3F72A

Crystal structure of the staphylococcus aureus pi258 cadc metal binding site 2 mutant
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
108
structure length
107
Chain Sequence
IFGYDEEKVNRIQGDLQTVDISGVSQILKAIADENRAKITYALCQDEELCVCDIANILGVTIANASHHLRTLYKQGVVNFRKGKLALYSLGGEAIRQIMMIALAHKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cadmium efflux system accessory protein
publication title Role of bound Zn(II) in the CadC Cd(II)/Pb(II)/Zn(II)-responsive repressor.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Dna binding protein, gene regulation
total genus 35
structure length 107
sequence length 108
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2008-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01022 HTH_5 Bacterial regulatory protein, arsR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3f72A00
4ESFA 5L3DA 5DUKA 3I4PA 1R7JA 2W85A 4FX4A 3GFMA 5LHIA 2O0YA 3G73A 3ABTA 3RTRA 1IN8A 4I7HA 2MLGA 3V7RA 4N9HA 3EYYA 2L4AA 2HKXA 2WV0A 5LBQA 2JPCA 2FNAA 4RB0A 2NNYA 5BOXA 3G3ZA 3QP5A 2X0LA 2CQKA 4S04A 4AVPA 1TLHB 1IRFA 3WGIA 2D45A 1GHCA 1XSVA 3ROUA 3L2CA 1D5VA 2W57A 4GYIA 4CGZA 2ESNA 4UVCA 4UV9A 3TOBA 3DEUA 2P5VA 2EK5A 3E97A 1KQ0A 3TO6A 5K5OA 3T5XA 3J80K 3ZMVA 1OYIA 3W6JB 2BYVE 3TGNA 3CLOA 1R00A 3TDZC 2RVCA 1SD4A 3RKXA 1QO0D 1XN7A 3K1PA 5CVJA 5HLHA 1ON2A 3BJOA 2IA0A 1ZYRF 3LA3A 2FBKA 1T39A 1HSTA 3I54A 4HF0A 4XBFA 1F4KA 1Z1DA 2V1DA 4KMUX 1R1TA 3IRRA 2OAZA 1F5TA 2QBYB 2P7CB 4YG2F 1FZPB 3RIRA 2L01A 3QU3A 3RYPA 5ED4A 4EVIA 2PLYA 3WE3A 3BWGA 4HA8A 3I0TA 3GZ6A 1W7PA 2VBZA 1T0FA 1H9TA 4ZZDA 2WC2A 1FP2A 5TRDA 1WSUA 2O61A 4L9NA 2HWVA 1TQIA 1FYMA 4KFCA 3GLXA 1E17A 1I1GA 2QQBA 2VBYA 3P9KA 3M7GA 4G94A 5EEGA 1W4MA 4AIHA 2VODA 3IC7A 2ZFWA 4U7DA 4RGRA 3KP5A 5D6FA 4HF2A 5FD5A 5HLIA 1XCBA 2PQ8A 3LWFA 1OPCA 4WWCA 2D1VA 5BMZA 4HDUA 4EQQA 2XAGA 2ZBKA 1RI7A 1I27A 2EWNA 1SD7A 2MH9A 1TTYA 1L3LA 5CJ9A 2ZMEA 1D8KA 1XMKA 5ILUA 5TJJA 1XGSA 4G7HF 2XGXA 3LFKA 3VFZA 4MTDA 4U88A 3ZMSA 4IRIA 3KP7A 4P5OA 2YX7A 1AOYA 2F5CA 2A07F 3SFZA 5HOOA 1Q1HA 2A61A 1REPC 1B1BA 3BROA 5A2QK 4JK1X 3WTWC 3WU1B 3CUQB 3H92A 2GZWA 3OOPA 1DPUA 4EGZA 2CFXA 4O3MA 5F6FA 1A04A 3FXRA 1EH8A 2VOPA 4OU0A 2FMYA 1FBUA 5H6QA 4ZYEA 1JE8A 2R7DA 1O7FA 1USTA 1J0RA 3EQLF 3GVAA 3MZHA 1MGTA 4IRGA 2KJBA 3BPVA 2MLKA 4GXOA 2IT0A 4G8XA 4XSXF 2IW5A 3BP8A 1RZ4A 3FM3A 1BIBA 2CGPA 1FNNA 5F1RA 5CVRA 1U2WA 3BPXA 4EM2A 1WRJA 3FMRA 2H27A 4G7OF 1XGMA 5K1YA 1F9NA 1XSDA 2ETHA 1ZGJA 1IN4A 4RB1A 3BJAA 4RGUA 2KIMA 5HS7A 3EDPA 2QWWA 1HW2A 1UB9A 2XUBA 4GGGA 2O8XA 4M9ZA 3TQNA 3BDDA 5LEJA 5ICFA 1HKQA 1G3WA 2EFNA 4P55A 2ISZA 1W7PD 3C7JA 4N9IA 1ZG3A 2YU3A 3PQKA 3K1MA 2OQRA 1MJAA 1TW3A 3M1EA 2CO5A 3K9TA 2JSCA 2EFOA 3S2WA 4AIKA 4ZYGA 4BAYA 2FU4A 3CO7C 1HW1A 3C1DA 3BY6A 3DPLC 2JRTA 1J7KA 4LG0B 4XLNF 2YR2A 4UHTA 1UCRA 2G7HA 1UHWA 1QZZA 5FFZA 1ONVA 1Z91A 1O3QA 3JAMK 3ZMUA 3E6BA 2P5KA 1J59A 4RS8A 5CLSA 1S3JA 1E2XA 3U1DA 2ACJA 2GA2A 3E5QA 3VB2A 1FT9A 4L9TA 3BZ6A 1KYZA 3GFLA 3V7CA 3M8FA 5HDNA 2DW4A 3HOSA 3EUHA 2IA2A 2PBIA 4KA4A 1WQ2A 1T2KA 4KUMA 3I59A 2FMLA 2WWYA 2L54A 1I1SA 4HV6A 5BQTA 3RYRA 2YSRA 5DD8A 3GUDA 4EV0A 4CXFA 2ZMEB 1KQ9A 2KRFA 1I5ZA 5LHGA 1JHFA 2V6CA 2RC4A 4YFKF 2A68F 5JFRA 3T0YA 2ZO4A 5DYMA 1MDMA 3LSTA 3RKYA 3FZVA 1SD6A 2CSOA 2LSOA 2HS5A 3N4MA 1ZRFA 3NEUA 3R0JA 1IUYA 2A6EF 2AS5F 1ODDA 3E6DA 4XLPF 5FLXZ 3HRTA 4UVAA 4YFXF 3GW2A 2FBHA 3GFJA 2YPRA 2QZ8A 3D5LA 1OMIA 4HQMA 3F21A 4NHJA 3I71A 4EJVA 4RAZA 4EJOA 4U7BA 1Z6RA 5HLGA 2OD5A 5DV5A 1PDNC 1T6SA 5AONA 1U78A 1U3EM 3H3ZA 3WODF 2TDXA 1FSHA 3FMQA 1OR7A 4CO8A 3GFIA 4KYWA 5LLQA 4FX0A 1S7AA 2V9VA 4U0WA 3F72A 4WX9A 3FF5A 3QRFF 1XDSA 2K7LA 3R0AA 2M8EA 3Q9VA 3E6CC 3DF8A 4CYDA 2NRAC 2P4WA 5LGUA 3MZYA 1B59A 4KIGA 1HXDA 2A5YB 3R61A 3FXUA 2FXAA 4WCGA 4A5NA 1GXPA 3HTSB 4AWXB 3MEXA 4RGSA 1P92A 3F8CA 3R4KA 5D5WB 5K5RA 2QM3A 6PAXA 3MQ0A 2J5PA 2QLZA 3CUQC 4M71A 2Z33A 4LGWA 4M6XA 2QQAA 2XHKA 3O3KA 1IXSB 5LEKA 2DFIA 1H9GA 1YQAA 2AXLA 2XAJA 2E7XA 1ZHFA 3VEPA 1ZREA 2KKOA 4MNUA 5D5VB 2OBPA 4WXHA 2OZ6A 3C3WA 3ELKA 2EA2A 4KIFA 2D2WA 1XD7A 1DP7P 3M8EA 4HX8A 1TNSA 2VT2A 5E1ZB 3RI4A 3F22A 5DUIA 4ETSA 3F6VA 4Y13A 2ESHA 3R60A 1R1UA 4P9FA 3HRUA 3RPQA 4Q4ZF 1H0MA 2GIVA 3ZN0A 4M74A 4L0ZB 3DP7A 2HFHA 4UV8A 2EJRA 2XASA 4HV5A 3MFKA 3I64A 4L5JA 1W5TA 1FSEA 2R3SA 1U5TA 4M9SA 2C6YA 5HDKA 1MZBA 3I59B 4MHGA 1LEAA 3O2PE 3MAJA 2LF8A 2CWEA 2EV0A 1K78B 4ENNA 3J81K 1BBYA 4KN7X 1B9MA 4LB6B 1SFEA 3E6MA 3GXOA 4IRHA 4HAMA 2DPUA 3IKVA 3ZQ7A 3ZP5A 3WTYC 4PCQA 1TQPA 4Y17A 1MDMB 3JTGA 2DK8A 4LD5A 4PGGA 1R5GA 3LQQA 1O3SA 2FRHA 3GWZA 5LGNA 1DPRA 3MCZA 4M6YA 5BS6A 2MA3A 1IXCA 3CDHA 4MQ9F 2GWRA 2YX4A 5FFXA 3KP2A 1FY7A 5IT9K 2DK5A 3GF2A 3IKTA 1BM9A 2O03A 4LLNA 2Y75A 1KU7A 5DD4A 4I09A 3WTTC 3I58A 4I01A 4WK8F 3HIFA 2DBBA 4I0AA 2PJPA 1RUNA 1TBXA 4CICA 1SD5A 4U0VA 5FGMA 2H6BA 2DTRA 2LF7A 2LKPA 3RJPA 5E17F 3Q5FA 3U2RA 4QWQA 4I02A 3L00A 1BI0A 3FXQA 4KT5C 5K5QA 3P9CA 2PI0A 4XSZF 2ZNYA 1UHMA 2GQQA 4U0YA 2XAQA 5ILSA 1LNWA 2JTVA 5L3EA 1U6GA 2FBIA 4IHTA 4Y15A 5D4SA 5JVTA 5DCMB 3T1BA 2HQRA 4NB5A 5E8IA 1P2FA 4O6JA 4CHUA 2IVMA 1SAXA 1U8RA 2VC1A 2QENA 4BNCA 1FPQA 2E1CA 3WGHA 3RKWA 1PUEE 4ZYHA 2FOKA 1IAWA 4HF1A 2DT5A 1KU9A 3GZ5A 3PFIA 3VODA 5FB2A 4YIIA 3ZMDA 2UZKA 1FYKA 1QBJA 1JGSA 2HTJA 2K4BA 1ON1A 3F8BA 4NQWA 1BIAA 3HUGA 5IT3A 5HDGA 3P9IA 2GAUA 1O7LA 1Z9CA 3J80Z 1CF7A 1XGNA 2M1BA 1G3TA 5JR3A 1VTNC 1Z7UA 1IF1A 1B9NA 4UVBA 2COMA 1TQMA 5J6XA 5F64A 4HLYA 1R1VA 2A6HF 2E7WA 3ECOA 1SFUA 2FA5A 4YFNF 4WXDA 4KIBA 2VBXA 1D8JA 3P7NA 5LHHA 1GVJA 2XRNA 2VXZA 3LAPA 1TW2A 1J75A 5E20A 1G6NA 4DQ2A 1FC3A 1XGOA 2WTEA 3ZMZA 2ZNZA 1P4AA 1P4XA 3QOPA 4WF2A 1ZLKA 4DNCA 1R36A 4UNOA 3F8MA 4ZH4F 3WTVC 2NAZA 3KEQA 1FBSA 2K86A 4OOIA 2IA1A 4O5VA 1IZ1A 3E5UA 3JW4A 2VE9A 4OIOF 4L5IA 4HX7A 1W7PB 4BHCA 2UWMA 3HRMA 1YW7A 5ERIA 1BI1A 3PQJA 2MD5A 3BOQA 4A2UA 1BI3A 2EFQA 3B02A 3HSFA 4PZJA 4RB2C 4S05A 2BV6A 5BPIA 3ML6A 4Q48A 1EH6A 2W25A 4BHPA 4BQAA 3QPTA 1ZARA 2PMUA 1MJ9A 4JQFA 3FHZA 2X4HA 2XV4S 3L09A 2OA4A 2V1UA 1RUOA 3KLOA 2HEOA 2FQ3A 4F7ZA 1P6RA 3SZTA 4EJWA 3IWFA 2XVCA 1I6XA 1LVAA 1O3RA 2QQ9A 1KU3A 3T8RA 1Y0UA 2IPQX 2QYOA 1KA8A 1GXQA 4N0BA 5A2QZ 2Z5UA 4K2EA 2FEZA 2B0LA 5D5XB 2E1NA 2EFPA 4LLGF 5CVUA 5KVRA 5H6RA 4GO1A 4G7ZF 2QUFA 1FOKA 2DPDA 4A5MA 1YLFA 4AIJA 1TNTA 4KDPA 4EMSA 5LGTA 4XRFA 4M9XA 4IHSA 1HBXG 2OZUA 2J5OA 3ERED 3F8FA 4UXNA 3NQOA 4KMFA 5LRRA 3QAHA 4OIRF 2IJLA 5D4RA 1DUXC 1RNLA 2MH2A 4D0PA 4GYGA 1PP8F 4OIQF 2GXGA 4MQVA 3KLNA 1J2XA 2KIUA 4UUVA 2HQNA 4IPAA 2RNJA 2XKOA 1LJ9A 2H09A 2W24A 1XMAA 1XCVA 4HW0A 3F3XA 3HOTA 1X3UA 1K7AA 1FWZA 5DEQA 3TDUC 2VT3A 4A0ZA 3CO6C 1YO5C 1HW5A 3HSEA 3C18A 1RIOH 2FE3A 1LDKB 1YIOA 4A12A 1KGSA 5L3BA 1ZRDA 2DQLA 3KE2A 4ESJA 2A3SA 2IP2A 2DLLA 3WU0A 1MKMA 2NYXA 1IXRC 3ECHA 3SXYA 2F2EA 4L9VA 2VONA 3R6SA 5CVIA 3WTSC 1QZYA 2XAHA 3JAMZ 3RDIA 3FX3A 3V7SA 1YS7A 1G3YA 3ZMTA 3WG9A 1DDNA 1S6LA 1O3TA 1L0OC 3F6OA 3U9GA 2F5DA 2FF4A 1YYVA 5L3FA 2V1XA 2FSWA 3V8LA 5FO5A 4I2OA 2ISYA 4A6DA 2M87A 1S7OA 5CYVA 1K79A 3TOAA 1IRGA 2W84A 4IXAA 1EH7A 2A69F 2VOOA 1KYWA 1ULYA 3QPHA 4L9JA 5ILVA 2P7VB 1T38A 4AD9A 3F8NA 2HDCA 2STTA 2PG4A 2GXBA 2RQPA 5D5UB 1LB2A 3E5XA 3QP6A 3KCCA 4LFUA 3DPTA 1ZLJA 2K02A 3CUOA 3K1NA 1U5TC 2O3FA 4EM1A 2L3DA 4HYEA 1O57A 1BC8C 1R5HA 2XROA 5D6EA 1XB4A 2FNPA 2M5WA 1HKSA 1PP7U 2F5FA 4LK0F 4LMYA 2KIFA 4H0EA 2Z3YA 4P9UA 2BEOA 4CDGA 2G7UA 3FM5A 3WE2A 1J9IA 3DV8A 5E1XA 4MTEA 4PGHA 4A0XA 1ZRCA 5JI6A 1B4AA 3LA2A 2DU9A 3FMSA 1G3SA 3GX4X 4OMZA 4LG0A 2MBFA 5KK1A 1QNTA 2EB7A 2DAOA 2RGVA 2HYFA 3RPUA 2EA4A 5AIQA 3WTZA 4LJZF 5DCFA 2VBWA 3KEOA 2P8TA 5AIPA 3GEZA 1IW7F 3ZPLA 2UXXA 1V4RA 3KP4A 2HZTA 5HS8A 1MD0A 2UXNA 3K69A 3V8KA 1YTYA 1T98A 1ZH5A 2OU2A 2STWA 3B73A 4ENJA 2Q0OA 1KU2A 4ENMA 3Q9SA 5CVVA 4HZFA 5HS9A 3TKYA 5BPDA 2RN7A 3D0SA 4ESBA 2LNBA 4R79A 2H6CA 2XIGA 5J8FA 3GYHX 4EJTA 3I5UA 3SZPA 4G6QA 2HOEA 2VN2A 1XDUA 3DFGA 2P5LC 1FBQA 1BN5A 2D1HA 4FT8A 4CZZA 4PDKA 1UFMA 3GO5A 3ZN1A 4TV7A 1P4WA 3DKWA 4HLXA 3AAFA 1SMYF 5JHUA 2JT1A 2NS0A 3EETA 1IN5A 2Q2EA 2ZCWA 4ZZLA 5EEHA 1BC7C 3KP3A 4EM0B 4RB3C 3T8TA 2JPBA 4A6EA 1KQ8A 5DDGA 2P6SA 2PN6A 4OINF 2QVOA 5FLXK 4Z2YA 1STZA 5J8CA 1OYWA 4KICA 2CYYA 2CG4A 4ASNA 1FLIA 2M45A 4IVNA 3V4GA 2L02A 3REOA 3FWEA 1W5SA 1LDJA 4G9YA 2BGCA 4A0YA 4E70A 4IF4A 3O6BB 4HOBA 4FHTA 4KNYA 2ZJ2A 4ON0A 3J81Z 4HQEA 1OKRA 4ZYDA 3F23A 1LDDA 3HYIA 2GA1A 2ADUA 1HKTA 1U5TB 1EV7A 3HHGA 4IJAA 4ENKA 2XKPA 2ELHA 3L9FA 2EV5A 5FD6A 4M73A 2Y48A 3SQNA 4RGXA 1FYLA 5D8LB 3WTXC 1AWCA 2EV6A 5D8KB 3K0LA 1F1ZA 5IT9Z 1SMTA 5L3GA 3OV8A 1C0WA 1BOAA 3W6KB 5E1WA 2PFBA 2HGCA 3JSPA 3K2ZA 4EJUA 1IN7A 2RKHA 2NNNA 2Q8KA 3CTAA 2KJCA 3HRSA 1ZG1A 4BH9A 2ZXJA 5ICGA 3WGGA 3I53A 1Z05A 1QQIA 1ZGAA 3DXJF 3H3UA 3NRVA 3IHUA 1YS6A 4B09A 5ICCA 2L4MA 2RDPA 2DO7A 3LAJA 4R8HA 3J7AO 1BI2A 2PEXA 5E18F 4LLLA 2Z9OA 2HKOA 1HSJA 1K6OA 1FX7A 3HTUA 5HVQC 3ABUA 2EFWA 1XSXA 1ZAOA 1YFHA 4P96A 3JSOA 2R7FA 3IRQA 2LDUA 3VOEA 1NHAA 1YG2A 1QPMA 2VE8A 3V8JA 2G9WA 5H20A 2Y0MA 1FP1D 1B6AA 4JBAA 2HTSA 4MEXF 5E8GA 2ZKZA 3TO7A 2O6GE 1K78A 3E3VA 3N97A 1BJAA 1HQCA 1S8NA 2MC3A 3L7WA 4EGYA 1ZG5A 1J5YA 2H94A 4GCVA 4LK1F 1G4DA 5LRSA 2VC0A 3TO9A 2QBYA 1ZN2A 1WWXA 1R58A 4BXUA 3EYIA 4I0BA 3LQRA 3CJNA 1R23A 4YIFA 1OYYA 5ICEA 3WTUC 1IN6A 1YW9A 2BBYA 2V79A 1LEBA 4OMYA 1V3FA 5L3CA 4RAYA 2PMHA 3ISPA 4MEYF 3KETA 2IRFG 1SFXA 4Q5SF 4BHBA 4L18B 3BJ6A 1WKMA 2K27A 3MWMA 4BYYA 1MJBA 2HYGD 3IWZA 2DQRA 3LA7A 1R22A 2F5EA 4QLCU 1CF7B 4HBLA 2CW0F 3SHFA 3QU6A 4HX4A 2XAFA 3KZZA 2P6TA 4L0YB 3HSRA 3HHHA 1LQ1A 4Q47A 2BE5F 2HR3A 3DQVC 4M72A 2Z99A 4HDVA 1CGPA 2JZYA 1USSA 3ULQB 1JXSA 3KFWX 3KP6A 1QGPA 4R1HA 2DI3A 2M30A 3KZYA 3JTHA 1YW8A 4B8XA 3COAC 3IL2A 4LB5A 1D3YA 1S29A 1Z6TA 4G6DA 3M9AA 2K4JA 2RV8A 1WI9A 4MGRA 4WXCA 4KN4X 4OIPF 2OQGA 1JHHA 3CUQA 4I98B 5DCMA
chains in the Genus database with same CATH superfamily
2KRHA 4ESFA 5L3DA 5DUKA 3I4PA 1R7JA 2HOTA 4ZDOA 3S3MA 1ACIA 2W85A 3AG1H 4FX4A 3K7AJ 2EZKA 3GFMA 2GLOA 5LHIA 2EH3A 2O0YA 4XLHA 3G73A 3ABTA 3RTRA 1VQPI 1IN8A 2DOEA 4I7HA 2X6YA 4RLFA 2MLGA 4A3KJ 2JVGA 3V7RA 4N9HA 1KONA 4EEFG 3EYYA 3GTJJ 3OSGA 5M5XJ 2L4AA 3DU6A 4HPQA 2HKXA 2WV0A 5LBQA 3FBIB 5JVGF 2JPCA 2LLKA 4DW6A 2FNAA 2K9NA 3JRDA 4IOAF 1POGA 3OL3A 4RB0A 2NNYA 1MMAA 5BOXA 3G3ZA 2V9KA 3HM5A 3QP5A 1G8XA 2X0LA 2CQKA 4S04A 3OIOA 2UV1A 4AVPA 2EIMH 1TLHB 1IRFA 3WGIA 2D45A 2VKDA 1XMXA 3BZKA 1GHCA 4XNFA 4DYRA 1RKTA 4XOPA 4E7SA 2L0KA 3CMYA 1XSVA 3ROUA 3L2CA 2E35A 2M9HA 1D5VA 2W57A 3BG3A 1YRNB 1MSEC 4GYIA 4CGZA 2ESNA 3CCVI 4UVCA 1MBHA 5F27A 4UV9A 3TOBA 3DEUA 4F55A 2P5VA 2EK5A 3E97A 1KQ0A 2W48A 3TO6A 3I3LA 5K5OA 3T5XA 3J80K 4MFEA 1GV2A 3RZOJ 3ZMVA 2E34A 2VKVA 1OYIA 3W6JB 2BYVE 3TGNA 1PUFB 1SFKA 3NAUA 2JK3A 1R00A 3CLOA 3TDZC 3ABKH 3RCOA 3ESWB 2RVCA 4F93B 1SD4A 2BVMA 4BE1A 3RKXA 1QO0D 1XN7A 2DOFA 3JCUC 3K1PA 5CVJA 2E36A 5HLHA 2BVLA 2MW8A 1ON2A 3BJOA 2HVRA 2IA0A 1ZYRF 3LA3A 1JUMA 4XIDA 2Y31A 2FBKA 1T39A 3QYFA 3CDLA 2OUMA 1HSTA 2BXYA 3I54A 4HF0A 4B48A 3GTPJ 1VQKI 4XBFA 1F4KA 1Z1DA 2V1DA 4KMUX 2DTZA 1R1TA 4DOZA 4HEA2 3IRRA 2OAZA 1F5TA 2JA7J 5J47A 1MIJA 4HNVA 2QBYB 2P7CB 5GADJ 1TZLA 1ETVA 4YG2F 1FZPB 2IAIA 3RIRA 3K4LA 2L01A 3QU3A 2PJRB 1NTCA 3RYPA 4EVIA 5ED4A 2PLYA 3WE3A 3BWGA 2KMUA 4BS9A 2L9RA 4HA8A 2E60A 4ZDPA 3I0TA 2LC2A 1W7PA 3GZ6A 2VBZA 4IZZA 1T0FA 5HODA 4B47A 4I6ZA 1H9TA 3CF5F 3TMOA 4ZZDA 2WC2A 1FP2A 4YIRX 3KZIC 5TRDA 1V5EA 1WSUA 2O61A 4H4KC 3WG7H 2VQCA 4L9NA 2HWVA 1TQIA 2E2IJ 1FYMA 2JWTA 4KFCA 3GLXA 1E17A 5CPRB 1QVTA 2M4KA 4D5CA 2QA4I 1I1GA 1T8IA 2QQBA 1MH4A 1DU0A 4ZDLA 2VBYA 3P9KA 2ID6A 4M3EA 3M7GA 4G94A 5EEGA 1DGRM 1W4MA 4AIHA 1YJNI 2VODA 2OTJI 3M4OJ 3IC7A 1X3ZB 2CUZA 2ZFWA 4U7DA 3DLAA 4RGRA 3KP5A 5D6FA 4HF2A 1D0ZA 5FD5A 4DJAA 5HLIA 3A4CA 1XCBA 4HNUA 2PQ8A 3LWFA 1OPCA 2EQRA 3OR1C 4WWCA 2D1VA 5BMZA 4HDUA 4RDUA 3JRAA 4EQQA 1R49A 2XAGA 2JVHA 2ZBKA 1RI7A 3K70C 1I27A 2EWNA 2EIKH 1SD7A 2MH9A 1TTYA 5FKLA 2MFZA 1WJBA 1L3LA 4YRVA 2ZFUA 5CJ9A 2ZMEA 1LKXA 1D8KA 3QWLA 4BKXA 3MN2A 4X1EA 2V7FA 1XMKA 2LRDA 2DOAA 2CU7A 1UJ8A 2PMZN 3LSIA 5ILUA 1MMGA 5TJJA 1XGSA 4G7HF 4XLFA 1FEXA 2XGXA 3PL8A 4M3GA 4XKVA 3LFKA 1K4TA 5FKNA 3VFZA 4RAFA 4MTDA 4U88A 3ZMSA 3HPHA 4IRIA 4A3EJ 3A0BC 3KP7A 1LFBA 2B9SA 2L7ZA 4QPOA 2CW8A 3H9QA 4CUGA 1ZK8A 2E71A 4P5OA 5IY5H 2H1LA 2YX7A 1AOYA 2ZJRF 2F5CA 1WJ5A 2OF7A 5KAIC 3SFZA 5HOOA 2A07F 1Q1HA 2A61A 3BR2A 1U8BA 3FXLA 2ELJA 1REPC 1B1BA 1H88C 3BROA 2VLAA 5A2QK 4BE2A 4JK1X 4G12A 3WTWC 3WU1B 2XC7A 2R5ZB 3CUQB 3H92A 2GZWA 2JUGA 3OOPA 1TT5B 1DPUA 5FKKA 2HXIA 4EGZA 1LE8A 4AYBN 2CFXA 2VASA 5LD2C 4O3MA 5F6FA 1A04A 3FXRA 2V9PA 1EH8A 2VOPA 1P7IA 4OU0A 2FMYA 1FBUA 2CJJA 5H6QA 4ZYEA 1JE8A 2R7DA 1AHDP 3JREA 1O7FA 1NK2P 1FOWA 1T33A 1USTA 2BZTA 2D5VA 3LSJA 4Y3OA 1J0RA 3EQLF 3BC8A 3GVAA 5GAHJ 2A05A 2BHYA 3LFUA 1MGTA 4IRGA 2KJBA 3BPVA 3MZHA 2MLKA 4GXOA 3DBHB 2IT0A 4G8XA 4XSXF 5K7ZA 2IW5A 3BP8A 1RZ4A 3MVPA 4ITVA 3FM3A 1BIBA 2CGPA 3S32A 3GMEA 2XAUA 4OAYA 1WPKA 1FNNA 3BTCA 5F1RA 5CVRA 5DTDA 2AHQA 3A2KA 4D7MA 2HXOA 1MSFC 1U2WA 2ID3A 3BPXA 4EM2A 1WRJA 2LY9A 3FMRA 2MYSA 4MLOA 4C9YA 2H27A 4G7OF 1XGMA 2I8DA 1SVLA 4N4OB 5K1YA 1F9NA 1X1PA 4L5EA 2GIZA 1XSDA 1SFOJ 2ETHA 1ZGJA 1IN4A 3BR1A 4C2TA 4XRSA 1IRXA 5IP6A 1R6RA 4RB1A 3BJAA 4RGUA 1MH3A 4C2MJ 2JUCA 2KIMA 2QKMB 5GAGJ 5HS7A 3EDPA 5F0FA 1A5JA 2QWWA 1HW2A 1UB9A 2XUBA 4Y4RA 2VJJA 2XF7A 4GGGA 2O8XA 4M9ZA 3TQNA 5M3FJ 2M7BA 3ZQIA 3JRFA 3BDDA 4FE4A 5LEJA 2E19A 5ICFA 1HKQA 1G3WA 3GZNB 3IH3A 2EFNA 5KAFC 4P55A 1VQ5I 3BTLA 1W7PD 2ISZA 3C7JA 4N9IA 5HLTA 1ZG3A 2YU3A 1QA6A 3PQKA 1WJFA 3ZRGA 3K1MA 4A3DJ 2OQRA 2LY2A 1MJAA 1TW3A 3M1EA 2EPFA 2ZJQF 1DU6A 2LVSA 2CO5A 3K9TA 3JRBA 3A0HC 2JSCA 2EFOA 3ZGKA 3S2WA 4E7KA 1TWFJ 5B1BH 4AIKA 4ZYGA 4BAYA 2FU4A 4PFPA 3CO7C 1HW1A 3C1DA 5EF6A 4GDFA 3BY6A 3OYCA 3DPLC 2AO9A 2KZVA 2JRTA 1MNMC 1J7KA 4LG0B 2LREA 4XLNF 2XPWA 2YR2A 4UHTA 4E7HA 1UCRA 5F0HA 2G7HA 4JX4A 1UHWA 1MBEA 1R71A 1QZZA 2K3PA 1WHUA 1Y0NA 5FFZA 1ONVA 1Z91A 1O3QA 3JAMK 2L5QA 3ZMUA 3E6BA 2P5KA 2JJ7A 1YJWI 1J59A 1MMNA 4GFBA 2HOSA 3KYDB 2M34A 4RS8A 5CLSA 1S3JA 4BBRJ 1E2XA 3U1DA 2VUMJ 1GT0C 2ACJA 2GA2A 4V2GA 2NOJB 3E5QA 3VB2A 1TWGJ 3WU2C 1FT9A 1OLTA 4L9TA 1QPIA 2DJNA 3BZ6A 1KYZA 1RETA 5M5YJ 3GFLA 5EDNA 3V7CA 5CQGA 3A1YA 3H9JA 3M8FA 5HDNA 2DW4A 3HOSA 1HDPA 3EUHA 1H89C 2IA2A 2PBIA 4KA4A 1WQ2A 1T2KA 4MIMA 2K40A 4KUMA 3I59A 1YX3A 2FMLA 2L54A 2WWYA 1I1SA 3HOZJ 2V26A 1ENHA 4HV6A 3VPRA 1OQYA 5BQTA 2KT0A 3RYRA 1UELB 2YSRA 3NWTA 5DD8A 2ZXIA 3GUDA 4EV0A 4CXFA 2ZMEB 4P1WA 4PSWA 1KQ9A 1S5LC 2KRFA 1W5CC 1I5ZA 1S72I 5LHGA 1BJZA 2FUG2 2QEXI 1JHFA 3HXLA 4A3GJ 2DMQA 3LOCA 5IYBJ 4HNTA 3DTKA 5FKOA 2FJ1A 1WJAA 2V6CA 1BR2A 2RC4A 3DKXA 1JTXA 4YFKF 3Q3SA 5DS9A 2VJ5A 2A68F 5JFRA 3T0YA 2ZO4A 5DYMA 2VKEA 3LSTA 1IV8A 1MDMA 3RKYA 1EJ9A 2JMWA 3FZVA 1SD6A 2CSOA 4CYCB 2LSOA 2HS5A 3N4MA 1ZRFA 2R7SA 3NEUA 2GBYA 4PSXA 1VQ4I 5B5EC 3R0JA 2V6EA 3C2HA 1IUYA 2A6EF 3CP2A 3F0CA 2CMPA 5C44J 1IG7A 1ODDA 3E6DA 4X0GA 2AS5F 4F92B 4XLPF 2IS6A 5FLXZ 3HRTA 4UVAA 3OYJA 1P9QC 3G1OA 4YFXF 3GW2A 3OY9A 2AQEA 1LE8B 2FBHA 1ORKA 3RQ4A 3CCMI 3GFJA 2M3AA 2ZSHB 4CA0A 2YPRA 3D5SC 5EG0A 2QZ8A 3D5LA 1OMIA 4HQMA 3F21A 4NHJA 3I71A 4EJVA 4PJLA 2LBFB 4RAZA 4EJOA 4QPQA 2DA3A 2K9MA 4U7BA 1WJDA 1Z6RA 1X4OA 5HLGA 3S1RJ 2OD5A 2E1MB 4OWRB 5DV5A 1PDNC 1T6SA 5AONA 5J1UA 1U78A 1JUSA 5CKTA 4E7LA 3MKWB 1U3EM 4XKBA 2MABA 2L7FP 3H3ZA 2DFEA 1D1AA 3WODF 2TDXA 4RM3A 1FSHA 3FMQA 1OR7A 4CO8A 5F08A 3GFIA 1Z3YA 3CCQI 4KYWA 4M3BA 5LLQA 4NDLA 2Q1ZB 4UUTA 2M4GA 2VJIA 4FX0A 1S7AA 4YEJA 4JOMA 3ZOBA 5IOYA 2V9VA 4U0WA 3OYEA 3F72A 1APLC 1XS9A 4WX9A 3FF5A 3CJQB 2HVQA 3QRFF 3CZ6A 1B72A 1XDSA 2K7LA 2L9SA 3R0AA 5FKMA 2M8EA 3Q9VA 3B6CA 3E6CC 3DF8A 4CH7A 1Y6IA 3S2DJ 3RQIA 4CYDA 2NRAC 2P4WA 5LGUA 3MZYA 1B59A 4KIGA 1HXDA 2A5YB 3R61A 3CF2A 3FXUA 2FXAA 2HNHA 4WCGA 4A5NA 1FTTA 1GXPA 5E3NA 1OCOH 3HTSB 4XKCA 4AWXB 3MEXA 4RGSA 1P92A 1X2MA 2EINH 4C3HJ 1IUFA 3F8CA 3TBIA 3ZQHA 3R4KA 4A69C 5D5WB 3TW7A 5K5RA 2QM3A 6PAXA 4AUXA 3CCEI 2X9DA 3MQ0A 2OV7A 2J5PA 2QLZA 3CUQC 3K4JA 4M71A 3TP3A 4LGWA 4XKWA 2Z33A 4M6XA 2QQAA 2DMNA 3VSLA 2XHKA 3O3KA 1IXSB 5LEKA 2DFIA 4J19A 2KHMA 1H9GA 1YQAA 2AXLA 3HG9A 2XAJA 2ZJPF 2E7XA 1ZHFA 3VEPA 4C30A 1ZREA 2KKOA 4MNUA 4E7ZA 4IEJA 1MNDA 3QODA 5D5VB 1OCCH 3LSRA 3ERMA 2WBMA 1OCZH 2EIJH 2OBPA 2X6WA 3L2UA 1R4MB 4XLAA 1Y8QB 2B7EA 2NVQJ 4WXHA 2OZ6A 4RLQA 1HOMA 3C3WA 3ELKA 3S1MJ 2EA2A 3S1QJ 2DMTA 2JSPA 4KIFA 2L2OA 1N75A 2NS7A 1K83J 2D2WA 1XD7A 1DP7P 5FRNA 5EGOB 4W1UA 4FQGA 3M8EA 1HCRA 3WHBA 1A35A 4X6AJ 3SYTA 2Y9ZA 2BOLA 3HOUJ 1DP3A 4HX8A 1TNSA 2IGNA 1TL8A 2VT2A 5E1ZB 3RI4A 3M07A 3F22A 4CCLA 5DUIA 4ETSA 3F6VA 3E7LA 3CCSI 2HDDA 4Y13A 3CD6I 1V55H 5B3SH 2XSDC 2ESHA 3OIPA 3R60A 1OCTC 1R1UA 4P9FA 2KL4A 2DN0A 3HRUA 3RPQA 4Q4ZF 4FTHA 1H0MA 2GIVA 3CDIA 3ZN0A 3FK6A 4M74A 4FETA 3PNTA 3HOWJ 4L0ZB 3DP7A 1VI0A 2HFHA 3HJEA 4UV8A 2EJRA 2NVTJ 2XASA 4HV5A 1UAAA 2X1EA 3OMYA 1J09A 4FASD 3MFKA 5EEAA 3I64A 4L5JA 1W5TA 1FSEA 3BR6A 2R3SA 3HKZA 1U5TA 3HB9A 4M9SA 2C6YA 4MFDA 5HDKA 4Y52J 4HRIA 3CC2I 1MZBA 3ASOH 3I59B 2A6TA 3Q0VA 4MHGA 1LEAA 3MKLA 3O2PE 1UG0A 3MAJA 2LF8A 1IJWC 4MO7A 2CWEA 2R92J 1E3HA 3BG9A 2EV0A 1K78B 3SDGA 5E3MA 1ITYA 1QHHD 3OS1A 4ENNA 3LSKA 3J81K 2DMPA 1BBYA 4KN7X 1B9MA 4LB6B 1SFEA 1FOYA 3E6MA 4CSWA 3GXOA 5GTIC 2HQAA 2FOWA 4IRHA 4HAMA 4KITB 2DPUA 3IKVA 3ZQ7A 3ZP5A 5GP9A 3D5RC 3FDYA 3WTYC 4PCQA 1TQPA 4Y17A 1MBFA 3TP0A 3S15J 2FD5A 4PJMA 1MDMB 1EA3A 1WGXA 2DK8A 4LD5A 4PGGA 4D9JA 3JTGA 4BEHA 1R5GA 3LQQA 1W36D 1O3SA 2FRHA 3GWZA 2CUJA 3Q0UA 5LGNA 2JQ7A 1DPRA 3MCZA 4JX6A 4M6YA 5BS6A 2MA3A 4M6VA 1FMWA 2CUEA 1IXCA 2X51A 1RESA 3CDHA 4MQ9F 3DCFA 2GWRA 2YX4A 5FFXA 3KP2A 1E3PA 1FY7A 5IT9K 3C2GA 3FXKA 1NG7A 2DK5A 3GF2A 2K85A 1JKQC 2X85A 3IKTA 2WAQA 3EUKL 1BM9A 4V2FA 3U1KA 2O03A 4LLNA 1YHQI 2AXTC 2BXZA 2Y75A 2NOGA 2K9LA 5J40A 3H9GA 3PUFA 1Z67A 4I09A 5DD4A 5J1YA 2W82A 1KU7A 3WTTC 1XTAA 3LL7A 3I58A 3OWTA 4I01A 3I4NJ 2XDVA 1RKWA 4WK8F 3HIFA 2DBBA 3ZR8X 4I0AA 1FJLA 2PJPA 3FKJA 1RUNA 1TBXA 4CICA 1SVOA 3ABMH 4C3IJ 1W1WE 1YE9A 3W3CA 1ZELA 4XMYA 3LSPA 1JJ6C 1SD5A 2WB1N 2N8GA 4U0VA 3DTIA 5FGMA 2W00A 1Y39A 2H6BA 1MMSA 2EILH 1YITI 2DTRA 2LF7A 1TWAJ 2LKPA 3BLYA 3RJPA 3L2WA 2E2JJ 5E17F 2XB0X 3A02A 1JGGA 3Q5FA 3U2RA 4QWQA 4I02A 1BA5A 4IHVA 2LR8A 3L00A 2OJED 1K61A 1BI0A 1SVMA 1WH5A 3GCMA 4A3IJ 3FXQA 2ZMEC 1VFCA 4KT5C 2EZLA 4BXFA 5K5QA 1R9TJ 3GLLA 3P9CA 5EZHA 2PI0A 4XSZF 3OIQA 3W6VA 4A3BJ 1IC8A 2ZNYA 1UHMA 1A31A 1MBGA 2GQQA 4UUSA 2EZIA 2XAQA 4U0YA 2R7RA 5ILSA 1LNWA 3QYEA 1VQ8I 3UNGC 3IAM2 2JTVA 1E3OC 2BW3B 3L2VA 1BL0A 5L3EA 5GPCA 1U6GA 4GRIA 2FBIA 4IHTA 4XONA 3AG4H 4Y15A 3FK7A 5D4SA 3VWBA 5FROA 5JVTA 5DCMB 3T1BA 3CESA 2HQRA 1Y56A 3ZXSA 4NB5A 4XK4A 2LG4A 5E8IA 1BR1A 1P2FA 3M3YJ 4O6JA 4CHUA 2H1KA 3DTEA 2IVMA 2GM4A 1UZCA 3G2BA 1U8RA 1SAXA 2VC1A 2QENA 3M1CA 1HDDC 3P5JA 4LITA 4BNCA 1FPQA 1LUJB 1TWHJ 3I55I 2E1CA 2JA5J 3WGHA 2MSYA 3RKWA 1PUEE 2IGKA 2ECBA 4ZYHA 2DT6A 2FOKA 1IAWA 4HF1A 1S9HA 1IGNA 3OSFA 2DT5A 1IDZA 1KU9A 3GZ5A 3PFIA 3VODA 1X1CA 2IGOA 5FB2A 1I6HJ 1G59A 2X6XA 4YIIA 4DIQA 3IP4B 4BU2A 3ZMDA 1I3AA 3QOEA 2UZKA 1FYKA 2HPIA 3BR5A 1QBJA 1JGSA 2HTJA 3MMYB 2K4BA 3X2QH 4BACA 1AU7A 4IX7A 2E1MC 4BGDA 3JRIA 3GTQJ 1ON1A 4DZPA 3ASNH 3F8BA 3HBLA 5B1AH 4NQWA 2R7TA 1BIAA 3HUGA 5IT3A 5HDGA 2QCOA 3P9IA 2GAUA 1O7LA 1Z9CA 1XG1A 2UUZA 1AKHA 3J80Z 3G4SI 1QVUA 1CF7A 1XGNA 2M1BA 1G3TA 5E3OA 1FTZA 4ZTFA 5JR3A 1VTNC 2QQ8A 4W97A 1Z7UA 1IF1A 2DA4A 1B9NA 2R4GA 4UVBA 3BR0A 2KQRA 3HOXJ 2COMA 3OYKA 3GTGJ 3PSIA 1TQMA 5J6XA 5F64A 4HLYA 1WCMJ 1R1VA 2A6HF 1X1DA 2HZDA 4NC6A 1ZGWA 2E7WA 3ECOA 1SFUA 2FA5A 3VYRB 4YFNF 4HG2A 4WXDA 2CH0A 2KRCA 4KIBA 2VBXA 2H8RA 1GUUA 2PX9A 4F3QA 2K3FA 3ZQGA 3P7NA 1D8JA 1XC5A 1Y1VJ 5GTHC 5IPAA 5LHHA 2QSFX 2W1OA 2FQ4A 1GVJA 2CUFA 2GOXB 3IH4A 2XRNA 1X19A 4BXXJ 4AVZA 2VXZA 2KIQA 3LAPA 2CQNA 1TW2A 1J75A 5E20A 1G6NA 4DQ2A 1GV5A 1ETYA 1FC3A 2V1NA 3OYDA 2QKLB 5TGTA 1XGOA 2WTEA 3ZMZA 2ZNZA 1P4AA 2LKXA 4BJ6C 2X6OA 3GTLJ 3HOVJ 1P4XA 3QOPA 4IQ4A 2QSGX 3K6GA 4WF2A 3FHNA 5B66C 4A3FJ 4BL0B 2XPUA 1ZLKA 2E5NA 3BT9A 4DNCA 1R36A 4UNOA 4LIUA 4A93J 3KX2A 3F8MA 4ZH4F 4NC7A 3WTVC 3LSMA 2NAZA 5CQEA 3KEQA 2ZB9A 1FBSA 2K86A 4OOIA 2IA1A 3RPUD 4O5VA 1IZ1A 3E5UA 2X1CA 3JW4A 2DDBA 2R7QA 1FOXA 1RPWA 2Z2SB 3BG6A 2VE9A 4BEHB 4IO9F 4L5IA 3SEQA 4HX7A 4OIOF 1W7PB 1JTYA 4PFOA 4BHCA 4RBOA 2UWMA 2OPTA 3HRMA 1X1AA 3PM1A 3W2VA 5KNLA 4PJNA 1EF4A 1YW7A 5ERIA 1BI1A 3PQJA 1NG6A 2MD5A 2CQQA 3BOQA 3CC7I 4A2UA 1BI3A 2EFQA 3FXJA 1MMDA 3K4CA 2DMUA 3AKZA 3W2AA 3B02A 3CQZJ 3HSFA 3FKIJ 3PIOF 3PIPF 4PZJA 4U87A 4RB2C 4S05A 3K70D 2BV6A 5BPIA 3ML6A 4Q48A 2LMDA 1EH6A 2W25A 4BHPA 4BDZA 1YIJI 4BQAA 2H8WA 3ABLH 3QPTA 5TISC 3G1MA 1ZARA 2PMUA 2K5CA 5K7HA 1MJ9A 4JQFA 3FHZA 1OJLA 2X4HA 2XV4S 3L09A 2OA4A 4AU7A 4II3A 2TRTA 1OISA 1YRNA 3ZQQA 2V1UA 2CV0A 4BBSJ 2K9SA 4AC0A 1IV6A 1Z3XA 3KLOA 1RUOA 4C2UA 2HEOA 2MG4A 3I4MJ 1X58A 2FQ3A 2KDOA 4F7ZA 4HSRA 3S14J 4OAZA 1P6RA 4C3JJ 3SZTA 4EJWA 2MGQA 3IWFA 2XVCA 2F4OB 3DPUA 1I6XA 1LVAA 1O3RA 2QQ9A 1T95A 4ZTJA 5J4VA 1KU3A 3HL2A 2QGUA 4XR6A 1PUFA 3T8RA 1G2HA 1JJ8C 1Y0UA 2CFOA 2IPQX 4JP0A 3MD2A 2WAEA 3OYLA 3J7ZI 2QYOA 1KA8A 1GXQA 4N0BA 5A2QZ 2Z5UA 4K2EA 2FEZA 1N25A 4JYKA 4FISA 3CCUI 2B0LA 5D5XB 2E1NA 3VYSB 2EFPA 4LLGF 2M7AA 3TEDA 3KYCB 1RR7A 2KFDA 5CVUA 5KVRA 2I5UA 4GO1A 5H6RA 4DBRA 3FIWA 4G7ZF 3AG3H 2QUFA 1FOKA 1F43A 2DPDA 1YLFA 4A5MA 4AIJA 1TNTA 4I99C 4EMSA 4KDPA 5LGTA 4NNJA 2BY3A 4XRFA 4M9XA 1VQMI 4IHSA 2PJRA 1ETXA 1HBXG 2OZUA 2J5OA 2O9LA 2DA1A 2XGEA 4XORA 2LFBA 3WHCA 2WA0A 3ERED 1NH3A 2E5ZA 3F8FA 4UXNA 2F48A 3NQOA 4KMFA 2F4MB 3BR3A 3AG2H 1MBKA 2OCCH 3K4MA 5LRRA 2BHZA 3QAHA 2DCEA 3A03A 4OIRF 5J1RA 2IJLA 5D4RA 1ZR2A 1DUXC 2ZXHA 1RNLA 3JRHA 2DFHA 2LH9A 3JRCA 2MH2A 2WV1A 4GYGA 4D0PA 3OYNA 1PP8F 4OIQF 2GXGA 2NVYJ 1UG2A 1D0YA 4IQJA 1VQ7I 4MQVA 2IEKA 3KLNA 1J2XA 2KIUA 3J7AY 2CQ7A 2RAEA 4XN0A 4UUVA 2HQNA 2DODA 4IPAA 2RNJA 1XX5A 1GLNA 3EPZA 1SAUA 2DYRH 2XKOA 3BQYA 4NQWB 2DA7A 3O8GA 1LJ9A 3HC7A 2VB6A 1AKHB 3FBNB 3A01A 1IRZA 3OYHA 1OR7C 2H09A 2W24A 3OYBA 1XMAA 1XCVA 3U21A 1A6QA 2VIXA 3GTOJ 1WJEA 4HW0A 3RSNA 3F3XA 3ZQCA 5JLXA 1W0UA 3HOTA 1X3UA 2XF6A 3S16J 1K7AA 1FWZA 5DEQA 2XRLA 1ZKGA 3CCYA 3TDUC 2VT3A 1QRYA 5C4JJ 3LSHA 4A0ZA 2KP6A 3CO6C 2PMZA 3V42A 1YO5C 4XL9A 4ZYAA 1HW5A 3HSEA 3O8HA 3C18A 4CZCA 1RIOH 2FE3A 2Y69H 2P81A 4A3CJ 4KJZA 1LDKB 2L9NA 1YIOA 4A12A 1KGSA 3CCRI 5L3BA 1AA7A 3ZQLA 1ZRDA 2XGCA 1OCPA 3CMEI 4XM3A 2IBDA 2DQLA 3CMAI 9ANTA 4RA2A 2R7UA 1V5FA 3KE2A 4IHYA 4BUPA 2Z1DA 3BZCA 4ESJA 2YS9A 2A3SA 2IP2A 2K9QA 2DLLA 2CS3A 3C2BA 4E7JA 1K4SA 2KDZA 3PJRA 3WU0A 4YELA 4BQOA 1MKMA 2NYXA 3VSKA 2HDWA 2R5ZA 3H1CA 4V19K 1IXRC 3ECHA 3SXYA 5J4YA 2DJIA 4Y7NJ 2F2EA 5EJCA 1F36A 4L9VA 2VONA 3R6SA 4AYBA 5CVIA 3WTSC 2Y2ZA 1QZYA 2XAHA 2P0WA 3JAMZ 5KHDA 3RDIA 2XB5A 4PJJA 1VF9A 2HPMA 2L7MP 2JRMA 3FX3A 5FLVA 3V7SA 2WY7Q 3LNQA 4IKFA 1ETQA 1YS7A 1I39A 1G3YA 1LVKA 4B1RA 3ZMTA 3WG9A 1DDNA 4AIDA 1MNEA 1S6LA 1DQUA 2WY8Q 3HEFA 2BY1A 1O3TA 1L0OC 1U0JA 4QIWN 3F6OA 3U9GA 2F5DA 4F52A 2ICWG 1HF0A 1R5ID 2KPMA 2FF4A 3AL0B 1YYVA 5L3FA 2VQGA 2V1XA 2FSWA 3FXOA 3V8LA 3KIOA 5FO5A 4I2OA 2ISYA 4A6DA 2M87A 4B3AA 3OS0A 3AFHA 1S7OA 5EYRA 5CYVA 3K2AA 1V54H 3TOAA 1K79A 3MKYB 3RKQA 2KZGA 1IRGA 4CCNA 5F0CA 5KCMA 2W84A 4ABZA 4IXAA 1EH7A 2A5WA 3OOUA 2A69F 4XQFA 2M2EA 2VOOA 1KYWA 4KISA 3MKZA 1ULYA 1W0TA 1V5GA 3QPHA 1VQ6I 4L9JA 5ILVA 2P7VB 1T38A 4AD9A 3F8NA 1Y8RB 2HDCA 1D1CA 2STTA 2PG4A 2VI6A 2MD0A 3S8PA 2GXBA 1EKEA 2RQPA 1B8IA 5D5UB 3MZ8A 1LB2A 1U9NA 2LTPA 3E5XA 1JKOC 3VYUB 1D1BA 4M3DA 4D5FA 3QP6A 3ONQA 3KCCA 2RQQA 4LFUA 1ZTRA 5F04A 3DPTA 3HOYJ 2IGMA 5M5WJ 1ZLJA 2K02A 3CUOA 3K1NA 1U5TC 1WI3A 2O3FA 2L3DA 4HYEA 4EM1A 1O57A 1BC8C 2IS4A 1R5HA 2DXIA 2XROA 2M0MA 2R7WA 5D6EA 2BY0A 1XB4A 1BR4A 2FNPA 2M5WA 2OCEA 1HKSA 4B4CA 5E3LA 1PP7U 3KEYA 2F5FA 3BCAA 1Z21A 4LK0F 1JT6A 4LMYA 1BW6A 2KIFA 2X48A 4H0EA 2DDAA 3DWLE 2Z3YA 4P9UA 2BEOA 4CDGA 2G7UA 2IS1A 1PYVA 2HI3A 2ME6A 4BJTA 3G71I 3TW6A 4RMNA 3FM5A 3H35A 3WE2A 2DT7B 1J9IA 1VZ0A 3DV8A 3RZDJ 4BJ5C 5E1XA 1MW7A 5HNHA 2R7XA 4MTEA 4PGHA 4A0XA 1ZRCA 5JI6A 1B4AA 3LA2A 2NVXJ 2DU9A 1BOBA 1JKRC 1IDYA 1G3SA 3DBRB 3FMSA 4OMZA 3GX4X 5FJ8J 3B6AA 1GVDA 1T0FC 4DYQA 4LG0A 2VPRA 2MBFA 3H0DA 2EZHA 3L2RA 1RC9A 5KK1A 1QNTA 2EB7A 2DAOA 5EG0B 2JA8J 4UB8C 4II2A 2RGVA 2HYFA 1I3QJ 3RPUA 2R7VA 1LFPA 2EA4A 5AIQA 1JT0A 1ERDA 1SEUA 3WTZA 4CCJA 3K4NA 3PNVA 4IOCF 3J7YJ 4LJZF 5IOZA 1SC7A 5DCFA 3S17J 2VBWA 2W4SA 5JHFA 3BTIA 3NARA 3KEOA 4IHXA 1VQNI 2P8TA 1HC8A 2CV1A 1LPQA 5AIPA 3GEZA 1IW7F 1T56A 3ZPLA 4LIVA 5FRMA 2UXXA 1V4RA 3KP4A 2HZTA 4B44A 5HS8A 1MD0A 2F6CA 2UXNA 3K69A 2HVSA 1O4XA 3V8KA 4XLEA 1YTYA 1T98A 1NK3P 1ZH5A 3W2WA 2OU2A 2STWA 4G6TB 3B73A 4ENJA 2Q0OA 4KT6A 1KU2A 3N05A 4ENMA 1TP4A 2VXDA 3Q9SA 3A01B 5CVVA 1GDTA 4HZFA 5HS9A 1VQ9I 3TKYA 3K10A 5BPDA 2RN7A 3D0SA 4ESBA 2E1OA 2LNBA 4R79A 3KYLA 2H6CA 3UKGA 3H5NA 2XIGA 1KZHA 1B72B 1DGWY 2OTLI 2R5YA 2VQHA 1WZ2A 5DM6F 5J8FA 4BDYA 3OS2A 3DLLF 2W7NA 1FIAA 3GYHX 4EJTA 1K6YA 2ZC2A 3I5UA 1S7EA 2M0CA 3SZPA 3OYFA 4G6QA 2HOEA 2VN2A 2DA6A 1XDUA 4RAGA 3DFGA 1MBJA 3PNYA 4B43A 1Z77A 2RREA 4CYCA 2P5LC 1D5YA 1M1EB 1LFUP 2R7ZJ 1FBQA 1BN5A 3OYAA 2D1HA 4FT8A 2OC6A 4CZZA 4PDKA 3PO2J 1WH7A 1UFMA 2DA5A 3GO5A 3BCBA 2LP0A 3ZN1A 1VQLI 4TV7A 3E0JB 2G0EA 1P4WA 3DKWA 1X2NA 4HLXA 3AAFA 1SMYF 5JHUA 5IP7J 2JT1A 2NS0A 2YUSA 3EETA 3HPGA 3QPLA 4D1QA 1IN5A 2VJ4A 2Q2EA 3HZJA 2ZCWA 1UHSA 4ZZLA 5EZGA 1PVEA 2O5RA 1N77A 5EEHA 2YU9J 2CW7A 2QSHX 3TL4X 2VL8A 1BC7C 4PJ0C 3KP3A 4EM0B 3FISA 3Q0WA 4RB3C 1N78A 1IO2A 3SDBA 3T8TA 2LBFA 2JPBA 4A6EA 2XSJC 1KQ8A 5DDGA 2P6SA 2PN6A 3HGGA 2QVOA 2TCTA 2X1DA 3OR2C 4OINF 5FLXK 4Z2YA 3QQAA 2XGDA 3FXMA 1STZA 5J8CA 1OYWA 3GBGA 4KICA 2CYYA 3H3VK 2CG4A 4ASNA 1FLIA 2M45A 4DGWB 3S3OA 4J01A 3DBLB 4IVNA 4N4NB 3V4GA 2ME0A 4B3XA 1P7JA 2VKHA 2L02A 2Y0SA 3LMMA 3REOA 2ECCA 3FWEA 1W5SA 1LDJA 4G9YA 3BQZA 4A3LJ 4RM2A 2BGCA 4A0YA 4E70A 2COBA 4IF4A 2FX0A 3O6BB 4HOBA 4IHWA 4FHTA 4CCOA 3S3NA 4KNYA 4XN3A 4E7IA 2ZJ2A 2LD5A 4FE7A 4XRSG 4ON0A 2HOAA 2JN6A 4XICA 1I50J 3J81Z 1ZR4A 3E1SA 1OKRA 4HQEA 2CV2A 4ZYDA 1R4NB 2O8KA 1BW5A 3F23A 1LDDA 3CP8A 2HYJA 3HYIA 1JI8A 2LKSA 2GA1A 2Z16A 2HU9A 4NBQA 2ADUA 5C3EJ 1Q1VA 4BY1J 1U5TB 3HKZN 1HKTA 3S1NJ 1EV7A 1FIPA 3HHGA 4IJAA 4M3FA 2NXNB 1B8IB 4ENKA 2XKPA 2I10A 5BNGA 1RR8C 5FLMJ 2ELHA 3L9FA 2EV5A 4QSHA 4F91B 5FD6A 4I76A 4M73A 1YX5A 5LFAA 4CCKA 5F1JA 1VQOI 5H2FC 2Y48A 3SQNA 2LYCA 4RGXA 1FYLA 1ETWA 3ZCOA 2DFFA 2B63J 5D8LB 3WTXC 1AWCA 2EV6A 4DZJA 5D8KB 3K0LA 1F1ZA 3H5RA 2VPLA 2QF7A 3SZGA 2M8GX 1SMTA 3CCLI 5IT9Z 3L1PA 1X4PA 5L3GA 3OV8A 4JX5A 4XLCA 3JRGA 2RNGA 1X1BA 4XOTA 1BOAA 4E4HA 1C0WA 3W6KB 3D1NI 2F4IA 5E1WA 2PFBA 3H5AA 1TWCJ 4LG3A 2HGCA 3JSPA 3SEZA 4DYCA 3HGYA 1ETKA 3VDXA 4ANJA 1ETOA 2ZXWH 4A3JJ 3K2ZA 1IN7A 2RKHA 4EJUA 2NNNA 1YJ9I 5J3LA 2Q8KA 3CTAA 1PJRA 2KJCA 2L9VA 3H36A 5IP9J 3HRSA 2O7OA 1ZG1A 4BH9A 2WAQN 2ZXJA 5ICGA 3L2QA 3WGGA 5EGOA 3I53A 1Z05A 3AL0C 4QTRA 1E0EA 1QQIA 1RRJA 2JA2A 4ZJZA 4Y33A 1ZGAA 3DXJF 3VYTB 3SJMA 3H3UA 3LSGA 1U9OA 4HSTA 3NRVA 3IHUA 1A36A 3ZQFA 1TT0A 1YS6A 4B09A 5ICCA 3PSFA 1Z7LA 2L4MA 2RDPA 2DO7A 3LAJA 4R8HA 5E79C 1FMVA 3J7AO 1BI2A 2PEXA 5E18F 1A6IA 1SANA 2Y30A 4LLLA 2Z9OA 2HKOA 1HSJA 1K6OA 1FX7A 3HTUA 4AM3A 5HVQC 5C4XJ 2DA2A 4S0HB 4D7NA 3ABUA 4UY8I 2EFWA 1XSXA 3EUHC 1ZAOA 2ELKA 4UB6C 1YFHA 3GTMJ 4P96A 3JSOA 2R7FA 3M8JA 3IRQA 2LDUA 2GXAA 3VOEA 1NHAA 1YG2A 1H8AC 1QPMA 2VE8A 3DEEA 2G9WA 3V8JA 3QYBA 5H20A 2Y0MA 1D0XA 1FP1D 2CRGA 1JKPC 1B6AA 4JBAA 2HTSA 1Z0XA 2NS8A 2IXSA 4MEXF 3DU5A 5E8GA 2ZKZA 3TO7A 2O6GE 3G6EI 1K78A 3IV5A 4A3MJ 3E3VA 3N97A 2R5YB 1BJAA 1HQCA 2V4JC 4UUSB 1S8NA 1Y1WJ 4DBQA 2MC3A 3L7WA 4EGYA 2LK2A 1ZG5A 3PO3J 1HLVA 1J5YA 2BY2A 2H94A 4GCVA 2GOMA 4LK1F 4PUSA 5LRSA 1G4DA 2VC0A 5GPAA 2MC4A 3TO9A 2QBYA 1ZN2A 3BG7A 4NUBA 1WWXA 1R58A 2HQ5A 4LOCA 4BXUA 3CJRB 3CLQA 3CCJI 3EYIA 4I0BA 3LQRA 3JR9A 3CC4I 3CJTB 3GTKJ 3CJNA 2AQFA 1R23A 1T08B 2LOOA 4YIFA 1OYYA 5ICEA 4BQNA 1X3WB 3BG5A 3K4BA 3WTUC 3IUOA 1IN6A 1YW9A 2BBYA 2V79A 2L7KA 2IS2A 1QZEA 5DM7F 3IAS2 1LEBA 4OMYA 4ZC3A 1V3FA 5M3MJ 2Q2EB 3IH2A 4E6KG 2KLOA 3OYMA 5L3CA 3EUAA 4FCYA 4RAYA 2PMHA 1TC3C 1CQTA 3ISPA 3DKYA 4MEYF 1YOVB 3KETA 2IRFG 1SFXA 1W36C 3DEWA 2CQXA 1VNDA 4Q5SF 4BHBA 4L18B 3BJ6A 3PFYA 1WKMA 3HDDA 4XRMA 2K27A 5IYDJ 2DYSH 2WADA 3S2HJ 3MWMA 4BYYA 1QHGA 1MJBA 2KISA 3G1LA 2HYGD 1ZQ3P 3HUGB 1JUPA 3IWZA 2DQRA 3LA7A 4EATA 1R22A 1WJCA 2F5EA 2Y9YA 1YI2I 4QLCU 1CF7B 4HBLA 4Z6YA 2XPVA 2E2HJ 2WAFA 2R93J 2WB1A 2CW0F 3SHFA 1HA8A 2LY1A 3QU6A 4HX4A 2XAFA 5JLWA 3KZZA 2P6TA 4L0YB 3HSRA 2Y0SN 1OFCX 3HHHA 1LQ1A 1WVRA 4Q47A 3OYGA 2BE5F 3I9V2 2HR3A 3BTJA 3DQVC 4M72A 3CMMA 4PK4A 5HNFA 4BE0A 2Z99A 1XPXA 4HDVA 2R0QC 1CGPA 1OCRH 2JZYA 3H0GJ 3KPHA 3NWSA 1USSA 3QPSA 3ULQB 1JXSA 5IYCJ 3KFWX 3KP6A 4BQQA 1UMQA 3S93A 1QGPA 5GAEJ 4R1HA 2DI3A 2M30A 3KZYA 2F5VA 3OYIA 3JTHA 1YW8A 2VQLA 3PUBA 2JA6J 3OL4A 2XF5A 4NC8A 4B8XA 3UR3C 2EBIA 2ZSIB 4BY7J 3COAC 3IL2A 4LB5A 3F9KA 1D3YA 1S29A 1WFXA 1Z6TA 4G6DA 3M9AA 2BW3A 2K4JA 2RV8A 1WI9A 3I56I 4MGRA 4WXCA 4KN4X 4CCMA 3SFIA 4OIPF 2OQGA 3K4KA 1JHHA 3CUQA 1QU3A 4IL6C 2R7OA 4I98B 5K7FA 4J00A 2NVUB 5DCMA
chains in the Genus database with same CATH topology
4ESFA 5L3DA 5DUKA 3I4PA 1R7JA 2W85A 4FX4A 3GFMA 5LHIA 2O0YA 3G73A 3ABTA 3RTRA 1IN8A 4I7HA 2MLGA 3V7RA 4N9HA 3EYYA 2L4AA 2HKXA 2WV0A 5LBQA 2JPCA 2FNAA 4RB0A 2NNYA 5BOXA 3G3ZA 3QP5A 2X0LA 2CQKA 4S04A 4AVPA 1TLHB 1IRFA 3WGIA 2D45A 1GHCA 1XSVA 3ROUA 3L2CA 1D5VA 2W57A 4GYIA 4CGZA 2ESNA 4UVCA 4UV9A 3TOBA 3DEUA 2P5VA 2EK5A 3E97A 1KQ0A 3TO6A 5K5OA 3T5XA 3J80K 3ZMVA 1OYIA 3W6JB 2BYVE 3TGNA 3CLOA 1R00A 3TDZC 2RVCA 1SD4A 3RKXA 1QO0D 1XN7A 3K1PA 5CVJA 5HLHA 1ON2A 3BJOA 2IA0A 1ZYRF 3LA3A 2FBKA 1T39A 1HSTA 3I54A 4HF0A 4XBFA 1F4KA 1Z1DA 2V1DA 4KMUX 1R1TA 3IRRA 2OAZA 1F5TA 2QBYB 2P7CB 4YG2F 1FZPB 3RIRA 2L01A 3QU3A 3RYPA 5ED4A 4EVIA 2PLYA 3WE3A 3BWGA 4HA8A 3I0TA 3GZ6A 1W7PA 2VBZA 1T0FA 1H9TA 4ZZDA 2WC2A 1FP2A 5TRDA 1WSUA 2O61A 4L9NA 2HWVA 1TQIA 1FYMA 4KFCA 3GLXA 1E17A 1I1GA 2QQBA 2VBYA 3P9KA 3M7GA 4G94A 5EEGA 1W4MA 4AIHA 2VODA 3IC7A 2ZFWA 4U7DA 4RGRA 3KP5A 5D6FA 4HF2A 5FD5A 5HLIA 1XCBA 2PQ8A 3LWFA 1OPCA 4WWCA 2D1VA 5BMZA 4HDUA 4EQQA 2XAGA 2ZBKA 1RI7A 1I27A 2EWNA 1SD7A 2MH9A 1TTYA 1L3LA 5CJ9A 2ZMEA 1D8KA 1XMKA 5ILUA 5TJJA 1XGSA 4G7HF 2XGXA 3LFKA 3VFZA 4MTDA 4U88A 3ZMSA 4IRIA 3KP7A 4P5OA 2YX7A 1AOYA 2F5CA 2A07F 3SFZA 5HOOA 1Q1HA 2A61A 1REPC 1B1BA 3BROA 5A2QK 4JK1X 3WTWC 3WU1B 3CUQB 3H92A 2GZWA 3OOPA 1DPUA 4EGZA 2CFXA 4O3MA 5F6FA 1A04A 3FXRA 1EH8A 2VOPA 4OU0A 2FMYA 1FBUA 5H6QA 4ZYEA 1JE8A 2R7DA 1O7FA 1USTA 1J0RA 3EQLF 3GVAA 3MZHA 1MGTA 4IRGA 2KJBA 3BPVA 2MLKA 4GXOA 2IT0A 4G8XA 4XSXF 2IW5A 3BP8A 1RZ4A 3FM3A 1BIBA 2CGPA 1FNNA 5F1RA 5CVRA 1U2WA 3BPXA 4EM2A 1WRJA 3FMRA 2H27A 4G7OF 1XGMA 5K1YA 1F9NA 1XSDA 2ETHA 1ZGJA 1IN4A 4RB1A 3BJAA 4RGUA 2KIMA 5HS7A 3EDPA 2QWWA 1HW2A 1UB9A 2XUBA 4GGGA 2O8XA 4M9ZA 3TQNA 3BDDA 5LEJA 5ICFA 1HKQA 1G3WA 2EFNA 4P55A 2ISZA 1W7PD 3C7JA 4N9IA 1ZG3A 2YU3A 3PQKA 3K1MA 2OQRA 1MJAA 1TW3A 3M1EA 2CO5A 3K9TA 2JSCA 2EFOA 3S2WA 4AIKA 4ZYGA 4BAYA 2FU4A 3CO7C 1HW1A 3C1DA 3BY6A 3DPLC 2JRTA 1J7KA 4LG0B 4XLNF 2YR2A 4UHTA 1UCRA 2G7HA 1UHWA 1QZZA 5FFZA 1ONVA 1Z91A 1O3QA 3JAMK 3ZMUA 3E6BA 2P5KA 1J59A 4RS8A 5CLSA 1S3JA 1E2XA 3U1DA 2ACJA 2GA2A 3E5QA 3VB2A 1FT9A 4L9TA 3BZ6A 1KYZA 3GFLA 3V7CA 3M8FA 5HDNA 2DW4A 3HOSA 3EUHA 2IA2A 2PBIA 4KA4A 1WQ2A 1T2KA 4KUMA 3I59A 2FMLA 2WWYA 2L54A 1I1SA 4HV6A 5BQTA 3RYRA 2YSRA 5DD8A 3GUDA 4EV0A 4CXFA 2ZMEB 1KQ9A 2KRFA 1I5ZA 5LHGA 1JHFA 2V6CA 2RC4A 4YFKF 2A68F 5JFRA 3T0YA 2ZO4A 5DYMA 1MDMA 3LSTA 3RKYA 3FZVA 1SD6A 2CSOA 2LSOA 2HS5A 3N4MA 1ZRFA 3NEUA 3R0JA 1IUYA 2A6EF 2AS5F 1ODDA 3E6DA 4XLPF 5FLXZ 3HRTA 4UVAA 4YFXF 3GW2A 2FBHA 3GFJA 2YPRA 2QZ8A 3D5LA 1OMIA 4HQMA 3F21A 4NHJA 3I71A 4EJVA 4RAZA 4EJOA 4U7BA 1Z6RA 5HLGA 2OD5A 5DV5A 1PDNC 1T6SA 5AONA 1U78A 1U3EM 3H3ZA 3WODF 2TDXA 1FSHA 3FMQA 1OR7A 4CO8A 3GFIA 4KYWA 5LLQA 4FX0A 1S7AA 2V9VA 4U0WA 3F72A 4WX9A 3FF5A 3QRFF 1XDSA 2K7LA 3R0AA 2M8EA 3Q9VA 3E6CC 3DF8A 4CYDA 2NRAC 2P4WA 5LGUA 3MZYA 1B59A 4KIGA 1HXDA 2A5YB 3R61A 3FXUA 2FXAA 4WCGA 4A5NA 1GXPA 3HTSB 4AWXB 3MEXA 4RGSA 1P92A 3F8CA 3R4KA 5D5WB 5K5RA 2QM3A 6PAXA 3MQ0A 2J5PA 2QLZA 3CUQC 4M71A 2Z33A 4LGWA 4M6XA 2QQAA 2XHKA 3O3KA 1IXSB 5LEKA 2DFIA 1H9GA 1YQAA 2AXLA 2XAJA 2E7XA 1ZHFA 3VEPA 1ZREA 2KKOA 4MNUA 5D5VB 2OBPA 4WXHA 2OZ6A 3C3WA 3ELKA 2EA2A 4KIFA 2D2WA 1XD7A 1DP7P 3M8EA 4HX8A 1TNSA 2VT2A 5E1ZB 3RI4A 3F22A 5DUIA 4ETSA 3F6VA 4Y13A 2ESHA 3R60A 1R1UA 4P9FA 3HRUA 3RPQA 4Q4ZF 1H0MA 2GIVA 3ZN0A 4M74A 4L0ZB 3DP7A 2HFHA 4UV8A 2EJRA 2XASA 4HV5A 3MFKA 3I64A 4L5JA 1W5TA 1FSEA 2R3SA 1U5TA 4M9SA 2C6YA 5HDKA 1MZBA 3I59B 4MHGA 1LEAA 3O2PE 3MAJA 2LF8A 2CWEA 2EV0A 1K78B 4ENNA 3J81K 1BBYA 4KN7X 1B9MA 4LB6B 1SFEA 3E6MA 3GXOA 4IRHA 4HAMA 2DPUA 3IKVA 3ZQ7A 3ZP5A 3WTYC 4PCQA 1TQPA 4Y17A 1MDMB 3JTGA 2DK8A 4LD5A 4PGGA 1R5GA 3LQQA 1O3SA 2FRHA 3GWZA 5LGNA 1DPRA 3MCZA 4M6YA 5BS6A 2MA3A 1IXCA 3CDHA 4MQ9F 2GWRA 2YX4A 5FFXA 3KP2A 1FY7A 5IT9K 2DK5A 3GF2A 3IKTA 1BM9A 2O03A 4LLNA 2Y75A 1KU7A 5DD4A 4I09A 3WTTC 3I58A 4I01A 4WK8F 3HIFA 2DBBA 4I0AA 2PJPA 1RUNA 1TBXA 4CICA 1SD5A 4U0VA 5FGMA 2H6BA 2DTRA 2LF7A 2LKPA 3RJPA 5E17F 3Q5FA 3U2RA 4QWQA 4I02A 3L00A 1BI0A 3FXQA 4KT5C 5K5QA 3P9CA 2PI0A 4XSZF 2ZNYA 1UHMA 2GQQA 4U0YA 2XAQA 5ILSA 1LNWA 2JTVA 5L3EA 1U6GA 2FBIA 4IHTA 4Y15A 5D4SA 5JVTA 5DCMB 3T1BA 2HQRA 4NB5A 5E8IA 1P2FA 4O6JA 4CHUA 2IVMA 1SAXA 1U8RA 2VC1A 2QENA 4BNCA 1FPQA 2E1CA 3WGHA 3RKWA 1PUEE 4ZYHA 2FOKA 1IAWA 4HF1A 2DT5A 1KU9A 3GZ5A 3PFIA 3VODA 5FB2A 4YIIA 3ZMDA 2UZKA 1FYKA 1QBJA 1JGSA 2HTJA 2K4BA 1ON1A 3F8BA 4NQWA 1BIAA 3HUGA 5IT3A 5HDGA 3P9IA 2GAUA 1O7LA 1Z9CA 3J80Z 1CF7A 1XGNA 2M1BA 1G3TA 5JR3A 1VTNC 1Z7UA 1IF1A 1B9NA 4UVBA 2COMA 1TQMA 5J6XA 5F64A 4HLYA 1R1VA 2A6HF 2E7WA 3ECOA 1SFUA 2FA5A 4YFNF 4WXDA 4KIBA 2VBXA 1D8JA 3P7NA 5LHHA 1GVJA 2XRNA 2VXZA 3LAPA 1TW2A 1J75A 5E20A 1G6NA 4DQ2A 1FC3A 1XGOA 2WTEA 3ZMZA 2ZNZA 1P4AA 1P4XA 3QOPA 4WF2A 1ZLKA 4DNCA 1R36A 4UNOA 3F8MA 4ZH4F 3WTVC 2NAZA 3KEQA 1FBSA 2K86A 4OOIA 2IA1A 4O5VA 1IZ1A 3E5UA 3JW4A 2VE9A 4OIOF 4L5IA 4HX7A 1W7PB 4BHCA 2UWMA 3HRMA 1YW7A 5ERIA 1BI1A 3PQJA 2MD5A 3BOQA 4A2UA 1BI3A 2EFQA 3B02A 3HSFA 4PZJA 4RB2C 4S05A 2BV6A 5BPIA 3ML6A 4Q48A 1EH6A 2W25A 4BHPA 4BQAA 3QPTA 1ZARA 2PMUA 1MJ9A 4JQFA 3FHZA 2X4HA 2XV4S 3L09A 2OA4A 2V1UA 1RUOA 3KLOA 2HEOA 2FQ3A 4F7ZA 1P6RA 3SZTA 4EJWA 3IWFA 2XVCA 1I6XA 1LVAA 1O3RA 2QQ9A 1KU3A 3T8RA 1Y0UA 2IPQX 2QYOA 1KA8A 1GXQA 4N0BA 5A2QZ 2Z5UA 4K2EA 2FEZA 2B0LA 5D5XB 2E1NA 2EFPA 4LLGF 5CVUA 5KVRA 5H6RA 4GO1A 4G7ZF 2QUFA 1FOKA 2DPDA 4A5MA 1YLFA 4AIJA 1TNTA 4KDPA 4EMSA 5LGTA 4XRFA 4M9XA 4IHSA 1HBXG 2OZUA 2J5OA 3ERED 3F8FA 4UXNA 3NQOA 4KMFA 5LRRA 3QAHA 4OIRF 2IJLA 5D4RA 1DUXC 1RNLA 2MH2A 4D0PA 4GYGA 1PP8F 4OIQF 2GXGA 4MQVA 3KLNA 1J2XA 2KIUA 4UUVA 2HQNA 4IPAA 2RNJA 2XKOA 1LJ9A 2H09A 2W24A 1XMAA 1XCVA 4HW0A 3F3XA 3HOTA 1X3UA 1K7AA 1FWZA 5DEQA 3TDUC 2VT3A 4A0ZA 3CO6C 1YO5C 1HW5A 3HSEA 3C18A 1RIOH 2FE3A 1LDKB 1YIOA 4A12A 1KGSA 5L3BA 1ZRDA 2DQLA 3KE2A 4ESJA 2A3SA 2IP2A 2DLLA 3WU0A 1MKMA 2NYXA 1IXRC 3ECHA 3SXYA 2F2EA 4L9VA 2VONA 3R6SA 5CVIA 3WTSC 1QZYA 2XAHA 3JAMZ 3RDIA 3FX3A 3V7SA 1YS7A 1G3YA 3ZMTA 3WG9A 1DDNA 1S6LA 1O3TA 1L0OC 3F6OA 3U9GA 2F5DA 2FF4A 1YYVA 5L3FA 2V1XA 2FSWA 3V8LA 5FO5A 4I2OA 2ISYA 4A6DA 2M87A 1S7OA 5CYVA 1K79A 3TOAA 1IRGA 2W84A 4IXAA 1EH7A 2A69F 2VOOA 1KYWA 1ULYA 3QPHA 4L9JA 5ILVA 2P7VB 1T38A 4AD9A 3F8NA 2HDCA 2STTA 2PG4A 2GXBA 2RQPA 5D5UB 1LB2A 3E5XA 3QP6A 3KCCA 4LFUA 3DPTA 1ZLJA 2K02A 3CUOA 3K1NA 1U5TC 2O3FA 4EM1A 2L3DA 4HYEA 1O57A 1BC8C 1R5HA 2XROA 5D6EA 1XB4A 2FNPA 2M5WA 1HKSA 1PP7U 2F5FA 4LK0F 4LMYA 2KIFA 4H0EA 2Z3YA 4P9UA 2BEOA 4CDGA 2G7UA 3FM5A 3WE2A 1J9IA 3DV8A 5E1XA 4MTEA 4PGHA 4A0XA 1ZRCA 5JI6A 1B4AA 3LA2A 2DU9A 3FMSA 1G3SA 3GX4X 4OMZA 4LG0A 2MBFA 5KK1A 1QNTA 2EB7A 2DAOA 2RGVA 2HYFA 3RPUA 2EA4A 5AIQA 3WTZA 4LJZF 5DCFA 2VBWA 3KEOA 2P8TA 5AIPA 3GEZA 1IW7F 3ZPLA 2UXXA 1V4RA 3KP4A 2HZTA 5HS8A 1MD0A 2UXNA 3K69A 3V8KA 1YTYA 1T98A 1ZH5A 2OU2A 2STWA 3B73A 4ENJA 2Q0OA 1KU2A 4ENMA 3Q9SA 5CVVA 4HZFA 5HS9A 3TKYA 5BPDA 2RN7A 3D0SA 4ESBA 2LNBA 4R79A 2H6CA 2XIGA 5J8FA 3GYHX 4EJTA 3I5UA 3SZPA 4G6QA 2HOEA 2VN2A 1XDUA 3DFGA 2P5LC 1FBQA 1BN5A 2D1HA 4FT8A 4CZZA 4PDKA 1UFMA 3GO5A 3ZN1A 4TV7A 1P4WA 3DKWA 4HLXA 3AAFA 1SMYF 5JHUA 2JT1A 2NS0A 3EETA 1IN5A 2Q2EA 2ZCWA 4ZZLA 5EEHA 1BC7C 3KP3A 4EM0B 4RB3C 3T8TA 2JPBA 4A6EA 1KQ8A 5DDGA 2P6SA 2PN6A 4OINF 2QVOA 5FLXK 4Z2YA 1STZA 5J8CA 1OYWA 4KICA 2CYYA 2CG4A 4ASNA 1FLIA 2M45A 4IVNA 3V4GA 2L02A 3REOA 3FWEA 1W5SA 1LDJA 4G9YA 2BGCA 4A0YA 4E70A 4IF4A 3O6BB 4HOBA 4FHTA 4KNYA 2ZJ2A 4ON0A 3J81Z 4HQEA 1OKRA 4ZYDA 3F23A 1LDDA 3HYIA 2GA1A 2ADUA 1HKTA 1U5TB 1EV7A 3HHGA 4IJAA 4ENKA 2XKPA 2ELHA 3L9FA 2EV5A 5FD6A 4M73A 2Y48A 3SQNA 4RGXA 1FYLA 5D8LB 3WTXC 1AWCA 2EV6A 5D8KB 3K0LA 1F1ZA 5IT9Z 1SMTA 5L3GA 3OV8A 1C0WA 1BOAA 3W6KB 5E1WA 2PFBA 2HGCA 3JSPA 3K2ZA 4EJUA 1IN7A 2RKHA 2NNNA 2Q8KA 3CTAA 2KJCA 3HRSA 1ZG1A 4BH9A 2ZXJA 5ICGA 3WGGA 3I53A 1Z05A 1QQIA 1ZGAA 3DXJF 3H3UA 3NRVA 3IHUA 1YS6A 4B09A 5ICCA 2L4MA 2RDPA 2DO7A 3LAJA 4R8HA 3J7AO 1BI2A 2PEXA 5E18F 4LLLA 2Z9OA 2HKOA 1HSJA 1K6OA 1FX7A 3HTUA 5HVQC 3ABUA 2EFWA 1XSXA 1ZAOA 1YFHA 4P96A 3JSOA 2R7FA 3IRQA 2LDUA 3VOEA 1NHAA 1YG2A 1QPMA 2VE8A 3V8JA 2G9WA 5H20A 2Y0MA 1FP1D 1B6AA 4JBAA 2HTSA 4MEXF 5E8GA 2ZKZA 3TO7A 2O6GE 1K78A 3E3VA 3N97A 1BJAA 1HQCA 1S8NA 2MC3A 3L7WA 4EGYA 1ZG5A 1J5YA 2H94A 4GCVA 4LK1F 1G4DA 5LRSA 2VC0A 3TO9A 2QBYA 1ZN2A 1WWXA 1R58A 4BXUA 3EYIA 4I0BA 3LQRA 3CJNA 1R23A 4YIFA 1OYYA 5ICEA 3WTUC 1IN6A 1YW9A 2BBYA 2V79A 1LEBA 4OMYA 1V3FA 5L3CA 4RAYA 2PMHA 3ISPA 4MEYF 3KETA 2IRFG 1SFXA 4Q5SF 4BHBA 4L18B 3BJ6A 1WKMA 2K27A 3MWMA 4BYYA 1MJBA 2HYGD 3IWZA 2DQRA 3LA7A 1R22A 2F5EA 4QLCU 1CF7B 4HBLA 2CW0F 3SHFA 3QU6A 4HX4A 2XAFA 3KZZA 2P6TA 4L0YB 3HSRA 3HHHA 1LQ1A 4Q47A 2BE5F 2HR3A 3DQVC 4M72A 2Z99A 4HDVA 1CGPA 2JZYA 1USSA 3ULQB 1JXSA 3KFWX 3KP6A 1QGPA 4R1HA 2DI3A 2M30A 3KZYA 3JTHA 1YW8A 4B8XA 3COAC 3IL2A 4LB5A 1D3YA 1S29A 1Z6TA 4G6DA 3M9AA 2K4JA 2RV8A 1WI9A 4MGRA 4WXCA 4KN4X 4OIPF 2OQGA 1JHHA 3CUQA 4I98B 5DCMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ESF A;  5L3D A;  5DUK A;  3I4P A;  1R7J A;  2W85 A;  4FX4 A;  3GFM A;  5LHI A;  2O0Y A;  3G73 A;  3ABT A;  3RTR A;  1IN8 A;  4I7H A;  2MLG A;  3V7R A;  4N9H A;  3EYY A;  2L4A A;  2HKX A;  2WV0 A;  5LBQ A;  2JPC A;  2FNA A;  4RB0 A;  2NNY A;  5BOX A;  3G3Z A;  3QP5 A;  2X0L A;  2CQK A;  4S04 A;  4AVP A;  1TLH B;  1IRF A;  3WGI A;  2D45 A;  1GHC A;  1XSV A;  3ROU A;  3L2C A;  1D5V A;  2W57 A;  4GYI A;  4CGZ A;  2ESN A;  4UVC A;  4UV9 A;  3TOB A;  3DEU A;  2P5V A;  2EK5 A;  3E97 A;  1KQ0 A;  3TO6 A;  5K5O A;  3T5X A;  3J80 K;  3ZMV A;  1OYI A;  3W6J B;  2BYV E;  3TGN A;  3CLO A;  1R00 A;  3TDZ C;  2RVC A;  1SD4 A;  3RKX A;  1QO0 D;  1XN7 A;  3K1P A;  5CVJ A;  5HLH A;  1ON2 A;  3BJO A;  2IA0 A;  1ZYR F;  3LA3 A;  2FBK A;  1T39 A;  1HST A;  3I54 A;  4HF0 A;  4XBF A;  1F4K A;  1Z1D A;  2V1D A;  4KMU X;  1R1T A;  3IRR A;  2OAZ A;  1F5T A;  2QBY B;  2P7C B;  4YG2 F;  1FZP B;  3RIR A;  2L01 A;  3QU3 A;  3RYP A;  5ED4 A;  4EVI A;  2PLY A;  3WE3 A;  3BWG A;  4HA8 A;  3I0T A;  3GZ6 A;  1W7P A;  2VBZ A;  1T0F A;  1H9T A;  4ZZD A;  2WC2 A;  1FP2 A;  5TRD A;  1WSU A;  2O61 A;  4L9N A;  2HWV A;  1TQI A;  1FYM A;  4KFC A;  3GLX A;  1E17 A;  1I1G A;  2QQB A;  2VBY A;  3P9K A;  3M7G A;  4G94 A;  5EEG A;  1W4M A;  4AIH A;  2VOD A;  3IC7 A;  2ZFW A;  4U7D A;  4RGR A;  3KP5 A;  5D6F A;  4HF2 A;  5FD5 A;  5HLI A;  1XCB A;  2PQ8 A;  3LWF A;  1OPC A;  4WWC A;  2D1V A;  5BMZ A;  4HDU A;  4EQQ A;  2XAG A;  2ZBK A;  1RI7 A;  1I27 A;  2EWN A;  1SD7 A;  2MH9 A;  1TTY A;  1L3L A;  5CJ9 A;  2ZME A;  1D8K A;  1XMK A;  5ILU A;  5TJJ A;  1XGS A;  4G7H F;  2XGX A;  3LFK A;  3VFZ A;  4MTD A;  4U88 A;  3ZMS A;  4IRI A;  3KP7 A;  4P5O A;  2YX7 A;  1AOY A;  2F5C A;  2A07 F;  3SFZ A;  5HOO A;  1Q1H A;  2A61 A;  1REP C;  1B1B A;  3BRO A;  5A2Q K;  4JK1 X;  3WTW C;  3WU1 B;  3CUQ B;  3H92 A;  2GZW A;  3OOP A;  1DPU A;  4EGZ A;  2CFX A;  4O3M A;  5F6F A;  1A04 A;  3FXR A;  1EH8 A;  2VOP A;  4OU0 A;  2FMY A;  1FBU A;  5H6Q A;  4ZYE A;  1JE8 A;  2R7D A;  1O7F A;  1UST A;  1J0R A;  3EQL F;  3GVA A;  3MZH A;  1MGT A;  4IRG A;  2KJB A;  3BPV A;  2MLK A;  4GXO A;  2IT0 A;  4G8X A;  4XSX F;  2IW5 A;  3BP8 A;  1RZ4 A;  3FM3 A;  1BIB A;  2CGP A;  1FNN A;  5F1R A;  5CVR A;  1U2W A;  3BPX A;  4EM2 A;  1WRJ A;  3FMR A;  2H27 A;  4G7O F;  1XGM A;  5K1Y A;  1F9N A;  1XSD A;  2ETH A;  1ZGJ A;  1IN4 A;  4RB1 A;  3BJA A;  4RGU A;  2KIM A;  5HS7 A;  3EDP A;  2QWW A;  1HW2 A;  1UB9 A;  2XUB A;  4GGG A;  2O8X A;  4M9Z A;  3TQN A;  3BDD A;  5LEJ A;  5ICF A;  1HKQ A;  1G3W A;  2EFN A;  4P55 A;  2ISZ A;  1W7P D;  3C7J A;  4N9I A;  1ZG3 A;  2YU3 A;  3PQK A;  3K1M A;  2OQR A;  1MJA A;  1TW3 A;  3M1E A;  2CO5 A;  3K9T A;  2JSC A;  2EFO A;  3S2W A;  4AIK A;  4ZYG A;  4BAY A;  2FU4 A;  3CO7 C;  1HW1 A;  3C1D A;  3BY6 A;  3DPL C;  2JRT A;  1J7K A;  4LG0 B;  4XLN F;  2YR2 A;  4UHT A;  1UCR A;  2G7H A;  1UHW A;  1QZZ A;  5FFZ A;  1ONV A;  1Z91 A;  1O3Q A;  3JAM K;  3ZMU A;  3E6B A;  2P5K A;  1J59 A;  4RS8 A;  5CLS A;  1S3J A;  1E2X A;  3U1D A;  2ACJ A;  2GA2 A;  3E5Q A;  3VB2 A;  1FT9 A;  4L9T A;  3BZ6 A;  1KYZ A;  3GFL A;  3V7C A;  3M8F A;  5HDN A;  2DW4 A;  3HOS A;  3EUH A;  2IA2 A;  2PBI A;  4KA4 A;  1WQ2 A;  1T2K A;  4KUM A;  3I59 A;  2FML A;  2WWY A;  2L54 A;  1I1S A;  4HV6 A;  5BQT A;  3RYR A;  2YSR A;  5DD8 A;  3GUD A;  4EV0 A;  4CXF A;  2ZME B;  1KQ9 A;  2KRF A;  1I5Z A;  5LHG A;  1JHF A;  2V6C A;  2RC4 A;  4YFK F;  2A68 F;  5JFR A;  3T0Y A;  2ZO4 A;  5DYM A;  1MDM A;  3LST A;  3RKY A;  3FZV A;  1SD6 A;  2CSO A;  2LSO A;  2HS5 A;  3N4M A;  1ZRF A;  3NEU A;  3R0J A;  1IUY A;  2A6E F;  2AS5 F;  1ODD A;  3E6D A;  4XLP F;  5FLX Z;  3HRT A;  4UVA A;  4YFX F;  3GW2 A;  2FBH A;  3GFJ A;  2YPR A;  2QZ8 A;  3D5L A;  1OMI A;  4HQM A;  3F21 A;  4NHJ A;  3I71 A;  4EJV A;  4RAZ A;  4EJO A;  4U7B A;  1Z6R A;  5HLG A;  2OD5 A;  5DV5 A;  1PDN C;  1T6S A;  5AON A;  1U78 A;  1U3E M;  3H3Z A;  3WOD F;  2TDX A;  1FSH A;  3FMQ A;  1OR7 A;  4CO8 A;  3GFI A;  4KYW A;  5LLQ A;  4FX0 A;  1S7A A;  2V9V A;  4U0W A;  3F72 A;  4WX9 A;  3FF5 A;  3QRF F;  1XDS A;  2K7L A;  3R0A A;  2M8E A;  3Q9V A;  3E6C C;  3DF8 A;  4CYD A;  2NRA C;  2P4W A;  5LGU A;  3MZY A;  1B59 A;  4KIG A;  1HXD A;  2A5Y B;  3R61 A;  3FXU A;  2FXA A;  4WCG A;  4A5N A;  1GXP A;  3HTS B;  4AWX B;  3MEX A;  4RGS A;  1P92 A;  3F8C A;  3R4K A;  5D5W B;  5K5R A;  2QM3 A;  6PAX A;  3MQ0 A;  2J5P A;  2QLZ A;  3CUQ C;  4M71 A;  2Z33 A;  4LGW A;  4M6X A;  2QQA A;  2XHK A;  3O3K A;  1IXS B;  5LEK A;  2DFI A;  1H9G A;  1YQA A;  2AXL A;  2XAJ A;  2E7X A;  1ZHF A;  3VEP A;  1ZRE A;  2KKO A;  4MNU A;  5D5V B;  2OBP A;  4WXH A;  2OZ6 A;  3C3W A;  3ELK A;  2EA2 A;  4KIF A;  2D2W A;  1XD7 A;  1DP7 P;  3M8E A;  4HX8 A;  1TNS A;  2VT2 A;  5E1Z B;  3RI4 A;  3F22 A;  5DUI A;  4ETS A;  3F6V A;  4Y13 A;  2ESH A;  3R60 A;  1R1U A;  4P9F A;  3HRU A;  3RPQ A;  4Q4Z F;  1H0M A;  2GIV A;  3ZN0 A;  4M74 A;  4L0Z B;  3DP7 A;  2HFH A;  4UV8 A;  2EJR A;  2XAS A;  4HV5 A;  3MFK A;  3I64 A;  4L5J A;  1W5T A;  1FSE A;  2R3S A;  1U5T A;  4M9S A;  2C6Y A;  5HDK A;  1MZB A;  3I59 B;  4MHG A;  1LEA A;  3O2P E;  3MAJ A;  2LF8 A;  2CWE A;  2EV0 A;  1K78 B;  4ENN A;  3J81 K;  1BBY A;  4KN7 X;  1B9M A;  4LB6 B;  1SFE A;  3E6M A;  3GXO A;  4IRH A;  4HAM A;  2DPU A;  3IKV A;  3ZQ7 A;  3ZP5 A;  3WTY C;  4PCQ A;  1TQP A;  4Y17 A;  1MDM B;  3JTG A;  2DK8 A;  4LD5 A;  4PGG A;  1R5G A;  3LQQ A;  1O3S A;  2FRH A;  3GWZ A;  5LGN A;  1DPR A;  3MCZ A;  4M6Y A;  5BS6 A;  2MA3 A;  1IXC A;  3CDH A;  4MQ9 F;  2GWR A;  2YX4 A;  5FFX A;  3KP2 A;  1FY7 A;  5IT9 K;  2DK5 A;  3GF2 A;  3IKT A;  1BM9 A;  2O03 A;  4LLN A;  2Y75 A;  1KU7 A;  5DD4 A;  4I09 A;  3WTT C;  3I58 A;  4I01 A;  4WK8 F;  3HIF A;  2DBB A;  4I0A A;  2PJP A;  1RUN A;  1TBX A;  4CIC A;  1SD5 A;  4U0V A;  5FGM A;  2H6B A;  2DTR A;  2LF7 A;  2LKP A;  3RJP A;  5E17 F;  3Q5F A;  3U2R A;  4QWQ A;  4I02 A;  3L00 A;  1BI0 A;  3FXQ A;  4KT5 C;  5K5Q A;  3P9C A;  2PI0 A;  4XSZ F;  2ZNY A;  1UHM A;  2GQQ A;  4U0Y A;  2XAQ A;  5ILS A;  1LNW A;  2JTV A;  5L3E A;  1U6G A;  2FBI A;  4IHT A;  4Y15 A;  5D4S A;  5JVT A;  5DCM B;  3T1B A;  2HQR A;  4NB5 A;  5E8I A;  1P2F A;  4O6J A;  4CHU A;  2IVM A;  1SAX A;  1U8R A;  2VC1 A;  2QEN A;  4BNC A;  1FPQ A;  2E1C A;  3WGH A;  3RKW A;  1PUE E;  4ZYH A;  2FOK A;  1IAW A;  4HF1 A;  2DT5 A;  1KU9 A;  3GZ5 A;  3PFI A;  3VOD A;  5FB2 A;  4YII A;  3ZMD A;  2UZK A;  1FYK A;  1QBJ A;  1JGS A;  2HTJ A;  2K4B A;  1ON1 A;  3F8B A;  4NQW A;  1BIA A;  3HUG A;  5IT3 A;  5HDG A;  3P9I A;  2GAU A;  1O7L A;  1Z9C A;  3J80 Z;  1CF7 A;  1XGN A;  2M1B A;  1G3T A;  5JR3 A;  1VTN C;  1Z7U A;  1IF1 A;  1B9N A;  4UVB A;  2COM A;  1TQM A;  5J6X A;  5F64 A;  4HLY A;  1R1V A;  2A6H F;  2E7W A;  3ECO A;  1SFU A;  2FA5 A;  4YFN F;  4WXD A;  4KIB A;  2VBX A;  1D8J A;  3P7N A;  5LHH A;  1GVJ A;  2XRN A;  2VXZ A;  3LAP A;  1TW2 A;  1J75 A;  5E20 A;  1G6N A;  4DQ2 A;  1FC3 A;  1XGO A;  2WTE A;  3ZMZ A;  2ZNZ A;  1P4A A;  1P4X A;  3QOP A;  4WF2 A;  1ZLK A;  4DNC A;  1R36 A;  4UNO A;  3F8M A;  4ZH4 F;  3WTV C;  2NAZ A;  3KEQ A;  1FBS A;  2K86 A;  4OOI A;  2IA1 A;  4O5V A;  1IZ1 A;  3E5U A;  3JW4 A;  2VE9 A;  4OIO F;  4L5I A;  4HX7 A;  1W7P B;  4BHC A;  2UWM A;  3HRM A;  1YW7 A;  5ERI A;  1BI1 A;  3PQJ A;  2MD5 A;  3BOQ A;  4A2U A;  1BI3 A;  2EFQ A;  3B02 A;  3HSF A;  4PZJ A;  4RB2 C;  4S05 A;  2BV6 A;  5BPI A;  3ML6 A;  4Q48 A;  1EH6 A;  2W25 A;  4BHP A;  4BQA A;  3QPT A;  1ZAR A;  2PMU A;  1MJ9 A;  4JQF A;  3FHZ A;  2X4H A;  2XV4 S;  3L09 A;  2OA4 A;  2V1U A;  1RUO A;  3KLO A;  2HEO A;  2FQ3 A;  4F7Z A;  1P6R A;  3SZT A;  4EJW A;  3IWF A;  2XVC A;  1I6X A;  1LVA A;  1O3R A;  2QQ9 A;  1KU3 A;  3T8R A;  1Y0U A;  2IPQ X;  2QYO A;  1KA8 A;  1GXQ A;  4N0B A;  5A2Q Z;  2Z5U A;  4K2E A;  2FEZ A;  2B0L A;  5D5X B;  2E1N A;  2EFP A;  4LLG F;  5CVU A;  5KVR A;  5H6R A;  4GO1 A;  4G7Z F;  2QUF A;  1FOK A;  2DPD A;  4A5M A;  1YLF A;  4AIJ A;  1TNT A;  4KDP A;  4EMS A;  5LGT A;  4XRF A;  4M9X A;  4IHS A;  1HBX G;  2OZU A;  2J5O A;  3ERE D;  3F8F A;  4UXN A;  3NQO A;  4KMF A;  5LRR A;  3QAH A;  4OIR F;  2IJL A;  5D4R A;  1DUX C;  1RNL A;  2MH2 A;  4D0P A;  4GYG A;  1PP8 F;  4OIQ F;  2GXG A;  4MQV A;  3KLN A;  1J2X A;  2KIU A;  4UUV A;  2HQN A;  4IPA A;  2RNJ A;  2XKO A;  1LJ9 A;  2H09 A;  2W24 A;  1XMA A;  1XCV A;  4HW0 A;  3F3X A;  3HOT A;  1X3U A;  1K7A A;  1FWZ A;  5DEQ A;  3TDU C;  2VT3 A;  4A0Z A;  3CO6 C;  1YO5 C;  1HW5 A;  3HSE A;  3C18 A;  1RIO H;  2FE3 A;  1LDK B;  1YIO A;  4A12 A;  1KGS A;  5L3B A;  1ZRD A;  2DQL A;  3KE2 A;  4ESJ A;  2A3S A;  2IP2 A;  2DLL A;  3WU0 A;  1MKM A;  2NYX A;  1IXR C;  3ECH A;  3SXY A;  2F2E A;  4L9V A;  2VON A;  3R6S A;  5CVI A;  3WTS C;  1QZY A;  2XAH A;  3JAM Z;  3RDI A;  3FX3 A;  3V7S A;  1YS7 A;  1G3Y A;  3ZMT A;  3WG9 A;  1DDN A;  1S6L A;  1O3T A;  1L0O C;  3F6O A;  3U9G A;  2F5D A;  2FF4 A;  1YYV A;  5L3F A;  2V1X A;  2FSW A;  3V8L A;  5FO5 A;  4I2O A;  2ISY A;  4A6D A;  2M87 A;  1S7O A;  5CYV A;  1K79 A;  3TOA A;  1IRG A;  2W84 A;  4IXA A;  1EH7 A;  2A69 F;  2VOO A;  1KYW A;  1ULY A;  3QPH A;  4L9J A;  5ILV A;  2P7V B;  1T38 A;  4AD9 A;  3F8N A;  2HDC A;  2STT A;  2PG4 A;  2GXB A;  2RQP A;  5D5U B;  1LB2 A;  3E5X A;  3QP6 A;  3KCC A;  4LFU A;  3DPT A;  1ZLJ A;  2K02 A;  3CUO A;  3K1N A;  1U5T C;  2O3F A;  4EM1 A;  2L3D A;  4HYE A;  1O57 A;  1BC8 C;  1R5H A;  2XRO A;  5D6E A;  1XB4 A;  2FNP A;  2M5W A;  1HKS A;  1PP7 U;  2F5F A;  4LK0 F;  4LMY A;  2KIF A;  4H0E A;  2Z3Y A;  4P9U A;  2BEO A;  4CDG A;  2G7U A;  3FM5 A;  3WE2 A;  1J9I A;  3DV8 A;  5E1X A;  4MTE A;  4PGH A;  4A0X A;  1ZRC A;  5JI6 A;  1B4A A;  3LA2 A;  2DU9 A;  3FMS A;  1G3S A;  3GX4 X;  4OMZ A;  4LG0 A;  2MBF A;  5KK1 A;  1QNT A;  2EB7 A;  2DAO A;  2RGV A;  2HYF A;  3RPU A;  2EA4 A;  5AIQ A;  3WTZ A;  4LJZ F;  5DCF A;  2VBW A;  3KEO A;  2P8T A;  5AIP A;  3GEZ A;  1IW7 F;  3ZPL A;  2UXX A;  1V4R A;  3KP4 A;  2HZT A;  5HS8 A;  1MD0 A;  2UXN A;  3K69 A;  3V8K A;  1YTY A;  1T98 A;  1ZH5 A;  2OU2 A;  2STW A;  3B73 A;  4ENJ A;  2Q0O A;  1KU2 A;  4ENM A;  3Q9S A;  5CVV A;  4HZF A;  5HS9 A;  3TKY A;  5BPD A;  2RN7 A;  3D0S A;  4ESB A;  2LNB A;  4R79 A;  2H6C A;  2XIG A;  5J8F A;  3GYH X;  4EJT A;  3I5U A;  3SZP A;  4G6Q A;  2HOE A;  2VN2 A;  1XDU A;  3DFG A;  2P5L C;  1FBQ A;  1BN5 A;  2D1H A;  4FT8 A;  4CZZ A;  4PDK A;  1UFM A;  3GO5 A;  3ZN1 A;  4TV7 A;  1P4W A;  3DKW A;  4HLX A;  3AAF A;  1SMY F;  5JHU A;  2JT1 A;  2NS0 A;  3EET A;  1IN5 A;  2Q2E A;  2ZCW A;  4ZZL A;  5EEH A;  1BC7 C;  3KP3 A;  4EM0 B;  4RB3 C;  3T8T A;  2JPB A;  4A6E A;  1KQ8 A;  5DDG A;  2P6S A;  2PN6 A;  4OIN F;  2QVO A;  5FLX K;  4Z2Y A;  1STZ A;  5J8C A;  1OYW A;  4KIC A;  2CYY A;  2CG4 A;  4ASN A;  1FLI A;  2M45 A;  4IVN A;  3V4G A;  2L02 A;  3REO A;  3FWE A;  1W5S A;  1LDJ A;  4G9Y A;  2BGC A;  4A0Y A;  4E70 A;  4IF4 A;  3O6B B;  4HOB A;  4FHT A;  4KNY A;  2ZJ2 A;  4ON0 A;  3J81 Z;  4HQE A;  1OKR A;  4ZYD A;  3F23 A;  1LDD A;  3HYI A;  2GA1 A;  2ADU A;  1HKT A;  1U5T B;  1EV7 A;  3HHG A;  4IJA A;  4ENK A;  2XKP A;  2ELH A;  3L9F A;  2EV5 A;  5FD6 A;  4M73 A;  2Y48 A;  3SQN A;  4RGX A;  1FYL A;  5D8L B;  3WTX C;  1AWC A;  2EV6 A;  5D8K B;  3K0L A;  1F1Z A;  5IT9 Z;  1SMT A;  5L3G A;  3OV8 A;  1C0W A;  1BOA A;  3W6K B;  5E1W A;  2PFB A;  2HGC A;  3JSP A;  3K2Z A;  4EJU A;  1IN7 A;  2RKH A;  2NNN A;  2Q8K A;  3CTA A;  2KJC A;  3HRS A;  1ZG1 A;  4BH9 A;  2ZXJ A;  5ICG A;  3WGG A;  3I53 A;  1Z05 A;  1QQI A;  1ZGA A;  3DXJ F;  3H3U A;  3NRV A;  3IHU A;  1YS6 A;  4B09 A;  5ICC A;  2L4M A;  2RDP A;  2DO7 A;  3LAJ A;  4R8H A;  3J7A O;  1BI2 A;  2PEX A;  5E18 F;  4LLL A;  2Z9O A;  2HKO A;  1HSJ A;  1K6O A;  1FX7 A;  3HTU A;  5HVQ C;  3ABU A;  2EFW A;  1XSX A;  1ZAO A;  1YFH A;  4P96 A;  3JSO A;  2R7F A;  3IRQ A;  2LDU A;  3VOE A;  1NHA A;  1YG2 A;  1QPM A;  2VE8 A;  3V8J A;  2G9W A;  5H20 A;  2Y0M A;  1FP1 D;  1B6A A;  4JBA A;  2HTS A;  4MEX F;  5E8G A;  2ZKZ A;  3TO7 A;  2O6G E;  1K78 A;  3E3V A;  3N97 A;  1BJA A;  1HQC A;  1S8N A;  2MC3 A;  3L7W A;  4EGY A;  1ZG5 A;  1J5Y A;  2H94 A;  4GCV A;  4LK1 F;  1G4D A;  5LRS A;  2VC0 A;  3TO9 A;  2QBY A;  1ZN2 A;  1WWX A;  1R58 A;  4BXU A;  3EYI A;  4I0B A;  3LQR A;  3CJN A;  1R23 A;  4YIF A;  1OYY A;  5ICE A;  3WTU C;  1IN6 A;  1YW9 A;  2BBY A;  2V79 A;  1LEB A;  4OMY A;  1V3F A;  5L3C A;  4RAY A;  2PMH A;  3ISP A;  4MEY F;  3KET A;  2IRF G;  1SFX A;  4Q5S F;  4BHB A;  4L18 B;  3BJ6 A;  1WKM A;  2K27 A;  3MWM A;  4BYY A;  1MJB A;  2HYG D;  3IWZ A;  2DQR A;  3LA7 A;  1R22 A;  2F5E A;  4QLC U;  1CF7 B;  4HBL A;  2CW0 F;  3SHF A;  3QU6 A;  4HX4 A;  2XAF A;  3KZZ A;  2P6T A;  4L0Y B;  3HSR A;  3HHH A;  1LQ1 A;  4Q47 A;  2BE5 F;  2HR3 A;  3DQV C;  4M72 A;  2Z99 A;  4HDV A;  1CGP A;  2JZY A;  1USS A;  3ULQ B;  1JXS A;  3KFW X;  3KP6 A;  1QGP A;  4R1H A;  2DI3 A;  2M30 A;  3KZY A;  3JTH A;  1YW8 A;  4B8X A;  3COA C;  3IL2 A;  4LB5 A;  1D3Y A;  1S29 A;  1Z6T A;  4G6D A;  3M9A A;  2K4J A;  2RV8 A;  1WI9 A;  4MGR A;  4WXC A;  4KN4 X;  4OIP F;  2OQG A;  1JHH A;  3CUQ A;  4I98 B;  5DCM A; 
#chains in the Genus database with same CATH topology
 2KRH A;  4ESF A;  5L3D A;  5DUK A;  3I4P A;  1R7J A;  2HOT A;  4ZDO A;  3S3M A;  1ACI A;  2W85 A;  3AG1 H;  4FX4 A;  3K7A J;  2EZK A;  3GFM A;  2GLO A;  5LHI A;  2EH3 A;  2O0Y A;  4XLH A;  3G73 A;  3ABT A;  3RTR A;  1VQP I;  1IN8 A;  2DOE A;  4I7H A;  2X6Y A;  4RLF A;  2MLG A;  4A3K J;  2JVG A;  3V7R A;  4N9H A;  1KON A;  4EEF G;  3EYY A;  3GTJ J;  3OSG A;  5M5X J;  2L4A A;  3DU6 A;  4HPQ A;  2HKX A;  2WV0 A;  5LBQ A;  3FBI B;  5JVG F;  2JPC A;  2LLK A;  4DW6 A;  2FNA A;  2K9N A;  3JRD A;  4IOA F;  1POG A;  3OL3 A;  4RB0 A;  2NNY A;  1MMA A;  5BOX A;  3G3Z A;  2V9K A;  3HM5 A;  3QP5 A;  1G8X A;  2X0L A;  2CQK A;  4S04 A;  3OIO A;  2UV1 A;  4AVP A;  2EIM H;  1TLH B;  1IRF A;  3WGI A;  2D45 A;  2VKD A;  1XMX A;  3BZK A;  1GHC A;  4XNF A;  4DYR A;  1RKT A;  4XOP A;  4E7S A;  2L0K A;  3CMY A;  1XSV A;  3ROU A;  3L2C A;  2E35 A;  2M9H A;  1D5V A;  2W57 A;  3BG3 A;  1YRN B;  1MSE C;  4GYI A;  4CGZ A;  2ESN A;  3CCV I;  4UVC A;  1MBH A;  5F27 A;  4UV9 A;  3TOB A;  3DEU A;  4F55 A;  2P5V A;  2EK5 A;  3E97 A;  1KQ0 A;  2W48 A;  3TO6 A;  3I3L A;  5K5O A;  3T5X A;  3J80 K;  4MFE A;  1GV2 A;  3RZO J;  3ZMV A;  2E34 A;  2VKV A;  1OYI A;  3W6J B;  2BYV E;  3TGN A;  1PUF B;  1SFK A;  3NAU A;  2JK3 A;  1R00 A;  3CLO A;  3TDZ C;  3ABK H;  3RCO A;  3ESW B;  2RVC A;  4F93 B;  1SD4 A;  2BVM A;  4BE1 A;  3RKX A;  1QO0 D;  1XN7 A;  2DOF A;  3JCU C;  3K1P A;  5CVJ A;  2E36 A;  5HLH A;  2BVL A;  2MW8 A;  1ON2 A;  3BJO A;  2HVR A;  2IA0 A;  1ZYR F;  3LA3 A;  1JUM A;  4XID A;  2Y31 A;  2FBK A;  1T39 A;  3QYF A;  3CDL A;  2OUM A;  1HST A;  2BXY A;  3I54 A;  4HF0 A;  4B48 A;  3GTP J;  1VQK I;  4XBF A;  1F4K A;  1Z1D A;  2V1D A;  4KMU X;  2DTZ A;  1R1T A;  4DOZ A;  4HEA 2;  3IRR A;  2OAZ A;  1F5T A;  2JA7 J;  5J47 A;  1MIJ A;  4HNV A;  2QBY B;  2P7C B;  5GAD J;  1TZL A;  1ETV A;  4YG2 F;  1FZP B;  2IAI A;  3RIR A;  3K4L A;  2L01 A;  3QU3 A;  2PJR B;  1NTC A;  3RYP A;  4EVI A;  5ED4 A;  2PLY A;  3WE3 A;  3BWG A;  2KMU A;  4BS9 A;  2L9R A;  4HA8 A;  2E60 A;  4ZDP A;  3I0T A;  2LC2 A;  1W7P A;  3GZ6 A;  2VBZ A;  4IZZ A;  1T0F A;  5HOD A;  4B47 A;  4I6Z A;  1H9T A;  3CF5 F;  3TMO A;  4ZZD A;  2WC2 A;  1FP2 A;  4YIR X;  3KZI C;  5TRD A;  1V5E A;  1WSU A;  2O61 A;  4H4K C;  3WG7 H;  2VQC A;  4L9N A;  2HWV A;  1TQI A;  2E2I J;  1FYM A;  2JWT A;  4KFC A;  3GLX A;  1E17 A;  5CPR B;  1QVT A;  2M4K A;  4D5C A;  2QA4 I;  1I1G A;  1T8I A;  2QQB A;  1MH4 A;  1DU0 A;  4ZDL A;  2VBY A;  3P9K A;  2ID6 A;  4M3E A;  3M7G A;  4G94 A;  5EEG A;  1DGR M;  1W4M A;  4AIH A;  1YJN I;  2VOD A;  2OTJ I;  3M4O J;  3IC7 A;  1X3Z B;  2CUZ A;  2ZFW A;  4U7D A;  3DLA A;  4RGR A;  3KP5 A;  5D6F A;  4HF2 A;  1D0Z A;  5FD5 A;  4DJA A;  5HLI A;  3A4C A;  1XCB A;  4HNU A;  2PQ8 A;  3LWF A;  1OPC A;  2EQR A;  3OR1 C;  4WWC A;  2D1V A;  5BMZ A;  4HDU A;  4RDU A;  3JRA A;  4EQQ A;  1R49 A;  2XAG A;  2JVH A;  2ZBK A;  1RI7 A;  3K70 C;  1I27 A;  2EWN A;  2EIK H;  1SD7 A;  2MH9 A;  1TTY A;  5FKL A;  2MFZ A;  1WJB A;  1L3L A;  4YRV A;  2ZFU A;  5CJ9 A;  2ZME A;  1LKX A;  1D8K A;  3QWL A;  4BKX A;  3MN2 A;  4X1E A;  2V7F A;  1XMK A;  2LRD A;  2DOA A;  2CU7 A;  1UJ8 A;  2PMZ N;  3LSI A;  5ILU A;  1MMG A;  5TJJ A;  1XGS A;  4G7H F;  4XLF A;  1FEX A;  2XGX A;  3PL8 A;  4M3G A;  4XKV A;  3LFK A;  1K4T A;  5FKN A;  3VFZ A;  4RAF A;  4MTD A;  4U88 A;  3ZMS A;  3HPH A;  4IRI A;  4A3E J;  3A0B C;  3KP7 A;  1LFB A;  2B9S A;  2L7Z A;  4QPO A;  2CW8 A;  3H9Q A;  4CUG A;  1ZK8 A;  2E71 A;  4P5O A;  5IY5 H;  2H1L A;  2YX7 A;  1AOY A;  2ZJR F;  2F5C A;  1WJ5 A;  2OF7 A;  5KAI C;  3SFZ A;  5HOO A;  2A07 F;  1Q1H A;  2A61 A;  3BR2 A;  1U8B A;  3FXL A;  2ELJ A;  1REP C;  1B1B A;  1H88 C;  3BRO A;  2VLA A;  5A2Q K;  4BE2 A;  4JK1 X;  4G12 A;  3WTW C;  3WU1 B;  2XC7 A;  2R5Z B;  3CUQ B;  3H92 A;  2GZW A;  2JUG A;  3OOP A;  1TT5 B;  1DPU A;  5FKK A;  2HXI A;  4EGZ A;  1LE8 A;  4AYB N;  2CFX A;  2VAS A;  5LD2 C;  4O3M A;  5F6F A;  1A04 A;  3FXR A;  2V9P A;  1EH8 A;  2VOP A;  1P7I A;  4OU0 A;  2FMY A;  1FBU A;  2CJJ A;  5H6Q A;  4ZYE A;  1JE8 A;  2R7D A;  1AHD P;  3JRE A;  1O7F A;  1NK2 P;  1FOW A;  1T33 A;  1UST A;  2BZT A;  2D5V A;  3LSJ A;  4Y3O A;  1J0R A;  3EQL F;  3BC8 A;  3GVA A;  5GAH J;  2A05 A;  2BHY A;  3LFU A;  1MGT A;  4IRG A;  2KJB A;  3BPV A;  3MZH A;  2MLK A;  4GXO A;  3DBH B;  2IT0 A;  4G8X A;  4XSX F;  5K7Z A;  2IW5 A;  3BP8 A;  1RZ4 A;  3MVP A;  4ITV A;  3FM3 A;  1BIB A;  2CGP A;  3S32 A;  3GME A;  2XAU A;  4OAY A;  1WPK A;  1FNN A;  3BTC A;  5F1R A;  5CVR A;  5DTD A;  2AHQ A;  3A2K A;  4D7M A;  2HXO A;  1MSF C;  1U2W A;  2ID3 A;  3BPX A;  4EM2 A;  1WRJ A;  2LY9 A;  3FMR A;  2MYS A;  4MLO A;  4C9Y A;  2H27 A;  4G7O F;  1XGM A;  2I8D A;  1SVL A;  4N4O B;  5K1Y A;  1F9N A;  1X1P A;  4L5E A;  2GIZ A;  1XSD A;  1SFO J;  2ETH A;  1ZGJ A;  1IN4 A;  3BR1 A;  4C2T A;  4XRS A;  1IRX A;  5IP6 A;  1R6R A;  4RB1 A;  3BJA A;  4RGU A;  1MH3 A;  4C2M J;  2JUC A;  2KIM A;  2QKM B;  5GAG J;  5HS7 A;  3EDP A;  5F0F A;  1A5J A;  2QWW A;  1HW2 A;  1UB9 A;  2XUB A;  4Y4R A;  2VJJ A;  2XF7 A;  4GGG A;  2O8X A;  4M9Z A;  3TQN A;  5M3F J;  2M7B A;  3ZQI A;  3JRF A;  3BDD A;  4FE4 A;  5LEJ A;  2E19 A;  5ICF A;  1HKQ A;  1G3W A;  3GZN B;  3IH3 A;  2EFN A;  5KAF C;  4P55 A;  1VQ5 I;  3BTL A;  1W7P D;  2ISZ A;  3C7J A;  4N9I A;  5HLT A;  1ZG3 A;  2YU3 A;  1QA6 A;  3PQK A;  1WJF A;  3ZRG A;  3K1M A;  4A3D J;  2OQR A;  2LY2 A;  1MJA A;  1TW3 A;  3M1E A;  2EPF A;  2ZJQ F;  1DU6 A;  2LVS A;  2CO5 A;  3K9T A;  3JRB A;  3A0H C;  2JSC A;  2EFO A;  3ZGK A;  3S2W A;  4E7K A;  1TWF J;  5B1B H;  4AIK A;  4ZYG A;  4BAY A;  2FU4 A;  4PFP A;  3CO7 C;  1HW1 A;  3C1D A;  5EF6 A;  4GDF A;  3BY6 A;  3OYC A;  3DPL C;  2AO9 A;  2KZV A;  2JRT A;  1MNM C;  1J7K A;  4LG0 B;  2LRE A;  4XLN F;  2XPW A;  2YR2 A;  4UHT A;  4E7H A;  1UCR A;  5F0H A;  2G7H A;  4JX4 A;  1UHW A;  1MBE A;  1R71 A;  1QZZ A;  2K3P A;  1WHU A;  1Y0N A;  5FFZ A;  1ONV A;  1Z91 A;  1O3Q A;  3JAM K;  2L5Q A;  3ZMU A;  3E6B A;  2P5K A;  2JJ7 A;  1YJW I;  1J59 A;  1MMN A;  4GFB A;  2HOS A;  3KYD B;  2M34 A;  4RS8 A;  5CLS A;  1S3J A;  4BBR J;  1E2X A;  3U1D A;  2VUM J;  1GT0 C;  2ACJ A;  2GA2 A;  4V2G A;  2NOJ B;  3E5Q A;  3VB2 A;  1TWG J;  3WU2 C;  1FT9 A;  1OLT A;  4L9T A;  1QPI A;  2DJN A;  3BZ6 A;  1KYZ A;  1RET A;  5M5Y J;  3GFL A;  5EDN A;  3V7C A;  5CQG A;  3A1Y A;  3H9J A;  3M8F A;  5HDN A;  2DW4 A;  3HOS A;  1HDP A;  3EUH A;  1H89 C;  2IA2 A;  2PBI A;  4KA4 A;  1WQ2 A;  1T2K A;  4MIM A;  2K40 A;  4KUM A;  3I59 A;  1YX3 A;  2FML A;  2L54 A;  2WWY A;  1I1S A;  3HOZ J;  2V26 A;  1ENH A;  4HV6 A;  3VPR A;  1OQY A;  5BQT A;  2KT0 A;  3RYR A;  1UEL B;  2YSR A;  3NWT A;  5DD8 A;  2ZXI A;  3GUD A;  4EV0 A;  4CXF A;  2ZME B;  4P1W A;  4PSW A;  1KQ9 A;  1S5L C;  2KRF A;  1W5C C;  1I5Z A;  1S72 I;  5LHG A;  1BJZ A;  2FUG 2;  2QEX I;  1JHF A;  3HXL A;  4A3G J;  2DMQ A;  3LOC A;  5IYB J;  4HNT A;  3DTK A;  5FKO A;  2FJ1 A;  1WJA A;  2V6C A;  1BR2 A;  2RC4 A;  3DKX A;  1JTX A;  4YFK F;  3Q3S A;  5DS9 A;  2VJ5 A;  2A68 F;  5JFR A;  3T0Y A;  2ZO4 A;  5DYM A;  2VKE A;  3LST A;  1IV8 A;  1MDM A;  3RKY A;  1EJ9 A;  2JMW A;  3FZV A;  1SD6 A;  2CSO A;  4CYC B;  2LSO A;  2HS5 A;  3N4M A;  1ZRF A;  2R7S A;  3NEU A;  2GBY A;  4PSX A;  1VQ4 I;  5B5E C;  3R0J A;  2V6E A;  3C2H A;  1IUY A;  2A6E F;  3CP2 A;  3F0C A;  2CMP A;  5C44 J;  1IG7 A;  1ODD A;  3E6D A;  4X0G A;  2AS5 F;  4F92 B;  4XLP F;  2IS6 A;  5FLX Z;  3HRT A;  4UVA A;  3OYJ A;  1P9Q C;  3G1O A;  4YFX F;  3GW2 A;  3OY9 A;  2AQE A;  1LE8 B;  2FBH A;  1ORK A;  3RQ4 A;  3CCM I;  3GFJ A;  2M3A A;  2ZSH B;  4CA0 A;  2YPR A;  3D5S C;  5EG0 A;  2QZ8 A;  3D5L A;  1OMI A;  4HQM A;  3F21 A;  4NHJ A;  3I71 A;  4EJV A;  4PJL A;  2LBF B;  4RAZ A;  4EJO A;  4QPQ A;  2DA3 A;  2K9M A;  4U7B A;  1WJD A;  1Z6R A;  1X4O A;  5HLG A;  3S1R J;  2OD5 A;  2E1M B;  4OWR B;  5DV5 A;  1PDN C;  1T6S A;  5AON A;  5J1U A;  1U78 A;  1JUS A;  5CKT A;  4E7L A;  3MKW B;  1U3E M;  4XKB A;  2MAB A;  2L7F P;  3H3Z A;  2DFE A;  1D1A A;  3WOD F;  2TDX A;  4RM3 A;  1FSH A;  3FMQ A;  1OR7 A;  4CO8 A;  5F08 A;  3GFI A;  1Z3Y A;  3CCQ I;  4KYW A;  4M3B A;  5LLQ A;  4NDL A;  2Q1Z B;  4UUT A;  2M4G A;  2VJI A;  4FX0 A;  1S7A A;  4YEJ A;  4JOM A;  3ZOB A;  5IOY A;  2V9V A;  4U0W A;  3OYE A;  3F72 A;  1APL C;  1XS9 A;  4WX9 A;  3FF5 A;  3CJQ B;  2HVQ A;  3QRF F;  3CZ6 A;  1B72 A;  1XDS A;  2K7L A;  2L9S A;  3R0A A;  5FKM A;  2M8E A;  3Q9V A;  3B6C A;  3E6C C;  3DF8 A;  4CH7 A;  1Y6I A;  3S2D J;  3RQI A;  4CYD A;  2NRA C;  2P4W A;  5LGU A;  3MZY A;  1B59 A;  4KIG A;  1HXD A;  2A5Y B;  3R61 A;  3CF2 A;  3FXU A;  2FXA A;  2HNH A;  4WCG A;  4A5N A;  1FTT A;  1GXP A;  5E3N A;  1OCO H;  3HTS B;  4XKC A;  4AWX B;  3MEX A;  4RGS A;  1P92 A;  1X2M A;  2EIN H;  4C3H J;  1IUF A;  3F8C A;  3TBI A;  3ZQH A;  3R4K A;  4A69 C;  5D5W B;  3TW7 A;  5K5R A;  2QM3 A;  6PAX A;  4AUX A;  3CCE I;  2X9D A;  3MQ0 A;  2OV7 A;  2J5P A;  2QLZ A;  3CUQ C;  3K4J A;  4M71 A;  3TP3 A;  4LGW A;  4XKW A;  2Z33 A;  4M6X A;  2QQA A;  2DMN A;  3VSL A;  2XHK A;  3O3K A;  1IXS B;  5LEK A;  2DFI A;  4J19 A;  2KHM A;  1H9G A;  1YQA A;  2AXL A;  3HG9 A;  2XAJ A;  2ZJP F;  2E7X A;  1ZHF A;  3VEP A;  4C30 A;  1ZRE A;  2KKO A;  4MNU A;  4E7Z A;  4IEJ A;  1MND A;  3QOD A;  5D5V B;  1OCC H;  3LSR A;  3ERM A;  2WBM A;  1OCZ H;  2EIJ H;  2OBP A;  2X6W A;  3L2U A;  1R4M B;  4XLA A;  1Y8Q B;  2B7E A;  2NVQ J;  4WXH A;  2OZ6 A;  4RLQ A;  1HOM A;  3C3W A;  3ELK A;  3S1M J;  2EA2 A;  3S1Q J;  2DMT A;  2JSP A;  4KIF A;  2L2O A;  1N75 A;  2NS7 A;  1K83 J;  2D2W A;  1XD7 A;  1DP7 P;  5FRN A;  5EGO B;  4W1U A;  4FQG A;  3M8E A;  1HCR A;  3WHB A;  1A35 A;  4X6A J;  3SYT A;  2Y9Z A;  2BOL A;  3HOU J;  1DP3 A;  4HX8 A;  1TNS A;  2IGN A;  1TL8 A;  2VT2 A;  5E1Z B;  3RI4 A;  3M07 A;  3F22 A;  4CCL A;  5DUI A;  4ETS A;  3F6V A;  3E7L A;  3CCS I;  2HDD A;  4Y13 A;  3CD6 I;  1V55 H;  5B3S H;  2XSD C;  2ESH A;  3OIP A;  3R60 A;  1OCT C;  1R1U A;  4P9F A;  2KL4 A;  2DN0 A;  3HRU A;  3RPQ A;  4Q4Z F;  4FTH A;  1H0M A;  2GIV A;  3CDI A;  3ZN0 A;  3FK6 A;  4M74 A;  4FET A;  3PNT A;  3HOW J;  4L0Z B;  3DP7 A;  1VI0 A;  2HFH A;  3HJE A;  4UV8 A;  2EJR A;  2NVT J;  2XAS A;  4HV5 A;  1UAA A;  2X1E A;  3OMY A;  1J09 A;  4FAS D;  3MFK A;  5EEA A;  3I64 A;  4L5J A;  1W5T A;  1FSE A;  3BR6 A;  2R3S A;  3HKZ A;  1U5T A;  3HB9 A;  4M9S A;  2C6Y A;  4MFD A;  5HDK A;  4Y52 J;  4HRI A;  3CC2 I;  1MZB A;  3ASO H;  3I59 B;  2A6T A;  3Q0V A;  4MHG A;  1LEA A;  3MKL A;  3O2P E;  1UG0 A;  3MAJ A;  2LF8 A;  1IJW C;  4MO7 A;  2CWE A;  2R92 J;  1E3H A;  3BG9 A;  2EV0 A;  1K78 B;  3SDG A;  5E3M A;  1ITY A;  1QHH D;  3OS1 A;  4ENN A;  3LSK A;  3J81 K;  2DMP A;  1BBY A;  4KN7 X;  1B9M A;  4LB6 B;  1SFE A;  1FOY A;  3E6M A;  4CSW A;  3GXO A;  5GTI C;  2HQA A;  2FOW A;  4IRH A;  4HAM A;  4KIT B;  2DPU A;  3IKV A;  3ZQ7 A;  3ZP5 A;  5GP9 A;  3D5R C;  3FDY A;  3WTY C;  4PCQ A;  1TQP A;  4Y17 A;  1MBF A;  3TP0 A;  3S15 J;  2FD5 A;  4PJM A;  1MDM B;  1EA3 A;  1WGX A;  2DK8 A;  4LD5 A;  4PGG A;  4D9J A;  3JTG A;  4BEH A;  1R5G A;  3LQQ A;  1W36 D;  1O3S A;  2FRH A;  3GWZ A;  2CUJ A;  3Q0U A;  5LGN A;  2JQ7 A;  1DPR A;  3MCZ A;  4JX6 A;  4M6Y A;  5BS6 A;  2MA3 A;  4M6V A;  1FMW A;  2CUE A;  1IXC A;  2X51 A;  1RES A;  3CDH A;  4MQ9 F;  3DCF A;  2GWR A;  2YX4 A;  5FFX A;  3KP2 A;  1E3P A;  1FY7 A;  5IT9 K;  3C2G A;  3FXK A;  1NG7 A;  2DK5 A;  3GF2 A;  2K85 A;  1JKQ C;  2X85 A;  3IKT A;  2WAQ A;  3EUK L;  1BM9 A;  4V2F A;  3U1K A;  2O03 A;  4LLN A;  1YHQ I;  2AXT C;  2BXZ A;  2Y75 A;  2NOG A;  2K9L A;  5J40 A;  3H9G A;  3PUF A;  1Z67 A;  4I09 A;  5DD4 A;  5J1Y A;  2W82 A;  1KU7 A;  3WTT C;  1XTA A;  3LL7 A;  3I58 A;  3OWT A;  4I01 A;  3I4N J;  2XDV A;  1RKW A;  4WK8 F;  3HIF A;  2DBB A;  3ZR8 X;  4I0A A;  1FJL A;  2PJP A;  3FKJ A;  1RUN A;  1TBX A;  4CIC A;  1SVO A;  3ABM H;  4C3I J;  1W1W E;  1YE9 A;  3W3C A;  1ZEL A;  4XMY A;  3LSP A;  1JJ6 C;  1SD5 A;  2WB1 N;  2N8G A;  4U0V A;  3DTI A;  5FGM A;  2W00 A;  1Y39 A;  2H6B A;  1MMS A;  2EIL H;  1YIT I;  2DTR A;  2LF7 A;  1TWA J;  2LKP A;  3BLY A;  3RJP A;  3L2W A;  2E2J J;  5E17 F;  2XB0 X;  3A02 A;  1JGG A;  3Q5F A;  3U2R A;  4QWQ A;  4I02 A;  1BA5 A;  4IHV A;  2LR8 A;  3L00 A;  2OJE D;  1K61 A;  1BI0 A;  1SVM A;  1WH5 A;  3GCM A;  4A3I J;  3FXQ A;  2ZME C;  1VFC A;  4KT5 C;  2EZL A;  4BXF A;  5K5Q A;  1R9T J;  3GLL A;  3P9C A;  5EZH A;  2PI0 A;  4XSZ F;  3OIQ A;  3W6V A;  4A3B J;  1IC8 A;  2ZNY A;  1UHM A;  1A31 A;  1MBG A;  2GQQ A;  4UUS A;  2EZI A;  2XAQ A;  4U0Y A;  2R7R A;  5ILS A;  1LNW A;  3QYE A;  1VQ8 I;  3UNG C;  3IAM 2;  2JTV A;  1E3O C;  2BW3 B;  3L2V A;  1BL0 A;  5L3E A;  5GPC A;  1U6G A;  4GRI A;  2FBI A;  4IHT A;  4XON A;  3AG4 H;  4Y15 A;  3FK7 A;  5D4S A;  3VWB A;  5FRO A;  5JVT A;  5DCM B;  3T1B A;  3CES A;  2HQR A;  1Y56 A;  3ZXS A;  4NB5 A;  4XK4 A;  2LG4 A;  5E8I A;  1BR1 A;  1P2F A;  3M3Y J;  4O6J A;  4CHU A;  2H1K A;  3DTE A;  2IVM A;  2GM4 A;  1UZC A;  3G2B A;  1U8R A;  1SAX A;  2VC1 A;  2QEN A;  3M1C A;  1HDD C;  3P5J A;  4LIT A;  4BNC A;  1FPQ A;  1LUJ B;  1TWH J;  3I55 I;  2E1C A;  2JA5 J;  3WGH A;  2MSY A;  3RKW A;  1PUE E;  2IGK A;  2ECB A;  4ZYH A;  2DT6 A;  2FOK A;  1IAW A;  4HF1 A;  1S9H A;  1IGN A;  3OSF A;  2DT5 A;  1IDZ A;  1KU9 A;  3GZ5 A;  3PFI A;  3VOD A;  1X1C A;  2IGO A;  5FB2 A;  1I6H J;  1G59 A;  2X6X A;  4YII A;  4DIQ A;  3IP4 B;  4BU2 A;  3ZMD A;  1I3A A;  3QOE A;  2UZK A;  1FYK A;  2HPI A;  3BR5 A;  1QBJ A;  1JGS A;  2HTJ A;  3MMY B;  2K4B A;  3X2Q H;  4BAC A;  1AU7 A;  4IX7 A;  2E1M C;  4BGD A;  3JRI A;  3GTQ J;  1ON1 A;  4DZP A;  3ASN H;  3F8B A;  3HBL A;  5B1A H;  4NQW A;  2R7T A;  1BIA A;  3HUG A;  5IT3 A;  5HDG A;  2QCO A;  3P9I A;  2GAU A;  1O7L A;  1Z9C A;  1XG1 A;  2UUZ A;  1AKH A;  3J80 Z;  3G4S I;  1QVU A;  1CF7 A;  1XGN A;  2M1B A;  1G3T A;  5E3O A;  1FTZ A;  4ZTF A;  5JR3 A;  1VTN C;  2QQ8 A;  4W97 A;  1Z7U A;  1IF1 A;  2DA4 A;  1B9N A;  2R4G A;  4UVB A;  3BR0 A;  2KQR A;  3HOX J;  2COM A;  3OYK A;  3GTG J;  3PSI A;  1TQM A;  5J6X A;  5F64 A;  4HLY A;  1WCM J;  1R1V A;  2A6H F;  1X1D A;  2HZD A;  4NC6 A;  1ZGW A;  2E7W A;  3ECO A;  1SFU A;  2FA5 A;  3VYR B;  4YFN F;  4HG2 A;  4WXD A;  2CH0 A;  2KRC A;  4KIB A;  2VBX A;  2H8R A;  1GUU A;  2PX9 A;  4F3Q A;  2K3F A;  3ZQG A;  3P7N A;  1D8J A;  1XC5 A;  1Y1V J;  5GTH C;  5IPA A;  5LHH A;  2QSF X;  2W1O A;  2FQ4 A;  1GVJ A;  2CUF A;  2GOX B;  3IH4 A;  2XRN A;  1X19 A;  4BXX J;  4AVZ A;  2VXZ A;  2KIQ A;  3LAP A;  2CQN A;  1TW2 A;  1J75 A;  5E20 A;  1G6N A;  4DQ2 A;  1GV5 A;  1ETY A;  1FC3 A;  2V1N A;  3OYD A;  2QKL B;  5TGT A;  1XGO A;  2WTE A;  3ZMZ A;  2ZNZ A;  1P4A A;  2LKX A;  4BJ6 C;  2X6O A;  3GTL J;  3HOV J;  1P4X A;  3QOP A;  4IQ4 A;  2QSG X;  3K6G A;  4WF2 A;  3FHN A;  5B66 C;  4A3F J;  4BL0 B;  2XPU A;  1ZLK A;  2E5N A;  3BT9 A;  4DNC A;  1R36 A;  4UNO A;  4LIU A;  4A93 J;  3KX2 A;  3F8M A;  4ZH4 F;  4NC7 A;  3WTV C;  3LSM A;  2NAZ A;  5CQE A;  3KEQ A;  2ZB9 A;  1FBS A;  2K86 A;  4OOI A;  2IA1 A;  3RPU D;  4O5V A;  1IZ1 A;  3E5U A;  2X1C A;  3JW4 A;  2DDB A;  2R7Q A;  1FOX A;  1RPW A;  2Z2S B;  3BG6 A;  2VE9 A;  4BEH B;  4IO9 F;  4L5I A;  3SEQ A;  4HX7 A;  4OIO F;  1W7P B;  1JTY A;  4PFO A;  4BHC A;  4RBO A;  2UWM A;  2OPT A;  3HRM A;  1X1A A;  3PM1 A;  3W2V A;  5KNL A;  4PJN A;  1EF4 A;  1YW7 A;  5ERI A;  1BI1 A;  3PQJ A;  1NG6 A;  2MD5 A;  2CQQ A;  3BOQ A;  3CC7 I;  4A2U A;  1BI3 A;  2EFQ A;  3FXJ A;  1MMD A;  3K4C A;  2DMU A;  3AKZ A;  3W2A A;  3B02 A;  3CQZ J;  3HSF A;  3FKI J;  3PIO F;  3PIP F;  4PZJ A;  4U87 A;  4RB2 C;  4S05 A;  3K70 D;  2BV6 A;  5BPI A;  3ML6 A;  4Q48 A;  2LMD A;  1EH6 A;  2W25 A;  4BHP A;  4BDZ A;  1YIJ I;  4BQA A;  2H8W A;  3ABL H;  3QPT A;  5TIS C;  3G1M A;  1ZAR A;  2PMU A;  2K5C A;  5K7H A;  1MJ9 A;  4JQF A;  3FHZ A;  1OJL A;  2X4H A;  2XV4 S;  3L09 A;  2OA4 A;  4AU7 A;  4II3 A;  2TRT A;  1OIS A;  1YRN A;  3ZQQ A;  2V1U A;  2CV0 A;  4BBS J;  2K9S A;  4AC0 A;  1IV6 A;  1Z3X A;  3KLO A;  1RUO A;  4C2U A;  2HEO A;  2MG4 A;  3I4M J;  1X58 A;  2FQ3 A;  2KDO A;  4F7Z A;  4HSR A;  3S14 J;  4OAZ A;  1P6R A;  4C3J J;  3SZT A;  4EJW A;  2MGQ A;  3IWF A;  2XVC A;  2F4O B;  3DPU A;  1I6X A;  1LVA A;  1O3R A;  2QQ9 A;  1T95 A;  4ZTJ A;  5J4V A;  1KU3 A;  3HL2 A;  2QGU A;  4XR6 A;  1PUF A;  3T8R A;  1G2H A;  1JJ8 C;  1Y0U A;  2CFO A;  2IPQ X;  4JP0 A;  3MD2 A;  2WAE A;  3OYL A;  3J7Z I;  2QYO A;  1KA8 A;  1GXQ A;  4N0B A;  5A2Q Z;  2Z5U A;  4K2E A;  2FEZ A;  1N25 A;  4JYK A;  4FIS A;  3CCU I;  2B0L A;  5D5X B;  2E1N A;  3VYS B;  2EFP A;  4LLG F;  2M7A A;  3TED A;  3KYC B;  1RR7 A;  2KFD A;  5CVU A;  5KVR A;  2I5U A;  4GO1 A;  5H6R A;  4DBR A;  3FIW A;  4G7Z F;  3AG3 H;  2QUF A;  1FOK A;  1F43 A;  2DPD A;  1YLF A;  4A5M A;  4AIJ A;  1TNT A;  4I99 C;  4EMS A;  4KDP A;  5LGT A;  4NNJ A;  2BY3 A;  4XRF A;  4M9X A;  1VQM I;  4IHS A;  2PJR A;  1ETX A;  1HBX G;  2OZU A;  2J5O A;  2O9L A;  2DA1 A;  2XGE A;  4XOR A;  2LFB A;  3WHC A;  2WA0 A;  3ERE D;  1NH3 A;  2E5Z A;  3F8F A;  4UXN A;  2F48 A;  3NQO A;  4KMF A;  2F4M B;  3BR3 A;  3AG2 H;  1MBK A;  2OCC H;  3K4M A;  5LRR A;  2BHZ A;  3QAH A;  2DCE A;  3A03 A;  4OIR F;  5J1R A;  2IJL A;  5D4R A;  1ZR2 A;  1DUX C;  2ZXH A;  1RNL A;  3JRH A;  2DFH A;  2LH9 A;  3JRC A;  2MH2 A;  2WV1 A;  4GYG A;  4D0P A;  3OYN A;  1PP8 F;  4OIQ F;  2GXG A;  2NVY J;  1UG2 A;  1D0Y A;  4IQJ A;  1VQ7 I;  4MQV A;  2IEK A;  3KLN A;  1J2X A;  2KIU A;  3J7A Y;  2CQ7 A;  2RAE A;  4XN0 A;  4UUV A;  2HQN A;  2DOD A;  4IPA A;  2RNJ A;  1XX5 A;  1GLN A;  3EPZ A;  1SAU A;  2DYR H;  2XKO A;  3BQY A;  4NQW B;  2DA7 A;  3O8G A;  1LJ9 A;  3HC7 A;  2VB6 A;  1AKH B;  3FBN B;  3A01 A;  1IRZ A;  3OYH A;  1OR7 C;  2H09 A;  2W24 A;  3OYB A;  1XMA A;  1XCV A;  3U21 A;  1A6Q A;  2VIX A;  3GTO J;  1WJE A;  4HW0 A;  3RSN A;  3F3X A;  3ZQC A;  5JLX A;  1W0U A;  3HOT A;  1X3U A;  2XF6 A;  3S16 J;  1K7A A;  1FWZ A;  5DEQ A;  2XRL A;  1ZKG A;  3CCY A;  3TDU C;  2VT3 A;  1QRY A;  5C4J J;  3LSH A;  4A0Z A;  2KP6 A;  3CO6 C;  2PMZ A;  3V42 A;  1YO5 C;  4XL9 A;  4ZYA A;  1HW5 A;  3HSE A;  3O8H A;  3C18 A;  4CZC A;  1RIO H;  2FE3 A;  2Y69 H;  2P81 A;  4A3C J;  4KJZ A;  1LDK B;  2L9N A;  1YIO A;  4A12 A;  1KGS A;  3CCR I;  5L3B A;  1AA7 A;  3ZQL A;  1ZRD A;  2XGC A;  1OCP A;  3CME I;  4XM3 A;  2IBD A;  2DQL A;  3CMA I;  9ANT A;  4RA2 A;  2R7U A;  1V5F A;  3KE2 A;  4IHY A;  4BUP A;  2Z1D A;  3BZC A;  4ESJ A;  2YS9 A;  2A3S A;  2IP2 A;  2K9Q A;  2DLL A;  2CS3 A;  3C2B A;  4E7J A;  1K4S A;  2KDZ A;  3PJR A;  3WU0 A;  4YEL A;  4BQO A;  1MKM A;  2NYX A;  3VSK A;  2HDW A;  2R5Z A;  3H1C A;  4V19 K;  1IXR C;  3ECH A;  3SXY A;  5J4Y A;  2DJI A;  4Y7N J;  2F2E A;  5EJC A;  1F36 A;  4L9V A;  2VON A;  3R6S A;  4AYB A;  5CVI A;  3WTS C;  2Y2Z A;  1QZY A;  2XAH A;  2P0W A;  3JAM Z;  5KHD A;  3RDI A;  2XB5 A;  4PJJ A;  1VF9 A;  2HPM A;  2L7M P;  2JRM A;  3FX3 A;  5FLV A;  3V7S A;  2WY7 Q;  3LNQ A;  4IKF A;  1ETQ A;  1YS7 A;  1I39 A;  1G3Y A;  1LVK A;  4B1R A;  3ZMT A;  3WG9 A;  1DDN A;  4AID A;  1MNE A;  1S6L A;  1DQU A;  2WY8 Q;  3HEF A;  2BY1 A;  1O3T A;  1L0O C;  1U0J A;  4QIW N;  3F6O A;  3U9G A;  2F5D A;  4F52 A;  2ICW G;  1HF0 A;  1R5I D;  2KPM A;  2FF4 A;  3AL0 B;  1YYV A;  5L3F A;  2VQG A;  2V1X A;  2FSW A;  3FXO A;  3V8L A;  3KIO A;  5FO5 A;  4I2O A;  2ISY A;  4A6D A;  2M87 A;  4B3A A;  3OS0 A;  3AFH A;  1S7O A;  5EYR A;  5CYV A;  3K2A A;  1V54 H;  3TOA A;  1K79 A;  3MKY B;  3RKQ A;  2KZG A;  1IRG A;  4CCN A;  5F0C A;  5KCM A;  2W84 A;  4ABZ A;  4IXA A;  1EH7 A;  2A5W A;  3OOU A;  2A69 F;  4XQF A;  2M2E A;  2VOO A;  1KYW A;  4KIS A;  3MKZ A;  1ULY A;  1W0T A;  1V5G A;  3QPH A;  1VQ6 I;  4L9J A;  5ILV A;  2P7V B;  1T38 A;  4AD9 A;  3F8N A;  1Y8R B;  2HDC A;  1D1C A;  2STT A;  2PG4 A;  2VI6 A;  2MD0 A;  3S8P A;  2GXB A;  1EKE A;  2RQP A;  1B8I A;  5D5U B;  3MZ8 A;  1LB2 A;  1U9N A;  2LTP A;  3E5X A;  1JKO C;  3VYU B;  1D1B A;  4M3D A;  4D5F A;  3QP6 A;  3ONQ A;  3KCC A;  2RQQ A;  4LFU A;  1ZTR A;  5F04 A;  3DPT A;  3HOY J;  2IGM A;  5M5W J;  1ZLJ A;  2K02 A;  3CUO A;  3K1N A;  1U5T C;  1WI3 A;  2O3F A;  2L3D A;  4HYE A;  4EM1 A;  1O57 A;  1BC8 C;  2IS4 A;  1R5H A;  2DXI A;  2XRO A;  2M0M A;  2R7W A;  5D6E A;  2BY0 A;  1XB4 A;  1BR4 A;  2FNP A;  2M5W A;  2OCE A;  1HKS A;  4B4C A;  5E3L A;  1PP7 U;  3KEY A;  2F5F A;  3BCA A;  1Z21 A;  4LK0 F;  1JT6 A;  4LMY A;  1BW6 A;  2KIF A;  2X48 A;  4H0E A;  2DDA A;  3DWL E;  2Z3Y A;  4P9U A;  2BEO A;  4CDG A;  2G7U A;  2IS1 A;  1PYV A;  2HI3 A;  2ME6 A;  4BJT A;  3G71 I;  3TW6 A;  4RMN A;  3FM5 A;  3H35 A;  3WE2 A;  2DT7 B;  1J9I A;  1VZ0 A;  3DV8 A;  3RZD J;  4BJ5 C;  5E1X A;  1MW7 A;  5HNH A;  2R7X A;  4MTE A;  4PGH A;  4A0X A;  1ZRC A;  5JI6 A;  1B4A A;  3LA2 A;  2NVX J;  2DU9 A;  1BOB A;  1JKR C;  1IDY A;  1G3S A;  3DBR B;  3FMS A;  4OMZ A;  3GX4 X;  5FJ8 J;  3B6A A;  1GVD A;  1T0F C;  4DYQ A;  4LG0 A;  2VPR A;  2MBF A;  3H0D A;  2EZH A;  3L2R A;  1RC9 A;  5KK1 A;  1QNT A;  2EB7 A;  2DAO A;  5EG0 B;  2JA8 J;  4UB8 C;  4II2 A;  2RGV A;  2HYF A;  1I3Q J;  3RPU A;  2R7V A;  1LFP A;  2EA4 A;  5AIQ A;  1JT0 A;  1ERD A;  1SEU A;  3WTZ A;  4CCJ A;  3K4N A;  3PNV A;  4IOC F;  3J7Y J;  4LJZ F;  5IOZ A;  1SC7 A;  5DCF A;  3S17 J;  2VBW A;  2W4S A;  5JHF A;  3BTI A;  3NAR A;  3KEO A;  4IHX A;  1VQN I;  2P8T A;  1HC8 A;  2CV1 A;  1LPQ A;  5AIP A;  3GEZ A;  1IW7 F;  1T56 A;  3ZPL A;  4LIV A;  5FRM A;  2UXX A;  1V4R A;  3KP4 A;  2HZT A;  4B44 A;  5HS8 A;  1MD0 A;  2F6C A;  2UXN A;  3K69 A;  2HVS A;  1O4X A;  3V8K A;  4XLE A;  1YTY A;  1T98 A;  1NK3 P;  1ZH5 A;  3W2W A;  2OU2 A;  2STW A;  4G6T B;  3B73 A;  4ENJ A;  2Q0O A;  4KT6 A;  1KU2 A;  3N05 A;  4ENM A;  1TP4 A;  2VXD A;  3Q9S A;  3A01 B;  5CVV A;  1GDT A;  4HZF A;  5HS9 A;  1VQ9 I;  3TKY A;  3K10 A;  5BPD A;  2RN7 A;  3D0S A;  4ESB A;  2E1O A;  2LNB A;  4R79 A;  3KYL A;  2H6C A;  3UKG A;  3H5N A;  2XIG A;  1KZH A;  1B72 B;  1DGW Y;  2OTL I;  2R5Y A;  2VQH A;  1WZ2 A;  5DM6 F;  5J8F A;  4BDY A;  3OS2 A;  3DLL F;  2W7N A;  1FIA A;  3GYH X;  4EJT A;  1K6Y A;  2ZC2 A;  3I5U A;  1S7E A;  2M0C A;  3SZP A;  3OYF A;  4G6Q A;  2HOE A;  2VN2 A;  2DA6 A;  1XDU A;  4RAG A;  3DFG A;  1MBJ A;  3PNY A;  4B43 A;  1Z77 A;  2RRE A;  4CYC A;  2P5L C;  1D5Y A;  1M1E B;  1LFU P;  2R7Z J;  1FBQ A;  1BN5 A;  3OYA A;  2D1H A;  4FT8 A;  2OC6 A;  4CZZ A;  4PDK A;  3PO2 J;  1WH7 A;  1UFM A;  2DA5 A;  3GO5 A;  3BCB A;  2LP0 A;  3ZN1 A;  1VQL I;  4TV7 A;  3E0J B;  2G0E A;  1P4W A;  3DKW A;  1X2N A;  4HLX A;  3AAF A;  1SMY F;  5JHU A;  5IP7 J;  2JT1 A;  2NS0 A;  2YUS A;  3EET A;  3HPG A;  3QPL A;  4D1Q A;  1IN5 A;  2VJ4 A;  2Q2E A;  3HZJ A;  2ZCW A;  1UHS A;  4ZZL A;  5EZG A;  1PVE A;  2O5R A;  1N77 A;  5EEH A;  2YU9 J;  2CW7 A;  2QSH X;  3TL4 X;  2VL8 A;  1BC7 C;  4PJ0 C;  3KP3 A;  4EM0 B;  3FIS A;  3Q0W A;  4RB3 C;  1N78 A;  1IO2 A;  3SDB A;  3T8T A;  2LBF A;  2JPB A;  4A6E A;  2XSJ C;  1KQ8 A;  5DDG A;  2P6S A;  2PN6 A;  3HGG A;  2QVO A;  2TCT A;  2X1D A;  3OR2 C;  4OIN F;  5FLX K;  4Z2Y A;  3QQA A;  2XGD A;  3FXM A;  1STZ A;  5J8C A;  1OYW A;  3GBG A;  4KIC A;  2CYY A;  3H3V K;  2CG4 A;  4ASN A;  1FLI A;  2M45 A;  4DGW B;  3S3O A;  4J01 A;  3DBL B;  4IVN A;  4N4N B;  3V4G A;  2ME0 A;  4B3X A;  1P7J A;  2VKH A;  2L02 A;  2Y0S A;  3LMM A;  3REO A;  2ECC A;  3FWE A;  1W5S A;  1LDJ A;  4G9Y A;  3BQZ A;  4A3L J;  4RM2 A;  2BGC A;  4A0Y A;  4E70 A;  2COB A;  4IF4 A;  2FX0 A;  3O6B B;  4HOB A;  4IHW A;  4FHT A;  4CCO A;  3S3N A;  4KNY A;  4XN3 A;  4E7I A;  2ZJ2 A;  2LD5 A;  4FE7 A;  4XRS G;  4ON0 A;  2HOA A;  2JN6 A;  4XIC A;  1I50 J;  3J81 Z;  1ZR4 A;  3E1S A;  1OKR A;  4HQE A;  2CV2 A;  4ZYD A;  1R4N B;  2O8K A;  1BW5 A;  3F23 A;  1LDD A;  3CP8 A;  2HYJ A;  3HYI A;  1JI8 A;  2LKS A;  2GA1 A;  2Z16 A;  2HU9 A;  4NBQ A;  2ADU A;  5C3E J;  1Q1V A;  4BY1 J;  1U5T B;  3HKZ N;  1HKT A;  3S1N J;  1EV7 A;  1FIP A;  3HHG A;  4IJA A;  4M3F A;  2NXN B;  1B8I B;  4ENK A;  2XKP A;  2I10 A;  5BNG A;  1RR8 C;  5FLM J;  2ELH A;  3L9F A;  2EV5 A;  4QSH A;  4F91 B;  5FD6 A;  4I76 A;  4M73 A;  1YX5 A;  5LFA A;  4CCK A;  5F1J A;  1VQO I;  5H2F C;  2Y48 A;  3SQN A;  2LYC A;  4RGX A;  1FYL A;  1ETW A;  3ZCO A;  2DFF A;  2B63 J;  5D8L B;  3WTX C;  1AWC A;  2EV6 A;  4DZJ A;  5D8K B;  3K0L A;  1F1Z A;  3H5R A;  2VPL A;  2QF7 A;  3SZG A;  2M8G X;  1SMT A;  3CCL I;  5IT9 Z;  3L1P A;  1X4P A;  5L3G A;  3OV8 A;  4JX5 A;  4XLC A;  3JRG A;  2RNG A;  1X1B A;  4XOT A;  1BOA A;  4E4H A;  1C0W A;  3W6K B;  3D1N I;  2F4I A;  5E1W A;  2PFB A;  3H5A A;  1TWC J;  4LG3 A;  2HGC A;  3JSP A;  3SEZ A;  4DYC A;  3HGY A;  1ETK A;  3VDX A;  4ANJ A;  1ETO A;  2ZXW H;  4A3J J;  3K2Z A;  1IN7 A;  2RKH A;  4EJU A;  2NNN A;  1YJ9 I;  5J3L A;  2Q8K A;  3CTA A;  1PJR A;  2KJC A;  2L9V A;  3H36 A;  5IP9 J;  3HRS A;  2O7O A;  1ZG1 A;  4BH9 A;  2WAQ N;  2ZXJ A;  5ICG A;  3L2Q A;  3WGG A;  5EGO A;  3I53 A;  1Z05 A;  3AL0 C;  4QTR A;  1E0E A;  1QQI A;  1RRJ A;  2JA2 A;  4ZJZ A;  4Y33 A;  1ZGA A;  3DXJ F;  3VYT B;  3SJM A;  3H3U A;  3LSG A;  1U9O A;  4HST A;  3NRV A;  3IHU A;  1A36 A;  3ZQF A;  1TT0 A;  1YS6 A;  4B09 A;  5ICC A;  3PSF A;  1Z7L A;  2L4M A;  2RDP A;  2DO7 A;  3LAJ A;  4R8H A;  5E79 C;  1FMV A;  3J7A O;  1BI2 A;  2PEX A;  5E18 F;  1A6I A;  1SAN A;  2Y30 A;  4LLL A;  2Z9O A;  2HKO A;  1HSJ A;  1K6O A;  1FX7 A;  3HTU A;  4AM3 A;  5HVQ C;  5C4X J;  2DA2 A;  4S0H B;  4D7N A;  3ABU A;  4UY8 I;  2EFW A;  1XSX A;  3EUH C;  1ZAO A;  2ELK A;  4UB6 C;  1YFH A;  3GTM J;  4P96 A;  3JSO A;  2R7F A;  3M8J A;  3IRQ A;  2LDU A;  2GXA A;  3VOE A;  1NHA A;  1YG2 A;  1H8A C;  1QPM A;  2VE8 A;  3DEE A;  2G9W A;  3V8J A;  3QYB A;  5H20 A;  2Y0M A;  1D0X A;  1FP1 D;  2CRG A;  1JKP C;  1B6A A;  4JBA A;  2HTS A;  1Z0X A;  2NS8 A;  2IXS A;  4MEX F;  3DU5 A;  5E8G A;  2ZKZ A;  3TO7 A;  2O6G E;  3G6E I;  1K78 A;  3IV5 A;  4A3M J;  3E3V A;  3N97 A;  2R5Y B;  1BJA A;  1HQC A;  2V4J C;  4UUS B;  1S8N A;  1Y1W J;  4DBQ A;  2MC3 A;  3L7W A;  4EGY A;  2LK2 A;  1ZG5 A;  3PO3 J;  1HLV A;  1J5Y A;  2BY2 A;  2H94 A;  4GCV A;  2GOM A;  4LK1 F;  4PUS A;  5LRS A;  1G4D A;  2VC0 A;  5GPA A;  2MC4 A;  3TO9 A;  2QBY A;  1ZN2 A;  3BG7 A;  4NUB A;  1WWX A;  1R58 A;  2HQ5 A;  4LOC A;  4BXU A;  3CJR B;  3CLQ A;  3CCJ I;  3EYI A;  4I0B A;  3LQR A;  3JR9 A;  3CC4 I;  3CJT B;  3GTK J;  3CJN A;  2AQF A;  1R23 A;  1T08 B;  2LOO A;  4YIF A;  1OYY A;  5ICE A;  4BQN A;  1X3W B;  3BG5 A;  3K4B A;  3WTU C;  3IUO A;  1IN6 A;  1YW9 A;  2BBY A;  2V79 A;  2L7K A;  2IS2 A;  1QZE A;  5DM7 F;  3IAS 2;  1LEB A;  4OMY A;  4ZC3 A;  1V3F A;  5M3M J;  2Q2E B;  3IH2 A;  4E6K G;  2KLO A;  3OYM A;  5L3C A;  3EUA A;  4FCY A;  4RAY A;  2PMH A;  1TC3 C;  1CQT A;  3ISP A;  3DKY A;  4MEY F;  1YOV B;  3KET A;  2IRF G;  1SFX A;  1W36 C;  3DEW A;  2CQX A;  1VND A;  4Q5S F;  4BHB A;  4L18 B;  3BJ6 A;  3PFY A;  1WKM A;  3HDD A;  4XRM A;  2K27 A;  5IYD J;  2DYS H;  2WAD A;  3S2H J;  3MWM A;  4BYY A;  1QHG A;  1MJB A;  2KIS A;  3G1L A;  2HYG D;  1ZQ3 P;  3HUG B;  1JUP A;  3IWZ A;  2DQR A;  3LA7 A;  4EAT A;  1R22 A;  1WJC A;  2F5E A;  2Y9Y A;  1YI2 I;  4QLC U;  1CF7 B;  4HBL A;  4Z6Y A;  2XPV A;  2E2H J;  2WAF A;  2R93 J;  2WB1 A;  2CW0 F;  3SHF A;  1HA8 A;  2LY1 A;  3QU6 A;  4HX4 A;  2XAF A;  5JLW A;  3KZZ A;  2P6T A;  4L0Y B;  3HSR A;  2Y0S N;  1OFC X;  3HHH A;  1LQ1 A;  1WVR A;  4Q47 A;  3OYG A;  2BE5 F;  3I9V 2;  2HR3 A;  3BTJ A;  3DQV C;  4M72 A;  3CMM A;  4PK4 A;  5HNF A;  4BE0 A;  2Z99 A;  1XPX A;  4HDV A;  2R0Q C;  1CGP A;  1OCR H;  2JZY A;  3H0G J;  3KPH A;  3NWS A;  1USS A;  3QPS A;  3ULQ B;  1JXS A;  5IYC J;  3KFW X;  3KP6 A;  4BQQ A;  1UMQ A;  3S93 A;  1QGP A;  5GAE J;  4R1H A;  2DI3 A;  2M30 A;  3KZY A;  2F5V A;  3OYI A;  3JTH A;  1YW8 A;  2VQL A;  3PUB A;  2JA6 J;  3OL4 A;  2XF5 A;  4NC8 A;  4B8X A;  3UR3 C;  2EBI A;  2ZSI B;  4BY7 J;  3COA C;  3IL2 A;  4LB5 A;  3F9K A;  1D3Y A;  1S29 A;  1WFX A;  1Z6T A;  4G6D A;  3M9A A;  2BW3 A;  2K4J A;  2RV8 A;  1WI9 A;  3I56 I;  4MGR A;  4WXC A;  4KN4 X;  4CCM A;  3SFI A;  4OIP F;  2OQG A;  3K4K A;  1JHH A;  3CUQ A;  1QU3 A;  4IL6 C;  2R7O A;  4I98 B;  5K7F A;  4J00 A;  2NVU B;  5DCM A; 
#chains in the Genus database with same CATH homology
 4ESF A;  5L3D A;  5DUK A;  3I4P A;  1R7J A;  2W85 A;  4FX4 A;  3GFM A;  5LHI A;  2O0Y A;  3G73 A;  3ABT A;  3RTR A;  1IN8 A;  4I7H A;  2MLG A;  3V7R A;  4N9H A;  3EYY A;  2L4A A;  2HKX A;  2WV0 A;  5LBQ A;  2JPC A;  2FNA A;  4RB0 A;  2NNY A;  5BOX A;  3G3Z A;  3QP5 A;  2X0L A;  2CQK A;  4S04 A;  4AVP A;  1TLH B;  1IRF A;  3WGI A;  2D45 A;  1GHC A;  1XSV A;  3ROU A;  3L2C A;  1D5V A;  2W57 A;  4GYI A;  4CGZ A;  2ESN A;  4UVC A;  4UV9 A;  3TOB A;  3DEU A;  2P5V A;  2EK5 A;  3E97 A;  1KQ0 A;  3TO6 A;  5K5O A;  3T5X A;  3J80 K;  3ZMV A;  1OYI A;  3W6J B;  2BYV E;  3TGN A;  3CLO A;  1R00 A;  3TDZ C;  2RVC A;  1SD4 A;  3RKX A;  1QO0 D;  1XN7 A;  3K1P A;  5CVJ A;  5HLH A;  1ON2 A;  3BJO A;  2IA0 A;  1ZYR F;  3LA3 A;  2FBK A;  1T39 A;  1HST A;  3I54 A;  4HF0 A;  4XBF A;  1F4K A;  1Z1D A;  2V1D A;  4KMU X;  1R1T A;  3IRR A;  2OAZ A;  1F5T A;  2QBY B;  2P7C B;  4YG2 F;  1FZP B;  3RIR A;  2L01 A;  3QU3 A;  3RYP A;  5ED4 A;  4EVI A;  2PLY A;  3WE3 A;  3BWG A;  4HA8 A;  3I0T A;  3GZ6 A;  1W7P A;  2VBZ A;  1T0F A;  1H9T A;  4ZZD A;  2WC2 A;  1FP2 A;  5TRD A;  1WSU A;  2O61 A;  4L9N A;  2HWV A;  1TQI A;  1FYM A;  4KFC A;  3GLX A;  1E17 A;  1I1G A;  2QQB A;  2VBY A;  3P9K A;  3M7G A;  4G94 A;  5EEG A;  1W4M A;  4AIH A;  2VOD A;  3IC7 A;  2ZFW A;  4U7D A;  4RGR A;  3KP5 A;  5D6F A;  4HF2 A;  5FD5 A;  5HLI A;  1XCB A;  2PQ8 A;  3LWF A;  1OPC A;  4WWC A;  2D1V A;  5BMZ A;  4HDU A;  4EQQ A;  2XAG A;  2ZBK A;  1RI7 A;  1I27 A;  2EWN A;  1SD7 A;  2MH9 A;  1TTY A;  1L3L A;  5CJ9 A;  2ZME A;  1D8K A;  1XMK A;  5ILU A;  5TJJ A;  1XGS A;  4G7H F;  2XGX A;  3LFK A;  3VFZ A;  4MTD A;  4U88 A;  3ZMS A;  4IRI A;  3KP7 A;  4P5O A;  2YX7 A;  1AOY A;  2F5C A;  2A07 F;  3SFZ A;  5HOO A;  1Q1H A;  2A61 A;  1REP C;  1B1B A;  3BRO A;  5A2Q K;  4JK1 X;  3WTW C;  3WU1 B;  3CUQ B;  3H92 A;  2GZW A;  3OOP A;  1DPU A;  4EGZ A;  2CFX A;  4O3M A;  5F6F A;  1A04 A;  3FXR A;  1EH8 A;  2VOP A;  4OU0 A;  2FMY A;  1FBU A;  5H6Q A;  4ZYE A;  1JE8 A;  2R7D A;  1O7F A;  1UST A;  1J0R A;  3EQL F;  3GVA A;  3MZH A;  1MGT A;  4IRG A;  2KJB A;  3BPV A;  2MLK A;  4GXO A;  2IT0 A;  4G8X A;  4XSX F;  2IW5 A;  3BP8 A;  1RZ4 A;  3FM3 A;  1BIB A;  2CGP A;  1FNN A;  5F1R A;  5CVR A;  1U2W A;  3BPX A;  4EM2 A;  1WRJ A;  3FMR A;  2H27 A;  4G7O F;  1XGM A;  5K1Y A;  1F9N A;  1XSD A;  2ETH A;  1ZGJ A;  1IN4 A;  4RB1 A;  3BJA A;  4RGU A;  2KIM A;  5HS7 A;  3EDP A;  2QWW A;  1HW2 A;  1UB9 A;  2XUB A;  4GGG A;  2O8X A;  4M9Z A;  3TQN A;  3BDD A;  5LEJ A;  5ICF A;  1HKQ A;  1G3W A;  2EFN A;  4P55 A;  2ISZ A;  1W7P D;  3C7J A;  4N9I A;  1ZG3 A;  2YU3 A;  3PQK A;  3K1M A;  2OQR A;  1MJA A;  1TW3 A;  3M1E A;  2CO5 A;  3K9T A;  2JSC A;  2EFO A;  3S2W A;  4AIK A;  4ZYG A;  4BAY A;  2FU4 A;  3CO7 C;  1HW1 A;  3C1D A;  3BY6 A;  3DPL C;  2JRT A;  1J7K A;  4LG0 B;  4XLN F;  2YR2 A;  4UHT A;  1UCR A;  2G7H A;  1UHW A;  1QZZ A;  5FFZ A;  1ONV A;  1Z91 A;  1O3Q A;  3JAM K;  3ZMU A;  3E6B A;  2P5K A;  1J59 A;  4RS8 A;  5CLS A;  1S3J A;  1E2X A;  3U1D A;  2ACJ A;  2GA2 A;  3E5Q A;  3VB2 A;  1FT9 A;  4L9T A;  3BZ6 A;  1KYZ A;  3GFL A;  3V7C A;  3M8F A;  5HDN A;  2DW4 A;  3HOS A;  3EUH A;  2IA2 A;  2PBI A;  4KA4 A;  1WQ2 A;  1T2K A;  4KUM A;  3I59 A;  2FML A;  2WWY A;  2L54 A;  1I1S A;  4HV6 A;  5BQT A;  3RYR A;  2YSR A;  5DD8 A;  3GUD A;  4EV0 A;  4CXF A;  2ZME B;  1KQ9 A;  2KRF A;  1I5Z A;  5LHG A;  1JHF A;  2V6C A;  2RC4 A;  4YFK F;  2A68 F;  5JFR A;  3T0Y A;  2ZO4 A;  5DYM A;  1MDM A;  3LST A;  3RKY A;  3FZV A;  1SD6 A;  2CSO A;  2LSO A;  2HS5 A;  3N4M A;  1ZRF A;  3NEU A;  3R0J A;  1IUY A;  2A6E F;  2AS5 F;  1ODD A;  3E6D A;  4XLP F;  5FLX Z;  3HRT A;  4UVA A;  4YFX F;  3GW2 A;  2FBH A;  3GFJ A;  2YPR A;  2QZ8 A;  3D5L A;  1OMI A;  4HQM A;  3F21 A;  4NHJ A;  3I71 A;  4EJV A;  4RAZ A;  4EJO A;  4U7B A;  1Z6R A;  5HLG A;  2OD5 A;  5DV5 A;  1PDN C;  1T6S A;  5AON A;  1U78 A;  1U3E M;  3H3Z A;  3WOD F;  2TDX A;  1FSH A;  3FMQ A;  1OR7 A;  4CO8 A;  3GFI A;  4KYW A;  5LLQ A;  4FX0 A;  1S7A A;  2V9V A;  4U0W A;  3F72 A;  4WX9 A;  3FF5 A;  3QRF F;  1XDS A;  2K7L A;  3R0A A;  2M8E A;  3Q9V A;  3E6C C;  3DF8 A;  4CYD A;  2NRA C;  2P4W A;  5LGU A;  3MZY A;  1B59 A;  4KIG A;  1HXD A;  2A5Y B;  3R61 A;  3FXU A;  2FXA A;  4WCG A;  4A5N A;  1GXP A;  3HTS B;  4AWX B;  3MEX A;  4RGS A;  1P92 A;  3F8C A;  3R4K A;  5D5W B;  5K5R A;  2QM3 A;  6PAX A;  3MQ0 A;  2J5P A;  2QLZ A;  3CUQ C;  4M71 A;  2Z33 A;  4LGW A;  4M6X A;  2QQA A;  2XHK A;  3O3K A;  1IXS B;  5LEK A;  2DFI A;  1H9G A;  1YQA A;  2AXL A;  2XAJ A;  2E7X A;  1ZHF A;  3VEP A;  1ZRE A;  2KKO A;  4MNU A;  5D5V B;  2OBP A;  4WXH A;  2OZ6 A;  3C3W A;  3ELK A;  2EA2 A;  4KIF A;  2D2W A;  1XD7 A;  1DP7 P;  3M8E A;  4HX8 A;  1TNS A;  2VT2 A;  5E1Z B;  3RI4 A;  3F22 A;  5DUI A;  4ETS A;  3F6V A;  4Y13 A;  2ESH A;  3R60 A;  1R1U A;  4P9F A;  3HRU A;  3RPQ A;  4Q4Z F;  1H0M A;  2GIV A;  3ZN0 A;  4M74 A;  4L0Z B;  3DP7 A;  2HFH A;  4UV8 A;  2EJR A;  2XAS A;  4HV5 A;  3MFK A;  3I64 A;  4L5J A;  1W5T A;  1FSE A;  2R3S A;  1U5T A;  4M9S A;  2C6Y A;  5HDK A;  1MZB A;  3I59 B;  4MHG A;  1LEA A;  3O2P E;  3MAJ A;  2LF8 A;  2CWE A;  2EV0 A;  1K78 B;  4ENN A;  3J81 K;  1BBY A;  4KN7 X;  1B9M A;  4LB6 B;  1SFE A;  3E6M A;  3GXO A;  4IRH A;  4HAM A;  2DPU A;  3IKV A;  3ZQ7 A;  3ZP5 A;  3WTY C;  4PCQ A;  1TQP A;  4Y17 A;  1MDM B;  3JTG A;  2DK8 A;  4LD5 A;  4PGG A;  1R5G A;  3LQQ A;  1O3S A;  2FRH A;  3GWZ A;  5LGN A;  1DPR A;  3MCZ A;  4M6Y A;  5BS6 A;  2MA3 A;  1IXC A;  3CDH A;  4MQ9 F;  2GWR A;  2YX4 A;  5FFX A;  3KP2 A;  1FY7 A;  5IT9 K;  2DK5 A;  3GF2 A;  3IKT A;  1BM9 A;  2O03 A;  4LLN A;  2Y75 A;  1KU7 A;  5DD4 A;  4I09 A;  3WTT C;  3I58 A;  4I01 A;  4WK8 F;  3HIF A;  2DBB A;  4I0A A;  2PJP A;  1RUN A;  1TBX A;  4CIC A;  1SD5 A;  4U0V A;  5FGM A;  2H6B A;  2DTR A;  2LF7 A;  2LKP A;  3RJP A;  5E17 F;  3Q5F A;  3U2R A;  4QWQ A;  4I02 A;  3L00 A;  1BI0 A;  3FXQ A;  4KT5 C;  5K5Q A;  3P9C A;  2PI0 A;  4XSZ F;  2ZNY A;  1UHM A;  2GQQ A;  4U0Y A;  2XAQ A;  5ILS A;  1LNW A;  2JTV A;  5L3E A;  1U6G A;  2FBI A;  4IHT A;  4Y15 A;  5D4S A;  5JVT A;  5DCM B;  3T1B A;  2HQR A;  4NB5 A;  5E8I A;  1P2F A;  4O6J A;  4CHU A;  2IVM A;  1SAX A;  1U8R A;  2VC1 A;  2QEN A;  4BNC A;  1FPQ A;  2E1C A;  3WGH A;  3RKW A;  1PUE E;  4ZYH A;  2FOK A;  1IAW A;  4HF1 A;  2DT5 A;  1KU9 A;  3GZ5 A;  3PFI A;  3VOD A;  5FB2 A;  4YII A;  3ZMD A;  2UZK A;  1FYK A;  1QBJ A;  1JGS A;  2HTJ A;  2K4B A;  1ON1 A;  3F8B A;  4NQW A;  1BIA A;  3HUG A;  5IT3 A;  5HDG A;  3P9I A;  2GAU A;  1O7L A;  1Z9C A;  3J80 Z;  1CF7 A;  1XGN A;  2M1B A;  1G3T A;  5JR3 A;  1VTN C;  1Z7U A;  1IF1 A;  1B9N A;  4UVB A;  2COM A;  1TQM A;  5J6X A;  5F64 A;  4HLY A;  1R1V A;  2A6H F;  2E7W A;  3ECO A;  1SFU A;  2FA5 A;  4YFN F;  4WXD A;  4KIB A;  2VBX A;  1D8J A;  3P7N A;  5LHH A;  1GVJ A;  2XRN A;  2VXZ A;  3LAP A;  1TW2 A;  1J75 A;  5E20 A;  1G6N A;  4DQ2 A;  1FC3 A;  1XGO A;  2WTE A;  3ZMZ A;  2ZNZ A;  1P4A A;  1P4X A;  3QOP A;  4WF2 A;  1ZLK A;  4DNC A;  1R36 A;  4UNO A;  3F8M A;  4ZH4 F;  3WTV C;  2NAZ A;  3KEQ A;  1FBS A;  2K86 A;  4OOI A;  2IA1 A;  4O5V A;  1IZ1 A;  3E5U A;  3JW4 A;  2VE9 A;  4OIO F;  4L5I A;  4HX7 A;  1W7P B;  4BHC A;  2UWM A;  3HRM A;  1YW7 A;  5ERI A;  1BI1 A;  3PQJ A;  2MD5 A;  3BOQ A;  4A2U A;  1BI3 A;  2EFQ A;  3B02 A;  3HSF A;  4PZJ A;  4RB2 C;  4S05 A;  2BV6 A;  5BPI A;  3ML6 A;  4Q48 A;  1EH6 A;  2W25 A;  4BHP A;  4BQA A;  3QPT A;  1ZAR A;  2PMU A;  1MJ9 A;  4JQF A;  3FHZ A;  2X4H A;  2XV4 S;  3L09 A;  2OA4 A;  2V1U A;  1RUO A;  3KLO A;  2HEO A;  2FQ3 A;  4F7Z A;  1P6R A;  3SZT A;  4EJW A;  3IWF A;  2XVC A;  1I6X A;  1LVA A;  1O3R A;  2QQ9 A;  1KU3 A;  3T8R A;  1Y0U A;  2IPQ X;  2QYO A;  1KA8 A;  1GXQ A;  4N0B A;  5A2Q Z;  2Z5U A;  4K2E A;  2FEZ A;  2B0L A;  5D5X B;  2E1N A;  2EFP A;  4LLG F;  5CVU A;  5KVR A;  5H6R A;  4GO1 A;  4G7Z F;  2QUF A;  1FOK A;  2DPD A;  4A5M A;  1YLF A;  4AIJ A;  1TNT A;  4KDP A;  4EMS A;  5LGT A;  4XRF A;  4M9X A;  4IHS A;  1HBX G;  2OZU A;  2J5O A;  3ERE D;  3F8F A;  4UXN A;  3NQO A;  4KMF A;  5LRR A;  3QAH A;  4OIR F;  2IJL A;  5D4R A;  1DUX C;  1RNL A;  2MH2 A;  4D0P A;  4GYG A;  1PP8 F;  4OIQ F;  2GXG A;  4MQV A;  3KLN A;  1J2X A;  2KIU A;  4UUV A;  2HQN A;  4IPA A;  2RNJ A;  2XKO A;  1LJ9 A;  2H09 A;  2W24 A;  1XMA A;  1XCV A;  4HW0 A;  3F3X A;  3HOT A;  1X3U A;  1K7A A;  1FWZ A;  5DEQ A;  3TDU C;  2VT3 A;  4A0Z A;  3CO6 C;  1YO5 C;  1HW5 A;  3HSE A;  3C18 A;  1RIO H;  2FE3 A;  1LDK B;  1YIO A;  4A12 A;  1KGS A;  5L3B A;  1ZRD A;  2DQL A;  3KE2 A;  4ESJ A;  2A3S A;  2IP2 A;  2DLL A;  3WU0 A;  1MKM A;  2NYX A;  1IXR C;  3ECH A;  3SXY A;  2F2E A;  4L9V A;  2VON A;  3R6S A;  5CVI A;  3WTS C;  1QZY A;  2XAH A;  3JAM Z;  3RDI A;  3FX3 A;  3V7S A;  1YS7 A;  1G3Y A;  3ZMT A;  3WG9 A;  1DDN A;  1S6L A;  1O3T A;  1L0O C;  3F6O A;  3U9G A;  2F5D A;  2FF4 A;  1YYV A;  5L3F A;  2V1X A;  2FSW A;  3V8L A;  5FO5 A;  4I2O A;  2ISY A;  4A6D A;  2M87 A;  1S7O A;  5CYV A;  1K79 A;  3TOA A;  1IRG A;  2W84 A;  4IXA A;  1EH7 A;  2A69 F;  2VOO A;  1KYW A;  1ULY A;  3QPH A;  4L9J A;  5ILV A;  2P7V B;  1T38 A;  4AD9 A;  3F8N A;  2HDC A;  2STT A;  2PG4 A;  2GXB A;  2RQP A;  5D5U B;  1LB2 A;  3E5X A;  3QP6 A;  3KCC A;  4LFU A;  3DPT A;  1ZLJ A;  2K02 A;  3CUO A;  3K1N A;  1U5T C;  2O3F A;  4EM1 A;  2L3D A;  4HYE A;  1O57 A;  1BC8 C;  1R5H A;  2XRO A;  5D6E A;  1XB4 A;  2FNP A;  2M5W A;  1HKS A;  1PP7 U;  2F5F A;  4LK0 F;  4LMY A;  2KIF A;  4H0E A;  2Z3Y A;  4P9U A;  2BEO A;  4CDG A;  2G7U A;  3FM5 A;  3WE2 A;  1J9I A;  3DV8 A;  5E1X A;  4MTE A;  4PGH A;  4A0X A;  1ZRC A;  5JI6 A;  1B4A A;  3LA2 A;  2DU9 A;  3FMS A;  1G3S A;  3GX4 X;  4OMZ A;  4LG0 A;  2MBF A;  5KK1 A;  1QNT A;  2EB7 A;  2DAO A;  2RGV A;  2HYF A;  3RPU A;  2EA4 A;  5AIQ A;  3WTZ A;  4LJZ F;  5DCF A;  2VBW A;  3KEO A;  2P8T A;  5AIP A;  3GEZ A;  1IW7 F;  3ZPL A;  2UXX A;  1V4R A;  3KP4 A;  2HZT A;  5HS8 A;  1MD0 A;  2UXN A;  3K69 A;  3V8K A;  1YTY A;  1T98 A;  1ZH5 A;  2OU2 A;  2STW A;  3B73 A;  4ENJ A;  2Q0O A;  1KU2 A;  4ENM A;  3Q9S A;  5CVV A;  4HZF A;  5HS9 A;  3TKY A;  5BPD A;  2RN7 A;  3D0S A;  4ESB A;  2LNB A;  4R79 A;  2H6C A;  2XIG A;  5J8F A;  3GYH X;  4EJT A;  3I5U A;  3SZP A;  4G6Q A;  2HOE A;  2VN2 A;  1XDU A;  3DFG A;  2P5L C;  1FBQ A;  1BN5 A;  2D1H A;  4FT8 A;  4CZZ A;  4PDK A;  1UFM A;  3GO5 A;  3ZN1 A;  4TV7 A;  1P4W A;  3DKW A;  4HLX A;  3AAF A;  1SMY F;  5JHU A;  2JT1 A;  2NS0 A;  3EET A;  1IN5 A;  2Q2E A;  2ZCW A;  4ZZL A;  5EEH A;  1BC7 C;  3KP3 A;  4EM0 B;  4RB3 C;  3T8T A;  2JPB A;  4A6E A;  1KQ8 A;  5DDG A;  2P6S A;  2PN6 A;  4OIN F;  2QVO A;  5FLX K;  4Z2Y A;  1STZ A;  5J8C A;  1OYW A;  4KIC A;  2CYY A;  2CG4 A;  4ASN A;  1FLI A;  2M45 A;  4IVN A;  3V4G A;  2L02 A;  3REO A;  3FWE A;  1W5S A;  1LDJ A;  4G9Y A;  2BGC A;  4A0Y A;  4E70 A;  4IF4 A;  3O6B B;  4HOB A;  4FHT A;  4KNY A;  2ZJ2 A;  4ON0 A;  3J81 Z;  4HQE A;  1OKR A;  4ZYD A;  3F23 A;  1LDD A;  3HYI A;  2GA1 A;  2ADU A;  1HKT A;  1U5T B;  1EV7 A;  3HHG A;  4IJA A;  4ENK A;  2XKP A;  2ELH A;  3L9F A;  2EV5 A;  5FD6 A;  4M73 A;  2Y48 A;  3SQN A;  4RGX A;  1FYL A;  5D8L B;  3WTX C;  1AWC A;  2EV6 A;  5D8K B;  3K0L A;  1F1Z A;  5IT9 Z;  1SMT A;  5L3G A;  3OV8 A;  1C0W A;  1BOA A;  3W6K B;  5E1W A;  2PFB A;  2HGC A;  3JSP A;  3K2Z A;  4EJU A;  1IN7 A;  2RKH A;  2NNN A;  2Q8K A;  3CTA A;  2KJC A;  3HRS A;  1ZG1 A;  4BH9 A;  2ZXJ A;  5ICG A;  3WGG A;  3I53 A;  1Z05 A;  1QQI A;  1ZGA A;  3DXJ F;  3H3U A;  3NRV A;  3IHU A;  1YS6 A;  4B09 A;  5ICC A;  2L4M A;  2RDP A;  2DO7 A;  3LAJ A;  4R8H A;  3J7A O;  1BI2 A;  2PEX A;  5E18 F;  4LLL A;  2Z9O A;  2HKO A;  1HSJ A;  1K6O A;  1FX7 A;  3HTU A;  5HVQ C;  3ABU A;  2EFW A;  1XSX A;  1ZAO A;  1YFH A;  4P96 A;  3JSO A;  2R7F A;  3IRQ A;  2LDU A;  3VOE A;  1NHA A;  1YG2 A;  1QPM A;  2VE8 A;  3V8J A;  2G9W A;  5H20 A;  2Y0M A;  1FP1 D;  1B6A A;  4JBA A;  2HTS A;  4MEX F;  5E8G A;  2ZKZ A;  3TO7 A;  2O6G E;  1K78 A;  3E3V A;  3N97 A;  1BJA A;  1HQC A;  1S8N A;  2MC3 A;  3L7W A;  4EGY A;  1ZG5 A;  1J5Y A;  2H94 A;  4GCV A;  4LK1 F;  1G4D A;  5LRS A;  2VC0 A;  3TO9 A;  2QBY A;  1ZN2 A;  1WWX A;  1R58 A;  4BXU A;  3EYI A;  4I0B A;  3LQR A;  3CJN A;  1R23 A;  4YIF A;  1OYY A;  5ICE A;  3WTU C;  1IN6 A;  1YW9 A;  2BBY A;  2V79 A;  1LEB A;  4OMY A;  1V3F A;  5L3C A;  4RAY A;  2PMH A;  3ISP A;  4MEY F;  3KET A;  2IRF G;  1SFX A;  4Q5S F;  4BHB A;  4L18 B;  3BJ6 A;  1WKM A;  2K27 A;  3MWM A;  4BYY A;  1MJB A;  2HYG D;  3IWZ A;  2DQR A;  3LA7 A;  1R22 A;  2F5E A;  4QLC U;  1CF7 B;  4HBL A;  2CW0 F;  3SHF A;  3QU6 A;  4HX4 A;  2XAF A;  3KZZ A;  2P6T A;  4L0Y B;  3HSR A;  3HHH A;  1LQ1 A;  4Q47 A;  2BE5 F;  2HR3 A;  3DQV C;  4M72 A;  2Z99 A;  4HDV A;  1CGP A;  2JZY A;  1USS A;  3ULQ B;  1JXS A;  3KFW X;  3KP6 A;  1QGP A;  4R1H A;  2DI3 A;  2M30 A;  3KZY A;  3JTH A;  1YW8 A;  4B8X A;  3COA C;  3IL2 A;  4LB5 A;  1D3Y A;  1S29 A;  1Z6T A;  4G6D A;  3M9A A;  2K4J A;  2RV8 A;  1WI9 A;  4MGR A;  4WXC A;  4KN4 X;  4OIP F;  2OQG A;  1JHH A;  3CUQ A;  4I98 B;  5DCM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...