3F72A

Crystal structure of the staphylococcus aureus pi258 cadc metal binding site 2 mutant
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
108
structure length
107
Chain Sequence
IFGYDEEKVNRIQGDLQTVDISGVSQILKAIADENRAKITYALCQDEELCVCDIANILGVTIANASHHLRTLYKQGVVNFRKGKLALYSLGGEAIRQIMMIALAHKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein, gene regulation
molecule keywords Cadmium efflux system accessory protein
publication title Role of bound Zn(II) in the CadC Cd(II)/Pb(II)/Zn(II)-responsive repressor.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 35
structure length 107
sequence length 108
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2008-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01022 HTH_5 Bacterial regulatory protein, arsR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3f72A00
1IXRC 1QO0D 5HS8A 1YO5C 2Z3YA 2VC0A 2V79A 4BHCA 2H6BA 1TQPA 4GYIA 1V3FA 3FXQA 5L3GA 4MQ9F 1YW7A 4OIOF 2LSOA 4HF1A 2GAUA 3E6DA 1JE8A 4G7OF 3KFWX 3WGHA 3KEOA 3ZPLA 1KU3A 2JSCA 4CICA 3V8KA 3DP7A 5IT9Z 1B59A 2JRTA 2AS5F 1SD4A 2IP2A 5FFXA 3LSTA 2HYGD 5F6FA 4LLLA 5D5XB 2QQAA 1IN6A 2YSRA 2FBHA 5IT3A 1W4MA 4L9NA 2TDXA 1FSEA 3LQRA 2GXGA 3BROA 1WWXA 4ON0A 4KYWA 1YIOA 3NQOA 2Z9OA 2DFIA 2KIFA 3CDHA 1FP2A 4KUMA 2Z5UA 5DUKA 1IN8A 4HQMA 5J8CA 4MNUA 2STTA 4RS8A 5LHHA 1T0FA 1PP8F 2NS0A 2ZKZA 4KIBA 2VE8A 2CG4A 2MLKA 5D6EA 4CZZA 3WTZA 5HDNA 4HF0A 4L5JA 4XLPF 1KGSA 3ZMDA 3QAHA 3DV8A 1XMAA 2O8XA 3B73A 1GHCA 3GVAA 2HTSA 1IZ1A 3JSOA 3L00A 3HSRA 3N4MA 3O2PE 4OINF 3H92A 2D45A 3ERED 2YPRA 2RQPA 4YIFA 4LLGF 3VOEA 3COAC 1RZ4A 4ENMA 2O6GE 1HXDA 1IXCA 4HX8A 4TV7A 5EEGA 3HTUA 4I2OA 2MA3A 5DD4A 1PP7U 1LDJA 2OBPA 1SMYF 2EA4A 2GIVA 2FBIA 1WSUA 2M5WA 3E5XA 1HW1A 1GXQA 3KP7A 5E17F 2K4BA 4K2EA 4LG0A 2WC2A 2VBZA 2PN6A 1TW3A 1XGSA 1Q1HA 4WX9A 3WTXC 4IXAA 4WCGA 1TNSA 3EETA 4P9FA 2Z99A 1XGNA 1WRJA 2HQNA 3TDUC 1G4DA 3C1DA 3JAMZ 3WTWC 1FBUA 2PMUA 5ICFA 3L2CA 1U6GA 2L54A 2HZTA 3F21A 1R5GA 1C0WA 4IHSA 4IPAA 2HKXA 4RB3C 4YFXF 4ESFA 1BIAA 3RKYA 4Q47A 4Y17A 4LG0B 3E6CC 1J0RA 3DXJF 3CUOA 2ISYA 2K86A 4R79A 3ELKA 4IVNA 1IN5A 2XUBA 3LWFA 3VEPA 1BN5A 2MD5A 3BWGA 4OIPF 4WXCA 5E1ZB 4L9TA 2VBXA 1BI2A 2RDPA 5HVQC 3K1MA 3I59A 1T38A 2PQ8A 1BI0A 1ULYA 1U5TA 2Q2EA 5CVUA 4EVIA 2ELHA 1YFHA 4RGUA 3WG9A 2XIGA 4MQVA 3Q5FA 1EH8A 4ZH4F 1YW9A 1HKSA 1U78A 5LGTA 4CHUA 1TLHB 2O03A 4BYYA 1S29A 1XDUA 3I59B 2M87A 3WU0A 5FLXZ 3C18A 1U5TB 2RN7A 4MTDA 1P4AA 2V9VA 3ZMZA 2A3SA 1J9IA 3F8FA 3HUGA 2E1CA 1ZRCA 2XVCA 3J81K 3V4GA 1DPRA 2FF4A 1T39A 1D5VA 3VODA 4HYEA 2XV4S 4ZYGA 2VT2A 2MLGA 1K7AA 3LAJA 2FNPA 2MC3A 3KLNA 1YW8A 1ZAOA 2ZXJA 2EA2A 3KZYA 5ILUA 1OKRA 4XSZF 3ECOA 3E97A 1SMTA 4ASNA 2K27A 2WTEA 1IF1A 1QBJA 4CGZA 5IT9K 2MBFA 3JSPA 2RKHA 1K6OA 4RB2C 3F3XA 3TQNA 5DYMA 2H94A 4FX4A 2XAHA 4P96A 4XRFA 1L0OC 5LLQA 2L3DA 5D5UB 5LRRA 1AWCA 2STWA 1KYWA 2WV0A 1ZGAA 2ZMEA 1SD6A 4RB1A 2ISZA 3H3ZA 3H3UA 1XB4A 2JPBA 3TDZC 5L3BA 1KU9A 2VOPA 1MJ9A 2A68F 5BQTA 1D8JA 4L9VA 2GXBA 2YU3A 1B1BA 5LHIA 2VONA 1S7OA 1FC3A 1LDKB 2P7VB 3REOA 1G6NA 2FU4A 2A5YB 3IKTA 1R5HA 2HEOA 1ZLJA 2ZMEB 3W6JB 2AXLA 1XCVA 3R4KA 4Y13A 3RTRA 1J59A 3P9KA 4L0YB 5E1WA 5FB2A 5LHGA 4IHTA 1MZBA 4KN7X 4DNCA 2LNBA 2FMYA 4KMUX 4WK8F 1TBXA 2F2EA 3GYHX 3MZYA 5D5WB 3N97A 1LJ9A 3PQJA 1T2KA 3MCZA 4HX7A 4MHGA 4UHTA 3WTYC 3MAJA 3I64A 1S7AA 2DAOA 5E8GA 3NEUA 3L09A 4UVCA 1PDNC 1IXSB 4U88A 4PCQA 1FSHA 3HRSA 2P6TA 2ZFWA 4ZYDA 4JK1X 1KQ8A 4OIRF 1LQ1A 1IW7F 4MEYF 1HSJA 4WWCA 2QENA 3SFZA 1K79A 3D0SA 3FM5A 4AIHA 4G6QA 5J6XA 1H9TA 2DI3A 5JVTA 2W25A 4OMZA 3JAMK 2G7HA 1WQ2A 2XGXA 5FO5A 5DV5A 2QLZA 4CDGA 1STZA 1J2XA 2FA5A 1F5TA 3ZMSA 1HW2A 3RKXA 1ZLKA 1P2FA 3GO5A 3I0TA 4M71A 3EDPA 2VN2A 1OYIA 1LNWA 5D6FA 5BPIA 3P9CA 2LDUA 2EWNA 4ZYEA 1B9MA 3GUDA 4M9XA 3QU3A 1ZYRF 1U3EM 3I53A 1CF7A 1IN4A 4P5OA 3M9AA 1ZHFA 1EV7A 2EV6A 3FMQA 2IA2A 2LF7A 4LB5A 5K5OA 1P4XA 3IRRA 4PZJA 3ZMTA 3WTSC 1R7JA 5A2QZ 2ZBKA 1R36A 3DPTA 2KIUA 3MFKA 3KE2A 3R60A 1XD7A 2QVOA 3E6MA 3BOQA 1R1TA 2D1VA 4P9UA 3KEQA 1G3TA 1CF7B 5FLXK 4KN4X 2W85A 3CUQC 4A6EA 5D4RA 3EYIA 3TO9A 4HOBA 4QWQA 3KP2A 2P5VA 4N0BA 2Y75A 4H0EA 4I98B 3HIFA 4B09A 5DUIA 1SD5A 4LGWA 2F5CA 4M9ZA 2L4AA 1JXSA 5J8FA 5TRDA 1DPUA 1P4WA 4BHPA 2ZJ2A 3CLOA 1UHWA 2VE9A 4ETSA 2EV5A 1ZARA 3GWZA 4KNYA 5HDGA 2XAJA 3GW2A 4CO8A 5D4SA 1F1ZA 5ERIA 2H27A 2IA1A 2M45A 2FSWA 5E18F 4EGZA 1PUEE 3MWMA 2P5KA 4GCVA 5ED4A 4L18B 2W57A 3OV8A 2J5PA 2COMA 5BPDA 1T98A 3HRUA 3K9TA 2BEOA 2X0LA 1IUYA 1IRFA 2FEZA 1ZRFA 3IL2A 1UFMA 2M30A 1UCRA 3ECHA 4AWXB 4M6XA 3CTAA 2D2WA 4HLYA 3SZTA 5LBQA 3JW4A 4A0XA 3ML6A 1SFXA 2G9WA 3VB2A 1Z7UA 4EJVA 2EJRA 2LF8A 4ESBA 3T0YA 4A6DA 2VC1A 1MD0A 1RIOH 2K7LA 5D5VB 1BBYA 4MEXF 1Z6RA 1LDDA 1YYVA 3ABUA 2CGPA 2GZWA 4HLXA 1I6XA 2EFOA 1JHFA 2V6CA 2HOEA 1TQIA 1O7FA 1QGPA 2DLLA 1D3YA 1Z1DA 2JTVA 1P6RA 3LFKA 4N9HA 2A6EF 3BZ6A 3RI4A 4GGGA 2CW0F 1KQ9A 3F8NA 1R00A 1J75A 2OZUA 1FZPB 2O0YA 4FX0A 3BJOA 4HZFA 5L3EA 2A6HF 5JFRA 2WWYA 2HWVA 2O3FA 3PQKA 1RNLA 4YFKF 3WTUC 3FX3A 1B6AA 4RB0A 2OU2A 1S8NA 1S3JA 1FX7A 5CYVA 3KZZA 4Q4ZF 4PDKA 2L01A 2QZ8A 4ZZDA 5E1XA 5K5QA 2JZYA 1FBQA 5BMZA 3I5UA 4HF2A 1W5SA 1LEAA 3IRQA 2ESHA 3ULQB 2UXXA 4WXHA 3J80Z 1SFEA 2IRFG 5LRSA 3C7JA 2B0LA 5DEQA 1DDNA 1ODDA 2H6CA 4I0BA 1RUOA 4S04A 2E7XA 3ZQ7A 3FWEA 2LKPA 2PFBA 1FYMA 4AIJA 1G3YA 3D5LA 3FHZA 3HOSA 4N9IA 2CSOA 2K4JA 2DPUA 1FPQA 1Y0UA 2VOOA 4LJZF 3E5QA 4KDPA 2PJPA 2EFWA 5HS9A 2UWMA 4EGYA 4Q5SF 5H6RA 2XRNA 1D8KA 3BJAA 2Y0MA 3TGNA 4EV0A 5A2QK 2GWRA 3V7CA 2EV0A 3QOPA 1LVAA 3QU6A 2QM3A 3GEZA 3ZP5A 2K02A 2RVCA 4EM0B 4HDUA 1W7PD 1EH7A 3ABTA 3M8FA 4Q48A 1F9NA 4HAMA 4HBLA 2QQ9A 3I71A 3T5XA 2DO7A 1R1UA 3HHGA 5L3DA 2ETHA 1F4KA 4DQ2A 1DUXC 4EJUA 4A5MA 5L3CA 5FFZA 3Q9VA 3LA7A 3K1PA 1U2WA 2FOKA 2P5LC 4ENNA 4IRHA 2DPDA 5LGUA 2VXZA 2FNAA 3CUQA 4UXNA 4I0AA 4UV9A 1JGSA 2CQKA 5D8KB 3EUHA 2D1HA 1SAXA 2FQ3A 4G8XA 1USSA 2QYOA 4U0VA 2XAQA 2Y48A 2XKOA 3QRFF 4ENJA 3C3WA 5K1YA 4UV8A 4BQAA 2RV8A 2BGCA 4M72A 4G94A 4LK1F 3CUQB 4R1HA 3RPUA 3LA2A 5E20A 5CLSA 4AD9A 1BI1A 4OMYA 4BXUA 3M1EA 2KIMA 1OYYA 4M74A 1MGTA 5AIQA 3FZVA 3J7AO 3M7GA 1WI9A 1K78A 2ZO4A 5ICEA 2F5DA 2UZKA 1O3TA 2PG4A 5FD5A 2HFHA 4LD5A 1OPCA 2EFPA 3MZHA 1ZG1A 3K2ZA 3LA3A 4UVAA 4GO1A 2HS5A 4HA8A 3OOPA 4AVPA 2DW4A 5FGMA 1XMKA 4LB6B 3EQLF 4UNOA 3BJ6A 2CFXA 3I58A 2XAFA 3KLOA 1W5TA 1K78B 5HLIA 3WU1B 2KKOA 2CO5A 2EB7A 1I1GA 2YX7A 4MGRA 3T8RA 2P7CB 5LEKA 4D0PA 2QQBA 3ZN0A 5AONA 2R7DA 4XSXF 4I02A 6PAXA 1OYWA 4EJWA 2YX4A 3TO7A 3F72A 1RUNA 4CXFA 1J5YA 4HQEA 4RGRA 1ZH5A 2XKPA 3BY6A 2RC4A 3R6SA 1UB9A 3L7WA 4A12A 4I7HA 3GFJA 1UHMA 2DU9A 3HSFA 4NHJA 4EQQA 4RAZA 1H9GA 2NAZA 2PEXA 4GXOA 4LFUA 2PBIA 4PGHA 5F64A 4B8XA 3KCCA 1MDMA 1DP7P 2MH2A 1KQ0A 1ZREA 3J80K 3QPTA 1G3WA 4G7ZF 4WF2A 3E5UA 5ICGA 3O6BB 4I01A 4KIFA 1BOAA 4KMFA 3V7RA 2HKOA 3RPQA 2IT0A 1JHHA 1BC8C 1IRGA 3JTHA 1MDMB 3F8MA 1QNTA 1ZRDA 1O3SA 3GF2A 3HRMA 4EJOA 2VODA 3WTTC 3GFIA 3QP6A 1ONVA 5AIPA 1IN7A 1USTA 1TTYA 1FBSA 3B02A 3FMRA 3MEXA 4S05A 1B9NA 1R1VA 4U7DA 5DDGA 1GXPA 1BIBA 2NYXA 4ENKA 2DTRA 3E6BA 2V1UA 3RYRA 3DKWA 2Q8KA 4PGGA 1R23A 1MKMA 4A0YA 3GZ5A 2VBYA 3SQNA 3DPLC 1XSXA 2W84A 2JT1A 2E7WA 2UXNA 2F5FA 2ZNYA 4FHTA 3ROUA 4AIKA 4GYGA 3GXOA 3GLXA 3R0AA 3DFGA 3L9FA 1FYKA 2ZNZA 4EM1A 2BBYA 2GA1A 1RI7A 4L5IA 4U7BA 3U1DA 5F1RA 1O7LA 1EH6A 3O3KA 4HX4A 4MTEA 1Z6TA 3FF5A 5TJJA 2A69F 3DQVC 5D8LB 4O6JA 4EM2A 2PMHA 4OU0A 1XCBA 4O3MA 3IC7A 2L02A 3BDDA 4IJAA 5ICCA 4JQFA 3ISPA 5HLHA 2EFNA 1FT9A 1LB2A 3KP3A 3G73A 4O5VA 2R3SA 3HOTA 5HOOA 4ZYHA 2L4MA 4U0YA 2NNYA 1REPC 1FY7A 5HDKA 3KP6A 1G3SA 4LK0F 5ILVA 1XN7A 1MJAA 1XSDA 4UUVA 2XHKA 2OQGA 2XAGA 2HGCA 2P6SA 4A5NA 5JI6A 2OZ6A 5CVIA 1KYZA 2DT5A 1MJBA 1Z05A 1ZN2A 1T6SA 4YIIA 4YG2F 2OD5A 4A0ZA 2ESNA 2XASA 5L3FA 3SZPA 3WE3A 3ZMVA 1I1SA 2A61A 3V8LA 3WGGA 2VBWA 2M1BA 3DF8A 1W7PA 3HSEA 4KIGA 5CVVA 3LQQA 1O3QA 5ILSA 2BYVE 1E17A 2M8EA 4EJTA 3I4PA 3R61A 3JTGA 3TO6A 2DQLA 2CYYA 1TW2A 1LEBA 2KJCA 2J5OA 4KFCA 2IA0A 3TKYA 2BE5F 3WGIA 5EEHA 3RDIA 5HS7A 2YR2A 1YTYA 1Z91A 3R0JA 1W7PB 2IW5A 1SFUA 3WE2A 1OR7A 1YG2A 4KA4A 4NQWA 5HLGA 2V1DA 1YS6A 1S6LA 4G6DA 3GZ6A 4HV6A 2X4HA 4RGXA 2FE3A 2FRHA 1AOYA 1YS7A 3IHUA 4LLNA 3SXYA 1IAWA 4RGSA 1ZG5A 2DK8A 3ZMUA 2GA2A 4E70A 3RYPA 4F7ZA 3F22A 3HYIA 1YQAA 2CWEA 4R8HA 1HKQA 1ON1A 2IPQX 2G7UA 1XSVA 3F6OA 5CVRA 4XBFA 2BV6A 3QP5A 1I5ZA 3G3ZA 2DK5A 2HQRA 2QBYA 3HTSB 2HYFA 4M9SA 1FYLA 4U0WA 2DBBA 2V1XA 3FXUA 4G9YA 3WTVC 3CJNA 1YLFA 1FLIA 1NHAA 3W6KB 2PI0A 4YFNF 1HSTA 1BC7C 1TQMA 4KT5C 4G7HF 2H09A 5E8IA 1ZGJA 4JBAA 2RGVA 1A04A 2ZCWA 1KA8A 2QBYB 3SHFA 4LMYA 5H20A 2FXAA 3KP5A 5KVRA 1TNTA 5DCFA 3AAFA 5CVJA 1BM9A 3HRTA 3K69A 4BNCA 2VT3A 1X3UA 1J7KA 5KK1A 3FM3A 4BHBA 1SD7A 4L9JA 3M8EA 4UVBA 2HDCA 1BI3A 1KU7A 3MQ0A 4CYDA 4P55A 3BPVA 1FOKA 2DQRA 3U2RA 3F8BA 2W24A 1KU2A 3F23A 3U9GA 3E3VA 1QZZA 2NNNA 3T1BA 3KETA 4HW0A 5DCMA 1ZG3A 4Y15A 5LEJA 5BOXA 3VFZA 4FT8A 1QZYA 2OAZA 1FP1D 2P8TA 5LGNA 4IRIA 4RAYA 3IWFA 2NRAC 3LAPA 3V8JA 2Q0OA 4M73A 5BS6A 3P7NA 3QPHA 3K1NA 3BP8A 5DCMB 1HQCA 4ZZLA 2ACJA 3CO7C 2FMLA 2XROA 1P92A 2JPCA 3S2WA 1FWZA 3F6VA 1WKMA 2RNJA 2A07F 1I27A 4M6YA 1U5TC 3GFMA 5H6QA 1HBXG 4WXDA 4NB5A 1CGPA 1B4AA 3IKVA 3WODF 2R7FA 1V4RA 3DEUA 2HR3A 3K0LA 2QUFA 4ESJA 2EFQA 3ZN1A 2QWWA 3T8TA 1XDSA 5JHUA 3I54A 3RKWA 5K5RA 3F8CA 1E2XA 2MH9A 4EMSA 2EK5A 3BPXA 4KICA 1XGMA 1R22A 3HHHA 1XGOA 4HDVA 1H0MA 3Q9SA 1Z9CA 5CJ9A 3GFLA 1QPMA 4Z2YA 4HV5A 3KP4A 1BJAA 1HKTA 3RIRA 1ON2A 1R58A 2OA4A 3RJPA 3IWZA 3FMSA 4OIQF 4BH9A 1O57A 2C6YA 2P4WA 3GX4X 4BAYA 2FBKA 2OQRA 2IJLA 1O3RA 2PLYA 4IF4A 1OMIA 5JR3A 4A2UA 3EYYA 4I09A 3TOBA 2HTJA 2E1NA 1L3LA 2O61A 5FD6A 3PFIA 2IVMA 3CO6C 2F5EA 1VTNC 1HW5A 1U8RA 4XLNF 2Z33A 1FNNA 1QQIA 2ADUA 3J81Z 5DD8A 3NRVA 3V7SA 2GQQA 4IRGA 3P9IA 3TOAA 3FXRA 4OOIA 2KJBA 1GVJA 4QLCU 4L0ZB 2KRFA
chains in the Genus database with same CATH superfamily
4ZDLA 1IXRC 1QO0D 5HS8A 2RNGA 1TC3C 2R7VA 1YO5C 4MFEA 2Z3YA 2VC0A 2V79A 5JHFA 4BHCA 1YX3A 2H6BA 4W97A 1TQPA 4GYIA 1V3FA 4QPQA 3A01A 3FXQA 3H5NA 3G2BA 5L3GA 4MQ9F 1YW7A 4OIOF 2LSOA 4HF1A 2GAUA 5TISC 3GCMA 3TW7A 3E6DA 3OYNA 1JE8A 4G7OF 3KFWX 3OYFA 2YUSA 1FEXA 3WGHA 3KEOA 3AFHA 3ZPLA 4UB6C 3Q0UA 3OYBA 1W36C 3FK7A 1KU3A 2JSCA 4CICA 4HSRA 3V8KA 3DP7A 5JLXA 5IT9Z 9ANTA 1B59A 2LREA 3HOXJ 2DMPA 2JRTA 2XGEA 2AS5F 1SD4A 1W5CC 3A01B 3SDGA 2OUMA 1MW7A 2IP2A 3EUHC 5FFXA 3LSTA 3SYTA 4DYCA 3S2DJ 3AL0B 1QVTA 1BW5A 2HYGD 5F6FA 4LLLA 5D5XB 2QQAA 1IN6A 2XB5A 2FBHA 2YSRA 5IT3A 1W4MA 4L9NA 4DW6A 2BY3A 2TDXA 1V54H 1FSEA 2KT0A 2V9PA 3LQRA 2X6YA 2GXGA 3BROA 4G12A 4GRIA 1WWXA 4ON0A 1S9HA 4XOPA 4A3IJ 2E2IJ 4KYWA 1YIOA 3NQOA 2L9RA 2Z9OA 3CMAI 2DFIA 2KIFA 3CDHA 3ESWB 1FP2A 3S32A 4KUMA 1MMNA 2Z5UA 2EQRA 5DUKA 1IN8A 4HQMA 5J8CA 2KFDA 3H5AA 4MNUA 2STTA 4HNUA 2EPFA 4RS8A 4B4CA 3D5RC 2HDDA 4M3DA 5LHHA 2DMNA 1T0FA 2LYCA 3AG3H 1PP8F 2NS0A 1HCRA 2QQ8A 1IRZA 3E7LA 1VI0A 2ZKZA 3QYEA 4KIBA 2JSPA 1ETVA 2VE8A 1K61A 2CG4A 2MLKA 4UUSA 5D6EA 3QODA 4CZZA 3WTZA 2OPTA 5HDNA 4HF0A 1SAUA 4L5JA 4XLPF 2GBYA 3K4JA 2DYRH 3HC7A 2DMQA 4F55A 3OS2A 1KGSA 2XPUA 3ZMDA 3QAHA 3DV8A 1DQUA 1R49A 4B43A 1XMAA 2O8XA 1F36A 3B73A 1GHCA 2E36A 3GVAA 5M3MJ 2HTSA 2Y0SA 2DCEA 1IZ1A 3JSOA 2R7ZJ 3S3OA 5EEAA 2R0QC 2CW7A 4UUSB 3L00A 3HSRA 3N4MA 3O2PE 1Y6IA 2M0MA 4OINF 1S5LC 3HGYA 2XSJC 3H92A 5KAIC 2D45A 3ERED 2YPRA 2RQPA 3HPGA 4YIFA 4LLGF 3VOEA 2LR8A 3COAC 1RZ4A 2CQXA 4ENMA 2AHQA 2KLOA 2O6GE 3RQ4A 3G1MA 4B1RA 1HXDA 4HNTA 5IOYA 1IXCA 5IYBJ 5M3FJ 2HQAA 2CJJA 2DFFA 4HX8A 4LIUA 3BG5A 3KX2A 4TV7A 5EEGA 3V42A 1N77A 3HTUA 4I2OA 2MA3A 5JLWA 5DD4A 1PP7U 1LDJA 3ZQCA 2OBPA 4AUXA 1SMYF 2EA4A 2KIQA 4BY1J 2GIVA 2FBIA 1WSUA 3Q0VA 2M5WA 4JX6A 2MSYA 3E5XA 1HW1A 1GXQA 2OJED 2IS1A 3LNQA 4BJTA 3BR6A 3FHNA 3KP7A 5E17F 2K4BA 2XF5A 4K2EA 2CFOA 4LG0A 4Y7NJ 2WC2A 3IH2A 2VBZA 2PN6A 1TW3A 1XGSA 1OLTA 3DLAA 2ZXIA 2E2JJ 1Q1HA 4WX9A 3WTXC 4HRIA 4PJMA 1U9NA 4IXAA 3S1QJ 4WCGA 2Z2SB 1TNSA 3EETA 3OL3A 2HOTA 4P9FA 1I50J 2HYJA 1KONA 2Z99A 1XGNA 2GOXB 2XSDC 1WRJA 2HQNA 2R7RA 3TDUC 1G4DA 3C1DA 4BE2A 2EZIA 2L7KA 1JJ6C 3JAMZ 3WTWC 1FBUA 2PMUA 3M4OJ 3FKJA 4OWRB 2HOAA 5ICFA 3OMYA 3L2CA 1GV2A 1U6GA 2Y69H 2L54A 2HZTA 2MD0A 3FK6A 3F21A 1HA8A 1R5GA 2RQQA 1C0WA 4IHSA 4IPAA 3H0DA 2HKXA 4RB3C 2VPLA 4YFXF 1TT5B 4ESFA 1BIAA 3RKYA 4Q47A 4Y17A 4LG0B 3E6CC 1J0RA 3DXJF 3CUOA 4B3AA 2W1OA 2ISYA 2R7UA 2K86A 5FJ8J 4R79A 3ELKA 3GMEA 1IN5A 4IVNA 2X85A 2XUBA 3FXJA 4I99C 3LWFA 1VQ7I 1JT0A 3VEPA 1BN5A 2MD5A 4UY8I 2XGCA 3DU5A 3CCRI 3BWGA 3EUAA 4OIPF 4WXCA 2LVSA 5E1ZB 4L9TA 2VBXA 1BI2A 4DOZA 4F52A 2RDPA 3PFYA 5HVQC 3S1RJ 2W00A 3K1MA 3I59A 1T38A 3PUFA 1AKHA 2PQ8A 1ACIA 1BI0A 3PL8A 1ZQ3P 4ZDOA 3LSGA 3GTOJ 1ULYA 1U5TA 2Q2EA 2K3PA 3VYTB 3BC8A 2VKEA 5CVUA 4D9JA 4EVIA 2ELHA 1X2NA 1LUJB 1I3AA 1YFHA 1D1CA 4RGUA 4Y3OA 1T33A 3WG9A 2XIGA 4MQVA 4KISA 1ZR2A 3Q5FA 1EH8A 4LOCA 2GLOA 4ZH4F 1YW9A 5F0FA 3HG9A 2ZJRF 1HKSA 1U78A 3H36A 5LGTA 4ZJZA 4CHUA 3GTPJ 1TLHB 2O03A 2ZB9A 2JVHA 3DTKA 4XR6A 4LITA 4BYYA 1QPIA 2E34A 1YOVB 1S29A 1XDUA 3I59B 1AKHB 2JA8J 4M3GA 2M87A 3WU0A 5FLXZ 1QA6A 3IH4A 3C18A 1U5TB 2Q2EB 1P7JA 2RN7A 3PIOF 3OYGA 4MTDA 1P4AA 2V9VA 3ZMZA 1XPXA 2MFZA 2A3SA 3FXLA 1J9IA 3F8FA 3HUGA 2E1CA 1ZRCA 2XVCA 2E60A 2ELKA 4ZYAA 3J81K 3V4GA 1DPRA 3S1NJ 2FF4A 1T39A 1D5VA 3ZOBA 1VZ0A 3VODA 4DIQA 4HYEA 1A36A 2MG4A 4XRSG 2XV4S 4DYQA 4BE0A 1P7IA 4XRSA 4A3EJ 4ZYGA 2VT2A 1ENHA 2EIMH 2VQCA 2MLGA 1JGGA 3J7YJ 1K7AA 3LAJA 2FNPA 2BOLA 5IP6A 4D7NA 1O4XA 2EZHA 2MC3A 3KLNA 1YW8A 1ZAOA 2ZXJA 1MMAA 1X1BA 3HUGB 3NAUA 1R5ID 4IHWA 1Y56A 1GVDA 2EA2A 3KZYA 5ILUA 4BUPA 1E3HA 2XB0X 1OKRA 4XSZF 3ECOA 2B63J 3PSFA 3E97A 5FRMA 1SMTA 4ASNA 2K27A 3VYRB 2R5YA 2WTEA 1IF1A 1X58A 1QBJA 4CGZA 3HOVJ 3S17J 2MBFA 5IT9K 2LKSA 1ERDA 4L5EA 3JSPA 2RKHA 1K6OA 4RB2C 1AA7A 2DDBA 3F3XA 3L2QA 3TQNA 5E3MA 5DYMA 2H94A 2VQHA 4FX4A 2XAHA 1X3WB 4P96A 4XRFA 1L0OC 1MMSA 5LLQA 2L3DA 4YIRX 5D5UB 5LRRA 1AWCA 2STWA 4E7ZA 1KYWA 5F04A 2WV0A 2L9VA 3HDDA 1ZGAA 3A4CA 2LD5A 2ZMEA 1SD6A 5GADJ 4RB1A 2ISZA 3H3ZA 2X6XA 3H3UA 5FROA 1XB4A 2K9SA 2LH9A 2R5YB 2JPBA 3TDZC 5L3BA 1KU9A 2CS3A 2VOPA 2X9DA 1MJ9A 2A68F 2ELJA 5BQTA 2R7SA 1D8JA 4L9VA 4XLAA 4F93B 2GXBA 2VPRA 4IHXA 3BR2A 3J7AY 2JN6A 1B1BA 2YU3A 5LHIA 2VONA 1S7OA 1FC3A 2DN0A 1SANA 4BDYA 4JYKA 4FISA 1XG1A 1LDKB 2P7VB 2ZXHA 3REOA 4A3KJ 1G6NA 2FU4A 2COBA 2K9QA 2A5YB 3IKTA 1R5HA 4XKCA 5B3SH 5M5YJ 2HEOA 4E7KA 1ZLJA 3UR3C 2ZMEB 5KNLA 2CV1A 1LKXA 4IZZA 3W6JB 2F4OB 2AXLA 1XCVA 2H1LA 3R4KA 2DA6A 5FKOA 2LKXA 4Y13A 3RTRA 2PJRB 1XMXA 1J59A 1XC5A 3P9KA 5J4YA 4L0YB 4I6ZA 1Y0NA 4MFDA 1JKOC 1A31A 1N25A 3F9KA 5E1WA 3OYCA 5FB2A 4NC7A 5LHGA 4IHTA 2HPMA 3BG7A 1MZBA 4KN7X 2LG4A 2E2HJ 4II3A 2E1MC 4DNCA 1WZ2A 1A5JA 2K9LA 5CKTA 2LNBA 1ZKGA 2FMYA 4KMUX 2R92J 4WK8F 1TBXA 2F2EA 3OOUA 4D7MA 3GYHX 3ZQIA 1E3OC 2ZJQF 2M0CA 5EJCA 2DA4A 5F0CA 3MZYA 5D5WB 3N97A 2OF7A 1LJ9A 3PQJA 3TP3A 4XRMA 1T2KA 1ZR4A 1TL8A 2P81A 3MCZA 1OFCX 1MMGA 5E3LA 4HX7A 4MHGA 4UHTA 3S3NA 1X19A 3WTYC 3MAJA 3RZOJ 3I64A 1S7AA 2DAOA 3CF2A 5E8GA 3C2BA 3NEUA 3L09A 4MLOA 4UVCA 1PDNC 3SZGA 1IXSB 4U88A 2AXTC 1YHQI 4PCQA 2MGQA 1HLVA 3H1CA 1FSHA 1X2MA 4A3LJ 1MNDA 4AVZA 2VLAA 3HRSA 2V6EA 1YJNI 2P6TA 1SFOJ 1D0YA 1IV8A 3GTLJ 5F1JA 1HDPA 2ZFWA 2MYSA 1BL0A 4ZYDA 3VWBA 4JK1X 3ASOH 2WB1N 4OIRF 1KQ8A 1LQ1A 2LY9A 1IW7F 1SVLA 4AYBN 5F08A 3O8HA 4MEYF 1HSJA 1N75A 4WWCA 2QENA 3QPLA 2V26A 3SFZA 1K79A 3D0SA 3FDYA 4II2A 4DYRA 3HXLA 3I56I 4C30A 3FM5A 4AIHA 3W3CA 4G6QA 5C4XJ 3E0JB 5J6XA 3OS1A 1H9TA 3K4CA 2DI3A 2W7NA 2MABA 5JVTA 2W25A 4OMZA 1IC8A 4CCOA 4D5CA 3JAMK 2G7HA 3MKWB 1WQ2A 3W2AA 2XGXA 4C2UA 5GPAA 2LLKA 5FO5A 5DV5A 1MBHA 1YITI 2DOEA 2QLZA 4CDGA 1ZK8A 5EG0A 1STZA 2HQ5A 3SDBA 1J2XA 4XM3A 2FA5A 1ORKA 1F5TA 3ZMSA 4F92B 1SC7A 1HW2A 3RKXA 2CW8A 1ZLKA 1R6RA 1P2FA 3GO5A 3I0TA 4M71A 2NVUB 1MBGA 3EDPA 2VN2A 4E6KG 1OYIA 2EBIA 1LNWA 3KYCB 5D6FA 1WJEA 5BPIA 3P9CA 2LDUA 2KDOA 2EWNA 4A3DJ 4A69C 3L1PA 4ZYEA 1WJAA 1B9MA 3RPUD 3GUDA 3ZQFA 3GBGA 4M9XA 3QU3A 1ZYRF 2DJNA 1U3EM 3I53A 1YRNA 2F4IA 1CF7A 3FBNB 5FRNA 5FKNA 3PJRA 1IN4A 4P5OA 1OCOH 1ZHFA 1EV7A 3M9AA 4FE7A 5EG0B 2EV6A 3FMQA 3G1OA 2IA2A 2LF7A 4LB5A 1K83J 3CDIA 1MSEC 5K5OA 1NK2P 1P4XA 3IRRA 4XLCA 3VDXA 4PZJA 3ZMTA 3WTSC 4NNJA 3SEZA 3BG6A 3CF5F 1R7JA 3CCUI 2IGNA 2HXOA 3LSMA 5CQEA 5A2QZ 4XKBA 2ZBKA 1R36A 3DPTA 3LSIA 2KIUA 3MFKA 2X51A 2BHYA 3K6GA 3KE2A 3R60A 1XD7A 3FXOA 2QVOA 4ITVA 3E6MA 2IXSA 3BOQA 4Y33A 2VJ5A 1R1TA 5GPCA 1WHUA 1YRNB 2D1VA 4P9UA 3KEQA 2ICWG 1G3TA 1CF7B 5FLXK 2O9LA 4KN4X 2P0WA 5IYCJ 2W85A 1SFKA 2B7EA 3CUQC 4A6EA 2JJ7A 5D4RA 1ETOA 3EYIA 3TO9A 4HOBA 2LOOA 4QWQA 1EKEA 2PMZN 4W1UA 3KP2A 2P5VA 4YEJA 4N0BA 2Y75A 4H0EA 4I98B 4XLEA 1FMWA 4DJAA 5DS9A 2F4MB 3HIFA 4B09A 1SD5A 5DUIA 4LGWA 2F5CA 4M9ZA 2L4AA 1JXSA 4J01A 5J8FA 5TRDA 3CCVI 1H88C 1DPUA 3OYKA 1P4WA 2XPVA 4BHPA 1WVRA 2ZJ2A 3CLOA 1UHWA 4IX7A 5HLTA 5FLMJ 2VE9A 1X1DA 4ETSA 3BZCA 2DOAA 2OCCH 2GOMA 2EV5A 2WBMA 1ZARA 2VJIA 4X6AJ 2JA7J 3SFIA 3OSFA 2DA5A 3ZQHA 2O8KA 3GWZA 4XNFA 1XTAA 5HDGA 4KNYA 2XAJA 3GW2A 4CO8A 3CZ6A 3DBLB 5D4SA 1JUMA 1F1ZA 5ERIA 2H27A 2IA1A 2M45A 2K85A 2BZTA 1A35A 2FSWA 2DMUA 3I3LA 3JRDA 5E18F 4EGZA 1PUEE 3MWMA 4Z6YA 2P5KA 1OCCH 4GCVA 3HB9A 3RQIA 5ED4A 4L18B 4PSXA 2W57A 2HXIA 2J5PA 3OV8A 3JREA 2COMA 2R7TA 4PFPA 5BPDA 1T98A 3HOYJ 3HRUA 3K9TA 5C4JJ 1OJLA 2BEOA 1LFUP 3LSJA 1CQTA 3S3MA 1D1BA 2X0LA 1YIJI 1IUYA 1IRFA 3JRHA 1ZELA 2FEZA 1ZRFA 2KDZA 3IL2A 1UFMA 2M30A 1UCRA 3ECHA 2A5WA 4KITB 1LVKA 3MKYB 1Y39A 2L9NA 2Z16A 3K70D 4S0HB 4AWXB 3BG9A 4M6XA 3CTAA 2D2WA 4HLYA 5B1AH 2HVQA 3ZXSA 3D1NI 2M7BA 2DA7A 3SZTA 3ABKH 2KZVA 2QSFX 3DWLE 5LBQA 3JW4A 3HBLA 4A0XA 2H8WA 3ML6A 1DU0A 2XAUA 1SFXA 4XICA 4DGWB 2G9WA 3VB2A 1Z7UA 4EJVA 2EJRA 4QTRA 2LF8A 1V5EA 4ESBA 4CCNA 4BDZA 3T0YA 2HOSA 4A6DA 2VC1A 1JUSA 2NXNB 1MD0A 1RIOH 2VUMJ 2K7LA 2VJJA 5D5VB 4BXXJ 1BBYA 2AQEA 4MEXF 4JX5A 1Z6RA 1LDDA 2AO9A 3CCJI 2RAEA 1YYVA 3ABUA 3FXKA 2CGPA 2GZWA 4HLXA 1I6XA 2L7MP 1LFPA 1BW6A 3OR2C 4M3BA 2EFOA 4BGDA 3H3VK 2IGKA 1Z77A 3GTKJ 3IH3A 4XQFA 1JHFA 2R4GA 3QPSA 2OV7A 2V6CA 2HOEA 1TQIA 1O7FA 1QGPA 3SEQA 2DLLA 1D3YA 2DMTA 1Z1DA 3BR5A 2Y2ZA 2JTVA 1P6RA 1NG6A 3LFKA 1JJ8C 4N9HA 1R4MB 2A6EF 3CP2A 3BZ6A 3ONQA 4GGGA 4XONA 4CSWA 3RI4A 2E19A 2CW0F 4RBOA 3MVPA 3K4LA 1I3QJ 1KQ9A 2ECCA 5EF6A 3F8NA 2JQ7A 1R00A 1N78A 1J75A 2OZUA 1FZPB 3BTIA 2QKMB 1K6YA 2O0YA 4FX0A 3BJOA 2BY0A 4HZFA 3K70C 5L3EA 4CZCA 2IS6A 3MKZA 3MMYB 2RREA 3JRIA 1TWFJ 2DA3A 1OISA 1TP4A 2CQNA 2A6HF 2ZSHB 5JFRA 1AU7A 3PO3J 5M5WJ 4ANJA 1B72A 2WWYA 2TCTA 1T95A 2HWVA 2O3FA 3BCBA 3PQKA 1RNLA 2WB1A 4YFKF 1WH5A 1YJWI 1UG2A 4QIWN 4AYBA 3WTUC 3FX3A 2V1NA 1VQMI 2D5VA 1FOXA 1B6AA 4RB0A 1WJCA 5IOZA 5J1RA 2F6CA 2OU2A 1S8NA 4RLFA 1S3JA 1FX7A 3GLLA 3OSGA 2EH3A 5CYVA 3KZZA 2VKHA 4BQOA 1XS9A 4Q4ZF 4PDKA 2L01A 2QZ8A 2V9KA 4ZZDA 5E1XA 5K5QA 1FIPA 3EUKL 2JZYA 1FBQA 1TWHJ 2WAEA 2EILH 2H8RA 5BMZA 3I5UA 4HF2A 1W5SA 3DBRB 4N4OB 1B72B 1LEAA 3IRQA 2KPMA 2NVQJ 2ESHA 3ULQB 3NARA 3JR9A 2UXXA 2E1MB 4WXHA 3J80Z 1SFEA 2IRFG 4QSHA 1VQKI 1VQLI 5LRSA 2TRTA 4YELA 2HVSA 3C7JA 4YRVA 3JRFA 4DZPA 2NS7A 2B0LA 4F91B 5DEQA 1U9OA 1DDNA 1ODDA 2WY8Q 2BVMA 2H6CA 4I0BA 4PUSA 1RUOA 3K4BA 5FKMA 4AIDA 3BR0A 4S04A 2LTPA 2IEKA 1DGWY 3X2QH 2E7XA 3FBIB 3ZQ7A 2V4JC 3FWEA 3PSIA 3PO2J 4CUGA 3K7AJ 2LKPA 2JUCA 2PFBA 5H2FC 2QSGX 5LFAA 1MNEA 2DYSH 4OAZA 1FYMA 4AIJA 1G3YA 3PIPF 2A05A 4OAYA 3D5LA 4N9IA 3HOSA 3FHZA 3E1SA 2UUZA 2CSOA 2K4JA 2BVLA 2E5ZA 2HU9A 2DPUA 1FPQA 1Y0UA 1TWGJ 2CMPA 1TT0A 1UG0A 2M34A 2VOOA 4LJZF 3E5QA 4KDPA 2PJPA 3JCUC 5DM6F 2EFWA 5HS9A 2Q1ZB 2UWMA 2WAQN 4JX4A 4EGYA 4Q5SF 2M4GA 5H6RA 2A6TA 2XRNA 2PX9A 2HZDA 4XLHA 3AG1H 1D8KA 2CH0A 3BJAA 2Y0MA 4UUTA 3TGNA 4IHVA 1MNMC 3M8JA 4EV0A 2E71A 5A2QK 2GWRA 1YJ9I 3V7CA 4CCJA 2EV0A 3BT9A 1VNDA 3G6EI 2W48A 2VKDA 3DKXA 3QOPA 4G6TB 2OC6A 1LVAA 3QU6A 1RRJA 2QM3A 3GEZA 3FXMA 2PMZA 3ZP5A 2K02A 2RVCA 2CUZA 4EM0B 4HDUA 1W7PD 1EH7A 3ABTA 3M8FA 4Q48A 3OWTA 4PJ0C 1F9NA 2KMUA 4XMYA 4E7SA 3K4NA 4HAMA 1S7EA 4HBLA 2CUJA 3TEDA 4XN3A 2QQ9A 3S1MJ 3DLLF 2JK3A 3I71A 3T5XA 2DA2A 2DO7A 3HOWJ 1R1UA 3HHGA 5L3DA 2ETHA 3MZ8A 1F4KA 3C2HA 4BS9A 1K4TA 4DQ2A 1DUXC 2L7ZA 3HGGA 4EJUA 1DP3A 3CLQA 3M1CA 4A5MA 5J47A 3SJMA 3W2WA 4GDFA 2X1DA 2CQ7A 5J4VA 2XGDA 3OL4A 5L3CA 5FFZA 3Q9VA 3LA7A 3K1PA 1U2WA 1W1WE 2FOKA 3ABLH 2P5LC 4DZJA 2DODA 4ENNA 4IRHA 2PJRA 4FE4A 5C3EJ 2DPDA 4NC8A 1MBJA 3BZKA 4ZTFA 1UZCA 3WHBA 4A3GJ 2JUGA 5LGUA 2QF7A 5F0HA 3PNTA 4C3JJ 5K7HA 2VXZA 2FNAA 3NWTA 3CUQA 4UXNA 4I0AA 3JRCA 4UV9A 3BTLA 4CH7A 1JGSA 1Z21A 3CJTB 3G1LA 2XPWA 4XORA 2DXIA 2CQKA 4FQGA 1T8IA 3GTJJ 4IQJA 5D8KB 1H8AC 3EUHA 2D1HA 1SAXA 1FTZA 4EEFG 2FQ3A 4G8XA 1USSA 2QYOA 4U0VA 2XAQA 2Y48A 2XKOA 1WFXA 3HPHA 3WG7H 3QRFF 4IKFA 2K9NA 4ENJA 5EZHA 2VJ4A 3C3WA 5K1YA 4X0GA 4XKVA 4UV8A 1EJ9A 4BQAA 2RV8A 2BGCA 2M4KA 1FIAA 4M72A 4G94A 4LK1F 3CUQB 4R1HA 3G71I 3RPUA 3LA2A 3MN2A 4BJ6C 5E20A 3LL7A 4FETA 5CLSA 2EZLA 3IAM2 2FJ1A 4AD9A 1BI1A 2KZGA 2VKVA 1V5GA 4OMYA 1UJ8A 4XIDA 2KL4A 4BXUA 3M1EA 1V5FA 2L7FP 2L9SA 4RA2A 5K7FA 2NVXJ 2KIMA 3QYBA 1OYYA 3KZIC 5EGOA 4M74A 2QGUA 3NWSA 4I76A 1MGTA 2KRCA 1JKRC 4C9YA 4RAFA 5AIQA 3FZVA 3J7AO 2L0KA 3I4NJ 1V55H 3DEWA 4DBQA 3BG3A 3M7GA 4A3MJ 2IS4A 1WI9A 1K78A 2ZO4A 1HC8A 5J3LA 5B5EC 1GV5A 2O5RA 1PYVA 2F5DA 4BQNA 5ICEA 2UZKA 1O3TA 2PG4A 5FD5A 2HFHA 5KCMA 4LD5A 1OPCA 2EFPA 4KJZA 3LSRA 3MZHA 1ZG1A 3K2ZA 3LA3A 4A3FJ 4UVAA 1OR7C 1JTYA 1RPWA 2XC7A 2KISA 5FKLA 4UB8C 4GO1A 3BCAA 2HS5A 4HA8A 1Z7LA 2BXYA 2F5VA 3PM1A 2H1KA 3OOPA 4AVPA 2M9HA 2DW4A 5FGMA 4BBRJ 1XMKA 1J09A 5EGOB 2DFHA 3EQLF 4LB6B 2W82A 3HEFA 4UNOA 1WJBA 3DPUA 3OIQA 4HG2A 3BJ6A 3W6VA 4A3BJ 2CFXA 3I58A 2UV1A 2LRDA 2XAFA 3KLOA 1W5TA 1HDDC 3RKQA 1IDZA 1E0EA 1K78B 5HLIA 3WU1B 2LC2A 2KKOA 2CO5A 2EB7A 1I1GA 5E3OA 2YX7A 1X4PA 4ABZA 4MGRA 3T8RA 3OIOA 4E4HA 3LOCA 2IS2A 2P7CB 1ETQA 5LEKA 1U8BA 4D0PA 1H89C 1D5YA 2DT6A 2QQBA 3QYFA 1WI3A 3ZR8X 3ZN0A 1X1AA 1GT0C 1W0TA 5AONA 1FOWA 2R7DA 3M07A 5EYRA 4XSXF 2ME0A 3HKZN 4I02A 6PAXA 1OYWA 3L2RA 4EJWA 1Y1WJ 2NVTJ 4FCYA 2YX4A 5LD2C 2W4SA 3OYEA 3TO7A 3F72A 3ZQLA 4HPQA 1RUNA 2OTLI 5IPAA 1MBFA 4CXFA 1J5YA 4HQEA 4RGRA 4A3JJ 1ZH5A 2XKPA 3OYDA 5EDNA 3BY6A 2RC4A 2DT7B 3R6SA 1UB9A 2M8GX 3L7WA 4I7HA 4A12A 3DU6A 1UHMA 3GFJA 1TWCJ 2DU9A 3HSFA 3BQYA 1JI8A 4NHJA 4EQQA 1MH3A 4RAZA 2XF6A 3DEEA 4RLQA 1H9GA 3OIPA 2NAZA 2PEXA 4GXOA 4LFUA 3HOZJ 1MSFC 3S16J 2PBIA 4JOMA 2LP0A 3JRAA 4PGHA 1IUFA 4CA0A 4EATA 4IL6C 5F64A 2GM4A 4IEJA 2XF7A 4B8XA 3KCCA 2WADA 1WJDA 1MDMA 1DP7P 3OR1C 1PUFA 4D5FA 3CD6I 2MH2A 1KQ0A 4MO7A 2GIZA 1ZREA 5KAFC 3J80K 3QPTA 5FLVA 3ZCOA 4PFOA 4BE1A 1G3WA 2O7OA 4G7ZF 4WF2A 1JT6A 3E5UA 2X1CA 1ETXA 5ICGA 2B9SA 4LG3A 1X1PA 3O6BB 4I01A 4KIFA 1BOAA 1IV6A 4KMFA 2IBDA 3V7RA 2HKOA 4B3XA 1T56A 3H35A 3ASNH 4PJNA 3K4KA 4C2MJ 3RPQA 2R7QA 2X6WA 2IT0A 4V2GA 1JHHA 1BC8C 3TBIA 3S15J 1IRGA 1G8XA 4BXFA 3JTHA 3U1KA 3HM5A 1MDMB 2HI3A 2IAIA 1PUFB 3F8MA 4BBSJ 1MH4A 4CCMA 3CCEI 1QNTA 4E7LA 1VQ6I 4C2TA 4B48A 1ZRDA 3CMMA 4PJJA 1YX5A 3CCYA 1O3SA 3GF2A 1YI2I 2CUFA 1WCMJ 4NDLA 2ZMEC 3HRMA 4EJOA 3J7ZI 3H9JA 4H4KC 2VODA 3WTTC 1X4OA 3GFIA 3QP6A 2WAQA 1ONVA 5AIPA 2VASA 3B6AA 3RCOA 1IN7A 1USTA 3H9QA 1TTYA 1FBSA 3B02A 2K5CA 3FMRA 3MEXA 4S05A 4RAGA 1B9NA 1R1VA 4FTHA 4A3CJ 4U7DA 1VQ9I 2XDVA 1BOBA 5DDGA 3I9V2 3UKGA 1GXPA 3DTEA 1BIBA 4AC0A 2ZC2A 5DTDA 2NYXA 1HF0A 4ENKA 3QOEA 2DTRA 3E6BA 3A02A 3LSKA 2AQFA 1WH7A 2V1UA 3OYHA 3RYRA 1GDTA 3DKWA 2Q8KA 4D1QA 2K3FA 4PGGA 1R23A 1MKMA 4A0YA 3GZ5A 2VBYA 3SQNA 1M1EB 3DPLC 1XSXA 2W84A 4AM3A 3CCMI 2JT1A 3VYSB 2E7WA 1JKPC 2HVRA 5DM7F 1I6HJ 1FTTA 2UXNA 2F5FA 2ZNYA 3CDLA 4V2FA 3I4MJ 3TP0A 4FHTA 3ROUA 4AIKA 1VQOI 1ETKA 2BHZA 4GYGA 3DTIA 3GXOA 3GLXA 3R0AA 3DFGA 5FKKA 3L9FA 1FYKA 1IRXA 2ECBA 4AU7A 2QA4I 2ZNZA 3CC4I 1BA5A 4EM1A 5M5XJ 2BBYA 4IOAF 2GA1A 1RI7A 4L5IA 1K4SA 4F3QA 2E35A 4MIMA 4U7BA 3Q0WA 3U1DA 5F1RA 3KEYA 5J1UA 1O7LA 5GAEJ 3RZDJ 3QQAA 1EH6A 4NC6A 3O3KA 1VQPI 3S2HJ 4HX4A 3GTMJ 4MTEA 1Z6TA 1FMVA 3FF5A 3KPHA 5TJJA 2A69F 3DQVC 5D8LB 4O6JA 4EM2A 4E7HA 3OYMA 2ZXWH 1Z3XA 1QVUA 4XOTA 2PMHA 4OU0A 1XCBA 4RDUA 3IC7A 2Y9ZA 4O3MA 2L02A 3BDDA 4IJAA 5ICCA 4JQFA 3ISPA 5HLHA 1POGA 4PK4A 1VQ5I 2LMDA 2EFNA 1FT9A 1LB2A 3KIOA 1QHHD 3BR1A 3KP3A 3Q3SA 5GP9A 4O5VA 4PSWA 3G73A 1VF9A 2OCEA 2R3SA 2LY2A 3ERMA 3HOTA 5HOOA 4ZYHA 1ZTRA 2L4MA 4U0YA 2NNYA 3JRBA 1REPC 2L5QA 2CUEA 1U0JA 4DBRA 2M7AA 1FJLA 5CQGA 3CCQI 1FY7A 5HDKA 5KHDA 3KP6A 1GLNA 1PVEA 3WHCA 1E3PA 1G3SA 4LK0F 4HNVA 3BR3A 4B44A 2E5NA 4XN0A 5B1BH 5ILVA 3I55I 3A03A 1XN7A 3CCSI 1OCTC 1MJAA 3H5RA 3M3YJ 2QKLB 3DCFA 1XSDA 2LY1A 1ETYA 4UUVA 1IG7A 2XHKA 3PNYA 2OQGA 2XAGA 3MD2A 2HGCA 2P6SA 4A5NA 4ZTJA 5JI6A 2OZ6A 3TL4X 5CVIA 1D0ZA 4ZC3A 1KYZA 4LIVA 1APLC 2DT5A 3LSHA 4CCKA 2NVYJ 5IP9J 1MJBA 1Z05A 2X1EA 2XRLA 2CRGA 2KHMA 1ZN2A 1JTXA 1T6SA 2Y30A 4YIIA 1HOMA 3CP8A 4YG2F 2OD5A 4KT6A 4A0ZA 2ESNA 2XASA 2K9MA 5L3FA 3SZPA 1RR7A 3WE3A 4E7IA 3ZMVA 1I1SA 2A61A 3V8LA 3H0GJ 3WGGA 3BTCA 2VBWA 2BW3A 3IAS2 1Q1VA 2M1BA 4M6VA 3DF8A 5IY5H 1W7PA 2VL8A 3HSEA 2QSHX 1NK3P 4KIGA 2EINH 5CVVA 1RESA 3LQQA 4PJLA 1BR2A 1O3QA 5ILSA 1S72I 2VXDA 4Y52J 1G59A 2BYVE 1E17A 2M8EA 4J00A 1XX5A 4EJTA 3I4PA 2JA2A 3JRGA 3R61A 2Y9YA 3JTGA 5E79C 1JUPA 1SEUA 3TO6A 2DQLA 1OQYA 2CYYA 1RETA 1TW2A 1LEBA 4NUBA 3LSPA 4RMNA 1UELB 2KJCA 2J5OA 4KFCA 2IA0A 3TKYA 5TGTA 4ZDPA 2BE5F 3WGIA 1Y8QB 5EEHA 3RDIA 3AL0C 3F0CA 5HS7A 3ZQQA 2YR2A 2JWTA 2BW3B 1YTYA 1Z91A 2V7FA 3PUBA 3R0JA 1MBKA 1D1AA 2FQ4A 3L2VA 1W7PB 3HKZA 2IW5A 1SFUA 2EIJH 3RSNA 3WE2A 2OTJI 1OR7A 4XL9A 2DA1A 2VIXA 4C3IJ 1YG2A 4KA4A 1LPQA 4NQWA 1IDYA 1A6QA 5HLGA 2V1DA 1YS6A 1S6LA 3P5JA 1ITYA 4NBQA 4G6DA 3GZ6A 3UNGC 4BACA 4HV6A 1ETWA 2X4HA 1P9QC 3BLYA 4RGXA 2FE3A 2FRHA 2CQQA 1AOYA 1YS7A 3IHUA 2WV1A 4M3FA 4LLNA 3SXYA 3W2VA 1IAWA 2FX0A 1Z3YA 4RGSA 5IP7J 1ZG5A 2DK8A 3ZMUA 4BEHA 1DGRM 1UAAA 2GA2A 2M3AA 3N05A 4CYCA 4E70A 1ZGWA 2ZSIB 3RYPA 3HZJA 3CESA 3O8GA 4V19K 4U87A 1GUUA 2MW8A 4F7ZA 4BU2A 5J1YA 4BL0B 3A2KA 3F22A 4NQWB 2YU9J 2CV2A 5E3NA 3HYIA 1YQAA 2CWEA 4R8HA 3OS0A 1HKQA 1ON1A 1T0FC 5J40A 1MIJA 2I8DA 1LFBA 3C2GA 2IPQX 2G7UA 1XSVA 3CJRB 3F6OA 2KQRA 3ZRGA 3IV5A 3CQZJ 2ID3A 3MKLA 2HNHA 5IYDJ 2Z1DA 5CVRA 4XBFA 3ZGKA 2BV6A 2ZFUA 4BEHB 1NTCA 3KYLA 3QP5A 2CV0A 1SVMA 1I5ZA 3G3ZA 2DK5A 4CYCB 2HQRA 3A0HC 2QBYA 2JA6J 3HTSB 2HYFA 1IO2A 4M9SA 4U0WA 1FYLA 2DBBA 2R5ZA 3A0BC 2V1XA 3FXUA 2IGMA 1UMQA 4G9YA 2KRHA 2ME6A 3IUOA 1BJZA 3WTVC 5HODA 3CC2I 3CJNA 2Y31A 3K10A 5F27A 1YLFA 1F43A 1FLIA 1TZLA 3GTGJ 1NHAA 1TWAJ 5EZGA 4BY7J 1B8IA 1EA3A 3W6KB 2PI0A 4YFNF 1HSTA 1W0UA 1R4NB 1BC7C 4BKXA 1TQMA 4KT5C 4G7HF 2H09A 5E8IA 1ZGJA 4JBAA 2RGVA 1A04A 2I5UA 2ZCWA 1KA8A 2QBYB 3GZNB 3SHFA 4LMYA 2R5ZB 2X6OA 5H20A 1KZHA 2R93J 2FXAA 4JP0A 3KP5A 1SVOA 2LK2A 4J19A 3CMEI 5KVRA 1Y8RB 3BTJA 4N4NB 1TNTA 5DCFA 3AAFA 1WGXA 5CVJA 1BM9A 3HRTA 2WAFA 3FKIJ 1B8IB 1OCPA 2VB6A 2VT3A 3K69A 4BNCA 3OY9A 1X3UA 1J7KA 5KK1A 1EF4A 3H9GA 3FM3A 4BHBA 1SD7A 4L9JA 3WU2C 3CMYA 2F48A 3M8EA 4UVBA 2HDCA 1D0XA 2VQGA 3PNVA 1JKQC 1UHSA 1BI3A 1WJ5A 1KU7A 3MQ0A 4CYDA 3LFUA 4E7JA 4P55A 4B47A 2FUG2 3BPVA 2NS8A 1FOKA 2DQRA 3OYIA 2Y0SN 2ZJPF 3L2UA 2DTZA 3FIWA 3U2RA 3CC7I 3F8BA 2W24A 1KU2A 2BY2A 3F23A 3U9GA 4RM3A 2NOGA 3EPZA 3E3VA 1QZZA 2QEXI 2NNNA 3VSLA 5JVGF 5BNGA 3T1BA 3KETA 1IGNA 1G2HA 4HW0A 5DCMA 2HDWA 1ZG3A 4Y15A 3OYLA 2E1OA 5LEJA 5BOXA 1R9TJ 3VFZA 4FT8A 3AG2H 1QZYA 5CPRB 2JVGA 2OAZA 1FP1D 2P8TA 2R7WA 1VQNI 5LGNA 4IRIA 1QHGA 2VQLA 4RAYA 3IWFA 3OYJA 1VQ4I 2NRAC 1WPKA 3B6CA 3V8JA 3VSKA 3LAPA 3L2WA 2JRMA 2Q0OA 1LE8A 1Z0XA 2KP6A 2LBFA 2JA5J 1Y1VJ 4M73A 5BS6A 3P7NA 1BR1A 1R71A 3QPHA 5GTIC 3K1NA 3BP8A 3IP4B 3OYAA 5DCMB 5GAGJ 1HQCA 4ZZLA 2ACJA 3CO7C 2FMLA 2NOJB 2XROA 1P92A 2JPCA 1QRYA 1RC9A 5GAHJ 2K40A 3HJEA 3S2WA 1FWZA 3F6VA 5HNFA 1RKTA 1X1CA 1WKMA 2RNJA 1RR8C 2A07F 2DFEA 2EZKA 3U21A 1I27A 3K2AA 3CCLI 1LE8B 4M6YA 3S8PA 1U5TC 3GFMA 1BR4A 5H6QA 2LBFB 1VQ8I 1HBXG 4WXDA 2L2OA 3KYDB 1NG7A 4NB5A 3ABMH 1CGPA 1B4AA 3IKVA 4XK4A 2R7FA 3VPRA 3WODF 3GTQJ 1V4RA 3DEUA 2HR3A 3K0LA 2QUFA 1RKWA 4ESJA 1FOYA 2EFQA 3ZN1A 2IGOA 2QWWA 4QPOA 4BJ5C 4HEA2 2FD5A 3T8TA 1XDSA 4IO9F 5JHUA 3I54A 2BXZA 2G0EA 3RKWA 5K5RA 4HSTA 3S14J 3F8CA 1E2XA 3DKYA 2VI6A 2MH9A 2GXAA 4EMSA 3G4SI 2ID6A 2EK5A 3BPXA 1QU3A 2I10A 4KICA 1XGMA 1R22A 3HHHA 1XGOA 1Z67A 3VYUB 2YS9A 4BQQA 4HDVA 1VFCA 1AHDP 1OCRH 1H0MA 3Q9SA 3QWLA 2FOWA 4Y4RA 1Z9CA 5CJ9A 3GFLA 1QPMA 4Z2YA 1IJWC 4HV5A 3KP4A 5K7ZA 1BJAA 4CCLA 1HKTA 2WA0A 3AG4H 3RIRA 2R7XA 1ON2A 1DU6A 2CU7A 4IOCF 1R58A 2OA4A 4XLFA 3RJPA 3IWZA 3FMSA 4C3HJ 4FASD 4OIQF 4BH9A 1O57A 2C6YA 4RM2A 2DJIA 2P4WA 3GX4X 1W36D 2R7OA 2FBKA 4BAYA 3DBHB 2OQRA 3HL2A 3A1YA 2EIKH 4A93J 2IJLA 1O3RA 4P1WA 2DDAA 2PLYA 4IF4A 3K4MA 2MC4A 1OMIA 5JR3A 1T08B 4A2UA 3EYYA 5GTHC 4IHYA 5B66C 1MMDA 1A6IA 2M2EA 4I09A 2X48A 3TOBA 2HTJA 2E1NA 1L3LA 1NH3A 2O61A 3TMOA 5FD6A 5C44J 2JMWA 3PFIA 2IVMA 2LFBA 4IQ4A 2DOFA 3ZQGA 3CO6C 2F5EA 1VTNC 1HW5A 3LMMA 1PJRA 4XLNF 1U8RA 3HOUJ 4GFBA 1QZEA 2Z33A 1FNNA 1QQIA 2QCOA 1WJFA 2WY7Q 3BQZA 1X3ZB 5HNHA 1MBEA 4XKWA 2ADUA 3CJQB 3J81Z 4X1EA 5DD8A 2BY1A 3NRVA 3TW6A 3V7SA 2GQQA 1YE9A 2N8GA 4IRGA 1I39A 3P9IA 1OCZH 3FISA 3AKZA 3S93A 3D5SC 3TOAA 3FXRA 4OOIA 2KJBA 1GVJA 2HPIA 4QLCU 4L0ZB 2KRFA 4M3EA
chains in the Genus database with same CATH topology
1IXRC 1QO0D 5HS8A 1YO5C 2Z3YA 2VC0A 2V79A 4BHCA 2H6BA 1TQPA 4GYIA 1V3FA 3FXQA 5L3GA 4MQ9F 1YW7A 4OIOF 2LSOA 4HF1A 2GAUA 3E6DA 1JE8A 4G7OF 3KFWX 3WGHA 3KEOA 3ZPLA 1KU3A 2JSCA 4CICA 3V8KA 3DP7A 5IT9Z 1B59A 2JRTA 2AS5F 1SD4A 2IP2A 5FFXA 3LSTA 2HYGD 5F6FA 4LLLA 5D5XB 2QQAA 1IN6A 2YSRA 2FBHA 5IT3A 1W4MA 4L9NA 2TDXA 1FSEA 3LQRA 2GXGA 3BROA 1WWXA 4ON0A 4KYWA 1YIOA 3NQOA 2Z9OA 2DFIA 2KIFA 3CDHA 1FP2A 4KUMA 2Z5UA 5DUKA 1IN8A 4HQMA 5J8CA 4MNUA 2STTA 4RS8A 5LHHA 1T0FA 1PP8F 2NS0A 2ZKZA 4KIBA 2VE8A 2CG4A 2MLKA 5D6EA 4CZZA 3WTZA 5HDNA 4HF0A 4L5JA 4XLPF 1KGSA 3ZMDA 3QAHA 3DV8A 1XMAA 2O8XA 3B73A 1GHCA 3GVAA 2HTSA 1IZ1A 3JSOA 3L00A 3HSRA 3N4MA 3O2PE 4OINF 3H92A 2D45A 3ERED 2YPRA 2RQPA 4YIFA 4LLGF 3VOEA 3COAC 1RZ4A 4ENMA 2O6GE 1HXDA 1IXCA 4HX8A 4TV7A 5EEGA 3HTUA 4I2OA 2MA3A 5DD4A 1PP7U 1LDJA 2OBPA 1SMYF 2EA4A 2GIVA 2FBIA 1WSUA 2M5WA 3E5XA 1HW1A 1GXQA 3KP7A 5E17F 2K4BA 4K2EA 4LG0A 2WC2A 2VBZA 2PN6A 1TW3A 1XGSA 1Q1HA 4WX9A 3WTXC 4IXAA 4WCGA 1TNSA 3EETA 4P9FA 2Z99A 1XGNA 1WRJA 2HQNA 3TDUC 1G4DA 3C1DA 3JAMZ 3WTWC 1FBUA 2PMUA 5ICFA 3L2CA 1U6GA 2L54A 2HZTA 3F21A 1R5GA 1C0WA 4IHSA 4IPAA 2HKXA 4RB3C 4YFXF 4ESFA 1BIAA 3RKYA 4Q47A 4Y17A 4LG0B 3E6CC 1J0RA 3DXJF 3CUOA 2ISYA 2K86A 4R79A 3ELKA 4IVNA 1IN5A 2XUBA 3LWFA 3VEPA 1BN5A 2MD5A 3BWGA 4OIPF 4WXCA 5E1ZB 4L9TA 2VBXA 1BI2A 2RDPA 5HVQC 3K1MA 3I59A 1T38A 2PQ8A 1BI0A 1ULYA 1U5TA 2Q2EA 5CVUA 4EVIA 2ELHA 1YFHA 4RGUA 3WG9A 2XIGA 4MQVA 3Q5FA 1EH8A 4ZH4F 1YW9A 1HKSA 1U78A 5LGTA 4CHUA 1TLHB 2O03A 4BYYA 1S29A 1XDUA 3I59B 2M87A 3WU0A 5FLXZ 3C18A 1U5TB 2RN7A 4MTDA 1P4AA 2V9VA 3ZMZA 2A3SA 1J9IA 3F8FA 3HUGA 2E1CA 1ZRCA 2XVCA 3J81K 3V4GA 1DPRA 2FF4A 1T39A 1D5VA 3VODA 4HYEA 2XV4S 4ZYGA 2VT2A 2MLGA 1K7AA 3LAJA 2FNPA 2MC3A 3KLNA 1YW8A 1ZAOA 2ZXJA 2EA2A 3KZYA 5ILUA 1OKRA 4XSZF 3ECOA 3E97A 1SMTA 4ASNA 2K27A 2WTEA 1IF1A 1QBJA 4CGZA 5IT9K 2MBFA 3JSPA 2RKHA 1K6OA 4RB2C 3F3XA 3TQNA 5DYMA 2H94A 4FX4A 2XAHA 4P96A 4XRFA 1L0OC 5LLQA 2L3DA 5D5UB 5LRRA 1AWCA 2STWA 1KYWA 2WV0A 1ZGAA 2ZMEA 1SD6A 4RB1A 2ISZA 3H3ZA 3H3UA 1XB4A 2JPBA 3TDZC 5L3BA 1KU9A 2VOPA 1MJ9A 2A68F 5BQTA 1D8JA 4L9VA 2GXBA 2YU3A 1B1BA 5LHIA 2VONA 1S7OA 1FC3A 1LDKB 2P7VB 3REOA 1G6NA 2FU4A 2A5YB 3IKTA 1R5HA 2HEOA 1ZLJA 2ZMEB 3W6JB 2AXLA 1XCVA 3R4KA 4Y13A 3RTRA 1J59A 3P9KA 4L0YB 5E1WA 5FB2A 5LHGA 4IHTA 1MZBA 4KN7X 4DNCA 2LNBA 2FMYA 4KMUX 4WK8F 1TBXA 2F2EA 3GYHX 3MZYA 5D5WB 3N97A 1LJ9A 3PQJA 1T2KA 3MCZA 4HX7A 4MHGA 4UHTA 3WTYC 3MAJA 3I64A 1S7AA 2DAOA 5E8GA 3NEUA 3L09A 4UVCA 1PDNC 1IXSB 4U88A 4PCQA 1FSHA 3HRSA 2P6TA 2ZFWA 4ZYDA 4JK1X 1KQ8A 4OIRF 1LQ1A 1IW7F 4MEYF 1HSJA 4WWCA 2QENA 3SFZA 1K79A 3D0SA 3FM5A 4AIHA 4G6QA 5J6XA 1H9TA 2DI3A 5JVTA 2W25A 4OMZA 3JAMK 2G7HA 1WQ2A 2XGXA 5FO5A 5DV5A 2QLZA 4CDGA 1STZA 1J2XA 2FA5A 1F5TA 3ZMSA 1HW2A 3RKXA 1ZLKA 1P2FA 3GO5A 3I0TA 4M71A 3EDPA 2VN2A 1OYIA 1LNWA 5D6FA 5BPIA 3P9CA 2LDUA 2EWNA 4ZYEA 1B9MA 3GUDA 4M9XA 3QU3A 1ZYRF 1U3EM 3I53A 1CF7A 1IN4A 4P5OA 3M9AA 1ZHFA 1EV7A 2EV6A 3FMQA 2IA2A 2LF7A 4LB5A 5K5OA 1P4XA 3IRRA 4PZJA 3ZMTA 3WTSC 1R7JA 5A2QZ 2ZBKA 1R36A 3DPTA 2KIUA 3MFKA 3KE2A 3R60A 1XD7A 2QVOA 3E6MA 3BOQA 1R1TA 2D1VA 4P9UA 3KEQA 1G3TA 1CF7B 5FLXK 4KN4X 2W85A 3CUQC 4A6EA 5D4RA 3EYIA 3TO9A 4HOBA 4QWQA 3KP2A 2P5VA 4N0BA 2Y75A 4H0EA 4I98B 3HIFA 4B09A 5DUIA 1SD5A 4LGWA 2F5CA 4M9ZA 2L4AA 1JXSA 5J8FA 5TRDA 1DPUA 1P4WA 4BHPA 2ZJ2A 3CLOA 1UHWA 2VE9A 4ETSA 2EV5A 1ZARA 3GWZA 4KNYA 5HDGA 2XAJA 3GW2A 4CO8A 5D4SA 1F1ZA 5ERIA 2H27A 2IA1A 2M45A 2FSWA 5E18F 4EGZA 1PUEE 3MWMA 2P5KA 4GCVA 5ED4A 4L18B 2W57A 3OV8A 2J5PA 2COMA 5BPDA 1T98A 3HRUA 3K9TA 2BEOA 2X0LA 1IUYA 1IRFA 2FEZA 1ZRFA 3IL2A 1UFMA 2M30A 1UCRA 3ECHA 4AWXB 4M6XA 3CTAA 2D2WA 4HLYA 3SZTA 5LBQA 3JW4A 4A0XA 3ML6A 1SFXA 2G9WA 3VB2A 1Z7UA 4EJVA 2EJRA 2LF8A 4ESBA 3T0YA 4A6DA 2VC1A 1MD0A 1RIOH 2K7LA 5D5VB 1BBYA 4MEXF 1Z6RA 1LDDA 1YYVA 3ABUA 2CGPA 2GZWA 4HLXA 1I6XA 2EFOA 1JHFA 2V6CA 2HOEA 1TQIA 1O7FA 1QGPA 2DLLA 1D3YA 1Z1DA 2JTVA 1P6RA 3LFKA 4N9HA 2A6EF 3BZ6A 3RI4A 4GGGA 2CW0F 1KQ9A 3F8NA 1R00A 1J75A 2OZUA 1FZPB 2O0YA 4FX0A 3BJOA 4HZFA 5L3EA 2A6HF 5JFRA 2WWYA 2HWVA 2O3FA 3PQKA 1RNLA 4YFKF 3WTUC 3FX3A 1B6AA 4RB0A 2OU2A 1S8NA 1S3JA 1FX7A 5CYVA 3KZZA 4Q4ZF 4PDKA 2L01A 2QZ8A 4ZZDA 5E1XA 5K5QA 2JZYA 1FBQA 5BMZA 3I5UA 4HF2A 1W5SA 1LEAA 3IRQA 2ESHA 3ULQB 2UXXA 4WXHA 3J80Z 1SFEA 2IRFG 5LRSA 3C7JA 2B0LA 5DEQA 1DDNA 1ODDA 2H6CA 4I0BA 1RUOA 4S04A 2E7XA 3ZQ7A 3FWEA 2LKPA 2PFBA 1FYMA 4AIJA 1G3YA 3D5LA 3FHZA 3HOSA 4N9IA 2CSOA 2K4JA 2DPUA 1FPQA 1Y0UA 2VOOA 4LJZF 3E5QA 4KDPA 2PJPA 2EFWA 5HS9A 2UWMA 4EGYA 4Q5SF 5H6RA 2XRNA 1D8KA 3BJAA 2Y0MA 3TGNA 4EV0A 5A2QK 2GWRA 3V7CA 2EV0A 3QOPA 1LVAA 3QU6A 2QM3A 3GEZA 3ZP5A 2K02A 2RVCA 4EM0B 4HDUA 1W7PD 1EH7A 3ABTA 3M8FA 4Q48A 1F9NA 4HAMA 4HBLA 2QQ9A 3I71A 3T5XA 2DO7A 1R1UA 3HHGA 5L3DA 2ETHA 1F4KA 4DQ2A 1DUXC 4EJUA 4A5MA 5L3CA 5FFZA 3Q9VA 3LA7A 3K1PA 1U2WA 2FOKA 2P5LC 4ENNA 4IRHA 2DPDA 5LGUA 2VXZA 2FNAA 3CUQA 4UXNA 4I0AA 4UV9A 1JGSA 2CQKA 5D8KB 3EUHA 2D1HA 1SAXA 2FQ3A 4G8XA 1USSA 2QYOA 4U0VA 2XAQA 2Y48A 2XKOA 3QRFF 4ENJA 3C3WA 5K1YA 4UV8A 4BQAA 2RV8A 2BGCA 4M72A 4G94A 4LK1F 3CUQB 4R1HA 3RPUA 3LA2A 5E20A 5CLSA 4AD9A 1BI1A 4OMYA 4BXUA 3M1EA 2KIMA 1OYYA 4M74A 1MGTA 5AIQA 3FZVA 3J7AO 3M7GA 1WI9A 1K78A 2ZO4A 5ICEA 2F5DA 2UZKA 1O3TA 2PG4A 5FD5A 2HFHA 4LD5A 1OPCA 2EFPA 3MZHA 1ZG1A 3K2ZA 3LA3A 4UVAA 4GO1A 2HS5A 4HA8A 3OOPA 4AVPA 2DW4A 5FGMA 1XMKA 4LB6B 3EQLF 4UNOA 3BJ6A 2CFXA 3I58A 2XAFA 3KLOA 1W5TA 1K78B 5HLIA 3WU1B 2KKOA 2CO5A 2EB7A 1I1GA 2YX7A 4MGRA 3T8RA 2P7CB 5LEKA 4D0PA 2QQBA 3ZN0A 5AONA 2R7DA 4XSXF 4I02A 6PAXA 1OYWA 4EJWA 2YX4A 3TO7A 3F72A 1RUNA 4CXFA 1J5YA 4HQEA 4RGRA 1ZH5A 2XKPA 3BY6A 2RC4A 3R6SA 1UB9A 3L7WA 4A12A 4I7HA 3GFJA 1UHMA 2DU9A 3HSFA 4NHJA 4EQQA 4RAZA 1H9GA 2NAZA 2PEXA 4GXOA 4LFUA 2PBIA 4PGHA 5F64A 4B8XA 3KCCA 1MDMA 1DP7P 2MH2A 1KQ0A 1ZREA 3J80K 3QPTA 1G3WA 4G7ZF 4WF2A 3E5UA 5ICGA 3O6BB 4I01A 4KIFA 1BOAA 4KMFA 3V7RA 2HKOA 3RPQA 2IT0A 1JHHA 1BC8C 1IRGA 3JTHA 1MDMB 3F8MA 1QNTA 1ZRDA 1O3SA 3GF2A 3HRMA 4EJOA 2VODA 3WTTC 3GFIA 3QP6A 1ONVA 5AIPA 1IN7A 1USTA 1TTYA 1FBSA 3B02A 3FMRA 3MEXA 4S05A 1B9NA 1R1VA 4U7DA 5DDGA 1GXPA 1BIBA 2NYXA 4ENKA 2DTRA 3E6BA 2V1UA 3RYRA 3DKWA 2Q8KA 4PGGA 1R23A 1MKMA 4A0YA 3GZ5A 2VBYA 3SQNA 3DPLC 1XSXA 2W84A 2JT1A 2E7WA 2UXNA 2F5FA 2ZNYA 4FHTA 3ROUA 4AIKA 4GYGA 3GXOA 3GLXA 3R0AA 3DFGA 3L9FA 1FYKA 2ZNZA 4EM1A 2BBYA 2GA1A 1RI7A 4L5IA 4U7BA 3U1DA 5F1RA 1O7LA 1EH6A 3O3KA 4HX4A 4MTEA 1Z6TA 3FF5A 5TJJA 2A69F 3DQVC 5D8LB 4O6JA 4EM2A 2PMHA 4OU0A 1XCBA 4O3MA 3IC7A 2L02A 3BDDA 4IJAA 5ICCA 4JQFA 3ISPA 5HLHA 2EFNA 1FT9A 1LB2A 3KP3A 3G73A 4O5VA 2R3SA 3HOTA 5HOOA 4ZYHA 2L4MA 4U0YA 2NNYA 1REPC 1FY7A 5HDKA 3KP6A 1G3SA 4LK0F 5ILVA 1XN7A 1MJAA 1XSDA 4UUVA 2XHKA 2OQGA 2XAGA 2HGCA 2P6SA 4A5NA 5JI6A 2OZ6A 5CVIA 1KYZA 2DT5A 1MJBA 1Z05A 1ZN2A 1T6SA 4YIIA 4YG2F 2OD5A 4A0ZA 2ESNA 2XASA 5L3FA 3SZPA 3WE3A 3ZMVA 1I1SA 2A61A 3V8LA 3WGGA 2VBWA 2M1BA 3DF8A 1W7PA 3HSEA 4KIGA 5CVVA 3LQQA 1O3QA 5ILSA 2BYVE 1E17A 2M8EA 4EJTA 3I4PA 3R61A 3JTGA 3TO6A 2DQLA 2CYYA 1TW2A 1LEBA 2KJCA 2J5OA 4KFCA 2IA0A 3TKYA 2BE5F 3WGIA 5EEHA 3RDIA 5HS7A 2YR2A 1YTYA 1Z91A 3R0JA 1W7PB 2IW5A 1SFUA 3WE2A 1OR7A 1YG2A 4KA4A 4NQWA 5HLGA 2V1DA 1YS6A 1S6LA 4G6DA 3GZ6A 4HV6A 2X4HA 4RGXA 2FE3A 2FRHA 1AOYA 1YS7A 3IHUA 4LLNA 3SXYA 1IAWA 4RGSA 1ZG5A 2DK8A 3ZMUA 2GA2A 4E70A 3RYPA 4F7ZA 3F22A 3HYIA 1YQAA 2CWEA 4R8HA 1HKQA 1ON1A 2IPQX 2G7UA 1XSVA 3F6OA 5CVRA 4XBFA 2BV6A 3QP5A 1I5ZA 3G3ZA 2DK5A 2HQRA 2QBYA 3HTSB 2HYFA 4M9SA 1FYLA 4U0WA 2DBBA 2V1XA 3FXUA 4G9YA 3WTVC 3CJNA 1YLFA 1FLIA 1NHAA 3W6KB 2PI0A 4YFNF 1HSTA 1BC7C 1TQMA 4KT5C 4G7HF 2H09A 5E8IA 1ZGJA 4JBAA 2RGVA 1A04A 2ZCWA 1KA8A 2QBYB 3SHFA 4LMYA 5H20A 2FXAA 3KP5A 5KVRA 1TNTA 5DCFA 3AAFA 5CVJA 1BM9A 3HRTA 3K69A 4BNCA 2VT3A 1X3UA 1J7KA 5KK1A 3FM3A 4BHBA 1SD7A 4L9JA 3M8EA 4UVBA 2HDCA 1BI3A 1KU7A 3MQ0A 4CYDA 4P55A 3BPVA 1FOKA 2DQRA 3U2RA 3F8BA 2W24A 1KU2A 3F23A 3U9GA 3E3VA 1QZZA 2NNNA 3T1BA 3KETA 4HW0A 5DCMA 1ZG3A 4Y15A 5LEJA 5BOXA 3VFZA 4FT8A 1QZYA 2OAZA 1FP1D 2P8TA 5LGNA 4IRIA 4RAYA 3IWFA 2NRAC 3LAPA 3V8JA 2Q0OA 4M73A 5BS6A 3P7NA 3QPHA 3K1NA 3BP8A 5DCMB 1HQCA 4ZZLA 2ACJA 3CO7C 2FMLA 2XROA 1P92A 2JPCA 3S2WA 1FWZA 3F6VA 1WKMA 2RNJA 2A07F 1I27A 4M6YA 1U5TC 3GFMA 5H6QA 1HBXG 4WXDA 4NB5A 1CGPA 1B4AA 3IKVA 3WODF 2R7FA 1V4RA 3DEUA 2HR3A 3K0LA 2QUFA 4ESJA 2EFQA 3ZN1A 2QWWA 3T8TA 1XDSA 5JHUA 3I54A 3RKWA 5K5RA 3F8CA 1E2XA 2MH9A 4EMSA 2EK5A 3BPXA 4KICA 1XGMA 1R22A 3HHHA 1XGOA 4HDVA 1H0MA 3Q9SA 1Z9CA 5CJ9A 3GFLA 1QPMA 4Z2YA 4HV5A 3KP4A 1BJAA 1HKTA 3RIRA 1ON2A 1R58A 2OA4A 3RJPA 3IWZA 3FMSA 4OIQF 4BH9A 1O57A 2C6YA 2P4WA 3GX4X 4BAYA 2FBKA 2OQRA 2IJLA 1O3RA 2PLYA 4IF4A 1OMIA 5JR3A 4A2UA 3EYYA 4I09A 3TOBA 2HTJA 2E1NA 1L3LA 2O61A 5FD6A 3PFIA 2IVMA 3CO6C 2F5EA 1VTNC 1HW5A 1U8RA 4XLNF 2Z33A 1FNNA 1QQIA 2ADUA 3J81Z 5DD8A 3NRVA 3V7SA 2GQQA 4IRGA 3P9IA 3TOAA 3FXRA 4OOIA 2KJBA 1GVJA 4QLCU 4L0ZB 2KRFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IXR C;  1QO0 D;  5HS8 A;  1YO5 C;  2Z3Y A;  2VC0 A;  2V79 A;  4BHC A;  2H6B A;  1TQP A;  4GYI A;  1V3F A;  3FXQ A;  5L3G A;  4MQ9 F;  1YW7 A;  4OIO F;  2LSO A;  4HF1 A;  2GAU A;  3E6D A;  1JE8 A;  4G7O F;  3KFW X;  3WGH A;  3KEO A;  3ZPL A;  1KU3 A;  2JSC A;  4CIC A;  3V8K A;  3DP7 A;  5IT9 Z;  1B59 A;  2JRT A;  2AS5 F;  1SD4 A;  2IP2 A;  5FFX A;  3LST A;  2HYG D;  5F6F A;  4LLL A;  5D5X B;  2QQA A;  1IN6 A;  2YSR A;  2FBH A;  5IT3 A;  1W4M A;  4L9N A;  2TDX A;  1FSE A;  3LQR A;  2GXG A;  3BRO A;  1WWX A;  4ON0 A;  4KYW A;  1YIO A;  3NQO A;  2Z9O A;  2DFI A;  2KIF A;  3CDH A;  1FP2 A;  4KUM A;  2Z5U A;  5DUK A;  1IN8 A;  4HQM A;  5J8C A;  4MNU A;  2STT A;  4RS8 A;  5LHH A;  1T0F A;  1PP8 F;  2NS0 A;  2ZKZ A;  4KIB A;  2VE8 A;  2CG4 A;  2MLK A;  5D6E A;  4CZZ A;  3WTZ A;  5HDN A;  4HF0 A;  4L5J A;  4XLP F;  1KGS A;  3ZMD A;  3QAH A;  3DV8 A;  1XMA A;  2O8X A;  3B73 A;  1GHC A;  3GVA A;  2HTS A;  1IZ1 A;  3JSO A;  3L00 A;  3HSR A;  3N4M A;  3O2P E;  4OIN F;  3H92 A;  2D45 A;  3ERE D;  2YPR A;  2RQP A;  4YIF A;  4LLG F;  3VOE A;  3COA C;  1RZ4 A;  4ENM A;  2O6G E;  1HXD A;  1IXC A;  4HX8 A;  4TV7 A;  5EEG A;  3HTU A;  4I2O A;  2MA3 A;  5DD4 A;  1PP7 U;  1LDJ A;  2OBP A;  1SMY F;  2EA4 A;  2GIV A;  2FBI A;  1WSU A;  2M5W A;  3E5X A;  1HW1 A;  1GXQ A;  3KP7 A;  5E17 F;  2K4B A;  4K2E A;  4LG0 A;  2WC2 A;  2VBZ A;  2PN6 A;  1TW3 A;  1XGS A;  1Q1H A;  4WX9 A;  3WTX C;  4IXA A;  4WCG A;  1TNS A;  3EET A;  4P9F A;  2Z99 A;  1XGN A;  1WRJ A;  2HQN A;  3TDU C;  1G4D A;  3C1D A;  3JAM Z;  3WTW C;  1FBU A;  2PMU A;  5ICF A;  3L2C A;  1U6G A;  2L54 A;  2HZT A;  3F21 A;  1R5G A;  1C0W A;  4IHS A;  4IPA A;  2HKX A;  4RB3 C;  4YFX F;  4ESF A;  1BIA A;  3RKY A;  4Q47 A;  4Y17 A;  4LG0 B;  3E6C C;  1J0R A;  3DXJ F;  3CUO A;  2ISY A;  2K86 A;  4R79 A;  3ELK A;  4IVN A;  1IN5 A;  2XUB A;  3LWF A;  3VEP A;  1BN5 A;  2MD5 A;  3BWG A;  4OIP F;  4WXC A;  5E1Z B;  4L9T A;  2VBX A;  1BI2 A;  2RDP A;  5HVQ C;  3K1M A;  3I59 A;  1T38 A;  2PQ8 A;  1BI0 A;  1ULY A;  1U5T A;  2Q2E A;  5CVU A;  4EVI A;  2ELH A;  1YFH A;  4RGU A;  3WG9 A;  2XIG A;  4MQV A;  3Q5F A;  1EH8 A;  4ZH4 F;  1YW9 A;  1HKS A;  1U78 A;  5LGT A;  4CHU A;  1TLH B;  2O03 A;  4BYY A;  1S29 A;  1XDU A;  3I59 B;  2M87 A;  3WU0 A;  5FLX Z;  3C18 A;  1U5T B;  2RN7 A;  4MTD A;  1P4A A;  2V9V A;  3ZMZ A;  2A3S A;  1J9I A;  3F8F A;  3HUG A;  2E1C A;  1ZRC A;  2XVC A;  3J81 K;  3V4G A;  1DPR A;  2FF4 A;  1T39 A;  1D5V A;  3VOD A;  4HYE A;  2XV4 S;  4ZYG A;  2VT2 A;  2MLG A;  1K7A A;  3LAJ A;  2FNP A;  2MC3 A;  3KLN A;  1YW8 A;  1ZAO A;  2ZXJ A;  2EA2 A;  3KZY A;  5ILU A;  1OKR A;  4XSZ F;  3ECO A;  3E97 A;  1SMT A;  4ASN A;  2K27 A;  2WTE A;  1IF1 A;  1QBJ A;  4CGZ A;  5IT9 K;  2MBF A;  3JSP A;  2RKH A;  1K6O A;  4RB2 C;  3F3X A;  3TQN A;  5DYM A;  2H94 A;  4FX4 A;  2XAH A;  4P96 A;  4XRF A;  1L0O C;  5LLQ A;  2L3D A;  5D5U B;  5LRR A;  1AWC A;  2STW A;  1KYW A;  2WV0 A;  1ZGA A;  2ZME A;  1SD6 A;  4RB1 A;  2ISZ A;  3H3Z A;  3H3U A;  1XB4 A;  2JPB A;  3TDZ C;  5L3B A;  1KU9 A;  2VOP A;  1MJ9 A;  2A68 F;  5BQT A;  1D8J A;  4L9V A;  2GXB A;  2YU3 A;  1B1B A;  5LHI A;  2VON A;  1S7O A;  1FC3 A;  1LDK B;  2P7V B;  3REO A;  1G6N A;  2FU4 A;  2A5Y B;  3IKT A;  1R5H A;  2HEO A;  1ZLJ A;  2ZME B;  3W6J B;  2AXL A;  1XCV A;  3R4K A;  4Y13 A;  3RTR A;  1J59 A;  3P9K A;  4L0Y B;  5E1W A;  5FB2 A;  5LHG A;  4IHT A;  1MZB A;  4KN7 X;  4DNC A;  2LNB A;  2FMY A;  4KMU X;  4WK8 F;  1TBX A;  2F2E A;  3GYH X;  3MZY A;  5D5W B;  3N97 A;  1LJ9 A;  3PQJ A;  1T2K A;  3MCZ A;  4HX7 A;  4MHG A;  4UHT A;  3WTY C;  3MAJ A;  3I64 A;  1S7A A;  2DAO A;  5E8G A;  3NEU A;  3L09 A;  4UVC A;  1PDN C;  1IXS B;  4U88 A;  4PCQ A;  1FSH A;  3HRS A;  2P6T A;  2ZFW A;  4ZYD A;  4JK1 X;  1KQ8 A;  4OIR F;  1LQ1 A;  1IW7 F;  4MEY F;  1HSJ A;  4WWC A;  2QEN A;  3SFZ A;  1K79 A;  3D0S A;  3FM5 A;  4AIH A;  4G6Q A;  5J6X A;  1H9T A;  2DI3 A;  5JVT A;  2W25 A;  4OMZ A;  3JAM K;  2G7H A;  1WQ2 A;  2XGX A;  5FO5 A;  5DV5 A;  2QLZ A;  4CDG A;  1STZ A;  1J2X A;  2FA5 A;  1F5T A;  3ZMS A;  1HW2 A;  3RKX A;  1ZLK A;  1P2F A;  3GO5 A;  3I0T A;  4M71 A;  3EDP A;  2VN2 A;  1OYI A;  1LNW A;  5D6F A;  5BPI A;  3P9C A;  2LDU A;  2EWN A;  4ZYE A;  1B9M A;  3GUD A;  4M9X A;  3QU3 A;  1ZYR F;  1U3E M;  3I53 A;  1CF7 A;  1IN4 A;  4P5O A;  3M9A A;  1ZHF A;  1EV7 A;  2EV6 A;  3FMQ A;  2IA2 A;  2LF7 A;  4LB5 A;  5K5O A;  1P4X A;  3IRR A;  4PZJ A;  3ZMT A;  3WTS C;  1R7J A;  5A2Q Z;  2ZBK A;  1R36 A;  3DPT A;  2KIU A;  3MFK A;  3KE2 A;  3R60 A;  1XD7 A;  2QVO A;  3E6M A;  3BOQ A;  1R1T A;  2D1V A;  4P9U A;  3KEQ A;  1G3T A;  1CF7 B;  5FLX K;  4KN4 X;  2W85 A;  3CUQ C;  4A6E A;  5D4R A;  3EYI A;  3TO9 A;  4HOB A;  4QWQ A;  3KP2 A;  2P5V A;  4N0B A;  2Y75 A;  4H0E A;  4I98 B;  3HIF A;  4B09 A;  5DUI A;  1SD5 A;  4LGW A;  2F5C A;  4M9Z A;  2L4A A;  1JXS A;  5J8F A;  5TRD A;  1DPU A;  1P4W A;  4BHP A;  2ZJ2 A;  3CLO A;  1UHW A;  2VE9 A;  4ETS A;  2EV5 A;  1ZAR A;  3GWZ A;  4KNY A;  5HDG A;  2XAJ A;  3GW2 A;  4CO8 A;  5D4S A;  1F1Z A;  5ERI A;  2H27 A;  2IA1 A;  2M45 A;  2FSW A;  5E18 F;  4EGZ A;  1PUE E;  3MWM A;  2P5K A;  4GCV A;  5ED4 A;  4L18 B;  2W57 A;  3OV8 A;  2J5P A;  2COM A;  5BPD A;  1T98 A;  3HRU A;  3K9T A;  2BEO A;  2X0L A;  1IUY A;  1IRF A;  2FEZ A;  1ZRF A;  3IL2 A;  1UFM A;  2M30 A;  1UCR A;  3ECH A;  4AWX B;  4M6X A;  3CTA A;  2D2W A;  4HLY A;  3SZT A;  5LBQ A;  3JW4 A;  4A0X A;  3ML6 A;  1SFX A;  2G9W A;  3VB2 A;  1Z7U A;  4EJV A;  2EJR A;  2LF8 A;  4ESB A;  3T0Y A;  4A6D A;  2VC1 A;  1MD0 A;  1RIO H;  2K7L A;  5D5V B;  1BBY A;  4MEX F;  1Z6R A;  1LDD A;  1YYV A;  3ABU A;  2CGP A;  2GZW A;  4HLX A;  1I6X A;  2EFO A;  1JHF A;  2V6C A;  2HOE A;  1TQI A;  1O7F A;  1QGP A;  2DLL A;  1D3Y A;  1Z1D A;  2JTV A;  1P6R A;  3LFK A;  4N9H A;  2A6E F;  3BZ6 A;  3RI4 A;  4GGG A;  2CW0 F;  1KQ9 A;  3F8N A;  1R00 A;  1J75 A;  2OZU A;  1FZP B;  2O0Y A;  4FX0 A;  3BJO A;  4HZF A;  5L3E A;  2A6H F;  5JFR A;  2WWY A;  2HWV A;  2O3F A;  3PQK A;  1RNL A;  4YFK F;  3WTU C;  3FX3 A;  1B6A A;  4RB0 A;  2OU2 A;  1S8N A;  1S3J A;  1FX7 A;  5CYV A;  3KZZ A;  4Q4Z F;  4PDK A;  2L01 A;  2QZ8 A;  4ZZD A;  5E1X A;  5K5Q A;  2JZY A;  1FBQ A;  5BMZ A;  3I5U A;  4HF2 A;  1W5S A;  1LEA A;  3IRQ A;  2ESH A;  3ULQ B;  2UXX A;  4WXH A;  3J80 Z;  1SFE A;  2IRF G;  5LRS A;  3C7J A;  2B0L A;  5DEQ A;  1DDN A;  1ODD A;  2H6C A;  4I0B A;  1RUO A;  4S04 A;  2E7X A;  3ZQ7 A;  3FWE A;  2LKP A;  2PFB A;  1FYM A;  4AIJ A;  1G3Y A;  3D5L A;  3FHZ A;  3HOS A;  4N9I A;  2CSO A;  2K4J A;  2DPU A;  1FPQ A;  1Y0U A;  2VOO A;  4LJZ F;  3E5Q A;  4KDP A;  2PJP A;  2EFW A;  5HS9 A;  2UWM A;  4EGY A;  4Q5S F;  5H6R A;  2XRN A;  1D8K A;  3BJA A;  2Y0M A;  3TGN A;  4EV0 A;  5A2Q K;  2GWR A;  3V7C A;  2EV0 A;  3QOP A;  1LVA A;  3QU6 A;  2QM3 A;  3GEZ A;  3ZP5 A;  2K02 A;  2RVC A;  4EM0 B;  4HDU A;  1W7P D;  1EH7 A;  3ABT A;  3M8F A;  4Q48 A;  1F9N A;  4HAM A;  4HBL A;  2QQ9 A;  3I71 A;  3T5X A;  2DO7 A;  1R1U A;  3HHG A;  5L3D A;  2ETH A;  1F4K A;  4DQ2 A;  1DUX C;  4EJU A;  4A5M A;  5L3C A;  5FFZ A;  3Q9V A;  3LA7 A;  3K1P A;  1U2W A;  2FOK A;  2P5L C;  4ENN A;  4IRH A;  2DPD A;  5LGU A;  2VXZ A;  2FNA A;  3CUQ A;  4UXN A;  4I0A A;  4UV9 A;  1JGS A;  2CQK A;  5D8K B;  3EUH A;  2D1H A;  1SAX A;  2FQ3 A;  4G8X A;  1USS A;  2QYO A;  4U0V A;  2XAQ A;  2Y48 A;  2XKO A;  3QRF F;  4ENJ A;  3C3W A;  5K1Y A;  4UV8 A;  4BQA A;  2RV8 A;  2BGC A;  4M72 A;  4G94 A;  4LK1 F;  3CUQ B;  4R1H A;  3RPU A;  3LA2 A;  5E20 A;  5CLS A;  4AD9 A;  1BI1 A;  4OMY A;  4BXU A;  3M1E A;  2KIM A;  1OYY A;  4M74 A;  1MGT A;  5AIQ A;  3FZV A;  3J7A O;  3M7G A;  1WI9 A;  1K78 A;  2ZO4 A;  5ICE A;  2F5D A;  2UZK A;  1O3T A;  2PG4 A;  5FD5 A;  2HFH A;  4LD5 A;  1OPC A;  2EFP A;  3MZH A;  1ZG1 A;  3K2Z A;  3LA3 A;  4UVA A;  4GO1 A;  2HS5 A;  4HA8 A;  3OOP A;  4AVP A;  2DW4 A;  5FGM A;  1XMK A;  4LB6 B;  3EQL F;  4UNO A;  3BJ6 A;  2CFX A;  3I58 A;  2XAF A;  3KLO A;  1W5T A;  1K78 B;  5HLI A;  3WU1 B;  2KKO A;  2CO5 A;  2EB7 A;  1I1G A;  2YX7 A;  4MGR A;  3T8R A;  2P7C B;  5LEK A;  4D0P A;  2QQB A;  3ZN0 A;  5AON A;  2R7D A;  4XSX F;  4I02 A;  6PAX A;  1OYW A;  4EJW A;  2YX4 A;  3TO7 A;  3F72 A;  1RUN A;  4CXF A;  1J5Y A;  4HQE A;  4RGR A;  1ZH5 A;  2XKP A;  3BY6 A;  2RC4 A;  3R6S A;  1UB9 A;  3L7W A;  4A12 A;  4I7H A;  3GFJ A;  1UHM A;  2DU9 A;  3HSF A;  4NHJ A;  4EQQ A;  4RAZ A;  1H9G A;  2NAZ A;  2PEX A;  4GXO A;  4LFU A;  2PBI A;  4PGH A;  5F64 A;  4B8X A;  3KCC A;  1MDM A;  1DP7 P;  2MH2 A;  1KQ0 A;  1ZRE A;  3J80 K;  3QPT A;  1G3W A;  4G7Z F;  4WF2 A;  3E5U A;  5ICG A;  3O6B B;  4I01 A;  4KIF A;  1BOA A;  4KMF A;  3V7R A;  2HKO A;  3RPQ A;  2IT0 A;  1JHH A;  1BC8 C;  1IRG A;  3JTH A;  1MDM B;  3F8M A;  1QNT A;  1ZRD A;  1O3S A;  3GF2 A;  3HRM A;  4EJO A;  2VOD A;  3WTT C;  3GFI A;  3QP6 A;  1ONV A;  5AIP A;  1IN7 A;  1UST A;  1TTY A;  1FBS A;  3B02 A;  3FMR A;  3MEX A;  4S05 A;  1B9N A;  1R1V A;  4U7D A;  5DDG A;  1GXP A;  1BIB A;  2NYX A;  4ENK A;  2DTR A;  3E6B A;  2V1U A;  3RYR A;  3DKW A;  2Q8K A;  4PGG A;  1R23 A;  1MKM A;  4A0Y A;  3GZ5 A;  2VBY A;  3SQN A;  3DPL C;  1XSX A;  2W84 A;  2JT1 A;  2E7W A;  2UXN A;  2F5F A;  2ZNY A;  4FHT A;  3ROU A;  4AIK A;  4GYG A;  3GXO A;  3GLX A;  3R0A A;  3DFG A;  3L9F A;  1FYK A;  2ZNZ A;  4EM1 A;  2BBY A;  2GA1 A;  1RI7 A;  4L5I A;  4U7B A;  3U1D A;  5F1R A;  1O7L A;  1EH6 A;  3O3K A;  4HX4 A;  4MTE A;  1Z6T A;  3FF5 A;  5TJJ A;  2A69 F;  3DQV C;  5D8L B;  4O6J A;  4EM2 A;  2PMH A;  4OU0 A;  1XCB A;  4O3M A;  3IC7 A;  2L02 A;  3BDD A;  4IJA A;  5ICC A;  4JQF A;  3ISP A;  5HLH A;  2EFN A;  1FT9 A;  1LB2 A;  3KP3 A;  3G73 A;  4O5V A;  2R3S A;  3HOT A;  5HOO A;  4ZYH A;  2L4M A;  4U0Y A;  2NNY A;  1REP C;  1FY7 A;  5HDK A;  3KP6 A;  1G3S A;  4LK0 F;  5ILV A;  1XN7 A;  1MJA A;  1XSD A;  4UUV A;  2XHK A;  2OQG A;  2XAG A;  2HGC A;  2P6S A;  4A5N A;  5JI6 A;  2OZ6 A;  5CVI A;  1KYZ A;  2DT5 A;  1MJB A;  1Z05 A;  1ZN2 A;  1T6S A;  4YII A;  4YG2 F;  2OD5 A;  4A0Z A;  2ESN A;  2XAS A;  5L3F A;  3SZP A;  3WE3 A;  3ZMV A;  1I1S A;  2A61 A;  3V8L A;  3WGG A;  2VBW A;  2M1B A;  3DF8 A;  1W7P A;  3HSE A;  4KIG A;  5CVV A;  3LQQ A;  1O3Q A;  5ILS A;  2BYV E;  1E17 A;  2M8E A;  4EJT A;  3I4P A;  3R61 A;  3JTG A;  3TO6 A;  2DQL A;  2CYY A;  1TW2 A;  1LEB A;  2KJC A;  2J5O A;  4KFC A;  2IA0 A;  3TKY A;  2BE5 F;  3WGI A;  5EEH A;  3RDI A;  5HS7 A;  2YR2 A;  1YTY A;  1Z91 A;  3R0J A;  1W7P B;  2IW5 A;  1SFU A;  3WE2 A;  1OR7 A;  1YG2 A;  4KA4 A;  4NQW A;  5HLG A;  2V1D A;  1YS6 A;  1S6L A;  4G6D A;  3GZ6 A;  4HV6 A;  2X4H A;  4RGX A;  2FE3 A;  2FRH A;  1AOY A;  1YS7 A;  3IHU A;  4LLN A;  3SXY A;  1IAW A;  4RGS A;  1ZG5 A;  2DK8 A;  3ZMU A;  2GA2 A;  4E70 A;  3RYP A;  4F7Z A;  3F22 A;  3HYI A;  1YQA A;  2CWE A;  4R8H A;  1HKQ A;  1ON1 A;  2IPQ X;  2G7U A;  1XSV A;  3F6O A;  5CVR A;  4XBF A;  2BV6 A;  3QP5 A;  1I5Z A;  3G3Z A;  2DK5 A;  2HQR A;  2QBY A;  3HTS B;  2HYF A;  4M9S A;  1FYL A;  4U0W A;  2DBB A;  2V1X A;  3FXU A;  4G9Y A;  3WTV C;  3CJN A;  1YLF A;  1FLI A;  1NHA A;  3W6K B;  2PI0 A;  4YFN F;  1HST A;  1BC7 C;  1TQM A;  4KT5 C;  4G7H F;  2H09 A;  5E8I A;  1ZGJ A;  4JBA A;  2RGV A;  1A04 A;  2ZCW A;  1KA8 A;  2QBY B;  3SHF A;  4LMY A;  5H20 A;  2FXA A;  3KP5 A;  5KVR A;  1TNT A;  5DCF A;  3AAF A;  5CVJ A;  1BM9 A;  3HRT A;  3K69 A;  4BNC A;  2VT3 A;  1X3U A;  1J7K A;  5KK1 A;  3FM3 A;  4BHB A;  1SD7 A;  4L9J A;  3M8E A;  4UVB A;  2HDC A;  1BI3 A;  1KU7 A;  3MQ0 A;  4CYD A;  4P55 A;  3BPV A;  1FOK A;  2DQR A;  3U2R A;  3F8B A;  2W24 A;  1KU2 A;  3F23 A;  3U9G A;  3E3V A;  1QZZ A;  2NNN A;  3T1B A;  3KET A;  4HW0 A;  5DCM A;  1ZG3 A;  4Y15 A;  5LEJ A;  5BOX A;  3VFZ A;  4FT8 A;  1QZY A;  2OAZ A;  1FP1 D;  2P8T A;  5LGN A;  4IRI A;  4RAY A;  3IWF A;  2NRA C;  3LAP A;  3V8J A;  2Q0O A;  4M73 A;  5BS6 A;  3P7N A;  3QPH A;  3K1N A;  3BP8 A;  5DCM B;  1HQC A;  4ZZL A;  2ACJ A;  3CO7 C;  2FML A;  2XRO A;  1P92 A;  2JPC A;  3S2W A;  1FWZ A;  3F6V A;  1WKM A;  2RNJ A;  2A07 F;  1I27 A;  4M6Y A;  1U5T C;  3GFM A;  5H6Q A;  1HBX G;  4WXD A;  4NB5 A;  1CGP A;  1B4A A;  3IKV A;  3WOD F;  2R7F A;  1V4R A;  3DEU A;  2HR3 A;  3K0L A;  2QUF A;  4ESJ A;  2EFQ A;  3ZN1 A;  2QWW A;  3T8T A;  1XDS A;  5JHU A;  3I54 A;  3RKW A;  5K5R A;  3F8C A;  1E2X A;  2MH9 A;  4EMS A;  2EK5 A;  3BPX A;  4KIC A;  1XGM A;  1R22 A;  3HHH A;  1XGO A;  4HDV A;  1H0M A;  3Q9S A;  1Z9C A;  5CJ9 A;  3GFL A;  1QPM A;  4Z2Y A;  4HV5 A;  3KP4 A;  1BJA A;  1HKT A;  3RIR A;  1ON2 A;  1R58 A;  2OA4 A;  3RJP A;  3IWZ A;  3FMS A;  4OIQ F;  4BH9 A;  1O57 A;  2C6Y A;  2P4W A;  3GX4 X;  4BAY A;  2FBK A;  2OQR A;  2IJL A;  1O3R A;  2PLY A;  4IF4 A;  1OMI A;  5JR3 A;  4A2U A;  3EYY A;  4I09 A;  3TOB A;  2HTJ A;  2E1N A;  1L3L A;  2O61 A;  5FD6 A;  3PFI A;  2IVM A;  3CO6 C;  2F5E A;  1VTN C;  1HW5 A;  1U8R A;  4XLN F;  2Z33 A;  1FNN A;  1QQI A;  2ADU A;  3J81 Z;  5DD8 A;  3NRV A;  3V7S A;  2GQQ A;  4IRG A;  3P9I A;  3TOA A;  3FXR A;  4OOI A;  2KJB A;  1GVJ A;  4QLC U;  4L0Z B;  2KRF A; 
#chains in the Genus database with same CATH topology
 4ZDL A;  1IXR C;  1QO0 D;  5HS8 A;  2RNG A;  1TC3 C;  2R7V A;  1YO5 C;  4MFE A;  2Z3Y A;  2VC0 A;  2V79 A;  5JHF A;  4BHC A;  1YX3 A;  2H6B A;  4W97 A;  1TQP A;  4GYI A;  1V3F A;  4QPQ A;  3A01 A;  3FXQ A;  3H5N A;  3G2B A;  5L3G A;  4MQ9 F;  1YW7 A;  4OIO F;  2LSO A;  4HF1 A;  2GAU A;  5TIS C;  3GCM A;  3TW7 A;  3E6D A;  3OYN A;  1JE8 A;  4G7O F;  3KFW X;  3OYF A;  2YUS A;  1FEX A;  3WGH A;  3KEO A;  3AFH A;  3ZPL A;  4UB6 C;  3Q0U A;  3OYB A;  1W36 C;  3FK7 A;  1KU3 A;  2JSC A;  4CIC A;  4HSR A;  3V8K A;  3DP7 A;  5JLX A;  5IT9 Z;  9ANT A;  1B59 A;  2LRE A;  3HOX J;  2DMP A;  2JRT A;  2XGE A;  2AS5 F;  1SD4 A;  1W5C C;  3A01 B;  3SDG A;  2OUM A;  1MW7 A;  2IP2 A;  3EUH C;  5FFX A;  3LST A;  3SYT A;  4DYC A;  3S2D J;  3AL0 B;  1QVT A;  1BW5 A;  2HYG D;  5F6F A;  4LLL A;  5D5X B;  2QQA A;  1IN6 A;  2XB5 A;  2FBH A;  2YSR A;  5IT3 A;  1W4M A;  4L9N A;  4DW6 A;  2BY3 A;  2TDX A;  1V54 H;  1FSE A;  2KT0 A;  2V9P A;  3LQR A;  2X6Y A;  2GXG A;  3BRO A;  4G12 A;  4GRI A;  1WWX A;  4ON0 A;  1S9H A;  4XOP A;  4A3I J;  2E2I J;  4KYW A;  1YIO A;  3NQO A;  2L9R A;  2Z9O A;  3CMA I;  2DFI A;  2KIF A;  3CDH A;  3ESW B;  1FP2 A;  3S32 A;  4KUM A;  1MMN A;  2Z5U A;  2EQR A;  5DUK A;  1IN8 A;  4HQM A;  5J8C A;  2KFD A;  3H5A A;  4MNU A;  2STT A;  4HNU A;  2EPF A;  4RS8 A;  4B4C A;  3D5R C;  2HDD A;  4M3D A;  5LHH A;  2DMN A;  1T0F A;  2LYC A;  3AG3 H;  1PP8 F;  2NS0 A;  1HCR A;  2QQ8 A;  1IRZ A;  3E7L A;  1VI0 A;  2ZKZ A;  3QYE A;  4KIB A;  2JSP A;  1ETV A;  2VE8 A;  1K61 A;  2CG4 A;  2MLK A;  4UUS A;  5D6E A;  3QOD A;  4CZZ A;  3WTZ A;  2OPT A;  5HDN A;  4HF0 A;  1SAU A;  4L5J A;  4XLP F;  2GBY A;  3K4J A;  2DYR H;  3HC7 A;  2DMQ A;  4F55 A;  3OS2 A;  1KGS A;  2XPU A;  3ZMD A;  3QAH A;  3DV8 A;  1DQU A;  1R49 A;  4B43 A;  1XMA A;  2O8X A;  1F36 A;  3B73 A;  1GHC A;  2E36 A;  3GVA A;  5M3M J;  2HTS A;  2Y0S A;  2DCE A;  1IZ1 A;  3JSO A;  2R7Z J;  3S3O A;  5EEA A;  2R0Q C;  2CW7 A;  4UUS B;  3L00 A;  3HSR A;  3N4M A;  3O2P E;  1Y6I A;  2M0M A;  4OIN F;  1S5L C;  3HGY A;  2XSJ C;  3H92 A;  5KAI C;  2D45 A;  3ERE D;  2YPR A;  2RQP A;  3HPG A;  4YIF A;  4LLG F;  3VOE A;  2LR8 A;  3COA C;  1RZ4 A;  2CQX A;  4ENM A;  2AHQ A;  2KLO A;  2O6G E;  3RQ4 A;  3G1M A;  4B1R A;  1HXD A;  4HNT A;  5IOY A;  1IXC A;  5IYB J;  5M3F J;  2HQA A;  2CJJ A;  2DFF A;  4HX8 A;  4LIU A;  3BG5 A;  3KX2 A;  4TV7 A;  5EEG A;  3V42 A;  1N77 A;  3HTU A;  4I2O A;  2MA3 A;  5JLW A;  5DD4 A;  1PP7 U;  1LDJ A;  3ZQC A;  2OBP A;  4AUX A;  1SMY F;  2EA4 A;  2KIQ A;  4BY1 J;  2GIV A;  2FBI A;  1WSU A;  3Q0V A;  2M5W A;  4JX6 A;  2MSY A;  3E5X A;  1HW1 A;  1GXQ A;  2OJE D;  2IS1 A;  3LNQ A;  4BJT A;  3BR6 A;  3FHN A;  3KP7 A;  5E17 F;  2K4B A;  2XF5 A;  4K2E A;  2CFO A;  4LG0 A;  4Y7N J;  2WC2 A;  3IH2 A;  2VBZ A;  2PN6 A;  1TW3 A;  1XGS A;  1OLT A;  3DLA A;  2ZXI A;  2E2J J;  1Q1H A;  4WX9 A;  3WTX C;  4HRI A;  4PJM A;  1U9N A;  4IXA A;  3S1Q J;  4WCG A;  2Z2S B;  1TNS A;  3EET A;  3OL3 A;  2HOT A;  4P9F A;  1I50 J;  2HYJ A;  1KON A;  2Z99 A;  1XGN A;  2GOX B;  2XSD C;  1WRJ A;  2HQN A;  2R7R A;  3TDU C;  1G4D A;  3C1D A;  4BE2 A;  2EZI A;  2L7K A;  1JJ6 C;  3JAM Z;  3WTW C;  1FBU A;  2PMU A;  3M4O J;  3FKJ A;  4OWR B;  2HOA A;  5ICF A;  3OMY A;  3L2C A;  1GV2 A;  1U6G A;  2Y69 H;  2L54 A;  2HZT A;  2MD0 A;  3FK6 A;  3F21 A;  1HA8 A;  1R5G A;  2RQQ A;  1C0W A;  4IHS A;  4IPA A;  3H0D A;  2HKX A;  4RB3 C;  2VPL A;  4YFX F;  1TT5 B;  4ESF A;  1BIA A;  3RKY A;  4Q47 A;  4Y17 A;  4LG0 B;  3E6C C;  1J0R A;  3DXJ F;  3CUO A;  4B3A A;  2W1O A;  2ISY A;  2R7U A;  2K86 A;  5FJ8 J;  4R79 A;  3ELK A;  3GME A;  1IN5 A;  4IVN A;  2X85 A;  2XUB A;  3FXJ A;  4I99 C;  3LWF A;  1VQ7 I;  1JT0 A;  3VEP A;  1BN5 A;  2MD5 A;  4UY8 I;  2XGC A;  3DU5 A;  3CCR I;  3BWG A;  3EUA A;  4OIP F;  4WXC A;  2LVS A;  5E1Z B;  4L9T A;  2VBX A;  1BI2 A;  4DOZ A;  4F52 A;  2RDP A;  3PFY A;  5HVQ C;  3S1R J;  2W00 A;  3K1M A;  3I59 A;  1T38 A;  3PUF A;  1AKH A;  2PQ8 A;  1ACI A;  1BI0 A;  3PL8 A;  1ZQ3 P;  4ZDO A;  3LSG A;  3GTO J;  1ULY A;  1U5T A;  2Q2E A;  2K3P A;  3VYT B;  3BC8 A;  2VKE A;  5CVU A;  4D9J A;  4EVI A;  2ELH A;  1X2N A;  1LUJ B;  1I3A A;  1YFH A;  1D1C A;  4RGU A;  4Y3O A;  1T33 A;  3WG9 A;  2XIG A;  4MQV A;  4KIS A;  1ZR2 A;  3Q5F A;  1EH8 A;  4LOC A;  2GLO A;  4ZH4 F;  1YW9 A;  5F0F A;  3HG9 A;  2ZJR F;  1HKS A;  1U78 A;  3H36 A;  5LGT A;  4ZJZ A;  4CHU A;  3GTP J;  1TLH B;  2O03 A;  2ZB9 A;  2JVH A;  3DTK A;  4XR6 A;  4LIT A;  4BYY A;  1QPI A;  2E34 A;  1YOV B;  1S29 A;  1XDU A;  3I59 B;  1AKH B;  2JA8 J;  4M3G A;  2M87 A;  3WU0 A;  5FLX Z;  1QA6 A;  3IH4 A;  3C18 A;  1U5T B;  2Q2E B;  1P7J A;  2RN7 A;  3PIO F;  3OYG A;  4MTD A;  1P4A A;  2V9V A;  3ZMZ A;  1XPX A;  2MFZ A;  2A3S A;  3FXL A;  1J9I A;  3F8F A;  3HUG A;  2E1C A;  1ZRC A;  2XVC A;  2E60 A;  2ELK A;  4ZYA A;  3J81 K;  3V4G A;  1DPR A;  3S1N J;  2FF4 A;  1T39 A;  1D5V A;  3ZOB A;  1VZ0 A;  3VOD A;  4DIQ A;  4HYE A;  1A36 A;  2MG4 A;  4XRS G;  2XV4 S;  4DYQ A;  4BE0 A;  1P7I A;  4XRS A;  4A3E J;  4ZYG A;  2VT2 A;  1ENH A;  2EIM H;  2VQC A;  2MLG A;  1JGG A;  3J7Y J;  1K7A A;  3LAJ A;  2FNP A;  2BOL A;  5IP6 A;  4D7N A;  1O4X A;  2EZH A;  2MC3 A;  3KLN A;  1YW8 A;  1ZAO A;  2ZXJ A;  1MMA A;  1X1B A;  3HUG B;  3NAU A;  1R5I D;  4IHW A;  1Y56 A;  1GVD A;  2EA2 A;  3KZY A;  5ILU A;  4BUP A;  1E3H A;  2XB0 X;  1OKR A;  4XSZ F;  3ECO A;  2B63 J;  3PSF A;  3E97 A;  5FRM A;  1SMT A;  4ASN A;  2K27 A;  3VYR B;  2R5Y A;  2WTE A;  1IF1 A;  1X58 A;  1QBJ A;  4CGZ A;  3HOV J;  3S17 J;  2MBF A;  5IT9 K;  2LKS A;  1ERD A;  4L5E A;  3JSP A;  2RKH A;  1K6O A;  4RB2 C;  1AA7 A;  2DDB A;  3F3X A;  3L2Q A;  3TQN A;  5E3M A;  5DYM A;  2H94 A;  2VQH A;  4FX4 A;  2XAH A;  1X3W B;  4P96 A;  4XRF A;  1L0O C;  1MMS A;  5LLQ A;  2L3D A;  4YIR X;  5D5U B;  5LRR A;  1AWC A;  2STW A;  4E7Z A;  1KYW A;  5F04 A;  2WV0 A;  2L9V A;  3HDD A;  1ZGA A;  3A4C A;  2LD5 A;  2ZME A;  1SD6 A;  5GAD J;  4RB1 A;  2ISZ A;  3H3Z A;  2X6X A;  3H3U A;  5FRO A;  1XB4 A;  2K9S A;  2LH9 A;  2R5Y B;  2JPB A;  3TDZ C;  5L3B A;  1KU9 A;  2CS3 A;  2VOP A;  2X9D A;  1MJ9 A;  2A68 F;  2ELJ A;  5BQT A;  2R7S A;  1D8J A;  4L9V A;  4XLA A;  4F93 B;  2GXB A;  2VPR A;  4IHX A;  3BR2 A;  3J7A Y;  2JN6 A;  1B1B A;  2YU3 A;  5LHI A;  2VON A;  1S7O A;  1FC3 A;  2DN0 A;  1SAN A;  4BDY A;  4JYK A;  4FIS A;  1XG1 A;  1LDK B;  2P7V B;  2ZXH A;  3REO A;  4A3K J;  1G6N A;  2FU4 A;  2COB A;  2K9Q A;  2A5Y B;  3IKT A;  1R5H A;  4XKC A;  5B3S H;  5M5Y J;  2HEO A;  4E7K A;  1ZLJ A;  3UR3 C;  2ZME B;  5KNL A;  2CV1 A;  1LKX A;  4IZZ A;  3W6J B;  2F4O B;  2AXL A;  1XCV A;  2H1L A;  3R4K A;  2DA6 A;  5FKO A;  2LKX A;  4Y13 A;  3RTR A;  2PJR B;  1XMX A;  1J59 A;  1XC5 A;  3P9K A;  5J4Y A;  4L0Y B;  4I6Z A;  1Y0N A;  4MFD A;  1JKO C;  1A31 A;  1N25 A;  3F9K A;  5E1W A;  3OYC A;  5FB2 A;  4NC7 A;  5LHG A;  4IHT A;  2HPM A;  3BG7 A;  1MZB A;  4KN7 X;  2LG4 A;  2E2H J;  4II3 A;  2E1M C;  4DNC A;  1WZ2 A;  1A5J A;  2K9L A;  5CKT A;  2LNB A;  1ZKG A;  2FMY A;  4KMU X;  2R92 J;  4WK8 F;  1TBX A;  2F2E A;  3OOU A;  4D7M A;  3GYH X;  3ZQI A;  1E3O C;  2ZJQ F;  2M0C A;  5EJC A;  2DA4 A;  5F0C A;  3MZY A;  5D5W B;  3N97 A;  2OF7 A;  1LJ9 A;  3PQJ A;  3TP3 A;  4XRM A;  1T2K A;  1ZR4 A;  1TL8 A;  2P81 A;  3MCZ A;  1OFC X;  1MMG A;  5E3L A;  4HX7 A;  4MHG A;  4UHT A;  3S3N A;  1X19 A;  3WTY C;  3MAJ A;  3RZO J;  3I64 A;  1S7A A;  2DAO A;  3CF2 A;  5E8G A;  3C2B A;  3NEU A;  3L09 A;  4MLO A;  4UVC A;  1PDN C;  3SZG A;  1IXS B;  4U88 A;  2AXT C;  1YHQ I;  4PCQ A;  2MGQ A;  1HLV A;  3H1C A;  1FSH A;  1X2M A;  4A3L J;  1MND A;  4AVZ A;  2VLA A;  3HRS A;  2V6E A;  1YJN I;  2P6T A;  1SFO J;  1D0Y A;  1IV8 A;  3GTL J;  5F1J A;  1HDP A;  2ZFW A;  2MYS A;  1BL0 A;  4ZYD A;  3VWB A;  4JK1 X;  3ASO H;  2WB1 N;  4OIR F;  1KQ8 A;  1LQ1 A;  2LY9 A;  1IW7 F;  1SVL A;  4AYB N;  5F08 A;  3O8H A;  4MEY F;  1HSJ A;  1N75 A;  4WWC A;  2QEN A;  3QPL A;  2V26 A;  3SFZ A;  1K79 A;  3D0S A;  3FDY A;  4II2 A;  4DYR A;  3HXL A;  3I56 I;  4C30 A;  3FM5 A;  4AIH A;  3W3C A;  4G6Q A;  5C4X J;  3E0J B;  5J6X A;  3OS1 A;  1H9T A;  3K4C A;  2DI3 A;  2W7N A;  2MAB A;  5JVT A;  2W25 A;  4OMZ A;  1IC8 A;  4CCO A;  4D5C A;  3JAM K;  2G7H A;  3MKW B;  1WQ2 A;  3W2A A;  2XGX A;  4C2U A;  5GPA A;  2LLK A;  5FO5 A;  5DV5 A;  1MBH A;  1YIT I;  2DOE A;  2QLZ A;  4CDG A;  1ZK8 A;  5EG0 A;  1STZ A;  2HQ5 A;  3SDB A;  1J2X A;  4XM3 A;  2FA5 A;  1ORK A;  1F5T A;  3ZMS A;  4F92 B;  1SC7 A;  1HW2 A;  3RKX A;  2CW8 A;  1ZLK A;  1R6R A;  1P2F A;  3GO5 A;  3I0T A;  4M71 A;  2NVU B;  1MBG A;  3EDP A;  2VN2 A;  4E6K G;  1OYI A;  2EBI A;  1LNW A;  3KYC B;  5D6F A;  1WJE A;  5BPI A;  3P9C A;  2LDU A;  2KDO A;  2EWN A;  4A3D J;  4A69 C;  3L1P A;  4ZYE A;  1WJA A;  1B9M A;  3RPU D;  3GUD A;  3ZQF A;  3GBG A;  4M9X A;  3QU3 A;  1ZYR F;  2DJN A;  1U3E M;  3I53 A;  1YRN A;  2F4I A;  1CF7 A;  3FBN B;  5FRN A;  5FKN A;  3PJR A;  1IN4 A;  4P5O A;  1OCO H;  1ZHF A;  1EV7 A;  3M9A A;  4FE7 A;  5EG0 B;  2EV6 A;  3FMQ A;  3G1O A;  2IA2 A;  2LF7 A;  4LB5 A;  1K83 J;  3CDI A;  1MSE C;  5K5O A;  1NK2 P;  1P4X A;  3IRR A;  4XLC A;  3VDX A;  4PZJ A;  3ZMT A;  3WTS C;  4NNJ A;  3SEZ A;  3BG6 A;  3CF5 F;  1R7J A;  3CCU I;  2IGN A;  2HXO A;  3LSM A;  5CQE A;  5A2Q Z;  4XKB A;  2ZBK A;  1R36 A;  3DPT A;  3LSI A;  2KIU A;  3MFK A;  2X51 A;  2BHY A;  3K6G A;  3KE2 A;  3R60 A;  1XD7 A;  3FXO A;  2QVO A;  4ITV A;  3E6M A;  2IXS A;  3BOQ A;  4Y33 A;  2VJ5 A;  1R1T A;  5GPC A;  1WHU A;  1YRN B;  2D1V A;  4P9U A;  3KEQ A;  2ICW G;  1G3T A;  1CF7 B;  5FLX K;  2O9L A;  4KN4 X;  2P0W A;  5IYC J;  2W85 A;  1SFK A;  2B7E A;  3CUQ C;  4A6E A;  2JJ7 A;  5D4R A;  1ETO A;  3EYI A;  3TO9 A;  4HOB A;  2LOO A;  4QWQ A;  1EKE A;  2PMZ N;  4W1U A;  3KP2 A;  2P5V A;  4YEJ A;  4N0B A;  2Y75 A;  4H0E A;  4I98 B;  4XLE A;  1FMW A;  4DJA A;  5DS9 A;  2F4M B;  3HIF A;  4B09 A;  1SD5 A;  5DUI A;  4LGW A;  2F5C A;  4M9Z A;  2L4A A;  1JXS A;  4J01 A;  5J8F A;  5TRD A;  3CCV I;  1H88 C;  1DPU A;  3OYK A;  1P4W A;  2XPV A;  4BHP A;  1WVR A;  2ZJ2 A;  3CLO A;  1UHW A;  4IX7 A;  5HLT A;  5FLM J;  2VE9 A;  1X1D A;  4ETS A;  3BZC A;  2DOA A;  2OCC H;  2GOM A;  2EV5 A;  2WBM A;  1ZAR A;  2VJI A;  4X6A J;  2JA7 J;  3SFI A;  3OSF A;  2DA5 A;  3ZQH A;  2O8K A;  3GWZ A;  4XNF A;  1XTA A;  5HDG A;  4KNY A;  2XAJ A;  3GW2 A;  4CO8 A;  3CZ6 A;  3DBL B;  5D4S A;  1JUM A;  1F1Z A;  5ERI A;  2H27 A;  2IA1 A;  2M45 A;  2K85 A;  2BZT A;  1A35 A;  2FSW A;  2DMU A;  3I3L A;  3JRD A;  5E18 F;  4EGZ A;  1PUE E;  3MWM A;  4Z6Y A;  2P5K A;  1OCC H;  4GCV A;  3HB9 A;  3RQI A;  5ED4 A;  4L18 B;  4PSX A;  2W57 A;  2HXI A;  2J5P A;  3OV8 A;  3JRE A;  2COM A;  2R7T A;  4PFP A;  5BPD A;  1T98 A;  3HOY J;  3HRU A;  3K9T A;  5C4J J;  1OJL A;  2BEO A;  1LFU P;  3LSJ A;  1CQT A;  3S3M A;  1D1B A;  2X0L A;  1YIJ I;  1IUY A;  1IRF A;  3JRH A;  1ZEL A;  2FEZ A;  1ZRF A;  2KDZ A;  3IL2 A;  1UFM A;  2M30 A;  1UCR A;  3ECH A;  2A5W A;  4KIT B;  1LVK A;  3MKY B;  1Y39 A;  2L9N A;  2Z16 A;  3K70 D;  4S0H B;  4AWX B;  3BG9 A;  4M6X A;  3CTA A;  2D2W A;  4HLY A;  5B1A H;  2HVQ A;  3ZXS A;  3D1N I;  2M7B A;  2DA7 A;  3SZT A;  3ABK H;  2KZV A;  2QSF X;  3DWL E;  5LBQ A;  3JW4 A;  3HBL A;  4A0X A;  2H8W A;  3ML6 A;  1DU0 A;  2XAU A;  1SFX A;  4XIC A;  4DGW B;  2G9W A;  3VB2 A;  1Z7U A;  4EJV A;  2EJR A;  4QTR A;  2LF8 A;  1V5E A;  4ESB A;  4CCN A;  4BDZ A;  3T0Y A;  2HOS A;  4A6D A;  2VC1 A;  1JUS A;  2NXN B;  1MD0 A;  1RIO H;  2VUM J;  2K7L A;  2VJJ A;  5D5V B;  4BXX J;  1BBY A;  2AQE A;  4MEX F;  4JX5 A;  1Z6R A;  1LDD A;  2AO9 A;  3CCJ I;  2RAE A;  1YYV A;  3ABU A;  3FXK A;  2CGP A;  2GZW A;  4HLX A;  1I6X A;  2L7M P;  1LFP A;  1BW6 A;  3OR2 C;  4M3B A;  2EFO A;  4BGD A;  3H3V K;  2IGK A;  1Z77 A;  3GTK J;  3IH3 A;  4XQF A;  1JHF A;  2R4G A;  3QPS A;  2OV7 A;  2V6C A;  2HOE A;  1TQI A;  1O7F A;  1QGP A;  3SEQ A;  2DLL A;  1D3Y A;  2DMT A;  1Z1D A;  3BR5 A;  2Y2Z A;  2JTV A;  1P6R A;  1NG6 A;  3LFK A;  1JJ8 C;  4N9H A;  1R4M B;  2A6E F;  3CP2 A;  3BZ6 A;  3ONQ A;  4GGG A;  4XON A;  4CSW A;  3RI4 A;  2E19 A;  2CW0 F;  4RBO A;  3MVP A;  3K4L A;  1I3Q J;  1KQ9 A;  2ECC A;  5EF6 A;  3F8N A;  2JQ7 A;  1R00 A;  1N78 A;  1J75 A;  2OZU A;  1FZP B;  3BTI A;  2QKM B;  1K6Y A;  2O0Y A;  4FX0 A;  3BJO A;  2BY0 A;  4HZF A;  3K70 C;  5L3E A;  4CZC A;  2IS6 A;  3MKZ A;  3MMY B;  2RRE A;  3JRI A;  1TWF J;  2DA3 A;  1OIS A;  1TP4 A;  2CQN A;  2A6H F;  2ZSH B;  5JFR A;  1AU7 A;  3PO3 J;  5M5W J;  4ANJ A;  1B72 A;  2WWY A;  2TCT A;  1T95 A;  2HWV A;  2O3F A;  3BCB A;  3PQK A;  1RNL A;  2WB1 A;  4YFK F;  1WH5 A;  1YJW I;  1UG2 A;  4QIW N;  4AYB A;  3WTU C;  3FX3 A;  2V1N A;  1VQM I;  2D5V A;  1FOX A;  1B6A A;  4RB0 A;  1WJC A;  5IOZ A;  5J1R A;  2F6C A;  2OU2 A;  1S8N A;  4RLF A;  1S3J A;  1FX7 A;  3GLL A;  3OSG A;  2EH3 A;  5CYV A;  3KZZ A;  2VKH A;  4BQO A;  1XS9 A;  4Q4Z F;  4PDK A;  2L01 A;  2QZ8 A;  2V9K A;  4ZZD A;  5E1X A;  5K5Q A;  1FIP A;  3EUK L;  2JZY A;  1FBQ A;  1TWH J;  2WAE A;  2EIL H;  2H8R A;  5BMZ A;  3I5U A;  4HF2 A;  1W5S A;  3DBR B;  4N4O B;  1B72 B;  1LEA A;  3IRQ A;  2KPM A;  2NVQ J;  2ESH A;  3ULQ B;  3NAR A;  3JR9 A;  2UXX A;  2E1M B;  4WXH A;  3J80 Z;  1SFE A;  2IRF G;  4QSH A;  1VQK I;  1VQL I;  5LRS A;  2TRT A;  4YEL A;  2HVS A;  3C7J A;  4YRV A;  3JRF A;  4DZP A;  2NS7 A;  2B0L A;  4F91 B;  5DEQ A;  1U9O A;  1DDN A;  1ODD A;  2WY8 Q;  2BVM A;  2H6C A;  4I0B A;  4PUS A;  1RUO A;  3K4B A;  5FKM A;  4AID A;  3BR0 A;  4S04 A;  2LTP A;  2IEK A;  1DGW Y;  3X2Q H;  2E7X A;  3FBI B;  3ZQ7 A;  2V4J C;  3FWE A;  3PSI A;  3PO2 J;  4CUG A;  3K7A J;  2LKP A;  2JUC A;  2PFB A;  5H2F C;  2QSG X;  5LFA A;  1MNE A;  2DYS H;  4OAZ A;  1FYM A;  4AIJ A;  1G3Y A;  3PIP F;  2A05 A;  4OAY A;  3D5L A;  4N9I A;  3HOS A;  3FHZ A;  3E1S A;  2UUZ A;  2CSO A;  2K4J A;  2BVL A;  2E5Z A;  2HU9 A;  2DPU A;  1FPQ A;  1Y0U A;  1TWG J;  2CMP A;  1TT0 A;  1UG0 A;  2M34 A;  2VOO A;  4LJZ F;  3E5Q A;  4KDP A;  2PJP A;  3JCU C;  5DM6 F;  2EFW A;  5HS9 A;  2Q1Z B;  2UWM A;  2WAQ N;  4JX4 A;  4EGY A;  4Q5S F;  2M4G A;  5H6R A;  2A6T A;  2XRN A;  2PX9 A;  2HZD A;  4XLH A;  3AG1 H;  1D8K A;  2CH0 A;  3BJA A;  2Y0M A;  4UUT A;  3TGN A;  4IHV A;  1MNM C;  3M8J A;  4EV0 A;  2E71 A;  5A2Q K;  2GWR A;  1YJ9 I;  3V7C A;  4CCJ A;  2EV0 A;  3BT9 A;  1VND A;  3G6E I;  2W48 A;  2VKD A;  3DKX A;  3QOP A;  4G6T B;  2OC6 A;  1LVA A;  3QU6 A;  1RRJ A;  2QM3 A;  3GEZ A;  3FXM A;  2PMZ A;  3ZP5 A;  2K02 A;  2RVC A;  2CUZ A;  4EM0 B;  4HDU A;  1W7P D;  1EH7 A;  3ABT A;  3M8F A;  4Q48 A;  3OWT A;  4PJ0 C;  1F9N A;  2KMU A;  4XMY A;  4E7S A;  3K4N A;  4HAM A;  1S7E A;  4HBL A;  2CUJ A;  3TED A;  4XN3 A;  2QQ9 A;  3S1M J;  3DLL F;  2JK3 A;  3I71 A;  3T5X A;  2DA2 A;  2DO7 A;  3HOW J;  1R1U A;  3HHG A;  5L3D A;  2ETH A;  3MZ8 A;  1F4K A;  3C2H A;  4BS9 A;  1K4T A;  4DQ2 A;  1DUX C;  2L7Z A;  3HGG A;  4EJU A;  1DP3 A;  3CLQ A;  3M1C A;  4A5M A;  5J47 A;  3SJM A;  3W2W A;  4GDF A;  2X1D A;  2CQ7 A;  5J4V A;  2XGD A;  3OL4 A;  5L3C A;  5FFZ A;  3Q9V A;  3LA7 A;  3K1P A;  1U2W A;  1W1W E;  2FOK A;  3ABL H;  2P5L C;  4DZJ A;  2DOD A;  4ENN A;  4IRH A;  2PJR A;  4FE4 A;  5C3E J;  2DPD A;  4NC8 A;  1MBJ A;  3BZK A;  4ZTF A;  1UZC A;  3WHB A;  4A3G J;  2JUG A;  5LGU A;  2QF7 A;  5F0H A;  3PNT A;  4C3J J;  5K7H A;  2VXZ A;  2FNA A;  3NWT A;  3CUQ A;  4UXN A;  4I0A A;  3JRC A;  4UV9 A;  3BTL A;  4CH7 A;  1JGS A;  1Z21 A;  3CJT B;  3G1L A;  2XPW A;  4XOR A;  2DXI A;  2CQK A;  4FQG A;  1T8I A;  3GTJ J;  4IQJ A;  5D8K B;  1H8A C;  3EUH A;  2D1H A;  1SAX A;  1FTZ A;  4EEF G;  2FQ3 A;  4G8X A;  1USS A;  2QYO A;  4U0V A;  2XAQ A;  2Y48 A;  2XKO A;  1WFX A;  3HPH A;  3WG7 H;  3QRF F;  4IKF A;  2K9N A;  4ENJ A;  5EZH A;  2VJ4 A;  3C3W A;  5K1Y A;  4X0G A;  4XKV A;  4UV8 A;  1EJ9 A;  4BQA A;  2RV8 A;  2BGC A;  2M4K A;  1FIA A;  4M72 A;  4G94 A;  4LK1 F;  3CUQ B;  4R1H A;  3G71 I;  3RPU A;  3LA2 A;  3MN2 A;  4BJ6 C;  5E20 A;  3LL7 A;  4FET A;  5CLS A;  2EZL A;  3IAM 2;  2FJ1 A;  4AD9 A;  1BI1 A;  2KZG A;  2VKV A;  1V5G A;  4OMY A;  1UJ8 A;  4XID A;  2KL4 A;  4BXU A;  3M1E A;  1V5F A;  2L7F P;  2L9S A;  4RA2 A;  5K7F A;  2NVX J;  2KIM A;  3QYB A;  1OYY A;  3KZI C;  5EGO A;  4M74 A;  2QGU A;  3NWS A;  4I76 A;  1MGT A;  2KRC A;  1JKR C;  4C9Y A;  4RAF A;  5AIQ A;  3FZV A;  3J7A O;  2L0K A;  3I4N J;  1V55 H;  3DEW A;  4DBQ A;  3BG3 A;  3M7G A;  4A3M J;  2IS4 A;  1WI9 A;  1K78 A;  2ZO4 A;  1HC8 A;  5J3L A;  5B5E C;  1GV5 A;  2O5R A;  1PYV A;  2F5D A;  4BQN A;  5ICE A;  2UZK A;  1O3T A;  2PG4 A;  5FD5 A;  2HFH A;  5KCM A;  4LD5 A;  1OPC A;  2EFP A;  4KJZ A;  3LSR A;  3MZH A;  1ZG1 A;  3K2Z A;  3LA3 A;  4A3F J;  4UVA A;  1OR7 C;  1JTY A;  1RPW A;  2XC7 A;  2KIS A;  5FKL A;  4UB8 C;  4GO1 A;  3BCA A;  2HS5 A;  4HA8 A;  1Z7L A;  2BXY A;  2F5V A;  3PM1 A;  2H1K A;  3OOP A;  4AVP A;  2M9H A;  2DW4 A;  5FGM A;  4BBR J;  1XMK A;  1J09 A;  5EGO B;  2DFH A;  3EQL F;  4LB6 B;  2W82 A;  3HEF A;  4UNO A;  1WJB A;  3DPU A;  3OIQ A;  4HG2 A;  3BJ6 A;  3W6V A;  4A3B J;  2CFX A;  3I58 A;  2UV1 A;  2LRD A;  2XAF A;  3KLO A;  1W5T A;  1HDD C;  3RKQ A;  1IDZ A;  1E0E A;  1K78 B;  5HLI A;  3WU1 B;  2LC2 A;  2KKO A;  2CO5 A;  2EB7 A;  1I1G A;  5E3O A;  2YX7 A;  1X4P A;  4ABZ A;  4MGR A;  3T8R A;  3OIO A;  4E4H A;  3LOC A;  2IS2 A;  2P7C B;  1ETQ A;  5LEK A;  1U8B A;  4D0P A;  1H89 C;  1D5Y A;  2DT6 A;  2QQB A;  3QYF A;  1WI3 A;  3ZR8 X;  3ZN0 A;  1X1A A;  1GT0 C;  1W0T A;  5AON A;  1FOW A;  2R7D A;  3M07 A;  5EYR A;  4XSX F;  2ME0 A;  3HKZ N;  4I02 A;  6PAX A;  1OYW A;  3L2R A;  4EJW A;  1Y1W J;  2NVT J;  4FCY A;  2YX4 A;  5LD2 C;  2W4S A;  3OYE A;  3TO7 A;  3F72 A;  3ZQL A;  4HPQ A;  1RUN A;  2OTL I;  5IPA A;  1MBF A;  4CXF A;  1J5Y A;  4HQE A;  4RGR A;  4A3J J;  1ZH5 A;  2XKP A;  3OYD A;  5EDN A;  3BY6 A;  2RC4 A;  2DT7 B;  3R6S A;  1UB9 A;  2M8G X;  3L7W A;  4I7H A;  4A12 A;  3DU6 A;  1UHM A;  3GFJ A;  1TWC J;  2DU9 A;  3HSF A;  3BQY A;  1JI8 A;  4NHJ A;  4EQQ A;  1MH3 A;  4RAZ A;  2XF6 A;  3DEE A;  4RLQ A;  1H9G A;  3OIP A;  2NAZ A;  2PEX A;  4GXO A;  4LFU A;  3HOZ J;  1MSF C;  3S16 J;  2PBI A;  4JOM A;  2LP0 A;  3JRA A;  4PGH A;  1IUF A;  4CA0 A;  4EAT A;  4IL6 C;  5F64 A;  2GM4 A;  4IEJ A;  2XF7 A;  4B8X A;  3KCC A;  2WAD A;  1WJD A;  1MDM A;  1DP7 P;  3OR1 C;  1PUF A;  4D5F A;  3CD6 I;  2MH2 A;  1KQ0 A;  4MO7 A;  2GIZ A;  1ZRE A;  5KAF C;  3J80 K;  3QPT A;  5FLV A;  3ZCO A;  4PFO A;  4BE1 A;  1G3W A;  2O7O A;  4G7Z F;  4WF2 A;  1JT6 A;  3E5U A;  2X1C A;  1ETX A;  5ICG A;  2B9S A;  4LG3 A;  1X1P A;  3O6B B;  4I01 A;  4KIF A;  1BOA A;  1IV6 A;  4KMF A;  2IBD A;  3V7R A;  2HKO A;  4B3X A;  1T56 A;  3H35 A;  3ASN H;  4PJN A;  3K4K A;  4C2M J;  3RPQ A;  2R7Q A;  2X6W A;  2IT0 A;  4V2G A;  1JHH A;  1BC8 C;  3TBI A;  3S15 J;  1IRG A;  1G8X A;  4BXF A;  3JTH A;  3U1K A;  3HM5 A;  1MDM B;  2HI3 A;  2IAI A;  1PUF B;  3F8M A;  4BBS J;  1MH4 A;  4CCM A;  3CCE I;  1QNT A;  4E7L A;  1VQ6 I;  4C2T A;  4B48 A;  1ZRD A;  3CMM A;  4PJJ A;  1YX5 A;  3CCY A;  1O3S A;  3GF2 A;  1YI2 I;  2CUF A;  1WCM J;  4NDL A;  2ZME C;  3HRM A;  4EJO A;  3J7Z I;  3H9J A;  4H4K C;  2VOD A;  3WTT C;  1X4O A;  3GFI A;  3QP6 A;  2WAQ A;  1ONV A;  5AIP A;  2VAS A;  3B6A A;  3RCO A;  1IN7 A;  1UST A;  3H9Q A;  1TTY A;  1FBS A;  3B02 A;  2K5C A;  3FMR A;  3MEX A;  4S05 A;  4RAG A;  1B9N A;  1R1V A;  4FTH A;  4A3C J;  4U7D A;  1VQ9 I;  2XDV A;  1BOB A;  5DDG A;  3I9V 2;  3UKG A;  1GXP A;  3DTE A;  1BIB A;  4AC0 A;  2ZC2 A;  5DTD A;  2NYX A;  1HF0 A;  4ENK A;  3QOE A;  2DTR A;  3E6B A;  3A02 A;  3LSK A;  2AQF A;  1WH7 A;  2V1U A;  3OYH A;  3RYR A;  1GDT A;  3DKW A;  2Q8K A;  4D1Q A;  2K3F A;  4PGG A;  1R23 A;  1MKM A;  4A0Y A;  3GZ5 A;  2VBY A;  3SQN A;  1M1E B;  3DPL C;  1XSX A;  2W84 A;  4AM3 A;  3CCM I;  2JT1 A;  3VYS B;  2E7W A;  1JKP C;  2HVR A;  5DM7 F;  1I6H J;  1FTT A;  2UXN A;  2F5F A;  2ZNY A;  3CDL A;  4V2F A;  3I4M J;  3TP0 A;  4FHT A;  3ROU A;  4AIK A;  1VQO I;  1ETK A;  2BHZ A;  4GYG A;  3DTI A;  3GXO A;  3GLX A;  3R0A A;  3DFG A;  5FKK A;  3L9F A;  1FYK A;  1IRX A;  2ECB A;  4AU7 A;  2QA4 I;  2ZNZ A;  3CC4 I;  1BA5 A;  4EM1 A;  5M5X J;  2BBY A;  4IOA F;  2GA1 A;  1RI7 A;  4L5I A;  1K4S A;  4F3Q A;  2E35 A;  4MIM A;  4U7B A;  3Q0W A;  3U1D A;  5F1R A;  3KEY A;  5J1U A;  1O7L A;  5GAE J;  3RZD J;  3QQA A;  1EH6 A;  4NC6 A;  3O3K A;  1VQP I;  3S2H J;  4HX4 A;  3GTM J;  4MTE A;  1Z6T A;  1FMV A;  3FF5 A;  3KPH A;  5TJJ A;  2A69 F;  3DQV C;  5D8L B;  4O6J A;  4EM2 A;  4E7H A;  3OYM A;  2ZXW H;  1Z3X A;  1QVU A;  4XOT A;  2PMH A;  4OU0 A;  1XCB A;  4RDU A;  3IC7 A;  2Y9Z A;  4O3M A;  2L02 A;  3BDD A;  4IJA A;  5ICC A;  4JQF A;  3ISP A;  5HLH A;  1POG A;  4PK4 A;  1VQ5 I;  2LMD A;  2EFN A;  1FT9 A;  1LB2 A;  3KIO A;  1QHH D;  3BR1 A;  3KP3 A;  3Q3S A;  5GP9 A;  4O5V A;  4PSW A;  3G73 A;  1VF9 A;  2OCE A;  2R3S A;  2LY2 A;  3ERM A;  3HOT A;  5HOO A;  4ZYH A;  1ZTR A;  2L4M A;  4U0Y A;  2NNY A;  3JRB A;  1REP C;  2L5Q A;  2CUE A;  1U0J A;  4DBR A;  2M7A A;  1FJL A;  5CQG A;  3CCQ I;  1FY7 A;  5HDK A;  5KHD A;  3KP6 A;  1GLN A;  1PVE A;  3WHC A;  1E3P A;  1G3S A;  4LK0 F;  4HNV A;  3BR3 A;  4B44 A;  2E5N A;  4XN0 A;  5B1B H;  5ILV A;  3I55 I;  3A03 A;  1XN7 A;  3CCS I;  1OCT C;  1MJA A;  3H5R A;  3M3Y J;  2QKL B;  3DCF A;  1XSD A;  2LY1 A;  1ETY A;  4UUV A;  1IG7 A;  2XHK A;  3PNY A;  2OQG A;  2XAG A;  3MD2 A;  2HGC A;  2P6S A;  4A5N A;  4ZTJ A;  5JI6 A;  2OZ6 A;  3TL4 X;  5CVI A;  1D0Z A;  4ZC3 A;  1KYZ A;  4LIV A;  1APL C;  2DT5 A;  3LSH A;  4CCK A;  2NVY J;  5IP9 J;  1MJB A;  1Z05 A;  2X1E A;  2XRL A;  2CRG A;  2KHM A;  1ZN2 A;  1JTX A;  1T6S A;  2Y30 A;  4YII A;  1HOM A;  3CP8 A;  4YG2 F;  2OD5 A;  4KT6 A;  4A0Z A;  2ESN A;  2XAS A;  2K9M A;  5L3F A;  3SZP A;  1RR7 A;  3WE3 A;  4E7I A;  3ZMV A;  1I1S A;  2A61 A;  3V8L A;  3H0G J;  3WGG A;  3BTC A;  2VBW A;  2BW3 A;  3IAS 2;  1Q1V A;  2M1B A;  4M6V A;  3DF8 A;  5IY5 H;  1W7P A;  2VL8 A;  3HSE A;  2QSH X;  1NK3 P;  4KIG A;  2EIN H;  5CVV A;  1RES A;  3LQQ A;  4PJL A;  1BR2 A;  1O3Q A;  5ILS A;  1S72 I;  2VXD A;  4Y52 J;  1G59 A;  2BYV E;  1E17 A;  2M8E A;  4J00 A;  1XX5 A;  4EJT A;  3I4P A;  2JA2 A;  3JRG A;  3R61 A;  2Y9Y A;  3JTG A;  5E79 C;  1JUP A;  1SEU A;  3TO6 A;  2DQL A;  1OQY A;  2CYY A;  1RET A;  1TW2 A;  1LEB A;  4NUB A;  3LSP A;  4RMN A;  1UEL B;  2KJC A;  2J5O A;  4KFC A;  2IA0 A;  3TKY A;  5TGT A;  4ZDP A;  2BE5 F;  3WGI A;  1Y8Q B;  5EEH A;  3RDI A;  3AL0 C;  3F0C A;  5HS7 A;  3ZQQ A;  2YR2 A;  2JWT A;  2BW3 B;  1YTY A;  1Z91 A;  2V7F A;  3PUB A;  3R0J A;  1MBK A;  1D1A A;  2FQ4 A;  3L2V A;  1W7P B;  3HKZ A;  2IW5 A;  1SFU A;  2EIJ H;  3RSN A;  3WE2 A;  2OTJ I;  1OR7 A;  4XL9 A;  2DA1 A;  2VIX A;  4C3I J;  1YG2 A;  4KA4 A;  1LPQ A;  4NQW A;  1IDY A;  1A6Q A;  5HLG A;  2V1D A;  1YS6 A;  1S6L A;  3P5J A;  1ITY A;  4NBQ A;  4G6D A;  3GZ6 A;  3UNG C;  4BAC A;  4HV6 A;  1ETW A;  2X4H A;  1P9Q C;  3BLY A;  4RGX A;  2FE3 A;  2FRH A;  2CQQ A;  1AOY A;  1YS7 A;  3IHU A;  2WV1 A;  4M3F A;  4LLN A;  3SXY A;  3W2V A;  1IAW A;  2FX0 A;  1Z3Y A;  4RGS A;  5IP7 J;  1ZG5 A;  2DK8 A;  3ZMU A;  4BEH A;  1DGR M;  1UAA A;  2GA2 A;  2M3A A;  3N05 A;  4CYC A;  4E70 A;  1ZGW A;  2ZSI B;  3RYP A;  3HZJ A;  3CES A;  3O8G A;  4V19 K;  4U87 A;  1GUU A;  2MW8 A;  4F7Z A;  4BU2 A;  5J1Y A;  4BL0 B;  3A2K A;  3F22 A;  4NQW B;  2YU9 J;  2CV2 A;  5E3N A;  3HYI A;  1YQA A;  2CWE A;  4R8H A;  3OS0 A;  1HKQ A;  1ON1 A;  1T0F C;  5J40 A;  1MIJ A;  2I8D A;  1LFB A;  3C2G A;  2IPQ X;  2G7U A;  1XSV A;  3CJR B;  3F6O A;  2KQR A;  3ZRG A;  3IV5 A;  3CQZ J;  2ID3 A;  3MKL A;  2HNH A;  5IYD J;  2Z1D A;  5CVR A;  4XBF A;  3ZGK A;  2BV6 A;  2ZFU A;  4BEH B;  1NTC A;  3KYL A;  3QP5 A;  2CV0 A;  1SVM A;  1I5Z A;  3G3Z A;  2DK5 A;  4CYC B;  2HQR A;  3A0H C;  2QBY A;  2JA6 J;  3HTS B;  2HYF A;  1IO2 A;  4M9S A;  4U0W A;  1FYL A;  2DBB A;  2R5Z A;  3A0B C;  2V1X A;  3FXU A;  2IGM A;  1UMQ A;  4G9Y A;  2KRH A;  2ME6 A;  3IUO A;  1BJZ A;  3WTV C;  5HOD A;  3CC2 I;  3CJN A;  2Y31 A;  3K10 A;  5F27 A;  1YLF A;  1F43 A;  1FLI A;  1TZL A;  3GTG J;  1NHA A;  1TWA J;  5EZG A;  4BY7 J;  1B8I A;  1EA3 A;  3W6K B;  2PI0 A;  4YFN F;  1HST A;  1W0U A;  1R4N B;  1BC7 C;  4BKX A;  1TQM A;  4KT5 C;  4G7H F;  2H09 A;  5E8I A;  1ZGJ A;  4JBA A;  2RGV A;  1A04 A;  2I5U A;  2ZCW A;  1KA8 A;  2QBY B;  3GZN B;  3SHF A;  4LMY A;  2R5Z B;  2X6O A;  5H20 A;  1KZH A;  2R93 J;  2FXA A;  4JP0 A;  3KP5 A;  1SVO A;  2LK2 A;  4J19 A;  3CME I;  5KVR A;  1Y8R B;  3BTJ A;  4N4N B;  1TNT A;  5DCF A;  3AAF A;  1WGX A;  5CVJ A;  1BM9 A;  3HRT A;  2WAF A;  3FKI J;  1B8I B;  1OCP A;  2VB6 A;  2VT3 A;  3K69 A;  4BNC A;  3OY9 A;  1X3U A;  1J7K A;  5KK1 A;  1EF4 A;  3H9G A;  3FM3 A;  4BHB A;  1SD7 A;  4L9J A;  3WU2 C;  3CMY A;  2F48 A;  3M8E A;  4UVB A;  2HDC A;  1D0X A;  2VQG A;  3PNV A;  1JKQ C;  1UHS A;  1BI3 A;  1WJ5 A;  1KU7 A;  3MQ0 A;  4CYD A;  3LFU A;  4E7J A;  4P55 A;  4B47 A;  2FUG 2;  3BPV A;  2NS8 A;  1FOK A;  2DQR A;  3OYI A;  2Y0S N;  2ZJP F;  3L2U A;  2DTZ A;  3FIW A;  3U2R A;  3CC7 I;  3F8B A;  2W24 A;  1KU2 A;  2BY2 A;  3F23 A;  3U9G A;  4RM3 A;  2NOG A;  3EPZ A;  3E3V A;  1QZZ A;  2QEX I;  2NNN A;  3VSL A;  5JVG F;  5BNG A;  3T1B A;  3KET A;  1IGN A;  1G2H A;  4HW0 A;  5DCM A;  2HDW A;  1ZG3 A;  4Y15 A;  3OYL A;  2E1O A;  5LEJ A;  5BOX A;  1R9T J;  3VFZ A;  4FT8 A;  3AG2 H;  1QZY A;  5CPR B;  2JVG A;  2OAZ A;  1FP1 D;  2P8T A;  2R7W A;  1VQN I;  5LGN A;  4IRI A;  1QHG A;  2VQL A;  4RAY A;  3IWF A;  3OYJ A;  1VQ4 I;  2NRA C;  1WPK A;  3B6C A;  3V8J A;  3VSK A;  3LAP A;  3L2W A;  2JRM A;  2Q0O A;  1LE8 A;  1Z0X A;  2KP6 A;  2LBF A;  2JA5 J;  1Y1V J;  4M73 A;  5BS6 A;  3P7N A;  1BR1 A;  1R71 A;  3QPH A;  5GTI C;  3K1N A;  3BP8 A;  3IP4 B;  3OYA A;  5DCM B;  5GAG J;  1HQC A;  4ZZL A;  2ACJ A;  3CO7 C;  2FML A;  2NOJ B;  2XRO A;  1P92 A;  2JPC A;  1QRY A;  1RC9 A;  5GAH J;  2K40 A;  3HJE A;  3S2W A;  1FWZ A;  3F6V A;  5HNF A;  1RKT A;  1X1C A;  1WKM A;  2RNJ A;  1RR8 C;  2A07 F;  2DFE A;  2EZK A;  3U21 A;  1I27 A;  3K2A A;  3CCL I;  1LE8 B;  4M6Y A;  3S8P A;  1U5T C;  3GFM A;  1BR4 A;  5H6Q A;  2LBF B;  1VQ8 I;  1HBX G;  4WXD A;  2L2O A;  3KYD B;  1NG7 A;  4NB5 A;  3ABM H;  1CGP A;  1B4A A;  3IKV A;  4XK4 A;  2R7F A;  3VPR A;  3WOD F;  3GTQ J;  1V4R A;  3DEU A;  2HR3 A;  3K0L A;  2QUF A;  1RKW A;  4ESJ A;  1FOY A;  2EFQ A;  3ZN1 A;  2IGO A;  2QWW A;  4QPO A;  4BJ5 C;  4HEA 2;  2FD5 A;  3T8T A;  1XDS A;  4IO9 F;  5JHU A;  3I54 A;  2BXZ A;  2G0E A;  3RKW A;  5K5R A;  4HST A;  3S14 J;  3F8C A;  1E2X A;  3DKY A;  2VI6 A;  2MH9 A;  2GXA A;  4EMS A;  3G4S I;  2ID6 A;  2EK5 A;  3BPX A;  1QU3 A;  2I10 A;  4KIC A;  1XGM A;  1R22 A;  3HHH A;  1XGO A;  1Z67 A;  3VYU B;  2YS9 A;  4BQQ A;  4HDV A;  1VFC A;  1AHD P;  1OCR H;  1H0M A;  3Q9S A;  3QWL A;  2FOW A;  4Y4R A;  1Z9C A;  5CJ9 A;  3GFL A;  1QPM A;  4Z2Y A;  1IJW C;  4HV5 A;  3KP4 A;  5K7Z A;  1BJA A;  4CCL A;  1HKT A;  2WA0 A;  3AG4 H;  3RIR A;  2R7X A;  1ON2 A;  1DU6 A;  2CU7 A;  4IOC F;  1R58 A;  2OA4 A;  4XLF A;  3RJP A;  3IWZ A;  3FMS A;  4C3H J;  4FAS D;  4OIQ F;  4BH9 A;  1O57 A;  2C6Y A;  4RM2 A;  2DJI A;  2P4W A;  3GX4 X;  1W36 D;  2R7O A;  2FBK A;  4BAY A;  3DBH B;  2OQR A;  3HL2 A;  3A1Y A;  2EIK H;  4A93 J;  2IJL A;  1O3R A;  4P1W A;  2DDA A;  2PLY A;  4IF4 A;  3K4M A;  2MC4 A;  1OMI A;  5JR3 A;  1T08 B;  4A2U A;  3EYY A;  5GTH C;  4IHY A;  5B66 C;  1MMD A;  1A6I A;  2M2E A;  4I09 A;  2X48 A;  3TOB A;  2HTJ A;  2E1N A;  1L3L A;  1NH3 A;  2O61 A;  3TMO A;  5FD6 A;  5C44 J;  2JMW A;  3PFI A;  2IVM A;  2LFB A;  4IQ4 A;  2DOF A;  3ZQG A;  3CO6 C;  2F5E A;  1VTN C;  1HW5 A;  3LMM A;  1PJR A;  4XLN F;  1U8R A;  3HOU J;  4GFB A;  1QZE A;  2Z33 A;  1FNN A;  1QQI A;  2QCO A;  1WJF A;  2WY7 Q;  3BQZ A;  1X3Z B;  5HNH A;  1MBE A;  4XKW A;  2ADU A;  3CJQ B;  3J81 Z;  4X1E A;  5DD8 A;  2BY1 A;  3NRV A;  3TW6 A;  3V7S A;  2GQQ A;  1YE9 A;  2N8G A;  4IRG A;  1I39 A;  3P9I A;  1OCZ H;  3FIS A;  3AKZ A;  3S93 A;  3D5S C;  3TOA A;  3FXR A;  4OOI A;  2KJB A;  1GVJ A;  2HPI A;  4QLC U;  4L0Z B;  2KRF A;  4M3E A; 
#chains in the Genus database with same CATH homology
 1IXR C;  1QO0 D;  5HS8 A;  1YO5 C;  2Z3Y A;  2VC0 A;  2V79 A;  4BHC A;  2H6B A;  1TQP A;  4GYI A;  1V3F A;  3FXQ A;  5L3G A;  4MQ9 F;  1YW7 A;  4OIO F;  2LSO A;  4HF1 A;  2GAU A;  3E6D A;  1JE8 A;  4G7O F;  3KFW X;  3WGH A;  3KEO A;  3ZPL A;  1KU3 A;  2JSC A;  4CIC A;  3V8K A;  3DP7 A;  5IT9 Z;  1B59 A;  2JRT A;  2AS5 F;  1SD4 A;  2IP2 A;  5FFX A;  3LST A;  2HYG D;  5F6F A;  4LLL A;  5D5X B;  2QQA A;  1IN6 A;  2YSR A;  2FBH A;  5IT3 A;  1W4M A;  4L9N A;  2TDX A;  1FSE A;  3LQR A;  2GXG A;  3BRO A;  1WWX A;  4ON0 A;  4KYW A;  1YIO A;  3NQO A;  2Z9O A;  2DFI A;  2KIF A;  3CDH A;  1FP2 A;  4KUM A;  2Z5U A;  5DUK A;  1IN8 A;  4HQM A;  5J8C A;  4MNU A;  2STT A;  4RS8 A;  5LHH A;  1T0F A;  1PP8 F;  2NS0 A;  2ZKZ A;  4KIB A;  2VE8 A;  2CG4 A;  2MLK A;  5D6E A;  4CZZ A;  3WTZ A;  5HDN A;  4HF0 A;  4L5J A;  4XLP F;  1KGS A;  3ZMD A;  3QAH A;  3DV8 A;  1XMA A;  2O8X A;  3B73 A;  1GHC A;  3GVA A;  2HTS A;  1IZ1 A;  3JSO A;  3L00 A;  3HSR A;  3N4M A;  3O2P E;  4OIN F;  3H92 A;  2D45 A;  3ERE D;  2YPR A;  2RQP A;  4YIF A;  4LLG F;  3VOE A;  3COA C;  1RZ4 A;  4ENM A;  2O6G E;  1HXD A;  1IXC A;  4HX8 A;  4TV7 A;  5EEG A;  3HTU A;  4I2O A;  2MA3 A;  5DD4 A;  1PP7 U;  1LDJ A;  2OBP A;  1SMY F;  2EA4 A;  2GIV A;  2FBI A;  1WSU A;  2M5W A;  3E5X A;  1HW1 A;  1GXQ A;  3KP7 A;  5E17 F;  2K4B A;  4K2E A;  4LG0 A;  2WC2 A;  2VBZ A;  2PN6 A;  1TW3 A;  1XGS A;  1Q1H A;  4WX9 A;  3WTX C;  4IXA A;  4WCG A;  1TNS A;  3EET A;  4P9F A;  2Z99 A;  1XGN A;  1WRJ A;  2HQN A;  3TDU C;  1G4D A;  3C1D A;  3JAM Z;  3WTW C;  1FBU A;  2PMU A;  5ICF A;  3L2C A;  1U6G A;  2L54 A;  2HZT A;  3F21 A;  1R5G A;  1C0W A;  4IHS A;  4IPA A;  2HKX A;  4RB3 C;  4YFX F;  4ESF A;  1BIA A;  3RKY A;  4Q47 A;  4Y17 A;  4LG0 B;  3E6C C;  1J0R A;  3DXJ F;  3CUO A;  2ISY A;  2K86 A;  4R79 A;  3ELK A;  4IVN A;  1IN5 A;  2XUB A;  3LWF A;  3VEP A;  1BN5 A;  2MD5 A;  3BWG A;  4OIP F;  4WXC A;  5E1Z B;  4L9T A;  2VBX A;  1BI2 A;  2RDP A;  5HVQ C;  3K1M A;  3I59 A;  1T38 A;  2PQ8 A;  1BI0 A;  1ULY A;  1U5T A;  2Q2E A;  5CVU A;  4EVI A;  2ELH A;  1YFH A;  4RGU A;  3WG9 A;  2XIG A;  4MQV A;  3Q5F A;  1EH8 A;  4ZH4 F;  1YW9 A;  1HKS A;  1U78 A;  5LGT A;  4CHU A;  1TLH B;  2O03 A;  4BYY A;  1S29 A;  1XDU A;  3I59 B;  2M87 A;  3WU0 A;  5FLX Z;  3C18 A;  1U5T B;  2RN7 A;  4MTD A;  1P4A A;  2V9V A;  3ZMZ A;  2A3S A;  1J9I A;  3F8F A;  3HUG A;  2E1C A;  1ZRC A;  2XVC A;  3J81 K;  3V4G A;  1DPR A;  2FF4 A;  1T39 A;  1D5V A;  3VOD A;  4HYE A;  2XV4 S;  4ZYG A;  2VT2 A;  2MLG A;  1K7A A;  3LAJ A;  2FNP A;  2MC3 A;  3KLN A;  1YW8 A;  1ZAO A;  2ZXJ A;  2EA2 A;  3KZY A;  5ILU A;  1OKR A;  4XSZ F;  3ECO A;  3E97 A;  1SMT A;  4ASN A;  2K27 A;  2WTE A;  1IF1 A;  1QBJ A;  4CGZ A;  5IT9 K;  2MBF A;  3JSP A;  2RKH A;  1K6O A;  4RB2 C;  3F3X A;  3TQN A;  5DYM A;  2H94 A;  4FX4 A;  2XAH A;  4P96 A;  4XRF A;  1L0O C;  5LLQ A;  2L3D A;  5D5U B;  5LRR A;  1AWC A;  2STW A;  1KYW A;  2WV0 A;  1ZGA A;  2ZME A;  1SD6 A;  4RB1 A;  2ISZ A;  3H3Z A;  3H3U A;  1XB4 A;  2JPB A;  3TDZ C;  5L3B A;  1KU9 A;  2VOP A;  1MJ9 A;  2A68 F;  5BQT A;  1D8J A;  4L9V A;  2GXB A;  2YU3 A;  1B1B A;  5LHI A;  2VON A;  1S7O A;  1FC3 A;  1LDK B;  2P7V B;  3REO A;  1G6N A;  2FU4 A;  2A5Y B;  3IKT A;  1R5H A;  2HEO A;  1ZLJ A;  2ZME B;  3W6J B;  2AXL A;  1XCV A;  3R4K A;  4Y13 A;  3RTR A;  1J59 A;  3P9K A;  4L0Y B;  5E1W A;  5FB2 A;  5LHG A;  4IHT A;  1MZB A;  4KN7 X;  4DNC A;  2LNB A;  2FMY A;  4KMU X;  4WK8 F;  1TBX A;  2F2E A;  3GYH X;  3MZY A;  5D5W B;  3N97 A;  1LJ9 A;  3PQJ A;  1T2K A;  3MCZ A;  4HX7 A;  4MHG A;  4UHT A;  3WTY C;  3MAJ A;  3I64 A;  1S7A A;  2DAO A;  5E8G A;  3NEU A;  3L09 A;  4UVC A;  1PDN C;  1IXS B;  4U88 A;  4PCQ A;  1FSH A;  3HRS A;  2P6T A;  2ZFW A;  4ZYD A;  4JK1 X;  1KQ8 A;  4OIR F;  1LQ1 A;  1IW7 F;  4MEY F;  1HSJ A;  4WWC A;  2QEN A;  3SFZ A;  1K79 A;  3D0S A;  3FM5 A;  4AIH A;  4G6Q A;  5J6X A;  1H9T A;  2DI3 A;  5JVT A;  2W25 A;  4OMZ A;  3JAM K;  2G7H A;  1WQ2 A;  2XGX A;  5FO5 A;  5DV5 A;  2QLZ A;  4CDG A;  1STZ A;  1J2X A;  2FA5 A;  1F5T A;  3ZMS A;  1HW2 A;  3RKX A;  1ZLK A;  1P2F A;  3GO5 A;  3I0T A;  4M71 A;  3EDP A;  2VN2 A;  1OYI A;  1LNW A;  5D6F A;  5BPI A;  3P9C A;  2LDU A;  2EWN A;  4ZYE A;  1B9M A;  3GUD A;  4M9X A;  3QU3 A;  1ZYR F;  1U3E M;  3I53 A;  1CF7 A;  1IN4 A;  4P5O A;  3M9A A;  1ZHF A;  1EV7 A;  2EV6 A;  3FMQ A;  2IA2 A;  2LF7 A;  4LB5 A;  5K5O A;  1P4X A;  3IRR A;  4PZJ A;  3ZMT A;  3WTS C;  1R7J A;  5A2Q Z;  2ZBK A;  1R36 A;  3DPT A;  2KIU A;  3MFK A;  3KE2 A;  3R60 A;  1XD7 A;  2QVO A;  3E6M A;  3BOQ A;  1R1T A;  2D1V A;  4P9U A;  3KEQ A;  1G3T A;  1CF7 B;  5FLX K;  4KN4 X;  2W85 A;  3CUQ C;  4A6E A;  5D4R A;  3EYI A;  3TO9 A;  4HOB A;  4QWQ A;  3KP2 A;  2P5V A;  4N0B A;  2Y75 A;  4H0E A;  4I98 B;  3HIF A;  4B09 A;  5DUI A;  1SD5 A;  4LGW A;  2F5C A;  4M9Z A;  2L4A A;  1JXS A;  5J8F A;  5TRD A;  1DPU A;  1P4W A;  4BHP A;  2ZJ2 A;  3CLO A;  1UHW A;  2VE9 A;  4ETS A;  2EV5 A;  1ZAR A;  3GWZ A;  4KNY A;  5HDG A;  2XAJ A;  3GW2 A;  4CO8 A;  5D4S A;  1F1Z A;  5ERI A;  2H27 A;  2IA1 A;  2M45 A;  2FSW A;  5E18 F;  4EGZ A;  1PUE E;  3MWM A;  2P5K A;  4GCV A;  5ED4 A;  4L18 B;  2W57 A;  3OV8 A;  2J5P A;  2COM A;  5BPD A;  1T98 A;  3HRU A;  3K9T A;  2BEO A;  2X0L A;  1IUY A;  1IRF A;  2FEZ A;  1ZRF A;  3IL2 A;  1UFM A;  2M30 A;  1UCR A;  3ECH A;  4AWX B;  4M6X A;  3CTA A;  2D2W A;  4HLY A;  3SZT A;  5LBQ A;  3JW4 A;  4A0X A;  3ML6 A;  1SFX A;  2G9W A;  3VB2 A;  1Z7U A;  4EJV A;  2EJR A;  2LF8 A;  4ESB A;  3T0Y A;  4A6D A;  2VC1 A;  1MD0 A;  1RIO H;  2K7L A;  5D5V B;  1BBY A;  4MEX F;  1Z6R A;  1LDD A;  1YYV A;  3ABU A;  2CGP A;  2GZW A;  4HLX A;  1I6X A;  2EFO A;  1JHF A;  2V6C A;  2HOE A;  1TQI A;  1O7F A;  1QGP A;  2DLL A;  1D3Y A;  1Z1D A;  2JTV A;  1P6R A;  3LFK A;  4N9H A;  2A6E F;  3BZ6 A;  3RI4 A;  4GGG A;  2CW0 F;  1KQ9 A;  3F8N A;  1R00 A;  1J75 A;  2OZU A;  1FZP B;  2O0Y A;  4FX0 A;  3BJO A;  4HZF A;  5L3E A;  2A6H F;  5JFR A;  2WWY A;  2HWV A;  2O3F A;  3PQK A;  1RNL A;  4YFK F;  3WTU C;  3FX3 A;  1B6A A;  4RB0 A;  2OU2 A;  1S8N A;  1S3J A;  1FX7 A;  5CYV A;  3KZZ A;  4Q4Z F;  4PDK A;  2L01 A;  2QZ8 A;  4ZZD A;  5E1X A;  5K5Q A;  2JZY A;  1FBQ A;  5BMZ A;  3I5U A;  4HF2 A;  1W5S A;  1LEA A;  3IRQ A;  2ESH A;  3ULQ B;  2UXX A;  4WXH A;  3J80 Z;  1SFE A;  2IRF G;  5LRS A;  3C7J A;  2B0L A;  5DEQ A;  1DDN A;  1ODD A;  2H6C A;  4I0B A;  1RUO A;  4S04 A;  2E7X A;  3ZQ7 A;  3FWE A;  2LKP A;  2PFB A;  1FYM A;  4AIJ A;  1G3Y A;  3D5L A;  3FHZ A;  3HOS A;  4N9I A;  2CSO A;  2K4J A;  2DPU A;  1FPQ A;  1Y0U A;  2VOO A;  4LJZ F;  3E5Q A;  4KDP A;  2PJP A;  2EFW A;  5HS9 A;  2UWM A;  4EGY A;  4Q5S F;  5H6R A;  2XRN A;  1D8K A;  3BJA A;  2Y0M A;  3TGN A;  4EV0 A;  5A2Q K;  2GWR A;  3V7C A;  2EV0 A;  3QOP A;  1LVA A;  3QU6 A;  2QM3 A;  3GEZ A;  3ZP5 A;  2K02 A;  2RVC A;  4EM0 B;  4HDU A;  1W7P D;  1EH7 A;  3ABT A;  3M8F A;  4Q48 A;  1F9N A;  4HAM A;  4HBL A;  2QQ9 A;  3I71 A;  3T5X A;  2DO7 A;  1R1U A;  3HHG A;  5L3D A;  2ETH A;  1F4K A;  4DQ2 A;  1DUX C;  4EJU A;  4A5M A;  5L3C A;  5FFZ A;  3Q9V A;  3LA7 A;  3K1P A;  1U2W A;  2FOK A;  2P5L C;  4ENN A;  4IRH A;  2DPD A;  5LGU A;  2VXZ A;  2FNA A;  3CUQ A;  4UXN A;  4I0A A;  4UV9 A;  1JGS A;  2CQK A;  5D8K B;  3EUH A;  2D1H A;  1SAX A;  2FQ3 A;  4G8X A;  1USS A;  2QYO A;  4U0V A;  2XAQ A;  2Y48 A;  2XKO A;  3QRF F;  4ENJ A;  3C3W A;  5K1Y A;  4UV8 A;  4BQA A;  2RV8 A;  2BGC A;  4M72 A;  4G94 A;  4LK1 F;  3CUQ B;  4R1H A;  3RPU A;  3LA2 A;  5E20 A;  5CLS A;  4AD9 A;  1BI1 A;  4OMY A;  4BXU A;  3M1E A;  2KIM A;  1OYY A;  4M74 A;  1MGT A;  5AIQ A;  3FZV A;  3J7A O;  3M7G A;  1WI9 A;  1K78 A;  2ZO4 A;  5ICE A;  2F5D A;  2UZK A;  1O3T A;  2PG4 A;  5FD5 A;  2HFH A;  4LD5 A;  1OPC A;  2EFP A;  3MZH A;  1ZG1 A;  3K2Z A;  3LA3 A;  4UVA A;  4GO1 A;  2HS5 A;  4HA8 A;  3OOP A;  4AVP A;  2DW4 A;  5FGM A;  1XMK A;  4LB6 B;  3EQL F;  4UNO A;  3BJ6 A;  2CFX A;  3I58 A;  2XAF A;  3KLO A;  1W5T A;  1K78 B;  5HLI A;  3WU1 B;  2KKO A;  2CO5 A;  2EB7 A;  1I1G A;  2YX7 A;  4MGR A;  3T8R A;  2P7C B;  5LEK A;  4D0P A;  2QQB A;  3ZN0 A;  5AON A;  2R7D A;  4XSX F;  4I02 A;  6PAX A;  1OYW A;  4EJW A;  2YX4 A;  3TO7 A;  3F72 A;  1RUN A;  4CXF A;  1J5Y A;  4HQE A;  4RGR A;  1ZH5 A;  2XKP A;  3BY6 A;  2RC4 A;  3R6S A;  1UB9 A;  3L7W A;  4A12 A;  4I7H A;  3GFJ A;  1UHM A;  2DU9 A;  3HSF A;  4NHJ A;  4EQQ A;  4RAZ A;  1H9G A;  2NAZ A;  2PEX A;  4GXO A;  4LFU A;  2PBI A;  4PGH A;  5F64 A;  4B8X A;  3KCC A;  1MDM A;  1DP7 P;  2MH2 A;  1KQ0 A;  1ZRE A;  3J80 K;  3QPT A;  1G3W A;  4G7Z F;  4WF2 A;  3E5U A;  5ICG A;  3O6B B;  4I01 A;  4KIF A;  1BOA A;  4KMF A;  3V7R A;  2HKO A;  3RPQ A;  2IT0 A;  1JHH A;  1BC8 C;  1IRG A;  3JTH A;  1MDM B;  3F8M A;  1QNT A;  1ZRD A;  1O3S A;  3GF2 A;  3HRM A;  4EJO A;  2VOD A;  3WTT C;  3GFI A;  3QP6 A;  1ONV A;  5AIP A;  1IN7 A;  1UST A;  1TTY A;  1FBS A;  3B02 A;  3FMR A;  3MEX A;  4S05 A;  1B9N A;  1R1V A;  4U7D A;  5DDG A;  1GXP A;  1BIB A;  2NYX A;  4ENK A;  2DTR A;  3E6B A;  2V1U A;  3RYR A;  3DKW A;  2Q8K A;  4PGG A;  1R23 A;  1MKM A;  4A0Y A;  3GZ5 A;  2VBY A;  3SQN A;  3DPL C;  1XSX A;  2W84 A;  2JT1 A;  2E7W A;  2UXN A;  2F5F A;  2ZNY A;  4FHT A;  3ROU A;  4AIK A;  4GYG A;  3GXO A;  3GLX A;  3R0A A;  3DFG A;  3L9F A;  1FYK A;  2ZNZ A;  4EM1 A;  2BBY A;  2GA1 A;  1RI7 A;  4L5I A;  4U7B A;  3U1D A;  5F1R A;  1O7L A;  1EH6 A;  3O3K A;  4HX4 A;  4MTE A;  1Z6T A;  3FF5 A;  5TJJ A;  2A69 F;  3DQV C;  5D8L B;  4O6J A;  4EM2 A;  2PMH A;  4OU0 A;  1XCB A;  4O3M A;  3IC7 A;  2L02 A;  3BDD A;  4IJA A;  5ICC A;  4JQF A;  3ISP A;  5HLH A;  2EFN A;  1FT9 A;  1LB2 A;  3KP3 A;  3G73 A;  4O5V A;  2R3S A;  3HOT A;  5HOO A;  4ZYH A;  2L4M A;  4U0Y A;  2NNY A;  1REP C;  1FY7 A;  5HDK A;  3KP6 A;  1G3S A;  4LK0 F;  5ILV A;  1XN7 A;  1MJA A;  1XSD A;  4UUV A;  2XHK A;  2OQG A;  2XAG A;  2HGC A;  2P6S A;  4A5N A;  5JI6 A;  2OZ6 A;  5CVI A;  1KYZ A;  2DT5 A;  1MJB A;  1Z05 A;  1ZN2 A;  1T6S A;  4YII A;  4YG2 F;  2OD5 A;  4A0Z A;  2ESN A;  2XAS A;  5L3F A;  3SZP A;  3WE3 A;  3ZMV A;  1I1S A;  2A61 A;  3V8L A;  3WGG A;  2VBW A;  2M1B A;  3DF8 A;  1W7P A;  3HSE A;  4KIG A;  5CVV A;  3LQQ A;  1O3Q A;  5ILS A;  2BYV E;  1E17 A;  2M8E A;  4EJT A;  3I4P A;  3R61 A;  3JTG A;  3TO6 A;  2DQL A;  2CYY A;  1TW2 A;  1LEB A;  2KJC A;  2J5O A;  4KFC A;  2IA0 A;  3TKY A;  2BE5 F;  3WGI A;  5EEH A;  3RDI A;  5HS7 A;  2YR2 A;  1YTY A;  1Z91 A;  3R0J A;  1W7P B;  2IW5 A;  1SFU A;  3WE2 A;  1OR7 A;  1YG2 A;  4KA4 A;  4NQW A;  5HLG A;  2V1D A;  1YS6 A;  1S6L A;  4G6D A;  3GZ6 A;  4HV6 A;  2X4H A;  4RGX A;  2FE3 A;  2FRH A;  1AOY A;  1YS7 A;  3IHU A;  4LLN A;  3SXY A;  1IAW A;  4RGS A;  1ZG5 A;  2DK8 A;  3ZMU A;  2GA2 A;  4E70 A;  3RYP A;  4F7Z A;  3F22 A;  3HYI A;  1YQA A;  2CWE A;  4R8H A;  1HKQ A;  1ON1 A;  2IPQ X;  2G7U A;  1XSV A;  3F6O A;  5CVR A;  4XBF A;  2BV6 A;  3QP5 A;  1I5Z A;  3G3Z A;  2DK5 A;  2HQR A;  2QBY A;  3HTS B;  2HYF A;  4M9S A;  1FYL A;  4U0W A;  2DBB A;  2V1X A;  3FXU A;  4G9Y A;  3WTV C;  3CJN A;  1YLF A;  1FLI A;  1NHA A;  3W6K B;  2PI0 A;  4YFN F;  1HST A;  1BC7 C;  1TQM A;  4KT5 C;  4G7H F;  2H09 A;  5E8I A;  1ZGJ A;  4JBA A;  2RGV A;  1A04 A;  2ZCW A;  1KA8 A;  2QBY B;  3SHF A;  4LMY A;  5H20 A;  2FXA A;  3KP5 A;  5KVR A;  1TNT A;  5DCF A;  3AAF A;  5CVJ A;  1BM9 A;  3HRT A;  3K69 A;  4BNC A;  2VT3 A;  1X3U A;  1J7K A;  5KK1 A;  3FM3 A;  4BHB A;  1SD7 A;  4L9J A;  3M8E A;  4UVB A;  2HDC A;  1BI3 A;  1KU7 A;  3MQ0 A;  4CYD A;  4P55 A;  3BPV A;  1FOK A;  2DQR A;  3U2R A;  3F8B A;  2W24 A;  1KU2 A;  3F23 A;  3U9G A;  3E3V A;  1QZZ A;  2NNN A;  3T1B A;  3KET A;  4HW0 A;  5DCM A;  1ZG3 A;  4Y15 A;  5LEJ A;  5BOX A;  3VFZ A;  4FT8 A;  1QZY A;  2OAZ A;  1FP1 D;  2P8T A;  5LGN A;  4IRI A;  4RAY A;  3IWF A;  2NRA C;  3LAP A;  3V8J A;  2Q0O A;  4M73 A;  5BS6 A;  3P7N A;  3QPH A;  3K1N A;  3BP8 A;  5DCM B;  1HQC A;  4ZZL A;  2ACJ A;  3CO7 C;  2FML A;  2XRO A;  1P92 A;  2JPC A;  3S2W A;  1FWZ A;  3F6V A;  1WKM A;  2RNJ A;  2A07 F;  1I27 A;  4M6Y A;  1U5T C;  3GFM A;  5H6Q A;  1HBX G;  4WXD A;  4NB5 A;  1CGP A;  1B4A A;  3IKV A;  3WOD F;  2R7F A;  1V4R A;  3DEU A;  2HR3 A;  3K0L A;  2QUF A;  4ESJ A;  2EFQ A;  3ZN1 A;  2QWW A;  3T8T A;  1XDS A;  5JHU A;  3I54 A;  3RKW A;  5K5R A;  3F8C A;  1E2X A;  2MH9 A;  4EMS A;  2EK5 A;  3BPX A;  4KIC A;  1XGM A;  1R22 A;  3HHH A;  1XGO A;  4HDV A;  1H0M A;  3Q9S A;  1Z9C A;  5CJ9 A;  3GFL A;  1QPM A;  4Z2Y A;  4HV5 A;  3KP4 A;  1BJA A;  1HKT A;  3RIR A;  1ON2 A;  1R58 A;  2OA4 A;  3RJP A;  3IWZ A;  3FMS A;  4OIQ F;  4BH9 A;  1O57 A;  2C6Y A;  2P4W A;  3GX4 X;  4BAY A;  2FBK A;  2OQR A;  2IJL A;  1O3R A;  2PLY A;  4IF4 A;  1OMI A;  5JR3 A;  4A2U A;  3EYY A;  4I09 A;  3TOB A;  2HTJ A;  2E1N A;  1L3L A;  2O61 A;  5FD6 A;  3PFI A;  2IVM A;  3CO6 C;  2F5E A;  1VTN C;  1HW5 A;  1U8R A;  4XLN F;  2Z33 A;  1FNN A;  1QQI A;  2ADU A;  3J81 Z;  5DD8 A;  3NRV A;  3V7S A;  2GQQ A;  4IRG A;  3P9I A;  3TOA A;  3FXR A;  4OOI A;  2KJB A;  1GVJ A;  4QLC U;  4L0Z B;  2KRF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...