2L7FP

Solution structure of the pitx2 homeodomain
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
68
structure length
68
Chain Sequence
GSQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKREEFIVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the Pitx2 Homeodomain
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Pituitary homeobox 2
total genus 20
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2010-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2l7fP00
1A5JA 4HNVA 2CUEA 5C3EJ 3L1PA 1T56A 3OSFA 3PO2J 1NK3P 3HM5A 2CRGA 2M8GX 2OF7A 2DA4A 1FTZA 4V2GA 1AHDP 5DS9A 5FKMA 3JRAA 1HDPA 2X48A 3RZDJ 1U8BA 1JUMA 2X6OA 2DTZA 1NK2P 1Y1WJ 3Q0VA 2ECCA 4ABZA 2L9RA 2LY9A 3IH3A 1X2NA 3HGYA 2JA8J 3H3VK 4DYQA 4C2MJ 2P81A 4CYCA 2NVXJ 2HXIA 5J3LA 2XGCA 2R5YA 1FTTA 1AKHB 2L7MP 4FE4A 1RETA 3GTKJ 3HKZN 3QPLA 4D7MA 4QIWN 1ZR4A 3M3YJ 3FKIJ 1GVDA 1FIAA 1ENHA 2LFBA 4MIMA 3SJMA 3GTGJ 2JA5J 3GTPJ 3ZQHA 1MBGA 1I50J 1ORKA 1WH7A 5GPAA 4D5CA 2XPUA 5EGOB 1LFBA 4QTRA 2CQQA 2R5YB 4MO7A 3Q0WA 3OIOA 5IYDJ 1OFCX 1JKQC 2R7ZJ 3BR1A 3OSGA 2K9SA 1ZQ3P 3W6VA 1LE8B 3RQIA 2R5ZB 5F04A 4XICA 2YS9A 1X2MA 2JMWA 2VUMJ 1DU6A 5FJ8J 3A02A 4A3FJ 2HXOA 4BBRJ 1JKRC 1RR7A 1MNMC 2H8RA 3BR6A 1IC8A 3BT9A 3JRDA 2JA7J 1UHSA 2K40A 2XB0X 1BJZA 2JWTA 3NAUA 5EYRA 2GBYA 2H1KA 2DMQA 4UUTA 5FKLA 1JT6A 5EEAA 3QPSA 1FJLA 1QPIA 3GTJJ 3BQYA 2WAQN 4LOCA 1W0UA 2X9DA 3QQAA 2EZKA 5EG0B 1P7JA 2CQXA 5EDNA 1TWGJ 4IHVA 1E3OC 1IV6A 1AU7A 4QSHA 1MBEA 5E3MA 1HDDC 2ME0A 3IV5A 2XSDC 2LTPA 4BKXA 2M2EA 1DU0A 1IDYA 3Q3SA 1RKWA 3NARA 1WPKA 4B3AA 5M3FJ 1SANA 3LSPA 5J1YA 2ECBA 3HOXJ 1HLVA 2Y9ZA 3G1LA 3HOUJ 2G0EA 4BBSJ 3WHBA 3MN2A 2RAEA 4M3BA 2R92J 4B1RA 5F08A 1TWCJ 5JLXA 1GUUA 3CMYA 4A69C 5FKNA 2HOSA 5FLMJ 4BY7J 2L7ZA 5EZGA 3HBLA 2Y31A 2OPTA 4BXXJ 2VKEA 4B4CA 3BG9A 2DA6A 4I6ZA 2ZB9A 3BTLA 3LSGA 5BNGA 4XK4A 1TWAJ 3JRCA 2HI3A 3JRIA 4MLOA 3IH4A 5K7ZA 4A93J 3ZQLA 3K2AA 4FISA 3JRGA 1U9NA 3A03A 3D1NI 2E2IJ 4AUXA 2XGEA 1IUFA 5K7HA 5E3NA 2HDDA 1LE8A 1K61A 2Y2ZA 2IBDA 3JR9A 1JJ8C 1HOMA 1OCPA 1I6HJ 1PUFA 1U78A 5K7FA 3H0GJ 4G12A 4M3EA 1XC5A 4JX4A 3Q0UA 3TEDA 1FIPA 1ETOA 5EG0A 1JKPC 2YU9J 1VFCA 1MBFA 5IYCJ 3DCFA 3JRHA 2IEKA 2AHQA 4MFEA 2I10A 1JGGA 2DMTA 1B8IB 1YRNB 3HGGA 2LKXA 3I4MJ 2LLKA 3ZOBA 4AC0A 1G2HA 3S17J 1JKOC 1ETKA 2LP0A 2ID3A 2XPWA 5E3OA 4J19A 4X1EA 4FTHA 1W0TA 2HOTA 2M0CA 1T33A 3WHCA 1HCRA 3F0CA 5EGOA 3CQZJ 5IOZA 4IHWA 2MW8A 4DW6A 3BR0A 4D7NA 2DMPA 1OJLA 1ZTRA 3BTIA 1LFUP 1I3QJ 2PMZN 9ANTA 5C4JJ 5M5WJ 3S1MJ 2LK2A 1WI3A 4A3IJ 2L0KA 1POGA 2K9QA 1CQTA 1MSEC 2O7OA 4NDLA 3S1QJ 1ITYA 5F0CA 1ZGWA 4V2FA 2KDZA 1S7EA 5GPCA 5JLWA 1GV2A 3HOWJ 1JUSA 1XG1A 1ETXA 3LNQA 1JT0A 3E7LA 1ETWA 1UMQA 5C4XJ 1RKTA 3HOVJ 4C3JJ 3A01A 3GTLJ 3LSJA 5IP6A 4RDUA 1MBKA 4M3GA 1OCTC 4M3DA 2GM4A 3S16J 4A3BJ 1RPWA 5IP9J 1R9TJ 3FK7A 4CYCB 2D5VA 2W48A 3VPRA 4XRSG 2VKVA 4Y52J 1UG2A 2ME6A 2ELKA 2Y30A 3S2DJ 3BQZA 1X58A 1BL0A 3DEWA 1ETYA 4A3CJ 3M4OJ 5GP9A 3SDGA 3ZQCA 2LR8A 1MBJA 3RKQA 3S2HJ 4L5EA 2EQRA 1O4XA 1MH3A 1H88C 1B72B 2CUFA 1BA5A 1JJ6C 3CCYA 3BR2A 5F0HA 2M9HA 2EBIA 2ID6A 2K9NA 1GV5A 1Z77A 1HF0A 5IYBJ 4BY1J 3LSRA 4RBOA 1FEXA 2FJ1A 3S15J 2HQ5A 4JYKA 5HODA 1WGXA 2DJNA 4W1UA 4XRSA 2L7FP 3PO3J 3I4NJ 4A3EJ 1APLC 2R5ZA 3B6CA 3FK6A 1QVTA 1B72A 3TP3A 4DYRA 1Y1VJ 2DA5A 2XPVA 3OOUA 5DTDA 1PUFB 1JTXA 4C3HJ 3JREA 3GTMJ 3BG3A 3BTJA 2LVSA 4M6VA 2CJJA 5IP7J 3HDDA 3ZQIA 2TRTA 3BTCA 4D5FA 4DYCA 2JA6J 1NTCA 5IPAA 4GFBA 1EF4A 2R0QC 3TW7A 2LD5A 1MH4A 2NVQJ 3O8GA 3BR5A 3BR3A 4IHXA 2AO9A 1ZK8A 2NVYJ 4DZPA 2QCOA 2TCTA 3GTOJ 3IH2A 1H89C 3TW6A 4A3MJ 3G1MA 1H8AC 2E19A 3GTQJ 2E1OA 2O9LA 3BG5A 4A3KJ 1ZR2A 4DZJA 2Y0SN 3FISA 2CU7A 4JX5A 2FQ4A 1P7IA 2M34A 3A01B 1QVUA 3CDLA 2DA3A 2MG4A 5F27A 4XRMA 1GT0C 3O8HA 4UUSA 1RESA 4S0HB 4A3GJ 2O8KA 2HYJA 1F36A 1IGNA 3HOYJ 4I76A 4JX6A 3RZOJ 2N8GA 5J1UA 2NVTJ 5FKOA 2R93J 1JTYA 3S14J 3ZQFA 2DA1A 1QRYA 1ETQA 1ETVA 3S1NJ 5IOYA 4AYBN 3SFIA 4M3FA 4FCYA 2DMUA 2XGDA 2NOGA 3K7AJ 2VPRA 4A3JJ 1VNDA 1MBHA 2JN6A 2KT0A 5EZHA 1D5YA 3ZQGA 2MSYA 2EZIA 1VF9A 1VI0A 3GBGA 2Y9YA 1MSFC 3JRFA 2NS8A 5FLVA 2NS7A 2DA7A 2DN0A 2E2HJ 4JP0A 3MVPA 1WCMJ 2FD5A 4A3LJ 2EH3A 1B8IA 1YRNA 2FX0A 3G1OA 5M5XJ 1TWHJ 5M3MJ 3HB9A 3HEFA 5E3LA 4C3IJ 1JUPA 3UKGA 2MGQA 3FIWA 1IJWC 1K83J 2DMNA 2B63J 3HOZJ 4FE7A 2WV1A 3MKLA 4IHYA 2VI6A 3PM1A 2JK3A 1U9OA 4MFDA 5F1JA 1XS9A 5F0FA 5EF6A 1AKHA 5FKKA 1SFOJ 2DA2A 4UUSB 2GLOA 1WH5A 1A6IA 4EEFG 2YUSA 3TP0A 1IG7A 1IRZA 2E2JJ 2XRLA 2EZHA 4W97A 3LOCA 5J1RA 5M5YJ 2QF7A 1BW6A 1Z0XA 2XB5A 3C2BA 2IAIA 1TWFJ 1ZKGA 2EZLA 2WB1N 1IDZA 2COBA 3B6AA 4XIDA 4Y7NJ 3S1RJ 4X6AJ 4A3DJ 1TC3C 1F43A 3JRBA 1Q1VA 4IEJA 1BW5A 5C44J 2JJ7A 1GDTA 2HOAA
chains in the Genus database with same CATH superfamily
2I5UA 1PJRA 3LA7A 2CUEA 3G71I 5BOXA 3EYIA 3CESA 3CUQC 4XKCA 4A0XA 2E71A 3S3OA 1JXSA 1X4PA 4ZH4F 2OD5A 3BG7A 3M1CA 4QPQA 1WJCA 1U2WA 2HZTA 1NG7A 3GX4X 3I9V2 4V2GA 4G7OF 5DS9A 5E17F 2F4MB 1EJ9A 1J5YA 5B66C 4JQFA 5CYVA 3ZMSA 2DTZA 3N97A 1IO2A 4MTDA 3CLOA 5FD6A 2E60A 1Z6RA 2LY9A 1G4DA 2X4HA 3K6GA 2R7UA 1X2NA 3A1YA 3HGYA 1I6XA 3CUQB 3WTYC 4C2MJ 3QWLA 4CYCA 4XONA 2QYOA 5LHIA 2R5YA 3L09A 1VQ7I 2L7MP 2DQRA 4FE4A 3GTKJ 1T6SA 4RB1A 1SVLA 3QPLA 4D7MA 2FNPA 3K4NA 3W3CA 4QIWN 3TDUC 3FKIJ 3ZRGA 2P6TA 1RI7A 2FOWA 2FXAA 4KICA 4BH9A 4RGSA 3MKZA 3WTZA 3GTPJ 3ABLH 1WWXA 2ZNYA 3GW2A 2D1HA 2H27A 1ERDA 3EETA 4XMYA 3WTVC 4HX8A 5GPAA 2QZ8A 4D5CA 2XPUA 1LFBA 1KQ0A 5ICGA 1S6LA 4QTRA 2M0MA 4GRIA 4MO7A 2KRHA 3Q0WA 3RKXA 3OIOA 5L3BA 5FRMA 3V7SA 3OYHA 3E0JB 4IL6C 3GF2A 4N9HA 5B3SH 2KZGA 2Q2EA 1OCOH 5DUIA 1OYWA 2LKSA 1I1SA 3WTUC 3LSHA 3WTSC 4I02A 2IVMA 3V42A 2RNJA 1MD0A 4NUBA 3E1SA 2GZWA 1FYKA 4BQOA 2KRFA 4S04A 2CG4A 1WJAA 2QQBA 2JT1A 2E35A 1JE8A 4CXFA 1KU2A 4FX0A 2XAQA 3KZIC 3QPHA 2L02A 1BR4A 1XMXA 2Y48A 4P96A 2JPBA 4BQAA 1BJZA 2JWTA 3NAUA 2GBYA 2V26A 1S9HA 2HYFA 5D8LB 2CGPA 3H3ZA 4R8HA 4KITB 2ZKZA 3QPSA 3J81Z 3AG1H 4O5VA 2DT7B 2WAQN 3M07A 2CQ7A 2FA5A 4L0ZB 1STZA 3IWZA 3CUQA 3ECHA 3QQAA 4PSWA 4FT8A 1P7JA 1H9GA 4D0PA 2E1CA 4RMNA 4F7ZA 2JA2A 3OIQA 1E3OC 1IV6A 3CCQI 4LGWA 1XD7A 4QSHA 5HLGA 1MBEA 1MMGA 2Z2SB 5E3MA 2X1DA 2R7TA 3ZQQA 1RR8C 1O7FA 2ME0A 3DKYA 3FXJA 3H5AA 3R0JA 2LTPA 1B9NA 2XSDC 3DBHB 3HG9A 4UB6C 1PDNC 1LFPA 1DGRM 1KQ8A 3JSPA 1ON1A 1YE9A 3TQNA 5DM7F 4YG2F 5J1YA 3HOXJ 1HLVA 1K6OA 1BR1A 1QZYA 1V4RA 2E34A 1Z3YA 1XX5A 5LHHA 2G0EA 2CW8A 1DP7P 4KNYA 1SFUA 4LLLA 2ISZA 1IN5A 2W82A 1TWCJ 1WI9A 1G6NA 2MABA 5JLXA 1GUUA 3F8BA 2P6SA 3SHFA 5FLMJ 2XDVA 4HDVA 4E7ZA 3QP5A 2VXZA 3GLLA 3HKZA 2XAHA 2R7FA 4CYDA 5E20A 3HPGA 3BG9A 2XAGA 3FMRA 3V7CA 4ASNA 2HI3A 1N77A 4MLOA 3BJAA 3IH4A 4BE2A 2CQKA 2DO7A 4AVPA 4XKVA 2A05A 4I09A 4Y33A 4XLFA 3ZQLA 1YJ9I 4HX4A 3HSEA 1ZGAA 1VQLI 2DK5A 1IUFA 4IKFA 2NOJB 4RS8A 3KEOA 3WG9A 3IP4B 3F23A 1K61A 1REPC 3G4SI 4E7SA 3LMMA 1LVAA 3PNTA 1PUFA 5CVJA 4G12A 4M3EA 4RLFA 3F8MA 4HW0A 3CLQA 2IP2A 5FFXA 4LLNA 3DTKA 1MBFA 1WVRA 2M8EA 3MWMA 5GADJ 2IEKA 4MFEA 3H5NA 2I10A 4A6DA 2BXZA 4HF1A 2LKXA 2COMA 2LLKA 3CP8A 5E18F 4N0BA 3EQLF 3ZQ7A 4NQWA 1XCBA 2E5NA 3S17J 2H6BA 1JKOC 2XPWA 2C6YA 4FTHA 1J2XA 1GXQA 3QOEA 5BPDA 4AM3A 1Z7UA 2DT5A 2ZJ2A 3WU2C 4Y4RA 1KU9A 1T39A 5IOZA 2MW8A 4HG2A 1I3AA 4DW6A 2EJRA 1T0FC 2AQFA 3HPHA 3CCJI 1L3LA 4OWRB 1LFUP 4MEYF 1EH7A 2KPMA 4EM0B 5M5WJ 2DFHA 3S1MJ 3KP6A 3FXQA 2L0KA 3J81K 2QLZA 4BE0A 1XGOA 2JSPA 3LA3A 1XGSA 2L4MA 4LD5A 1MSEC 3A0HC 3S1QJ 3LWFA 4MQ9F 5F0CA 4V2FA 1HKSA 1GV2A 2HTSA 4GYIA 3OYCA 5E1WA 5D4RA 1XG1A 3K4JA 4Q48A 2PG4A 4NNJA 5FO5A 2Y0SA 4N9IA 4C2TA 4JBAA 1UB9A 2HDWA 4PDKA 4PFOA 2HFHA 1E0EA 1MBKA 5E8GA 1ZLKA 2QM3A 2Z16A 3GFLA 4F91B 5HOOA 2ZJQF 4HEA2 1X3WB 4IVNA 2LRDA 3KYLA 4Y52J 1S3JA 2DI3A 1QPMA 2Y30A 2VQHA 2K3PA 1SD7A 1BL0A 4GO1A 4XKBA 1IN8A 3AKZA 1FC3A 4XNFA 1XDUA 3DKXA 2YX4A 5JHUA 3TKYA 1SD6A 3KLNA 2W25A 1R23A 1P4WA 4A0YA 3M9AA 1H88C 5DEQA 2OTJI 2DQLA 2YX7A 2CQNA 2IGOA 4G9YA 4WXHA 3OYAA 3CCYA 5ERIA 3JSOA 1D1BA 4M6XA 3L2RA 2ID6A 1KYZA 2K9NA 1Z77A 5IYBJ 4BY1J 1Z05A 3CDHA 2FJ1A 3I56I 2HTJA 3E6DA 5HODA 1WGXA 2DJNA 3H3UA 4XRSA 4DGWB 3MEXA 1RUOA 1P92A 1APLC 1F5TA 3V4GA 4PGGA 4XM3A 2W57A 1HBXG 4XSXF 4C30A 3CZ6A 3OL3A 3SEZA 4EGYA 3ZQIA 2TRTA 3KPHA 2JA6J 5LBQA 1TNTA 4BACA 1RZ4A 3BJ6A 4RLQA 2L7KA 1MMAA 2PN6A 2B7EA 2NXNB 3LQQA 1ZK8A 2Z9OA 1FOYA 1XB4A 5ILVA 4EQQA 2IGNA 1U6GA 5FLXK 4MGRA 4A3MJ 3G1MA 3GTQJ 1I1GA 3VWBA 3H5RA 3GZNB 3FHNA 4XQFA 4A3KJ 4CUGA 3PIOF 2FF4A 4DZJA 1ZR2A 1FOKA 3DEEA 3FISA 2CU7A 5DV5A 1SAUA 2XRNA 2QEXI 2Q0OA 3VDXA 3HIFA 4BEHB 3E5XA 3K1NA 1S72I 4XRMA 1V5EA 1K79A 3N4MA 1KU7A 1ACIA 4A3GJ 2GIVA 2KHMA 1EKEA 2NVTJ 4EJOA 1FSEA 3KEQA 1TBXA 2CV0A 2DOFA 2O8XA 4FX4A 5JVGF 4BXFA 2DA1A 1ETVA 2E1MC 4AYBN 1OR7C 1J09A 3SZGA 4FCYA 2A6EF 3QODA 2RC4A 4HSTA 4UB8C 1P2FA 2X1CA 5AONA 3OY9A 2JQ7A 1YW8A 2STWA 1SFEA 4LG0B 1WFXA 2EIJH 1UHMA 2AQEA 2K85A 2CWEA 3PSIA 2ICWG 1VF9A 2UXNA 2Y9YA 1ON2A 3OR1C 1IXSB 5K5RA 1XN7A 3BJOA 1D8JA 2NS7A 3D5SC 3NEUA 2DN0A 2OU2A 2VBWA 4BYYA 5FB2A 3LSMA 5JI6A 2FMYA 3R61A 1LDJA 1YRNA 2FX0A 2FU4A 1BOAA 2V1DA 2JZYA 1TWHJ 3IRRA 4NQWB 5M3MJ 3LL7A 2XSJC 3HB9A 3LFUA 1HA8A 2Z3YA 2A6HF 3FIWA 2R7DA 1X3ZB 3CUOA 2DMNA 4DJAA 3CJNA 4LB6B 1U8RA 2WV1A 4DBRA 2DPDA 4MFDA 2QSGX 1X1AA 1XS9A 3CCVI 2BGCA 5F0FA 1IN4A 5FKKA 4CHUA 3DFGA 1HW2A 1SFOJ 2V7FA 1D5VA 5FLXZ 3IKTA 1WH5A 1IG7A 2EZHA 3CJTB 2XV4S 4W97A 4Y15A 4YEJA 4MQVA 5J1RA 2CUZA 1BW6A 3J80K 2F5EA 3T8RA 4XORA 2WB1N 5F6FA 5LEJA 3B6AA 5LGTA 4LB5A 3K70C 4IX7A 3FHZA 2TDXA 2W1OA 4X6AJ 4LLGF 1LB2A 2WAEA 4BHPA 4BNCA 3JRBA 1FP2A 2IT0A 1VQ6I 5D5XB 5HLTA 2JUGA 3SDBA 3X2QH 3OYLA 5CQGA 2JJ7A 2RGVA 1GDTA 3V8LA 3T0YA 1A5JA 1AOYA 4IZZA 2ZXJA 3EPZA 3L1PA 2Q1ZB 1C0WA 3OMYA 1U5TC 1PP8F 1ZLJA 3BCAA 3EUKL 3PO2J 3M8JA 1NK3P 5CKTA 3S2WA 2E1MB 5LRSA 4KFCA 4L9TA 1BJAA 3GFMA 2KQRA 5L3GA 5J4YA 1T8IA 2QSHX 4B47A 2VLAA 5FRNA 4Z2YA 4XL9A 1AHDP 4NHJA 1HDPA 3V7RA 1QHGA 2IGKA 2X48A 3K4BA 1JUMA 2X6OA 4U0VA 1NK2P 3DU6A 3PSFA 2ECCA 1J7KA 4GGGA 5H6RA 4AIHA 2L01A 3VFZA 2ZCWA 1IUYA 3DLAA 2HXIA 3EDPA 2VASA 5B1BH 2XGCA 5J3LA 1FTTA 2JUCA 4BAYA 3HJEA 1XTAA 2RVCA 1IXRC 3L2CA 1GVJA 3QYFA 1ZR4A 1MIJA 1BOBA 4II2A 1TQMA 4NC6A 3FMSA 2EFOA 1YYVA 5GAHJ 1IF1A 1IZ1A 4QLCU 5LHGA 3SJMA 1FIAA 2IS1A 5B5EC 2LY1A 4XLEA 1PYVA 4IO9F 2CH0A 4F92B 4Y13A 3KZYA 3AFHA 3DTEA 4CSWA 4PCQA 3TDZC 2VIXA 1WRJA 2CQQA 3BDDA 2R5YB 3I0TA 5IYDJ 2NVUB 4D1QA 1JKQC 1VQ8I 1LKXA 3K4KA 2EPFA 4EMSA 2K9SA 1UFMA 4BJ6C 1YFHA 1ZQ3P 1BI3A 2EFNA 2R5ZB 4G8XA 4XICA 2XAFA 2K7LA 3G6EI 2VONA 3DPUA 1X2MA 2JMWA 1XPXA 1DU6A 5FJ8J 3Q5FA 1JKRC 1E3HA 2XC7A 2F5CA 1NG6A 2K02A 2LNBA 1MNMC 2H8RA 2OZUA 3BZKA 3EYYA 4ESFA 3JRDA 1R5HA 3MZHA 2MLKA 1LPQA 2H1KA 1EH8A 1T98A 4OAYA 2DU9A 4ZDPA 1D0ZA 1A36A 1R7JA 1JT6A 1YHQI 2QKMB 3D0SA 3RYRA 5EEAA 3ZMDA 1FJLA 2ETHA 4IQ4A 1QPIA 2M5WA 3U1KA 4ZYDA 1S5LC 2X9DA 4PFPA 3ZMTA 2EZKA 5EG0B 1IN7A 2KZVA 5EDNA 3VYRB 2NS0A 1AU7A 3KYDB 2LOOA 2ZXHA 3QYEA 3DLLF 3I53A 1FY7A 1OISA 2M2EA 3U9GA 1RKWA 2RQPA 3HYIA 4NBQA 2X1EA 4B3AA 2DYSH 4NC7A 2PJRB 2R7RA 3LSPA 4CDGA 3D5RC 3HRUA 3F8FA 1W1WE 3ABTA 1B9MA 4V19K 3WHBA 1PVEA 2R92J 4B1RA 2L9VA 2V1NA 2RREA 5J4VA 3VYSB 1CGPA 5CVIA 2IW5A 5KCMA 2HOSA 4BXUA 2ZJPF 1X3UA 2M45A 2Y31A 4WX9A 2IRFG 1DUXC 1YW7A 4U0YA 4HSRA 4IOAF 3HXLA 3IUOA 3BTLA 1MMDA 2IS6A 3JRCA 3JRIA 4J01A 1LEBA 2ZFUA 3OR2C 2BOLA 1FYLA 2DT6A 3K2AA 2EIMH 3ML6A 4G6DA 1VQ5I 3A03A 3C2HA 2XGEA 1XCVA 5E3NA 1LE8A 3K1PA 2MA3A 2EA4A 5JR3A 2Y2ZA 1Z3XA 3FXOA 1WJBA 2KIMA 6PAXA 3UR3C 4XLPF 1U78A 4DBQA 3TO6A 3K70D 1FIPA 3FXKA 1JKPC 5EG0A 2L9NA 4RAFA 2YU9J 3ZMUA 1F9NA 5IYCJ 4XOPA 2VKDA 2OC6A 2GWRA 1T95A 3ZCOA 1K4TA 1G3TA 4CZCA 3DTIA 1R49A 1YRNB 3OYBA 3GXOA 2KJCA 4E6KG 3C3WA 4YRVA 3SQNA 5HLHA 5E3OA 2LP0A 4X1EA 1IAWA 2FRHA 3KEYA 4B48A 4IHSA 2GXAA 4HLXA 1T33A 3WTTC 1QGPA 2UUZA 3HRMA 4CCLA 4BDYA 3CQZJ 5L3EA 5ED4A 3P5JA 3DEUA 2HR3A 5DUKA 2ZFWA 1ZTRA 1LVKA 3BTIA 4Q5SF 1B4AA 2PMZN 1FMVA 4M71A 1G59A 4L0YB 4PSXA 5KAIC 3RCOA 4P9FA 4F52A 2K9QA 2OQRA 1GHCA 1MKMA 2OAZA 3OV8A 4NDLA 2VBZA 1ZGWA 2JVGA 2Y75A 5JLWA 1JUSA 2HVRA 1LEAA 1G3YA 4G6TB 1WSUA 5HDKA 2MBFA 4XBFA 3JAMZ 1P4AA 4M9XA 1UMQA 2DAOA 1V5FA 1RKTA 2O03A 3GTLJ 2WA0A 2WC2A 1XSDA 4M3GA 2VJ5A 1XSXA 3ZP5A 2GM4A 2VOPA 1TP4A 5JHFA 3JTGA 1MMSA 3WG7H 2DLLA 4HF0A 5LGNA 3RTRA 1GLNA 1UG2A 2ME6A 2ELKA 4XN0A 2LY2A 2W7NA 3S2DJ 3DEWA 4BS9A 1BR2A 3O6BB 1YOVB 4CCJA 3MKYB 2G7UA 4OAZA 1IRXA 2K4BA 3REOA 3VEPA 2LR8A 3TMOA 2IGMA 4OOIA 3LSKA 4BL0B 1O4XA 2GOMA 4XRFA 3I4PA 1B72B 1E3PA 1BA5A 3D5LA 3T1BA 5CJ9A 5F0HA 1LDDA 3V8JA 2M9HA 4OIRF 1P6RA 2P8TA 4ZDLA 3BPVA 5HLIA 4DQ2A 1HF0A 4RBOA 1FEXA 5A2QK 2HQ5A 3KX2A 1U0JA 3ROUA 3HL2A 2XIGA 4EM1A 4W1UA 4ZZLA 2X85A 2L7FP 2BY0A 3PO3J 2YU3A 5KHDA 1Y8RB 2R5ZA 2BVLA 2ZNZA 2XASA 4ZJZA 3B6CA 4CCNA 1Z6TA 3M8FA 3TP3A 4DYRA 2VN2A 1X1DA 1Y1VJ 1G3WA 2DA5A 3OOUA 4C3HJ 2HNHA 2XF5A 5L3DA 2LBFA 4YFKF 3KFWX 2X6YA 2NYXA 2G9WA 3L2VA 5IP7J 5H2FC 2Y69H 3BTCA 4CICA 4D5FA 5A2QZ 1NTCA 2YR2A 2IA2A 1HXDA 2QQAA 4RAYA 1MH4A 3O8GA 3I3LA 4KDPA 3E6BA 4IHXA 2XKPA 2M87A 2L2OA 3I64A 2NVYJ 4UNOA 3RPUD 2F4OB 2QCOA 4AVZA 3IH2A 2EFPA 1USSA 3R4KA 2CV2A 2E19A 4MHGA 4HLYA 2DFFA 2FQ3A 4CGZA 3KP7A 3SXYA 1B59A 2JRTA 4OMZA 3P9CA 1ZG5A 2AXLA 3FXLA 3BY6A 3W2WA 1W7PD 2EB7A 2H09A 2FQ4A 2OCCH 3LQRA 2M34A 3A01B 4PJLA 1QVUA 3CDLA 1BIBA 1LNWA 2DA3A 2MG4A 2VQCA 1QQIA 4S0HB 4GYGA 2IS2A 5AIPA 3U21A 1F36A 1MDMB 1BM9A 1IGNA 3RZOJ 5FKOA 2R93J 4EJWA 5J47A 2XGXA 1FWZA 3ZQFA 4MNUA 1AA7A 4EATA 5GAEJ 4UUVA 1QRYA 3A4CA 1FPQA 3HOSA 1ETQA 4YFNF 1K4SA 4FHTA 2A5WA 3M7GA 2DW4A 4NC8A 1WJ5A 2ZXWH 1D0XA 4F3QA 4UV8A 2E7WA 3J7AY 1V55H 5LEKA 1X19A 2NOGA 2LYCA 3K7AJ 1H9TA 3F22A 4RAZA 4AYBA 4CCOA 1D5YA 1W5CC 4HV5A 3E6MA 1YIJI 1U3EM 4RB3C 2KMUA 2OUMA 3JRFA 5F1RA 1QZZA 5FLVA 1N78A 5CVUA 4ZYGA 3CMAI 1WCMJ 2FD5A 4X0GA 1B8IA 3R6SA 3S3MA 5M5XJ 1S7AA 4CZZA 4KN4X 5DM6F 2VODA 1V54H 3HEFA 5E3LA 4C3IJ 3KP2A 1JUPA 3UKGA 3C2GA 1OPCA 3B73A 2Y0MA 2R7QA 1I27A 4E70A 1K83J 3WODF 1SC7A 4OMYA 2VQGA 3H92A 2JK3A 3BZCA 1KGSA 5F1JA 3MQ0A 1D8KA 3BP8A 4YIIA 2HU9A 3AAFA 4LIVA 5BQTA 2HGCA 2DA2A 2QQ8A 3N05A 4PK4A 2O6GE 4M72A 2VE8A 4EEFG 2YUSA 2OA4A 1WHUA 3W2AA 4WK8F 1A6QA 3DKWA 1IRZA 2GQQA 3DQVC 2RKHA 5CVRA 1W36C 1BC7C 2DBBA 3ELKA 1SMTA 5M5YJ 1O3QA 1T2KA 4OIQF 2FMLA 1Z0XA 1V5GA 3C2BA 1TWFJ 2D1VA 2VB6A 3ESWB 1R22A 3MZYA 2P5LC 3HSFA 4RM2A 1R4NB 2L5QA 1Z91A 1HSTA 4L9JA 3ZPLA 2MC3A 1Q1VA 4IEJA 1BW5A 2ZJRF 4KIGA 2HOAA 5C3EJ 1UAAA 3TGNA 4PUSA 2P5KA 3ERED 3G2BA 3P9IA 3P7NA 4L5JA 5D5VB 2BW3A 2L9SA 3K0LA 3OSFA 3OL4A 1YITI 2FE3A 4IRGA 5KNLA 3HM5A 2HKOA 2KDOA 2M8GX 2OF7A 2VKHA 2HVSA 2F48A 2DA4A 3PL8A 4M9SA 2CMPA 1FTZA 1YW9A 3TOBA 3OYMA 1SD4A 2H94A 2L4AA 2P5VA 1FBSA 2RQQA 5FKMA 4RB2C 3T5XA 1OYIA 1MNDA 2EV0A 2XAJA 5KVRA 2VT2A 4ENKA 4L9VA 1W36D 3Q0VA 2L9RA 3BLYA 4RGRA 5ICEA 1B6AA 3IH3A 3H3VK 1SEUA 4DYQA 5CVVA 2V6CA 3HUGA 2LREA 2ZO4A 2F5VA 2DTRA 2HQAA 4UVAA 3L2WA 2PMZA 2MH9A 3I54A 4E4HA 3O2PE 2D2WA 5GAGJ 1K78B 3KLOA 3VYUB 1WQ2A 1LDKB 3PUFA 4M74A 3M3YJ 1QO0D 4HX7A 2Z1DA 3H9QA 2KLOA 3VSKA 3GTGJ 1FYMA 2BBYA 3WGGA 2GA2A 2JA5J 2VOOA 4BJ5C 3KETA 1R71A 3BC8A 1MBGA 1HQCA 1HKQA 3HZJA 1ORKA 1BBYA 2LH9A 1BN5A 2M7AA 3E3VA 4C2UA 4CA0A 1XGNA 1OFCX 5TGTA 3BR1A 1BC8C 2F5FA 5H6QA 3W6VA 3KIOA 4ZDOA 3ZR8X 3KE2A 1TQIA 3RQIA 3PNVA 4LJZF 4G7HF 4M6YA 4HPQA 1MJAA 2YS9A 3FZVA 5BMZA 5J8FA 4E7LA 3A02A 4A3FJ 2HXOA 3R0AA 1ZG1A 1RR7A 2ADUA 3BOQA 2E7XA 3BR6A 1NHAA 1IC8A 1OKRA 4RGXA 2W4SA 2JA7J 1UHSA 2HZDA 2RV8A 1EH6A 1O3SA 1U5TB 4ON0A 2CFXA 4LIUA 2LG4A 3RPUA 3GTJJ 4OIOF 4Z6YA 2LKPA 3FBIB 3CC7I 4LOCA 2BEOA 3CO7C 4ZTFA 4BU2A 1HKTA 3GWZA 3TL4X 4HNTA 3HRTA 3L2QA 3NWTA 5IT9Z 1TWGJ 4AIJA 3K4MA 1R4MB 2LF8A 1HDDC 3WTWC 5ICCA 2W00A 3LA2A 2ELHA 4EV0A 4P55A 2DOEA 1Z67A 3RQ4A 2Z5UA 3PIPF 1DU0A 1DP3A 3NARA 4HBLA 5E8IA 4WXCA 1USTA 3L7WA 1SANA 2PQ8A 3AG4H 5HS8A 1F4KA 2JPCA 3KZZA 4HQEA 2Y9ZA 2CUJA 3G1LA 3HOUJ 4BBSJ 3WGIA 3KCCA 4CO8A 2RAEA 1QA6A 4M3BA 5D8KB 5HDGA 3GFIA 1FLIA 1R5ID 1X4OA 5FKNA 4BY7J 2IPQX 5EZGA 1R00A 4AD9A 2A69F 4B4CA 3ISPA 4XLNF 2DA6A 4I6ZA 3AL0B 2ZB9A 3DU5A 3LSGA 5BNGA 4S05A 4XK4A 4WCGA 1KA8A 4BE1A 1TWAJ 3IKVA 5FROA 3C7JA 3H1CA 5CLSA 3LAPA 4A93J 2QVOA 2IA1A 3JTHA 4U7DA 5E79C 1ZGJA 3JRGA 1U9NA 3D1NI 3ASNH 4HV6A 4UVCA 2E2IJ 4AUXA 2HDDA 1UCRA 1Z21A 3JW4A 2MYSA 1JJ8C 3CMMA 3SZTA 1OCPA 1FZPB 1I6HJ 3E5UA 2QQ9A 3QRFF 3H0GJ 1VZ0A 3Q0UA 3HRSA 3TEDA 1ETOA 1S7OA 3H9GA 1VFCA 3JRHA 1ZN2A 3ZXSA 1DPUA 2AHQA 4A2UA 2OV7A 1JGGA 4E7JA 2DMTA 1B8IB 2GIZA 4R1HA 5DCFA 3I4MJ 1E2XA 5DCMA 2V9VA 1QZEA 1G2HA 5D4SA 1ETKA 3CJRB 4J19A 4CCKA 4U88A 2M7BA 2PI0A 1R1VA 3RPQA 2NNYA 2M0CA 1MMNA 5EGOA 2ZSIB 4IHWA 5HDNA 2FSWA 2DMPA 4IOCF 2FNAA 2A6TA 4L18B 1I3QJ 9ANTA 3T8TA 2WY7Q 3GYHX 2DDBA 2LK2A 3S93A 1WI3A 2IXSA 1WZ2A 5EJCA 3E97A 1POGA 4I2OA 1CQTA 4BJTA 4H0EA 4XSZF 1FSHA 2WBMA 2UV1A 1BIAA 2HWVA 1YO5C 3J80Z 1S7EA 3E5QA 2XROA 2JVHA 5JVTA 4IQJA 4NB5A 4ENNA 2G7HA 1X1CA 1ZAOA 1JT0A 5C4XJ 4LFUA 4HF2A 3HOVJ 4C3JJ 3A01A 4LG0A 3LSJA 4LITA 5IP6A 4RDUA 2R7XA 4M3DA 2X51A 3S16J 4A3BJ 4KT6A 3FK7A 1XMAA 2D5VA 2PFBA 4L9NA 3VB2A 2RDPA 3VPRA 4FQGA 3I5UA 1XGMA 3PQJA 3RKWA 2K27A 4U7BA 4KA4A 1CF7A 2MLGA 5GTIC 3H36A 1RUNA 5CQEA 1IV8A 2GA1A 1X1PA 2UXXA 3KP3A 1ETYA 2O5RA 4A3CJ 3QU6A 3M4OJ 3EUAA 1Y8QB 2E5ZA 2WWYA 2I8DA 5GP9A 2VJ4A 3ZQCA 1OMIA 5ILSA 1I39A 2EQRA 3FBNB 1RNLA 3CCRI 1H0MA 1J9IA 2HKXA 3FX3A 2MC4A 4UXNA 3C1DA 1K7AA 2CFOA 1FP1D 2BE5F 2DCEA 4B44A 2H1LA 3DV8A 1GV5A 4A12A 4WXDA 3NRVA 5BS6A 4I99C 2FUG2 4U87A 2STTA 3OYGA 3OS0A 4QWQA 1W5TA 5LFAA 5TISC 2GXGA 3I4NJ 2VJIA 1M1EB 3J7YJ 3VODA 5CPRB 2DFEA 1R6RA 2EV5A 2LBFB 1B72A 5F64A 3DPTA 2MD0A 1PUFB 4DIQA 1JTXA 3GTMJ 3W2VA 3AG2H 3BG3A 2LVSA 4M6VA 5FGMA 2CJJA 1VQ9I 3HDDA 1PP7U 4IXAA 4XLCA 3TO9A 2BXYA 4ENJA 2QWWA 2YPRA 5IPAA 1RRJA 2HPMA 4GFBA 3TW7A 3ZMZA 5HNHA 5FD5A 2NVQJ 4XOTA 2KIFA 3BR5A 3BR3A 2BVMA 3HHGA 2A61A 3PQKA 1ZYRF 2AO9A 4JK1X 2TCTA 1EV7A 1H89C 1D3YA 3TW6A 5HS7A 5L3FA 4KMFA 2NRAC 3G73A 2E1OA 1UJ8A 1SFXA 2XF7A 2DJIA 1KZHA 2O61A 3I59A 4UY8I 5HNFA 2Y0SN 4KYWA 4I0BA 3HC7A 1XSVA 1P7IA 5LLQA 4KMUX 3K4LA 5EEGA 1SD5A 2KL4A 1MDMA 1Y0NA 2VJJA 2KISA 3O8HA 3RYPA 1TNSA 2K9LA 2HQRA 4HDUA 2O8KA 3COAC 2HYJA 2R7OA 4JX6A 2J5OA 3WE3A 2KJBA 2YSRA 5J1UA 3S14J 3ABMH 1W7PB 1A04A 1DPRA 1LUJB 2DODA 3QYBA 3SFZA 1RC9A 3ONQA 4RAGA 2KIUA 4JOMA 3S1NJ 3U2RA 3CTAA 3CP2A 5IOYA 3SFIA 1MNEA 1S8NA 1DQUA 4M3FA 4PJ0C 3CD6I 1JGSA 2F6CA 3P9KA 2FBIA 4Y3OA 1VQKI 2XGDA 4AIKA 1B1BA 4A3JJ 2VPRA 4G7ZF 1VNDA 4XLHA 4XKWA 1MW7A 2FOKA 2ZSHB 2Z33A 3ZQGA 2EIKH 1ZARA 2BW3B 3ABUA 3BCBA 2EZIA 4H4KC 4BHBA 2XVCA 3R60A 5E1ZB 4ZTJA 4AIDA 2QUFA 2A5YB 2P0WA 3OS2A 3BROA 2OJED 4A3LJ 2EH3A 3F8NA 2X0LA 3DP7A 4ZC3A 2M30A 3VSLA 5J8CA 1J75A 2PEXA 3EUHA 2MGQA 1VQNI 4WWCA 1FOXA 4RGUA 3W6KB 4P9UA 2VC1A 1YS6A 2V6EA 4FE7A 2KIQA 3PM1A 5D6FA 4E7IA 1U9OA 3K4CA 2QBYB 2EINH 1W4MA 3IAS2 4BUPA 4I7HA 5EF6A 1J59A 3QOPA 4B43A 1I5ZA 2FBKA 2ESHA 2V9KA 2ZMEA 3GZ6A 2R7SA 2GLOA 1A6IA 3F6OA 1SMYF 3TP0A 4AWXB 5IY5H 2E2JJ 2XUBA 4ITVA 4LK0F 2VQLA 4N4OB 3FDYA 3B02A 2A68F 2VXDA 3FF5A 3Q9VA 2RN7A 4GCVA 5L3CA 2COBA 4IJAA 1IDZA 3BWGA 3MZ8A 4Y7NJ 4A3DJ 4A0ZA 3MMYB 1F43A 2WV0A 4EVIA 4I01A 5E1XA 4C9YA 2VT3A 5C44J 2VL8A 3E6CC 1R1TA 3RKYA 3OWTA 1G8XA 4HNVA 1SVMA 3IC7A 3OYKA 3WE2A 2H6CA 3QU3A 4HYEA 1T56A 1U5TA 4A5MA 2AS5F 1OR7A 5LRRA 3K9TA 3QP6A 1YX3A 4EJVA 2CRGA 2ELJA 2BHZA 1FBUA 3IAM2 2JRMA 1ZH5A 1LQ1A 1MGTA 2M3AA 5AIQA 3JRAA 2ISYA 1BI1A 1FBQA 3RZDJ 1U8BA 5DD4A 4BQQA 4ANJA 1IN6A 1Y1WJ 4HRIA 1FMWA 4IRIA 2P4WA 4ABZA 2GAUA 2KP6A 2QA4I 2K5CA 2AXTC 2OTLI 2JA8J 2BHYA 4HAMA 1D1CA 1W5SA 2P81A 3F3XA 2NVXJ 3K10A 1ULYA 1YS7A 1DDNA 3IL2A 1AKHB 1RETA 3HKZN 2K4JA 4B3XA 3BPXA 2MFZA 2V1UA 3ZMVA 4A5NA 5LGUA 3K69A 2CS3A 3OS1A 1YI2I 2DOAA 3RDIA 2BY3A 1GVDA 2LFBA 1ENHA 4MIMA 4YFXF 1S29A 3ZQHA 2HQNA 1I50J 3OYDA 3I58A 3LSTA 1YX5A 2FEZA 1WH7A 1RIOH 3J7AO 5EGOB 1O3RA 1ZREA 3HUGB 3BG6A 4E7KA 1N75A 3L00A 3H0DA 2PBIA 1VQ4I 3TBIA 2R7ZJ 4A6EA 4GDFA 3OSGA 4O6JA 2EWNA 1LE8B 3GFJA 3DBLB 4HA8A 5F04A 1OCZH 3OOPA 4RB0A 2VUMJ 1QHHD 1Y39A 4KIBA 4ZZDA 3HOTA 4BBRJ 4XLAA 4F55A 2R3SA 3BT9A 1MJ9A 3MCZA 3GVAA 2K40A 2XB0X 2MH2A 1VQMI 4M9ZA 2BZTA 2B0LA 5EYRA 2FBHA 2DMQA 2WTEA 4YIFA 4UUTA 5FKLA 2DPUA 3V8KA 1W7PA 3BQYA 3DBRB 5DD8A 4I98B 1W0UA 1TQPA 3GEZA 3DPLC 3HTUA 2PLYA 1R5GA 2CQXA 5DYMA 2LF7A 3GCMA 2A3SA 4IHVA 2WAFA 3WU0A 3DF8A 4CH7A 4MEXF 4IF4A 2VBXA 1GXPA 3GZ5A 1VTNC 3IV5A 1Z7LA 2GXBA 3TOAA 4BKXA 1IDYA 3Q3SA 5DDGA 2IA0A 1WPKA 3OYEA 1TW2A 5M3FJ 4I0AA 3RSNA 3FXMA 4HNUA 2ECBA 5JFRA 4OINF 3RJPA 2PJRA 2ESNA 3MN2A 2HS5A 3FXRA 5HVQC 5F08A 4B8XA 2O0YA 3CCUI 2L54A 2EK5A 1XMKA 5ICFA 3ECOA 4A69C 3CMYA 3A0BC 2A07F 2CW0F 4XR6A 2L7ZA 1WKMA 2W24A 1D0YA 1OCCH 3HBLA 2OPTA 3CO6C 1HW5A 3CC4I 4BXXJ 2Q8KA 2VKEA 1YTYA 2E1NA 5LD2C 3CCMI 4M73A 5TRDA 2KKOA 4KISA 3WU1B 1VQPI 5K7ZA 3KP4A 5J40A 1DGWY 3GMEA 3HTSB 1CF7B 2ZMEC 5D5WB 4FISA 4EJUA 5K7HA 3HSRA 3ZN1A 3MD2A 2EA2A 2M4KA 2EILH 2IBDA 3JR9A 1HOMA 1TZLA 4PJJA 3MKWB 2R7VA 5K7FA 2BY1A 1XC5A 4JX4A 2E36A 2VC0A 2CO5A 1ONVA 4ESBA 3LSIA 4ESJA 4Q47A 3DCFA 2DYRH 5IT9K 1O3TA 3IWFA 5K5QA 1IRFA 2NAZA 3O3KA 2MD5A 4ETSA 3W6JB 3CCLI 1J0RA 3HGGA 3OIPA 2LDUA 3ASOH 4GXOA 1Y56A 1N25A 3ZOBA 2R4GA 1JHHA 2D45A 4AC0A 2IS4A 1KYWA 4B09A 2LSOA 3PUBA 4BQNA 2ID3A 2L3DA 1W0TA 2HOTA 3MAJA 5B1AH 1HCRA 3WHCA 5IT3A 4P5OA 1PUEE 4MTEA 2F4IA 2IJLA 1UHWA 2KFDA 3F0CA 2HPIA 4J00A 1KU3A 3FKJA 2P7CB 2DXIA 1UZCA 3BR0A 4D7NA 1OJLA 1TT5B 3U1DA 2V1XA 1TTYA 2P7VB 2WADA 2OBPA 2W85A 5C4JJ 2BY2A 2Z99A 4A3IJ 3PJRA 1HW1A 5DCMB 4F93B 3MFKA 2DDAA 4ENMA 2PX9A 4RM3A 3UNGC 1D1AA 3PFIA 1KONA 1ODDA 2O7OA 4IPAA 1ITYA 2NNNA 2V4JC 2KDZA 3CCSI 1TL8A 5GPCA 4WF2A 3F72A 3HOWJ 2CW7A 2BYVE 3H9JA 2HEOA 1ETXA 4EM2A 3LNQA 1G3SA 1Z1DA 3E7LA 2ZC2A 1ETWA 5J6XA 3KYCB 3VYTB 3BZ6A 3QPTA 3VOEA 2K3FA 1OCTC 4ZYHA 1T38A 3S32A 1RPWA 5IP9J 1R9TJ 4CYCB 2VBYA 2WB1A 2W48A 5KK1A 1LJ9A 1O7LA 2KRCA 4XRSG 1OYYA 4ZYEA 2VKVA 3CF2A 3WTXC 4G94A 1MJBA 3CDIA 1BI0A 1YJNI 3BQZA 1X58A 3SYTA 3OYFA 1O57A 4FETA 3CCEI 5GTHC 4BHCA 2F5DA 3EUHC 1SVOA 1X1BA 3OYIA 2Q2EB 4O3MA 1L0OC 3SDGA 3S2HJ 3RKQA 1FT9A 1MBJA 2F2EA 2B9SA 1QBJA 3M8EA 1R58A 3FM3A 4L5EA 1MH3A 2UZKA 1TW3A 2CUFA 2K86A 2WY8Q 1UG0A 3DXJF 5K1YA 1JJ6C 3GUDA 3BR2A 3WGHA 1Z9CA 2QKLB 2EBIA 2CV1A 1KQ9A 2QGUA 5HS9A 2M4GA 1JHFA 3ZGKA 5BPIA 3LSRA 2PMHA 1JI8A 4G6QA 4KUMA 2PJPA 3I55I 3S15J 1P4XA 1R1UA 2LMDA 4JYKA 3CMEI 1YQAA 2H8WA 2ZXIA 2J5PA 4A3EJ 1ZG3A 5H20A 2ACJA 4R79A 1ZELA 2ZBKA 1YIOA 3FK6A 1TT0A 1QVTA 2RNGA 4IRHA 3ZN0A 2XPVA 5DTDA 1BI2A 3JREA 3L9FA 3NQOA 3F9KA 3OYNA 3RI4A 3BTJA 5EEHA 2EFQA 3C18A 3F8CA 4II3A 1Y0UA 3IHUA 4BGDA 4DYCA 5K5OA 4OIPF 3DWLE 2JSCA 4BEHA 3A2KA 2QENA 1EF4A 2R0QC 3CC2I 4PZJA 3ULQB 4YIRX 2LD5A 2EFWA 3OYJA 3JCUC 1QNTA 4DZPA 2GOXB 3GTOJ 2W84A 4KIFA 2DK8A 3AL0C 3F21A 2HYGD 3I59B 1H8AC 4LG3A 4Q4ZF 2O9LA 1WJFA 3BG5A 4K2EA 4L5IA 2VPLA 5D5UB 2XHKA 3L2UA 2OCEA 2PMUA 4UV9A 3H35A 1SFKA 4JX5A 4LMYA 3S3NA 1HC8A 2O3FA 1T0FA 3G3ZA 1E17A 5F27A 1GT0C 2ZMEB 4UUSA 1RESA 4KJZA 3LFKA 3LAJA 4PGHA 3PFYA 3HOYJ 4I76A 2N8GA 2JTVA 1JTYA 4PJMA 2R7WA 1NH3A 1YJWI 3CJQB 1WJDA 1VQOI 4YELA 2K9MA 1IW7F 3NWSA 4TV7A 2X6XA 3S8PA 2HOEA 4BDZA 2DMUA 4UHTA 3AG3H 1A35A 4ZYAA 1MBHA 2WAQA 1F1ZA 2JN6A 3FMQA 1OCRH 3J7ZI 4HOBA 2KT0A 5EZHA 1UELB 4Y17A 2MSYA 3I71A 4UVBA 2M1BA 4LK1F 1VI0A 1MZBA 3GBGA 1MSFC 1A31A 1OQYA 3RIRA 3ERMA 1YG2A 2NS8A 3HHHA 2DA7A 4RA2A 1P9QC 2E2HJ 3TO7A 4JP0A 3M1EA 1AWCA 3MVPA 2CYYA 3FM5A 2EV6A 3G1OA 1FOWA 1R36A 1Y6IA 3KP5A 1QU3A 3ABKH 4HZFA 1K78A 4DNCA 4CCMA 1Q1HA 2X6WA 4KN7X 2XF6A 3K2ZA 4E7HA 5TJJA 3FWEA 1ZRFA 4N4NB 2V79A 1IJWC 3SZPA 4EGZA 2B63J 2OZ6A 3HOZJ 1FNNA 5D6EA 1EA3A 1ZHFA 4IHYA 3MKLA 2VI6A 4D9JA 1ZRCA 2LC2A 3SEQA 1YLFA 2XAUA 4KT5C 2HVQA 4U0WA 1AKHA 1ZRDA 3F6VA 2QSFX 3FXUA 4AU7A 4EJTA 3GLXA 3K1MA 1IRGA 2BV6A 4UUSB 3JAMK 1IXCA 5ILUA 2UWMA 1K6YA 3GO5A 4XN3A 1FX7A 3CF5F 2XRLA 2DFIA 4OU0A 4P1WA 1XDSA 3LOCA 2XKOA 2QF7A 4HQMA 4FASD 5FFZA 4PJNA 2CSOA 2XB5A 2IAIA 3Q9SA 1ZKGA 2EZLA 5KAFC 2HDCA 4XIDA 3QAHA 3S1RJ 3PNYA 4QPOA 3IRQA 2VE9A 2QBYA 1TLHB 1SAXA 1TC3C 1OLTA 1HSJA 2OQGA 4DOZA 4IHTA 2V9PA 1T08B 1V3FA 1WJEA
chains in the Genus database with same CATH topology
1A5JA 4HNVA 2CUEA 5C3EJ 3L1PA 1T56A 3OSFA 3PO2J 1NK3P 3HM5A 2CRGA 2M8GX 2OF7A 2DA4A 1FTZA 4V2GA 1AHDP 5DS9A 5FKMA 3JRAA 1HDPA 2X48A 3RZDJ 1U8BA 1JUMA 2X6OA 2DTZA 1NK2P 1Y1WJ 3Q0VA 2ECCA 4ABZA 2L9RA 2LY9A 3IH3A 1X2NA 3HGYA 2JA8J 3H3VK 4DYQA 4C2MJ 2P81A 4CYCA 2NVXJ 2HXIA 5J3LA 2XGCA 2R5YA 1FTTA 1AKHB 2L7MP 4FE4A 1RETA 3GTKJ 3HKZN 3QPLA 4D7MA 4QIWN 1ZR4A 3M3YJ 3FKIJ 1GVDA 1FIAA 1ENHA 2LFBA 4MIMA 3SJMA 3GTGJ 2JA5J 3GTPJ 3ZQHA 1MBGA 1I50J 1ORKA 1WH7A 5GPAA 4D5CA 2XPUA 5EGOB 1LFBA 4QTRA 2CQQA 2R5YB 4MO7A 3Q0WA 3OIOA 5IYDJ 1OFCX 1JKQC 2R7ZJ 3BR1A 3OSGA 2K9SA 1ZQ3P 3W6VA 1LE8B 3RQIA 2R5ZB 5F04A 4XICA 2YS9A 1X2MA 2JMWA 2VUMJ 1DU6A 5FJ8J 3A02A 4A3FJ 2HXOA 4BBRJ 1JKRC 1RR7A 1MNMC 2H8RA 3BR6A 1IC8A 3BT9A 3JRDA 2JA7J 1UHSA 2K40A 2XB0X 1BJZA 2JWTA 3NAUA 5EYRA 2GBYA 2H1KA 2DMQA 4UUTA 5FKLA 1JT6A 5EEAA 3QPSA 1FJLA 1QPIA 3GTJJ 3BQYA 2WAQN 4LOCA 1W0UA 2X9DA 3QQAA 2EZKA 5EG0B 1P7JA 2CQXA 5EDNA 1TWGJ 4IHVA 1E3OC 1IV6A 1AU7A 4QSHA 1MBEA 5E3MA 1HDDC 2ME0A 3IV5A 2XSDC 2LTPA 4BKXA 2M2EA 1DU0A 1IDYA 3Q3SA 1RKWA 3NARA 1WPKA 4B3AA 5M3FJ 1SANA 3LSPA 5J1YA 2ECBA 3HOXJ 1HLVA 2Y9ZA 3G1LA 3HOUJ 2G0EA 4BBSJ 3WHBA 3MN2A 2RAEA 4M3BA 2R92J 4B1RA 5F08A 1TWCJ 5JLXA 1GUUA 3CMYA 4A69C 5FKNA 2HOSA 5FLMJ 4BY7J 2L7ZA 5EZGA 3HBLA 2Y31A 2OPTA 4BXXJ 2VKEA 4B4CA 3BG9A 2DA6A 4I6ZA 2ZB9A 3BTLA 3LSGA 5BNGA 4XK4A 1TWAJ 3JRCA 2HI3A 3JRIA 4MLOA 3IH4A 5K7ZA 4A93J 3ZQLA 3K2AA 4FISA 3JRGA 1U9NA 3A03A 3D1NI 2E2IJ 4AUXA 2XGEA 1IUFA 5K7HA 5E3NA 2HDDA 1LE8A 1K61A 2Y2ZA 2IBDA 3JR9A 1JJ8C 1HOMA 1OCPA 1I6HJ 1PUFA 1U78A 5K7FA 3H0GJ 4G12A 4M3EA 1XC5A 4JX4A 3Q0UA 3TEDA 1FIPA 1ETOA 5EG0A 1JKPC 2YU9J 1VFCA 1MBFA 5IYCJ 3DCFA 3JRHA 2IEKA 2AHQA 4MFEA 2I10A 1JGGA 2DMTA 1B8IB 1YRNB 3HGGA 2LKXA 3I4MJ 2LLKA 3ZOBA 4AC0A 1G2HA 3S17J 1JKOC 1ETKA 2LP0A 2ID3A 2XPWA 5E3OA 4J19A 4X1EA 4FTHA 1W0TA 2HOTA 2M0CA 1T33A 3WHCA 1HCRA 3F0CA 5EGOA 3CQZJ 5IOZA 4IHWA 2MW8A 4DW6A 3BR0A 4D7NA 2DMPA 1OJLA 1ZTRA 3BTIA 1LFUP 1I3QJ 2PMZN 9ANTA 5C4JJ 5M5WJ 3S1MJ 2LK2A 1WI3A 4A3IJ 2L0KA 1POGA 2K9QA 1CQTA 1MSEC 2O7OA 4NDLA 3S1QJ 1ITYA 5F0CA 1ZGWA 4V2FA 2KDZA 1S7EA 5GPCA 5JLWA 1GV2A 3HOWJ 1JUSA 1XG1A 1ETXA 3LNQA 1JT0A 3E7LA 1ETWA 1UMQA 5C4XJ 1RKTA 3HOVJ 4C3JJ 3A01A 3GTLJ 3LSJA 5IP6A 4RDUA 1MBKA 4M3GA 1OCTC 4M3DA 2GM4A 3S16J 4A3BJ 1RPWA 5IP9J 1R9TJ 3FK7A 4CYCB 2D5VA 2W48A 3VPRA 4XRSG 2VKVA 4Y52J 1UG2A 2ME6A 2ELKA 2Y30A 3S2DJ 3BQZA 1X58A 1BL0A 3DEWA 1ETYA 4A3CJ 3M4OJ 5GP9A 3SDGA 3ZQCA 2LR8A 1MBJA 3RKQA 3S2HJ 4L5EA 2EQRA 1O4XA 1MH3A 1H88C 1B72B 2CUFA 1BA5A 1JJ6C 3CCYA 3BR2A 5F0HA 2M9HA 2EBIA 2ID6A 2K9NA 1GV5A 1Z77A 1HF0A 5IYBJ 4BY1J 3LSRA 4RBOA 1FEXA 2FJ1A 3S15J 2HQ5A 4JYKA 5HODA 1WGXA 2DJNA 4W1UA 4XRSA 2L7FP 3PO3J 3I4NJ 4A3EJ 1APLC 2R5ZA 3B6CA 3FK6A 1QVTA 1B72A 3TP3A 4DYRA 1Y1VJ 2DA5A 2XPVA 3OOUA 5DTDA 1PUFB 1JTXA 4C3HJ 3JREA 3GTMJ 3BG3A 3BTJA 2LVSA 4M6VA 2CJJA 5IP7J 3HDDA 3ZQIA 2TRTA 3BTCA 4D5FA 4DYCA 2JA6J 1NTCA 5IPAA 4GFBA 1EF4A 2R0QC 3TW7A 2LD5A 1MH4A 2NVQJ 3O8GA 3BR5A 3BR3A 4IHXA 2AO9A 1ZK8A 2NVYJ 4DZPA 2QCOA 2TCTA 3GTOJ 3IH2A 1H89C 3TW6A 4A3MJ 3G1MA 1H8AC 2E19A 3GTQJ 2E1OA 2O9LA 3BG5A 4A3KJ 1ZR2A 4DZJA 2Y0SN 3FISA 2CU7A 4JX5A 2FQ4A 1P7IA 2M34A 3A01B 1QVUA 3CDLA 2DA3A 2MG4A 5F27A 4XRMA 1GT0C 3O8HA 4UUSA 1RESA 4S0HB 4A3GJ 2O8KA 2HYJA 1F36A 1IGNA 3HOYJ 4I76A 4JX6A 3RZOJ 2N8GA 5J1UA 2NVTJ 5FKOA 2R93J 1JTYA 3S14J 3ZQFA 2DA1A 1QRYA 1ETQA 1ETVA 3S1NJ 5IOYA 4AYBN 3SFIA 4M3FA 4FCYA 2DMUA 2XGDA 2NOGA 3K7AJ 2VPRA 4A3JJ 1VNDA 1MBHA 2JN6A 2KT0A 5EZHA 1D5YA 3ZQGA 2MSYA 2EZIA 1VF9A 1VI0A 3GBGA 2Y9YA 1MSFC 3JRFA 2NS8A 5FLVA 2NS7A 2DA7A 2DN0A 2E2HJ 4JP0A 3MVPA 1WCMJ 2FD5A 4A3LJ 2EH3A 1B8IA 1YRNA 2FX0A 3G1OA 5M5XJ 1TWHJ 5M3MJ 3HB9A 3HEFA 5E3LA 4C3IJ 1JUPA 3UKGA 2MGQA 3FIWA 1IJWC 1K83J 2DMNA 2B63J 3HOZJ 4FE7A 2WV1A 3MKLA 4IHYA 2VI6A 3PM1A 2JK3A 1U9OA 4MFDA 5F1JA 1XS9A 5F0FA 5EF6A 1AKHA 5FKKA 1SFOJ 2DA2A 4UUSB 2GLOA 1WH5A 1A6IA 4EEFG 2YUSA 3TP0A 1IG7A 1IRZA 2E2JJ 2XRLA 2EZHA 4W97A 3LOCA 5J1RA 5M5YJ 2QF7A 1BW6A 1Z0XA 2XB5A 3C2BA 2IAIA 1TWFJ 1ZKGA 2EZLA 2WB1N 1IDZA 2COBA 3B6AA 4XIDA 4Y7NJ 3S1RJ 4X6AJ 4A3DJ 1TC3C 1F43A 3JRBA 1Q1VA 4IEJA 1BW5A 5C44J 2JJ7A 1GDTA 2HOAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A5J A;  4HNV A;  2CUE A;  5C3E J;  3L1P A;  1T56 A;  3OSF A;  3PO2 J;  1NK3 P;  3HM5 A;  2CRG A;  2M8G X;  2OF7 A;  2DA4 A;  1FTZ A;  4V2G A;  1AHD P;  5DS9 A;  5FKM A;  3JRA A;  1HDP A;  2X48 A;  3RZD J;  1U8B A;  1JUM A;  2X6O A;  2DTZ A;  1NK2 P;  1Y1W J;  3Q0V A;  2ECC A;  4ABZ A;  2L9R A;  2LY9 A;  3IH3 A;  1X2N A;  3HGY A;  2JA8 J;  3H3V K;  4DYQ A;  4C2M J;  2P81 A;  4CYC A;  2NVX J;  2HXI A;  5J3L A;  2XGC A;  2R5Y A;  1FTT A;  1AKH B;  2L7M P;  4FE4 A;  1RET A;  3GTK J;  3HKZ N;  3QPL A;  4D7M A;  4QIW N;  1ZR4 A;  3M3Y J;  3FKI J;  1GVD A;  1FIA A;  1ENH A;  2LFB A;  4MIM A;  3SJM A;  3GTG J;  2JA5 J;  3GTP J;  3ZQH A;  1MBG A;  1I50 J;  1ORK A;  1WH7 A;  5GPA A;  4D5C A;  2XPU A;  5EGO B;  1LFB A;  4QTR A;  2CQQ A;  2R5Y B;  4MO7 A;  3Q0W A;  3OIO A;  5IYD J;  1OFC X;  1JKQ C;  2R7Z J;  3BR1 A;  3OSG A;  2K9S A;  1ZQ3 P;  3W6V A;  1LE8 B;  3RQI A;  2R5Z B;  5F04 A;  4XIC A;  2YS9 A;  1X2M A;  2JMW A;  2VUM J;  1DU6 A;  5FJ8 J;  3A02 A;  4A3F J;  2HXO A;  4BBR J;  1JKR C;  1RR7 A;  1MNM C;  2H8R A;  3BR6 A;  1IC8 A;  3BT9 A;  3JRD A;  2JA7 J;  1UHS A;  2K40 A;  2XB0 X;  1BJZ A;  2JWT A;  3NAU A;  5EYR A;  2GBY A;  2H1K A;  2DMQ A;  4UUT A;  5FKL A;  1JT6 A;  5EEA A;  3QPS A;  1FJL A;  1QPI A;  3GTJ J;  3BQY A;  2WAQ N;  4LOC A;  1W0U A;  2X9D A;  3QQA A;  2EZK A;  5EG0 B;  1P7J A;  2CQX A;  5EDN A;  1TWG J;  4IHV A;  1E3O C;  1IV6 A;  1AU7 A;  4QSH A;  1MBE A;  5E3M A;  1HDD C;  2ME0 A;  3IV5 A;  2XSD C;  2LTP A;  4BKX A;  2M2E A;  1DU0 A;  1IDY A;  3Q3S A;  1RKW A;  3NAR A;  1WPK A;  4B3A A;  5M3F J;  1SAN A;  3LSP A;  5J1Y A;  2ECB A;  3HOX J;  1HLV A;  2Y9Z A;  3G1L A;  3HOU J;  2G0E A;  4BBS J;  3WHB A;  3MN2 A;  2RAE A;  4M3B A;  2R92 J;  4B1R A;  5F08 A;  1TWC J;  5JLX A;  1GUU A;  3CMY A;  4A69 C;  5FKN A;  2HOS A;  5FLM J;  4BY7 J;  2L7Z A;  5EZG A;  3HBL A;  2Y31 A;  2OPT A;  4BXX J;  2VKE A;  4B4C A;  3BG9 A;  2DA6 A;  4I6Z A;  2ZB9 A;  3BTL A;  3LSG A;  5BNG A;  4XK4 A;  1TWA J;  3JRC A;  2HI3 A;  3JRI A;  4MLO A;  3IH4 A;  5K7Z A;  4A93 J;  3ZQL A;  3K2A A;  4FIS A;  3JRG A;  1U9N A;  3A03 A;  3D1N I;  2E2I J;  4AUX A;  2XGE A;  1IUF A;  5K7H A;  5E3N A;  2HDD A;  1LE8 A;  1K61 A;  2Y2Z A;  2IBD A;  3JR9 A;  1JJ8 C;  1HOM A;  1OCP A;  1I6H J;  1PUF A;  1U78 A;  5K7F A;  3H0G J;  4G12 A;  4M3E A;  1XC5 A;  4JX4 A;  3Q0U A;  3TED A;  1FIP A;  1ETO A;  5EG0 A;  1JKP C;  2YU9 J;  1VFC A;  1MBF A;  5IYC J;  3DCF A;  3JRH A;  2IEK A;  2AHQ A;  4MFE A;  2I10 A;  1JGG A;  2DMT A;  1B8I B;  1YRN B;  3HGG A;  2LKX A;  3I4M J;  2LLK A;  3ZOB A;  4AC0 A;  1G2H A;  3S17 J;  1JKO C;  1ETK A;  2LP0 A;  2ID3 A;  2XPW A;  5E3O A;  4J19 A;  4X1E A;  4FTH A;  1W0T A;  2HOT A;  2M0C A;  1T33 A;  3WHC A;  1HCR A;  3F0C A;  5EGO A;  3CQZ J;  5IOZ A;  4IHW A;  2MW8 A;  4DW6 A;  3BR0 A;  4D7N A;  2DMP A;  1OJL A;  1ZTR A;  3BTI A;  1LFU P;  1I3Q J;  2PMZ N;  9ANT A;  5C4J J;  5M5W J;  3S1M J;  2LK2 A;  1WI3 A;  4A3I J;  2L0K A;  1POG A;  2K9Q A;  1CQT A;  1MSE C;  2O7O A;  4NDL A;  3S1Q J;  1ITY A;  5F0C A;  1ZGW A;  4V2F A;  2KDZ A;  1S7E A;  5GPC A;  5JLW A;  1GV2 A;  3HOW J;  1JUS A;  1XG1 A;  1ETX A;  3LNQ A;  1JT0 A;  3E7L A;  1ETW A;  1UMQ A;  5C4X J;  1RKT A;  3HOV J;  4C3J J;  3A01 A;  3GTL J;  3LSJ A;  5IP6 A;  4RDU A;  1MBK A;  4M3G A;  1OCT C;  4M3D A;  2GM4 A;  3S16 J;  4A3B J;  1RPW A;  5IP9 J;  1R9T J;  3FK7 A;  4CYC B;  2D5V A;  2W48 A;  3VPR A;  4XRS G;  2VKV A;  4Y52 J;  1UG2 A;  2ME6 A;  2ELK A;  2Y30 A;  3S2D J;  3BQZ A;  1X58 A;  1BL0 A;  3DEW A;  1ETY A;  4A3C J;  3M4O J;  5GP9 A;  3SDG A;  3ZQC A;  2LR8 A;  1MBJ A;  3RKQ A;  3S2H J;  4L5E A;  2EQR A;  1O4X A;  1MH3 A;  1H88 C;  1B72 B;  2CUF A;  1BA5 A;  1JJ6 C;  3CCY A;  3BR2 A;  5F0H A;  2M9H A;  2EBI A;  2ID6 A;  2K9N A;  1GV5 A;  1Z77 A;  1HF0 A;  5IYB J;  4BY1 J;  3LSR A;  4RBO A;  1FEX A;  2FJ1 A;  3S15 J;  2HQ5 A;  4JYK A;  5HOD A;  1WGX A;  2DJN A;  4W1U A;  4XRS A;  2L7F P;  3PO3 J;  3I4N J;  4A3E J;  1APL C;  2R5Z A;  3B6C A;  3FK6 A;  1QVT A;  1B72 A;  3TP3 A;  4DYR A;  1Y1V J;  2DA5 A;  2XPV A;  3OOU A;  5DTD A;  1PUF B;  1JTX A;  4C3H J;  3JRE A;  3GTM J;  3BG3 A;  3BTJ A;  2LVS A;  4M6V A;  2CJJ A;  5IP7 J;  3HDD A;  3ZQI A;  2TRT A;  3BTC A;  4D5F A;  4DYC A;  2JA6 J;  1NTC A;  5IPA A;  4GFB A;  1EF4 A;  2R0Q C;  3TW7 A;  2LD5 A;  1MH4 A;  2NVQ J;  3O8G A;  3BR5 A;  3BR3 A;  4IHX A;  2AO9 A;  1ZK8 A;  2NVY J;  4DZP A;  2QCO A;  2TCT A;  3GTO J;  3IH2 A;  1H89 C;  3TW6 A;  4A3M J;  3G1M A;  1H8A C;  2E19 A;  3GTQ J;  2E1O A;  2O9L A;  3BG5 A;  4A3K J;  1ZR2 A;  4DZJ A;  2Y0S N;  3FIS A;  2CU7 A;  4JX5 A;  2FQ4 A;  1P7I A;  2M34 A;  3A01 B;  1QVU A;  3CDL A;  2DA3 A;  2MG4 A;  5F27 A;  4XRM A;  1GT0 C;  3O8H A;  4UUS A;  1RES A;  4S0H B;  4A3G J;  2O8K A;  2HYJ A;  1F36 A;  1IGN A;  3HOY J;  4I76 A;  4JX6 A;  3RZO J;  2N8G A;  5J1U A;  2NVT J;  5FKO A;  2R93 J;  1JTY A;  3S14 J;  3ZQF A;  2DA1 A;  1QRY A;  1ETQ A;  1ETV A;  3S1N J;  5IOY A;  4AYB N;  3SFI A;  4M3F A;  4FCY A;  2DMU A;  2XGD A;  2NOG A;  3K7A J;  2VPR A;  4A3J J;  1VND A;  1MBH A;  2JN6 A;  2KT0 A;  5EZH A;  1D5Y A;  3ZQG A;  2MSY A;  2EZI A;  1VF9 A;  1VI0 A;  3GBG A;  2Y9Y A;  1MSF C;  3JRF A;  2NS8 A;  5FLV A;  2NS7 A;  2DA7 A;  2DN0 A;  2E2H J;  4JP0 A;  3MVP A;  1WCM J;  2FD5 A;  4A3L J;  2EH3 A;  1B8I A;  1YRN A;  2FX0 A;  3G1O A;  5M5X J;  1TWH J;  5M3M J;  3HB9 A;  3HEF A;  5E3L A;  4C3I J;  1JUP A;  3UKG A;  2MGQ A;  3FIW A;  1IJW C;  1K83 J;  2DMN A;  2B63 J;  3HOZ J;  4FE7 A;  2WV1 A;  3MKL A;  4IHY A;  2VI6 A;  3PM1 A;  2JK3 A;  1U9O A;  4MFD A;  5F1J A;  1XS9 A;  5F0F A;  5EF6 A;  1AKH A;  5FKK A;  1SFO J;  2DA2 A;  4UUS B;  2GLO A;  1WH5 A;  1A6I A;  4EEF G;  2YUS A;  3TP0 A;  1IG7 A;  1IRZ A;  2E2J J;  2XRL A;  2EZH A;  4W97 A;  3LOC A;  5J1R A;  5M5Y J;  2QF7 A;  1BW6 A;  1Z0X A;  2XB5 A;  3C2B A;  2IAI A;  1TWF J;  1ZKG A;  2EZL A;  2WB1 N;  1IDZ A;  2COB A;  3B6A A;  4XID A;  4Y7N J;  3S1R J;  4X6A J;  4A3D J;  1TC3 C;  1F43 A;  3JRB A;  1Q1V A;  4IEJ A;  1BW5 A;  5C44 J;  2JJ7 A;  1GDT A;  2HOA A; 
#chains in the Genus database with same CATH topology
 2I5U A;  1PJR A;  3LA7 A;  2CUE A;  3G71 I;  5BOX A;  3EYI A;  3CES A;  3CUQ C;  4XKC A;  4A0X A;  2E71 A;  3S3O A;  1JXS A;  1X4P A;  4ZH4 F;  2OD5 A;  3BG7 A;  3M1C A;  4QPQ A;  1WJC A;  1U2W A;  2HZT A;  1NG7 A;  3GX4 X;  3I9V 2;  4V2G A;  4G7O F;  5DS9 A;  5E17 F;  2F4M B;  1EJ9 A;  1J5Y A;  5B66 C;  4JQF A;  5CYV A;  3ZMS A;  2DTZ A;  3N97 A;  1IO2 A;  4MTD A;  3CLO A;  5FD6 A;  2E60 A;  1Z6R A;  2LY9 A;  1G4D A;  2X4H A;  3K6G A;  2R7U A;  1X2N A;  3A1Y A;  3HGY A;  1I6X A;  3CUQ B;  3WTY C;  4C2M J;  3QWL A;  4CYC A;  4XON A;  2QYO A;  5LHI A;  2R5Y A;  3L09 A;  1VQ7 I;  2L7M P;  2DQR A;  4FE4 A;  3GTK J;  1T6S A;  4RB1 A;  1SVL A;  3QPL A;  4D7M A;  2FNP A;  3K4N A;  3W3C A;  4QIW N;  3TDU C;  3FKI J;  3ZRG A;  2P6T A;  1RI7 A;  2FOW A;  2FXA A;  4KIC A;  4BH9 A;  4RGS A;  3MKZ A;  3WTZ A;  3GTP J;  3ABL H;  1WWX A;  2ZNY A;  3GW2 A;  2D1H A;  2H27 A;  1ERD A;  3EET A;  4XMY A;  3WTV C;  4HX8 A;  5GPA A;  2QZ8 A;  4D5C A;  2XPU A;  1LFB A;  1KQ0 A;  5ICG A;  1S6L A;  4QTR A;  2M0M A;  4GRI A;  4MO7 A;  2KRH A;  3Q0W A;  3RKX A;  3OIO A;  5L3B A;  5FRM A;  3V7S A;  3OYH A;  3E0J B;  4IL6 C;  3GF2 A;  4N9H A;  5B3S H;  2KZG A;  2Q2E A;  1OCO H;  5DUI A;  1OYW A;  2LKS A;  1I1S A;  3WTU C;  3LSH A;  3WTS C;  4I02 A;  2IVM A;  3V42 A;  2RNJ A;  1MD0 A;  4NUB A;  3E1S A;  2GZW A;  1FYK A;  4BQO A;  2KRF A;  4S04 A;  2CG4 A;  1WJA A;  2QQB A;  2JT1 A;  2E35 A;  1JE8 A;  4CXF A;  1KU2 A;  4FX0 A;  2XAQ A;  3KZI C;  3QPH A;  2L02 A;  1BR4 A;  1XMX A;  2Y48 A;  4P96 A;  2JPB A;  4BQA A;  1BJZ A;  2JWT A;  3NAU A;  2GBY A;  2V26 A;  1S9H A;  2HYF A;  5D8L B;  2CGP A;  3H3Z A;  4R8H A;  4KIT B;  2ZKZ A;  3QPS A;  3J81 Z;  3AG1 H;  4O5V A;  2DT7 B;  2WAQ N;  3M07 A;  2CQ7 A;  2FA5 A;  4L0Z B;  1STZ A;  3IWZ A;  3CUQ A;  3ECH A;  3QQA A;  4PSW A;  4FT8 A;  1P7J A;  1H9G A;  4D0P A;  2E1C A;  4RMN A;  4F7Z A;  2JA2 A;  3OIQ A;  1E3O C;  1IV6 A;  3CCQ I;  4LGW A;  1XD7 A;  4QSH A;  5HLG A;  1MBE A;  1MMG A;  2Z2S B;  5E3M A;  2X1D A;  2R7T A;  3ZQQ A;  1RR8 C;  1O7F A;  2ME0 A;  3DKY A;  3FXJ A;  3H5A A;  3R0J A;  2LTP A;  1B9N A;  2XSD C;  3DBH B;  3HG9 A;  4UB6 C;  1PDN C;  1LFP A;  1DGR M;  1KQ8 A;  3JSP A;  1ON1 A;  1YE9 A;  3TQN A;  5DM7 F;  4YG2 F;  5J1Y A;  3HOX J;  1HLV A;  1K6O A;  1BR1 A;  1QZY A;  1V4R A;  2E34 A;  1Z3Y A;  1XX5 A;  5LHH A;  2G0E A;  2CW8 A;  1DP7 P;  4KNY A;  1SFU A;  4LLL A;  2ISZ A;  1IN5 A;  2W82 A;  1TWC J;  1WI9 A;  1G6N A;  2MAB A;  5JLX A;  1GUU A;  3F8B A;  2P6S A;  3SHF A;  5FLM J;  2XDV A;  4HDV A;  4E7Z A;  3QP5 A;  2VXZ A;  3GLL A;  3HKZ A;  2XAH A;  2R7F A;  4CYD A;  5E20 A;  3HPG A;  3BG9 A;  2XAG A;  3FMR A;  3V7C A;  4ASN A;  2HI3 A;  1N77 A;  4MLO A;  3BJA A;  3IH4 A;  4BE2 A;  2CQK A;  2DO7 A;  4AVP A;  4XKV A;  2A05 A;  4I09 A;  4Y33 A;  4XLF A;  3ZQL A;  1YJ9 I;  4HX4 A;  3HSE A;  1ZGA A;  1VQL I;  2DK5 A;  1IUF A;  4IKF A;  2NOJ B;  4RS8 A;  3KEO A;  3WG9 A;  3IP4 B;  3F23 A;  1K61 A;  1REP C;  3G4S I;  4E7S A;  3LMM A;  1LVA A;  3PNT A;  1PUF A;  5CVJ A;  4G12 A;  4M3E A;  4RLF A;  3F8M A;  4HW0 A;  3CLQ A;  2IP2 A;  5FFX A;  4LLN A;  3DTK A;  1MBF A;  1WVR A;  2M8E A;  3MWM A;  5GAD J;  2IEK A;  4MFE A;  3H5N A;  2I10 A;  4A6D A;  2BXZ A;  4HF1 A;  2LKX A;  2COM A;  2LLK A;  3CP8 A;  5E18 F;  4N0B A;  3EQL F;  3ZQ7 A;  4NQW A;  1XCB A;  2E5N A;  3S17 J;  2H6B A;  1JKO C;  2XPW A;  2C6Y A;  4FTH A;  1J2X A;  1GXQ A;  3QOE A;  5BPD A;  4AM3 A;  1Z7U A;  2DT5 A;  2ZJ2 A;  3WU2 C;  4Y4R A;  1KU9 A;  1T39 A;  5IOZ A;  2MW8 A;  4HG2 A;  1I3A A;  4DW6 A;  2EJR A;  1T0F C;  2AQF A;  3HPH A;  3CCJ I;  1L3L A;  4OWR B;  1LFU P;  4MEY F;  1EH7 A;  2KPM A;  4EM0 B;  5M5W J;  2DFH A;  3S1M J;  3KP6 A;  3FXQ A;  2L0K A;  3J81 K;  2QLZ A;  4BE0 A;  1XGO A;  2JSP A;  3LA3 A;  1XGS A;  2L4M A;  4LD5 A;  1MSE C;  3A0H C;  3S1Q J;  3LWF A;  4MQ9 F;  5F0C A;  4V2F A;  1HKS A;  1GV2 A;  2HTS A;  4GYI A;  3OYC A;  5E1W A;  5D4R A;  1XG1 A;  3K4J A;  4Q48 A;  2PG4 A;  4NNJ A;  5FO5 A;  2Y0S A;  4N9I A;  4C2T A;  4JBA A;  1UB9 A;  2HDW A;  4PDK A;  4PFO A;  2HFH A;  1E0E A;  1MBK A;  5E8G A;  1ZLK A;  2QM3 A;  2Z16 A;  3GFL A;  4F91 B;  5HOO A;  2ZJQ F;  4HEA 2;  1X3W B;  4IVN A;  2LRD A;  3KYL A;  4Y52 J;  1S3J A;  2DI3 A;  1QPM A;  2Y30 A;  2VQH A;  2K3P A;  1SD7 A;  1BL0 A;  4GO1 A;  4XKB A;  1IN8 A;  3AKZ A;  1FC3 A;  4XNF A;  1XDU A;  3DKX A;  2YX4 A;  5JHU A;  3TKY A;  1SD6 A;  3KLN A;  2W25 A;  1R23 A;  1P4W A;  4A0Y A;  3M9A A;  1H88 C;  5DEQ A;  2OTJ I;  2DQL A;  2YX7 A;  2CQN A;  2IGO A;  4G9Y A;  4WXH A;  3OYA A;  3CCY A;  5ERI A;  3JSO A;  1D1B A;  4M6X A;  3L2R A;  2ID6 A;  1KYZ A;  2K9N A;  1Z77 A;  5IYB J;  4BY1 J;  1Z05 A;  3CDH A;  2FJ1 A;  3I56 I;  2HTJ A;  3E6D A;  5HOD A;  1WGX A;  2DJN A;  3H3U A;  4XRS A;  4DGW B;  3MEX A;  1RUO A;  1P92 A;  1APL C;  1F5T A;  3V4G A;  4PGG A;  4XM3 A;  2W57 A;  1HBX G;  4XSX F;  4C30 A;  3CZ6 A;  3OL3 A;  3SEZ A;  4EGY A;  3ZQI A;  2TRT A;  3KPH A;  2JA6 J;  5LBQ A;  1TNT A;  4BAC A;  1RZ4 A;  3BJ6 A;  4RLQ A;  2L7K A;  1MMA A;  2PN6 A;  2B7E A;  2NXN B;  3LQQ A;  1ZK8 A;  2Z9O A;  1FOY A;  1XB4 A;  5ILV A;  4EQQ A;  2IGN A;  1U6G A;  5FLX K;  4MGR A;  4A3M J;  3G1M A;  3GTQ J;  1I1G A;  3VWB A;  3H5R A;  3GZN B;  3FHN A;  4XQF A;  4A3K J;  4CUG A;  3PIO F;  2FF4 A;  4DZJ A;  1ZR2 A;  1FOK A;  3DEE A;  3FIS A;  2CU7 A;  5DV5 A;  1SAU A;  2XRN A;  2QEX I;  2Q0O A;  3VDX A;  3HIF A;  4BEH B;  3E5X A;  3K1N A;  1S72 I;  4XRM A;  1V5E A;  1K79 A;  3N4M A;  1KU7 A;  1ACI A;  4A3G J;  2GIV A;  2KHM A;  1EKE A;  2NVT J;  4EJO A;  1FSE A;  3KEQ A;  1TBX A;  2CV0 A;  2DOF A;  2O8X A;  4FX4 A;  5JVG F;  4BXF A;  2DA1 A;  1ETV A;  2E1M C;  4AYB N;  1OR7 C;  1J09 A;  3SZG A;  4FCY A;  2A6E F;  3QOD A;  2RC4 A;  4HST A;  4UB8 C;  1P2F A;  2X1C A;  5AON A;  3OY9 A;  2JQ7 A;  1YW8 A;  2STW A;  1SFE A;  4LG0 B;  1WFX A;  2EIJ H;  1UHM A;  2AQE A;  2K85 A;  2CWE A;  3PSI A;  2ICW G;  1VF9 A;  2UXN A;  2Y9Y A;  1ON2 A;  3OR1 C;  1IXS B;  5K5R A;  1XN7 A;  3BJO A;  1D8J A;  2NS7 A;  3D5S C;  3NEU A;  2DN0 A;  2OU2 A;  2VBW A;  4BYY A;  5FB2 A;  3LSM A;  5JI6 A;  2FMY A;  3R61 A;  1LDJ A;  1YRN A;  2FX0 A;  2FU4 A;  1BOA A;  2V1D A;  2JZY A;  1TWH J;  3IRR A;  4NQW B;  5M3M J;  3LL7 A;  2XSJ C;  3HB9 A;  3LFU A;  1HA8 A;  2Z3Y A;  2A6H F;  3FIW A;  2R7D A;  1X3Z B;  3CUO A;  2DMN A;  4DJA A;  3CJN A;  4LB6 B;  1U8R A;  2WV1 A;  4DBR A;  2DPD A;  4MFD A;  2QSG X;  1X1A A;  1XS9 A;  3CCV I;  2BGC A;  5F0F A;  1IN4 A;  5FKK A;  4CHU A;  3DFG A;  1HW2 A;  1SFO J;  2V7F A;  1D5V A;  5FLX Z;  3IKT A;  1WH5 A;  1IG7 A;  2EZH A;  3CJT B;  2XV4 S;  4W97 A;  4Y15 A;  4YEJ A;  4MQV A;  5J1R A;  2CUZ A;  1BW6 A;  3J80 K;  2F5E A;  3T8R A;  4XOR A;  2WB1 N;  5F6F A;  5LEJ A;  3B6A A;  5LGT A;  4LB5 A;  3K70 C;  4IX7 A;  3FHZ A;  2TDX A;  2W1O A;  4X6A J;  4LLG F;  1LB2 A;  2WAE A;  4BHP A;  4BNC A;  3JRB A;  1FP2 A;  2IT0 A;  1VQ6 I;  5D5X B;  5HLT A;  2JUG A;  3SDB A;  3X2Q H;  3OYL A;  5CQG A;  2JJ7 A;  2RGV A;  1GDT A;  3V8L A;  3T0Y A;  1A5J A;  1AOY A;  4IZZ A;  2ZXJ A;  3EPZ A;  3L1P A;  2Q1Z B;  1C0W A;  3OMY A;  1U5T C;  1PP8 F;  1ZLJ A;  3BCA A;  3EUK L;  3PO2 J;  3M8J A;  1NK3 P;  5CKT A;  3S2W A;  2E1M B;  5LRS A;  4KFC A;  4L9T A;  1BJA A;  3GFM A;  2KQR A;  5L3G A;  5J4Y A;  1T8I A;  2QSH X;  4B47 A;  2VLA A;  5FRN A;  4Z2Y A;  4XL9 A;  1AHD P;  4NHJ A;  1HDP A;  3V7R A;  1QHG A;  2IGK A;  2X48 A;  3K4B A;  1JUM A;  2X6O A;  4U0V A;  1NK2 P;  3DU6 A;  3PSF A;  2ECC A;  1J7K A;  4GGG A;  5H6R A;  4AIH A;  2L01 A;  3VFZ A;  2ZCW A;  1IUY A;  3DLA A;  2HXI A;  3EDP A;  2VAS A;  5B1B H;  2XGC A;  5J3L A;  1FTT A;  2JUC A;  4BAY A;  3HJE A;  1XTA A;  2RVC A;  1IXR C;  3L2C A;  1GVJ A;  3QYF A;  1ZR4 A;  1MIJ A;  1BOB A;  4II2 A;  1TQM A;  4NC6 A;  3FMS A;  2EFO A;  1YYV A;  5GAH J;  1IF1 A;  1IZ1 A;  4QLC U;  5LHG A;  3SJM A;  1FIA A;  2IS1 A;  5B5E C;  2LY1 A;  4XLE A;  1PYV A;  4IO9 F;  2CH0 A;  4F92 B;  4Y13 A;  3KZY A;  3AFH A;  3DTE A;  4CSW A;  4PCQ A;  3TDZ C;  2VIX A;  1WRJ A;  2CQQ A;  3BDD A;  2R5Y B;  3I0T A;  5IYD J;  2NVU B;  4D1Q A;  1JKQ C;  1VQ8 I;  1LKX A;  3K4K A;  2EPF A;  4EMS A;  2K9S A;  1UFM A;  4BJ6 C;  1YFH A;  1ZQ3 P;  1BI3 A;  2EFN A;  2R5Z B;  4G8X A;  4XIC A;  2XAF A;  2K7L A;  3G6E I;  2VON A;  3DPU A;  1X2M A;  2JMW A;  1XPX A;  1DU6 A;  5FJ8 J;  3Q5F A;  1JKR C;  1E3H A;  2XC7 A;  2F5C A;  1NG6 A;  2K02 A;  2LNB A;  1MNM C;  2H8R A;  2OZU A;  3BZK A;  3EYY A;  4ESF A;  3JRD A;  1R5H A;  3MZH A;  2MLK A;  1LPQ A;  2H1K A;  1EH8 A;  1T98 A;  4OAY A;  2DU9 A;  4ZDP A;  1D0Z A;  1A36 A;  1R7J A;  1JT6 A;  1YHQ I;  2QKM B;  3D0S A;  3RYR A;  5EEA A;  3ZMD A;  1FJL A;  2ETH A;  4IQ4 A;  1QPI A;  2M5W A;  3U1K A;  4ZYD A;  1S5L C;  2X9D A;  4PFP A;  3ZMT A;  2EZK A;  5EG0 B;  1IN7 A;  2KZV A;  5EDN A;  3VYR B;  2NS0 A;  1AU7 A;  3KYD B;  2LOO A;  2ZXH A;  3QYE A;  3DLL F;  3I53 A;  1FY7 A;  1OIS A;  2M2E A;  3U9G A;  1RKW A;  2RQP A;  3HYI A;  4NBQ A;  2X1E A;  4B3A A;  2DYS H;  4NC7 A;  2PJR B;  2R7R A;  3LSP A;  4CDG A;  3D5R C;  3HRU A;  3F8F A;  1W1W E;  3ABT A;  1B9M A;  4V19 K;  3WHB A;  1PVE A;  2R92 J;  4B1R A;  2L9V A;  2V1N A;  2RRE A;  5J4V A;  3VYS B;  1CGP A;  5CVI A;  2IW5 A;  5KCM A;  2HOS A;  4BXU A;  2ZJP F;  1X3U A;  2M45 A;  2Y31 A;  4WX9 A;  2IRF G;  1DUX C;  1YW7 A;  4U0Y A;  4HSR A;  4IOA F;  3HXL A;  3IUO A;  3BTL A;  1MMD A;  2IS6 A;  3JRC A;  3JRI A;  4J01 A;  1LEB A;  2ZFU A;  3OR2 C;  2BOL A;  1FYL A;  2DT6 A;  3K2A A;  2EIM H;  3ML6 A;  4G6D A;  1VQ5 I;  3A03 A;  3C2H A;  2XGE A;  1XCV A;  5E3N A;  1LE8 A;  3K1P A;  2MA3 A;  2EA4 A;  5JR3 A;  2Y2Z A;  1Z3X A;  3FXO A;  1WJB A;  2KIM A;  6PAX A;  3UR3 C;  4XLP F;  1U78 A;  4DBQ A;  3TO6 A;  3K70 D;  1FIP A;  3FXK A;  1JKP C;  5EG0 A;  2L9N A;  4RAF A;  2YU9 J;  3ZMU A;  1F9N A;  5IYC J;  4XOP A;  2VKD A;  2OC6 A;  2GWR A;  1T95 A;  3ZCO A;  1K4T A;  1G3T A;  4CZC A;  3DTI A;  1R49 A;  1YRN B;  3OYB A;  3GXO A;  2KJC A;  4E6K G;  3C3W A;  4YRV A;  3SQN A;  5HLH A;  5E3O A;  2LP0 A;  4X1E A;  1IAW A;  2FRH A;  3KEY A;  4B48 A;  4IHS A;  2GXA A;  4HLX A;  1T33 A;  3WTT C;  1QGP A;  2UUZ A;  3HRM A;  4CCL A;  4BDY A;  3CQZ J;  5L3E A;  5ED4 A;  3P5J A;  3DEU A;  2HR3 A;  5DUK A;  2ZFW A;  1ZTR A;  1LVK A;  3BTI A;  4Q5S F;  1B4A A;  2PMZ N;  1FMV A;  4M71 A;  1G59 A;  4L0Y B;  4PSX A;  5KAI C;  3RCO A;  4P9F A;  4F52 A;  2K9Q A;  2OQR A;  1GHC A;  1MKM A;  2OAZ A;  3OV8 A;  4NDL A;  2VBZ A;  1ZGW A;  2JVG A;  2Y75 A;  5JLW A;  1JUS A;  2HVR A;  1LEA A;  1G3Y A;  4G6T B;  1WSU A;  5HDK A;  2MBF A;  4XBF A;  3JAM Z;  1P4A A;  4M9X A;  1UMQ A;  2DAO A;  1V5F A;  1RKT A;  2O03 A;  3GTL J;  2WA0 A;  2WC2 A;  1XSD A;  4M3G A;  2VJ5 A;  1XSX A;  3ZP5 A;  2GM4 A;  2VOP A;  1TP4 A;  5JHF A;  3JTG A;  1MMS A;  3WG7 H;  2DLL A;  4HF0 A;  5LGN A;  3RTR A;  1GLN A;  1UG2 A;  2ME6 A;  2ELK A;  4XN0 A;  2LY2 A;  2W7N A;  3S2D J;  3DEW A;  4BS9 A;  1BR2 A;  3O6B B;  1YOV B;  4CCJ A;  3MKY B;  2G7U A;  4OAZ A;  1IRX A;  2K4B A;  3REO A;  3VEP A;  2LR8 A;  3TMO A;  2IGM A;  4OOI A;  3LSK A;  4BL0 B;  1O4X A;  2GOM A;  4XRF A;  3I4P A;  1B72 B;  1E3P A;  1BA5 A;  3D5L A;  3T1B A;  5CJ9 A;  5F0H A;  1LDD A;  3V8J A;  2M9H A;  4OIR F;  1P6R A;  2P8T A;  4ZDL A;  3BPV A;  5HLI A;  4DQ2 A;  1HF0 A;  4RBO A;  1FEX A;  5A2Q K;  2HQ5 A;  3KX2 A;  1U0J A;  3ROU A;  3HL2 A;  2XIG A;  4EM1 A;  4W1U A;  4ZZL A;  2X85 A;  2L7F P;  2BY0 A;  3PO3 J;  2YU3 A;  5KHD A;  1Y8R B;  2R5Z A;  2BVL A;  2ZNZ A;  2XAS A;  4ZJZ A;  3B6C A;  4CCN A;  1Z6T A;  3M8F A;  3TP3 A;  4DYR A;  2VN2 A;  1X1D A;  1Y1V J;  1G3W A;  2DA5 A;  3OOU A;  4C3H J;  2HNH A;  2XF5 A;  5L3D A;  2LBF A;  4YFK F;  3KFW X;  2X6Y A;  2NYX A;  2G9W A;  3L2V A;  5IP7 J;  5H2F C;  2Y69 H;  3BTC A;  4CIC A;  4D5F A;  5A2Q Z;  1NTC A;  2YR2 A;  2IA2 A;  1HXD A;  2QQA A;  4RAY A;  1MH4 A;  3O8G A;  3I3L A;  4KDP A;  3E6B A;  4IHX A;  2XKP A;  2M87 A;  2L2O A;  3I64 A;  2NVY J;  4UNO A;  3RPU D;  2F4O B;  2QCO A;  4AVZ A;  3IH2 A;  2EFP A;  1USS A;  3R4K A;  2CV2 A;  2E19 A;  4MHG A;  4HLY A;  2DFF A;  2FQ3 A;  4CGZ A;  3KP7 A;  3SXY A;  1B59 A;  2JRT A;  4OMZ A;  3P9C A;  1ZG5 A;  2AXL A;  3FXL A;  3BY6 A;  3W2W A;  1W7P D;  2EB7 A;  2H09 A;  2FQ4 A;  2OCC H;  3LQR A;  2M34 A;  3A01 B;  4PJL A;  1QVU A;  3CDL A;  1BIB A;  1LNW A;  2DA3 A;  2MG4 A;  2VQC A;  1QQI A;  4S0H B;  4GYG A;  2IS2 A;  5AIP A;  3U21 A;  1F36 A;  1MDM B;  1BM9 A;  1IGN A;  3RZO J;  5FKO A;  2R93 J;  4EJW A;  5J47 A;  2XGX A;  1FWZ A;  3ZQF A;  4MNU A;  1AA7 A;  4EAT A;  5GAE J;  4UUV A;  1QRY A;  3A4C A;  1FPQ A;  3HOS A;  1ETQ A;  4YFN F;  1K4S A;  4FHT A;  2A5W A;  3M7G A;  2DW4 A;  4NC8 A;  1WJ5 A;  2ZXW H;  1D0X A;  4F3Q A;  4UV8 A;  2E7W A;  3J7A Y;  1V55 H;  5LEK A;  1X19 A;  2NOG A;  2LYC A;  3K7A J;  1H9T A;  3F22 A;  4RAZ A;  4AYB A;  4CCO A;  1D5Y A;  1W5C C;  4HV5 A;  3E6M A;  1YIJ I;  1U3E M;  4RB3 C;  2KMU A;  2OUM A;  3JRF A;  5F1R A;  1QZZ A;  5FLV A;  1N78 A;  5CVU A;  4ZYG A;  3CMA I;  1WCM J;  2FD5 A;  4X0G A;  1B8I A;  3R6S A;  3S3M A;  5M5X J;  1S7A A;  4CZZ A;  4KN4 X;  5DM6 F;  2VOD A;  1V54 H;  3HEF A;  5E3L A;  4C3I J;  3KP2 A;  1JUP A;  3UKG A;  3C2G A;  1OPC A;  3B73 A;  2Y0M A;  2R7Q A;  1I27 A;  4E70 A;  1K83 J;  3WOD F;  1SC7 A;  4OMY A;  2VQG A;  3H92 A;  2JK3 A;  3BZC A;  1KGS A;  5F1J A;  3MQ0 A;  1D8K A;  3BP8 A;  4YII A;  2HU9 A;  3AAF A;  4LIV A;  5BQT A;  2HGC A;  2DA2 A;  2QQ8 A;  3N05 A;  4PK4 A;  2O6G E;  4M72 A;  2VE8 A;  4EEF G;  2YUS A;  2OA4 A;  1WHU A;  3W2A A;  4WK8 F;  1A6Q A;  3DKW A;  1IRZ A;  2GQQ A;  3DQV C;  2RKH A;  5CVR A;  1W36 C;  1BC7 C;  2DBB A;  3ELK A;  1SMT A;  5M5Y J;  1O3Q A;  1T2K A;  4OIQ F;  2FML A;  1Z0X A;  1V5G A;  3C2B A;  1TWF J;  2D1V A;  2VB6 A;  3ESW B;  1R22 A;  3MZY A;  2P5L C;  3HSF A;  4RM2 A;  1R4N B;  2L5Q A;  1Z91 A;  1HST A;  4L9J A;  3ZPL A;  2MC3 A;  1Q1V A;  4IEJ A;  1BW5 A;  2ZJR F;  4KIG A;  2HOA A;  5C3E J;  1UAA A;  3TGN A;  4PUS A;  2P5K A;  3ERE D;  3G2B A;  3P9I A;  3P7N A;  4L5J A;  5D5V B;  2BW3 A;  2L9S A;  3K0L A;  3OSF A;  3OL4 A;  1YIT I;  2FE3 A;  4IRG A;  5KNL A;  3HM5 A;  2HKO A;  2KDO A;  2M8G X;  2OF7 A;  2VKH A;  2HVS A;  2F48 A;  2DA4 A;  3PL8 A;  4M9S A;  2CMP A;  1FTZ A;  1YW9 A;  3TOB A;  3OYM A;  1SD4 A;  2H94 A;  2L4A A;  2P5V A;  1FBS A;  2RQQ A;  5FKM A;  4RB2 C;  3T5X A;  1OYI A;  1MND A;  2EV0 A;  2XAJ A;  5KVR A;  2VT2 A;  4ENK A;  4L9V A;  1W36 D;  3Q0V A;  2L9R A;  3BLY A;  4RGR A;  5ICE A;  1B6A A;  3IH3 A;  3H3V K;  1SEU A;  4DYQ A;  5CVV A;  2V6C A;  3HUG A;  2LRE A;  2ZO4 A;  2F5V A;  2DTR A;  2HQA A;  4UVA A;  3L2W A;  2PMZ A;  2MH9 A;  3I54 A;  4E4H A;  3O2P E;  2D2W A;  5GAG J;  1K78 B;  3KLO A;  3VYU B;  1WQ2 A;  1LDK B;  3PUF A;  4M74 A;  3M3Y J;  1QO0 D;  4HX7 A;  2Z1D A;  3H9Q A;  2KLO A;  3VSK A;  3GTG J;  1FYM A;  2BBY A;  3WGG A;  2GA2 A;  2JA5 J;  2VOO A;  4BJ5 C;  3KET A;  1R71 A;  3BC8 A;  1MBG A;  1HQC A;  1HKQ A;  3HZJ A;  1ORK A;  1BBY A;  2LH9 A;  1BN5 A;  2M7A A;  3E3V A;  4C2U A;  4CA0 A;  1XGN A;  1OFC X;  5TGT A;  3BR1 A;  1BC8 C;  2F5F A;  5H6Q A;  3W6V A;  3KIO A;  4ZDO A;  3ZR8 X;  3KE2 A;  1TQI A;  3RQI A;  3PNV A;  4LJZ F;  4G7H F;  4M6Y A;  4HPQ A;  1MJA A;  2YS9 A;  3FZV A;  5BMZ A;  5J8F A;  4E7L A;  3A02 A;  4A3F J;  2HXO A;  3R0A A;  1ZG1 A;  1RR7 A;  2ADU A;  3BOQ A;  2E7X A;  3BR6 A;  1NHA A;  1IC8 A;  1OKR A;  4RGX A;  2W4S A;  2JA7 J;  1UHS A;  2HZD A;  2RV8 A;  1EH6 A;  1O3S A;  1U5T B;  4ON0 A;  2CFX A;  4LIU A;  2LG4 A;  3RPU A;  3GTJ J;  4OIO F;  4Z6Y A;  2LKP A;  3FBI B;  3CC7 I;  4LOC A;  2BEO A;  3CO7 C;  4ZTF A;  4BU2 A;  1HKT A;  3GWZ A;  3TL4 X;  4HNT A;  3HRT A;  3L2Q A;  3NWT A;  5IT9 Z;  1TWG J;  4AIJ A;  3K4M A;  1R4M B;  2LF8 A;  1HDD C;  3WTW C;  5ICC A;  2W00 A;  3LA2 A;  2ELH A;  4EV0 A;  4P55 A;  2DOE A;  1Z67 A;  3RQ4 A;  2Z5U A;  3PIP F;  1DU0 A;  1DP3 A;  3NAR A;  4HBL A;  5E8I A;  4WXC A;  1UST A;  3L7W A;  1SAN A;  2PQ8 A;  3AG4 H;  5HS8 A;  1F4K A;  2JPC A;  3KZZ A;  4HQE A;  2Y9Z A;  2CUJ A;  3G1L A;  3HOU J;  4BBS J;  3WGI A;  3KCC A;  4CO8 A;  2RAE A;  1QA6 A;  4M3B A;  5D8K B;  5HDG A;  3GFI A;  1FLI A;  1R5I D;  1X4O A;  5FKN A;  4BY7 J;  2IPQ X;  5EZG A;  1R00 A;  4AD9 A;  2A69 F;  4B4C A;  3ISP A;  4XLN F;  2DA6 A;  4I6Z A;  3AL0 B;  2ZB9 A;  3DU5 A;  3LSG A;  5BNG A;  4S05 A;  4XK4 A;  4WCG A;  1KA8 A;  4BE1 A;  1TWA J;  3IKV A;  5FRO A;  3C7J A;  3H1C A;  5CLS A;  3LAP A;  4A93 J;  2QVO A;  2IA1 A;  3JTH A;  4U7D A;  5E79 C;  1ZGJ A;  3JRG A;  1U9N A;  3D1N I;  3ASN H;  4HV6 A;  4UVC A;  2E2I J;  4AUX A;  2HDD A;  1UCR A;  1Z21 A;  3JW4 A;  2MYS A;  1JJ8 C;  3CMM A;  3SZT A;  1OCP A;  1FZP B;  1I6H J;  3E5U A;  2QQ9 A;  3QRF F;  3H0G J;  1VZ0 A;  3Q0U A;  3HRS A;  3TED A;  1ETO A;  1S7O A;  3H9G A;  1VFC A;  3JRH A;  1ZN2 A;  3ZXS A;  1DPU A;  2AHQ A;  4A2U A;  2OV7 A;  1JGG A;  4E7J A;  2DMT A;  1B8I B;  2GIZ A;  4R1H A;  5DCF A;  3I4M J;  1E2X A;  5DCM A;  2V9V A;  1QZE A;  1G2H A;  5D4S A;  1ETK A;  3CJR B;  4J19 A;  4CCK A;  4U88 A;  2M7B A;  2PI0 A;  1R1V A;  3RPQ A;  2NNY A;  2M0C A;  1MMN A;  5EGO A;  2ZSI B;  4IHW A;  5HDN A;  2FSW A;  2DMP A;  4IOC F;  2FNA A;  2A6T A;  4L18 B;  1I3Q J;  9ANT A;  3T8T A;  2WY7 Q;  3GYH X;  2DDB A;  2LK2 A;  3S93 A;  1WI3 A;  2IXS A;  1WZ2 A;  5EJC A;  3E97 A;  1POG A;  4I2O A;  1CQT A;  4BJT A;  4H0E A;  4XSZ F;  1FSH A;  2WBM A;  2UV1 A;  1BIA A;  2HWV A;  1YO5 C;  3J80 Z;  1S7E A;  3E5Q A;  2XRO A;  2JVH A;  5JVT A;  4IQJ A;  4NB5 A;  4ENN A;  2G7H A;  1X1C A;  1ZAO A;  1JT0 A;  5C4X J;  4LFU A;  4HF2 A;  3HOV J;  4C3J J;  3A01 A;  4LG0 A;  3LSJ A;  4LIT A;  5IP6 A;  4RDU A;  2R7X A;  4M3D A;  2X51 A;  3S16 J;  4A3B J;  4KT6 A;  3FK7 A;  1XMA A;  2D5V A;  2PFB A;  4L9N A;  3VB2 A;  2RDP A;  3VPR A;  4FQG A;  3I5U A;  1XGM A;  3PQJ A;  3RKW A;  2K27 A;  4U7B A;  4KA4 A;  1CF7 A;  2MLG A;  5GTI C;  3H36 A;  1RUN A;  5CQE A;  1IV8 A;  2GA1 A;  1X1P A;  2UXX A;  3KP3 A;  1ETY A;  2O5R A;  4A3C J;  3QU6 A;  3M4O J;  3EUA A;  1Y8Q B;  2E5Z A;  2WWY A;  2I8D A;  5GP9 A;  2VJ4 A;  3ZQC A;  1OMI A;  5ILS A;  1I39 A;  2EQR A;  3FBN B;  1RNL A;  3CCR I;  1H0M A;  1J9I A;  2HKX A;  3FX3 A;  2MC4 A;  4UXN A;  3C1D A;  1K7A A;  2CFO A;  1FP1 D;  2BE5 F;  2DCE A;  4B44 A;  2H1L A;  3DV8 A;  1GV5 A;  4A12 A;  4WXD A;  3NRV A;  5BS6 A;  4I99 C;  2FUG 2;  4U87 A;  2STT A;  3OYG A;  3OS0 A;  4QWQ A;  1W5T A;  5LFA A;  5TIS C;  2GXG A;  3I4N J;  2VJI A;  1M1E B;  3J7Y J;  3VOD A;  5CPR B;  2DFE A;  1R6R A;  2EV5 A;  2LBF B;  1B72 A;  5F64 A;  3DPT A;  2MD0 A;  1PUF B;  4DIQ A;  1JTX A;  3GTM J;  3W2V A;  3AG2 H;  3BG3 A;  2LVS A;  4M6V A;  5FGM A;  2CJJ A;  1VQ9 I;  3HDD A;  1PP7 U;  4IXA A;  4XLC A;  3TO9 A;  2BXY A;  4ENJ A;  2QWW A;  2YPR A;  5IPA A;  1RRJ A;  2HPM A;  4GFB A;  3TW7 A;  3ZMZ A;  5HNH A;  5FD5 A;  2NVQ J;  4XOT A;  2KIF A;  3BR5 A;  3BR3 A;  2BVM A;  3HHG A;  2A61 A;  3PQK A;  1ZYR F;  2AO9 A;  4JK1 X;  2TCT A;  1EV7 A;  1H89 C;  1D3Y A;  3TW6 A;  5HS7 A;  5L3F A;  4KMF A;  2NRA C;  3G73 A;  2E1O A;  1UJ8 A;  1SFX A;  2XF7 A;  2DJI A;  1KZH A;  2O61 A;  3I59 A;  4UY8 I;  5HNF A;  2Y0S N;  4KYW A;  4I0B A;  3HC7 A;  1XSV A;  1P7I A;  5LLQ A;  4KMU X;  3K4L A;  5EEG A;  1SD5 A;  2KL4 A;  1MDM A;  1Y0N A;  2VJJ A;  2KIS A;  3O8H A;  3RYP A;  1TNS A;  2K9L A;  2HQR A;  4HDU A;  2O8K A;  3COA C;  2HYJ A;  2R7O A;  4JX6 A;  2J5O A;  3WE3 A;  2KJB A;  2YSR A;  5J1U A;  3S14 J;  3ABM H;  1W7P B;  1A04 A;  1DPR A;  1LUJ B;  2DOD A;  3QYB A;  3SFZ A;  1RC9 A;  3ONQ A;  4RAG A;  2KIU A;  4JOM A;  3S1N J;  3U2R A;  3CTA A;  3CP2 A;  5IOY A;  3SFI A;  1MNE A;  1S8N A;  1DQU A;  4M3F A;  4PJ0 C;  3CD6 I;  1JGS A;  2F6C A;  3P9K A;  2FBI A;  4Y3O A;  1VQK I;  2XGD A;  4AIK A;  1B1B A;  4A3J J;  2VPR A;  4G7Z F;  1VND A;  4XLH A;  4XKW A;  1MW7 A;  2FOK A;  2ZSH B;  2Z33 A;  3ZQG A;  2EIK H;  1ZAR A;  2BW3 B;  3ABU A;  3BCB A;  2EZI A;  4H4K C;  4BHB A;  2XVC A;  3R60 A;  5E1Z B;  4ZTJ A;  4AID A;  2QUF A;  2A5Y B;  2P0W A;  3OS2 A;  3BRO A;  2OJE D;  4A3L J;  2EH3 A;  3F8N A;  2X0L A;  3DP7 A;  4ZC3 A;  2M30 A;  3VSL A;  5J8C A;  1J75 A;  2PEX A;  3EUH A;  2MGQ A;  1VQN I;  4WWC A;  1FOX A;  4RGU A;  3W6K B;  4P9U A;  2VC1 A;  1YS6 A;  2V6E A;  4FE7 A;  2KIQ A;  3PM1 A;  5D6F A;  4E7I A;  1U9O A;  3K4C A;  2QBY B;  2EIN H;  1W4M A;  3IAS 2;  4BUP A;  4I7H A;  5EF6 A;  1J59 A;  3QOP A;  4B43 A;  1I5Z A;  2FBK A;  2ESH A;  2V9K A;  2ZME A;  3GZ6 A;  2R7S A;  2GLO A;  1A6I A;  3F6O A;  1SMY F;  3TP0 A;  4AWX B;  5IY5 H;  2E2J J;  2XUB A;  4ITV A;  4LK0 F;  2VQL A;  4N4O B;  3FDY A;  3B02 A;  2A68 F;  2VXD A;  3FF5 A;  3Q9V A;  2RN7 A;  4GCV A;  5L3C A;  2COB A;  4IJA A;  1IDZ A;  3BWG A;  3MZ8 A;  4Y7N J;  4A3D J;  4A0Z A;  3MMY B;  1F43 A;  2WV0 A;  4EVI A;  4I01 A;  5E1X A;  4C9Y A;  2VT3 A;  5C44 J;  2VL8 A;  3E6C C;  1R1T A;  3RKY A;  3OWT A;  1G8X A;  4HNV A;  1SVM A;  3IC7 A;  3OYK A;  3WE2 A;  2H6C A;  3QU3 A;  4HYE A;  1T56 A;  1U5T A;  4A5M A;  2AS5 F;  1OR7 A;  5LRR A;  3K9T A;  3QP6 A;  1YX3 A;  4EJV A;  2CRG A;  2ELJ A;  2BHZ A;  1FBU A;  3IAM 2;  2JRM A;  1ZH5 A;  1LQ1 A;  1MGT A;  2M3A A;  5AIQ A;  3JRA A;  2ISY A;  1BI1 A;  1FBQ A;  3RZD J;  1U8B A;  5DD4 A;  4BQQ A;  4ANJ A;  1IN6 A;  1Y1W J;  4HRI A;  1FMW A;  4IRI A;  2P4W A;  4ABZ A;  2GAU A;  2KP6 A;  2QA4 I;  2K5C A;  2AXT C;  2OTL I;  2JA8 J;  2BHY A;  4HAM A;  1D1C A;  1W5S A;  2P81 A;  3F3X A;  2NVX J;  3K10 A;  1ULY A;  1YS7 A;  1DDN A;  3IL2 A;  1AKH B;  1RET A;  3HKZ N;  2K4J A;  4B3X A;  3BPX A;  2MFZ A;  2V1U A;  3ZMV A;  4A5N A;  5LGU A;  3K69 A;  2CS3 A;  3OS1 A;  1YI2 I;  2DOA A;  3RDI A;  2BY3 A;  1GVD A;  2LFB A;  1ENH A;  4MIM A;  4YFX F;  1S29 A;  3ZQH A;  2HQN A;  1I50 J;  3OYD A;  3I58 A;  3LST A;  1YX5 A;  2FEZ A;  1WH7 A;  1RIO H;  3J7A O;  5EGO B;  1O3R A;  1ZRE A;  3HUG B;  3BG6 A;  4E7K A;  1N75 A;  3L00 A;  3H0D A;  2PBI A;  1VQ4 I;  3TBI A;  2R7Z J;  4A6E A;  4GDF A;  3OSG A;  4O6J A;  2EWN A;  1LE8 B;  3GFJ A;  3DBL B;  4HA8 A;  5F04 A;  1OCZ H;  3OOP A;  4RB0 A;  2VUM J;  1QHH D;  1Y39 A;  4KIB A;  4ZZD A;  3HOT A;  4BBR J;  4XLA A;  4F55 A;  2R3S A;  3BT9 A;  1MJ9 A;  3MCZ A;  3GVA A;  2K40 A;  2XB0 X;  2MH2 A;  1VQM I;  4M9Z A;  2BZT A;  2B0L A;  5EYR A;  2FBH A;  2DMQ A;  2WTE A;  4YIF A;  4UUT A;  5FKL A;  2DPU A;  3V8K A;  1W7P A;  3BQY A;  3DBR B;  5DD8 A;  4I98 B;  1W0U A;  1TQP A;  3GEZ A;  3DPL C;  3HTU A;  2PLY A;  1R5G A;  2CQX A;  5DYM A;  2LF7 A;  3GCM A;  2A3S A;  4IHV A;  2WAF A;  3WU0 A;  3DF8 A;  4CH7 A;  4MEX F;  4IF4 A;  2VBX A;  1GXP A;  3GZ5 A;  1VTN C;  3IV5 A;  1Z7L A;  2GXB A;  3TOA A;  4BKX A;  1IDY A;  3Q3S A;  5DDG A;  2IA0 A;  1WPK A;  3OYE A;  1TW2 A;  5M3F J;  4I0A A;  3RSN A;  3FXM A;  4HNU A;  2ECB A;  5JFR A;  4OIN F;  3RJP A;  2PJR A;  2ESN A;  3MN2 A;  2HS5 A;  3FXR A;  5HVQ C;  5F08 A;  4B8X A;  2O0Y A;  3CCU I;  2L54 A;  2EK5 A;  1XMK A;  5ICF A;  3ECO A;  4A69 C;  3CMY A;  3A0B C;  2A07 F;  2CW0 F;  4XR6 A;  2L7Z A;  1WKM A;  2W24 A;  1D0Y A;  1OCC H;  3HBL A;  2OPT A;  3CO6 C;  1HW5 A;  3CC4 I;  4BXX J;  2Q8K A;  2VKE A;  1YTY A;  2E1N A;  5LD2 C;  3CCM I;  4M73 A;  5TRD A;  2KKO A;  4KIS A;  3WU1 B;  1VQP I;  5K7Z A;  3KP4 A;  5J40 A;  1DGW Y;  3GME A;  3HTS B;  1CF7 B;  2ZME C;  5D5W B;  4FIS A;  4EJU A;  5K7H A;  3HSR A;  3ZN1 A;  3MD2 A;  2EA2 A;  2M4K A;  2EIL H;  2IBD A;  3JR9 A;  1HOM A;  1TZL A;  4PJJ A;  3MKW B;  2R7V A;  5K7F A;  2BY1 A;  1XC5 A;  4JX4 A;  2E36 A;  2VC0 A;  2CO5 A;  1ONV A;  4ESB A;  3LSI A;  4ESJ A;  4Q47 A;  3DCF A;  2DYR H;  5IT9 K;  1O3T A;  3IWF A;  5K5Q A;  1IRF A;  2NAZ A;  3O3K A;  2MD5 A;  4ETS A;  3W6J B;  3CCL I;  1J0R A;  3HGG A;  3OIP A;  2LDU A;  3ASO H;  4GXO A;  1Y56 A;  1N25 A;  3ZOB A;  2R4G A;  1JHH A;  2D45 A;  4AC0 A;  2IS4 A;  1KYW A;  4B09 A;  2LSO A;  3PUB A;  4BQN A;  2ID3 A;  2L3D A;  1W0T A;  2HOT A;  3MAJ A;  5B1A H;  1HCR A;  3WHC A;  5IT3 A;  4P5O A;  1PUE E;  4MTE A;  2F4I A;  2IJL A;  1UHW A;  2KFD A;  3F0C A;  2HPI A;  4J00 A;  1KU3 A;  3FKJ A;  2P7C B;  2DXI A;  1UZC A;  3BR0 A;  4D7N A;  1OJL A;  1TT5 B;  3U1D A;  2V1X A;  1TTY A;  2P7V B;  2WAD A;  2OBP A;  2W85 A;  5C4J J;  2BY2 A;  2Z99 A;  4A3I J;  3PJR A;  1HW1 A;  5DCM B;  4F93 B;  3MFK A;  2DDA A;  4ENM A;  2PX9 A;  4RM3 A;  3UNG C;  1D1A A;  3PFI A;  1KON A;  1ODD A;  2O7O A;  4IPA A;  1ITY A;  2NNN A;  2V4J C;  2KDZ A;  3CCS I;  1TL8 A;  5GPC A;  4WF2 A;  3F72 A;  3HOW J;  2CW7 A;  2BYV E;  3H9J A;  2HEO A;  1ETX A;  4EM2 A;  3LNQ A;  1G3S A;  1Z1D A;  3E7L A;  2ZC2 A;  1ETW A;  5J6X A;  3KYC B;  3VYT B;  3BZ6 A;  3QPT A;  3VOE A;  2K3F A;  1OCT C;  4ZYH A;  1T38 A;  3S32 A;  1RPW A;  5IP9 J;  1R9T J;  4CYC B;  2VBY A;  2WB1 A;  2W48 A;  5KK1 A;  1LJ9 A;  1O7L A;  2KRC A;  4XRS G;  1OYY A;  4ZYE A;  2VKV A;  3CF2 A;  3WTX C;  4G94 A;  1MJB A;  3CDI A;  1BI0 A;  1YJN I;  3BQZ A;  1X58 A;  3SYT A;  3OYF A;  1O57 A;  4FET A;  3CCE I;  5GTH C;  4BHC A;  2F5D A;  3EUH C;  1SVO A;  1X1B A;  3OYI A;  2Q2E B;  4O3M A;  1L0O C;  3SDG A;  3S2H J;  3RKQ A;  1FT9 A;  1MBJ A;  2F2E A;  2B9S A;  1QBJ A;  3M8E A;  1R58 A;  3FM3 A;  4L5E A;  1MH3 A;  2UZK A;  1TW3 A;  2CUF A;  2K86 A;  2WY8 Q;  1UG0 A;  3DXJ F;  5K1Y A;  1JJ6 C;  3GUD A;  3BR2 A;  3WGH A;  1Z9C A;  2QKL B;  2EBI A;  2CV1 A;  1KQ9 A;  2QGU A;  5HS9 A;  2M4G A;  1JHF A;  3ZGK A;  5BPI A;  3LSR A;  2PMH A;  1JI8 A;  4G6Q A;  4KUM A;  2PJP A;  3I55 I;  3S15 J;  1P4X A;  1R1U A;  2LMD A;  4JYK A;  3CME I;  1YQA A;  2H8W A;  2ZXI A;  2J5P A;  4A3E J;  1ZG3 A;  5H20 A;  2ACJ A;  4R79 A;  1ZEL A;  2ZBK A;  1YIO A;  3FK6 A;  1TT0 A;  1QVT A;  2RNG A;  4IRH A;  3ZN0 A;  2XPV A;  5DTD A;  1BI2 A;  3JRE A;  3L9F A;  3NQO A;  3F9K A;  3OYN A;  3RI4 A;  3BTJ A;  5EEH A;  2EFQ A;  3C18 A;  3F8C A;  4II3 A;  1Y0U A;  3IHU A;  4BGD A;  4DYC A;  5K5O A;  4OIP F;  3DWL E;  2JSC A;  4BEH A;  3A2K A;  2QEN A;  1EF4 A;  2R0Q C;  3CC2 I;  4PZJ A;  3ULQ B;  4YIR X;  2LD5 A;  2EFW A;  3OYJ A;  3JCU C;  1QNT A;  4DZP A;  2GOX B;  3GTO J;  2W84 A;  4KIF A;  2DK8 A;  3AL0 C;  3F21 A;  2HYG D;  3I59 B;  1H8A C;  4LG3 A;  4Q4Z F;  2O9L A;  1WJF A;  3BG5 A;  4K2E A;  4L5I A;  2VPL A;  5D5U B;  2XHK A;  3L2U A;  2OCE A;  2PMU A;  4UV9 A;  3H35 A;  1SFK A;  4JX5 A;  4LMY A;  3S3N A;  1HC8 A;  2O3F A;  1T0F A;  3G3Z A;  1E17 A;  5F27 A;  1GT0 C;  2ZME B;  4UUS A;  1RES A;  4KJZ A;  3LFK A;  3LAJ A;  4PGH A;  3PFY A;  3HOY J;  4I76 A;  2N8G A;  2JTV A;  1JTY A;  4PJM A;  2R7W A;  1NH3 A;  1YJW I;  3CJQ B;  1WJD A;  1VQO I;  4YEL A;  2K9M A;  1IW7 F;  3NWS A;  4TV7 A;  2X6X A;  3S8P A;  2HOE A;  4BDZ A;  2DMU A;  4UHT A;  3AG3 H;  1A35 A;  4ZYA A;  1MBH A;  2WAQ A;  1F1Z A;  2JN6 A;  3FMQ A;  1OCR H;  3J7Z I;  4HOB A;  2KT0 A;  5EZH A;  1UEL B;  4Y17 A;  2MSY A;  3I71 A;  4UVB A;  2M1B A;  4LK1 F;  1VI0 A;  1MZB A;  3GBG A;  1MSF C;  1A31 A;  1OQY A;  3RIR A;  3ERM A;  1YG2 A;  2NS8 A;  3HHH A;  2DA7 A;  4RA2 A;  1P9Q C;  2E2H J;  3TO7 A;  4JP0 A;  3M1E A;  1AWC A;  3MVP A;  2CYY A;  3FM5 A;  2EV6 A;  3G1O A;  1FOW A;  1R36 A;  1Y6I A;  3KP5 A;  1QU3 A;  3ABK H;  4HZF A;  1K78 A;  4DNC A;  4CCM A;  1Q1H A;  2X6W A;  4KN7 X;  2XF6 A;  3K2Z A;  4E7H A;  5TJJ A;  3FWE A;  1ZRF A;  4N4N B;  2V79 A;  1IJW C;  3SZP A;  4EGZ A;  2B63 J;  2OZ6 A;  3HOZ J;  1FNN A;  5D6E A;  1EA3 A;  1ZHF A;  4IHY A;  3MKL A;  2VI6 A;  4D9J A;  1ZRC A;  2LC2 A;  3SEQ A;  1YLF A;  2XAU A;  4KT5 C;  2HVQ A;  4U0W A;  1AKH A;  1ZRD A;  3F6V A;  2QSF X;  3FXU A;  4AU7 A;  4EJT A;  3GLX A;  3K1M A;  1IRG A;  2BV6 A;  4UUS B;  3JAM K;  1IXC A;  5ILU A;  2UWM A;  1K6Y A;  3GO5 A;  4XN3 A;  1FX7 A;  3CF5 F;  2XRL A;  2DFI A;  4OU0 A;  4P1W A;  1XDS A;  3LOC A;  2XKO A;  2QF7 A;  4HQM A;  4FAS D;  5FFZ A;  4PJN A;  2CSO A;  2XB5 A;  2IAI A;  3Q9S A;  1ZKG A;  2EZL A;  5KAF C;  2HDC A;  4XID A;  3QAH A;  3S1R J;  3PNY A;  4QPO A;  3IRQ A;  2VE9 A;  2QBY A;  1TLH B;  1SAX A;  1TC3 C;  1OLT A;  1HSJ A;  2OQG A;  4DOZ A;  4IHT A;  2V9P A;  1T08 B;  1V3F A;  1WJE A; 
#chains in the Genus database with same CATH homology
 1A5J A;  4HNV A;  2CUE A;  5C3E J;  3L1P A;  1T56 A;  3OSF A;  3PO2 J;  1NK3 P;  3HM5 A;  2CRG A;  2M8G X;  2OF7 A;  2DA4 A;  1FTZ A;  4V2G A;  1AHD P;  5DS9 A;  5FKM A;  3JRA A;  1HDP A;  2X48 A;  3RZD J;  1U8B A;  1JUM A;  2X6O A;  2DTZ A;  1NK2 P;  1Y1W J;  3Q0V A;  2ECC A;  4ABZ A;  2L9R A;  2LY9 A;  3IH3 A;  1X2N A;  3HGY A;  2JA8 J;  3H3V K;  4DYQ A;  4C2M J;  2P81 A;  4CYC A;  2NVX J;  2HXI A;  5J3L A;  2XGC A;  2R5Y A;  1FTT A;  1AKH B;  2L7M P;  4FE4 A;  1RET A;  3GTK J;  3HKZ N;  3QPL A;  4D7M A;  4QIW N;  1ZR4 A;  3M3Y J;  3FKI J;  1GVD A;  1FIA A;  1ENH A;  2LFB A;  4MIM A;  3SJM A;  3GTG J;  2JA5 J;  3GTP J;  3ZQH A;  1MBG A;  1I50 J;  1ORK A;  1WH7 A;  5GPA A;  4D5C A;  2XPU A;  5EGO B;  1LFB A;  4QTR A;  2CQQ A;  2R5Y B;  4MO7 A;  3Q0W A;  3OIO A;  5IYD J;  1OFC X;  1JKQ C;  2R7Z J;  3BR1 A;  3OSG A;  2K9S A;  1ZQ3 P;  3W6V A;  1LE8 B;  3RQI A;  2R5Z B;  5F04 A;  4XIC A;  2YS9 A;  1X2M A;  2JMW A;  2VUM J;  1DU6 A;  5FJ8 J;  3A02 A;  4A3F J;  2HXO A;  4BBR J;  1JKR C;  1RR7 A;  1MNM C;  2H8R A;  3BR6 A;  1IC8 A;  3BT9 A;  3JRD A;  2JA7 J;  1UHS A;  2K40 A;  2XB0 X;  1BJZ A;  2JWT A;  3NAU A;  5EYR A;  2GBY A;  2H1K A;  2DMQ A;  4UUT A;  5FKL A;  1JT6 A;  5EEA A;  3QPS A;  1FJL A;  1QPI A;  3GTJ J;  3BQY A;  2WAQ N;  4LOC A;  1W0U A;  2X9D A;  3QQA A;  2EZK A;  5EG0 B;  1P7J A;  2CQX A;  5EDN A;  1TWG J;  4IHV A;  1E3O C;  1IV6 A;  1AU7 A;  4QSH A;  1MBE A;  5E3M A;  1HDD C;  2ME0 A;  3IV5 A;  2XSD C;  2LTP A;  4BKX A;  2M2E A;  1DU0 A;  1IDY A;  3Q3S A;  1RKW A;  3NAR A;  1WPK A;  4B3A A;  5M3F J;  1SAN A;  3LSP A;  5J1Y A;  2ECB A;  3HOX J;  1HLV A;  2Y9Z A;  3G1L A;  3HOU J;  2G0E A;  4BBS J;  3WHB A;  3MN2 A;  2RAE A;  4M3B A;  2R92 J;  4B1R A;  5F08 A;  1TWC J;  5JLX A;  1GUU A;  3CMY A;  4A69 C;  5FKN A;  2HOS A;  5FLM J;  4BY7 J;  2L7Z A;  5EZG A;  3HBL A;  2Y31 A;  2OPT A;  4BXX J;  2VKE A;  4B4C A;  3BG9 A;  2DA6 A;  4I6Z A;  2ZB9 A;  3BTL A;  3LSG A;  5BNG A;  4XK4 A;  1TWA J;  3JRC A;  2HI3 A;  3JRI A;  4MLO A;  3IH4 A;  5K7Z A;  4A93 J;  3ZQL A;  3K2A A;  4FIS A;  3JRG A;  1U9N A;  3A03 A;  3D1N I;  2E2I J;  4AUX A;  2XGE A;  1IUF A;  5K7H A;  5E3N A;  2HDD A;  1LE8 A;  1K61 A;  2Y2Z A;  2IBD A;  3JR9 A;  1JJ8 C;  1HOM A;  1OCP A;  1I6H J;  1PUF A;  1U78 A;  5K7F A;  3H0G J;  4G12 A;  4M3E A;  1XC5 A;  4JX4 A;  3Q0U A;  3TED A;  1FIP A;  1ETO A;  5EG0 A;  1JKP C;  2YU9 J;  1VFC A;  1MBF A;  5IYC J;  3DCF A;  3JRH A;  2IEK A;  2AHQ A;  4MFE A;  2I10 A;  1JGG A;  2DMT A;  1B8I B;  1YRN B;  3HGG A;  2LKX A;  3I4M J;  2LLK A;  3ZOB A;  4AC0 A;  1G2H A;  3S17 J;  1JKO C;  1ETK A;  2LP0 A;  2ID3 A;  2XPW A;  5E3O A;  4J19 A;  4X1E A;  4FTH A;  1W0T A;  2HOT A;  2M0C A;  1T33 A;  3WHC A;  1HCR A;  3F0C A;  5EGO A;  3CQZ J;  5IOZ A;  4IHW A;  2MW8 A;  4DW6 A;  3BR0 A;  4D7N A;  2DMP A;  1OJL A;  1ZTR A;  3BTI A;  1LFU P;  1I3Q J;  2PMZ N;  9ANT A;  5C4J J;  5M5W J;  3S1M J;  2LK2 A;  1WI3 A;  4A3I J;  2L0K A;  1POG A;  2K9Q A;  1CQT A;  1MSE C;  2O7O A;  4NDL A;  3S1Q J;  1ITY A;  5F0C A;  1ZGW A;  4V2F A;  2KDZ A;  1S7E A;  5GPC A;  5JLW A;  1GV2 A;  3HOW J;  1JUS A;  1XG1 A;  1ETX A;  3LNQ A;  1JT0 A;  3E7L A;  1ETW A;  1UMQ A;  5C4X J;  1RKT A;  3HOV J;  4C3J J;  3A01 A;  3GTL J;  3LSJ A;  5IP6 A;  4RDU A;  1MBK A;  4M3G A;  1OCT C;  4M3D A;  2GM4 A;  3S16 J;  4A3B J;  1RPW A;  5IP9 J;  1R9T J;  3FK7 A;  4CYC B;  2D5V A;  2W48 A;  3VPR A;  4XRS G;  2VKV A;  4Y52 J;  1UG2 A;  2ME6 A;  2ELK A;  2Y30 A;  3S2D J;  3BQZ A;  1X58 A;  1BL0 A;  3DEW A;  1ETY A;  4A3C J;  3M4O J;  5GP9 A;  3SDG A;  3ZQC A;  2LR8 A;  1MBJ A;  3RKQ A;  3S2H J;  4L5E A;  2EQR A;  1O4X A;  1MH3 A;  1H88 C;  1B72 B;  2CUF A;  1BA5 A;  1JJ6 C;  3CCY A;  3BR2 A;  5F0H A;  2M9H A;  2EBI A;  2ID6 A;  2K9N A;  1GV5 A;  1Z77 A;  1HF0 A;  5IYB J;  4BY1 J;  3LSR A;  4RBO A;  1FEX A;  2FJ1 A;  3S15 J;  2HQ5 A;  4JYK A;  5HOD A;  1WGX A;  2DJN A;  4W1U A;  4XRS A;  2L7F P;  3PO3 J;  3I4N J;  4A3E J;  1APL C;  2R5Z A;  3B6C A;  3FK6 A;  1QVT A;  1B72 A;  3TP3 A;  4DYR A;  1Y1V J;  2DA5 A;  2XPV A;  3OOU A;  5DTD A;  1PUF B;  1JTX A;  4C3H J;  3JRE A;  3GTM J;  3BG3 A;  3BTJ A;  2LVS A;  4M6V A;  2CJJ A;  5IP7 J;  3HDD A;  3ZQI A;  2TRT A;  3BTC A;  4D5F A;  4DYC A;  2JA6 J;  1NTC A;  5IPA A;  4GFB A;  1EF4 A;  2R0Q C;  3TW7 A;  2LD5 A;  1MH4 A;  2NVQ J;  3O8G A;  3BR5 A;  3BR3 A;  4IHX A;  2AO9 A;  1ZK8 A;  2NVY J;  4DZP A;  2QCO A;  2TCT A;  3GTO J;  3IH2 A;  1H89 C;  3TW6 A;  4A3M J;  3G1M A;  1H8A C;  2E19 A;  3GTQ J;  2E1O A;  2O9L A;  3BG5 A;  4A3K J;  1ZR2 A;  4DZJ A;  2Y0S N;  3FIS A;  2CU7 A;  4JX5 A;  2FQ4 A;  1P7I A;  2M34 A;  3A01 B;  1QVU A;  3CDL A;  2DA3 A;  2MG4 A;  5F27 A;  4XRM A;  1GT0 C;  3O8H A;  4UUS A;  1RES A;  4S0H B;  4A3G J;  2O8K A;  2HYJ A;  1F36 A;  1IGN A;  3HOY J;  4I76 A;  4JX6 A;  3RZO J;  2N8G A;  5J1U A;  2NVT J;  5FKO A;  2R93 J;  1JTY A;  3S14 J;  3ZQF A;  2DA1 A;  1QRY A;  1ETQ A;  1ETV A;  3S1N J;  5IOY A;  4AYB N;  3SFI A;  4M3F A;  4FCY A;  2DMU A;  2XGD A;  2NOG A;  3K7A J;  2VPR A;  4A3J J;  1VND A;  1MBH A;  2JN6 A;  2KT0 A;  5EZH A;  1D5Y A;  3ZQG A;  2MSY A;  2EZI A;  1VF9 A;  1VI0 A;  3GBG A;  2Y9Y A;  1MSF C;  3JRF A;  2NS8 A;  5FLV A;  2NS7 A;  2DA7 A;  2DN0 A;  2E2H J;  4JP0 A;  3MVP A;  1WCM J;  2FD5 A;  4A3L J;  2EH3 A;  1B8I A;  1YRN A;  2FX0 A;  3G1O A;  5M5X J;  1TWH J;  5M3M J;  3HB9 A;  3HEF A;  5E3L A;  4C3I J;  1JUP A;  3UKG A;  2MGQ A;  3FIW A;  1IJW C;  1K83 J;  2DMN A;  2B63 J;  3HOZ J;  4FE7 A;  2WV1 A;  3MKL A;  4IHY A;  2VI6 A;  3PM1 A;  2JK3 A;  1U9O A;  4MFD A;  5F1J A;  1XS9 A;  5F0F A;  5EF6 A;  1AKH A;  5FKK A;  1SFO J;  2DA2 A;  4UUS B;  2GLO A;  1WH5 A;  1A6I A;  4EEF G;  2YUS A;  3TP0 A;  1IG7 A;  1IRZ A;  2E2J J;  2XRL A;  2EZH A;  4W97 A;  3LOC A;  5J1R A;  5M5Y J;  2QF7 A;  1BW6 A;  1Z0X A;  2XB5 A;  3C2B A;  2IAI A;  1TWF J;  1ZKG A;  2EZL A;  2WB1 N;  1IDZ A;  2COB A;  3B6A A;  4XID A;  4Y7N J;  3S1R J;  4X6A J;  4A3D J;  1TC3 C;  1F43 A;  3JRB A;  1Q1V A;  4IEJ A;  1BW5 A;  5C44 J;  2JJ7 A;  1GDT A;  2HOA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...