1XSXA

Nmr structure of sso10a, a hyperthermophile dna-binding protein with an extended anti-parallel coiled coil
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
95
structure length
95
Chain Sequence
AKKKSKLEIIQAILEACKSGSPKTRIMYGANLSYALTGRYIKMLMDLEIIRQEGKQYMLTKKGEELLEDIRKFNEMRKNMDQLKEKINSVLSIRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sso10a
publication title Solution Structure, Stability, and Flexibility of Sso10a: A Hyperthermophile Coiled-Coil DNA-Binding Protein(,).
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Dna binding protein
total genus 29
structure length 95
sequence length 95
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14947 HTH_45 Winged helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1xsxA00
1PP7U 3WG9A 1Z9CA 1U3EM 2Z3YA 3GFIA 2VODA 3GF2A 4ETSA 4D0PA 3EYIA 2EA2A 1O3QA 1KU9A 2JRTA 4UVBA 3WU0A 2CYYA 1SFUA 4UUVA 4YG2F 3W6JB 2XVCA 3IHUA 4QLCU 1R5GA 2KIUA 5FD5A 1R7JA 3WTWC 2X4HA 4U0VA 4MQ9F 3BDDA 2V6CA 4M74A 1U2WA 2HYFA 4Y13A 3DV8A 2CQKA 2DTRA 3DPLC 3KEOA 3T8RA 4OIPF 3DEUA 4EM0B 2K27A 1EV7A 2MH9A 2LSOA 5KVRA 1ON2A 3WTZA 1V3FA 2QBYB 4KFCA 3DXJF 3J80K 1RNLA 4HW0A 3GFLA 1QGPA 4BAYA 5L3CA 2EV6A 2ZCWA 2VXZA 5LHHA 1GVJA 3CO6C 2P8TA 1ZG3A 4EV0A 4WX9A 3FXRA 2ISZA 1HW5A 3PQKA 3ZMVA 1I6XA 3KLOA 4A5NA 1YO5C 4LK1F 3COAC 2R7FA 1Z91A 2OU2A 1W7PA 4OIQF 2RGVA 1JE8A 1G6NA 1EH7A 4IPAA 4CO8A 3I4PA 5FLXK 2JZYA 5LEJA 3J81Z 1WWXA 1U5TB 4FHTA 1JHHA 1XGSA 2A68F 2IRFG 2V1XA 3QAHA 2YU3A 1SD5A 3NQOA 1J9IA 2FQ3A 1QQIA 1CF7B 4KIGA 2O0YA 4ENKA 1H9TA 3WTVC 2UXNA 1F9NA 2PQ8A 1FP1D 4Y17A 4IXAA 4NQWA 2NAZA 3ZPLA 3BPVA 4JK1X 5DUKA 5JFRA 2GA2A 1MKMA 3KP7A 1ONVA 2LNBA 1W4MA 3TKYA 5CYVA 4AIJA 3LFKA 2XV4S 2CW0F 3QRFF 3KFWX 5ED4A 4P55A 4I0BA 3KP4A 2HKOA 2MD5A 4RAYA 1RUOA 4EJWA 2QVOA 3BP8A 3KETA 1R23A 2EV5A 4ESFA 1QBJA 4RS8A 4PDKA 4UXNA 2LDUA 4L18B 3U2RA 3FHZA 4KIBA 3RKXA 3ULQB 1MJ9A 4BQAA 2NS0A 3RJPA 3JTHA 3MWMA 2IA2A 3M1EA 1LDJA 1SFEA 1W7PB 3E6MA 4CICA 3V8LA 1SMYF 2MA3A 4MGRA 3TDUC 1HW2A 2FE3A 2Q2EA 4O6JA 5D6FA 1K78A 1WRJA 2DPDA 3U1DA 3K1PA 4HQMA 2HZTA 5L3BA 2Y0MA 4UHTA 4LJZF 4BYYA 2HWVA 4L9JA 3HSRA 4MEXF 1W7PD 5ILVA 5FB2A 4GYGA 1SD7A 2QQ9A 4Q47A 2Z9OA 3KP6A 3MAJA 2RQPA 2ZJ2A 2DPUA 1TNTA 2FMYA 5L3EA 3HOSA 1CGPA 4ENJA 4S05A 3Q9SA 3L2CA 1ZG1A 1YIOA 4MNUA 4YFKF 3H92A 2HQNA 3B02A 4WF2A 2XAFA 4TV7A 2NYXA 3JAMK 1T98A 2XAGA 4G94A 4HLXA 4WXDA 4AD9A 1C0WA 5HOOA 1B9NA 4I0AA 2JT1A 3CUQA 4XBFA 2P4WA 3J80Z 3PQJA 4WXHA 2MC3A 2YR2A 3M9AA 1LDDA 4XLNF 4KIFA 1ZHFA 5FO5A 4EVIA 5LHGA 4NB5A 3ZMTA 1DPRA 5TRDA 2XKOA 4AWXB 1R1UA 5LGNA 4WK8F 4G7ZF 4E70A 1LNWA 3E3VA 5HDKA 1GXQA 4B09A 4P9UA 1PDNC 2RVCA 2W24A 1K78B 4YIFA 3R0JA 2ISYA 5HLGA 4L9NA 4P96A 2BEOA 3T0YA 5FLXZ 1S8NA 2GXGA 2FA5A 2P6SA 2R3SA 3GFJA 4A2UA 3ABTA 3HSEA 3GXOA 1XB4A 1J5YA 1TTYA 4LMYA 1BOAA 1O3SA 1H9GA 2GQQA 1IXRC 2R7DA 2ESHA 2F5FA 2JPCA 2VC1A 2KRFA 4LLGF 4CYDA 1JGSA 5ICCA 3CUOA 1REPC 3O3KA 1O3RA 4OMZA 2AS5F 1XSDA 2FOKA 4YFNF 4ON0A 1QPMA 5CVRA 3SZTA 2F5EA 3U9GA 1NHAA 2QENA 2JSCA 1FYLA 1RIOH 4XSZF 3IC7A 4ESBA 3CUQB 5HS8A 1GHCA 3WTTC 3HSFA 1BI3A 1SD4A 1R00A 4O5VA 5AIPA 2EFQA 3BJAA 5K5OA 5TJJA 1ZRFA 2XRNA 3W6KB 2FNAA 1BC8C 3O6BB 1IUYA 2G9WA 4A0XA 2RV8A 3G73A 4G7OF 3RYPA 4ZYGA 3RTRA 1IXSB 2ESNA 4M9XA 2HS5A 3RYRA 5DCFA 3F8BA 1HKTA 1YQAA 1B4AA 2H6BA 1ZN2A 4HX4A 2EFWA 3V8JA 1KA8A 1KYZA 3P9KA 4AIHA 3WTXC 2KKOA 1K6OA 1FBUA 2MLGA 5K5RA 2FF4A 2P5KA 4ZZLA 4L5JA 2L02A 2E1CA 4HLYA 1F5TA 4KA4A 5HS7A 3GWZA 3M8EA 3GZ5A 3ABUA 2EFOA 3VODA 5A2QZ 2CFXA 4HV6A 1AWCA 2Y48A 4ENMA 3VFZA 3WTSC 2FBHA 2ZBKA 4RAZA 5ICEA 2J5PA 1Z6TA 3JAMZ 2WV0A 5L3FA 4ZYEA 3TDZC 2RC4A 1Y0UA 4GXOA 1U8RA 5DCMB 2F5DA 2HR3A 3ELKA 3WE3A 1SD6A 4BHBA 2PI0A 4ZYDA 1YW9A 4L9VA 3FF5A 5D4SA 4N9IA 1MGTA 2DLLA 2UWMA 2MH2A 3QPTA 4N9HA 2KIMA 2VBYA 1SMTA 3LQQA 2FMLA 4H0EA 2WTEA 1I27A 2QLZA 4CGZA 4HBLA 2EV0A 1ZH5A 2J5OA 4EQQA 2E1NA 1BC7C 3SHFA 3VB2A 1SAXA 1R22A 4IRIA 3F8FA 2WC2A 1B1BA 2HDCA 2A6HF 3F72A 3ZQ7A 2EFNA 3ZMSA 4OIRF 5HDNA 4Q5SF 2VE8A 1G3SA 4O3MA 3TOBA 4HDVA 3E97A 2PMHA 1XDSA 1Z6RA 1KGSA 4KICA 3MQ0A 1HSTA 1H0MA 3ZN0A 2CWEA 1YS6A 5CVJA 4I01A 3WODF 2XAHA 2FU4A 4Y15A 5CLSA 1RZ4A 3HHHA 2Y75A 5ERIA 3IKVA 1I1GA 1BI1A 1V4RA 4GO1A 4DQ2A 5HVQC 1VTNC 4UNOA 5J8FA 5CVIA 3DF8A 4RB2C 2O6GE 4HF2A 3IRQA 1KQ9A 1TQPA 4M6YA 5F1RA 3NEUA 3VOEA 2A5YB 1E17A 1S7OA 3HIFA 2AXLA 2ACJA 5BPDA 3JSPA 4A0ZA 1KYWA 4M9ZA 2DK8A 3MFKA 1XGNA 4YIIA 4KDPA 4ESJA 2BGCA 2GAUA 3HUGA 1P6RA 3LA7A 3J7AO 3M8FA 3MZHA 2F2EA 2PFBA 1U5TC 2QM3A 3BPXA 2ADUA 3JTGA 2ZFWA 5J6XA 1ON1A 4UVCA 5CJ9A 3H3ZA 1FP2A 2G7HA 2FBKA 1T2KA 5BPIA 3RKYA 1IXCA 4OINF 4ZH4F 4U7DA 3FMQA 2GZWA 3E6DA 2FNPA 1T0FA 1WKMA 3QPHA 4R79A 3EUHA 4BH9A 3BOQA 4Z2YA 3ZMDA 2CO5A 4R8HA 4RB0A 1XD7A 2IA0A 4Q4ZF 4BHCA 2DW4A 4M71A 1ODDA 1OR7A 3IWFA 4IVNA 6PAXA 1XGMA 1HXDA 2K4JA 3WGIA 3RPUA 1XMKA 4ZZDA 5E1XA 1B6AA 2CGPA 1I5ZA 1IN7A 1KU7A 2Q0OA 5FD6A 1LQ1A 3Q9VA 3R6SA 3CTAA 4XLPF 4G6DA 4RB3C 3ML6A 1KQ0A 1S6LA 2CSOA 1MD0A 5CVVA 1R58A 3V7SA 1ZARA 1TLHB 2OBPA 4MQVA 3MEXA 1IF1A 2VBWA 2K02A 2L4MA 2XAQA 1L3LA 4JQFA 2NNNA 2KIFA 2D2WA 5LGTA 1XGOA 2VC0A 2ZKZA 1WSUA 1O57A 3GLXA 1ZRCA 5D5XB 1W5TA 1RI7A 2STWA 2H27A 2DO7A 2HYGD 4M9SA 4M6XA 2X0LA 4G6QA 1UCRA 2DFIA 3V7RA 4I2OA 5HS9A 5D8LB 3LQRA 2QUFA 2W57A 1IN4A 2ZNZA 1FWZA 3DKWA 3FXQA 2WWYA 4M72A 3N4MA 1YW7A 4WWCA 1YYVA 5BS6A 1WI9A 3EQLF 1BIAA 1ZGAA 1DDNA 1D8JA 3HOTA 2EJRA 3IL2A 4BHPA 1HSJA 4LLLA 3DPTA 2IW5A 3VEPA 3P7NA 4LGWA 2VE9A 4A5MA 4FX0A 5D6EA 3WGHA 3C18A 5ILUA 1LJ9A 3GX4X 4GGGA 4R1HA 2DAOA 3F22A 1UHWA 2HFHA 5KK1A 3QP5A 3HTSB 3LWFA 1KQ8A 3ISPA 4N0BA 3F8NA 2EA4A 3FM3A 5DV5A 3NRVA 5LHIA 4LB6B 4EGZA 1ZRDA 2P5LC 3C3WA 3E5XA 3RIRA 1P4XA 2EB7A 5HLIA 1TQIA 2FBIA 3HRUA 1R1TA 2D1VA 1A04A 3R4KA 1P4WA 1T6SA 2ZO4A 4L0ZB 1FYMA 2XUBA 2PG4A 3O2PE 1DPUA 1L0OC 1MZBA 3N97A 3F23A 3SXYA 1J2XA 5J8CA 4UV8A 1G3TA 3RDIA 3KLNA 3J81K 4LB5A 1BBYA 1G3WA 3R60A 4HDUA 2MLKA 2PN6A 3JSOA 4YFXF 1DUXC 2L54A 3EDPA 3SZPA 4PGGA 2HEOA 1T39A 2E7XA 1P4AA 4HF0A 4MEYF 2IA1A 4EJVA 4S04A 4EJUA 4U0WA 5LGUA 1R5HA 3S2WA 1XMAA 2QZ8A 1OYIA 1BJAA 1B9MA 2JPBA 3CUQC 1TNSA 2YX4A 2G7UA 3PFIA 1IAWA 2PMUA 3WTUC 1XSXA 3GEZA 1MDMA 2K86A 5H6QA 5D4RA 4A6DA 3WE2A 1XSVA 3L00A 4KUMA 1FYKA 1PP8F 3HRSA 1R36A 2XGXA 2IVMA 1Z7UA 4BXUA 2P7CB 2EWNA 2YX7A 4KMFA 4EM1A 4XSXF 3I58A 5IT3A 4LFUA 2XIGA 1ZG5A 4FT8A 2DBBA 2CG4A 1OYWA 3DQVC 3R0AA 1K7AA 2GWRA 2K4BA 2UXXA 4RGRA 2M8EA 2OAZA 2DK5A 2JTVA 3ECHA 3FXUA 4B8XA 5L3GA 1XN7A 2H09A 2OD5A 5DDGA 1T38A 3MZYA 4RGSA 1FX7A 2HOEA 2M5WA 1STZA 2O03A 3BJ6A 5ICFA 2ETHA 1RUNA 3KP5A 2V1DA 1JHFA 2A3SA 1I1SA 2BYVE 1MJAA 5D8KB 3DP7A 5IT9K 3FX3A 5LEKA 2OQGA 4MTEA 1UB9A 5E18F 4L9TA 5F64A 4G7HF 3K1MA 2Q8KA 3JW4A 2HGCA 1BI2A 2P7VB 3I53A 4HZFA 5D5VB 4BNCA 1CF7A 2V1UA 3QU6A 4LK0F 3TGNA 4HQEA 3LSTA 3AAFA 1MDMB 3ECOA 4I7HA 4LLNA 2V79A 3HTUA 1TW3A 5LRRA 2IT0A 3TOAA 1TW2A 3KCCA 1QO0D 1O7FA 4U0YA 2L01A 3BWGA 2DT5A 1LVAA 3L9FA 1Z1DA 3FM5A 2KJCA 3P9IA 3HHGA 2RNJA 3IWZA 2DQLA 3Q5FA 2TDXA 3GZ6A 4EMSA 2A6EF 4HAMA 3QOPA 3LA3A 2GA1A 5FGMA 2M30A 3F8CA 1FSEA 3HRMA 4HX7A 4ASNA 1IRGA 4NHJA 1S29A 4EM2A 3D0SA 1P2FA 3E6CC 4L0YB 5HLHA 2EFPA 1ZREA 4I02A 1Q1HA 4FX4A 2M87A 2D1HA 2DQRA 3MCZA 2FXAA 2H6CA 1O7LA 4HX8A 1EH6A 1LEAA 1OPCA 4PGHA 3GW2A 4IHTA 1AOYA 1HKQA 2PJPA 3K0LA 2STTA 4EGYA 1YS7A 3OV8A 4U88A 2A69F 1J7KA 2RN7A 2Z33A 3KEQA 3L7WA 3E5UA 5E1WA 1FZPB 1BM9A 1UFMA 2FSWA 3GO5A 1U6GA 2VT3A 2H94A 4WCGA 1O3TA 5AIQA 2LKPA 2IJLA 1E2XA 3D5LA 1LB2A 4IRGA 3TO9A 2V9VA 1MJBA 2Z99A 1XCVA 2O8XA 4ZYHA 4U7BA 3CLOA 1F1ZA 3GFMA 3GUDA 2D45A 1B59A 5JHUA 3HRTA 4LG0A 1FBSA 1OMIA 2M1BA 1IRFA 1R1VA 3E5QA 4OMYA 4RGXA 3REOA 1TQMA 5FFXA 2DU9A 5DYMA 4CXFA 1HKSA 2LF8A 2BE5F 4HV5A 4I09A 2E7WA 3HYIA 2PLYA 4RGUA 5H6RA 4G9YA 4PCQA 3BY6A 3IKTA 3I64A 3RKWA 4MTDA 5E17F 1WQ2A 5E8GA 2VN2A 1FSHA 1G4DA 3TQNA 3EYYA 5ICGA 5DD8A 2C6YA 4G8XA 2HKXA 3SFZA 2COMA 1Z05A 2NNYA 1QNTA 4IF4A 2W85A 1YTYA 4Q48A 2VT2A 1X3UA 1HW1A 3I0TA 4CDGA 1KU3A 2A61A 3F6VA 3GVAA 4I98B 5K1YA 1OKRA 5IT9Z 1IN6A 4HYEA 2F5CA 4LD5A 4P9FA 4A6EA 4QWQA 4MHGA 2YPRA 5E1ZB 3V4GA 4OIOF 3C7JA 2M45A 5BQTA 2VOPA 4RB1A 2KJBA 5A2QK 1HQCA 1ZLKA 2ELHA 2FRHA 2GIVA 2LF7A 2HTSA 4XRFA 1BIBA 5K5QA 1TBXA 3I5UA 5EEHA 1GXPA 1OYYA 1XCBA 3CDHA 3KZZA 3T1BA 2L3DA 4HF1A 1BN5A 1KU2A 3WTYC 3EETA 3GYHX 3IRRA 1ZGJA 4GCVA 4LG0B 4KT5C 5EEGA 1ZAOA 2XHKA 5L3DA 3K1NA 1J59A 4WXCA 3FMRA 3CJNA 1YLFA 2W84A 1D3YA 4JBAA 2QQAA 2YSRA 5JI6A 3FWEA 4KNYA 1XDUA 2OA4A 2W25A 3WGGA 4IHSA 5BMZA 4OU0A 2BBYA 1IW7F 4KMUX 3QP6A 2QQBA 2VONA 4KN4X 5FFZA 2RKHA 3BJOA 3BZ6A 1QZYA 2ZXJA 4A0YA 1JXSA 1FY7A 3FMSA 3FZVA 2IP2A 4AVPA 2ZMEA 1D5VA 3M7GA 2XASA 4CZZA 2L4AA 1W5SA 3I59A 4HA8A 1LEBA 5E20A 1YW8A 2VOOA 4F7ZA 3ZMZA 4EJOA 4IJAA 2OZ6A 3LA2A 2QWWA 1YG2A 3F3XA 2P5VA 3R61A 2VBZA 3ZP5A 4IRHA 4M73A 1S7AA 5LLQA 5DUIA 2HTJA 1QZZA 2O3FA 1ZLJA 5ILSA 3C1DA 2O61A 5DD4A 3WU1B 4EJTA 3E6BA 1FBQA 1PUEE 4ENNA 3KP2A 3L09A 2EK5A 3OOPA 1P92A 4GYIA 5DEQA 5JR3A 1J0RA 3F8MA 3G3ZA 1SFXA 1DP7P 2VBXA 3LAPA 4UV9A 1S3JA 3I54A 2B0LA 3QU3A 1U78A 4PZJA 3CO7C 1FPQA 4DNCA 5DCMA 4AIKA 1G3YA 1K79A 2DI3A 3BROA 4P5OA 1UHMA 1YFHA 3K69A 4KYWA 1USSA 4UVAA 5D5WB 2RDPA 3ZMUA 2XKPA 2PBIA 3K2ZA 3TO7A 3ERED 2IPQX 5D5UB 1EH8A 3T5XA 1USTA 1F4KA 3LAJA 5HDGA 2ZMEB 3TO6A 5AONA 5H20A 2OQRA 2PEXA 2OZUA 4A12A 4HOBA 2UZKA 3I59B 3KE2A 5LBQA 5F6FA 5LRSA 1J75A 2GXBA 3V7CA 1FLIA 1HBXG 1FC3A 3B73A 2QBYA 5JVTA 1IN5A 2MBFA 1FOKA 2QYOA 2BV6A 4L5IA 2HQRA 3I71A 3RPQA 3DFGA 1FNNA 5CVUA 3SQNA 3K9TA 5E8IA 3KP3A 3KZYA 2FEZA 4K2EA 2XAJA 3ROUA 1IZ1A 3ZN1A 1LDKB 1BI0A 2Z5UA 2NRAC 3RI4A 1ZYRF 3V8KA 4CHUA 3H3UA 1FT9A 1ULYA 4KN7X 2XROA 5BOXA 3F6OA 3F21A 1U5TA 2P6TA 2ZNYA 3T8TA 4OOIA 3P9CA 2A07F 2K7LA 1IN8A 1D8KA
chains in the Genus database with same CATH superfamily
1Y8RB 4H4KC 2MYSA 1PP7U 3PSFA 3WG9A 1ETOA 1Z9CA 1N75A 1U3EM 2O8KA 2Z3YA 3GFIA 2VODA 3GF2A 4ETSA 4D0PA 3EYIA 3VWBA 2EA2A 1O3QA 1KU9A 2JRTA 4UVBA 1MMNA 1X2MA 3WU0A 2CYYA 1SFUA 4UUVA 4YG2F 3MN2A 3W6JB 2XVCA 3IHUA 4QLCU 1MNEA 2EIJH 1R5GA 2I10A 2KIUA 3KZIC 3MKZA 5FD5A 1K4SA 1ACIA 3K7AJ 3BR3A 4IQJA 5FROA 2DYSH 4B47A 2IS6A 2GOMA 1R7JA 3QWLA 3WTWC 2R7TA 3BG5A 2X4HA 3HEFA 4U0VA 2X6OA 4MQ9F 3BDDA 2V6CA 3CQZJ 4M74A 1U2WA 2HYFA 4Y13A 3DV8A 2CQKA 2DTRA 2XSJC 3DPLC 3KEOA 3T8RA 2JK3A 4OIPF 3DEUA 4EM0B 2OCCH 1E0EA 2K27A 4BBSJ 1EV7A 2MH9A 2W00A 4A93J 2LSOA 5KVRA 1QPIA 1ON2A 5JLWA 1ZELA 1VQLI 3WTZA 1V3FA 2QBYB 4KFCA 2ZJQF 3HB9A 4HNTA 2N8GA 4M3BA 3DXJF 1FOYA 3J80K 2AQFA 3KIOA 1RNLA 4HW0A 3GFLA 3OR2C 3ZQCA 1QGPA 2BOLA 4BAYA 5L3CA 2HXIA 2EV6A 2ZCWA 2VXZA 1ETQA 2ELKA 4Z6YA 5LHHA 3G1LA 2LLKA 4BU2A 3DU5A 1GVJA 2M4KA 2EZIA 3CO6C 3ABKH 1J09A 2P8TA 1ZG3A 1Y56A 4EV0A 4WX9A 4D5CA 3FXRA 3PNYA 3D1NI 2ISZA 3EUKL 2AHQA 2O9LA 1RETA 4CUGA 1QVTA 1HW5A 3PQKA 3ZMVA 1I6XA 1BA5A 3KLOA 2H8WA 4A5NA 4CCLA 3LFUA 2CS3A 5EG0A 1YO5C 4LK1F 4HPQA 3COAC 2R7FA 2M4GA 1Z91A 2OU2A 1W7PA 4E7SA 4OIQF 4F93B 2RGVA 3K70D 2DXIA 3B6AA 1JE8A 1G6NA 4DZJA 3CCYA 3OYMA 1EH7A 4IPAA 4CO8A 3I4PA 3VYRB 5FLXK 1E3PA 1U9OA 2JZYA 5LEJA 3HBLA 3J81Z 1WWXA 2GBYA 1JUPA 1U5TB 1NK2P 2VQGA 4FHTA 4PJJA 2VKHA 1JHHA 1XGSA 3QPSA 2A68F 3H5AA 1G59A 3A0HC 2IRFG 2WAEA 2V1XA 3QAHA 1VQ9I 1VZ0A 4Y3OA 3S14J 2YU3A 2YUSA 4F52A 1SD5A 3KYCB 3LSRA 2GLOA 3NQOA 2QEXI 2F5VA 2VQLA 4GDFA 1J9IA 2FQ3A 2DOAA 4HRIA 2R7OA 1QQIA 3A1YA 1CF7B 5IYDJ 2K9NA 4KIGA 2O0YA 4ENKA 1H9TA 3OSFA 2ZB9A 3WTVC 1MBJA 2UXNA 5GPAA 1F9NA 2PQ8A 2XPVA 1FP1D 3AL0C 4Y17A 2ECBA 1G8XA 3DBHB 4IXAA 4NQWA 2NAZA 3ZPLA 2HVRA 3BPVA 4JK1X 5DUKA 5JFRA 1RRJA 2GA2A 5KNLA 4DZPA 4MLOA 3OYIA 1MKMA 3KP7A 2BZTA 1ONVA 2LNBA 1W4MA 2W4SA 4XK4A 3TKYA 5CYVA 4BQNA 4AIJA 1MMDA 3LFKA 2XV4S 2CW0F 3QRFF 1GV5A 3KFWX 3AKZA 5ED4A 4P55A 4I0BA 3KP4A 2HKOA 2MD5A 4RAYA 1RUOA 3FXKA 4EJWA 2QVOA 3BP8A 1WPKA 3KETA 3OYHA 3W2VA 1R23A 2EV5A 5J1UA 4DBRA 4ESFA 3L2RA 2CV0A 2GOXB 3RKQA 2X51A 1QBJA 4RS8A 4PDKA 4UXNA 2LDUA 4L18B 1OLTA 3U2RA 2Y0SA 3FHZA 4ZDOA 2BW3A 2E5ZA 2B7EA 2XF5A 2V9KA 4KIBA 5E79C 3RKXA 4G6TB 2M8GX 3TMOA 3ULQB 2YU9J 1QRYA 1MJ9A 4BQAA 2NS0A 3H5RA 5GTHC 4II3A 3O8GA 2XAUA 3RJPA 3GTOJ 3JTHA 3HL2A 3DKXA 3QYBA 5CPRB 4A3KJ 4FISA 3MWMA 3I3LA 5EG0B 2IA2A 2K85A 3M1EA 1LDJA 1SFEA 1WJFA 1W7PB 4RMNA 3E6MA 2EZKA 1MNDA 3BC8A 4CICA 2DMQA 4V2GA 1MBEA 3V8LA 5B1AH 1Z77A 2MSYA 3ERMA 3BQZA 1SMYF 4C2UA 2MA3A 4MGRA 3TDUC 2R5ZA 1HW2A 1DP3A 3JRGA 2FE3A 2Q2EA 4O6JA 2HVQA 5D6FA 2JA2A 1K78A 1WRJA 2DPDA 3U21A 2X9DA 1EJ9A 2LK2A 3U1DA 2XF6A 3K1PA 3OIQA 4HQMA 3GTQJ 1W0TA 1QHHD 2HZTA 2JVHA 5L3BA 1ENHA 3OMYA 2Y0MA 1FOWA 2JA7J 3MKYB 1LE8A 5M3MJ 4XOTA 1FIPA 3DBRB 4UHTA 4LJZF 4BYYA 4PSWA 2HWVA 4L9JA 1VNDA 1WFXA 1YITI 2CV2A 3HSRA 4MEXF 1W7PD 5ILVA 1H8AC 1WJ5A 5FB2A 4GYGA 1SD7A 2QQ9A 4Q47A 3JRFA 4RLFA 3KP6A 2Z9OA 3FIWA 3MAJA 2RQPA 1YOVB 2ZJ2A 2DPUA 3LOCA 1TNTA 2FMYA 5L3EA 3HOSA 1CGPA 4NQWB 5F1JA 2V26A 4ENJA 4S05A 3Q9SA 3L2CA 3FXLA 2R7XA 1ZG1A 1MSFC 1XPXA 1YIOA 4W1UA 4MNUA 2WA0A 4YFKF 4AIDA 2WADA 3H92A 2HQNA 3B02A 4CCNA 5FRMA 3CCJI 2M0MA 2R7WA 2ME6A 4IKFA 5GAHJ 2Y9YA 2XAFA 4TV7A 2IGMA 4WF2A 1ETYA 1WZ2A 2DMUA 4ZTFA 2NYXA 5IYCJ 2RREA 4XIDA 3JAMK 1T98A 4IHWA 3FK6A 5EEAA 2XAGA 3H9JA 4G94A 4HLXA 1XX5A 4PK4A 4WXDA 4AD9A 1C0WA 5HOOA 2OTJI 1AKHB 1BL0A 2R92J 5FKKA 1B9NA 1R4MB 2L7KA 2LREA 4FQGA 4I0AA 3U1KA 2JT1A 3CUQA 2X6XA 2BW3B 4XBFA 5DS9A 2Z2SB 2P4WA 3PQJA 4WXHA 3J80Z 2MC3A 2YR2A 3M9AA 1LDDA 1Z67A 4XLNF 2DA2A 4KIFA 1ZHFA 5FO5A 1N77A 4EVIA 3GTKJ 5LHGA 2LP0A 4NB5A 3PNTA 3ZMTA 4IHYA 4M3GA 1DPRA 4DYCA 2Z16A 3ASNH 3CJRB 5TRDA 3PUBA 2XKOA 3I4MJ 3LSGA 4XOPA 4AWXB 1I6HJ 2IEKA 4CSWA 3CC4I 3ZQIA 1R1UA 1ZK8A 2H1LA 5LGNA 3LSHA 3HM5A 4WK8F 4G7ZF 1P7JA 4E70A 1LNWA 3E3VA 3CF2A 5HDKA 2IS1A 5EZHA 4DW6A 2R5ZB 2KISA 1QU3A 1VQ5I 1GXQA 4B09A 4P9UA 1PDNC 1D1CA 2L9VA 2RVCA 2Q2EB 4CZCA 2W24A 1K78B 3CDIA 2GIZA 4YRVA 4YIFA 2LY1A 3O8HA 4E7IA 3R0JA 2ISYA 2LH9A 5HLGA 4UUSA 4L9NA 1JKOC 4P96A 4A3FJ 2BEOA 3FISA 3T0YA 5FLXZ 1S8NA 2GXGA 2FA5A 2CJJA 2P6SA 2CQNA 4LITA 2R3SA 3GFJA 1X19A 1LE8B 1DU0A 3L2VA 4A2UA 3G1OA 4F3QA 1WHUA 1VQ7I 3ABTA 3HSEA 1SVMA 2MFZA 3GXOA 4IZZA 1Z21A 1SEUA 2OC6A 1XB4A 1J5YA 1TTYA 1X1CA 4LMYA 1BOAA 1IDYA 2E2HJ 4RM2A 2KIQA 1MMAA 2DOFA 1O3SA 1H9GA 2VKEA 2GQQA 1IXRC 3LMMA 1NG7A 3RCOA 4E4HA 2R7DA 4FCYA 3VYSB 1PUFA 2ESHA 2F5FA 2JPCA 3S17J 2VC1A 3S15J 2KRFA 1UG0A 4LLGF 4CYDA 2E2JJ 1JGSA 5ICCA 3CUOA 1REPC 2CV1A 3O3KA 1O3RA 1JUSA 4OMZA 2AS5F 1XSDA 1YRNA 2FOKA 4YFNF 3SEQA 4ON0A 1QPMA 5CVRA 3SZTA 3LNQA 2TCTA 1R5ID 5FKMA 3I56I 4AYBA 2F5EA 3U9GA 1NHAA 2QENA 2EIMH 4I76A 2JSCA 4CA0A 2IS4A 3BR6A 3IH3A 1FYLA 1RIOH 4XLEA 2XB0X 2KQRA 4XSZF 4N4NB 3IC7A 3RQIA 3E7LA 3AFHA 4ESBA 4ANJA 3K4BA 4XNFA 3CUQB 2LYCA 5FLMJ 1FTTA 5HS8A 1GHCA 5FKOA 1YJWI 3WTTC 4A3CJ 3HSFA 1BI3A 1SD4A 1WJEA 1R00A 4ZDPA 4ZYAA 4O5VA 5AIPA 2EFQA 1ITYA 3BJAA 1I3QJ 2KRHA 2R7ZJ 5K5OA 5TJJA 2R7QA 4XM3A 1ZRFA 3BT9A 2XRNA 4C9YA 3S1RJ 4M3DA 4ZDLA 1K61A 3W6KB 2FNAA 4A3MJ 2K9QA 5HNHA 1BC8C 3O6BB 5IOYA 4PSXA 1IUYA 1VI0A 2G9WA 4A0XA 2RV8A 3G73A 4G7OF 3JR9A 3RYPA 4ZYGA 1UMQA 3MVPA 3RTRA 1IXSB 2ESNA 3L2WA 1Y39A 2QSGX 4M9XA 2HS5A 3RYRA 5DCFA 3EUAA 3CCMI 1NG6A 3F8BA 1WGXA 3OS2A 1HKTA 1R6RA 2HXOA 4KISA 2K5CA 1T8IA 1YQAA 1B4AA 4E6KG 4CCJA 4UUSB 2H6BA 3CMAI 2ZJPF 1ZN2A 3FDYA 4HX4A 1DGRM 4BY7J 1DGWY 4PUSA 1LUJB 1RKWA 2EFWA 2VJIA 3CP2A 3V8JA 3KYDB 1KA8A 1KYZA 2OJED 2BY3A 2DOEA 3P9KA 3TW6A 4AIHA 3A4CA 4A3EJ 1X58A 1TWCJ 4FASD 2ECCA 4B4CA 4NBQA 3LSJA 4XKWA 3OYKA 1JKQC 3WTXC 3CDLA 1OJLA 2KKOA 4JOMA 5IYBJ 2DA6A 3A2KA 1OCPA 1XG1A 1K6OA 1FBUA 3SDGA 1HCRA 2MLGA 2EZLA 3BG3A 3NAUA 2VPLA 2DDAA 5K5RA 4N4OB 2ELJA 1BR1A 1MW7A 2FF4A 3RSNA 3H9QA 2P5KA 4ZZLA 4L5JA 3TL4X 2ME0A 2L02A 1RR8C 2KDOA 2E1CA 1FEXA 2DFEA 2EZHA 1YRNB 4PJ0C 2KHMA 4DYRA 2Y0SN 4HLYA 1F5TA 4EEFG 1UAAA 4KA4A 5HS7A 3GWZA 3M8EA 2X48A 3LSMA 1LFBA 1X1AA 3GZ5A 3ABUA 2EFOA 1JUMA 3Q0UA 3VODA 5A2QZ 1H89C 2CFXA 4HV6A 1UJ8A 2JQ7A 4MFDA 5IPAA 2VJ5A 2ZMEC 2L9NA 3AG4H 1AWCA 2Y48A 4C3HJ 1A35A 3LSKA 1W36C 3OIPA 4ENMA 3G6EI 2A5WA 1MBHA 3VFZA 1IRZA 3WTSC 2FBHA 3ZRGA 2M9HA 2ZBKA 4RAZA 5ICEA 2J5PA 1TT0A 4J19A 1Z6TA 4C2TA 3JAMZ 2WV0A 5L3FA 4ZYEA 2KZGA 3FXMA 3M4OJ 2JRMA 3TDZC 1BR4A 2RC4A 1ZGWA 1Y0UA 2DYRH 1E3OC 4GXOA 1KZHA 2GM4A 1U8RA 2DJIA 2KMUA 5DCMB 2F5DA 2HR3A 3KX2A 4EATA 3ELKA 3WE3A 1SD6A 3SZGA 1BR2A 4BHBA 4YELA 2PI0A 4ZYDA 1YW9A 4L9VA 3FF5A 5D4SA 4N9IA 1MGTA 3JRDA 2DLLA 2A6TA 2UWMA 2MH2A 3QPTA 1ORKA 4N9HA 3SJMA 1MIJA 2AO9A 2KIMA 3S3MA 2VBYA 2HZDA 1SMTA 4PJMA 1X1DA 3LQQA 2FMLA 4H0EA 2EH3A 3OL4A 3ZXSA 2QSHX 2WTEA 1I27A 4BACA 2QLZA 3BQYA 4CGZA 4HBLA 2EV0A 2UUZA 4AC0A 1ZH5A 2J5OA 4EQQA 3FHNA 4E7KA 3HG9A 2E1NA 1BC7C 5FRNA 2HI3A 3SHFA 3VB2A 1I39A 1R22A 1SAXA 4JP0A 4IRIA 1FMWA 3F8FA 2WC2A 1B1BA 4PJNA 1LKXA 1LFPA 2L7FP 3D5SC 1DU6A 2HDCA 2A6HF 3F72A 3ZQ7A 2HPIA 3IH4A 1T33A 2EFNA 3ZMSA 1SFOJ 4OIRF 3K4NA 4E7ZA 2PX9A 5DM6F 3ZQGA 2CQ7A 3F9KA 1YX5A 2Z1DA 5HDNA 4Q5SF 2VE8A 1G3SA 4O3MA 1T56A 3TOBA 4HDVA 1Y0NA 1Z3XA 3TP0A 3E97A 3J7YJ 2PMHA 1XDSA 1Z6RA 1KGSA 3IAM2 3CCEI 4E7JA 4KICA 3JRAA 1PJRA 1LVKA 2LBFA 1QA6A 3ABLH 3MQ0A 1HSTA 1YIJI 1H0MA 1RPWA 3CP8A 4RA2A 3OYAA 3ZN0A 2VPRA 2CWEA 2L9RA 1YS6A 2JSPA 2LD5A 2IAIA 4BY1J 5CVJA 3PJRA 2FJ1A 5M3FJ 4I01A 3WODF 2XAHA 4KITB 3M3YJ 2FU4A 3SDBA 2BVLA 3VSLA 2WY7Q 2CFOA 4IO9F 2Y30A 4Y15A 1JJ8C 5CLSA 3HPGA 1RZ4A 2F4IA 3BZKA 3ZQQA 2V4JC 3AG1H 3Q0WA 4LIVA 3DLLF 4IOAF 1ZR2A 4W97A 4FE4A 2G0EA 3HHHA 4XR6A 1BW5A 2Y75A 5ERIA 3IKVA 1I1GA 3W6VA 1BI1A 2LTPA 1V4RA 4GO1A 4OAZA 4P1WA 4DQ2A 5HVQC 1VTNC 3K70C 4UNOA 3ZR8X 5IOZA 5J8FA 5CVIA 3QQAA 3F0CA 2LY9A 3DF8A 4OAYA 4RB2C 2O6GE 4HF2A 3IRQA 1KQ9A 1IJWC 3GMEA 1TQPA 4M6YA 3V42A 5LFAA 4A3JJ 4XKVA 5F1RA 3NEUA 3RZDJ 2JUCA 3VOEA 2A5YB 4B44A 4FTHA 1E17A 1S7OA 3HIFA 1HA8A 1ETKA 2AXLA 1SANA 2ACJA 5BPDA 2VASA 3JSPA 4CCOA 1RC9A 1EKEA 1OCOH 2VKVA 2X1CA 3HJEA 3WHBA 4A0ZA 2E36A 3G2BA 3DU6A 3IAS2 1KYWA 2R5YA 4M9ZA 2VJ4A 4JX6A 5H2FC 2DK8A 3MFKA 1XGNA 4YIIA 4KDPA 4ESJA 3CC7I 2BGCA 2GAUA 4BXFA 3HUGA 3C2BA 3H1CA 1P6RA 3LA7A 3J7AO 2NS7A 4F91B 3M8FA 2ZC2A 2F2EA 3MZHA 4MFEA 4AYBN 2PFBA 1A6IA 1U5TC 5KHDA 1FIAA 2QM3A 3BPXA 1IGNA 2ADUA 4DIQA 5M5WJ 3JTGA 2ZFWA 5J6XA 1ON1A 3QYFA 2MD0A 1OCCH 4UVCA 5CJ9A 3H3ZA 4HNVA 3IP4B 3PUFA 3OYJA 1FP2A 2G7HA 2FBKA 1T2KA 2IGKA 5BPIA 3RKYA 5F04A 1H88C 3MZ8A 3OYFA 1IXCA 4QIWN 3L2UA 4V2FA 2LBFB 4OINF 1YX3A 5E3LA 4U87A 4ZH4F 3CC2I 2JJ7A 4RDUA 4U7DA 3FMQA 2GZWA 3E6DA 2FNPA 1T0FA 2DA1A 1WKMA 3QPHA 3JRBA 5GPCA 4R79A 3FKJA 4YIRX 3CCUI 4M3FA 5IY5H 3EUHA 3BOQA 2KT0A 4Z2YA 3ZMDA 4BH9A 2CO5A 4R8HA 4RB0A 1XD7A 2IA0A 4Q4ZF 4BHCA 1U9NA 2AQEA 4V19K 2DW4A 4M71A 4FE7A 1ODDA 1OR7A 3IWFA 4IVNA 6PAXA 3BR1A 1XGMA 1HXDA 3OYGA 2K4JA 2OPTA 2E35A 3RPUA 1XMKA 3WGIA 4ZZDA 2VJJA 5E1XA 2KP6A 2H8RA 1B6AA 2CGPA 5K7ZA 1I5ZA 1FMVA 1IN7A 3DWLE 4XRSA 1KU7A 4B48A 2Q0OA 5FD6A 3H0GJ 1LQ1A 2BXZA 3Q9VA 3R6SA 1F43A 2LC2A 5EGOA 1BJZA 3CTAA 4XLPF 3TBIA 4G6DA 4RB3C 3K4MA 3ML6A 2VQCA 1KQ0A 1RKTA 2R5YB 1Y6IA 1NK3P 5JVGF 1S6LA 2CSOA 1MD0A 5CVVA 1R58A 3V7SA 1ZARA 1TLHB 2OBPA 4XMYA 3L2QA 1JTXA 1A5JA 4MQVA 3MEXA 1IF1A 2VBWA 2DT6A 2K02A 1JKPC 3HUGB 2L4MA 3A0BC 2XAQA 1R49A 1L3LA 4A3DJ 1YJ9I 4JX4A 4MO7A 4JQFA 2NNNA 2LY2A 3GCMA 2KIFA 2D2WA 1QHGA 5LGTA 1XGOA 3HOXJ 2VC0A 1Z3YA 2QKLB 2ZKZA 1WSUA 1MSEC 2R4GA 1O57A 2X1EA 3GLXA 1ZRCA 1ZKGA 5D5XB 1MBKA 1W5TA 3PM1A 1RI7A 1D5YA 2STWA 3M1CA 2DO7A 3ZQFA 2H27A 1XTAA 2HYGD 5EF6A 3OL3A 4ZJZA 4M9SA 4M6XA 2CUFA 2X0LA 2H1KA 5M5XJ 4G6QA 5F0HA 1UCRA 2CQQA 1V55H 2DFIA 3VYTB 3X2QH 3HOZJ 1ETWA 3WHCA 2EINH 3V7RA 4BBRJ 4I2OA 4B43A 3ZQHA 5HS9A 5D8LB 3LQRA 2QUFA 2W57A 1IN4A 2F4MB 2ZNZA 1FWZA 3DKWA 3H36A 3H5NA 2JVGA 5KAFC 1GLNA 3FXQA 2WWYA 2KFDA 4M72A 3N4MA 2R7VA 1YW7A 4WWCA 1VFCA 3K4KA 2ZXIA 2VKDA 2LRDA 5M5YJ 1YYVA 5BS6A 3GTGJ 1WI9A 3EQLF 2CRGA 3HC7A 1BIAA 1OCZH 1ZGAA 1JI8A 3DTEA 1DDNA 3VYUB 1GV2A 1D8JA 3HOTA 1JTYA 2EJRA 3IL2A 4BHPA 5DM7F 1HSJA 1F36A 1X3WB 4LLLA 3S8PA 3DPTA 3GTLJ 2IW5A 4X1EA 2NS8A 3VEPA 3P7NA 4LGWA 3ZOBA 9ANTA 2E1MB 2VE9A 5FKNA 4A5MA 3NWSA 4FX0A 5D6EA 3WGHA 2LR8A 3NARA 4XICA 3C18A 5ILUA 1LJ9A 1D0XA 2K9MA 3BR2A 4D9JA 3GX4X 4GGGA 1VQ4I 3A03A 1RESA 4R1HA 2LG4A 2DAOA 1OFCX 3F22A 2KL4A 1UHWA 3S93A 3B6CA 2HFHA 4KJZA 5EGOB 3QODA 5TGTA 5KK1A 3QP5A 5KCMA 3HPHA 3C2GA 3HTSB 3K4LA 3J7ZI 2Q1ZB 3LWFA 3MKWB 1KQ8A 1V5EA 4BEHA 3ISPA 4N0BA 4A3LJ 3F8NA 3G71I 2QA4I 2EA4A 3FKIJ 3FM3A 5DV5A 3NRVA 5LHIA 3A01A 4X0GA 4LB6B 4EGZA 2WV1A 2P5LC 2ZFUA 3C3WA 1ZRDA 3E5XA 2NOJB 3RIRA 2XF7A 1P4XA 2EB7A 3H0DA 3RPUD 2JN6A 1A31A 5HLIA 4Y52J 1TQIA 3OYCA 2FBIA 2L7ZA 3HRUA 4RAFA 4BDYA 3BG6A 2A05A 2CUZA 1R1TA 2D1VA 5E3OA 5LD2C 1K83J 2KZVA 2DA3A 4XQFA 1A04A 3R4KA 1P4WA 2AXTC 3GZNB 3OOUA 1T6SA 2ZO4A 2OCEA 4L0ZB 2COBA 2BY0A 3FBIB 3TEDA 3PSIA 1FYMA 1W0UA 5HLTA 2XUBA 2PG4A 2X85A 3O2PE 5C44J 5B5EC 1DPUA 1L0OC 1MZBA 2E1OA 3N97A 4XLHA 1X4OA 3F23A 4BQOA 4XLAA 3SXYA 1J2XA 2DA5A 5J8CA 4UV8A 2LMDA 1G3TA 3RDIA 3KLNA 3J81K 1ZR4A 2DCEA 4NDLA 1BBYA 1G3WA 4UB8C 4LB5A 4QTRA 3CCSI 5J4YA 1R4NB 3HKZA 3R60A 2VXDA 4HDUA 2MLKA 2PN6A 3JSOA 4YFXF 4DJAA 5J1YA 1DUXC 2L7MP 2L54A 2NVXJ 2L9SA 3EDPA 3DTIA 1JT6A 3UNGC 2LOOA 2OTLI 4CH7A 2CU7A 3SZPA 2CH0A 2HOTA 5GTIC 2MG4A 4PGGA 2HEOA 3ASOH 1D1AA 2E7XA 2LFBA 1T39A 1VF9A 1R9TJ 2OV7A 1VQOI 1P4AA 1GDTA 3ZQLA 2FX0A 4HF0A 3JRIA 1NTCA 1WVRA 4MEYF 1BW6A 2BHZA 4A3BJ 2IA1A 4EJVA 4S04A 4EJUA 4M6VA 2NVTJ 4U0WA 5LGUA 1R5HA 3S2WA 1TT5B 1XMAA 2QZ8A 1OYIA 1SC7A 1BJAA 3K4CA 1B9MA 2JPBA 2PMZA 3CUQC 1TNSA 3QOEA 5B3SH 2YX4A 3DLAA 2BHYA 1RR7A 2G7UA 3PFIA 1IAWA 3CESA 2PMUA 2ZSHB 2VB6A 3WTUC 1XSXA 3OYNA 3GEZA 3S1MJ 1MDMA 2K86A 1NH3A 4BEHB 2DMPA 5H6QA 3L1PA 5D4RA 1PUFB 4GFBA 4A6DA 1E3HA 3WE2A 1XSVA 3L00A 3AG2H 3A01B 4KUMA 2XGEA 4BJ6C 1FYKA 1PP8F 2W1OA 1SFKA 3HRSA 2XSDC 1R36A 1T95A 3FXJA 1A6QA 2XGXA 3JREA 4BUPA 2IVMA 1JKRC 1Z7UA 4BXUA 2P7CB 2EWNA 2YX7A 4KMFA 4EM1A 1QZEA 4XSXF 3I58A 3S32A 4GRIA 5IT3A 4RM3A 3Q3SA 4LFUA 1SVOA 2FD5A 2XGDA 4C30A 2XIGA 1KONA 3LL7A 4HG2A 2HU9A 2WAQA 1IRXA 2K9SA 4ZC3A 3WG7H 4BL0B 2MC4A 2IXSA 1ZG5A 2IBDA 4FT8A 1Y8QB 2DBBA 2CG4A 1XC5A 1OYWA 5C4JJ 1W36D 3DQVC 3R0AA 1K7AA 1X3ZB 2M7AA 4RAGA 2E5NA 2GWRA 2K4BA 2UXXA 4I99C 4RGRA 3CCVI 1MMSA 2M8EA 2OAZA 3BZCA 2DK5A 2HQAA 4XORA 1EA3A 2JTVA 3ECHA 3JCUC 3FXUA 4B8XA 5L3GA 3LSPA 1JJ6C 1XN7A 2H09A 2OD5A 2WBMA 5DDGA 1T38A 2HOAA 3MZYA 5CKTA 2XB5A 4RGSA 2NVQJ 2BY2A 1FX7A 2HOEA 3OWTA 1HC8A 2M5WA 1W1WE 1STZA 2UV1A 4F92B 2O03A 3BJ6A 4AM3A 5ICFA 2ZJRF 2ETHA 1RUNA 1APLC 3KP5A 2V1DA 1B8IA 1JHFA 1XMXA 3RZOJ 2XPUA 2A3SA 5EDNA 2Y69H 4E7LA 2EBIA 3E0JB 5FKLA 1I1SA 1X4PA 1OQYA 2BYVE 5IP6A 1MJAA 5D8KB 3DP7A 5IT9K 1ZTRA 5J4VA 1X2NA 3FX3A 5LEKA 3HOYJ 3PIOF 2OQGA 4NC8A 4MTEA 1UB9A 5E18F 1K4TA 4NUBA 4NNJA 2K40A 4L9TA 5F64A 3TP3A 4G7HF 4BS9A 3K1MA 1WCMJ 2V9PA 1AHDP 2Q8KA 3JW4A 3C2HA 2HGCA 1BI2A 2P7VB 3I53A 4HZFA 1IDZA 5D5VB 3HGGA 4BNCA 1DQUA 3OR1C 2R93J 2WB1A 3KPHA 1CF7A 2V1UA 1SAUA 2EILH 2CUJA 3QU6A 4LK0F 3TGNA 4HQEA 2VIXA 1MBFA 2QSFX 2DFHA 3LSTA 3AAFA 1MDMB 3ECOA 4CCMA 1VQKI 4I6ZA 4LOCA 4I7HA 4LLNA 1N25A 1D0YA 3HOWJ 2V79A 1MH3A 3HTUA 1TW3A 5EYRA 5LRRA 1FJLA 3K2AA 2P81A 2JA6J 2IT0A 2DODA 3TOAA 3DTKA 2ID3A 4HNUA 1TW2A 3KCCA 4IHXA 3HDDA 1QO0D 1O7FA 2EIKH 4U0YA 2L01A 3GTMJ 3S3NA 3BWGA 3BLYA 1IV6A 2DT5A 1HOMA 5J3LA 1LVAA 3L9FA 1Z1DA 3FM5A 1MMGA 2KJCA 3K6GA 3P9IA 4FETA 1O4XA 3HHGA 2RNJA 3S1NJ 3IWZA 2DQLA 3Q5FA 2TDXA 4Y33A 3GZ6A 2KLOA 2CMPA 2JMWA 3S16J 4EMSA 1PVEA 2A6EF 2CUEA 5GP9A 4HAMA 4Y7NJ 2W7NA 3QOPA 2ZSIB 2I5UA 3LA3A 2LKSA 2GA1A 4B1RA 3OYBA 3N05A 2M30A 5FGMA 2K3PA 3F8CA 1FSEA 3HRMA 4HX7A 3M8JA 4ASNA 1TWGJ 4NHJA 1IRGA 1ZQ3P 2M0CA 1IUFA 2M7BA 3BTIA 1S29A 3GLLA 3AL0B 2X6WA 4C3JJ 4EM2A 1U8BA 3D0SA 1UG2A 2E60A 2OUMA 1P2FA 3E6CC 3BR5A 4L0YB 1IG7A 5HLHA 3IV5A 2EFPA 1ZREA 4I02A 1Q1HA 4FX4A 2M87A 2D1HA 4XLCA 2DQRA 2M34A 2NXNB 2M3AA 4XRSG 1B8IB 3MCZA 2FXAA 2JA8J 2H6CA 1O7LA 4HX8A 1EH6A 1LEAA 1EF4A 1OPCA 1Z7LA 4PGHA 2VI6A 3GW2A 4IHTA 1AOYA 1HKQA 2PJPA 3K0LA 3OYLA 2RQQA 4NC6A 2STTA 3CMYA 1T08B 2E19A 5F08A 4EGYA 1WH5A 1YS7A 2M2EA 3OV8A 1Z0XA 1JT0A 1VQ6I 2XDVA 2A69F 4U88A 2NOGA 4AUXA 1J7KA 2RN7A 2Z33A 2W82A 5F0FA 3KEQA 1V54H 3L7WA 3E5UA 3HZJA 4CCKA 5E1WA 3WU2C 3CZ6A 1FZPB 1BM9A 1I50J 1UFMA 3IH2A 2FSWA 3GO5A 3ZCOA 2VQHA 1U6GA 2ZXWH 2VT3A 4C2MJ 3RQ4A 2H94A 1AA7A 2DTZA 3BG9A 2EPFA 4WCGA 3IUOA 1O3TA 5AIQA 3I4NJ 2LKPA 3GTPJ 2IJLA 1Y1WJ 3K10A 2D5VA 1E2XA 3D5LA 1WJAA 1LB2A 2NVUB 4IRGA 3I55I 4DOZA 3TO9A 1P7IA 1MJBA 2V9VA 1P9QC 1V5GA 2NVYJ 2Z99A 1XCVA 2O8XA 4ZYHA 4U7BA 2TRTA 3CLOA 4AU7A 4HSRA 2Y31A 1F1ZA 5CQGA 3GFMA 3GUDA 1GVDA 2BXYA 2P0WA 1OCTC 2D45A 2K3FA 4BE2A 5K7FA 1B72A 1B59A 4PJLA 5JHUA 2QGUA 1VQMI 3HRTA 4IX7A 3CMEI 1YE9A 4OWRB 4XKCA 4LG0A 1FBSA 1OMIA 2M1BA 1IRFA 5E3MA 2HPMA 3PL8A 4E7HA 1XS9A 1AKHA 2WAFA 1POGA 1R1VA 3W2AA 1TZLA 3E5QA 4OMYA 3A02A 2LKXA 3HKZN 1V5FA 3QPLA 3VDXA 4RGXA 3PO2J 2QCOA 3REOA 1TQMA 5FFXA 3S2DJ 2DU9A 3Q0VA 5DYMA 2RNGA 4CXFA 1HKSA 2LF8A 2BE5F 1GT0C 3G4SI 4HV5A 4I09A 2E7WA 4PFOA 4HEA2 3HYIA 2PLYA 2HQ5A 4RGUA 4G9YA 2K9LA 5H6RA 4PCQA 1SVLA 4J00A 2JA5J 3BY6A 2PJRA 5JLXA 3IKTA 1S5LC 1WJBA 3I64A 3RKWA 4MTDA 5E17F 1WQ2A 5E8GA 4UY8I 2VN2A 1FSHA 2OF7A 1G4DA 3TQNA 3EYYA 5EZGA 5DD8A 5ICGA 1AU7A 4B3AA 2C6YA 4G8XA 2HKXA 3SFZA 4A3GJ 2COMA 3ABMH 1TWFJ 1Z05A 2NNYA 2E34A 2B9SA 4LIUA 1QNTA 3I9V2 4L5EA 2PMZN 2W85A 4IF4A 1YTYA 4D7MA 4Q48A 2VT2A 5F0CA 1X3UA 2Y9ZA 5BNGA 3MKLA 1HW1A 3HOVJ 3I0TA 5FLVA 3CJQB 4CDGA 5C3EJ 1D1BA 4IEJA 1KU3A 2A61A 2GXAA 3F6VA 3OY9A 3DKYA 3TW7A 3GVAA 4A3IJ 1FOXA 4D1QA 2DFFA 5B66C 3DBLB 3ESWB 4XRMA 1S72I 4I98B 5K1YA 2HDDA 1OKRA 5F27A 5IT9Z 2JUGA 1IN6A 4HYEA 2F5CA 4LD5A 2Y2ZA 3BTCA 4P9FA 2BY1A 4A6EA 3D5RC 4QWQA 4MHGA 2YPRA 5E1ZB 2E71A 3V4GA 4OIOF 3C7JA 2M45A 4XN0A 4BQQA 4BDZA 5BQTA 2VOPA 1UHSA 4RB1A 5IP7J 2R7UA 2WAQN 3M07A 2KJBA 5A2QK 1HQCA 4ZTJA 2CW8A 2MW8A 1OISA 2JWTA 1ZLKA 2ELHA 2FRHA 3CCRI 4RLQA 2GIVA 2LF7A 4IQ4A 2CW7A 2HTSA 4XRFA 1BIBA 5K5QA 4II2A 1TBXA 2O5RA 3I5UA 5EEHA 2VLAA 1GXPA 1OYYA 1XCBA 3CDHA 3BCAA 3KZZA 2KDZA 1TWAJ 2L3DA 3T1BA 5JHFA 5B1BH 4HF1A 2F4OB 4XKBA 1BN5A 1KU2A 3WTYC 1B72B 3DEEA 3EETA 3GYHX 3IRRA 3W2WA 1ZGJA 5HNFA 4GCVA 4QPOA 3SYTA 4LG0B 1Y1VJ 4D7NA 4KT5C 5EEGA 1ZAOA 3E1SA 2XHKA 1G2HA 4JX5A 5L3DA 3BG7A 3K1NA 1J59A 4WXCA 3FMRA 4JYKA 1HDPA 3UR3C 3CJNA 1YLFA 2W84A 2X6YA 1X1PA 1D3YA 3ONQA 2KPMA 3HXLA 4JBAA 1HDDC 1M1EB 2QQAA 3CJTB 2YSRA 5JI6A 1D0ZA 3H9GA 3BR0A 3FWEA 2ZXHA 3BTLA 1JGGA 4A69C 4KNYA 1S9HA 1XDUA 4DYQA 2PJRB 3DEWA 2OA4A 2W25A 3WGGA 4IHSA 5BMZA 4OU0A 2BBYA 1IW7F 2DA4A 2DMTA 3OSGA 4KMUX 2QQ8A 3QP6A 2QQBA 2E2IJ 2VONA 2WY8Q 4KN4X 5FFZA 2V7FA 2YS9A 2X1DA 2RKHA 4CYCA 2IS2A 3BJOA 3BZ6A 2LVSA 1QZYA 2ZXJA 4A0YA 1JXSA 2QKMB 3HGYA 4XONA 1FY7A 3FMSA 2R7SA 3FZVA 2IP2A 4AVPA 3KYLA 4DGWB 3SEZA 3AG3H 2WB1N 2ZMEA 2IGOA 2W48A 1D5VA 3M7GA 2XASA 4CZZA 2L4AA 1T0FC 3PFYA 3GTJJ 4BJ5C 1W5SA 3I59A 4HA8A 1LEBA 5E20A 3S1QJ 1YW8A 2L5QA 2VOOA 3LSIA 2R7RA 1A36A 4F7ZA 1R71A 3PO3J 3ZMZA 4EJOA 4KT6A 1ETVA 3EUHC 4IJAA 2OZ6A 3LA2A 2QWWA 4BKXA 4AVZA 1YG2A 3F3XA 2P5VA 1HF0A 3R61A 1IC8A 2VBZA 4ABZA 2DA7A 3ZP5A 2VL8A 3W3CA 4IRHA 4BE0A 1OR7C 5TISC 4M73A 1S7AA 5LLQA 5DUIA 2E1MC 2ICWG 1VQPI 2HTJA 1QZZA 2DN0A 2O3FA 1ZLJA 1WI3A 4X6AJ 5ILSA 3FK7A 1BOBA 3C1DA 5GADJ 2O61A 1MH4A 5DD4A 5GAEJ 3WU1B 4EJTA 3E6BA 2B63J 2XRLA 1FBQA 1PUEE 5J1RA 4ENNA 3BCBA 3KP2A 3L09A 2R0QC 2EK5A 3OOPA 4BXXJ 1P92A 2FQ4A 4GYIA 3HOUJ 4HSTA 4RBOA 2DDBA 2DJNA 5DEQA 2XPWA 5E3NA 5JR3A 3SFIA 1J0RA 3F8MA 1GUUA 3K4JA 1TP4A 3G3ZA 3OS0A 1SFXA 1DP7P 1OCRH 5EJCA 3CCQI 2VBXA 3LAPA 4UV9A 1S3JA 3I54A 4NC7A 5J40A 2B0LA 3H35A 3QYEA 5KAIC 3QU3A 4IOCF 4BE1A 1IO2A 1U78A 1UZCA 3PNVA 4PZJA 4F55A 3CO7C 2RAEA 1FPQA 3OYEA 5DTDA 5DCMA 4DNCA 4AIKA 1G3YA 1I3AA 1K79A 2DI3A 3BROA 3H3VK 4BJTA 1TL8A 3OS1A 1MBGA 4P5OA 1UHMA 4YEJA 1YFHA 3K69A 2V1NA 1W5CC 2F48A 2I8DA 4M3EA 4KYWA 3MMYB 3J7AY 1USSA 4UVAA 4QSHA 5D5WB 2RDPA 3ZMUA 4CYCB 2XKPA 2PBIA 3S2HJ 4LG3A 3K2ZA 3TO7A 3ERED 2O7OA 3FXOA 1LFUP 1WH7A 2IPQX 5D5UB 1EH8A 3T5XA 3OYDA 3MD2A 1TC3C 4UUTA 1USTA 1F4KA 3LAJA 5HDGA 4J01A 2ZMEB 3TO6A 4G12A 1YI2I 5AONA 1YJNI 1N78A 3CMMA 5H20A 2OQRA 2PEXA 2OZUA 4A12A 1TWHJ 2QF7A 4UB6C 2V6EA 4HOBA 2UZKA 2IGNA 3I59B 3EPZA 3KE2A 5LBQA 3GBGA 5F6FA 4S0HB 5CQEA 4DBQA 3CCLI 2DT7B 4MIMA 5LRSA 1J75A 4XLFA 2GXBA 3V7CA 3CF5F 1FLIA 5HODA 2VUMJ 1X1BA 1LPQA 1HBXG 1FC3A 1WJDA 3B73A 3FBNB 2QBYA 4IL6C 5IP9J 3DCFA 4D5FA 5C4XJ 5JVTA 1S7EA 1IN5A 2MBFA 1FOKA 2MGQA 2QYOA 3NWTA 2CQXA 1HLVA 1K6YA 5K7HA 1YHQI 4QPQA 3VSKA 3JRCA 2BV6A 4L5IA 4XL9A 4BGDA 2DMNA 3JRHA 1MNMC 2XC7A 1QVUA 4XN3A 2HQRA 3I71A 3RPQA 3DFGA 1FNNA 3S3OA 4PFPA 2L0KA 5CVUA 2XGCA 2L2OA 3SQNA 3VPRA 2HDWA 4C3IJ 3K9TA 3OIOA 5E8IA 1WJCA 2FUG2 3KP3A 5J47A 3BTJA 1VQNI 1UELB 1Q1VA 3KZYA 5GAGJ 2FEZA 1ETXA 3G1MA 4K2EA 2XAJA 3ZGKA 3ROUA 1IZ1A 3UKGA 1LDKB 1BI0A 2Z5UA 3ZN1A 1VQ8I 4B3XA 1IV8A 4ITVA 3DPUA 3P5JA 2BVMA 2HOSA 4IHVA 3KEYA 2NRAC 2HVSA 2HNHA 4Y4RA 5FJ8J 3RI4A 1ZYRF 3V8KA 1U0JA 3PIPF 4CHUA 3H3UA 3CD6I 1FT9A 2MABA 1CQTA 1ULYA 4KN7X 2XROA 5BOXA 1FTZA 3F6OA 3F21A 1ERDA 2HYJA 3CLQA 1U5TA 2P6TA 2ZNYA 3T8TA 4OOIA 3P9CA 2FOWA 1PYVA 2K7LA 2A07F 2ID6A 2F6CA 1IN8A 2EQRA 1D8KA 2KRCA
chains in the Genus database with same CATH topology
1PP7U 3WG9A 1Z9CA 1U3EM 2Z3YA 3GFIA 2VODA 3GF2A 4ETSA 4D0PA 3EYIA 2EA2A 1O3QA 1KU9A 2JRTA 4UVBA 3WU0A 2CYYA 1SFUA 4UUVA 4YG2F 3W6JB 2XVCA 3IHUA 4QLCU 1R5GA 2KIUA 5FD5A 1R7JA 3WTWC 2X4HA 4U0VA 4MQ9F 3BDDA 2V6CA 4M74A 1U2WA 2HYFA 4Y13A 3DV8A 2CQKA 2DTRA 3DPLC 3KEOA 3T8RA 4OIPF 3DEUA 4EM0B 2K27A 1EV7A 2MH9A 2LSOA 5KVRA 1ON2A 3WTZA 1V3FA 2QBYB 4KFCA 3DXJF 3J80K 1RNLA 4HW0A 3GFLA 1QGPA 4BAYA 5L3CA 2EV6A 2ZCWA 2VXZA 5LHHA 1GVJA 3CO6C 2P8TA 1ZG3A 4EV0A 4WX9A 3FXRA 2ISZA 1HW5A 3PQKA 3ZMVA 1I6XA 3KLOA 4A5NA 1YO5C 4LK1F 3COAC 2R7FA 1Z91A 2OU2A 1W7PA 4OIQF 2RGVA 1JE8A 1G6NA 1EH7A 4IPAA 4CO8A 3I4PA 5FLXK 2JZYA 5LEJA 3J81Z 1WWXA 1U5TB 4FHTA 1JHHA 1XGSA 2A68F 2IRFG 2V1XA 3QAHA 2YU3A 1SD5A 3NQOA 1J9IA 2FQ3A 1QQIA 1CF7B 4KIGA 2O0YA 4ENKA 1H9TA 3WTVC 2UXNA 1F9NA 2PQ8A 1FP1D 4Y17A 4IXAA 4NQWA 2NAZA 3ZPLA 3BPVA 4JK1X 5DUKA 5JFRA 2GA2A 1MKMA 3KP7A 1ONVA 2LNBA 1W4MA 3TKYA 5CYVA 4AIJA 3LFKA 2XV4S 2CW0F 3QRFF 3KFWX 5ED4A 4P55A 4I0BA 3KP4A 2HKOA 2MD5A 4RAYA 1RUOA 4EJWA 2QVOA 3BP8A 3KETA 1R23A 2EV5A 4ESFA 1QBJA 4RS8A 4PDKA 4UXNA 2LDUA 4L18B 3U2RA 3FHZA 4KIBA 3RKXA 3ULQB 1MJ9A 4BQAA 2NS0A 3RJPA 3JTHA 3MWMA 2IA2A 3M1EA 1LDJA 1SFEA 1W7PB 3E6MA 4CICA 3V8LA 1SMYF 2MA3A 4MGRA 3TDUC 1HW2A 2FE3A 2Q2EA 4O6JA 5D6FA 1K78A 1WRJA 2DPDA 3U1DA 3K1PA 4HQMA 2HZTA 5L3BA 2Y0MA 4UHTA 4LJZF 4BYYA 2HWVA 4L9JA 3HSRA 4MEXF 1W7PD 5ILVA 5FB2A 4GYGA 1SD7A 2QQ9A 4Q47A 2Z9OA 3KP6A 3MAJA 2RQPA 2ZJ2A 2DPUA 1TNTA 2FMYA 5L3EA 3HOSA 1CGPA 4ENJA 4S05A 3Q9SA 3L2CA 1ZG1A 1YIOA 4MNUA 4YFKF 3H92A 2HQNA 3B02A 4WF2A 2XAFA 4TV7A 2NYXA 3JAMK 1T98A 2XAGA 4G94A 4HLXA 4WXDA 4AD9A 1C0WA 5HOOA 1B9NA 4I0AA 2JT1A 3CUQA 4XBFA 2P4WA 3J80Z 3PQJA 4WXHA 2MC3A 2YR2A 3M9AA 1LDDA 4XLNF 4KIFA 1ZHFA 5FO5A 4EVIA 5LHGA 4NB5A 3ZMTA 1DPRA 5TRDA 2XKOA 4AWXB 1R1UA 5LGNA 4WK8F 4G7ZF 4E70A 1LNWA 3E3VA 5HDKA 1GXQA 4B09A 4P9UA 1PDNC 2RVCA 2W24A 1K78B 4YIFA 3R0JA 2ISYA 5HLGA 4L9NA 4P96A 2BEOA 3T0YA 5FLXZ 1S8NA 2GXGA 2FA5A 2P6SA 2R3SA 3GFJA 4A2UA 3ABTA 3HSEA 3GXOA 1XB4A 1J5YA 1TTYA 4LMYA 1BOAA 1O3SA 1H9GA 2GQQA 1IXRC 2R7DA 2ESHA 2F5FA 2JPCA 2VC1A 2KRFA 4LLGF 4CYDA 1JGSA 5ICCA 3CUOA 1REPC 3O3KA 1O3RA 4OMZA 2AS5F 1XSDA 2FOKA 4YFNF 4ON0A 1QPMA 5CVRA 3SZTA 2F5EA 3U9GA 1NHAA 2QENA 2JSCA 1FYLA 1RIOH 4XSZF 3IC7A 4ESBA 3CUQB 5HS8A 1GHCA 3WTTC 3HSFA 1BI3A 1SD4A 1R00A 4O5VA 5AIPA 2EFQA 3BJAA 5K5OA 5TJJA 1ZRFA 2XRNA 3W6KB 2FNAA 1BC8C 3O6BB 1IUYA 2G9WA 4A0XA 2RV8A 3G73A 4G7OF 3RYPA 4ZYGA 3RTRA 1IXSB 2ESNA 4M9XA 2HS5A 3RYRA 5DCFA 3F8BA 1HKTA 1YQAA 1B4AA 2H6BA 1ZN2A 4HX4A 2EFWA 3V8JA 1KA8A 1KYZA 3P9KA 4AIHA 3WTXC 2KKOA 1K6OA 1FBUA 2MLGA 5K5RA 2FF4A 2P5KA 4ZZLA 4L5JA 2L02A 2E1CA 4HLYA 1F5TA 4KA4A 5HS7A 3GWZA 3M8EA 3GZ5A 3ABUA 2EFOA 3VODA 5A2QZ 2CFXA 4HV6A 1AWCA 2Y48A 4ENMA 3VFZA 3WTSC 2FBHA 2ZBKA 4RAZA 5ICEA 2J5PA 1Z6TA 3JAMZ 2WV0A 5L3FA 4ZYEA 3TDZC 2RC4A 1Y0UA 4GXOA 1U8RA 5DCMB 2F5DA 2HR3A 3ELKA 3WE3A 1SD6A 4BHBA 2PI0A 4ZYDA 1YW9A 4L9VA 3FF5A 5D4SA 4N9IA 1MGTA 2DLLA 2UWMA 2MH2A 3QPTA 4N9HA 2KIMA 2VBYA 1SMTA 3LQQA 2FMLA 4H0EA 2WTEA 1I27A 2QLZA 4CGZA 4HBLA 2EV0A 1ZH5A 2J5OA 4EQQA 2E1NA 1BC7C 3SHFA 3VB2A 1SAXA 1R22A 4IRIA 3F8FA 2WC2A 1B1BA 2HDCA 2A6HF 3F72A 3ZQ7A 2EFNA 3ZMSA 4OIRF 5HDNA 4Q5SF 2VE8A 1G3SA 4O3MA 3TOBA 4HDVA 3E97A 2PMHA 1XDSA 1Z6RA 1KGSA 4KICA 3MQ0A 1HSTA 1H0MA 3ZN0A 2CWEA 1YS6A 5CVJA 4I01A 3WODF 2XAHA 2FU4A 4Y15A 5CLSA 1RZ4A 3HHHA 2Y75A 5ERIA 3IKVA 1I1GA 1BI1A 1V4RA 4GO1A 4DQ2A 5HVQC 1VTNC 4UNOA 5J8FA 5CVIA 3DF8A 4RB2C 2O6GE 4HF2A 3IRQA 1KQ9A 1TQPA 4M6YA 5F1RA 3NEUA 3VOEA 2A5YB 1E17A 1S7OA 3HIFA 2AXLA 2ACJA 5BPDA 3JSPA 4A0ZA 1KYWA 4M9ZA 2DK8A 3MFKA 1XGNA 4YIIA 4KDPA 4ESJA 2BGCA 2GAUA 3HUGA 1P6RA 3LA7A 3J7AO 3M8FA 3MZHA 2F2EA 2PFBA 1U5TC 2QM3A 3BPXA 2ADUA 3JTGA 2ZFWA 5J6XA 1ON1A 4UVCA 5CJ9A 3H3ZA 1FP2A 2G7HA 2FBKA 1T2KA 5BPIA 3RKYA 1IXCA 4OINF 4ZH4F 4U7DA 3FMQA 2GZWA 3E6DA 2FNPA 1T0FA 1WKMA 3QPHA 4R79A 3EUHA 4BH9A 3BOQA 4Z2YA 3ZMDA 2CO5A 4R8HA 4RB0A 1XD7A 2IA0A 4Q4ZF 4BHCA 2DW4A 4M71A 1ODDA 1OR7A 3IWFA 4IVNA 6PAXA 1XGMA 1HXDA 2K4JA 3WGIA 3RPUA 1XMKA 4ZZDA 5E1XA 1B6AA 2CGPA 1I5ZA 1IN7A 1KU7A 2Q0OA 5FD6A 1LQ1A 3Q9VA 3R6SA 3CTAA 4XLPF 4G6DA 4RB3C 3ML6A 1KQ0A 1S6LA 2CSOA 1MD0A 5CVVA 1R58A 3V7SA 1ZARA 1TLHB 2OBPA 4MQVA 3MEXA 1IF1A 2VBWA 2K02A 2L4MA 2XAQA 1L3LA 4JQFA 2NNNA 2KIFA 2D2WA 5LGTA 1XGOA 2VC0A 2ZKZA 1WSUA 1O57A 3GLXA 1ZRCA 5D5XB 1W5TA 1RI7A 2STWA 2H27A 2DO7A 2HYGD 4M9SA 4M6XA 2X0LA 4G6QA 1UCRA 2DFIA 3V7RA 4I2OA 5HS9A 5D8LB 3LQRA 2QUFA 2W57A 1IN4A 2ZNZA 1FWZA 3DKWA 3FXQA 2WWYA 4M72A 3N4MA 1YW7A 4WWCA 1YYVA 5BS6A 1WI9A 3EQLF 1BIAA 1ZGAA 1DDNA 1D8JA 3HOTA 2EJRA 3IL2A 4BHPA 1HSJA 4LLLA 3DPTA 2IW5A 3VEPA 3P7NA 4LGWA 2VE9A 4A5MA 4FX0A 5D6EA 3WGHA 3C18A 5ILUA 1LJ9A 3GX4X 4GGGA 4R1HA 2DAOA 3F22A 1UHWA 2HFHA 5KK1A 3QP5A 3HTSB 3LWFA 1KQ8A 3ISPA 4N0BA 3F8NA 2EA4A 3FM3A 5DV5A 3NRVA 5LHIA 4LB6B 4EGZA 1ZRDA 2P5LC 3C3WA 3E5XA 3RIRA 1P4XA 2EB7A 5HLIA 1TQIA 2FBIA 3HRUA 1R1TA 2D1VA 1A04A 3R4KA 1P4WA 1T6SA 2ZO4A 4L0ZB 1FYMA 2XUBA 2PG4A 3O2PE 1DPUA 1L0OC 1MZBA 3N97A 3F23A 3SXYA 1J2XA 5J8CA 4UV8A 1G3TA 3RDIA 3KLNA 3J81K 4LB5A 1BBYA 1G3WA 3R60A 4HDUA 2MLKA 2PN6A 3JSOA 4YFXF 1DUXC 2L54A 3EDPA 3SZPA 4PGGA 2HEOA 1T39A 2E7XA 1P4AA 4HF0A 4MEYF 2IA1A 4EJVA 4S04A 4EJUA 4U0WA 5LGUA 1R5HA 3S2WA 1XMAA 2QZ8A 1OYIA 1BJAA 1B9MA 2JPBA 3CUQC 1TNSA 2YX4A 2G7UA 3PFIA 1IAWA 2PMUA 3WTUC 1XSXA 3GEZA 1MDMA 2K86A 5H6QA 5D4RA 4A6DA 3WE2A 1XSVA 3L00A 4KUMA 1FYKA 1PP8F 3HRSA 1R36A 2XGXA 2IVMA 1Z7UA 4BXUA 2P7CB 2EWNA 2YX7A 4KMFA 4EM1A 4XSXF 3I58A 5IT3A 4LFUA 2XIGA 1ZG5A 4FT8A 2DBBA 2CG4A 1OYWA 3DQVC 3R0AA 1K7AA 2GWRA 2K4BA 2UXXA 4RGRA 2M8EA 2OAZA 2DK5A 2JTVA 3ECHA 3FXUA 4B8XA 5L3GA 1XN7A 2H09A 2OD5A 5DDGA 1T38A 3MZYA 4RGSA 1FX7A 2HOEA 2M5WA 1STZA 2O03A 3BJ6A 5ICFA 2ETHA 1RUNA 3KP5A 2V1DA 1JHFA 2A3SA 1I1SA 2BYVE 1MJAA 5D8KB 3DP7A 5IT9K 3FX3A 5LEKA 2OQGA 4MTEA 1UB9A 5E18F 4L9TA 5F64A 4G7HF 3K1MA 2Q8KA 3JW4A 2HGCA 1BI2A 2P7VB 3I53A 4HZFA 5D5VB 4BNCA 1CF7A 2V1UA 3QU6A 4LK0F 3TGNA 4HQEA 3LSTA 3AAFA 1MDMB 3ECOA 4I7HA 4LLNA 2V79A 3HTUA 1TW3A 5LRRA 2IT0A 3TOAA 1TW2A 3KCCA 1QO0D 1O7FA 4U0YA 2L01A 3BWGA 2DT5A 1LVAA 3L9FA 1Z1DA 3FM5A 2KJCA 3P9IA 3HHGA 2RNJA 3IWZA 2DQLA 3Q5FA 2TDXA 3GZ6A 4EMSA 2A6EF 4HAMA 3QOPA 3LA3A 2GA1A 5FGMA 2M30A 3F8CA 1FSEA 3HRMA 4HX7A 4ASNA 1IRGA 4NHJA 1S29A 4EM2A 3D0SA 1P2FA 3E6CC 4L0YB 5HLHA 2EFPA 1ZREA 4I02A 1Q1HA 4FX4A 2M87A 2D1HA 2DQRA 3MCZA 2FXAA 2H6CA 1O7LA 4HX8A 1EH6A 1LEAA 1OPCA 4PGHA 3GW2A 4IHTA 1AOYA 1HKQA 2PJPA 3K0LA 2STTA 4EGYA 1YS7A 3OV8A 4U88A 2A69F 1J7KA 2RN7A 2Z33A 3KEQA 3L7WA 3E5UA 5E1WA 1FZPB 1BM9A 1UFMA 2FSWA 3GO5A 1U6GA 2VT3A 2H94A 4WCGA 1O3TA 5AIQA 2LKPA 2IJLA 1E2XA 3D5LA 1LB2A 4IRGA 3TO9A 2V9VA 1MJBA 2Z99A 1XCVA 2O8XA 4ZYHA 4U7BA 3CLOA 1F1ZA 3GFMA 3GUDA 2D45A 1B59A 5JHUA 3HRTA 4LG0A 1FBSA 1OMIA 2M1BA 1IRFA 1R1VA 3E5QA 4OMYA 4RGXA 3REOA 1TQMA 5FFXA 2DU9A 5DYMA 4CXFA 1HKSA 2LF8A 2BE5F 4HV5A 4I09A 2E7WA 3HYIA 2PLYA 4RGUA 5H6RA 4G9YA 4PCQA 3BY6A 3IKTA 3I64A 3RKWA 4MTDA 5E17F 1WQ2A 5E8GA 2VN2A 1FSHA 1G4DA 3TQNA 3EYYA 5ICGA 5DD8A 2C6YA 4G8XA 2HKXA 3SFZA 2COMA 1Z05A 2NNYA 1QNTA 4IF4A 2W85A 1YTYA 4Q48A 2VT2A 1X3UA 1HW1A 3I0TA 4CDGA 1KU3A 2A61A 3F6VA 3GVAA 4I98B 5K1YA 1OKRA 5IT9Z 1IN6A 4HYEA 2F5CA 4LD5A 4P9FA 4A6EA 4QWQA 4MHGA 2YPRA 5E1ZB 3V4GA 4OIOF 3C7JA 2M45A 5BQTA 2VOPA 4RB1A 2KJBA 5A2QK 1HQCA 1ZLKA 2ELHA 2FRHA 2GIVA 2LF7A 2HTSA 4XRFA 1BIBA 5K5QA 1TBXA 3I5UA 5EEHA 1GXPA 1OYYA 1XCBA 3CDHA 3KZZA 3T1BA 2L3DA 4HF1A 1BN5A 1KU2A 3WTYC 3EETA 3GYHX 3IRRA 1ZGJA 4GCVA 4LG0B 4KT5C 5EEGA 1ZAOA 2XHKA 5L3DA 3K1NA 1J59A 4WXCA 3FMRA 3CJNA 1YLFA 2W84A 1D3YA 4JBAA 2QQAA 2YSRA 5JI6A 3FWEA 4KNYA 1XDUA 2OA4A 2W25A 3WGGA 4IHSA 5BMZA 4OU0A 2BBYA 1IW7F 4KMUX 3QP6A 2QQBA 2VONA 4KN4X 5FFZA 2RKHA 3BJOA 3BZ6A 1QZYA 2ZXJA 4A0YA 1JXSA 1FY7A 3FMSA 3FZVA 2IP2A 4AVPA 2ZMEA 1D5VA 3M7GA 2XASA 4CZZA 2L4AA 1W5SA 3I59A 4HA8A 1LEBA 5E20A 1YW8A 2VOOA 4F7ZA 3ZMZA 4EJOA 4IJAA 2OZ6A 3LA2A 2QWWA 1YG2A 3F3XA 2P5VA 3R61A 2VBZA 3ZP5A 4IRHA 4M73A 1S7AA 5LLQA 5DUIA 2HTJA 1QZZA 2O3FA 1ZLJA 5ILSA 3C1DA 2O61A 5DD4A 3WU1B 4EJTA 3E6BA 1FBQA 1PUEE 4ENNA 3KP2A 3L09A 2EK5A 3OOPA 1P92A 4GYIA 5DEQA 5JR3A 1J0RA 3F8MA 3G3ZA 1SFXA 1DP7P 2VBXA 3LAPA 4UV9A 1S3JA 3I54A 2B0LA 3QU3A 1U78A 4PZJA 3CO7C 1FPQA 4DNCA 5DCMA 4AIKA 1G3YA 1K79A 2DI3A 3BROA 4P5OA 1UHMA 1YFHA 3K69A 4KYWA 1USSA 4UVAA 5D5WB 2RDPA 3ZMUA 2XKPA 2PBIA 3K2ZA 3TO7A 3ERED 2IPQX 5D5UB 1EH8A 3T5XA 1USTA 1F4KA 3LAJA 5HDGA 2ZMEB 3TO6A 5AONA 5H20A 2OQRA 2PEXA 2OZUA 4A12A 4HOBA 2UZKA 3I59B 3KE2A 5LBQA 5F6FA 5LRSA 1J75A 2GXBA 3V7CA 1FLIA 1HBXG 1FC3A 3B73A 2QBYA 5JVTA 1IN5A 2MBFA 1FOKA 2QYOA 2BV6A 4L5IA 2HQRA 3I71A 3RPQA 3DFGA 1FNNA 5CVUA 3SQNA 3K9TA 5E8IA 3KP3A 3KZYA 2FEZA 4K2EA 2XAJA 3ROUA 1IZ1A 3ZN1A 1LDKB 1BI0A 2Z5UA 2NRAC 3RI4A 1ZYRF 3V8KA 4CHUA 3H3UA 1FT9A 1ULYA 4KN7X 2XROA 5BOXA 3F6OA 3F21A 1U5TA 2P6TA 2ZNYA 3T8TA 4OOIA 3P9CA 2A07F 2K7LA 1IN8A 1D8KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PP7 U;  3WG9 A;  1Z9C A;  1U3E M;  2Z3Y A;  3GFI A;  2VOD A;  3GF2 A;  4ETS A;  4D0P A;  3EYI A;  2EA2 A;  1O3Q A;  1KU9 A;  2JRT A;  4UVB A;  3WU0 A;  2CYY A;  1SFU A;  4UUV A;  4YG2 F;  3W6J B;  2XVC A;  3IHU A;  4QLC U;  1R5G A;  2KIU A;  5FD5 A;  1R7J A;  3WTW C;  2X4H A;  4U0V A;  4MQ9 F;  3BDD A;  2V6C A;  4M74 A;  1U2W A;  2HYF A;  4Y13 A;  3DV8 A;  2CQK A;  2DTR A;  3DPL C;  3KEO A;  3T8R A;  4OIP F;  3DEU A;  4EM0 B;  2K27 A;  1EV7 A;  2MH9 A;  2LSO A;  5KVR A;  1ON2 A;  3WTZ A;  1V3F A;  2QBY B;  4KFC A;  3DXJ F;  3J80 K;  1RNL A;  4HW0 A;  3GFL A;  1QGP A;  4BAY A;  5L3C A;  2EV6 A;  2ZCW A;  2VXZ A;  5LHH A;  1GVJ A;  3CO6 C;  2P8T A;  1ZG3 A;  4EV0 A;  4WX9 A;  3FXR A;  2ISZ A;  1HW5 A;  3PQK A;  3ZMV A;  1I6X A;  3KLO A;  4A5N A;  1YO5 C;  4LK1 F;  3COA C;  2R7F A;  1Z91 A;  2OU2 A;  1W7P A;  4OIQ F;  2RGV A;  1JE8 A;  1G6N A;  1EH7 A;  4IPA A;  4CO8 A;  3I4P A;  5FLX K;  2JZY A;  5LEJ A;  3J81 Z;  1WWX A;  1U5T B;  4FHT A;  1JHH A;  1XGS A;  2A68 F;  2IRF G;  2V1X A;  3QAH A;  2YU3 A;  1SD5 A;  3NQO A;  1J9I A;  2FQ3 A;  1QQI A;  1CF7 B;  4KIG A;  2O0Y A;  4ENK A;  1H9T A;  3WTV C;  2UXN A;  1F9N A;  2PQ8 A;  1FP1 D;  4Y17 A;  4IXA A;  4NQW A;  2NAZ A;  3ZPL A;  3BPV A;  4JK1 X;  5DUK A;  5JFR A;  2GA2 A;  1MKM A;  3KP7 A;  1ONV A;  2LNB A;  1W4M A;  3TKY A;  5CYV A;  4AIJ A;  3LFK A;  2XV4 S;  2CW0 F;  3QRF F;  3KFW X;  5ED4 A;  4P55 A;  4I0B A;  3KP4 A;  2HKO A;  2MD5 A;  4RAY A;  1RUO A;  4EJW A;  2QVO A;  3BP8 A;  3KET A;  1R23 A;  2EV5 A;  4ESF A;  1QBJ A;  4RS8 A;  4PDK A;  4UXN A;  2LDU A;  4L18 B;  3U2R A;  3FHZ A;  4KIB A;  3RKX A;  3ULQ B;  1MJ9 A;  4BQA A;  2NS0 A;  3RJP A;  3JTH A;  3MWM A;  2IA2 A;  3M1E A;  1LDJ A;  1SFE A;  1W7P B;  3E6M A;  4CIC A;  3V8L A;  1SMY F;  2MA3 A;  4MGR A;  3TDU C;  1HW2 A;  2FE3 A;  2Q2E A;  4O6J A;  5D6F A;  1K78 A;  1WRJ A;  2DPD A;  3U1D A;  3K1P A;  4HQM A;  2HZT A;  5L3B A;  2Y0M A;  4UHT A;  4LJZ F;  4BYY A;  2HWV A;  4L9J A;  3HSR A;  4MEX F;  1W7P D;  5ILV A;  5FB2 A;  4GYG A;  1SD7 A;  2QQ9 A;  4Q47 A;  2Z9O A;  3KP6 A;  3MAJ A;  2RQP A;  2ZJ2 A;  2DPU A;  1TNT A;  2FMY A;  5L3E A;  3HOS A;  1CGP A;  4ENJ A;  4S05 A;  3Q9S A;  3L2C A;  1ZG1 A;  1YIO A;  4MNU A;  4YFK F;  3H92 A;  2HQN A;  3B02 A;  4WF2 A;  2XAF A;  4TV7 A;  2NYX A;  3JAM K;  1T98 A;  2XAG A;  4G94 A;  4HLX A;  4WXD A;  4AD9 A;  1C0W A;  5HOO A;  1B9N A;  4I0A A;  2JT1 A;  3CUQ A;  4XBF A;  2P4W A;  3J80 Z;  3PQJ A;  4WXH A;  2MC3 A;  2YR2 A;  3M9A A;  1LDD A;  4XLN F;  4KIF A;  1ZHF A;  5FO5 A;  4EVI A;  5LHG A;  4NB5 A;  3ZMT A;  1DPR A;  5TRD A;  2XKO A;  4AWX B;  1R1U A;  5LGN A;  4WK8 F;  4G7Z F;  4E70 A;  1LNW A;  3E3V A;  5HDK A;  1GXQ A;  4B09 A;  4P9U A;  1PDN C;  2RVC A;  2W24 A;  1K78 B;  4YIF A;  3R0J A;  2ISY A;  5HLG A;  4L9N A;  4P96 A;  2BEO A;  3T0Y A;  5FLX Z;  1S8N A;  2GXG A;  2FA5 A;  2P6S A;  2R3S A;  3GFJ A;  4A2U A;  3ABT A;  3HSE A;  3GXO A;  1XB4 A;  1J5Y A;  1TTY A;  4LMY A;  1BOA A;  1O3S A;  1H9G A;  2GQQ A;  1IXR C;  2R7D A;  2ESH A;  2F5F A;  2JPC A;  2VC1 A;  2KRF A;  4LLG F;  4CYD A;  1JGS A;  5ICC A;  3CUO A;  1REP C;  3O3K A;  1O3R A;  4OMZ A;  2AS5 F;  1XSD A;  2FOK A;  4YFN F;  4ON0 A;  1QPM A;  5CVR A;  3SZT A;  2F5E A;  3U9G A;  1NHA A;  2QEN A;  2JSC A;  1FYL A;  1RIO H;  4XSZ F;  3IC7 A;  4ESB A;  3CUQ B;  5HS8 A;  1GHC A;  3WTT C;  3HSF A;  1BI3 A;  1SD4 A;  1R00 A;  4O5V A;  5AIP A;  2EFQ A;  3BJA A;  5K5O A;  5TJJ A;  1ZRF A;  2XRN A;  3W6K B;  2FNA A;  1BC8 C;  3O6B B;  1IUY A;  2G9W A;  4A0X A;  2RV8 A;  3G73 A;  4G7O F;  3RYP A;  4ZYG A;  3RTR A;  1IXS B;  2ESN A;  4M9X A;  2HS5 A;  3RYR A;  5DCF A;  3F8B A;  1HKT A;  1YQA A;  1B4A A;  2H6B A;  1ZN2 A;  4HX4 A;  2EFW A;  3V8J A;  1KA8 A;  1KYZ A;  3P9K A;  4AIH A;  3WTX C;  2KKO A;  1K6O A;  1FBU A;  2MLG A;  5K5R A;  2FF4 A;  2P5K A;  4ZZL A;  4L5J A;  2L02 A;  2E1C A;  4HLY A;  1F5T A;  4KA4 A;  5HS7 A;  3GWZ A;  3M8E A;  3GZ5 A;  3ABU A;  2EFO A;  3VOD A;  5A2Q Z;  2CFX A;  4HV6 A;  1AWC A;  2Y48 A;  4ENM A;  3VFZ A;  3WTS C;  2FBH A;  2ZBK A;  4RAZ A;  5ICE A;  2J5P A;  1Z6T A;  3JAM Z;  2WV0 A;  5L3F A;  4ZYE A;  3TDZ C;  2RC4 A;  1Y0U A;  4GXO A;  1U8R A;  5DCM B;  2F5D A;  2HR3 A;  3ELK A;  3WE3 A;  1SD6 A;  4BHB A;  2PI0 A;  4ZYD A;  1YW9 A;  4L9V A;  3FF5 A;  5D4S A;  4N9I A;  1MGT A;  2DLL A;  2UWM A;  2MH2 A;  3QPT A;  4N9H A;  2KIM A;  2VBY A;  1SMT A;  3LQQ A;  2FML A;  4H0E A;  2WTE A;  1I27 A;  2QLZ A;  4CGZ A;  4HBL A;  2EV0 A;  1ZH5 A;  2J5O A;  4EQQ A;  2E1N A;  1BC7 C;  3SHF A;  3VB2 A;  1SAX A;  1R22 A;  4IRI A;  3F8F A;  2WC2 A;  1B1B A;  2HDC A;  2A6H F;  3F72 A;  3ZQ7 A;  2EFN A;  3ZMS A;  4OIR F;  5HDN A;  4Q5S F;  2VE8 A;  1G3S A;  4O3M A;  3TOB A;  4HDV A;  3E97 A;  2PMH A;  1XDS A;  1Z6R A;  1KGS A;  4KIC A;  3MQ0 A;  1HST A;  1H0M A;  3ZN0 A;  2CWE A;  1YS6 A;  5CVJ A;  4I01 A;  3WOD F;  2XAH A;  2FU4 A;  4Y15 A;  5CLS A;  1RZ4 A;  3HHH A;  2Y75 A;  5ERI A;  3IKV A;  1I1G A;  1BI1 A;  1V4R A;  4GO1 A;  4DQ2 A;  5HVQ C;  1VTN C;  4UNO A;  5J8F A;  5CVI A;  3DF8 A;  4RB2 C;  2O6G E;  4HF2 A;  3IRQ A;  1KQ9 A;  1TQP A;  4M6Y A;  5F1R A;  3NEU A;  3VOE A;  2A5Y B;  1E17 A;  1S7O A;  3HIF A;  2AXL A;  2ACJ A;  5BPD A;  3JSP A;  4A0Z A;  1KYW A;  4M9Z A;  2DK8 A;  3MFK A;  1XGN A;  4YII A;  4KDP A;  4ESJ A;  2BGC A;  2GAU A;  3HUG A;  1P6R A;  3LA7 A;  3J7A O;  3M8F A;  3MZH A;  2F2E A;  2PFB A;  1U5T C;  2QM3 A;  3BPX A;  2ADU A;  3JTG A;  2ZFW A;  5J6X A;  1ON1 A;  4UVC A;  5CJ9 A;  3H3Z A;  1FP2 A;  2G7H A;  2FBK A;  1T2K A;  5BPI A;  3RKY A;  1IXC A;  4OIN F;  4ZH4 F;  4U7D A;  3FMQ A;  2GZW A;  3E6D A;  2FNP A;  1T0F A;  1WKM A;  3QPH A;  4R79 A;  3EUH A;  4BH9 A;  3BOQ A;  4Z2Y A;  3ZMD A;  2CO5 A;  4R8H A;  4RB0 A;  1XD7 A;  2IA0 A;  4Q4Z F;  4BHC A;  2DW4 A;  4M71 A;  1ODD A;  1OR7 A;  3IWF A;  4IVN A;  6PAX A;  1XGM A;  1HXD A;  2K4J A;  3WGI A;  3RPU A;  1XMK A;  4ZZD A;  5E1X A;  1B6A A;  2CGP A;  1I5Z A;  1IN7 A;  1KU7 A;  2Q0O A;  5FD6 A;  1LQ1 A;  3Q9V A;  3R6S A;  3CTA A;  4XLP F;  4G6D A;  4RB3 C;  3ML6 A;  1KQ0 A;  1S6L A;  2CSO A;  1MD0 A;  5CVV A;  1R58 A;  3V7S A;  1ZAR A;  1TLH B;  2OBP A;  4MQV A;  3MEX A;  1IF1 A;  2VBW A;  2K02 A;  2L4M A;  2XAQ A;  1L3L A;  4JQF A;  2NNN A;  2KIF A;  2D2W A;  5LGT A;  1XGO A;  2VC0 A;  2ZKZ A;  1WSU A;  1O57 A;  3GLX A;  1ZRC A;  5D5X B;  1W5T A;  1RI7 A;  2STW A;  2H27 A;  2DO7 A;  2HYG D;  4M9S A;  4M6X A;  2X0L A;  4G6Q A;  1UCR A;  2DFI A;  3V7R A;  4I2O A;  5HS9 A;  5D8L B;  3LQR A;  2QUF A;  2W57 A;  1IN4 A;  2ZNZ A;  1FWZ A;  3DKW A;  3FXQ A;  2WWY A;  4M72 A;  3N4M A;  1YW7 A;  4WWC A;  1YYV A;  5BS6 A;  1WI9 A;  3EQL F;  1BIA A;  1ZGA A;  1DDN A;  1D8J A;  3HOT A;  2EJR A;  3IL2 A;  4BHP A;  1HSJ A;  4LLL A;  3DPT A;  2IW5 A;  3VEP A;  3P7N A;  4LGW A;  2VE9 A;  4A5M A;  4FX0 A;  5D6E A;  3WGH A;  3C18 A;  5ILU A;  1LJ9 A;  3GX4 X;  4GGG A;  4R1H A;  2DAO A;  3F22 A;  1UHW A;  2HFH A;  5KK1 A;  3QP5 A;  3HTS B;  3LWF A;  1KQ8 A;  3ISP A;  4N0B A;  3F8N A;  2EA4 A;  3FM3 A;  5DV5 A;  3NRV A;  5LHI A;  4LB6 B;  4EGZ A;  1ZRD A;  2P5L C;  3C3W A;  3E5X A;  3RIR A;  1P4X A;  2EB7 A;  5HLI A;  1TQI A;  2FBI A;  3HRU A;  1R1T A;  2D1V A;  1A04 A;  3R4K A;  1P4W A;  1T6S A;  2ZO4 A;  4L0Z B;  1FYM A;  2XUB A;  2PG4 A;  3O2P E;  1DPU A;  1L0O C;  1MZB A;  3N97 A;  3F23 A;  3SXY A;  1J2X A;  5J8C A;  4UV8 A;  1G3T A;  3RDI A;  3KLN A;  3J81 K;  4LB5 A;  1BBY A;  1G3W A;  3R60 A;  4HDU A;  2MLK A;  2PN6 A;  3JSO A;  4YFX F;  1DUX C;  2L54 A;  3EDP A;  3SZP A;  4PGG A;  2HEO A;  1T39 A;  2E7X A;  1P4A A;  4HF0 A;  4MEY F;  2IA1 A;  4EJV A;  4S04 A;  4EJU A;  4U0W A;  5LGU A;  1R5H A;  3S2W A;  1XMA A;  2QZ8 A;  1OYI A;  1BJA A;  1B9M A;  2JPB A;  3CUQ C;  1TNS A;  2YX4 A;  2G7U A;  3PFI A;  1IAW A;  2PMU A;  3WTU C;  1XSX A;  3GEZ A;  1MDM A;  2K86 A;  5H6Q A;  5D4R A;  4A6D A;  3WE2 A;  1XSV A;  3L00 A;  4KUM A;  1FYK A;  1PP8 F;  3HRS A;  1R36 A;  2XGX A;  2IVM A;  1Z7U A;  4BXU A;  2P7C B;  2EWN A;  2YX7 A;  4KMF A;  4EM1 A;  4XSX F;  3I58 A;  5IT3 A;  4LFU A;  2XIG A;  1ZG5 A;  4FT8 A;  2DBB A;  2CG4 A;  1OYW A;  3DQV C;  3R0A A;  1K7A A;  2GWR A;  2K4B A;  2UXX A;  4RGR A;  2M8E A;  2OAZ A;  2DK5 A;  2JTV A;  3ECH A;  3FXU A;  4B8X A;  5L3G A;  1XN7 A;  2H09 A;  2OD5 A;  5DDG A;  1T38 A;  3MZY A;  4RGS A;  1FX7 A;  2HOE A;  2M5W A;  1STZ A;  2O03 A;  3BJ6 A;  5ICF A;  2ETH A;  1RUN A;  3KP5 A;  2V1D A;  1JHF A;  2A3S A;  1I1S A;  2BYV E;  1MJA A;  5D8K B;  3DP7 A;  5IT9 K;  3FX3 A;  5LEK A;  2OQG A;  4MTE A;  1UB9 A;  5E18 F;  4L9T A;  5F64 A;  4G7H F;  3K1M A;  2Q8K A;  3JW4 A;  2HGC A;  1BI2 A;  2P7V B;  3I53 A;  4HZF A;  5D5V B;  4BNC A;  1CF7 A;  2V1U A;  3QU6 A;  4LK0 F;  3TGN A;  4HQE A;  3LST A;  3AAF A;  1MDM B;  3ECO A;  4I7H A;  4LLN A;  2V79 A;  3HTU A;  1TW3 A;  5LRR A;  2IT0 A;  3TOA A;  1TW2 A;  3KCC A;  1QO0 D;  1O7F A;  4U0Y A;  2L01 A;  3BWG A;  2DT5 A;  1LVA A;  3L9F A;  1Z1D A;  3FM5 A;  2KJC A;  3P9I A;  3HHG A;  2RNJ A;  3IWZ A;  2DQL A;  3Q5F A;  2TDX A;  3GZ6 A;  4EMS A;  2A6E F;  4HAM A;  3QOP A;  3LA3 A;  2GA1 A;  5FGM A;  2M30 A;  3F8C A;  1FSE A;  3HRM A;  4HX7 A;  4ASN A;  1IRG A;  4NHJ A;  1S29 A;  4EM2 A;  3D0S A;  1P2F A;  3E6C C;  4L0Y B;  5HLH A;  2EFP A;  1ZRE A;  4I02 A;  1Q1H A;  4FX4 A;  2M87 A;  2D1H A;  2DQR A;  3MCZ A;  2FXA A;  2H6C A;  1O7L A;  4HX8 A;  1EH6 A;  1LEA A;  1OPC A;  4PGH A;  3GW2 A;  4IHT A;  1AOY A;  1HKQ A;  2PJP A;  3K0L A;  2STT A;  4EGY A;  1YS7 A;  3OV8 A;  4U88 A;  2A69 F;  1J7K A;  2RN7 A;  2Z33 A;  3KEQ A;  3L7W A;  3E5U A;  5E1W A;  1FZP B;  1BM9 A;  1UFM A;  2FSW A;  3GO5 A;  1U6G A;  2VT3 A;  2H94 A;  4WCG A;  1O3T A;  5AIQ A;  2LKP A;  2IJL A;  1E2X A;  3D5L A;  1LB2 A;  4IRG A;  3TO9 A;  2V9V A;  1MJB A;  2Z99 A;  1XCV A;  2O8X A;  4ZYH A;  4U7B A;  3CLO A;  1F1Z A;  3GFM A;  3GUD A;  2D45 A;  1B59 A;  5JHU A;  3HRT A;  4LG0 A;  1FBS A;  1OMI A;  2M1B A;  1IRF A;  1R1V A;  3E5Q A;  4OMY A;  4RGX A;  3REO A;  1TQM A;  5FFX A;  2DU9 A;  5DYM A;  4CXF A;  1HKS A;  2LF8 A;  2BE5 F;  4HV5 A;  4I09 A;  2E7W A;  3HYI A;  2PLY A;  4RGU A;  5H6R A;  4G9Y A;  4PCQ A;  3BY6 A;  3IKT A;  3I64 A;  3RKW A;  4MTD A;  5E17 F;  1WQ2 A;  5E8G A;  2VN2 A;  1FSH A;  1G4D A;  3TQN A;  3EYY A;  5ICG A;  5DD8 A;  2C6Y A;  4G8X A;  2HKX A;  3SFZ A;  2COM A;  1Z05 A;  2NNY A;  1QNT A;  4IF4 A;  2W85 A;  1YTY A;  4Q48 A;  2VT2 A;  1X3U A;  1HW1 A;  3I0T A;  4CDG A;  1KU3 A;  2A61 A;  3F6V A;  3GVA A;  4I98 B;  5K1Y A;  1OKR A;  5IT9 Z;  1IN6 A;  4HYE A;  2F5C A;  4LD5 A;  4P9F A;  4A6E A;  4QWQ A;  4MHG A;  2YPR A;  5E1Z B;  3V4G A;  4OIO F;  3C7J A;  2M45 A;  5BQT A;  2VOP A;  4RB1 A;  2KJB A;  5A2Q K;  1HQC A;  1ZLK A;  2ELH A;  2FRH A;  2GIV A;  2LF7 A;  2HTS A;  4XRF A;  1BIB A;  5K5Q A;  1TBX A;  3I5U A;  5EEH A;  1GXP A;  1OYY A;  1XCB A;  3CDH A;  3KZZ A;  3T1B A;  2L3D A;  4HF1 A;  1BN5 A;  1KU2 A;  3WTY C;  3EET A;  3GYH X;  3IRR A;  1ZGJ A;  4GCV A;  4LG0 B;  4KT5 C;  5EEG A;  1ZAO A;  2XHK A;  5L3D A;  3K1N A;  1J59 A;  4WXC A;  3FMR A;  3CJN A;  1YLF A;  2W84 A;  1D3Y A;  4JBA A;  2QQA A;  2YSR A;  5JI6 A;  3FWE A;  4KNY A;  1XDU A;  2OA4 A;  2W25 A;  3WGG A;  4IHS A;  5BMZ A;  4OU0 A;  2BBY A;  1IW7 F;  4KMU X;  3QP6 A;  2QQB A;  2VON A;  4KN4 X;  5FFZ A;  2RKH A;  3BJO A;  3BZ6 A;  1QZY A;  2ZXJ A;  4A0Y A;  1JXS A;  1FY7 A;  3FMS A;  3FZV A;  2IP2 A;  4AVP A;  2ZME A;  1D5V A;  3M7G A;  2XAS A;  4CZZ A;  2L4A A;  1W5S A;  3I59 A;  4HA8 A;  1LEB A;  5E20 A;  1YW8 A;  2VOO A;  4F7Z A;  3ZMZ A;  4EJO A;  4IJA A;  2OZ6 A;  3LA2 A;  2QWW A;  1YG2 A;  3F3X A;  2P5V A;  3R61 A;  2VBZ A;  3ZP5 A;  4IRH A;  4M73 A;  1S7A A;  5LLQ A;  5DUI A;  2HTJ A;  1QZZ A;  2O3F A;  1ZLJ A;  5ILS A;  3C1D A;  2O61 A;  5DD4 A;  3WU1 B;  4EJT A;  3E6B A;  1FBQ A;  1PUE E;  4ENN A;  3KP2 A;  3L09 A;  2EK5 A;  3OOP A;  1P92 A;  4GYI A;  5DEQ A;  5JR3 A;  1J0R A;  3F8M A;  3G3Z A;  1SFX A;  1DP7 P;  2VBX A;  3LAP A;  4UV9 A;  1S3J A;  3I54 A;  2B0L A;  3QU3 A;  1U78 A;  4PZJ A;  3CO7 C;  1FPQ A;  4DNC A;  5DCM A;  4AIK A;  1G3Y A;  1K79 A;  2DI3 A;  3BRO A;  4P5O A;  1UHM A;  1YFH A;  3K69 A;  4KYW A;  1USS A;  4UVA A;  5D5W B;  2RDP A;  3ZMU A;  2XKP A;  2PBI A;  3K2Z A;  3TO7 A;  3ERE D;  2IPQ X;  5D5U B;  1EH8 A;  3T5X A;  1UST A;  1F4K A;  3LAJ A;  5HDG A;  2ZME B;  3TO6 A;  5AON A;  5H20 A;  2OQR A;  2PEX A;  2OZU A;  4A12 A;  4HOB A;  2UZK A;  3I59 B;  3KE2 A;  5LBQ A;  5F6F A;  5LRS A;  1J75 A;  2GXB A;  3V7C A;  1FLI A;  1HBX G;  1FC3 A;  3B73 A;  2QBY A;  5JVT A;  1IN5 A;  2MBF A;  1FOK A;  2QYO A;  2BV6 A;  4L5I A;  2HQR A;  3I71 A;  3RPQ A;  3DFG A;  1FNN A;  5CVU A;  3SQN A;  3K9T A;  5E8I A;  3KP3 A;  3KZY A;  2FEZ A;  4K2E A;  2XAJ A;  3ROU A;  1IZ1 A;  3ZN1 A;  1LDK B;  1BI0 A;  2Z5U A;  2NRA C;  3RI4 A;  1ZYR F;  3V8K A;  4CHU A;  3H3U A;  1FT9 A;  1ULY A;  4KN7 X;  2XRO A;  5BOX A;  3F6O A;  3F21 A;  1U5T A;  2P6T A;  2ZNY A;  3T8T A;  4OOI A;  3P9C A;  2A07 F;  2K7L A;  1IN8 A;  1D8K A; 
#chains in the Genus database with same CATH topology
 1Y8R B;  4H4K C;  2MYS A;  1PP7 U;  3PSF A;  3WG9 A;  1ETO A;  1Z9C A;  1N75 A;  1U3E M;  2O8K A;  2Z3Y A;  3GFI A;  2VOD A;  3GF2 A;  4ETS A;  4D0P A;  3EYI A;  3VWB A;  2EA2 A;  1O3Q A;  1KU9 A;  2JRT A;  4UVB A;  1MMN A;  1X2M A;  3WU0 A;  2CYY A;  1SFU A;  4UUV A;  4YG2 F;  3MN2 A;  3W6J B;  2XVC A;  3IHU A;  4QLC U;  1MNE A;  2EIJ H;  1R5G A;  2I10 A;  2KIU A;  3KZI C;  3MKZ A;  5FD5 A;  1K4S A;  1ACI A;  3K7A J;  3BR3 A;  4IQJ A;  5FRO A;  2DYS H;  4B47 A;  2IS6 A;  2GOM A;  1R7J A;  3QWL A;  3WTW C;  2R7T A;  3BG5 A;  2X4H A;  3HEF A;  4U0V A;  2X6O A;  4MQ9 F;  3BDD A;  2V6C A;  3CQZ J;  4M74 A;  1U2W A;  2HYF A;  4Y13 A;  3DV8 A;  2CQK A;  2DTR A;  2XSJ C;  3DPL C;  3KEO A;  3T8R A;  2JK3 A;  4OIP F;  3DEU A;  4EM0 B;  2OCC H;  1E0E A;  2K27 A;  4BBS J;  1EV7 A;  2MH9 A;  2W00 A;  4A93 J;  2LSO A;  5KVR A;  1QPI A;  1ON2 A;  5JLW A;  1ZEL A;  1VQL I;  3WTZ A;  1V3F A;  2QBY B;  4KFC A;  2ZJQ F;  3HB9 A;  4HNT A;  2N8G A;  4M3B A;  3DXJ F;  1FOY A;  3J80 K;  2AQF A;  3KIO A;  1RNL A;  4HW0 A;  3GFL A;  3OR2 C;  3ZQC A;  1QGP A;  2BOL A;  4BAY A;  5L3C A;  2HXI A;  2EV6 A;  2ZCW A;  2VXZ A;  1ETQ A;  2ELK A;  4Z6Y A;  5LHH A;  3G1L A;  2LLK A;  4BU2 A;  3DU5 A;  1GVJ A;  2M4K A;  2EZI A;  3CO6 C;  3ABK H;  1J09 A;  2P8T A;  1ZG3 A;  1Y56 A;  4EV0 A;  4WX9 A;  4D5C A;  3FXR A;  3PNY A;  3D1N I;  2ISZ A;  3EUK L;  2AHQ A;  2O9L A;  1RET A;  4CUG A;  1QVT A;  1HW5 A;  3PQK A;  3ZMV A;  1I6X A;  1BA5 A;  3KLO A;  2H8W A;  4A5N A;  4CCL A;  3LFU A;  2CS3 A;  5EG0 A;  1YO5 C;  4LK1 F;  4HPQ A;  3COA C;  2R7F A;  2M4G A;  1Z91 A;  2OU2 A;  1W7P A;  4E7S A;  4OIQ F;  4F93 B;  2RGV A;  3K70 D;  2DXI A;  3B6A A;  1JE8 A;  1G6N A;  4DZJ A;  3CCY A;  3OYM A;  1EH7 A;  4IPA A;  4CO8 A;  3I4P A;  3VYR B;  5FLX K;  1E3P A;  1U9O A;  2JZY A;  5LEJ A;  3HBL A;  3J81 Z;  1WWX A;  2GBY A;  1JUP A;  1U5T B;  1NK2 P;  2VQG A;  4FHT A;  4PJJ A;  2VKH A;  1JHH A;  1XGS A;  3QPS A;  2A68 F;  3H5A A;  1G59 A;  3A0H C;  2IRF G;  2WAE A;  2V1X A;  3QAH A;  1VQ9 I;  1VZ0 A;  4Y3O A;  3S14 J;  2YU3 A;  2YUS A;  4F52 A;  1SD5 A;  3KYC B;  3LSR A;  2GLO A;  3NQO A;  2QEX I;  2F5V A;  2VQL A;  4GDF A;  1J9I A;  2FQ3 A;  2DOA A;  4HRI A;  2R7O A;  1QQI A;  3A1Y A;  1CF7 B;  5IYD J;  2K9N A;  4KIG A;  2O0Y A;  4ENK A;  1H9T A;  3OSF A;  2ZB9 A;  3WTV C;  1MBJ A;  2UXN A;  5GPA A;  1F9N A;  2PQ8 A;  2XPV A;  1FP1 D;  3AL0 C;  4Y17 A;  2ECB A;  1G8X A;  3DBH B;  4IXA A;  4NQW A;  2NAZ A;  3ZPL A;  2HVR A;  3BPV A;  4JK1 X;  5DUK A;  5JFR A;  1RRJ A;  2GA2 A;  5KNL A;  4DZP A;  4MLO A;  3OYI A;  1MKM A;  3KP7 A;  2BZT A;  1ONV A;  2LNB A;  1W4M A;  2W4S A;  4XK4 A;  3TKY A;  5CYV A;  4BQN A;  4AIJ A;  1MMD A;  3LFK A;  2XV4 S;  2CW0 F;  3QRF F;  1GV5 A;  3KFW X;  3AKZ A;  5ED4 A;  4P55 A;  4I0B A;  3KP4 A;  2HKO A;  2MD5 A;  4RAY A;  1RUO A;  3FXK A;  4EJW A;  2QVO A;  3BP8 A;  1WPK A;  3KET A;  3OYH A;  3W2V A;  1R23 A;  2EV5 A;  5J1U A;  4DBR A;  4ESF A;  3L2R A;  2CV0 A;  2GOX B;  3RKQ A;  2X51 A;  1QBJ A;  4RS8 A;  4PDK A;  4UXN A;  2LDU A;  4L18 B;  1OLT A;  3U2R A;  2Y0S A;  3FHZ A;  4ZDO A;  2BW3 A;  2E5Z A;  2B7E A;  2XF5 A;  2V9K A;  4KIB A;  5E79 C;  3RKX A;  4G6T B;  2M8G X;  3TMO A;  3ULQ B;  2YU9 J;  1QRY A;  1MJ9 A;  4BQA A;  2NS0 A;  3H5R A;  5GTH C;  4II3 A;  3O8G A;  2XAU A;  3RJP A;  3GTO J;  3JTH A;  3HL2 A;  3DKX A;  3QYB A;  5CPR B;  4A3K J;  4FIS A;  3MWM A;  3I3L A;  5EG0 B;  2IA2 A;  2K85 A;  3M1E A;  1LDJ A;  1SFE A;  1WJF A;  1W7P B;  4RMN A;  3E6M A;  2EZK A;  1MND A;  3BC8 A;  4CIC A;  2DMQ A;  4V2G A;  1MBE A;  3V8L A;  5B1A H;  1Z77 A;  2MSY A;  3ERM A;  3BQZ A;  1SMY F;  4C2U A;  2MA3 A;  4MGR A;  3TDU C;  2R5Z A;  1HW2 A;  1DP3 A;  3JRG A;  2FE3 A;  2Q2E A;  4O6J A;  2HVQ A;  5D6F A;  2JA2 A;  1K78 A;  1WRJ A;  2DPD A;  3U21 A;  2X9D A;  1EJ9 A;  2LK2 A;  3U1D A;  2XF6 A;  3K1P A;  3OIQ A;  4HQM A;  3GTQ J;  1W0T A;  1QHH D;  2HZT A;  2JVH A;  5L3B A;  1ENH A;  3OMY A;  2Y0M A;  1FOW A;  2JA7 J;  3MKY B;  1LE8 A;  5M3M J;  4XOT A;  1FIP A;  3DBR B;  4UHT A;  4LJZ F;  4BYY A;  4PSW A;  2HWV A;  4L9J A;  1VND A;  1WFX A;  1YIT I;  2CV2 A;  3HSR A;  4MEX F;  1W7P D;  5ILV A;  1H8A C;  1WJ5 A;  5FB2 A;  4GYG A;  1SD7 A;  2QQ9 A;  4Q47 A;  3JRF A;  4RLF A;  3KP6 A;  2Z9O A;  3FIW A;  3MAJ A;  2RQP A;  1YOV B;  2ZJ2 A;  2DPU A;  3LOC A;  1TNT A;  2FMY A;  5L3E A;  3HOS A;  1CGP A;  4NQW B;  5F1J A;  2V26 A;  4ENJ A;  4S05 A;  3Q9S A;  3L2C A;  3FXL A;  2R7X A;  1ZG1 A;  1MSF C;  1XPX A;  1YIO A;  4W1U A;  4MNU A;  2WA0 A;  4YFK F;  4AID A;  2WAD A;  3H92 A;  2HQN A;  3B02 A;  4CCN A;  5FRM A;  3CCJ I;  2M0M A;  2R7W A;  2ME6 A;  4IKF A;  5GAH J;  2Y9Y A;  2XAF A;  4TV7 A;  2IGM A;  4WF2 A;  1ETY A;  1WZ2 A;  2DMU A;  4ZTF A;  2NYX A;  5IYC J;  2RRE A;  4XID A;  3JAM K;  1T98 A;  4IHW A;  3FK6 A;  5EEA A;  2XAG A;  3H9J A;  4G94 A;  4HLX A;  1XX5 A;  4PK4 A;  4WXD A;  4AD9 A;  1C0W A;  5HOO A;  2OTJ I;  1AKH B;  1BL0 A;  2R92 J;  5FKK A;  1B9N A;  1R4M B;  2L7K A;  2LRE A;  4FQG A;  4I0A A;  3U1K A;  2JT1 A;  3CUQ A;  2X6X A;  2BW3 B;  4XBF A;  5DS9 A;  2Z2S B;  2P4W A;  3PQJ A;  4WXH A;  3J80 Z;  2MC3 A;  2YR2 A;  3M9A A;  1LDD A;  1Z67 A;  4XLN F;  2DA2 A;  4KIF A;  1ZHF A;  5FO5 A;  1N77 A;  4EVI A;  3GTK J;  5LHG A;  2LP0 A;  4NB5 A;  3PNT A;  3ZMT A;  4IHY A;  4M3G A;  1DPR A;  4DYC A;  2Z16 A;  3ASN H;  3CJR B;  5TRD A;  3PUB A;  2XKO A;  3I4M J;  3LSG A;  4XOP A;  4AWX B;  1I6H J;  2IEK A;  4CSW A;  3CC4 I;  3ZQI A;  1R1U A;  1ZK8 A;  2H1L A;  5LGN A;  3LSH A;  3HM5 A;  4WK8 F;  4G7Z F;  1P7J A;  4E70 A;  1LNW A;  3E3V A;  3CF2 A;  5HDK A;  2IS1 A;  5EZH A;  4DW6 A;  2R5Z B;  2KIS A;  1QU3 A;  1VQ5 I;  1GXQ A;  4B09 A;  4P9U A;  1PDN C;  1D1C A;  2L9V A;  2RVC A;  2Q2E B;  4CZC A;  2W24 A;  1K78 B;  3CDI A;  2GIZ A;  4YRV A;  4YIF A;  2LY1 A;  3O8H A;  4E7I A;  3R0J A;  2ISY A;  2LH9 A;  5HLG A;  4UUS A;  4L9N A;  1JKO C;  4P96 A;  4A3F J;  2BEO A;  3FIS A;  3T0Y A;  5FLX Z;  1S8N A;  2GXG A;  2FA5 A;  2CJJ A;  2P6S A;  2CQN A;  4LIT A;  2R3S A;  3GFJ A;  1X19 A;  1LE8 B;  1DU0 A;  3L2V A;  4A2U A;  3G1O A;  4F3Q A;  1WHU A;  1VQ7 I;  3ABT A;  3HSE A;  1SVM A;  2MFZ A;  3GXO A;  4IZZ A;  1Z21 A;  1SEU A;  2OC6 A;  1XB4 A;  1J5Y A;  1TTY A;  1X1C A;  4LMY A;  1BOA A;  1IDY A;  2E2H J;  4RM2 A;  2KIQ A;  1MMA A;  2DOF A;  1O3S A;  1H9G A;  2VKE A;  2GQQ A;  1IXR C;  3LMM A;  1NG7 A;  3RCO A;  4E4H A;  2R7D A;  4FCY A;  3VYS B;  1PUF A;  2ESH A;  2F5F A;  2JPC A;  3S17 J;  2VC1 A;  3S15 J;  2KRF A;  1UG0 A;  4LLG F;  4CYD A;  2E2J J;  1JGS A;  5ICC A;  3CUO A;  1REP C;  2CV1 A;  3O3K A;  1O3R A;  1JUS A;  4OMZ A;  2AS5 F;  1XSD A;  1YRN A;  2FOK A;  4YFN F;  3SEQ A;  4ON0 A;  1QPM A;  5CVR A;  3SZT A;  3LNQ A;  2TCT A;  1R5I D;  5FKM A;  3I56 I;  4AYB A;  2F5E A;  3U9G A;  1NHA A;  2QEN A;  2EIM H;  4I76 A;  2JSC A;  4CA0 A;  2IS4 A;  3BR6 A;  3IH3 A;  1FYL A;  1RIO H;  4XLE A;  2XB0 X;  2KQR A;  4XSZ F;  4N4N B;  3IC7 A;  3RQI A;  3E7L A;  3AFH A;  4ESB A;  4ANJ A;  3K4B A;  4XNF A;  3CUQ B;  2LYC A;  5FLM J;  1FTT A;  5HS8 A;  1GHC A;  5FKO A;  1YJW I;  3WTT C;  4A3C J;  3HSF A;  1BI3 A;  1SD4 A;  1WJE A;  1R00 A;  4ZDP A;  4ZYA A;  4O5V A;  5AIP A;  2EFQ A;  1ITY A;  3BJA A;  1I3Q J;  2KRH A;  2R7Z J;  5K5O A;  5TJJ A;  2R7Q A;  4XM3 A;  1ZRF A;  3BT9 A;  2XRN A;  4C9Y A;  3S1R J;  4M3D A;  4ZDL A;  1K61 A;  3W6K B;  2FNA A;  4A3M J;  2K9Q A;  5HNH A;  1BC8 C;  3O6B B;  5IOY A;  4PSX A;  1IUY A;  1VI0 A;  2G9W A;  4A0X A;  2RV8 A;  3G73 A;  4G7O F;  3JR9 A;  3RYP A;  4ZYG A;  1UMQ A;  3MVP A;  3RTR A;  1IXS B;  2ESN A;  3L2W A;  1Y39 A;  2QSG X;  4M9X A;  2HS5 A;  3RYR A;  5DCF A;  3EUA A;  3CCM I;  1NG6 A;  3F8B A;  1WGX A;  3OS2 A;  1HKT A;  1R6R A;  2HXO A;  4KIS A;  2K5C A;  1T8I A;  1YQA A;  1B4A A;  4E6K G;  4CCJ A;  4UUS B;  2H6B A;  3CMA I;  2ZJP F;  1ZN2 A;  3FDY A;  4HX4 A;  1DGR M;  4BY7 J;  1DGW Y;  4PUS A;  1LUJ B;  1RKW A;  2EFW A;  2VJI A;  3CP2 A;  3V8J A;  3KYD B;  1KA8 A;  1KYZ A;  2OJE D;  2BY3 A;  2DOE A;  3P9K A;  3TW6 A;  4AIH A;  3A4C A;  4A3E J;  1X58 A;  1TWC J;  4FAS D;  2ECC A;  4B4C A;  4NBQ A;  3LSJ A;  4XKW A;  3OYK A;  1JKQ C;  3WTX C;  3CDL A;  1OJL A;  2KKO A;  4JOM A;  5IYB J;  2DA6 A;  3A2K A;  1OCP A;  1XG1 A;  1K6O A;  1FBU A;  3SDG A;  1HCR A;  2MLG A;  2EZL A;  3BG3 A;  3NAU A;  2VPL A;  2DDA A;  5K5R A;  4N4O B;  2ELJ A;  1BR1 A;  1MW7 A;  2FF4 A;  3RSN A;  3H9Q A;  2P5K A;  4ZZL A;  4L5J A;  3TL4 X;  2ME0 A;  2L02 A;  1RR8 C;  2KDO A;  2E1C A;  1FEX A;  2DFE A;  2EZH A;  1YRN B;  4PJ0 C;  2KHM A;  4DYR A;  2Y0S N;  4HLY A;  1F5T A;  4EEF G;  1UAA A;  4KA4 A;  5HS7 A;  3GWZ A;  3M8E A;  2X48 A;  3LSM A;  1LFB A;  1X1A A;  3GZ5 A;  3ABU A;  2EFO A;  1JUM A;  3Q0U A;  3VOD A;  5A2Q Z;  1H89 C;  2CFX A;  4HV6 A;  1UJ8 A;  2JQ7 A;  4MFD A;  5IPA A;  2VJ5 A;  2ZME C;  2L9N A;  3AG4 H;  1AWC A;  2Y48 A;  4C3H J;  1A35 A;  3LSK A;  1W36 C;  3OIP A;  4ENM A;  3G6E I;  2A5W A;  1MBH A;  3VFZ A;  1IRZ A;  3WTS C;  2FBH A;  3ZRG A;  2M9H A;  2ZBK A;  4RAZ A;  5ICE A;  2J5P A;  1TT0 A;  4J19 A;  1Z6T A;  4C2T A;  3JAM Z;  2WV0 A;  5L3F A;  4ZYE A;  2KZG A;  3FXM A;  3M4O J;  2JRM A;  3TDZ C;  1BR4 A;  2RC4 A;  1ZGW A;  1Y0U A;  2DYR H;  1E3O C;  4GXO A;  1KZH A;  2GM4 A;  1U8R A;  2DJI A;  2KMU A;  5DCM B;  2F5D A;  2HR3 A;  3KX2 A;  4EAT A;  3ELK A;  3WE3 A;  1SD6 A;  3SZG A;  1BR2 A;  4BHB A;  4YEL A;  2PI0 A;  4ZYD A;  1YW9 A;  4L9V A;  3FF5 A;  5D4S A;  4N9I A;  1MGT A;  3JRD A;  2DLL A;  2A6T A;  2UWM A;  2MH2 A;  3QPT A;  1ORK A;  4N9H A;  3SJM A;  1MIJ A;  2AO9 A;  2KIM A;  3S3M A;  2VBY A;  2HZD A;  1SMT A;  4PJM A;  1X1D A;  3LQQ A;  2FML A;  4H0E A;  2EH3 A;  3OL4 A;  3ZXS A;  2QSH X;  2WTE A;  1I27 A;  4BAC A;  2QLZ A;  3BQY A;  4CGZ A;  4HBL A;  2EV0 A;  2UUZ A;  4AC0 A;  1ZH5 A;  2J5O A;  4EQQ A;  3FHN A;  4E7K A;  3HG9 A;  2E1N A;  1BC7 C;  5FRN A;  2HI3 A;  3SHF A;  3VB2 A;  1I39 A;  1R22 A;  1SAX A;  4JP0 A;  4IRI A;  1FMW A;  3F8F A;  2WC2 A;  1B1B A;  4PJN A;  1LKX A;  1LFP A;  2L7F P;  3D5S C;  1DU6 A;  2HDC A;  2A6H F;  3F72 A;  3ZQ7 A;  2HPI A;  3IH4 A;  1T33 A;  2EFN A;  3ZMS A;  1SFO J;  4OIR F;  3K4N A;  4E7Z A;  2PX9 A;  5DM6 F;  3ZQG A;  2CQ7 A;  3F9K A;  1YX5 A;  2Z1D A;  5HDN A;  4Q5S F;  2VE8 A;  1G3S A;  4O3M A;  1T56 A;  3TOB A;  4HDV A;  1Y0N A;  1Z3X A;  3TP0 A;  3E97 A;  3J7Y J;  2PMH A;  1XDS A;  1Z6R A;  1KGS A;  3IAM 2;  3CCE I;  4E7J A;  4KIC A;  3JRA A;  1PJR A;  1LVK A;  2LBF A;  1QA6 A;  3ABL H;  3MQ0 A;  1HST A;  1YIJ I;  1H0M A;  1RPW A;  3CP8 A;  4RA2 A;  3OYA A;  3ZN0 A;  2VPR A;  2CWE A;  2L9R A;  1YS6 A;  2JSP A;  2LD5 A;  2IAI A;  4BY1 J;  5CVJ A;  3PJR A;  2FJ1 A;  5M3F J;  4I01 A;  3WOD F;  2XAH A;  4KIT B;  3M3Y J;  2FU4 A;  3SDB A;  2BVL A;  3VSL A;  2WY7 Q;  2CFO A;  4IO9 F;  2Y30 A;  4Y15 A;  1JJ8 C;  5CLS A;  3HPG A;  1RZ4 A;  2F4I A;  3BZK A;  3ZQQ A;  2V4J C;  3AG1 H;  3Q0W A;  4LIV A;  3DLL F;  4IOA F;  1ZR2 A;  4W97 A;  4FE4 A;  2G0E A;  3HHH A;  4XR6 A;  1BW5 A;  2Y75 A;  5ERI A;  3IKV A;  1I1G A;  3W6V A;  1BI1 A;  2LTP A;  1V4R A;  4GO1 A;  4OAZ A;  4P1W A;  4DQ2 A;  5HVQ C;  1VTN C;  3K70 C;  4UNO A;  3ZR8 X;  5IOZ A;  5J8F A;  5CVI A;  3QQA A;  3F0C A;  2LY9 A;  3DF8 A;  4OAY A;  4RB2 C;  2O6G E;  4HF2 A;  3IRQ A;  1KQ9 A;  1IJW C;  3GME A;  1TQP A;  4M6Y A;  3V42 A;  5LFA A;  4A3J J;  4XKV A;  5F1R A;  3NEU A;  3RZD J;  2JUC A;  3VOE A;  2A5Y B;  4B44 A;  4FTH A;  1E17 A;  1S7O A;  3HIF A;  1HA8 A;  1ETK A;  2AXL A;  1SAN A;  2ACJ A;  5BPD A;  2VAS A;  3JSP A;  4CCO A;  1RC9 A;  1EKE A;  1OCO H;  2VKV A;  2X1C A;  3HJE A;  3WHB A;  4A0Z A;  2E36 A;  3G2B A;  3DU6 A;  3IAS 2;  1KYW A;  2R5Y A;  4M9Z A;  2VJ4 A;  4JX6 A;  5H2F C;  2DK8 A;  3MFK A;  1XGN A;  4YII A;  4KDP A;  4ESJ A;  3CC7 I;  2BGC A;  2GAU A;  4BXF A;  3HUG A;  3C2B A;  3H1C A;  1P6R A;  3LA7 A;  3J7A O;  2NS7 A;  4F91 B;  3M8F A;  2ZC2 A;  2F2E A;  3MZH A;  4MFE A;  4AYB N;  2PFB A;  1A6I A;  1U5T C;  5KHD A;  1FIA A;  2QM3 A;  3BPX A;  1IGN A;  2ADU A;  4DIQ A;  5M5W J;  3JTG A;  2ZFW A;  5J6X A;  1ON1 A;  3QYF A;  2MD0 A;  1OCC H;  4UVC A;  5CJ9 A;  3H3Z A;  4HNV A;  3IP4 B;  3PUF A;  3OYJ A;  1FP2 A;  2G7H A;  2FBK A;  1T2K A;  2IGK A;  5BPI A;  3RKY A;  5F04 A;  1H88 C;  3MZ8 A;  3OYF A;  1IXC A;  4QIW N;  3L2U A;  4V2F A;  2LBF B;  4OIN F;  1YX3 A;  5E3L A;  4U87 A;  4ZH4 F;  3CC2 I;  2JJ7 A;  4RDU A;  4U7D A;  3FMQ A;  2GZW A;  3E6D A;  2FNP A;  1T0F A;  2DA1 A;  1WKM A;  3QPH A;  3JRB A;  5GPC A;  4R79 A;  3FKJ A;  4YIR X;  3CCU I;  4M3F A;  5IY5 H;  3EUH A;  3BOQ A;  2KT0 A;  4Z2Y A;  3ZMD A;  4BH9 A;  2CO5 A;  4R8H A;  4RB0 A;  1XD7 A;  2IA0 A;  4Q4Z F;  4BHC A;  1U9N A;  2AQE A;  4V19 K;  2DW4 A;  4M71 A;  4FE7 A;  1ODD A;  1OR7 A;  3IWF A;  4IVN A;  6PAX A;  3BR1 A;  1XGM A;  1HXD A;  3OYG A;  2K4J A;  2OPT A;  2E35 A;  3RPU A;  1XMK A;  3WGI A;  4ZZD A;  2VJJ A;  5E1X A;  2KP6 A;  2H8R A;  1B6A A;  2CGP A;  5K7Z A;  1I5Z A;  1FMV A;  1IN7 A;  3DWL E;  4XRS A;  1KU7 A;  4B48 A;  2Q0O A;  5FD6 A;  3H0G J;  1LQ1 A;  2BXZ A;  3Q9V A;  3R6S A;  1F43 A;  2LC2 A;  5EGO A;  1BJZ A;  3CTA A;  4XLP F;  3TBI A;  4G6D A;  4RB3 C;  3K4M A;  3ML6 A;  2VQC A;  1KQ0 A;  1RKT A;  2R5Y B;  1Y6I A;  1NK3 P;  5JVG F;  1S6L A;  2CSO A;  1MD0 A;  5CVV A;  1R58 A;  3V7S A;  1ZAR A;  1TLH B;  2OBP A;  4XMY A;  3L2Q A;  1JTX A;  1A5J A;  4MQV A;  3MEX A;  1IF1 A;  2VBW A;  2DT6 A;  2K02 A;  1JKP C;  3HUG B;  2L4M A;  3A0B C;  2XAQ A;  1R49 A;  1L3L A;  4A3D J;  1YJ9 I;  4JX4 A;  4MO7 A;  4JQF A;  2NNN A;  2LY2 A;  3GCM A;  2KIF A;  2D2W A;  1QHG A;  5LGT A;  1XGO A;  3HOX J;  2VC0 A;  1Z3Y A;  2QKL B;  2ZKZ A;  1WSU A;  1MSE C;  2R4G A;  1O57 A;  2X1E A;  3GLX A;  1ZRC A;  1ZKG A;  5D5X B;  1MBK A;  1W5T A;  3PM1 A;  1RI7 A;  1D5Y A;  2STW A;  3M1C A;  2DO7 A;  3ZQF A;  2H27 A;  1XTA A;  2HYG D;  5EF6 A;  3OL3 A;  4ZJZ A;  4M9S A;  4M6X A;  2CUF A;  2X0L A;  2H1K A;  5M5X J;  4G6Q A;  5F0H A;  1UCR A;  2CQQ A;  1V55 H;  2DFI A;  3VYT B;  3X2Q H;  3HOZ J;  1ETW A;  3WHC A;  2EIN H;  3V7R A;  4BBR J;  4I2O A;  4B43 A;  3ZQH A;  5HS9 A;  5D8L B;  3LQR A;  2QUF A;  2W57 A;  1IN4 A;  2F4M B;  2ZNZ A;  1FWZ A;  3DKW A;  3H36 A;  3H5N A;  2JVG A;  5KAF C;  1GLN A;  3FXQ A;  2WWY A;  2KFD A;  4M72 A;  3N4M A;  2R7V A;  1YW7 A;  4WWC A;  1VFC A;  3K4K A;  2ZXI A;  2VKD A;  2LRD A;  5M5Y J;  1YYV A;  5BS6 A;  3GTG J;  1WI9 A;  3EQL F;  2CRG A;  3HC7 A;  1BIA A;  1OCZ H;  1ZGA A;  1JI8 A;  3DTE A;  1DDN A;  3VYU B;  1GV2 A;  1D8J A;  3HOT A;  1JTY A;  2EJR A;  3IL2 A;  4BHP A;  5DM7 F;  1HSJ A;  1F36 A;  1X3W B;  4LLL A;  3S8P A;  3DPT A;  3GTL J;  2IW5 A;  4X1E A;  2NS8 A;  3VEP A;  3P7N A;  4LGW A;  3ZOB A;  9ANT A;  2E1M B;  2VE9 A;  5FKN A;  4A5M A;  3NWS A;  4FX0 A;  5D6E A;  3WGH A;  2LR8 A;  3NAR A;  4XIC A;  3C18 A;  5ILU A;  1LJ9 A;  1D0X A;  2K9M A;  3BR2 A;  4D9J A;  3GX4 X;  4GGG A;  1VQ4 I;  3A03 A;  1RES A;  4R1H A;  2LG4 A;  2DAO A;  1OFC X;  3F22 A;  2KL4 A;  1UHW A;  3S93 A;  3B6C A;  2HFH A;  4KJZ A;  5EGO B;  3QOD A;  5TGT A;  5KK1 A;  3QP5 A;  5KCM A;  3HPH A;  3C2G A;  3HTS B;  3K4L A;  3J7Z I;  2Q1Z B;  3LWF A;  3MKW B;  1KQ8 A;  1V5E A;  4BEH A;  3ISP A;  4N0B A;  4A3L J;  3F8N A;  3G71 I;  2QA4 I;  2EA4 A;  3FKI J;  3FM3 A;  5DV5 A;  3NRV A;  5LHI A;  3A01 A;  4X0G A;  4LB6 B;  4EGZ A;  2WV1 A;  2P5L C;  2ZFU A;  3C3W A;  1ZRD A;  3E5X A;  2NOJ B;  3RIR A;  2XF7 A;  1P4X A;  2EB7 A;  3H0D A;  3RPU D;  2JN6 A;  1A31 A;  5HLI A;  4Y52 J;  1TQI A;  3OYC A;  2FBI A;  2L7Z A;  3HRU A;  4RAF A;  4BDY A;  3BG6 A;  2A05 A;  2CUZ A;  1R1T A;  2D1V A;  5E3O A;  5LD2 C;  1K83 J;  2KZV A;  2DA3 A;  4XQF A;  1A04 A;  3R4K A;  1P4W A;  2AXT C;  3GZN B;  3OOU A;  1T6S A;  2ZO4 A;  2OCE A;  4L0Z B;  2COB A;  2BY0 A;  3FBI B;  3TED A;  3PSI A;  1FYM A;  1W0U A;  5HLT A;  2XUB A;  2PG4 A;  2X85 A;  3O2P E;  5C44 J;  5B5E C;  1DPU A;  1L0O C;  1MZB A;  2E1O A;  3N97 A;  4XLH A;  1X4O A;  3F23 A;  4BQO A;  4XLA A;  3SXY A;  1J2X A;  2DA5 A;  5J8C A;  4UV8 A;  2LMD A;  1G3T A;  3RDI A;  3KLN A;  3J81 K;  1ZR4 A;  2DCE A;  4NDL A;  1BBY A;  1G3W A;  4UB8 C;  4LB5 A;  4QTR A;  3CCS I;  5J4Y A;  1R4N B;  3HKZ A;  3R60 A;  2VXD A;  4HDU A;  2MLK A;  2PN6 A;  3JSO A;  4YFX F;  4DJA A;  5J1Y A;  1DUX C;  2L7M P;  2L54 A;  2NVX J;  2L9S A;  3EDP A;  3DTI A;  1JT6 A;  3UNG C;  2LOO A;  2OTL I;  4CH7 A;  2CU7 A;  3SZP A;  2CH0 A;  2HOT A;  5GTI C;  2MG4 A;  4PGG A;  2HEO A;  3ASO H;  1D1A A;  2E7X A;  2LFB A;  1T39 A;  1VF9 A;  1R9T J;  2OV7 A;  1VQO I;  1P4A A;  1GDT A;  3ZQL A;  2FX0 A;  4HF0 A;  3JRI A;  1NTC A;  1WVR A;  4MEY F;  1BW6 A;  2BHZ A;  4A3B J;  2IA1 A;  4EJV A;  4S04 A;  4EJU A;  4M6V A;  2NVT J;  4U0W A;  5LGU A;  1R5H A;  3S2W A;  1TT5 B;  1XMA A;  2QZ8 A;  1OYI A;  1SC7 A;  1BJA A;  3K4C A;  1B9M A;  2JPB A;  2PMZ A;  3CUQ C;  1TNS A;  3QOE A;  5B3S H;  2YX4 A;  3DLA A;  2BHY A;  1RR7 A;  2G7U A;  3PFI A;  1IAW A;  3CES A;  2PMU A;  2ZSH B;  2VB6 A;  3WTU C;  1XSX A;  3OYN A;  3GEZ A;  3S1M J;  1MDM A;  2K86 A;  1NH3 A;  4BEH B;  2DMP A;  5H6Q A;  3L1P A;  5D4R A;  1PUF B;  4GFB A;  4A6D A;  1E3H A;  3WE2 A;  1XSV A;  3L00 A;  3AG2 H;  3A01 B;  4KUM A;  2XGE A;  4BJ6 C;  1FYK A;  1PP8 F;  2W1O A;  1SFK A;  3HRS A;  2XSD C;  1R36 A;  1T95 A;  3FXJ A;  1A6Q A;  2XGX A;  3JRE A;  4BUP A;  2IVM A;  1JKR C;  1Z7U A;  4BXU A;  2P7C B;  2EWN A;  2YX7 A;  4KMF A;  4EM1 A;  1QZE A;  4XSX F;  3I58 A;  3S32 A;  4GRI A;  5IT3 A;  4RM3 A;  3Q3S A;  4LFU A;  1SVO A;  2FD5 A;  2XGD A;  4C30 A;  2XIG A;  1KON A;  3LL7 A;  4HG2 A;  2HU9 A;  2WAQ A;  1IRX A;  2K9S A;  4ZC3 A;  3WG7 H;  4BL0 B;  2MC4 A;  2IXS A;  1ZG5 A;  2IBD A;  4FT8 A;  1Y8Q B;  2DBB A;  2CG4 A;  1XC5 A;  1OYW A;  5C4J J;  1W36 D;  3DQV C;  3R0A A;  1K7A A;  1X3Z B;  2M7A A;  4RAG A;  2E5N A;  2GWR A;  2K4B A;  2UXX A;  4I99 C;  4RGR A;  3CCV I;  1MMS A;  2M8E A;  2OAZ A;  3BZC A;  2DK5 A;  2HQA A;  4XOR A;  1EA3 A;  2JTV A;  3ECH A;  3JCU C;  3FXU A;  4B8X A;  5L3G A;  3LSP A;  1JJ6 C;  1XN7 A;  2H09 A;  2OD5 A;  2WBM A;  5DDG A;  1T38 A;  2HOA A;  3MZY A;  5CKT A;  2XB5 A;  4RGS A;  2NVQ J;  2BY2 A;  1FX7 A;  2HOE A;  3OWT A;  1HC8 A;  2M5W A;  1W1W E;  1STZ A;  2UV1 A;  4F92 B;  2O03 A;  3BJ6 A;  4AM3 A;  5ICF A;  2ZJR F;  2ETH A;  1RUN A;  1APL C;  3KP5 A;  2V1D A;  1B8I A;  1JHF A;  1XMX A;  3RZO J;  2XPU A;  2A3S A;  5EDN A;  2Y69 H;  4E7L A;  2EBI A;  3E0J B;  5FKL A;  1I1S A;  1X4P A;  1OQY A;  2BYV E;  5IP6 A;  1MJA A;  5D8K B;  3DP7 A;  5IT9 K;  1ZTR A;  5J4V A;  1X2N A;  3FX3 A;  5LEK A;  3HOY J;  3PIO F;  2OQG A;  4NC8 A;  4MTE A;  1UB9 A;  5E18 F;  1K4T A;  4NUB A;  4NNJ A;  2K40 A;  4L9T A;  5F64 A;  3TP3 A;  4G7H F;  4BS9 A;  3K1M A;  1WCM J;  2V9P A;  1AHD P;  2Q8K A;  3JW4 A;  3C2H A;  2HGC A;  1BI2 A;  2P7V B;  3I53 A;  4HZF A;  1IDZ A;  5D5V B;  3HGG A;  4BNC A;  1DQU A;  3OR1 C;  2R93 J;  2WB1 A;  3KPH A;  1CF7 A;  2V1U A;  1SAU A;  2EIL H;  2CUJ A;  3QU6 A;  4LK0 F;  3TGN A;  4HQE A;  2VIX A;  1MBF A;  2QSF X;  2DFH A;  3LST A;  3AAF A;  1MDM B;  3ECO A;  4CCM A;  1VQK I;  4I6Z A;  4LOC A;  4I7H A;  4LLN A;  1N25 A;  1D0Y A;  3HOW J;  2V79 A;  1MH3 A;  3HTU A;  1TW3 A;  5EYR A;  5LRR A;  1FJL A;  3K2A A;  2P81 A;  2JA6 J;  2IT0 A;  2DOD A;  3TOA A;  3DTK A;  2ID3 A;  4HNU A;  1TW2 A;  3KCC A;  4IHX A;  3HDD A;  1QO0 D;  1O7F A;  2EIK H;  4U0Y A;  2L01 A;  3GTM J;  3S3N A;  3BWG A;  3BLY A;  1IV6 A;  2DT5 A;  1HOM A;  5J3L A;  1LVA A;  3L9F A;  1Z1D A;  3FM5 A;  1MMG A;  2KJC A;  3K6G A;  3P9I A;  4FET A;  1O4X A;  3HHG A;  2RNJ A;  3S1N J;  3IWZ A;  2DQL A;  3Q5F A;  2TDX A;  4Y33 A;  3GZ6 A;  2KLO A;  2CMP A;  2JMW A;  3S16 J;  4EMS A;  1PVE A;  2A6E F;  2CUE A;  5GP9 A;  4HAM A;  4Y7N J;  2W7N A;  3QOP A;  2ZSI B;  2I5U A;  3LA3 A;  2LKS A;  2GA1 A;  4B1R A;  3OYB A;  3N05 A;  2M30 A;  5FGM A;  2K3P A;  3F8C A;  1FSE A;  3HRM A;  4HX7 A;  3M8J A;  4ASN A;  1TWG J;  4NHJ A;  1IRG A;  1ZQ3 P;  2M0C A;  1IUF A;  2M7B A;  3BTI A;  1S29 A;  3GLL A;  3AL0 B;  2X6W A;  4C3J J;  4EM2 A;  1U8B A;  3D0S A;  1UG2 A;  2E60 A;  2OUM A;  1P2F A;  3E6C C;  3BR5 A;  4L0Y B;  1IG7 A;  5HLH A;  3IV5 A;  2EFP A;  1ZRE A;  4I02 A;  1Q1H A;  4FX4 A;  2M87 A;  2D1H A;  4XLC A;  2DQR A;  2M34 A;  2NXN B;  2M3A A;  4XRS G;  1B8I B;  3MCZ A;  2FXA A;  2JA8 J;  2H6C A;  1O7L A;  4HX8 A;  1EH6 A;  1LEA A;  1EF4 A;  1OPC A;  1Z7L A;  4PGH A;  2VI6 A;  3GW2 A;  4IHT A;  1AOY A;  1HKQ A;  2PJP A;  3K0L A;  3OYL A;  2RQQ A;  4NC6 A;  2STT A;  3CMY A;  1T08 B;  2E19 A;  5F08 A;  4EGY A;  1WH5 A;  1YS7 A;  2M2E A;  3OV8 A;  1Z0X A;  1JT0 A;  1VQ6 I;  2XDV A;  2A69 F;  4U88 A;  2NOG A;  4AUX A;  1J7K A;  2RN7 A;  2Z33 A;  2W82 A;  5F0F A;  3KEQ A;  1V54 H;  3L7W A;  3E5U A;  3HZJ A;  4CCK A;  5E1W A;  3WU2 C;  3CZ6 A;  1FZP B;  1BM9 A;  1I50 J;  1UFM A;  3IH2 A;  2FSW A;  3GO5 A;  3ZCO A;  2VQH A;  1U6G A;  2ZXW H;  2VT3 A;  4C2M J;  3RQ4 A;  2H94 A;  1AA7 A;  2DTZ A;  3BG9 A;  2EPF A;  4WCG A;  3IUO A;  1O3T A;  5AIQ A;  3I4N J;  2LKP A;  3GTP J;  2IJL A;  1Y1W J;  3K10 A;  2D5V A;  1E2X A;  3D5L A;  1WJA A;  1LB2 A;  2NVU B;  4IRG A;  3I55 I;  4DOZ A;  3TO9 A;  1P7I A;  1MJB A;  2V9V A;  1P9Q C;  1V5G A;  2NVY J;  2Z99 A;  1XCV A;  2O8X A;  4ZYH A;  4U7B A;  2TRT A;  3CLO A;  4AU7 A;  4HSR A;  2Y31 A;  1F1Z A;  5CQG A;  3GFM A;  3GUD A;  1GVD A;  2BXY A;  2P0W A;  1OCT C;  2D45 A;  2K3F A;  4BE2 A;  5K7F A;  1B72 A;  1B59 A;  4PJL A;  5JHU A;  2QGU A;  1VQM I;  3HRT A;  4IX7 A;  3CME I;  1YE9 A;  4OWR B;  4XKC A;  4LG0 A;  1FBS A;  1OMI A;  2M1B A;  1IRF A;  5E3M A;  2HPM A;  3PL8 A;  4E7H A;  1XS9 A;  1AKH A;  2WAF A;  1POG A;  1R1V A;  3W2A A;  1TZL A;  3E5Q A;  4OMY A;  3A02 A;  2LKX A;  3HKZ N;  1V5F A;  3QPL A;  3VDX A;  4RGX A;  3PO2 J;  2QCO A;  3REO A;  1TQM A;  5FFX A;  3S2D J;  2DU9 A;  3Q0V A;  5DYM A;  2RNG A;  4CXF A;  1HKS A;  2LF8 A;  2BE5 F;  1GT0 C;  3G4S I;  4HV5 A;  4I09 A;  2E7W A;  4PFO A;  4HEA 2;  3HYI A;  2PLY A;  2HQ5 A;  4RGU A;  4G9Y A;  2K9L A;  5H6R A;  4PCQ A;  1SVL A;  4J00 A;  2JA5 J;  3BY6 A;  2PJR A;  5JLX A;  3IKT A;  1S5L C;  1WJB A;  3I64 A;  3RKW A;  4MTD A;  5E17 F;  1WQ2 A;  5E8G A;  4UY8 I;  2VN2 A;  1FSH A;  2OF7 A;  1G4D A;  3TQN A;  3EYY A;  5EZG A;  5DD8 A;  5ICG A;  1AU7 A;  4B3A A;  2C6Y A;  4G8X A;  2HKX A;  3SFZ A;  4A3G J;  2COM A;  3ABM H;  1TWF J;  1Z05 A;  2NNY A;  2E34 A;  2B9S A;  4LIU A;  1QNT A;  3I9V 2;  4L5E A;  2PMZ N;  2W85 A;  4IF4 A;  1YTY A;  4D7M A;  4Q48 A;  2VT2 A;  5F0C A;  1X3U A;  2Y9Z A;  5BNG A;  3MKL A;  1HW1 A;  3HOV J;  3I0T A;  5FLV A;  3CJQ B;  4CDG A;  5C3E J;  1D1B A;  4IEJ A;  1KU3 A;  2A61 A;  2GXA A;  3F6V A;  3OY9 A;  3DKY A;  3TW7 A;  3GVA A;  4A3I J;  1FOX A;  4D1Q A;  2DFF A;  5B66 C;  3DBL B;  3ESW B;  4XRM A;  1S72 I;  4I98 B;  5K1Y A;  2HDD A;  1OKR A;  5F27 A;  5IT9 Z;  2JUG A;  1IN6 A;  4HYE A;  2F5C A;  4LD5 A;  2Y2Z A;  3BTC A;  4P9F A;  2BY1 A;  4A6E A;  3D5R C;  4QWQ A;  4MHG A;  2YPR A;  5E1Z B;  2E71 A;  3V4G A;  4OIO F;  3C7J A;  2M45 A;  4XN0 A;  4BQQ A;  4BDZ A;  5BQT A;  2VOP A;  1UHS A;  4RB1 A;  5IP7 J;  2R7U A;  2WAQ N;  3M07 A;  2KJB A;  5A2Q K;  1HQC A;  4ZTJ A;  2CW8 A;  2MW8 A;  1OIS A;  2JWT A;  1ZLK A;  2ELH A;  2FRH A;  3CCR I;  4RLQ A;  2GIV A;  2LF7 A;  4IQ4 A;  2CW7 A;  2HTS A;  4XRF A;  1BIB A;  5K5Q A;  4II2 A;  1TBX A;  2O5R A;  3I5U A;  5EEH A;  2VLA A;  1GXP A;  1OYY A;  1XCB A;  3CDH A;  3BCA A;  3KZZ A;  2KDZ A;  1TWA J;  2L3D A;  3T1B A;  5JHF A;  5B1B H;  4HF1 A;  2F4O B;  4XKB A;  1BN5 A;  1KU2 A;  3WTY C;  1B72 B;  3DEE A;  3EET A;  3GYH X;  3IRR A;  3W2W A;  1ZGJ A;  5HNF A;  4GCV A;  4QPO A;  3SYT A;  4LG0 B;  1Y1V J;  4D7N A;  4KT5 C;  5EEG A;  1ZAO A;  3E1S A;  2XHK A;  1G2H A;  4JX5 A;  5L3D A;  3BG7 A;  3K1N A;  1J59 A;  4WXC A;  3FMR A;  4JYK A;  1HDP A;  3UR3 C;  3CJN A;  1YLF A;  2W84 A;  2X6Y A;  1X1P A;  1D3Y A;  3ONQ A;  2KPM A;  3HXL A;  4JBA A;  1HDD C;  1M1E B;  2QQA A;  3CJT B;  2YSR A;  5JI6 A;  1D0Z A;  3H9G A;  3BR0 A;  3FWE A;  2ZXH A;  3BTL A;  1JGG A;  4A69 C;  4KNY A;  1S9H A;  1XDU A;  4DYQ A;  2PJR B;  3DEW A;  2OA4 A;  2W25 A;  3WGG A;  4IHS A;  5BMZ A;  4OU0 A;  2BBY A;  1IW7 F;  2DA4 A;  2DMT A;  3OSG A;  4KMU X;  2QQ8 A;  3QP6 A;  2QQB A;  2E2I J;  2VON A;  2WY8 Q;  4KN4 X;  5FFZ A;  2V7F A;  2YS9 A;  2X1D A;  2RKH A;  4CYC A;  2IS2 A;  3BJO A;  3BZ6 A;  2LVS A;  1QZY A;  2ZXJ A;  4A0Y A;  1JXS A;  2QKM B;  3HGY A;  4XON A;  1FY7 A;  3FMS A;  2R7S A;  3FZV A;  2IP2 A;  4AVP A;  3KYL A;  4DGW B;  3SEZ A;  3AG3 H;  2WB1 N;  2ZME A;  2IGO A;  2W48 A;  1D5V A;  3M7G A;  2XAS A;  4CZZ A;  2L4A A;  1T0F C;  3PFY A;  3GTJ J;  4BJ5 C;  1W5S A;  3I59 A;  4HA8 A;  1LEB A;  5E20 A;  3S1Q J;  1YW8 A;  2L5Q A;  2VOO A;  3LSI A;  2R7R A;  1A36 A;  4F7Z A;  1R71 A;  3PO3 J;  3ZMZ A;  4EJO A;  4KT6 A;  1ETV A;  3EUH C;  4IJA A;  2OZ6 A;  3LA2 A;  2QWW A;  4BKX A;  4AVZ A;  1YG2 A;  3F3X A;  2P5V A;  1HF0 A;  3R61 A;  1IC8 A;  2VBZ A;  4ABZ A;  2DA7 A;  3ZP5 A;  2VL8 A;  3W3C A;  4IRH A;  4BE0 A;  1OR7 C;  5TIS C;  4M73 A;  1S7A A;  5LLQ A;  5DUI A;  2E1M C;  2ICW G;  1VQP I;  2HTJ A;  1QZZ A;  2DN0 A;  2O3F A;  1ZLJ A;  1WI3 A;  4X6A J;  5ILS A;  3FK7 A;  1BOB A;  3C1D A;  5GAD J;  2O61 A;  1MH4 A;  5DD4 A;  5GAE J;  3WU1 B;  4EJT A;  3E6B A;  2B63 J;  2XRL A;  1FBQ A;  1PUE E;  5J1R A;  4ENN A;  3BCB A;  3KP2 A;  3L09 A;  2R0Q C;  2EK5 A;  3OOP A;  4BXX J;  1P92 A;  2FQ4 A;  4GYI A;  3HOU J;  4HST A;  4RBO A;  2DDB A;  2DJN A;  5DEQ A;  2XPW A;  5E3N A;  5JR3 A;  3SFI A;  1J0R A;  3F8M A;  1GUU A;  3K4J A;  1TP4 A;  3G3Z A;  3OS0 A;  1SFX A;  1DP7 P;  1OCR H;  5EJC A;  3CCQ I;  2VBX A;  3LAP A;  4UV9 A;  1S3J A;  3I54 A;  4NC7 A;  5J40 A;  2B0L A;  3H35 A;  3QYE A;  5KAI C;  3QU3 A;  4IOC F;  4BE1 A;  1IO2 A;  1U78 A;  1UZC A;  3PNV A;  4PZJ A;  4F55 A;  3CO7 C;  2RAE A;  1FPQ A;  3OYE A;  5DTD A;  5DCM A;  4DNC A;  4AIK A;  1G3Y A;  1I3A A;  1K79 A;  2DI3 A;  3BRO A;  3H3V K;  4BJT A;  1TL8 A;  3OS1 A;  1MBG A;  4P5O A;  1UHM A;  4YEJ A;  1YFH A;  3K69 A;  2V1N A;  1W5C C;  2F48 A;  2I8D A;  4M3E A;  4KYW A;  3MMY B;  3J7A Y;  1USS A;  4UVA A;  4QSH A;  5D5W B;  2RDP A;  3ZMU A;  4CYC B;  2XKP A;  2PBI A;  3S2H J;  4LG3 A;  3K2Z A;  3TO7 A;  3ERE D;  2O7O A;  3FXO A;  1LFU P;  1WH7 A;  2IPQ X;  5D5U B;  1EH8 A;  3T5X A;  3OYD A;  3MD2 A;  1TC3 C;  4UUT A;  1UST A;  1F4K A;  3LAJ A;  5HDG A;  4J01 A;  2ZME B;  3TO6 A;  4G12 A;  1YI2 I;  5AON A;  1YJN I;  1N78 A;  3CMM A;  5H20 A;  2OQR A;  2PEX A;  2OZU A;  4A12 A;  1TWH J;  2QF7 A;  4UB6 C;  2V6E A;  4HOB A;  2UZK A;  2IGN A;  3I59 B;  3EPZ A;  3KE2 A;  5LBQ A;  3GBG A;  5F6F A;  4S0H B;  5CQE A;  4DBQ A;  3CCL I;  2DT7 B;  4MIM A;  5LRS A;  1J75 A;  4XLF A;  2GXB A;  3V7C A;  3CF5 F;  1FLI A;  5HOD A;  2VUM J;  1X1B A;  1LPQ A;  1HBX G;  1FC3 A;  1WJD A;  3B73 A;  3FBN B;  2QBY A;  4IL6 C;  5IP9 J;  3DCF A;  4D5F A;  5C4X J;  5JVT A;  1S7E A;  1IN5 A;  2MBF A;  1FOK A;  2MGQ A;  2QYO A;  3NWT A;  2CQX A;  1HLV A;  1K6Y A;  5K7H A;  1YHQ I;  4QPQ A;  3VSK A;  3JRC A;  2BV6 A;  4L5I A;  4XL9 A;  4BGD A;  2DMN A;  3JRH A;  1MNM C;  2XC7 A;  1QVU A;  4XN3 A;  2HQR A;  3I71 A;  3RPQ A;  3DFG A;  1FNN A;  3S3O A;  4PFP A;  2L0K A;  5CVU A;  2XGC A;  2L2O A;  3SQN A;  3VPR A;  2HDW A;  4C3I J;  3K9T A;  3OIO A;  5E8I A;  1WJC A;  2FUG 2;  3KP3 A;  5J47 A;  3BTJ A;  1VQN I;  1UEL B;  1Q1V A;  3KZY A;  5GAG J;  2FEZ A;  1ETX A;  3G1M A;  4K2E A;  2XAJ A;  3ZGK A;  3ROU A;  1IZ1 A;  3UKG A;  1LDK B;  1BI0 A;  2Z5U A;  3ZN1 A;  1VQ8 I;  4B3X A;  1IV8 A;  4ITV A;  3DPU A;  3P5J A;  2BVM A;  2HOS A;  4IHV A;  3KEY A;  2NRA C;  2HVS A;  2HNH A;  4Y4R A;  5FJ8 J;  3RI4 A;  1ZYR F;  3V8K A;  1U0J A;  3PIP F;  4CHU A;  3H3U A;  3CD6 I;  1FT9 A;  2MAB A;  1CQT A;  1ULY A;  4KN7 X;  2XRO A;  5BOX A;  1FTZ A;  3F6O A;  3F21 A;  1ERD A;  2HYJ A;  3CLQ A;  1U5T A;  2P6T A;  2ZNY A;  3T8T A;  4OOI A;  3P9C A;  2FOW A;  1PYV A;  2K7L A;  2A07 F;  2ID6 A;  2F6C A;  1IN8 A;  2EQR A;  1D8K A;  2KRC A; 
#chains in the Genus database with same CATH homology
 1PP7 U;  3WG9 A;  1Z9C A;  1U3E M;  2Z3Y A;  3GFI A;  2VOD A;  3GF2 A;  4ETS A;  4D0P A;  3EYI A;  2EA2 A;  1O3Q A;  1KU9 A;  2JRT A;  4UVB A;  3WU0 A;  2CYY A;  1SFU A;  4UUV A;  4YG2 F;  3W6J B;  2XVC A;  3IHU A;  4QLC U;  1R5G A;  2KIU A;  5FD5 A;  1R7J A;  3WTW C;  2X4H A;  4U0V A;  4MQ9 F;  3BDD A;  2V6C A;  4M74 A;  1U2W A;  2HYF A;  4Y13 A;  3DV8 A;  2CQK A;  2DTR A;  3DPL C;  3KEO A;  3T8R A;  4OIP F;  3DEU A;  4EM0 B;  2K27 A;  1EV7 A;  2MH9 A;  2LSO A;  5KVR A;  1ON2 A;  3WTZ A;  1V3F A;  2QBY B;  4KFC A;  3DXJ F;  3J80 K;  1RNL A;  4HW0 A;  3GFL A;  1QGP A;  4BAY A;  5L3C A;  2EV6 A;  2ZCW A;  2VXZ A;  5LHH A;  1GVJ A;  3CO6 C;  2P8T A;  1ZG3 A;  4EV0 A;  4WX9 A;  3FXR A;  2ISZ A;  1HW5 A;  3PQK A;  3ZMV A;  1I6X A;  3KLO A;  4A5N A;  1YO5 C;  4LK1 F;  3COA C;  2R7F A;  1Z91 A;  2OU2 A;  1W7P A;  4OIQ F;  2RGV A;  1JE8 A;  1G6N A;  1EH7 A;  4IPA A;  4CO8 A;  3I4P A;  5FLX K;  2JZY A;  5LEJ A;  3J81 Z;  1WWX A;  1U5T B;  4FHT A;  1JHH A;  1XGS A;  2A68 F;  2IRF G;  2V1X A;  3QAH A;  2YU3 A;  1SD5 A;  3NQO A;  1J9I A;  2FQ3 A;  1QQI A;  1CF7 B;  4KIG A;  2O0Y A;  4ENK A;  1H9T A;  3WTV C;  2UXN A;  1F9N A;  2PQ8 A;  1FP1 D;  4Y17 A;  4IXA A;  4NQW A;  2NAZ A;  3ZPL A;  3BPV A;  4JK1 X;  5DUK A;  5JFR A;  2GA2 A;  1MKM A;  3KP7 A;  1ONV A;  2LNB A;  1W4M A;  3TKY A;  5CYV A;  4AIJ A;  3LFK A;  2XV4 S;  2CW0 F;  3QRF F;  3KFW X;  5ED4 A;  4P55 A;  4I0B A;  3KP4 A;  2HKO A;  2MD5 A;  4RAY A;  1RUO A;  4EJW A;  2QVO A;  3BP8 A;  3KET A;  1R23 A;  2EV5 A;  4ESF A;  1QBJ A;  4RS8 A;  4PDK A;  4UXN A;  2LDU A;  4L18 B;  3U2R A;  3FHZ A;  4KIB A;  3RKX A;  3ULQ B;  1MJ9 A;  4BQA A;  2NS0 A;  3RJP A;  3JTH A;  3MWM A;  2IA2 A;  3M1E A;  1LDJ A;  1SFE A;  1W7P B;  3E6M A;  4CIC A;  3V8L A;  1SMY F;  2MA3 A;  4MGR A;  3TDU C;  1HW2 A;  2FE3 A;  2Q2E A;  4O6J A;  5D6F A;  1K78 A;  1WRJ A;  2DPD A;  3U1D A;  3K1P A;  4HQM A;  2HZT A;  5L3B A;  2Y0M A;  4UHT A;  4LJZ F;  4BYY A;  2HWV A;  4L9J A;  3HSR A;  4MEX F;  1W7P D;  5ILV A;  5FB2 A;  4GYG A;  1SD7 A;  2QQ9 A;  4Q47 A;  2Z9O A;  3KP6 A;  3MAJ A;  2RQP A;  2ZJ2 A;  2DPU A;  1TNT A;  2FMY A;  5L3E A;  3HOS A;  1CGP A;  4ENJ A;  4S05 A;  3Q9S A;  3L2C A;  1ZG1 A;  1YIO A;  4MNU A;  4YFK F;  3H92 A;  2HQN A;  3B02 A;  4WF2 A;  2XAF A;  4TV7 A;  2NYX A;  3JAM K;  1T98 A;  2XAG A;  4G94 A;  4HLX A;  4WXD A;  4AD9 A;  1C0W A;  5HOO A;  1B9N A;  4I0A A;  2JT1 A;  3CUQ A;  4XBF A;  2P4W A;  3J80 Z;  3PQJ A;  4WXH A;  2MC3 A;  2YR2 A;  3M9A A;  1LDD A;  4XLN F;  4KIF A;  1ZHF A;  5FO5 A;  4EVI A;  5LHG A;  4NB5 A;  3ZMT A;  1DPR A;  5TRD A;  2XKO A;  4AWX B;  1R1U A;  5LGN A;  4WK8 F;  4G7Z F;  4E70 A;  1LNW A;  3E3V A;  5HDK A;  1GXQ A;  4B09 A;  4P9U A;  1PDN C;  2RVC A;  2W24 A;  1K78 B;  4YIF A;  3R0J A;  2ISY A;  5HLG A;  4L9N A;  4P96 A;  2BEO A;  3T0Y A;  5FLX Z;  1S8N A;  2GXG A;  2FA5 A;  2P6S A;  2R3S A;  3GFJ A;  4A2U A;  3ABT A;  3HSE A;  3GXO A;  1XB4 A;  1J5Y A;  1TTY A;  4LMY A;  1BOA A;  1O3S A;  1H9G A;  2GQQ A;  1IXR C;  2R7D A;  2ESH A;  2F5F A;  2JPC A;  2VC1 A;  2KRF A;  4LLG F;  4CYD A;  1JGS A;  5ICC A;  3CUO A;  1REP C;  3O3K A;  1O3R A;  4OMZ A;  2AS5 F;  1XSD A;  2FOK A;  4YFN F;  4ON0 A;  1QPM A;  5CVR A;  3SZT A;  2F5E A;  3U9G A;  1NHA A;  2QEN A;  2JSC A;  1FYL A;  1RIO H;  4XSZ F;  3IC7 A;  4ESB A;  3CUQ B;  5HS8 A;  1GHC A;  3WTT C;  3HSF A;  1BI3 A;  1SD4 A;  1R00 A;  4O5V A;  5AIP A;  2EFQ A;  3BJA A;  5K5O A;  5TJJ A;  1ZRF A;  2XRN A;  3W6K B;  2FNA A;  1BC8 C;  3O6B B;  1IUY A;  2G9W A;  4A0X A;  2RV8 A;  3G73 A;  4G7O F;  3RYP A;  4ZYG A;  3RTR A;  1IXS B;  2ESN A;  4M9X A;  2HS5 A;  3RYR A;  5DCF A;  3F8B A;  1HKT A;  1YQA A;  1B4A A;  2H6B A;  1ZN2 A;  4HX4 A;  2EFW A;  3V8J A;  1KA8 A;  1KYZ A;  3P9K A;  4AIH A;  3WTX C;  2KKO A;  1K6O A;  1FBU A;  2MLG A;  5K5R A;  2FF4 A;  2P5K A;  4ZZL A;  4L5J A;  2L02 A;  2E1C A;  4HLY A;  1F5T A;  4KA4 A;  5HS7 A;  3GWZ A;  3M8E A;  3GZ5 A;  3ABU A;  2EFO A;  3VOD A;  5A2Q Z;  2CFX A;  4HV6 A;  1AWC A;  2Y48 A;  4ENM A;  3VFZ A;  3WTS C;  2FBH A;  2ZBK A;  4RAZ A;  5ICE A;  2J5P A;  1Z6T A;  3JAM Z;  2WV0 A;  5L3F A;  4ZYE A;  3TDZ C;  2RC4 A;  1Y0U A;  4GXO A;  1U8R A;  5DCM B;  2F5D A;  2HR3 A;  3ELK A;  3WE3 A;  1SD6 A;  4BHB A;  2PI0 A;  4ZYD A;  1YW9 A;  4L9V A;  3FF5 A;  5D4S A;  4N9I A;  1MGT A;  2DLL A;  2UWM A;  2MH2 A;  3QPT A;  4N9H A;  2KIM A;  2VBY A;  1SMT A;  3LQQ A;  2FML A;  4H0E A;  2WTE A;  1I27 A;  2QLZ A;  4CGZ A;  4HBL A;  2EV0 A;  1ZH5 A;  2J5O A;  4EQQ A;  2E1N A;  1BC7 C;  3SHF A;  3VB2 A;  1SAX A;  1R22 A;  4IRI A;  3F8F A;  2WC2 A;  1B1B A;  2HDC A;  2A6H F;  3F72 A;  3ZQ7 A;  2EFN A;  3ZMS A;  4OIR F;  5HDN A;  4Q5S F;  2VE8 A;  1G3S A;  4O3M A;  3TOB A;  4HDV A;  3E97 A;  2PMH A;  1XDS A;  1Z6R A;  1KGS A;  4KIC A;  3MQ0 A;  1HST A;  1H0M A;  3ZN0 A;  2CWE A;  1YS6 A;  5CVJ A;  4I01 A;  3WOD F;  2XAH A;  2FU4 A;  4Y15 A;  5CLS A;  1RZ4 A;  3HHH A;  2Y75 A;  5ERI A;  3IKV A;  1I1G A;  1BI1 A;  1V4R A;  4GO1 A;  4DQ2 A;  5HVQ C;  1VTN C;  4UNO A;  5J8F A;  5CVI A;  3DF8 A;  4RB2 C;  2O6G E;  4HF2 A;  3IRQ A;  1KQ9 A;  1TQP A;  4M6Y A;  5F1R A;  3NEU A;  3VOE A;  2A5Y B;  1E17 A;  1S7O A;  3HIF A;  2AXL A;  2ACJ A;  5BPD A;  3JSP A;  4A0Z A;  1KYW A;  4M9Z A;  2DK8 A;  3MFK A;  1XGN A;  4YII A;  4KDP A;  4ESJ A;  2BGC A;  2GAU A;  3HUG A;  1P6R A;  3LA7 A;  3J7A O;  3M8F A;  3MZH A;  2F2E A;  2PFB A;  1U5T C;  2QM3 A;  3BPX A;  2ADU A;  3JTG A;  2ZFW A;  5J6X A;  1ON1 A;  4UVC A;  5CJ9 A;  3H3Z A;  1FP2 A;  2G7H A;  2FBK A;  1T2K A;  5BPI A;  3RKY A;  1IXC A;  4OIN F;  4ZH4 F;  4U7D A;  3FMQ A;  2GZW A;  3E6D A;  2FNP A;  1T0F A;  1WKM A;  3QPH A;  4R79 A;  3EUH A;  4BH9 A;  3BOQ A;  4Z2Y A;  3ZMD A;  2CO5 A;  4R8H A;  4RB0 A;  1XD7 A;  2IA0 A;  4Q4Z F;  4BHC A;  2DW4 A;  4M71 A;  1ODD A;  1OR7 A;  3IWF A;  4IVN A;  6PAX A;  1XGM A;  1HXD A;  2K4J A;  3WGI A;  3RPU A;  1XMK A;  4ZZD A;  5E1X A;  1B6A A;  2CGP A;  1I5Z A;  1IN7 A;  1KU7 A;  2Q0O A;  5FD6 A;  1LQ1 A;  3Q9V A;  3R6S A;  3CTA A;  4XLP F;  4G6D A;  4RB3 C;  3ML6 A;  1KQ0 A;  1S6L A;  2CSO A;  1MD0 A;  5CVV A;  1R58 A;  3V7S A;  1ZAR A;  1TLH B;  2OBP A;  4MQV A;  3MEX A;  1IF1 A;  2VBW A;  2K02 A;  2L4M A;  2XAQ A;  1L3L A;  4JQF A;  2NNN A;  2KIF A;  2D2W A;  5LGT A;  1XGO A;  2VC0 A;  2ZKZ A;  1WSU A;  1O57 A;  3GLX A;  1ZRC A;  5D5X B;  1W5T A;  1RI7 A;  2STW A;  2H27 A;  2DO7 A;  2HYG D;  4M9S A;  4M6X A;  2X0L A;  4G6Q A;  1UCR A;  2DFI A;  3V7R A;  4I2O A;  5HS9 A;  5D8L B;  3LQR A;  2QUF A;  2W57 A;  1IN4 A;  2ZNZ A;  1FWZ A;  3DKW A;  3FXQ A;  2WWY A;  4M72 A;  3N4M A;  1YW7 A;  4WWC A;  1YYV A;  5BS6 A;  1WI9 A;  3EQL F;  1BIA A;  1ZGA A;  1DDN A;  1D8J A;  3HOT A;  2EJR A;  3IL2 A;  4BHP A;  1HSJ A;  4LLL A;  3DPT A;  2IW5 A;  3VEP A;  3P7N A;  4LGW A;  2VE9 A;  4A5M A;  4FX0 A;  5D6E A;  3WGH A;  3C18 A;  5ILU A;  1LJ9 A;  3GX4 X;  4GGG A;  4R1H A;  2DAO A;  3F22 A;  1UHW A;  2HFH A;  5KK1 A;  3QP5 A;  3HTS B;  3LWF A;  1KQ8 A;  3ISP A;  4N0B A;  3F8N A;  2EA4 A;  3FM3 A;  5DV5 A;  3NRV A;  5LHI A;  4LB6 B;  4EGZ A;  1ZRD A;  2P5L C;  3C3W A;  3E5X A;  3RIR A;  1P4X A;  2EB7 A;  5HLI A;  1TQI A;  2FBI A;  3HRU A;  1R1T A;  2D1V A;  1A04 A;  3R4K A;  1P4W A;  1T6S A;  2ZO4 A;  4L0Z B;  1FYM A;  2XUB A;  2PG4 A;  3O2P E;  1DPU A;  1L0O C;  1MZB A;  3N97 A;  3F23 A;  3SXY A;  1J2X A;  5J8C A;  4UV8 A;  1G3T A;  3RDI A;  3KLN A;  3J81 K;  4LB5 A;  1BBY A;  1G3W A;  3R60 A;  4HDU A;  2MLK A;  2PN6 A;  3JSO A;  4YFX F;  1DUX C;  2L54 A;  3EDP A;  3SZP A;  4PGG A;  2HEO A;  1T39 A;  2E7X A;  1P4A A;  4HF0 A;  4MEY F;  2IA1 A;  4EJV A;  4S04 A;  4EJU A;  4U0W A;  5LGU A;  1R5H A;  3S2W A;  1XMA A;  2QZ8 A;  1OYI A;  1BJA A;  1B9M A;  2JPB A;  3CUQ C;  1TNS A;  2YX4 A;  2G7U A;  3PFI A;  1IAW A;  2PMU A;  3WTU C;  1XSX A;  3GEZ A;  1MDM A;  2K86 A;  5H6Q A;  5D4R A;  4A6D A;  3WE2 A;  1XSV A;  3L00 A;  4KUM A;  1FYK A;  1PP8 F;  3HRS A;  1R36 A;  2XGX A;  2IVM A;  1Z7U A;  4BXU A;  2P7C B;  2EWN A;  2YX7 A;  4KMF A;  4EM1 A;  4XSX F;  3I58 A;  5IT3 A;  4LFU A;  2XIG A;  1ZG5 A;  4FT8 A;  2DBB A;  2CG4 A;  1OYW A;  3DQV C;  3R0A A;  1K7A A;  2GWR A;  2K4B A;  2UXX A;  4RGR A;  2M8E A;  2OAZ A;  2DK5 A;  2JTV A;  3ECH A;  3FXU A;  4B8X A;  5L3G A;  1XN7 A;  2H09 A;  2OD5 A;  5DDG A;  1T38 A;  3MZY A;  4RGS A;  1FX7 A;  2HOE A;  2M5W A;  1STZ A;  2O03 A;  3BJ6 A;  5ICF A;  2ETH A;  1RUN A;  3KP5 A;  2V1D A;  1JHF A;  2A3S A;  1I1S A;  2BYV E;  1MJA A;  5D8K B;  3DP7 A;  5IT9 K;  3FX3 A;  5LEK A;  2OQG A;  4MTE A;  1UB9 A;  5E18 F;  4L9T A;  5F64 A;  4G7H F;  3K1M A;  2Q8K A;  3JW4 A;  2HGC A;  1BI2 A;  2P7V B;  3I53 A;  4HZF A;  5D5V B;  4BNC A;  1CF7 A;  2V1U A;  3QU6 A;  4LK0 F;  3TGN A;  4HQE A;  3LST A;  3AAF A;  1MDM B;  3ECO A;  4I7H A;  4LLN A;  2V79 A;  3HTU A;  1TW3 A;  5LRR A;  2IT0 A;  3TOA A;  1TW2 A;  3KCC A;  1QO0 D;  1O7F A;  4U0Y A;  2L01 A;  3BWG A;  2DT5 A;  1LVA A;  3L9F A;  1Z1D A;  3FM5 A;  2KJC A;  3P9I A;  3HHG A;  2RNJ A;  3IWZ A;  2DQL A;  3Q5F A;  2TDX A;  3GZ6 A;  4EMS A;  2A6E F;  4HAM A;  3QOP A;  3LA3 A;  2GA1 A;  5FGM A;  2M30 A;  3F8C A;  1FSE A;  3HRM A;  4HX7 A;  4ASN A;  1IRG A;  4NHJ A;  1S29 A;  4EM2 A;  3D0S A;  1P2F A;  3E6C C;  4L0Y B;  5HLH A;  2EFP A;  1ZRE A;  4I02 A;  1Q1H A;  4FX4 A;  2M87 A;  2D1H A;  2DQR A;  3MCZ A;  2FXA A;  2H6C A;  1O7L A;  4HX8 A;  1EH6 A;  1LEA A;  1OPC A;  4PGH A;  3GW2 A;  4IHT A;  1AOY A;  1HKQ A;  2PJP A;  3K0L A;  2STT A;  4EGY A;  1YS7 A;  3OV8 A;  4U88 A;  2A69 F;  1J7K A;  2RN7 A;  2Z33 A;  3KEQ A;  3L7W A;  3E5U A;  5E1W A;  1FZP B;  1BM9 A;  1UFM A;  2FSW A;  3GO5 A;  1U6G A;  2VT3 A;  2H94 A;  4WCG A;  1O3T A;  5AIQ A;  2LKP A;  2IJL A;  1E2X A;  3D5L A;  1LB2 A;  4IRG A;  3TO9 A;  2V9V A;  1MJB A;  2Z99 A;  1XCV A;  2O8X A;  4ZYH A;  4U7B A;  3CLO A;  1F1Z A;  3GFM A;  3GUD A;  2D45 A;  1B59 A;  5JHU A;  3HRT A;  4LG0 A;  1FBS A;  1OMI A;  2M1B A;  1IRF A;  1R1V A;  3E5Q A;  4OMY A;  4RGX A;  3REO A;  1TQM A;  5FFX A;  2DU9 A;  5DYM A;  4CXF A;  1HKS A;  2LF8 A;  2BE5 F;  4HV5 A;  4I09 A;  2E7W A;  3HYI A;  2PLY A;  4RGU A;  5H6R A;  4G9Y A;  4PCQ A;  3BY6 A;  3IKT A;  3I64 A;  3RKW A;  4MTD A;  5E17 F;  1WQ2 A;  5E8G A;  2VN2 A;  1FSH A;  1G4D A;  3TQN A;  3EYY A;  5ICG A;  5DD8 A;  2C6Y A;  4G8X A;  2HKX A;  3SFZ A;  2COM A;  1Z05 A;  2NNY A;  1QNT A;  4IF4 A;  2W85 A;  1YTY A;  4Q48 A;  2VT2 A;  1X3U A;  1HW1 A;  3I0T A;  4CDG A;  1KU3 A;  2A61 A;  3F6V A;  3GVA A;  4I98 B;  5K1Y A;  1OKR A;  5IT9 Z;  1IN6 A;  4HYE A;  2F5C A;  4LD5 A;  4P9F A;  4A6E A;  4QWQ A;  4MHG A;  2YPR A;  5E1Z B;  3V4G A;  4OIO F;  3C7J A;  2M45 A;  5BQT A;  2VOP A;  4RB1 A;  2KJB A;  5A2Q K;  1HQC A;  1ZLK A;  2ELH A;  2FRH A;  2GIV A;  2LF7 A;  2HTS A;  4XRF A;  1BIB A;  5K5Q A;  1TBX A;  3I5U A;  5EEH A;  1GXP A;  1OYY A;  1XCB A;  3CDH A;  3KZZ A;  3T1B A;  2L3D A;  4HF1 A;  1BN5 A;  1KU2 A;  3WTY C;  3EET A;  3GYH X;  3IRR A;  1ZGJ A;  4GCV A;  4LG0 B;  4KT5 C;  5EEG A;  1ZAO A;  2XHK A;  5L3D A;  3K1N A;  1J59 A;  4WXC A;  3FMR A;  3CJN A;  1YLF A;  2W84 A;  1D3Y A;  4JBA A;  2QQA A;  2YSR A;  5JI6 A;  3FWE A;  4KNY A;  1XDU A;  2OA4 A;  2W25 A;  3WGG A;  4IHS A;  5BMZ A;  4OU0 A;  2BBY A;  1IW7 F;  4KMU X;  3QP6 A;  2QQB A;  2VON A;  4KN4 X;  5FFZ A;  2RKH A;  3BJO A;  3BZ6 A;  1QZY A;  2ZXJ A;  4A0Y A;  1JXS A;  1FY7 A;  3FMS A;  3FZV A;  2IP2 A;  4AVP A;  2ZME A;  1D5V A;  3M7G A;  2XAS A;  4CZZ A;  2L4A A;  1W5S A;  3I59 A;  4HA8 A;  1LEB A;  5E20 A;  1YW8 A;  2VOO A;  4F7Z A;  3ZMZ A;  4EJO A;  4IJA A;  2OZ6 A;  3LA2 A;  2QWW A;  1YG2 A;  3F3X A;  2P5V A;  3R61 A;  2VBZ A;  3ZP5 A;  4IRH A;  4M73 A;  1S7A A;  5LLQ A;  5DUI A;  2HTJ A;  1QZZ A;  2O3F A;  1ZLJ A;  5ILS A;  3C1D A;  2O61 A;  5DD4 A;  3WU1 B;  4EJT A;  3E6B A;  1FBQ A;  1PUE E;  4ENN A;  3KP2 A;  3L09 A;  2EK5 A;  3OOP A;  1P92 A;  4GYI A;  5DEQ A;  5JR3 A;  1J0R A;  3F8M A;  3G3Z A;  1SFX A;  1DP7 P;  2VBX A;  3LAP A;  4UV9 A;  1S3J A;  3I54 A;  2B0L A;  3QU3 A;  1U78 A;  4PZJ A;  3CO7 C;  1FPQ A;  4DNC A;  5DCM A;  4AIK A;  1G3Y A;  1K79 A;  2DI3 A;  3BRO A;  4P5O A;  1UHM A;  1YFH A;  3K69 A;  4KYW A;  1USS A;  4UVA A;  5D5W B;  2RDP A;  3ZMU A;  2XKP A;  2PBI A;  3K2Z A;  3TO7 A;  3ERE D;  2IPQ X;  5D5U B;  1EH8 A;  3T5X A;  1UST A;  1F4K A;  3LAJ A;  5HDG A;  2ZME B;  3TO6 A;  5AON A;  5H20 A;  2OQR A;  2PEX A;  2OZU A;  4A12 A;  4HOB A;  2UZK A;  3I59 B;  3KE2 A;  5LBQ A;  5F6F A;  5LRS A;  1J75 A;  2GXB A;  3V7C A;  1FLI A;  1HBX G;  1FC3 A;  3B73 A;  2QBY A;  5JVT A;  1IN5 A;  2MBF A;  1FOK A;  2QYO A;  2BV6 A;  4L5I A;  2HQR A;  3I71 A;  3RPQ A;  3DFG A;  1FNN A;  5CVU A;  3SQN A;  3K9T A;  5E8I A;  3KP3 A;  3KZY A;  2FEZ A;  4K2E A;  2XAJ A;  3ROU A;  1IZ1 A;  3ZN1 A;  1LDK B;  1BI0 A;  2Z5U A;  2NRA C;  3RI4 A;  1ZYR F;  3V8K A;  4CHU A;  3H3U A;  1FT9 A;  1ULY A;  4KN7 X;  2XRO A;  5BOX A;  3F6O A;  3F21 A;  1U5T A;  2P6T A;  2ZNY A;  3T8T A;  4OOI A;  3P9C A;  2A07 F;  2K7L A;  1IN8 A;  1D8K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...