1YX3A

Nmr structure of allochromatium vinosum dsrc: northeast structural genomics consortium target op4
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
112
structure length
112
Chain Sequence
MADTIEVDGKQFAVDEEGYLSNLNDWVPGVADVMAKQDNLELTEEHWDIINFLREYYEEYQIAPAVRVLTKAVGKKLGKEKGNSKYLYSLFPYGPAKQACRFAGLPKPTGCV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein DsrC
publication title Allochromatium vinosum DsrC: solution-state NMR structure, redox properties, and interaction with DsrEFH, a protein essential for purple sulfur bacterial sulfur oxidation.
pubmed doi rcsb
source organism Allochromatium vinosum
molecule tags Structural genomics, unknown function
total genus 31
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2005-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04358 DsrC DsrC like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.370 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1yx3A02
3.30.1420.10 Alpha Beta 2-Layer Sandwich Dissimilatory Siroheme-sulfite Reductase; Chain: A; domain 1 Dissimilatory Siroheme-sulfite Reductase; Chain: A; domain 1 1yx3A01
2XSJC 1YX3A 2V4JC 3OR1C 1SAUA 3OR2C 1JI8A 2A5WA
chains in the Genus database with same CATH superfamily
2DJNA 3UR3C 5DM6F 1E3HA 2J5OA 1BJZA 1M1EB 4N9IA 4RBOA 1X4OA 1I6XA 3Q3SA 1YITI 2EA4A 1UMQA 2DA6A 4JQFA 5CJ9A 2KP6A 4CSWA 5DCFA 5HDNA 2EH3A 2FQ3A 3FHNA 2DN0A 2L4AA 4BQAA 2HOTA 2M87A 5FKLA 4A3GJ 1PVEA 4W97A 4XMYA 1MBHA 4AIDA 4XICA 3Q5FA 1T8IA 2PJRA 4UUVA 2W4SA 2DDAA 1FMWA 3LSHA 4XN0A 2NVUB 2XB0X 5HS7A 3V7CA 2VODA 1X3ZB 1LDDA 1Z3YA 1G3WA 4F55A 3FK7A 5GTIC 1V3FA 2VT3A 4XKCA 3K10A 3HM5A 5KAFC 5KNLA 2GXAA 3ML6A 1HW5A 2DMPA 4KIFA 4PSXA 1EJ9A 3V7RA 5FLXK 2X1DA 2LF7A 3JRDA 3HTUA 2R7TA 1SVOA 3OV8A 1MNDA 3ERMA 4I09A 1N78A 4NC8A 4XSZF 3KP6A 2XIGA 1OCRH 1TNSA 2XF5A 4K2EA 2R7UA 1QRYA 3K70C 3QU6A 3HOTA 4UUSA 3OSFA 2V26A 2O8XA 3KZYA 4KICA 4LFUA 4M3FA 2K9LA 4CCKA 2ZSHB 3VDXA 1R5GA 1K6OA 1U6GA 2EK5A 3J7AY 4U0YA 3DPUA 2H27A 2W82A 3TKYA 4MFDA 3LSMA 3O3KA 2VB6A 2VN2A 2M9HA 1FLIA 2OPTA 4DBRA 3PSFA 1FOWA 1TWGJ 2AXLA 5FD5A 5CVJA 1MBJA 3OYAA 3JRIA 2D45A 1R1TA 3K1MA 2RQQA 4HX4A 4MIMA 1GV2A 3BCBA 4L5EA 3E7LA 3ZCOA 1XMAA 1LFBA 4KISA 1I5ZA 1OYWA 3BJAA 4U7BA 5E18F 3I3LA 2NAZA 1R00A 1TNTA 2DO7A 2VT2A 5LRRA 2EZKA 2Y31A 3B6CA 4ZTFA 3J80K 2MABA 1P6RA 5K5OA 1SD6A 1PJRA 5JVGF 2RVCA 5J47A 3H36A 2QLZA 3BG3A 1HCRA 3E5UA 2XAGA 3CUQC 1O7FA 2IA2A 3DLLF 1OCOH 2KZGA 2YUSA 3DWLE 1LDKB 3U9GA 1TWCJ 3GFIA 4D5CA 2BBYA 4CZCA 1JTXA 3ABUA 4ENNA 3R4KA 4Y3OA 1IXSB 2Y69H 3H5NA 4NBQA 2PI0A 1AA7A 1LFUP 3DKYA 2E1CA 1XPXA 3LSPA 1TW3A 3BTJA 3WGIA 3KP4A 2MC4A 2QQ9A 4BEHB 2HQNA 5FLMJ 3WTSC 5DD4A 2MD5A 4I02A 2HPMA 3WTXC 1T33A 1GVDA 3BG9A 1Z0XA 2M0MA 4WWCA 2UZKA 3CO7C 3I55I 2IGNA 4B09A 3FBIB 4HX7A 3VODA 1IC8A 2UXNA 5J8CA 3DKXA 4KT6A 2UUZA 3TDUC 4D7NA 2FBHA 4HLXA 2NNNA 2R7FA 1T95A 3H92A 2OAZA 1Y6IA 2FMYA 2M3AA 5D5UB 2KRCA 4BQNA 2HYJA 3SYTA 3I54A 3WE3A 5FGMA 4KN4X 2XGEA 3HIFA 1WZ2A 4M9ZA 5FKKA 3IWZA 4XKWA 3ZQHA 1K4SA 2DQRA 4LMYA 2W84A 1XSXA 2OA4A 3ZGKA 2TDXA 1JJ6C 1DP7P 1V4RA 4XNFA 2IBDA 3K4CA 4LK0F 3E3VA 4XQFA 1IZ1A 4IEJA 3GEZA 2FJ1A 2CG4A 1D0YA 3VYSB 2FA5A 4HNUA 1XDSA 2A6TA 1A6QA 2CJJA 2LSOA 2HR3A 3G1MA 4QLCU 4R8HA 3VSKA 3OYCA 3BR5A 3IC7A 4E7IA 4PZJA 2PMZA 2ECBA 3CJNA 1WJEA 5FFXA 4A0XA 2DK5A 2V9PA 1QHGA 1S7EA 1V5GA 1EV7A 3DPTA 1SAUA 3F9KA 3SDGA 1O3RA 3GTKJ 2DMNA 3AG3H 2O3FA 1FWZA 2LC2A 1QPIA 3S17J 3OR1C 4O6JA 2HWVA 3LSJA 4RM3A 4S04A 1RZ4A 3QPHA 1HQCA 2A5WA 1VQ4I 4EQQA 3EUKL 2NNYA 3ZN1A 2VOPA 1JE8A 2RC4A 2X48A 2COBA 1YO5C 4RDUA 3HSEA 3LQRA 1LVAA 1J7KA 2HOEA 2R7XA 4F52A 5GAEJ 3IKTA 2FNPA 1S6LA 2EBIA 2XPWA 3GFJA 3L1PA 3CC2I 3JRGA 3GZ6A 1YIJI 4ENJA 1MNEA 3Q0WA 4YELA 3K2ZA 1ZLKA 3SEZA 4KN7X 3HOVJ 3TP0A 5H6RA 4B48A 3DTKA 5J4VA 3A0BC 3VEPA 2P5KA 2F48A 2BVMA 2OCEA 3QP6A 4IRHA 1U5TB 4A3KJ 3E5QA 5IYBJ 1MGTA 4ZJZA 1I27A 2HU9A 4IXAA 3M4OJ 5CVUA 3M7GA 3OWTA 4E7ZA 3O8GA 1DGRM 2E7WA 4F93B 5CQEA 1OFCX 2FOWA 3BR2A 4WXDA 2W7NA 1KYZA 1G4DA 3F8BA 3BR6A 3WE2A 1U78A 5J1RA 1YYVA 1Z9CA 2VQCA 2LRDA 2FQ4A 1JT0A 5BS6A 2IS6A 5CPRB 4YFKF 1IN6A 1FBQA 2Z99A 3NQOA 5GADJ 3G1OA 3KZZA 4N0BA 4BQQA 4XKVA 1BL0A 3KLNA 3OIQA 3OYFA 2BW3A 2HXOA 3PUFA 2R5ZA 1FJLA 2OQRA 2FD5A 4JOMA 2XPUA 3T5XA 3HGYA 4N4OB 5F27A 3DTEA 1SFXA 1G2HA 2CRGA 2E2JJ 5GPCA 3ECOA 3DCFA 4L5JA 3MKYB 4WF2A 1ETVA 3MWMA 4E70A 2HQRA 1X4PA 3KE2A 1KA8A 2M4KA 1SANA 3G3ZA 1U0JA 2NRAC 2LVSA 3C2GA 1FYKA 1U2WA 2OBPA 4XRMA 4HA8A 3R0AA 4PGHA 1T08B 3C1DA 1D5YA 5ICEA 4V19K 5GAHJ 1FBSA 3DTIA 6PAXA 2L02A 4M6XA 1ZELA 4RGSA 1W4MA 5L3DA 1VQ5I 1J9IA 1IRXA 2V7FA 2ZCWA 2BY3A 3P9KA 3G2BA 1KZHA 4HQEA 1OCTC 1XMXA 2E19A 3SZPA 4CO8A 1Z05A 4ZZLA 3CD6I 3CESA 4EV0A 3RPUD 1O3SA 1X1BA 5AONA 4UXNA 2HTJA 2R92J 4XLFA 1ZYRF 1OLTA 3WTVC 2AQFA 1UAAA 3E6MA 4D7MA 1BW6A 1IV8A 1IAWA 2Y0SN 4NUBA 4CCOA 3QPLA 4EJOA 5K7FA 4LLNA 3I9V2 2ACJA 2GLOA 2DQLA 4BXUA 2GOXB 4IZZA 1TBXA 5FD6A 1IXCA 2M8EA 5DCMB 3EPZA 1A04A 1YRNB 1CF7B 4C2MJ 1A36A 2MYSA 3ZMSA 2QYOA 4YEJA 2KT0A 1S5LC 4V2GA 3RKWA 4I01A 3RKYA 2F4MB 5TRDA 5IPAA 2GXGA 3EUHA 1B8IA 3FF5A 3OYEA 3TW7A 4OWRB 2VI6A 2WADA 2XAJA 5C3EJ 2H8RA 2FUG2 5IT9Z 2QBYA 3N97A 1TL8A 1BR2A 5J8FA 3FXJA 2BEOA 2LFBA 2C6YA 1VQNI 4AVPA 5IYDJ 2KJBA 3RIRA 2HS5A 5K5RA 3KP5A 2ZFUA 3HYIA 4HV6A 1Y8QB 4L9TA 3ZQGA 5D4RA 1Y0NA 1IGNA 3F3XA 4UVCA 4A2UA 4UNOA 3NWTA 3E6DA 4Q47A 2EFOA 3ZP5A 4FX4A 5K5QA 4CYDA 1ZK8A 1BN5A 1AKHA 1IF1A 2XROA 2XGCA 1FYLA 1GDTA 1XG1A 4HPQA 4IX7A 4A6EA 2ZJQF 2EWNA 1I1GA 4RAYA 3WG9A 3S15J 1YW9A 2IGOA 3HC7A 5IOZA 1MBGA 2E1MB 4HEA2 2JA5J 2V1UA 3ZPLA 1ZH5A 4XORA 1XGMA 1YOVB 2GIVA 3NWSA 1YJ9I 1R5HA 1UFMA 2LNBA 5CVRA 3ULQB 4AWXB 3JTGA 1ORKA 3LSIA 2GOMA 3SFIA 1CGPA 4R79A 3IWFA 4A3JJ 1BW5A 3QODA 2R0QC 1OISA 1ACIA 4AM3A 1VQMI 4DNCA 1FT9A 2K7LA 2QENA 3RPUA 3IH3A 3J81Z 2DYSH 1T0FA 1GV5A 2LY2A 3HGGA 1JI8A 1RR7A 4FASD 2PJRB 1UHWA 2E5ZA 3JRHA 4MO7A 3OMYA 1YFHA 5GAGJ 3F22A 2ELHA 1XCBA 4G6DA 1FTTA 1G59A 1LE8A 2QWWA 4ZYHA 2ZB9A 3ZXSA 3H0DA 1WVRA 3CCEI 2KRHA 4EJTA 1Y8RB 3KP2A 3K70D 1Q1VA 2QGUA 3UNGC 4JX4A 1KYWA 2XKOA 3LA3A 2L3DA 2DFHA 3HSRA 1YS6A 4B3AA 2DODA 3SDBA 1SMYF 4ZTJA 1FOXA 4HW0A 1W5TA 1HSTA 2RV8A 1KU9A 2FRHA 1R1UA 5HDGA 5M5XJ 2WB1N 1XS9A 2H94A 3QOPA 3BR1A 4BACA 3LFUA 2NVQJ 3L00A 4PJLA 2X1EA 3PNYA 5CLSA 4RB2C 2ZXJA 5FKMA 5IT9K 2K9MA 4UUSB 2DT6A 4HF1A 1OR7C 1TZLA 2VKEA 3OYNA 3K4NA 1KQ0A 1AU7A 5F64A 2R7RA 3VB2A 1ZG1A 1G3SA 4KT5C 4GCVA 4C2UA 1K79A 3IH2A 1I3QJ 3WU1B 2PEXA 1UELB 2HGCA 2MG4A 4P9UA 2B9SA 4IHYA 3FMSA 4DYQA 1WJCA 3A0HC 1ODDA 5HS9A 3Q0UA 2BY1A 3HKZA 3BG7A 2JVHA 3VSLA 2ZJRF 2L9RA 1N25A 4NC7A 1J59A 4E7JA 3LAJA 2ZNZA 1Y56A 4YRVA 3BDDA 1T38A 3FKIJ 2M30A 1QBJA 3ROUA 3ASOH 4EATA 3GLXA 1J5YA 2LMDA 1V5FA 1KONA 4RAZA 3RDIA 2DTZA 4M6YA 1KU3A 4ENKA 3LNQA 2PX9A 2EA2A 2WC2A 4XOTA 2QA4I 1FY7A 4KA4A 2ZJ2A 2JPBA 3AL0B 1R6RA 3AFHA 1WGXA 3HZJA 3ZMZA 4UV8A 1NTCA 3D1NI 2E2HJ 1D8KA 4XL9A 3W3CA 4E6KG 2R7WA 2IVMA 1XN7A 3F21A 3J81K 1VFCA 4KIBA 1N75A 4LIUA 5F0FA 5DDGA 2EZHA 5AIQA 1G3TA 1ZAOA 3GCMA 1LDJA 1K6YA 2M7BA 1OCZH 3D5SC 5HVQC 4A3BJ 1HDPA 4IHWA 3W6VA 3OIOA 3T8RA 2OUMA 2WY7Q 2ZNYA 2JUGA 2NVYJ 3E1SA 4XLHA 4XRSA 3RKXA 3L2WA 2EZLA 3RQ4A 3A1YA 2M2EA 4BU2A 3F23A 3B73A 1VQPI 1U8RA 3R0JA 4DQ2A 4BBSJ 1WJBA 2Q0OA 2CO5A 3JAMZ 1TQMA 1W5SA 3KPHA 2NS0A 1B72A 3QQAA 1U5TC 4A3FJ 1XSVA 1XGNA 2CUJA 1J09A 2LDUA 2M4GA 2H1KA 2IS1A 3RJPA 3FM5A 3BR0A 5E3NA 2MH9A 2OF7A 3Q9VA 2ZMEA 3HDDA 2L7MP 4PJJA 4TV7A 1WH7A 3GXOA 3K4JA 5CQGA 3PIOF 1S7OA 2XSJC 3DQVC 4MHGA 3OIPA 3W2VA 1JT6A 1W7PA 4BUPA 4IOCF 4DOZA 1F36A 3IAM2 1ERDA 2L9NA 3BT9A 5EZGA 4BDZA 4G7HF 1DDNA 1FP1D 1FP2A 3QOEA 3CUQA 2A07F 3V4GA 2FEZA 4S05A 1Y0UA 2VASA 5LHIA 4JYKA 1R22A 2ZC2A 2X51A 3J7YJ 2K02A 2NYXA 4ESBA 5DV5A 4EGZA 3D0SA 1F43A 3FXMA 3KLOA 4IOAF 3F8FA 3CDIA 1IRZA 2IXSA 1YJNI 3FM3A 2JUCA 4BH9A 2HPIA 1WKMA 3M1CA 5H2FC 3G73A 3CO6C 3IRRA 4JBAA 3F6VA 2K4BA 5DEQA 2LH9A 1V55H 3M8EA 2VKHA 3I0TA 2H09A 4M3EA 1R71A 1V5EA 2IGMA 1E2XA 4RLQA 5D8KB 2W57A 1YX3A 1EH6A 1LFPA 3OYIA 1QPMA 4B1RA 2P7CB 2B7EA 5LGUA 3U1DA 4OAZA 4ESJA 5L3EA 1D3YA 3GUDA 1HW2A 1XB4A 1K78B 2F5DA 2X6OA 3KEYA 2CUFA 2DT5A 3M8FA 4Z6YA 3BQZA 1WJFA 1Z77A 4ASNA 2QM3A 3BG5A 2MH2A 2DTRA 3GTMJ 2HEOA 3Q9SA 1J0RA 2F5EA 1FX7A 3CLOA 3TW6A 4HRIA 3L2UA 4CXFA 5EEGA 2PG4A 4F7ZA 1LB2A 1OMIA 2KL4A 2E36A 2F5FA 4L5IA 1I1SA 5KAIC 2DMTA 2PN6A 2Z1DA 2Q2EA 2F4OB 2VIXA 1QNTA 4AIHA 3JAMK 2F6CA 4HG2A 4EJVA 1GUUA 2JN6A 5HLGA 2B63J 2BW3B 2YX7A 3U21A 4OAYA 5BNGA 1AHDP 1O7LA 4XLCA 2R5ZB 3COAC 4GFBA 4ZH4F 1VZ0A 3ABLH 2EV0A 2DCEA 3LSKA 5EF6A 4EM0B 2GA1A 4HSRA 2P5LC 3HOYJ 3OY9A 2M5WA 3L9FA 4PJMA 1VQ6I 3VFZA 2NOGA 4L18B 2L9SA 2TCTA 5JHUA 2W48A 2QCOA 2JVGA 3H3VK 4GO1A 4PDKA 3BQYA 4A0YA 2FX0A 3BZKA 2IA1A 2JA8J 4BQOA 2CS3A 3HJEA 2ESHA 3DKWA 3F0CA 2QSHX 3QPSA 3I58A 2KIFA 1HSJA 1A5JA 4QWQA 3L2RA 1RRJA 5ICGA 1MSEC 1XTAA 3BTLA 3JTHA 2HYGD 2XGXA 5B66C 2A3SA 3C18A 3HHGA 3TMOA 3ZMVA 3N4MA 5K7ZA 3H5AA 2PLYA 1D8JA 4OMZA 2QQAA 3SZGA 5GPAA 4MTDA 1W1WE 1P7JA 2HVSA 1MIJA 2YPRA 2KHMA 3GZ5A 4LJZF 1D0XA 2JA6J 2CQKA 4B44A 3CMYA 3MVPA 1Q1HA 2M7AA 4IO9F 2DPDA 1T39A 2CV2A 1ZHFA 2YX4A 4X6AJ 4OU0A 1I50J 4I0AA 3O6BB 3R60A 4OIPF 2XF7A 1WH5A 4AIKA 1ETOA 1MZBA 1RNLA 4J00A 4II2A 9ANTA 1Z1DA 4IHSA 4GRIA 1Y1WJ 4AU7A 4FTHA 2R5YB 2LKPA 2PFBA 2ME6A 3HB9A 4HX8A 2HQAA 2KIUA 2QKLB 4XM3A 1ZTRA 1ZGJA 1REPC 4KMFA 2JZYA 4HLYA 1UZCA 2W85A 1MW7A 2XKPA 2VBZA 1PP7U 3ABTA 2QBYB 2OZ6A 2VJJA 2M0CA 1KQ9A 2CSOA 3PFIA 4DGWB 5LFAA 3GWZA 2QKMB 2GIZA 3KZIC 2AHQA 3HTSB 4G9YA 3JRAA 4M71A 3A01A 1APLC 1E3PA 4O3MA 4OIQF 3BOQA 4L9VA 4IHTA 4XOPA 2IW5A 3G6EI 1V54H 2P5VA 4M72A 3CMAI 2LOOA 1B9MA 1D1BA 2RKHA 2RNJA 1FNNA 1AKHB 3U2RA 1UB9A 1Z6RA 1G6NA 2HXIA 3GF2A 3PQKA 4F91B 3HL2A 2ESNA 2V9KA 2K9QA 1YI2I 2CQXA 1JHFA 5FB2A 4A3CJ 2YSRA 2PMZN 3H9QA 4HNVA 2AXTC 1WFXA 3K1NA 1FOKA 1ETWA 3K9TA 3TDZC 1TWHJ 5ILVA 2L0KA 1I39A 4M9SA 2LTPA 1WJ5A 1KQ8A 2JA2A 4CICA 1X1CA 1X3WB 3DF8A 3TL4X 2E1OA 2W25A 4NB5A 3HOWJ 4CGZA 5BPDA 2L7KA 3S32A 2KQRA 1TT5B 2EFPA 3E0JB 1S7AA 3DFGA 5B1AH 3MKWB 1WJDA 1G3YA 4A0ZA 1MMDA 5CKTA 4WX9A 1UG0A 3MQ0A 2IS4A 1O4XA 2CQ7A 5IP7J 1HBXG 2ME0A 3JR9A 2OJED 4HF0A 1ONVA 1SAXA 1HC8A 3N05A 2IEKA 3IRQA 4IJAA 1IN7A 4P5OA 5ERIA 3CCSI 1B9NA 3AL0C 2CFXA 2CW7A 1ENHA 4A5NA 1IRFA 1FZPB 1FSHA 2BY2A 3ELKA 3ABKH 4QPOA 5JVTA 5IT3A 3EYYA 3K0LA 4DYRA 1UHSA 2XC7A 2LY1A 5JR3A 2JPCA 3OYHA 2MA3A 4U0WA 4PGGA 1MJBA 2L54A 2V79A 4BNCA 1LVKA 2L5QA 3S3OA 1MJAA 2LKSA 2AO9A 3DP7A 5E3MA 4AIJA 1JTYA 4BAYA 1FSEA 1MD0A 4CCLA 3S8PA 3CDLA 4W1UA 2KISA 2O5RA 2YS9A 2XRLA 5DUKA 3TO6A 4H0EA 3QAHA 4XLEA 5H6QA 2L7FP 3V7SA 1VQ8I 1NHAA 2M8GX 4B4CA 4E7KA 3DBHB 3DBLB 3MEXA 2R7OA 1ZRFA 3DEUA 1ETQA 3IUOA 1MDMA 2JA7J 3ZRGA 3DBRB 3SZTA 2DJIA 4ZDLA 2HDWA 2ZO4A 3CCRI 1U8BA 3RZOJ 1HOMA 1O57A 3HSFA 3OYDA 2V6CA 2HZDA 3TOAA 4EGYA 1F1ZA 1B59A 2EFWA 1I3AA 3TGNA 2VLAA 1BC8C 5FO5A 1WCMJ 4G7OF 1ITYA 1X3UA 3V42A 5HODA 1SFOJ 4XR6A 4Y15A 4RB3C 4OIOF 5F1RA 4RA2A 2W24A 4Y17A 1QQIA 2Z16A 3RKQA 5KHDA 1BOBA 1KGSA 1PP8F 3GTPJ 3KP3A 4NDLA 3OR2C 3S2WA 5LBQA 3WHCA 1GXPA 2KZVA 2EIJH 1SMTA 4E7HA 3GTGJ 4BXXJ 3WTZA 2NS8A 3FXQA 2XGDA 2Y0SA 5H20A 1WI3A 1UJ8A 4JP0A 2HDDA 2WAQN 2MC3A 4ON0A 1MKMA 4XRSG 3WTWC 1W0TA 4M3DA 2QQBA 1HKTA 1Z3XA 1OR7A 5GP9A 3BPVA 4Q4ZF 2WBMA 3JRBA 2BZTA 4CYCA 4BY7J 2IGKA 2K27A 1YHQI 3OL3A 5IY5H 3M1EA 3VYRB 1CQTA 1R5ID 3CP2A 2D2WA 4BE0A 4R1HA 4A3DJ 3SXYA 3ERED 5EG0B 1E17A 2WV1A 4PUSA 3KP7A 3OS1A 2ID6A 1B72B 3SFZA 3REOA 1IN5A 4RM2A 2IRFG 3MZHA 3HXLA 3IP4B 2Y48A 1BIAA 5FJ8J 3TQNA 2KIMA 3H9JA 4HQMA 2LBFA 2ZMEB 3MMYB 2BGCA 1ZR2A 5B5EC 2CGPA 2OTJI 2MD0A 1P9QC 1FOYA 1RESA 3PL8A 3G1LA 4LITA 4DZJA 5J3LA 1W7PB 3M07A 3CJTB 2K4JA 1RKWA 2F5VA 3S16J 3RYRA 4BHPA 1H89C 3CUQB 3OYBA 3F6OA 2VQHA 4I7HA 3QWLA 2NS7A 3FXUA 5C4XJ 2COMA 2W00A 4M6VA 5TGTA 1HA8A 1Z7LA 3X2QH 3FKJA 1YW8A 2WV0A 2CH0A 3LSRA 1LKXA 3TEDA 2PJPA 3IHUA 3C3WA 2XB5A 2EFNA 4KYWA 4XSXF 4GYIA 4L9JA 1JHHA 3S2HJ 1XD7A 3I4MJ 3HOZJ 3K1PA 1QZYA 1NH3A 1STZA 1VI0A 4RAFA 1Z7UA 3ASNH 1L3LA 3CC4I 1B4AA 1BA5A 2P8TA 1ZRCA 2EQRA 2DBBA 3H35A 2BXYA 5LHHA 2A6EF 3ZR8X 5E1WA 5F08A 1TTYA 5IP6A 3CCMI 3BR3A 4MQVA 2VC1A 3JRFA 1B1BA 4UB8C 2NVTJ 5L3BA 4AC0A 2R93J 3JSPA 1G8XA 3FBNB 4IL6C 3S93A 2X85A 2A6HF 4CDGA 3I59A 1K7AA 4B43A 1MMSA 1ZG3A 3WTTC 5E3OA 4UVAA 3FXKA 2MFZA 2WB1A 2D1VA 1T56A 5F0CA 1ZRDA 3ZMTA 4A3LJ 4G12A 2HOAA 2Q2EB 2JRMA 1MMAA 2JRTA 4X0GA 1IJWC 4LK1F 2VJ5A 3JSOA 4MLOA 2DI3A 1ZARA 3K4LA 3CUOA 4Z2YA 3WODF 1NG6A 4LOCA 5DD8A 3OS0A 2MBFA 4I98B 4CZZA 2OCCH 5B3SH 3WTYC 2IS2A 2YU3A 2E71A 2KKOA 2XV4S 4HF2A 5J6XA 3WGGA 2QSFX 2VKVA 1XGOA 1Z91A 2R3SA 3WU2C 1QU3A 5E20A 1DP3A 4RMNA 2BE5F 3I5UA 2VE9A 1FTZA 3L2VA 1T2KA 1DGWY 3T0YA 4I99C 4WXCA 3W6JB 3PJRA 4FISA 1D0ZA 1X58A 4M3BA 1R4NB 4YFXF 4MEYF 4G8XA 2HKOA 4AVZA 4GYGA 3RQIA 3ZQIA 4FE4A 4YFNF 5JLWA 5BQTA 4LG0A 2KIQA 4RS8A 1P4XA 4OOIA 3BLYA 2M34A 3L2CA 2CUEA 4RAGA 1IRGA 3DXJF 2QVOA 4CA0A 4HAMA 1LQ1A 1H9TA 1BR4A 2HOSA 2STWA 1PUEE 5KCMA 2QZ8A 2V1NA 2EV6A 1LPQA 4KJZA 2EILH 2FF4A 1W36C 1N77A 3FK6A 3ABMH 3S1NJ 3GVAA 1IDYA 4XN3A 4OIRF 5LEKA 1R23A 4GDFA 2VC0A 3CCJI 3B6AA 1MH3A 3BZ6A 3A03A 5CVIA 4N4NB 3RZDJ 1VQKI 1WPKA 1QVTA 1FIPA 2PBIA 3HEFA 4BJ6C 1D1AA 4CUGA 1F9NA 4V2FA 3WG7H 4WCGA 1FC3A 1W5CC 4EEFG 4IQJA 1XCVA 1ZGAA 5GTHC 3QRFF 1F4KA 1NK2P 1MNMC 3K4KA 1ZREA 5FKNA 3AG2H 4BGDA 2NVXJ 2IAIA 2DA1A 1QZEA 4IHVA 4XKBA 4JX5A 4QSHA 4F92B 1SC7A 4M9XA 1X19A 3IKVA 5FLXZ 2HDCA 1JUPA 3T8TA 2ZXIA 2XVCA 3QU3A 2DOFA 1W0UA 2K3PA 4HV5A 5K7HA 2A68F 3S1MJ 5ICCA 2V9VA 2ICWG 5J1YA 3OS2A 2QSGX 1P4WA 3CMMA 5F0HA 2BHZA 3HOXJ 1FBUA 3KX2A 1MBEA 2PMHA 4BBRJ 5ED4A 4ETSA 3GTQJ 2CV0A 5HNHA 4EJUA 2A61A 4AYBN 1R1VA 2UV1A 2DA4A 2VXZA 3TOBA 4D1QA 4C3JJ 4O5VA 3A01B 4P1WA 1JKRC 2XASA 3OYJA 1QO0D 3DLAA 4G94A 1OJLA 5F04A 2WWYA 2DFEA 3QPTA 4A12A 1VF9A 1TT0A 3KCCA 2JSPA 2VPRA 3NARA 2K85A 2OQGA 3D5RC 3SJMA 1SFEA 2PMUA 3P9CA 2EFQA 3LA7A 1O3TA 2ELJA 2Y2ZA 4YG2F 1HKQA 4A69C 2EB7A 1YG2A 3CDHA 1FEXA 2JT1A 4Y4RA 1TWFJ 2CV1A 3JRCA 1RIOH 3J80Z 1K4TA 1TC3C 2LLKA 2LY9A 5E1ZB 1UCRA 2H6CA 3F8MA 5C4JJ 3TO9A 3F72A 2Z5UA 4ZYEA 3AG1H 2IT0A 2P0WA 2FBIA 1HW1A 1ZG5A 2DK8A 1I6HJ 1X2MA 1XX5A 2OV7A 3MKLA 1R9TJ 4U88A 2G9WA 4KIGA 2Y30A 3BY6A 2MSYA 1SFKA 3HPHA 2XAUA 1PYVA 1USTA 5F6FA 1DU0A 1WI9A 3I64A 1SVLA 4PSWA 4NHJA 1VQLI 5J1UA 3A4CA 1H0MA 5M5YJ 1OQYA 4XLPF 3BG6A 4A3IJ 1LUJB 5ICFA 2JWTA 1IUYA 1H88C 2R7SA 4IHXA 2AS5F 1DPRA 5BPIA 2IA0A 4UHTA 2X4HA 4DJAA 2UXXA 2DU9A 4BJ5C 1VQ9I 3GTOJ 2BHYA 1ZLJA 1R58A 4ZYDA 1WHUA 3HBLA 2NOJB 2HYFA 5E8GA 2LK2A 1HLVA 3NRVA 1QHHD 2QUFA 2XF6A 4FETA 2JQ7A 3GLLA 2E7XA 2QEXI 2GWRA 3BTCA 4BXFA 3S1QJ 2GQQA 2RAEA 4E4HA 3HOUJ 1GHCA 1OCCH 2WAEA 3PM1A 3AKZA 4G6TB 4Q5SF 3KYCB 1ON2A 5CYVA 3GZNB 5D6FA 3DU6A 4AUXA 3O2PE 1HDDC 4Y13A 4WK8F 3EUAA 2Z2SB 2VL8A 4AD9A 2ZXWH 4NQWA 1IN4A 4B8XA 2DPUA 2X0LA 1P7IA 1ULYA 4RLFA 3I71A 2DDBA 4HBLA 3ZQQA 3S14J 1X2NA 3ZMUA 4BE2A 1R36A 3WTUC 3DPLC 4C9YA 4DBQA 1MDMB 3JCUC 1MBFA 1RUNA 3BJ6A 2FE3A 3IH4A 1MH4A 2VBXA 2ZMEC 2BVLA 2Y9ZA 4PCQA 1GT0C 3HUGA 3FWEA 1TP4A 3RSNA 1Y1VJ 4UB6C 3PNVA 2VUMJ 2H6BA 2Z3YA 1RC9A 3A02A 5E8IA 4PK4A 2MW8A 4KUMA 3GX4X 2CQNA 1LNWA 4DW6A 1JJ8C 2E1MC 3SHFA 3VOEA 1JKOC 1U3EM 2VQGA 3EQLF 1TQPA 4ENMA 4FQGA 1IUFA 4U7DA 1K61A 3E97A 3LA2A 2F5CA 3MN2A 3IL2A 2EIMH 4DYCA 3KEQA 1RI7A 4P55A 4XRFA 5FROA 2HKXA 3MZ8A 2ZJPF 2QF7A 4HYEA 3WU0A 3HRTA 3CCVI 1PUFA 4MEXF 2WTEA 4FT8A 4ZC3A 3I53A 4XLAA 3PNTA 1Z21A 3KETA 1OPCA 1A35A 5LLQA 3LAPA 1R4MB 3FMRA 1B8IB 4CYCB 3GMEA 3EDPA 4GXOA 4JX6A 5DM7F 4ANJA 1OCPA 2XDVA 2DOEA 4H4KC 4J19A 5LRSA 1P2FA 2O03A 3BROA 2IP2A 2DOAA 3KIOA 1YJWI 3FHZA 4UY8I 3LL7A 1BI3A 4LB6B 1JXSA 5FFZA 3RTRA 4B3XA 3NAUA 3K4BA 4LG3A 1BI2A 5EGOA 4BL0B 3G4SI 4A5MA 3ECHA 2HFHA 1ZR4A 3NEUA 1TW2A 2NXNB 2X6YA 1DU6A 1D5VA 3LWFA 1YX5A 2LBFB 2OTLI 2ELKA 3BZCA 5D5XB 1B6AA 4HNTA 5A2QZ 3RCOA 3L2QA 4MFEA 2UWMA 5B1BH 3FIWA 2V4JC 1JKPC 2EIKH 4CHUA 3QYFA 1GXQA 5J4YA 3LSGA 4BHBA 2KRFA 1EH8A 3GW2A 4DIQA 2GM4A 2HVRA 5DYMA 2HVQA 3MAJA 4M74A 2OD5A 2DW4A 3GFLA 5LHGA 3HHHA 4BY1J 3H3ZA 3L7WA 2WAFA 4ZZDA 5DTDA 2XRNA 5IOYA 2Y75A 4L0YB 4GGGA 4QIWN 4OINF 2O7OA 2XPVA 2MLKA 4XK4A 3S3NA 1IG7A 2HZTA 4RGRA 2ISYA 1X1PA 3CF2A 3CP8A 2FBKA 2ZKZA 3R61A 4II3A 4S0HB 2BV6A 4PFOA 4P9FA 4ITVA 1WSUA 1VQ7I 3PO2J 4RB1A 2EV5A 3G71I 1RPWA 1ZN2A 3E6BA 5EZHA 1IXRC 5CVVA 3P9IA 1VNDA 3CQZJ 1E0EA 2O61A 3FX3A 2X6WA 4NC6A 3HRSA 2CYYA 3EETA 3K4MA 4MGRA 3CMEI 4Y7NJ 1LE8B 2RQPA 3LSTA 1T6SA 2HTSA 3GO5A 4UUTA 2P4WA 2AQEA 2D1HA 3QYEA 3ZMDA 1LEAA 4J01A 2FMLA 2XAFA 4XBFA 1HKSA 3GYHX 1ZGWA 3GFMA 2Z9OA 5FRMA 3MCZA 3S1RJ 3HG9A 2G7UA 1FIAA 2BYVE 3LFKA 5E79C 2EJRA 1K78A 3CZ6A 1FYMA 1SD4A 1BI0A 2M1BA 4U0VA 2DAOA 1DUXC 4C3HJ 2RN7A 1ZKGA 3ZN0A 4KITB 3C2HA 2P6SA 3I59B 3PSIA 2R4GA 1J2XA 2IJLA 2KFDA 2ISZA 2DMQA 3I4PA 5EJCA 4F3QA 2OZUA 1C0WA 3C7JA 3U1KA 3PO3J 4PJNA 2MGQA 3GTLJ 1SVMA 5HOOA 1ETXA 4G7ZF 2R7ZJ 1MJ9A 4C3IJ 1ZQ3P 2FSWA 4EM1A 1SEUA 4RGXA 3H9GA 3W2WA 2VE8A 2JK3A 2CQQA 3VPRA 5M3MJ 3OYMA 5ILUA 4KMUX 4YIRX 4ESFA 4EM2A 5A2QK 2I5UA 1SD7A 1A6IA 2H1LA 2KDOA 1KU7A 4B47A 5BOXA 4WXHA 5LD2C 2EPFA 3SQNA 2KPMA 2KDZA 4IF4A 2BOLA 5LGTA 4Y52J 2IPQX 2BXZA 2OU2A 5D4SA 4C2TA 1YQAA 2J5PA 4UVBA 2CU7A 3CF5F 2O0YA 1ETYA 4DZPA 1W36D 2OC6A 2DA3A 4IQ4A 1FMVA 2DA2A 5EDNA 1XC5A 4CCMA 2A5YB 5L3FA 1QZZA 3V8LA 4IRIA 4EMSA 3MFKA 4LG0B 1SD5A 1O3QA 1P92A 5ILSA 2JJ7A 1U9OA 4BDYA 2D5VA 1BI1A 2DFFA 4MNUA 3TBIA 2DA5A 2RDPA 3BWGA 2WA0A 3LOCA 4BS9A 4UV9A 5EYRA 3CLQA 3SEQA 2VXDA 2O8KA 1S29A 4L0ZB 4OMYA 3BPXA 1XSDA 2VPLA 4MTEA 3RYPA 2K9NA 4BEHA 2VOOA 1GLNA 3I56I 2VQLA 4LB5A 2RGVA 3B02A 4X1EA 1Z6TA 4KNYA 1X1AA 2WAQA 3KFWX 3VYUB 3UKGA 1AOYA 1RETA 4LLLA 2KLOA 5IP9J 2Z33A 4JK1X 1UHMA 3QYBA 2LKXA 1OYYA 1H9GA 1JGSA 2W1OA 3MZYA 3JREA 2DT7B 2V6EA 5AIPA 3F8NA 2R5YA 2KJCA 1QGPA 3ZQFA 2STTA 1H8AC 3BCAA 4M3GA 1A31A 2A69F 5C44J 3CJQB 2VBWA 4BHCA 5KK1A 4ZDPA 1BR1A 1JGGA 3R6SA 2GA2A 2XHKA 4LIVA 2G7HA 5EEHA 5LEJA 1ETKA 2DA7A 2DLLA 5M3FJ 2VKDA 4PJ0C 2ETHA 3FISA 2RREA 2LD5A 3CCUI 3DV8A 3HRUA 2X1CA 4A3MJ 4BE1A 2V1DA 1BM9A 5L3CA 3J7AO 1D1CA 2GAUA 1PDNC 3EYIA 5EEAA 2I10A 3PFYA 2L2OA 1L0OC 2XAQA 4HDVA 3S3MA 2P6TA 1FPQA 2R7VA 5LGNA 3C2BA 1S8NA 2JSCA 1WWXA 2FOKA 3H3UA 4Q48A 3KYLA 2FNAA 5KVRA 2R7DA 2CW0F 3BC8A 1R49A 1F5TA 3OOPA 2DFIA 2L4MA 3RPQA 4BJTA 1JUSA 2V1XA 4NNJA 4BYYA 2ID3A 3OYLA 5D5WB 2ZSIB 1JUMA 3CJRB 2ZBKA 2LREA 3HOSA 4FHTA 4RGUA 3OL4A 3ZQLA 3AAFA 5F1JA 4FCYA 2HNHA 5JHFA 5HNFA 3K2AA 4LLGF 3GTJJ 5DS9A 1J75A 3MD2A 5L3GA 3FZVA 2JTVA 3CCYA 3ZOBA 4HSTA 1YW7A 2Q8KA 2LYCA 5JFRA 1YS7A 3KYDB 4EVIA 3HRMA 1HF0A 4I0BA 2N8GA 3IAS2 4KFCA 4I2OA 3L09A 2R7QA 4HZFA 2K5CA 5JI6A 1U5TA 2VJ4A 2L7ZA 4G6QA 1NG7A 4IKFA 2GZWA 1RR8C 1E3OC 5M5WJ 2K9SA 3T1BA 1UG2A 2F2EA 2DYRH 3OSGA 5D5VB 1VQOI 5HS8A 2EZIA 2VBYA 3TO7A 2L9VA 3FXLA 3OYKA 4XLNF 1RKTA 1EF4A 2HI3A 2Y0MA 1S72I 1XDUA 2XAHA 4E7SA 2E60A 3GBGA 4M73A 5K1YA 3BP8A 4CH7A 2DXIA 4XIDA 1Z67A 2KMUA 3PIPF 2ZXHA 3BTIA 3CCLI 1OKRA 2CMPA 5BMZA 2YR2A 2XUBA 3P7NA 4C30A 1OYIA 2RNGA 2WY8Q 4L9NA 4A6DA 3M8JA 4IPAA 2ZFWA 1EA3A 1BJAA 3E5XA 4Y33A 3DEWA 3EUHC 1MBKA 2BY0A 5J40A 2K40A 3CTAA 1EKEA 2GBYA 1YE9A 2XSDC 4I76A 3HKZN 1U9NA 1BBYA 3V8KA 3RI4A 2G0EA 5TISC 3P5JA 3H5RA 2FXAA 2TRTA 5E3LA 4NQWB 4BKXA 4E7LA 1TQIA 3DEEA 3FMQA 1XMKA 2E34A 3A2KA 2GXBA 2DMUA 2HQ5A 2X9DA 1W7PD 5HDKA 3OYGA 4ZYGA 4QTRA 2YU9J 3MKZA 4U87A 1S9HA 3DU5A 2EINH 3WHBA 1IW7F 1TLHB 5E1XA 5FRNA 4KDPA 5TJJA 3VWBA 1QVUA 3ISPA 1DQUA 3LQQA 1DPUA 3S2DJ 2X6XA 4EJWA 4ZDOA 3K69A 4YIIA 4IVNA 3HUGB 2VJIA 4CCJA 3FXOA 1USSA 1WRJA 3QP5A 1XGSA 2F4IA 2E1NA 2M45A 3PQJA 3ZQ7A 2B0LA 2A05A 1YIOA 2P7VB 3ONQA 1RUOA 1MMGA 2O6GE 3PUBA 5JLXA 2LG4A 2CFOA 4HOBA 1YTYA 3FXRA 4IRGA 4N9HA 2MLGA 1R7JA 1KU2A 3K6GA 4P96A 1TWAJ 1MMNA 3J7ZI 3F8CA 4D9JA 4I6ZA 4A3EJ 5D8LB 2ADUA 1BC7C 3KEOA 2FU4A 1WQ2A 5IYCJ 1X1DA 3LMMA 2E2IJ 4YIFA 3H0GJ 2LF8A 1YLFA 5HLHA 3W2AA 3FDYA 4LD5A 4D0PA 2K3FA 3IV5A 5DCMA 2L01A 1PUFB 1YRNA 1CF7A 1JKQC 3I4NJ 1IDZA 1T0FC 1QA6A 5D6EA 3M3YJ 3H1CA 2LP0A 5HLTA 1LEBA 2CWEA 4MQ9F 4FE7A 3VYTB 4XONA 3HPGA 1T98A 3JW4A 4RB0A 2CUZA 1BIBA 1POGA 3O8HA 3AG4H 1GVJA 4ABZA 2Q1ZB 4QPQA 5FLVA 3Q0VA 4A93J 3K7AJ 2PQ8A 3WGHA 1SFUA 3CCQI 2O9LA 1AWCA 4D5FA 4FX0A 5FKOA 1VTNC 1EH7A 1IN8A 3M9AA 5EG0A 1ON1A 1P4AA 5EGOB 1WJAA 3D5LA 1NK3P 2QQ8A 1Y39A 2Y9YA 4ZYAA 4PFPA 1IO2A 4AYBA 4CCNA 1K83J 2I8DA 2H8WA 2JMWA 3OOUA 2P81A 3W6KB 4HDUA 3BJOA 3E6CC 3ZQCA 2CW8A 3ESWB 1MSFC 1BOAA 1HXDA 1LJ9A 2K86A 2E5NA 2LR8A 5E17F 2VONA 2E35A 3TP3A 3V8JA 1IV6A 4LGWA 5HLIA 1S3JA 5DUIA 3CC7I 2ECCA
chains in the Genus database with same CATH topology
4ZTJA 3UR3C 3OYDA 4ANJA 1X4OA 2XDVA 4H4KC 2HZDA 2DOAA 3LL7A 4JQFA 4BACA 3LFUA 4PJLA 4CSWA 2KP6A 2X1EA 3PNYA 3RTRA 3K4BA 4LG3A 4B3XA 2VLAA 3FHNA 2K9MA 3V42A 2DT6A 4BL0B 1OR7C 1TZLA 4XR6A 3OYNA 3K4NA 2X6YA 4XMYA 2R7RA 2PJRA 2Z16A 5KHDA 1BOBA 4C2UA 1YX5A 2LBFB 2W4SA 1UELB 3OR2C 3L2QA 4HNTA 3RCOA 1FMWA 3LSHA 2UWMA 2KZVA 4XN0A 4E7HA 2V4JC 1WJCA 2Y0SA 3QYFA 3HKZA 3BG7A 2JVHA 3LSGA 3VSLA 1Z3YA 4DIQA 4F55A 2HVRA 4NC7A 2HVQA 4E7JA 4XKCA 3K10A 1Y56A 5KNLA 1Z3XA 4YRVA 2WAFA 4PSXA 4EATA 2WBMA 2X1DA 2IGKA 1V5FA 1KONA 2R7TA 3OL3A 3S3NA 1MNDA 3VYRB 1N78A 3CP2A 4NC8A 4BE0A 3CF2A 3CP8A 4II3A 4XOTA 2XF5A 2R7UA 4PUSA 4PFOA 4ITVA 3K70C 3OS1A 3AL0B 3HOTA 1R6RA 2V26A 3AFHA 4RM2A 2K9LA 3HXLA 3IP4B 4CCKA 2ZSHB 3VDXA 4XL9A 3W3CA 4E6KG 2R7WA 1E0EA 3J7AY 3DPUA 2X6WA 3H9JA 2LBFA 2W82A 3MMYB 3LSMA 2VB6A 3K4MA 1N75A 2MD0A 1P9QC 4LIUA 4DBRA 3PSFA 2AQEA 3OYAA 3PL8A 3QYEA 4LITA 1K6YA 4J01A 2M7BA 2RQQA 3D5SC 3BCBA 5HVQC 2F5VA 3ZCOA 5FRMA 4KISA 3HG9A 4U7BA 3OYBA 3I3LA 2VQHA 2OUMA 2WY7Q 3CZ6A 1HA8A 2JUGA 2W00A 5TGTA 1Z7LA 3E1SA 3FKJA 2CH0A 4XLHA 4ZTFA 1LKXA 3L2WA 2MABA 3RQ4A 4KITB 3A1YA 1PJRA 4BU2A 3C2HA 3PSIA 2R4GA 1WJBA 4F3QA 3DWLE 1LDKB 4PJNA 2CUJA 2M4GA 1J09A 4CZCA 5HOOA 2IS1A 4Y3OA 3H9GA 3H5NA 4PJJA 3W2WA 1AA7A 3DKYA 3K4JA 5CQGA 3OYMA 3H35A 2XSJC 3DQVC 3W2VA 3OIPA 4BUPA 3ZR8X 2KDOA 4DOZA 2MC4A 4B47A 4BEHB 3IAM2 5LD2C 1ERDA 2L9NA 4BDZA 2KPMA 3QOEA 2HPMA 2BOLA 2VASA 4C2TA 2M0MA 2X51A 1W36D 2IGNA 2OC6A 3FBIB 1G8XA 4IQ4A 3FBNB 1FMVA 3S93A 2X85A 4CCMA 3DKXA 4KT6A 2UUZA 4B43A 1T95A 2MFZA 2IXSA 1Y6IA 2M3AA 2WB1A 2KRCA 4BQNA 3SYTA 2HPIA 3M1CA 4BDYA 2Q2EB 3TBIA 1MMAA 4X0GA 2VJ5A 2WA0A 4BS9A 4MLOA 4XKWA 3SEQA 2LH9A 3K4LA 2VXDA 2VKHA 3ZGKA 1NG6A 4XNFA 3OS0A 1V5EA 2IGMA 3K4CA 4RLQA 2VPLA 4XQFA 1YX3A 1LFPA 3OYIA 2IS2A 1D0YA 3VYSB 4BEHA 1GLNA 4HNUA 1QU3A 2VQLA 1DP3A 2A6TA 4RMNA 4OAZA 3L2VA 2WAQA 1X1AA 1DGWY 3VYUB 3VSKA 3OYCA 4E7IA 3KEYA 3PJRA 2KLOA 1D0ZA 2PMZA 1WJFA 1WJEA 3QYBA 4AVZA 2W1OA 1QHGA 1V5GA 3DPTA 3F9KA 2DT7B 1SAUA 4HRIA 2V6EA 2LC2A 3L2UA 3OR1C 4RM3A 2KL4A 3BCAA 3BLYA 2A5WA 2Z1DA 3EUKL 4CA0A 2VIXA 1BR4A 3CJQB 5KCMA 2F6CA 4ZDPA 1BR1A 2V1NA 2R7XA 4HG2A 4KJZA 4LIVA 1W36C 1N77A 4F52A 2BW3B 3U21A 4OAYA 4XN3A 4XLCA 1VZ0A 2VKDA 1MNEA 2DCEA 2RREA 3LSKA 4N4NB 4YELA 3SEZA 4HSRA 2X1CA 4B48A 3OY9A 4BJ6C 3DTKA 4CUGA 1D1AA 4BE1A 4PJMA 1D1CA 2BVMA 2L9SA 3PFYA 2L2OA 4IQJA 3S3MA 2JVGA 3K4KA 4ZJZA 2R7VA 4BGDA 2HU9A 3OWTA 4E7ZA 4XKBA 1DGRM 4F93B 5CQEA 3KYLA 4BQOA 3BC8A 2CS3A 4F92B 1X19A 4BJTA 2W7NA 4NNJA 2ZXIA 2K3PA 3L2RA 3OYLA 2VQCA 2ZSIB 2LRDA 3OS2A 2IS6A 5CPRB 3CJRB 2LREA 3CMMA 3HOSA 3KX2A 3OL4A 4BQQA 3TMOA 4XKVA 3H5AA 2CV0A 5HNHA 2HNHA 3OIQA 5JHFA 2BW3A 5HNFA 3OYFA 2UV1A 3MD2A 2VXZA 3SZGA 4JOMA 4N4OB 4D1QA 4HSTA 3DTEA 2LYCA 2HVSA 4P1WA 2KHMA 3OYJA 3DLAA 3MKYB 3IAS2 1D0XA 1X4PA 2R7QA 2K5CA 4B44A 1TT0A 2M4KA 2M7AA 2VJ4A 2CV2A 2JSPA 1U0JA 1NG7A 3C2GA 3D5RC 4IKFA 2XF7A 4J00A 4II2A 2ELJA 4GRIA 4AU7A 3DTIA 1ZELA 1IRXA 2V7FA 4Y4RA 3OYKA 2HQAA 2QKLB 2CV1A 4XM3A 3G2BA 4E7SA 2E60A 3GBGA 4CH7A 2DXIA 1MW7A 2KMUA 2ZXHA 2VJJA 2CMPA 3CESA 4C30A 4DGWB 2RNGA 2WY8Q 2P0WA 3RPUD 5LFAA 1X1BA 3M8JA 2QKMB 1EA3A 4XLFA 2OV7A 1OLTA 1UAAA 2AQFA 4Y33A 3EUHC 1SFKA 3HPHA 2XAUA 1PYVA 4NUBA 1YE9A 4CCOA 4XOPA 3I9V2 3H5RA 4PSWA 2GOXB 2LOOA 4IZZA 4E7LA 1D1BA 3A4CA 4NQWB 3DEEA 3A2KA 3BG6A 3OYGA 3EPZA 3MKZA 4U87A 1S9HA 2MYSA 3DU5A 4F91B 3HL2A 2V9KA 2R7SA 4YEJA 3H9QA 5FRNA 1WFXA 3VWBA 1DQUA 4DJAA 2X6XA 4ZDOA 4BJ5C 3HUGB 2VJIA 4CCJA 3OYEA 4OWRB 1WJ5A 2WADA 2JA2A 2F4IA 1X1CA 2FUG2 2NOJB 1BR2A 3TL4X 1QHHD 3ONQA 2XF6A 4FETA 1MMGA 3PUBA 2LG4A 2L7KA 3S32A 2CFOA 2KQRA 3E0JB 3K6GA 4BXFA 4E4HA 1MMNA 2WAEA 3MKWB 3AKZA 2ZFUA 4D9JA 4G6TB 1WJDA 1MMDA 5CKTA 1X1DA 3DU6A 1UG0A 2IS4A 3LMMA 3NWTA 3EUAA 3W2AA 2Z2SB 2VL8A 3FDYA 4RLFA 3N05A 4P5OA 3ZQQA 4HPQA 1T0FC 3AL0C 2CW7A 4IX7A 4BE2A 3DPLC 4C9YA 4DBQA 5HLTA 4QPOA 3VYTB 2IGOA 3HC7A 2E1MB 3HPGA 4HEA2 4XONA 2CUZA 2XC7A 2LY1A 2BVLA 4XORA 3OYHA 2Q1ZB 4QPQA 3NWSA 3RSNA 3PNVA 3LSIA 2GOMA 4R79A 3QODA 4PK4A 1LVKA 2L5QA 3S3OA 1WJAA 3D5LA 2E1MC 2LY2A 2VQGA 1JI8A 4FASD 2PJRB 4ZYAA 4AYBA 4PFPA 2E5ZA 3S8PA 4CCLA 3OMYA 4CCNA 2I8DA 2O5RA 3OOUA 4XLEA 2CW8A 5FROA 1G59A 3ZXSA 3H0DA 2KRHA 2E5NA 4E7KA 4ZC3A 4XLAA 3K70D 3PNTA 1Z21A 2R7OA 3IUOA 3UNGC 3ZRGA 2DJIA 4ZDLA 2HDWA 3SDBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XSJ C;  1YX3 A;  2V4J C;  3OR1 C;  1SAU A;  3OR2 C;  1JI8 A;  2A5W A; 
#chains in the Genus database with same CATH topology
 2DJN A;  3UR3 C;  5DM6 F;  1E3H A;  2J5O A;  1BJZ A;  1M1E B;  4N9I A;  4RBO A;  1X4O A;  1I6X A;  3Q3S A;  1YIT I;  2EA4 A;  1UMQ A;  2DA6 A;  4JQF A;  5CJ9 A;  2KP6 A;  4CSW A;  5DCF A;  5HDN A;  2EH3 A;  2FQ3 A;  3FHN A;  2DN0 A;  2L4A A;  4BQA A;  2HOT A;  2M87 A;  5FKL A;  4A3G J;  1PVE A;  4W97 A;  4XMY A;  1MBH A;  4AID A;  4XIC A;  3Q5F A;  1T8I A;  2PJR A;  4UUV A;  2W4S A;  2DDA A;  1FMW A;  3LSH A;  4XN0 A;  2NVU B;  2XB0 X;  5HS7 A;  3V7C A;  2VOD A;  1X3Z B;  1LDD A;  1Z3Y A;  1G3W A;  4F55 A;  3FK7 A;  5GTI C;  1V3F A;  2VT3 A;  4XKC A;  3K10 A;  3HM5 A;  5KAF C;  5KNL A;  2GXA A;  3ML6 A;  1HW5 A;  2DMP A;  4KIF A;  4PSX A;  1EJ9 A;  3V7R A;  5FLX K;  2X1D A;  2LF7 A;  3JRD A;  3HTU A;  2R7T A;  1SVO A;  3OV8 A;  1MND A;  3ERM A;  4I09 A;  1N78 A;  4NC8 A;  4XSZ F;  3KP6 A;  2XIG A;  1OCR H;  1TNS A;  2XF5 A;  4K2E A;  2R7U A;  1QRY A;  3K70 C;  3QU6 A;  3HOT A;  4UUS A;  3OSF A;  2V26 A;  2O8X A;  3KZY A;  4KIC A;  4LFU A;  4M3F A;  2K9L A;  4CCK A;  2ZSH B;  3VDX A;  1R5G A;  1K6O A;  1U6G A;  2EK5 A;  3J7A Y;  4U0Y A;  3DPU A;  2H27 A;  2W82 A;  3TKY A;  4MFD A;  3LSM A;  3O3K A;  2VB6 A;  2VN2 A;  2M9H A;  1FLI A;  2OPT A;  4DBR A;  3PSF A;  1FOW A;  1TWG J;  2AXL A;  5FD5 A;  5CVJ A;  1MBJ A;  3OYA A;  3JRI A;  2D45 A;  1R1T A;  3K1M A;  2RQQ A;  4HX4 A;  4MIM A;  1GV2 A;  3BCB A;  4L5E A;  3E7L A;  3ZCO A;  1XMA A;  1LFB A;  4KIS A;  1I5Z A;  1OYW A;  3BJA A;  4U7B A;  5E18 F;  3I3L A;  2NAZ A;  1R00 A;  1TNT A;  2DO7 A;  2VT2 A;  5LRR A;  2EZK A;  2Y31 A;  3B6C A;  4ZTF A;  3J80 K;  2MAB A;  1P6R A;  5K5O A;  1SD6 A;  1PJR A;  5JVG F;  2RVC A;  5J47 A;  3H36 A;  2QLZ A;  3BG3 A;  1HCR A;  3E5U A;  2XAG A;  3CUQ C;  1O7F A;  2IA2 A;  3DLL F;  1OCO H;  2KZG A;  2YUS A;  3DWL E;  1LDK B;  3U9G A;  1TWC J;  3GFI A;  4D5C A;  2BBY A;  4CZC A;  1JTX A;  3ABU A;  4ENN A;  3R4K A;  4Y3O A;  1IXS B;  2Y69 H;  3H5N A;  4NBQ A;  2PI0 A;  1AA7 A;  1LFU P;  3DKY A;  2E1C A;  1XPX A;  3LSP A;  1TW3 A;  3BTJ A;  3WGI A;  3KP4 A;  2MC4 A;  2QQ9 A;  4BEH B;  2HQN A;  5FLM J;  3WTS C;  5DD4 A;  2MD5 A;  4I02 A;  2HPM A;  3WTX C;  1T33 A;  1GVD A;  3BG9 A;  1Z0X A;  2M0M A;  4WWC A;  2UZK A;  3CO7 C;  3I55 I;  2IGN A;  4B09 A;  3FBI B;  4HX7 A;  3VOD A;  1IC8 A;  2UXN A;  5J8C A;  3DKX A;  4KT6 A;  2UUZ A;  3TDU C;  4D7N A;  2FBH A;  4HLX A;  2NNN A;  2R7F A;  1T95 A;  3H92 A;  2OAZ A;  1Y6I A;  2FMY A;  2M3A A;  5D5U B;  2KRC A;  4BQN A;  2HYJ A;  3SYT A;  3I54 A;  3WE3 A;  5FGM A;  4KN4 X;  2XGE A;  3HIF A;  1WZ2 A;  4M9Z A;  5FKK A;  3IWZ A;  4XKW A;  3ZQH A;  1K4S A;  2DQR A;  4LMY A;  2W84 A;  1XSX A;  2OA4 A;  3ZGK A;  2TDX A;  1JJ6 C;  1DP7 P;  1V4R A;  4XNF A;  2IBD A;  3K4C A;  4LK0 F;  3E3V A;  4XQF A;  1IZ1 A;  4IEJ A;  3GEZ A;  2FJ1 A;  2CG4 A;  1D0Y A;  3VYS B;  2FA5 A;  4HNU A;  1XDS A;  2A6T A;  1A6Q A;  2CJJ A;  2LSO A;  2HR3 A;  3G1M A;  4QLC U;  4R8H A;  3VSK A;  3OYC A;  3BR5 A;  3IC7 A;  4E7I A;  4PZJ A;  2PMZ A;  2ECB A;  3CJN A;  1WJE A;  5FFX A;  4A0X A;  2DK5 A;  2V9P A;  1QHG A;  1S7E A;  1V5G A;  1EV7 A;  3DPT A;  1SAU A;  3F9K A;  3SDG A;  1O3R A;  3GTK J;  2DMN A;  3AG3 H;  2O3F A;  1FWZ A;  2LC2 A;  1QPI A;  3S17 J;  3OR1 C;  4O6J A;  2HWV A;  3LSJ A;  4RM3 A;  4S04 A;  1RZ4 A;  3QPH A;  1HQC A;  2A5W A;  1VQ4 I;  4EQQ A;  3EUK L;  2NNY A;  3ZN1 A;  2VOP A;  1JE8 A;  2RC4 A;  2X48 A;  2COB A;  1YO5 C;  4RDU A;  3HSE A;  3LQR A;  1LVA A;  1J7K A;  2HOE A;  2R7X A;  4F52 A;  5GAE J;  3IKT A;  2FNP A;  1S6L A;  2EBI A;  2XPW A;  3GFJ A;  3L1P A;  3CC2 I;  3JRG A;  3GZ6 A;  1YIJ I;  4ENJ A;  1MNE A;  3Q0W A;  4YEL A;  3K2Z A;  1ZLK A;  3SEZ A;  4KN7 X;  3HOV J;  3TP0 A;  5H6R A;  4B48 A;  3DTK A;  5J4V A;  3A0B C;  3VEP A;  2P5K A;  2F48 A;  2BVM A;  2OCE A;  3QP6 A;  4IRH A;  1U5T B;  4A3K J;  3E5Q A;  5IYB J;  1MGT A;  4ZJZ A;  1I27 A;  2HU9 A;  4IXA A;  3M4O J;  5CVU A;  3M7G A;  3OWT A;  4E7Z A;  3O8G A;  1DGR M;  2E7W A;  4F93 B;  5CQE A;  1OFC X;  2FOW A;  3BR2 A;  4WXD A;  2W7N A;  1KYZ A;  1G4D A;  3F8B A;  3BR6 A;  3WE2 A;  1U78 A;  5J1R A;  1YYV A;  1Z9C A;  2VQC A;  2LRD A;  2FQ4 A;  1JT0 A;  5BS6 A;  2IS6 A;  5CPR B;  4YFK F;  1IN6 A;  1FBQ A;  2Z99 A;  3NQO A;  5GAD J;  3G1O A;  3KZZ A;  4N0B A;  4BQQ A;  4XKV A;  1BL0 A;  3KLN A;  3OIQ A;  3OYF A;  2BW3 A;  2HXO A;  3PUF A;  2R5Z A;  1FJL A;  2OQR A;  2FD5 A;  4JOM A;  2XPU A;  3T5X A;  3HGY A;  4N4O B;  5F27 A;  3DTE A;  1SFX A;  1G2H A;  2CRG A;  2E2J J;  5GPC A;  3ECO A;  3DCF A;  4L5J A;  3MKY B;  4WF2 A;  1ETV A;  3MWM A;  4E70 A;  2HQR A;  1X4P A;  3KE2 A;  1KA8 A;  2M4K A;  1SAN A;  3G3Z A;  1U0J A;  2NRA C;  2LVS A;  3C2G A;  1FYK A;  1U2W A;  2OBP A;  4XRM A;  4HA8 A;  3R0A A;  4PGH A;  1T08 B;  3C1D A;  1D5Y A;  5ICE A;  4V19 K;  5GAH J;  1FBS A;  3DTI A;  6PAX A;  2L02 A;  4M6X A;  1ZEL A;  4RGS A;  1W4M A;  5L3D A;  1VQ5 I;  1J9I A;  1IRX A;  2V7F A;  2ZCW A;  2BY3 A;  3P9K A;  3G2B A;  1KZH A;  4HQE A;  1OCT C;  1XMX A;  2E19 A;  3SZP A;  4CO8 A;  1Z05 A;  4ZZL A;  3CD6 I;  3CES A;  4EV0 A;  3RPU D;  1O3S A;  1X1B A;  5AON A;  4UXN A;  2HTJ A;  2R92 J;  4XLF A;  1ZYR F;  1OLT A;  3WTV C;  2AQF A;  1UAA A;  3E6M A;  4D7M A;  1BW6 A;  1IV8 A;  1IAW A;  2Y0S N;  4NUB A;  4CCO A;  3QPL A;  4EJO A;  5K7F A;  4LLN A;  3I9V 2;  2ACJ A;  2GLO A;  2DQL A;  4BXU A;  2GOX B;  4IZZ A;  1TBX A;  5FD6 A;  1IXC A;  2M8E A;  5DCM B;  3EPZ A;  1A04 A;  1YRN B;  1CF7 B;  4C2M J;  1A36 A;  2MYS A;  3ZMS A;  2QYO A;  4YEJ A;  2KT0 A;  1S5L C;  4V2G A;  3RKW A;  4I01 A;  3RKY A;  2F4M B;  5TRD A;  5IPA A;  2GXG A;  3EUH A;  1B8I A;  3FF5 A;  3OYE A;  3TW7 A;  4OWR B;  2VI6 A;  2WAD A;  2XAJ A;  5C3E J;  2H8R A;  2FUG 2;  5IT9 Z;  2QBY A;  3N97 A;  1TL8 A;  1BR2 A;  5J8F A;  3FXJ A;  2BEO A;  2LFB A;  2C6Y A;  1VQN I;  4AVP A;  5IYD J;  2KJB A;  3RIR A;  2HS5 A;  5K5R A;  3KP5 A;  2ZFU A;  3HYI A;  4HV6 A;  1Y8Q B;  4L9T A;  3ZQG A;  5D4R A;  1Y0N A;  1IGN A;  3F3X A;  4UVC A;  4A2U A;  4UNO A;  3NWT A;  3E6D A;  4Q47 A;  2EFO A;  3ZP5 A;  4FX4 A;  5K5Q A;  4CYD A;  1ZK8 A;  1BN5 A;  1AKH A;  1IF1 A;  2XRO A;  2XGC A;  1FYL A;  1GDT A;  1XG1 A;  4HPQ A;  4IX7 A;  4A6E A;  2ZJQ F;  2EWN A;  1I1G A;  4RAY A;  3WG9 A;  3S15 J;  1YW9 A;  2IGO A;  3HC7 A;  5IOZ A;  1MBG A;  2E1M B;  4HEA 2;  2JA5 J;  2V1U A;  3ZPL A;  1ZH5 A;  4XOR A;  1XGM A;  1YOV B;  2GIV A;  3NWS A;  1YJ9 I;  1R5H A;  1UFM A;  2LNB A;  5CVR A;  3ULQ B;  4AWX B;  3JTG A;  1ORK A;  3LSI A;  2GOM A;  3SFI A;  1CGP A;  4R79 A;  3IWF A;  4A3J J;  1BW5 A;  3QOD A;  2R0Q C;  1OIS A;  1ACI A;  4AM3 A;  1VQM I;  4DNC A;  1FT9 A;  2K7L A;  2QEN A;  3RPU A;  3IH3 A;  3J81 Z;  2DYS H;  1T0F A;  1GV5 A;  2LY2 A;  3HGG A;  1JI8 A;  1RR7 A;  4FAS D;  2PJR B;  1UHW A;  2E5Z A;  3JRH A;  4MO7 A;  3OMY A;  1YFH A;  5GAG J;  3F22 A;  2ELH A;  1XCB A;  4G6D A;  1FTT A;  1G59 A;  1LE8 A;  2QWW A;  4ZYH A;  2ZB9 A;  3ZXS A;  3H0D A;  1WVR A;  3CCE I;  2KRH A;  4EJT A;  1Y8R B;  3KP2 A;  3K70 D;  1Q1V A;  2QGU A;  3UNG C;  4JX4 A;  1KYW A;  2XKO A;  3LA3 A;  2L3D A;  2DFH A;  3HSR A;  1YS6 A;  4B3A A;  2DOD A;  3SDB A;  1SMY F;  4ZTJ A;  1FOX A;  4HW0 A;  1W5T A;  1HST A;  2RV8 A;  1KU9 A;  2FRH A;  1R1U A;  5HDG A;  5M5X J;  2WB1 N;  1XS9 A;  2H94 A;  3QOP A;  3BR1 A;  4BAC A;  3LFU A;  2NVQ J;  3L00 A;  4PJL A;  2X1E A;  3PNY A;  5CLS A;  4RB2 C;  2ZXJ A;  5FKM A;  5IT9 K;  2K9M A;  4UUS B;  2DT6 A;  4HF1 A;  1OR7 C;  1TZL A;  2VKE A;  3OYN A;  3K4N A;  1KQ0 A;  1AU7 A;  5F64 A;  2R7R A;  3VB2 A;  1ZG1 A;  1G3S A;  4KT5 C;  4GCV A;  4C2U A;  1K79 A;  3IH2 A;  1I3Q J;  3WU1 B;  2PEX A;  1UEL B;  2HGC A;  2MG4 A;  4P9U A;  2B9S A;  4IHY A;  3FMS A;  4DYQ A;  1WJC A;  3A0H C;  1ODD A;  5HS9 A;  3Q0U A;  2BY1 A;  3HKZ A;  3BG7 A;  2JVH A;  3VSL A;  2ZJR F;  2L9R A;  1N25 A;  4NC7 A;  1J59 A;  4E7J A;  3LAJ A;  2ZNZ A;  1Y56 A;  4YRV A;  3BDD A;  1T38 A;  3FKI J;  2M30 A;  1QBJ A;  3ROU A;  3ASO H;  4EAT A;  3GLX A;  1J5Y A;  2LMD A;  1V5F A;  1KON A;  4RAZ A;  3RDI A;  2DTZ A;  4M6Y A;  1KU3 A;  4ENK A;  3LNQ A;  2PX9 A;  2EA2 A;  2WC2 A;  4XOT A;  2QA4 I;  1FY7 A;  4KA4 A;  2ZJ2 A;  2JPB A;  3AL0 B;  1R6R A;  3AFH A;  1WGX A;  3HZJ A;  3ZMZ A;  4UV8 A;  1NTC A;  3D1N I;  2E2H J;  1D8K A;  4XL9 A;  3W3C A;  4E6K G;  2R7W A;  2IVM A;  1XN7 A;  3F21 A;  3J81 K;  1VFC A;  4KIB A;  1N75 A;  4LIU A;  5F0F A;  5DDG A;  2EZH A;  5AIQ A;  1G3T A;  1ZAO A;  3GCM A;  1LDJ A;  1K6Y A;  2M7B A;  1OCZ H;  3D5S C;  5HVQ C;  4A3B J;  1HDP A;  4IHW A;  3W6V A;  3OIO A;  3T8R A;  2OUM A;  2WY7 Q;  2ZNY A;  2JUG A;  2NVY J;  3E1S A;  4XLH A;  4XRS A;  3RKX A;  3L2W A;  2EZL A;  3RQ4 A;  3A1Y A;  2M2E A;  4BU2 A;  3F23 A;  3B73 A;  1VQP I;  1U8R A;  3R0J A;  4DQ2 A;  4BBS J;  1WJB A;  2Q0O A;  2CO5 A;  3JAM Z;  1TQM A;  1W5S A;  3KPH A;  2NS0 A;  1B72 A;  3QQA A;  1U5T C;  4A3F J;  1XSV A;  1XGN A;  2CUJ A;  1J09 A;  2LDU A;  2M4G A;  2H1K A;  2IS1 A;  3RJP A;  3FM5 A;  3BR0 A;  5E3N A;  2MH9 A;  2OF7 A;  3Q9V A;  2ZME A;  3HDD A;  2L7M P;  4PJJ A;  4TV7 A;  1WH7 A;  3GXO A;  3K4J A;  5CQG A;  3PIO F;  1S7O A;  2XSJ C;  3DQV C;  4MHG A;  3OIP A;  3W2V A;  1JT6 A;  1W7P A;  4BUP A;  4IOC F;  4DOZ A;  1F36 A;  3IAM 2;  1ERD A;  2L9N A;  3BT9 A;  5EZG A;  4BDZ A;  4G7H F;  1DDN A;  1FP1 D;  1FP2 A;  3QOE A;  3CUQ A;  2A07 F;  3V4G A;  2FEZ A;  4S05 A;  1Y0U A;  2VAS A;  5LHI A;  4JYK A;  1R22 A;  2ZC2 A;  2X51 A;  3J7Y J;  2K02 A;  2NYX A;  4ESB A;  5DV5 A;  4EGZ A;  3D0S A;  1F43 A;  3FXM A;  3KLO A;  4IOA F;  3F8F A;  3CDI A;  1IRZ A;  2IXS A;  1YJN I;  3FM3 A;  2JUC A;  4BH9 A;  2HPI A;  1WKM A;  3M1C A;  5H2F C;  3G73 A;  3CO6 C;  3IRR A;  4JBA A;  3F6V A;  2K4B A;  5DEQ A;  2LH9 A;  1V55 H;  3M8E A;  2VKH A;  3I0T A;  2H09 A;  4M3E A;  1R71 A;  1V5E A;  2IGM A;  1E2X A;  4RLQ A;  5D8K B;  2W57 A;  1YX3 A;  1EH6 A;  1LFP A;  3OYI A;  1QPM A;  4B1R A;  2P7C B;  2B7E A;  5LGU A;  3U1D A;  4OAZ A;  4ESJ A;  5L3E A;  1D3Y A;  3GUD A;  1HW2 A;  1XB4 A;  1K78 B;  2F5D A;  2X6O A;  3KEY A;  2CUF A;  2DT5 A;  3M8F A;  4Z6Y A;  3BQZ A;  1WJF A;  1Z77 A;  4ASN A;  2QM3 A;  3BG5 A;  2MH2 A;  2DTR A;  3GTM J;  2HEO A;  3Q9S A;  1J0R A;  2F5E A;  1FX7 A;  3CLO A;  3TW6 A;  4HRI A;  3L2U A;  4CXF A;  5EEG A;  2PG4 A;  4F7Z A;  1LB2 A;  1OMI A;  2KL4 A;  2E36 A;  2F5F A;  4L5I A;  1I1S A;  5KAI C;  2DMT A;  2PN6 A;  2Z1D A;  2Q2E A;  2F4O B;  2VIX A;  1QNT A;  4AIH A;  3JAM K;  2F6C A;  4HG2 A;  4EJV A;  1GUU A;  2JN6 A;  5HLG A;  2B63 J;  2BW3 B;  2YX7 A;  3U21 A;  4OAY A;  5BNG A;  1AHD P;  1O7L A;  4XLC A;  2R5Z B;  3COA C;  4GFB A;  4ZH4 F;  1VZ0 A;  3ABL H;  2EV0 A;  2DCE A;  3LSK A;  5EF6 A;  4EM0 B;  2GA1 A;  4HSR A;  2P5L C;  3HOY J;  3OY9 A;  2M5W A;  3L9F A;  4PJM A;  1VQ6 I;  3VFZ A;  2NOG A;  4L18 B;  2L9S A;  2TCT A;  5JHU A;  2W48 A;  2QCO A;  2JVG A;  3H3V K;  4GO1 A;  4PDK A;  3BQY A;  4A0Y A;  2FX0 A;  3BZK A;  2IA1 A;  2JA8 J;  4BQO A;  2CS3 A;  3HJE A;  2ESH A;  3DKW A;  3F0C A;  2QSH X;  3QPS A;  3I58 A;  2KIF A;  1HSJ A;  1A5J A;  4QWQ A;  3L2R A;  1RRJ A;  5ICG A;  1MSE C;  1XTA A;  3BTL A;  3JTH A;  2HYG D;  2XGX A;  5B66 C;  2A3S A;  3C18 A;  3HHG A;  3TMO A;  3ZMV A;  3N4M A;  5K7Z A;  3H5A A;  2PLY A;  1D8J A;  4OMZ A;  2QQA A;  3SZG A;  5GPA A;  4MTD A;  1W1W E;  1P7J A;  2HVS A;  1MIJ A;  2YPR A;  2KHM A;  3GZ5 A;  4LJZ F;  1D0X A;  2JA6 J;  2CQK A;  4B44 A;  3CMY A;  3MVP A;  1Q1H A;  2M7A A;  4IO9 F;  2DPD A;  1T39 A;  2CV2 A;  1ZHF A;  2YX4 A;  4X6A J;  4OU0 A;  1I50 J;  4I0A A;  3O6B B;  3R60 A;  4OIP F;  2XF7 A;  1WH5 A;  4AIK A;  1ETO A;  1MZB A;  1RNL A;  4J00 A;  4II2 A;  9ANT A;  1Z1D A;  4IHS A;  4GRI A;  1Y1W J;  4AU7 A;  4FTH A;  2R5Y B;  2LKP A;  2PFB A;  2ME6 A;  3HB9 A;  4HX8 A;  2HQA A;  2KIU A;  2QKL B;  4XM3 A;  1ZTR A;  1ZGJ A;  1REP C;  4KMF A;  2JZY A;  4HLY A;  1UZC A;  2W85 A;  1MW7 A;  2XKP A;  2VBZ A;  1PP7 U;  3ABT A;  2QBY B;  2OZ6 A;  2VJJ A;  2M0C A;  1KQ9 A;  2CSO A;  3PFI A;  4DGW B;  5LFA A;  3GWZ A;  2QKM B;  2GIZ A;  3KZI C;  2AHQ A;  3HTS B;  4G9Y A;  3JRA A;  4M71 A;  3A01 A;  1APL C;  1E3P A;  4O3M A;  4OIQ F;  3BOQ A;  4L9V A;  4IHT A;  4XOP A;  2IW5 A;  3G6E I;  1V54 H;  2P5V A;  4M72 A;  3CMA I;  2LOO A;  1B9M A;  1D1B A;  2RKH A;  2RNJ A;  1FNN A;  1AKH B;  3U2R A;  1UB9 A;  1Z6R A;  1G6N A;  2HXI A;  3GF2 A;  3PQK A;  4F91 B;  3HL2 A;  2ESN A;  2V9K A;  2K9Q A;  1YI2 I;  2CQX A;  1JHF A;  5FB2 A;  4A3C J;  2YSR A;  2PMZ N;  3H9Q A;  4HNV A;  2AXT C;  1WFX A;  3K1N A;  1FOK A;  1ETW A;  3K9T A;  3TDZ C;  1TWH J;  5ILV A;  2L0K A;  1I39 A;  4M9S A;  2LTP A;  1WJ5 A;  1KQ8 A;  2JA2 A;  4CIC A;  1X1C A;  1X3W B;  3DF8 A;  3TL4 X;  2E1O A;  2W25 A;  4NB5 A;  3HOW J;  4CGZ A;  5BPD A;  2L7K A;  3S32 A;  2KQR A;  1TT5 B;  2EFP A;  3E0J B;  1S7A A;  3DFG A;  5B1A H;  3MKW B;  1WJD A;  1G3Y A;  4A0Z A;  1MMD A;  5CKT A;  4WX9 A;  1UG0 A;  3MQ0 A;  2IS4 A;  1O4X A;  2CQ7 A;  5IP7 J;  1HBX G;  2ME0 A;  3JR9 A;  2OJE D;  4HF0 A;  1ONV A;  1SAX A;  1HC8 A;  3N05 A;  2IEK A;  3IRQ A;  4IJA A;  1IN7 A;  4P5O A;  5ERI A;  3CCS I;  1B9N A;  3AL0 C;  2CFX A;  2CW7 A;  1ENH A;  4A5N A;  1IRF A;  1FZP B;  1FSH A;  2BY2 A;  3ELK A;  3ABK H;  4QPO A;  5JVT A;  5IT3 A;  3EYY A;  3K0L A;  4DYR A;  1UHS A;  2XC7 A;  2LY1 A;  5JR3 A;  2JPC A;  3OYH A;  2MA3 A;  4U0W A;  4PGG A;  1MJB A;  2L54 A;  2V79 A;  4BNC A;  1LVK A;  2L5Q A;  3S3O A;  1MJA A;  2LKS A;  2AO9 A;  3DP7 A;  5E3M A;  4AIJ A;  1JTY A;  4BAY A;  1FSE A;  1MD0 A;  4CCL A;  3S8P A;  3CDL A;  4W1U A;  2KIS A;  2O5R A;  2YS9 A;  2XRL A;  5DUK A;  3TO6 A;  4H0E A;  3QAH A;  4XLE A;  5H6Q A;  2L7F P;  3V7S A;  1VQ8 I;  1NHA A;  2M8G X;  4B4C A;  4E7K A;  3DBH B;  3DBL B;  3MEX A;  2R7O A;  1ZRF A;  3DEU A;  1ETQ A;  3IUO A;  1MDM A;  2JA7 J;  3ZRG A;  3DBR B;  3SZT A;  2DJI A;  4ZDL A;  2HDW A;  2ZO4 A;  3CCR I;  1U8B A;  3RZO J;  1HOM A;  1O57 A;  3HSF A;  3OYD A;  2V6C A;  2HZD A;  3TOA A;  4EGY A;  1F1Z A;  1B59 A;  2EFW A;  1I3A A;  3TGN A;  2VLA A;  1BC8 C;  5FO5 A;  1WCM J;  4G7O F;  1ITY A;  1X3U A;  3V42 A;  5HOD A;  1SFO J;  4XR6 A;  4Y15 A;  4RB3 C;  4OIO F;  5F1R A;  4RA2 A;  2W24 A;  4Y17 A;  1QQI A;  2Z16 A;  3RKQ A;  5KHD A;  1BOB A;  1KGS A;  1PP8 F;  3GTP J;  3KP3 A;  4NDL A;  3OR2 C;  3S2W A;  5LBQ A;  3WHC A;  1GXP A;  2KZV A;  2EIJ H;  1SMT A;  4E7H A;  3GTG J;  4BXX J;  3WTZ A;  2NS8 A;  3FXQ A;  2XGD A;  2Y0S A;  5H20 A;  1WI3 A;  1UJ8 A;  4JP0 A;  2HDD A;  2WAQ N;  2MC3 A;  4ON0 A;  1MKM A;  4XRS G;  3WTW C;  1W0T A;  4M3D A;  2QQB A;  1HKT A;  1Z3X A;  1OR7 A;  5GP9 A;  3BPV A;  4Q4Z F;  2WBM A;  3JRB A;  2BZT A;  4CYC A;  4BY7 J;  2IGK A;  2K27 A;  1YHQ I;  3OL3 A;  5IY5 H;  3M1E A;  3VYR B;  1CQT A;  1R5I D;  3CP2 A;  2D2W A;  4BE0 A;  4R1H A;  4A3D J;  3SXY A;  3ERE D;  5EG0 B;  1E17 A;  2WV1 A;  4PUS A;  3KP7 A;  3OS1 A;  2ID6 A;  1B72 B;  3SFZ A;  3REO A;  1IN5 A;  4RM2 A;  2IRF G;  3MZH A;  3HXL A;  3IP4 B;  2Y48 A;  1BIA A;  5FJ8 J;  3TQN A;  2KIM A;  3H9J A;  4HQM A;  2LBF A;  2ZME B;  3MMY B;  2BGC A;  1ZR2 A;  5B5E C;  2CGP A;  2OTJ I;  2MD0 A;  1P9Q C;  1FOY A;  1RES A;  3PL8 A;  3G1L A;  4LIT A;  4DZJ A;  5J3L A;  1W7P B;  3M07 A;  3CJT B;  2K4J A;  1RKW A;  2F5V A;  3S16 J;  3RYR A;  4BHP A;  1H89 C;  3CUQ B;  3OYB A;  3F6O A;  2VQH A;  4I7H A;  3QWL A;  2NS7 A;  3FXU A;  5C4X J;  2COM A;  2W00 A;  4M6V A;  5TGT A;  1HA8 A;  1Z7L A;  3X2Q H;  3FKJ A;  1YW8 A;  2WV0 A;  2CH0 A;  3LSR A;  1LKX A;  3TED A;  2PJP A;  3IHU A;  3C3W A;  2XB5 A;  2EFN A;  4KYW A;  4XSX F;  4GYI A;  4L9J A;  1JHH A;  3S2H J;  1XD7 A;  3I4M J;  3HOZ J;  3K1P A;  1QZY A;  1NH3 A;  1STZ A;  1VI0 A;  4RAF A;  1Z7U A;  3ASN H;  1L3L A;  3CC4 I;  1B4A A;  1BA5 A;  2P8T A;  1ZRC A;  2EQR A;  2DBB A;  3H35 A;  2BXY A;  5LHH A;  2A6E F;  3ZR8 X;  5E1W A;  5F08 A;  1TTY A;  5IP6 A;  3CCM I;  3BR3 A;  4MQV A;  2VC1 A;  3JRF A;  1B1B A;  4UB8 C;  2NVT J;  5L3B A;  4AC0 A;  2R93 J;  3JSP A;  1G8X A;  3FBN B;  4IL6 C;  3S93 A;  2X85 A;  2A6H F;  4CDG A;  3I59 A;  1K7A A;  4B43 A;  1MMS A;  1ZG3 A;  3WTT C;  5E3O A;  4UVA A;  3FXK A;  2MFZ A;  2WB1 A;  2D1V A;  1T56 A;  5F0C A;  1ZRD A;  3ZMT A;  4A3L J;  4G12 A;  2HOA A;  2Q2E B;  2JRM A;  1MMA A;  2JRT A;  4X0G A;  1IJW C;  4LK1 F;  2VJ5 A;  3JSO A;  4MLO A;  2DI3 A;  1ZAR A;  3K4L A;  3CUO A;  4Z2Y A;  3WOD F;  1NG6 A;  4LOC A;  5DD8 A;  3OS0 A;  2MBF A;  4I98 B;  4CZZ A;  2OCC H;  5B3S H;  3WTY C;  2IS2 A;  2YU3 A;  2E71 A;  2KKO A;  2XV4 S;  4HF2 A;  5J6X A;  3WGG A;  2QSF X;  2VKV A;  1XGO A;  1Z91 A;  2R3S A;  3WU2 C;  1QU3 A;  5E20 A;  1DP3 A;  4RMN A;  2BE5 F;  3I5U A;  2VE9 A;  1FTZ A;  3L2V A;  1T2K A;  1DGW Y;  3T0Y A;  4I99 C;  4WXC A;  3W6J B;  3PJR A;  4FIS A;  1D0Z A;  1X58 A;  4M3B A;  1R4N B;  4YFX F;  4MEY F;  4G8X A;  2HKO A;  4AVZ A;  4GYG A;  3RQI A;  3ZQI A;  4FE4 A;  4YFN F;  5JLW A;  5BQT A;  4LG0 A;  2KIQ A;  4RS8 A;  1P4X A;  4OOI A;  3BLY A;  2M34 A;  3L2C A;  2CUE A;  4RAG A;  1IRG A;  3DXJ F;  2QVO A;  4CA0 A;  4HAM A;  1LQ1 A;  1H9T A;  1BR4 A;  2HOS A;  2STW A;  1PUE E;  5KCM A;  2QZ8 A;  2V1N A;  2EV6 A;  1LPQ A;  4KJZ A;  2EIL H;  2FF4 A;  1W36 C;  1N77 A;  3FK6 A;  3ABM H;  3S1N J;  3GVA A;  1IDY A;  4XN3 A;  4OIR F;  5LEK A;  1R23 A;  4GDF A;  2VC0 A;  3CCJ I;  3B6A A;  1MH3 A;  3BZ6 A;  3A03 A;  5CVI A;  4N4N B;  3RZD J;  1VQK I;  1WPK A;  1QVT A;  1FIP A;  2PBI A;  3HEF A;  4BJ6 C;  1D1A A;  4CUG A;  1F9N A;  4V2F A;  3WG7 H;  4WCG A;  1FC3 A;  1W5C C;  4EEF G;  4IQJ A;  1XCV A;  1ZGA A;  5GTH C;  3QRF F;  1F4K A;  1NK2 P;  1MNM C;  3K4K A;  1ZRE A;  5FKN A;  3AG2 H;  4BGD A;  2NVX J;  2IAI A;  2DA1 A;  1QZE A;  4IHV A;  4XKB A;  4JX5 A;  4QSH A;  4F92 B;  1SC7 A;  4M9X A;  1X19 A;  3IKV A;  5FLX Z;  2HDC A;  1JUP A;  3T8T A;  2ZXI A;  2XVC A;  3QU3 A;  2DOF A;  1W0U A;  2K3P A;  4HV5 A;  5K7H A;  2A68 F;  3S1M J;  5ICC A;  2V9V A;  2ICW G;  5J1Y A;  3OS2 A;  2QSG X;  1P4W A;  3CMM A;  5F0H A;  2BHZ A;  3HOX J;  1FBU A;  3KX2 A;  1MBE A;  2PMH A;  4BBR J;  5ED4 A;  4ETS A;  3GTQ J;  2CV0 A;  5HNH A;  4EJU A;  2A61 A;  4AYB N;  1R1V A;  2UV1 A;  2DA4 A;  2VXZ A;  3TOB A;  4D1Q A;  4C3J J;  4O5V A;  3A01 B;  4P1W A;  1JKR C;  2XAS A;  3OYJ A;  1QO0 D;  3DLA A;  4G94 A;  1OJL A;  5F04 A;  2WWY A;  2DFE A;  3QPT A;  4A12 A;  1VF9 A;  1TT0 A;  3KCC A;  2JSP A;  2VPR A;  3NAR A;  2K85 A;  2OQG A;  3D5R C;  3SJM A;  1SFE A;  2PMU A;  3P9C A;  2EFQ A;  3LA7 A;  1O3T A;  2ELJ A;  2Y2Z A;  4YG2 F;  1HKQ A;  4A69 C;  2EB7 A;  1YG2 A;  3CDH A;  1FEX A;  2JT1 A;  4Y4R A;  1TWF J;  2CV1 A;  3JRC A;  1RIO H;  3J80 Z;  1K4T A;  1TC3 C;  2LLK A;  2LY9 A;  5E1Z B;  1UCR A;  2H6C A;  3F8M A;  5C4J J;  3TO9 A;  3F72 A;  2Z5U A;  4ZYE A;  3AG1 H;  2IT0 A;  2P0W A;  2FBI A;  1HW1 A;  1ZG5 A;  2DK8 A;  1I6H J;  1X2M A;  1XX5 A;  2OV7 A;  3MKL A;  1R9T J;  4U88 A;  2G9W A;  4KIG A;  2Y30 A;  3BY6 A;  2MSY A;  1SFK A;  3HPH A;  2XAU A;  1PYV A;  1UST A;  5F6F A;  1DU0 A;  1WI9 A;  3I64 A;  1SVL A;  4PSW A;  4NHJ A;  1VQL I;  5J1U A;  3A4C A;  1H0M A;  5M5Y J;  1OQY A;  4XLP F;  3BG6 A;  4A3I J;  1LUJ B;  5ICF A;  2JWT A;  1IUY A;  1H88 C;  2R7S A;  4IHX A;  2AS5 F;  1DPR A;  5BPI A;  2IA0 A;  4UHT A;  2X4H A;  4DJA A;  2UXX A;  2DU9 A;  4BJ5 C;  1VQ9 I;  3GTO J;  2BHY A;  1ZLJ A;  1R58 A;  4ZYD A;  1WHU A;  3HBL A;  2NOJ B;  2HYF A;  5E8G A;  2LK2 A;  1HLV A;  3NRV A;  1QHH D;  2QUF A;  2XF6 A;  4FET A;  2JQ7 A;  3GLL A;  2E7X A;  2QEX I;  2GWR A;  3BTC A;  4BXF A;  3S1Q J;  2GQQ A;  2RAE A;  4E4H A;  3HOU J;  1GHC A;  1OCC H;  2WAE A;  3PM1 A;  3AKZ A;  4G6T B;  4Q5S F;  3KYC B;  1ON2 A;  5CYV A;  3GZN B;  5D6F A;  3DU6 A;  4AUX A;  3O2P E;  1HDD C;  4Y13 A;  4WK8 F;  3EUA A;  2Z2S B;  2VL8 A;  4AD9 A;  2ZXW H;  4NQW A;  1IN4 A;  4B8X A;  2DPU A;  2X0L A;  1P7I A;  1ULY A;  4RLF A;  3I71 A;  2DDB A;  4HBL A;  3ZQQ A;  3S14 J;  1X2N A;  3ZMU A;  4BE2 A;  1R36 A;  3WTU C;  3DPL C;  4C9Y A;  4DBQ A;  1MDM B;  3JCU C;  1MBF A;  1RUN A;  3BJ6 A;  2FE3 A;  3IH4 A;  1MH4 A;  2VBX A;  2ZME C;  2BVL A;  2Y9Z A;  4PCQ A;  1GT0 C;  3HUG A;  3FWE A;  1TP4 A;  3RSN A;  1Y1V J;  4UB6 C;  3PNV A;  2VUM J;  2H6B A;  2Z3Y A;  1RC9 A;  3A02 A;  5E8I A;  4PK4 A;  2MW8 A;  4KUM A;  3GX4 X;  2CQN A;  1LNW A;  4DW6 A;  1JJ8 C;  2E1M C;  3SHF A;  3VOE A;  1JKO C;  1U3E M;  2VQG A;  3EQL F;  1TQP A;  4ENM A;  4FQG A;  1IUF A;  4U7D A;  1K61 A;  3E97 A;  3LA2 A;  2F5C A;  3MN2 A;  3IL2 A;  2EIM H;  4DYC A;  3KEQ A;  1RI7 A;  4P55 A;  4XRF A;  5FRO A;  2HKX A;  3MZ8 A;  2ZJP F;  2QF7 A;  4HYE A;  3WU0 A;  3HRT A;  3CCV I;  1PUF A;  4MEX F;  2WTE A;  4FT8 A;  4ZC3 A;  3I53 A;  4XLA A;  3PNT A;  1Z21 A;  3KET A;  1OPC A;  1A35 A;  5LLQ A;  3LAP A;  1R4M B;  3FMR A;  1B8I B;  4CYC B;  3GME A;  3EDP A;  4GXO A;  4JX6 A;  5DM7 F;  4ANJ A;  1OCP A;  2XDV A;  2DOE A;  4H4K C;  4J19 A;  5LRS A;  1P2F A;  2O03 A;  3BRO A;  2IP2 A;  2DOA A;  3KIO A;  1YJW I;  3FHZ A;  4UY8 I;  3LL7 A;  1BI3 A;  4LB6 B;  1JXS A;  5FFZ A;  3RTR A;  4B3X A;  3NAU A;  3K4B A;  4LG3 A;  1BI2 A;  5EGO A;  4BL0 B;  3G4S I;  4A5M A;  3ECH A;  2HFH A;  1ZR4 A;  3NEU A;  1TW2 A;  2NXN B;  2X6Y A;  1DU6 A;  1D5V A;  3LWF A;  1YX5 A;  2LBF B;  2OTL I;  2ELK A;  3BZC A;  5D5X B;  1B6A A;  4HNT A;  5A2Q Z;  3RCO A;  3L2Q A;  4MFE A;  2UWM A;  5B1B H;  3FIW A;  2V4J C;  1JKP C;  2EIK H;  4CHU A;  3QYF A;  1GXQ A;  5J4Y A;  3LSG A;  4BHB A;  2KRF A;  1EH8 A;  3GW2 A;  4DIQ A;  2GM4 A;  2HVR A;  5DYM A;  2HVQ A;  3MAJ A;  4M74 A;  2OD5 A;  2DW4 A;  3GFL A;  5LHG A;  3HHH A;  4BY1 J;  3H3Z A;  3L7W A;  2WAF A;  4ZZD A;  5DTD A;  2XRN A;  5IOY A;  2Y75 A;  4L0Y B;  4GGG A;  4QIW N;  4OIN F;  2O7O A;  2XPV A;  2MLK A;  4XK4 A;  3S3N A;  1IG7 A;  2HZT A;  4RGR A;  2ISY A;  1X1P A;  3CF2 A;  3CP8 A;  2FBK A;  2ZKZ A;  3R61 A;  4II3 A;  4S0H B;  2BV6 A;  4PFO A;  4P9F A;  4ITV A;  1WSU A;  1VQ7 I;  3PO2 J;  4RB1 A;  2EV5 A;  3G71 I;  1RPW A;  1ZN2 A;  3E6B A;  5EZH A;  1IXR C;  5CVV A;  3P9I A;  1VND A;  3CQZ J;  1E0E A;  2O61 A;  3FX3 A;  2X6W A;  4NC6 A;  3HRS A;  2CYY A;  3EET A;  3K4M A;  4MGR A;  3CME I;  4Y7N J;  1LE8 B;  2RQP A;  3LST A;  1T6S A;  2HTS A;  3GO5 A;  4UUT A;  2P4W A;  2AQE A;  2D1H A;  3QYE A;  3ZMD A;  1LEA A;  4J01 A;  2FML A;  2XAF A;  4XBF A;  1HKS A;  3GYH X;  1ZGW A;  3GFM A;  2Z9O A;  5FRM A;  3MCZ A;  3S1R J;  3HG9 A;  2G7U A;  1FIA A;  2BYV E;  3LFK A;  5E79 C;  2EJR A;  1K78 A;  3CZ6 A;  1FYM A;  1SD4 A;  1BI0 A;  2M1B A;  4U0V A;  2DAO A;  1DUX C;  4C3H J;  2RN7 A;  1ZKG A;  3ZN0 A;  4KIT B;  3C2H A;  2P6S A;  3I59 B;  3PSI A;  2R4G A;  1J2X A;  2IJL A;  2KFD A;  2ISZ A;  2DMQ A;  3I4P A;  5EJC A;  4F3Q A;  2OZU A;  1C0W A;  3C7J A;  3U1K A;  3PO3 J;  4PJN A;  2MGQ A;  3GTL J;  1SVM A;  5HOO A;  1ETX A;  4G7Z F;  2R7Z J;  1MJ9 A;  4C3I J;  1ZQ3 P;  2FSW A;  4EM1 A;  1SEU A;  4RGX A;  3H9G A;  3W2W A;  2VE8 A;  2JK3 A;  2CQQ A;  3VPR A;  5M3M J;  3OYM A;  5ILU A;  4KMU X;  4YIR X;  4ESF A;  4EM2 A;  5A2Q K;  2I5U A;  1SD7 A;  1A6I A;  2H1L A;  2KDO A;  1KU7 A;  4B47 A;  5BOX A;  4WXH A;  5LD2 C;  2EPF A;  3SQN A;  2KPM A;  2KDZ A;  4IF4 A;  2BOL A;  5LGT A;  4Y52 J;  2IPQ X;  2BXZ A;  2OU2 A;  5D4S A;  4C2T A;  1YQA A;  2J5P A;  4UVB A;  2CU7 A;  3CF5 F;  2O0Y A;  1ETY A;  4DZP A;  1W36 D;  2OC6 A;  2DA3 A;  4IQ4 A;  1FMV A;  2DA2 A;  5EDN A;  1XC5 A;  4CCM A;  2A5Y B;  5L3F A;  1QZZ A;  3V8L A;  4IRI A;  4EMS A;  3MFK A;  4LG0 B;  1SD5 A;  1O3Q A;  1P92 A;  5ILS A;  2JJ7 A;  1U9O A;  4BDY A;  2D5V A;  1BI1 A;  2DFF A;  4MNU A;  3TBI A;  2DA5 A;  2RDP A;  3BWG A;  2WA0 A;  3LOC A;  4BS9 A;  4UV9 A;  5EYR A;  3CLQ A;  3SEQ A;  2VXD A;  2O8K A;  1S29 A;  4L0Z B;  4OMY A;  3BPX A;  1XSD A;  2VPL A;  4MTE A;  3RYP A;  2K9N A;  4BEH A;  2VOO A;  1GLN A;  3I56 I;  2VQL A;  4LB5 A;  2RGV A;  3B02 A;  4X1E A;  1Z6T A;  4KNY A;  1X1A A;  2WAQ A;  3KFW X;  3VYU B;  3UKG A;  1AOY A;  1RET A;  4LLL A;  2KLO A;  5IP9 J;  2Z33 A;  4JK1 X;  1UHM A;  3QYB A;  2LKX A;  1OYY A;  1H9G A;  1JGS A;  2W1O A;  3MZY A;  3JRE A;  2DT7 B;  2V6E A;  5AIP A;  3F8N A;  2R5Y A;  2KJC A;  1QGP A;  3ZQF A;  2STT A;  1H8A C;  3BCA A;  4M3G A;  1A31 A;  2A69 F;  5C44 J;  3CJQ B;  2VBW A;  4BHC A;  5KK1 A;  4ZDP A;  1BR1 A;  1JGG A;  3R6S A;  2GA2 A;  2XHK A;  4LIV A;  2G7H A;  5EEH A;  5LEJ A;  1ETK A;  2DA7 A;  2DLL A;  5M3F J;  2VKD A;  4PJ0 C;  2ETH A;  3FIS A;  2RRE A;  2LD5 A;  3CCU I;  3DV8 A;  3HRU A;  2X1C A;  4A3M J;  4BE1 A;  2V1D A;  1BM9 A;  5L3C A;  3J7A O;  1D1C A;  2GAU A;  1PDN C;  3EYI A;  5EEA A;  2I10 A;  3PFY A;  2L2O A;  1L0O C;  2XAQ A;  4HDV A;  3S3M A;  2P6T A;  1FPQ A;  2R7V A;  5LGN A;  3C2B A;  1S8N A;  2JSC A;  1WWX A;  2FOK A;  3H3U A;  4Q48 A;  3KYL A;  2FNA A;  5KVR A;  2R7D A;  2CW0 F;  3BC8 A;  1R49 A;  1F5T A;  3OOP A;  2DFI A;  2L4M A;  3RPQ A;  4BJT A;  1JUS A;  2V1X A;  4NNJ A;  4BYY A;  2ID3 A;  3OYL A;  5D5W B;  2ZSI B;  1JUM A;  3CJR B;  2ZBK A;  2LRE A;  3HOS A;  4FHT A;  4RGU A;  3OL4 A;  3ZQL A;  3AAF A;  5F1J A;  4FCY A;  2HNH A;  5JHF A;  5HNF A;  3K2A A;  4LLG F;  3GTJ J;  5DS9 A;  1J75 A;  3MD2 A;  5L3G A;  3FZV A;  2JTV A;  3CCY A;  3ZOB A;  4HST A;  1YW7 A;  2Q8K A;  2LYC A;  5JFR A;  1YS7 A;  3KYD B;  4EVI A;  3HRM A;  1HF0 A;  4I0B A;  2N8G A;  3IAS 2;  4KFC A;  4I2O A;  3L09 A;  2R7Q A;  4HZF A;  2K5C A;  5JI6 A;  1U5T A;  2VJ4 A;  2L7Z A;  4G6Q A;  1NG7 A;  4IKF A;  2GZW A;  1RR8 C;  1E3O C;  5M5W J;  2K9S A;  3T1B A;  1UG2 A;  2F2E A;  2DYR H;  3OSG A;  5D5V B;  1VQO I;  5HS8 A;  2EZI A;  2VBY A;  3TO7 A;  2L9V A;  3FXL A;  3OYK A;  4XLN F;  1RKT A;  1EF4 A;  2HI3 A;  2Y0M A;  1S72 I;  1XDU A;  2XAH A;  4E7S A;  2E60 A;  3GBG A;  4M73 A;  5K1Y A;  3BP8 A;  4CH7 A;  2DXI A;  4XID A;  1Z67 A;  2KMU A;  3PIP F;  2ZXH A;  3BTI A;  3CCL I;  1OKR A;  2CMP A;  5BMZ A;  2YR2 A;  2XUB A;  3P7N A;  4C30 A;  1OYI A;  2RNG A;  2WY8 Q;  4L9N A;  4A6D A;  3M8J A;  4IPA A;  2ZFW A;  1EA3 A;  1BJA A;  3E5X A;  4Y33 A;  3DEW A;  3EUH C;  1MBK A;  2BY0 A;  5J40 A;  2K40 A;  3CTA A;  1EKE A;  2GBY A;  1YE9 A;  2XSD C;  4I76 A;  3HKZ N;  1U9N A;  1BBY A;  3V8K A;  3RI4 A;  2G0E A;  5TIS C;  3P5J A;  3H5R A;  2FXA A;  2TRT A;  5E3L A;  4NQW B;  4BKX A;  4E7L A;  1TQI A;  3DEE A;  3FMQ A;  1XMK A;  2E34 A;  3A2K A;  2GXB A;  2DMU A;  2HQ5 A;  2X9D A;  1W7P D;  5HDK A;  3OYG A;  4ZYG A;  4QTR A;  2YU9 J;  3MKZ A;  4U87 A;  1S9H A;  3DU5 A;  2EIN H;  3WHB A;  1IW7 F;  1TLH B;  5E1X A;  5FRN A;  4KDP A;  5TJJ A;  3VWB A;  1QVU A;  3ISP A;  1DQU A;  3LQQ A;  1DPU A;  3S2D J;  2X6X A;  4EJW A;  4ZDO A;  3K69 A;  4YII A;  4IVN A;  3HUG B;  2VJI A;  4CCJ A;  3FXO A;  1USS A;  1WRJ A;  3QP5 A;  1XGS A;  2F4I A;  2E1N A;  2M45 A;  3PQJ A;  3ZQ7 A;  2B0L A;  2A05 A;  1YIO A;  2P7V B;  3ONQ A;  1RUO A;  1MMG A;  2O6G E;  3PUB A;  5JLX A;  2LG4 A;  2CFO A;  4HOB A;  1YTY A;  3FXR A;  4IRG A;  4N9H A;  2MLG A;  1R7J A;  1KU2 A;  3K6G A;  4P96 A;  1TWA J;  1MMN A;  3J7Z I;  3F8C A;  4D9J A;  4I6Z A;  4A3E J;  5D8L B;  2ADU A;  1BC7 C;  3KEO A;  2FU4 A;  1WQ2 A;  5IYC J;  1X1D A;  3LMM A;  2E2I J;  4YIF A;  3H0G J;  2LF8 A;  1YLF A;  5HLH A;  3W2A A;  3FDY A;  4LD5 A;  4D0P A;  2K3F A;  3IV5 A;  5DCM A;  2L01 A;  1PUF B;  1YRN A;  1CF7 A;  1JKQ C;  3I4N J;  1IDZ A;  1T0F C;  1QA6 A;  5D6E A;  3M3Y J;  3H1C A;  2LP0 A;  5HLT A;  1LEB A;  2CWE A;  4MQ9 F;  4FE7 A;  3VYT B;  4XON A;  3HPG A;  1T98 A;  3JW4 A;  4RB0 A;  2CUZ A;  1BIB A;  1POG A;  3O8H A;  3AG4 H;  1GVJ A;  4ABZ A;  2Q1Z B;  4QPQ A;  5FLV A;  3Q0V A;  4A93 J;  3K7A J;  2PQ8 A;  3WGH A;  1SFU A;  3CCQ I;  2O9L A;  1AWC A;  4D5F A;  4FX0 A;  5FKO A;  1VTN C;  1EH7 A;  1IN8 A;  3M9A A;  5EG0 A;  1ON1 A;  1P4A A;  5EGO B;  1WJA A;  3D5L A;  1NK3 P;  2QQ8 A;  1Y39 A;  2Y9Y A;  4ZYA A;  4PFP A;  1IO2 A;  4AYB A;  4CCN A;  1K83 J;  2I8D A;  2H8W A;  2JMW A;  3OOU A;  2P81 A;  3W6K B;  4HDU A;  3BJO A;  3E6C C;  3ZQC A;  2CW8 A;  3ESW B;  1MSF C;  1BOA A;  1HXD A;  1LJ9 A;  2K86 A;  2E5N A;  2LR8 A;  5E17 F;  2VON A;  2E35 A;  3TP3 A;  3V8J A;  1IV6 A;  4LGW A;  5HLI A;  1S3J A;  5DUI A;  3CC7 I;  2ECC A; 
#chains in the Genus database with same CATH homology
 4ZTJ A;  3UR3 C;  3OYD A;  4ANJ A;  1X4O A;  2XDV A;  4H4K C;  2HZD A;  2DOA A;  3LL7 A;  4JQF A;  4BAC A;  3LFU A;  4PJL A;  4CSW A;  2KP6 A;  2X1E A;  3PNY A;  3RTR A;  3K4B A;  4LG3 A;  4B3X A;  2VLA A;  3FHN A;  2K9M A;  3V42 A;  2DT6 A;  4BL0 B;  1OR7 C;  1TZL A;  4XR6 A;  3OYN A;  3K4N A;  2X6Y A;  4XMY A;  2R7R A;  2PJR A;  2Z16 A;  5KHD A;  1BOB A;  4C2U A;  1YX5 A;  2LBF B;  2W4S A;  1UEL B;  3OR2 C;  3L2Q A;  4HNT A;  3RCO A;  1FMW A;  3LSH A;  2UWM A;  2KZV A;  4XN0 A;  4E7H A;  2V4J C;  1WJC A;  2Y0S A;  3QYF A;  3HKZ A;  3BG7 A;  2JVH A;  3LSG A;  3VSL A;  1Z3Y A;  4DIQ A;  4F55 A;  2HVR A;  4NC7 A;  2HVQ A;  4E7J A;  4XKC A;  3K10 A;  1Y56 A;  5KNL A;  1Z3X A;  4YRV A;  2WAF A;  4PSX A;  4EAT A;  2WBM A;  2X1D A;  2IGK A;  1V5F A;  1KON A;  2R7T A;  3OL3 A;  3S3N A;  1MND A;  3VYR B;  1N78 A;  3CP2 A;  4NC8 A;  4BE0 A;  3CF2 A;  3CP8 A;  4II3 A;  4XOT A;  2XF5 A;  2R7U A;  4PUS A;  4PFO A;  4ITV A;  3K70 C;  3OS1 A;  3AL0 B;  3HOT A;  1R6R A;  2V26 A;  3AFH A;  4RM2 A;  2K9L A;  3HXL A;  3IP4 B;  4CCK A;  2ZSH B;  3VDX A;  4XL9 A;  3W3C A;  4E6K G;  2R7W A;  1E0E A;  3J7A Y;  3DPU A;  2X6W A;  3H9J A;  2LBF A;  2W82 A;  3MMY B;  3LSM A;  2VB6 A;  3K4M A;  1N75 A;  2MD0 A;  1P9Q C;  4LIU A;  4DBR A;  3PSF A;  2AQE A;  3OYA A;  3PL8 A;  3QYE A;  4LIT A;  1K6Y A;  4J01 A;  2M7B A;  2RQQ A;  3D5S C;  3BCB A;  5HVQ C;  2F5V A;  3ZCO A;  5FRM A;  4KIS A;  3HG9 A;  4U7B A;  3OYB A;  3I3L A;  2VQH A;  2OUM A;  2WY7 Q;  3CZ6 A;  1HA8 A;  2JUG A;  2W00 A;  5TGT A;  1Z7L A;  3E1S A;  3FKJ A;  2CH0 A;  4XLH A;  4ZTF A;  1LKX A;  3L2W A;  2MAB A;  3RQ4 A;  4KIT B;  3A1Y A;  1PJR A;  4BU2 A;  3C2H A;  3PSI A;  2R4G A;  1WJB A;  4F3Q A;  3DWL E;  1LDK B;  4PJN A;  2CUJ A;  2M4G A;  1J09 A;  4CZC A;  5HOO A;  2IS1 A;  4Y3O A;  3H9G A;  3H5N A;  4PJJ A;  3W2W A;  1AA7 A;  3DKY A;  3K4J A;  5CQG A;  3OYM A;  3H35 A;  2XSJ C;  3DQV C;  3W2V A;  3OIP A;  4BUP A;  3ZR8 X;  2KDO A;  4DOZ A;  2MC4 A;  4B47 A;  4BEH B;  3IAM 2;  5LD2 C;  1ERD A;  2L9N A;  4BDZ A;  2KPM A;  3QOE A;  2HPM A;  2BOL A;  2VAS A;  4C2T A;  2M0M A;  2X51 A;  1W36 D;  2IGN A;  2OC6 A;  3FBI B;  1G8X A;  4IQ4 A;  3FBN B;  1FMV A;  3S93 A;  2X85 A;  4CCM A;  3DKX A;  4KT6 A;  2UUZ A;  4B43 A;  1T95 A;  2MFZ A;  2IXS A;  1Y6I A;  2M3A A;  2WB1 A;  2KRC A;  4BQN A;  3SYT A;  2HPI A;  3M1C A;  4BDY A;  2Q2E B;  3TBI A;  1MMA A;  4X0G A;  2VJ5 A;  2WA0 A;  4BS9 A;  4MLO A;  4XKW A;  3SEQ A;  2LH9 A;  3K4L A;  2VXD A;  2VKH A;  3ZGK A;  1NG6 A;  4XNF A;  3OS0 A;  1V5E A;  2IGM A;  3K4C A;  4RLQ A;  2VPL A;  4XQF A;  1YX3 A;  1LFP A;  3OYI A;  2IS2 A;  1D0Y A;  3VYS B;  4BEH A;  1GLN A;  4HNU A;  1QU3 A;  2VQL A;  1DP3 A;  2A6T A;  4RMN A;  4OAZ A;  3L2V A;  2WAQ A;  1X1A A;  1DGW Y;  3VYU B;  3VSK A;  3OYC A;  4E7I A;  3KEY A;  3PJR A;  2KLO A;  1D0Z A;  2PMZ A;  1WJF A;  1WJE A;  3QYB A;  4AVZ A;  2W1O A;  1QHG A;  1V5G A;  3DPT A;  3F9K A;  2DT7 B;  1SAU A;  4HRI A;  2V6E A;  2LC2 A;  3L2U A;  3OR1 C;  4RM3 A;  2KL4 A;  3BCA A;  3BLY A;  2A5W A;  2Z1D A;  3EUK L;  4CA0 A;  2VIX A;  1BR4 A;  3CJQ B;  5KCM A;  2F6C A;  4ZDP A;  1BR1 A;  2V1N A;  2R7X A;  4HG2 A;  4KJZ A;  4LIV A;  1W36 C;  1N77 A;  4F52 A;  2BW3 B;  3U21 A;  4OAY A;  4XN3 A;  4XLC A;  1VZ0 A;  2VKD A;  1MNE A;  2DCE A;  2RRE A;  3LSK A;  4N4N B;  4YEL A;  3SEZ A;  4HSR A;  2X1C A;  4B48 A;  3OY9 A;  4BJ6 C;  3DTK A;  4CUG A;  1D1A A;  4BE1 A;  4PJM A;  1D1C A;  2BVM A;  2L9S A;  3PFY A;  2L2O A;  4IQJ A;  3S3M A;  2JVG A;  3K4K A;  4ZJZ A;  2R7V A;  4BGD A;  2HU9 A;  3OWT A;  4E7Z A;  4XKB A;  1DGR M;  4F93 B;  5CQE A;  3KYL A;  4BQO A;  3BC8 A;  2CS3 A;  4F92 B;  1X19 A;  4BJT A;  2W7N A;  4NNJ A;  2ZXI A;  2K3P A;  3L2R A;  3OYL A;  2VQC A;  2ZSI B;  2LRD A;  3OS2 A;  2IS6 A;  5CPR B;  3CJR B;  2LRE A;  3CMM A;  3HOS A;  3KX2 A;  3OL4 A;  4BQQ A;  3TMO A;  4XKV A;  3H5A A;  2CV0 A;  5HNH A;  2HNH A;  3OIQ A;  5JHF A;  2BW3 A;  5HNF A;  3OYF A;  2UV1 A;  3MD2 A;  2VXZ A;  3SZG A;  4JOM A;  4N4O B;  4D1Q A;  4HST A;  3DTE A;  2LYC A;  2HVS A;  4P1W A;  2KHM A;  3OYJ A;  3DLA A;  3MKY B;  3IAS 2;  1D0X A;  1X4P A;  2R7Q A;  2K5C A;  4B44 A;  1TT0 A;  2M4K A;  2M7A A;  2VJ4 A;  2CV2 A;  2JSP A;  1U0J A;  1NG7 A;  3C2G A;  3D5R C;  4IKF A;  2XF7 A;  4J00 A;  4II2 A;  2ELJ A;  4GRI A;  4AU7 A;  3DTI A;  1ZEL A;  1IRX A;  2V7F A;  4Y4R A;  3OYK A;  2HQA A;  2QKL B;  2CV1 A;  4XM3 A;  3G2B A;  4E7S A;  2E60 A;  3GBG A;  4CH7 A;  2DXI A;  1MW7 A;  2KMU A;  2ZXH A;  2VJJ A;  2CMP A;  3CES A;  4C30 A;  4DGW B;  2RNG A;  2WY8 Q;  2P0W A;  3RPU D;  5LFA A;  1X1B A;  3M8J A;  2QKM B;  1EA3 A;  4XLF A;  2OV7 A;  1OLT A;  1UAA A;  2AQF A;  4Y33 A;  3EUH C;  1SFK A;  3HPH A;  2XAU A;  1PYV A;  4NUB A;  1YE9 A;  4CCO A;  4XOP A;  3I9V 2;  3H5R A;  4PSW A;  2GOX B;  2LOO A;  4IZZ A;  4E7L A;  1D1B A;  3A4C A;  4NQW B;  3DEE A;  3A2K A;  3BG6 A;  3OYG A;  3EPZ A;  3MKZ A;  4U87 A;  1S9H A;  2MYS A;  3DU5 A;  4F91 B;  3HL2 A;  2V9K A;  2R7S A;  4YEJ A;  3H9Q A;  5FRN A;  1WFX A;  3VWB A;  1DQU A;  4DJA A;  2X6X A;  4ZDO A;  4BJ5 C;  3HUG B;  2VJI A;  4CCJ A;  3OYE A;  4OWR B;  1WJ5 A;  2WAD A;  2JA2 A;  2F4I A;  1X1C A;  2FUG 2;  2NOJ B;  1BR2 A;  3TL4 X;  1QHH D;  3ONQ A;  2XF6 A;  4FET A;  1MMG A;  3PUB A;  2LG4 A;  2L7K A;  3S32 A;  2CFO A;  2KQR A;  3E0J B;  3K6G A;  4BXF A;  4E4H A;  1MMN A;  2WAE A;  3MKW B;  3AKZ A;  2ZFU A;  4D9J A;  4G6T B;  1WJD A;  1MMD A;  5CKT A;  1X1D A;  3DU6 A;  1UG0 A;  2IS4 A;  3LMM A;  3NWT A;  3EUA A;  3W2A A;  2Z2S B;  2VL8 A;  3FDY A;  4RLF A;  3N05 A;  4P5O A;  3ZQQ A;  4HPQ A;  1T0F C;  3AL0 C;  2CW7 A;  4IX7 A;  4BE2 A;  3DPL C;  4C9Y A;  4DBQ A;  5HLT A;  4QPO A;  3VYT B;  2IGO A;  3HC7 A;  2E1M B;  3HPG A;  4HEA 2;  4XON A;  2CUZ A;  2XC7 A;  2LY1 A;  2BVL A;  4XOR A;  3OYH A;  2Q1Z B;  4QPQ A;  3NWS A;  3RSN A;  3PNV A;  3LSI A;  2GOM A;  4R79 A;  3QOD A;  4PK4 A;  1LVK A;  2L5Q A;  3S3O A;  1WJA A;  3D5L A;  2E1M C;  2LY2 A;  2VQG A;  1JI8 A;  4FAS D;  2PJR B;  4ZYA A;  4AYB A;  4PFP A;  2E5Z A;  3S8P A;  4CCL A;  3OMY A;  4CCN A;  2I8D A;  2O5R A;  3OOU A;  4XLE A;  2CW8 A;  5FRO A;  1G59 A;  3ZXS A;  3H0D A;  2KRH A;  2E5N A;  4E7K A;  4ZC3 A;  4XLA A;  3K70 D;  3PNT A;  1Z21 A;  2R7O A;  3IUO A;  3UNG C;  3ZRG A;  2DJI A;  4ZDL A;  2HDW A;  3SDB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...