2L7FP

Solution structure of the pitx2 homeodomain
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
68
structure length
68
Chain Sequence
GSQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKREEFIVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pituitary homeobox 2
publication title Solution Structure of the Pitx2 Homeodomain
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 20
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2010-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2l7fP00
3IH4A 5IP9J 3ZQCA 2RAEA 1OCPA 4M3BA 5EZHA 4QTRA 5C4XJ 3S2HJ 2XPVA 1IUFA 1WGXA 2Y9ZA 1ETWA 1FIPA 3LSRA 3A03A 2MSYA 1Z77A 4W1UA 1JGGA 4RDUA 4A3JJ 3S17J 1ENHA 3UKGA 4BXXJ 1WH7A 3BG9A 5K7ZA 3PO3J 5K7FA 4A3KJ 3HB9A 5BNGA 1X2MA 1JKPC 1JTYA 4AYBN 2WB1N 5C4JJ 3A02A 5M5YJ 4Y7NJ 3BR0A 5J3LA 4IHYA 2GLOA 2YUSA 4V2FA 2DMTA 2TCTA 2HOSA 2M34A 1ZR2A 2NOGA 1ETXA 1GT0C 2EZIA 4CYCA 2K9SA 2O7OA 2XRLA 2HOTA 2H1KA 5IYBJ 1ZR4A 1LFBA 3MVPA 4S0HB 1D5YA 1IG7A 4DZJA 2NS8A 2Y0SN 5HODA 2LY9A 4I76A 3ZQFA 2E19A 4X6AJ 2XB0X 5EF6A 1GV2A 2CUEA 2K9NA 1LE8A 1BW5A 2EH3A 2FD5A 3FK6A 3WHCA 2E2JJ 1K61A 1H8AC 4DZPA 5K7HA 2DA4A 5IYDJ 2R92J 2E2IJ 1X58A 2LKXA 2XPWA 1TWCJ 1IJWC 3S14J 1MH4A 3GBGA 3BR1A 2TRTA 3CQZJ 1TWGJ 3CDLA 3K7AJ 4MFEA 3OSGA 3GTGJ 1U9OA 5F27A 2O9LA 5C3EJ 1HF0A 2P81A 2E1OA 3B6AA 1HDDC 1XS9A 2HQ5A 5E3NA 3OIOA 5GPCA 3FIWA 1FEXA 1JT6A 3SFIA 4A3EJ 4DYCA 1Y1WJ 3A01B 2R5YA 3BR3A 3RZOJ 3S1MJ 1HOMA 3JRAA 4M3FA 1AU7A 1JKOC 2B63J 3RQIA 3JRHA 3L1PA 2CJJA 1JUSA 4IHVA 4A3FJ 3FKIJ 2HDDA 2CQQA 2QF7A 4ABZA 1QPIA 3I4NJ 1ZQ3P 1XC5A 3CCYA 2DN0A 4JX5A 3BT9A 2DTZA 3B6CA 2IAIA 1S7EA 4A3CJ 3RKQA 3S2DJ 2Y9YA 4NDLA 3C2BA 3JREA 3BTJA 3BTLA 1VI0A 4BY1J 2IEKA 2CUFA 1NTCA 2PMZN 2R93J 4HNVA 2DA1A 3I4MJ 4MFDA 4C3JJ 2GBYA 3G1LA 1Z0XA 1MBGA 1MBHA 4A3BJ 1G2HA 2LFBA 2ME0A 1K83J 1B8IB 1MBKA 2HOAA 1MBFA 2ZB9A 3JRDA 4QSHA 3RZDJ 3O8HA 5IOZA 1VFCA 1AHDP 3BG3A 2EBIA 2DA5A 2DMNA 3TW7A 1O4XA 1U8BA 3S16J 2DJNA 5JLWA 3PO2J 1TWAJ 2FJ1A 2Y2ZA 1TWFJ 2DA7A 2KDZA 1Y1VJ 2M8GX 4X1EA 1JT0A 2R5ZA 1MH3A 3S1RJ 2VKVA 1R9TJ 1JKRC 2E2HJ 1OFCX 4D7NA 2JJ7A 5IP6A 2R0QC 2G0EA 5IYCJ 1BA5A 1ZGWA 3D1NI 1IC8A 4GFBA 3Q0WA 1AKHB 1MSEC 5FKMA 1CQTA 2ID3A 2ID6A 1F43A 2AO9A 4B1RA 1NK3P 1ZKGA 3HOVJ 2NVXJ 2MGQA 2HI3A 2XB5A 5J1YA 3HOZJ 3M3YJ 3TEDA 5EEAA 3GTQJ 4A3GJ 4BKXA 2XGDA 5F1JA 3JRCA 1U9NA 2LP0A 4B3AA 1P7IA 2DMQA 3ZQIA 3GTOJ 4I6ZA 5DTDA 1VNDA 3ZQGA 1JUPA 1OJLA 3ZQHA 2ECBA 3S1NJ 1OCTC 1B8IA 2MG4A 3BQYA 5FJ8J 3TW6A 3H0GJ 3G1OA 3CMYA 4C3IJ 1FJLA 5M5XJ 1FTZA 1IGNA 4XRMA 3SDGA 1IDYA 1POGA 2JA5J 1SANA 4Y52J 3GTMJ 3HBLA 2NVYJ 3GTLJ 1ITYA 1JKQC 3SJMA 5FKKA 3ZQLA 4QIWN 1NK2P 4A3LJ 4J19A 2M2EA 3LOCA 3GTJJ 3S15J 2LK2A 2X6OA 2EZLA 3JRBA 2L9RA 3K2AA 3BR6A 4A69C 1DU6A 1ETOA 5EZGA 3MN2A 1H89C 4G12A 1I6HJ 1ETVA 1F36A 2LLKA 4UUSB 1ORKA 2LR8A 3QQAA 5DS9A 3IV5A 1I3QJ 4XK4A 2VI6A 5FKLA 3MKLA 5C44J 5GP9A 4A3MJ 4IHWA 4MO7A 4FTHA 4JX6A 2Y30A 4M3EA 1T33A 4D7MA 1YRNB 3TP3A 2L7ZA 3HKZN 2MW8A 2JA7J 1MBJA 3BQZA 2DA6A 2HXIA 2DMPA 2L7MP 5E3LA 3DEWA 5IOYA 1ETKA 2CQXA 3Q0VA 2DA3A 2FQ4A 4CYCB 5GPAA 4C2MJ 2YU9J 3LSGA 2ELKA 1I50J 3Q0UA 3ZOBA 4EEFG 5F0CA 2OPTA 5FLMJ 2QCOA 3OSFA 1LFUP 3W6VA 1TC3C 1GVDA 1JTXA 1LE8B 2JN6A 4FE4A 3A01A 1A6IA 1MSFC 1GUUA 3H3VK 4C3HJ 5J1RA 3DCFA 1UHSA 5JLXA 4JP0A 2WAQN 3HOWJ 1IV6A 2JMWA 5M3FJ 1U78A 2LD5A 3NAUA 4D5CA 1RKTA 4UUSA 1JUMA 2EZKA 4M3DA 2XSDC 2K40A 3BTIA 1B72B 3HOUJ 2XPUA 3HGYA 4JX4A 4DW6A 1RPWA 4FE7A 1X2NA 1SFOJ 2K9QA 3BR5A 3WHBA 2O8KA 1WCMJ 5F04A 2W48A 1BL0A 1QRYA 2JA6J 2NVQJ 2VKEA 1E3OC 2OF7A 2R5YB 9ANTA 4DYQA 2AHQA 2NVTJ 1YRNA 1P7JA 4IHXA 3LNQA 2DMUA 3HGGA 2WV1A 5F0FA 4XRSG 1GDTA 5F0HA 1ZTRA 3JRGA 5EG0B 4V2GA 2IBDA 1WPKA 5M3MJ 4DYRA 2FX0A 3GTKJ 1ETYA 2I10A 3F0CA 2X9DA 4FISA 5E3OA 3JRFA 1W0UA 2M9HA 2YS9A 2LVSA 2JK3A 3OOUA 2COBA 5EYRA 2R7ZJ 3PM1A 5FKOA 4MIMA 4BY7J 5IP7J 3O8GA 3JRIA 1EF4A 1MNMC 3S1QJ 1ETQA 5FLVA 1WI3A 2ME6A 1DU0A 3VPRA 2CRGA 4A3IJ 4A3DJ 1ZK8A 3IH3A 1GV5A 3GTPJ 1PUFB 2EZHA 3G1MA 2HXOA 3TP0A 2JWTA 5EGOB 1BJZA 2XGCA 1QVUA 2L0KA 1B72A 4A93J 4L5EA 1HLVA 1AKHA 3FK7A 3HEFA 1WH5A 3LSJA 1W0TA 1HDPA 2L7FP 3HDDA 2JA8J 3M4OJ 1FIAA 3QPSA 4JYKA 1UG2A 2GM4A 1BW6A 1Q1VA 2EQRA 4RBOA 3FISA 1A5JA 3HM5A 3Q3SA 1FTTA 1IDZA 2Y31A 2LTPA 3IH2A 1RR7A 4BBRJ 2R5ZB 1T56A 1VF9A 4M3GA 4XRSA 1UMQA 1MBEA 4MLOA 4XICA 4UUTA 1XG1A 1JJ6C 5M5WJ 2X48A 1QVTA 5J1UA 5EG0A 3LSPA 4LOCA 4XIDA 1APLC 1RESA 2H8RA 3NARA 5F08A 1RKWA 2KT0A 4IEJA 4AC0A 2NS7A 3HOXJ 1TWHJ 4W97A 5IPAA 1IRZA 3E7LA 4B4CA 3BTCA 2M0CA 4FCYA 4D5FA 2CU7A 2D5VA 5EDNA 1RETA 4M6VA 1HCRA 2N8GA 4AUXA 3HOYJ 5E3MA 3JR9A 1PUFA 2XGEA 3QPLA 2HYJA 1H88C 5EGOA 2VPRA 5FKNA 2DA2A 2ECCA 4BBSJ 1JJ8C 3BG5A 2VUMJ 3BR2A
chains in the Genus database with same CATH superfamily
3KZYA 4HW0A 1TTYA 5IP9J 3ZQCA 2RDPA 4RAZA 1VQOI 1MDMB 1OCPA 4M3BA 2F5FA 4PUSA 1HC8A 2ZSIB 3F8NA 4N0BA 3K69A 1YJNI 1IUFA 2HQNA 5LGNA 1F4KA 1HQCA 1MMAA 2MSYA 4EJVA 4EV0A 1Z77A 2OZUA 4W1UA 2PJRB 4RDUA 4NB5A 2WBMA 3I59A 3S17J 3K1NA 4B43A 5DYMA 3RSNA 4A3KJ 1JKPC 4J00A 3HRSA 4AYBN 3A02A 1WVRA 4KNYA 4Y7NJ 2HZTA 3GEZA 1KU9A 2GLOA 1GHCA 5FO5A 5BMZA 2X1CA 1X1CA 2F4OB 3LFKA 4CYCA 2M45A 3J81Z 3IUOA 4CCJA 4UVCA 2H1KA 2L5QA 3MVPA 2QYOA 2VJ4A 2Y0SN 3S2WA 2A05A 2M5WA 3AL0B 5J4VA 2E19A 4X6AJ 2UV1A 1GV2A 2CQ7A 2K9NA 1ON1A 2P6TA 3CCEI 1V55H 4EVIA 1IZ1A 2BY3A 4YIFA 2EINH 3DPLC 2E2IJ 3PNVA 3OYIA 5JFRA 1T8IA 4KFCA 5LHGA 1IJWC 3E5UA 3G71I 1YJWI 1LVKA 2CFOA 1AWCA 3CMMA 2KDOA 3OSGA 1U9OA 3WU2C 2PJRA 5C3EJ 2P81A 3E5XA 3VYUB 4DBRA 3FXRA 2UXNA 3OIOA 3RTRA 1SVLA 3FIWA 1VQ6I 1XSVA 3K4NA 4KDPA 4A6EA 2R5YA 3BR3A 2K02A 3PUFA 1J9IA 3SZTA 1OLTA 2VQHA 4M3FA 4UV8A 1AU7A 1JKOC 3VEPA 3JRHA 5JHFA 1K4SA 6PAXA 3V8JA 3BCAA 1Z7LA 5JHUA 3FKIJ 2HDDA 3RJPA 1W7PD 1Z67A 5LGUA 2QF7A 2HQAA 1UELB 1NG7A 2H09A 3HOTA 1XC5A 4GDFA 2A61A 2DTZA 2H94A 1VQLI 2EJRA 4WCGA 1ZAOA 1VQKI 4HQMA 4GCVA 4L9VA 3WTXC 4IOCF 2L4AA 4A3CJ 2Y9YA 4NDLA 5H20A 1XD7A 3PUBA 2FMLA 3JREA 3BTJA 1YOVB 4F52A 1VI0A 4BY1J 2IEKA 3QU3A 3LSMA 3H5RA 4HLXA 1YE9A 1YI2I 4A3BJ 1Z0XA 4IVNA 4DJAA 2ME0A 1K6OA 1B8IB 2MFZA 3HL2A 3MEXA 1MBFA 2ZB9A 3ROUA 1QGPA 2DYRH 1FMWA 3CO7C 3JRDA 4PZJA 2CQNA 3I3LA 2AXTC 1Z3XA 3ZRGA 3RZDJ 1VQ7I 1BM9A 2HYFA 2OD5A 3EDPA 3ASOH 5GAEJ 3L2RA 2XVCA 4KN4X 3BG3A 2DO7A 3TW7A 5E20A 2G7UA 4OIRF 4H4KC 2Y75A 2XASA 1C0WA 1TWAJ 3FXUA 4Y4RA 3S8PA 2Y2ZA 4ZYAA 1W36C 1TWFJ 4O3MA 4A0ZA 3EUKL 2DODA 1JT0A 3ZXSA 4BU2A 5J47A 2FOWA 3O3KA 1G6NA 2VKVA 3MZYA 3AG2H 4I02A 1FP2A 2NNYA 2E2HJ 1P4XA 3Q9SA 4BHPA 3H3ZA 4D7NA 1G3WA 1ZN2A 1ODDA 1R22A 2G0EA 2XKOA 2VXDA 2ZMEC 2CO5A 3SDBA 3OS1A 3I71A 2KLOA 2PFBA 3UNGC 2XAFA 3TOAA 4PK4A 4U0WA 1LEBA 1TW2A 1ULYA 4ANJA 1R5GA 2NVXJ 4UXNA 2LBFA 2MGQA 2M87A 2V6EA 2XSJC 3LSIA 3M3YJ 3OYCA 1DPRA 2KFDA 3C7JA 3P9CA 2FMYA 4BKXA 5F1JA 3S93A 3HXLA 3RYPA 3P5JA 1KQ0A 2VB6A 3L2VA 5FROA 3ZQGA 5HNHA 3ZQHA 3BG7A 5CVRA 2ECBA 3IAS2 2HGCA 1B8IA 1RZ4A 2Z2SB 3J80K 5DCMB 2X1DA 1QBJA 1U3EM 2RKHA 3G1OA 3CC4I 4HF0A 4CXFA 2BY0A 5M5XJ 1FTZA 4MNUA 3TBIA 4BJ5C 1IDYA 3LQRA 2FUG2 1EJ9A 1ZGAA 4BJ6C 4HV6A 2VBXA 1FWZA 5EJCA 3DU5A 3N05A 4UNOA 4FETA 3KEQA 5HVQC 1JKQC 1QHHD 5FKKA 1NH3A 2CUJA 2I5UA 2WAQA 4ZZLA 3GYHX 4E7JA 2MD5A 3GTJJ 4Z2YA 1WJCA 1RUOA 4J01A 2LK2A 4PFOA 1DQUA 2EZLA 2ZXJA 2XROA 3CF5F 4XMYA 4U0VA 1ETVA 1SMTA 2LLKA 3LA7A 5J4YA 4UUSB 1RRJA 1ORKA 5HDGA 3QQAA 2O3FA 3M8FA 1T98A 2HNHA 3CC2I 2QQ9A 2VI6A 2Z99A 4UB6C 3EUHA 3PL8A 5GP9A 1FSHA 2QBYB 4YELA 5DD4A 2NXNB 2E7XA 3TKYA 1G3YA 3DKYA 3WGHA 2COMA 2EV0A 2Y30A 3TDUC 3AAFA 1V5EA 1S9HA 1MMNA 2IXSA 2V1DA 1YRNB 2ADUA 4RB3C 3TP3A 2L7ZA 1JE8A 3T0YA 2CQKA 3HKZN 2MW8A 2F5DA 1V5FA 3K4KA 2DA6A 2LF7A 1BI1A 2DMPA 2L7MP 4WX9A 2CQXA 3E5QA 2DA3A 3CCSI 5H2FC 1KQ8A 2IS6A 3MKZA 2Z33A 4YFXF 2P5VA 3QU6A 3CO6C 2ELKA 4YFNF 4EEFG 5F0CA 2OPTA 3TQNA 2DU9A 2PX9A 3K6GA 5LEJA 3VODA 4C9YA 4XLPF 1XDUA 1BR4A 1GVDA 5E1WA 2HPMA 1S8NA 4WF2A 1LE8B 2JVGA 3U21A 2VOOA 3H3VK 1O3TA 1ZRDA 4C3HJ 1FP1D 3DCFA 1Q1HA 2ZJRF 4JP0A 4AIJA 2X6WA 3HOWJ 2VN2A 3OYGA 4XOTA 4QPQA 2VKDA 2LD5A 4EGZA 4UUSA 1ZARA 4LGWA 1JUMA 2NVUB 4U7DA 2XSDC 2P5LC 1T6SA 1BBYA 2EILH 3FKJA 3M1CA 3IL2A 2XPUA 2P4WA 2UZKA 3CMEI 4AVZA 2R3SA 1RPWA 5GAHJ 1IRXA 4P5OA 1ERDA 3VB2A 4OAYA 1FYKA 2O6GE 5ED4A 4IF4A 2NVQJ 3AG1H 2Q8KA 2X51A 4RB2C 9ANTA 2AHQA 2TDXA 1JHHA 1YRNA 1P7JA 4ZYGA 2DMUA 5K5OA 4KN7X 5F0FA 3D5RC 3BWGA 1GDTA 1ZTRA 2LH9A 4F92B 3TDZC 3M8JA 5EG0B 4V2GA 4XRFA 1SFKA 2IBDA 4E7IA 3WTSC 4AVPA 3JAMZ 1O3QA 3GZ5A 3GWZA 3GTKJ 1PJRA 3F0CA 2X9DA 3NWTA 5E3OA 4ZYDA 1W0UA 1H9TA 2M7AA 1ZLJA 2K86A 2LVSA 2YSRA 4MTEA 2JK3A 4E7KA 2COBA 5EYRA 3SFZA 5K5QA 2R7ZJ 1TQMA 4S04A 3PQJA 2XIGA 3BDDA 3K9TA 1MNMC 1EF4A 2PBIA 4I0BA 4U7BA 1R71A 4AD9A 1R1TA 4XKBA 1O3RA 4XR6A 1OPCA 3GZNB 3CDHA 4RGRA 2IA0A 3G1MA 4KJZA 1FPQA 3R61A 4HNUA 4EGYA 2C6YA 1BJZA 2ZJPF 4N4OB 1OQYA 2L0KA 2ZMEB 1MNEA 4G9YA 4BYYA 4DGWB 1IW7F 2FNPA 2WC2A 3ABLH 4B09A 2IA2A 3ZQQA 1XCBA 4UUVA 1DPUA 3ABTA 2OTJI 1HDPA 3M4OJ 2HWVA 1FIAA 2QLZA 2VJ5A 1UG2A 2GM4A 1L3LA 4RBOA 3Q3SA 1FTTA 2PG4A 1WJDA 3IH2A 4B44A 5B3SH 4G8XA 2WB1A 2DYSH 1VF9A 2BEOA 4M3GA 2V9KA 5A2QK 3LA3A 4BUPA 1JJ6C 5M5WJ 2I8DA 2X48A 1OKRA 2AQFA 3IP4B 5EG0A 3CC7I 2D1VA 1APLC 3HG9A 5TISC 1R36A 2HKOA 2KT0A 3BZCA 3I4PA 1LDJA 1BIAA 3AKZA 3H1CA 3VFZA 5B1AH 3GXOA 4RB1A 3AFHA 3DEEA 4IOAF 3BPVA 4AIDA 4M9XA 3KEYA 2DK8A 3EPZA 3IRRA 1WJBA 4QLCU 5LHHA 2K3FA 3OOPA 3CTAA 2LSOA 2M0CA 1KZHA 3IRQA 4FCYA 2CU7A 3U2RA 1PP7U 2EPFA 1WSUA 2RV8A 2CW8A 1ZG5A 5E3MA 5FLXZ 4XLHA 4C2TA 2EV5A 2FE3A 2VPRA 5FKNA 3F21A 1RIOH 2P6SA 4XNFA 2H27A 2LOOA 3KE2A 1ZRFA 2ZMEA 2K4JA 2VUMJ 3C3WA 4GRIA 4PJNA 2RAEA 3RPUA 5K1YA 4QTRA 2BY2A 2DFFA 3E0JB 4PJJA 1FIPA 3LSRA 2BBYA 3VWBA 1JGGA 4P55A 3UKGA 2QKMB 1WH7A 1B6AA 3BG9A 5GTIC 3P9IA 2CS3A 3L2WA 2XAJA 2P7CB 4I7HA 2QA4I 2E5NA 2M8EA 1X2MA 2BW3B 2V1UA 1JTYA 2LMDA 5M5YJ 3ZGKA 1MMDA 2EFOA 3BR0A 3FXMA 5J3LA 3DPUA 2LKPA 3HPHA 5DV5A 5KVRA 2WA0A 5TRDA 2YUSA 4V2FA 4F3QA 2ZSHB 1HKTA 2RREA 4XN3A 5ERIA 2HOSA 4HQEA 2M34A 1VTNC 3K0LA 1ETXA 1GT0C 2EZIA 4BNCA 2K9SA 4XSZF 5IYBJ 3JSOA 2CH0A 1WQ2A 2IVMA 5DUIA 2NS8A 2PMZA 3K1PA 3H3UA 5F1RA 1QZZA 4G6TB 5HLIA 3U1DA 4ESFA 1WJAA 2A6EF 2V7FA 2IS2A 4Y15A 3GLXA 2L3DA 3COAC 2QGUA 3HSFA 3WHCA 1V4RA 2KQRA 1K61A 1H8AC 2JSCA 1YX5A 4LB5A 2OA4A 1IUYA 5K7HA 2DA4A 3JTGA 4K2EA 4BACA 1X58A 2QM3A 2LKXA 3D0SA 3RDIA 1P92A 3S14J 2J5OA 1MH4A 4LLNA 5CVVA 3GBGA 3CQZJ 1PDNC 4BDZA 3K7AJ 4HX8A 5HLGA 2AQEA 4IXAA 3FX3A 3B6AA 3NEUA 1HDDC 1YLFA 2IGKA 4OMYA 5GPCA 1YFHA 2BE5F 1K79A 1FEXA 3IKTA 4DYCA 1IXSB 4EJTA 3SZPA 1SVOA 3PSFA 3S1MJ 3LWFA 1HOMA 2DAOA 1KONA 1T2KA 1DDNA 2B63J 2KZVA 3L1PA 3ISPA 2PLYA 1USTA 2WY8Q 1X1DA 2CJJA 1JUSA 2KIFA 4IHVA 1ZG3A 5E18F 4UVBA 2HTJA 1YW9A 4WWCA 3AG4H 2FNAA 2M4GA 3I4NJ 5CVUA 1ZQ3P 4IRHA 3DLLF 2QKLB 3ZN0A 2LY2A 3ZMUA 2DN0A 4E70A 2BVLA 5LD2C 2AXLA 3DTIA 4LB6B 2GOXB 2FBIA 4L9JA 1R1UA 2JRTA 3I54A 3GF2A 4PCQA 5ICGA 2QUFA 3BTLA 5EEHA 1BOAA 1TL8A 4ZDOA 2R7UA 1W5SA 1WKMA 3CMAI 2CV1A 2HVSA 2X6XA 4OOIA 2DI3A 5HS9A 5HS8A 2DA1A 3REOA 3I4MJ 2LFBA 5BS6A 4X0GA 2IS1A 4RS8A 1K83J 1LPQA 3H9GA 3F8FA 2A6TA 4IQJA 5LEKA 1JI8A 3N4MA 1GXQA 3DEUA 1R49A 1T38A 2M0MA 4YRVA 2R7TA 2EBIA 2FA5A 2DMNA 2GIVA 1O4XA 1YG2A 1U8BA 3S16J 2DJNA 2FJ1A 3ZR8X 3HZJA 4O5VA 5HNFA 5D5UB 4D1QA 1H0MA 3QAHA 2M8GX 4X1EA 1UFMA 4II2A 2DFHA 5DD8A 1R9TJ 1FNNA 2MC4A 2MC3A 5JI6A 3ELKA 2PMUA 1OFCX 2QENA 3F3XA 3LFUA 4BE1A 5IP6A 3KYLA 4V19K 2EIKH 3IKVA 5IYCJ 1BA5A 2F6CA 3KFWX 3F6OA 3D1NI 1KQ9A 2JUGA 1MMGA 4GFBA 4IL6C 1AKHB 2MLGA 2A3SA 3R6SA 5FKMA 1MSEC 4PFPA 2MBFA 1LUJB 2XF6A 1LKXA 2AO9A 4B1RA 2XAGA 3CDIA 1ZKGA 2F4MB 4MHGA 3GVAA 3HOVJ 1RC9A 2IS4A 5J1YA 2QZ8A 4P9UA 1UG0A 3TEDA 5EEAA 3PNYA 2R7SA 2CYYA 2JPCA 2XGDA 3LQQA 1ONVA 1U9NA 3FMRA 1P7IA 2FSWA 3ZQIA 4LK1F 4UHTA 3GTOJ 4I6ZA 3E97A 3ERMA 1VNDA 4LG3A 2IA1A 1JUPA 2DQLA 1WHUA 3S1NJ 1OCTC 2R7RA 2KKOA 2MG4A 4CUGA 3FDYA 2M3AA 3FM5A 4OMZA 3OYDA 2FBHA 2P0WA 1IRGA 1D1CA 2B0LA 3KP2A 4LG0B 4P9FA 2VC1A 4RAGA 1MDMA 3FWEA 1W7PB 4G7OF 1BC7C 1P2FA 1IGNA 4XRMA 1V5GA 3CJRB 4RM3A 1POGA 2JA5J 1SANA 2UUZA 3F8MA 3M9AA 4HG2A 1OYWA 1FBUA 3ZQLA 3TOBA 3O6BB 3KIOA 4BAYA 1SFXA 5CJ9A 5FFZA 1FT9A 3MCZA 1JHFA 2HDWA 4CICA 3OYNA 3JRBA 1YHQI 1DU6A 4L9TA 4HSRA 4L18B 5EZGA 4G12A 2CGPA 1F36A 3IWFA 5CVJA 3DKWA 4ZDPA 3WTZA 4XLCA 2BXYA 4BEHB 1I3QJ 1VZ0A 2GWRA 1QQIA 1FMVA 3FXQA 3S3MA 5C44J 2EB7A 2EIMH 2HS5A 2F5CA 4D9JA 1YS7A 1CGPA 4FTHA 2HVRA 2X85A 3J7ZI 4PJLA 4HV5A 2D2WA 1TNTA 3C2HA 4M3EA 2CG4A 2V9VA 3G2BA 1T08B 3WTUC 3ERED 3CZ6A 3M07A 4MEXF 3D5SC 4YEJA 3K4MA 4A2UA 3ABKH 4G7ZF 3TO9A 1YIOA 3KETA 5IOYA 1SVMA 1VQNI 1IO2A 1HW1A 3WG9A 1W7PA 5B66C 2HEOA 1BJAA 2GXGA 2VODA 3QYEA 4CYDA 2YU9J 2ZFWA 3CP8A 4NBQA 5E1ZB 3SQNA 1I50J 3OYFA 5FLMJ 3QWLA 2QCOA 1LFUP 2DDBA 2A6HF 4EQQA 1K7AA 3ZCOA 2PMHA 5AIPA 1FY7A 1TC3C 3GFMA 3ZMTA 3IWZA 3H5AA 1GUUA 3KP6A 3LAPA 4I98B 2RQQA 5J1RA 4EATA 1YX3A 5CVIA 5JLXA 1BR1A 2DPUA 3ZMSA 1IV6A 1RKTA 1LDKB 2K40A 1D8JA 3PQKA 2CMPA 4BEHA 3C2GA 1J59A 1R7JA 3FHNA 4JX4A 4DW6A 5E17F 1TT0A 4FE7A 1Y56A 1M1EB 4EJOA 1SFOJ 2K9QA 5BQTA 2YR2A 3KYDB 3WHBA 1K78B 2DT7B 2HPIA 3E6MA 2P8TA 3V4GA 2O8KA 2VL8A 3TMOA 3DU6A 4I09A 3GZ6A 2CV0A 1E3OC 3U9GA 3Q5FA 2OF7A 3HTUA 1I5ZA 2CW7A 4YIIA 3DF8A 3L9FA 1Z7UA 1LNWA 2WV1A 3CUQB 1LFPA 1PP8F 2Z9OA 4XKCA 1REPC 4XL9A 1WPKA 2XV4S 4RGSA 1Z6TA 2DBBA 3L00A 1XDSA 1D0ZA 2B7EA 4AIKA 1Z3YA 3E6BA 3V8KA 3FBNB 3I53A 1Y6IA 4BY7J 3O8GA 2QQ8A 3H0DA 4RGUA 5FLVA 2L54A 1W5TA 2HFHA 3VPRA 2CRGA 2WAEA 4RA2A 4A3IJ 1DUXC 1P4WA 3KZIC 2ZC2A 3X2QH 2HXOA 3ABUA 2KJBA 2Z16A 1G3SA 2JWTA 5EGOB 4OINF 1E0EA 4OU0A 3F8BA 2R7DA 2L2OA 2W25A 4ZC3A 1HLVA 3HEFA 1WH5A 5JR3A 3FXOA 2DLLA 3J7YJ 3HDDA 3QPHA 2DJIA 1QPMA 3FXJA 3ZP5A 2JA8J 1XMAA 2HVQA 2L9NA 1HXDA 3OV8A 2QSGX 1Q1VA 1GVJA 2GOMA 1AA7A 3A2KA 2VONA 2GXBA 1RR7A 3M7GA 4AYBA 2R5ZB 1UMQA 3HHHA 1SMYF 1MBEA 3CUQA 4MLOA 4XICA 3DXJF 4IJAA 4PJ0C 2K5CA 2KRCA 4CDGA 1YJ9I 1S3JA 5J1UA 2MLKA 4LOCA 4XIDA 3LSPA 1RESA 2H8RA 2IW5A 2JVHA 2RNJA 3NARA 5F08A 4XLNF 3GFIA 3E3VA 5IT3A 1ZREA 3I9V2 1SD7A 5DCMA 1OCOH 3DV8A 2RC4A 1HSJA 3HOXJ 2ESHA 3OL4A 2NNNA 5IPAA 2EA4A 3E7LA 4B4CA 2XC7A 1R58A 5TGTA 3H9QA 3NQOA 4DIQA 4EM2A 5D5XB 1EA3A 4WXHA 3T1BA 2HU9A 2DTRA 2N8GA 1I39A 1UAAA 2XGEA 3QPLA 3KP4A 1X1AA 2W85A 5EGOA 2J5PA 2EWNA 2WWYA 3PFIA 4BE0A 3ABMH 4BBSJ 2E5ZA 4E7LA 2O61A 3BC8A 3IH4A 3J81K 2KRFA 2XF7A 5ICCA 3MMYB 5EZHA 1YW8A 2PEXA 4DOZA 4PGGA 1WGXA 4Z6YA 2Y9ZA 1ETWA 2IP2A 3A03A 4R1HA 4A5MA 3QRFF 4DQ2A 1QA6A 2QBYA 2XAQA 3GFLA 3WGGA 1KA8A 4CCNA 5L3DA 3CCQI 4A3JJ 1ENHA 2DK5A 4BXXJ 4ZYEA 3DBHB 5K7ZA 3R0JA 3BOQA 5K7FA 3JW4A 3HB9A 3G4SI 3KX2A 3OYBA 3EUAA 4KMUX 1FZPB 4E7HA 4IHYA 2K9MA 2IRFG 3OIQA 4UV9A 3RIRA 2Z1DA 2TCTA 2YX4A 2E1NA 1ZR2A 3BY6A 2NOGA 3VYSB 1IN8A 2VC0A 2MYSA 2X0LA 2O7OA 1XX5A 2XRLA 4BHCA 4MEYF 4ENMA 1LFBA 2BYVE 3CUOA 3DQVC 1IV8A 4S0HB 5L3EA 1D5YA 1IG7A 4HX7A 2R7XA 1XGSA 3PIPF 1BIBA 2ZNZA 5HODA 2Z5UA 3MZ8A 2XB0X 5EF6A 2ZBKA 2CUEA 3BZKA 3P9KA 1LE8A 1BW5A 2FD5A 4Q4ZF 1LDDA 3F22A 2WY7Q 4LFUA 1Z9CA 2LRDA 3LSTA 3OL3A 2L9VA 1TWCJ 2HKXA 2HDCA 3OYMA 1U6GA 1QHGA 3TL4X 3BR1A 2TRTA 1SFEA 2L02A 3CDLA 4NHJA 4O6JA 3DWLE 3GTGJ 4BQAA 3PFYA 2EFQA 2MH2A 2O9LA 3I64A 1HF0A 2E1OA 5H6QA 5J8CA 2ELJA 1JT6A 1Y8QB 4LLGF 3SFIA 1XTAA 4II3A 4A3EJ 3A01B 1Y0UA 4TV7A 1OYIA 2JT1A 4RB0A 4YG2F 3RZOJ 4KUMA 3JRAA 2R7WA 5EEGA 5AIQA 2H8WA 2DXIA 2QQAA 3EYIA 2RGVA 1W4MA 4RAYA 3ASNH 1X4PA 4I99C 1KYZA 2L9SA 1XB4A 1W1WE 2A68F 3CCYA 1D0YA 2ZO4A 3BT9A 4GYIA 3B6CA 3GCMA 1XGNA 3BJOA 1MIJA 1MJAA 2V1NA 4B3XA 2Z3YA 1S72I 3R0AA 1RUNA 5FD6A 3RKQA 2LG4A 4NQWB 3C2BA 2XHKA 2XKPA 2XDVA 4CZZA 4LK0F 2CUFA 1XGMA 2VKHA 2FBKA 2R93J 4IPAA 2VQLA 3W2WA 4HNVA 4IZZA 4H0EA 5IT9Z 4C2UA 4MFDA 3FXKA 3IAM2 4C3JJ 1W5CC 2CUZA 2GBYA 3G1LA 1U0JA 3RKYA 1G2HA 2KISA 4XLFA 5LLQA 4BQNA 2HOAA 4KIFA 3I58A 2VE8A 4QSHA 3C18A 3A0BC 3O8HA 3OYEA 3QOPA 3K4JA 3ECOA 2W57A 3ECHA 4M9SA 4BXFA 3I56I 5J6XA 2ISYA 1U5TB 1X1BA 1AHDP 4ENNA 2DA5A 1UZCA 2XF5A 5JLWA 3PIOF 2KZGA 4ZYHA 1DGWY 3M8EA 3DPTA 2KDZA 1Y1VJ 3LAJA 1HKSA 2JA2A 4PGHA 4XSXF 1MH3A 1OCCH 3MFKA 3CCRI 1Y39A 4Y13A 2PJPA 1Z1DA 2PN6A 5FB2A 1JKRC 1IN5A 2W1OA 1FLIA 2BZTA 3F72A 5CQEA 3CLQA 2R0QC 2ISZA 3S32A 1ZGWA 4HYEA 3SXYA 4E6KG 1IC8A 3QP5A 3Q0WA 1TBXA 5E79C 2LYCA 3IC7A 3F9KA 4KISA 2ID6A 3GO5A 2GZWA 3S3NA 3DP7A 4KICA 3DKXA 2HI3A 4GXOA 4BE2A 1B9NA 4NQWA 2XGXA 3GTQJ 4A3GJ 5J8FA 1XSXA 1T0FA 3JRCA 4B3AA 3K70D 3HKZA 5HOOA 2DMQA 3R4KA 4KIBA 2R7FA 3OYKA 5DTDA 4AU7A 1BI2A 1MD0A 5H6RA 4BH9A 1QU3A 3GW2A 3RCOA 4B8XA 1IAWA 3BLYA 1WZ2A 1WJ5A 5TJJA 2M30A 2OBPA 2NOJB 3BG6A 4MTDA 4KA4A 3BQYA 2CV2A 5FJ8J 2OAZA 1X1PA 1O7LA 3H5NA 3JCUC 1J7KA 5HDKA 4CH7A 1VQ4I 1U5TA 2EFPA 3OS0A 3SDGA 2XAHA 2Q0OA 1IF1A 3JSPA 4CCOA 4OIOF 4Y52J 3GTMJ 2UWMA 2V9PA 1R00A 3E6CC 4HF2A 3GTLJ 2OCCH 1J09A 1ITYA 2A07F 3OWTA 2JRMA 1QZYA 1ZLKA 4QIWN 3RI4A 3L2UA 1K6YA 3MAJA 1J2XA 4A3LJ 2LDUA 4J19A 2M2EA 3A0HC 3S15J 2BW3A 2X6OA 1U8RA 1I6XA 2DT5A 3BCBA 3TGNA 4HBLA 1XGOA 1RR8C 1YS6A 3W6JB 3K4CA 1X3ZB 1G59A 1H89C 3MN2A 1I6HJ 2X1EA 4LIVA 4OWRB 3EETA 3J80Z 2LR8A 5L3FA 2IGNA 3H35A 1A6QA 1HW2A 4AIHA 5DS9A 3IV5A 1CF7B 3CJNA 3F6VA 5FKLA 1ZG1A 1E2XA 1E3HA 1R5ID 4L9NA 4A3MJ 4IHWA 2ZXWH 4MO7A 4KT6A 3I59B 5ILVA 4JX6A 3SYTA 3E1SA 2D1HA 1D8KA 4F55A 3H92A 4RLQA 1F5TA 4BL0B 4LLLA 1QZEA 1T33A 2YPRA 4BHBA 4OIPF 4S05A 5FFXA 1WJFA 4KIGA 3P7NA 2V6CA 5FRNA 4NUBA 3CUQC 3BQZA 3E6DA 5DM6F 4CGZA 1X19A 5E3LA 5DEQA 3Q0VA 4QWQA 1OR7C 4F93B 4CYCB 3VOEA 3KP5A 4PSWA 3U1KA 5E8IA 4C2MJ 1ZYRF 3LSGA 2VBWA 3HPGA 3Q0UA 3ZOBA 2R4GA 1MZBA 1XMXA 1S29A 5DUKA 1Y0NA 1PYVA 4PSXA 4ON0A 3FM3A 4ENJA 1ZELA 2HR3A 1JTXA 2JN6A 2ZXHA 2LF8A 1FYMA 1MSFC 1LVAA 1V54H 2WAQN 1P6RA 3JAMK 5M3FJ 1U78A 4I2OA 3B02A 3T5XA 4D5CA 2OV7A 4M3DA 3BTIA 1BN5A 1S7AA 2MH9A 1CF7A 3HGYA 2DOAA 3W2AA 2JQ7A 2IT0A 5BOXA 3OY9A 4CHUA 1RNLA 1B4AA 4ZZDA 1X2NA 3HSRA 5LRRA 1BC8C 2W24A 4UY8I 3BR5A 5LHIA 2LKSA 2O8XA 3GFJA 1MJBA 1WCMJ 5F04A 2W48A 1SAUA 2P5KA 2Y69H 2JPBA 5HLTA 1I1SA 3F8CA 1KU2A 2VKEA 3CCVI 3T8RA 2BOLA 4EMSA 4CCKA 2R5YB 2G7HA 4DYQA 2NVTJ 5KAFC 3LNQA 2HTSA 3HGGA 4BGDA 3Q9VA 1D3YA 4XRSG 4NC6A 3VSLA 5F0HA 3BROA 1R23A 4U87A 1S6LA 5CPRB 2VT3A 3W2VA 1VQ9I 4I0AA 4DYRA 2FX0A 2E71A 4LMYA 2IJLA 2I10A 3ZMVA 4FISA 4CZCA 1A35A 2YS9A 2QWWA 4HEA2 1G3TA 3I55I 3PM1A 4XOPA 5FKOA 2EIJH 1R5HA 1ETQA 3WTYC 2ME6A 4WXCA 2VJIA 3MQ0A 1AOYA 3A1YA 3HTSB 1OCRH 3TO7A 3IH3A 4QPOA 2EZHA 3QYBA 4PDKA 2VIXA 3FMSA 2XGCA 3V8LA 2X6YA 4HF1A 4WK8F 4ESBA 1UCRA 2V79A 3OYLA 2E34A 4L5EA 4ENKA 1AKHA 2LC2A 3FK7A 3LSJA 1WFXA 1BR2A 3BP8A 4Y3OA 3J7AO 4G6DA 4U88A 2W84A 2KP6A 4JYKA 1BW6A 2VJJA 3RKWA 2GQQA 5DDGA 1GXPA 3FISA 1A5JA 3ZPLA 2QSHX 1IDZA 2FRHA 2LTPA 3MKYB 5FLXK 5IT9K 4Y17A 3RKXA 1KYWA 2K85A 1T56A 3ESWB 4ZJZA 5ILSA 1XMKA 4UUTA 5KK1A 4CCMA 1QVTA 3HHGA 3GLLA 1WJEA 3VSKA 5FGMA 2UXXA 1FBSA 4HAMA 1RKWA 2K7LA 2E7WA 2BY1A 3CCJI 3FZVA 4B48A 2XRNA 2W7NA 3BZ6A 4LG0A 4ASNA 1IXRC 1F1ZA 2NS7A 1QO0D 1TWHJ 2K9LA 2NS0A 4W97A 2K3PA 1BI3A 4ZH4F 1L0OC 1MGTA 1STZA 3BJ6A 3FBIB 4FT8A 5E1XA 2LBFB 1TQPA 4D5FA 4U0YA 4Q5SF 2D5VA 3ULQB 3QYFA 1RETA 2MABA 2RNGA 1SD5A 2STTA 4G7HF 1MW7A 1OMIA 4YIRX 4HDVA 4AUXA 1EH8A 5B5EC 4RGXA 3JR9A 2NRAC 3DTKA 3JTHA 5L3CA 3K2ZA 4D0PA 2QEXI 4HOBA 4L0ZB 3J7AY 1D5VA 5A2QZ 3I5UA 4LD5A 2G9WA 1N25A 1J75A 1KU7A 2DA2A 1JJ8C 1FSEA 1SD4A 1KU3A 3BR2A 5K5RA 3H9JA 4IRGA 4OIQF 1NG6A 1R6RA 5C4XJ 3CCUI 2XPVA 3S2HJ 4IX7A 2O03A 4G94A 4HZFA 5JVTA 5LGTA 5KCMA 2VASA 2L01A 3PSIA 5HLHA 4KYWA 2LNBA 1FOYA 4BXUA 5L3BA 5LBQA 2RN7A 1FOXA 4R8HA 2K4BA 4UB8C 4P1WA 2E35A 3PO3J 4Q47A 2WADA 3HRUA 1EH7A 5BNGA 3FXLA 2BGCA 4M73A 5D6FA 2O5RA 4KITB 3KEOA 2O0YA 2WB1N 2JTVA 3EYYA 5C4JJ 2OJED 1SFUA 1OYYA 1EH6A 3ZMDA 1DGRM 3V7SA 2DMTA 4CCLA 1R1VA 2W4SA 3K1MA 1VQ8I 1Z91A 4HPQA 2HOTA 1ZR4A 2BVMA 3G6EI 3K4LA 4NC8A 1ZRCA 2OQGA 3LA2A 4DZJA 3HRMA 2IGMA 5CYVA 4GYGA 2STWA 2LY9A 4I76A 1S7OA 3ZQFA 2ZJQF 3SEZA 2KIUA 3KLOA 3HIFA 2QSFX 2DQRA 1FX7A 2F4IA 2F5EA 3LMMA 2ICWG 4F91B 2EH3A 3FK6A 1WI9A 2E2JJ 2ZJ2A 3WGIA 1T0FC 2CWEA 3HUGB 4DZPA 2A5YB 2ELHA 3SEQA 4AM3A 2R92J 5IYDJ 3GMEA 3DBRB 4HRIA 2OC6A 5D5VB 2EFNA 2VBYA 2XPWA 1FOKA 2KIQA 1OCZH 1XSDA 3C1DA 2ETHA 1FBQA 1LB2A 1TWGJ 2DFIA 1NHAA 3VYRB 4MFEA 3EQLF 5F27A 1J0RA 4L0YB 3HRTA 1T39A 1ZH5A 3WTVC 1K78A 1YTYA 2OZ6A 1U5TC 1MKMA 4FX0A 1XS9A 2HQ5A 5E3NA 1YQAA 2LREA 5GTHC 1O57A 4HX4A 3HYIA 1YIJI 3CJQB 3W6KB 1D1BA 3WE2A 1Y1WJ 4HA8A 4OAZA 1FYLA 3KLNA 3K70C 3PNTA 3RQIA 1YYVA 4M9ZA 2M4KA 2VQGA 2XAUA 5FD5A 3RQ4A 1VQMI 1A31A 4A3FJ 1TQIA 1OR7A 3CESA 3IHUA 3QODA 2CQQA 3CF2A 4ABZA 4BQQA 1N77A 1LQ1A 1J5YA 3WE3A 1QPIA 1X3WB 2ZXIA 2NAZA 4M6XA 3V7CA 2KRHA 1IN6A 3KPHA 4JX5A 2JSPA 5KHDA 2E1MC 2Y0SA 3CD6I 2IAIA 3WG7H 1S7EA 2OTLI 4ZDLA 3WTWC 2BV6A 3MZHA 4LIUA 3S2DJ 4C30A 4XQFA 2VQCA 4MGRA 2DW4A 3K10A 1NTCA 2PMZN 3HUGA 5LRSA 1WWXA 3CP2A 1MBGA 1MBHA 4KT5C 3WU0A 1U2WA 2K27A 2KHMA 1MBKA 2F2EA 3W3CA 4IQ4A 2DOEA 2B9SA 5IOZA 3HOSA 1TLHB 2FQ3A 1VFCA 2BHZA 2R7VA 4ETSA 2H6BA 1IN4A 1EV7A 4P96A 4M72A 4RAFA 1TNSA 3PO2J 1O7FA 2GA2A 2V1XA 4RMNA 4XORA 4DNCA 5D4RA 1MJ9A 1DP3A 2LY1A 2ZNYA 2DA7A 3CCMI 2RVCA 2R5ZA 5KNLA 1Z21A 4BJTA 3S1RJ 1SAXA 2V4JC 1D0XA 1QNTA 2R7OA 3KCCA 2ZKZA 1MNDA 4XONA 2DDAA 2JJ7A 2RQPA 2PI0A 2OQRA 2E1CA 1P9QC 1IXCA 2H6CA 3O2PE 1ZGJA 2F48A 1CQTA 2ID3A 3ZN1A 1F43A 5BPIA 1NK3P 3OYAA 4JQFA 4A6DA 1B9MA 1IRFA 1G8XA 2XB5A 3MKWB 3HOZJ 3A4CA 5ICFA 3T8TA 2L7KA 3LL7A 1PUEE 2X4HA 1GLNA 2NYXA 2LP0A 3I0TA 1BI0A 2HYGD 1OJLA 2PQ8A 2V26A 3KYCB 3R60A 2A5WA 5KAIC 4E7ZA 2IGOA 2DT6A 3OYHA 3HJEA 3CCLI 2XUBA 1ACIA 4FHTA 4BS9A 4E4HA 2CW0F 3TW6A 3ZQ7A 2OUMA 3H0GJ 3CMYA 1XN7A 4C3IJ 1FJLA 2FEZA 2OU2A 4XM3A 1G4DA 2Y48A 3SZGA 1LEAA 5D6EA 2BXZA 2JUCA 3QP6A 3HBLA 4RM2A 2NVYJ 1X3UA 2GAUA 3K4BA 3SJMA 2GXAA 4LITA 1JXSA 2M7BA 1NK2P 3FHZA 4IHSA 4FASD 3LOCA 4NNJA 4L5IA 1Z6RA 3G3ZA 3VYTB 4CSWA 1I27A 3CJTB 4GGGA 2L9RA 3K2AA 3BR6A 1E3PA 4A69C 2EV6A 1ETOA 3OYJA 2WV0A 4A5NA 2GA1A 2CSOA 3DBLB 1FOWA 1A04A 3L09A 4JK1X 4XK4A 1I1GA 3L7WA 3WODF 3MKLA 1UHWA 4XLAA 1W36D 2YU3A 5DCFA 3KZZA 1H9GA 4A0XA 4MQ9F 2VLAA 2YX7A 1E17A 1HA8A 5CLSA 4KMFA 3DTEA 5D5WB 2VE9A 1XCVA 5L3GA 3FF5A 2WTEA 3VDXA 4HSTA 2KMUA 4AWXB 4D7MA 4MQVA 2VOPA 4HLYA 1HKQA 2ZFUA 3V7RA 3DFGA 5AONA 5LFAA 2JA7J 1MBJA 3B73A 5D8KB 2VXZA 4RLFA 4Q48A 1RI7A 2HXIA 3DEWA 4N9IA 1ETKA 4LJZF 3RPUD 1HBXG 4GO1A 1YW7A 2E36A 2FQ4A 4G6QA 1I3AA 2KJCA 5GPAA 4NC7A 2FF4A 2MA3A 2BHYA 4XN0A 4BDYA 4L5JA 4HNTA 3OSFA 3W6VA 5HDNA 5DM7F 3AL0C 1YO5C 3KP3A 4F7ZA 3ONQA 4FE4A 1YITI 3A01A 1A6IA 2M1BA 5F6FA 1KGSA 1UHSA 3BJAA 3ZMZA 4A0YA 2JMWA 3OIPA 2EFWA 4JBAA 1N78A 4WXDA 3NAUA 5GADJ 4DBQA 2EZKA 1B72B 3AG3H 4IO9F 2ACJA 3HOUJ 5CKTA 2DCEA 4PJMA 2KPMA 2P7VB 5J40A 1Z05A 2H1LA 2E1MB 1ON2A 3OR2C 4FX4A 4XBFA 1IN7A 4EJUA 4A12A 1LJ9A 5D4SA 4ITVA 2HQRA 2QQBA 5HS7A 4B47A 5JVGF 1BL0A 1QRYA 1FC3A 2FOKA 1SEUA 3RYRA 2JA6J 2L4MA 1EKEA 1BOBA 1R4NB 2MD0A 3NRVA 4IHXA 1USSA 1JGSA 2E60A 3LSHA 3MWMA 3V42A 4IKFA 3BPXA 4YFKF 5IY5H 3M1EA 1F9NA 3JRGA 2DOFA 3UR3C 3HSEA 4XLEA 5M3MJ 2D45A 1ETYA 1B59A 1ZHFA 3JRFA 2VPLA 2DFEA 4R79A 2M9HA 1P4AA 3WU1B 1O3SA 1MMSA 3GX4X 3OOUA 4MIMA 1SD6A 2AS5F 1B1BA 1A36A 5IP7J 3JRIA 2FXAA 4IRIA 3S1QJ 3MD2A 1OISA 1WI3A 1TW3A 2Q2EB 1DU0A 5F64A 2HZDA 3ML6A 2OCEA 2EA2A 2W00A 3QOEA 4A3DJ 1ZK8A 4EM0B 2ZCWA 1GV5A 3GTPJ 1HSTA 1PUFB 5BPDA 1SC7A 1UB9A 3F23A 3TP0A 5ICEA 1VQ5I 4BQOA 1QVUA 1B72A 1K4TA 3S3OA 3PJRA 4JOMA 4A93J 4XKVA 5FRMA 4CA0A 1W0TA 3NWSA 2R7QA 3OMYA 3OR1C 1DP7P 5GAGJ 1XPXA 4I01A 2L7FP 2W82A 2F5VA 3QPSA 2VBZA 2EQRA 3CLOA 1S5LC 1V3FA 1TP4A 2Q1ZB 1N75A 3DLAA 2FU4A 3HM5A 3OS2A 4ZTJA 2Y31A 3D5LA 3LSKA 3L2QA 2IPQX 4BBRJ 3L2CA 4UVAA 4EM1A 4M74A 4XRSA 4N4NB 5D8LB 1T95A 3HC7A 4CO8A 4Y33A 1XG1A 1UJ8A 3G73A 3WTTC 2HOEA 5B1BH 4FQGA 2WAFA 4E7SA 2A69F 2ESNA 2Y0MA 4IHTA 4ESJA 4ZTFA 2JZYA 2KIMA 3SHFA 4IEJA 1TT5B 4AC0A 1VQPI 1IRZA 3FMQA 4EJWA 3BTCA 3H36A 1WRJA 3N97A 1HW5A 4M6YA 2GIZA 4N9HA 3EUHC 2Q2EA 1D1AA 5E8GA 5EDNA 4M6VA 2QVOA 1HCRA 2CFXA 4XKWA 3HOYJ 2VT2A 4M71A 5ILUA 1PUFA 1Y8RB 2HYJA 3GUDA 1TZLA 1R4MB 3TO6A 1H88C 4HDUA 2EK5A 3RPQA 2KL4A 2ECCA 3BG5A 5CQGA 1PVEA 3QPTA 2DPDA 1UHMA 3KP7A 1X4OA
chains in the Genus database with same CATH topology
3IH4A 5IP9J 3ZQCA 2RAEA 1OCPA 4M3BA 5EZHA 4QTRA 5C4XJ 3S2HJ 2XPVA 1IUFA 1WGXA 2Y9ZA 1ETWA 1FIPA 3LSRA 3A03A 2MSYA 1Z77A 4W1UA 1JGGA 4RDUA 4A3JJ 3S17J 1ENHA 3UKGA 4BXXJ 1WH7A 3BG9A 5K7ZA 3PO3J 5K7FA 4A3KJ 3HB9A 5BNGA 1X2MA 1JKPC 1JTYA 4AYBN 2WB1N 5C4JJ 3A02A 5M5YJ 4Y7NJ 3BR0A 5J3LA 4IHYA 2GLOA 2YUSA 4V2FA 2DMTA 2TCTA 2HOSA 2M34A 1ZR2A 2NOGA 1ETXA 1GT0C 2EZIA 4CYCA 2K9SA 2O7OA 2XRLA 2HOTA 2H1KA 5IYBJ 1ZR4A 1LFBA 3MVPA 4S0HB 1D5YA 1IG7A 4DZJA 2NS8A 2Y0SN 5HODA 2LY9A 4I76A 3ZQFA 2E19A 4X6AJ 2XB0X 5EF6A 1GV2A 2CUEA 2K9NA 1LE8A 1BW5A 2EH3A 2FD5A 3FK6A 3WHCA 2E2JJ 1K61A 1H8AC 4DZPA 5K7HA 2DA4A 5IYDJ 2R92J 2E2IJ 1X58A 2LKXA 2XPWA 1TWCJ 1IJWC 3S14J 1MH4A 3GBGA 3BR1A 2TRTA 3CQZJ 1TWGJ 3CDLA 3K7AJ 4MFEA 3OSGA 3GTGJ 1U9OA 5F27A 2O9LA 5C3EJ 1HF0A 2P81A 2E1OA 3B6AA 1HDDC 1XS9A 2HQ5A 5E3NA 3OIOA 5GPCA 3FIWA 1FEXA 1JT6A 3SFIA 4A3EJ 4DYCA 1Y1WJ 3A01B 2R5YA 3BR3A 3RZOJ 3S1MJ 1HOMA 3JRAA 4M3FA 1AU7A 1JKOC 2B63J 3RQIA 3JRHA 3L1PA 2CJJA 1JUSA 4IHVA 4A3FJ 3FKIJ 2HDDA 2CQQA 2QF7A 4ABZA 1QPIA 3I4NJ 1ZQ3P 1XC5A 3CCYA 2DN0A 4JX5A 3BT9A 2DTZA 3B6CA 2IAIA 1S7EA 4A3CJ 3RKQA 3S2DJ 2Y9YA 4NDLA 3C2BA 3JREA 3BTJA 3BTLA 1VI0A 4BY1J 2IEKA 2CUFA 1NTCA 2PMZN 2R93J 4HNVA 2DA1A 3I4MJ 4MFDA 4C3JJ 2GBYA 3G1LA 1Z0XA 1MBGA 1MBHA 4A3BJ 1G2HA 2LFBA 2ME0A 1K83J 1B8IB 1MBKA 2HOAA 1MBFA 2ZB9A 3JRDA 4QSHA 3RZDJ 3O8HA 5IOZA 1VFCA 1AHDP 3BG3A 2EBIA 2DA5A 2DMNA 3TW7A 1O4XA 1U8BA 3S16J 2DJNA 5JLWA 3PO2J 1TWAJ 2FJ1A 2Y2ZA 1TWFJ 2DA7A 2KDZA 1Y1VJ 2M8GX 4X1EA 1JT0A 2R5ZA 1MH3A 3S1RJ 2VKVA 1R9TJ 1JKRC 2E2HJ 1OFCX 4D7NA 2JJ7A 5IP6A 2R0QC 2G0EA 5IYCJ 1BA5A 1ZGWA 3D1NI 1IC8A 4GFBA 3Q0WA 1AKHB 1MSEC 5FKMA 1CQTA 2ID3A 2ID6A 1F43A 2AO9A 4B1RA 1NK3P 1ZKGA 3HOVJ 2NVXJ 2MGQA 2HI3A 2XB5A 5J1YA 3HOZJ 3M3YJ 3TEDA 5EEAA 3GTQJ 4A3GJ 4BKXA 2XGDA 5F1JA 3JRCA 1U9NA 2LP0A 4B3AA 1P7IA 2DMQA 3ZQIA 3GTOJ 4I6ZA 5DTDA 1VNDA 3ZQGA 1JUPA 1OJLA 3ZQHA 2ECBA 3S1NJ 1OCTC 1B8IA 2MG4A 3BQYA 5FJ8J 3TW6A 3H0GJ 3G1OA 3CMYA 4C3IJ 1FJLA 5M5XJ 1FTZA 1IGNA 4XRMA 3SDGA 1IDYA 1POGA 2JA5J 1SANA 4Y52J 3GTMJ 3HBLA 2NVYJ 3GTLJ 1ITYA 1JKQC 3SJMA 5FKKA 3ZQLA 4QIWN 1NK2P 4A3LJ 4J19A 2M2EA 3LOCA 3GTJJ 3S15J 2LK2A 2X6OA 2EZLA 3JRBA 2L9RA 3K2AA 3BR6A 4A69C 1DU6A 1ETOA 5EZGA 3MN2A 1H89C 4G12A 1I6HJ 1ETVA 1F36A 2LLKA 4UUSB 1ORKA 2LR8A 3QQAA 5DS9A 3IV5A 1I3QJ 4XK4A 2VI6A 5FKLA 3MKLA 5C44J 5GP9A 4A3MJ 4IHWA 4MO7A 4FTHA 4JX6A 2Y30A 4M3EA 1T33A 4D7MA 1YRNB 3TP3A 2L7ZA 3HKZN 2MW8A 2JA7J 1MBJA 3BQZA 2DA6A 2HXIA 2DMPA 2L7MP 5E3LA 3DEWA 5IOYA 1ETKA 2CQXA 3Q0VA 2DA3A 2FQ4A 4CYCB 5GPAA 4C2MJ 2YU9J 3LSGA 2ELKA 1I50J 3Q0UA 3ZOBA 4EEFG 5F0CA 2OPTA 5FLMJ 2QCOA 3OSFA 1LFUP 3W6VA 1TC3C 1GVDA 1JTXA 1LE8B 2JN6A 4FE4A 3A01A 1A6IA 1MSFC 1GUUA 3H3VK 4C3HJ 5J1RA 3DCFA 1UHSA 5JLXA 4JP0A 2WAQN 3HOWJ 1IV6A 2JMWA 5M3FJ 1U78A 2LD5A 3NAUA 4D5CA 1RKTA 4UUSA 1JUMA 2EZKA 4M3DA 2XSDC 2K40A 3BTIA 1B72B 3HOUJ 2XPUA 3HGYA 4JX4A 4DW6A 1RPWA 4FE7A 1X2NA 1SFOJ 2K9QA 3BR5A 3WHBA 2O8KA 1WCMJ 5F04A 2W48A 1BL0A 1QRYA 2JA6J 2NVQJ 2VKEA 1E3OC 2OF7A 2R5YB 9ANTA 4DYQA 2AHQA 2NVTJ 1YRNA 1P7JA 4IHXA 3LNQA 2DMUA 3HGGA 2WV1A 5F0FA 4XRSG 1GDTA 5F0HA 1ZTRA 3JRGA 5EG0B 4V2GA 2IBDA 1WPKA 5M3MJ 4DYRA 2FX0A 3GTKJ 1ETYA 2I10A 3F0CA 2X9DA 4FISA 5E3OA 3JRFA 1W0UA 2M9HA 2YS9A 2LVSA 2JK3A 3OOUA 2COBA 5EYRA 2R7ZJ 3PM1A 5FKOA 4MIMA 4BY7J 5IP7J 3O8GA 3JRIA 1EF4A 1MNMC 3S1QJ 1ETQA 5FLVA 1WI3A 2ME6A 1DU0A 3VPRA 2CRGA 4A3IJ 4A3DJ 1ZK8A 3IH3A 1GV5A 3GTPJ 1PUFB 2EZHA 3G1MA 2HXOA 3TP0A 2JWTA 5EGOB 1BJZA 2XGCA 1QVUA 2L0KA 1B72A 4A93J 4L5EA 1HLVA 1AKHA 3FK7A 3HEFA 1WH5A 3LSJA 1W0TA 1HDPA 2L7FP 3HDDA 2JA8J 3M4OJ 1FIAA 3QPSA 4JYKA 1UG2A 2GM4A 1BW6A 1Q1VA 2EQRA 4RBOA 3FISA 1A5JA 3HM5A 3Q3SA 1FTTA 1IDZA 2Y31A 2LTPA 3IH2A 1RR7A 4BBRJ 2R5ZB 1T56A 1VF9A 4M3GA 4XRSA 1UMQA 1MBEA 4MLOA 4XICA 4UUTA 1XG1A 1JJ6C 5M5WJ 2X48A 1QVTA 5J1UA 5EG0A 3LSPA 4LOCA 4XIDA 1APLC 1RESA 2H8RA 3NARA 5F08A 1RKWA 2KT0A 4IEJA 4AC0A 2NS7A 3HOXJ 1TWHJ 4W97A 5IPAA 1IRZA 3E7LA 4B4CA 3BTCA 2M0CA 4FCYA 4D5FA 2CU7A 2D5VA 5EDNA 1RETA 4M6VA 1HCRA 2N8GA 4AUXA 3HOYJ 5E3MA 3JR9A 1PUFA 2XGEA 3QPLA 2HYJA 1H88C 5EGOA 2VPRA 5FKNA 2DA2A 2ECCA 4BBSJ 1JJ8C 3BG5A 2VUMJ 3BR2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IH4 A;  5IP9 J;  3ZQC A;  2RAE A;  1OCP A;  4M3B A;  5EZH A;  4QTR A;  5C4X J;  3S2H J;  2XPV A;  1IUF A;  1WGX A;  2Y9Z A;  1ETW A;  1FIP A;  3LSR A;  3A03 A;  2MSY A;  1Z77 A;  4W1U A;  1JGG A;  4RDU A;  4A3J J;  3S17 J;  1ENH A;  3UKG A;  4BXX J;  1WH7 A;  3BG9 A;  5K7Z A;  3PO3 J;  5K7F A;  4A3K J;  3HB9 A;  5BNG A;  1X2M A;  1JKP C;  1JTY A;  4AYB N;  2WB1 N;  5C4J J;  3A02 A;  5M5Y J;  4Y7N J;  3BR0 A;  5J3L A;  4IHY A;  2GLO A;  2YUS A;  4V2F A;  2DMT A;  2TCT A;  2HOS A;  2M34 A;  1ZR2 A;  2NOG A;  1ETX A;  1GT0 C;  2EZI A;  4CYC A;  2K9S A;  2O7O A;  2XRL A;  2HOT A;  2H1K A;  5IYB J;  1ZR4 A;  1LFB A;  3MVP A;  4S0H B;  1D5Y A;  1IG7 A;  4DZJ A;  2NS8 A;  2Y0S N;  5HOD A;  2LY9 A;  4I76 A;  3ZQF A;  2E19 A;  4X6A J;  2XB0 X;  5EF6 A;  1GV2 A;  2CUE A;  2K9N A;  1LE8 A;  1BW5 A;  2EH3 A;  2FD5 A;  3FK6 A;  3WHC A;  2E2J J;  1K61 A;  1H8A C;  4DZP A;  5K7H A;  2DA4 A;  5IYD J;  2R92 J;  2E2I J;  1X58 A;  2LKX A;  2XPW A;  1TWC J;  1IJW C;  3S14 J;  1MH4 A;  3GBG A;  3BR1 A;  2TRT A;  3CQZ J;  1TWG J;  3CDL A;  3K7A J;  4MFE A;  3OSG A;  3GTG J;  1U9O A;  5F27 A;  2O9L A;  5C3E J;  1HF0 A;  2P81 A;  2E1O A;  3B6A A;  1HDD C;  1XS9 A;  2HQ5 A;  5E3N A;  3OIO A;  5GPC A;  3FIW A;  1FEX A;  1JT6 A;  3SFI A;  4A3E J;  4DYC A;  1Y1W J;  3A01 B;  2R5Y A;  3BR3 A;  3RZO J;  3S1M J;  1HOM A;  3JRA A;  4M3F A;  1AU7 A;  1JKO C;  2B63 J;  3RQI A;  3JRH A;  3L1P A;  2CJJ A;  1JUS A;  4IHV A;  4A3F J;  3FKI J;  2HDD A;  2CQQ A;  2QF7 A;  4ABZ A;  1QPI A;  3I4N J;  1ZQ3 P;  1XC5 A;  3CCY A;  2DN0 A;  4JX5 A;  3BT9 A;  2DTZ A;  3B6C A;  2IAI A;  1S7E A;  4A3C J;  3RKQ A;  3S2D J;  2Y9Y A;  4NDL A;  3C2B A;  3JRE A;  3BTJ A;  3BTL A;  1VI0 A;  4BY1 J;  2IEK A;  2CUF A;  1NTC A;  2PMZ N;  2R93 J;  4HNV A;  2DA1 A;  3I4M J;  4MFD A;  4C3J J;  2GBY A;  3G1L A;  1Z0X A;  1MBG A;  1MBH A;  4A3B J;  1G2H A;  2LFB A;  2ME0 A;  1K83 J;  1B8I B;  1MBK A;  2HOA A;  1MBF A;  2ZB9 A;  3JRD A;  4QSH A;  3RZD J;  3O8H A;  5IOZ A;  1VFC A;  1AHD P;  3BG3 A;  2EBI A;  2DA5 A;  2DMN A;  3TW7 A;  1O4X A;  1U8B A;  3S16 J;  2DJN A;  5JLW A;  3PO2 J;  1TWA J;  2FJ1 A;  2Y2Z A;  1TWF J;  2DA7 A;  2KDZ A;  1Y1V J;  2M8G X;  4X1E A;  1JT0 A;  2R5Z A;  1MH3 A;  3S1R J;  2VKV A;  1R9T J;  1JKR C;  2E2H J;  1OFC X;  4D7N A;  2JJ7 A;  5IP6 A;  2R0Q C;  2G0E A;  5IYC J;  1BA5 A;  1ZGW A;  3D1N I;  1IC8 A;  4GFB A;  3Q0W A;  1AKH B;  1MSE C;  5FKM A;  1CQT A;  2ID3 A;  2ID6 A;  1F43 A;  2AO9 A;  4B1R A;  1NK3 P;  1ZKG A;  3HOV J;  2NVX J;  2MGQ A;  2HI3 A;  2XB5 A;  5J1Y A;  3HOZ J;  3M3Y J;  3TED A;  5EEA A;  3GTQ J;  4A3G J;  4BKX A;  2XGD A;  5F1J A;  3JRC A;  1U9N A;  2LP0 A;  4B3A A;  1P7I A;  2DMQ A;  3ZQI A;  3GTO J;  4I6Z A;  5DTD A;  1VND A;  3ZQG A;  1JUP A;  1OJL A;  3ZQH A;  2ECB A;  3S1N J;  1OCT C;  1B8I A;  2MG4 A;  3BQY A;  5FJ8 J;  3TW6 A;  3H0G J;  3G1O A;  3CMY A;  4C3I J;  1FJL A;  5M5X J;  1FTZ A;  1IGN A;  4XRM A;  3SDG A;  1IDY A;  1POG A;  2JA5 J;  1SAN A;  4Y52 J;  3GTM J;  3HBL A;  2NVY J;  3GTL J;  1ITY A;  1JKQ C;  3SJM A;  5FKK A;  3ZQL A;  4QIW N;  1NK2 P;  4A3L J;  4J19 A;  2M2E A;  3LOC A;  3GTJ J;  3S15 J;  2LK2 A;  2X6O A;  2EZL A;  3JRB A;  2L9R A;  3K2A A;  3BR6 A;  4A69 C;  1DU6 A;  1ETO A;  5EZG A;  3MN2 A;  1H89 C;  4G12 A;  1I6H J;  1ETV A;  1F36 A;  2LLK A;  4UUS B;  1ORK A;  2LR8 A;  3QQA A;  5DS9 A;  3IV5 A;  1I3Q J;  4XK4 A;  2VI6 A;  5FKL A;  3MKL A;  5C44 J;  5GP9 A;  4A3M J;  4IHW A;  4MO7 A;  4FTH A;  4JX6 A;  2Y30 A;  4M3E A;  1T33 A;  4D7M A;  1YRN B;  3TP3 A;  2L7Z A;  3HKZ N;  2MW8 A;  2JA7 J;  1MBJ A;  3BQZ A;  2DA6 A;  2HXI A;  2DMP A;  2L7M P;  5E3L A;  3DEW A;  5IOY A;  1ETK A;  2CQX A;  3Q0V A;  2DA3 A;  2FQ4 A;  4CYC B;  5GPA A;  4C2M J;  2YU9 J;  3LSG A;  2ELK A;  1I50 J;  3Q0U A;  3ZOB A;  4EEF G;  5F0C A;  2OPT A;  5FLM J;  2QCO A;  3OSF A;  1LFU P;  3W6V A;  1TC3 C;  1GVD A;  1JTX A;  1LE8 B;  2JN6 A;  4FE4 A;  3A01 A;  1A6I A;  1MSF C;  1GUU A;  3H3V K;  4C3H J;  5J1R A;  3DCF A;  1UHS A;  5JLX A;  4JP0 A;  2WAQ N;  3HOW J;  1IV6 A;  2JMW A;  5M3F J;  1U78 A;  2LD5 A;  3NAU A;  4D5C A;  1RKT A;  4UUS A;  1JUM A;  2EZK A;  4M3D A;  2XSD C;  2K40 A;  3BTI A;  1B72 B;  3HOU J;  2XPU A;  3HGY A;  4JX4 A;  4DW6 A;  1RPW A;  4FE7 A;  1X2N A;  1SFO J;  2K9Q A;  3BR5 A;  3WHB A;  2O8K A;  1WCM J;  5F04 A;  2W48 A;  1BL0 A;  1QRY A;  2JA6 J;  2NVQ J;  2VKE A;  1E3O C;  2OF7 A;  2R5Y B;  9ANT A;  4DYQ A;  2AHQ A;  2NVT J;  1YRN A;  1P7J A;  4IHX A;  3LNQ A;  2DMU A;  3HGG A;  2WV1 A;  5F0F A;  4XRS G;  1GDT A;  5F0H A;  1ZTR A;  3JRG A;  5EG0 B;  4V2G A;  2IBD A;  1WPK A;  5M3M J;  4DYR A;  2FX0 A;  3GTK J;  1ETY A;  2I10 A;  3F0C A;  2X9D A;  4FIS A;  5E3O A;  3JRF A;  1W0U A;  2M9H A;  2YS9 A;  2LVS A;  2JK3 A;  3OOU A;  2COB A;  5EYR A;  2R7Z J;  3PM1 A;  5FKO A;  4MIM A;  4BY7 J;  5IP7 J;  3O8G A;  3JRI A;  1EF4 A;  1MNM C;  3S1Q J;  1ETQ A;  5FLV A;  1WI3 A;  2ME6 A;  1DU0 A;  3VPR A;  2CRG A;  4A3I J;  4A3D J;  1ZK8 A;  3IH3 A;  1GV5 A;  3GTP J;  1PUF B;  2EZH A;  3G1M A;  2HXO A;  3TP0 A;  2JWT A;  5EGO B;  1BJZ A;  2XGC A;  1QVU A;  2L0K A;  1B72 A;  4A93 J;  4L5E A;  1HLV A;  1AKH A;  3FK7 A;  3HEF A;  1WH5 A;  3LSJ A;  1W0T A;  1HDP A;  2L7F P;  3HDD A;  2JA8 J;  3M4O J;  1FIA A;  3QPS A;  4JYK A;  1UG2 A;  2GM4 A;  1BW6 A;  1Q1V A;  2EQR A;  4RBO A;  3FIS A;  1A5J A;  3HM5 A;  3Q3S A;  1FTT A;  1IDZ A;  2Y31 A;  2LTP A;  3IH2 A;  1RR7 A;  4BBR J;  2R5Z B;  1T56 A;  1VF9 A;  4M3G A;  4XRS A;  1UMQ A;  1MBE A;  4MLO A;  4XIC A;  4UUT A;  1XG1 A;  1JJ6 C;  5M5W J;  2X48 A;  1QVT A;  5J1U A;  5EG0 A;  3LSP A;  4LOC A;  4XID A;  1APL C;  1RES A;  2H8R A;  3NAR A;  5F08 A;  1RKW A;  2KT0 A;  4IEJ A;  4AC0 A;  2NS7 A;  3HOX J;  1TWH J;  4W97 A;  5IPA A;  1IRZ A;  3E7L A;  4B4C A;  3BTC A;  2M0C A;  4FCY A;  4D5F A;  2CU7 A;  2D5V A;  5EDN A;  1RET A;  4M6V A;  1HCR A;  2N8G A;  4AUX A;  3HOY J;  5E3M A;  3JR9 A;  1PUF A;  2XGE A;  3QPL A;  2HYJ A;  1H88 C;  5EGO A;  2VPR A;  5FKN A;  2DA2 A;  2ECC A;  4BBS J;  1JJ8 C;  3BG5 A;  2VUM J;  3BR2 A; 
#chains in the Genus database with same CATH topology
 3KZY A;  4HW0 A;  1TTY A;  5IP9 J;  3ZQC A;  2RDP A;  4RAZ A;  1VQO I;  1MDM B;  1OCP A;  4M3B A;  2F5F A;  4PUS A;  1HC8 A;  2ZSI B;  3F8N A;  4N0B A;  3K69 A;  1YJN I;  1IUF A;  2HQN A;  5LGN A;  1F4K A;  1HQC A;  1MMA A;  2MSY A;  4EJV A;  4EV0 A;  1Z77 A;  2OZU A;  4W1U A;  2PJR B;  4RDU A;  4NB5 A;  2WBM A;  3I59 A;  3S17 J;  3K1N A;  4B43 A;  5DYM A;  3RSN A;  4A3K J;  1JKP C;  4J00 A;  3HRS A;  4AYB N;  3A02 A;  1WVR A;  4KNY A;  4Y7N J;  2HZT A;  3GEZ A;  1KU9 A;  2GLO A;  1GHC A;  5FO5 A;  5BMZ A;  2X1C A;  1X1C A;  2F4O B;  3LFK A;  4CYC A;  2M45 A;  3J81 Z;  3IUO A;  4CCJ A;  4UVC A;  2H1K A;  2L5Q A;  3MVP A;  2QYO A;  2VJ4 A;  2Y0S N;  3S2W A;  2A05 A;  2M5W A;  3AL0 B;  5J4V A;  2E19 A;  4X6A J;  2UV1 A;  1GV2 A;  2CQ7 A;  2K9N A;  1ON1 A;  2P6T A;  3CCE I;  1V55 H;  4EVI A;  1IZ1 A;  2BY3 A;  4YIF A;  2EIN H;  3DPL C;  2E2I J;  3PNV A;  3OYI A;  5JFR A;  1T8I A;  4KFC A;  5LHG A;  1IJW C;  3E5U A;  3G71 I;  1YJW I;  1LVK A;  2CFO A;  1AWC A;  3CMM A;  2KDO A;  3OSG A;  1U9O A;  3WU2 C;  2PJR A;  5C3E J;  2P81 A;  3E5X A;  3VYU B;  4DBR A;  3FXR A;  2UXN A;  3OIO A;  3RTR A;  1SVL A;  3FIW A;  1VQ6 I;  1XSV A;  3K4N A;  4KDP A;  4A6E A;  2R5Y A;  3BR3 A;  2K02 A;  3PUF A;  1J9I A;  3SZT A;  1OLT A;  2VQH A;  4M3F A;  4UV8 A;  1AU7 A;  1JKO C;  3VEP A;  3JRH A;  5JHF A;  1K4S A;  6PAX A;  3V8J A;  3BCA A;  1Z7L A;  5JHU A;  3FKI J;  2HDD A;  3RJP A;  1W7P D;  1Z67 A;  5LGU A;  2QF7 A;  2HQA A;  1UEL B;  1NG7 A;  2H09 A;  3HOT A;  1XC5 A;  4GDF A;  2A61 A;  2DTZ A;  2H94 A;  1VQL I;  2EJR A;  4WCG A;  1ZAO A;  1VQK I;  4HQM A;  4GCV A;  4L9V A;  3WTX C;  4IOC F;  2L4A A;  4A3C J;  2Y9Y A;  4NDL A;  5H20 A;  1XD7 A;  3PUB A;  2FML A;  3JRE A;  3BTJ A;  1YOV B;  4F52 A;  1VI0 A;  4BY1 J;  2IEK A;  3QU3 A;  3LSM A;  3H5R A;  4HLX A;  1YE9 A;  1YI2 I;  4A3B J;  1Z0X A;  4IVN A;  4DJA A;  2ME0 A;  1K6O A;  1B8I B;  2MFZ A;  3HL2 A;  3MEX A;  1MBF A;  2ZB9 A;  3ROU A;  1QGP A;  2DYR H;  1FMW A;  3CO7 C;  3JRD A;  4PZJ A;  2CQN A;  3I3L A;  2AXT C;  1Z3X A;  3ZRG A;  3RZD J;  1VQ7 I;  1BM9 A;  2HYF A;  2OD5 A;  3EDP A;  3ASO H;  5GAE J;  3L2R A;  2XVC A;  4KN4 X;  3BG3 A;  2DO7 A;  3TW7 A;  5E20 A;  2G7U A;  4OIR F;  4H4K C;  2Y75 A;  2XAS A;  1C0W A;  1TWA J;  3FXU A;  4Y4R A;  3S8P A;  2Y2Z A;  4ZYA A;  1W36 C;  1TWF J;  4O3M A;  4A0Z A;  3EUK L;  2DOD A;  1JT0 A;  3ZXS A;  4BU2 A;  5J47 A;  2FOW A;  3O3K A;  1G6N A;  2VKV A;  3MZY A;  3AG2 H;  4I02 A;  1FP2 A;  2NNY A;  2E2H J;  1P4X A;  3Q9S A;  4BHP A;  3H3Z A;  4D7N A;  1G3W A;  1ZN2 A;  1ODD A;  1R22 A;  2G0E A;  2XKO A;  2VXD A;  2ZME C;  2CO5 A;  3SDB A;  3OS1 A;  3I71 A;  2KLO A;  2PFB A;  3UNG C;  2XAF A;  3TOA A;  4PK4 A;  4U0W A;  1LEB A;  1TW2 A;  1ULY A;  4ANJ A;  1R5G A;  2NVX J;  4UXN A;  2LBF A;  2MGQ A;  2M87 A;  2V6E A;  2XSJ C;  3LSI A;  3M3Y J;  3OYC A;  1DPR A;  2KFD A;  3C7J A;  3P9C A;  2FMY A;  4BKX A;  5F1J A;  3S93 A;  3HXL A;  3RYP A;  3P5J A;  1KQ0 A;  2VB6 A;  3L2V A;  5FRO A;  3ZQG A;  5HNH A;  3ZQH A;  3BG7 A;  5CVR A;  2ECB A;  3IAS 2;  2HGC A;  1B8I A;  1RZ4 A;  2Z2S B;  3J80 K;  5DCM B;  2X1D A;  1QBJ A;  1U3E M;  2RKH A;  3G1O A;  3CC4 I;  4HF0 A;  4CXF A;  2BY0 A;  5M5X J;  1FTZ A;  4MNU A;  3TBI A;  4BJ5 C;  1IDY A;  3LQR A;  2FUG 2;  1EJ9 A;  1ZGA A;  4BJ6 C;  4HV6 A;  2VBX A;  1FWZ A;  5EJC A;  3DU5 A;  3N05 A;  4UNO A;  4FET A;  3KEQ A;  5HVQ C;  1JKQ C;  1QHH D;  5FKK A;  1NH3 A;  2CUJ A;  2I5U A;  2WAQ A;  4ZZL A;  3GYH X;  4E7J A;  2MD5 A;  3GTJ J;  4Z2Y A;  1WJC A;  1RUO A;  4J01 A;  2LK2 A;  4PFO A;  1DQU A;  2EZL A;  2ZXJ A;  2XRO A;  3CF5 F;  4XMY A;  4U0V A;  1ETV A;  1SMT A;  2LLK A;  3LA7 A;  5J4Y A;  4UUS B;  1RRJ A;  1ORK A;  5HDG A;  3QQA A;  2O3F A;  3M8F A;  1T98 A;  2HNH A;  3CC2 I;  2QQ9 A;  2VI6 A;  2Z99 A;  4UB6 C;  3EUH A;  3PL8 A;  5GP9 A;  1FSH A;  2QBY B;  4YEL A;  5DD4 A;  2NXN B;  2E7X A;  3TKY A;  1G3Y A;  3DKY A;  3WGH A;  2COM A;  2EV0 A;  2Y30 A;  3TDU C;  3AAF A;  1V5E A;  1S9H A;  1MMN A;  2IXS A;  2V1D A;  1YRN B;  2ADU A;  4RB3 C;  3TP3 A;  2L7Z A;  1JE8 A;  3T0Y A;  2CQK A;  3HKZ N;  2MW8 A;  2F5D A;  1V5F A;  3K4K A;  2DA6 A;  2LF7 A;  1BI1 A;  2DMP A;  2L7M P;  4WX9 A;  2CQX A;  3E5Q A;  2DA3 A;  3CCS I;  5H2F C;  1KQ8 A;  2IS6 A;  3MKZ A;  2Z33 A;  4YFX F;  2P5V A;  3QU6 A;  3CO6 C;  2ELK A;  4YFN F;  4EEF G;  5F0C A;  2OPT A;  3TQN A;  2DU9 A;  2PX9 A;  3K6G A;  5LEJ A;  3VOD A;  4C9Y A;  4XLP F;  1XDU A;  1BR4 A;  1GVD A;  5E1W A;  2HPM A;  1S8N A;  4WF2 A;  1LE8 B;  2JVG A;  3U21 A;  2VOO A;  3H3V K;  1O3T A;  1ZRD A;  4C3H J;  1FP1 D;  3DCF A;  1Q1H A;  2ZJR F;  4JP0 A;  4AIJ A;  2X6W A;  3HOW J;  2VN2 A;  3OYG A;  4XOT A;  4QPQ A;  2VKD A;  2LD5 A;  4EGZ A;  4UUS A;  1ZAR A;  4LGW A;  1JUM A;  2NVU B;  4U7D A;  2XSD C;  2P5L C;  1T6S A;  1BBY A;  2EIL H;  3FKJ A;  3M1C A;  3IL2 A;  2XPU A;  2P4W A;  2UZK A;  3CME I;  4AVZ A;  2R3S A;  1RPW A;  5GAH J;  1IRX A;  4P5O A;  1ERD A;  3VB2 A;  4OAY A;  1FYK A;  2O6G E;  5ED4 A;  4IF4 A;  2NVQ J;  3AG1 H;  2Q8K A;  2X51 A;  4RB2 C;  9ANT A;  2AHQ A;  2TDX A;  1JHH A;  1YRN A;  1P7J A;  4ZYG A;  2DMU A;  5K5O A;  4KN7 X;  5F0F A;  3D5R C;  3BWG A;  1GDT A;  1ZTR A;  2LH9 A;  4F92 B;  3TDZ C;  3M8J A;  5EG0 B;  4V2G A;  4XRF A;  1SFK A;  2IBD A;  4E7I A;  3WTS C;  4AVP A;  3JAM Z;  1O3Q A;  3GZ5 A;  3GWZ A;  3GTK J;  1PJR A;  3F0C A;  2X9D A;  3NWT A;  5E3O A;  4ZYD A;  1W0U A;  1H9T A;  2M7A A;  1ZLJ A;  2K86 A;  2LVS A;  2YSR A;  4MTE A;  2JK3 A;  4E7K A;  2COB A;  5EYR A;  3SFZ A;  5K5Q A;  2R7Z J;  1TQM A;  4S04 A;  3PQJ A;  2XIG A;  3BDD A;  3K9T A;  1MNM C;  1EF4 A;  2PBI A;  4I0B A;  4U7B A;  1R71 A;  4AD9 A;  1R1T A;  4XKB A;  1O3R A;  4XR6 A;  1OPC A;  3GZN B;  3CDH A;  4RGR A;  2IA0 A;  3G1M A;  4KJZ A;  1FPQ A;  3R61 A;  4HNU A;  4EGY A;  2C6Y A;  1BJZ A;  2ZJP F;  4N4O B;  1OQY A;  2L0K A;  2ZME B;  1MNE A;  4G9Y A;  4BYY A;  4DGW B;  1IW7 F;  2FNP A;  2WC2 A;  3ABL H;  4B09 A;  2IA2 A;  3ZQQ A;  1XCB A;  4UUV A;  1DPU A;  3ABT A;  2OTJ I;  1HDP A;  3M4O J;  2HWV A;  1FIA A;  2QLZ A;  2VJ5 A;  1UG2 A;  2GM4 A;  1L3L A;  4RBO A;  3Q3S A;  1FTT A;  2PG4 A;  1WJD A;  3IH2 A;  4B44 A;  5B3S H;  4G8X A;  2WB1 A;  2DYS H;  1VF9 A;  2BEO A;  4M3G A;  2V9K A;  5A2Q K;  3LA3 A;  4BUP A;  1JJ6 C;  5M5W J;  2I8D A;  2X48 A;  1OKR A;  2AQF A;  3IP4 B;  5EG0 A;  3CC7 I;  2D1V A;  1APL C;  3HG9 A;  5TIS C;  1R36 A;  2HKO A;  2KT0 A;  3BZC A;  3I4P A;  1LDJ A;  1BIA A;  3AKZ A;  3H1C A;  3VFZ A;  5B1A H;  3GXO A;  4RB1 A;  3AFH A;  3DEE A;  4IOA F;  3BPV A;  4AID A;  4M9X A;  3KEY A;  2DK8 A;  3EPZ A;  3IRR A;  1WJB A;  4QLC U;  5LHH A;  2K3F A;  3OOP A;  3CTA A;  2LSO A;  2M0C A;  1KZH A;  3IRQ A;  4FCY A;  2CU7 A;  3U2R A;  1PP7 U;  2EPF A;  1WSU A;  2RV8 A;  2CW8 A;  1ZG5 A;  5E3M A;  5FLX Z;  4XLH A;  4C2T A;  2EV5 A;  2FE3 A;  2VPR A;  5FKN A;  3F21 A;  1RIO H;  2P6S A;  4XNF A;  2H27 A;  2LOO A;  3KE2 A;  1ZRF A;  2ZME A;  2K4J A;  2VUM J;  3C3W A;  4GRI A;  4PJN A;  2RAE A;  3RPU A;  5K1Y A;  4QTR A;  2BY2 A;  2DFF A;  3E0J B;  4PJJ A;  1FIP A;  3LSR A;  2BBY A;  3VWB A;  1JGG A;  4P55 A;  3UKG A;  2QKM B;  1WH7 A;  1B6A A;  3BG9 A;  5GTI C;  3P9I A;  2CS3 A;  3L2W A;  2XAJ A;  2P7C B;  4I7H A;  2QA4 I;  2E5N A;  2M8E A;  1X2M A;  2BW3 B;  2V1U A;  1JTY A;  2LMD A;  5M5Y J;  3ZGK A;  1MMD A;  2EFO A;  3BR0 A;  3FXM A;  5J3L A;  3DPU A;  2LKP A;  3HPH A;  5DV5 A;  5KVR A;  2WA0 A;  5TRD A;  2YUS A;  4V2F A;  4F3Q A;  2ZSH B;  1HKT A;  2RRE A;  4XN3 A;  5ERI A;  2HOS A;  4HQE A;  2M34 A;  1VTN C;  3K0L A;  1ETX A;  1GT0 C;  2EZI A;  4BNC A;  2K9S A;  4XSZ F;  5IYB J;  3JSO A;  2CH0 A;  1WQ2 A;  2IVM A;  5DUI A;  2NS8 A;  2PMZ A;  3K1P A;  3H3U A;  5F1R A;  1QZZ A;  4G6T B;  5HLI A;  3U1D A;  4ESF A;  1WJA A;  2A6E F;  2V7F A;  2IS2 A;  4Y15 A;  3GLX A;  2L3D A;  3COA C;  2QGU A;  3HSF A;  3WHC A;  1V4R A;  2KQR A;  1K61 A;  1H8A C;  2JSC A;  1YX5 A;  4LB5 A;  2OA4 A;  1IUY A;  5K7H A;  2DA4 A;  3JTG A;  4K2E A;  4BAC A;  1X58 A;  2QM3 A;  2LKX A;  3D0S A;  3RDI A;  1P92 A;  3S14 J;  2J5O A;  1MH4 A;  4LLN A;  5CVV A;  3GBG A;  3CQZ J;  1PDN C;  4BDZ A;  3K7A J;  4HX8 A;  5HLG A;  2AQE A;  4IXA A;  3FX3 A;  3B6A A;  3NEU A;  1HDD C;  1YLF A;  2IGK A;  4OMY A;  5GPC A;  1YFH A;  2BE5 F;  1K79 A;  1FEX A;  3IKT A;  4DYC A;  1IXS B;  4EJT A;  3SZP A;  1SVO A;  3PSF A;  3S1M J;  3LWF A;  1HOM A;  2DAO A;  1KON A;  1T2K A;  1DDN A;  2B63 J;  2KZV A;  3L1P A;  3ISP A;  2PLY A;  1UST A;  2WY8 Q;  1X1D A;  2CJJ A;  1JUS A;  2KIF A;  4IHV A;  1ZG3 A;  5E18 F;  4UVB A;  2HTJ A;  1YW9 A;  4WWC A;  3AG4 H;  2FNA A;  2M4G A;  3I4N J;  5CVU A;  1ZQ3 P;  4IRH A;  3DLL F;  2QKL B;  3ZN0 A;  2LY2 A;  3ZMU A;  2DN0 A;  4E70 A;  2BVL A;  5LD2 C;  2AXL A;  3DTI A;  4LB6 B;  2GOX B;  2FBI A;  4L9J A;  1R1U A;  2JRT A;  3I54 A;  3GF2 A;  4PCQ A;  5ICG A;  2QUF A;  3BTL A;  5EEH A;  1BOA A;  1TL8 A;  4ZDO A;  2R7U A;  1W5S A;  1WKM A;  3CMA I;  2CV1 A;  2HVS A;  2X6X A;  4OOI A;  2DI3 A;  5HS9 A;  5HS8 A;  2DA1 A;  3REO A;  3I4M J;  2LFB A;  5BS6 A;  4X0G A;  2IS1 A;  4RS8 A;  1K83 J;  1LPQ A;  3H9G A;  3F8F A;  2A6T A;  4IQJ A;  5LEK A;  1JI8 A;  3N4M A;  1GXQ A;  3DEU A;  1R49 A;  1T38 A;  2M0M A;  4YRV A;  2R7T A;  2EBI A;  2FA5 A;  2DMN A;  2GIV A;  1O4X A;  1YG2 A;  1U8B A;  3S16 J;  2DJN A;  2FJ1 A;  3ZR8 X;  3HZJ A;  4O5V A;  5HNF A;  5D5U B;  4D1Q A;  1H0M A;  3QAH A;  2M8G X;  4X1E A;  1UFM A;  4II2 A;  2DFH A;  5DD8 A;  1R9T J;  1FNN A;  2MC4 A;  2MC3 A;  5JI6 A;  3ELK A;  2PMU A;  1OFC X;  2QEN A;  3F3X A;  3LFU A;  4BE1 A;  5IP6 A;  3KYL A;  4V19 K;  2EIK H;  3IKV A;  5IYC J;  1BA5 A;  2F6C A;  3KFW X;  3F6O A;  3D1N I;  1KQ9 A;  2JUG A;  1MMG A;  4GFB A;  4IL6 C;  1AKH B;  2MLG A;  2A3S A;  3R6S A;  5FKM A;  1MSE C;  4PFP A;  2MBF A;  1LUJ B;  2XF6 A;  1LKX A;  2AO9 A;  4B1R A;  2XAG A;  3CDI A;  1ZKG A;  2F4M B;  4MHG A;  3GVA A;  3HOV J;  1RC9 A;  2IS4 A;  5J1Y A;  2QZ8 A;  4P9U A;  1UG0 A;  3TED A;  5EEA A;  3PNY A;  2R7S A;  2CYY A;  2JPC A;  2XGD A;  3LQQ A;  1ONV A;  1U9N A;  3FMR A;  1P7I A;  2FSW A;  3ZQI A;  4LK1 F;  4UHT A;  3GTO J;  4I6Z A;  3E97 A;  3ERM A;  1VND A;  4LG3 A;  2IA1 A;  1JUP A;  2DQL A;  1WHU A;  3S1N J;  1OCT C;  2R7R A;  2KKO A;  2MG4 A;  4CUG A;  3FDY A;  2M3A A;  3FM5 A;  4OMZ A;  3OYD A;  2FBH A;  2P0W A;  1IRG A;  1D1C A;  2B0L A;  3KP2 A;  4LG0 B;  4P9F A;  2VC1 A;  4RAG A;  1MDM A;  3FWE A;  1W7P B;  4G7O F;  1BC7 C;  1P2F A;  1IGN A;  4XRM A;  1V5G A;  3CJR B;  4RM3 A;  1POG A;  2JA5 J;  1SAN A;  2UUZ A;  3F8M A;  3M9A A;  4HG2 A;  1OYW A;  1FBU A;  3ZQL A;  3TOB A;  3O6B B;  3KIO A;  4BAY A;  1SFX A;  5CJ9 A;  5FFZ A;  1FT9 A;  3MCZ A;  1JHF A;  2HDW A;  4CIC A;  3OYN A;  3JRB A;  1YHQ I;  1DU6 A;  4L9T A;  4HSR A;  4L18 B;  5EZG A;  4G12 A;  2CGP A;  1F36 A;  3IWF A;  5CVJ A;  3DKW A;  4ZDP A;  3WTZ A;  4XLC A;  2BXY A;  4BEH B;  1I3Q J;  1VZ0 A;  2GWR A;  1QQI A;  1FMV A;  3FXQ A;  3S3M A;  5C44 J;  2EB7 A;  2EIM H;  2HS5 A;  2F5C A;  4D9J A;  1YS7 A;  1CGP A;  4FTH A;  2HVR A;  2X85 A;  3J7Z I;  4PJL A;  4HV5 A;  2D2W A;  1TNT A;  3C2H A;  4M3E A;  2CG4 A;  2V9V A;  3G2B A;  1T08 B;  3WTU C;  3ERE D;  3CZ6 A;  3M07 A;  4MEX F;  3D5S C;  4YEJ A;  3K4M A;  4A2U A;  3ABK H;  4G7Z F;  3TO9 A;  1YIO A;  3KET A;  5IOY A;  1SVM A;  1VQN I;  1IO2 A;  1HW1 A;  3WG9 A;  1W7P A;  5B66 C;  2HEO A;  1BJA A;  2GXG A;  2VOD A;  3QYE A;  4CYD A;  2YU9 J;  2ZFW A;  3CP8 A;  4NBQ A;  5E1Z B;  3SQN A;  1I50 J;  3OYF A;  5FLM J;  3QWL A;  2QCO A;  1LFU P;  2DDB A;  2A6H F;  4EQQ A;  1K7A A;  3ZCO A;  2PMH A;  5AIP A;  1FY7 A;  1TC3 C;  3GFM A;  3ZMT A;  3IWZ A;  3H5A A;  1GUU A;  3KP6 A;  3LAP A;  4I98 B;  2RQQ A;  5J1R A;  4EAT A;  1YX3 A;  5CVI A;  5JLX A;  1BR1 A;  2DPU A;  3ZMS A;  1IV6 A;  1RKT A;  1LDK B;  2K40 A;  1D8J A;  3PQK A;  2CMP A;  4BEH A;  3C2G A;  1J59 A;  1R7J A;  3FHN A;  4JX4 A;  4DW6 A;  5E17 F;  1TT0 A;  4FE7 A;  1Y56 A;  1M1E B;  4EJO A;  1SFO J;  2K9Q A;  5BQT A;  2YR2 A;  3KYD B;  3WHB A;  1K78 B;  2DT7 B;  2HPI A;  3E6M A;  2P8T A;  3V4G A;  2O8K A;  2VL8 A;  3TMO A;  3DU6 A;  4I09 A;  3GZ6 A;  2CV0 A;  1E3O C;  3U9G A;  3Q5F A;  2OF7 A;  3HTU A;  1I5Z A;  2CW7 A;  4YII A;  3DF8 A;  3L9F A;  1Z7U A;  1LNW A;  2WV1 A;  3CUQ B;  1LFP A;  1PP8 F;  2Z9O A;  4XKC A;  1REP C;  4XL9 A;  1WPK A;  2XV4 S;  4RGS A;  1Z6T A;  2DBB A;  3L00 A;  1XDS A;  1D0Z A;  2B7E A;  4AIK A;  1Z3Y A;  3E6B A;  3V8K A;  3FBN B;  3I53 A;  1Y6I A;  4BY7 J;  3O8G A;  2QQ8 A;  3H0D A;  4RGU A;  5FLV A;  2L54 A;  1W5T A;  2HFH A;  3VPR A;  2CRG A;  2WAE A;  4RA2 A;  4A3I J;  1DUX C;  1P4W A;  3KZI C;  2ZC2 A;  3X2Q H;  2HXO A;  3ABU A;  2KJB A;  2Z16 A;  1G3S A;  2JWT A;  5EGO B;  4OIN F;  1E0E A;  4OU0 A;  3F8B A;  2R7D A;  2L2O A;  2W25 A;  4ZC3 A;  1HLV A;  3HEF A;  1WH5 A;  5JR3 A;  3FXO A;  2DLL A;  3J7Y J;  3HDD A;  3QPH A;  2DJI A;  1QPM A;  3FXJ A;  3ZP5 A;  2JA8 J;  1XMA A;  2HVQ A;  2L9N A;  1HXD A;  3OV8 A;  2QSG X;  1Q1V A;  1GVJ A;  2GOM A;  1AA7 A;  3A2K A;  2VON A;  2GXB A;  1RR7 A;  3M7G A;  4AYB A;  2R5Z B;  1UMQ A;  3HHH A;  1SMY F;  1MBE A;  3CUQ A;  4MLO A;  4XIC A;  3DXJ F;  4IJA A;  4PJ0 C;  2K5C A;  2KRC A;  4CDG A;  1YJ9 I;  1S3J A;  5J1U A;  2MLK A;  4LOC A;  4XID A;  3LSP A;  1RES A;  2H8R A;  2IW5 A;  2JVH A;  2RNJ A;  3NAR A;  5F08 A;  4XLN F;  3GFI A;  3E3V A;  5IT3 A;  1ZRE A;  3I9V 2;  1SD7 A;  5DCM A;  1OCO H;  3DV8 A;  2RC4 A;  1HSJ A;  3HOX J;  2ESH A;  3OL4 A;  2NNN A;  5IPA A;  2EA4 A;  3E7L A;  4B4C A;  2XC7 A;  1R58 A;  5TGT A;  3H9Q A;  3NQO A;  4DIQ A;  4EM2 A;  5D5X B;  1EA3 A;  4WXH A;  3T1B A;  2HU9 A;  2DTR A;  2N8G A;  1I39 A;  1UAA A;  2XGE A;  3QPL A;  3KP4 A;  1X1A A;  2W85 A;  5EGO A;  2J5P A;  2EWN A;  2WWY A;  3PFI A;  4BE0 A;  3ABM H;  4BBS J;  2E5Z A;  4E7L A;  2O61 A;  3BC8 A;  3IH4 A;  3J81 K;  2KRF A;  2XF7 A;  5ICC A;  3MMY B;  5EZH A;  1YW8 A;  2PEX A;  4DOZ A;  4PGG A;  1WGX A;  4Z6Y A;  2Y9Z A;  1ETW A;  2IP2 A;  3A03 A;  4R1H A;  4A5M A;  3QRF F;  4DQ2 A;  1QA6 A;  2QBY A;  2XAQ A;  3GFL A;  3WGG A;  1KA8 A;  4CCN A;  5L3D A;  3CCQ I;  4A3J J;  1ENH A;  2DK5 A;  4BXX J;  4ZYE A;  3DBH B;  5K7Z A;  3R0J A;  3BOQ A;  5K7F A;  3JW4 A;  3HB9 A;  3G4S I;  3KX2 A;  3OYB A;  3EUA A;  4KMU X;  1FZP B;  4E7H A;  4IHY A;  2K9M A;  2IRF G;  3OIQ A;  4UV9 A;  3RIR A;  2Z1D A;  2TCT A;  2YX4 A;  2E1N A;  1ZR2 A;  3BY6 A;  2NOG A;  3VYS B;  1IN8 A;  2VC0 A;  2MYS A;  2X0L A;  2O7O A;  1XX5 A;  2XRL A;  4BHC A;  4MEY F;  4ENM A;  1LFB A;  2BYV E;  3CUO A;  3DQV C;  1IV8 A;  4S0H B;  5L3E A;  1D5Y A;  1IG7 A;  4HX7 A;  2R7X A;  1XGS A;  3PIP F;  1BIB A;  2ZNZ A;  5HOD A;  2Z5U A;  3MZ8 A;  2XB0 X;  5EF6 A;  2ZBK A;  2CUE A;  3BZK A;  3P9K A;  1LE8 A;  1BW5 A;  2FD5 A;  4Q4Z F;  1LDD A;  3F22 A;  2WY7 Q;  4LFU A;  1Z9C A;  2LRD A;  3LST A;  3OL3 A;  2L9V A;  1TWC J;  2HKX A;  2HDC A;  3OYM A;  1U6G A;  1QHG A;  3TL4 X;  3BR1 A;  2TRT A;  1SFE A;  2L02 A;  3CDL A;  4NHJ A;  4O6J A;  3DWL E;  3GTG J;  4BQA A;  3PFY A;  2EFQ A;  2MH2 A;  2O9L A;  3I64 A;  1HF0 A;  2E1O A;  5H6Q A;  5J8C A;  2ELJ A;  1JT6 A;  1Y8Q B;  4LLG F;  3SFI A;  1XTA A;  4II3 A;  4A3E J;  3A01 B;  1Y0U A;  4TV7 A;  1OYI A;  2JT1 A;  4RB0 A;  4YG2 F;  3RZO J;  4KUM A;  3JRA A;  2R7W A;  5EEG A;  5AIQ A;  2H8W A;  2DXI A;  2QQA A;  3EYI A;  2RGV A;  1W4M A;  4RAY A;  3ASN H;  1X4P A;  4I99 C;  1KYZ A;  2L9S A;  1XB4 A;  1W1W E;  2A68 F;  3CCY A;  1D0Y A;  2ZO4 A;  3BT9 A;  4GYI A;  3B6C A;  3GCM A;  1XGN A;  3BJO A;  1MIJ A;  1MJA A;  2V1N A;  4B3X A;  2Z3Y A;  1S72 I;  3R0A A;  1RUN A;  5FD6 A;  3RKQ A;  2LG4 A;  4NQW B;  3C2B A;  2XHK A;  2XKP A;  2XDV A;  4CZZ A;  4LK0 F;  2CUF A;  1XGM A;  2VKH A;  2FBK A;  2R93 J;  4IPA A;  2VQL A;  3W2W A;  4HNV A;  4IZZ A;  4H0E A;  5IT9 Z;  4C2U A;  4MFD A;  3FXK A;  3IAM 2;  4C3J J;  1W5C C;  2CUZ A;  2GBY A;  3G1L A;  1U0J A;  3RKY A;  1G2H A;  2KIS A;  4XLF A;  5LLQ A;  4BQN A;  2HOA A;  4KIF A;  3I58 A;  2VE8 A;  4QSH A;  3C18 A;  3A0B C;  3O8H A;  3OYE A;  3QOP A;  3K4J A;  3ECO A;  2W57 A;  3ECH A;  4M9S A;  4BXF A;  3I56 I;  5J6X A;  2ISY A;  1U5T B;  1X1B A;  1AHD P;  4ENN A;  2DA5 A;  1UZC A;  2XF5 A;  5JLW A;  3PIO F;  2KZG A;  4ZYH A;  1DGW Y;  3M8E A;  3DPT A;  2KDZ A;  1Y1V J;  3LAJ A;  1HKS A;  2JA2 A;  4PGH A;  4XSX F;  1MH3 A;  1OCC H;  3MFK A;  3CCR I;  1Y39 A;  4Y13 A;  2PJP A;  1Z1D A;  2PN6 A;  5FB2 A;  1JKR C;  1IN5 A;  2W1O A;  1FLI A;  2BZT A;  3F72 A;  5CQE A;  3CLQ A;  2R0Q C;  2ISZ A;  3S32 A;  1ZGW A;  4HYE A;  3SXY A;  4E6K G;  1IC8 A;  3QP5 A;  3Q0W A;  1TBX A;  5E79 C;  2LYC A;  3IC7 A;  3F9K A;  4KIS A;  2ID6 A;  3GO5 A;  2GZW A;  3S3N A;  3DP7 A;  4KIC A;  3DKX A;  2HI3 A;  4GXO A;  4BE2 A;  1B9N A;  4NQW A;  2XGX A;  3GTQ J;  4A3G J;  5J8F A;  1XSX A;  1T0F A;  3JRC A;  4B3A A;  3K70 D;  3HKZ A;  5HOO A;  2DMQ A;  3R4K A;  4KIB A;  2R7F A;  3OYK A;  5DTD A;  4AU7 A;  1BI2 A;  1MD0 A;  5H6R A;  4BH9 A;  1QU3 A;  3GW2 A;  3RCO A;  4B8X A;  1IAW A;  3BLY A;  1WZ2 A;  1WJ5 A;  5TJJ A;  2M30 A;  2OBP A;  2NOJ B;  3BG6 A;  4MTD A;  4KA4 A;  3BQY A;  2CV2 A;  5FJ8 J;  2OAZ A;  1X1P A;  1O7L A;  3H5N A;  3JCU C;  1J7K A;  5HDK A;  4CH7 A;  1VQ4 I;  1U5T A;  2EFP A;  3OS0 A;  3SDG A;  2XAH A;  2Q0O A;  1IF1 A;  3JSP A;  4CCO A;  4OIO F;  4Y52 J;  3GTM J;  2UWM A;  2V9P A;  1R00 A;  3E6C C;  4HF2 A;  3GTL J;  2OCC H;  1J09 A;  1ITY A;  2A07 F;  3OWT A;  2JRM A;  1QZY A;  1ZLK A;  4QIW N;  3RI4 A;  3L2U A;  1K6Y A;  3MAJ A;  1J2X A;  4A3L J;  2LDU A;  4J19 A;  2M2E A;  3A0H C;  3S15 J;  2BW3 A;  2X6O A;  1U8R A;  1I6X A;  2DT5 A;  3BCB A;  3TGN A;  4HBL A;  1XGO A;  1RR8 C;  1YS6 A;  3W6J B;  3K4C A;  1X3Z B;  1G59 A;  1H89 C;  3MN2 A;  1I6H J;  2X1E A;  4LIV A;  4OWR B;  3EET A;  3J80 Z;  2LR8 A;  5L3F A;  2IGN A;  3H35 A;  1A6Q A;  1HW2 A;  4AIH A;  5DS9 A;  3IV5 A;  1CF7 B;  3CJN A;  3F6V A;  5FKL A;  1ZG1 A;  1E2X A;  1E3H A;  1R5I D;  4L9N A;  4A3M J;  4IHW A;  2ZXW H;  4MO7 A;  4KT6 A;  3I59 B;  5ILV A;  4JX6 A;  3SYT A;  3E1S A;  2D1H A;  1D8K A;  4F55 A;  3H92 A;  4RLQ A;  1F5T A;  4BL0 B;  4LLL A;  1QZE A;  1T33 A;  2YPR A;  4BHB A;  4OIP F;  4S05 A;  5FFX A;  1WJF A;  4KIG A;  3P7N A;  2V6C A;  5FRN A;  4NUB A;  3CUQ C;  3BQZ A;  3E6D A;  5DM6 F;  4CGZ A;  1X19 A;  5E3L A;  5DEQ A;  3Q0V A;  4QWQ A;  1OR7 C;  4F93 B;  4CYC B;  3VOE A;  3KP5 A;  4PSW A;  3U1K A;  5E8I A;  4C2M J;  1ZYR F;  3LSG A;  2VBW A;  3HPG A;  3Q0U A;  3ZOB A;  2R4G A;  1MZB A;  1XMX A;  1S29 A;  5DUK A;  1Y0N A;  1PYV A;  4PSX A;  4ON0 A;  3FM3 A;  4ENJ A;  1ZEL A;  2HR3 A;  1JTX A;  2JN6 A;  2ZXH A;  2LF8 A;  1FYM A;  1MSF C;  1LVA A;  1V54 H;  2WAQ N;  1P6R A;  3JAM K;  5M3F J;  1U78 A;  4I2O A;  3B02 A;  3T5X A;  4D5C A;  2OV7 A;  4M3D A;  3BTI A;  1BN5 A;  1S7A A;  2MH9 A;  1CF7 A;  3HGY A;  2DOA A;  3W2A A;  2JQ7 A;  2IT0 A;  5BOX A;  3OY9 A;  4CHU A;  1RNL A;  1B4A A;  4ZZD A;  1X2N A;  3HSR A;  5LRR A;  1BC8 C;  2W24 A;  4UY8 I;  3BR5 A;  5LHI A;  2LKS A;  2O8X A;  3GFJ A;  1MJB A;  1WCM J;  5F04 A;  2W48 A;  1SAU A;  2P5K A;  2Y69 H;  2JPB A;  5HLT A;  1I1S A;  3F8C A;  1KU2 A;  2VKE A;  3CCV I;  3T8R A;  2BOL A;  4EMS A;  4CCK A;  2R5Y B;  2G7H A;  4DYQ A;  2NVT J;  5KAF C;  3LNQ A;  2HTS A;  3HGG A;  4BGD A;  3Q9V A;  1D3Y A;  4XRS G;  4NC6 A;  3VSL A;  5F0H A;  3BRO A;  1R23 A;  4U87 A;  1S6L A;  5CPR B;  2VT3 A;  3W2V A;  1VQ9 I;  4I0A A;  4DYR A;  2FX0 A;  2E71 A;  4LMY A;  2IJL A;  2I10 A;  3ZMV A;  4FIS A;  4CZC A;  1A35 A;  2YS9 A;  2QWW A;  4HEA 2;  1G3T A;  3I55 I;  3PM1 A;  4XOP A;  5FKO A;  2EIJ H;  1R5H A;  1ETQ A;  3WTY C;  2ME6 A;  4WXC A;  2VJI A;  3MQ0 A;  1AOY A;  3A1Y A;  3HTS B;  1OCR H;  3TO7 A;  3IH3 A;  4QPO A;  2EZH A;  3QYB A;  4PDK A;  2VIX A;  3FMS A;  2XGC A;  3V8L A;  2X6Y A;  4HF1 A;  4WK8 F;  4ESB A;  1UCR A;  2V79 A;  3OYL A;  2E34 A;  4L5E A;  4ENK A;  1AKH A;  2LC2 A;  3FK7 A;  3LSJ A;  1WFX A;  1BR2 A;  3BP8 A;  4Y3O A;  3J7A O;  4G6D A;  4U88 A;  2W84 A;  2KP6 A;  4JYK A;  1BW6 A;  2VJJ A;  3RKW A;  2GQQ A;  5DDG A;  1GXP A;  3FIS A;  1A5J A;  3ZPL A;  2QSH X;  1IDZ A;  2FRH A;  2LTP A;  3MKY B;  5FLX K;  5IT9 K;  4Y17 A;  3RKX A;  1KYW A;  2K85 A;  1T56 A;  3ESW B;  4ZJZ A;  5ILS A;  1XMK A;  4UUT A;  5KK1 A;  4CCM A;  1QVT A;  3HHG A;  3GLL A;  1WJE A;  3VSK A;  5FGM A;  2UXX A;  1FBS A;  4HAM A;  1RKW A;  2K7L A;  2E7W A;  2BY1 A;  3CCJ I;  3FZV A;  4B48 A;  2XRN A;  2W7N A;  3BZ6 A;  4LG0 A;  4ASN A;  1IXR C;  1F1Z A;  2NS7 A;  1QO0 D;  1TWH J;  2K9L A;  2NS0 A;  4W97 A;  2K3P A;  1BI3 A;  4ZH4 F;  1L0O C;  1MGT A;  1STZ A;  3BJ6 A;  3FBI B;  4FT8 A;  5E1X A;  2LBF B;  1TQP A;  4D5F A;  4U0Y A;  4Q5S F;  2D5V A;  3ULQ B;  3QYF A;  1RET A;  2MAB A;  2RNG A;  1SD5 A;  2STT A;  4G7H F;  1MW7 A;  1OMI A;  4YIR X;  4HDV A;  4AUX A;  1EH8 A;  5B5E C;  4RGX A;  3JR9 A;  2NRA C;  3DTK A;  3JTH A;  5L3C A;  3K2Z A;  4D0P A;  2QEX I;  4HOB A;  4L0Z B;  3J7A Y;  1D5V A;  5A2Q Z;  3I5U A;  4LD5 A;  2G9W A;  1N25 A;  1J75 A;  1KU7 A;  2DA2 A;  1JJ8 C;  1FSE A;  1SD4 A;  1KU3 A;  3BR2 A;  5K5R A;  3H9J A;  4IRG A;  4OIQ F;  1NG6 A;  1R6R A;  5C4X J;  3CCU I;  2XPV A;  3S2H J;  4IX7 A;  2O03 A;  4G94 A;  4HZF A;  5JVT A;  5LGT A;  5KCM A;  2VAS A;  2L01 A;  3PSI A;  5HLH A;  4KYW A;  2LNB A;  1FOY A;  4BXU A;  5L3B A;  5LBQ A;  2RN7 A;  1FOX A;  4R8H A;  2K4B A;  4UB8 C;  4P1W A;  2E35 A;  3PO3 J;  4Q47 A;  2WAD A;  3HRU A;  1EH7 A;  5BNG A;  3FXL A;  2BGC A;  4M73 A;  5D6F A;  2O5R A;  4KIT B;  3KEO A;  2O0Y A;  2WB1 N;  2JTV A;  3EYY A;  5C4J J;  2OJE D;  1SFU A;  1OYY A;  1EH6 A;  3ZMD A;  1DGR M;  3V7S A;  2DMT A;  4CCL A;  1R1V A;  2W4S A;  3K1M A;  1VQ8 I;  1Z91 A;  4HPQ A;  2HOT A;  1ZR4 A;  2BVM A;  3G6E I;  3K4L A;  4NC8 A;  1ZRC A;  2OQG A;  3LA2 A;  4DZJ A;  3HRM A;  2IGM A;  5CYV A;  4GYG A;  2STW A;  2LY9 A;  4I76 A;  1S7O A;  3ZQF A;  2ZJQ F;  3SEZ A;  2KIU A;  3KLO A;  3HIF A;  2QSF X;  2DQR A;  1FX7 A;  2F4I A;  2F5E A;  3LMM A;  2ICW G;  4F91 B;  2EH3 A;  3FK6 A;  1WI9 A;  2E2J J;  2ZJ2 A;  3WGI A;  1T0F C;  2CWE A;  3HUG B;  4DZP A;  2A5Y B;  2ELH A;  3SEQ A;  4AM3 A;  2R92 J;  5IYD J;  3GME A;  3DBR B;  4HRI A;  2OC6 A;  5D5V B;  2EFN A;  2VBY A;  2XPW A;  1FOK A;  2KIQ A;  1OCZ H;  1XSD A;  3C1D A;  2ETH A;  1FBQ A;  1LB2 A;  1TWG J;  2DFI A;  1NHA A;  3VYR B;  4MFE A;  3EQL F;  5F27 A;  1J0R A;  4L0Y B;  3HRT A;  1T39 A;  1ZH5 A;  3WTV C;  1K78 A;  1YTY A;  2OZ6 A;  1U5T C;  1MKM A;  4FX0 A;  1XS9 A;  2HQ5 A;  5E3N A;  1YQA A;  2LRE A;  5GTH C;  1O57 A;  4HX4 A;  3HYI A;  1YIJ I;  3CJQ B;  3W6K B;  1D1B A;  3WE2 A;  1Y1W J;  4HA8 A;  4OAZ A;  1FYL A;  3KLN A;  3K70 C;  3PNT A;  3RQI A;  1YYV A;  4M9Z A;  2M4K A;  2VQG A;  2XAU A;  5FD5 A;  3RQ4 A;  1VQM I;  1A31 A;  4A3F J;  1TQI A;  1OR7 A;  3CES A;  3IHU A;  3QOD A;  2CQQ A;  3CF2 A;  4ABZ A;  4BQQ A;  1N77 A;  1LQ1 A;  1J5Y A;  3WE3 A;  1QPI A;  1X3W B;  2ZXI A;  2NAZ A;  4M6X A;  3V7C A;  2KRH A;  1IN6 A;  3KPH A;  4JX5 A;  2JSP A;  5KHD A;  2E1M C;  2Y0S A;  3CD6 I;  2IAI A;  3WG7 H;  1S7E A;  2OTL I;  4ZDL A;  3WTW C;  2BV6 A;  3MZH A;  4LIU A;  3S2D J;  4C30 A;  4XQF A;  2VQC A;  4MGR A;  2DW4 A;  3K10 A;  1NTC A;  2PMZ N;  3HUG A;  5LRS A;  1WWX A;  3CP2 A;  1MBG A;  1MBH A;  4KT5 C;  3WU0 A;  1U2W A;  2K27 A;  2KHM A;  1MBK A;  2F2E A;  3W3C A;  4IQ4 A;  2DOE A;  2B9S A;  5IOZ A;  3HOS A;  1TLH B;  2FQ3 A;  1VFC A;  2BHZ A;  2R7V A;  4ETS A;  2H6B A;  1IN4 A;  1EV7 A;  4P96 A;  4M72 A;  4RAF A;  1TNS A;  3PO2 J;  1O7F A;  2GA2 A;  2V1X A;  4RMN A;  4XOR A;  4DNC A;  5D4R A;  1MJ9 A;  1DP3 A;  2LY1 A;  2ZNY A;  2DA7 A;  3CCM I;  2RVC A;  2R5Z A;  5KNL A;  1Z21 A;  4BJT A;  3S1R J;  1SAX A;  2V4J C;  1D0X A;  1QNT A;  2R7O A;  3KCC A;  2ZKZ A;  1MND A;  4XON A;  2DDA A;  2JJ7 A;  2RQP A;  2PI0 A;  2OQR A;  2E1C A;  1P9Q C;  1IXC A;  2H6C A;  3O2P E;  1ZGJ A;  2F48 A;  1CQT A;  2ID3 A;  3ZN1 A;  1F43 A;  5BPI A;  1NK3 P;  3OYA A;  4JQF A;  4A6D A;  1B9M A;  1IRF A;  1G8X A;  2XB5 A;  3MKW B;  3HOZ J;  3A4C A;  5ICF A;  3T8T A;  2L7K A;  3LL7 A;  1PUE E;  2X4H A;  1GLN A;  2NYX A;  2LP0 A;  3I0T A;  1BI0 A;  2HYG D;  1OJL A;  2PQ8 A;  2V26 A;  3KYC B;  3R60 A;  2A5W A;  5KAI C;  4E7Z A;  2IGO A;  2DT6 A;  3OYH A;  3HJE A;  3CCL I;  2XUB A;  1ACI A;  4FHT A;  4BS9 A;  4E4H A;  2CW0 F;  3TW6 A;  3ZQ7 A;  2OUM A;  3H0G J;  3CMY A;  1XN7 A;  4C3I J;  1FJL A;  2FEZ A;  2OU2 A;  4XM3 A;  1G4D A;  2Y48 A;  3SZG A;  1LEA A;  5D6E A;  2BXZ A;  2JUC A;  3QP6 A;  3HBL A;  4RM2 A;  2NVY J;  1X3U A;  2GAU A;  3K4B A;  3SJM A;  2GXA A;  4LIT A;  1JXS A;  2M7B A;  1NK2 P;  3FHZ A;  4IHS A;  4FAS D;  3LOC A;  4NNJ A;  4L5I A;  1Z6R A;  3G3Z A;  3VYT B;  4CSW A;  1I27 A;  3CJT B;  4GGG A;  2L9R A;  3K2A A;  3BR6 A;  1E3P A;  4A69 C;  2EV6 A;  1ETO A;  3OYJ A;  2WV0 A;  4A5N A;  2GA1 A;  2CSO A;  3DBL B;  1FOW A;  1A04 A;  3L09 A;  4JK1 X;  4XK4 A;  1I1G A;  3L7W A;  3WOD F;  3MKL A;  1UHW A;  4XLA A;  1W36 D;  2YU3 A;  5DCF A;  3KZZ A;  1H9G A;  4A0X A;  4MQ9 F;  2VLA A;  2YX7 A;  1E17 A;  1HA8 A;  5CLS A;  4KMF A;  3DTE A;  5D5W B;  2VE9 A;  1XCV A;  5L3G A;  3FF5 A;  2WTE A;  3VDX A;  4HST A;  2KMU A;  4AWX B;  4D7M A;  4MQV A;  2VOP A;  4HLY A;  1HKQ A;  2ZFU A;  3V7R A;  3DFG A;  5AON A;  5LFA A;  2JA7 J;  1MBJ A;  3B73 A;  5D8K B;  2VXZ A;  4RLF A;  4Q48 A;  1RI7 A;  2HXI A;  3DEW A;  4N9I A;  1ETK A;  4LJZ F;  3RPU D;  1HBX G;  4GO1 A;  1YW7 A;  2E36 A;  2FQ4 A;  4G6Q A;  1I3A A;  2KJC A;  5GPA A;  4NC7 A;  2FF4 A;  2MA3 A;  2BHY A;  4XN0 A;  4BDY A;  4L5J A;  4HNT A;  3OSF A;  3W6V A;  5HDN A;  5DM7 F;  3AL0 C;  1YO5 C;  3KP3 A;  4F7Z A;  3ONQ A;  4FE4 A;  1YIT I;  3A01 A;  1A6I A;  2M1B A;  5F6F A;  1KGS A;  1UHS A;  3BJA A;  3ZMZ A;  4A0Y A;  2JMW A;  3OIP A;  2EFW A;  4JBA A;  1N78 A;  4WXD A;  3NAU A;  5GAD J;  4DBQ A;  2EZK A;  1B72 B;  3AG3 H;  4IO9 F;  2ACJ A;  3HOU J;  5CKT A;  2DCE A;  4PJM A;  2KPM A;  2P7V B;  5J40 A;  1Z05 A;  2H1L A;  2E1M B;  1ON2 A;  3OR2 C;  4FX4 A;  4XBF A;  1IN7 A;  4EJU A;  4A12 A;  1LJ9 A;  5D4S A;  4ITV A;  2HQR A;  2QQB A;  5HS7 A;  4B47 A;  5JVG F;  1BL0 A;  1QRY A;  1FC3 A;  2FOK A;  1SEU A;  3RYR A;  2JA6 J;  2L4M A;  1EKE A;  1BOB A;  1R4N B;  2MD0 A;  3NRV A;  4IHX A;  1USS A;  1JGS A;  2E60 A;  3LSH A;  3MWM A;  3V42 A;  4IKF A;  3BPX A;  4YFK F;  5IY5 H;  3M1E A;  1F9N A;  3JRG A;  2DOF A;  3UR3 C;  3HSE A;  4XLE A;  5M3M J;  2D45 A;  1ETY A;  1B59 A;  1ZHF A;  3JRF A;  2VPL A;  2DFE A;  4R79 A;  2M9H A;  1P4A A;  3WU1 B;  1O3S A;  1MMS A;  3GX4 X;  3OOU A;  4MIM A;  1SD6 A;  2AS5 F;  1B1B A;  1A36 A;  5IP7 J;  3JRI A;  2FXA A;  4IRI A;  3S1Q J;  3MD2 A;  1OIS A;  1WI3 A;  1TW3 A;  2Q2E B;  1DU0 A;  5F64 A;  2HZD A;  3ML6 A;  2OCE A;  2EA2 A;  2W00 A;  3QOE A;  4A3D J;  1ZK8 A;  4EM0 B;  2ZCW A;  1GV5 A;  3GTP J;  1HST A;  1PUF B;  5BPD A;  1SC7 A;  1UB9 A;  3F23 A;  3TP0 A;  5ICE A;  1VQ5 I;  4BQO A;  1QVU A;  1B72 A;  1K4T A;  3S3O A;  3PJR A;  4JOM A;  4A93 J;  4XKV A;  5FRM A;  4CA0 A;  1W0T A;  3NWS A;  2R7Q A;  3OMY A;  3OR1 C;  1DP7 P;  5GAG J;  1XPX A;  4I01 A;  2L7F P;  2W82 A;  2F5V A;  3QPS A;  2VBZ A;  2EQR A;  3CLO A;  1S5L C;  1V3F A;  1TP4 A;  2Q1Z B;  1N75 A;  3DLA A;  2FU4 A;  3HM5 A;  3OS2 A;  4ZTJ A;  2Y31 A;  3D5L A;  3LSK A;  3L2Q A;  2IPQ X;  4BBR J;  3L2C A;  4UVA A;  4EM1 A;  4M74 A;  4XRS A;  4N4N B;  5D8L B;  1T95 A;  3HC7 A;  4CO8 A;  4Y33 A;  1XG1 A;  1UJ8 A;  3G73 A;  3WTT C;  2HOE A;  5B1B H;  4FQG A;  2WAF A;  4E7S A;  2A69 F;  2ESN A;  2Y0M A;  4IHT A;  4ESJ A;  4ZTF A;  2JZY A;  2KIM A;  3SHF A;  4IEJ A;  1TT5 B;  4AC0 A;  1VQP I;  1IRZ A;  3FMQ A;  4EJW A;  3BTC A;  3H36 A;  1WRJ A;  3N97 A;  1HW5 A;  4M6Y A;  2GIZ A;  4N9H A;  3EUH C;  2Q2E A;  1D1A A;  5E8G A;  5EDN A;  4M6V A;  2QVO A;  1HCR A;  2CFX A;  4XKW A;  3HOY J;  2VT2 A;  4M71 A;  5ILU A;  1PUF A;  1Y8R B;  2HYJ A;  3GUD A;  1TZL A;  1R4M B;  3TO6 A;  1H88 C;  4HDU A;  2EK5 A;  3RPQ A;  2KL4 A;  2ECC A;  3BG5 A;  5CQG A;  1PVE A;  3QPT A;  2DPD A;  1UHM A;  3KP7 A;  1X4O A; 
#chains in the Genus database with same CATH homology
 3IH4 A;  5IP9 J;  3ZQC A;  2RAE A;  1OCP A;  4M3B A;  5EZH A;  4QTR A;  5C4X J;  3S2H J;  2XPV A;  1IUF A;  1WGX A;  2Y9Z A;  1ETW A;  1FIP A;  3LSR A;  3A03 A;  2MSY A;  1Z77 A;  4W1U A;  1JGG A;  4RDU A;  4A3J J;  3S17 J;  1ENH A;  3UKG A;  4BXX J;  1WH7 A;  3BG9 A;  5K7Z A;  3PO3 J;  5K7F A;  4A3K J;  3HB9 A;  5BNG A;  1X2M A;  1JKP C;  1JTY A;  4AYB N;  2WB1 N;  5C4J J;  3A02 A;  5M5Y J;  4Y7N J;  3BR0 A;  5J3L A;  4IHY A;  2GLO A;  2YUS A;  4V2F A;  2DMT A;  2TCT A;  2HOS A;  2M34 A;  1ZR2 A;  2NOG A;  1ETX A;  1GT0 C;  2EZI A;  4CYC A;  2K9S A;  2O7O A;  2XRL A;  2HOT A;  2H1K A;  5IYB J;  1ZR4 A;  1LFB A;  3MVP A;  4S0H B;  1D5Y A;  1IG7 A;  4DZJ A;  2NS8 A;  2Y0S N;  5HOD A;  2LY9 A;  4I76 A;  3ZQF A;  2E19 A;  4X6A J;  2XB0 X;  5EF6 A;  1GV2 A;  2CUE A;  2K9N A;  1LE8 A;  1BW5 A;  2EH3 A;  2FD5 A;  3FK6 A;  3WHC A;  2E2J J;  1K61 A;  1H8A C;  4DZP A;  5K7H A;  2DA4 A;  5IYD J;  2R92 J;  2E2I J;  1X58 A;  2LKX A;  2XPW A;  1TWC J;  1IJW C;  3S14 J;  1MH4 A;  3GBG A;  3BR1 A;  2TRT A;  3CQZ J;  1TWG J;  3CDL A;  3K7A J;  4MFE A;  3OSG A;  3GTG J;  1U9O A;  5F27 A;  2O9L A;  5C3E J;  1HF0 A;  2P81 A;  2E1O A;  3B6A A;  1HDD C;  1XS9 A;  2HQ5 A;  5E3N A;  3OIO A;  5GPC A;  3FIW A;  1FEX A;  1JT6 A;  3SFI A;  4A3E J;  4DYC A;  1Y1W J;  3A01 B;  2R5Y A;  3BR3 A;  3RZO J;  3S1M J;  1HOM A;  3JRA A;  4M3F A;  1AU7 A;  1JKO C;  2B63 J;  3RQI A;  3JRH A;  3L1P A;  2CJJ A;  1JUS A;  4IHV A;  4A3F J;  3FKI J;  2HDD A;  2CQQ A;  2QF7 A;  4ABZ A;  1QPI A;  3I4N J;  1ZQ3 P;  1XC5 A;  3CCY A;  2DN0 A;  4JX5 A;  3BT9 A;  2DTZ A;  3B6C A;  2IAI A;  1S7E A;  4A3C J;  3RKQ A;  3S2D J;  2Y9Y A;  4NDL A;  3C2B A;  3JRE A;  3BTJ A;  3BTL A;  1VI0 A;  4BY1 J;  2IEK A;  2CUF A;  1NTC A;  2PMZ N;  2R93 J;  4HNV A;  2DA1 A;  3I4M J;  4MFD A;  4C3J J;  2GBY A;  3G1L A;  1Z0X A;  1MBG A;  1MBH A;  4A3B J;  1G2H A;  2LFB A;  2ME0 A;  1K83 J;  1B8I B;  1MBK A;  2HOA A;  1MBF A;  2ZB9 A;  3JRD A;  4QSH A;  3RZD J;  3O8H A;  5IOZ A;  1VFC A;  1AHD P;  3BG3 A;  2EBI A;  2DA5 A;  2DMN A;  3TW7 A;  1O4X A;  1U8B A;  3S16 J;  2DJN A;  5JLW A;  3PO2 J;  1TWA J;  2FJ1 A;  2Y2Z A;  1TWF J;  2DA7 A;  2KDZ A;  1Y1V J;  2M8G X;  4X1E A;  1JT0 A;  2R5Z A;  1MH3 A;  3S1R J;  2VKV A;  1R9T J;  1JKR C;  2E2H J;  1OFC X;  4D7N A;  2JJ7 A;  5IP6 A;  2R0Q C;  2G0E A;  5IYC J;  1BA5 A;  1ZGW A;  3D1N I;  1IC8 A;  4GFB A;  3Q0W A;  1AKH B;  1MSE C;  5FKM A;  1CQT A;  2ID3 A;  2ID6 A;  1F43 A;  2AO9 A;  4B1R A;  1NK3 P;  1ZKG A;  3HOV J;  2NVX J;  2MGQ A;  2HI3 A;  2XB5 A;  5J1Y A;  3HOZ J;  3M3Y J;  3TED A;  5EEA A;  3GTQ J;  4A3G J;  4BKX A;  2XGD A;  5F1J A;  3JRC A;  1U9N A;  2LP0 A;  4B3A A;  1P7I A;  2DMQ A;  3ZQI A;  3GTO J;  4I6Z A;  5DTD A;  1VND A;  3ZQG A;  1JUP A;  1OJL A;  3ZQH A;  2ECB A;  3S1N J;  1OCT C;  1B8I A;  2MG4 A;  3BQY A;  5FJ8 J;  3TW6 A;  3H0G J;  3G1O A;  3CMY A;  4C3I J;  1FJL A;  5M5X J;  1FTZ A;  1IGN A;  4XRM A;  3SDG A;  1IDY A;  1POG A;  2JA5 J;  1SAN A;  4Y52 J;  3GTM J;  3HBL A;  2NVY J;  3GTL J;  1ITY A;  1JKQ C;  3SJM A;  5FKK A;  3ZQL A;  4QIW N;  1NK2 P;  4A3L J;  4J19 A;  2M2E A;  3LOC A;  3GTJ J;  3S15 J;  2LK2 A;  2X6O A;  2EZL A;  3JRB A;  2L9R A;  3K2A A;  3BR6 A;  4A69 C;  1DU6 A;  1ETO A;  5EZG A;  3MN2 A;  1H89 C;  4G12 A;  1I6H J;  1ETV A;  1F36 A;  2LLK A;  4UUS B;  1ORK A;  2LR8 A;  3QQA A;  5DS9 A;  3IV5 A;  1I3Q J;  4XK4 A;  2VI6 A;  5FKL A;  3MKL A;  5C44 J;  5GP9 A;  4A3M J;  4IHW A;  4MO7 A;  4FTH A;  4JX6 A;  2Y30 A;  4M3E A;  1T33 A;  4D7M A;  1YRN B;  3TP3 A;  2L7Z A;  3HKZ N;  2MW8 A;  2JA7 J;  1MBJ A;  3BQZ A;  2DA6 A;  2HXI A;  2DMP A;  2L7M P;  5E3L A;  3DEW A;  5IOY A;  1ETK A;  2CQX A;  3Q0V A;  2DA3 A;  2FQ4 A;  4CYC B;  5GPA A;  4C2M J;  2YU9 J;  3LSG A;  2ELK A;  1I50 J;  3Q0U A;  3ZOB A;  4EEF G;  5F0C A;  2OPT A;  5FLM J;  2QCO A;  3OSF A;  1LFU P;  3W6V A;  1TC3 C;  1GVD A;  1JTX A;  1LE8 B;  2JN6 A;  4FE4 A;  3A01 A;  1A6I A;  1MSF C;  1GUU A;  3H3V K;  4C3H J;  5J1R A;  3DCF A;  1UHS A;  5JLX A;  4JP0 A;  2WAQ N;  3HOW J;  1IV6 A;  2JMW A;  5M3F J;  1U78 A;  2LD5 A;  3NAU A;  4D5C A;  1RKT A;  4UUS A;  1JUM A;  2EZK A;  4M3D A;  2XSD C;  2K40 A;  3BTI A;  1B72 B;  3HOU J;  2XPU A;  3HGY A;  4JX4 A;  4DW6 A;  1RPW A;  4FE7 A;  1X2N A;  1SFO J;  2K9Q A;  3BR5 A;  3WHB A;  2O8K A;  1WCM J;  5F04 A;  2W48 A;  1BL0 A;  1QRY A;  2JA6 J;  2NVQ J;  2VKE A;  1E3O C;  2OF7 A;  2R5Y B;  9ANT A;  4DYQ A;  2AHQ A;  2NVT J;  1YRN A;  1P7J A;  4IHX A;  3LNQ A;  2DMU A;  3HGG A;  2WV1 A;  5F0F A;  4XRS G;  1GDT A;  5F0H A;  1ZTR A;  3JRG A;  5EG0 B;  4V2G A;  2IBD A;  1WPK A;  5M3M J;  4DYR A;  2FX0 A;  3GTK J;  1ETY A;  2I10 A;  3F0C A;  2X9D A;  4FIS A;  5E3O A;  3JRF A;  1W0U A;  2M9H A;  2YS9 A;  2LVS A;  2JK3 A;  3OOU A;  2COB A;  5EYR A;  2R7Z J;  3PM1 A;  5FKO A;  4MIM A;  4BY7 J;  5IP7 J;  3O8G A;  3JRI A;  1EF4 A;  1MNM C;  3S1Q J;  1ETQ A;  5FLV A;  1WI3 A;  2ME6 A;  1DU0 A;  3VPR A;  2CRG A;  4A3I J;  4A3D J;  1ZK8 A;  3IH3 A;  1GV5 A;  3GTP J;  1PUF B;  2EZH A;  3G1M A;  2HXO A;  3TP0 A;  2JWT A;  5EGO B;  1BJZ A;  2XGC A;  1QVU A;  2L0K A;  1B72 A;  4A93 J;  4L5E A;  1HLV A;  1AKH A;  3FK7 A;  3HEF A;  1WH5 A;  3LSJ A;  1W0T A;  1HDP A;  2L7F P;  3HDD A;  2JA8 J;  3M4O J;  1FIA A;  3QPS A;  4JYK A;  1UG2 A;  2GM4 A;  1BW6 A;  1Q1V A;  2EQR A;  4RBO A;  3FIS A;  1A5J A;  3HM5 A;  3Q3S A;  1FTT A;  1IDZ A;  2Y31 A;  2LTP A;  3IH2 A;  1RR7 A;  4BBR J;  2R5Z B;  1T56 A;  1VF9 A;  4M3G A;  4XRS A;  1UMQ A;  1MBE A;  4MLO A;  4XIC A;  4UUT A;  1XG1 A;  1JJ6 C;  5M5W J;  2X48 A;  1QVT A;  5J1U A;  5EG0 A;  3LSP A;  4LOC A;  4XID A;  1APL C;  1RES A;  2H8R A;  3NAR A;  5F08 A;  1RKW A;  2KT0 A;  4IEJ A;  4AC0 A;  2NS7 A;  3HOX J;  1TWH J;  4W97 A;  5IPA A;  1IRZ A;  3E7L A;  4B4C A;  3BTC A;  2M0C A;  4FCY A;  4D5F A;  2CU7 A;  2D5V A;  5EDN A;  1RET A;  4M6V A;  1HCR A;  2N8G A;  4AUX A;  3HOY J;  5E3M A;  3JR9 A;  1PUF A;  2XGE A;  3QPL A;  2HYJ A;  1H88 C;  5EGO A;  2VPR A;  5FKN A;  2DA2 A;  2ECC A;  4BBS J;  1JJ8 C;  3BG5 A;  2VUM J;  3BR2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...