2D1VA

Crystal structure of dna-binding domain of bacillus subtilis yycf
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
103
structure length
103
Chain Sequence
SSNEIHIGSLVIFPDAYVVSKRDETIELTHREFELLHYLAKHIGQVMTREHLLQTVWGYDYFGDVRTVDVTVRRLREKIEDNPSHPNWIVTRRGVGYYLRNPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcriptional regulatory protein yycF
publication title Response regulator YycF essential for bacterial growth: X-ray crystal structure of the DNA-binding domain and its PhoB-like DNA recognition motif
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
total genus 28
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2005-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2d1vA00
2P8TA 1RNLA 1H0MA 1YQAA 2EWNA 2FRHA 1FWZA 4KN4X 2CW0F 3GWZA 4OOIA 2DO7A 3RDIA 3HRMA 2H09A 4HF2A 3DV8A 3TKYA 1DUXC 2EV6A 1U5TC 2ACJA 3I5UA 5LEKA 4A6EA 3LWFA 4IJAA 5D5VB 1TQPA 3FM3A 1T2KA 4P9FA 1I5ZA 4R79A 2FU4A 3CUQC 3ROUA 5DEQA 1MDMA 1YG2A 2Z5UA 2KKOA 4OIRF 2D1VA 1G4DA 2XROA 1B9MA 2GWRA 1IN5A 1JE8A 5BOXA 3IC7A 2OBPA 2E7XA 4A5NA 4EGYA 2MH2A 3Q9VA 1ZN2A 2FXAA 1WQ2A 4HX8A 2UWMA 3F6VA 1HKTA 2H6CA 1YLFA 4FX0A 1RUOA 5ILUA 2IA2A 3F8FA 3HRUA 2K02A 5H6QA 1P4AA 4NB5A 2CO5A 3FXRA 2L4MA 1HSJA 2MH9A 2XKPA 3HIFA 2XAQA 3DP7A 3M7GA 3HHGA 4WXHA 3WTUC 2KIMA 2VBWA 1S3JA 3I59B 2QQBA 2H27A 3GEZA 4YIFA 4LJZF 1XGOA 2HQNA 1A04A 4OINF 2DQRA 2L3DA 1OYWA 4LK0F 1QZZA 3HSRA 4BAYA 5D6FA 3JSPA 4I01A 4R8HA 2KIFA 4L9VA 2P5LC 4ESBA 2PG4A 1YYVA 3CUOA 1C0WA 1HSTA 2A5YB 3GO5A 4EJVA 2WWYA 1RUNA 1V4RA 2Q2EA 1T38A 4QLCU 2VXZA 1IXRC 3FM5A 5FFZA 4GYIA 5JVTA 1YO5C 1XDSA 1R00A 3WGHA 4UV9A 2XKOA 3B73A 2L02A 2R7DA 3W6KB 4NQWA 3HYIA 1MKMA 4IRIA 4G6QA 5D8LB 1D5VA 1BC7C 2YPRA 1USTA 4MQVA 3WU1B 2NAZA 3QPHA 1I27A 2GAUA 4BQAA 4O5VA 5DV5A 3PQJA 2STWA 2HYGD 2MA3A 2ESNA 1Y0UA 2OZ6A 3EDPA 1VTNC 4CO8A 3F8NA 3E3VA 5FFXA 3T5XA 5KK1A 1GVJA 1XD7A 3BOQA 4IXAA 4P5OA 2RKHA 2HQRA 3I59A 3HTSB 3I54A 5TRDA 4PGGA 2Y0MA 2FQ3A 1XMKA 1H9TA 5D5XB 5K5RA 2STTA 2FMLA 4HQEA 5CVIA 2DW4A 1G3SA 4XLPF 5CVJA 3SQNA 2MD5A 2QVOA 3LA3A 1MGTA 1R7JA 2DBBA 3HTUA 1O57A 1S7AA 2XAJA 2QQ9A 2P5VA 1FLIA 1OYYA 2GXBA 2Q8KA 2W85A 1SD6A 2V9VA 1K6OA 2YU3A 3E5UA 4B09A 2HZTA 4L5JA 5LRSA 4ZZLA 1LDDA 4CGZA 3BWGA 2OA4A 3M8FA 3VB2A 1T0FA 2ZKZA 1WKMA 2DU9A 3ZMZA 1HQCA 3I71A 1TLHB 2EA4A 5F64A 1KQ9A 2A6EF 2QZ8A 2DT5A 4KMFA 3KLOA 2CGPA 4KYWA 1Z6TA 1IUYA 3EYYA 3Q9SA 3WTZA 1ZARA 4BHPA 2XAHA 2WC2A 3M8EA 4KNYA 3EYIA 1W7PD 2J5PA 2H94A 3K9TA 3KE2A 5E17F 4LK1F 1T6SA 2TDXA 5IT3A 1AOYA 5LRRA 3MZHA 4CZZA 5IT9K 3FMRA 5HOOA 1ZLKA 1FP1D 4Q48A 4CXFA 4ESJA 1MJBA 1NHAA 2XRNA 4TV7A 4KICA 2O03A 4A0XA 3BPXA 2IW5A 3RKWA 4ETSA 2FA5A 1UFMA 4IHTA 2F5FA 2YX4A 3C1DA 4OMYA 1Z1DA 4YFXF 5CVUA 1YS7A 1XN7A 3WTYC 5L3DA 4I7HA 1PP7U 2ZMEB 4RGUA 2P4WA 5CYVA 3L2CA 2PQ8A 3VFZA 4L9NA 2BGCA 5BPIA 2VE9A 3NRVA 1FNNA 2XAFA 1KGSA 4I2OA 5ILVA 4I0AA 3SFZA 4S05A 3RJPA 1ODDA 1R1VA 1TTYA 4BHCA 1P92A 4ENJA 1FZPB 1RIOH 1AWCA 2O8XA 4XBFA 1WWXA 2VBYA 4DNCA 4HX4A 3F21A 1UB9A 3TQNA 1DP7P 4KIFA 3JTGA 3DXJF 4LLLA 3FX3A 2L54A 1EH8A 2NS0A 3K0LA 3D5LA 4KIGA 4N0BA 3B02A 1GHCA 3HOTA 1ZG3A 4RS8A 4I09A 1KYWA 2Y75A 1PP8F 2P7CB 5BS6A 4BXUA 2VT3A 5D5UB 3WTWC 3TOAA 3LAPA 3FHZA 2X4HA 2ELHA 3HRSA 4ENNA 5LBQA 1HW2A 3J81Z 2FBKA 1UHMA 2ISZA 5FGMA 1OMIA 4AIJA 3R0AA 1J9IA 1F4KA 2NNNA 2G7HA 1MJ9A 4GXOA 2ZMEA 1BIAA 2JPCA 2JTVA 2P6TA 1EH6A 2EA2A 4P55A 4HLXA 1CF7B 3ABUA 4AIKA 3RKYA 2XUBA 1QBJA 4HQMA 2VN2A 4M73A 5L3FA 3R60A 5L3CA 1OKRA 2COMA 1Z05A 3SZTA 1XGMA 2ZBKA 2CWEA 4FHTA 4HF0A 3FF5A 3U2RA 3J81K 3LAJA 2VBXA 4IRGA 4G6DA 1FYLA 4M74A 1W4MA 2MLKA 3TO6A 1K7AA 1J0RA 1GXQA 2IRFG 3PFIA 3DFGA 4HDVA 5E18F 1KU7A 1G3TA 3G3ZA 4U88A 3KEOA 3DEUA 3VODA 1ZAOA 3JAMZ 4LGWA 5FB2A 2J5OA 4HBLA 2A3SA 2W84A 3PQKA 2CYYA 1ZG1A 3E6DA 3FWEA 1I1SA 2BYVE 4EV0A 5LHHA 5CVRA 1TQMA 3JTHA 4O6JA 5FLXK 3GFLA 3LA2A 3VEPA 1XGSA 2QM3A 3GVAA 4RB1A 2PMHA 2RGVA 4RAYA 2LSOA 2GXGA 3TO9A 1HKSA 1ZLJA 5EEHA 1CF7A 5D4RA 1J2XA 4UVBA 3JW4A 2O61A 4G7HF 3WODF 5CLSA 1F5TA 1O3QA 3JAMK 5LHGA 4HV5A 1IF1A 2VOPA 5JFRA 1TBXA 2Z33A 2HFHA 4GO1A 4PGHA 4N9IA 1BJAA 4M71A 3QP6A 3GFIA 3ELKA 2O3FA 1J75A 3GFJA 5FD6A 3O2PE 4PCQA 2XVCA 5K1YA 4LLGF 4BHBA 4ASNA 3C3WA 1BI0A 4LLNA 3QRFF 4A0ZA 2EV0A 2KIUA 4IHSA 1FBSA 4JQFA 1RI7A 2QENA 2F5EA 3ERED 1LJ9A 2NRAC 3KP7A 2FE3A 1K78B 5ICCA 1ZHFA 1I6XA 3BDDA 2XIGA 2JZYA 2XGXA 1P4WA 2XHKA 2Z99A 2XASA 3BROA 1KU3A 4UUVA 2K7LA 4H0EA 1SAXA 2Z9OA 2F2EA 4WCGA 4UVCA 4D0PA 1IN7A 2X0LA 2M87A 1L3LA 1JXSA 3K1MA 1MZBA 3OV8A 1YTYA 2IA0A 4RGRA 1D8JA 2H6BA 4XSZF 4U0WA 2Q0OA 2P5KA 3ZMVA 3E5QA 4MNUA 1O3SA 2A61A 4ENMA 3U1DA 3BY6A 5E1XA 1USSA 6PAXA 4WXCA 2GZWA 1IRFA 3ZQ7A 1B9NA 1G6NA 3I0TA 4RB2C 2QUFA 5FD5A 3LFKA 3V8JA 1HW5A 1KYZA 3HUGA 4HZFA 4DQ2A 1W5TA 1B59A 1WRJA 2MBFA 1OR7A 4EJWA 1ULYA 5TJJA 3HOSA 2MLGA 3C18A 4EMSA 4ON0A 2HOEA 1K78A 1HXDA 1R1TA 4OIQF 1ZYRF 3F23A 3M9AA 1S29A 4FX4A 3V8KA 3M1EA 2YSRA 2FNAA 2JPBA 3WU0A 1IN4A 3F8BA 2FBHA 5F1RA 1S8NA 1S6LA 4NHJA 4HW0A 3BJOA 1UHWA 2ESHA 5IT9Z 2M45A 3CO7C 4RB3C 4L9JA 1J7KA 1IN6A 2K27A 3K69A 4G8XA 5L3EA 1LDKB 3TDZC 5DCFA 5HLIA 1IW7F 1TQIA 4G7ZF 1YS6A 3Q5FA 1TW2A 2ZXJA 1JHFA 2IVMA 3FXQA 3KCCA 1R58A 3R6SA 3BJAA 3DF8A 4Y13A 1ZH5A 3KP3A 2G9WA 3KZYA 3T8TA 5K5OA 1ONVA 2D1HA 1KU9A 4G94A 3LQQA 5ICGA 1FY7A 2OZUA 1U3EM 2K4BA 3HSFA 4G9YA 2A6HF 2VT2A 3K2ZA 4U7BA 4YG2F 4A0YA 2IPQX 2VONA 1FBQA 2CG4A 1XB4A 3GXOA 1DDNA 1XGNA 4OMZA 4LMYA 4KIBA 2QLZA 4O3MA 4XSXF 1O7LA 3MAJA 3CDHA 4UXNA 3BZ6A 2DI3A 2AS5F 3LQRA 3RPQA 3R61A 3F8CA 3QPTA 2GQQA 1HBXG 1BM9A 2FNPA 1FYKA 4Q4ZF 4MTDA 3CLOA 4P96A 1S7OA 5AIPA 2P7VB 3EQLF 3VOEA 3ISPA 1SD4A 1ON2A 3ZMDA 2HWVA 2OAZA 2EJRA 4HYEA 1D3YA 1OPCA 2CFXA 4EM2A 5EEGA 1YW7A 2HGCA 4UNOA 5E1WA 1SMTA 3ML6A 2HKXA 4IPAA 3MWMA 5DD4A 3GX4X 3L7WA 2RDPA 3WTSC 2O0YA 2EB7A 3J80K 2V1UA 4M6XA 3P7NA 2RQPA 2KJBA 5HS9A 2GA1A 5D8KB 3IKTA 4BYYA 4GGGA 3RKXA 4EQQA 2DTRA 5DYMA 1MD0A 1MJAA 2ZJ2A 2A07F 2RN7A 2ZO4A 1FX7A 5JHUA 5AONA 1KQ0A 2L4AA 1GXPA 2V1XA 2HR3A 2ADUA 4PZJA 2QYOA 4A5MA 2V79A 2DAOA 1R23A 1BN5A 2IT0A 3R0JA 4L0ZB 4YIIA 3QU3A 2JSCA 2PEXA 5DUKA 1ZRCA 1G3WA 1XSVA 1IXCA 2Y48A 4CDGA 1TW3A 2XAGA 2IP2A 3LA7A 3RYRA 4F7ZA 3HSEA 2BE5F 1B4AA 1R5GA 4CICA 2M5WA 5DD8A 3DQVC 5E8IA 4IVNA 1QZYA 2FF4A 2ZNZA 1U8RA 3ZN1A 1STZA 2LDUA 5HS8A 5ICFA 3WTTC 5HS7A 3TO7A 1ON1A 1KQ8A 2LNBA 5BQTA 2UXXA 3K1PA 5FLXZ 2WTEA 3ULQB 3KP5A 1OYIA 4ZYEA 3KP4A 1P2FA 3GYHX 4YFKF 2E1NA 3DPTA 2RVCA 5DDGA 1U6GA 2ZFWA 1R1UA 3ZP5A 1LDJA 2M1BA 2EK5A 3RTRA 5LLQA 4B8XA 2QWWA 3FMSA 3EETA 2V1DA 1O3RA 5HDGA 2DK5A 1J5YA 1X3UA 2BV6A 2EFPA 2HTSA 4LFUA 4ZYDA 2K4JA 1Z7UA 3O6BB 5LGUA 3H92A 1E17A 1IXSB 2KRFA 3IKVA 2LF7A 4WXDA 3KFWX 2PI0A 4KDPA 1V3FA 5HLHA 2A69F 1SMYF 2PN6A 5KVRA 3WGIA 3BPVA 3P9IA 2FMYA 3ZMUA 3N4MA 4ZYHA 3R4KA 1EV7A 2D2WA 5JR3A 4AIHA 2VODA 3W6JB 3ECOA 5AIQA 3WGGA 2W25A 3ZMSA 4OU0A 4ZZDA 1LQ1A 2XV4S 1B1BA 2HS5A 3GUDA 1FSHA 3MFKA 4OIPF 5J8CA 5K5QA 3S2WA 3E97A 1HW1A 3GZ5A 4L5IA 1BOAA 2PFBA 1HKQA 3KLNA 4QWQA 1IZ1A 1I1GA 3N97A 1D8KA 5BMZA 5D6EA 4UVAA 1JHHA 3HRTA 3V7CA 3WTXC 3E6CC 4JK1X 1LVAA 2LF8A 1KU2A 2RV8A 3V4GA 4RAZA 2QBYB 2CQKA 4N9HA 3I64A 1Q1HA 4M72A 3V7SA 3CJNA 1O7FA 1WI9A 2E1CA 2VE8A 3P9KA 3RIRA 1P6RA 4Y15A 2F5DA 5DCMB 2KJCA 1F9NA 5CJ9A 4EGZA 4KMUX 4WF2A 5ERIA 3REOA 3DPLC 1XMAA 3EUHA 4WX9A 1B6AA 5F6FA 1JGSA 2GIVA 5FO5A 5D5WB 2D45A 3MCZA 4ZH4F 3F8MA 1LEAA 4GYGA 1QO0D 4ENKA 1DPRA 2B0LA 2OQGA 3WTVC 4L9TA 2DPUA 2IA1A 5A2QZ 1ZRFA 1XCVA 3IRQA 4HDUA 3QAHA 4Z2YA 2UZKA 1ZGAA 3RPUA 4Q47A 1R5HA 1ZG5A 3J7AO 1YW9A 3QU6A 2JRTA 2V6CA 1SFXA 3OOPA 3QOPA 3CTAA 3GFMA 3CO6C 3L00A 3COAC 2HDCA 4I98B 1WSUA 3FMQA 3D0SA 4MQ9F 4OIOF 2QBYA 3IL2A 3L9FA 3JSOA 2M30A 2L01A 2PBIA 3KZZA 3T0YA 3MQ0A 2QQAA 4I0BA 3MZYA 1W7PB 4MGRA 2EV5A 3ZMTA 1FPQA 1O3TA 2W24A 2PLYA 5A2QK 4L18B 2K86A 4HLYA 1U5TB 3IRRA 1BBYA 5DCMA 4HOBA 5LGNA 1FC3A 1FP2A 1XSXA 4U0VA 1LNWA 2C6YA 3CUQB 2GA2A 4EM1A 3WE2A 1XDUA 4EJUA 4U7DA 2HKOA 4RB0A 4RGXA 1DPUA 1RZ4A 3FXUA 3GLXA 2OD5A 4KT5C 1REPC 4HA8A 3WE3A 3TGNA 1YIOA 3E6MA 1BI1A 1CGPA 3E5XA 4L0YB 2HYFA 2HEOA 4M9XA 4MHGA 1T98A 5L3GA 1UCRA 3IWZA 2G7UA 4GCVA 4CHUA 3H3ZA 2RC4A 3GW2A 4E70A 3U9GA 2NNYA 2BBYA 5ILSA 1G3YA 3KEQA 5H20A 4KN7X 5D4SA 4P9UA 1PUEE 2DQLA 2OQRA 4UHTA 5H6RA 3MEXA 3V7RA 1K79A 2ISYA 4BNCA 4LG0B 4MTEA 3I4PA 3L09A 2ETHA 1W7PA 4IF4A 2ZNYA 3F72A 2FOKA 3AAFA 4HF1A 4KUMA 1FOKA 5LHIA 1YW8A 3KP2A 1U5TA 3TDUC 3J80Z 4WWCA 4AD9A 1L0OC 3I58A 5J6XA 3CUQA 2AXLA 5E8GA 3GZ6A 5HDKA 1LB2A 5E1ZB 1F1ZA 4KFCA 1U2WA 1ZREA 2DLLA 4M6YA 4Y17A 2IJLA 4Q5SF 4M9ZA 1Z6RA 3O3KA 4RGSA 4A6DA 2EFOA 3DKWA 1Z91A 4HAMA 5HDNA 4HX7A 2MC3A 4EVIA 5LGTA 3QP5A 3FZVA 3V8LA 1XSDA 1FBUA 2FSWA 4K2EA 2EFQA 5JI6A 2A68F 4JBAA 2JT1A 4YFNF 3BJ6A 1TNTA 4UV8A 4KA4A 4EJOA 4LB5A 1SD7A 2FBIA 2O6GE 4LG0A 4G7OF 3F3XA 2Z3YA 3ECHA 3TOBA 1SD5A 5CVVA 1XCBA 3RYPA 1FSEA 1YFHA 1IRGA 2DK8A 3IHUA 4CYDA 2DFIA 1TNSA 1ZGJA 5LEJA 1R22A 2HTJA 2WV0A 4XLNF 5ICEA 4A12A 4ZYGA 1QNTA 2VOOA 3K1NA 5ED4A 4MEYF 1FT9A 3ABTA 4LD5A 5DUIA 2ZCWA 1T39A 3E6BA 1P4XA 2F5CA 4EJTA 2R7FA 5BPDA 5HLGA 1FYMA 3I53A 1IN8A 4R1HA 2PJPA 4FT8A 3SHFA 2VC0A 1QQIA 3GF2A 2R3SA 1IAWA 1BC8C 1SFEA 2YR2A 3HHHA 4HV6A 2DPDA 3ZN0A 4AWXB 3WG9A 4MEXF 2BEOA 4EM0B 2EFWA 3NQOA 3RI4A 4WK8F 1MDMB 5J8FA 1E2XA 1Z9CA 3F22A 1BI3A 2YX7A 2OU2A 2VBZA 1U78A 4ESFA 1R36A 1EH7A 5L3BA 3BP8A 4I02A 3G73A 1W5SA 2W57A 4AVPA 2EFNA 1BIBA 1BI2A 5E20A 4PDKA 2RNJA 3NEUA 1ZRDA 2P6SA 1KA8A 3KP6A 4A2UA 5HVQC 2VC1A 2LKPA 3C7JA 1QPMA 3F6OA 4LB6B 4IRHA 4XRFA 1SFUA 3SZPA 1PDNC 1J59A 3H3UA 4U0YA 3ZPLA 3T8RA 2M8EA 3T1BA 2NYXA 3P9CA 4BH9A 1QGPA 3SXYA 3LSTA 3IWFA 2CSOA 2UXNA 1LEBA 2PMUA 1H9GA 4S04A 2E7WA 3KETA 2FEZA 4M9SA
chains in the Genus database with same CATH superfamily
2P8TA 1RNLA 1H0MA 1YQAA 2EZIA 2EWNA 1XC5A 2FRHA 3LL7A 1YJNI 4XKBA 1FWZA 4KN4X 1T33A 2CW0F 1U9NA 3GWZA 5GAEJ 4OOIA 4B1RA 1JTXA 2DO7A 3OYKA 2KQRA 3HRMA 3RDIA 2H09A 4HF2A 3DV8A 3TKYA 2Z2SB 1DUXC 2EV6A 1VQKI 2K5CA 3CC4I 1U5TC 2ACJA 4FTHA 3I5UA 5LEKA 4A6EA 3LWFA 4IJAA 2IAIA 1TQPA 4U87A 5D5VB 3VWBA 3FM3A 4MFEA 1T2KA 3PM1A 4CYCB 4P9FA 3GLLA 2RAEA 1I5ZA 1MBEA 5GAHJ 4R79A 4XLEA 2FU4A 3CUQC 1YX5A 4XKWA 4ZTFA 3ROUA 1MBFA 5DEQA 3G4SI 1XPXA 1MDMA 1YG2A 3DTKA 3HC7A 2G0EA 2Q2EB 3DU5A 4RM2A 5J1YA 3JRDA 2HOAA 3ZQCA 2Z5UA 4XRSG 2KKOA 1VQ6I 3H5NA 4A3IJ 1BOBA 4OIRF 5J47A 1Z77A 1ORKA 2D1VA 1G4DA 2XROA 1NH3A 5J4YA 2ZJPF 1DU0A 1B9MA 4C3HJ 2V6EA 4NQWB 3GTOJ 4CCNA 3CCUI 2GWRA 1IN5A 1K6YA 1JE8A 5BOXA 3IC7A 2OBPA 2E7XA 4A5NA 2M4KA 2KMUA 2MH2A 4EGYA 3Q9VA 1ZN2A 2FXAA 1WQ2A 1IRZA 4HX8A 3JR9A 2UWMA 3F6VA 4ZDPA 1HKTA 2H6CA 2OC6A 1YLFA 3BG7A 1Z67A 4FX0A 1RUOA 5ILUA 2IA2A 1QHHD 2R4GA 3F8FA 3HRUA 2K02A 5H6QA 3E7LA 1P4AA 4M3EA 1D5YA 4NB5A 2CO5A 3FXRA 2L4MA 4BY7J 1HSJA 1IG7A 1ERDA 2MH9A 2XKPA 1G8XA 3HIFA 3HJEA 2XAQA 3KYDB 3K4LA 1HOMA 3DP7A 3M7GA 3HHGA 3HEFA 4WXHA 1OISA 3BZCA 2DDBA 3WTUC 2KIMA 1MBKA 2VBWA 1S3JA 2WAFA 3QOEA 1RKWA 2QQBA 3I59B 2H27A 3GEZA 4DGWB 1FIAA 4YIFA 3GBGA 2LY9A 4LJZF 3NARA 1Y1VJ 1TZLA 2E60A 1LVKA 4XRMA 4B4CA 1XGOA 3J7YJ 2HQNA 4CCJA 1A04A 4OINF 4QPQA 2DQRA 3H9GA 3LSGA 2L3DA 1OYWA 4LK0F 1QZZA 3HSRA 3OOUA 4BAYA 3DLLF 2NS8A 1X1DA 2OV7A 5D6FA 4II2A 4I01A 4R8HA 3JSPA 4XOPA 2KIFA 2K85A 2CV1A 3D5SC 3BT9A 4L9VA 1RC9A 2P5LC 4ESBA 2PG4A 1YYVA 3CUOA 1C0WA 4CYCA 2E34A 2CS3A 1HSTA 2A5YB 3GO5A 5EEAA 2X6WA 4EJVA 1VQ7I 2WWYA 1GLNA 1S7EA 3DKXA 1RUNA 1V4RA 3ERMA 2Q2EA 1FOXA 1T38A 2H8RA 4QLCU 2VXZA 3FXMA 1IXRC 3FM5A 5FFZA 2BHZA 3PUBA 4GYIA 5JVTA 1YO5C 1VQ4I 1XDSA 1R00A 3F0CA 3WGHA 2CJJA 4UV9A 1MMDA 2XKOA 3B73A 2L02A 2R7DA 3W6KB 2GXAA 4NQWA 3HYIA 1MKMA 2HXOA 3S1RJ 1LE8B 3A01B 4HRIA 4G6QA 1OFCX 5D8LB 4IRIA 1D5VA 1BC7C 2XF7A 2YPRA 1USTA 4MQVA 2CUFA 3RPUD 2EZHA 3VYTB 3RCOA 3WU1B 2E2HJ 2MABA 2NAZA 2DOFA 1BR2A 3QPHA 1I27A 2F48A 2GAUA 4OAZA 4F52A 4BQAA 3KPHA 4O5VA 5DV5A 4E7SA 2QF7A 1EA3A 3PQJA 2STWA 2HYGD 2MA3A 2ZMEC 2ESNA 3HM5A 1Y0UA 2OZ6A 3EDPA 5EJCA 1VTNC 4CO8A 3F8NA 3OYEA 1H8AC 1BW5A 3E3VA 1TWCJ 3QYEA 5FFXA 3A4CA 3T5XA 2ZJQF 3HXLA 2DMQA 5KK1A 1OCTC 1GVJA 1XD7A 3BOQA 1DGRM 4IXAA 4P5OA 3JRBA 4BBSJ 2FD5A 2Q1ZB 2RKHA 1WJ5A 2W4SA 2HQRA 2ECBA 3I59A 3HTSB 2HVQA 3I54A 5KCMA 5F0HA 5TRDA 4PGGA 2Y0MA 1U0JA 2FQ3A 1XMKA 1H9TA 5D5XB 4JP0A 4L5EA 5K5RA 2STTA 2FMLA 5CVIA 4HQEA 1NG6A 3RKQA 1YITI 1GV2A 4M6VA 2DW4A 3HL2A 1G3SA 1MMAA 4XLPF 2JVGA 2W7NA 4XOTA 5CVJA 5JLWA 3SQNA 4C3JJ 1YI2I 2MD5A 1OCCH 2QKMB 2QVOA 3K4MA 3JRCA 3LA3A 4KISA 1MGTA 2ZJRF 1R7JA 2K40A 4F92B 2DBBA 3SEZA 3HTUA 1O57A 2VPLA 1S7AA 2XAJA 2QQ9A 2P5VA 2KDOA 2MSYA 1FLIA 4P1WA 4PJLA 4A3DJ 1OYYA 3CCVI 4HSTA 2GXBA 2Q8KA 2RQQA 2IEKA 3LFUA 2W85A 1SD6A 2V26A 2V9VA 1K6OA 1FJLA 2YU3A 1POGA 3E5UA 4B09A 2HZTA 4L5JA 5LRSA 2JWTA 3P5JA 3SZGA 1IDYA 4ZZLA 1LDDA 4CGZA 3BWGA 5TGTA 3PO3J 2OA4A 3M8FA 2R5YB 4DYCA 1LE8A 2WBMA 3A01A 1ITYA 3VB2A 1T0FA 1Z7LA 2ZKZA 4Y4RA 1WKMA 1PYVA 2DU9A 3B6CA 3ZMZA 4IO9F 1HQCA 2EH3A 2ZB9A 3I71A 1TLHB 1JKPC 1QRYA 2ZXWH 4XLAA 4J19A 4PJMA 2EA4A 5F64A 2HXIA 2M7BA 3GTKJ 4XRSA 2IGMA 1KQ9A 1Y8QB 1JI8A 1CQTA 2IS4A 1ETOA 2A6EF 3LSPA 1JKQC 4A93J 5EZGA 2QZ8A 3FDYA 2LY1A 2DT5A 4KMFA 1B72B 5IOZA 3KLOA 2CGPA 4KYWA 1Z6TA 5IYDJ 4KT6A 3WHCA 1IUYA 3EYYA 3Q9SA 2DA1A 5FKLA 3VSLA 2L7FP 3WTZA 4UB6C 1ZARA 4LOCA 4BHPA 2DN0A 3BG6A 4UUSB 2XAHA 5EDNA 2E1MC 3RZOJ 2WC2A 1PVEA 1LUJB 3BCBA 3M8EA 4KNYA 3EYIA 4S0HB 1W7PD 2J5PA 2H94A 4J00A 3K9TA 3KE2A 1R49A 1HLVA 5E17F 1TT0A 4LK1F 1T6SA 2TDXA 1MMNA 3HZJA 3CMYA 2CV2A 2XF5A 1VQMI 5IT3A 1PUFB 1AOYA 2ECCA 1R5ID 1D1BA 5LRRA 4CZZA 3MZHA 5IT9K 2MFZA 4BDZA 3FMRA 4A3FJ 5HOOA 2X85A 1MW7A 1FP1D 4DZPA 1ZLKA 1GDTA 2DJIA 3ZR8X 4Q48A 4CXFA 3CP2A 5LFAA 2FJ1A 2R7XA 4ESJA 1MJBA 1W36C 1NHAA 2XRNA 4TV7A 3ABKH 3LSKA 1X3WB 4KICA 4BQNA 1OCOH 4IHYA 2O03A 4A0XA 3BPXA 2KZGA 4AYBN 2IW5A 5KHDA 3BTLA 4XLFA 2VASA 1EKEA 4W97A 3RKWA 4ETSA 4W1UA 2FA5A 1UFMA 4IHTA 2F5FA 2YX4A 3C1DA 3W2AA 1ZK8A 3ZQLA 1E3PA 2VL8A 3EUAA 3KYCB 4OMYA 3FXOA 2ELJA 1Z1DA 4YFXF 3OS1A 1FTTA 5CVUA 3K70C 1YS7A 1XN7A 2XB0X 3WTYC 3CCEI 5L3DA 3I4NJ 4I7HA 1PP7U 1X2MA 2ZMEB 5FJ8J 4RGUA 3TBIA 2P4WA 1VQ9I 2R5YA 1N78A 5CYVA 3HOYJ 4AM3A 3L2CA 2PQ8A 2L7KA 3VFZA 1ZR4A 4BDYA 1EF4A 2JRMA 4L9NA 2JQ7A 2CUJA 1N25A 3CMMA 2BGCA 5BPIA 2VE9A 2OCCH 3NRVA 3IH2A 3MN2A 4UB8C 1FNNA 3ESWB 1FEXA 2XAFA 1KGSA 4BE2A 1D0YA 4I2OA 5ILVA 2A6TA 4I0AA 2BW3B 2AQEA 4FQGA 3SFZA 1B72A 3OIOA 4S05A 3TW6A 2EILH 3RJPA 1ODDA 2LBFB 2VXDA 1R1VA 1TTYA 4BHCA 1P92A 2ZSHB 4ENJA 1FZPB 3L1PA 1RETA 1RIOH 1AWCA 2O8XA 4IHXA 3OL4A 1NK2P 4UUSA 4XBFA 1WWXA 2WAEA 2M8GX 3W6VA 2VBYA 4DNCA 1VFCA 4HX4A 3F21A 1VQ5I 1UB9A 3CC2I 3TQNA 1DP7P 4KIFA 3DXJF 3PL8A 3JTGA 1X1AA 1N75A 2YS9A 4LLLA 3LOCA 2VJIA 2L54A 3FX3A 2LK2A 4DIQA 1PUFA 1EH8A 1W0UA 2NS0A 3K0LA 1LPQA 3D5LA 1MBJA 4KIGA 2IGOA 4QPOA 4N0BA 4BBRJ 4RAGA 5M5XJ 2P0WA 3B02A 1GHCA 3HOTA 2ELKA 2IXSA 4BKXA 4RBOA 4F55A 2DODA 1ZG3A 4RS8A 2M0CA 4I09A 1KYWA 1X1CA 2Y75A 2WAQN 1PP8F 2VQCA 2P7CB 5BS6A 4BXUA 2VT3A 5D5UB 3WTWC 2Y31A 2EIKH 3BZKA 3TOAA 3CMEI 3SDGA 4D9JA 2MYSA 3LAPA 1HA8A 3BR1A 4XKVA 3FHZA 2Y9ZA 2X4HA 3BG3A 2ELHA 3HRSA 4XM3A 5M5WJ 4ENNA 2O9LA 4IOAF 5LBQA 1HW2A 3J81Z 4NUBA 5IYCJ 2FBKA 1UHMA 1FIPA 2ISZA 3OR1C 5FGMA 2BXZA 1OMIA 2QSGX 4AIJA 3R0AA 5FROA 1WGXA 1A31A 1J9IA 3HOVJ 1F4KA 2NNNA 1D0ZA 2G7HA 1MJ9A 3TP0A 4GXOA 4HNVA 2ZMEA 1Y8RB 3IH4A 3NAUA 2DA5A 1BIAA 2JPCA 2JTVA 5IP7J 2P6TA 1EH6A 4RAFA 2EA2A 2HOTA 1YHQI 5GAGJ 4X1EA 2LFBA 4JYKA 4P55A 2OUMA 2B63J 4HLXA 1HCRA 3FK6A 3HOUJ 2YUSA 3GTGJ 1CF7B 3ABUA 4AIKA 1YJ9I 2E1MB 3RKYA 2XUBA 1QBJA 2NXNB 4AUXA 4HQMA 2VN2A 4M73A 5L3FA 3BR6A 1UMQA 5B66C 2BW3A 3R60A 4DJAA 5L3CA 3BTCA 3VYRB 3C2BA 1SVOA 1Z3XA 1OKRA 4ZTJA 2COMA 2F4MB 2LBFA 3ZQGA 1WJAA 1Z05A 4XLCA 3SZTA 1VQ8I 1XGMA 1HDPA 1VQLI 2ZBKA 2CWEA 1JKOC 4XNFA 1SVMA 4FHTA 4HF0A 5DM7F 4YIRX 3MKLA 3CJTB 3FF5A 3U2RA 1WJCA 3J81K 3LAJA 3RSNA 2VBXA 4IRGA 4X0GA 4G6DA 1FOYA 1ENHA 1SFKA 1TT5B 3HGGA 1FYLA 4M74A 1W4MA 2MLKA 3TO6A 4B44A 4YRVA 4F91B 1J0RA 1GXQA 1K7AA 2IRFG 3PFIA 1Z0XA 2L9SA 3BTIA 3DFGA 4IZZA 4HDVA 2GIZA 2DFEA 3S17J 5E18F 1KU7A 1G3TA 3G3ZA 3GTLJ 4U88A 2P81A 2NVYJ 1EJ9A 3KEOA 3DEUA 3VODA 1ZAOA 3OYJA 4QSHA 2AHQA 2A5WA 3JAMZ 4LGWA 1TWGJ 4HNTA 5FB2A 4CSWA 2LP0A 3S15J 3JREA 2J5OA 4HBLA 2A3SA 2W84A 3PQKA 2CYYA 1ZG1A 3E6DA 3FWEA 1I1SA 3CJQB 3N05A 2BYVE 2WY7Q 3FBNB 4EV0A 5LHHA 5CVRA 1IV6A 1GT0C 3M8JA 2WADA 1TQMA 2IS6A 2DYSH 2EBIA 2O5RA 3LSJA 3JTHA 4O6JA 1NK3P 5F1JA 5E3NA 5FLXK 2KRCA 3GFLA 3LA2A 3VEPA 3LMMA 5C4JJ 3OYDA 2X1CA 1XGSA 4AC0A 3BR0A 3ZGKA 1ETQA 2QM3A 3GVAA 5E79C 4RB1A 3UR3C 4ZDLA 2PMHA 3PNYA 2RGVA 4RAYA 2LSOA 1VI0A 2GXGA 3TO9A 3PIOF 2X6OA 2AO9A 1HKSA 1BL0A 3QYBA 4X6AJ 1ZLJA 3OYNA 5EEHA 1CF7A 2NOGA 5D4RA 5IY5H 1J2XA 2L7MP 4UVBA 3JW4A 1H88C 2M0MA 3BLYA 2O61A 4G7HF 3ZQHA 2HPMA 3WODF 5CLSA 1F5TA 1O3QA 1P7IA 2K9QA 2MG4A 3JAMK 5LHGA 4HV5A 3IV5A 1IF1A 2VOPA 2L7ZA 4ABZA 4UUTA 4XONA 3AG4H 3L2RA 5JFRA 3A2KA 1X19A 1TBXA 3FK7A 2Z33A 3GTMJ 2BY3A 4XLHA 3IUOA 2HFHA 4GO1A 4PGHA 4N9IA 3CP8A 1BJAA 3Q0WA 1RKTA 2E1OA 4M71A 3QP6A 3GFIA 3S3OA 5JHFA 3A1YA 4G12A 3ELKA 2O3FA 1J75A 3HPGA 2JUGA 3GFJA 5FD6A 1W36D 1MNMC 5KAFC 3O2PE 1WH7A 2K9SA 4PCQA 2XVCA 3ASNH 3MMYB 5K1YA 4GFBA 4LLGF 3OYBA 1DU6A 4RLQA 2M34A 4BHBA 4ASNA 1P9QC 5C3EJ 3C3WA 5KNLA 1BI0A 1SC7A 2ICWG 2R93J 3RQIA 4LLNA 3QRFF 4A0ZA 5DTDA 4BQQA 1T56A 4DBQA 2EV0A 2KIUA 3OS0A 3OYAA 3HUGB 4IHSA 2KL4A 3OMYA 2KZVA 1FBSA 4JQFA 1RI7A 1IV8A 2QENA 3K70D 2F5EA 1S5LC 1MIJA 3OSGA 3K10A 2R7OA 3ERED 4IQJA 2BXYA 1ACIA 2TRTA 1LJ9A 1A36A 2NRAC 4NC6A 3ZXSA 3KP7A 2QA4I 3RZDJ 2FE3A 1K78B 1JUMA 5ICCA 1ZHFA 1I6XA 4JOMA 3BDDA 4YEJA 3S1QJ 2H8WA 2XIGA 4CH7A 2IGKA 3O8GA 4NDLA 2ZSIB 5C4XJ 2JZYA 1R4MB 2XGXA 3HB9A 1P4WA 2E2IJ 1F43A 1FMVA 4KITB 2XHKA 1IO2A 2VQHA 2Z99A 4DOZA 4F3QA 2XASA 3BROA 1KU3A 3Q3SA 4UUVA 2K7LA 2KP6A 4ZC3A 2OCEA 4H0EA 1AKHB 2JJ7A 1SAXA 1X4OA 2Z9OA 2F2EA 3DBHB 1GV5A 3DKYA 1BR1A 4WCGA 3S16J 5B5EC 4UVCA 2I8DA 5EGOB 1JJ6C 4D0PA 4LIUA 1VQOI 2DFHA 1IN7A 2X0LA 2M87A 2Y2ZA 1L3LA 3K1MA 1MZBA 5FRNA 1JXSA 3OV8A 3AKZA 1YTYA 2JMWA 2IA0A 3ABLH 3K6GA 3HDDA 4IEJA 3ZQQA 4RGRA 3LSIA 1D8JA 2DT7B 2H6BA 1ZR2A 2BY2A 3VDXA 1TL8A 4XSZF 3BC8A 3K4BA 1UG2A 4U0WA 2Q0OA 4XL9A 2LH9A 3SDBA 1MH4A 4IHWA 2P5KA 3OY9A 2OTLI 3ZMVA 3E5QA 1K4SA 4D5CA 5JLXA 4MNUA 1O3SA 2A61A 3BR2A 4ENMA 3U1DA 3BY6A 5E1XA 1USSA 1XMXA 1ETKA 6PAXA 3JRAA 4WXCA 3PNTA 1JUSA 3JRIA 2GZWA 4MLOA 1LFUP 1IRFA 2JUCA 3ZQ7A 1V55H 1B9NA 2XF6A 1G6NA 2VQGA 3I0TA 5E3LA 4RB2C 2ZXHA 4I99C 2QUFA 4BUPA 5FD5A 3LFKA 4FE4A 3V8JA 1HW5A 4AU7A 1FTZA 5CQGA 1D0XA 1IGNA 2K9MA 1KYZA 2XB5A 4FISA 3HUGA 1JTYA 3H9JA 4HZFA 4DQ2A 3M3YJ 1W5TA 2X48A 3CCRI 1B59A 1WRJA 1LFPA 3KIOA 5FKNA 2MBFA 1OR7A 3PO2J 4Y3OA 4XR6A 1DQUA 5F08A 4EJWA 2BHYA 1ULYA 1VQNI 5TJJA 3HOSA 1JT6A 3ZCOA 2MLGA 3C18A 4EMSA 3I56I 4V2GA 4ON0A 2HOEA 2DTZA 1DGWY 1K78A 1WHUA 1WJDA 2Z1DA 1HXDA 1ZELA 2UV1A 4M3GA 1R1TA 4OIQF 2HU9A 1WJEA 1ZYRF 3S14J 1W1WE 2V1NA 1OCZH 2JA2A 4IL6C 3F23A 4II3A 3M9AA 3BQZA 2R7ZJ 1S29A 2ZXIA 4FX4A 3V8KA 2M2EA 2Y69H 3M1EA 2YSRA 2FNAA 2HI3A 2JPBA 3WU0A 3PSFA 1AKHA 1IN4A 3F8BA 2FBHA 5F1RA 5IP6A 1S8NA 1S6LA 2WAQA 4NHJA 3K4JA 2KLOA 2EQRA 4HW0A 5EGOA 3BJOA 1UHWA 2ESHA 3L2UA 3GTPJ 5IT9Z 1X4PA 2M45A 3CO7C 4RB3C 4L9JA 2DDAA 3OL3A 4RM3A 1J7KA 2DMNA 1IN6A 2CU7A 2K27A 3K69A 4G8XA 2NS7A 5L3EA 2JA5J 2GM4A 1LDKB 3TDZC 5DCFA 5HLIA 1IW7F 3PSIA 1TQIA 4G7ZF 1YS6A 5CPRB 2DA7A 3H0DA 3Q5FA 1TW2A 2ZXJA 1JHFA 2IVMA 3FXQA 3QWLA 3S2DJ 3KCCA 1R58A 3R6SA 5GTIC 3BJAA 1ZQ3P 2VUMJ 2XGDA 3DF8A 4DBRA 1S72I 4Y13A 1ZH5A 3KP3A 2G9WA 2LTPA 2KT0A 2X1EA 3KZYA 2YU9J 3T8TA 5K5OA 1ONVA 2D1HA 1KU9A 4D5FA 2QKLB 2VKEA 3PIPF 1PJRA 4G94A 3LQQA 5ICGA 1FY7A 5J40A 2OZUA 2CQNA 3HGYA 1G59A 1U3EM 2IGNA 2K4BA 2KISA 3HSFA 3VYSB 4G9YA 2A6HF 2VQLA 2L5QA 1R6RA 2VT2A 4I76A 3K2ZA 4U7BA 4YG2F 4A0YA 2IPQX 3CCJI 5GP9A 1FBQA 2VONA 2CG4A 2LY2A 2VI6A 3PNVA 1XB4A 3GXOA 1DDNA 2E19A 1XGNA 3CLQA 4OMZA 4LMYA 4ZDOA 4KIBA 2WA0A 2QLZA 4O3MA 4XSXF 3U21A 1O7LA 3M07A 3A03A 3QYFA 3PUFA 3MAJA 2EINH 4XKCA 2B9SA 4FE7A 3S93A 4D7MA 1E3OC 2R5ZB 3BCAA 3CDHA 4UXNA 3W3CA 3BZ6A 1SEUA 5FRMA 2E2JJ 2DI3A 2AS5F 3LQRA 3RPQA 3R61A 3F8CA 3MZ8A 3QPTA 3DEEA 1ETWA 3NWTA 1K4TA 2GQQA 1TWFJ 1UELB 4M3FA 2X6XA 1HBXG 1BM9A 2FNPA 4DYRA 1FYKA 2XPWA 5FKMA 1SFOJ 4Q4ZF 4MTDA 4BE1A 4C2TA 3CLOA 3K4CA 4XN0A 4P96A 1S7OA 5AIPA 2P7VB 4J01A 3AFHA 3EQLF 2E35A 3VOEA 1Y1WJ 3BTJA 1HF0A 5TISC 3ISPA 4A3EJ 1YOVB 3CESA 3HOZJ 1SD4A 4Y7NJ 2VKHA 4RDUA 1ON2A 3ZMDA 3LSMA 1MMGA 2HWVA 2OAZA 2EJRA 2NVUB 4HYEA 2Z16A 1D3YA 3KZIC 3PFYA 1OPCA 5CQEA 2X51A 2CFXA 3K4NA 4EM2A 2LC2A 1QZEA 5EEGA 2VPRA 1YW7A 2GOMA 2HGCA 2NOJB 4UNOA 4BS9A 5E1WA 1SMTA 3ML6A 2HKXA 4IPAA 3MWMA 5DD4A 3GX4X 3L7WA 5M3FJ 4JX4A 2RDPA 1JKRC 2IBDA 4DW6A 4PSWA 3WTSC 2R0QC 2O0YA 2EB7A 3J80K 1Y56A 2V1UA 4M6XA 3P7NA 3CC7I 2ME0A 2DMUA 1UAAA 2RQPA 1OLTA 2KJBA 5HS9A 1I39A 2GA1A 2HVRA 5D8KB 3IKTA 2WB1N 3QODA 2CUEA 4BYYA 2EZKA 2BVLA 1JT0A 4GGGA 3RKXA 2HQAA 1G2HA 4EQQA 2DTRA 5DYMA 4CUGA 1MD0A 1MJAA 3HOXJ 1Z3YA 4XORA 4FASD 2ZJ2A 1DP3A 2A07F 2K9NA 2RN7A 2ZO4A 1FX7A 2V4JC 4HPQA 3KYLA 3ZQIA 5JHUA 3W2VA 5AONA 5F27A 1KQ0A 2L4AA 1GXPA 2DJNA 2V1XA 3NWSA 2QQ8A 1R4NB 2HR3A 2TCTA 1V5EA 5FKOA 2K9LA 2ADUA 4M3BA 5B3SH 4PZJA 3I3LA 4IOCF 2QYOA 4A5MA 1I6HJ 2QGUA 2L9VA 1MNDA 2DOAA 2V79A 2R5ZA 2R7SA 2DAOA 1R23A 1BN5A 4M3DA 5M5YJ 5DM6F 4BU2A 2IT0A 4CCOA 2V9PA 3R0JA 1S9HA 4BE0A 3H9QA 2M4GA 4PFPA 4H4KC 3CJRB 4L0ZB 4YIIA 3E0JB 3QU3A 1IUFA 2JSCA 3S1NJ 2PEXA 5DUKA 2LD5A 1ZRCA 1G3WA 1XSVA 3CF2A 2NVQJ 2CRGA 1IXCA 2Y48A 4CDGA 1TW3A 2XAGA 5E3OA 2IP2A 1R9TJ 3A02A 2DYRH 3LA7A 3RYRA 5J4VA 2F6CA 5IOYA 4BEHB 3JRFA 2VKDA 2A05A 4F7ZA 2LLKA 3HSEA 2BE5F 2CH0A 1B4AA 1OR7C 3KEYA 3OR2C 1R5GA 4CICA 2M5WA 5DD8A 3DQVC 5E8IA 1U9OA 2PMZN 1TWAJ 4IVNA 1QZYA 2FF4A 2XPVA 2ZNZA 3DWLE 4LIVA 3ZN1A 1U8RA 1STZA 2LDUA 4EEFG 3MKYB 5FLVA 2M9HA 5HS8A 5ICFA 2BZTA 3WTTC 5HS7A 2HZDA 1IRXA 1ON1A 3TO7A 1KQ8A 4RMNA 2LNBA 5BQTA 2UXXA 1UG0A 3H3VK 1QU3A 1WPKA 3K1PA 2LREA 5FLXZ 1MBGA 2WTEA 3ULQB 3KP5A 1OYIA 1RESA 4ZYEA 3KP4A 1P2FA 3MD2A 3GYHX 4YFKF 2E1NA 3DPTA 4B43A 2RVCA 2RNGA 5DDGA 1U6GA 2ZFWA 1R1UA 3ZP5A 3CCMI 1LDJA 2Y0SN 2M1BA 2EK5A 3RTRA 5LLQA 2LKXA 4B8XA 2QWWA 3FIWA 2R7UA 2CQQA 3FMSA 5F0FA 3EETA 2V1DA 1O3RA 2MD0A 5HDGA 2CMPA 2DK5A 3S3MA 3HKZN 3SJMA 1Z21A 2LRDA 3SEQA 1J5YA 1T95A 2H1LA 4IQ4A 1X3UA 3CD6I 2VJJA 5FKKA 4PJJA 3FXLA 4DYQA 4A69C 1J09A 1M1EB 3DEWA 1BA5A 4DZJA 2BV6A 2EFPA 2HTSA 4LFUA 2V9KA 1Y6IA 4GRIA 2K4JA 4ZYDA 2DA2A 2FX0A 3DBLB 1Z7UA 3O6BB 5LGUA 3H92A 4NNJA 1IXSB 3ZOBA 2D5VA 1E17A 2KRFA 3IKVA 3EUKL 2VKVA 1Y39A 4C30A 3H5RA 2DFFA 4LITA 2LF7A 2LMDA 2X6YA 4WXDA 3KFWX 3OYMA 2PI0A 4KDPA 1QHGA 2R7VA 2KRHA 1V3FA 5HLHA 4BEHA 2A69F 1SMYF 1YJWI 2PN6A 1V5FA 4ITVA 5KVRA 2DOEA 3WGIA 2HDWA 2EZLA 3BPVA 3P9IA 2FMYA 2M7AA 3ZMUA 3N4MA 4ZYHA 3R4KA 4A3BJ 4UY8I 1EV7A 2D2WA 2L2OA 4AIHA 5JR3A 4XN3A 2VODA 2BY0A 3VPRA 3W6JB 3ECOA 5AIQA 5M3MJ 2JA8J 3WGGA 2W25A 1APLC 3H0GJ 1GUUA 3ZMSA 4OU0A 4ZZDA 1LQ1A 2HQ5A 1X2NA 2KHMA 3H36A 2XV4S 1B1BA 1JGGA 2HS5A 2Y30A 3GUDA 1FSHA 4ZYAA 5EF6A 3MFKA 2WV1A 1UJ8A 1WVRA 4OIPF 2ID3A 5J8CA 4IKFA 4PFOA 5K5QA 5C44J 3S2WA 3E97A 1HW1A 3FKIJ 3GZ5A 2JA7J 3HG9A 1TP4A 3QPSA 4L5IA 1BOAA 2W82A 2PFBA 4BQOA 5K7HA 1HKQA 3KLNA 2WY8Q 5EYRA 3IP4B 4QWQA 5KAIC 4Y52J 3X2QH 1IZ1A 1I1GA 2GBYA 3N97A 2XAUA 1D8KA 5BMZA 5D6EA 3J7ZI 2HVSA 3S32A 4UVAA 1JHHA 1BW6A 3HRTA 3V7CA 4E7LA 3WTXC 2UUZA 3E6CC 4B47A 4JK1X 5EZHA 4A3MJ 1IC8A 3TEDA 3G2BA 5E3MA 1LVAA 2LF8A 3OYFA 3LSHA 1KU2A 1MH3A 3ASOH 3Q0UA 2RV8A 3CDLA 3V4GA 4RAZA 2R7TA 2HOSA 2CQKA 2QBYB 1MMSA 2FOWA 3D5RC 3BR5A 1HC8A 3ONQA 4QIWN 3G1LA 4N9HA 5K7FA 3I64A 3S2HJ 3H5AA 1Q1HA 5B1AH 4M72A 4MIMA 2HNHA 3V7SA 1OCPA 3CJNA 1O7FA 1WI9A 2E1CA 4E4HA 1Q1VA 2VE8A 3P9KA 1P6RA 3RIRA 4Y15A 2F5DA 2KFDA 2XSJC 2AXTC 1E0EA 2JK3A 3SYTA 5DCMB 1XG1A 2KJCA 2R7RA 1F9NA 2BOLA 4NC8A 2GLOA 3CMAI 2F4OB 1FMWA 5CJ9A 2DXIA 3DTEA 4EGZA 1VF9A 4QTRA 4KMUX 3HBLA 4N4NB 4WF2A 5ERIA 2ZFUA 3FISA 3OSFA 1A6QA 4BJ5C 3OYCA 2W48A 3REOA 3CQZJ 3DPLC 1XMAA 3EUHA 4OAYA 4WX9A 3PJRA 2EIMH 1B6AA 5F6FA 4CCMA 4BJ6C 1JGSA 2GIVA 1GVDA 5FO5A 2CUZA 5D5WB 4C2MJ 3CCQI 2E71A 2D45A 3MCZA 5JVGF 4ZH4F 3OIQA 4AYBA 3F8MA 3JRHA 1LEAA 5HODA 3M1CA 4GYGA 3H1CA 1QO0D 4ENKA 1DPRA 2B0LA 2OQGA 3WTVC 4L9TA 3OS2A 2DPUA 2CV0A 3S8PA 2F5VA 3VYUB 2LVSA 2IA1A 3U1KA 1H89C 2CW8A 1YIJI 5A2QZ 1ZRFA 5K7ZA 4BJTA 1WZ2A 1BJZA 1XCVA 4EATA 4RA2A 2KIQA 3IRQA 4HDUA 1V5GA 2RREA 1MBHA 1VZ0A 3QAHA 3RQ4A 1OQYA 1RR8C 2LOOA 4Z2YA 3FXJA 2AQFA 4C9YA 2UZKA 5DS9A 1ZGAA 2E5NA 2EPFA 4Q47A 3RPUA 4ANJA 4BXXJ 2H1KA 1R5HA 1MSEC 1NG7A 1HDDC 4BACA 3TW7A 5F04A 1ZG5A 3J7AO 4JX5A 1YW9A 1B8IB 3QU6A 3EPZA 2JRTA 1YRNB 1I3AA 4Z6YA 1P7JA 2V6CA 2VB6A 1SFXA 1A6IA 3OOPA 3QOPA 3C2GA 2LR8A 3CTAA 3OWTA 3BG5A 3GFMA 3CO6C 3GTJJ 3L00A 3COAC 2HDCA 4I98B 1AU7A 1WSUA 1I50J 3FMQA 3D0SA 4MQ9F 4OIOF 2QBYA 2ID6A 3IL2A 4C3IJ 3L9FA 3JSOA 4HNUA 2M30A 2X9DA 1F36A 2L01A 2PBIA 1ZTRA 3KZZA 2HYJA 3T0YA 3MQ0A 2OJED 2QQAA 3TL4X 4I0BA 2CW7A 3CCSI 3MZYA 1W7PB 2VJ5A 4MGRA 2EV5A 4PSXA 3ZMTA 1FPQA 1O3TA 2W24A 2WB1A 2PLYA 2QSFX 2CQ7A 4A3CJ 4BXFA 2L9RA 2FUG2 5A2QK 4L18B 2K86A 4HLYA 1U5TB 3IRRA 3TMOA 1BBYA 5DCMA 3G1OA 1YX3A 2DA4A 4HOBA 1KZHA 2VIXA 3QPLA 3O8HA 5LGNA 1FC3A 1FP2A 3LNQA 1XSXA 2DT6A 4U0VA 1LNWA 2DMPA 2C6YA 3CUQB 2F4IA 1XTAA 2GA2A 4E7IA 4EM1A 4F93B 1TWHJ 3WE2A 1XDUA 1IDZA 4EJUA 4U7DA 1RRJA 2HKOA 4RB0A 4RGXA 2BY1A 1RZ4A 1DPUA 3FXUA 1D1AA 2OD5A 2JSPA 3GLXA 4KT5C 4E7JA 2CQXA 1REPC 4HA8A 2DA3A 3WE3A 3TGNA 3AL0C 1YIOA 3E6MA 3WHBA 1BI1A 4A3LJ 1CGPA 4IX7A 3E5XA 2XC7A 4L0YB 2HYFA 1WI3A 2XGCA 4NC7A 2HEOA 1A5JA 4M9XA 1QPIA 2COBA 2VLAA 4PJ0C 4MHGA 2OPTA 1OCRH 1T98A 1YE9A 4FETA 5L3GA 3FKJA 1R71A 1UCRA 3IWZA 2G7UA 2LG4A 5IYBJ 4BGDA 1W0TA 4GCVA 4CHUA 1WJBA 3H3ZA 2RC4A 3GW2A 3HOWJ 4E70A 4IHVA 3U9GA 2NNYA 1TC3C 2BVMA 2NVXJ 2L0KA 2BBYA 5ILSA 1XS9A 1B8IA 1YRNA 2PMZA 1G3YA 2EIJH 3KEQA 5H20A 4KN7X 5D4SA 4P9UA 1PUEE 2DQLA 2OQRA 2DMTA 3E1SA 4UHTA 5IPAA 3UNGC 4A3KJ 3CCLI 5H6RA 4E7HA 2LKSA 3MEXA 1E3HA 3V7RA 1K79A 4E7ZA 3HPHA 2ISYA 4BNCA 4LG0B 4MTEA 1UHSA 3I4PA 3L09A 2ETHA 2FQ4A 4XMYA 1W7PA 3MKZA 3K4KA 2ZNYA 4IF4A 3F72A 2FOKA 3VSKA 3AAFA 3CF5F 2JA6J 3DBRB 4BL0B 4HF1A 4KUMA 3DPUA 1FOKA 5GPAA 5LHIA 1YW8A 2Y0SA 4XQFA 3KP2A 5F0CA 4N4OB 2W1OA 1QVUA 3ZRGA 3OYLA 1U5TA 2L9NA 3GTQJ 3M4OJ 5BNGA 3TDUC 3J80Z 4WWCA 4JX6A 3L2QA 3HKZA 3CCYA 3I55I 4AD9A 4CZCA 1L0OC 3I58A 3OYGA 3G6EI 4V19K 2QSHX 3FBIB 2PJRB 5J6XA 2E5ZA 3CUQA 4BY1J 2AXLA 5E8GA 3GZ6A 5HDKA 1LB2A 5E1ZB 2V7FA 2W00A 1F1ZA 5GTHC 4KFCA 5B1BH 3DU6A 2KDZA 1U2WA 2IS1A 5J1RA 1ZREA 2DLLA 2DCEA 4M6YA 4ZJZA 3AG2H 3MVPA 4Y17A 4CA0A 2MGQA 1A35A 4PJNA 2O7OA 3K7AJ 2IJLA 4A3JJ 5HNFA 1ZKGA 1JJ8C 3H35A 3JCUC 4Q5SF 4M9ZA 2ME6A 1Z6RA 2R7QA 3O3KA 3IAS2 4RGSA 4A6DA 1K61A 2EFOA 1ETVA 3DKWA 2HDDA 3WU2C 1Z91A 3I4MJ 3BR3A 4HAMA 5HDNA 1SVLA 4HX7A 3D1NI 2MC3A 4D7NA 3I9V2 1LKXA 1Y0NA 4MO7A 4EVIA 5LGTA 3QP5A 3OYHA 3FZVA 3JRGA 3V8LA 4C2UA 1XSDA 4E7KA 1FBUA 2KPMA 5LD2C 1OJLA 3S3NA 2FSWA 4K2EA 1I3QJ 2EFQA 4AIDA 1RPWA 2M3AA 5JI6A 2A68F 5EG0B 4JBAA 3A0BC 2JT1A 5H2FC 4YFNF 1U8BA 3BJ6A 3KX2A 4G6TB 3EUHC 3GMEA 1TNTA 1XX5A 4LG3A 2OTJI 1LFBA 4UV8A 4KA4A 3AG3H 2NVTJ 4EJOA 3K2AA 1X1BA 4LB5A 4B3AA 1SD7A 1FOWA 2DA6A 2FBIA 2E36A 2O6GE 4E6KG 4LG0A 4G7OF 3BQYA 1W5CC 3UKGA 3F3XA 2Z3YA 3ECHA 3TOBA 1SD5A 3V42A 5CVVA 1XCBA 3RYPA 1FSEA 1YFHA 4D1QA 1IRGA 1ZGWA 2DK8A 3S1MJ 1ETXA 3IHUA 4CYDA 2DFIA 4V2FA 1TNSA 1ZGJA 3WG7H 5LEJA 2ZC2A 1R22A 3BG9A 2HTJA 2WV0A 4XLNF 4HG2A 5ICEA 3IH3A 4A12A 1KONA 4MFDA 4ZYGA 3FXKA 1D1CA 2MW8A 1QNTA 2VOOA 3K1NA 5IP9J 5ED4A 2Y9YA 4MEYF 1FT9A 3ABTA 4KJZA 3AL0B 4XICA 1JUPA 4LD5A 3OIPA 4B48A 1T08B 4I6ZA 2PJRA 2QEXI 4OWRB 2GOXB 5DUIA 2ZCWA 4XIDA 1X3ZB 1T39A 2X1DA 3E6BA 1BR4A 3L2WA 5FLMJ 5HLTA 4A3GJ 1P4XA 3G1MA 2F5CA 3B6AA 3L2VA 4AVZA 2XSDC 4EJTA 3W2WA 2R7FA 5BPDA 5HLGA 3AG1H 2R7WA 3CZ6A 1FYMA 3SFIA 3QQAA 3I53A 4PUSA 3TP3A 4B3XA 1IN8A 4R1HA 2PJPA 5GPCA 3OYIA 3DLAA 4FT8A 3SHFA 5CKTA 1N77A 4XK4A 2OF7A 2VC0A 2R92J 1QQIA 3GF2A 1K83J 1MSFC 2R3SA 5J3LA 1IAWA 3G71I 1BC8C 1SFEA 2YR2A 3HHHA 1MNEA 4HV6A 3ZN0A 1SANA 1WJFA 3WG9A 4AWXB 4CCLA 2DPDA 9ANTA 3DTIA 1QA6A 4MEXF 1RR7A 4CCKA 2N8GA 2BEOA 3FHNA 4EM0B 1O4XA 2EFWA 3NQOA 3J7AY 5EG0A 2IS2A 1NTCA 3RI4A 3DCFA 1WH5A 4PK4A 1QVTA 3ZQFA 4WK8F 1VQPI 1MDMB 1V54H 1ETYA 2B7EA 5J8FA 1VNDA 1E2XA 1Z9CA 3F22A 1BI3A 2YX7A 2JN6A 2OU2A 2VJ4A 2VBZA 4HSRA 1U78A 4ESFA 2O8KA 1R36A 3ABMH 1EH7A 4YELA 4NBQA 5L3BA 3BP8A 3IAM2 3GZNB 4I02A 3G73A 1W5SA 2W57A 4AVPA 2EFNA 1BIBA 1BI2A 5E20A 3LSRA 4PDKA 2RNJA 3NEUA 1ZRDA 2P6SA 3CDIA 1KA8A 2I5UA 3KP6A 4A2UA 5HNHA 5HVQC 1WFXA 2CFOA 4HEA2 2VC1A 4FCYA 3MKWB 3GCMA 2LKPA 3Q0VA 3C7JA 1QPMA 2XRLA 3F6OA 1WCMJ 4LB6B 4IRHA 1X58A 4GDFA 4XRFA 1SFUA 3SZPA 2JVHA 1PDNC 1IJWC 2XPUA 1SAUA 1J59A 1AHDP 1T0FC 3H3UA 4U0YA 3ZPLA 3T8RA 4Y33A 2M8EA 3T1BA 2NYXA 4RLFA 1UZCA 3F9KA 2K3PA 2PX9A 2HPIA 2K3FA 2XGEA 3P9CA 4BH9A 5GADJ 1QGPA 5J1UA 3SXYA 3LSTA 1T8IA 2QCOA 3IWFA 2UXNA 2XDVA 2CSOA 1X1PA 1LEBA 2I10A 3C2HA 2PMUA 1H9GA 2LYCA 4S04A 1AA7A 2MC4A 2E7WA 3KETA 3A0HC 2FEZA 4M9SA
chains in the Genus database with same CATH topology
2P8TA 1RNLA 1H0MA 1YQAA 2EWNA 2FRHA 1FWZA 4KN4X 2CW0F 3GWZA 4OOIA 2DO7A 3RDIA 3HRMA 2H09A 4HF2A 3DV8A 3TKYA 1DUXC 2EV6A 1U5TC 2ACJA 3I5UA 5LEKA 4A6EA 3LWFA 4IJAA 5D5VB 1TQPA 3FM3A 1T2KA 4P9FA 1I5ZA 4R79A 2FU4A 3CUQC 3ROUA 5DEQA 1MDMA 1YG2A 2Z5UA 2KKOA 4OIRF 2D1VA 1G4DA 2XROA 1B9MA 2GWRA 1IN5A 1JE8A 5BOXA 3IC7A 2OBPA 2E7XA 4A5NA 4EGYA 2MH2A 3Q9VA 1ZN2A 2FXAA 1WQ2A 4HX8A 2UWMA 3F6VA 1HKTA 2H6CA 1YLFA 4FX0A 1RUOA 5ILUA 2IA2A 3F8FA 3HRUA 2K02A 5H6QA 1P4AA 4NB5A 2CO5A 3FXRA 2L4MA 1HSJA 2MH9A 2XKPA 3HIFA 2XAQA 3DP7A 3M7GA 3HHGA 4WXHA 3WTUC 2KIMA 2VBWA 1S3JA 3I59B 2QQBA 2H27A 3GEZA 4YIFA 4LJZF 1XGOA 2HQNA 1A04A 4OINF 2DQRA 2L3DA 1OYWA 4LK0F 1QZZA 3HSRA 4BAYA 5D6FA 3JSPA 4I01A 4R8HA 2KIFA 4L9VA 2P5LC 4ESBA 2PG4A 1YYVA 3CUOA 1C0WA 1HSTA 2A5YB 3GO5A 4EJVA 2WWYA 1RUNA 1V4RA 2Q2EA 1T38A 4QLCU 2VXZA 1IXRC 3FM5A 5FFZA 4GYIA 5JVTA 1YO5C 1XDSA 1R00A 3WGHA 4UV9A 2XKOA 3B73A 2L02A 2R7DA 3W6KB 4NQWA 3HYIA 1MKMA 4IRIA 4G6QA 5D8LB 1D5VA 1BC7C 2YPRA 1USTA 4MQVA 3WU1B 2NAZA 3QPHA 1I27A 2GAUA 4BQAA 4O5VA 5DV5A 3PQJA 2STWA 2HYGD 2MA3A 2ESNA 1Y0UA 2OZ6A 3EDPA 1VTNC 4CO8A 3F8NA 3E3VA 5FFXA 3T5XA 5KK1A 1GVJA 1XD7A 3BOQA 4IXAA 4P5OA 2RKHA 2HQRA 3I59A 3HTSB 3I54A 5TRDA 4PGGA 2Y0MA 2FQ3A 1XMKA 1H9TA 5D5XB 5K5RA 2STTA 2FMLA 4HQEA 5CVIA 2DW4A 1G3SA 4XLPF 5CVJA 3SQNA 2MD5A 2QVOA 3LA3A 1MGTA 1R7JA 2DBBA 3HTUA 1O57A 1S7AA 2XAJA 2QQ9A 2P5VA 1FLIA 1OYYA 2GXBA 2Q8KA 2W85A 1SD6A 2V9VA 1K6OA 2YU3A 3E5UA 4B09A 2HZTA 4L5JA 5LRSA 4ZZLA 1LDDA 4CGZA 3BWGA 2OA4A 3M8FA 3VB2A 1T0FA 2ZKZA 1WKMA 2DU9A 3ZMZA 1HQCA 3I71A 1TLHB 2EA4A 5F64A 1KQ9A 2A6EF 2QZ8A 2DT5A 4KMFA 3KLOA 2CGPA 4KYWA 1Z6TA 1IUYA 3EYYA 3Q9SA 3WTZA 1ZARA 4BHPA 2XAHA 2WC2A 3M8EA 4KNYA 3EYIA 1W7PD 2J5PA 2H94A 3K9TA 3KE2A 5E17F 4LK1F 1T6SA 2TDXA 5IT3A 1AOYA 5LRRA 3MZHA 4CZZA 5IT9K 3FMRA 5HOOA 1ZLKA 1FP1D 4Q48A 4CXFA 4ESJA 1MJBA 1NHAA 2XRNA 4TV7A 4KICA 2O03A 4A0XA 3BPXA 2IW5A 3RKWA 4ETSA 2FA5A 1UFMA 4IHTA 2F5FA 2YX4A 3C1DA 4OMYA 1Z1DA 4YFXF 5CVUA 1YS7A 1XN7A 3WTYC 5L3DA 4I7HA 1PP7U 2ZMEB 4RGUA 2P4WA 5CYVA 3L2CA 2PQ8A 3VFZA 4L9NA 2BGCA 5BPIA 2VE9A 3NRVA 1FNNA 2XAFA 1KGSA 4I2OA 5ILVA 4I0AA 3SFZA 4S05A 3RJPA 1ODDA 1R1VA 1TTYA 4BHCA 1P92A 4ENJA 1FZPB 1RIOH 1AWCA 2O8XA 4XBFA 1WWXA 2VBYA 4DNCA 4HX4A 3F21A 1UB9A 3TQNA 1DP7P 4KIFA 3JTGA 3DXJF 4LLLA 3FX3A 2L54A 1EH8A 2NS0A 3K0LA 3D5LA 4KIGA 4N0BA 3B02A 1GHCA 3HOTA 1ZG3A 4RS8A 4I09A 1KYWA 2Y75A 1PP8F 2P7CB 5BS6A 4BXUA 2VT3A 5D5UB 3WTWC 3TOAA 3LAPA 3FHZA 2X4HA 2ELHA 3HRSA 4ENNA 5LBQA 1HW2A 3J81Z 2FBKA 1UHMA 2ISZA 5FGMA 1OMIA 4AIJA 3R0AA 1J9IA 1F4KA 2NNNA 2G7HA 1MJ9A 4GXOA 2ZMEA 1BIAA 2JPCA 2JTVA 2P6TA 1EH6A 2EA2A 4P55A 4HLXA 1CF7B 3ABUA 4AIKA 3RKYA 2XUBA 1QBJA 4HQMA 2VN2A 4M73A 5L3FA 3R60A 5L3CA 1OKRA 2COMA 1Z05A 3SZTA 1XGMA 2ZBKA 2CWEA 4FHTA 4HF0A 3FF5A 3U2RA 3J81K 3LAJA 2VBXA 4IRGA 4G6DA 1FYLA 4M74A 1W4MA 2MLKA 3TO6A 1K7AA 1J0RA 1GXQA 2IRFG 3PFIA 3DFGA 4HDVA 5E18F 1KU7A 1G3TA 3G3ZA 4U88A 3KEOA 3DEUA 3VODA 1ZAOA 3JAMZ 4LGWA 5FB2A 2J5OA 4HBLA 2A3SA 2W84A 3PQKA 2CYYA 1ZG1A 3E6DA 3FWEA 1I1SA 2BYVE 4EV0A 5LHHA 5CVRA 1TQMA 3JTHA 4O6JA 5FLXK 3GFLA 3LA2A 3VEPA 1XGSA 2QM3A 3GVAA 4RB1A 2PMHA 2RGVA 4RAYA 2LSOA 2GXGA 3TO9A 1HKSA 1ZLJA 5EEHA 1CF7A 5D4RA 1J2XA 4UVBA 3JW4A 2O61A 4G7HF 3WODF 5CLSA 1F5TA 1O3QA 3JAMK 5LHGA 4HV5A 1IF1A 2VOPA 5JFRA 1TBXA 2Z33A 2HFHA 4GO1A 4PGHA 4N9IA 1BJAA 4M71A 3QP6A 3GFIA 3ELKA 2O3FA 1J75A 3GFJA 5FD6A 3O2PE 4PCQA 2XVCA 5K1YA 4LLGF 4BHBA 4ASNA 3C3WA 1BI0A 4LLNA 3QRFF 4A0ZA 2EV0A 2KIUA 4IHSA 1FBSA 4JQFA 1RI7A 2QENA 2F5EA 3ERED 1LJ9A 2NRAC 3KP7A 2FE3A 1K78B 5ICCA 1ZHFA 1I6XA 3BDDA 2XIGA 2JZYA 2XGXA 1P4WA 2XHKA 2Z99A 2XASA 3BROA 1KU3A 4UUVA 2K7LA 4H0EA 1SAXA 2Z9OA 2F2EA 4WCGA 4UVCA 4D0PA 1IN7A 2X0LA 2M87A 1L3LA 1JXSA 3K1MA 1MZBA 3OV8A 1YTYA 2IA0A 4RGRA 1D8JA 2H6BA 4XSZF 4U0WA 2Q0OA 2P5KA 3ZMVA 3E5QA 4MNUA 1O3SA 2A61A 4ENMA 3U1DA 3BY6A 5E1XA 1USSA 6PAXA 4WXCA 2GZWA 1IRFA 3ZQ7A 1B9NA 1G6NA 3I0TA 4RB2C 2QUFA 5FD5A 3LFKA 3V8JA 1HW5A 1KYZA 3HUGA 4HZFA 4DQ2A 1W5TA 1B59A 1WRJA 2MBFA 1OR7A 4EJWA 1ULYA 5TJJA 3HOSA 2MLGA 3C18A 4EMSA 4ON0A 2HOEA 1K78A 1HXDA 1R1TA 4OIQF 1ZYRF 3F23A 3M9AA 1S29A 4FX4A 3V8KA 3M1EA 2YSRA 2FNAA 2JPBA 3WU0A 1IN4A 3F8BA 2FBHA 5F1RA 1S8NA 1S6LA 4NHJA 4HW0A 3BJOA 1UHWA 2ESHA 5IT9Z 2M45A 3CO7C 4RB3C 4L9JA 1J7KA 1IN6A 2K27A 3K69A 4G8XA 5L3EA 1LDKB 3TDZC 5DCFA 5HLIA 1IW7F 1TQIA 4G7ZF 1YS6A 3Q5FA 1TW2A 2ZXJA 1JHFA 2IVMA 3FXQA 3KCCA 1R58A 3R6SA 3BJAA 3DF8A 4Y13A 1ZH5A 3KP3A 2G9WA 3KZYA 3T8TA 5K5OA 1ONVA 2D1HA 1KU9A 4G94A 3LQQA 5ICGA 1FY7A 2OZUA 1U3EM 2K4BA 3HSFA 4G9YA 2A6HF 2VT2A 3K2ZA 4U7BA 4YG2F 4A0YA 2IPQX 2VONA 1FBQA 2CG4A 1XB4A 3GXOA 1DDNA 1XGNA 4OMZA 4LMYA 4KIBA 2QLZA 4O3MA 4XSXF 1O7LA 3MAJA 3CDHA 4UXNA 3BZ6A 2DI3A 2AS5F 3LQRA 3RPQA 3R61A 3F8CA 3QPTA 2GQQA 1HBXG 1BM9A 2FNPA 1FYKA 4Q4ZF 4MTDA 3CLOA 4P96A 1S7OA 5AIPA 2P7VB 3EQLF 3VOEA 3ISPA 1SD4A 1ON2A 3ZMDA 2HWVA 2OAZA 2EJRA 4HYEA 1D3YA 1OPCA 2CFXA 4EM2A 5EEGA 1YW7A 2HGCA 4UNOA 5E1WA 1SMTA 3ML6A 2HKXA 4IPAA 3MWMA 5DD4A 3GX4X 3L7WA 2RDPA 3WTSC 2O0YA 2EB7A 3J80K 2V1UA 4M6XA 3P7NA 2RQPA 2KJBA 5HS9A 2GA1A 5D8KB 3IKTA 4BYYA 4GGGA 3RKXA 4EQQA 2DTRA 5DYMA 1MD0A 1MJAA 2ZJ2A 2A07F 2RN7A 2ZO4A 1FX7A 5JHUA 5AONA 1KQ0A 2L4AA 1GXPA 2V1XA 2HR3A 2ADUA 4PZJA 2QYOA 4A5MA 2V79A 2DAOA 1R23A 1BN5A 2IT0A 3R0JA 4L0ZB 4YIIA 3QU3A 2JSCA 2PEXA 5DUKA 1ZRCA 1G3WA 1XSVA 1IXCA 2Y48A 4CDGA 1TW3A 2XAGA 2IP2A 3LA7A 3RYRA 4F7ZA 3HSEA 2BE5F 1B4AA 1R5GA 4CICA 2M5WA 5DD8A 3DQVC 5E8IA 4IVNA 1QZYA 2FF4A 2ZNZA 1U8RA 3ZN1A 1STZA 2LDUA 5HS8A 5ICFA 3WTTC 5HS7A 3TO7A 1ON1A 1KQ8A 2LNBA 5BQTA 2UXXA 3K1PA 5FLXZ 2WTEA 3ULQB 3KP5A 1OYIA 4ZYEA 3KP4A 1P2FA 3GYHX 4YFKF 2E1NA 3DPTA 2RVCA 5DDGA 1U6GA 2ZFWA 1R1UA 3ZP5A 1LDJA 2M1BA 2EK5A 3RTRA 5LLQA 4B8XA 2QWWA 3FMSA 3EETA 2V1DA 1O3RA 5HDGA 2DK5A 1J5YA 1X3UA 2BV6A 2EFPA 2HTSA 4LFUA 4ZYDA 2K4JA 1Z7UA 3O6BB 5LGUA 3H92A 1E17A 1IXSB 2KRFA 3IKVA 2LF7A 4WXDA 3KFWX 2PI0A 4KDPA 1V3FA 5HLHA 2A69F 1SMYF 2PN6A 5KVRA 3WGIA 3BPVA 3P9IA 2FMYA 3ZMUA 3N4MA 4ZYHA 3R4KA 1EV7A 2D2WA 5JR3A 4AIHA 2VODA 3W6JB 3ECOA 5AIQA 3WGGA 2W25A 3ZMSA 4OU0A 4ZZDA 1LQ1A 2XV4S 1B1BA 2HS5A 3GUDA 1FSHA 3MFKA 4OIPF 5J8CA 5K5QA 3S2WA 3E97A 1HW1A 3GZ5A 4L5IA 1BOAA 2PFBA 1HKQA 3KLNA 4QWQA 1IZ1A 1I1GA 3N97A 1D8KA 5BMZA 5D6EA 4UVAA 1JHHA 3HRTA 3V7CA 3WTXC 3E6CC 4JK1X 1LVAA 2LF8A 1KU2A 2RV8A 3V4GA 4RAZA 2QBYB 2CQKA 4N9HA 3I64A 1Q1HA 4M72A 3V7SA 3CJNA 1O7FA 1WI9A 2E1CA 2VE8A 3P9KA 3RIRA 1P6RA 4Y15A 2F5DA 5DCMB 2KJCA 1F9NA 5CJ9A 4EGZA 4KMUX 4WF2A 5ERIA 3REOA 3DPLC 1XMAA 3EUHA 4WX9A 1B6AA 5F6FA 1JGSA 2GIVA 5FO5A 5D5WB 2D45A 3MCZA 4ZH4F 3F8MA 1LEAA 4GYGA 1QO0D 4ENKA 1DPRA 2B0LA 2OQGA 3WTVC 4L9TA 2DPUA 2IA1A 5A2QZ 1ZRFA 1XCVA 3IRQA 4HDUA 3QAHA 4Z2YA 2UZKA 1ZGAA 3RPUA 4Q47A 1R5HA 1ZG5A 3J7AO 1YW9A 3QU6A 2JRTA 2V6CA 1SFXA 3OOPA 3QOPA 3CTAA 3GFMA 3CO6C 3L00A 3COAC 2HDCA 4I98B 1WSUA 3FMQA 3D0SA 4MQ9F 4OIOF 2QBYA 3IL2A 3L9FA 3JSOA 2M30A 2L01A 2PBIA 3KZZA 3T0YA 3MQ0A 2QQAA 4I0BA 3MZYA 1W7PB 4MGRA 2EV5A 3ZMTA 1FPQA 1O3TA 2W24A 2PLYA 5A2QK 4L18B 2K86A 4HLYA 1U5TB 3IRRA 1BBYA 5DCMA 4HOBA 5LGNA 1FC3A 1FP2A 1XSXA 4U0VA 1LNWA 2C6YA 3CUQB 2GA2A 4EM1A 3WE2A 1XDUA 4EJUA 4U7DA 2HKOA 4RB0A 4RGXA 1DPUA 1RZ4A 3FXUA 3GLXA 2OD5A 4KT5C 1REPC 4HA8A 3WE3A 3TGNA 1YIOA 3E6MA 1BI1A 1CGPA 3E5XA 4L0YB 2HYFA 2HEOA 4M9XA 4MHGA 1T98A 5L3GA 1UCRA 3IWZA 2G7UA 4GCVA 4CHUA 3H3ZA 2RC4A 3GW2A 4E70A 3U9GA 2NNYA 2BBYA 5ILSA 1G3YA 3KEQA 5H20A 4KN7X 5D4SA 4P9UA 1PUEE 2DQLA 2OQRA 4UHTA 5H6RA 3MEXA 3V7RA 1K79A 2ISYA 4BNCA 4LG0B 4MTEA 3I4PA 3L09A 2ETHA 1W7PA 4IF4A 2ZNYA 3F72A 2FOKA 3AAFA 4HF1A 4KUMA 1FOKA 5LHIA 1YW8A 3KP2A 1U5TA 3TDUC 3J80Z 4WWCA 4AD9A 1L0OC 3I58A 5J6XA 3CUQA 2AXLA 5E8GA 3GZ6A 5HDKA 1LB2A 5E1ZB 1F1ZA 4KFCA 1U2WA 1ZREA 2DLLA 4M6YA 4Y17A 2IJLA 4Q5SF 4M9ZA 1Z6RA 3O3KA 4RGSA 4A6DA 2EFOA 3DKWA 1Z91A 4HAMA 5HDNA 4HX7A 2MC3A 4EVIA 5LGTA 3QP5A 3FZVA 3V8LA 1XSDA 1FBUA 2FSWA 4K2EA 2EFQA 5JI6A 2A68F 4JBAA 2JT1A 4YFNF 3BJ6A 1TNTA 4UV8A 4KA4A 4EJOA 4LB5A 1SD7A 2FBIA 2O6GE 4LG0A 4G7OF 3F3XA 2Z3YA 3ECHA 3TOBA 1SD5A 5CVVA 1XCBA 3RYPA 1FSEA 1YFHA 1IRGA 2DK8A 3IHUA 4CYDA 2DFIA 1TNSA 1ZGJA 5LEJA 1R22A 2HTJA 2WV0A 4XLNF 5ICEA 4A12A 4ZYGA 1QNTA 2VOOA 3K1NA 5ED4A 4MEYF 1FT9A 3ABTA 4LD5A 5DUIA 2ZCWA 1T39A 3E6BA 1P4XA 2F5CA 4EJTA 2R7FA 5BPDA 5HLGA 1FYMA 3I53A 1IN8A 4R1HA 2PJPA 4FT8A 3SHFA 2VC0A 1QQIA 3GF2A 2R3SA 1IAWA 1BC8C 1SFEA 2YR2A 3HHHA 4HV6A 2DPDA 3ZN0A 4AWXB 3WG9A 4MEXF 2BEOA 4EM0B 2EFWA 3NQOA 3RI4A 4WK8F 1MDMB 5J8FA 1E2XA 1Z9CA 3F22A 1BI3A 2YX7A 2OU2A 2VBZA 1U78A 4ESFA 1R36A 1EH7A 5L3BA 3BP8A 4I02A 3G73A 1W5SA 2W57A 4AVPA 2EFNA 1BIBA 1BI2A 5E20A 4PDKA 2RNJA 3NEUA 1ZRDA 2P6SA 1KA8A 3KP6A 4A2UA 5HVQC 2VC1A 2LKPA 3C7JA 1QPMA 3F6OA 4LB6B 4IRHA 4XRFA 1SFUA 3SZPA 1PDNC 1J59A 3H3UA 4U0YA 3ZPLA 3T8RA 2M8EA 3T1BA 2NYXA 3P9CA 4BH9A 1QGPA 3SXYA 3LSTA 3IWFA 2CSOA 2UXNA 1LEBA 2PMUA 1H9GA 4S04A 2E7WA 3KETA 2FEZA 4M9SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P8T A;  1RNL A;  1H0M A;  1YQA A;  2EWN A;  2FRH A;  1FWZ A;  4KN4 X;  2CW0 F;  3GWZ A;  4OOI A;  2DO7 A;  3RDI A;  3HRM A;  2H09 A;  4HF2 A;  3DV8 A;  3TKY A;  1DUX C;  2EV6 A;  1U5T C;  2ACJ A;  3I5U A;  5LEK A;  4A6E A;  3LWF A;  4IJA A;  5D5V B;  1TQP A;  3FM3 A;  1T2K A;  4P9F A;  1I5Z A;  4R79 A;  2FU4 A;  3CUQ C;  3ROU A;  5DEQ A;  1MDM A;  1YG2 A;  2Z5U A;  2KKO A;  4OIR F;  2D1V A;  1G4D A;  2XRO A;  1B9M A;  2GWR A;  1IN5 A;  1JE8 A;  5BOX A;  3IC7 A;  2OBP A;  2E7X A;  4A5N A;  4EGY A;  2MH2 A;  3Q9V A;  1ZN2 A;  2FXA A;  1WQ2 A;  4HX8 A;  2UWM A;  3F6V A;  1HKT A;  2H6C A;  1YLF A;  4FX0 A;  1RUO A;  5ILU A;  2IA2 A;  3F8F A;  3HRU A;  2K02 A;  5H6Q A;  1P4A A;  4NB5 A;  2CO5 A;  3FXR A;  2L4M A;  1HSJ A;  2MH9 A;  2XKP A;  3HIF A;  2XAQ A;  3DP7 A;  3M7G A;  3HHG A;  4WXH A;  3WTU C;  2KIM A;  2VBW A;  1S3J A;  3I59 B;  2QQB A;  2H27 A;  3GEZ A;  4YIF A;  4LJZ F;  1XGO A;  2HQN A;  1A04 A;  4OIN F;  2DQR A;  2L3D A;  1OYW A;  4LK0 F;  1QZZ A;  3HSR A;  4BAY A;  5D6F A;  3JSP A;  4I01 A;  4R8H A;  2KIF A;  4L9V A;  2P5L C;  4ESB A;  2PG4 A;  1YYV A;  3CUO A;  1C0W A;  1HST A;  2A5Y B;  3GO5 A;  4EJV A;  2WWY A;  1RUN A;  1V4R A;  2Q2E A;  1T38 A;  4QLC U;  2VXZ A;  1IXR C;  3FM5 A;  5FFZ A;  4GYI A;  5JVT A;  1YO5 C;  1XDS A;  1R00 A;  3WGH A;  4UV9 A;  2XKO A;  3B73 A;  2L02 A;  2R7D A;  3W6K B;  4NQW A;  3HYI A;  1MKM A;  4IRI A;  4G6Q A;  5D8L B;  1D5V A;  1BC7 C;  2YPR A;  1UST A;  4MQV A;  3WU1 B;  2NAZ A;  3QPH A;  1I27 A;  2GAU A;  4BQA A;  4O5V A;  5DV5 A;  3PQJ A;  2STW A;  2HYG D;  2MA3 A;  2ESN A;  1Y0U A;  2OZ6 A;  3EDP A;  1VTN C;  4CO8 A;  3F8N A;  3E3V A;  5FFX A;  3T5X A;  5KK1 A;  1GVJ A;  1XD7 A;  3BOQ A;  4IXA A;  4P5O A;  2RKH A;  2HQR A;  3I59 A;  3HTS B;  3I54 A;  5TRD A;  4PGG A;  2Y0M A;  2FQ3 A;  1XMK A;  1H9T A;  5D5X B;  5K5R A;  2STT A;  2FML A;  4HQE A;  5CVI A;  2DW4 A;  1G3S A;  4XLP F;  5CVJ A;  3SQN A;  2MD5 A;  2QVO A;  3LA3 A;  1MGT A;  1R7J A;  2DBB A;  3HTU A;  1O57 A;  1S7A A;  2XAJ A;  2QQ9 A;  2P5V A;  1FLI A;  1OYY A;  2GXB A;  2Q8K A;  2W85 A;  1SD6 A;  2V9V A;  1K6O A;  2YU3 A;  3E5U A;  4B09 A;  2HZT A;  4L5J A;  5LRS A;  4ZZL A;  1LDD A;  4CGZ A;  3BWG A;  2OA4 A;  3M8F A;  3VB2 A;  1T0F A;  2ZKZ A;  1WKM A;  2DU9 A;  3ZMZ A;  1HQC A;  3I71 A;  1TLH B;  2EA4 A;  5F64 A;  1KQ9 A;  2A6E F;  2QZ8 A;  2DT5 A;  4KMF A;  3KLO A;  2CGP A;  4KYW A;  1Z6T A;  1IUY A;  3EYY A;  3Q9S A;  3WTZ A;  1ZAR A;  4BHP A;  2XAH A;  2WC2 A;  3M8E A;  4KNY A;  3EYI A;  1W7P D;  2J5P A;  2H94 A;  3K9T A;  3KE2 A;  5E17 F;  4LK1 F;  1T6S A;  2TDX A;  5IT3 A;  1AOY A;  5LRR A;  3MZH A;  4CZZ A;  5IT9 K;  3FMR A;  5HOO A;  1ZLK A;  1FP1 D;  4Q48 A;  4CXF A;  4ESJ A;  1MJB A;  1NHA A;  2XRN A;  4TV7 A;  4KIC A;  2O03 A;  4A0X A;  3BPX A;  2IW5 A;  3RKW A;  4ETS A;  2FA5 A;  1UFM A;  4IHT A;  2F5F A;  2YX4 A;  3C1D A;  4OMY A;  1Z1D A;  4YFX F;  5CVU A;  1YS7 A;  1XN7 A;  3WTY C;  5L3D A;  4I7H A;  1PP7 U;  2ZME B;  4RGU A;  2P4W A;  5CYV A;  3L2C A;  2PQ8 A;  3VFZ A;  4L9N A;  2BGC A;  5BPI A;  2VE9 A;  3NRV A;  1FNN A;  2XAF A;  1KGS A;  4I2O A;  5ILV A;  4I0A A;  3SFZ A;  4S05 A;  3RJP A;  1ODD A;  1R1V A;  1TTY A;  4BHC A;  1P92 A;  4ENJ A;  1FZP B;  1RIO H;  1AWC A;  2O8X A;  4XBF A;  1WWX A;  2VBY A;  4DNC A;  4HX4 A;  3F21 A;  1UB9 A;  3TQN A;  1DP7 P;  4KIF A;  3JTG A;  3DXJ F;  4LLL A;  3FX3 A;  2L54 A;  1EH8 A;  2NS0 A;  3K0L A;  3D5L A;  4KIG A;  4N0B A;  3B02 A;  1GHC A;  3HOT A;  1ZG3 A;  4RS8 A;  4I09 A;  1KYW A;  2Y75 A;  1PP8 F;  2P7C B;  5BS6 A;  4BXU A;  2VT3 A;  5D5U B;  3WTW C;  3TOA A;  3LAP A;  3FHZ A;  2X4H A;  2ELH A;  3HRS A;  4ENN A;  5LBQ A;  1HW2 A;  3J81 Z;  2FBK A;  1UHM A;  2ISZ A;  5FGM A;  1OMI A;  4AIJ A;  3R0A A;  1J9I A;  1F4K A;  2NNN A;  2G7H A;  1MJ9 A;  4GXO A;  2ZME A;  1BIA A;  2JPC A;  2JTV A;  2P6T A;  1EH6 A;  2EA2 A;  4P55 A;  4HLX A;  1CF7 B;  3ABU A;  4AIK A;  3RKY A;  2XUB A;  1QBJ A;  4HQM A;  2VN2 A;  4M73 A;  5L3F A;  3R60 A;  5L3C A;  1OKR A;  2COM A;  1Z05 A;  3SZT A;  1XGM A;  2ZBK A;  2CWE A;  4FHT A;  4HF0 A;  3FF5 A;  3U2R A;  3J81 K;  3LAJ A;  2VBX A;  4IRG A;  4G6D A;  1FYL A;  4M74 A;  1W4M A;  2MLK A;  3TO6 A;  1K7A A;  1J0R A;  1GXQ A;  2IRF G;  3PFI A;  3DFG A;  4HDV A;  5E18 F;  1KU7 A;  1G3T A;  3G3Z A;  4U88 A;  3KEO A;  3DEU A;  3VOD A;  1ZAO A;  3JAM Z;  4LGW A;  5FB2 A;  2J5O A;  4HBL A;  2A3S A;  2W84 A;  3PQK A;  2CYY A;  1ZG1 A;  3E6D A;  3FWE A;  1I1S A;  2BYV E;  4EV0 A;  5LHH A;  5CVR A;  1TQM A;  3JTH A;  4O6J A;  5FLX K;  3GFL A;  3LA2 A;  3VEP A;  1XGS A;  2QM3 A;  3GVA A;  4RB1 A;  2PMH A;  2RGV A;  4RAY A;  2LSO A;  2GXG A;  3TO9 A;  1HKS A;  1ZLJ A;  5EEH A;  1CF7 A;  5D4R A;  1J2X A;  4UVB A;  3JW4 A;  2O61 A;  4G7H F;  3WOD F;  5CLS A;  1F5T A;  1O3Q A;  3JAM K;  5LHG A;  4HV5 A;  1IF1 A;  2VOP A;  5JFR A;  1TBX A;  2Z33 A;  2HFH A;  4GO1 A;  4PGH A;  4N9I A;  1BJA A;  4M71 A;  3QP6 A;  3GFI A;  3ELK A;  2O3F A;  1J75 A;  3GFJ A;  5FD6 A;  3O2P E;  4PCQ A;  2XVC A;  5K1Y A;  4LLG F;  4BHB A;  4ASN A;  3C3W A;  1BI0 A;  4LLN A;  3QRF F;  4A0Z A;  2EV0 A;  2KIU A;  4IHS A;  1FBS A;  4JQF A;  1RI7 A;  2QEN A;  2F5E A;  3ERE D;  1LJ9 A;  2NRA C;  3KP7 A;  2FE3 A;  1K78 B;  5ICC A;  1ZHF A;  1I6X A;  3BDD A;  2XIG A;  2JZY A;  2XGX A;  1P4W A;  2XHK A;  2Z99 A;  2XAS A;  3BRO A;  1KU3 A;  4UUV A;  2K7L A;  4H0E A;  1SAX A;  2Z9O A;  2F2E A;  4WCG A;  4UVC A;  4D0P A;  1IN7 A;  2X0L A;  2M87 A;  1L3L A;  1JXS A;  3K1M A;  1MZB A;  3OV8 A;  1YTY A;  2IA0 A;  4RGR A;  1D8J A;  2H6B A;  4XSZ F;  4U0W A;  2Q0O A;  2P5K A;  3ZMV A;  3E5Q A;  4MNU A;  1O3S A;  2A61 A;  4ENM A;  3U1D A;  3BY6 A;  5E1X A;  1USS A;  6PAX A;  4WXC A;  2GZW A;  1IRF A;  3ZQ7 A;  1B9N A;  1G6N A;  3I0T A;  4RB2 C;  2QUF A;  5FD5 A;  3LFK A;  3V8J A;  1HW5 A;  1KYZ A;  3HUG A;  4HZF A;  4DQ2 A;  1W5T A;  1B59 A;  1WRJ A;  2MBF A;  1OR7 A;  4EJW A;  1ULY A;  5TJJ A;  3HOS A;  2MLG A;  3C18 A;  4EMS A;  4ON0 A;  2HOE A;  1K78 A;  1HXD A;  1R1T A;  4OIQ F;  1ZYR F;  3F23 A;  3M9A A;  1S29 A;  4FX4 A;  3V8K A;  3M1E A;  2YSR A;  2FNA A;  2JPB A;  3WU0 A;  1IN4 A;  3F8B A;  2FBH A;  5F1R A;  1S8N A;  1S6L A;  4NHJ A;  4HW0 A;  3BJO A;  1UHW A;  2ESH A;  5IT9 Z;  2M45 A;  3CO7 C;  4RB3 C;  4L9J A;  1J7K A;  1IN6 A;  2K27 A;  3K69 A;  4G8X A;  5L3E A;  1LDK B;  3TDZ C;  5DCF A;  5HLI A;  1IW7 F;  1TQI A;  4G7Z F;  1YS6 A;  3Q5F A;  1TW2 A;  2ZXJ A;  1JHF A;  2IVM A;  3FXQ A;  3KCC A;  1R58 A;  3R6S A;  3BJA A;  3DF8 A;  4Y13 A;  1ZH5 A;  3KP3 A;  2G9W A;  3KZY A;  3T8T A;  5K5O A;  1ONV A;  2D1H A;  1KU9 A;  4G94 A;  3LQQ A;  5ICG A;  1FY7 A;  2OZU A;  1U3E M;  2K4B A;  3HSF A;  4G9Y A;  2A6H F;  2VT2 A;  3K2Z A;  4U7B A;  4YG2 F;  4A0Y A;  2IPQ X;  2VON A;  1FBQ A;  2CG4 A;  1XB4 A;  3GXO A;  1DDN A;  1XGN A;  4OMZ A;  4LMY A;  4KIB A;  2QLZ A;  4O3M A;  4XSX F;  1O7L A;  3MAJ A;  3CDH A;  4UXN A;  3BZ6 A;  2DI3 A;  2AS5 F;  3LQR A;  3RPQ A;  3R61 A;  3F8C A;  3QPT A;  2GQQ A;  1HBX G;  1BM9 A;  2FNP A;  1FYK A;  4Q4Z F;  4MTD A;  3CLO A;  4P96 A;  1S7O A;  5AIP A;  2P7V B;  3EQL F;  3VOE A;  3ISP A;  1SD4 A;  1ON2 A;  3ZMD A;  2HWV A;  2OAZ A;  2EJR A;  4HYE A;  1D3Y A;  1OPC A;  2CFX A;  4EM2 A;  5EEG A;  1YW7 A;  2HGC A;  4UNO A;  5E1W A;  1SMT A;  3ML6 A;  2HKX A;  4IPA A;  3MWM A;  5DD4 A;  3GX4 X;  3L7W A;  2RDP A;  3WTS C;  2O0Y A;  2EB7 A;  3J80 K;  2V1U A;  4M6X A;  3P7N A;  2RQP A;  2KJB A;  5HS9 A;  2GA1 A;  5D8K B;  3IKT A;  4BYY A;  4GGG A;  3RKX A;  4EQQ A;  2DTR A;  5DYM A;  1MD0 A;  1MJA A;  2ZJ2 A;  2A07 F;  2RN7 A;  2ZO4 A;  1FX7 A;  5JHU A;  5AON A;  1KQ0 A;  2L4A A;  1GXP A;  2V1X A;  2HR3 A;  2ADU A;  4PZJ A;  2QYO A;  4A5M A;  2V79 A;  2DAO A;  1R23 A;  1BN5 A;  2IT0 A;  3R0J A;  4L0Z B;  4YII A;  3QU3 A;  2JSC A;  2PEX A;  5DUK A;  1ZRC A;  1G3W A;  1XSV A;  1IXC A;  2Y48 A;  4CDG A;  1TW3 A;  2XAG A;  2IP2 A;  3LA7 A;  3RYR A;  4F7Z A;  3HSE A;  2BE5 F;  1B4A A;  1R5G A;  4CIC A;  2M5W A;  5DD8 A;  3DQV C;  5E8I A;  4IVN A;  1QZY A;  2FF4 A;  2ZNZ A;  1U8R A;  3ZN1 A;  1STZ A;  2LDU A;  5HS8 A;  5ICF A;  3WTT C;  5HS7 A;  3TO7 A;  1ON1 A;  1KQ8 A;  2LNB A;  5BQT A;  2UXX A;  3K1P A;  5FLX Z;  2WTE A;  3ULQ B;  3KP5 A;  1OYI A;  4ZYE A;  3KP4 A;  1P2F A;  3GYH X;  4YFK F;  2E1N A;  3DPT A;  2RVC A;  5DDG A;  1U6G A;  2ZFW A;  1R1U A;  3ZP5 A;  1LDJ A;  2M1B A;  2EK5 A;  3RTR A;  5LLQ A;  4B8X A;  2QWW A;  3FMS A;  3EET A;  2V1D A;  1O3R A;  5HDG A;  2DK5 A;  1J5Y A;  1X3U A;  2BV6 A;  2EFP A;  2HTS A;  4LFU A;  4ZYD A;  2K4J A;  1Z7U A;  3O6B B;  5LGU A;  3H92 A;  1E17 A;  1IXS B;  2KRF A;  3IKV A;  2LF7 A;  4WXD A;  3KFW X;  2PI0 A;  4KDP A;  1V3F A;  5HLH A;  2A69 F;  1SMY F;  2PN6 A;  5KVR A;  3WGI A;  3BPV A;  3P9I A;  2FMY A;  3ZMU A;  3N4M A;  4ZYH A;  3R4K A;  1EV7 A;  2D2W A;  5JR3 A;  4AIH A;  2VOD A;  3W6J B;  3ECO A;  5AIQ A;  3WGG A;  2W25 A;  3ZMS A;  4OU0 A;  4ZZD A;  1LQ1 A;  2XV4 S;  1B1B A;  2HS5 A;  3GUD A;  1FSH A;  3MFK A;  4OIP F;  5J8C A;  5K5Q A;  3S2W A;  3E97 A;  1HW1 A;  3GZ5 A;  4L5I A;  1BOA A;  2PFB A;  1HKQ A;  3KLN A;  4QWQ A;  1IZ1 A;  1I1G A;  3N97 A;  1D8K A;  5BMZ A;  5D6E A;  4UVA A;  1JHH A;  3HRT A;  3V7C A;  3WTX C;  3E6C C;  4JK1 X;  1LVA A;  2LF8 A;  1KU2 A;  2RV8 A;  3V4G A;  4RAZ A;  2QBY B;  2CQK A;  4N9H A;  3I64 A;  1Q1H A;  4M72 A;  3V7S A;  3CJN A;  1O7F A;  1WI9 A;  2E1C A;  2VE8 A;  3P9K A;  3RIR A;  1P6R A;  4Y15 A;  2F5D A;  5DCM B;  2KJC A;  1F9N A;  5CJ9 A;  4EGZ A;  4KMU X;  4WF2 A;  5ERI A;  3REO A;  3DPL C;  1XMA A;  3EUH A;  4WX9 A;  1B6A A;  5F6F A;  1JGS A;  2GIV A;  5FO5 A;  5D5W B;  2D45 A;  3MCZ A;  4ZH4 F;  3F8M A;  1LEA A;  4GYG A;  1QO0 D;  4ENK A;  1DPR A;  2B0L A;  2OQG A;  3WTV C;  4L9T A;  2DPU A;  2IA1 A;  5A2Q Z;  1ZRF A;  1XCV A;  3IRQ A;  4HDU A;  3QAH A;  4Z2Y A;  2UZK A;  1ZGA A;  3RPU A;  4Q47 A;  1R5H A;  1ZG5 A;  3J7A O;  1YW9 A;  3QU6 A;  2JRT A;  2V6C A;  1SFX A;  3OOP A;  3QOP A;  3CTA A;  3GFM A;  3CO6 C;  3L00 A;  3COA C;  2HDC A;  4I98 B;  1WSU A;  3FMQ A;  3D0S A;  4MQ9 F;  4OIO F;  2QBY A;  3IL2 A;  3L9F A;  3JSO A;  2M30 A;  2L01 A;  2PBI A;  3KZZ A;  3T0Y A;  3MQ0 A;  2QQA A;  4I0B A;  3MZY A;  1W7P B;  4MGR A;  2EV5 A;  3ZMT A;  1FPQ A;  1O3T A;  2W24 A;  2PLY A;  5A2Q K;  4L18 B;  2K86 A;  4HLY A;  1U5T B;  3IRR A;  1BBY A;  5DCM A;  4HOB A;  5LGN A;  1FC3 A;  1FP2 A;  1XSX A;  4U0V A;  1LNW A;  2C6Y A;  3CUQ B;  2GA2 A;  4EM1 A;  3WE2 A;  1XDU A;  4EJU A;  4U7D A;  2HKO A;  4RB0 A;  4RGX A;  1DPU A;  1RZ4 A;  3FXU A;  3GLX A;  2OD5 A;  4KT5 C;  1REP C;  4HA8 A;  3WE3 A;  3TGN A;  1YIO A;  3E6M A;  1BI1 A;  1CGP A;  3E5X A;  4L0Y B;  2HYF A;  2HEO A;  4M9X A;  4MHG A;  1T98 A;  5L3G A;  1UCR A;  3IWZ A;  2G7U A;  4GCV A;  4CHU A;  3H3Z A;  2RC4 A;  3GW2 A;  4E70 A;  3U9G A;  2NNY A;  2BBY A;  5ILS A;  1G3Y A;  3KEQ A;  5H20 A;  4KN7 X;  5D4S A;  4P9U A;  1PUE E;  2DQL A;  2OQR A;  4UHT A;  5H6R A;  3MEX A;  3V7R A;  1K79 A;  2ISY A;  4BNC A;  4LG0 B;  4MTE A;  3I4P A;  3L09 A;  2ETH A;  1W7P A;  4IF4 A;  2ZNY A;  3F72 A;  2FOK A;  3AAF A;  4HF1 A;  4KUM A;  1FOK A;  5LHI A;  1YW8 A;  3KP2 A;  1U5T A;  3TDU C;  3J80 Z;  4WWC A;  4AD9 A;  1L0O C;  3I58 A;  5J6X A;  3CUQ A;  2AXL A;  5E8G A;  3GZ6 A;  5HDK A;  1LB2 A;  5E1Z B;  1F1Z A;  4KFC A;  1U2W A;  1ZRE A;  2DLL A;  4M6Y A;  4Y17 A;  2IJL A;  4Q5S F;  4M9Z A;  1Z6R A;  3O3K A;  4RGS A;  4A6D A;  2EFO A;  3DKW A;  1Z91 A;  4HAM A;  5HDN A;  4HX7 A;  2MC3 A;  4EVI A;  5LGT A;  3QP5 A;  3FZV A;  3V8L A;  1XSD A;  1FBU A;  2FSW A;  4K2E A;  2EFQ A;  5JI6 A;  2A68 F;  4JBA A;  2JT1 A;  4YFN F;  3BJ6 A;  1TNT A;  4UV8 A;  4KA4 A;  4EJO A;  4LB5 A;  1SD7 A;  2FBI A;  2O6G E;  4LG0 A;  4G7O F;  3F3X A;  2Z3Y A;  3ECH A;  3TOB A;  1SD5 A;  5CVV A;  1XCB A;  3RYP A;  1FSE A;  1YFH A;  1IRG A;  2DK8 A;  3IHU A;  4CYD A;  2DFI A;  1TNS A;  1ZGJ A;  5LEJ A;  1R22 A;  2HTJ A;  2WV0 A;  4XLN F;  5ICE A;  4A12 A;  4ZYG A;  1QNT A;  2VOO A;  3K1N A;  5ED4 A;  4MEY F;  1FT9 A;  3ABT A;  4LD5 A;  5DUI A;  2ZCW A;  1T39 A;  3E6B A;  1P4X A;  2F5C A;  4EJT A;  2R7F A;  5BPD A;  5HLG A;  1FYM A;  3I53 A;  1IN8 A;  4R1H A;  2PJP A;  4FT8 A;  3SHF A;  2VC0 A;  1QQI A;  3GF2 A;  2R3S A;  1IAW A;  1BC8 C;  1SFE A;  2YR2 A;  3HHH A;  4HV6 A;  2DPD A;  3ZN0 A;  4AWX B;  3WG9 A;  4MEX F;  2BEO A;  4EM0 B;  2EFW A;  3NQO A;  3RI4 A;  4WK8 F;  1MDM B;  5J8F A;  1E2X A;  1Z9C A;  3F22 A;  1BI3 A;  2YX7 A;  2OU2 A;  2VBZ A;  1U78 A;  4ESF A;  1R36 A;  1EH7 A;  5L3B A;  3BP8 A;  4I02 A;  3G73 A;  1W5S A;  2W57 A;  4AVP A;  2EFN A;  1BIB A;  1BI2 A;  5E20 A;  4PDK A;  2RNJ A;  3NEU A;  1ZRD A;  2P6S A;  1KA8 A;  3KP6 A;  4A2U A;  5HVQ C;  2VC1 A;  2LKP A;  3C7J A;  1QPM A;  3F6O A;  4LB6 B;  4IRH A;  4XRF A;  1SFU A;  3SZP A;  1PDN C;  1J59 A;  3H3U A;  4U0Y A;  3ZPL A;  3T8R A;  2M8E A;  3T1B A;  2NYX A;  3P9C A;  4BH9 A;  1QGP A;  3SXY A;  3LST A;  3IWF A;  2CSO A;  2UXN A;  1LEB A;  2PMU A;  1H9G A;  4S04 A;  2E7W A;  3KET A;  2FEZ A;  4M9S A; 
#chains in the Genus database with same CATH topology
 2P8T A;  1RNL A;  1H0M A;  1YQA A;  2EZI A;  2EWN A;  1XC5 A;  2FRH A;  3LL7 A;  1YJN I;  4XKB A;  1FWZ A;  4KN4 X;  1T33 A;  2CW0 F;  1U9N A;  3GWZ A;  5GAE J;  4OOI A;  4B1R A;  1JTX A;  2DO7 A;  3OYK A;  2KQR A;  3HRM A;  3RDI A;  2H09 A;  4HF2 A;  3DV8 A;  3TKY A;  2Z2S B;  1DUX C;  2EV6 A;  1VQK I;  2K5C A;  3CC4 I;  1U5T C;  2ACJ A;  4FTH A;  3I5U A;  5LEK A;  4A6E A;  3LWF A;  4IJA A;  2IAI A;  1TQP A;  4U87 A;  5D5V B;  3VWB A;  3FM3 A;  4MFE A;  1T2K A;  3PM1 A;  4CYC B;  4P9F A;  3GLL A;  2RAE A;  1I5Z A;  1MBE A;  5GAH J;  4R79 A;  4XLE A;  2FU4 A;  3CUQ C;  1YX5 A;  4XKW A;  4ZTF A;  3ROU A;  1MBF A;  5DEQ A;  3G4S I;  1XPX A;  1MDM A;  1YG2 A;  3DTK A;  3HC7 A;  2G0E A;  2Q2E B;  3DU5 A;  4RM2 A;  5J1Y A;  3JRD A;  2HOA A;  3ZQC A;  2Z5U A;  4XRS G;  2KKO A;  1VQ6 I;  3H5N A;  4A3I J;  1BOB A;  4OIR F;  5J47 A;  1Z77 A;  1ORK A;  2D1V A;  1G4D A;  2XRO A;  1NH3 A;  5J4Y A;  2ZJP F;  1DU0 A;  1B9M A;  4C3H J;  2V6E A;  4NQW B;  3GTO J;  4CCN A;  3CCU I;  2GWR A;  1IN5 A;  1K6Y A;  1JE8 A;  5BOX A;  3IC7 A;  2OBP A;  2E7X A;  4A5N A;  2M4K A;  2KMU A;  2MH2 A;  4EGY A;  3Q9V A;  1ZN2 A;  2FXA A;  1WQ2 A;  1IRZ A;  4HX8 A;  3JR9 A;  2UWM A;  3F6V A;  4ZDP A;  1HKT A;  2H6C A;  2OC6 A;  1YLF A;  3BG7 A;  1Z67 A;  4FX0 A;  1RUO A;  5ILU A;  2IA2 A;  1QHH D;  2R4G A;  3F8F A;  3HRU A;  2K02 A;  5H6Q A;  3E7L A;  1P4A A;  4M3E A;  1D5Y A;  4NB5 A;  2CO5 A;  3FXR A;  2L4M A;  4BY7 J;  1HSJ A;  1IG7 A;  1ERD A;  2MH9 A;  2XKP A;  1G8X A;  3HIF A;  3HJE A;  2XAQ A;  3KYD B;  3K4L A;  1HOM A;  3DP7 A;  3M7G A;  3HHG A;  3HEF A;  4WXH A;  1OIS A;  3BZC A;  2DDB A;  3WTU C;  2KIM A;  1MBK A;  2VBW A;  1S3J A;  2WAF A;  3QOE A;  1RKW A;  2QQB A;  3I59 B;  2H27 A;  3GEZ A;  4DGW B;  1FIA A;  4YIF A;  3GBG A;  2LY9 A;  4LJZ F;  3NAR A;  1Y1V J;  1TZL A;  2E60 A;  1LVK A;  4XRM A;  4B4C A;  1XGO A;  3J7Y J;  2HQN A;  4CCJ A;  1A04 A;  4OIN F;  4QPQ A;  2DQR A;  3H9G A;  3LSG A;  2L3D A;  1OYW A;  4LK0 F;  1QZZ A;  3HSR A;  3OOU A;  4BAY A;  3DLL F;  2NS8 A;  1X1D A;  2OV7 A;  5D6F A;  4II2 A;  4I01 A;  4R8H A;  3JSP A;  4XOP A;  2KIF A;  2K85 A;  2CV1 A;  3D5S C;  3BT9 A;  4L9V A;  1RC9 A;  2P5L C;  4ESB A;  2PG4 A;  1YYV A;  3CUO A;  1C0W A;  4CYC A;  2E34 A;  2CS3 A;  1HST A;  2A5Y B;  3GO5 A;  5EEA A;  2X6W A;  4EJV A;  1VQ7 I;  2WWY A;  1GLN A;  1S7E A;  3DKX A;  1RUN A;  1V4R A;  3ERM A;  2Q2E A;  1FOX A;  1T38 A;  2H8R A;  4QLC U;  2VXZ A;  3FXM A;  1IXR C;  3FM5 A;  5FFZ A;  2BHZ A;  3PUB A;  4GYI A;  5JVT A;  1YO5 C;  1VQ4 I;  1XDS A;  1R00 A;  3F0C A;  3WGH A;  2CJJ A;  4UV9 A;  1MMD A;  2XKO A;  3B73 A;  2L02 A;  2R7D A;  3W6K B;  2GXA A;  4NQW A;  3HYI A;  1MKM A;  2HXO A;  3S1R J;  1LE8 B;  3A01 B;  4HRI A;  4G6Q A;  1OFC X;  5D8L B;  4IRI A;  1D5V A;  1BC7 C;  2XF7 A;  2YPR A;  1UST A;  4MQV A;  2CUF A;  3RPU D;  2EZH A;  3VYT B;  3RCO A;  3WU1 B;  2E2H J;  2MAB A;  2NAZ A;  2DOF A;  1BR2 A;  3QPH A;  1I27 A;  2F48 A;  2GAU A;  4OAZ A;  4F52 A;  4BQA A;  3KPH A;  4O5V A;  5DV5 A;  4E7S A;  2QF7 A;  1EA3 A;  3PQJ A;  2STW A;  2HYG D;  2MA3 A;  2ZME C;  2ESN A;  3HM5 A;  1Y0U A;  2OZ6 A;  3EDP A;  5EJC A;  1VTN C;  4CO8 A;  3F8N A;  3OYE A;  1H8A C;  1BW5 A;  3E3V A;  1TWC J;  3QYE A;  5FFX A;  3A4C A;  3T5X A;  2ZJQ F;  3HXL A;  2DMQ A;  5KK1 A;  1OCT C;  1GVJ A;  1XD7 A;  3BOQ A;  1DGR M;  4IXA A;  4P5O A;  3JRB A;  4BBS J;  2FD5 A;  2Q1Z B;  2RKH A;  1WJ5 A;  2W4S A;  2HQR A;  2ECB A;  3I59 A;  3HTS B;  2HVQ A;  3I54 A;  5KCM A;  5F0H A;  5TRD A;  4PGG A;  2Y0M A;  1U0J A;  2FQ3 A;  1XMK A;  1H9T A;  5D5X B;  4JP0 A;  4L5E A;  5K5R A;  2STT A;  2FML A;  5CVI A;  4HQE A;  1NG6 A;  3RKQ A;  1YIT I;  1GV2 A;  4M6V A;  2DW4 A;  3HL2 A;  1G3S A;  1MMA A;  4XLP F;  2JVG A;  2W7N A;  4XOT A;  5CVJ A;  5JLW A;  3SQN A;  4C3J J;  1YI2 I;  2MD5 A;  1OCC H;  2QKM B;  2QVO A;  3K4M A;  3JRC A;  3LA3 A;  4KIS A;  1MGT A;  2ZJR F;  1R7J A;  2K40 A;  4F92 B;  2DBB A;  3SEZ A;  3HTU A;  1O57 A;  2VPL A;  1S7A A;  2XAJ A;  2QQ9 A;  2P5V A;  2KDO A;  2MSY A;  1FLI A;  4P1W A;  4PJL A;  4A3D J;  1OYY A;  3CCV I;  4HST A;  2GXB A;  2Q8K A;  2RQQ A;  2IEK A;  3LFU A;  2W85 A;  1SD6 A;  2V26 A;  2V9V A;  1K6O A;  1FJL A;  2YU3 A;  1POG A;  3E5U A;  4B09 A;  2HZT A;  4L5J A;  5LRS A;  2JWT A;  3P5J A;  3SZG A;  1IDY A;  4ZZL A;  1LDD A;  4CGZ A;  3BWG A;  5TGT A;  3PO3 J;  2OA4 A;  3M8F A;  2R5Y B;  4DYC A;  1LE8 A;  2WBM A;  3A01 A;  1ITY A;  3VB2 A;  1T0F A;  1Z7L A;  2ZKZ A;  4Y4R A;  1WKM A;  1PYV A;  2DU9 A;  3B6C A;  3ZMZ A;  4IO9 F;  1HQC A;  2EH3 A;  2ZB9 A;  3I71 A;  1TLH B;  1JKP C;  1QRY A;  2ZXW H;  4XLA A;  4J19 A;  4PJM A;  2EA4 A;  5F64 A;  2HXI A;  2M7B A;  3GTK J;  4XRS A;  2IGM A;  1KQ9 A;  1Y8Q B;  1JI8 A;  1CQT A;  2IS4 A;  1ETO A;  2A6E F;  3LSP A;  1JKQ C;  4A93 J;  5EZG A;  2QZ8 A;  3FDY A;  2LY1 A;  2DT5 A;  4KMF A;  1B72 B;  5IOZ A;  3KLO A;  2CGP A;  4KYW A;  1Z6T A;  5IYD J;  4KT6 A;  3WHC A;  1IUY A;  3EYY A;  3Q9S A;  2DA1 A;  5FKL A;  3VSL A;  2L7F P;  3WTZ A;  4UB6 C;  1ZAR A;  4LOC A;  4BHP A;  2DN0 A;  3BG6 A;  4UUS B;  2XAH A;  5EDN A;  2E1M C;  3RZO J;  2WC2 A;  1PVE A;  1LUJ B;  3BCB A;  3M8E A;  4KNY A;  3EYI A;  4S0H B;  1W7P D;  2J5P A;  2H94 A;  4J00 A;  3K9T A;  3KE2 A;  1R49 A;  1HLV A;  5E17 F;  1TT0 A;  4LK1 F;  1T6S A;  2TDX A;  1MMN A;  3HZJ A;  3CMY A;  2CV2 A;  2XF5 A;  1VQM I;  5IT3 A;  1PUF B;  1AOY A;  2ECC A;  1R5I D;  1D1B A;  5LRR A;  4CZZ A;  3MZH A;  5IT9 K;  2MFZ A;  4BDZ A;  3FMR A;  4A3F J;  5HOO A;  2X85 A;  1MW7 A;  1FP1 D;  4DZP A;  1ZLK A;  1GDT A;  2DJI A;  3ZR8 X;  4Q48 A;  4CXF A;  3CP2 A;  5LFA A;  2FJ1 A;  2R7X A;  4ESJ A;  1MJB A;  1W36 C;  1NHA A;  2XRN A;  4TV7 A;  3ABK H;  3LSK A;  1X3W B;  4KIC A;  4BQN A;  1OCO H;  4IHY A;  2O03 A;  4A0X A;  3BPX A;  2KZG A;  4AYB N;  2IW5 A;  5KHD A;  3BTL A;  4XLF A;  2VAS A;  1EKE A;  4W97 A;  3RKW A;  4ETS A;  4W1U A;  2FA5 A;  1UFM A;  4IHT A;  2F5F A;  2YX4 A;  3C1D A;  3W2A A;  1ZK8 A;  3ZQL A;  1E3P A;  2VL8 A;  3EUA A;  3KYC B;  4OMY A;  3FXO A;  2ELJ A;  1Z1D A;  4YFX F;  3OS1 A;  1FTT A;  5CVU A;  3K70 C;  1YS7 A;  1XN7 A;  2XB0 X;  3WTY C;  3CCE I;  5L3D A;  3I4N J;  4I7H A;  1PP7 U;  1X2M A;  2ZME B;  5FJ8 J;  4RGU A;  3TBI A;  2P4W A;  1VQ9 I;  2R5Y A;  1N78 A;  5CYV A;  3HOY J;  4AM3 A;  3L2C A;  2PQ8 A;  2L7K A;  3VFZ A;  1ZR4 A;  4BDY A;  1EF4 A;  2JRM A;  4L9N A;  2JQ7 A;  2CUJ A;  1N25 A;  3CMM A;  2BGC A;  5BPI A;  2VE9 A;  2OCC H;  3NRV A;  3IH2 A;  3MN2 A;  4UB8 C;  1FNN A;  3ESW B;  1FEX A;  2XAF A;  1KGS A;  4BE2 A;  1D0Y A;  4I2O A;  5ILV A;  2A6T A;  4I0A A;  2BW3 B;  2AQE A;  4FQG A;  3SFZ A;  1B72 A;  3OIO A;  4S05 A;  3TW6 A;  2EIL H;  3RJP A;  1ODD A;  2LBF B;  2VXD A;  1R1V A;  1TTY A;  4BHC A;  1P92 A;  2ZSH B;  4ENJ A;  1FZP B;  3L1P A;  1RET A;  1RIO H;  1AWC A;  2O8X A;  4IHX A;  3OL4 A;  1NK2 P;  4UUS A;  4XBF A;  1WWX A;  2WAE A;  2M8G X;  3W6V A;  2VBY A;  4DNC A;  1VFC A;  4HX4 A;  3F21 A;  1VQ5 I;  1UB9 A;  3CC2 I;  3TQN A;  1DP7 P;  4KIF A;  3DXJ F;  3PL8 A;  3JTG A;  1X1A A;  1N75 A;  2YS9 A;  4LLL A;  3LOC A;  2VJI A;  2L54 A;  3FX3 A;  2LK2 A;  4DIQ A;  1PUF A;  1EH8 A;  1W0U A;  2NS0 A;  3K0L A;  1LPQ A;  3D5L A;  1MBJ A;  4KIG A;  2IGO A;  4QPO A;  4N0B A;  4BBR J;  4RAG A;  5M5X J;  2P0W A;  3B02 A;  1GHC A;  3HOT A;  2ELK A;  2IXS A;  4BKX A;  4RBO A;  4F55 A;  2DOD A;  1ZG3 A;  4RS8 A;  2M0C A;  4I09 A;  1KYW A;  1X1C A;  2Y75 A;  2WAQ N;  1PP8 F;  2VQC A;  2P7C B;  5BS6 A;  4BXU A;  2VT3 A;  5D5U B;  3WTW C;  2Y31 A;  2EIK H;  3BZK A;  3TOA A;  3CME I;  3SDG A;  4D9J A;  2MYS A;  3LAP A;  1HA8 A;  3BR1 A;  4XKV A;  3FHZ A;  2Y9Z A;  2X4H A;  3BG3 A;  2ELH A;  3HRS A;  4XM3 A;  5M5W J;  4ENN A;  2O9L A;  4IOA F;  5LBQ A;  1HW2 A;  3J81 Z;  4NUB A;  5IYC J;  2FBK A;  1UHM A;  1FIP A;  2ISZ A;  3OR1 C;  5FGM A;  2BXZ A;  1OMI A;  2QSG X;  4AIJ A;  3R0A A;  5FRO A;  1WGX A;  1A31 A;  1J9I A;  3HOV J;  1F4K A;  2NNN A;  1D0Z A;  2G7H A;  1MJ9 A;  3TP0 A;  4GXO A;  4HNV A;  2ZME A;  1Y8R B;  3IH4 A;  3NAU A;  2DA5 A;  1BIA A;  2JPC A;  2JTV A;  5IP7 J;  2P6T A;  1EH6 A;  4RAF A;  2EA2 A;  2HOT A;  1YHQ I;  5GAG J;  4X1E A;  2LFB A;  4JYK A;  4P55 A;  2OUM A;  2B63 J;  4HLX A;  1HCR A;  3FK6 A;  3HOU J;  2YUS A;  3GTG J;  1CF7 B;  3ABU A;  4AIK A;  1YJ9 I;  2E1M B;  3RKY A;  2XUB A;  1QBJ A;  2NXN B;  4AUX A;  4HQM A;  2VN2 A;  4M73 A;  5L3F A;  3BR6 A;  1UMQ A;  5B66 C;  2BW3 A;  3R60 A;  4DJA A;  5L3C A;  3BTC A;  3VYR B;  3C2B A;  1SVO A;  1Z3X A;  1OKR A;  4ZTJ A;  2COM A;  2F4M B;  2LBF A;  3ZQG A;  1WJA A;  1Z05 A;  4XLC A;  3SZT A;  1VQ8 I;  1XGM A;  1HDP A;  1VQL I;  2ZBK A;  2CWE A;  1JKO C;  4XNF A;  1SVM A;  4FHT A;  4HF0 A;  5DM7 F;  4YIR X;  3MKL A;  3CJT B;  3FF5 A;  3U2R A;  1WJC A;  3J81 K;  3LAJ A;  3RSN A;  2VBX A;  4IRG A;  4X0G A;  4G6D A;  1FOY A;  1ENH A;  1SFK A;  1TT5 B;  3HGG A;  1FYL A;  4M74 A;  1W4M A;  2MLK A;  3TO6 A;  4B44 A;  4YRV A;  4F91 B;  1J0R A;  1GXQ A;  1K7A A;  2IRF G;  3PFI A;  1Z0X A;  2L9S A;  3BTI A;  3DFG A;  4IZZ A;  4HDV A;  2GIZ A;  2DFE A;  3S17 J;  5E18 F;  1KU7 A;  1G3T A;  3G3Z A;  3GTL J;  4U88 A;  2P81 A;  2NVY J;  1EJ9 A;  3KEO A;  3DEU A;  3VOD A;  1ZAO A;  3OYJ A;  4QSH A;  2AHQ A;  2A5W A;  3JAM Z;  4LGW A;  1TWG J;  4HNT A;  5FB2 A;  4CSW A;  2LP0 A;  3S15 J;  3JRE A;  2J5O A;  4HBL A;  2A3S A;  2W84 A;  3PQK A;  2CYY A;  1ZG1 A;  3E6D A;  3FWE A;  1I1S A;  3CJQ B;  3N05 A;  2BYV E;  2WY7 Q;  3FBN B;  4EV0 A;  5LHH A;  5CVR A;  1IV6 A;  1GT0 C;  3M8J A;  2WAD A;  1TQM A;  2IS6 A;  2DYS H;  2EBI A;  2O5R A;  3LSJ A;  3JTH A;  4O6J A;  1NK3 P;  5F1J A;  5E3N A;  5FLX K;  2KRC A;  3GFL A;  3LA2 A;  3VEP A;  3LMM A;  5C4J J;  3OYD A;  2X1C A;  1XGS A;  4AC0 A;  3BR0 A;  3ZGK A;  1ETQ A;  2QM3 A;  3GVA A;  5E79 C;  4RB1 A;  3UR3 C;  4ZDL A;  2PMH A;  3PNY A;  2RGV A;  4RAY A;  2LSO A;  1VI0 A;  2GXG A;  3TO9 A;  3PIO F;  2X6O A;  2AO9 A;  1HKS A;  1BL0 A;  3QYB A;  4X6A J;  1ZLJ A;  3OYN A;  5EEH A;  1CF7 A;  2NOG A;  5D4R A;  5IY5 H;  1J2X A;  2L7M P;  4UVB A;  3JW4 A;  1H88 C;  2M0M A;  3BLY A;  2O61 A;  4G7H F;  3ZQH A;  2HPM A;  3WOD F;  5CLS A;  1F5T A;  1O3Q A;  1P7I A;  2K9Q A;  2MG4 A;  3JAM K;  5LHG A;  4HV5 A;  3IV5 A;  1IF1 A;  2VOP A;  2L7Z A;  4ABZ A;  4UUT A;  4XON A;  3AG4 H;  3L2R A;  5JFR A;  3A2K A;  1X19 A;  1TBX A;  3FK7 A;  2Z33 A;  3GTM J;  2BY3 A;  4XLH A;  3IUO A;  2HFH A;  4GO1 A;  4PGH A;  4N9I A;  3CP8 A;  1BJA A;  3Q0W A;  1RKT A;  2E1O A;  4M71 A;  3QP6 A;  3GFI A;  3S3O A;  5JHF A;  3A1Y A;  4G12 A;  3ELK A;  2O3F A;  1J75 A;  3HPG A;  2JUG A;  3GFJ A;  5FD6 A;  1W36 D;  1MNM C;  5KAF C;  3O2P E;  1WH7 A;  2K9S A;  4PCQ A;  2XVC A;  3ASN H;  3MMY B;  5K1Y A;  4GFB A;  4LLG F;  3OYB A;  1DU6 A;  4RLQ A;  2M34 A;  4BHB A;  4ASN A;  1P9Q C;  5C3E J;  3C3W A;  5KNL A;  1BI0 A;  1SC7 A;  2ICW G;  2R93 J;  3RQI A;  4LLN A;  3QRF F;  4A0Z A;  5DTD A;  4BQQ A;  1T56 A;  4DBQ A;  2EV0 A;  2KIU A;  3OS0 A;  3OYA A;  3HUG B;  4IHS A;  2KL4 A;  3OMY A;  2KZV A;  1FBS A;  4JQF A;  1RI7 A;  1IV8 A;  2QEN A;  3K70 D;  2F5E A;  1S5L C;  1MIJ A;  3OSG A;  3K10 A;  2R7O A;  3ERE D;  4IQJ A;  2BXY A;  1ACI A;  2TRT A;  1LJ9 A;  1A36 A;  2NRA C;  4NC6 A;  3ZXS A;  3KP7 A;  2QA4 I;  3RZD J;  2FE3 A;  1K78 B;  1JUM A;  5ICC A;  1ZHF A;  1I6X A;  4JOM A;  3BDD A;  4YEJ A;  3S1Q J;  2H8W A;  2XIG A;  4CH7 A;  2IGK A;  3O8G A;  4NDL A;  2ZSI B;  5C4X J;  2JZY A;  1R4M B;  2XGX A;  3HB9 A;  1P4W A;  2E2I J;  1F43 A;  1FMV A;  4KIT B;  2XHK A;  1IO2 A;  2VQH A;  2Z99 A;  4DOZ A;  4F3Q A;  2XAS A;  3BRO A;  1KU3 A;  3Q3S A;  4UUV A;  2K7L A;  2KP6 A;  4ZC3 A;  2OCE A;  4H0E A;  1AKH B;  2JJ7 A;  1SAX A;  1X4O A;  2Z9O A;  2F2E A;  3DBH B;  1GV5 A;  3DKY A;  1BR1 A;  4WCG A;  3S16 J;  5B5E C;  4UVC A;  2I8D A;  5EGO B;  1JJ6 C;  4D0P A;  4LIU A;  1VQO I;  2DFH A;  1IN7 A;  2X0L A;  2M87 A;  2Y2Z A;  1L3L A;  3K1M A;  1MZB A;  5FRN A;  1JXS A;  3OV8 A;  3AKZ A;  1YTY A;  2JMW A;  2IA0 A;  3ABL H;  3K6G A;  3HDD A;  4IEJ A;  3ZQQ A;  4RGR A;  3LSI A;  1D8J A;  2DT7 B;  2H6B A;  1ZR2 A;  2BY2 A;  3VDX A;  1TL8 A;  4XSZ F;  3BC8 A;  3K4B A;  1UG2 A;  4U0W A;  2Q0O A;  4XL9 A;  2LH9 A;  3SDB A;  1MH4 A;  4IHW A;  2P5K A;  3OY9 A;  2OTL I;  3ZMV A;  3E5Q A;  1K4S A;  4D5C A;  5JLX A;  4MNU A;  1O3S A;  2A61 A;  3BR2 A;  4ENM A;  3U1D A;  3BY6 A;  5E1X A;  1USS A;  1XMX A;  1ETK A;  6PAX A;  3JRA A;  4WXC A;  3PNT A;  1JUS A;  3JRI A;  2GZW A;  4MLO A;  1LFU P;  1IRF A;  2JUC A;  3ZQ7 A;  1V55 H;  1B9N A;  2XF6 A;  1G6N A;  2VQG A;  3I0T A;  5E3L A;  4RB2 C;  2ZXH A;  4I99 C;  2QUF A;  4BUP A;  5FD5 A;  3LFK A;  4FE4 A;  3V8J A;  1HW5 A;  4AU7 A;  1FTZ A;  5CQG A;  1D0X A;  1IGN A;  2K9M A;  1KYZ A;  2XB5 A;  4FIS A;  3HUG A;  1JTY A;  3H9J A;  4HZF A;  4DQ2 A;  3M3Y J;  1W5T A;  2X48 A;  3CCR I;  1B59 A;  1WRJ A;  1LFP A;  3KIO A;  5FKN A;  2MBF A;  1OR7 A;  3PO2 J;  4Y3O A;  4XR6 A;  1DQU A;  5F08 A;  4EJW A;  2BHY A;  1ULY A;  1VQN I;  5TJJ A;  3HOS A;  1JT6 A;  3ZCO A;  2MLG A;  3C18 A;  4EMS A;  3I56 I;  4V2G A;  4ON0 A;  2HOE A;  2DTZ A;  1DGW Y;  1K78 A;  1WHU A;  1WJD A;  2Z1D A;  1HXD A;  1ZEL A;  2UV1 A;  4M3G A;  1R1T A;  4OIQ F;  2HU9 A;  1WJE A;  1ZYR F;  3S14 J;  1W1W E;  2V1N A;  1OCZ H;  2JA2 A;  4IL6 C;  3F23 A;  4II3 A;  3M9A A;  3BQZ A;  2R7Z J;  1S29 A;  2ZXI A;  4FX4 A;  3V8K A;  2M2E A;  2Y69 H;  3M1E A;  2YSR A;  2FNA A;  2HI3 A;  2JPB A;  3WU0 A;  3PSF A;  1AKH A;  1IN4 A;  3F8B A;  2FBH A;  5F1R A;  5IP6 A;  1S8N A;  1S6L A;  2WAQ A;  4NHJ A;  3K4J A;  2KLO A;  2EQR A;  4HW0 A;  5EGO A;  3BJO A;  1UHW A;  2ESH A;  3L2U A;  3GTP J;  5IT9 Z;  1X4P A;  2M45 A;  3CO7 C;  4RB3 C;  4L9J A;  2DDA A;  3OL3 A;  4RM3 A;  1J7K A;  2DMN A;  1IN6 A;  2CU7 A;  2K27 A;  3K69 A;  4G8X A;  2NS7 A;  5L3E A;  2JA5 J;  2GM4 A;  1LDK B;  3TDZ C;  5DCF A;  5HLI A;  1IW7 F;  3PSI A;  1TQI A;  4G7Z F;  1YS6 A;  5CPR B;  2DA7 A;  3H0D A;  3Q5F A;  1TW2 A;  2ZXJ A;  1JHF A;  2IVM A;  3FXQ A;  3QWL A;  3S2D J;  3KCC A;  1R58 A;  3R6S A;  5GTI C;  3BJA A;  1ZQ3 P;  2VUM J;  2XGD A;  3DF8 A;  4DBR A;  1S72 I;  4Y13 A;  1ZH5 A;  3KP3 A;  2G9W A;  2LTP A;  2KT0 A;  2X1E A;  3KZY A;  2YU9 J;  3T8T A;  5K5O A;  1ONV A;  2D1H A;  1KU9 A;  4D5F A;  2QKL B;  2VKE A;  3PIP F;  1PJR A;  4G94 A;  3LQQ A;  5ICG A;  1FY7 A;  5J40 A;  2OZU A;  2CQN A;  3HGY A;  1G59 A;  1U3E M;  2IGN A;  2K4B A;  2KIS A;  3HSF A;  3VYS B;  4G9Y A;  2A6H F;  2VQL A;  2L5Q A;  1R6R A;  2VT2 A;  4I76 A;  3K2Z A;  4U7B A;  4YG2 F;  4A0Y A;  2IPQ X;  3CCJ I;  5GP9 A;  1FBQ A;  2VON A;  2CG4 A;  2LY2 A;  2VI6 A;  3PNV A;  1XB4 A;  3GXO A;  1DDN A;  2E19 A;  1XGN A;  3CLQ A;  4OMZ A;  4LMY A;  4ZDO A;  4KIB A;  2WA0 A;  2QLZ A;  4O3M A;  4XSX F;  3U21 A;  1O7L A;  3M07 A;  3A03 A;  3QYF A;  3PUF A;  3MAJ A;  2EIN H;  4XKC A;  2B9S A;  4FE7 A;  3S93 A;  4D7M A;  1E3O C;  2R5Z B;  3BCA A;  3CDH A;  4UXN A;  3W3C A;  3BZ6 A;  1SEU A;  5FRM A;  2E2J J;  2DI3 A;  2AS5 F;  3LQR A;  3RPQ A;  3R61 A;  3F8C A;  3MZ8 A;  3QPT A;  3DEE A;  1ETW A;  3NWT A;  1K4T A;  2GQQ A;  1TWF J;  1UEL B;  4M3F A;  2X6X A;  1HBX G;  1BM9 A;  2FNP A;  4DYR A;  1FYK A;  2XPW A;  5FKM A;  1SFO J;  4Q4Z F;  4MTD A;  4BE1 A;  4C2T A;  3CLO A;  3K4C A;  4XN0 A;  4P96 A;  1S7O A;  5AIP A;  2P7V B;  4J01 A;  3AFH A;  3EQL F;  2E35 A;  3VOE A;  1Y1W J;  3BTJ A;  1HF0 A;  5TIS C;  3ISP A;  4A3E J;  1YOV B;  3CES A;  3HOZ J;  1SD4 A;  4Y7N J;  2VKH A;  4RDU A;  1ON2 A;  3ZMD A;  3LSM A;  1MMG A;  2HWV A;  2OAZ A;  2EJR A;  2NVU B;  4HYE A;  2Z16 A;  1D3Y A;  3KZI C;  3PFY A;  1OPC A;  5CQE A;  2X51 A;  2CFX A;  3K4N A;  4EM2 A;  2LC2 A;  1QZE A;  5EEG A;  2VPR A;  1YW7 A;  2GOM A;  2HGC A;  2NOJ B;  4UNO A;  4BS9 A;  5E1W A;  1SMT A;  3ML6 A;  2HKX A;  4IPA A;  3MWM A;  5DD4 A;  3GX4 X;  3L7W A;  5M3F J;  4JX4 A;  2RDP A;  1JKR C;  2IBD A;  4DW6 A;  4PSW A;  3WTS C;  2R0Q C;  2O0Y A;  2EB7 A;  3J80 K;  1Y56 A;  2V1U A;  4M6X A;  3P7N A;  3CC7 I;  2ME0 A;  2DMU A;  1UAA A;  2RQP A;  1OLT A;  2KJB A;  5HS9 A;  1I39 A;  2GA1 A;  2HVR A;  5D8K B;  3IKT A;  2WB1 N;  3QOD A;  2CUE A;  4BYY A;  2EZK A;  2BVL A;  1JT0 A;  4GGG A;  3RKX A;  2HQA A;  1G2H A;  4EQQ A;  2DTR A;  5DYM A;  4CUG A;  1MD0 A;  1MJA A;  3HOX J;  1Z3Y A;  4XOR A;  4FAS D;  2ZJ2 A;  1DP3 A;  2A07 F;  2K9N A;  2RN7 A;  2ZO4 A;  1FX7 A;  2V4J C;  4HPQ A;  3KYL A;  3ZQI A;  5JHU A;  3W2V A;  5AON A;  5F27 A;  1KQ0 A;  2L4A A;  1GXP A;  2DJN A;  2V1X A;  3NWS A;  2QQ8 A;  1R4N B;  2HR3 A;  2TCT A;  1V5E A;  5FKO A;  2K9L A;  2ADU A;  4M3B A;  5B3S H;  4PZJ A;  3I3L A;  4IOC F;  2QYO A;  4A5M A;  1I6H J;  2QGU A;  2L9V A;  1MND A;  2DOA A;  2V79 A;  2R5Z A;  2R7S A;  2DAO A;  1R23 A;  1BN5 A;  4M3D A;  5M5Y J;  5DM6 F;  4BU2 A;  2IT0 A;  4CCO A;  2V9P A;  3R0J A;  1S9H A;  4BE0 A;  3H9Q A;  2M4G A;  4PFP A;  4H4K C;  3CJR B;  4L0Z B;  4YII A;  3E0J B;  3QU3 A;  1IUF A;  2JSC A;  3S1N J;  2PEX A;  5DUK A;  2LD5 A;  1ZRC A;  1G3W A;  1XSV A;  3CF2 A;  2NVQ J;  2CRG A;  1IXC A;  2Y48 A;  4CDG A;  1TW3 A;  2XAG A;  5E3O A;  2IP2 A;  1R9T J;  3A02 A;  2DYR H;  3LA7 A;  3RYR A;  5J4V A;  2F6C A;  5IOY A;  4BEH B;  3JRF A;  2VKD A;  2A05 A;  4F7Z A;  2LLK A;  3HSE A;  2BE5 F;  2CH0 A;  1B4A A;  1OR7 C;  3KEY A;  3OR2 C;  1R5G A;  4CIC A;  2M5W A;  5DD8 A;  3DQV C;  5E8I A;  1U9O A;  2PMZ N;  1TWA J;  4IVN A;  1QZY A;  2FF4 A;  2XPV A;  2ZNZ A;  3DWL E;  4LIV A;  3ZN1 A;  1U8R A;  1STZ A;  2LDU A;  4EEF G;  3MKY B;  5FLV A;  2M9H A;  5HS8 A;  5ICF A;  2BZT A;  3WTT C;  5HS7 A;  2HZD A;  1IRX A;  1ON1 A;  3TO7 A;  1KQ8 A;  4RMN A;  2LNB A;  5BQT A;  2UXX A;  1UG0 A;  3H3V K;  1QU3 A;  1WPK A;  3K1P A;  2LRE A;  5FLX Z;  1MBG A;  2WTE A;  3ULQ B;  3KP5 A;  1OYI A;  1RES A;  4ZYE A;  3KP4 A;  1P2F A;  3MD2 A;  3GYH X;  4YFK F;  2E1N A;  3DPT A;  4B43 A;  2RVC A;  2RNG A;  5DDG A;  1U6G A;  2ZFW A;  1R1U A;  3ZP5 A;  3CCM I;  1LDJ A;  2Y0S N;  2M1B A;  2EK5 A;  3RTR A;  5LLQ A;  2LKX A;  4B8X A;  2QWW A;  3FIW A;  2R7U A;  2CQQ A;  3FMS A;  5F0F A;  3EET A;  2V1D A;  1O3R A;  2MD0 A;  5HDG A;  2CMP A;  2DK5 A;  3S3M A;  3HKZ N;  3SJM A;  1Z21 A;  2LRD A;  3SEQ A;  1J5Y A;  1T95 A;  2H1L A;  4IQ4 A;  1X3U A;  3CD6 I;  2VJJ A;  5FKK A;  4PJJ A;  3FXL A;  4DYQ A;  4A69 C;  1J09 A;  1M1E B;  3DEW A;  1BA5 A;  4DZJ A;  2BV6 A;  2EFP A;  2HTS A;  4LFU A;  2V9K A;  1Y6I A;  4GRI A;  2K4J A;  4ZYD A;  2DA2 A;  2FX0 A;  3DBL B;  1Z7U A;  3O6B B;  5LGU A;  3H92 A;  4NNJ A;  1IXS B;  3ZOB A;  2D5V A;  1E17 A;  2KRF A;  3IKV A;  3EUK L;  2VKV A;  1Y39 A;  4C30 A;  3H5R A;  2DFF A;  4LIT A;  2LF7 A;  2LMD A;  2X6Y A;  4WXD A;  3KFW X;  3OYM A;  2PI0 A;  4KDP A;  1QHG A;  2R7V A;  2KRH A;  1V3F A;  5HLH A;  4BEH A;  2A69 F;  1SMY F;  1YJW I;  2PN6 A;  1V5F A;  4ITV A;  5KVR A;  2DOE A;  3WGI A;  2HDW A;  2EZL A;  3BPV A;  3P9I A;  2FMY A;  2M7A A;  3ZMU A;  3N4M A;  4ZYH A;  3R4K A;  4A3B J;  4UY8 I;  1EV7 A;  2D2W A;  2L2O A;  4AIH A;  5JR3 A;  4XN3 A;  2VOD A;  2BY0 A;  3VPR A;  3W6J B;  3ECO A;  5AIQ A;  5M3M J;  2JA8 J;  3WGG A;  2W25 A;  1APL C;  3H0G J;  1GUU A;  3ZMS A;  4OU0 A;  4ZZD A;  1LQ1 A;  2HQ5 A;  1X2N A;  2KHM A;  3H36 A;  2XV4 S;  1B1B A;  1JGG A;  2HS5 A;  2Y30 A;  3GUD A;  1FSH A;  4ZYA A;  5EF6 A;  3MFK A;  2WV1 A;  1UJ8 A;  1WVR A;  4OIP F;  2ID3 A;  5J8C A;  4IKF A;  4PFO A;  5K5Q A;  5C44 J;  3S2W A;  3E97 A;  1HW1 A;  3FKI J;  3GZ5 A;  2JA7 J;  3HG9 A;  1TP4 A;  3QPS A;  4L5I A;  1BOA A;  2W82 A;  2PFB A;  4BQO A;  5K7H A;  1HKQ A;  3KLN A;  2WY8 Q;  5EYR A;  3IP4 B;  4QWQ A;  5KAI C;  4Y52 J;  3X2Q H;  1IZ1 A;  1I1G A;  2GBY A;  3N97 A;  2XAU A;  1D8K A;  5BMZ A;  5D6E A;  3J7Z I;  2HVS A;  3S32 A;  4UVA A;  1JHH A;  1BW6 A;  3HRT A;  3V7C A;  4E7L A;  3WTX C;  2UUZ A;  3E6C C;  4B47 A;  4JK1 X;  5EZH A;  4A3M J;  1IC8 A;  3TED A;  3G2B A;  5E3M A;  1LVA A;  2LF8 A;  3OYF A;  3LSH A;  1KU2 A;  1MH3 A;  3ASO H;  3Q0U A;  2RV8 A;  3CDL A;  3V4G A;  4RAZ A;  2R7T A;  2HOS A;  2CQK A;  2QBY B;  1MMS A;  2FOW A;  3D5R C;  3BR5 A;  1HC8 A;  3ONQ A;  4QIW N;  3G1L A;  4N9H A;  5K7F A;  3I64 A;  3S2H J;  3H5A A;  1Q1H A;  5B1A H;  4M72 A;  4MIM A;  2HNH A;  3V7S A;  1OCP A;  3CJN A;  1O7F A;  1WI9 A;  2E1C A;  4E4H A;  1Q1V A;  2VE8 A;  3P9K A;  1P6R A;  3RIR A;  4Y15 A;  2F5D A;  2KFD A;  2XSJ C;  2AXT C;  1E0E A;  2JK3 A;  3SYT A;  5DCM B;  1XG1 A;  2KJC A;  2R7R A;  1F9N A;  2BOL A;  4NC8 A;  2GLO A;  3CMA I;  2F4O B;  1FMW A;  5CJ9 A;  2DXI A;  3DTE A;  4EGZ A;  1VF9 A;  4QTR A;  4KMU X;  3HBL A;  4N4N B;  4WF2 A;  5ERI A;  2ZFU A;  3FIS A;  3OSF A;  1A6Q A;  4BJ5 C;  3OYC A;  2W48 A;  3REO A;  3CQZ J;  3DPL C;  1XMA A;  3EUH A;  4OAY A;  4WX9 A;  3PJR A;  2EIM H;  1B6A A;  5F6F A;  4CCM A;  4BJ6 C;  1JGS A;  2GIV A;  1GVD A;  5FO5 A;  2CUZ A;  5D5W B;  4C2M J;  3CCQ I;  2E71 A;  2D45 A;  3MCZ A;  5JVG F;  4ZH4 F;  3OIQ A;  4AYB A;  3F8M A;  3JRH A;  1LEA A;  5HOD A;  3M1C A;  4GYG A;  3H1C A;  1QO0 D;  4ENK A;  1DPR A;  2B0L A;  2OQG A;  3WTV C;  4L9T A;  3OS2 A;  2DPU A;  2CV0 A;  3S8P A;  2F5V A;  3VYU B;  2LVS A;  2IA1 A;  3U1K A;  1H89 C;  2CW8 A;  1YIJ I;  5A2Q Z;  1ZRF A;  5K7Z A;  4BJT A;  1WZ2 A;  1BJZ A;  1XCV A;  4EAT A;  4RA2 A;  2KIQ A;  3IRQ A;  4HDU A;  1V5G A;  2RRE A;  1MBH A;  1VZ0 A;  3QAH A;  3RQ4 A;  1OQY A;  1RR8 C;  2LOO A;  4Z2Y A;  3FXJ A;  2AQF A;  4C9Y A;  2UZK A;  5DS9 A;  1ZGA A;  2E5N A;  2EPF A;  4Q47 A;  3RPU A;  4ANJ A;  4BXX J;  2H1K A;  1R5H A;  1MSE C;  1NG7 A;  1HDD C;  4BAC A;  3TW7 A;  5F04 A;  1ZG5 A;  3J7A O;  4JX5 A;  1YW9 A;  1B8I B;  3QU6 A;  3EPZ A;  2JRT A;  1YRN B;  1I3A A;  4Z6Y A;  1P7J A;  2V6C A;  2VB6 A;  1SFX A;  1A6I A;  3OOP A;  3QOP A;  3C2G A;  2LR8 A;  3CTA A;  3OWT A;  3BG5 A;  3GFM A;  3CO6 C;  3GTJ J;  3L00 A;  3COA C;  2HDC A;  4I98 B;  1AU7 A;  1WSU A;  1I50 J;  3FMQ A;  3D0S A;  4MQ9 F;  4OIO F;  2QBY A;  2ID6 A;  3IL2 A;  4C3I J;  3L9F A;  3JSO A;  4HNU A;  2M30 A;  2X9D A;  1F36 A;  2L01 A;  2PBI A;  1ZTR A;  3KZZ A;  2HYJ A;  3T0Y A;  3MQ0 A;  2OJE D;  2QQA A;  3TL4 X;  4I0B A;  2CW7 A;  3CCS I;  3MZY A;  1W7P B;  2VJ5 A;  4MGR A;  2EV5 A;  4PSX A;  3ZMT A;  1FPQ A;  1O3T A;  2W24 A;  2WB1 A;  2PLY A;  2QSF X;  2CQ7 A;  4A3C J;  4BXF A;  2L9R A;  2FUG 2;  5A2Q K;  4L18 B;  2K86 A;  4HLY A;  1U5T B;  3IRR A;  3TMO A;  1BBY A;  5DCM A;  3G1O A;  1YX3 A;  2DA4 A;  4HOB A;  1KZH A;  2VIX A;  3QPL A;  3O8H A;  5LGN A;  1FC3 A;  1FP2 A;  3LNQ A;  1XSX A;  2DT6 A;  4U0V A;  1LNW A;  2DMP A;  2C6Y A;  3CUQ B;  2F4I A;  1XTA A;  2GA2 A;  4E7I A;  4EM1 A;  4F93 B;  1TWH J;  3WE2 A;  1XDU A;  1IDZ A;  4EJU A;  4U7D A;  1RRJ A;  2HKO A;  4RB0 A;  4RGX A;  2BY1 A;  1RZ4 A;  1DPU A;  3FXU A;  1D1A A;  2OD5 A;  2JSP A;  3GLX A;  4KT5 C;  4E7J A;  2CQX A;  1REP C;  4HA8 A;  2DA3 A;  3WE3 A;  3TGN A;  3AL0 C;  1YIO A;  3E6M A;  3WHB A;  1BI1 A;  4A3L J;  1CGP A;  4IX7 A;  3E5X A;  2XC7 A;  4L0Y B;  2HYF A;  1WI3 A;  2XGC A;  4NC7 A;  2HEO A;  1A5J A;  4M9X A;  1QPI A;  2COB A;  2VLA A;  4PJ0 C;  4MHG A;  2OPT A;  1OCR H;  1T98 A;  1YE9 A;  4FET A;  5L3G A;  3FKJ A;  1R71 A;  1UCR A;  3IWZ A;  2G7U A;  2LG4 A;  5IYB J;  4BGD A;  1W0T A;  4GCV A;  4CHU A;  1WJB A;  3H3Z A;  2RC4 A;  3GW2 A;  3HOW J;  4E70 A;  4IHV A;  3U9G A;  2NNY A;  1TC3 C;  2BVM A;  2NVX J;  2L0K A;  2BBY A;  5ILS A;  1XS9 A;  1B8I A;  1YRN A;  2PMZ A;  1G3Y A;  2EIJ H;  3KEQ A;  5H20 A;  4KN7 X;  5D4S A;  4P9U A;  1PUE E;  2DQL A;  2OQR A;  2DMT A;  3E1S A;  4UHT A;  5IPA A;  3UNG C;  4A3K J;  3CCL I;  5H6R A;  4E7H A;  2LKS A;  3MEX A;  1E3H A;  3V7R A;  1K79 A;  4E7Z A;  3HPH A;  2ISY A;  4BNC A;  4LG0 B;  4MTE A;  1UHS A;  3I4P A;  3L09 A;  2ETH A;  2FQ4 A;  4XMY A;  1W7P A;  3MKZ A;  3K4K A;  2ZNY A;  4IF4 A;  3F72 A;  2FOK A;  3VSK A;  3AAF A;  3CF5 F;  2JA6 J;  3DBR B;  4BL0 B;  4HF1 A;  4KUM A;  3DPU A;  1FOK A;  5GPA A;  5LHI A;  1YW8 A;  2Y0S A;  4XQF A;  3KP2 A;  5F0C A;  4N4O B;  2W1O A;  1QVU A;  3ZRG A;  3OYL A;  1U5T A;  2L9N A;  3GTQ J;  3M4O J;  5BNG A;  3TDU C;  3J80 Z;  4WWC A;  4JX6 A;  3L2Q A;  3HKZ A;  3CCY A;  3I55 I;  4AD9 A;  4CZC A;  1L0O C;  3I58 A;  3OYG A;  3G6E I;  4V19 K;  2QSH X;  3FBI B;  2PJR B;  5J6X A;  2E5Z A;  3CUQ A;  4BY1 J;  2AXL A;  5E8G A;  3GZ6 A;  5HDK A;  1LB2 A;  5E1Z B;  2V7F A;  2W00 A;  1F1Z A;  5GTH C;  4KFC A;  5B1B H;  3DU6 A;  2KDZ A;  1U2W A;  2IS1 A;  5J1R A;  1ZRE A;  2DLL A;  2DCE A;  4M6Y A;  4ZJZ A;  3AG2 H;  3MVP A;  4Y17 A;  4CA0 A;  2MGQ A;  1A35 A;  4PJN A;  2O7O A;  3K7A J;  2IJL A;  4A3J J;  5HNF A;  1ZKG A;  1JJ8 C;  3H35 A;  3JCU C;  4Q5S F;  4M9Z A;  2ME6 A;  1Z6R A;  2R7Q A;  3O3K A;  3IAS 2;  4RGS A;  4A6D A;  1K61 A;  2EFO A;  1ETV A;  3DKW A;  2HDD A;  3WU2 C;  1Z91 A;  3I4M J;  3BR3 A;  4HAM A;  5HDN A;  1SVL A;  4HX7 A;  3D1N I;  2MC3 A;  4D7N A;  3I9V 2;  1LKX A;  1Y0N A;  4MO7 A;  4EVI A;  5LGT A;  3QP5 A;  3OYH A;  3FZV A;  3JRG A;  3V8L A;  4C2U A;  1XSD A;  4E7K A;  1FBU A;  2KPM A;  5LD2 C;  1OJL A;  3S3N A;  2FSW A;  4K2E A;  1I3Q J;  2EFQ A;  4AID A;  1RPW A;  2M3A A;  5JI6 A;  2A68 F;  5EG0 B;  4JBA A;  3A0B C;  2JT1 A;  5H2F C;  4YFN F;  1U8B A;  3BJ6 A;  3KX2 A;  4G6T B;  3EUH C;  3GME A;  1TNT A;  1XX5 A;  4LG3 A;  2OTJ I;  1LFB A;  4UV8 A;  4KA4 A;  3AG3 H;  2NVT J;  4EJO A;  3K2A A;  1X1B A;  4LB5 A;  4B3A A;  1SD7 A;  1FOW A;  2DA6 A;  2FBI A;  2E36 A;  2O6G E;  4E6K G;  4LG0 A;  4G7O F;  3BQY A;  1W5C C;  3UKG A;  3F3X A;  2Z3Y A;  3ECH A;  3TOB A;  1SD5 A;  3V42 A;  5CVV A;  1XCB A;  3RYP A;  1FSE A;  1YFH A;  4D1Q A;  1IRG A;  1ZGW A;  2DK8 A;  3S1M J;  1ETX A;  3IHU A;  4CYD A;  2DFI A;  4V2F A;  1TNS A;  1ZGJ A;  3WG7 H;  5LEJ A;  2ZC2 A;  1R22 A;  3BG9 A;  2HTJ A;  2WV0 A;  4XLN F;  4HG2 A;  5ICE A;  3IH3 A;  4A12 A;  1KON A;  4MFD A;  4ZYG A;  3FXK A;  1D1C A;  2MW8 A;  1QNT A;  2VOO A;  3K1N A;  5IP9 J;  5ED4 A;  2Y9Y A;  4MEY F;  1FT9 A;  3ABT A;  4KJZ A;  3AL0 B;  4XIC A;  1JUP A;  4LD5 A;  3OIP A;  4B48 A;  1T08 B;  4I6Z A;  2PJR A;  2QEX I;  4OWR B;  2GOX B;  5DUI A;  2ZCW A;  4XID A;  1X3Z B;  1T39 A;  2X1D A;  3E6B A;  1BR4 A;  3L2W A;  5FLM J;  5HLT A;  4A3G J;  1P4X A;  3G1M A;  2F5C A;  3B6A A;  3L2V A;  4AVZ A;  2XSD C;  4EJT A;  3W2W A;  2R7F A;  5BPD A;  5HLG A;  3AG1 H;  2R7W A;  3CZ6 A;  1FYM A;  3SFI A;  3QQA A;  3I53 A;  4PUS A;  3TP3 A;  4B3X A;  1IN8 A;  4R1H A;  2PJP A;  5GPC A;  3OYI A;  3DLA A;  4FT8 A;  3SHF A;  5CKT A;  1N77 A;  4XK4 A;  2OF7 A;  2VC0 A;  2R92 J;  1QQI A;  3GF2 A;  1K83 J;  1MSF C;  2R3S A;  5J3L A;  1IAW A;  3G71 I;  1BC8 C;  1SFE A;  2YR2 A;  3HHH A;  1MNE A;  4HV6 A;  3ZN0 A;  1SAN A;  1WJF A;  3WG9 A;  4AWX B;  4CCL A;  2DPD A;  9ANT A;  3DTI A;  1QA6 A;  4MEX F;  1RR7 A;  4CCK A;  2N8G A;  2BEO A;  3FHN A;  4EM0 B;  1O4X A;  2EFW A;  3NQO A;  3J7A Y;  5EG0 A;  2IS2 A;  1NTC A;  3RI4 A;  3DCF A;  1WH5 A;  4PK4 A;  1QVT A;  3ZQF A;  4WK8 F;  1VQP I;  1MDM B;  1V54 H;  1ETY A;  2B7E A;  5J8F A;  1VND A;  1E2X A;  1Z9C A;  3F22 A;  1BI3 A;  2YX7 A;  2JN6 A;  2OU2 A;  2VJ4 A;  2VBZ A;  4HSR A;  1U78 A;  4ESF A;  2O8K A;  1R36 A;  3ABM H;  1EH7 A;  4YEL A;  4NBQ A;  5L3B A;  3BP8 A;  3IAM 2;  3GZN B;  4I02 A;  3G73 A;  1W5S A;  2W57 A;  4AVP A;  2EFN A;  1BIB A;  1BI2 A;  5E20 A;  3LSR A;  4PDK A;  2RNJ A;  3NEU A;  1ZRD A;  2P6S A;  3CDI A;  1KA8 A;  2I5U A;  3KP6 A;  4A2U A;  5HNH A;  5HVQ C;  1WFX A;  2CFO A;  4HEA 2;  2VC1 A;  4FCY A;  3MKW B;  3GCM A;  2LKP A;  3Q0V A;  3C7J A;  1QPM A;  2XRL A;  3F6O A;  1WCM J;  4LB6 B;  4IRH A;  1X58 A;  4GDF A;  4XRF A;  1SFU A;  3SZP A;  2JVH A;  1PDN C;  1IJW C;  2XPU A;  1SAU A;  1J59 A;  1AHD P;  1T0F C;  3H3U A;  4U0Y A;  3ZPL A;  3T8R A;  4Y33 A;  2M8E A;  3T1B A;  2NYX A;  4RLF A;  1UZC A;  3F9K A;  2K3P A;  2PX9 A;  2HPI A;  2K3F A;  2XGE A;  3P9C A;  4BH9 A;  5GAD J;  1QGP A;  5J1U A;  3SXY A;  3LST A;  1T8I A;  2QCO A;  3IWF A;  2UXN A;  2XDV A;  2CSO A;  1X1P A;  1LEB A;  2I10 A;  3C2H A;  2PMU A;  1H9G A;  2LYC A;  4S04 A;  1AA7 A;  2MC4 A;  2E7W A;  3KET A;  3A0H C;  2FEZ A;  4M9S A; 
#chains in the Genus database with same CATH homology
 2P8T A;  1RNL A;  1H0M A;  1YQA A;  2EWN A;  2FRH A;  1FWZ A;  4KN4 X;  2CW0 F;  3GWZ A;  4OOI A;  2DO7 A;  3RDI A;  3HRM A;  2H09 A;  4HF2 A;  3DV8 A;  3TKY A;  1DUX C;  2EV6 A;  1U5T C;  2ACJ A;  3I5U A;  5LEK A;  4A6E A;  3LWF A;  4IJA A;  5D5V B;  1TQP A;  3FM3 A;  1T2K A;  4P9F A;  1I5Z A;  4R79 A;  2FU4 A;  3CUQ C;  3ROU A;  5DEQ A;  1MDM A;  1YG2 A;  2Z5U A;  2KKO A;  4OIR F;  2D1V A;  1G4D A;  2XRO A;  1B9M A;  2GWR A;  1IN5 A;  1JE8 A;  5BOX A;  3IC7 A;  2OBP A;  2E7X A;  4A5N A;  4EGY A;  2MH2 A;  3Q9V A;  1ZN2 A;  2FXA A;  1WQ2 A;  4HX8 A;  2UWM A;  3F6V A;  1HKT A;  2H6C A;  1YLF A;  4FX0 A;  1RUO A;  5ILU A;  2IA2 A;  3F8F A;  3HRU A;  2K02 A;  5H6Q A;  1P4A A;  4NB5 A;  2CO5 A;  3FXR A;  2L4M A;  1HSJ A;  2MH9 A;  2XKP A;  3HIF A;  2XAQ A;  3DP7 A;  3M7G A;  3HHG A;  4WXH A;  3WTU C;  2KIM A;  2VBW A;  1S3J A;  3I59 B;  2QQB A;  2H27 A;  3GEZ A;  4YIF A;  4LJZ F;  1XGO A;  2HQN A;  1A04 A;  4OIN F;  2DQR A;  2L3D A;  1OYW A;  4LK0 F;  1QZZ A;  3HSR A;  4BAY A;  5D6F A;  3JSP A;  4I01 A;  4R8H A;  2KIF A;  4L9V A;  2P5L C;  4ESB A;  2PG4 A;  1YYV A;  3CUO A;  1C0W A;  1HST A;  2A5Y B;  3GO5 A;  4EJV A;  2WWY A;  1RUN A;  1V4R A;  2Q2E A;  1T38 A;  4QLC U;  2VXZ A;  1IXR C;  3FM5 A;  5FFZ A;  4GYI A;  5JVT A;  1YO5 C;  1XDS A;  1R00 A;  3WGH A;  4UV9 A;  2XKO A;  3B73 A;  2L02 A;  2R7D A;  3W6K B;  4NQW A;  3HYI A;  1MKM A;  4IRI A;  4G6Q A;  5D8L B;  1D5V A;  1BC7 C;  2YPR A;  1UST A;  4MQV A;  3WU1 B;  2NAZ A;  3QPH A;  1I27 A;  2GAU A;  4BQA A;  4O5V A;  5DV5 A;  3PQJ A;  2STW A;  2HYG D;  2MA3 A;  2ESN A;  1Y0U A;  2OZ6 A;  3EDP A;  1VTN C;  4CO8 A;  3F8N A;  3E3V A;  5FFX A;  3T5X A;  5KK1 A;  1GVJ A;  1XD7 A;  3BOQ A;  4IXA A;  4P5O A;  2RKH A;  2HQR A;  3I59 A;  3HTS B;  3I54 A;  5TRD A;  4PGG A;  2Y0M A;  2FQ3 A;  1XMK A;  1H9T A;  5D5X B;  5K5R A;  2STT A;  2FML A;  4HQE A;  5CVI A;  2DW4 A;  1G3S A;  4XLP F;  5CVJ A;  3SQN A;  2MD5 A;  2QVO A;  3LA3 A;  1MGT A;  1R7J A;  2DBB A;  3HTU A;  1O57 A;  1S7A A;  2XAJ A;  2QQ9 A;  2P5V A;  1FLI A;  1OYY A;  2GXB A;  2Q8K A;  2W85 A;  1SD6 A;  2V9V A;  1K6O A;  2YU3 A;  3E5U A;  4B09 A;  2HZT A;  4L5J A;  5LRS A;  4ZZL A;  1LDD A;  4CGZ A;  3BWG A;  2OA4 A;  3M8F A;  3VB2 A;  1T0F A;  2ZKZ A;  1WKM A;  2DU9 A;  3ZMZ A;  1HQC A;  3I71 A;  1TLH B;  2EA4 A;  5F64 A;  1KQ9 A;  2A6E F;  2QZ8 A;  2DT5 A;  4KMF A;  3KLO A;  2CGP A;  4KYW A;  1Z6T A;  1IUY A;  3EYY A;  3Q9S A;  3WTZ A;  1ZAR A;  4BHP A;  2XAH A;  2WC2 A;  3M8E A;  4KNY A;  3EYI A;  1W7P D;  2J5P A;  2H94 A;  3K9T A;  3KE2 A;  5E17 F;  4LK1 F;  1T6S A;  2TDX A;  5IT3 A;  1AOY A;  5LRR A;  3MZH A;  4CZZ A;  5IT9 K;  3FMR A;  5HOO A;  1ZLK A;  1FP1 D;  4Q48 A;  4CXF A;  4ESJ A;  1MJB A;  1NHA A;  2XRN A;  4TV7 A;  4KIC A;  2O03 A;  4A0X A;  3BPX A;  2IW5 A;  3RKW A;  4ETS A;  2FA5 A;  1UFM A;  4IHT A;  2F5F A;  2YX4 A;  3C1D A;  4OMY A;  1Z1D A;  4YFX F;  5CVU A;  1YS7 A;  1XN7 A;  3WTY C;  5L3D A;  4I7H A;  1PP7 U;  2ZME B;  4RGU A;  2P4W A;  5CYV A;  3L2C A;  2PQ8 A;  3VFZ A;  4L9N A;  2BGC A;  5BPI A;  2VE9 A;  3NRV A;  1FNN A;  2XAF A;  1KGS A;  4I2O A;  5ILV A;  4I0A A;  3SFZ A;  4S05 A;  3RJP A;  1ODD A;  1R1V A;  1TTY A;  4BHC A;  1P92 A;  4ENJ A;  1FZP B;  1RIO H;  1AWC A;  2O8X A;  4XBF A;  1WWX A;  2VBY A;  4DNC A;  4HX4 A;  3F21 A;  1UB9 A;  3TQN A;  1DP7 P;  4KIF A;  3JTG A;  3DXJ F;  4LLL A;  3FX3 A;  2L54 A;  1EH8 A;  2NS0 A;  3K0L A;  3D5L A;  4KIG A;  4N0B A;  3B02 A;  1GHC A;  3HOT A;  1ZG3 A;  4RS8 A;  4I09 A;  1KYW A;  2Y75 A;  1PP8 F;  2P7C B;  5BS6 A;  4BXU A;  2VT3 A;  5D5U B;  3WTW C;  3TOA A;  3LAP A;  3FHZ A;  2X4H A;  2ELH A;  3HRS A;  4ENN A;  5LBQ A;  1HW2 A;  3J81 Z;  2FBK A;  1UHM A;  2ISZ A;  5FGM A;  1OMI A;  4AIJ A;  3R0A A;  1J9I A;  1F4K A;  2NNN A;  2G7H A;  1MJ9 A;  4GXO A;  2ZME A;  1BIA A;  2JPC A;  2JTV A;  2P6T A;  1EH6 A;  2EA2 A;  4P55 A;  4HLX A;  1CF7 B;  3ABU A;  4AIK A;  3RKY A;  2XUB A;  1QBJ A;  4HQM A;  2VN2 A;  4M73 A;  5L3F A;  3R60 A;  5L3C A;  1OKR A;  2COM A;  1Z05 A;  3SZT A;  1XGM A;  2ZBK A;  2CWE A;  4FHT A;  4HF0 A;  3FF5 A;  3U2R A;  3J81 K;  3LAJ A;  2VBX A;  4IRG A;  4G6D A;  1FYL A;  4M74 A;  1W4M A;  2MLK A;  3TO6 A;  1K7A A;  1J0R A;  1GXQ A;  2IRF G;  3PFI A;  3DFG A;  4HDV A;  5E18 F;  1KU7 A;  1G3T A;  3G3Z A;  4U88 A;  3KEO A;  3DEU A;  3VOD A;  1ZAO A;  3JAM Z;  4LGW A;  5FB2 A;  2J5O A;  4HBL A;  2A3S A;  2W84 A;  3PQK A;  2CYY A;  1ZG1 A;  3E6D A;  3FWE A;  1I1S A;  2BYV E;  4EV0 A;  5LHH A;  5CVR A;  1TQM A;  3JTH A;  4O6J A;  5FLX K;  3GFL A;  3LA2 A;  3VEP A;  1XGS A;  2QM3 A;  3GVA A;  4RB1 A;  2PMH A;  2RGV A;  4RAY A;  2LSO A;  2GXG A;  3TO9 A;  1HKS A;  1ZLJ A;  5EEH A;  1CF7 A;  5D4R A;  1J2X A;  4UVB A;  3JW4 A;  2O61 A;  4G7H F;  3WOD F;  5CLS A;  1F5T A;  1O3Q A;  3JAM K;  5LHG A;  4HV5 A;  1IF1 A;  2VOP A;  5JFR A;  1TBX A;  2Z33 A;  2HFH A;  4GO1 A;  4PGH A;  4N9I A;  1BJA A;  4M71 A;  3QP6 A;  3GFI A;  3ELK A;  2O3F A;  1J75 A;  3GFJ A;  5FD6 A;  3O2P E;  4PCQ A;  2XVC A;  5K1Y A;  4LLG F;  4BHB A;  4ASN A;  3C3W A;  1BI0 A;  4LLN A;  3QRF F;  4A0Z A;  2EV0 A;  2KIU A;  4IHS A;  1FBS A;  4JQF A;  1RI7 A;  2QEN A;  2F5E A;  3ERE D;  1LJ9 A;  2NRA C;  3KP7 A;  2FE3 A;  1K78 B;  5ICC A;  1ZHF A;  1I6X A;  3BDD A;  2XIG A;  2JZY A;  2XGX A;  1P4W A;  2XHK A;  2Z99 A;  2XAS A;  3BRO A;  1KU3 A;  4UUV A;  2K7L A;  4H0E A;  1SAX A;  2Z9O A;  2F2E A;  4WCG A;  4UVC A;  4D0P A;  1IN7 A;  2X0L A;  2M87 A;  1L3L A;  1JXS A;  3K1M A;  1MZB A;  3OV8 A;  1YTY A;  2IA0 A;  4RGR A;  1D8J A;  2H6B A;  4XSZ F;  4U0W A;  2Q0O A;  2P5K A;  3ZMV A;  3E5Q A;  4MNU A;  1O3S A;  2A61 A;  4ENM A;  3U1D A;  3BY6 A;  5E1X A;  1USS A;  6PAX A;  4WXC A;  2GZW A;  1IRF A;  3ZQ7 A;  1B9N A;  1G6N A;  3I0T A;  4RB2 C;  2QUF A;  5FD5 A;  3LFK A;  3V8J A;  1HW5 A;  1KYZ A;  3HUG A;  4HZF A;  4DQ2 A;  1W5T A;  1B59 A;  1WRJ A;  2MBF A;  1OR7 A;  4EJW A;  1ULY A;  5TJJ A;  3HOS A;  2MLG A;  3C18 A;  4EMS A;  4ON0 A;  2HOE A;  1K78 A;  1HXD A;  1R1T A;  4OIQ F;  1ZYR F;  3F23 A;  3M9A A;  1S29 A;  4FX4 A;  3V8K A;  3M1E A;  2YSR A;  2FNA A;  2JPB A;  3WU0 A;  1IN4 A;  3F8B A;  2FBH A;  5F1R A;  1S8N A;  1S6L A;  4NHJ A;  4HW0 A;  3BJO A;  1UHW A;  2ESH A;  5IT9 Z;  2M45 A;  3CO7 C;  4RB3 C;  4L9J A;  1J7K A;  1IN6 A;  2K27 A;  3K69 A;  4G8X A;  5L3E A;  1LDK B;  3TDZ C;  5DCF A;  5HLI A;  1IW7 F;  1TQI A;  4G7Z F;  1YS6 A;  3Q5F A;  1TW2 A;  2ZXJ A;  1JHF A;  2IVM A;  3FXQ A;  3KCC A;  1R58 A;  3R6S A;  3BJA A;  3DF8 A;  4Y13 A;  1ZH5 A;  3KP3 A;  2G9W A;  3KZY A;  3T8T A;  5K5O A;  1ONV A;  2D1H A;  1KU9 A;  4G94 A;  3LQQ A;  5ICG A;  1FY7 A;  2OZU A;  1U3E M;  2K4B A;  3HSF A;  4G9Y A;  2A6H F;  2VT2 A;  3K2Z A;  4U7B A;  4YG2 F;  4A0Y A;  2IPQ X;  2VON A;  1FBQ A;  2CG4 A;  1XB4 A;  3GXO A;  1DDN A;  1XGN A;  4OMZ A;  4LMY A;  4KIB A;  2QLZ A;  4O3M A;  4XSX F;  1O7L A;  3MAJ A;  3CDH A;  4UXN A;  3BZ6 A;  2DI3 A;  2AS5 F;  3LQR A;  3RPQ A;  3R61 A;  3F8C A;  3QPT A;  2GQQ A;  1HBX G;  1BM9 A;  2FNP A;  1FYK A;  4Q4Z F;  4MTD A;  3CLO A;  4P96 A;  1S7O A;  5AIP A;  2P7V B;  3EQL F;  3VOE A;  3ISP A;  1SD4 A;  1ON2 A;  3ZMD A;  2HWV A;  2OAZ A;  2EJR A;  4HYE A;  1D3Y A;  1OPC A;  2CFX A;  4EM2 A;  5EEG A;  1YW7 A;  2HGC A;  4UNO A;  5E1W A;  1SMT A;  3ML6 A;  2HKX A;  4IPA A;  3MWM A;  5DD4 A;  3GX4 X;  3L7W A;  2RDP A;  3WTS C;  2O0Y A;  2EB7 A;  3J80 K;  2V1U A;  4M6X A;  3P7N A;  2RQP A;  2KJB A;  5HS9 A;  2GA1 A;  5D8K B;  3IKT A;  4BYY A;  4GGG A;  3RKX A;  4EQQ A;  2DTR A;  5DYM A;  1MD0 A;  1MJA A;  2ZJ2 A;  2A07 F;  2RN7 A;  2ZO4 A;  1FX7 A;  5JHU A;  5AON A;  1KQ0 A;  2L4A A;  1GXP A;  2V1X A;  2HR3 A;  2ADU A;  4PZJ A;  2QYO A;  4A5M A;  2V79 A;  2DAO A;  1R23 A;  1BN5 A;  2IT0 A;  3R0J A;  4L0Z B;  4YII A;  3QU3 A;  2JSC A;  2PEX A;  5DUK A;  1ZRC A;  1G3W A;  1XSV A;  1IXC A;  2Y48 A;  4CDG A;  1TW3 A;  2XAG A;  2IP2 A;  3LA7 A;  3RYR A;  4F7Z A;  3HSE A;  2BE5 F;  1B4A A;  1R5G A;  4CIC A;  2M5W A;  5DD8 A;  3DQV C;  5E8I A;  4IVN A;  1QZY A;  2FF4 A;  2ZNZ A;  1U8R A;  3ZN1 A;  1STZ A;  2LDU A;  5HS8 A;  5ICF A;  3WTT C;  5HS7 A;  3TO7 A;  1ON1 A;  1KQ8 A;  2LNB A;  5BQT A;  2UXX A;  3K1P A;  5FLX Z;  2WTE A;  3ULQ B;  3KP5 A;  1OYI A;  4ZYE A;  3KP4 A;  1P2F A;  3GYH X;  4YFK F;  2E1N A;  3DPT A;  2RVC A;  5DDG A;  1U6G A;  2ZFW A;  1R1U A;  3ZP5 A;  1LDJ A;  2M1B A;  2EK5 A;  3RTR A;  5LLQ A;  4B8X A;  2QWW A;  3FMS A;  3EET A;  2V1D A;  1O3R A;  5HDG A;  2DK5 A;  1J5Y A;  1X3U A;  2BV6 A;  2EFP A;  2HTS A;  4LFU A;  4ZYD A;  2K4J A;  1Z7U A;  3O6B B;  5LGU A;  3H92 A;  1E17 A;  1IXS B;  2KRF A;  3IKV A;  2LF7 A;  4WXD A;  3KFW X;  2PI0 A;  4KDP A;  1V3F A;  5HLH A;  2A69 F;  1SMY F;  2PN6 A;  5KVR A;  3WGI A;  3BPV A;  3P9I A;  2FMY A;  3ZMU A;  3N4M A;  4ZYH A;  3R4K A;  1EV7 A;  2D2W A;  5JR3 A;  4AIH A;  2VOD A;  3W6J B;  3ECO A;  5AIQ A;  3WGG A;  2W25 A;  3ZMS A;  4OU0 A;  4ZZD A;  1LQ1 A;  2XV4 S;  1B1B A;  2HS5 A;  3GUD A;  1FSH A;  3MFK A;  4OIP F;  5J8C A;  5K5Q A;  3S2W A;  3E97 A;  1HW1 A;  3GZ5 A;  4L5I A;  1BOA A;  2PFB A;  1HKQ A;  3KLN A;  4QWQ A;  1IZ1 A;  1I1G A;  3N97 A;  1D8K A;  5BMZ A;  5D6E A;  4UVA A;  1JHH A;  3HRT A;  3V7C A;  3WTX C;  3E6C C;  4JK1 X;  1LVA A;  2LF8 A;  1KU2 A;  2RV8 A;  3V4G A;  4RAZ A;  2QBY B;  2CQK A;  4N9H A;  3I64 A;  1Q1H A;  4M72 A;  3V7S A;  3CJN A;  1O7F A;  1WI9 A;  2E1C A;  2VE8 A;  3P9K A;  3RIR A;  1P6R A;  4Y15 A;  2F5D A;  5DCM B;  2KJC A;  1F9N A;  5CJ9 A;  4EGZ A;  4KMU X;  4WF2 A;  5ERI A;  3REO A;  3DPL C;  1XMA A;  3EUH A;  4WX9 A;  1B6A A;  5F6F A;  1JGS A;  2GIV A;  5FO5 A;  5D5W B;  2D45 A;  3MCZ A;  4ZH4 F;  3F8M A;  1LEA A;  4GYG A;  1QO0 D;  4ENK A;  1DPR A;  2B0L A;  2OQG A;  3WTV C;  4L9T A;  2DPU A;  2IA1 A;  5A2Q Z;  1ZRF A;  1XCV A;  3IRQ A;  4HDU A;  3QAH A;  4Z2Y A;  2UZK A;  1ZGA A;  3RPU A;  4Q47 A;  1R5H A;  1ZG5 A;  3J7A O;  1YW9 A;  3QU6 A;  2JRT A;  2V6C A;  1SFX A;  3OOP A;  3QOP A;  3CTA A;  3GFM A;  3CO6 C;  3L00 A;  3COA C;  2HDC A;  4I98 B;  1WSU A;  3FMQ A;  3D0S A;  4MQ9 F;  4OIO F;  2QBY A;  3IL2 A;  3L9F A;  3JSO A;  2M30 A;  2L01 A;  2PBI A;  3KZZ A;  3T0Y A;  3MQ0 A;  2QQA A;  4I0B A;  3MZY A;  1W7P B;  4MGR A;  2EV5 A;  3ZMT A;  1FPQ A;  1O3T A;  2W24 A;  2PLY A;  5A2Q K;  4L18 B;  2K86 A;  4HLY A;  1U5T B;  3IRR A;  1BBY A;  5DCM A;  4HOB A;  5LGN A;  1FC3 A;  1FP2 A;  1XSX A;  4U0V A;  1LNW A;  2C6Y A;  3CUQ B;  2GA2 A;  4EM1 A;  3WE2 A;  1XDU A;  4EJU A;  4U7D A;  2HKO A;  4RB0 A;  4RGX A;  1DPU A;  1RZ4 A;  3FXU A;  3GLX A;  2OD5 A;  4KT5 C;  1REP C;  4HA8 A;  3WE3 A;  3TGN A;  1YIO A;  3E6M A;  1BI1 A;  1CGP A;  3E5X A;  4L0Y B;  2HYF A;  2HEO A;  4M9X A;  4MHG A;  1T98 A;  5L3G A;  1UCR A;  3IWZ A;  2G7U A;  4GCV A;  4CHU A;  3H3Z A;  2RC4 A;  3GW2 A;  4E70 A;  3U9G A;  2NNY A;  2BBY A;  5ILS A;  1G3Y A;  3KEQ A;  5H20 A;  4KN7 X;  5D4S A;  4P9U A;  1PUE E;  2DQL A;  2OQR A;  4UHT A;  5H6R A;  3MEX A;  3V7R A;  1K79 A;  2ISY A;  4BNC A;  4LG0 B;  4MTE A;  3I4P A;  3L09 A;  2ETH A;  1W7P A;  4IF4 A;  2ZNY A;  3F72 A;  2FOK A;  3AAF A;  4HF1 A;  4KUM A;  1FOK A;  5LHI A;  1YW8 A;  3KP2 A;  1U5T A;  3TDU C;  3J80 Z;  4WWC A;  4AD9 A;  1L0O C;  3I58 A;  5J6X A;  3CUQ A;  2AXL A;  5E8G A;  3GZ6 A;  5HDK A;  1LB2 A;  5E1Z B;  1F1Z A;  4KFC A;  1U2W A;  1ZRE A;  2DLL A;  4M6Y A;  4Y17 A;  2IJL A;  4Q5S F;  4M9Z A;  1Z6R A;  3O3K A;  4RGS A;  4A6D A;  2EFO A;  3DKW A;  1Z91 A;  4HAM A;  5HDN A;  4HX7 A;  2MC3 A;  4EVI A;  5LGT A;  3QP5 A;  3FZV A;  3V8L A;  1XSD A;  1FBU A;  2FSW A;  4K2E A;  2EFQ A;  5JI6 A;  2A68 F;  4JBA A;  2JT1 A;  4YFN F;  3BJ6 A;  1TNT A;  4UV8 A;  4KA4 A;  4EJO A;  4LB5 A;  1SD7 A;  2FBI A;  2O6G E;  4LG0 A;  4G7O F;  3F3X A;  2Z3Y A;  3ECH A;  3TOB A;  1SD5 A;  5CVV A;  1XCB A;  3RYP A;  1FSE A;  1YFH A;  1IRG A;  2DK8 A;  3IHU A;  4CYD A;  2DFI A;  1TNS A;  1ZGJ A;  5LEJ A;  1R22 A;  2HTJ A;  2WV0 A;  4XLN F;  5ICE A;  4A12 A;  4ZYG A;  1QNT A;  2VOO A;  3K1N A;  5ED4 A;  4MEY F;  1FT9 A;  3ABT A;  4LD5 A;  5DUI A;  2ZCW A;  1T39 A;  3E6B A;  1P4X A;  2F5C A;  4EJT A;  2R7F A;  5BPD A;  5HLG A;  1FYM A;  3I53 A;  1IN8 A;  4R1H A;  2PJP A;  4FT8 A;  3SHF A;  2VC0 A;  1QQI A;  3GF2 A;  2R3S A;  1IAW A;  1BC8 C;  1SFE A;  2YR2 A;  3HHH A;  4HV6 A;  2DPD A;  3ZN0 A;  4AWX B;  3WG9 A;  4MEX F;  2BEO A;  4EM0 B;  2EFW A;  3NQO A;  3RI4 A;  4WK8 F;  1MDM B;  5J8F A;  1E2X A;  1Z9C A;  3F22 A;  1BI3 A;  2YX7 A;  2OU2 A;  2VBZ A;  1U78 A;  4ESF A;  1R36 A;  1EH7 A;  5L3B A;  3BP8 A;  4I02 A;  3G73 A;  1W5S A;  2W57 A;  4AVP A;  2EFN A;  1BIB A;  1BI2 A;  5E20 A;  4PDK A;  2RNJ A;  3NEU A;  1ZRD A;  2P6S A;  1KA8 A;  3KP6 A;  4A2U A;  5HVQ C;  2VC1 A;  2LKP A;  3C7J A;  1QPM A;  3F6O A;  4LB6 B;  4IRH A;  4XRF A;  1SFU A;  3SZP A;  1PDN C;  1J59 A;  3H3U A;  4U0Y A;  3ZPL A;  3T8R A;  2M8E A;  3T1B A;  2NYX A;  3P9C A;  4BH9 A;  1QGP A;  3SXY A;  3LST A;  3IWF A;  2CSO A;  2UXN A;  1LEB A;  2PMU A;  1H9G A;  4S04 A;  2E7W A;  3KET A;  2FEZ A;  4M9S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...