2L7FP

Solution structure of the pitx2 homeodomain
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
68
structure length
68
Chain Sequence
GSQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKREEFIVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Pituitary homeobox 2
publication title Solution Structure of the Pitx2 Homeodomain
rcsb
source organism Homo sapiens
total genus 20
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2010-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2l7fP00
4W1UA 5EG0B 4RDUA 2DMNA 4LOCA 3BG9A 1JTYA 2HOAA 3JRCA 1HLVA 2XB0X 1GV5A 3JRBA 2EH3A 3K2AA 1T56A 2CJJA 2LR8A 4C3IJ 3FK6A 3UKGA 3W6VA 3BTIA 1K61A 5IYCJ 3S2DJ 1IC8A 3LSRA 4UUSB 4D5FA 1IUFA 2CQQA 3IH3A 5IYDJ 2E2IJ 1X58A 2GBYA 2LFBA 3A01B 4MO7A 4FTHA 3GTKJ 2B63J 1NK2P 3A02A 5F0HA 3BTLA 2JA5J 3E7LA 1U9OA 2DJNA 1ZR2A 3S1NJ 5E3OA 2H8RA 3SJMA 2NVYJ 4J19A 4M3FA 1W0UA 3CCYA 3LSJA 3I4MJ 2LK2A 2R5YB 2ELKA 4AYBN 2R93J 4B1RA 3ZQGA 3JRIA 4RBOA 1RKTA 2MW8A 2FJ1A 3G1MA 1BW5A 2NS8A 3LSGA 3NAUA 1WI3A 2R92J 2O7OA 1IG7A 1FIPA 5FJ8J 1P7JA 3F0CA 1OCTC 2CUFA 1UHSA 2XRLA 1JTXA 5EYRA 3IV5A 3QPLA 4XICA 2EQRA 1MBJA 3HEFA 3GTMJ 4JX4A 4XRSA 1JKPC 3HM5A 2LY9A 3LOCA 1LFUP 1MSFC 1U78A 4FE7A 1SANA 1H88C 1JT6A 2KT0A 1ZR4A 3MVPA 4A3BJ 1U9NA 1OCPA 2XGCA 5DS9A 5IP6A 4Y52J 4JX5A 5JLXA 3TEDA 1FJLA 3ZQCA 1NK3P 1WPKA 4IEJA 3CDLA 3ZQFA 1AKHA 1JUPA 2LKXA 1Y1VJ 2Y2ZA 5M5WJ 2JJ7A 5EEAA 3S17J 5EZGA 4FCYA 3C2BA 3FKIJ 2LVSA 3OSFA 3BTJA 3CQZJ 3HOUJ 1ETWA 2DN0A 4A3JJ 5F1JA 5C4JJ 2DMUA 4FISA 4M3GA 3TW6A 2HI3A 1ITYA 2K9QA 4DYQA 1B72B 4QTRA 3HOZJ 5IOZA 3Q0WA 3BG5A 1RPWA 2JK3A 4UUTA 1AHDP 5EGOA 5EDNA 5M3FJ 4W97A 2EZLA 2COBA 1AU7A 4A3DJ 1IJWC 5FKMA 2R0QC 2P81A 1ZTRA 2L7ZA 4CYCA 1T33A 4BKXA 2MSYA 3B6AA 1MBKA 2ME6A 2VUMJ 4XK4A 4BY1J 2JA8J 3BTCA 2O8KA 3TP0A 4X6AJ 1P7IA 4QSHA 2LD5A 1VNDA 2HOTA 1JUSA 5E3MA 2JA7J 1B8IA 2TRTA 3G1OA 1HDPA 5F04A 4IHXA 3HOYJ 4NDLA 3JRDA 4A3FJ 1ETKA 4MLOA 1VI0A 3JRAA 4Y7NJ 3S16J 1RESA 4AC0A 5M5XJ 3DEWA 2HXOA 4A93J 1XS9A 2L7MP 5IOYA 1MBGA 1DU0A 3BR6A 4JX6A 3JRGA 1JJ8C 1MBHA 1PUFA 2VKVA 1JT0A 1ZK8A 1WCMJ 2XPVA 1GVDA 2M34A 3BR0A 1ZKGA 4DW6A 2KDZA 3RQIA 2CU7A 1TWGJ 1LE8A 4I76A 1RETA 3JRFA 4D7NA 1TWFJ 3FK7A 2D5VA 2GLOA 1D5YA 3K7AJ 2DMQA 9ANTA 2NVXJ 4S0HB 5J1UA 2DA7A 4IHYA 1QRYA 2RAEA 3MN2A 5JLWA 2AHQA 1X2MA 2DA4A 1ETOA 3B6CA 3Q0VA 4DYRA 3IH2A 2IBDA 1F43A 1GV2A 3IH4A 1YRNA 2ECCA 2JMWA 2ECBA 2FQ4A 5FKNA 2JWTA 5J1RA 3QQAA 1ZQ3P 1JKOC 1EF4A 3QPSA 1LFBA 4MFDA 2DA2A 4C2MJ 5IP9J 2XSDC 4GFBA 4A3MJ 1I6HJ 3DCFA 2R7ZJ 3GBGA 1MBFA 3WHCA 1BW6A 1UMQA 2OF7A 5FLMJ 1G2HA 2NOGA 1GUUA 3HOVJ 3GTLJ 2DMTA 3MKLA 3BT9A 3HOXJ 3O8GA 2X9DA 4A69C 1PUFB 4A3GJ 1O4XA 3L1PA 4X1EA 3HBLA 2K9NA 4BBRJ 2NVQJ 2W48A 4IHVA 2XB5A 5E3LA 3BR2A 3O8HA 3Q0UA 1I3QJ 1BA5A 5EF6A 1FEXA 1I50J 2L7FP 5M5YJ 3S1QJ 3BR5A 3BG3A 4A3LJ 1ENHA 5GPAA 2Y0SN 3FIWA 2E1OA 4UUSA 5IP7J 2EBIA 2ID3A 2R5ZA 3S1RJ 4XRMA 1R9TJ 1MH4A 1APLC 3OIOA 2O9LA 1GDTA 3A01A 2QCOA 2ME0A 2JA6J 4HNVA 2CQXA 4A3KJ 2Y30A 3BQZA 4V2FA 3RKQA 2K40A 1QVTA 3S1MJ 1WGXA 3M3YJ 3SDGA 1OJLA 4M6VA 1TWAJ 5K7HA 5HODA 2E19A 2PMZN 3LSPA 1RKWA 3M4OJ 1FTZA 4DYCA 2L0KA 2HYJA 2I10A 1JUMA 2MG4A 2X48A 1X2NA 2ZB9A 5BNGA 3ZQIA 1DU6A 2H1KA 4M3EA 4QIWN 2R5YA 2DA1A 3FISA 4A3EJ 1Z77A 3GTPJ 2XPWA 2M9HA 4BXXJ 1A5JA 1ZGWA 3PO2J 2NVTJ 2M0CA 1F36A 5F08A 3SFIA 5K7ZA 3H0GJ 2Y31A 1HF0A 2IEKA 4MFEA 5K7FA 1UG2A 1AKHB 2DMPA 1BJZA 3PO3J 4M3DA 5EZHA 4DZPA 3PM1A 3TW7A 3GTOJ 3OSGA 5FKOA 3GTGJ 3JRHA 3S15J 1ORKA 1JKQC 2M2EA 1IDYA 4FE4A 1ETQA 3JR9A 2HDDA 3VPRA 2ID6A 3HB9A 1K83J 4ABZA 4C3JJ 2YU9J 2VI6A 5C44J 3S2HJ 2LP0A 2R5ZB 4M3BA 3BQYA 4BBSJ 1Q1VA 3HDDA 2AO9A 2G0EA 4BY7J 5FKKA 5GP9A 5EGOB 2XGEA 1Z0XA 1ETVA 3LNQA 1BL0A 3OOUA 4MIMA 4D5CA 3HOWJ 4CYCB 3WHBA 1ETYA 5F0FA 5F0CA 2LTPA 1MSEC 3HGYA 1A6IA 2M8GX 2TCTA 3BR1A 2E2JJ 1OFCX 1H89C 2DA5A 3JREA 4IHWA 1B8IB 1WH5A 4L5EA 1FTTA 3ZOBA 4C3HJ 1U8BA 2WAQN 1IDZA 2Y9YA 4AUXA 4JYKA 2GM4A 2WV1A 1W0TA 1B72A 4I6ZA 2VKEA 2FD5A 1CQTA 1HCRA 3S14J 2EZKA 2L9RA 2X6OA 1JJ6C 1MBEA 2XGDA 2WB1N 5FKLA 1H8AC 4G12A 1SFOJ 5E3NA 2XPUA 5C4XJ 1NTCA 5IYBJ 3H3VK 1RR7A 5EG0A 3HKZN 1IV6A 4B3AA 3D1NI 1FIAA 2HXIA 5DTDA 4DZJA 5IPAA 2EZIA 1LE8B 5F27A 2JN6A 3RZOJ 1ETXA 1XC5A 3RZDJ 1JKRC 2LLKA 1QVUA 3GTJJ 1QPIA 5J3LA 1POGA 2OPTA 5C3EJ 2CUEA 3A03A 3TP3A 1MH3A 4B4CA 5J1YA 1Y1WJ 4EEFG 2QF7A 1VF9A 3G1LA 1VFCA 3ZQLA 1E3OC 5GPCA 1S7EA 2HQ5A 4V2GA 2E2HJ 2DA6A 3BR3A 1JGGA 3HGGA 2MGQA 1TC3C 1YRNB 1TWCJ 2Y9ZA 1HOMA 4A3IJ 3ZQHA 1MNMC 2FX0A 2DA3A 3NARA 3I4NJ 5M3MJ 2EZHA 2VPRA 1TWHJ 2DTZA 2N8GA 1XG1A 4JP0A 3CMYA 2CRGA 2YUSA 2K9SA 1HDDC 3Q3SA 1GT0C 2NS7A 5FLVA 1IRZA 4XRSG 4D7MA 1WH7A 4XIDA 4A3CJ 2YS9A 1IGNA 2HOSA 2IAIA 3GTQJ
chains in the Genus database with same CATH superfamily
5EG0B 1DUXC 2HZDA 3FMQA 1Z05A 3NQOA 2NVUB 1TQIA 5GAGJ 1QHHD 1E2XA 2L01A 3MZ8A 4FX4A 3JRBA 1Z3XA 3BOQA 1LDKB 2P0WA 5BS6A 1Y8RB 3B73A 3RYRA 2R3SA 2BXYA 4RAGA 4C3IJ 1W1WE 5FRNA 5DM7F 1WKMA 3BTIA 4DJAA 1K61A 4U0VA 2COMA 2IW5A 1IC8A 1R23A 1D0ZA 3H92A 3GYHX 2QGUA 4D5FA 1IUFA 1MMAA 4XRFA 4XKCA 1QGPA 1PDNC 2R7TA 3I4PA 2IGNA 2LFBA 2XHKA 5B5EC 5HDKA 4YFXF 3RDIA 3A01B 4MO7A 4FTHA 4A6DA 3H3UA 4ZDOA 4RLFA 3TBIA 1MMSA 3OMYA 1QO0D 3MFKA 5LEJA 1DGWY 5F0HA 2JA5J 3E7LA 4HSRA 4BE0A 2DJNA 1NH3A 2G7UA 5LHHA 3W2WA 2R7RA 1V5GA 2W57A 3L00A 3IAS2 1XMKA 1PUEE 2NVYJ 4JBAA 2PJRA 2QENA 3IWZA 4YFNF 4AIJA 3CCYA 2V9KA 3WTYC 3C7JA 3I4MJ 1U0JA 1O3QA 1IN8A 4UHTA 2R93J 2CUJA 3L2QA 5LEKA 1YIJI 2MW8A 3FDYA 3F23A 1BW5A 1W5CC 4EATA 4U7DA 2NS8A 3LSGA 5DV5A 1K6OA 1IG7A 2EFPA 1Z7UA 2XAJA 4U0YA 2Y69H 2Y48A 3F0CA 3WU2C 2CUFA 4BQAA 1VQNI 3H9GA 2VKDA 3EETA 5EYRA 2EQRA 4AD9A 4XRSA 4NNJA 5J47A 1LFUP 3LOCA 2V1UA 1BIBA 1UCRA 3ABUA 2O3FA 3VEPA 3CC2I 3MVPA 4A3BJ 1FOWA 1FBQA 1MIJA 6PAXA 3G71I 4Y52J 2EPFA 1F1ZA 2VN2A 1UHMA 2M7BA 5D5XB 2IXSA 5CLSA 2CQNA 1Q1HA 1WPKA 4HZFA 2LKSA 4IKFA 3HJEA 2Y2ZA 4HAMA 3TO7A 3UR3C 4KT5C 1G3WA 2BVMA 4LD5A 1W36C 2EINH 4GCVA 1RI7A 3E6BA 3H9QA 3R0JA 1XX5A 4F93B 2RGVA 1A04A 1TTYA 2GQQA 2DN0A 1TT5B 3GMEA 4M3GA 3WTXC 3GX4X 2HI3A 1RRJA 4IL6C 4XQFA 2WAFA 2X6YA 4DYQA 3F8BA 3LA7A 4RB1A 4HDVA 2KDOA 1J75A 4HQMA 1RPWA 4ETSA 4HF2A 4UUTA 3IUOA 3AG4H 1X4OA 2A07F 4W97A 3GEZA 4L5IA 4OIPF 4A3DJ 1ULYA 4KN7X 5ILVA 3BY6A 3EUAA 1HSJA 2P81A 5F6FA 2JT1A 1WJBA 1T33A 1OR7A 2GXGA 3BTCA 2O8KA 1IN6A 3TP0A 4OIOF 3H5RA 5CVIA 5F64A 3KLNA 2BY1A 4IQJA 3VDXA 5BMZA 3HOYJ 4L0ZB 1F4KA 2K86A 4A3FJ 2PQ8A 2IS6A 3S16J 3OY9A 4PFPA 3I59A 5E17F 1XS9A 4A6EA 3GTPJ 4BQOA 2H8WA 2L02A 2Q0OA 1MBHA 4KN4X 3FXOA 3HKZA 3IL2A 3PSFA 1FP2A 3K4MA 2FUG2 1J59A 2IVMA 1WCMJ 2NNNA 2M0MA 3BR0A 4DW6A 2MFZA 2ELJA 2WY8Q 3KEOA 3FF5A 3TOAA 1YJNI 2A5WA 2G7HA 1TWGJ 4U7BA 1E17A 3IKVA 1MJ9A 2X4HA 5GAEJ 1ACIA 1Z3YA 1RETA 4AU7A 1MD0A 2FMYA 4KIGA 4PGGA 1TWFJ 4EQQA 2OC6A 2UWMA 4HF1A 3G6EI 1MKMA 2LBFA 2XC7A 1XMXA 2DFIA 1BI3A 2EIMH 5HS7A 2NRAC 2DPUA 4KFCA 2X1CA 1S29A 3CJRB 1LVAA 2NVXJ 3WGHA 2OAZA 3BJOA 2DA7A 1QRYA 3HYIA 2UXNA 1X2MA 2BGCA 1AOYA 3B6CA 2CV2A 1BBYA 1GHCA 3IH2A 1JI8A 1YRNA 5JI6A 3ZPLA 1ONVA 2JWTA 4G9YA 5D4RA 3CZ6A 3E6CC 1EF4A 1P92A 1JKOC 3DBLB 1G2HA 1FBUA 3CUOA 2GAUA 4N9IA 2WBMA 5HNFA 4A3MJ 3A0HC 4GFBA 2VPLA 2R7ZJ 3FXUA 1IO2A 3MD2A 5HLHA 1ZARA 5GAHJ 4O3MA 5HS8A 1BW6A 1UMQA 3GCMA 4E7JA 2NOGA 3RQ4A 3GTLJ 2QM3A 3O8GA 3ZMUA 1HW2A 1FPQA 1PUFB 4XKVA 4A0ZA 4S05A 4DOZA 1WHUA 4AWXB 4B3XA 2EB7A 1S6LA 4BQQA 2W48A 1D0YA 2DJIA 2XB5A 3CLQA 1N75A 5E3LA 5ICEA 3BR2A 4Q5SF 4BUPA 5CVVA 3E1SA 3QOEA 1YW9A 4PJJA 1L3LA 2XKOA 2X51A 3BP8A 1I50J 3ZR8X 2L4MA 2Y75A 1HXDA 4IQ4A 3S1QJ 4H4KC 4CO8A 4ENNA 4A3LJ 1ENHA 5AIPA 3IHUA 3DKXA 2PJRB 3D5LA 3FIWA 3F8MA 2V6EA 4XNFA 2XDVA 4RAYA 5LHIA 2KZVA 4UUSA 2R5ZA 2ID3A 2QKMB 3WTSC 1ZG1A 4ITVA 4I99C 3MCZA 1USTA 1WFXA 3WTUC 1UG0A 3CCMI 4E7HA 2AQFA 2KMUA 3I71A 3PFYA 2VOPA 2E1MC 1FBSA 2QCOA 3HSRA 3P9CA 1WJAA 2ZC2A 4HNVA 1WJEA 2CQXA 4XSZF 5K5QA 2Y30A 4A3KJ 2LNBA 4PJNA 1QVTA 3E6DA 3M7GA 4EV0A 3S1MJ 1WGXA 4IHSA 5LD2C 1X1DA 3WTWC 1UZCA 3BPVA 2H27A 2E19A 2PMZN 3IWFA 3LSPA 1WZ2A 3J81K 1V5FA 3CUQA 5DDGA 2HYJA 1DU6A 1OYIA 4GXOA 5CJ9A 4YFKF 4O5VA 4E70A 2H6BA 3GO5A 4M3EA 2R5YA 1A5JA 4P5OA 1XMAA 2CW7A 2XKPA 2M0CA 1F36A 4HLXA 1KONA 2V26A 2KISA 4CH7A 3CF5F 3AG2H 1N25A 1BJZA 2A68F 1DGRM 4MQ9F 3VYTB 4RAFA 4DZPA 4KISA 2EILH 3PM1A 1FT9A 3JAMK 3OSGA 4WWCA 5FKOA 4M9XA 4HLYA 4BAYA 3GTGJ 3EQLF 1JKQC 1FMVA 3ZRGA 3BLYA 2DU9A 4PJLA 4RGRA 2VB6A 5EEGA 2P6TA 4IRIA 5IT9Z 1VQ9I 1USSA 2YU9J 2C6YA 5C44J 1K6YA 5IT9K 4UB6C 4BBSJ 2V9VA 4BY7J 1P6RA 2V7FA 3NRVA 3SEZA 1JXSA 2PI0A 3OOUA 1G6NA 2VXDA 1RR8C 4IOAF 2HVRA 3T8TA 4BHCA 3PNVA 2KL4A 2EA4A 4F52A 1ETYA 1MSEC 1A6IA 2DODA 4D0PA 4E7LA 2FNAA 4TV7A 2BEOA 1KU2A 4IHWA 3KZYA 4D9JA 2P6SA 4C3HJ 2H09A 2JPCA 1IDZA 4IO9F 4V19K 1XGNA 4I6ZA 3RI4A 3CMMA 4R1HA 2M4GA 2VKEA 4PJ0C 1CQTA 3S14J 2BHYA 2L9RA 2X6OA 3ELKA 3COAC 3CCEI 1JJ6C 2VONA 5FKLA 2ZXIA 4ANJA 4E6KG 4EM1A 4DQ2A 3HZJA 5E3NA 5AIQA 2XPUA 3TKYA 2QVOA 5EG0A 4JOMA 1W7PB 3TDZC 4LG0A 3J7YJ 1KQ8A 2IPQX 3JTGA 2MLKA 5TRDA 1QNTA 3AG1H 4IRHA 4XL9A 2PMZA 3CESA 4DZJA 5HOOA 1B9MA 3FKJA 2EZIA 1YI2I 2RNGA 2JN6A 4Q47A 2EK5A 3DLLF 2HYGD 4DGWB 1D8JA 2JSCA 1ZRFA 3F22A 5CVRA 5CVJA 4NC8A 1ZHFA 5J3LA 2DAOA 2LBFB 4LLNA 3I9V2 4WXHA 4DBRA 1MH3A 2O6GE 2LY2A 3KP2A 3H0DA 3A1YA 3SEQA 3G1LA 1VFCA 3ZQLA 2O8XA 1E3OC 4LIUA 4V2GA 3BR3A 3EUHA 1G59A 5FD5A 1S7AA 1YRNB 2Q2EA 1UHWA 3P5JA 3ZQHA 3P7NA 3I56I 2FX0A 2DA3A 5TGTA 3UNGC 2VPRA 2I5UA 3CLOA 3E5XA 1S8NA 1FYLA 1MJBA 1I3AA 1XG1A 1VQMI 4WK8F 3OYFA 2XAFA 2V1XA 1Z21A 1HDDC 2GIVA 4A0YA 5FLVA 1IRZA 3EUHC 4XRSG 2XF6A 3C2HA 4A3CJ 3X2QH 2YS9A 2DOEA 3QU3A 4GRIA 3OOPA 1HKTA 1F9NA 1I5ZA 1S5LC 3OR1C 2DMNA 2OTLI 4K2EA 3JRCA 2ZJ2A 5FD6A 3Q9SA 4HNUA 3D0SA 4M6YA 4L5JA 2F5DA 3BZ6A 1SMTA 1G4DA 3DKYA 3FK6A 3W6VA 1OYWA 5BPDA 2B0LA 2Z2SB 1BN5A 3H35A 3LMMA 4UVAA 3S2DJ 2MC4A 3TO9A 2CV1A 4UUSB 3GUDA 3LFKA 2O03A 1IRFA 3WE3A 5KVRA 3HOTA 3VSLA 2VQGA 2A6EF 1WJCA 2Z16A 2W84A 2CFOA 1H0MA 2OQGA 5KAIC 2K4JA 2HVQA 5DCFA 3WU1B 2PLYA 3GTKJ 4ENJA 2B63J 2KPMA 3NWSA 2FU4A 3BTLA 4NC7A 3OV8A 1X1PA 3FZVA 1FSHA 3L2RA 1DP3A 3SJMA 1SAUA 2L7KA 4CCNA 1K78A 2Z99A 4J19A 5H2FC 2LRDA 5JFRA 3OWTA 5GADJ 1DDNA 3E5QA 3DLAA 3VODA 2R5YB 1YHQI 2ELKA 4HA8A 5D5UB 1A35A 1YX3A 1Y8QB 2HDWA 2WV0A 2JRTA 2IJLA 4I7HA 3CO6C 2E7WA 2R92J 1WI3A 3ABLH 3CD6I 2R7SA 2JUGA 3QYBA 4IX7A 2MBFA 4FX0A 4F3QA 2NS0A 3ZXSA 1R1VA 1R4MB 1BR1A 4LLLA 4II2A 3VYSB 4EJTA 3SXYA 2HPMA 3CDIA 3EYIA 3I3LA 2DDBA 3KZIC 4OAYA 1H88C 1JT6A 2CH0A 3KEYA 3QPHA 1U9NA 1OCPA 5IP6A 3PUFA 1A36A 4BXFA 1R58A 5BPIA 3R4KA 3OYNA 1FJLA 2JRMA 5EJCA 2YPRA 1NK3P 5H6RA 3J80K 4BNCA 3HTUA 2LKXA 1LDJA 2Z9OA 1IRXA 5EEAA 2D1HA 2KRCA 1D5VA 2K4BA 2Y0MA 3WG9A 3IAM2 2XAUA 2LVSA 3L2VA 1OLTA 3OS0A 3BTJA 5BOXA 4BH9A 4IHTA 3LSKA 3A0BC 1ETWA 2DFHA 4MQVA 3H9JA 3L2CA 2HU9A 3L2WA 1ZG5A 2STWA 4B8XA 1ITYA 3MMYB 3K4JA 2R4GA 1BM9A 1ZELA 4QTRA 3BG7A 1YQAA 1WJ5A 4XLHA 4E7IA 4MTDA 3BG5A 4YEJA 2ZJRF 2JK3A 3OYCA 1BOAA 2VBZA 1LNWA 3N05A 5EDNA 2WY7Q 4A2UA 4BL0B 3HPGA 5FKMA 1I1GA 2A69F 4LG0B 3B6AA 1T2KA 4RS8A 1U6GA 4B43A 2IGMA 1XCVA 1FX7A 1X1BA 4AM3A 1MMGA 1P7IA 2QSGX 2LD5A 3HUGA 4G8XA 2HOTA 3QYFA 1JUSA 4HNTA 1Z9CA 2MH2A 3T1BA 2QSFX 1BI0A 3CC4I 4OINF 1IF1A 4IHXA 3WGIA 4G6DA 1A31A 3KP6A 3JRDA 3E3VA 1ETKA 4MLOA 1VQPI 4Y7NJ 1RESA 2YR2A 4O6JA 2WB1A 3PSIA 3FBIB 1W36D 5IOYA 1MBGA 4HYEA 3BR6A 1F5TA 3JRGA 4LITA 2Z3YA 1JJ8C 4R79A 1PUFA 2VKVA 1JT0A 2AS5F 2A3SA 3D5SC 5ICFA 5CPRB 3HIFA 2PMHA 1DPRA 2Q2EB 1GVDA 1MNDA 2BXZA 2M34A 2LF8A 4MNUA 3RQIA 3M8EA 1IUYA 2DCEA 4YIFA 4JQFA 3KLOA 5D4SA 2GXBA 1FSEA 1FMWA 1OCRH 2DXIA 1D1CA 4KUMA 4RAZA 1D5YA 2MH9A 3K7AJ 2X0LA 2DMQA 2BOLA 1R7JA 2VASA 1WSUA 4S0HB 2VXZA 1D3YA 2FE3A 2RAEA 5KK1A 5JLWA 1LB2A 4HV6A 1T08B 1YFHA 4MEXF 5FROA 4HW0A 3DQVC 3IH4A 2ECBA 2FA5A 1HKQA 2FQ4A 4OOIA 5J1RA 1VQKI 3K1MA 2X6WA 1D0XA 1R1TA 5DD8A 4M6XA 2VJJA 1ZH5A 3AL0C 3CMEI 3QPSA 2W82A 5L3BA 3VFZA 3CDHA 2E35A 1V54H 2DA2A 4MFDA 1YG2A 4C2MJ 5IP9J 1I6HJ 2DOFA 2Z1DA 4A0XA 1VQ6I 4KYWA 3WHCA 2K7LA 2OA4A 3GZNB 3TO6A 2QSHX 2EJRA 3BCBA 1OQYA 2K5CA 4Y17A 3FWEA 1LJ9A 2E60A 3ZQ7A 1O4XA 4I0AA 2LMDA 2OJED 4X1EA 3HBLA 3M8FA 4BBRJ 3EYYA 1IRGA 2P8TA 3M1EA 2W7NA 1G8XA 1GXPA 1LEBA 2RREA 1BA5A 1YOVB 5EF6A 5LBQA 3LL7A 2UZKA 1Z1DA 1W7PD 2V1NA 4KT6A 5LGUA 3F8CA 2ZJPF 1K78B 5KNLA 2CV0A 3B02A 2HVSA 5HS9A 1TQMA 1W4MA 2F5EA 1TBXA 4ZDLA 4Y13A 3RYPA 2F4OB 4WCGA 4XRMA 2LOOA 2VQCA 1QHGA 1FY7A 1EKEA 2ELHA 3EPZA 3OIOA 4BE2A 1GDTA 3KZZA 4L9JA 1SVMA 2JA6J 3K1PA 2XSJC 2ESNA 4PCQA 1KZHA 3K69A 4LMYA 4Y4RA 3RKQA 1FOKA 4PJMA 3IRRA 2ETHA 1BOBA 3W2VA 1OJLA 4LFUA 5J4VA 1TWAJ 5K7HA 2VT2A 3LA2A 1MDMA 1YE9A 1RKWA 3M4OJ 2DK8A 5AONA 1N77A 2X48A 5BNGA 2ZB9A 2H1KA 1FZPB 2PN6A 4MEYF 3L7WA 4BXXJ 1Z77A 2E34A 2M9HA 4IJAA 2UUZA 2NVTJ 3SFIA 4HSTA 5K7ZA 2I8DA 1EJ9A 4AIKA 4XLNF 2HQAA 1HF0A 1SEUA 5K7FA 1ERDA 3MQ0A 3PO3J 5HNHA 3E5UA 1P2FA 2LY1A 1W7PA 2OU2A 3ML6A 4C2UA 1FC3A 5IY5H 4P9UA 2UXXA 5IT3A 1AA7A 2M3AA 3JRHA 2PG4A 2X1DA 4FE4A 1ETQA 3JR9A 3TQNA 1YTYA 3CCJI 4F91B 3P9IA 4C3JJ 2IS2A 2WWYA 2WC2A 2VODA 2VI6A 1T0FC 5ERIA 2LP0A 1O57A 3KPHA 3OYAA 4II3A 2KIFA 2JZYA 2M30A 3HRMA 2RN7A 3BZCA 1HC8A 3I5UA 1Z0XA 2YSRA 3V42A 1T6SA 3HOWJ 2M1BA 2NNYA 1QZZA 3VYUB 5F0FA 3FHZA 3BJ6A 3KYDB 3BR1A 1OFCX 4ZZLA 5JVGF 1O3RA 3HUGB 2RVCA 2O61A 3GZ5A 1R00A 4RB0A 1FTTA 3CF2A 2CQKA 5ICCA 1BC7C 2GIZA 5CKTA 2WAQN 2Y9YA 1W0TA 4G6QA 4BXUA 2FD5A 1HCRA 5LRSA 2QKLB 3DPLC 4F55A 1MBEA 1XN7A 2FSWA 3BWGA 1WQ2A 3DKWA 1H8AC 4PDKA 4G12A 3OS2A 2K9LA 1SC7A 2E7XA 2R7DA 3J7AO 3L9FA 2VL8A 5C4XJ 1RR7A 2J5PA 3HL2A 1STZA 2K3FA 2GOXB 4N0BA 3D1NI 5DTDA 4J00A 1TNTA 3H1CA 4UXNA 1FWZA 2DDAA 3FXLA 4IF4A 2ADUA 3GF2A 1FOXA 1SMYF 1FOYA 4P1WA 5F27A 1JE8A 3RZOJ 2IA2A 4BE1A 2IRFG 1YYVA 2BVLA 5CQEA 1O7LA 1ON2A 1R5ID 4CGZA 5K5RA 2V1DA 2HGCA 1POGA 3F9KA 3A03A 1BI2A 4BS9A 4Y3OA 1Y1WJ 3EDPA 4U87A 1RUNA 2IGKA 1VF9A 1WWXA 1JHHA 3AFHA 1Y6IA 5GPCA 1S7EA 1SD5A 2HQ5A 1G3SA 3VWBA 1JGGA 3J7AY 4N4NB 2QLZA 2XAQA 1JHFA 1XSXA 1ZG3A 3GFIA 2G9WA 1XTAA 2A6HF 2P5VA 1TWCJ 3OL3A 1HOMA 4A3IJ 4EM2A 4B09A 1U8RA 3KP5A 1I1SA 1KU3A 2XF5A 1IXSB 3I4NJ 2M87A 1YW7A 3GXOA 4P55A 1HKSA 3CC7I 1TWHJ 2DTZA 2KQRA 3K70C 2F5VA 3OYGA 2DK5A 4LB6B 2K9SA 3Q3SA 3WGGA 2DBBA 5L3GA 1XPXA 4D7MA 2JVHA 2YX7A 4NHJA 3DBHB 2CW8A 3O3KA 3PL8A 3AAFA 3HHHA 4OWRB 4G94A 3GTQJ 1XD7A 3TL4X 2PEXA 4BDZA 4ESFA 2VBWA 2F6CA 1YO5C 4HG2A 4LOCA 3BG9A 3FM3A 1U5TC 1V5EA 4M9SA 1HLVA 3BZKA 1O3TA 2K9MA 1Y0NA 2XB0X 1GV5A 3QODA 2BHZA 3DPTA 3RPUD 1VQ8I 1T56A 1GVJA 5DUKA 4LK1F 5DEQA 1OKRA 5HLTA 2Q8KA 4QPOA 1LKXA 5E8GA 3KCCA 3PNTA 5IYCJ 2VJIA 2WAEA 3LSRA 4IRGA 2WADA 2HEOA 3SFZA 2DLLA 2BBYA 5IYDJ 3LSHA 2EFNA 4CDGA 2F2EA 3CCLI 3GFLA 4UVBA 2A61A 2HDCA 4XN3A 3TDUC 1I6XA 2OBPA 2RV8A 3CP8A 3HOSA 2XAHA 1ZLJA 3K4KA 1T98A 3J7ZI 2LG4A 4HQEA 1NK2P 1U9OA 2WTEA 1T39A 1ZR2A 3S1NJ 5E3OA 4EMSA 3QRFF 1MDMB 3SZGA 1LFPA 1OCOH 2H8RA 3KP4A 5HDNA 1I27A 1G3TA 3DF8A 2V9PA 1OYYA 3R60A 5DCMB 3KFWX 3IP4B 2LK2A 4AYBN 3AG3H 2VT3A 1SFKA 3ZCOA 4RBOA 3JRIA 3V4GA 1RKTA 3V7SA 2FJ1A 3G1MA 1FP1D 2K3PA 2QQ9A 2O7OA 2CUZA 1FIPA 4C9YA 3RPUA 2R7FA 4CCMA 3OYEA 1OCTC 1UHSA 5LGTA 3SHFA 1VQLI 4ZTFA 2HFHA 1MBJA 3ABTA 3FMSA 1YJ9I 1IN7A 1D1BA 3FXMA 4JX4A 5B66C 2E1NA 3HPHA 1JKPC 2LY9A 1MSFC 4FE7A 1SANA 1MJAA 3V7CA 1ZR4A 2KRHA 2X6XA 4MTEA 2ICWG 2ZSHB 5HLIA 1K4TA 4RLQA 5TJJA 2XGCA 5DS9A 2CFXA 3FMRA 4JX5A 4OMZA 5JLXA 1QQIA 4CSWA 2QA4I 1YJWI 4C2TA 2HYFA 3CDLA 3ZQFA 4FASD 3QP6A 1AKHA 3LQQA 2CG4A 2QYOA 1Y1VJ 4AVPA 1T38A 5J4YA 2FF4A 5K5OA 5M5WJ 1X3ZB 5EZGA 1R5HA 4FCYA 3FHNA 2F48A 4XKBA 1UELB 2FXAA 2Q1ZB 3CQZJ 3HOUJ 4ZJZA 2M4KA 4JK1X 1CF7B 5FRMA 5C4JJ 4FISA 4E7KA 3TW6A 3DXJF 3G2BA 2K9QA 3F3XA 5J40A 3OR2C 2W1OA 3Q0WA 1ZRDA 2IGOA 2JPBA 4XLFA 3CCSI 2VBYA 4GDFA 3MKYB 1AU7A 3FBNB 1EH6A 4R8HA 5J6XA 1I39A 2L7ZA 4GO1A 4BKXA 2MSYA 1MBKA 4XK4A 2JA8J 2X1EA 2DYSH 2EFOA 4X6AJ 2M7AA 4QSHA 3CTAA 3ASNH 1VNDA 2RNJA 2ESHA 5E3MA 4Z2YA 2KIMA 1XCBA 2E1MB 3T5XA 1M1EB 2XF7A 3DPUA 3KX2A 4HF0A 4LGWA 4NDLA 4YG2F 4AC0A 5M5XJ 3DEWA 4RM3A 2HXOA 2OCEA 2HS5A 2L7MP 4BU2A 3V8LA 1DU0A 1J09A 4JX6A 5ICGA 4CCOA 2XROA 2OCCH 4A5MA 2FEZA 5CVUA 4LIVA 2LF7A 4ESJA 1QPMA 3I54A 3L09A 1PYVA 2R7OA 3QYEA 1T8IA 3PQJA 3DTEA 1ZKGA 3GFJA 2ZXJA 2CYYA 4I02A 1LE8A 2BY2A 3G73A 5LHGA 4I76A 1MW7A 1U5TB 3IC7A 4D7NA 3FK7A 3JRFA 1IN4A 1R22A 3OYJA 1PP8F 2GLOA 3E97A 1IV8A 3C2GA 2OZUA 2MD0A 4GYGA 4UV9A 5TISC 3BC8A 3HRSA 3FXQA 9ANTA 1HBXG 2LREA 4NQWB 1B9NA 2XRNA 4WXCA 4ZYGA 1K4SA 2L2OA 3ESWB 5J1UA 5HDGA 3LAJA 1NG7A 3MN2A 4KIFA 2DA4A 2L9NA 1ETOA 5FFXA 3Q0VA 1T95A 4DYRA 4XN0A 1WJFA 4ZYDA 1MZBA 2ECCA 2VIXA 3CJTB 2H1LA 2JMWA 3RIRA 1BIAA 5FKNA 3ROUA 4BEHB 4EVIA 1ZQ3P 1HW1A 1P4AA 1BR2A 5EEHA 3F6VA 4HX7A 3ULQB 1KQ9A 4H0EA 4CUGA 2ZMEC 3KEQA 1PP7U 1W5SA 3GBGA 1MBFA 2ISYA 3KETA 5E79C 1VQ5I 4F7ZA 2FOWA 4XLCA 1L0OC 3V8JA 4E7SA 2VC0A 1K7AA 2FBHA 3K0LA 4A69C 1WJDA 4L9VA 3S3MA 2JTVA 3E6MA 3JSPA 4A3GJ 2R7XA 2FBKA 3BROA 2K85A 3LSIA 5D6FA 2KKOA 3A4CA 2K9NA 1OPCA 5KCMA 3OYLA 2BY0A 5JVTA 2LDUA 3K1NA 3QP5A 4IHVA 4UUVA 1I3QJ 4L18B 1TL8A 1V4RA 1FEXA 3CO7C 3QWLA 3BG3A 1YS7A 2W25A 3K4BA 3SZPA 3SDBA 4IZZA 2IS1A 1E0EA 5GPAA 1CGPA 2Y0SN 4XOTA 3GZ6A 2KFDA 2OV7A 3ZN1A 2E1OA 2R7VA 3ISPA 3DV8A 3M8JA 3S1RJ 1QZYA 2O0YA 2VBXA 1R9TJ 1MH4A 1K79A 5FO5A 2O9LA 3GLLA 2A5YB 4UVCA 3R0AA 1RC9A 4HPQA 2ME0A 3ZGKA 2QUFA 1ON1A 4RA2A 3VB2A 2DOAA 1H9TA 3BQZA 2VOOA 2K40A 3RKWA 1J7KA 1QZEA 2LSOA 3M3YJ 3SDGA 3PIPF 1Z7LA 4CCLA 4PFOA 1TP4A 1SD7A 4PK4A 3TOBA 3WODF 3ECHA 4LB5A 3LFUA 4RB2C 4BYYA 4CYDA 4DYCA 2FQ3A 2I10A 2KP6A 2MG4A 3ZQIA 2CS3A 2DFEA 1SVOA 4QIWN 4OIRF 2ZBKA 1YX5A 2XV4S 1B1BA 3PO2J 2E5ZA 2L9VA 2MA3A 5KHDA 5F08A 2OQRA 2Y31A 2HKXA 2WA0A 1YS6A 1AKHB 1UG2A 3JCUC 2OTJI 3K10A 2MC3A 2VLAA 4Y15A 4CZCA 2EIJH 3K4CA 4OU0A 2K02A 2BYVE 1X1AA 4FQGA 1ORKA 2HKOA 2BZTA 4A5NA 3SQNA 3HC7A 3CCQI 2P7CB 2O5RA 2HQNA 1KYZA 2HDDA 3T0YA 3VPRA 2ID6A 1KA8A 2VKHA 4N4OB 4XR6A 1S7OA 2PX9A 1O7FA 3REOA 3S2HJ 2ZNZA 4M3BA 1ZGJA 3DEEA 1VTNC 4PGHA 5FGMA 2G0EA 4EJVA 3RCOA 1XDSA 1UB9A 4XONA 5DM6F 5GP9A 1OISA 2XGEA 2IS4A 2KIUA 2B9SA 1ETVA 1ZYRF 1BL0A 2JQ7A 4UY8I 3HTSB 4MIMA 2EV0A 2EFQA 4D5CA 4HOBA 1ZGAA 3W2AA 2IP2A 5KAFC 1J9IA 4M71A 2LTPA 2TCTA 3MKWB 4EJOA 2E2JJ 4LJZF 2IA1A 2F5FA 1HQCA 2Y0SA 1UJ8A 4CHUA 5E8IA 1WH5A 3ZOBA 4G7HF 3F72A 4YIIA 4BJ6C 1B72A 3DTIA 2ZCWA 1RNLA 2DQLA 2DTRA 3S32A 1KQ0A 1G3YA 3KP7A 1Z6RA 2IA0A 3DEUA 1Z67A 4BHBA 3K9TA 1NTCA 5IYBJ 3S3OA 4OIQF 2CMPA 3HKZN 1LDDA 3P9KA 2GXAA 2XASA 4ZTJA 3O2PE 4XMYA 2KIQA 1GXQA 4B3AA 2EFWA 3N4MA 1FIAA 2HXIA 1SD4A 3MAJA 3ABMH 2FOKA 2E36A 4XLPF 3BJAA 3S8PA 3PIOF 2HPIA 1XSDA 4F92B 1LE8B 2KJBA 1V55H 1XC5A 4FETA 5J8FA 2Z5UA 4KMFA 2AQEA 4EGZA 2JSPA 1ZN2A 4UV8A 3GTJJ 1QPIA 2LC2A 3ONQA 1QA6A 5B1BH 4CCKA 2OPTA 3TP3A 1MMNA 3RJPA 5J1YA 2L4AA 5L3CA 1ZLKA 4EEFG 4L0YB 2QF7A 3S2WA 5ED4A 1V3FA 2ZMEB 2DT6A 3EUKL 2E2HJ 2H6CA 2P5LC 4ON0A 4EJUA 3WU0A 4EJWA 5LFAA 2DT7B 2MGQA 5D8KB 3CMAI 3DTKA 4KA4A 1OCZH 2KZGA 3MZHA 4ZYAA 2R7QA 3F6OA 5GTIC 1C0WA 2EV6A 3CJQB 5LGNA 3FXRA 4G7ZF 4XSXF 4IXAA 4KMUX 3JTHA 4JP0A 3ZMTA 2A05A 4KJZA 5FLXZ 3RPQA 5DCMA 4S04A 1U2WA 3M9AA 3I0TA 3KYLA 2HOSA 2IAIA 5FFZA 1ODDA 3DFGA 2BY3A 4W1UA 4GGGA 5FLXK 4RDUA 1D8KA 3FX3A 1X19A 2B7EA 2L5QA 2RQPA 4XOPA 5LRRA 3L2UA 1JTYA 3TGNA 2CSOA 3FXKA 3ECOA 1WRJA 2HOAA 1T0FA 2UV1A 2DT5A 2V6CA 4RGSA 3A2KA 2EH3A 3K2AA 1N78A 2CJJA 2LR8A 4AVZA 1MGTA 3MZYA 4ZZDA 4NC6A 1WI9A 3K4NA 3UKGA 3ZMDA 3GFMA 3KE2A 5E1XA 1OR7C 2XAGA 2TDXA 4RGXA 3K4LA 1Y39A 2CQQA 5J8CA 3IH3A 2E2IJ 1X58A 2GBYA 2RDPA 3PFIA 1P4WA 3H5NA 1TZLA 4Y33A 1SFUA 1SFXA 3LSTA 2RC4A 1UFMA 2QQAA 4LG3A 3A02A 2D1VA 2CO5A 3K70D 1VQOI 4AIHA 5HVQC 2XVCA 2ZNYA 2E5NA 4B47A 5L3DA 2HTJA 2HWVA 2M5WA 3LSMA 1W0UA 4M3FA 1CF7A 1P4XA 3HRUA 5JHUA 5FB2A 4A12A 2QWWA 1AWCA 1EV7A 3LSJA 2AXLA 4UNOA 2STTA 4XORA 4B1RA 3JSOA 3ZQGA 1RUOA 2ZSIB 1J5YA 5H20A 1SFEA 2DW4A 1S3JA 2BV6A 1EA3A 2DQRA 2IT0A 3NAUA 4U88A 2FRHA 2KHMA 4KITB 5FJ8J 1P7JA 4G6TB 3G3ZA 4G7OF 1LVKA 1W5TA 2XRLA 1JTXA 2VJ4A 3WG7H 3IV5A 4CCJA 3F21A 3QPLA 4NB5A 4XICA 1YIOA 4HRIA 4AIDA 3KP3A 3HEFA 2GA1A 3ZP5A 2PFBA 3GTMJ 2NOJB 3HM5A 4EM0B 3F8NA 1U78A 4L9TA 2KT0A 1LPQA 4RGUA 1WVRA 5E20A 3QPTA 1IXRC 3TEDA 1XB4A 2D45A 3ZQCA 4IEJA 4KICA 3AL0B 1IAWA 4X0GA 1JUPA 2VC1A 2OD5A 4M72A 1KU7A 2JVGA 3I64A 4PSWA 2GZWA 3RKXA 2JJ7A 3QOPA 3S17J 3M1CA 3C2BA 3RSNA 3VOEA 3FKIJ 2GOMA 5E1ZB 3OSFA 1IW7F 1IXCA 2ZFUA 3OS1A 5D5VB 1E3PA 1JGSA 3V7RA 4A3JJ 1TNSA 5F1JA 5CQGA 2DMUA 1YLFA 3H3ZA 4BACA 3HG9A 5A2QZ 1B72B 1U5TA 2XGXA 3Q9VA 3HOZJ 5IOZA 3WE2A 4KDPA 5A2QK 1AHDP 4C30A 4NUBA 5EGOA 4CA0A 5M3FJ 1KU9A 2EZLA 1P9QC 2COBA 4NBQA 1IJWC 4NQWA 2R0QC 5JHFA 1ZTRA 5DD4A 4CYCA 3J81Z 1EH8A 2ME6A 2E1CA 4BY1J 2VUMJ 3SYTA 3ASOH 2QZ8A 1R5GA 3OL4A 2OZ6A 4B48A 1YITI 2JA7J 2DPDA 2P7VB 4BEHA 1B8IA 2ACJA 3PJRA 2TRTA 3G1OA 1HDPA 2L9SA 5F04A 2WAQA 3TMOA 3CP2A 2W00A 2ZKZA 4I0BA 4N9HA 1X4PA 1VI0A 3JRAA 4YELA 4P96A 2QEXI 1BC8C 5DYMA 3H5AA 3U21A 4A93J 4RMNA 3JAMZ 3I53A 1OMIA 3CUQC 2R7WA 5K1YA 2A6TA 4OMYA 2F4IA 4HEA2 5JR3A 2BW3A 1ZK8A 3RTRA 3Q5FA 2LH9A 3V8KA 2CW0F 2JA2A 2XPVA 2GA2A 1A6QA 5E18F 1KGSA 2KDZA 2CU7A 4ZYEA 2KJCA 2GWRA 2ISZA 1R4NB 4WXDA 4J01A 1FYKA 3O6BB 2HZTA 1REPC 3IKTA 2D5VA 3CCRI 1S72I 4QWQA 3ZMSA 1XGOA 2EA2A 2HQRA 5D6EA 2HTSA 2R7UA 4HX8A 4DBQA 2V4JC 3OYBA 2NXNB 1R6RA 4XKWA 3WTVC 1MNEA 2DO7A 4HDUA 1BR4A 4BQNA 4IHYA 4ESBA 2AHQA 5HLGA 3CJNA 4CXFA 2XUBA 2QBYA 4KIBA 4ZC3A 2IBDA 3ERED 1F43A 1E3HA 1GV2A 1R1UA 2RQQA 1QBJA 1TW3A 1B4AA 3QQAA 3LQRA 4HV5A 1RIOH 1LFBA 2J5OA 2XSDC 3W3CA 4MHGA 3DCFA 3HSFA 3I58A 2EV5A 2K27A 4XLEA 3I59B 5H6QA 4M73A 3MEXA 3N97A 3C3WA 2VE8A 2OF7A 5FLMJ 4YIRX 3W6KB 2QQBA 3C1DA 4IPAA 1GUUA 3HOVJ 3E0JB 2DMTA 3MKLA 3BT9A 5B3SH 3HOXJ 3ZMZA 3U9GA 2X9DA 1TW2A 5BQTA 2HR3A 3U2RA 2MLGA 1SVLA 3ABKH 3GW2A 4DNCA 3L1PA 2NVQJ 1BI1A 3OIQA 1Z91A 3DU6A 3O8HA 3LA3A 3Q0UA 1DP7P 3FM5A 1DQUA 3ERMA 5LLQA 1IN5A 2ZXHA 2DI3A 2L7FP 4Z6YA 5M5YJ 1ZREA 3BR5A 4I09A 2PBIA 3OYIA 2DFFA 3QAHA 2KRFA 4HX4A 2FBIA 4XM3A 4M9ZA 4KNYA 3PUBA 3HXLA 1LQ1A 4YRVA 2JUCA 3QU6A 5L3FA 5IP7J 2EBIA 3WTZA 2F4MB 4P9FA 1APLC 3OYDA 2FNPA 5CYVA 3KIOA 4FHTA 3A01A 1QU3A 1J2XA 1DPUA 4V2FA 3LAPA 1TLHB 4PSXA 3AKZA 5E1WA 3PNYA 4QLCU 1LEAA 3KYCB 1XSVA 4M6VA 5ILUA 5HODA 3S93A 1R49A 3I55I 2AXTC 1B6AA 2H94A 2X85A 3ZQQA 2MD5A 1FTZA 4BGDA 2L0KA 2ZFWA 1JUMA 1TT0A 4Q48A 1X2NA 3BPXA 2CQ7A 3C18A 1X3WB 2L3DA 4OAZA 1H9GA 2DA1A 3FISA 4AYBA 4BJ5C 5B1AH 2XPWA 4A3EJ 1Z6TA 3G4SI 3CCUI 4M74A 1ZGWA 4PZJA 1UAAA 4EGYA 3H0GJ 2IEKA 4MFEA 2DMPA 4WF2A 4IOCF 3NEUA 4M3DA 3WTTC 5EZHA 1S9HA 3TW7A 1X3UA 1Y0UA 2HNHA 2M45A 3OYMA 3GTOJ 1TQPA 2LKPA 3S15J 1Y56A 1FYMA 2M2EA 1HW5A 1IDYA 1SD6A 3OIPA 3JW4A 4U0WA 3RKYA 3HB9A 1K83J 4ABZA 2EWNA 2XIGA 2VE9A 2ZXWH 4LK0F 2R5ZB 3LWFA 4E7ZA 4FT8A 5D5WB 3BQYA 4L9NA 5L3EA 3VYRB 3BG6A 1Q1VA 3OYHA 2AO9A 3HDDA 1MMDA 5FKKA 1XGMA 5EGOB 2CWEA 3IRQA 1ZAOA 3BDDA 3R6SA 2DYRH 3LNQA 1O3SA 1SAXA 5GTHC 4E4HA 3T8RA 1ZRCA 4CYCB 2NYXA 1R36A 2ZMEA 5ILSA 3HRTA 4I2OA 3WHBA 5F0CA 1J0RA 3HGYA 2M8GX 3DBRB 2ZJQF 1H89C 1KYWA 3CUQB 4Q4ZF 2DA5A 1FNNA 3JREA 4I98B 1B8IB 3GLXA 3DWLE 4L5EA 1EH7A 3M07A 4LLGF 4RM2A 2RKHA 1U8BA 5F1RA 2V79A 4AUXA 4JYKA 1X1CA 2F5CA 2WV1A 3PQKA 2L54A 2GM4A 1HSTA 2EZKA 2MYSA 3K2ZA 3MWMA 2XGDA 2WB1N 3DP7A 2QQ8A 3VSKA 1SFOJ 2P5KA 2E71A 3H3VK 3HHGA 2Z33A 1VQ7I 3GVAA 3ZN0A 1IV6A 2BW3B 3BCAA 1VQ4I 3S3NA 1NG6A 2W85A 3FXJA 4RB3C 5D8LB 2NAZA 3U1KA 3K6GA 2ZO4A 1D1AA 1FLIA 5IPAA 2VQLA 4ZYHA 1R71A 4I01A 1ETXA 1OCCH 3H36A 3NWTA 3OYKA 3RZDJ 1IZ1A 4MGRA 3U1DA 1JKRC 2LLKA 3R61A 1QVUA 1PVEA 4WX9A 3J80Z 4CICA 4QPQA 2PMUA 5C3EJ 2CUEA 1HA8A 4B4CA 2PJPA 2W4SA 1B59A 1VZ0A 4CZZA 2VQHA 3F8FA 1XDUA 4BJTA 4ZH4F 1NHAA 3DU5A 4ASNA 4GYIA 1BJAA 4XLAA 2CGPA 4IVNA 2DA6A 3HSEA 1U3EM 2QBYB 3W6JB 1XGSA 3ZMVA 3HGGA 4HBLA 1TC3C 3SZTA 2Y9ZA 2EIKH 1YW8A 3CCVI 4XBFA 1LUJB 3MKZA 1MNMC 1RZ4A 3NARA 1GLNA 5M3MJ 2EZHA 3GWZA 4UB8C 2VJ5A 5DUIA 4BDYA 2P4WA 2YU3A 2YX4A 2KLOA 3CMYA 2N8GA 4B44A 2MABA 2BE5F 2CRGA 2FMLA 2OUMA 2YUSA 4BHPA 4ENMA 4PUSA 1PJRA 2HOEA 4ZDPA 1GT0C 2NS7A 2W24A 4D1QA 4DIQA 2D2WA 1WH7A 4XIDA 2M8EA 2LYCA 1IGNA 3D5RC 4ENKA
chains in the Genus database with same CATH topology
4W1UA 5EG0B 4RDUA 2DMNA 4LOCA 3BG9A 1JTYA 2HOAA 3JRCA 1HLVA 2XB0X 1GV5A 3JRBA 2EH3A 3K2AA 1T56A 2CJJA 2LR8A 4C3IJ 3FK6A 3UKGA 3W6VA 3BTIA 1K61A 5IYCJ 3S2DJ 1IC8A 3LSRA 4UUSB 4D5FA 1IUFA 2CQQA 3IH3A 5IYDJ 2E2IJ 1X58A 2GBYA 2LFBA 3A01B 4MO7A 4FTHA 3GTKJ 2B63J 1NK2P 3A02A 5F0HA 3BTLA 2JA5J 3E7LA 1U9OA 2DJNA 1ZR2A 3S1NJ 5E3OA 2H8RA 3SJMA 2NVYJ 4J19A 4M3FA 1W0UA 3CCYA 3LSJA 3I4MJ 2LK2A 2R5YB 2ELKA 4AYBN 2R93J 4B1RA 3ZQGA 3JRIA 4RBOA 1RKTA 2MW8A 2FJ1A 3G1MA 1BW5A 2NS8A 3LSGA 3NAUA 1WI3A 2R92J 2O7OA 1IG7A 1FIPA 5FJ8J 1P7JA 3F0CA 1OCTC 2CUFA 1UHSA 2XRLA 1JTXA 5EYRA 3IV5A 3QPLA 4XICA 2EQRA 1MBJA 3HEFA 3GTMJ 4JX4A 4XRSA 1JKPC 3HM5A 2LY9A 3LOCA 1LFUP 1MSFC 1U78A 4FE7A 1SANA 1H88C 1JT6A 2KT0A 1ZR4A 3MVPA 4A3BJ 1U9NA 1OCPA 2XGCA 5DS9A 5IP6A 4Y52J 4JX5A 5JLXA 3TEDA 1FJLA 3ZQCA 1NK3P 1WPKA 4IEJA 3CDLA 3ZQFA 1AKHA 1JUPA 2LKXA 1Y1VJ 2Y2ZA 5M5WJ 2JJ7A 5EEAA 3S17J 5EZGA 4FCYA 3C2BA 3FKIJ 2LVSA 3OSFA 3BTJA 3CQZJ 3HOUJ 1ETWA 2DN0A 4A3JJ 5F1JA 5C4JJ 2DMUA 4FISA 4M3GA 3TW6A 2HI3A 1ITYA 2K9QA 4DYQA 1B72B 4QTRA 3HOZJ 5IOZA 3Q0WA 3BG5A 1RPWA 2JK3A 4UUTA 1AHDP 5EGOA 5EDNA 5M3FJ 4W97A 2EZLA 2COBA 1AU7A 4A3DJ 1IJWC 5FKMA 2R0QC 2P81A 1ZTRA 2L7ZA 4CYCA 1T33A 4BKXA 2MSYA 3B6AA 1MBKA 2ME6A 2VUMJ 4XK4A 4BY1J 2JA8J 3BTCA 2O8KA 3TP0A 4X6AJ 1P7IA 4QSHA 2LD5A 1VNDA 2HOTA 1JUSA 5E3MA 2JA7J 1B8IA 2TRTA 3G1OA 1HDPA 5F04A 4IHXA 3HOYJ 4NDLA 3JRDA 4A3FJ 1ETKA 4MLOA 1VI0A 3JRAA 4Y7NJ 3S16J 1RESA 4AC0A 5M5XJ 3DEWA 2HXOA 4A93J 1XS9A 2L7MP 5IOYA 1MBGA 1DU0A 3BR6A 4JX6A 3JRGA 1JJ8C 1MBHA 1PUFA 2VKVA 1JT0A 1ZK8A 1WCMJ 2XPVA 1GVDA 2M34A 3BR0A 1ZKGA 4DW6A 2KDZA 3RQIA 2CU7A 1TWGJ 1LE8A 4I76A 1RETA 3JRFA 4D7NA 1TWFJ 3FK7A 2D5VA 2GLOA 1D5YA 3K7AJ 2DMQA 9ANTA 2NVXJ 4S0HB 5J1UA 2DA7A 4IHYA 1QRYA 2RAEA 3MN2A 5JLWA 2AHQA 1X2MA 2DA4A 1ETOA 3B6CA 3Q0VA 4DYRA 3IH2A 2IBDA 1F43A 1GV2A 3IH4A 1YRNA 2ECCA 2JMWA 2ECBA 2FQ4A 5FKNA 2JWTA 5J1RA 3QQAA 1ZQ3P 1JKOC 1EF4A 3QPSA 1LFBA 4MFDA 2DA2A 4C2MJ 5IP9J 2XSDC 4GFBA 4A3MJ 1I6HJ 3DCFA 2R7ZJ 3GBGA 1MBFA 3WHCA 1BW6A 1UMQA 2OF7A 5FLMJ 1G2HA 2NOGA 1GUUA 3HOVJ 3GTLJ 2DMTA 3MKLA 3BT9A 3HOXJ 3O8GA 2X9DA 4A69C 1PUFB 4A3GJ 1O4XA 3L1PA 4X1EA 3HBLA 2K9NA 4BBRJ 2NVQJ 2W48A 4IHVA 2XB5A 5E3LA 3BR2A 3O8HA 3Q0UA 1I3QJ 1BA5A 5EF6A 1FEXA 1I50J 2L7FP 5M5YJ 3S1QJ 3BR5A 3BG3A 4A3LJ 1ENHA 5GPAA 2Y0SN 3FIWA 2E1OA 4UUSA 5IP7J 2EBIA 2ID3A 2R5ZA 3S1RJ 4XRMA 1R9TJ 1MH4A 1APLC 3OIOA 2O9LA 1GDTA 3A01A 2QCOA 2ME0A 2JA6J 4HNVA 2CQXA 4A3KJ 2Y30A 3BQZA 4V2FA 3RKQA 2K40A 1QVTA 3S1MJ 1WGXA 3M3YJ 3SDGA 1OJLA 4M6VA 1TWAJ 5K7HA 5HODA 2E19A 2PMZN 3LSPA 1RKWA 3M4OJ 1FTZA 4DYCA 2L0KA 2HYJA 2I10A 1JUMA 2MG4A 2X48A 1X2NA 2ZB9A 5BNGA 3ZQIA 1DU6A 2H1KA 4M3EA 4QIWN 2R5YA 2DA1A 3FISA 4A3EJ 1Z77A 3GTPJ 2XPWA 2M9HA 4BXXJ 1A5JA 1ZGWA 3PO2J 2NVTJ 2M0CA 1F36A 5F08A 3SFIA 5K7ZA 3H0GJ 2Y31A 1HF0A 2IEKA 4MFEA 5K7FA 1UG2A 1AKHB 2DMPA 1BJZA 3PO3J 4M3DA 5EZHA 4DZPA 3PM1A 3TW7A 3GTOJ 3OSGA 5FKOA 3GTGJ 3JRHA 3S15J 1ORKA 1JKQC 2M2EA 1IDYA 4FE4A 1ETQA 3JR9A 2HDDA 3VPRA 2ID6A 3HB9A 1K83J 4ABZA 4C3JJ 2YU9J 2VI6A 5C44J 3S2HJ 2LP0A 2R5ZB 4M3BA 3BQYA 4BBSJ 1Q1VA 3HDDA 2AO9A 2G0EA 4BY7J 5FKKA 5GP9A 5EGOB 2XGEA 1Z0XA 1ETVA 3LNQA 1BL0A 3OOUA 4MIMA 4D5CA 3HOWJ 4CYCB 3WHBA 1ETYA 5F0FA 5F0CA 2LTPA 1MSEC 3HGYA 1A6IA 2M8GX 2TCTA 3BR1A 2E2JJ 1OFCX 1H89C 2DA5A 3JREA 4IHWA 1B8IB 1WH5A 4L5EA 1FTTA 3ZOBA 4C3HJ 1U8BA 2WAQN 1IDZA 2Y9YA 4AUXA 4JYKA 2GM4A 2WV1A 1W0TA 1B72A 4I6ZA 2VKEA 2FD5A 1CQTA 1HCRA 3S14J 2EZKA 2L9RA 2X6OA 1JJ6C 1MBEA 2XGDA 2WB1N 5FKLA 1H8AC 4G12A 1SFOJ 5E3NA 2XPUA 5C4XJ 1NTCA 5IYBJ 3H3VK 1RR7A 5EG0A 3HKZN 1IV6A 4B3AA 3D1NI 1FIAA 2HXIA 5DTDA 4DZJA 5IPAA 2EZIA 1LE8B 5F27A 2JN6A 3RZOJ 1ETXA 1XC5A 3RZDJ 1JKRC 2LLKA 1QVUA 3GTJJ 1QPIA 5J3LA 1POGA 2OPTA 5C3EJ 2CUEA 3A03A 3TP3A 1MH3A 4B4CA 5J1YA 1Y1WJ 4EEFG 2QF7A 1VF9A 3G1LA 1VFCA 3ZQLA 1E3OC 5GPCA 1S7EA 2HQ5A 4V2GA 2E2HJ 2DA6A 3BR3A 1JGGA 3HGGA 2MGQA 1TC3C 1YRNB 1TWCJ 2Y9ZA 1HOMA 4A3IJ 3ZQHA 1MNMC 2FX0A 2DA3A 3NARA 3I4NJ 5M3MJ 2EZHA 2VPRA 1TWHJ 2DTZA 2N8GA 1XG1A 4JP0A 3CMYA 2CRGA 2YUSA 2K9SA 1HDDC 3Q3SA 1GT0C 2NS7A 5FLVA 1IRZA 4XRSG 4D7MA 1WH7A 4XIDA 4A3CJ 2YS9A 1IGNA 2HOSA 2IAIA 3GTQJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W1U A;  5EG0 B;  4RDU A;  2DMN A;  4LOC A;  3BG9 A;  1JTY A;  2HOA A;  3JRC A;  1HLV A;  2XB0 X;  1GV5 A;  3JRB A;  2EH3 A;  3K2A A;  1T56 A;  2CJJ A;  2LR8 A;  4C3I J;  3FK6 A;  3UKG A;  3W6V A;  3BTI A;  1K61 A;  5IYC J;  3S2D J;  1IC8 A;  3LSR A;  4UUS B;  4D5F A;  1IUF A;  2CQQ A;  3IH3 A;  5IYD J;  2E2I J;  1X58 A;  2GBY A;  2LFB A;  3A01 B;  4MO7 A;  4FTH A;  3GTK J;  2B63 J;  1NK2 P;  3A02 A;  5F0H A;  3BTL A;  2JA5 J;  3E7L A;  1U9O A;  2DJN A;  1ZR2 A;  3S1N J;  5E3O A;  2H8R A;  3SJM A;  2NVY J;  4J19 A;  4M3F A;  1W0U A;  3CCY A;  3LSJ A;  3I4M J;  2LK2 A;  2R5Y B;  2ELK A;  4AYB N;  2R93 J;  4B1R A;  3ZQG A;  3JRI A;  4RBO A;  1RKT A;  2MW8 A;  2FJ1 A;  3G1M A;  1BW5 A;  2NS8 A;  3LSG A;  3NAU A;  1WI3 A;  2R92 J;  2O7O A;  1IG7 A;  1FIP A;  5FJ8 J;  1P7J A;  3F0C A;  1OCT C;  2CUF A;  1UHS A;  2XRL A;  1JTX A;  5EYR A;  3IV5 A;  3QPL A;  4XIC A;  2EQR A;  1MBJ A;  3HEF A;  3GTM J;  4JX4 A;  4XRS A;  1JKP C;  3HM5 A;  2LY9 A;  3LOC A;  1LFU P;  1MSF C;  1U78 A;  4FE7 A;  1SAN A;  1H88 C;  1JT6 A;  2KT0 A;  1ZR4 A;  3MVP A;  4A3B J;  1U9N A;  1OCP A;  2XGC A;  5DS9 A;  5IP6 A;  4Y52 J;  4JX5 A;  5JLX A;  3TED A;  1FJL A;  3ZQC A;  1NK3 P;  1WPK A;  4IEJ A;  3CDL A;  3ZQF A;  1AKH A;  1JUP A;  2LKX A;  1Y1V J;  2Y2Z A;  5M5W J;  2JJ7 A;  5EEA A;  3S17 J;  5EZG A;  4FCY A;  3C2B A;  3FKI J;  2LVS A;  3OSF A;  3BTJ A;  3CQZ J;  3HOU J;  1ETW A;  2DN0 A;  4A3J J;  5F1J A;  5C4J J;  2DMU A;  4FIS A;  4M3G A;  3TW6 A;  2HI3 A;  1ITY A;  2K9Q A;  4DYQ A;  1B72 B;  4QTR A;  3HOZ J;  5IOZ A;  3Q0W A;  3BG5 A;  1RPW A;  2JK3 A;  4UUT A;  1AHD P;  5EGO A;  5EDN A;  5M3F J;  4W97 A;  2EZL A;  2COB A;  1AU7 A;  4A3D J;  1IJW C;  5FKM A;  2R0Q C;  2P81 A;  1ZTR A;  2L7Z A;  4CYC A;  1T33 A;  4BKX A;  2MSY A;  3B6A A;  1MBK A;  2ME6 A;  2VUM J;  4XK4 A;  4BY1 J;  2JA8 J;  3BTC A;  2O8K A;  3TP0 A;  4X6A J;  1P7I A;  4QSH A;  2LD5 A;  1VND A;  2HOT A;  1JUS A;  5E3M A;  2JA7 J;  1B8I A;  2TRT A;  3G1O A;  1HDP A;  5F04 A;  4IHX A;  3HOY J;  4NDL A;  3JRD A;  4A3F J;  1ETK A;  4MLO A;  1VI0 A;  3JRA A;  4Y7N J;  3S16 J;  1RES A;  4AC0 A;  5M5X J;  3DEW A;  2HXO A;  4A93 J;  1XS9 A;  2L7M P;  5IOY A;  1MBG A;  1DU0 A;  3BR6 A;  4JX6 A;  3JRG A;  1JJ8 C;  1MBH A;  1PUF A;  2VKV A;  1JT0 A;  1ZK8 A;  1WCM J;  2XPV A;  1GVD A;  2M34 A;  3BR0 A;  1ZKG A;  4DW6 A;  2KDZ A;  3RQI A;  2CU7 A;  1TWG J;  1LE8 A;  4I76 A;  1RET A;  3JRF A;  4D7N A;  1TWF J;  3FK7 A;  2D5V A;  2GLO A;  1D5Y A;  3K7A J;  2DMQ A;  9ANT A;  2NVX J;  4S0H B;  5J1U A;  2DA7 A;  4IHY A;  1QRY A;  2RAE A;  3MN2 A;  5JLW A;  2AHQ A;  1X2M A;  2DA4 A;  1ETO A;  3B6C A;  3Q0V A;  4DYR A;  3IH2 A;  2IBD A;  1F43 A;  1GV2 A;  3IH4 A;  1YRN A;  2ECC A;  2JMW A;  2ECB A;  2FQ4 A;  5FKN A;  2JWT A;  5J1R A;  3QQA A;  1ZQ3 P;  1JKO C;  1EF4 A;  3QPS A;  1LFB A;  4MFD A;  2DA2 A;  4C2M J;  5IP9 J;  2XSD C;  4GFB A;  4A3M J;  1I6H J;  3DCF A;  2R7Z J;  3GBG A;  1MBF A;  3WHC A;  1BW6 A;  1UMQ A;  2OF7 A;  5FLM J;  1G2H A;  2NOG A;  1GUU A;  3HOV J;  3GTL J;  2DMT A;  3MKL A;  3BT9 A;  3HOX J;  3O8G A;  2X9D A;  4A69 C;  1PUF B;  4A3G J;  1O4X A;  3L1P A;  4X1E A;  3HBL A;  2K9N A;  4BBR J;  2NVQ J;  2W48 A;  4IHV A;  2XB5 A;  5E3L A;  3BR2 A;  3O8H A;  3Q0U A;  1I3Q J;  1BA5 A;  5EF6 A;  1FEX A;  1I50 J;  2L7F P;  5M5Y J;  3S1Q J;  3BR5 A;  3BG3 A;  4A3L J;  1ENH A;  5GPA A;  2Y0S N;  3FIW A;  2E1O A;  4UUS A;  5IP7 J;  2EBI A;  2ID3 A;  2R5Z A;  3S1R J;  4XRM A;  1R9T J;  1MH4 A;  1APL C;  3OIO A;  2O9L A;  1GDT A;  3A01 A;  2QCO A;  2ME0 A;  2JA6 J;  4HNV A;  2CQX A;  4A3K J;  2Y30 A;  3BQZ A;  4V2F A;  3RKQ A;  2K40 A;  1QVT A;  3S1M J;  1WGX A;  3M3Y J;  3SDG A;  1OJL A;  4M6V A;  1TWA J;  5K7H A;  5HOD A;  2E19 A;  2PMZ N;  3LSP A;  1RKW A;  3M4O J;  1FTZ A;  4DYC A;  2L0K A;  2HYJ A;  2I10 A;  1JUM A;  2MG4 A;  2X48 A;  1X2N A;  2ZB9 A;  5BNG A;  3ZQI A;  1DU6 A;  2H1K A;  4M3E A;  4QIW N;  2R5Y A;  2DA1 A;  3FIS A;  4A3E J;  1Z77 A;  3GTP J;  2XPW A;  2M9H A;  4BXX J;  1A5J A;  1ZGW A;  3PO2 J;  2NVT J;  2M0C A;  1F36 A;  5F08 A;  3SFI A;  5K7Z A;  3H0G J;  2Y31 A;  1HF0 A;  2IEK A;  4MFE A;  5K7F A;  1UG2 A;  1AKH B;  2DMP A;  1BJZ A;  3PO3 J;  4M3D A;  5EZH A;  4DZP A;  3PM1 A;  3TW7 A;  3GTO J;  3OSG A;  5FKO A;  3GTG J;  3JRH A;  3S15 J;  1ORK A;  1JKQ C;  2M2E A;  1IDY A;  4FE4 A;  1ETQ A;  3JR9 A;  2HDD A;  3VPR A;  2ID6 A;  3HB9 A;  1K83 J;  4ABZ A;  4C3J J;  2YU9 J;  2VI6 A;  5C44 J;  3S2H J;  2LP0 A;  2R5Z B;  4M3B A;  3BQY A;  4BBS J;  1Q1V A;  3HDD A;  2AO9 A;  2G0E A;  4BY7 J;  5FKK A;  5GP9 A;  5EGO B;  2XGE A;  1Z0X A;  1ETV A;  3LNQ A;  1BL0 A;  3OOU A;  4MIM A;  4D5C A;  3HOW J;  4CYC B;  3WHB A;  1ETY A;  5F0F A;  5F0C A;  2LTP A;  1MSE C;  3HGY A;  1A6I A;  2M8G X;  2TCT A;  3BR1 A;  2E2J J;  1OFC X;  1H89 C;  2DA5 A;  3JRE A;  4IHW A;  1B8I B;  1WH5 A;  4L5E A;  1FTT A;  3ZOB A;  4C3H J;  1U8B A;  2WAQ N;  1IDZ A;  2Y9Y A;  4AUX A;  4JYK A;  2GM4 A;  2WV1 A;  1W0T A;  1B72 A;  4I6Z A;  2VKE A;  2FD5 A;  1CQT A;  1HCR A;  3S14 J;  2EZK A;  2L9R A;  2X6O A;  1JJ6 C;  1MBE A;  2XGD A;  2WB1 N;  5FKL A;  1H8A C;  4G12 A;  1SFO J;  5E3N A;  2XPU A;  5C4X J;  1NTC A;  5IYB J;  3H3V K;  1RR7 A;  5EG0 A;  3HKZ N;  1IV6 A;  4B3A A;  3D1N I;  1FIA A;  2HXI A;  5DTD A;  4DZJ A;  5IPA A;  2EZI A;  1LE8 B;  5F27 A;  2JN6 A;  3RZO J;  1ETX A;  1XC5 A;  3RZD J;  1JKR C;  2LLK A;  1QVU A;  3GTJ J;  1QPI A;  5J3L A;  1POG A;  2OPT A;  5C3E J;  2CUE A;  3A03 A;  3TP3 A;  1MH3 A;  4B4C A;  5J1Y A;  1Y1W J;  4EEF G;  2QF7 A;  1VF9 A;  3G1L A;  1VFC A;  3ZQL A;  1E3O C;  5GPC A;  1S7E A;  2HQ5 A;  4V2G A;  2E2H J;  2DA6 A;  3BR3 A;  1JGG A;  3HGG A;  2MGQ A;  1TC3 C;  1YRN B;  1TWC J;  2Y9Z A;  1HOM A;  4A3I J;  3ZQH A;  1MNM C;  2FX0 A;  2DA3 A;  3NAR A;  3I4N J;  5M3M J;  2EZH A;  2VPR A;  1TWH J;  2DTZ A;  2N8G A;  1XG1 A;  4JP0 A;  3CMY A;  2CRG A;  2YUS A;  2K9S A;  1HDD C;  3Q3S A;  1GT0 C;  2NS7 A;  5FLV A;  1IRZ A;  4XRS G;  4D7M A;  1WH7 A;  4XID A;  4A3C J;  2YS9 A;  1IGN A;  2HOS A;  2IAI A;  3GTQ J; 
#chains in the Genus database with same CATH topology
 5EG0 B;  1DUX C;  2HZD A;  3FMQ A;  1Z05 A;  3NQO A;  2NVU B;  1TQI A;  5GAG J;  1QHH D;  1E2X A;  2L01 A;  3MZ8 A;  4FX4 A;  3JRB A;  1Z3X A;  3BOQ A;  1LDK B;  2P0W A;  5BS6 A;  1Y8R B;  3B73 A;  3RYR A;  2R3S A;  2BXY A;  4RAG A;  4C3I J;  1W1W E;  5FRN A;  5DM7 F;  1WKM A;  3BTI A;  4DJA A;  1K61 A;  4U0V A;  2COM A;  2IW5 A;  1IC8 A;  1R23 A;  1D0Z A;  3H92 A;  3GYH X;  2QGU A;  4D5F A;  1IUF A;  1MMA A;  4XRF A;  4XKC A;  1QGP A;  1PDN C;  2R7T A;  3I4P A;  2IGN A;  2LFB A;  2XHK A;  5B5E C;  5HDK A;  4YFX F;  3RDI A;  3A01 B;  4MO7 A;  4FTH A;  4A6D A;  3H3U A;  4ZDO A;  4RLF A;  3TBI A;  1MMS A;  3OMY A;  1QO0 D;  3MFK A;  5LEJ A;  1DGW Y;  5F0H A;  2JA5 J;  3E7L A;  4HSR A;  4BE0 A;  2DJN A;  1NH3 A;  2G7U A;  5LHH A;  3W2W A;  2R7R A;  1V5G A;  2W57 A;  3L00 A;  3IAS 2;  1XMK A;  1PUE E;  2NVY J;  4JBA A;  2PJR A;  2QEN A;  3IWZ A;  4YFN F;  4AIJ A;  3CCY A;  2V9K A;  3WTY C;  3C7J A;  3I4M J;  1U0J A;  1O3Q A;  1IN8 A;  4UHT A;  2R93 J;  2CUJ A;  3L2Q A;  5LEK A;  1YIJ I;  2MW8 A;  3FDY A;  3F23 A;  1BW5 A;  1W5C C;  4EAT A;  4U7D A;  2NS8 A;  3LSG A;  5DV5 A;  1K6O A;  1IG7 A;  2EFP A;  1Z7U A;  2XAJ A;  4U0Y A;  2Y69 H;  2Y48 A;  3F0C A;  3WU2 C;  2CUF A;  4BQA A;  1VQN I;  3H9G A;  2VKD A;  3EET A;  5EYR A;  2EQR A;  4AD9 A;  4XRS A;  4NNJ A;  5J47 A;  1LFU P;  3LOC A;  2V1U A;  1BIB A;  1UCR A;  3ABU A;  2O3F A;  3VEP A;  3CC2 I;  3MVP A;  4A3B J;  1FOW A;  1FBQ A;  1MIJ A;  6PAX A;  3G71 I;  4Y52 J;  2EPF A;  1F1Z A;  2VN2 A;  1UHM A;  2M7B A;  5D5X B;  2IXS A;  5CLS A;  2CQN A;  1Q1H A;  1WPK A;  4HZF A;  2LKS A;  4IKF A;  3HJE A;  2Y2Z A;  4HAM A;  3TO7 A;  3UR3 C;  4KT5 C;  1G3W A;  2BVM A;  4LD5 A;  1W36 C;  2EIN H;  4GCV A;  1RI7 A;  3E6B A;  3H9Q A;  3R0J A;  1XX5 A;  4F93 B;  2RGV A;  1A04 A;  1TTY A;  2GQQ A;  2DN0 A;  1TT5 B;  3GME A;  4M3G A;  3WTX C;  3GX4 X;  2HI3 A;  1RRJ A;  4IL6 C;  4XQF A;  2WAF A;  2X6Y A;  4DYQ A;  3F8B A;  3LA7 A;  4RB1 A;  4HDV A;  2KDO A;  1J75 A;  4HQM A;  1RPW A;  4ETS A;  4HF2 A;  4UUT A;  3IUO A;  3AG4 H;  1X4O A;  2A07 F;  4W97 A;  3GEZ A;  4L5I A;  4OIP F;  4A3D J;  1ULY A;  4KN7 X;  5ILV A;  3BY6 A;  3EUA A;  1HSJ A;  2P81 A;  5F6F A;  2JT1 A;  1WJB A;  1T33 A;  1OR7 A;  2GXG A;  3BTC A;  2O8K A;  1IN6 A;  3TP0 A;  4OIO F;  3H5R A;  5CVI A;  5F64 A;  3KLN A;  2BY1 A;  4IQJ A;  3VDX A;  5BMZ A;  3HOY J;  4L0Z B;  1F4K A;  2K86 A;  4A3F J;  2PQ8 A;  2IS6 A;  3S16 J;  3OY9 A;  4PFP A;  3I59 A;  5E17 F;  1XS9 A;  4A6E A;  3GTP J;  4BQO A;  2H8W A;  2L02 A;  2Q0O A;  1MBH A;  4KN4 X;  3FXO A;  3HKZ A;  3IL2 A;  3PSF A;  1FP2 A;  3K4M A;  2FUG 2;  1J59 A;  2IVM A;  1WCM J;  2NNN A;  2M0M A;  3BR0 A;  4DW6 A;  2MFZ A;  2ELJ A;  2WY8 Q;  3KEO A;  3FF5 A;  3TOA A;  1YJN I;  2A5W A;  2G7H A;  1TWG J;  4U7B A;  1E17 A;  3IKV A;  1MJ9 A;  2X4H A;  5GAE J;  1ACI A;  1Z3Y A;  1RET A;  4AU7 A;  1MD0 A;  2FMY A;  4KIG A;  4PGG A;  1TWF J;  4EQQ A;  2OC6 A;  2UWM A;  4HF1 A;  3G6E I;  1MKM A;  2LBF A;  2XC7 A;  1XMX A;  2DFI A;  1BI3 A;  2EIM H;  5HS7 A;  2NRA C;  2DPU A;  4KFC A;  2X1C A;  1S29 A;  3CJR B;  1LVA A;  2NVX J;  3WGH A;  2OAZ A;  3BJO A;  2DA7 A;  1QRY A;  3HYI A;  2UXN A;  1X2M A;  2BGC A;  1AOY A;  3B6C A;  2CV2 A;  1BBY A;  1GHC A;  3IH2 A;  1JI8 A;  1YRN A;  5JI6 A;  3ZPL A;  1ONV A;  2JWT A;  4G9Y A;  5D4R A;  3CZ6 A;  3E6C C;  1EF4 A;  1P92 A;  1JKO C;  3DBL B;  1G2H A;  1FBU A;  3CUO A;  2GAU A;  4N9I A;  2WBM A;  5HNF A;  4A3M J;  3A0H C;  4GFB A;  2VPL A;  2R7Z J;  3FXU A;  1IO2 A;  3MD2 A;  5HLH A;  1ZAR A;  5GAH J;  4O3M A;  5HS8 A;  1BW6 A;  1UMQ A;  3GCM A;  4E7J A;  2NOG A;  3RQ4 A;  3GTL J;  2QM3 A;  3O8G A;  3ZMU A;  1HW2 A;  1FPQ A;  1PUF B;  4XKV A;  4A0Z A;  4S05 A;  4DOZ A;  1WHU A;  4AWX B;  4B3X A;  2EB7 A;  1S6L A;  4BQQ A;  2W48 A;  1D0Y A;  2DJI A;  2XB5 A;  3CLQ A;  1N75 A;  5E3L A;  5ICE A;  3BR2 A;  4Q5S F;  4BUP A;  5CVV A;  3E1S A;  3QOE A;  1YW9 A;  4PJJ A;  1L3L A;  2XKO A;  2X51 A;  3BP8 A;  1I50 J;  3ZR8 X;  2L4M A;  2Y75 A;  1HXD A;  4IQ4 A;  3S1Q J;  4H4K C;  4CO8 A;  4ENN A;  4A3L J;  1ENH A;  5AIP A;  3IHU A;  3DKX A;  2PJR B;  3D5L A;  3FIW A;  3F8M A;  2V6E A;  4XNF A;  2XDV A;  4RAY A;  5LHI A;  2KZV A;  4UUS A;  2R5Z A;  2ID3 A;  2QKM B;  3WTS C;  1ZG1 A;  4ITV A;  4I99 C;  3MCZ A;  1UST A;  1WFX A;  3WTU C;  1UG0 A;  3CCM I;  4E7H A;  2AQF A;  2KMU A;  3I71 A;  3PFY A;  2VOP A;  2E1M C;  1FBS A;  2QCO A;  3HSR A;  3P9C A;  1WJA A;  2ZC2 A;  4HNV A;  1WJE A;  2CQX A;  4XSZ F;  5K5Q A;  2Y30 A;  4A3K J;  2LNB A;  4PJN A;  1QVT A;  3E6D A;  3M7G A;  4EV0 A;  3S1M J;  1WGX A;  4IHS A;  5LD2 C;  1X1D A;  3WTW C;  1UZC A;  3BPV A;  2H27 A;  2E19 A;  2PMZ N;  3IWF A;  3LSP A;  1WZ2 A;  3J81 K;  1V5F A;  3CUQ A;  5DDG A;  2HYJ A;  1DU6 A;  1OYI A;  4GXO A;  5CJ9 A;  4YFK F;  4O5V A;  4E70 A;  2H6B A;  3GO5 A;  4M3E A;  2R5Y A;  1A5J A;  4P5O A;  1XMA A;  2CW7 A;  2XKP A;  2M0C A;  1F36 A;  4HLX A;  1KON A;  2V26 A;  2KIS A;  4CH7 A;  3CF5 F;  3AG2 H;  1N25 A;  1BJZ A;  2A68 F;  1DGR M;  4MQ9 F;  3VYT B;  4RAF A;  4DZP A;  4KIS A;  2EIL H;  3PM1 A;  1FT9 A;  3JAM K;  3OSG A;  4WWC A;  5FKO A;  4M9X A;  4HLY A;  4BAY A;  3GTG J;  3EQL F;  1JKQ C;  1FMV A;  3ZRG A;  3BLY A;  2DU9 A;  4PJL A;  4RGR A;  2VB6 A;  5EEG A;  2P6T A;  4IRI A;  5IT9 Z;  1VQ9 I;  1USS A;  2YU9 J;  2C6Y A;  5C44 J;  1K6Y A;  5IT9 K;  4UB6 C;  4BBS J;  2V9V A;  4BY7 J;  1P6R A;  2V7F A;  3NRV A;  3SEZ A;  1JXS A;  2PI0 A;  3OOU A;  1G6N A;  2VXD A;  1RR8 C;  4IOA F;  2HVR A;  3T8T A;  4BHC A;  3PNV A;  2KL4 A;  2EA4 A;  4F52 A;  1ETY A;  1MSE C;  1A6I A;  2DOD A;  4D0P A;  4E7L A;  2FNA A;  4TV7 A;  2BEO A;  1KU2 A;  4IHW A;  3KZY A;  4D9J A;  2P6S A;  4C3H J;  2H09 A;  2JPC A;  1IDZ A;  4IO9 F;  4V19 K;  1XGN A;  4I6Z A;  3RI4 A;  3CMM A;  4R1H A;  2M4G A;  2VKE A;  4PJ0 C;  1CQT A;  3S14 J;  2BHY A;  2L9R A;  2X6O A;  3ELK A;  3COA C;  3CCE I;  1JJ6 C;  2VON A;  5FKL A;  2ZXI A;  4ANJ A;  4E6K G;  4EM1 A;  4DQ2 A;  3HZJ A;  5E3N A;  5AIQ A;  2XPU A;  3TKY A;  2QVO A;  5EG0 A;  4JOM A;  1W7P B;  3TDZ C;  4LG0 A;  3J7Y J;  1KQ8 A;  2IPQ X;  3JTG A;  2MLK A;  5TRD A;  1QNT A;  3AG1 H;  4IRH A;  4XL9 A;  2PMZ A;  3CES A;  4DZJ A;  5HOO A;  1B9M A;  3FKJ A;  2EZI A;  1YI2 I;  2RNG A;  2JN6 A;  4Q47 A;  2EK5 A;  3DLL F;  2HYG D;  4DGW B;  1D8J A;  2JSC A;  1ZRF A;  3F22 A;  5CVR A;  5CVJ A;  4NC8 A;  1ZHF A;  5J3L A;  2DAO A;  2LBF B;  4LLN A;  3I9V 2;  4WXH A;  4DBR A;  1MH3 A;  2O6G E;  2LY2 A;  3KP2 A;  3H0D A;  3A1Y A;  3SEQ A;  3G1L A;  1VFC A;  3ZQL A;  2O8X A;  1E3O C;  4LIU A;  4V2G A;  3BR3 A;  3EUH A;  1G59 A;  5FD5 A;  1S7A A;  1YRN B;  2Q2E A;  1UHW A;  3P5J A;  3ZQH A;  3P7N A;  3I56 I;  2FX0 A;  2DA3 A;  5TGT A;  3UNG C;  2VPR A;  2I5U A;  3CLO A;  3E5X A;  1S8N A;  1FYL A;  1MJB A;  1I3A A;  1XG1 A;  1VQM I;  4WK8 F;  3OYF A;  2XAF A;  2V1X A;  1Z21 A;  1HDD C;  2GIV A;  4A0Y A;  5FLV A;  1IRZ A;  3EUH C;  4XRS G;  2XF6 A;  3C2H A;  4A3C J;  3X2Q H;  2YS9 A;  2DOE A;  3QU3 A;  4GRI A;  3OOP A;  1HKT A;  1F9N A;  1I5Z A;  1S5L C;  3OR1 C;  2DMN A;  2OTL I;  4K2E A;  3JRC A;  2ZJ2 A;  5FD6 A;  3Q9S A;  4HNU A;  3D0S A;  4M6Y A;  4L5J A;  2F5D A;  3BZ6 A;  1SMT A;  1G4D A;  3DKY A;  3FK6 A;  3W6V A;  1OYW A;  5BPD A;  2B0L A;  2Z2S B;  1BN5 A;  3H35 A;  3LMM A;  4UVA A;  3S2D J;  2MC4 A;  3TO9 A;  2CV1 A;  4UUS B;  3GUD A;  3LFK A;  2O03 A;  1IRF A;  3WE3 A;  5KVR A;  3HOT A;  3VSL A;  2VQG A;  2A6E F;  1WJC A;  2Z16 A;  2W84 A;  2CFO A;  1H0M A;  2OQG A;  5KAI C;  2K4J A;  2HVQ A;  5DCF A;  3WU1 B;  2PLY A;  3GTK J;  4ENJ A;  2B63 J;  2KPM A;  3NWS A;  2FU4 A;  3BTL A;  4NC7 A;  3OV8 A;  1X1P A;  3FZV A;  1FSH A;  3L2R A;  1DP3 A;  3SJM A;  1SAU A;  2L7K A;  4CCN A;  1K78 A;  2Z99 A;  4J19 A;  5H2F C;  2LRD A;  5JFR A;  3OWT A;  5GAD J;  1DDN A;  3E5Q A;  3DLA A;  3VOD A;  2R5Y B;  1YHQ I;  2ELK A;  4HA8 A;  5D5U B;  1A35 A;  1YX3 A;  1Y8Q B;  2HDW A;  2WV0 A;  2JRT A;  2IJL A;  4I7H A;  3CO6 C;  2E7W A;  2R92 J;  1WI3 A;  3ABL H;  3CD6 I;  2R7S A;  2JUG A;  3QYB A;  4IX7 A;  2MBF A;  4FX0 A;  4F3Q A;  2NS0 A;  3ZXS A;  1R1V A;  1R4M B;  1BR1 A;  4LLL A;  4II2 A;  3VYS B;  4EJT A;  3SXY A;  2HPM A;  3CDI A;  3EYI A;  3I3L A;  2DDB A;  3KZI C;  4OAY A;  1H88 C;  1JT6 A;  2CH0 A;  3KEY A;  3QPH A;  1U9N A;  1OCP A;  5IP6 A;  3PUF A;  1A36 A;  4BXF A;  1R58 A;  5BPI A;  3R4K A;  3OYN A;  1FJL A;  2JRM A;  5EJC A;  2YPR A;  1NK3 P;  5H6R A;  3J80 K;  4BNC A;  3HTU A;  2LKX A;  1LDJ A;  2Z9O A;  1IRX A;  5EEA A;  2D1H A;  2KRC A;  1D5V A;  2K4B A;  2Y0M A;  3WG9 A;  3IAM 2;  2XAU A;  2LVS A;  3L2V A;  1OLT A;  3OS0 A;  3BTJ A;  5BOX A;  4BH9 A;  4IHT A;  3LSK A;  3A0B C;  1ETW A;  2DFH A;  4MQV A;  3H9J A;  3L2C A;  2HU9 A;  3L2W A;  1ZG5 A;  2STW A;  4B8X A;  1ITY A;  3MMY B;  3K4J A;  2R4G A;  1BM9 A;  1ZEL A;  4QTR A;  3BG7 A;  1YQA A;  1WJ5 A;  4XLH A;  4E7I A;  4MTD A;  3BG5 A;  4YEJ A;  2ZJR F;  2JK3 A;  3OYC A;  1BOA A;  2VBZ A;  1LNW A;  3N05 A;  5EDN A;  2WY7 Q;  4A2U A;  4BL0 B;  3HPG A;  5FKM A;  1I1G A;  2A69 F;  4LG0 B;  3B6A A;  1T2K A;  4RS8 A;  1U6G A;  4B43 A;  2IGM A;  1XCV A;  1FX7 A;  1X1B A;  4AM3 A;  1MMG A;  1P7I A;  2QSG X;  2LD5 A;  3HUG A;  4G8X A;  2HOT A;  3QYF A;  1JUS A;  4HNT A;  1Z9C A;  2MH2 A;  3T1B A;  2QSF X;  1BI0 A;  3CC4 I;  4OIN F;  1IF1 A;  4IHX A;  3WGI A;  4G6D A;  1A31 A;  3KP6 A;  3JRD A;  3E3V A;  1ETK A;  4MLO A;  1VQP I;  4Y7N J;  1RES A;  2YR2 A;  4O6J A;  2WB1 A;  3PSI A;  3FBI B;  1W36 D;  5IOY A;  1MBG A;  4HYE A;  3BR6 A;  1F5T A;  3JRG A;  4LIT A;  2Z3Y A;  1JJ8 C;  4R79 A;  1PUF A;  2VKV A;  1JT0 A;  2AS5 F;  2A3S A;  3D5S C;  5ICF A;  5CPR B;  3HIF A;  2PMH A;  1DPR A;  2Q2E B;  1GVD A;  1MND A;  2BXZ A;  2M34 A;  2LF8 A;  4MNU A;  3RQI A;  3M8E A;  1IUY A;  2DCE A;  4YIF A;  4JQF A;  3KLO A;  5D4S A;  2GXB A;  1FSE A;  1FMW A;  1OCR H;  2DXI A;  1D1C A;  4KUM A;  4RAZ A;  1D5Y A;  2MH9 A;  3K7A J;  2X0L A;  2DMQ A;  2BOL A;  1R7J A;  2VAS A;  1WSU A;  4S0H B;  2VXZ A;  1D3Y A;  2FE3 A;  2RAE A;  5KK1 A;  5JLW A;  1LB2 A;  4HV6 A;  1T08 B;  1YFH A;  4MEX F;  5FRO A;  4HW0 A;  3DQV C;  3IH4 A;  2ECB A;  2FA5 A;  1HKQ A;  2FQ4 A;  4OOI A;  5J1R A;  1VQK I;  3K1M A;  2X6W A;  1D0X A;  1R1T A;  5DD8 A;  4M6X A;  2VJJ A;  1ZH5 A;  3AL0 C;  3CME I;  3QPS A;  2W82 A;  5L3B A;  3VFZ A;  3CDH A;  2E35 A;  1V54 H;  2DA2 A;  4MFD A;  1YG2 A;  4C2M J;  5IP9 J;  1I6H J;  2DOF A;  2Z1D A;  4A0X A;  1VQ6 I;  4KYW A;  3WHC A;  2K7L A;  2OA4 A;  3GZN B;  3TO6 A;  2QSH X;  2EJR A;  3BCB A;  1OQY A;  2K5C A;  4Y17 A;  3FWE A;  1LJ9 A;  2E60 A;  3ZQ7 A;  1O4X A;  4I0A A;  2LMD A;  2OJE D;  4X1E A;  3HBL A;  3M8F A;  4BBR J;  3EYY A;  1IRG A;  2P8T A;  3M1E A;  2W7N A;  1G8X A;  1GXP A;  1LEB A;  2RRE A;  1BA5 A;  1YOV B;  5EF6 A;  5LBQ A;  3LL7 A;  2UZK A;  1Z1D A;  1W7P D;  2V1N A;  4KT6 A;  5LGU A;  3F8C A;  2ZJP F;  1K78 B;  5KNL A;  2CV0 A;  3B02 A;  2HVS A;  5HS9 A;  1TQM A;  1W4M A;  2F5E A;  1TBX A;  4ZDL A;  4Y13 A;  3RYP A;  2F4O B;  4WCG A;  4XRM A;  2LOO A;  2VQC A;  1QHG A;  1FY7 A;  1EKE A;  2ELH A;  3EPZ A;  3OIO A;  4BE2 A;  1GDT A;  3KZZ A;  4L9J A;  1SVM A;  2JA6 J;  3K1P A;  2XSJ C;  2ESN A;  4PCQ A;  1KZH A;  3K69 A;  4LMY A;  4Y4R A;  3RKQ A;  1FOK A;  4PJM A;  3IRR A;  2ETH A;  1BOB A;  3W2V A;  1OJL A;  4LFU A;  5J4V A;  1TWA J;  5K7H A;  2VT2 A;  3LA2 A;  1MDM A;  1YE9 A;  1RKW A;  3M4O J;  2DK8 A;  5AON A;  1N77 A;  2X48 A;  5BNG A;  2ZB9 A;  2H1K A;  1FZP B;  2PN6 A;  4MEY F;  3L7W A;  4BXX J;  1Z77 A;  2E34 A;  2M9H A;  4IJA A;  2UUZ A;  2NVT J;  3SFI A;  4HST A;  5K7Z A;  2I8D A;  1EJ9 A;  4AIK A;  4XLN F;  2HQA A;  1HF0 A;  1SEU A;  5K7F A;  1ERD A;  3MQ0 A;  3PO3 J;  5HNH A;  3E5U A;  1P2F A;  2LY1 A;  1W7P A;  2OU2 A;  3ML6 A;  4C2U A;  1FC3 A;  5IY5 H;  4P9U A;  2UXX A;  5IT3 A;  1AA7 A;  2M3A A;  3JRH A;  2PG4 A;  2X1D A;  4FE4 A;  1ETQ A;  3JR9 A;  3TQN A;  1YTY A;  3CCJ I;  4F91 B;  3P9I A;  4C3J J;  2IS2 A;  2WWY A;  2WC2 A;  2VOD A;  2VI6 A;  1T0F C;  5ERI A;  2LP0 A;  1O57 A;  3KPH A;  3OYA A;  4II3 A;  2KIF A;  2JZY A;  2M30 A;  3HRM A;  2RN7 A;  3BZC A;  1HC8 A;  3I5U A;  1Z0X A;  2YSR A;  3V42 A;  1T6S A;  3HOW J;  2M1B A;  2NNY A;  1QZZ A;  3VYU B;  5F0F A;  3FHZ A;  3BJ6 A;  3KYD B;  3BR1 A;  1OFC X;  4ZZL A;  5JVG F;  1O3R A;  3HUG B;  2RVC A;  2O61 A;  3GZ5 A;  1R00 A;  4RB0 A;  1FTT A;  3CF2 A;  2CQK A;  5ICC A;  1BC7 C;  2GIZ A;  5CKT A;  2WAQ N;  2Y9Y A;  1W0T A;  4G6Q A;  4BXU A;  2FD5 A;  1HCR A;  5LRS A;  2QKL B;  3DPL C;  4F55 A;  1MBE A;  1XN7 A;  2FSW A;  3BWG A;  1WQ2 A;  3DKW A;  1H8A C;  4PDK A;  4G12 A;  3OS2 A;  2K9L A;  1SC7 A;  2E7X A;  2R7D A;  3J7A O;  3L9F A;  2VL8 A;  5C4X J;  1RR7 A;  2J5P A;  3HL2 A;  1STZ A;  2K3F A;  2GOX B;  4N0B A;  3D1N I;  5DTD A;  4J00 A;  1TNT A;  3H1C A;  4UXN A;  1FWZ A;  2DDA A;  3FXL A;  4IF4 A;  2ADU A;  3GF2 A;  1FOX A;  1SMY F;  1FOY A;  4P1W A;  5F27 A;  1JE8 A;  3RZO J;  2IA2 A;  4BE1 A;  2IRF G;  1YYV A;  2BVL A;  5CQE A;  1O7L A;  1ON2 A;  1R5I D;  4CGZ A;  5K5R A;  2V1D A;  2HGC A;  1POG A;  3F9K A;  3A03 A;  1BI2 A;  4BS9 A;  4Y3O A;  1Y1W J;  3EDP A;  4U87 A;  1RUN A;  2IGK A;  1VF9 A;  1WWX A;  1JHH A;  3AFH A;  1Y6I A;  5GPC A;  1S7E A;  1SD5 A;  2HQ5 A;  1G3S A;  3VWB A;  1JGG A;  3J7A Y;  4N4N B;  2QLZ A;  2XAQ A;  1JHF A;  1XSX A;  1ZG3 A;  3GFI A;  2G9W A;  1XTA A;  2A6H F;  2P5V A;  1TWC J;  3OL3 A;  1HOM A;  4A3I J;  4EM2 A;  4B09 A;  1U8R A;  3KP5 A;  1I1S A;  1KU3 A;  2XF5 A;  1IXS B;  3I4N J;  2M87 A;  1YW7 A;  3GXO A;  4P55 A;  1HKS A;  3CC7 I;  1TWH J;  2DTZ A;  2KQR A;  3K70 C;  2F5V A;  3OYG A;  2DK5 A;  4LB6 B;  2K9S A;  3Q3S A;  3WGG A;  2DBB A;  5L3G A;  1XPX A;  4D7M A;  2JVH A;  2YX7 A;  4NHJ A;  3DBH B;  2CW8 A;  3O3K A;  3PL8 A;  3AAF A;  3HHH A;  4OWR B;  4G94 A;  3GTQ J;  1XD7 A;  3TL4 X;  2PEX A;  4BDZ A;  4ESF A;  2VBW A;  2F6C A;  1YO5 C;  4HG2 A;  4LOC A;  3BG9 A;  3FM3 A;  1U5T C;  1V5E A;  4M9S A;  1HLV A;  3BZK A;  1O3T A;  2K9M A;  1Y0N A;  2XB0 X;  1GV5 A;  3QOD A;  2BHZ A;  3DPT A;  3RPU D;  1VQ8 I;  1T56 A;  1GVJ A;  5DUK A;  4LK1 F;  5DEQ A;  1OKR A;  5HLT A;  2Q8K A;  4QPO A;  1LKX A;  5E8G A;  3KCC A;  3PNT A;  5IYC J;  2VJI A;  2WAE A;  3LSR A;  4IRG A;  2WAD A;  2HEO A;  3SFZ A;  2DLL A;  2BBY A;  5IYD J;  3LSH A;  2EFN A;  4CDG A;  2F2E A;  3CCL I;  3GFL A;  4UVB A;  2A61 A;  2HDC A;  4XN3 A;  3TDU C;  1I6X A;  2OBP A;  2RV8 A;  3CP8 A;  3HOS A;  2XAH A;  1ZLJ A;  3K4K A;  1T98 A;  3J7Z I;  2LG4 A;  4HQE A;  1NK2 P;  1U9O A;  2WTE A;  1T39 A;  1ZR2 A;  3S1N J;  5E3O A;  4EMS A;  3QRF F;  1MDM B;  3SZG A;  1LFP A;  1OCO H;  2H8R A;  3KP4 A;  5HDN A;  1I27 A;  1G3T A;  3DF8 A;  2V9P A;  1OYY A;  3R60 A;  5DCM B;  3KFW X;  3IP4 B;  2LK2 A;  4AYB N;  3AG3 H;  2VT3 A;  1SFK A;  3ZCO A;  4RBO A;  3JRI A;  3V4G A;  1RKT A;  3V7S A;  2FJ1 A;  3G1M A;  1FP1 D;  2K3P A;  2QQ9 A;  2O7O A;  2CUZ A;  1FIP A;  4C9Y A;  3RPU A;  2R7F A;  4CCM A;  3OYE A;  1OCT C;  1UHS A;  5LGT A;  3SHF A;  1VQL I;  4ZTF A;  2HFH A;  1MBJ A;  3ABT A;  3FMS A;  1YJ9 I;  1IN7 A;  1D1B A;  3FXM A;  4JX4 A;  5B66 C;  2E1N A;  3HPH A;  1JKP C;  2LY9 A;  1MSF C;  4FE7 A;  1SAN A;  1MJA A;  3V7C A;  1ZR4 A;  2KRH A;  2X6X A;  4MTE A;  2ICW G;  2ZSH B;  5HLI A;  1K4T A;  4RLQ A;  5TJJ A;  2XGC A;  5DS9 A;  2CFX A;  3FMR A;  4JX5 A;  4OMZ A;  5JLX A;  1QQI A;  4CSW A;  2QA4 I;  1YJW I;  4C2T A;  2HYF A;  3CDL A;  3ZQF A;  4FAS D;  3QP6 A;  1AKH A;  3LQQ A;  2CG4 A;  2QYO A;  1Y1V J;  4AVP A;  1T38 A;  5J4Y A;  2FF4 A;  5K5O A;  5M5W J;  1X3Z B;  5EZG A;  1R5H A;  4FCY A;  3FHN A;  2F48 A;  4XKB A;  1UEL B;  2FXA A;  2Q1Z B;  3CQZ J;  3HOU J;  4ZJZ A;  2M4K A;  4JK1 X;  1CF7 B;  5FRM A;  5C4J J;  4FIS A;  4E7K A;  3TW6 A;  3DXJ F;  3G2B A;  2K9Q A;  3F3X A;  5J40 A;  3OR2 C;  2W1O A;  3Q0W A;  1ZRD A;  2IGO A;  2JPB A;  4XLF A;  3CCS I;  2VBY A;  4GDF A;  3MKY B;  1AU7 A;  3FBN B;  1EH6 A;  4R8H A;  5J6X A;  1I39 A;  2L7Z A;  4GO1 A;  4BKX A;  2MSY A;  1MBK A;  4XK4 A;  2JA8 J;  2X1E A;  2DYS H;  2EFO A;  4X6A J;  2M7A A;  4QSH A;  3CTA A;  3ASN H;  1VND A;  2RNJ A;  2ESH A;  5E3M A;  4Z2Y A;  2KIM A;  1XCB A;  2E1M B;  3T5X A;  1M1E B;  2XF7 A;  3DPU A;  3KX2 A;  4HF0 A;  4LGW A;  4NDL A;  4YG2 F;  4AC0 A;  5M5X J;  3DEW A;  4RM3 A;  2HXO A;  2OCE A;  2HS5 A;  2L7M P;  4BU2 A;  3V8L A;  1DU0 A;  1J09 A;  4JX6 A;  5ICG A;  4CCO A;  2XRO A;  2OCC H;  4A5M A;  2FEZ A;  5CVU A;  4LIV A;  2LF7 A;  4ESJ A;  1QPM A;  3I54 A;  3L09 A;  1PYV A;  2R7O A;  3QYE A;  1T8I A;  3PQJ A;  3DTE A;  1ZKG A;  3GFJ A;  2ZXJ A;  2CYY A;  4I02 A;  1LE8 A;  2BY2 A;  3G73 A;  5LHG A;  4I76 A;  1MW7 A;  1U5T B;  3IC7 A;  4D7N A;  3FK7 A;  3JRF A;  1IN4 A;  1R22 A;  3OYJ A;  1PP8 F;  2GLO A;  3E97 A;  1IV8 A;  3C2G A;  2OZU A;  2MD0 A;  4GYG A;  4UV9 A;  5TIS C;  3BC8 A;  3HRS A;  3FXQ A;  9ANT A;  1HBX G;  2LRE A;  4NQW B;  1B9N A;  2XRN A;  4WXC A;  4ZYG A;  1K4S A;  2L2O A;  3ESW B;  5J1U A;  5HDG A;  3LAJ A;  1NG7 A;  3MN2 A;  4KIF A;  2DA4 A;  2L9N A;  1ETO A;  5FFX A;  3Q0V A;  1T95 A;  4DYR A;  4XN0 A;  1WJF A;  4ZYD A;  1MZB A;  2ECC A;  2VIX A;  3CJT B;  2H1L A;  2JMW A;  3RIR A;  1BIA A;  5FKN A;  3ROU A;  4BEH B;  4EVI A;  1ZQ3 P;  1HW1 A;  1P4A A;  1BR2 A;  5EEH A;  3F6V A;  4HX7 A;  3ULQ B;  1KQ9 A;  4H0E A;  4CUG A;  2ZME C;  3KEQ A;  1PP7 U;  1W5S A;  3GBG A;  1MBF A;  2ISY A;  3KET A;  5E79 C;  1VQ5 I;  4F7Z A;  2FOW A;  4XLC A;  1L0O C;  3V8J A;  4E7S A;  2VC0 A;  1K7A A;  2FBH A;  3K0L A;  4A69 C;  1WJD A;  4L9V A;  3S3M A;  2JTV A;  3E6M A;  3JSP A;  4A3G J;  2R7X A;  2FBK A;  3BRO A;  2K85 A;  3LSI A;  5D6F A;  2KKO A;  3A4C A;  2K9N A;  1OPC A;  5KCM A;  3OYL A;  2BY0 A;  5JVT A;  2LDU A;  3K1N A;  3QP5 A;  4IHV A;  4UUV A;  1I3Q J;  4L18 B;  1TL8 A;  1V4R A;  1FEX A;  3CO7 C;  3QWL A;  3BG3 A;  1YS7 A;  2W25 A;  3K4B A;  3SZP A;  3SDB A;  4IZZ A;  2IS1 A;  1E0E A;  5GPA A;  1CGP A;  2Y0S N;  4XOT A;  3GZ6 A;  2KFD A;  2OV7 A;  3ZN1 A;  2E1O A;  2R7V A;  3ISP A;  3DV8 A;  3M8J A;  3S1R J;  1QZY A;  2O0Y A;  2VBX A;  1R9T J;  1MH4 A;  1K79 A;  5FO5 A;  2O9L A;  3GLL A;  2A5Y B;  4UVC A;  3R0A A;  1RC9 A;  4HPQ A;  2ME0 A;  3ZGK A;  2QUF A;  1ON1 A;  4RA2 A;  3VB2 A;  2DOA A;  1H9T A;  3BQZ A;  2VOO A;  2K40 A;  3RKW A;  1J7K A;  1QZE A;  2LSO A;  3M3Y J;  3SDG A;  3PIP F;  1Z7L A;  4CCL A;  4PFO A;  1TP4 A;  1SD7 A;  4PK4 A;  3TOB A;  3WOD F;  3ECH A;  4LB5 A;  3LFU A;  4RB2 C;  4BYY A;  4CYD A;  4DYC A;  2FQ3 A;  2I10 A;  2KP6 A;  2MG4 A;  3ZQI A;  2CS3 A;  2DFE A;  1SVO A;  4QIW N;  4OIR F;  2ZBK A;  1YX5 A;  2XV4 S;  1B1B A;  3PO2 J;  2E5Z A;  2L9V A;  2MA3 A;  5KHD A;  5F08 A;  2OQR A;  2Y31 A;  2HKX A;  2WA0 A;  1YS6 A;  1AKH B;  1UG2 A;  3JCU C;  2OTJ I;  3K10 A;  2MC3 A;  2VLA A;  4Y15 A;  4CZC A;  2EIJ H;  3K4C A;  4OU0 A;  2K02 A;  2BYV E;  1X1A A;  4FQG A;  1ORK A;  2HKO A;  2BZT A;  4A5N A;  3SQN A;  3HC7 A;  3CCQ I;  2P7C B;  2O5R A;  2HQN A;  1KYZ A;  2HDD A;  3T0Y A;  3VPR A;  2ID6 A;  1KA8 A;  2VKH A;  4N4O B;  4XR6 A;  1S7O A;  2PX9 A;  1O7F A;  3REO A;  3S2H J;  2ZNZ A;  4M3B A;  1ZGJ A;  3DEE A;  1VTN C;  4PGH A;  5FGM A;  2G0E A;  4EJV A;  3RCO A;  1XDS A;  1UB9 A;  4XON A;  5DM6 F;  5GP9 A;  1OIS A;  2XGE A;  2IS4 A;  2KIU A;  2B9S A;  1ETV A;  1ZYR F;  1BL0 A;  2JQ7 A;  4UY8 I;  3HTS B;  4MIM A;  2EV0 A;  2EFQ A;  4D5C A;  4HOB A;  1ZGA A;  3W2A A;  2IP2 A;  5KAF C;  1J9I A;  4M71 A;  2LTP A;  2TCT A;  3MKW B;  4EJO A;  2E2J J;  4LJZ F;  2IA1 A;  2F5F A;  1HQC A;  2Y0S A;  1UJ8 A;  4CHU A;  5E8I A;  1WH5 A;  3ZOB A;  4G7H F;  3F72 A;  4YII A;  4BJ6 C;  1B72 A;  3DTI A;  2ZCW A;  1RNL A;  2DQL A;  2DTR A;  3S32 A;  1KQ0 A;  1G3Y A;  3KP7 A;  1Z6R A;  2IA0 A;  3DEU A;  1Z67 A;  4BHB A;  3K9T A;  1NTC A;  5IYB J;  3S3O A;  4OIQ F;  2CMP A;  3HKZ N;  1LDD A;  3P9K A;  2GXA A;  2XAS A;  4ZTJ A;  3O2P E;  4XMY A;  2KIQ A;  1GXQ A;  4B3A A;  2EFW A;  3N4M A;  1FIA A;  2HXI A;  1SD4 A;  3MAJ A;  3ABM H;  2FOK A;  2E36 A;  4XLP F;  3BJA A;  3S8P A;  3PIO F;  2HPI A;  1XSD A;  4F92 B;  1LE8 B;  2KJB A;  1V55 H;  1XC5 A;  4FET A;  5J8F A;  2Z5U A;  4KMF A;  2AQE A;  4EGZ A;  2JSP A;  1ZN2 A;  4UV8 A;  3GTJ J;  1QPI A;  2LC2 A;  3ONQ A;  1QA6 A;  5B1B H;  4CCK A;  2OPT A;  3TP3 A;  1MMN A;  3RJP A;  5J1Y A;  2L4A A;  5L3C A;  1ZLK A;  4EEF G;  4L0Y B;  2QF7 A;  3S2W A;  5ED4 A;  1V3F A;  2ZME B;  2DT6 A;  3EUK L;  2E2H J;  2H6C A;  2P5L C;  4ON0 A;  4EJU A;  3WU0 A;  4EJW A;  5LFA A;  2DT7 B;  2MGQ A;  5D8K B;  3CMA I;  3DTK A;  4KA4 A;  1OCZ H;  2KZG A;  3MZH A;  4ZYA A;  2R7Q A;  3F6O A;  5GTI C;  1C0W A;  2EV6 A;  3CJQ B;  5LGN A;  3FXR A;  4G7Z F;  4XSX F;  4IXA A;  4KMU X;  3JTH A;  4JP0 A;  3ZMT A;  2A05 A;  4KJZ A;  5FLX Z;  3RPQ A;  5DCM A;  4S04 A;  1U2W A;  3M9A A;  3I0T A;  3KYL A;  2HOS A;  2IAI A;  5FFZ A;  1ODD A;  3DFG A;  2BY3 A;  4W1U A;  4GGG A;  5FLX K;  4RDU A;  1D8K A;  3FX3 A;  1X19 A;  2B7E A;  2L5Q A;  2RQP A;  4XOP A;  5LRR A;  3L2U A;  1JTY A;  3TGN A;  2CSO A;  3FXK A;  3ECO A;  1WRJ A;  2HOA A;  1T0F A;  2UV1 A;  2DT5 A;  2V6C A;  4RGS A;  3A2K A;  2EH3 A;  3K2A A;  1N78 A;  2CJJ A;  2LR8 A;  4AVZ A;  1MGT A;  3MZY A;  4ZZD A;  4NC6 A;  1WI9 A;  3K4N A;  3UKG A;  3ZMD A;  3GFM A;  3KE2 A;  5E1X A;  1OR7 C;  2XAG A;  2TDX A;  4RGX A;  3K4L A;  1Y39 A;  2CQQ A;  5J8C A;  3IH3 A;  2E2I J;  1X58 A;  2GBY A;  2RDP A;  3PFI A;  1P4W A;  3H5N A;  1TZL A;  4Y33 A;  1SFU A;  1SFX A;  3LST A;  2RC4 A;  1UFM A;  2QQA A;  4LG3 A;  3A02 A;  2D1V A;  2CO5 A;  3K70 D;  1VQO I;  4AIH A;  5HVQ C;  2XVC A;  2ZNY A;  2E5N A;  4B47 A;  5L3D A;  2HTJ A;  2HWV A;  2M5W A;  3LSM A;  1W0U A;  4M3F A;  1CF7 A;  1P4X A;  3HRU A;  5JHU A;  5FB2 A;  4A12 A;  2QWW A;  1AWC A;  1EV7 A;  3LSJ A;  2AXL A;  4UNO A;  2STT A;  4XOR A;  4B1R A;  3JSO A;  3ZQG A;  1RUO A;  2ZSI B;  1J5Y A;  5H20 A;  1SFE A;  2DW4 A;  1S3J A;  2BV6 A;  1EA3 A;  2DQR A;  2IT0 A;  3NAU A;  4U88 A;  2FRH A;  2KHM A;  4KIT B;  5FJ8 J;  1P7J A;  4G6T B;  3G3Z A;  4G7O F;  1LVK A;  1W5T A;  2XRL A;  1JTX A;  2VJ4 A;  3WG7 H;  3IV5 A;  4CCJ A;  3F21 A;  3QPL A;  4NB5 A;  4XIC A;  1YIO A;  4HRI A;  4AID A;  3KP3 A;  3HEF A;  2GA1 A;  3ZP5 A;  2PFB A;  3GTM J;  2NOJ B;  3HM5 A;  4EM0 B;  3F8N A;  1U78 A;  4L9T A;  2KT0 A;  1LPQ A;  4RGU A;  1WVR A;  5E20 A;  3QPT A;  1IXR C;  3TED A;  1XB4 A;  2D45 A;  3ZQC A;  4IEJ A;  4KIC A;  3AL0 B;  1IAW A;  4X0G A;  1JUP A;  2VC1 A;  2OD5 A;  4M72 A;  1KU7 A;  2JVG A;  3I64 A;  4PSW A;  2GZW A;  3RKX A;  2JJ7 A;  3QOP A;  3S17 J;  3M1C A;  3C2B A;  3RSN A;  3VOE A;  3FKI J;  2GOM A;  5E1Z B;  3OSF A;  1IW7 F;  1IXC A;  2ZFU A;  3OS1 A;  5D5V B;  1E3P A;  1JGS A;  3V7R A;  4A3J J;  1TNS A;  5F1J A;  5CQG A;  2DMU A;  1YLF A;  3H3Z A;  4BAC A;  3HG9 A;  5A2Q Z;  1B72 B;  1U5T A;  2XGX A;  3Q9V A;  3HOZ J;  5IOZ A;  3WE2 A;  4KDP A;  5A2Q K;  1AHD P;  4C30 A;  4NUB A;  5EGO A;  4CA0 A;  5M3F J;  1KU9 A;  2EZL A;  1P9Q C;  2COB A;  4NBQ A;  1IJW C;  4NQW A;  2R0Q C;  5JHF A;  1ZTR A;  5DD4 A;  4CYC A;  3J81 Z;  1EH8 A;  2ME6 A;  2E1C A;  4BY1 J;  2VUM J;  3SYT A;  3ASO H;  2QZ8 A;  1R5G A;  3OL4 A;  2OZ6 A;  4B48 A;  1YIT I;  2JA7 J;  2DPD A;  2P7V B;  4BEH A;  1B8I A;  2ACJ A;  3PJR A;  2TRT A;  3G1O A;  1HDP A;  2L9S A;  5F04 A;  2WAQ A;  3TMO A;  3CP2 A;  2W00 A;  2ZKZ A;  4I0B A;  4N9H A;  1X4P A;  1VI0 A;  3JRA A;  4YEL A;  4P96 A;  2QEX I;  1BC8 C;  5DYM A;  3H5A A;  3U21 A;  4A93 J;  4RMN A;  3JAM Z;  3I53 A;  1OMI A;  3CUQ C;  2R7W A;  5K1Y A;  2A6T A;  4OMY A;  2F4I A;  4HEA 2;  5JR3 A;  2BW3 A;  1ZK8 A;  3RTR A;  3Q5F A;  2LH9 A;  3V8K A;  2CW0 F;  2JA2 A;  2XPV A;  2GA2 A;  1A6Q A;  5E18 F;  1KGS A;  2KDZ A;  2CU7 A;  4ZYE A;  2KJC A;  2GWR A;  2ISZ A;  1R4N B;  4WXD A;  4J01 A;  1FYK A;  3O6B B;  2HZT A;  1REP C;  3IKT A;  2D5V A;  3CCR I;  1S72 I;  4QWQ A;  3ZMS A;  1XGO A;  2EA2 A;  2HQR A;  5D6E A;  2HTS A;  2R7U A;  4HX8 A;  4DBQ A;  2V4J C;  3OYB A;  2NXN B;  1R6R A;  4XKW A;  3WTV C;  1MNE A;  2DO7 A;  4HDU A;  1BR4 A;  4BQN A;  4IHY A;  4ESB A;  2AHQ A;  5HLG A;  3CJN A;  4CXF A;  2XUB A;  2QBY A;  4KIB A;  4ZC3 A;  2IBD A;  3ERE D;  1F43 A;  1E3H A;  1GV2 A;  1R1U A;  2RQQ A;  1QBJ A;  1TW3 A;  1B4A A;  3QQA A;  3LQR A;  4HV5 A;  1RIO H;  1LFB A;  2J5O A;  2XSD C;  3W3C A;  4MHG A;  3DCF A;  3HSF A;  3I58 A;  2EV5 A;  2K27 A;  4XLE A;  3I59 B;  5H6Q A;  4M73 A;  3MEX A;  3N97 A;  3C3W A;  2VE8 A;  2OF7 A;  5FLM J;  4YIR X;  3W6K B;  2QQB A;  3C1D A;  4IPA A;  1GUU A;  3HOV J;  3E0J B;  2DMT A;  3MKL A;  3BT9 A;  5B3S H;  3HOX J;  3ZMZ A;  3U9G A;  2X9D A;  1TW2 A;  5BQT A;  2HR3 A;  3U2R A;  2MLG A;  1SVL A;  3ABK H;  3GW2 A;  4DNC A;  3L1P A;  2NVQ J;  1BI1 A;  3OIQ A;  1Z91 A;  3DU6 A;  3O8H A;  3LA3 A;  3Q0U A;  1DP7 P;  3FM5 A;  1DQU A;  3ERM A;  5LLQ A;  1IN5 A;  2ZXH A;  2DI3 A;  2L7F P;  4Z6Y A;  5M5Y J;  1ZRE A;  3BR5 A;  4I09 A;  2PBI A;  3OYI A;  2DFF A;  3QAH A;  2KRF A;  4HX4 A;  2FBI A;  4XM3 A;  4M9Z A;  4KNY A;  3PUB A;  3HXL A;  1LQ1 A;  4YRV A;  2JUC A;  3QU6 A;  5L3F A;  5IP7 J;  2EBI A;  3WTZ A;  2F4M B;  4P9F A;  1APL C;  3OYD A;  2FNP A;  5CYV A;  3KIO A;  4FHT A;  3A01 A;  1QU3 A;  1J2X A;  1DPU A;  4V2F A;  3LAP A;  1TLH B;  4PSX A;  3AKZ A;  5E1W A;  3PNY A;  4QLC U;  1LEA A;  3KYC B;  1XSV A;  4M6V A;  5ILU A;  5HOD A;  3S93 A;  1R49 A;  3I55 I;  2AXT C;  1B6A A;  2H94 A;  2X85 A;  3ZQQ A;  2MD5 A;  1FTZ A;  4BGD A;  2L0K A;  2ZFW A;  1JUM A;  1TT0 A;  4Q48 A;  1X2N A;  3BPX A;  2CQ7 A;  3C18 A;  1X3W B;  2L3D A;  4OAZ A;  1H9G A;  2DA1 A;  3FIS A;  4AYB A;  4BJ5 C;  5B1A H;  2XPW A;  4A3E J;  1Z6T A;  3G4S I;  3CCU I;  4M74 A;  1ZGW A;  4PZJ A;  1UAA A;  4EGY A;  3H0G J;  2IEK A;  4MFE A;  2DMP A;  4WF2 A;  4IOC F;  3NEU A;  4M3D A;  3WTT C;  5EZH A;  1S9H A;  3TW7 A;  1X3U A;  1Y0U A;  2HNH A;  2M45 A;  3OYM A;  3GTO J;  1TQP A;  2LKP A;  3S15 J;  1Y56 A;  1FYM A;  2M2E A;  1HW5 A;  1IDY A;  1SD6 A;  3OIP A;  3JW4 A;  4U0W A;  3RKY A;  3HB9 A;  1K83 J;  4ABZ A;  2EWN A;  2XIG A;  2VE9 A;  2ZXW H;  4LK0 F;  2R5Z B;  3LWF A;  4E7Z A;  4FT8 A;  5D5W B;  3BQY A;  4L9N A;  5L3E A;  3VYR B;  3BG6 A;  1Q1V A;  3OYH A;  2AO9 A;  3HDD A;  1MMD A;  5FKK A;  1XGM A;  5EGO B;  2CWE A;  3IRQ A;  1ZAO A;  3BDD A;  3R6S A;  2DYR H;  3LNQ A;  1O3S A;  1SAX A;  5GTH C;  4E4H A;  3T8R A;  1ZRC A;  4CYC B;  2NYX A;  1R36 A;  2ZME A;  5ILS A;  3HRT A;  4I2O A;  3WHB A;  5F0C A;  1J0R A;  3HGY A;  2M8G X;  3DBR B;  2ZJQ F;  1H89 C;  1KYW A;  3CUQ B;  4Q4Z F;  2DA5 A;  1FNN A;  3JRE A;  4I98 B;  1B8I B;  3GLX A;  3DWL E;  4L5E A;  1EH7 A;  3M07 A;  4LLG F;  4RM2 A;  2RKH A;  1U8B A;  5F1R A;  2V79 A;  4AUX A;  4JYK A;  1X1C A;  2F5C A;  2WV1 A;  3PQK A;  2L54 A;  2GM4 A;  1HST A;  2EZK A;  2MYS A;  3K2Z A;  3MWM A;  2XGD A;  2WB1 N;  3DP7 A;  2QQ8 A;  3VSK A;  1SFO J;  2P5K A;  2E71 A;  3H3V K;  3HHG A;  2Z33 A;  1VQ7 I;  3GVA A;  3ZN0 A;  1IV6 A;  2BW3 B;  3BCA A;  1VQ4 I;  3S3N A;  1NG6 A;  2W85 A;  3FXJ A;  4RB3 C;  5D8L B;  2NAZ A;  3U1K A;  3K6G A;  2ZO4 A;  1D1A A;  1FLI A;  5IPA A;  2VQL A;  4ZYH A;  1R71 A;  4I01 A;  1ETX A;  1OCC H;  3H36 A;  3NWT A;  3OYK A;  3RZD J;  1IZ1 A;  4MGR A;  3U1D A;  1JKR C;  2LLK A;  3R61 A;  1QVU A;  1PVE A;  4WX9 A;  3J80 Z;  4CIC A;  4QPQ A;  2PMU A;  5C3E J;  2CUE A;  1HA8 A;  4B4C A;  2PJP A;  2W4S A;  1B59 A;  1VZ0 A;  4CZZ A;  2VQH A;  3F8F A;  1XDU A;  4BJT A;  4ZH4 F;  1NHA A;  3DU5 A;  4ASN A;  4GYI A;  1BJA A;  4XLA A;  2CGP A;  4IVN A;  2DA6 A;  3HSE A;  1U3E M;  2QBY B;  3W6J B;  1XGS A;  3ZMV A;  3HGG A;  4HBL A;  1TC3 C;  3SZT A;  2Y9Z A;  2EIK H;  1YW8 A;  3CCV I;  4XBF A;  1LUJ B;  3MKZ A;  1MNM C;  1RZ4 A;  3NAR A;  1GLN A;  5M3M J;  2EZH A;  3GWZ A;  4UB8 C;  2VJ5 A;  5DUI A;  4BDY A;  2P4W A;  2YU3 A;  2YX4 A;  2KLO A;  3CMY A;  2N8G A;  4B44 A;  2MAB A;  2BE5 F;  2CRG A;  2FML A;  2OUM A;  2YUS A;  4BHP A;  4ENM A;  4PUS A;  1PJR A;  2HOE A;  4ZDP A;  1GT0 C;  2NS7 A;  2W24 A;  4D1Q A;  4DIQ A;  2D2W A;  1WH7 A;  4XID A;  2M8E A;  2LYC A;  1IGN A;  3D5R C;  4ENK A; 
#chains in the Genus database with same CATH homology
 4W1U A;  5EG0 B;  4RDU A;  2DMN A;  4LOC A;  3BG9 A;  1JTY A;  2HOA A;  3JRC A;  1HLV A;  2XB0 X;  1GV5 A;  3JRB A;  2EH3 A;  3K2A A;  1T56 A;  2CJJ A;  2LR8 A;  4C3I J;  3FK6 A;  3UKG A;  3W6V A;  3BTI A;  1K61 A;  5IYC J;  3S2D J;  1IC8 A;  3LSR A;  4UUS B;  4D5F A;  1IUF A;  2CQQ A;  3IH3 A;  5IYD J;  2E2I J;  1X58 A;  2GBY A;  2LFB A;  3A01 B;  4MO7 A;  4FTH A;  3GTK J;  2B63 J;  1NK2 P;  3A02 A;  5F0H A;  3BTL A;  2JA5 J;  3E7L A;  1U9O A;  2DJN A;  1ZR2 A;  3S1N J;  5E3O A;  2H8R A;  3SJM A;  2NVY J;  4J19 A;  4M3F A;  1W0U A;  3CCY A;  3LSJ A;  3I4M J;  2LK2 A;  2R5Y B;  2ELK A;  4AYB N;  2R93 J;  4B1R A;  3ZQG A;  3JRI A;  4RBO A;  1RKT A;  2MW8 A;  2FJ1 A;  3G1M A;  1BW5 A;  2NS8 A;  3LSG A;  3NAU A;  1WI3 A;  2R92 J;  2O7O A;  1IG7 A;  1FIP A;  5FJ8 J;  1P7J A;  3F0C A;  1OCT C;  2CUF A;  1UHS A;  2XRL A;  1JTX A;  5EYR A;  3IV5 A;  3QPL A;  4XIC A;  2EQR A;  1MBJ A;  3HEF A;  3GTM J;  4JX4 A;  4XRS A;  1JKP C;  3HM5 A;  2LY9 A;  3LOC A;  1LFU P;  1MSF C;  1U78 A;  4FE7 A;  1SAN A;  1H88 C;  1JT6 A;  2KT0 A;  1ZR4 A;  3MVP A;  4A3B J;  1U9N A;  1OCP A;  2XGC A;  5DS9 A;  5IP6 A;  4Y52 J;  4JX5 A;  5JLX A;  3TED A;  1FJL A;  3ZQC A;  1NK3 P;  1WPK A;  4IEJ A;  3CDL A;  3ZQF A;  1AKH A;  1JUP A;  2LKX A;  1Y1V J;  2Y2Z A;  5M5W J;  2JJ7 A;  5EEA A;  3S17 J;  5EZG A;  4FCY A;  3C2B A;  3FKI J;  2LVS A;  3OSF A;  3BTJ A;  3CQZ J;  3HOU J;  1ETW A;  2DN0 A;  4A3J J;  5F1J A;  5C4J J;  2DMU A;  4FIS A;  4M3G A;  3TW6 A;  2HI3 A;  1ITY A;  2K9Q A;  4DYQ A;  1B72 B;  4QTR A;  3HOZ J;  5IOZ A;  3Q0W A;  3BG5 A;  1RPW A;  2JK3 A;  4UUT A;  1AHD P;  5EGO A;  5EDN A;  5M3F J;  4W97 A;  2EZL A;  2COB A;  1AU7 A;  4A3D J;  1IJW C;  5FKM A;  2R0Q C;  2P81 A;  1ZTR A;  2L7Z A;  4CYC A;  1T33 A;  4BKX A;  2MSY A;  3B6A A;  1MBK A;  2ME6 A;  2VUM J;  4XK4 A;  4BY1 J;  2JA8 J;  3BTC A;  2O8K A;  3TP0 A;  4X6A J;  1P7I A;  4QSH A;  2LD5 A;  1VND A;  2HOT A;  1JUS A;  5E3M A;  2JA7 J;  1B8I A;  2TRT A;  3G1O A;  1HDP A;  5F04 A;  4IHX A;  3HOY J;  4NDL A;  3JRD A;  4A3F J;  1ETK A;  4MLO A;  1VI0 A;  3JRA A;  4Y7N J;  3S16 J;  1RES A;  4AC0 A;  5M5X J;  3DEW A;  2HXO A;  4A93 J;  1XS9 A;  2L7M P;  5IOY A;  1MBG A;  1DU0 A;  3BR6 A;  4JX6 A;  3JRG A;  1JJ8 C;  1MBH A;  1PUF A;  2VKV A;  1JT0 A;  1ZK8 A;  1WCM J;  2XPV A;  1GVD A;  2M34 A;  3BR0 A;  1ZKG A;  4DW6 A;  2KDZ A;  3RQI A;  2CU7 A;  1TWG J;  1LE8 A;  4I76 A;  1RET A;  3JRF A;  4D7N A;  1TWF J;  3FK7 A;  2D5V A;  2GLO A;  1D5Y A;  3K7A J;  2DMQ A;  9ANT A;  2NVX J;  4S0H B;  5J1U A;  2DA7 A;  4IHY A;  1QRY A;  2RAE A;  3MN2 A;  5JLW A;  2AHQ A;  1X2M A;  2DA4 A;  1ETO A;  3B6C A;  3Q0V A;  4DYR A;  3IH2 A;  2IBD A;  1F43 A;  1GV2 A;  3IH4 A;  1YRN A;  2ECC A;  2JMW A;  2ECB A;  2FQ4 A;  5FKN A;  2JWT A;  5J1R A;  3QQA A;  1ZQ3 P;  1JKO C;  1EF4 A;  3QPS A;  1LFB A;  4MFD A;  2DA2 A;  4C2M J;  5IP9 J;  2XSD C;  4GFB A;  4A3M J;  1I6H J;  3DCF A;  2R7Z J;  3GBG A;  1MBF A;  3WHC A;  1BW6 A;  1UMQ A;  2OF7 A;  5FLM J;  1G2H A;  2NOG A;  1GUU A;  3HOV J;  3GTL J;  2DMT A;  3MKL A;  3BT9 A;  3HOX J;  3O8G A;  2X9D A;  4A69 C;  1PUF B;  4A3G J;  1O4X A;  3L1P A;  4X1E A;  3HBL A;  2K9N A;  4BBR J;  2NVQ J;  2W48 A;  4IHV A;  2XB5 A;  5E3L A;  3BR2 A;  3O8H A;  3Q0U A;  1I3Q J;  1BA5 A;  5EF6 A;  1FEX A;  1I50 J;  2L7F P;  5M5Y J;  3S1Q J;  3BR5 A;  3BG3 A;  4A3L J;  1ENH A;  5GPA A;  2Y0S N;  3FIW A;  2E1O A;  4UUS A;  5IP7 J;  2EBI A;  2ID3 A;  2R5Z A;  3S1R J;  4XRM A;  1R9T J;  1MH4 A;  1APL C;  3OIO A;  2O9L A;  1GDT A;  3A01 A;  2QCO A;  2ME0 A;  2JA6 J;  4HNV A;  2CQX A;  4A3K J;  2Y30 A;  3BQZ A;  4V2F A;  3RKQ A;  2K40 A;  1QVT A;  3S1M J;  1WGX A;  3M3Y J;  3SDG A;  1OJL A;  4M6V A;  1TWA J;  5K7H A;  5HOD A;  2E19 A;  2PMZ N;  3LSP A;  1RKW A;  3M4O J;  1FTZ A;  4DYC A;  2L0K A;  2HYJ A;  2I10 A;  1JUM A;  2MG4 A;  2X48 A;  1X2N A;  2ZB9 A;  5BNG A;  3ZQI A;  1DU6 A;  2H1K A;  4M3E A;  4QIW N;  2R5Y A;  2DA1 A;  3FIS A;  4A3E J;  1Z77 A;  3GTP J;  2XPW A;  2M9H A;  4BXX J;  1A5J A;  1ZGW A;  3PO2 J;  2NVT J;  2M0C A;  1F36 A;  5F08 A;  3SFI A;  5K7Z A;  3H0G J;  2Y31 A;  1HF0 A;  2IEK A;  4MFE A;  5K7F A;  1UG2 A;  1AKH B;  2DMP A;  1BJZ A;  3PO3 J;  4M3D A;  5EZH A;  4DZP A;  3PM1 A;  3TW7 A;  3GTO J;  3OSG A;  5FKO A;  3GTG J;  3JRH A;  3S15 J;  1ORK A;  1JKQ C;  2M2E A;  1IDY A;  4FE4 A;  1ETQ A;  3JR9 A;  2HDD A;  3VPR A;  2ID6 A;  3HB9 A;  1K83 J;  4ABZ A;  4C3J J;  2YU9 J;  2VI6 A;  5C44 J;  3S2H J;  2LP0 A;  2R5Z B;  4M3B A;  3BQY A;  4BBS J;  1Q1V A;  3HDD A;  2AO9 A;  2G0E A;  4BY7 J;  5FKK A;  5GP9 A;  5EGO B;  2XGE A;  1Z0X A;  1ETV A;  3LNQ A;  1BL0 A;  3OOU A;  4MIM A;  4D5C A;  3HOW J;  4CYC B;  3WHB A;  1ETY A;  5F0F A;  5F0C A;  2LTP A;  1MSE C;  3HGY A;  1A6I A;  2M8G X;  2TCT A;  3BR1 A;  2E2J J;  1OFC X;  1H89 C;  2DA5 A;  3JRE A;  4IHW A;  1B8I B;  1WH5 A;  4L5E A;  1FTT A;  3ZOB A;  4C3H J;  1U8B A;  2WAQ N;  1IDZ A;  2Y9Y A;  4AUX A;  4JYK A;  2GM4 A;  2WV1 A;  1W0T A;  1B72 A;  4I6Z A;  2VKE A;  2FD5 A;  1CQT A;  1HCR A;  3S14 J;  2EZK A;  2L9R A;  2X6O A;  1JJ6 C;  1MBE A;  2XGD A;  2WB1 N;  5FKL A;  1H8A C;  4G12 A;  1SFO J;  5E3N A;  2XPU A;  5C4X J;  1NTC A;  5IYB J;  3H3V K;  1RR7 A;  5EG0 A;  3HKZ N;  1IV6 A;  4B3A A;  3D1N I;  1FIA A;  2HXI A;  5DTD A;  4DZJ A;  5IPA A;  2EZI A;  1LE8 B;  5F27 A;  2JN6 A;  3RZO J;  1ETX A;  1XC5 A;  3RZD J;  1JKR C;  2LLK A;  1QVU A;  3GTJ J;  1QPI A;  5J3L A;  1POG A;  2OPT A;  5C3E J;  2CUE A;  3A03 A;  3TP3 A;  1MH3 A;  4B4C A;  5J1Y A;  1Y1W J;  4EEF G;  2QF7 A;  1VF9 A;  3G1L A;  1VFC A;  3ZQL A;  1E3O C;  5GPC A;  1S7E A;  2HQ5 A;  4V2G A;  2E2H J;  2DA6 A;  3BR3 A;  1JGG A;  3HGG A;  2MGQ A;  1TC3 C;  1YRN B;  1TWC J;  2Y9Z A;  1HOM A;  4A3I J;  3ZQH A;  1MNM C;  2FX0 A;  2DA3 A;  3NAR A;  3I4N J;  5M3M J;  2EZH A;  2VPR A;  1TWH J;  2DTZ A;  2N8G A;  1XG1 A;  4JP0 A;  3CMY A;  2CRG A;  2YUS A;  2K9S A;  1HDD C;  3Q3S A;  1GT0 C;  2NS7 A;  5FLV A;  1IRZ A;  4XRS G;  4D7M A;  1WH7 A;  4XID A;  4A3C J;  2YS9 A;  1IGN A;  2HOS A;  2IAI A;  3GTQ J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...