1GHCA

Homo-and heteronuclear two-dimensional nmr studies of the globular domain of histone h1: full assignment, tertiary structure, and comparison with the globular domain of histone h5
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
75
structure length
75
Chain Sequence
MAGPSVTELITKAVSASKERKGLSLAALKKALAAGGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFRLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GH1
publication title Homo- and heteronuclear two-dimensional NMR studies of the globular domain of histone H1: full assignment, tertiary structure, and comparison with the globular domain of histone H5.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Chromosomal protein
total genus 9
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 1994-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00538 Linker_histone linker histone H1 and H5 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1ghcA00
4ASNA 2CSOA 1W5TA 5ILVA 1W5SA 2P4WA 1F1ZA 3R60A 1EV7A 1KQ8A 2PG4A 5K5QA 4AWXB 1XCVA 1J7KA 5ILSA 1T0FA 4DNCA 3ECOA 3J81K 4LB5A 3TO7A 2ZJ2A 3ELKA 4RB0A 3JAMZ 4MGRA 4Y13A 5L3EA 1PP7U 3D0SA 1MDMB 1SFEA 3K1PA 1YW8A 3JSPA 4RB1A 1Z91A 2DK8A 5ILUA 3VEPA 1ZARA 3RTRA 4HQMA 1U5TC 2XV4S 2EFNA 3G3ZA 4KUMA 5DCMA 2XROA 2A6HF 1WI9A 2ZMEB 1P6RA 1BN5A 4LK0F 4L9TA 2E7WA 1WKMA 2F5FA 1BM9A 3SHFA 4R79A 2QLZA 1ZLJA 5FD6A 3HRUA 2DQLA 1QZZA 3JAMK 2FXAA 2P5VA 5LBQA 5JR3A 3MQ0A 1K78B 2A6EF 3QU6A 2GZWA 1BIAA 2CW0F 1TNTA 1JHHA 4MTEA 4WXDA 1MJ9A 4G9YA 2OBPA 1QGPA 3U9GA 1DPRA 5LHGA 1O3TA 3E6DA 3KZZA 5F1RA 3KEOA 4RAYA 4CHUA 1W7PB 4AIHA 4BAYA 2LF8A 1FP2A 2OZ6A 3TGNA 3HSRA 1ZN2A 3FMRA 3GFMA 1LEAA 5DYMA 5HVQC 2M8EA 1XDSA 3PFIA 3DFGA 4UXNA 2D2WA 4IJAA 4ENMA 1I1SA 1FC3A 4MHGA 4OIPF 4G7HF 1D8JA 3KZYA 4IVNA 2IVMA 5CJ9A 1P4WA 2CG4A 2VODA 1U5TA 1OR7A 1CF7A 1TW3A 2DU9A 3LWFA 3F8MA 3LQQA 1FYLA 1J2XA 3JSOA 3VOEA 1QNTA 3RKYA 1SD5A 1IRGA 4ZYEA 2NS0A 3GEZA 4EMSA 2V1XA 3F72A 3CDHA 2FRHA 3NEUA 5E8IA 1VTNC 1P92A 2EJRA 1IN7A 3F22A 4E70A 2NYXA 1R1TA 2JSCA 2M87A 3EQLF 4O6JA 5D8KB 1LQ1A 3TDUC 2IA2A 4LG0A 1USTA 2VXZA 2XVCA 4YFKF 3KE2A 4ZZDA 3IKVA 4D0PA 1FYMA 1E17A 2EFOA 3CUQA 2OAZA 2PMHA 3FWEA 2RC4A 2L01A 4A0ZA 2FF4A 1IUYA 3I64A 4YFNF 3FHZA 1FOKA 5CVJA 4A6DA 3GXOA 4IHTA 1YW7A 1SFXA 2L4AA 3R6SA 2EA4A 1CGPA 3KP6A 4L9JA 1FWZA 5L3DA 2Z3YA 2YPRA 3E5UA 1OPCA 1Z7UA 3E6BA 2DLLA 2QQ9A 1BC8C 2FOKA 4GYIA 2A69F 2NAZA 2NRAC 1U78A 1U6GA 4BH9A 3QP6A 1P4XA 4EGZA 1OYYA 1BJAA 1LDDA 4DQ2A 4I2OA 3WTWC 2DPUA 2YU3A 2Y48A 2VBWA 4YG2F 2PEXA 2KRFA 1FSHA 5CYVA 2RDPA 2Q8KA 2IRFG 4QLCU 4LGWA 1ZG1A 4GXOA 3R0JA 5HLHA 2JPBA 2BBYA 2HFHA 4UVBA 4RGXA 1ZLKA 5D5XB 4M6XA 2V1DA 3OV8A 5K5RA 3ZQ7A 3H3UA 5BPDA 1ON1A 2P6SA 2HEOA 2BE5F 1PP8F 3MZYA 3Q5FA 3HSEA 3WTVC 5D8LB 2ZFWA 2XRNA 3RIRA 4L18B 1ON2A 3SXYA 2EK5A 3I5UA 1YFHA 4P9UA 5D4RA 4HV6A 4ENNA 2IA1A 1HXDA 2PN6A 4UVAA 4Z2YA 2VBYA 1SD4A 1D5VA 2PI0A 5J8FA 5BOXA 1KU9A 2OU2A 1K6OA 1SD7A 4ZYHA 2A3SA 2EFQA 2O8XA 4MNUA 3MEXA 1KGSA 1K79A 5FLXZ 2VC0A 4BNCA 3TKYA 2FNAA 1X3UA 1G3WA 1XMAA 1B9NA 2OZUA 2XASA 4Q4ZF 4HA8A 1LDJA 1SMTA 3M9AA 2P5KA 2KIUA 4FHTA 4KN4X 3FXRA 4PDKA 1S6LA 2O0YA 5LHIA 1FBUA 5D4SA 3KP7A 1MGTA 2IPQX 3U1DA 4EM1A 3FF5A 2ZKZA 2XKPA 5DUIA 3HTSB 3ABUA 3LA3A 3F8BA 5D5WB 5J6XA 3SFZA 3ML6A 3BJ6A 1WQ2A 5D6FA 4UV9A 2MLGA 3GFJA 5FLXK 5CVUA 4U7BA 2A07F 4XSXF 2P7CB 3FMQA 2ETHA 4IRHA 2GA2A 3DP7A 1SD6A 3VODA 2EFWA 4N9IA 4M9XA 5FFXA 2STWA 1PDNC 4S05A 3C18A 3KP2A 1HBXG 4HBLA 3EDPA 2DW4A 1U2WA 1RZ4A 3F8FA 3E6CC 3ULQB 3EETA 3HIFA 1EH7A 2AXLA 4BQAA 2VOPA 2V9VA 1QPMA 4ENKA 2UXNA 1OKRA 2HQNA 5LGNA 1FYKA 2K86A 2QQBA 2E1NA 1Y0UA 2XAHA 2H27A 1R00A 1KYWA 5HS7A 4OIOF 1ULYA 5LEJA 4G7ZF 2ZMEA 4L0YB 5EEGA 2P5LC 4NB5A 5DUKA 5IT9Z 1KQ0A 1FZPB 4A0YA 3KFWX 4OU0A 1YTYA 1WWXA 5L3GA 1XB4A 3FZVA 1JGSA 1MD0A 3CO7C 2RQPA 4NHJA 2JRTA 4G94A 3P9IA 5LRSA 4FX0A 3SQNA 1K78A 2YSRA 2FMLA 2JTVA 3VFZA 5CVRA 2L54A 5E1WA 4P96A 3ZP5A 1HW1A 2STTA 2PQ8A 1EH8A 4XLNF 4PCQA 1ODDA 1XD7A 1KU3A 3K2ZA 3WTYC 3LAJA 2V1UA 2FBHA 1O57A 1W7PA 4HF2A 1FT9A 2IT0A 4U0WA 4XSZF 5IT9K 1KYZA 1ZH5A 2C6YA 5HLGA 4G6DA 4A0XA 1HW2A 4OIQF 4JQFA 3SZPA 2W84A 2VE9A 2WV0A 3HTUA 1JXSA 3V8KA 4R1HA 2AS5F 4P55A 1Q1HA 2VT2A 2HR3A 3JTGA 2Q0OA 2J5PA 4JK1X 1HKTA 4WCGA 1LVAA 1S3JA 5BQTA 1KQ9A 3KP5A 2K4BA 4EJOA 2H6CA 3ZN0A 4KIGA 4HF1A 1XSDA 2GQQA 5TJJA 3PQKA 4KA4A 3M7GA 3WE3A 3I4PA 3C7JA 3M8EA 1P4AA 3OOPA 1IXSB 2PFBA 3P9KA 4OIRF 1MZBA 2DQRA 1KU2A 2PLYA 3QPHA 4XRFA 3CUQC 3WG9A 4IRGA 1YYVA 3V4GA 3BDDA 1FBSA 4KMUX 5H6RA 3WTXC 1LEBA 4HX8A 1I1GA 2D1HA 3GWZA 4CDGA 2F2EA 1DPUA 1ZG3A 4M74A 1S7AA 3BWGA 2VT3A 3CUOA 4UVCA 3C3WA 5KK1A 4I02A 1XDUA 2M45A 2QQAA 1JHFA 1HQCA 2KJBA 1REPC 2WC2A 3R4KA 5HDGA 1HSJA 4ZH4F 3RI4A 5HDKA 1UHMA 4BHCA 1MJAA 5CVIA 1Z9CA 2QVOA 5E1ZB 3O3KA 1UCRA 4AVPA 2RKHA 3E5XA 3V7SA 3RKXA 3BJOA 3IHUA 5HS9A 1D8KA 4M9ZA 1BIBA 2W24A 4LK1F 2HWVA 1IF1A 1ZRFA 5E8GA 1XGOA 1TNSA 5LGTA 2CO5A 3L00A 2ZCWA 5DD4A 4Y15A 1F9NA 4PGHA 1IN8A 2HYGD 3BY6A 1H9TA 1ZREA 1SMYF 4KIBA 4U7DA 2VE8A 4F7ZA 4P9FA 1T98A 3E5QA 5J8CA 3HHGA 1BBYA 2QUFA 4O3MA 2COMA 3ROUA 1ZYRF 1RNLA 4KFCA 2BEOA 3ZMSA 3LA2A 3V7RA 4LMYA 4MEYF 2DBBA 1J59A 4HW0A 3BPXA 3M1EA 4KN7X 1L3LA 3GFLA 4KYWA 2Z5UA 3I59A 1IN4A 4LB6B 3GZ5A 1FX7A 4A6EA 4IHSA 2GAUA 1LJ9A 1ONVA 4BHPA 4L5IA 2IJLA 3T8TA 3GZ6A 1SAXA 4A12A 1W4MA 4CZZA 1T2KA 4CGZA 4EV0A 1EH6A 4M6YA 4OINF 3RYRA 3FM5A 2Z9OA 2OA4A 1CF7B 2OD5A 1P2FA 3IL2A 3DQVC 5E20A 2XAJA 3BJAA 3IWZA 5DDGA 2FSWA 1BC7C 4A5NA 1R1VA 4EM2A 1V3FA 1HKSA 2DTRA 4WWCA 1GXQA 3ZMUA 2HQRA 4RGRA 2GIVA 3FXQA 1HKQA 2LDUA 4MEXF 1QQIA 1ZAOA 4LG0B 5HLIA 4Q48A 2LSOA 3KEQA 1T6SA 2MD5A 1AWCA 4EQQA 1IRFA 2MH2A 3BZ6A 3T8RA 4CICA 3ZMDA 2QBYB 2L02A 1ZGJA 2VC1A 2H6BA 4JBAA 2CGPA 1S7OA 4P5OA 4EJUA 2MLKA 2VBZA 2W25A 2O6GE 1XSVA 4L5JA 4HX4A 3F21A 3F8CA 4Y17A 2OQGA 4BHBA 1XGSA 1B59A 2RV8A 5L3FA 2NNNA 1IN5A 2IW5A 1BOAA 2X4HA 4HOBA 4U0VA 4EVIA 3ZMZA 3E6MA 4HLYA 2Q2EA 4IXAA 4L9VA 5FFZA 2QZ8A 3JTHA 1FY7A 5LEKA 5ICFA 1FNNA 1R23A 4ZYDA 3SZTA 3WODF 1TQIA 1GHCA 3J80Z 1MJBA 1DUXC 2JT1A 2VONA 1BI2A 5BPIA 3PQJA 1YW9A 1LB2A 2XUBA 2LNBA 1ZRCA 3KCCA 2K27A 4KDPA 1GXPA 3V8JA 2HKXA 5LHHA 5D5UB 1J75A 3WGHA 1YS6A 3K1MA 2XIGA 4UHTA 5HOOA 1STZA 1Z6RA 3W6JB 2CWEA 3P9CA 5H20A 5DD8A 3JW4A 4AIJA 2HZTA 5L3CA 5KVRA 4OOIA 5LRRA 2HGCA 1USSA 4ENJA 1JE8A 3DV8A 2PJPA 4I0BA 2HS5A 2ZBKA 3T1BA 4YFXF 3WTSC 4KIFA 1Z05A 3J80K 4M9SA 1MDMA 4OMZA 4HZFA 2GXGA 3TOAA 4PGGA 4I7HA 3DXJF 1I6XA 4U88A 2HKOA 2ELHA 1T38A 3EUHA 2B0LA 4YIFA 3QRFF 2FBKA 5CLSA 5DEQA 3TOBA 4K2EA 3I54A 1B6AA 5BS6A 3ISPA 1RI7A 2XKOA 1WSUA 4LLGF 3I71A 1I5ZA 2R7DA 3W6KB 5DCFA 5EEHA 2HYFA 2XHKA 2XAFA 1QBJA 1J9IA 3RJPA 4A2UA 2O03A 1ZHFA 2QM3A 2KKOA 4HF0A 5DV5A 1C0WA 3T0YA 3IRRA 3GLXA 1T39A 3TQNA 3HOTA 3Q9SA 4UUVA 5AIPA 2VOOA 3FM3A 1I27A 3E97A 5HDNA 2DO7A 3KLOA 3IC7A 3CTAA 1S29A 5ED4A 3FXUA 4AD9A 3GYHX 1YIOA 3F23A 4CO8A 1UHWA 1L0OC 1MKMA 4I09A 3DPTA 3L2CA 2MBFA 4HX7A 5IT3A 1R36A 3AAFA 2Z99A 1V4RA 1BI0A 3QAHA 4Q5SF 2RN7A 1YG2A 2XAQA 3ERED 3NRVA 3O2PE 4RB2C 3TO9A 2MA3A 5JI6A 4AIKA 4GO1A 3V8LA 1J0RA 2UZKA 4FX4A 3MCZA 4G7OF 2ZNYA 1YLFA 5E1XA 2FEZA 3IWFA 1TBXA 3K0LA 2D1VA 1XGMA 1RIOH 1A04A 2EV5A 4S04A 2CYYA 1XSXA 4HDVA 5JFRA 2FU4A 5LLQA 4RB3C 3I0TA 2ISYA 2YX4A 3K1NA 4O5VA 4LJZF 2VN2A 1QZYA 2F5CA 2WWYA 4EJVA 4QWQA 4WX9A 5HS8A 2BGCA 4M72A 3N97A 3HRSA 2ZNZA 1TW2A 3MFKA 2VBXA 4ESBA 4L9NA 3GW2A 4ON0A 1OMIA 1B9MA 2EV0A 1R5GA 4G6QA 4GGGA 1G3YA 5AONA 4WXCA 3IKTA 2NNYA 2BYVE 1TQPA 1YQAA 4TV7A 1DP7P 3F8NA 3J7AO 2A68F 4EJTA 1B4AA 3F6VA 2P8TA 4L0ZB 1XMKA 4HDUA 1G6NA 5LGUA 4A5MA 3HUGA 3ECHA 4EGYA 5FD5A 2K4JA 4I98B 3G73A 4HAMA 5FO5A 2YX7A 3GX4X 6PAXA 4LLNA 1O7LA 4GYGA 2HOEA 1B1BA 2RGVA 4B8XA 3LQRA 2GXBA 5DCMB 1IXRC 3MAJA 3FMSA 1BI3A 3QOPA 1G3SA 2K7LA 4RS8A 2V79A 1XGNA 3R0AA 3HRMA 4LFUA 4XLPF 5E18F 1YO5C 4HYEA 3MZHA 1R58A 1O3SA 3RKWA 3EYYA 3ZMTA 1ZGAA 4XBFA 3IRQA 4KNYA 2V6CA 4EM0B 2HTSA 1FLIA 1YS7A 2J5OA 3C1DA 1O7FA 3RPQA 3L7WA 3V7CA 2M1BA 3ABTA 4OMYA 2P7VB 5F6FA 5JHUA 1OYIA 3LA7A 2P6TA 1NHAA 4MTDA 2G7HA 3D5LA 2R7FA 2IP2A 2K02A 2JPCA 4ETSA 2FMYA 4Q47A 5ICGA 1E2XA 3DPLC 1F4KA 3I53A 3BP8A 2KJCA 4HLXA 2DPDA 4BXUA 2QBYA 1IAWA 3M8FA 1R7JA 5TRDA 5FB2A 2CQKA 2ESHA 1H9GA 2ACJA 1IN6A 2HTJA 1WRJA 4ZZLA 3P7NA 4MQVA 4WXHA 4N9HA 3QPTA 2H09A 1IXCA 3WE2A 2FBIA 2LF7A 1SFUA 4FT8A 2KIFA 1U5TB 3RYPA 2ZO4A 2FQ3A 5ERIA 3RPUA 3CLOA 2RNJA 3GUDA 2FNPA 3T5XA 3S2WA 2DFIA 2QENA 1TQMA 2XAGA 4GCVA 1AOYA 1Z1DA 3TO6A 2RVCA 1FSEA 1F5TA 3BOQA 2Y75A 5AIQA 1ZG5A 4ESJA 1TTYA 2QWWA 2PBIA 3HSFA 1XCBA 3H92A 3WTUC 3NQOA 3LAPA 4BYYA 5ICEA 2EV6A 4U0YA 4HQEA 1H0MA 2IA0A 5A2QZ 1R1UA 3I58A 2EB7A 3CUQB 1UB9A 5JVTA 3EYIA 1FPQA 3KP4A 3REOA 2KIMA 2QYOA 3RDIA 2EFPA 2FA5A 1BI1A 4M73A 4CYDA 2X0LA 1D3YA 4KICA 3I59B 4YIIA 1UFMA 2M5WA 4WF2A 1K7AA 1PUEE 3BPVA 1QO0D 1DDNA 4M71A 3WU0A 2EWNA 4LD5A 1RUOA 2R3SA 5K1YA 1OYWA 2G9WA 2GWRA 1LNWA 2TDXA 4RAZA 5BMZA 3WU1B 3KLNA 2F5EA 3BROA 3F6OA 5F64A 5A2QK 1IW7F 1U3EM 2ESNA 2OQRA 2UWMA 4UV8A 4B09A 2M30A 2MH9A 3ZPLA 1LDKB 1IZ1A 2Y0MA 2D45A 1O3RA 4MQ9F 3K9TA 3HOSA 3K69A 2LKPA 1KU7A 4WK8F 2MC3A 3U2RA 4NQWA 3GF2A 3O6BB 4G8XA 3ZN1A 5E17F 4ESFA 4IRIA 2JZYA 2EA2A 2E1CA 1W7PD 2DK5A 3WTZA 3E3VA 3L9FA 5K5OA 3KETA 3COAC 3F3XA 5CVVA 3QP5A 2Z33A 3GFIA 2DAOA 4UNOA 3WGIA 2DI3A 2O61A 1RUNA 3ZMVA 3CO6C 4RGUA 1R5HA 1HSTA 3H3ZA 3GO5A 4I01A 3WGGA 4CXFA 4N0BA 1G4DA 1G3TA 1KA8A 2A5YB 3KP3A 3QU3A 3VB2A 3DKWA 2E7XA 3GVAA 2WTEA 3B02A 5D6EA 5H6QA 3N4MA 5L3BA 4HV5A 1J5YA 4PZJA 2HDCA 2XGXA 4R8HA 4IF4A 3TDZC 2CFXA 1S8NA 1XN7A 3MWMA 3LFKA 5FGMA 1Z6TA 3FX3A 2W57A 3Q9VA 3CJNA 3B73A 4ZYGA 4LLLA 3HRTA 1FBQA 3HYIA 4EJWA 1GVJA 2GA1A 3DEUA 3HHHA 1U8RA 2L4MA 2UXXA 4KMFA 2PMUA 2ISZA 2H94A 3J81Z 3DF8A 2G7UA 2BV6A 2ZXJA 2O3FA 1TLHB 2W85A 4H0EA 2A61A 2FE3A 5D5VB 2ADUA 4IPAA 1ZRDA 4I0AA 3LSTA 1HW5A 3R61A 2DT5A 3WTTC 1R22A 1O3QA 5ICCA 1FP1D 2L3DA 2F5DA 2YR2A 4RGSA 4KT5C 3L09A
chains in the Genus database with same CATH superfamily
1TL8A 4ASNA 2CSOA 1W5TA 4BY7J 2DT7B 2VQGA 5ILVA 1OCZH 3TMOA 1W5SA 2P4WA 1TT5B 1F1ZA 4JX4A 2V7FA 3R60A 3BR2A 3K70C 1EV7A 3OYAA 1XS9A 2PG4A 1KQ8A 4II3A 2XAUA 5K5QA 1VQNI 4AWXB 1XCVA 1J7KA 1X1BA 2XF7A 3BR5A 4IQJA 5ILSA 1T0FA 4DNCA 1GVDA 3ECOA 4CCLA 2LY9A 4IKFA 2M34A 3J81K 4XKWA 3LSIA 3BTIA 1QVUA 4LB5A 3TO7A 2ZJ2A 3ELKA 2R92J 4RB0A 3M07A 3S93A 1FOXA 3J7YJ 1VQOI 4B44A 3JAMZ 2K9MA 4MGRA 4Y13A 5L3EA 1PP7U 3D0SA 2LTPA 2LYCA 3HM5A 3PL8A 2I5UA 1MDMB 1SFEA 3K1PA 1YW8A 3FKJA 2QGUA 3JSPA 4RB1A 4Y33A 1Z91A 3CMEI 1YHQI 3A02A 2DK8A 3K7AJ 5ILUA 3VEPA 4XRSA 4BDZA 1T95A 1ZARA 3RTRA 4HQMA 1U5TC 1OR7C 3JRBA 1FTZA 2K3FA 2HYJA 4CYCA 2FX0A 2FQ4A 2XV4S 4PJNA 3A2KA 3L1PA 2EFNA 3G3ZA 4KUMA 5DCMA 2XROA 1G8XA 3CCJI 2A6HF 3JCUC 4CSWA 1WI9A 2NS8A 2ZMEB 4I6ZA 3GLLA 1K83J 1P6RA 1BN5A 2XB0X 4F93B 1MBHA 2Y0SA 4IZZA 3S3NA 1X4OA 4UUTA 4LK0F 4L9TA 1OFCX 3RQIA 2E7WA 1WKMA 2F5FA 4FE4A 2A05A 1BM9A 3SHFA 4R79A 1ZKGA 2QLZA 1ZLJA 4PJJA 2ECBA 2E19A 5FD6A 3HRUA 2DQLA 3BG3A 2WV1A 1QZZA 3JAMK 2FXAA 1K4SA 2OTLI 1VQMI 1P7IA 2P5VA 2XRLA 5LBQA 5JR3A 4AM3A 2GOMA 3MQ0A 3CF5F 1I50J 1K78B 3TP3A 2OF7A 2A6EF 2WB1A 4RM2A 1I3AA 3QU6A 2VLAA 2GZWA 3CJRB 1BIAA 2CW0F 1HOMA 1JTXA 1TNTA 4H4KC 4Y3OA 1JHHA 3CCVI 4XR6A 2L7KA 4MTEA 3LOCA 4KT6A 4WXDA 1B72B 2IGNA 4NC6A 1WI3A 1MJ9A 3BR1A 3BT9A 2OBPA 2B7EA 4G9YA 1QGPA 5DTDA 3U9GA 3TP0A 2A5WA 4CCJA 2JA6J 1DPRA 5LHGA 1O3TA 4D5FA 3E6DA 5FKOA 3KZZA 5F1RA 3KEOA 4RAYA 4CHUA 1W7PB 4AIHA 4BAYA 3HPGA 2LP0A 1T08B 1XPXA 4XKVA 4A3MJ 2LF8A 2IAIA 1FP2A 2OZ6A 1MMGA 2KHMA 3QPSA 3TGNA 4II2A 3HSRA 1PUFB 1XC5A 1ZN2A 4HSRA 2LY1A 3HL2A 1RR7A 3FMRA 3GFMA 1SANA 3WHBA 2CV2A 1W36D 1LEAA 5DYMA 5HVQC 2M8EA 1AHDP 3S14J 1XDSA 3PFIA 2ME6A 4B47A 2BXZA 2CH0A 3DFGA 4UXNA 3BG9A 5DS9A 2IS4A 5F0HA 2D2WA 3OYFA 1F36A 2X1EA 1Y0NA 2DJIA 4Y52J 1WJBA 4IJAA 1VQPI 4ENMA 1I1SA 1FC3A 2DMUA 2LG4A 4MHGA 3OYIA 4G7HF 4OIPF 2MW8A 1D8JA 3KZYA 4IVNA 2IVMA 5HLTA 5CJ9A 1E3OC 4D9JA 1P4WA 2CG4A 2VODA 4M3FA 1U5TA 2R7QA 1OR7A 1CF7A 4RA2A 4DW6A 2DOAA 4C9YA 1TW3A 2DU9A 3LWFA 3F8MA 4IL6C 5EZHA 2BHYA 3LQQA 1FYLA 2AQEA 2CRGA 3QYEA 5KAFC 2O8KA 3PNTA 3DU6A 3GTPJ 1J2XA 3ZQIA 3JSOA 3VOEA 3LL7A 1QNTA 3RKYA 3CP8A 2R7TA 1SD5A 1IRGA 2KZGA 4ZYEA 2R5YA 2NS0A 3GEZA 2HQ5A 1R5ID 4EMSA 2V1XA 3M1CA 3ZQLA 2ZJRF 2G0EA 2KP6A 3F72A 3CDHA 2FRHA 3GTLJ 3NEUA 2GBYA 2Z2SB 5E8IA 5H2FC 1BW6A 1VTNC 1BA5A 1UELB 2EZIA 2ZXWH 3DKXA 1P92A 2EJRA 2EIKH 1IN7A 3F22A 1LE8A 1JJ8C 4E70A 3H5RA 2NYXA 1MNDA 1R1TA 2JSCA 2M87A 3DKYA 3EQLF 2HOTA 4JX5A 1MNEA 4O6JA 1EA3A 2M7AA 5D8KB 5IY5H 4BEHB 1LQ1A 2JA5J 4F91B 3TDUC 2IA2A 4X6AJ 4LG0A 1UJ8A 1USTA 2VXZA 2XVCA 1UZCA 3DU5A 2F5VA 1JKQC 2X48A 4YFKF 3KE2A 4ZZDA 1IV8A 3IKVA 4D0PA 1FYMA 2EQRA 2EFOA 2VKVA 3CUQA 2OAZA 4QIWN 2NVUB 2X85A 1E17A 1JUSA 2PMHA 3FWEA 3E0JB 3CZ6A 4DYCA 2RC4A 3W3CA 2ME0A 2L01A 4B1RA 2V1NA 4A0ZA 2FF4A 1IUYA 3I64A 4YFNF 4ZTJA 3FHZA 1FOKA 3AG2H 5CVJA 4A6DA 3GXOA 2E36A 4XONA 4IHTA 1YW7A 4A3LJ 1EKEA 1SFXA 2M3AA 1ZTRA 4ZDPA 2L4AA 3R6SA 4RDUA 2EA4A 1CGPA 3KP6A 4L9JA 3BTJA 1FWZA 5L3DA 3C2GA 1SFOJ 2E2IJ 2DFFA 2Z3YA 5FLVA 2NVQJ 3GCMA 4ZC3A 2BY2A 2YPRA 3E5UA 5CQGA 1OPCA 3RZOJ 5F27A 1Z7UA 3KIOA 3E6BA 1Z7LA 2DA1A 2DLLA 1YOVB 2QQ9A 2VXDA 3G6EI 1BC8C 2KZVA 2VIXA 3QOEA 2FOKA 3Q3SA 4GYIA 3O8HA 2A69F 1ETVA 2NAZA 2NRAC 1U78A 1U6GA 4BH9A 3ZR8X 4KISA 1TP4A 2HU9A 2QSFX 3QP6A 1D1CA 1P4XA 4A3EJ 3NWSA 2O5RA 4BDYA 4EGZA 1OYYA 3OY9A 1BJAA 1LDDA 4A3IJ 2ZFUA 1IG7A 4DQ2A 5LD2C 4RAGA 2O9LA 4I2OA 3WTWC 3JR9A 2DPUA 2YU3A 2CW8A 2Y48A 1IJWC 2VBWA 2R93J 4YG2F 2PEXA 2KRFA 2X51A 1FSHA 5CYVA 1QHGA 2RDPA 2Q8KA 2IRFG 2LR8A 4QLCU 4LGWA 1ZG1A 4GXOA 3R0JA 5HLHA 2JPBA 2EZHA 2CFOA 1S7EA 2VKDA 1Q1VA 2BBYA 2DOFA 2HFHA 4UVBA 1TC3C 4RGXA 1ZLKA 1R71A 1OCCH 5D5XB 2LBFB 4M6XA 2V1DA 3OV8A 5M3MJ 5EG0B 2XGCA 5HODA 2HNHA 3SDBA 5K5RA 3ZQ7A 3H3UA 5BPDA 1ON1A 2P6SA 2HEOA 2BE5F 3OYLA 3OWTA 1PP8F 3MZYA 3Q5FA 3HSEA 3ZOBA 3WTVC 2ELJA 4A3BJ 5D8LB 2ZFWA 2VJ5A 2XRNA 3RIRA 3P5JA 4L18B 1ON2A 2EZLA 3SXYA 3I56I 4BE0A 2N8GA 2EK5A 3I5UA 1YFHA 5BNGA 4P9UA 5D4RA 4G6TB 3ONQA 4HV6A 4BGDA 1CQTA 4ENNA 2IA1A 5JLXA 4NNJA 1HXDA 2PN6A 4UVAA 5EDNA 3JRFA 4Z2YA 3GTQJ 2VBYA 1SD4A 3BR3A 1D5VA 2M0CA 2GXAA 5M3FJ 2PI0A 5J8FA 3BC8A 2ZB9A 4NDLA 4D1QA 5BOXA 2KMUA 3LSHA 3JRAA 2M7BA 1JTYA 1KU9A 2OU2A 1K6OA 1QA6A 5GAHJ 1OJLA 1D5YA 2JSPA 4G12A 3PUBA 1SD7A 4ZYHA 2A3SA 3K4JA 2EFQA 2O8XA 4PK4A 4MNUA 3A01B 3MEXA 4D7NA 4C2TA 2BVLA 1KGSA 2QKLB 1K79A 4ZTFA 1WHUA 2QSHX 5FLXZ 2VC0A 3LFUA 4BNCA 2XC7A 4BXFA 5M5XJ 3TKYA 1RKTA 2FNAA 4Z6YA 1X3UA 3OSFA 1G3WA 1XMAA 5K7FA 4EATA 2TCTA 1B9NA 2OZUA 2XASA 4Q4ZF 2ECCA 1LDJA 1SMTA 1WGXA 2OPTA 3DWLE 3M9AA 4HA8A 4A69C 1LFPA 1D0ZA 3CD6I 2P5KA 2F4MB 2KIUA 4FHTA 2YUSA 3FXRA 4KN4X 4PDKA 1BJZA 3LSMA 3JREA 4OAYA 2LC2A 3RCOA 1S6LA 4QTRA 1VFCA 2O0YA 5LHIA 1Z0XA 4LG3A 1FBUA 5D4SA 3KP7A 4F55A 1VQ9I 1MGTA 2IPQX 3U1DA 4EM1A 3CCLI 1K61A 3LSPA 1MMDA 1AKHB 3FF5A 2NS7A 2ZKZA 2KRHA 2XKPA 5DUIA 1YITI 3HTSB 2M9HA 3ABUA 2CJJA 3LA3A 1ORKA 2LKXA 3CDLA 3F8BA 4RLFA 5D5WB 5J6XA 2KPMA 3SFZA 1JT6A 4XLAA 2F6CA 3ML6A 2DOEA 3BJ6A 1WQ2A 2YU9J 5D6FA 3MKLA 2HDDA 3HGGA 4CUGA 2LMDA 4UV9A 3IP4B 1QRYA 2MLGA 3GFJA 5FLXK 5CVUA 1UG0A 4U7BA 3OMYA 3FKIJ 1X1PA 3HOVJ 2A07F 2HQAA 4V19K 1MNMC 3G71I 4XSXF 4IOCF 2P7CB 3FMQA 3VSLA 4IHVA 2ETHA 2E5ZA 4IRHA 3S1RJ 4BJTA 2CQ7A 5B1BH 2GA2A 2JVHA 4E6KG 4DOZA 3DP7A 1SD6A 3K4KA 3VODA 2EFWA 1EJ9A 4N9IA 4M9XA 4HSTA 1FTTA 3MVPA 2VPLA 5FFXA 2STWA 1AA7A 4PFOA 4XLCA 3D5SC 2M4GA 1PDNC 4S05A 5J40A 4XORA 2DFEA 3C18A 3KP2A 3L2RA 4MFDA 1HBXG 2HVSA 4HBLA 1WVRA 3EDPA 2H1KA 1HLVA 2DW4A 2W48A 1U2WA 1RZ4A 3F8FA 3GBGA 1ZR2A 3MD2A 4W97A 1M1EB 3UNGC 3E6CC 1W0UA 2L9NA 4CCKA 2BOLA 2R7XA 3ULQB 3BTLA 3EETA 3HIFA 1EH7A 2AXLA 2QF7A 4BQAA 2VOPA 1TWFJ 2V9VA 1QPMA 4ENKA 2UXNA 1OKRA 3BR6A 1AU7A 2HQNA 4PFPA 2Q2EB 5LGNA 1FYKA 2K86A 3F0CA 4ZDLA 2QQBA 2E1NA 1Y0UA 2XAHA 3DTKA 2ZXIA 4GFBA 3ABKH 1A35A 2H27A 2X1DA 1R00A 2MYSA 4BACA 2FJ1A 2RNGA 1KYWA 2X9DA 1NG6A 5HS7A 2ZJQF 4OIOF 1ULYA 2R7WA 5LEJA 4G7ZF 2PX9A 2ZMEA 4L0YB 5EEGA 3AL0B 2P5LC 2DA4A 4NB5A 5DUKA 1RRJA 3HOZJ 2W7NA 5IT9Z 1KQ0A 4ABZA 1FZPB 1FIPA 4A0YA 3KFWX 3VYSB 4OU0A 1YTYA 2W00A 3S1QJ 1WWXA 5L3GA 3OL3A 4CH7A 1XB4A 3FZVA 3PIPF 2ZJPF 1JGSA 2NOJB 3ZQGA 1MD0A 3CO7C 2L7FP 2RQPA 4NHJA 3J7ZI 2LLKA 1E0EA 3VYUB 3IH2A 2JRTA 1K4TA 3K4CA 1D1AA 4G94A 3P9IA 4PJLA 4FX0A 3SQNA 5LRSA 1K78A 3IH3A 3K4BA 2YSRA 4BS9A 4DIQA 1Z67A 4A3DJ 3OL4A 2FMLA 3OYNA 4CA0A 3ASNH 2JTVA 3V42A 3VFZA 5CVRA 1R9TJ 2K40A 2L54A 3H1CA 1ITYA 5E1WA 3GMEA 2PJRB 2W82A 4P96A 3ZP5A 1HW1A 2VPRA 2STTA 3DLAA 2PQ8A 1Y1VJ 1X1CA 1ZGWA 1HDPA 1WZ2A 1G59A 1EH8A 2QA4I 5FRMA 1OLTA 3DLLF 4XLNF 5FROA 4PCQA 1ODDA 1XD7A 4DBQA 2X6WA 2JA2A 3KX2A 1KU3A 2KFDA 3K2ZA 2DYSH 3WTYC 3LAJA 2VQHA 5E3OA 1Y6IA 2CU7A 2V1UA 2FBHA 2GIZA 1O57A 5B66C 3FISA 1HA8A 1W7PA 4HF2A 4X0GA 1FT9A 3D5RC 2IT0A 4U0WA 4XSZF 5IT9K 1YX3A 1KYZA 1ZH5A 2C6YA 5HLGA 2V9KA 1IRZA 2Y9ZA 2L5QA 4G6DA 4A0XA 1HW2A 3BQYA 2XDVA 1PUFA 3LMMA 2AHQA 5IOYA 4OIQF 4JQFA 1V5EA 3SZPA 2W84A 2XGDA 4HPQA 2VE9A 3ZQCA 2WV0A 4A3JJ 3HTUA 2E1OA 3MN2A 1JXSA 3BZKA 3V8KA 4XRMA 3DEWA 3BG5A 2F4OB 1U9OA 1Z3XA 4R1HA 2AS5F 4P55A 1Q1HA 2VT2A 2WY7Q 2HR3A 4AIDA 5JHFA 1YX5A 3JTGA 3ESWB 3G1OA 3FBIB 3KYDB 2Q0OA 2J5PA 4BKXA 4JK1X 1HKTA 4WCGA 1QZEA 1LVAA 1LFBA 1S3JA 5BQTA 4XMYA 4A93J 2R0QC 1KQ9A 3KP5A 1JKPC 2HVQA 2K4BA 3A0HC 4EJOA 2XPUA 2DA6A 2H6CA 3BCAA 3ZN0A 4NC8A 4AC0A 4KIGA 3BG7A 2JUGA 4HF1A 3FK6A 1XSDA 2GQQA 2VQCA 1YI2I 5TJJA 3H9QA 3PQKA 4KA4A 3I3LA 2DTZA 3M7GA 2DN0A 4LITA 3WE3A 5KNLA 1VQ8I 3JRDA 3I4PA 3C7JA 4B3AA 3LSJA 3M8EA 2NXNB 3HC7A 2KL4A 2E1MB 3CCSI 1P4AA 3OOPA 1IXSB 2H8RA 2PFBA 4IHWA 3P9KA 4OIRF 2VB6A 1MZBA 2DQRA 1KU2A 1D1BA 2Y31A 3G2BA 2VUMJ 2PLYA 3QPHA 4XRFA 4M3BA 1FMVA 3CUQC 3WG9A 4IRGA 3WHCA 2OCCH 3H36A 3OYJA 1YYVA 3A03A 3V4GA 3OYEA 3GTJJ 3E7LA 3BDDA 1YJNI 4BEHA 4V2GA 3ASOH 1FBSA 4KMUX 5H6RA 3WTXC 1LEBA 4GRIA 1XMXA 4HX8A 1I1GA 2IBDA 5EJCA 2D1HA 3GWZA 2LD5A 5M5YJ 1MSEC 1V5GA 4CDGA 1IRXA 4RBOA 2JMWA 2F2EA 3S3MA 5IOZA 1WH7A 4XOPA 4BL0B 1DPUA 3MKWB 1ZG3A 2LKSA 2B63J 4M74A 3F9KA 4IOAF 3RPUD 1S7AA 2MC4A 3CCYA 3BWGA 2VT3A 3CUOA 3K2AA 4UVCA 3CP2A 2LREA 3C3WA 5KK1A 4I02A 3PNYA 1XDUA 2M45A 2QQAA 3JRHA 1U9NA 1JHFA 4BXXJ 5F08A 1HQCA 2KJBA 1REPC 2WC2A 3R4KA 5HDGA 1HSJA 4ZH4F 3RI4A 3JRIA 5HDKA 2E2JJ 1X1DA 1MIJA 1PJRA 2COBA 1UHMA 4BHCA 2CW7A 1MJAA 5CVIA 1Z9CA 1WJEA 2QVOA 4OAZA 5E1ZB 1KONA 1N77A 1JKOC 3TL4X 3O3KA 1UCRA 3JRGA 4AVPA 1ETWA 2RKHA 2HDWA 3E5XA 1S72I 3DTIA 3MMYB 3V7SA 3H35A 3RKXA 3BJOA 3IHUA 4XK4A 3I55I 2Y9YA 5HS9A 1D8KA 2HVRA 3AG3H 4M9ZA 1BIBA 2W24A 4LK1F 3LNQA 2HWVA 4B43A 1IF1A 1W36C 1ZRFA 5E8GA 1XGOA 3OS2A 1W0TA 5HNFA 1D0XA 1X3WB 1TNSA 5LGTA 2CO5A 3K4LA 2Y30A 3L00A 2ZCWA 2X6YA 1HDDC 2DODA 3PO2J 5DD4A 4Y15A 3DEEA 2WBMA 1F9NA 4PGHA 1DU6A 1IN8A 3HEFA 5FRNA 2HYGD 3BY6A 5IYDJ 1GV2A 1WH5A 2VJJA 1H9TA 1A5JA 1ZREA 3GTKJ 1SMYF 5IP6A 1HF0A 4KIBA 4U7DA 4Y4RA 5E79C 2VE8A 4F7ZA 4P9FA 1T98A 5EG0A 5B3SH 4CCNA 2OCEA 3E5QA 3HHGA 5J8CA 1VI0A 1BBYA 3HDDA 1SVMA 2QUFA 4O3MA 2Z1DA 2COMA 2VQLA 4RMNA 5GPAA 1ZYRF 1RNLA 3ROUA 4HNVA 1RPWA 4KFCA 2BEOA 4PJ0C 1FJLA 2BY1A 2JA8J 2DA5A 3ZMSA 3LA2A 2IS2A 1RKWA 3V7RA 4UUSB 2E34A 4LMYA 4MEYF 2DBBA 4DZPA 1J59A 1JJ6C 3H0DA 2MGQA 4HW0A 3HUGB 4I99C 2QEXI 3BPXA 1MBJA 4NC7A 3M1EA 2WAQN 4KN7X 3QYFA 1L3LA 5DM6F 3GFLA 4KYWA 2Z5UA 1OCPA 3I59A 1N78A 9ANTA 1VQ5I 2DA7A 3OYKA 1IN4A 3FXLA 4LB6B 2JK3A 1FX7A 3GZ5A 3SEQA 4A6EA 2IEKA 3K4NA 4IHSA 2LRDA 2GAUA 1LJ9A 2GM4A 4E7HA 2L9RA 5HNHA 2XSJC 1WPKA 3QWLA 5B5EC 1ONVA 1FEXA 1OCRH 4BHPA 4L5IA 3L2VA 2IJLA 5LFAA 3T8TA 3VDXA 3GZ6A 1SAXA 4XOTA 4AVZA 4A12A 1W4MA 1WCMJ 3DPUA 4Y7NJ 2OV7A 4CZZA 1X1AA 1G2HA 1T2KA 3HPHA 4CGZA 1NTCA 4EV0A 4E7JA 4ANJA 1EH6A 4M6YA 4OINF 3RYRA 3FM5A 1NK2P 2Z9OA 2OA4A 2DJNA 1V55H 1CF7B 2OD5A 3IH4A 3CCEI 3K4MA 2OUMA 1P2FA 3IL2A 2H8WA 1SC7A 2BW3B 5GPCA 5E3LA 3DQVC 2EPFA 5E20A 1TWCJ 3MKZA 1YRNB 2XAJA 1QPIA 2R5ZB 3BJAA 2FD5A 2V26A 1E3HA 3IWZA 5DDGA 2FSWA 4P1WA 1BC7C 4A5NA 4FISA 4PSXA 1R1VA 1GV5A 2DFHA 5JVGF 2BY0A 4EM2A 1V3FA 2K85A 1HKSA 1AKHA 3D1NI 3S1MJ 3AFHA 4KJZA 2DTRA 1LE8B 4BBRJ 4WWCA 1GXQA 3ZMUA 3AKZA 2HQRA 4RGRA 2GIVA 2I10A 3FXQA 2O7OA 2W1OA 1HKQA 4AUXA 2LDUA 2X1CA 4MEXF 1TWAJ 1JI8A 1QQIA 2X6OA 1ZAOA 4LG0B 1DP3A 1ACIA 5HLIA 4MO7A 1X2MA 4Q48A 4YRVA 2LSOA 3KEQA 1T6SA 2MD5A 1AWCA 2GLOA 2KDOA 4EQQA 4BJ5C 2M2EA 1IRFA 2Q1ZB 2MH2A 3BZ6A 4E4HA 2WAEA 1MBEA 4KITB 3Q0VA 3I4MJ 3T8RA 3U1KA 4CICA 3ZMDA 3L2UA 4YIRX 2QBYB 3G1LA 2VJIA 2L02A 1ZGJA 2JUCA 3KPHA 2R7UA 2VC1A 5J1YA 3W2WA 2H6BA 4JBAA 5KHDA 2CGPA 4AYBN 1S7OA 4P5OA 4EJUA 2MLKA 2VBZA 2W25A 2Y69H 4GDFA 2O6GE 1XSVA 4L5JA 4HX4A 4N4NB 3F21A 3EUKL 3F8CA 4Y17A 4UB6C 3EUHC 4U87A 2OQGA 4F92B 4BHBA 1T8IA 1XGSA 1B59A 3OYHA 3VYTB 2RV8A 4E7SA 5L3FA 2NNNA 3ZQQA 1IN5A 2IW5A 1BOAA 1OISA 1Z3YA 3LSKA 1WJFA 2BHZA 2DA3A 2X4HA 4HOBA 4U0VA 4XKBA 4EVIA 2M4KA 3ZMZA 1X3ZB 3A1YA 2AXTC 3C2BA 3E6MA 5CKTA 2ZMEC 4HLYA 2Q2EA 1V5FA 1YJ9I 4IXAA 4L9VA 4IQ4A 5C3EJ 5FFZA 1UHSA 1YJWI 5C44J 2QZ8A 1MBGA 4A3KJ 1YE9A 3JTHA 1FY7A 5LEKA 3EPZA 5ICFA 1FNNA 1I3QJ 1R23A 2EINH 1MH4A 3X2QH 3UKGA 2AQFA 4ZYDA 3SZTA 3WODF 1SEUA 2KT0A 1TQIA 1GHCA 2ELKA 3J80Z 1YIJI 1MJBA 1DUXC 4AU7A 2L2OA 3ZRGA 2JT1A 2VONA 3NWTA 1BI2A 2ZC2A 5BPIA 5KAIC 3PQJA 1YW9A 1LB2A 2XUBA 4BUPA 2LNBA 1JKRC 1ZRCA 2JQ7A 3KCCA 2K27A 4KDPA 1GXPA 3V8JA 2HKXA 2E1MC 2WAQA 2LY2A 5LHHA 1RC9A 4RLQA 4JYKA 3ZGKA 5D5UB 2CUEA 1J75A 4RAFA 3WGHA 3DBHB 3CC7I 1YS6A 3K1MA 1B8IB 2HOAA 2XIGA 4UHTA 5HOOA 1STZA 4NBQA 3HOWJ 1X19A 4ZYAA 5KCMA 3E1SA 1Z6RA 3W6JB 2CWEA 3P9CA 2DDBA 5H20A 5DD8A 3QODA 3JW4A 3S32A 4AIJA 1LPQA 2HZTA 5L3CA 2XF6A 5KVRA 3QPLA 4OOIA 2CQQA 2PJRA 2LVSA 5LRRA 2HGCA 3I9V2 3BZCA 1P7JA 1W1WE 1W5CC 3J7AY 1USSA 2IGKA 4JX6A 3FHNA 4ENJA 1JE8A 2HPIA 3BCBA 3DV8A 2CUFA 2PJPA 4I0BA 1IV6A 3CESA 2HS5A 3M4OJ 2ZBKA 1X4PA 2E2HJ 3HOYJ 2KDZA 3T1BA 4YFXF 2E5NA 3VSKA 1MH3A 2PMZN 3WTSC 4KIFA 4QSHA 1Z05A 1U8BA 3J80K 3PO3J 2JVGA 3ZXSA 4M9SA 1MDMA 4OMZA 2ZSIB 4HZFA 4C2MJ 3H5NA 2GXGA 3TOAA 4PGGA 4I7HA 3DXJF 1I6XA 3HZJA 2EIJH 5EGOB 1JGGA 3S8PA 4N4OB 2TRTA 3HB9A 2E60A 2KRCA 2HKOA 4U88A 4XICA 2LH9A 2ELHA 1T38A 3EUHA 2B0LA 4DBRA 1ZQ3P 3L2QA 1DGWY 4YIFA 2K9SA 3QRFF 1IO2A 2FBKA 5FJ8J 5CLSA 5CQEA 3S3OA 3H0GJ 5DEQA 3TOBA 4IHXA 4K2EA 1APLC 3I54A 1B6AA 5BS6A 1IDYA 4B48A 4V2FA 3ISPA 3BLYA 2WADA 2EBIA 1RI7A 2XKOA 1WSUA 4XIDA 4LLGF 1LFUP 2XGEA 3I71A 1I5ZA 1O4XA 2R7DA 1ENHA 3W6KB 2DMNA 5DCFA 5EEHA 4D7MA 2HYFA 3OIOA 2DA2A 4FQGA 2XHKA 2XAFA 1QBJA 4DYRA 1J9IA 4IX7A 1KZHA 3RJPA 1ERDA 1DQUA 4A2UA 3K70D 3CCQI 2O03A 1ZHFA 2L9SA 4NQWB 2QM3A 2VKHA 2KKOA 4HF0A 5DV5A 1C0WA 3T0YA 3IRRA 3GLXA 1R6RA 2Z16A 2VASA 1JUPA 4XN0A 3S1NJ 1IGNA 4HNTA 1T39A 2EH3A 2F4IA 3TQNA 5J1UA 3Q9SA 3HOTA 1JT0A 2V9PA 4UUVA 5AIPA 1Z77A 2VOOA 3FM3A 4BE1A 1I27A 3E97A 5HDNA 3BR0A 2DO7A 3OR2C 1SVLA 3KLOA 3IC7A 2KISA 4AYBA 3CJQB 1OQYA 3CTAA 1S29A 5ED4A 1B72A 3FXUA 1MMSA 3NAUA 4J19A 1Y56A 4AD9A 3GYHX 1YIOA 1NH3A 2P0WA 1ETOA 1XTAA 4F3QA 3F23A 4CO8A 4MLOA 1J09A 2DCEA 1UHWA 2KQRA 2QKMB 1L0OC 1MKMA 3CMAI 2FOWA 4I09A 3CQZJ 3CMYA 2Y2ZA 3OYGA 3DPTA 3L2CA 2MBFA 1HCRA 1H88C 4HX7A 4NUBA 2LK2A 1H8AC 4XM3A 5IT3A 1R36A 5M5WJ 3S2DJ 3AAFA 1FOWA 2Z99A 1V4RA 1BI0A 3QAHA 4M3DA 4Q5SF 4HEA2 2RN7A 1I6HJ 3DCFA 1YG2A 2XAQA 2XSDC 3ERED 5TISC 3NRVA 3BQZA 2H1LA 3O2PE 4RB2C 3OIQA 3TO9A 4L5EA 2K9NA 3ZQFA 1MBKA 2MA3A 2QQ8A 1BOBA 5JI6A 4AIKA 4GO1A 4A3GJ 3V8LA 1J0RA 3S15J 2K9QA 2UZKA 4W1UA 1TWHJ 4FX4A 4XLEA 3MCZA 4G7OF 2ZNYA 2JN6A 2MD0A 1YLFA 5E1XA 2FEZA 2ID6A 2WY8Q 3IWFA 3IAM2 5IP7J 1TBXA 3K0LA 1MBFA 2D1VA 1XGMA 1RIOH 1A04A 3HXLA 2MSYA 2EV5A 3DBLB 4S04A 3ZCOA 2CYYA 4CCOA 1P9QC 1XSXA 4HDVA 3WU2C 5JFRA 2WA0A 2CV1A 1VQ6I 2XPVA 2FU4A 4B4CA 5LLQA 3I0TA 1MW7A 4RB3C 3CCUI 2ISYA 2V4JC 2P81A 2YX4A 3K1NA 4O5VA 2D5VA 4LJZF 3MZ8A 1R4MB 2HXOA 2VN2A 4RM3A 1QZYA 5K7ZA 1IDZA 2LOOA 2F5CA 3OR1C 3VPRA 2WWYA 4EJVA 3FIWA 3HJEA 2EILH 4QWQA 1F43A 4LIUA 1IC8A 1LVKA 4BQNA 4WX9A 5HS8A 2BGCA 4M72A 3CJTB 2W4SA 1VZ0A 3N97A 3HRSA 2JRMA 2ZNZA 4FTHA 5B1AH 1TW2A 2DDAA 3MFKA 2VBXA 2M0MA 4ESBA 4L9NA 4YELA 2PMZA 3GW2A 4ON0A 1OMIA 1B9MA 1HC8A 1TZLA 2EV0A 1R5GA 4G6QA 2CQXA 4GGGA 3QQAA 1G3YA 5AONA 3TW7A 4WXCA 3IKTA 1TQPA 2BYVE 2NNYA 1YQAA 4PJMA 4TV7A 1SFKA 1DP7P 3S16J 3C2HA 3F8NA 3J7AO 2A68F 4EJTA 1B4AA 3F6VA 4UUSA 2P8TA 4L0ZB 1XMKA 4HDUA 1ETXA 2BVMA 1G6NA 5FLMJ 2IXSA 3BTCA 1FMWA 5LGUA 4A5MA 4DJAA 2RAEA 3CLQA 3ECHA 3HUGA 4BQQA 2R7RA 1TWGJ 4EGYA 2L7MP 5FD5A 4PUSA 4XRSG 2CV0A 2YS9A 3H5AA 2HXIA 1MMAA 1U0JA 3FXKA 1Y1WJ 2K4JA 3W6VA 4LOCA 4I98B 3G73A 4HAMA 5FKNA 5FO5A 2YX7A 2I8DA 4BU2A 3GX4X 6PAXA 5DM7F 2UV1A 1O7LA 4LLNA 3PUFA 4GYGA 4PSWA 2HOEA 1B1BA 2XB5A 4MIMA 2RGVA 4CYCB 4B8XA 3LQRA 2B9SA 2GXBA 3OS0A 5DCMB 1IXRC 3HBLA 2FUG2 3MAJA 1N75A 3FK7A 3FMSA 1BI3A 3QOPA 3L2WA 3JRCA 3SEZA 2NVYJ 2R7OA 1G3SA 2A6TA 2K7LA 4RS8A 3RZDJ 2V79A 1XGNA 3R0AA 1RR8C 3HRMA 4LFUA 4XLPF 4CZCA 5E18F 4M6VA 1YO5C 1BL0A 2HZDA 4HYEA 3MZHA 1R58A 1O3SA 3RKWA 3EYYA 3HOUJ 1WFXA 3IUOA 3ZMTA 2BW3A 1ZGAA 4XBFA 3S17J 4A3FJ 1YRNA 2CUJA 3IRQA 4KNYA 4C3IJ 2V6CA 4EM0B 2R5ZA 2HTSA 1WJAA 1MSFC 1FLIA 1YS7A 4HRIA 2LBFA 2J5OA 3C1DA 4DGWB 1O7FA 3RPQA 3L7WA 3V7CA 3GTOJ 1Y39A 3S2HJ 2M1BA 4BY1J 4F52A 1QVTA 3PIOF 3ABTA 1E3PA 4OMYA 3WG7H 2P7VB 2BY3A 5F6FA 2QCOA 5GTIC 3CCRI 3PSFA 2ZXHA 5JHUA 1OYIA 2ICWG 2JJ7A 3LA7A 1X58A 1V54H 2P6TA 1NHAA 4LIVA 4MTDA 5GTHC 2IS1A 2G7HA 3D5LA 1H89C 1WJ5A 2R7FA 4JP0A 2IP2A 2K02A 2JPCA 3B6CA 1NG7A 1S9HA 4ETSA 5EF6A 1D0YA 2FMYA 4C2UA 3TEDA 2GOXB 4Q47A 3N05A 2CS3A 4FE7A 5ICGA 2EIMH 1E2XA 1FOYA 1RETA 3DPLC 1F4KA 3I53A 3BP8A 2KJCA 4HLXA 2DPDA 4BXUA 2QBYA 1IAWA 3KZIC 3UR3C 1WJCA 3QYBA 3SFIA 5EZGA 4C3HJ 3M3YJ 3M8FA 1NK3P 5FKMA 3U21A 4EEFG 1R7JA 5TRDA 5FB2A 2CQKA 2ESHA 3HKZN 3AG4H 3A01A 4XLFA 1H9GA 4ITVA 1MMNA 1IN6A 1VNDA 3NARA 5EEAA 2ACJA 1GT0C 2HTJA 1WRJA 4ZZLA 3DBRB 3P7NA 3CDIA 4MQVA 4WXHA 1QHHD 2RREA 2KIQA 4N9HA 2K9LA 2H09A 3FXMA 1IXCA 3FXOA 3QPTA 3WE2A 4HNUA 3PM1A 1OCOH 1PYVA 3PSIA 2FBIA 2LF7A 1SFUA 4FT8A 1UAAA 2KIFA 1U5TB 1UG2A 3HG9A 3RYPA 1BR1A 5F04A 2ZO4A 2FQ3A 3VWBA 5ERIA 2CMPA 2L7ZA 3RPUA 3PJRA 2E35A 4I76A 3AL0C 3CLOA 2RNJA 3GUDA 2FNPA 2OC6A 2IGMA 2VJ4A 3OYDA 3T5XA 4FETA 3S2WA 1BW5A 2DFIA 2QENA 1TQMA 2XAGA 3GZNB 4GCVA 1AOYA 2R5YB 2WAFA 1Z1DA 3K6GA 3TO6A 2RVCA 1FSEA 1F5TA 3BOQA 2Y75A 5J47A 5AIQA 1VQKI 3Q0WA 4D5CA 2HOSA 1ZG5A 4ESJA 1TTYA 3Q0UA 5TGTA 3ABLH 1ETKA 2QWWA 3RSNA 4B3XA 2PBIA 3HSFA 1XCBA 3W2AA 3H92A 3SJMA 2LFBA 4IO9F 3WTUC 3KYLA 4M3EA 3NQOA 4DYQA 3LAPA 1VQ7I 4BYYA 5ICEA 1VF9A 1DGRM 2EV6A 4U0YA 1ETYA 2X6XA 3ZQHA 2QSGX 4HQEA 1H0MA 3EUAA 2IA0A 5A2QZ 3M8JA 1B8IA 1POGA 1R49A 2UUZA 1R1UA 3I58A 3K10A 2EB7A 3CUQB 2NVXJ 2IS6A 1UB9A 4C30A 1VQ4I 5JVTA 3BG6A 1VQLI 3EYIA 1FPQA 3KP4A 3REOA 2KIMA 2F48A 4S0HB 1BR2A 2QYOA 3RDIA 4UY8I 2EFPA 1ZELA 2FA5A 4XNFA 4DZJA 3LSGA 5F1JA 3CF2A 1BI1A 4IHYA 5JLWA 1S5LC 1SVOA 1I39A 4M73A 2HI3A 4UB8C 4CYDA 2X0LA 5J3LA 1SAUA 3RKQA 3A4CA 3PFYA 1D3YA 4KICA 1A36A 3I59B 1T56A 4YIIA 4ZDOA 1PVEA 1UFMA 2M5WA 4WF2A 1EF4A 4JOMA 1RESA 1K7AA 1PUEE 3BPVA 2K5CA 1QO0D 3PNVA 1DDNA 4M71A 3WU0A 2EWNA 1XX5A 4LD5A 5E3NA 1RUOA 1QU3A 2R3SA 2DMPA 5K1YA 1OYWA 1DU0A 2G9WA 2VL8A 2E71A 3CC2I 4E7KA 2GWRA 1LNWA 2TDXA 5GP9A 4RAZA 5EGOA 5C4JJ 2DMTA 4XL9A 5IYCJ 5BMZA 3WU1B 3DTEA 5IP9J 3KLNA 2F5EA 3BROA 3F6OA 5F64A 5A2QK 1IW7F 1U3EM 3G1MA 2ESNA 2ZSHB 2OQRA 3GTMJ 4QPOA 2DYRH 4HG2A 4XLHA 2JWTA 4XKCA 2UWMA 2ID3A 3IV5A 4UV8A 3VYRB 4B09A 5J1RA 2M30A 5C4XJ 4IEJA 2MH9A 3CC4I 1TT0A 2R7SA 3ZPLA 3SYTA 1LDKB 2EZKA 1IZ1A 3OYCA 2Y0MA 2BXYA 2D45A 3HOXJ 1O3RA 4MQ9F 3K9TA 3H3VK 3SDGA 3HOSA 2VI6A 3K69A 4J01A 2LKPA 5IPAA 1KU7A 4OWRB 2KLOA 2VKEA 2BZTA 2MC3A 4WK8F 3U2RA 4NQWA 5CPRB 3GF2A 3O6BB 4G8XA 3ZN1A 5E17F 1K6YA 4ESFA 3G4SI 4IRIA 2JZYA 2EA2A 2L9VA 2K3PA 1A31A 1W7PD 2DK5A 2DMQA 5E3MA 2E1CA 1UMQA 2R4GA 3WTZA 3O8GA 2XPWA 3E3VA 3L9FA 5K5OA 3KETA 3KEYA 3F3XA 5CVVA 3MKYB 3QP5A 3COAC 4E7IA 4FASD 2Y0SN 2Z33A 2DXIA 3GFIA 2DAOA 4UNOA 1IUFA 4A3CJ 4E7ZA 3CMMA 3WGIA 1GUUA 2DI3A 2O61A 3OYMA 5EYRA 3HGYA 3ZMVA 1RUNA 1T0FC 5FKKA 3CO6C 3ABMH 1OCTC 3HKZA 4RGUA 3OS1A 2MG4A 2DT6A 1R5HA 1HSTA 4BJ6C 2R7VA 3H3ZA 3SZGA 3GO5A 5J4YA 4I01A 2AO9A 2OJED 3WGGA 3FDYA 4CXFA 2JA7J 4N0BA 3KYCB 1G4DA 1N25A 1G3TA 1KA8A 2WB1N 5F0FA 2L0KA 2R7ZJ 2A5YB 3KP3A 3QU3A 1Y8QB 3VB2A 3DKWA 1JUMA 2E7XA 2XF5A 3GVAA 1GDTA 2WTEA 3IAS2 4BBSJ 3FBNB 4XQFA 3B02A 5D6EA 5H6QA 3N4MA 2CUZA 5FKLA 5L3BA 4BQOA 4HV5A 1J5YA 4PZJA 1BR4A 3TBIA 2HDCA 2XGXA 3AG1H 4C3JJ 4X1EA 3OSGA 4R8HA 3H9JA 1T33A 4IF4A 3OYBA 3TDZC 2CFXA 3LSRA 2MFZA 3RQ4A 1LKXA 1S8NA 4MFEA 3W2VA 1XN7A 3MWMA 1ZR4A 1GLNA 3LFKA 5FGMA 1Z6TA 1XG1A 3FX3A 4YEJA 5K7HA 2W57A 3TW6A 3ERMA 3Q9VA 2IGOA 2RQQA 3CJNA 3B73A 4ZYGA 4LLLA 3HRTA 1FBQA 1R4NB 3HYIA 3A0BC 4EJWA 2V6EA 1GVJA 2GA1A 3DEUA 5GADJ 5GAGJ 1Y8RB 1A6IA 3HHHA 3OIPA 2L4MA 2UXXA 1U8RA 4KMFA 5F0CA 2PMUA 2NVTJ 2ISZA 3OOUA 2H94A 3B6AA 3J81Z 3DF8A 2G7UA 1LUJB 2BV6A 3CCMI 3GTGJ 2ZXJA 2O3FA 3H9GA 1Z21A 1TLHB 4E7LA 2W85A 4H0EA 2A61A 2NOGA 2FE3A 5D5VB 2ADUA 5GAEJ 2MABA 5J4VA 2HPMA 4IPAA 1ZRDA 4M3GA 4I0AA 3LSTA 4J00A 1HW5A 3R61A 2DT5A 1WJDA 4FCYA 2CQNA 4QPQA 3FXJA 5IYBJ 3WTTC 2OTJI 1X2NA 4BE2A 1ETQA 3I4NJ 1R22A 1O3QA 5ICCA 2M8GX 1FP1D 2L3DA 4XN3A 2F5DA 2YR2A 4RGSA 4KT5C 3L09A 4CCMA 4ZJZA 1A6QA 1ZK8A 1FIAA
chains in the Genus database with same CATH topology
4ASNA 2CSOA 1W5TA 5ILVA 1W5SA 2P4WA 1F1ZA 3R60A 1EV7A 1KQ8A 2PG4A 5K5QA 4AWXB 1XCVA 1J7KA 5ILSA 1T0FA 4DNCA 3ECOA 3J81K 4LB5A 3TO7A 2ZJ2A 3ELKA 4RB0A 3JAMZ 4MGRA 4Y13A 5L3EA 1PP7U 3D0SA 1MDMB 1SFEA 3K1PA 1YW8A 3JSPA 4RB1A 1Z91A 2DK8A 5ILUA 3VEPA 1ZARA 3RTRA 4HQMA 1U5TC 2XV4S 2EFNA 3G3ZA 4KUMA 5DCMA 2XROA 2A6HF 1WI9A 2ZMEB 1P6RA 1BN5A 4LK0F 4L9TA 2E7WA 1WKMA 2F5FA 1BM9A 3SHFA 4R79A 2QLZA 1ZLJA 5FD6A 3HRUA 2DQLA 1QZZA 3JAMK 2FXAA 2P5VA 5LBQA 5JR3A 3MQ0A 1K78B 2A6EF 3QU6A 2GZWA 1BIAA 2CW0F 1TNTA 1JHHA 4MTEA 4WXDA 1MJ9A 4G9YA 2OBPA 1QGPA 3U9GA 1DPRA 5LHGA 1O3TA 3E6DA 3KZZA 5F1RA 3KEOA 4RAYA 4CHUA 1W7PB 4AIHA 4BAYA 2LF8A 1FP2A 2OZ6A 3TGNA 3HSRA 1ZN2A 3FMRA 3GFMA 1LEAA 5DYMA 5HVQC 2M8EA 1XDSA 3PFIA 3DFGA 4UXNA 2D2WA 4IJAA 4ENMA 1I1SA 1FC3A 4MHGA 4OIPF 4G7HF 1D8JA 3KZYA 4IVNA 2IVMA 5CJ9A 1P4WA 2CG4A 2VODA 1U5TA 1OR7A 1CF7A 1TW3A 2DU9A 3LWFA 3F8MA 3LQQA 1FYLA 1J2XA 3JSOA 3VOEA 1QNTA 3RKYA 1SD5A 1IRGA 4ZYEA 2NS0A 3GEZA 4EMSA 2V1XA 3F72A 3CDHA 2FRHA 3NEUA 5E8IA 1VTNC 1P92A 2EJRA 1IN7A 3F22A 4E70A 2NYXA 1R1TA 2JSCA 2M87A 3EQLF 4O6JA 5D8KB 1LQ1A 3TDUC 2IA2A 4LG0A 1USTA 2VXZA 2XVCA 4YFKF 3KE2A 4ZZDA 3IKVA 4D0PA 1FYMA 1E17A 2EFOA 3CUQA 2OAZA 2PMHA 3FWEA 2RC4A 2L01A 4A0ZA 2FF4A 1IUYA 3I64A 4YFNF 3FHZA 1FOKA 5CVJA 4A6DA 3GXOA 4IHTA 1YW7A 1SFXA 2L4AA 3R6SA 2EA4A 1CGPA 3KP6A 4L9JA 1FWZA 5L3DA 2Z3YA 2YPRA 3E5UA 1OPCA 1Z7UA 3E6BA 2DLLA 2QQ9A 1BC8C 2FOKA 4GYIA 2A69F 2NAZA 2NRAC 1U78A 1U6GA 4BH9A 3QP6A 1P4XA 4EGZA 1OYYA 1BJAA 1LDDA 4DQ2A 4I2OA 3WTWC 2DPUA 2YU3A 2Y48A 2VBWA 4YG2F 2PEXA 2KRFA 1FSHA 5CYVA 2RDPA 2Q8KA 2IRFG 4QLCU 4LGWA 1ZG1A 4GXOA 3R0JA 5HLHA 2JPBA 2BBYA 2HFHA 4UVBA 4RGXA 1ZLKA 5D5XB 4M6XA 2V1DA 3OV8A 5K5RA 3ZQ7A 3H3UA 5BPDA 1ON1A 2P6SA 2HEOA 2BE5F 1PP8F 3MZYA 3Q5FA 3HSEA 3WTVC 5D8LB 2ZFWA 2XRNA 3RIRA 4L18B 1ON2A 3SXYA 2EK5A 3I5UA 1YFHA 4P9UA 5D4RA 4HV6A 4ENNA 2IA1A 1HXDA 2PN6A 4UVAA 4Z2YA 2VBYA 1SD4A 1D5VA 2PI0A 5J8FA 5BOXA 1KU9A 2OU2A 1K6OA 1SD7A 4ZYHA 2A3SA 2EFQA 2O8XA 4MNUA 3MEXA 1KGSA 1K79A 5FLXZ 2VC0A 4BNCA 3TKYA 2FNAA 1X3UA 1G3WA 1XMAA 1B9NA 2OZUA 2XASA 4Q4ZF 4HA8A 1LDJA 1SMTA 3M9AA 2P5KA 2KIUA 4FHTA 4KN4X 3FXRA 4PDKA 1S6LA 2O0YA 5LHIA 1FBUA 5D4SA 3KP7A 1MGTA 2IPQX 3U1DA 4EM1A 3FF5A 2ZKZA 2XKPA 5DUIA 3HTSB 3ABUA 3LA3A 3F8BA 5D5WB 5J6XA 3SFZA 3ML6A 3BJ6A 1WQ2A 5D6FA 4UV9A 2MLGA 3GFJA 5FLXK 5CVUA 4U7BA 2A07F 4XSXF 2P7CB 3FMQA 2ETHA 4IRHA 2GA2A 3DP7A 1SD6A 3VODA 2EFWA 4N9IA 4M9XA 5FFXA 2STWA 1PDNC 4S05A 3C18A 3KP2A 1HBXG 4HBLA 3EDPA 2DW4A 1U2WA 1RZ4A 3F8FA 3E6CC 3ULQB 3EETA 3HIFA 1EH7A 2AXLA 4BQAA 2VOPA 2V9VA 1QPMA 4ENKA 2UXNA 1OKRA 2HQNA 5LGNA 1FYKA 2K86A 2QQBA 2E1NA 1Y0UA 2XAHA 2H27A 1R00A 1KYWA 5HS7A 4OIOF 1ULYA 5LEJA 4G7ZF 2ZMEA 4L0YB 5EEGA 2P5LC 4NB5A 5DUKA 5IT9Z 1KQ0A 1FZPB 4A0YA 3KFWX 4OU0A 1YTYA 1WWXA 5L3GA 1XB4A 3FZVA 1JGSA 1MD0A 3CO7C 2RQPA 4NHJA 2JRTA 4G94A 3P9IA 5LRSA 4FX0A 3SQNA 1K78A 2YSRA 2FMLA 2JTVA 3VFZA 5CVRA 2L54A 5E1WA 4P96A 3ZP5A 1HW1A 2STTA 2PQ8A 1EH8A 4XLNF 4PCQA 1ODDA 1XD7A 1KU3A 3K2ZA 3WTYC 3LAJA 2V1UA 2FBHA 1O57A 1W7PA 4HF2A 1FT9A 2IT0A 4U0WA 4XSZF 5IT9K 1KYZA 1ZH5A 2C6YA 5HLGA 4G6DA 4A0XA 1HW2A 4OIQF 4JQFA 3SZPA 2W84A 2VE9A 2WV0A 3HTUA 1JXSA 3V8KA 4R1HA 2AS5F 4P55A 1Q1HA 2VT2A 2HR3A 3JTGA 2Q0OA 2J5PA 4JK1X 1HKTA 4WCGA 1LVAA 1S3JA 5BQTA 1KQ9A 3KP5A 2K4BA 4EJOA 2H6CA 3ZN0A 4KIGA 4HF1A 1XSDA 2GQQA 5TJJA 3PQKA 4KA4A 3M7GA 3WE3A 3I4PA 3C7JA 3M8EA 1P4AA 3OOPA 1IXSB 2PFBA 3P9KA 4OIRF 1MZBA 2DQRA 1KU2A 2PLYA 3QPHA 4XRFA 3CUQC 3WG9A 4IRGA 1YYVA 3V4GA 3BDDA 1FBSA 4KMUX 5H6RA 3WTXC 1LEBA 4HX8A 1I1GA 2D1HA 3GWZA 4CDGA 2F2EA 1DPUA 1ZG3A 4M74A 1S7AA 3BWGA 2VT3A 3CUOA 4UVCA 3C3WA 5KK1A 4I02A 1XDUA 2M45A 2QQAA 1JHFA 1HQCA 2KJBA 1REPC 2WC2A 3R4KA 5HDGA 1HSJA 4ZH4F 3RI4A 5HDKA 1UHMA 4BHCA 1MJAA 5CVIA 1Z9CA 2QVOA 5E1ZB 3O3KA 1UCRA 4AVPA 2RKHA 3E5XA 3V7SA 3RKXA 3BJOA 3IHUA 5HS9A 1D8KA 4M9ZA 1BIBA 2W24A 4LK1F 2HWVA 1IF1A 1ZRFA 5E8GA 1XGOA 1TNSA 5LGTA 2CO5A 3L00A 2ZCWA 5DD4A 4Y15A 1F9NA 4PGHA 1IN8A 2HYGD 3BY6A 1H9TA 1ZREA 1SMYF 4KIBA 4U7DA 2VE8A 4F7ZA 4P9FA 1T98A 3E5QA 5J8CA 3HHGA 1BBYA 2QUFA 4O3MA 2COMA 3ROUA 1ZYRF 1RNLA 4KFCA 2BEOA 3ZMSA 3LA2A 3V7RA 4LMYA 4MEYF 2DBBA 1J59A 4HW0A 3BPXA 3M1EA 4KN7X 1L3LA 3GFLA 4KYWA 2Z5UA 3I59A 1IN4A 4LB6B 3GZ5A 1FX7A 4A6EA 4IHSA 2GAUA 1LJ9A 1ONVA 4BHPA 4L5IA 2IJLA 3T8TA 3GZ6A 1SAXA 4A12A 1W4MA 4CZZA 1T2KA 4CGZA 4EV0A 1EH6A 4M6YA 4OINF 3RYRA 3FM5A 2Z9OA 2OA4A 1CF7B 2OD5A 1P2FA 3IL2A 3DQVC 5E20A 2XAJA 3BJAA 3IWZA 5DDGA 2FSWA 1BC7C 4A5NA 1R1VA 4EM2A 1V3FA 1HKSA 2DTRA 4WWCA 1GXQA 3ZMUA 2HQRA 4RGRA 2GIVA 3FXQA 1HKQA 2LDUA 4MEXF 1QQIA 1ZAOA 4LG0B 5HLIA 4Q48A 2LSOA 3KEQA 1T6SA 2MD5A 1AWCA 4EQQA 1IRFA 2MH2A 3BZ6A 3T8RA 4CICA 3ZMDA 2QBYB 2L02A 1ZGJA 2VC1A 2H6BA 4JBAA 2CGPA 1S7OA 4P5OA 4EJUA 2MLKA 2VBZA 2W25A 2O6GE 1XSVA 4L5JA 4HX4A 3F21A 3F8CA 4Y17A 2OQGA 4BHBA 1XGSA 1B59A 2RV8A 5L3FA 2NNNA 1IN5A 2IW5A 1BOAA 2X4HA 4HOBA 4U0VA 4EVIA 3ZMZA 3E6MA 4HLYA 2Q2EA 4IXAA 4L9VA 5FFZA 2QZ8A 3JTHA 1FY7A 5LEKA 5ICFA 1FNNA 1R23A 4ZYDA 3SZTA 3WODF 1TQIA 1GHCA 3J80Z 1MJBA 1DUXC 2JT1A 2VONA 1BI2A 5BPIA 3PQJA 1YW9A 1LB2A 2XUBA 2LNBA 1ZRCA 3KCCA 2K27A 4KDPA 1GXPA 3V8JA 2HKXA 5LHHA 5D5UB 1J75A 3WGHA 1YS6A 3K1MA 2XIGA 4UHTA 5HOOA 1STZA 1Z6RA 3W6JB 2CWEA 3P9CA 5H20A 5DD8A 3JW4A 4AIJA 2HZTA 5L3CA 5KVRA 4OOIA 5LRRA 2HGCA 1USSA 4ENJA 1JE8A 3DV8A 2PJPA 4I0BA 2HS5A 2ZBKA 3T1BA 4YFXF 3WTSC 4KIFA 1Z05A 3J80K 4M9SA 1MDMA 4OMZA 4HZFA 2GXGA 3TOAA 4PGGA 4I7HA 3DXJF 1I6XA 4U88A 2HKOA 2ELHA 1T38A 3EUHA 2B0LA 4YIFA 3QRFF 2FBKA 5CLSA 5DEQA 3TOBA 4K2EA 3I54A 1B6AA 5BS6A 3ISPA 1RI7A 2XKOA 1WSUA 4LLGF 3I71A 1I5ZA 2R7DA 3W6KB 5DCFA 5EEHA 2HYFA 2XHKA 2XAFA 1QBJA 1J9IA 3RJPA 4A2UA 2O03A 1ZHFA 2QM3A 2KKOA 4HF0A 5DV5A 1C0WA 3T0YA 3IRRA 3GLXA 1T39A 3TQNA 3HOTA 3Q9SA 4UUVA 5AIPA 2VOOA 3FM3A 1I27A 3E97A 5HDNA 2DO7A 3KLOA 3IC7A 3CTAA 1S29A 5ED4A 3FXUA 4AD9A 3GYHX 1YIOA 3F23A 4CO8A 1UHWA 1L0OC 1MKMA 4I09A 3DPTA 3L2CA 2MBFA 4HX7A 5IT3A 1R36A 3AAFA 2Z99A 1V4RA 1BI0A 3QAHA 4Q5SF 2RN7A 1YG2A 2XAQA 3ERED 3NRVA 3O2PE 4RB2C 3TO9A 2MA3A 5JI6A 4AIKA 4GO1A 3V8LA 1J0RA 2UZKA 4FX4A 3MCZA 4G7OF 2ZNYA 1YLFA 5E1XA 2FEZA 3IWFA 1TBXA 3K0LA 2D1VA 1XGMA 1RIOH 1A04A 2EV5A 4S04A 2CYYA 1XSXA 4HDVA 5JFRA 2FU4A 5LLQA 4RB3C 3I0TA 2ISYA 2YX4A 3K1NA 4O5VA 4LJZF 2VN2A 1QZYA 2F5CA 2WWYA 4EJVA 4QWQA 4WX9A 5HS8A 2BGCA 4M72A 3N97A 3HRSA 2ZNZA 1TW2A 3MFKA 2VBXA 4ESBA 4L9NA 3GW2A 4ON0A 1OMIA 1B9MA 2EV0A 1R5GA 4G6QA 4GGGA 1G3YA 5AONA 4WXCA 3IKTA 2NNYA 2BYVE 1TQPA 1YQAA 4TV7A 1DP7P 3F8NA 3J7AO 2A68F 4EJTA 1B4AA 3F6VA 2P8TA 4L0ZB 1XMKA 4HDUA 1G6NA 5LGUA 4A5MA 3HUGA 3ECHA 4EGYA 5FD5A 2K4JA 4I98B 3G73A 4HAMA 5FO5A 2YX7A 3GX4X 6PAXA 4LLNA 1O7LA 4GYGA 2HOEA 1B1BA 2RGVA 4B8XA 3LQRA 2GXBA 5DCMB 1IXRC 3MAJA 3FMSA 1BI3A 3QOPA 1G3SA 2K7LA 4RS8A 2V79A 1XGNA 3R0AA 3HRMA 4LFUA 4XLPF 5E18F 1YO5C 4HYEA 3MZHA 1R58A 1O3SA 3RKWA 3EYYA 3ZMTA 1ZGAA 4XBFA 3IRQA 4KNYA 2V6CA 4EM0B 2HTSA 1FLIA 1YS7A 2J5OA 3C1DA 1O7FA 3RPQA 3L7WA 3V7CA 2M1BA 3ABTA 4OMYA 2P7VB 5F6FA 5JHUA 1OYIA 3LA7A 2P6TA 1NHAA 4MTDA 2G7HA 3D5LA 2R7FA 2IP2A 2K02A 2JPCA 4ETSA 2FMYA 4Q47A 5ICGA 1E2XA 3DPLC 1F4KA 3I53A 3BP8A 2KJCA 4HLXA 2DPDA 4BXUA 2QBYA 1IAWA 3M8FA 1R7JA 5TRDA 5FB2A 2CQKA 2ESHA 1H9GA 2ACJA 1IN6A 2HTJA 1WRJA 4ZZLA 3P7NA 4MQVA 4WXHA 4N9HA 3QPTA 2H09A 1IXCA 3WE2A 2FBIA 2LF7A 1SFUA 4FT8A 2KIFA 1U5TB 3RYPA 2ZO4A 2FQ3A 5ERIA 3RPUA 3CLOA 2RNJA 3GUDA 2FNPA 3T5XA 3S2WA 2DFIA 2QENA 1TQMA 2XAGA 4GCVA 1AOYA 1Z1DA 3TO6A 2RVCA 1FSEA 1F5TA 3BOQA 2Y75A 5AIQA 1ZG5A 4ESJA 1TTYA 2QWWA 2PBIA 3HSFA 1XCBA 3H92A 3WTUC 3NQOA 3LAPA 4BYYA 5ICEA 2EV6A 4U0YA 4HQEA 1H0MA 2IA0A 5A2QZ 1R1UA 3I58A 2EB7A 3CUQB 1UB9A 5JVTA 3EYIA 1FPQA 3KP4A 3REOA 2KIMA 2QYOA 3RDIA 2EFPA 2FA5A 1BI1A 4M73A 4CYDA 2X0LA 1D3YA 4KICA 3I59B 4YIIA 1UFMA 2M5WA 4WF2A 1K7AA 1PUEE 3BPVA 1QO0D 1DDNA 4M71A 3WU0A 2EWNA 4LD5A 1RUOA 2R3SA 5K1YA 1OYWA 2G9WA 2GWRA 1LNWA 2TDXA 4RAZA 5BMZA 3WU1B 3KLNA 2F5EA 3BROA 3F6OA 5F64A 5A2QK 1IW7F 1U3EM 2ESNA 2OQRA 2UWMA 4UV8A 4B09A 2M30A 2MH9A 3ZPLA 1LDKB 1IZ1A 2Y0MA 2D45A 1O3RA 4MQ9F 3K9TA 3HOSA 3K69A 2LKPA 1KU7A 4WK8F 2MC3A 3U2RA 4NQWA 3GF2A 3O6BB 4G8XA 3ZN1A 5E17F 4ESFA 4IRIA 2JZYA 2EA2A 2E1CA 1W7PD 2DK5A 3WTZA 3E3VA 3L9FA 5K5OA 3KETA 3COAC 3F3XA 5CVVA 3QP5A 2Z33A 3GFIA 2DAOA 4UNOA 3WGIA 2DI3A 2O61A 1RUNA 3ZMVA 3CO6C 4RGUA 1R5HA 1HSTA 3H3ZA 3GO5A 4I01A 3WGGA 4CXFA 4N0BA 1G4DA 1G3TA 1KA8A 2A5YB 3KP3A 3QU3A 3VB2A 3DKWA 2E7XA 3GVAA 2WTEA 3B02A 5D6EA 5H6QA 3N4MA 5L3BA 4HV5A 1J5YA 4PZJA 2HDCA 2XGXA 4R8HA 4IF4A 3TDZC 2CFXA 1S8NA 1XN7A 3MWMA 3LFKA 5FGMA 1Z6TA 3FX3A 2W57A 3Q9VA 3CJNA 3B73A 4ZYGA 4LLLA 3HRTA 1FBQA 3HYIA 4EJWA 1GVJA 2GA1A 3DEUA 3HHHA 1U8RA 2L4MA 2UXXA 4KMFA 2PMUA 2ISZA 2H94A 3J81Z 3DF8A 2G7UA 2BV6A 2ZXJA 2O3FA 1TLHB 2W85A 4H0EA 2A61A 2FE3A 5D5VB 2ADUA 4IPAA 1ZRDA 4I0AA 3LSTA 1HW5A 3R61A 2DT5A 3WTTC 1R22A 1O3QA 5ICCA 1FP1D 2L3DA 2F5DA 2YR2A 4RGSA 4KT5C 3L09A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ASN A;  2CSO A;  1W5T A;  5ILV A;  1W5S A;  2P4W A;  1F1Z A;  3R60 A;  1EV7 A;  1KQ8 A;  2PG4 A;  5K5Q A;  4AWX B;  1XCV A;  1J7K A;  5ILS A;  1T0F A;  4DNC A;  3ECO A;  3J81 K;  4LB5 A;  3TO7 A;  2ZJ2 A;  3ELK A;  4RB0 A;  3JAM Z;  4MGR A;  4Y13 A;  5L3E A;  1PP7 U;  3D0S A;  1MDM B;  1SFE A;  3K1P A;  1YW8 A;  3JSP A;  4RB1 A;  1Z91 A;  2DK8 A;  5ILU A;  3VEP A;  1ZAR A;  3RTR A;  4HQM A;  1U5T C;  2XV4 S;  2EFN A;  3G3Z A;  4KUM A;  5DCM A;  2XRO A;  2A6H F;  1WI9 A;  2ZME B;  1P6R A;  1BN5 A;  4LK0 F;  4L9T A;  2E7W A;  1WKM A;  2F5F A;  1BM9 A;  3SHF A;  4R79 A;  2QLZ A;  1ZLJ A;  5FD6 A;  3HRU A;  2DQL A;  1QZZ A;  3JAM K;  2FXA A;  2P5V A;  5LBQ A;  5JR3 A;  3MQ0 A;  1K78 B;  2A6E F;  3QU6 A;  2GZW A;  1BIA A;  2CW0 F;  1TNT A;  1JHH A;  4MTE A;  4WXD A;  1MJ9 A;  4G9Y A;  2OBP A;  1QGP A;  3U9G A;  1DPR A;  5LHG A;  1O3T A;  3E6D A;  3KZZ A;  5F1R A;  3KEO A;  4RAY A;  4CHU A;  1W7P B;  4AIH A;  4BAY A;  2LF8 A;  1FP2 A;  2OZ6 A;  3TGN A;  3HSR A;  1ZN2 A;  3FMR A;  3GFM A;  1LEA A;  5DYM A;  5HVQ C;  2M8E A;  1XDS A;  3PFI A;  3DFG A;  4UXN A;  2D2W A;  4IJA A;  4ENM A;  1I1S A;  1FC3 A;  4MHG A;  4OIP F;  4G7H F;  1D8J A;  3KZY A;  4IVN A;  2IVM A;  5CJ9 A;  1P4W A;  2CG4 A;  2VOD A;  1U5T A;  1OR7 A;  1CF7 A;  1TW3 A;  2DU9 A;  3LWF A;  3F8M A;  3LQQ A;  1FYL A;  1J2X A;  3JSO A;  3VOE A;  1QNT A;  3RKY A;  1SD5 A;  1IRG A;  4ZYE A;  2NS0 A;  3GEZ A;  4EMS A;  2V1X A;  3F72 A;  3CDH A;  2FRH A;  3NEU A;  5E8I A;  1VTN C;  1P92 A;  2EJR A;  1IN7 A;  3F22 A;  4E70 A;  2NYX A;  1R1T A;  2JSC A;  2M87 A;  3EQL F;  4O6J A;  5D8K B;  1LQ1 A;  3TDU C;  2IA2 A;  4LG0 A;  1UST A;  2VXZ A;  2XVC A;  4YFK F;  3KE2 A;  4ZZD A;  3IKV A;  4D0P A;  1FYM A;  1E17 A;  2EFO A;  3CUQ A;  2OAZ A;  2PMH A;  3FWE A;  2RC4 A;  2L01 A;  4A0Z A;  2FF4 A;  1IUY A;  3I64 A;  4YFN F;  3FHZ A;  1FOK A;  5CVJ A;  4A6D A;  3GXO A;  4IHT A;  1YW7 A;  1SFX A;  2L4A A;  3R6S A;  2EA4 A;  1CGP A;  3KP6 A;  4L9J A;  1FWZ A;  5L3D A;  2Z3Y A;  2YPR A;  3E5U A;  1OPC A;  1Z7U A;  3E6B A;  2DLL A;  2QQ9 A;  1BC8 C;  2FOK A;  4GYI A;  2A69 F;  2NAZ A;  2NRA C;  1U78 A;  1U6G A;  4BH9 A;  3QP6 A;  1P4X A;  4EGZ A;  1OYY A;  1BJA A;  1LDD A;  4DQ2 A;  4I2O A;  3WTW C;  2DPU A;  2YU3 A;  2Y48 A;  2VBW A;  4YG2 F;  2PEX A;  2KRF A;  1FSH A;  5CYV A;  2RDP A;  2Q8K A;  2IRF G;  4QLC U;  4LGW A;  1ZG1 A;  4GXO A;  3R0J A;  5HLH A;  2JPB A;  2BBY A;  2HFH A;  4UVB A;  4RGX A;  1ZLK A;  5D5X B;  4M6X A;  2V1D A;  3OV8 A;  5K5R A;  3ZQ7 A;  3H3U A;  5BPD A;  1ON1 A;  2P6S A;  2HEO A;  2BE5 F;  1PP8 F;  3MZY A;  3Q5F A;  3HSE A;  3WTV C;  5D8L B;  2ZFW A;  2XRN A;  3RIR A;  4L18 B;  1ON2 A;  3SXY A;  2EK5 A;  3I5U A;  1YFH A;  4P9U A;  5D4R A;  4HV6 A;  4ENN A;  2IA1 A;  1HXD A;  2PN6 A;  4UVA A;  4Z2Y A;  2VBY A;  1SD4 A;  1D5V A;  2PI0 A;  5J8F A;  5BOX A;  1KU9 A;  2OU2 A;  1K6O A;  1SD7 A;  4ZYH A;  2A3S A;  2EFQ A;  2O8X A;  4MNU A;  3MEX A;  1KGS A;  1K79 A;  5FLX Z;  2VC0 A;  4BNC A;  3TKY A;  2FNA A;  1X3U A;  1G3W A;  1XMA A;  1B9N A;  2OZU A;  2XAS A;  4Q4Z F;  4HA8 A;  1LDJ A;  1SMT A;  3M9A A;  2P5K A;  2KIU A;  4FHT A;  4KN4 X;  3FXR A;  4PDK A;  1S6L A;  2O0Y A;  5LHI A;  1FBU A;  5D4S A;  3KP7 A;  1MGT A;  2IPQ X;  3U1D A;  4EM1 A;  3FF5 A;  2ZKZ A;  2XKP A;  5DUI A;  3HTS B;  3ABU A;  3LA3 A;  3F8B A;  5D5W B;  5J6X A;  3SFZ A;  3ML6 A;  3BJ6 A;  1WQ2 A;  5D6F A;  4UV9 A;  2MLG A;  3GFJ A;  5FLX K;  5CVU A;  4U7B A;  2A07 F;  4XSX F;  2P7C B;  3FMQ A;  2ETH A;  4IRH A;  2GA2 A;  3DP7 A;  1SD6 A;  3VOD A;  2EFW A;  4N9I A;  4M9X A;  5FFX A;  2STW A;  1PDN C;  4S05 A;  3C18 A;  3KP2 A;  1HBX G;  4HBL A;  3EDP A;  2DW4 A;  1U2W A;  1RZ4 A;  3F8F A;  3E6C C;  3ULQ B;  3EET A;  3HIF A;  1EH7 A;  2AXL A;  4BQA A;  2VOP A;  2V9V A;  1QPM A;  4ENK A;  2UXN A;  1OKR A;  2HQN A;  5LGN A;  1FYK A;  2K86 A;  2QQB A;  2E1N A;  1Y0U A;  2XAH A;  2H27 A;  1R00 A;  1KYW A;  5HS7 A;  4OIO F;  1ULY A;  5LEJ A;  4G7Z F;  2ZME A;  4L0Y B;  5EEG A;  2P5L C;  4NB5 A;  5DUK A;  5IT9 Z;  1KQ0 A;  1FZP B;  4A0Y A;  3KFW X;  4OU0 A;  1YTY A;  1WWX A;  5L3G A;  1XB4 A;  3FZV A;  1JGS A;  1MD0 A;  3CO7 C;  2RQP A;  4NHJ A;  2JRT A;  4G94 A;  3P9I A;  5LRS A;  4FX0 A;  3SQN A;  1K78 A;  2YSR A;  2FML A;  2JTV A;  3VFZ A;  5CVR A;  2L54 A;  5E1W A;  4P96 A;  3ZP5 A;  1HW1 A;  2STT A;  2PQ8 A;  1EH8 A;  4XLN F;  4PCQ A;  1ODD A;  1XD7 A;  1KU3 A;  3K2Z A;  3WTY C;  3LAJ A;  2V1U A;  2FBH A;  1O57 A;  1W7P A;  4HF2 A;  1FT9 A;  2IT0 A;  4U0W A;  4XSZ F;  5IT9 K;  1KYZ A;  1ZH5 A;  2C6Y A;  5HLG A;  4G6D A;  4A0X A;  1HW2 A;  4OIQ F;  4JQF A;  3SZP A;  2W84 A;  2VE9 A;  2WV0 A;  3HTU A;  1JXS A;  3V8K A;  4R1H A;  2AS5 F;  4P55 A;  1Q1H A;  2VT2 A;  2HR3 A;  3JTG A;  2Q0O A;  2J5P A;  4JK1 X;  1HKT A;  4WCG A;  1LVA A;  1S3J A;  5BQT A;  1KQ9 A;  3KP5 A;  2K4B A;  4EJO A;  2H6C A;  3ZN0 A;  4KIG A;  4HF1 A;  1XSD A;  2GQQ A;  5TJJ A;  3PQK A;  4KA4 A;  3M7G A;  3WE3 A;  3I4P A;  3C7J A;  3M8E A;  1P4A A;  3OOP A;  1IXS B;  2PFB A;  3P9K A;  4OIR F;  1MZB A;  2DQR A;  1KU2 A;  2PLY A;  3QPH A;  4XRF A;  3CUQ C;  3WG9 A;  4IRG A;  1YYV A;  3V4G A;  3BDD A;  1FBS A;  4KMU X;  5H6R A;  3WTX C;  1LEB A;  4HX8 A;  1I1G A;  2D1H A;  3GWZ A;  4CDG A;  2F2E A;  1DPU A;  1ZG3 A;  4M74 A;  1S7A A;  3BWG A;  2VT3 A;  3CUO A;  4UVC A;  3C3W A;  5KK1 A;  4I02 A;  1XDU A;  2M45 A;  2QQA A;  1JHF A;  1HQC A;  2KJB A;  1REP C;  2WC2 A;  3R4K A;  5HDG A;  1HSJ A;  4ZH4 F;  3RI4 A;  5HDK A;  1UHM A;  4BHC A;  1MJA A;  5CVI A;  1Z9C A;  2QVO A;  5E1Z B;  3O3K A;  1UCR A;  4AVP A;  2RKH A;  3E5X A;  3V7S A;  3RKX A;  3BJO A;  3IHU A;  5HS9 A;  1D8K A;  4M9Z A;  1BIB A;  2W24 A;  4LK1 F;  2HWV A;  1IF1 A;  1ZRF A;  5E8G A;  1XGO A;  1TNS A;  5LGT A;  2CO5 A;  3L00 A;  2ZCW A;  5DD4 A;  4Y15 A;  1F9N A;  4PGH A;  1IN8 A;  2HYG D;  3BY6 A;  1H9T A;  1ZRE A;  1SMY F;  4KIB A;  4U7D A;  2VE8 A;  4F7Z A;  4P9F A;  1T98 A;  3E5Q A;  5J8C A;  3HHG A;  1BBY A;  2QUF A;  4O3M A;  2COM A;  3ROU A;  1ZYR F;  1RNL A;  4KFC A;  2BEO A;  3ZMS A;  3LA2 A;  3V7R A;  4LMY A;  4MEY F;  2DBB A;  1J59 A;  4HW0 A;  3BPX A;  3M1E A;  4KN7 X;  1L3L A;  3GFL A;  4KYW A;  2Z5U A;  3I59 A;  1IN4 A;  4LB6 B;  3GZ5 A;  1FX7 A;  4A6E A;  4IHS A;  2GAU A;  1LJ9 A;  1ONV A;  4BHP A;  4L5I A;  2IJL A;  3T8T A;  3GZ6 A;  1SAX A;  4A12 A;  1W4M A;  4CZZ A;  1T2K A;  4CGZ A;  4EV0 A;  1EH6 A;  4M6Y A;  4OIN F;  3RYR A;  3FM5 A;  2Z9O A;  2OA4 A;  1CF7 B;  2OD5 A;  1P2F A;  3IL2 A;  3DQV C;  5E20 A;  2XAJ A;  3BJA A;  3IWZ A;  5DDG A;  2FSW A;  1BC7 C;  4A5N A;  1R1V A;  4EM2 A;  1V3F A;  1HKS A;  2DTR A;  4WWC A;  1GXQ A;  3ZMU A;  2HQR A;  4RGR A;  2GIV A;  3FXQ A;  1HKQ A;  2LDU A;  4MEX F;  1QQI A;  1ZAO A;  4LG0 B;  5HLI A;  4Q48 A;  2LSO A;  3KEQ A;  1T6S A;  2MD5 A;  1AWC A;  4EQQ A;  1IRF A;  2MH2 A;  3BZ6 A;  3T8R A;  4CIC A;  3ZMD A;  2QBY B;  2L02 A;  1ZGJ A;  2VC1 A;  2H6B A;  4JBA A;  2CGP A;  1S7O A;  4P5O A;  4EJU A;  2MLK A;  2VBZ A;  2W25 A;  2O6G E;  1XSV A;  4L5J A;  4HX4 A;  3F21 A;  3F8C A;  4Y17 A;  2OQG A;  4BHB A;  1XGS A;  1B59 A;  2RV8 A;  5L3F A;  2NNN A;  1IN5 A;  2IW5 A;  1BOA A;  2X4H A;  4HOB A;  4U0V A;  4EVI A;  3ZMZ A;  3E6M A;  4HLY A;  2Q2E A;  4IXA A;  4L9V A;  5FFZ A;  2QZ8 A;  3JTH A;  1FY7 A;  5LEK A;  5ICF A;  1FNN A;  1R23 A;  4ZYD A;  3SZT A;  3WOD F;  1TQI A;  1GHC A;  3J80 Z;  1MJB A;  1DUX C;  2JT1 A;  2VON A;  1BI2 A;  5BPI A;  3PQJ A;  1YW9 A;  1LB2 A;  2XUB A;  2LNB A;  1ZRC A;  3KCC A;  2K27 A;  4KDP A;  1GXP A;  3V8J A;  2HKX A;  5LHH A;  5D5U B;  1J75 A;  3WGH A;  1YS6 A;  3K1M A;  2XIG A;  4UHT A;  5HOO A;  1STZ A;  1Z6R A;  3W6J B;  2CWE A;  3P9C A;  5H20 A;  5DD8 A;  3JW4 A;  4AIJ A;  2HZT A;  5L3C A;  5KVR A;  4OOI A;  5LRR A;  2HGC A;  1USS A;  4ENJ A;  1JE8 A;  3DV8 A;  2PJP A;  4I0B A;  2HS5 A;  2ZBK A;  3T1B A;  4YFX F;  3WTS C;  4KIF A;  1Z05 A;  3J80 K;  4M9S A;  1MDM A;  4OMZ A;  4HZF A;  2GXG A;  3TOA A;  4PGG A;  4I7H A;  3DXJ F;  1I6X A;  4U88 A;  2HKO A;  2ELH A;  1T38 A;  3EUH A;  2B0L A;  4YIF A;  3QRF F;  2FBK A;  5CLS A;  5DEQ A;  3TOB A;  4K2E A;  3I54 A;  1B6A A;  5BS6 A;  3ISP A;  1RI7 A;  2XKO A;  1WSU A;  4LLG F;  3I71 A;  1I5Z A;  2R7D A;  3W6K B;  5DCF A;  5EEH A;  2HYF A;  2XHK A;  2XAF A;  1QBJ A;  1J9I A;  3RJP A;  4A2U A;  2O03 A;  1ZHF A;  2QM3 A;  2KKO A;  4HF0 A;  5DV5 A;  1C0W A;  3T0Y A;  3IRR A;  3GLX A;  1T39 A;  3TQN A;  3HOT A;  3Q9S A;  4UUV A;  5AIP A;  2VOO A;  3FM3 A;  1I27 A;  3E97 A;  5HDN A;  2DO7 A;  3KLO A;  3IC7 A;  3CTA A;  1S29 A;  5ED4 A;  3FXU A;  4AD9 A;  3GYH X;  1YIO A;  3F23 A;  4CO8 A;  1UHW A;  1L0O C;  1MKM A;  4I09 A;  3DPT A;  3L2C A;  2MBF A;  4HX7 A;  5IT3 A;  1R36 A;  3AAF A;  2Z99 A;  1V4R A;  1BI0 A;  3QAH A;  4Q5S F;  2RN7 A;  1YG2 A;  2XAQ A;  3ERE D;  3NRV A;  3O2P E;  4RB2 C;  3TO9 A;  2MA3 A;  5JI6 A;  4AIK A;  4GO1 A;  3V8L A;  1J0R A;  2UZK A;  4FX4 A;  3MCZ A;  4G7O F;  2ZNY A;  1YLF A;  5E1X A;  2FEZ A;  3IWF A;  1TBX A;  3K0L A;  2D1V A;  1XGM A;  1RIO H;  1A04 A;  2EV5 A;  4S04 A;  2CYY A;  1XSX A;  4HDV A;  5JFR A;  2FU4 A;  5LLQ A;  4RB3 C;  3I0T A;  2ISY A;  2YX4 A;  3K1N A;  4O5V A;  4LJZ F;  2VN2 A;  1QZY A;  2F5C A;  2WWY A;  4EJV A;  4QWQ A;  4WX9 A;  5HS8 A;  2BGC A;  4M72 A;  3N97 A;  3HRS A;  2ZNZ A;  1TW2 A;  3MFK A;  2VBX A;  4ESB A;  4L9N A;  3GW2 A;  4ON0 A;  1OMI A;  1B9M A;  2EV0 A;  1R5G A;  4G6Q A;  4GGG A;  1G3Y A;  5AON A;  4WXC A;  3IKT A;  2NNY A;  2BYV E;  1TQP A;  1YQA A;  4TV7 A;  1DP7 P;  3F8N A;  3J7A O;  2A68 F;  4EJT A;  1B4A A;  3F6V A;  2P8T A;  4L0Z B;  1XMK A;  4HDU A;  1G6N A;  5LGU A;  4A5M A;  3HUG A;  3ECH A;  4EGY A;  5FD5 A;  2K4J A;  4I98 B;  3G73 A;  4HAM A;  5FO5 A;  2YX7 A;  3GX4 X;  6PAX A;  4LLN A;  1O7L A;  4GYG A;  2HOE A;  1B1B A;  2RGV A;  4B8X A;  3LQR A;  2GXB A;  5DCM B;  1IXR C;  3MAJ A;  3FMS A;  1BI3 A;  3QOP A;  1G3S A;  2K7L A;  4RS8 A;  2V79 A;  1XGN A;  3R0A A;  3HRM A;  4LFU A;  4XLP F;  5E18 F;  1YO5 C;  4HYE A;  3MZH A;  1R58 A;  1O3S A;  3RKW A;  3EYY A;  3ZMT A;  1ZGA A;  4XBF A;  3IRQ A;  4KNY A;  2V6C A;  4EM0 B;  2HTS A;  1FLI A;  1YS7 A;  2J5O A;  3C1D A;  1O7F A;  3RPQ A;  3L7W A;  3V7C A;  2M1B A;  3ABT A;  4OMY A;  2P7V B;  5F6F A;  5JHU A;  1OYI A;  3LA7 A;  2P6T A;  1NHA A;  4MTD A;  2G7H A;  3D5L A;  2R7F A;  2IP2 A;  2K02 A;  2JPC A;  4ETS A;  2FMY A;  4Q47 A;  5ICG A;  1E2X A;  3DPL C;  1F4K A;  3I53 A;  3BP8 A;  2KJC A;  4HLX A;  2DPD A;  4BXU A;  2QBY A;  1IAW A;  3M8F A;  1R7J A;  5TRD A;  5FB2 A;  2CQK A;  2ESH A;  1H9G A;  2ACJ A;  1IN6 A;  2HTJ A;  1WRJ A;  4ZZL A;  3P7N A;  4MQV A;  4WXH A;  4N9H A;  3QPT A;  2H09 A;  1IXC A;  3WE2 A;  2FBI A;  2LF7 A;  1SFU A;  4FT8 A;  2KIF A;  1U5T B;  3RYP A;  2ZO4 A;  2FQ3 A;  5ERI A;  3RPU A;  3CLO A;  2RNJ A;  3GUD A;  2FNP A;  3T5X A;  3S2W A;  2DFI A;  2QEN A;  1TQM A;  2XAG A;  4GCV A;  1AOY A;  1Z1D A;  3TO6 A;  2RVC A;  1FSE A;  1F5T A;  3BOQ A;  2Y75 A;  5AIQ A;  1ZG5 A;  4ESJ A;  1TTY A;  2QWW A;  2PBI A;  3HSF A;  1XCB A;  3H92 A;  3WTU C;  3NQO A;  3LAP A;  4BYY A;  5ICE A;  2EV6 A;  4U0Y A;  4HQE A;  1H0M A;  2IA0 A;  5A2Q Z;  1R1U A;  3I58 A;  2EB7 A;  3CUQ B;  1UB9 A;  5JVT A;  3EYI A;  1FPQ A;  3KP4 A;  3REO A;  2KIM A;  2QYO A;  3RDI A;  2EFP A;  2FA5 A;  1BI1 A;  4M73 A;  4CYD A;  2X0L A;  1D3Y A;  4KIC A;  3I59 B;  4YII A;  1UFM A;  2M5W A;  4WF2 A;  1K7A A;  1PUE E;  3BPV A;  1QO0 D;  1DDN A;  4M71 A;  3WU0 A;  2EWN A;  4LD5 A;  1RUO A;  2R3S A;  5K1Y A;  1OYW A;  2G9W A;  2GWR A;  1LNW A;  2TDX A;  4RAZ A;  5BMZ A;  3WU1 B;  3KLN A;  2F5E A;  3BRO A;  3F6O A;  5F64 A;  5A2Q K;  1IW7 F;  1U3E M;  2ESN A;  2OQR A;  2UWM A;  4UV8 A;  4B09 A;  2M30 A;  2MH9 A;  3ZPL A;  1LDK B;  1IZ1 A;  2Y0M A;  2D45 A;  1O3R A;  4MQ9 F;  3K9T A;  3HOS A;  3K69 A;  2LKP A;  1KU7 A;  4WK8 F;  2MC3 A;  3U2R A;  4NQW A;  3GF2 A;  3O6B B;  4G8X A;  3ZN1 A;  5E17 F;  4ESF A;  4IRI A;  2JZY A;  2EA2 A;  2E1C A;  1W7P D;  2DK5 A;  3WTZ A;  3E3V A;  3L9F A;  5K5O A;  3KET A;  3COA C;  3F3X A;  5CVV A;  3QP5 A;  2Z33 A;  3GFI A;  2DAO A;  4UNO A;  3WGI A;  2DI3 A;  2O61 A;  1RUN A;  3ZMV A;  3CO6 C;  4RGU A;  1R5H A;  1HST A;  3H3Z A;  3GO5 A;  4I01 A;  3WGG A;  4CXF A;  4N0B A;  1G4D A;  1G3T A;  1KA8 A;  2A5Y B;  3KP3 A;  3QU3 A;  3VB2 A;  3DKW A;  2E7X A;  3GVA A;  2WTE A;  3B02 A;  5D6E A;  5H6Q A;  3N4M A;  5L3B A;  4HV5 A;  1J5Y A;  4PZJ A;  2HDC A;  2XGX A;  4R8H A;  4IF4 A;  3TDZ C;  2CFX A;  1S8N A;  1XN7 A;  3MWM A;  3LFK A;  5FGM A;  1Z6T A;  3FX3 A;  2W57 A;  3Q9V A;  3CJN A;  3B73 A;  4ZYG A;  4LLL A;  3HRT A;  1FBQ A;  3HYI A;  4EJW A;  1GVJ A;  2GA1 A;  3DEU A;  3HHH A;  1U8R A;  2L4M A;  2UXX A;  4KMF A;  2PMU A;  2ISZ A;  2H94 A;  3J81 Z;  3DF8 A;  2G7U A;  2BV6 A;  2ZXJ A;  2O3F A;  1TLH B;  2W85 A;  4H0E A;  2A61 A;  2FE3 A;  5D5V B;  2ADU A;  4IPA A;  1ZRD A;  4I0A A;  3LST A;  1HW5 A;  3R61 A;  2DT5 A;  3WTT C;  1R22 A;  1O3Q A;  5ICC A;  1FP1 D;  2L3D A;  2F5D A;  2YR2 A;  4RGS A;  4KT5 C;  3L09 A; 
#chains in the Genus database with same CATH topology
 1TL8 A;  4ASN A;  2CSO A;  1W5T A;  4BY7 J;  2DT7 B;  2VQG A;  5ILV A;  1OCZ H;  3TMO A;  1W5S A;  2P4W A;  1TT5 B;  1F1Z A;  4JX4 A;  2V7F A;  3R60 A;  3BR2 A;  3K70 C;  1EV7 A;  3OYA A;  1XS9 A;  2PG4 A;  1KQ8 A;  4II3 A;  2XAU A;  5K5Q A;  1VQN I;  4AWX B;  1XCV A;  1J7K A;  1X1B A;  2XF7 A;  3BR5 A;  4IQJ A;  5ILS A;  1T0F A;  4DNC A;  1GVD A;  3ECO A;  4CCL A;  2LY9 A;  4IKF A;  2M34 A;  3J81 K;  4XKW A;  3LSI A;  3BTI A;  1QVU A;  4LB5 A;  3TO7 A;  2ZJ2 A;  3ELK A;  2R92 J;  4RB0 A;  3M07 A;  3S93 A;  1FOX A;  3J7Y J;  1VQO I;  4B44 A;  3JAM Z;  2K9M A;  4MGR A;  4Y13 A;  5L3E A;  1PP7 U;  3D0S A;  2LTP A;  2LYC A;  3HM5 A;  3PL8 A;  2I5U A;  1MDM B;  1SFE A;  3K1P A;  1YW8 A;  3FKJ A;  2QGU A;  3JSP A;  4RB1 A;  4Y33 A;  1Z91 A;  3CME I;  1YHQ I;  3A02 A;  2DK8 A;  3K7A J;  5ILU A;  3VEP A;  4XRS A;  4BDZ A;  1T95 A;  1ZAR A;  3RTR A;  4HQM A;  1U5T C;  1OR7 C;  3JRB A;  1FTZ A;  2K3F A;  2HYJ A;  4CYC A;  2FX0 A;  2FQ4 A;  2XV4 S;  4PJN A;  3A2K A;  3L1P A;  2EFN A;  3G3Z A;  4KUM A;  5DCM A;  2XRO A;  1G8X A;  3CCJ I;  2A6H F;  3JCU C;  4CSW A;  1WI9 A;  2NS8 A;  2ZME B;  4I6Z A;  3GLL A;  1K83 J;  1P6R A;  1BN5 A;  2XB0 X;  4F93 B;  1MBH A;  2Y0S A;  4IZZ A;  3S3N A;  1X4O A;  4UUT A;  4LK0 F;  4L9T A;  1OFC X;  3RQI A;  2E7W A;  1WKM A;  2F5F A;  4FE4 A;  2A05 A;  1BM9 A;  3SHF A;  4R79 A;  1ZKG A;  2QLZ A;  1ZLJ A;  4PJJ A;  2ECB A;  2E19 A;  5FD6 A;  3HRU A;  2DQL A;  3BG3 A;  2WV1 A;  1QZZ A;  3JAM K;  2FXA A;  1K4S A;  2OTL I;  1VQM I;  1P7I A;  2P5V A;  2XRL A;  5LBQ A;  5JR3 A;  4AM3 A;  2GOM A;  3MQ0 A;  3CF5 F;  1I50 J;  1K78 B;  3TP3 A;  2OF7 A;  2A6E F;  2WB1 A;  4RM2 A;  1I3A A;  3QU6 A;  2VLA A;  2GZW A;  3CJR B;  1BIA A;  2CW0 F;  1HOM A;  1JTX A;  1TNT A;  4H4K C;  4Y3O A;  1JHH A;  3CCV I;  4XR6 A;  2L7K A;  4MTE A;  3LOC A;  4KT6 A;  4WXD A;  1B72 B;  2IGN A;  4NC6 A;  1WI3 A;  1MJ9 A;  3BR1 A;  3BT9 A;  2OBP A;  2B7E A;  4G9Y A;  1QGP A;  5DTD A;  3U9G A;  3TP0 A;  2A5W A;  4CCJ A;  2JA6 J;  1DPR A;  5LHG A;  1O3T A;  4D5F A;  3E6D A;  5FKO A;  3KZZ A;  5F1R A;  3KEO A;  4RAY A;  4CHU A;  1W7P B;  4AIH A;  4BAY A;  3HPG A;  2LP0 A;  1T08 B;  1XPX A;  4XKV A;  4A3M J;  2LF8 A;  2IAI A;  1FP2 A;  2OZ6 A;  1MMG A;  2KHM A;  3QPS A;  3TGN A;  4II2 A;  3HSR A;  1PUF B;  1XC5 A;  1ZN2 A;  4HSR A;  2LY1 A;  3HL2 A;  1RR7 A;  3FMR A;  3GFM A;  1SAN A;  3WHB A;  2CV2 A;  1W36 D;  1LEA A;  5DYM A;  5HVQ C;  2M8E A;  1AHD P;  3S14 J;  1XDS A;  3PFI A;  2ME6 A;  4B47 A;  2BXZ A;  2CH0 A;  3DFG A;  4UXN A;  3BG9 A;  5DS9 A;  2IS4 A;  5F0H A;  2D2W A;  3OYF A;  1F36 A;  2X1E A;  1Y0N A;  2DJI A;  4Y52 J;  1WJB A;  4IJA A;  1VQP I;  4ENM A;  1I1S A;  1FC3 A;  2DMU A;  2LG4 A;  4MHG A;  3OYI A;  4G7H F;  4OIP F;  2MW8 A;  1D8J A;  3KZY A;  4IVN A;  2IVM A;  5HLT A;  5CJ9 A;  1E3O C;  4D9J A;  1P4W A;  2CG4 A;  2VOD A;  4M3F A;  1U5T A;  2R7Q A;  1OR7 A;  1CF7 A;  4RA2 A;  4DW6 A;  2DOA A;  4C9Y A;  1TW3 A;  2DU9 A;  3LWF A;  3F8M A;  4IL6 C;  5EZH A;  2BHY A;  3LQQ A;  1FYL A;  2AQE A;  2CRG A;  3QYE A;  5KAF C;  2O8K A;  3PNT A;  3DU6 A;  3GTP J;  1J2X A;  3ZQI A;  3JSO A;  3VOE A;  3LL7 A;  1QNT A;  3RKY A;  3CP8 A;  2R7T A;  1SD5 A;  1IRG A;  2KZG A;  4ZYE A;  2R5Y A;  2NS0 A;  3GEZ A;  2HQ5 A;  1R5I D;  4EMS A;  2V1X A;  3M1C A;  3ZQL A;  2ZJR F;  2G0E A;  2KP6 A;  3F72 A;  3CDH A;  2FRH A;  3GTL J;  3NEU A;  2GBY A;  2Z2S B;  5E8I A;  5H2F C;  1BW6 A;  1VTN C;  1BA5 A;  1UEL B;  2EZI A;  2ZXW H;  3DKX A;  1P92 A;  2EJR A;  2EIK H;  1IN7 A;  3F22 A;  1LE8 A;  1JJ8 C;  4E70 A;  3H5R A;  2NYX A;  1MND A;  1R1T A;  2JSC A;  2M87 A;  3DKY A;  3EQL F;  2HOT A;  4JX5 A;  1MNE A;  4O6J A;  1EA3 A;  2M7A A;  5D8K B;  5IY5 H;  4BEH B;  1LQ1 A;  2JA5 J;  4F91 B;  3TDU C;  2IA2 A;  4X6A J;  4LG0 A;  1UJ8 A;  1UST A;  2VXZ A;  2XVC A;  1UZC A;  3DU5 A;  2F5V A;  1JKQ C;  2X48 A;  4YFK F;  3KE2 A;  4ZZD A;  1IV8 A;  3IKV A;  4D0P A;  1FYM A;  2EQR A;  2EFO A;  2VKV A;  3CUQ A;  2OAZ A;  4QIW N;  2NVU B;  2X85 A;  1E17 A;  1JUS A;  2PMH A;  3FWE A;  3E0J B;  3CZ6 A;  4DYC A;  2RC4 A;  3W3C A;  2ME0 A;  2L01 A;  4B1R A;  2V1N A;  4A0Z A;  2FF4 A;  1IUY A;  3I64 A;  4YFN F;  4ZTJ A;  3FHZ A;  1FOK A;  3AG2 H;  5CVJ A;  4A6D A;  3GXO A;  2E36 A;  4XON A;  4IHT A;  1YW7 A;  4A3L J;  1EKE A;  1SFX A;  2M3A A;  1ZTR A;  4ZDP A;  2L4A A;  3R6S A;  4RDU A;  2EA4 A;  1CGP A;  3KP6 A;  4L9J A;  3BTJ A;  1FWZ A;  5L3D A;  3C2G A;  1SFO J;  2E2I J;  2DFF A;  2Z3Y A;  5FLV A;  2NVQ J;  3GCM A;  4ZC3 A;  2BY2 A;  2YPR A;  3E5U A;  5CQG A;  1OPC A;  3RZO J;  5F27 A;  1Z7U A;  3KIO A;  3E6B A;  1Z7L A;  2DA1 A;  2DLL A;  1YOV B;  2QQ9 A;  2VXD A;  3G6E I;  1BC8 C;  2KZV A;  2VIX A;  3QOE A;  2FOK A;  3Q3S A;  4GYI A;  3O8H A;  2A69 F;  1ETV A;  2NAZ A;  2NRA C;  1U78 A;  1U6G A;  4BH9 A;  3ZR8 X;  4KIS A;  1TP4 A;  2HU9 A;  2QSF X;  3QP6 A;  1D1C A;  1P4X A;  4A3E J;  3NWS A;  2O5R A;  4BDY A;  4EGZ A;  1OYY A;  3OY9 A;  1BJA A;  1LDD A;  4A3I J;  2ZFU A;  1IG7 A;  4DQ2 A;  5LD2 C;  4RAG A;  2O9L A;  4I2O A;  3WTW C;  3JR9 A;  2DPU A;  2YU3 A;  2CW8 A;  2Y48 A;  1IJW C;  2VBW A;  2R93 J;  4YG2 F;  2PEX A;  2KRF A;  2X51 A;  1FSH A;  5CYV A;  1QHG A;  2RDP A;  2Q8K A;  2IRF G;  2LR8 A;  4QLC U;  4LGW A;  1ZG1 A;  4GXO A;  3R0J A;  5HLH A;  2JPB A;  2EZH A;  2CFO A;  1S7E A;  2VKD A;  1Q1V A;  2BBY A;  2DOF A;  2HFH A;  4UVB A;  1TC3 C;  4RGX A;  1ZLK A;  1R71 A;  1OCC H;  5D5X B;  2LBF B;  4M6X A;  2V1D A;  3OV8 A;  5M3M J;  5EG0 B;  2XGC A;  5HOD A;  2HNH A;  3SDB A;  5K5R A;  3ZQ7 A;  3H3U A;  5BPD A;  1ON1 A;  2P6S A;  2HEO A;  2BE5 F;  3OYL A;  3OWT A;  1PP8 F;  3MZY A;  3Q5F A;  3HSE A;  3ZOB A;  3WTV C;  2ELJ A;  4A3B J;  5D8L B;  2ZFW A;  2VJ5 A;  2XRN A;  3RIR A;  3P5J A;  4L18 B;  1ON2 A;  2EZL A;  3SXY A;  3I56 I;  4BE0 A;  2N8G A;  2EK5 A;  3I5U A;  1YFH A;  5BNG A;  4P9U A;  5D4R A;  4G6T B;  3ONQ A;  4HV6 A;  4BGD A;  1CQT A;  4ENN A;  2IA1 A;  5JLX A;  4NNJ A;  1HXD A;  2PN6 A;  4UVA A;  5EDN A;  3JRF A;  4Z2Y A;  3GTQ J;  2VBY A;  1SD4 A;  3BR3 A;  1D5V A;  2M0C A;  2GXA A;  5M3F J;  2PI0 A;  5J8F A;  3BC8 A;  2ZB9 A;  4NDL A;  4D1Q A;  5BOX A;  2KMU A;  3LSH A;  3JRA A;  2M7B A;  1JTY A;  1KU9 A;  2OU2 A;  1K6O A;  1QA6 A;  5GAH J;  1OJL A;  1D5Y A;  2JSP A;  4G12 A;  3PUB A;  1SD7 A;  4ZYH A;  2A3S A;  3K4J A;  2EFQ A;  2O8X A;  4PK4 A;  4MNU A;  3A01 B;  3MEX A;  4D7N A;  4C2T A;  2BVL A;  1KGS A;  2QKL B;  1K79 A;  4ZTF A;  1WHU A;  2QSH X;  5FLX Z;  2VC0 A;  3LFU A;  4BNC A;  2XC7 A;  4BXF A;  5M5X J;  3TKY A;  1RKT A;  2FNA A;  4Z6Y A;  1X3U A;  3OSF A;  1G3W A;  1XMA A;  5K7F A;  4EAT A;  2TCT A;  1B9N A;  2OZU A;  2XAS A;  4Q4Z F;  2ECC A;  1LDJ A;  1SMT A;  1WGX A;  2OPT A;  3DWL E;  3M9A A;  4HA8 A;  4A69 C;  1LFP A;  1D0Z A;  3CD6 I;  2P5K A;  2F4M B;  2KIU A;  4FHT A;  2YUS A;  3FXR A;  4KN4 X;  4PDK A;  1BJZ A;  3LSM A;  3JRE A;  4OAY A;  2LC2 A;  3RCO A;  1S6L A;  4QTR A;  1VFC A;  2O0Y A;  5LHI A;  1Z0X A;  4LG3 A;  1FBU A;  5D4S A;  3KP7 A;  4F55 A;  1VQ9 I;  1MGT A;  2IPQ X;  3U1D A;  4EM1 A;  3CCL I;  1K61 A;  3LSP A;  1MMD A;  1AKH B;  3FF5 A;  2NS7 A;  2ZKZ A;  2KRH A;  2XKP A;  5DUI A;  1YIT I;  3HTS B;  2M9H A;  3ABU A;  2CJJ A;  3LA3 A;  1ORK A;  2LKX A;  3CDL A;  3F8B A;  4RLF A;  5D5W B;  5J6X A;  2KPM A;  3SFZ A;  1JT6 A;  4XLA A;  2F6C A;  3ML6 A;  2DOE A;  3BJ6 A;  1WQ2 A;  2YU9 J;  5D6F A;  3MKL A;  2HDD A;  3HGG A;  4CUG A;  2LMD A;  4UV9 A;  3IP4 B;  1QRY A;  2MLG A;  3GFJ A;  5FLX K;  5CVU A;  1UG0 A;  4U7B A;  3OMY A;  3FKI J;  1X1P A;  3HOV J;  2A07 F;  2HQA A;  4V19 K;  1MNM C;  3G71 I;  4XSX F;  4IOC F;  2P7C B;  3FMQ A;  3VSL A;  4IHV A;  2ETH A;  2E5Z A;  4IRH A;  3S1R J;  4BJT A;  2CQ7 A;  5B1B H;  2GA2 A;  2JVH A;  4E6K G;  4DOZ A;  3DP7 A;  1SD6 A;  3K4K A;  3VOD A;  2EFW A;  1EJ9 A;  4N9I A;  4M9X A;  4HST A;  1FTT A;  3MVP A;  2VPL A;  5FFX A;  2STW A;  1AA7 A;  4PFO A;  4XLC A;  3D5S C;  2M4G A;  1PDN C;  4S05 A;  5J40 A;  4XOR A;  2DFE A;  3C18 A;  3KP2 A;  3L2R A;  4MFD A;  1HBX G;  2HVS A;  4HBL A;  1WVR A;  3EDP A;  2H1K A;  1HLV A;  2DW4 A;  2W48 A;  1U2W A;  1RZ4 A;  3F8F A;  3GBG A;  1ZR2 A;  3MD2 A;  4W97 A;  1M1E B;  3UNG C;  3E6C C;  1W0U A;  2L9N A;  4CCK A;  2BOL A;  2R7X A;  3ULQ B;  3BTL A;  3EET A;  3HIF A;  1EH7 A;  2AXL A;  2QF7 A;  4BQA A;  2VOP A;  1TWF J;  2V9V A;  1QPM A;  4ENK A;  2UXN A;  1OKR A;  3BR6 A;  1AU7 A;  2HQN A;  4PFP A;  2Q2E B;  5LGN A;  1FYK A;  2K86 A;  3F0C A;  4ZDL A;  2QQB A;  2E1N A;  1Y0U A;  2XAH A;  3DTK A;  2ZXI A;  4GFB A;  3ABK H;  1A35 A;  2H27 A;  2X1D A;  1R00 A;  2MYS A;  4BAC A;  2FJ1 A;  2RNG A;  1KYW A;  2X9D A;  1NG6 A;  5HS7 A;  2ZJQ F;  4OIO F;  1ULY A;  2R7W A;  5LEJ A;  4G7Z F;  2PX9 A;  2ZME A;  4L0Y B;  5EEG A;  3AL0 B;  2P5L C;  2DA4 A;  4NB5 A;  5DUK A;  1RRJ A;  3HOZ J;  2W7N A;  5IT9 Z;  1KQ0 A;  4ABZ A;  1FZP B;  1FIP A;  4A0Y A;  3KFW X;  3VYS B;  4OU0 A;  1YTY A;  2W00 A;  3S1Q J;  1WWX A;  5L3G A;  3OL3 A;  4CH7 A;  1XB4 A;  3FZV A;  3PIP F;  2ZJP F;  1JGS A;  2NOJ B;  3ZQG A;  1MD0 A;  3CO7 C;  2L7F P;  2RQP A;  4NHJ A;  3J7Z I;  2LLK A;  1E0E A;  3VYU B;  3IH2 A;  2JRT A;  1K4T A;  3K4C A;  1D1A A;  4G94 A;  3P9I A;  4PJL A;  4FX0 A;  3SQN A;  5LRS A;  1K78 A;  3IH3 A;  3K4B A;  2YSR A;  4BS9 A;  4DIQ A;  1Z67 A;  4A3D J;  3OL4 A;  2FML A;  3OYN A;  4CA0 A;  3ASN H;  2JTV A;  3V42 A;  3VFZ A;  5CVR A;  1R9T J;  2K40 A;  2L54 A;  3H1C A;  1ITY A;  5E1W A;  3GME A;  2PJR B;  2W82 A;  4P96 A;  3ZP5 A;  1HW1 A;  2VPR A;  2STT A;  3DLA A;  2PQ8 A;  1Y1V J;  1X1C A;  1ZGW A;  1HDP A;  1WZ2 A;  1G59 A;  1EH8 A;  2QA4 I;  5FRM A;  1OLT A;  3DLL F;  4XLN F;  5FRO A;  4PCQ A;  1ODD A;  1XD7 A;  4DBQ A;  2X6W A;  2JA2 A;  3KX2 A;  1KU3 A;  2KFD A;  3K2Z A;  2DYS H;  3WTY C;  3LAJ A;  2VQH A;  5E3O A;  1Y6I A;  2CU7 A;  2V1U A;  2FBH A;  2GIZ A;  1O57 A;  5B66 C;  3FIS A;  1HA8 A;  1W7P A;  4HF2 A;  4X0G A;  1FT9 A;  3D5R C;  2IT0 A;  4U0W A;  4XSZ F;  5IT9 K;  1YX3 A;  1KYZ A;  1ZH5 A;  2C6Y A;  5HLG A;  2V9K A;  1IRZ A;  2Y9Z A;  2L5Q A;  4G6D A;  4A0X A;  1HW2 A;  3BQY A;  2XDV A;  1PUF A;  3LMM A;  2AHQ A;  5IOY A;  4OIQ F;  4JQF A;  1V5E A;  3SZP A;  2W84 A;  2XGD A;  4HPQ A;  2VE9 A;  3ZQC A;  2WV0 A;  4A3J J;  3HTU A;  2E1O A;  3MN2 A;  1JXS A;  3BZK A;  3V8K A;  4XRM A;  3DEW A;  3BG5 A;  2F4O B;  1U9O A;  1Z3X A;  4R1H A;  2AS5 F;  4P55 A;  1Q1H A;  2VT2 A;  2WY7 Q;  2HR3 A;  4AID A;  5JHF A;  1YX5 A;  3JTG A;  3ESW B;  3G1O A;  3FBI B;  3KYD B;  2Q0O A;  2J5P A;  4BKX A;  4JK1 X;  1HKT A;  4WCG A;  1QZE A;  1LVA A;  1LFB A;  1S3J A;  5BQT A;  4XMY A;  4A93 J;  2R0Q C;  1KQ9 A;  3KP5 A;  1JKP C;  2HVQ A;  2K4B A;  3A0H C;  4EJO A;  2XPU A;  2DA6 A;  2H6C A;  3BCA A;  3ZN0 A;  4NC8 A;  4AC0 A;  4KIG A;  3BG7 A;  2JUG A;  4HF1 A;  3FK6 A;  1XSD A;  2GQQ A;  2VQC A;  1YI2 I;  5TJJ A;  3H9Q A;  3PQK A;  4KA4 A;  3I3L A;  2DTZ A;  3M7G A;  2DN0 A;  4LIT A;  3WE3 A;  5KNL A;  1VQ8 I;  3JRD A;  3I4P A;  3C7J A;  4B3A A;  3LSJ A;  3M8E A;  2NXN B;  3HC7 A;  2KL4 A;  2E1M B;  3CCS I;  1P4A A;  3OOP A;  1IXS B;  2H8R A;  2PFB A;  4IHW A;  3P9K A;  4OIR F;  2VB6 A;  1MZB A;  2DQR A;  1KU2 A;  1D1B A;  2Y31 A;  3G2B A;  2VUM J;  2PLY A;  3QPH A;  4XRF A;  4M3B A;  1FMV A;  3CUQ C;  3WG9 A;  4IRG A;  3WHC A;  2OCC H;  3H36 A;  3OYJ A;  1YYV A;  3A03 A;  3V4G A;  3OYE A;  3GTJ J;  3E7L A;  3BDD A;  1YJN I;  4BEH A;  4V2G A;  3ASO H;  1FBS A;  4KMU X;  5H6R A;  3WTX C;  1LEB A;  4GRI A;  1XMX A;  4HX8 A;  1I1G A;  2IBD A;  5EJC A;  2D1H A;  3GWZ A;  2LD5 A;  5M5Y J;  1MSE C;  1V5G A;  4CDG A;  1IRX A;  4RBO A;  2JMW A;  2F2E A;  3S3M A;  5IOZ A;  1WH7 A;  4XOP A;  4BL0 B;  1DPU A;  3MKW B;  1ZG3 A;  2LKS A;  2B63 J;  4M74 A;  3F9K A;  4IOA F;  3RPU D;  1S7A A;  2MC4 A;  3CCY A;  3BWG A;  2VT3 A;  3CUO A;  3K2A A;  4UVC A;  3CP2 A;  2LRE A;  3C3W A;  5KK1 A;  4I02 A;  3PNY A;  1XDU A;  2M45 A;  2QQA A;  3JRH A;  1U9N A;  1JHF A;  4BXX J;  5F08 A;  1HQC A;  2KJB A;  1REP C;  2WC2 A;  3R4K A;  5HDG A;  1HSJ A;  4ZH4 F;  3RI4 A;  3JRI A;  5HDK A;  2E2J J;  1X1D A;  1MIJ A;  1PJR A;  2COB A;  1UHM A;  4BHC A;  2CW7 A;  1MJA A;  5CVI A;  1Z9C A;  1WJE A;  2QVO A;  4OAZ A;  5E1Z B;  1KON A;  1N77 A;  1JKO C;  3TL4 X;  3O3K A;  1UCR A;  3JRG A;  4AVP A;  1ETW A;  2RKH A;  2HDW A;  3E5X A;  1S72 I;  3DTI A;  3MMY B;  3V7S A;  3H35 A;  3RKX A;  3BJO A;  3IHU A;  4XK4 A;  3I55 I;  2Y9Y A;  5HS9 A;  1D8K A;  2HVR A;  3AG3 H;  4M9Z A;  1BIB A;  2W24 A;  4LK1 F;  3LNQ A;  2HWV A;  4B43 A;  1IF1 A;  1W36 C;  1ZRF A;  5E8G A;  1XGO A;  3OS2 A;  1W0T A;  5HNF A;  1D0X A;  1X3W B;  1TNS A;  5LGT A;  2CO5 A;  3K4L A;  2Y30 A;  3L00 A;  2ZCW A;  2X6Y A;  1HDD C;  2DOD A;  3PO2 J;  5DD4 A;  4Y15 A;  3DEE A;  2WBM A;  1F9N A;  4PGH A;  1DU6 A;  1IN8 A;  3HEF A;  5FRN A;  2HYG D;  3BY6 A;  5IYD J;  1GV2 A;  1WH5 A;  2VJJ A;  1H9T A;  1A5J A;  1ZRE A;  3GTK J;  1SMY F;  5IP6 A;  1HF0 A;  4KIB A;  4U7D A;  4Y4R A;  5E79 C;  2VE8 A;  4F7Z A;  4P9F A;  1T98 A;  5EG0 A;  5B3S H;  4CCN A;  2OCE A;  3E5Q A;  3HHG A;  5J8C A;  1VI0 A;  1BBY A;  3HDD A;  1SVM A;  2QUF A;  4O3M A;  2Z1D A;  2COM A;  2VQL A;  4RMN A;  5GPA A;  1ZYR F;  1RNL A;  3ROU A;  4HNV A;  1RPW A;  4KFC A;  2BEO A;  4PJ0 C;  1FJL A;  2BY1 A;  2JA8 J;  2DA5 A;  3ZMS A;  3LA2 A;  2IS2 A;  1RKW A;  3V7R A;  4UUS B;  2E34 A;  4LMY A;  4MEY F;  2DBB A;  4DZP A;  1J59 A;  1JJ6 C;  3H0D A;  2MGQ A;  4HW0 A;  3HUG B;  4I99 C;  2QEX I;  3BPX A;  1MBJ A;  4NC7 A;  3M1E A;  2WAQ N;  4KN7 X;  3QYF A;  1L3L A;  5DM6 F;  3GFL A;  4KYW A;  2Z5U A;  1OCP A;  3I59 A;  1N78 A;  9ANT A;  1VQ5 I;  2DA7 A;  3OYK A;  1IN4 A;  3FXL A;  4LB6 B;  2JK3 A;  1FX7 A;  3GZ5 A;  3SEQ A;  4A6E A;  2IEK A;  3K4N A;  4IHS A;  2LRD A;  2GAU A;  1LJ9 A;  2GM4 A;  4E7H A;  2L9R A;  5HNH A;  2XSJ C;  1WPK A;  3QWL A;  5B5E C;  1ONV A;  1FEX A;  1OCR H;  4BHP A;  4L5I A;  3L2V A;  2IJL A;  5LFA A;  3T8T A;  3VDX A;  3GZ6 A;  1SAX A;  4XOT A;  4AVZ A;  4A12 A;  1W4M A;  1WCM J;  3DPU A;  4Y7N J;  2OV7 A;  4CZZ A;  1X1A A;  1G2H A;  1T2K A;  3HPH A;  4CGZ A;  1NTC A;  4EV0 A;  4E7J A;  4ANJ A;  1EH6 A;  4M6Y A;  4OIN F;  3RYR A;  3FM5 A;  1NK2 P;  2Z9O A;  2OA4 A;  2DJN A;  1V55 H;  1CF7 B;  2OD5 A;  3IH4 A;  3CCE I;  3K4M A;  2OUM A;  1P2F A;  3IL2 A;  2H8W A;  1SC7 A;  2BW3 B;  5GPC A;  5E3L A;  3DQV C;  2EPF A;  5E20 A;  1TWC J;  3MKZ A;  1YRN B;  2XAJ A;  1QPI A;  2R5Z B;  3BJA A;  2FD5 A;  2V26 A;  1E3H A;  3IWZ A;  5DDG A;  2FSW A;  4P1W A;  1BC7 C;  4A5N A;  4FIS A;  4PSX A;  1R1V A;  1GV5 A;  2DFH A;  5JVG F;  2BY0 A;  4EM2 A;  1V3F A;  2K85 A;  1HKS A;  1AKH A;  3D1N I;  3S1M J;  3AFH A;  4KJZ A;  2DTR A;  1LE8 B;  4BBR J;  4WWC A;  1GXQ A;  3ZMU A;  3AKZ A;  2HQR A;  4RGR A;  2GIV A;  2I10 A;  3FXQ A;  2O7O A;  2W1O A;  1HKQ A;  4AUX A;  2LDU A;  2X1C A;  4MEX F;  1TWA J;  1JI8 A;  1QQI A;  2X6O A;  1ZAO A;  4LG0 B;  1DP3 A;  1ACI A;  5HLI A;  4MO7 A;  1X2M A;  4Q48 A;  4YRV A;  2LSO A;  3KEQ A;  1T6S A;  2MD5 A;  1AWC A;  2GLO A;  2KDO A;  4EQQ A;  4BJ5 C;  2M2E A;  1IRF A;  2Q1Z B;  2MH2 A;  3BZ6 A;  4E4H A;  2WAE A;  1MBE A;  4KIT B;  3Q0V A;  3I4M J;  3T8R A;  3U1K A;  4CIC A;  3ZMD A;  3L2U A;  4YIR X;  2QBY B;  3G1L A;  2VJI A;  2L02 A;  1ZGJ A;  2JUC A;  3KPH A;  2R7U A;  2VC1 A;  5J1Y A;  3W2W A;  2H6B A;  4JBA A;  5KHD A;  2CGP A;  4AYB N;  1S7O A;  4P5O A;  4EJU A;  2MLK A;  2VBZ A;  2W25 A;  2Y69 H;  4GDF A;  2O6G E;  1XSV A;  4L5J A;  4HX4 A;  4N4N B;  3F21 A;  3EUK L;  3F8C A;  4Y17 A;  4UB6 C;  3EUH C;  4U87 A;  2OQG A;  4F92 B;  4BHB A;  1T8I A;  1XGS A;  1B59 A;  3OYH A;  3VYT B;  2RV8 A;  4E7S A;  5L3F A;  2NNN A;  3ZQQ A;  1IN5 A;  2IW5 A;  1BOA A;  1OIS A;  1Z3Y A;  3LSK A;  1WJF A;  2BHZ A;  2DA3 A;  2X4H A;  4HOB A;  4U0V A;  4XKB A;  4EVI A;  2M4K A;  3ZMZ A;  1X3Z B;  3A1Y A;  2AXT C;  3C2B A;  3E6M A;  5CKT A;  2ZME C;  4HLY A;  2Q2E A;  1V5F A;  1YJ9 I;  4IXA A;  4L9V A;  4IQ4 A;  5C3E J;  5FFZ A;  1UHS A;  1YJW I;  5C44 J;  2QZ8 A;  1MBG A;  4A3K J;  1YE9 A;  3JTH A;  1FY7 A;  5LEK A;  3EPZ A;  5ICF A;  1FNN A;  1I3Q J;  1R23 A;  2EIN H;  1MH4 A;  3X2Q H;  3UKG A;  2AQF A;  4ZYD A;  3SZT A;  3WOD F;  1SEU A;  2KT0 A;  1TQI A;  1GHC A;  2ELK A;  3J80 Z;  1YIJ I;  1MJB A;  1DUX C;  4AU7 A;  2L2O A;  3ZRG A;  2JT1 A;  2VON A;  3NWT A;  1BI2 A;  2ZC2 A;  5BPI A;  5KAI C;  3PQJ A;  1YW9 A;  1LB2 A;  2XUB A;  4BUP A;  2LNB A;  1JKR C;  1ZRC A;  2JQ7 A;  3KCC A;  2K27 A;  4KDP A;  1GXP A;  3V8J A;  2HKX A;  2E1M C;  2WAQ A;  2LY2 A;  5LHH A;  1RC9 A;  4RLQ A;  4JYK A;  3ZGK A;  5D5U B;  2CUE A;  1J75 A;  4RAF A;  3WGH A;  3DBH B;  3CC7 I;  1YS6 A;  3K1M A;  1B8I B;  2HOA A;  2XIG A;  4UHT A;  5HOO A;  1STZ A;  4NBQ A;  3HOW J;  1X19 A;  4ZYA A;  5KCM A;  3E1S A;  1Z6R A;  3W6J B;  2CWE A;  3P9C A;  2DDB A;  5H20 A;  5DD8 A;  3QOD A;  3JW4 A;  3S32 A;  4AIJ A;  1LPQ A;  2HZT A;  5L3C A;  2XF6 A;  5KVR A;  3QPL A;  4OOI A;  2CQQ A;  2PJR A;  2LVS A;  5LRR A;  2HGC A;  3I9V 2;  3BZC A;  1P7J A;  1W1W E;  1W5C C;  3J7A Y;  1USS A;  2IGK A;  4JX6 A;  3FHN A;  4ENJ A;  1JE8 A;  2HPI A;  3BCB A;  3DV8 A;  2CUF A;  2PJP A;  4I0B A;  1IV6 A;  3CES A;  2HS5 A;  3M4O J;  2ZBK A;  1X4P A;  2E2H J;  3HOY J;  2KDZ A;  3T1B A;  4YFX F;  2E5N A;  3VSK A;  1MH3 A;  2PMZ N;  3WTS C;  4KIF A;  4QSH A;  1Z05 A;  1U8B A;  3J80 K;  3PO3 J;  2JVG A;  3ZXS A;  4M9S A;  1MDM A;  4OMZ A;  2ZSI B;  4HZF A;  4C2M J;  3H5N A;  2GXG A;  3TOA A;  4PGG A;  4I7H A;  3DXJ F;  1I6X A;  3HZJ A;  2EIJ H;  5EGO B;  1JGG A;  3S8P A;  4N4O B;  2TRT A;  3HB9 A;  2E60 A;  2KRC A;  2HKO A;  4U88 A;  4XIC A;  2LH9 A;  2ELH A;  1T38 A;  3EUH A;  2B0L A;  4DBR A;  1ZQ3 P;  3L2Q A;  1DGW Y;  4YIF A;  2K9S A;  3QRF F;  1IO2 A;  2FBK A;  5FJ8 J;  5CLS A;  5CQE A;  3S3O A;  3H0G J;  5DEQ A;  3TOB A;  4IHX A;  4K2E A;  1APL C;  3I54 A;  1B6A A;  5BS6 A;  1IDY A;  4B48 A;  4V2F A;  3ISP A;  3BLY A;  2WAD A;  2EBI A;  1RI7 A;  2XKO A;  1WSU A;  4XID A;  4LLG F;  1LFU P;  2XGE A;  3I71 A;  1I5Z A;  1O4X A;  2R7D A;  1ENH A;  3W6K B;  2DMN A;  5DCF A;  5EEH A;  4D7M A;  2HYF A;  3OIO A;  2DA2 A;  4FQG A;  2XHK A;  2XAF A;  1QBJ A;  4DYR A;  1J9I A;  4IX7 A;  1KZH A;  3RJP A;  1ERD A;  1DQU A;  4A2U A;  3K70 D;  3CCQ I;  2O03 A;  1ZHF A;  2L9S A;  4NQW B;  2QM3 A;  2VKH A;  2KKO A;  4HF0 A;  5DV5 A;  1C0W A;  3T0Y A;  3IRR A;  3GLX A;  1R6R A;  2Z16 A;  2VAS A;  1JUP A;  4XN0 A;  3S1N J;  1IGN A;  4HNT A;  1T39 A;  2EH3 A;  2F4I A;  3TQN A;  5J1U A;  3Q9S A;  3HOT A;  1JT0 A;  2V9P A;  4UUV A;  5AIP A;  1Z77 A;  2VOO A;  3FM3 A;  4BE1 A;  1I27 A;  3E97 A;  5HDN A;  3BR0 A;  2DO7 A;  3OR2 C;  1SVL A;  3KLO A;  3IC7 A;  2KIS A;  4AYB A;  3CJQ B;  1OQY A;  3CTA A;  1S29 A;  5ED4 A;  1B72 A;  3FXU A;  1MMS A;  3NAU A;  4J19 A;  1Y56 A;  4AD9 A;  3GYH X;  1YIO A;  1NH3 A;  2P0W A;  1ETO A;  1XTA A;  4F3Q A;  3F23 A;  4CO8 A;  4MLO A;  1J09 A;  2DCE A;  1UHW A;  2KQR A;  2QKM B;  1L0O C;  1MKM A;  3CMA I;  2FOW A;  4I09 A;  3CQZ J;  3CMY A;  2Y2Z A;  3OYG A;  3DPT A;  3L2C A;  2MBF A;  1HCR A;  1H88 C;  4HX7 A;  4NUB A;  2LK2 A;  1H8A C;  4XM3 A;  5IT3 A;  1R36 A;  5M5W J;  3S2D J;  3AAF A;  1FOW A;  2Z99 A;  1V4R A;  1BI0 A;  3QAH A;  4M3D A;  4Q5S F;  4HEA 2;  2RN7 A;  1I6H J;  3DCF A;  1YG2 A;  2XAQ A;  2XSD C;  3ERE D;  5TIS C;  3NRV A;  3BQZ A;  2H1L A;  3O2P E;  4RB2 C;  3OIQ A;  3TO9 A;  4L5E A;  2K9N A;  3ZQF A;  1MBK A;  2MA3 A;  2QQ8 A;  1BOB A;  5JI6 A;  4AIK A;  4GO1 A;  4A3G J;  3V8L A;  1J0R A;  3S15 J;  2K9Q A;  2UZK A;  4W1U A;  1TWH J;  4FX4 A;  4XLE A;  3MCZ A;  4G7O F;  2ZNY A;  2JN6 A;  2MD0 A;  1YLF A;  5E1X A;  2FEZ A;  2ID6 A;  2WY8 Q;  3IWF A;  3IAM 2;  5IP7 J;  1TBX A;  3K0L A;  1MBF A;  2D1V A;  1XGM A;  1RIO H;  1A04 A;  3HXL A;  2MSY A;  2EV5 A;  3DBL B;  4S04 A;  3ZCO A;  2CYY A;  4CCO A;  1P9Q C;  1XSX A;  4HDV A;  3WU2 C;  5JFR A;  2WA0 A;  2CV1 A;  1VQ6 I;  2XPV A;  2FU4 A;  4B4C A;  5LLQ A;  3I0T A;  1MW7 A;  4RB3 C;  3CCU I;  2ISY A;  2V4J C;  2P81 A;  2YX4 A;  3K1N A;  4O5V A;  2D5V A;  4LJZ F;  3MZ8 A;  1R4M B;  2HXO A;  2VN2 A;  4RM3 A;  1QZY A;  5K7Z A;  1IDZ A;  2LOO A;  2F5C A;  3OR1 C;  3VPR A;  2WWY A;  4EJV A;  3FIW A;  3HJE A;  2EIL H;  4QWQ A;  1F43 A;  4LIU A;  1IC8 A;  1LVK A;  4BQN A;  4WX9 A;  5HS8 A;  2BGC A;  4M72 A;  3CJT B;  2W4S A;  1VZ0 A;  3N97 A;  3HRS A;  2JRM A;  2ZNZ A;  4FTH A;  5B1A H;  1TW2 A;  2DDA A;  3MFK A;  2VBX A;  2M0M A;  4ESB A;  4L9N A;  4YEL A;  2PMZ A;  3GW2 A;  4ON0 A;  1OMI A;  1B9M A;  1HC8 A;  1TZL A;  2EV0 A;  1R5G A;  4G6Q A;  2CQX A;  4GGG A;  3QQA A;  1G3Y A;  5AON A;  3TW7 A;  4WXC A;  3IKT A;  1TQP A;  2BYV E;  2NNY A;  1YQA A;  4PJM A;  4TV7 A;  1SFK A;  1DP7 P;  3S16 J;  3C2H A;  3F8N A;  3J7A O;  2A68 F;  4EJT A;  1B4A A;  3F6V A;  4UUS A;  2P8T A;  4L0Z B;  1XMK A;  4HDU A;  1ETX A;  2BVM A;  1G6N A;  5FLM J;  2IXS A;  3BTC A;  1FMW A;  5LGU A;  4A5M A;  4DJA A;  2RAE A;  3CLQ A;  3ECH A;  3HUG A;  4BQQ A;  2R7R A;  1TWG J;  4EGY A;  2L7M P;  5FD5 A;  4PUS A;  4XRS G;  2CV0 A;  2YS9 A;  3H5A A;  2HXI A;  1MMA A;  1U0J A;  3FXK A;  1Y1W J;  2K4J A;  3W6V A;  4LOC A;  4I98 B;  3G73 A;  4HAM A;  5FKN A;  5FO5 A;  2YX7 A;  2I8D A;  4BU2 A;  3GX4 X;  6PAX A;  5DM7 F;  2UV1 A;  1O7L A;  4LLN A;  3PUF A;  4GYG A;  4PSW A;  2HOE A;  1B1B A;  2XB5 A;  4MIM A;  2RGV A;  4CYC B;  4B8X A;  3LQR A;  2B9S A;  2GXB A;  3OS0 A;  5DCM B;  1IXR C;  3HBL A;  2FUG 2;  3MAJ A;  1N75 A;  3FK7 A;  3FMS A;  1BI3 A;  3QOP A;  3L2W A;  3JRC A;  3SEZ A;  2NVY J;  2R7O A;  1G3S A;  2A6T A;  2K7L A;  4RS8 A;  3RZD J;  2V79 A;  1XGN A;  3R0A A;  1RR8 C;  3HRM A;  4LFU A;  4XLP F;  4CZC A;  5E18 F;  4M6V A;  1YO5 C;  1BL0 A;  2HZD A;  4HYE A;  3MZH A;  1R58 A;  1O3S A;  3RKW A;  3EYY A;  3HOU J;  1WFX A;  3IUO A;  3ZMT A;  2BW3 A;  1ZGA A;  4XBF A;  3S17 J;  4A3F J;  1YRN A;  2CUJ A;  3IRQ A;  4KNY A;  4C3I J;  2V6C A;  4EM0 B;  2R5Z A;  2HTS A;  1WJA A;  1MSF C;  1FLI A;  1YS7 A;  4HRI A;  2LBF A;  2J5O A;  3C1D A;  4DGW B;  1O7F A;  3RPQ A;  3L7W A;  3V7C A;  3GTO J;  1Y39 A;  3S2H J;  2M1B A;  4BY1 J;  4F52 A;  1QVT A;  3PIO F;  3ABT A;  1E3P A;  4OMY A;  3WG7 H;  2P7V B;  2BY3 A;  5F6F A;  2QCO A;  5GTI C;  3CCR I;  3PSF A;  2ZXH A;  5JHU A;  1OYI A;  2ICW G;  2JJ7 A;  3LA7 A;  1X58 A;  1V54 H;  2P6T A;  1NHA A;  4LIV A;  4MTD A;  5GTH C;  2IS1 A;  2G7H A;  3D5L A;  1H89 C;  1WJ5 A;  2R7F A;  4JP0 A;  2IP2 A;  2K02 A;  2JPC A;  3B6C A;  1NG7 A;  1S9H A;  4ETS A;  5EF6 A;  1D0Y A;  2FMY A;  4C2U A;  3TED A;  2GOX B;  4Q47 A;  3N05 A;  2CS3 A;  4FE7 A;  5ICG A;  2EIM H;  1E2X A;  1FOY A;  1RET A;  3DPL C;  1F4K A;  3I53 A;  3BP8 A;  2KJC A;  4HLX A;  2DPD A;  4BXU A;  2QBY A;  1IAW A;  3KZI C;  3UR3 C;  1WJC A;  3QYB A;  3SFI A;  5EZG A;  4C3H J;  3M3Y J;  3M8F A;  1NK3 P;  5FKM A;  3U21 A;  4EEF G;  1R7J A;  5TRD A;  5FB2 A;  2CQK A;  2ESH A;  3HKZ N;  3AG4 H;  3A01 A;  4XLF A;  1H9G A;  4ITV A;  1MMN A;  1IN6 A;  1VND A;  3NAR A;  5EEA A;  2ACJ A;  1GT0 C;  2HTJ A;  1WRJ A;  4ZZL A;  3DBR B;  3P7N A;  3CDI A;  4MQV A;  4WXH A;  1QHH D;  2RRE A;  2KIQ A;  4N9H A;  2K9L A;  2H09 A;  3FXM A;  1IXC A;  3FXO A;  3QPT A;  3WE2 A;  4HNU A;  3PM1 A;  1OCO H;  1PYV A;  3PSI A;  2FBI A;  2LF7 A;  1SFU A;  4FT8 A;  1UAA A;  2KIF A;  1U5T B;  1UG2 A;  3HG9 A;  3RYP A;  1BR1 A;  5F04 A;  2ZO4 A;  2FQ3 A;  3VWB A;  5ERI A;  2CMP A;  2L7Z A;  3RPU A;  3PJR A;  2E35 A;  4I76 A;  3AL0 C;  3CLO A;  2RNJ A;  3GUD A;  2FNP A;  2OC6 A;  2IGM A;  2VJ4 A;  3OYD A;  3T5X A;  4FET A;  3S2W A;  1BW5 A;  2DFI A;  2QEN A;  1TQM A;  2XAG A;  3GZN B;  4GCV A;  1AOY A;  2R5Y B;  2WAF A;  1Z1D A;  3K6G A;  3TO6 A;  2RVC A;  1FSE A;  1F5T A;  3BOQ A;  2Y75 A;  5J47 A;  5AIQ A;  1VQK I;  3Q0W A;  4D5C A;  2HOS A;  1ZG5 A;  4ESJ A;  1TTY A;  3Q0U A;  5TGT A;  3ABL H;  1ETK A;  2QWW A;  3RSN A;  4B3X A;  2PBI A;  3HSF A;  1XCB A;  3W2A A;  3H92 A;  3SJM A;  2LFB A;  4IO9 F;  3WTU C;  3KYL A;  4M3E A;  3NQO A;  4DYQ A;  3LAP A;  1VQ7 I;  4BYY A;  5ICE A;  1VF9 A;  1DGR M;  2EV6 A;  4U0Y A;  1ETY A;  2X6X A;  3ZQH A;  2QSG X;  4HQE A;  1H0M A;  3EUA A;  2IA0 A;  5A2Q Z;  3M8J A;  1B8I A;  1POG A;  1R49 A;  2UUZ A;  1R1U A;  3I58 A;  3K10 A;  2EB7 A;  3CUQ B;  2NVX J;  2IS6 A;  1UB9 A;  4C30 A;  1VQ4 I;  5JVT A;  3BG6 A;  1VQL I;  3EYI A;  1FPQ A;  3KP4 A;  3REO A;  2KIM A;  2F48 A;  4S0H B;  1BR2 A;  2QYO A;  3RDI A;  4UY8 I;  2EFP A;  1ZEL A;  2FA5 A;  4XNF A;  4DZJ A;  3LSG A;  5F1J A;  3CF2 A;  1BI1 A;  4IHY A;  5JLW A;  1S5L C;  1SVO A;  1I39 A;  4M73 A;  2HI3 A;  4UB8 C;  4CYD A;  2X0L A;  5J3L A;  1SAU A;  3RKQ A;  3A4C A;  3PFY A;  1D3Y A;  4KIC A;  1A36 A;  3I59 B;  1T56 A;  4YII A;  4ZDO A;  1PVE A;  1UFM A;  2M5W A;  4WF2 A;  1EF4 A;  4JOM A;  1RES A;  1K7A A;  1PUE E;  3BPV A;  2K5C A;  1QO0 D;  3PNV A;  1DDN A;  4M71 A;  3WU0 A;  2EWN A;  1XX5 A;  4LD5 A;  5E3N A;  1RUO A;  1QU3 A;  2R3S A;  2DMP A;  5K1Y A;  1OYW A;  1DU0 A;  2G9W A;  2VL8 A;  2E71 A;  3CC2 I;  4E7K A;  2GWR A;  1LNW A;  2TDX A;  5GP9 A;  4RAZ A;  5EGO A;  5C4J J;  2DMT A;  4XL9 A;  5IYC J;  5BMZ A;  3WU1 B;  3DTE A;  5IP9 J;  3KLN A;  2F5E A;  3BRO A;  3F6O A;  5F64 A;  5A2Q K;  1IW7 F;  1U3E M;  3G1M A;  2ESN A;  2ZSH B;  2OQR A;  3GTM J;  4QPO A;  2DYR H;  4HG2 A;  4XLH A;  2JWT A;  4XKC A;  2UWM A;  2ID3 A;  3IV5 A;  4UV8 A;  3VYR B;  4B09 A;  5J1R A;  2M30 A;  5C4X J;  4IEJ A;  2MH9 A;  3CC4 I;  1TT0 A;  2R7S A;  3ZPL A;  3SYT A;  1LDK B;  2EZK A;  1IZ1 A;  3OYC A;  2Y0M A;  2BXY A;  2D45 A;  3HOX J;  1O3R A;  4MQ9 F;  3K9T A;  3H3V K;  3SDG A;  3HOS A;  2VI6 A;  3K69 A;  4J01 A;  2LKP A;  5IPA A;  1KU7 A;  4OWR B;  2KLO A;  2VKE A;  2BZT A;  2MC3 A;  4WK8 F;  3U2R A;  4NQW A;  5CPR B;  3GF2 A;  3O6B B;  4G8X A;  3ZN1 A;  5E17 F;  1K6Y A;  4ESF A;  3G4S I;  4IRI A;  2JZY A;  2EA2 A;  2L9V A;  2K3P A;  1A31 A;  1W7P D;  2DK5 A;  2DMQ A;  5E3M A;  2E1C A;  1UMQ A;  2R4G A;  3WTZ A;  3O8G A;  2XPW A;  3E3V A;  3L9F A;  5K5O A;  3KET A;  3KEY A;  3F3X A;  5CVV A;  3MKY B;  3QP5 A;  3COA C;  4E7I A;  4FAS D;  2Y0S N;  2Z33 A;  2DXI A;  3GFI A;  2DAO A;  4UNO A;  1IUF A;  4A3C J;  4E7Z A;  3CMM A;  3WGI A;  1GUU A;  2DI3 A;  2O61 A;  3OYM A;  5EYR A;  3HGY A;  3ZMV A;  1RUN A;  1T0F C;  5FKK A;  3CO6 C;  3ABM H;  1OCT C;  3HKZ A;  4RGU A;  3OS1 A;  2MG4 A;  2DT6 A;  1R5H A;  1HST A;  4BJ6 C;  2R7V A;  3H3Z A;  3SZG A;  3GO5 A;  5J4Y A;  4I01 A;  2AO9 A;  2OJE D;  3WGG A;  3FDY A;  4CXF A;  2JA7 J;  4N0B A;  3KYC B;  1G4D A;  1N25 A;  1G3T A;  1KA8 A;  2WB1 N;  5F0F A;  2L0K A;  2R7Z J;  2A5Y B;  3KP3 A;  3QU3 A;  1Y8Q B;  3VB2 A;  3DKW A;  1JUM A;  2E7X A;  2XF5 A;  3GVA A;  1GDT A;  2WTE A;  3IAS 2;  4BBS J;  3FBN B;  4XQF A;  3B02 A;  5D6E A;  5H6Q A;  3N4M A;  2CUZ A;  5FKL A;  5L3B A;  4BQO A;  4HV5 A;  1J5Y A;  4PZJ A;  1BR4 A;  3TBI A;  2HDC A;  2XGX A;  3AG1 H;  4C3J J;  4X1E A;  3OSG A;  4R8H A;  3H9J A;  1T33 A;  4IF4 A;  3OYB A;  3TDZ C;  2CFX A;  3LSR A;  2MFZ A;  3RQ4 A;  1LKX A;  1S8N A;  4MFE A;  3W2V A;  1XN7 A;  3MWM A;  1ZR4 A;  1GLN A;  3LFK A;  5FGM A;  1Z6T A;  1XG1 A;  3FX3 A;  4YEJ A;  5K7H A;  2W57 A;  3TW6 A;  3ERM A;  3Q9V A;  2IGO A;  2RQQ A;  3CJN A;  3B73 A;  4ZYG A;  4LLL A;  3HRT A;  1FBQ A;  1R4N B;  3HYI A;  3A0B C;  4EJW A;  2V6E A;  1GVJ A;  2GA1 A;  3DEU A;  5GAD J;  5GAG J;  1Y8R B;  1A6I A;  3HHH A;  3OIP A;  2L4M A;  2UXX A;  1U8R A;  4KMF A;  5F0C A;  2PMU A;  2NVT J;  2ISZ A;  3OOU A;  2H94 A;  3B6A A;  3J81 Z;  3DF8 A;  2G7U A;  1LUJ B;  2BV6 A;  3CCM I;  3GTG J;  2ZXJ A;  2O3F A;  3H9G A;  1Z21 A;  1TLH B;  4E7L A;  2W85 A;  4H0E A;  2A61 A;  2NOG A;  2FE3 A;  5D5V B;  2ADU A;  5GAE J;  2MAB A;  5J4V A;  2HPM A;  4IPA A;  1ZRD A;  4M3G A;  4I0A A;  3LST A;  4J00 A;  1HW5 A;  3R61 A;  2DT5 A;  1WJD A;  4FCY A;  2CQN A;  4QPQ A;  3FXJ A;  5IYB J;  3WTT C;  2OTJ I;  1X2N A;  4BE2 A;  1ETQ A;  3I4N J;  1R22 A;  1O3Q A;  5ICC A;  2M8G X;  1FP1 D;  2L3D A;  4XN3 A;  2F5D A;  2YR2 A;  4RGS A;  4KT5 C;  3L09 A;  4CCM A;  4ZJZ A;  1A6Q A;  1ZK8 A;  1FIA A; 
#chains in the Genus database with same CATH homology
 4ASN A;  2CSO A;  1W5T A;  5ILV A;  1W5S A;  2P4W A;  1F1Z A;  3R60 A;  1EV7 A;  1KQ8 A;  2PG4 A;  5K5Q A;  4AWX B;  1XCV A;  1J7K A;  5ILS A;  1T0F A;  4DNC A;  3ECO A;  3J81 K;  4LB5 A;  3TO7 A;  2ZJ2 A;  3ELK A;  4RB0 A;  3JAM Z;  4MGR A;  4Y13 A;  5L3E A;  1PP7 U;  3D0S A;  1MDM B;  1SFE A;  3K1P A;  1YW8 A;  3JSP A;  4RB1 A;  1Z91 A;  2DK8 A;  5ILU A;  3VEP A;  1ZAR A;  3RTR A;  4HQM A;  1U5T C;  2XV4 S;  2EFN A;  3G3Z A;  4KUM A;  5DCM A;  2XRO A;  2A6H F;  1WI9 A;  2ZME B;  1P6R A;  1BN5 A;  4LK0 F;  4L9T A;  2E7W A;  1WKM A;  2F5F A;  1BM9 A;  3SHF A;  4R79 A;  2QLZ A;  1ZLJ A;  5FD6 A;  3HRU A;  2DQL A;  1QZZ A;  3JAM K;  2FXA A;  2P5V A;  5LBQ A;  5JR3 A;  3MQ0 A;  1K78 B;  2A6E F;  3QU6 A;  2GZW A;  1BIA A;  2CW0 F;  1TNT A;  1JHH A;  4MTE A;  4WXD A;  1MJ9 A;  4G9Y A;  2OBP A;  1QGP A;  3U9G A;  1DPR A;  5LHG A;  1O3T A;  3E6D A;  3KZZ A;  5F1R A;  3KEO A;  4RAY A;  4CHU A;  1W7P B;  4AIH A;  4BAY A;  2LF8 A;  1FP2 A;  2OZ6 A;  3TGN A;  3HSR A;  1ZN2 A;  3FMR A;  3GFM A;  1LEA A;  5DYM A;  5HVQ C;  2M8E A;  1XDS A;  3PFI A;  3DFG A;  4UXN A;  2D2W A;  4IJA A;  4ENM A;  1I1S A;  1FC3 A;  4MHG A;  4OIP F;  4G7H F;  1D8J A;  3KZY A;  4IVN A;  2IVM A;  5CJ9 A;  1P4W A;  2CG4 A;  2VOD A;  1U5T A;  1OR7 A;  1CF7 A;  1TW3 A;  2DU9 A;  3LWF A;  3F8M A;  3LQQ A;  1FYL A;  1J2X A;  3JSO A;  3VOE A;  1QNT A;  3RKY A;  1SD5 A;  1IRG A;  4ZYE A;  2NS0 A;  3GEZ A;  4EMS A;  2V1X A;  3F72 A;  3CDH A;  2FRH A;  3NEU A;  5E8I A;  1VTN C;  1P92 A;  2EJR A;  1IN7 A;  3F22 A;  4E70 A;  2NYX A;  1R1T A;  2JSC A;  2M87 A;  3EQL F;  4O6J A;  5D8K B;  1LQ1 A;  3TDU C;  2IA2 A;  4LG0 A;  1UST A;  2VXZ A;  2XVC A;  4YFK F;  3KE2 A;  4ZZD A;  3IKV A;  4D0P A;  1FYM A;  1E17 A;  2EFO A;  3CUQ A;  2OAZ A;  2PMH A;  3FWE A;  2RC4 A;  2L01 A;  4A0Z A;  2FF4 A;  1IUY A;  3I64 A;  4YFN F;  3FHZ A;  1FOK A;  5CVJ A;  4A6D A;  3GXO A;  4IHT A;  1YW7 A;  1SFX A;  2L4A A;  3R6S A;  2EA4 A;  1CGP A;  3KP6 A;  4L9J A;  1FWZ A;  5L3D A;  2Z3Y A;  2YPR A;  3E5U A;  1OPC A;  1Z7U A;  3E6B A;  2DLL A;  2QQ9 A;  1BC8 C;  2FOK A;  4GYI A;  2A69 F;  2NAZ A;  2NRA C;  1U78 A;  1U6G A;  4BH9 A;  3QP6 A;  1P4X A;  4EGZ A;  1OYY A;  1BJA A;  1LDD A;  4DQ2 A;  4I2O A;  3WTW C;  2DPU A;  2YU3 A;  2Y48 A;  2VBW A;  4YG2 F;  2PEX A;  2KRF A;  1FSH A;  5CYV A;  2RDP A;  2Q8K A;  2IRF G;  4QLC U;  4LGW A;  1ZG1 A;  4GXO A;  3R0J A;  5HLH A;  2JPB A;  2BBY A;  2HFH A;  4UVB A;  4RGX A;  1ZLK A;  5D5X B;  4M6X A;  2V1D A;  3OV8 A;  5K5R A;  3ZQ7 A;  3H3U A;  5BPD A;  1ON1 A;  2P6S A;  2HEO A;  2BE5 F;  1PP8 F;  3MZY A;  3Q5F A;  3HSE A;  3WTV C;  5D8L B;  2ZFW A;  2XRN A;  3RIR A;  4L18 B;  1ON2 A;  3SXY A;  2EK5 A;  3I5U A;  1YFH A;  4P9U A;  5D4R A;  4HV6 A;  4ENN A;  2IA1 A;  1HXD A;  2PN6 A;  4UVA A;  4Z2Y A;  2VBY A;  1SD4 A;  1D5V A;  2PI0 A;  5J8F A;  5BOX A;  1KU9 A;  2OU2 A;  1K6O A;  1SD7 A;  4ZYH A;  2A3S A;  2EFQ A;  2O8X A;  4MNU A;  3MEX A;  1KGS A;  1K79 A;  5FLX Z;  2VC0 A;  4BNC A;  3TKY A;  2FNA A;  1X3U A;  1G3W A;  1XMA A;  1B9N A;  2OZU A;  2XAS A;  4Q4Z F;  4HA8 A;  1LDJ A;  1SMT A;  3M9A A;  2P5K A;  2KIU A;  4FHT A;  4KN4 X;  3FXR A;  4PDK A;  1S6L A;  2O0Y A;  5LHI A;  1FBU A;  5D4S A;  3KP7 A;  1MGT A;  2IPQ X;  3U1D A;  4EM1 A;  3FF5 A;  2ZKZ A;  2XKP A;  5DUI A;  3HTS B;  3ABU A;  3LA3 A;  3F8B A;  5D5W B;  5J6X A;  3SFZ A;  3ML6 A;  3BJ6 A;  1WQ2 A;  5D6F A;  4UV9 A;  2MLG A;  3GFJ A;  5FLX K;  5CVU A;  4U7B A;  2A07 F;  4XSX F;  2P7C B;  3FMQ A;  2ETH A;  4IRH A;  2GA2 A;  3DP7 A;  1SD6 A;  3VOD A;  2EFW A;  4N9I A;  4M9X A;  5FFX A;  2STW A;  1PDN C;  4S05 A;  3C18 A;  3KP2 A;  1HBX G;  4HBL A;  3EDP A;  2DW4 A;  1U2W A;  1RZ4 A;  3F8F A;  3E6C C;  3ULQ B;  3EET A;  3HIF A;  1EH7 A;  2AXL A;  4BQA A;  2VOP A;  2V9V A;  1QPM A;  4ENK A;  2UXN A;  1OKR A;  2HQN A;  5LGN A;  1FYK A;  2K86 A;  2QQB A;  2E1N A;  1Y0U A;  2XAH A;  2H27 A;  1R00 A;  1KYW A;  5HS7 A;  4OIO F;  1ULY A;  5LEJ A;  4G7Z F;  2ZME A;  4L0Y B;  5EEG A;  2P5L C;  4NB5 A;  5DUK A;  5IT9 Z;  1KQ0 A;  1FZP B;  4A0Y A;  3KFW X;  4OU0 A;  1YTY A;  1WWX A;  5L3G A;  1XB4 A;  3FZV A;  1JGS A;  1MD0 A;  3CO7 C;  2RQP A;  4NHJ A;  2JRT A;  4G94 A;  3P9I A;  5LRS A;  4FX0 A;  3SQN A;  1K78 A;  2YSR A;  2FML A;  2JTV A;  3VFZ A;  5CVR A;  2L54 A;  5E1W A;  4P96 A;  3ZP5 A;  1HW1 A;  2STT A;  2PQ8 A;  1EH8 A;  4XLN F;  4PCQ A;  1ODD A;  1XD7 A;  1KU3 A;  3K2Z A;  3WTY C;  3LAJ A;  2V1U A;  2FBH A;  1O57 A;  1W7P A;  4HF2 A;  1FT9 A;  2IT0 A;  4U0W A;  4XSZ F;  5IT9 K;  1KYZ A;  1ZH5 A;  2C6Y A;  5HLG A;  4G6D A;  4A0X A;  1HW2 A;  4OIQ F;  4JQF A;  3SZP A;  2W84 A;  2VE9 A;  2WV0 A;  3HTU A;  1JXS A;  3V8K A;  4R1H A;  2AS5 F;  4P55 A;  1Q1H A;  2VT2 A;  2HR3 A;  3JTG A;  2Q0O A;  2J5P A;  4JK1 X;  1HKT A;  4WCG A;  1LVA A;  1S3J A;  5BQT A;  1KQ9 A;  3KP5 A;  2K4B A;  4EJO A;  2H6C A;  3ZN0 A;  4KIG A;  4HF1 A;  1XSD A;  2GQQ A;  5TJJ A;  3PQK A;  4KA4 A;  3M7G A;  3WE3 A;  3I4P A;  3C7J A;  3M8E A;  1P4A A;  3OOP A;  1IXS B;  2PFB A;  3P9K A;  4OIR F;  1MZB A;  2DQR A;  1KU2 A;  2PLY A;  3QPH A;  4XRF A;  3CUQ C;  3WG9 A;  4IRG A;  1YYV A;  3V4G A;  3BDD A;  1FBS A;  4KMU X;  5H6R A;  3WTX C;  1LEB A;  4HX8 A;  1I1G A;  2D1H A;  3GWZ A;  4CDG A;  2F2E A;  1DPU A;  1ZG3 A;  4M74 A;  1S7A A;  3BWG A;  2VT3 A;  3CUO A;  4UVC A;  3C3W A;  5KK1 A;  4I02 A;  1XDU A;  2M45 A;  2QQA A;  1JHF A;  1HQC A;  2KJB A;  1REP C;  2WC2 A;  3R4K A;  5HDG A;  1HSJ A;  4ZH4 F;  3RI4 A;  5HDK A;  1UHM A;  4BHC A;  1MJA A;  5CVI A;  1Z9C A;  2QVO A;  5E1Z B;  3O3K A;  1UCR A;  4AVP A;  2RKH A;  3E5X A;  3V7S A;  3RKX A;  3BJO A;  3IHU A;  5HS9 A;  1D8K A;  4M9Z A;  1BIB A;  2W24 A;  4LK1 F;  2HWV A;  1IF1 A;  1ZRF A;  5E8G A;  1XGO A;  1TNS A;  5LGT A;  2CO5 A;  3L00 A;  2ZCW A;  5DD4 A;  4Y15 A;  1F9N A;  4PGH A;  1IN8 A;  2HYG D;  3BY6 A;  1H9T A;  1ZRE A;  1SMY F;  4KIB A;  4U7D A;  2VE8 A;  4F7Z A;  4P9F A;  1T98 A;  3E5Q A;  5J8C A;  3HHG A;  1BBY A;  2QUF A;  4O3M A;  2COM A;  3ROU A;  1ZYR F;  1RNL A;  4KFC A;  2BEO A;  3ZMS A;  3LA2 A;  3V7R A;  4LMY A;  4MEY F;  2DBB A;  1J59 A;  4HW0 A;  3BPX A;  3M1E A;  4KN7 X;  1L3L A;  3GFL A;  4KYW A;  2Z5U A;  3I59 A;  1IN4 A;  4LB6 B;  3GZ5 A;  1FX7 A;  4A6E A;  4IHS A;  2GAU A;  1LJ9 A;  1ONV A;  4BHP A;  4L5I A;  2IJL A;  3T8T A;  3GZ6 A;  1SAX A;  4A12 A;  1W4M A;  4CZZ A;  1T2K A;  4CGZ A;  4EV0 A;  1EH6 A;  4M6Y A;  4OIN F;  3RYR A;  3FM5 A;  2Z9O A;  2OA4 A;  1CF7 B;  2OD5 A;  1P2F A;  3IL2 A;  3DQV C;  5E20 A;  2XAJ A;  3BJA A;  3IWZ A;  5DDG A;  2FSW A;  1BC7 C;  4A5N A;  1R1V A;  4EM2 A;  1V3F A;  1HKS A;  2DTR A;  4WWC A;  1GXQ A;  3ZMU A;  2HQR A;  4RGR A;  2GIV A;  3FXQ A;  1HKQ A;  2LDU A;  4MEX F;  1QQI A;  1ZAO A;  4LG0 B;  5HLI A;  4Q48 A;  2LSO A;  3KEQ A;  1T6S A;  2MD5 A;  1AWC A;  4EQQ A;  1IRF A;  2MH2 A;  3BZ6 A;  3T8R A;  4CIC A;  3ZMD A;  2QBY B;  2L02 A;  1ZGJ A;  2VC1 A;  2H6B A;  4JBA A;  2CGP A;  1S7O A;  4P5O A;  4EJU A;  2MLK A;  2VBZ A;  2W25 A;  2O6G E;  1XSV A;  4L5J A;  4HX4 A;  3F21 A;  3F8C A;  4Y17 A;  2OQG A;  4BHB A;  1XGS A;  1B59 A;  2RV8 A;  5L3F A;  2NNN A;  1IN5 A;  2IW5 A;  1BOA A;  2X4H A;  4HOB A;  4U0V A;  4EVI A;  3ZMZ A;  3E6M A;  4HLY A;  2Q2E A;  4IXA A;  4L9V A;  5FFZ A;  2QZ8 A;  3JTH A;  1FY7 A;  5LEK A;  5ICF A;  1FNN A;  1R23 A;  4ZYD A;  3SZT A;  3WOD F;  1TQI A;  1GHC A;  3J80 Z;  1MJB A;  1DUX C;  2JT1 A;  2VON A;  1BI2 A;  5BPI A;  3PQJ A;  1YW9 A;  1LB2 A;  2XUB A;  2LNB A;  1ZRC A;  3KCC A;  2K27 A;  4KDP A;  1GXP A;  3V8J A;  2HKX A;  5LHH A;  5D5U B;  1J75 A;  3WGH A;  1YS6 A;  3K1M A;  2XIG A;  4UHT A;  5HOO A;  1STZ A;  1Z6R A;  3W6J B;  2CWE A;  3P9C A;  5H20 A;  5DD8 A;  3JW4 A;  4AIJ A;  2HZT A;  5L3C A;  5KVR A;  4OOI A;  5LRR A;  2HGC A;  1USS A;  4ENJ A;  1JE8 A;  3DV8 A;  2PJP A;  4I0B A;  2HS5 A;  2ZBK A;  3T1B A;  4YFX F;  3WTS C;  4KIF A;  1Z05 A;  3J80 K;  4M9S A;  1MDM A;  4OMZ A;  4HZF A;  2GXG A;  3TOA A;  4PGG A;  4I7H A;  3DXJ F;  1I6X A;  4U88 A;  2HKO A;  2ELH A;  1T38 A;  3EUH A;  2B0L A;  4YIF A;  3QRF F;  2FBK A;  5CLS A;  5DEQ A;  3TOB A;  4K2E A;  3I54 A;  1B6A A;  5BS6 A;  3ISP A;  1RI7 A;  2XKO A;  1WSU A;  4LLG F;  3I71 A;  1I5Z A;  2R7D A;  3W6K B;  5DCF A;  5EEH A;  2HYF A;  2XHK A;  2XAF A;  1QBJ A;  1J9I A;  3RJP A;  4A2U A;  2O03 A;  1ZHF A;  2QM3 A;  2KKO A;  4HF0 A;  5DV5 A;  1C0W A;  3T0Y A;  3IRR A;  3GLX A;  1T39 A;  3TQN A;  3HOT A;  3Q9S A;  4UUV A;  5AIP A;  2VOO A;  3FM3 A;  1I27 A;  3E97 A;  5HDN A;  2DO7 A;  3KLO A;  3IC7 A;  3CTA A;  1S29 A;  5ED4 A;  3FXU A;  4AD9 A;  3GYH X;  1YIO A;  3F23 A;  4CO8 A;  1UHW A;  1L0O C;  1MKM A;  4I09 A;  3DPT A;  3L2C A;  2MBF A;  4HX7 A;  5IT3 A;  1R36 A;  3AAF A;  2Z99 A;  1V4R A;  1BI0 A;  3QAH A;  4Q5S F;  2RN7 A;  1YG2 A;  2XAQ A;  3ERE D;  3NRV A;  3O2P E;  4RB2 C;  3TO9 A;  2MA3 A;  5JI6 A;  4AIK A;  4GO1 A;  3V8L A;  1J0R A;  2UZK A;  4FX4 A;  3MCZ A;  4G7O F;  2ZNY A;  1YLF A;  5E1X A;  2FEZ A;  3IWF A;  1TBX A;  3K0L A;  2D1V A;  1XGM A;  1RIO H;  1A04 A;  2EV5 A;  4S04 A;  2CYY A;  1XSX A;  4HDV A;  5JFR A;  2FU4 A;  5LLQ A;  4RB3 C;  3I0T A;  2ISY A;  2YX4 A;  3K1N A;  4O5V A;  4LJZ F;  2VN2 A;  1QZY A;  2F5C A;  2WWY A;  4EJV A;  4QWQ A;  4WX9 A;  5HS8 A;  2BGC A;  4M72 A;  3N97 A;  3HRS A;  2ZNZ A;  1TW2 A;  3MFK A;  2VBX A;  4ESB A;  4L9N A;  3GW2 A;  4ON0 A;  1OMI A;  1B9M A;  2EV0 A;  1R5G A;  4G6Q A;  4GGG A;  1G3Y A;  5AON A;  4WXC A;  3IKT A;  2NNY A;  2BYV E;  1TQP A;  1YQA A;  4TV7 A;  1DP7 P;  3F8N A;  3J7A O;  2A68 F;  4EJT A;  1B4A A;  3F6V A;  2P8T A;  4L0Z B;  1XMK A;  4HDU A;  1G6N A;  5LGU A;  4A5M A;  3HUG A;  3ECH A;  4EGY A;  5FD5 A;  2K4J A;  4I98 B;  3G73 A;  4HAM A;  5FO5 A;  2YX7 A;  3GX4 X;  6PAX A;  4LLN A;  1O7L A;  4GYG A;  2HOE A;  1B1B A;  2RGV A;  4B8X A;  3LQR A;  2GXB A;  5DCM B;  1IXR C;  3MAJ A;  3FMS A;  1BI3 A;  3QOP A;  1G3S A;  2K7L A;  4RS8 A;  2V79 A;  1XGN A;  3R0A A;  3HRM A;  4LFU A;  4XLP F;  5E18 F;  1YO5 C;  4HYE A;  3MZH A;  1R58 A;  1O3S A;  3RKW A;  3EYY A;  3ZMT A;  1ZGA A;  4XBF A;  3IRQ A;  4KNY A;  2V6C A;  4EM0 B;  2HTS A;  1FLI A;  1YS7 A;  2J5O A;  3C1D A;  1O7F A;  3RPQ A;  3L7W A;  3V7C A;  2M1B A;  3ABT A;  4OMY A;  2P7V B;  5F6F A;  5JHU A;  1OYI A;  3LA7 A;  2P6T A;  1NHA A;  4MTD A;  2G7H A;  3D5L A;  2R7F A;  2IP2 A;  2K02 A;  2JPC A;  4ETS A;  2FMY A;  4Q47 A;  5ICG A;  1E2X A;  3DPL C;  1F4K A;  3I53 A;  3BP8 A;  2KJC A;  4HLX A;  2DPD A;  4BXU A;  2QBY A;  1IAW A;  3M8F A;  1R7J A;  5TRD A;  5FB2 A;  2CQK A;  2ESH A;  1H9G A;  2ACJ A;  1IN6 A;  2HTJ A;  1WRJ A;  4ZZL A;  3P7N A;  4MQV A;  4WXH A;  4N9H A;  3QPT A;  2H09 A;  1IXC A;  3WE2 A;  2FBI A;  2LF7 A;  1SFU A;  4FT8 A;  2KIF A;  1U5T B;  3RYP A;  2ZO4 A;  2FQ3 A;  5ERI A;  3RPU A;  3CLO A;  2RNJ A;  3GUD A;  2FNP A;  3T5X A;  3S2W A;  2DFI A;  2QEN A;  1TQM A;  2XAG A;  4GCV A;  1AOY A;  1Z1D A;  3TO6 A;  2RVC A;  1FSE A;  1F5T A;  3BOQ A;  2Y75 A;  5AIQ A;  1ZG5 A;  4ESJ A;  1TTY A;  2QWW A;  2PBI A;  3HSF A;  1XCB A;  3H92 A;  3WTU C;  3NQO A;  3LAP A;  4BYY A;  5ICE A;  2EV6 A;  4U0Y A;  4HQE A;  1H0M A;  2IA0 A;  5A2Q Z;  1R1U A;  3I58 A;  2EB7 A;  3CUQ B;  1UB9 A;  5JVT A;  3EYI A;  1FPQ A;  3KP4 A;  3REO A;  2KIM A;  2QYO A;  3RDI A;  2EFP A;  2FA5 A;  1BI1 A;  4M73 A;  4CYD A;  2X0L A;  1D3Y A;  4KIC A;  3I59 B;  4YII A;  1UFM A;  2M5W A;  4WF2 A;  1K7A A;  1PUE E;  3BPV A;  1QO0 D;  1DDN A;  4M71 A;  3WU0 A;  2EWN A;  4LD5 A;  1RUO A;  2R3S A;  5K1Y A;  1OYW A;  2G9W A;  2GWR A;  1LNW A;  2TDX A;  4RAZ A;  5BMZ A;  3WU1 B;  3KLN A;  2F5E A;  3BRO A;  3F6O A;  5F64 A;  5A2Q K;  1IW7 F;  1U3E M;  2ESN A;  2OQR A;  2UWM A;  4UV8 A;  4B09 A;  2M30 A;  2MH9 A;  3ZPL A;  1LDK B;  1IZ1 A;  2Y0M A;  2D45 A;  1O3R A;  4MQ9 F;  3K9T A;  3HOS A;  3K69 A;  2LKP A;  1KU7 A;  4WK8 F;  2MC3 A;  3U2R A;  4NQW A;  3GF2 A;  3O6B B;  4G8X A;  3ZN1 A;  5E17 F;  4ESF A;  4IRI A;  2JZY A;  2EA2 A;  2E1C A;  1W7P D;  2DK5 A;  3WTZ A;  3E3V A;  3L9F A;  5K5O A;  3KET A;  3COA C;  3F3X A;  5CVV A;  3QP5 A;  2Z33 A;  3GFI A;  2DAO A;  4UNO A;  3WGI A;  2DI3 A;  2O61 A;  1RUN A;  3ZMV A;  3CO6 C;  4RGU A;  1R5H A;  1HST A;  3H3Z A;  3GO5 A;  4I01 A;  3WGG A;  4CXF A;  4N0B A;  1G4D A;  1G3T A;  1KA8 A;  2A5Y B;  3KP3 A;  3QU3 A;  3VB2 A;  3DKW A;  2E7X A;  3GVA A;  2WTE A;  3B02 A;  5D6E A;  5H6Q A;  3N4M A;  5L3B A;  4HV5 A;  1J5Y A;  4PZJ A;  2HDC A;  2XGX A;  4R8H A;  4IF4 A;  3TDZ C;  2CFX A;  1S8N A;  1XN7 A;  3MWM A;  3LFK A;  5FGM A;  1Z6T A;  3FX3 A;  2W57 A;  3Q9V A;  3CJN A;  3B73 A;  4ZYG A;  4LLL A;  3HRT A;  1FBQ A;  3HYI A;  4EJW A;  1GVJ A;  2GA1 A;  3DEU A;  3HHH A;  1U8R A;  2L4M A;  2UXX A;  4KMF A;  2PMU A;  2ISZ A;  2H94 A;  3J81 Z;  3DF8 A;  2G7U A;  2BV6 A;  2ZXJ A;  2O3F A;  1TLH B;  2W85 A;  4H0E A;  2A61 A;  2FE3 A;  5D5V B;  2ADU A;  4IPA A;  1ZRD A;  4I0A A;  3LST A;  1HW5 A;  3R61 A;  2DT5 A;  3WTT C;  1R22 A;  1O3Q A;  5ICC A;  1FP1 D;  2L3D A;  2F5D A;  2YR2 A;  4RGS A;  4KT5 C;  3L09 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...