1XSXA

Nmr structure of sso10a, a hyperthermophile dna-binding protein with an extended anti-parallel coiled coil
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
95
structure length
95
Chain Sequence
AKKKSKLEIIQAILEACKSGSPKTRIMYGANLSYALTGRYIKMLMDLEIIRQEGKQYMLTKKGEELLEDIRKFNEMRKNMDQLKEKINSVLSIRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Sso10a
publication title Solution Structure, Stability, and Flexibility of Sso10a: A Hyperthermophile Coiled-Coil DNA-Binding Protein(,).
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 29
structure length 95
sequence length 95
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14947 HTH_45 Winged helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1xsxA00
2CGPA 2HOEA 4Q47A 5E18F 2Q2EA 3FXRA 3SFZA 1QBJA 2YX7A 1U6GA 1PP7U 1B9NA 3BROA 3FX3A 4MGRA 3JTHA 1KU7A 3FWEA 5DCFA 1U5TB 1IN6A 1UHMA 1XCVA 1ZYRF 5E17F 2M87A 4MTEA 3T5XA 4BNCA 1KU9A 2OAZA 3QU6A 4L9JA 4U0YA 2DTRA 4RS8A 1TBXA 4A0ZA 3DKWA 5F1RA 5L3CA 2EJRA 3E5UA 2EFOA 3DPLC 1YW9A 4LB5A 3C7JA 4IHSA 3CO6C 3FF5A 1GVJA 4U88A 4HDUA 1XSVA 5D5WB 1O3TA 2ZNYA 4OIPF 3ECOA 1P4XA 4Y15A 3ZMDA 3TOAA 2O6GE 1T2KA 4B09A 2Y75A 1F5TA 4L18B 5HS8A 4M73A 1KA8A 4CZZA 1T98A 4HLYA 2IP2A 4LLGF 3I64A 4BXUA 2GZWA 4M6XA 3RKWA 2O03A 4FX0A 2FQ3A 3GF2A 4EMSA 3WG9A 5JVTA 3C18A 3P9IA 3DFGA 4RB2C 5CVUA 3P9CA 3BOQA 1XB4A 4AIJA 3I4PA 1TQMA 1R1TA 5J8FA 1XGOA 2UXNA 1FNNA 4HF2A 4M71A 3ML6A 3CDHA 3HSEA 5FB2A 1P4WA 2ESNA 1O57A 2M5WA 3KP3A 5E1ZB 3L00A 4GGGA 3MQ0A 3WGHA 1G6NA 5TJJA 4G8XA 5FLXZ 2KJCA 3F6OA 3REOA 5JI6A 2LKPA 4BHPA 2MH9A 1BN5A 3HOTA 2RV8A 5HVQC 1SFUA 4Y17A 1AOYA 2P7CB 2VE8A 1W5TA 3EETA 1J9IA 3KEQA 3BJAA 1XSDA 1OYYA 2P4WA 4RAYA 5CVJA 2H6CA 1U2WA 4DNCA 2XV4S 4EV0A 1WI9A 4G6DA 4ENMA 4LD5A 1SMTA 4A6DA 4P55A 2E7WA 2STWA 5LRRA 1TTYA 1SFEA 1STZA 2HTSA 3WE3A 3RPUA 4P9UA 4LLLA 2ZBKA 1FP1D 2ACJA 2O61A 2FMYA 3KETA 5BOXA 1FT9A 4UNOA 3E6DA 5E1XA 2MD5A 4S05A 1YFHA 1TLHB 1P92A 3HHHA 1ZG5A 4MEYF 3I54A 3SXYA 3VB2A 3F23A 5ILVA 2IT0A 3TDZC 4LMYA 3EYIA 1PP8F 2HYFA 3VOEA 3R61A 5ILUA 4OIQF 5CLSA 4WXHA 3RYPA 1UB9A 4EJOA 1KYZA 3IL2A 2ZMEA 3IC7A 3SZTA 3KP4A 5ICGA 2IW5A 3RJPA 2C6YA 3SQNA 3GZ5A 2ZCWA 1Q1HA 1HQCA 3WTZA 4AIHA 3LA3A 4IRIA 2HKXA 1EH6A 3IHUA 4LJZF 3K0LA 1L0OC 5IT3A 2HDCA 1OYWA 1WSUA 4YFNF 1W4MA 1W7PD 2EK5A 2OA4A 2W24A 2VODA 2COMA 4G7ZF 2LF7A 4WK8F 1OMIA 2VC0A 2XASA 1HXDA 2CW0F 2QLZA 2K27A 4HX8A 1BC8C 1S3JA 1IRFA 2PJPA 1ZRDA 1Z6TA 4G7OF 5F6FA 2CYYA 1CF7A 2UXXA 4ZYHA 5HDGA 4UV9A 1GXQA 1CGPA 4IVNA 2BEOA 4EM2A 5HDKA 3BDDA 5HLIA 5ERIA 3ZMUA 4I02A 2XROA 3ZMTA 2YU3A 3BPVA 2CSOA 1J59A 1V4RA 2P5VA 4ZYDA 3JSPA 2KIUA 3F21A 4Q5SF 2FNPA 1DPUA 1DUXC 3ZP5A 1YLFA 3V7RA 1MD0A 4I01A 4JQFA 5EEGA 1YW8A 2KIFA 1U5TA 4RGXA 1R5HA 2EFPA 3ZN1A 1SD7A 1PUEE 1XD7A 2LDUA 3R0JA 2V1XA 4R1HA 1I27A 2IVMA 3WTSC 2J5PA 4RB0A 1O3QA 1L3LA 1FLIA 1BIAA 3FHZA 1WWXA 4CICA 3J7AO 4OMYA 2LSOA 1HBXG 3I5UA 4RB3C 2PI0A 5JFRA 2NNYA 3ZMZA 4UVAA 1XGSA 3IRRA 4ENKA 1TW2A 5LGTA 2GXGA 2UZKA 2ZNZA 1SMYF 1OYIA 3BPXA 2LF8A 4HYEA 4M74A 2QUFA 1AWCA 2Q8KA 3GW2A 1B9MA 4LG0A 1HKQA 4QLCU 2VBWA 6PAXA 2Y48A 1LVAA 4WCGA 4ON0A 1OKRA 3WTYC 5D6EA 2XVCA 4KNYA 1MZBA 2EFQA 3BY6A 4YIFA 4WX9A 1P6RA 5HS9A 2RC4A 4NHJA 2RGVA 2PMHA 4IF4A 1JHFA 4ESFA 2XIGA 2GQQA 2ZMEB 3T0YA 2FF4A 4I2OA 3CUOA 1SD4A 3J81K 1ON1A 1U8RA 1IN7A 1XDSA 4ETSA 1R1UA 3GLXA 4HF1A 2VE9A 5BMZA 1IXCA 4ZYEA 2A6HF 5DYMA 4P9FA 4IXAA 2BBYA 4UXNA 3Q9VA 3QAHA 4LGWA 2VC1A 4L5IA 4G94A 1ZLJA 1J5YA 1OR7A 3SZPA 2XRNA 1UFMA 3LAPA 3T8TA 3QRFF 1BI3A 2K7LA 4HX4A 1E2XA 1LJ9A 3NQOA 2XKOA 3GXOA 3TQNA 3RKYA 4HZFA 2FBKA 1H9TA 4L5JA 3MZYA 2XAFA 4YG2F 3R0AA 4UV8A 3WODF 1KU2A 3TO7A 1FYKA 3RKXA 5K5QA 4ESBA 4ZZDA 2MLGA 1IUYA 2VBXA 3RTRA 1FBQA 1BI0A 3Q9SA 4L0ZB 2K86A 4KN7X 5FGMA 5CVIA 3ROUA 1LQ1A 5E8IA 3GFMA 2D45A 1JHHA 2M30A 1FBSA 1Z91A 3R4KA 5FFZA 2O8XA 1IAWA 1MJ9A 3HTSB 3PQKA 2JRTA 4HAMA 2QYOA 2X4HA 4PGGA 2BE5F 4RGSA 3GUDA 3ISPA 3V8KA 5ICFA 3HSRA 4EJWA 5E20A 1T39A 3LQRA 1VTNC 4BYYA 1DP7P 2GA2A 3F22A 3FMSA 4MNUA 2KJBA 5H6RA 2B0LA 5D6FA 5BS6A 5CJ9A 1D8KA 1LDDA 2YPRA 3E97A 1TW3A 1LB2A 5K1YA 4GYGA 4LG0B 5L3GA 2KRFA 3GEZA 3GFJA 4ENNA 1K78A 4LLNA 4KMFA 3GYHX 1BIBA 3KCCA 3NRVA 2KIMA 1B1BA 2QWWA 1NHAA 2NAZA 2W57A 4HQEA 3KFWX 2GA1A 5HLGA 3M7GA 4KMUX 4CO8A 3ERED 2P6TA 1B59A 3BJOA 1G3SA 4M72A 2IA1A 3I0TA 5LGNA 1EV7A 2JSCA 2H09A 3F72A 1P4AA 3ABTA 2QBYA 3JAMK 2R7DA 5AIPA 4HV5A 1BJAA 1HKTA 2A69F 1Y0UA 2HKOA 3CLOA 1XGMA 1BOAA 1EH8A 4KIBA 1R23A 5ILSA 1HKSA 2F5DA 2HYGD 4EQQA 4UVBA 3KLOA 4TV7A 4Z2YA 2HQRA 1BI1A 2QENA 4XSXF 5D5VB 1W7PB 5JHUA 5L3BA 1QPMA 4N9HA 4PCQA 1OPCA 1HW5A 3G3ZA 5DD4A 2DPDA 3HSFA 5DDGA 1UCRA 4K2EA 3F8BA 2XHKA 1FC3A 3T1BA 4P96A 1MKMA 1S7OA 3CUQC 1ZG1A 4QWQA 4N9IA 3RIRA 2VBYA 1ODDA 4RB1A 1Z7UA 2HR3A 4OIRF 3JW4A 1BI2A 1IRGA 4MQVA 3W6KB 2DI3A 1SD6A 2L4AA 1JXSA 3QPHA 4A0XA 1QGPA 2Z3YA 2QVOA 3MAJA 5LHGA 3F6VA 2Z33A 1YQAA 4IRHA 5CVVA 1YG2A 3MZHA 1IXSB 5K5OA 3V7SA 4CGZA 1QNTA 2HQNA 2AXLA 2V9VA 3F3XA 4MEXF 3GFIA 4KDPA 4S04A 3K2ZA 5EEHA 2L02A 1XGNA 4OU0A 3C1DA 4I7HA 2HS5A 5IT9K 4O3MA 3E6MA 4XRFA 2FBHA 2NRAC 1F1ZA 2OQGA 4OINF 1IN4A 4KN4X 4A6EA 2VBZA 4EM1A 2V6CA 4AD9A 1XN7A 3K1MA 3OV8A 5D4SA 3KZZA 1ZN2A 5D5UB 2EA2A 4R8HA 3KP2A 2P7VB 1RNLA 2L01A 3QP5A 3ULQB 2HZTA 2DQRA 5J8CA 2GAUA 5FD5A 3K9TA 2QZ8A 4GXOA 3TDUC 2DO7A 5DD8A 3N97A 5DUKA 1DPRA 4G6QA 2QQAA 2VT2A 3JTGA 2W84A 1FYMA 4CHUA 4OIOF 4M9ZA 3I53A 1D3YA 1KU3A 5HLHA 3NEUA 4HQMA 1K78B 4IJAA 2DBBA 4YIIA 2H27A 3F8CA 2VOPA 3V4GA 5LHIA 4L9VA 1R36A 5KK1A 2DPUA 3M1EA 3VFZA 2FRHA 2EB7A 5LLQA 1V3FA 4CDGA 3HRUA 1IW7F 3ZMSA 4XLPF 2QBYB 1YIOA 2EV6A 4FX4A 4ENJA 1FPQA 4G9YA 5L3DA 1FBUA 2FNAA 4LFUA 2ZO4A 2JZYA 3O3KA 2M45A 2CG4A 2XKPA 2CO5A 2A3SA 1YS6A 2L54A 1XMKA 2CFXA 3BP8A 4HBLA 3V8LA 1G3TA 2Z9OA 1R22A 1YO5C 1RUNA 4LB6B 5E8GA 1W5SA 3IKVA 1HW1A 2K4BA 4UUVA 4HA8A 2HGCA 3WTUC 1G3WA 1U78A 1MJBA 2NS0A 2FBIA 1R7JA 1S6LA 1ZRFA 5L3FA 3FM5A 5HS7A 1E17A 1MDMB 3GX4X 1ZGJA 1S29A 2HFHA 2PLYA 2P5KA 3IWZA 4Q4ZF 4EGYA 2YX4A 3WE2A 5CVRA 2ISZA 2H94A 4U7DA 3J81Z 3PFIA 1LDJA 1ZH5A 4YFKF 4Q48A 2V1UA 4O6JA 2A68F 3R60A 3CJNA 2EWNA 2PBIA 4I0AA 1KQ0A 2VT3A 3MCZA 1J7KA 5DV5A 3TO6A 3Q5FA 5LEKA 4NQWA 3I58A 3LSTA 2E7XA 3D0SA 4GCVA 2FXAA 3ZN0A 1K6OA 4RAZA 2G7HA 1K7AA 4F7ZA 2BV6A 2DLLA 2LNBA 4ASNA 5CYVA 3TGNA 1LEAA 3V7CA 2XAJA 2Q0OA 3DEUA 4EM0B 1J0RA 5JR3A 1Z9CA 2D1VA 3D5LA 1LEBA 2FA5A 2MC3A 1XSXA 1LDKB 4HV6A 3KP5A 1Z1DA 1W7PA 4RGUA 4JK1X 3DV8A 2FSWA 2A07F 3JSOA 3GZ6A 1B6AA 2F5FA 1U5TC 1FOKA 3EYYA 5A2QK 5J6XA 1FZPB 4M9XA 3HYIA 2XAQA 2HTJA 3LA2A 4G7HF 1FX7A 3I59B 1R00A 1FSHA 3FXQA 2DT5A 3HUGA 2QQBA 1YTYA 5FO5A 2ZFWA 5H6QA 4UHTA 1O7LA 2EV0A 4IRGA 1QZYA 2FEZA 3LQQA 4D0PA 3EDPA 4E70A 1FSEA 1K79A 3PQJA 1IZ1A 1IN5A 2EFNA 2PMUA 4EVIA 3GVAA 3F8MA 3IWFA 4ZH4F 4MTDA 3E3VA 2BYVE 2Z5UA 2P8TA 2KKOA 4L9TA 1C0WA 3KLNA 2JPBA 2DK8A 2V1DA 5L3EA 4L0YB 1ZAOA 1IN8A 3J80K 3B73A 4MHGA 1D5VA 4LK0F 4A12A 3LA7A 1PDNC 4HLXA 1ZREA 3CUQA 2AS5F 2FOKA 2IA0A 2RNJA 4OMZA 3C3WA 2TDXA 2Y0MA 3LWFA 4FT8A 2F5CA 1FP2A 2R3SA 4XBFA 5DUIA 3FM3A 2QQ9A 2UWMA 3COAC 2HEOA 3G73A 2YSRA 3O2PE 2ZKZA 4PGHA 2GIVA 1U3EM 3DPTA 3B02A 1ZRCA 3WU0A 4H0EA 2OZ6A 1KQ8A 3JAMZ 2NYXA 3FMQA 1XDUA 4BHCA 4I98B 4BH9A 3M8FA 2PN6A 2WV0A 3F8FA 2OD5A 2D2WA 4HW0A 4WXDA 3FXUA 3HTUA 2MBFA 5AIQA 2FE3A 2MA3A 1ZHFA 2STTA 2K4JA 4M9SA 5DCMB 4IPAA 1TQPA 3M9AA 1T38A 2OZUA 1TNTA 4O5VA 5BPDA 5HDNA 2V79A 2ISYA 2VN2A 3E6CC 4IHTA 3E5QA 5LGUA 3TOBA 1JGSA 1XMAA 4HX7A 1R1VA 2OU2A 4R79A 4EGZA 2L4MA 3F8NA 3N4MA 1FYLA 1YW7A 1Z6RA 1J2XA 2BGCA 4KIFA 2VOOA 1DDNA 1RIOH 1O3SA 1H9GA 3P9KA 4RGRA 2EFWA 4AIKA 1MDMA 3GO5A 2MLKA 1F9NA 1ZGAA 1QO0D 2ESHA 4XLNF 1P2FA 3WGGA 4BHBA 5FLXK 2RKHA 3AAFA 5IT9Z 4KT5C 3HRMA 2XAGA 1SAXA 1USSA 5ED4A 1QQIA 2IJLA 1USTA 1EH7A 5E1WA 4KIGA 5ICCA 1D8JA 3U9GA 3U1DA 1FY7A 3T8RA 3DXJF 2A6EF 3FMRA 5KVRA 1S8NA 1B4AA 1R58A 1XCBA 3H92A 1KYWA 3TO9A 1QZZA 4U0VA 4MQ9F 3BJ6A 3WTWC 1RI7A 4ESJA 4U0WA 1BC7C 3W6JB 3K1PA 3KP6A 1YS7A 4Y13A 2YR2A 2ELHA 5LBQA 5F64A 4KICA 1F4KA 3K69A 4U7BA 5K5RA 2PFBA 2FU4A 1GHCA 2O3FA 1SD5A 3M8EA 1ZG3A 3V8JA 1I5ZA 3CUQB 2DU9A 2EA4A 3HOSA 1WRJA 1T6SA 2VXZA 1O7FA 2M1BA 3ZQ7A 3EQLF 3RPQA 4GO1A 3P7NA 3DF8A 2J5OA 1GXPA 2DAOA 5D4RA 2A61A 3L09A 4AVPA 4EJVA 4HF0A 3WTTC 4A0YA 1I1GA 2F5EA 3KZYA 4FHTA 3RDIA 3LFKA 3RYRA 3I59A 2DQLA 1YYVA 4P5OA 3ZPLA 5D5XB 3MFKA 2D1HA 3DQVC 1A04A 2PEXA 1BM9A 2W85A 4A5MA 3E5XA 4EJTA 2WWYA 4KYWA 1H0MA 1I1SA 4I09A 3H3ZA 2WTEA 2H6BA 2DW4A 2A5YB 1G3YA 4KUMA 1WKMA 2IPQX 3QU3A 4WF2A 5AONA 1ONVA 4PZJA 2CQKA 1HW2A 3E6BA 2RDPA 3FZVA 5DEQA 4A2UA 1I6XA 3ECHA 5BPIA 1R5GA 2P6SA 1ON2A 1JE8A 1J75A 3O6BB 4BAYA 4WXCA 2Z99A 2XGXA 4KA4A 3H3UA 2ZJ2A 1ZARA 4CYDA 5TRDA 1S7AA 4XSZF 3CO7C 3QP6A 2PG4A 3MEXA 1REPC 1Z05A 2QM3A 1SFXA 4GYIA 2ZXJA 3I71A 5ICEA 2OBPA 5LHHA 2F2EA 2MH2A 1MGTA 2GWRA 1TNSA 4B8XA 1FWZA 1G4DA 5D8LB 3HRTA 1KGSA 2DFIA 3KE2A 3WTVC 1BBYA 1HSTA 1IXRC 5FFXA 3SHFA 5LRSA 1X3UA 2ETHA 2E1NA 3ZMVA 1WQ2A 1TQIA 3IRQA 3VEPA 4OOIA 2W25A 2HWVA 2JT1A 3WU1B 4ZYGA 2NNNA 3DP7A 3IKTA 2VONA 2X0LA 1RUOA 2JTVA 2K02A 4CXFA 3L2CA 2G7UA 4DQ2A 2G9WA 3LAJA 3R6SA 2RVCA 2FMLA 2M8EA 4I0BA 4AWXB 2OQRA 5HOOA 1MJAA 5DCMA 4LK1F 4JBAA 5LEJA 3WTXC 2EV5A 5H20A 4HOBA 2L3DA 4ZZLA 3OOPA 5A2QZ 3GWZA 2CWEA 2ADUA 3K1NA 1IF1A 3TKYA 1ULYA 2IRFG 2PQ8A 3U2RA 3BWGA 1ZLKA 3HRSA 2R7FA 3WGIA 1HSJA 2JPCA 4YFXF 3HHGA 5BQTA 2XAHA 3ELKA 3L9FA 2DK5A 5FD6A 4L9NA 3VODA 2XUBA 4KFCA 4UVCA 1UHWA 3KEOA 4PDKA 3KP7A 2P5LC 3GFLA 4HDVA 4WWCA 4BQAA 3RI4A 1LNWA 4EJUA 3BZ6A 5D8KB 2WC2A 3L7WA 2RN7A 3HIFA 1O3RA 4M6YA 4A5NA 1T0FA 1CF7B 3QPTA 2IA2A 3J80Z 3S2WA 1KQ9A 3ABUA 3MWMA 3EUHA 2RQPA 1RZ4A 4NB5A 4N0BA 2E1CA 3QOPA 3CTAA 2GXBA 2O0YA
chains in the Genus database with same CATH superfamily
2IGNA 4BU2A 3H3VK 1I6HJ 2CGPA 2HOEA 4Q47A 5E18F 2Q2EA 3FXRA 3SFZA 1QBJA 1MIJA 3CJTB 1MNMC 3D5RC 4FCYA 1T95A 1X2NA 3SJMA 2YX7A 2HVQA 3TW6A 1N78A 1U6GA 3A01A 1B9NA 1PP7U 3BROA 3FX3A 4MGRA 3X2QH 4BBRJ 3JTHA 1KU7A 3FWEA 5DCFA 1B72B 1U5TB 2DOEA 2RREA 1IN6A 2LH9A 1E0EA 1FMVA 2AXTC 4QIWN 1UHMA 1XCVA 4DBRA 3W6VA 1IJWC 1ZYRF 5E17F 2V1NA 1BW5A 2M87A 2I8DA 4MTEA 2Y9ZA 3T5XA 2AQFA 3CP2A 4BNCA 1KU9A 2OAZA 3JCUC 4D5FA 5KHDA 2K85A 4RDUA 3QU6A 4L9JA 2HOAA 2I10A 4U0YA 2DTRA 2JMWA 4RS8A 1ITYA 4XRSA 1TBXA 2ZFUA 4A0ZA 3TMOA 1OJLA 3DKWA 5F1RA 1X1DA 2QCOA 5L3CA 2IS4A 1XS9A 2EJRA 3E5UA 2EFOA 3DPLC 2CUFA 4AM3A 1YW9A 1G8XA 4LB5A 3C7JA 4IHSA 3CO6C 3FF5A 1GVJA 4U88A 3S14J 4HDUA 3HGYA 4FQGA 1XSVA 4XLAA 5D5WB 4E7HA 1O3TA 2W82A 2ZNYA 4YRVA 3ECOA 4OIPF 1P4XA 2F4MB 4A3IJ 4CH7A 2VASA 4Y15A 4PJMA 4E4HA 3HOUJ 3ZMDA 4D7MA 4G6TB 3TOAA 2AHQA 3JREA 1YRNA 2CFOA 3DLAA 3BTJA 1T2KA 2O6GE 4B09A 2OV7A 3I4NJ 2Y75A 1MH4A 3E1SA 4XIDA 1F5TA 1XX5A 2DMPA 4L18B 5HS8A 3CCJI 1A31A 4M73A 1I50J 1LUJB 1OR7C 1TWGJ 1KA8A 1R71A 4CZZA 1P7IA 1FEXA 1T98A 5GPAA 4HLYA 3V42A 1IGNA 4A3KJ 2DA7A 1QU3A 2IP2A 3H9JA 3O8GA 4LLGF 3ASOH 3I64A 4BXUA 1Z21A 2GZWA 4M6XA 3RKWA 4A3BJ 1Z0XA 2O03A 3IV5A 4FX0A 2FQ3A 2E60A 2DMTA 1VQNI 3GF2A 1OCPA 4EMSA 3WG9A 1VQOI 2OTLI 5JVTA 3C18A 3DEEA 3DFGA 3P9IA 4RB2C 5CVUA 3P9CA 1GLNA 2WADA 3BOQA 4AVZA 2F5VA 1WJCA 1XB4A 2LMDA 2L9VA 4AIJA 3I4PA 4IEJA 1TQMA 1R1TA 1RR7A 2XSDC 5J8FA 1XGOA 2VQCA 3K7AJ 2UXNA 1FNNA 4H4KC 3OYIA 4HF2A 1TC3C 4M71A 3ML6A 3CDHA 3QQAA 3HSEA 5FB2A 1X19A 1P4WA 2ESNA 2F6CA 2R7ZJ 4A3LJ 1O57A 4PSXA 2M5WA 3KP3A 2V4JC 5E1ZB 3L00A 4GGGA 2KLOA 4JYKA 3MQ0A 3WGHA 1G6NA 4CCNA 5TJJA 3CCLI 3SYTA 2X9DA 3OIOA 3M3YJ 3A0HC 3JRCA 2EH3A 2BY0A 1IDYA 2NOJB 4G8XA 5FLXZ 5DM7F 1GVDA 1ZKGA 2VJ4A 4F55A 2KJCA 1LFPA 3F6OA 3REOA 5JI6A 2LKPA 1N75A 4BHPA 3ZQLA 2CQ7A 2MH9A 1BN5A 3HOTA 2RV8A 1VQKI 4AU7A 1APLC 3K70D 5HVQC 1SFUA 4AYBA 4UUSA 1Z3XA 4Y17A 1AOYA 1WVRA 2P7CB 3N05A 2ZJQF 2VE8A 1W5TA 1BA5A 3EETA 3ZQFA 1J9IA 3FISA 4XNFA 3KEQA 4ZYAA 3BJAA 1T56A 5TGTA 1VZ0A 3HPGA 4PFOA 4XRSG 1OYYA 2P4WA 4B1RA 1XSDA 4RAYA 3S32A 5IYCJ 4UB8C 3DKXA 5CVJA 2H6CA 1U2WA 2KRCA 4DNCA 2XV4S 4EV0A 1WI9A 3GTPJ 1D1BA 2HOTA 4G6DA 2ICWG 4ENMA 4LD5A 1ETOA 1HDPA 2XGEA 1SMTA 4A6DA 4X1EA 4P55A 2E7WA 1RKWA 4HPQA 1SANA 2STWA 3GTGJ 5LRRA 3W2AA 3IAM2 2ZXHA 1A36A 3M8JA 1TTYA 3BCBA 1STZA 1SFEA 2HTSA 3I56I 3WE3A 2IS6A 4E7KA 4V19K 3RPUA 4P9UA 4LLLA 1BW6A 1XC5A 2ZBKA 1FP1D 2ACJA 2O61A 2EQRA 1D1CA 2FMYA 3KETA 3K10A 2X6YA 4FETA 5BOXA 1FT9A 2DDBA 3K4JA 4UNOA 3E6DA 2W7NA 5E1XA 2MD5A 3H9GA 4S05A 2ZJRF 1YFHA 3BT9A 2R5YB 1TLHB 4DZPA 2WB1N 1P92A 3PNVA 2Q2EB 2XPUA 3HHHA 1ZG5A 4MEYF 2K40A 3I54A 3SXYA 3VB2A 2DA3A 3K4BA 3HOVJ 3F23A 1FJLA 1YX3A 5ILVA 4BJTA 2IT0A 3TDZC 4BE0A 2UV1A 3FXLA 3KPHA 2V9KA 4LMYA 3EYIA 2L5QA 2HYFA 1PP8F 5E79C 3VOEA 3R61A 4ITVA 5ILUA 1VQ7I 3HGGA 4OIQF 1ETVA 2XPWA 2E5NA 3CCUI 5CLSA 4XMYA 1LKXA 3CLQA 3CMMA 4WXHA 3RYPA 5CQEA 4IOCF 1UB9A 3HKZA 4XLHA 4UB6C 1KYZA 4EJOA 3IL2A 3ZQCA 1T8IA 2ZMEA 3IC7A 1OCOH 3SZTA 3KP4A 3RJPA 2IW5A 5ICGA 2C6YA 3SQNA 3GZ5A 2ZCWA 1Q1HA 1HQCA 3VYTB 3HM5A 2IAIA 1Y0NA 3WTZA 4XN0A 4AIHA 3LA3A 4IRIA 2HKXA 1EH6A 1LFBA 2Y2ZA 3IHUA 4LJZF 1NK3P 4BE1A 3DKYA 2CMPA 3K0LA 4I6ZA 1L0OC 2BXZA 3U1KA 4DIQA 1U0JA 5IT3A 2H1LA 2LREA 1T08B 3UR3C 2HDCA 1OCRH 2LKXA 1EKEA 3HDDA 2M7BA 1UJ8A 3J7ZI 4BKXA 4C2MJ 3LOCA 1RETA 3BTCA 1OYWA 1WSUA 1W4MA 1W7PD 2EK5A 2OA4A 2W24A 4YFNF 2VODA 2COMA 4G7ZF 3IAS2 2WAQN 2LF7A 4WK8F 1OMIA 2VC0A 3S1QJ 2XASA 3AG1H 3LNQA 5LD2C 2PMZA 1MMAA 3OR1C 1HXDA 2CW0F 3OSFA 1D5YA 2QLZA 2K27A 4HX8A 3L2VA 1BC8C 1S3JA 1IRFA 2PJPA 2LR8A 4EEFG 1ZRDA 2R7SA 3QYBA 1Z6TA 5F08A 4G7OF 5F6FA 2CYYA 3J7YJ 1GDTA 2DMUA 1MBFA 1CF7A 3OMYA 3CDLA 3VSLA 2UXXA 4ZYHA 1ETWA 3ABMH 4UV9A 5HDGA 1GXQA 1CGPA 1X1AA 4IVNA 2VB6A 3OL4A 2BEOA 4EM2A 4ZDOA 5HDKA 2F48A 3BDDA 5HLIA 2FD5A 2O5RA 5ERIA 3ZMUA 1MMDA 4I02A 4BY1J 3S93A 4LIUA 1EJ9A 2XROA 1R6RA 3ZMTA 3TEDA 4W97A 2YU3A 5J1YA 2LY2A 3JRAA 3BPVA 2CSOA 1J59A 1DQUA 3FXMA 2ZSHB 2R7OA 5M3FJ 1V4RA 2P5VA 4ZYDA 3H5NA 3M1CA 3JSPA 2KIUA 3F21A 4Q5SF 2FNPA 1DPUA 1X3ZB 2DTZA 1DUXC 3ZP5A 1YLFA 3S1RJ 3Q0UA 2IXSA 3V7RA 4BDZA 1MD0A 2CUJA 5M5WJ 4CZCA 4I01A 4KISA 4JQFA 5EEGA 5EEAA 4A3JJ 1YW8A 3CC4I 2KIFA 1B72A 4PFPA 1U5TA 1JJ8C 4RGXA 3KX2A 4RM2A 1R5HA 3B6AA 2ID3A 2EFPA 2QA4I 4XQFA 4U87A 4ZDLA 3ZN1A 1P9QC 1V5FA 2HZDA 1SD7A 1PUEE 1XD7A 2LDUA 3R0JA 2V1XA 4R1HA 5B66C 1I27A 2IVMA 1S5LC 3WTSC 2J5PA 4RB0A 1O3QA 2QKMB 3HB9A 3KYDB 2GOXB 1L3LA 1RC9A 1RESA 4UUSB 1FLIA 1BIAA 2W48A 2IGOA 3FHZA 1WWXA 4CICA 3J7AO 4OMYA 1DP3A 3J7AY 2LSOA 3GTQJ 1HBXG 5FKMA 1Y39A 1B8IB 4KT6A 1R5ID 2LKSA 5HODA 3I5UA 4RB3C 2ID6A 2PI0A 1Y8QB 1W36D 5JFRA 2NNYA 3VDXA 2LC2A 3CCYA 3ZMZA 2CV2A 4HRIA 4UVAA 2KQRA 1BR2A 3RQ4A 1XGSA 3IRRA 3DU6A 4IL6C 4ENKA 1KONA 1TW2A 2WY8Q 1SC7A 5LGTA 4J00A 2KDOA 2GXGA 3L2QA 1X1PA 1W5CC 2FQ4A 2UZKA 4GDFA 4L5EA 2ZNZA 2VQHA 1XMXA 1SMYF 2X1DA 1OYIA 5EZHA 3MKZA 2H8WA 3BPXA 4DJAA 3FBNB 5IYBJ 1WJEA 1Z77A 2LF8A 3Q0VA 4HYEA 2XGDA 4M74A 2QUFA 4QSHA 1AWCA 2Q8KA 3W2WA 4CCMA 4HNUA 5F0HA 3GW2A 1B9MA 4LG0A 1HKQA 3CC7I 4QLCU 2VBWA 3JRDA 2M4GA 1FTTA 3K4NA 1V5GA 6PAXA 2Y48A 4CYCB 3QODA 4FTHA 2DA4A 1LVAA 4WCGA 4F93B 1X1CA 2XPVA 2EINH 1OKRA 4ON0A 3WTYC 1TWAJ 5D6EA 2CV0A 2XVCA 4KNYA 3IUOA 4AYBN 1MZBA 4C3HJ 2EFQA 2QSGX 1VF9A 3BY6A 2NVUB 5J47A 4YIFA 3IH2A 1Q1VA 4WX9A 1P6RA 5HS9A 1IRXA 2RC4A 4NHJA 2RGVA 2NVTJ 2PMHA 2A6TA 5E3OA 3RSNA 2BW3B 4IF4A 1JHFA 3GTMJ 2W00A 4ESFA 2XIGA 2HVSA 1WJ5A 2GQQA 3DBRB 2ZMEB 5IOZA 2NVXJ 4MFEA 3T0YA 2FF4A 3BTLA 4I2OA 3CUOA 2VXDA 1MNDA 4HNVA 1SD4A 3J81K 1ON1A 2ELKA 1U8RA 2V6EA 3S2HJ 1IN7A 4BY7J 4RAFA 3BR0A 2Y0SA 1XDSA 4ETSA 1HOMA 5E3MA 4XLEA 1LVKA 3RCOA 3K4CA 1R1UA 3GLXA 4HF1A 1JKPC 3HJEA 2DFEA 4E7SA 2VE9A 5BMZA 2BVMA 3MKLA 1IXCA 4ZYEA 2XC7A 4F92B 2A6HF 5DYMA 5GP9A 4OAYA 2EIJH 4P9FA 4IXAA 2LG4A 2BBYA 4UXNA 3AFHA 3Q9VA 3QAHA 2L7ZA 4LGWA 2VC1A 2WAFA 4L5IA 4G94A 2M2EA 3BZKA 1Y6IA 1VQ5I 1ZLJA 1J5YA 1OR7A 2KRHA 2V7FA 3SZPA 2XRNA 4FISA 4DZJA 1UFMA 3LAPA 3T8TA 3QRFF 3K70C 1BI3A 2K7LA 1A6IA 4HX4A 1E2XA 2XF7A 1LJ9A 5C44J 5FROA 3OSGA 2IGMA 3NQOA 1JJ6C 2XKOA 4B47A 3GXOA 2ME6A 1Y56A 4XM3A 5FJ8J 3TQNA 1FTZA 4N4NB 2L9SA 4NUBA 5F27A 1WGXA 2E2JJ 1OISA 1OCTC 3RKYA 3HKZN 1JI8A 4HZFA 2A05A 2FBKA 2KDZA 2BXYA 3JRHA 1DGRM 3PFYA 1H9TA 2PJRB 3A1YA 4L5JA 3L2WA 4ZDPA 2HPIA 4CUGA 3MZYA 2XAFA 4YG2F 3R0AA 4UV8A 1ETXA 1KU2A 3WODF 3TO7A 1BR1A 3HZJA 2B63J 4XKVA 1RPWA 3BTIA 2R5YA 1X4PA 3ONQA 2RQQA 1FYKA 3RKXA 5K5QA 2GXAA 4ESBA 4ZZDA 2DYSH 5HLTA 5BNGA 2MLGA 1IUYA 2VBXA 2Y30A 3RTRA 1QPIA 1WH7A 1FBQA 2EIMH 3EUKL 1BI0A 3OYKA 3Q9SA 4L0ZB 2NVQJ 2K86A 3BR6A 4KN7X 5FGMA 2LK2A 2KT0A 1IG7A 5CVIA 3ROUA 5GPCA 1LQ1A 3GZNB 2PMZN 4XRMA 2DCEA 5E8IA 3GFMA 2D45A 1JHHA 5B1AH 2EILH 1H89C 3PJRA 4E7IA 2M30A 1FBSA 1Z91A 2CRGA 3R4KA 5FFZA 4UY8I 4Y4RA 2O8XA 1IAWA 2DFHA 1MJ9A 3HTSB 3PQKA 2HYJA 2JRTA 4XLFA 2R5ZB 4HAMA 2QYOA 4RLFA 4DGWB 2X4HA 1X4OA 4NNJA 4PGGA 2BE5F 4RGSA 2MD0A 2FX0A 2HOSA 2VPLA 2CW7A 2VJJA 1ZK8A 3GUDA 3ISPA 3V8KA 3BG7A 3Q0WA 2NS7A 5ICFA 3BG5A 4RA2A 4D5CA 3HSRA 4EJWA 5E20A 3DTIA 1T39A 3HC7A 3LQRA 4PUSA 1VTNC 4BYYA 1DP7P 2GA2A 3M07A 3F22A 3FMSA 4MNUA 2KJBA 4IO9F 5H6RA 1IO2A 4BE2A 2R4GA 1Y1WJ 4LITA 5F04A 2B0LA 5D6FA 5BS6A 5CJ9A 1D0XA 4B43A 1D8KA 1LDDA 3BR5A 3OWTA 4IQ4A 2YPRA 3E97A 4F3QA 1TW3A 3AL0C 2XRLA 1LB2A 4IHYA 4DYRA 5K1YA 3CD6I 3SDBA 4GYGA 2MC4A 3OYDA 3HOZJ 4LG0B 5L3GA 2KRFA 4KITB 5J4YA 2ZSIB 3GEZA 3GFJA 4ENNA 1K78A 4LLNA 3GTKJ 4KMFA 2HU9A 1BL0A 3GYHX 1VNDA 1PJRA 1BIBA 3ABLH 3S2DJ 1NH3A 3KCCA 3NRVA 2XGCA 3I4MJ 2KIMA 3H36A 2X6XA 1B1BA 3SDGA 2QWWA 1NHAA 2NAZA 1Z7LA 2W57A 2R7QA 5C4JJ 4HQEA 5GTHC 3KFWX 2GA1A 1QZEA 2LFBA 2OJED 3M7GA 4KMUX 5HLGA 4CO8A 3SFIA 1QHHD 3ERED 2P6TA 1B59A 2GM4A 3BJOA 4NQWB 1F43A 1G3SA 4M72A 2BY2A 2CQQA 2IA1A 3I0TA 5LGNA 2E2HJ 5IYDJ 1EV7A 2BY1A 2JSCA 1T0FC 2MFZA 2KZGA 2H09A 4OAZA 5DM6F 3F72A 2VKDA 4IQJA 3VWBA 1P4AA 3ABTA 2V26A 2QBYA 3JAMK 4XOTA 1MH3A 2OCEA 3ABKH 2R7DA 5AIPA 2YUSA 3SEQA 4HV5A 4PJLA 1BJAA 1HKTA 3EUHC 1WJFA 3SZGA 2A69F 2HQAA 1Y0UA 3CLOA 2HKOA 1LE8B 1XGMA 1R9TJ 1BOAA 3ZQGA 1EH8A 4KIBA 1R23A 5ILSA 4NBQA 1HKSA 2F5DA 1GV2A 2JA2A 2HYGD 3GBGA 4EQQA 2HVRA 4C30A 2H1KA 2CQXA 3HXLA 3KLOA 1ETQA 4UVBA 3OYBA 4TV7A 1TL8A 2JSPA 4Z2YA 2X1CA 2HQRA 2P81A 1BI1A 2QENA 2WY7Q 4XSXF 3AL0B 5D5VB 1W7PB 5JHUA 5L3BA 1QPMA 4N9HA 4PCQA 1B8IA 1OPCA 2NXNB 2PX9A 3RKQA 2L0KA 2XB0X 1HW5A 3G3ZA 3G2BA 5FKNA 3A2KA 3F0CA 1MW7A 5DD4A 2DPDA 3HSFA 5DDGA 4ZJZA 1U9NA 1UCRA 4K2EA 4JX5A 3F8BA 1I3QJ 2XHKA 4NDLA 5J1UA 1FC3A 3BQYA 1W36C 1WJAA 4AIDA 3CMEI 3T1BA 1UG0A 4P96A 1MKMA 3E0JB 1S7OA 3CUQC 1ZG1A 4QWQA 2ME0A 1ZR2A 4IX7A 4N9IA 3RIRA 4IHXA 2VBYA 3DBLB 1ODDA 3HUGB 3BZCA 4RB1A 1Z7UA 2HR3A 4OIRF 4BXXJ 2V9PA 3JW4A 1BI2A 1IRGA 2LD5A 4MQVA 3L2RA 3W6KB 2DI3A 3OYAA 2VI6A 1SD6A 2L4AA 1JXSA 4CYCA 3QPHA 2QQ8A 4A0XA 2NOGA 1QGPA 3S17J 3TL4X 1NK2P 3HOYJ 1K6YA 2Z3YA 2QVOA 3LSIA 4GRIA 1I3AA 2YS9A 3MAJA 1MMGA 3F6VA 5LHGA 1YQAA 2Z33A 4IRHA 5CVVA 4E7JA 1YG2A 3MZHA 3GTOJ 1S7EA 5JVGF 1IXSB 4CCKA 3V7SA 1KZHA 5K5OA 4CGZA 1QNTA 3S16J 2BW3A 2HQNA 2AXLA 2V9VA 3F3XA 4MEXF 4RBOA 1UG2A 3GFIA 4KDPA 4S04A 1UMQA 3GMEA 3K2ZA 2WAEA 4CA0A 3EPZA 3OS1A 5EEHA 4D1QA 2L02A 1XGNA 4OU0A 3C1DA 4HSTA 4I7HA 4OWRB 1MBEA 4IKFA 2HS5A 5IT9K 3PM1A 2MG4A 3E6MA 4QPOA 4O3MA 3TP0A 4XRFA 2FBHA 2NRAC 3ZQIA 1F1ZA 2OQGA 4OINF 1IN4A 4M3DA 4KN4X 3LL7A 4A6EA 2VBZA 2ZB9A 2V6CA 4EM1A 2K3PA 1XN7A 2M34A 3G1LA 3K1MA 4RMNA 3OV8A 4AD9A 5D4SA 3K4KA 3KZZA 3ZXSA 1Y8RB 1JT6A 3KYLA 1ZN2A 4M3FA 1MNEA 2K5CA 5D5UB 2EA2A 4R8HA 3KP2A 2P7VB 3NWTA 1RNLA 2L01A 3P5JA 3QP5A 3ULQB 1MBHA 2HZTA 2HPMA 1CQTA 2DQRA 2M8GX 1POGA 5J8CA 5GAEJ 2GAUA 5FD5A 2JQ7A 5IY5H 1TT5B 3K9TA 4BXFA 3ZQQA 2QZ8A 3QPLA 4GXOA 1MBJA 3TDUC 2DO7A 3CF5F 1YIJI 5DD8A 2K3FA 5DUKA 3N97A 1DPRA 4G6QA 5M5YJ 2QQAA 2VT2A 3JTGA 1FMWA 2W84A 3A0BC 1FYMA 4CHUA 4OIOF 3B6CA 4JOMA 3FXJA 1JUPA 4M9ZA 3I53A 1D3YA 1KU3A 3DCFA 5HLHA 3NEUA 4HQMA 1K78B 4XKCA 3A03A 4IJAA 2DBBA 4YIIA 2ZXIA 2KPMA 4YELA 2H27A 3FIWA 3F8CA 3ESWB 2PJRA 1A5JA 2VOPA 3V4GA 5LHIA 4L9VA 1R36A 2O7OA 2CU7A 3K6GA 3Q3SA 5EG0B 1TWCJ 5KK1A 2DPUA 1GUUA 3M1EA 1S72I 3S1MJ 4JX6A 3VFZA 2ELJA 2FRHA 2EB7A 3PSFA 4C3IJ 1MMNA 2M7AA 2VKVA 4DW6A 1H8AC 5LLQA 1V3FA 4CDGA 1WCMJ 2LRDA 3HRUA 3FK7A 1IW7F 2OPTA 3ZMSA 3FXOA 5C3EJ 4XLPF 2QBYB 1YIOA 2EV6A 4BL0B 4FX4A 3QYEA 4ENJA 1FPQA 2XF6A 4G9YA 5L3DA 1R4NB 4BQNA 2MABA 1VQ8I 2VJ5A 5F0FA 3CCQI 2M4KA 1FBUA 2FNAA 1K4TA 2KP6A 4LFUA 3CJRB 2ZO4A 2JJ7A 2JZYA 3O3KA 2M45A 2CG4A 2XKPA 2CO5A 1F36A 3AG4H 2DDAA 1ERDA 2DMQA 4CSWA 3HEFA 2A3SA 3GCMA 2QGUA 1YS6A 1VFCA 2L54A 4A3FJ 1U9OA 1XMKA 2CFXA 3BP8A 4HBLA 3V8LA 2R5ZA 3HG9A 1G3TA 3OS0A 2Z9OA 1YJWI 1R22A 3DWLE 1YO5C 1RUNA 2FUG2 3I9V2 3LSHA 4LB6B 1W0TA 2OCCH 3UKGA 5E8GA 3H5RA 5J3LA 3PO3J 1W5SA 3IKVA 5GADJ 1LPQA 1HW1A 2K4BA 4UUVA 4HA8A 5M5XJ 3IH3A 2HGCA 2JUCA 3C2GA 3WTUC 1G3WA 4A93J 1U78A 3JRIA 1MJBA 2NS0A 2K9QA 2FBIA 1R7JA 1S6LA 1ZRFA 4MLOA 5L3FA 1SVOA 3BC8A 3FM5A 5HS7A 1E17A 3PO2J 1MDMB 3RZOJ 1D0ZA 3GX4X 1ZGJA 1V55H 1S29A 2HFHA 4NC7A 2PLYA 3FDYA 2P5KA 3IWZA 4Q4ZF 4EGYA 1TZLA 2YX4A 3WE2A 2E71A 5CVRA 2ISZA 3PIOF 1YJNI 4M3GA 4BJ5C 2HXIA 2H94A 3H0GJ 3BG3A 2VQGA 4U7DA 3J81Z 1WZ2A 4PJJA 3PFIA 1BJZA 4A3GJ 3IP4B 1LDJA 3FK6A 1ZH5A 2R7VA 4XOPA 4YFKF 4BUPA 4Q48A 2Z16A 2OF7A 2V1UA 1TT0A 2KISA 3LMMA 4O6JA 2A68F 3R60A 1FIPA 1FIAA 3AKZA 1MBGA 3CJNA 4RAGA 3PNYA 2EWNA 2PBIA 4I0AA 1KQ0A 2VT3A 3MCZA 1J7KA 5DV5A 2YU9J 2N8GA 3TO6A 2XF5A 3Q5FA 5LEKA 4NQWA 3VSKA 3I58A 3LSTA 2E7XA 3ZOBA 1RR8C 3D0SA 1K83J 2FXAA 4GCVA 3ZN0A 2LY1A 1K6OA 3CC2I 4RAZA 2G7HA 1JKRC 3OYLA 4DBQA 3HPHA 2ZC2A 3AG2H 1K7AA 3IH4A 4PK4A 4F7ZA 2BV6A 1WJDA 2A5WA 2DLLA 2LNBA 2M0MA 4ASNA 5CYVA 4D7NA 1X1BA 1I39A 5EJCA 3TGNA 1LEAA 4ZTJA 3V7CA 1XG1A 3PL8A 2M0CA 2XAJA 2Q0OA 5B5EC 4ZC3A 4N4OB 1LE8A 4C2UA 3DEUA 2BHZA 4XLCA 4PJ0C 3OYCA 4EM0B 1J0RA 5JR3A 1Z9CA 2D1VA 3D5LA 1HF0A 1RRJA 1LEBA 1ORKA 2FA5A 2MC3A 3W2VA 2ZJPF 4A69C 3CF2A 5IOYA 2IGKA 1XSXA 2JRMA 5J40A 1LDKB 4HV6A 3KP5A 3GTJJ 1Z1DA 2DA6A 1W7PA 3RQIA 1TWFJ 3PIPF 4RGUA 4JK1X 1M1EB 3DV8A 2FSWA 2WB1A 2A07F 4C3JJ 3U21A 4CCJA 3JSOA 3GZ6A 1HDDC 1B6AA 2F5FA 1U5TC 1FOKA 3G71I 3D5SC 1ENHA 3EYYA 4PSWA 4BS9A 5A2QK 1HC8A 4Y33A 5K7FA 5J6XA 4BACA 1LFUP 2W4SA 1FZPB 4M9XA 1OLTA 4BGDA 3HYIA 2EZLA 9ANTA 3KIOA 2XAQA 3K4MA 5FKKA 2CQNA 2EIKH 2HTJA 2LTPA 2F4IA 3LA2A 4G12A 4G7HF 3BR1A 2NVYJ 1FX7A 5C4XJ 3I59B 4XK4A 1R00A 1FSHA 1VQPI 2H8RA 3FXQA 2DT5A 3HUGA 4II2A 2HNHA 4I99C 4E6KG 2KL4A 2L7MP 1UELB 1ZTRA 2DMNA 2QQBA 4MFDA 1YTYA 5FO5A 2ZFWA 3WU2C 5H6QA 2DOAA 4UHTA 3AG3H 4HSRA 1O7LA 2EV0A 4IRGA 4J01A 4HG2A 4B3XA 1U8BA 1QZYA 2FEZA 1IC8A 3LQQA 3RPUD 4D0PA 4QTRA 3EDPA 4E70A 1FSEA 2LBFA 1K79A 4A3DJ 5M3MJ 2JVHA 3VYUB 4NC6A 3PQJA 1T33A 3K2AA 1IZ1A 1IN5A 1TP4A 2EFNA 2PMUA 4EVIA 3GVAA 3F8MA 1XPXA 2OTJI 3IWFA 2WAQA 1WHUA 4ZH4F 4MTDA 3PNTA 3E3VA 2BYVE 2Z5UA 2P8TA 3DLLF 2KKOA 1YHQI 4L9TA 1C0WA 4M3EA 3KLNA 1QVTA 2JPBA 1QRYA 2EZIA 3TP3A 2VKHA 4FE4A 1MMSA 1QA6A 2DK8A 3M4OJ 2V1DA 5L3EA 4L0YB 1ZAOA 1IN8A 1ZQ3P 2ECCA 1E3HA 2DJNA 3J80K 3B73A 4Y52J 2LYCA 4MHGA 2IEKA 3WHCA 2DA5A 2JA7J 1D5VA 3S3NA 3MMYB 4LK0F 4A12A 4DOZA 1JTXA 5GTIC 5EZGA 2R7RA 3BLYA 3LA7A 1PDNC 4HLXA 2VUMJ 5JLXA 3PUBA 1ZREA 2TRTA 3CUQA 2AS5F 3OYJA 2FOKA 2IA0A 2GIZA 2RNJA 4AC0A 1MBKA 4OMZA 3C3WA 2GLOA 3QWLA 2TDXA 2Y0MA 3LWFA 4FT8A 1DU0A 2F5CA 3DPUA 1W1WE 3OYGA 1JUMA 1FP2A 2R3SA 2L7KA 4XBFA 1OCCH 1N25A 5JLWA 5DUIA 4IHVA 3FM3A 4S0HB 2QQ9A 4BQQA 2UWMA 3JRBA 2JWTA 2LY9A 3COAC 2HEOA 3LSKA 3G73A 1YJ9I 4YEJA 2YSRA 1FOYA 3O2PE 2XB5A 2ZKZA 4BEHA 4PGHA 4BJ6C 2GIVA 2VPRA 2QF7A 3LSGA 1U3EM 3DPTA 3B02A 1ZRCA 3WU0A 3WHBA 2K9SA 4H0EA 2OZ6A 4FASD 5KNLA 1KQ8A 1WH5A 2E35A 3JAMZ 2NYXA 3OOUA 2FOWA 3FMQA 1XDUA 1WJBA 1P7JA 1HA8A 3HOWJ 4BHCA 3OIPA 3JRFA 1YE9A 4I98B 3S3OA 4BH9A 2CUZA 2EPFA 3M8FA 2JVGA 4GFBA 2PN6A 2WV0A 1D0YA 3F8FA 5EG0A 1G2HA 2OD5A 1GT0C 2O8KA 2D2WA 2DA1A 4HW0A 2X48A 1JTYA 4WXDA 3FXUA 3HTUA 3ZR8X 3D1NI 4W1UA 2JUGA 2K9LA 2MBFA 1PUFB 3VYSB 1DU6A 5AIQA 3C2HA 2FE3A 3H1CA 2VQLA 3A4CA 2MA3A 1ZHFA 3PUFA 1WPKA 4F91B 2E1OA 3OL3A 3ERMA 2STTA 2K4JA 4M9SA 5DCMB 1XTAA 4IPAA 1MSEC 1TQPA 3M9AA 2FJ1A 1QHGA 3LSRA 1T38A 3K4LA 2OZUA 1TNTA 4O5VA 5BPDA 1JKOC 1X2MA 4E7LA 4II3A 3L1PA 5HDNA 2V79A 1JUSA 2ISYA 2VN2A 3F9KA 3E6CC 2B7EA 3FKJA 5EF6A 2NS8A 3OYNA 1R4MB 4IHTA 1JKQC 1ETKA 1WI3A 2IS1A 5EGOA 3E5QA 5LGUA 2Y69H 3TOBA 1AU7A 3MVPA 4XL9A 1JGSA 1XMAA 5EYRA 4HX7A 1R1VA 5J4VA 5H2FC 4C2TA 2OU2A 3HL2A 5IP7J 3HBLA 3TBIA 2GOMA 5GAHJ 5EDNA 2Z1DA 4R79A 1VI0A 3WG7H 1BOBA 5IP6A 4EGZA 2UUZA 2L4MA 3F8NA 1ZGWA 4HNTA 3N4MA 1FYLA 1YW7A 2ECBA 3MN2A 2L7FP 3ZCOA 1Z6RA 1J2XA 2BGCA 4KIFA 2VOOA 3G1MA 1DDNA 5B1BH 4B4CA 5DS9A 1H9GA 1RIOH 1O3SA 4A3CJ 1TWHJ 2E34A 3P9KA 3O8HA 3BG9A 2E1MC 1H88C 2VKEA 1AKHA 3CP8A 3CCSI 3I3LA 4RGRA 2WBMA 2EFWA 1A35A 4AIKA 5LFAA 1MDMA 4MO7A 2R7TA 2CS3A 3GO5A 2MLKA 4UUTA 1F9NA 1ZGAA 1QO0D 2ESHA 2EZHA 4BDYA 2BY3A 5E3NA 4XLNF 1P2FA 2Y0SN 3WGGA 1HCRA 2HI3A 2X51A 4BHBA 1ZELA 1ACIA 5FLXK 2RKHA 2RNGA 3AAFA 5IT9Z 3QOEA 4KT5C 4A3EJ 2ZXWH 3HRMA 1DGWY 4M6VA 2XAGA 2LBFB 1SAXA 1USSA 3KZIC 1YI2I 1AA7A 1RKTA 2WV1A 5ED4A 1QQIA 2IJLA 1USTA 1EH7A 4V2GA 5E1WA 3OY9A 4KIGA 5ICCA 2DT6A 1MSFC 3OYMA 4XKBA 4Z6YA 1D8JA 3U9GA 3U1DA 3OR2C 2LVSA 3CQZJ 1FY7A 3T8RA 3DXJF 2A6EF 1BR4A 3FMRA 4NC8A 1S8NA 1B4AA 5KVRA 3GTLJ 1R58A 1XCBA 2IBDA 3H92A 2QKLB 1KYWA 3TO9A 1QZZA 4U0VA 3OIQA 3BJ6A 2CH0A 4MQ9F 3A01B 3WTWC 1RI7A 4ESJA 4I76A 4U0WA 2EBIA 1BC7C 2M9HA 1IRZA 3W6JB 3FHNA 3K1PA 1QVUA 1YS7A 3KP6A 2K9NA 4Y13A 1WFXA 2I5UA 5J1RA 2YR2A 1Z3YA 3CMYA 3S3MA 2ELHA 5KAIC 5LBQA 1HLVA 5F64A 2AQEA 4KICA 3CCVI 1F4KA 3K69A 4U7BA 5K5RA 4XR6A 1UHSA 2E1MB 4IZZA 1SAUA 2PFBA 3BR3A 2FU4A 1GHCA 2O3FA 1VQMI 2EZKA 1SD5A 3M8EA 1PYVA 1ZG3A 5FRMA 3V8JA 1I5ZA 3CUQB 2DU9A 2EA4A 2RAEA 3HOSA 1WRJA 2X85A 3H9QA 1T6SA 2VXZA 5KAFC 1AHDP 1NG6A 2DT7B 1O7FA 2M1BA 3OS2A 1ETYA 3ZQ7A 3EQLF 3RPQA 3KEYA 1YOVB 4GO1A 2O9LA 3P7NA 3DF8A 2J5OA 1GXPA 3H0DA 2AO9A 2DAOA 1PVEA 5D4RA 3DTKA 2A61A 2KIQA 3L09A 4AVPA 4BEHB 3ZRGA 3OYEA 3KYCB 4EJVA 1JGGA 4HF0A 3WTTC 4A0YA 1I1GA 2F5EA 4XORA 2B9SA 1EF4A 3FXKA 1UZCA 3KZYA 4FHTA 3LFKA 3RDIA 3RYRA 1VQ9I 2F4OB 2LOOA 2L9RA 4KJZA 3MD2A 3I59A 2LLKA 1YRNB 4LOCA 2BVLA 1YYVA 1EA3A 2DQLA 3FBIB 4P5OA 3ZPLA 3CZ6A 5D5XB 1SVLA 2D1HA 3MFKA 3DQVC 4C9YA 1A04A 1FOWA 2PEXA 3CCMI 2DOFA 1BM9A 1OQYA 2W85A 1UAAA 4ABZA 1K4SA 1J09A 4A5MA 4BQOA 3E5XA 4LG3A 2WWYA 4EJTA 4KYWA 2R7UA 4JP0A 2KFDA 4XICA 4YIRX 1H0MA 3NWSA 4MIMA 1E3OC 1I1SA 4Y3OA 4B48A 3S1NJ 2KZVA 1IUFA 3NAUA 4I09A 2GBYA 3BG6A 2Z2SB 3H3ZA 2COBA 2E19A 2G0EA 2XSJC 3E7LA 2WTEA 3S8PA 2H6BA 2L9NA 3I55I 2A5YB 2DW4A 5TISC 1G3YA 3ASNH 2HDDA 4KUMA 5FLMJ 5FLVA 4IHWA 1WKMA 2X6OA 2KMUA 2IPQX 3QU3A 4WF2A 2LP0A 3RZDJ 5AONA 1ONVA 4PZJA 2CQKA 4Y7NJ 1HW2A 3E6BA 3NARA 2DFFA 5EGOB 2RDPA 2W1OA 4J19A 3FZVA 3TW7A 1W0UA 2R93J 2CV1A 5DEQA 1Z67A 4A2UA 1I6XA 2VJIA 3CCEI 4ANJA 3ECHA 4B44A 5BPIA 2R7WA 1V54H 2R7XA 4AUXA 1R5GA 2P6SA 1ON2A 3BQZA 1JE8A 1J75A 3O6BB 4BAYA 4WXCA 2CW8A 2Z99A 2XGXA 1IV8A 3H3UA 4HEA2 4KA4A 2ZJ2A 1ZARA 4CYDA 5TRDA 2DODA 2OUMA 4V2FA 3HOXJ 1S7AA 4XSZF 1SFOJ 3CO7C 4BBSJ 3QP6A 3BR2A 2PG4A 3OYFA 2K9MA 5GAGJ 2DA2A 1OCZH 2HDWA 3G1OA 3MEXA 5JHFA 1Z05A 5CKTA 3C2BA 2QM3A 1REPC 1SFXA 4GYIA 4F52A 2ZXJA 3I71A 5ICEA 2OBPA 5LHHA 2F2EA 3OYHA 2MH2A 3PSIA 1MGTA 4QPQA 2ZMEC 2GWRA 1TNSA 4X0GA 3JR9A 1G59A 4B8XA 1AKHB 1GV5A 2TCTA 2MYSA 2DXIA 2X1EA 1FWZA 1G4DA 5D8LB 2MW8A 3HRTA 1KGSA 5HNHA 4CCLA 2DFIA 3KE2A 3WTVC 1BBYA 1YX5A 5DTDA 2BOLA 2XAUA 2D5VA 4XKWA 1HSTA 1IXRC 1D1AA 5FFXA 3SHFA 3DBHB 3G6EI 3A02A 5LRSA 1VQ4I 1A6QA 1X3UA 4RLQA 2QSHX 2ETHA 5KCMA 2CJJA 2E1NA 3ZMVA 1WQ2A 2MSYA 1TQIA 3G4SI 1SEUA 3LFUA 3LSPA 3IRQA 2QSFX 3VEPA 4OOIA 5K7ZA 2W25A 2HWVA 5FKOA 5IPAA 2JT1A 4P1WA 4ZYGA 3LSJA 3WU1B 2E5ZA 2NNNA 4PJNA 4E7ZA 3DP7A 2DYRH 2Y9YA 3IKTA 2VONA 2X0LA 1RUOA 2JTVA 2K02A 3MKYB 1X58A 4CXFA 3VYRB 3L2CA 2G7UA 2JA5J 4DQ2A 3H35A 2VLAA 3DU5A 2G9WA 1PUFA 2KHMA 3LAJA 1OFCX 2R92J 3R6SA 1S9HA 2RVCA 5B3SH 2VL8A 3CJQB 2CUEA 5CQGA 2FMLA 2M8EA 5K7HA 4I0BA 4AWXB 2OQRA 3JRGA 2P0WA 5HOOA 1MJAA 5DCMA 4FE7A 4LK1F 5IP9J 2BZTA 3ZGKA 1VQLI 4JBAA 5LEJA 4JX4A 3WTXC 2EV5A 5H20A 2HQ5A 4HOBA 2L3DA 4ZZLA 3OOPA 2IS2A 5A2QZ 4XONA 3GWZA 1Y1VJ 5FRNA 2CWEA 4LIVA 2ADUA 4IOAF 3K1NA 2DN0A 1IF1A 3TKYA 1ULYA 4A3MJ 2IRFG 3EUAA 3ZQHA 2E36A 2PQ8A 4CCOA 2Y31A 3CESA 1R49A 3U2RA 3BWGA 1IDZA 1N77A 2WA0A 5F0CA 1ZLKA 3HRSA 2DJIA 4M3BA 2R7FA 3WGIA 3W3CA 1HSJA 2Q1ZB 2MGQA 2JPCA 4X6AJ 4YFXF 4DYQA 2L2OA 1NG7A 1YITI 3HHGA 3GLLA 5BQTA 2XAHA 1FOXA 3ELKA 3L9FA 1SFKA 4EATA 2DK5A 3VPRA 5FD6A 3L2UA 4L9NA 5CPRB 5FKLA 3CMAI 3VODA 4RM3A 5E3LA 1VQ6I 2XUBA 1O4XA 4KFCA 2JN6A 3QPSA 5F1JA 3CCRI 4UVCA 1NTCA 2BHYA 1UHWA 3KEOA 4PDKA 3UNGC 1K61A 2JA6J 3DEWA 3KP7A 2P5LC 3GFLA 2E2IJ 4HDVA 4WWCA 4BQAA 3RI4A 1LNWA 4EJUA 2VIXA 3BZ6A 2WC2A 5D8KB 2R0QC 3L7WA 4XN3A 2HXOA 3MZ8A 2RN7A 3HIFA 3BCAA 1O3RA 4M6YA 4A5NA 2JK3A 1T0FA 3MKWB 2M3AA 1JT0A 4DYCA 1CF7B 3LSMA 2OC6A 3DTEA 3QPTA 1E3PA 4D9JA 4B3AA 2IA2A 3SEZA 3J80Z 3S2WA 1KQ9A 1X3WB 2QEXI 3ABUA 3QYFA 1IV6A 1V5EA 3MWMA 3EUHA 3H5AA 4ZTFA 2RQPA 1ZR4A 5HNFA 1RZ4A 2JA8J 1SVMA 3CDIA 2X6WA 4NB5A 3S15J 4N0BA 2E1CA 3QOPA 3CTAA 2GXBA 2O0YA 2XDVA 3FKIJ
chains in the Genus database with same CATH topology
2CGPA 2HOEA 4Q47A 5E18F 2Q2EA 3FXRA 3SFZA 1QBJA 2YX7A 1U6GA 1PP7U 1B9NA 3BROA 3FX3A 4MGRA 3JTHA 1KU7A 3FWEA 5DCFA 1U5TB 1IN6A 1UHMA 1XCVA 1ZYRF 5E17F 2M87A 4MTEA 3T5XA 4BNCA 1KU9A 2OAZA 3QU6A 4L9JA 4U0YA 2DTRA 4RS8A 1TBXA 4A0ZA 3DKWA 5F1RA 5L3CA 2EJRA 3E5UA 2EFOA 3DPLC 1YW9A 4LB5A 3C7JA 4IHSA 3CO6C 3FF5A 1GVJA 4U88A 4HDUA 1XSVA 5D5WB 1O3TA 2ZNYA 4OIPF 3ECOA 1P4XA 4Y15A 3ZMDA 3TOAA 2O6GE 1T2KA 4B09A 2Y75A 1F5TA 4L18B 5HS8A 4M73A 1KA8A 4CZZA 1T98A 4HLYA 2IP2A 4LLGF 3I64A 4BXUA 2GZWA 4M6XA 3RKWA 2O03A 4FX0A 2FQ3A 3GF2A 4EMSA 3WG9A 5JVTA 3C18A 3P9IA 3DFGA 4RB2C 5CVUA 3P9CA 3BOQA 1XB4A 4AIJA 3I4PA 1TQMA 1R1TA 5J8FA 1XGOA 2UXNA 1FNNA 4HF2A 4M71A 3ML6A 3CDHA 3HSEA 5FB2A 1P4WA 2ESNA 1O57A 2M5WA 3KP3A 5E1ZB 3L00A 4GGGA 3MQ0A 3WGHA 1G6NA 5TJJA 4G8XA 5FLXZ 2KJCA 3F6OA 3REOA 5JI6A 2LKPA 4BHPA 2MH9A 1BN5A 3HOTA 2RV8A 5HVQC 1SFUA 4Y17A 1AOYA 2P7CB 2VE8A 1W5TA 3EETA 1J9IA 3KEQA 3BJAA 1XSDA 1OYYA 2P4WA 4RAYA 5CVJA 2H6CA 1U2WA 4DNCA 2XV4S 4EV0A 1WI9A 4G6DA 4ENMA 4LD5A 1SMTA 4A6DA 4P55A 2E7WA 2STWA 5LRRA 1TTYA 1SFEA 1STZA 2HTSA 3WE3A 3RPUA 4P9UA 4LLLA 2ZBKA 1FP1D 2ACJA 2O61A 2FMYA 3KETA 5BOXA 1FT9A 4UNOA 3E6DA 5E1XA 2MD5A 4S05A 1YFHA 1TLHB 1P92A 3HHHA 1ZG5A 4MEYF 3I54A 3SXYA 3VB2A 3F23A 5ILVA 2IT0A 3TDZC 4LMYA 3EYIA 1PP8F 2HYFA 3VOEA 3R61A 5ILUA 4OIQF 5CLSA 4WXHA 3RYPA 1UB9A 4EJOA 1KYZA 3IL2A 2ZMEA 3IC7A 3SZTA 3KP4A 5ICGA 2IW5A 3RJPA 2C6YA 3SQNA 3GZ5A 2ZCWA 1Q1HA 1HQCA 3WTZA 4AIHA 3LA3A 4IRIA 2HKXA 1EH6A 3IHUA 4LJZF 3K0LA 1L0OC 5IT3A 2HDCA 1OYWA 1WSUA 4YFNF 1W4MA 1W7PD 2EK5A 2OA4A 2W24A 2VODA 2COMA 4G7ZF 2LF7A 4WK8F 1OMIA 2VC0A 2XASA 1HXDA 2CW0F 2QLZA 2K27A 4HX8A 1BC8C 1S3JA 1IRFA 2PJPA 1ZRDA 1Z6TA 4G7OF 5F6FA 2CYYA 1CF7A 2UXXA 4ZYHA 5HDGA 4UV9A 1GXQA 1CGPA 4IVNA 2BEOA 4EM2A 5HDKA 3BDDA 5HLIA 5ERIA 3ZMUA 4I02A 2XROA 3ZMTA 2YU3A 3BPVA 2CSOA 1J59A 1V4RA 2P5VA 4ZYDA 3JSPA 2KIUA 3F21A 4Q5SF 2FNPA 1DPUA 1DUXC 3ZP5A 1YLFA 3V7RA 1MD0A 4I01A 4JQFA 5EEGA 1YW8A 2KIFA 1U5TA 4RGXA 1R5HA 2EFPA 3ZN1A 1SD7A 1PUEE 1XD7A 2LDUA 3R0JA 2V1XA 4R1HA 1I27A 2IVMA 3WTSC 2J5PA 4RB0A 1O3QA 1L3LA 1FLIA 1BIAA 3FHZA 1WWXA 4CICA 3J7AO 4OMYA 2LSOA 1HBXG 3I5UA 4RB3C 2PI0A 5JFRA 2NNYA 3ZMZA 4UVAA 1XGSA 3IRRA 4ENKA 1TW2A 5LGTA 2GXGA 2UZKA 2ZNZA 1SMYF 1OYIA 3BPXA 2LF8A 4HYEA 4M74A 2QUFA 1AWCA 2Q8KA 3GW2A 1B9MA 4LG0A 1HKQA 4QLCU 2VBWA 6PAXA 2Y48A 1LVAA 4WCGA 4ON0A 1OKRA 3WTYC 5D6EA 2XVCA 4KNYA 1MZBA 2EFQA 3BY6A 4YIFA 4WX9A 1P6RA 5HS9A 2RC4A 4NHJA 2RGVA 2PMHA 4IF4A 1JHFA 4ESFA 2XIGA 2GQQA 2ZMEB 3T0YA 2FF4A 4I2OA 3CUOA 1SD4A 3J81K 1ON1A 1U8RA 1IN7A 1XDSA 4ETSA 1R1UA 3GLXA 4HF1A 2VE9A 5BMZA 1IXCA 4ZYEA 2A6HF 5DYMA 4P9FA 4IXAA 2BBYA 4UXNA 3Q9VA 3QAHA 4LGWA 2VC1A 4L5IA 4G94A 1ZLJA 1J5YA 1OR7A 3SZPA 2XRNA 1UFMA 3LAPA 3T8TA 3QRFF 1BI3A 2K7LA 4HX4A 1E2XA 1LJ9A 3NQOA 2XKOA 3GXOA 3TQNA 3RKYA 4HZFA 2FBKA 1H9TA 4L5JA 3MZYA 2XAFA 4YG2F 3R0AA 4UV8A 3WODF 1KU2A 3TO7A 1FYKA 3RKXA 5K5QA 4ESBA 4ZZDA 2MLGA 1IUYA 2VBXA 3RTRA 1FBQA 1BI0A 3Q9SA 4L0ZB 2K86A 4KN7X 5FGMA 5CVIA 3ROUA 1LQ1A 5E8IA 3GFMA 2D45A 1JHHA 2M30A 1FBSA 1Z91A 3R4KA 5FFZA 2O8XA 1IAWA 1MJ9A 3HTSB 3PQKA 2JRTA 4HAMA 2QYOA 2X4HA 4PGGA 2BE5F 4RGSA 3GUDA 3ISPA 3V8KA 5ICFA 3HSRA 4EJWA 5E20A 1T39A 3LQRA 1VTNC 4BYYA 1DP7P 2GA2A 3F22A 3FMSA 4MNUA 2KJBA 5H6RA 2B0LA 5D6FA 5BS6A 5CJ9A 1D8KA 1LDDA 2YPRA 3E97A 1TW3A 1LB2A 5K1YA 4GYGA 4LG0B 5L3GA 2KRFA 3GEZA 3GFJA 4ENNA 1K78A 4LLNA 4KMFA 3GYHX 1BIBA 3KCCA 3NRVA 2KIMA 1B1BA 2QWWA 1NHAA 2NAZA 2W57A 4HQEA 3KFWX 2GA1A 5HLGA 3M7GA 4KMUX 4CO8A 3ERED 2P6TA 1B59A 3BJOA 1G3SA 4M72A 2IA1A 3I0TA 5LGNA 1EV7A 2JSCA 2H09A 3F72A 1P4AA 3ABTA 2QBYA 3JAMK 2R7DA 5AIPA 4HV5A 1BJAA 1HKTA 2A69F 1Y0UA 2HKOA 3CLOA 1XGMA 1BOAA 1EH8A 4KIBA 1R23A 5ILSA 1HKSA 2F5DA 2HYGD 4EQQA 4UVBA 3KLOA 4TV7A 4Z2YA 2HQRA 1BI1A 2QENA 4XSXF 5D5VB 1W7PB 5JHUA 5L3BA 1QPMA 4N9HA 4PCQA 1OPCA 1HW5A 3G3ZA 5DD4A 2DPDA 3HSFA 5DDGA 1UCRA 4K2EA 3F8BA 2XHKA 1FC3A 3T1BA 4P96A 1MKMA 1S7OA 3CUQC 1ZG1A 4QWQA 4N9IA 3RIRA 2VBYA 1ODDA 4RB1A 1Z7UA 2HR3A 4OIRF 3JW4A 1BI2A 1IRGA 4MQVA 3W6KB 2DI3A 1SD6A 2L4AA 1JXSA 3QPHA 4A0XA 1QGPA 2Z3YA 2QVOA 3MAJA 5LHGA 3F6VA 2Z33A 1YQAA 4IRHA 5CVVA 1YG2A 3MZHA 1IXSB 5K5OA 3V7SA 4CGZA 1QNTA 2HQNA 2AXLA 2V9VA 3F3XA 4MEXF 3GFIA 4KDPA 4S04A 3K2ZA 5EEHA 2L02A 1XGNA 4OU0A 3C1DA 4I7HA 2HS5A 5IT9K 4O3MA 3E6MA 4XRFA 2FBHA 2NRAC 1F1ZA 2OQGA 4OINF 1IN4A 4KN4X 4A6EA 2VBZA 4EM1A 2V6CA 4AD9A 1XN7A 3K1MA 3OV8A 5D4SA 3KZZA 1ZN2A 5D5UB 2EA2A 4R8HA 3KP2A 2P7VB 1RNLA 2L01A 3QP5A 3ULQB 2HZTA 2DQRA 5J8CA 2GAUA 5FD5A 3K9TA 2QZ8A 4GXOA 3TDUC 2DO7A 5DD8A 3N97A 5DUKA 1DPRA 4G6QA 2QQAA 2VT2A 3JTGA 2W84A 1FYMA 4CHUA 4OIOF 4M9ZA 3I53A 1D3YA 1KU3A 5HLHA 3NEUA 4HQMA 1K78B 4IJAA 2DBBA 4YIIA 2H27A 3F8CA 2VOPA 3V4GA 5LHIA 4L9VA 1R36A 5KK1A 2DPUA 3M1EA 3VFZA 2FRHA 2EB7A 5LLQA 1V3FA 4CDGA 3HRUA 1IW7F 3ZMSA 4XLPF 2QBYB 1YIOA 2EV6A 4FX4A 4ENJA 1FPQA 4G9YA 5L3DA 1FBUA 2FNAA 4LFUA 2ZO4A 2JZYA 3O3KA 2M45A 2CG4A 2XKPA 2CO5A 2A3SA 1YS6A 2L54A 1XMKA 2CFXA 3BP8A 4HBLA 3V8LA 1G3TA 2Z9OA 1R22A 1YO5C 1RUNA 4LB6B 5E8GA 1W5SA 3IKVA 1HW1A 2K4BA 4UUVA 4HA8A 2HGCA 3WTUC 1G3WA 1U78A 1MJBA 2NS0A 2FBIA 1R7JA 1S6LA 1ZRFA 5L3FA 3FM5A 5HS7A 1E17A 1MDMB 3GX4X 1ZGJA 1S29A 2HFHA 2PLYA 2P5KA 3IWZA 4Q4ZF 4EGYA 2YX4A 3WE2A 5CVRA 2ISZA 2H94A 4U7DA 3J81Z 3PFIA 1LDJA 1ZH5A 4YFKF 4Q48A 2V1UA 4O6JA 2A68F 3R60A 3CJNA 2EWNA 2PBIA 4I0AA 1KQ0A 2VT3A 3MCZA 1J7KA 5DV5A 3TO6A 3Q5FA 5LEKA 4NQWA 3I58A 3LSTA 2E7XA 3D0SA 4GCVA 2FXAA 3ZN0A 1K6OA 4RAZA 2G7HA 1K7AA 4F7ZA 2BV6A 2DLLA 2LNBA 4ASNA 5CYVA 3TGNA 1LEAA 3V7CA 2XAJA 2Q0OA 3DEUA 4EM0B 1J0RA 5JR3A 1Z9CA 2D1VA 3D5LA 1LEBA 2FA5A 2MC3A 1XSXA 1LDKB 4HV6A 3KP5A 1Z1DA 1W7PA 4RGUA 4JK1X 3DV8A 2FSWA 2A07F 3JSOA 3GZ6A 1B6AA 2F5FA 1U5TC 1FOKA 3EYYA 5A2QK 5J6XA 1FZPB 4M9XA 3HYIA 2XAQA 2HTJA 3LA2A 4G7HF 1FX7A 3I59B 1R00A 1FSHA 3FXQA 2DT5A 3HUGA 2QQBA 1YTYA 5FO5A 2ZFWA 5H6QA 4UHTA 1O7LA 2EV0A 4IRGA 1QZYA 2FEZA 3LQQA 4D0PA 3EDPA 4E70A 1FSEA 1K79A 3PQJA 1IZ1A 1IN5A 2EFNA 2PMUA 4EVIA 3GVAA 3F8MA 3IWFA 4ZH4F 4MTDA 3E3VA 2BYVE 2Z5UA 2P8TA 2KKOA 4L9TA 1C0WA 3KLNA 2JPBA 2DK8A 2V1DA 5L3EA 4L0YB 1ZAOA 1IN8A 3J80K 3B73A 4MHGA 1D5VA 4LK0F 4A12A 3LA7A 1PDNC 4HLXA 1ZREA 3CUQA 2AS5F 2FOKA 2IA0A 2RNJA 4OMZA 3C3WA 2TDXA 2Y0MA 3LWFA 4FT8A 2F5CA 1FP2A 2R3SA 4XBFA 5DUIA 3FM3A 2QQ9A 2UWMA 3COAC 2HEOA 3G73A 2YSRA 3O2PE 2ZKZA 4PGHA 2GIVA 1U3EM 3DPTA 3B02A 1ZRCA 3WU0A 4H0EA 2OZ6A 1KQ8A 3JAMZ 2NYXA 3FMQA 1XDUA 4BHCA 4I98B 4BH9A 3M8FA 2PN6A 2WV0A 3F8FA 2OD5A 2D2WA 4HW0A 4WXDA 3FXUA 3HTUA 2MBFA 5AIQA 2FE3A 2MA3A 1ZHFA 2STTA 2K4JA 4M9SA 5DCMB 4IPAA 1TQPA 3M9AA 1T38A 2OZUA 1TNTA 4O5VA 5BPDA 5HDNA 2V79A 2ISYA 2VN2A 3E6CC 4IHTA 3E5QA 5LGUA 3TOBA 1JGSA 1XMAA 4HX7A 1R1VA 2OU2A 4R79A 4EGZA 2L4MA 3F8NA 3N4MA 1FYLA 1YW7A 1Z6RA 1J2XA 2BGCA 4KIFA 2VOOA 1DDNA 1RIOH 1O3SA 1H9GA 3P9KA 4RGRA 2EFWA 4AIKA 1MDMA 3GO5A 2MLKA 1F9NA 1ZGAA 1QO0D 2ESHA 4XLNF 1P2FA 3WGGA 4BHBA 5FLXK 2RKHA 3AAFA 5IT9Z 4KT5C 3HRMA 2XAGA 1SAXA 1USSA 5ED4A 1QQIA 2IJLA 1USTA 1EH7A 5E1WA 4KIGA 5ICCA 1D8JA 3U9GA 3U1DA 1FY7A 3T8RA 3DXJF 2A6EF 3FMRA 5KVRA 1S8NA 1B4AA 1R58A 1XCBA 3H92A 1KYWA 3TO9A 1QZZA 4U0VA 4MQ9F 3BJ6A 3WTWC 1RI7A 4ESJA 4U0WA 1BC7C 3W6JB 3K1PA 3KP6A 1YS7A 4Y13A 2YR2A 2ELHA 5LBQA 5F64A 4KICA 1F4KA 3K69A 4U7BA 5K5RA 2PFBA 2FU4A 1GHCA 2O3FA 1SD5A 3M8EA 1ZG3A 3V8JA 1I5ZA 3CUQB 2DU9A 2EA4A 3HOSA 1WRJA 1T6SA 2VXZA 1O7FA 2M1BA 3ZQ7A 3EQLF 3RPQA 4GO1A 3P7NA 3DF8A 2J5OA 1GXPA 2DAOA 5D4RA 2A61A 3L09A 4AVPA 4EJVA 4HF0A 3WTTC 4A0YA 1I1GA 2F5EA 3KZYA 4FHTA 3RDIA 3LFKA 3RYRA 3I59A 2DQLA 1YYVA 4P5OA 3ZPLA 5D5XB 3MFKA 2D1HA 3DQVC 1A04A 2PEXA 1BM9A 2W85A 4A5MA 3E5XA 4EJTA 2WWYA 4KYWA 1H0MA 1I1SA 4I09A 3H3ZA 2WTEA 2H6BA 2DW4A 2A5YB 1G3YA 4KUMA 1WKMA 2IPQX 3QU3A 4WF2A 5AONA 1ONVA 4PZJA 2CQKA 1HW2A 3E6BA 2RDPA 3FZVA 5DEQA 4A2UA 1I6XA 3ECHA 5BPIA 1R5GA 2P6SA 1ON2A 1JE8A 1J75A 3O6BB 4BAYA 4WXCA 2Z99A 2XGXA 4KA4A 3H3UA 2ZJ2A 1ZARA 4CYDA 5TRDA 1S7AA 4XSZF 3CO7C 3QP6A 2PG4A 3MEXA 1REPC 1Z05A 2QM3A 1SFXA 4GYIA 2ZXJA 3I71A 5ICEA 2OBPA 5LHHA 2F2EA 2MH2A 1MGTA 2GWRA 1TNSA 4B8XA 1FWZA 1G4DA 5D8LB 3HRTA 1KGSA 2DFIA 3KE2A 3WTVC 1BBYA 1HSTA 1IXRC 5FFXA 3SHFA 5LRSA 1X3UA 2ETHA 2E1NA 3ZMVA 1WQ2A 1TQIA 3IRQA 3VEPA 4OOIA 2W25A 2HWVA 2JT1A 3WU1B 4ZYGA 2NNNA 3DP7A 3IKTA 2VONA 2X0LA 1RUOA 2JTVA 2K02A 4CXFA 3L2CA 2G7UA 4DQ2A 2G9WA 3LAJA 3R6SA 2RVCA 2FMLA 2M8EA 4I0BA 4AWXB 2OQRA 5HOOA 1MJAA 5DCMA 4LK1F 4JBAA 5LEJA 3WTXC 2EV5A 5H20A 4HOBA 2L3DA 4ZZLA 3OOPA 5A2QZ 3GWZA 2CWEA 2ADUA 3K1NA 1IF1A 3TKYA 1ULYA 2IRFG 2PQ8A 3U2RA 3BWGA 1ZLKA 3HRSA 2R7FA 3WGIA 1HSJA 2JPCA 4YFXF 3HHGA 5BQTA 2XAHA 3ELKA 3L9FA 2DK5A 5FD6A 4L9NA 3VODA 2XUBA 4KFCA 4UVCA 1UHWA 3KEOA 4PDKA 3KP7A 2P5LC 3GFLA 4HDVA 4WWCA 4BQAA 3RI4A 1LNWA 4EJUA 3BZ6A 5D8KB 2WC2A 3L7WA 2RN7A 3HIFA 1O3RA 4M6YA 4A5NA 1T0FA 1CF7B 3QPTA 2IA2A 3J80Z 3S2WA 1KQ9A 3ABUA 3MWMA 3EUHA 2RQPA 1RZ4A 4NB5A 4N0BA 2E1CA 3QOPA 3CTAA 2GXBA 2O0YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CGP A;  2HOE A;  4Q47 A;  5E18 F;  2Q2E A;  3FXR A;  3SFZ A;  1QBJ A;  2YX7 A;  1U6G A;  1PP7 U;  1B9N A;  3BRO A;  3FX3 A;  4MGR A;  3JTH A;  1KU7 A;  3FWE A;  5DCF A;  1U5T B;  1IN6 A;  1UHM A;  1XCV A;  1ZYR F;  5E17 F;  2M87 A;  4MTE A;  3T5X A;  4BNC A;  1KU9 A;  2OAZ A;  3QU6 A;  4L9J A;  4U0Y A;  2DTR A;  4RS8 A;  1TBX A;  4A0Z A;  3DKW A;  5F1R A;  5L3C A;  2EJR A;  3E5U A;  2EFO A;  3DPL C;  1YW9 A;  4LB5 A;  3C7J A;  4IHS A;  3CO6 C;  3FF5 A;  1GVJ A;  4U88 A;  4HDU A;  1XSV A;  5D5W B;  1O3T A;  2ZNY A;  4OIP F;  3ECO A;  1P4X A;  4Y15 A;  3ZMD A;  3TOA A;  2O6G E;  1T2K A;  4B09 A;  2Y75 A;  1F5T A;  4L18 B;  5HS8 A;  4M73 A;  1KA8 A;  4CZZ A;  1T98 A;  4HLY A;  2IP2 A;  4LLG F;  3I64 A;  4BXU A;  2GZW A;  4M6X A;  3RKW A;  2O03 A;  4FX0 A;  2FQ3 A;  3GF2 A;  4EMS A;  3WG9 A;  5JVT A;  3C18 A;  3P9I A;  3DFG A;  4RB2 C;  5CVU A;  3P9C A;  3BOQ A;  1XB4 A;  4AIJ A;  3I4P A;  1TQM A;  1R1T A;  5J8F A;  1XGO A;  2UXN A;  1FNN A;  4HF2 A;  4M71 A;  3ML6 A;  3CDH A;  3HSE A;  5FB2 A;  1P4W A;  2ESN A;  1O57 A;  2M5W A;  3KP3 A;  5E1Z B;  3L00 A;  4GGG A;  3MQ0 A;  3WGH A;  1G6N A;  5TJJ A;  4G8X A;  5FLX Z;  2KJC A;  3F6O A;  3REO A;  5JI6 A;  2LKP A;  4BHP A;  2MH9 A;  1BN5 A;  3HOT A;  2RV8 A;  5HVQ C;  1SFU A;  4Y17 A;  1AOY A;  2P7C B;  2VE8 A;  1W5T A;  3EET A;  1J9I A;  3KEQ A;  3BJA A;  1XSD A;  1OYY A;  2P4W A;  4RAY A;  5CVJ A;  2H6C A;  1U2W A;  4DNC A;  2XV4 S;  4EV0 A;  1WI9 A;  4G6D A;  4ENM A;  4LD5 A;  1SMT A;  4A6D A;  4P55 A;  2E7W A;  2STW A;  5LRR A;  1TTY A;  1SFE A;  1STZ A;  2HTS A;  3WE3 A;  3RPU A;  4P9U A;  4LLL A;  2ZBK A;  1FP1 D;  2ACJ A;  2O61 A;  2FMY A;  3KET A;  5BOX A;  1FT9 A;  4UNO A;  3E6D A;  5E1X A;  2MD5 A;  4S05 A;  1YFH A;  1TLH B;  1P92 A;  3HHH A;  1ZG5 A;  4MEY F;  3I54 A;  3SXY A;  3VB2 A;  3F23 A;  5ILV A;  2IT0 A;  3TDZ C;  4LMY A;  3EYI A;  1PP8 F;  2HYF A;  3VOE A;  3R61 A;  5ILU A;  4OIQ F;  5CLS A;  4WXH A;  3RYP A;  1UB9 A;  4EJO A;  1KYZ A;  3IL2 A;  2ZME A;  3IC7 A;  3SZT A;  3KP4 A;  5ICG A;  2IW5 A;  3RJP A;  2C6Y A;  3SQN A;  3GZ5 A;  2ZCW A;  1Q1H A;  1HQC A;  3WTZ A;  4AIH A;  3LA3 A;  4IRI A;  2HKX A;  1EH6 A;  3IHU A;  4LJZ F;  3K0L A;  1L0O C;  5IT3 A;  2HDC A;  1OYW A;  1WSU A;  4YFN F;  1W4M A;  1W7P D;  2EK5 A;  2OA4 A;  2W24 A;  2VOD A;  2COM A;  4G7Z F;  2LF7 A;  4WK8 F;  1OMI A;  2VC0 A;  2XAS A;  1HXD A;  2CW0 F;  2QLZ A;  2K27 A;  4HX8 A;  1BC8 C;  1S3J A;  1IRF A;  2PJP A;  1ZRD A;  1Z6T A;  4G7O F;  5F6F A;  2CYY A;  1CF7 A;  2UXX A;  4ZYH A;  5HDG A;  4UV9 A;  1GXQ A;  1CGP A;  4IVN A;  2BEO A;  4EM2 A;  5HDK A;  3BDD A;  5HLI A;  5ERI A;  3ZMU A;  4I02 A;  2XRO A;  3ZMT A;  2YU3 A;  3BPV A;  2CSO A;  1J59 A;  1V4R A;  2P5V A;  4ZYD A;  3JSP A;  2KIU A;  3F21 A;  4Q5S F;  2FNP A;  1DPU A;  1DUX C;  3ZP5 A;  1YLF A;  3V7R A;  1MD0 A;  4I01 A;  4JQF A;  5EEG A;  1YW8 A;  2KIF A;  1U5T A;  4RGX A;  1R5H A;  2EFP A;  3ZN1 A;  1SD7 A;  1PUE E;  1XD7 A;  2LDU A;  3R0J A;  2V1X A;  4R1H A;  1I27 A;  2IVM A;  3WTS C;  2J5P A;  4RB0 A;  1O3Q A;  1L3L A;  1FLI A;  1BIA A;  3FHZ A;  1WWX A;  4CIC A;  3J7A O;  4OMY A;  2LSO A;  1HBX G;  3I5U A;  4RB3 C;  2PI0 A;  5JFR A;  2NNY A;  3ZMZ A;  4UVA A;  1XGS A;  3IRR A;  4ENK A;  1TW2 A;  5LGT A;  2GXG A;  2UZK A;  2ZNZ A;  1SMY F;  1OYI A;  3BPX A;  2LF8 A;  4HYE A;  4M74 A;  2QUF A;  1AWC A;  2Q8K A;  3GW2 A;  1B9M A;  4LG0 A;  1HKQ A;  4QLC U;  2VBW A;  6PAX A;  2Y48 A;  1LVA A;  4WCG A;  4ON0 A;  1OKR A;  3WTY C;  5D6E A;  2XVC A;  4KNY A;  1MZB A;  2EFQ A;  3BY6 A;  4YIF A;  4WX9 A;  1P6R A;  5HS9 A;  2RC4 A;  4NHJ A;  2RGV A;  2PMH A;  4IF4 A;  1JHF A;  4ESF A;  2XIG A;  2GQQ A;  2ZME B;  3T0Y A;  2FF4 A;  4I2O A;  3CUO A;  1SD4 A;  3J81 K;  1ON1 A;  1U8R A;  1IN7 A;  1XDS A;  4ETS A;  1R1U A;  3GLX A;  4HF1 A;  2VE9 A;  5BMZ A;  1IXC A;  4ZYE A;  2A6H F;  5DYM A;  4P9F A;  4IXA A;  2BBY A;  4UXN A;  3Q9V A;  3QAH A;  4LGW A;  2VC1 A;  4L5I A;  4G94 A;  1ZLJ A;  1J5Y A;  1OR7 A;  3SZP A;  2XRN A;  1UFM A;  3LAP A;  3T8T A;  3QRF F;  1BI3 A;  2K7L A;  4HX4 A;  1E2X A;  1LJ9 A;  3NQO A;  2XKO A;  3GXO A;  3TQN A;  3RKY A;  4HZF A;  2FBK A;  1H9T A;  4L5J A;  3MZY A;  2XAF A;  4YG2 F;  3R0A A;  4UV8 A;  3WOD F;  1KU2 A;  3TO7 A;  1FYK A;  3RKX A;  5K5Q A;  4ESB A;  4ZZD A;  2MLG A;  1IUY A;  2VBX A;  3RTR A;  1FBQ A;  1BI0 A;  3Q9S A;  4L0Z B;  2K86 A;  4KN7 X;  5FGM A;  5CVI A;  3ROU A;  1LQ1 A;  5E8I A;  3GFM A;  2D45 A;  1JHH A;  2M30 A;  1FBS A;  1Z91 A;  3R4K A;  5FFZ A;  2O8X A;  1IAW A;  1MJ9 A;  3HTS B;  3PQK A;  2JRT A;  4HAM A;  2QYO A;  2X4H A;  4PGG A;  2BE5 F;  4RGS A;  3GUD A;  3ISP A;  3V8K A;  5ICF A;  3HSR A;  4EJW A;  5E20 A;  1T39 A;  3LQR A;  1VTN C;  4BYY A;  1DP7 P;  2GA2 A;  3F22 A;  3FMS A;  4MNU A;  2KJB A;  5H6R A;  2B0L A;  5D6F A;  5BS6 A;  5CJ9 A;  1D8K A;  1LDD A;  2YPR A;  3E97 A;  1TW3 A;  1LB2 A;  5K1Y A;  4GYG A;  4LG0 B;  5L3G A;  2KRF A;  3GEZ A;  3GFJ A;  4ENN A;  1K78 A;  4LLN A;  4KMF A;  3GYH X;  1BIB A;  3KCC A;  3NRV A;  2KIM A;  1B1B A;  2QWW A;  1NHA A;  2NAZ A;  2W57 A;  4HQE A;  3KFW X;  2GA1 A;  5HLG A;  3M7G A;  4KMU X;  4CO8 A;  3ERE D;  2P6T A;  1B59 A;  3BJO A;  1G3S A;  4M72 A;  2IA1 A;  3I0T A;  5LGN A;  1EV7 A;  2JSC A;  2H09 A;  3F72 A;  1P4A A;  3ABT A;  2QBY A;  3JAM K;  2R7D A;  5AIP A;  4HV5 A;  1BJA A;  1HKT A;  2A69 F;  1Y0U A;  2HKO A;  3CLO A;  1XGM A;  1BOA A;  1EH8 A;  4KIB A;  1R23 A;  5ILS A;  1HKS A;  2F5D A;  2HYG D;  4EQQ A;  4UVB A;  3KLO A;  4TV7 A;  4Z2Y A;  2HQR A;  1BI1 A;  2QEN A;  4XSX F;  5D5V B;  1W7P B;  5JHU A;  5L3B A;  1QPM A;  4N9H A;  4PCQ A;  1OPC A;  1HW5 A;  3G3Z A;  5DD4 A;  2DPD A;  3HSF A;  5DDG A;  1UCR A;  4K2E A;  3F8B A;  2XHK A;  1FC3 A;  3T1B A;  4P96 A;  1MKM A;  1S7O A;  3CUQ C;  1ZG1 A;  4QWQ A;  4N9I A;  3RIR A;  2VBY A;  1ODD A;  4RB1 A;  1Z7U A;  2HR3 A;  4OIR F;  3JW4 A;  1BI2 A;  1IRG A;  4MQV A;  3W6K B;  2DI3 A;  1SD6 A;  2L4A A;  1JXS A;  3QPH A;  4A0X A;  1QGP A;  2Z3Y A;  2QVO A;  3MAJ A;  5LHG A;  3F6V A;  2Z33 A;  1YQA A;  4IRH A;  5CVV A;  1YG2 A;  3MZH A;  1IXS B;  5K5O A;  3V7S A;  4CGZ A;  1QNT A;  2HQN A;  2AXL A;  2V9V A;  3F3X A;  4MEX F;  3GFI A;  4KDP A;  4S04 A;  3K2Z A;  5EEH A;  2L02 A;  1XGN A;  4OU0 A;  3C1D A;  4I7H A;  2HS5 A;  5IT9 K;  4O3M A;  3E6M A;  4XRF A;  2FBH A;  2NRA C;  1F1Z A;  2OQG A;  4OIN F;  1IN4 A;  4KN4 X;  4A6E A;  2VBZ A;  4EM1 A;  2V6C A;  4AD9 A;  1XN7 A;  3K1M A;  3OV8 A;  5D4S A;  3KZZ A;  1ZN2 A;  5D5U B;  2EA2 A;  4R8H A;  3KP2 A;  2P7V B;  1RNL A;  2L01 A;  3QP5 A;  3ULQ B;  2HZT A;  2DQR A;  5J8C A;  2GAU A;  5FD5 A;  3K9T A;  2QZ8 A;  4GXO A;  3TDU C;  2DO7 A;  5DD8 A;  3N97 A;  5DUK A;  1DPR A;  4G6Q A;  2QQA A;  2VT2 A;  3JTG A;  2W84 A;  1FYM A;  4CHU A;  4OIO F;  4M9Z A;  3I53 A;  1D3Y A;  1KU3 A;  5HLH A;  3NEU A;  4HQM A;  1K78 B;  4IJA A;  2DBB A;  4YII A;  2H27 A;  3F8C A;  2VOP A;  3V4G A;  5LHI A;  4L9V A;  1R36 A;  5KK1 A;  2DPU A;  3M1E A;  3VFZ A;  2FRH A;  2EB7 A;  5LLQ A;  1V3F A;  4CDG A;  3HRU A;  1IW7 F;  3ZMS A;  4XLP F;  2QBY B;  1YIO A;  2EV6 A;  4FX4 A;  4ENJ A;  1FPQ A;  4G9Y A;  5L3D A;  1FBU A;  2FNA A;  4LFU A;  2ZO4 A;  2JZY A;  3O3K A;  2M45 A;  2CG4 A;  2XKP A;  2CO5 A;  2A3S A;  1YS6 A;  2L54 A;  1XMK A;  2CFX A;  3BP8 A;  4HBL A;  3V8L A;  1G3T A;  2Z9O A;  1R22 A;  1YO5 C;  1RUN A;  4LB6 B;  5E8G A;  1W5S A;  3IKV A;  1HW1 A;  2K4B A;  4UUV A;  4HA8 A;  2HGC A;  3WTU C;  1G3W A;  1U78 A;  1MJB A;  2NS0 A;  2FBI A;  1R7J A;  1S6L A;  1ZRF A;  5L3F A;  3FM5 A;  5HS7 A;  1E17 A;  1MDM B;  3GX4 X;  1ZGJ A;  1S29 A;  2HFH A;  2PLY A;  2P5K A;  3IWZ A;  4Q4Z F;  4EGY A;  2YX4 A;  3WE2 A;  5CVR A;  2ISZ A;  2H94 A;  4U7D A;  3J81 Z;  3PFI A;  1LDJ A;  1ZH5 A;  4YFK F;  4Q48 A;  2V1U A;  4O6J A;  2A68 F;  3R60 A;  3CJN A;  2EWN A;  2PBI A;  4I0A A;  1KQ0 A;  2VT3 A;  3MCZ A;  1J7K A;  5DV5 A;  3TO6 A;  3Q5F A;  5LEK A;  4NQW A;  3I58 A;  3LST A;  2E7X A;  3D0S A;  4GCV A;  2FXA A;  3ZN0 A;  1K6O A;  4RAZ A;  2G7H A;  1K7A A;  4F7Z A;  2BV6 A;  2DLL A;  2LNB A;  4ASN A;  5CYV A;  3TGN A;  1LEA A;  3V7C A;  2XAJ A;  2Q0O A;  3DEU A;  4EM0 B;  1J0R A;  5JR3 A;  1Z9C A;  2D1V A;  3D5L A;  1LEB A;  2FA5 A;  2MC3 A;  1XSX A;  1LDK B;  4HV6 A;  3KP5 A;  1Z1D A;  1W7P A;  4RGU A;  4JK1 X;  3DV8 A;  2FSW A;  2A07 F;  3JSO A;  3GZ6 A;  1B6A A;  2F5F A;  1U5T C;  1FOK A;  3EYY A;  5A2Q K;  5J6X A;  1FZP B;  4M9X A;  3HYI A;  2XAQ A;  2HTJ A;  3LA2 A;  4G7H F;  1FX7 A;  3I59 B;  1R00 A;  1FSH A;  3FXQ A;  2DT5 A;  3HUG A;  2QQB A;  1YTY A;  5FO5 A;  2ZFW A;  5H6Q A;  4UHT A;  1O7L A;  2EV0 A;  4IRG A;  1QZY A;  2FEZ A;  3LQQ A;  4D0P A;  3EDP A;  4E70 A;  1FSE A;  1K79 A;  3PQJ A;  1IZ1 A;  1IN5 A;  2EFN A;  2PMU A;  4EVI A;  3GVA A;  3F8M A;  3IWF A;  4ZH4 F;  4MTD A;  3E3V A;  2BYV E;  2Z5U A;  2P8T A;  2KKO A;  4L9T A;  1C0W A;  3KLN A;  2JPB A;  2DK8 A;  2V1D A;  5L3E A;  4L0Y B;  1ZAO A;  1IN8 A;  3J80 K;  3B73 A;  4MHG A;  1D5V A;  4LK0 F;  4A12 A;  3LA7 A;  1PDN C;  4HLX A;  1ZRE A;  3CUQ A;  2AS5 F;  2FOK A;  2IA0 A;  2RNJ A;  4OMZ A;  3C3W A;  2TDX A;  2Y0M A;  3LWF A;  4FT8 A;  2F5C A;  1FP2 A;  2R3S A;  4XBF A;  5DUI A;  3FM3 A;  2QQ9 A;  2UWM A;  3COA C;  2HEO A;  3G73 A;  2YSR A;  3O2P E;  2ZKZ A;  4PGH A;  2GIV A;  1U3E M;  3DPT A;  3B02 A;  1ZRC A;  3WU0 A;  4H0E A;  2OZ6 A;  1KQ8 A;  3JAM Z;  2NYX A;  3FMQ A;  1XDU A;  4BHC A;  4I98 B;  4BH9 A;  3M8F A;  2PN6 A;  2WV0 A;  3F8F A;  2OD5 A;  2D2W A;  4HW0 A;  4WXD A;  3FXU A;  3HTU A;  2MBF A;  5AIQ A;  2FE3 A;  2MA3 A;  1ZHF A;  2STT A;  2K4J A;  4M9S A;  5DCM B;  4IPA A;  1TQP A;  3M9A A;  1T38 A;  2OZU A;  1TNT A;  4O5V A;  5BPD A;  5HDN A;  2V79 A;  2ISY A;  2VN2 A;  3E6C C;  4IHT A;  3E5Q A;  5LGU A;  3TOB A;  1JGS A;  1XMA A;  4HX7 A;  1R1V A;  2OU2 A;  4R79 A;  4EGZ A;  2L4M A;  3F8N A;  3N4M A;  1FYL A;  1YW7 A;  1Z6R A;  1J2X A;  2BGC A;  4KIF A;  2VOO A;  1DDN A;  1RIO H;  1O3S A;  1H9G A;  3P9K A;  4RGR A;  2EFW A;  4AIK A;  1MDM A;  3GO5 A;  2MLK A;  1F9N A;  1ZGA A;  1QO0 D;  2ESH A;  4XLN F;  1P2F A;  3WGG A;  4BHB A;  5FLX K;  2RKH A;  3AAF A;  5IT9 Z;  4KT5 C;  3HRM A;  2XAG A;  1SAX A;  1USS A;  5ED4 A;  1QQI A;  2IJL A;  1UST A;  1EH7 A;  5E1W A;  4KIG A;  5ICC A;  1D8J A;  3U9G A;  3U1D A;  1FY7 A;  3T8R A;  3DXJ F;  2A6E F;  3FMR A;  5KVR A;  1S8N A;  1B4A A;  1R58 A;  1XCB A;  3H92 A;  1KYW A;  3TO9 A;  1QZZ A;  4U0V A;  4MQ9 F;  3BJ6 A;  3WTW C;  1RI7 A;  4ESJ A;  4U0W A;  1BC7 C;  3W6J B;  3K1P A;  3KP6 A;  1YS7 A;  4Y13 A;  2YR2 A;  2ELH A;  5LBQ A;  5F64 A;  4KIC A;  1F4K A;  3K69 A;  4U7B A;  5K5R A;  2PFB A;  2FU4 A;  1GHC A;  2O3F A;  1SD5 A;  3M8E A;  1ZG3 A;  3V8J A;  1I5Z A;  3CUQ B;  2DU9 A;  2EA4 A;  3HOS A;  1WRJ A;  1T6S A;  2VXZ A;  1O7F A;  2M1B A;  3ZQ7 A;  3EQL F;  3RPQ A;  4GO1 A;  3P7N A;  3DF8 A;  2J5O A;  1GXP A;  2DAO A;  5D4R A;  2A61 A;  3L09 A;  4AVP A;  4EJV A;  4HF0 A;  3WTT C;  4A0Y A;  1I1G A;  2F5E A;  3KZY A;  4FHT A;  3RDI A;  3LFK A;  3RYR A;  3I59 A;  2DQL A;  1YYV A;  4P5O A;  3ZPL A;  5D5X B;  3MFK A;  2D1H A;  3DQV C;  1A04 A;  2PEX A;  1BM9 A;  2W85 A;  4A5M A;  3E5X A;  4EJT A;  2WWY A;  4KYW A;  1H0M A;  1I1S A;  4I09 A;  3H3Z A;  2WTE A;  2H6B A;  2DW4 A;  2A5Y B;  1G3Y A;  4KUM A;  1WKM A;  2IPQ X;  3QU3 A;  4WF2 A;  5AON A;  1ONV A;  4PZJ A;  2CQK A;  1HW2 A;  3E6B A;  2RDP A;  3FZV A;  5DEQ A;  4A2U A;  1I6X A;  3ECH A;  5BPI A;  1R5G A;  2P6S A;  1ON2 A;  1JE8 A;  1J75 A;  3O6B B;  4BAY A;  4WXC A;  2Z99 A;  2XGX A;  4KA4 A;  3H3U A;  2ZJ2 A;  1ZAR A;  4CYD A;  5TRD A;  1S7A A;  4XSZ F;  3CO7 C;  3QP6 A;  2PG4 A;  3MEX A;  1REP C;  1Z05 A;  2QM3 A;  1SFX A;  4GYI A;  2ZXJ A;  3I71 A;  5ICE A;  2OBP A;  5LHH A;  2F2E A;  2MH2 A;  1MGT A;  2GWR A;  1TNS A;  4B8X A;  1FWZ A;  1G4D A;  5D8L B;  3HRT A;  1KGS A;  2DFI A;  3KE2 A;  3WTV C;  1BBY A;  1HST A;  1IXR C;  5FFX A;  3SHF A;  5LRS A;  1X3U A;  2ETH A;  2E1N A;  3ZMV A;  1WQ2 A;  1TQI A;  3IRQ A;  3VEP A;  4OOI A;  2W25 A;  2HWV A;  2JT1 A;  3WU1 B;  4ZYG A;  2NNN A;  3DP7 A;  3IKT A;  2VON A;  2X0L A;  1RUO A;  2JTV A;  2K02 A;  4CXF A;  3L2C A;  2G7U A;  4DQ2 A;  2G9W A;  3LAJ A;  3R6S A;  2RVC A;  2FML A;  2M8E A;  4I0B A;  4AWX B;  2OQR A;  5HOO A;  1MJA A;  5DCM A;  4LK1 F;  4JBA A;  5LEJ A;  3WTX C;  2EV5 A;  5H20 A;  4HOB A;  2L3D A;  4ZZL A;  3OOP A;  5A2Q Z;  3GWZ A;  2CWE A;  2ADU A;  3K1N A;  1IF1 A;  3TKY A;  1ULY A;  2IRF G;  2PQ8 A;  3U2R A;  3BWG A;  1ZLK A;  3HRS A;  2R7F A;  3WGI A;  1HSJ A;  2JPC A;  4YFX F;  3HHG A;  5BQT A;  2XAH A;  3ELK A;  3L9F A;  2DK5 A;  5FD6 A;  4L9N A;  3VOD A;  2XUB A;  4KFC A;  4UVC A;  1UHW A;  3KEO A;  4PDK A;  3KP7 A;  2P5L C;  3GFL A;  4HDV A;  4WWC A;  4BQA A;  3RI4 A;  1LNW A;  4EJU A;  3BZ6 A;  5D8K B;  2WC2 A;  3L7W A;  2RN7 A;  3HIF A;  1O3R A;  4M6Y A;  4A5N A;  1T0F A;  1CF7 B;  3QPT A;  2IA2 A;  3J80 Z;  3S2W A;  1KQ9 A;  3ABU A;  3MWM A;  3EUH A;  2RQP A;  1RZ4 A;  4NB5 A;  4N0B A;  2E1C A;  3QOP A;  3CTA A;  2GXB A;  2O0Y A; 
#chains in the Genus database with same CATH topology
 2IGN A;  4BU2 A;  3H3V K;  1I6H J;  2CGP A;  2HOE A;  4Q47 A;  5E18 F;  2Q2E A;  3FXR A;  3SFZ A;  1QBJ A;  1MIJ A;  3CJT B;  1MNM C;  3D5R C;  4FCY A;  1T95 A;  1X2N A;  3SJM A;  2YX7 A;  2HVQ A;  3TW6 A;  1N78 A;  1U6G A;  3A01 A;  1B9N A;  1PP7 U;  3BRO A;  3FX3 A;  4MGR A;  3X2Q H;  4BBR J;  3JTH A;  1KU7 A;  3FWE A;  5DCF A;  1B72 B;  1U5T B;  2DOE A;  2RRE A;  1IN6 A;  2LH9 A;  1E0E A;  1FMV A;  2AXT C;  4QIW N;  1UHM A;  1XCV A;  4DBR A;  3W6V A;  1IJW C;  1ZYR F;  5E17 F;  2V1N A;  1BW5 A;  2M87 A;  2I8D A;  4MTE A;  2Y9Z A;  3T5X A;  2AQF A;  3CP2 A;  4BNC A;  1KU9 A;  2OAZ A;  3JCU C;  4D5F A;  5KHD A;  2K85 A;  4RDU A;  3QU6 A;  4L9J A;  2HOA A;  2I10 A;  4U0Y A;  2DTR A;  2JMW A;  4RS8 A;  1ITY A;  4XRS A;  1TBX A;  2ZFU A;  4A0Z A;  3TMO A;  1OJL A;  3DKW A;  5F1R A;  1X1D A;  2QCO A;  5L3C A;  2IS4 A;  1XS9 A;  2EJR A;  3E5U A;  2EFO A;  3DPL C;  2CUF A;  4AM3 A;  1YW9 A;  1G8X A;  4LB5 A;  3C7J A;  4IHS A;  3CO6 C;  3FF5 A;  1GVJ A;  4U88 A;  3S14 J;  4HDU A;  3HGY A;  4FQG A;  1XSV A;  4XLA A;  5D5W B;  4E7H A;  1O3T A;  2W82 A;  2ZNY A;  4YRV A;  3ECO A;  4OIP F;  1P4X A;  2F4M B;  4A3I J;  4CH7 A;  2VAS A;  4Y15 A;  4PJM A;  4E4H A;  3HOU J;  3ZMD A;  4D7M A;  4G6T B;  3TOA A;  2AHQ A;  3JRE A;  1YRN A;  2CFO A;  3DLA A;  3BTJ A;  1T2K A;  2O6G E;  4B09 A;  2OV7 A;  3I4N J;  2Y75 A;  1MH4 A;  3E1S A;  4XID A;  1F5T A;  1XX5 A;  2DMP A;  4L18 B;  5HS8 A;  3CCJ I;  1A31 A;  4M73 A;  1I50 J;  1LUJ B;  1OR7 C;  1TWG J;  1KA8 A;  1R71 A;  4CZZ A;  1P7I A;  1FEX A;  1T98 A;  5GPA A;  4HLY A;  3V42 A;  1IGN A;  4A3K J;  2DA7 A;  1QU3 A;  2IP2 A;  3H9J A;  3O8G A;  4LLG F;  3ASO H;  3I64 A;  4BXU A;  1Z21 A;  2GZW A;  4M6X A;  3RKW A;  4A3B J;  1Z0X A;  2O03 A;  3IV5 A;  4FX0 A;  2FQ3 A;  2E60 A;  2DMT A;  1VQN I;  3GF2 A;  1OCP A;  4EMS A;  3WG9 A;  1VQO I;  2OTL I;  5JVT A;  3C18 A;  3DEE A;  3DFG A;  3P9I A;  4RB2 C;  5CVU A;  3P9C A;  1GLN A;  2WAD A;  3BOQ A;  4AVZ A;  2F5V A;  1WJC A;  1XB4 A;  2LMD A;  2L9V A;  4AIJ A;  3I4P A;  4IEJ A;  1TQM A;  1R1T A;  1RR7 A;  2XSD C;  5J8F A;  1XGO A;  2VQC A;  3K7A J;  2UXN A;  1FNN A;  4H4K C;  3OYI A;  4HF2 A;  1TC3 C;  4M71 A;  3ML6 A;  3CDH A;  3QQA A;  3HSE A;  5FB2 A;  1X19 A;  1P4W A;  2ESN A;  2F6C A;  2R7Z J;  4A3L J;  1O57 A;  4PSX A;  2M5W A;  3KP3 A;  2V4J C;  5E1Z B;  3L00 A;  4GGG A;  2KLO A;  4JYK A;  3MQ0 A;  3WGH A;  1G6N A;  4CCN A;  5TJJ A;  3CCL I;  3SYT A;  2X9D A;  3OIO A;  3M3Y J;  3A0H C;  3JRC A;  2EH3 A;  2BY0 A;  1IDY A;  2NOJ B;  4G8X A;  5FLX Z;  5DM7 F;  1GVD A;  1ZKG A;  2VJ4 A;  4F55 A;  2KJC A;  1LFP A;  3F6O A;  3REO A;  5JI6 A;  2LKP A;  1N75 A;  4BHP A;  3ZQL A;  2CQ7 A;  2MH9 A;  1BN5 A;  3HOT A;  2RV8 A;  1VQK I;  4AU7 A;  1APL C;  3K70 D;  5HVQ C;  1SFU A;  4AYB A;  4UUS A;  1Z3X A;  4Y17 A;  1AOY A;  1WVR A;  2P7C B;  3N05 A;  2ZJQ F;  2VE8 A;  1W5T A;  1BA5 A;  3EET A;  3ZQF A;  1J9I A;  3FIS A;  4XNF A;  3KEQ A;  4ZYA A;  3BJA A;  1T56 A;  5TGT A;  1VZ0 A;  3HPG A;  4PFO A;  4XRS G;  1OYY A;  2P4W A;  4B1R A;  1XSD A;  4RAY A;  3S32 A;  5IYC J;  4UB8 C;  3DKX A;  5CVJ A;  2H6C A;  1U2W A;  2KRC A;  4DNC A;  2XV4 S;  4EV0 A;  1WI9 A;  3GTP J;  1D1B A;  2HOT A;  4G6D A;  2ICW G;  4ENM A;  4LD5 A;  1ETO A;  1HDP A;  2XGE A;  1SMT A;  4A6D A;  4X1E A;  4P55 A;  2E7W A;  1RKW A;  4HPQ A;  1SAN A;  2STW A;  3GTG J;  5LRR A;  3W2A A;  3IAM 2;  2ZXH A;  1A36 A;  3M8J A;  1TTY A;  3BCB A;  1STZ A;  1SFE A;  2HTS A;  3I56 I;  3WE3 A;  2IS6 A;  4E7K A;  4V19 K;  3RPU A;  4P9U A;  4LLL A;  1BW6 A;  1XC5 A;  2ZBK A;  1FP1 D;  2ACJ A;  2O61 A;  2EQR A;  1D1C A;  2FMY A;  3KET A;  3K10 A;  2X6Y A;  4FET A;  5BOX A;  1FT9 A;  2DDB A;  3K4J A;  4UNO A;  3E6D A;  2W7N A;  5E1X A;  2MD5 A;  3H9G A;  4S05 A;  2ZJR F;  1YFH A;  3BT9 A;  2R5Y B;  1TLH B;  4DZP A;  2WB1 N;  1P92 A;  3PNV A;  2Q2E B;  2XPU A;  3HHH A;  1ZG5 A;  4MEY F;  2K40 A;  3I54 A;  3SXY A;  3VB2 A;  2DA3 A;  3K4B A;  3HOV J;  3F23 A;  1FJL A;  1YX3 A;  5ILV A;  4BJT A;  2IT0 A;  3TDZ C;  4BE0 A;  2UV1 A;  3FXL A;  3KPH A;  2V9K A;  4LMY A;  3EYI A;  2L5Q A;  2HYF A;  1PP8 F;  5E79 C;  3VOE A;  3R61 A;  4ITV A;  5ILU A;  1VQ7 I;  3HGG A;  4OIQ F;  1ETV A;  2XPW A;  2E5N A;  3CCU I;  5CLS A;  4XMY A;  1LKX A;  3CLQ A;  3CMM A;  4WXH A;  3RYP A;  5CQE A;  4IOC F;  1UB9 A;  3HKZ A;  4XLH A;  4UB6 C;  1KYZ A;  4EJO A;  3IL2 A;  3ZQC A;  1T8I A;  2ZME A;  3IC7 A;  1OCO H;  3SZT A;  3KP4 A;  3RJP A;  2IW5 A;  5ICG A;  2C6Y A;  3SQN A;  3GZ5 A;  2ZCW A;  1Q1H A;  1HQC A;  3VYT B;  3HM5 A;  2IAI A;  1Y0N A;  3WTZ A;  4XN0 A;  4AIH A;  3LA3 A;  4IRI A;  2HKX A;  1EH6 A;  1LFB A;  2Y2Z A;  3IHU A;  4LJZ F;  1NK3 P;  4BE1 A;  3DKY A;  2CMP A;  3K0L A;  4I6Z A;  1L0O C;  2BXZ A;  3U1K A;  4DIQ A;  1U0J A;  5IT3 A;  2H1L A;  2LRE A;  1T08 B;  3UR3 C;  2HDC A;  1OCR H;  2LKX A;  1EKE A;  3HDD A;  2M7B A;  1UJ8 A;  3J7Z I;  4BKX A;  4C2M J;  3LOC A;  1RET A;  3BTC A;  1OYW A;  1WSU A;  1W4M A;  1W7P D;  2EK5 A;  2OA4 A;  2W24 A;  4YFN F;  2VOD A;  2COM A;  4G7Z F;  3IAS 2;  2WAQ N;  2LF7 A;  4WK8 F;  1OMI A;  2VC0 A;  3S1Q J;  2XAS A;  3AG1 H;  3LNQ A;  5LD2 C;  2PMZ A;  1MMA A;  3OR1 C;  1HXD A;  2CW0 F;  3OSF A;  1D5Y A;  2QLZ A;  2K27 A;  4HX8 A;  3L2V A;  1BC8 C;  1S3J A;  1IRF A;  2PJP A;  2LR8 A;  4EEF G;  1ZRD A;  2R7S A;  3QYB A;  1Z6T A;  5F08 A;  4G7O F;  5F6F A;  2CYY A;  3J7Y J;  1GDT A;  2DMU A;  1MBF A;  1CF7 A;  3OMY A;  3CDL A;  3VSL A;  2UXX A;  4ZYH A;  1ETW A;  3ABM H;  4UV9 A;  5HDG A;  1GXQ A;  1CGP A;  1X1A A;  4IVN A;  2VB6 A;  3OL4 A;  2BEO A;  4EM2 A;  4ZDO A;  5HDK A;  2F48 A;  3BDD A;  5HLI A;  2FD5 A;  2O5R A;  5ERI A;  3ZMU A;  1MMD A;  4I02 A;  4BY1 J;  3S93 A;  4LIU A;  1EJ9 A;  2XRO A;  1R6R A;  3ZMT A;  3TED A;  4W97 A;  2YU3 A;  5J1Y A;  2LY2 A;  3JRA A;  3BPV A;  2CSO A;  1J59 A;  1DQU A;  3FXM A;  2ZSH B;  2R7O A;  5M3F J;  1V4R A;  2P5V A;  4ZYD A;  3H5N A;  3M1C A;  3JSP A;  2KIU A;  3F21 A;  4Q5S F;  2FNP A;  1DPU A;  1X3Z B;  2DTZ A;  1DUX C;  3ZP5 A;  1YLF A;  3S1R J;  3Q0U A;  2IXS A;  3V7R A;  4BDZ A;  1MD0 A;  2CUJ A;  5M5W J;  4CZC A;  4I01 A;  4KIS A;  4JQF A;  5EEG A;  5EEA A;  4A3J J;  1YW8 A;  3CC4 I;  2KIF A;  1B72 A;  4PFP A;  1U5T A;  1JJ8 C;  4RGX A;  3KX2 A;  4RM2 A;  1R5H A;  3B6A A;  2ID3 A;  2EFP A;  2QA4 I;  4XQF A;  4U87 A;  4ZDL A;  3ZN1 A;  1P9Q C;  1V5F A;  2HZD A;  1SD7 A;  1PUE E;  1XD7 A;  2LDU A;  3R0J A;  2V1X A;  4R1H A;  5B66 C;  1I27 A;  2IVM A;  1S5L C;  3WTS C;  2J5P A;  4RB0 A;  1O3Q A;  2QKM B;  3HB9 A;  3KYD B;  2GOX B;  1L3L A;  1RC9 A;  1RES A;  4UUS B;  1FLI A;  1BIA A;  2W48 A;  2IGO A;  3FHZ A;  1WWX A;  4CIC A;  3J7A O;  4OMY A;  1DP3 A;  3J7A Y;  2LSO A;  3GTQ J;  1HBX G;  5FKM A;  1Y39 A;  1B8I B;  4KT6 A;  1R5I D;  2LKS A;  5HOD A;  3I5U A;  4RB3 C;  2ID6 A;  2PI0 A;  1Y8Q B;  1W36 D;  5JFR A;  2NNY A;  3VDX A;  2LC2 A;  3CCY A;  3ZMZ A;  2CV2 A;  4HRI A;  4UVA A;  2KQR A;  1BR2 A;  3RQ4 A;  1XGS A;  3IRR A;  3DU6 A;  4IL6 C;  4ENK A;  1KON A;  1TW2 A;  2WY8 Q;  1SC7 A;  5LGT A;  4J00 A;  2KDO A;  2GXG A;  3L2Q A;  1X1P A;  1W5C C;  2FQ4 A;  2UZK A;  4GDF A;  4L5E A;  2ZNZ A;  2VQH A;  1XMX A;  1SMY F;  2X1D A;  1OYI A;  5EZH A;  3MKZ A;  2H8W A;  3BPX A;  4DJA A;  3FBN B;  5IYB J;  1WJE A;  1Z77 A;  2LF8 A;  3Q0V A;  4HYE A;  2XGD A;  4M74 A;  2QUF A;  4QSH A;  1AWC A;  2Q8K A;  3W2W A;  4CCM A;  4HNU A;  5F0H A;  3GW2 A;  1B9M A;  4LG0 A;  1HKQ A;  3CC7 I;  4QLC U;  2VBW A;  3JRD A;  2M4G A;  1FTT A;  3K4N A;  1V5G A;  6PAX A;  2Y48 A;  4CYC B;  3QOD A;  4FTH A;  2DA4 A;  1LVA A;  4WCG A;  4F93 B;  1X1C A;  2XPV A;  2EIN H;  1OKR A;  4ON0 A;  3WTY C;  1TWA J;  5D6E A;  2CV0 A;  2XVC A;  4KNY A;  3IUO A;  4AYB N;  1MZB A;  4C3H J;  2EFQ A;  2QSG X;  1VF9 A;  3BY6 A;  2NVU B;  5J47 A;  4YIF A;  3IH2 A;  1Q1V A;  4WX9 A;  1P6R A;  5HS9 A;  1IRX A;  2RC4 A;  4NHJ A;  2RGV A;  2NVT J;  2PMH A;  2A6T A;  5E3O A;  3RSN A;  2BW3 B;  4IF4 A;  1JHF A;  3GTM J;  2W00 A;  4ESF A;  2XIG A;  2HVS A;  1WJ5 A;  2GQQ A;  3DBR B;  2ZME B;  5IOZ A;  2NVX J;  4MFE A;  3T0Y A;  2FF4 A;  3BTL A;  4I2O A;  3CUO A;  2VXD A;  1MND A;  4HNV A;  1SD4 A;  3J81 K;  1ON1 A;  2ELK A;  1U8R A;  2V6E A;  3S2H J;  1IN7 A;  4BY7 J;  4RAF A;  3BR0 A;  2Y0S A;  1XDS A;  4ETS A;  1HOM A;  5E3M A;  4XLE A;  1LVK A;  3RCO A;  3K4C A;  1R1U A;  3GLX A;  4HF1 A;  1JKP C;  3HJE A;  2DFE A;  4E7S A;  2VE9 A;  5BMZ A;  2BVM A;  3MKL A;  1IXC A;  4ZYE A;  2XC7 A;  4F92 B;  2A6H F;  5DYM A;  5GP9 A;  4OAY A;  2EIJ H;  4P9F A;  4IXA A;  2LG4 A;  2BBY A;  4UXN A;  3AFH A;  3Q9V A;  3QAH A;  2L7Z A;  4LGW A;  2VC1 A;  2WAF A;  4L5I A;  4G94 A;  2M2E A;  3BZK A;  1Y6I A;  1VQ5 I;  1ZLJ A;  1J5Y A;  1OR7 A;  2KRH A;  2V7F A;  3SZP A;  2XRN A;  4FIS A;  4DZJ A;  1UFM A;  3LAP A;  3T8T A;  3QRF F;  3K70 C;  1BI3 A;  2K7L A;  1A6I A;  4HX4 A;  1E2X A;  2XF7 A;  1LJ9 A;  5C44 J;  5FRO A;  3OSG A;  2IGM A;  3NQO A;  1JJ6 C;  2XKO A;  4B47 A;  3GXO A;  2ME6 A;  1Y56 A;  4XM3 A;  5FJ8 J;  3TQN A;  1FTZ A;  4N4N B;  2L9S A;  4NUB A;  5F27 A;  1WGX A;  2E2J J;  1OIS A;  1OCT C;  3RKY A;  3HKZ N;  1JI8 A;  4HZF A;  2A05 A;  2FBK A;  2KDZ A;  2BXY A;  3JRH A;  1DGR M;  3PFY A;  1H9T A;  2PJR B;  3A1Y A;  4L5J A;  3L2W A;  4ZDP A;  2HPI A;  4CUG A;  3MZY A;  2XAF A;  4YG2 F;  3R0A A;  4UV8 A;  1ETX A;  1KU2 A;  3WOD F;  3TO7 A;  1BR1 A;  3HZJ A;  2B63 J;  4XKV A;  1RPW A;  3BTI A;  2R5Y A;  1X4P A;  3ONQ A;  2RQQ A;  1FYK A;  3RKX A;  5K5Q A;  2GXA A;  4ESB A;  4ZZD A;  2DYS H;  5HLT A;  5BNG A;  2MLG A;  1IUY A;  2VBX A;  2Y30 A;  3RTR A;  1QPI A;  1WH7 A;  1FBQ A;  2EIM H;  3EUK L;  1BI0 A;  3OYK A;  3Q9S A;  4L0Z B;  2NVQ J;  2K86 A;  3BR6 A;  4KN7 X;  5FGM A;  2LK2 A;  2KT0 A;  1IG7 A;  5CVI A;  3ROU A;  5GPC A;  1LQ1 A;  3GZN B;  2PMZ N;  4XRM A;  2DCE A;  5E8I A;  3GFM A;  2D45 A;  1JHH A;  5B1A H;  2EIL H;  1H89 C;  3PJR A;  4E7I A;  2M30 A;  1FBS A;  1Z91 A;  2CRG A;  3R4K A;  5FFZ A;  4UY8 I;  4Y4R A;  2O8X A;  1IAW A;  2DFH A;  1MJ9 A;  3HTS B;  3PQK A;  2HYJ A;  2JRT A;  4XLF A;  2R5Z B;  4HAM A;  2QYO A;  4RLF A;  4DGW B;  2X4H A;  1X4O A;  4NNJ A;  4PGG A;  2BE5 F;  4RGS A;  2MD0 A;  2FX0 A;  2HOS A;  2VPL A;  2CW7 A;  2VJJ A;  1ZK8 A;  3GUD A;  3ISP A;  3V8K A;  3BG7 A;  3Q0W A;  2NS7 A;  5ICF A;  3BG5 A;  4RA2 A;  4D5C A;  3HSR A;  4EJW A;  5E20 A;  3DTI A;  1T39 A;  3HC7 A;  3LQR A;  4PUS A;  1VTN C;  4BYY A;  1DP7 P;  2GA2 A;  3M07 A;  3F22 A;  3FMS A;  4MNU A;  2KJB A;  4IO9 F;  5H6R A;  1IO2 A;  4BE2 A;  2R4G A;  1Y1W J;  4LIT A;  5F04 A;  2B0L A;  5D6F A;  5BS6 A;  5CJ9 A;  1D0X A;  4B43 A;  1D8K A;  1LDD A;  3BR5 A;  3OWT A;  4IQ4 A;  2YPR A;  3E97 A;  4F3Q A;  1TW3 A;  3AL0 C;  2XRL A;  1LB2 A;  4IHY A;  4DYR A;  5K1Y A;  3CD6 I;  3SDB A;  4GYG A;  2MC4 A;  3OYD A;  3HOZ J;  4LG0 B;  5L3G A;  2KRF A;  4KIT B;  5J4Y A;  2ZSI B;  3GEZ A;  3GFJ A;  4ENN A;  1K78 A;  4LLN A;  3GTK J;  4KMF A;  2HU9 A;  1BL0 A;  3GYH X;  1VND A;  1PJR A;  1BIB A;  3ABL H;  3S2D J;  1NH3 A;  3KCC A;  3NRV A;  2XGC A;  3I4M J;  2KIM A;  3H36 A;  2X6X A;  1B1B A;  3SDG A;  2QWW A;  1NHA A;  2NAZ A;  1Z7L A;  2W57 A;  2R7Q A;  5C4J J;  4HQE A;  5GTH C;  3KFW X;  2GA1 A;  1QZE A;  2LFB A;  2OJE D;  3M7G A;  4KMU X;  5HLG A;  4CO8 A;  3SFI A;  1QHH D;  3ERE D;  2P6T A;  1B59 A;  2GM4 A;  3BJO A;  4NQW B;  1F43 A;  1G3S A;  4M72 A;  2BY2 A;  2CQQ A;  2IA1 A;  3I0T A;  5LGN A;  2E2H J;  5IYD J;  1EV7 A;  2BY1 A;  2JSC A;  1T0F C;  2MFZ A;  2KZG A;  2H09 A;  4OAZ A;  5DM6 F;  3F72 A;  2VKD A;  4IQJ A;  3VWB A;  1P4A A;  3ABT A;  2V26 A;  2QBY A;  3JAM K;  4XOT A;  1MH3 A;  2OCE A;  3ABK H;  2R7D A;  5AIP A;  2YUS A;  3SEQ A;  4HV5 A;  4PJL A;  1BJA A;  1HKT A;  3EUH C;  1WJF A;  3SZG A;  2A69 F;  2HQA A;  1Y0U A;  3CLO A;  2HKO A;  1LE8 B;  1XGM A;  1R9T J;  1BOA A;  3ZQG A;  1EH8 A;  4KIB A;  1R23 A;  5ILS A;  4NBQ A;  1HKS A;  2F5D A;  1GV2 A;  2JA2 A;  2HYG D;  3GBG A;  4EQQ A;  2HVR A;  4C30 A;  2H1K A;  2CQX A;  3HXL A;  3KLO A;  1ETQ A;  4UVB A;  3OYB A;  4TV7 A;  1TL8 A;  2JSP A;  4Z2Y A;  2X1C A;  2HQR A;  2P81 A;  1BI1 A;  2QEN A;  2WY7 Q;  4XSX F;  3AL0 B;  5D5V B;  1W7P B;  5JHU A;  5L3B A;  1QPM A;  4N9H A;  4PCQ A;  1B8I A;  1OPC A;  2NXN B;  2PX9 A;  3RKQ A;  2L0K A;  2XB0 X;  1HW5 A;  3G3Z A;  3G2B A;  5FKN A;  3A2K A;  3F0C A;  1MW7 A;  5DD4 A;  2DPD A;  3HSF A;  5DDG A;  4ZJZ A;  1U9N A;  1UCR A;  4K2E A;  4JX5 A;  3F8B A;  1I3Q J;  2XHK A;  4NDL A;  5J1U A;  1FC3 A;  3BQY A;  1W36 C;  1WJA A;  4AID A;  3CME I;  3T1B A;  1UG0 A;  4P96 A;  1MKM A;  3E0J B;  1S7O A;  3CUQ C;  1ZG1 A;  4QWQ A;  2ME0 A;  1ZR2 A;  4IX7 A;  4N9I A;  3RIR A;  4IHX A;  2VBY A;  3DBL B;  1ODD A;  3HUG B;  3BZC A;  4RB1 A;  1Z7U A;  2HR3 A;  4OIR F;  4BXX J;  2V9P A;  3JW4 A;  1BI2 A;  1IRG A;  2LD5 A;  4MQV A;  3L2R A;  3W6K B;  2DI3 A;  3OYA A;  2VI6 A;  1SD6 A;  2L4A A;  1JXS A;  4CYC A;  3QPH A;  2QQ8 A;  4A0X A;  2NOG A;  1QGP A;  3S17 J;  3TL4 X;  1NK2 P;  3HOY J;  1K6Y A;  2Z3Y A;  2QVO A;  3LSI A;  4GRI A;  1I3A A;  2YS9 A;  3MAJ A;  1MMG A;  3F6V A;  5LHG A;  1YQA A;  2Z33 A;  4IRH A;  5CVV A;  4E7J A;  1YG2 A;  3MZH A;  3GTO J;  1S7E A;  5JVG F;  1IXS B;  4CCK A;  3V7S A;  1KZH A;  5K5O A;  4CGZ A;  1QNT A;  3S16 J;  2BW3 A;  2HQN A;  2AXL A;  2V9V A;  3F3X A;  4MEX F;  4RBO A;  1UG2 A;  3GFI A;  4KDP A;  4S04 A;  1UMQ A;  3GME A;  3K2Z A;  2WAE A;  4CA0 A;  3EPZ A;  3OS1 A;  5EEH A;  4D1Q A;  2L02 A;  1XGN A;  4OU0 A;  3C1D A;  4HST A;  4I7H A;  4OWR B;  1MBE A;  4IKF A;  2HS5 A;  5IT9 K;  3PM1 A;  2MG4 A;  3E6M A;  4QPO A;  4O3M A;  3TP0 A;  4XRF A;  2FBH A;  2NRA C;  3ZQI A;  1F1Z A;  2OQG A;  4OIN F;  1IN4 A;  4M3D A;  4KN4 X;  3LL7 A;  4A6E A;  2VBZ A;  2ZB9 A;  2V6C A;  4EM1 A;  2K3P A;  1XN7 A;  2M34 A;  3G1L A;  3K1M A;  4RMN A;  3OV8 A;  4AD9 A;  5D4S A;  3K4K A;  3KZZ A;  3ZXS A;  1Y8R B;  1JT6 A;  3KYL A;  1ZN2 A;  4M3F A;  1MNE A;  2K5C A;  5D5U B;  2EA2 A;  4R8H A;  3KP2 A;  2P7V B;  3NWT A;  1RNL A;  2L01 A;  3P5J A;  3QP5 A;  3ULQ B;  1MBH A;  2HZT A;  2HPM A;  1CQT A;  2DQR A;  2M8G X;  1POG A;  5J8C A;  5GAE J;  2GAU A;  5FD5 A;  2JQ7 A;  5IY5 H;  1TT5 B;  3K9T A;  4BXF A;  3ZQQ A;  2QZ8 A;  3QPL A;  4GXO A;  1MBJ A;  3TDU C;  2DO7 A;  3CF5 F;  1YIJ I;  5DD8 A;  2K3F A;  5DUK A;  3N97 A;  1DPR A;  4G6Q A;  5M5Y J;  2QQA A;  2VT2 A;  3JTG A;  1FMW A;  2W84 A;  3A0B C;  1FYM A;  4CHU A;  4OIO F;  3B6C A;  4JOM A;  3FXJ A;  1JUP A;  4M9Z A;  3I53 A;  1D3Y A;  1KU3 A;  3DCF A;  5HLH A;  3NEU A;  4HQM A;  1K78 B;  4XKC A;  3A03 A;  4IJA A;  2DBB A;  4YII A;  2ZXI A;  2KPM A;  4YEL A;  2H27 A;  3FIW A;  3F8C A;  3ESW B;  2PJR A;  1A5J A;  2VOP A;  3V4G A;  5LHI A;  4L9V A;  1R36 A;  2O7O A;  2CU7 A;  3K6G A;  3Q3S A;  5EG0 B;  1TWC J;  5KK1 A;  2DPU A;  1GUU A;  3M1E A;  1S72 I;  3S1M J;  4JX6 A;  3VFZ A;  2ELJ A;  2FRH A;  2EB7 A;  3PSF A;  4C3I J;  1MMN A;  2M7A A;  2VKV A;  4DW6 A;  1H8A C;  5LLQ A;  1V3F A;  4CDG A;  1WCM J;  2LRD A;  3HRU A;  3FK7 A;  1IW7 F;  2OPT A;  3ZMS A;  3FXO A;  5C3E J;  4XLP F;  2QBY B;  1YIO A;  2EV6 A;  4BL0 B;  4FX4 A;  3QYE A;  4ENJ A;  1FPQ A;  2XF6 A;  4G9Y A;  5L3D A;  1R4N B;  4BQN A;  2MAB A;  1VQ8 I;  2VJ5 A;  5F0F A;  3CCQ I;  2M4K A;  1FBU A;  2FNA A;  1K4T A;  2KP6 A;  4LFU A;  3CJR B;  2ZO4 A;  2JJ7 A;  2JZY A;  3O3K A;  2M45 A;  2CG4 A;  2XKP A;  2CO5 A;  1F36 A;  3AG4 H;  2DDA A;  1ERD A;  2DMQ A;  4CSW A;  3HEF A;  2A3S A;  3GCM A;  2QGU A;  1YS6 A;  1VFC A;  2L54 A;  4A3F J;  1U9O A;  1XMK A;  2CFX A;  3BP8 A;  4HBL A;  3V8L A;  2R5Z A;  3HG9 A;  1G3T A;  3OS0 A;  2Z9O A;  1YJW I;  1R22 A;  3DWL E;  1YO5 C;  1RUN A;  2FUG 2;  3I9V 2;  3LSH A;  4LB6 B;  1W0T A;  2OCC H;  3UKG A;  5E8G A;  3H5R A;  5J3L A;  3PO3 J;  1W5S A;  3IKV A;  5GAD J;  1LPQ A;  1HW1 A;  2K4B A;  4UUV A;  4HA8 A;  5M5X J;  3IH3 A;  2HGC A;  2JUC A;  3C2G A;  3WTU C;  1G3W A;  4A93 J;  1U78 A;  3JRI A;  1MJB A;  2NS0 A;  2K9Q A;  2FBI A;  1R7J A;  1S6L A;  1ZRF A;  4MLO A;  5L3F A;  1SVO A;  3BC8 A;  3FM5 A;  5HS7 A;  1E17 A;  3PO2 J;  1MDM B;  3RZO J;  1D0Z A;  3GX4 X;  1ZGJ A;  1V55 H;  1S29 A;  2HFH A;  4NC7 A;  2PLY A;  3FDY A;  2P5K A;  3IWZ A;  4Q4Z F;  4EGY A;  1TZL A;  2YX4 A;  3WE2 A;  2E71 A;  5CVR A;  2ISZ A;  3PIO F;  1YJN I;  4M3G A;  4BJ5 C;  2HXI A;  2H94 A;  3H0G J;  3BG3 A;  2VQG A;  4U7D A;  3J81 Z;  1WZ2 A;  4PJJ A;  3PFI A;  1BJZ A;  4A3G J;  3IP4 B;  1LDJ A;  3FK6 A;  1ZH5 A;  2R7V A;  4XOP A;  4YFK F;  4BUP A;  4Q48 A;  2Z16 A;  2OF7 A;  2V1U A;  1TT0 A;  2KIS A;  3LMM A;  4O6J A;  2A68 F;  3R60 A;  1FIP A;  1FIA A;  3AKZ A;  1MBG A;  3CJN A;  4RAG A;  3PNY A;  2EWN A;  2PBI A;  4I0A A;  1KQ0 A;  2VT3 A;  3MCZ A;  1J7K A;  5DV5 A;  2YU9 J;  2N8G A;  3TO6 A;  2XF5 A;  3Q5F A;  5LEK A;  4NQW A;  3VSK A;  3I58 A;  3LST A;  2E7X A;  3ZOB A;  1RR8 C;  3D0S A;  1K83 J;  2FXA A;  4GCV A;  3ZN0 A;  2LY1 A;  1K6O A;  3CC2 I;  4RAZ A;  2G7H A;  1JKR C;  3OYL A;  4DBQ A;  3HPH A;  2ZC2 A;  3AG2 H;  1K7A A;  3IH4 A;  4PK4 A;  4F7Z A;  2BV6 A;  1WJD A;  2A5W A;  2DLL A;  2LNB A;  2M0M A;  4ASN A;  5CYV A;  4D7N A;  1X1B A;  1I39 A;  5EJC A;  3TGN A;  1LEA A;  4ZTJ A;  3V7C A;  1XG1 A;  3PL8 A;  2M0C A;  2XAJ A;  2Q0O A;  5B5E C;  4ZC3 A;  4N4O B;  1LE8 A;  4C2U A;  3DEU A;  2BHZ A;  4XLC A;  4PJ0 C;  3OYC A;  4EM0 B;  1J0R A;  5JR3 A;  1Z9C A;  2D1V A;  3D5L A;  1HF0 A;  1RRJ A;  1LEB A;  1ORK A;  2FA5 A;  2MC3 A;  3W2V A;  2ZJP F;  4A69 C;  3CF2 A;  5IOY A;  2IGK A;  1XSX A;  2JRM A;  5J40 A;  1LDK B;  4HV6 A;  3KP5 A;  3GTJ J;  1Z1D A;  2DA6 A;  1W7P A;  3RQI A;  1TWF J;  3PIP F;  4RGU A;  4JK1 X;  1M1E B;  3DV8 A;  2FSW A;  2WB1 A;  2A07 F;  4C3J J;  3U21 A;  4CCJ A;  3JSO A;  3GZ6 A;  1HDD C;  1B6A A;  2F5F A;  1U5T C;  1FOK A;  3G71 I;  3D5S C;  1ENH A;  3EYY A;  4PSW A;  4BS9 A;  5A2Q K;  1HC8 A;  4Y33 A;  5K7F A;  5J6X A;  4BAC A;  1LFU P;  2W4S A;  1FZP B;  4M9X A;  1OLT A;  4BGD A;  3HYI A;  2EZL A;  9ANT A;  3KIO A;  2XAQ A;  3K4M A;  5FKK A;  2CQN A;  2EIK H;  2HTJ A;  2LTP A;  2F4I A;  3LA2 A;  4G12 A;  4G7H F;  3BR1 A;  2NVY J;  1FX7 A;  5C4X J;  3I59 B;  4XK4 A;  1R00 A;  1FSH A;  1VQP I;  2H8R A;  3FXQ A;  2DT5 A;  3HUG A;  4II2 A;  2HNH A;  4I99 C;  4E6K G;  2KL4 A;  2L7M P;  1UEL B;  1ZTR A;  2DMN A;  2QQB A;  4MFD A;  1YTY A;  5FO5 A;  2ZFW A;  3WU2 C;  5H6Q A;  2DOA A;  4UHT A;  3AG3 H;  4HSR A;  1O7L A;  2EV0 A;  4IRG A;  4J01 A;  4HG2 A;  4B3X A;  1U8B A;  1QZY A;  2FEZ A;  1IC8 A;  3LQQ A;  3RPU D;  4D0P A;  4QTR A;  3EDP A;  4E70 A;  1FSE A;  2LBF A;  1K79 A;  4A3D J;  5M3M J;  2JVH A;  3VYU B;  4NC6 A;  3PQJ A;  1T33 A;  3K2A A;  1IZ1 A;  1IN5 A;  1TP4 A;  2EFN A;  2PMU A;  4EVI A;  3GVA A;  3F8M A;  1XPX A;  2OTJ I;  3IWF A;  2WAQ A;  1WHU A;  4ZH4 F;  4MTD A;  3PNT A;  3E3V A;  2BYV E;  2Z5U A;  2P8T A;  3DLL F;  2KKO A;  1YHQ I;  4L9T A;  1C0W A;  4M3E A;  3KLN A;  1QVT A;  2JPB A;  1QRY A;  2EZI A;  3TP3 A;  2VKH A;  4FE4 A;  1MMS A;  1QA6 A;  2DK8 A;  3M4O J;  2V1D A;  5L3E A;  4L0Y B;  1ZAO A;  1IN8 A;  1ZQ3 P;  2ECC A;  1E3H A;  2DJN A;  3J80 K;  3B73 A;  4Y52 J;  2LYC A;  4MHG A;  2IEK A;  3WHC A;  2DA5 A;  2JA7 J;  1D5V A;  3S3N A;  3MMY B;  4LK0 F;  4A12 A;  4DOZ A;  1JTX A;  5GTI C;  5EZG A;  2R7R A;  3BLY A;  3LA7 A;  1PDN C;  4HLX A;  2VUM J;  5JLX A;  3PUB A;  1ZRE A;  2TRT A;  3CUQ A;  2AS5 F;  3OYJ A;  2FOK A;  2IA0 A;  2GIZ A;  2RNJ A;  4AC0 A;  1MBK A;  4OMZ A;  3C3W A;  2GLO A;  3QWL A;  2TDX A;  2Y0M A;  3LWF A;  4FT8 A;  1DU0 A;  2F5C A;  3DPU A;  1W1W E;  3OYG A;  1JUM A;  1FP2 A;  2R3S A;  2L7K A;  4XBF A;  1OCC H;  1N25 A;  5JLW A;  5DUI A;  4IHV A;  3FM3 A;  4S0H B;  2QQ9 A;  4BQQ A;  2UWM A;  3JRB A;  2JWT A;  2LY9 A;  3COA C;  2HEO A;  3LSK A;  3G73 A;  1YJ9 I;  4YEJ A;  2YSR A;  1FOY A;  3O2P E;  2XB5 A;  2ZKZ A;  4BEH A;  4PGH A;  4BJ6 C;  2GIV A;  2VPR A;  2QF7 A;  3LSG A;  1U3E M;  3DPT A;  3B02 A;  1ZRC A;  3WU0 A;  3WHB A;  2K9S A;  4H0E A;  2OZ6 A;  4FAS D;  5KNL A;  1KQ8 A;  1WH5 A;  2E35 A;  3JAM Z;  2NYX A;  3OOU A;  2FOW A;  3FMQ A;  1XDU A;  1WJB A;  1P7J A;  1HA8 A;  3HOW J;  4BHC A;  3OIP A;  3JRF A;  1YE9 A;  4I98 B;  3S3O A;  4BH9 A;  2CUZ A;  2EPF A;  3M8F A;  2JVG A;  4GFB A;  2PN6 A;  2WV0 A;  1D0Y A;  3F8F A;  5EG0 A;  1G2H A;  2OD5 A;  1GT0 C;  2O8K A;  2D2W A;  2DA1 A;  4HW0 A;  2X48 A;  1JTY A;  4WXD A;  3FXU A;  3HTU A;  3ZR8 X;  3D1N I;  4W1U A;  2JUG A;  2K9L A;  2MBF A;  1PUF B;  3VYS B;  1DU6 A;  5AIQ A;  3C2H A;  2FE3 A;  3H1C A;  2VQL A;  3A4C A;  2MA3 A;  1ZHF A;  3PUF A;  1WPK A;  4F91 B;  2E1O A;  3OL3 A;  3ERM A;  2STT A;  2K4J A;  4M9S A;  5DCM B;  1XTA A;  4IPA A;  1MSE C;  1TQP A;  3M9A A;  2FJ1 A;  1QHG A;  3LSR A;  1T38 A;  3K4L A;  2OZU A;  1TNT A;  4O5V A;  5BPD A;  1JKO C;  1X2M A;  4E7L A;  4II3 A;  3L1P A;  5HDN A;  2V79 A;  1JUS A;  2ISY A;  2VN2 A;  3F9K A;  3E6C C;  2B7E A;  3FKJ A;  5EF6 A;  2NS8 A;  3OYN A;  1R4M B;  4IHT A;  1JKQ C;  1ETK A;  1WI3 A;  2IS1 A;  5EGO A;  3E5Q A;  5LGU A;  2Y69 H;  3TOB A;  1AU7 A;  3MVP A;  4XL9 A;  1JGS A;  1XMA A;  5EYR A;  4HX7 A;  1R1V A;  5J4V A;  5H2F C;  4C2T A;  2OU2 A;  3HL2 A;  5IP7 J;  3HBL A;  3TBI A;  2GOM A;  5GAH J;  5EDN A;  2Z1D A;  4R79 A;  1VI0 A;  3WG7 H;  1BOB A;  5IP6 A;  4EGZ A;  2UUZ A;  2L4M A;  3F8N A;  1ZGW A;  4HNT A;  3N4M A;  1FYL A;  1YW7 A;  2ECB A;  3MN2 A;  2L7F P;  3ZCO A;  1Z6R A;  1J2X A;  2BGC A;  4KIF A;  2VOO A;  3G1M A;  1DDN A;  5B1B H;  4B4C A;  5DS9 A;  1H9G A;  1RIO H;  1O3S A;  4A3C J;  1TWH J;  2E34 A;  3P9K A;  3O8H A;  3BG9 A;  2E1M C;  1H88 C;  2VKE A;  1AKH A;  3CP8 A;  3CCS I;  3I3L A;  4RGR A;  2WBM A;  2EFW A;  1A35 A;  4AIK A;  5LFA A;  1MDM A;  4MO7 A;  2R7T A;  2CS3 A;  3GO5 A;  2MLK A;  4UUT A;  1F9N A;  1ZGA A;  1QO0 D;  2ESH A;  2EZH A;  4BDY A;  2BY3 A;  5E3N A;  4XLN F;  1P2F A;  2Y0S N;  3WGG A;  1HCR A;  2HI3 A;  2X51 A;  4BHB A;  1ZEL A;  1ACI A;  5FLX K;  2RKH A;  2RNG A;  3AAF A;  5IT9 Z;  3QOE A;  4KT5 C;  4A3E J;  2ZXW H;  3HRM A;  1DGW Y;  4M6V A;  2XAG A;  2LBF B;  1SAX A;  1USS A;  3KZI C;  1YI2 I;  1AA7 A;  1RKT A;  2WV1 A;  5ED4 A;  1QQI A;  2IJL A;  1UST A;  1EH7 A;  4V2G A;  5E1W A;  3OY9 A;  4KIG A;  5ICC A;  2DT6 A;  1MSF C;  3OYM A;  4XKB A;  4Z6Y A;  1D8J A;  3U9G A;  3U1D A;  3OR2 C;  2LVS A;  3CQZ J;  1FY7 A;  3T8R A;  3DXJ F;  2A6E F;  1BR4 A;  3FMR A;  4NC8 A;  1S8N A;  1B4A A;  5KVR A;  3GTL J;  1R58 A;  1XCB A;  2IBD A;  3H92 A;  2QKL B;  1KYW A;  3TO9 A;  1QZZ A;  4U0V A;  3OIQ A;  3BJ6 A;  2CH0 A;  4MQ9 F;  3A01 B;  3WTW C;  1RI7 A;  4ESJ A;  4I76 A;  4U0W A;  2EBI A;  1BC7 C;  2M9H A;  1IRZ A;  3W6J B;  3FHN A;  3K1P A;  1QVU A;  1YS7 A;  3KP6 A;  2K9N A;  4Y13 A;  1WFX A;  2I5U A;  5J1R A;  2YR2 A;  1Z3Y A;  3CMY A;  3S3M A;  2ELH A;  5KAI C;  5LBQ A;  1HLV A;  5F64 A;  2AQE A;  4KIC A;  3CCV I;  1F4K A;  3K69 A;  4U7B A;  5K5R A;  4XR6 A;  1UHS A;  2E1M B;  4IZZ A;  1SAU A;  2PFB A;  3BR3 A;  2FU4 A;  1GHC A;  2O3F A;  1VQM I;  2EZK A;  1SD5 A;  3M8E A;  1PYV A;  1ZG3 A;  5FRM A;  3V8J A;  1I5Z A;  3CUQ B;  2DU9 A;  2EA4 A;  2RAE A;  3HOS A;  1WRJ A;  2X85 A;  3H9Q A;  1T6S A;  2VXZ A;  5KAF C;  1AHD P;  1NG6 A;  2DT7 B;  1O7F A;  2M1B A;  3OS2 A;  1ETY A;  3ZQ7 A;  3EQL F;  3RPQ A;  3KEY A;  1YOV B;  4GO1 A;  2O9L A;  3P7N A;  3DF8 A;  2J5O A;  1GXP A;  3H0D A;  2AO9 A;  2DAO A;  1PVE A;  5D4R A;  3DTK A;  2A61 A;  2KIQ A;  3L09 A;  4AVP A;  4BEH B;  3ZRG A;  3OYE A;  3KYC B;  4EJV A;  1JGG A;  4HF0 A;  3WTT C;  4A0Y A;  1I1G A;  2F5E A;  4XOR A;  2B9S A;  1EF4 A;  3FXK A;  1UZC A;  3KZY A;  4FHT A;  3LFK A;  3RDI A;  3RYR A;  1VQ9 I;  2F4O B;  2LOO A;  2L9R A;  4KJZ A;  3MD2 A;  3I59 A;  2LLK A;  1YRN B;  4LOC A;  2BVL A;  1YYV A;  1EA3 A;  2DQL A;  3FBI B;  4P5O A;  3ZPL A;  3CZ6 A;  5D5X B;  1SVL A;  2D1H A;  3MFK A;  3DQV C;  4C9Y A;  1A04 A;  1FOW A;  2PEX A;  3CCM I;  2DOF A;  1BM9 A;  1OQY A;  2W85 A;  1UAA A;  4ABZ A;  1K4S A;  1J09 A;  4A5M A;  4BQO A;  3E5X A;  4LG3 A;  2WWY A;  4EJT A;  4KYW A;  2R7U A;  4JP0 A;  2KFD A;  4XIC A;  4YIR X;  1H0M A;  3NWS A;  4MIM A;  1E3O C;  1I1S A;  4Y3O A;  4B48 A;  3S1N J;  2KZV A;  1IUF A;  3NAU A;  4I09 A;  2GBY A;  3BG6 A;  2Z2S B;  3H3Z A;  2COB A;  2E19 A;  2G0E A;  2XSJ C;  3E7L A;  2WTE A;  3S8P A;  2H6B A;  2L9N A;  3I55 I;  2A5Y B;  2DW4 A;  5TIS C;  1G3Y A;  3ASN H;  2HDD A;  4KUM A;  5FLM J;  5FLV A;  4IHW A;  1WKM A;  2X6O A;  2KMU A;  2IPQ X;  3QU3 A;  4WF2 A;  2LP0 A;  3RZD J;  5AON A;  1ONV A;  4PZJ A;  2CQK A;  4Y7N J;  1HW2 A;  3E6B A;  3NAR A;  2DFF A;  5EGO B;  2RDP A;  2W1O A;  4J19 A;  3FZV A;  3TW7 A;  1W0U A;  2R93 J;  2CV1 A;  5DEQ A;  1Z67 A;  4A2U A;  1I6X A;  2VJI A;  3CCE I;  4ANJ A;  3ECH A;  4B44 A;  5BPI A;  2R7W A;  1V54 H;  2R7X A;  4AUX A;  1R5G A;  2P6S A;  1ON2 A;  3BQZ A;  1JE8 A;  1J75 A;  3O6B B;  4BAY A;  4WXC A;  2CW8 A;  2Z99 A;  2XGX A;  1IV8 A;  3H3U A;  4HEA 2;  4KA4 A;  2ZJ2 A;  1ZAR A;  4CYD A;  5TRD A;  2DOD A;  2OUM A;  4V2F A;  3HOX J;  1S7A A;  4XSZ F;  1SFO J;  3CO7 C;  4BBS J;  3QP6 A;  3BR2 A;  2PG4 A;  3OYF A;  2K9M A;  5GAG J;  2DA2 A;  1OCZ H;  2HDW A;  3G1O A;  3MEX A;  5JHF A;  1Z05 A;  5CKT A;  3C2B A;  2QM3 A;  1REP C;  1SFX A;  4GYI A;  4F52 A;  2ZXJ A;  3I71 A;  5ICE A;  2OBP A;  5LHH A;  2F2E A;  3OYH A;  2MH2 A;  3PSI A;  1MGT A;  4QPQ A;  2ZME C;  2GWR A;  1TNS A;  4X0G A;  3JR9 A;  1G59 A;  4B8X A;  1AKH B;  1GV5 A;  2TCT A;  2MYS A;  2DXI A;  2X1E A;  1FWZ A;  1G4D A;  5D8L B;  2MW8 A;  3HRT A;  1KGS A;  5HNH A;  4CCL A;  2DFI A;  3KE2 A;  3WTV C;  1BBY A;  1YX5 A;  5DTD A;  2BOL A;  2XAU A;  2D5V A;  4XKW A;  1HST A;  1IXR C;  1D1A A;  5FFX A;  3SHF A;  3DBH B;  3G6E I;  3A02 A;  5LRS A;  1VQ4 I;  1A6Q A;  1X3U A;  4RLQ A;  2QSH X;  2ETH A;  5KCM A;  2CJJ A;  2E1N A;  3ZMV A;  1WQ2 A;  2MSY A;  1TQI A;  3G4S I;  1SEU A;  3LFU A;  3LSP A;  3IRQ A;  2QSF X;  3VEP A;  4OOI A;  5K7Z A;  2W25 A;  2HWV A;  5FKO A;  5IPA A;  2JT1 A;  4P1W A;  4ZYG A;  3LSJ A;  3WU1 B;  2E5Z A;  2NNN A;  4PJN A;  4E7Z A;  3DP7 A;  2DYR H;  2Y9Y A;  3IKT A;  2VON A;  2X0L A;  1RUO A;  2JTV A;  2K02 A;  3MKY B;  1X58 A;  4CXF A;  3VYR B;  3L2C A;  2G7U A;  2JA5 J;  4DQ2 A;  3H35 A;  2VLA A;  3DU5 A;  2G9W A;  1PUF A;  2KHM A;  3LAJ A;  1OFC X;  2R92 J;  3R6S A;  1S9H A;  2RVC A;  5B3S H;  2VL8 A;  3CJQ B;  2CUE A;  5CQG A;  2FML A;  2M8E A;  5K7H A;  4I0B A;  4AWX B;  2OQR A;  3JRG A;  2P0W A;  5HOO A;  1MJA A;  5DCM A;  4FE7 A;  4LK1 F;  5IP9 J;  2BZT A;  3ZGK A;  1VQL I;  4JBA A;  5LEJ A;  4JX4 A;  3WTX C;  2EV5 A;  5H20 A;  2HQ5 A;  4HOB A;  2L3D A;  4ZZL A;  3OOP A;  2IS2 A;  5A2Q Z;  4XON A;  3GWZ A;  1Y1V J;  5FRN A;  2CWE A;  4LIV A;  2ADU A;  4IOA F;  3K1N A;  2DN0 A;  1IF1 A;  3TKY A;  1ULY A;  4A3M J;  2IRF G;  3EUA A;  3ZQH A;  2E36 A;  2PQ8 A;  4CCO A;  2Y31 A;  3CES A;  1R49 A;  3U2R A;  3BWG A;  1IDZ A;  1N77 A;  2WA0 A;  5F0C A;  1ZLK A;  3HRS A;  2DJI A;  4M3B A;  2R7F A;  3WGI A;  3W3C A;  1HSJ A;  2Q1Z B;  2MGQ A;  2JPC A;  4X6A J;  4YFX F;  4DYQ A;  2L2O A;  1NG7 A;  1YIT I;  3HHG A;  3GLL A;  5BQT A;  2XAH A;  1FOX A;  3ELK A;  3L9F A;  1SFK A;  4EAT A;  2DK5 A;  3VPR A;  5FD6 A;  3L2U A;  4L9N A;  5CPR B;  5FKL A;  3CMA I;  3VOD A;  4RM3 A;  5E3L A;  1VQ6 I;  2XUB A;  1O4X A;  4KFC A;  2JN6 A;  3QPS A;  5F1J A;  3CCR I;  4UVC A;  1NTC A;  2BHY A;  1UHW A;  3KEO A;  4PDK A;  3UNG C;  1K61 A;  2JA6 J;  3DEW A;  3KP7 A;  2P5L C;  3GFL A;  2E2I J;  4HDV A;  4WWC A;  4BQA A;  3RI4 A;  1LNW A;  4EJU A;  2VIX A;  3BZ6 A;  2WC2 A;  5D8K B;  2R0Q C;  3L7W A;  4XN3 A;  2HXO A;  3MZ8 A;  2RN7 A;  3HIF A;  3BCA A;  1O3R A;  4M6Y A;  4A5N A;  2JK3 A;  1T0F A;  3MKW B;  2M3A A;  1JT0 A;  4DYC A;  1CF7 B;  3LSM A;  2OC6 A;  3DTE A;  3QPT A;  1E3P A;  4D9J A;  4B3A A;  2IA2 A;  3SEZ A;  3J80 Z;  3S2W A;  1KQ9 A;  1X3W B;  2QEX I;  3ABU A;  3QYF A;  1IV6 A;  1V5E A;  3MWM A;  3EUH A;  3H5A A;  4ZTF A;  2RQP A;  1ZR4 A;  5HNF A;  1RZ4 A;  2JA8 J;  1SVM A;  3CDI A;  2X6W A;  4NB5 A;  3S15 J;  4N0B A;  2E1C A;  3QOP A;  3CTA A;  2GXB A;  2O0Y A;  2XDV A;  3FKI J; 
#chains in the Genus database with same CATH homology
 2CGP A;  2HOE A;  4Q47 A;  5E18 F;  2Q2E A;  3FXR A;  3SFZ A;  1QBJ A;  2YX7 A;  1U6G A;  1PP7 U;  1B9N A;  3BRO A;  3FX3 A;  4MGR A;  3JTH A;  1KU7 A;  3FWE A;  5DCF A;  1U5T B;  1IN6 A;  1UHM A;  1XCV A;  1ZYR F;  5E17 F;  2M87 A;  4MTE A;  3T5X A;  4BNC A;  1KU9 A;  2OAZ A;  3QU6 A;  4L9J A;  4U0Y A;  2DTR A;  4RS8 A;  1TBX A;  4A0Z A;  3DKW A;  5F1R A;  5L3C A;  2EJR A;  3E5U A;  2EFO A;  3DPL C;  1YW9 A;  4LB5 A;  3C7J A;  4IHS A;  3CO6 C;  3FF5 A;  1GVJ A;  4U88 A;  4HDU A;  1XSV A;  5D5W B;  1O3T A;  2ZNY A;  4OIP F;  3ECO A;  1P4X A;  4Y15 A;  3ZMD A;  3TOA A;  2O6G E;  1T2K A;  4B09 A;  2Y75 A;  1F5T A;  4L18 B;  5HS8 A;  4M73 A;  1KA8 A;  4CZZ A;  1T98 A;  4HLY A;  2IP2 A;  4LLG F;  3I64 A;  4BXU A;  2GZW A;  4M6X A;  3RKW A;  2O03 A;  4FX0 A;  2FQ3 A;  3GF2 A;  4EMS A;  3WG9 A;  5JVT A;  3C18 A;  3P9I A;  3DFG A;  4RB2 C;  5CVU A;  3P9C A;  3BOQ A;  1XB4 A;  4AIJ A;  3I4P A;  1TQM A;  1R1T A;  5J8F A;  1XGO A;  2UXN A;  1FNN A;  4HF2 A;  4M71 A;  3ML6 A;  3CDH A;  3HSE A;  5FB2 A;  1P4W A;  2ESN A;  1O57 A;  2M5W A;  3KP3 A;  5E1Z B;  3L00 A;  4GGG A;  3MQ0 A;  3WGH A;  1G6N A;  5TJJ A;  4G8X A;  5FLX Z;  2KJC A;  3F6O A;  3REO A;  5JI6 A;  2LKP A;  4BHP A;  2MH9 A;  1BN5 A;  3HOT A;  2RV8 A;  5HVQ C;  1SFU A;  4Y17 A;  1AOY A;  2P7C B;  2VE8 A;  1W5T A;  3EET A;  1J9I A;  3KEQ A;  3BJA A;  1XSD A;  1OYY A;  2P4W A;  4RAY A;  5CVJ A;  2H6C A;  1U2W A;  4DNC A;  2XV4 S;  4EV0 A;  1WI9 A;  4G6D A;  4ENM A;  4LD5 A;  1SMT A;  4A6D A;  4P55 A;  2E7W A;  2STW A;  5LRR A;  1TTY A;  1SFE A;  1STZ A;  2HTS A;  3WE3 A;  3RPU A;  4P9U A;  4LLL A;  2ZBK A;  1FP1 D;  2ACJ A;  2O61 A;  2FMY A;  3KET A;  5BOX A;  1FT9 A;  4UNO A;  3E6D A;  5E1X A;  2MD5 A;  4S05 A;  1YFH A;  1TLH B;  1P92 A;  3HHH A;  1ZG5 A;  4MEY F;  3I54 A;  3SXY A;  3VB2 A;  3F23 A;  5ILV A;  2IT0 A;  3TDZ C;  4LMY A;  3EYI A;  1PP8 F;  2HYF A;  3VOE A;  3R61 A;  5ILU A;  4OIQ F;  5CLS A;  4WXH A;  3RYP A;  1UB9 A;  4EJO A;  1KYZ A;  3IL2 A;  2ZME A;  3IC7 A;  3SZT A;  3KP4 A;  5ICG A;  2IW5 A;  3RJP A;  2C6Y A;  3SQN A;  3GZ5 A;  2ZCW A;  1Q1H A;  1HQC A;  3WTZ A;  4AIH A;  3LA3 A;  4IRI A;  2HKX A;  1EH6 A;  3IHU A;  4LJZ F;  3K0L A;  1L0O C;  5IT3 A;  2HDC A;  1OYW A;  1WSU A;  4YFN F;  1W4M A;  1W7P D;  2EK5 A;  2OA4 A;  2W24 A;  2VOD A;  2COM A;  4G7Z F;  2LF7 A;  4WK8 F;  1OMI A;  2VC0 A;  2XAS A;  1HXD A;  2CW0 F;  2QLZ A;  2K27 A;  4HX8 A;  1BC8 C;  1S3J A;  1IRF A;  2PJP A;  1ZRD A;  1Z6T A;  4G7O F;  5F6F A;  2CYY A;  1CF7 A;  2UXX A;  4ZYH A;  5HDG A;  4UV9 A;  1GXQ A;  1CGP A;  4IVN A;  2BEO A;  4EM2 A;  5HDK A;  3BDD A;  5HLI A;  5ERI A;  3ZMU A;  4I02 A;  2XRO A;  3ZMT A;  2YU3 A;  3BPV A;  2CSO A;  1J59 A;  1V4R A;  2P5V A;  4ZYD A;  3JSP A;  2KIU A;  3F21 A;  4Q5S F;  2FNP A;  1DPU A;  1DUX C;  3ZP5 A;  1YLF A;  3V7R A;  1MD0 A;  4I01 A;  4JQF A;  5EEG A;  1YW8 A;  2KIF A;  1U5T A;  4RGX A;  1R5H A;  2EFP A;  3ZN1 A;  1SD7 A;  1PUE E;  1XD7 A;  2LDU A;  3R0J A;  2V1X A;  4R1H A;  1I27 A;  2IVM A;  3WTS C;  2J5P A;  4RB0 A;  1O3Q A;  1L3L A;  1FLI A;  1BIA A;  3FHZ A;  1WWX A;  4CIC A;  3J7A O;  4OMY A;  2LSO A;  1HBX G;  3I5U A;  4RB3 C;  2PI0 A;  5JFR A;  2NNY A;  3ZMZ A;  4UVA A;  1XGS A;  3IRR A;  4ENK A;  1TW2 A;  5LGT A;  2GXG A;  2UZK A;  2ZNZ A;  1SMY F;  1OYI A;  3BPX A;  2LF8 A;  4HYE A;  4M74 A;  2QUF A;  1AWC A;  2Q8K A;  3GW2 A;  1B9M A;  4LG0 A;  1HKQ A;  4QLC U;  2VBW A;  6PAX A;  2Y48 A;  1LVA A;  4WCG A;  4ON0 A;  1OKR A;  3WTY C;  5D6E A;  2XVC A;  4KNY A;  1MZB A;  2EFQ A;  3BY6 A;  4YIF A;  4WX9 A;  1P6R A;  5HS9 A;  2RC4 A;  4NHJ A;  2RGV A;  2PMH A;  4IF4 A;  1JHF A;  4ESF A;  2XIG A;  2GQQ A;  2ZME B;  3T0Y A;  2FF4 A;  4I2O A;  3CUO A;  1SD4 A;  3J81 K;  1ON1 A;  1U8R A;  1IN7 A;  1XDS A;  4ETS A;  1R1U A;  3GLX A;  4HF1 A;  2VE9 A;  5BMZ A;  1IXC A;  4ZYE A;  2A6H F;  5DYM A;  4P9F A;  4IXA A;  2BBY A;  4UXN A;  3Q9V A;  3QAH A;  4LGW A;  2VC1 A;  4L5I A;  4G94 A;  1ZLJ A;  1J5Y A;  1OR7 A;  3SZP A;  2XRN A;  1UFM A;  3LAP A;  3T8T A;  3QRF F;  1BI3 A;  2K7L A;  4HX4 A;  1E2X A;  1LJ9 A;  3NQO A;  2XKO A;  3GXO A;  3TQN A;  3RKY A;  4HZF A;  2FBK A;  1H9T A;  4L5J A;  3MZY A;  2XAF A;  4YG2 F;  3R0A A;  4UV8 A;  3WOD F;  1KU2 A;  3TO7 A;  1FYK A;  3RKX A;  5K5Q A;  4ESB A;  4ZZD A;  2MLG A;  1IUY A;  2VBX A;  3RTR A;  1FBQ A;  1BI0 A;  3Q9S A;  4L0Z B;  2K86 A;  4KN7 X;  5FGM A;  5CVI A;  3ROU A;  1LQ1 A;  5E8I A;  3GFM A;  2D45 A;  1JHH A;  2M30 A;  1FBS A;  1Z91 A;  3R4K A;  5FFZ A;  2O8X A;  1IAW A;  1MJ9 A;  3HTS B;  3PQK A;  2JRT A;  4HAM A;  2QYO A;  2X4H A;  4PGG A;  2BE5 F;  4RGS A;  3GUD A;  3ISP A;  3V8K A;  5ICF A;  3HSR A;  4EJW A;  5E20 A;  1T39 A;  3LQR A;  1VTN C;  4BYY A;  1DP7 P;  2GA2 A;  3F22 A;  3FMS A;  4MNU A;  2KJB A;  5H6R A;  2B0L A;  5D6F A;  5BS6 A;  5CJ9 A;  1D8K A;  1LDD A;  2YPR A;  3E97 A;  1TW3 A;  1LB2 A;  5K1Y A;  4GYG A;  4LG0 B;  5L3G A;  2KRF A;  3GEZ A;  3GFJ A;  4ENN A;  1K78 A;  4LLN A;  4KMF A;  3GYH X;  1BIB A;  3KCC A;  3NRV A;  2KIM A;  1B1B A;  2QWW A;  1NHA A;  2NAZ A;  2W57 A;  4HQE A;  3KFW X;  2GA1 A;  5HLG A;  3M7G A;  4KMU X;  4CO8 A;  3ERE D;  2P6T A;  1B59 A;  3BJO A;  1G3S A;  4M72 A;  2IA1 A;  3I0T A;  5LGN A;  1EV7 A;  2JSC A;  2H09 A;  3F72 A;  1P4A A;  3ABT A;  2QBY A;  3JAM K;  2R7D A;  5AIP A;  4HV5 A;  1BJA A;  1HKT A;  2A69 F;  1Y0U A;  2HKO A;  3CLO A;  1XGM A;  1BOA A;  1EH8 A;  4KIB A;  1R23 A;  5ILS A;  1HKS A;  2F5D A;  2HYG D;  4EQQ A;  4UVB A;  3KLO A;  4TV7 A;  4Z2Y A;  2HQR A;  1BI1 A;  2QEN A;  4XSX F;  5D5V B;  1W7P B;  5JHU A;  5L3B A;  1QPM A;  4N9H A;  4PCQ A;  1OPC A;  1HW5 A;  3G3Z A;  5DD4 A;  2DPD A;  3HSF A;  5DDG A;  1UCR A;  4K2E A;  3F8B A;  2XHK A;  1FC3 A;  3T1B A;  4P96 A;  1MKM A;  1S7O A;  3CUQ C;  1ZG1 A;  4QWQ A;  4N9I A;  3RIR A;  2VBY A;  1ODD A;  4RB1 A;  1Z7U A;  2HR3 A;  4OIR F;  3JW4 A;  1BI2 A;  1IRG A;  4MQV A;  3W6K B;  2DI3 A;  1SD6 A;  2L4A A;  1JXS A;  3QPH A;  4A0X A;  1QGP A;  2Z3Y A;  2QVO A;  3MAJ A;  5LHG A;  3F6V A;  2Z33 A;  1YQA A;  4IRH A;  5CVV A;  1YG2 A;  3MZH A;  1IXS B;  5K5O A;  3V7S A;  4CGZ A;  1QNT A;  2HQN A;  2AXL A;  2V9V A;  3F3X A;  4MEX F;  3GFI A;  4KDP A;  4S04 A;  3K2Z A;  5EEH A;  2L02 A;  1XGN A;  4OU0 A;  3C1D A;  4I7H A;  2HS5 A;  5IT9 K;  4O3M A;  3E6M A;  4XRF A;  2FBH A;  2NRA C;  1F1Z A;  2OQG A;  4OIN F;  1IN4 A;  4KN4 X;  4A6E A;  2VBZ A;  4EM1 A;  2V6C A;  4AD9 A;  1XN7 A;  3K1M A;  3OV8 A;  5D4S A;  3KZZ A;  1ZN2 A;  5D5U B;  2EA2 A;  4R8H A;  3KP2 A;  2P7V B;  1RNL A;  2L01 A;  3QP5 A;  3ULQ B;  2HZT A;  2DQR A;  5J8C A;  2GAU A;  5FD5 A;  3K9T A;  2QZ8 A;  4GXO A;  3TDU C;  2DO7 A;  5DD8 A;  3N97 A;  5DUK A;  1DPR A;  4G6Q A;  2QQA A;  2VT2 A;  3JTG A;  2W84 A;  1FYM A;  4CHU A;  4OIO F;  4M9Z A;  3I53 A;  1D3Y A;  1KU3 A;  5HLH A;  3NEU A;  4HQM A;  1K78 B;  4IJA A;  2DBB A;  4YII A;  2H27 A;  3F8C A;  2VOP A;  3V4G A;  5LHI A;  4L9V A;  1R36 A;  5KK1 A;  2DPU A;  3M1E A;  3VFZ A;  2FRH A;  2EB7 A;  5LLQ A;  1V3F A;  4CDG A;  3HRU A;  1IW7 F;  3ZMS A;  4XLP F;  2QBY B;  1YIO A;  2EV6 A;  4FX4 A;  4ENJ A;  1FPQ A;  4G9Y A;  5L3D A;  1FBU A;  2FNA A;  4LFU A;  2ZO4 A;  2JZY A;  3O3K A;  2M45 A;  2CG4 A;  2XKP A;  2CO5 A;  2A3S A;  1YS6 A;  2L54 A;  1XMK A;  2CFX A;  3BP8 A;  4HBL A;  3V8L A;  1G3T A;  2Z9O A;  1R22 A;  1YO5 C;  1RUN A;  4LB6 B;  5E8G A;  1W5S A;  3IKV A;  1HW1 A;  2K4B A;  4UUV A;  4HA8 A;  2HGC A;  3WTU C;  1G3W A;  1U78 A;  1MJB A;  2NS0 A;  2FBI A;  1R7J A;  1S6L A;  1ZRF A;  5L3F A;  3FM5 A;  5HS7 A;  1E17 A;  1MDM B;  3GX4 X;  1ZGJ A;  1S29 A;  2HFH A;  2PLY A;  2P5K A;  3IWZ A;  4Q4Z F;  4EGY A;  2YX4 A;  3WE2 A;  5CVR A;  2ISZ A;  2H94 A;  4U7D A;  3J81 Z;  3PFI A;  1LDJ A;  1ZH5 A;  4YFK F;  4Q48 A;  2V1U A;  4O6J A;  2A68 F;  3R60 A;  3CJN A;  2EWN A;  2PBI A;  4I0A A;  1KQ0 A;  2VT3 A;  3MCZ A;  1J7K A;  5DV5 A;  3TO6 A;  3Q5F A;  5LEK A;  4NQW A;  3I58 A;  3LST A;  2E7X A;  3D0S A;  4GCV A;  2FXA A;  3ZN0 A;  1K6O A;  4RAZ A;  2G7H A;  1K7A A;  4F7Z A;  2BV6 A;  2DLL A;  2LNB A;  4ASN A;  5CYV A;  3TGN A;  1LEA A;  3V7C A;  2XAJ A;  2Q0O A;  3DEU A;  4EM0 B;  1J0R A;  5JR3 A;  1Z9C A;  2D1V A;  3D5L A;  1LEB A;  2FA5 A;  2MC3 A;  1XSX A;  1LDK B;  4HV6 A;  3KP5 A;  1Z1D A;  1W7P A;  4RGU A;  4JK1 X;  3DV8 A;  2FSW A;  2A07 F;  3JSO A;  3GZ6 A;  1B6A A;  2F5F A;  1U5T C;  1FOK A;  3EYY A;  5A2Q K;  5J6X A;  1FZP B;  4M9X A;  3HYI A;  2XAQ A;  2HTJ A;  3LA2 A;  4G7H F;  1FX7 A;  3I59 B;  1R00 A;  1FSH A;  3FXQ A;  2DT5 A;  3HUG A;  2QQB A;  1YTY A;  5FO5 A;  2ZFW A;  5H6Q A;  4UHT A;  1O7L A;  2EV0 A;  4IRG A;  1QZY A;  2FEZ A;  3LQQ A;  4D0P A;  3EDP A;  4E70 A;  1FSE A;  1K79 A;  3PQJ A;  1IZ1 A;  1IN5 A;  2EFN A;  2PMU A;  4EVI A;  3GVA A;  3F8M A;  3IWF A;  4ZH4 F;  4MTD A;  3E3V A;  2BYV E;  2Z5U A;  2P8T A;  2KKO A;  4L9T A;  1C0W A;  3KLN A;  2JPB A;  2DK8 A;  2V1D A;  5L3E A;  4L0Y B;  1ZAO A;  1IN8 A;  3J80 K;  3B73 A;  4MHG A;  1D5V A;  4LK0 F;  4A12 A;  3LA7 A;  1PDN C;  4HLX A;  1ZRE A;  3CUQ A;  2AS5 F;  2FOK A;  2IA0 A;  2RNJ A;  4OMZ A;  3C3W A;  2TDX A;  2Y0M A;  3LWF A;  4FT8 A;  2F5C A;  1FP2 A;  2R3S A;  4XBF A;  5DUI A;  3FM3 A;  2QQ9 A;  2UWM A;  3COA C;  2HEO A;  3G73 A;  2YSR A;  3O2P E;  2ZKZ A;  4PGH A;  2GIV A;  1U3E M;  3DPT A;  3B02 A;  1ZRC A;  3WU0 A;  4H0E A;  2OZ6 A;  1KQ8 A;  3JAM Z;  2NYX A;  3FMQ A;  1XDU A;  4BHC A;  4I98 B;  4BH9 A;  3M8F A;  2PN6 A;  2WV0 A;  3F8F A;  2OD5 A;  2D2W A;  4HW0 A;  4WXD A;  3FXU A;  3HTU A;  2MBF A;  5AIQ A;  2FE3 A;  2MA3 A;  1ZHF A;  2STT A;  2K4J A;  4M9S A;  5DCM B;  4IPA A;  1TQP A;  3M9A A;  1T38 A;  2OZU A;  1TNT A;  4O5V A;  5BPD A;  5HDN A;  2V79 A;  2ISY A;  2VN2 A;  3E6C C;  4IHT A;  3E5Q A;  5LGU A;  3TOB A;  1JGS A;  1XMA A;  4HX7 A;  1R1V A;  2OU2 A;  4R79 A;  4EGZ A;  2L4M A;  3F8N A;  3N4M A;  1FYL A;  1YW7 A;  1Z6R A;  1J2X A;  2BGC A;  4KIF A;  2VOO A;  1DDN A;  1RIO H;  1O3S A;  1H9G A;  3P9K A;  4RGR A;  2EFW A;  4AIK A;  1MDM A;  3GO5 A;  2MLK A;  1F9N A;  1ZGA A;  1QO0 D;  2ESH A;  4XLN F;  1P2F A;  3WGG A;  4BHB A;  5FLX K;  2RKH A;  3AAF A;  5IT9 Z;  4KT5 C;  3HRM A;  2XAG A;  1SAX A;  1USS A;  5ED4 A;  1QQI A;  2IJL A;  1UST A;  1EH7 A;  5E1W A;  4KIG A;  5ICC A;  1D8J A;  3U9G A;  3U1D A;  1FY7 A;  3T8R A;  3DXJ F;  2A6E F;  3FMR A;  5KVR A;  1S8N A;  1B4A A;  1R58 A;  1XCB A;  3H92 A;  1KYW A;  3TO9 A;  1QZZ A;  4U0V A;  4MQ9 F;  3BJ6 A;  3WTW C;  1RI7 A;  4ESJ A;  4U0W A;  1BC7 C;  3W6J B;  3K1P A;  3KP6 A;  1YS7 A;  4Y13 A;  2YR2 A;  2ELH A;  5LBQ A;  5F64 A;  4KIC A;  1F4K A;  3K69 A;  4U7B A;  5K5R A;  2PFB A;  2FU4 A;  1GHC A;  2O3F A;  1SD5 A;  3M8E A;  1ZG3 A;  3V8J A;  1I5Z A;  3CUQ B;  2DU9 A;  2EA4 A;  3HOS A;  1WRJ A;  1T6S A;  2VXZ A;  1O7F A;  2M1B A;  3ZQ7 A;  3EQL F;  3RPQ A;  4GO1 A;  3P7N A;  3DF8 A;  2J5O A;  1GXP A;  2DAO A;  5D4R A;  2A61 A;  3L09 A;  4AVP A;  4EJV A;  4HF0 A;  3WTT C;  4A0Y A;  1I1G A;  2F5E A;  3KZY A;  4FHT A;  3RDI A;  3LFK A;  3RYR A;  3I59 A;  2DQL A;  1YYV A;  4P5O A;  3ZPL A;  5D5X B;  3MFK A;  2D1H A;  3DQV C;  1A04 A;  2PEX A;  1BM9 A;  2W85 A;  4A5M A;  3E5X A;  4EJT A;  2WWY A;  4KYW A;  1H0M A;  1I1S A;  4I09 A;  3H3Z A;  2WTE A;  2H6B A;  2DW4 A;  2A5Y B;  1G3Y A;  4KUM A;  1WKM A;  2IPQ X;  3QU3 A;  4WF2 A;  5AON A;  1ONV A;  4PZJ A;  2CQK A;  1HW2 A;  3E6B A;  2RDP A;  3FZV A;  5DEQ A;  4A2U A;  1I6X A;  3ECH A;  5BPI A;  1R5G A;  2P6S A;  1ON2 A;  1JE8 A;  1J75 A;  3O6B B;  4BAY A;  4WXC A;  2Z99 A;  2XGX A;  4KA4 A;  3H3U A;  2ZJ2 A;  1ZAR A;  4CYD A;  5TRD A;  1S7A A;  4XSZ F;  3CO7 C;  3QP6 A;  2PG4 A;  3MEX A;  1REP C;  1Z05 A;  2QM3 A;  1SFX A;  4GYI A;  2ZXJ A;  3I71 A;  5ICE A;  2OBP A;  5LHH A;  2F2E A;  2MH2 A;  1MGT A;  2GWR A;  1TNS A;  4B8X A;  1FWZ A;  1G4D A;  5D8L B;  3HRT A;  1KGS A;  2DFI A;  3KE2 A;  3WTV C;  1BBY A;  1HST A;  1IXR C;  5FFX A;  3SHF A;  5LRS A;  1X3U A;  2ETH A;  2E1N A;  3ZMV A;  1WQ2 A;  1TQI A;  3IRQ A;  3VEP A;  4OOI A;  2W25 A;  2HWV A;  2JT1 A;  3WU1 B;  4ZYG A;  2NNN A;  3DP7 A;  3IKT A;  2VON A;  2X0L A;  1RUO A;  2JTV A;  2K02 A;  4CXF A;  3L2C A;  2G7U A;  4DQ2 A;  2G9W A;  3LAJ A;  3R6S A;  2RVC A;  2FML A;  2M8E A;  4I0B A;  4AWX B;  2OQR A;  5HOO A;  1MJA A;  5DCM A;  4LK1 F;  4JBA A;  5LEJ A;  3WTX C;  2EV5 A;  5H20 A;  4HOB A;  2L3D A;  4ZZL A;  3OOP A;  5A2Q Z;  3GWZ A;  2CWE A;  2ADU A;  3K1N A;  1IF1 A;  3TKY A;  1ULY A;  2IRF G;  2PQ8 A;  3U2R A;  3BWG A;  1ZLK A;  3HRS A;  2R7F A;  3WGI A;  1HSJ A;  2JPC A;  4YFX F;  3HHG A;  5BQT A;  2XAH A;  3ELK A;  3L9F A;  2DK5 A;  5FD6 A;  4L9N A;  3VOD A;  2XUB A;  4KFC A;  4UVC A;  1UHW A;  3KEO A;  4PDK A;  3KP7 A;  2P5L C;  3GFL A;  4HDV A;  4WWC A;  4BQA A;  3RI4 A;  1LNW A;  4EJU A;  3BZ6 A;  5D8K B;  2WC2 A;  3L7W A;  2RN7 A;  3HIF A;  1O3R A;  4M6Y A;  4A5N A;  1T0F A;  1CF7 B;  3QPT A;  2IA2 A;  3J80 Z;  3S2W A;  1KQ9 A;  3ABU A;  3MWM A;  3EUH A;  2RQP A;  1RZ4 A;  4NB5 A;  4N0B A;  2E1C A;  3QOP A;  3CTA A;  2GXB A;  2O0Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...