1GHCA

Homo-and heteronuclear two-dimensional nmr studies of the globular domain of histone h1: full assignment, tertiary structure, and comparison with the globular domain of histone h5
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
75
structure length
75
Chain Sequence
MAGPSVTELITKAVSASKERKGLSLAALKKALAAGGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFRLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GH1
publication title Homo- and heteronuclear two-dimensional NMR studies of the globular domain of histone H1: full assignment, tertiary structure, and comparison with the globular domain of histone H5.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Chromosomal protein
total genus 9
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 1994-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00538 Linker_histone linker histone H1 and H5 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1ghcA00
3GX4X 1Z1DA 3MEXA 2XAHA 3MAJA 4PZJA 2KJCA 1MDMB 5CYVA 1LJ9A 2W85A 4RB2C 3FM3A 1B9NA 3JTHA 2DW4A 4L0ZB 1MKMA 5D5WB 4ENMA 5ERIA 2Q8KA 4I02A 2EK5A 4KIBA 4GYIA 1IXRC 3HOTA 2VBXA 1GHCA 3ZN0A 1UHWA 5AONA 4P55A 4AWXB 3GFMA 2G7HA 3FMSA 1QZYA 4I98B 3ABTA 1T2KA 2XAQA 1ZG1A 2HWVA 1YIOA 2ZNYA 2P7VB 4B09A 4G7ZF 5HDGA 2A5YB 2L01A 1BI2A 2FBHA 4G7OF 1J0RA 1SMTA 1A04A 1LDJA 3WTZA 3RYRA 3J81Z 4R8HA 2QZ8A 3VB2A 4JQFA 3QU6A 4AIJA 3ABUA 2PN6A 2JPCA 5KVRA 1G3TA 5LEKA 1KU9A 5DYMA 2GQQA 4AIHA 2STWA 2IA0A 4GCVA 3CO6C 4ZYHA 3ECOA 1S7AA 4KIGA 4UNOA 2V9VA 1JHFA 2QUFA 1QZZA 2EV0A 2BE5F 1ZRFA 3K0LA 2QYOA 1KU2A 4HDVA 1ZG3A 5D5UB 2LNBA 2HOEA 4HLYA 4YFNF 1YLFA 1ZN2A 2KKOA 4BQAA 1H9TA 1P4XA 5TRDA 2W25A 2BGCA 3L7WA 4GO1A 4KMUX 4U0WA 2L4MA 1F9NA 1RNLA 1OKRA 1I6XA 3DV8A 2FXAA 3ZMDA 2D2WA 1AWCA 3WTSC 1U5TC 1LDDA 1SD5A 1W5SA 2A07F 2D1HA 3P9KA 1ZRDA 3ULQB 4Q4ZF 4Y13A 3L2CA 5ICFA 4CYDA 2QQ9A 1Z6RA 4AVPA 3P7NA 2CFXA 3IHUA 1LB2A 1IW7F 2E7WA 5K5OA 1CF7A 1USTA 2D1VA 4HBLA 3J7AO 4HQMA 3QAHA 5BQTA 2A6HF 3R0JA 4M9SA 2Q2EA 2DK8A 1BOAA 2H94A 3EETA 4DQ2A 5DEQA 1XSVA 1ZGJA 1RZ4A 2IPQX 3F72A 4XSZF 1EH6A 3BJ6A 3N97A 5DUKA 3E6MA 3NEUA 1I27A 2UZKA 3DXJF 4XLPF 2O8XA 2PJPA 2QM3A 3IKTA 4LK0F 2EFNA 5DV5A 4KMFA 1KU3A 1YS6A 3E6BA 1XDSA 1YTYA 1WRJA 1KU7A 3LA2A 3F8NA 4DNCA 2VBZA 3QP6A 4HA8A 5CVVA 2DTRA 1FSEA 4KUMA 2VOOA 1FYMA 3GW2A 2A69F 2F2EA 3FXQA 4HLXA 1J5YA 3QPTA 2YU3A 2V6CA 3T0YA 2EFOA 4A0ZA 5H6QA 2V79A 2PI0A 2K86A 4G6DA 4M9ZA 1LVAA 1R7JA 4PGHA 1IF1A 4EVIA 5L3EA 1L0OC 4K2EA 3PQKA 4ZZLA 4L18B 4G6QA 2QENA 4P9FA 5E1WA 3EYYA 2E1CA 4CZZA 1ON1A 3HRUA 2ZJ2A 4EGZA 4LGWA 2A61A 1J2XA 2W24A 2P5VA 3KEQA 1QGPA 1IZ1A 2JPBA 2LKPA 5K1YA 3HOSA 1UB9A 4MHGA 2DK5A 5BOXA 3CTAA 2E7XA 1DUXC 1MZBA 4OMYA 5DCFA 4WWCA 2Z5UA 1L3LA 4MTDA 1IAWA 3E5UA 4YFKF 2P6SA 1KYZA 2L4AA 2DPDA 4A6DA 4RS8A 2A68F 2UXNA 2EV6A 1WSUA 4EM0B 1V4RA 3R61A 2XUBA 5FD6A 5L3GA 5CLSA 1ZARA 4CHUA 4YIIA 2ZO4A 4H0EA 3CUQA 3WGIA 1U2WA 1SFXA 2CSOA 4L5JA 3IL2A 2OZ6A 3NRVA 5K5RA 2Z9OA 2DAOA 4PGGA 1SAXA 2H27A 3TO9A 2AXLA 3D0SA 1T39A 3R4KA 1BIBA 5ICGA 3BOQA 4N0BA 4U7DA 3F6VA 3ZMTA 1K7AA 1TBXA 2EB7A 2HS5A 2RV8A 1JE8A 2QWWA 1IN6A 5FGMA 2NS0A 2JZYA 5DCMA 1HW2A 4Z2YA 4QWQA 1XSDA 3BP8A 1E2XA 3J81K 3VFZA 5JVTA 3FXUA 4MQ9F 2BBYA 4UHTA 3ZMZA 4HZFA 3C7JA 1P92A 2VOPA 3VOEA 3T1BA 4ESBA 4YIFA 2VBWA 2F5FA 4OU0A 5HDNA 4LJZF 2XGXA 4B8XA 2VT2A 3LA3A 1R00A 2PQ8A 2VE8A 1YW8A 2XAJA 3SZPA 1T98A 1PP8F 1S6LA 3GEZA 3TOAA 3JSOA 2FMYA 3GFLA 1KYWA 4ENJA 3WE2A 2FNAA 1ON2A 1DPRA 1YW9A 1OYIA 4HQEA 2YX4A 4KICA 1ZHFA 2RVCA 5J8CA 4KN4X 2P7CB 4OIRF 2MLKA 1WI9A 3KZYA 1OPCA 4LB6B 2W84A 5FFXA 3BPVA 4M6YA 5HOOA 4IHSA 2HGCA 1S3JA 2ACJA 2HTJA 5LHGA 3DPLC 1AOYA 2MA3A 4OIQF 1ZYRF 2XHKA 2HYFA 3FHZA 2OZUA 3KZZA 2DFIA 1H0MA 2D45A 4IRGA 1QPMA 2ZNZA 2HR3A 4LG0A 3HSEA 2COMA 4OMZA 3IWZA 3VEPA 5ILUA 4BYYA 2DLLA 2OA4A 4L9NA 5FD5A 4TV7A 3F3XA 1T6SA 2RNJA 3ZQ7A 1R1UA 4D0PA 5FB2A 2HKOA 3E6CC 3HHHA 2B0LA 3W6KB 4OIPF 3HTUA 3I54A 3I64A 1IN4A 4KIFA 3M8FA 4HX4A 1B4AA 1LQ1A 4UV8A 3F8FA 2K27A 2XAGA 2GAUA 1K78A 3GWZA 3F8MA 5HLIA 3E5QA 4L9JA 3I59A 4IXAA 5LGUA 2EJRA 3RTRA 2MH9A 1B59A 2MC3A 5F64A 5H6RA 1BM9A 1XGOA 3GUDA 2CO5A 2IJLA 1U8RA 4G94A 5A2QK 3K1NA 1UFMA 1WQ2A 3C3WA 1HSTA 3REOA 1DDNA 5LRRA 4WXDA 1FZPB 2X4HA 1FNNA 1USSA 5CJ9A 3LAPA 4BHBA 4UVAA 4MEXF 3PQJA 3TGNA 2A6EF 1LDKB 2PFBA 5HLGA 4UV9A 1FX7A 2E1NA 3GYHX 3QU3A 2J5OA 4L9VA 3KLNA 5AIPA 2FOKA 5BS6A 3E97A 1XCBA 1R1TA 3HIFA 2ESNA 4KNYA 1XGMA 1YYVA 1QQIA 2Q0OA 1QNTA 1JHHA 2G9WA 4ETSA 3LQRA 1PP7U 1GXQA 1IXCA 1P6RA 1MD0A 4HX7A 3G3ZA 2VT3A 3L9FA 4WX9A 2CQKA 4A2UA 1OYYA 2KIFA 1G4DA 1D5VA 2FF4A 4CGZA 4L5IA 4EJVA 1I5ZA 4BAYA 1R36A 3PFIA 4MGRA 5J6XA 1BC8C 2ZMEB 1T38A 2DQRA 1QBJA 4LLNA 1BI1A 4EJTA 1TQIA 1J7KA 4F7ZA 4LLGF 4BH9A 1YG2A 2F5DA 1J75A 3Q9VA 2P5KA 1TQMA 4LB5A 3FWEA 5J8FA 1WWXA 3R60A 3V8LA 1XGSA 3WG9A 4PCQA 2NNNA 2QQBA 3J80K 3JTGA 2DT5A 2KJBA 4RGUA 1QO0D 2QBYA 5LGTA 5HLHA 2DO7A 3WU0A 1DP7P 5KK1A 5JI6A 5L3BA 1U5TB 4O6JA 1RIOH 3QOPA 5IT9K 5L3CA 3C18A 2QQAA 1RUOA 1HBXG 3CDHA 3SXYA 1S8NA 5H20A 1TW3A 2LSOA 1GVJA 3V4GA 1FPQA 1HW5A 3I71A 1TNSA 4EMSA 4HX8A 3RPUA 2O61A 2WWYA 3GFIA 2W57A 1B6AA 3E3VA 3EQLF 4FHTA 3KETA 3BJAA 1G6NA 3WTTC 5E1XA 1I1SA 2ADUA 2M8EA 4I0AA 4RGRA 5A2QZ 1XMKA 1Z6TA 4M74A 1HKTA 5ICEA 4RAZA 2L3DA 3QRFF 1YQAA 1E17A 3V8JA 5HS8A 4IRHA 4PDKA 4WK8F 2LF7A 4Y15A 5EEHA 4P9UA 1Z7UA 4MEYF 1F4KA 1TTYA 4HYEA 1C0WA 1BJAA 1V3FA 1HXDA 2MH2A 3U2RA 4Q5SF 3OOPA 4R1HA 3KCCA 2FBIA 2RC4A 1RI7A 2DPUA 4HF2A 1OMIA 4EM2A 4E70A 1MJBA 1REPC 2HTSA 1MDMA 4EM1A 2R3SA 5L3DA 2NAZA 1OYWA 4AIKA 4QLCU 2BEOA 2A3SA 3V7SA 1KA8A 3W6JB 2X0LA 2VN2A 5ILVA 3TDZC 5FLXZ 3EDPA 1LNWA 4KN7X 1EH8A 3D5LA 2XASA 4S05A 2M45A 3SZTA 4ZYDA 3KEOA 4ZZDA 1XMAA 1U6GA 4KFCA 3RYPA 1O3SA 2NNYA 1O3TA 1SFUA 2FRHA 3WE3A 1MGTA 3F6OA 3GZ6A 3T8RA 4WF2A 3DF8A 2F5EA 1ZH5A 2YX7A 4ZH4F 2ZBKA 3WTWC 4XBFA 1F5TA 3ML6A 3ZN1A 2HQNA 3O6BB 2JSCA 3J80Z 2PMHA 1BIAA 3ZPLA 2IP2A 1MJ9A 1XGNA 4A5NA 2FBKA 3L00A 3ZMSA 3C1DA 3MFKA 4CICA 1HSJA 2FNPA 1CF7B 3G73A 3TDUC 2Z3YA 5IT9Z 3BZ6A 4U7BA 2JRTA 4RGXA 3KFWX 5LLQA 1P4AA 2ZFWA 4I0BA 2HKXA 2RDPA 2P8TA 3SQNA 3JAMZ 5FFZA 6PAXA 2L54A 4UXNA 1R5HA 5E8GA 1W7PB 2RKHA 4HF1A 4KA4A 4KYWA 4OINF 3HUGA 3SFZA 1BN5A 4HOBA 5LBQA 1IRGA 5ED4A 1R5GA 2HEOA 3KP7A 4IF4A 1SFEA 4P5OA 2XAFA 3ZMUA 4LD5A 5E18F 1ULYA 3LWFA 3HRSA 1XN7A 1FYKA 2V1DA 4Y17A 3FX3A 2OU2A 3V8KA 1O3QA 5D8LB 1FC3A 4IRIA 5D6FA 2VBYA 1SMYF 1W5TA 1B9MA 2NYXA 4JBAA 5DD4A 2PG4A 4M72A 1HQCA 5BMZA 5E17F 1O7FA 1U5TA 3F21A 1O3RA 1D8JA 1ODDA 1FP2A 2P5LC 3CUQC 3F23A 4M9XA 4RAYA 5HDKA 3RDIA 1Z9CA 4G7HF 4CXFA 3FF5A 3R0AA 5HVQC 2H6CA 2XVCA 3TO7A 3BJOA 3WTVC 3LSTA 4ASNA 2OQGA 3MZYA 1FLIA 5D4RA 1ZRCA 2TDXA 3KP4A 4IVNA 4GGGA 3HHGA 3RPQA 1UHMA 5HS7A 3ERED 1KQ9A 3DFGA 2KIMA 1KQ0A 3KP2A 4ESFA 2IW5A 2M1BA 3N4MA 4A6EA 3R6SA 1PUEE 3ZP5A 1ZAOA 4NQWA 2CYYA 4EV0A 3CUQB 3P9CA 5BPDA 5IT3A 5E1ZB 2CWEA 3TO6A 5F6FA 2JT1A 4IPAA 3RI4A 1X3UA 2PMUA 2VC1A 2FMLA 3KP3A 2GIVA 3BPXA 1ZREA 5L3FA 1XDUA 2G7UA 4ON0A 3FZVA 5D5XB 1YS7A 4MQVA 1P2FA 2BV6A 3I58A 2GXBA 1JXSA 1STZA 2XROA 4R79A 2MBFA 1RUNA 2M30A 3GVAA 2Y0MA 1FP1D 2IT0A 3LA7A 3COAC 3KP5A 3AAFA 2H6BA 5DCMB 5TJJA 5ICCA 2EFWA 4EJWA 5DDGA 3IKVA 3DEUA 1HKSA 1ONVA 2EA4A 2WV0A 4I2OA 4HV6A 4A12A 3HSRA 4HW0A 5K5QA 2KRFA 3U1DA 2ZXJA 2YR2A 1IN7A 3IWFA 3LQQA 1WKMA 1BI0A 5CVUA 1HKQA 4LMYA 2AS5F 4L9TA 2DU9A 3O3KA 1R22A 3K9TA 2GA1A 2KIUA 4WXHA 1ZGAA 3T8TA 5FLXK 1YO5C 4YFXF 4IHTA 1UCRA 3WGGA 1IXSB 2CG4A 5CVRA 2NRAC 4ENKA 1K6OA 3H3ZA 2ISYA 3RJPA 3DKWA 2ISZA 3RKYA 2ETHA 1FT9A 3K1MA 1U3EM 1BBYA 3BY6A 4BHPA 5HS9A 3FMQA 3L09A 3U9GA 3ZMVA 2FQ3A 3M9AA 4FX4A 3KE2A 3B02A 3K69A 3GLXA 1DPUA 3VODA 2O03A 3F8BA 3CUOA 2EWNA 3ISPA 4BXUA 1R23A 3HSFA 1TW2A 3EUHA 4HF0A 1Q1HA 3P9IA 3LAJA 4EJUA 4LK1F 2LDUA 4HAMA 1FBUA 2JTVA 1KQ8A 4AD9A 2EV5A 2M87A 5EEGA 5D6EA 3M7GA 3CO7C 2Z33A 5LEJA 3GXOA 4XRFA 1FBQA 4MTEA 2XKOA 2DQLA 3GF2A 4XSXF 1O7LA 1FWZA 5JHUA 4A0XA 3WODF 2IVMA 3RIRA 3TOBA 1W4MA 2FSWA 2OD5A 3O2PE 5DD8A 4M73A 5D5VB 4LG0B 3TKYA 5D8KB 1MJAA 1W7PA 4RB1A 2OBPA 3JAMK 1J9IA 1T0FA 4RGSA 3JSPA 4O5VA 1O57A 4LLLA 3MCZA 3CLOA 1NHAA 2RQPA 2RN7A 1G3WA 4I7HA 3DPTA 1FOKA 2OQRA 4KT5C 3QPHA 5FO5A 3B73A 2LF8A 1FYLA 1R58A 2F5CA 3GZ5A 2J5PA 2O0YA 3I5UA 4IJAA 1U78A 3FXRA 3IRRA 2ZCWA 3BWGA 2K4JA 2GZWA 2YSRA 5ILSA 5BPIA 3M1EA 4EQQA 1KGSA 4I01A 4UUVA 4M6XA 4G8XA 1K79A 1K78B 1R1VA 1GXPA 1W7PD 2QVOA 3I59B 4JK1X 1YFHA 1ZG5A 5JR3A 2Y75A 2PLYA 2FU4A 1XD7A 2EFQA 1J59A 1IRFA 2VC0A 2FA5A 2BYVE 3SHFA 4WCGA 1JGSA 4ESJA 4O3MA 2PBIA 4NB5A 1XCVA 1YW7A 4RB3C 4CO8A 4WXCA 2P6TA 4HV5A 2XIGA 1B1BA 3RKWA 2R7DA 3WTYC 2GA2A 1D3YA 1XSXA 3K2ZA 3RKXA 2HZTA 4CDGA 4GXOA 1S7OA 3ROUA 2OAZA 1ZLKA 2VONA 1S29A 2MLGA 1Y0UA 1TQPA 3GO5A 4A0YA 1VTNC 1I1GA 2XKPA 5CVIA 2ESHA 2DI3A 1Z91A 3TQNA 2FEZA 1LEAA 2M5WA 3GFJA 4P96A 1OR7A 4LFUA 2RGVA 3WGHA 2FE3A 2WC2A 2K4BA 2C6YA 3K1PA 2GWRA 2P4WA 4ZYGA 2CGPA 2IA2A 3F8CA 4N9IA 3CJNA 3WU1B 4OOIA 2STTA 1FBSA 3HRMA 1IN8A 1HW1A 4U0VA 2Z99A 3FMRA 2H09A 2HFHA 2ELHA 1FSHA 4YG2F 3OV8A 3IRQA 1SD7A 3E5XA 4L0YB 2L02A 5LGNA 5F1RA 4XLNF 5AIQA 4UVBA 1FY7A 5LRSA 3M8EA 2V1XA 2XV4S 2EFPA 1PDNC 4UVCA 2GXGA 2HQRA 3I0TA 4U88A 1CGPA 2HDCA 2XRNA 1F1ZA 3DP7A 3T5XA 3Q9SA 4Q47A 1TLHB 4A5MA 3NQOA 4BHCA 2ZKZA 2Y48A 2CW0F 4KDPA 2QBYB 3WTXC 3KLOA 3V7RA 4I09A 1H9GA 3HYIA 1XB4A 4MNUA 2PEXA 4OIOF 2EA2A 3I4PA 1D8KA 2K02A 2K7LA 3H3UA 2ZMEA 4M71A 5LHIA 2O6GE 3WTUC 5LHHA 1BC7C 2VE9A 3BDDA 5D4SA 2UXXA 4ZYEA 2IA1A 4Q48A 4EGYA 3ELKA 1EH7A 1LEBA 1G3YA 3KP6A 4BNCA 3H92A 2VODA 3QP5A 3MZHA 4GYGA 3DQVC 1IUYA 1SD6A 4NHJA 1Z05A 5JFRA 2YPRA 3ECHA 4ENNA 4FX0A 4N9HA 3MQ0A 4FT8A 1IN5A 1TNTA 2MD5A 3MWMA 5DUIA 1BI3A 3Q5FA 3HRTA 4EJOA 2UWMA 2WTEA 2DBBA 4U0YA 2V1UA 3BROA 5CVJA 3S2WA 2O3FA 2VXZA 3V7CA 3LFKA 1G3SA 3EYIA 3HTSB 3E6DA 1ZLJA 1EV7A 2QLZA 4S04A 4RB0A 3F22A 3I53A 1SD4A 4HDUA 3FM5A 5E20A 3IC7A 3JW4A 1P4WA 5E8IA 4G9YA 2IRFG 2R7FA 2HYGD
chains in the Genus database with same CATH superfamily
3IP4B 4ZTFA 1ZTRA 2DOFA 3ASNH 3GX4X 1Z1DA 5J1RA 3NAUA 1A5JA 3MEXA 3TL4X 2XAHA 1XTAA 2KFDA 1HDPA 2NS8A 2R7RA 1SVOA 3MAJA 2A5WA 4XLHA 1IJWC 3I4MJ 2QQ8A 4KITB 5F0FA 4DZPA 1AHDP 4PZJA 3RZDJ 3RZOJ 2KJCA 3OYJA 3DLAA 1MDMB 5CYVA 1LJ9A 2W85A 4RB2C 3FM3A 1B9NA 3JRIA 1JKPC 3JTHA 2DA2A 3MN2A 2DW4A 5M5YJ 5CKTA 3OS1A 4L0ZB 1MKMA 5D5WB 5FLVA 4ENMA 5ERIA 3M4OJ 5CPRB 2JVGA 2Q8KA 4I02A 4ABZA 2EK5A 4KIBA 1T8IA 4GYIA 4L5EA 2DA7A 1IXRC 3A01B 2DYRH 5DM7F 3HOTA 3O8HA 1WZ2A 2VBXA 1VF9A 1F36A 1GHCA 3ZN0A 2W82A 5J3LA 5GP9A 1FJLA 1UHWA 5AONA 3VYRB 3KYCB 4P55A 4RDUA 5B3SH 4AWXB 2HI3A 3GFMA 1JKOC 2G7HA 4NUBA 1RRJA 2DXIA 3FMSA 1QZYA 4I98B 4B43A 3ABTA 1T2KA 3G1OA 2XAQA 1ZG1A 5IY5H 2HWVA 3HBLA 1YIOA 1Y39A 2ZNYA 2P7VB 3QYBA 4B09A 3OYMA 4IL6C 4G7ZF 5HDGA 2A5YB 2L01A 1BI2A 2FBHA 4G7OF 2QCOA 1J0RA 1SMTA 2E5ZA 2WB1N 1A04A 1LDJA 3WTZA 3RYRA 3J81Z 1PYVA 4R8HA 2NXNB 2AHQA 2QZ8A 1R5ID 3VB2A 3OY9A 4JQFA 2H1KA 3GTKJ 1VQNI 1VI0A 3ABMH 3QU6A 4AIJA 3ABUA 2PN6A 2JPCA 1G8XA 2OPTA 5KVRA 1G3TA 5LEKA 1KU9A 2Y0SN 5DYMA 1AU7A 4PK4A 2GQQA 3BG5A 3S1RJ 2ZMEC 4AIHA 2LTPA 2Q1ZB 3W2AA 2F6CA 3Q0VA 2IA0A 2STWA 2ELKA 3AL0C 4GCVA 3AG1H 3L2RA 3CO6C 4ZYHA 3ECOA 1S7AA 3TEDA 4KIGA 4BU2A 4UNOA 3BTLA 2V9VA 1JHFA 2WV1A 3CQZJ 2QUFA 1QZZA 2EV0A 1FOYA 4J19A 3KYDB 1M1EB 2BE5F 3IAS2 1ZRFA 2CUJA 3K0LA 2QYOA 1KU2A 1TL8A 4XKWA 4HDVA 1ZG3A 2W48A 5D5UB 4CCKA 2LNBA 2HOEA 5DS9A 2CS3A 4HLYA 4YFNF 1YLFA 1ZN2A 3JRBA 2KKOA 2MABA 2KIQA 2DJIA 4BQAA 1H9TA 1P4XA 3K70C 5TRDA 2W25A 3A0BC 2BGCA 4BS9A 3FDYA 1V5FA 3L7WA 4GO1A 4KMUX 4XORA 4U0WA 1FOXA 2L4MA 1ZQ3P 1F9NA 1RNLA 1GDTA 1X3WB 1OKRA 2R93J 3ZQCA 1N78A 2DT7B 1I6XA 4CA0A 3OL3A 1SFKA 3DV8A 2FXAA 2WY7Q 3BT9A 3ZMDA 2D2WA 1WGXA 3CDLA 3WTSC 1AWCA 1U5TC 1SD5A 1LDDA 1W5SA 1BJZA 3HUGB 3VYTB 2A07F 3JCUC 5F27A 2F48A 3S1NJ 1RKWA 2D1HA 1BR1A 1R6RA 3P9KA 1ZRDA 2VI6A 2HDDA 2QKMB 3ULQB 4Q4ZF 4Y13A 4B44A 2L2OA 4I99C 3PNVA 3PL8A 4XKCA 1FOWA 3CJQB 2W4SA 5ICFA 4CYDA 3L2CA 2QQ9A 1Z6RA 4V2FA 4XRMA 4AVPA 1D0XA 2FUG2 3P7NA 2CFXA 5C44J 1HOMA 2K85A 2HXOA 3IHUA 3GTQJ 4BE0A 1IW7F 1LB2A 2E7WA 2CJJA 1OCZH 2DTZA 5K5OA 1CF7A 2JA5J 4JP0A 1USTA 2D1VA 4HBLA 3J7AO 4Y7NJ 4HQMA 1RESA 2JVHA 3QAHA 4W97A 3S1MJ 5BQTA 1YRNA 4JX5A 2A6HF 3R0JA 4M9SA 2Q2EA 2DK8A 1IDYA 2GIZA 2OF7A 4XLCA 1BOAA 2H94A 3DKYA 3EETA 3TP3A 5EG0B 4DQ2A 5DEQA 1XSVA 2WB1A 1ZGJA 3OL4A 4FTHA 2KISA 1RZ4A 4ANJA 2IPQX 2OTJI 2Y9YA 3IH4A 3F72A 4XSZF 1WJDA 3CLQA 1EH6A 4YELA 3BJ6A 3ZQGA 3N97A 5DUKA 2JUGA 3E6MA 2Y0SA 3NEUA 5GAEJ 3OYNA 5HODA 1VQOI 1I27A 1BW6A 2UZKA 4BY7J 1MH4A 3DXJF 4XLPF 2O8XA 4AYBN 2PJPA 3HOXJ 3E1SA 2QM3A 1UHSA 1FIPA 3IKTA 4DGWB 4LK0F 2EFNA 3LSHA 2CMPA 5DV5A 4KMFA 3FXJA 3BR3A 1QVTA 2HOAA 1KU3A 1YS6A 3K4LA 3IV5A 3E6BA 1XDSA 1MMSA 4BEHA 1YTYA 4CYCA 1WRJA 1KU7A 2K9SA 5GPCA 2MD0A 3LA2A 3D5SC 2L9RA 2LY2A 3G4SI 3F8NA 1FIAA 2VKEA 4JX6A 2P0WA 2X9DA 5IYDJ 4DNCA 2VBZA 3QP6A 4HA8A 1XX5A 2NOGA 5CVVA 3OOUA 4Y3OA 4PFPA 2DTRA 1FSEA 3KPHA 4KUMA 4QIWN 2VOOA 3SYTA 3BR5A 2B63J 1SAUA 3CCLI 4PFOA 5KHDA 3CD6I 1FYMA 3GW2A 4XKBA 2A69F 2F2EA 3FXQA 4HLXA 1J5YA 3HKZA 1QHHD 3QPTA 1R4MB 1JJ6C 2KZVA 3CP8A 2YU3A 2V6CA 3DBRB 3T0YA 2EFOA 4A0ZA 5H6QA 1QZEA 2V79A 2PI0A 1WJBA 2XSJC 2K86A 4G6DA 1LPQA 2DFEA 1MIJA 1IRXA 3OYDA 4M9ZA 4NQWB 3PUFA 1E3PA 2PMZA 4D5CA 1LVAA 2MGQA 1R7JA 4PGHA 1IF1A 2KRCA 4EVIA 5L3EA 4NDLA 1L0OC 4K2EA 3PQKA 4ZZLA 4L18B 2DMQA 4G6QA 2QENA 3HC7A 4P9FA 5E1WA 3EYYA 2E1CA 2MW8A 1ON1A 1UELB 2X85A 3HRUA 2ZJ2A 4CZZA 4EGZA 4LGWA 3U1KA 2A61A 1J2XA 2W24A 2P5VA 2Z2SB 2OCEA 3KEQA 1TWFJ 1QGPA 1IZ1A 2JPBA 1MMNA 1MNMC 2LKPA 5K1YA 2X1EA 3HOSA 1UB9A 4MHGA 2BXZA 3CMEI 5FROA 3ZQHA 2DK5A 5BOXA 2XRLA 3CTAA 2R7SA 5HNHA 1YIJI 1Z3YA 2E7XA 1DUXC 3BTCA 1MZBA 3FKIJ 2EIKH 4OMYA 1JKQC 1I6HJ 5DCFA 4UUSB 4WWCA 2Z5UA 1L3LA 1DGRM 2QKLB 4MTDA 1IAWA 3E5UA 4YFKF 2LD5A 3CMMA 2P6SA 4HNTA 2DMNA 1KYZA 2A05A 2L4AA 2DPDA 4A6DA 1HLVA 4RS8A 2A68F 2R5YA 2UXNA 3BTIA 2EV6A 2ZXHA 1WSUA 4I76A 4EM0B 4HG2A 1V4RA 3R61A 4RAGA 2XUBA 5FD6A 5L3GA 3J7AY 5CLSA 4AYBA 1ZARA 4CHUA 2GXAA 4YIIA 3HOYJ 5E3MA 2M4KA 2ZO4A 4H0EA 1RPWA 3CUQA 4FCYA 2F4OB 3WG7H 4AIDA 2JA2A 3M3YJ 3WGIA 1D0YA 1U2WA 1QPIA 5K7FA 1SFXA 2CSOA 4L5JA 4LIUA 3IL2A 4S0HB 2OZ6A 5M5XJ 1R9TJ 3PO2J 3NRVA 5K5RA 2Z9OA 2DAOA 4PGGA 2WAQN 1SAXA 2CQ7A 2H27A 1MBJA 2QEXI 3TO9A 3I56I 2AXLA 1BW5A 3D0SA 1T39A 2VXDA 3R4KA 1LFPA 1BIBA 2JRMA 2JQ7A 4NBQA 1PUFA 5ICGA 2E60A 4AVZA 2VL8A 3BOQA 4B1RA 4N0BA 1HA8A 2L0KA 4U7DA 2CFOA 3F6VA 3ZMTA 1K7AA 1TBXA 2EB7A 5HNFA 2HS5A 2RV8A 1JE8A 2QWWA 5K7HA 1IN6A 1OCCH 2JUCA 2VQLA 1UAAA 5FGMA 2NS0A 1MBKA 2ME0A 2JZYA 2R5ZA 4BACA 1PJRA 3ABLH 5DCMA 4Z2YA 1HW2A 4IHXA 4RLQA 3TBIA 4QWQA 5KCMA 4RBOA 1XSDA 3BP8A 1E2XA 3J81K 3VFZA 5EF6A 3OYLA 4XQFA 5JVTA 1T33A 1T0FC 3FXUA 5IOYA 4MQ9F 1Q1VA 2BBYA 4Y52J 2W1OA 4XKVA 2G0EA 3RQ4A 2Y2ZA 4UHTA 3ZMZA 4HZFA 3C7JA 1P92A 1I3QJ 1I39A 2VOPA 3SEQA 2E71A 2DMUA 2IGKA 3VOEA 3T1BA 1BR2A 4F92B 1MNEA 4ESBA 4YIFA 2VBWA 3K4KA 1BR4A 2QGUA 5EGOA 1H88C 2F5FA 4OU0A 5HDNA 1UMQA 2Y69H 4LJZF 2XGXA 3PNTA 1MW7A 5FKLA 2ZC2A 2O8KA 4KJZA 1MNDA 2HXIA 3FISA 4B8XA 2VT2A 2JA7J 3MD2A 3PUBA 3DKXA 3LA3A 1R00A 2PQ8A 2VE8A 3BR1A 2XPUA 5FRMA 1YW8A 3MKLA 2NVXJ 2XAJA 3SZPA 3MMYB 4HSTA 3VSLA 2HVSA 1T98A 3GZNB 2KDZA 2HVRA 1PP8F 1S6LA 3GEZA 2AXTC 5E3NA 2VKDA 3TOAA 5DM6F 1IRZA 3JSOA 3EPZA 2VJJA 2FMYA 3GFLA 1KYWA 3BC8A 2V26A 3DU6A 1W36C 4ENJA 3WE2A 1EKEA 4ZC3A 2FNAA 1E0EA 3W2VA 2M2EA 1ON2A 1DPRA 4LIVA 4D1QA 1YW9A 1OYIA 2DOAA 4HQEA 1VQ6I 2YX4A 4KICA 5JLXA 1Y8QB 3AFHA 4IHYA 1ZHFA 2RVCA 5J8CA 4KN4X 2P7CB 1K6YA 4XOPA 4OIRF 2MLKA 1WI9A 3L2QA 1A6QA 3KZYA 5IOZA 1OPCA 5EEAA 2LRDA 4LB6B 2W84A 5FFXA 2WAQA 3BPVA 4PJLA 2E35A 3DTKA 1YJ9I 4M6YA 3AKZA 5HOOA 4IHSA 2HGCA 1S3JA 2HQAA 2DFHA 3HPHA 2ECBA 2ACJA 1TT5B 2LG4A 3DU5A 2HTJA 5LHGA 3DPLC 4PUSA 4B3XA 2BW3A 3OYIA 2R7XA 1AOYA 2AO9A 2MA3A 4OIQF 3CCVI 1ZYRF 2XHKA 2M34A 3A4CA 4RLFA 4IHWA 3CC2I 3ZGKA 3W3CA 1FEXA 2IGOA 2ZXWH 2LC2A 2HYFA 3FHZA 2OZUA 3KZZA 2DFIA 4E7ZA 1LVKA 2ZJQF 2D45A 1H0MA 4IRGA 3Q3SA 3OSFA 1QPMA 3DTIA 1YOVB 3L2WA 3VWBA 2ZNZA 2HR3A 4LG0A 4DYQA 3CZ6A 1R4NB 3HSEA 2B9SA 2E1MC 1UJ8A 2COMA 1OR7C 3HGYA 4OMZA 4BDYA 3IWZA 2R7OA 3VEPA 5ILUA 4BYYA 2CU7A 2VKHA 1QVUA 1WVRA 2DLLA 2OA4A 3ONQA 1JUPA 4X0GA 4L9NA 5FD5A 4BJTA 4TV7A 1BL0A 3F3XA 1T6SA 2RNJA 3CCSI 2LY9A 2OV7A 3ZQ7A 1R1UA 5M3MJ 4II3A 2X51A 4D0PA 3KYLA 5FB2A 2HKOA 3E6CC 2BVMA 2ZJPF 3K2AA 3HHHA 2B0LA 2JA8J 3W6KB 4M3FA 2OUMA 4OIPF 3HTUA 3A1YA 3I54A 3I64A 1IN4A 4KIFA 3SJMA 3M8FA 4DJAA 3LOCA 2ZFUA 2KDOA 3GTLJ 4HX4A 1AKHB 1B4AA 3SFIA 2V4JC 4ZYAA 1LQ1A 2DA3A 1WJ5A 4UV8A 4EEFG 3F8FA 2K27A 4F55A 2XAGA 4PJ0C 3TW7A 2GAUA 1K78A 3GCMA 3GWZA 2BHZA 3F8MA 5HLIA 3E5QA 3PSFA 4OAYA 4L9JA 3ZQFA 3I59A 1FMWA 4IXAA 5LGUA 5K7ZA 2EJRA 3RTRA 2MH9A 2BY2A 1B59A 2MC3A 5F64A 5H6RA 4E4HA 1BM9A 5KAFC 1XGOA 3GUDA 2CO5A 4IEJA 2W7NA 2IJLA 2F4MB 1U8RA 1OJLA 2LY1A 2LKSA 4G94A 4DYCA 3S2DJ 5A2QK 1GLNA 3K1NA 1UFMA 1WQ2A 3C3WA 1A36A 1HSTA 2CQNA 3REOA 2L7KA 1DDNA 5LRRA 3PIPF 4WXDA 1FZPB 2X4HA 2IS1A 1FNNA 1USSA 5CJ9A 3LAPA 4BHBA 1X4OA 4UVAA 2XSDC 4MEXF 3PQJA 3TGNA 2A6EF 1LDKB 3OYCA 2KL4A 3OYFA 2PFBA 4A93J 2MC4A 5HLGA 2M3AA 3BG6A 5E3OA 4UV9A 3EUAA 3S93A 4U87A 2PJRA 1O4XA 1FX7A 3BG3A 2E1NA 3GYHX 2HOTA 1LE8A 3QU3A 1HF0A 2BOLA 2J5OA 4QSHA 1JTYA 4L9VA 2OTLI 3CJRB 3KLNA 3Q0UA 1WJFA 4UUTA 5AIPA 2FOKA 1A31A 3LSIA 4ZDOA 2DN0A 5BS6A 1B72B 2JA6J 1CQTA 3CDIA 3E97A 4NC7A 2CW8A 1XCBA 4XLFA 4XICA 1LFUP 4IZZA 1R1TA 3HIFA 1H8AC 3K4BA 2ESNA 4KNYA 1XGMA 1YYVA 1QQIA 2MSYA 1MSEC 2FJ1A 2K9QA 1RC9A 2Q0OA 1QNTA 1JHHA 2G9WA 4ETSA 3E0JB 4XONA 3LSKA 4EATA 3LQRA 1P9QC 1PP7U 1HCRA 1ZR4A 1YE9A 1IDZA 2CV0A 3GTJJ 1GXQA 2DDBA 5FLMJ 1IC8A 1IXCA 1P6RA 2IGMA 1WJAA 1MD0A 3OIQA 5GTIC 2Z16A 4HX7A 1OCPA 3G3ZA 4HEA2 2VT3A 3L9FA 1YX3A 4JYKA 4WX9A 2CQKA 2WAFA 4A2UA 3OYKA 4II2A 2AQEA 1QA6A 2VKVA 1OYYA 2KIFA 2AQFA 1ITYA 5E79C 2X48A 1G4DA 5EJCA 1SANA 1D5VA 2FF4A 4CGZA 3DEEA 2RNGA 1B8IB 2DA5A 4L5IA 4EJVA 1I5ZA 2K5CA 4BAYA 1R36A 3PFIA 2EH3A 3CC4I 4MGRA 1EA3A 4BQNA 2BY1A 4A3BJ 5J6XA 4HNUA 1BC8C 4DOZA 4E7SA 2M9HA 2IS4A 2M8GX 2ZMEB 1T38A 2DQRA 1QBJA 4LLNA 1BI1A 4EJTA 2EZIA 1TQIA 1J7KA 3DEWA 3AL0B 4F7ZA 3ZQLA 1ERDA 4LLGF 3AG3H 3H5NA 3FIWA 4BH9A 1YG2A 2F5DA 1J75A 3K4CA 3Q9VA 2P5KA 4B48A 1TQMA 4LB5A 4D7MA 1U8BA 3FWEA 4JOMA 5J8FA 4A3CJ 2LH9A 3H9GA 5GTHC 5C4JJ 3AG2H 1GV5A 1WWXA 2KHMA 1R49A 3R60A 3V8LA 1XGSA 1Z77A 3WG9A 2RQQA 4NC8A 4D7NA 4PCQA 1VNDA 3HL2A 2X6YA 3H35A 5BNGA 1YI2I 2TRTA 2Y31A 3GTGJ 2NNNA 2QQBA 3J80K 1XC5A 3ZR8X 3JTGA 1VQPI 2DT5A 2KJBA 2DMPA 1DGWY 4RGUA 3AG4H 1QO0D 2DA4A 3OR2C 2BY3A 2HYJA 2QBYA 1VFCA 2L7MP 3SDBA 5LGTA 5HLHA 5IPAA 2DO7A 3WU0A 1DP7P 4F91B 1WH5A 5KK1A 5JI6A 2E1OA 5J4YA 4CCLA 5L3BA 1VQMI 1U5TB 4O6JA 3CCMI 1X2MA 2HVQA 3JRGA 2M7BA 3TMOA 4MFEA 1RIOH 3QOPA 5IT9K 4BQQA 5L3CA 2HPMA 3C18A 2JK3A 2UUZA 2QQAA 2VJ5A 4Z6YA 1V55H 2O7OA 1RUOA 3S1QJ 1LKXA 4M3BA 2KPMA 3QYEA 1HBXG 2IGNA 3CDHA 3WHCA 3SXYA 3G71I 3JRFA 3S3MA 1S8NA 2HNHA 5H20A 1DU0A 1BA5A 1TW3A 2LSOA 1GVJA 2XPVA 4W1UA 1FPQA 2EIJH 4OWRB 3V4GA 2EIMH 1Y56A 1HW5A 3I71A 5FKOA 4RMNA 1TNSA 5IP7J 4C2TA 4EMSA 2H1LA 3FBIB 3L2VA 1SC7A 1SFOJ 4HX8A 3RPUA 3JRCA 1W0TA 2CUZA 3S3OA 2KZGA 2O61A 2WWYA 3GFIA 2W57A 2LR8A 1B6AA 3ASOH 3E3VA 3EQLF 3LL7A 4AC0A 4FHTA 1Y8RB 3KETA 1NK3P 3BJAA 1S9HA 2HPIA 1WPKA 1G6NA 3WTTC 3M07A 5E1XA 2HZDA 1I1SA 1JTXA 1U9NA 3QWLA 4PSXA 3HJEA 2TCTA 2ADUA 2M8EA 4I0AA 4RGRA 2XF5A 3OR1C 2XC7A 2L9NA 2CUFA 2ZB9A 5A2QZ 1N77A 2ZXIA 1XMKA 1Z6TA 4M74A 1X1DA 1HKTA 5ICEA 2I5UA 3GLLA 3ZOBA 4RAZA 2L3DA 3BLYA 3QRFF 1YITI 4ZDLA 1YQAA 2LBFB 3H0GJ 1E17A 3V8JA 5IP6A 1VQKI 4A69C 3JR9A 3O8GA 3IH3A 2NVUB 4ZDPA 5HS8A 3HDDA 3CMAI 3CCJI 4IRHA 4PDKA 4XL9A 4WK8F 3OYAA 3RPUD 2LF7A 5F08A 4Y15A 4ITVA 4NNJA 3V42A 2R7WA 2ELJA 1P7JA 4GRIA 3M8JA 5EEHA 4P9UA 1Z7UA 1S72I 4MEYF 1F4KA 1TTYA 4HYEA 1C0WA 3ESWB 1BJAA 1V3FA 1HXDA 2VQCA 5FRNA 2B7EA 2LYCA 2GBYA 1UZCA 2MH2A 1K4SA 1WJEA 3U2RA 4HPQA 1D1BA 2O9LA 4Q5SF 3OOPA 4R1HA 3KCCA 2FBIA 1ETQA 3BG7A 4Y33A 3G1LA 2M0MA 2RC4A 1RI7A 1TC3C 2DPUA 4HF2A 3RCOA 1OMIA 1WJCA 3CMYA 4EM2A 2LMDA 1MJBA 4E70A 1REPC 1SEUA 1K61A 2V9KA 2K9LA 2HTSA 1MDMA 2JWTA 1OCTC 3S15J 4EM1A 1NK2P 2R3SA 5L3DA 2NAZA 3SEZA 1OYWA 4AIKA 4IOCF 2K3PA 3OYGA 2N8GA 4QLCU 3HZJA 5GADJ 2BEOA 2R7TA 2DODA 1J09A 2A3SA 3V7SA 1KA8A 1IV6A 1TWAJ 4J00A 3W6JB 1RR8C 4M6VA 2E19A 4X6AJ 2X0LA 2VN2A 5ILVA 5HLTA 3TDZC 5FLXZ 3EDPA 1GUUA 1LNWA 3ERMA 4KN7X 4BJ5C 1EH8A 3A01A 3D5LA 2XB0X 3KZIC 2XASA 4I6ZA 4S05A 2M45A 3CP2A 3SZTA 2OJED 4ZYDA 2ID6A 1JUSA 3QYFA 4XOTA 3KEOA 1X58A 4ZZDA 3HB9A 1XMAA 1U6GA 2LLKA 3DBLB 4KFCA 3RYPA 2ID3A 1O3SA 1OFCX 1YJWI 1OCOH 2NNYA 2HOSA 1O3TA 1JJ8C 4UB6C 1SFUA 3FXLA 4FQGA 2FRHA 3NARA 1X1PA 3WE3A 1OCRH 1MGTA 3F6OA 3GZ6A 2R0QC 2X6XA 3T8RA 4WF2A 3DF8A 2LFBA 1NH3A 2F5EA 3E7LA 2YX7A 4ZH4F 1ZH5A 2ZBKA 3WTWC 4XBFA 1F5TA 3ML6A 3H1CA 2XF7A 3FXKA 3OSGA 1I3AA 3ZN1A 2R92J 2JN6A 2HQNA 1RR7A 2VQHA 3O6BB 3D1NI 2YUSA 2JSCA 4Y4RA 1A35A 3S17J 2Y9ZA 3J80Z 1E3HA 2PMHA 1V5EA 1BIAA 2EILH 3ZPLA 3IAM2 5F0CA 4E7KA 2IP2A 1UG0A 1MJ9A 3S32A 3I55I 1XGNA 2VPRA 2FBKA 4A5NA 1Z0XA 5J40A 1R71A 2CW7A 3L00A 3ZMSA 3C1DA 3MFKA 3DCFA 4CICA 1HSJA 2KRHA 2FNPA 4BBRJ 2EZKA 5TISC 2DMTA 4F52A 1CF7B 3G73A 1X1BA 1QHGA 1QU3A 3TDUC 2VLAA 1YRNB 2Z3YA 5IT9Z 3BZ6A 3WU2C 4U7BA 2Q2EB 3K6GA 3NWTA 4PJJA 2JRTA 3CESA 4RGXA 4XK4A 3KFWX 5LLQA 1P4AA 2ZFWA 4I0BA 2E5NA 2HKXA 2RDPA 1IG7A 2P8TA 3U21A 4CCMA 2V7FA 2NVYJ 3QPLA 3SQNA 1B8IA 3MKWB 4FE4A 4AU7A 3JAMZ 3BTJA 2JMWA 1XMXA 5FFZA 3RQIA 3MKZA 2CH0A 3K4JA 6PAXA 3HG9A 2L54A 4UXNA 1TZLA 1R5HA 4BJ6C 5E8GA 1W7PB 2RKHA 4N4NB 4HF1A 4KA4A 4KYWA 4OINF 2L9SA 1WCMJ 1RKTA 3HUGA 3SFZA 1BN5A 4HOBA 1I50J 1BOBA 5LBQA 2OC6A 1IRGA 3FBNB 5ED4A 2E2IJ 1R5GA 5B1AH 3QODA 2HEOA 3KP7A 2A6TA 4IF4A 3MKYB 4AUXA 4D5FA 2DT6A 4BEHB 1SFEA 4P5OA 3LNQA 4BXXJ 1KONA 2XAFA 2GLOA 1PVEA 3ZMUA 3BR6A 3PIOF 4LD5A 3ZCOA 5EDNA 4BE1A 4G12A 4ZTJA 1VQ4I 5E18F 4PJMA 1ULYA 3LWFA 3HRSA 4BBSJ 1ZGWA 1XN7A 1FYKA 1Z3XA 4KISA 1D1AA 2V1DA 4Y17A 3FX3A 2YS9A 3L2UA 2OU2A 3V8KA 1O3QA 1E3OC 1Z21A 5D8LB 2KLOA 1SVLA 3FHNA 3I4NJ 1FC3A 1VQ9I 4IRIA 3OYHA 1YX5A 5D6FA 3OWTA 4JX4A 5EG0A 3I3LA 2VBYA 1SMYF 3LSPA 1W5TA 1B9MA 2FX0A 2NYXA 3QPSA 2JJ7A 4JBAA 5DD4A 2PG4A 2Z1DA 4M72A 4M3GA 2DJNA 3UNGC 5JHFA 1HQCA 5BMZA 5FJ8J 5E17F 4B4CA 1FTTA 1O7FA 1Z7LA 2F5VA 1U5TA 3BQZA 3F21A 1W0UA 4CCOA 1ZK8A 1O3RA 2GOXB 4KT6A 1D8JA 4MIMA 1ODDA 1FP2A 4BXFA 2BZTA 2P5LC 3J7YJ 3CUQC 4YIRX 3CC7I 3F23A 4XNFA 1GT0C 4J01A 2DFFA 2LVSA 4M9XA 4RAYA 5HDKA 1W1WE 3RDIA 3L1PA 1Z9CA 2DA6A 4G7HF 4CXFA 3FF5A 3R0AA 1TWGJ 3CF2A 5HVQC 4E6KG 4UY8I 2H6CA 2PX9A 2XVCA 3TO7A 5LD2C 3BJOA 2GOMA 3WTVC 4D9JA 3LSTA 4ASNA 5F0HA 3OS0A 4C3HJ 1WFXA 2OQGA 3MZYA 3Q0WA 1FLIA 1X1CA 1MMDA 5D4RA 1ZRCA 3HOVJ 3IUOA 2TDXA 2X1DA 4A3FJ 1WHUA 3KP4A 4PJNA 4IVNA 2K3FA 4GGGA 3HHGA 1G59A 3RPQA 2WY8Q 1DP3A 1MMAA 1UHMA 3H5AA 1Y1WJ 5HS7A 3ERED 3DFGA 1KQ9A 3BR0A 2KIMA 1KQ0A 2DOEA 5J1UA 3HOUJ 3G2BA 2R5YB 3KP2A 1Y1VJ 2UV1A 4ESFA 2R7ZJ 2IW5A 2VJIA 2M1BA 5E3LA 2R7VA 3VYUB 4A6EA 3R6SA 4DW6A 3N4MA 1ZR2A 3ZP5A 2L5QA 1PUEE 1ZAOA 2E1MB 2WAEA 4NQWA 2CYYA 4EV0A 5H2FC 3HM5A 2XGDA 2NOJB 3CUQB 3P9CA 5BPDA 5IT3A 4E7LA 5E1ZB 2ICWG 2CWEA 2LBFA 3HXLA 3TO6A 5F6FA 1JI8A 2JT1A 4IPAA 3RI4A 3BZCA 1X3UA 2XPWA 2PMUA 1U9OA 2KT0A 2VC1A 2FMLA 3VPRA 3ZQIA 4IKFA 3KP3A 4MFDA 3S16J 3S8PA 3CCYA 2I8DA 2GIVA 2BXYA 3RKQA 3BPXA 1ZREA 5L3FA 1XDUA 2G7UA 4BUPA 4ON0A 1PUFB 1ETWA 1ZELA 3HOZJ 1MH3A 3FZVA 5D5XB 5M3FJ 2VPLA 1YHQI 2HU9A 1YS7A 1XS9A 4MQVA 2EPFA 1P2FA 1HC8A 2BV6A 3I58A 1IV8A 2EZHA 2CV1A 2GXBA 1JXSA 1STZA 2XROA 4R79A 2MBFA 1RUNA 3OIPA 4UUSA 2M30A 3GVAA 2Y0MA 4XR6A 1FP1D 2M4GA 1ENHA 2O5RA 3BCBA 3N05A 4CCJA 2IT0A 2YU9J 3LA7A 3COAC 3KP5A 1N75A 1JGGA 1DU6A 3AAFA 1TP4A 2H6BA 2R5ZB 1HDDC 5DCMB 4LITA 4CUGA 3FXOA 5TJJA 1TT0A 5ICCA 5DTDA 2EFWA 4EJWA 5DDGA 2ZSIB 3IKVA 3DEUA 4V2GA 1HKSA 1ONVA 4A3DJ 2EA4A 4XM3A 2WV0A 4IQJA 2DDAA 4I2OA 4HV6A 4OAZA 5KNLA 4A12A 4QTRA 1JUMA 3HSRA 4HW0A 3UKGA 5K5QA 2KRFA 2DA1A 3U1DA 3F0CA 4DBQA 2ZXJA 2YR2A 1IN7A 2FQ4A 2ME6A 3IWFA 1X2NA 3LQQA 1WKMA 4GDFA 1BI0A 5CVUA 3DTEA 1HKQA 4XRSA 3FXMA 1MMGA 2V1NA 4LMYA 4A3LJ 2AS5F 4L9TA 2DU9A 1UG2A 3O3KA 1R22A 5EGOB 3K9TA 2GA1A 2DYSH 2KIUA 3F9KA 1G2HA 4WXHA 2L9VA 1ZGAA 1VQ5I 3T8TA 4HRIA 2IS6A 5FLXK 5FKMA 5M5WJ 1YO5C 2VASA 3LMMA 4YFXF 4C9YA 4IHTA 1UCRA 3WGGA 2LREA 1IXSB 3QOEA 1JT6A 4X1EA 4HNVA 2CG4A 5CVRA 4CSWA 2NRAC 4ENKA 1K6OA 3H3ZA 2ISYA 3RJPA 1N25A 3DKWA 3RKYA 2ISZA 4C3IJ 2ETHA 1FT9A 3K1MA 1U3EM 2R7UA 1BBYA 2LP0A 3BY6A 4BHPA 2X6WA 5HS9A 3FK6A 4N4OB 3FMQA 3L09A 3U9GA 3HKZN 4DYRA 4AM3A 3ZMVA 4QPOA 2FQ3A 3M9AA 2L7FP 4FX4A 3KE2A 3B02A 3K69A 3GLXA 2XDVA 4C2MJ 1DPUA 3VODA 2O03A 3F8BA 3CUOA 2EWNA 2FOWA 2ZSHB 5B5EC 3X2QH 3A0HC 3ISPA 2CQXA 4LG3A 2FD5A 1R23A 1V5GA 2PMZN 3HSFA 4BXUA 1TW2A 3EUHA 4HF0A 1Q1HA 4XLAA 5F1JA 4MO7A 3P9IA 5KAIC 4A3KJ 3LAJA 3GTOJ 3C2GA 3H9QA 3BG9A 4EJUA 4LK1F 5IYBJ 2LDUA 4CZCA 2EQRA 1OISA 4HAMA 1FBUA 2JTVA 2XAUA 3CCRI 1KQ8A 2EZLA 3LFUA 2EV5A 4AD9A 1MBGA 4BKXA 3BCAA 3HGGA 2M87A 5EEGA 4FE7A 5D6EA 2NVQJ 3M7GA 3CO7C 5C4XJ 2Z33A 5LEJA 3BZKA 4F3QA 3GXOA 2Y30A 2BW3B 4XRFA 1FBQA 4MTEA 2XKOA 1AA7A 3HPGA 2DQLA 4RM3A 3GF2A 4XSXF 4B47A 1FMVA 1F43A 4PSWA 4CH7A 1O7LA 1FWZA 5JHUA 2QSHX 4YRVA 3D5RC 4A0XA 3WODF 2LOOA 2IVMA 4M3EA 3RIRA 1ORKA 3TOBA 4E7HA 2K40A 1W4MA 2FSWA 3A02A 1U0JA 4XLEA 5TGTA 2OD5A 3O2PE 3H9JA 5DD8A 4M73A 5D5VB 3G1MA 4LG0B 3TKYA 5D8KB 2IXSA 1MJAA 3ZXSA 1W7PA 4RB1A 2OBPA 3JAMK 2E34A 1V54H 2CUEA 1J9IA 1T0FA 3S14J 4RGSA 2V9PA 2BHYA 1KZHA 3JSPA 1VQ7I 4O5VA 1O57A 2E2HJ 2JSPA 4LLLA 3OIOA 3PFYA 3JRDA 2XGEA 5IYCJ 1W5CC 1Y6IA 3MCZA 3KX2A 3CLOA 4DZJA 3H5RA 1RETA 3K4NA 1NHAA 2QF7A 2RQPA 1TWCJ 2RN7A 1G3WA 3BQYA 4I7HA 3DPTA 4M3DA 2EINH 1FOKA 1EF4A 2OQRA 4KT5C 3QPHA 5FO5A 3B73A 5B1BH 1K83J 2LF8A 1FYLA 1R58A 2F5CA 3GZ5A 4C2UA 2J5PA 2VIXA 2O0YA 2D5VA 3JRHA 1D0ZA 3W2WA 3I5UA 4IJAA 1K4TA 1U78A 1T08B 4QPQA 3FXRA 3IRRA 3K10A 3WHBA 2ZCWA 3BWGA 2K4JA 5FKKA 2GZWA 2YSRA 5ILSA 5BPIA 3M1EA 4EQQA 1KGSA 2XF6A 4I01A 4XIDA 4UUVA 1D5YA 3PNYA 4M6XA 1T95A 3CJTB 4G8XA 1K79A 4G6TB 5J1YA 5EZGA 1K78B 2XGCA 1R1VA 3ZQQA 1GXPA 3G6EI 3PJRA 1W7PD 2IAIA 2QVOA 3I59B 4JK1X 4E7JA 4A3MJ 1YFHA 1ZG5A 3J7ZI 2NS7A 5JR3A 2IEKA 2Y75A 2PLYA 4ZJZA 3K7AJ 5B66C 2FU4A 4HSRA 1XD7A 4GFBA 2EFQA 1J59A 3TP0A 2W00A 3S2HJ 3SZGA 1IRFA 2VC0A 3VDXA 3GBGA 4IOAF 3RSNA 2FA5A 2BYVE 2VQGA 5CQEA 3CCUI 5EYRA 3SHFA 4WCGA 1JGSA 3P5JA 4ESJA 4O3MA 2PBIA 5GAHJ 1ACIA 5C3EJ 4NC6A 4NB5A 1XCVA 3VSKA 1YW7A 4BY1J 1S7EA 4XN0A 4RB3C 2GM4A 4XN3A 2WBMA 4CO8A 4WXCA 2PJRB 3S3NA 1ETKA 1OQYA 2P6TA 4HV5A 2XIGA 1LE8B 1B1BA 1X3ZB 3RKWA 2R7DA 3WTYC 2GA2A 3OMYA 1IGNA 3UR3C 3DLLF 3DBHB 1AKHA 1D3YA 1XSXA 1EJ9A 3K2ZA 3RKXA 2NVTJ 2HZTA 4CDGA 4GXOA 1S7OA 3ROUA 2OAZA 1ZLKA 2VONA 1S29A 1D1CA 1NG6A 1T56A 1Y0UA 2CRGA 1TQPA 2MLGA 3GO5A 4A0YA 4DIQA 4BE2A 4V19K 3K4MA 1VTNC 1W36D 3PM1A 1I1GA 4A3JJ 2XKPA 2ECCA 5CVIA 2ESHA 2DI3A 2RAEA 1Z91A 3TQNA 4FASD 2FEZA 1LEAA 1LFBA 2M5WA 3GFJA 5IP9J 3ABKH 2VJ4A 3EUHC 3B6CA 4P96A 1OR7A 3W6VA 3TW6A 1S5LC 4RAFA 4LFUA 2RGVA 3WGHA 2FE3A 2WC2A 2K4BA 2C6YA 3K1PA 4B3AA 2GWRA 3H0DA 2P4WA 4ZYGA 1XPXA 4RM2A 2CGPA 2IA2A 3SDGA 2K9MA 3F8CA 2HDWA 2QSFX 3CJNA 4N9IA 3WU1B 4OOIA 2STTA 3H3VK 2MYSA 1POGA 1FBSA 3HRMA 2KMUA 1IN8A 4BL0B 1HW1A 2H8WA 4U0VA 4DBRA 2E2JJ 2Z99A 5JLWA 3FMRA 2H09A 2HFHA 1LUJB 2ELHA 3A2KA 1FSHA 1MBEA 4YG2F 1Z67A 1MBHA 1GV2A 4BQOA 5FKNA 3OV8A 3IRQA 1YJNI 1APLC 1SD7A 3E5XA 4L0YB 2L02A 5LGNA 3C2BA 4XRSG 3B6AA 5F1RA 3CF5F 1ZKGA 4XLNF 5AIQA 4UVBA 2CQQA 5EZHA 3IH2A 1B72A 1FY7A 5LRSA 4FISA 2V6EA 2BVLA 3EUKL 2V1XA 3M8EA 2KP6A 2XV4S 1Y0NA 2LK2A 1TWHJ 2EFPA 1PDNC 1DQUA 4UVCA 3VYSB 2K9NA 2GXGA 2HQRA 3I0TA 1FTZA 4U88A 1JT0A 1CGPA 2HDCA 4F93B 2XB5A 2XRNA 4BGDA 4A3GJ 3JRAA 4E7IA 2ZJRF 1F1ZA 3DP7A 1VZ0A 3T5XA 3Q9SA 1VQLI 4Q47A 1TLHB 1NTCA 4C30A 3LSRA 2HQ5A 3GTPJ 4A5MA 3GTMJ 3NQOA 3PO3J 4BHCA 3HEFA 3LSGA 5GPAA 2ZKZA 2Y48A 2CW0F 5JVGF 2WA0A 2QSGX 1VQ8I 2R7QA 2I10A 4KDPA 2QBYB 3WTXC 1SVMA 4IO9F 2BY0A 4IQ4A 2IBDA 3KLOA 3V7RA 4I09A 1H9GA 3HYIA 1XB4A 4MNUA 3I9V2 4YEJA 2PEXA 4OIOF 4A3EJ 1OLTA 2EA2A 3I4PA 1D8KA 4UB8C 2K02A 4CCNA 3NWSA 2QA4I 2WADA 1ETVA 2K7LA 3H3UA 4IHVA 5F04A 2ZMEA 3A03A 4M71A 5LHIA 3H36A 2F4IA 3WTUC 2O6GE 5LFAA 3HOWJ 5LHHA 4BDZA 3BR2A 3DPUA 1BC7C 4RA2A 1XG1A 1IUFA 1ETYA 2VE9A 5J4VA 3BDDA 1WI3A 1GVDA 5GAGJ 9ANTA 4A3IJ 1ETOA 5D4SA 2UXXA 2COBA 4ZYEA 3OS2A 3CCEI 1MBFA 2IA1A 4CYCB 4Q48A 4EGYA 2DCEA 2E36A 3ELKA 2M0CA 1EH7A 1LEBA 1G3YA 3KP6A 4P1WA 4BNCA 3H92A 2VODA 3QP5A 3MZHA 2P81A 4GYGA 3DQVC 1IUYA 1SD6A 4NHJA 1X4PA 1Z05A 2X1CA 2YPRA 3DWLE 5JFRA 2CV2A 3ECHA 3OYEA 4C3JJ 2OCCH 3ZRGA 4ENNA 3LSJA 2LKXA 4FX0A 4N9HA 3MQ0A 1NG7A 4FT8A 3KEYA 3GMEA 1IN5A 1TNTA 2MD5A 3MWMA 4H4KC 5DUIA 4IX7A 1MSFC 4MLOA 2VUMJ 1BI3A 3FKJA 3MZ8A 3Q5FA 3HRTA 4EJOA 2UWMA 2WTEA 2DBBA 2RREA 2MFZA 1A6IA 5J47A 4U0YA 2V1UA 1ETXA 1H89C 3BROA 3CCQI 1IO2A 5CVJA 3S2WA 2H8RA 2X6OA 3PSIA 2O3FA 2VXZA 3V7CA 3C2HA 3LFKA 5CQGA 1X19A 3QQAA 2IS2A 2L7ZA 2KQRA 1G3SA 3JREA 3KIOA 3EYIA 2VB6A 3E6DA 3OYBA 3HTSB 1ZLJA 2MG4A 1EV7A 2QLZA 4S04A 2R4GA 4RB0A 3F22A 3I53A 1SD4A 2EBIA 4HDUA 3FK7A 3FM5A 5E20A 4FETA 3MVPA 4XMYA 2M7AA 3IC7A 3JW4A 1P7IA 1P4WA 1X1AA 3LSMA 4LOCA 3K70D 1WH7A 1JKRC 5E8IA 3M1CA 4G9YA 2IRFG 2R7FA 1QRYA 2HYGD
chains in the Genus database with same CATH topology
3GX4X 1Z1DA 3MEXA 2XAHA 3MAJA 4PZJA 2KJCA 1MDMB 5CYVA 1LJ9A 2W85A 4RB2C 3FM3A 1B9NA 3JTHA 2DW4A 4L0ZB 1MKMA 5D5WB 4ENMA 5ERIA 2Q8KA 4I02A 2EK5A 4KIBA 4GYIA 1IXRC 3HOTA 2VBXA 1GHCA 3ZN0A 1UHWA 5AONA 4P55A 4AWXB 3GFMA 2G7HA 3FMSA 1QZYA 4I98B 3ABTA 1T2KA 2XAQA 1ZG1A 2HWVA 1YIOA 2ZNYA 2P7VB 4B09A 4G7ZF 5HDGA 2A5YB 2L01A 1BI2A 2FBHA 4G7OF 1J0RA 1SMTA 1A04A 1LDJA 3WTZA 3RYRA 3J81Z 4R8HA 2QZ8A 3VB2A 4JQFA 3QU6A 4AIJA 3ABUA 2PN6A 2JPCA 5KVRA 1G3TA 5LEKA 1KU9A 5DYMA 2GQQA 4AIHA 2STWA 2IA0A 4GCVA 3CO6C 4ZYHA 3ECOA 1S7AA 4KIGA 4UNOA 2V9VA 1JHFA 2QUFA 1QZZA 2EV0A 2BE5F 1ZRFA 3K0LA 2QYOA 1KU2A 4HDVA 1ZG3A 5D5UB 2LNBA 2HOEA 4HLYA 4YFNF 1YLFA 1ZN2A 2KKOA 4BQAA 1H9TA 1P4XA 5TRDA 2W25A 2BGCA 3L7WA 4GO1A 4KMUX 4U0WA 2L4MA 1F9NA 1RNLA 1OKRA 1I6XA 3DV8A 2FXAA 3ZMDA 2D2WA 1AWCA 3WTSC 1U5TC 1LDDA 1SD5A 1W5SA 2A07F 2D1HA 3P9KA 1ZRDA 3ULQB 4Q4ZF 4Y13A 3L2CA 5ICFA 4CYDA 2QQ9A 1Z6RA 4AVPA 3P7NA 2CFXA 3IHUA 1LB2A 1IW7F 2E7WA 5K5OA 1CF7A 1USTA 2D1VA 4HBLA 3J7AO 4HQMA 3QAHA 5BQTA 2A6HF 3R0JA 4M9SA 2Q2EA 2DK8A 1BOAA 2H94A 3EETA 4DQ2A 5DEQA 1XSVA 1ZGJA 1RZ4A 2IPQX 3F72A 4XSZF 1EH6A 3BJ6A 3N97A 5DUKA 3E6MA 3NEUA 1I27A 2UZKA 3DXJF 4XLPF 2O8XA 2PJPA 2QM3A 3IKTA 4LK0F 2EFNA 5DV5A 4KMFA 1KU3A 1YS6A 3E6BA 1XDSA 1YTYA 1WRJA 1KU7A 3LA2A 3F8NA 4DNCA 2VBZA 3QP6A 4HA8A 5CVVA 2DTRA 1FSEA 4KUMA 2VOOA 1FYMA 3GW2A 2A69F 2F2EA 3FXQA 4HLXA 1J5YA 3QPTA 2YU3A 2V6CA 3T0YA 2EFOA 4A0ZA 5H6QA 2V79A 2PI0A 2K86A 4G6DA 4M9ZA 1LVAA 1R7JA 4PGHA 1IF1A 4EVIA 5L3EA 1L0OC 4K2EA 3PQKA 4ZZLA 4L18B 4G6QA 2QENA 4P9FA 5E1WA 3EYYA 2E1CA 4CZZA 1ON1A 3HRUA 2ZJ2A 4EGZA 4LGWA 2A61A 1J2XA 2W24A 2P5VA 3KEQA 1QGPA 1IZ1A 2JPBA 2LKPA 5K1YA 3HOSA 1UB9A 4MHGA 2DK5A 5BOXA 3CTAA 2E7XA 1DUXC 1MZBA 4OMYA 5DCFA 4WWCA 2Z5UA 1L3LA 4MTDA 1IAWA 3E5UA 4YFKF 2P6SA 1KYZA 2L4AA 2DPDA 4A6DA 4RS8A 2A68F 2UXNA 2EV6A 1WSUA 4EM0B 1V4RA 3R61A 2XUBA 5FD6A 5L3GA 5CLSA 1ZARA 4CHUA 4YIIA 2ZO4A 4H0EA 3CUQA 3WGIA 1U2WA 1SFXA 2CSOA 4L5JA 3IL2A 2OZ6A 3NRVA 5K5RA 2Z9OA 2DAOA 4PGGA 1SAXA 2H27A 3TO9A 2AXLA 3D0SA 1T39A 3R4KA 1BIBA 5ICGA 3BOQA 4N0BA 4U7DA 3F6VA 3ZMTA 1K7AA 1TBXA 2EB7A 2HS5A 2RV8A 1JE8A 2QWWA 1IN6A 5FGMA 2NS0A 2JZYA 5DCMA 1HW2A 4Z2YA 4QWQA 1XSDA 3BP8A 1E2XA 3J81K 3VFZA 5JVTA 3FXUA 4MQ9F 2BBYA 4UHTA 3ZMZA 4HZFA 3C7JA 1P92A 2VOPA 3VOEA 3T1BA 4ESBA 4YIFA 2VBWA 2F5FA 4OU0A 5HDNA 4LJZF 2XGXA 4B8XA 2VT2A 3LA3A 1R00A 2PQ8A 2VE8A 1YW8A 2XAJA 3SZPA 1T98A 1PP8F 1S6LA 3GEZA 3TOAA 3JSOA 2FMYA 3GFLA 1KYWA 4ENJA 3WE2A 2FNAA 1ON2A 1DPRA 1YW9A 1OYIA 4HQEA 2YX4A 4KICA 1ZHFA 2RVCA 5J8CA 4KN4X 2P7CB 4OIRF 2MLKA 1WI9A 3KZYA 1OPCA 4LB6B 2W84A 5FFXA 3BPVA 4M6YA 5HOOA 4IHSA 2HGCA 1S3JA 2ACJA 2HTJA 5LHGA 3DPLC 1AOYA 2MA3A 4OIQF 1ZYRF 2XHKA 2HYFA 3FHZA 2OZUA 3KZZA 2DFIA 1H0MA 2D45A 4IRGA 1QPMA 2ZNZA 2HR3A 4LG0A 3HSEA 2COMA 4OMZA 3IWZA 3VEPA 5ILUA 4BYYA 2DLLA 2OA4A 4L9NA 5FD5A 4TV7A 3F3XA 1T6SA 2RNJA 3ZQ7A 1R1UA 4D0PA 5FB2A 2HKOA 3E6CC 3HHHA 2B0LA 3W6KB 4OIPF 3HTUA 3I54A 3I64A 1IN4A 4KIFA 3M8FA 4HX4A 1B4AA 1LQ1A 4UV8A 3F8FA 2K27A 2XAGA 2GAUA 1K78A 3GWZA 3F8MA 5HLIA 3E5QA 4L9JA 3I59A 4IXAA 5LGUA 2EJRA 3RTRA 2MH9A 1B59A 2MC3A 5F64A 5H6RA 1BM9A 1XGOA 3GUDA 2CO5A 2IJLA 1U8RA 4G94A 5A2QK 3K1NA 1UFMA 1WQ2A 3C3WA 1HSTA 3REOA 1DDNA 5LRRA 4WXDA 1FZPB 2X4HA 1FNNA 1USSA 5CJ9A 3LAPA 4BHBA 4UVAA 4MEXF 3PQJA 3TGNA 2A6EF 1LDKB 2PFBA 5HLGA 4UV9A 1FX7A 2E1NA 3GYHX 3QU3A 2J5OA 4L9VA 3KLNA 5AIPA 2FOKA 5BS6A 3E97A 1XCBA 1R1TA 3HIFA 2ESNA 4KNYA 1XGMA 1YYVA 1QQIA 2Q0OA 1QNTA 1JHHA 2G9WA 4ETSA 3LQRA 1PP7U 1GXQA 1IXCA 1P6RA 1MD0A 4HX7A 3G3ZA 2VT3A 3L9FA 4WX9A 2CQKA 4A2UA 1OYYA 2KIFA 1G4DA 1D5VA 2FF4A 4CGZA 4L5IA 4EJVA 1I5ZA 4BAYA 1R36A 3PFIA 4MGRA 5J6XA 1BC8C 2ZMEB 1T38A 2DQRA 1QBJA 4LLNA 1BI1A 4EJTA 1TQIA 1J7KA 4F7ZA 4LLGF 4BH9A 1YG2A 2F5DA 1J75A 3Q9VA 2P5KA 1TQMA 4LB5A 3FWEA 5J8FA 1WWXA 3R60A 3V8LA 1XGSA 3WG9A 4PCQA 2NNNA 2QQBA 3J80K 3JTGA 2DT5A 2KJBA 4RGUA 1QO0D 2QBYA 5LGTA 5HLHA 2DO7A 3WU0A 1DP7P 5KK1A 5JI6A 5L3BA 1U5TB 4O6JA 1RIOH 3QOPA 5IT9K 5L3CA 3C18A 2QQAA 1RUOA 1HBXG 3CDHA 3SXYA 1S8NA 5H20A 1TW3A 2LSOA 1GVJA 3V4GA 1FPQA 1HW5A 3I71A 1TNSA 4EMSA 4HX8A 3RPUA 2O61A 2WWYA 3GFIA 2W57A 1B6AA 3E3VA 3EQLF 4FHTA 3KETA 3BJAA 1G6NA 3WTTC 5E1XA 1I1SA 2ADUA 2M8EA 4I0AA 4RGRA 5A2QZ 1XMKA 1Z6TA 4M74A 1HKTA 5ICEA 4RAZA 2L3DA 3QRFF 1YQAA 1E17A 3V8JA 5HS8A 4IRHA 4PDKA 4WK8F 2LF7A 4Y15A 5EEHA 4P9UA 1Z7UA 4MEYF 1F4KA 1TTYA 4HYEA 1C0WA 1BJAA 1V3FA 1HXDA 2MH2A 3U2RA 4Q5SF 3OOPA 4R1HA 3KCCA 2FBIA 2RC4A 1RI7A 2DPUA 4HF2A 1OMIA 4EM2A 4E70A 1MJBA 1REPC 2HTSA 1MDMA 4EM1A 2R3SA 5L3DA 2NAZA 1OYWA 4AIKA 4QLCU 2BEOA 2A3SA 3V7SA 1KA8A 3W6JB 2X0LA 2VN2A 5ILVA 3TDZC 5FLXZ 3EDPA 1LNWA 4KN7X 1EH8A 3D5LA 2XASA 4S05A 2M45A 3SZTA 4ZYDA 3KEOA 4ZZDA 1XMAA 1U6GA 4KFCA 3RYPA 1O3SA 2NNYA 1O3TA 1SFUA 2FRHA 3WE3A 1MGTA 3F6OA 3GZ6A 3T8RA 4WF2A 3DF8A 2F5EA 1ZH5A 2YX7A 4ZH4F 2ZBKA 3WTWC 4XBFA 1F5TA 3ML6A 3ZN1A 2HQNA 3O6BB 2JSCA 3J80Z 2PMHA 1BIAA 3ZPLA 2IP2A 1MJ9A 1XGNA 4A5NA 2FBKA 3L00A 3ZMSA 3C1DA 3MFKA 4CICA 1HSJA 2FNPA 1CF7B 3G73A 3TDUC 2Z3YA 5IT9Z 3BZ6A 4U7BA 2JRTA 4RGXA 3KFWX 5LLQA 1P4AA 2ZFWA 4I0BA 2HKXA 2RDPA 2P8TA 3SQNA 3JAMZ 5FFZA 6PAXA 2L54A 4UXNA 1R5HA 5E8GA 1W7PB 2RKHA 4HF1A 4KA4A 4KYWA 4OINF 3HUGA 3SFZA 1BN5A 4HOBA 5LBQA 1IRGA 5ED4A 1R5GA 2HEOA 3KP7A 4IF4A 1SFEA 4P5OA 2XAFA 3ZMUA 4LD5A 5E18F 1ULYA 3LWFA 3HRSA 1XN7A 1FYKA 2V1DA 4Y17A 3FX3A 2OU2A 3V8KA 1O3QA 5D8LB 1FC3A 4IRIA 5D6FA 2VBYA 1SMYF 1W5TA 1B9MA 2NYXA 4JBAA 5DD4A 2PG4A 4M72A 1HQCA 5BMZA 5E17F 1O7FA 1U5TA 3F21A 1O3RA 1D8JA 1ODDA 1FP2A 2P5LC 3CUQC 3F23A 4M9XA 4RAYA 5HDKA 3RDIA 1Z9CA 4G7HF 4CXFA 3FF5A 3R0AA 5HVQC 2H6CA 2XVCA 3TO7A 3BJOA 3WTVC 3LSTA 4ASNA 2OQGA 3MZYA 1FLIA 5D4RA 1ZRCA 2TDXA 3KP4A 4IVNA 4GGGA 3HHGA 3RPQA 1UHMA 5HS7A 3ERED 1KQ9A 3DFGA 2KIMA 1KQ0A 3KP2A 4ESFA 2IW5A 2M1BA 3N4MA 4A6EA 3R6SA 1PUEE 3ZP5A 1ZAOA 4NQWA 2CYYA 4EV0A 3CUQB 3P9CA 5BPDA 5IT3A 5E1ZB 2CWEA 3TO6A 5F6FA 2JT1A 4IPAA 3RI4A 1X3UA 2PMUA 2VC1A 2FMLA 3KP3A 2GIVA 3BPXA 1ZREA 5L3FA 1XDUA 2G7UA 4ON0A 3FZVA 5D5XB 1YS7A 4MQVA 1P2FA 2BV6A 3I58A 2GXBA 1JXSA 1STZA 2XROA 4R79A 2MBFA 1RUNA 2M30A 3GVAA 2Y0MA 1FP1D 2IT0A 3LA7A 3COAC 3KP5A 3AAFA 2H6BA 5DCMB 5TJJA 5ICCA 2EFWA 4EJWA 5DDGA 3IKVA 3DEUA 1HKSA 1ONVA 2EA4A 2WV0A 4I2OA 4HV6A 4A12A 3HSRA 4HW0A 5K5QA 2KRFA 3U1DA 2ZXJA 2YR2A 1IN7A 3IWFA 3LQQA 1WKMA 1BI0A 5CVUA 1HKQA 4LMYA 2AS5F 4L9TA 2DU9A 3O3KA 1R22A 3K9TA 2GA1A 2KIUA 4WXHA 1ZGAA 3T8TA 5FLXK 1YO5C 4YFXF 4IHTA 1UCRA 3WGGA 1IXSB 2CG4A 5CVRA 2NRAC 4ENKA 1K6OA 3H3ZA 2ISYA 3RJPA 3DKWA 2ISZA 3RKYA 2ETHA 1FT9A 3K1MA 1U3EM 1BBYA 3BY6A 4BHPA 5HS9A 3FMQA 3L09A 3U9GA 3ZMVA 2FQ3A 3M9AA 4FX4A 3KE2A 3B02A 3K69A 3GLXA 1DPUA 3VODA 2O03A 3F8BA 3CUOA 2EWNA 3ISPA 4BXUA 1R23A 3HSFA 1TW2A 3EUHA 4HF0A 1Q1HA 3P9IA 3LAJA 4EJUA 4LK1F 2LDUA 4HAMA 1FBUA 2JTVA 1KQ8A 4AD9A 2EV5A 2M87A 5EEGA 5D6EA 3M7GA 3CO7C 2Z33A 5LEJA 3GXOA 4XRFA 1FBQA 4MTEA 2XKOA 2DQLA 3GF2A 4XSXF 1O7LA 1FWZA 5JHUA 4A0XA 3WODF 2IVMA 3RIRA 3TOBA 1W4MA 2FSWA 2OD5A 3O2PE 5DD8A 4M73A 5D5VB 4LG0B 3TKYA 5D8KB 1MJAA 1W7PA 4RB1A 2OBPA 3JAMK 1J9IA 1T0FA 4RGSA 3JSPA 4O5VA 1O57A 4LLLA 3MCZA 3CLOA 1NHAA 2RQPA 2RN7A 1G3WA 4I7HA 3DPTA 1FOKA 2OQRA 4KT5C 3QPHA 5FO5A 3B73A 2LF8A 1FYLA 1R58A 2F5CA 3GZ5A 2J5PA 2O0YA 3I5UA 4IJAA 1U78A 3FXRA 3IRRA 2ZCWA 3BWGA 2K4JA 2GZWA 2YSRA 5ILSA 5BPIA 3M1EA 4EQQA 1KGSA 4I01A 4UUVA 4M6XA 4G8XA 1K79A 1K78B 1R1VA 1GXPA 1W7PD 2QVOA 3I59B 4JK1X 1YFHA 1ZG5A 5JR3A 2Y75A 2PLYA 2FU4A 1XD7A 2EFQA 1J59A 1IRFA 2VC0A 2FA5A 2BYVE 3SHFA 4WCGA 1JGSA 4ESJA 4O3MA 2PBIA 4NB5A 1XCVA 1YW7A 4RB3C 4CO8A 4WXCA 2P6TA 4HV5A 2XIGA 1B1BA 3RKWA 2R7DA 3WTYC 2GA2A 1D3YA 1XSXA 3K2ZA 3RKXA 2HZTA 4CDGA 4GXOA 1S7OA 3ROUA 2OAZA 1ZLKA 2VONA 1S29A 2MLGA 1Y0UA 1TQPA 3GO5A 4A0YA 1VTNC 1I1GA 2XKPA 5CVIA 2ESHA 2DI3A 1Z91A 3TQNA 2FEZA 1LEAA 2M5WA 3GFJA 4P96A 1OR7A 4LFUA 2RGVA 3WGHA 2FE3A 2WC2A 2K4BA 2C6YA 3K1PA 2GWRA 2P4WA 4ZYGA 2CGPA 2IA2A 3F8CA 4N9IA 3CJNA 3WU1B 4OOIA 2STTA 1FBSA 3HRMA 1IN8A 1HW1A 4U0VA 2Z99A 3FMRA 2H09A 2HFHA 2ELHA 1FSHA 4YG2F 3OV8A 3IRQA 1SD7A 3E5XA 4L0YB 2L02A 5LGNA 5F1RA 4XLNF 5AIQA 4UVBA 1FY7A 5LRSA 3M8EA 2V1XA 2XV4S 2EFPA 1PDNC 4UVCA 2GXGA 2HQRA 3I0TA 4U88A 1CGPA 2HDCA 2XRNA 1F1ZA 3DP7A 3T5XA 3Q9SA 4Q47A 1TLHB 4A5MA 3NQOA 4BHCA 2ZKZA 2Y48A 2CW0F 4KDPA 2QBYB 3WTXC 3KLOA 3V7RA 4I09A 1H9GA 3HYIA 1XB4A 4MNUA 2PEXA 4OIOF 2EA2A 3I4PA 1D8KA 2K02A 2K7LA 3H3UA 2ZMEA 4M71A 5LHIA 2O6GE 3WTUC 5LHHA 1BC7C 2VE9A 3BDDA 5D4SA 2UXXA 4ZYEA 2IA1A 4Q48A 4EGYA 3ELKA 1EH7A 1LEBA 1G3YA 3KP6A 4BNCA 3H92A 2VODA 3QP5A 3MZHA 4GYGA 3DQVC 1IUYA 1SD6A 4NHJA 1Z05A 5JFRA 2YPRA 3ECHA 4ENNA 4FX0A 4N9HA 3MQ0A 4FT8A 1IN5A 1TNTA 2MD5A 3MWMA 5DUIA 1BI3A 3Q5FA 3HRTA 4EJOA 2UWMA 2WTEA 2DBBA 4U0YA 2V1UA 3BROA 5CVJA 3S2WA 2O3FA 2VXZA 3V7CA 3LFKA 1G3SA 3EYIA 3HTSB 3E6DA 1ZLJA 1EV7A 2QLZA 4S04A 4RB0A 3F22A 3I53A 1SD4A 4HDUA 3FM5A 5E20A 3IC7A 3JW4A 1P4WA 5E8IA 4G9YA 2IRFG 2R7FA 2HYGD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GX4 X;  1Z1D A;  3MEX A;  2XAH A;  3MAJ A;  4PZJ A;  2KJC A;  1MDM B;  5CYV A;  1LJ9 A;  2W85 A;  4RB2 C;  3FM3 A;  1B9N A;  3JTH A;  2DW4 A;  4L0Z B;  1MKM A;  5D5W B;  4ENM A;  5ERI A;  2Q8K A;  4I02 A;  2EK5 A;  4KIB A;  4GYI A;  1IXR C;  3HOT A;  2VBX A;  1GHC A;  3ZN0 A;  1UHW A;  5AON A;  4P55 A;  4AWX B;  3GFM A;  2G7H A;  3FMS A;  1QZY A;  4I98 B;  3ABT A;  1T2K A;  2XAQ A;  1ZG1 A;  2HWV A;  1YIO A;  2ZNY A;  2P7V B;  4B09 A;  4G7Z F;  5HDG A;  2A5Y B;  2L01 A;  1BI2 A;  2FBH A;  4G7O F;  1J0R A;  1SMT A;  1A04 A;  1LDJ A;  3WTZ A;  3RYR A;  3J81 Z;  4R8H A;  2QZ8 A;  3VB2 A;  4JQF A;  3QU6 A;  4AIJ A;  3ABU A;  2PN6 A;  2JPC A;  5KVR A;  1G3T A;  5LEK A;  1KU9 A;  5DYM A;  2GQQ A;  4AIH A;  2STW A;  2IA0 A;  4GCV A;  3CO6 C;  4ZYH A;  3ECO A;  1S7A A;  4KIG A;  4UNO A;  2V9V A;  1JHF A;  2QUF A;  1QZZ A;  2EV0 A;  2BE5 F;  1ZRF A;  3K0L A;  2QYO A;  1KU2 A;  4HDV A;  1ZG3 A;  5D5U B;  2LNB A;  2HOE A;  4HLY A;  4YFN F;  1YLF A;  1ZN2 A;  2KKO A;  4BQA A;  1H9T A;  1P4X A;  5TRD A;  2W25 A;  2BGC A;  3L7W A;  4GO1 A;  4KMU X;  4U0W A;  2L4M A;  1F9N A;  1RNL A;  1OKR A;  1I6X A;  3DV8 A;  2FXA A;  3ZMD A;  2D2W A;  1AWC A;  3WTS C;  1U5T C;  1LDD A;  1SD5 A;  1W5S A;  2A07 F;  2D1H A;  3P9K A;  1ZRD A;  3ULQ B;  4Q4Z F;  4Y13 A;  3L2C A;  5ICF A;  4CYD A;  2QQ9 A;  1Z6R A;  4AVP A;  3P7N A;  2CFX A;  3IHU A;  1LB2 A;  1IW7 F;  2E7W A;  5K5O A;  1CF7 A;  1UST A;  2D1V A;  4HBL A;  3J7A O;  4HQM A;  3QAH A;  5BQT A;  2A6H F;  3R0J A;  4M9S A;  2Q2E A;  2DK8 A;  1BOA A;  2H94 A;  3EET A;  4DQ2 A;  5DEQ A;  1XSV A;  1ZGJ A;  1RZ4 A;  2IPQ X;  3F72 A;  4XSZ F;  1EH6 A;  3BJ6 A;  3N97 A;  5DUK A;  3E6M A;  3NEU A;  1I27 A;  2UZK A;  3DXJ F;  4XLP F;  2O8X A;  2PJP A;  2QM3 A;  3IKT A;  4LK0 F;  2EFN A;  5DV5 A;  4KMF A;  1KU3 A;  1YS6 A;  3E6B A;  1XDS A;  1YTY A;  1WRJ A;  1KU7 A;  3LA2 A;  3F8N A;  4DNC A;  2VBZ A;  3QP6 A;  4HA8 A;  5CVV A;  2DTR A;  1FSE A;  4KUM A;  2VOO A;  1FYM A;  3GW2 A;  2A69 F;  2F2E A;  3FXQ A;  4HLX A;  1J5Y A;  3QPT A;  2YU3 A;  2V6C A;  3T0Y A;  2EFO A;  4A0Z A;  5H6Q A;  2V79 A;  2PI0 A;  2K86 A;  4G6D A;  4M9Z A;  1LVA A;  1R7J A;  4PGH A;  1IF1 A;  4EVI A;  5L3E A;  1L0O C;  4K2E A;  3PQK A;  4ZZL A;  4L18 B;  4G6Q A;  2QEN A;  4P9F A;  5E1W A;  3EYY A;  2E1C A;  4CZZ A;  1ON1 A;  3HRU A;  2ZJ2 A;  4EGZ A;  4LGW A;  2A61 A;  1J2X A;  2W24 A;  2P5V A;  3KEQ A;  1QGP A;  1IZ1 A;  2JPB A;  2LKP A;  5K1Y A;  3HOS A;  1UB9 A;  4MHG A;  2DK5 A;  5BOX A;  3CTA A;  2E7X A;  1DUX C;  1MZB A;  4OMY A;  5DCF A;  4WWC A;  2Z5U A;  1L3L A;  4MTD A;  1IAW A;  3E5U A;  4YFK F;  2P6S A;  1KYZ A;  2L4A A;  2DPD A;  4A6D A;  4RS8 A;  2A68 F;  2UXN A;  2EV6 A;  1WSU A;  4EM0 B;  1V4R A;  3R61 A;  2XUB A;  5FD6 A;  5L3G A;  5CLS A;  1ZAR A;  4CHU A;  4YII A;  2ZO4 A;  4H0E A;  3CUQ A;  3WGI A;  1U2W A;  1SFX A;  2CSO A;  4L5J A;  3IL2 A;  2OZ6 A;  3NRV A;  5K5R A;  2Z9O A;  2DAO A;  4PGG A;  1SAX A;  2H27 A;  3TO9 A;  2AXL A;  3D0S A;  1T39 A;  3R4K A;  1BIB A;  5ICG A;  3BOQ A;  4N0B A;  4U7D A;  3F6V A;  3ZMT A;  1K7A A;  1TBX A;  2EB7 A;  2HS5 A;  2RV8 A;  1JE8 A;  2QWW A;  1IN6 A;  5FGM A;  2NS0 A;  2JZY A;  5DCM A;  1HW2 A;  4Z2Y A;  4QWQ A;  1XSD A;  3BP8 A;  1E2X A;  3J81 K;  3VFZ A;  5JVT A;  3FXU A;  4MQ9 F;  2BBY A;  4UHT A;  3ZMZ A;  4HZF A;  3C7J A;  1P92 A;  2VOP A;  3VOE A;  3T1B A;  4ESB A;  4YIF A;  2VBW A;  2F5F A;  4OU0 A;  5HDN A;  4LJZ F;  2XGX A;  4B8X A;  2VT2 A;  3LA3 A;  1R00 A;  2PQ8 A;  2VE8 A;  1YW8 A;  2XAJ A;  3SZP A;  1T98 A;  1PP8 F;  1S6L A;  3GEZ A;  3TOA A;  3JSO A;  2FMY A;  3GFL A;  1KYW A;  4ENJ A;  3WE2 A;  2FNA A;  1ON2 A;  1DPR A;  1YW9 A;  1OYI A;  4HQE A;  2YX4 A;  4KIC A;  1ZHF A;  2RVC A;  5J8C A;  4KN4 X;  2P7C B;  4OIR F;  2MLK A;  1WI9 A;  3KZY A;  1OPC A;  4LB6 B;  2W84 A;  5FFX A;  3BPV A;  4M6Y A;  5HOO A;  4IHS A;  2HGC A;  1S3J A;  2ACJ A;  2HTJ A;  5LHG A;  3DPL C;  1AOY A;  2MA3 A;  4OIQ F;  1ZYR F;  2XHK A;  2HYF A;  3FHZ A;  2OZU A;  3KZZ A;  2DFI A;  1H0M A;  2D45 A;  4IRG A;  1QPM A;  2ZNZ A;  2HR3 A;  4LG0 A;  3HSE A;  2COM A;  4OMZ A;  3IWZ A;  3VEP A;  5ILU A;  4BYY A;  2DLL A;  2OA4 A;  4L9N A;  5FD5 A;  4TV7 A;  3F3X A;  1T6S A;  2RNJ A;  3ZQ7 A;  1R1U A;  4D0P A;  5FB2 A;  2HKO A;  3E6C C;  3HHH A;  2B0L A;  3W6K B;  4OIP F;  3HTU A;  3I54 A;  3I64 A;  1IN4 A;  4KIF A;  3M8F A;  4HX4 A;  1B4A A;  1LQ1 A;  4UV8 A;  3F8F A;  2K27 A;  2XAG A;  2GAU A;  1K78 A;  3GWZ A;  3F8M A;  5HLI A;  3E5Q A;  4L9J A;  3I59 A;  4IXA A;  5LGU A;  2EJR A;  3RTR A;  2MH9 A;  1B59 A;  2MC3 A;  5F64 A;  5H6R A;  1BM9 A;  1XGO A;  3GUD A;  2CO5 A;  2IJL A;  1U8R A;  4G94 A;  5A2Q K;  3K1N A;  1UFM A;  1WQ2 A;  3C3W A;  1HST A;  3REO A;  1DDN A;  5LRR A;  4WXD A;  1FZP B;  2X4H A;  1FNN A;  1USS A;  5CJ9 A;  3LAP A;  4BHB A;  4UVA A;  4MEX F;  3PQJ A;  3TGN A;  2A6E F;  1LDK B;  2PFB A;  5HLG A;  4UV9 A;  1FX7 A;  2E1N A;  3GYH X;  3QU3 A;  2J5O A;  4L9V A;  3KLN A;  5AIP A;  2FOK A;  5BS6 A;  3E97 A;  1XCB A;  1R1T A;  3HIF A;  2ESN A;  4KNY A;  1XGM A;  1YYV A;  1QQI A;  2Q0O A;  1QNT A;  1JHH A;  2G9W A;  4ETS A;  3LQR A;  1PP7 U;  1GXQ A;  1IXC A;  1P6R A;  1MD0 A;  4HX7 A;  3G3Z A;  2VT3 A;  3L9F A;  4WX9 A;  2CQK A;  4A2U A;  1OYY A;  2KIF A;  1G4D A;  1D5V A;  2FF4 A;  4CGZ A;  4L5I A;  4EJV A;  1I5Z A;  4BAY A;  1R36 A;  3PFI A;  4MGR A;  5J6X A;  1BC8 C;  2ZME B;  1T38 A;  2DQR A;  1QBJ A;  4LLN A;  1BI1 A;  4EJT A;  1TQI A;  1J7K A;  4F7Z A;  4LLG F;  4BH9 A;  1YG2 A;  2F5D A;  1J75 A;  3Q9V A;  2P5K A;  1TQM A;  4LB5 A;  3FWE A;  5J8F A;  1WWX A;  3R60 A;  3V8L A;  1XGS A;  3WG9 A;  4PCQ A;  2NNN A;  2QQB A;  3J80 K;  3JTG A;  2DT5 A;  2KJB A;  4RGU A;  1QO0 D;  2QBY A;  5LGT A;  5HLH A;  2DO7 A;  3WU0 A;  1DP7 P;  5KK1 A;  5JI6 A;  5L3B A;  1U5T B;  4O6J A;  1RIO H;  3QOP A;  5IT9 K;  5L3C A;  3C18 A;  2QQA A;  1RUO A;  1HBX G;  3CDH A;  3SXY A;  1S8N A;  5H20 A;  1TW3 A;  2LSO A;  1GVJ A;  3V4G A;  1FPQ A;  1HW5 A;  3I71 A;  1TNS A;  4EMS A;  4HX8 A;  3RPU A;  2O61 A;  2WWY A;  3GFI A;  2W57 A;  1B6A A;  3E3V A;  3EQL F;  4FHT A;  3KET A;  3BJA A;  1G6N A;  3WTT C;  5E1X A;  1I1S A;  2ADU A;  2M8E A;  4I0A A;  4RGR A;  5A2Q Z;  1XMK A;  1Z6T A;  4M74 A;  1HKT A;  5ICE A;  4RAZ A;  2L3D A;  3QRF F;  1YQA A;  1E17 A;  3V8J A;  5HS8 A;  4IRH A;  4PDK A;  4WK8 F;  2LF7 A;  4Y15 A;  5EEH A;  4P9U A;  1Z7U A;  4MEY F;  1F4K A;  1TTY A;  4HYE A;  1C0W A;  1BJA A;  1V3F A;  1HXD A;  2MH2 A;  3U2R A;  4Q5S F;  3OOP A;  4R1H A;  3KCC A;  2FBI A;  2RC4 A;  1RI7 A;  2DPU A;  4HF2 A;  1OMI A;  4EM2 A;  4E70 A;  1MJB A;  1REP C;  2HTS A;  1MDM A;  4EM1 A;  2R3S A;  5L3D A;  2NAZ A;  1OYW A;  4AIK A;  4QLC U;  2BEO A;  2A3S A;  3V7S A;  1KA8 A;  3W6J B;  2X0L A;  2VN2 A;  5ILV A;  3TDZ C;  5FLX Z;  3EDP A;  1LNW A;  4KN7 X;  1EH8 A;  3D5L A;  2XAS A;  4S05 A;  2M45 A;  3SZT A;  4ZYD A;  3KEO A;  4ZZD A;  1XMA A;  1U6G A;  4KFC A;  3RYP A;  1O3S A;  2NNY A;  1O3T A;  1SFU A;  2FRH A;  3WE3 A;  1MGT A;  3F6O A;  3GZ6 A;  3T8R A;  4WF2 A;  3DF8 A;  2F5E A;  1ZH5 A;  2YX7 A;  4ZH4 F;  2ZBK A;  3WTW C;  4XBF A;  1F5T A;  3ML6 A;  3ZN1 A;  2HQN A;  3O6B B;  2JSC A;  3J80 Z;  2PMH A;  1BIA A;  3ZPL A;  2IP2 A;  1MJ9 A;  1XGN A;  4A5N A;  2FBK A;  3L00 A;  3ZMS A;  3C1D A;  3MFK A;  4CIC A;  1HSJ A;  2FNP A;  1CF7 B;  3G73 A;  3TDU C;  2Z3Y A;  5IT9 Z;  3BZ6 A;  4U7B A;  2JRT A;  4RGX A;  3KFW X;  5LLQ A;  1P4A A;  2ZFW A;  4I0B A;  2HKX A;  2RDP A;  2P8T A;  3SQN A;  3JAM Z;  5FFZ A;  6PAX A;  2L54 A;  4UXN A;  1R5H A;  5E8G A;  1W7P B;  2RKH A;  4HF1 A;  4KA4 A;  4KYW A;  4OIN F;  3HUG A;  3SFZ A;  1BN5 A;  4HOB A;  5LBQ A;  1IRG A;  5ED4 A;  1R5G A;  2HEO A;  3KP7 A;  4IF4 A;  1SFE A;  4P5O A;  2XAF A;  3ZMU A;  4LD5 A;  5E18 F;  1ULY A;  3LWF A;  3HRS A;  1XN7 A;  1FYK A;  2V1D A;  4Y17 A;  3FX3 A;  2OU2 A;  3V8K A;  1O3Q A;  5D8L B;  1FC3 A;  4IRI A;  5D6F A;  2VBY A;  1SMY F;  1W5T A;  1B9M A;  2NYX A;  4JBA A;  5DD4 A;  2PG4 A;  4M72 A;  1HQC A;  5BMZ A;  5E17 F;  1O7F A;  1U5T A;  3F21 A;  1O3R A;  1D8J A;  1ODD A;  1FP2 A;  2P5L C;  3CUQ C;  3F23 A;  4M9X A;  4RAY A;  5HDK A;  3RDI A;  1Z9C A;  4G7H F;  4CXF A;  3FF5 A;  3R0A A;  5HVQ C;  2H6C A;  2XVC A;  3TO7 A;  3BJO A;  3WTV C;  3LST A;  4ASN A;  2OQG A;  3MZY A;  1FLI A;  5D4R A;  1ZRC A;  2TDX A;  3KP4 A;  4IVN A;  4GGG A;  3HHG A;  3RPQ A;  1UHM A;  5HS7 A;  3ERE D;  1KQ9 A;  3DFG A;  2KIM A;  1KQ0 A;  3KP2 A;  4ESF A;  2IW5 A;  2M1B A;  3N4M A;  4A6E A;  3R6S A;  1PUE E;  3ZP5 A;  1ZAO A;  4NQW A;  2CYY A;  4EV0 A;  3CUQ B;  3P9C A;  5BPD A;  5IT3 A;  5E1Z B;  2CWE A;  3TO6 A;  5F6F A;  2JT1 A;  4IPA A;  3RI4 A;  1X3U A;  2PMU A;  2VC1 A;  2FML A;  3KP3 A;  2GIV A;  3BPX A;  1ZRE A;  5L3F A;  1XDU A;  2G7U A;  4ON0 A;  3FZV A;  5D5X B;  1YS7 A;  4MQV A;  1P2F A;  2BV6 A;  3I58 A;  2GXB A;  1JXS A;  1STZ A;  2XRO A;  4R79 A;  2MBF A;  1RUN A;  2M30 A;  3GVA A;  2Y0M A;  1FP1 D;  2IT0 A;  3LA7 A;  3COA C;  3KP5 A;  3AAF A;  2H6B A;  5DCM B;  5TJJ A;  5ICC A;  2EFW A;  4EJW A;  5DDG A;  3IKV A;  3DEU A;  1HKS A;  1ONV A;  2EA4 A;  2WV0 A;  4I2O A;  4HV6 A;  4A12 A;  3HSR A;  4HW0 A;  5K5Q A;  2KRF A;  3U1D A;  2ZXJ A;  2YR2 A;  1IN7 A;  3IWF A;  3LQQ A;  1WKM A;  1BI0 A;  5CVU A;  1HKQ A;  4LMY A;  2AS5 F;  4L9T A;  2DU9 A;  3O3K A;  1R22 A;  3K9T A;  2GA1 A;  2KIU A;  4WXH A;  1ZGA A;  3T8T A;  5FLX K;  1YO5 C;  4YFX F;  4IHT A;  1UCR A;  3WGG A;  1IXS B;  2CG4 A;  5CVR A;  2NRA C;  4ENK A;  1K6O A;  3H3Z A;  2ISY A;  3RJP A;  3DKW A;  2ISZ A;  3RKY A;  2ETH A;  1FT9 A;  3K1M A;  1U3E M;  1BBY A;  3BY6 A;  4BHP A;  5HS9 A;  3FMQ A;  3L09 A;  3U9G A;  3ZMV A;  2FQ3 A;  3M9A A;  4FX4 A;  3KE2 A;  3B02 A;  3K69 A;  3GLX A;  1DPU A;  3VOD A;  2O03 A;  3F8B A;  3CUO A;  2EWN A;  3ISP A;  4BXU A;  1R23 A;  3HSF A;  1TW2 A;  3EUH A;  4HF0 A;  1Q1H A;  3P9I A;  3LAJ A;  4EJU A;  4LK1 F;  2LDU A;  4HAM A;  1FBU A;  2JTV A;  1KQ8 A;  4AD9 A;  2EV5 A;  2M87 A;  5EEG A;  5D6E A;  3M7G A;  3CO7 C;  2Z33 A;  5LEJ A;  3GXO A;  4XRF A;  1FBQ A;  4MTE A;  2XKO A;  2DQL A;  3GF2 A;  4XSX F;  1O7L A;  1FWZ A;  5JHU A;  4A0X A;  3WOD F;  2IVM A;  3RIR A;  3TOB A;  1W4M A;  2FSW A;  2OD5 A;  3O2P E;  5DD8 A;  4M73 A;  5D5V B;  4LG0 B;  3TKY A;  5D8K B;  1MJA A;  1W7P A;  4RB1 A;  2OBP A;  3JAM K;  1J9I A;  1T0F A;  4RGS A;  3JSP A;  4O5V A;  1O57 A;  4LLL A;  3MCZ A;  3CLO A;  1NHA A;  2RQP A;  2RN7 A;  1G3W A;  4I7H A;  3DPT A;  1FOK A;  2OQR A;  4KT5 C;  3QPH A;  5FO5 A;  3B73 A;  2LF8 A;  1FYL A;  1R58 A;  2F5C A;  3GZ5 A;  2J5P A;  2O0Y A;  3I5U A;  4IJA A;  1U78 A;  3FXR A;  3IRR A;  2ZCW A;  3BWG A;  2K4J A;  2GZW A;  2YSR A;  5ILS A;  5BPI A;  3M1E A;  4EQQ A;  1KGS A;  4I01 A;  4UUV A;  4M6X A;  4G8X A;  1K79 A;  1K78 B;  1R1V A;  1GXP A;  1W7P D;  2QVO A;  3I59 B;  4JK1 X;  1YFH A;  1ZG5 A;  5JR3 A;  2Y75 A;  2PLY A;  2FU4 A;  1XD7 A;  2EFQ A;  1J59 A;  1IRF A;  2VC0 A;  2FA5 A;  2BYV E;  3SHF A;  4WCG A;  1JGS A;  4ESJ A;  4O3M A;  2PBI A;  4NB5 A;  1XCV A;  1YW7 A;  4RB3 C;  4CO8 A;  4WXC A;  2P6T A;  4HV5 A;  2XIG A;  1B1B A;  3RKW A;  2R7D A;  3WTY C;  2GA2 A;  1D3Y A;  1XSX A;  3K2Z A;  3RKX A;  2HZT A;  4CDG A;  4GXO A;  1S7O A;  3ROU A;  2OAZ A;  1ZLK A;  2VON A;  1S29 A;  2MLG A;  1Y0U A;  1TQP A;  3GO5 A;  4A0Y A;  1VTN C;  1I1G A;  2XKP A;  5CVI A;  2ESH A;  2DI3 A;  1Z91 A;  3TQN A;  2FEZ A;  1LEA A;  2M5W A;  3GFJ A;  4P96 A;  1OR7 A;  4LFU A;  2RGV A;  3WGH A;  2FE3 A;  2WC2 A;  2K4B A;  2C6Y A;  3K1P A;  2GWR A;  2P4W A;  4ZYG A;  2CGP A;  2IA2 A;  3F8C A;  4N9I A;  3CJN A;  3WU1 B;  4OOI A;  2STT A;  1FBS A;  3HRM A;  1IN8 A;  1HW1 A;  4U0V A;  2Z99 A;  3FMR A;  2H09 A;  2HFH A;  2ELH A;  1FSH A;  4YG2 F;  3OV8 A;  3IRQ A;  1SD7 A;  3E5X A;  4L0Y B;  2L02 A;  5LGN A;  5F1R A;  4XLN F;  5AIQ A;  4UVB A;  1FY7 A;  5LRS A;  3M8E A;  2V1X A;  2XV4 S;  2EFP A;  1PDN C;  4UVC A;  2GXG A;  2HQR A;  3I0T A;  4U88 A;  1CGP A;  2HDC A;  2XRN A;  1F1Z A;  3DP7 A;  3T5X A;  3Q9S A;  4Q47 A;  1TLH B;  4A5M A;  3NQO A;  4BHC A;  2ZKZ A;  2Y48 A;  2CW0 F;  4KDP A;  2QBY B;  3WTX C;  3KLO A;  3V7R A;  4I09 A;  1H9G A;  3HYI A;  1XB4 A;  4MNU A;  2PEX A;  4OIO F;  2EA2 A;  3I4P A;  1D8K A;  2K02 A;  2K7L A;  3H3U A;  2ZME A;  4M71 A;  5LHI A;  2O6G E;  3WTU C;  5LHH A;  1BC7 C;  2VE9 A;  3BDD A;  5D4S A;  2UXX A;  4ZYE A;  2IA1 A;  4Q48 A;  4EGY A;  3ELK A;  1EH7 A;  1LEB A;  1G3Y A;  3KP6 A;  4BNC A;  3H92 A;  2VOD A;  3QP5 A;  3MZH A;  4GYG A;  3DQV C;  1IUY A;  1SD6 A;  4NHJ A;  1Z05 A;  5JFR A;  2YPR A;  3ECH A;  4ENN A;  4FX0 A;  4N9H A;  3MQ0 A;  4FT8 A;  1IN5 A;  1TNT A;  2MD5 A;  3MWM A;  5DUI A;  1BI3 A;  3Q5F A;  3HRT A;  4EJO A;  2UWM A;  2WTE A;  2DBB A;  4U0Y A;  2V1U A;  3BRO A;  5CVJ A;  3S2W A;  2O3F A;  2VXZ A;  3V7C A;  3LFK A;  1G3S A;  3EYI A;  3HTS B;  3E6D A;  1ZLJ A;  1EV7 A;  2QLZ A;  4S04 A;  4RB0 A;  3F22 A;  3I53 A;  1SD4 A;  4HDU A;  3FM5 A;  5E20 A;  3IC7 A;  3JW4 A;  1P4W A;  5E8I A;  4G9Y A;  2IRF G;  2R7F A;  2HYG D; 
#chains in the Genus database with same CATH topology
 3IP4 B;  4ZTF A;  1ZTR A;  2DOF A;  3ASN H;  3GX4 X;  1Z1D A;  5J1R A;  3NAU A;  1A5J A;  3MEX A;  3TL4 X;  2XAH A;  1XTA A;  2KFD A;  1HDP A;  2NS8 A;  2R7R A;  1SVO A;  3MAJ A;  2A5W A;  4XLH A;  1IJW C;  3I4M J;  2QQ8 A;  4KIT B;  5F0F A;  4DZP A;  1AHD P;  4PZJ A;  3RZD J;  3RZO J;  2KJC A;  3OYJ A;  3DLA A;  1MDM B;  5CYV A;  1LJ9 A;  2W85 A;  4RB2 C;  3FM3 A;  1B9N A;  3JRI A;  1JKP C;  3JTH A;  2DA2 A;  3MN2 A;  2DW4 A;  5M5Y J;  5CKT A;  3OS1 A;  4L0Z B;  1MKM A;  5D5W B;  5FLV A;  4ENM A;  5ERI A;  3M4O J;  5CPR B;  2JVG A;  2Q8K A;  4I02 A;  4ABZ A;  2EK5 A;  4KIB A;  1T8I A;  4GYI A;  4L5E A;  2DA7 A;  1IXR C;  3A01 B;  2DYR H;  5DM7 F;  3HOT A;  3O8H A;  1WZ2 A;  2VBX A;  1VF9 A;  1F36 A;  1GHC A;  3ZN0 A;  2W82 A;  5J3L A;  5GP9 A;  1FJL A;  1UHW A;  5AON A;  3VYR B;  3KYC B;  4P55 A;  4RDU A;  5B3S H;  4AWX B;  2HI3 A;  3GFM A;  1JKO C;  2G7H A;  4NUB A;  1RRJ A;  2DXI A;  3FMS A;  1QZY A;  4I98 B;  4B43 A;  3ABT A;  1T2K A;  3G1O A;  2XAQ A;  1ZG1 A;  5IY5 H;  2HWV A;  3HBL A;  1YIO A;  1Y39 A;  2ZNY A;  2P7V B;  3QYB A;  4B09 A;  3OYM A;  4IL6 C;  4G7Z F;  5HDG A;  2A5Y B;  2L01 A;  1BI2 A;  2FBH A;  4G7O F;  2QCO A;  1J0R A;  1SMT A;  2E5Z A;  2WB1 N;  1A04 A;  1LDJ A;  3WTZ A;  3RYR A;  3J81 Z;  1PYV A;  4R8H A;  2NXN B;  2AHQ A;  2QZ8 A;  1R5I D;  3VB2 A;  3OY9 A;  4JQF A;  2H1K A;  3GTK J;  1VQN I;  1VI0 A;  3ABM H;  3QU6 A;  4AIJ A;  3ABU A;  2PN6 A;  2JPC A;  1G8X A;  2OPT A;  5KVR A;  1G3T A;  5LEK A;  1KU9 A;  2Y0S N;  5DYM A;  1AU7 A;  4PK4 A;  2GQQ A;  3BG5 A;  3S1R J;  2ZME C;  4AIH A;  2LTP A;  2Q1Z B;  3W2A A;  2F6C A;  3Q0V A;  2IA0 A;  2STW A;  2ELK A;  3AL0 C;  4GCV A;  3AG1 H;  3L2R A;  3CO6 C;  4ZYH A;  3ECO A;  1S7A A;  3TED A;  4KIG A;  4BU2 A;  4UNO A;  3BTL A;  2V9V A;  1JHF A;  2WV1 A;  3CQZ J;  2QUF A;  1QZZ A;  2EV0 A;  1FOY A;  4J19 A;  3KYD B;  1M1E B;  2BE5 F;  3IAS 2;  1ZRF A;  2CUJ A;  3K0L A;  2QYO A;  1KU2 A;  1TL8 A;  4XKW A;  4HDV A;  1ZG3 A;  2W48 A;  5D5U B;  4CCK A;  2LNB A;  2HOE A;  5DS9 A;  2CS3 A;  4HLY A;  4YFN F;  1YLF A;  1ZN2 A;  3JRB A;  2KKO A;  2MAB A;  2KIQ A;  2DJI A;  4BQA A;  1H9T A;  1P4X A;  3K70 C;  5TRD A;  2W25 A;  3A0B C;  2BGC A;  4BS9 A;  3FDY A;  1V5F A;  3L7W A;  4GO1 A;  4KMU X;  4XOR A;  4U0W A;  1FOX A;  2L4M A;  1ZQ3 P;  1F9N A;  1RNL A;  1GDT A;  1X3W B;  1OKR A;  2R93 J;  3ZQC A;  1N78 A;  2DT7 B;  1I6X A;  4CA0 A;  3OL3 A;  1SFK A;  3DV8 A;  2FXA A;  2WY7 Q;  3BT9 A;  3ZMD A;  2D2W A;  1WGX A;  3CDL A;  3WTS C;  1AWC A;  1U5T C;  1SD5 A;  1LDD A;  1W5S A;  1BJZ A;  3HUG B;  3VYT B;  2A07 F;  3JCU C;  5F27 A;  2F48 A;  3S1N J;  1RKW A;  2D1H A;  1BR1 A;  1R6R A;  3P9K A;  1ZRD A;  2VI6 A;  2HDD A;  2QKM B;  3ULQ B;  4Q4Z F;  4Y13 A;  4B44 A;  2L2O A;  4I99 C;  3PNV A;  3PL8 A;  4XKC A;  1FOW A;  3CJQ B;  2W4S A;  5ICF A;  4CYD A;  3L2C A;  2QQ9 A;  1Z6R A;  4V2F A;  4XRM A;  4AVP A;  1D0X A;  2FUG 2;  3P7N A;  2CFX A;  5C44 J;  1HOM A;  2K85 A;  2HXO A;  3IHU A;  3GTQ J;  4BE0 A;  1IW7 F;  1LB2 A;  2E7W A;  2CJJ A;  1OCZ H;  2DTZ A;  5K5O A;  1CF7 A;  2JA5 J;  4JP0 A;  1UST A;  2D1V A;  4HBL A;  3J7A O;  4Y7N J;  4HQM A;  1RES A;  2JVH A;  3QAH A;  4W97 A;  3S1M J;  5BQT A;  1YRN A;  4JX5 A;  2A6H F;  3R0J A;  4M9S A;  2Q2E A;  2DK8 A;  1IDY A;  2GIZ A;  2OF7 A;  4XLC A;  1BOA A;  2H94 A;  3DKY A;  3EET A;  3TP3 A;  5EG0 B;  4DQ2 A;  5DEQ A;  1XSV A;  2WB1 A;  1ZGJ A;  3OL4 A;  4FTH A;  2KIS A;  1RZ4 A;  4ANJ A;  2IPQ X;  2OTJ I;  2Y9Y A;  3IH4 A;  3F72 A;  4XSZ F;  1WJD A;  3CLQ A;  1EH6 A;  4YEL A;  3BJ6 A;  3ZQG A;  3N97 A;  5DUK A;  2JUG A;  3E6M A;  2Y0S A;  3NEU A;  5GAE J;  3OYN A;  5HOD A;  1VQO I;  1I27 A;  1BW6 A;  2UZK A;  4BY7 J;  1MH4 A;  3DXJ F;  4XLP F;  2O8X A;  4AYB N;  2PJP A;  3HOX J;  3E1S A;  2QM3 A;  1UHS A;  1FIP A;  3IKT A;  4DGW B;  4LK0 F;  2EFN A;  3LSH A;  2CMP A;  5DV5 A;  4KMF A;  3FXJ A;  3BR3 A;  1QVT A;  2HOA A;  1KU3 A;  1YS6 A;  3K4L A;  3IV5 A;  3E6B A;  1XDS A;  1MMS A;  4BEH A;  1YTY A;  4CYC A;  1WRJ A;  1KU7 A;  2K9S A;  5GPC A;  2MD0 A;  3LA2 A;  3D5S C;  2L9R A;  2LY2 A;  3G4S I;  3F8N A;  1FIA A;  2VKE A;  4JX6 A;  2P0W A;  2X9D A;  5IYD J;  4DNC A;  2VBZ A;  3QP6 A;  4HA8 A;  1XX5 A;  2NOG A;  5CVV A;  3OOU A;  4Y3O A;  4PFP A;  2DTR A;  1FSE A;  3KPH A;  4KUM A;  4QIW N;  2VOO A;  3SYT A;  3BR5 A;  2B63 J;  1SAU A;  3CCL I;  4PFO A;  5KHD A;  3CD6 I;  1FYM A;  3GW2 A;  4XKB A;  2A69 F;  2F2E A;  3FXQ A;  4HLX A;  1J5Y A;  3HKZ A;  1QHH D;  3QPT A;  1R4M B;  1JJ6 C;  2KZV A;  3CP8 A;  2YU3 A;  2V6C A;  3DBR B;  3T0Y A;  2EFO A;  4A0Z A;  5H6Q A;  1QZE A;  2V79 A;  2PI0 A;  1WJB A;  2XSJ C;  2K86 A;  4G6D A;  1LPQ A;  2DFE A;  1MIJ A;  1IRX A;  3OYD A;  4M9Z A;  4NQW B;  3PUF A;  1E3P A;  2PMZ A;  4D5C A;  1LVA A;  2MGQ A;  1R7J A;  4PGH A;  1IF1 A;  2KRC A;  4EVI A;  5L3E A;  4NDL A;  1L0O C;  4K2E A;  3PQK A;  4ZZL A;  4L18 B;  2DMQ A;  4G6Q A;  2QEN A;  3HC7 A;  4P9F A;  5E1W A;  3EYY A;  2E1C A;  2MW8 A;  1ON1 A;  1UEL B;  2X85 A;  3HRU A;  2ZJ2 A;  4CZZ A;  4EGZ A;  4LGW A;  3U1K A;  2A61 A;  1J2X A;  2W24 A;  2P5V A;  2Z2S B;  2OCE A;  3KEQ A;  1TWF J;  1QGP A;  1IZ1 A;  2JPB A;  1MMN A;  1MNM C;  2LKP A;  5K1Y A;  2X1E A;  3HOS A;  1UB9 A;  4MHG A;  2BXZ A;  3CME I;  5FRO A;  3ZQH A;  2DK5 A;  5BOX A;  2XRL A;  3CTA A;  2R7S A;  5HNH A;  1YIJ I;  1Z3Y A;  2E7X A;  1DUX C;  3BTC A;  1MZB A;  3FKI J;  2EIK H;  4OMY A;  1JKQ C;  1I6H J;  5DCF A;  4UUS B;  4WWC A;  2Z5U A;  1L3L A;  1DGR M;  2QKL B;  4MTD A;  1IAW A;  3E5U A;  4YFK F;  2LD5 A;  3CMM A;  2P6S A;  4HNT A;  2DMN A;  1KYZ A;  2A05 A;  2L4A A;  2DPD A;  4A6D A;  1HLV A;  4RS8 A;  2A68 F;  2R5Y A;  2UXN A;  3BTI A;  2EV6 A;  2ZXH A;  1WSU A;  4I76 A;  4EM0 B;  4HG2 A;  1V4R A;  3R61 A;  4RAG A;  2XUB A;  5FD6 A;  5L3G A;  3J7A Y;  5CLS A;  4AYB A;  1ZAR A;  4CHU A;  2GXA A;  4YII A;  3HOY J;  5E3M A;  2M4K A;  2ZO4 A;  4H0E A;  1RPW A;  3CUQ A;  4FCY A;  2F4O B;  3WG7 H;  4AID A;  2JA2 A;  3M3Y J;  3WGI A;  1D0Y A;  1U2W A;  1QPI A;  5K7F A;  1SFX A;  2CSO A;  4L5J A;  4LIU A;  3IL2 A;  4S0H B;  2OZ6 A;  5M5X J;  1R9T J;  3PO2 J;  3NRV A;  5K5R A;  2Z9O A;  2DAO A;  4PGG A;  2WAQ N;  1SAX A;  2CQ7 A;  2H27 A;  1MBJ A;  2QEX I;  3TO9 A;  3I56 I;  2AXL A;  1BW5 A;  3D0S A;  1T39 A;  2VXD A;  3R4K A;  1LFP A;  1BIB A;  2JRM A;  2JQ7 A;  4NBQ A;  1PUF A;  5ICG A;  2E60 A;  4AVZ A;  2VL8 A;  3BOQ A;  4B1R A;  4N0B A;  1HA8 A;  2L0K A;  4U7D A;  2CFO A;  3F6V A;  3ZMT A;  1K7A A;  1TBX A;  2EB7 A;  5HNF A;  2HS5 A;  2RV8 A;  1JE8 A;  2QWW A;  5K7H A;  1IN6 A;  1OCC H;  2JUC A;  2VQL A;  1UAA A;  5FGM A;  2NS0 A;  1MBK A;  2ME0 A;  2JZY A;  2R5Z A;  4BAC A;  1PJR A;  3ABL H;  5DCM A;  4Z2Y A;  1HW2 A;  4IHX A;  4RLQ A;  3TBI A;  4QWQ A;  5KCM A;  4RBO A;  1XSD A;  3BP8 A;  1E2X A;  3J81 K;  3VFZ A;  5EF6 A;  3OYL A;  4XQF A;  5JVT A;  1T33 A;  1T0F C;  3FXU A;  5IOY A;  4MQ9 F;  1Q1V A;  2BBY A;  4Y52 J;  2W1O A;  4XKV A;  2G0E A;  3RQ4 A;  2Y2Z A;  4UHT A;  3ZMZ A;  4HZF A;  3C7J A;  1P92 A;  1I3Q J;  1I39 A;  2VOP A;  3SEQ A;  2E71 A;  2DMU A;  2IGK A;  3VOE A;  3T1B A;  1BR2 A;  4F92 B;  1MNE A;  4ESB A;  4YIF A;  2VBW A;  3K4K A;  1BR4 A;  2QGU A;  5EGO A;  1H88 C;  2F5F A;  4OU0 A;  5HDN A;  1UMQ A;  2Y69 H;  4LJZ F;  2XGX A;  3PNT A;  1MW7 A;  5FKL A;  2ZC2 A;  2O8K A;  4KJZ A;  1MND A;  2HXI A;  3FIS A;  4B8X A;  2VT2 A;  2JA7 J;  3MD2 A;  3PUB A;  3DKX A;  3LA3 A;  1R00 A;  2PQ8 A;  2VE8 A;  3BR1 A;  2XPU A;  5FRM A;  1YW8 A;  3MKL A;  2NVX J;  2XAJ A;  3SZP A;  3MMY B;  4HST A;  3VSL A;  2HVS A;  1T98 A;  3GZN B;  2KDZ A;  2HVR A;  1PP8 F;  1S6L A;  3GEZ A;  2AXT C;  5E3N A;  2VKD A;  3TOA A;  5DM6 F;  1IRZ A;  3JSO A;  3EPZ A;  2VJJ A;  2FMY A;  3GFL A;  1KYW A;  3BC8 A;  2V26 A;  3DU6 A;  1W36 C;  4ENJ A;  3WE2 A;  1EKE A;  4ZC3 A;  2FNA A;  1E0E A;  3W2V A;  2M2E A;  1ON2 A;  1DPR A;  4LIV A;  4D1Q A;  1YW9 A;  1OYI A;  2DOA A;  4HQE A;  1VQ6 I;  2YX4 A;  4KIC A;  5JLX A;  1Y8Q B;  3AFH A;  4IHY A;  1ZHF A;  2RVC A;  5J8C A;  4KN4 X;  2P7C B;  1K6Y A;  4XOP A;  4OIR F;  2MLK A;  1WI9 A;  3L2Q A;  1A6Q A;  3KZY A;  5IOZ A;  1OPC A;  5EEA A;  2LRD A;  4LB6 B;  2W84 A;  5FFX A;  2WAQ A;  3BPV A;  4PJL A;  2E35 A;  3DTK A;  1YJ9 I;  4M6Y A;  3AKZ A;  5HOO A;  4IHS A;  2HGC A;  1S3J A;  2HQA A;  2DFH A;  3HPH A;  2ECB A;  2ACJ A;  1TT5 B;  2LG4 A;  3DU5 A;  2HTJ A;  5LHG A;  3DPL C;  4PUS A;  4B3X A;  2BW3 A;  3OYI A;  2R7X A;  1AOY A;  2AO9 A;  2MA3 A;  4OIQ F;  3CCV I;  1ZYR F;  2XHK A;  2M34 A;  3A4C A;  4RLF A;  4IHW A;  3CC2 I;  3ZGK A;  3W3C A;  1FEX A;  2IGO A;  2ZXW H;  2LC2 A;  2HYF A;  3FHZ A;  2OZU A;  3KZZ A;  2DFI A;  4E7Z A;  1LVK A;  2ZJQ F;  2D45 A;  1H0M A;  4IRG A;  3Q3S A;  3OSF A;  1QPM A;  3DTI A;  1YOV B;  3L2W A;  3VWB A;  2ZNZ A;  2HR3 A;  4LG0 A;  4DYQ A;  3CZ6 A;  1R4N B;  3HSE A;  2B9S A;  2E1M C;  1UJ8 A;  2COM A;  1OR7 C;  3HGY A;  4OMZ A;  4BDY A;  3IWZ A;  2R7O A;  3VEP A;  5ILU A;  4BYY A;  2CU7 A;  2VKH A;  1QVU A;  1WVR A;  2DLL A;  2OA4 A;  3ONQ A;  1JUP A;  4X0G A;  4L9N A;  5FD5 A;  4BJT A;  4TV7 A;  1BL0 A;  3F3X A;  1T6S A;  2RNJ A;  3CCS I;  2LY9 A;  2OV7 A;  3ZQ7 A;  1R1U A;  5M3M J;  4II3 A;  2X51 A;  4D0P A;  3KYL A;  5FB2 A;  2HKO A;  3E6C C;  2BVM A;  2ZJP F;  3K2A A;  3HHH A;  2B0L A;  2JA8 J;  3W6K B;  4M3F A;  2OUM A;  4OIP F;  3HTU A;  3A1Y A;  3I54 A;  3I64 A;  1IN4 A;  4KIF A;  3SJM A;  3M8F A;  4DJA A;  3LOC A;  2ZFU A;  2KDO A;  3GTL J;  4HX4 A;  1AKH B;  1B4A A;  3SFI A;  2V4J C;  4ZYA A;  1LQ1 A;  2DA3 A;  1WJ5 A;  4UV8 A;  4EEF G;  3F8F A;  2K27 A;  4F55 A;  2XAG A;  4PJ0 C;  3TW7 A;  2GAU A;  1K78 A;  3GCM A;  3GWZ A;  2BHZ A;  3F8M A;  5HLI A;  3E5Q A;  3PSF A;  4OAY A;  4L9J A;  3ZQF A;  3I59 A;  1FMW A;  4IXA A;  5LGU A;  5K7Z A;  2EJR A;  3RTR A;  2MH9 A;  2BY2 A;  1B59 A;  2MC3 A;  5F64 A;  5H6R A;  4E4H A;  1BM9 A;  5KAF C;  1XGO A;  3GUD A;  2CO5 A;  4IEJ A;  2W7N A;  2IJL A;  2F4M B;  1U8R A;  1OJL A;  2LY1 A;  2LKS A;  4G94 A;  4DYC A;  3S2D J;  5A2Q K;  1GLN A;  3K1N A;  1UFM A;  1WQ2 A;  3C3W A;  1A36 A;  1HST A;  2CQN A;  3REO A;  2L7K A;  1DDN A;  5LRR A;  3PIP F;  4WXD A;  1FZP B;  2X4H A;  2IS1 A;  1FNN A;  1USS A;  5CJ9 A;  3LAP A;  4BHB A;  1X4O A;  4UVA A;  2XSD C;  4MEX F;  3PQJ A;  3TGN A;  2A6E F;  1LDK B;  3OYC A;  2KL4 A;  3OYF A;  2PFB A;  4A93 J;  2MC4 A;  5HLG A;  2M3A A;  3BG6 A;  5E3O A;  4UV9 A;  3EUA A;  3S93 A;  4U87 A;  2PJR A;  1O4X A;  1FX7 A;  3BG3 A;  2E1N A;  3GYH X;  2HOT A;  1LE8 A;  3QU3 A;  1HF0 A;  2BOL A;  2J5O A;  4QSH A;  1JTY A;  4L9V A;  2OTL I;  3CJR B;  3KLN A;  3Q0U A;  1WJF A;  4UUT A;  5AIP A;  2FOK A;  1A31 A;  3LSI A;  4ZDO A;  2DN0 A;  5BS6 A;  1B72 B;  2JA6 J;  1CQT A;  3CDI A;  3E97 A;  4NC7 A;  2CW8 A;  1XCB A;  4XLF A;  4XIC A;  1LFU P;  4IZZ A;  1R1T A;  3HIF A;  1H8A C;  3K4B A;  2ESN A;  4KNY A;  1XGM A;  1YYV A;  1QQI A;  2MSY A;  1MSE C;  2FJ1 A;  2K9Q A;  1RC9 A;  2Q0O A;  1QNT A;  1JHH A;  2G9W A;  4ETS A;  3E0J B;  4XON A;  3LSK A;  4EAT A;  3LQR A;  1P9Q C;  1PP7 U;  1HCR A;  1ZR4 A;  1YE9 A;  1IDZ A;  2CV0 A;  3GTJ J;  1GXQ A;  2DDB A;  5FLM J;  1IC8 A;  1IXC A;  1P6R A;  2IGM A;  1WJA A;  1MD0 A;  3OIQ A;  5GTI C;  2Z16 A;  4HX7 A;  1OCP A;  3G3Z A;  4HEA 2;  2VT3 A;  3L9F A;  1YX3 A;  4JYK A;  4WX9 A;  2CQK A;  2WAF A;  4A2U A;  3OYK A;  4II2 A;  2AQE A;  1QA6 A;  2VKV A;  1OYY A;  2KIF A;  2AQF A;  1ITY A;  5E79 C;  2X48 A;  1G4D A;  5EJC A;  1SAN A;  1D5V A;  2FF4 A;  4CGZ A;  3DEE A;  2RNG A;  1B8I B;  2DA5 A;  4L5I A;  4EJV A;  1I5Z A;  2K5C A;  4BAY A;  1R36 A;  3PFI A;  2EH3 A;  3CC4 I;  4MGR A;  1EA3 A;  4BQN A;  2BY1 A;  4A3B J;  5J6X A;  4HNU A;  1BC8 C;  4DOZ A;  4E7S A;  2M9H A;  2IS4 A;  2M8G X;  2ZME B;  1T38 A;  2DQR A;  1QBJ A;  4LLN A;  1BI1 A;  4EJT A;  2EZI A;  1TQI A;  1J7K A;  3DEW A;  3AL0 B;  4F7Z A;  3ZQL A;  1ERD A;  4LLG F;  3AG3 H;  3H5N A;  3FIW A;  4BH9 A;  1YG2 A;  2F5D A;  1J75 A;  3K4C A;  3Q9V A;  2P5K A;  4B48 A;  1TQM A;  4LB5 A;  4D7M A;  1U8B A;  3FWE A;  4JOM A;  5J8F A;  4A3C J;  2LH9 A;  3H9G A;  5GTH C;  5C4J J;  3AG2 H;  1GV5 A;  1WWX A;  2KHM A;  1R49 A;  3R60 A;  3V8L A;  1XGS A;  1Z77 A;  3WG9 A;  2RQQ A;  4NC8 A;  4D7N A;  4PCQ A;  1VND A;  3HL2 A;  2X6Y A;  3H35 A;  5BNG A;  1YI2 I;  2TRT A;  2Y31 A;  3GTG J;  2NNN A;  2QQB A;  3J80 K;  1XC5 A;  3ZR8 X;  3JTG A;  1VQP I;  2DT5 A;  2KJB A;  2DMP A;  1DGW Y;  4RGU A;  3AG4 H;  1QO0 D;  2DA4 A;  3OR2 C;  2BY3 A;  2HYJ A;  2QBY A;  1VFC A;  2L7M P;  3SDB A;  5LGT A;  5HLH A;  5IPA A;  2DO7 A;  3WU0 A;  1DP7 P;  4F91 B;  1WH5 A;  5KK1 A;  5JI6 A;  2E1O A;  5J4Y A;  4CCL A;  5L3B A;  1VQM I;  1U5T B;  4O6J A;  3CCM I;  1X2M A;  2HVQ A;  3JRG A;  2M7B A;  3TMO A;  4MFE A;  1RIO H;  3QOP A;  5IT9 K;  4BQQ A;  5L3C A;  2HPM A;  3C18 A;  2JK3 A;  2UUZ A;  2QQA A;  2VJ5 A;  4Z6Y A;  1V55 H;  2O7O A;  1RUO A;  3S1Q J;  1LKX A;  4M3B A;  2KPM A;  3QYE A;  1HBX G;  2IGN A;  3CDH A;  3WHC A;  3SXY A;  3G71 I;  3JRF A;  3S3M A;  1S8N A;  2HNH A;  5H20 A;  1DU0 A;  1BA5 A;  1TW3 A;  2LSO A;  1GVJ A;  2XPV A;  4W1U A;  1FPQ A;  2EIJ H;  4OWR B;  3V4G A;  2EIM H;  1Y56 A;  1HW5 A;  3I71 A;  5FKO A;  4RMN A;  1TNS A;  5IP7 J;  4C2T A;  4EMS A;  2H1L A;  3FBI B;  3L2V A;  1SC7 A;  1SFO J;  4HX8 A;  3RPU A;  3JRC A;  1W0T A;  2CUZ A;  3S3O A;  2KZG A;  2O61 A;  2WWY A;  3GFI A;  2W57 A;  2LR8 A;  1B6A A;  3ASO H;  3E3V A;  3EQL F;  3LL7 A;  4AC0 A;  4FHT A;  1Y8R B;  3KET A;  1NK3 P;  3BJA A;  1S9H A;  2HPI A;  1WPK A;  1G6N A;  3WTT C;  3M07 A;  5E1X A;  2HZD A;  1I1S A;  1JTX A;  1U9N A;  3QWL A;  4PSX A;  3HJE A;  2TCT A;  2ADU A;  2M8E A;  4I0A A;  4RGR A;  2XF5 A;  3OR1 C;  2XC7 A;  2L9N A;  2CUF A;  2ZB9 A;  5A2Q Z;  1N77 A;  2ZXI A;  1XMK A;  1Z6T A;  4M74 A;  1X1D A;  1HKT A;  5ICE A;  2I5U A;  3GLL A;  3ZOB A;  4RAZ A;  2L3D A;  3BLY A;  3QRF F;  1YIT I;  4ZDL A;  1YQA A;  2LBF B;  3H0G J;  1E17 A;  3V8J A;  5IP6 A;  1VQK I;  4A69 C;  3JR9 A;  3O8G A;  3IH3 A;  2NVU B;  4ZDP A;  5HS8 A;  3HDD A;  3CMA I;  3CCJ I;  4IRH A;  4PDK A;  4XL9 A;  4WK8 F;  3OYA A;  3RPU D;  2LF7 A;  5F08 A;  4Y15 A;  4ITV A;  4NNJ A;  3V42 A;  2R7W A;  2ELJ A;  1P7J A;  4GRI A;  3M8J A;  5EEH A;  4P9U A;  1Z7U A;  1S72 I;  4MEY F;  1F4K A;  1TTY A;  4HYE A;  1C0W A;  3ESW B;  1BJA A;  1V3F A;  1HXD A;  2VQC A;  5FRN A;  2B7E A;  2LYC A;  2GBY A;  1UZC A;  2MH2 A;  1K4S A;  1WJE A;  3U2R A;  4HPQ A;  1D1B A;  2O9L A;  4Q5S F;  3OOP A;  4R1H A;  3KCC A;  2FBI A;  1ETQ A;  3BG7 A;  4Y33 A;  3G1L A;  2M0M A;  2RC4 A;  1RI7 A;  1TC3 C;  2DPU A;  4HF2 A;  3RCO A;  1OMI A;  1WJC A;  3CMY A;  4EM2 A;  2LMD A;  1MJB A;  4E70 A;  1REP C;  1SEU A;  1K61 A;  2V9K A;  2K9L A;  2HTS A;  1MDM A;  2JWT A;  1OCT C;  3S15 J;  4EM1 A;  1NK2 P;  2R3S A;  5L3D A;  2NAZ A;  3SEZ A;  1OYW A;  4AIK A;  4IOC F;  2K3P A;  3OYG A;  2N8G A;  4QLC U;  3HZJ A;  5GAD J;  2BEO A;  2R7T A;  2DOD A;  1J09 A;  2A3S A;  3V7S A;  1KA8 A;  1IV6 A;  1TWA J;  4J00 A;  3W6J B;  1RR8 C;  4M6V A;  2E19 A;  4X6A J;  2X0L A;  2VN2 A;  5ILV A;  5HLT A;  3TDZ C;  5FLX Z;  3EDP A;  1GUU A;  1LNW A;  3ERM A;  4KN7 X;  4BJ5 C;  1EH8 A;  3A01 A;  3D5L A;  2XB0 X;  3KZI C;  2XAS A;  4I6Z A;  4S05 A;  2M45 A;  3CP2 A;  3SZT A;  2OJE D;  4ZYD A;  2ID6 A;  1JUS A;  3QYF A;  4XOT A;  3KEO A;  1X58 A;  4ZZD A;  3HB9 A;  1XMA A;  1U6G A;  2LLK A;  3DBL B;  4KFC A;  3RYP A;  2ID3 A;  1O3S A;  1OFC X;  1YJW I;  1OCO H;  2NNY A;  2HOS A;  1O3T A;  1JJ8 C;  4UB6 C;  1SFU A;  3FXL A;  4FQG A;  2FRH A;  3NAR A;  1X1P A;  3WE3 A;  1OCR H;  1MGT A;  3F6O A;  3GZ6 A;  2R0Q C;  2X6X A;  3T8R A;  4WF2 A;  3DF8 A;  2LFB A;  1NH3 A;  2F5E A;  3E7L A;  2YX7 A;  4ZH4 F;  1ZH5 A;  2ZBK A;  3WTW C;  4XBF A;  1F5T A;  3ML6 A;  3H1C A;  2XF7 A;  3FXK A;  3OSG A;  1I3A A;  3ZN1 A;  2R92 J;  2JN6 A;  2HQN A;  1RR7 A;  2VQH A;  3O6B B;  3D1N I;  2YUS A;  2JSC A;  4Y4R A;  1A35 A;  3S17 J;  2Y9Z A;  3J80 Z;  1E3H A;  2PMH A;  1V5E A;  1BIA A;  2EIL H;  3ZPL A;  3IAM 2;  5F0C A;  4E7K A;  2IP2 A;  1UG0 A;  1MJ9 A;  3S32 A;  3I55 I;  1XGN A;  2VPR A;  2FBK A;  4A5N A;  1Z0X A;  5J40 A;  1R71 A;  2CW7 A;  3L00 A;  3ZMS A;  3C1D A;  3MFK A;  3DCF A;  4CIC A;  1HSJ A;  2KRH A;  2FNP A;  4BBR J;  2EZK A;  5TIS C;  2DMT A;  4F52 A;  1CF7 B;  3G73 A;  1X1B A;  1QHG A;  1QU3 A;  3TDU C;  2VLA A;  1YRN B;  2Z3Y A;  5IT9 Z;  3BZ6 A;  3WU2 C;  4U7B A;  2Q2E B;  3K6G A;  3NWT A;  4PJJ A;  2JRT A;  3CES A;  4RGX A;  4XK4 A;  3KFW X;  5LLQ A;  1P4A A;  2ZFW A;  4I0B A;  2E5N A;  2HKX A;  2RDP A;  1IG7 A;  2P8T A;  3U21 A;  4CCM A;  2V7F A;  2NVY J;  3QPL A;  3SQN A;  1B8I A;  3MKW B;  4FE4 A;  4AU7 A;  3JAM Z;  3BTJ A;  2JMW A;  1XMX A;  5FFZ A;  3RQI A;  3MKZ A;  2CH0 A;  3K4J A;  6PAX A;  3HG9 A;  2L54 A;  4UXN A;  1TZL A;  1R5H A;  4BJ6 C;  5E8G A;  1W7P B;  2RKH A;  4N4N B;  4HF1 A;  4KA4 A;  4KYW A;  4OIN F;  2L9S A;  1WCM J;  1RKT A;  3HUG A;  3SFZ A;  1BN5 A;  4HOB A;  1I50 J;  1BOB A;  5LBQ A;  2OC6 A;  1IRG A;  3FBN B;  5ED4 A;  2E2I J;  1R5G A;  5B1A H;  3QOD A;  2HEO A;  3KP7 A;  2A6T A;  4IF4 A;  3MKY B;  4AUX A;  4D5F A;  2DT6 A;  4BEH B;  1SFE A;  4P5O A;  3LNQ A;  4BXX J;  1KON A;  2XAF A;  2GLO A;  1PVE A;  3ZMU A;  3BR6 A;  3PIO F;  4LD5 A;  3ZCO A;  5EDN A;  4BE1 A;  4G12 A;  4ZTJ A;  1VQ4 I;  5E18 F;  4PJM A;  1ULY A;  3LWF A;  3HRS A;  4BBS J;  1ZGW A;  1XN7 A;  1FYK A;  1Z3X A;  4KIS A;  1D1A A;  2V1D A;  4Y17 A;  3FX3 A;  2YS9 A;  3L2U A;  2OU2 A;  3V8K A;  1O3Q A;  1E3O C;  1Z21 A;  5D8L B;  2KLO A;  1SVL A;  3FHN A;  3I4N J;  1FC3 A;  1VQ9 I;  4IRI A;  3OYH A;  1YX5 A;  5D6F A;  3OWT A;  4JX4 A;  5EG0 A;  3I3L A;  2VBY A;  1SMY F;  3LSP A;  1W5T A;  1B9M A;  2FX0 A;  2NYX A;  3QPS A;  2JJ7 A;  4JBA A;  5DD4 A;  2PG4 A;  2Z1D A;  4M72 A;  4M3G A;  2DJN A;  3UNG C;  5JHF A;  1HQC A;  5BMZ A;  5FJ8 J;  5E17 F;  4B4C A;  1FTT A;  1O7F A;  1Z7L A;  2F5V A;  1U5T A;  3BQZ A;  3F21 A;  1W0U A;  4CCO A;  1ZK8 A;  1O3R A;  2GOX B;  4KT6 A;  1D8J A;  4MIM A;  1ODD A;  1FP2 A;  4BXF A;  2BZT A;  2P5L C;  3J7Y J;  3CUQ C;  4YIR X;  3CC7 I;  3F23 A;  4XNF A;  1GT0 C;  4J01 A;  2DFF A;  2LVS A;  4M9X A;  4RAY A;  5HDK A;  1W1W E;  3RDI A;  3L1P A;  1Z9C A;  2DA6 A;  4G7H F;  4CXF A;  3FF5 A;  3R0A A;  1TWG J;  3CF2 A;  5HVQ C;  4E6K G;  4UY8 I;  2H6C A;  2PX9 A;  2XVC A;  3TO7 A;  5LD2 C;  3BJO A;  2GOM A;  3WTV C;  4D9J A;  3LST A;  4ASN A;  5F0H A;  3OS0 A;  4C3H J;  1WFX A;  2OQG A;  3MZY A;  3Q0W A;  1FLI A;  1X1C A;  1MMD A;  5D4R A;  1ZRC A;  3HOV J;  3IUO A;  2TDX A;  2X1D A;  4A3F J;  1WHU A;  3KP4 A;  4PJN A;  4IVN A;  2K3F A;  4GGG A;  3HHG A;  1G59 A;  3RPQ A;  2WY8 Q;  1DP3 A;  1MMA A;  1UHM A;  3H5A A;  1Y1W J;  5HS7 A;  3ERE D;  3DFG A;  1KQ9 A;  3BR0 A;  2KIM A;  1KQ0 A;  2DOE A;  5J1U A;  3HOU J;  3G2B A;  2R5Y B;  3KP2 A;  1Y1V J;  2UV1 A;  4ESF A;  2R7Z J;  2IW5 A;  2VJI A;  2M1B A;  5E3L A;  2R7V A;  3VYU B;  4A6E A;  3R6S A;  4DW6 A;  3N4M A;  1ZR2 A;  3ZP5 A;  2L5Q A;  1PUE E;  1ZAO A;  2E1M B;  2WAE A;  4NQW A;  2CYY A;  4EV0 A;  5H2F C;  3HM5 A;  2XGD A;  2NOJ B;  3CUQ B;  3P9C A;  5BPD A;  5IT3 A;  4E7L A;  5E1Z B;  2ICW G;  2CWE A;  2LBF A;  3HXL A;  3TO6 A;  5F6F A;  1JI8 A;  2JT1 A;  4IPA A;  3RI4 A;  3BZC A;  1X3U A;  2XPW A;  2PMU A;  1U9O A;  2KT0 A;  2VC1 A;  2FML A;  3VPR A;  3ZQI A;  4IKF A;  3KP3 A;  4MFD A;  3S16 J;  3S8P A;  3CCY A;  2I8D A;  2GIV A;  2BXY A;  3RKQ A;  3BPX A;  1ZRE A;  5L3F A;  1XDU A;  2G7U A;  4BUP A;  4ON0 A;  1PUF B;  1ETW A;  1ZEL A;  3HOZ J;  1MH3 A;  3FZV A;  5D5X B;  5M3F J;  2VPL A;  1YHQ I;  2HU9 A;  1YS7 A;  1XS9 A;  4MQV A;  2EPF A;  1P2F A;  1HC8 A;  2BV6 A;  3I58 A;  1IV8 A;  2EZH A;  2CV1 A;  2GXB A;  1JXS A;  1STZ A;  2XRO A;  4R79 A;  2MBF A;  1RUN A;  3OIP A;  4UUS A;  2M30 A;  3GVA A;  2Y0M A;  4XR6 A;  1FP1 D;  2M4G A;  1ENH A;  2O5R A;  3BCB A;  3N05 A;  4CCJ A;  2IT0 A;  2YU9 J;  3LA7 A;  3COA C;  3KP5 A;  1N75 A;  1JGG A;  1DU6 A;  3AAF A;  1TP4 A;  2H6B A;  2R5Z B;  1HDD C;  5DCM B;  4LIT A;  4CUG A;  3FXO A;  5TJJ A;  1TT0 A;  5ICC A;  5DTD A;  2EFW A;  4EJW A;  5DDG A;  2ZSI B;  3IKV A;  3DEU A;  4V2G A;  1HKS A;  1ONV A;  4A3D J;  2EA4 A;  4XM3 A;  2WV0 A;  4IQJ A;  2DDA A;  4I2O A;  4HV6 A;  4OAZ A;  5KNL A;  4A12 A;  4QTR A;  1JUM A;  3HSR A;  4HW0 A;  3UKG A;  5K5Q A;  2KRF A;  2DA1 A;  3U1D A;  3F0C A;  4DBQ A;  2ZXJ A;  2YR2 A;  1IN7 A;  2FQ4 A;  2ME6 A;  3IWF A;  1X2N A;  3LQQ A;  1WKM A;  4GDF A;  1BI0 A;  5CVU A;  3DTE A;  1HKQ A;  4XRS A;  3FXM A;  1MMG A;  2V1N A;  4LMY A;  4A3L J;  2AS5 F;  4L9T A;  2DU9 A;  1UG2 A;  3O3K A;  1R22 A;  5EGO B;  3K9T A;  2GA1 A;  2DYS H;  2KIU A;  3F9K A;  1G2H A;  4WXH A;  2L9V A;  1ZGA A;  1VQ5 I;  3T8T A;  4HRI A;  2IS6 A;  5FLX K;  5FKM A;  5M5W J;  1YO5 C;  2VAS A;  3LMM A;  4YFX F;  4C9Y A;  4IHT A;  1UCR A;  3WGG A;  2LRE A;  1IXS B;  3QOE A;  1JT6 A;  4X1E A;  4HNV A;  2CG4 A;  5CVR A;  4CSW A;  2NRA C;  4ENK A;  1K6O A;  3H3Z A;  2ISY A;  3RJP A;  1N25 A;  3DKW A;  3RKY A;  2ISZ A;  4C3I J;  2ETH A;  1FT9 A;  3K1M A;  1U3E M;  2R7U A;  1BBY A;  2LP0 A;  3BY6 A;  4BHP A;  2X6W A;  5HS9 A;  3FK6 A;  4N4O B;  3FMQ A;  3L09 A;  3U9G A;  3HKZ N;  4DYR A;  4AM3 A;  3ZMV A;  4QPO A;  2FQ3 A;  3M9A A;  2L7F P;  4FX4 A;  3KE2 A;  3B02 A;  3K69 A;  3GLX A;  2XDV A;  4C2M J;  1DPU A;  3VOD A;  2O03 A;  3F8B A;  3CUO A;  2EWN A;  2FOW A;  2ZSH B;  5B5E C;  3X2Q H;  3A0H C;  3ISP A;  2CQX A;  4LG3 A;  2FD5 A;  1R23 A;  1V5G A;  2PMZ N;  3HSF A;  4BXU A;  1TW2 A;  3EUH A;  4HF0 A;  1Q1H A;  4XLA A;  5F1J A;  4MO7 A;  3P9I A;  5KAI C;  4A3K J;  3LAJ A;  3GTO J;  3C2G A;  3H9Q A;  3BG9 A;  4EJU A;  4LK1 F;  5IYB J;  2LDU A;  4CZC A;  2EQR A;  1OIS A;  4HAM A;  1FBU A;  2JTV A;  2XAU A;  3CCR I;  1KQ8 A;  2EZL A;  3LFU A;  2EV5 A;  4AD9 A;  1MBG A;  4BKX A;  3BCA A;  3HGG A;  2M87 A;  5EEG A;  4FE7 A;  5D6E A;  2NVQ J;  3M7G A;  3CO7 C;  5C4X J;  2Z33 A;  5LEJ A;  3BZK A;  4F3Q A;  3GXO A;  2Y30 A;  2BW3 B;  4XRF A;  1FBQ A;  4MTE A;  2XKO A;  1AA7 A;  3HPG A;  2DQL A;  4RM3 A;  3GF2 A;  4XSX F;  4B47 A;  1FMV A;  1F43 A;  4PSW A;  4CH7 A;  1O7L A;  1FWZ A;  5JHU A;  2QSH X;  4YRV A;  3D5R C;  4A0X A;  3WOD F;  2LOO A;  2IVM A;  4M3E A;  3RIR A;  1ORK A;  3TOB A;  4E7H A;  2K40 A;  1W4M A;  2FSW A;  3A02 A;  1U0J A;  4XLE A;  5TGT A;  2OD5 A;  3O2P E;  3H9J A;  5DD8 A;  4M73 A;  5D5V B;  3G1M A;  4LG0 B;  3TKY A;  5D8K B;  2IXS A;  1MJA A;  3ZXS A;  1W7P A;  4RB1 A;  2OBP A;  3JAM K;  2E34 A;  1V54 H;  2CUE A;  1J9I A;  1T0F A;  3S14 J;  4RGS A;  2V9P A;  2BHY A;  1KZH A;  3JSP A;  1VQ7 I;  4O5V A;  1O57 A;  2E2H J;  2JSP A;  4LLL A;  3OIO A;  3PFY A;  3JRD A;  2XGE A;  5IYC J;  1W5C C;  1Y6I A;  3MCZ A;  3KX2 A;  3CLO A;  4DZJ A;  3H5R A;  1RET A;  3K4N A;  1NHA A;  2QF7 A;  2RQP A;  1TWC J;  2RN7 A;  1G3W A;  3BQY A;  4I7H A;  3DPT A;  4M3D A;  2EIN H;  1FOK A;  1EF4 A;  2OQR A;  4KT5 C;  3QPH A;  5FO5 A;  3B73 A;  5B1B H;  1K83 J;  2LF8 A;  1FYL A;  1R58 A;  2F5C A;  3GZ5 A;  4C2U A;  2J5P A;  2VIX A;  2O0Y A;  2D5V A;  3JRH A;  1D0Z A;  3W2W A;  3I5U A;  4IJA A;  1K4T A;  1U78 A;  1T08 B;  4QPQ A;  3FXR A;  3IRR A;  3K10 A;  3WHB A;  2ZCW A;  3BWG A;  2K4J A;  5FKK A;  2GZW A;  2YSR A;  5ILS A;  5BPI A;  3M1E A;  4EQQ A;  1KGS A;  2XF6 A;  4I01 A;  4XID A;  4UUV A;  1D5Y A;  3PNY A;  4M6X A;  1T95 A;  3CJT B;  4G8X A;  1K79 A;  4G6T B;  5J1Y A;  5EZG A;  1K78 B;  2XGC A;  1R1V A;  3ZQQ A;  1GXP A;  3G6E I;  3PJR A;  1W7P D;  2IAI A;  2QVO A;  3I59 B;  4JK1 X;  4E7J A;  4A3M J;  1YFH A;  1ZG5 A;  3J7Z I;  2NS7 A;  5JR3 A;  2IEK A;  2Y75 A;  2PLY A;  4ZJZ A;  3K7A J;  5B66 C;  2FU4 A;  4HSR A;  1XD7 A;  4GFB A;  2EFQ A;  1J59 A;  3TP0 A;  2W00 A;  3S2H J;  3SZG A;  1IRF A;  2VC0 A;  3VDX A;  3GBG A;  4IOA F;  3RSN A;  2FA5 A;  2BYV E;  2VQG A;  5CQE A;  3CCU I;  5EYR A;  3SHF A;  4WCG A;  1JGS A;  3P5J A;  4ESJ A;  4O3M A;  2PBI A;  5GAH J;  1ACI A;  5C3E J;  4NC6 A;  4NB5 A;  1XCV A;  3VSK A;  1YW7 A;  4BY1 J;  1S7E A;  4XN0 A;  4RB3 C;  2GM4 A;  4XN3 A;  2WBM A;  4CO8 A;  4WXC A;  2PJR B;  3S3N A;  1ETK A;  1OQY A;  2P6T A;  4HV5 A;  2XIG A;  1LE8 B;  1B1B A;  1X3Z B;  3RKW A;  2R7D A;  3WTY C;  2GA2 A;  3OMY A;  1IGN A;  3UR3 C;  3DLL F;  3DBH B;  1AKH A;  1D3Y A;  1XSX A;  1EJ9 A;  3K2Z A;  3RKX A;  2NVT J;  2HZT A;  4CDG A;  4GXO A;  1S7O A;  3ROU A;  2OAZ A;  1ZLK A;  2VON A;  1S29 A;  1D1C A;  1NG6 A;  1T56 A;  1Y0U A;  2CRG A;  1TQP A;  2MLG A;  3GO5 A;  4A0Y A;  4DIQ A;  4BE2 A;  4V19 K;  3K4M A;  1VTN C;  1W36 D;  3PM1 A;  1I1G A;  4A3J J;  2XKP A;  2ECC A;  5CVI A;  2ESH A;  2DI3 A;  2RAE A;  1Z91 A;  3TQN A;  4FAS D;  2FEZ A;  1LEA A;  1LFB A;  2M5W A;  3GFJ A;  5IP9 J;  3ABK H;  2VJ4 A;  3EUH C;  3B6C A;  4P96 A;  1OR7 A;  3W6V A;  3TW6 A;  1S5L C;  4RAF A;  4LFU A;  2RGV A;  3WGH A;  2FE3 A;  2WC2 A;  2K4B A;  2C6Y A;  3K1P A;  4B3A A;  2GWR A;  3H0D A;  2P4W A;  4ZYG A;  1XPX A;  4RM2 A;  2CGP A;  2IA2 A;  3SDG A;  2K9M A;  3F8C A;  2HDW A;  2QSF X;  3CJN A;  4N9I A;  3WU1 B;  4OOI A;  2STT A;  3H3V K;  2MYS A;  1POG A;  1FBS A;  3HRM A;  2KMU A;  1IN8 A;  4BL0 B;  1HW1 A;  2H8W A;  4U0V A;  4DBR A;  2E2J J;  2Z99 A;  5JLW A;  3FMR A;  2H09 A;  2HFH A;  1LUJ B;  2ELH A;  3A2K A;  1FSH A;  1MBE A;  4YG2 F;  1Z67 A;  1MBH A;  1GV2 A;  4BQO A;  5FKN A;  3OV8 A;  3IRQ A;  1YJN I;  1APL C;  1SD7 A;  3E5X A;  4L0Y B;  2L02 A;  5LGN A;  3C2B A;  4XRS G;  3B6A A;  5F1R A;  3CF5 F;  1ZKG A;  4XLN F;  5AIQ A;  4UVB A;  2CQQ A;  5EZH A;  3IH2 A;  1B72 A;  1FY7 A;  5LRS A;  4FIS A;  2V6E A;  2BVL A;  3EUK L;  2V1X A;  3M8E A;  2KP6 A;  2XV4 S;  1Y0N A;  2LK2 A;  1TWH J;  2EFP A;  1PDN C;  1DQU A;  4UVC A;  3VYS B;  2K9N A;  2GXG A;  2HQR A;  3I0T A;  1FTZ A;  4U88 A;  1JT0 A;  1CGP A;  2HDC A;  4F93 B;  2XB5 A;  2XRN A;  4BGD A;  4A3G J;  3JRA A;  4E7I A;  2ZJR F;  1F1Z A;  3DP7 A;  1VZ0 A;  3T5X A;  3Q9S A;  1VQL I;  4Q47 A;  1TLH B;  1NTC A;  4C30 A;  3LSR A;  2HQ5 A;  3GTP J;  4A5M A;  3GTM J;  3NQO A;  3PO3 J;  4BHC A;  3HEF A;  3LSG A;  5GPA A;  2ZKZ A;  2Y48 A;  2CW0 F;  5JVG F;  2WA0 A;  2QSG X;  1VQ8 I;  2R7Q A;  2I10 A;  4KDP A;  2QBY B;  3WTX C;  1SVM A;  4IO9 F;  2BY0 A;  4IQ4 A;  2IBD A;  3KLO A;  3V7R A;  4I09 A;  1H9G A;  3HYI A;  1XB4 A;  4MNU A;  3I9V 2;  4YEJ A;  2PEX A;  4OIO F;  4A3E J;  1OLT A;  2EA2 A;  3I4P A;  1D8K A;  4UB8 C;  2K02 A;  4CCN A;  3NWS A;  2QA4 I;  2WAD A;  1ETV A;  2K7L A;  3H3U A;  4IHV A;  5F04 A;  2ZME A;  3A03 A;  4M71 A;  5LHI A;  3H36 A;  2F4I A;  3WTU C;  2O6G E;  5LFA A;  3HOW J;  5LHH A;  4BDZ A;  3BR2 A;  3DPU A;  1BC7 C;  4RA2 A;  1XG1 A;  1IUF A;  1ETY A;  2VE9 A;  5J4V A;  3BDD A;  1WI3 A;  1GVD A;  5GAG J;  9ANT A;  4A3I J;  1ETO A;  5D4S A;  2UXX A;  2COB A;  4ZYE A;  3OS2 A;  3CCE I;  1MBF A;  2IA1 A;  4CYC B;  4Q48 A;  4EGY A;  2DCE A;  2E36 A;  3ELK A;  2M0C A;  1EH7 A;  1LEB A;  1G3Y A;  3KP6 A;  4P1W A;  4BNC A;  3H92 A;  2VOD A;  3QP5 A;  3MZH A;  2P81 A;  4GYG A;  3DQV C;  1IUY A;  1SD6 A;  4NHJ A;  1X4P A;  1Z05 A;  2X1C A;  2YPR A;  3DWL E;  5JFR A;  2CV2 A;  3ECH A;  3OYE A;  4C3J J;  2OCC H;  3ZRG A;  4ENN A;  3LSJ A;  2LKX A;  4FX0 A;  4N9H A;  3MQ0 A;  1NG7 A;  4FT8 A;  3KEY A;  3GME A;  1IN5 A;  1TNT A;  2MD5 A;  3MWM A;  4H4K C;  5DUI A;  4IX7 A;  1MSF C;  4MLO A;  2VUM J;  1BI3 A;  3FKJ A;  3MZ8 A;  3Q5F A;  3HRT A;  4EJO A;  2UWM A;  2WTE A;  2DBB A;  2RRE A;  2MFZ A;  1A6I A;  5J47 A;  4U0Y A;  2V1U A;  1ETX A;  1H89 C;  3BRO A;  3CCQ I;  1IO2 A;  5CVJ A;  3S2W A;  2H8R A;  2X6O A;  3PSI A;  2O3F A;  2VXZ A;  3V7C A;  3C2H A;  3LFK A;  5CQG A;  1X19 A;  3QQA A;  2IS2 A;  2L7Z A;  2KQR A;  1G3S A;  3JRE A;  3KIO A;  3EYI A;  2VB6 A;  3E6D A;  3OYB A;  3HTS B;  1ZLJ A;  2MG4 A;  1EV7 A;  2QLZ A;  4S04 A;  2R4G A;  4RB0 A;  3F22 A;  3I53 A;  1SD4 A;  2EBI A;  4HDU A;  3FK7 A;  3FM5 A;  5E20 A;  4FET A;  3MVP A;  4XMY A;  2M7A A;  3IC7 A;  3JW4 A;  1P7I A;  1P4W A;  1X1A A;  3LSM A;  4LOC A;  3K70 D;  1WH7 A;  1JKR C;  5E8I A;  3M1C A;  4G9Y A;  2IRF G;  2R7F A;  1QRY A;  2HYG D; 
#chains in the Genus database with same CATH homology
 3GX4 X;  1Z1D A;  3MEX A;  2XAH A;  3MAJ A;  4PZJ A;  2KJC A;  1MDM B;  5CYV A;  1LJ9 A;  2W85 A;  4RB2 C;  3FM3 A;  1B9N A;  3JTH A;  2DW4 A;  4L0Z B;  1MKM A;  5D5W B;  4ENM A;  5ERI A;  2Q8K A;  4I02 A;  2EK5 A;  4KIB A;  4GYI A;  1IXR C;  3HOT A;  2VBX A;  1GHC A;  3ZN0 A;  1UHW A;  5AON A;  4P55 A;  4AWX B;  3GFM A;  2G7H A;  3FMS A;  1QZY A;  4I98 B;  3ABT A;  1T2K A;  2XAQ A;  1ZG1 A;  2HWV A;  1YIO A;  2ZNY A;  2P7V B;  4B09 A;  4G7Z F;  5HDG A;  2A5Y B;  2L01 A;  1BI2 A;  2FBH A;  4G7O F;  1J0R A;  1SMT A;  1A04 A;  1LDJ A;  3WTZ A;  3RYR A;  3J81 Z;  4R8H A;  2QZ8 A;  3VB2 A;  4JQF A;  3QU6 A;  4AIJ A;  3ABU A;  2PN6 A;  2JPC A;  5KVR A;  1G3T A;  5LEK A;  1KU9 A;  5DYM A;  2GQQ A;  4AIH A;  2STW A;  2IA0 A;  4GCV A;  3CO6 C;  4ZYH A;  3ECO A;  1S7A A;  4KIG A;  4UNO A;  2V9V A;  1JHF A;  2QUF A;  1QZZ A;  2EV0 A;  2BE5 F;  1ZRF A;  3K0L A;  2QYO A;  1KU2 A;  4HDV A;  1ZG3 A;  5D5U B;  2LNB A;  2HOE A;  4HLY A;  4YFN F;  1YLF A;  1ZN2 A;  2KKO A;  4BQA A;  1H9T A;  1P4X A;  5TRD A;  2W25 A;  2BGC A;  3L7W A;  4GO1 A;  4KMU X;  4U0W A;  2L4M A;  1F9N A;  1RNL A;  1OKR A;  1I6X A;  3DV8 A;  2FXA A;  3ZMD A;  2D2W A;  1AWC A;  3WTS C;  1U5T C;  1LDD A;  1SD5 A;  1W5S A;  2A07 F;  2D1H A;  3P9K A;  1ZRD A;  3ULQ B;  4Q4Z F;  4Y13 A;  3L2C A;  5ICF A;  4CYD A;  2QQ9 A;  1Z6R A;  4AVP A;  3P7N A;  2CFX A;  3IHU A;  1LB2 A;  1IW7 F;  2E7W A;  5K5O A;  1CF7 A;  1UST A;  2D1V A;  4HBL A;  3J7A O;  4HQM A;  3QAH A;  5BQT A;  2A6H F;  3R0J A;  4M9S A;  2Q2E A;  2DK8 A;  1BOA A;  2H94 A;  3EET A;  4DQ2 A;  5DEQ A;  1XSV A;  1ZGJ A;  1RZ4 A;  2IPQ X;  3F72 A;  4XSZ F;  1EH6 A;  3BJ6 A;  3N97 A;  5DUK A;  3E6M A;  3NEU A;  1I27 A;  2UZK A;  3DXJ F;  4XLP F;  2O8X A;  2PJP A;  2QM3 A;  3IKT A;  4LK0 F;  2EFN A;  5DV5 A;  4KMF A;  1KU3 A;  1YS6 A;  3E6B A;  1XDS A;  1YTY A;  1WRJ A;  1KU7 A;  3LA2 A;  3F8N A;  4DNC A;  2VBZ A;  3QP6 A;  4HA8 A;  5CVV A;  2DTR A;  1FSE A;  4KUM A;  2VOO A;  1FYM A;  3GW2 A;  2A69 F;  2F2E A;  3FXQ A;  4HLX A;  1J5Y A;  3QPT A;  2YU3 A;  2V6C A;  3T0Y A;  2EFO A;  4A0Z A;  5H6Q A;  2V79 A;  2PI0 A;  2K86 A;  4G6D A;  4M9Z A;  1LVA A;  1R7J A;  4PGH A;  1IF1 A;  4EVI A;  5L3E A;  1L0O C;  4K2E A;  3PQK A;  4ZZL A;  4L18 B;  4G6Q A;  2QEN A;  4P9F A;  5E1W A;  3EYY A;  2E1C A;  4CZZ A;  1ON1 A;  3HRU A;  2ZJ2 A;  4EGZ A;  4LGW A;  2A61 A;  1J2X A;  2W24 A;  2P5V A;  3KEQ A;  1QGP A;  1IZ1 A;  2JPB A;  2LKP A;  5K1Y A;  3HOS A;  1UB9 A;  4MHG A;  2DK5 A;  5BOX A;  3CTA A;  2E7X A;  1DUX C;  1MZB A;  4OMY A;  5DCF A;  4WWC A;  2Z5U A;  1L3L A;  4MTD A;  1IAW A;  3E5U A;  4YFK F;  2P6S A;  1KYZ A;  2L4A A;  2DPD A;  4A6D A;  4RS8 A;  2A68 F;  2UXN A;  2EV6 A;  1WSU A;  4EM0 B;  1V4R A;  3R61 A;  2XUB A;  5FD6 A;  5L3G A;  5CLS A;  1ZAR A;  4CHU A;  4YII A;  2ZO4 A;  4H0E A;  3CUQ A;  3WGI A;  1U2W A;  1SFX A;  2CSO A;  4L5J A;  3IL2 A;  2OZ6 A;  3NRV A;  5K5R A;  2Z9O A;  2DAO A;  4PGG A;  1SAX A;  2H27 A;  3TO9 A;  2AXL A;  3D0S A;  1T39 A;  3R4K A;  1BIB A;  5ICG A;  3BOQ A;  4N0B A;  4U7D A;  3F6V A;  3ZMT A;  1K7A A;  1TBX A;  2EB7 A;  2HS5 A;  2RV8 A;  1JE8 A;  2QWW A;  1IN6 A;  5FGM A;  2NS0 A;  2JZY A;  5DCM A;  1HW2 A;  4Z2Y A;  4QWQ A;  1XSD A;  3BP8 A;  1E2X A;  3J81 K;  3VFZ A;  5JVT A;  3FXU A;  4MQ9 F;  2BBY A;  4UHT A;  3ZMZ A;  4HZF A;  3C7J A;  1P92 A;  2VOP A;  3VOE A;  3T1B A;  4ESB A;  4YIF A;  2VBW A;  2F5F A;  4OU0 A;  5HDN A;  4LJZ F;  2XGX A;  4B8X A;  2VT2 A;  3LA3 A;  1R00 A;  2PQ8 A;  2VE8 A;  1YW8 A;  2XAJ A;  3SZP A;  1T98 A;  1PP8 F;  1S6L A;  3GEZ A;  3TOA A;  3JSO A;  2FMY A;  3GFL A;  1KYW A;  4ENJ A;  3WE2 A;  2FNA A;  1ON2 A;  1DPR A;  1YW9 A;  1OYI A;  4HQE A;  2YX4 A;  4KIC A;  1ZHF A;  2RVC A;  5J8C A;  4KN4 X;  2P7C B;  4OIR F;  2MLK A;  1WI9 A;  3KZY A;  1OPC A;  4LB6 B;  2W84 A;  5FFX A;  3BPV A;  4M6Y A;  5HOO A;  4IHS A;  2HGC A;  1S3J A;  2ACJ A;  2HTJ A;  5LHG A;  3DPL C;  1AOY A;  2MA3 A;  4OIQ F;  1ZYR F;  2XHK A;  2HYF A;  3FHZ A;  2OZU A;  3KZZ A;  2DFI A;  1H0M A;  2D45 A;  4IRG A;  1QPM A;  2ZNZ A;  2HR3 A;  4LG0 A;  3HSE A;  2COM A;  4OMZ A;  3IWZ A;  3VEP A;  5ILU A;  4BYY A;  2DLL A;  2OA4 A;  4L9N A;  5FD5 A;  4TV7 A;  3F3X A;  1T6S A;  2RNJ A;  3ZQ7 A;  1R1U A;  4D0P A;  5FB2 A;  2HKO A;  3E6C C;  3HHH A;  2B0L A;  3W6K B;  4OIP F;  3HTU A;  3I54 A;  3I64 A;  1IN4 A;  4KIF A;  3M8F A;  4HX4 A;  1B4A A;  1LQ1 A;  4UV8 A;  3F8F A;  2K27 A;  2XAG A;  2GAU A;  1K78 A;  3GWZ A;  3F8M A;  5HLI A;  3E5Q A;  4L9J A;  3I59 A;  4IXA A;  5LGU A;  2EJR A;  3RTR A;  2MH9 A;  1B59 A;  2MC3 A;  5F64 A;  5H6R A;  1BM9 A;  1XGO A;  3GUD A;  2CO5 A;  2IJL A;  1U8R A;  4G94 A;  5A2Q K;  3K1N A;  1UFM A;  1WQ2 A;  3C3W A;  1HST A;  3REO A;  1DDN A;  5LRR A;  4WXD A;  1FZP B;  2X4H A;  1FNN A;  1USS A;  5CJ9 A;  3LAP A;  4BHB A;  4UVA A;  4MEX F;  3PQJ A;  3TGN A;  2A6E F;  1LDK B;  2PFB A;  5HLG A;  4UV9 A;  1FX7 A;  2E1N A;  3GYH X;  3QU3 A;  2J5O A;  4L9V A;  3KLN A;  5AIP A;  2FOK A;  5BS6 A;  3E97 A;  1XCB A;  1R1T A;  3HIF A;  2ESN A;  4KNY A;  1XGM A;  1YYV A;  1QQI A;  2Q0O A;  1QNT A;  1JHH A;  2G9W A;  4ETS A;  3LQR A;  1PP7 U;  1GXQ A;  1IXC A;  1P6R A;  1MD0 A;  4HX7 A;  3G3Z A;  2VT3 A;  3L9F A;  4WX9 A;  2CQK A;  4A2U A;  1OYY A;  2KIF A;  1G4D A;  1D5V A;  2FF4 A;  4CGZ A;  4L5I A;  4EJV A;  1I5Z A;  4BAY A;  1R36 A;  3PFI A;  4MGR A;  5J6X A;  1BC8 C;  2ZME B;  1T38 A;  2DQR A;  1QBJ A;  4LLN A;  1BI1 A;  4EJT A;  1TQI A;  1J7K A;  4F7Z A;  4LLG F;  4BH9 A;  1YG2 A;  2F5D A;  1J75 A;  3Q9V A;  2P5K A;  1TQM A;  4LB5 A;  3FWE A;  5J8F A;  1WWX A;  3R60 A;  3V8L A;  1XGS A;  3WG9 A;  4PCQ A;  2NNN A;  2QQB A;  3J80 K;  3JTG A;  2DT5 A;  2KJB A;  4RGU A;  1QO0 D;  2QBY A;  5LGT A;  5HLH A;  2DO7 A;  3WU0 A;  1DP7 P;  5KK1 A;  5JI6 A;  5L3B A;  1U5T B;  4O6J A;  1RIO H;  3QOP A;  5IT9 K;  5L3C A;  3C18 A;  2QQA A;  1RUO A;  1HBX G;  3CDH A;  3SXY A;  1S8N A;  5H20 A;  1TW3 A;  2LSO A;  1GVJ A;  3V4G A;  1FPQ A;  1HW5 A;  3I71 A;  1TNS A;  4EMS A;  4HX8 A;  3RPU A;  2O61 A;  2WWY A;  3GFI A;  2W57 A;  1B6A A;  3E3V A;  3EQL F;  4FHT A;  3KET A;  3BJA A;  1G6N A;  3WTT C;  5E1X A;  1I1S A;  2ADU A;  2M8E A;  4I0A A;  4RGR A;  5A2Q Z;  1XMK A;  1Z6T A;  4M74 A;  1HKT A;  5ICE A;  4RAZ A;  2L3D A;  3QRF F;  1YQA A;  1E17 A;  3V8J A;  5HS8 A;  4IRH A;  4PDK A;  4WK8 F;  2LF7 A;  4Y15 A;  5EEH A;  4P9U A;  1Z7U A;  4MEY F;  1F4K A;  1TTY A;  4HYE A;  1C0W A;  1BJA A;  1V3F A;  1HXD A;  2MH2 A;  3U2R A;  4Q5S F;  3OOP A;  4R1H A;  3KCC A;  2FBI A;  2RC4 A;  1RI7 A;  2DPU A;  4HF2 A;  1OMI A;  4EM2 A;  4E70 A;  1MJB A;  1REP C;  2HTS A;  1MDM A;  4EM1 A;  2R3S A;  5L3D A;  2NAZ A;  1OYW A;  4AIK A;  4QLC U;  2BEO A;  2A3S A;  3V7S A;  1KA8 A;  3W6J B;  2X0L A;  2VN2 A;  5ILV A;  3TDZ C;  5FLX Z;  3EDP A;  1LNW A;  4KN7 X;  1EH8 A;  3D5L A;  2XAS A;  4S05 A;  2M45 A;  3SZT A;  4ZYD A;  3KEO A;  4ZZD A;  1XMA A;  1U6G A;  4KFC A;  3RYP A;  1O3S A;  2NNY A;  1O3T A;  1SFU A;  2FRH A;  3WE3 A;  1MGT A;  3F6O A;  3GZ6 A;  3T8R A;  4WF2 A;  3DF8 A;  2F5E A;  1ZH5 A;  2YX7 A;  4ZH4 F;  2ZBK A;  3WTW C;  4XBF A;  1F5T A;  3ML6 A;  3ZN1 A;  2HQN A;  3O6B B;  2JSC A;  3J80 Z;  2PMH A;  1BIA A;  3ZPL A;  2IP2 A;  1MJ9 A;  1XGN A;  4A5N A;  2FBK A;  3L00 A;  3ZMS A;  3C1D A;  3MFK A;  4CIC A;  1HSJ A;  2FNP A;  1CF7 B;  3G73 A;  3TDU C;  2Z3Y A;  5IT9 Z;  3BZ6 A;  4U7B A;  2JRT A;  4RGX A;  3KFW X;  5LLQ A;  1P4A A;  2ZFW A;  4I0B A;  2HKX A;  2RDP A;  2P8T A;  3SQN A;  3JAM Z;  5FFZ A;  6PAX A;  2L54 A;  4UXN A;  1R5H A;  5E8G A;  1W7P B;  2RKH A;  4HF1 A;  4KA4 A;  4KYW A;  4OIN F;  3HUG A;  3SFZ A;  1BN5 A;  4HOB A;  5LBQ A;  1IRG A;  5ED4 A;  1R5G A;  2HEO A;  3KP7 A;  4IF4 A;  1SFE A;  4P5O A;  2XAF A;  3ZMU A;  4LD5 A;  5E18 F;  1ULY A;  3LWF A;  3HRS A;  1XN7 A;  1FYK A;  2V1D A;  4Y17 A;  3FX3 A;  2OU2 A;  3V8K A;  1O3Q A;  5D8L B;  1FC3 A;  4IRI A;  5D6F A;  2VBY A;  1SMY F;  1W5T A;  1B9M A;  2NYX A;  4JBA A;  5DD4 A;  2PG4 A;  4M72 A;  1HQC A;  5BMZ A;  5E17 F;  1O7F A;  1U5T A;  3F21 A;  1O3R A;  1D8J A;  1ODD A;  1FP2 A;  2P5L C;  3CUQ C;  3F23 A;  4M9X A;  4RAY A;  5HDK A;  3RDI A;  1Z9C A;  4G7H F;  4CXF A;  3FF5 A;  3R0A A;  5HVQ C;  2H6C A;  2XVC A;  3TO7 A;  3BJO A;  3WTV C;  3LST A;  4ASN A;  2OQG A;  3MZY A;  1FLI A;  5D4R A;  1ZRC A;  2TDX A;  3KP4 A;  4IVN A;  4GGG A;  3HHG A;  3RPQ A;  1UHM A;  5HS7 A;  3ERE D;  1KQ9 A;  3DFG A;  2KIM A;  1KQ0 A;  3KP2 A;  4ESF A;  2IW5 A;  2M1B A;  3N4M A;  4A6E A;  3R6S A;  1PUE E;  3ZP5 A;  1ZAO A;  4NQW A;  2CYY A;  4EV0 A;  3CUQ B;  3P9C A;  5BPD A;  5IT3 A;  5E1Z B;  2CWE A;  3TO6 A;  5F6F A;  2JT1 A;  4IPA A;  3RI4 A;  1X3U A;  2PMU A;  2VC1 A;  2FML A;  3KP3 A;  2GIV A;  3BPX A;  1ZRE A;  5L3F A;  1XDU A;  2G7U A;  4ON0 A;  3FZV A;  5D5X B;  1YS7 A;  4MQV A;  1P2F A;  2BV6 A;  3I58 A;  2GXB A;  1JXS A;  1STZ A;  2XRO A;  4R79 A;  2MBF A;  1RUN A;  2M30 A;  3GVA A;  2Y0M A;  1FP1 D;  2IT0 A;  3LA7 A;  3COA C;  3KP5 A;  3AAF A;  2H6B A;  5DCM B;  5TJJ A;  5ICC A;  2EFW A;  4EJW A;  5DDG A;  3IKV A;  3DEU A;  1HKS A;  1ONV A;  2EA4 A;  2WV0 A;  4I2O A;  4HV6 A;  4A12 A;  3HSR A;  4HW0 A;  5K5Q A;  2KRF A;  3U1D A;  2ZXJ A;  2YR2 A;  1IN7 A;  3IWF A;  3LQQ A;  1WKM A;  1BI0 A;  5CVU A;  1HKQ A;  4LMY A;  2AS5 F;  4L9T A;  2DU9 A;  3O3K A;  1R22 A;  3K9T A;  2GA1 A;  2KIU A;  4WXH A;  1ZGA A;  3T8T A;  5FLX K;  1YO5 C;  4YFX F;  4IHT A;  1UCR A;  3WGG A;  1IXS B;  2CG4 A;  5CVR A;  2NRA C;  4ENK A;  1K6O A;  3H3Z A;  2ISY A;  3RJP A;  3DKW A;  2ISZ A;  3RKY A;  2ETH A;  1FT9 A;  3K1M A;  1U3E M;  1BBY A;  3BY6 A;  4BHP A;  5HS9 A;  3FMQ A;  3L09 A;  3U9G A;  3ZMV A;  2FQ3 A;  3M9A A;  4FX4 A;  3KE2 A;  3B02 A;  3K69 A;  3GLX A;  1DPU A;  3VOD A;  2O03 A;  3F8B A;  3CUO A;  2EWN A;  3ISP A;  4BXU A;  1R23 A;  3HSF A;  1TW2 A;  3EUH A;  4HF0 A;  1Q1H A;  3P9I A;  3LAJ A;  4EJU A;  4LK1 F;  2LDU A;  4HAM A;  1FBU A;  2JTV A;  1KQ8 A;  4AD9 A;  2EV5 A;  2M87 A;  5EEG A;  5D6E A;  3M7G A;  3CO7 C;  2Z33 A;  5LEJ A;  3GXO A;  4XRF A;  1FBQ A;  4MTE A;  2XKO A;  2DQL A;  3GF2 A;  4XSX F;  1O7L A;  1FWZ A;  5JHU A;  4A0X A;  3WOD F;  2IVM A;  3RIR A;  3TOB A;  1W4M A;  2FSW A;  2OD5 A;  3O2P E;  5DD8 A;  4M73 A;  5D5V B;  4LG0 B;  3TKY A;  5D8K B;  1MJA A;  1W7P A;  4RB1 A;  2OBP A;  3JAM K;  1J9I A;  1T0F A;  4RGS A;  3JSP A;  4O5V A;  1O57 A;  4LLL A;  3MCZ A;  3CLO A;  1NHA A;  2RQP A;  2RN7 A;  1G3W A;  4I7H A;  3DPT A;  1FOK A;  2OQR A;  4KT5 C;  3QPH A;  5FO5 A;  3B73 A;  2LF8 A;  1FYL A;  1R58 A;  2F5C A;  3GZ5 A;  2J5P A;  2O0Y A;  3I5U A;  4IJA A;  1U78 A;  3FXR A;  3IRR A;  2ZCW A;  3BWG A;  2K4J A;  2GZW A;  2YSR A;  5ILS A;  5BPI A;  3M1E A;  4EQQ A;  1KGS A;  4I01 A;  4UUV A;  4M6X A;  4G8X A;  1K79 A;  1K78 B;  1R1V A;  1GXP A;  1W7P D;  2QVO A;  3I59 B;  4JK1 X;  1YFH A;  1ZG5 A;  5JR3 A;  2Y75 A;  2PLY A;  2FU4 A;  1XD7 A;  2EFQ A;  1J59 A;  1IRF A;  2VC0 A;  2FA5 A;  2BYV E;  3SHF A;  4WCG A;  1JGS A;  4ESJ A;  4O3M A;  2PBI A;  4NB5 A;  1XCV A;  1YW7 A;  4RB3 C;  4CO8 A;  4WXC A;  2P6T A;  4HV5 A;  2XIG A;  1B1B A;  3RKW A;  2R7D A;  3WTY C;  2GA2 A;  1D3Y A;  1XSX A;  3K2Z A;  3RKX A;  2HZT A;  4CDG A;  4GXO A;  1S7O A;  3ROU A;  2OAZ A;  1ZLK A;  2VON A;  1S29 A;  2MLG A;  1Y0U A;  1TQP A;  3GO5 A;  4A0Y A;  1VTN C;  1I1G A;  2XKP A;  5CVI A;  2ESH A;  2DI3 A;  1Z91 A;  3TQN A;  2FEZ A;  1LEA A;  2M5W A;  3GFJ A;  4P96 A;  1OR7 A;  4LFU A;  2RGV A;  3WGH A;  2FE3 A;  2WC2 A;  2K4B A;  2C6Y A;  3K1P A;  2GWR A;  2P4W A;  4ZYG A;  2CGP A;  2IA2 A;  3F8C A;  4N9I A;  3CJN A;  3WU1 B;  4OOI A;  2STT A;  1FBS A;  3HRM A;  1IN8 A;  1HW1 A;  4U0V A;  2Z99 A;  3FMR A;  2H09 A;  2HFH A;  2ELH A;  1FSH A;  4YG2 F;  3OV8 A;  3IRQ A;  1SD7 A;  3E5X A;  4L0Y B;  2L02 A;  5LGN A;  5F1R A;  4XLN F;  5AIQ A;  4UVB A;  1FY7 A;  5LRS A;  3M8E A;  2V1X A;  2XV4 S;  2EFP A;  1PDN C;  4UVC A;  2GXG A;  2HQR A;  3I0T A;  4U88 A;  1CGP A;  2HDC A;  2XRN A;  1F1Z A;  3DP7 A;  3T5X A;  3Q9S A;  4Q47 A;  1TLH B;  4A5M A;  3NQO A;  4BHC A;  2ZKZ A;  2Y48 A;  2CW0 F;  4KDP A;  2QBY B;  3WTX C;  3KLO A;  3V7R A;  4I09 A;  1H9G A;  3HYI A;  1XB4 A;  4MNU A;  2PEX A;  4OIO F;  2EA2 A;  3I4P A;  1D8K A;  2K02 A;  2K7L A;  3H3U A;  2ZME A;  4M71 A;  5LHI A;  2O6G E;  3WTU C;  5LHH A;  1BC7 C;  2VE9 A;  3BDD A;  5D4S A;  2UXX A;  4ZYE A;  2IA1 A;  4Q48 A;  4EGY A;  3ELK A;  1EH7 A;  1LEB A;  1G3Y A;  3KP6 A;  4BNC A;  3H92 A;  2VOD A;  3QP5 A;  3MZH A;  4GYG A;  3DQV C;  1IUY A;  1SD6 A;  4NHJ A;  1Z05 A;  5JFR A;  2YPR A;  3ECH A;  4ENN A;  4FX0 A;  4N9H A;  3MQ0 A;  4FT8 A;  1IN5 A;  1TNT A;  2MD5 A;  3MWM A;  5DUI A;  1BI3 A;  3Q5F A;  3HRT A;  4EJO A;  2UWM A;  2WTE A;  2DBB A;  4U0Y A;  2V1U A;  3BRO A;  5CVJ A;  3S2W A;  2O3F A;  2VXZ A;  3V7C A;  3LFK A;  1G3S A;  3EYI A;  3HTS B;  3E6D A;  1ZLJ A;  1EV7 A;  2QLZ A;  4S04 A;  4RB0 A;  3F22 A;  3I53 A;  1SD4 A;  4HDU A;  3FM5 A;  5E20 A;  3IC7 A;  3JW4 A;  1P4W A;  5E8I A;  4G9Y A;  2IRF G;  2R7F A;  2HYG D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...