2L7FP

Solution structure of the pitx2 homeodomain
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
68
structure length
68
Chain Sequence
b'GSQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKREEFIVTD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pituitary homeobox 2
publication title Solution Structure of the Pitx2 Homeodomain
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 20
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2010-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2l7fP00
1OCTC 4X6AJ 1HLVA 4JX6A 2DA6A 1JKQC 5M3FJ 4XICA 3HGGA 1Y1VJ 5EGOA 2JWTA 2WV1A 3BR6A 3QPSA 1H8AC 5J3LA 3E7LA 4IHWA 3D1NI 2LR8A 3A03A 3GTKJ 2B63J 1QVTA 1LE8B 2R92J 4C3HJ 3OSFA 2M2EA 3LSPA 1UHSA 1TWFJ 1UMQA 3LNQA 2CUFA 5FKLA 2E2JJ 4D7MA 1OFCX 3UKGA 1A5JA 3GTLJ 4CYCA 3TP3A 1BA5A 1K61A 5M5YJ 3IV5A 3LSGA 2IAIA 1ENHA 1ZKGA 4AC0A 2CJJA 1LFBA 1ZR4A 4S0HB 3G1MA 2DA1A 2TCTA 1ETYA 3F0CA 2HXOA 1VF9A 1O4XA 3BTIA 5JLWA 1MBHA 1H89C 4IHXA 3S14J 4A3JJ 3M3YJ 2Y2ZA 2FD5A 3WHCA 1NTCA 2NS8A 2EQRA 2ZB9A 2ME0A 2Y9ZA 2XGCA 2K9SA 1X2NA 2HI3A 2JA5J 2L7MP 4MO7A 2VI6A 3ZQHA 5C4XJ 4I76A 2XSDC 3S1RJ 1TC3C 2CRGA 2K40A 3H3VK 2DJNA 2R0QC 2DTZA 5C44J 3Q0UA 2FX0A 3GBGA 3BR5A 2VPRA 2XB5A 3HOZJ 3S2HJ 1P7IA 4M3GA 3JRIA 1B8IB 1JJ8C 5FLVA 3S1QJ 4D7NA 1T56A 2P81A 4A3FJ 1FEXA 2XPVA 3WHBA 3S1MJ 2XPUA 3QQAA 4RDUA 1OJLA 2YUSA 2DMQA 4V2GA 1HF0A 1ITYA 3BR1A 4XRMA 4I6ZA 2LFBA 2LK2A 2DA2A 1PUFA 4UUSB 2ELKA 3O8GA 3JRCA 3GTOJ 4G12A 1WPKA 1MBGA 1D5YA 1QRYA 3S1NJ 4DW6A 3LOCA 1MBJA 2JJ7A 4HNVA 4M3BA 2R5YB 2OF7A 5FKMA 3SJMA 3G1LA 1SANA 5EDNA 4M3FA 4J19A 2NVYJ 2DA5A 1S7EA 5EF6A 1AKHA 1U9OA 4C3JJ 3B6AA 4UUTA 3TEDA 2DA7A 4DYQA 2TRTA 5IP9J 1ZGWA 4IHYA 3K2AA 5IP7J 1ETWA 5E3OA 1ETQA 2DN0A 2DMNA 2R5ZA 2MSYA 5EEAA 1Z0XA 3H0GJ 5F1JA 3A02A 2E1OA 4QTRA 2H8RA 1MH3A 3PO3J 5EG0B 5JLXA 1X58A 5M3MJ 1IGNA 3BQZA 1E3OC 1U78A 2M9HA 3RQIA 2L9RA 2L7ZA 3S15J 3S17J 4BBRJ 4FTHA 2DMPA 3Q0VA 2W48A 3CQZJ 4LOCA 3TP0A 9ANTA 1JGGA 4IHVA 5FKNA 5IP6A 3HEFA 3A01A 1IV6A 4DZJA 2LLKA 1MSEC 2Y9YA 3FK6A 4JX4A 1MBKA 3OSGA 5GPAA 2AHQA 2NS7A 1IC8A 1JJ6C 3BG5A 2K9QA 5K7ZA 1JUPA 1B72A 1U8BA 2JMWA 1AHDP 3W6VA 1WI3A 2ID3A 3BTCA 1ETKA 3HOXJ 1K83J 2LY9A 5IYCJ 4L5EA 3GTGJ 3JRAA 1ZTRA 5EZGA 3B6CA 5F0HA 5IOZA 5EGOB 3BR3A 4MFEA 3RZDJ 2Y30A 4NDLA 1HDPA 3VPRA 1GUUA 5J1UA 2LD5A 2I10A 5F04A 5C3EJ 2PMZN 1ZK8A 2ME6A 2DMUA 2AO9A 5J1RA 3GTPJ 3JRFA 1GDTA 4MLOA 3ZQLA 4A3GJ 1SFOJ 3C2BA 3MKLA 3K7AJ 1H88C 1GV2A 3FKIJ 1U9NA 1XS9A 3Q3SA 5IPAA 4A3BJ 2LVSA 3BR2A 2VUMJ 3GTQJ 1JT6A 1FTZA 3BQYA 5DS9A 1W0UA 1JTYA 2DA4A 5F0CA 1QVUA 2E19A 1A6IA 4A93J 2DMTA 2VKEA 2HXIA 2MGQA 4AYBN 1IJWC 4M3EA 3I4NJ 5DTDA 3I4MJ 4CYCB 2FJ1A 3QPLA 5F0FA 1JTXA 1MBFA 5K7FA 2K9NA 2IEKA 3HGYA 3OOUA 2XB0X 3FK7A 1WGXA 1YRNA 2H1KA 1Z77A 4D5CA 3S2DJ 2NVTJ 3BTJA 4RBOA 1RESA 2XGDA 5IOYA 2EZKA 1IDZA 4A3MJ 4ABZA 4QIWN 1CQTA 2LTPA 2FQ4A 1ETXA 1VFCA 1NK3P 2NVXJ 2JA6J 1LE8A 5K7HA 4FE7A 3HOVJ 1FTTA 5E3NA 3DEWA 5M5XJ 1RETA 1DU6A 1MH4A 1BW5A 3IH4A 3CCYA 2L0KA 1G2HA 2JA7J 1VNDA 3ZQFA 1TWCJ 1APLC 4A3DJ 2WAQN 1FJLA 1ETOA 4W1UA 1BW6A 3S16J 3Q0WA 3HM5A 3HDDA 1W0TA 2WB1N 3BTLA 5GP9A 2O8KA 3PO2J 4JP0A 3BT9A 3TW6A 1JKPC 2Y31A 5E3LA 1T33A 4A69C 3JRDA 1GV5A 1JUMA 3L1PA 1IUFA 2COBA 1RPWA 4DZPA 3TW7A 4A3KJ 4M3DA 4XIDA 4Y52J 4FE4A 3PM1A 5J1YA 2HOTA 3BR0A 3HB9A 5GPCA 2G0EA 2HYJA 1PUFB 1FIPA 1ETVA 4JX5A 5FLMJ 1WCMJ 4MFDA 2LKXA 5F08A 5BNGA 3BG3A 3OIOA 1LFUP 5M5WJ 4B1RA 2OPTA 1Q1VA 1TWHJ 4BKXA 1EF4A 1TWGJ 2LP0A 4BXXJ 1Y1WJ 4FISA 3LSJA 1BL0A 2M34A 4MIMA 3ZQCA 2CQXA 5IYDJ 4XRSA 2IBDA 3RZOJ 2M8GX 2O7OA 4AUXA 1AKHB 5EZHA 1B8IA 3IH3A 1ZR2A 2KDZA 1F43A 2Y0SN 1DU0A 1ZQ3P 4B4CA 1IDYA 2ECBA 2L7FP 2VKVA 5EYRA 5FKOA 3GTJJ 2HOSA 3ZQGA 4Y7NJ 5FJ8J 3SFIA 1I3QJ 2HQ5A 2XGEA 4IEJA 2R5ZB 1MSFC 4JYKA 3JRHA 3HOWJ 3CMYA 1RKWA 2M0CA 3JRBA 3O8HA 2NVQJ 2XPWA 4B3AA 1OCPA 3MN2A 2EBIA 4QSHA 4UUSA 1NK2P 1FIAA 3MVPA 2CU7A 1F36A 2GBYA 4BY1J 2QCOA 2YU9J 2KT0A 4DYRA 4XK4A 3HOYJ 2R5YA 5E3MA 5C4JJ 3A01B 4A3LJ 4V2FA 2R7ZJ 1IRZA 1UG2A 3SDGA 2MW8A 2GM4A 1ORKA 4M6VA 3RKQA 1HOMA 5HODA 1VI0A 1GT0C 3BG9A 1MNMC 2JN6A 2XRLA 2HOAA 5IYBJ 2CQQA 4DYCA 1B72B 2NOGA 4X1EA 2D5VA 3M4OJ 1TWAJ 2EZLA 2X6OA 3HBLA 4BY7J 4A3CJ 3CDLA 3ZQIA 1RKTA 2R93J 5F27A 2EZHA 1P7JA 3HOUJ 4GFBA 1R9TJ 4EEFG 1QPIA 2MG4A 2YS9A 3FISA 1RR7A 1BJZA 2DA3A 2X9DA 1POGA 2QF7A 2N8GA 4FCYA 1IG7A 4BBSJ 1XG1A 1MBEA 1X2MA 1I50J 5EG0A 1HCRA 1AU7A 3LSRA 1JT0A 2CUEA 2HDDA 3GTMJ 4D5FA 2O9LA 3NAUA 1HDDC 2RAEA 2JA8J 4A3IJ 3ZOBA 1JKOC 5FKKA 1JKRC 2ECCA 4XRSG 1XC5A 3HKZN 1I6HJ 1WH7A 4W97A 3JRGA 2X48A 2EZIA 2E2HJ 1WH5A 3G1OA 4C3IJ 4C2MJ 2EH3A 3IH2A 2GLOA 3JREA 3NARA 3JR9A 2ID6A 1YRNB 2E2IJ 3FIWA 1JUSA 4A3EJ 2JK3A 1GVDA 3DCFA
chains in the Genus database with same CATH superfamily
3K4JA 5LHIA 4Y3OA 2Y0MA 1OCTC 3EPZA 3T0YA 4RGRA 1X3WB 1JKQC 3A0HC 5EGOA 1ZAOA 3BR6A 3Q9SA 1HSTA 2ISZA 2ICWG 5FRNA 4EATA 1FMVA 3J81K 1OISA 5J3LA 3E7LA 1T95A 1VQNI 1R5ID 2HNHA 2LR8A 3FXJA 3GW2A 2F5EA 2IRFG 1ZGJA 3HOSA 2WBMA 4TV7A 1V55H 2EFNA 1T38A 3SEZA 3DEUA 1D0ZA 4WXCA 3LNQA 3S3MA 4D7MA 4KDPA 1A5JA 1WJAA 1IN7A 4RB0A 4BS9A 1C0WA 4V19K 3P9IA 3GTLJ 2HVSA 1GLNA 4AIJA 3H35A 1P4AA 3E3VA 3CC2I 3CDIA 1T6SA 4AIKA 3PQKA 5J4YA 3IV5A 1LDJA 4IOCF 1VTNC 1ENHA 2KZGA 2M3AA 2CJJA 3BZKA 5CQGA 1ZR4A 4AIHA 4LK1F 3G1MA 2X1CA 3E6BA 5KK1A 2TCTA 4ZTJA 2EA2A 3BTIA 3RSNA 1MBHA 3OIQA 3RPUD 4IHXA 1UAAA 1IZ1A 3M8EA 5DD8A 1SAUA 2NS8A 2EFPA 2M5WA 2MYSA 3MEXA 5GADJ 3F21A 3CCRI 2XGCA 1G8XA 2VLAA 1X2NA 1HBXG 2JA5J 3DP7A 2DO7A 2L7MP 4I7HA 3AG1H 3TBIA 3KEQA 1Z6TA 4HX4A 1J0RA 2W4SA 2CRGA 1IW7F 3IAM2 3M1EA 3LSTA 2WY8Q 2X85A 4MQ9F 3FM3A 4G9YA 4GRIA 1STZA 5C44J 2R3SA 4Y33A 1HA8A 1NG7A 2HDWA 2VPRA 2QA4I 3HOZJ 4EGYA 4ENNA 4M3GA 3E6MA 3W2AA 1JJ8C 3FKJA 1V5GA 5HS7A 2V26A 2XKOA 5FLVA 3V4GA 1T56A 1FEXA 3VOEA 4RAGA 2GAUA 3CLOA 5JI6A 1SD7A 2XPUA 3VFZA 1WI9A 4NC8A 4RDUA 2R7RA 3Q5FA 2VQLA 1LUJB 2GOMA 1LQ1A 2YUSA 2WWYA 1KQ8A 3LQRA 3FZVA 3B73A 4WX9A 5E20A 2M1BA 3MZHA 1PJRA 3KCCA 2RNJA 3O8GA 1SVMA 3KP4A 2PJRB 2LC2A 1K79A 1MW7A 1MBGA 2QUFA 3GFMA 2ELJA 3IWFA 2CYYA 4G6QA 1YHQI 4IKFA 1VQ4I 1MBJA 4HNVA 1OMIA 3PIOF 2QWWA 2CW0F 2O3FA 2GA2A 3OWTA 5FKMA 3PSFA 2FMLA 1WVRA 4JK1X 2V1XA 4KMUX 1D0YA 4XQFA 2A5YB 1D1BA 1QQIA 4CZCA 4I0AA 5D5VB 1SMTA 2WY7Q 3K4KA 5EF6A 3SHFA 3FXKA 2KJBA 1K78B 4L9VA 3DTKA 2XAFA 3S93A 3ZMTA 2VJ5A 4XLCA 2JPBA 3HPGA 2LKPA 2DMNA 2HPMA 2H27A 2R5ZA 2Q8KA 1MMGA 2DOEA 1TT5B 2M4GA 3SXYA 5LLQA 2EWNA 4QTRA 1FLIA 1X58A 3N97A 2H6BA 5BS6A 3BQZA 1USSA 2M30A 3SDBA 1U78A 2M9HA 1EH7A 3RQIA 4CGZA 2LMDA 1YLFA 1TQIA 5B3SH 2EINH 3RKWA 3QAHA 4KT6A 1KYZA 5BQTA 2W48A 3CQZJ 3N05A 4LGWA 5GTIC 5E17F 3M07A 5IP6A 5D8KB 2QQ8A 2MC3A 1BOAA 2L7KA 3W6JB 4UVAA 3CCQI 5FLXK 2JQ7A 4ZDPA 1RRJA 4L9TA 2NS7A 3VWBA 1I3AA 3QODA 1JJ6C 2Y69H 3GF2A 5K7ZA 3GUDA 2VC0A 3ROUA 1U8BA 2HEOA 5JR3A 3QOEA 2YSRA 1J59A 3BTCA 2EILH 4LIUA 3TL4X 1K83J 5IYCJ 2D2WA 4PDKA 2O6GE 1TT0A 2K02A 5F0HA 3A4CA 3I58A 2FQ3A 5DCFA 3TO7A 5IOZA 3BR3A 3NWSA 2IT0A 4QPOA 1IN5A 4MFEA 2Y30A 3VPRA 5FROA 3DPLC 1GUUA 2K3PA 2I10A 5CVJA 3PNVA 4EJOA 1IF1A 4XLAA 3CLQA 3JSOA 5ERIA 3GTPJ 3ZQLA 4A3GJ 2DK5A 2VT3A 2O5RA 3FKIJ 3A2KA 2HWVA 1XS9A 4D9JA 1A6QA 4RS8A 2R7TA 3BQYA 2CGPA 1JTYA 2R7VA 4A93J 4YIRX 2DMTA 3KYDB 2MGQA 3BOQA 3HG9A 4M3EA 5H2FC 2OAZA 1WJEA 3I4NJ 4PJLA 4X0GA 2E60A 2FJ1A 2OD5A 3QPLA 4P9UA 5DUIA 3W3CA 5F0FA 4IO9F 2MD5A 2XB0X 1CF7A 1Y0UA 3FK7A 3S2DJ 2Z3YA 1XTAA 1FOYA 1LVAA 2PBIA 2G9WA 2OA4A 2OZ6A 2W85A 5ILSA 3DBHB 1BN5A 2K5CA 4ZTFA 2KQRA 4QIWN 3O6BB 4Y17A 2XRNA 2J5OA 3F8NA 2FQ4A 2P5VA 6PAXA 2BXYA 5DCMA 2FNPA 1NK3P 3CESA 3C3WA 1HKSA 1LE8A 2A07F 2K85A 3HOVJ 3HTUA 1FTTA 3DEWA 2CQ7A 5M5XJ 1RETA 2M45A 1Y39A 1G2HA 1TWCJ 3E5UA 1APLC 1FT9A 1FJLA 1BW6A 3KFWX 2DYRH 3KZYA 2QSGX 3Q0WA 1X1DA 2O8KA 3K0LA 2IGNA 4N9IA 1XMAA 4RM2A 4G7ZF 4I99C 4JP0A 4XLEA 5DYMA 3DWLE 4BQOA 1ZREA 1A36A 2BHZA 2GA1A 2Y31A 3JRDA 5KAFC 1HKTA 2EA4A 3L1PA 4CCKA 2K27A 1RPWA 5LFAA 3L2RA 1Y6IA 1S3JA 3O3KA 4A3KJ 2XAGA 4DBQA 1SFKA 4XIDA 2VE8A 5F6FA 3DEEA 3HB9A 4HDVA 5TRDA 2OQGA 2G0EA 1BIBA 1MMSA 4JX5A 4AD9A 1WCMJ 3G3ZA 3RJPA 3ZMDA 3G73A 4PUSA 4IX7A 3C18A 3I53A 3BG3A 4PFOA 2FA5A 2DOAA 2E36A 1P9QC 4ZH4F 5M5WJ 4B1RA 3MCZA 2OPTA 2IPQX 3ABLH 2ESHA 2LP0A 1VZ0A 1VQ5I 2XF7A 4NQWA 1BL0A 4FISA 4LB5A 3J81Z 2M34A 1ZN2A 5IYDJ 2BY1A 4RGUA 1R6RA 4XRSA 2LKSA 3LAJA 1T0FC 2VQHA 2M8GX 4FX0A 3ZR8X 1L3LA 5EZHA 4I0BA 1ZR2A 2KDZA 5F1RA 2WAEA 3KLOA 4A5NA 1D1AA 5EYRA 4RLQA 3ZQGA 3G6EI 1JE8A 1UB9A 4XKCA 4NUBA 5D5XB 3U2RA 3CMEI 4IEJA 3HSRA 1ZG1A 1LB2A 4E4HA 5LHGA 3BG6A 4D1QA 3UR3C 2GZWA 3P9CA 3BLYA 2DDAA 1HQCA 3CCEI 3BROA 4UUSA 1WRJA 5FD5A 3SZTA 2UWMA 2VPLA 4BY1J 2R7FA 2YU9J 3C2GA 3MZ8A 4ZZDA 4BAYA 1K4SA 2YR2A 2GIVA 3A01B 2A68F 4ZYAA 2EFOA 2MLGA 4V2FA 1PUEE 1XD7A 3FHNA 1BOBA 2LBFB 1ON1A 4M6VA 2QBYB 1HOMA 1TQMA 5LGTA 1VI0A 3BG9A 2P5KA 2JN6A 2XRLA 4A6DA 3OS1A 1B4AA 4DYCA 2QVOA 3VSLA 3M4OJ 2I8DA 2DFEA 3HBLA 4LIVA 3KLNA 5E1WA 3PJRA 3DBLB 2LNBA 3LAPA 3GEZA 1R9TJ 3I56I 3LL7A 3ECHA 3DFGA 3RCOA 2MG4A 4RAZA 3OYHA 1NH3A 5E79C 2Q2EA 3SFZA 4ZDOA 4BQAA 1G6NA 4RAYA 1FSEA 3OYDA 1O3SA 4BBSJ 1XG1A 5EG0A 3K9TA 1PVEA 1HCRA 4KITB 2AXLA 4R79A 1W7PA 3SQNA 4B8XA 1ODDA 3J80K 2XAJA 4BACA 4D5FA 4EM0B 2O9LA 1QZYA 3CC7I 2KLOA 1FP2A 2XVCA 3OYLA 3I54A 3GYHX 5KNLA 3B02A 1WH7A 3FX3A 3MKYB 1SAXA 3CF5F 3DTIA 4BHBA 2E2HJ 1FWZA 4C3IJ 2L54A 1BR1A 3LSHA 1N75A 2CMPA 3A1YA 2GLOA 1RUNA 2OTJI 3JR9A 2MFZA 2DK8A 4UVCA 2E2IJ 3FIWA 2DT7B 3NWTA 1GHCA 1JUSA 1DQUA 5D5UB 4IRHA 4R8HA 3U1DA 3RPUA 2F4MB 4IL6C 3DCFA 1YI2I 1CGPA 2PMUA 2Z1DA 3NQOA 1XPXA 4X6AJ 2MLKA 3C1DA 3RPQA 1HLVA 2ZO4A 2DA6A 4OINF 4G6DA 4HA8A 2JWTA 2DI3A 2WV1A 3ZXSA 3CCMI 3QP6A 5E18F 3RKXA 3QPSA 2P8TA 2FRHA 3J7YJ 3A03A 3RYRA 2ZBKA 1LJ9A 2CS3A 3DU6A 4IQ4A 1U3EM 3RYPA 4KMFA 2VC1A 1JI8A 2XHKA 1TWFJ 3HHHA 3I0TA 3GVAA 2QQAA 3BWGA 5FKLA 2L3DA 1OFCX 1J75A 3S3OA 3L7WA 2CH0A 5L3BA 1MJBA 1S8NA 4CYCA 1IN8A 2NNYA 2H6CA 3HUGB 3LSGA 2IAIA 4U0VA 3ABUA 1Z7LA 1ZKGA 3OR2C 1QGPA 4F55A 5HVQC 2DA1A 2FXAA 4CCOA 5B1AH 1R49A 3F0CA 1VF9A 2A05A 3H92A 2IS6A 5FLXZ 2R7UA 1QHHD 3VYSB 3S14J 4LB6B 4E6KG 4A3JJ 4BE2A 1DP3A 3WHCA 4XLNF 2E7XA 1X1CA 5H20A 3M1CA 4EGZA 2EQRA 2KIUA 4HLXA 5D4SA 2VQCA 3OYIA 3CO6C 2K9SA 4RMNA 3F6VA 2WAQA 1IXSB 4PJJA 4OIQF 5C4XJ 4XLPF 5KCMA 1TC3C 3HKZA 4MEXF 2RNGA 1Q1HA 2YPRA 1FNNA 4NC6A 2F5DA 3FXRA 3OL4A 4EM1A 3Q0UA 2FX0A 4M74A 5ILVA 5JVGF 3CCUI 2DAOA 3DKYA 3JSPA 3ISPA 4O6JA 1KONA 1P7IA 1UG0A 4RGSA 2L4MA 1JHFA 3CUQA 3HRMA 4B09A 2AQFA 1XDSA 1MIJA 5DD4A 5J40A 4J00A 3BP8A 3KZIC 1YJWI 2P6SA 1AWCA 3RDIA 3QQAA 5TISC 2IA1A 1OJLA 3BG7A 1FSHA 4F91B 3BR1A 4XRMA 1BR4A 3LA3A 3RTRA 3HSFA 1YE9A 4EJUA 1LEBA 1XN7A 2HTSA 1ZHFA 2WA0A 2DFFA 2W1OA 2E5NA 2HQRA 1FP1D 2VN2A 3JRCA 2OV7A 5DM6F 2P0WA 1QBJA 2Z2SB 1SD6A 4HPQA 1QRYA 2V7FA 4FETA 3X2QH 3S1NJ 4DW6A 4U88A 4G7HF 2JJ7A 4IXAA 1BIAA 4M3BA 2R5YB 5LHHA 4CH7A 2BZTA 2OF7A 1UCRA 3SJMA 2VOOA 3G1LA 3DTEA 2O8XA 3CP8A 4RB1A 1OPCA 2IS1A 1KYWA 2QKLB 5EDNA 4IJAA 4J19A 2GIZA 2X6WA 4HG2A 2BVLA 3HXLA 2VXDA 1U9OA 3E5QA 2O61A 3B6AA 2JSCA 4UUTA 1V5FA 4XKBA 3TEDA 3DQVC 4A2UA 1TQPA 4AIDA 1RUOA 3IKTA 4DYQA 1J09A 2CQNA 4IHYA 1ETWA 1FY7A 1ETQA 1S7AA 4ZYGA 4U0WA 4A0ZA 3L2WA 2KL4A 3IHUA 2DYSH 2R7QA 3V42A 5F1JA 3A02A 2E1OA 2H8RA 2NAZA 1U5TA 2A6HF 2WTEA 1QZEA 1WQ2A 3WTWC 2L9RA 2HYFA 2ZJRF 2L7ZA 4YG2F 1AA7A 2M4KA 3S15J 2PQ8A 4YFXF 3L9FA 2IGKA 1WKMA 4XRFA 3Q0VA 9ANTA 1YO5C 2HYGD 4IHVA 4RB2C 2V6CA 4BUPA 1ERDA 4DZJA 4KIGA 1MSEC 3IRQA 2Y9YA 1R1UA 2ZSIB 1MBKA 2F5FA 2MH9A 2Q0OA 3M8JA 5BPIA 1L0OC 2K9QA 3CJRB 2NXNB 1B72A 3K4NA 1R23A 1BI0A 3W6VA 5HNHA 4N9HA 4P1WA 1MMDA 4C2TA 1XSDA 3T5XA 5BPDA 3L00A 3PL8A 2QENA 1VQKI 3CZ6A 3GTGJ 4IVNA 5EZGA 1A31A 2R7SA 3CUOA 2HU9A 2E71A 1SVOA 4N0BA 1G4DA 2F5CA 4NDLA 1LDDA 3PFYA 1V4RA 1S6LA 1KU2A 2KHMA 3DLLF 2RN7A 2JUCA 4Z2YA 1OR7A 5C3EJ 4HEA2 2DMUA 4CCNA 1IXCA 3F8BA 3JRFA 4UNOA 1S29A 1T08B 3FXMA 2PFBA 2DT5A 2VBZA 3C2BA 4I02A 1H88C 1R00A 2CFXA 4S04A 4HRIA 1B9MA 1VQLI 3I59B 4ZZLA 2VUMJ 5DS9A 1W0UA 2D1HA 2DA4A 2BW3B 5E1ZB 2QSFX 2E19A 1P4XA 1A6IA 4E7LA 1XGMA 2VKEA 4PFPA 2DJIA 4XOPA 4AYBN 5DTDA 1U2WA 2LY2A 4ON0A 1Z05A 3GCMA 2ADUA 4KJZA 1BR2A 1MBFA 3R60A 2K9NA 2IEKA 2VODA 1O3QA 1K6OA 3TO9A 4N4NB 2ZMEA 2CV2A 2H1KA 1WZ2A 3ZMUA 5AIPA 1OQYA 3MZYA 1NHAA 4S05A 4H0EA 3BCAA 2FEZA 4ETSA 2BY3A 4L5JA 1IDZA 4BEHB 2KJCA 2A3SA 2A5WA 4R1HA 1P92A 1REPC 3OYAA 3VEPA 3BJ6A 1V3FA 2KISA 1VFCA 2STTA 2XAUA 4PGHA 1ZRFA 1RIOH 2JA6J 1PDNC 1J9IA 3WU1B 3AL0C 4F52A 1YFHA 3H9JA 4MHGA 3DLAA 2JVGA 3CCYA 2L0KA 1EV7A 2UXXA 1YW7A 1UJ8A 2JA7J 3W2VA 4A3DJ 2WAQN 1X3UA 3M9AA 2LRDA 3KEOA 2X6XA 4W1UA 3OYNA 1Y0NA 5L3DA 2FOKA 3HDDA 4PGGA 4LG0B 1W5SA 1Z21A 2WB1N 4XR6A 3J80Z 3OS2A 1XMKA 2JTVA 4HV6A 4FQGA 3TW6A 3L2CA 4OIOF 3GZNB 2ZSHB 4A69C 2PN6A 1JUMA 1IUFA 2COBA 1W5CC 3ELKA 4ZC3A 1X4PA 3TW7A 3ZQ7A 4YRVA 5BMZA 3M8FA 4F3QA 4BJTA 2KDOA 3WTTC 2A61A 3A0BC 2ZXHA 3PM1A 2KZVA 4I01A 2LF8A 2D45A 2HOTA 3BR0A 4XM3A 1TLHB 2HYJA 3OYKA 1YJ9I 1PUFB 1FIPA 2KPMA 4ZJZA 1FZPB 5HS9A 2A6TA 1XDUA 3L2UA 1LFUP 1GVJA 3DV8A 1E2XA 5DDGA 4I09A 2ETHA 3IL2A 3IAS2 4WXHA 3KYLA 1EF4A 1TWGJ 4NHJA 3EETA 3FHZA 4MIMA 3ZQCA 1ZRCA 2Z16A 4I98B 3V7RA 5J6XA 5H6QA 2IBDA 4WCGA 1Z6RA 4AUXA 1AKHB 3J7AO 4C2UA 3ABTA 3E0JB 4Y4RA 1DU0A 4BHCA 1SC7A 2I5UA 2Y75A 4B44A 4CSWA 3GTJJ 4OU0A 3D0SA 1DUXC 5FJ8J 1OYWA 2BXZA 3ASNH 2HPIA 1I3QJ 3OOPA 4LFUA 1VQPI 4XOTA 4OAZA 4JYKA 4WF2A 3HOWJ 4KN4X 1RKWA 2M0CA 3O8HA 2VE9A 1G3WA 2HGCA 4IF4A 2VASA 3WTYC 2F5VA 2CU7A 2NOJB 2MABA 4CDGA 2CV1A 3WG7H 2PJRA 4QWQA 5EJCA 1RNLA 1KQ9A 2KT0A 3OL3A 3REOA 2DCEA 1FX7A 2HZTA 3HPHA 3OYGA 2KFDA 2IS4A 2BYVE 4L9JA 5E3MA 4A3LJ 1IRZA 1UG2A 2HS5A 2KP6A 3SDGA 2ZNYA 5FFXA 2ZKZA 2FF4A 1KU3A 1MNDA 2EV5A 2PG4A 1QPMA 3DKXA 5CVRA 3T8RA 5IYBJ 1IAWA 3HRSA 2X6OA 4BY7J 1GXQA 1HXDA 3CDLA 4DIQA 1RKTA 2R93J 3E97A 3OYBA 4CYDA 1K7AA 2R7XA 1P7JA 3I3LA 1R7JA 3HZJA 2RC4A 2YS9A 2IA2A 1O3RA 1RR7A 1BJZA 3HRTA 1OCCH 2K86A 3CCSI 2X9DA 1POGA 5D6EA 1YYVA 2HKXA 1MKMA 2JRTA 2N8GA 1IG7A 2HDCA 3H9GA 1X2MA 3K6GA 1SD5A 2QQ9A 2KIQA 3LSRA 3MD2A 4RB3C 1R22A 3EQLF 1D0XA 2CUEA 3LA2A 4B3XA 1MMNA 1X1BA 5LBQA 3GTMJ 1F1ZA 3PNTA 2NYXA 2MBFA 2C6YA 2ELHA 1IV8A 4BDZA 1IRGA 1YOVB 1UELB 2ECCA 2GQQA 3OMYA 5HDNA 4F93B 4MQVA 1U0JA 3I64A 4B48A 1MJ9A 3JRGA 3GMEA 3G1OA 3Q9VA 3OYFA 3JTGA 2Y0SA 4C2MJ 5FFZA 1JGSA 2QKMB 4GYIA 1A35A 3NARA 4L0ZB 1YRNB 5L3EA 2CO5A 5L3FA 1OYYA 3RQ4A 2DLLA 2GWRA 4XNFA 4ZYDA 4MTDA 2QQBA 3FXQA 3PQJA 3GO5A 4D0PA 4BNCA 2PMZA 3QRFF 3WODF 4MTEA 4JX6A 2VL8A 3SZPA 3OYCA 3TOBA 1K6YA 3HGGA 4XICA 1Y1VJ 3EUHA 1O3TA 4IHSA 2X0LA 2V1DA 3LFKA 1XB4A 5HS8A 4CO8A 1F5TA 3IUOA 1H9GA 4K2EA 3GTKJ 2CV0A 1QVTA 2E1NA 3S3NA 3F22A 4HZFA 2R92J 4C3HJ 3QPHA 1YS7A 3ESWB 3KP2A 3OSFA 2M2EA 4YFKF 1RR8C 2AXTC 5HNFA 1GXPA 1OCOH 2PX9A 2JZYA 3LSPA 1NG6A 4BL0B 1PP7U 4A6EA 2XKPA 2E2JJ 4UUVA 4BQQA 4A5MA 2DTRA 3R6SA 3TP3A 3P5JA 1IN4A 3J7ZI 1EH6A 1EH8A 4LLGF 5M5YJ 2LY1A 2Z5UA 1M1EB 4AC0A 2L5QA 2COMA 3BDDA 4M9ZA 5D4RA 2BGCA 4IOAF 3O2PE 2Y48A 4AU7A 1O4XA 5D6FA 3ZRGA 1UZCA 1W36C 2RREA 2W24A 2VONA 1VQ9I 2FD5A 4OWRB 1NTCA 2J5PA 3F72A 2ZB9A 3CF2A 2ZFUA 2PEXA 5E1XA 1SEUA 4OMYA 4YFNF 5D5WB 1ZH5A 2TDXA 2IW5A 3ZGKA 4I76A 2XSDC 3ABKH 4KFCA 5J47A 5JFRA 2K40A 2DJNA 2WV0A 1ULYA 1MDMB 2XIGA 2DTZA 3D5LA 5J8FA 5JHFA 1FBQA 4Z6YA 3KIOA 1RZ4A 3GBGA 2DPDA 2FBHA 4FHTA 4XONA 2DOFA 2L9SA 2V6EA 2CQKA 2K3FA 1B8IB 5DM7F 4PJMA 2ZCWA 2EK5A 4KISA 2NRAC 4Q4ZF 3WE2A 3S1QJ 2P81A 1MZBA 4A3FJ 2HZDA 2XPVA 3AG2H 3BJAA 4LG3A 3WHBA 2NNNA 2FSWA 2QGUA 3WU0A 4ITVA 3SEQA 4PZJA 4XKWA 3H0DA 3S1MJ 4M9SA 3MKWB 5DV5A 3QU6A 3G2BA 4FT8A 2L9VA 3BPVA 3L2QA 3ERED 3JCUC 1LFPA 4KIBA 2DA2A 2LK2A 1YG2A 2V9KA 3H5AA 4EV0A 4CCMA 3QP5A 5GAHJ 3GTOJ 2E1MC 4G12A 1WPKA 3OIPA 3WU2C 3LOCA 3MAJA 1BC8C 2JSPA 3FBNB 3GWZA 4IQJA 3FXUA 1ZYRF 2ZXJA 4HAMA 1TTYA 2KMUA 4IHTA 4KICA 5D8LB 3MQ0A 3HJEA 1B9NA 3LQQA 2NVYJ 5B5EC 2K9LA 5A2QK 1P2FA 4YIIA 5CPRB 1YX3A 4BE1A 1S7OA 4C3JJ 3FBIB 1X3ZB 2DA7A 2JA2A 5DUKA 2XROA 1VQ8I 1ZGWA 3LA7A 3K2AA 3GZ5A 1HC8A 1D8JA 4O3MA 5E3OA 3HOTA 2MH2A 2RQQA 2B7EA 3H0GJ 3N4MA 1QO0D 1MH3A 3G4SI 5JLXA 2H1LA 1IN6A 3IWZA 2VOPA 4MGRA 2QEXI 4WWCA 3SYTA 4UB6C 3S17J 2DFIA 2DMPA 2ZFWA 3K2ZA 2ZNZA 1W36D 1F4KA 3TP0A 4RGXA 3P7NA 3ULQB 1JGGA 1T8IA 5FKNA 3RIRA 1ZARA 3A01A 1IV6A 4PSWA 2LBFA 2LLKA 1SVLA 3I9V2 3FXOA 3FK6A 2XF5A 5KAIC 3OSGA 1R1VA 2QBYA 5TJJA 4XN0A 5GPAA 3KP5A 2M8EA 3BG5A 3ERMA 3MMYB 2XDVA 3OYJA 1TL8A 4HDUA 3JAMK 2JMWA 4M73A 1WI3A 1XGNA 2ID3A 1MJAA 4M72A 4BHPA 1ETKA 1T2KA 2Z9OA 3FXLA 3HOXJ 3JTHA 3ML6A 4L5EA 3C2HA 3JRAA 2EPFA 1ZTRA 3B6CA 5GAEJ 1WJ5A 4ZYEA 5EGOB 2VQGA 3E6DA 3FMQA 3MFKA 1B1BA 4CICA 2L4AA 4AVZA 2XV4S 5J1UA 5F04A 2CG4A 2VKHA 2YU3A 2V1NA 1HKQA 2PMZN 2ME6A 4ENJA 4C30A 5J1RA 4MLOA 1SD4A 2VBWA 3MKLA 3K7AJ 3S32A 1U9NA 2IP2A 3Q3SA 4GGGA 5IPAA 2P7CB 1LPQA 2B0LA 3AL0B 4HW0A 2VBXA 5K5OA 1K4TA 3GTQJ 1FTZA 3BZCA 3DF8A 4B47A 1T98A 2L2OA 5CLSA 4AWXB 1LKXA 4Q5SF 1ZG5A 4NNJA 3TKYA 5LEJA 1IXRC 1TW2A 3R61A 2OZUA 3EDPA 1JTXA 3CCLI 5K7FA 2W57A 2RVCA 4P5OA 1Y56A 3MWMA 4IRGA 3WE3A 3CJNA 1FOWA 1Z77A 4D5CA 4P96A 2NVTJ 3BTJA 5LD2C 4LMYA 4G7OF 1RESA 2LOOA 2X6YA 2ZXIA 2XGDA 1BI1A 1D3YA 2EIJH 5LEKA 3CTAA 3SZGA 3ZMSA 3U1KA 3AKZA 1KQ0A 3WTVC 1CQTA 2R7DA 1JHHA 5HDGA 2LTPA 1ETXA 3HHGA 2LG4A 3GFIA 5K7HA 4E7IA 1VQMI 3CD6I 4XL9A 5TGTA 2IA0A 1XGSA 1S72I 5E3NA 2X1EA 1J2XA 1DU6A 1MH4A 3CCVI 4EJTA 2F4OB 1BW5A 3GXOA 1XMXA 4HQEA 2BBYA 5JVTA 2VBYA 3DXJF 5E8IA 1R5GA 2W82A 3VYUB 3HM5A 3HYIA 1W0TA 4EQQA 1E0EA 3PO2J 2KRFA 1X4OA 3HC7A 4UB8C 1O57A 1JKPC 4PJNA 1FYKA 3HUGA 3WG9A 4BH9A 2F2EA 1T33A 3KE2A 3QYEA 4ANJA 2VJIA 4DZPA 3EYIA 5LGUA 1FOXA 4KUMA 4Y52J 2K9MA 4FE4A 5HLTA 4HX8A 4XBFA 4BE0A 3V7CA 3VDXA 5GPCA 2AQEA 1UHMA 4N4OB 1WWXA 4MFDA 1YW8A 5BNGA 3I71A 3DPUA 3OIOA 3PUFA 3F8FA 4XN3A 2QSHX 2RV8A 2W84A 5GAGJ 2CUZA 2F6CA 3F6OA 5HDKA 1Q1VA 1TWHJ 3V7SA 1BM9A 1B59A 2FNAA 2NVUB 4BKXA 3T1BA 4BXXJ 1W7PD 1Y1WJ 1OKRA 4E7JA 2CQXA 3P9KA 3UNGC 2HQAA 3CUQC 1WJBA 2WAFA 1KGSA 3K1PA 2LH9A 2O7OA 3GLXA 5LGNA 1XCVA 1TNTA 2XC7A 1OYIA 4B4CA 1IDYA 3RKYA 2VKVA 3HTSB 5KHDA 1FPQA 1G3YA 1RI7A 2HOSA 2UUZA 4Y7NJ 3SFIA 3T8TA 5IT3A 2EFWA 1OLTA 2XGEA 2E1CA 4UV9A 3IRRA 2R5ZB 1TBXA 1MSFC 2P7VB 4OMZA 1YIOA 2DU9A 4PSXA 4A0YA 4QLCU 3KZZA 4YEJA 2VB6A 2NVQJ 2M7AA 2XPWA 1OCPA 4B3AA 3QYFA 1F9NA 3QU3A 4E7HA 2EBIA 4QSHA 1LVKA 1NK2P 2KIFA 2BV6A 1F36A 3R0AA 2QCOA 1SMYF 1MGTA 3ONQA 1MNEA 3CCJI 4XK4A 5AIQA 1IRXA 3K1NA 3WTZA 1R71A 2R5YA 4UVBA 3E5XA 5C4JJ 4U0YA 2XASA 4YELA 1Z7UA 3GLLA 4HV5A 3BC8A 1P4WA 2MW8A 3AFHA 2GM4A 5EEGA 4AM3A 4E7SA 5HODA 2GOXB 4I2OA 2HOAA 2FBKA 1O7FA 2CQQA 4ESFA 2VJ4A 2P6TA 1TWAJ 3TOAA 2EZLA 4DGWB 4XSXF 3ZQIA 1Z3XA 2KRHA 1Z9CA 2B9SA 5CYVA 4CHUA 4RM3A 1U6GA 2PJPA 2OUMA 1QPIA 2ZJQF 2DBBA 3LSMA 3FISA 3OS0A 2WADA 4HF1A 2ZC2A 2DA3A 3G71I 1U5TC 1RC9A 2LSOA 2Q1ZB 3LWFA 4LITA 4E70A 4IZZA 3NRVA 1G59A 4UY8I 2M87A 5ILUA 2PI0A 1DGRM 1OCRH 1I50J 4BYYA 1AU7A 1VQ6I 2DFHA 3GFJA 3OR1C 4CCJA 1JT0A 5FRMA 1ON2A 2K4JA 4OIRF 1E3PA 4YIFA 1HDDC 3LMMA 4RLFA 4JOMA 2CW8A 3F3XA 2LYCA 5FKKA 1JKRC 1XC5A 3HKZN 1I6HJ 2OCCH 2BOLA 4W97A 2EIMH 4HYEA 2EZIA 4E7KA 4NBQA 4Y15A 1SFXA 1MD0A 4M71A 4M9XA 5FGMA 4P55A 3V8LA 2P5LC 3CDHA 4KNYA 5GTHC 2RQPA 3JREA 1CF7B 2CW7A 2ID6A 4U87A 1XSXA 2FUG2 3LSIA 1HW2A 5IT9K 2VT2A 2IGMA 5H6RA 3KP7A 4A3EJ 2A6EF 4CCLA 4DQ2A 1OCZH 4UV8A 2F48A 2V4JC 5M3FJ 5HLHA 3OYMA 5A2QZ 1R4MB 3U9GA 3VODA 3ZCOA 1AOYA 4EMSA 1OR7C 2CWEA 1H8AC 4IHWA 3D1NI 1FOKA 5DCMB 2R4GA 5HLGA 4KT5C 2B63J 1LE8B 3LSKA 2CSOA 4J01A 5J8CA 1DGWY 5AONA 3E6CC 3I59A 1H9TA 1IUYA 3CO7C 1UHSA 3VYRB 4II2A 1R4NB 1UMQA 2BW3A 2CUFA 2OU2A 2KIMA 2O0YA 4XSZF 3UKGA 2O03A 2HOEA 2FE3A 3R4KA 1DP7P 1EKEA 2KKOA 2ZMEC 2VIXA 1I27A 3C7JA 1N77A 1K61A 1BA5A 4EJWA 3DPTA 4XKVA 1LFBA 3GFLA 4S0HB 1ETYA 2HXOA 1BC7C 1TNSA 4GDFA 4ENMA 2WC2A 5JLWA 1QU3A 3WGIA 1H89C 2K4BA 5K1YA 4BEHA 2PMHA 2Z33A 1WJCA 3M3YJ 2Y2ZA 2GXGA 3FWEA 2ZXWH 4UHTA 3W6KB 1UHWA 3JAMZ 2ME0A 2Y9ZA 4HNTA 1WFXA 2HI3A 4LLLA 2E1MB 2HTJA 5CVVA 1D5VA 4MO7A 2VI6A 2DQLA 4HSTA 3ZQHA 3S1RJ 4GO1A 3S8PA 1YX5A 3H3VK 2QLZA 4M6XA 4MEYF 1XX5A 1S5LC 3K4MA 4BJ5C 2R0QC 4NQWB 3OV8A 2EB7A 1YTYA 1I1SA 3CJQB 3CJTB 2ZJ2A 3BJOA 3BR5A 3K4CA 3V8KA 2XB5A 4KA4A 2LREA 3S2HJ 1K78A 1YIJI 4LLNA 3EUKL 4LG0A 1E17A 1J7KA 3JRIA 1BI2A 4BJ6C 4OAYA 1I6XA 1ACIA 4CUGA 1T0FA 1W1WE 3KYCB 4D7NA 4C9YA 2D1VA 4U7DA 1XSVA 3H36A 2IVMA 2VXZA 1B6AA 3F23A 5FB2A 4ZYHA 2OC6A 3COAC 4L0YB 3QYBA 1G3TA 2DMQA 4V2GA 2XUBA 2NS0A 3F8MA 4CXFA 1HF0A 1EJ9A 1ITYA 4EVIA 3IP4B 2A69F 4GYGA 4I6ZA 2G7HA 2VKDA 2LFBA 3H1CA 4P9FA 1I39A 3VSKA 3HRUA 5ICGA 1PUFA 4UUSB 3FF5A 2ELKA 5LRRA 3ECOA 4A12A 2OQRA 1D5YA 4BGDA 1FYLA 2QM3A 2Z99A 1YJNI 2MC4A 1FC3A 2W00A 3EUAA 4G6TB 1SANA 2JUGA 1QNTA 1X1PA 2DQRA 2L01A 4M3FA 2R7OA 2DA5A 3H3UA 2ACJA 1S7EA 5FD6A 2IS2A 3WTXC 1AKHA 2UV1A 5ED4A 5HOOA 3FMSA 2F4IA 3M7GA 3KP6A 5E8GA 2TRTA 5IP9J 5IP7J 3ZN0A 3WGGA 1HSJA 2Q2EB 2DN0A 3H5RA 3ZQQA 2V9PA 2MSYA 4U7BA 5EEAA 4G8XA 1Z0XA 2GXAA 4Y13A 3PO3J 5EG0B 5JHUA 5M3MJ 3BZ6A 1IGNA 1YQAA 1LDKB 1W7PB 2E7WA 2OJED 2QYOA 1E3OC 5EEHA 1S9HA 5CVIA 3VYTB 2IJLA 4BBRJ 1W5TA 2XSJC 4FTHA 2DXIA 3D5SC 1A04A 4LOCA 3ZMZA 2FOWA 2JPCA 5L3GA 3HEFA 4M6YA 1ZGAA 4JX4A 4HF0A 2AHQA 3ABMH 5K5QA 1IC8A 3OYEA 3I55I 2HQNA 1JUPA 2R7WA 1HW5A 4F7ZA 2V9VA 1AHDP 3BY6A 5J4VA 2HR3A 3LFUA 2W25A 4RAFA 4DNCA 3WTUC 3DU5A 1D1CA 5L3CA 2LY9A 3H9QA 2W7NA 1X19A 1XGOA 1XCBA 2BY2A 4UXNA 1KU9A 1LEAA 2P4WA 4KN7X 3QWLA 3RZDJ 1HDPA 4BU2A 2XF6A 3R0JA 2DT6A 2LD5A 2EFQA 1ZK8A 4ASNA 2RDPA 2AO9A 1G3SA 1GDTA 4OOIA 1SFOJ 1BJAA 2BE5F 3KETA 1GV2A 2BEOA 4A3BJ 2M0MA 4EM2A 2LVSA 3E1SA 3IC7A 1J5YA 2BHYA 3BR2A 3HSEA 1JT6A 3EYYA 5F0CA 1QVUA 3ZP5A 2KRCA 5ICFA 2YX7A 4CZZA 2HXIA 1ZELA 1IJWC 2HVQA 3W2WA 3I4MJ 4L5IA 3PSIA 4CYCB 2JT1A 1YITI 3PIPF 3K70C 3I5UA 3OOUA 3V8JA 3HGYA 1WGXA 1YRNA 1BI3A 4RBOA 1YW9A 2EIKH 5HLIA 3PFIA 4HOBA 2IXSA 1V54H 1Z3YA 2EV6A 3EUHC 2EZKA 4F92B 1R58A 2OBPA 5IOYA 3CMAI 2IGOA 1KA8A 2LF7A 3ZN1A 3FM5A 3WTSC 1VQ7I 4A3MJ 5B66C 2AS5F 1FMWA 4ABZA 2CFOA 2RGVA 4BXFA 1W4MA 3TGNA 2E5ZA 4IPAA 1FBUA 2DW4A 3K69A 1N78A 2H09A 2NVXJ 5CQEA 1FYMA 5LRSA 2EV0A 4Q47A 4EJVA 3J7AY 5CJ9A 4FE7A 2E34A 3TO6A 2E35A 4HLYA 3GZ6A 2PLYA 4HX7A 3IH4A 3FDYA 4QPQA 1VNDA 3ZQFA 1ETOA 2FBIA 4II3A 4FASD 3NEUA 5DEQA 3CMMA 3S16J 1IRFA 4DBRA 2MA3A 2K7LA 4WXDA 3CUQB 4E7ZA 3BTLA 1WJFA 3PUBA 5GP9A 2DDBA 5IY5H 3BT9A 3K4BA 2UXNA 5FO5A 1BBYA 2EJRA 2H8WA 5E3LA 1GV5A 3RI4A 4LJZF 1T39A 3GX4X 3L09A 1X1AA 1DDNA 3S2WA 2XAQA 4Q48A 3PNYA 3D5RC 4M3DA 2BVMA 3KP3A 1H0MA 3K10A 3IKVA 5J1YA 2X51A 5BOXA 3CP2A 2JRMA 2JVHA 1ETVA 4RA2A 1R5HA 2BY0A 3TQNA 5FLMJ 2ZJPF 2LKXA 5IT9Z 5F08A 2HFHA 4ENKA 4NB5A 3AG3H 1WJDA 4GCVA 1KZHA 4PJ0C 2G7UA 1WHUA 3K1MA 1YS6A 3TDUC 1R1TA 4AYBA 1MDMA 1TW3A 3ASOH 1PP8F 3LSJA 2OCEA 3AG4H 4XLFA 4ESJA 4GXOA 1FBSA 2L02A 5KVRA 3HL2A 1IO2A 4HF2A 3RZOJ 1UFMA 3AAFA 4L9NA 2MD0A 2LDUA 1B8IA 3FMRA 3IH3A 1F43A 2Y0SN 1ZQ3P 1KU7A 2ECBA 4L18B 2L7FP 5FKOA 1Y8RB 1QZZA 4HQMA 2M7BA 2DODA 1JXSA 2STWA 2HQ5A 4AVPA 4IRIA 4BQNA 4H4KC 4ESBA 3JRHA 3CMYA 4O5VA 4MNUA 3K70D 3JRBA 1U5TB 2X1DA 2YX4A 4B43A 2VJJA 5K5RA 3MN2A 1ONVA 3TDZC 1FIAA 3DKWA 4PK4A 3KX2A 3MVPA 4XORA 4BDYA 1O7LA 3HIFA 2GBYA 1WSUA 3H3ZA 3F8CA 4DYRA 3QPTA 4CA0A 3HOYJ 3KPHA 3TMOA 3BCBA 3U21A 2L9NA 2R7ZJ 4XLHA 4LD5A 4LK0F 2XAHA 3ZMVA 2WB1A 1ORKA 1SFEA 3RKQA 5CVUA 1U8RA 1D8KA 4XMYA 1EA3A 1MNMC 2V79A 2GXBA 1N25A 1ZG3A 1B72B 2NOGA 4X1EA 1ZLJA 2D5VA 4A3CJ 4G94A 4JBAA 1ZRDA 1TP4A 5F27A 2CUJA 1QA6A 4HBLA 3KEYA 3WGHA 1Z1DA 2EZHA 3CC4I 2HKOA 4A0XA 4DJAA 2XGXA 4GFBA 1HW1A 4EEFG 5F64A 3HOUJ 4FX4A 1DPRA 3OY9A 1USTA 1LNWA 2ISYA 2DPUA 2FMYA 2FU4A 2QF7A 1Y8QB 1I1GA 1I5ZA 4FCYA 3MKZA 5ICEA 3DBRB 1MBEA 3K4LA 1R36A 1Z67A 5CKTA 4HSRA 3BPXA 2HDDA 1MMAA 5B1BH 3NAUA 1SFUA 4OIPF 2RAEA 2OTLI 1TZLA 4JQFA 5ICCA 1Z91A 4BXUA 3L2VA 2JA8J 4A3IJ 3VB2A 3ZOBA 4NC7A 1JKOC 4PCQA 3JW4A 4XRSG 1ZLKA 4ZDLA 3F9KA 2HVRA 2ESNA 4KYWA 2X48A 1PYVA 2RKHA 1QHGA 2QZ8A 1WH5A 3I4PA 4HNUA 2H94A 4WK8F 2EH3A 3IH2A 2UZKA 3H5NA 3ZPLA 2X4HA 2V1UA 1DPUA 2ZMEB 3QOPA 1V5EA 1E3HA 4KIFA 1P6RA 1VQOI 1GT0C 2JK3A 4DOZA 1GVDA
chains in the Genus database with same CATH topology
1OCTC 4X6AJ 1HLVA 4JX6A 2DA6A 1JKQC 5M3FJ 4XICA 3HGGA 1Y1VJ 5EGOA 2JWTA 2WV1A 3BR6A 3QPSA 1H8AC 5J3LA 3E7LA 4IHWA 3D1NI 2LR8A 3A03A 3GTKJ 2B63J 1QVTA 1LE8B 2R92J 4C3HJ 3OSFA 2M2EA 3LSPA 1UHSA 1TWFJ 1UMQA 3LNQA 2CUFA 5FKLA 2E2JJ 4D7MA 1OFCX 3UKGA 1A5JA 3GTLJ 4CYCA 3TP3A 1BA5A 1K61A 5M5YJ 3IV5A 3LSGA 2IAIA 1ENHA 1ZKGA 4AC0A 2CJJA 1LFBA 1ZR4A 4S0HB 3G1MA 2DA1A 2TCTA 1ETYA 3F0CA 2HXOA 1VF9A 1O4XA 3BTIA 5JLWA 1MBHA 1H89C 4IHXA 3S14J 4A3JJ 3M3YJ 2Y2ZA 2FD5A 3WHCA 1NTCA 2NS8A 2EQRA 2ZB9A 2ME0A 2Y9ZA 2XGCA 2K9SA 1X2NA 2HI3A 2JA5J 2L7MP 4MO7A 2VI6A 3ZQHA 5C4XJ 4I76A 2XSDC 3S1RJ 1TC3C 2CRGA 2K40A 3H3VK 2DJNA 2R0QC 2DTZA 5C44J 3Q0UA 2FX0A 3GBGA 3BR5A 2VPRA 2XB5A 3HOZJ 3S2HJ 1P7IA 4M3GA 3JRIA 1B8IB 1JJ8C 5FLVA 3S1QJ 4D7NA 1T56A 2P81A 4A3FJ 1FEXA 2XPVA 3WHBA 3S1MJ 2XPUA 3QQAA 4RDUA 1OJLA 2YUSA 2DMQA 4V2GA 1HF0A 1ITYA 3BR1A 4XRMA 4I6ZA 2LFBA 2LK2A 2DA2A 1PUFA 4UUSB 2ELKA 3O8GA 3JRCA 3GTOJ 4G12A 1WPKA 1MBGA 1D5YA 1QRYA 3S1NJ 4DW6A 3LOCA 1MBJA 2JJ7A 4HNVA 4M3BA 2R5YB 2OF7A 5FKMA 3SJMA 3G1LA 1SANA 5EDNA 4M3FA 4J19A 2NVYJ 2DA5A 1S7EA 5EF6A 1AKHA 1U9OA 4C3JJ 3B6AA 4UUTA 3TEDA 2DA7A 4DYQA 2TRTA 5IP9J 1ZGWA 4IHYA 3K2AA 5IP7J 1ETWA 5E3OA 1ETQA 2DN0A 2DMNA 2R5ZA 2MSYA 5EEAA 1Z0XA 3H0GJ 5F1JA 3A02A 2E1OA 4QTRA 2H8RA 1MH3A 3PO3J 5EG0B 5JLXA 1X58A 5M3MJ 1IGNA 3BQZA 1E3OC 1U78A 2M9HA 3RQIA 2L9RA 2L7ZA 3S15J 3S17J 4BBRJ 4FTHA 2DMPA 3Q0VA 2W48A 3CQZJ 4LOCA 3TP0A 9ANTA 1JGGA 4IHVA 5FKNA 5IP6A 3HEFA 3A01A 1IV6A 4DZJA 2LLKA 1MSEC 2Y9YA 3FK6A 4JX4A 1MBKA 3OSGA 5GPAA 2AHQA 2NS7A 1IC8A 1JJ6C 3BG5A 2K9QA 5K7ZA 1JUPA 1B72A 1U8BA 2JMWA 1AHDP 3W6VA 1WI3A 2ID3A 3BTCA 1ETKA 3HOXJ 1K83J 2LY9A 5IYCJ 4L5EA 3GTGJ 3JRAA 1ZTRA 5EZGA 3B6CA 5F0HA 5IOZA 5EGOB 3BR3A 4MFEA 3RZDJ 2Y30A 4NDLA 1HDPA 3VPRA 1GUUA 5J1UA 2LD5A 2I10A 5F04A 5C3EJ 2PMZN 1ZK8A 2ME6A 2DMUA 2AO9A 5J1RA 3GTPJ 3JRFA 1GDTA 4MLOA 3ZQLA 4A3GJ 1SFOJ 3C2BA 3MKLA 3K7AJ 1H88C 1GV2A 3FKIJ 1U9NA 1XS9A 3Q3SA 5IPAA 4A3BJ 2LVSA 3BR2A 2VUMJ 3GTQJ 1JT6A 1FTZA 3BQYA 5DS9A 1W0UA 1JTYA 2DA4A 5F0CA 1QVUA 2E19A 1A6IA 4A93J 2DMTA 2VKEA 2HXIA 2MGQA 4AYBN 1IJWC 4M3EA 3I4NJ 5DTDA 3I4MJ 4CYCB 2FJ1A 3QPLA 5F0FA 1JTXA 1MBFA 5K7FA 2K9NA 2IEKA 3HGYA 3OOUA 2XB0X 3FK7A 1WGXA 1YRNA 2H1KA 1Z77A 4D5CA 3S2DJ 2NVTJ 3BTJA 4RBOA 1RESA 2XGDA 5IOYA 2EZKA 1IDZA 4A3MJ 4ABZA 4QIWN 1CQTA 2LTPA 2FQ4A 1ETXA 1VFCA 1NK3P 2NVXJ 2JA6J 1LE8A 5K7HA 4FE7A 3HOVJ 1FTTA 5E3NA 3DEWA 5M5XJ 1RETA 1DU6A 1MH4A 1BW5A 3IH4A 3CCYA 2L0KA 1G2HA 2JA7J 1VNDA 3ZQFA 1TWCJ 1APLC 4A3DJ 2WAQN 1FJLA 1ETOA 4W1UA 1BW6A 3S16J 3Q0WA 3HM5A 3HDDA 1W0TA 2WB1N 3BTLA 5GP9A 2O8KA 3PO2J 4JP0A 3BT9A 3TW6A 1JKPC 2Y31A 5E3LA 1T33A 4A69C 3JRDA 1GV5A 1JUMA 3L1PA 1IUFA 2COBA 1RPWA 4DZPA 3TW7A 4A3KJ 4M3DA 4XIDA 4Y52J 4FE4A 3PM1A 5J1YA 2HOTA 3BR0A 3HB9A 5GPCA 2G0EA 2HYJA 1PUFB 1FIPA 1ETVA 4JX5A 5FLMJ 1WCMJ 4MFDA 2LKXA 5F08A 5BNGA 3BG3A 3OIOA 1LFUP 5M5WJ 4B1RA 2OPTA 1Q1VA 1TWHJ 4BKXA 1EF4A 1TWGJ 2LP0A 4BXXJ 1Y1WJ 4FISA 3LSJA 1BL0A 2M34A 4MIMA 3ZQCA 2CQXA 5IYDJ 4XRSA 2IBDA 3RZOJ 2M8GX 2O7OA 4AUXA 1AKHB 5EZHA 1B8IA 3IH3A 1ZR2A 2KDZA 1F43A 2Y0SN 1DU0A 1ZQ3P 4B4CA 1IDYA 2ECBA 2L7FP 2VKVA 5EYRA 5FKOA 3GTJJ 2HOSA 3ZQGA 4Y7NJ 5FJ8J 3SFIA 1I3QJ 2HQ5A 2XGEA 4IEJA 2R5ZB 1MSFC 4JYKA 3JRHA 3HOWJ 3CMYA 1RKWA 2M0CA 3JRBA 3O8HA 2NVQJ 2XPWA 4B3AA 1OCPA 3MN2A 2EBIA 4QSHA 4UUSA 1NK2P 1FIAA 3MVPA 2CU7A 1F36A 2GBYA 4BY1J 2QCOA 2YU9J 2KT0A 4DYRA 4XK4A 3HOYJ 2R5YA 5E3MA 5C4JJ 3A01B 4A3LJ 4V2FA 2R7ZJ 1IRZA 1UG2A 3SDGA 2MW8A 2GM4A 1ORKA 4M6VA 3RKQA 1HOMA 5HODA 1VI0A 1GT0C 3BG9A 1MNMC 2JN6A 2XRLA 2HOAA 5IYBJ 2CQQA 4DYCA 1B72B 2NOGA 4X1EA 2D5VA 3M4OJ 1TWAJ 2EZLA 2X6OA 3HBLA 4BY7J 4A3CJ 3CDLA 3ZQIA 1RKTA 2R93J 5F27A 2EZHA 1P7JA 3HOUJ 4GFBA 1R9TJ 4EEFG 1QPIA 2MG4A 2YS9A 3FISA 1RR7A 1BJZA 2DA3A 2X9DA 1POGA 2QF7A 2N8GA 4FCYA 1IG7A 4BBSJ 1XG1A 1MBEA 1X2MA 1I50J 5EG0A 1HCRA 1AU7A 3LSRA 1JT0A 2CUEA 2HDDA 3GTMJ 4D5FA 2O9LA 3NAUA 1HDDC 2RAEA 2JA8J 4A3IJ 3ZOBA 1JKOC 5FKKA 1JKRC 2ECCA 4XRSG 1XC5A 3HKZN 1I6HJ 1WH7A 4W97A 3JRGA 2X48A 2EZIA 2E2HJ 1WH5A 3G1OA 4C3IJ 4C2MJ 2EH3A 3IH2A 2GLOA 3JREA 3NARA 3JR9A 2ID6A 1YRNB 2E2IJ 3FIWA 1JUSA 4A3EJ 2JK3A 1GVDA 3DCFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OCT C;  4X6A J;  1HLV A;  4JX6 A;  2DA6 A;  1JKQ C;  5M3F J;  4XIC A;  3HGG A;  1Y1V J;  5EGO A;  2JWT A;  2WV1 A;  3BR6 A;  3QPS A;  1H8A C;  5J3L A;  3E7L A;  4IHW A;  3D1N I;  2LR8 A;  3A03 A;  3GTK J;  2B63 J;  1QVT A;  1LE8 B;  2R92 J;  4C3H J;  3OSF A;  2M2E A;  3LSP A;  1UHS A;  1TWF J;  1UMQ A;  3LNQ A;  2CUF A;  5FKL A;  2E2J J;  4D7M A;  1OFC X;  3UKG A;  1A5J A;  3GTL J;  4CYC A;  3TP3 A;  1BA5 A;  1K61 A;  5M5Y J;  3IV5 A;  3LSG A;  2IAI A;  1ENH A;  1ZKG A;  4AC0 A;  2CJJ A;  1LFB A;  1ZR4 A;  4S0H B;  3G1M A;  2DA1 A;  2TCT A;  1ETY A;  3F0C A;  2HXO A;  1VF9 A;  1O4X A;  3BTI A;  5JLW A;  1MBH A;  1H89 C;  4IHX A;  3S14 J;  4A3J J;  3M3Y J;  2Y2Z A;  2FD5 A;  3WHC A;  1NTC A;  2NS8 A;  2EQR A;  2ZB9 A;  2ME0 A;  2Y9Z A;  2XGC A;  2K9S A;  1X2N A;  2HI3 A;  2JA5 J;  2L7M P;  4MO7 A;  2VI6 A;  3ZQH A;  5C4X J;  4I76 A;  2XSD C;  3S1R J;  1TC3 C;  2CRG A;  2K40 A;  3H3V K;  2DJN A;  2R0Q C;  2DTZ A;  5C44 J;  3Q0U A;  2FX0 A;  3GBG A;  3BR5 A;  2VPR A;  2XB5 A;  3HOZ J;  3S2H J;  1P7I A;  4M3G A;  3JRI A;  1B8I B;  1JJ8 C;  5FLV A;  3S1Q J;  4D7N A;  1T56 A;  2P81 A;  4A3F J;  1FEX A;  2XPV A;  3WHB A;  3S1M J;  2XPU A;  3QQA A;  4RDU A;  1OJL A;  2YUS A;  2DMQ A;  4V2G A;  1HF0 A;  1ITY A;  3BR1 A;  4XRM A;  4I6Z A;  2LFB A;  2LK2 A;  2DA2 A;  1PUF A;  4UUS B;  2ELK A;  3O8G A;  3JRC A;  3GTO J;  4G12 A;  1WPK A;  1MBG A;  1D5Y A;  1QRY A;  3S1N J;  4DW6 A;  3LOC A;  1MBJ A;  2JJ7 A;  4HNV A;  4M3B A;  2R5Y B;  2OF7 A;  5FKM A;  3SJM A;  3G1L A;  1SAN A;  5EDN A;  4M3F A;  4J19 A;  2NVY J;  2DA5 A;  1S7E A;  5EF6 A;  1AKH A;  1U9O A;  4C3J J;  3B6A A;  4UUT A;  3TED A;  2DA7 A;  4DYQ A;  2TRT A;  5IP9 J;  1ZGW A;  4IHY A;  3K2A A;  5IP7 J;  1ETW A;  5E3O A;  1ETQ A;  2DN0 A;  2DMN A;  2R5Z A;  2MSY A;  5EEA A;  1Z0X A;  3H0G J;  5F1J A;  3A02 A;  2E1O A;  4QTR A;  2H8R A;  1MH3 A;  3PO3 J;  5EG0 B;  5JLX A;  1X58 A;  5M3M J;  1IGN A;  3BQZ A;  1E3O C;  1U78 A;  2M9H A;  3RQI A;  2L9R A;  2L7Z A;  3S15 J;  3S17 J;  4BBR J;  4FTH A;  2DMP A;  3Q0V A;  2W48 A;  3CQZ J;  4LOC A;  3TP0 A;  9ANT A;  1JGG A;  4IHV A;  5FKN A;  5IP6 A;  3HEF A;  3A01 A;  1IV6 A;  4DZJ A;  2LLK A;  1MSE C;  2Y9Y A;  3FK6 A;  4JX4 A;  1MBK A;  3OSG A;  5GPA A;  2AHQ A;  2NS7 A;  1IC8 A;  1JJ6 C;  3BG5 A;  2K9Q A;  5K7Z A;  1JUP A;  1B72 A;  1U8B A;  2JMW A;  1AHD P;  3W6V A;  1WI3 A;  2ID3 A;  3BTC A;  1ETK A;  3HOX J;  1K83 J;  2LY9 A;  5IYC J;  4L5E A;  3GTG J;  3JRA A;  1ZTR A;  5EZG A;  3B6C A;  5F0H A;  5IOZ A;  5EGO B;  3BR3 A;  4MFE A;  3RZD J;  2Y30 A;  4NDL A;  1HDP A;  3VPR A;  1GUU A;  5J1U A;  2LD5 A;  2I10 A;  5F04 A;  5C3E J;  2PMZ N;  1ZK8 A;  2ME6 A;  2DMU A;  2AO9 A;  5J1R A;  3GTP J;  3JRF A;  1GDT A;  4MLO A;  3ZQL A;  4A3G J;  1SFO J;  3C2B A;  3MKL A;  3K7A J;  1H88 C;  1GV2 A;  3FKI J;  1U9N A;  1XS9 A;  3Q3S A;  5IPA A;  4A3B J;  2LVS A;  3BR2 A;  2VUM J;  3GTQ J;  1JT6 A;  1FTZ A;  3BQY A;  5DS9 A;  1W0U A;  1JTY A;  2DA4 A;  5F0C A;  1QVU A;  2E19 A;  1A6I A;  4A93 J;  2DMT A;  2VKE A;  2HXI A;  2MGQ A;  4AYB N;  1IJW C;  4M3E A;  3I4N J;  5DTD A;  3I4M J;  4CYC B;  2FJ1 A;  3QPL A;  5F0F A;  1JTX A;  1MBF A;  5K7F A;  2K9N A;  2IEK A;  3HGY A;  3OOU A;  2XB0 X;  3FK7 A;  1WGX A;  1YRN A;  2H1K A;  1Z77 A;  4D5C A;  3S2D J;  2NVT J;  3BTJ A;  4RBO A;  1RES A;  2XGD A;  5IOY A;  2EZK A;  1IDZ A;  4A3M J;  4ABZ A;  4QIW N;  1CQT A;  2LTP A;  2FQ4 A;  1ETX A;  1VFC A;  1NK3 P;  2NVX J;  2JA6 J;  1LE8 A;  5K7H A;  4FE7 A;  3HOV J;  1FTT A;  5E3N A;  3DEW A;  5M5X J;  1RET A;  1DU6 A;  1MH4 A;  1BW5 A;  3IH4 A;  3CCY A;  2L0K A;  1G2H A;  2JA7 J;  1VND A;  3ZQF A;  1TWC J;  1APL C;  4A3D J;  2WAQ N;  1FJL A;  1ETO A;  4W1U A;  1BW6 A;  3S16 J;  3Q0W A;  3HM5 A;  3HDD A;  1W0T A;  2WB1 N;  3BTL A;  5GP9 A;  2O8K A;  3PO2 J;  4JP0 A;  3BT9 A;  3TW6 A;  1JKP C;  2Y31 A;  5E3L A;  1T33 A;  4A69 C;  3JRD A;  1GV5 A;  1JUM A;  3L1P A;  1IUF A;  2COB A;  1RPW A;  4DZP A;  3TW7 A;  4A3K J;  4M3D A;  4XID A;  4Y52 J;  4FE4 A;  3PM1 A;  5J1Y A;  2HOT A;  3BR0 A;  3HB9 A;  5GPC A;  2G0E A;  2HYJ A;  1PUF B;  1FIP A;  1ETV A;  4JX5 A;  5FLM J;  1WCM J;  4MFD A;  2LKX A;  5F08 A;  5BNG A;  3BG3 A;  3OIO A;  1LFU P;  5M5W J;  4B1R A;  2OPT A;  1Q1V A;  1TWH J;  4BKX A;  1EF4 A;  1TWG J;  2LP0 A;  4BXX J;  1Y1W J;  4FIS A;  3LSJ A;  1BL0 A;  2M34 A;  4MIM A;  3ZQC A;  2CQX A;  5IYD J;  4XRS A;  2IBD A;  3RZO J;  2M8G X;  2O7O A;  4AUX A;  1AKH B;  5EZH A;  1B8I A;  3IH3 A;  1ZR2 A;  2KDZ A;  1F43 A;  2Y0S N;  1DU0 A;  1ZQ3 P;  4B4C A;  1IDY A;  2ECB A;  2L7F P;  2VKV A;  5EYR A;  5FKO A;  3GTJ J;  2HOS A;  3ZQG A;  4Y7N J;  5FJ8 J;  3SFI A;  1I3Q J;  2HQ5 A;  2XGE A;  4IEJ A;  2R5Z B;  1MSF C;  4JYK A;  3JRH A;  3HOW J;  3CMY A;  1RKW A;  2M0C A;  3JRB A;  3O8H A;  2NVQ J;  2XPW A;  4B3A A;  1OCP A;  3MN2 A;  2EBI A;  4QSH A;  4UUS A;  1NK2 P;  1FIA A;  3MVP A;  2CU7 A;  1F36 A;  2GBY A;  4BY1 J;  2QCO A;  2YU9 J;  2KT0 A;  4DYR A;  4XK4 A;  3HOY J;  2R5Y A;  5E3M A;  5C4J J;  3A01 B;  4A3L J;  4V2F A;  2R7Z J;  1IRZ A;  1UG2 A;  3SDG A;  2MW8 A;  2GM4 A;  1ORK A;  4M6V A;  3RKQ A;  1HOM A;  5HOD A;  1VI0 A;  1GT0 C;  3BG9 A;  1MNM C;  2JN6 A;  2XRL A;  2HOA A;  5IYB J;  2CQQ A;  4DYC A;  1B72 B;  2NOG A;  4X1E A;  2D5V A;  3M4O J;  1TWA J;  2EZL A;  2X6O A;  3HBL A;  4BY7 J;  4A3C J;  3CDL A;  3ZQI A;  1RKT A;  2R93 J;  5F27 A;  2EZH A;  1P7J A;  3HOU J;  4GFB A;  1R9T J;  4EEF G;  1QPI A;  2MG4 A;  2YS9 A;  3FIS A;  1RR7 A;  1BJZ A;  2DA3 A;  2X9D A;  1POG A;  2QF7 A;  2N8G A;  4FCY A;  1IG7 A;  4BBS J;  1XG1 A;  1MBE A;  1X2M A;  1I50 J;  5EG0 A;  1HCR A;  1AU7 A;  3LSR A;  1JT0 A;  2CUE A;  2HDD A;  3GTM J;  4D5F A;  2O9L A;  3NAU A;  1HDD C;  2RAE A;  2JA8 J;  4A3I J;  3ZOB A;  1JKO C;  5FKK A;  1JKR C;  2ECC A;  4XRS G;  1XC5 A;  3HKZ N;  1I6H J;  1WH7 A;  4W97 A;  3JRG A;  2X48 A;  2EZI A;  2E2H J;  1WH5 A;  3G1O A;  4C3I J;  4C2M J;  2EH3 A;  3IH2 A;  2GLO A;  3JRE A;  3NAR A;  3JR9 A;  2ID6 A;  1YRN B;  2E2I J;  3FIW A;  1JUS A;  4A3E J;  2JK3 A;  1GVD A;  3DCF A; 
#chains in the Genus database with same CATH topology
 3K4J A;  5LHI A;  4Y3O A;  2Y0M A;  1OCT C;  3EPZ A;  3T0Y A;  4RGR A;  1X3W B;  1JKQ C;  3A0H C;  5EGO A;  1ZAO A;  3BR6 A;  3Q9S A;  1HST A;  2ISZ A;  2ICW G;  5FRN A;  4EAT A;  1FMV A;  3J81 K;  1OIS A;  5J3L A;  3E7L A;  1T95 A;  1VQN I;  1R5I D;  2HNH A;  2LR8 A;  3FXJ A;  3GW2 A;  2F5E A;  2IRF G;  1ZGJ A;  3HOS A;  2WBM A;  4TV7 A;  1V55 H;  2EFN A;  1T38 A;  3SEZ A;  3DEU A;  1D0Z A;  4WXC A;  3LNQ A;  3S3M A;  4D7M A;  4KDP A;  1A5J A;  1WJA A;  1IN7 A;  4RB0 A;  4BS9 A;  1C0W A;  4V19 K;  3P9I A;  3GTL J;  2HVS A;  1GLN A;  4AIJ A;  3H35 A;  1P4A A;  3E3V A;  3CC2 I;  3CDI A;  1T6S A;  4AIK A;  3PQK A;  5J4Y A;  3IV5 A;  1LDJ A;  4IOC F;  1VTN C;  1ENH A;  2KZG A;  2M3A A;  2CJJ A;  3BZK A;  5CQG A;  1ZR4 A;  4AIH A;  4LK1 F;  3G1M A;  2X1C A;  3E6B A;  5KK1 A;  2TCT A;  4ZTJ A;  2EA2 A;  3BTI A;  3RSN A;  1MBH A;  3OIQ A;  3RPU D;  4IHX A;  1UAA A;  1IZ1 A;  3M8E A;  5DD8 A;  1SAU A;  2NS8 A;  2EFP A;  2M5W A;  2MYS A;  3MEX A;  5GAD J;  3F21 A;  3CCR I;  2XGC A;  1G8X A;  2VLA A;  1X2N A;  1HBX G;  2JA5 J;  3DP7 A;  2DO7 A;  2L7M P;  4I7H A;  3AG1 H;  3TBI A;  3KEQ A;  1Z6T A;  4HX4 A;  1J0R A;  2W4S A;  2CRG A;  1IW7 F;  3IAM 2;  3M1E A;  3LST A;  2WY8 Q;  2X85 A;  4MQ9 F;  3FM3 A;  4G9Y A;  4GRI A;  1STZ A;  5C44 J;  2R3S A;  4Y33 A;  1HA8 A;  1NG7 A;  2HDW A;  2VPR A;  2QA4 I;  3HOZ J;  4EGY A;  4ENN A;  4M3G A;  3E6M A;  3W2A A;  1JJ8 C;  3FKJ A;  1V5G A;  5HS7 A;  2V26 A;  2XKO A;  5FLV A;  3V4G A;  1T56 A;  1FEX A;  3VOE A;  4RAG A;  2GAU A;  3CLO A;  5JI6 A;  1SD7 A;  2XPU A;  3VFZ A;  1WI9 A;  4NC8 A;  4RDU A;  2R7R A;  3Q5F A;  2VQL A;  1LUJ B;  2GOM A;  1LQ1 A;  2YUS A;  2WWY A;  1KQ8 A;  3LQR A;  3FZV A;  3B73 A;  4WX9 A;  5E20 A;  2M1B A;  3MZH A;  1PJR A;  3KCC A;  2RNJ A;  3O8G A;  1SVM A;  3KP4 A;  2PJR B;  2LC2 A;  1K79 A;  1MW7 A;  1MBG A;  2QUF A;  3GFM A;  2ELJ A;  3IWF A;  2CYY A;  4G6Q A;  1YHQ I;  4IKF A;  1VQ4 I;  1MBJ A;  4HNV A;  1OMI A;  3PIO F;  2QWW A;  2CW0 F;  2O3F A;  2GA2 A;  3OWT A;  5FKM A;  3PSF A;  2FML A;  1WVR A;  4JK1 X;  2V1X A;  4KMU X;  1D0Y A;  4XQF A;  2A5Y B;  1D1B A;  1QQI A;  4CZC A;  4I0A A;  5D5V B;  1SMT A;  2WY7 Q;  3K4K A;  5EF6 A;  3SHF A;  3FXK A;  2KJB A;  1K78 B;  4L9V A;  3DTK A;  2XAF A;  3S93 A;  3ZMT A;  2VJ5 A;  4XLC A;  2JPB A;  3HPG A;  2LKP A;  2DMN A;  2HPM A;  2H27 A;  2R5Z A;  2Q8K A;  1MMG A;  2DOE A;  1TT5 B;  2M4G A;  3SXY A;  5LLQ A;  2EWN A;  4QTR A;  1FLI A;  1X58 A;  3N97 A;  2H6B A;  5BS6 A;  3BQZ A;  1USS A;  2M30 A;  3SDB A;  1U78 A;  2M9H A;  1EH7 A;  3RQI A;  4CGZ A;  2LMD A;  1YLF A;  1TQI A;  5B3S H;  2EIN H;  3RKW A;  3QAH A;  4KT6 A;  1KYZ A;  5BQT A;  2W48 A;  3CQZ J;  3N05 A;  4LGW A;  5GTI C;  5E17 F;  3M07 A;  5IP6 A;  5D8K B;  2QQ8 A;  2MC3 A;  1BOA A;  2L7K A;  3W6J B;  4UVA A;  3CCQ I;  5FLX K;  2JQ7 A;  4ZDP A;  1RRJ A;  4L9T A;  2NS7 A;  3VWB A;  1I3A A;  3QOD A;  1JJ6 C;  2Y69 H;  3GF2 A;  5K7Z A;  3GUD A;  2VC0 A;  3ROU A;  1U8B A;  2HEO A;  5JR3 A;  3QOE A;  2YSR A;  1J59 A;  3BTC A;  2EIL H;  4LIU A;  3TL4 X;  1K83 J;  5IYC J;  2D2W A;  4PDK A;  2O6G E;  1TT0 A;  2K02 A;  5F0H A;  3A4C A;  3I58 A;  2FQ3 A;  5DCF A;  3TO7 A;  5IOZ A;  3BR3 A;  3NWS A;  2IT0 A;  4QPO A;  1IN5 A;  4MFE A;  2Y30 A;  3VPR A;  5FRO A;  3DPL C;  1GUU A;  2K3P A;  2I10 A;  5CVJ A;  3PNV A;  4EJO A;  1IF1 A;  4XLA A;  3CLQ A;  3JSO A;  5ERI A;  3GTP J;  3ZQL A;  4A3G J;  2DK5 A;  2VT3 A;  2O5R A;  3FKI J;  3A2K A;  2HWV A;  1XS9 A;  4D9J A;  1A6Q A;  4RS8 A;  2R7T A;  3BQY A;  2CGP A;  1JTY A;  2R7V A;  4A93 J;  4YIR X;  2DMT A;  3KYD B;  2MGQ A;  3BOQ A;  3HG9 A;  4M3E A;  5H2F C;  2OAZ A;  1WJE A;  3I4N J;  4PJL A;  4X0G A;  2E60 A;  2FJ1 A;  2OD5 A;  3QPL A;  4P9U A;  5DUI A;  3W3C A;  5F0F A;  4IO9 F;  2MD5 A;  2XB0 X;  1CF7 A;  1Y0U A;  3FK7 A;  3S2D J;  2Z3Y A;  1XTA A;  1FOY A;  1LVA A;  2PBI A;  2G9W A;  2OA4 A;  2OZ6 A;  2W85 A;  5ILS A;  3DBH B;  1BN5 A;  2K5C A;  4ZTF A;  2KQR A;  4QIW N;  3O6B B;  4Y17 A;  2XRN A;  2J5O A;  3F8N A;  2FQ4 A;  2P5V A;  6PAX A;  2BXY A;  5DCM A;  2FNP A;  1NK3 P;  3CES A;  3C3W A;  1HKS A;  1LE8 A;  2A07 F;  2K85 A;  3HOV J;  3HTU A;  1FTT A;  3DEW A;  2CQ7 A;  5M5X J;  1RET A;  2M45 A;  1Y39 A;  1G2H A;  1TWC J;  3E5U A;  1APL C;  1FT9 A;  1FJL A;  1BW6 A;  3KFW X;  2DYR H;  3KZY A;  2QSG X;  3Q0W A;  1X1D A;  2O8K A;  3K0L A;  2IGN A;  4N9I A;  1XMA A;  4RM2 A;  4G7Z F;  4I99 C;  4JP0 A;  4XLE A;  5DYM A;  3DWL E;  4BQO A;  1ZRE A;  1A36 A;  2BHZ A;  2GA1 A;  2Y31 A;  3JRD A;  5KAF C;  1HKT A;  2EA4 A;  3L1P A;  4CCK A;  2K27 A;  1RPW A;  5LFA A;  3L2R A;  1Y6I A;  1S3J A;  3O3K A;  4A3K J;  2XAG A;  4DBQ A;  1SFK A;  4XID A;  2VE8 A;  5F6F A;  3DEE A;  3HB9 A;  4HDV A;  5TRD A;  2OQG A;  2G0E A;  1BIB A;  1MMS A;  4JX5 A;  4AD9 A;  1WCM J;  3G3Z A;  3RJP A;  3ZMD A;  3G73 A;  4PUS A;  4IX7 A;  3C18 A;  3I53 A;  3BG3 A;  4PFO A;  2FA5 A;  2DOA A;  2E36 A;  1P9Q C;  4ZH4 F;  5M5W J;  4B1R A;  3MCZ A;  2OPT A;  2IPQ X;  3ABL H;  2ESH A;  2LP0 A;  1VZ0 A;  1VQ5 I;  2XF7 A;  4NQW A;  1BL0 A;  4FIS A;  4LB5 A;  3J81 Z;  2M34 A;  1ZN2 A;  5IYD J;  2BY1 A;  4RGU A;  1R6R A;  4XRS A;  2LKS A;  3LAJ A;  1T0F C;  2VQH A;  2M8G X;  4FX0 A;  3ZR8 X;  1L3L A;  5EZH A;  4I0B A;  1ZR2 A;  2KDZ A;  5F1R A;  2WAE A;  3KLO A;  4A5N A;  1D1A A;  5EYR A;  4RLQ A;  3ZQG A;  3G6E I;  1JE8 A;  1UB9 A;  4XKC A;  4NUB A;  5D5X B;  3U2R A;  3CME I;  4IEJ A;  3HSR A;  1ZG1 A;  1LB2 A;  4E4H A;  5LHG A;  3BG6 A;  4D1Q A;  3UR3 C;  2GZW A;  3P9C A;  3BLY A;  2DDA A;  1HQC A;  3CCE I;  3BRO A;  4UUS A;  1WRJ A;  5FD5 A;  3SZT A;  2UWM A;  2VPL A;  4BY1 J;  2R7F A;  2YU9 J;  3C2G A;  3MZ8 A;  4ZZD A;  4BAY A;  1K4S A;  2YR2 A;  2GIV A;  3A01 B;  2A68 F;  4ZYA A;  2EFO A;  2MLG A;  4V2F A;  1PUE E;  1XD7 A;  3FHN A;  1BOB A;  2LBF B;  1ON1 A;  4M6V A;  2QBY B;  1HOM A;  1TQM A;  5LGT A;  1VI0 A;  3BG9 A;  2P5K A;  2JN6 A;  2XRL A;  4A6D A;  3OS1 A;  1B4A A;  4DYC A;  2QVO A;  3VSL A;  3M4O J;  2I8D A;  2DFE A;  3HBL A;  4LIV A;  3KLN A;  5E1W A;  3PJR A;  3DBL B;  2LNB A;  3LAP A;  3GEZ A;  1R9T J;  3I56 I;  3LL7 A;  3ECH A;  3DFG A;  3RCO A;  2MG4 A;  4RAZ A;  3OYH A;  1NH3 A;  5E79 C;  2Q2E A;  3SFZ A;  4ZDO A;  4BQA A;  1G6N A;  4RAY A;  1FSE A;  3OYD A;  1O3S A;  4BBS J;  1XG1 A;  5EG0 A;  3K9T A;  1PVE A;  1HCR A;  4KIT B;  2AXL A;  4R79 A;  1W7P A;  3SQN A;  4B8X A;  1ODD A;  3J80 K;  2XAJ A;  4BAC A;  4D5F A;  4EM0 B;  2O9L A;  1QZY A;  3CC7 I;  2KLO A;  1FP2 A;  2XVC A;  3OYL A;  3I54 A;  3GYH X;  5KNL A;  3B02 A;  1WH7 A;  3FX3 A;  3MKY B;  1SAX A;  3CF5 F;  3DTI A;  4BHB A;  2E2H J;  1FWZ A;  4C3I J;  2L54 A;  1BR1 A;  3LSH A;  1N75 A;  2CMP A;  3A1Y A;  2GLO A;  1RUN A;  2OTJ I;  3JR9 A;  2MFZ A;  2DK8 A;  4UVC A;  2E2I J;  3FIW A;  2DT7 B;  3NWT A;  1GHC A;  1JUS A;  1DQU A;  5D5U B;  4IRH A;  4R8H A;  3U1D A;  3RPU A;  2F4M B;  4IL6 C;  3DCF A;  1YI2 I;  1CGP A;  2PMU A;  2Z1D A;  3NQO A;  1XPX A;  4X6A J;  2MLK A;  3C1D A;  3RPQ A;  1HLV A;  2ZO4 A;  2DA6 A;  4OIN F;  4G6D A;  4HA8 A;  2JWT A;  2DI3 A;  2WV1 A;  3ZXS A;  3CCM I;  3QP6 A;  5E18 F;  3RKX A;  3QPS A;  2P8T A;  2FRH A;  3J7Y J;  3A03 A;  3RYR A;  2ZBK A;  1LJ9 A;  2CS3 A;  3DU6 A;  4IQ4 A;  1U3E M;  3RYP A;  4KMF A;  2VC1 A;  1JI8 A;  2XHK A;  1TWF J;  3HHH A;  3I0T A;  3GVA A;  2QQA A;  3BWG A;  5FKL A;  2L3D A;  1OFC X;  1J75 A;  3S3O A;  3L7W A;  2CH0 A;  5L3B A;  1MJB A;  1S8N A;  4CYC A;  1IN8 A;  2NNY A;  2H6C A;  3HUG B;  3LSG A;  2IAI A;  4U0V A;  3ABU A;  1Z7L A;  1ZKG A;  3OR2 C;  1QGP A;  4F55 A;  5HVQ C;  2DA1 A;  2FXA A;  4CCO A;  5B1A H;  1R49 A;  3F0C A;  1VF9 A;  2A05 A;  3H92 A;  2IS6 A;  5FLX Z;  2R7U A;  1QHH D;  3VYS B;  3S14 J;  4LB6 B;  4E6K G;  4A3J J;  4BE2 A;  1DP3 A;  3WHC A;  4XLN F;  2E7X A;  1X1C A;  5H20 A;  3M1C A;  4EGZ A;  2EQR A;  2KIU A;  4HLX A;  5D4S A;  2VQC A;  3OYI A;  3CO6 C;  2K9S A;  4RMN A;  3F6V A;  2WAQ A;  1IXS B;  4PJJ A;  4OIQ F;  5C4X J;  4XLP F;  5KCM A;  1TC3 C;  3HKZ A;  4MEX F;  2RNG A;  1Q1H A;  2YPR A;  1FNN A;  4NC6 A;  2F5D A;  3FXR A;  3OL4 A;  4EM1 A;  3Q0U A;  2FX0 A;  4M74 A;  5ILV A;  5JVG F;  3CCU I;  2DAO A;  3DKY A;  3JSP A;  3ISP A;  4O6J A;  1KON A;  1P7I A;  1UG0 A;  4RGS A;  2L4M A;  1JHF A;  3CUQ A;  3HRM A;  4B09 A;  2AQF A;  1XDS A;  1MIJ A;  5DD4 A;  5J40 A;  4J00 A;  3BP8 A;  3KZI C;  1YJW I;  2P6S A;  1AWC A;  3RDI A;  3QQA A;  5TIS C;  2IA1 A;  1OJL A;  3BG7 A;  1FSH A;  4F91 B;  3BR1 A;  4XRM A;  1BR4 A;  3LA3 A;  3RTR A;  3HSF A;  1YE9 A;  4EJU A;  1LEB A;  1XN7 A;  2HTS A;  1ZHF A;  2WA0 A;  2DFF A;  2W1O A;  2E5N A;  2HQR A;  1FP1 D;  2VN2 A;  3JRC A;  2OV7 A;  5DM6 F;  2P0W A;  1QBJ A;  2Z2S B;  1SD6 A;  4HPQ A;  1QRY A;  2V7F A;  4FET A;  3X2Q H;  3S1N J;  4DW6 A;  4U88 A;  4G7H F;  2JJ7 A;  4IXA A;  1BIA A;  4M3B A;  2R5Y B;  5LHH A;  4CH7 A;  2BZT A;  2OF7 A;  1UCR A;  3SJM A;  2VOO A;  3G1L A;  3DTE A;  2O8X A;  3CP8 A;  4RB1 A;  1OPC A;  2IS1 A;  1KYW A;  2QKL B;  5EDN A;  4IJA A;  4J19 A;  2GIZ A;  2X6W A;  4HG2 A;  2BVL A;  3HXL A;  2VXD A;  1U9O A;  3E5Q A;  2O61 A;  3B6A A;  2JSC A;  4UUT A;  1V5F A;  4XKB A;  3TED A;  3DQV C;  4A2U A;  1TQP A;  4AID A;  1RUO A;  3IKT A;  4DYQ A;  1J09 A;  2CQN A;  4IHY A;  1ETW A;  1FY7 A;  1ETQ A;  1S7A A;  4ZYG A;  4U0W A;  4A0Z A;  3L2W A;  2KL4 A;  3IHU A;  2DYS H;  2R7Q A;  3V42 A;  5F1J A;  3A02 A;  2E1O A;  2H8R A;  2NAZ A;  1U5T A;  2A6H F;  2WTE A;  1QZE A;  1WQ2 A;  3WTW C;  2L9R A;  2HYF A;  2ZJR F;  2L7Z A;  4YG2 F;  1AA7 A;  2M4K A;  3S15 J;  2PQ8 A;  4YFX F;  3L9F A;  2IGK A;  1WKM A;  4XRF A;  3Q0V A;  9ANT A;  1YO5 C;  2HYG D;  4IHV A;  4RB2 C;  2V6C A;  4BUP A;  1ERD A;  4DZJ A;  4KIG A;  1MSE C;  3IRQ A;  2Y9Y A;  1R1U A;  2ZSI B;  1MBK A;  2F5F A;  2MH9 A;  2Q0O A;  3M8J A;  5BPI A;  1L0O C;  2K9Q A;  3CJR B;  2NXN B;  1B72 A;  3K4N A;  1R23 A;  1BI0 A;  3W6V A;  5HNH A;  4N9H A;  4P1W A;  1MMD A;  4C2T A;  1XSD A;  3T5X A;  5BPD A;  3L00 A;  3PL8 A;  2QEN A;  1VQK I;  3CZ6 A;  3GTG J;  4IVN A;  5EZG A;  1A31 A;  2R7S A;  3CUO A;  2HU9 A;  2E71 A;  1SVO A;  4N0B A;  1G4D A;  2F5C A;  4NDL A;  1LDD A;  3PFY A;  1V4R A;  1S6L A;  1KU2 A;  2KHM A;  3DLL F;  2RN7 A;  2JUC A;  4Z2Y A;  1OR7 A;  5C3E J;  4HEA 2;  2DMU A;  4CCN A;  1IXC A;  3F8B A;  3JRF A;  4UNO A;  1S29 A;  1T08 B;  3FXM A;  2PFB A;  2DT5 A;  2VBZ A;  3C2B A;  4I02 A;  1H88 C;  1R00 A;  2CFX A;  4S04 A;  4HRI A;  1B9M A;  1VQL I;  3I59 B;  4ZZL A;  2VUM J;  5DS9 A;  1W0U A;  2D1H A;  2DA4 A;  2BW3 B;  5E1Z B;  2QSF X;  2E19 A;  1P4X A;  1A6I A;  4E7L A;  1XGM A;  2VKE A;  4PFP A;  2DJI A;  4XOP A;  4AYB N;  5DTD A;  1U2W A;  2LY2 A;  4ON0 A;  1Z05 A;  3GCM A;  2ADU A;  4KJZ A;  1BR2 A;  1MBF A;  3R60 A;  2K9N A;  2IEK A;  2VOD A;  1O3Q A;  1K6O A;  3TO9 A;  4N4N B;  2ZME A;  2CV2 A;  2H1K A;  1WZ2 A;  3ZMU A;  5AIP A;  1OQY A;  3MZY A;  1NHA A;  4S05 A;  4H0E A;  3BCA A;  2FEZ A;  4ETS A;  2BY3 A;  4L5J A;  1IDZ A;  4BEH B;  2KJC A;  2A3S A;  2A5W A;  4R1H A;  1P92 A;  1REP C;  3OYA A;  3VEP A;  3BJ6 A;  1V3F A;  2KIS A;  1VFC A;  2STT A;  2XAU A;  4PGH A;  1ZRF A;  1RIO H;  2JA6 J;  1PDN C;  1J9I A;  3WU1 B;  3AL0 C;  4F52 A;  1YFH A;  3H9J A;  4MHG A;  3DLA A;  2JVG A;  3CCY A;  2L0K A;  1EV7 A;  2UXX A;  1YW7 A;  1UJ8 A;  2JA7 J;  3W2V A;  4A3D J;  2WAQ N;  1X3U A;  3M9A A;  2LRD A;  3KEO A;  2X6X A;  4W1U A;  3OYN A;  1Y0N A;  5L3D A;  2FOK A;  3HDD A;  4PGG A;  4LG0 B;  1W5S A;  1Z21 A;  2WB1 N;  4XR6 A;  3J80 Z;  3OS2 A;  1XMK A;  2JTV A;  4HV6 A;  4FQG A;  3TW6 A;  3L2C A;  4OIO F;  3GZN B;  2ZSH B;  4A69 C;  2PN6 A;  1JUM A;  1IUF A;  2COB A;  1W5C C;  3ELK A;  4ZC3 A;  1X4P A;  3TW7 A;  3ZQ7 A;  4YRV A;  5BMZ A;  3M8F A;  4F3Q A;  4BJT A;  2KDO A;  3WTT C;  2A61 A;  3A0B C;  2ZXH A;  3PM1 A;  2KZV A;  4I01 A;  2LF8 A;  2D45 A;  2HOT A;  3BR0 A;  4XM3 A;  1TLH B;  2HYJ A;  3OYK A;  1YJ9 I;  1PUF B;  1FIP A;  2KPM A;  4ZJZ A;  1FZP B;  5HS9 A;  2A6T A;  1XDU A;  3L2U A;  1LFU P;  1GVJ A;  3DV8 A;  1E2X A;  5DDG A;  4I09 A;  2ETH A;  3IL2 A;  3IAS 2;  4WXH A;  3KYL A;  1EF4 A;  1TWG J;  4NHJ A;  3EET A;  3FHZ A;  4MIM A;  3ZQC A;  1ZRC A;  2Z16 A;  4I98 B;  3V7R A;  5J6X A;  5H6Q A;  2IBD A;  4WCG A;  1Z6R A;  4AUX A;  1AKH B;  3J7A O;  4C2U A;  3ABT A;  3E0J B;  4Y4R A;  1DU0 A;  4BHC A;  1SC7 A;  2I5U A;  2Y75 A;  4B44 A;  4CSW A;  3GTJ J;  4OU0 A;  3D0S A;  1DUX C;  5FJ8 J;  1OYW A;  2BXZ A;  3ASN H;  2HPI A;  1I3Q J;  3OOP A;  4LFU A;  1VQP I;  4XOT A;  4OAZ A;  4JYK A;  4WF2 A;  3HOW J;  4KN4 X;  1RKW A;  2M0C A;  3O8H A;  2VE9 A;  1G3W A;  2HGC A;  4IF4 A;  2VAS A;  3WTY C;  2F5V A;  2CU7 A;  2NOJ B;  2MAB A;  4CDG A;  2CV1 A;  3WG7 H;  2PJR A;  4QWQ A;  5EJC A;  1RNL A;  1KQ9 A;  2KT0 A;  3OL3 A;  3REO A;  2DCE A;  1FX7 A;  2HZT A;  3HPH A;  3OYG A;  2KFD A;  2IS4 A;  2BYV E;  4L9J A;  5E3M A;  4A3L J;  1IRZ A;  1UG2 A;  2HS5 A;  2KP6 A;  3SDG A;  2ZNY A;  5FFX A;  2ZKZ A;  2FF4 A;  1KU3 A;  1MND A;  2EV5 A;  2PG4 A;  1QPM A;  3DKX A;  5CVR A;  3T8R A;  5IYB J;  1IAW A;  3HRS A;  2X6O A;  4BY7 J;  1GXQ A;  1HXD A;  3CDL A;  4DIQ A;  1RKT A;  2R93 J;  3E97 A;  3OYB A;  4CYD A;  1K7A A;  2R7X A;  1P7J A;  3I3L A;  1R7J A;  3HZJ A;  2RC4 A;  2YS9 A;  2IA2 A;  1O3R A;  1RR7 A;  1BJZ A;  3HRT A;  1OCC H;  2K86 A;  3CCS I;  2X9D A;  1POG A;  5D6E A;  1YYV A;  2HKX A;  1MKM A;  2JRT A;  2N8G A;  1IG7 A;  2HDC A;  3H9G A;  1X2M A;  3K6G A;  1SD5 A;  2QQ9 A;  2KIQ A;  3LSR A;  3MD2 A;  4RB3 C;  1R22 A;  3EQL F;  1D0X A;  2CUE A;  3LA2 A;  4B3X A;  1MMN A;  1X1B A;  5LBQ A;  3GTM J;  1F1Z A;  3PNT A;  2NYX A;  2MBF A;  2C6Y A;  2ELH A;  1IV8 A;  4BDZ A;  1IRG A;  1YOV B;  1UEL B;  2ECC A;  2GQQ A;  3OMY A;  5HDN A;  4F93 B;  4MQV A;  1U0J A;  3I64 A;  4B48 A;  1MJ9 A;  3JRG A;  3GME A;  3G1O A;  3Q9V A;  3OYF A;  3JTG A;  2Y0S A;  4C2M J;  5FFZ A;  1JGS A;  2QKM B;  4GYI A;  1A35 A;  3NAR A;  4L0Z B;  1YRN B;  5L3E A;  2CO5 A;  5L3F A;  1OYY A;  3RQ4 A;  2DLL A;  2GWR A;  4XNF A;  4ZYD A;  4MTD A;  2QQB A;  3FXQ A;  3PQJ A;  3GO5 A;  4D0P A;  4BNC A;  2PMZ A;  3QRF F;  3WOD F;  4MTE A;  4JX6 A;  2VL8 A;  3SZP A;  3OYC A;  3TOB A;  1K6Y A;  3HGG A;  4XIC A;  1Y1V J;  3EUH A;  1O3T A;  4IHS A;  2X0L A;  2V1D A;  3LFK A;  1XB4 A;  5HS8 A;  4CO8 A;  1F5T A;  3IUO A;  1H9G A;  4K2E A;  3GTK J;  2CV0 A;  1QVT A;  2E1N A;  3S3N A;  3F22 A;  4HZF A;  2R92 J;  4C3H J;  3QPH A;  1YS7 A;  3ESW B;  3KP2 A;  3OSF A;  2M2E A;  4YFK F;  1RR8 C;  2AXT C;  5HNF A;  1GXP A;  1OCO H;  2PX9 A;  2JZY A;  3LSP A;  1NG6 A;  4BL0 B;  1PP7 U;  4A6E A;  2XKP A;  2E2J J;  4UUV A;  4BQQ A;  4A5M A;  2DTR A;  3R6S A;  3TP3 A;  3P5J A;  1IN4 A;  3J7Z I;  1EH6 A;  1EH8 A;  4LLG F;  5M5Y J;  2LY1 A;  2Z5U A;  1M1E B;  4AC0 A;  2L5Q A;  2COM A;  3BDD A;  4M9Z A;  5D4R A;  2BGC A;  4IOA F;  3O2P E;  2Y48 A;  4AU7 A;  1O4X A;  5D6F A;  3ZRG A;  1UZC A;  1W36 C;  2RRE A;  2W24 A;  2VON A;  1VQ9 I;  2FD5 A;  4OWR B;  1NTC A;  2J5P A;  3F72 A;  2ZB9 A;  3CF2 A;  2ZFU A;  2PEX A;  5E1X A;  1SEU A;  4OMY A;  4YFN F;  5D5W B;  1ZH5 A;  2TDX A;  2IW5 A;  3ZGK A;  4I76 A;  2XSD C;  3ABK H;  4KFC A;  5J47 A;  5JFR A;  2K40 A;  2DJN A;  2WV0 A;  1ULY A;  1MDM B;  2XIG A;  2DTZ A;  3D5L A;  5J8F A;  5JHF A;  1FBQ A;  4Z6Y A;  3KIO A;  1RZ4 A;  3GBG A;  2DPD A;  2FBH A;  4FHT A;  4XON A;  2DOF A;  2L9S A;  2V6E A;  2CQK A;  2K3F A;  1B8I B;  5DM7 F;  4PJM A;  2ZCW A;  2EK5 A;  4KIS A;  2NRA C;  4Q4Z F;  3WE2 A;  3S1Q J;  2P81 A;  1MZB A;  4A3F J;  2HZD A;  2XPV A;  3AG2 H;  3BJA A;  4LG3 A;  3WHB A;  2NNN A;  2FSW A;  2QGU A;  3WU0 A;  4ITV A;  3SEQ A;  4PZJ A;  4XKW A;  3H0D A;  3S1M J;  4M9S A;  3MKW B;  5DV5 A;  3QU6 A;  3G2B A;  4FT8 A;  2L9V A;  3BPV A;  3L2Q A;  3ERE D;  3JCU C;  1LFP A;  4KIB A;  2DA2 A;  2LK2 A;  1YG2 A;  2V9K A;  3H5A A;  4EV0 A;  4CCM A;  3QP5 A;  5GAH J;  3GTO J;  2E1M C;  4G12 A;  1WPK A;  3OIP A;  3WU2 C;  3LOC A;  3MAJ A;  1BC8 C;  2JSP A;  3FBN B;  3GWZ A;  4IQJ A;  3FXU A;  1ZYR F;  2ZXJ A;  4HAM A;  1TTY A;  2KMU A;  4IHT A;  4KIC A;  5D8L B;  3MQ0 A;  3HJE A;  1B9N A;  3LQQ A;  2NVY J;  5B5E C;  2K9L A;  5A2Q K;  1P2F A;  4YII A;  5CPR B;  1YX3 A;  4BE1 A;  1S7O A;  4C3J J;  3FBI B;  1X3Z B;  2DA7 A;  2JA2 A;  5DUK A;  2XRO A;  1VQ8 I;  1ZGW A;  3LA7 A;  3K2A A;  3GZ5 A;  1HC8 A;  1D8J A;  4O3M A;  5E3O A;  3HOT A;  2MH2 A;  2RQQ A;  2B7E A;  3H0G J;  3N4M A;  1QO0 D;  1MH3 A;  3G4S I;  5JLX A;  2H1L A;  1IN6 A;  3IWZ A;  2VOP A;  4MGR A;  2QEX I;  4WWC A;  3SYT A;  4UB6 C;  3S17 J;  2DFI A;  2DMP A;  2ZFW A;  3K2Z A;  2ZNZ A;  1W36 D;  1F4K A;  3TP0 A;  4RGX A;  3P7N A;  3ULQ B;  1JGG A;  1T8I A;  5FKN A;  3RIR A;  1ZAR A;  3A01 A;  1IV6 A;  4PSW A;  2LBF A;  2LLK A;  1SVL A;  3I9V 2;  3FXO A;  3FK6 A;  2XF5 A;  5KAI C;  3OSG A;  1R1V A;  2QBY A;  5TJJ A;  4XN0 A;  5GPA A;  3KP5 A;  2M8E A;  3BG5 A;  3ERM A;  3MMY B;  2XDV A;  3OYJ A;  1TL8 A;  4HDU A;  3JAM K;  2JMW A;  4M73 A;  1WI3 A;  1XGN A;  2ID3 A;  1MJA A;  4M72 A;  4BHP A;  1ETK A;  1T2K A;  2Z9O A;  3FXL A;  3HOX J;  3JTH A;  3ML6 A;  4L5E A;  3C2H A;  3JRA A;  2EPF A;  1ZTR A;  3B6C A;  5GAE J;  1WJ5 A;  4ZYE A;  5EGO B;  2VQG A;  3E6D A;  3FMQ A;  3MFK A;  1B1B A;  4CIC A;  2L4A A;  4AVZ A;  2XV4 S;  5J1U A;  5F04 A;  2CG4 A;  2VKH A;  2YU3 A;  2V1N A;  1HKQ A;  2PMZ N;  2ME6 A;  4ENJ A;  4C30 A;  5J1R A;  4MLO A;  1SD4 A;  2VBW A;  3MKL A;  3K7A J;  3S32 A;  1U9N A;  2IP2 A;  3Q3S A;  4GGG A;  5IPA A;  2P7C B;  1LPQ A;  2B0L A;  3AL0 B;  4HW0 A;  2VBX A;  5K5O A;  1K4T A;  3GTQ J;  1FTZ A;  3BZC A;  3DF8 A;  4B47 A;  1T98 A;  2L2O A;  5CLS A;  4AWX B;  1LKX A;  4Q5S F;  1ZG5 A;  4NNJ A;  3TKY A;  5LEJ A;  1IXR C;  1TW2 A;  3R61 A;  2OZU A;  3EDP A;  1JTX A;  3CCL I;  5K7F A;  2W57 A;  2RVC A;  4P5O A;  1Y56 A;  3MWM A;  4IRG A;  3WE3 A;  3CJN A;  1FOW A;  1Z77 A;  4D5C A;  4P96 A;  2NVT J;  3BTJ A;  5LD2 C;  4LMY A;  4G7O F;  1RES A;  2LOO A;  2X6Y A;  2ZXI A;  2XGD A;  1BI1 A;  1D3Y A;  2EIJ H;  5LEK A;  3CTA A;  3SZG A;  3ZMS A;  3U1K A;  3AKZ A;  1KQ0 A;  3WTV C;  1CQT A;  2R7D A;  1JHH A;  5HDG A;  2LTP A;  1ETX A;  3HHG A;  2LG4 A;  3GFI A;  5K7H A;  4E7I A;  1VQM I;  3CD6 I;  4XL9 A;  5TGT A;  2IA0 A;  1XGS A;  1S72 I;  5E3N A;  2X1E A;  1J2X A;  1DU6 A;  1MH4 A;  3CCV I;  4EJT A;  2F4O B;  1BW5 A;  3GXO A;  1XMX A;  4HQE A;  2BBY A;  5JVT A;  2VBY A;  3DXJ F;  5E8I A;  1R5G A;  2W82 A;  3VYU B;  3HM5 A;  3HYI A;  1W0T A;  4EQQ A;  1E0E A;  3PO2 J;  2KRF A;  1X4O A;  3HC7 A;  4UB8 C;  1O57 A;  1JKP C;  4PJN A;  1FYK A;  3HUG A;  3WG9 A;  4BH9 A;  2F2E A;  1T33 A;  3KE2 A;  3QYE A;  4ANJ A;  2VJI A;  4DZP A;  3EYI A;  5LGU A;  1FOX A;  4KUM A;  4Y52 J;  2K9M A;  4FE4 A;  5HLT A;  4HX8 A;  4XBF A;  4BE0 A;  3V7C A;  3VDX A;  5GPC A;  2AQE A;  1UHM A;  4N4O B;  1WWX A;  4MFD A;  1YW8 A;  5BNG A;  3I71 A;  3DPU A;  3OIO A;  3PUF A;  3F8F A;  4XN3 A;  2QSH X;  2RV8 A;  2W84 A;  5GAG J;  2CUZ A;  2F6C A;  3F6O A;  5HDK A;  1Q1V A;  1TWH J;  3V7S A;  1BM9 A;  1B59 A;  2FNA A;  2NVU B;  4BKX A;  3T1B A;  4BXX J;  1W7P D;  1Y1W J;  1OKR A;  4E7J A;  2CQX A;  3P9K A;  3UNG C;  2HQA A;  3CUQ C;  1WJB A;  2WAF A;  1KGS A;  3K1P A;  2LH9 A;  2O7O A;  3GLX A;  5LGN A;  1XCV A;  1TNT A;  2XC7 A;  1OYI A;  4B4C A;  1IDY A;  3RKY A;  2VKV A;  3HTS B;  5KHD A;  1FPQ A;  1G3Y A;  1RI7 A;  2HOS A;  2UUZ A;  4Y7N J;  3SFI A;  3T8T A;  5IT3 A;  2EFW A;  1OLT A;  2XGE A;  2E1C A;  4UV9 A;  3IRR A;  2R5Z B;  1TBX A;  1MSF C;  2P7V B;  4OMZ A;  1YIO A;  2DU9 A;  4PSX A;  4A0Y A;  4QLC U;  3KZZ A;  4YEJ A;  2VB6 A;  2NVQ J;  2M7A A;  2XPW A;  1OCP A;  4B3A A;  3QYF A;  1F9N A;  3QU3 A;  4E7H A;  2EBI A;  4QSH A;  1LVK A;  1NK2 P;  2KIF A;  2BV6 A;  1F36 A;  3R0A A;  2QCO A;  1SMY F;  1MGT A;  3ONQ A;  1MNE A;  3CCJ I;  4XK4 A;  5AIQ A;  1IRX A;  3K1N A;  3WTZ A;  1R71 A;  2R5Y A;  4UVB A;  3E5X A;  5C4J J;  4U0Y A;  2XAS A;  4YEL A;  1Z7U A;  3GLL A;  4HV5 A;  3BC8 A;  1P4W A;  2MW8 A;  3AFH A;  2GM4 A;  5EEG A;  4AM3 A;  4E7S A;  5HOD A;  2GOX B;  4I2O A;  2HOA A;  2FBK A;  1O7F A;  2CQQ A;  4ESF A;  2VJ4 A;  2P6T A;  1TWA J;  3TOA A;  2EZL A;  4DGW B;  4XSX F;  3ZQI A;  1Z3X A;  2KRH A;  1Z9C A;  2B9S A;  5CYV A;  4CHU A;  4RM3 A;  1U6G A;  2PJP A;  2OUM A;  1QPI A;  2ZJQ F;  2DBB A;  3LSM A;  3FIS A;  3OS0 A;  2WAD A;  4HF1 A;  2ZC2 A;  2DA3 A;  3G71 I;  1U5T C;  1RC9 A;  2LSO A;  2Q1Z B;  3LWF A;  4LIT A;  4E70 A;  4IZZ A;  3NRV A;  1G59 A;  4UY8 I;  2M87 A;  5ILU A;  2PI0 A;  1DGR M;  1OCR H;  1I50 J;  4BYY A;  1AU7 A;  1VQ6 I;  2DFH A;  3GFJ A;  3OR1 C;  4CCJ A;  1JT0 A;  5FRM A;  1ON2 A;  2K4J A;  4OIR F;  1E3P A;  4YIF A;  1HDD C;  3LMM A;  4RLF A;  4JOM A;  2CW8 A;  3F3X A;  2LYC A;  5FKK A;  1JKR C;  1XC5 A;  3HKZ N;  1I6H J;  2OCC H;  2BOL A;  4W97 A;  2EIM H;  4HYE A;  2EZI A;  4E7K A;  4NBQ A;  4Y15 A;  1SFX A;  1MD0 A;  4M71 A;  4M9X A;  5FGM A;  4P55 A;  3V8L A;  2P5L C;  3CDH A;  4KNY A;  5GTH C;  2RQP A;  3JRE A;  1CF7 B;  2CW7 A;  2ID6 A;  4U87 A;  1XSX A;  2FUG 2;  3LSI A;  1HW2 A;  5IT9 K;  2VT2 A;  2IGM A;  5H6R A;  3KP7 A;  4A3E J;  2A6E F;  4CCL A;  4DQ2 A;  1OCZ H;  4UV8 A;  2F48 A;  2V4J C;  5M3F J;  5HLH A;  3OYM A;  5A2Q Z;  1R4M B;  3U9G A;  3VOD A;  3ZCO A;  1AOY A;  4EMS A;  1OR7 C;  2CWE A;  1H8A C;  4IHW A;  3D1N I;  1FOK A;  5DCM B;  2R4G A;  5HLG A;  4KT5 C;  2B63 J;  1LE8 B;  3LSK A;  2CSO A;  4J01 A;  5J8C A;  1DGW Y;  5AON A;  3E6C C;  3I59 A;  1H9T A;  1IUY A;  3CO7 C;  1UHS A;  3VYR B;  4II2 A;  1R4N B;  1UMQ A;  2BW3 A;  2CUF A;  2OU2 A;  2KIM A;  2O0Y A;  4XSZ F;  3UKG A;  2O03 A;  2HOE A;  2FE3 A;  3R4K A;  1DP7 P;  1EKE A;  2KKO A;  2ZME C;  2VIX A;  1I27 A;  3C7J A;  1N77 A;  1K61 A;  1BA5 A;  4EJW A;  3DPT A;  4XKV A;  1LFB A;  3GFL A;  4S0H B;  1ETY A;  2HXO A;  1BC7 C;  1TNS A;  4GDF A;  4ENM A;  2WC2 A;  5JLW A;  1QU3 A;  3WGI A;  1H89 C;  2K4B A;  5K1Y A;  4BEH A;  2PMH A;  2Z33 A;  1WJC A;  3M3Y J;  2Y2Z A;  2GXG A;  3FWE A;  2ZXW H;  4UHT A;  3W6K B;  1UHW A;  3JAM Z;  2ME0 A;  2Y9Z A;  4HNT A;  1WFX A;  2HI3 A;  4LLL A;  2E1M B;  2HTJ A;  5CVV A;  1D5V A;  4MO7 A;  2VI6 A;  2DQL A;  4HST A;  3ZQH A;  3S1R J;  4GO1 A;  3S8P A;  1YX5 A;  3H3V K;  2QLZ A;  4M6X A;  4MEY F;  1XX5 A;  1S5L C;  3K4M A;  4BJ5 C;  2R0Q C;  4NQW B;  3OV8 A;  2EB7 A;  1YTY A;  1I1S A;  3CJQ B;  3CJT B;  2ZJ2 A;  3BJO A;  3BR5 A;  3K4C A;  3V8K A;  2XB5 A;  4KA4 A;  2LRE A;  3S2H J;  1K78 A;  1YIJ I;  4LLN A;  3EUK L;  4LG0 A;  1E17 A;  1J7K A;  3JRI A;  1BI2 A;  4BJ6 C;  4OAY A;  1I6X A;  1ACI A;  4CUG A;  1T0F A;  1W1W E;  3KYC B;  4D7N A;  4C9Y A;  2D1V A;  4U7D A;  1XSV A;  3H36 A;  2IVM A;  2VXZ A;  1B6A A;  3F23 A;  5FB2 A;  4ZYH A;  2OC6 A;  3COA C;  4L0Y B;  3QYB A;  1G3T A;  2DMQ A;  4V2G A;  2XUB A;  2NS0 A;  3F8M A;  4CXF A;  1HF0 A;  1EJ9 A;  1ITY A;  4EVI A;  3IP4 B;  2A69 F;  4GYG A;  4I6Z A;  2G7H A;  2VKD A;  2LFB A;  3H1C A;  4P9F A;  1I39 A;  3VSK A;  3HRU A;  5ICG A;  1PUF A;  4UUS B;  3FF5 A;  2ELK A;  5LRR A;  3ECO A;  4A12 A;  2OQR A;  1D5Y A;  4BGD A;  1FYL A;  2QM3 A;  2Z99 A;  1YJN I;  2MC4 A;  1FC3 A;  2W00 A;  3EUA A;  4G6T B;  1SAN A;  2JUG A;  1QNT A;  1X1P A;  2DQR A;  2L01 A;  4M3F A;  2R7O A;  2DA5 A;  3H3U A;  2ACJ A;  1S7E A;  5FD6 A;  2IS2 A;  3WTX C;  1AKH A;  2UV1 A;  5ED4 A;  5HOO A;  3FMS A;  2F4I A;  3M7G A;  3KP6 A;  5E8G A;  2TRT A;  5IP9 J;  5IP7 J;  3ZN0 A;  3WGG A;  1HSJ A;  2Q2E B;  2DN0 A;  3H5R A;  3ZQQ A;  2V9P A;  2MSY A;  4U7B A;  5EEA A;  4G8X A;  1Z0X A;  2GXA A;  4Y13 A;  3PO3 J;  5EG0 B;  5JHU A;  5M3M J;  3BZ6 A;  1IGN A;  1YQA A;  1LDK B;  1W7P B;  2E7W A;  2OJE D;  2QYO A;  1E3O C;  5EEH A;  1S9H A;  5CVI A;  3VYT B;  2IJL A;  4BBR J;  1W5T A;  2XSJ C;  4FTH A;  2DXI A;  3D5S C;  1A04 A;  4LOC A;  3ZMZ A;  2FOW A;  2JPC A;  5L3G A;  3HEF A;  4M6Y A;  1ZGA A;  4JX4 A;  4HF0 A;  2AHQ A;  3ABM H;  5K5Q A;  1IC8 A;  3OYE A;  3I55 I;  2HQN A;  1JUP A;  2R7W A;  1HW5 A;  4F7Z A;  2V9V A;  1AHD P;  3BY6 A;  5J4V A;  2HR3 A;  3LFU A;  2W25 A;  4RAF A;  4DNC A;  3WTU C;  3DU5 A;  1D1C A;  5L3C A;  2LY9 A;  3H9Q A;  2W7N A;  1X19 A;  1XGO A;  1XCB A;  2BY2 A;  4UXN A;  1KU9 A;  1LEA A;  2P4W A;  4KN7 X;  3QWL A;  3RZD J;  1HDP A;  4BU2 A;  2XF6 A;  3R0J A;  2DT6 A;  2LD5 A;  2EFQ A;  1ZK8 A;  4ASN A;  2RDP A;  2AO9 A;  1G3S A;  1GDT A;  4OOI A;  1SFO J;  1BJA A;  2BE5 F;  3KET A;  1GV2 A;  2BEO A;  4A3B J;  2M0M A;  4EM2 A;  2LVS A;  3E1S A;  3IC7 A;  1J5Y A;  2BHY A;  3BR2 A;  3HSE A;  1JT6 A;  3EYY A;  5F0C A;  1QVU A;  3ZP5 A;  2KRC A;  5ICF A;  2YX7 A;  4CZZ A;  2HXI A;  1ZEL A;  1IJW C;  2HVQ A;  3W2W A;  3I4M J;  4L5I A;  3PSI A;  4CYC B;  2JT1 A;  1YIT I;  3PIP F;  3K70 C;  3I5U A;  3OOU A;  3V8J A;  3HGY A;  1WGX A;  1YRN A;  1BI3 A;  4RBO A;  1YW9 A;  2EIK H;  5HLI A;  3PFI A;  4HOB A;  2IXS A;  1V54 H;  1Z3Y A;  2EV6 A;  3EUH C;  2EZK A;  4F92 B;  1R58 A;  2OBP A;  5IOY A;  3CMA I;  2IGO A;  1KA8 A;  2LF7 A;  3ZN1 A;  3FM5 A;  3WTS C;  1VQ7 I;  4A3M J;  5B66 C;  2AS5 F;  1FMW A;  4ABZ A;  2CFO A;  2RGV A;  4BXF A;  1W4M A;  3TGN A;  2E5Z A;  4IPA A;  1FBU A;  2DW4 A;  3K69 A;  1N78 A;  2H09 A;  2NVX J;  5CQE A;  1FYM A;  5LRS A;  2EV0 A;  4Q47 A;  4EJV A;  3J7A Y;  5CJ9 A;  4FE7 A;  2E34 A;  3TO6 A;  2E35 A;  4HLY A;  3GZ6 A;  2PLY A;  4HX7 A;  3IH4 A;  3FDY A;  4QPQ A;  1VND A;  3ZQF A;  1ETO A;  2FBI A;  4II3 A;  4FAS D;  3NEU A;  5DEQ A;  3CMM A;  3S16 J;  1IRF A;  4DBR A;  2MA3 A;  2K7L A;  4WXD A;  3CUQ B;  4E7Z A;  3BTL A;  1WJF A;  3PUB A;  5GP9 A;  2DDB A;  5IY5 H;  3BT9 A;  3K4B A;  2UXN A;  5FO5 A;  1BBY A;  2EJR A;  2H8W A;  5E3L A;  1GV5 A;  3RI4 A;  4LJZ F;  1T39 A;  3GX4 X;  3L09 A;  1X1A A;  1DDN A;  3S2W A;  2XAQ A;  4Q48 A;  3PNY A;  3D5R C;  4M3D A;  2BVM A;  3KP3 A;  1H0M A;  3K10 A;  3IKV A;  5J1Y A;  2X51 A;  5BOX A;  3CP2 A;  2JRM A;  2JVH A;  1ETV A;  4RA2 A;  1R5H A;  2BY0 A;  3TQN A;  5FLM J;  2ZJP F;  2LKX A;  5IT9 Z;  5F08 A;  2HFH A;  4ENK A;  4NB5 A;  3AG3 H;  1WJD A;  4GCV A;  1KZH A;  4PJ0 C;  2G7U A;  1WHU A;  3K1M A;  1YS6 A;  3TDU C;  1R1T A;  4AYB A;  1MDM A;  1TW3 A;  3ASO H;  1PP8 F;  3LSJ A;  2OCE A;  3AG4 H;  4XLF A;  4ESJ A;  4GXO A;  1FBS A;  2L02 A;  5KVR A;  3HL2 A;  1IO2 A;  4HF2 A;  3RZO J;  1UFM A;  3AAF A;  4L9N A;  2MD0 A;  2LDU A;  1B8I A;  3FMR A;  3IH3 A;  1F43 A;  2Y0S N;  1ZQ3 P;  1KU7 A;  2ECB A;  4L18 B;  2L7F P;  5FKO A;  1Y8R B;  1QZZ A;  4HQM A;  2M7B A;  2DOD A;  1JXS A;  2STW A;  2HQ5 A;  4AVP A;  4IRI A;  4BQN A;  4H4K C;  4ESB A;  3JRH A;  3CMY A;  4O5V A;  4MNU A;  3K70 D;  3JRB A;  1U5T B;  2X1D A;  2YX4 A;  4B43 A;  2VJJ A;  5K5R A;  3MN2 A;  1ONV A;  3TDZ C;  1FIA A;  3DKW A;  4PK4 A;  3KX2 A;  3MVP A;  4XOR A;  4BDY A;  1O7L A;  3HIF A;  2GBY A;  1WSU A;  3H3Z A;  3F8C A;  4DYR A;  3QPT A;  4CA0 A;  3HOY J;  3KPH A;  3TMO A;  3BCB A;  3U21 A;  2L9N A;  2R7Z J;  4XLH A;  4LD5 A;  4LK0 F;  2XAH A;  3ZMV A;  2WB1 A;  1ORK A;  1SFE A;  3RKQ A;  5CVU A;  1U8R A;  1D8K A;  4XMY A;  1EA3 A;  1MNM C;  2V79 A;  2GXB A;  1N25 A;  1ZG3 A;  1B72 B;  2NOG A;  4X1E A;  1ZLJ A;  2D5V A;  4A3C J;  4G94 A;  4JBA A;  1ZRD A;  1TP4 A;  5F27 A;  2CUJ A;  1QA6 A;  4HBL A;  3KEY A;  3WGH A;  1Z1D A;  2EZH A;  3CC4 I;  2HKO A;  4A0X A;  4DJA A;  2XGX A;  4GFB A;  1HW1 A;  4EEF G;  5F64 A;  3HOU J;  4FX4 A;  1DPR A;  3OY9 A;  1UST A;  1LNW A;  2ISY A;  2DPU A;  2FMY A;  2FU4 A;  2QF7 A;  1Y8Q B;  1I1G A;  1I5Z A;  4FCY A;  3MKZ A;  5ICE A;  3DBR B;  1MBE A;  3K4L A;  1R36 A;  1Z67 A;  5CKT A;  4HSR A;  3BPX A;  2HDD A;  1MMA A;  5B1B H;  3NAU A;  1SFU A;  4OIP F;  2RAE A;  2OTL I;  1TZL A;  4JQF A;  5ICC A;  1Z91 A;  4BXU A;  3L2V A;  2JA8 J;  4A3I J;  3VB2 A;  3ZOB A;  4NC7 A;  1JKO C;  4PCQ A;  3JW4 A;  4XRS G;  1ZLK A;  4ZDL A;  3F9K A;  2HVR A;  2ESN A;  4KYW A;  2X48 A;  1PYV A;  2RKH A;  1QHG A;  2QZ8 A;  1WH5 A;  3I4P A;  4HNU A;  2H94 A;  4WK8 F;  2EH3 A;  3IH2 A;  2UZK A;  3H5N A;  3ZPL A;  2X4H A;  2V1U A;  1DPU A;  2ZME B;  3QOP A;  1V5E A;  1E3H A;  4KIF A;  1P6R A;  1VQO I;  1GT0 C;  2JK3 A;  4DOZ A;  1GVD A; 
#chains in the Genus database with same CATH homology
 1OCT C;  4X6A J;  1HLV A;  4JX6 A;  2DA6 A;  1JKQ C;  5M3F J;  4XIC A;  3HGG A;  1Y1V J;  5EGO A;  2JWT A;  2WV1 A;  3BR6 A;  3QPS A;  1H8A C;  5J3L A;  3E7L A;  4IHW A;  3D1N I;  2LR8 A;  3A03 A;  3GTK J;  2B63 J;  1QVT A;  1LE8 B;  2R92 J;  4C3H J;  3OSF A;  2M2E A;  3LSP A;  1UHS A;  1TWF J;  1UMQ A;  3LNQ A;  2CUF A;  5FKL A;  2E2J J;  4D7M A;  1OFC X;  3UKG A;  1A5J A;  3GTL J;  4CYC A;  3TP3 A;  1BA5 A;  1K61 A;  5M5Y J;  3IV5 A;  3LSG A;  2IAI A;  1ENH A;  1ZKG A;  4AC0 A;  2CJJ A;  1LFB A;  1ZR4 A;  4S0H B;  3G1M A;  2DA1 A;  2TCT A;  1ETY A;  3F0C A;  2HXO A;  1VF9 A;  1O4X A;  3BTI A;  5JLW A;  1MBH A;  1H89 C;  4IHX A;  3S14 J;  4A3J J;  3M3Y J;  2Y2Z A;  2FD5 A;  3WHC A;  1NTC A;  2NS8 A;  2EQR A;  2ZB9 A;  2ME0 A;  2Y9Z A;  2XGC A;  2K9S A;  1X2N A;  2HI3 A;  2JA5 J;  2L7M P;  4MO7 A;  2VI6 A;  3ZQH A;  5C4X J;  4I76 A;  2XSD C;  3S1R J;  1TC3 C;  2CRG A;  2K40 A;  3H3V K;  2DJN A;  2R0Q C;  2DTZ A;  5C44 J;  3Q0U A;  2FX0 A;  3GBG A;  3BR5 A;  2VPR A;  2XB5 A;  3HOZ J;  3S2H J;  1P7I A;  4M3G A;  3JRI A;  1B8I B;  1JJ8 C;  5FLV A;  3S1Q J;  4D7N A;  1T56 A;  2P81 A;  4A3F J;  1FEX A;  2XPV A;  3WHB A;  3S1M J;  2XPU A;  3QQA A;  4RDU A;  1OJL A;  2YUS A;  2DMQ A;  4V2G A;  1HF0 A;  1ITY A;  3BR1 A;  4XRM A;  4I6Z A;  2LFB A;  2LK2 A;  2DA2 A;  1PUF A;  4UUS B;  2ELK A;  3O8G A;  3JRC A;  3GTO J;  4G12 A;  1WPK A;  1MBG A;  1D5Y A;  1QRY A;  3S1N J;  4DW6 A;  3LOC A;  1MBJ A;  2JJ7 A;  4HNV A;  4M3B A;  2R5Y B;  2OF7 A;  5FKM A;  3SJM A;  3G1L A;  1SAN A;  5EDN A;  4M3F A;  4J19 A;  2NVY J;  2DA5 A;  1S7E A;  5EF6 A;  1AKH A;  1U9O A;  4C3J J;  3B6A A;  4UUT A;  3TED A;  2DA7 A;  4DYQ A;  2TRT A;  5IP9 J;  1ZGW A;  4IHY A;  3K2A A;  5IP7 J;  1ETW A;  5E3O A;  1ETQ A;  2DN0 A;  2DMN A;  2R5Z A;  2MSY A;  5EEA A;  1Z0X A;  3H0G J;  5F1J A;  3A02 A;  2E1O A;  4QTR A;  2H8R A;  1MH3 A;  3PO3 J;  5EG0 B;  5JLX A;  1X58 A;  5M3M J;  1IGN A;  3BQZ A;  1E3O C;  1U78 A;  2M9H A;  3RQI A;  2L9R A;  2L7Z A;  3S15 J;  3S17 J;  4BBR J;  4FTH A;  2DMP A;  3Q0V A;  2W48 A;  3CQZ J;  4LOC A;  3TP0 A;  9ANT A;  1JGG A;  4IHV A;  5FKN A;  5IP6 A;  3HEF A;  3A01 A;  1IV6 A;  4DZJ A;  2LLK A;  1MSE C;  2Y9Y A;  3FK6 A;  4JX4 A;  1MBK A;  3OSG A;  5GPA A;  2AHQ A;  2NS7 A;  1IC8 A;  1JJ6 C;  3BG5 A;  2K9Q A;  5K7Z A;  1JUP A;  1B72 A;  1U8B A;  2JMW A;  1AHD P;  3W6V A;  1WI3 A;  2ID3 A;  3BTC A;  1ETK A;  3HOX J;  1K83 J;  2LY9 A;  5IYC J;  4L5E A;  3GTG J;  3JRA A;  1ZTR A;  5EZG A;  3B6C A;  5F0H A;  5IOZ A;  5EGO B;  3BR3 A;  4MFE A;  3RZD J;  2Y30 A;  4NDL A;  1HDP A;  3VPR A;  1GUU A;  5J1U A;  2LD5 A;  2I10 A;  5F04 A;  5C3E J;  2PMZ N;  1ZK8 A;  2ME6 A;  2DMU A;  2AO9 A;  5J1R A;  3GTP J;  3JRF A;  1GDT A;  4MLO A;  3ZQL A;  4A3G J;  1SFO J;  3C2B A;  3MKL A;  3K7A J;  1H88 C;  1GV2 A;  3FKI J;  1U9N A;  1XS9 A;  3Q3S A;  5IPA A;  4A3B J;  2LVS A;  3BR2 A;  2VUM J;  3GTQ J;  1JT6 A;  1FTZ A;  3BQY A;  5DS9 A;  1W0U A;  1JTY A;  2DA4 A;  5F0C A;  1QVU A;  2E19 A;  1A6I A;  4A93 J;  2DMT A;  2VKE A;  2HXI A;  2MGQ A;  4AYB N;  1IJW C;  4M3E A;  3I4N J;  5DTD A;  3I4M J;  4CYC B;  2FJ1 A;  3QPL A;  5F0F A;  1JTX A;  1MBF A;  5K7F A;  2K9N A;  2IEK A;  3HGY A;  3OOU A;  2XB0 X;  3FK7 A;  1WGX A;  1YRN A;  2H1K A;  1Z77 A;  4D5C A;  3S2D J;  2NVT J;  3BTJ A;  4RBO A;  1RES A;  2XGD A;  5IOY A;  2EZK A;  1IDZ A;  4A3M J;  4ABZ A;  4QIW N;  1CQT A;  2LTP A;  2FQ4 A;  1ETX A;  1VFC A;  1NK3 P;  2NVX J;  2JA6 J;  1LE8 A;  5K7H A;  4FE7 A;  3HOV J;  1FTT A;  5E3N A;  3DEW A;  5M5X J;  1RET A;  1DU6 A;  1MH4 A;  1BW5 A;  3IH4 A;  3CCY A;  2L0K A;  1G2H A;  2JA7 J;  1VND A;  3ZQF A;  1TWC J;  1APL C;  4A3D J;  2WAQ N;  1FJL A;  1ETO A;  4W1U A;  1BW6 A;  3S16 J;  3Q0W A;  3HM5 A;  3HDD A;  1W0T A;  2WB1 N;  3BTL A;  5GP9 A;  2O8K A;  3PO2 J;  4JP0 A;  3BT9 A;  3TW6 A;  1JKP C;  2Y31 A;  5E3L A;  1T33 A;  4A69 C;  3JRD A;  1GV5 A;  1JUM A;  3L1P A;  1IUF A;  2COB A;  1RPW A;  4DZP A;  3TW7 A;  4A3K J;  4M3D A;  4XID A;  4Y52 J;  4FE4 A;  3PM1 A;  5J1Y A;  2HOT A;  3BR0 A;  3HB9 A;  5GPC A;  2G0E A;  2HYJ A;  1PUF B;  1FIP A;  1ETV A;  4JX5 A;  5FLM J;  1WCM J;  4MFD A;  2LKX A;  5F08 A;  5BNG A;  3BG3 A;  3OIO A;  1LFU P;  5M5W J;  4B1R A;  2OPT A;  1Q1V A;  1TWH J;  4BKX A;  1EF4 A;  1TWG J;  2LP0 A;  4BXX J;  1Y1W J;  4FIS A;  3LSJ A;  1BL0 A;  2M34 A;  4MIM A;  3ZQC A;  2CQX A;  5IYD J;  4XRS A;  2IBD A;  3RZO J;  2M8G X;  2O7O A;  4AUX A;  1AKH B;  5EZH A;  1B8I A;  3IH3 A;  1ZR2 A;  2KDZ A;  1F43 A;  2Y0S N;  1DU0 A;  1ZQ3 P;  4B4C A;  1IDY A;  2ECB A;  2L7F P;  2VKV A;  5EYR A;  5FKO A;  3GTJ J;  2HOS A;  3ZQG A;  4Y7N J;  5FJ8 J;  3SFI A;  1I3Q J;  2HQ5 A;  2XGE A;  4IEJ A;  2R5Z B;  1MSF C;  4JYK A;  3JRH A;  3HOW J;  3CMY A;  1RKW A;  2M0C A;  3JRB A;  3O8H A;  2NVQ J;  2XPW A;  4B3A A;  1OCP A;  3MN2 A;  2EBI A;  4QSH A;  4UUS A;  1NK2 P;  1FIA A;  3MVP A;  2CU7 A;  1F36 A;  2GBY A;  4BY1 J;  2QCO A;  2YU9 J;  2KT0 A;  4DYR A;  4XK4 A;  3HOY J;  2R5Y A;  5E3M A;  5C4J J;  3A01 B;  4A3L J;  4V2F A;  2R7Z J;  1IRZ A;  1UG2 A;  3SDG A;  2MW8 A;  2GM4 A;  1ORK A;  4M6V A;  3RKQ A;  1HOM A;  5HOD A;  1VI0 A;  1GT0 C;  3BG9 A;  1MNM C;  2JN6 A;  2XRL A;  2HOA A;  5IYB J;  2CQQ A;  4DYC A;  1B72 B;  2NOG A;  4X1E A;  2D5V A;  3M4O J;  1TWA J;  2EZL A;  2X6O A;  3HBL A;  4BY7 J;  4A3C J;  3CDL A;  3ZQI A;  1RKT A;  2R93 J;  5F27 A;  2EZH A;  1P7J A;  3HOU J;  4GFB A;  1R9T J;  4EEF G;  1QPI A;  2MG4 A;  2YS9 A;  3FIS A;  1RR7 A;  1BJZ A;  2DA3 A;  2X9D A;  1POG A;  2QF7 A;  2N8G A;  4FCY A;  1IG7 A;  4BBS J;  1XG1 A;  1MBE A;  1X2M A;  1I50 J;  5EG0 A;  1HCR A;  1AU7 A;  3LSR A;  1JT0 A;  2CUE A;  2HDD A;  3GTM J;  4D5F A;  2O9L A;  3NAU A;  1HDD C;  2RAE A;  2JA8 J;  4A3I J;  3ZOB A;  1JKO C;  5FKK A;  1JKR C;  2ECC A;  4XRS G;  1XC5 A;  3HKZ N;  1I6H J;  1WH7 A;  4W97 A;  3JRG A;  2X48 A;  2EZI A;  2E2H J;  1WH5 A;  3G1O A;  4C3I J;  4C2M J;  2EH3 A;  3IH2 A;  2GLO A;  3JRE A;  3NAR A;  3JR9 A;  2ID6 A;  1YRN B;  2E2I J;  3FIW A;  1JUS A;  4A3E J;  2JK3 A;  1GVD A;  3DCF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...