OV7A 4Y3OA 1BR4A 2KMUA 4XORA 3DPUA 4J00A 3PJRA 3S3NA 1T95A 1JI8A 2V26A 2JSPA 2WBMA 2XF6A 4LIUA 1BOBA 4Y33A 4PK4A 3FKJA 1UG0A 2LREA 2KP6A 3CZ6A 4XKWA 2VJJA 3A2KA 5LD2C 2X85A 1TZLA 4PFPA 3L2WA 3OYAA 2K9LA 3LSGA 3RPUD 4CCNA 4B3XA 1WJEA 2WY8Q 4EATA 2XF5A 4XMYA 3TMOA 2AQEA 4P5OA 3VWBA 1DGWY 1W36D 2DT6A 3AL0B 2AQFA 3HUGB 4F91B 4HNUA 2VJ5A 1MMAA 3OYJA 4CSWA 4BDZA 2E1MC 3HKZA 3NWTA 4PFOA 2M4KA 2ZSHB 2BVMA 4BACA 2K9MA 2MFZA 2L2OA 2KDOA 5HVQC 4DIQA 4DBRA 1WJ5A 3AFHA 2Z16A 4F92B 3E0JB 2KRHA 2HZDA 2IS4A 2A6TA 1DGRM 4XOPA 4DOZA 3DLAA 4ZDOA 3VYUB 3OL3A 1KONA 2CW8A 1QHHD 2VQLA 1Z3XA 3FBNB 3ZXSA 3LL7A 1OLTA 3OS0A 4HPQA 2ZXIA 2ZSIB 3SEZA 3QYFA 1Z21A 1WFXA 4KISA 3MKWB 3OWTA 1NG7A 1ZELA 2V7FA 4XL9A 3E1SA 4KITB 4BJTA 2HNHA 5KCMA 2K5CA 1D0YA 3ZRGA 4BJ5C 1QU3A 2MC4A 3PFYA 4PSXA 2KLOA 3KYLA 1D0ZA 2FUG2 4MLOA 4DGWB 2WAEA 4HEA2 3RTRA 2VB6A 3ZCOA 2MABA 4RM3A 4E4HA 2CH0A 4FETA 4JOMA 2XF7A 4KT6A 3D5SC 2KPMA 2LRDA 3IAS2 4E7IA 5FRMA 3A1YA 2R7UA 4CCMA 3H9QA 4XM3A 3K6GA 1WJFA 3FDYA 4ZTFA 1X4PA 1T0FC 3DPLC 3QOEA 2JVGA 1WJAA 1V5GA 2LY1A 2E1MB 1U0JA 1Z3YA 3H35A 3PL8A 4ZDPA 2X1EA 3SYTA 2BW3A 3D5LA 3OYDA 2Q1ZB 2WAQA 2LBFB 1P9QC 4E6KG 1SAUA 1IRXA 2Q2EB 1MNEA 2ZFUA 3W2AA 1YX5A 4XKVA 4CZCA 2HPMA 3K4JA 4BQOA 2E5NA 1NG6A 2R7SA 1QHGA 2V4JC 4NUBA 2JUGA 4RM2A 3EUAA 4D9JA 2IS1A 5HNHA 4IKFA 1X1CA 4E7KA 4BGDA 3RQ4A 1J09A 5TGTA 1LKXA 3SZGA 3LFUA 2VXDA 4C2TA 2V6EA 3DEEA 3GBGA 3H5AA 4BL0B 3OYLA 1MMNA 1MMGA 3LSIA 3BCBA 3RCOA 4CH7A 4E7JA 4N4NB 4BE0A 4RLFA 3C2HA 4YRVA 3IP4B 1UAAA 2PJRA 3F9KA 2ELJA 2VQCA 4HSRA 1MMDA 2IGNA 3RSNA 4LITA 1LVKA 3TBIA 3W3CA 3ZQQA 3OY9A 4BQQA 2XSJC 4PJJA 3OS2A 2DCEA 4U87A 3BCAA 2KRCA 3HPHA 2R7VA 3L2RA 1VZ0A 2Z2SB 4BJ6C 2F4IA 2Z1DA 3DKXA 1V5EA 4H4KC 4XOTA 2RNGA 1PYVA 3TL4X 3DU6A 3K4CA 2HVQA 5HNFA 5CQEA 3VDXA 4OWRB 2CV0A 3LMMA 4LG3A 1D0XA 2GOMA 2L5QA 3UR3C 4PJMA 1D1BA 3OS1A 4CCOA 2IGOA 2HQAA 4BEHB 3FHNA 4II3A 1E0EA 5HLTA 5CQGA 2RQQA 2UUZA 4E7HA 2RREA 2X51A 4ZYAA 4DJAA 1AA7A 2UV1A 4PJNA 2X6XA 4XLEA 3SEQA 3I3LA 2VASA 5HOOA 2VXZA 3W2WA 4YELA 2IGMA 2X1CA 3PNTA 1DP3A 4ANJA 4XKCA 2WA0A 4FASD 4AYBA 3OYHA 3OYCA 1PJRA 4IQJA 2VKHA 4NC7A 1G8XA 3C2GA 2V9KA 3VSLA 4F55A 4HNTA 2X1DA 3K4KA 2M3AA 2HPIA 1Y6IA 3FBIB 2W1OA 3EPZA 3PUBA 4QPOA 2VQHA 3L2UA 2BOLA 2M4GA 1W36C 2LBFA 3K4LA 4YEJA 2R7OA 2WADA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JI8 A;  2V4J C;  2A5W A;  2XSJ C;  1YX3 A;  3OR1 C;  3OR2 C;  1SAU A; 
#chains in the Genus database with same CATH topology
 3QYE A;  3H5R A;  2ECB A;  2Q2E A;  1ETY A;  3A02 A;  2OUM A;  1X1B A;  2M7A A;  3HRM A;  3M1C A;  1MMS A;  2DK5 A;  2HOE A;  2HWV A;  4MQV A;  2R4G A;  4XRS A;  5ICF A;  1ZG5 A;  3KIO A;  1K83 J;  4MFD A;  3BTL A;  1WSU A;  2GIZ A;  3K4B A;  4RMN A;  3PFI A;  1O3S A;  2LC2 A;  3QOP A;  2BVL A;  3ABU A;  3MMY B;  5GTH C;  2E2I J;  3EDP A;  2LDU A;  3CQZ J;  1CF7 B;  4I09 A;  1OYI A;  2KIF A;  2OQR A;  4PJ0 C;  1IN7 A;  2H8R A;  3BR6 A;  2ID6 A;  4X0G A;  2MLG A;  3CO7 C;  2B7E A;  1MBK A;  1WJC A;  2R7T A;  3CDI A;  5F08 A;  1J59 A;  2M5W A;  2V79 A;  1LDK B;  2L9S A;  2HDD A;  1GVD A;  3TQN A;  1H9T A;  1KYZ A;  4M6X A;  2KZV A;  2LH9 A;  2ZME B;  3DTI A;  2HYG D;  2R7W A;  1LDD A;  2W48 A;  3I58 A;  1BIA A;  1I6X A;  1VQO I;  3OYE A;  3ONQ A;  1JT0 A;  2O9L A;  3BT9 A;  3V42 A;  3L2V A;  5M3M J;  2M9H A;  5K5Q A;  3ZQ7 A;  3G4S I;  2DPU A;  2P6T A;  4I0A A;  2HQR A;  4RBO A;  3LAP A;  4KA4 A;  5E8I A;  4YFK F;  4L0Z B;  4CCJ A;  3PO3 J;  3WTT C;  4Y4R A;  1G2H A;  3S32 A;  2HYF A;  3P7N A;  3CC7 I;  1X1A A;  1LFP A;  2CUJ A;  4CYC B;  2EB7 A;  1YRN A;  1YYV A;  5GTI C;  3M8F A;  1SD5 A;  3KP7 A;  3OYI A;  4IHX A;  2VOP A;  1GT0 C;  4AIH A;  3OYM A;  3QOD A;  3CDH A;  5CKT A;  1GLN A;  1G59 A;  2QZ8 A;  1G3W A;  3IRQ A;  3MKY B;  3CUQ C;  2RKH A;  4G9Y A;  4BEH A;  4N4O B;  4BHC A;  2I10 A;  3MQ0 A;  3OR2 C;  3O2P E;  2J5O A;  4CHU A;  1Y56 A;  1VQK I;  3ZP5 A;  4ENJ A;  3FM3 A;  1UHM A;  3G1M A;  4XN3 A;  5K7F A;  1XSX A;  4A69 C;  3CUO A;  3NAU A;  5ERI A;  3V7R A;  3GTM J;  2X6Y A;  2XKP A;  4G12 A;  3JTG A;  2ISZ A;  1K6Y A;  3H92 A;  2K9S A;  1S8N A;  3CJN A;  3BC8 A;  4YFX F;  2IXS A;  3EQL F;  2DN0 A;  2HU9 A;  4OAY A;  1R36 A;  4L9N A;  4Q47 A;  2F4M B;  3M07 A;  2CUZ A;  2XKO A;  2EIM H;  2HZT A;  4LIV A;  2VT2 A;  3IUO A;  3DCF A;  3GXO A;  3ZMS A;  4G7Z F;  3GCM A;  4UUT A;  2VE9 A;  3K10 A;  4U88 A;  2R5Y A;  1GDT A;  2GXB A;  1A6I A;  3MVP A;  2I8D A;  3GW2 A;  1PVE A;  2AXL A;  3RZD J;  4R8H A;  1MJ9 A;  1YLF A;  1D1C A;  2KL4 A;  1JKQ C;  5KHD A;  2B63 J;  1IN8 A;  1UEL B;  4MTE A;  4XR6 A;  4Y15 A;  1MW7 A;  2HKX A;  3G2B A;  5LEK A;  3KP6 A;  2IEK A;  5LFA A;  1Q1V A;  5BS6 A;  1R9T J;  3R0J A;  1OJL A;  3S93 A;  1XG1 A;  1HBX G;  2VOO A;  2VBX A;  3Q0V A;  2F5V A;  1DP7 P;  5IYD J;  2CV1 A;  1YW9 A;  2LD5 A;  1B8I B;  3VYT B;  5BOX A;  2LY9 A;  3CJR B;  4BXU A;  4OIP F;  2FXA A;  2Y30 A;  5JLW A;  1Z67 A;  1PDN C;  2DOA A;  3HRS A;  2A68 F;  4XKB A;  2M8G X;  3JCU C;  1VQP I;  1N77 A;  4U7D A;  2HVR A;  4NBQ A;  4YG2 F;  3HM5 A;  2EFQ A;  3GTG J;  2P0W A;  1OFC X;  3OIQ A;  4CCL A;  1DUX C;  5E79 C;  4QPQ A;  1Z6T A;  1X2N A;  2COB A;  5CVV A;  5FRN A;  1MND A;  2WV0 A;  4AIK A;  2DA6 A;  4RB0 A;  5CPR B;  2L7Z A;  1SC7 A;  1RR8 C;  1HLV A;  5HLH A;  1J0R A;  2MD0 A;  3H5N A;  4UV8 A;  1WI9 A;  1OQY A;  3BJO A;  3OMY A;  1APL C;  3F3X A;  1SFX A;  3DPT A;  3SQN A;  3CMA I;  3I4N J;  4ESJ A;  3P9K A;  4I7H A;  3WGH A;  3CCQ I;  3S1R J;  3C7J A;  2KMU A;  4XOR A;  2TRT A;  2PX9 A;  1T95 A;  4ABZ A;  4A3F J;  2IT0 A;  2QCO A;  3F8F A;  3BG5 A;  5FFX A;  4ETS A;  4LIU A;  1XD7 A;  4Y33 A;  2GXG A;  1UCR A;  1MDM B;  1LEA A;  3RKY A;  2FML A;  3DEW A;  3WTX C;  4P9U A;  3FKI J;  5H2F C;  1ETW A;  1N25 A;  1RIO H;  2VJJ A;  1BOA A;  1USS A;  1Y8R B;  2PMZ N;  4JX4 A;  4O5V A;  5IP7 J;  5LD2 C;  4L0Y B;  2VUM J;  3L2W A;  2KIQ A;  1E17 A;  5EEH A;  4MFE A;  1TBX A;  2YUS A;  3HYI A;  4EAT A;  4RB2 C;  3COA C;  4LLN A;  3CCY A;  1R5H A;  4P5O A;  2ZXW H;  1H89 C;  2O0Y A;  1DGW Y;  1ZHF A;  4CO8 A;  3HUG B;  1LPQ A;  1VF9 A;  2K9N A;  1DDN A;  4X1E A;  4L9T A;  2EBI A;  5DM7 F;  3U1K A;  1E2X A;  4BDZ A;  2DPD A;  4BHP A;  3SFI A;  3F8M A;  2H94 A;  3RZO J;  2ZSH B;  4H0E A;  2K9M A;  3HTU A;  2R7Z J;  2CUF A;  3TP0 A;  2KDO A;  5HVQ C;  5D5X B;  4DIQ A;  1WJ5 A;  4IOA F;  3TOB A;  1ZRF A;  2FF4 A;  3SDG A;  2HZD A;  2GM4 A;  2IS4 A;  4DOZ A;  2DQL A;  2DFF A;  4B3A A;  4ZZL A;  1XSV A;  3OL3 A;  3SHF A;  2CW8 A;  3ROU A;  1E3P A;  3JRA A;  1Z3X A;  2JT1 A;  3ZXS A;  3J7Y J;  1R4N B;  3OS0 A;  3IRR A;  2M45 A;  3LOC A;  1SVM A;  2FEZ A;  1AWC A;  2ZXI A;  4KUM A;  2ZSI B;  4M6V A;  2L3D A;  1FEX A;  3QPH A;  4NHJ A;  3TW6 A;  1ZQ3 P;  5J4V A;  1WFX A;  3LAJ A;  4HOB A;  3LFK A;  4IVN A;  1JXS A;  4YII A;  1A36 A;  3MKW B;  1SAX A;  1NG7 A;  5FKM A;  5E3M A;  4UUV A;  3B73 A;  5CVR A;  3R4K A;  5K5O A;  2EFN A;  1HW5 A;  1RR7 A;  1SFO J;  1E3H A;  4KIT B;  1YIO A;  4BJT A;  3U9G A;  2HNH A;  1POG A;  2FOW A;  4YFN F;  2BHZ A;  3CCE I;  1XPX A;  1Q1H A;  3DFG A;  2Y69 H;  2MC4 A;  3PFY A;  4HLX A;  4XBF A;  1EJ9 A;  2LKX A;  4OU0 A;  2GLO A;  4DGW B;  1OCT C;  2K4J A;  4RGX A;  1H9G A;  3ZCO A;  3CCV I;  2QM3 A;  5J4Y A;  1HKT A;  4UB8 C;  5IYC J;  4MNU A;  2FRH A;  1HDD C;  5GPC A;  1ZGA A;  5GAH J;  3VOE A;  4FIS A;  5E3L A;  3CUQ A;  3OOP A;  1ITY A;  5ED4 A;  3H9Q A;  1BA5 A;  4JX5 A;  1Z6R A;  3HRT A;  3DBL B;  5C4X J;  3FDY A;  1X4P A;  4LK1 F;  1V5G A;  1T8I A;  1U78 A;  1TC3 C;  3E7L A;  2HEO A;  2R3S A;  2X1E A;  3SYT A;  2BW3 A;  2KJC A;  4EJT A;  4AWX B;  2WAQ A;  4A0Y A;  3K2Z A;  3D0S A;  3WTW C;  1IRX A;  2ZME A;  2Q2E B;  4CDG A;  3ESW B;  3M1E A;  3J80 K;  3LSR A;  2HI3 A;  3KFW X;  3ERE D;  2ZO4 A;  2FSW A;  1NG6 A;  2BXZ A;  2R7S A;  1TNT A;  1D8K A;  2HQ5 A;  3ZOB A;  4IKF A;  4E7K A;  3BPX A;  4BGD A;  3I4M J;  3RQ4 A;  3FK7 A;  5TGT A;  4CGZ A;  3HOV J;  2DMT A;  5FKL A;  4ENM A;  1PUE E;  2YU9 J;  4C2T A;  1A04 A;  1RI7 A;  2EPF A;  3G6E I;  1UFM A;  3O8H A;  4AYB N;  2LLK A;  5EJC A;  2B0L A;  1MMN A;  3OYL A;  3BCB A;  4UV9 A;  1HST A;  1YG2 A;  2HS5 A;  3RCO A;  1REP C;  1JE8 A;  4N4N B;  1W1W E;  4BE0 A;  1QVU A;  4P9F A;  3IP4 B;  3RJP A;  1HF0 A;  1ZR4 A;  4O3M A;  1YO5 C;  1GUU A;  3I4P A;  3LQR A;  4G6D A;  1SFE A;  3WG9 A;  2HR3 A;  1MMD A;  2DLL A;  3PM1 A;  3TBI A;  1Z7U A;  3ZQQ A;  2D1V A;  5J1R A;  3J7Z I;  2LFB A;  1KU7 A;  5D4S A;  3OY9 A;  1KU9 A;  3FMQ A;  1PUF A;  3OS2 A;  1F9N A;  4I99 C;  2EFW A;  3S16 J;  1U8R A;  3KYC B;  4GYG A;  3L2R A;  2BY0 A;  4LOC A;  5CLS A;  4Y13 A;  2G9W A;  1YRN B;  2P4W A;  5FO5 A;  1L3L A;  2G0E A;  1FOK A;  4OMY A;  2RNG A;  3K0L A;  3TL4 X;  3DU6 A;  3E5U A;  2ME6 A;  1K4T A;  5LGT A;  2XAQ A;  2RQP A;  5CVJ A;  2FMY A;  3LMM A;  1D0X A;  1MZB A;  4ON0 A;  3UR3 C;  5FKO A;  1D1B A;  3CLO A;  5LGU A;  2BY3 A;  2E34 A;  4BEH B;  4II3 A;  1STZ A;  4FHT A;  4BNC A;  2FNA A;  2RQQ A;  1HKS A;  4AD9 A;  2KKO A;  3QPT A;  2E19 A;  1PP7 U;  1VQM I;  2UV1 A;  5DCM A;  4RGU A;  4IHS A;  3SEQ A;  4GGG A;  3H3U A;  3I3L A;  3S2D J;  2VXZ A;  4KIB A;  3K2A A;  4RGR A;  2BEO A;  2IJL A;  1CQT A;  2K40 A;  2STT A;  4MHG A;  4ANJ A;  1WI3 A;  5EDN A;  2WA0 A;  4FAS D;  1MD0 A;  2BE5 F;  5AIQ A;  1FYK A;  4UB6 C;  3UKG A;  2QBY A;  3WGI A;  1ZAO A;  2JA8 J;  3GME A;  4BKX A;  3P5J A;  2DDB A;  5ILU A;  3DXJ F;  5HS7 A;  2R5Y B;  1TL8 A;  4K2E A;  1Y6I A;  2IA2 A;  3TP3 A;  2F5D A;  5DUK A;  4M9X A;  2BOL A;  3G3Z A;  1W36 C;  3IKT A;  3IH4 A;  2EZL A;  1XCB A;  2A3S A;  3FMR A;  3BTJ A;  4IHY A;  3DQV C;  1XDU A;  2WY7 Q;  4OIO F;  1I50 J;  1ETO A;  1RC9 A;  5FD6 A;  2R92 J;  5BPI A;  2JA7 J;  1XGS A;  2BY2 A;  5HLI A;  5KK1 A;  3EUK L;  1XSD A;  2MYS A;  3QP6 A;  4DNC A;  4J01 A;  2LF7 A;  1BI0 A;  5JVG F;  1T56 A;  4WK8 F;  2M87 A;  4RLQ A;  3S2W A;  1Z7L A;  4KT5 C;  4A2U A;  2IS2 A;  5M5Y J;  1GXQ A;  4DBQ A;  3ZR8 X;  2K02 A;  4HG2 A;  2FBK A;  3IHU A;  3QP5 A;  3HJE A;  4S04 A;  4E7Z A;  2PN6 A;  4X6A J;  1IXR C;  3RKX A;  3PSI A;  1IN4 A;  1MBG A;  4C3I J;  5J6X A;  1FJL A;  1I1S A;  1N75 A;  3CLQ A;  4BDY A;  4IJA A;  3JTH A;  3CP2 A;  3SZP A;  3HOT A;  3VYS B;  4KFC A;  2K4B A;  4CCK A;  4B8X A;  2QGU A;  4KIF A;  2XAS A;  2JTV A;  2QKL B;  4GYI A;  1FP1 D;  1I5Z A;  2DQR A;  2CMP A;  1FYL A;  1XS9 A;  2EIJ H;  3D5R C;  1LJ9 A;  3CCL I;  3GTO J;  1VTN C;  4NC8 A;  5FKN A;  4WWC A;  1FBQ A;  2DI3 A;  5EZG A;  3WHB A;  1RUN A;  2KJB A;  4NNJ A;  1SAN A;  1TWC J;  2BXY A;  2H1L A;  2L9V A;  3U2R A;  1LFU P;  3DTK A;  2IAI A;  2L7K A;  2EIL H;  3GFI A;  1UB9 A;  4DZP A;  4S05 A;  2WTE A;  2IS6 A;  3Q3S A;  3B02 A;  4JP0 A;  1D3Y A;  2OZU A;  1Z1D A;  3BR2 A;  4KYW A;  2UXX A;  2CWE A;  2K7L A;  1W5T A;  5LHG A;  1X4O A;  2JRM A;  1FOW A;  3R0A A;  1OR7 C;  4UVB A;  4HST A;  1ETV A;  1ON1 A;  2PJR B;  2DXI A;  3CF2 A;  1EH7 A;  2Y0S A;  1Z77 A;  4MGR A;  2CV2 A;  5F27 A;  1K78 B;  3BR3 A;  3F72 A;  5M5W J;  3RYP A;  1QZY A;  1K61 A;  4ITV A;  4LK0 F;  4U7B A;  1MH3 A;  2CS3 A;  3GZ6 A;  4XIC A;  1B1B A;  2OC6 A;  3PSF A;  3CMY A;  3FXQ A;  5E1X A;  1VQ9 I;  1QPI A;  2PMU A;  4HX7 A;  3FXR A;  1R6R A;  3O6B B;  5J1Y A;  3HG9 A;  2V1N A;  1LB2 A;  2CU7 A;  5J1U A;  3F6O A;  1P4A A;  4O6J A;  2NRA C;  3F21 A;  5F6F A;  4B48 A;  2QUF A;  2E71 A;  4PZJ A;  2JPC A;  2DOD A;  2YR2 A;  2VKD A;  2O61 A;  1R1U A;  4LB6 B;  5E1Z B;  4LB5 A;  4HF2 A;  4A12 A;  1WHU A;  4WXD A;  2C6Y A;  5EEA A;  1ERD A;  3HGY A;  3PQK A;  1S7E A;  2UWM A;  2CW7 A;  4I76 A;  4E7S A;  2LY2 A;  4L9V A;  1WH5 A;  3AL0 C;  1FPQ A;  2HOT A;  2QWW A;  1JHH A;  3IWZ A;  5DTD A;  4D1Q A;  4A3B J;  1JKO C;  4PDK A;  3HBL A;  1R5G A;  3HEF A;  3K70 C;  2W00 A;  2FU4 A;  5F64 A;  2QA4 I;  3ZQL A;  2L9N A;  2NVX J;  1ONV A;  3F8C A;  2L54 A;  3IAM 2;  3AG1 H;  1O4X A;  1QO0 D;  1FC3 A;  1G4D A;  2FE3 A;  5BNG A;  2VJ4 A;  1BM9 A;  2GOX B;  2CFX A;  2WB1 A;  1R4M B;  3FWE A;  1O3T A;  3JR9 A;  1QPM A;  2EK5 A;  4JYK A;  4XQF A;  4MTD A;  2CGP A;  1GVJ A;  3BG6 A;  3GFL A;  1H0M A;  3FMS A;  1NHA A;  5B5E C;  3ABL H;  3OSG A;  3AG3 H;  3CUQ B;  2BY1 A;  3S3M A;  2KZG A;  3OL4 A;  1OYY A;  3ECO A;  3HC7 A;  4A3J J;  3HL2 A;  2UXN A;  3M7G A;  5L3D A;  1B72 B;  2M7B A;  1I6H J;  3FXM A;  4XNF A;  2K85 A;  2JN6 A;  2BW3 B;  2LSO A;  4P1W A;  1FIA A;  4LLG F;  3CJT B;  3DU5 A;  4L5J A;  4A0X A;  3BRO A;  2A5W A;  2OV7 A;  1YOV B;  2L9R A;  4N0B A;  1RNL A;  3PJR A;  2EWN A;  3IKV A;  2JSP A;  2XF6 A;  4A3E J;  2FA5 A;  2XGE A;  1SVO A;  3P9C A;  3GZ5 A;  3HRU A;  4AIJ A;  2KIS A;  2LRE A;  1DU6 A;  2KP6 A;  3A0B C;  4XKW A;  3HOY J;  2DFI A;  3VPR A;  1KZH A;  3E6M A;  1OCZ H;  4PFP A;  4A3C J;  3I53 A;  1J7K A;  2K9L A;  3LSG A;  3RPU D;  5F0H A;  1HKQ A;  4CCN A;  2DFE A;  5E17 F;  1WJE A;  2DTZ A;  2ZB9 A;  5H6Q A;  2OBP A;  3RPU A;  4XMY A;  3CCM I;  1K7A A;  2ZJP F;  1C0W A;  2LP0 A;  2CQK A;  2K9Q A;  1W36 D;  2DT6 A;  2DOF A;  3OIO A;  2A6H F;  2MW8 A;  5DYM A;  4F91 B;  2JWT A;  1JJ8 C;  1H8A C;  1ENH A;  3T0Y A;  2VJ5 A;  5LGN A;  1FSE A;  2CYY A;  3GTJ J;  2DYS H;  3HOZ J;  3OYJ A;  4CSW A;  2E1M C;  4EJW A;  2Z33 A;  3NWT A;  4M73 A;  1QVT A;  4OIN F;  1QGP A;  2ELH A;  2MFZ A;  2OCC H;  1BI1 A;  2JA5 J;  3F6V A;  1V3F A;  5FLV A;  4DBR A;  2JPB A;  3AFH A;  1PUF B;  1XB4 A;  2Z16 A;  2HQN A;  2PLY A;  3MCZ A;  2A6T A;  1DGR M;  2A07 F;  5ICG A;  2A5Y B;  1QHH D;  1J2X A;  1ZN2 A;  1FTZ A;  4LMY A;  3LL7 A;  2HTS A;  3D1N I;  3BP8 A;  2CQN A;  2FJ1 A;  4HPQ A;  4LFU A;  1IV6 A;  5J47 A;  3A01 A;  2M2E A;  3HB9 A;  4FX0 A;  5D4R A;  1AKH A;  1RKT A;  3QYF A;  1ZG3 A;  4LLL A;  1B9N A;  2NXN B;  5LHI A;  1XX5 A;  4RAZ A;  4TV7 A;  2AO9 A;  2X48 A;  2L7F P;  5DS9 A;  2V7F A;  3BJ6 A;  4AUX A;  5L3E A;  3E6C C;  2NS8 A;  2DA5 A;  3Q9S A;  4NB5 A;  3HSF A;  1U9O A;  5DCM B;  3ULQ B;  4G7O F;  1A5J A;  3REO A;  5AON A;  1BIB A;  5GAE J;  1UHW A;  5D8K B;  5DEQ A;  3ZRG A;  1SD6 A;  3TKY A;  4PSX A;  1P2F A;  2KLO A;  2VC1 A;  1S29 A;  4MLO A;  1OIS A;  1KU2 A;  4E4H A;  2MC3 A;  2HXO A;  3GZN B;  2AS5 F;  3J80 Z;  2QBY B;  4FET A;  1LDJ A;  1HC8 A;  3HSE A;  1OPC A;  5E8G A;  3ZMV A;  2JMW A;  4ESF A;  1W5C C;  2LRD A;  2MA3 A;  1YQA A;  1S72 I;  5FRM A;  2ZKZ A;  3A1Y A;  1OR7 A;  4CCM A;  3CC4 I;  2DJN A;  4J19 A;  3ELK A;  1WJF A;  2RAE A;  2DTR A;  1T0F C;  3LA7 A;  3DPL C;  1FZP B;  3QOE A;  1U5T C;  2TCT A;  2JVG A;  1WJA A;  4N9H A;  3V7S A;  3TED A;  5FD5 A;  1X3W B;  2GA2 A;  2L4M A;  4ZDP A;  2JRT A;  2RN7 A;  1HCR A;  1LEB A;  3WU1 B;  2Q1Z B;  1HSJ A;  4U0V A;  2VKE A;  1P9Q C;  2P7V B;  2COM A;  1JUS A;  3BJA A;  1WH7 A;  3K69 A;  3KYD B;  1VI0 A;  2O8X A;  1XC5 A;  2Z99 A;  1J75 A;  3LSJ A;  3PO2 J;  2O7O A;  1JGS A;  2E5N A;  4EV0 A;  4M3B A;  2JUG A;  4RM2 A;  4M3F A;  3E97 A;  3KEQ A;  1J09 A;  2QEX I;  3PIO F;  2F2E A;  3SZG A;  3BG9 A;  4EM0 B;  2ADU A;  1BI3 A;  2FQ4 A;  5J8C A;  1NTC A;  1U6G A;  3LSI A;  5JVT A;  3FM5 A;  3G1O A;  2RDP A;  4CH7 A;  1D5V A;  2CG4 A;  4FCY A;  4G6Q A;  4FE7 A;  4RLF A;  5K7Z A;  1SVL A;  2YX7 A;  1OCP A;  3ML6 A;  2PJR A;  1DPU A;  4DYR A;  3KEO A;  2X4H A;  1J5Y A;  3PUF A;  1K78 A;  2VQC A;  4HSR A;  2IA1 A;  3E6B A;  1LVK A;  3G73 A;  3CME I;  2W57 A;  5BQT A;  1FBS A;  4BQQ A;  5M3F J;  4HAM A;  5HLG A;  2DCE A;  3C1D A;  2DMN A;  1FWZ A;  3ASO H;  4U87 A;  4MEX F;  1OCC H;  1O57 A;  2MG4 A;  2R7V A;  1IZ1 A;  4HYE A;  2PJP A;  1VZ0 A;  2Z2S B;  4M9S A;  4BJ6 C;  5IPA A;  5HDN A;  3ABK H;  3MKL A;  2Z1D A;  4XOT A;  1FIP A;  1V4R A;  1XGM A;  2ETH A;  4L18 B;  2ZCW A;  3O3K A;  3K4C A;  5HNF A;  2JZY A;  5CQE A;  4A5N A;  2Q0O A;  3RIR A;  1QZZ A;  4LG3 A;  2GOM A;  4KN4 X;  3F22 A;  3OS1 A;  1QA6 A;  4OIQ F;  2ZBK A;  3JRD A;  1AU7 A;  2BGC A;  3K7A J;  1F4K A;  3WTY C;  2RRE A;  2X51 A;  4ZYA A;  4XRS G;  5FLX K;  3R60 A;  2CQQ A;  1AA7 A;  2YX4 A;  2L4A A;  1BBY A;  5B66 C;  2X6X A;  1FYM A;  1F5T A;  1HW2 A;  5HOO A;  5C44 J;  1HQC A;  2XRN A;  3W2W A;  3HTS B;  2DDA A;  2A69 F;  2IGM A;  2X1C A;  3PNT A;  1YFH A;  2HTJ A;  1DP3 A;  4BXX J;  3PQJ A;  2ME0 A;  3BQZ A;  4XKC A;  3S2H J;  1O7F A;  3I56 I;  3P9I A;  3OYC A;  1PJR A;  2VKH A;  2E2H J;  4EQQ A;  1IV8 A;  1G8X A;  1MKM A;  2V9K A;  3VSL A;  4IRI A;  1NK3 P;  2EA4 A;  4M6Y A;  2XGC A;  1QZE A;  5JFR A;  1VQN I;  1Z91 A;  5BPD A;  1HDP A;  1WGX A;  3DBR B;  3Q9V A;  3SZT A;  3R6S A;  3WU0 A;  3PUB A;  3FK6 A;  4LD5 A;  2VQH A;  3W6V A;  3IH2 A;  3E6D A;  2XSD C;  3H36 A;  4IPA A;  2LBF A;  3K4L A;  1B72 A;  2R7O A;  3TW7 A;  3T8R A;  4EEF G;  3CMM A;  2PI0 A;  4R1H A;  3BY6 A;  1FMV A;  1TQM A;  2OA4 A;  4BHB A;  1UZC A;  5D8L B;  1RPW A;  4E7L A;  5F04 A;  1IUF A;  1IW7 F;  3BZK A;  3RQI A;  4Z6Y A;  2X9D A;  1LFB A;  2G7U A;  5EEG A;  2L7M P;  3BTC A;  1ZRD A;  3S17 J;  1YS7 A;  2Y0M A;  2VBW A;  1I3A A;  4KIC A;  2H6B A;  2HDC A;  4QTR A;  4HV6 A;  5ILS A;  3CC2 I;  1S9H A;  1F36 A;  4IEJ A;  5BMZ A;  3KP3 A;  1X3U A;  5D6E A;  3OYF A;  1IF1 A;  4I6Z A;  3QAH A;  1SMY F;  2EV6 A;  2XC7 A;  1DQU A;  2DO7 A;  3HXL A;  2ZJR F;  1X1P A;  2NOG A;  2ZXH A;  3DF8 A;  2M0C A;  4ZYG A;  2E5Z A;  4BQN A;  4WXH A;  2W24 A;  3MWM A;  4UNO A;  3HZJ A;  2KIM A;  4Y7N J;  3OIP A;  5EF6 A;  1F1Z A;  2R5Z B;  2VQG A;  3ZMZ A;  2JUC A;  2BZT A;  3NWS A;  1YIT I;  2NVY J;  4NQW B;  2LOO A;  2OJE D;  1J9I A;  3H9G A;  1X3Z B;  1WJD A;  3K4M A;  4GRI A;  2X6O A;  1X2M A;  3Q5F A;  1JJ6 C;  4QWQ A;  1ZRC A;  2CJJ A;  5E3O A;  2XAH A;  1TW2 A;  4AU7 A;  3ZQH A;  4IO9 F;  4KN7 X;  1BW5 A;  2DK8 A;  3W2V A;  1S7O A;  2PFB A;  2RV8 A;  4D7N A;  2W82 A;  3M8E A;  3MKZ A;  2DMU A;  3OR1 C;  3ZMU A;  5D5U B;  4B4C A;  4A3M J;  3S3O A;  4M72 A;  1T0F A;  4ZYH A;  2QEN A;  1K79 A;  4XLH A;  2WB1 N;  1K6O A;  3C18 A;  1U5T A;  5DDG A;  4C2U A;  4C30 A;  3WGG A;  1IO2 A;  3ZMD A;  2NVT J;  4MO7 A;  3T8T A;  1IN5 A;  4EGY A;  2VKV A;  2V1U A;  3CJQ B;  2D1H A;  1RZ4 A;  1W7P D;  3UNG C;  3EYI A;  5IT3 A;  3K4N A;  1W7P A;  5K5R A;  4BE2 A;  4ZC3 A;  2NVU B;  2LG4 A;  2OPT A;  4G8X A;  3TO9 A;  3TDZ C;  3GO5 A;  1R58 A;  2IRF G;  4KMF A;  4LGW A;  4RAY A;  4B44 A;  2D2W A;  3KP2 A;  3M8J A;  4AVZ A;  3S1Q J;  4BY1 J;  5LEJ A;  5JR3 A;  1KU3 A;  5HOD A;  2CO5 A;  4IQ4 A;  2CQ7 A;  4XLF A;  2VJI A;  3LQQ A;  1YE9 A;  3BOQ A;  1T08 B;  2VPL A;  2Y75 A;  3OYB A;  4C3H J;  4BS9 A;  5FB2 A;  4RB3 C;  4IX7 A;  3V4G A;  2DJI A;  1BC7 C;  2ECC A;  5B3S H;  3A01 B;  1XN7 A;  1Z05 A;  1AKH B;  4AM3 A;  3TDU C;  1FOY A;  3S8P A;  3DTE A;  2QVO A;  1EA3 A;  5IYB J;  2W85 A;  3BTI A;  4D5F A;  2O5R A;  2DT5 A;  2EV0 A;  3HHG A;  4B47 A;  3BLY A;  5F0F A;  1IDY A;  2QKM B;  5LLQ A;  2EZK A;  4KNY A;  2PMZ A;  1IRZ A;  4HF0 A;  1ZYR F;  1WPK A;  3JRG A;  5HDK A;  3FXU A;  3AAF A;  3K1P A;  1DU0 A;  1YX3 A;  2PQ8 A;  4BU2 A;  2R7Q A;  4M9Z A;  4XLN F;  3U21 A;  5A2Q K;  3ZGK A;  1BR2 A;  1LE8 A;  3JRI A;  2K3F A;  1D1A A;  2PBI A;  2XAG A;  3MN2 A;  3ZMT A;  3FX3 A;  4BAY A;  5FLM J;  4A3I J;  1V5F A;  2IBD A;  3OYN A;  4HZF A;  4Y17 A;  1RKW A;  1ON2 A;  4ZJZ A;  4BUP A;  5TIS C;  3GFM A;  3HOS A;  1ZH5 A;  5LRR A;  2W7N A;  3CDL A;  1R71 A;  3OOU A;  3VB2 A;  1EH6 A;  2K27 A;  1TQP A;  3BQY A;  3EUH C;  4G7H F;  2DFH A;  2VI6 A;  1SFU A;  4UY8 I;  1TT0 A;  2RNJ A;  2OF7 A;  5M5X J;  3KCC A;  1FT9 A;  1L0O C;  4B09 A;  3JRC A;  1ZKG A;  1IAW A;  1RRJ A;  4HDV A;  1MBF A;  2F6C A;  2Y9Z A;  2XDV A;  1YS6 A;  1CGP A;  3KLN A;  3JAM K;  3ZQI A;  3QPL A;  4Y3O A;  1MJB A;  3DPU A;  4RDU A;  1JI8 A;  3FIS A;  5C3E J;  1YJN I;  2WBM A;  4UXN A;  1W4M A;  4PK4 A;  3RDI A;  3S14 J;  3FKJ A;  3FZV A;  1TT5 B;  1SMT A;  3NRV A;  4WCG A;  2D45 A;  1IDZ A;  2V9V A;  1TZL A;  2KT0 A;  3OYA A;  1QQI A;  1ACI A;  1BJZ A;  2FBI A;  5L3F A;  3FXO A;  4I0B A;  1S5L C;  4IRH A;  4BY7 J;  2XGD A;  2WY8 Q;  3H0G J;  4BBS J;  2MD5 A;  2Z9O A;  2XF5 A;  1WWX A;  5ILV A;  3KZY A;  3N97 A;  2ACJ A;  2OU2 A;  2QSH X;  3AL0 B;  2AQF A;  3ERM A;  4IOC F;  1VQ6 I;  3SFZ A;  1U3E M;  1R22 A;  2W84 A;  3CO6 C;  4HX8 A;  2V1D A;  1P4X A;  3FF5 A;  2E36 A;  2NS7 A;  4HLY A;  2Z5U A;  3HKZ A;  1MBH A;  4KDP A;  2NNY A;  2BVM A;  4BAC A;  4XLP F;  4RS8 A;  1ULY A;  1OCR H;  2R93 J;  2R7F A;  5B1A H;  2EA2 A;  1ZRE A;  2VPR A;  1ODD A;  4ZZD A;  1HW1 A;  1ORK A;  4IHV A;  2IPQ X;  5GP9 A;  2PMH A;  1EF4 A;  1LUJ B;  3E0J B;  4ASN A;  4RAF A;  1G3S A;  4ZDO A;  3VYU B;  3QU6 A;  1KON A;  1BW6 A;  2V9P A;  4GO1 A;  3L00 A;  2JQ7 A;  3BR0 A;  2VQL A;  2Z3Y A;  1OLT A;  4A3D J;  5L3B A;  3M3Y J;  4ENK A;  1UST A;  1TW3 A;  5C4J J;  3SEZ A;  3KZI C;  2KFD A;  3ISP A;  2A61 A;  3GTP J;  1EH8 A;  2YSR A;  2XGX A;  4HQM A;  1HOM A;  2OTL I;  1SD7 A;  3H1C A;  2CQX A;  3OWT A;  4FT8 A;  5DD8 A;  1ZEL A;  3I64 A;  2CSO A;  1D8J A;  3ZQC A;  3E3V A;  1S6L A;  3BWG A;  5DV5 A;  5ICE A;  3IWF A;  2NVQ J;  4A3L J;  4XL9 A;  2M30 A;  1IXC A;  2XHK A;  2HOA A;  1KQ8 A;  5HS8 A;  3G1L A;  5DD4 A;  1D0Y A;  2JK3 A;  3OSF A;  2MH9 A;  4BJ5 C;  3L9F A;  1XMA A;  1I3Q J;  1O7L A;  2ZC2 A;  2W25 A;  1D0Z A;  1BJA A;  2FUG 2;  3HDD A;  2EQR A;  2WAE A;  4I98 B;  2VB6 A;  2QLZ A;  3NEU A;  5CVI A;  4UVC A;  4NDL A;  3I5U A;  4RM3 A;  2CRG A;  4JOM A;  2MSY A;  4LJZ F;  4CYD A;  2WV1 A;  2M8E A;  2XF7 A;  3D5S C;  4LG0 A;  2KPM A;  3ASN H;  5ICC A;  3IAS 2;  4E7I A;  1PP8 F;  4CZZ A;  4XM3 A;  2DAO A;  3K6G A;  2OZ6 A;  2E1C A;  5E20 A;  1QBJ A;  2EZH A;  1O3R A;  5IT9 K;  2LY1 A;  2E1M B;  1U0J A;  1Z3Y A;  1MSE C;  2R7D A;  3D5L A;  4FE4 A;  3WG7 H;  3OYD A;  3GUD A;  2LBF B;  2DA1 A;  2Y2Z A;  4D0P A;  2E1O A;  2DMQ A;  5AIP A;  2P6S A;  3S15 J;  3W2A A;  2CW0 F;  4XKV A;  4MQ9 F;  2R5Z A;  2DA2 A;  1KA8 A;  1X58 A;  2MBF A;  4NQW A;  4BQO A;  2HPM A;  1A35 A;  1XGN A;  4C3J J;  1QHG A;  2YU3 A;  4NUB A;  3B6A A;  1R49 A;  2NNN A;  5HNH A;  2AHQ A;  4F7Z A;  1TWF J;  1K4S A;  1MJA A;  2RC4 A;  2Q8K A;  1U8B A;  3ZQG A;  1EKE A;  3L7W A;  3K1N A;  3GBG A;  1FY7 A;  4BL0 B;  4D7M A;  4DYC A;  1MMG A;  3EYY A;  5FJ8 J;  3JRF A;  5D5V B;  2JSC A;  2VE8 A;  2ELK A;  4YRV A;  1OKR A;  4UUS A;  2DU9 A;  1GV5 A;  4A3G J;  2V6C A;  3F9K A;  2ELJ A;  3WTV C;  2H1K A;  1R00 A;  3RSN A;  1G6N A;  4LIT A;  4HQE A;  4Y52 J;  2ESH A;  1JTY A;  2JA6 J;  3GLX A;  2QQB A;  3KP4 A;  1Y1V J;  1XGO A;  4PJJ A;  2LTP A;  1RET A;  3RYR A;  5FLX Z;  1TLH B;  3VEP A;  2DYR H;  3BCA A;  5EG0 A;  3M9A A;  2WAQ N;  1VQL I;  3EUH A;  2F4I A;  4H4K C;  5K1Y A;  1S3J A;  1MH4 A;  2XIG A;  2MH2 A;  2YS9 A;  4G94 A;  3C3W A;  3ZN0 A;  1U5T B;  4KMU X;  1OCO H;  3V8K A;  3DV8 A;  2XAJ A;  2RGV A;  2L5Q A;  4A3K J;  4PJM A;  4QSH A;  2P7C B;  1P7J A;  4CCO A;  2XB0 X;  2HQA A;  2F5E A;  3FHN A;  2P81 A;  1E0E A;  5HLT A;  3IC7 A;  1UJ8 A;  2UUZ A;  1I39 A;  3MZY A;  4E7H A;  4DJA A;  5TJJ A;  1W7P B;  1WQ2 A;  1ZLK A;  1H88 C;  1ETK A;  3I71 A;  2ZME C;  2L0K A;  5KAF C;  3CF5 F;  2OD5 A;  3QPS A;  4XLE A;  2VAS A;  3RPQ A;  2WWY A;  2A05 A;  2HKO A;  5H20 A;  4YEL A;  3LA3 A;  4HW0 A;  4N9I A;  2FX0 A;  1DPR A;  3DP7 A;  1I27 A;  4HA8 A;  4IQJ A;  1ZG1 A;  2P5K A;  4FX4 A;  3I54 A;  1GV2 A;  2LNB A;  1VFC A;  3ABT A;  5E18 F;  3TO7 A;  2BHY A;  3F0C A;  3G71 I;  1NK2 P;  2XPU A;  2X1D A;  4I02 A;  2XRL A;  3JRE A;  3H3V K;  4RA2 A;  2HPI A;  2LMD A;  3WE2 A;  5GAD J;  1B6A A;  4E70 A;  2I5U A;  3EPZ A;  1R7J A;  2O3F A;  2TDX A;  3L2U A;  3J81 K;  3MEX A;  4HX4 A;  4XRF A;  1FBU A;  4YEJ A;  5FRO A;  1BL0 A;  4XN0 A;  4CA0 A;  4WF2 A;  5CJ9 A;  2E1N A;  2R7X A;  2ID3 A;  1IG7 A;  3GLL A;  3I0T A;  1LE8 B;  5JHF A;  1YIJ I;  4I2O A;  2JJ7 A;  3BZ6 A;  3KX2 A;  2QYO A;  3KEY A;  1P6R A;  4U0W A;  4CIC A;  3CES A;  2XAU A;  1V55 H;  1N78 A;  2F5C A;  3GEZ A;  2VIX A;  3H9J A;  1HA8 A;  1UG2 A;  2KRF A;  5EGO A;  3A4C A;  4C9Y A;  3JSP A;  4EGZ A;  5F1J A;  1VQ8 I;  1JUM A;  2ZNY A;  4CUG A;  1XDS A;  4FTH A;  3J7A Y;  1FTT A;  3WTZ A;  1WCM J;  4BE1 A;  2IVM A;  1IUY A;  3OV8 A;  4F52 A;  2VLA A;  1IN6 A;  2E35 A;  3HIF A;  4PUS A;  4I01 A;  4QLC U;  1T6S A;  5JI6 A;  4HDU A;  2VL8 A;  4RGS A;  4XON A;  2Y9Y A;  1S7A A;  3MAJ A;  2OCE A;  1B59 A;  3BZC A;  1RES A;  4KJZ A;  4HRI A;  3K70 D;  4OAZ A;  4JQF A;  1P7I A;  1QNT A;  1BR1 A;  2KDZ A;  3F8N A;  1BN5 A;  2DBB A;  3GX4 X;  3MD2 A;  4A93 J;  2LR8 A;  4B43 A;  1VQ5 I;  5JLX A;  2E60 A;  1JT6 A;  3GFJ A;  1R23 A;  5H6R A;  5D6F A;  1T39 A;  3QU3 A;  2XVC A;  3PNY A;  5E3N A;  5KNL A;  3MFK A;  3V7C A;  3QYB A;  3TOA A;  3WU2 C;  1OMI A;  2VBZ A;  3DEU A;  1YHQ I;  4R79 A;  3I59 A;  3T1B A;  3H0D A;  5F0C A;  2VC0 A;  3N4M A;  3E5X A;  2R7R A;  2OQG A;  3PNV A;  3OYG A;  3DKY A;  5F1R A;  3JSO A;  3M4O J;  1ZGJ A;  3GTK J;  4WXC A;  3LSK A;  5B1B H;  1JHF A;  3QRF F;  4PJL A;  3SDB A;  2KQR A;  2WC2 A;  2DT7 B;  2JVH A;  4AVP A;  1JKR C;  2ZJQ F;  2XUB A;  2V1X A;  4IRG A;  1ETQ A;  2R0Q C;  3HOX J;  3CCJ I;  1ZR2 A;  4A5M A;  1AHD P;  1Y8Q B;  1YTY A;  2DA3 A;  1SFK A;  2NOJ B;  3FXK A;  3ZPL A;  3GVA A;  2IP2 A;  2BBY A;  1TWG J;  2NAZ A;  4P55 A;  2O8K A;  4ZDL A;  5LBQ A;  3A0H C;  3VSK A;  2HGC A;  2ESN A;  4XLC A;  2PEX A;  4F93 B;  4ZTJ A;  1WJB A;  5GPA A;  4XRM A;  1IJW C;  3CP8 A;  1X1D A;  2K3P A;  2QF7 A;  4UVA A;  2XRO A;  1E3O C;  3DWL E;  2CFO A;  2KIU A;  3LA2 A;  3ECH A;  2A6E F;  5A2Q Z;  2HXI A;  1WZ2 A;  2XPW A;  3O8G A;  3L2Q A;  4XLA A;  3K9T A;  1W5S A;  3N05 A;  3AKZ A;  2XV4 S;  4BXF A;  4DZJ A;  4YIR X;  2B9S A;  1JKP C;  2H8W A;  4V2F A;  3B6C A;  3LSM A;  1X19 A;  2M34 A;  2X6W A;  5LHH A;  2HVS A;  3MZ8 A;  2LK2 A;  1A31 A;  3JW4 A;  1TP4 A;  4G6T B;  4C2M J;  3LSH A;  3WOD F;  4UHT A;  4EM1 A;  4IZZ A;  3OYK A;  1ZGW A;  3RKQ A;  3CCR I;  4F3Q A;  2RVC A;  2VT3 A;  3QQA A;  3T5X A;  5JHU A;  2HDW A;  4PSW A;  1W0T A;  2OAZ A;  4OMZ A;  2FD5 A;  2VN2 A;  1BC8 C;  2KHM A;  2Y0S N;  2LKS A;  3HKZ N;  3CCS I;  1IXS B;  4II2 A;  3JAM Z;  2F48 A;  1T2K A;  2JA2 A;  3WTS C;  2Y31 A;  2W4S A;  2QSG X;  3I9V 2;  2FNP A;  5IP6 A;  1CF7 A;  4RB1 A;  2EIK H;  1FMW A;  2M0M A;  4LG0 B;  1JGG A;  1GXP A;  1KQ0 A;  3KPH A;  3VYR B;  3KZZ A;  3BG7 A;  2IGK A;  3HPG A;  3PIP F;  3FHZ A;  2WAF A;  4KIG A;  1AOY A;  1WKM A;  2OTJ I;  5HDG A;  2E7W A;  2FOK A;  3KE2 A;  4Q48 A;  2QQ8 A;  4ZYE A;  2GXA A;  1G3T A;  5E1W A;  2LYC A;  4EJU A;  3GTL J;  5DM6 F;  3GYH X;  2GWR A;  2EZI A;  5IP9 J;  1BR4 A;  2GA1 A;  5IOZ A;  1GHC A;  4L5I A;  4J00 A;  1FNN A;  3S3N A;  2V26 A;  3C2B A;  2XPV A;  1IC8 A;  1BOB A;  2K86 A;  5IOY A;  4NC6 A;  4V19 K;  1TQI A;  4EM2 A;  4V2G A;  1UG0 A;  5HS9 A;  3E5Q A;  3CZ6 A;  4BH9 A;  4M71 A;  2E7X A;  3IV5 A;  3A2K A;  2X85 A;  3FXJ A;  1A6Q A;  4CYC A;  4MEY F;  3F8B A;  2E2J J;  4B3X A;  1ETX A;  4RAG A;  3TMO A;  2P5V A;  2AQE A;  2ZNZ A;  2XAF A;  3VWB A;  2Y48 A;  5GAG J;  4W97 A;  2F5F A;  4GFB A;  1YI2 I;  4M74 A;  2GIV A;  4HNU A;  3ABM H;  3HGG A;  1P92 A;  2PG4 A;  1MMA A;  1ZTR A;  2M1B A;  3EET A;  4UUS B;  5KAI C;  4QIW N;  1G3Y A;  5L3G A;  3LNQ A;  4PFO A;  2M4K A;  1XMK A;  2ISY A;  2L2O A;  5EZH A;  2DW4 A;  2J5P A;  5EYR A;  1JUP A;  2DA7 A;  1Y1W J;  3TO6 A;  4F92 B;  4HV5 A;  1FSH A;  2KRH A;  4XOP A;  3ZQF A;  3DLA A;  5EG0 B;  2DOE A;  4HF1 A;  1TNS A;  2VOD A;  4L5E A;  5KVR A;  1KYW A;  3FBN B;  3VOD A;  5D5W B;  1FX7 A;  4P96 A;  1M1E B;  1XTA A;  5K7H A;  4HBL A;  2EH3 A;  3HHH A;  1KQ9 A;  2YPR A;  3BG3 A;  2FBH A;  3BR1 A;  5FKK A;  1Z9C A;  1Z21 A;  2IA0 A;  3AG2 H;  3HOU J;  4M3E A;  5J40 A;  1QRY A;  4KIS A;  1TTY A;  2H27 A;  2D5V A;  2QSF X;  9ANT A;  4IL6 C;  3Q0U A;  5LRS A;  4AID A;  1WVR A;  2H09 A;  4W1U A;  3LST A;  3E1S A;  4DYQ A;  3IL2 A;  3SJM A;  5KCM A;  2K5C A;  5IT9 Z;  4EMS A;  1FOX A;  1FP2 A;  1Y0U A;  1IGN A;  3DKW A;  1QU3 A;  3L2C A;  3TGN A;  4XSX F;  3KYL A;  2STW A;  1R1V A;  1MGT A;  4HEA 2;  3RTR A;  2N8G A;  2MAB A;  4B1R A;  4Z2Y A;  1B8I A;  2CH0 A;  3HSR A;  1IRF A;  4GCV A;  1HXD A;  2P8T A;  4ZH4 F;  1VQ4 I;  2CUE A;  3H3Z A;  4KT6 A;  1ZAR A;  1SD4 A;  1FLI A;  4ESB A;  2HFH A;  3Q0W A;  1U9N A;  2R7U A;  2MLK A;  4HNV A;  2QQA A;  2VON A;  3GTQ J;  1R5I D;  6PAX A;  4BYY A;  1IRG A;  4JBA A;  4ZTF A;  3JRB A;  3LWF A;  3F23 A;  1YW8 A;  4JX6 A;  2QQ9 A;  4YIF A;  3KET A;  3KLO A;  3U1D A;  3H35 A;  3V8L A;  3PL8 A;  3LSP A;  5CYV A;  1D5Y A;  3CD6 I;  3RKW A;  4MIM A;  1W0U A;  4BQA A;  4E6K G;  1SAU A;  2UZK A;  4Q5S F;  1U2W A;  3KP5 A;  2FQ3 A;  3BPV A;  1ZK8 A;  1MNE A;  2ZFU A;  1YX5 A;  1KGS A;  4CZC A;  3W6K B;  4ENN A;  3L1P A;  2HYJ A;  3K4J A;  2X0L A;  2LVS A;  5L3C A;  4M3G A;  3R61 A;  3HOW J;  2V4J C;  1MDM A;  4XID A;  2XB5 A;  3EUA A;  4D9J A;  1MNM C;  2IS1 A;  3AG4 H;  1X1C A;  2MGQ A;  4S0H B;  1LVA A;  2LF8 A;  1YJW I;  2L02 A;  4DQ2 A;  1T38 A;  1LKX A;  5DUI A;  5EGO B;  3DLL F;  3IH3 A;  2DA4 A;  3LFU A;  1LQ1 A;  2VXD A;  2ZJ2 A;  3GF2 A;  4PCQ A;  2IW5 A;  3JRH A;  2V6E A;  1TWA J;  3DEE A;  3H5A A;  5CVU A;  1T98 A;  3ZN1 A;  2DMP A;  1WRJ A;  4ZYD A;  5J8F A;  2GZW A;  1P4W A;  3HUG A;  4GDF A;  1V54 H;  4E7J A;  1I1G A;  3C2H A;  2L01 A;  2VBY A;  5FGM A;  1BI2 A;  3NQO A;  1UAA A;  1UHS A;  4OIR F;  1MIJ A;  1Y39 A;  2BV6 A;  3BR5 A;  1B4A A;  2ICW G;  4EJV A;  2IGN A;  1R1T A;  1UMQ A;  2EJR A;  3CTA A;  3W3C A;  2NS0 A;  2HOS A;  2XSJ C;  5DCF A;  4JK1 X;  3I55 I;  2KRC A;  3HPH A;  4IF4 A;  3VFZ A;  4IHW A;  3DKX A;  1V5E A;  2GBY A;  3CCU I;  3I59 B;  4OOI A;  1PYV A;  1YJ9 I;  1Z0X A;  2H6C A;  3BDD A;  2GAU A;  2HVQ A;  4Q4Z F;  3S1M J;  3VDX A;  4OWR B;  2CV0 A;  3A03 A;  1MBE A;  3WE3 A;  2NYX A;  1XMX A;  1OYW A;  1MBJ A;  2IGO A;  1F43 A;  1O3Q A;  2G7H A;  4PGH A;  5J3L A;  3MZH A;  2EIN H;  3FXL A;  4FQG A;  5FFZ A;  1NH3 A;  5CQG A;  2O03 A;  1T33 A;  2EFP A;  4CXF A;  1XCV A;  3WHC A;  4WX9 A;  1EV7 A;  1SEU A;  4D5C A;  1MSF C;  4L9J A;  1B9M A;  4PJN A;  3S1N J;  3V8J A;  2O6G E;  2ZFW A;  1YW7 A;  2ZXJ A;  1ZLJ A;  4A6D A;  5TRD A;  3J81 Z;  2P5L C;  1RUO A;  4IHT A;  3GWZ A;  4XSZ F;  4EVI A;  4EJO A;  2LKP A;  4AYB A;  3OYH A;  3DBH B;  4DW6 A;  2GQQ A;  3K1M A;  3QWL A;  4BBR J;  4A0Z A;  4NC7 A;  3J7A O;  3C2G A;  3FIW A;  4GXO A;  4F55 A;  3NAR A;  4HNT A;  5IY5 H;  3WTU C;  4AC0 A;  2BYV E;  1VND A;  3K4K A;  3X2Q H;  2M3A A;  2EV5 A;  3FBI B;  4PGG A;  1JTX A;  1TWH J;  2F4O B;  3W6J B;  2W1O A;  2AXT C;  2EFO A;  3SXY A;  1VQ7 I;  4QPO A;  4IXA A;  2M4G A;  4U0Y A;  3RI4 A;  4A6E A;  4M3D A;  1Y0N A;  1LNW A;  4XK4 A;  3L09 A;  2WAD A; 
#chains in the Genus database with same CATH homology
 3CMM A;  5FRO A;  3QYE A;  3DQV C;  3H5R A;  2WY7 Q;  4XN0 A;  1FMV A;  2OUM A;  1X1B A;  2M7A A;  4CA0 A;  2R7X A;  3M1C A;  2R4G A;  5JHF A;  3EUK L;  3KX2 A;  2MYS A;  3KEY A;  4E7L A;  3K4B A;  4RMN A;  4J01 A;  3CES A;  2XAU A;  1N78 A;  2LC2 A;  4RLQ A;  1Z7L A;  2BVL A;  2VIX A;  3H9J A;  1HA8 A;  3MMY B;  2IS2 A;  4DBQ A;  3ZR8 X;  4HG2 A;  3A4C A;  4C9Y A;  1S9H A;  4E7Z A;  3PSI A;  4X0G A;  4CUG A;  1N75 A;  3OYF A;  4BDY A;  1WJC A;  3J7A Y;  2R7T A;  3CP2 A;  2XC7 A;  1DQU A;  3HOT A;  3VYS B;  4BE1 A;  4CCK A;  3HXL A;  1LDK B;  2L9S A;  4F52 A;  2VLA A;  4PUS A;  2ZXH A;  2KZV A;  2LH9 A;  2QKL B;  2E5Z A;  4BQN A;  3DTI A;  2VL8 A;  2R7W A;  3OIP A;  4XON A;  2CMP A;  4KJZ A;  4HRI A;  2VQG A;  3NWS A;  3K70 D;  4NQW B;  2LOO A;  4OAZ A;  4JQF A;  3H9G A;  1BR1 A;  1WJD A;  3D5R C;  3K4M A;  4GRI A;  3OYE A;  3ONQ A;  3V42 A;  3L2V A;  3MD2 A;  4NC8 A;  4B43 A;  2E60 A;  4NNJ A;  4AU7 A;  4CCJ A;  4Y4R A;  3S32 A;  3PNY A;  3DTK A;  3W2V A;  2L7K A;  1X1A A;  5KNL A;  1LFP A;  3QYB A;  2CUJ A;  2IS6 A;  2W82 A;  4R79 A;  3MKZ A;  3OR1 C;  3H0D A;  3OYI A;  3S3O A;  2R7R A;  3PNV A;  3OYM A;  3DKY A;  3QOD A;  4XLH A;  5CKT A;  3OYG A;  1GLN A;  1G59 A;  4C2U A;  3LSK A;  1X4O A;  4C30 A;  1OR7 C;  3MKY B;  4HST A;  4PJL A;  2PJR B;  3SDB A;  2KQR A;  2DXI A;  3CF2 A;  2DT7 B;  2JVH A;  2Y0S A;  4BEH A;  4N4O B;  2CV2 A;  3CJQ B;  3OR2 C;  3UNG C;  1Y56 A;  4ITV A;  4U7B A;  3K4N A;  4XN3 A;  4BE2 A;  2CS3 A;  1SFK A;  2NOJ B;  4ZC3 A;  2LG4 A;  2OC6 A;  3PSF A;  2X6Y A;  4ZDL A;  1R6R A;  1K6Y A;  3HG9 A;  4B44 A;  3VSK A;  3M8J A;  2V1N A;  4AVZ A;  4XLC A;  4F93 B;  4ZTJ A;  1WJB A;  3BC8 A;  3CP8 A;  2IXS A;  4IQ4 A;  1X1D A;  4XLF A;  2HU9 A;  2K3P A;  2VJI A;  4OAY A;  1YE9 A;  4B48 A;  2VPL A;  2CUZ A;  3DWL E;  3OYB A;  2CFO A;  2VKD A;  4LIV A;  4BS9 A;  3IUO A;  4IX7 A;  2DJI A;  3L2Q A;  4XLA A;  3K10 A;  3N05 A;  1ERD A;  3AKZ A;  2I8D A;  4BXF A;  2UWM A;  3S8P A;  2CW7 A;  3DTE A;  4E7S A;  1EA3 A;  3LSM A;  1D1C A;  2KL4 A;  2O5R A;  2LY2 A;  5KHD A;  1X19 A;  4B47 A;  3BLY A;  2X6W A;  1UEL B;  2HVS A;  3AL0 C;  4XR6 A;  1MW7 A;  2QKM B;  3G2B A;  4D1Q A;  2PMZ A;  5LFA A;  4G6T B;  3LSH A;  4IZZ A;  3OYK A;  3K70 C;  2W00 A;  3S93 A;  1YX3 A;  4F3Q A;  2L9N A;  4BU2 A;  2R7Q A;  2HDW A;  4PSW A;  3U21 A;  2F5V A;  3IAM 2;  3ZGK A;  1BR2 A;  1D1A A;  2KHM A;  2VJ4 A;  2CV1 A;  1V5F A;  4II2 A;  2GOX B;  2WB1 A;  3OYN A;  3VYT B;  2JA2 A;  4ZJZ A;  2W4S A;  4BUP A;  3CJR B;  3I9V 2;  3HOS A;  4XQF A;  1FMW A;  2M0M A;  2DOA A;  3BG6 A;  3OOU A;  2W7N A;  4XKB A;  2HVR A;  1N77 A;  3VYR B;  3S3M A;  3EUH C;  2P0W A;  3BG7 A;  2IGK A;  3HPG A;  3OIQ A;  4CCL A;  2WAF A;  4QPQ A;  1TT0 A;  3OL4 A;  3HC7 A;  5FRN A;  1MND A;  3HL2 A;  5CPR B;  2MD0 A;  3H5N A;  2M7B A;  3OMY A;  2LYC A;  4XNF A;  3DPT A;  2F6C A;  2BW3 B;  2XDV A;  4P1W A;  3DU5 A;  2A5W A;  2OV7 A;  4Y3O A;  1BR4 A;  2KMU A;  4XOR A;  3DPU A;  4J00 A;  3PJR A;  3S3N A;  1T95 A;  1JI8 A;  2V26 A;  2JSP A;  2WBM A;  2XF6 A;  4LIU A;  1BOB A;  4Y33 A;  4PK4 A;  3FKJ A;  1UG0 A;  2LRE A;  2KP6 A;  3CZ6 A;  4XKW A;  2VJJ A;  3A2K A;  5LD2 C;  2X85 A;  1TZL A;  4PFP A;  3L2W A;  3OYA A;  2K9L A;  3LSG A;  3RPU D;  4CCN A;  4B3X A;  1WJE A;  2WY8 Q;  4EAT A;  2XF5 A;  4XMY A;  3TMO A;  2AQE A;  4P5O A;  3VWB A;  1DGW Y;  1W36 D;  2DT6 A;  3AL0 B;  2AQF A;  3HUG B;  4F91 B;  4HNU A;  2VJ5 A;  1MMA A;  3OYJ A;  4CSW A;  4BDZ A;  2E1M C;  3HKZ A;  3NWT A;  4PFO A;  2M4K A;  2ZSH B;  2BVM A;  4BAC A;  2K9M A;  2MFZ A;  2L2O A;  2KDO A;  5HVQ C;  4DIQ A;  4DBR A;  1WJ5 A;  3AFH A;  2Z16 A;  4F92 B;  3E0J B;  2KRH A;  2HZD A;  2IS4 A;  2A6T A;  1DGR M;  4XOP A;  4DOZ A;  3DLA A;  4ZDO A;  3VYU B;  3OL3 A;  1KON A;  2CW8 A;  1QHH D;  2VQL A;  1Z3X A;  3FBN B;  3ZXS A;  3LL7 A;  1OLT A;  3OS0 A;  4HPQ A;  2ZXI A;  2ZSI B;  3SEZ A;  3QYF A;  1Z21 A;  1WFX A;  4KIS A;  3MKW B;  3OWT A;  1NG7 A;  1ZEL A;  2V7F A;  4XL9 A;  3E1S A;  4KIT B;  4BJT A;  2HNH A;  5KCM A;  2K5C A;  1D0Y A;  3ZRG A;  4BJ5 C;  1QU3 A;  2MC4 A;  3PFY A;  4PSX A;  2KLO A;  3KYL A;  1D0Z A;  2FUG 2;  4MLO A;  4DGW B;  2WAE A;  4HEA 2;  3RTR A;  2VB6 A;  3ZCO A;  2MAB A;  4RM3 A;  4E4H A;  2CH0 A;  4FET A;  4JOM A;  2XF7 A;  4KT6 A;  3D5S C;  2KPM A;  2LRD A;  3IAS 2;  4E7I A;  5FRM A;  3A1Y A;  2R7U A;  4CCM A;  3H9Q A;  4XM3 A;  3K6G A;  1WJF A;  3FDY A;  4ZTF A;  1X4P A;  1T0F C;  3DPL C;  3QOE A;  2JVG A;  1WJA A;  1V5G A;  2LY1 A;  2E1M B;  1U0J A;  1Z3Y A;  3H35 A;  3PL8 A;  4ZDP A;  2X1E A;  3SYT A;  2BW3 A;  3D5L A;  3OYD A;  2Q1Z B;  2WAQ A;  2LBF B;  1P9Q C;  4E6K G;  1SAU A;  1IRX A;  2Q2E B;  1MNE A;  2ZFU A;  3W2A A;  1YX5 A;  4XKV A;  4CZC A;  2HPM A;  3K4J A;  4BQO A;  2E5N A;  1NG6 A;  2R7S A;  1QHG A;  2V4J C;  4NUB A;  2JUG A;  4RM2 A;  3EUA A;  4D9J A;  2IS1 A;  5HNH A;  4IKF A;  1X1C A;  4E7K A;  4BGD A;  3RQ4 A;  1J09 A;  5TGT A;  1LKX A;  3SZG A;  3LFU A;  2VXD A;  4C2T A;  2V6E A;  3DEE A;  3GBG A;  3H5A A;  4BL0 B;  3OYL A;  1MMN A;  1MMG A;  3LSI A;  3BCB A;  3RCO A;  4CH7 A;  4E7J A;  4N4N B;  4BE0 A;  4RLF A;  3C2H A;  4YRV A;  3IP4 B;  1UAA A;  2PJR A;  3F9K A;  2ELJ A;  2VQC A;  4HSR A;  1MMD A;  2IGN A;  3RSN A;  4LIT A;  1LVK A;  3TBI A;  3W3C A;  3ZQQ A;  3OY9 A;  4BQQ A;  2XSJ C;  4PJJ A;  3OS2 A;  2DCE A;  4U87 A;  3BCA A;  2KRC A;  3HPH A;  2R7V A;  3L2R A;  1VZ0 A;  2Z2S B;  4BJ6 C;  2F4I A;  2Z1D A;  3DKX A;  1V5E A;  4H4K C;  4XOT A;  2RNG A;  1PYV A;  3TL4 X;  3DU6 A;  3K4C A;  2HVQ A;  5HNF A;  5CQE A;  3VDX A;  4OWR B;  2CV0 A;  3LMM A;  4LG3 A;  1D0X A;  2GOM A;  2L5Q A;  3UR3 C;  4PJM A;  1D1B A;  3OS1 A;  4CCO A;  2IGO A;  2HQA A;  4BEH B;  3FHN A;  4II3 A;  1E0E A;  5HLT A;  5CQG A;  2RQQ A;  2UUZ A;  4E7H A;  2RRE A;  2X51 A;  4ZYA A;  4DJA A;  1AA7 A;  2UV1 A;  4PJN A;  2X6X A;  4XLE A;  3SEQ A;  3I3L A;  2VAS A;  5HOO A;  2VXZ A;  3W2W A;  4YEL A;  2IGM A;  2X1C A;  3PNT A;  1DP3 A;  4ANJ A;  4XKC A;  2WA0 A;  4FAS D;  4AYB A;  3OYH A;  3OYC A;  1PJR A;  4IQJ A;  2VKH A;  4NC7 A;  1G8X A;  3C2G A;  2V9K A;  3VSL A;  4F55 A;  4HNT A;  2X1D A;  3K4K A;  2M3A A;  2HPI A;  1Y6I A;  3FBI B;  2W1O A;  3EPZ A;  3PUB A;  4QPO A;  2VQH A;  3L2U A;  2BOL A;  2M4G A;  1W36 C;  2LBF A;  3K4L A;  4YEJ A;  2R7O A;  2WAD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...