1GHCA

Homo-and heteronuclear two-dimensional nmr studies of the globular domain of histone h1: full assignment, tertiary structure, and comparison with the globular domain of histone h5
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
75
structure length
75
Chain Sequence
MAGPSVTELITKAVSASKERKGLSLAALKKALAAGGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFRLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chromosomal protein
molecule keywords GH1
publication title Homo- and heteronuclear two-dimensional NMR studies of the globular domain of histone H1: full assignment, tertiary structure, and comparison with the globular domain of histone H5.
pubmed doi rcsb
source organism Gallus gallus
total genus 9
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 1994-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00538 Linker_histone linker histone H1 and H5 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1ghcA00
1OMIA 4LG0A 5DD8A 3I0TA 1G3YA 3KP2A 4Z2YA 3WODF 1IXRC 1K6OA 2QLZA 4HQMA 3ZMTA 3IWFA 2X0LA 5EEGA 5D5XB 2IA0A 2GA2A 2R3SA 3CUQA 4M9SA 3OOPA 4PCQA 3M8EA 1MDMA 3F8MA 2QYOA 3FXQA 4ZZLA 1HW1A 1H9TA 3HHHA 5AIQA 1JXSA 3KP6A 2VC0A 4ESBA 4FX4A 3M1EA 1ZGAA 2FF4A 2PFBA 1IN7A 1DDNA 5EEHA 1WI9A 4KDPA 1R23A 4RB0A 2UWMA 3K1MA 4NHJA 1ODDA 4RAYA 3O3KA 4YIFA 3WTWC 5E8GA 3TOBA 1K78B 1E17A 2A6HF 4XSZF 1ZYRF 1FNNA 4LK1F 3RJPA 2E7XA 1R1VA 1NHAA 1FC3A 2L54A 2M30A 3FF5A 2XIGA 4ZYGA 2J5OA 1DP7P 4FX0A 2QVOA 2HFHA 2PEXA 3HSEA 2A69F 4I09A 4EJUA 2QUFA 4HQEA 5ILVA 3MFKA 3DPLC 1DPUA 3BJOA 1T98A 3KETA 2JSCA 1FP1D 1VTNC 2IA2A 3SXYA 3ZMZA 2IJLA 2XKPA 3SHFA 1T38A 2F2EA 4B8XA 5CVUA 3TDZC 4HZFA 4EQQA 2XKOA 4EVIA 2UXXA 3J80Z 1R5HA 4EJTA 1PUEE 2FNPA 2O8XA 1P4AA 2A6EF 2Q8KA 2CQKA 3J81Z 1ZG5A 2JTVA 2DAOA 2VBWA 4R8HA 2JPCA 2P7VB 3W6JB 4M71A 1SD4A 1XN7A 2EV0A 3RI4A 5E18F 3T5XA 5FLXK 2XAQA 4GGGA 5HLIA 3DXJF 4LJZF 3VODA 3GW2A 1O7FA 2W25A 1CF7B 2G7HA 1KU3A 1XMAA 3ZN1A 1AWCA 2OA4A 4B09A 4BH9A 1R22A 3GXOA 1REPC 4ZYEA 4U7DA 2QBYA 3L9FA 4A5NA 1J75A 1YFHA 1DUXC 2EA2A 1USSA 3CJNA 3TKYA 4IHSA 3MEXA 2GZWA 3FWEA 4ENJA 4U88A 1SMTA 1EH8A 1T0FA 3KE2A 1I6XA 2OU2A 4S05A 3V7CA 4LFUA 4EM2A 1Z7UA 1WWXA 1TQPA 3KLOA 4LK0F 3SQNA 2K4BA 1FWZA 2XAFA 3H3UA 3T0YA 5BPIA 2YX7A 1QBJA 2LSOA 5LEKA 2Y75A 4XSXF 5HDNA 1KA8A 2GIVA 4UV8A 4WCGA 2ZXJA 2M1BA 2E1CA 2R7DA 5HDKA 4M73A 2EJRA 4KN4X 5LGUA 2VN2A 4EM0B 2XV4S 3G3ZA 5LLQA 1Z6TA 4R1HA 1BC8C 2L4MA 2MH2A 4MTEA 4MQVA 3K0LA 1QGPA 1FYKA 5CVVA 1CGPA 1Q1HA 3T8RA 1T6SA 1KQ0A 3V7SA 1FBUA 4AVPA 1OYYA 5HS9A 3GFIA 3VFZA 3CUQC 1EH7A 5L3BA 2VODA 2AXLA 3E5QA 5DCFA 5CJ9A 2EA4A 4U0VA 4XBFA 1IF1A 2Z5UA 2QQ9A 4KMUX 2BEOA 1W5SA 4I98B 3KP7A 1UB9A 4LGWA 3BJ6A 1O3TA 3R61A 3GX4X 5L3DA 1V4RA 5DUKA 5HLGA 4L18B 1P6RA 1G6NA 1S6LA 2R7FA 2P6TA 5F1RA 4O6JA 2AS5F 1U5TA 4IPAA 4HLXA 4U0WA 3SZTA 3TO9A 1HW5A 2E7WA 2K7LA 3KP5A 1O3QA 4LLNA 3F8CA 1D5VA 4WK8F 3PQKA 4UNOA 2Q2EA 4ZYHA 3FX3A 1F1ZA 3L7WA 2PG4A 1D3YA 3ABUA 1ZG1A 1HKTA 3MCZA 5HS8A 2VT3A 3TO7A 3WTUC 4M6XA 4Y15A 2YSRA 5E1XA 1R5GA 3M8FA 4JBAA 3ISPA 1I1SA 2HEOA 2EFWA 3N97A 4H0EA 4KMFA 1B4AA 1W7PA 1J59A 3GEZA 3MZHA 3W6KB 1K79A 3LAJA 2Z3YA 3PFIA 1BIAA 2OD5A 1U2WA 5DCMB 2ZBKA 3K9TA 1BI2A 2BBYA 3H92A 5LBQA 5BMZA 1SD6A 2VT2A 1RI7A 2H27A 1R7JA 4UVCA 3GUDA 5D8KB 3FZVA 4RB3C 2H09A 3E5UA 2EWNA 1IUYA 1WRJA 3LA7A 4KICA 5JFRA 1XDUA 3GYHX 4UV9A 3Q5FA 4P5OA 1Z05A 2A5YB 5ERIA 2A61A 4FHTA 4EGZA 4YFXF 2Z9OA 3DPTA 2XVCA 5JVTA 3S2WA 5HOOA 4MHGA 3R0AA 4OIRF 2G9WA 3L00A 2MD5A 2VBXA 4QWQA 1UCRA 2MH9A 3TGNA 1TQMA 1YLFA 3V7RA 2P7CB 3Q9SA 4KUMA 1SAXA 1IN8A 1P4XA 4MTDA 1FZPB 3BROA 2GAUA 3GVAA 3WTVC 2RC4A 2Y48A 4CHUA 2K27A 4EMSA 5K5QA 2VE9A 3Q9VA 5HVQC 2PI0A 1P4WA 1IAWA 3MZYA 3GLXA 1OPCA 4QLCU 2NRAC 2Y0MA 2DU9A 1MD0A 2L3DA 4E70A 3E6CC 1J7KA 3WGIA 4LB6B 3V4GA 2YU3A 3DP7A 5J8CA 1XSVA 2ZMEA 5IT9Z 4LLGF 4ZH4F 3B02A 2QQAA 4LB5A 2CO5A 2HQRA 5K1YA 4AWXB 3F8NA 2HOEA 3RPQA 1V3FA 1FLIA 1YW7A 1WKMA 5HS7A 3HSFA 3CO7C 4OIQF 2ELHA 3RTRA 1KYZA 2FXAA 4NQWA 1ULYA 3RKWA 3NRVA 2V1XA 1DPRA 2STTA 1S7AA 3F6VA 1GXPA 4O5VA 2EK5A 2KJBA 1QZYA 1HQCA 1SMYF 3WE3A 2FBKA 3FMSA 4HX8A 3ERED 1ZLKA 1BIBA 2X4HA 3I59B 2O61A 4XRFA 5A2QZ 3FM3A 1ZRCA 5D5VB 2IA1A 1TNSA 2FA5A 4KA4A 2XASA 4KYWA 3NQOA 2BV6A 5LRSA 3ABTA 4S04A 4WX9A 4A0XA 3U2RA 2OAZA 1YS7A 2DI3A 4HF0A 2L4AA 4HLYA 4WXHA 3IHUA 2DW4A 2HTSA 5J8FA 4N9HA 2LDUA 3WE2A 2DFIA 4MQ9F 1HSJA 1IN5A 1FPQA 2D1VA 3NEUA 1MJ9A 1MKMA 2KIUA 2ESNA 4OINF 3VEPA 2PMUA 5K5RA 1OYWA 1ZLJA 1D8JA 3ELKA 3M7GA 2RNJA 1U5TC 2FMYA 2EFNA 2ADUA 4Y17A 2EV6A 3SFZA 1YW8A 1XDSA 2HTJA 2P5VA 3EDPA 4AIHA 2PN6A 4RGXA 2GA1A 2EFPA 4G94A 1ZAOA 1BI1A 3KP3A 4MEXF 4UVBA 4P9UA 4OMZA 3JAMZ 1QO0D 3CLOA 1ZN2A 2CG4A 3ECHA 1QZZA 1QNTA 4LG0B 4Q5SF 2Z33A 3LQQA 3REOA 3ZQ7A 2RDPA 2GWRA 1W5TA 2FBIA 5L3GA 1HXDA 1ZRDA 1J9IA 1X3UA 1GXQA 1U6GA 2GXGA 4CXFA 1YTYA 1B9MA 4MGRA 4DNCA 1LDKB 2EB7A 3CUQB 4EM1A 2DPUA 1LB2A 1RUOA 1FOKA 1XSDA 4LMYA 2EFQA 1FT9A 5DD4A 3PQJA 1MDMB 1Z91A 5BOXA 5DDGA 1ZRFA 4M72A 2ZO4A 4AIJA 3WTYC 2FQ3A 3RIRA 3C18A 4ZYDA 2P6SA 3LAPA 2RQPA 2F5DA 3IKVA 2KIMA 3GF2A 4PGGA 5DV5A 3C1DA 1EV7A 2CYYA 1K7AA 2EV5A 2JT1A 5ICFA 1S3JA 2DT5A 4BNCA 1U78A 2TDXA 5D4SA 2ZFWA 2XRNA 1C0WA 1W4MA 3JSOA 1O3RA 4A6EA 2Z99A 4LLLA 1TLHB 4A12A 3GZ5A 3KFWX 4GYGA 1ON1A 3IC7A 2DBBA 1LDDA 2OZUA 3L2CA 5H6QA 4KFCA 5F64A 1D8KA 5HLHA 4RGUA 1PP8F 3K69A 2ISZA 4ENMA 5LGNA 4JK1X 3GO5A 1G3SA 3RKXA 4ZZDA 4P9FA 2HDCA 3FMRA 1ONVA 3QOPA 3VOEA 2YX4A 5H20A 2IVMA 2J5PA 4KIBA 5L3CA 5KK1A 2P5LC 5BQTA 3F6OA 3F8FA 3WTSC 1GHCA 2HZTA 4HF2A 2W85A 5FO5A 1WSUA 2YPRA 1KGSA 2PJPA 1UHWA 2PBIA 1FYMA 3CUOA 1XSXA 2GXBA 1H9GA 2EFOA 1ZREA 4L0YB 3QP6A 3J80K 4OOIA 4RGRA 3RDIA 4UXNA 2D1HA 1R1TA 1JHHA 4CYDA 4HOBA 2WWYA 3J81K 4OIOF 1KQ8A 3E97A 4DQ2A 1B9NA 4EJVA 4R79A 1FSHA 1FBQA 2V1DA 4BHCA 4GYIA 2V6CA 4D0PA 2WTEA 3DEUA 4HX7A 3KZZA 3P9CA 4EJOA 1YW9A 2HKXA 2NAZA 5BS6A 1YQAA 3F22A 1IRGA 1BBYA 3QU3A 1XGSA 4A2UA 4M74A 3ZMUA 4N0BA 4K2EA 3HYIA 2A3SA 2DO7A 2QBYB 4LD5A 3MWMA 5ILUA 3K2ZA 3WGGA 2FOKA 2K86A 1MJBA 4BYYA 1G3WA 5ICCA 3GZ6A 1T2KA 5DUIA 5LGTA 2H94A 4I2OA 4WWCA 2MA3A 3TDUC 2YR2A 2UZKA 3R60A 1JHFA 2O3FA 3V8LA 2IP2A 2QWWA 3HTUA 1YO5C 2L01A 2D45A 3LQRA 5D8LB 5ED4A 2FU4A 2BE5F 4EGYA 5ICEA 1I27A 3D0SA 4L0ZB 3BY6A 4L9TA 2B0LA 3HRUA 3WU1B 5L3EA 3WTXC 1XGNA 1L0OC 4HAMA 1FP2A 4A6DA 3L09A 4IRHA 3K1PA 5LRRA 3COAC 2P5KA 2P8TA 1ZARA 1FYLA 2RN7A 4G9YA 4YIIA 5LEJA 1EH6A 2GQQA 4IXAA 2COMA 2QM3A 1MJAA 2KKOA 2DK5A 3HHGA 3ZN0A 3LWFA 1B59A 4RAZA 2LF8A 1U3EM 3WTTC 1UFMA 3QPHA 1H0MA 3BOQA 4KIGA 2IW5A 2XAJA 3IKTA 4HDVA 1K78A 1ZH5A 3I54A 4AIKA 2CGPA 4HX4A 3TQNA 5D5UB 3HRSA 3R4KA 5E1ZB 3EYIA 5ILSA 4WF2A 2PLYA 4HDUA 2F5EA 1TNTA 1SFEA 3HUGA 1FBSA 3FXUA 1YIOA 3K1NA 3QP5A 3JW4A 4G6DA 2XUBA 3CDHA 2D2WA 2DK8A 4YFNF 4NB5A 4ON0A 5LHIA 1LJ9A 2FRHA 2WC2A 4I0AA 1U5TB 3DF8A 3WU0A 3P7NA 3IWZA 2BGCA 5J6XA 1SFUA 3B73A 2DQLA 1TW2A 3G73A 3JSPA 1Z9CA 3WG9A 1A04A 2MBFA 1XD7A 3CTAA 4U7BA 3KEOA 4ENKA 3AAFA 2QZ8A 5FLXZ 1F4KA 2ZNZA 4IF4A 3GFLA 2M5WA 3C7JA 2XHKA 2HYFA 3OV8A 1JGSA 1ZGJA 3F72A 2FSWA 3QU6A 5FB2A 3GFJA 3IRRA 3F21A 4EV0A 1UHMA 5ICGA 1B6AA 1PP7U 1G3TA 5BPDA 1IN4A 4OIPF 1J5YA 4G7ZF 4HF1A 5CVJA 1Z6RA 2ZNYA 1RZ4A 4L9VA 2W57A 1CF7A 1IW7F 1KYWA 2KRFA 2VXZA 4G7OF 1W7PB 2A07F 2OQGA 1L3LA 2MLGA 2H6CA 4BAYA 4RB2C 1O7LA 3ML6A 4G6QA 2W24A 3SZPA 2LF7A 3QRFF 2WV0A 2DTRA 2IPQX 1LQ1A 1YYVA 1KU9A 1IXCA 3BPVA 4TV7A 1MGTA 1LNWA 5IT3A 3JTHA 5D5WB 4M6YA 4XLPF 1BI3A 5E20A 2XROA 2VBYA 4L5JA 3LA3A 2VC1A 1SD7A 4ASNA 4F7ZA 1FSEA 4ENNA 4OU0A 1HKSA 4Q4ZF 1J2XA 1TW3A 3I53A 3U1DA 3O2PE 3HSRA 4PGHA 1LEBA 1TQIA 5E17F 4HW0A 3T1BA 1IXSB 3FXRA 4IJAA 3C3WA 5CVRA 4KT5C 1P92A 2M45A 3ZPLA 1S29A 4GCVA 1IN6A 2VOPA 3EQLF 3EETA 1TTYA 4KNYA 3WGHA 2VE8A 3HRMA 1JE8A 5LHHA 1OR7A 1OYIA 1I5ZA 4RGSA 2A68F 4KIFA 3LA2A 4IRIA 2RVCA 3ECOA 2ZMEB 3N4MA 1AOYA 2K4JA 2HKOA 1F9NA 1IRFA 1I1GA 2JZYA 4OMYA 1BM9A 2F5CA 3KP4A 3O6BB 3ZMSA 1ZHFA 3JTGA 3H3ZA 1HSTA 5IT9K 4MEYF 2HWVA 2HS5A 1FX7A 2ISYA 5D6EA 2XGXA 4N9IA 4PZJA 2JRTA 3E5XA 3ROUA 2IT0A 1BN5A 1BC7C 5K5OA 4P55A 1GVJA 3KCCA 1PDNC 4ETSA 1KU2A 3V8KA 4CZZA 4XLNF 4G8XA 2LNBA 2FMLA 3P9KA 2IRFG 2FE3A 2ZKZA 2F5FA 4HBLA 1YS6A 3F3XA 5CYVA 5D6FA 4O3MA 3DV8A 2H6BA 1E2XA 2ESHA 5A2QK 2XAGA 5CLSA 4RB1A 2BYVE 3RYPA 1SD5A 4FT8A 5AONA 3HTSB 4IRGA 3ZMDA 3EUHA 3E6BA 5H6RA 2XAHA 4CICA 3QPTA 4HV6A 2HQNA 4BHPA 1STZA 4JQFA 2OBPA 2V9VA 1KU7A 3LSTA 5FD6A 5DEQA 2MLKA 5FFXA 1R00A 3R6SA 1IZ1A 3ZMVA 4GO1A 3HRTA 4UVAA 4Q48A 2ZJ2A 4YFKF 1TBXA 3E6DA 2VOOA 3V8JA 2KIFA 3I58A 2CW0F 5DCMA 1OKRA 2O03A 1XGMA 3RKYA 1KQ9A 4Y13A 2QENA 5JHUA 3IRQA 3JAMK 3FM5A 4CDGA 1BI0A 1T39A 2HGCA 3RPUA 4I7HA 3WTZA 4IHTA 2FNAA 3I64A 3E6MA 4MNUA 1W7PD 1WQ2A 1RUNA 1BOAA 1S8NA 3I71A 2NNYA 5TRDA 4L9JA 2CSOA 3DFGA 2OZ6A 2STWA 3P9IA 1HKQA 2Q0OA 3RYRA 1MZBA 4HV5A 4WXDA 2P4WA 3T8TA 3BJAA 3GWZA 4BQAA 3BWGA 3U9GA 4M9ZA 2RV8A 4CO8A 4IVNA 1G4DA 4G7HF 2MC3A 2CWEA 4CGZA 3R0JA 4A0ZA 4P96A 3HOTA 2KJCA 2V79A 3KZYA 5HDGA 3DQVC 1USTA 1HW2A 1LEAA 4I02A 2G7UA 3BZ6A 3CO6C 2VBZA 3J7AO 3HOSA 3KEQA 4M9XA 3F8BA 2L02A 1LVAA 2PMHA 2NYXA 5E1WA 4AD9A 3FHZA 1HBXG 3D5LA 2RKHA 1BJAA 5D4RA 3I4PA 4Q47A 2O6GE 1B1BA 2M87A 2QQBA 4L5IA 3F23A 1P2FA 3FMQA 3ZP5A 3GFMA 1Z1DA 5E8IA 3KLNA 3TOAA 2FEZA 1R58A 5FD5A 1XB4A 1QQIA 2ACJA 1ON2A 1XCBA 4I01A 1QPMA 4L9NA 4PDKA 3I5UA 4WXCA 3BPXA 2UXNA 2C6YA 2K02A 4ESJA 1R36A 1LDJA 1S7OA 1SFXA 3QAHA 5TJJA 4UUVA 3VB2A 5FGMA 4I0BA 3I59A 2VONA 4YG2F 4KN7X 3E3VA 5AIPA 3HIFA 1Y0UA 1R1UA 1F5TA 4ESFA 4HYEA 4BXUA 2NNNA 2LKPA 6PAXA 2DQRA 2PQ8A 4BHBA 3M9AA 3LFKA 1RNLA 1O57A 4U0YA 2W84A 5JR3A 3EYYA 1XCVA 2FBHA 1U8RA 2JPBA 1J0RA 5F6FA 2RGVA 5DYMA 3TO6A 2NS0A 4GXOA 3IL2A 2HYGD 3BDDA 2HR3A 2OQRA 2ZCWA 1FY7A 2ETHA 4RS8A 2CFXA 4A0YA 2DPDA 2V1UA 5KVRA 4HA8A 4UHTA 3MQ0A 5LHGA 2DLLA 3DKWA 1RIOH 5JI6A 2O0YA 1ZG3A 3ULQB 4EJWA 1O3SA 2M8EA 3BP8A 1XMKA 2E1NA 5FFZA 4A5MA 1YG2A 5L3FA 1XGOA 5CVIA 3MAJA
chains in the Genus database with same CATH superfamily
1OMIA 4LG0A 5DD8A 2ZJQF 3LSMA 3I0TA 2WAQN 3M3YJ 4QPOA 1G3YA 2DA5A 2MGQA 3KP2A 2CV0A 4Z2YA 2W7NA 2L5QA 2CQQA 3WODF 4CCKA 3OSFA 3Q0UA 1IXRC 2LYCA 1X19A 1X1CA 1YITI 1K6OA 2A5WA 4E7KA 1TP4A 2QLZA 3HPGA 4HQMA 3ZMTA 1U0JA 3HPHA 2CQ7A 3IWFA 2V4JC 2X0LA 5EEGA 2KIQA 5D5XB 2R5YA 2Y2ZA 5DS9A 1LFBA 2IA0A 2GA2A 1T95A 1MMAA 1TWCJ 2LRDA 2HI3A 4M6VA 2R3SA 3CUQA 4XM3A 3QYEA 2L9VA 4M9SA 2NS8A 3OOPA 2R7TA 4PCQA 3M8EA 2Y31A 1MDMA 3F8MA 1ETWA 2QYOA 1MBJA 4HRIA 3FXQA 4ZZLA 3OYDA 1HW1A 1H9TA 3C2GA 1OCOH 3HHHA 1MMNA 4XL9A 5KAFC 5AIQA 1JXSA 5B5EC 3KP6A 2VC0A 4RBOA 1X1BA 4ESBA 1S72I 4FX4A 3M1EA 1ZGAA 2FF4A 2ZB9A 2PFBA 2WBMA 1IN7A 1DDNA 1YX3A 1MNEA 2PMZN 1F36A 5EEHA 5IYCJ 4B47A 1WI9A 4KDPA 1R23A 3K4BA 4RB0A 1TL8A 2UWMA 3K1MA 4NHJA 1ODDA 1LUJB 4RAYA 3O3KA 4YIFA 3WTWC 5E8GA 3DLAA 3TOBA 3H9JA 3BG5A 1GT0C 2A6HF 1K78B 2HPMA 4XSZF 1E17A 1ZYRF 1FNNA 2BW3A 4LK1F 1V55H 3S2HJ 3RJPA 2E7XA 1RESA 1R1VA 2JUCA 1NHAA 3DBLB 3QYBA 1FC3A 4AUXA 4A3GJ 2CQNA 1ETQA 2L54A 2XGDA 2M30A 3FF5A 2XIGA 4ZYGA 2OF7A 2XF6A 5M3FJ 2J5OA 1DP7P 3HGGA 1JJ6C 4FX0A 2QVOA 4PJLA 2F48A 2HFHA 2E60A 2PEXA 3HSEA 4F52A 2A69F 4I09A 4EJUA 2QUFA 2V6EA 4KT6A 4HQEA 5ILVA 3MFKA 3DPLC 1DPUA 3BJOA 1T98A 4M3BA 3KETA 1IGNA 2JSCA 3FHNA 3HUGB 5TGTA 2M2EA 5F1JA 3KPHA 2IGOA 1FP1D 1MNDA 1VTNC 5EGOA 2IA2A 2QGUA 3SXYA 1T08B 2WAEA 3ZMZA 5C4XJ 2LR8A 4S0HB 2IJLA 3OYHA 2XKPA 3SHFA 2H1LA 2F2EA 1T38A 2LKSA 4J00A 4B8XA 5CVUA 3BTLA 2A6TA 4HZFA 3TDZC 5E3MA 3S17J 4EQQA 3N05A 2XKOA 1X1PA 4EVIA 2FOWA 2UXXA 3LSJA 5JLWA 1S5LC 3S1NJ 2K3FA 3J80Z 4XKWA 1R5HA 2BVLA 2X1CA 4EJTA 2ID6A 1JUSA 2ID3A 2VQLA 1PUEE 1JUMA 2FNPA 1IDYA 2O8XA 2E1MC 5E3LA 1P4AA 2A6EF 2Q8KA 2CQKA 3J81Z 4II3A 1LPQA 1ZG5A 3CDIA 1PJRA 1VQOI 3CMEI 3OYEA 3S14J 2JTVA 1VQPI 5J4YA 1E3HA 2Y0SA 3FBIB 4XKBA 2DAOA 2VBWA 4R8HA 2JPCA 4X0GA 2LTPA 2P7VB 3W6JB 1LFPA 4M71A 1SD4A 2RQQA 1NK3P 3BCBA 1XN7A 2EV0A 3DKXA 5EJCA 3RI4A 5E18F 3T5XA 5FLXK 2MYSA 3BTCA 2XAQA 3K4LA 2KISA 3W2AA 4GGGA 5HLIA 2HOTA 5F0FA 3DXJF 2GIZA 1JGGA 1MBFA 1A36A 4V2GA 4LJZF 3VODA 3JRDA 3GW2A 1O7FA 2W25A 2EBIA 1CF7B 2M4GA 1VQKI 2G7HA 1PUFB 1KU3A 1XMAA 3ZN1A 3IH4A 1AWCA 2OA4A 4QTRA 2W1OA 5IY5H 4B09A 4BH9A 4IHYA 1R22A 1Y1VJ 2EINH 3GXOA 3TEDA 1REPC 4ZYEA 3BQZA 2ZXWH 1OISA 4U7DA 2QBYA 2BY3A 3L9FA 4A5NA 2XPVA 3RPUD 1JKOC 1J75A 1WHUA 1YFHA 1DUXC 2EA2A 1IRXA 2YU9J 1QVTA 3W3CA 1USSA 4ZYAA 3CJNA 3TKYA 4IHSA 4OAZA 2EZLA 3MEXA 3AG3H 2GZWA 4XLCA 3FWEA 4ENJA 1T56A 1SMTA 3HXLA 4U88A 3S16J 1EH8A 1T0FA 2H1KA 4BXFA 3GTLJ 3H0DA 3KE2A 1ETOA 1I6XA 5E3OA 1W0TA 3FKJA 2VPLA 2OU2A 2K85A 4S05A 2ZXHA 1Y6IA 1MBKA 3V7CA 4LFUA 4EM2A 4ZTJA 1X4PA 1Z7UA 1WWXA 3DCFA 2AO9A 1TQPA 3KLOA 4LK0F 3VYUB 1BL0A 3H1CA 3SQNA 2K4BA 1FWZA 1I39A 2XAFA 1XG1A 3H3UA 3DBRB 3T0YA 5BPIA 2YX7A 3TL4X 1QBJA 2LSOA 2R93J 3SEQA 5LEKA 2CV2A 2Y75A 4XSXF 2DFEA 5EYRA 4QIWN 5HDNA 3OY9A 2E5NA 3S93A 3G71I 1YJ9I 2GXAA 3CD6I 1KA8A 3PNVA 2LMDA 2R4GA 2GIVA 4UV8A 4WCGA 1IJWC 2ZXJA 1VNDA 2K9LA 2M1BA 2E1CA 2R7DA 5HDKA 2WY7Q 4M73A 2EJRA 2UV1A 4KN4X 5LGUA 2VN2A 4EM0B 4J01A 2XV4S 4M3EA 3G3ZA 1QZEA 1HF0A 4RA2A 4A3KJ 5LLQA 3CF2A 2CU7A 3HM5A 3SYTA 1Z6TA 2F4OB 4HNVA 4R1HA 1BC8C 5GAHJ 2L4MA 5BNGA 2MH2A 3W2VA 2QA4I 4MTEA 1LE8A 4MQVA 3HKZA 1EF4A 3WHCA 1UG2A 2VJ4A 1WJCA 3HOWJ 3K0LA 4DZJA 1QGPA 1FYKA 5CVVA 1CGPA 1Q1HA 3T8RA 1T6SA 4H4KC 3TW6A 1MSEC 3L2RA 1KQ0A 1ACIA 4RM2A 4YELA 3V7SA 1I3AA 1FBUA 1HDPA 2KFDA 3K4MA 2VJ5A 2I5UA 3CCVI 4AVPA 3DTIA 1K6YA 1OYYA 2L7MP 5HS9A 3SJMA 3GFIA 3H5NA 3VFZA 2BY0A 2XF5A 3CJQB 2M7BA 5FKKA 3BR1A 4AYBN 3CUQC 2KT0A 4UUTA 4XLFA 5M5XJ 1EH7A 5L3BA 2DN0A 2VODA 2V7FA 4GRIA 2AXLA 4E6KG 1P7IA 3E5QA 5DCFA 3S3OA 3OL4A 5CJ9A 1G59A 2EA4A 4U0VA 4Y7NJ 3QQAA 2BXYA 4BEHB 4XBFA 1IF1A 2Z5UA 4B43A 3SFIA 1W5CC 2QQ9A 4KMUX 2DDAA 3DBHB 2BEOA 1W5SA 4I98B 2HXOA 3M07A 4RDUA 3KP7A 2WADA 3W6VA 2W82A 4MFDA 5LFAA 1ERDA 1UB9A 1UJ8A 4Y52J 3CJRB 4LGWA 3WU2C 3BJ6A 1O3TA 3R61A 5IOYA 3RCOA 3GX4X 2QEXI 4AM3A 4UB8C 1V4RA 5DUKA 5L3DA 5EF6A 5HLGA 5EG0A 3OYAA 4L18B 1P6RA 1G6NA 1RKTA 4A3DJ 2CV1A 1S6LA 2R7FA 2P6TA 5F1RA 3K6GA 4O6JA 3F9KA 2DTZA 3BR2A 1YX5A 2R7ZJ 2AS5F 4V19K 2MD0A 1U5TA 3MMYB 1SFKA 3PIOF 2XPWA 4IPAA 2NOJB 4HLXA 1HLVA 4U0WA 3OIQA 1ZKGA 3SZTA 3TO9A 5H2FC 1HW5A 2O9LA 1Y8RB 1WJ5A 5C4JJ 3OYJA 1UZCA 1WZ2A 3SDGA 2E7WA 4PFOA 2K7LA 3KP5A 1O3QA 4LLNA 2NVUB 3F8CA 1D5VA 2TCTA 4WK8F 4E7ZA 1A35A 3PQKA 3CJTB 3OL3A 4UNOA 3HZJA 2E34A 2Q2EA 4IOAF 1VF9A 1P9QC 4XN0A 4XMYA 2Z1DA 4ZYHA 2IGMA 4JOMA 1VQNI 1GUUA 4A3JJ 2WV1A 3FX3A 1F1ZA 5E79C 3L7WA 5FKOA 2PG4A 4AIDA 2ELKA 1D3YA 2OTJI 3ABUA 1VZ0A 1VI0A 1ZG1A 1HKTA 3MCZA 5HS8A 4XIDA 2VT3A 3TO7A 3ERMA 4M3GA 3ZQIA 3WTUC 4M6XA 2DMUA 4Y15A 2DFHA 2PX9A 2YSRA 4LG3A 5E1XA 4DYRA 1HDDC 1R5GA 4RMNA 3M8FA 4XKVA 4JBAA 3TBIA 2E36A 1SVOA 2VKHA 3ISPA 1I1SA 2HEOA 4D1QA 4ZC3A 1BR2A 2EFWA 3N97A 3K4CA 3UNGC 3LSGA 4H0EA 2ME0A 1BW6A 4KMFA 1B4AA 2MFZA 1QU3A 1D1BA 3A01A 1W7PA 4E7JA 1J59A 3GEZA 3MZHA 3QYFA 3W6KB 1K79A 3LAJA 2Z3YA 3PFIA 1BIAA 2OD5A 3CMAI 1U2WA 4L5EA 3I3LA 2EQRA 2VL8A 5DCMB 2M34A 2ZBKA 1RR7A 3K9TA 1BI2A 2BBYA 3H92A 5LBQA 2IAIA 5BMZA 1SD6A 2EZKA 2VT2A 1RI7A 2H27A 4X6AJ 1R7JA 3EUAA 2JWTA 4UVCA 3GUDA 5D8KB 1W0UA 3FZVA 3H36A 4BBSJ 3MZ8A 2DMTA 4RB3C 2OTLI 2H09A 1MMGA 2IBDA 3QPSA 3E5UA 2EWNA 3ASOH 1IUYA 1WRJA 3LA7A 1JKPC 3BLYA 3S2DJ 3LSIA 1CQTA 1FTZA 3M8JA 2L2OA 4KICA 4NC7A 5JFRA 1JT6A 1XDUA 5GPAA 3GYHX 3M1CA 4A3FJ 4JX5A 2X6YA 2LY1A 4UV9A 3Q5FA 1Y1WJ 1D0XA 4P5OA 1Z05A 4ZJZA 2A5YB 5ERIA 2A61A 1WFXA 4FHTA 4EGZA 4YFXF 3CCEI 3S32A 4A93J 2Z9OA 1UELB 3DPTA 2XVCA 5K7ZA 5JVTA 3S2WA 5HOOA 3NWTA 4MHGA 3PJRA 4D5FA 2R7SA 2X6OA 3F0CA 3R0AA 4OIRF 2EZHA 2G9WA 3L00A 2MD5A 3HDDA 2O7OA 2EIKH 1V54H 2VBXA 2ZJRF 4QWQA 4W1UA 4CZCA 1UCRA 2MH9A 2R5ZB 1K83J 3C2HA 3TGNA 1TQMA 3HJEA 1YLFA 3V7RA 4CYCB 1N25A 2JMWA 4Z6YA 2P7CB 3Q9SA 2ZJPF 4KUMA 1SAXA 2WA0A 1IN8A 1WVRA 4EATA 1P4XA 2LG4A 4MTDA 1FZPB 4I99C 2LBFA 3BROA 1OCCH 2GAUA 3GVAA 2F5VA 2HVSA 2G0EA 3WTVC 2RC4A 5B1AH 3JRCA 2Y48A 4CHUA 1NG6A 2K27A 3OS1A 4EMSA 5K5QA 1FTTA 3MKYB 3CP8A 3Q9VA 5HVQC 2VE9A 2PI0A 1P4WA 1IAWA 3MZYA 3GLXA 1OPCA 4QLCU 1ETVA 3HC7A 2Y0MA 3CCQI 2NRAC 2DU9A 2V26A 1MD0A 2CJJA 2L3DA 2HVQA 4E70A 2K5CA 3K10A 5CQEA 1J7KA 2VI6A 3E6CC 1FOXA 2E1MB 3WGIA 3IAM2 3VYSB 1LKXA 4LB6B 2KHMA 4HEA2 3PNTA 4UY8I 1UG0A 3ZCOA 3V4GA 2YU3A 3DP7A 5J8CA 1XSVA 2ZMEA 5IT9Z 1V5FA 4LLGF 4ZH4F 2JJ7A 3B02A 2QQAA 4LB5A 1I50J 2CO5A 2HQRA 5K1YA 4AWXB 3F8NA 5GTHC 1GV5A 1W1WE 2HOEA 3RPQA 1V3FA 4DIQA 3FBNB 1FLIA 1YW7A 1WKMA 3HOUJ 5HS7A 2Z16A 3HSFA 3CO7C 3AG2H 2JSPA 2X1DA 4OIQF 2ELHA 3RTRA 1KYZA 2FXAA 1TT5B 4NQWA 1ULYA 3RKWA 1SVMA 3C2BA 3NRVA 2W00A 3OYFA 4BBRJ 2V1XA 4D7MA 4MLOA 1DPRA 2STTA 1S7AA 3F6VA 3ZQLA 2DYSH 1GXPA 4O5VA 2EK5A 2VJJA 2KJBA 2PJRB 3PIPF 4FCYA 1QZYA 1HQCA 2ECCA 4BY1J 3GTQJ 1SMYF 2H8WA 3WE3A 1VQ9I 3MKLA 2FBKA 5F08A 1X58A 4XRSA 2NVXJ 2HQ5A 3FMSA 4HX8A 2JK3A 3ERED 2DXIA 2E2HJ 1ZLKA 1BIBA 2X4HA 3I59B 2I8DA 2K40A 5IYBJ 4BE0A 1VQ4I 3ZRGA 2O61A 4FQGA 4AU7A 1TC3C 3I4MJ 2AQEA 3S1MJ 3ESWB 4XRFA 2QQ8A 5A2QZ 2LFBA 1YHQI 3FM3A 4DBRA 2LKXA 1BA5A 1ZRCA 3J7ZI 5D5VB 2IA1A 1TNSA 2OUMA 2FA5A 4KA4A 2IS6A 1K4TA 3FISA 5CPRB 2XASA 4KYWA 3NQOA 2BV6A 3AFHA 2VLAA 5LRSA 3ABTA 4S04A 4QSHA 2Y0SN 4WX9A 4A0XA 3K2AA 3BZCA 3BR3A 4ANJA 3U2RA 2OAZA 2E2IJ 1BJZA 1YS7A 2VIXA 2DI3A 4FE7A 2XPUA 4HF0A 2L4AA 4IZZA 5IPAA 4XRMA 4HLYA 2M3AA 4WXHA 3IHUA 2DW4A 2HTSA 5J8FA 4N9HA 1WJBA 3CZ6A 2LDUA 3WE2A 4PJJA 2DFIA 4MQ9F 4CCMA 1R49A 1HSJA 1IN5A 3KYDB 2K3PA 1FPQA 2D1VA 3NEUA 4PJNA 3HGYA 4E7SA 1MJ9A 1MKMA 2KIUA 4RM3A 2ESNA 4OINF 3VEPA 2PMUA 5K5RA 1OYWA 1ZLJA 1AKHB 1D8JA 2R0QC 3ELKA 3M7GA 1GVDA 2RNJA 1U5TC 2FMYA 2EFNA 2DA1A 2ADUA 5B3SH 4Y17A 5FJ8J 2BOLA 2EV6A 5GAEJ 3OS0A 3SFZA 1YW8A 1XDSA 2HTJA 2P5VA 1TT0A 3EDPA 4AIHA 2PN6A 4RGXA 2GA1A 5HODA 3VSLA 2EFPA 2WAFA 4NDLA 4CA0A 3LSRA 4G94A 2QSFX 1ZAOA 1BI1A 3KP3A 4A3MJ 1A6IA 4MEXF 4MO7A 4UVBA 1XC5A 2HYJA 3FK6A 4OMZA 3JAMZ 4P9UA 1VQ7I 4XOPA 3VWBA 1QO0D 3CLOA 4HNUA 3L2VA 1ZN2A 5FLMJ 1FMVA 1ITYA 2CG4A 4YRVA 4M3FA 1B72A 3ECHA 3GTMJ 1QZZA 1QNTA 4LG0B 4Q5SF 4MFEA 2ELJA 1XPXA 2Z33A 3LQQA 3REOA 2DYRH 3ZQ7A 2LK2A 2HDWA 2RDPA 2HOAA 2GWRA 1W5TA 4C3HJ 5J1UA 2FBIA 5L3GA 3CCJI 2AHQA 1N78A 1WJDA 1HXDA 2VASA 4U87A 1ZRDA 2BY1A 2OCCH 3RSNA 3OS2A 1J9IA 2RAEA 3U1KA 1B8IA 1X3UA 1GXQA 2HPIA 5F04A 1U6GA 2GXGA 4ZDLA 4CXFA 1YTYA 1ZR2A 3OOUA 1D1AA 2R5YB 1XMXA 1W36C 1B9MA 4MGRA 4DNCA 1LDKB 3ASNH 2EB7A 3CUQB 4EM1A 3G6EI 2DPUA 1LB2A 1RUOA 1FOKA 1XSDA 4E7LA 3LSHA 4LMYA 2EFQA 3GTOJ 1FT9A 5DD4A 3PQJA 1MDMB 1YRNA 1Z91A 3FK7A 5BOXA 5DDGA 3CCRI 1ZRFA 4M72A 2ZO4A 5K7FA 4MIMA 1Z3XA 4AIJA 2OJED 4E4HA 3WTYC 3CCMI 2FQ3A 5CQGA 3DPUA 3RIRA 3C18A 4ZYDA 4HNTA 1OCRH 3X2QH 2HU9A 2P6SA 2V9PA 4BE1A 3LAPA 2B7EA 2RQPA 2F5DA 2HDDA 1LFUP 3MVPA 3IKVA 2KIMA 3GF2A 3QWLA 1TZLA 4PGGA 3JREA 5DV5A 1ETXA 4BY7J 2P0WA 3C1DA 1EV7A 2CYYA 4PJMA 1K7AA 4XLHA 2IGKA 3CCSI 3PM1A 4C3IJ 2EV5A 2JT1A 5ICFA 2EIJH 1S3JA 2DT5A 3HKZN 4BNCA 5J40A 2TDXA 1U78A 4AVZA 5D4SA 2ZFWA 1H8AC 2BW3B 2XRNA 4PSXA 1C0WA 3A0HC 4CCLA 1W4MA 3JSOA 1O3RA 3LOCA 4A6EA 2Z99A 4LLLA 1TLHB 2FD5A 2RNGA 4A12A 2JA8J 3GZ5A 3KX2A 3KFWX 2ZXIA 4GYGA 3HB9A 1ON1A 3IC7A 2DBBA 1Z7LA 1LDDA 2OZUA 3L2CA 5H6QA 2KRCA 4KFCA 3OWTA 5F64A 1D8KA 2OV7A 1POGA 5HLHA 3L2UA 4RGUA 1PP8F 3K69A 5HNHA 2ISZA 4ENMA 5LGNA 1RPWA 4JK1X 3DU5A 1SEUA 3GO5A 2K9MA 3AKZA 4IQ4A 1G3SA 3RKXA 5EGOB 1IV8A 3FXKA 4XNFA 4ZZDA 1A5JA 2JVGA 1N77A 2LC2A 1HC8A 1Y8QB 4P9FA 2HDCA 1DP3A 3FMRA 1ONVA 3QOPA 3HOVJ 2YX4A 3VOEA 2JA2A 2KLOA 2IVMA 5H20A 4X1EA 2J5PA 4KIBA 5L3CA 2K9NA 5KK1A 4XR6A 2P5LC 3O8HA 5BQTA 3F6OA 3F8FA 3WTSC 2X1EA 1GHCA 2HZTA 5M5WJ 2DODA 4HF2A 2W85A 5FO5A 1WSUA 1AA7A 2YPRA 2N8GA 3D5RC 5F0HA 4HSTA 2NS7A 2QCOA 1KGSA 3AG1H 2PJPA 1UHWA 4P1WA 1WPKA 2PBIA 3DEWA 2CH0A 2E35A 3CUOA 1FYMA 3A2KA 1XSXA 2GXBA 1H9GA 2EFOA 1ZREA 4L0YB 3QP6A 3J80K 2ZMEC 2EILH 4OOIA 4RGRA 3RDIA 4UXNA 2D1HA 3VYRB 1R1TA 1JHHA 3FDYA 4CYDA 2Y9ZA 4BDZA 5EZGA 2NVYJ 4HOBA 2WWYA 3J81K 4OIOF 2R7VA 1KQ8A 3H5RA 3E97A 4DQ2A 1LVKA 5JVGF 1B9NA 4EJVA 4R79A 1FSHA 1H89C 1FBQA 2V1DA 2TRTA 2E2JJ 4BHCA 2A05A 3FKIJ 2BVMA 4GYIA 1IO2A 2V6CA 3ZQQA 4LIVA 4D0PA 1K61A 2WTEA 2KL4A 4FASD 3DEUA 4HX7A 3S8PA 3KZZA 3P9CA 4CCJA 1JTXA 4BQNA 4EJOA 1B8IB 1YW9A 2HKXA 3GCMA 2NAZA 2XAUA 5BS6A 2LY9A 1YQAA 3F22A 1IRGA 2L9RA 1BBYA 3HOXJ 3QU3A 1XGSA 1QPIA 4A2UA 4M74A 3ZMUA 4BQOA 1SFOJ 2WB1A 3IP4B 3PL8A 2QSHX 4N0BA 1MBGA 4K2EA 4C30A 3HYIA 3GMEA 1Q1VA 2L9SA 3G2BA 2O8KA 2YUSA 2A3SA 3OYIA 2M9HA 3BG3A 2GOMA 2DO7A 3O8GA 2QBYB 4LD5A 3MWMA 4BUPA 5ILUA 1O4XA 4JX6A 4IEJA 4UUSA 3K2ZA 3WGGA 4M3DA 1E3PA 2DMPA 1V5GA 3KIOA 2FOKA 3DWLE 4FETA 2K86A 1MJBA 1SAUA 2XF7A 1IUFA 1MW7A 4KITB 5B1BH 4BYYA 1G3WA 3ZQFA 1X4OA 5ICCA 3GZ6A 3OIOA 1T2KA 2CMPA 3L2WA 2ICWG 2JN6A 4Y33A 2R7WA 3MKZA 5DUIA 5LGTA 2H94A 4I2OA 4WWCA 5IYDJ 2L7KA 2MA3A 3TDUC 3E1SA 4CSWA 2YR2A 2UZKA 3R60A 2MABA 1DU0A 2DT7B 1SC7A 1WGXA 1JHFA 1WJAA 2O3FA 3V8LA 2IP2A 3G1LA 4G6TB 2QWWA 3LSKA 3HTUA 1VQLI 3AL0C 1YO5C 2L01A 2D45A 3LQRA 5D8LB 4DYCA 2FU4A 5GAGJ 5ED4A 2DA6A 4YIRX 4XOTA 2BE5F 1VQ8I 4EGYA 4FE4A 1ETKA 2R7RA 4G12A 4BGDA 1R6RA 5ICEA 2AXTC 1ZR4A 4A3LJ 4BKXA 1I27A 5GTIC 3D0SA 4L0ZB 3BY6A 4L9TA 2B0LA 3HRUA 1UHSA 2L0KA 3WU1B 5L3EA 1Z21A 3WTXC 2M0CA 4A3CJ 1XGNA 1L0OC 4YEJA 3CCUI 3CDLA 4HAMA 1FP2A 2XSJC 2L9NA 2R7UA 4CCNA 3CC2I 4BXXJ 3A02A 4A6DA 3DLLF 2VQHA 3L09A 4IRHA 3K1PA 4DGWB 5LRRA 2CUEA 2M0MA 3LFUA 2P5KA 2Y69H 3COAC 2P8TA 2DMNA 3D5SC 1ZARA 1FYLA 2RN7A 4G9YA 4DYQA 4YIIA 2Q1ZB 5LEJA 1EH6A 5KCMA 2HZDA 1OCZH 2GQQA 4IXAA 2X9DA 4C9YA 2COMA 4RLQA 1LE8B 2QM3A 2E1OA 1MJAA 2KKOA 2DK5A 3K4JA 1OR7C 3HHGA 3LSPA 3ZN0A 2Z2SB 3LWFA 1B59A 4RAZA 3D1NI 1JTYA 2KP6A 2LF8A 2MW8A 1U3EM 3K4NA 3J7YJ 4JX4A 1KONA 3WTTC 1UFMA 1JKRC 3QPHA 1H0MA 3BOQA 1RETA 4KIGA 2IW5A 2XAJA 3RQ4A 3L2QA 2LD5A 2JA5J 3IKTA 3I4NJ 5KHDA 1DQUA 4F91B 2ZSIB 4HDVA 1K78A 1ZH5A 2CUZA 3I54A 3LMMA 4AIKA 2CGPA 4HX4A 3TQNA 4NBQA 5D5UB 1M1EB 5J3LA 3HRSA 5GADJ 2EPFA 3R4KA 5E1ZB 3EYIA 2VXDA 5ILSA 5FKMA 1X1DA 1Z0XA 2VPRA 3ABLH 1RKWA 4WF2A 2PLYA 4LOCA 4HDUA 2LREA 2F5EA 3K7AJ 3FXJA 1IC8A 4E7HA 1TNTA 3ZR8X 1S9HA 1TWGJ 1SFEA 3HUGA 5FKLA 2QSGX 1JKQC 5C44J 2IEKA 3G1MA 1FBSA 3FXUA 1FIAA 1YIOA 3K1NA 3QP5A 1MH3A 3JW4A 4G6DA 2XUBA 4F55A 3CDHA 2D2WA 2DK8A 4YFNF 4NB5A 2D5VA 2KZVA 5EG0B 4ZTFA 4IHWA 3PO2J 5CKTA 1HCRA 4ON0A 3MN2A 5LHIA 1LJ9A 2FRHA 3HOYJ 2YS9A 2F6CA 4A3EJ 2WC2A 2Y30A 2O5RA 4D5CA 4BE2A 1UMQA 2HXIA 4I0AA 1U5TB 2LOOA 3DF8A 2KPMA 3WU0A 3P7NA 3A1YA 3IWZA 3DU6A 2BGCA 2MC4A 5J6XA 3QOEA 1SFUA 3B73A 2DQLA 1TW2A 3G73A 2DMQA 3JSPA 2W48A 1Z9CA 3WG9A 2GOXB 1A04A 3L1PA 3H3VK 2DJIA 2MBFA 1XD7A 4Y4RA 2CUFA 2K9SA 3CTAA 5E3NA 4U7BA 5GPCA 2BY2A 3KEOA 2CW7A 3HG9A 4PK4A 2Q2EB 4ENKA 3AAFA 1ETYA 3OR2C 3HOZJ 2QZ8A 2NOGA 5FLXZ 1F4KA 2ZNZA 2JUGA 3OYBA 3WHBA 4IF4A 1IV6A 3GFLA 5FRNA 2M5WA 3BR5A 2X6WA 2X51A 3I56I 3C7JA 4XICA 3UKGA 3MKWB 4E7IA 2XHKA 4KJZA 2HYFA 2ZFUA 1VQMI 2FX0A 3OV8A 1JGSA 1QHHD 1ZGJA 3KYCB 3JRIA 4XQFA 3F72A 2FSWA 3QU6A 5FB2A 3GFJA 3IRRA 1U8BA 2HQAA 3F21A 1R5ID 3OMYA 4EV0A 3HBLA 3G4SI 1UHMA 5ICGA 1B6AA 2VKEA 1PP7U 1G3TA 5BPDA 1IN4A 2XB5A 3FXMA 1J5YA 4G7ZF 4OIPF 1BR4A 4HF1A 1BW5A 3DTKA 5CVJA 1Z6RA 2ZNYA 3OYCA 5J1YA 2WY8Q 1RZ4A 4L9VA 2W57A 1CF7A 3TW7A 1A31A 5FRMA 1IW7F 1NH3A 1KYWA 3BQYA 2KRFA 3A01B 2VXZA 2I10A 5FROA 1PUFA 4G7OF 1W7PB 2A07F 2OQGA 2X6XA 3G1OA 1L3LA 2MLGA 1YIJI 5J4VA 2LLKA 4PSWA 3S1RJ 1OLTA 2H6CA 4BAYA 3NAUA 4RB2C 1O7LA 3E0JB 1APLC 3ML6A 4G6QA 3LL7A 4BJ5C 1QRYA 2DOFA 2L7ZA 4NC6A 2W24A 3SZPA 2LF7A 3QRFF 4NNJA 2WV0A 2DTRA 2IPQX 1LQ1A 1ENHA 2W4SA 1WJEA 4GFBA 1YYVA 1KU9A 3U21A 1IXCA 3BPVA 4TV7A 1MGTA 4IO9F 1LNWA 2WAQA 4HG2A 5IT3A 2CUJA 4AC0A 4W97A 3JTHA 1QHGA 5D5WB 4M6YA 4F92B 3QODA 4XLPF 2E5ZA 1BI3A 5E20A 2XROA 1FEXA 1MBEA 2VBYA 1FJLA 2IS2A 4N4OB 2K9QA 4L5JA 3LA3A 2VC1A 5IP9J 5K7HA 2VKVA 3V42A 1SD7A 2VQCA 4ASNA 3I9V2 4F7ZA 2FJ1A 1FSEA 2DA4A 2QKMB 3IAS2 1ZQ3P 4ENNA 4OU0A 4IQJA 2R7XA 4J19A 1OCPA 1HKSA 3ZXSA 4Q4ZF 4BJTA 1ZK8A 3S1QJ 1MIJA 1J2XA 1TW3A 3SDBA 1GV2A 2MSYA 3I53A 3U1DA 4BACA 2VUMJ 3S3NA 1J09A 1Y56A 3O2PE 4II2A 3HSRA 5FLVA 2CQXA 4PGHA 1YE9A 4B3AA 3PNYA 1MH4A 3GLLA 3BG6A 3FXOA 3H9GA 1LEBA 1TQIA 5E17F 4HW0A 3T1BA 1IXSB 2VB6A 2LBFB 3FXRA 4B44A 4IJAA 2MG4A 2PMZA 3B6AA 1BR1A 3C3WA 5CVRA 1TWHJ 3FXLA 4KT5C 1P92A 2M45A 3ZPLA 1S29A 4GCVA 1IN6A 2VOPA 3EQLF 3TP0A 3OR1C 3EETA 1EKEA 4DOZA 1TTYA 2JVHA 2R7QA 4KNYA 4V2FA 2ZC2A 3WGHA 3ZQGA 2VE8A 3HRMA 4FISA 3W2WA 1JE8A 2VKDA 5LHHA 4PFPA 1OR7A 1OYIA 4BJ6C 5DM7F 1I5ZA 4RGSA 2A68F 4RAGA 4KIFA 3LA2A 4ZDPA 4IRIA 3H0GJ 4LIUA 2RVCA 3ECOA 2EH3A 4IX7A 2ZMEB 2OC6A 1TWAJ 3N4MA 1AOYA 2K4JA 2LP0A 2Y9YA 2HKOA 1GDTA 1F9NA 1FOWA 1E0EA 1FOYA 4ABZA 1ORKA 4KISA 1X1AA 1IRFA 1I1GA 2JZYA 4DBQA 4OMYA 5M3MJ 1BM9A 2F5CA 3KP4A 3O6BB 3ZMSA 1ZHFA 3JTGA 3H3ZA 4NUBA 4BS9A 1HSTA 5IT9K 3ABKH 4MEYF 2HWVA 2HS5A 1FX7A 2ISYA 4UB6C 2DDBA 3WG7H 2HOSA 4NQWB 1HA8A 5D6EA 2XGXA 2CRGA 4RLFA 4N9IA 1D5YA 2XSDC 4PZJA 1ZGWA 3VSKA 2JRTA 3E5XA 4B4CA 3ROUA 2IT0A 1BN5A 4BEHA 9ANTA 1BC7C 1WJFA 5K5OA 4P55A 1GVJA 2COBA 1KZHA 3KCCA 1YJWI 1PDNC 1SVLA 4ETSA 3E7LA 1KU2A 3V8KA 3KEYA 4CZZA 4XLNF 4G8XA 4PJ0C 2LNBA 1NTCA 5HNFA 4PUSA 2FMLA 3P9KA 3CLQA 2IRFG 3RZDJ 5J47A 2FE3A 2KDZA 2ZKZA 2E71A 1DGWY 1AHDP 2F5FA 4HBLA 4IL6C 1JI8A 1YS6A 1VQ6I 5J1RA 5F27A 3F3XA 2B63J 5CYVA 5D6FA 1EA3A 1H88C 4EEFG 1DU6A 4O3MA 4XORA 3DV8A 2H6BA 1E2XA 2ESHA 5B66C 5A2QK 3EUHC 2GM4A 3Q3SA 2XAGA 5EZHA 3K70C 5CLSA 4RB1A 2BYVE 3NARA 2KRHA 3HEFA 1Z77A 2V1NA 4A69C 3ZOBA 1N75A 4XRSG 4DZPA 3ZGKA 2DOEA 2BHZA 2KDOA 3RYPA 1SD5A 3SEZA 4FT8A 2FUG2 5AONA 3HTSB 3S15J 4IRGA 1S7EA 3ZMDA 1X2MA 2KQRA 1OQYA 2EIMH 3E6BA 3EUHA 4XKCA 5H6RA 2XAHA 4CICA 1WCMJ 2LY2A 1XTAA 2XB0X 3QPTA 4HV6A 3H35A 3AL0B 3RKQA 2HQNA 4BHPA 1STZA 3K4KA 4JQFA 4Y3OA 2OBPA 3MD2A 1JUPA 2NXNB 2V9VA 1KU7A 3LSTA 5FD6A 5DEQA 2QKLB 2MLKA 5FFXA 1R00A 3VDXA 3R6SA 1IZ1A 3BZKA 3ZMVA 3JRBA 2IS4A 3BR0A 4GO1A 3HRTA 2B9SA 1QVUA 4IHXA 3ZQHA 5IP7J 1MMSA 1G8XA 4C3JJ 4UVAA 4Q48A 2V9KA 2WB1N 1WI3A 3IUOA 2M8GX 3CCLI 3OYKA 2ZJ2A 3PSIA 1F43A 1MSFC 4YFKF 1TBXA 3E6DA 4B48A 2VOOA 4LITA 3V8JA 4OWRB 2OPTA 3UR3C 2KIFA 2QF7A 3DKYA 3I58A 1IRZA 1Y0NA 2CW0F 2JA7J 5DCMA 1OKRA 2O03A 5LD2C 4DJAA 4XLAA 5DTDA 5IOZA 1XGMA 3RKYA 2JQ7A 1KQ9A 4HPQA 4OAYA 4Y13A 1OCTC 2HVRA 2QENA 4D9JA 2KZGA 1B72B 5JHUA 1UAAA 2GBYA 4XONA 3IRQA 3JAMK 3OYNA 1D1CA 3FM5A 4CDGA 3JRHA 2ME6A 1BI0A 2JA6J 1T39A 2HGCA 3RPUA 1YJNI 1Z3YA 4I7HA 3OYLA 3WTZA 5JHFA 5F0CA 2CS3A 4BU2A 4IHTA 3IH3A 2FNAA 3TP3A 4HSRA 4C2MJ 3I64A 1W36D 3E6MA 4MNUA 1W7PD 1WQ2A 1RUNA 1U9NA 5KNLA 4C2UA 1BOAA 1S8NA 3I71A 2NNYA 5TRDA 2RREA 4L9JA 5GP9A 1I6HJ 1A6QA 3S3MA 2CSOA 3DFGA 2OZ6A 2STWA 3P9IA 1HKQA 3H9QA 2Q0OA 3RYRA 1MZBA 1JJ8C 4HV5A 1OFCX 3I55I 4I76A 1R4MB 1MBHA 2M7AA 4WXDA 3IV5A 2JRMA 2P4WA 3NWSA 3CMYA 3GTGJ 3T8TA 3BJAA 3JCUC 4I6ZA 3GWZA 1YRNB 3VYTB 4BQAA 2L7FP 3BWGA 3U9GA 4M9ZA 2RV8A 2E19A 4B1RA 3RZOJ 3M4OJ 1T8IA 4CO8A 4IVNA 2DA3A 2H8RA 2VJIA 1G4DA 4G7HF 3EUKL 3LNQA 2R5ZA 4N4NB 2MC3A 2CWEA 4CGZA 4CYCA 4BL0B 5HLTA 4IHVA 2ECBA 2GLOA 3R0JA 1FMWA 4A0ZA 3ZQCA 4F93B 3B6CA 4P96A 3HOTA 3GBGA 1VQ5I 3GTPJ 4ITVA 2KJCA 2V79A 3KZYA 5HDGA 1ZTRA 2XGEA 3DQVC 4CUGA 1USTA 1HW2A 4IOCF 4A3IJ 1MNMC 2EZIA 1K4SA 1LEAA 4I02A 1VFCA 2G7UA 5FKNA 3BZ6A 3JR9A 3CO6C 4B3XA 2VBZA 3SZGA 2DA2A 3IH2A 3J7AO 3BG9A 3HOSA 3KEQA 4M9XA 3F8BA 3BG7A 2L02A 2F4MB 3PUBA 3K70D 1LVAA 2PMHA 2NYXA 3HL2A 4A3BJ 1QA6A 1R4NB 3PUFA 5E1WA 1P7JA 4AD9A 3FHZA 1HBXG 3D5LA 2RKHA 1BJAA 3A0BC 4XK4A 5D4RA 4AYBA 3BR6A 3I4PA 4Q47A 1YI2I 2O6GE 1B1BA 2M87A 2QQBA 4GDFA 4L5IA 2DA7A 3A4CA 3F23A 3PO3J 1P2FA 5KAIC 3FMQA 4C2TA 1Y39A 3CESA 3ZP5A 3RQIA 2DOAA 3GFMA 3ONQA 1WH7A 1Z1DA 1T33A 3CP2A 4JYKA 3BTIA 5E8IA 3DEEA 3QPLA 3KYLA 1OJLA 3KLNA 2UUZA 2VQGA 3TOAA 3TMOA 2FEZA 1R58A 5FD5A 1XB4A 1QQIA 2ACJA 4QPQA 1ON2A 2DFFA 4F3QA 3BT9A 2X48A 2XRLA 3AG4H 2DJNA 3CF5F 1XCBA 4I01A 4DW6A 1X3WB 3P5JA 1QPMA 4IKFA 4L9NA 3PSFA 4PDKA 1NK2P 4XLEA 3I5UA 4WXCA 1JT0A 3BPXA 1RR8C 4CCOA 5DM6F 3OIPA 3GTKJ 2UXNA 2PJRA 1D0ZA 1FIPA 2DCEA 2X85A 4FTHA 2C6YA 1HOMA 2K02A 4ESJA 1R36A 1LDJA 1IG7A 3Q0WA 1S7OA 1SFXA 3QAHA 2ZSHB 5TJJA 1IDZA 4UUVA 2P81A 4RAFA 3VB2A 5FGMA 4I0BA 3KZIC 1GLNA 3I59A 3PFYA 1G2HA 2VONA 4YG2F 4KN7X 2R7OA 3E3VA 1X3ZB 5AIPA 1BOBA 1U9OA 2OCEA 3VPRA 1WH5A 5M5YJ 1ZELA 3HIFA 1Y0UA 3GTJJ 3CCYA 4CH7A 1R1UA 1F5TA 2LH9A 4ESFA 4HYEA 4BXUA 2NNNA 5JLXA 3BTJA 2LKPA 6PAXA 2DQRA 2PQ8A 1E3OC 3DTEA 1V5EA 4ZDOA 1EJ9A 1RRJA 4BHBA 3JRGA 3M9AA 3LFKA 1RNLA 1O57A 1PYVA 2FQ4A 4U0YA 2W84A 3JRAA 3OSGA 5JR3A 2XDVA 1XCVA 3EYYA 2R92J 4BQQA 2CW8A 1PVEA 2FBHA 1U8RA 1MMDA 1RC9A 2BZTA 4D7NA 3J7AY 2JPBA 5EDNA 3OYMA 1J0RA 1TWFJ 2F4IA 5F6FA 2XGCA 2RGVA 5DYMA 3ABMH 1Z67A 3JRFA 3GZNB 3H5AA 3TO6A 2NS0A 3BC8A 4JP0A 1R71A 2LVSA 4GXOA 3IL2A 2HYGD 3FIWA 1AKHA 4NC8A 3BDDA 2AQFA 2XC7A 2HR3A 3CMMA 2OQRA 1YOVB 2ZCWA 1R9TJ 2BHYA 3CC7I 2BXZA 4UUSB 2HNHA 1FY7A 1NG7A 1XX5A 2ETHA 1D0YA 2CFXA 4RS8A 3BCAA 4A0YA 3EPZA 2CFOA 1SANA 2DPDA 2V1UA 5KVRA 4HA8A 4UHTA 1X2NA 3MQ0A 5LHGA 2DLLA 3DKWA 1RIOH 2KMUA 5JI6A 3Q0VA 2O0YA 2IGNA 3CC4I 2IS1A 1T0FC 1ZG3A 3ULQB 1DGRM 4EJWA 5EEAA 1XS9A 3CQZJ 5IP6A 1O3SA 5TISC 2M8EA 3BP8A 5C3EJ 1XMKA 2M4KA 2E1NA 3OYGA 5FFZA 4BDYA 4A5MA 1YG2A 5L3FA 4XN3A 1AU7A 2NVQJ 3A03A 1I3QJ 1XGOA 5CVIA 2NVTJ 2IXSA 2DT6A 3MAJA
chains in the Genus database with same CATH topology
1OMIA 4LG0A 5DD8A 3I0TA 1G3YA 3KP2A 4Z2YA 3WODF 1IXRC 1K6OA 2QLZA 4HQMA 3ZMTA 3IWFA 2X0LA 5EEGA 5D5XB 2IA0A 2GA2A 2R3SA 3CUQA 4M9SA 3OOPA 4PCQA 3M8EA 1MDMA 3F8MA 2QYOA 3FXQA 4ZZLA 1HW1A 1H9TA 3HHHA 5AIQA 1JXSA 3KP6A 2VC0A 4ESBA 4FX4A 3M1EA 1ZGAA 2FF4A 2PFBA 1IN7A 1DDNA 5EEHA 1WI9A 4KDPA 1R23A 4RB0A 2UWMA 3K1MA 4NHJA 1ODDA 4RAYA 3O3KA 4YIFA 3WTWC 5E8GA 3TOBA 1K78B 1E17A 2A6HF 4XSZF 1ZYRF 1FNNA 4LK1F 3RJPA 2E7XA 1R1VA 1NHAA 1FC3A 2L54A 2M30A 3FF5A 2XIGA 4ZYGA 2J5OA 1DP7P 4FX0A 2QVOA 2HFHA 2PEXA 3HSEA 2A69F 4I09A 4EJUA 2QUFA 4HQEA 5ILVA 3MFKA 3DPLC 1DPUA 3BJOA 1T98A 3KETA 2JSCA 1FP1D 1VTNC 2IA2A 3SXYA 3ZMZA 2IJLA 2XKPA 3SHFA 1T38A 2F2EA 4B8XA 5CVUA 3TDZC 4HZFA 4EQQA 2XKOA 4EVIA 2UXXA 3J80Z 1R5HA 4EJTA 1PUEE 2FNPA 2O8XA 1P4AA 2A6EF 2Q8KA 2CQKA 3J81Z 1ZG5A 2JTVA 2DAOA 2VBWA 4R8HA 2JPCA 2P7VB 3W6JB 4M71A 1SD4A 1XN7A 2EV0A 3RI4A 5E18F 3T5XA 5FLXK 2XAQA 4GGGA 5HLIA 3DXJF 4LJZF 3VODA 3GW2A 1O7FA 2W25A 1CF7B 2G7HA 1KU3A 1XMAA 3ZN1A 1AWCA 2OA4A 4B09A 4BH9A 1R22A 3GXOA 1REPC 4ZYEA 4U7DA 2QBYA 3L9FA 4A5NA 1J75A 1YFHA 1DUXC 2EA2A 1USSA 3CJNA 3TKYA 4IHSA 3MEXA 2GZWA 3FWEA 4ENJA 4U88A 1SMTA 1EH8A 1T0FA 3KE2A 1I6XA 2OU2A 4S05A 3V7CA 4LFUA 4EM2A 1Z7UA 1WWXA 1TQPA 3KLOA 4LK0F 3SQNA 2K4BA 1FWZA 2XAFA 3H3UA 3T0YA 5BPIA 2YX7A 1QBJA 2LSOA 5LEKA 2Y75A 4XSXF 5HDNA 1KA8A 2GIVA 4UV8A 4WCGA 2ZXJA 2M1BA 2E1CA 2R7DA 5HDKA 4M73A 2EJRA 4KN4X 5LGUA 2VN2A 4EM0B 2XV4S 3G3ZA 5LLQA 1Z6TA 4R1HA 1BC8C 2L4MA 2MH2A 4MTEA 4MQVA 3K0LA 1QGPA 1FYKA 5CVVA 1CGPA 1Q1HA 3T8RA 1T6SA 1KQ0A 3V7SA 1FBUA 4AVPA 1OYYA 5HS9A 3GFIA 3VFZA 3CUQC 1EH7A 5L3BA 2VODA 2AXLA 3E5QA 5DCFA 5CJ9A 2EA4A 4U0VA 4XBFA 1IF1A 2Z5UA 2QQ9A 4KMUX 2BEOA 1W5SA 4I98B 3KP7A 1UB9A 4LGWA 3BJ6A 1O3TA 3R61A 3GX4X 5L3DA 1V4RA 5DUKA 5HLGA 4L18B 1P6RA 1G6NA 1S6LA 2R7FA 2P6TA 5F1RA 4O6JA 2AS5F 1U5TA 4IPAA 4HLXA 4U0WA 3SZTA 3TO9A 1HW5A 2E7WA 2K7LA 3KP5A 1O3QA 4LLNA 3F8CA 1D5VA 4WK8F 3PQKA 4UNOA 2Q2EA 4ZYHA 3FX3A 1F1ZA 3L7WA 2PG4A 1D3YA 3ABUA 1ZG1A 1HKTA 3MCZA 5HS8A 2VT3A 3TO7A 3WTUC 4M6XA 4Y15A 2YSRA 5E1XA 1R5GA 3M8FA 4JBAA 3ISPA 1I1SA 2HEOA 2EFWA 3N97A 4H0EA 4KMFA 1B4AA 1W7PA 1J59A 3GEZA 3MZHA 3W6KB 1K79A 3LAJA 2Z3YA 3PFIA 1BIAA 2OD5A 1U2WA 5DCMB 2ZBKA 3K9TA 1BI2A 2BBYA 3H92A 5LBQA 5BMZA 1SD6A 2VT2A 1RI7A 2H27A 1R7JA 4UVCA 3GUDA 5D8KB 3FZVA 4RB3C 2H09A 3E5UA 2EWNA 1IUYA 1WRJA 3LA7A 4KICA 5JFRA 1XDUA 3GYHX 4UV9A 3Q5FA 4P5OA 1Z05A 2A5YB 5ERIA 2A61A 4FHTA 4EGZA 4YFXF 2Z9OA 3DPTA 2XVCA 5JVTA 3S2WA 5HOOA 4MHGA 3R0AA 4OIRF 2G9WA 3L00A 2MD5A 2VBXA 4QWQA 1UCRA 2MH9A 3TGNA 1TQMA 1YLFA 3V7RA 2P7CB 3Q9SA 4KUMA 1SAXA 1IN8A 1P4XA 4MTDA 1FZPB 3BROA 2GAUA 3GVAA 3WTVC 2RC4A 2Y48A 4CHUA 2K27A 4EMSA 5K5QA 2VE9A 3Q9VA 5HVQC 2PI0A 1P4WA 1IAWA 3MZYA 3GLXA 1OPCA 4QLCU 2NRAC 2Y0MA 2DU9A 1MD0A 2L3DA 4E70A 3E6CC 1J7KA 3WGIA 4LB6B 3V4GA 2YU3A 3DP7A 5J8CA 1XSVA 2ZMEA 5IT9Z 4LLGF 4ZH4F 3B02A 2QQAA 4LB5A 2CO5A 2HQRA 5K1YA 4AWXB 3F8NA 2HOEA 3RPQA 1V3FA 1FLIA 1YW7A 1WKMA 5HS7A 3HSFA 3CO7C 4OIQF 2ELHA 3RTRA 1KYZA 2FXAA 4NQWA 1ULYA 3RKWA 3NRVA 2V1XA 1DPRA 2STTA 1S7AA 3F6VA 1GXPA 4O5VA 2EK5A 2KJBA 1QZYA 1HQCA 1SMYF 3WE3A 2FBKA 3FMSA 4HX8A 3ERED 1ZLKA 1BIBA 2X4HA 3I59B 2O61A 4XRFA 5A2QZ 3FM3A 1ZRCA 5D5VB 2IA1A 1TNSA 2FA5A 4KA4A 2XASA 4KYWA 3NQOA 2BV6A 5LRSA 3ABTA 4S04A 4WX9A 4A0XA 3U2RA 2OAZA 1YS7A 2DI3A 4HF0A 2L4AA 4HLYA 4WXHA 3IHUA 2DW4A 2HTSA 5J8FA 4N9HA 2LDUA 3WE2A 2DFIA 4MQ9F 1HSJA 1IN5A 1FPQA 2D1VA 3NEUA 1MJ9A 1MKMA 2KIUA 2ESNA 4OINF 3VEPA 2PMUA 5K5RA 1OYWA 1ZLJA 1D8JA 3ELKA 3M7GA 2RNJA 1U5TC 2FMYA 2EFNA 2ADUA 4Y17A 2EV6A 3SFZA 1YW8A 1XDSA 2HTJA 2P5VA 3EDPA 4AIHA 2PN6A 4RGXA 2GA1A 2EFPA 4G94A 1ZAOA 1BI1A 3KP3A 4MEXF 4UVBA 4P9UA 4OMZA 3JAMZ 1QO0D 3CLOA 1ZN2A 2CG4A 3ECHA 1QZZA 1QNTA 4LG0B 4Q5SF 2Z33A 3LQQA 3REOA 3ZQ7A 2RDPA 2GWRA 1W5TA 2FBIA 5L3GA 1HXDA 1ZRDA 1J9IA 1X3UA 1GXQA 1U6GA 2GXGA 4CXFA 1YTYA 1B9MA 4MGRA 4DNCA 1LDKB 2EB7A 3CUQB 4EM1A 2DPUA 1LB2A 1RUOA 1FOKA 1XSDA 4LMYA 2EFQA 1FT9A 5DD4A 3PQJA 1MDMB 1Z91A 5BOXA 5DDGA 1ZRFA 4M72A 2ZO4A 4AIJA 3WTYC 2FQ3A 3RIRA 3C18A 4ZYDA 2P6SA 3LAPA 2RQPA 2F5DA 3IKVA 2KIMA 3GF2A 4PGGA 5DV5A 3C1DA 1EV7A 2CYYA 1K7AA 2EV5A 2JT1A 5ICFA 1S3JA 2DT5A 4BNCA 1U78A 2TDXA 5D4SA 2ZFWA 2XRNA 1C0WA 1W4MA 3JSOA 1O3RA 4A6EA 2Z99A 4LLLA 1TLHB 4A12A 3GZ5A 3KFWX 4GYGA 1ON1A 3IC7A 2DBBA 1LDDA 2OZUA 3L2CA 5H6QA 4KFCA 5F64A 1D8KA 5HLHA 4RGUA 1PP8F 3K69A 2ISZA 4ENMA 5LGNA 4JK1X 3GO5A 1G3SA 3RKXA 4ZZDA 4P9FA 2HDCA 3FMRA 1ONVA 3QOPA 3VOEA 2YX4A 5H20A 2IVMA 2J5PA 4KIBA 5L3CA 5KK1A 2P5LC 5BQTA 3F6OA 3F8FA 3WTSC 1GHCA 2HZTA 4HF2A 2W85A 5FO5A 1WSUA 2YPRA 1KGSA 2PJPA 1UHWA 2PBIA 1FYMA 3CUOA 1XSXA 2GXBA 1H9GA 2EFOA 1ZREA 4L0YB 3QP6A 3J80K 4OOIA 4RGRA 3RDIA 4UXNA 2D1HA 1R1TA 1JHHA 4CYDA 4HOBA 2WWYA 3J81K 4OIOF 1KQ8A 3E97A 4DQ2A 1B9NA 4EJVA 4R79A 1FSHA 1FBQA 2V1DA 4BHCA 4GYIA 2V6CA 4D0PA 2WTEA 3DEUA 4HX7A 3KZZA 3P9CA 4EJOA 1YW9A 2HKXA 2NAZA 5BS6A 1YQAA 3F22A 1IRGA 1BBYA 3QU3A 1XGSA 4A2UA 4M74A 3ZMUA 4N0BA 4K2EA 3HYIA 2A3SA 2DO7A 2QBYB 4LD5A 3MWMA 5ILUA 3K2ZA 3WGGA 2FOKA 2K86A 1MJBA 4BYYA 1G3WA 5ICCA 3GZ6A 1T2KA 5DUIA 5LGTA 2H94A 4I2OA 4WWCA 2MA3A 3TDUC 2YR2A 2UZKA 3R60A 1JHFA 2O3FA 3V8LA 2IP2A 2QWWA 3HTUA 1YO5C 2L01A 2D45A 3LQRA 5D8LB 5ED4A 2FU4A 2BE5F 4EGYA 5ICEA 1I27A 3D0SA 4L0ZB 3BY6A 4L9TA 2B0LA 3HRUA 3WU1B 5L3EA 3WTXC 1XGNA 1L0OC 4HAMA 1FP2A 4A6DA 3L09A 4IRHA 3K1PA 5LRRA 3COAC 2P5KA 2P8TA 1ZARA 1FYLA 2RN7A 4G9YA 4YIIA 5LEJA 1EH6A 2GQQA 4IXAA 2COMA 2QM3A 1MJAA 2KKOA 2DK5A 3HHGA 3ZN0A 3LWFA 1B59A 4RAZA 2LF8A 1U3EM 3WTTC 1UFMA 3QPHA 1H0MA 3BOQA 4KIGA 2IW5A 2XAJA 3IKTA 4HDVA 1K78A 1ZH5A 3I54A 4AIKA 2CGPA 4HX4A 3TQNA 5D5UB 3HRSA 3R4KA 5E1ZB 3EYIA 5ILSA 4WF2A 2PLYA 4HDUA 2F5EA 1TNTA 1SFEA 3HUGA 1FBSA 3FXUA 1YIOA 3K1NA 3QP5A 3JW4A 4G6DA 2XUBA 3CDHA 2D2WA 2DK8A 4YFNF 4NB5A 4ON0A 5LHIA 1LJ9A 2FRHA 2WC2A 4I0AA 1U5TB 3DF8A 3WU0A 3P7NA 3IWZA 2BGCA 5J6XA 1SFUA 3B73A 2DQLA 1TW2A 3G73A 3JSPA 1Z9CA 3WG9A 1A04A 2MBFA 1XD7A 3CTAA 4U7BA 3KEOA 4ENKA 3AAFA 2QZ8A 5FLXZ 1F4KA 2ZNZA 4IF4A 3GFLA 2M5WA 3C7JA 2XHKA 2HYFA 3OV8A 1JGSA 1ZGJA 3F72A 2FSWA 3QU6A 5FB2A 3GFJA 3IRRA 3F21A 4EV0A 1UHMA 5ICGA 1B6AA 1PP7U 1G3TA 5BPDA 1IN4A 4OIPF 1J5YA 4G7ZF 4HF1A 5CVJA 1Z6RA 2ZNYA 1RZ4A 4L9VA 2W57A 1CF7A 1IW7F 1KYWA 2KRFA 2VXZA 4G7OF 1W7PB 2A07F 2OQGA 1L3LA 2MLGA 2H6CA 4BAYA 4RB2C 1O7LA 3ML6A 4G6QA 2W24A 3SZPA 2LF7A 3QRFF 2WV0A 2DTRA 2IPQX 1LQ1A 1YYVA 1KU9A 1IXCA 3BPVA 4TV7A 1MGTA 1LNWA 5IT3A 3JTHA 5D5WB 4M6YA 4XLPF 1BI3A 5E20A 2XROA 2VBYA 4L5JA 3LA3A 2VC1A 1SD7A 4ASNA 4F7ZA 1FSEA 4ENNA 4OU0A 1HKSA 4Q4ZF 1J2XA 1TW3A 3I53A 3U1DA 3O2PE 3HSRA 4PGHA 1LEBA 1TQIA 5E17F 4HW0A 3T1BA 1IXSB 3FXRA 4IJAA 3C3WA 5CVRA 4KT5C 1P92A 2M45A 3ZPLA 1S29A 4GCVA 1IN6A 2VOPA 3EQLF 3EETA 1TTYA 4KNYA 3WGHA 2VE8A 3HRMA 1JE8A 5LHHA 1OR7A 1OYIA 1I5ZA 4RGSA 2A68F 4KIFA 3LA2A 4IRIA 2RVCA 3ECOA 2ZMEB 3N4MA 1AOYA 2K4JA 2HKOA 1F9NA 1IRFA 1I1GA 2JZYA 4OMYA 1BM9A 2F5CA 3KP4A 3O6BB 3ZMSA 1ZHFA 3JTGA 3H3ZA 1HSTA 5IT9K 4MEYF 2HWVA 2HS5A 1FX7A 2ISYA 5D6EA 2XGXA 4N9IA 4PZJA 2JRTA 3E5XA 3ROUA 2IT0A 1BN5A 1BC7C 5K5OA 4P55A 1GVJA 3KCCA 1PDNC 4ETSA 1KU2A 3V8KA 4CZZA 4XLNF 4G8XA 2LNBA 2FMLA 3P9KA 2IRFG 2FE3A 2ZKZA 2F5FA 4HBLA 1YS6A 3F3XA 5CYVA 5D6FA 4O3MA 3DV8A 2H6BA 1E2XA 2ESHA 5A2QK 2XAGA 5CLSA 4RB1A 2BYVE 3RYPA 1SD5A 4FT8A 5AONA 3HTSB 4IRGA 3ZMDA 3EUHA 3E6BA 5H6RA 2XAHA 4CICA 3QPTA 4HV6A 2HQNA 4BHPA 1STZA 4JQFA 2OBPA 2V9VA 1KU7A 3LSTA 5FD6A 5DEQA 2MLKA 5FFXA 1R00A 3R6SA 1IZ1A 3ZMVA 4GO1A 3HRTA 4UVAA 4Q48A 2ZJ2A 4YFKF 1TBXA 3E6DA 2VOOA 3V8JA 2KIFA 3I58A 2CW0F 5DCMA 1OKRA 2O03A 1XGMA 3RKYA 1KQ9A 4Y13A 2QENA 5JHUA 3IRQA 3JAMK 3FM5A 4CDGA 1BI0A 1T39A 2HGCA 3RPUA 4I7HA 3WTZA 4IHTA 2FNAA 3I64A 3E6MA 4MNUA 1W7PD 1WQ2A 1RUNA 1BOAA 1S8NA 3I71A 2NNYA 5TRDA 4L9JA 2CSOA 3DFGA 2OZ6A 2STWA 3P9IA 1HKQA 2Q0OA 3RYRA 1MZBA 4HV5A 4WXDA 2P4WA 3T8TA 3BJAA 3GWZA 4BQAA 3BWGA 3U9GA 4M9ZA 2RV8A 4CO8A 4IVNA 1G4DA 4G7HF 2MC3A 2CWEA 4CGZA 3R0JA 4A0ZA 4P96A 3HOTA 2KJCA 2V79A 3KZYA 5HDGA 3DQVC 1USTA 1HW2A 1LEAA 4I02A 2G7UA 3BZ6A 3CO6C 2VBZA 3J7AO 3HOSA 3KEQA 4M9XA 3F8BA 2L02A 1LVAA 2PMHA 2NYXA 5E1WA 4AD9A 3FHZA 1HBXG 3D5LA 2RKHA 1BJAA 5D4RA 3I4PA 4Q47A 2O6GE 1B1BA 2M87A 2QQBA 4L5IA 3F23A 1P2FA 3FMQA 3ZP5A 3GFMA 1Z1DA 5E8IA 3KLNA 3TOAA 2FEZA 1R58A 5FD5A 1XB4A 1QQIA 2ACJA 1ON2A 1XCBA 4I01A 1QPMA 4L9NA 4PDKA 3I5UA 4WXCA 3BPXA 2UXNA 2C6YA 2K02A 4ESJA 1R36A 1LDJA 1S7OA 1SFXA 3QAHA 5TJJA 4UUVA 3VB2A 5FGMA 4I0BA 3I59A 2VONA 4YG2F 4KN7X 3E3VA 5AIPA 3HIFA 1Y0UA 1R1UA 1F5TA 4ESFA 4HYEA 4BXUA 2NNNA 2LKPA 6PAXA 2DQRA 2PQ8A 4BHBA 3M9AA 3LFKA 1RNLA 1O57A 4U0YA 2W84A 5JR3A 3EYYA 1XCVA 2FBHA 1U8RA 2JPBA 1J0RA 5F6FA 2RGVA 5DYMA 3TO6A 2NS0A 4GXOA 3IL2A 2HYGD 3BDDA 2HR3A 2OQRA 2ZCWA 1FY7A 2ETHA 4RS8A 2CFXA 4A0YA 2DPDA 2V1UA 5KVRA 4HA8A 4UHTA 3MQ0A 5LHGA 2DLLA 3DKWA 1RIOH 5JI6A 2O0YA 1ZG3A 3ULQB 4EJWA 1O3SA 2M8EA 3BP8A 1XMKA 2E1NA 5FFZA 4A5MA 1YG2A 5L3FA 1XGOA 5CVIA 3MAJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OMI A;  4LG0 A;  5DD8 A;  3I0T A;  1G3Y A;  3KP2 A;  4Z2Y A;  3WOD F;  1IXR C;  1K6O A;  2QLZ A;  4HQM A;  3ZMT A;  3IWF A;  2X0L A;  5EEG A;  5D5X B;  2IA0 A;  2GA2 A;  2R3S A;  3CUQ A;  4M9S A;  3OOP A;  4PCQ A;  3M8E A;  1MDM A;  3F8M A;  2QYO A;  3FXQ A;  4ZZL A;  1HW1 A;  1H9T A;  3HHH A;  5AIQ A;  1JXS A;  3KP6 A;  2VC0 A;  4ESB A;  4FX4 A;  3M1E A;  1ZGA A;  2FF4 A;  2PFB A;  1IN7 A;  1DDN A;  5EEH A;  1WI9 A;  4KDP A;  1R23 A;  4RB0 A;  2UWM A;  3K1M A;  4NHJ A;  1ODD A;  4RAY A;  3O3K A;  4YIF A;  3WTW C;  5E8G A;  3TOB A;  1K78 B;  1E17 A;  2A6H F;  4XSZ F;  1ZYR F;  1FNN A;  4LK1 F;  3RJP A;  2E7X A;  1R1V A;  1NHA A;  1FC3 A;  2L54 A;  2M30 A;  3FF5 A;  2XIG A;  4ZYG A;  2J5O A;  1DP7 P;  4FX0 A;  2QVO A;  2HFH A;  2PEX A;  3HSE A;  2A69 F;  4I09 A;  4EJU A;  2QUF A;  4HQE A;  5ILV A;  3MFK A;  3DPL C;  1DPU A;  3BJO A;  1T98 A;  3KET A;  2JSC A;  1FP1 D;  1VTN C;  2IA2 A;  3SXY A;  3ZMZ A;  2IJL A;  2XKP A;  3SHF A;  1T38 A;  2F2E A;  4B8X A;  5CVU A;  3TDZ C;  4HZF A;  4EQQ A;  2XKO A;  4EVI A;  2UXX A;  3J80 Z;  1R5H A;  4EJT A;  1PUE E;  2FNP A;  2O8X A;  1P4A A;  2A6E F;  2Q8K A;  2CQK A;  3J81 Z;  1ZG5 A;  2JTV A;  2DAO A;  2VBW A;  4R8H A;  2JPC A;  2P7V B;  3W6J B;  4M71 A;  1SD4 A;  1XN7 A;  2EV0 A;  3RI4 A;  5E18 F;  3T5X A;  5FLX K;  2XAQ A;  4GGG A;  5HLI A;  3DXJ F;  4LJZ F;  3VOD A;  3GW2 A;  1O7F A;  2W25 A;  1CF7 B;  2G7H A;  1KU3 A;  1XMA A;  3ZN1 A;  1AWC A;  2OA4 A;  4B09 A;  4BH9 A;  1R22 A;  3GXO A;  1REP C;  4ZYE A;  4U7D A;  2QBY A;  3L9F A;  4A5N A;  1J75 A;  1YFH A;  1DUX C;  2EA2 A;  1USS A;  3CJN A;  3TKY A;  4IHS A;  3MEX A;  2GZW A;  3FWE A;  4ENJ A;  4U88 A;  1SMT A;  1EH8 A;  1T0F A;  3KE2 A;  1I6X A;  2OU2 A;  4S05 A;  3V7C A;  4LFU A;  4EM2 A;  1Z7U A;  1WWX A;  1TQP A;  3KLO A;  4LK0 F;  3SQN A;  2K4B A;  1FWZ A;  2XAF A;  3H3U A;  3T0Y A;  5BPI A;  2YX7 A;  1QBJ A;  2LSO A;  5LEK A;  2Y75 A;  4XSX F;  5HDN A;  1KA8 A;  2GIV A;  4UV8 A;  4WCG A;  2ZXJ A;  2M1B A;  2E1C A;  2R7D A;  5HDK A;  4M73 A;  2EJR A;  4KN4 X;  5LGU A;  2VN2 A;  4EM0 B;  2XV4 S;  3G3Z A;  5LLQ A;  1Z6T A;  4R1H A;  1BC8 C;  2L4M A;  2MH2 A;  4MTE A;  4MQV A;  3K0L A;  1QGP A;  1FYK A;  5CVV A;  1CGP A;  1Q1H A;  3T8R A;  1T6S A;  1KQ0 A;  3V7S A;  1FBU A;  4AVP A;  1OYY A;  5HS9 A;  3GFI A;  3VFZ A;  3CUQ C;  1EH7 A;  5L3B A;  2VOD A;  2AXL A;  3E5Q A;  5DCF A;  5CJ9 A;  2EA4 A;  4U0V A;  4XBF A;  1IF1 A;  2Z5U A;  2QQ9 A;  4KMU X;  2BEO A;  1W5S A;  4I98 B;  3KP7 A;  1UB9 A;  4LGW A;  3BJ6 A;  1O3T A;  3R61 A;  3GX4 X;  5L3D A;  1V4R A;  5DUK A;  5HLG A;  4L18 B;  1P6R A;  1G6N A;  1S6L A;  2R7F A;  2P6T A;  5F1R A;  4O6J A;  2AS5 F;  1U5T A;  4IPA A;  4HLX A;  4U0W A;  3SZT A;  3TO9 A;  1HW5 A;  2E7W A;  2K7L A;  3KP5 A;  1O3Q A;  4LLN A;  3F8C A;  1D5V A;  4WK8 F;  3PQK A;  4UNO A;  2Q2E A;  4ZYH A;  3FX3 A;  1F1Z A;  3L7W A;  2PG4 A;  1D3Y A;  3ABU A;  1ZG1 A;  1HKT A;  3MCZ A;  5HS8 A;  2VT3 A;  3TO7 A;  3WTU C;  4M6X A;  4Y15 A;  2YSR A;  5E1X A;  1R5G A;  3M8F A;  4JBA A;  3ISP A;  1I1S A;  2HEO A;  2EFW A;  3N97 A;  4H0E A;  4KMF A;  1B4A A;  1W7P A;  1J59 A;  3GEZ A;  3MZH A;  3W6K B;  1K79 A;  3LAJ A;  2Z3Y A;  3PFI A;  1BIA A;  2OD5 A;  1U2W A;  5DCM B;  2ZBK A;  3K9T A;  1BI2 A;  2BBY A;  3H92 A;  5LBQ A;  5BMZ A;  1SD6 A;  2VT2 A;  1RI7 A;  2H27 A;  1R7J A;  4UVC A;  3GUD A;  5D8K B;  3FZV A;  4RB3 C;  2H09 A;  3E5U A;  2EWN A;  1IUY A;  1WRJ A;  3LA7 A;  4KIC A;  5JFR A;  1XDU A;  3GYH X;  4UV9 A;  3Q5F A;  4P5O A;  1Z05 A;  2A5Y B;  5ERI A;  2A61 A;  4FHT A;  4EGZ A;  4YFX F;  2Z9O A;  3DPT A;  2XVC A;  5JVT A;  3S2W A;  5HOO A;  4MHG A;  3R0A A;  4OIR F;  2G9W A;  3L00 A;  2MD5 A;  2VBX A;  4QWQ A;  1UCR A;  2MH9 A;  3TGN A;  1TQM A;  1YLF A;  3V7R A;  2P7C B;  3Q9S A;  4KUM A;  1SAX A;  1IN8 A;  1P4X A;  4MTD A;  1FZP B;  3BRO A;  2GAU A;  3GVA A;  3WTV C;  2RC4 A;  2Y48 A;  4CHU A;  2K27 A;  4EMS A;  5K5Q A;  2VE9 A;  3Q9V A;  5HVQ C;  2PI0 A;  1P4W A;  1IAW A;  3MZY A;  3GLX A;  1OPC A;  4QLC U;  2NRA C;  2Y0M A;  2DU9 A;  1MD0 A;  2L3D A;  4E70 A;  3E6C C;  1J7K A;  3WGI A;  4LB6 B;  3V4G A;  2YU3 A;  3DP7 A;  5J8C A;  1XSV A;  2ZME A;  5IT9 Z;  4LLG F;  4ZH4 F;  3B02 A;  2QQA A;  4LB5 A;  2CO5 A;  2HQR A;  5K1Y A;  4AWX B;  3F8N A;  2HOE A;  3RPQ A;  1V3F A;  1FLI A;  1YW7 A;  1WKM A;  5HS7 A;  3HSF A;  3CO7 C;  4OIQ F;  2ELH A;  3RTR A;  1KYZ A;  2FXA A;  4NQW A;  1ULY A;  3RKW A;  3NRV A;  2V1X A;  1DPR A;  2STT A;  1S7A A;  3F6V A;  1GXP A;  4O5V A;  2EK5 A;  2KJB A;  1QZY A;  1HQC A;  1SMY F;  3WE3 A;  2FBK A;  3FMS A;  4HX8 A;  3ERE D;  1ZLK A;  1BIB A;  2X4H A;  3I59 B;  2O61 A;  4XRF A;  5A2Q Z;  3FM3 A;  1ZRC A;  5D5V B;  2IA1 A;  1TNS A;  2FA5 A;  4KA4 A;  2XAS A;  4KYW A;  3NQO A;  2BV6 A;  5LRS A;  3ABT A;  4S04 A;  4WX9 A;  4A0X A;  3U2R A;  2OAZ A;  1YS7 A;  2DI3 A;  4HF0 A;  2L4A A;  4HLY A;  4WXH A;  3IHU A;  2DW4 A;  2HTS A;  5J8F A;  4N9H A;  2LDU A;  3WE2 A;  2DFI A;  4MQ9 F;  1HSJ A;  1IN5 A;  1FPQ A;  2D1V A;  3NEU A;  1MJ9 A;  1MKM A;  2KIU A;  2ESN A;  4OIN F;  3VEP A;  2PMU A;  5K5R A;  1OYW A;  1ZLJ A;  1D8J A;  3ELK A;  3M7G A;  2RNJ A;  1U5T C;  2FMY A;  2EFN A;  2ADU A;  4Y17 A;  2EV6 A;  3SFZ A;  1YW8 A;  1XDS A;  2HTJ A;  2P5V A;  3EDP A;  4AIH A;  2PN6 A;  4RGX A;  2GA1 A;  2EFP A;  4G94 A;  1ZAO A;  1BI1 A;  3KP3 A;  4MEX F;  4UVB A;  4P9U A;  4OMZ A;  3JAM Z;  1QO0 D;  3CLO A;  1ZN2 A;  2CG4 A;  3ECH A;  1QZZ A;  1QNT A;  4LG0 B;  4Q5S F;  2Z33 A;  3LQQ A;  3REO A;  3ZQ7 A;  2RDP A;  2GWR A;  1W5T A;  2FBI A;  5L3G A;  1HXD A;  1ZRD A;  1J9I A;  1X3U A;  1GXQ A;  1U6G A;  2GXG A;  4CXF A;  1YTY A;  1B9M A;  4MGR A;  4DNC A;  1LDK B;  2EB7 A;  3CUQ B;  4EM1 A;  2DPU A;  1LB2 A;  1RUO A;  1FOK A;  1XSD A;  4LMY A;  2EFQ A;  1FT9 A;  5DD4 A;  3PQJ A;  1MDM B;  1Z91 A;  5BOX A;  5DDG A;  1ZRF A;  4M72 A;  2ZO4 A;  4AIJ A;  3WTY C;  2FQ3 A;  3RIR A;  3C18 A;  4ZYD A;  2P6S A;  3LAP A;  2RQP A;  2F5D A;  3IKV A;  2KIM A;  3GF2 A;  4PGG A;  5DV5 A;  3C1D A;  1EV7 A;  2CYY A;  1K7A A;  2EV5 A;  2JT1 A;  5ICF A;  1S3J A;  2DT5 A;  4BNC A;  1U78 A;  2TDX A;  5D4S A;  2ZFW A;  2XRN A;  1C0W A;  1W4M A;  3JSO A;  1O3R A;  4A6E A;  2Z99 A;  4LLL A;  1TLH B;  4A12 A;  3GZ5 A;  3KFW X;  4GYG A;  1ON1 A;  3IC7 A;  2DBB A;  1LDD A;  2OZU A;  3L2C A;  5H6Q A;  4KFC A;  5F64 A;  1D8K A;  5HLH A;  4RGU A;  1PP8 F;  3K69 A;  2ISZ A;  4ENM A;  5LGN A;  4JK1 X;  3GO5 A;  1G3S A;  3RKX A;  4ZZD A;  4P9F A;  2HDC A;  3FMR A;  1ONV A;  3QOP A;  3VOE A;  2YX4 A;  5H20 A;  2IVM A;  2J5P A;  4KIB A;  5L3C A;  5KK1 A;  2P5L C;  5BQT A;  3F6O A;  3F8F A;  3WTS C;  1GHC A;  2HZT A;  4HF2 A;  2W85 A;  5FO5 A;  1WSU A;  2YPR A;  1KGS A;  2PJP A;  1UHW A;  2PBI A;  1FYM A;  3CUO A;  1XSX A;  2GXB A;  1H9G A;  2EFO A;  1ZRE A;  4L0Y B;  3QP6 A;  3J80 K;  4OOI A;  4RGR A;  3RDI A;  4UXN A;  2D1H A;  1R1T A;  1JHH A;  4CYD A;  4HOB A;  2WWY A;  3J81 K;  4OIO F;  1KQ8 A;  3E97 A;  4DQ2 A;  1B9N A;  4EJV A;  4R79 A;  1FSH A;  1FBQ A;  2V1D A;  4BHC A;  4GYI A;  2V6C A;  4D0P A;  2WTE A;  3DEU A;  4HX7 A;  3KZZ A;  3P9C A;  4EJO A;  1YW9 A;  2HKX A;  2NAZ A;  5BS6 A;  1YQA A;  3F22 A;  1IRG A;  1BBY A;  3QU3 A;  1XGS A;  4A2U A;  4M74 A;  3ZMU A;  4N0B A;  4K2E A;  3HYI A;  2A3S A;  2DO7 A;  2QBY B;  4LD5 A;  3MWM A;  5ILU A;  3K2Z A;  3WGG A;  2FOK A;  2K86 A;  1MJB A;  4BYY A;  1G3W A;  5ICC A;  3GZ6 A;  1T2K A;  5DUI A;  5LGT A;  2H94 A;  4I2O A;  4WWC A;  2MA3 A;  3TDU C;  2YR2 A;  2UZK A;  3R60 A;  1JHF A;  2O3F A;  3V8L A;  2IP2 A;  2QWW A;  3HTU A;  1YO5 C;  2L01 A;  2D45 A;  3LQR A;  5D8L B;  5ED4 A;  2FU4 A;  2BE5 F;  4EGY A;  5ICE A;  1I27 A;  3D0S A;  4L0Z B;  3BY6 A;  4L9T A;  2B0L A;  3HRU A;  3WU1 B;  5L3E A;  3WTX C;  1XGN A;  1L0O C;  4HAM A;  1FP2 A;  4A6D A;  3L09 A;  4IRH A;  3K1P A;  5LRR A;  3COA C;  2P5K A;  2P8T A;  1ZAR A;  1FYL A;  2RN7 A;  4G9Y A;  4YII A;  5LEJ A;  1EH6 A;  2GQQ A;  4IXA A;  2COM A;  2QM3 A;  1MJA A;  2KKO A;  2DK5 A;  3HHG A;  3ZN0 A;  3LWF A;  1B59 A;  4RAZ A;  2LF8 A;  1U3E M;  3WTT C;  1UFM A;  3QPH A;  1H0M A;  3BOQ A;  4KIG A;  2IW5 A;  2XAJ A;  3IKT A;  4HDV A;  1K78 A;  1ZH5 A;  3I54 A;  4AIK A;  2CGP A;  4HX4 A;  3TQN A;  5D5U B;  3HRS A;  3R4K A;  5E1Z B;  3EYI A;  5ILS A;  4WF2 A;  2PLY A;  4HDU A;  2F5E A;  1TNT A;  1SFE A;  3HUG A;  1FBS A;  3FXU A;  1YIO A;  3K1N A;  3QP5 A;  3JW4 A;  4G6D A;  2XUB A;  3CDH A;  2D2W A;  2DK8 A;  4YFN F;  4NB5 A;  4ON0 A;  5LHI A;  1LJ9 A;  2FRH A;  2WC2 A;  4I0A A;  1U5T B;  3DF8 A;  3WU0 A;  3P7N A;  3IWZ A;  2BGC A;  5J6X A;  1SFU A;  3B73 A;  2DQL A;  1TW2 A;  3G73 A;  3JSP A;  1Z9C A;  3WG9 A;  1A04 A;  2MBF A;  1XD7 A;  3CTA A;  4U7B A;  3KEO A;  4ENK A;  3AAF A;  2QZ8 A;  5FLX Z;  1F4K A;  2ZNZ A;  4IF4 A;  3GFL A;  2M5W A;  3C7J A;  2XHK A;  2HYF A;  3OV8 A;  1JGS A;  1ZGJ A;  3F72 A;  2FSW A;  3QU6 A;  5FB2 A;  3GFJ A;  3IRR A;  3F21 A;  4EV0 A;  1UHM A;  5ICG A;  1B6A A;  1PP7 U;  1G3T A;  5BPD A;  1IN4 A;  4OIP F;  1J5Y A;  4G7Z F;  4HF1 A;  5CVJ A;  1Z6R A;  2ZNY A;  1RZ4 A;  4L9V A;  2W57 A;  1CF7 A;  1IW7 F;  1KYW A;  2KRF A;  2VXZ A;  4G7O F;  1W7P B;  2A07 F;  2OQG A;  1L3L A;  2MLG A;  2H6C A;  4BAY A;  4RB2 C;  1O7L A;  3ML6 A;  4G6Q A;  2W24 A;  3SZP A;  2LF7 A;  3QRF F;  2WV0 A;  2DTR A;  2IPQ X;  1LQ1 A;  1YYV A;  1KU9 A;  1IXC A;  3BPV A;  4TV7 A;  1MGT A;  1LNW A;  5IT3 A;  3JTH A;  5D5W B;  4M6Y A;  4XLP F;  1BI3 A;  5E20 A;  2XRO A;  2VBY A;  4L5J A;  3LA3 A;  2VC1 A;  1SD7 A;  4ASN A;  4F7Z A;  1FSE A;  4ENN A;  4OU0 A;  1HKS A;  4Q4Z F;  1J2X A;  1TW3 A;  3I53 A;  3U1D A;  3O2P E;  3HSR A;  4PGH A;  1LEB A;  1TQI A;  5E17 F;  4HW0 A;  3T1B A;  1IXS B;  3FXR A;  4IJA A;  3C3W A;  5CVR A;  4KT5 C;  1P92 A;  2M45 A;  3ZPL A;  1S29 A;  4GCV A;  1IN6 A;  2VOP A;  3EQL F;  3EET A;  1TTY A;  4KNY A;  3WGH A;  2VE8 A;  3HRM A;  1JE8 A;  5LHH A;  1OR7 A;  1OYI A;  1I5Z A;  4RGS A;  2A68 F;  4KIF A;  3LA2 A;  4IRI A;  2RVC A;  3ECO A;  2ZME B;  3N4M A;  1AOY A;  2K4J A;  2HKO A;  1F9N A;  1IRF A;  1I1G A;  2JZY A;  4OMY A;  1BM9 A;  2F5C A;  3KP4 A;  3O6B B;  3ZMS A;  1ZHF A;  3JTG A;  3H3Z A;  1HST A;  5IT9 K;  4MEY F;  2HWV A;  2HS5 A;  1FX7 A;  2ISY A;  5D6E A;  2XGX A;  4N9I A;  4PZJ A;  2JRT A;  3E5X A;  3ROU A;  2IT0 A;  1BN5 A;  1BC7 C;  5K5O A;  4P55 A;  1GVJ A;  3KCC A;  1PDN C;  4ETS A;  1KU2 A;  3V8K A;  4CZZ A;  4XLN F;  4G8X A;  2LNB A;  2FML A;  3P9K A;  2IRF G;  2FE3 A;  2ZKZ A;  2F5F A;  4HBL A;  1YS6 A;  3F3X A;  5CYV A;  5D6F A;  4O3M A;  3DV8 A;  2H6B A;  1E2X A;  2ESH A;  5A2Q K;  2XAG A;  5CLS A;  4RB1 A;  2BYV E;  3RYP A;  1SD5 A;  4FT8 A;  5AON A;  3HTS B;  4IRG A;  3ZMD A;  3EUH A;  3E6B A;  5H6R A;  2XAH A;  4CIC A;  3QPT A;  4HV6 A;  2HQN A;  4BHP A;  1STZ A;  4JQF A;  2OBP A;  2V9V A;  1KU7 A;  3LST A;  5FD6 A;  5DEQ A;  2MLK A;  5FFX A;  1R00 A;  3R6S A;  1IZ1 A;  3ZMV A;  4GO1 A;  3HRT A;  4UVA A;  4Q48 A;  2ZJ2 A;  4YFK F;  1TBX A;  3E6D A;  2VOO A;  3V8J A;  2KIF A;  3I58 A;  2CW0 F;  5DCM A;  1OKR A;  2O03 A;  1XGM A;  3RKY A;  1KQ9 A;  4Y13 A;  2QEN A;  5JHU A;  3IRQ A;  3JAM K;  3FM5 A;  4CDG A;  1BI0 A;  1T39 A;  2HGC A;  3RPU A;  4I7H A;  3WTZ A;  4IHT A;  2FNA A;  3I64 A;  3E6M A;  4MNU A;  1W7P D;  1WQ2 A;  1RUN A;  1BOA A;  1S8N A;  3I71 A;  2NNY A;  5TRD A;  4L9J A;  2CSO A;  3DFG A;  2OZ6 A;  2STW A;  3P9I A;  1HKQ A;  2Q0O A;  3RYR A;  1MZB A;  4HV5 A;  4WXD A;  2P4W A;  3T8T A;  3BJA A;  3GWZ A;  4BQA A;  3BWG A;  3U9G A;  4M9Z A;  2RV8 A;  4CO8 A;  4IVN A;  1G4D A;  4G7H F;  2MC3 A;  2CWE A;  4CGZ A;  3R0J A;  4A0Z A;  4P96 A;  3HOT A;  2KJC A;  2V79 A;  3KZY A;  5HDG A;  3DQV C;  1UST A;  1HW2 A;  1LEA A;  4I02 A;  2G7U A;  3BZ6 A;  3CO6 C;  2VBZ A;  3J7A O;  3HOS A;  3KEQ A;  4M9X A;  3F8B A;  2L02 A;  1LVA A;  2PMH A;  2NYX A;  5E1W A;  4AD9 A;  3FHZ A;  1HBX G;  3D5L A;  2RKH A;  1BJA A;  5D4R A;  3I4P A;  4Q47 A;  2O6G E;  1B1B A;  2M87 A;  2QQB A;  4L5I A;  3F23 A;  1P2F A;  3FMQ A;  3ZP5 A;  3GFM A;  1Z1D A;  5E8I A;  3KLN A;  3TOA A;  2FEZ A;  1R58 A;  5FD5 A;  1XB4 A;  1QQI A;  2ACJ A;  1ON2 A;  1XCB A;  4I01 A;  1QPM A;  4L9N A;  4PDK A;  3I5U A;  4WXC A;  3BPX A;  2UXN A;  2C6Y A;  2K02 A;  4ESJ A;  1R36 A;  1LDJ A;  1S7O A;  1SFX A;  3QAH A;  5TJJ A;  4UUV A;  3VB2 A;  5FGM A;  4I0B A;  3I59 A;  2VON A;  4YG2 F;  4KN7 X;  3E3V A;  5AIP A;  3HIF A;  1Y0U A;  1R1U A;  1F5T A;  4ESF A;  4HYE A;  4BXU A;  2NNN A;  2LKP A;  6PAX A;  2DQR A;  2PQ8 A;  4BHB A;  3M9A A;  3LFK A;  1RNL A;  1O57 A;  4U0Y A;  2W84 A;  5JR3 A;  3EYY A;  1XCV A;  2FBH A;  1U8R A;  2JPB A;  1J0R A;  5F6F A;  2RGV A;  5DYM A;  3TO6 A;  2NS0 A;  4GXO A;  3IL2 A;  2HYG D;  3BDD A;  2HR3 A;  2OQR A;  2ZCW A;  1FY7 A;  2ETH A;  4RS8 A;  2CFX A;  4A0Y A;  2DPD A;  2V1U A;  5KVR A;  4HA8 A;  4UHT A;  3MQ0 A;  5LHG A;  2DLL A;  3DKW A;  1RIO H;  5JI6 A;  2O0Y A;  1ZG3 A;  3ULQ B;  4EJW A;  1O3S A;  2M8E A;  3BP8 A;  1XMK A;  2E1N A;  5FFZ A;  4A5M A;  1YG2 A;  5L3F A;  1XGO A;  5CVI A;  3MAJ A; 
#chains in the Genus database with same CATH topology
 1OMI A;  4LG0 A;  5DD8 A;  2ZJQ F;  3LSM A;  3I0T A;  2WAQ N;  3M3Y J;  4QPO A;  1G3Y A;  2DA5 A;  2MGQ A;  3KP2 A;  2CV0 A;  4Z2Y A;  2W7N A;  2L5Q A;  2CQQ A;  3WOD F;  4CCK A;  3OSF A;  3Q0U A;  1IXR C;  2LYC A;  1X19 A;  1X1C A;  1YIT I;  1K6O A;  2A5W A;  4E7K A;  1TP4 A;  2QLZ A;  3HPG A;  4HQM A;  3ZMT A;  1U0J A;  3HPH A;  2CQ7 A;  3IWF A;  2V4J C;  2X0L A;  5EEG A;  2KIQ A;  5D5X B;  2R5Y A;  2Y2Z A;  5DS9 A;  1LFB A;  2IA0 A;  2GA2 A;  1T95 A;  1MMA A;  1TWC J;  2LRD A;  2HI3 A;  4M6V A;  2R3S A;  3CUQ A;  4XM3 A;  3QYE A;  2L9V A;  4M9S A;  2NS8 A;  3OOP A;  2R7T A;  4PCQ A;  3M8E A;  2Y31 A;  1MDM A;  3F8M A;  1ETW A;  2QYO A;  1MBJ A;  4HRI A;  3FXQ A;  4ZZL A;  3OYD A;  1HW1 A;  1H9T A;  3C2G A;  1OCO H;  3HHH A;  1MMN A;  4XL9 A;  5KAF C;  5AIQ A;  1JXS A;  5B5E C;  3KP6 A;  2VC0 A;  4RBO A;  1X1B A;  4ESB A;  1S72 I;  4FX4 A;  3M1E A;  1ZGA A;  2FF4 A;  2ZB9 A;  2PFB A;  2WBM A;  1IN7 A;  1DDN A;  1YX3 A;  1MNE A;  2PMZ N;  1F36 A;  5EEH A;  5IYC J;  4B47 A;  1WI9 A;  4KDP A;  1R23 A;  3K4B A;  4RB0 A;  1TL8 A;  2UWM A;  3K1M A;  4NHJ A;  1ODD A;  1LUJ B;  4RAY A;  3O3K A;  4YIF A;  3WTW C;  5E8G A;  3DLA A;  3TOB A;  3H9J A;  3BG5 A;  1GT0 C;  2A6H F;  1K78 B;  2HPM A;  4XSZ F;  1E17 A;  1ZYR F;  1FNN A;  2BW3 A;  4LK1 F;  1V55 H;  3S2H J;  3RJP A;  2E7X A;  1RES A;  1R1V A;  2JUC A;  1NHA A;  3DBL B;  3QYB A;  1FC3 A;  4AUX A;  4A3G J;  2CQN A;  1ETQ A;  2L54 A;  2XGD A;  2M30 A;  3FF5 A;  2XIG A;  4ZYG A;  2OF7 A;  2XF6 A;  5M3F J;  2J5O A;  1DP7 P;  3HGG A;  1JJ6 C;  4FX0 A;  2QVO A;  4PJL A;  2F48 A;  2HFH A;  2E60 A;  2PEX A;  3HSE A;  4F52 A;  2A69 F;  4I09 A;  4EJU A;  2QUF A;  2V6E A;  4KT6 A;  4HQE A;  5ILV A;  3MFK A;  3DPL C;  1DPU A;  3BJO A;  1T98 A;  4M3B A;  3KET A;  1IGN A;  2JSC A;  3FHN A;  3HUG B;  5TGT A;  2M2E A;  5F1J A;  3KPH A;  2IGO A;  1FP1 D;  1MND A;  1VTN C;  5EGO A;  2IA2 A;  2QGU A;  3SXY A;  1T08 B;  2WAE A;  3ZMZ A;  5C4X J;  2LR8 A;  4S0H B;  2IJL A;  3OYH A;  2XKP A;  3SHF A;  2H1L A;  2F2E A;  1T38 A;  2LKS A;  4J00 A;  4B8X A;  5CVU A;  3BTL A;  2A6T A;  4HZF A;  3TDZ C;  5E3M A;  3S17 J;  4EQQ A;  3N05 A;  2XKO A;  1X1P A;  4EVI A;  2FOW A;  2UXX A;  3LSJ A;  5JLW A;  1S5L C;  3S1N J;  2K3F A;  3J80 Z;  4XKW A;  1R5H A;  2BVL A;  2X1C A;  4EJT A;  2ID6 A;  1JUS A;  2ID3 A;  2VQL A;  1PUE E;  1JUM A;  2FNP A;  1IDY A;  2O8X A;  2E1M C;  5E3L A;  1P4A A;  2A6E F;  2Q8K A;  2CQK A;  3J81 Z;  4II3 A;  1LPQ A;  1ZG5 A;  3CDI A;  1PJR A;  1VQO I;  3CME I;  3OYE A;  3S14 J;  2JTV A;  1VQP I;  5J4Y A;  1E3H A;  2Y0S A;  3FBI B;  4XKB A;  2DAO A;  2VBW A;  4R8H A;  2JPC A;  4X0G A;  2LTP A;  2P7V B;  3W6J B;  1LFP A;  4M71 A;  1SD4 A;  2RQQ A;  1NK3 P;  3BCB A;  1XN7 A;  2EV0 A;  3DKX A;  5EJC A;  3RI4 A;  5E18 F;  3T5X A;  5FLX K;  2MYS A;  3BTC A;  2XAQ A;  3K4L A;  2KIS A;  3W2A A;  4GGG A;  5HLI A;  2HOT A;  5F0F A;  3DXJ F;  2GIZ A;  1JGG A;  1MBF A;  1A36 A;  4V2G A;  4LJZ F;  3VOD A;  3JRD A;  3GW2 A;  1O7F A;  2W25 A;  2EBI A;  1CF7 B;  2M4G A;  1VQK I;  2G7H A;  1PUF B;  1KU3 A;  1XMA A;  3ZN1 A;  3IH4 A;  1AWC A;  2OA4 A;  4QTR A;  2W1O A;  5IY5 H;  4B09 A;  4BH9 A;  4IHY A;  1R22 A;  1Y1V J;  2EIN H;  3GXO A;  3TED A;  1REP C;  4ZYE A;  3BQZ A;  2ZXW H;  1OIS A;  4U7D A;  2QBY A;  2BY3 A;  3L9F A;  4A5N A;  2XPV A;  3RPU D;  1JKO C;  1J75 A;  1WHU A;  1YFH A;  1DUX C;  2EA2 A;  1IRX A;  2YU9 J;  1QVT A;  3W3C A;  1USS A;  4ZYA A;  3CJN A;  3TKY A;  4IHS A;  4OAZ A;  2EZL A;  3MEX A;  3AG3 H;  2GZW A;  4XLC A;  3FWE A;  4ENJ A;  1T56 A;  1SMT A;  3HXL A;  4U88 A;  3S16 J;  1EH8 A;  1T0F A;  2H1K A;  4BXF A;  3GTL J;  3H0D A;  3KE2 A;  1ETO A;  1I6X A;  5E3O A;  1W0T A;  3FKJ A;  2VPL A;  2OU2 A;  2K85 A;  4S05 A;  2ZXH A;  1Y6I A;  1MBK A;  3V7C A;  4LFU A;  4EM2 A;  4ZTJ A;  1X4P A;  1Z7U A;  1WWX A;  3DCF A;  2AO9 A;  1TQP A;  3KLO A;  4LK0 F;  3VYU B;  1BL0 A;  3H1C A;  3SQN A;  2K4B A;  1FWZ A;  1I39 A;  2XAF A;  1XG1 A;  3H3U A;  3DBR B;  3T0Y A;  5BPI A;  2YX7 A;  3TL4 X;  1QBJ A;  2LSO A;  2R93 J;  3SEQ A;  5LEK A;  2CV2 A;  2Y75 A;  4XSX F;  2DFE A;  5EYR A;  4QIW N;  5HDN A;  3OY9 A;  2E5N A;  3S93 A;  3G71 I;  1YJ9 I;  2GXA A;  3CD6 I;  1KA8 A;  3PNV A;  2LMD A;  2R4G A;  2GIV A;  4UV8 A;  4WCG A;  1IJW C;  2ZXJ A;  1VND A;  2K9L A;  2M1B A;  2E1C A;  2R7D A;  5HDK A;  2WY7 Q;  4M73 A;  2EJR A;  2UV1 A;  4KN4 X;  5LGU A;  2VN2 A;  4EM0 B;  4J01 A;  2XV4 S;  4M3E A;  3G3Z A;  1QZE A;  1HF0 A;  4RA2 A;  4A3K J;  5LLQ A;  3CF2 A;  2CU7 A;  3HM5 A;  3SYT A;  1Z6T A;  2F4O B;  4HNV A;  4R1H A;  1BC8 C;  5GAH J;  2L4M A;  5BNG A;  2MH2 A;  3W2V A;  2QA4 I;  4MTE A;  1LE8 A;  4MQV A;  3HKZ A;  1EF4 A;  3WHC A;  1UG2 A;  2VJ4 A;  1WJC A;  3HOW J;  3K0L A;  4DZJ A;  1QGP A;  1FYK A;  5CVV A;  1CGP A;  1Q1H A;  3T8R A;  1T6S A;  4H4K C;  3TW6 A;  1MSE C;  3L2R A;  1KQ0 A;  1ACI A;  4RM2 A;  4YEL A;  3V7S A;  1I3A A;  1FBU A;  1HDP A;  2KFD A;  3K4M A;  2VJ5 A;  2I5U A;  3CCV I;  4AVP A;  3DTI A;  1K6Y A;  1OYY A;  2L7M P;  5HS9 A;  3SJM A;  3GFI A;  3H5N A;  3VFZ A;  2BY0 A;  2XF5 A;  3CJQ B;  2M7B A;  5FKK A;  3BR1 A;  4AYB N;  3CUQ C;  2KT0 A;  4UUT A;  4XLF A;  5M5X J;  1EH7 A;  5L3B A;  2DN0 A;  2VOD A;  2V7F A;  4GRI A;  2AXL A;  4E6K G;  1P7I A;  3E5Q A;  5DCF A;  3S3O A;  3OL4 A;  5CJ9 A;  1G59 A;  2EA4 A;  4U0V A;  4Y7N J;  3QQA A;  2BXY A;  4BEH B;  4XBF A;  1IF1 A;  2Z5U A;  4B43 A;  3SFI A;  1W5C C;  2QQ9 A;  4KMU X;  2DDA A;  3DBH B;  2BEO A;  1W5S A;  4I98 B;  2HXO A;  3M07 A;  4RDU A;  3KP7 A;  2WAD A;  3W6V A;  2W82 A;  4MFD A;  5LFA A;  1ERD A;  1UB9 A;  1UJ8 A;  4Y52 J;  3CJR B;  4LGW A;  3WU2 C;  3BJ6 A;  1O3T A;  3R61 A;  5IOY A;  3RCO A;  3GX4 X;  2QEX I;  4AM3 A;  4UB8 C;  1V4R A;  5DUK A;  5L3D A;  5EF6 A;  5HLG A;  5EG0 A;  3OYA A;  4L18 B;  1P6R A;  1G6N A;  1RKT A;  4A3D J;  2CV1 A;  1S6L A;  2R7F A;  2P6T A;  5F1R A;  3K6G A;  4O6J A;  3F9K A;  2DTZ A;  3BR2 A;  1YX5 A;  2R7Z J;  2AS5 F;  4V19 K;  2MD0 A;  1U5T A;  3MMY B;  1SFK A;  3PIO F;  2XPW A;  4IPA A;  2NOJ B;  4HLX A;  1HLV A;  4U0W A;  3OIQ A;  1ZKG A;  3SZT A;  3TO9 A;  5H2F C;  1HW5 A;  2O9L A;  1Y8R B;  1WJ5 A;  5C4J J;  3OYJ A;  1UZC A;  1WZ2 A;  3SDG A;  2E7W A;  4PFO A;  2K7L A;  3KP5 A;  1O3Q A;  4LLN A;  2NVU B;  3F8C A;  1D5V A;  2TCT A;  4WK8 F;  4E7Z A;  1A35 A;  3PQK A;  3CJT B;  3OL3 A;  4UNO A;  3HZJ A;  2E34 A;  2Q2E A;  4IOA F;  1VF9 A;  1P9Q C;  4XN0 A;  4XMY A;  2Z1D A;  4ZYH A;  2IGM A;  4JOM A;  1VQN I;  1GUU A;  4A3J J;  2WV1 A;  3FX3 A;  1F1Z A;  5E79 C;  3L7W A;  5FKO A;  2PG4 A;  4AID A;  2ELK A;  1D3Y A;  2OTJ I;  3ABU A;  1VZ0 A;  1VI0 A;  1ZG1 A;  1HKT A;  3MCZ A;  5HS8 A;  4XID A;  2VT3 A;  3TO7 A;  3ERM A;  4M3G A;  3ZQI A;  3WTU C;  4M6X A;  2DMU A;  4Y15 A;  2DFH A;  2PX9 A;  2YSR A;  4LG3 A;  5E1X A;  4DYR A;  1HDD C;  1R5G A;  4RMN A;  3M8F A;  4XKV A;  4JBA A;  3TBI A;  2E36 A;  1SVO A;  2VKH A;  3ISP A;  1I1S A;  2HEO A;  4D1Q A;  4ZC3 A;  1BR2 A;  2EFW A;  3N97 A;  3K4C A;  3UNG C;  3LSG A;  4H0E A;  2ME0 A;  1BW6 A;  4KMF A;  1B4A A;  2MFZ A;  1QU3 A;  1D1B A;  3A01 A;  1W7P A;  4E7J A;  1J59 A;  3GEZ A;  3MZH A;  3QYF A;  3W6K B;  1K79 A;  3LAJ A;  2Z3Y A;  3PFI A;  1BIA A;  2OD5 A;  3CMA I;  1U2W A;  4L5E A;  3I3L A;  2EQR A;  2VL8 A;  5DCM B;  2M34 A;  2ZBK A;  1RR7 A;  3K9T A;  1BI2 A;  2BBY A;  3H92 A;  5LBQ A;  2IAI A;  5BMZ A;  1SD6 A;  2EZK A;  2VT2 A;  1RI7 A;  2H27 A;  4X6A J;  1R7J A;  3EUA A;  2JWT A;  4UVC A;  3GUD A;  5D8K B;  1W0U A;  3FZV A;  3H36 A;  4BBS J;  3MZ8 A;  2DMT A;  4RB3 C;  2OTL I;  2H09 A;  1MMG A;  2IBD A;  3QPS A;  3E5U A;  2EWN A;  3ASO H;  1IUY A;  1WRJ A;  3LA7 A;  1JKP C;  3BLY A;  3S2D J;  3LSI A;  1CQT A;  1FTZ A;  3M8J A;  2L2O A;  4KIC A;  4NC7 A;  5JFR A;  1JT6 A;  1XDU A;  5GPA A;  3GYH X;  3M1C A;  4A3F J;  4JX5 A;  2X6Y A;  2LY1 A;  4UV9 A;  3Q5F A;  1Y1W J;  1D0X A;  4P5O A;  1Z05 A;  4ZJZ A;  2A5Y B;  5ERI A;  2A61 A;  1WFX A;  4FHT A;  4EGZ A;  4YFX F;  3CCE I;  3S32 A;  4A93 J;  2Z9O A;  1UEL B;  3DPT A;  2XVC A;  5K7Z A;  5JVT A;  3S2W A;  5HOO A;  3NWT A;  4MHG A;  3PJR A;  4D5F A;  2R7S A;  2X6O A;  3F0C A;  3R0A A;  4OIR F;  2EZH A;  2G9W A;  3L00 A;  2MD5 A;  3HDD A;  2O7O A;  2EIK H;  1V54 H;  2VBX A;  2ZJR F;  4QWQ A;  4W1U A;  4CZC A;  1UCR A;  2MH9 A;  2R5Z B;  1K83 J;  3C2H A;  3TGN A;  1TQM A;  3HJE A;  1YLF A;  3V7R A;  4CYC B;  1N25 A;  2JMW A;  4Z6Y A;  2P7C B;  3Q9S A;  2ZJP F;  4KUM A;  1SAX A;  2WA0 A;  1IN8 A;  1WVR A;  4EAT A;  1P4X A;  2LG4 A;  4MTD A;  1FZP B;  4I99 C;  2LBF A;  3BRO A;  1OCC H;  2GAU A;  3GVA A;  2F5V A;  2HVS A;  2G0E A;  3WTV C;  2RC4 A;  5B1A H;  3JRC A;  2Y48 A;  4CHU A;  1NG6 A;  2K27 A;  3OS1 A;  4EMS A;  5K5Q A;  1FTT A;  3MKY B;  3CP8 A;  3Q9V A;  5HVQ C;  2VE9 A;  2PI0 A;  1P4W A;  1IAW A;  3MZY A;  3GLX A;  1OPC A;  4QLC U;  1ETV A;  3HC7 A;  2Y0M A;  3CCQ I;  2NRA C;  2DU9 A;  2V26 A;  1MD0 A;  2CJJ A;  2L3D A;  2HVQ A;  4E70 A;  2K5C A;  3K10 A;  5CQE A;  1J7K A;  2VI6 A;  3E6C C;  1FOX A;  2E1M B;  3WGI A;  3IAM 2;  3VYS B;  1LKX A;  4LB6 B;  2KHM A;  4HEA 2;  3PNT A;  4UY8 I;  1UG0 A;  3ZCO A;  3V4G A;  2YU3 A;  3DP7 A;  5J8C A;  1XSV A;  2ZME A;  5IT9 Z;  1V5F A;  4LLG F;  4ZH4 F;  2JJ7 A;  3B02 A;  2QQA A;  4LB5 A;  1I50 J;  2CO5 A;  2HQR A;  5K1Y A;  4AWX B;  3F8N A;  5GTH C;  1GV5 A;  1W1W E;  2HOE A;  3RPQ A;  1V3F A;  4DIQ A;  3FBN B;  1FLI A;  1YW7 A;  1WKM A;  3HOU J;  5HS7 A;  2Z16 A;  3HSF A;  3CO7 C;  3AG2 H;  2JSP A;  2X1D A;  4OIQ F;  2ELH A;  3RTR A;  1KYZ A;  2FXA A;  1TT5 B;  4NQW A;  1ULY A;  3RKW A;  1SVM A;  3C2B A;  3NRV A;  2W00 A;  3OYF A;  4BBR J;  2V1X A;  4D7M A;  4MLO A;  1DPR A;  2STT A;  1S7A A;  3F6V A;  3ZQL A;  2DYS H;  1GXP A;  4O5V A;  2EK5 A;  2VJJ A;  2KJB A;  2PJR B;  3PIP F;  4FCY A;  1QZY A;  1HQC A;  2ECC A;  4BY1 J;  3GTQ J;  1SMY F;  2H8W A;  3WE3 A;  1VQ9 I;  3MKL A;  2FBK A;  5F08 A;  1X58 A;  4XRS A;  2NVX J;  2HQ5 A;  3FMS A;  4HX8 A;  2JK3 A;  3ERE D;  2DXI A;  2E2H J;  1ZLK A;  1BIB A;  2X4H A;  3I59 B;  2I8D A;  2K40 A;  5IYB J;  4BE0 A;  1VQ4 I;  3ZRG A;  2O61 A;  4FQG A;  4AU7 A;  1TC3 C;  3I4M J;  2AQE A;  3S1M J;  3ESW B;  4XRF A;  2QQ8 A;  5A2Q Z;  2LFB A;  1YHQ I;  3FM3 A;  4DBR A;  2LKX A;  1BA5 A;  1ZRC A;  3J7Z I;  5D5V B;  2IA1 A;  1TNS A;  2OUM A;  2FA5 A;  4KA4 A;  2IS6 A;  1K4T A;  3FIS A;  5CPR B;  2XAS A;  4KYW A;  3NQO A;  2BV6 A;  3AFH A;  2VLA A;  5LRS A;  3ABT A;  4S04 A;  4QSH A;  2Y0S N;  4WX9 A;  4A0X A;  3K2A A;  3BZC A;  3BR3 A;  4ANJ A;  3U2R A;  2OAZ A;  2E2I J;  1BJZ A;  1YS7 A;  2VIX A;  2DI3 A;  4FE7 A;  2XPU A;  4HF0 A;  2L4A A;  4IZZ A;  5IPA A;  4XRM A;  4HLY A;  2M3A A;  4WXH A;  3IHU A;  2DW4 A;  2HTS A;  5J8F A;  4N9H A;  1WJB A;  3CZ6 A;  2LDU A;  3WE2 A;  4PJJ A;  2DFI A;  4MQ9 F;  4CCM A;  1R49 A;  1HSJ A;  1IN5 A;  3KYD B;  2K3P A;  1FPQ A;  2D1V A;  3NEU A;  4PJN A;  3HGY A;  4E7S A;  1MJ9 A;  1MKM A;  2KIU A;  4RM3 A;  2ESN A;  4OIN F;  3VEP A;  2PMU A;  5K5R A;  1OYW A;  1ZLJ A;  1AKH B;  1D8J A;  2R0Q C;  3ELK A;  3M7G A;  1GVD A;  2RNJ A;  1U5T C;  2FMY A;  2EFN A;  2DA1 A;  2ADU A;  5B3S H;  4Y17 A;  5FJ8 J;  2BOL A;  2EV6 A;  5GAE J;  3OS0 A;  3SFZ A;  1YW8 A;  1XDS A;  2HTJ A;  2P5V A;  1TT0 A;  3EDP A;  4AIH A;  2PN6 A;  4RGX A;  2GA1 A;  5HOD A;  3VSL A;  2EFP A;  2WAF A;  4NDL A;  4CA0 A;  3LSR A;  4G94 A;  2QSF X;  1ZAO A;  1BI1 A;  3KP3 A;  4A3M J;  1A6I A;  4MEX F;  4MO7 A;  4UVB A;  1XC5 A;  2HYJ A;  3FK6 A;  4OMZ A;  3JAM Z;  4P9U A;  1VQ7 I;  4XOP A;  3VWB A;  1QO0 D;  3CLO A;  4HNU A;  3L2V A;  1ZN2 A;  5FLM J;  1FMV A;  1ITY A;  2CG4 A;  4YRV A;  4M3F A;  1B72 A;  3ECH A;  3GTM J;  1QZZ A;  1QNT A;  4LG0 B;  4Q5S F;  4MFE A;  2ELJ A;  1XPX A;  2Z33 A;  3LQQ A;  3REO A;  2DYR H;  3ZQ7 A;  2LK2 A;  2HDW A;  2RDP A;  2HOA A;  2GWR A;  1W5T A;  4C3H J;  5J1U A;  2FBI A;  5L3G A;  3CCJ I;  2AHQ A;  1N78 A;  1WJD A;  1HXD A;  2VAS A;  4U87 A;  1ZRD A;  2BY1 A;  2OCC H;  3RSN A;  3OS2 A;  1J9I A;  2RAE A;  3U1K A;  1B8I A;  1X3U A;  1GXQ A;  2HPI A;  5F04 A;  1U6G A;  2GXG A;  4ZDL A;  4CXF A;  1YTY A;  1ZR2 A;  3OOU A;  1D1A A;  2R5Y B;  1XMX A;  1W36 C;  1B9M A;  4MGR A;  4DNC A;  1LDK B;  3ASN H;  2EB7 A;  3CUQ B;  4EM1 A;  3G6E I;  2DPU A;  1LB2 A;  1RUO A;  1FOK A;  1XSD A;  4E7L A;  3LSH A;  4LMY A;  2EFQ A;  3GTO J;  1FT9 A;  5DD4 A;  3PQJ A;  1MDM B;  1YRN A;  1Z91 A;  3FK7 A;  5BOX A;  5DDG A;  3CCR I;  1ZRF A;  4M72 A;  2ZO4 A;  5K7F A;  4MIM A;  1Z3X A;  4AIJ A;  2OJE D;  4E4H A;  3WTY C;  3CCM I;  2FQ3 A;  5CQG A;  3DPU A;  3RIR A;  3C18 A;  4ZYD A;  4HNT A;  1OCR H;  3X2Q H;  2HU9 A;  2P6S A;  2V9P A;  4BE1 A;  3LAP A;  2B7E A;  2RQP A;  2F5D A;  2HDD A;  1LFU P;  3MVP A;  3IKV A;  2KIM A;  3GF2 A;  3QWL A;  1TZL A;  4PGG A;  3JRE A;  5DV5 A;  1ETX A;  4BY7 J;  2P0W A;  3C1D A;  1EV7 A;  2CYY A;  4PJM A;  1K7A A;  4XLH A;  2IGK A;  3CCS I;  3PM1 A;  4C3I J;  2EV5 A;  2JT1 A;  5ICF A;  2EIJ H;  1S3J A;  2DT5 A;  3HKZ N;  4BNC A;  5J40 A;  2TDX A;  1U78 A;  4AVZ A;  5D4S A;  2ZFW A;  1H8A C;  2BW3 B;  2XRN A;  4PSX A;  1C0W A;  3A0H C;  4CCL A;  1W4M A;  3JSO A;  1O3R A;  3LOC A;  4A6E A;  2Z99 A;  4LLL A;  1TLH B;  2FD5 A;  2RNG A;  4A12 A;  2JA8 J;  3GZ5 A;  3KX2 A;  3KFW X;  2ZXI A;  4GYG A;  3HB9 A;  1ON1 A;  3IC7 A;  2DBB A;  1Z7L A;  1LDD A;  2OZU A;  3L2C A;  5H6Q A;  2KRC A;  4KFC A;  3OWT A;  5F64 A;  1D8K A;  2OV7 A;  1POG A;  5HLH A;  3L2U A;  4RGU A;  1PP8 F;  3K69 A;  5HNH A;  2ISZ A;  4ENM A;  5LGN A;  1RPW A;  4JK1 X;  3DU5 A;  1SEU A;  3GO5 A;  2K9M A;  3AKZ A;  4IQ4 A;  1G3S A;  3RKX A;  5EGO B;  1IV8 A;  3FXK A;  4XNF A;  4ZZD A;  1A5J A;  2JVG A;  1N77 A;  2LC2 A;  1HC8 A;  1Y8Q B;  4P9F A;  2HDC A;  1DP3 A;  3FMR A;  1ONV A;  3QOP A;  3HOV J;  2YX4 A;  3VOE A;  2JA2 A;  2KLO A;  2IVM A;  5H20 A;  4X1E A;  2J5P A;  4KIB A;  5L3C A;  2K9N A;  5KK1 A;  4XR6 A;  2P5L C;  3O8H A;  5BQT A;  3F6O A;  3F8F A;  3WTS C;  2X1E A;  1GHC A;  2HZT A;  5M5W J;  2DOD A;  4HF2 A;  2W85 A;  5FO5 A;  1WSU A;  1AA7 A;  2YPR A;  2N8G A;  3D5R C;  5F0H A;  4HST A;  2NS7 A;  2QCO A;  1KGS A;  3AG1 H;  2PJP A;  1UHW A;  4P1W A;  1WPK A;  2PBI A;  3DEW A;  2CH0 A;  2E35 A;  3CUO A;  1FYM A;  3A2K A;  1XSX A;  2GXB A;  1H9G A;  2EFO A;  1ZRE A;  4L0Y B;  3QP6 A;  3J80 K;  2ZME C;  2EIL H;  4OOI A;  4RGR A;  3RDI A;  4UXN A;  2D1H A;  3VYR B;  1R1T A;  1JHH A;  3FDY A;  4CYD A;  2Y9Z A;  4BDZ A;  5EZG A;  2NVY J;  4HOB A;  2WWY A;  3J81 K;  4OIO F;  2R7V A;  1KQ8 A;  3H5R A;  3E97 A;  4DQ2 A;  1LVK A;  5JVG F;  1B9N A;  4EJV A;  4R79 A;  1FSH A;  1H89 C;  1FBQ A;  2V1D A;  2TRT A;  2E2J J;  4BHC A;  2A05 A;  3FKI J;  2BVM A;  4GYI A;  1IO2 A;  2V6C A;  3ZQQ A;  4LIV A;  4D0P A;  1K61 A;  2WTE A;  2KL4 A;  4FAS D;  3DEU A;  4HX7 A;  3S8P A;  3KZZ A;  3P9C A;  4CCJ A;  1JTX A;  4BQN A;  4EJO A;  1B8I B;  1YW9 A;  2HKX A;  3GCM A;  2NAZ A;  2XAU A;  5BS6 A;  2LY9 A;  1YQA A;  3F22 A;  1IRG A;  2L9R A;  1BBY A;  3HOX J;  3QU3 A;  1XGS A;  1QPI A;  4A2U A;  4M74 A;  3ZMU A;  4BQO A;  1SFO J;  2WB1 A;  3IP4 B;  3PL8 A;  2QSH X;  4N0B A;  1MBG A;  4K2E A;  4C30 A;  3HYI A;  3GME A;  1Q1V A;  2L9S A;  3G2B A;  2O8K A;  2YUS A;  2A3S A;  3OYI A;  2M9H A;  3BG3 A;  2GOM A;  2DO7 A;  3O8G A;  2QBY B;  4LD5 A;  3MWM A;  4BUP A;  5ILU A;  1O4X A;  4JX6 A;  4IEJ A;  4UUS A;  3K2Z A;  3WGG A;  4M3D A;  1E3P A;  2DMP A;  1V5G A;  3KIO A;  2FOK A;  3DWL E;  4FET A;  2K86 A;  1MJB A;  1SAU A;  2XF7 A;  1IUF A;  1MW7 A;  4KIT B;  5B1B H;  4BYY A;  1G3W A;  3ZQF A;  1X4O A;  5ICC A;  3GZ6 A;  3OIO A;  1T2K A;  2CMP A;  3L2W A;  2ICW G;  2JN6 A;  4Y33 A;  2R7W A;  3MKZ A;  5DUI A;  5LGT A;  2H94 A;  4I2O A;  4WWC A;  5IYD J;  2L7K A;  2MA3 A;  3TDU C;  3E1S A;  4CSW A;  2YR2 A;  2UZK A;  3R60 A;  2MAB A;  1DU0 A;  2DT7 B;  1SC7 A;  1WGX A;  1JHF A;  1WJA A;  2O3F A;  3V8L A;  2IP2 A;  3G1L A;  4G6T B;  2QWW A;  3LSK A;  3HTU A;  1VQL I;  3AL0 C;  1YO5 C;  2L01 A;  2D45 A;  3LQR A;  5D8L B;  4DYC A;  2FU4 A;  5GAG J;  5ED4 A;  2DA6 A;  4YIR X;  4XOT A;  2BE5 F;  1VQ8 I;  4EGY A;  4FE4 A;  1ETK A;  2R7R A;  4G12 A;  4BGD A;  1R6R A;  5ICE A;  2AXT C;  1ZR4 A;  4A3L J;  4BKX A;  1I27 A;  5GTI C;  3D0S A;  4L0Z B;  3BY6 A;  4L9T A;  2B0L A;  3HRU A;  1UHS A;  2L0K A;  3WU1 B;  5L3E A;  1Z21 A;  3WTX C;  2M0C A;  4A3C J;  1XGN A;  1L0O C;  4YEJ A;  3CCU I;  3CDL A;  4HAM A;  1FP2 A;  2XSJ C;  2L9N A;  2R7U A;  4CCN A;  3CC2 I;  4BXX J;  3A02 A;  4A6D A;  3DLL F;  2VQH A;  3L09 A;  4IRH A;  3K1P A;  4DGW B;  5LRR A;  2CUE A;  2M0M A;  3LFU A;  2P5K A;  2Y69 H;  3COA C;  2P8T A;  2DMN A;  3D5S C;  1ZAR A;  1FYL A;  2RN7 A;  4G9Y A;  4DYQ A;  4YII A;  2Q1Z B;  5LEJ A;  1EH6 A;  5KCM A;  2HZD A;  1OCZ H;  2GQQ A;  4IXA A;  2X9D A;  4C9Y A;  2COM A;  4RLQ A;  1LE8 B;  2QM3 A;  2E1O A;  1MJA A;  2KKO A;  2DK5 A;  3K4J A;  1OR7 C;  3HHG A;  3LSP A;  3ZN0 A;  2Z2S B;  3LWF A;  1B59 A;  4RAZ A;  3D1N I;  1JTY A;  2KP6 A;  2LF8 A;  2MW8 A;  1U3E M;  3K4N A;  3J7Y J;  4JX4 A;  1KON A;  3WTT C;  1UFM A;  1JKR C;  3QPH A;  1H0M A;  3BOQ A;  1RET A;  4KIG A;  2IW5 A;  2XAJ A;  3RQ4 A;  3L2Q A;  2LD5 A;  2JA5 J;  3IKT A;  3I4N J;  5KHD A;  1DQU A;  4F91 B;  2ZSI B;  4HDV A;  1K78 A;  1ZH5 A;  2CUZ A;  3I54 A;  3LMM A;  4AIK A;  2CGP A;  4HX4 A;  3TQN A;  4NBQ A;  5D5U B;  1M1E B;  5J3L A;  3HRS A;  5GAD J;  2EPF A;  3R4K A;  5E1Z B;  3EYI A;  2VXD A;  5ILS A;  5FKM A;  1X1D A;  1Z0X A;  2VPR A;  3ABL H;  1RKW A;  4WF2 A;  2PLY A;  4LOC A;  4HDU A;  2LRE A;  2F5E A;  3K7A J;  3FXJ A;  1IC8 A;  4E7H A;  1TNT A;  3ZR8 X;  1S9H A;  1TWG J;  1SFE A;  3HUG A;  5FKL A;  2QSG X;  1JKQ C;  5C44 J;  2IEK A;  3G1M A;  1FBS A;  3FXU A;  1FIA A;  1YIO A;  3K1N A;  3QP5 A;  1MH3 A;  3JW4 A;  4G6D A;  2XUB A;  4F55 A;  3CDH A;  2D2W A;  2DK8 A;  4YFN F;  4NB5 A;  2D5V A;  2KZV A;  5EG0 B;  4ZTF A;  4IHW A;  3PO2 J;  5CKT A;  1HCR A;  4ON0 A;  3MN2 A;  5LHI A;  1LJ9 A;  2FRH A;  3HOY J;  2YS9 A;  2F6C A;  4A3E J;  2WC2 A;  2Y30 A;  2O5R A;  4D5C A;  4BE2 A;  1UMQ A;  2HXI A;  4I0A A;  1U5T B;  2LOO A;  3DF8 A;  2KPM A;  3WU0 A;  3P7N A;  3A1Y A;  3IWZ A;  3DU6 A;  2BGC A;  2MC4 A;  5J6X A;  3QOE A;  1SFU A;  3B73 A;  2DQL A;  1TW2 A;  3G73 A;  2DMQ A;  3JSP A;  2W48 A;  1Z9C A;  3WG9 A;  2GOX B;  1A04 A;  3L1P A;  3H3V K;  2DJI A;  2MBF A;  1XD7 A;  4Y4R A;  2CUF A;  2K9S A;  3CTA A;  5E3N A;  4U7B A;  5GPC A;  2BY2 A;  3KEO A;  2CW7 A;  3HG9 A;  4PK4 A;  2Q2E B;  4ENK A;  3AAF A;  1ETY A;  3OR2 C;  3HOZ J;  2QZ8 A;  2NOG A;  5FLX Z;  1F4K A;  2ZNZ A;  2JUG A;  3OYB A;  3WHB A;  4IF4 A;  1IV6 A;  3GFL A;  5FRN A;  2M5W A;  3BR5 A;  2X6W A;  2X51 A;  3I56 I;  3C7J A;  4XIC A;  3UKG A;  3MKW B;  4E7I A;  2XHK A;  4KJZ A;  2HYF A;  2ZFU A;  1VQM I;  2FX0 A;  3OV8 A;  1JGS A;  1QHH D;  1ZGJ A;  3KYC B;  3JRI A;  4XQF A;  3F72 A;  2FSW A;  3QU6 A;  5FB2 A;  3GFJ A;  3IRR A;  1U8B A;  2HQA A;  3F21 A;  1R5I D;  3OMY A;  4EV0 A;  3HBL A;  3G4S I;  1UHM A;  5ICG A;  1B6A A;  2VKE A;  1PP7 U;  1G3T A;  5BPD A;  1IN4 A;  2XB5 A;  3FXM A;  1J5Y A;  4G7Z F;  4OIP F;  1BR4 A;  4HF1 A;  1BW5 A;  3DTK A;  5CVJ A;  1Z6R A;  2ZNY A;  3OYC A;  5J1Y A;  2WY8 Q;  1RZ4 A;  4L9V A;  2W57 A;  1CF7 A;  3TW7 A;  1A31 A;  5FRM A;  1IW7 F;  1NH3 A;  1KYW A;  3BQY A;  2KRF A;  3A01 B;  2VXZ A;  2I10 A;  5FRO A;  1PUF A;  4G7O F;  1W7P B;  2A07 F;  2OQG A;  2X6X A;  3G1O A;  1L3L A;  2MLG A;  1YIJ I;  5J4V A;  2LLK A;  4PSW A;  3S1R J;  1OLT A;  2H6C A;  4BAY A;  3NAU A;  4RB2 C;  1O7L A;  3E0J B;  1APL C;  3ML6 A;  4G6Q A;  3LL7 A;  4BJ5 C;  1QRY A;  2DOF A;  2L7Z A;  4NC6 A;  2W24 A;  3SZP A;  2LF7 A;  3QRF F;  4NNJ A;  2WV0 A;  2DTR A;  2IPQ X;  1LQ1 A;  1ENH A;  2W4S A;  1WJE A;  4GFB A;  1YYV A;  1KU9 A;  3U21 A;  1IXC A;  3BPV A;  4TV7 A;  1MGT A;  4IO9 F;  1LNW A;  2WAQ A;  4HG2 A;  5IT3 A;  2CUJ A;  4AC0 A;  4W97 A;  3JTH A;  1QHG A;  5D5W B;  4M6Y A;  4F92 B;  3QOD A;  4XLP F;  2E5Z A;  1BI3 A;  5E20 A;  2XRO A;  1FEX A;  1MBE A;  2VBY A;  1FJL A;  2IS2 A;  4N4O B;  2K9Q A;  4L5J A;  3LA3 A;  2VC1 A;  5IP9 J;  5K7H A;  2VKV A;  3V42 A;  1SD7 A;  2VQC A;  4ASN A;  3I9V 2;  4F7Z A;  2FJ1 A;  1FSE A;  2DA4 A;  2QKM B;  3IAS 2;  1ZQ3 P;  4ENN A;  4OU0 A;  4IQJ A;  2R7X A;  4J19 A;  1OCP A;  1HKS A;  3ZXS A;  4Q4Z F;  4BJT A;  1ZK8 A;  3S1Q J;  1MIJ A;  1J2X A;  1TW3 A;  3SDB A;  1GV2 A;  2MSY A;  3I53 A;  3U1D A;  4BAC A;  2VUM J;  3S3N A;  1J09 A;  1Y56 A;  3O2P E;  4II2 A;  3HSR A;  5FLV A;  2CQX A;  4PGH A;  1YE9 A;  4B3A A;  3PNY A;  1MH4 A;  3GLL A;  3BG6 A;  3FXO A;  3H9G A;  1LEB A;  1TQI A;  5E17 F;  4HW0 A;  3T1B A;  1IXS B;  2VB6 A;  2LBF B;  3FXR A;  4B44 A;  4IJA A;  2MG4 A;  2PMZ A;  3B6A A;  1BR1 A;  3C3W A;  5CVR A;  1TWH J;  3FXL A;  4KT5 C;  1P92 A;  2M45 A;  3ZPL A;  1S29 A;  4GCV A;  1IN6 A;  2VOP A;  3EQL F;  3TP0 A;  3OR1 C;  3EET A;  1EKE A;  4DOZ A;  1TTY A;  2JVH A;  2R7Q A;  4KNY A;  4V2F A;  2ZC2 A;  3WGH A;  3ZQG A;  2VE8 A;  3HRM A;  4FIS A;  3W2W A;  1JE8 A;  2VKD A;  5LHH A;  4PFP A;  1OR7 A;  1OYI A;  4BJ6 C;  5DM7 F;  1I5Z A;  4RGS A;  2A68 F;  4RAG A;  4KIF A;  3LA2 A;  4ZDP A;  4IRI A;  3H0G J;  4LIU A;  2RVC A;  3ECO A;  2EH3 A;  4IX7 A;  2ZME B;  2OC6 A;  1TWA J;  3N4M A;  1AOY A;  2K4J A;  2LP0 A;  2Y9Y A;  2HKO A;  1GDT A;  1F9N A;  1FOW A;  1E0E A;  1FOY A;  4ABZ A;  1ORK A;  4KIS A;  1X1A A;  1IRF A;  1I1G A;  2JZY A;  4DBQ A;  4OMY A;  5M3M J;  1BM9 A;  2F5C A;  3KP4 A;  3O6B B;  3ZMS A;  1ZHF A;  3JTG A;  3H3Z A;  4NUB A;  4BS9 A;  1HST A;  5IT9 K;  3ABK H;  4MEY F;  2HWV A;  2HS5 A;  1FX7 A;  2ISY A;  4UB6 C;  2DDB A;  3WG7 H;  2HOS A;  4NQW B;  1HA8 A;  5D6E A;  2XGX A;  2CRG A;  4RLF A;  4N9I A;  1D5Y A;  2XSD C;  4PZJ A;  1ZGW A;  3VSK A;  2JRT A;  3E5X A;  4B4C A;  3ROU A;  2IT0 A;  1BN5 A;  4BEH A;  9ANT A;  1BC7 C;  1WJF A;  5K5O A;  4P55 A;  1GVJ A;  2COB A;  1KZH A;  3KCC A;  1YJW I;  1PDN C;  1SVL A;  4ETS A;  3E7L A;  1KU2 A;  3V8K A;  3KEY A;  4CZZ A;  4XLN F;  4G8X A;  4PJ0 C;  2LNB A;  1NTC A;  5HNF A;  4PUS A;  2FML A;  3P9K A;  3CLQ A;  2IRF G;  3RZD J;  5J47 A;  2FE3 A;  2KDZ A;  2ZKZ A;  2E71 A;  1DGW Y;  1AHD P;  2F5F A;  4HBL A;  4IL6 C;  1JI8 A;  1YS6 A;  1VQ6 I;  5J1R A;  5F27 A;  3F3X A;  2B63 J;  5CYV A;  5D6F A;  1EA3 A;  1H88 C;  4EEF G;  1DU6 A;  4O3M A;  4XOR A;  3DV8 A;  2H6B A;  1E2X A;  2ESH A;  5B66 C;  5A2Q K;  3EUH C;  2GM4 A;  3Q3S A;  2XAG A;  5EZH A;  3K70 C;  5CLS A;  4RB1 A;  2BYV E;  3NAR A;  2KRH A;  3HEF A;  1Z77 A;  2V1N A;  4A69 C;  3ZOB A;  1N75 A;  4XRS G;  4DZP A;  3ZGK A;  2DOE A;  2BHZ A;  2KDO A;  3RYP A;  1SD5 A;  3SEZ A;  4FT8 A;  2FUG 2;  5AON A;  3HTS B;  3S15 J;  4IRG A;  1S7E A;  3ZMD A;  1X2M A;  2KQR A;  1OQY A;  2EIM H;  3E6B A;  3EUH A;  4XKC A;  5H6R A;  2XAH A;  4CIC A;  1WCM J;  2LY2 A;  1XTA A;  2XB0 X;  3QPT A;  4HV6 A;  3H35 A;  3AL0 B;  3RKQ A;  2HQN A;  4BHP A;  1STZ A;  3K4K A;  4JQF A;  4Y3O A;  2OBP A;  3MD2 A;  1JUP A;  2NXN B;  2V9V A;  1KU7 A;  3LST A;  5FD6 A;  5DEQ A;  2QKL B;  2MLK A;  5FFX A;  1R00 A;  3VDX A;  3R6S A;  1IZ1 A;  3BZK A;  3ZMV A;  3JRB A;  2IS4 A;  3BR0 A;  4GO1 A;  3HRT A;  2B9S A;  1QVU A;  4IHX A;  3ZQH A;  5IP7 J;  1MMS A;  1G8X A;  4C3J J;  4UVA A;  4Q48 A;  2V9K A;  2WB1 N;  1WI3 A;  3IUO A;  2M8G X;  3CCL I;  3OYK A;  2ZJ2 A;  3PSI A;  1F43 A;  1MSF C;  4YFK F;  1TBX A;  3E6D A;  4B48 A;  2VOO A;  4LIT A;  3V8J A;  4OWR B;  2OPT A;  3UR3 C;  2KIF A;  2QF7 A;  3DKY A;  3I58 A;  1IRZ A;  1Y0N A;  2CW0 F;  2JA7 J;  5DCM A;  1OKR A;  2O03 A;  5LD2 C;  4DJA A;  4XLA A;  5DTD A;  5IOZ A;  1XGM A;  3RKY A;  2JQ7 A;  1KQ9 A;  4HPQ A;  4OAY A;  4Y13 A;  1OCT C;  2HVR A;  2QEN A;  4D9J A;  2KZG A;  1B72 B;  5JHU A;  1UAA A;  2GBY A;  4XON A;  3IRQ A;  3JAM K;  3OYN A;  1D1C A;  3FM5 A;  4CDG A;  3JRH A;  2ME6 A;  1BI0 A;  2JA6 J;  1T39 A;  2HGC A;  3RPU A;  1YJN I;  1Z3Y A;  4I7H A;  3OYL A;  3WTZ A;  5JHF A;  5F0C A;  2CS3 A;  4BU2 A;  4IHT A;  3IH3 A;  2FNA A;  3TP3 A;  4HSR A;  4C2M J;  3I64 A;  1W36 D;  3E6M A;  4MNU A;  1W7P D;  1WQ2 A;  1RUN A;  1U9N A;  5KNL A;  4C2U A;  1BOA A;  1S8N A;  3I71 A;  2NNY A;  5TRD A;  2RRE A;  4L9J A;  5GP9 A;  1I6H J;  1A6Q A;  3S3M A;  2CSO A;  3DFG A;  2OZ6 A;  2STW A;  3P9I A;  1HKQ A;  3H9Q A;  2Q0O A;  3RYR A;  1MZB A;  1JJ8 C;  4HV5 A;  1OFC X;  3I55 I;  4I76 A;  1R4M B;  1MBH A;  2M7A A;  4WXD A;  3IV5 A;  2JRM A;  2P4W A;  3NWS A;  3CMY A;  3GTG J;  3T8T A;  3BJA A;  3JCU C;  4I6Z A;  3GWZ A;  1YRN B;  3VYT B;  4BQA A;  2L7F P;  3BWG A;  3U9G A;  4M9Z A;  2RV8 A;  2E19 A;  4B1R A;  3RZO J;  3M4O J;  1T8I A;  4CO8 A;  4IVN A;  2DA3 A;  2H8R A;  2VJI A;  1G4D A;  4G7H F;  3EUK L;  3LNQ A;  2R5Z A;  4N4N B;  2MC3 A;  2CWE A;  4CGZ A;  4CYC A;  4BL0 B;  5HLT A;  4IHV A;  2ECB A;  2GLO A;  3R0J A;  1FMW A;  4A0Z A;  3ZQC A;  4F93 B;  3B6C A;  4P96 A;  3HOT A;  3GBG A;  1VQ5 I;  3GTP J;  4ITV A;  2KJC A;  2V79 A;  3KZY A;  5HDG A;  1ZTR A;  2XGE A;  3DQV C;  4CUG A;  1UST A;  1HW2 A;  4IOC F;  4A3I J;  1MNM C;  2EZI A;  1K4S A;  1LEA A;  4I02 A;  1VFC A;  2G7U A;  5FKN A;  3BZ6 A;  3JR9 A;  3CO6 C;  4B3X A;  2VBZ A;  3SZG A;  2DA2 A;  3IH2 A;  3J7A O;  3BG9 A;  3HOS A;  3KEQ A;  4M9X A;  3F8B A;  3BG7 A;  2L02 A;  2F4M B;  3PUB A;  3K70 D;  1LVA A;  2PMH A;  2NYX A;  3HL2 A;  4A3B J;  1QA6 A;  1R4N B;  3PUF A;  5E1W A;  1P7J A;  4AD9 A;  3FHZ A;  1HBX G;  3D5L A;  2RKH A;  1BJA A;  3A0B C;  4XK4 A;  5D4R A;  4AYB A;  3BR6 A;  3I4P A;  4Q47 A;  1YI2 I;  2O6G E;  1B1B A;  2M87 A;  2QQB A;  4GDF A;  4L5I A;  2DA7 A;  3A4C A;  3F23 A;  3PO3 J;  1P2F A;  5KAI C;  3FMQ A;  4C2T A;  1Y39 A;  3CES A;  3ZP5 A;  3RQI A;  2DOA A;  3GFM A;  3ONQ A;  1WH7 A;  1Z1D A;  1T33 A;  3CP2 A;  4JYK A;  3BTI A;  5E8I A;  3DEE A;  3QPL A;  3KYL A;  1OJL A;  3KLN A;  2UUZ A;  2VQG A;  3TOA A;  3TMO A;  2FEZ A;  1R58 A;  5FD5 A;  1XB4 A;  1QQI A;  2ACJ A;  4QPQ A;  1ON2 A;  2DFF A;  4F3Q A;  3BT9 A;  2X48 A;  2XRL A;  3AG4 H;  2DJN A;  3CF5 F;  1XCB A;  4I01 A;  4DW6 A;  1X3W B;  3P5J A;  1QPM A;  4IKF A;  4L9N A;  3PSF A;  4PDK A;  1NK2 P;  4XLE A;  3I5U A;  4WXC A;  1JT0 A;  3BPX A;  1RR8 C;  4CCO A;  5DM6 F;  3OIP A;  3GTK J;  2UXN A;  2PJR A;  1D0Z A;  1FIP A;  2DCE A;  2X85 A;  4FTH A;  2C6Y A;  1HOM A;  2K02 A;  4ESJ A;  1R36 A;  1LDJ A;  1IG7 A;  3Q0W A;  1S7O A;  1SFX A;  3QAH A;  2ZSH B;  5TJJ A;  1IDZ A;  4UUV A;  2P81 A;  4RAF A;  3VB2 A;  5FGM A;  4I0B A;  3KZI C;  1GLN A;  3I59 A;  3PFY A;  1G2H A;  2VON A;  4YG2 F;  4KN7 X;  2R7O A;  3E3V A;  1X3Z B;  5AIP A;  1BOB A;  1U9O A;  2OCE A;  3VPR A;  1WH5 A;  5M5Y J;  1ZEL A;  3HIF A;  1Y0U A;  3GTJ J;  3CCY A;  4CH7 A;  1R1U A;  1F5T A;  2LH9 A;  4ESF A;  4HYE A;  4BXU A;  2NNN A;  5JLX A;  3BTJ A;  2LKP A;  6PAX A;  2DQR A;  2PQ8 A;  1E3O C;  3DTE A;  1V5E A;  4ZDO A;  1EJ9 A;  1RRJ A;  4BHB A;  3JRG A;  3M9A A;  3LFK A;  1RNL A;  1O57 A;  1PYV A;  2FQ4 A;  4U0Y A;  2W84 A;  3JRA A;  3OSG A;  5JR3 A;  2XDV A;  1XCV A;  3EYY A;  2R92 J;  4BQQ A;  2CW8 A;  1PVE A;  2FBH A;  1U8R A;  1MMD A;  1RC9 A;  2BZT A;  4D7N A;  3J7A Y;  2JPB A;  5EDN A;  3OYM A;  1J0R A;  1TWF J;  2F4I A;  5F6F A;  2XGC A;  2RGV A;  5DYM A;  3ABM H;  1Z67 A;  3JRF A;  3GZN B;  3H5A A;  3TO6 A;  2NS0 A;  3BC8 A;  4JP0 A;  1R71 A;  2LVS A;  4GXO A;  3IL2 A;  2HYG D;  3FIW A;  1AKH A;  4NC8 A;  3BDD A;  2AQF A;  2XC7 A;  2HR3 A;  3CMM A;  2OQR A;  1YOV B;  2ZCW A;  1R9T J;  2BHY A;  3CC7 I;  2BXZ A;  4UUS B;  2HNH A;  1FY7 A;  1NG7 A;  1XX5 A;  2ETH A;  1D0Y A;  2CFX A;  4RS8 A;  3BCA A;  4A0Y A;  3EPZ A;  2CFO A;  1SAN A;  2DPD A;  2V1U A;  5KVR A;  4HA8 A;  4UHT A;  1X2N A;  3MQ0 A;  5LHG A;  2DLL A;  3DKW A;  1RIO H;  2KMU A;  5JI6 A;  3Q0V A;  2O0Y A;  2IGN A;  3CC4 I;  2IS1 A;  1T0F C;  1ZG3 A;  3ULQ B;  1DGR M;  4EJW A;  5EEA A;  1XS9 A;  3CQZ J;  5IP6 A;  1O3S A;  5TIS C;  2M8E A;  3BP8 A;  5C3E J;  1XMK A;  2M4K A;  2E1N A;  3OYG A;  5FFZ A;  4BDY A;  4A5M A;  1YG2 A;  5L3F A;  4XN3 A;  1AU7 A;  2NVQ J;  3A03 A;  1I3Q J;  1XGO A;  5CVI A;  2NVT J;  2IXS A;  2DT6 A;  3MAJ A; 
#chains in the Genus database with same CATH homology
 1OMI A;  4LG0 A;  5DD8 A;  3I0T A;  1G3Y A;  3KP2 A;  4Z2Y A;  3WOD F;  1IXR C;  1K6O A;  2QLZ A;  4HQM A;  3ZMT A;  3IWF A;  2X0L A;  5EEG A;  5D5X B;  2IA0 A;  2GA2 A;  2R3S A;  3CUQ A;  4M9S A;  3OOP A;  4PCQ A;  3M8E A;  1MDM A;  3F8M A;  2QYO A;  3FXQ A;  4ZZL A;  1HW1 A;  1H9T A;  3HHH A;  5AIQ A;  1JXS A;  3KP6 A;  2VC0 A;  4ESB A;  4FX4 A;  3M1E A;  1ZGA A;  2FF4 A;  2PFB A;  1IN7 A;  1DDN A;  5EEH A;  1WI9 A;  4KDP A;  1R23 A;  4RB0 A;  2UWM A;  3K1M A;  4NHJ A;  1ODD A;  4RAY A;  3O3K A;  4YIF A;  3WTW C;  5E8G A;  3TOB A;  1K78 B;  1E17 A;  2A6H F;  4XSZ F;  1ZYR F;  1FNN A;  4LK1 F;  3RJP A;  2E7X A;  1R1V A;  1NHA A;  1FC3 A;  2L54 A;  2M30 A;  3FF5 A;  2XIG A;  4ZYG A;  2J5O A;  1DP7 P;  4FX0 A;  2QVO A;  2HFH A;  2PEX A;  3HSE A;  2A69 F;  4I09 A;  4EJU A;  2QUF A;  4HQE A;  5ILV A;  3MFK A;  3DPL C;  1DPU A;  3BJO A;  1T98 A;  3KET A;  2JSC A;  1FP1 D;  1VTN C;  2IA2 A;  3SXY A;  3ZMZ A;  2IJL A;  2XKP A;  3SHF A;  1T38 A;  2F2E A;  4B8X A;  5CVU A;  3TDZ C;  4HZF A;  4EQQ A;  2XKO A;  4EVI A;  2UXX A;  3J80 Z;  1R5H A;  4EJT A;  1PUE E;  2FNP A;  2O8X A;  1P4A A;  2A6E F;  2Q8K A;  2CQK A;  3J81 Z;  1ZG5 A;  2JTV A;  2DAO A;  2VBW A;  4R8H A;  2JPC A;  2P7V B;  3W6J B;  4M71 A;  1SD4 A;  1XN7 A;  2EV0 A;  3RI4 A;  5E18 F;  3T5X A;  5FLX K;  2XAQ A;  4GGG A;  5HLI A;  3DXJ F;  4LJZ F;  3VOD A;  3GW2 A;  1O7F A;  2W25 A;  1CF7 B;  2G7H A;  1KU3 A;  1XMA A;  3ZN1 A;  1AWC A;  2OA4 A;  4B09 A;  4BH9 A;  1R22 A;  3GXO A;  1REP C;  4ZYE A;  4U7D A;  2QBY A;  3L9F A;  4A5N A;  1J75 A;  1YFH A;  1DUX C;  2EA2 A;  1USS A;  3CJN A;  3TKY A;  4IHS A;  3MEX A;  2GZW A;  3FWE A;  4ENJ A;  4U88 A;  1SMT A;  1EH8 A;  1T0F A;  3KE2 A;  1I6X A;  2OU2 A;  4S05 A;  3V7C A;  4LFU A;  4EM2 A;  1Z7U A;  1WWX A;  1TQP A;  3KLO A;  4LK0 F;  3SQN A;  2K4B A;  1FWZ A;  2XAF A;  3H3U A;  3T0Y A;  5BPI A;  2YX7 A;  1QBJ A;  2LSO A;  5LEK A;  2Y75 A;  4XSX F;  5HDN A;  1KA8 A;  2GIV A;  4UV8 A;  4WCG A;  2ZXJ A;  2M1B A;  2E1C A;  2R7D A;  5HDK A;  4M73 A;  2EJR A;  4KN4 X;  5LGU A;  2VN2 A;  4EM0 B;  2XV4 S;  3G3Z A;  5LLQ A;  1Z6T A;  4R1H A;  1BC8 C;  2L4M A;  2MH2 A;  4MTE A;  4MQV A;  3K0L A;  1QGP A;  1FYK A;  5CVV A;  1CGP A;  1Q1H A;  3T8R A;  1T6S A;  1KQ0 A;  3V7S A;  1FBU A;  4AVP A;  1OYY A;  5HS9 A;  3GFI A;  3VFZ A;  3CUQ C;  1EH7 A;  5L3B A;  2VOD A;  2AXL A;  3E5Q A;  5DCF A;  5CJ9 A;  2EA4 A;  4U0V A;  4XBF A;  1IF1 A;  2Z5U A;  2QQ9 A;  4KMU X;  2BEO A;  1W5S A;  4I98 B;  3KP7 A;  1UB9 A;  4LGW A;  3BJ6 A;  1O3T A;  3R61 A;  3GX4 X;  5L3D A;  1V4R A;  5DUK A;  5HLG A;  4L18 B;  1P6R A;  1G6N A;  1S6L A;  2R7F A;  2P6T A;  5F1R A;  4O6J A;  2AS5 F;  1U5T A;  4IPA A;  4HLX A;  4U0W A;  3SZT A;  3TO9 A;  1HW5 A;  2E7W A;  2K7L A;  3KP5 A;  1O3Q A;  4LLN A;  3F8C A;  1D5V A;  4WK8 F;  3PQK A;  4UNO A;  2Q2E A;  4ZYH A;  3FX3 A;  1F1Z A;  3L7W A;  2PG4 A;  1D3Y A;  3ABU A;  1ZG1 A;  1HKT A;  3MCZ A;  5HS8 A;  2VT3 A;  3TO7 A;  3WTU C;  4M6X A;  4Y15 A;  2YSR A;  5E1X A;  1R5G A;  3M8F A;  4JBA A;  3ISP A;  1I1S A;  2HEO A;  2EFW A;  3N97 A;  4H0E A;  4KMF A;  1B4A A;  1W7P A;  1J59 A;  3GEZ A;  3MZH A;  3W6K B;  1K79 A;  3LAJ A;  2Z3Y A;  3PFI A;  1BIA A;  2OD5 A;  1U2W A;  5DCM B;  2ZBK A;  3K9T A;  1BI2 A;  2BBY A;  3H92 A;  5LBQ A;  5BMZ A;  1SD6 A;  2VT2 A;  1RI7 A;  2H27 A;  1R7J A;  4UVC A;  3GUD A;  5D8K B;  3FZV A;  4RB3 C;  2H09 A;  3E5U A;  2EWN A;  1IUY A;  1WRJ A;  3LA7 A;  4KIC A;  5JFR A;  1XDU A;  3GYH X;  4UV9 A;  3Q5F A;  4P5O A;  1Z05 A;  2A5Y B;  5ERI A;  2A61 A;  4FHT A;  4EGZ A;  4YFX F;  2Z9O A;  3DPT A;  2XVC A;  5JVT A;  3S2W A;  5HOO A;  4MHG A;  3R0A A;  4OIR F;  2G9W A;  3L00 A;  2MD5 A;  2VBX A;  4QWQ A;  1UCR A;  2MH9 A;  3TGN A;  1TQM A;  1YLF A;  3V7R A;  2P7C B;  3Q9S A;  4KUM A;  1SAX A;  1IN8 A;  1P4X A;  4MTD A;  1FZP B;  3BRO A;  2GAU A;  3GVA A;  3WTV C;  2RC4 A;  2Y48 A;  4CHU A;  2K27 A;  4EMS A;  5K5Q A;  2VE9 A;  3Q9V A;  5HVQ C;  2PI0 A;  1P4W A;  1IAW A;  3MZY A;  3GLX A;  1OPC A;  4QLC U;  2NRA C;  2Y0M A;  2DU9 A;  1MD0 A;  2L3D A;  4E70 A;  3E6C C;  1J7K A;  3WGI A;  4LB6 B;  3V4G A;  2YU3 A;  3DP7 A;  5J8C A;  1XSV A;  2ZME A;  5IT9 Z;  4LLG F;  4ZH4 F;  3B02 A;  2QQA A;  4LB5 A;  2CO5 A;  2HQR A;  5K1Y A;  4AWX B;  3F8N A;  2HOE A;  3RPQ A;  1V3F A;  1FLI A;  1YW7 A;  1WKM A;  5HS7 A;  3HSF A;  3CO7 C;  4OIQ F;  2ELH A;  3RTR A;  1KYZ A;  2FXA A;  4NQW A;  1ULY A;  3RKW A;  3NRV A;  2V1X A;  1DPR A;  2STT A;  1S7A A;  3F6V A;  1GXP A;  4O5V A;  2EK5 A;  2KJB A;  1QZY A;  1HQC A;  1SMY F;  3WE3 A;  2FBK A;  3FMS A;  4HX8 A;  3ERE D;  1ZLK A;  1BIB A;  2X4H A;  3I59 B;  2O61 A;  4XRF A;  5A2Q Z;  3FM3 A;  1ZRC A;  5D5V B;  2IA1 A;  1TNS A;  2FA5 A;  4KA4 A;  2XAS A;  4KYW A;  3NQO A;  2BV6 A;  5LRS A;  3ABT A;  4S04 A;  4WX9 A;  4A0X A;  3U2R A;  2OAZ A;  1YS7 A;  2DI3 A;  4HF0 A;  2L4A A;  4HLY A;  4WXH A;  3IHU A;  2DW4 A;  2HTS A;  5J8F A;  4N9H A;  2LDU A;  3WE2 A;  2DFI A;  4MQ9 F;  1HSJ A;  1IN5 A;  1FPQ A;  2D1V A;  3NEU A;  1MJ9 A;  1MKM A;  2KIU A;  2ESN A;  4OIN F;  3VEP A;  2PMU A;  5K5R A;  1OYW A;  1ZLJ A;  1D8J A;  3ELK A;  3M7G A;  2RNJ A;  1U5T C;  2FMY A;  2EFN A;  2ADU A;  4Y17 A;  2EV6 A;  3SFZ A;  1YW8 A;  1XDS A;  2HTJ A;  2P5V A;  3EDP A;  4AIH A;  2PN6 A;  4RGX A;  2GA1 A;  2EFP A;  4G94 A;  1ZAO A;  1BI1 A;  3KP3 A;  4MEX F;  4UVB A;  4P9U A;  4OMZ A;  3JAM Z;  1QO0 D;  3CLO A;  1ZN2 A;  2CG4 A;  3ECH A;  1QZZ A;  1QNT A;  4LG0 B;  4Q5S F;  2Z33 A;  3LQQ A;  3REO A;  3ZQ7 A;  2RDP A;  2GWR A;  1W5T A;  2FBI A;  5L3G A;  1HXD A;  1ZRD A;  1J9I A;  1X3U A;  1GXQ A;  1U6G A;  2GXG A;  4CXF A;  1YTY A;  1B9M A;  4MGR A;  4DNC A;  1LDK B;  2EB7 A;  3CUQ B;  4EM1 A;  2DPU A;  1LB2 A;  1RUO A;  1FOK A;  1XSD A;  4LMY A;  2EFQ A;  1FT9 A;  5DD4 A;  3PQJ A;  1MDM B;  1Z91 A;  5BOX A;  5DDG A;  1ZRF A;  4M72 A;  2ZO4 A;  4AIJ A;  3WTY C;  2FQ3 A;  3RIR A;  3C18 A;  4ZYD A;  2P6S A;  3LAP A;  2RQP A;  2F5D A;  3IKV A;  2KIM A;  3GF2 A;  4PGG A;  5DV5 A;  3C1D A;  1EV7 A;  2CYY A;  1K7A A;  2EV5 A;  2JT1 A;  5ICF A;  1S3J A;  2DT5 A;  4BNC A;  1U78 A;  2TDX A;  5D4S A;  2ZFW A;  2XRN A;  1C0W A;  1W4M A;  3JSO A;  1O3R A;  4A6E A;  2Z99 A;  4LLL A;  1TLH B;  4A12 A;  3GZ5 A;  3KFW X;  4GYG A;  1ON1 A;  3IC7 A;  2DBB A;  1LDD A;  2OZU A;  3L2C A;  5H6Q A;  4KFC A;  5F64 A;  1D8K A;  5HLH A;  4RGU A;  1PP8 F;  3K69 A;  2ISZ A;  4ENM A;  5LGN A;  4JK1 X;  3GO5 A;  1G3S A;  3RKX A;  4ZZD A;  4P9F A;  2HDC A;  3FMR A;  1ONV A;  3QOP A;  3VOE A;  2YX4 A;  5H20 A;  2IVM A;  2J5P A;  4KIB A;  5L3C A;  5KK1 A;  2P5L C;  5BQT A;  3F6O A;  3F8F A;  3WTS C;  1GHC A;  2HZT A;  4HF2 A;  2W85 A;  5FO5 A;  1WSU A;  2YPR A;  1KGS A;  2PJP A;  1UHW A;  2PBI A;  1FYM A;  3CUO A;  1XSX A;  2GXB A;  1H9G A;  2EFO A;  1ZRE A;  4L0Y B;  3QP6 A;  3J80 K;  4OOI A;  4RGR A;  3RDI A;  4UXN A;  2D1H A;  1R1T A;  1JHH A;  4CYD A;  4HOB A;  2WWY A;  3J81 K;  4OIO F;  1KQ8 A;  3E97 A;  4DQ2 A;  1B9N A;  4EJV A;  4R79 A;  1FSH A;  1FBQ A;  2V1D A;  4BHC A;  4GYI A;  2V6C A;  4D0P A;  2WTE A;  3DEU A;  4HX7 A;  3KZZ A;  3P9C A;  4EJO A;  1YW9 A;  2HKX A;  2NAZ A;  5BS6 A;  1YQA A;  3F22 A;  1IRG A;  1BBY A;  3QU3 A;  1XGS A;  4A2U A;  4M74 A;  3ZMU A;  4N0B A;  4K2E A;  3HYI A;  2A3S A;  2DO7 A;  2QBY B;  4LD5 A;  3MWM A;  5ILU A;  3K2Z A;  3WGG A;  2FOK A;  2K86 A;  1MJB A;  4BYY A;  1G3W A;  5ICC A;  3GZ6 A;  1T2K A;  5DUI A;  5LGT A;  2H94 A;  4I2O A;  4WWC A;  2MA3 A;  3TDU C;  2YR2 A;  2UZK A;  3R60 A;  1JHF A;  2O3F A;  3V8L A;  2IP2 A;  2QWW A;  3HTU A;  1YO5 C;  2L01 A;  2D45 A;  3LQR A;  5D8L B;  5ED4 A;  2FU4 A;  2BE5 F;  4EGY A;  5ICE A;  1I27 A;  3D0S A;  4L0Z B;  3BY6 A;  4L9T A;  2B0L A;  3HRU A;  3WU1 B;  5L3E A;  3WTX C;  1XGN A;  1L0O C;  4HAM A;  1FP2 A;  4A6D A;  3L09 A;  4IRH A;  3K1P A;  5LRR A;  3COA C;  2P5K A;  2P8T A;  1ZAR A;  1FYL A;  2RN7 A;  4G9Y A;  4YII A;  5LEJ A;  1EH6 A;  2GQQ A;  4IXA A;  2COM A;  2QM3 A;  1MJA A;  2KKO A;  2DK5 A;  3HHG A;  3ZN0 A;  3LWF A;  1B59 A;  4RAZ A;  2LF8 A;  1U3E M;  3WTT C;  1UFM A;  3QPH A;  1H0M A;  3BOQ A;  4KIG A;  2IW5 A;  2XAJ A;  3IKT A;  4HDV A;  1K78 A;  1ZH5 A;  3I54 A;  4AIK A;  2CGP A;  4HX4 A;  3TQN A;  5D5U B;  3HRS A;  3R4K A;  5E1Z B;  3EYI A;  5ILS A;  4WF2 A;  2PLY A;  4HDU A;  2F5E A;  1TNT A;  1SFE A;  3HUG A;  1FBS A;  3FXU A;  1YIO A;  3K1N A;  3QP5 A;  3JW4 A;  4G6D A;  2XUB A;  3CDH A;  2D2W A;  2DK8 A;  4YFN F;  4NB5 A;  4ON0 A;  5LHI A;  1LJ9 A;  2FRH A;  2WC2 A;  4I0A A;  1U5T B;  3DF8 A;  3WU0 A;  3P7N A;  3IWZ A;  2BGC A;  5J6X A;  1SFU A;  3B73 A;  2DQL A;  1TW2 A;  3G73 A;  3JSP A;  1Z9C A;  3WG9 A;  1A04 A;  2MBF A;  1XD7 A;  3CTA A;  4U7B A;  3KEO A;  4ENK A;  3AAF A;  2QZ8 A;  5FLX Z;  1F4K A;  2ZNZ A;  4IF4 A;  3GFL A;  2M5W A;  3C7J A;  2XHK A;  2HYF A;  3OV8 A;  1JGS A;  1ZGJ A;  3F72 A;  2FSW A;  3QU6 A;  5FB2 A;  3GFJ A;  3IRR A;  3F21 A;  4EV0 A;  1UHM A;  5ICG A;  1B6A A;  1PP7 U;  1G3T A;  5BPD A;  1IN4 A;  4OIP F;  1J5Y A;  4G7Z F;  4HF1 A;  5CVJ A;  1Z6R A;  2ZNY A;  1RZ4 A;  4L9V A;  2W57 A;  1CF7 A;  1IW7 F;  1KYW A;  2KRF A;  2VXZ A;  4G7O F;  1W7P B;  2A07 F;  2OQG A;  1L3L A;  2MLG A;  2H6C A;  4BAY A;  4RB2 C;  1O7L A;  3ML6 A;  4G6Q A;  2W24 A;  3SZP A;  2LF7 A;  3QRF F;  2WV0 A;  2DTR A;  2IPQ X;  1LQ1 A;  1YYV A;  1KU9 A;  1IXC A;  3BPV A;  4TV7 A;  1MGT A;  1LNW A;  5IT3 A;  3JTH A;  5D5W B;  4M6Y A;  4XLP F;  1BI3 A;  5E20 A;  2XRO A;  2VBY A;  4L5J A;  3LA3 A;  2VC1 A;  1SD7 A;  4ASN A;  4F7Z A;  1FSE A;  4ENN A;  4OU0 A;  1HKS A;  4Q4Z F;  1J2X A;  1TW3 A;  3I53 A;  3U1D A;  3O2P E;  3HSR A;  4PGH A;  1LEB A;  1TQI A;  5E17 F;  4HW0 A;  3T1B A;  1IXS B;  3FXR A;  4IJA A;  3C3W A;  5CVR A;  4KT5 C;  1P92 A;  2M45 A;  3ZPL A;  1S29 A;  4GCV A;  1IN6 A;  2VOP A;  3EQL F;  3EET A;  1TTY A;  4KNY A;  3WGH A;  2VE8 A;  3HRM A;  1JE8 A;  5LHH A;  1OR7 A;  1OYI A;  1I5Z A;  4RGS A;  2A68 F;  4KIF A;  3LA2 A;  4IRI A;  2RVC A;  3ECO A;  2ZME B;  3N4M A;  1AOY A;  2K4J A;  2HKO A;  1F9N A;  1IRF A;  1I1G A;  2JZY A;  4OMY A;  1BM9 A;  2F5C A;  3KP4 A;  3O6B B;  3ZMS A;  1ZHF A;  3JTG A;  3H3Z A;  1HST A;  5IT9 K;  4MEY F;  2HWV A;  2HS5 A;  1FX7 A;  2ISY A;  5D6E A;  2XGX A;  4N9I A;  4PZJ A;  2JRT A;  3E5X A;  3ROU A;  2IT0 A;  1BN5 A;  1BC7 C;  5K5O A;  4P55 A;  1GVJ A;  3KCC A;  1PDN C;  4ETS A;  1KU2 A;  3V8K A;  4CZZ A;  4XLN F;  4G8X A;  2LNB A;  2FML A;  3P9K A;  2IRF G;  2FE3 A;  2ZKZ A;  2F5F A;  4HBL A;  1YS6 A;  3F3X A;  5CYV A;  5D6F A;  4O3M A;  3DV8 A;  2H6B A;  1E2X A;  2ESH A;  5A2Q K;  2XAG A;  5CLS A;  4RB1 A;  2BYV E;  3RYP A;  1SD5 A;  4FT8 A;  5AON A;  3HTS B;  4IRG A;  3ZMD A;  3EUH A;  3E6B A;  5H6R A;  2XAH A;  4CIC A;  3QPT A;  4HV6 A;  2HQN A;  4BHP A;  1STZ A;  4JQF A;  2OBP A;  2V9V A;  1KU7 A;  3LST A;  5FD6 A;  5DEQ A;  2MLK A;  5FFX A;  1R00 A;  3R6S A;  1IZ1 A;  3ZMV A;  4GO1 A;  3HRT A;  4UVA A;  4Q48 A;  2ZJ2 A;  4YFK F;  1TBX A;  3E6D A;  2VOO A;  3V8J A;  2KIF A;  3I58 A;  2CW0 F;  5DCM A;  1OKR A;  2O03 A;  1XGM A;  3RKY A;  1KQ9 A;  4Y13 A;  2QEN A;  5JHU A;  3IRQ A;  3JAM K;  3FM5 A;  4CDG A;  1BI0 A;  1T39 A;  2HGC A;  3RPU A;  4I7H A;  3WTZ A;  4IHT A;  2FNA A;  3I64 A;  3E6M A;  4MNU A;  1W7P D;  1WQ2 A;  1RUN A;  1BOA A;  1S8N A;  3I71 A;  2NNY A;  5TRD A;  4L9J A;  2CSO A;  3DFG A;  2OZ6 A;  2STW A;  3P9I A;  1HKQ A;  2Q0O A;  3RYR A;  1MZB A;  4HV5 A;  4WXD A;  2P4W A;  3T8T A;  3BJA A;  3GWZ A;  4BQA A;  3BWG A;  3U9G A;  4M9Z A;  2RV8 A;  4CO8 A;  4IVN A;  1G4D A;  4G7H F;  2MC3 A;  2CWE A;  4CGZ A;  3R0J A;  4A0Z A;  4P96 A;  3HOT A;  2KJC A;  2V79 A;  3KZY A;  5HDG A;  3DQV C;  1UST A;  1HW2 A;  1LEA A;  4I02 A;  2G7U A;  3BZ6 A;  3CO6 C;  2VBZ A;  3J7A O;  3HOS A;  3KEQ A;  4M9X A;  3F8B A;  2L02 A;  1LVA A;  2PMH A;  2NYX A;  5E1W A;  4AD9 A;  3FHZ A;  1HBX G;  3D5L A;  2RKH A;  1BJA A;  5D4R A;  3I4P A;  4Q47 A;  2O6G E;  1B1B A;  2M87 A;  2QQB A;  4L5I A;  3F23 A;  1P2F A;  3FMQ A;  3ZP5 A;  3GFM A;  1Z1D A;  5E8I A;  3KLN A;  3TOA A;  2FEZ A;  1R58 A;  5FD5 A;  1XB4 A;  1QQI A;  2ACJ A;  1ON2 A;  1XCB A;  4I01 A;  1QPM A;  4L9N A;  4PDK A;  3I5U A;  4WXC A;  3BPX A;  2UXN A;  2C6Y A;  2K02 A;  4ESJ A;  1R36 A;  1LDJ A;  1S7O A;  1SFX A;  3QAH A;  5TJJ A;  4UUV A;  3VB2 A;  5FGM A;  4I0B A;  3I59 A;  2VON A;  4YG2 F;  4KN7 X;  3E3V A;  5AIP A;  3HIF A;  1Y0U A;  1R1U A;  1F5T A;  4ESF A;  4HYE A;  4BXU A;  2NNN A;  2LKP A;  6PAX A;  2DQR A;  2PQ8 A;  4BHB A;  3M9A A;  3LFK A;  1RNL A;  1O57 A;  4U0Y A;  2W84 A;  5JR3 A;  3EYY A;  1XCV A;  2FBH A;  1U8R A;  2JPB A;  1J0R A;  5F6F A;  2RGV A;  5DYM A;  3TO6 A;  2NS0 A;  4GXO A;  3IL2 A;  2HYG D;  3BDD A;  2HR3 A;  2OQR A;  2ZCW A;  1FY7 A;  2ETH A;  4RS8 A;  2CFX A;  4A0Y A;  2DPD A;  2V1U A;  5KVR A;  4HA8 A;  4UHT A;  3MQ0 A;  5LHG A;  2DLL A;  3DKW A;  1RIO H;  5JI6 A;  2O0Y A;  1ZG3 A;  3ULQ B;  4EJW A;  1O3S A;  2M8E A;  3BP8 A;  1XMK A;  2E1N A;  5FFZ A;  4A5M A;  1YG2 A;  5L3F A;  1XGO A;  5CVI A;  3MAJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...