2D1VA

Crystal structure of dna-binding domain of bacillus subtilis yycf
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
103
structure length
103
Chain Sequence
SSNEIHIGSLVIFPDAYVVSKRDETIELTHREFELLHYLAKHIGQVMTREHLLQTVWGYDYFGDVRTVDVTVRRLREKIEDNPSHPNWIVTRRGVGYYLRNPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Response regulator YycF essential for bacterial growth: X-ray crystal structure of the DNA-binding domain and its PhoB-like DNA recognition motif
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
molecule keywords Transcriptional regulatory protein yycF
total genus 28
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2005-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2d1vA00
4KA4A 3QP5A 3L2CA 5DEQA 3MAJA 2RGVA 4M9XA 1ZG3A 1XB4A 1FP1D 3M7GA 2P5LC 1R1TA 2KIFA 4L9JA 2F2EA 4MHGA 4KT5C 4EJVA 6PAXA 4L5IA 2CQKA 3E3VA 3IRRA 2V9VA 5D5UB 1YS6A 1WRJA 3IWFA 5BS6A 3J80Z 4BYYA 3P9IA 3QPTA 1ZARA 4LLNA 3BOQA 4U0WA 3KE2A 3R61A 5HLGA 2OU2A 1TTYA 3K69A 1F4KA 3JSOA 5DCMA 4EM0B 1YTYA 2ZFWA 3O2PE 4GGGA 2H6BA 1UHMA 4LGWA 3AAFA 3RKYA 2KIUA 2XASA 5HS9A 5CLSA 3S2WA 3KLNA 1SFEA 3JW4A 2RVCA 2VC1A 3J81Z 1U5TC 2DFIA 1Z6RA 1ZLJA 2GZWA 2QVOA 1R5GA 5FD5A 1S3JA 3GZ6A 1HSJA 3K1PA 4U0YA 3VOEA 2EK5A 1IN5A 1D3YA 4AVPA 1L0OC 3I64A 1R36A 2VBZA 2MH9A 2G7HA 2OBPA 1QZYA 1XCVA 3WU0A 2C6YA 3I5UA 3ZMVA 2XUBA 1K79A 3ZMUA 3HOTA 5LBQA 4HDUA 1FC3A 1X3UA 3K9TA 2V1DA 2CG4A 1MGTA 5LGTA 1Z9CA 2ZMEA 3LA3A 3IC7A 4FHTA 1S6LA 4IHSA 4YIFA 2JSCA 2DPUA 2WV0A 2XV4S 4A6EA 1FLIA 1ONVA 5IT3A 5FFXA 2NRAC 5EEHA 3WG9A 4NB5A 4KDPA 5KVRA 4Z2YA 2Q0OA 2KIMA 1TQMA 4OMZA 4HX4A 2FMLA 5HDGA 4HZFA 5TRDA 1R23A 3QP6A 4YG2F 4WK8F 4CO8A 4MEYF 2PI0A 1SD6A 3RKWA 1I27A 4EMSA 5ICCA 1HKTA 5FO5A 2XRNA 2UWMA 1BI3A 2MD5A 2VODA 4Y17A 3KP5A 1ZREA 1JHHA 1T38A 1W5TA 3IRQA 5HVQC 3HUGA 3ZMSA 1W7PA 3M8FA 4IRGA 1U2WA 2TDXA 4Y15A 1T2KA 3I71A 3I59B 4HYEA 2BYVE 4CGZA 4IXAA 1PP7U 1HW5A 4A0ZA 2RDPA 4RB1A 3EETA 2HQNA 2W24A 3D0SA 2M5WA 2FBHA 2YR2A 4KIFA 1O7FA 1MD0A 3R60A 2VT2A 3V8KA 4O6JA 5D4SA 4WXDA 2EA2A 1MKMA 3KP6A 4XSXF 2XKPA 1P92A 4P96A 4GXOA 3ULQB 3QPHA 3T1BA 4I02A 5FB2A 4BQAA 1LDJA 2HWVA 3I53A 1B1BA 4L9VA 1BBYA 2D1VA 5K5RA 1W7PD 1ZN2A 2OZ6A 4I0AA 1GXPA 2XAFA 5D8KB 3ABUA 1BM9A 3BPXA 1KU9A 2FEZA 3HHHA 3GO5A 4I7HA 4BHPA 5L3EA 4P55A 2VN2A 4M74A 4HLYA 3IL2A 3QRFF 4R1HA 1DUXC 2BEOA 1U5TA 3RYRA 1JHFA 1Z1DA 3C3WA 2W85A 3BJ6A 4ENKA 3Q9VA 5F1RA 1IAWA 1IXSB 2LSOA 1YW9A 2PMHA 3E5QA 5E8GA 5LHHA 1OKRA 1XD7A 1U8RA 2L54A 1IN7A 2EV6A 2V6CA 4FX4A 3ISPA 3ECOA 2DI3A 3Q5FA 1V3FA 1BJAA 4HV5A 2EV0A 4EJWA 1W5SA 1TNTA 5DUKA 3LAJA 3V7SA 3FF5A 3ZP5A 2M30A 5DDGA 1XGSA 2GXBA 2MC3A 1BI1A 2OZUA 2E1CA 4BAYA 4HF2A 2PJPA 2CSOA 2JTVA 1H9TA 1U3EM 2J5PA 5D8LB 3DKWA 3ML6A 5JR3A 2NNNA 1HSTA 2IRFG 1Z6TA 4U7BA 4DQ2A 3RJPA 3ZPLA 2ESHA 4CICA 2QQAA 4RGSA 2M1BA 3HYIA 2M8EA 3PFIA 2FRHA 2O3FA 2H94A 3KP3A 3WTYC 5CVUA 3H92A 3V8LA 1H9GA 2LDUA 2Q2EA 2HKXA 1PP8F 1W7PB 4HBLA 1G3TA 3FHZA 2P7VB 4OIRF 1BC7C 1R00A 3SFZA 3L09A 3K0LA 1T6SA 1R1VA 3JSPA 4RGRA 2MA3A 3KEQA 1IN6A 5E1XA 3RTRA 1KU2A 3F8MA 2QYOA 4L18B 3WE2A 2M87A 2HYGD 3PQJA 3NRVA 2FXAA 4H0EA 4YFNF 2QBYB 1IN4A 1S7OA 2GA1A 4IHTA 2A69F 3U2RA 1RZ4A 3RIRA 2EA4A 4AIKA 1B9NA 3SXYA 1IRGA 5ILUA 1CGPA 4HAMA 1XSDA 1IN8A 2K86A 4MGRA 5LHGA 3I0TA 1E2XA 4S04A 4HF1A 2P7CB 2ISZA 4P9FA 4A12A 4ZYHA 2DU9A 4ZYGA 2R7FA 4UV8A 1OYWA 1TBXA 2EFWA 5H6RA 1TW2A 2UZKA 3GFLA 3H3ZA 1A04A 4M9SA 3WGIA 4EGYA 4GO1A 3WTUC 1HKSA 2PEXA 4GYIA 4CYDA 2A3SA 3TO7A 5HLIA 2GXGA 5FD6A 4L0YB 5BOXA 2MBFA 2HEOA 1B6AA 3P9CA 1JXSA 1V4RA 5D6EA 3C1DA 4BHCA 4NHJA 5H6QA 3V8JA 1J5YA 2DPDA 4BNCA 1QNTA 3RYPA 1I5ZA 2COMA 3HSRA 1R5HA 2P8TA 4EQQA 2PLYA 2GIVA 1PDNC 3ZQ7A 1S8NA 1MJ9A 2HTSA 3D5LA 3TDUC 1REPC 3HSFA 3VODA 5LEKA 5JHUA 4LJZF 2LF8A 2CFXA 3ZMZA 2W25A 1YIOA 2L4MA 4CDGA 4F7ZA 1Z91A 1R1UA 3CLOA 2HKOA 3ROUA 2A6EF 3FMQA 3N4MA 3F8FA 2ZCWA 2IA2A 1GHCA 1ZHFA 3TOAA 1ZGJA 1Q1HA 2A5YB 3E6DA 4I09A 2P5VA 4CXFA 1WI9A 3MEXA 5CJ9A 5FLXK 3K1MA 1D5VA 2R3SA 2Z9OA 2HR3A 1GXQA 4KIBA 3JTGA 1O57A 4UXNA 4EM1A 4YFXF 2DK8A 2EFQA 3RPUA 2X4HA 3GVAA 4IJAA 2ZNZA 3G73A 5J6XA 3HTSB 1YS7A 1LEAA 2XKOA 2ZMEB 4G7HF 2JPBA 5IT9Z 3ZMDA 2NNYA 2FQ3A 3FXQA 2MLGA 4DNCA 4HLXA 1KQ9A 2UXXA 1YG2A 2CYYA 4Q5SF 1H0MA 1FYKA 1F1ZA 3SZPA 4HOBA 4M6XA 1ON1A 1FYLA 1YW7A 1SAXA 4UV9A 2H6CA 1QZZA 1SD5A 2QBYA 4LB6B 1ZG5A 4L9TA 3DFGA 5LGNA 2FF4A 5FLXZ 3EQLF 2HGCA 1ZH5A 4R8HA 1USSA 2STTA 3V7RA 5J8CA 3TO6A 1FWZA 4AIHA 3SQNA 3J80K 5HDNA 2XAJA 2FOKA 3GYHX 1ZGAA 3LWFA 4QLCU 4L0ZB 3IKVA 2NAZA 4N9HA 3RPQA 5ICFA 5IT9K 1LVAA 2QQ9A 3HHGA 2ZO4A 2VONA 3QOPA 3IWZA 2EFPA 1F5TA 2P6TA 2K4JA 1G3WA 2ADUA 1SFUA 1FPQA 4ZZDA 3CUQB 3LA2A 2D2WA 5E20A 1T39A 4KN4X 1OMIA 4EM2A 3HRMA 3L7WA 1UFMA 1OYYA 2YX7A 2HZTA 1GVJA 1IUYA 1S7AA 1O3SA 1PUEE 3TKYA 1XGMA 2LKPA 2OA4A 3W6KB 2PG4A 4A0YA 2DT5A 3T5XA 1HQCA 4PZJA 4FT8A 4ENNA 5DCFA 1RNLA 1G6NA 4KN7X 3RDIA 3E97A 4A0XA 3FMRA 3W6JB 3WTWC 2Z5UA 3BJOA 5LRSA 5E8IA 3E5UA 3FMSA 5D5XB 1OYIA 3F8CA 1IZ1A 3HRTA 2OQRA 4LFUA 4PGHA 2VXZA 2X0LA 4A2UA 2QUFA 4KFCA 4KMFA 4ENJA 2A68F 1FYMA 1B59A 5EEGA 3GW2A 3KEOA 2CO5A 3KZYA 1FBSA 3GEZA 1J75A 1B9MA 2FA5A 4Q4ZF 2DLLA 3R4KA 5CVVA 1LQ1A 4M9ZA 1LB2A 1UCRA 5HLHA 2KJCA 4LK0F 4A6DA 2K02A 2LNBA 3GFMA 1RI7A 2VBYA 2Y48A 1SMYF 2EB7A 4AD9A 5D4RA 3DP7A 3BWGA 2XAGA 3DXJF 3FWEA 3N97A 1FBQA 4G7ZF 5D6FA 2OQGA 2A07F 2XIGA 1DPRA 4YIIA 3QAHA 1LDKB 4KIGA 1XGNA 4O5VA 1P2FA 1ZRFA 4U7DA 2BBYA 1K6OA 1HBXG 2RC4A 1JE8A 2F5FA 2V1UA 4UVAA 5ERIA 3CJNA 1R7JA 1ULYA 5TJJA 5ICEA 4ZH4F 3O6BB 4PCQA 1KU7A 4KYWA 4Q48A 1K78A 2A61A 4G6DA 4B8XA 3F21A 1UHWA 1AOYA 1WWXA 3ERED 3L00A 3SHFA 2IA1A 2KRFA 3GWZA 2Y75A 1O3QA 3WTXC 1HXDA 3ECHA 4EJTA 4HX7A 3EYYA 2ETHA 3CO7C 1MJAA 2QLZA 3KCCA 1R22A 2OAZA 4XBFA 3F8NA 4RAZA 3CO6C 2KJBA 1XCBA 3KP2A 3V4GA 3QU3A 3WU1B 3H3UA 2F5CA 3BROA 1FY7A 2ZJ2A 5DYMA 1BI0A 1SD7A 4AIJA 3IKTA 5JI6A 5AIQA 2O8XA 3GX4X 2HS5A 3T0YA 4OINF 5A2QZ 1XSVA 2H27A 4EGZA 4IVNA 3MQ0A 2RQPA 5LLQA 5KK1A 2WWYA 1J0RA 5BPIA 2L4AA 5L3DA 1LEBA 3OV8A 5J8FA 3U9GA 4OIQF 4LLGF 1STZA 4XSZF 3ZN1A 2ZBKA 2NS0A 4MTDA 2DBBA 1K78B 1P4WA 5HS7A 3REOA 3R0AA 3WTVC 1BIBA 1U6GA 1TW3A 3F23A 1L3LA 1XSXA 3GFJA 1I1GA 5H20A 5ED4A 4XLNF 3G3ZA 2Z33A 4CZZA 3GXOA 2XGXA 5DD8A 4P9UA 2YSRA 4GYGA 3F8BA 1TQPA 1BN5A 3ELKA 1MDMB 4FX0A 1R58A 4N0BA 2H09A 5L3FA 4Q47A 4L9NA 1U5TB 2IW5A 5LRRA 3P7NA 5DCMB 4IRIA 1T98A 4ON0A 1HW2A 2XHKA 3KFWX 4K2EA 3F72A 2VC0A 4JQFA 2ISYA 4OIOF 1DDNA 1I1SA 1SFXA 2CWEA 2K27A 2EJRA 2DO7A 3OOPA 4MNUA 2DW4A 1ZLKA 1IXCA 4M72A 1EH6A 2G9WA 3WODF 1FT9A 3BDDA 2HQRA 2AXLA 2ELHA 2V79A 5E1ZB 3EUHA 5CVRA 1IRFA 2RNJA 3LSTA 5CVIA 3LAPA 2DK5A 1OPCA 5ILSA 4RAYA 4UHTA 2E7WA 3K1NA 2FNAA 3F22A 1BIAA 2DAOA 2QENA 5L3BA 5HDKA 3I58A 1YLFA 1HKQA 4WCGA 2L01A 1W4MA 4ESFA 1BOAA 2DQRA 1FOKA 1FSHA 3HSEA 3F6VA 3EYIA 1ZG1A 3TGNA 4TV7A 3M9AA 1J7KA 3IHUA 1EH7A 3CTAA 2E7XA 4ZYEA 2ZNYA 4MTEA 3HTUA 2F5DA 3DV8A 4RGXA 5D5VB 1XMKA 2BV6A 1ZRCA 3B02A 2IP2A 3ZN0A 2OD5A 1TNSA 1YFHA 1O7LA 3I54A 3FM5A 4M73A 1XGOA 5E1WA 2O61A 4IRHA 2FNPA 2VBXA 4WWCA 3I4PA 4ESJA 3DPTA 5L3GA 2F5EA 3BPVA 4Y13A 2VOOA 1RUNA 4M71A 1KYZA 4KUMA 4I01A 4WF2A 3KZZA 2RV8A 2PQ8A 2XAHA 1FBUA 2AS5F 2PBIA 1O3TA 4UNOA 4LD5A 3L9FA 5BMZA 4PDKA 2R7DA 3HOSA 4HW0A 1EH8A 1DPUA 2O6GE 3MFKA 3BZ6A 5LEJA 1ON2A 4LB5A 4RB0A 1AWCA 4BHBA 1BI2A 1C0WA 4RS8A 2HFHA 1O3RA 2EV5A 2W84A 3BY6A 3TDZC 4JK1X 2HOEA 4HQMA 5AONA 2DTRA 1KQ8A 3LQQA 4N9IA 4ETSA 3T8RA 3MZHA 4AWXB 5JVTA 3GLXA 4OOIA 2L3DA 4BXUA 2YU3A 1J59A 1WKMA 3DQVC 4IPAA 2E1NA 2JZYA 1IW7F 4I2OA 3LFKA 3NQOA 1Z7UA 3Q9SA 4BH9A 1KYWA 3QU6A 1K7AA 4U0VA 3U1DA 3WTSC 4OIPF 2K7LA 3E6MA 3R6SA 2PMUA 4WXHA 2VT3A 2M45A 3NEUA 1DP7P 1D8KA 4OU0A 1QBJA 4ZZLA 1QPMA 1KU3A 4I0BA 2STWA 3WGHA 2JPCA 3TQNA 4EJUA 3DF8A 1B4AA 3GZ5A 2ZXJA 5E18F 5A2QK 5FFZA 1S29A 1J9IA 3V7CA 1G3YA 3F6OA 3CUQA 3GUDA 5ILVA 2BGCA 2FSWA 4A5MA 2RN7A 1MJBA 2KKOA 1MDMA 3GFIA 1RUOA 1CF7B 3WTTC 5D5WB 1XN7A 2EFNA 4G94A 4HX8A 4KICA 3ABTA 1BC8C 4P5OA 2D1HA 1VTNC 1T0FA 4LK1F 4PGGA 4QWQA 3LA7A 2IA0A 1G3SA 4L5JA 3I59A 1LJ9A 2GAUA 3WE3A 1ZYRF 2PFBA 4ENMA 2FU4A 2UXNA 5FGMA 3HRUA 4UUVA 1ZAOA 4XLPF 3JAMZ 4IF4A 4LMYA 3FX3A 2D45A 4KNYA 2DQLA 5LHIA 2Z99A 2VE9A 3CUOA 4HF0A 3MZYA 1QO0D 3BP8A 4CHUA 3J7AO 1FSEA 4G6QA 4ZYDA 2O03A 5LGUA 2RKHA 1ODDA 2NYXA 1QGPA 5K5QA 3VEPA 2Y0MA 1IF1A 1P4AA 1UB9A 4O3MA 3VFZA 4GCVA 3C7JA 1LNWA 2L02A 3R0JA 3TO9A 4JBAA 5DD4A 1YYVA 2QWWA 2P5KA 1OR7A 5HOOA 4UVBA 4RB3C 1KQ0A 5L3CA 1I6XA 5AIPA 1HW1A 4HV6A 1YQAA 3FZVA 1QQIA 2YPRA 1XDUA 2IT0A 1U78A 1SD4A 2JRTA 2IPQX 5JFRA 1F9NA 1MZBA 5CVJA 1JGSA 2IVMA 3GF2A 4NQWA 4S05A 1D8JA 2JT1A 1FZPB 1YO5C 3O3KA 3KP7A 3ZMTA 3B73A 1FX7A 4E70A 4G8XA 4U88A 4HQEA 2VOPA 1XMAA 1EV7A 2ESNA 4EVIA 2FE3A 5E17F 1P6RA 4HDVA 3CUQC 1YW8A 2FBIA 2A6HF 3WTZA 2IJLA 2W57A 2MLKA 1WQ2A 2XROA 4RGUA 1ZRDA 2GWRA 2ACJA 3E6CC 4KMUX 2HTJA 5DUIA 1RIOH 5ICGA 5F64A 3MCZA 1KA8A 1NHAA 4R79A 2QQBA 4MEXF 1J2XA 4ASNA 2MH2A 3JAMK 3DEUA 3JTHA 1G4DA 3M8EA 2GQQA 3SZTA 3PQKA 2QM3A 3FXRA 5BPDA 3C18A 2Q8KA 2K4BA 4HA8A 3RI4A 3E5XA 3COAC 2WC2A 4YFKF 4XRFA 3HRSA 3BJAA 4MQVA 3HIFA 5K1YA 2EFOA 1WSUA 2EWNA 3RKXA 4G9YA 2HYFA 4WXCA 2FBKA 4OMYA 4B09A 1FP2A 2G7UA 2LF7A 4EV0A 2XVCA 2VE8A 5CYVA 3KP4A 4LLLA 2WTEA 2V1XA 5HS8A 3TOBA 3VB2A 5F6FA 1KGSA 5DV5A 4A5NA 3DPLC 3KLOA 1FNNA 1TLHB 2O0YA 2ZKZA 4G7OF 4MQ9F 3P9KA 3F3XA 4D0PA 3CDHA 3FXUA 4M6YA 3M1EA 3FM3A 4WX9A 4ESBA 2XAQA 2P4WA 1LDDA 1USTA 2GA2A 1SMTA 2QZ8A 5BQTA 1E17A 1Y0UA 3LQRA 2B0LA 3T8TA 2PN6A 4RB2C 2BE5F 5K5OA 2HDCA 1P4XA 3MWMA 4LG0A 2P6SA 4LG0B 3K2ZA 4EJOA 2VBWA 2CGPA 2FMYA 4I98B 3E6BA 1CF7A 4UVCA 2CW0F 1IXRC 2J5OA 1XDSA 2YX4A 3KETA 2Z3YA 3WGGA 1TQIA 3EDPA 3J81K 1Z05A
chains in the Genus database with same CATH superfamily
1F36A 4KA4A 2X1CA 3DEEA 2LG4A 2JUCA 2EIKH 3QP5A 3L2CA 5DEQA 4RAFA 3MAJA 3MKLA 5KAIC 2O8KA 2RGVA 2VB6A 4M9XA 1ZG3A 1XB4A 1FP1D 3S14J 3M7GA 2DFHA 2P5LC 1OQYA 1U8BA 5E3OA 4DYRA 1OFCX 1R1TA 3AL0B 2KQRA 2KIFA 4B1RA 4L9JA 5LD2C 1D1BA 1AKHB 1ZR4A 2F2EA 2QEXI 5BNGA 4M3BA 1YOVB 4MHGA 2FD5A 4KT5C 4EJVA 6PAXA 4L5IA 1G8XA 2R4GA 4PK4A 2CQKA 3E3VA 1F43A 3OYBA 3IRRA 5IY5H 4A3LJ 2V9VA 2F4MB 5D5UB 3I4MJ 1YS6A 1WRJA 2FQ4A 2BOLA 3OYJA 3IWFA 5BS6A 3J80Z 4BYYA 5C4JJ 3P9IA 5M5WJ 3QPTA 3VYSB 4DW6A 1ZARA 1R49A 4LLNA 3K70C 2E1MB 3DLLF 3BOQA 4U0WA 5DS9A 3TP3A 5CPRB 4PFPA 3KE2A 3R61A 3Q0UA 5HLGA 2OU2A 1X4OA 1TTYA 2OUMA 3K69A 1N77A 1F4KA 1DU6A 3JSOA 3K4KA 5DCMA 4EM0B 3K10A 1ORKA 2VUMJ 4B47A 3KYLA 4Y52J 1YTYA 5F27A 3OYAA 2ZFWA 3RZOJ 3O2PE 1P7JA 4GGGA 2DN0A 2XB0X 4XRSG 2H6BA 1UHMA 4LGWA 3AAFA 3RKYA 2AHQA 2KIUA 3OYEA 2XASA 2WY7Q 1HCRA 5HS9A 2R5YA 3CCYA 3TL4X 3LSKA 5CLSA 2NVTJ 3S2WA 3VYRB 3KLNA 1SFEA 2CV1A 1OCCH 3JW4A 3K4JA 2DMQA 2RVCA 2VC1A 3J81Z 2I8DA 1U5TC 2DFIA 3HB9A 1Z6RA 1ZLJA 2GZWA 2QVOA 1R5GA 3BR5A 5FD5A 1S3JA 3GZ6A 2TRTA 1HSJA 3CC4I 3A1YA 3K1PA 2E34A 4U0YA 2L9NA 4RM2A 3VOEA 2EK5A 1IN5A 3FXJA 2F4OB 3LSRA 2LTPA 1D3YA 4AVPA 1BOBA 1L0OC 4PJMA 3I64A 1X2NA 1R36A 2XDVA 3AG3H 2VBZA 3H9GA 2MH9A 4XLCA 2EBIA 2OCEA 3ABKH 1WJDA 1D0XA 2G7HA 2OBPA 1QZYA 1XCVA 3WU0A 3CP8A 2C6YA 1FJLA 3I5UA 3ZMVA 2X51A 2XUBA 1K79A 4RBOA 3ZMUA 2HXOA 3P5JA 2PMZA 3BR3A 3HOTA 3W3CA 5LBQA 1FC3A 3QODA 4HDUA 1X3UA 3K9TA 3HBLA 2V1DA 5C3EJ 2CG4A 3OL3A 2OC6A 3MKWB 4HRIA 1MGTA 3JRBA 5LGTA 1Z9CA 2ZMEA 3CZ6A 3LA3A 3IC7A 4FHTA 1S6LA 1TWGJ 3ASOH 4QTRA 4YIFA 4IHSA 5EEAA 2JSCA 2DPUA 2WV0A 3VYTB 3KX2A 2R0QC 2XV4S 3S2DJ 2NVYJ 4A6EA 2KDZA 1FLIA 1ONVA 5IT3A 1N78A 5FFXA 2NRAC 5EEHA 3WG9A 4NB5A 1VQNI 4XKCA 4KDPA 1D0YA 2M0MA 2VKVA 5KVRA 2IGKA 2KT0A 4Z2YA 2Q0OA 2KIMA 1TQMA 4OMZA 3H9JA 4HX4A 2FMLA 5HDGA 4HZFA 5TRDA 2R7OA 1HDPA 1R23A 3QP6A 5IP7J 5CKTA 4FQGA 4IQ4A 2K9QA 4YG2F 4BKXA 1Y1WJ 2AQEA 4CO8A 4MEYF 4WK8F 2BHZA 2PI0A 5JLXA 3H5RA 5F0HA 3A01A 2JK3A 1SD6A 1JUSA 3RKWA 1LUJB 4DZPA 1I27A 3PNTA 4EMSA 2KMUA 5ICCA 1HKTA 4IHYA 5FO5A 3PJRA 5B1AH 1Y8QB 2XRNA 1Z3YA 2UWMA 2F5VA 1ETXA 5CQEA 1BI3A 2JA8J 1T0FC 2MD5A 1RKTA 3BG7A 2VODA 4Y17A 3KP5A 1MMAA 3OL4A 1OCZH 1ZREA 1JHHA 1T38A 1W5CC 3W6VA 1W1WE 4NUBA 4HSRA 1W5TA 3IRQA 2BXZA 3H9QA 5HVQC 2IBDA 3HUGA 5EG0B 1OCPA 2LD5A 3ZMSA 1W7PA 3M8FA 2V1NA 4IRGA 1IDYA 4NC8A 1U2WA 1UG2A 2YU9J 4UUSB 3CJTB 2TDXA 4XIDA 4Y15A 1T2KA 2DOFA 3S32A 3I71A 1TT5B 3I59B 4HYEA 3ZR8X 3PSIA 2BYVE 4CGZA 1E0EA 3OYNA 3OYIA 4IXAA 3I55I 1PP7U 3GTKJ 1HW5A 4A0ZA 2RDPA 4RB1A 3EETA 2IAIA 1O4XA 3GTGJ 2W1OA 2ZJQF 3OS2A 4BEHB 1VFCA 2HQNA 2W24A 3D0SA 4NNJA 2M5WA 3BZKA 1IRXA 2FBHA 2YR2A 4KIFA 2XSJC 1O7FA 1MD0A 3QWLA 3R60A 2VT2A 3V8KA 5FJ8J 4O6JA 2LYCA 1ENHA 5D4SA 5EDNA 4WXDA 1Z0XA 2EA2A 1MKMA 3KP6A 2MG4A 3FKJA 4XSXF 2XKPA 3TEDA 2XAUA 2E36A 1P92A 4P96A 4GXOA 4XN3A 3ULQB 3QPHA 3T1BA 2W4SA 4I02A 5FB2A 4BQAA 3W2VA 4M3DA 2BW3B 2ME0A 1LDJA 2HWVA 3I53A 1B1BA 5IP6A 3S3OA 1TWFJ 1BBYA 4L9VA 2D1VA 5K5RA 1W7PD 1ZN2A 3HJEA 2OZ6A 4I0AA 3K4MA 1GXPA 1YRNA 2XAFA 5D8KB 3CMAI 2A6TA 2CFOA 3ABUA 3LL7A 4II2A 3H0GJ 1BM9A 3BPXA 1T8IA 1KU9A 2FEZA 3HHHA 2Q1ZB 5KHDA 1VQMI 2M7BA 3GO5A 4I7HA 4BHPA 5L3EA 4BE0A 4P55A 3CCSI 2VN2A 3GTOJ 5GADJ 2IS2A 4M74A 3DTKA 2L0KA 4HLYA 3IL2A 3QRFF 1IUFA 4R1HA 1DUXC 2BEOA 1U5TA 3U1KA 3RYRA 1JHFA 1Z1DA 3JCUC 1FOYA 3S2HJ 1SFKA 1VZ0A 2CQQA 1ZK8A 3C3WA 3M3YJ 1RPWA 2W85A 3BJ6A 3L2QA 1DP3A 3G4SI 4ENKA 3Q9VA 4C9YA 5F1RA 1IAWA 1YX3A 1IXSB 2LSOA 3O8HA 1YW9A 2PMHA 3E5QA 5E8GA 5LHHA 3HPGA 3CD6I 2Y0SN 1OKRA 1XD7A 3CC2I 3L2RA 1QHHD 3DPUA 1U8RA 1Z3XA 2L54A 1IN7A 2EV6A 2HNHA 2V6CA 3OYHA 4FX4A 1X1PA 3ISPA 3ECOA 2DI3A 3S93A 2NVUB 3Q5FA 1V3FA 1BJAA 4CCKA 3M07A 4HV5A 2EV0A 4LIVA 1S7EA 3HC7A 2MD0A 4KT6A 5TISC 4EJWA 2CQNA 1W5SA 1TNTA 5DUKA 3LAJA 4D5CA 3V7SA 3FF5A 3ZP5A 2R93J 2HVSA 2M30A 3WHBA 1SANA 1UZCA 1DGWY 1M1EB 2VJ5A 1UHSA 1SVMA 2GIZA 3OWTA 5DDGA 1XGSA 3JRFA 4RMNA 2MC3A 1BI1A 2GXBA 2OZUA 1MBGA 2E1CA 4A69C 4BAYA 4HF2A 2PJPA 2CSOA 3PNYA 2JTVA 4PFOA 4FASD 3ABMH 1U3EM 1H9TA 1JTYA 1RESA 2J5PA 5D8LB 3DKWA 3ML6A 1H89C 1ACIA 4EATA 5JR3A 1OCRH 3OMYA 2NNNA 5TGTA 1FTZA 1HSTA 1OR7C 2IRFG 1I3QJ 1Z6TA 4N4OB 2K9LA 4DQ2A 4U7BA 3RJPA 2W82A 3G1OA 2ESHA 3ZPLA 4CICA 1PYVA 2QQAA 2VIXA 4RGSA 2IGNA 2M1BA 3HYIA 1IRZA 2M8EA 3PFIA 2DJIA 1PVEA 2XPUA 3FHNA 2FRHA 1MMNA 2O3FA 2H94A 2EILH 3KP3A 3WTYC 4V19K 5CVUA 3H92A 1U0JA 4YRVA 3S17J 3BG9A 3V8LA 4DYCA 1H9GA 2DA3A 4B3XA 5DM7F 2LDUA 2VQGA 2Q2EA 3A4CA 2HKXA 3IH3A 1MNDA 2HQ5A 1PP8F 2W7NA 1OLTA 3MVPA 3GZNB 3PO3J 1W7PB 4HBLA 4BY1J 3H3VK 1G3TA 2LP0A 2QA4I 2CV2A 3UNGC 3FHZA 2P7VB 2HU9A 5F04A 3OIPA 4PUSA 1PJRA 4OIRF 1QVUA 2WB1A 1BC7C 2KP6A 1R00A 3SFZA 2ZSIB 3L09A 4F91B 3K0LA 1T6SA 3GCMA 4BJ6C 1AHDP 2WAQA 1R1VA 3JSPA 1YITI 1X3ZB 2H8WA 3CCUI 4RGRA 4DGWB 2MA3A 4I76A 1FIAA 1IN6A 3KEQA 5J1YA 5E1XA 3RTRA 1KU2A 3F8MA 2QYOA 4L18B 3WE2A 3K6GA 2M87A 2HYGD 3PQJA 4ABZA 1N25A 1JUMA 3NRVA 3CMYA 2FXAA 4W97A 4XLEA 3LMMA 4H0EA 4YFNF 2QBYB 2LK2A 3GTJJ 1IN4A 1S7OA 3WG7H 2GA1A 5J1UA 4IHTA 2A69F 1RKWA 2DOEA 4C30A 3U2RA 2X1DA 1RZ4A 3RIRA 3OYFA 1XS9A 2DTZA 4GFBA 2EA4A 3DLAA 4AIKA 1B9NA 3SXYA 1IRGA 5EYRA 1VF9A 1QU3A 1W36D 5ILUA 3BTIA 1CGPA 4HAMA 2L9RA 1A5JA 3CDIA 1XSDA 3OYLA 3G71I 2DA1A 1IN8A 1Z67A 3KPHA 1K4SA 2E2HJ 2K86A 4MGRA 5LHGA 3I0TA 3LSHA 2MGQA 3MZ8A 1FOXA 1E2XA 2E2IJ 4S04A 3IH2A 4HF1A 2VJ4A 2P7CB 2ISZA 4P9FA 2E1OA 1JGGA 4A12A 2DA7A 4E7JA 4ZYHA 3KYDB 2DU9A 1T08B 4ZYGA 1ZKGA 2R7FA 1VQ7I 4UV8A 4XKWA 1OYWA 1MMDA 1GV5A 1TBXA 3FK7A 2LREA 1SAUA 2EFWA 2VQLA 5H6RA 4P1WA 2BVMA 4XR6A 1TW2A 2UZKA 3GFLA 3H3ZA 1A04A 4M9SA 3WGIA 4EGYA 2NS7A 2R7XA 2WA0A 4GO1A 4BBSJ 3WTUC 3RSNA 2ZJRF 1HKSA 2Y9YA 2BY1A 2PEXA 4GYIA 4CYDA 1BJZA 2A3SA 2DDBA 3TO7A 4F92B 1LFUP 2IGMA 4RM3A 2DMTA 3HG9A 3I3LA 1ZGWA 4A3FJ 5HLIA 2GXGA 5FD6A 4L0YB 5BOXA 2MBFA 3SJMA 2HEOA 1B6AA 3P9CA 1JXSA 1V4RA 5D6EA 3C1DA 2L9VA 4BHCA 3HM5A 3H5AA 5H6QA 4XQFA 3RQ4A 3V8JA 4NHJA 1MH4A 3VSKA 2DA4A 3MKZA 5IYDJ 1J5YA 2DPDA 1Y56A 4BNCA 3L2VA 4HNTA 3LSJA 3SFIA 1QNTA 3RYPA 1I5ZA 2COMA 2R7ZJ 1X19A 2FJ1A 3HSRA 1R5HA 2P8TA 4EQQA 2PLYA 2GIVA 1PDNC 4PJLA 3DTIA 3ZQ7A 1I3AA 1S8NA 1R9TJ 1MJ9A 2HTSA 3HEFA 2K9NA 2GOMA 3D5LA 3TDUC 1REPC 1X58A 3HSFA 3VODA 2KHMA 5LEKA 5JHUA 3JRGA 4LJZF 2IGOA 2LF8A 2CFXA 3ZMZA 4B3AA 4ZYAA 5K7HA 2W25A 1YIOA 2L4MA 3L2UA 1SC7A 4X1EA 5LFAA 4CDGA 1YHQI 3ZXSA 1WJ5A 4A3IJ 1RR7A 4F7ZA 1Z91A 1R1UA 3K4CA 1MIJA 2CUEA 4MO7A 2DMNA 3CLOA 1ETVA 1HDDC 2HKOA 3ROUA 2DFFA 2DXIA 4E4HA 2A6EF 3FMQA 2X9DA 3N4MA 1E3OC 3F8FA 4YELA 2ZCWA 3CF5F 2IA2A 3K70D 1GHCA 2QSFX 3OYMA 1ZHFA 3TOAA 4C3JJ 4Y33A 2JRMA 1UJ8A 1ZGJA 4IOCF 2R5ZB 1Q1HA 1WH7A 3LSIA 3ZQLA 2A5YB 3A01B 3E6DA 5B1BH 3OYCA 4I09A 4FTHA 2P5VA 4CXFA 1WI9A 2K5CA 2WAFA 2DODA 3MEXA 5CJ9A 3LNQA 5FLXK 3K1MA 3PIPF 3RZDJ 1D5VA 2R3SA 1JT6A 2Z9OA 2HR3A 1POGA 3I9V2 3GBGA 1GXQA 4KIBA 1WHUA 3JTGA 2V4JC 1O57A 3F9KA 1V5EA 1A6IA 3K4BA 4UXNA 4EM1A 2BVLA 2JUGA 5IOYA 4YFXF 2DK8A 2EFQA 3PL8A 3RPUA 4CYCB 1R4MB 2X4HA 3GVAA 4IJAA 5M3FJ 2ZNZA 1VQLI 3G73A 5J6XA 2B9SA 1T33A 3HTSB 4MFEA 3IV5A 1YS7A 1LEAA 2XKOA 2ZMEB 4G7HF 2JPBA 3OIQA 5IT9Z 3ZMDA 2NNYA 1GLNA 2FQ3A 2LBFA 4A3GJ 5E3MA 3FXQA 2JWTA 2XPVA 2MLGA 3OSFA 3JRDA 2D5VA 2IEKA 4DNCA 4HLXA 1KQ9A 3A0HC 2UXXA 1YG2A 2CYYA 4Q5SF 4XN0A 2H8RA 1H0MA 1FYKA 2XSDC 3CCQI 4A3EJ 1F1ZA 3SZPA 4HOBA 3HL2A 4M6XA 2DCEA 3S1MJ 2KL4A 4QIWN 2Y9ZA 1ON1A 1FYLA 1YW7A 3S1NJ 1SAXA 4BE1A 2BXYA 4UV9A 4E7IA 2ICWG 4ZDLA 2H6CA 1WVRA 1RR8C 3HXLA 1QZZA 1OCOH 1SD5A 2P81A 2QBYA 1WJAA 2WAEA 4LB6B 3CCRI 4L9TA 2BZTA 2LY1A 3DFGA 5LGNA 1ZG5A 2FF4A 5JHFA 5FLXZ 4ZJZA 1OISA 3EQLF 2HGCA 1ZH5A 4R8HA 1USSA 2STTA 3PUFA 3EPZA 3V7RA 4JX6A 1X4PA 5J8CA 3TO6A 3AFHA 1FWZA 4AIHA 3RCOA 3SQNA 3KIOA 2WV1A 3S8PA 4A3CJ 3KZIC 2KIQA 3J80K 2K85A 5HDNA 2XAJA 2FOKA 3GYHX 1WCMJ 1ZGAA 3SDGA 3LWFA 4QLCU 4L0ZB 3IKVA 2NAZA 4N9HA 3VDXA 3G1MA 3RPQA 5ICFA 2A5WA 1K4TA 2HZDA 5IT9K 4XICA 4OAZA 1LVAA 3BT9A 2LBFB 2QQ9A 2E60A 3HHGA 2ZO4A 3H35A 2VONA 3QOPA 3IWZA 2EFPA 4JOMA 4UUSA 1WPKA 1B72A 1WFXA 3FKIJ 3RPUD 1F5TA 2P6TA 2K4JA 4MLOA 2DJNA 1G3WA 4A3BJ 3D5RC 1IGNA 2ADUA 4BBRJ 1D1CA 1SFUA 1BR4A 1FPQA 2Y30A 4ZZDA 4CCLA 2R7TA 4XOPA 3CUQB 3LA2A 1Q1VA 2D2WA 2X48A 4MFDA 2V9KA 5E20A 3AG2H 1T39A 4KN4X 1OMIA 1NG6A 2FUG2 4EM2A 3HRMA 3L7WA 2BY3A 4F55A 3AG4H 3JRIA 1EF4A 1UFMA 2OV7A 1OYYA 3BG3A 3ESWB 4XMYA 1JTXA 5KAFC 2YX7A 2LKXA 4IOAF 2VKEA 5GTIC 2HZTA 1GVJA 2L2OA 2HXIA 3F0CA 1IUYA 1S7AA 1V54H 4NQWB 1O3SA 1PUEE 2WB1N 1XMXA 3TKYA 2W00A 4M3FA 1XGMA 2LKPA 2OA4A 5HNFA 5EZGA 3ZCOA 1MBKA 4CH7A 4C2MJ 3W6KB 2PG4A 4A0YA 2R5ZA 2DT5A 3WHCA 3T5XA 2VLAA 1HQCA 1E3HA 4PZJA 5F1JA 2CMPA 4BQQA 1X3WB 3E0JB 5GAHJ 1SVOA 4FT8A 4ENNA 2EQRA 5DCFA 2RQQA 1RNLA 1G6NA 5F08A 4U87A 1WGXA 4KN7X 1PUFA 3RDIA 3E97A 4A0XA 4PJ0C 2XGEA 3FMRA 3W6JB 3WTWC 1LE8A 2Z5UA 4JX4A 1LKXA 2NVQJ 1X1AA 1ETQA 3BJOA 5LRSA 1GUUA 5E8IA 4LG3A 3E5UA 3FMSA 3MN2A 5D5XB 1OYIA 3FIWA 1B72B 4Y4RA 1FIPA 3HKZN 1LVKA 3I4NJ 3F8CA 1IZ1A 3HRTA 2OQRA 4LFUA 2ID3A 2K3FA 4FE7A 4PGHA 2VXZA 2I5UA 2X0LA 4XKVA 4A2UA 2QUFA 4ANJA 3J7AY 4KFCA 2GLOA 4KMFA 4ENJA 2A68F 3VYUB 1FYMA 4XNFA 1B59A 4JYKA 2KZVA 3J7ZI 5EEGA 3GW2A 5EGOB 3KEOA 2WADA 2CO5A 3KZYA 4BL0B 3QPSA 1FBSA 1ETYA 3GEZA 1J75A 1B9MA 1GDTA 2FA5A 5IPAA 4X6AJ 3BC8A 4Q4ZF 2DLLA 3R4KA 5CVVA 1LQ1A 1Y6IA 4M9ZA 1LB2A 5FLVA 1UCRA 3Q3SA 4CSWA 5IP9J 5HLHA 2KJCA 1Z21A 4LK0F 2F4IA 4A6DA 2R7UA 2K02A 1IV8A 2LNBA 1VQ9I 3GFMA 2DT6A 1RI7A 2VBYA 2HQAA 1EJ9A 2HOTA 2Y48A 4HNVA 1AU7A 1PUFB 1SMYF 2CJJA 2EB7A 3SDBA 1MMGA 4AD9A 2CW7A 2HVRA 5D4RA 2DA6A 3DP7A 2UV1A 3G1LA 3BWGA 2XAGA 3CJQB 4RLFA 3DXJF 3FWEA 3N97A 2HYJA 1FBQA 4G7ZF 4BEHA 1YJWI 2Y2ZA 1EA3A 3DTEA 5D6FA 1VQKI 2VPRA 2OQGA 2A07F 3FXLA 4IX7A 2XIGA 3KYCB 1DPRA 1V5FA 1OJLA 4A93J 4YIIA 1JKOC 3QAHA 1LDKB 3VSLA 4KIGA 1NK2P 3BR6A 1P7IA 1XGNA 3HGYA 4O5VA 1P2FA 1WZ2A 3SYTA 1ZRFA 4U7DA 2BBYA 1K6OA 1HBXG 2RC4A 4CYCA 1JE8A 2F5FA 2V1UA 4UVAA 5ERIA 3CJNA 1R7JA 1ULYA 5TJJA 2E5ZA 5ICEA 2ZXWH 2ZB9A 1YRNB 2CUZA 4MIMA 4ZH4F 3O6BB 5J4VA 4UY8I 2JA7J 4Z6YA 4PCQA 1KU7A 3CCJI 5B66C 4KYWA 4Q48A 1K78A 2A61A 4G6DA 1DQUA 4B8XA 1P9QC 2VPLA 1Y8RB 3F21A 1UHWA 1AOYA 1WWXA 2EZHA 3ERED 1RRJA 3L2WA 3L00A 3SHFA 2IA1A 2KRFA 3GWZA 2Y75A 3HGGA 3WTXC 1W0TA 1O3QA 3DKYA 2V7FA 1HXDA 2R7WA 3ECHA 4EJTA 4HX7A 1AKHA 3EYYA 3ZQHA 3OYDA 5GP9A 3S1RJ 2ETHA 2M3AA 3IUOA 4AIDA 3CO7C 1MJAA 3CESA 2QLZA 1MW7A 2ECBA 2LY9A 2YS9A 3KCCA 1R22A 2X6YA 4CCJA 2KISA 3G2BA 2OAZA 4XBFA 3F8NA 1GVDA 1APLC 2EZIA 4RAZA 2M2EA 2P0WA 2DA5A 2DMUA 2X85A 3CO6C 2OTJI 2KJBA 5FKKA 1XCBA 3GLLA 3KP2A 2CUJA 3V4GA 3QU3A 3PNVA 3TP0A 3IAM2 3ZQFA 3WU1B 3H3UA 1HF0A 3AKZA 2OPTA 2VASA 2F5CA 3BROA 3TMOA 2O7OA 1FY7A 2ZJ2A 4E7ZA 2XB5A 5DM6F 1X1DA 5DYMA 1BI0A 1SD7A 2ZFUA 1S5LC 4Y3OA 4AIJA 2XGCA 3IKTA 3S16J 5JI6A 1Y0NA 2N8GA 1XTAA 5AIQA 4Y7NJ 1RC9A 2O8XA 3GX4X 1R6RA 3KEYA 4RLQA 1RETA 2EH3A 2HS5A 4OINF 3T0YA 1XG1A 5A2QZ 4BDZA 5HNHA 1LFPA 1XSVA 3BG5A 3FBNB 2LKSA 3PIOF 3CCLI 2DMPA 2H27A 4EGZA 4IVNA 3MQ0A 2RQPA 5LLQA 5KK1A 2M4KA 2WWYA 2X6XA 1J0RA 3LFUA 3M8JA 1IC8A 4BXFA 5BPIA 2L4AA 3GTQJ 2JMWA 5L3DA 1NH3A 1W36C 1LEBA 3OV8A 2H1KA 2DYSH 2Y31A 3U21A 5J8FA 3U9GA 4OIQF 4LLGF 1STZA 4KJZA 3CCMI 2CS3A 4XSZF 3ZN1A 2CV0A 2ZBKA 2NS0A 4MTDA 2DBBA 1BW6A 3JRHA 1OCTC 1K78B 1YE9A 1P4WA 5HS7A 1MMSA 3REOA 3R0AA 3WTVC 1BIBA 4ZC3A 1U6GA 1TW3A 3FXMA 3F23A 1XSXA 1L3LA 3GFJA 3JREA 1I1GA 2E35A 2LH9A 5H20A 2FOWA 5ED4A 4XLNF 3G3ZA 1MH3A 2Z33A 3CQZJ 2KLOA 2MSYA 4AM3A 4CZZA 4V2FA 3GXOA 3ZQQA 2V9PA 2XGXA 4CCOA 5DD8A 5JLWA 1QA6A 4P9UA 2YSRA 4GYGA 3F8BA 1TQPA 1BN5A 2AQFA 2PX9A 2HPMA 3ELKA 2LFBA 4FX0A 4YEJA 2K3PA 1R58A 1MDMB 1ZQ3P 5GPAA 1J09A 4N0BA 2H09A 4FCYA 1MNMC 4IEJA 5L3FA 4Q47A 4L9NA 1U5TB 4HPQA 2IW5A 5LRRA 3P7NA 5GTHC 5FKOA 5DCMB 2LC2A 4BS9A 4PSXA 4IRIA 2Y0SA 1MBEA 1T98A 3WU2C 1BW5A 4ON0A 1HW2A 2XHKA 3KFWX 4K2EA 4CZCA 3F72A 2VC0A 4JQFA 2ISYA 4E6KG 1DDNA 4OIOF 4BGDA 1I1SA 1QPIA 3ZQIA 4XORA 1H8AC 1SFXA 2CWEA 2K27A 2EJRA 1YIJI 2NOGA 4M3EA 2DO7A 3OOPA 4MNUA 1MBJA 2DW4A 2LY2A 2BW3A 4A3JJ 1ZLKA 5JVGF 1IXCA 1IO2A 4M72A 2L9SA 1EH6A 2EZLA 2BY2A 2G9WA 3WODF 1KONA 1IG7A 4LOCA 1FT9A 3BDDA 2HQRA 2AXLA 2ELHA 2V79A 4I99C 5K7ZA 5E1ZB 3EUHA 5CVRA 3ONQA 1IRFA 2RNJA 3LSTA 5CVIA 3LAPA 3MKYB 4AVZA 2DK5A 1OPCA 3LSMA 4GDFA 5ILSA 4RAYA 4UHTA 2E7WA 3K1NA 2KDOA 4XLFA 2FNAA 2WBMA 3BZCA 3F22A 3TBIA 2R5YB 1BIAA 2DAOA 2QENA 5L3BA 1TP4A 5HDKA 3I58A 1S9HA 1YLFA 1HKQA 3ASNH 5B3SH 4WCGA 2R7RA 2L01A 3QYFA 5E3LA 1W4MA 2Q2EB 2LVSA 4ESFA 4B44A 1BOAA 2DQRA 2UUZA 5GPCA 4D7MA 1FOKA 1TWHJ 2HVQA 3HDDA 2DDAA 2M0CA 4NBQA 2EIJH 2X1EA 3HSEA 1FSHA 3HUGB 3F6VA 1VQOI 1ZG1A 3EYIA 2RAEA 3TGNA 4E7SA 4TV7A 3M9AA 4B4CA 1J7KA 3IHUA 1TWAJ 2NXNB 1T56A 1EH7A 4QSHA 4GRIA 4C2TA 3CTAA 2E7XA 3DBLB 4ZYEA 2CRGA 2ZNYA 4C2UA 4ZDPA 4MTEA 1BA5A 3HTUA 4LITA 4F52A 2F5DA 3DV8A 3V42A 4RGXA 5D5VB 4S0HB 4C3IJ 1JJ8C 1XMKA 2BV6A 3B02A 2IP2A 2MC4A 3SEQA 4IO9F 1ZRCA 3A03A 3ZN0A 5FKMA 1BR2A 1UELB 4XK4A 2OD5A 3MMYB 1TNSA 1YFHA 3QPLA 1O7LA 4KISA 1ZELA 2BY0A 2XF6A 3FM5A 3I54A 1XGOA 4M73A 3FK6A 5E1WA 5FROA 1B8IA 3EUHC 2O61A 4DYQA 4X0GA 3NARA 4IRHA 1VI0A 2FNPA 3K4LA 3HOZJ 3NWTA 2VBXA 3C2HA 3H5NA 4WWCA 2COBA 2Z16A 4BUPA 2CQ7A 2OF7A 3I4PA 4ESJA 5FKNA 3DPTA 2M7AA 4HSTA 4AC0A 1IDZA 3BR2A 2DFEA 5L3GA 2F5EA 3EUKL 3BPVA 2JA5J 4Y13A 1A31A 4I6ZA 2CUFA 1HOMA 2VOOA 3OY9A 1RUNA 1MSEC 1IJWC 4KITB 4J01A 4M71A 3LSGA 3CMEI 1ETKA 1KYZA 4KUMA 3ZRGA 1Y39A 4I01A 3BQZA 4UUTA 1A36A 4WF2A 4M3GA 5J40A 2QKMB 4BJ5C 3KZZA 4PJNA 2RV8A 1NK3P 2PQ8A 2XAHA 1FBUA 2AS5F 2PBIA 4B43A 1O3TA 4UNOA 4LD5A 3L9FA 3BLYA 5IYBJ 5BMZA 4PDKA 1R5ID 2AO9A 2R7DA 3CLQA 3HOSA 1WJBA 3SEZA 4HW0A 1EH8A 1DPUA 3OS1A 2ZJPF 5FKLA 3FISA 3LSPA 3MFKA 3A02A 3BZ6A 2O6GE 5LEJA 1FOWA 1ON2A 3OOUA 5C4XJ 4LB5A 4RB0A 1Z7LA 1AWCA 4BHBA 3HOXJ 1BI2A 1C0WA 4RS8A 3ZQCA 1VQ6I 2HFHA 5J47A 1O3RA 2EV5A 2TCTA 2W84A 3BY6A 3IAS2 4JK1X 3TDZC 1DGRM 1HLVA 3D5SC 1WI3A 4D7NA 4OWRB 1B8IB 3S3NA 2O9LA 3DBRB 4FISA 2HOEA 3GMEA 4HQMA 4YIRX 4W1UA 5AONA 2DTRA 1X1BA 3G6EI 1FMVA 1V5GA 1KQ8A 1YJ9I 3LQQA 1UMQA 1V55H 3DCFA 4N9IA 2KPMA 4ETSA 1ZR2A 1JT0A 2VQCA 3T8RA 3MZHA 3QYEA 1A35A 5DTDA 4AWXB 5KCMA 3UR3C 5JVTA 3GLXA 4OOIA 1R4NB 4F3QA 2L3DA 1FMWA 4BXUA 1JUPA 5M3MJ 2YU3A 3Q0WA 3PSFA 1UG0A 4PSWA 1Y1VJ 1J59A 1YJNI 3QYBA 1WKMA 3DQVC 2E19A 3DBHB 4IPAA 2E1NA 2JZYA 4XKBA 2ZXHA 2FX0A 3H0DA 2E2JJ 1IW7F 1ITYA 4I2OA 1H88C 4XRSA 3LFKA 3NQOA 2PMZN 1Z7UA 2X6WA 3Q9SA 4BH9A 1X1CA 2JN6A 2E5NA 2XPWA 3NAUA 3E1SA 4ITVA 3W2AA 2B63J 1KYWA 3QU6A 1K7AA 3GTLJ 4U0VA 3U1DA 3WTSC 1A6QA 4OIPF 2VI6A 2QF7A 2K7LA 4LIUA 2VKHA 1ETWA 3E6MA 2DOAA 3R6SA 1D5YA 2HPIA 2ID6A 2GOXB 2PMUA 4WXHA 2VT3A 2M45A 2YUSA 3NEUA 1S72I 1DP7P 5FRNA 1D8KA 2CU7A 1LPQA 4OU0A 1QBJA 2M34A 4ZZLA 1QPMA 2QKLB 3UKGA 1XPXA 2GXAA 1KU3A 4I0BA 3D1NI 2STWA 1K6YA 3WGHA 2JPCA 4CCMA 5B5EC 3TQNA 4EJUA 2L7MP 3DF8A 4NC7A 1B4AA 3GZ5A 2ZXJA 2VXDA 5E18F 2MYSA 2L7ZA 3TW7A 3BCBA 5A2QK 4FETA 3ZOBA 4J00A 4A3MJ 5FFZA 3SZGA 1S29A 1FTTA 2JSPA 4IKFA 1J9IA 3V7CA 2ZMEC 4ZDOA 1G3YA 4FE4A 4D5FA 3PUBA 4JP0A 3VWBA 2ECCA 3F6OA 2RREA 1VQ8I 3CUQA 1JJ6C 5CQGA 5EZHA 3GUDA 4QPQA 4RDUA 3FBIB 3K4NA 5ILVA 2BGCA 2ME6A 2FSWA 3S15J 5J3LA 4E7KA 4A5MA 2RN7A 1MJBA 2KKOA 3HPHA 4OAYA 3A2KA 3OR1C 1MDMA 3OS0A 3GFIA 5E79C 1RUOA 1CF7B 4RA2A 5D5WB 2JVHA 3WTTC 1XN7A 2EFNA 2M9HA 4G94A 4HX8A 3ABTA 4KICA 1BC8C 4BXXJ 4AYBA 3ZQGA 4P5OA 2D1HA 2LRDA 1T0FA 1VTNC 4LK1F 4DBRA 3CCEI 3PO2J 4PGGA 4QWQA 3LA7A 2IA0A 3BR0A 3B6CA 1G3SA 1KZHA 3GTPJ 4L5JA 1JI8A 3ZGKA 3I59A 2I10A 1LJ9A 2GAUA 3WE3A 4A3KJ 2QQ8A 1ZYRF 2X6OA 2IXSA 1ETOA 1WJEA 3PM1A 2PFBA 1W0UA 4ENMA 4G12A 2FU4A 2UXNA 5FGMA 3HRUA 2HOAA 4UUVA 1ZAOA 4CUGA 3B6AA 4XLPF 3JAMZ 4IF4A 4LMYA 3FX3A 2D45A 4KNYA 2K40A 2VJIA 1LFBA 2DQLA 4IHVA 5LHIA 5GAEJ 3ABLH 4F93B 4XM3A 2Z99A 1VQ4I 2VE9A 3CUOA 1NG7A 1XX5A 2VQHA 2QCOA 2XC7A 4J19A 4HF0A 1X2MA 2ELKA 3MZYA 1QO0D 2VKDA 3BP8A 4CHUA 4QPOA 3J7AO 5EGOA 1MSFC 3S1QJ 3M4OJ 1FSEA 2LLKA 3FXOA 3I56I 2KRHA 3NWSA 2XF7A 4BJTA 4G6QA 4ZYDA 2O03A 3H36A 5LGUA 2RKHA 2V6EA 1G2HA 1ODDA 4HG2A 3CC7I 2NYXA 4BACA 1QGPA 5K5QA 2WY8Q 5HODA 3VEPA 2Y0MA 1IF1A 1P4AA 4RAGA 1UB9A 3OR2C 4XRMA 4O3MA 2HDDA 3VFZA 3A0BC 4GCVA 4DZJA 3C7JA 2JQ7A 3DWLE 1HA8A 2F6CA 1LNWA 1WJFA 1MBHA 3LOCA 4E7LA 4DIQA 3K2AA 2L02A 2XRLA 3R0JA 3TO9A 4JBAA 5DD4A 2PJRB 1YYVA 4IQJA 2M8GX 2AXTC 2QWWA 2R7QA 2P5KA 2Z2SB 2ZXIA 1OR7A 5HOOA 1WH5A 4UVBA 4UB6C 4RB3C 2PJRA 3VPRA 4BQNA 2QGUA 2NS8A 3DKXA 3E7LA 2K9MA 3BR1A 1KQ0A 3K7AJ 5L3CA 1I6XA 5AIPA 1HW1A 4II3A 4HV6A 1K61A 2ZSHB 1YQAA 3FZVA 1QQIA 2YPRA 1XDUA 2IT0A 1U78A 1SD4A 2JRTA 2CW8A 2A05A 2IPQX 2Y69H 4D9JA 1VNDA 5JFRA 2L7FP 1U9OA 1F9NA 4BE2A 1MZBA 2MABA 5CVJA 1JGSA 1NTCA 1R71A 1VQ5I 2O5RA 4AU7A 2IVMA 4EEFG 1SEUA 5C44J 3GF2A 1YI2I 4NQWA 4S05A 1D8JA 5E3NA 2JT1A 4HNUA 1FZPB 1YO5C 3O3KA 3KP7A 1EKEA 3FDYA 3ZMTA 3B73A 3DEWA 2F48A 1FX7A 5F0CA 4E70A 4G8XA 3C2GA 4CA0A 2ZC2A 4U88A 4HQEA 2LMDA 2W48A 2VOPA 2IS4A 3BTCA 1XMAA 2JJ7A 1EV7A 2ESNA 4EVIA 2HOSA 3TW6A 1HC8A 4D1QA 5H2FC 2FE3A 2XF5A 1CQTA 1Z77A 1IV6A 5E17F 2DT7B 3HKZA 1P6RA 4HDVA 1I6HJ 3CUQC 1YW8A 2DA2A 3N05A 2EIMH 1K83J 2VL8A 2FBIA 2A6HF 2EZKA 3WTZA 2LOOA 1QVTA 2IJLA 1QRYA 2DYRH 2W57A 2MLKA 1WQ2A 2KFDA 1N75A 1DU0A 4XONA 2XROA 5EF6A 4RGUA 5J4YA 1ZRDA 2G0EA 2GWRA 2ACJA 3E6CC 4KMUX 3W2WA 2HTJA 4XLAA 5DUIA 2R92J 4XOTA 1RIOH 4XL9A 4DJAA 2EINH 5ICGA 1QHGA 2LR8A 3CF2A 5F64A 3RQIA 3MCZA 1KA8A 1NHAA 4R79A 1AA7A 2QQBA 3S3MA 4MEXF 1VQPI 1J2XA 3Q0VA 4ASNA 2MH2A 3JAMK 1G59A 5EG0A 3MD2A 1MBFA 3DEUA 3JTHA 1D0ZA 2OCCH 4G6TB 3QOEA 1G4DA 4IL6C 3EUAA 3BG6A 3M8EA 1LE8B 2GQQA 1JKQC 2QSGX 3SZTA 3PQKA 2QM3A 3FXRA 5BPDA 4PJJA 1BR1A 4ZTFA 3C18A 2Q8KA 2K9SA 2OJED 5EJCA 2CH0A 3OYKA 2JVGA 2K4BA 2NVXJ 1D1AA 1TC3C 4HA8A 1MNEA 3RI4A 2QSHX 3E5XA 4N4NB 4BY7J 2Z1DA 4H4KC 3COAC 3HOWJ 3AL0C 2WC2A 4YFKF 2R7SA 4XRFA 3HRSA 3BJAA 4MQVA 3M1CA 4DBQA 3HIFA 3BCAA 5K1YA 2EFOA 1WSUA 2EWNA 5M5XJ 4NC6A 3BQYA 3FXKA 3RKXA 4A3DJ 4G9YA 2L7KA 2GBYA 2MW8A 3ERMA 2HYFA 2VJJA 4IHXA 4WXCA 3IH4A 2FBKA 2M4GA 2XGDA 4OMYA 3QQAA 4XLHA 4B09A 3CP2A 1FP2A 2L5QA 1BL0A 2G7UA 2E1MC 2LF7A 3CCVI 4NDLA 2XVCA 4EV0A 2VE8A 5CYVA 1UAAA 3CMMA 3KP4A 3PFYA 4LLLA 2WTEA 3CDLA 3IP4B 5HLTA 4E7HA 3H1CA 4IHWA 2V1XA 4JX5A 5HS8A 1SFOJ 2GM4A 5IYCJ 3TOBA 3VB2A 5F6FA 1KGSA 4B48A 3OSGA 1XC5A 5DV5A 4A5NA 3DPLC 2NOJB 3RKQA 2B7EA 2MFZA 3KLOA 4C3HJ 5K7FA 2WAQN 4IZZA 1GT0C 3HOYJ 1FNNA 3GTMJ 2ELJA 1TLHB 2O0YA 3C2BA 2ZKZA 3JR9A 3DU5A 1SVLA 4G7OF 2CQXA 4MQ9F 1QZEA 3P9KA 3F3XA 5F0FA 4D0PA 1TL8A 3CDHA 3FXUA 4M6YA 5KNLA 3M1EA 4BU2A 3OYGA 1WJCA 3FM3A 4WX9A 1JKPC 2JA2A 4AUXA 4ESBA 1E3PA 2XAQA 2IS6A 2P4WA 1LDDA 3X2QH 4CCNA 1USTA 3O8GA 2GA2A 1SMTA 2H1LA 3J7YJ 2QZ8A 5BQTA 3DU6A 1E17A 4M6VA 1Y0UA 1GV2A 2EPFA 1T95A 3OIOA 3LQRA 3HOUJ 2B0LA 4ZTJA 1I50J 1TZLA 2E71A 2PN6A 3T8TA 4BDYA 2HDWA 4RB2C 1TT0A 2KZGA 4L5EA 4HEA2 2BE5F 4UB8C 1FEXA 3HZJA 3HOVJ 3JRAA 3L1PA 5FLMJ 5K5OA 4DOZA 2HDCA 1YX5A 1ERDA 1P4XA 5GAGJ 3BTJA 3MWMA 4LG0A 3AG1H 2P6SA 5FRMA 2IS1A 4LG0B 3K2ZA 4V2GA 1TWCJ 4EJOA 2HI3A 2VBWA 2OTLI 2CGPA 5M5YJ 1U9NA 2BHYA 2FMYA 4I98B 5IOZA 3E6BA 3CJRB 1CF7A 4UVCA 2CW0F 2R7VA 2JA6J 1IXRC 1I39A 2RNGA 4AYBN 2J5OA 2V26A 1XDSA 4BQOA 2YX4A 3KETA 3JRCA 2KRCA 2Z3YA 9ANTA 5J1RA 3WGGA 1ZTRA 1JKRC 1TQIA 3BTLA 3EDPA 3J81K 1Z05A
chains in the Genus database with same CATH topology
4KA4A 3QP5A 3L2CA 5DEQA 3MAJA 2RGVA 4M9XA 1ZG3A 1XB4A 1FP1D 3M7GA 2P5LC 1R1TA 2KIFA 4L9JA 2F2EA 4MHGA 4KT5C 4EJVA 6PAXA 4L5IA 2CQKA 3E3VA 3IRRA 2V9VA 5D5UB 1YS6A 1WRJA 3IWFA 5BS6A 3J80Z 4BYYA 3P9IA 3QPTA 1ZARA 4LLNA 3BOQA 4U0WA 3KE2A 3R61A 5HLGA 2OU2A 1TTYA 3K69A 1F4KA 3JSOA 5DCMA 4EM0B 1YTYA 2ZFWA 3O2PE 4GGGA 2H6BA 1UHMA 4LGWA 3AAFA 3RKYA 2KIUA 2XASA 5HS9A 5CLSA 3S2WA 3KLNA 1SFEA 3JW4A 2RVCA 2VC1A 3J81Z 1U5TC 2DFIA 1Z6RA 1ZLJA 2GZWA 2QVOA 1R5GA 5FD5A 1S3JA 3GZ6A 1HSJA 3K1PA 4U0YA 3VOEA 2EK5A 1IN5A 1D3YA 4AVPA 1L0OC 3I64A 1R36A 2VBZA 2MH9A 2G7HA 2OBPA 1QZYA 1XCVA 3WU0A 2C6YA 3I5UA 3ZMVA 2XUBA 1K79A 3ZMUA 3HOTA 5LBQA 4HDUA 1FC3A 1X3UA 3K9TA 2V1DA 2CG4A 1MGTA 5LGTA 1Z9CA 2ZMEA 3LA3A 3IC7A 4FHTA 1S6LA 4IHSA 4YIFA 2JSCA 2DPUA 2WV0A 2XV4S 4A6EA 1FLIA 1ONVA 5IT3A 5FFXA 2NRAC 5EEHA 3WG9A 4NB5A 4KDPA 5KVRA 4Z2YA 2Q0OA 2KIMA 1TQMA 4OMZA 4HX4A 2FMLA 5HDGA 4HZFA 5TRDA 1R23A 3QP6A 4YG2F 4WK8F 4CO8A 4MEYF 2PI0A 1SD6A 3RKWA 1I27A 4EMSA 5ICCA 1HKTA 5FO5A 2XRNA 2UWMA 1BI3A 2MD5A 2VODA 4Y17A 3KP5A 1ZREA 1JHHA 1T38A 1W5TA 3IRQA 5HVQC 3HUGA 3ZMSA 1W7PA 3M8FA 4IRGA 1U2WA 2TDXA 4Y15A 1T2KA 3I71A 3I59B 4HYEA 2BYVE 4CGZA 4IXAA 1PP7U 1HW5A 4A0ZA 2RDPA 4RB1A 3EETA 2HQNA 2W24A 3D0SA 2M5WA 2FBHA 2YR2A 4KIFA 1O7FA 1MD0A 3R60A 2VT2A 3V8KA 4O6JA 5D4SA 4WXDA 2EA2A 1MKMA 3KP6A 4XSXF 2XKPA 1P92A 4P96A 4GXOA 3ULQB 3QPHA 3T1BA 4I02A 5FB2A 4BQAA 1LDJA 2HWVA 3I53A 1B1BA 4L9VA 1BBYA 2D1VA 5K5RA 1W7PD 1ZN2A 2OZ6A 4I0AA 1GXPA 2XAFA 5D8KB 3ABUA 1BM9A 3BPXA 1KU9A 2FEZA 3HHHA 3GO5A 4I7HA 4BHPA 5L3EA 4P55A 2VN2A 4M74A 4HLYA 3IL2A 3QRFF 4R1HA 1DUXC 2BEOA 1U5TA 3RYRA 1JHFA 1Z1DA 3C3WA 2W85A 3BJ6A 4ENKA 3Q9VA 5F1RA 1IAWA 1IXSB 2LSOA 1YW9A 2PMHA 3E5QA 5E8GA 5LHHA 1OKRA 1XD7A 1U8RA 2L54A 1IN7A 2EV6A 2V6CA 4FX4A 3ISPA 3ECOA 2DI3A 3Q5FA 1V3FA 1BJAA 4HV5A 2EV0A 4EJWA 1W5SA 1TNTA 5DUKA 3LAJA 3V7SA 3FF5A 3ZP5A 2M30A 5DDGA 1XGSA 2GXBA 2MC3A 1BI1A 2OZUA 2E1CA 4BAYA 4HF2A 2PJPA 2CSOA 2JTVA 1H9TA 1U3EM 2J5PA 5D8LB 3DKWA 3ML6A 5JR3A 2NNNA 1HSTA 2IRFG 1Z6TA 4U7BA 4DQ2A 3RJPA 3ZPLA 2ESHA 4CICA 2QQAA 4RGSA 2M1BA 3HYIA 2M8EA 3PFIA 2FRHA 2O3FA 2H94A 3KP3A 3WTYC 5CVUA 3H92A 3V8LA 1H9GA 2LDUA 2Q2EA 2HKXA 1PP8F 1W7PB 4HBLA 1G3TA 3FHZA 2P7VB 4OIRF 1BC7C 1R00A 3SFZA 3L09A 3K0LA 1T6SA 1R1VA 3JSPA 4RGRA 2MA3A 3KEQA 1IN6A 5E1XA 3RTRA 1KU2A 3F8MA 2QYOA 4L18B 3WE2A 2M87A 2HYGD 3PQJA 3NRVA 2FXAA 4H0EA 4YFNF 2QBYB 1IN4A 1S7OA 2GA1A 4IHTA 2A69F 3U2RA 1RZ4A 3RIRA 2EA4A 4AIKA 1B9NA 3SXYA 1IRGA 5ILUA 1CGPA 4HAMA 1XSDA 1IN8A 2K86A 4MGRA 5LHGA 3I0TA 1E2XA 4S04A 4HF1A 2P7CB 2ISZA 4P9FA 4A12A 4ZYHA 2DU9A 4ZYGA 2R7FA 4UV8A 1OYWA 1TBXA 2EFWA 5H6RA 1TW2A 2UZKA 3GFLA 3H3ZA 1A04A 4M9SA 3WGIA 4EGYA 4GO1A 3WTUC 1HKSA 2PEXA 4GYIA 4CYDA 2A3SA 3TO7A 5HLIA 2GXGA 5FD6A 4L0YB 5BOXA 2MBFA 2HEOA 1B6AA 3P9CA 1JXSA 1V4RA 5D6EA 3C1DA 4BHCA 4NHJA 5H6QA 3V8JA 1J5YA 2DPDA 4BNCA 1QNTA 3RYPA 1I5ZA 2COMA 3HSRA 1R5HA 2P8TA 4EQQA 2PLYA 2GIVA 1PDNC 3ZQ7A 1S8NA 1MJ9A 2HTSA 3D5LA 3TDUC 1REPC 3HSFA 3VODA 5LEKA 5JHUA 4LJZF 2LF8A 2CFXA 3ZMZA 2W25A 1YIOA 2L4MA 4CDGA 4F7ZA 1Z91A 1R1UA 3CLOA 2HKOA 3ROUA 2A6EF 3FMQA 3N4MA 3F8FA 2ZCWA 2IA2A 1GHCA 1ZHFA 3TOAA 1ZGJA 1Q1HA 2A5YB 3E6DA 4I09A 2P5VA 4CXFA 1WI9A 3MEXA 5CJ9A 5FLXK 3K1MA 1D5VA 2R3SA 2Z9OA 2HR3A 1GXQA 4KIBA 3JTGA 1O57A 4UXNA 4EM1A 4YFXF 2DK8A 2EFQA 3RPUA 2X4HA 3GVAA 4IJAA 2ZNZA 3G73A 5J6XA 3HTSB 1YS7A 1LEAA 2XKOA 2ZMEB 4G7HF 2JPBA 5IT9Z 3ZMDA 2NNYA 2FQ3A 3FXQA 2MLGA 4DNCA 4HLXA 1KQ9A 2UXXA 1YG2A 2CYYA 4Q5SF 1H0MA 1FYKA 1F1ZA 3SZPA 4HOBA 4M6XA 1ON1A 1FYLA 1YW7A 1SAXA 4UV9A 2H6CA 1QZZA 1SD5A 2QBYA 4LB6B 1ZG5A 4L9TA 3DFGA 5LGNA 2FF4A 5FLXZ 3EQLF 2HGCA 1ZH5A 4R8HA 1USSA 2STTA 3V7RA 5J8CA 3TO6A 1FWZA 4AIHA 3SQNA 3J80K 5HDNA 2XAJA 2FOKA 3GYHX 1ZGAA 3LWFA 4QLCU 4L0ZB 3IKVA 2NAZA 4N9HA 3RPQA 5ICFA 5IT9K 1LVAA 2QQ9A 3HHGA 2ZO4A 2VONA 3QOPA 3IWZA 2EFPA 1F5TA 2P6TA 2K4JA 1G3WA 2ADUA 1SFUA 1FPQA 4ZZDA 3CUQB 3LA2A 2D2WA 5E20A 1T39A 4KN4X 1OMIA 4EM2A 3HRMA 3L7WA 1UFMA 1OYYA 2YX7A 2HZTA 1GVJA 1IUYA 1S7AA 1O3SA 1PUEE 3TKYA 1XGMA 2LKPA 2OA4A 3W6KB 2PG4A 4A0YA 2DT5A 3T5XA 1HQCA 4PZJA 4FT8A 4ENNA 5DCFA 1RNLA 1G6NA 4KN7X 3RDIA 3E97A 4A0XA 3FMRA 3W6JB 3WTWC 2Z5UA 3BJOA 5LRSA 5E8IA 3E5UA 3FMSA 5D5XB 1OYIA 3F8CA 1IZ1A 3HRTA 2OQRA 4LFUA 4PGHA 2VXZA 2X0LA 4A2UA 2QUFA 4KFCA 4KMFA 4ENJA 2A68F 1FYMA 1B59A 5EEGA 3GW2A 3KEOA 2CO5A 3KZYA 1FBSA 3GEZA 1J75A 1B9MA 2FA5A 4Q4ZF 2DLLA 3R4KA 5CVVA 1LQ1A 4M9ZA 1LB2A 1UCRA 5HLHA 2KJCA 4LK0F 4A6DA 2K02A 2LNBA 3GFMA 1RI7A 2VBYA 2Y48A 1SMYF 2EB7A 4AD9A 5D4RA 3DP7A 3BWGA 2XAGA 3DXJF 3FWEA 3N97A 1FBQA 4G7ZF 5D6FA 2OQGA 2A07F 2XIGA 1DPRA 4YIIA 3QAHA 1LDKB 4KIGA 1XGNA 4O5VA 1P2FA 1ZRFA 4U7DA 2BBYA 1K6OA 1HBXG 2RC4A 1JE8A 2F5FA 2V1UA 4UVAA 5ERIA 3CJNA 1R7JA 1ULYA 5TJJA 5ICEA 4ZH4F 3O6BB 4PCQA 1KU7A 4KYWA 4Q48A 1K78A 2A61A 4G6DA 4B8XA 3F21A 1UHWA 1AOYA 1WWXA 3ERED 3L00A 3SHFA 2IA1A 2KRFA 3GWZA 2Y75A 1O3QA 3WTXC 1HXDA 3ECHA 4EJTA 4HX7A 3EYYA 2ETHA 3CO7C 1MJAA 2QLZA 3KCCA 1R22A 2OAZA 4XBFA 3F8NA 4RAZA 3CO6C 2KJBA 1XCBA 3KP2A 3V4GA 3QU3A 3WU1B 3H3UA 2F5CA 3BROA 1FY7A 2ZJ2A 5DYMA 1BI0A 1SD7A 4AIJA 3IKTA 5JI6A 5AIQA 2O8XA 3GX4X 2HS5A 3T0YA 4OINF 5A2QZ 1XSVA 2H27A 4EGZA 4IVNA 3MQ0A 2RQPA 5LLQA 5KK1A 2WWYA 1J0RA 5BPIA 2L4AA 5L3DA 1LEBA 3OV8A 5J8FA 3U9GA 4OIQF 4LLGF 1STZA 4XSZF 3ZN1A 2ZBKA 2NS0A 4MTDA 2DBBA 1K78B 1P4WA 5HS7A 3REOA 3R0AA 3WTVC 1BIBA 1U6GA 1TW3A 3F23A 1L3LA 1XSXA 3GFJA 1I1GA 5H20A 5ED4A 4XLNF 3G3ZA 2Z33A 4CZZA 3GXOA 2XGXA 5DD8A 4P9UA 2YSRA 4GYGA 3F8BA 1TQPA 1BN5A 3ELKA 1MDMB 4FX0A 1R58A 4N0BA 2H09A 5L3FA 4Q47A 4L9NA 1U5TB 2IW5A 5LRRA 3P7NA 5DCMB 4IRIA 1T98A 4ON0A 1HW2A 2XHKA 3KFWX 4K2EA 3F72A 2VC0A 4JQFA 2ISYA 4OIOF 1DDNA 1I1SA 1SFXA 2CWEA 2K27A 2EJRA 2DO7A 3OOPA 4MNUA 2DW4A 1ZLKA 1IXCA 4M72A 1EH6A 2G9WA 3WODF 1FT9A 3BDDA 2HQRA 2AXLA 2ELHA 2V79A 5E1ZB 3EUHA 5CVRA 1IRFA 2RNJA 3LSTA 5CVIA 3LAPA 2DK5A 1OPCA 5ILSA 4RAYA 4UHTA 2E7WA 3K1NA 2FNAA 3F22A 1BIAA 2DAOA 2QENA 5L3BA 5HDKA 3I58A 1YLFA 1HKQA 4WCGA 2L01A 1W4MA 4ESFA 1BOAA 2DQRA 1FOKA 1FSHA 3HSEA 3F6VA 3EYIA 1ZG1A 3TGNA 4TV7A 3M9AA 1J7KA 3IHUA 1EH7A 3CTAA 2E7XA 4ZYEA 2ZNYA 4MTEA 3HTUA 2F5DA 3DV8A 4RGXA 5D5VB 1XMKA 2BV6A 1ZRCA 3B02A 2IP2A 3ZN0A 2OD5A 1TNSA 1YFHA 1O7LA 3I54A 3FM5A 4M73A 1XGOA 5E1WA 2O61A 4IRHA 2FNPA 2VBXA 4WWCA 3I4PA 4ESJA 3DPTA 5L3GA 2F5EA 3BPVA 4Y13A 2VOOA 1RUNA 4M71A 1KYZA 4KUMA 4I01A 4WF2A 3KZZA 2RV8A 2PQ8A 2XAHA 1FBUA 2AS5F 2PBIA 1O3TA 4UNOA 4LD5A 3L9FA 5BMZA 4PDKA 2R7DA 3HOSA 4HW0A 1EH8A 1DPUA 2O6GE 3MFKA 3BZ6A 5LEJA 1ON2A 4LB5A 4RB0A 1AWCA 4BHBA 1BI2A 1C0WA 4RS8A 2HFHA 1O3RA 2EV5A 2W84A 3BY6A 3TDZC 4JK1X 2HOEA 4HQMA 5AONA 2DTRA 1KQ8A 3LQQA 4N9IA 4ETSA 3T8RA 3MZHA 4AWXB 5JVTA 3GLXA 4OOIA 2L3DA 4BXUA 2YU3A 1J59A 1WKMA 3DQVC 4IPAA 2E1NA 2JZYA 1IW7F 4I2OA 3LFKA 3NQOA 1Z7UA 3Q9SA 4BH9A 1KYWA 3QU6A 1K7AA 4U0VA 3U1DA 3WTSC 4OIPF 2K7LA 3E6MA 3R6SA 2PMUA 4WXHA 2VT3A 2M45A 3NEUA 1DP7P 1D8KA 4OU0A 1QBJA 4ZZLA 1QPMA 1KU3A 4I0BA 2STWA 3WGHA 2JPCA 3TQNA 4EJUA 3DF8A 1B4AA 3GZ5A 2ZXJA 5E18F 5A2QK 5FFZA 1S29A 1J9IA 3V7CA 1G3YA 3F6OA 3CUQA 3GUDA 5ILVA 2BGCA 2FSWA 4A5MA 2RN7A 1MJBA 2KKOA 1MDMA 3GFIA 1RUOA 1CF7B 3WTTC 5D5WB 1XN7A 2EFNA 4G94A 4HX8A 4KICA 3ABTA 1BC8C 4P5OA 2D1HA 1VTNC 1T0FA 4LK1F 4PGGA 4QWQA 3LA7A 2IA0A 1G3SA 4L5JA 3I59A 1LJ9A 2GAUA 3WE3A 1ZYRF 2PFBA 4ENMA 2FU4A 2UXNA 5FGMA 3HRUA 4UUVA 1ZAOA 4XLPF 3JAMZ 4IF4A 4LMYA 3FX3A 2D45A 4KNYA 2DQLA 5LHIA 2Z99A 2VE9A 3CUOA 4HF0A 3MZYA 1QO0D 3BP8A 4CHUA 3J7AO 1FSEA 4G6QA 4ZYDA 2O03A 5LGUA 2RKHA 1ODDA 2NYXA 1QGPA 5K5QA 3VEPA 2Y0MA 1IF1A 1P4AA 1UB9A 4O3MA 3VFZA 4GCVA 3C7JA 1LNWA 2L02A 3R0JA 3TO9A 4JBAA 5DD4A 1YYVA 2QWWA 2P5KA 1OR7A 5HOOA 4UVBA 4RB3C 1KQ0A 5L3CA 1I6XA 5AIPA 1HW1A 4HV6A 1YQAA 3FZVA 1QQIA 2YPRA 1XDUA 2IT0A 1U78A 1SD4A 2JRTA 2IPQX 5JFRA 1F9NA 1MZBA 5CVJA 1JGSA 2IVMA 3GF2A 4NQWA 4S05A 1D8JA 2JT1A 1FZPB 1YO5C 3O3KA 3KP7A 3ZMTA 3B73A 1FX7A 4E70A 4G8XA 4U88A 4HQEA 2VOPA 1XMAA 1EV7A 2ESNA 4EVIA 2FE3A 5E17F 1P6RA 4HDVA 3CUQC 1YW8A 2FBIA 2A6HF 3WTZA 2IJLA 2W57A 2MLKA 1WQ2A 2XROA 4RGUA 1ZRDA 2GWRA 2ACJA 3E6CC 4KMUX 2HTJA 5DUIA 1RIOH 5ICGA 5F64A 3MCZA 1KA8A 1NHAA 4R79A 2QQBA 4MEXF 1J2XA 4ASNA 2MH2A 3JAMK 3DEUA 3JTHA 1G4DA 3M8EA 2GQQA 3SZTA 3PQKA 2QM3A 3FXRA 5BPDA 3C18A 2Q8KA 2K4BA 4HA8A 3RI4A 3E5XA 3COAC 2WC2A 4YFKF 4XRFA 3HRSA 3BJAA 4MQVA 3HIFA 5K1YA 2EFOA 1WSUA 2EWNA 3RKXA 4G9YA 2HYFA 4WXCA 2FBKA 4OMYA 4B09A 1FP2A 2G7UA 2LF7A 4EV0A 2XVCA 2VE8A 5CYVA 3KP4A 4LLLA 2WTEA 2V1XA 5HS8A 3TOBA 3VB2A 5F6FA 1KGSA 5DV5A 4A5NA 3DPLC 3KLOA 1FNNA 1TLHB 2O0YA 2ZKZA 4G7OF 4MQ9F 3P9KA 3F3XA 4D0PA 3CDHA 3FXUA 4M6YA 3M1EA 3FM3A 4WX9A 4ESBA 2XAQA 2P4WA 1LDDA 1USTA 2GA2A 1SMTA 2QZ8A 5BQTA 1E17A 1Y0UA 3LQRA 2B0LA 3T8TA 2PN6A 4RB2C 2BE5F 5K5OA 2HDCA 1P4XA 3MWMA 4LG0A 2P6SA 4LG0B 3K2ZA 4EJOA 2VBWA 2CGPA 2FMYA 4I98B 3E6BA 1CF7A 4UVCA 2CW0F 1IXRC 2J5OA 1XDSA 2YX4A 3KETA 2Z3YA 3WGGA 1TQIA 3EDPA 3J81K 1Z05A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KA4 A;  3QP5 A;  3L2C A;  5DEQ A;  3MAJ A;  2RGV A;  4M9X A;  1ZG3 A;  1XB4 A;  1FP1 D;  3M7G A;  2P5L C;  1R1T A;  2KIF A;  4L9J A;  2F2E A;  4MHG A;  4KT5 C;  4EJV A;  6PAX A;  4L5I A;  2CQK A;  3E3V A;  3IRR A;  2V9V A;  5D5U B;  1YS6 A;  1WRJ A;  3IWF A;  5BS6 A;  3J80 Z;  4BYY A;  3P9I A;  3QPT A;  1ZAR A;  4LLN A;  3BOQ A;  4U0W A;  3KE2 A;  3R61 A;  5HLG A;  2OU2 A;  1TTY A;  3K69 A;  1F4K A;  3JSO A;  5DCM A;  4EM0 B;  1YTY A;  2ZFW A;  3O2P E;  4GGG A;  2H6B A;  1UHM A;  4LGW A;  3AAF A;  3RKY A;  2KIU A;  2XAS A;  5HS9 A;  5CLS A;  3S2W A;  3KLN A;  1SFE A;  3JW4 A;  2RVC A;  2VC1 A;  3J81 Z;  1U5T C;  2DFI A;  1Z6R A;  1ZLJ A;  2GZW A;  2QVO A;  1R5G A;  5FD5 A;  1S3J A;  3GZ6 A;  1HSJ A;  3K1P A;  4U0Y A;  3VOE A;  2EK5 A;  1IN5 A;  1D3Y A;  4AVP A;  1L0O C;  3I64 A;  1R36 A;  2VBZ A;  2MH9 A;  2G7H A;  2OBP A;  1QZY A;  1XCV A;  3WU0 A;  2C6Y A;  3I5U A;  3ZMV A;  2XUB A;  1K79 A;  3ZMU A;  3HOT A;  5LBQ A;  4HDU A;  1FC3 A;  1X3U A;  3K9T A;  2V1D A;  2CG4 A;  1MGT A;  5LGT A;  1Z9C A;  2ZME A;  3LA3 A;  3IC7 A;  4FHT A;  1S6L A;  4IHS A;  4YIF A;  2JSC A;  2DPU A;  2WV0 A;  2XV4 S;  4A6E A;  1FLI A;  1ONV A;  5IT3 A;  5FFX A;  2NRA C;  5EEH A;  3WG9 A;  4NB5 A;  4KDP A;  5KVR A;  4Z2Y A;  2Q0O A;  2KIM A;  1TQM A;  4OMZ A;  4HX4 A;  2FML A;  5HDG A;  4HZF A;  5TRD A;  1R23 A;  3QP6 A;  4YG2 F;  4WK8 F;  4CO8 A;  4MEY F;  2PI0 A;  1SD6 A;  3RKW A;  1I27 A;  4EMS A;  5ICC A;  1HKT A;  5FO5 A;  2XRN A;  2UWM A;  1BI3 A;  2MD5 A;  2VOD A;  4Y17 A;  3KP5 A;  1ZRE A;  1JHH A;  1T38 A;  1W5T A;  3IRQ A;  5HVQ C;  3HUG A;  3ZMS A;  1W7P A;  3M8F A;  4IRG A;  1U2W A;  2TDX A;  4Y15 A;  1T2K A;  3I71 A;  3I59 B;  4HYE A;  2BYV E;  4CGZ A;  4IXA A;  1PP7 U;  1HW5 A;  4A0Z A;  2RDP A;  4RB1 A;  3EET A;  2HQN A;  2W24 A;  3D0S A;  2M5W A;  2FBH A;  2YR2 A;  4KIF A;  1O7F A;  1MD0 A;  3R60 A;  2VT2 A;  3V8K A;  4O6J A;  5D4S A;  4WXD A;  2EA2 A;  1MKM A;  3KP6 A;  4XSX F;  2XKP A;  1P92 A;  4P96 A;  4GXO A;  3ULQ B;  3QPH A;  3T1B A;  4I02 A;  5FB2 A;  4BQA A;  1LDJ A;  2HWV A;  3I53 A;  1B1B A;  4L9V A;  1BBY A;  2D1V A;  5K5R A;  1W7P D;  1ZN2 A;  2OZ6 A;  4I0A A;  1GXP A;  2XAF A;  5D8K B;  3ABU A;  1BM9 A;  3BPX A;  1KU9 A;  2FEZ A;  3HHH A;  3GO5 A;  4I7H A;  4BHP A;  5L3E A;  4P55 A;  2VN2 A;  4M74 A;  4HLY A;  3IL2 A;  3QRF F;  4R1H A;  1DUX C;  2BEO A;  1U5T A;  3RYR A;  1JHF A;  1Z1D A;  3C3W A;  2W85 A;  3BJ6 A;  4ENK A;  3Q9V A;  5F1R A;  1IAW A;  1IXS B;  2LSO A;  1YW9 A;  2PMH A;  3E5Q A;  5E8G A;  5LHH A;  1OKR A;  1XD7 A;  1U8R A;  2L54 A;  1IN7 A;  2EV6 A;  2V6C A;  4FX4 A;  3ISP A;  3ECO A;  2DI3 A;  3Q5F A;  1V3F A;  1BJA A;  4HV5 A;  2EV0 A;  4EJW A;  1W5S A;  1TNT A;  5DUK A;  3LAJ A;  3V7S A;  3FF5 A;  3ZP5 A;  2M30 A;  5DDG A;  1XGS A;  2GXB A;  2MC3 A;  1BI1 A;  2OZU A;  2E1C A;  4BAY A;  4HF2 A;  2PJP A;  2CSO A;  2JTV A;  1H9T A;  1U3E M;  2J5P A;  5D8L B;  3DKW A;  3ML6 A;  5JR3 A;  2NNN A;  1HST A;  2IRF G;  1Z6T A;  4U7B A;  4DQ2 A;  3RJP A;  3ZPL A;  2ESH A;  4CIC A;  2QQA A;  4RGS A;  2M1B A;  3HYI A;  2M8E A;  3PFI A;  2FRH A;  2O3F A;  2H94 A;  3KP3 A;  3WTY C;  5CVU A;  3H92 A;  3V8L A;  1H9G A;  2LDU A;  2Q2E A;  2HKX A;  1PP8 F;  1W7P B;  4HBL A;  1G3T A;  3FHZ A;  2P7V B;  4OIR F;  1BC7 C;  1R00 A;  3SFZ A;  3L09 A;  3K0L A;  1T6S A;  1R1V A;  3JSP A;  4RGR A;  2MA3 A;  3KEQ A;  1IN6 A;  5E1X A;  3RTR A;  1KU2 A;  3F8M A;  2QYO A;  4L18 B;  3WE2 A;  2M87 A;  2HYG D;  3PQJ A;  3NRV A;  2FXA A;  4H0E A;  4YFN F;  2QBY B;  1IN4 A;  1S7O A;  2GA1 A;  4IHT A;  2A69 F;  3U2R A;  1RZ4 A;  3RIR A;  2EA4 A;  4AIK A;  1B9N A;  3SXY A;  1IRG A;  5ILU A;  1CGP A;  4HAM A;  1XSD A;  1IN8 A;  2K86 A;  4MGR A;  5LHG A;  3I0T A;  1E2X A;  4S04 A;  4HF1 A;  2P7C B;  2ISZ A;  4P9F A;  4A12 A;  4ZYH A;  2DU9 A;  4ZYG A;  2R7F A;  4UV8 A;  1OYW A;  1TBX A;  2EFW A;  5H6R A;  1TW2 A;  2UZK A;  3GFL A;  3H3Z A;  1A04 A;  4M9S A;  3WGI A;  4EGY A;  4GO1 A;  3WTU C;  1HKS A;  2PEX A;  4GYI A;  4CYD A;  2A3S A;  3TO7 A;  5HLI A;  2GXG A;  5FD6 A;  4L0Y B;  5BOX A;  2MBF A;  2HEO A;  1B6A A;  3P9C A;  1JXS A;  1V4R A;  5D6E A;  3C1D A;  4BHC A;  4NHJ A;  5H6Q A;  3V8J A;  1J5Y A;  2DPD A;  4BNC A;  1QNT A;  3RYP A;  1I5Z A;  2COM A;  3HSR A;  1R5H A;  2P8T A;  4EQQ A;  2PLY A;  2GIV A;  1PDN C;  3ZQ7 A;  1S8N A;  1MJ9 A;  2HTS A;  3D5L A;  3TDU C;  1REP C;  3HSF A;  3VOD A;  5LEK A;  5JHU A;  4LJZ F;  2LF8 A;  2CFX A;  3ZMZ A;  2W25 A;  1YIO A;  2L4M A;  4CDG A;  4F7Z A;  1Z91 A;  1R1U A;  3CLO A;  2HKO A;  3ROU A;  2A6E F;  3FMQ A;  3N4M A;  3F8F A;  2ZCW A;  2IA2 A;  1GHC A;  1ZHF A;  3TOA A;  1ZGJ A;  1Q1H A;  2A5Y B;  3E6D A;  4I09 A;  2P5V A;  4CXF A;  1WI9 A;  3MEX A;  5CJ9 A;  5FLX K;  3K1M A;  1D5V A;  2R3S A;  2Z9O A;  2HR3 A;  1GXQ A;  4KIB A;  3JTG A;  1O57 A;  4UXN A;  4EM1 A;  4YFX F;  2DK8 A;  2EFQ A;  3RPU A;  2X4H A;  3GVA A;  4IJA A;  2ZNZ A;  3G73 A;  5J6X A;  3HTS B;  1YS7 A;  1LEA A;  2XKO A;  2ZME B;  4G7H F;  2JPB A;  5IT9 Z;  3ZMD A;  2NNY A;  2FQ3 A;  3FXQ A;  2MLG A;  4DNC A;  4HLX A;  1KQ9 A;  2UXX A;  1YG2 A;  2CYY A;  4Q5S F;  1H0M A;  1FYK A;  1F1Z A;  3SZP A;  4HOB A;  4M6X A;  1ON1 A;  1FYL A;  1YW7 A;  1SAX A;  4UV9 A;  2H6C A;  1QZZ A;  1SD5 A;  2QBY A;  4LB6 B;  1ZG5 A;  4L9T A;  3DFG A;  5LGN A;  2FF4 A;  5FLX Z;  3EQL F;  2HGC A;  1ZH5 A;  4R8H A;  1USS A;  2STT A;  3V7R A;  5J8C A;  3TO6 A;  1FWZ A;  4AIH A;  3SQN A;  3J80 K;  5HDN A;  2XAJ A;  2FOK A;  3GYH X;  1ZGA A;  3LWF A;  4QLC U;  4L0Z B;  3IKV A;  2NAZ A;  4N9H A;  3RPQ A;  5ICF A;  5IT9 K;  1LVA A;  2QQ9 A;  3HHG A;  2ZO4 A;  2VON A;  3QOP A;  3IWZ A;  2EFP A;  1F5T A;  2P6T A;  2K4J A;  1G3W A;  2ADU A;  1SFU A;  1FPQ A;  4ZZD A;  3CUQ B;  3LA2 A;  2D2W A;  5E20 A;  1T39 A;  4KN4 X;  1OMI A;  4EM2 A;  3HRM A;  3L7W A;  1UFM A;  1OYY A;  2YX7 A;  2HZT A;  1GVJ A;  1IUY A;  1S7A A;  1O3S A;  1PUE E;  3TKY A;  1XGM A;  2LKP A;  2OA4 A;  3W6K B;  2PG4 A;  4A0Y A;  2DT5 A;  3T5X A;  1HQC A;  4PZJ A;  4FT8 A;  4ENN A;  5DCF A;  1RNL A;  1G6N A;  4KN7 X;  3RDI A;  3E97 A;  4A0X A;  3FMR A;  3W6J B;  3WTW C;  2Z5U A;  3BJO A;  5LRS A;  5E8I A;  3E5U A;  3FMS A;  5D5X B;  1OYI A;  3F8C A;  1IZ1 A;  3HRT A;  2OQR A;  4LFU A;  4PGH A;  2VXZ A;  2X0L A;  4A2U A;  2QUF A;  4KFC A;  4KMF A;  4ENJ A;  2A68 F;  1FYM A;  1B59 A;  5EEG A;  3GW2 A;  3KEO A;  2CO5 A;  3KZY A;  1FBS A;  3GEZ A;  1J75 A;  1B9M A;  2FA5 A;  4Q4Z F;  2DLL A;  3R4K A;  5CVV A;  1LQ1 A;  4M9Z A;  1LB2 A;  1UCR A;  5HLH A;  2KJC A;  4LK0 F;  4A6D A;  2K02 A;  2LNB A;  3GFM A;  1RI7 A;  2VBY A;  2Y48 A;  1SMY F;  2EB7 A;  4AD9 A;  5D4R A;  3DP7 A;  3BWG A;  2XAG A;  3DXJ F;  3FWE A;  3N97 A;  1FBQ A;  4G7Z F;  5D6F A;  2OQG A;  2A07 F;  2XIG A;  1DPR A;  4YII A;  3QAH A;  1LDK B;  4KIG A;  1XGN A;  4O5V A;  1P2F A;  1ZRF A;  4U7D A;  2BBY A;  1K6O A;  1HBX G;  2RC4 A;  1JE8 A;  2F5F A;  2V1U A;  4UVA A;  5ERI A;  3CJN A;  1R7J A;  1ULY A;  5TJJ A;  5ICE A;  4ZH4 F;  3O6B B;  4PCQ A;  1KU7 A;  4KYW A;  4Q48 A;  1K78 A;  2A61 A;  4G6D A;  4B8X A;  3F21 A;  1UHW A;  1AOY A;  1WWX A;  3ERE D;  3L00 A;  3SHF A;  2IA1 A;  2KRF A;  3GWZ A;  2Y75 A;  1O3Q A;  3WTX C;  1HXD A;  3ECH A;  4EJT A;  4HX7 A;  3EYY A;  2ETH A;  3CO7 C;  1MJA A;  2QLZ A;  3KCC A;  1R22 A;  2OAZ A;  4XBF A;  3F8N A;  4RAZ A;  3CO6 C;  2KJB A;  1XCB A;  3KP2 A;  3V4G A;  3QU3 A;  3WU1 B;  3H3U A;  2F5C A;  3BRO A;  1FY7 A;  2ZJ2 A;  5DYM A;  1BI0 A;  1SD7 A;  4AIJ A;  3IKT A;  5JI6 A;  5AIQ A;  2O8X A;  3GX4 X;  2HS5 A;  3T0Y A;  4OIN F;  5A2Q Z;  1XSV A;  2H27 A;  4EGZ A;  4IVN A;  3MQ0 A;  2RQP A;  5LLQ A;  5KK1 A;  2WWY A;  1J0R A;  5BPI A;  2L4A A;  5L3D A;  1LEB A;  3OV8 A;  5J8F A;  3U9G A;  4OIQ F;  4LLG F;  1STZ A;  4XSZ F;  3ZN1 A;  2ZBK A;  2NS0 A;  4MTD A;  2DBB A;  1K78 B;  1P4W A;  5HS7 A;  3REO A;  3R0A A;  3WTV C;  1BIB A;  1U6G A;  1TW3 A;  3F23 A;  1L3L A;  1XSX A;  3GFJ A;  1I1G A;  5H20 A;  5ED4 A;  4XLN F;  3G3Z A;  2Z33 A;  4CZZ A;  3GXO A;  2XGX A;  5DD8 A;  4P9U A;  2YSR A;  4GYG A;  3F8B A;  1TQP A;  1BN5 A;  3ELK A;  1MDM B;  4FX0 A;  1R58 A;  4N0B A;  2H09 A;  5L3F A;  4Q47 A;  4L9N A;  1U5T B;  2IW5 A;  5LRR A;  3P7N A;  5DCM B;  4IRI A;  1T98 A;  4ON0 A;  1HW2 A;  2XHK A;  3KFW X;  4K2E A;  3F72 A;  2VC0 A;  4JQF A;  2ISY A;  4OIO F;  1DDN A;  1I1S A;  1SFX A;  2CWE A;  2K27 A;  2EJR A;  2DO7 A;  3OOP A;  4MNU A;  2DW4 A;  1ZLK A;  1IXC A;  4M72 A;  1EH6 A;  2G9W A;  3WOD F;  1FT9 A;  3BDD A;  2HQR A;  2AXL A;  2ELH A;  2V79 A;  5E1Z B;  3EUH A;  5CVR A;  1IRF A;  2RNJ A;  3LST A;  5CVI A;  3LAP A;  2DK5 A;  1OPC A;  5ILS A;  4RAY A;  4UHT A;  2E7W A;  3K1N A;  2FNA A;  3F22 A;  1BIA A;  2DAO A;  2QEN A;  5L3B A;  5HDK A;  3I58 A;  1YLF A;  1HKQ A;  4WCG A;  2L01 A;  1W4M A;  4ESF A;  1BOA A;  2DQR A;  1FOK A;  1FSH A;  3HSE A;  3F6V A;  3EYI A;  1ZG1 A;  3TGN A;  4TV7 A;  3M9A A;  1J7K A;  3IHU A;  1EH7 A;  3CTA A;  2E7X A;  4ZYE A;  2ZNY A;  4MTE A;  3HTU A;  2F5D A;  3DV8 A;  4RGX A;  5D5V B;  1XMK A;  2BV6 A;  1ZRC A;  3B02 A;  2IP2 A;  3ZN0 A;  2OD5 A;  1TNS A;  1YFH A;  1O7L A;  3I54 A;  3FM5 A;  4M73 A;  1XGO A;  5E1W A;  2O61 A;  4IRH A;  2FNP A;  2VBX A;  4WWC A;  3I4P A;  4ESJ A;  3DPT A;  5L3G A;  2F5E A;  3BPV A;  4Y13 A;  2VOO A;  1RUN A;  4M71 A;  1KYZ A;  4KUM A;  4I01 A;  4WF2 A;  3KZZ A;  2RV8 A;  2PQ8 A;  2XAH A;  1FBU A;  2AS5 F;  2PBI A;  1O3T A;  4UNO A;  4LD5 A;  3L9F A;  5BMZ A;  4PDK A;  2R7D A;  3HOS A;  4HW0 A;  1EH8 A;  1DPU A;  2O6G E;  3MFK A;  3BZ6 A;  5LEJ A;  1ON2 A;  4LB5 A;  4RB0 A;  1AWC A;  4BHB A;  1BI2 A;  1C0W A;  4RS8 A;  2HFH A;  1O3R A;  2EV5 A;  2W84 A;  3BY6 A;  3TDZ C;  4JK1 X;  2HOE A;  4HQM A;  5AON A;  2DTR A;  1KQ8 A;  3LQQ A;  4N9I A;  4ETS A;  3T8R A;  3MZH A;  4AWX B;  5JVT A;  3GLX A;  4OOI A;  2L3D A;  4BXU A;  2YU3 A;  1J59 A;  1WKM A;  3DQV C;  4IPA A;  2E1N A;  2JZY A;  1IW7 F;  4I2O A;  3LFK A;  3NQO A;  1Z7U A;  3Q9S A;  4BH9 A;  1KYW A;  3QU6 A;  1K7A A;  4U0V A;  3U1D A;  3WTS C;  4OIP F;  2K7L A;  3E6M A;  3R6S A;  2PMU A;  4WXH A;  2VT3 A;  2M45 A;  3NEU A;  1DP7 P;  1D8K A;  4OU0 A;  1QBJ A;  4ZZL A;  1QPM A;  1KU3 A;  4I0B A;  2STW A;  3WGH A;  2JPC A;  3TQN A;  4EJU A;  3DF8 A;  1B4A A;  3GZ5 A;  2ZXJ A;  5E18 F;  5A2Q K;  5FFZ A;  1S29 A;  1J9I A;  3V7C A;  1G3Y A;  3F6O A;  3CUQ A;  3GUD A;  5ILV A;  2BGC A;  2FSW A;  4A5M A;  2RN7 A;  1MJB A;  2KKO A;  1MDM A;  3GFI A;  1RUO A;  1CF7 B;  3WTT C;  5D5W B;  1XN7 A;  2EFN A;  4G94 A;  4HX8 A;  4KIC A;  3ABT A;  1BC8 C;  4P5O A;  2D1H A;  1VTN C;  1T0F A;  4LK1 F;  4PGG A;  4QWQ A;  3LA7 A;  2IA0 A;  1G3S A;  4L5J A;  3I59 A;  1LJ9 A;  2GAU A;  3WE3 A;  1ZYR F;  2PFB A;  4ENM A;  2FU4 A;  2UXN A;  5FGM A;  3HRU A;  4UUV A;  1ZAO A;  4XLP F;  3JAM Z;  4IF4 A;  4LMY A;  3FX3 A;  2D45 A;  4KNY A;  2DQL A;  5LHI A;  2Z99 A;  2VE9 A;  3CUO A;  4HF0 A;  3MZY A;  1QO0 D;  3BP8 A;  4CHU A;  3J7A O;  1FSE A;  4G6Q A;  4ZYD A;  2O03 A;  5LGU A;  2RKH A;  1ODD A;  2NYX A;  1QGP A;  5K5Q A;  3VEP A;  2Y0M A;  1IF1 A;  1P4A A;  1UB9 A;  4O3M A;  3VFZ A;  4GCV A;  3C7J A;  1LNW A;  2L02 A;  3R0J A;  3TO9 A;  4JBA A;  5DD4 A;  1YYV A;  2QWW A;  2P5K A;  1OR7 A;  5HOO A;  4UVB A;  4RB3 C;  1KQ0 A;  5L3C A;  1I6X A;  5AIP A;  1HW1 A;  4HV6 A;  1YQA A;  3FZV A;  1QQI A;  2YPR A;  1XDU A;  2IT0 A;  1U78 A;  1SD4 A;  2JRT A;  2IPQ X;  5JFR A;  1F9N A;  1MZB A;  5CVJ A;  1JGS A;  2IVM A;  3GF2 A;  4NQW A;  4S05 A;  1D8J A;  2JT1 A;  1FZP B;  1YO5 C;  3O3K A;  3KP7 A;  3ZMT A;  3B73 A;  1FX7 A;  4E70 A;  4G8X A;  4U88 A;  4HQE A;  2VOP A;  1XMA A;  1EV7 A;  2ESN A;  4EVI A;  2FE3 A;  5E17 F;  1P6R A;  4HDV A;  3CUQ C;  1YW8 A;  2FBI A;  2A6H F;  3WTZ A;  2IJL A;  2W57 A;  2MLK A;  1WQ2 A;  2XRO A;  4RGU A;  1ZRD A;  2GWR A;  2ACJ A;  3E6C C;  4KMU X;  2HTJ A;  5DUI A;  1RIO H;  5ICG A;  5F64 A;  3MCZ A;  1KA8 A;  1NHA A;  4R79 A;  2QQB A;  4MEX F;  1J2X A;  4ASN A;  2MH2 A;  3JAM K;  3DEU A;  3JTH A;  1G4D A;  3M8E A;  2GQQ A;  3SZT A;  3PQK A;  2QM3 A;  3FXR A;  5BPD A;  3C18 A;  2Q8K A;  2K4B A;  4HA8 A;  3RI4 A;  3E5X A;  3COA C;  2WC2 A;  4YFK F;  4XRF A;  3HRS A;  3BJA A;  4MQV A;  3HIF A;  5K1Y A;  2EFO A;  1WSU A;  2EWN A;  3RKX A;  4G9Y A;  2HYF A;  4WXC A;  2FBK A;  4OMY A;  4B09 A;  1FP2 A;  2G7U A;  2LF7 A;  4EV0 A;  2XVC A;  2VE8 A;  5CYV A;  3KP4 A;  4LLL A;  2WTE A;  2V1X A;  5HS8 A;  3TOB A;  3VB2 A;  5F6F A;  1KGS A;  5DV5 A;  4A5N A;  3DPL C;  3KLO A;  1FNN A;  1TLH B;  2O0Y A;  2ZKZ A;  4G7O F;  4MQ9 F;  3P9K A;  3F3X A;  4D0P A;  3CDH A;  3FXU A;  4M6Y A;  3M1E A;  3FM3 A;  4WX9 A;  4ESB A;  2XAQ A;  2P4W A;  1LDD A;  1UST A;  2GA2 A;  1SMT A;  2QZ8 A;  5BQT A;  1E17 A;  1Y0U A;  3LQR A;  2B0L A;  3T8T A;  2PN6 A;  4RB2 C;  2BE5 F;  5K5O A;  2HDC A;  1P4X A;  3MWM A;  4LG0 A;  2P6S A;  4LG0 B;  3K2Z A;  4EJO A;  2VBW A;  2CGP A;  2FMY A;  4I98 B;  3E6B A;  1CF7 A;  4UVC A;  2CW0 F;  1IXR C;  2J5O A;  1XDS A;  2YX4 A;  3KET A;  2Z3Y A;  3WGG A;  1TQI A;  3EDP A;  3J81 K;  1Z05 A; 
#chains in the Genus database with same CATH topology
 1F36 A;  4KA4 A;  2X1C A;  3DEE A;  2LG4 A;  2JUC A;  2EIK H;  3QP5 A;  3L2C A;  5DEQ A;  4RAF A;  3MAJ A;  3MKL A;  5KAI C;  2O8K A;  2RGV A;  2VB6 A;  4M9X A;  1ZG3 A;  1XB4 A;  1FP1 D;  3S14 J;  3M7G A;  2DFH A;  2P5L C;  1OQY A;  1U8B A;  5E3O A;  4DYR A;  1OFC X;  1R1T A;  3AL0 B;  2KQR A;  2KIF A;  4B1R A;  4L9J A;  5LD2 C;  1D1B A;  1AKH B;  1ZR4 A;  2F2E A;  2QEX I;  5BNG A;  4M3B A;  1YOV B;  4MHG A;  2FD5 A;  4KT5 C;  4EJV A;  6PAX A;  4L5I A;  1G8X A;  2R4G A;  4PK4 A;  2CQK A;  3E3V A;  1F43 A;  3OYB A;  3IRR A;  5IY5 H;  4A3L J;  2V9V A;  2F4M B;  5D5U B;  3I4M J;  1YS6 A;  1WRJ A;  2FQ4 A;  2BOL A;  3OYJ A;  3IWF A;  5BS6 A;  3J80 Z;  4BYY A;  5C4J J;  3P9I A;  5M5W J;  3QPT A;  3VYS B;  4DW6 A;  1ZAR A;  1R49 A;  4LLN A;  3K70 C;  2E1M B;  3DLL F;  3BOQ A;  4U0W A;  5DS9 A;  3TP3 A;  5CPR B;  4PFP A;  3KE2 A;  3R61 A;  3Q0U A;  5HLG A;  2OU2 A;  1X4O A;  1TTY A;  2OUM A;  3K69 A;  1N77 A;  1F4K A;  1DU6 A;  3JSO A;  3K4K A;  5DCM A;  4EM0 B;  3K10 A;  1ORK A;  2VUM J;  4B47 A;  3KYL A;  4Y52 J;  1YTY A;  5F27 A;  3OYA A;  2ZFW A;  3RZO J;  3O2P E;  1P7J A;  4GGG A;  2DN0 A;  2XB0 X;  4XRS G;  2H6B A;  1UHM A;  4LGW A;  3AAF A;  3RKY A;  2AHQ A;  2KIU A;  3OYE A;  2XAS A;  2WY7 Q;  1HCR A;  5HS9 A;  2R5Y A;  3CCY A;  3TL4 X;  3LSK A;  5CLS A;  2NVT J;  3S2W A;  3VYR B;  3KLN A;  1SFE A;  2CV1 A;  1OCC H;  3JW4 A;  3K4J A;  2DMQ A;  2RVC A;  2VC1 A;  3J81 Z;  2I8D A;  1U5T C;  2DFI A;  3HB9 A;  1Z6R A;  1ZLJ A;  2GZW A;  2QVO A;  1R5G A;  3BR5 A;  5FD5 A;  1S3J A;  3GZ6 A;  2TRT A;  1HSJ A;  3CC4 I;  3A1Y A;  3K1P A;  2E34 A;  4U0Y A;  2L9N A;  4RM2 A;  3VOE A;  2EK5 A;  1IN5 A;  3FXJ A;  2F4O B;  3LSR A;  2LTP A;  1D3Y A;  4AVP A;  1BOB A;  1L0O C;  4PJM A;  3I64 A;  1X2N A;  1R36 A;  2XDV A;  3AG3 H;  2VBZ A;  3H9G A;  2MH9 A;  4XLC A;  2EBI A;  2OCE A;  3ABK H;  1WJD A;  1D0X A;  2G7H A;  2OBP A;  1QZY A;  1XCV A;  3WU0 A;  3CP8 A;  2C6Y A;  1FJL A;  3I5U A;  3ZMV A;  2X51 A;  2XUB A;  1K79 A;  4RBO A;  3ZMU A;  2HXO A;  3P5J A;  2PMZ A;  3BR3 A;  3HOT A;  3W3C A;  5LBQ A;  1FC3 A;  3QOD A;  4HDU A;  1X3U A;  3K9T A;  3HBL A;  2V1D A;  5C3E J;  2CG4 A;  3OL3 A;  2OC6 A;  3MKW B;  4HRI A;  1MGT A;  3JRB A;  5LGT A;  1Z9C A;  2ZME A;  3CZ6 A;  3LA3 A;  3IC7 A;  4FHT A;  1S6L A;  1TWG J;  3ASO H;  4QTR A;  4YIF A;  4IHS A;  5EEA A;  2JSC A;  2DPU A;  2WV0 A;  3VYT B;  3KX2 A;  2R0Q C;  2XV4 S;  3S2D J;  2NVY J;  4A6E A;  2KDZ A;  1FLI A;  1ONV A;  5IT3 A;  1N78 A;  5FFX A;  2NRA C;  5EEH A;  3WG9 A;  4NB5 A;  1VQN I;  4XKC A;  4KDP A;  1D0Y A;  2M0M A;  2VKV A;  5KVR A;  2IGK A;  2KT0 A;  4Z2Y A;  2Q0O A;  2KIM A;  1TQM A;  4OMZ A;  3H9J A;  4HX4 A;  2FML A;  5HDG A;  4HZF A;  5TRD A;  2R7O A;  1HDP A;  1R23 A;  3QP6 A;  5IP7 J;  5CKT A;  4FQG A;  4IQ4 A;  2K9Q A;  4YG2 F;  4BKX A;  1Y1W J;  2AQE A;  4CO8 A;  4MEY F;  4WK8 F;  2BHZ A;  2PI0 A;  5JLX A;  3H5R A;  5F0H A;  3A01 A;  2JK3 A;  1SD6 A;  1JUS A;  3RKW A;  1LUJ B;  4DZP A;  1I27 A;  3PNT A;  4EMS A;  2KMU A;  5ICC A;  1HKT A;  4IHY A;  5FO5 A;  3PJR A;  5B1A H;  1Y8Q B;  2XRN A;  1Z3Y A;  2UWM A;  2F5V A;  1ETX A;  5CQE A;  1BI3 A;  2JA8 J;  1T0F C;  2MD5 A;  1RKT A;  3BG7 A;  2VOD A;  4Y17 A;  3KP5 A;  1MMA A;  3OL4 A;  1OCZ H;  1ZRE A;  1JHH A;  1T38 A;  1W5C C;  3W6V A;  1W1W E;  4NUB A;  4HSR A;  1W5T A;  3IRQ A;  2BXZ A;  3H9Q A;  5HVQ C;  2IBD A;  3HUG A;  5EG0 B;  1OCP A;  2LD5 A;  3ZMS A;  1W7P A;  3M8F A;  2V1N A;  4IRG A;  1IDY A;  4NC8 A;  1U2W A;  1UG2 A;  2YU9 J;  4UUS B;  3CJT B;  2TDX A;  4XID A;  4Y15 A;  1T2K A;  2DOF A;  3S32 A;  3I71 A;  1TT5 B;  3I59 B;  4HYE A;  3ZR8 X;  3PSI A;  2BYV E;  4CGZ A;  1E0E A;  3OYN A;  3OYI A;  4IXA A;  3I55 I;  1PP7 U;  3GTK J;  1HW5 A;  4A0Z A;  2RDP A;  4RB1 A;  3EET A;  2IAI A;  1O4X A;  3GTG J;  2W1O A;  2ZJQ F;  3OS2 A;  4BEH B;  1VFC A;  2HQN A;  2W24 A;  3D0S A;  4NNJ A;  2M5W A;  3BZK A;  1IRX A;  2FBH A;  2YR2 A;  4KIF A;  2XSJ C;  1O7F A;  1MD0 A;  3QWL A;  3R60 A;  2VT2 A;  3V8K A;  5FJ8 J;  4O6J A;  2LYC A;  1ENH A;  5D4S A;  5EDN A;  4WXD A;  1Z0X A;  2EA2 A;  1MKM A;  3KP6 A;  2MG4 A;  3FKJ A;  4XSX F;  2XKP A;  3TED A;  2XAU A;  2E36 A;  1P92 A;  4P96 A;  4GXO A;  4XN3 A;  3ULQ B;  3QPH A;  3T1B A;  2W4S A;  4I02 A;  5FB2 A;  4BQA A;  3W2V A;  4M3D A;  2BW3 B;  2ME0 A;  1LDJ A;  2HWV A;  3I53 A;  1B1B A;  5IP6 A;  3S3O A;  1TWF J;  1BBY A;  4L9V A;  2D1V A;  5K5R A;  1W7P D;  1ZN2 A;  3HJE A;  2OZ6 A;  4I0A A;  3K4M A;  1GXP A;  1YRN A;  2XAF A;  5D8K B;  3CMA I;  2A6T A;  2CFO A;  3ABU A;  3LL7 A;  4II2 A;  3H0G J;  1BM9 A;  3BPX A;  1T8I A;  1KU9 A;  2FEZ A;  3HHH A;  2Q1Z B;  5KHD A;  1VQM I;  2M7B A;  3GO5 A;  4I7H A;  4BHP A;  5L3E A;  4BE0 A;  4P55 A;  3CCS I;  2VN2 A;  3GTO J;  5GAD J;  2IS2 A;  4M74 A;  3DTK A;  2L0K A;  4HLY A;  3IL2 A;  3QRF F;  1IUF A;  4R1H A;  1DUX C;  2BEO A;  1U5T A;  3U1K A;  3RYR A;  1JHF A;  1Z1D A;  3JCU C;  1FOY A;  3S2H J;  1SFK A;  1VZ0 A;  2CQQ A;  1ZK8 A;  3C3W A;  3M3Y J;  1RPW A;  2W85 A;  3BJ6 A;  3L2Q A;  1DP3 A;  3G4S I;  4ENK A;  3Q9V A;  4C9Y A;  5F1R A;  1IAW A;  1YX3 A;  1IXS B;  2LSO A;  3O8H A;  1YW9 A;  2PMH A;  3E5Q A;  5E8G A;  5LHH A;  3HPG A;  3CD6 I;  2Y0S N;  1OKR A;  1XD7 A;  3CC2 I;  3L2R A;  1QHH D;  3DPU A;  1U8R A;  1Z3X A;  2L54 A;  1IN7 A;  2EV6 A;  2HNH A;  2V6C A;  3OYH A;  4FX4 A;  1X1P A;  3ISP A;  3ECO A;  2DI3 A;  3S93 A;  2NVU B;  3Q5F A;  1V3F A;  1BJA A;  4CCK A;  3M07 A;  4HV5 A;  2EV0 A;  4LIV A;  1S7E A;  3HC7 A;  2MD0 A;  4KT6 A;  5TIS C;  4EJW A;  2CQN A;  1W5S A;  1TNT A;  5DUK A;  3LAJ A;  4D5C A;  3V7S A;  3FF5 A;  3ZP5 A;  2R93 J;  2HVS A;  2M30 A;  3WHB A;  1SAN A;  1UZC A;  1DGW Y;  1M1E B;  2VJ5 A;  1UHS A;  1SVM A;  2GIZ A;  3OWT A;  5DDG A;  1XGS A;  3JRF A;  4RMN A;  2MC3 A;  1BI1 A;  2GXB A;  2OZU A;  1MBG A;  2E1C A;  4A69 C;  4BAY A;  4HF2 A;  2PJP A;  2CSO A;  3PNY A;  2JTV A;  4PFO A;  4FAS D;  3ABM H;  1U3E M;  1H9T A;  1JTY A;  1RES A;  2J5P A;  5D8L B;  3DKW A;  3ML6 A;  1H89 C;  1ACI A;  4EAT A;  5JR3 A;  1OCR H;  3OMY A;  2NNN A;  5TGT A;  1FTZ A;  1HST A;  1OR7 C;  2IRF G;  1I3Q J;  1Z6T A;  4N4O B;  2K9L A;  4DQ2 A;  4U7B A;  3RJP A;  2W82 A;  3G1O A;  2ESH A;  3ZPL A;  4CIC A;  1PYV A;  2QQA A;  2VIX A;  4RGS A;  2IGN A;  2M1B A;  3HYI A;  1IRZ A;  2M8E A;  3PFI A;  2DJI A;  1PVE A;  2XPU A;  3FHN A;  2FRH A;  1MMN A;  2O3F A;  2H94 A;  2EIL H;  3KP3 A;  3WTY C;  4V19 K;  5CVU A;  3H92 A;  1U0J A;  4YRV A;  3S17 J;  3BG9 A;  3V8L A;  4DYC A;  1H9G A;  2DA3 A;  4B3X A;  5DM7 F;  2LDU A;  2VQG A;  2Q2E A;  3A4C A;  2HKX A;  3IH3 A;  1MND A;  2HQ5 A;  1PP8 F;  2W7N A;  1OLT A;  3MVP A;  3GZN B;  3PO3 J;  1W7P B;  4HBL A;  4BY1 J;  3H3V K;  1G3T A;  2LP0 A;  2QA4 I;  2CV2 A;  3UNG C;  3FHZ A;  2P7V B;  2HU9 A;  5F04 A;  3OIP A;  4PUS A;  1PJR A;  4OIR F;  1QVU A;  2WB1 A;  1BC7 C;  2KP6 A;  1R00 A;  3SFZ A;  2ZSI B;  3L09 A;  4F91 B;  3K0L A;  1T6S A;  3GCM A;  4BJ6 C;  1AHD P;  2WAQ A;  1R1V A;  3JSP A;  1YIT I;  1X3Z B;  2H8W A;  3CCU I;  4RGR A;  4DGW B;  2MA3 A;  4I76 A;  1FIA A;  1IN6 A;  3KEQ A;  5J1Y A;  5E1X A;  3RTR A;  1KU2 A;  3F8M A;  2QYO A;  4L18 B;  3WE2 A;  3K6G A;  2M87 A;  2HYG D;  3PQJ A;  4ABZ A;  1N25 A;  1JUM A;  3NRV A;  3CMY A;  2FXA A;  4W97 A;  4XLE A;  3LMM A;  4H0E A;  4YFN F;  2QBY B;  2LK2 A;  3GTJ J;  1IN4 A;  1S7O A;  3WG7 H;  2GA1 A;  5J1U A;  4IHT A;  2A69 F;  1RKW A;  2DOE A;  4C30 A;  3U2R A;  2X1D A;  1RZ4 A;  3RIR A;  3OYF A;  1XS9 A;  2DTZ A;  4GFB A;  2EA4 A;  3DLA A;  4AIK A;  1B9N A;  3SXY A;  1IRG A;  5EYR A;  1VF9 A;  1QU3 A;  1W36 D;  5ILU A;  3BTI A;  1CGP A;  4HAM A;  2L9R A;  1A5J A;  3CDI A;  1XSD A;  3OYL A;  3G71 I;  2DA1 A;  1IN8 A;  1Z67 A;  3KPH A;  1K4S A;  2E2H J;  2K86 A;  4MGR A;  5LHG A;  3I0T A;  3LSH A;  2MGQ A;  3MZ8 A;  1FOX A;  1E2X A;  2E2I J;  4S04 A;  3IH2 A;  4HF1 A;  2VJ4 A;  2P7C B;  2ISZ A;  4P9F A;  2E1O A;  1JGG A;  4A12 A;  2DA7 A;  4E7J A;  4ZYH A;  3KYD B;  2DU9 A;  1T08 B;  4ZYG A;  1ZKG A;  2R7F A;  1VQ7 I;  4UV8 A;  4XKW A;  1OYW A;  1MMD A;  1GV5 A;  1TBX A;  3FK7 A;  2LRE A;  1SAU A;  2EFW A;  2VQL A;  5H6R A;  4P1W A;  2BVM A;  4XR6 A;  1TW2 A;  2UZK A;  3GFL A;  3H3Z A;  1A04 A;  4M9S A;  3WGI A;  4EGY A;  2NS7 A;  2R7X A;  2WA0 A;  4GO1 A;  4BBS J;  3WTU C;  3RSN A;  2ZJR F;  1HKS A;  2Y9Y A;  2BY1 A;  2PEX A;  4GYI A;  4CYD A;  1BJZ A;  2A3S A;  2DDB A;  3TO7 A;  4F92 B;  1LFU P;  2IGM A;  4RM3 A;  2DMT A;  3HG9 A;  3I3L A;  1ZGW A;  4A3F J;  5HLI A;  2GXG A;  5FD6 A;  4L0Y B;  5BOX A;  2MBF A;  3SJM A;  2HEO A;  1B6A A;  3P9C A;  1JXS A;  1V4R A;  5D6E A;  3C1D A;  2L9V A;  4BHC A;  3HM5 A;  3H5A A;  5H6Q A;  4XQF A;  3RQ4 A;  3V8J A;  4NHJ A;  1MH4 A;  3VSK A;  2DA4 A;  3MKZ A;  5IYD J;  1J5Y A;  2DPD A;  1Y56 A;  4BNC A;  3L2V A;  4HNT A;  3LSJ A;  3SFI A;  1QNT A;  3RYP A;  1I5Z A;  2COM A;  2R7Z J;  1X19 A;  2FJ1 A;  3HSR A;  1R5H A;  2P8T A;  4EQQ A;  2PLY A;  2GIV A;  1PDN C;  4PJL A;  3DTI A;  3ZQ7 A;  1I3A A;  1S8N A;  1R9T J;  1MJ9 A;  2HTS A;  3HEF A;  2K9N A;  2GOM A;  3D5L A;  3TDU C;  1REP C;  1X58 A;  3HSF A;  3VOD A;  2KHM A;  5LEK A;  5JHU A;  3JRG A;  4LJZ F;  2IGO A;  2LF8 A;  2CFX A;  3ZMZ A;  4B3A A;  4ZYA A;  5K7H A;  2W25 A;  1YIO A;  2L4M A;  3L2U A;  1SC7 A;  4X1E A;  5LFA A;  4CDG A;  1YHQ I;  3ZXS A;  1WJ5 A;  4A3I J;  1RR7 A;  4F7Z A;  1Z91 A;  1R1U A;  3K4C A;  1MIJ A;  2CUE A;  4MO7 A;  2DMN A;  3CLO A;  1ETV A;  1HDD C;  2HKO A;  3ROU A;  2DFF A;  2DXI A;  4E4H A;  2A6E F;  3FMQ A;  2X9D A;  3N4M A;  1E3O C;  3F8F A;  4YEL A;  2ZCW A;  3CF5 F;  2IA2 A;  3K70 D;  1GHC A;  2QSF X;  3OYM A;  1ZHF A;  3TOA A;  4C3J J;  4Y33 A;  2JRM A;  1UJ8 A;  1ZGJ A;  4IOC F;  2R5Z B;  1Q1H A;  1WH7 A;  3LSI A;  3ZQL A;  2A5Y B;  3A01 B;  3E6D A;  5B1B H;  3OYC A;  4I09 A;  4FTH A;  2P5V A;  4CXF A;  1WI9 A;  2K5C A;  2WAF A;  2DOD A;  3MEX A;  5CJ9 A;  3LNQ A;  5FLX K;  3K1M A;  3PIP F;  3RZD J;  1D5V A;  2R3S A;  1JT6 A;  2Z9O A;  2HR3 A;  1POG A;  3I9V 2;  3GBG A;  1GXQ A;  4KIB A;  1WHU A;  3JTG A;  2V4J C;  1O57 A;  3F9K A;  1V5E A;  1A6I A;  3K4B A;  4UXN A;  4EM1 A;  2BVL A;  2JUG A;  5IOY A;  4YFX F;  2DK8 A;  2EFQ A;  3PL8 A;  3RPU A;  4CYC B;  1R4M B;  2X4H A;  3GVA A;  4IJA A;  5M3F J;  2ZNZ A;  1VQL I;  3G73 A;  5J6X A;  2B9S A;  1T33 A;  3HTS B;  4MFE A;  3IV5 A;  1YS7 A;  1LEA A;  2XKO A;  2ZME B;  4G7H F;  2JPB A;  3OIQ A;  5IT9 Z;  3ZMD A;  2NNY A;  1GLN A;  2FQ3 A;  2LBF A;  4A3G J;  5E3M A;  3FXQ A;  2JWT A;  2XPV A;  2MLG A;  3OSF A;  3JRD A;  2D5V A;  2IEK A;  4DNC A;  4HLX A;  1KQ9 A;  3A0H C;  2UXX A;  1YG2 A;  2CYY A;  4Q5S F;  4XN0 A;  2H8R A;  1H0M A;  1FYK A;  2XSD C;  3CCQ I;  4A3E J;  1F1Z A;  3SZP A;  4HOB A;  3HL2 A;  4M6X A;  2DCE A;  3S1M J;  2KL4 A;  4QIW N;  2Y9Z A;  1ON1 A;  1FYL A;  1YW7 A;  3S1N J;  1SAX A;  4BE1 A;  2BXY A;  4UV9 A;  4E7I A;  2ICW G;  4ZDL A;  2H6C A;  1WVR A;  1RR8 C;  3HXL A;  1QZZ A;  1OCO H;  1SD5 A;  2P81 A;  2QBY A;  1WJA A;  2WAE A;  4LB6 B;  3CCR I;  4L9T A;  2BZT A;  2LY1 A;  3DFG A;  5LGN A;  1ZG5 A;  2FF4 A;  5JHF A;  5FLX Z;  4ZJZ A;  1OIS A;  3EQL F;  2HGC A;  1ZH5 A;  4R8H A;  1USS A;  2STT A;  3PUF A;  3EPZ A;  3V7R A;  4JX6 A;  1X4P A;  5J8C A;  3TO6 A;  3AFH A;  1FWZ A;  4AIH A;  3RCO A;  3SQN A;  3KIO A;  2WV1 A;  3S8P A;  4A3C J;  3KZI C;  2KIQ A;  3J80 K;  2K85 A;  5HDN A;  2XAJ A;  2FOK A;  3GYH X;  1WCM J;  1ZGA A;  3SDG A;  3LWF A;  4QLC U;  4L0Z B;  3IKV A;  2NAZ A;  4N9H A;  3VDX A;  3G1M A;  3RPQ A;  5ICF A;  2A5W A;  1K4T A;  2HZD A;  5IT9 K;  4XIC A;  4OAZ A;  1LVA A;  3BT9 A;  2LBF B;  2QQ9 A;  2E60 A;  3HHG A;  2ZO4 A;  3H35 A;  2VON A;  3QOP A;  3IWZ A;  2EFP A;  4JOM A;  4UUS A;  1WPK A;  1B72 A;  1WFX A;  3FKI J;  3RPU D;  1F5T A;  2P6T A;  2K4J A;  4MLO A;  2DJN A;  1G3W A;  4A3B J;  3D5R C;  1IGN A;  2ADU A;  4BBR J;  1D1C A;  1SFU A;  1BR4 A;  1FPQ A;  2Y30 A;  4ZZD A;  4CCL A;  2R7T A;  4XOP A;  3CUQ B;  3LA2 A;  1Q1V A;  2D2W A;  2X48 A;  4MFD A;  2V9K A;  5E20 A;  3AG2 H;  1T39 A;  4KN4 X;  1OMI A;  1NG6 A;  2FUG 2;  4EM2 A;  3HRM A;  3L7W A;  2BY3 A;  4F55 A;  3AG4 H;  3JRI A;  1EF4 A;  1UFM A;  2OV7 A;  1OYY A;  3BG3 A;  3ESW B;  4XMY A;  1JTX A;  5KAF C;  2YX7 A;  2LKX A;  4IOA F;  2VKE A;  5GTI C;  2HZT A;  1GVJ A;  2L2O A;  2HXI A;  3F0C A;  1IUY A;  1S7A A;  1V54 H;  4NQW B;  1O3S A;  1PUE E;  2WB1 N;  1XMX A;  3TKY A;  2W00 A;  4M3F A;  1XGM A;  2LKP A;  2OA4 A;  5HNF A;  5EZG A;  3ZCO A;  1MBK A;  4CH7 A;  4C2M J;  3W6K B;  2PG4 A;  4A0Y A;  2R5Z A;  2DT5 A;  3WHC A;  3T5X A;  2VLA A;  1HQC A;  1E3H A;  4PZJ A;  5F1J A;  2CMP A;  4BQQ A;  1X3W B;  3E0J B;  5GAH J;  1SVO A;  4FT8 A;  4ENN A;  2EQR A;  5DCF A;  2RQQ A;  1RNL A;  1G6N A;  5F08 A;  4U87 A;  1WGX A;  4KN7 X;  1PUF A;  3RDI A;  3E97 A;  4A0X A;  4PJ0 C;  2XGE A;  3FMR A;  3W6J B;  3WTW C;  1LE8 A;  2Z5U A;  4JX4 A;  1LKX A;  2NVQ J;  1X1A A;  1ETQ A;  3BJO A;  5LRS A;  1GUU A;  5E8I A;  4LG3 A;  3E5U A;  3FMS A;  3MN2 A;  5D5X B;  1OYI A;  3FIW A;  1B72 B;  4Y4R A;  1FIP A;  3HKZ N;  1LVK A;  3I4N J;  3F8C A;  1IZ1 A;  3HRT A;  2OQR A;  4LFU A;  2ID3 A;  2K3F A;  4FE7 A;  4PGH A;  2VXZ A;  2I5U A;  2X0L A;  4XKV A;  4A2U A;  2QUF A;  4ANJ A;  3J7A Y;  4KFC A;  2GLO A;  4KMF A;  4ENJ A;  2A68 F;  3VYU B;  1FYM A;  4XNF A;  1B59 A;  4JYK A;  2KZV A;  3J7Z I;  5EEG A;  3GW2 A;  5EGO B;  3KEO A;  2WAD A;  2CO5 A;  3KZY A;  4BL0 B;  3QPS A;  1FBS A;  1ETY A;  3GEZ A;  1J75 A;  1B9M A;  1GDT A;  2FA5 A;  5IPA A;  4X6A J;  3BC8 A;  4Q4Z F;  2DLL A;  3R4K A;  5CVV A;  1LQ1 A;  1Y6I A;  4M9Z A;  1LB2 A;  5FLV A;  1UCR A;  3Q3S A;  4CSW A;  5IP9 J;  5HLH A;  2KJC A;  1Z21 A;  4LK0 F;  2F4I A;  4A6D A;  2R7U A;  2K02 A;  1IV8 A;  2LNB A;  1VQ9 I;  3GFM A;  2DT6 A;  1RI7 A;  2VBY A;  2HQA A;  1EJ9 A;  2HOT A;  2Y48 A;  4HNV A;  1AU7 A;  1PUF B;  1SMY F;  2CJJ A;  2EB7 A;  3SDB A;  1MMG A;  4AD9 A;  2CW7 A;  2HVR A;  5D4R A;  2DA6 A;  3DP7 A;  2UV1 A;  3G1L A;  3BWG A;  2XAG A;  3CJQ B;  4RLF A;  3DXJ F;  3FWE A;  3N97 A;  2HYJ A;  1FBQ A;  4G7Z F;  4BEH A;  1YJW I;  2Y2Z A;  1EA3 A;  3DTE A;  5D6F A;  1VQK I;  2VPR A;  2OQG A;  2A07 F;  3FXL A;  4IX7 A;  2XIG A;  3KYC B;  1DPR A;  1V5F A;  1OJL A;  4A93 J;  4YII A;  1JKO C;  3QAH A;  1LDK B;  3VSL A;  4KIG A;  1NK2 P;  3BR6 A;  1P7I A;  1XGN A;  3HGY A;  4O5V A;  1P2F A;  1WZ2 A;  3SYT A;  1ZRF A;  4U7D A;  2BBY A;  1K6O A;  1HBX G;  2RC4 A;  4CYC A;  1JE8 A;  2F5F A;  2V1U A;  4UVA A;  5ERI A;  3CJN A;  1R7J A;  1ULY A;  5TJJ A;  2E5Z A;  5ICE A;  2ZXW H;  2ZB9 A;  1YRN B;  2CUZ A;  4MIM A;  4ZH4 F;  3O6B B;  5J4V A;  4UY8 I;  2JA7 J;  4Z6Y A;  4PCQ A;  1KU7 A;  3CCJ I;  5B66 C;  4KYW A;  4Q48 A;  1K78 A;  2A61 A;  4G6D A;  1DQU A;  4B8X A;  1P9Q C;  2VPL A;  1Y8R B;  3F21 A;  1UHW A;  1AOY A;  1WWX A;  2EZH A;  3ERE D;  1RRJ A;  3L2W A;  3L00 A;  3SHF A;  2IA1 A;  2KRF A;  3GWZ A;  2Y75 A;  3HGG A;  3WTX C;  1W0T A;  1O3Q A;  3DKY A;  2V7F A;  1HXD A;  2R7W A;  3ECH A;  4EJT A;  4HX7 A;  1AKH A;  3EYY A;  3ZQH A;  3OYD A;  5GP9 A;  3S1R J;  2ETH A;  2M3A A;  3IUO A;  4AID A;  3CO7 C;  1MJA A;  3CES A;  2QLZ A;  1MW7 A;  2ECB A;  2LY9 A;  2YS9 A;  3KCC A;  1R22 A;  2X6Y A;  4CCJ A;  2KIS A;  3G2B A;  2OAZ A;  4XBF A;  3F8N A;  1GVD A;  1APL C;  2EZI A;  4RAZ A;  2M2E A;  2P0W A;  2DA5 A;  2DMU A;  2X85 A;  3CO6 C;  2OTJ I;  2KJB A;  5FKK A;  1XCB A;  3GLL A;  3KP2 A;  2CUJ A;  3V4G A;  3QU3 A;  3PNV A;  3TP0 A;  3IAM 2;  3ZQF A;  3WU1 B;  3H3U A;  1HF0 A;  3AKZ A;  2OPT A;  2VAS A;  2F5C A;  3BRO A;  3TMO A;  2O7O A;  1FY7 A;  2ZJ2 A;  4E7Z A;  2XB5 A;  5DM6 F;  1X1D A;  5DYM A;  1BI0 A;  1SD7 A;  2ZFU A;  1S5L C;  4Y3O A;  4AIJ A;  2XGC A;  3IKT A;  3S16 J;  5JI6 A;  1Y0N A;  2N8G A;  1XTA A;  5AIQ A;  4Y7N J;  1RC9 A;  2O8X A;  3GX4 X;  1R6R A;  3KEY A;  4RLQ A;  1RET A;  2EH3 A;  2HS5 A;  4OIN F;  3T0Y A;  1XG1 A;  5A2Q Z;  4BDZ A;  5HNH A;  1LFP A;  1XSV A;  3BG5 A;  3FBN B;  2LKS A;  3PIO F;  3CCL I;  2DMP A;  2H27 A;  4EGZ A;  4IVN A;  3MQ0 A;  2RQP A;  5LLQ A;  5KK1 A;  2M4K A;  2WWY A;  2X6X A;  1J0R A;  3LFU A;  3M8J A;  1IC8 A;  4BXF A;  5BPI A;  2L4A A;  3GTQ J;  2JMW A;  5L3D A;  1NH3 A;  1W36 C;  1LEB A;  3OV8 A;  2H1K A;  2DYS H;  2Y31 A;  3U21 A;  5J8F A;  3U9G A;  4OIQ F;  4LLG F;  1STZ A;  4KJZ A;  3CCM I;  2CS3 A;  4XSZ F;  3ZN1 A;  2CV0 A;  2ZBK A;  2NS0 A;  4MTD A;  2DBB A;  1BW6 A;  3JRH A;  1OCT C;  1K78 B;  1YE9 A;  1P4W A;  5HS7 A;  1MMS A;  3REO A;  3R0A A;  3WTV C;  1BIB A;  4ZC3 A;  1U6G A;  1TW3 A;  3FXM A;  3F23 A;  1XSX A;  1L3L A;  3GFJ A;  3JRE A;  1I1G A;  2E35 A;  2LH9 A;  5H20 A;  2FOW A;  5ED4 A;  4XLN F;  3G3Z A;  1MH3 A;  2Z33 A;  3CQZ J;  2KLO A;  2MSY A;  4AM3 A;  4CZZ A;  4V2F A;  3GXO A;  3ZQQ A;  2V9P A;  2XGX A;  4CCO A;  5DD8 A;  5JLW A;  1QA6 A;  4P9U A;  2YSR A;  4GYG A;  3F8B A;  1TQP A;  1BN5 A;  2AQF A;  2PX9 A;  2HPM A;  3ELK A;  2LFB A;  4FX0 A;  4YEJ A;  2K3P A;  1R58 A;  1MDM B;  1ZQ3 P;  5GPA A;  1J09 A;  4N0B A;  2H09 A;  4FCY A;  1MNM C;  4IEJ A;  5L3F A;  4Q47 A;  4L9N A;  1U5T B;  4HPQ A;  2IW5 A;  5LRR A;  3P7N A;  5GTH C;  5FKO A;  5DCM B;  2LC2 A;  4BS9 A;  4PSX A;  4IRI A;  2Y0S A;  1MBE A;  1T98 A;  3WU2 C;  1BW5 A;  4ON0 A;  1HW2 A;  2XHK A;  3KFW X;  4K2E A;  4CZC A;  3F72 A;  2VC0 A;  4JQF A;  2ISY A;  4E6K G;  1DDN A;  4OIO F;  4BGD A;  1I1S A;  1QPI A;  3ZQI A;  4XOR A;  1H8A C;  1SFX A;  2CWE A;  2K27 A;  2EJR A;  1YIJ I;  2NOG A;  4M3E A;  2DO7 A;  3OOP A;  4MNU A;  1MBJ A;  2DW4 A;  2LY2 A;  2BW3 A;  4A3J J;  1ZLK A;  5JVG F;  1IXC A;  1IO2 A;  4M72 A;  2L9S A;  1EH6 A;  2EZL A;  2BY2 A;  2G9W A;  3WOD F;  1KON A;  1IG7 A;  4LOC A;  1FT9 A;  3BDD A;  2HQR A;  2AXL A;  2ELH A;  2V79 A;  4I99 C;  5K7Z A;  5E1Z B;  3EUH A;  5CVR A;  3ONQ A;  1IRF A;  2RNJ A;  3LST A;  5CVI A;  3LAP A;  3MKY B;  4AVZ A;  2DK5 A;  1OPC A;  3LSM A;  4GDF A;  5ILS A;  4RAY A;  4UHT A;  2E7W A;  3K1N A;  2KDO A;  4XLF A;  2FNA A;  2WBM A;  3BZC A;  3F22 A;  3TBI A;  2R5Y B;  1BIA A;  2DAO A;  2QEN A;  5L3B A;  1TP4 A;  5HDK A;  3I58 A;  1S9H A;  1YLF A;  1HKQ A;  3ASN H;  5B3S H;  4WCG A;  2R7R A;  2L01 A;  3QYF A;  5E3L A;  1W4M A;  2Q2E B;  2LVS A;  4ESF A;  4B44 A;  1BOA A;  2DQR A;  2UUZ A;  5GPC A;  4D7M A;  1FOK A;  1TWH J;  2HVQ A;  3HDD A;  2DDA A;  2M0C A;  4NBQ A;  2EIJ H;  2X1E A;  3HSE A;  1FSH A;  3HUG B;  3F6V A;  1VQO I;  1ZG1 A;  3EYI A;  2RAE A;  3TGN A;  4E7S A;  4TV7 A;  3M9A A;  4B4C A;  1J7K A;  3IHU A;  1TWA J;  2NXN B;  1T56 A;  1EH7 A;  4QSH A;  4GRI A;  4C2T A;  3CTA A;  2E7X A;  3DBL B;  4ZYE A;  2CRG A;  2ZNY A;  4C2U A;  4ZDP A;  4MTE A;  1BA5 A;  3HTU A;  4LIT A;  4F52 A;  2F5D A;  3DV8 A;  3V42 A;  4RGX A;  5D5V B;  4S0H B;  4C3I J;  1JJ8 C;  1XMK A;  2BV6 A;  3B02 A;  2IP2 A;  2MC4 A;  3SEQ A;  4IO9 F;  1ZRC A;  3A03 A;  3ZN0 A;  5FKM A;  1BR2 A;  1UEL B;  4XK4 A;  2OD5 A;  3MMY B;  1TNS A;  1YFH A;  3QPL A;  1O7L A;  4KIS A;  1ZEL A;  2BY0 A;  2XF6 A;  3FM5 A;  3I54 A;  1XGO A;  4M73 A;  3FK6 A;  5E1W A;  5FRO A;  1B8I A;  3EUH C;  2O61 A;  4DYQ A;  4X0G A;  3NAR A;  4IRH A;  1VI0 A;  2FNP A;  3K4L A;  3HOZ J;  3NWT A;  2VBX A;  3C2H A;  3H5N A;  4WWC A;  2COB A;  2Z16 A;  4BUP A;  2CQ7 A;  2OF7 A;  3I4P A;  4ESJ A;  5FKN A;  3DPT A;  2M7A A;  4HST A;  4AC0 A;  1IDZ A;  3BR2 A;  2DFE A;  5L3G A;  2F5E A;  3EUK L;  3BPV A;  2JA5 J;  4Y13 A;  1A31 A;  4I6Z A;  2CUF A;  1HOM A;  2VOO A;  3OY9 A;  1RUN A;  1MSE C;  1IJW C;  4KIT B;  4J01 A;  4M71 A;  3LSG A;  3CME I;  1ETK A;  1KYZ A;  4KUM A;  3ZRG A;  1Y39 A;  4I01 A;  3BQZ A;  4UUT A;  1A36 A;  4WF2 A;  4M3G A;  5J40 A;  2QKM B;  4BJ5 C;  3KZZ A;  4PJN A;  2RV8 A;  1NK3 P;  2PQ8 A;  2XAH A;  1FBU A;  2AS5 F;  2PBI A;  4B43 A;  1O3T A;  4UNO A;  4LD5 A;  3L9F A;  3BLY A;  5IYB J;  5BMZ A;  4PDK A;  1R5I D;  2AO9 A;  2R7D A;  3CLQ A;  3HOS A;  1WJB A;  3SEZ A;  4HW0 A;  1EH8 A;  1DPU A;  3OS1 A;  2ZJP F;  5FKL A;  3FIS A;  3LSP A;  3MFK A;  3A02 A;  3BZ6 A;  2O6G E;  5LEJ A;  1FOW A;  1ON2 A;  3OOU A;  5C4X J;  4LB5 A;  4RB0 A;  1Z7L A;  1AWC A;  4BHB A;  3HOX J;  1BI2 A;  1C0W A;  4RS8 A;  3ZQC A;  1VQ6 I;  2HFH A;  5J47 A;  1O3R A;  2EV5 A;  2TCT A;  2W84 A;  3BY6 A;  3IAS 2;  4JK1 X;  3TDZ C;  1DGR M;  1HLV A;  3D5S C;  1WI3 A;  4D7N A;  4OWR B;  1B8I B;  3S3N A;  2O9L A;  3DBR B;  4FIS A;  2HOE A;  3GME A;  4HQM A;  4YIR X;  4W1U A;  5AON A;  2DTR A;  1X1B A;  3G6E I;  1FMV A;  1V5G A;  1KQ8 A;  1YJ9 I;  3LQQ A;  1UMQ A;  1V55 H;  3DCF A;  4N9I A;  2KPM A;  4ETS A;  1ZR2 A;  1JT0 A;  2VQC A;  3T8R A;  3MZH A;  3QYE A;  1A35 A;  5DTD A;  4AWX B;  5KCM A;  3UR3 C;  5JVT A;  3GLX A;  4OOI A;  1R4N B;  4F3Q A;  2L3D A;  1FMW A;  4BXU A;  1JUP A;  5M3M J;  2YU3 A;  3Q0W A;  3PSF A;  1UG0 A;  4PSW A;  1Y1V J;  1J59 A;  1YJN I;  3QYB A;  1WKM A;  3DQV C;  2E19 A;  3DBH B;  4IPA A;  2E1N A;  2JZY A;  4XKB A;  2ZXH A;  2FX0 A;  3H0D A;  2E2J J;  1IW7 F;  1ITY A;  4I2O A;  1H88 C;  4XRS A;  3LFK A;  3NQO A;  2PMZ N;  1Z7U A;  2X6W A;  3Q9S A;  4BH9 A;  1X1C A;  2JN6 A;  2E5N A;  2XPW A;  3NAU A;  3E1S A;  4ITV A;  3W2A A;  2B63 J;  1KYW A;  3QU6 A;  1K7A A;  3GTL J;  4U0V A;  3U1D A;  3WTS C;  1A6Q A;  4OIP F;  2VI6 A;  2QF7 A;  2K7L A;  4LIU A;  2VKH A;  1ETW A;  3E6M A;  2DOA A;  3R6S A;  1D5Y A;  2HPI A;  2ID6 A;  2GOX B;  2PMU A;  4WXH A;  2VT3 A;  2M45 A;  2YUS A;  3NEU A;  1S72 I;  1DP7 P;  5FRN A;  1D8K A;  2CU7 A;  1LPQ A;  4OU0 A;  1QBJ A;  2M34 A;  4ZZL A;  1QPM A;  2QKL B;  3UKG A;  1XPX A;  2GXA A;  1KU3 A;  4I0B A;  3D1N I;  2STW A;  1K6Y A;  3WGH A;  2JPC A;  4CCM A;  5B5E C;  3TQN A;  4EJU A;  2L7M P;  3DF8 A;  4NC7 A;  1B4A A;  3GZ5 A;  2ZXJ A;  2VXD A;  5E18 F;  2MYS A;  2L7Z A;  3TW7 A;  3BCB A;  5A2Q K;  4FET A;  3ZOB A;  4J00 A;  4A3M J;  5FFZ A;  3SZG A;  1S29 A;  1FTT A;  2JSP A;  4IKF A;  1J9I A;  3V7C A;  2ZME C;  4ZDO A;  1G3Y A;  4FE4 A;  4D5F A;  3PUB A;  4JP0 A;  3VWB A;  2ECC A;  3F6O A;  2RRE A;  1VQ8 I;  3CUQ A;  1JJ6 C;  5CQG A;  5EZH A;  3GUD A;  4QPQ A;  4RDU A;  3FBI B;  3K4N A;  5ILV A;  2BGC A;  2ME6 A;  2FSW A;  3S15 J;  5J3L A;  4E7K A;  4A5M A;  2RN7 A;  1MJB A;  2KKO A;  3HPH A;  4OAY A;  3A2K A;  3OR1 C;  1MDM A;  3OS0 A;  3GFI A;  5E79 C;  1RUO A;  1CF7 B;  4RA2 A;  5D5W B;  2JVH A;  3WTT C;  1XN7 A;  2EFN A;  2M9H A;  4G94 A;  4HX8 A;  3ABT A;  4KIC A;  1BC8 C;  4BXX J;  4AYB A;  3ZQG A;  4P5O A;  2D1H A;  2LRD A;  1T0F A;  1VTN C;  4LK1 F;  4DBR A;  3CCE I;  3PO2 J;  4PGG A;  4QWQ A;  3LA7 A;  2IA0 A;  3BR0 A;  3B6C A;  1G3S A;  1KZH A;  3GTP J;  4L5J A;  1JI8 A;  3ZGK A;  3I59 A;  2I10 A;  1LJ9 A;  2GAU A;  3WE3 A;  4A3K J;  2QQ8 A;  1ZYR F;  2X6O A;  2IXS A;  1ETO A;  1WJE A;  3PM1 A;  2PFB A;  1W0U A;  4ENM A;  4G12 A;  2FU4 A;  2UXN A;  5FGM A;  3HRU A;  2HOA A;  4UUV A;  1ZAO A;  4CUG A;  3B6A A;  4XLP F;  3JAM Z;  4IF4 A;  4LMY A;  3FX3 A;  2D45 A;  4KNY A;  2K40 A;  2VJI A;  1LFB A;  2DQL A;  4IHV A;  5LHI A;  5GAE J;  3ABL H;  4F93 B;  4XM3 A;  2Z99 A;  1VQ4 I;  2VE9 A;  3CUO A;  1NG7 A;  1XX5 A;  2VQH A;  2QCO A;  2XC7 A;  4J19 A;  4HF0 A;  1X2M A;  2ELK A;  3MZY A;  1QO0 D;  2VKD A;  3BP8 A;  4CHU A;  4QPO A;  3J7A O;  5EGO A;  1MSF C;  3S1Q J;  3M4O J;  1FSE A;  2LLK A;  3FXO A;  3I56 I;  2KRH A;  3NWS A;  2XF7 A;  4BJT A;  4G6Q A;  4ZYD A;  2O03 A;  3H36 A;  5LGU A;  2RKH A;  2V6E A;  1G2H A;  1ODD A;  4HG2 A;  3CC7 I;  2NYX A;  4BAC A;  1QGP A;  5K5Q A;  2WY8 Q;  5HOD A;  3VEP A;  2Y0M A;  1IF1 A;  1P4A A;  4RAG A;  1UB9 A;  3OR2 C;  4XRM A;  4O3M A;  2HDD A;  3VFZ A;  3A0B C;  4GCV A;  4DZJ A;  3C7J A;  2JQ7 A;  3DWL E;  1HA8 A;  2F6C A;  1LNW A;  1WJF A;  1MBH A;  3LOC A;  4E7L A;  4DIQ A;  3K2A A;  2L02 A;  2XRL A;  3R0J A;  3TO9 A;  4JBA A;  5DD4 A;  2PJR B;  1YYV A;  4IQJ A;  2M8G X;  2AXT C;  2QWW A;  2R7Q A;  2P5K A;  2Z2S B;  2ZXI A;  1OR7 A;  5HOO A;  1WH5 A;  4UVB A;  4UB6 C;  4RB3 C;  2PJR A;  3VPR A;  4BQN A;  2QGU A;  2NS8 A;  3DKX A;  3E7L A;  2K9M A;  3BR1 A;  1KQ0 A;  3K7A J;  5L3C A;  1I6X A;  5AIP A;  1HW1 A;  4II3 A;  4HV6 A;  1K61 A;  2ZSH B;  1YQA A;  3FZV A;  1QQI A;  2YPR A;  1XDU A;  2IT0 A;  1U78 A;  1SD4 A;  2JRT A;  2CW8 A;  2A05 A;  2IPQ X;  2Y69 H;  4D9J A;  1VND A;  5JFR A;  2L7F P;  1U9O A;  1F9N A;  4BE2 A;  1MZB A;  2MAB A;  5CVJ A;  1JGS A;  1NTC A;  1R71 A;  1VQ5 I;  2O5R A;  4AU7 A;  2IVM A;  4EEF G;  1SEU A;  5C44 J;  3GF2 A;  1YI2 I;  4NQW A;  4S05 A;  1D8J A;  5E3N A;  2JT1 A;  4HNU A;  1FZP B;  1YO5 C;  3O3K A;  3KP7 A;  1EKE A;  3FDY A;  3ZMT A;  3B73 A;  3DEW A;  2F48 A;  1FX7 A;  5F0C A;  4E70 A;  4G8X A;  3C2G A;  4CA0 A;  2ZC2 A;  4U88 A;  4HQE A;  2LMD A;  2W48 A;  2VOP A;  2IS4 A;  3BTC A;  1XMA A;  2JJ7 A;  1EV7 A;  2ESN A;  4EVI A;  2HOS A;  3TW6 A;  1HC8 A;  4D1Q A;  5H2F C;  2FE3 A;  2XF5 A;  1CQT A;  1Z77 A;  1IV6 A;  5E17 F;  2DT7 B;  3HKZ A;  1P6R A;  4HDV A;  1I6H J;  3CUQ C;  1YW8 A;  2DA2 A;  3N05 A;  2EIM H;  1K83 J;  2VL8 A;  2FBI A;  2A6H F;  2EZK A;  3WTZ A;  2LOO A;  1QVT A;  2IJL A;  1QRY A;  2DYR H;  2W57 A;  2MLK A;  1WQ2 A;  2KFD A;  1N75 A;  1DU0 A;  4XON A;  2XRO A;  5EF6 A;  4RGU A;  5J4Y A;  1ZRD A;  2G0E A;  2GWR A;  2ACJ A;  3E6C C;  4KMU X;  3W2W A;  2HTJ A;  4XLA A;  5DUI A;  2R92 J;  4XOT A;  1RIO H;  4XL9 A;  4DJA A;  2EIN H;  5ICG A;  1QHG A;  2LR8 A;  3CF2 A;  5F64 A;  3RQI A;  3MCZ A;  1KA8 A;  1NHA A;  4R79 A;  1AA7 A;  2QQB A;  3S3M A;  4MEX F;  1VQP I;  1J2X A;  3Q0V A;  4ASN A;  2MH2 A;  3JAM K;  1G59 A;  5EG0 A;  3MD2 A;  1MBF A;  3DEU A;  3JTH A;  1D0Z A;  2OCC H;  4G6T B;  3QOE A;  1G4D A;  4IL6 C;  3EUA A;  3BG6 A;  3M8E A;  1LE8 B;  2GQQ A;  1JKQ C;  2QSG X;  3SZT A;  3PQK A;  2QM3 A;  3FXR A;  5BPD A;  4PJJ A;  1BR1 A;  4ZTF A;  3C18 A;  2Q8K A;  2K9S A;  2OJE D;  5EJC A;  2CH0 A;  3OYK A;  2JVG A;  2K4B A;  2NVX J;  1D1A A;  1TC3 C;  4HA8 A;  1MNE A;  3RI4 A;  2QSH X;  3E5X A;  4N4N B;  4BY7 J;  2Z1D A;  4H4K C;  3COA C;  3HOW J;  3AL0 C;  2WC2 A;  4YFK F;  2R7S A;  4XRF A;  3HRS A;  3BJA A;  4MQV A;  3M1C A;  4DBQ A;  3HIF A;  3BCA A;  5K1Y A;  2EFO A;  1WSU A;  2EWN A;  5M5X J;  4NC6 A;  3BQY A;  3FXK A;  3RKX A;  4A3D J;  4G9Y A;  2L7K A;  2GBY A;  2MW8 A;  3ERM A;  2HYF A;  2VJJ A;  4IHX A;  4WXC A;  3IH4 A;  2FBK A;  2M4G A;  2XGD A;  4OMY A;  3QQA A;  4XLH A;  4B09 A;  3CP2 A;  1FP2 A;  2L5Q A;  1BL0 A;  2G7U A;  2E1M C;  2LF7 A;  3CCV I;  4NDL A;  2XVC A;  4EV0 A;  2VE8 A;  5CYV A;  1UAA A;  3CMM A;  3KP4 A;  3PFY A;  4LLL A;  2WTE A;  3CDL A;  3IP4 B;  5HLT A;  4E7H A;  3H1C A;  4IHW A;  2V1X A;  4JX5 A;  5HS8 A;  1SFO J;  2GM4 A;  5IYC J;  3TOB A;  3VB2 A;  5F6F A;  1KGS A;  4B48 A;  3OSG A;  1XC5 A;  5DV5 A;  4A5N A;  3DPL C;  2NOJ B;  3RKQ A;  2B7E A;  2MFZ A;  3KLO A;  4C3H J;  5K7F A;  2WAQ N;  4IZZ A;  1GT0 C;  3HOY J;  1FNN A;  3GTM J;  2ELJ A;  1TLH B;  2O0Y A;  3C2B A;  2ZKZ A;  3JR9 A;  3DU5 A;  1SVL A;  4G7O F;  2CQX A;  4MQ9 F;  1QZE A;  3P9K A;  3F3X A;  5F0F A;  4D0P A;  1TL8 A;  3CDH A;  3FXU A;  4M6Y A;  5KNL A;  3M1E A;  4BU2 A;  3OYG A;  1WJC A;  3FM3 A;  4WX9 A;  1JKP C;  2JA2 A;  4AUX A;  4ESB A;  1E3P A;  2XAQ A;  2IS6 A;  2P4W A;  1LDD A;  3X2Q H;  4CCN A;  1UST A;  3O8G A;  2GA2 A;  1SMT A;  2H1L A;  3J7Y J;  2QZ8 A;  5BQT A;  3DU6 A;  1E17 A;  4M6V A;  1Y0U A;  1GV2 A;  2EPF A;  1T95 A;  3OIO A;  3LQR A;  3HOU J;  2B0L A;  4ZTJ A;  1I50 J;  1TZL A;  2E71 A;  2PN6 A;  3T8T A;  4BDY A;  2HDW A;  4RB2 C;  1TT0 A;  2KZG A;  4L5E A;  4HEA 2;  2BE5 F;  4UB8 C;  1FEX A;  3HZJ A;  3HOV J;  3JRA A;  3L1P A;  5FLM J;  5K5O A;  4DOZ A;  2HDC A;  1YX5 A;  1ERD A;  1P4X A;  5GAG J;  3BTJ A;  3MWM A;  4LG0 A;  3AG1 H;  2P6S A;  5FRM A;  2IS1 A;  4LG0 B;  3K2Z A;  4V2G A;  1TWC J;  4EJO A;  2HI3 A;  2VBW A;  2OTL I;  2CGP A;  5M5Y J;  1U9N A;  2BHY A;  2FMY A;  4I98 B;  5IOZ A;  3E6B A;  3CJR B;  1CF7 A;  4UVC A;  2CW0 F;  2R7V A;  2JA6 J;  1IXR C;  1I39 A;  2RNG A;  4AYB N;  2J5O A;  2V26 A;  1XDS A;  4BQO A;  2YX4 A;  3KET A;  3JRC A;  2KRC A;  2Z3Y A;  9ANT A;  5J1R A;  3WGG A;  1ZTR A;  1JKR C;  1TQI A;  3BTL A;  3EDP A;  3J81 K;  1Z05 A; 
#chains in the Genus database with same CATH homology
 4KA4 A;  3QP5 A;  3L2C A;  5DEQ A;  3MAJ A;  2RGV A;  4M9X A;  1ZG3 A;  1XB4 A;  1FP1 D;  3M7G A;  2P5L C;  1R1T A;  2KIF A;  4L9J A;  2F2E A;  4MHG A;  4KT5 C;  4EJV A;  6PAX A;  4L5I A;  2CQK A;  3E3V A;  3IRR A;  2V9V A;  5D5U B;  1YS6 A;  1WRJ A;  3IWF A;  5BS6 A;  3J80 Z;  4BYY A;  3P9I A;  3QPT A;  1ZAR A;  4LLN A;  3BOQ A;  4U0W A;  3KE2 A;  3R61 A;  5HLG A;  2OU2 A;  1TTY A;  3K69 A;  1F4K A;  3JSO A;  5DCM A;  4EM0 B;  1YTY A;  2ZFW A;  3O2P E;  4GGG A;  2H6B A;  1UHM A;  4LGW A;  3AAF A;  3RKY A;  2KIU A;  2XAS A;  5HS9 A;  5CLS A;  3S2W A;  3KLN A;  1SFE A;  3JW4 A;  2RVC A;  2VC1 A;  3J81 Z;  1U5T C;  2DFI A;  1Z6R A;  1ZLJ A;  2GZW A;  2QVO A;  1R5G A;  5FD5 A;  1S3J A;  3GZ6 A;  1HSJ A;  3K1P A;  4U0Y A;  3VOE A;  2EK5 A;  1IN5 A;  1D3Y A;  4AVP A;  1L0O C;  3I64 A;  1R36 A;  2VBZ A;  2MH9 A;  2G7H A;  2OBP A;  1QZY A;  1XCV A;  3WU0 A;  2C6Y A;  3I5U A;  3ZMV A;  2XUB A;  1K79 A;  3ZMU A;  3HOT A;  5LBQ A;  4HDU A;  1FC3 A;  1X3U A;  3K9T A;  2V1D A;  2CG4 A;  1MGT A;  5LGT A;  1Z9C A;  2ZME A;  3LA3 A;  3IC7 A;  4FHT A;  1S6L A;  4IHS A;  4YIF A;  2JSC A;  2DPU A;  2WV0 A;  2XV4 S;  4A6E A;  1FLI A;  1ONV A;  5IT3 A;  5FFX A;  2NRA C;  5EEH A;  3WG9 A;  4NB5 A;  4KDP A;  5KVR A;  4Z2Y A;  2Q0O A;  2KIM A;  1TQM A;  4OMZ A;  4HX4 A;  2FML A;  5HDG A;  4HZF A;  5TRD A;  1R23 A;  3QP6 A;  4YG2 F;  4WK8 F;  4CO8 A;  4MEY F;  2PI0 A;  1SD6 A;  3RKW A;  1I27 A;  4EMS A;  5ICC A;  1HKT A;  5FO5 A;  2XRN A;  2UWM A;  1BI3 A;  2MD5 A;  2VOD A;  4Y17 A;  3KP5 A;  1ZRE A;  1JHH A;  1T38 A;  1W5T A;  3IRQ A;  5HVQ C;  3HUG A;  3ZMS A;  1W7P A;  3M8F A;  4IRG A;  1U2W A;  2TDX A;  4Y15 A;  1T2K A;  3I71 A;  3I59 B;  4HYE A;  2BYV E;  4CGZ A;  4IXA A;  1PP7 U;  1HW5 A;  4A0Z A;  2RDP A;  4RB1 A;  3EET A;  2HQN A;  2W24 A;  3D0S A;  2M5W A;  2FBH A;  2YR2 A;  4KIF A;  1O7F A;  1MD0 A;  3R60 A;  2VT2 A;  3V8K A;  4O6J A;  5D4S A;  4WXD A;  2EA2 A;  1MKM A;  3KP6 A;  4XSX F;  2XKP A;  1P92 A;  4P96 A;  4GXO A;  3ULQ B;  3QPH A;  3T1B A;  4I02 A;  5FB2 A;  4BQA A;  1LDJ A;  2HWV A;  3I53 A;  1B1B A;  4L9V A;  1BBY A;  2D1V A;  5K5R A;  1W7P D;  1ZN2 A;  2OZ6 A;  4I0A A;  1GXP A;  2XAF A;  5D8K B;  3ABU A;  1BM9 A;  3BPX A;  1KU9 A;  2FEZ A;  3HHH A;  3GO5 A;  4I7H A;  4BHP A;  5L3E A;  4P55 A;  2VN2 A;  4M74 A;  4HLY A;  3IL2 A;  3QRF F;  4R1H A;  1DUX C;  2BEO A;  1U5T A;  3RYR A;  1JHF A;  1Z1D A;  3C3W A;  2W85 A;  3BJ6 A;  4ENK A;  3Q9V A;  5F1R A;  1IAW A;  1IXS B;  2LSO A;  1YW9 A;  2PMH A;  3E5Q A;  5E8G A;  5LHH A;  1OKR A;  1XD7 A;  1U8R A;  2L54 A;  1IN7 A;  2EV6 A;  2V6C A;  4FX4 A;  3ISP A;  3ECO A;  2DI3 A;  3Q5F A;  1V3F A;  1BJA A;  4HV5 A;  2EV0 A;  4EJW A;  1W5S A;  1TNT A;  5DUK A;  3LAJ A;  3V7S A;  3FF5 A;  3ZP5 A;  2M30 A;  5DDG A;  1XGS A;  2GXB A;  2MC3 A;  1BI1 A;  2OZU A;  2E1C A;  4BAY A;  4HF2 A;  2PJP A;  2CSO A;  2JTV A;  1H9T A;  1U3E M;  2J5P A;  5D8L B;  3DKW A;  3ML6 A;  5JR3 A;  2NNN A;  1HST A;  2IRF G;  1Z6T A;  4U7B A;  4DQ2 A;  3RJP A;  3ZPL A;  2ESH A;  4CIC A;  2QQA A;  4RGS A;  2M1B A;  3HYI A;  2M8E A;  3PFI A;  2FRH A;  2O3F A;  2H94 A;  3KP3 A;  3WTY C;  5CVU A;  3H92 A;  3V8L A;  1H9G A;  2LDU A;  2Q2E A;  2HKX A;  1PP8 F;  1W7P B;  4HBL A;  1G3T A;  3FHZ A;  2P7V B;  4OIR F;  1BC7 C;  1R00 A;  3SFZ A;  3L09 A;  3K0L A;  1T6S A;  1R1V A;  3JSP A;  4RGR A;  2MA3 A;  3KEQ A;  1IN6 A;  5E1X A;  3RTR A;  1KU2 A;  3F8M A;  2QYO A;  4L18 B;  3WE2 A;  2M87 A;  2HYG D;  3PQJ A;  3NRV A;  2FXA A;  4H0E A;  4YFN F;  2QBY B;  1IN4 A;  1S7O A;  2GA1 A;  4IHT A;  2A69 F;  3U2R A;  1RZ4 A;  3RIR A;  2EA4 A;  4AIK A;  1B9N A;  3SXY A;  1IRG A;  5ILU A;  1CGP A;  4HAM A;  1XSD A;  1IN8 A;  2K86 A;  4MGR A;  5LHG A;  3I0T A;  1E2X A;  4S04 A;  4HF1 A;  2P7C B;  2ISZ A;  4P9F A;  4A12 A;  4ZYH A;  2DU9 A;  4ZYG A;  2R7F A;  4UV8 A;  1OYW A;  1TBX A;  2EFW A;  5H6R A;  1TW2 A;  2UZK A;  3GFL A;  3H3Z A;  1A04 A;  4M9S A;  3WGI A;  4EGY A;  4GO1 A;  3WTU C;  1HKS A;  2PEX A;  4GYI A;  4CYD A;  2A3S A;  3TO7 A;  5HLI A;  2GXG A;  5FD6 A;  4L0Y B;  5BOX A;  2MBF A;  2HEO A;  1B6A A;  3P9C A;  1JXS A;  1V4R A;  5D6E A;  3C1D A;  4BHC A;  4NHJ A;  5H6Q A;  3V8J A;  1J5Y A;  2DPD A;  4BNC A;  1QNT A;  3RYP A;  1I5Z A;  2COM A;  3HSR A;  1R5H A;  2P8T A;  4EQQ A;  2PLY A;  2GIV A;  1PDN C;  3ZQ7 A;  1S8N A;  1MJ9 A;  2HTS A;  3D5L A;  3TDU C;  1REP C;  3HSF A;  3VOD A;  5LEK A;  5JHU A;  4LJZ F;  2LF8 A;  2CFX A;  3ZMZ A;  2W25 A;  1YIO A;  2L4M A;  4CDG A;  4F7Z A;  1Z91 A;  1R1U A;  3CLO A;  2HKO A;  3ROU A;  2A6E F;  3FMQ A;  3N4M A;  3F8F A;  2ZCW A;  2IA2 A;  1GHC A;  1ZHF A;  3TOA A;  1ZGJ A;  1Q1H A;  2A5Y B;  3E6D A;  4I09 A;  2P5V A;  4CXF A;  1WI9 A;  3MEX A;  5CJ9 A;  5FLX K;  3K1M A;  1D5V A;  2R3S A;  2Z9O A;  2HR3 A;  1GXQ A;  4KIB A;  3JTG A;  1O57 A;  4UXN A;  4EM1 A;  4YFX F;  2DK8 A;  2EFQ A;  3RPU A;  2X4H A;  3GVA A;  4IJA A;  2ZNZ A;  3G73 A;  5J6X A;  3HTS B;  1YS7 A;  1LEA A;  2XKO A;  2ZME B;  4G7H F;  2JPB A;  5IT9 Z;  3ZMD A;  2NNY A;  2FQ3 A;  3FXQ A;  2MLG A;  4DNC A;  4HLX A;  1KQ9 A;  2UXX A;  1YG2 A;  2CYY A;  4Q5S F;  1H0M A;  1FYK A;  1F1Z A;  3SZP A;  4HOB A;  4M6X A;  1ON1 A;  1FYL A;  1YW7 A;  1SAX A;  4UV9 A;  2H6C A;  1QZZ A;  1SD5 A;  2QBY A;  4LB6 B;  1ZG5 A;  4L9T A;  3DFG A;  5LGN A;  2FF4 A;  5FLX Z;  3EQL F;  2HGC A;  1ZH5 A;  4R8H A;  1USS A;  2STT A;  3V7R A;  5J8C A;  3TO6 A;  1FWZ A;  4AIH A;  3SQN A;  3J80 K;  5HDN A;  2XAJ A;  2FOK A;  3GYH X;  1ZGA A;  3LWF A;  4QLC U;  4L0Z B;  3IKV A;  2NAZ A;  4N9H A;  3RPQ A;  5ICF A;  5IT9 K;  1LVA A;  2QQ9 A;  3HHG A;  2ZO4 A;  2VON A;  3QOP A;  3IWZ A;  2EFP A;  1F5T A;  2P6T A;  2K4J A;  1G3W A;  2ADU A;  1SFU A;  1FPQ A;  4ZZD A;  3CUQ B;  3LA2 A;  2D2W A;  5E20 A;  1T39 A;  4KN4 X;  1OMI A;  4EM2 A;  3HRM A;  3L7W A;  1UFM A;  1OYY A;  2YX7 A;  2HZT A;  1GVJ A;  1IUY A;  1S7A A;  1O3S A;  1PUE E;  3TKY A;  1XGM A;  2LKP A;  2OA4 A;  3W6K B;  2PG4 A;  4A0Y A;  2DT5 A;  3T5X A;  1HQC A;  4PZJ A;  4FT8 A;  4ENN A;  5DCF A;  1RNL A;  1G6N A;  4KN7 X;  3RDI A;  3E97 A;  4A0X A;  3FMR A;  3W6J B;  3WTW C;  2Z5U A;  3BJO A;  5LRS A;  5E8I A;  3E5U A;  3FMS A;  5D5X B;  1OYI A;  3F8C A;  1IZ1 A;  3HRT A;  2OQR A;  4LFU A;  4PGH A;  2VXZ A;  2X0L A;  4A2U A;  2QUF A;  4KFC A;  4KMF A;  4ENJ A;  2A68 F;  1FYM A;  1B59 A;  5EEG A;  3GW2 A;  3KEO A;  2CO5 A;  3KZY A;  1FBS A;  3GEZ A;  1J75 A;  1B9M A;  2FA5 A;  4Q4Z F;  2DLL A;  3R4K A;  5CVV A;  1LQ1 A;  4M9Z A;  1LB2 A;  1UCR A;  5HLH A;  2KJC A;  4LK0 F;  4A6D A;  2K02 A;  2LNB A;  3GFM A;  1RI7 A;  2VBY A;  2Y48 A;  1SMY F;  2EB7 A;  4AD9 A;  5D4R A;  3DP7 A;  3BWG A;  2XAG A;  3DXJ F;  3FWE A;  3N97 A;  1FBQ A;  4G7Z F;  5D6F A;  2OQG A;  2A07 F;  2XIG A;  1DPR A;  4YII A;  3QAH A;  1LDK B;  4KIG A;  1XGN A;  4O5V A;  1P2F A;  1ZRF A;  4U7D A;  2BBY A;  1K6O A;  1HBX G;  2RC4 A;  1JE8 A;  2F5F A;  2V1U A;  4UVA A;  5ERI A;  3CJN A;  1R7J A;  1ULY A;  5TJJ A;  5ICE A;  4ZH4 F;  3O6B B;  4PCQ A;  1KU7 A;  4KYW A;  4Q48 A;  1K78 A;  2A61 A;  4G6D A;  4B8X A;  3F21 A;  1UHW A;  1AOY A;  1WWX A;  3ERE D;  3L00 A;  3SHF A;  2IA1 A;  2KRF A;  3GWZ A;  2Y75 A;  1O3Q A;  3WTX C;  1HXD A;  3ECH A;  4EJT A;  4HX7 A;  3EYY A;  2ETH A;  3CO7 C;  1MJA A;  2QLZ A;  3KCC A;  1R22 A;  2OAZ A;  4XBF A;  3F8N A;  4RAZ A;  3CO6 C;  2KJB A;  1XCB A;  3KP2 A;  3V4G A;  3QU3 A;  3WU1 B;  3H3U A;  2F5C A;  3BRO A;  1FY7 A;  2ZJ2 A;  5DYM A;  1BI0 A;  1SD7 A;  4AIJ A;  3IKT A;  5JI6 A;  5AIQ A;  2O8X A;  3GX4 X;  2HS5 A;  3T0Y A;  4OIN F;  5A2Q Z;  1XSV A;  2H27 A;  4EGZ A;  4IVN A;  3MQ0 A;  2RQP A;  5LLQ A;  5KK1 A;  2WWY A;  1J0R A;  5BPI A;  2L4A A;  5L3D A;  1LEB A;  3OV8 A;  5J8F A;  3U9G A;  4OIQ F;  4LLG F;  1STZ A;  4XSZ F;  3ZN1 A;  2ZBK A;  2NS0 A;  4MTD A;  2DBB A;  1K78 B;  1P4W A;  5HS7 A;  3REO A;  3R0A A;  3WTV C;  1BIB A;  1U6G A;  1TW3 A;  3F23 A;  1L3L A;  1XSX A;  3GFJ A;  1I1G A;  5H20 A;  5ED4 A;  4XLN F;  3G3Z A;  2Z33 A;  4CZZ A;  3GXO A;  2XGX A;  5DD8 A;  4P9U A;  2YSR A;  4GYG A;  3F8B A;  1TQP A;  1BN5 A;  3ELK A;  1MDM B;  4FX0 A;  1R58 A;  4N0B A;  2H09 A;  5L3F A;  4Q47 A;  4L9N A;  1U5T B;  2IW5 A;  5LRR A;  3P7N A;  5DCM B;  4IRI A;  1T98 A;  4ON0 A;  1HW2 A;  2XHK A;  3KFW X;  4K2E A;  3F72 A;  2VC0 A;  4JQF A;  2ISY A;  4OIO F;  1DDN A;  1I1S A;  1SFX A;  2CWE A;  2K27 A;  2EJR A;  2DO7 A;  3OOP A;  4MNU A;  2DW4 A;  1ZLK A;  1IXC A;  4M72 A;  1EH6 A;  2G9W A;  3WOD F;  1FT9 A;  3BDD A;  2HQR A;  2AXL A;  2ELH A;  2V79 A;  5E1Z B;  3EUH A;  5CVR A;  1IRF A;  2RNJ A;  3LST A;  5CVI A;  3LAP A;  2DK5 A;  1OPC A;  5ILS A;  4RAY A;  4UHT A;  2E7W A;  3K1N A;  2FNA A;  3F22 A;  1BIA A;  2DAO A;  2QEN A;  5L3B A;  5HDK A;  3I58 A;  1YLF A;  1HKQ A;  4WCG A;  2L01 A;  1W4M A;  4ESF A;  1BOA A;  2DQR A;  1FOK A;  1FSH A;  3HSE A;  3F6V A;  3EYI A;  1ZG1 A;  3TGN A;  4TV7 A;  3M9A A;  1J7K A;  3IHU A;  1EH7 A;  3CTA A;  2E7X A;  4ZYE A;  2ZNY A;  4MTE A;  3HTU A;  2F5D A;  3DV8 A;  4RGX A;  5D5V B;  1XMK A;  2BV6 A;  1ZRC A;  3B02 A;  2IP2 A;  3ZN0 A;  2OD5 A;  1TNS A;  1YFH A;  1O7L A;  3I54 A;  3FM5 A;  4M73 A;  1XGO A;  5E1W A;  2O61 A;  4IRH A;  2FNP A;  2VBX A;  4WWC A;  3I4P A;  4ESJ A;  3DPT A;  5L3G A;  2F5E A;  3BPV A;  4Y13 A;  2VOO A;  1RUN A;  4M71 A;  1KYZ A;  4KUM A;  4I01 A;  4WF2 A;  3KZZ A;  2RV8 A;  2PQ8 A;  2XAH A;  1FBU A;  2AS5 F;  2PBI A;  1O3T A;  4UNO A;  4LD5 A;  3L9F A;  5BMZ A;  4PDK A;  2R7D A;  3HOS A;  4HW0 A;  1EH8 A;  1DPU A;  2O6G E;  3MFK A;  3BZ6 A;  5LEJ A;  1ON2 A;  4LB5 A;  4RB0 A;  1AWC A;  4BHB A;  1BI2 A;  1C0W A;  4RS8 A;  2HFH A;  1O3R A;  2EV5 A;  2W84 A;  3BY6 A;  3TDZ C;  4JK1 X;  2HOE A;  4HQM A;  5AON A;  2DTR A;  1KQ8 A;  3LQQ A;  4N9I A;  4ETS A;  3T8R A;  3MZH A;  4AWX B;  5JVT A;  3GLX A;  4OOI A;  2L3D A;  4BXU A;  2YU3 A;  1J59 A;  1WKM A;  3DQV C;  4IPA A;  2E1N A;  2JZY A;  1IW7 F;  4I2O A;  3LFK A;  3NQO A;  1Z7U A;  3Q9S A;  4BH9 A;  1KYW A;  3QU6 A;  1K7A A;  4U0V A;  3U1D A;  3WTS C;  4OIP F;  2K7L A;  3E6M A;  3R6S A;  2PMU A;  4WXH A;  2VT3 A;  2M45 A;  3NEU A;  1DP7 P;  1D8K A;  4OU0 A;  1QBJ A;  4ZZL A;  1QPM A;  1KU3 A;  4I0B A;  2STW A;  3WGH A;  2JPC A;  3TQN A;  4EJU A;  3DF8 A;  1B4A A;  3GZ5 A;  2ZXJ A;  5E18 F;  5A2Q K;  5FFZ A;  1S29 A;  1J9I A;  3V7C A;  1G3Y A;  3F6O A;  3CUQ A;  3GUD A;  5ILV A;  2BGC A;  2FSW A;  4A5M A;  2RN7 A;  1MJB A;  2KKO A;  1MDM A;  3GFI A;  1RUO A;  1CF7 B;  3WTT C;  5D5W B;  1XN7 A;  2EFN A;  4G94 A;  4HX8 A;  4KIC A;  3ABT A;  1BC8 C;  4P5O A;  2D1H A;  1VTN C;  1T0F A;  4LK1 F;  4PGG A;  4QWQ A;  3LA7 A;  2IA0 A;  1G3S A;  4L5J A;  3I59 A;  1LJ9 A;  2GAU A;  3WE3 A;  1ZYR F;  2PFB A;  4ENM A;  2FU4 A;  2UXN A;  5FGM A;  3HRU A;  4UUV A;  1ZAO A;  4XLP F;  3JAM Z;  4IF4 A;  4LMY A;  3FX3 A;  2D45 A;  4KNY A;  2DQL A;  5LHI A;  2Z99 A;  2VE9 A;  3CUO A;  4HF0 A;  3MZY A;  1QO0 D;  3BP8 A;  4CHU A;  3J7A O;  1FSE A;  4G6Q A;  4ZYD A;  2O03 A;  5LGU A;  2RKH A;  1ODD A;  2NYX A;  1QGP A;  5K5Q A;  3VEP A;  2Y0M A;  1IF1 A;  1P4A A;  1UB9 A;  4O3M A;  3VFZ A;  4GCV A;  3C7J A;  1LNW A;  2L02 A;  3R0J A;  3TO9 A;  4JBA A;  5DD4 A;  1YYV A;  2QWW A;  2P5K A;  1OR7 A;  5HOO A;  4UVB A;  4RB3 C;  1KQ0 A;  5L3C A;  1I6X A;  5AIP A;  1HW1 A;  4HV6 A;  1YQA A;  3FZV A;  1QQI A;  2YPR A;  1XDU A;  2IT0 A;  1U78 A;  1SD4 A;  2JRT A;  2IPQ X;  5JFR A;  1F9N A;  1MZB A;  5CVJ A;  1JGS A;  2IVM A;  3GF2 A;  4NQW A;  4S05 A;  1D8J A;  2JT1 A;  1FZP B;  1YO5 C;  3O3K A;  3KP7 A;  3ZMT A;  3B73 A;  1FX7 A;  4E70 A;  4G8X A;  4U88 A;  4HQE A;  2VOP A;  1XMA A;  1EV7 A;  2ESN A;  4EVI A;  2FE3 A;  5E17 F;  1P6R A;  4HDV A;  3CUQ C;  1YW8 A;  2FBI A;  2A6H F;  3WTZ A;  2IJL A;  2W57 A;  2MLK A;  1WQ2 A;  2XRO A;  4RGU A;  1ZRD A;  2GWR A;  2ACJ A;  3E6C C;  4KMU X;  2HTJ A;  5DUI A;  1RIO H;  5ICG A;  5F64 A;  3MCZ A;  1KA8 A;  1NHA A;  4R79 A;  2QQB A;  4MEX F;  1J2X A;  4ASN A;  2MH2 A;  3JAM K;  3DEU A;  3JTH A;  1G4D A;  3M8E A;  2GQQ A;  3SZT A;  3PQK A;  2QM3 A;  3FXR A;  5BPD A;  3C18 A;  2Q8K A;  2K4B A;  4HA8 A;  3RI4 A;  3E5X A;  3COA C;  2WC2 A;  4YFK F;  4XRF A;  3HRS A;  3BJA A;  4MQV A;  3HIF A;  5K1Y A;  2EFO A;  1WSU A;  2EWN A;  3RKX A;  4G9Y A;  2HYF A;  4WXC A;  2FBK A;  4OMY A;  4B09 A;  1FP2 A;  2G7U A;  2LF7 A;  4EV0 A;  2XVC A;  2VE8 A;  5CYV A;  3KP4 A;  4LLL A;  2WTE A;  2V1X A;  5HS8 A;  3TOB A;  3VB2 A;  5F6F A;  1KGS A;  5DV5 A;  4A5N A;  3DPL C;  3KLO A;  1FNN A;  1TLH B;  2O0Y A;  2ZKZ A;  4G7O F;  4MQ9 F;  3P9K A;  3F3X A;  4D0P A;  3CDH A;  3FXU A;  4M6Y A;  3M1E A;  3FM3 A;  4WX9 A;  4ESB A;  2XAQ A;  2P4W A;  1LDD A;  1UST A;  2GA2 A;  1SMT A;  2QZ8 A;  5BQT A;  1E17 A;  1Y0U A;  3LQR A;  2B0L A;  3T8T A;  2PN6 A;  4RB2 C;  2BE5 F;  5K5O A;  2HDC A;  1P4X A;  3MWM A;  4LG0 A;  2P6S A;  4LG0 B;  3K2Z A;  4EJO A;  2VBW A;  2CGP A;  2FMY A;  4I98 B;  3E6B A;  1CF7 A;  4UVC A;  2CW0 F;  1IXR C;  2J5O A;  1XDS A;  2YX4 A;  3KET A;  2Z3Y A;  3WGG A;  1TQI A;  3EDP A;  3J81 K;  1Z05 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...