2L7FP

Solution structure of the pitx2 homeodomain
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
68
structure length
68
Chain Sequence
GSQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKREEFIVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the Pitx2 Homeodomain
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Pituitary homeobox 2
total genus 20
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2010-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2l7fP00
2G0EA 1QPIA 5EGOA 1JGGA 2HOSA 2NVYJ 2EBIA 2LKXA 3ZQCA 1OFCX 1RKTA 3H0GJ 3HOYJ 2E2JJ 2TRTA 1X2MA 2HI3A 2VKEA 5F0FA 3IH2A 4QIWN 2X9DA 3HOZJ 2EH3A 4IEJA 3IV5A 3FIWA 1T56A 5C4JJ 2NVXJ 3K2AA 2M34A 1G2HA 4IHVA 5E3NA 3RKQA 3LSPA 5K7FA 2EZHA 2ME6A 5M3MJ 1ITYA 3DEWA 2KDZA 4CYCB 1XC5A 1Q1VA 4XRMA 3OOUA 3JRDA 1DU0A 3S1NJ 5EEAA 2EZLA 2CUFA 1ZK8A 5IYDJ 1WCMJ 5FKKA 1WPKA 5IP7J 1MH4A 4QSHA 3BR2A 4J19A 1ZTRA 4GFBA 4D5CA 2ID3A 3GTPJ 1VF9A 4M6VA 4ABZA 1TWCJ 3TP3A 1JUMA 2DTZA 3ZQHA 1MH3A 4MLOA 4FCYA 3S15J 3I4NJ 4A3CJ 2FQ4A 1B72A 4M3FA 4XRSG 5E3OA 3HBLA 2E19A 2JWTA 2OPTA 2GM4A 3GTJJ 4A3IJ 9ANTA 4DYQA 4G12A 4XIDA 2DMNA 3E7LA 4EEFG 3MVPA 3JRFA 3UKGA 1F43A 3BQYA 3WHCA 1I6HJ 2ID6A 2LR8A 2P81A 3Q0UA 5IOYA 1XS9A 1RETA 1SANA 4M3EA 5M5WJ 4V2FA 3L1PA 2CU7A 2EZIA 1B8IA 2DA3A 1MBHA 2B63J 2VUMJ 2L7MP 4FISA 4NDLA 2NOGA 1TWHJ 3FK6A 4DZPA 4HNVA 1PUFB 3GTOJ 2XGEA 1JJ6C 5IOZA 5K7ZA 5FKLA 2CQXA 4MFDA 2JK3A 3B6CA 5J1RA 1DU6A 1ETXA 1ETOA 1W0UA 4JX4A 4BBSJ 2L0KA 1OJLA 1VFCA 1GVDA 2HYJA 1LFBA 4BXXJ 4A3KJ 1OCPA 3PM1A 1QVTA 1UG2A 2RAEA 1IV6A 2Y31A 1HF0A 1JUSA 2LTPA 1HOMA 1ZKGA 3S14J 4C3IJ 2XB0X 1U8BA 2PMZN 5IYCJ 2YU9J 4A69C 3S1MJ 2DA7A 5E3LA 5FLVA 4MIMA 4M3GA 3G1OA 1JKOC 4X6AJ 2QF7A 4A3GJ 1AU7A 2Y30A 4C3HJ 1HDDC 4X1EA 1Y1VJ 3BG3A 4UUTA 4A3FJ 1B8IB 2LP0A 2E2HJ 3M3YJ 5DS9A 1QRYA 2XPWA 3A03A 2ECBA 1XG1A 2JN6A 4DYCA 5M3FJ 1PUFA 2DA2A 1BA5A 1B72B 2L7FP 4XRSA 1O4XA 1IDYA 5EZGA 1WI3A 3BG5A 4D7NA 4IHXA 4BY7J 1IRZA 1ETVA 1TWAJ 4IHWA 3Q0VA 3BR1A 2EQRA 4MO7A 3TEDA 2VI6A 3VPRA 2K40A 5DTDA 2DA1A 2ZB9A 5JLWA 4I76A 3JRGA 1Z0XA 2NVQJ 1A5JA 4BKXA 5IYBJ 2JA8J 3GTLJ 3A01B 2R5ZA 1JKPC 5IP6A 2ME0A 2N8GA 2X6OA 4FE4A 5F1JA 3H3VK 2OF7A 2HDDA 2MGQA 3QPSA 4AYBN 1NTCA 1IG7A 2R92J 3ZQGA 2O9LA 3WHBA 1FIAA 2KT0A 1FTZA 1U9NA 1TC3C 1T33A 1GV5A 2CJJA 2WAQN 3JREA 3G1LA 3BR0A 2HOTA 3S2HJ 3BTLA 2DMUA 2HXIA 2TCTA 1MSEC 2XB5A 3JRAA 2K9NA 2YUSA 4V2GA 5F0HA 2MG4A 3HGYA 4JP0A 5GPAA 4W1UA 3HOWJ 5HODA 4XICA 4C3JJ 4M3BA 1LE8B 1P7IA 1OCTC 1X58A 5M5XJ 1K83J 3QQAA 5JLXA 1S7EA 4BBRJ 3CDLA 1UHSA 2XGCA 5EDNA 2D5VA 5F0CA 4S0HB 3JRIA 1FIPA 1MSFC 4A3JJ 4JX6A 3JRBA 2O8KA 1VI0A 1GDTA 1MBFA 1I50J 3BQZA 2ELKA 2M2EA 2LLKA 2VPRA 3LSRA 1Z77A 1ZQ3P 1U9OA 2DMPA 5C44J 1FJLA 2IBDA 2XPUA 3HOXJ 2R0QC 2Y0SN 3ZQFA 3OSGA 1JJ8C 2XRLA 3LOCA 4AUXA 4RBOA 2CQQA 2FJ1A 5J1UA 2DMQA 2DN0A 2NS8A 2JA5J 3BTJA 2E2IJ 3TW6A 4IHYA 1RPWA 5EYRA 1BJZA 4A3EJ 3S2DJ 2DJNA 3M4OJ 1I3QJ 1F36A 4Y7NJ 4BY1J 2LFBA 1GT0C 4M3DA 1HDPA 1POGA 3BR3A 1JT6A 2WV1A 2R7ZJ 3ZQLA 5EG0B 1MBKA 1ZR2A 4A3MJ 4A93J 1BL0A 3MN2A 3TP0A 4QTRA 2R5YA 1YRNB 4Y52J 3ZOBA 5F04A 1BW6A 2L7ZA 2M9HA 3IH3A 5GPCA 2H1KA 3BTIA 1Y1WJ 2JMWA 1LE8A 4AC0A 3A01A 2R5ZB 3CMYA 2DMTA 3RQIA 1IC8A 2COBA 4LOCA 3BR5A 2Y9YA 2LVSA 5J3LA 2AO9A 3LSJA 4JYKA 2GBYA 3NAUA 5FJ8J 5E3MA 2EZKA 5FKMA 1A6IA 5F27A 3QPLA 5FKOA 1EF4A 3HKZN 2CRGA 3G1MA 1D5YA 2ECCA 1ENHA 1WGXA 2NVTJ 4D7MA 2LY9A 1ETWA 3PO3J 3CQZJ 4I6ZA 4UUSA 3LSGA 3B6AA 3HEFA 3MKLA 2AHQA 3JRHA 5EZHA 1RESA 3I4MJ 5K7HA 1GUUA 3S17J 3FKIJ 2IEKA 1RKWA 1ZGWA 4B4CA 3HOVJ 4DYRA 2JA7J 5EG0A 3GTQJ 1AKHA 5IP9J 3D1NI 1ZR4A 3ZQIA 2W48A 1HLVA 3BG9A 3BR6A 4DW6A 2QCOA 5EGOB 3S16J 2DA4A 2X48A 3IH4A 3LNQA 1SFOJ 2YS9A 1IJWC 2FD5A 2XGDA 3S1QJ 1JTXA 5FLMJ 1TWFJ 5FKNA 1GV2A 2XSDC 3GTGJ 2FX0A 2M0CA 4B3AA 3HB9A 4W97A 2R93J 4A3BJ 4FE7A 1UMQA 3NARA 2MW8A 5J1YA 2XPVA 1IUFA 3F0CA 1X2NA 4XK4A 2L9RA 3Q3SA 3HGGA 1H89C 1H88C 4CYCA 1JT0A 3RZDJ 2Y9ZA 1VNDA 3C2BA 4B1RA 3HOUJ 3O8HA 1APLC 1RR7A 3SDGA 1WH7A 1JKQC 3BT9A 3JR9A 2LK2A 4FTHA 4C2MJ 1E3OC 1AHDP 2R5YB 5C3EJ 1YRNA 2JA6J 3SJMA 1NK3P 3PO2J 3OSFA 2JJ7A 3CCYA 3HM5A 1IDZA 4D5FA 1ETQA 3W6VA 3GTKJ 2O7OA 1FTTA 2MSYA 1FEXA 3FK7A 2I10A 5M5YJ 2E1OA 3JRCA 4L5EA 2HXOA 1AKHB 3TW7A 3OIOA 1JKRC 1ORKA 5EF6A 2HOAA 4MFEA 3HDDA 2CUEA 2WB1N 5GP9A 1TWGJ 1CQTA 2K9SA 3O8GA 1ETKA 3FISA 4A3DJ 1W0TA 2H8RA 1BW5A 2IAIA 1U78A 1MBEA 3RZOJ 3Q0WA 2VKVA 4JX5A 5BNGA 5F08A 1NK2P 4UUSB 1MNMC 2HQ5A 1R9TJ 1P7JA 1MBGA 2DA5A 2NS7A 1QVUA 3K7AJ 1HCRA 3SFIA 4RDUA 4A3LJ 1JUPA 1WH5A 2M8GX 2GLOA 3DCFA 2Y2ZA 2DA6A 3GBGA 1K61A 1IGNA 2LD5A 3BTCA 3S1RJ 3GTMJ 1LFUP 4DZJA 2K9QA 1JTYA 3A02A 5C4XJ 1ETYA 1H8AC 5IPAA 1MBJA
chains in the Genus database with same CATH superfamily
3DLLF 1F9NA 5EGOA 1JGGA 4LG0B 4KT6A 1XSDA 4RMNA 4PGGA 1PP7U 4UV8A 1QPMA 1T08B 2G7UA 2DFHA 1ZG1A 2BVLA 2PN6A 4ZDPA 1TZLA 4OMYA 1HXDA 3T0YA 3EUHC 1T56A 1IAWA 2NVXJ 4BQAA 4E7HA 1G2HA 1D8JA 3KETA 2K02A 5IY5H 3D5SC 2F5CA 4LK0F 3GF2A 2NNYA 1Q1VA 2X4HA 1MNDA 3OOUA 5IT9Z 3S1NJ 5EEAA 2EZLA 2CUFA 1M1EB 1ZK8A 3K69A 3CCQI 2JQ7A 1WPKA 4IHSA 3ELKA 4G6DA 4QSHA 2O8XA 2A68F 4BE2A 2IGOA 4NUBA 4J19A 1ZTRA 4CHUA 3CD6I 4NC7A 1X19A 4M6VA 3S3OA 1G3TA 4XL9A 4ABZA 2DTZA 1WZ2A 2KRFA 3ABTA 5CKTA 4EVIA 1Z9CA 3S15J 2Y69H 3KIOA 5A2QZ 4LG3A 4XKCA 4CDGA 4EJOA 4GYGA 4HW0A 1IRFA 2FQ4A 4YIFA 3CCLI 1B72A 4HSTA 5ED4A 3S3MA 4IF4A 2GM4A 3QODA 2MD5A 3OS0A 4RB0A 4DYQA 1E3PA 4G12A 3K4JA 2FSWA 1VQ7I 3V8JA 4I01A 2DMNA 1KONA 5ICCA 2HQNA 3CCRI 3MVPA 4L9NA 3TL4X 3RPUA 1KA8A 2LR8A 2P81A 3Q0UA 1XS9A 4OIQF 1YW8A 3CP2A 2Z33A 4M3EA 4JOMA 1O7FA 1ZHFA 4ZYHA 2CU7A 2LBFA 1B8IA 2EINH 1MBHA 2KPMA 1HW5A 4FISA 4NDLA 4ZDLA 3CC7I 1SC7A 2FOKA 3G4SI 2OJED 1U6GA 2R7OA 1P4XA 2HZTA 1TT0A 2A07F 5D5WB 4XKWA 3BZCA 1T39A 4BXFA 1R5GA 5IOZA 3L2UA 3HRUA 2WAQA 2YSRA 4XORA 2CUZA 5FKLA 4F7ZA 1BR4A 2JK3A 1G8XA 3QP6A 3V8KA 2B9SA 1X1CA 1RNLA 4G7ZF 2KZVA 3E3VA 4M72A 2KIMA 4JX4A 2ZCWA 4E7ZA 3W2AA 4BBSJ 2BHZA 5FFXA 2IA0A 4Y13A 2RQPA 2LKPA 1AA7A 4CA0A 3M9AA 5GADJ 3VB2A 1OCPA 1W4MA 2WBMA 1IV6A 4IVNA 4L5JA 2Y31A 3GCMA 1HOMA 3L9FA 4NQWB 2XAUA 1WKMA 1REPC 5CLSA 2R7WA 4UY8I 4S04A 4P5OA 2PMZN 2QYOA 2WC2A 4QWQA 1QHGA 2VBWA 3AG1H 2DA7A 4EJUA 1U5TC 3FZVA 2P4WA 3CCMI 2PMHA 3EYYA 2A05A 5B1BH 3MKYB 1R22A 4A3GJ 1WJAA 2L9NA 2Y30A 4A5MA 5KK1A 4A3FJ 4DBRA 1Y0NA 2ZNZA 3K1NA 2DW4A 5DS9A 5LD2C 2X1CA 4R8HA 3OWTA 4BXUA 2GQQA 2ZJRF 5A2QK 3IWZA 1LDDA 4DOZA 5LLQA 1X4PA 2IVMA 1B72B 3OYCA 2LC2A 4XRSA 3KP6A 1B4AA 3N4MA 3CDHA 1IRZA 2OV7A 2EQRA 1O3RA 4M71A 3TEDA 2VI6A 3HTSB 2ICWG 2FNAA 4BU2A 4RGSA 4X0GA 4N4OB 2M5WA 3H9QA 3AG2H 4BKXA 5B3SH 3T8TA 1K78A 2JA8J 2BY1A 2ME0A 4LJZF 4PZJA 2DFIA 4BJTA 1PUEE 2X6OA 3MCZA 3SEQA 1LVAA 2OF7A 3EUAA 1YX5A 5HS9A 3QPSA 2P0WA 5HLIA 1B59A 1NTCA 2R92J 3PSFA 3CMAI 1DQUA 4CO8A 4IHTA 3F8BA 1J7KA 1U9NA 3AFHA 1T33A 3WTYC 1DDNA 1MMSA 1MMGA 1K7AA 4PFOA 3JREA 3BR0A 5FLXZ 2FA5A 2HOTA 1J09A 2CMPA 2DFFA 3E6CC 4XLPF 3J80Z 3FBNB 2PJPA 2QWWA 2K9NA 2YUSA 1OMIA 1TT5B 3HGYA 3PL8A 3G2BA 4RAFA 3HOWJ 1Z7UA 2ZJ2A 1LE8B 2CW7A 2GOXB 3WU2C 2X0LA 3RKWA 3QQAA 4YIIA 1R23A 2I5UA 1S7EA 2RN7A 1W36C 1V55H 3CDLA 3IC7A 2VXDA 3JSOA 3LSTA 3JRIA 1FIPA 1TQIA 5DD4A 4DGWB 3BWGA 3SZGA 4GO1A 1ZELA 4JX6A 4UNOA 2EB7A 3GZ6A 1VI0A 3FX3A 3U9GA 2VKHA 4QPOA 3ZRGA 2ELKA 2M2EA 3EQLF 1V4RA 3K4LA 1FJLA 1XD7A 1QNTA 1ODDA 3R60A 4BUPA 4PSWA 2R0QC 3LOCA 3W6KB 1KYZA 2BXYA 2CQQA 3LA3A 5GTIC 4MEXF 5J1UA 4EQQA 2DDAA 2EPFA 3R0JA 2RGVA 2DN0A 3ZQ7A 2JRTA 2E2IJ 3TW6A 3AG3H 2BY3A 2F4IA 1S6LA 4A3EJ 3B73A 5DM7F 2VJ4A 2ZNYA 3QP5A 1A04A 2IJLA 3KEQA 4HYEA 1FOWA 1HKQA 2E35A 4Y7NJ 3ZQQA 4BY1J 1R36A 1FWZA 2WV1A 2R7ZJ 2CQKA 2ETHA 3F22A 4PK4A 5K5QA 1SD4A 3TP0A 4NHJA 3ABUA 3J80K 4QTRA 2VLAA 2R5YA 4H0EA 2V6EA 4Y52J 2B0LA 3ZOBA 2OZ6A 1N25A 2L7ZA 3QYBA 1K4TA 3TDUC 3BTIA 1Y1WJ 1X1PA 2LF7A 2HQRA 3NEUA 1ZGJA 5ICEA 2MC4A 5D8LB 4LOCA 1O3QA 2QLZA 1R5HA 2Y9YA 4ZJZA 5L3EA 2GBYA 3NAUA 2BZTA 5ICFA 2VQCA 5GAGJ 4OIOF 1JXSA 3H92A 2V7FA 5FKMA 3M7GA 3QPLA 1ZYRF 4ZC3A 1EF4A 5E18F 4OOIA 2ZXWH 3RKXA 2VIXA 2MFZA 5BPIA 2CRGA 2XAQA 1D5YA 4CCLA 1DP3A 1BI2A 2DTRA 4F55A 3ONQA 3BP8A 2NVTJ 1KZHA 5LRSA 3JAMK 3D5RC 1WHUA 1MIJA 4WCGA 2M4KA 2WADA 1RESA 2ZMEB 4MNUA 4I2OA 3Q9VA 5D6EA 2FMYA 1A36A 3DPLC 4M6XA 3CJQB 4MTEA 3S17J 2IEKA 3BCBA 2XF7A 1U3EM 2JA7J 5EG0A 3K0LA 3GTQJ 1U5TB 2J5OA 1T0FC 4HSRA 1ZR4A 4ZDOA 4XLNF 1HLVA 3K4NA 1TQPA 1W1WE 4KUMA 2LDUA 3BR6A 2QCOA 5BPDA 3FMQA 1JHFA 1ON1A 1IJWC 1OCCH 4CICA 2M3AA 3LAJA 5FLMJ 3S1QJ 4LLGF 1D8KA 1GV2A 3SZTA 3KP7A 4YFNF 3QPHA 4EMSA 2CG4A 3W2VA 3GTGJ 1RUNA 4B3AA 1HKTA 4XLAA 2CH0A 2FXAA 4IL6C 1LJ9A 2MW8A 5J1YA 3CF5F 3RQ4A 3F8NA 3KEYA 4B44A 3HYIA 4GYIA 3Q3SA 2LSOA 1H89C 1H88C 4CYCA 4HAMA 1FT9A 1K6YA 1FBQA 1H9GA 2IS2A 3C2BA 4DNCA 2FE3A 1APLC 1RR7A 3ZMSA 2X6YA 3JR9A 2LK2A 5JHUA 1D3YA 4FTHA 1J59A 2H94A 4HV5A 3SFZA 1YYVA 2W82A 4I7HA 3CUQB 3X2QH 5KAFC 4OU0A 3OS2A 1YRNA 5C3EJ 2JA6J 3L2CA 1NK3P 4LK1F 3PO2J 3KPHA 2KZGA 3CCYA 4PUSA 2O7OA 2ZSIB 1USTA 3O2PE 1QU3A 3J7ZI 3JRCA 4G7HF 4NNJA 4B47A 1AKHB 3DPUA 3K4KA 1ZARA 3R0AA 1MMNA 1JKRC 2R4GA 3VDXA 1YW9A 1OISA 4BJ5C 2XHKA 1E2XA 2NS0A 3HDDA 4ZYAA 2CUEA 4WWCA 2WB1N 1A31A 3M8FA 3LWFA 5GP9A 4C30A 3CLOA 1A6QA 4ITVA 1XSXA 4RLFA 3O8GA 2MD0A 2HPMA 2HR3A 1YG2A 5L3CA 3V8LA 2IAIA 4MTDA 3RZOJ 3Q0WA 3RYPA 5JHFA 3DKWA 5F08A 3F8MA 2ELHA 3DFGA 2OCCH 3WTTC 1WJDA 3PNYA 2V1DA 3TGNA 1MBGA 2DA5A 2KHMA 2NS7A 3I59A 3BROA 3K4CA 5LHHA 3SFIA 2L01A 1B9NA 4I09A 4Y15A 5LGNA 4KIFA 3P9KA 1MW7A 3ABLH 4XR6A 4A3LJ 3DCFA 2Y2ZA 2DA6A 2OQRA 3OL4A 4ENMA 2UXXA 2FU4A 1IGNA 4RB2C 2LD5A 2DU9A 3S1RJ 2JUCA 3GTMJ 3CLQA 4GXOA 3A02A 2BGCA 1ZLJA 1H8AC 1W5SA 2LKXA 1FP1D 3HOYJ 1RKTA 3GEZA 5ILUA 4RAGA 3AL0B 2RV8A 1YFHA 1X2MA 1VQOI 4BE1A 4A0XA 3ZCOA 5J47A 1ZRDA 2EH3A 3M1CA 3IV5A 3FKJA 4D9JA 4HF1A 1R5ID 1Y0UA 2CFXA 2M34A 2F5FA 3PJRA 3LSPA 5M3MJ 1FYMA 4CYCB 5J4YA 4NB5A 3T8RA 4XRMA 3E6MA 5CYVA 3K70D 1SVLA 3F23A 2G7HA 2PI0A 5FKKA 2GIVA 2L2OA 4KN4X 1R1UA 2VPLA 3TDZC 5FROA 2BHYA 3BR2A 1TW3A 2AXLA 3HTUA 4GFBA 3FXKA 4D5CA 1RUOA 1A35A 2YU3A 3I0TA 5J8CA 1TWCJ 1LNWA 2LOOA 1MH3A 5TRDA 1P6RA 3HUGA 4BEHA 2KIQA 3I4NJ 3VODA 2XIGA 4LFUA 4HQEA 3JW4A 4U0VA 2RVCA 3I3LA 1U2WA 1SMYF 3WU1B 2ESNA 2V26A 2E19A 2JWTA 2OPTA 4XQFA 3GTJJ 1QHHD 3GWZA 2BBYA 4A3IJ 2Q1ZB 4ANJA 4CUGA 2QGUA 3V7SA 1J75A 3S93A 1YJNI 3VOEA 1F1ZA 5L3GA 3E7LA 1P2FA 2JPBA 3QPTA 3JRFA 1UHMA 1F4KA 2PMUA 3MKZA 2JPCA 3UKGA 1UB9A 3WHCA 3OMYA 2L54A 1I6HJ 5IOYA 2I8DA 4RB1A 1JHHA 1MKMA 1O3SA 2P6TA 3WODF 2H1LA 3L1PA 3IRQA 3VYSB 2QVOA 4KNYA 2B63J 3IP4B 2WWYA 2DYRH 1OR7C 2EFOA 2V1NA 1CF7B 1ZLKA 1EH7A 4KJZA 1NHAA 2MC3A 3FK6A 3OS1A 2WA0A 3T1BA 4DZPA 4HNVA 2P5LC 5HNFA 1YITI 4G94A 4N9HA 2OCEA 1IF1A 3DBHB 2GAUA 3GFIA 2OC6A 2XGEA 1Q1HA 1TP4A 5K7ZA 1IRGA 2VC0A 2F4OB 5J1RA 5E8IA 1DU6A 4Q4ZF 1ETXA 1YE9A 2M1BA 2ZO4A 4XLCA 1ETOA 1W0UA 4E4HA 4YFXF 2UUZA 3DQVC 3GVAA 2HYJA 2VN2A 4BXXJ 3KZYA 2K5CA 5LGTA 4A3KJ 2QKMB 1VQLI 1Y6IA 3K2ZA 3HIFA 4KT5C 2RAEA 3GFLA 4A0ZA 4Q48A 1ZKGA 4XONA 2UV1A 4LGWA 1Z1DA 2DK5A 1DUXC 1V54H 4UV9A 4ZYGA 2HVSA 5D8KB 3K1PA 3KYCB 2YU9J 1XCBA 1IN6A 5KNLA 5E3LA 4M3GA 2R3SA 3G1OA 2ZFUA 5E8GA 2NXNB 2QF7A 3PNTA 4XM3A 3QYEA 2QUFA 2LP0A 3D5LA 3DKXA 3KYDB 1QRYA 2XPWA 5DYMA 2A5YB 1X4OA 1BR2A 3C18A 4DYCA 2XAJA 1QA6A 2E1CA 5LFAA 3TO7A 4IRGA 3FM5A 1FYKA 1O4XA 1TW2A 5DM6F 1IDYA 3HPGA 3BG5A 5EZGA 4D7NA 3Q5FA 3QOPA 3G6EI 1BC8C 4BY7J 1TWAJ 5FD5A 4ZYDA 2BY0A 4N4NB 3OYLA 2CFOA 3BR1A 3TOBA 5DTDA 3O6BB 3VYRB 4L9JA 4P55A 1BN5A 3CC4I 1MJBA 4I76A 5HOOA 3JRGA 3GMEA 2ZXJA 4E7JA 1WJEA 2V9VA 4PSXA 1B6AA 4OWRB 1DP7P 3CMEI 3A01B 4XLFA 2R5ZA 2L7KA 3FWEA 1U8RA 2EFWA 1LQ1A 4HX7A 4KITB 3K1MA 1SAUA 2N8GA 3BJOA 4M9ZA 2VOOA 3MWMA 3H3VK 1VQ9I 3K9TA 1MDMA 2FBHA 2WTEA 3BJ6A 5KAIC 1VQKI 6PAXA 4GCVA 1YIOA 2DODA 3ZXSA 1IG7A 3AKZA 1V5GA 2VE9A 2K3FA 2K4JA 5F6FA 1ZAOA 1TC3C 2MBFA 2CJJA 1ZRFA 3V7RA 4FX4A 3BG7A 1YIJI 1XSVA 3BPXA 4UB6C 3HSRA 3WG7H 5HDNA 1MGTA 2HTJA 5BQTA 3JRAA 4R79A 5GPAA 2HWVA 4W1UA 1YJ9I 5HODA 3GZ5A 4XICA 1FMVA 1V3FA 2Q2EA 1WSUA 5FO5A 4IOAF 3K6GA 1G3WA 5HLHA 3MKWB 5M5XJ 1PP8F 5JR3A 5JLXA 2VBXA 1JGSA 1UHSA 3MAJA 1YW7A 2Z3YA 3E5UA 2XROA 2HDCA 5EEHA 2O8KA 3OYKA 3JRBA 1FY7A 3DKYA 4U87A 2IS1A 1N75A 3DP7A 1NH3A 5FRMA 1MBFA 4BHPA 3BQZA 3DTKA 3MD2A 4Y4RA 3U1DA 3OV8A 1ZQ3P 2XPUA 1Z7LA 1S5LC 2E1MB 2Y0SN 1B9MA 2M8EA 2W84A 4DIQA 2JSCA 4HDUA 1OR7A 2FJ1A 2DMQA 2ISZA 3HC7A 5JVTA 3JSPA 1XGOA 3BTJA 2HNHA 2ZKZA 4G9YA 1V5FA 1RPWA 1FOXA 3H5NA 3CJNA 2O03A 1HSJA 2YR2A 3WTUC 3REOA 2CV0A 3HOSA 5JVGF 2LFBA 4HPQA 1GT0C 3NRVA 1HDPA 4OIPF 4XRFA 1JT6A 2RC4A 2HQAA 3N05A 2L02A 3FXJA 1QZYA 5EG0B 3ZQLA 3C1DA 1I6XA 2BEOA 2MLGA 1ZR2A 2AQEA 3E97A 4ENJA 1YQAA 4HV6A 1T0FA 3TO9A 1BL0A 1YRNB 3DWLE 2Y0SA 2IA2A 2M9HA 2XF6A 2E34A 1HW1A 3IH3A 3IKVA 2H1KA 4JBAA 3IL2A 2VODA 3TQNA 4IJAA 3A01A 4R1HA 1OCRH 3CMYA 1J2XA 3FMRA 3RQIA 1IC8A 2EFPA 2COBA 3BPVA 4DQ2A 1IW7F 3BR5A 2QEXI 3GX4X 1T6SA 4CCMA 2LVSA 2ZMEC 1BI0A 1MD0A 5J8FA 4BE0A 3WTZA 3IAS2 2LG4A 3OYNA 2F48A 5FJ8J 2W57A 5E3MA 1K4SA 2EZKA 1SAXA 3IUOA 4HX8A 2ZBKA 4UXNA 4IRHA 2KP6A 3M1EA 3G1MA 2DT6A 2E71A 1WGXA 2X1EA 2XDVA 3I71A 3R6SA 4D7MA 2LY9A 1X3UA 5GTHC 1PDNC 1BM9A 3CQZJ 4UUSA 4D0PA 2O5RA 3F8CA 2OU2A 5E1XA 2CWEA 4F93B 3HEFA 3MKLA 2QSFX 3JRHA 5EZHA 3I4MJ 5KHDA 5K7HA 3CC2I 2VKDA 1OCOH 4A6EA 3FKIJ 1RKWA 1WJ5A 4QLCU 5HDGA 4BQNA 3ERED 2XRNA 3D1NI 3I55I 1FBSA 5AIQA 5H20A 1YTYA 5ILVA 1I1SA 2X1DA 4LG0A 5EGOB 3MZYA 1SFOJ 3VYTB 2Y0MA 1RI7A 3ULQB 3MZHA 2R7VA 5GAEJ 2Z9OA 2V6CA 2XSDC 4I0AA 1XGNA 2ZC2A 2VJIA 2FX0A 2OD5A 4W97A 2C6YA 4A3BJ 5FB2A 3NARA 4YFKF 4BS9A 2XPVA 2EFQA 2FMLA 1IUFA 2DOEA 3F0CA 3RPUD 1EV7A 4ESFA 2VT2A 1XN7A 3BCAA 3JCUC 1RZ4A 4F52A 3TO6A 4L0ZB 3BZ6A 4A5NA 1FC3A 4E70A 1VNDA 3RZDJ 2Y9ZA 3HOUJ 3O8HA 2A69F 2VQLA 3SDGA 1WH7A 5ERIA 1F5TA 5BS6A 1IRXA 2H09A 3RDIA 5D6FA 5H6QA 2DPUA 4II3A 2GWRA 5LEJA 4RA2A 2VOPA 2K85A 3DF8A 2R5YB 4KMUX 4XKVA 3UR3C 2UZKA 3R4KA 2JJ7A 3E5XA 2LREA 1R49A 2PMZA 3GTKJ 1PVEA 2MSYA 3QOEA 4BJ6C 5DUIA 4IO9F 1KQ8A 3FK7A 2R7TA 2I10A 3ASNH 2QZ8A 2WY8Q 4L5EA 4Q47A 1S29A 2MABA 3OIOA 3ZMDA 4JK1X 2NYXA 2L5QA 2IP2A 3ZPLA 3WTXC 3JTGA 1SFXA 3EUKL 3MZ8A 4HA8A 1TWGJ 5J40A 3W2WA 1S7AA 3H36A 4E7SA 1XCVA 1ETKA 1LUJB 1X1DA 1VQPI 4A3DJ 1O57A 1W5TA 1W0TA 5LEKA 4GDFA 2QENA 4EGYA 1MBEA 3PSIA 1SVMA 3PIPF 5BNGA 2QQBA 2XVCA 3K10A 4UUSB 4OAZA 1MNMC 4MHGA 1R9TJ 3F72A 2K86A 1BIAA 2KIFA 3S3NA 2ZMEA 1QVUA 2EA2A 2PEXA 3HOTA 4EV0A 2WY7Q 2DXIA 4Z6YA 1HKSA 1I27A 3HRTA 2M8GX 4ZTFA 4BDYA 1K61A 3FMSA 3DBRB 2JA2A 5F64A 5D5VB 3BTCA 2BV6A 1TQMA 4E6KG 3IHUA 1LFUP 1I39A 2F5DA 1JTYA 2XSJC 3CTAA 1ETYA 1KGSA 1MBJA 1X3ZB 3CCSI 2NAZA 1RIOH 1X3WB 5F1RA 2NVYJ 4O3MA 1WQ2A 1OFCX 2WV0A 3H0GJ 2CGPA 2TRTA 3ISPA 2HI3A 5L3FA 3H5RA 4YEJA 5F0FA 1GLNA 2F6CA 4HF2A 3HOZJ 3DPTA 2XKOA 4XMYA 3VSLA 1MMDA 3FIWA 5J4VA 4MQ9F 5C4JJ 2NRAC 2KFDA 2KDOA 1S8NA 3KP3A 4IHVA 3WE2A 4GGGA 2DOFA 5K7FA 2ME6A 1U0JA 4C2UA 3DEWA 5IT9K 1IZ1A 1XC5A 1VTNC 1QQIA 3KX2A 1DU0A 4FT8A 2M0MA 2KJCA 2AXTC 1SFUA 1R1TA 4G8XA 5IP7J 2ZJQF 4U88A 3FXOA 3H0DA 2L4MA 4ESJA 2D1VA 3E1SA 3RSNA 2PBIA 2CV2A 1QZEA 2ID3A 3GTPJ 1VF9A 4KA4A 3TP3A 3OYJA 2W00A 2JSPA 3CUQC 3RIRA 4MLOA 1LPQA 2R7RA 1WI9A 4A3CJ 1P4WA 2K3PA 2CYYA 3E5QA 4KN7X 1XPXA 1IO2A 4P96A 4UUVA 4M3FA 2NVUB 4XRSG 4ASNA 5E3OA 5K5OA 4IKFA 5DCMA 5HLTA 3GO5A 2X6XA 9ANTA 2WAFA 4B48A 1PYVA 2QSGX 2PFBA 4KDPA 4PJ0C 2LNBA 2K27A 2DJIA 2QKLB 3QU3A 1EH6A 1WRJA 3QRFF 1J9IA 2V9KA 3TMOA 2L9SA 1LVKA 4OAYA 1RETA 4Q5SF 1UZCA 5M5WJ 1FOYA 1YHQI 4AIJA 3ZMZA 2EZIA 2QQ9A 3L2RA 2DA3A 4ESBA 4UHTA 2L7MP 2FEZA 4RLQA 2VQGA 4KIGA 2R7QA 3KZZA 1PUFB 1ZN2A 2Q0OA 4BHCA 2X6WA 4BGDA 4XLHA 4M9SA 1NG6A 3HJEA 2LMDA 1VZ0A 1JJ6C 5FLXK 2CQXA 3GYHX 2VB6A 4EM2A 3B6CA 1X1BA 1YX3A 3LQQA 4KFCA 4ON0A 1D5VA 3LQRA 3SQNA 2P5VA 1SFKA 3M8EA 4BL0B 3JAMZ 2L0KA 2OTLI 1OJLA 1LFBA 2CS3A 1W7PB 2JVGA 3K4BA 2KISA 2GA1A 4D1QA 1QVTA 2DO7A 4IPAA 2IA1A 4EM1A 1HF0A 3I5UA 2LTPA 2L9VA 2FRHA 4G6QA 1SD7A 2RNJA 3S14J 3HG9A 3I58A 5CPRB 3CCUI 1CGPA 2XB0X 1IXRC 3OIPA 5DCFA 4CH7A 5JI6A 5IYCJ 3OY9A 1U8BA 1YS7A 5B66C 1D0YA 2HYGD 2E1MC 3PUBA 3H5AA 4A69C 2EIKH 3LA7A 3PIOF 4RGUA 4DJAA 4B3XA 1EJ9A 1TNSA 2CW0F 3FXRA 4C3HJ 1AU7A 2PJRA 1HDDC 3P9CA 1E0EA 2E2HJ 4UUTA 3QAHA 4CCJA 3NWTA 2PX9A 3HUGB 3M3YJ 2UWMA 3I4PA 2ECBA 1XG1A 3GUDA 2UXNA 4WX9A 3HSFA 3SDBA 3LAPA 3O3KA 5M3FJ 2DA2A 1BA5A 1O7LA 1D1AA 3FHNA 4F91B 3IAM2 1WI3A 4IHXA 1Z6RA 4BAYA 2JT1A 4MO7A 2K40A 2G9WA 3SEZA 3EDPA 3V42A 2ZB9A 1BI3A 3OYDA 5JLWA 4U0YA 4HOBA 1Z0XA 4AM3A 2E60A 2DLLA 4HQMA 1W7PA 2L4AA 3A1YA 5CVUA 2HKOA 4CCOA 1AOYA 3KP2A 3LSKA 5IP6A 1VQ8I 2M87A 1D1CA 4FE4A 1HA8A 4LB5A 1DGRM 1ZG3A 2VBZA 3KCCA 4AU7A 1S9HA 3HKZA 5D4RA 2HDDA 1R4MB 2E7WA 3OR2C 4AYBN 2E5NA 1NG7A 3NQOA 4ZZDA 1BOAA 2ZJPF 1VQMI 3ZQGA 4J00A 4BQOA 4FQGA 2IRFG 3H3ZA 4HEA2 2EA4A 3FDYA 3WHBA 2O9LA 2Z2SB 1FIAA 4FX0A 5KVRA 1GV5A 2XV4S 4OIRF 3G71I 2QM3A 2WAQN 3BTLA 2DMUA 2HXIA 4YRVA 2VC1A 4CXFA 3KFWX 2CSOA 1MSEC 4WXDA 2OAZA 4V2GA 2MG4A 3GW2A 1X1AA 3E6DA 5CVIA 5EJCA 2EILH 5HVQC 1UFMA 4C3JJ 4M3BA 3OYAA 4BH9A 2A6EF 3C7JA 1OCTC 2MH9A 4I99C 1K83J 2F2EA 3IKTA 2KRHA 3RPQA 3D0SA 2XGCA 5EDNA 4S0HB 4BHBA 4B09A 1R71A 4XNFA 2JUGA 4RGXA 4UVAA 5BOXA 4MQVA 2MYSA 1G3SA 1GDTA 4LLLA 3C3WA 3DEEA 2LLKA 1HW2A 1S3JA 3TBIA 2DMPA 1VQ6I 3I9V2 1KQ0A 2IBDA 1W5CC 3ZQFA 1JJ8C 2GZWA 2KMUA 1D0XA 2BE5F 4RBOA 4HDVA 2PJRB 3C2HA 2VJ5A 3T5XA 1UHWA 2EJRA 4UVBA 4F92B 2TDXA 2NS8A 2JA5J 4HZFA 1OPCA 4N9IA 1GHCA 5JFRA 3S2DJ 5CQGA 4OMZA 5D5UB 1Z67A 1I3QJ 4PDKA 2O61A 1F36A 2CV1A 3ESWB 2R7UA 2IGKA 3VSKA 4A0YA 1S7OA 3KZIC 4ETSA 1AWCA 1WJBA 1YJWI 1UAAA 3I53A 1POGA 3BR3A 4CZZA 4U7BA 1MBKA 1ZH5A 1ULYA 4Y33A 3MN2A 3WE3A 5BMZA 5CVVA 5TJJA 4HRIA 5GPCA 2EV5A 4I0BA 1R00A 2WAEA 1UJ8A 1XGMA 2JMWA 3LFUA 3ROUA 3UNGC 3WG9A 4AC0A 2Y75A 3OYFA 2R5ZB 4EJTA 2Z1DA 1RR8C 2ZSHB 4XOTA 2H8WA 4YG2F 4ZZLA 2AO9A 4JYKA 3PNVA 3L09A 2LY1A 2DYSH 5DD8A 4LD5A 2M7BA 5E20A 2EFNA 5F27A 2F5EA 5FKOA 3L00A 2ACJA 2IT0A 3HKZN 1SEUA 2P5KA 1HC8A 2DAOA 3DTEA 3ERMA 1ENHA 1GXQA 3ZMVA 1Z05A 1DPUA 1KQ9A 4AVPA 3BLYA 1ETWA 3PO3J 4WK8F 4O6JA 1OKRA 4L5IA 3BZKA 3H3UA 3A0HC 4A12A 3PFYA 3P5JA 1G6NA 2DT5A 3MQ0A 3ABKH 1GUUA 4NC6A 3QYFA 1FNNA 3BOQA 3A0BC 4U0WA 1KYWA 3HOVJ 2CQ7A 4A6DA 4DYRA 4IQ4A 2KL4A 4I98B 2PG4A 5IP9J 3SZPA 2XAHA 3AG4H 3GZNB 3ZQIA 2V1UA 4HLYA 1FLIA 4PJLA 4KICA 1E3HA 1FZPB 2DA4A 1MJ9A 3LNQA 3DBLB 2YS9A 1GVJA 2FD5A 4XBFA 1JTXA 5HNHA 4BNCA 2D1HA 3RI4A 5IT3A 2BW3B 2W24A 4UVCA 1I1GA 3PQKA 2ISYA 1D1BA 3F6VA 3HRSA 4A2UA 4WXCA 4PJJA 4AYBA 3ABMH 1X2NA 2H6CA 4XK4A 2L9RA 3CZ6A 2CQNA 5L3BA 1GXPA 5HLGA 4XSXF 2JZYA 1JT0A 1Z6TA 3DU6A 2B7EA 4B1RA 3U2RA 4IRIA 1SD5A 3F8FA 3S8PA 2ELJA 2VL8A 3FHZA 3CCEI 1KU2A 2IGNA 4C9YA 1JI8A 3IWFA 3ECOA 2A3SA 2P8TA 2W4SA 1FYLA 4C2MJ 1ERDA 4ZTJA 1AHDP 5LHGA 1J0RA 2D2WA 2HEOA 1Z3XA 3SJMA 3OSFA 1Z21A 1LDKB 3F9KA 3OOPA 1K79A 4D5FA 1IDZA 1LKXA 3W6VA 4KISA 3IRRA 1FEXA 4F3QA 2F5VA 5HS7A 2D45A 1EKEA 4PJNA 1WFXA 2E1OA 1OLTA 2GXAA 4LIUA 3RYRA 3H9GA 3OL3A 3A2KA 1I5ZA 1XMAA 3OYIA 2IW5A 2LRDA 2QSHX 1YOVB 1SMTA 2K9SA 2BY2A 4ZH4F 3H9JA 1IN5A 1WWXA 4J01A 2H8RA 1BW5A 1OYIA 2X85A 5E79C 4JX5A 2VKVA 2XAFA 4PCQA 3RKYA 3I64A 2HQ5A 1Y8QB 3GLXA 3TOAA 1QO0D 3FXUA 5D4SA 1YO5C 1W36D 4IX7A 3HL2A 2XASA 4L9TA 2KJBA 3OYHA 4MEYF 4RDUA 1JUPA 2GLOA 3EYIA 3S2WA 4P9FA 2EWNA 3GBGA 4K2EA 4RB3C 4II2A 1N77A 2DPDA 5CQEA 2IXSA 3VYUB 4NC8A 3RTRA 4DZJA 2K9QA 1OYYA 5C4XJ 5B1AH 3DLAA 1FBUA 5IPAA 2G0EA 4EATA 1QPIA 2A6HF 2KQRA 2P6SA 2ADUA 2VQHA 3ZQCA 2EBIA 2HOSA 2EK5A 4BQQA 3KP5A 2GOMA 2E2JJ 2VKEA 3BC8A 2EV0A 3I56I 3IH2A 4QIWN 2X9DA 3L2QA 2OBPA 2BW3A 3QWLA 4IEJA 1R7JA 1BOBA 1E17A 3M07A 3FBIB 2HKXA 3K2AA 4WXHA 2QQ8A 1TL8A 5E3NA 2MA3A 3RKQA 4NQWA 2EZHA 2P7CB 2LBFB 1ITYA 1XMKA 4RS8A 2KDZA 1IN7A 3JRDA 2NOJB 3GXOA 4LB6B 3CCVI 3HHGA 2K4BA 5IYDJ 1WCMJ 1Z91A 2K9MA 5E1WA 5ILSA 1VQNI 2VT3A 4GRIA 1L3LA 4Y17A 1VQ5I 1MH4A 4KYWA 2VE8A 3MMYB 2HGCA 3EETA 5DV5A 2Z16A 4HF0A 2R7SA 3ZN0A 2GIZA 3SYTA 3CF2A 3BJAA 1EH8A 1JUMA 1TLHB 3ZQHA 3I59B 4FCYA 2CO5A 4M73A 3ECHA 2DFEA 4PGHA 3QU6A 1D0ZA 2HFHA 4AIHA 3OYMA 3CMMA 3WTSC 3HBLA 2LF8A 3FF5A 3CCJI 3GFMA 5LHIA 2LKSA 4EGZA 2CW8A 1G3YA 1LFPA 4XIDA 1R58A 4AWXB 4ENNA 3FM3A 3OYBA 2VONA 4EEFG 2RNGA 2EIJH 3GFJA 1F43A 3BQYA 1K78B 2V9PA 2HVRA 2XGXA 2STWA 2IS4A 2ID6A 4EJWA 2FBIA 2WB1A 1SANA 2X51A 3WTVC 4V2FA 1L0OC 1WJCA 1FMWA 4LIVA 2PLYA 2AQFA 1C0WA 5K1YA 4FHTA 2V1XA 2GXBA 1IN8A 2VUMJ 1LEAA 4E7LA 3G73A 2VXZA 1XDSA 3L7WA 1MZBA 2NOGA 1TWHJ 2EIMH 2XF5A 2RQQA 2J5PA 5CJ9A 3GTOJ 3V7CA 2QQAA 2OQGA 3AAFA 1WVRA 2R7FA 4MFDA 3U21A 1LDJA 1HSTA 2K7LA 4NBQA 2IGMA 3I54A 4IZZA 4BEHB 4WF2A 3KLOA 1B1BA 3U1KA 4YIRX 3CJRB 3H35A 1BC7C 4AVZA 1BJAA 1VFCA 1GVDA 3HSEA 3PM1A 2DDBA 1UG2A 1XGSA 1RRJA 2ZXIA 4XN3A 2QA4I 4I02A 4TV7A 4BYYA 1JUSA 4P9UA 1ZGAA 3ZMTA 3CO6C 3DEUA 2HOEA 4C3IJ 2CUJA 2EV6A 4DBQA 2L3DA 3R61A 4U7DA 2W25A 3SHFA 5CVJA 3J81Z 2H6BA 4CSWA 3CUOA 3S1MJ 1LB2A 3K4MA 5FLVA 4MIMA 5LGUA 2Q8KA 1Y39A 3E0JB 2E5ZA 2A6TA 1JKOC 3FXQA 2FF4A 4X6AJ 2JRMA 2PQ8A 1MMAA 3GLLA 4MGRA 3EPZA 4X1EA 1Y1VJ 3BG3A 2RDPA 1B8IB 1OCZH 3F3XA 2FBKA 1XMXA 3WU0A 1Y56A 1Z3YA 3A03A 2KIUA 5H6RA 1T95A 2F4MB 1CF7A 2JN6A 4C2TA 4RGRA 3DTIA 1PUFA 2H27A 2L7FP 1ZRCA 1QBJA 2O0YA 3HHHA 4YELA 2E36A 1XX5A 2NNNA 1ETVA 1FOKA 4IHWA 3Q0VA 2GA2A 3VPRA 2DA1A 2E7XA 3G3ZA 5GAHJ 2HS5A 1A5JA 3W3CA 2NVQJ 1T8IA 4H4KC 5IYBJ 2YX4A 4HLXA 4XN0A 3GTLJ 2BVMA 4KIBA 5LRRA 3OYEA 4CYDA 1JKPC 1MJAA 1V5EA 1G59A 3VWBA 4IQJA 5DEQA 2RKHA 5F1JA 1BI1A 3LSHA 2HZDA 1XDUA 2R7DA 2LY2A 1O3TA 2HPIA 2MGQA 3VFZA 1I3AA 4N0BA 2MLKA 1UCRA 1IN4A 1S72I 3SXYA 5CVRA 4XSZF 3AL0C 2KT0A 1FTZA 3E6BA 1YI2I 1IV8A 3G1LA 3J7AY 3Q9SA 3S2HJ 3ASOH 1SVOA 3V4GA 2ZFWA 5AONA 3TKYA 2TCTA 2XB5A 1DGWY 4L18B 2XAGA 5F0HA 4M74A 4JP0A 1MNEA 1ONVA 5HS8A 3ZR8X 3RCOA 1P7IA 1X58A 5FFZA 1BR1A 3M8JA 2M4GA 4BBRJ 1KU3A 1JE8A 2IPQX 2D5VA 5F0CA 3OR1C 3COAC 1PJRA 1U5TA 1RC9A 3LL7A 1MSFC 1SFEA 5FD6A 4A3JJ 1ACIA 2HTSA 2DT7B 3WGIA 2ZXHA 4CZCA 1I50J 2KKOA 3DXJF 2XC7A 4IOCF 2VPRA 3LSRA 1Z77A 3ML6A 1U9OA 1QGPA 3S32A 5C44J 1HQCA 2IS6A 4HG2A 1R1VA 3HOXJ 3OSGA 2XRLA 2M7AA 3K70C 1KU7A 4AUXA 1MDMB 2XKPA 5EEGA 3ZGKA 3KLNA 4EM0B 2O6GE 1H0MA 4IHYA 5EYRA 1BJZA 3RJPA 2BYVE 2DJNA 2Z99A 3M4OJ 1K6OA 2A61A 3C2GA 5E17F 2VBYA 4S05A 4JQFA 1ZG5A 3F21A 2W7NA 3DU5A 5E1ZB 4M3DA 1VQ4I 4E7KA 1W7PD 3A4CA 3CUQA 4A3MJ 4A93J 4L0YB 5H2FC 3KE2A 4ENKA 2A5WA 5F04A 1BW6A 1N78A 2V79A 2Q2EB 4KMFA 1LE8A 2FQ3A 3MEXA 3NWSA 2DMTA 3KP4A 3J7YJ 3F6OA 4G6TB 1IUYA 1FP2A 1USSA 3J81K 2BOLA 5DUKA 5D5XB 4B43A 4RM3A 3LFKA 3LMMA 3LSJA 5J3LA 1J5YA 5L3DA 1BIBA 3L2WA 3BDDA 1A6IA 2VJJA 4ZYEA 2Y48A 3KYLA 4HNTA 2VASA 2DQRA 2YPRA 2ECCA 5ICGA 2LH9A 5AIPA 4PJMA 4AIKA 4XOPA 1DPRA 1IXCA 2M30A 3L2VA 4I6ZA 4O5VA 5LBQA 4LITA 3LSGA 2P7VB 2FUG2 2HDWA 3B6AA 1T38A 2AHQA 4CCNA 4BACA 4P1WA 2GXGA 3FXLA 2QBYA 4M9XA 2O3FA 1TBXA 4Y3OA 5FGMA 3WGGA 4B4CA 1EA3A 1Y8RB 2JVHA 3W6JB 2LYCA 4AIDA 1KU9A 4CGZA 1AKHA 1P9QC 3OYGA 1R4NB 1G4DA 2W48A 3ZP5A 4V19K 3FXMA 3BG9A 4AD9A 2OA4A 3CDIA 1XB4A 4DW6A 3HZJA 1STZA 3BG6A 2HVQA 3CP8A 3LA2A 3S16J 2W85A 3P7NA 1T2KA 1ON2A 2X48A 3IH4A 4HBLA 3ZMUA 2XGDA 3H1CA 4LLNA 1TWFJ 5FKNA 2YX7A 2DK8A 3EUHA 2M0CA 5TGTA 4CCKA 3HB9A 2R93J 4FE7A 2OUMA 1UMQA 4HX4A 2DI3A 3N97A 4E7IA 3OIQA 5B5EC 1UELB 2ESHA 2XUBA 3BY6A 3HGGA 4B8XA 1P4AA 2DBBA 1LEBA 3CJTB 3WTWC 2AS5F 2KRCA 1H9TA 2BXZA 1IXSB 1JKQC 3BT9A 2M45A 2OZUA 2KLOA 3HPHA 2JTVA 3CESA 3WGHA 5K5RA 1E3OC 3JTHA 3J7AO 4G7OF 1WJFA 3PUFA 4PFPA 3LSMA 2FOWA 2COMA 1XTAA 3VEPA 4FASD 4RAZA 3HRMA 3HM5A 2K9LA 1ETQA 4OINF 2STTA 5J6XA 4Z2YA 3B02A 2DQLA 1FTTA 2QBYB 4EJVA 1ZREA 4RAYA 2E1NA 2HYFA 4FETA 5M5YJ 1FPQA 3HXLA 2HXOA 3TW7A 5DCMB 2W1OA 4BDZA 1T98A 2OTJI 5TISC 1SD6A 2DOAA 1ORKA 5EF6A 2HOAA 2FNPA 3CO7C 1TTYA 2RREA 4MFEA 1YLFA 2MH2A 5KCMA 2R7XA 1FSHA 1P92A 5FRNA 1CQTA 3MFKA 4L9VA 2Z5UA 5HDKA 3FISA 4UB8C 4XLEA 1TNTA 3ZN1A 1U78A 4QPQA 4HNUA 1YS6A 1NK2P 3DV8A 4LMYA 5DDGA 1R6RA 1OQYA 2HU9A 2V4JC 1P7JA 1BBYA 1QZZA 1UG0A 3K7AJ 4XKBA 1HCRA 3P9IA 1FSEA 1HBXG 3PFIA 1WH5A 4IXAA 2DCEA 1OYWA 3KEOA 3LSIA 3PQJA 4RM2A 1FX7A 1ZGWA 4M6YA
chains in the Genus database with same CATH topology
2G0EA 1QPIA 5EGOA 1JGGA 2HOSA 2NVYJ 2EBIA 2LKXA 3ZQCA 1OFCX 1RKTA 3H0GJ 3HOYJ 2E2JJ 2TRTA 1X2MA 2HI3A 2VKEA 5F0FA 3IH2A 4QIWN 2X9DA 3HOZJ 2EH3A 4IEJA 3IV5A 3FIWA 1T56A 5C4JJ 2NVXJ 3K2AA 2M34A 1G2HA 4IHVA 5E3NA 3RKQA 3LSPA 5K7FA 2EZHA 2ME6A 5M3MJ 1ITYA 3DEWA 2KDZA 4CYCB 1XC5A 1Q1VA 4XRMA 3OOUA 3JRDA 1DU0A 3S1NJ 5EEAA 2EZLA 2CUFA 1ZK8A 5IYDJ 1WCMJ 5FKKA 1WPKA 5IP7J 1MH4A 4QSHA 3BR2A 4J19A 1ZTRA 4GFBA 4D5CA 2ID3A 3GTPJ 1VF9A 4M6VA 4ABZA 1TWCJ 3TP3A 1JUMA 2DTZA 3ZQHA 1MH3A 4MLOA 4FCYA 3S15J 3I4NJ 4A3CJ 2FQ4A 1B72A 4M3FA 4XRSG 5E3OA 3HBLA 2E19A 2JWTA 2OPTA 2GM4A 3GTJJ 4A3IJ 9ANTA 4DYQA 4G12A 4XIDA 2DMNA 3E7LA 4EEFG 3MVPA 3JRFA 3UKGA 1F43A 3BQYA 3WHCA 1I6HJ 2ID6A 2LR8A 2P81A 3Q0UA 5IOYA 1XS9A 1RETA 1SANA 4M3EA 5M5WJ 4V2FA 3L1PA 2CU7A 2EZIA 1B8IA 2DA3A 1MBHA 2B63J 2VUMJ 2L7MP 4FISA 4NDLA 2NOGA 1TWHJ 3FK6A 4DZPA 4HNVA 1PUFB 3GTOJ 2XGEA 1JJ6C 5IOZA 5K7ZA 5FKLA 2CQXA 4MFDA 2JK3A 3B6CA 5J1RA 1DU6A 1ETXA 1ETOA 1W0UA 4JX4A 4BBSJ 2L0KA 1OJLA 1VFCA 1GVDA 2HYJA 1LFBA 4BXXJ 4A3KJ 1OCPA 3PM1A 1QVTA 1UG2A 2RAEA 1IV6A 2Y31A 1HF0A 1JUSA 2LTPA 1HOMA 1ZKGA 3S14J 4C3IJ 2XB0X 1U8BA 2PMZN 5IYCJ 2YU9J 4A69C 3S1MJ 2DA7A 5E3LA 5FLVA 4MIMA 4M3GA 3G1OA 1JKOC 4X6AJ 2QF7A 4A3GJ 1AU7A 2Y30A 4C3HJ 1HDDC 4X1EA 1Y1VJ 3BG3A 4UUTA 4A3FJ 1B8IB 2LP0A 2E2HJ 3M3YJ 5DS9A 1QRYA 2XPWA 3A03A 2ECBA 1XG1A 2JN6A 4DYCA 5M3FJ 1PUFA 2DA2A 1BA5A 1B72B 2L7FP 4XRSA 1O4XA 1IDYA 5EZGA 1WI3A 3BG5A 4D7NA 4IHXA 4BY7J 1IRZA 1ETVA 1TWAJ 4IHWA 3Q0VA 3BR1A 2EQRA 4MO7A 3TEDA 2VI6A 3VPRA 2K40A 5DTDA 2DA1A 2ZB9A 5JLWA 4I76A 3JRGA 1Z0XA 2NVQJ 1A5JA 4BKXA 5IYBJ 2JA8J 3GTLJ 3A01B 2R5ZA 1JKPC 5IP6A 2ME0A 2N8GA 2X6OA 4FE4A 5F1JA 3H3VK 2OF7A 2HDDA 2MGQA 3QPSA 4AYBN 1NTCA 1IG7A 2R92J 3ZQGA 2O9LA 3WHBA 1FIAA 2KT0A 1FTZA 1U9NA 1TC3C 1T33A 1GV5A 2CJJA 2WAQN 3JREA 3G1LA 3BR0A 2HOTA 3S2HJ 3BTLA 2DMUA 2HXIA 2TCTA 1MSEC 2XB5A 3JRAA 2K9NA 2YUSA 4V2GA 5F0HA 2MG4A 3HGYA 4JP0A 5GPAA 4W1UA 3HOWJ 5HODA 4XICA 4C3JJ 4M3BA 1LE8B 1P7IA 1OCTC 1X58A 5M5XJ 1K83J 3QQAA 5JLXA 1S7EA 4BBRJ 3CDLA 1UHSA 2XGCA 5EDNA 2D5VA 5F0CA 4S0HB 3JRIA 1FIPA 1MSFC 4A3JJ 4JX6A 3JRBA 2O8KA 1VI0A 1GDTA 1MBFA 1I50J 3BQZA 2ELKA 2M2EA 2LLKA 2VPRA 3LSRA 1Z77A 1ZQ3P 1U9OA 2DMPA 5C44J 1FJLA 2IBDA 2XPUA 3HOXJ 2R0QC 2Y0SN 3ZQFA 3OSGA 1JJ8C 2XRLA 3LOCA 4AUXA 4RBOA 2CQQA 2FJ1A 5J1UA 2DMQA 2DN0A 2NS8A 2JA5J 3BTJA 2E2IJ 3TW6A 4IHYA 1RPWA 5EYRA 1BJZA 4A3EJ 3S2DJ 2DJNA 3M4OJ 1I3QJ 1F36A 4Y7NJ 4BY1J 2LFBA 1GT0C 4M3DA 1HDPA 1POGA 3BR3A 1JT6A 2WV1A 2R7ZJ 3ZQLA 5EG0B 1MBKA 1ZR2A 4A3MJ 4A93J 1BL0A 3MN2A 3TP0A 4QTRA 2R5YA 1YRNB 4Y52J 3ZOBA 5F04A 1BW6A 2L7ZA 2M9HA 3IH3A 5GPCA 2H1KA 3BTIA 1Y1WJ 2JMWA 1LE8A 4AC0A 3A01A 2R5ZB 3CMYA 2DMTA 3RQIA 1IC8A 2COBA 4LOCA 3BR5A 2Y9YA 2LVSA 5J3LA 2AO9A 3LSJA 4JYKA 2GBYA 3NAUA 5FJ8J 5E3MA 2EZKA 5FKMA 1A6IA 5F27A 3QPLA 5FKOA 1EF4A 3HKZN 2CRGA 3G1MA 1D5YA 2ECCA 1ENHA 1WGXA 2NVTJ 4D7MA 2LY9A 1ETWA 3PO3J 3CQZJ 4I6ZA 4UUSA 3LSGA 3B6AA 3HEFA 3MKLA 2AHQA 3JRHA 5EZHA 1RESA 3I4MJ 5K7HA 1GUUA 3S17J 3FKIJ 2IEKA 1RKWA 1ZGWA 4B4CA 3HOVJ 4DYRA 2JA7J 5EG0A 3GTQJ 1AKHA 5IP9J 3D1NI 1ZR4A 3ZQIA 2W48A 1HLVA 3BG9A 3BR6A 4DW6A 2QCOA 5EGOB 3S16J 2DA4A 2X48A 3IH4A 3LNQA 1SFOJ 2YS9A 1IJWC 2FD5A 2XGDA 3S1QJ 1JTXA 5FLMJ 1TWFJ 5FKNA 1GV2A 2XSDC 3GTGJ 2FX0A 2M0CA 4B3AA 3HB9A 4W97A 2R93J 4A3BJ 4FE7A 1UMQA 3NARA 2MW8A 5J1YA 2XPVA 1IUFA 3F0CA 1X2NA 4XK4A 2L9RA 3Q3SA 3HGGA 1H89C 1H88C 4CYCA 1JT0A 3RZDJ 2Y9ZA 1VNDA 3C2BA 4B1RA 3HOUJ 3O8HA 1APLC 1RR7A 3SDGA 1WH7A 1JKQC 3BT9A 3JR9A 2LK2A 4FTHA 4C2MJ 1E3OC 1AHDP 2R5YB 5C3EJ 1YRNA 2JA6J 3SJMA 1NK3P 3PO2J 3OSFA 2JJ7A 3CCYA 3HM5A 1IDZA 4D5FA 1ETQA 3W6VA 3GTKJ 2O7OA 1FTTA 2MSYA 1FEXA 3FK7A 2I10A 5M5YJ 2E1OA 3JRCA 4L5EA 2HXOA 1AKHB 3TW7A 3OIOA 1JKRC 1ORKA 5EF6A 2HOAA 4MFEA 3HDDA 2CUEA 2WB1N 5GP9A 1TWGJ 1CQTA 2K9SA 3O8GA 1ETKA 3FISA 4A3DJ 1W0TA 2H8RA 1BW5A 2IAIA 1U78A 1MBEA 3RZOJ 3Q0WA 2VKVA 4JX5A 5BNGA 5F08A 1NK2P 4UUSB 1MNMC 2HQ5A 1R9TJ 1P7JA 1MBGA 2DA5A 2NS7A 1QVUA 3K7AJ 1HCRA 3SFIA 4RDUA 4A3LJ 1JUPA 1WH5A 2M8GX 2GLOA 3DCFA 2Y2ZA 2DA6A 3GBGA 1K61A 1IGNA 2LD5A 3BTCA 3S1RJ 3GTMJ 1LFUP 4DZJA 2K9QA 1JTYA 3A02A 5C4XJ 1ETYA 1H8AC 5IPAA 1MBJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G0E A;  1QPI A;  5EGO A;  1JGG A;  2HOS A;  2NVY J;  2EBI A;  2LKX A;  3ZQC A;  1OFC X;  1RKT A;  3H0G J;  3HOY J;  2E2J J;  2TRT A;  1X2M A;  2HI3 A;  2VKE A;  5F0F A;  3IH2 A;  4QIW N;  2X9D A;  3HOZ J;  2EH3 A;  4IEJ A;  3IV5 A;  3FIW A;  1T56 A;  5C4J J;  2NVX J;  3K2A A;  2M34 A;  1G2H A;  4IHV A;  5E3N A;  3RKQ A;  3LSP A;  5K7F A;  2EZH A;  2ME6 A;  5M3M J;  1ITY A;  3DEW A;  2KDZ A;  4CYC B;  1XC5 A;  1Q1V A;  4XRM A;  3OOU A;  3JRD A;  1DU0 A;  3S1N J;  5EEA A;  2EZL A;  2CUF A;  1ZK8 A;  5IYD J;  1WCM J;  5FKK A;  1WPK A;  5IP7 J;  1MH4 A;  4QSH A;  3BR2 A;  4J19 A;  1ZTR A;  4GFB A;  4D5C A;  2ID3 A;  3GTP J;  1VF9 A;  4M6V A;  4ABZ A;  1TWC J;  3TP3 A;  1JUM A;  2DTZ A;  3ZQH A;  1MH3 A;  4MLO A;  4FCY A;  3S15 J;  3I4N J;  4A3C J;  2FQ4 A;  1B72 A;  4M3F A;  4XRS G;  5E3O A;  3HBL A;  2E19 A;  2JWT A;  2OPT A;  2GM4 A;  3GTJ J;  4A3I J;  9ANT A;  4DYQ A;  4G12 A;  4XID A;  2DMN A;  3E7L A;  4EEF G;  3MVP A;  3JRF A;  3UKG A;  1F43 A;  3BQY A;  3WHC A;  1I6H J;  2ID6 A;  2LR8 A;  2P81 A;  3Q0U A;  5IOY A;  1XS9 A;  1RET A;  1SAN A;  4M3E A;  5M5W J;  4V2F A;  3L1P A;  2CU7 A;  2EZI A;  1B8I A;  2DA3 A;  1MBH A;  2B63 J;  2VUM J;  2L7M P;  4FIS A;  4NDL A;  2NOG A;  1TWH J;  3FK6 A;  4DZP A;  4HNV A;  1PUF B;  3GTO J;  2XGE A;  1JJ6 C;  5IOZ A;  5K7Z A;  5FKL A;  2CQX A;  4MFD A;  2JK3 A;  3B6C A;  5J1R A;  1DU6 A;  1ETX A;  1ETO A;  1W0U A;  4JX4 A;  4BBS J;  2L0K A;  1OJL A;  1VFC A;  1GVD A;  2HYJ A;  1LFB A;  4BXX J;  4A3K J;  1OCP A;  3PM1 A;  1QVT A;  1UG2 A;  2RAE A;  1IV6 A;  2Y31 A;  1HF0 A;  1JUS A;  2LTP A;  1HOM A;  1ZKG A;  3S14 J;  4C3I J;  2XB0 X;  1U8B A;  2PMZ N;  5IYC J;  2YU9 J;  4A69 C;  3S1M J;  2DA7 A;  5E3L A;  5FLV A;  4MIM A;  4M3G A;  3G1O A;  1JKO C;  4X6A J;  2QF7 A;  4A3G J;  1AU7 A;  2Y30 A;  4C3H J;  1HDD C;  4X1E A;  1Y1V J;  3BG3 A;  4UUT A;  4A3F J;  1B8I B;  2LP0 A;  2E2H J;  3M3Y J;  5DS9 A;  1QRY A;  2XPW A;  3A03 A;  2ECB A;  1XG1 A;  2JN6 A;  4DYC A;  5M3F J;  1PUF A;  2DA2 A;  1BA5 A;  1B72 B;  2L7F P;  4XRS A;  1O4X A;  1IDY A;  5EZG A;  1WI3 A;  3BG5 A;  4D7N A;  4IHX A;  4BY7 J;  1IRZ A;  1ETV A;  1TWA J;  4IHW A;  3Q0V A;  3BR1 A;  2EQR A;  4MO7 A;  3TED A;  2VI6 A;  3VPR A;  2K40 A;  5DTD A;  2DA1 A;  2ZB9 A;  5JLW A;  4I76 A;  3JRG A;  1Z0X A;  2NVQ J;  1A5J A;  4BKX A;  5IYB J;  2JA8 J;  3GTL J;  3A01 B;  2R5Z A;  1JKP C;  5IP6 A;  2ME0 A;  2N8G A;  2X6O A;  4FE4 A;  5F1J A;  3H3V K;  2OF7 A;  2HDD A;  2MGQ A;  3QPS A;  4AYB N;  1NTC A;  1IG7 A;  2R92 J;  3ZQG A;  2O9L A;  3WHB A;  1FIA A;  2KT0 A;  1FTZ A;  1U9N A;  1TC3 C;  1T33 A;  1GV5 A;  2CJJ A;  2WAQ N;  3JRE A;  3G1L A;  3BR0 A;  2HOT A;  3S2H J;  3BTL A;  2DMU A;  2HXI A;  2TCT A;  1MSE C;  2XB5 A;  3JRA A;  2K9N A;  2YUS A;  4V2G A;  5F0H A;  2MG4 A;  3HGY A;  4JP0 A;  5GPA A;  4W1U A;  3HOW J;  5HOD A;  4XIC A;  4C3J J;  4M3B A;  1LE8 B;  1P7I A;  1OCT C;  1X58 A;  5M5X J;  1K83 J;  3QQA A;  5JLX A;  1S7E A;  4BBR J;  3CDL A;  1UHS A;  2XGC A;  5EDN A;  2D5V A;  5F0C A;  4S0H B;  3JRI A;  1FIP A;  1MSF C;  4A3J J;  4JX6 A;  3JRB A;  2O8K A;  1VI0 A;  1GDT A;  1MBF A;  1I50 J;  3BQZ A;  2ELK A;  2M2E A;  2LLK A;  2VPR A;  3LSR A;  1Z77 A;  1ZQ3 P;  1U9O A;  2DMP A;  5C44 J;  1FJL A;  2IBD A;  2XPU A;  3HOX J;  2R0Q C;  2Y0S N;  3ZQF A;  3OSG A;  1JJ8 C;  2XRL A;  3LOC A;  4AUX A;  4RBO A;  2CQQ A;  2FJ1 A;  5J1U A;  2DMQ A;  2DN0 A;  2NS8 A;  2JA5 J;  3BTJ A;  2E2I J;  3TW6 A;  4IHY A;  1RPW A;  5EYR A;  1BJZ A;  4A3E J;  3S2D J;  2DJN A;  3M4O J;  1I3Q J;  1F36 A;  4Y7N J;  4BY1 J;  2LFB A;  1GT0 C;  4M3D A;  1HDP A;  1POG A;  3BR3 A;  1JT6 A;  2WV1 A;  2R7Z J;  3ZQL A;  5EG0 B;  1MBK A;  1ZR2 A;  4A3M J;  4A93 J;  1BL0 A;  3MN2 A;  3TP0 A;  4QTR A;  2R5Y A;  1YRN B;  4Y52 J;  3ZOB A;  5F04 A;  1BW6 A;  2L7Z A;  2M9H A;  3IH3 A;  5GPC A;  2H1K A;  3BTI A;  1Y1W J;  2JMW A;  1LE8 A;  4AC0 A;  3A01 A;  2R5Z B;  3CMY A;  2DMT A;  3RQI A;  1IC8 A;  2COB A;  4LOC A;  3BR5 A;  2Y9Y A;  2LVS A;  5J3L A;  2AO9 A;  3LSJ A;  4JYK A;  2GBY A;  3NAU A;  5FJ8 J;  5E3M A;  2EZK A;  5FKM A;  1A6I A;  5F27 A;  3QPL A;  5FKO A;  1EF4 A;  3HKZ N;  2CRG A;  3G1M A;  1D5Y A;  2ECC A;  1ENH A;  1WGX A;  2NVT J;  4D7M A;  2LY9 A;  1ETW A;  3PO3 J;  3CQZ J;  4I6Z A;  4UUS A;  3LSG A;  3B6A A;  3HEF A;  3MKL A;  2AHQ A;  3JRH A;  5EZH A;  1RES A;  3I4M J;  5K7H A;  1GUU A;  3S17 J;  3FKI J;  2IEK A;  1RKW A;  1ZGW A;  4B4C A;  3HOV J;  4DYR A;  2JA7 J;  5EG0 A;  3GTQ J;  1AKH A;  5IP9 J;  3D1N I;  1ZR4 A;  3ZQI A;  2W48 A;  1HLV A;  3BG9 A;  3BR6 A;  4DW6 A;  2QCO A;  5EGO B;  3S16 J;  2DA4 A;  2X48 A;  3IH4 A;  3LNQ A;  1SFO J;  2YS9 A;  1IJW C;  2FD5 A;  2XGD A;  3S1Q J;  1JTX A;  5FLM J;  1TWF J;  5FKN A;  1GV2 A;  2XSD C;  3GTG J;  2FX0 A;  2M0C A;  4B3A A;  3HB9 A;  4W97 A;  2R93 J;  4A3B J;  4FE7 A;  1UMQ A;  3NAR A;  2MW8 A;  5J1Y A;  2XPV A;  1IUF A;  3F0C A;  1X2N A;  4XK4 A;  2L9R A;  3Q3S A;  3HGG A;  1H89 C;  1H88 C;  4CYC A;  1JT0 A;  3RZD J;  2Y9Z A;  1VND A;  3C2B A;  4B1R A;  3HOU J;  3O8H A;  1APL C;  1RR7 A;  3SDG A;  1WH7 A;  1JKQ C;  3BT9 A;  3JR9 A;  2LK2 A;  4FTH A;  4C2M J;  1E3O C;  1AHD P;  2R5Y B;  5C3E J;  1YRN A;  2JA6 J;  3SJM A;  1NK3 P;  3PO2 J;  3OSF A;  2JJ7 A;  3CCY A;  3HM5 A;  1IDZ A;  4D5F A;  1ETQ A;  3W6V A;  3GTK J;  2O7O A;  1FTT A;  2MSY A;  1FEX A;  3FK7 A;  2I10 A;  5M5Y J;  2E1O A;  3JRC A;  4L5E A;  2HXO A;  1AKH B;  3TW7 A;  3OIO A;  1JKR C;  1ORK A;  5EF6 A;  2HOA A;  4MFE A;  3HDD A;  2CUE A;  2WB1 N;  5GP9 A;  1TWG J;  1CQT A;  2K9S A;  3O8G A;  1ETK A;  3FIS A;  4A3D J;  1W0T A;  2H8R A;  1BW5 A;  2IAI A;  1U78 A;  1MBE A;  3RZO J;  3Q0W A;  2VKV A;  4JX5 A;  5BNG A;  5F08 A;  1NK2 P;  4UUS B;  1MNM C;  2HQ5 A;  1R9T J;  1P7J A;  1MBG A;  2DA5 A;  2NS7 A;  1QVU A;  3K7A J;  1HCR A;  3SFI A;  4RDU A;  4A3L J;  1JUP A;  1WH5 A;  2M8G X;  2GLO A;  3DCF A;  2Y2Z A;  2DA6 A;  3GBG A;  1K61 A;  1IGN A;  2LD5 A;  3BTC A;  3S1R J;  3GTM J;  1LFU P;  4DZJ A;  2K9Q A;  1JTY A;  3A02 A;  5C4X J;  1ETY A;  1H8A C;  5IPA A;  1MBJ A; 
#chains in the Genus database with same CATH topology
 3DLL F;  1F9N A;  5EGO A;  1JGG A;  4LG0 B;  4KT6 A;  1XSD A;  4RMN A;  4PGG A;  1PP7 U;  4UV8 A;  1QPM A;  1T08 B;  2G7U A;  2DFH A;  1ZG1 A;  2BVL A;  2PN6 A;  4ZDP A;  1TZL A;  4OMY A;  1HXD A;  3T0Y A;  3EUH C;  1T56 A;  1IAW A;  2NVX J;  4BQA A;  4E7H A;  1G2H A;  1D8J A;  3KET A;  2K02 A;  5IY5 H;  3D5S C;  2F5C A;  4LK0 F;  3GF2 A;  2NNY A;  1Q1V A;  2X4H A;  1MND A;  3OOU A;  5IT9 Z;  3S1N J;  5EEA A;  2EZL A;  2CUF A;  1M1E B;  1ZK8 A;  3K69 A;  3CCQ I;  2JQ7 A;  1WPK A;  4IHS A;  3ELK A;  4G6D A;  4QSH A;  2O8X A;  2A68 F;  4BE2 A;  2IGO A;  4NUB A;  4J19 A;  1ZTR A;  4CHU A;  3CD6 I;  4NC7 A;  1X19 A;  4M6V A;  3S3O A;  1G3T A;  4XL9 A;  4ABZ A;  2DTZ A;  1WZ2 A;  2KRF A;  3ABT A;  5CKT A;  4EVI A;  1Z9C A;  3S15 J;  2Y69 H;  3KIO A;  5A2Q Z;  4LG3 A;  4XKC A;  4CDG A;  4EJO A;  4GYG A;  4HW0 A;  1IRF A;  2FQ4 A;  4YIF A;  3CCL I;  1B72 A;  4HST A;  5ED4 A;  3S3M A;  4IF4 A;  2GM4 A;  3QOD A;  2MD5 A;  3OS0 A;  4RB0 A;  4DYQ A;  1E3P A;  4G12 A;  3K4J A;  2FSW A;  1VQ7 I;  3V8J A;  4I01 A;  2DMN A;  1KON A;  5ICC A;  2HQN A;  3CCR I;  3MVP A;  4L9N A;  3TL4 X;  3RPU A;  1KA8 A;  2LR8 A;  2P81 A;  3Q0U A;  1XS9 A;  4OIQ F;  1YW8 A;  3CP2 A;  2Z33 A;  4M3E A;  4JOM A;  1O7F A;  1ZHF A;  4ZYH A;  2CU7 A;  2LBF A;  1B8I A;  2EIN H;  1MBH A;  2KPM A;  1HW5 A;  4FIS A;  4NDL A;  4ZDL A;  3CC7 I;  1SC7 A;  2FOK A;  3G4S I;  2OJE D;  1U6G A;  2R7O A;  1P4X A;  2HZT A;  1TT0 A;  2A07 F;  5D5W B;  4XKW A;  3BZC A;  1T39 A;  4BXF A;  1R5G A;  5IOZ A;  3L2U A;  3HRU A;  2WAQ A;  2YSR A;  4XOR A;  2CUZ A;  5FKL A;  4F7Z A;  1BR4 A;  2JK3 A;  1G8X A;  3QP6 A;  3V8K A;  2B9S A;  1X1C A;  1RNL A;  4G7Z F;  2KZV A;  3E3V A;  4M72 A;  2KIM A;  4JX4 A;  2ZCW A;  4E7Z A;  3W2A A;  4BBS J;  2BHZ A;  5FFX A;  2IA0 A;  4Y13 A;  2RQP A;  2LKP A;  1AA7 A;  4CA0 A;  3M9A A;  5GAD J;  3VB2 A;  1OCP A;  1W4M A;  2WBM A;  1IV6 A;  4IVN A;  4L5J A;  2Y31 A;  3GCM A;  1HOM A;  3L9F A;  4NQW B;  2XAU A;  1WKM A;  1REP C;  5CLS A;  2R7W A;  4UY8 I;  4S04 A;  4P5O A;  2PMZ N;  2QYO A;  2WC2 A;  4QWQ A;  1QHG A;  2VBW A;  3AG1 H;  2DA7 A;  4EJU A;  1U5T C;  3FZV A;  2P4W A;  3CCM I;  2PMH A;  3EYY A;  2A05 A;  5B1B H;  3MKY B;  1R22 A;  4A3G J;  1WJA A;  2L9N A;  2Y30 A;  4A5M A;  5KK1 A;  4A3F J;  4DBR A;  1Y0N A;  2ZNZ A;  3K1N A;  2DW4 A;  5DS9 A;  5LD2 C;  2X1C A;  4R8H A;  3OWT A;  4BXU A;  2GQQ A;  2ZJR F;  5A2Q K;  3IWZ A;  1LDD A;  4DOZ A;  5LLQ A;  1X4P A;  2IVM A;  1B72 B;  3OYC A;  2LC2 A;  4XRS A;  3KP6 A;  1B4A A;  3N4M A;  3CDH A;  1IRZ A;  2OV7 A;  2EQR A;  1O3R A;  4M71 A;  3TED A;  2VI6 A;  3HTS B;  2ICW G;  2FNA A;  4BU2 A;  4RGS A;  4X0G A;  4N4O B;  2M5W A;  3H9Q A;  3AG2 H;  4BKX A;  5B3S H;  3T8T A;  1K78 A;  2JA8 J;  2BY1 A;  2ME0 A;  4LJZ F;  4PZJ A;  2DFI A;  4BJT A;  1PUE E;  2X6O A;  3MCZ A;  3SEQ A;  1LVA A;  2OF7 A;  3EUA A;  1YX5 A;  5HS9 A;  3QPS A;  2P0W A;  5HLI A;  1B59 A;  1NTC A;  2R92 J;  3PSF A;  3CMA I;  1DQU A;  4CO8 A;  4IHT A;  3F8B A;  1J7K A;  1U9N A;  3AFH A;  1T33 A;  3WTY C;  1DDN A;  1MMS A;  1MMG A;  1K7A A;  4PFO A;  3JRE A;  3BR0 A;  5FLX Z;  2FA5 A;  2HOT A;  1J09 A;  2CMP A;  2DFF A;  3E6C C;  4XLP F;  3J80 Z;  3FBN B;  2PJP A;  2QWW A;  2K9N A;  2YUS A;  1OMI A;  1TT5 B;  3HGY A;  3PL8 A;  3G2B A;  4RAF A;  3HOW J;  1Z7U A;  2ZJ2 A;  1LE8 B;  2CW7 A;  2GOX B;  3WU2 C;  2X0L A;  3RKW A;  3QQA A;  4YII A;  1R23 A;  2I5U A;  1S7E A;  2RN7 A;  1W36 C;  1V55 H;  3CDL A;  3IC7 A;  2VXD A;  3JSO A;  3LST A;  3JRI A;  1FIP A;  1TQI A;  5DD4 A;  4DGW B;  3BWG A;  3SZG A;  4GO1 A;  1ZEL A;  4JX6 A;  4UNO A;  2EB7 A;  3GZ6 A;  1VI0 A;  3FX3 A;  3U9G A;  2VKH A;  4QPO A;  3ZRG A;  2ELK A;  2M2E A;  3EQL F;  1V4R A;  3K4L A;  1FJL A;  1XD7 A;  1QNT A;  1ODD A;  3R60 A;  4BUP A;  4PSW A;  2R0Q C;  3LOC A;  3W6K B;  1KYZ A;  2BXY A;  2CQQ A;  3LA3 A;  5GTI C;  4MEX F;  5J1U A;  4EQQ A;  2DDA A;  2EPF A;  3R0J A;  2RGV A;  2DN0 A;  3ZQ7 A;  2JRT A;  2E2I J;  3TW6 A;  3AG3 H;  2BY3 A;  2F4I A;  1S6L A;  4A3E J;  3B73 A;  5DM7 F;  2VJ4 A;  2ZNY A;  3QP5 A;  1A04 A;  2IJL A;  3KEQ A;  4HYE A;  1FOW A;  1HKQ A;  2E35 A;  4Y7N J;  3ZQQ A;  4BY1 J;  1R36 A;  1FWZ A;  2WV1 A;  2R7Z J;  2CQK A;  2ETH A;  3F22 A;  4PK4 A;  5K5Q A;  1SD4 A;  3TP0 A;  4NHJ A;  3ABU A;  3J80 K;  4QTR A;  2VLA A;  2R5Y A;  4H0E A;  2V6E A;  4Y52 J;  2B0L A;  3ZOB A;  2OZ6 A;  1N25 A;  2L7Z A;  3QYB A;  1K4T A;  3TDU C;  3BTI A;  1Y1W J;  1X1P A;  2LF7 A;  2HQR A;  3NEU A;  1ZGJ A;  5ICE A;  2MC4 A;  5D8L B;  4LOC A;  1O3Q A;  2QLZ A;  1R5H A;  2Y9Y A;  4ZJZ A;  5L3E A;  2GBY A;  3NAU A;  2BZT A;  5ICF A;  2VQC A;  5GAG J;  4OIO F;  1JXS A;  3H92 A;  2V7F A;  5FKM A;  3M7G A;  3QPL A;  1ZYR F;  4ZC3 A;  1EF4 A;  5E18 F;  4OOI A;  2ZXW H;  3RKX A;  2VIX A;  2MFZ A;  5BPI A;  2CRG A;  2XAQ A;  1D5Y A;  4CCL A;  1DP3 A;  1BI2 A;  2DTR A;  4F55 A;  3ONQ A;  3BP8 A;  2NVT J;  1KZH A;  5LRS A;  3JAM K;  3D5R C;  1WHU A;  1MIJ A;  4WCG A;  2M4K A;  2WAD A;  1RES A;  2ZME B;  4MNU A;  4I2O A;  3Q9V A;  5D6E A;  2FMY A;  1A36 A;  3DPL C;  4M6X A;  3CJQ B;  4MTE A;  3S17 J;  2IEK A;  3BCB A;  2XF7 A;  1U3E M;  2JA7 J;  5EG0 A;  3K0L A;  3GTQ J;  1U5T B;  2J5O A;  1T0F C;  4HSR A;  1ZR4 A;  4ZDO A;  4XLN F;  1HLV A;  3K4N A;  1TQP A;  1W1W E;  4KUM A;  2LDU A;  3BR6 A;  2QCO A;  5BPD A;  3FMQ A;  1JHF A;  1ON1 A;  1IJW C;  1OCC H;  4CIC A;  2M3A A;  3LAJ A;  5FLM J;  3S1Q J;  4LLG F;  1D8K A;  1GV2 A;  3SZT A;  3KP7 A;  4YFN F;  3QPH A;  4EMS A;  2CG4 A;  3W2V A;  3GTG J;  1RUN A;  4B3A A;  1HKT A;  4XLA A;  2CH0 A;  2FXA A;  4IL6 C;  1LJ9 A;  2MW8 A;  5J1Y A;  3CF5 F;  3RQ4 A;  3F8N A;  3KEY A;  4B44 A;  3HYI A;  4GYI A;  3Q3S A;  2LSO A;  1H89 C;  1H88 C;  4CYC A;  4HAM A;  1FT9 A;  1K6Y A;  1FBQ A;  1H9G A;  2IS2 A;  3C2B A;  4DNC A;  2FE3 A;  1APL C;  1RR7 A;  3ZMS A;  2X6Y A;  3JR9 A;  2LK2 A;  5JHU A;  1D3Y A;  4FTH A;  1J59 A;  2H94 A;  4HV5 A;  3SFZ A;  1YYV A;  2W82 A;  4I7H A;  3CUQ B;  3X2Q H;  5KAF C;  4OU0 A;  3OS2 A;  1YRN A;  5C3E J;  2JA6 J;  3L2C A;  1NK3 P;  4LK1 F;  3PO2 J;  3KPH A;  2KZG A;  3CCY A;  4PUS A;  2O7O A;  2ZSI B;  1UST A;  3O2P E;  1QU3 A;  3J7Z I;  3JRC A;  4G7H F;  4NNJ A;  4B47 A;  1AKH B;  3DPU A;  3K4K A;  1ZAR A;  3R0A A;  1MMN A;  1JKR C;  2R4G A;  3VDX A;  1YW9 A;  1OIS A;  4BJ5 C;  2XHK A;  1E2X A;  2NS0 A;  3HDD A;  4ZYA A;  2CUE A;  4WWC A;  2WB1 N;  1A31 A;  3M8F A;  3LWF A;  5GP9 A;  4C30 A;  3CLO A;  1A6Q A;  4ITV A;  1XSX A;  4RLF A;  3O8G A;  2MD0 A;  2HPM A;  2HR3 A;  1YG2 A;  5L3C A;  3V8L A;  2IAI A;  4MTD A;  3RZO J;  3Q0W A;  3RYP A;  5JHF A;  3DKW A;  5F08 A;  3F8M A;  2ELH A;  3DFG A;  2OCC H;  3WTT C;  1WJD A;  3PNY A;  2V1D A;  3TGN A;  1MBG A;  2DA5 A;  2KHM A;  2NS7 A;  3I59 A;  3BRO A;  3K4C A;  5LHH A;  3SFI A;  2L01 A;  1B9N A;  4I09 A;  4Y15 A;  5LGN A;  4KIF A;  3P9K A;  1MW7 A;  3ABL H;  4XR6 A;  4A3L J;  3DCF A;  2Y2Z A;  2DA6 A;  2OQR A;  3OL4 A;  4ENM A;  2UXX A;  2FU4 A;  1IGN A;  4RB2 C;  2LD5 A;  2DU9 A;  3S1R J;  2JUC A;  3GTM J;  3CLQ A;  4GXO A;  3A02 A;  2BGC A;  1ZLJ A;  1H8A C;  1W5S A;  2LKX A;  1FP1 D;  3HOY J;  1RKT A;  3GEZ A;  5ILU A;  4RAG A;  3AL0 B;  2RV8 A;  1YFH A;  1X2M A;  1VQO I;  4BE1 A;  4A0X A;  3ZCO A;  5J47 A;  1ZRD A;  2EH3 A;  3M1C A;  3IV5 A;  3FKJ A;  4D9J A;  4HF1 A;  1R5I D;  1Y0U A;  2CFX A;  2M34 A;  2F5F A;  3PJR A;  3LSP A;  5M3M J;  1FYM A;  4CYC B;  5J4Y A;  4NB5 A;  3T8R A;  4XRM A;  3E6M A;  5CYV A;  3K70 D;  1SVL A;  3F23 A;  2G7H A;  2PI0 A;  5FKK A;  2GIV A;  2L2O A;  4KN4 X;  1R1U A;  2VPL A;  3TDZ C;  5FRO A;  2BHY A;  3BR2 A;  1TW3 A;  2AXL A;  3HTU A;  4GFB A;  3FXK A;  4D5C A;  1RUO A;  1A35 A;  2YU3 A;  3I0T A;  5J8C A;  1TWC J;  1LNW A;  2LOO A;  1MH3 A;  5TRD A;  1P6R A;  3HUG A;  4BEH A;  2KIQ A;  3I4N J;  3VOD A;  2XIG A;  4LFU A;  4HQE A;  3JW4 A;  4U0V A;  2RVC A;  3I3L A;  1U2W A;  1SMY F;  3WU1 B;  2ESN A;  2V26 A;  2E19 A;  2JWT A;  2OPT A;  4XQF A;  3GTJ J;  1QHH D;  3GWZ A;  2BBY A;  4A3I J;  2Q1Z B;  4ANJ A;  4CUG A;  2QGU A;  3V7S A;  1J75 A;  3S93 A;  1YJN I;  3VOE A;  1F1Z A;  5L3G A;  3E7L A;  1P2F A;  2JPB A;  3QPT A;  3JRF A;  1UHM A;  1F4K A;  2PMU A;  3MKZ A;  2JPC A;  3UKG A;  1UB9 A;  3WHC A;  3OMY A;  2L54 A;  1I6H J;  5IOY A;  2I8D A;  4RB1 A;  1JHH A;  1MKM A;  1O3S A;  2P6T A;  3WOD F;  2H1L A;  3L1P A;  3IRQ A;  3VYS B;  2QVO A;  4KNY A;  2B63 J;  3IP4 B;  2WWY A;  2DYR H;  1OR7 C;  2EFO A;  2V1N A;  1CF7 B;  1ZLK A;  1EH7 A;  4KJZ A;  1NHA A;  2MC3 A;  3FK6 A;  3OS1 A;  2WA0 A;  3T1B A;  4DZP A;  4HNV A;  2P5L C;  5HNF A;  1YIT I;  4G94 A;  4N9H A;  2OCE A;  1IF1 A;  3DBH B;  2GAU A;  3GFI A;  2OC6 A;  2XGE A;  1Q1H A;  1TP4 A;  5K7Z A;  1IRG A;  2VC0 A;  2F4O B;  5J1R A;  5E8I A;  1DU6 A;  4Q4Z F;  1ETX A;  1YE9 A;  2M1B A;  2ZO4 A;  4XLC A;  1ETO A;  1W0U A;  4E4H A;  4YFX F;  2UUZ A;  3DQV C;  3GVA A;  2HYJ A;  2VN2 A;  4BXX J;  3KZY A;  2K5C A;  5LGT A;  4A3K J;  2QKM B;  1VQL I;  1Y6I A;  3K2Z A;  3HIF A;  4KT5 C;  2RAE A;  3GFL A;  4A0Z A;  4Q48 A;  1ZKG A;  4XON A;  2UV1 A;  4LGW A;  1Z1D A;  2DK5 A;  1DUX C;  1V54 H;  4UV9 A;  4ZYG A;  2HVS A;  5D8K B;  3K1P A;  3KYC B;  2YU9 J;  1XCB A;  1IN6 A;  5KNL A;  5E3L A;  4M3G A;  2R3S A;  3G1O A;  2ZFU A;  5E8G A;  2NXN B;  2QF7 A;  3PNT A;  4XM3 A;  3QYE A;  2QUF A;  2LP0 A;  3D5L A;  3DKX A;  3KYD B;  1QRY A;  2XPW A;  5DYM A;  2A5Y B;  1X4O A;  1BR2 A;  3C18 A;  4DYC A;  2XAJ A;  1QA6 A;  2E1C A;  5LFA A;  3TO7 A;  4IRG A;  3FM5 A;  1FYK A;  1O4X A;  1TW2 A;  5DM6 F;  1IDY A;  3HPG A;  3BG5 A;  5EZG A;  4D7N A;  3Q5F A;  3QOP A;  3G6E I;  1BC8 C;  4BY7 J;  1TWA J;  5FD5 A;  4ZYD A;  2BY0 A;  4N4N B;  3OYL A;  2CFO A;  3BR1 A;  3TOB A;  5DTD A;  3O6B B;  3VYR B;  4L9J A;  4P55 A;  1BN5 A;  3CC4 I;  1MJB A;  4I76 A;  5HOO A;  3JRG A;  3GME A;  2ZXJ A;  4E7J A;  1WJE A;  2V9V A;  4PSX A;  1B6A A;  4OWR B;  1DP7 P;  3CME I;  3A01 B;  4XLF A;  2R5Z A;  2L7K A;  3FWE A;  1U8R A;  2EFW A;  1LQ1 A;  4HX7 A;  4KIT B;  3K1M A;  1SAU A;  2N8G A;  3BJO A;  4M9Z A;  2VOO A;  3MWM A;  3H3V K;  1VQ9 I;  3K9T A;  1MDM A;  2FBH A;  2WTE A;  3BJ6 A;  5KAI C;  1VQK I;  6PAX A;  4GCV A;  1YIO A;  2DOD A;  3ZXS A;  1IG7 A;  3AKZ A;  1V5G A;  2VE9 A;  2K3F A;  2K4J A;  5F6F A;  1ZAO A;  1TC3 C;  2MBF A;  2CJJ A;  1ZRF A;  3V7R A;  4FX4 A;  3BG7 A;  1YIJ I;  1XSV A;  3BPX A;  4UB6 C;  3HSR A;  3WG7 H;  5HDN A;  1MGT A;  2HTJ A;  5BQT A;  3JRA A;  4R79 A;  5GPA A;  2HWV A;  4W1U A;  1YJ9 I;  5HOD A;  3GZ5 A;  4XIC A;  1FMV A;  1V3F A;  2Q2E A;  1WSU A;  5FO5 A;  4IOA F;  3K6G A;  1G3W A;  5HLH A;  3MKW B;  5M5X J;  1PP8 F;  5JR3 A;  5JLX A;  2VBX A;  1JGS A;  1UHS A;  3MAJ A;  1YW7 A;  2Z3Y A;  3E5U A;  2XRO A;  2HDC A;  5EEH A;  2O8K A;  3OYK A;  3JRB A;  1FY7 A;  3DKY A;  4U87 A;  2IS1 A;  1N75 A;  3DP7 A;  1NH3 A;  5FRM A;  1MBF A;  4BHP A;  3BQZ A;  3DTK A;  3MD2 A;  4Y4R A;  3U1D A;  3OV8 A;  1ZQ3 P;  2XPU A;  1Z7L A;  1S5L C;  2E1M B;  2Y0S N;  1B9M A;  2M8E A;  2W84 A;  4DIQ A;  2JSC A;  4HDU A;  1OR7 A;  2FJ1 A;  2DMQ A;  2ISZ A;  3HC7 A;  5JVT A;  3JSP A;  1XGO A;  3BTJ A;  2HNH A;  2ZKZ A;  4G9Y A;  1V5F A;  1RPW A;  1FOX A;  3H5N A;  3CJN A;  2O03 A;  1HSJ A;  2YR2 A;  3WTU C;  3REO A;  2CV0 A;  3HOS A;  5JVG F;  2LFB A;  4HPQ A;  1GT0 C;  3NRV A;  1HDP A;  4OIP F;  4XRF A;  1JT6 A;  2RC4 A;  2HQA A;  3N05 A;  2L02 A;  3FXJ A;  1QZY A;  5EG0 B;  3ZQL A;  3C1D A;  1I6X A;  2BEO A;  2MLG A;  1ZR2 A;  2AQE A;  3E97 A;  4ENJ A;  1YQA A;  4HV6 A;  1T0F A;  3TO9 A;  1BL0 A;  1YRN B;  3DWL E;  2Y0S A;  2IA2 A;  2M9H A;  2XF6 A;  2E34 A;  1HW1 A;  3IH3 A;  3IKV A;  2H1K A;  4JBA A;  3IL2 A;  2VOD A;  3TQN A;  4IJA A;  3A01 A;  4R1H A;  1OCR H;  3CMY A;  1J2X A;  3FMR A;  3RQI A;  1IC8 A;  2EFP A;  2COB A;  3BPV A;  4DQ2 A;  1IW7 F;  3BR5 A;  2QEX I;  3GX4 X;  1T6S A;  4CCM A;  2LVS A;  2ZME C;  1BI0 A;  1MD0 A;  5J8F A;  4BE0 A;  3WTZ A;  3IAS 2;  2LG4 A;  3OYN A;  2F48 A;  5FJ8 J;  2W57 A;  5E3M A;  1K4S A;  2EZK A;  1SAX A;  3IUO A;  4HX8 A;  2ZBK A;  4UXN A;  4IRH A;  2KP6 A;  3M1E A;  3G1M A;  2DT6 A;  2E71 A;  1WGX A;  2X1E A;  2XDV A;  3I71 A;  3R6S A;  4D7M A;  2LY9 A;  1X3U A;  5GTH C;  1PDN C;  1BM9 A;  3CQZ J;  4UUS A;  4D0P A;  2O5R A;  3F8C A;  2OU2 A;  5E1X A;  2CWE A;  4F93 B;  3HEF A;  3MKL A;  2QSF X;  3JRH A;  5EZH A;  3I4M J;  5KHD A;  5K7H A;  3CC2 I;  2VKD A;  1OCO H;  4A6E A;  3FKI J;  1RKW A;  1WJ5 A;  4QLC U;  5HDG A;  4BQN A;  3ERE D;  2XRN A;  3D1N I;  3I55 I;  1FBS A;  5AIQ A;  5H20 A;  1YTY A;  5ILV A;  1I1S A;  2X1D A;  4LG0 A;  5EGO B;  3MZY A;  1SFO J;  3VYT B;  2Y0M A;  1RI7 A;  3ULQ B;  3MZH A;  2R7V A;  5GAE J;  2Z9O A;  2V6C A;  2XSD C;  4I0A A;  1XGN A;  2ZC2 A;  2VJI A;  2FX0 A;  2OD5 A;  4W97 A;  2C6Y A;  4A3B J;  5FB2 A;  3NAR A;  4YFK F;  4BS9 A;  2XPV A;  2EFQ A;  2FML A;  1IUF A;  2DOE A;  3F0C A;  3RPU D;  1EV7 A;  4ESF A;  2VT2 A;  1XN7 A;  3BCA A;  3JCU C;  1RZ4 A;  4F52 A;  3TO6 A;  4L0Z B;  3BZ6 A;  4A5N A;  1FC3 A;  4E70 A;  1VND A;  3RZD J;  2Y9Z A;  3HOU J;  3O8H A;  2A69 F;  2VQL A;  3SDG A;  1WH7 A;  5ERI A;  1F5T A;  5BS6 A;  1IRX A;  2H09 A;  3RDI A;  5D6F A;  5H6Q A;  2DPU A;  4II3 A;  2GWR A;  5LEJ A;  4RA2 A;  2VOP A;  2K85 A;  3DF8 A;  2R5Y B;  4KMU X;  4XKV A;  3UR3 C;  2UZK A;  3R4K A;  2JJ7 A;  3E5X A;  2LRE A;  1R49 A;  2PMZ A;  3GTK J;  1PVE A;  2MSY A;  3QOE A;  4BJ6 C;  5DUI A;  4IO9 F;  1KQ8 A;  3FK7 A;  2R7T A;  2I10 A;  3ASN H;  2QZ8 A;  2WY8 Q;  4L5E A;  4Q47 A;  1S29 A;  2MAB A;  3OIO A;  3ZMD A;  4JK1 X;  2NYX A;  2L5Q A;  2IP2 A;  3ZPL A;  3WTX C;  3JTG A;  1SFX A;  3EUK L;  3MZ8 A;  4HA8 A;  1TWG J;  5J40 A;  3W2W A;  1S7A A;  3H36 A;  4E7S A;  1XCV A;  1ETK A;  1LUJ B;  1X1D A;  1VQP I;  4A3D J;  1O57 A;  1W5T A;  1W0T A;  5LEK A;  4GDF A;  2QEN A;  4EGY A;  1MBE A;  3PSI A;  1SVM A;  3PIP F;  5BNG A;  2QQB A;  2XVC A;  3K10 A;  4UUS B;  4OAZ A;  1MNM C;  4MHG A;  1R9T J;  3F72 A;  2K86 A;  1BIA A;  2KIF A;  3S3N A;  2ZME A;  1QVU A;  2EA2 A;  2PEX A;  3HOT A;  4EV0 A;  2WY7 Q;  2DXI A;  4Z6Y A;  1HKS A;  1I27 A;  3HRT A;  2M8G X;  4ZTF A;  4BDY A;  1K61 A;  3FMS A;  3DBR B;  2JA2 A;  5F64 A;  5D5V B;  3BTC A;  2BV6 A;  1TQM A;  4E6K G;  3IHU A;  1LFU P;  1I39 A;  2F5D A;  1JTY A;  2XSJ C;  3CTA A;  1ETY A;  1KGS A;  1MBJ A;  1X3Z B;  3CCS I;  2NAZ A;  1RIO H;  1X3W B;  5F1R A;  2NVY J;  4O3M A;  1WQ2 A;  1OFC X;  2WV0 A;  3H0G J;  2CGP A;  2TRT A;  3ISP A;  2HI3 A;  5L3F A;  3H5R A;  4YEJ A;  5F0F A;  1GLN A;  2F6C A;  4HF2 A;  3HOZ J;  3DPT A;  2XKO A;  4XMY A;  3VSL A;  1MMD A;  3FIW A;  5J4V A;  4MQ9 F;  5C4J J;  2NRA C;  2KFD A;  2KDO A;  1S8N A;  3KP3 A;  4IHV A;  3WE2 A;  4GGG A;  2DOF A;  5K7F A;  2ME6 A;  1U0J A;  4C2U A;  3DEW A;  5IT9 K;  1IZ1 A;  1XC5 A;  1VTN C;  1QQI A;  3KX2 A;  1DU0 A;  4FT8 A;  2M0M A;  2KJC A;  2AXT C;  1SFU A;  1R1T A;  4G8X A;  5IP7 J;  2ZJQ F;  4U88 A;  3FXO A;  3H0D A;  2L4M A;  4ESJ A;  2D1V A;  3E1S A;  3RSN A;  2PBI A;  2CV2 A;  1QZE A;  2ID3 A;  3GTP J;  1VF9 A;  4KA4 A;  3TP3 A;  3OYJ A;  2W00 A;  2JSP A;  3CUQ C;  3RIR A;  4MLO A;  1LPQ A;  2R7R A;  1WI9 A;  4A3C J;  1P4W A;  2K3P A;  2CYY A;  3E5Q A;  4KN7 X;  1XPX A;  1IO2 A;  4P96 A;  4UUV A;  4M3F A;  2NVU B;  4XRS G;  4ASN A;  5E3O A;  5K5O A;  4IKF A;  5DCM A;  5HLT A;  3GO5 A;  2X6X A;  9ANT A;  2WAF A;  4B48 A;  1PYV A;  2QSG X;  2PFB A;  4KDP A;  4PJ0 C;  2LNB A;  2K27 A;  2DJI A;  2QKL B;  3QU3 A;  1EH6 A;  1WRJ A;  3QRF F;  1J9I A;  2V9K A;  3TMO A;  2L9S A;  1LVK A;  4OAY A;  1RET A;  4Q5S F;  1UZC A;  5M5W J;  1FOY A;  1YHQ I;  4AIJ A;  3ZMZ A;  2EZI A;  2QQ9 A;  3L2R A;  2DA3 A;  4ESB A;  4UHT A;  2L7M P;  2FEZ A;  4RLQ A;  2VQG A;  4KIG A;  2R7Q A;  3KZZ A;  1PUF B;  1ZN2 A;  2Q0O A;  4BHC A;  2X6W A;  4BGD A;  4XLH A;  4M9S A;  1NG6 A;  3HJE A;  2LMD A;  1VZ0 A;  1JJ6 C;  5FLX K;  2CQX A;  3GYH X;  2VB6 A;  4EM2 A;  3B6C A;  1X1B A;  1YX3 A;  3LQQ A;  4KFC A;  4ON0 A;  1D5V A;  3LQR A;  3SQN A;  2P5V A;  1SFK A;  3M8E A;  4BL0 B;  3JAM Z;  2L0K A;  2OTL I;  1OJL A;  1LFB A;  2CS3 A;  1W7P B;  2JVG A;  3K4B A;  2KIS A;  2GA1 A;  4D1Q A;  1QVT A;  2DO7 A;  4IPA A;  2IA1 A;  4EM1 A;  1HF0 A;  3I5U A;  2LTP A;  2L9V A;  2FRH A;  4G6Q A;  1SD7 A;  2RNJ A;  3S14 J;  3HG9 A;  3I58 A;  5CPR B;  3CCU I;  1CGP A;  2XB0 X;  1IXR C;  3OIP A;  5DCF A;  4CH7 A;  5JI6 A;  5IYC J;  3OY9 A;  1U8B A;  1YS7 A;  5B66 C;  1D0Y A;  2HYG D;  2E1M C;  3PUB A;  3H5A A;  4A69 C;  2EIK H;  3LA7 A;  3PIO F;  4RGU A;  4DJA A;  4B3X A;  1EJ9 A;  1TNS A;  2CW0 F;  3FXR A;  4C3H J;  1AU7 A;  2PJR A;  1HDD C;  3P9C A;  1E0E A;  2E2H J;  4UUT A;  3QAH A;  4CCJ A;  3NWT A;  2PX9 A;  3HUG B;  3M3Y J;  2UWM A;  3I4P A;  2ECB A;  1XG1 A;  3GUD A;  2UXN A;  4WX9 A;  3HSF A;  3SDB A;  3LAP A;  3O3K A;  5M3F J;  2DA2 A;  1BA5 A;  1O7L A;  1D1A A;  3FHN A;  4F91 B;  3IAM 2;  1WI3 A;  4IHX A;  1Z6R A;  4BAY A;  2JT1 A;  4MO7 A;  2K40 A;  2G9W A;  3SEZ A;  3EDP A;  3V42 A;  2ZB9 A;  1BI3 A;  3OYD A;  5JLW A;  4U0Y A;  4HOB A;  1Z0X A;  4AM3 A;  2E60 A;  2DLL A;  4HQM A;  1W7P A;  2L4A A;  3A1Y A;  5CVU A;  2HKO A;  4CCO A;  1AOY A;  3KP2 A;  3LSK A;  5IP6 A;  1VQ8 I;  2M87 A;  1D1C A;  4FE4 A;  1HA8 A;  4LB5 A;  1DGR M;  1ZG3 A;  2VBZ A;  3KCC A;  4AU7 A;  1S9H A;  3HKZ A;  5D4R A;  2HDD A;  1R4M B;  2E7W A;  3OR2 C;  4AYB N;  2E5N A;  1NG7 A;  3NQO A;  4ZZD A;  1BOA A;  2ZJP F;  1VQM I;  3ZQG A;  4J00 A;  4BQO A;  4FQG A;  2IRF G;  3H3Z A;  4HEA 2;  2EA4 A;  3FDY A;  3WHB A;  2O9L A;  2Z2S B;  1FIA A;  4FX0 A;  5KVR A;  1GV5 A;  2XV4 S;  4OIR F;  3G71 I;  2QM3 A;  2WAQ N;  3BTL A;  2DMU A;  2HXI A;  4YRV A;  2VC1 A;  4CXF A;  3KFW X;  2CSO A;  1MSE C;  4WXD A;  2OAZ A;  4V2G A;  2MG4 A;  3GW2 A;  1X1A A;  3E6D A;  5CVI A;  5EJC A;  2EIL H;  5HVQ C;  1UFM A;  4C3J J;  4M3B A;  3OYA A;  4BH9 A;  2A6E F;  3C7J A;  1OCT C;  2MH9 A;  4I99 C;  1K83 J;  2F2E A;  3IKT A;  2KRH A;  3RPQ A;  3D0S A;  2XGC A;  5EDN A;  4S0H B;  4BHB A;  4B09 A;  1R71 A;  4XNF A;  2JUG A;  4RGX A;  4UVA A;  5BOX A;  4MQV A;  2MYS A;  1G3S A;  1GDT A;  4LLL A;  3C3W A;  3DEE A;  2LLK A;  1HW2 A;  1S3J A;  3TBI A;  2DMP A;  1VQ6 I;  3I9V 2;  1KQ0 A;  2IBD A;  1W5C C;  3ZQF A;  1JJ8 C;  2GZW A;  2KMU A;  1D0X A;  2BE5 F;  4RBO A;  4HDV A;  2PJR B;  3C2H A;  2VJ5 A;  3T5X A;  1UHW A;  2EJR A;  4UVB A;  4F92 B;  2TDX A;  2NS8 A;  2JA5 J;  4HZF A;  1OPC A;  4N9I A;  1GHC A;  5JFR A;  3S2D J;  5CQG A;  4OMZ A;  5D5U B;  1Z67 A;  1I3Q J;  4PDK A;  2O61 A;  1F36 A;  2CV1 A;  3ESW B;  2R7U A;  2IGK A;  3VSK A;  4A0Y A;  1S7O A;  3KZI C;  4ETS A;  1AWC A;  1WJB A;  1YJW I;  1UAA A;  3I53 A;  1POG A;  3BR3 A;  4CZZ A;  4U7B A;  1MBK A;  1ZH5 A;  1ULY A;  4Y33 A;  3MN2 A;  3WE3 A;  5BMZ A;  5CVV A;  5TJJ A;  4HRI A;  5GPC A;  2EV5 A;  4I0B A;  1R00 A;  2WAE A;  1UJ8 A;  1XGM A;  2JMW A;  3LFU A;  3ROU A;  3UNG C;  3WG9 A;  4AC0 A;  2Y75 A;  3OYF A;  2R5Z B;  4EJT A;  2Z1D A;  1RR8 C;  2ZSH B;  4XOT A;  2H8W A;  4YG2 F;  4ZZL A;  2AO9 A;  4JYK A;  3PNV A;  3L09 A;  2LY1 A;  2DYS H;  5DD8 A;  4LD5 A;  2M7B A;  5E20 A;  2EFN A;  5F27 A;  2F5E A;  5FKO A;  3L00 A;  2ACJ A;  2IT0 A;  3HKZ N;  1SEU A;  2P5K A;  1HC8 A;  2DAO A;  3DTE A;  3ERM A;  1ENH A;  1GXQ A;  3ZMV A;  1Z05 A;  1DPU A;  1KQ9 A;  4AVP A;  3BLY A;  1ETW A;  3PO3 J;  4WK8 F;  4O6J A;  1OKR A;  4L5I A;  3BZK A;  3H3U A;  3A0H C;  4A12 A;  3PFY A;  3P5J A;  1G6N A;  2DT5 A;  3MQ0 A;  3ABK H;  1GUU A;  4NC6 A;  3QYF A;  1FNN A;  3BOQ A;  3A0B C;  4U0W A;  1KYW A;  3HOV J;  2CQ7 A;  4A6D A;  4DYR A;  4IQ4 A;  2KL4 A;  4I98 B;  2PG4 A;  5IP9 J;  3SZP A;  2XAH A;  3AG4 H;  3GZN B;  3ZQI A;  2V1U A;  4HLY A;  1FLI A;  4PJL A;  4KIC A;  1E3H A;  1FZP B;  2DA4 A;  1MJ9 A;  3LNQ A;  3DBL B;  2YS9 A;  1GVJ A;  2FD5 A;  4XBF A;  1JTX A;  5HNH A;  4BNC A;  2D1H A;  3RI4 A;  5IT3 A;  2BW3 B;  2W24 A;  4UVC A;  1I1G A;  3PQK A;  2ISY A;  1D1B A;  3F6V A;  3HRS A;  4A2U A;  4WXC A;  4PJJ A;  4AYB A;  3ABM H;  1X2N A;  2H6C A;  4XK4 A;  2L9R A;  3CZ6 A;  2CQN A;  5L3B A;  1GXP A;  5HLG A;  4XSX F;  2JZY A;  1JT0 A;  1Z6T A;  3DU6 A;  2B7E A;  4B1R A;  3U2R A;  4IRI A;  1SD5 A;  3F8F A;  3S8P A;  2ELJ A;  2VL8 A;  3FHZ A;  3CCE I;  1KU2 A;  2IGN A;  4C9Y A;  1JI8 A;  3IWF A;  3ECO A;  2A3S A;  2P8T A;  2W4S A;  1FYL A;  4C2M J;  1ERD A;  4ZTJ A;  1AHD P;  5LHG A;  1J0R A;  2D2W A;  2HEO A;  1Z3X A;  3SJM A;  3OSF A;  1Z21 A;  1LDK B;  3F9K A;  3OOP A;  1K79 A;  4D5F A;  1IDZ A;  1LKX A;  3W6V A;  4KIS A;  3IRR A;  1FEX A;  4F3Q A;  2F5V A;  5HS7 A;  2D45 A;  1EKE A;  4PJN A;  1WFX A;  2E1O A;  1OLT A;  2GXA A;  4LIU A;  3RYR A;  3H9G A;  3OL3 A;  3A2K A;  1I5Z A;  1XMA A;  3OYI A;  2IW5 A;  2LRD A;  2QSH X;  1YOV B;  1SMT A;  2K9S A;  2BY2 A;  4ZH4 F;  3H9J A;  1IN5 A;  1WWX A;  4J01 A;  2H8R A;  1BW5 A;  1OYI A;  2X85 A;  5E79 C;  4JX5 A;  2VKV A;  2XAF A;  4PCQ A;  3RKY A;  3I64 A;  2HQ5 A;  1Y8Q B;  3GLX A;  3TOA A;  1QO0 D;  3FXU A;  5D4S A;  1YO5 C;  1W36 D;  4IX7 A;  3HL2 A;  2XAS A;  4L9T A;  2KJB A;  3OYH A;  4MEY F;  4RDU A;  1JUP A;  2GLO A;  3EYI A;  3S2W A;  4P9F A;  2EWN A;  3GBG A;  4K2E A;  4RB3 C;  4II2 A;  1N77 A;  2DPD A;  5CQE A;  2IXS A;  3VYU B;  4NC8 A;  3RTR A;  4DZJ A;  2K9Q A;  1OYY A;  5C4X J;  5B1A H;  3DLA A;  1FBU A;  5IPA A;  2G0E A;  4EAT A;  1QPI A;  2A6H F;  2KQR A;  2P6S A;  2ADU A;  2VQH A;  3ZQC A;  2EBI A;  2HOS A;  2EK5 A;  4BQQ A;  3KP5 A;  2GOM A;  2E2J J;  2VKE A;  3BC8 A;  2EV0 A;  3I56 I;  3IH2 A;  4QIW N;  2X9D A;  3L2Q A;  2OBP A;  2BW3 A;  3QWL A;  4IEJ A;  1R7J A;  1BOB A;  1E17 A;  3M07 A;  3FBI B;  2HKX A;  3K2A A;  4WXH A;  2QQ8 A;  1TL8 A;  5E3N A;  2MA3 A;  3RKQ A;  4NQW A;  2EZH A;  2P7C B;  2LBF B;  1ITY A;  1XMK A;  4RS8 A;  2KDZ A;  1IN7 A;  3JRD A;  2NOJ B;  3GXO A;  4LB6 B;  3CCV I;  3HHG A;  2K4B A;  5IYD J;  1WCM J;  1Z91 A;  2K9M A;  5E1W A;  5ILS A;  1VQN I;  2VT3 A;  4GRI A;  1L3L A;  4Y17 A;  1VQ5 I;  1MH4 A;  4KYW A;  2VE8 A;  3MMY B;  2HGC A;  3EET A;  5DV5 A;  2Z16 A;  4HF0 A;  2R7S A;  3ZN0 A;  2GIZ A;  3SYT A;  3CF2 A;  3BJA A;  1EH8 A;  1JUM A;  1TLH B;  3ZQH A;  3I59 B;  4FCY A;  2CO5 A;  4M73 A;  3ECH A;  2DFE A;  4PGH A;  3QU6 A;  1D0Z A;  2HFH A;  4AIH A;  3OYM A;  3CMM A;  3WTS C;  3HBL A;  2LF8 A;  3FF5 A;  3CCJ I;  3GFM A;  5LHI A;  2LKS A;  4EGZ A;  2CW8 A;  1G3Y A;  1LFP A;  4XID A;  1R58 A;  4AWX B;  4ENN A;  3FM3 A;  3OYB A;  2VON A;  4EEF G;  2RNG A;  2EIJ H;  3GFJ A;  1F43 A;  3BQY A;  1K78 B;  2V9P A;  2HVR A;  2XGX A;  2STW A;  2IS4 A;  2ID6 A;  4EJW A;  2FBI A;  2WB1 A;  1SAN A;  2X51 A;  3WTV C;  4V2F A;  1L0O C;  1WJC A;  1FMW A;  4LIV A;  2PLY A;  2AQF A;  1C0W A;  5K1Y A;  4FHT A;  2V1X A;  2GXB A;  1IN8 A;  2VUM J;  1LEA A;  4E7L A;  3G73 A;  2VXZ A;  1XDS A;  3L7W A;  1MZB A;  2NOG A;  1TWH J;  2EIM H;  2XF5 A;  2RQQ A;  2J5P A;  5CJ9 A;  3GTO J;  3V7C A;  2QQA A;  2OQG A;  3AAF A;  1WVR A;  2R7F A;  4MFD A;  3U21 A;  1LDJ A;  1HST A;  2K7L A;  4NBQ A;  2IGM A;  3I54 A;  4IZZ A;  4BEH B;  4WF2 A;  3KLO A;  1B1B A;  3U1K A;  4YIR X;  3CJR B;  3H35 A;  1BC7 C;  4AVZ A;  1BJA A;  1VFC A;  1GVD A;  3HSE A;  3PM1 A;  2DDB A;  1UG2 A;  1XGS A;  1RRJ A;  2ZXI A;  4XN3 A;  2QA4 I;  4I02 A;  4TV7 A;  4BYY A;  1JUS A;  4P9U A;  1ZGA A;  3ZMT A;  3CO6 C;  3DEU A;  2HOE A;  4C3I J;  2CUJ A;  2EV6 A;  4DBQ A;  2L3D A;  3R61 A;  4U7D A;  2W25 A;  3SHF A;  5CVJ A;  3J81 Z;  2H6B A;  4CSW A;  3CUO A;  3S1M J;  1LB2 A;  3K4M A;  5FLV A;  4MIM A;  5LGU A;  2Q8K A;  1Y39 A;  3E0J B;  2E5Z A;  2A6T A;  1JKO C;  3FXQ A;  2FF4 A;  4X6A J;  2JRM A;  2PQ8 A;  1MMA A;  3GLL A;  4MGR A;  3EPZ A;  4X1E A;  1Y1V J;  3BG3 A;  2RDP A;  1B8I B;  1OCZ H;  3F3X A;  2FBK A;  1XMX A;  3WU0 A;  1Y56 A;  1Z3Y A;  3A03 A;  2KIU A;  5H6R A;  1T95 A;  2F4M B;  1CF7 A;  2JN6 A;  4C2T A;  4RGR A;  3DTI A;  1PUF A;  2H27 A;  2L7F P;  1ZRC A;  1QBJ A;  2O0Y A;  3HHH A;  4YEL A;  2E36 A;  1XX5 A;  2NNN A;  1ETV A;  1FOK A;  4IHW A;  3Q0V A;  2GA2 A;  3VPR A;  2DA1 A;  2E7X A;  3G3Z A;  5GAH J;  2HS5 A;  1A5J A;  3W3C A;  2NVQ J;  1T8I A;  4H4K C;  5IYB J;  2YX4 A;  4HLX A;  4XN0 A;  3GTL J;  2BVM A;  4KIB A;  5LRR A;  3OYE A;  4CYD A;  1JKP C;  1MJA A;  1V5E A;  1G59 A;  3VWB A;  4IQJ A;  5DEQ A;  2RKH A;  5F1J A;  1BI1 A;  3LSH A;  2HZD A;  1XDU A;  2R7D A;  2LY2 A;  1O3T A;  2HPI A;  2MGQ A;  3VFZ A;  1I3A A;  4N0B A;  2MLK A;  1UCR A;  1IN4 A;  1S72 I;  3SXY A;  5CVR A;  4XSZ F;  3AL0 C;  2KT0 A;  1FTZ A;  3E6B A;  1YI2 I;  1IV8 A;  3G1L A;  3J7A Y;  3Q9S A;  3S2H J;  3ASO H;  1SVO A;  3V4G A;  2ZFW A;  5AON A;  3TKY A;  2TCT A;  2XB5 A;  1DGW Y;  4L18 B;  2XAG A;  5F0H A;  4M74 A;  4JP0 A;  1MNE A;  1ONV A;  5HS8 A;  3ZR8 X;  3RCO A;  1P7I A;  1X58 A;  5FFZ A;  1BR1 A;  3M8J A;  2M4G A;  4BBR J;  1KU3 A;  1JE8 A;  2IPQ X;  2D5V A;  5F0C A;  3OR1 C;  3COA C;  1PJR A;  1U5T A;  1RC9 A;  3LL7 A;  1MSF C;  1SFE A;  5FD6 A;  4A3J J;  1ACI A;  2HTS A;  2DT7 B;  3WGI A;  2ZXH A;  4CZC A;  1I50 J;  2KKO A;  3DXJ F;  2XC7 A;  4IOC F;  2VPR A;  3LSR A;  1Z77 A;  3ML6 A;  1U9O A;  1QGP A;  3S32 A;  5C44 J;  1HQC A;  2IS6 A;  4HG2 A;  1R1V A;  3HOX J;  3OSG A;  2XRL A;  2M7A A;  3K70 C;  1KU7 A;  4AUX A;  1MDM B;  2XKP A;  5EEG A;  3ZGK A;  3KLN A;  4EM0 B;  2O6G E;  1H0M A;  4IHY A;  5EYR A;  1BJZ A;  3RJP A;  2BYV E;  2DJN A;  2Z99 A;  3M4O J;  1K6O A;  2A61 A;  3C2G A;  5E17 F;  2VBY A;  4S05 A;  4JQF A;  1ZG5 A;  3F21 A;  2W7N A;  3DU5 A;  5E1Z B;  4M3D A;  1VQ4 I;  4E7K A;  1W7P D;  3A4C A;  3CUQ A;  4A3M J;  4A93 J;  4L0Y B;  5H2F C;  3KE2 A;  4ENK A;  2A5W A;  5F04 A;  1BW6 A;  1N78 A;  2V79 A;  2Q2E B;  4KMF A;  1LE8 A;  2FQ3 A;  3MEX A;  3NWS A;  2DMT A;  3KP4 A;  3J7Y J;  3F6O A;  4G6T B;  1IUY A;  1FP2 A;  1USS A;  3J81 K;  2BOL A;  5DUK A;  5D5X B;  4B43 A;  4RM3 A;  3LFK A;  3LMM A;  3LSJ A;  5J3L A;  1J5Y A;  5L3D A;  1BIB A;  3L2W A;  3BDD A;  1A6I A;  2VJJ A;  4ZYE A;  2Y48 A;  3KYL A;  4HNT A;  2VAS A;  2DQR A;  2YPR A;  2ECC A;  5ICG A;  2LH9 A;  5AIP A;  4PJM A;  4AIK A;  4XOP A;  1DPR A;  1IXC A;  2M30 A;  3L2V A;  4I6Z A;  4O5V A;  5LBQ A;  4LIT A;  3LSG A;  2P7V B;  2FUG 2;  2HDW A;  3B6A A;  1T38 A;  2AHQ A;  4CCN A;  4BAC A;  4P1W A;  2GXG A;  3FXL A;  2QBY A;  4M9X A;  2O3F A;  1TBX A;  4Y3O A;  5FGM A;  3WGG A;  4B4C A;  1EA3 A;  1Y8R B;  2JVH A;  3W6J B;  2LYC A;  4AID A;  1KU9 A;  4CGZ A;  1AKH A;  1P9Q C;  3OYG A;  1R4N B;  1G4D A;  2W48 A;  3ZP5 A;  4V19 K;  3FXM A;  3BG9 A;  4AD9 A;  2OA4 A;  3CDI A;  1XB4 A;  4DW6 A;  3HZJ A;  1STZ A;  3BG6 A;  2HVQ A;  3CP8 A;  3LA2 A;  3S16 J;  2W85 A;  3P7N A;  1T2K A;  1ON2 A;  2X48 A;  3IH4 A;  4HBL A;  3ZMU A;  2XGD A;  3H1C A;  4LLN A;  1TWF J;  5FKN A;  2YX7 A;  2DK8 A;  3EUH A;  2M0C A;  5TGT A;  4CCK A;  3HB9 A;  2R93 J;  4FE7 A;  2OUM A;  1UMQ A;  4HX4 A;  2DI3 A;  3N97 A;  4E7I A;  3OIQ A;  5B5E C;  1UEL B;  2ESH A;  2XUB A;  3BY6 A;  3HGG A;  4B8X A;  1P4A A;  2DBB A;  1LEB A;  3CJT B;  3WTW C;  2AS5 F;  2KRC A;  1H9T A;  2BXZ A;  1IXS B;  1JKQ C;  3BT9 A;  2M45 A;  2OZU A;  2KLO A;  3HPH A;  2JTV A;  3CES A;  3WGH A;  5K5R A;  1E3O C;  3JTH A;  3J7A O;  4G7O F;  1WJF A;  3PUF A;  4PFP A;  3LSM A;  2FOW A;  2COM A;  1XTA A;  3VEP A;  4FAS D;  4RAZ A;  3HRM A;  3HM5 A;  2K9L A;  1ETQ A;  4OIN F;  2STT A;  5J6X A;  4Z2Y A;  3B02 A;  2DQL A;  1FTT A;  2QBY B;  4EJV A;  1ZRE A;  4RAY A;  2E1N A;  2HYF A;  4FET A;  5M5Y J;  1FPQ A;  3HXL A;  2HXO A;  3TW7 A;  5DCM B;  2W1O A;  4BDZ A;  1T98 A;  2OTJ I;  5TIS C;  1SD6 A;  2DOA A;  1ORK A;  5EF6 A;  2HOA A;  2FNP A;  3CO7 C;  1TTY A;  2RRE A;  4MFE A;  1YLF A;  2MH2 A;  5KCM A;  2R7X A;  1FSH A;  1P92 A;  5FRN A;  1CQT A;  3MFK A;  4L9V A;  2Z5U A;  5HDK A;  3FIS A;  4UB8 C;  4XLE A;  1TNT A;  3ZN1 A;  1U78 A;  4QPQ A;  4HNU A;  1YS6 A;  1NK2 P;  3DV8 A;  4LMY A;  5DDG A;  1R6R A;  1OQY A;  2HU9 A;  2V4J C;  1P7J A;  1BBY A;  1QZZ A;  1UG0 A;  3K7A J;  4XKB A;  1HCR A;  3P9I A;  1FSE A;  1HBX G;  3PFI A;  1WH5 A;  4IXA A;  2DCE A;  1OYW A;  3KEO A;  3LSI A;  3PQJ A;  4RM2 A;  1FX7 A;  1ZGW A;  4M6Y A; 
#chains in the Genus database with same CATH homology
 2G0E A;  1QPI A;  5EGO A;  1JGG A;  2HOS A;  2NVY J;  2EBI A;  2LKX A;  3ZQC A;  1OFC X;  1RKT A;  3H0G J;  3HOY J;  2E2J J;  2TRT A;  1X2M A;  2HI3 A;  2VKE A;  5F0F A;  3IH2 A;  4QIW N;  2X9D A;  3HOZ J;  2EH3 A;  4IEJ A;  3IV5 A;  3FIW A;  1T56 A;  5C4J J;  2NVX J;  3K2A A;  2M34 A;  1G2H A;  4IHV A;  5E3N A;  3RKQ A;  3LSP A;  5K7F A;  2EZH A;  2ME6 A;  5M3M J;  1ITY A;  3DEW A;  2KDZ A;  4CYC B;  1XC5 A;  1Q1V A;  4XRM A;  3OOU A;  3JRD A;  1DU0 A;  3S1N J;  5EEA A;  2EZL A;  2CUF A;  1ZK8 A;  5IYD J;  1WCM J;  5FKK A;  1WPK A;  5IP7 J;  1MH4 A;  4QSH A;  3BR2 A;  4J19 A;  1ZTR A;  4GFB A;  4D5C A;  2ID3 A;  3GTP J;  1VF9 A;  4M6V A;  4ABZ A;  1TWC J;  3TP3 A;  1JUM A;  2DTZ A;  3ZQH A;  1MH3 A;  4MLO A;  4FCY A;  3S15 J;  3I4N J;  4A3C J;  2FQ4 A;  1B72 A;  4M3F A;  4XRS G;  5E3O A;  3HBL A;  2E19 A;  2JWT A;  2OPT A;  2GM4 A;  3GTJ J;  4A3I J;  9ANT A;  4DYQ A;  4G12 A;  4XID A;  2DMN A;  3E7L A;  4EEF G;  3MVP A;  3JRF A;  3UKG A;  1F43 A;  3BQY A;  3WHC A;  1I6H J;  2ID6 A;  2LR8 A;  2P81 A;  3Q0U A;  5IOY A;  1XS9 A;  1RET A;  1SAN A;  4M3E A;  5M5W J;  4V2F A;  3L1P A;  2CU7 A;  2EZI A;  1B8I A;  2DA3 A;  1MBH A;  2B63 J;  2VUM J;  2L7M P;  4FIS A;  4NDL A;  2NOG A;  1TWH J;  3FK6 A;  4DZP A;  4HNV A;  1PUF B;  3GTO J;  2XGE A;  1JJ6 C;  5IOZ A;  5K7Z A;  5FKL A;  2CQX A;  4MFD A;  2JK3 A;  3B6C A;  5J1R A;  1DU6 A;  1ETX A;  1ETO A;  1W0U A;  4JX4 A;  4BBS J;  2L0K A;  1OJL A;  1VFC A;  1GVD A;  2HYJ A;  1LFB A;  4BXX J;  4A3K J;  1OCP A;  3PM1 A;  1QVT A;  1UG2 A;  2RAE A;  1IV6 A;  2Y31 A;  1HF0 A;  1JUS A;  2LTP A;  1HOM A;  1ZKG A;  3S14 J;  4C3I J;  2XB0 X;  1U8B A;  2PMZ N;  5IYC J;  2YU9 J;  4A69 C;  3S1M J;  2DA7 A;  5E3L A;  5FLV A;  4MIM A;  4M3G A;  3G1O A;  1JKO C;  4X6A J;  2QF7 A;  4A3G J;  1AU7 A;  2Y30 A;  4C3H J;  1HDD C;  4X1E A;  1Y1V J;  3BG3 A;  4UUT A;  4A3F J;  1B8I B;  2LP0 A;  2E2H J;  3M3Y J;  5DS9 A;  1QRY A;  2XPW A;  3A03 A;  2ECB A;  1XG1 A;  2JN6 A;  4DYC A;  5M3F J;  1PUF A;  2DA2 A;  1BA5 A;  1B72 B;  2L7F P;  4XRS A;  1O4X A;  1IDY A;  5EZG A;  1WI3 A;  3BG5 A;  4D7N A;  4IHX A;  4BY7 J;  1IRZ A;  1ETV A;  1TWA J;  4IHW A;  3Q0V A;  3BR1 A;  2EQR A;  4MO7 A;  3TED A;  2VI6 A;  3VPR A;  2K40 A;  5DTD A;  2DA1 A;  2ZB9 A;  5JLW A;  4I76 A;  3JRG A;  1Z0X A;  2NVQ J;  1A5J A;  4BKX A;  5IYB J;  2JA8 J;  3GTL J;  3A01 B;  2R5Z A;  1JKP C;  5IP6 A;  2ME0 A;  2N8G A;  2X6O A;  4FE4 A;  5F1J A;  3H3V K;  2OF7 A;  2HDD A;  2MGQ A;  3QPS A;  4AYB N;  1NTC A;  1IG7 A;  2R92 J;  3ZQG A;  2O9L A;  3WHB A;  1FIA A;  2KT0 A;  1FTZ A;  1U9N A;  1TC3 C;  1T33 A;  1GV5 A;  2CJJ A;  2WAQ N;  3JRE A;  3G1L A;  3BR0 A;  2HOT A;  3S2H J;  3BTL A;  2DMU A;  2HXI A;  2TCT A;  1MSE C;  2XB5 A;  3JRA A;  2K9N A;  2YUS A;  4V2G A;  5F0H A;  2MG4 A;  3HGY A;  4JP0 A;  5GPA A;  4W1U A;  3HOW J;  5HOD A;  4XIC A;  4C3J J;  4M3B A;  1LE8 B;  1P7I A;  1OCT C;  1X58 A;  5M5X J;  1K83 J;  3QQA A;  5JLX A;  1S7E A;  4BBR J;  3CDL A;  1UHS A;  2XGC A;  5EDN A;  2D5V A;  5F0C A;  4S0H B;  3JRI A;  1FIP A;  1MSF C;  4A3J J;  4JX6 A;  3JRB A;  2O8K A;  1VI0 A;  1GDT A;  1MBF A;  1I50 J;  3BQZ A;  2ELK A;  2M2E A;  2LLK A;  2VPR A;  3LSR A;  1Z77 A;  1ZQ3 P;  1U9O A;  2DMP A;  5C44 J;  1FJL A;  2IBD A;  2XPU A;  3HOX J;  2R0Q C;  2Y0S N;  3ZQF A;  3OSG A;  1JJ8 C;  2XRL A;  3LOC A;  4AUX A;  4RBO A;  2CQQ A;  2FJ1 A;  5J1U A;  2DMQ A;  2DN0 A;  2NS8 A;  2JA5 J;  3BTJ A;  2E2I J;  3TW6 A;  4IHY A;  1RPW A;  5EYR A;  1BJZ A;  4A3E J;  3S2D J;  2DJN A;  3M4O J;  1I3Q J;  1F36 A;  4Y7N J;  4BY1 J;  2LFB A;  1GT0 C;  4M3D A;  1HDP A;  1POG A;  3BR3 A;  1JT6 A;  2WV1 A;  2R7Z J;  3ZQL A;  5EG0 B;  1MBK A;  1ZR2 A;  4A3M J;  4A93 J;  1BL0 A;  3MN2 A;  3TP0 A;  4QTR A;  2R5Y A;  1YRN B;  4Y52 J;  3ZOB A;  5F04 A;  1BW6 A;  2L7Z A;  2M9H A;  3IH3 A;  5GPC A;  2H1K A;  3BTI A;  1Y1W J;  2JMW A;  1LE8 A;  4AC0 A;  3A01 A;  2R5Z B;  3CMY A;  2DMT A;  3RQI A;  1IC8 A;  2COB A;  4LOC A;  3BR5 A;  2Y9Y A;  2LVS A;  5J3L A;  2AO9 A;  3LSJ A;  4JYK A;  2GBY A;  3NAU A;  5FJ8 J;  5E3M A;  2EZK A;  5FKM A;  1A6I A;  5F27 A;  3QPL A;  5FKO A;  1EF4 A;  3HKZ N;  2CRG A;  3G1M A;  1D5Y A;  2ECC A;  1ENH A;  1WGX A;  2NVT J;  4D7M A;  2LY9 A;  1ETW A;  3PO3 J;  3CQZ J;  4I6Z A;  4UUS A;  3LSG A;  3B6A A;  3HEF A;  3MKL A;  2AHQ A;  3JRH A;  5EZH A;  1RES A;  3I4M J;  5K7H A;  1GUU A;  3S17 J;  3FKI J;  2IEK A;  1RKW A;  1ZGW A;  4B4C A;  3HOV J;  4DYR A;  2JA7 J;  5EG0 A;  3GTQ J;  1AKH A;  5IP9 J;  3D1N I;  1ZR4 A;  3ZQI A;  2W48 A;  1HLV A;  3BG9 A;  3BR6 A;  4DW6 A;  2QCO A;  5EGO B;  3S16 J;  2DA4 A;  2X48 A;  3IH4 A;  3LNQ A;  1SFO J;  2YS9 A;  1IJW C;  2FD5 A;  2XGD A;  3S1Q J;  1JTX A;  5FLM J;  1TWF J;  5FKN A;  1GV2 A;  2XSD C;  3GTG J;  2FX0 A;  2M0C A;  4B3A A;  3HB9 A;  4W97 A;  2R93 J;  4A3B J;  4FE7 A;  1UMQ A;  3NAR A;  2MW8 A;  5J1Y A;  2XPV A;  1IUF A;  3F0C A;  1X2N A;  4XK4 A;  2L9R A;  3Q3S A;  3HGG A;  1H89 C;  1H88 C;  4CYC A;  1JT0 A;  3RZD J;  2Y9Z A;  1VND A;  3C2B A;  4B1R A;  3HOU J;  3O8H A;  1APL C;  1RR7 A;  3SDG A;  1WH7 A;  1JKQ C;  3BT9 A;  3JR9 A;  2LK2 A;  4FTH A;  4C2M J;  1E3O C;  1AHD P;  2R5Y B;  5C3E J;  1YRN A;  2JA6 J;  3SJM A;  1NK3 P;  3PO2 J;  3OSF A;  2JJ7 A;  3CCY A;  3HM5 A;  1IDZ A;  4D5F A;  1ETQ A;  3W6V A;  3GTK J;  2O7O A;  1FTT A;  2MSY A;  1FEX A;  3FK7 A;  2I10 A;  5M5Y J;  2E1O A;  3JRC A;  4L5E A;  2HXO A;  1AKH B;  3TW7 A;  3OIO A;  1JKR C;  1ORK A;  5EF6 A;  2HOA A;  4MFE A;  3HDD A;  2CUE A;  2WB1 N;  5GP9 A;  1TWG J;  1CQT A;  2K9S A;  3O8G A;  1ETK A;  3FIS A;  4A3D J;  1W0T A;  2H8R A;  1BW5 A;  2IAI A;  1U78 A;  1MBE A;  3RZO J;  3Q0W A;  2VKV A;  4JX5 A;  5BNG A;  5F08 A;  1NK2 P;  4UUS B;  1MNM C;  2HQ5 A;  1R9T J;  1P7J A;  1MBG A;  2DA5 A;  2NS7 A;  1QVU A;  3K7A J;  1HCR A;  3SFI A;  4RDU A;  4A3L J;  1JUP A;  1WH5 A;  2M8G X;  2GLO A;  3DCF A;  2Y2Z A;  2DA6 A;  3GBG A;  1K61 A;  1IGN A;  2LD5 A;  3BTC A;  3S1R J;  3GTM J;  1LFU P;  4DZJ A;  2K9Q A;  1JTY A;  3A02 A;  5C4X J;  1ETY A;  1H8A C;  5IPA A;  1MBJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...