2D1VA

Crystal structure of dna-binding domain of bacillus subtilis yycf
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
103
structure length
103
Chain Sequence
SSNEIHIGSLVIFPDAYVVSKRDETIELTHREFELLHYLAKHIGQVMTREHLLQTVWGYDYFGDVRTVDVTVRRLREKIEDNPSHPNWIVTRRGVGYYLRNPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Response regulator YycF essential for bacterial growth: X-ray crystal structure of the DNA-binding domain and its PhoB-like DNA recognition motif
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
molecule keywords Transcriptional regulatory protein yycF
total genus 28
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2005-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2d1vA00
2YSRA 2FQ3A 3JTHA 1KU2A 3SFZA 3W6JB 1G4DA 3P7NA 1KYZA 3TKYA 3SXYA 1QBJA 1B9NA 5DV5A 5D6FA 4OMYA 5HS7A 4M74A 1U8RA 5HOOA 2YPRA 1LB2A 1DPUA 2HS5A 4U0YA 4IHSA 5E1WA 2Z9OA 2Q8KA 1RUOA 2DO7A 4EM1A 1B4AA 1MZBA 3PFIA 4G7OF 1JHFA 1EH8A 5CVVA 2MH2A 3I0TA 1XD7A 2ZXJA 1HW1A 2VC0A 5E8IA 2A6HF 1USTA 5D6EA 4UV9A 1K78B 3CO7C 1J0RA 4BQAA 4M9XA 4KICA 3DXJF 4HLXA 1PDNC 5D4RA 1SMYF 1FYMA 3WGGA 2P5LC 3K1MA 3I5UA 2ZFWA 2YU3A 3D0SA 4LG0A 3WTZA 4EMSA 4L0ZB 3WGIA 3KFWX 2P7VB 1XGNA 3RPQA 2DW4A 4BNCA 1Z6TA 1YO5C 1KU7A 1LDJA 2EFQA 1CF7B 3TO9A 1YW7A 2KIUA 4LJZF 4CHUA 4A0YA 1FYKA 1UB9A 4HLYA 1FLIA 1J75A 3BZ6A 1D8JA 5JI6A 1GXQA 1TW3A 2QUFA 1IN5A 2PEXA 2YX7A 5FFZA 2MBFA 4ETSA 3QAHA 3EDPA 3QU6A 3WTTC 3MWMA 5D5UB 4CZZA 4WCGA 3DP7A 4OINF 2ZBKA 1SAXA 1YS7A 1YTYA 3P9IA 2K4BA 3HHGA 5LBQA 1OR7A 2DK5A 1PUEE 3TDUC 3BROA 1JHHA 3JAMZ 3KLNA 5HVQC 4MTEA 1IW7F 2W24A 3IHUA 1FSEA 4A12A 2HWVA 2KJBA 3WTYC 3HRUA 1FBSA 1P4WA 5E8GA 5J6XA 2UZKA 5HDNA 3T1BA 4ESJA 4CXFA 3IRRA 4BHPA 4ZZLA 2P6SA 5DD8A 4A0XA 3KZYA 1K79A 3CTAA 1J9IA 1R1TA 4QLCU 2HZTA 4D0PA 3RDIA 4IVNA 2ZNZA 1OYYA 4LB5A 3F8BA 1Z05A 1J59A 5D5VB 4I01A 3IWFA 3IC7A 5DCFA 3M7GA 3GO5A 3TOBA 2XVCA 3F22A 2MA3A 2GXBA 4YIIA 3RKWA 4YFXF 2FRHA 1V3FA 1ZRCA 1TLHB 1FNNA 3ELKA 2JRTA 3MCZA 3N97A 1H9TA 4P96A 4ESFA 1DP7P 1QPMA 1P4AA 2OQGA 4LLLA 4KMUX 2P5VA 3RKXA 3F8MA 3FF5A 3JSOA 4I0AA 2Y48A 1YS6A 1F1ZA 2J5PA 4UUVA 4EJUA 1W5TA 5DCMA 4IJAA 5KK1A 3ZMSA 2VOPA 4MQ9F 2X4HA 1ZLJA 3K1NA 1UFMA 4HX7A 1XMKA 2HGCA 5F64A 1R23A 3ECOA 1RI7A 1BC8C 4ZYHA 3J7AO 3TO7A 4M73A 4N9HA 2NNNA 2QBYA 3IWZA 4RB1A 3VOEA 5K5RA 4I2OA 4KMFA 3D5LA 4LD5A 2OAZA 2DTRA 5K1YA 2IPQX 4HYEA 1R22A 3FWEA 4YG2F 4UVBA 2X0LA 5CVIA 2KIFA 2QQBA 2NAZA 4OOIA 2QYOA 2B0LA 2UXNA 4L5IA 1T6SA 3KP7A 3SHFA 2GIVA 2RN7A 1BJAA 2ISYA 2O61A 2WC2A 5E17F 3BWGA 2QQ9A 5L3EA 4HQMA 2G9WA 5DCMB 2O03A 4LK1F 4A2UA 1IN8A 4FX0A 3G73A 1TBXA 4JK1X 2WV0A 1FP1D 4ASNA 1XDUA 1XN7A 3WU1B 1U5TA 1YYVA 3DPTA 4KN4X 3V8KA 4CO8A 4L9JA 5BPIA 1UHWA 3V7RA 2H09A 1B6AA 5CVJA 2L4MA 2HOEA 2EV5A 1IXSB 1IXRC 2VT2A 4UNOA 4HBLA 2IW5A 5EEGA 3KP3A 1BI1A 4A6EA 1FYLA 3QP6A 3T5XA 1B59A 1P6RA 3R0JA 3WGHA 2MD5A 1YFHA 4ZYDA 1VTNC 4U88A 1V4RA 1SFXA 1RIOH 4GYIA 2DPUA 4Q4ZF 2QM3A 2VBWA 4CICA 4HF2A 3GW2A 2EA2A 4A5MA 4WXHA 2HQNA 1KQ8A 3F72A 2AXLA 2NRAC 4RAYA 3I59B 3RYPA 3R4KA 1UCRA 1KGSA 2W84A 1FSHA 1SD7A 3F8CA 4RB3C 2ZKZA 1TQIA 1KYWA 4EJOA 2YX4A 4P5OA 1E2XA 2PQ8A 1MJAA 2EFOA 1WWXA 5FO5A 3LA3A 4G6QA 4KFCA 2VN2A 3FXRA 2M5WA 2XROA 4EJVA 2Z33A 4EJWA 3BP8A 4KIBA 2VE9A 2E7XA 2DQRA 3IKVA 1IN7A 1REPC 1HXDA 1FC3A 1SD6A 2IA2A 4HV6A 5JVTA 1BOAA 2M1BA 2XAHA 4M9ZA 4GO1A 4ENJA 3BJ6A 3HOTA 1LEBA 3F8FA 1FWZA 4S04A 3WE3A 3K69A 2LF8A 1Z91A 2BV6A 3TGNA 2Q2EA 4Y15A 2QENA 1O3RA 4P9FA 4ESBA 1I27A 1FT9A 4FT8A 2ETHA 1TNTA 3HTSB 3WTWC 1R1VA 4EGZA 3VEPA 2Z3YA 4NB5A 4LLNA 3GXOA 4YFKF 1G3TA 1U6GA 2JT1A 4HF1A 2M30A 3GFLA 3ZN1A 2O3FA 5D8LB 2ESHA 1HW2A 5EEHA 5CVRA 3KZZA 2K7LA 2JPCA 4HZFA 1D8KA 4L5JA 1XSVA 4OU0A 3C1DA 1PP7U 3F6VA 1IRFA 2DI3A 1O3TA 2BGCA 5K5QA 3I64A 1XDSA 2DQLA 1MDMB 4AIKA 2CFXA 4MNUA 2A07F 2Q0OA 1FPQA 2LSOA 1R36A 3ZMZA 2OBPA 2W57A 1J7KA 3JW4A 2M8EA 3DFGA 1B9MA 1U5TB 3NRVA 3HRTA 4EQQA 1BI3A 1OMIA 3QP5A 2P8TA 4E70A 2JSCA 2D1HA 2R7DA 1W5SA 3CUQA 1E17A 4O3MA 1TTYA 2RGVA 1HSJA 4TV7A 2RC4A 5LRSA 1YG2A 3V4GA 3JTGA 3E5QA 2W25A 2FEZA 5LEJA 4IF4A 3ZPLA 3FZVA 2EFPA 4I98B 5L3BA 2AS5F 1MJBA 5LRRA 2LNBA 2MC3A 1OKRA 2M45A 5HLIA 3CUOA 1S7AA 3E6BA 1Y0UA 5ICGA 2ZO4A 4EV0A 4RB0A 3GYHX 2H6CA 1G3SA 4M9SA 4ZH4F 2XUBA 3J81Z 3FMSA 1HBXG 4CYDA 3C3WA 1R1UA 2HTJA 5CYVA 2O6GE 2UXXA 1W7PA 2J5OA 4ENKA 3RKYA 2A68F 3DF8A 3HOSA 1BC7C 1QZZA 4OIRF 3GF2A 3BOQA 1JE8A 2EJRA 1LDDA 3OV8A 3ZMUA 4GYGA 5AONA 1KA8A 5ILVA 3I58A 2RVCA 4PDKA 5HLGA 3I4PA 3O3KA 4UVAA 1H0MA 3MZYA 2EWNA 4FHTA 3ULQB 1IZ1A 2L54A 3ROUA 4LMYA 2GAUA 5CJ9A 3I53A 1UHMA 2HYGD 2COMA 4U7DA 2XKOA 1FX7A 2L4AA 3FHZA 4N0BA 1FBQA 1YW8A 1F4KA 2P4WA 2DU9A 2ZMEA 1LEAA 1R5GA 1BN5A 4UXNA 4KN7X 5L3CA 3P9KA 4IRHA 2A5YB 1FBUA 1YW9A 3LAPA 2QBYB 5E20A 1S3JA 2FU4A 3E5XA 4GXOA 2YR2A 1TW2A 4Q48A 1HW5A 3RI4A 1FY7A 4G7ZF 2F5FA 3I54A 4IHTA 3Q5FA 1BBYA 2HKXA 3L2CA 3V7SA 3HSFA 1WRJA 2XIGA 1EH7A 3KEOA 4HAMA 2BEOA 1Z9CA 2R7FA 1TQMA 2Z5UA 2PMUA 1USSA 2M87A 2FE3A 4JQFA 4EGYA 1MDMA 6PAXA 3IL2A 2K02A 5ICFA 1EH6A 2Z99A 3BJOA 2Y75A 3DEUA 2XASA 4RB2C 3MAJA 4XRFA 4U7BA 3GFIA 1A04A 4KA4A 3VFZA 4QWQA 3QPHA 3L00A 4KUMA 1QZYA 3WG9A 3VODA 1BI2A 3CUQB 1T39A 3L9FA 2V1DA 4WK8F 2RDPA 4RGXA 1DDNA 2GXGA 2BYVE 3P9CA 3HHHA 2XHKA 3TDZC 3JSPA 1AOYA 3KCCA 3HRMA 2XKPA 3HSRA 3R6SA 2QZ8A 4HDVA 1J2XA 4HA8A 3H92A 1IAWA 3KP2A 2DPDA 1AWCA 4UHTA 1ZRDA 3K2ZA 4R1HA 3LAJA 4I0BA 3BDDA 4H0EA 2O0YA 2VOOA 4EM2A 3FM3A 4ON0A 5H6RA 2Y0MA 2ZCWA 3BJAA 5H6QA 4PGHA 1S29A 2XV4S 3F21A 3QRFF 3KP5A 1H9GA 1OYIA 1T98A 3KP6A 2LDUA 4N9IA 2EA4A 2CYYA 2JZYA 5E1ZB 3MZHA 3FM5A 1ULYA 2D2WA 2EB7A 5LGUA 1NHAA 3I71A 3N4MA 2EFNA 3ZMVA 1ZGJA 3R61A 1RNLA 4LB6B 2VT3A 4BHCA 4PZJA 5E1XA 2HYFA 1FZPB 3LQRA 3B73A 3WTUC 2ESNA 5DEQA 1HKTA 2A3SA 4WF2A 3CJNA 1IN6A 1GVJA 5LEKA 2HKOA 5DD4A 4ENNA 2IVMA 3DPLC 3REOA 4YFNF 2P5KA 1BIBA 5BS6A 3SQNA 2DT5A 3LA2A 2IJLA 4MQVA 5BOXA 3CDHA 1ZG1A 3WODF 3O6BB 5J8FA 1IUYA 3RJPA 2KJCA 2C6YA 1I1SA 2P7CB 1Q1HA 3B02A 1SFEA 3ML6A 2RQPA 2ZNYA 4M71A 3K0LA 4G8XA 2OD5A 4OIQF 2DK8A 3S2WA 3FXUA 3M1EA 3L7WA 4BAYA 1ZARA 3E6MA 2VBZA 3TQNA 1G3YA 2K27A 3ISPA 2H6BA 3E6CC 1R5HA 5HDGA 4G7HF 1LVAA 5FLXZ 1KU3A 5J8CA 2PLYA 3PQKA 1XGOA 5ICEA 2K86A 3W6KB 3QOPA 5FGMA 2PJPA 5A2QZ 4L9TA 3LWFA 4AVPA 2KIMA 2WWYA 4WXCA 3RIRA 3FMQA 1ZHFA 2D1VA 1G3WA 2FOKA 3BPVA 2F2EA 2OZUA 4B09A 3E3VA 1F5TA 1KQ0A 4R79A 5BMZA 4KYWA 2UWMA 4P9UA 3T8RA 2KKOA 1L3LA 4XSXF 2CWEA 4G6DA 2GQQA 1ONVA 3EUHA 2TDXA 3ECHA 2STWA 3ZP5A 2HR3A 1STZA 2F5CA 2VBXA 3MQ0A 2F5EA 1ZRFA 1GHCA 3KLOA 1XGMA 2JPBA 2E7WA 2QVOA 5F6FA 2JTVA 1TNSA 4HDUA 5IT3A 2FBIA 3U2RA 3LSTA 5AIQA 2OA4A 4A5NA 2GZWA 3NEUA 5FD6A 4IXAA 5FFXA 1QO0D 1RUNA 5D5XB 3C18A 3HUGA 3K1PA 2PFBA 2L01A 2DFIA 3E5UA 2XAQA 1ZYRF 4ZYGA 2H27A 3EQLF 4RGUA 5BPDA 4IRIA 3GFMA 3LQQA 3F3XA 1ZREA 2H94A 2XAFA 4LK0F 2VXZA 4O6JA 1T0FA 1MD0A 1D3YA 3BY6A 4ZZDA 4WXDA 5AIPA 2O8XA 2FBHA 3G3ZA 3ZQ7A 2ELHA 1XCVA 4I02A 3ZMDA 1P2FA 3F6OA 2ISZA 1O7FA 1WKMA 3DQVC 1U78A 4L9VA 4MEXF 3V8LA 3ABUA 1BI0A 1U2WA 4CGZA 3L09A 3IRQA 3QPTA 4EM0B 1OYWA 1Z6RA 5HS9A 4KDPA 3Q9SA 2XGXA 1P4XA 5ICCA 1ON2A 5BQTA 3COAC 3ZN0A 5LHHA 2XAGA 4LLGF 2VE8A 2NYXA 2DLLA 3BPXA 3F8NA 5TJJA 1R7JA 1LNWA 2FBKA 2V1UA 2MH9A 2NS0A 2FXAA 4MGRA 5DUKA 1F9NA 4G9YA 1XMAA 3RTRA 1K78A 2IA0A 2RNJA 1S6LA 2EFWA 5E18F 1R58A 4OIOF 4KNYA 5ED4A 5LGTA 3CUQC 3AAFA 2V1XA 2F5DA 2L02A 1QNTA 1X3UA 2MLKA 1U5TC 1ON1A 4HW0A 2PBIA 2RV8A 3E6DA 3J81K 2VODA 2IT0A 3TO6A 4AWXB 1Z1DA 1TQPA 1O7LA 5DUIA 4XLNF 1ODDA 2CSOA 5K5OA 2PMHA 1L0OC 2FA5A 3HIFA 2FNPA 5LHGA 2R3SA 2NNYA 5LHIA 4M6XA 4BHBA 5D5WB 3KP4A 1I5ZA 1DUXC 4PCQA 4Q47A 4M72A 2LKPA 1HQCA 3GWZA 2LF7A 2QLZA 1T38A 5L3DA 2FF4A 5HS8A 2CO5A 4I7HA 4AIHA 3KEQA 3U1DA 1IXCA 1XB4A 2QQAA 1XGSA 4OMZA 1SFUA 4PGGA 3V7CA 3VB2A 4IRGA 3T8TA 1C0WA 1S8NA 3V8JA 4XLPF 2HEOA 4MEYF 3HRSA 1ZH5A 4MTDA 1XSXA 2RKHA 1OPCA 4BH9A 4ZYEA 2EV6A 3EETA 1GXPA 3LA7A 5IT9K 4RGRA 3FXQA 1QQIA 1HKQA 2G7HA 1ZG5A 1K6OA 3U9GA 3DV8A 3PQJA 1Z7UA 2EV0A 2HTSA 3T0YA 1YIOA 4LGWA 1XCBA 4RS8A 5A2QK 3M8EA 3MFKA 2FNAA 1RZ4A 4BYYA 5IT9Z 2PG4A 4A0ZA 3R60A 2G7UA 1YQAA 3DKWA 2V79A 1IN4A 3ERED 1BM9A 3GVAA 1LQ1A 5L3FA 5FB2A 1I1GA 1ZLKA 4Y17A 4L9NA 2HDCA 2FMLA 2BBYA 3GZ6A 4L0YB 1IRGA 5JHUA 5DYMA 2W85A 4U0WA 4MHGA 4KIFA 2K4JA 3GZ5A 1J5YA 2CW0F 3FX3A 4JBAA 3WTSC 2A69F 1WSUA 3GX4X 4K2EA 4Z2YA 1EV7A 3F23A 3RPUA 2GWRA 3KETA 1W7PD 2WTEA 5LLQA 3H3ZA 2L3DA 3EYIA 1FP2A 1WI9A 5L3GA 4ENMA 4WWCA 1W4MA 2V6CA 2CQKA 4FX4A 4EVIA 2MLGA 2ACJA 5DDGA 1SMTA 4BXUA 1WQ2A 3RYRA 2HFHA 4KIGA 3GEZA 4XBFA 2XAJA 3TOAA 4LFUA 3IKTA 2VC1A 1BIAA 4HOBA 4NQWA 1B1BA 4L18B 2FSWA 3GLXA 5HLHA 3WE2A 4KT5C 1FOKA 1IF1A 5LGNA 4GGGA 3NQOA 3ZMTA 1LDKB 3LFKA 3KE2A 3ABTA 4Y13A 3K9TA 4CDGA 1LJ9A 1S7OA 4YIFA 3CO6C 1I6XA 4XSZF 5JR3A 3H3UA 2ADUA 1G6NA 3WTXC 1ZAOA 5CLSA 2OZ6A 2IRFG 5D8KB 3WTVC 3GUDA 3Q9VA 3SZTA 2P6TA 4GCVA 2BE5F 2DAOA 1O3QA 3JAMK 2CGPA 4IPAA 2IP2A 1CF7A 5H20A 4A6DA 5HDKA 3J80Z 5JFRA 1MGTA 1ZG3A 1O57A 2D45A 1KU9A 2FMYA 1KQ9A 3CLOA 3EYYA 5TRDA 2OU2A 4EJTA 1JXSA 2CG4A 5ILUA 2EK5A 3HTUA 1D5VA 4Q5SF 1W7PB 1QGPA 2A61A 3M9AA 4P55A 1HSTA 5CVUA 4DNCA 3R0AA 1DPRA 3M8FA 2VONA 4I09A 5FD5A 3WU0A 2GA2A 4RAZA 4UVCA 2PN6A 5ILSA 1ZN2A 2GA1A 1PP8F 1K7AA 5D4SA 4HV5A 3HSEA 3SZPA 2KRFA 4LG0B 1YLFA 3E97A 1SD5A 3HYIA 4HQEA 3O2PE 4HF0A 4G94A 1JGSA 1P92A 3OOPA 4AD9A 5KVRA 5FLXK 3I59A 3FMRA 1CGPA 2IA1A 2A6EF 5ERIA 1ZGAA 1HKSA 2V9VA 4HX8A 4RGSA 4OIPF 2ZMEB 2E1CA 1R00A 4M6YA 4WX9A 1XSDA 2HQRA 1O3SA 2OQRA 4DQ2A 4AIJA 3J80K 2STTA 4NHJA 4U0VA 1T2KA 2E1NA 1MKMA 2PI0A 4HX4A 4R8HA 3C7JA 4UV8A 2VBYA 2XRNA 2QWWA 3GFJA 4S05A 1MJ9A 4B8XA 3MEXA 1U3EM 4O5VA 3QU3A 2ZJ2A 4F7ZA 2DBBA 5F1RA 1SD4A
chains in the Genus database with same CATH superfamily
3L2UA 4BBRJ 2YSRA 2FQ3A 2I5UA 3JTHA 1FOXA 2E19A 1SFOJ 1KU2A 4AM3A 3SFZA 4RAGA 3W6JB 2BY2A 1G4DA 2AO9A 3P7NA 3OSFA 1KYZA 3TKYA 3SXYA 1QBJA 5E3MA 1B9NA 5DV5A 1MNEA 5D6FA 3CC2I 4OMYA 5HS7A 4M74A 1U8RA 4PK4A 2JA6J 1H89C 5HOOA 2Z1DA 2YPRA 4PFPA 4BE1A 1LB2A 1ZR4A 2HS5A 1DPUA 4FASD 4U0YA 4IHSA 5E1WA 4V19K 1WJCA 2Z9OA 1UAAA 1RPWA 3DTEA 2Q8KA 1RUOA 4NUBA 2DO7A 4A3IJ 3LSIA 2JRMA 5LD2C 4BDYA 4EM1A 1B4AA 1MZBA 3PFIA 4G7OF 1JHFA 1EH8A 5CVVA 2MH2A 3A03A 1D1BA 3I0TA 1XD7A 2ZXJA 1HW1A 1SC7A 2VC0A 3AKZA 4BJ5C 5E8IA 3HKZA 2A6HF 1USTA 4XICA 3OIPA 4QPOA 5D6EA 5B3SH 4UV9A 3VYRB 1K78B 2CU7A 1J0RA 3CO7C 4BQAA 4M9XA 4KICA 2BXYA 1FJLA 1RKTA 3DXJF 2DCEA 4HLXA 3K6GA 1IRXA 2WAFA 1PDNC 5D4RA 1SMYF 1FYMA 1VQ7I 3WGGA 2P5LC 3K1MA 2FOWA 4B1RA 2VJJA 2ZFWA 3I5UA 2YU3A 1VQ6I 2OF7A 3D0SA 4LG0A 3AFHA 1G8XA 3WTZA 2JVHA 3GMEA 4EMSA 3WGIA 4L0ZB 2F4IA 3KFWX 2P7VB 1XGNA 3RPQA 3J7AY 4Y3OA 1WCMJ 2DW4A 3LMMA 5IY5H 2X9DA 5F0CA 4BNCA 1TT5B 1Z6TA 2VKHA 1YO5C 2EBIA 1XTAA 4S0HB 1WH7A 1YIJI 1KU7A 3ZRGA 1LDJA 2EFQA 1CF7B 1LFPA 4FE4A 1YW7A 3TO9A 4A3GJ 4UUSA 2KPMA 1JKQC 2KIUA 2O9LA 5J4VA 4LJZF 1WH5A 3ZOBA 4CHUA 4A0YA 3CF2A 1FYKA 1QHHD 1UB9A 3PNVA 4FISA 3SDGA 4HLYA 1FLIA 2XAUA 1J75A 2R7VA 3BZ6A 4B47A 1T33A 1Z3YA 5K7ZA 5EGOB 1D8JA 3MZ8A 4IHWA 5JI6A 1UHSA 1GXQA 1TW3A 2EH3A 2JSPA 1IN5A 2QUFA 3ASNH 3OYBA 1FEXA 4BY1J 2CUFA 2PEXA 1IJWC 2YX7A 5FFZA 4XOPA 4YELA 1TWCJ 2MBFA 1X3WB 4ETSA 1BL0A 1JKPC 3QAHA 3M4OJ 3LSPA 1NG7A 1XMXA 3EDPA 3QU6A 3WTTC 3MWMA 5FLMJ 5D5UB 3BT9A 3AG4H 3K70D 4CZZA 2E36A 3EPZA 1V5EA 1GUUA 1ZELA 4WCGA 3DP7A 2H1KA 2ID3A 3FXMA 4HPQA 4OINF 2ZBKA 1SAXA 3RZDJ 3ERMA 1YS7A 1B72B 1B8IB 1YTYA 2NVQJ 3P9IA 3BLYA 3PUFA 2K4BA 3LNQA 5HNHA 3HHGA 3UKGA 5EZGA 3DU6A 5LBQA 1OR7A 2DK5A 2AQEA 1PUEE 1RESA 2GOXB 4LITA 3HOVJ 2ID6A 4XOTA 3TDUC 3BROA 4JX6A 4MO7A 3OSGA 1JHHA 2R93J 1PYVA 3JAMZ 2EIJH 2LKSA 3KLNA 5HVQC 4JX4A 4MTEA 1IW7F 2G0EA 4YIRX 2W24A 3IHUA 1FSEA 4A12A 1LFUP 4RLFA 2CS3A 2D5VA 2HWVA 1P7JA 2KJBA 4Y7NJ 3WTYC 3HRUA 2XPVA 4HNUA 1FBSA 5EGOA 1P4WA 5E8GA 5J6XA 2UZKA 4MFEA 2DA5A 5HDNA 3T1BA 4XRMA 1D0YA 3MVPA 2F6CA 3DEWA 4ESJA 4M3DA 3PIPF 2WAQA 1WZ2A 3C2HA 4CXFA 3IRRA 2DFFA 4BHPA 4ZZLA 2P6SA 5DD8A 2EIKH 4A0XA 2KQRA 3KZYA 1DGWY 4P1WA 5HNFA 4IOAF 3KPHA 3EUKL 4BQQA 1K79A 3CTAA 1J9IA 3IH2A 2ZJQF 1R1TA 1VNDA 1MNDA 4QLCU 4C2TA 2HZTA 2V6EA 3S2HJ 3S17J 3FDYA 3RDIA 4D0PA 4IVNA 2ZNZA 4IHXA 4W1UA 3RPUD 2MYSA 1OYYA 4LB5A 3A1YA 3F8BA 3ESWB 2EINH 1Z05A 2LY1A 1J59A 2TRTA 3AL0B 5D5VB 4I01A 4I99C 3IWFA 3IC7A 5DCFA 3M7GA 3GO5A 3TOBA 2CQNA 2K40A 2XVCA 3F22A 2MA3A 4UUSB 2GXBA 4YIIA 1K6YA 3RKWA 4YFXF 3CJQB 2FRHA 2OUMA 1V3FA 1TLHB 1ZRCA 1FNNA 3ELKA 3ZXSA 2JRTA 2V4JC 2NS7A 3MCZA 1QVUA 3G71I 3N97A 1PUFB 1JT6A 1H9TA 1BJZA 3QYBA 4P96A 4ESFA 3O8HA 1DP7P 1QPMA 1P4AA 1IV8A 2OQGA 4LLLA 1YJWI 2COBA 2V1NA 1GV2A 1BA5A 4KMUX 4G12A 2P5VA 3RKXA 3DWLE 3F8MA 3FF5A 4I0AA 3JSOA 2Y48A 1N77A 1YS6A 1F1ZA 2J5PA 2H1LA 4UUVA 2CV1A 4EJUA 2ZXHA 1W5TA 3K7AJ 5DCMA 2OPTA 1YHQI 2HZDA 4DZPA 4IJAA 3VDXA 5KK1A 3ZMSA 2VOPA 4MQ9F 2X4HA 1OLTA 2CUJA 1ZLJA 2BOLA 1X4OA 3K1NA 1UFMA 4HX7A 2LY2A 1XMKA 2HGCA 5F64A 4BACA 1R23A 2LD5A 4CUGA 3ECOA 3W3CA 1RI7A 2DYRH 1BC8C 4Z6YA 4ZYHA 4XR6A 1APLC 3J7AO 2LRDA 3TO7A 1RETA 4XLHA 2VJ4A 4M73A 4N9HA 3SDBA 2NNNA 5IOZA 2A05A 2MW8A 2VPRA 2QBYA 4CCJA 3IWZA 4RB1A 3VOEA 4D7NA 3VSLA 5K5RA 1ETWA 4I2OA 2KDOA 4KMFA 2P0WA 3D5LA 4LD5A 3AL0C 2OAZA 3RSNA 2DTRA 1MW7A 2R92J 5K1YA 2IPQX 4CH7A 4HYEA 1R22A 3FWEA 4YG2F 2Q2EB 2X85A 1V5FA 3Q3SA 4UVBA 2X0LA 1YRNA 5CVIA 1X4PA 2KIFA 2QQBA 5J1UA 2NAZA 4OOIA 1Y6IA 2L9VA 4ZC3A 2QYOA 2B0LA 3HUGB 3JRDA 3LSJA 1GLNA 2WB1A 2RNGA 2VQHA 2UXNA 4L5IA 2Y69H 4NC6A 1K83J 2QKMB 1K61A 1I3QJ 1T6SA 1POGA 3CP8A 3KP7A 3SHFA 5F27A 4A3KJ 2GIVA 2RN7A 3IAM2 1RKWA 5CQEA 3HB9A 1BJAA 2ISYA 3I4MJ 4ZYAA 2O61A 2WC2A 2BHYA 1X19A 1QVTA 3H3VK 4DJAA 5E17F 2QKLB 3BWGA 2QQ9A 2QA4I 5L3EA 4HQMA 3KZIC 2G9WA 3ABLH 5DCMB 2O03A 2KDZA 4LK1F 4A2UA 1IN8A 3D5RC 4FX0A 3G73A 5GTIC 1TBXA 3DKXA 4JK1X 2WV0A 1SANA 1FP1D 3VYTB 4ASNA 1XDUA 3BG5A 1XN7A 3U1KA 3WU1B 1U5TA 1MBJA 1YYVA 3DPTA 4KN4X 3V8KA 4CO8A 3DTIA 1EF4A 1X2NA 5EYRA 1LE8A 3OYIA 3OIOA 4L9JA 5DS9A 5BPIA 2BXZA 1UHWA 3V7RA 2L7MP 2H09A 1F43A 3DTKA 1B6AA 1LVKA 5CVJA 2JQ7A 2L4MA 3ONQA 1B72A 2HOEA 3KYCB 1E3OC 2EV5A 1IXSB 2CQ7A 3W2VA 1IXRC 2VT2A 4M3GA 1T56A 2ZB9A 2KMUA 5GADJ 2F5VA 3CC7I 4UNOA 2E1MB 4HBLA 2M7BA 2R7RA 1OCTC 2IGMA 2IW5A 2JUCA 2L9NA 1BOBA 2R7QA 5EEGA 3KP3A 3HOXJ 2KFDA 1Y8QB 4JOMA 2QQ8A 1BI1A 1I3AA 2DA2A 2XGCA 4A6EA 3S2DJ 1FYLA 4BDZA 2V26A 5GPAA 3QP6A 4E7ZA 2ZJRF 3T5XA 1B59A 1P6RA 2M9HA 3R0JA 3I55I 2JA8J 3OOUA 3HGYA 3WGHA 3QYFA 4F92B 2MD5A 1ETYA 1YFHA 4ZYDA 1OCOH 5JLXA 4RDUA 5FROA 1VTNC 4U88A 1V4RA 4XKBA 1Y1WJ 4XNFA 1X1AA 4V2GA 1SFXA 1Y39A 2HVRA 3RKQA 2W4SA 2GXAA 3VYSB 1RIOH 4GYIA 2DPUA 4Q4ZF 2QM3A 2VBWA 4CICA 4HF2A 4PJMA 2LFBA 3BR2A 2QSGX 3GW2A 5B1BH 2W00A 2Y0SN 2IGKA 5IYCJ 4ZDLA 2DT6A 2EA2A 4A5MA 4WXHA 2HQNA 1KQ8A 3K10A 4GDFA 3F72A 5KNLA 2HOAA 2AXLA 2NRAC 4RAYA 3I59B 1GVDA 3RYPA 3OS1A 4CCLA 3R4KA 1UCRA 1KGSA 2K3PA 2W84A 1FSHA 4BXXJ 1ETVA 2OJED 1SD7A 2Y0SA 3CF5F 3F8CA 4RB3C 3JR9A 2ZKZA 1TQIA 2A5WA 1MMNA 1KYWA 4EJOA 1ZK8A 2YX4A 3BTCA 4NC8A 1NG6A 4P5OA 2VQLA 2L9RA 2CRGA 1E2XA 3MMYB 2PQ8A 1MJAA 5TGTA 2EFOA 3GTPJ 1AKHA 1WWXA 4C30A 5FO5A 3LA3A 1OJLA 4G6QA 4EATA 4KFCA 1WI3A 2VN2A 1N78A 3FXRA 5CKTA 3CCEI 4AU7A 5H2FC 2M5WA 4Y52J 1T95A 1OISA 2XROA 4EJVA 5TISC 2Z33A 4EJWA 3BP8A 4KIBA 1Z67A 2VKEA 2VE9A 2E7XA 2DQRA 5KAIC 3ZR8X 4BEHB 3IKVA 1VQMI 1IN7A 3OYMA 4XKCA 3Q0UA 3CCRI 1REPC 4XRSA 1HXDA 2VJ5A 1FC3A 1YOVB 2R7UA 1SD6A 2IA2A 4HV6A 2CH0A 1BOAA 5JVTA 2M1BA 1JTXA 2XAHA 4M9ZA 2Y9YA 4GO1A 4BQNA 1IGNA 3GTOJ 4ENJA 3BJ6A 2HDWA 3HOTA 1VQ4I 2RQQA 3F8FA 1LEBA 1FWZA 3LSGA 4BKXA 4S04A 1FOYA 3WE3A 2F4MB 2EIMH 3K69A 2LF8A 2OCEA 1T0FC 3ASOH 2AHQA 1Z91A 3A01A 1DP3A 1EJ9A 2BV6A 3TGNA 2Q2EA 4Y15A 1S5LC 4D9JA 4BGDA 2QENA 3JRIA 4P9FA 1O3RA 2DXIA 2XPUA 4ESBA 4GRIA 2MG4A 2DA1A 1I27A 1WJFA 3BCAA 1RRJA 3BCBA 1FT9A 4FT8A 1MIJA 4X1EA 2ETHA 1AA7A 3S1MJ 3S1NJ 1TNTA 5GPCA 3WTWC 3HTSB 1R1VA 4EGZA 1JTYA 3VEPA 1BR4A 2Z3YA 1ZR2A 4NB5A 4MLOA 4LLNA 3GXOA 4YFKF 1G3TA 5J3LA 1JKOC 1U6GA 3BZCA 2WY7Q 2JT1A 4HF1A 3FXJA 2F48A 2K5CA 2LP0A 2M30A 1WVRA 2IGOA 3LSMA 3GFLA 3ZN1A 5E3LA 4IQ4A 2O3FA 5D8LB 2VQCA 2ESHA 1HW2A 5EEHA 5CVRA 1VI0A 3KZZA 3WHCA 2K7LA 2JPCA 1FMWA 4HZFA 1D8KA 4L5JA 1XSVA 4OU0A 4PUSA 3C1DA 2FD5A 1PP7U 3F6VA 1IRFA 2DI3A 4A3LJ 4E7IA 1O3TA 2BGCA 4A69C 5K5QA 2PX9A 5M3MJ 2B9SA 3I64A 2Z16A 1S72I 1XDSA 2DQLA 2XB5A 1Y1VJ 3VPRA 4XN3A 2L7FP 2NVUB 1W0UA 2KP6A 3CJTB 4AIKA 1MDMB 4CCOA 2CFXA 4MNUA 3OYNA 2A07F 4DIQA 2Q0OA 1FPQA 2LSOA 4E6KG 4NC7A 5C4JJ 1GV5A 2YUSA 3CMMA 1R36A 3ZMZA 2OBPA 4B43A 5J4YA 2LC2A 2W57A 1J7KA 3JW4A 2M8EA 3DFGA 1A6QA 1B9MA 3GTKJ 3GBGA 5KAFC 1V5GA 1U5TB 3NRVA 2DA7A 1ETOA 4DYQA 3HRTA 1BI3A 1OMIA 2KZGA 1Q1VA 2LVSA 3QP5A 4EQQA 4ZTFA 2P8TA 4E70A 2GBYA 2HPMA 1G2HA 4HRIA 2JSCA 2D1HA 2MC4A 2K9SA 3Q0WA 2R7DA 1W5SA 1WPKA 3IUOA 2IS2A 3CUQA 1E17A 4Y33A 4O3MA 1TTYA 2RGVA 1HSJA 3VSKA 2TCTA 4TV7A 2RC4A 1IV6A 4RLQA 5LRSA 2OV7A 4KT6A 1YG2A 2PMZN 3V4GA 3JTGA 3E5QA 3FK6A 2W25A 2FEZA 2V9KA 1EA3A 5LEJA 2DMUA 4IF4A 3ABMH 1PVEA 3ZPLA 1VFCA 3FZVA 1UG2A 2EFPA 3V42A 4B44A 4I98B 3CCQI 4C2MJ 2R7ZJ 5L3BA 2AS5F 1VF9A 3J7ZI 3BTLA 1MJBA 5LRRA 2LNBA 3GTGJ 2MC3A 3BG9A 1HOMA 1OKRA 2M45A 5HLIA 1TWAJ 1VQ8I 5K7FA 2WAQN 3CUOA 3FIWA 1S7AA 3E6BA 3F0CA 4BQOA 1Y0UA 3ZCOA 3BR6A 5ICGA 1X58A 2ZO4A 4EV0A 4RB0A 1TZLA 3HPGA 3GYHX 2JUGA 1A31A 2H6CA 2LKXA 1G3SA 3BG6A 4M9SA 2Y30A 4ZH4F 4V2FA 2XUBA 2BY0A 3J81Z 2GM4A 3FMSA 1HBXG 4CYDA 4E7LA 3HG9A 5F1JA 3C3WA 2IBDA 1R1UA 3OIQA 2HTJA 5CYVA 2O6GE 2UXXA 1W7PA 2J5OA 4ENKA 1YX5A 5IPAA 2K9MA 3RKYA 2A68F 5FLVA 4E7KA 3OYCA 3OYGA 3DF8A 9ANTA 3OYJA 3GTMJ 4XLAA 3DKYA 3HOSA 1VQPI 1QZZA 4OIRF 1BC7C 5EG0B 3GF2A 3BOQA 4DBRA 1PJRA 2EJRA 1LDDA 1JE8A 4I6ZA 3OV8A 3ZMUA 4GYGA 5AONA 2JA7J 3C2GA 1SVLA 1KA8A 4BEHA 5ILVA 1PUFA 3I58A 1MMDA 2RVCA 4II3A 2CFOA 4PDKA 3I56I 5HLGA 3I4PA 2UUZA 1HLVA 2LLKA 3OWTA 3O3KA 1UMQA 4UVAA 1H0MA 3MZYA 2EWNA 4FHTA 3ULQB 3HPHA 5C3EJ 4IZZA 1IZ1A 2L54A 3ROUA 4LMYA 4MIMA 2GAUA 4B3AA 3ZQHA 5CJ9A 2FUG2 4XK4A 4HNTA 4HNVA 3EUAA 3I53A 1UHMA 3K70C 4E7SA 1UJ8A 2JJ7A 4UB8C 2HYGD 2X6YA 2COMA 2M0CA 2NOJB 4U7DA 3JREA 2XKOA 1FX7A 2BW3B 2L4AA 3FHZA 4N0BA 1FBQA 1YW8A 1F4KA 1R71A 3TEDA 2P4WA 1ZGWA 2DU9A 2MABA 2ZMEA 1LEAA 1R5GA 3CDLA 1BN5A 4UXNA 4KN7X 2DFHA 3QQAA 5L3CA 3KYLA 5F08A 1JUSA 3P9KA 4IRHA 3TL4X 2A5YB 1FBUA 4HSRA 2ELKA 4PFOA 2O8KA 3GTQJ 1YW9A 3GCMA 3OYHA 3LOCA 3LAPA 3CMEI 2QBYB 5E20A 1S3JA 3RQ4A 3QPSA 2FU4A 1MH4A 3E5XA 1A35A 4GXOA 2YR2A 1TW2A 3KIOA 4F91B 2LREA 4Q48A 3H0GJ 1HW5A 3L2RA 3BR3A 3RI4A 1FY7A 4G7ZF 2F5FA 3I54A 2L2OA 3CDIA 4IHTA 3Q5FA 1BBYA 2HKXA 2DYSH 3TW6A 3L2CA 3V7SA 1OCZH 3HSFA 3TBIA 5DM6F 1WRJA 2XGDA 2XIGA 1EH7A 1MMAA 4J00A 3KEOA 4HAMA 2BEOA 1Z9CA 4BXFA 2R7FA 1D5YA 3JRCA 1W5CC 1N75A 4PJ0C 1XG1A 2VKDA 3FXLA 3K4BA 1TQMA 3CCMI 2Z5UA 2PMUA 1USSA 2M87A 1YX3A 2XSDC 2OTLI 2ZSHB 2FE3A 5F0HA 3AG2H 4JQFA 1RC9A 3CJRB 4EGYA 1DU6A 1HF0A 1OCPA 1MDMA 1MSEC 2R7OA 6PAXA 3IL2A 2K02A 2FX0A 1WJAA 2W48A 5ICFA 5B1AH 2XB0X 1I39A 1EH6A 2Z99A 3PNTA 1JJ6C 3BJOA 1Z21A 2Y75A 2JMWA 3DEUA 4RM3A 3AG3H 4F93B 1U8BA 1YE9A 2WV1A 1TL8A 2A6TA 2XASA 4RB2C 1LKXA 1QPIA 3MAJA 2BW3A 4PJJA 4CA0A 2CQQA 3SYTA 5DM7F 4XRFA 4U7BA 2R7WA 3GFIA 1A04A 4KA4A 3HEFA 3VFZA 5GP9A 4QWQA 5M3FJ 3QPHA 3OYFA 3L00A 4KUMA 2R5YA 2XF6A 1QZYA 3WG9A 5IYBJ 3VODA 1BI2A 3CUQB 1ERDA 1QRYA 3L1PA 1T39A 3M8JA 2LOOA 3L9FA 4N4OB 2V9PA 4ZDPA 2CQXA 3DCFA 4F3QA 1V55H 2V1DA 1SFKA 3EUHC 3GLLA 4WK8F 1TP4A 3BC8A 2RDPA 4RGXA 3CC4I 3GTJJ 4BJ6C 2X1CA 2VJIA 2R7TA 1DDNA 2DMTA 1MBHA 2GXGA 2BYVE 3P9CA 3HHHA 2XHKA 3TDZC 3JSPA 1AOYA 3KCCA 3HRMA 1XC5A 2XKPA 2E2HJ 1X1CA 4BUPA 3ZQFA 1H88C 3H5AA 3HSRA 3R6SA 1R49A 4PJNA 2QZ8A 4IL6C 3JRAA 3CCSI 4HDVA 1D0ZA 5IP7J 1W1WE 1J2XA 4HA8A 3H92A 1IAWA 4ABZA 3CLQA 3S1RJ 3HC7A 5EG0A 2LR8A 3KP2A 1YRNB 2DPDA 1X2MA 1AWCA 2VLAA 1X1PA 4D5CA 4UHTA 1ZRDA 3PSIA 3K2ZA 1NK3P 4R1HA 3LAJA 4I0BA 3BDDA 5J1RA 2F4OB 2VI6A 4H0EA 3BR1A 4DYCA 2O0YA 1R9TJ 3MKWB 5J1YA 3UR3C 2PJRB 3O8GA 4AIDA 3H9GA 2VOOA 4EM2A 3FM3A 4ON0A 3JRBA 5H6RA 1VZ0A 3RZOJ 1QU3A 2Y0MA 2ZCWA 3BJAA 4XLCA 1X1BA 1JKRC 5H6QA 3BTIA 3I9V2 4RM2A 2ZMEC 1DU0A 5JVGF 4PGHA 2B63J 3E1SA 2E34A 5B5EC 1S29A 3MKZA 2JWTA 2XV4S 3A02A 3F21A 3QRFF 3KP5A 2XF7A 1H9GA 1D1AA 1AKHB 1OYIA 1T98A 3KP6A 4XIDA 2FJ1A 2W82A 2HDDA 4OAYA 2LDUA 4N9IA 2EA4A 1QA6A 2CYYA 2JZYA 5E1ZB 3MZHA 3FM5A 1ULYA 2D2WA 2EB7A 3S93A 5LGUA 3RCOA 4C9YA 1NHAA 3I71A 1TT0A 1OFCX 3HOWJ 1Y0NA 2BVMA 2ZFUA 2EFNA 3JRHA 3ZMVA 1ZGJA 3R61A 3N4MA 3HOYJ 1RNLA 1QHGA 4LB6B 2VT3A 3IH4A 2CUZA 4BHCA 3A2KA 3PNYA 4II2A 1WJEA 4PZJA 4CZCA 5E1XA 2NXNB 4D1QA 2HYFA 1FZPB 3LQRA 3B73A 3WTUC 1LUJB 1IRZA 1OCRH 2E1OA 2ME6A 3LSRA 3DLLF 2ESNA 5DEQA 1HKTA 2A3SA 5B66C 5IP9J 1XPXA 2L5QA 4WF2A 3CZ6A 2KRCA 1IN6A 3CJNA 4FETA 4FCYA 4NQWB 2M4GA 1GVJA 5LEKA 3NWTA 2HKOA 4DOZA 3E7LA 5DD4A 5FJ8J 4ENNA 5HODA 2IVMA 3DPLC 3REOA 4YFNF 2P5KA 1BIBA 3PFYA 1D0XA 3SQNA 5BS6A 2R7SA 2DT5A 4LIVA 5E79C 3LA2A 3LSKA 2X48A 1VQLI 1MBEA 2IJLA 2YU9J 2ECBA 2DA3A 4MQVA 3CDHA 5BOXA 3WU2C 1LFBA 4IO9F 3U21A 1ZG1A 3WODF 1SAUA 3O6BB 3B6AA 5J8FA 3H1CA 1IUYA 1GT0C 2X1DA 3RJPA 1T08B 4N4NB 4DBQA 2WBMA 4A3CJ 2KJCA 3C2BA 1Z7LA 1JT0A 2C6YA 1I1SA 4B4CA 2RAEA 2P7CB 3W2AA 1IUFA 2RREA 1Q1HA 3B02A 1SFEA 3ML6A 2RQPA 2ZNYA 4M71A 3FBIB 3K0LA 2PMZA 4G8XA 2OD5A 4OIQF 2DK8A 3OYDA 2LH9A 2NVTJ 5EZHA 3E0JB 1MBKA 1YJ9I 5C4XJ 1XX5A 3FXUA 3S2WA 3M1EA 5CQGA 2X6XA 3L7WA 4PSXA 3PIOF 3HXLA 4BAYA 1ZARA 3H35A 5HLTA 1U0JA 3CCJI 3E6MA 2CJJA 2VBZA 2MFZA 3TQNA 2VIXA 1G3YA 2K27A 1Z0XA 2DDBA 2JA2A 2KISA 3ISPA 2H6BA 1N25A 4M6VA 5EJCA 3E6CC 2DOEA 4A93J 4IOCF 1R5HA 2DMPA 5HDGA 4G7HF 2R5YB 1LVAA 5FLXZ 2OTJI 1KU3A 5J8CA 2ICWG 3PQKA 1YI2I 2PLYA 2NVYJ 4A3DJ 1XGOA 5ICEA 2K86A 2E60A 2M0MA 3W6KB 3QOPA 2HVQA 3VWBA 5FGMA 1Z77A 3BG3A 2PJPA 5A2QZ 4L9TA 3LWFA 4AVPA 2KIMA 2WWYA 4WXCA 3RIRA 4LOCA 1IC8A 3K4NA 1RR7A 1ETQA 1AU7A 2HOSA 3FMQA 3NARA 4QPQA 3OYKA 4XKWA 1ZHFA 2D1VA 2I8DA 3BR5A 1G3WA 3S3OA 2FOKA 3BPVA 2F2EA 1M1EB 2DJIA 2OZUA 4B09A 3E3VA 1F5TA 1KQ0A 4R79A 3IAS2 2N8GA 5FKKA 2DMQA 1ETKA 5BMZA 1YJNI 1FMVA 4KYWA 2UWMA 2KHMA 4P9UA 3MKYB 2CW7A 3T8RA 2DMNA 2KKOA 3CCUI 3CESA 3S3NA 1L3LA 2EILH 4XSXF 2CWEA 1E0EA 1ZQ3P 1J09A 2K85A 4G6DA 3HKZN 1ONVA 2GQQA 3EUHA 2XF5A 2TDXA 3ECHA 1MMSA 2STWA 3ZP5A 2PJRA 2HR3A 1XS9A 1STZA 1VQNI 2F5CA 5FKOA 2VBXA 3MQ0A 2F5EA 1ZRFA 2QSHX 1GHCA 3KLOA 3L2VA 1XGMA 2JPBA 4BE2A 3DU5A 2E7WA 2BY3A 3L2WA 2QVOA 5F6FA 2JTVA 2CW8A 1TNSA 4HDUA 4IEJA 5IT3A 2FBIA 3U2RA 3SFIA 3W6VA 3LSTA 1DGRM 1T8IA 5AIQA 2OA4A 4A5NA 5JLWA 4ZJZA 5KCMA 2GZWA 4PSWA 3NEUA 2HVSA 1V54H 3S15J 5FD6A 4XONA 4IXAA 5FFXA 3MKLA 1QO0D 1ZKGA 3K4MA 4U87A 5FKMA 5EF6A 1RUNA 2MD0A 5D5XB 3C18A 1JUPA 3HUGA 3HL2A 1WJBA 3K1PA 2PFBA 5KHDA 2L01A 2DFIA 2AXTC 1E3HA 1FTZA 3CMYA 3E5UA 2EZKA 1NK2P 4HEA2 2XAQA 1NTCA 2L7ZA 1ZYRF 4ZYGA 2WADA 3CCYA 4XMYA 2H27A 2DOFA 3EQLF 3HGGA 4RGUA 5BPDA 4IRIA 5EEAA 1K4SA 2XRLA 3GFMA 3CD6I 2DA6A 1SVOA 3LQQA 2BVLA 3F3XA 3QODA 5FKNA 1ZREA 2H94A 2XAFA 4B48A 4LK0F 4KJZA 5BNGA 2VXZA 2VB6A 4O6JA 3G4SI 1T0FA 1GDTA 1MD0A 1H8AC 3BTJA 1D3YA 3HOUJ 3FISA 3BY6A 2HU9A 3P5JA 3QPLA 2DTZA 4ZZDA 2CUEA 4WXDA 5AIPA 3OYEA 4DYRA 3UNGC 2JVGA 2EQRA 5IOYA 4IHYA 2O8XA 1SVMA 2FBHA 3G3ZA 4QIWN 3ZQ7A 2ELHA 2QCOA 2GLOA 1XCVA 1X3ZB 2ECCA 4I02A 3ZMDA 1MSFC 2O7OA 1P9QC 1P2FA 4E7JA 2X6WA 2EZLA 3DEEA 3F6OA 1FIAA 2ISZA 1O7FA 1WKMA 3DQVC 1U78A 4L9VA 1UZCA 4MEXF 4DZJA 3V8LA 1FTTA 3I4NJ 3ABUA 1BI0A 4ITVA 1U2WA 4CGZA 2ZXWH 3D5SC 3A4CA 3L09A 3IRQA 3QPTA 4EM0B 2ZJPF 4AVZA 1OYWA 5DTDA 1Z6RA 4MFDA 2H8RA 5HS9A 2XC7A 4IX7A 4KDPA 3KYDB 2KL4A 3Q9SA 2XGXA 2Y31A 2M34A 1RR8C 1P4XA 1S7EA 1ON2A 5ICCA 1WFXA 5BQTA 2K9QA 3COAC 3ZN0A 2E1MC 5LHHA 2XAGA 3HDDA 4BU2A 4LLGF 1MBGA 2VE8A 1MNMC 2E71A 4NBQA 2NYXA 2DLLA 3VYUB 3FHNA 3BPXA 3F8NA 5TJJA 1R7JA 3KEYA 1LNWA 1K4TA 3M3YJ 2FBKA 3HM5A 4QSHA 2V1UA 4BBSJ 2MH9A 2NS0A 2FXAA 4MGRA 4UB6C 5DUKA 1F9NA 4G9YA 1S9HA 1XMAA 3RTRA 1K78A 2IA0A 2RNJA 2NOGA 1S6LA 2EFWA 5GTHC 5E18F 3ZQCA 1R58A 4OIOF 2R7XA 3HZJA 4BE0A 4KNYA 5ED4A 5JHFA 4H4KC 2AQFA 5LGTA 3CUQC 3AAFA 2IGNA 1LPQA 2V1XA 4E7HA 2F5DA 2L02A 1QNTA 4RA2A 5F04A 1TC3C 1X3UA 2MLKA 1U5TC 1ON1A 2IS6A 2X51A 4HW0A 4Y4RA 3TMOA 2PBIA 3J7YJ 2RV8A 3E6DA 3J81K 2VODA 1UG0A 3L2QA 2IT0A 3TO6A 4D7MA 2IXSA 4AWXB 2M2EA 1Z1DA 3FKJA 1P7IA 1TQPA 1O7LA 5DUIA 4XLNF 4IQJA 1ODDA 3W2WA 2CSOA 5K5OA 2PMHA 1L0OC 2FA5A 3HIFA 5FRMA 2FNPA 4AYBA 5LHGA 3DPUA 4FTHA 2R3SA 2NNYA 3NWSA 5LHIA 2Y9ZA 4M6XA 2GIZA 4BHBA 4AYBN 3KP4A 5D5WB 2HOTA 3QOEA 1I5ZA 1TWFJ 1DUXC 2L7KA 3IH3A 2CV2A 3WHBA 4PCQA 3OY9A 4Q47A 4M3EA 4CCNA 2B7EA 1OCCH 4M72A 4XORA 2LKPA 4ANJA 4W97A 1HQCA 3FXOA 2JA5J 3GWZA 2L9SA 4HSTA 3TP0A 2LF7A 2QLZA 1T38A 2QF7A 5L3DA 2FF4A 5HS8A 2CO5A 4XKVA 2ZSIB 4I7HA 4AIHA 2LBFB 3F9KA 4GFBA 3KEQA 3U1DA 2GOMA 1IXCA 4RAFA 5K7HA 1XB4A 2K3FA 3OS0A 1VQOI 4IHVA 1VQKI 3PUBA 2QQAA 1XGSA 3DBRB 2M4KA 4OMZA 3LSHA 1SFUA 5J47A 4PGGA 3K4KA 2X6OA 3V7CA 3VB2A 4CSWA 4IRGA 1MMGA 3T8TA 2HPIA 1R6RA 2V7FA 3MN2A 1C0WA 1ZTRA 1S8NA 2LMDA 3ABKH 1X1DA 3ZQQA 2OC6A 3LFUA 4NNJA 3V8JA 4XLPF 5IYDJ 2HEOA 4MEYF 3HRSA 4HG2A 2NVXJ 3PSFA 1F36A 1ZH5A 4MTDA 3G2BA 3JCUC 1XSXA 1U9NA 1OPCA 2RKHA 1AHDP 1CQTA 2MGQA 1TWHJ 3S16J 1I50J 1ITYA 4BH9A 2DOAA 4ZYEA 2EV6A 3K4LA 1EKEA 2WA0A 2LY9A 2OCCH 3EETA 1GXPA 1WGXA 3LA7A 5IT9K 4RGRA 3FXQA 1QQIA 3X2QH 1HKQA 2G7HA 2NS8A 2O5RA 1ZG5A 1BR2A 1K6OA 5E3OA 3U9GA 3DV8A 4X0GA 3PQJA 1Z7UA 4JYKA 4DGWB 3BG7A 2E5NA 2EV0A 3NAUA 2HTSA 4NDLA 1YITI 1VQ9I 3T0YA 1YIOA 3G1MA 4LGWA 4E4HA 1XCBA 1B8IA 2R5ZB 4B3XA 4CCKA 3S1QJ 3SEZA 4RS8A 4UY8I 3M07A 5A2QK 3M8EA 4C3JJ 3H36A 3MFKA 2FNAA 1BR1A 4EEFG 1RZ4A 1JI8A 5GAEJ 1ACIA 5CPRB 3BQZA 4BYYA 5IT9Z 2ZC2A 2PG4A 4A0ZA 3R60A 3H9QA 2G7UA 1Y56A 2IS4A 3OL3A 3H0DA 1YQAA 3DKWA 3S8PA 1A36A 2DJNA 2V79A 1IN4A 3ERED 3HOZJ 4RMNA 1BM9A 3GVAA 2R0QC 1LQ1A 5L3FA 3PO2J 1DQUA 3CP2A 5FB2A 1I1GA 1ZLKA 3A01B 2JK3A 3N05A 1WJDA 3IP4B 4Y17A 2VASA 4LG3A 3OR1C 4L9NA 4XL9A 2BHZA 5FKLA 2M7AA 2EZHA 2HDCA 2XGEA 3DBLB 2FMLA 2BBYA 4XN0A 3GZ6A 2IS1A 2KRHA 4L0YB 1IRGA 5JHUA 5DYMA 2HQAA 2W85A 2M3AA 4U0WA 4MHGA 4KIFA 3OR2C 2K4JA 3GZ5A 1J5YA 4XLEA 2CW0F 3FX3A 2ELJA 4JBAA 3WTSC 2A69F 1WSUA 3GX4X 4K2EA 4Z2YA 3JRFA 4JP0A 1I6HJ 3QYEA 2M8GX 1EV7A 3F23A 3PJRA 2K9LA 4FE7A 2ZXIA 3RPUA 4RBOA 2GWRA 4UUTA 3KETA 1W7PD 1MH3A 3HBLA 2WTEA 5LLQA 3H3ZA 2IAIA 2L3DA 3EYIA 1FP2A 1WI9A 2KT0A 4M3BA 5L3GA 4ENMA 4A3EJ 4PJLA 4WWCA 1MBFA 3K4JA 2DN0A 3CMAI 1W4MA 2V6CA 3ZQIA 3KX2A 2CQKA 4FX4A 2FQ4A 4EVIA 1HC8A 3GZNB 3M1CA 4YEJA 3ZQLA 2MLGA 2ACJA 5DDGA 1SMTA 4BXUA 1WQ2A 2LTPA 3RYRA 2HFHA 4KIGA 2KLOA 3GEZA 4XBFA 1JUMA 2VUMJ 1BW5A 1D1CA 1IDYA 2XAJA 3DBHB 4L5EA 1OR7C 3TOAA 3OYAA 3MD2A 4LFUA 2P81A 4J01A 2W1OA 3IKTA 2VC1A 1BIAA 4CYCA 2HXOA 4HOBA 4NQWA 1R4MB 1B1BA 3WG7H 1ETXA 4L18B 4A3JJ 1WHUA 2FSWA 3FK7A 3GLXA 5HLHA 3WE2A 4KT5C 1FOKA 4G6TB 2HXIA 2EZIA 1IF1A 5LGNA 3PM1A 2ME0A 4KISA 4GGGA 4BS9A 1OQYA 5EDNA 1Y8RB 1LE8B 3NQOA 3ZMTA 5M5WJ 1LDKB 4F52A 3G1LA 1HCRA 2CMPA 3LFKA 3KE2A 4BJTA 5FRNA 4ZDOA 3ABTA 3D1NI 4Y13A 4A3FJ 3K9TA 4CDGA 3IV5A 4QTRA 1LJ9A 1S7OA 2HI3A 3CCVI 4YIFA 2HQ5A 3G6EI 3CO6C 3K2AA 1I6XA 3SJMA 4XSZF 4J19A 1BW6A 4AC0A 1A6IA 1E3PA 2I10A 5JR3A 3H3UA 2ADUA 1G6NA 3WTXC 1ZAOA 4XLFA 2KIQA 5CLSA 3A0BC 5LFAA 2OZ6A 2DA4A 2E5ZA 1W36C 1VQ5I 3PL8A 2IRFG 5D8KB 3WTVC 3ZGKA 4ZTJA 2CV0A 3PO3J 2H8WA 3GUDA 3Q9VA 3SZTA 2P6TA 4GCVA 2W7NA 3TP3A 2QSFX 2X1EA 1KZHA 3S14J 1JGGA 2BE5F 2DAOA 1O3QA 3JAMK 3AG1H 4C3HJ 2CGPA 4IPAA 1Z3XA 4YRVA 2IP2A 2LBFA 1ENHA 5F0FA 5E3NA 1CF7A 3TW7A 4BY7J 3LL7A 5H20A 4A6DA 5HDKA 3J80Z 5JFRA 2E35A 1MGTA 4OAZA 2JN6A 1ZG3A 1W0TA 1O57A 3B6CA 4JX5A 2DT7B 4CCMA 2D45A 1KU9A 2KZVA 3SEQA 4CYCB 3GTLJ 2YS9A 4C2UA 3SZGA 1W36D 2FMYA 2WAEA 1KQ9A 1SEUA 2UV1A 3CLOA 3K4CA 3JRGA 4X6AJ 3EYYA 2R4GA 5TRDA 2OU2A 4EJTA 1HDDC 1JXSA 2CG4A 2DDAA 5ILUA 2QEXI 2EK5A 3HTUA 1D5VA 2XPWA 4A3MJ 4Q5SF 1W7PB 2DFEA 2Y2ZA 1QGPA 2IEKA 2LYCA 3H5RA 3FKIJ 3H9JA 3BZKA 1FIPA 2VPLA 2A61A 3M9AA 4P55A 1HSTA 5CVUA 4LIUA 4DNCA 2HNHA 3OMYA 2Z2SB 1IO2A 3FXKA 3R0AA 1G59A 1DPRA 1KONA 3M8FA 2VONA 4C3IJ 4I09A 5FD5A 2GA2A 3WU0A 5GAHJ 4RAZA 4I76A 4UVCA 2PN6A 5ILSA 1ZN2A 5IP6A 2LG4A 4OWRB 2GA1A 1PP8F 1K7AA 1UELB 3HJEA 5C44J 4XM3A 5D4SA 4HV5A 3HSEA 1HDPA 3SZPA 4BL0B 2KRFA 5M5XJ 2R5ZA 2WY8Q 4D5FA 4LG0B 1R5ID 4A3BJ 2BZTA 1YLFA 3E97A 1R4NB 1SD5A 2K9NA 1QZEA 3HYIA 2BY1A 4HQEA 2HYJA 3O2PE 2QGUA 2XDVA 4HF0A 4G94A 1JGSA 1P92A 3OOPA 4AD9A 5KVRA 5FLXK 3G1OA 2WB1N 3I59A 1WJ5A 1IDZA 3FMRA 1CGPA 2IA1A 2LK2A 1FOWA 3S3MA 2A6EF 4FQGA 1U9OA 4IKFA 5ERIA 1ZGAA 3DLAA 1HKSA 4M3FA 2V9VA 3A0HC 3OYLA 3FBNB 4HX8A 4RGSA 1HA8A 3CQZJ 4OIPF 2ZMEB 2EPFA 5M5YJ 1R00A 2E1CA 2DODA 4M6YA 3OL4A 4AUXA 4WX9A 1XSDA 1O4XA 2HQRA 4DW6A 1O3SA 2OQRA 4DQ2A 4AIJA 3ZQGA 3J80K 2STTA 1JJ8C 2E2JJ 4NHJA 4U0VA 1T2KA 2E1NA 2E2IJ 3BQYA 1MKMA 2PI0A 4HX4A 4XRSG 4R8HA 5J40A 3C7JA 2MSYA 1ORKA 1TWGJ 2L0KA 4F55A 4UV8A 2VBYA 3Q0VA 2XRNA 3QWLA 2QWWA 3GFJA 5GAGJ 4S05A 3BR0A 2VL8A 3OS2A 4XQFA 2VQGA 4KITB 1MJ9A 4B8XA 3H5NA 3MEXA 1U3EM 3S32A 4O5VA 1IG7A 1A5JA 3I3LA 2ZJ2A 3QU3A 3RQIA 4F7ZA 2DBBA 2Q1ZB 3CCLI 5F1RA 1NH3A 2VXDA 2VKVA 2XSJC 1SD4A
chains in the Genus database with same CATH topology
2YSRA 2FQ3A 3JTHA 1KU2A 3SFZA 3W6JB 1G4DA 3P7NA 1KYZA 3TKYA 3SXYA 1QBJA 1B9NA 5DV5A 5D6FA 4OMYA 5HS7A 4M74A 1U8RA 5HOOA 2YPRA 1LB2A 1DPUA 2HS5A 4U0YA 4IHSA 5E1WA 2Z9OA 2Q8KA 1RUOA 2DO7A 4EM1A 1B4AA 1MZBA 3PFIA 4G7OF 1JHFA 1EH8A 5CVVA 2MH2A 3I0TA 1XD7A 2ZXJA 1HW1A 2VC0A 5E8IA 2A6HF 1USTA 5D6EA 4UV9A 1K78B 3CO7C 1J0RA 4BQAA 4M9XA 4KICA 3DXJF 4HLXA 1PDNC 5D4RA 1SMYF 1FYMA 3WGGA 2P5LC 3K1MA 3I5UA 2ZFWA 2YU3A 3D0SA 4LG0A 3WTZA 4EMSA 4L0ZB 3WGIA 3KFWX 2P7VB 1XGNA 3RPQA 2DW4A 4BNCA 1Z6TA 1YO5C 1KU7A 1LDJA 2EFQA 1CF7B 3TO9A 1YW7A 2KIUA 4LJZF 4CHUA 4A0YA 1FYKA 1UB9A 4HLYA 1FLIA 1J75A 3BZ6A 1D8JA 5JI6A 1GXQA 1TW3A 2QUFA 1IN5A 2PEXA 2YX7A 5FFZA 2MBFA 4ETSA 3QAHA 3EDPA 3QU6A 3WTTC 3MWMA 5D5UB 4CZZA 4WCGA 3DP7A 4OINF 2ZBKA 1SAXA 1YS7A 1YTYA 3P9IA 2K4BA 3HHGA 5LBQA 1OR7A 2DK5A 1PUEE 3TDUC 3BROA 1JHHA 3JAMZ 3KLNA 5HVQC 4MTEA 1IW7F 2W24A 3IHUA 1FSEA 4A12A 2HWVA 2KJBA 3WTYC 3HRUA 1FBSA 1P4WA 5E8GA 5J6XA 2UZKA 5HDNA 3T1BA 4ESJA 4CXFA 3IRRA 4BHPA 4ZZLA 2P6SA 5DD8A 4A0XA 3KZYA 1K79A 3CTAA 1J9IA 1R1TA 4QLCU 2HZTA 4D0PA 3RDIA 4IVNA 2ZNZA 1OYYA 4LB5A 3F8BA 1Z05A 1J59A 5D5VB 4I01A 3IWFA 3IC7A 5DCFA 3M7GA 3GO5A 3TOBA 2XVCA 3F22A 2MA3A 2GXBA 4YIIA 3RKWA 4YFXF 2FRHA 1V3FA 1ZRCA 1TLHB 1FNNA 3ELKA 2JRTA 3MCZA 3N97A 1H9TA 4P96A 4ESFA 1DP7P 1QPMA 1P4AA 2OQGA 4LLLA 4KMUX 2P5VA 3RKXA 3F8MA 3FF5A 3JSOA 4I0AA 2Y48A 1YS6A 1F1ZA 2J5PA 4UUVA 4EJUA 1W5TA 5DCMA 4IJAA 5KK1A 3ZMSA 2VOPA 4MQ9F 2X4HA 1ZLJA 3K1NA 1UFMA 4HX7A 1XMKA 2HGCA 5F64A 1R23A 3ECOA 1RI7A 1BC8C 4ZYHA 3J7AO 3TO7A 4M73A 4N9HA 2NNNA 2QBYA 3IWZA 4RB1A 3VOEA 5K5RA 4I2OA 4KMFA 3D5LA 4LD5A 2OAZA 2DTRA 5K1YA 2IPQX 4HYEA 1R22A 3FWEA 4YG2F 4UVBA 2X0LA 5CVIA 2KIFA 2QQBA 2NAZA 4OOIA 2QYOA 2B0LA 2UXNA 4L5IA 1T6SA 3KP7A 3SHFA 2GIVA 2RN7A 1BJAA 2ISYA 2O61A 2WC2A 5E17F 3BWGA 2QQ9A 5L3EA 4HQMA 2G9WA 5DCMB 2O03A 4LK1F 4A2UA 1IN8A 4FX0A 3G73A 1TBXA 4JK1X 2WV0A 1FP1D 4ASNA 1XDUA 1XN7A 3WU1B 1U5TA 1YYVA 3DPTA 4KN4X 3V8KA 4CO8A 4L9JA 5BPIA 1UHWA 3V7RA 2H09A 1B6AA 5CVJA 2L4MA 2HOEA 2EV5A 1IXSB 1IXRC 2VT2A 4UNOA 4HBLA 2IW5A 5EEGA 3KP3A 1BI1A 4A6EA 1FYLA 3QP6A 3T5XA 1B59A 1P6RA 3R0JA 3WGHA 2MD5A 1YFHA 4ZYDA 1VTNC 4U88A 1V4RA 1SFXA 1RIOH 4GYIA 2DPUA 4Q4ZF 2QM3A 2VBWA 4CICA 4HF2A 3GW2A 2EA2A 4A5MA 4WXHA 2HQNA 1KQ8A 3F72A 2AXLA 2NRAC 4RAYA 3I59B 3RYPA 3R4KA 1UCRA 1KGSA 2W84A 1FSHA 1SD7A 3F8CA 4RB3C 2ZKZA 1TQIA 1KYWA 4EJOA 2YX4A 4P5OA 1E2XA 2PQ8A 1MJAA 2EFOA 1WWXA 5FO5A 3LA3A 4G6QA 4KFCA 2VN2A 3FXRA 2M5WA 2XROA 4EJVA 2Z33A 4EJWA 3BP8A 4KIBA 2VE9A 2E7XA 2DQRA 3IKVA 1IN7A 1REPC 1HXDA 1FC3A 1SD6A 2IA2A 4HV6A 5JVTA 1BOAA 2M1BA 2XAHA 4M9ZA 4GO1A 4ENJA 3BJ6A 3HOTA 1LEBA 3F8FA 1FWZA 4S04A 3WE3A 3K69A 2LF8A 1Z91A 2BV6A 3TGNA 2Q2EA 4Y15A 2QENA 1O3RA 4P9FA 4ESBA 1I27A 1FT9A 4FT8A 2ETHA 1TNTA 3HTSB 3WTWC 1R1VA 4EGZA 3VEPA 2Z3YA 4NB5A 4LLNA 3GXOA 4YFKF 1G3TA 1U6GA 2JT1A 4HF1A 2M30A 3GFLA 3ZN1A 2O3FA 5D8LB 2ESHA 1HW2A 5EEHA 5CVRA 3KZZA 2K7LA 2JPCA 4HZFA 1D8KA 4L5JA 1XSVA 4OU0A 3C1DA 1PP7U 3F6VA 1IRFA 2DI3A 1O3TA 2BGCA 5K5QA 3I64A 1XDSA 2DQLA 1MDMB 4AIKA 2CFXA 4MNUA 2A07F 2Q0OA 1FPQA 2LSOA 1R36A 3ZMZA 2OBPA 2W57A 1J7KA 3JW4A 2M8EA 3DFGA 1B9MA 1U5TB 3NRVA 3HRTA 4EQQA 1BI3A 1OMIA 3QP5A 2P8TA 4E70A 2JSCA 2D1HA 2R7DA 1W5SA 3CUQA 1E17A 4O3MA 1TTYA 2RGVA 1HSJA 4TV7A 2RC4A 5LRSA 1YG2A 3V4GA 3JTGA 3E5QA 2W25A 2FEZA 5LEJA 4IF4A 3ZPLA 3FZVA 2EFPA 4I98B 5L3BA 2AS5F 1MJBA 5LRRA 2LNBA 2MC3A 1OKRA 2M45A 5HLIA 3CUOA 1S7AA 3E6BA 1Y0UA 5ICGA 2ZO4A 4EV0A 4RB0A 3GYHX 2H6CA 1G3SA 4M9SA 4ZH4F 2XUBA 3J81Z 3FMSA 1HBXG 4CYDA 3C3WA 1R1UA 2HTJA 5CYVA 2O6GE 2UXXA 1W7PA 2J5OA 4ENKA 3RKYA 2A68F 3DF8A 3HOSA 1BC7C 1QZZA 4OIRF 3GF2A 3BOQA 1JE8A 2EJRA 1LDDA 3OV8A 3ZMUA 4GYGA 5AONA 1KA8A 5ILVA 3I58A 2RVCA 4PDKA 5HLGA 3I4PA 3O3KA 4UVAA 1H0MA 3MZYA 2EWNA 4FHTA 3ULQB 1IZ1A 2L54A 3ROUA 4LMYA 2GAUA 5CJ9A 3I53A 1UHMA 2HYGD 2COMA 4U7DA 2XKOA 1FX7A 2L4AA 3FHZA 4N0BA 1FBQA 1YW8A 1F4KA 2P4WA 2DU9A 2ZMEA 1LEAA 1R5GA 1BN5A 4UXNA 4KN7X 5L3CA 3P9KA 4IRHA 2A5YB 1FBUA 1YW9A 3LAPA 2QBYB 5E20A 1S3JA 2FU4A 3E5XA 4GXOA 2YR2A 1TW2A 4Q48A 1HW5A 3RI4A 1FY7A 4G7ZF 2F5FA 3I54A 4IHTA 3Q5FA 1BBYA 2HKXA 3L2CA 3V7SA 3HSFA 1WRJA 2XIGA 1EH7A 3KEOA 4HAMA 2BEOA 1Z9CA 2R7FA 1TQMA 2Z5UA 2PMUA 1USSA 2M87A 2FE3A 4JQFA 4EGYA 1MDMA 6PAXA 3IL2A 2K02A 5ICFA 1EH6A 2Z99A 3BJOA 2Y75A 3DEUA 2XASA 4RB2C 3MAJA 4XRFA 4U7BA 3GFIA 1A04A 4KA4A 3VFZA 4QWQA 3QPHA 3L00A 4KUMA 1QZYA 3WG9A 3VODA 1BI2A 3CUQB 1T39A 3L9FA 2V1DA 4WK8F 2RDPA 4RGXA 1DDNA 2GXGA 2BYVE 3P9CA 3HHHA 2XHKA 3TDZC 3JSPA 1AOYA 3KCCA 3HRMA 2XKPA 3HSRA 3R6SA 2QZ8A 4HDVA 1J2XA 4HA8A 3H92A 1IAWA 3KP2A 2DPDA 1AWCA 4UHTA 1ZRDA 3K2ZA 4R1HA 3LAJA 4I0BA 3BDDA 4H0EA 2O0YA 2VOOA 4EM2A 3FM3A 4ON0A 5H6RA 2Y0MA 2ZCWA 3BJAA 5H6QA 4PGHA 1S29A 2XV4S 3F21A 3QRFF 3KP5A 1H9GA 1OYIA 1T98A 3KP6A 2LDUA 4N9IA 2EA4A 2CYYA 2JZYA 5E1ZB 3MZHA 3FM5A 1ULYA 2D2WA 2EB7A 5LGUA 1NHAA 3I71A 3N4MA 2EFNA 3ZMVA 1ZGJA 3R61A 1RNLA 4LB6B 2VT3A 4BHCA 4PZJA 5E1XA 2HYFA 1FZPB 3LQRA 3B73A 3WTUC 2ESNA 5DEQA 1HKTA 2A3SA 4WF2A 3CJNA 1IN6A 1GVJA 5LEKA 2HKOA 5DD4A 4ENNA 2IVMA 3DPLC 3REOA 4YFNF 2P5KA 1BIBA 5BS6A 3SQNA 2DT5A 3LA2A 2IJLA 4MQVA 5BOXA 3CDHA 1ZG1A 3WODF 3O6BB 5J8FA 1IUYA 3RJPA 2KJCA 2C6YA 1I1SA 2P7CB 1Q1HA 3B02A 1SFEA 3ML6A 2RQPA 2ZNYA 4M71A 3K0LA 4G8XA 2OD5A 4OIQF 2DK8A 3S2WA 3FXUA 3M1EA 3L7WA 4BAYA 1ZARA 3E6MA 2VBZA 3TQNA 1G3YA 2K27A 3ISPA 2H6BA 3E6CC 1R5HA 5HDGA 4G7HF 1LVAA 5FLXZ 1KU3A 5J8CA 2PLYA 3PQKA 1XGOA 5ICEA 2K86A 3W6KB 3QOPA 5FGMA 2PJPA 5A2QZ 4L9TA 3LWFA 4AVPA 2KIMA 2WWYA 4WXCA 3RIRA 3FMQA 1ZHFA 2D1VA 1G3WA 2FOKA 3BPVA 2F2EA 2OZUA 4B09A 3E3VA 1F5TA 1KQ0A 4R79A 5BMZA 4KYWA 2UWMA 4P9UA 3T8RA 2KKOA 1L3LA 4XSXF 2CWEA 4G6DA 2GQQA 1ONVA 3EUHA 2TDXA 3ECHA 2STWA 3ZP5A 2HR3A 1STZA 2F5CA 2VBXA 3MQ0A 2F5EA 1ZRFA 1GHCA 3KLOA 1XGMA 2JPBA 2E7WA 2QVOA 5F6FA 2JTVA 1TNSA 4HDUA 5IT3A 2FBIA 3U2RA 3LSTA 5AIQA 2OA4A 4A5NA 2GZWA 3NEUA 5FD6A 4IXAA 5FFXA 1QO0D 1RUNA 5D5XB 3C18A 3HUGA 3K1PA 2PFBA 2L01A 2DFIA 3E5UA 2XAQA 1ZYRF 4ZYGA 2H27A 3EQLF 4RGUA 5BPDA 4IRIA 3GFMA 3LQQA 3F3XA 1ZREA 2H94A 2XAFA 4LK0F 2VXZA 4O6JA 1T0FA 1MD0A 1D3YA 3BY6A 4ZZDA 4WXDA 5AIPA 2O8XA 2FBHA 3G3ZA 3ZQ7A 2ELHA 1XCVA 4I02A 3ZMDA 1P2FA 3F6OA 2ISZA 1O7FA 1WKMA 3DQVC 1U78A 4L9VA 4MEXF 3V8LA 3ABUA 1BI0A 1U2WA 4CGZA 3L09A 3IRQA 3QPTA 4EM0B 1OYWA 1Z6RA 5HS9A 4KDPA 3Q9SA 2XGXA 1P4XA 5ICCA 1ON2A 5BQTA 3COAC 3ZN0A 5LHHA 2XAGA 4LLGF 2VE8A 2NYXA 2DLLA 3BPXA 3F8NA 5TJJA 1R7JA 1LNWA 2FBKA 2V1UA 2MH9A 2NS0A 2FXAA 4MGRA 5DUKA 1F9NA 4G9YA 1XMAA 3RTRA 1K78A 2IA0A 2RNJA 1S6LA 2EFWA 5E18F 1R58A 4OIOF 4KNYA 5ED4A 5LGTA 3CUQC 3AAFA 2V1XA 2F5DA 2L02A 1QNTA 1X3UA 2MLKA 1U5TC 1ON1A 4HW0A 2PBIA 2RV8A 3E6DA 3J81K 2VODA 2IT0A 3TO6A 4AWXB 1Z1DA 1TQPA 1O7LA 5DUIA 4XLNF 1ODDA 2CSOA 5K5OA 2PMHA 1L0OC 2FA5A 3HIFA 2FNPA 5LHGA 2R3SA 2NNYA 5LHIA 4M6XA 4BHBA 5D5WB 3KP4A 1I5ZA 1DUXC 4PCQA 4Q47A 4M72A 2LKPA 1HQCA 3GWZA 2LF7A 2QLZA 1T38A 5L3DA 2FF4A 5HS8A 2CO5A 4I7HA 4AIHA 3KEQA 3U1DA 1IXCA 1XB4A 2QQAA 1XGSA 4OMZA 1SFUA 4PGGA 3V7CA 3VB2A 4IRGA 3T8TA 1C0WA 1S8NA 3V8JA 4XLPF 2HEOA 4MEYF 3HRSA 1ZH5A 4MTDA 1XSXA 2RKHA 1OPCA 4BH9A 4ZYEA 2EV6A 3EETA 1GXPA 3LA7A 5IT9K 4RGRA 3FXQA 1QQIA 1HKQA 2G7HA 1ZG5A 1K6OA 3U9GA 3DV8A 3PQJA 1Z7UA 2EV0A 2HTSA 3T0YA 1YIOA 4LGWA 1XCBA 4RS8A 5A2QK 3M8EA 3MFKA 2FNAA 1RZ4A 4BYYA 5IT9Z 2PG4A 4A0ZA 3R60A 2G7UA 1YQAA 3DKWA 2V79A 1IN4A 3ERED 1BM9A 3GVAA 1LQ1A 5L3FA 5FB2A 1I1GA 1ZLKA 4Y17A 4L9NA 2HDCA 2FMLA 2BBYA 3GZ6A 4L0YB 1IRGA 5JHUA 5DYMA 2W85A 4U0WA 4MHGA 4KIFA 2K4JA 3GZ5A 1J5YA 2CW0F 3FX3A 4JBAA 3WTSC 2A69F 1WSUA 3GX4X 4K2EA 4Z2YA 1EV7A 3F23A 3RPUA 2GWRA 3KETA 1W7PD 2WTEA 5LLQA 3H3ZA 2L3DA 3EYIA 1FP2A 1WI9A 5L3GA 4ENMA 4WWCA 1W4MA 2V6CA 2CQKA 4FX4A 4EVIA 2MLGA 2ACJA 5DDGA 1SMTA 4BXUA 1WQ2A 3RYRA 2HFHA 4KIGA 3GEZA 4XBFA 2XAJA 3TOAA 4LFUA 3IKTA 2VC1A 1BIAA 4HOBA 4NQWA 1B1BA 4L18B 2FSWA 3GLXA 5HLHA 3WE2A 4KT5C 1FOKA 1IF1A 5LGNA 4GGGA 3NQOA 3ZMTA 1LDKB 3LFKA 3KE2A 3ABTA 4Y13A 3K9TA 4CDGA 1LJ9A 1S7OA 4YIFA 3CO6C 1I6XA 4XSZF 5JR3A 3H3UA 2ADUA 1G6NA 3WTXC 1ZAOA 5CLSA 2OZ6A 2IRFG 5D8KB 3WTVC 3GUDA 3Q9VA 3SZTA 2P6TA 4GCVA 2BE5F 2DAOA 1O3QA 3JAMK 2CGPA 4IPAA 2IP2A 1CF7A 5H20A 4A6DA 5HDKA 3J80Z 5JFRA 1MGTA 1ZG3A 1O57A 2D45A 1KU9A 2FMYA 1KQ9A 3CLOA 3EYYA 5TRDA 2OU2A 4EJTA 1JXSA 2CG4A 5ILUA 2EK5A 3HTUA 1D5VA 4Q5SF 1W7PB 1QGPA 2A61A 3M9AA 4P55A 1HSTA 5CVUA 4DNCA 3R0AA 1DPRA 3M8FA 2VONA 4I09A 5FD5A 3WU0A 2GA2A 4RAZA 4UVCA 2PN6A 5ILSA 1ZN2A 2GA1A 1PP8F 1K7AA 5D4SA 4HV5A 3HSEA 3SZPA 2KRFA 4LG0B 1YLFA 3E97A 1SD5A 3HYIA 4HQEA 3O2PE 4HF0A 4G94A 1JGSA 1P92A 3OOPA 4AD9A 5KVRA 5FLXK 3I59A 3FMRA 1CGPA 2IA1A 2A6EF 5ERIA 1ZGAA 1HKSA 2V9VA 4HX8A 4RGSA 4OIPF 2ZMEB 2E1CA 1R00A 4M6YA 4WX9A 1XSDA 2HQRA 1O3SA 2OQRA 4DQ2A 4AIJA 3J80K 2STTA 4NHJA 4U0VA 1T2KA 2E1NA 1MKMA 2PI0A 4HX4A 4R8HA 3C7JA 4UV8A 2VBYA 2XRNA 2QWWA 3GFJA 4S05A 1MJ9A 4B8XA 3MEXA 1U3EM 4O5VA 3QU3A 2ZJ2A 4F7ZA 2DBBA 5F1RA 1SD4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YSR A;  2FQ3 A;  3JTH A;  1KU2 A;  3SFZ A;  3W6J B;  1G4D A;  3P7N A;  1KYZ A;  3TKY A;  3SXY A;  1QBJ A;  1B9N A;  5DV5 A;  5D6F A;  4OMY A;  5HS7 A;  4M74 A;  1U8R A;  5HOO A;  2YPR A;  1LB2 A;  1DPU A;  2HS5 A;  4U0Y A;  4IHS A;  5E1W A;  2Z9O A;  2Q8K A;  1RUO A;  2DO7 A;  4EM1 A;  1B4A A;  1MZB A;  3PFI A;  4G7O F;  1JHF A;  1EH8 A;  5CVV A;  2MH2 A;  3I0T A;  1XD7 A;  2ZXJ A;  1HW1 A;  2VC0 A;  5E8I A;  2A6H F;  1UST A;  5D6E A;  4UV9 A;  1K78 B;  3CO7 C;  1J0R A;  4BQA A;  4M9X A;  4KIC A;  3DXJ F;  4HLX A;  1PDN C;  5D4R A;  1SMY F;  1FYM A;  3WGG A;  2P5L C;  3K1M A;  3I5U A;  2ZFW A;  2YU3 A;  3D0S A;  4LG0 A;  3WTZ A;  4EMS A;  4L0Z B;  3WGI A;  3KFW X;  2P7V B;  1XGN A;  3RPQ A;  2DW4 A;  4BNC A;  1Z6T A;  1YO5 C;  1KU7 A;  1LDJ A;  2EFQ A;  1CF7 B;  3TO9 A;  1YW7 A;  2KIU A;  4LJZ F;  4CHU A;  4A0Y A;  1FYK A;  1UB9 A;  4HLY A;  1FLI A;  1J75 A;  3BZ6 A;  1D8J A;  5JI6 A;  1GXQ A;  1TW3 A;  2QUF A;  1IN5 A;  2PEX A;  2YX7 A;  5FFZ A;  2MBF A;  4ETS A;  3QAH A;  3EDP A;  3QU6 A;  3WTT C;  3MWM A;  5D5U B;  4CZZ A;  4WCG A;  3DP7 A;  4OIN F;  2ZBK A;  1SAX A;  1YS7 A;  1YTY A;  3P9I A;  2K4B A;  3HHG A;  5LBQ A;  1OR7 A;  2DK5 A;  1PUE E;  3TDU C;  3BRO A;  1JHH A;  3JAM Z;  3KLN A;  5HVQ C;  4MTE A;  1IW7 F;  2W24 A;  3IHU A;  1FSE A;  4A12 A;  2HWV A;  2KJB A;  3WTY C;  3HRU A;  1FBS A;  1P4W A;  5E8G A;  5J6X A;  2UZK A;  5HDN A;  3T1B A;  4ESJ A;  4CXF A;  3IRR A;  4BHP A;  4ZZL A;  2P6S A;  5DD8 A;  4A0X A;  3KZY A;  1K79 A;  3CTA A;  1J9I A;  1R1T A;  4QLC U;  2HZT A;  4D0P A;  3RDI A;  4IVN A;  2ZNZ A;  1OYY A;  4LB5 A;  3F8B A;  1Z05 A;  1J59 A;  5D5V B;  4I01 A;  3IWF A;  3IC7 A;  5DCF A;  3M7G A;  3GO5 A;  3TOB A;  2XVC A;  3F22 A;  2MA3 A;  2GXB A;  4YII A;  3RKW A;  4YFX F;  2FRH A;  1V3F A;  1ZRC A;  1TLH B;  1FNN A;  3ELK A;  2JRT A;  3MCZ A;  3N97 A;  1H9T A;  4P96 A;  4ESF A;  1DP7 P;  1QPM A;  1P4A A;  2OQG A;  4LLL A;  4KMU X;  2P5V A;  3RKX A;  3F8M A;  3FF5 A;  3JSO A;  4I0A A;  2Y48 A;  1YS6 A;  1F1Z A;  2J5P A;  4UUV A;  4EJU A;  1W5T A;  5DCM A;  4IJA A;  5KK1 A;  3ZMS A;  2VOP A;  4MQ9 F;  2X4H A;  1ZLJ A;  3K1N A;  1UFM A;  4HX7 A;  1XMK A;  2HGC A;  5F64 A;  1R23 A;  3ECO A;  1RI7 A;  1BC8 C;  4ZYH A;  3J7A O;  3TO7 A;  4M73 A;  4N9H A;  2NNN A;  2QBY A;  3IWZ A;  4RB1 A;  3VOE A;  5K5R A;  4I2O A;  4KMF A;  3D5L A;  4LD5 A;  2OAZ A;  2DTR A;  5K1Y A;  2IPQ X;  4HYE A;  1R22 A;  3FWE A;  4YG2 F;  4UVB A;  2X0L A;  5CVI A;  2KIF A;  2QQB A;  2NAZ A;  4OOI A;  2QYO A;  2B0L A;  2UXN A;  4L5I A;  1T6S A;  3KP7 A;  3SHF A;  2GIV A;  2RN7 A;  1BJA A;  2ISY A;  2O61 A;  2WC2 A;  5E17 F;  3BWG A;  2QQ9 A;  5L3E A;  4HQM A;  2G9W A;  5DCM B;  2O03 A;  4LK1 F;  4A2U A;  1IN8 A;  4FX0 A;  3G73 A;  1TBX A;  4JK1 X;  2WV0 A;  1FP1 D;  4ASN A;  1XDU A;  1XN7 A;  3WU1 B;  1U5T A;  1YYV A;  3DPT A;  4KN4 X;  3V8K A;  4CO8 A;  4L9J A;  5BPI A;  1UHW A;  3V7R A;  2H09 A;  1B6A A;  5CVJ A;  2L4M A;  2HOE A;  2EV5 A;  1IXS B;  1IXR C;  2VT2 A;  4UNO A;  4HBL A;  2IW5 A;  5EEG A;  3KP3 A;  1BI1 A;  4A6E A;  1FYL A;  3QP6 A;  3T5X A;  1B59 A;  1P6R A;  3R0J A;  3WGH A;  2MD5 A;  1YFH A;  4ZYD A;  1VTN C;  4U88 A;  1V4R A;  1SFX A;  1RIO H;  4GYI A;  2DPU A;  4Q4Z F;  2QM3 A;  2VBW A;  4CIC A;  4HF2 A;  3GW2 A;  2EA2 A;  4A5M A;  4WXH A;  2HQN A;  1KQ8 A;  3F72 A;  2AXL A;  2NRA C;  4RAY A;  3I59 B;  3RYP A;  3R4K A;  1UCR A;  1KGS A;  2W84 A;  1FSH A;  1SD7 A;  3F8C A;  4RB3 C;  2ZKZ A;  1TQI A;  1KYW A;  4EJO A;  2YX4 A;  4P5O A;  1E2X A;  2PQ8 A;  1MJA A;  2EFO A;  1WWX A;  5FO5 A;  3LA3 A;  4G6Q A;  4KFC A;  2VN2 A;  3FXR A;  2M5W A;  2XRO A;  4EJV A;  2Z33 A;  4EJW A;  3BP8 A;  4KIB A;  2VE9 A;  2E7X A;  2DQR A;  3IKV A;  1IN7 A;  1REP C;  1HXD A;  1FC3 A;  1SD6 A;  2IA2 A;  4HV6 A;  5JVT A;  1BOA A;  2M1B A;  2XAH A;  4M9Z A;  4GO1 A;  4ENJ A;  3BJ6 A;  3HOT A;  1LEB A;  3F8F A;  1FWZ A;  4S04 A;  3WE3 A;  3K69 A;  2LF8 A;  1Z91 A;  2BV6 A;  3TGN A;  2Q2E A;  4Y15 A;  2QEN A;  1O3R A;  4P9F A;  4ESB A;  1I27 A;  1FT9 A;  4FT8 A;  2ETH A;  1TNT A;  3HTS B;  3WTW C;  1R1V A;  4EGZ A;  3VEP A;  2Z3Y A;  4NB5 A;  4LLN A;  3GXO A;  4YFK F;  1G3T A;  1U6G A;  2JT1 A;  4HF1 A;  2M30 A;  3GFL A;  3ZN1 A;  2O3F A;  5D8L B;  2ESH A;  1HW2 A;  5EEH A;  5CVR A;  3KZZ A;  2K7L A;  2JPC A;  4HZF A;  1D8K A;  4L5J A;  1XSV A;  4OU0 A;  3C1D A;  1PP7 U;  3F6V A;  1IRF A;  2DI3 A;  1O3T A;  2BGC A;  5K5Q A;  3I64 A;  1XDS A;  2DQL A;  1MDM B;  4AIK A;  2CFX A;  4MNU A;  2A07 F;  2Q0O A;  1FPQ A;  2LSO A;  1R36 A;  3ZMZ A;  2OBP A;  2W57 A;  1J7K A;  3JW4 A;  2M8E A;  3DFG A;  1B9M A;  1U5T B;  3NRV A;  3HRT A;  4EQQ A;  1BI3 A;  1OMI A;  3QP5 A;  2P8T A;  4E70 A;  2JSC A;  2D1H A;  2R7D A;  1W5S A;  3CUQ A;  1E17 A;  4O3M A;  1TTY A;  2RGV A;  1HSJ A;  4TV7 A;  2RC4 A;  5LRS A;  1YG2 A;  3V4G A;  3JTG A;  3E5Q A;  2W25 A;  2FEZ A;  5LEJ A;  4IF4 A;  3ZPL A;  3FZV A;  2EFP A;  4I98 B;  5L3B A;  2AS5 F;  1MJB A;  5LRR A;  2LNB A;  2MC3 A;  1OKR A;  2M45 A;  5HLI A;  3CUO A;  1S7A A;  3E6B A;  1Y0U A;  5ICG A;  2ZO4 A;  4EV0 A;  4RB0 A;  3GYH X;  2H6C A;  1G3S A;  4M9S A;  4ZH4 F;  2XUB A;  3J81 Z;  3FMS A;  1HBX G;  4CYD A;  3C3W A;  1R1U A;  2HTJ A;  5CYV A;  2O6G E;  2UXX A;  1W7P A;  2J5O A;  4ENK A;  3RKY A;  2A68 F;  3DF8 A;  3HOS A;  1BC7 C;  1QZZ A;  4OIR F;  3GF2 A;  3BOQ A;  1JE8 A;  2EJR A;  1LDD A;  3OV8 A;  3ZMU A;  4GYG A;  5AON A;  1KA8 A;  5ILV A;  3I58 A;  2RVC A;  4PDK A;  5HLG A;  3I4P A;  3O3K A;  4UVA A;  1H0M A;  3MZY A;  2EWN A;  4FHT A;  3ULQ B;  1IZ1 A;  2L54 A;  3ROU A;  4LMY A;  2GAU A;  5CJ9 A;  3I53 A;  1UHM A;  2HYG D;  2COM A;  4U7D A;  2XKO A;  1FX7 A;  2L4A A;  3FHZ A;  4N0B A;  1FBQ A;  1YW8 A;  1F4K A;  2P4W A;  2DU9 A;  2ZME A;  1LEA A;  1R5G A;  1BN5 A;  4UXN A;  4KN7 X;  5L3C A;  3P9K A;  4IRH A;  2A5Y B;  1FBU A;  1YW9 A;  3LAP A;  2QBY B;  5E20 A;  1S3J A;  2FU4 A;  3E5X A;  4GXO A;  2YR2 A;  1TW2 A;  4Q48 A;  1HW5 A;  3RI4 A;  1FY7 A;  4G7Z F;  2F5F A;  3I54 A;  4IHT A;  3Q5F A;  1BBY A;  2HKX A;  3L2C A;  3V7S A;  3HSF A;  1WRJ A;  2XIG A;  1EH7 A;  3KEO A;  4HAM A;  2BEO A;  1Z9C A;  2R7F A;  1TQM A;  2Z5U A;  2PMU A;  1USS A;  2M87 A;  2FE3 A;  4JQF A;  4EGY A;  1MDM A;  6PAX A;  3IL2 A;  2K02 A;  5ICF A;  1EH6 A;  2Z99 A;  3BJO A;  2Y75 A;  3DEU A;  2XAS A;  4RB2 C;  3MAJ A;  4XRF A;  4U7B A;  3GFI A;  1A04 A;  4KA4 A;  3VFZ A;  4QWQ A;  3QPH A;  3L00 A;  4KUM A;  1QZY A;  3WG9 A;  3VOD A;  1BI2 A;  3CUQ B;  1T39 A;  3L9F A;  2V1D A;  4WK8 F;  2RDP A;  4RGX A;  1DDN A;  2GXG A;  2BYV E;  3P9C A;  3HHH A;  2XHK A;  3TDZ C;  3JSP A;  1AOY A;  3KCC A;  3HRM A;  2XKP A;  3HSR A;  3R6S A;  2QZ8 A;  4HDV A;  1J2X A;  4HA8 A;  3H92 A;  1IAW A;  3KP2 A;  2DPD A;  1AWC A;  4UHT A;  1ZRD A;  3K2Z A;  4R1H A;  3LAJ A;  4I0B A;  3BDD A;  4H0E A;  2O0Y A;  2VOO A;  4EM2 A;  3FM3 A;  4ON0 A;  5H6R A;  2Y0M A;  2ZCW A;  3BJA A;  5H6Q A;  4PGH A;  1S29 A;  2XV4 S;  3F21 A;  3QRF F;  3KP5 A;  1H9G A;  1OYI A;  1T98 A;  3KP6 A;  2LDU A;  4N9I A;  2EA4 A;  2CYY A;  2JZY A;  5E1Z B;  3MZH A;  3FM5 A;  1ULY A;  2D2W A;  2EB7 A;  5LGU A;  1NHA A;  3I71 A;  3N4M A;  2EFN A;  3ZMV A;  1ZGJ A;  3R61 A;  1RNL A;  4LB6 B;  2VT3 A;  4BHC A;  4PZJ A;  5E1X A;  2HYF A;  1FZP B;  3LQR A;  3B73 A;  3WTU C;  2ESN A;  5DEQ A;  1HKT A;  2A3S A;  4WF2 A;  3CJN A;  1IN6 A;  1GVJ A;  5LEK A;  2HKO A;  5DD4 A;  4ENN A;  2IVM A;  3DPL C;  3REO A;  4YFN F;  2P5K A;  1BIB A;  5BS6 A;  3SQN A;  2DT5 A;  3LA2 A;  2IJL A;  4MQV A;  5BOX A;  3CDH A;  1ZG1 A;  3WOD F;  3O6B B;  5J8F A;  1IUY A;  3RJP A;  2KJC A;  2C6Y A;  1I1S A;  2P7C B;  1Q1H A;  3B02 A;  1SFE A;  3ML6 A;  2RQP A;  2ZNY A;  4M71 A;  3K0L A;  4G8X A;  2OD5 A;  4OIQ F;  2DK8 A;  3S2W A;  3FXU A;  3M1E A;  3L7W A;  4BAY A;  1ZAR A;  3E6M A;  2VBZ A;  3TQN A;  1G3Y A;  2K27 A;  3ISP A;  2H6B A;  3E6C C;  1R5H A;  5HDG A;  4G7H F;  1LVA A;  5FLX Z;  1KU3 A;  5J8C A;  2PLY A;  3PQK A;  1XGO A;  5ICE A;  2K86 A;  3W6K B;  3QOP A;  5FGM A;  2PJP A;  5A2Q Z;  4L9T A;  3LWF A;  4AVP A;  2KIM A;  2WWY A;  4WXC A;  3RIR A;  3FMQ A;  1ZHF A;  2D1V A;  1G3W A;  2FOK A;  3BPV A;  2F2E A;  2OZU A;  4B09 A;  3E3V A;  1F5T A;  1KQ0 A;  4R79 A;  5BMZ A;  4KYW A;  2UWM A;  4P9U A;  3T8R A;  2KKO A;  1L3L A;  4XSX F;  2CWE A;  4G6D A;  2GQQ A;  1ONV A;  3EUH A;  2TDX A;  3ECH A;  2STW A;  3ZP5 A;  2HR3 A;  1STZ A;  2F5C A;  2VBX A;  3MQ0 A;  2F5E A;  1ZRF A;  1GHC A;  3KLO A;  1XGM A;  2JPB A;  2E7W A;  2QVO A;  5F6F A;  2JTV A;  1TNS A;  4HDU A;  5IT3 A;  2FBI A;  3U2R A;  3LST A;  5AIQ A;  2OA4 A;  4A5N A;  2GZW A;  3NEU A;  5FD6 A;  4IXA A;  5FFX A;  1QO0 D;  1RUN A;  5D5X B;  3C18 A;  3HUG A;  3K1P A;  2PFB A;  2L01 A;  2DFI A;  3E5U A;  2XAQ A;  1ZYR F;  4ZYG A;  2H27 A;  3EQL F;  4RGU A;  5BPD A;  4IRI A;  3GFM A;  3LQQ A;  3F3X A;  1ZRE A;  2H94 A;  2XAF A;  4LK0 F;  2VXZ A;  4O6J A;  1T0F A;  1MD0 A;  1D3Y A;  3BY6 A;  4ZZD A;  4WXD A;  5AIP A;  2O8X A;  2FBH A;  3G3Z A;  3ZQ7 A;  2ELH A;  1XCV A;  4I02 A;  3ZMD A;  1P2F A;  3F6O A;  2ISZ A;  1O7F A;  1WKM A;  3DQV C;  1U78 A;  4L9V A;  4MEX F;  3V8L A;  3ABU A;  1BI0 A;  1U2W A;  4CGZ A;  3L09 A;  3IRQ A;  3QPT A;  4EM0 B;  1OYW A;  1Z6R A;  5HS9 A;  4KDP A;  3Q9S A;  2XGX A;  1P4X A;  5ICC A;  1ON2 A;  5BQT A;  3COA C;  3ZN0 A;  5LHH A;  2XAG A;  4LLG F;  2VE8 A;  2NYX A;  2DLL A;  3BPX A;  3F8N A;  5TJJ A;  1R7J A;  1LNW A;  2FBK A;  2V1U A;  2MH9 A;  2NS0 A;  2FXA A;  4MGR A;  5DUK A;  1F9N A;  4G9Y A;  1XMA A;  3RTR A;  1K78 A;  2IA0 A;  2RNJ A;  1S6L A;  2EFW A;  5E18 F;  1R58 A;  4OIO F;  4KNY A;  5ED4 A;  5LGT A;  3CUQ C;  3AAF A;  2V1X A;  2F5D A;  2L02 A;  1QNT A;  1X3U A;  2MLK A;  1U5T C;  1ON1 A;  4HW0 A;  2PBI A;  2RV8 A;  3E6D A;  3J81 K;  2VOD A;  2IT0 A;  3TO6 A;  4AWX B;  1Z1D A;  1TQP A;  1O7L A;  5DUI A;  4XLN F;  1ODD A;  2CSO A;  5K5O A;  2PMH A;  1L0O C;  2FA5 A;  3HIF A;  2FNP A;  5LHG A;  2R3S A;  2NNY A;  5LHI A;  4M6X A;  4BHB A;  5D5W B;  3KP4 A;  1I5Z A;  1DUX C;  4PCQ A;  4Q47 A;  4M72 A;  2LKP A;  1HQC A;  3GWZ A;  2LF7 A;  2QLZ A;  1T38 A;  5L3D A;  2FF4 A;  5HS8 A;  2CO5 A;  4I7H A;  4AIH A;  3KEQ A;  3U1D A;  1IXC A;  1XB4 A;  2QQA A;  1XGS A;  4OMZ A;  1SFU A;  4PGG A;  3V7C A;  3VB2 A;  4IRG A;  3T8T A;  1C0W A;  1S8N A;  3V8J A;  4XLP F;  2HEO A;  4MEY F;  3HRS A;  1ZH5 A;  4MTD A;  1XSX A;  2RKH A;  1OPC A;  4BH9 A;  4ZYE A;  2EV6 A;  3EET A;  1GXP A;  3LA7 A;  5IT9 K;  4RGR A;  3FXQ A;  1QQI A;  1HKQ A;  2G7H A;  1ZG5 A;  1K6O A;  3U9G A;  3DV8 A;  3PQJ A;  1Z7U A;  2EV0 A;  2HTS A;  3T0Y A;  1YIO A;  4LGW A;  1XCB A;  4RS8 A;  5A2Q K;  3M8E A;  3MFK A;  2FNA A;  1RZ4 A;  4BYY A;  5IT9 Z;  2PG4 A;  4A0Z A;  3R60 A;  2G7U A;  1YQA A;  3DKW A;  2V79 A;  1IN4 A;  3ERE D;  1BM9 A;  3GVA A;  1LQ1 A;  5L3F A;  5FB2 A;  1I1G A;  1ZLK A;  4Y17 A;  4L9N A;  2HDC A;  2FML A;  2BBY A;  3GZ6 A;  4L0Y B;  1IRG A;  5JHU A;  5DYM A;  2W85 A;  4U0W A;  4MHG A;  4KIF A;  2K4J A;  3GZ5 A;  1J5Y A;  2CW0 F;  3FX3 A;  4JBA A;  3WTS C;  2A69 F;  1WSU A;  3GX4 X;  4K2E A;  4Z2Y A;  1EV7 A;  3F23 A;  3RPU A;  2GWR A;  3KET A;  1W7P D;  2WTE A;  5LLQ A;  3H3Z A;  2L3D A;  3EYI A;  1FP2 A;  1WI9 A;  5L3G A;  4ENM A;  4WWC A;  1W4M A;  2V6C A;  2CQK A;  4FX4 A;  4EVI A;  2MLG A;  2ACJ A;  5DDG A;  1SMT A;  4BXU A;  1WQ2 A;  3RYR A;  2HFH A;  4KIG A;  3GEZ A;  4XBF A;  2XAJ A;  3TOA A;  4LFU A;  3IKT A;  2VC1 A;  1BIA A;  4HOB A;  4NQW A;  1B1B A;  4L18 B;  2FSW A;  3GLX A;  5HLH A;  3WE2 A;  4KT5 C;  1FOK A;  1IF1 A;  5LGN A;  4GGG A;  3NQO A;  3ZMT A;  1LDK B;  3LFK A;  3KE2 A;  3ABT A;  4Y13 A;  3K9T A;  4CDG A;  1LJ9 A;  1S7O A;  4YIF A;  3CO6 C;  1I6X A;  4XSZ F;  5JR3 A;  3H3U A;  2ADU A;  1G6N A;  3WTX C;  1ZAO A;  5CLS A;  2OZ6 A;  2IRF G;  5D8K B;  3WTV C;  3GUD A;  3Q9V A;  3SZT A;  2P6T A;  4GCV A;  2BE5 F;  2DAO A;  1O3Q A;  3JAM K;  2CGP A;  4IPA A;  2IP2 A;  1CF7 A;  5H20 A;  4A6D A;  5HDK A;  3J80 Z;  5JFR A;  1MGT A;  1ZG3 A;  1O57 A;  2D45 A;  1KU9 A;  2FMY A;  1KQ9 A;  3CLO A;  3EYY A;  5TRD A;  2OU2 A;  4EJT A;  1JXS A;  2CG4 A;  5ILU A;  2EK5 A;  3HTU A;  1D5V A;  4Q5S F;  1W7P B;  1QGP A;  2A61 A;  3M9A A;  4P55 A;  1HST A;  5CVU A;  4DNC A;  3R0A A;  1DPR A;  3M8F A;  2VON A;  4I09 A;  5FD5 A;  3WU0 A;  2GA2 A;  4RAZ A;  4UVC A;  2PN6 A;  5ILS A;  1ZN2 A;  2GA1 A;  1PP8 F;  1K7A A;  5D4S A;  4HV5 A;  3HSE A;  3SZP A;  2KRF A;  4LG0 B;  1YLF A;  3E97 A;  1SD5 A;  3HYI A;  4HQE A;  3O2P E;  4HF0 A;  4G94 A;  1JGS A;  1P92 A;  3OOP A;  4AD9 A;  5KVR A;  5FLX K;  3I59 A;  3FMR A;  1CGP A;  2IA1 A;  2A6E F;  5ERI A;  1ZGA A;  1HKS A;  2V9V A;  4HX8 A;  4RGS A;  4OIP F;  2ZME B;  2E1C A;  1R00 A;  4M6Y A;  4WX9 A;  1XSD A;  2HQR A;  1O3S A;  2OQR A;  4DQ2 A;  4AIJ A;  3J80 K;  2STT A;  4NHJ A;  4U0V A;  1T2K A;  2E1N A;  1MKM A;  2PI0 A;  4HX4 A;  4R8H A;  3C7J A;  4UV8 A;  2VBY A;  2XRN A;  2QWW A;  3GFJ A;  4S05 A;  1MJ9 A;  4B8X A;  3MEX A;  1U3E M;  4O5V A;  3QU3 A;  2ZJ2 A;  4F7Z A;  2DBB A;  5F1R A;  1SD4 A; 
#chains in the Genus database with same CATH topology
 3L2U A;  4BBR J;  2YSR A;  2FQ3 A;  2I5U A;  3JTH A;  1FOX A;  2E19 A;  1SFO J;  1KU2 A;  4AM3 A;  3SFZ A;  4RAG A;  3W6J B;  2BY2 A;  1G4D A;  2AO9 A;  3P7N A;  3OSF A;  1KYZ A;  3TKY A;  3SXY A;  1QBJ A;  5E3M A;  1B9N A;  5DV5 A;  1MNE A;  5D6F A;  3CC2 I;  4OMY A;  5HS7 A;  4M74 A;  1U8R A;  4PK4 A;  2JA6 J;  1H89 C;  5HOO A;  2Z1D A;  2YPR A;  4PFP A;  4BE1 A;  1LB2 A;  1ZR4 A;  2HS5 A;  1DPU A;  4FAS D;  4U0Y A;  4IHS A;  5E1W A;  4V19 K;  1WJC A;  2Z9O A;  1UAA A;  1RPW A;  3DTE A;  2Q8K A;  1RUO A;  4NUB A;  2DO7 A;  4A3I J;  3LSI A;  2JRM A;  5LD2 C;  4BDY A;  4EM1 A;  1B4A A;  1MZB A;  3PFI A;  4G7O F;  1JHF A;  1EH8 A;  5CVV A;  2MH2 A;  3A03 A;  1D1B A;  3I0T A;  1XD7 A;  2ZXJ A;  1HW1 A;  1SC7 A;  2VC0 A;  3AKZ A;  4BJ5 C;  5E8I A;  3HKZ A;  2A6H F;  1UST A;  4XIC A;  3OIP A;  4QPO A;  5D6E A;  5B3S H;  4UV9 A;  3VYR B;  1K78 B;  2CU7 A;  1J0R A;  3CO7 C;  4BQA A;  4M9X A;  4KIC A;  2BXY A;  1FJL A;  1RKT A;  3DXJ F;  2DCE A;  4HLX A;  3K6G A;  1IRX A;  2WAF A;  1PDN C;  5D4R A;  1SMY F;  1FYM A;  1VQ7 I;  3WGG A;  2P5L C;  3K1M A;  2FOW A;  4B1R A;  2VJJ A;  2ZFW A;  3I5U A;  2YU3 A;  1VQ6 I;  2OF7 A;  3D0S A;  4LG0 A;  3AFH A;  1G8X A;  3WTZ A;  2JVH A;  3GME A;  4EMS A;  3WGI A;  4L0Z B;  2F4I A;  3KFW X;  2P7V B;  1XGN A;  3RPQ A;  3J7A Y;  4Y3O A;  1WCM J;  2DW4 A;  3LMM A;  5IY5 H;  2X9D A;  5F0C A;  4BNC A;  1TT5 B;  1Z6T A;  2VKH A;  1YO5 C;  2EBI A;  1XTA A;  4S0H B;  1WH7 A;  1YIJ I;  1KU7 A;  3ZRG A;  1LDJ A;  2EFQ A;  1CF7 B;  1LFP A;  4FE4 A;  1YW7 A;  3TO9 A;  4A3G J;  4UUS A;  2KPM A;  1JKQ C;  2KIU A;  2O9L A;  5J4V A;  4LJZ F;  1WH5 A;  3ZOB A;  4CHU A;  4A0Y A;  3CF2 A;  1FYK A;  1QHH D;  1UB9 A;  3PNV A;  4FIS A;  3SDG A;  4HLY A;  1FLI A;  2XAU A;  1J75 A;  2R7V A;  3BZ6 A;  4B47 A;  1T33 A;  1Z3Y A;  5K7Z A;  5EGO B;  1D8J A;  3MZ8 A;  4IHW A;  5JI6 A;  1UHS A;  1GXQ A;  1TW3 A;  2EH3 A;  2JSP A;  1IN5 A;  2QUF A;  3ASN H;  3OYB A;  1FEX A;  4BY1 J;  2CUF A;  2PEX A;  1IJW C;  2YX7 A;  5FFZ A;  4XOP A;  4YEL A;  1TWC J;  2MBF A;  1X3W B;  4ETS A;  1BL0 A;  1JKP C;  3QAH A;  3M4O J;  3LSP A;  1NG7 A;  1XMX A;  3EDP A;  3QU6 A;  3WTT C;  3MWM A;  5FLM J;  5D5U B;  3BT9 A;  3AG4 H;  3K70 D;  4CZZ A;  2E36 A;  3EPZ A;  1V5E A;  1GUU A;  1ZEL A;  4WCG A;  3DP7 A;  2H1K A;  2ID3 A;  3FXM A;  4HPQ A;  4OIN F;  2ZBK A;  1SAX A;  3RZD J;  3ERM A;  1YS7 A;  1B72 B;  1B8I B;  1YTY A;  2NVQ J;  3P9I A;  3BLY A;  3PUF A;  2K4B A;  3LNQ A;  5HNH A;  3HHG A;  3UKG A;  5EZG A;  3DU6 A;  5LBQ A;  1OR7 A;  2DK5 A;  2AQE A;  1PUE E;  1RES A;  2GOX B;  4LIT A;  3HOV J;  2ID6 A;  4XOT A;  3TDU C;  3BRO A;  4JX6 A;  4MO7 A;  3OSG A;  1JHH A;  2R93 J;  1PYV A;  3JAM Z;  2EIJ H;  2LKS A;  3KLN A;  5HVQ C;  4JX4 A;  4MTE A;  1IW7 F;  2G0E A;  4YIR X;  2W24 A;  3IHU A;  1FSE A;  4A12 A;  1LFU P;  4RLF A;  2CS3 A;  2D5V A;  2HWV A;  1P7J A;  2KJB A;  4Y7N J;  3WTY C;  3HRU A;  2XPV A;  4HNU A;  1FBS A;  5EGO A;  1P4W A;  5E8G A;  5J6X A;  2UZK A;  4MFE A;  2DA5 A;  5HDN A;  3T1B A;  4XRM A;  1D0Y A;  3MVP A;  2F6C A;  3DEW A;  4ESJ A;  4M3D A;  3PIP F;  2WAQ A;  1WZ2 A;  3C2H A;  4CXF A;  3IRR A;  2DFF A;  4BHP A;  4ZZL A;  2P6S A;  5DD8 A;  2EIK H;  4A0X A;  2KQR A;  3KZY A;  1DGW Y;  4P1W A;  5HNF A;  4IOA F;  3KPH A;  3EUK L;  4BQQ A;  1K79 A;  3CTA A;  1J9I A;  3IH2 A;  2ZJQ F;  1R1T A;  1VND A;  1MND A;  4QLC U;  4C2T A;  2HZT A;  2V6E A;  3S2H J;  3S17 J;  3FDY A;  3RDI A;  4D0P A;  4IVN A;  2ZNZ A;  4IHX A;  4W1U A;  3RPU D;  2MYS A;  1OYY A;  4LB5 A;  3A1Y A;  3F8B A;  3ESW B;  2EIN H;  1Z05 A;  2LY1 A;  1J59 A;  2TRT A;  3AL0 B;  5D5V B;  4I01 A;  4I99 C;  3IWF A;  3IC7 A;  5DCF A;  3M7G A;  3GO5 A;  3TOB A;  2CQN A;  2K40 A;  2XVC A;  3F22 A;  2MA3 A;  4UUS B;  2GXB A;  4YII A;  1K6Y A;  3RKW A;  4YFX F;  3CJQ B;  2FRH A;  2OUM A;  1V3F A;  1TLH B;  1ZRC A;  1FNN A;  3ELK A;  3ZXS A;  2JRT A;  2V4J C;  2NS7 A;  3MCZ A;  1QVU A;  3G71 I;  3N97 A;  1PUF B;  1JT6 A;  1H9T A;  1BJZ A;  3QYB A;  4P96 A;  4ESF A;  3O8H A;  1DP7 P;  1QPM A;  1P4A A;  1IV8 A;  2OQG A;  4LLL A;  1YJW I;  2COB A;  2V1N A;  1GV2 A;  1BA5 A;  4KMU X;  4G12 A;  2P5V A;  3RKX A;  3DWL E;  3F8M A;  3FF5 A;  4I0A A;  3JSO A;  2Y48 A;  1N77 A;  1YS6 A;  1F1Z A;  2J5P A;  2H1L A;  4UUV A;  2CV1 A;  4EJU A;  2ZXH A;  1W5T A;  3K7A J;  5DCM A;  2OPT A;  1YHQ I;  2HZD A;  4DZP A;  4IJA A;  3VDX A;  5KK1 A;  3ZMS A;  2VOP A;  4MQ9 F;  2X4H A;  1OLT A;  2CUJ A;  1ZLJ A;  2BOL A;  1X4O A;  3K1N A;  1UFM A;  4HX7 A;  2LY2 A;  1XMK A;  2HGC A;  5F64 A;  4BAC A;  1R23 A;  2LD5 A;  4CUG A;  3ECO A;  3W3C A;  1RI7 A;  2DYR H;  1BC8 C;  4Z6Y A;  4ZYH A;  4XR6 A;  1APL C;  3J7A O;  2LRD A;  3TO7 A;  1RET A;  4XLH A;  2VJ4 A;  4M73 A;  4N9H A;  3SDB A;  2NNN A;  5IOZ A;  2A05 A;  2MW8 A;  2VPR A;  2QBY A;  4CCJ A;  3IWZ A;  4RB1 A;  3VOE A;  4D7N A;  3VSL A;  5K5R A;  1ETW A;  4I2O A;  2KDO A;  4KMF A;  2P0W A;  3D5L A;  4LD5 A;  3AL0 C;  2OAZ A;  3RSN A;  2DTR A;  1MW7 A;  2R92 J;  5K1Y A;  2IPQ X;  4CH7 A;  4HYE A;  1R22 A;  3FWE A;  4YG2 F;  2Q2E B;  2X85 A;  1V5F A;  3Q3S A;  4UVB A;  2X0L A;  1YRN A;  5CVI A;  1X4P A;  2KIF A;  2QQB A;  5J1U A;  2NAZ A;  4OOI A;  1Y6I A;  2L9V A;  4ZC3 A;  2QYO A;  2B0L A;  3HUG B;  3JRD A;  3LSJ A;  1GLN A;  2WB1 A;  2RNG A;  2VQH A;  2UXN A;  4L5I A;  2Y69 H;  4NC6 A;  1K83 J;  2QKM B;  1K61 A;  1I3Q J;  1T6S A;  1POG A;  3CP8 A;  3KP7 A;  3SHF A;  5F27 A;  4A3K J;  2GIV A;  2RN7 A;  3IAM 2;  1RKW A;  5CQE A;  3HB9 A;  1BJA A;  2ISY A;  3I4M J;  4ZYA A;  2O61 A;  2WC2 A;  2BHY A;  1X19 A;  1QVT A;  3H3V K;  4DJA A;  5E17 F;  2QKL B;  3BWG A;  2QQ9 A;  2QA4 I;  5L3E A;  4HQM A;  3KZI C;  2G9W A;  3ABL H;  5DCM B;  2O03 A;  2KDZ A;  4LK1 F;  4A2U A;  1IN8 A;  3D5R C;  4FX0 A;  3G73 A;  5GTI C;  1TBX A;  3DKX A;  4JK1 X;  2WV0 A;  1SAN A;  1FP1 D;  3VYT B;  4ASN A;  1XDU A;  3BG5 A;  1XN7 A;  3U1K A;  3WU1 B;  1U5T A;  1MBJ A;  1YYV A;  3DPT A;  4KN4 X;  3V8K A;  4CO8 A;  3DTI A;  1EF4 A;  1X2N A;  5EYR A;  1LE8 A;  3OYI A;  3OIO A;  4L9J A;  5DS9 A;  5BPI A;  2BXZ A;  1UHW A;  3V7R A;  2L7M P;  2H09 A;  1F43 A;  3DTK A;  1B6A A;  1LVK A;  5CVJ A;  2JQ7 A;  2L4M A;  3ONQ A;  1B72 A;  2HOE A;  3KYC B;  1E3O C;  2EV5 A;  1IXS B;  2CQ7 A;  3W2V A;  1IXR C;  2VT2 A;  4M3G A;  1T56 A;  2ZB9 A;  2KMU A;  5GAD J;  2F5V A;  3CC7 I;  4UNO A;  2E1M B;  4HBL A;  2M7B A;  2R7R A;  1OCT C;  2IGM A;  2IW5 A;  2JUC A;  2L9N A;  1BOB A;  2R7Q A;  5EEG A;  3KP3 A;  3HOX J;  2KFD A;  1Y8Q B;  4JOM A;  2QQ8 A;  1BI1 A;  1I3A A;  2DA2 A;  2XGC A;  4A6E A;  3S2D J;  1FYL A;  4BDZ A;  2V26 A;  5GPA A;  3QP6 A;  4E7Z A;  2ZJR F;  3T5X A;  1B59 A;  1P6R A;  2M9H A;  3R0J A;  3I55 I;  2JA8 J;  3OOU A;  3HGY A;  3WGH A;  3QYF A;  4F92 B;  2MD5 A;  1ETY A;  1YFH A;  4ZYD A;  1OCO H;  5JLX A;  4RDU A;  5FRO A;  1VTN C;  4U88 A;  1V4R A;  4XKB A;  1Y1W J;  4XNF A;  1X1A A;  4V2G A;  1SFX A;  1Y39 A;  2HVR A;  3RKQ A;  2W4S A;  2GXA A;  3VYS B;  1RIO H;  4GYI A;  2DPU A;  4Q4Z F;  2QM3 A;  2VBW A;  4CIC A;  4HF2 A;  4PJM A;  2LFB A;  3BR2 A;  2QSG X;  3GW2 A;  5B1B H;  2W00 A;  2Y0S N;  2IGK A;  5IYC J;  4ZDL A;  2DT6 A;  2EA2 A;  4A5M A;  4WXH A;  2HQN A;  1KQ8 A;  3K10 A;  4GDF A;  3F72 A;  5KNL A;  2HOA A;  2AXL A;  2NRA C;  4RAY A;  3I59 B;  1GVD A;  3RYP A;  3OS1 A;  4CCL A;  3R4K A;  1UCR A;  1KGS A;  2K3P A;  2W84 A;  1FSH A;  4BXX J;  1ETV A;  2OJE D;  1SD7 A;  2Y0S A;  3CF5 F;  3F8C A;  4RB3 C;  3JR9 A;  2ZKZ A;  1TQI A;  2A5W A;  1MMN A;  1KYW A;  4EJO A;  1ZK8 A;  2YX4 A;  3BTC A;  4NC8 A;  1NG6 A;  4P5O A;  2VQL A;  2L9R A;  2CRG A;  1E2X A;  3MMY B;  2PQ8 A;  1MJA A;  5TGT A;  2EFO A;  3GTP J;  1AKH A;  1WWX A;  4C30 A;  5FO5 A;  3LA3 A;  1OJL A;  4G6Q A;  4EAT A;  4KFC A;  1WI3 A;  2VN2 A;  1N78 A;  3FXR A;  5CKT A;  3CCE I;  4AU7 A;  5H2F C;  2M5W A;  4Y52 J;  1T95 A;  1OIS A;  2XRO A;  4EJV A;  5TIS C;  2Z33 A;  4EJW A;  3BP8 A;  4KIB A;  1Z67 A;  2VKE A;  2VE9 A;  2E7X A;  2DQR A;  5KAI C;  3ZR8 X;  4BEH B;  3IKV A;  1VQM I;  1IN7 A;  3OYM A;  4XKC A;  3Q0U A;  3CCR I;  1REP C;  4XRS A;  1HXD A;  2VJ5 A;  1FC3 A;  1YOV B;  2R7U A;  1SD6 A;  2IA2 A;  4HV6 A;  2CH0 A;  1BOA A;  5JVT A;  2M1B A;  1JTX A;  2XAH A;  4M9Z A;  2Y9Y A;  4GO1 A;  4BQN A;  1IGN A;  3GTO J;  4ENJ A;  3BJ6 A;  2HDW A;  3HOT A;  1VQ4 I;  2RQQ A;  3F8F A;  1LEB A;  1FWZ A;  3LSG A;  4BKX A;  4S04 A;  1FOY A;  3WE3 A;  2F4M B;  2EIM H;  3K69 A;  2LF8 A;  2OCE A;  1T0F C;  3ASO H;  2AHQ A;  1Z91 A;  3A01 A;  1DP3 A;  1EJ9 A;  2BV6 A;  3TGN A;  2Q2E A;  4Y15 A;  1S5L C;  4D9J A;  4BGD A;  2QEN A;  3JRI A;  4P9F A;  1O3R A;  2DXI A;  2XPU A;  4ESB A;  4GRI A;  2MG4 A;  2DA1 A;  1I27 A;  1WJF A;  3BCA A;  1RRJ A;  3BCB A;  1FT9 A;  4FT8 A;  1MIJ A;  4X1E A;  2ETH A;  1AA7 A;  3S1M J;  3S1N J;  1TNT A;  5GPC A;  3WTW C;  3HTS B;  1R1V A;  4EGZ A;  1JTY A;  3VEP A;  1BR4 A;  2Z3Y A;  1ZR2 A;  4NB5 A;  4MLO A;  4LLN A;  3GXO A;  4YFK F;  1G3T A;  5J3L A;  1JKO C;  1U6G A;  3BZC A;  2WY7 Q;  2JT1 A;  4HF1 A;  3FXJ A;  2F48 A;  2K5C A;  2LP0 A;  2M30 A;  1WVR A;  2IGO A;  3LSM A;  3GFL A;  3ZN1 A;  5E3L A;  4IQ4 A;  2O3F A;  5D8L B;  2VQC A;  2ESH A;  1HW2 A;  5EEH A;  5CVR A;  1VI0 A;  3KZZ A;  3WHC A;  2K7L A;  2JPC A;  1FMW A;  4HZF A;  1D8K A;  4L5J A;  1XSV A;  4OU0 A;  4PUS A;  3C1D A;  2FD5 A;  1PP7 U;  3F6V A;  1IRF A;  2DI3 A;  4A3L J;  4E7I A;  1O3T A;  2BGC A;  4A69 C;  5K5Q A;  2PX9 A;  5M3M J;  2B9S A;  3I64 A;  2Z16 A;  1S72 I;  1XDS A;  2DQL A;  2XB5 A;  1Y1V J;  3VPR A;  4XN3 A;  2L7F P;  2NVU B;  1W0U A;  2KP6 A;  3CJT B;  4AIK A;  1MDM B;  4CCO A;  2CFX A;  4MNU A;  3OYN A;  2A07 F;  4DIQ A;  2Q0O A;  1FPQ A;  2LSO A;  4E6K G;  4NC7 A;  5C4J J;  1GV5 A;  2YUS A;  3CMM A;  1R36 A;  3ZMZ A;  2OBP A;  4B43 A;  5J4Y A;  2LC2 A;  2W57 A;  1J7K A;  3JW4 A;  2M8E A;  3DFG A;  1A6Q A;  1B9M A;  3GTK J;  3GBG A;  5KAF C;  1V5G A;  1U5T B;  3NRV A;  2DA7 A;  1ETO A;  4DYQ A;  3HRT A;  1BI3 A;  1OMI A;  2KZG A;  1Q1V A;  2LVS A;  3QP5 A;  4EQQ A;  4ZTF A;  2P8T A;  4E70 A;  2GBY A;  2HPM A;  1G2H A;  4HRI A;  2JSC A;  2D1H A;  2MC4 A;  2K9S A;  3Q0W A;  2R7D A;  1W5S A;  1WPK A;  3IUO A;  2IS2 A;  3CUQ A;  1E17 A;  4Y33 A;  4O3M A;  1TTY A;  2RGV A;  1HSJ A;  3VSK A;  2TCT A;  4TV7 A;  2RC4 A;  1IV6 A;  4RLQ A;  5LRS A;  2OV7 A;  4KT6 A;  1YG2 A;  2PMZ N;  3V4G A;  3JTG A;  3E5Q A;  3FK6 A;  2W25 A;  2FEZ A;  2V9K A;  1EA3 A;  5LEJ A;  2DMU A;  4IF4 A;  3ABM H;  1PVE A;  3ZPL A;  1VFC A;  3FZV A;  1UG2 A;  2EFP A;  3V42 A;  4B44 A;  4I98 B;  3CCQ I;  4C2M J;  2R7Z J;  5L3B A;  2AS5 F;  1VF9 A;  3J7Z I;  3BTL A;  1MJB A;  5LRR A;  2LNB A;  3GTG J;  2MC3 A;  3BG9 A;  1HOM A;  1OKR A;  2M45 A;  5HLI A;  1TWA J;  1VQ8 I;  5K7F A;  2WAQ N;  3CUO A;  3FIW A;  1S7A A;  3E6B A;  3F0C A;  4BQO A;  1Y0U A;  3ZCO A;  3BR6 A;  5ICG A;  1X58 A;  2ZO4 A;  4EV0 A;  4RB0 A;  1TZL A;  3HPG A;  3GYH X;  2JUG A;  1A31 A;  2H6C A;  2LKX A;  1G3S A;  3BG6 A;  4M9S A;  2Y30 A;  4ZH4 F;  4V2F A;  2XUB A;  2BY0 A;  3J81 Z;  2GM4 A;  3FMS A;  1HBX G;  4CYD A;  4E7L A;  3HG9 A;  5F1J A;  3C3W A;  2IBD A;  1R1U A;  3OIQ A;  2HTJ A;  5CYV A;  2O6G E;  2UXX A;  1W7P A;  2J5O A;  4ENK A;  1YX5 A;  5IPA A;  2K9M A;  3RKY A;  2A68 F;  5FLV A;  4E7K A;  3OYC A;  3OYG A;  3DF8 A;  9ANT A;  3OYJ A;  3GTM J;  4XLA A;  3DKY A;  3HOS A;  1VQP I;  1QZZ A;  4OIR F;  1BC7 C;  5EG0 B;  3GF2 A;  3BOQ A;  4DBR A;  1PJR A;  2EJR A;  1LDD A;  1JE8 A;  4I6Z A;  3OV8 A;  3ZMU A;  4GYG A;  5AON A;  2JA7 J;  3C2G A;  1SVL A;  1KA8 A;  4BEH A;  5ILV A;  1PUF A;  3I58 A;  1MMD A;  2RVC A;  4II3 A;  2CFO A;  4PDK A;  3I56 I;  5HLG A;  3I4P A;  2UUZ A;  1HLV A;  2LLK A;  3OWT A;  3O3K A;  1UMQ A;  4UVA A;  1H0M A;  3MZY A;  2EWN A;  4FHT A;  3ULQ B;  3HPH A;  5C3E J;  4IZZ A;  1IZ1 A;  2L54 A;  3ROU A;  4LMY A;  4MIM A;  2GAU A;  4B3A A;  3ZQH A;  5CJ9 A;  2FUG 2;  4XK4 A;  4HNT A;  4HNV A;  3EUA A;  3I53 A;  1UHM A;  3K70 C;  4E7S A;  1UJ8 A;  2JJ7 A;  4UB8 C;  2HYG D;  2X6Y A;  2COM A;  2M0C A;  2NOJ B;  4U7D A;  3JRE A;  2XKO A;  1FX7 A;  2BW3 B;  2L4A A;  3FHZ A;  4N0B A;  1FBQ A;  1YW8 A;  1F4K A;  1R71 A;  3TED A;  2P4W A;  1ZGW A;  2DU9 A;  2MAB A;  2ZME A;  1LEA A;  1R5G A;  3CDL A;  1BN5 A;  4UXN A;  4KN7 X;  2DFH A;  3QQA A;  5L3C A;  3KYL A;  5F08 A;  1JUS A;  3P9K A;  4IRH A;  3TL4 X;  2A5Y B;  1FBU A;  4HSR A;  2ELK A;  4PFO A;  2O8K A;  3GTQ J;  1YW9 A;  3GCM A;  3OYH A;  3LOC A;  3LAP A;  3CME I;  2QBY B;  5E20 A;  1S3J A;  3RQ4 A;  3QPS A;  2FU4 A;  1MH4 A;  3E5X A;  1A35 A;  4GXO A;  2YR2 A;  1TW2 A;  3KIO A;  4F91 B;  2LRE A;  4Q48 A;  3H0G J;  1HW5 A;  3L2R A;  3BR3 A;  3RI4 A;  1FY7 A;  4G7Z F;  2F5F A;  3I54 A;  2L2O A;  3CDI A;  4IHT A;  3Q5F A;  1BBY A;  2HKX A;  2DYS H;  3TW6 A;  3L2C A;  3V7S A;  1OCZ H;  3HSF A;  3TBI A;  5DM6 F;  1WRJ A;  2XGD A;  2XIG A;  1EH7 A;  1MMA A;  4J00 A;  3KEO A;  4HAM A;  2BEO A;  1Z9C A;  4BXF A;  2R7F A;  1D5Y A;  3JRC A;  1W5C C;  1N75 A;  4PJ0 C;  1XG1 A;  2VKD A;  3FXL A;  3K4B A;  1TQM A;  3CCM I;  2Z5U A;  2PMU A;  1USS A;  2M87 A;  1YX3 A;  2XSD C;  2OTL I;  2ZSH B;  2FE3 A;  5F0H A;  3AG2 H;  4JQF A;  1RC9 A;  3CJR B;  4EGY A;  1DU6 A;  1HF0 A;  1OCP A;  1MDM A;  1MSE C;  2R7O A;  6PAX A;  3IL2 A;  2K02 A;  2FX0 A;  1WJA A;  2W48 A;  5ICF A;  5B1A H;  2XB0 X;  1I39 A;  1EH6 A;  2Z99 A;  3PNT A;  1JJ6 C;  3BJO A;  1Z21 A;  2Y75 A;  2JMW A;  3DEU A;  4RM3 A;  3AG3 H;  4F93 B;  1U8B A;  1YE9 A;  2WV1 A;  1TL8 A;  2A6T A;  2XAS A;  4RB2 C;  1LKX A;  1QPI A;  3MAJ A;  2BW3 A;  4PJJ A;  4CA0 A;  2CQQ A;  3SYT A;  5DM7 F;  4XRF A;  4U7B A;  2R7W A;  3GFI A;  1A04 A;  4KA4 A;  3HEF A;  3VFZ A;  5GP9 A;  4QWQ A;  5M3F J;  3QPH A;  3OYF A;  3L00 A;  4KUM A;  2R5Y A;  2XF6 A;  1QZY A;  3WG9 A;  5IYB J;  3VOD A;  1BI2 A;  3CUQ B;  1ERD A;  1QRY A;  3L1P A;  1T39 A;  3M8J A;  2LOO A;  3L9F A;  4N4O B;  2V9P A;  4ZDP A;  2CQX A;  3DCF A;  4F3Q A;  1V55 H;  2V1D A;  1SFK A;  3EUH C;  3GLL A;  4WK8 F;  1TP4 A;  3BC8 A;  2RDP A;  4RGX A;  3CC4 I;  3GTJ J;  4BJ6 C;  2X1C A;  2VJI A;  2R7T A;  1DDN A;  2DMT A;  1MBH A;  2GXG A;  2BYV E;  3P9C A;  3HHH A;  2XHK A;  3TDZ C;  3JSP A;  1AOY A;  3KCC A;  3HRM A;  1XC5 A;  2XKP A;  2E2H J;  1X1C A;  4BUP A;  3ZQF A;  1H88 C;  3H5A A;  3HSR A;  3R6S A;  1R49 A;  4PJN A;  2QZ8 A;  4IL6 C;  3JRA A;  3CCS I;  4HDV A;  1D0Z A;  5IP7 J;  1W1W E;  1J2X A;  4HA8 A;  3H92 A;  1IAW A;  4ABZ A;  3CLQ A;  3S1R J;  3HC7 A;  5EG0 A;  2LR8 A;  3KP2 A;  1YRN B;  2DPD A;  1X2M A;  1AWC A;  2VLA A;  1X1P A;  4D5C A;  4UHT A;  1ZRD A;  3PSI A;  3K2Z A;  1NK3 P;  4R1H A;  3LAJ A;  4I0B A;  3BDD A;  5J1R A;  2F4O B;  2VI6 A;  4H0E A;  3BR1 A;  4DYC A;  2O0Y A;  1R9T J;  3MKW B;  5J1Y A;  3UR3 C;  2PJR B;  3O8G A;  4AID A;  3H9G A;  2VOO A;  4EM2 A;  3FM3 A;  4ON0 A;  3JRB A;  5H6R A;  1VZ0 A;  3RZO J;  1QU3 A;  2Y0M A;  2ZCW A;  3BJA A;  4XLC A;  1X1B A;  1JKR C;  5H6Q A;  3BTI A;  3I9V 2;  4RM2 A;  2ZME C;  1DU0 A;  5JVG F;  4PGH A;  2B63 J;  3E1S A;  2E34 A;  5B5E C;  1S29 A;  3MKZ A;  2JWT A;  2XV4 S;  3A02 A;  3F21 A;  3QRF F;  3KP5 A;  2XF7 A;  1H9G A;  1D1A A;  1AKH B;  1OYI A;  1T98 A;  3KP6 A;  4XID A;  2FJ1 A;  2W82 A;  2HDD A;  4OAY A;  2LDU A;  4N9I A;  2EA4 A;  1QA6 A;  2CYY A;  2JZY A;  5E1Z B;  3MZH A;  3FM5 A;  1ULY A;  2D2W A;  2EB7 A;  3S93 A;  5LGU A;  3RCO A;  4C9Y A;  1NHA A;  3I71 A;  1TT0 A;  1OFC X;  3HOW J;  1Y0N A;  2BVM A;  2ZFU A;  2EFN A;  3JRH A;  3ZMV A;  1ZGJ A;  3R61 A;  3N4M A;  3HOY J;  1RNL A;  1QHG A;  4LB6 B;  2VT3 A;  3IH4 A;  2CUZ A;  4BHC A;  3A2K A;  3PNY A;  4II2 A;  1WJE A;  4PZJ A;  4CZC A;  5E1X A;  2NXN B;  4D1Q A;  2HYF A;  1FZP B;  3LQR A;  3B73 A;  3WTU C;  1LUJ B;  1IRZ A;  1OCR H;  2E1O A;  2ME6 A;  3LSR A;  3DLL F;  2ESN A;  5DEQ A;  1HKT A;  2A3S A;  5B66 C;  5IP9 J;  1XPX A;  2L5Q A;  4WF2 A;  3CZ6 A;  2KRC A;  1IN6 A;  3CJN A;  4FET A;  4FCY A;  4NQW B;  2M4G A;  1GVJ A;  5LEK A;  3NWT A;  2HKO A;  4DOZ A;  3E7L A;  5DD4 A;  5FJ8 J;  4ENN A;  5HOD A;  2IVM A;  3DPL C;  3REO A;  4YFN F;  2P5K A;  1BIB A;  3PFY A;  1D0X A;  3SQN A;  5BS6 A;  2R7S A;  2DT5 A;  4LIV A;  5E79 C;  3LA2 A;  3LSK A;  2X48 A;  1VQL I;  1MBE A;  2IJL A;  2YU9 J;  2ECB A;  2DA3 A;  4MQV A;  3CDH A;  5BOX A;  3WU2 C;  1LFB A;  4IO9 F;  3U21 A;  1ZG1 A;  3WOD F;  1SAU A;  3O6B B;  3B6A A;  5J8F A;  3H1C A;  1IUY A;  1GT0 C;  2X1D A;  3RJP A;  1T08 B;  4N4N B;  4DBQ A;  2WBM A;  4A3C J;  2KJC A;  3C2B A;  1Z7L A;  1JT0 A;  2C6Y A;  1I1S A;  4B4C A;  2RAE A;  2P7C B;  3W2A A;  1IUF A;  2RRE A;  1Q1H A;  3B02 A;  1SFE A;  3ML6 A;  2RQP A;  2ZNY A;  4M71 A;  3FBI B;  3K0L A;  2PMZ A;  4G8X A;  2OD5 A;  4OIQ F;  2DK8 A;  3OYD A;  2LH9 A;  2NVT J;  5EZH A;  3E0J B;  1MBK A;  1YJ9 I;  5C4X J;  1XX5 A;  3FXU A;  3S2W A;  3M1E A;  5CQG A;  2X6X A;  3L7W A;  4PSX A;  3PIO F;  3HXL A;  4BAY A;  1ZAR A;  3H35 A;  5HLT A;  1U0J A;  3CCJ I;  3E6M A;  2CJJ A;  2VBZ A;  2MFZ A;  3TQN A;  2VIX A;  1G3Y A;  2K27 A;  1Z0X A;  2DDB A;  2JA2 A;  2KIS A;  3ISP A;  2H6B A;  1N25 A;  4M6V A;  5EJC A;  3E6C C;  2DOE A;  4A93 J;  4IOC F;  1R5H A;  2DMP A;  5HDG A;  4G7H F;  2R5Y B;  1LVA A;  5FLX Z;  2OTJ I;  1KU3 A;  5J8C A;  2ICW G;  3PQK A;  1YI2 I;  2PLY A;  2NVY J;  4A3D J;  1XGO A;  5ICE A;  2K86 A;  2E60 A;  2M0M A;  3W6K B;  3QOP A;  2HVQ A;  3VWB A;  5FGM A;  1Z77 A;  3BG3 A;  2PJP A;  5A2Q Z;  4L9T A;  3LWF A;  4AVP A;  2KIM A;  2WWY A;  4WXC A;  3RIR A;  4LOC A;  1IC8 A;  3K4N A;  1RR7 A;  1ETQ A;  1AU7 A;  2HOS A;  3FMQ A;  3NAR A;  4QPQ A;  3OYK A;  4XKW A;  1ZHF A;  2D1V A;  2I8D A;  3BR5 A;  1G3W A;  3S3O A;  2FOK A;  3BPV A;  2F2E A;  1M1E B;  2DJI A;  2OZU A;  4B09 A;  3E3V A;  1F5T A;  1KQ0 A;  4R79 A;  3IAS 2;  2N8G A;  5FKK A;  2DMQ A;  1ETK A;  5BMZ A;  1YJN I;  1FMV A;  4KYW A;  2UWM A;  2KHM A;  4P9U A;  3MKY B;  2CW7 A;  3T8R A;  2DMN A;  2KKO A;  3CCU I;  3CES A;  3S3N A;  1L3L A;  2EIL H;  4XSX F;  2CWE A;  1E0E A;  1ZQ3 P;  1J09 A;  2K85 A;  4G6D A;  3HKZ N;  1ONV A;  2GQQ A;  3EUH A;  2XF5 A;  2TDX A;  3ECH A;  1MMS A;  2STW A;  3ZP5 A;  2PJR A;  2HR3 A;  1XS9 A;  1STZ A;  1VQN I;  2F5C A;  5FKO A;  2VBX A;  3MQ0 A;  2F5E A;  1ZRF A;  2QSH X;  1GHC A;  3KLO A;  3L2V A;  1XGM A;  2JPB A;  4BE2 A;  3DU5 A;  2E7W A;  2BY3 A;  3L2W A;  2QVO A;  5F6F A;  2JTV A;  2CW8 A;  1TNS A;  4HDU A;  4IEJ A;  5IT3 A;  2FBI A;  3U2R A;  3SFI A;  3W6V A;  3LST A;  1DGR M;  1T8I A;  5AIQ A;  2OA4 A;  4A5N A;  5JLW A;  4ZJZ A;  5KCM A;  2GZW A;  4PSW A;  3NEU A;  2HVS A;  1V54 H;  3S15 J;  5FD6 A;  4XON A;  4IXA A;  5FFX A;  3MKL A;  1QO0 D;  1ZKG A;  3K4M A;  4U87 A;  5FKM A;  5EF6 A;  1RUN A;  2MD0 A;  5D5X B;  3C18 A;  1JUP A;  3HUG A;  3HL2 A;  1WJB A;  3K1P A;  2PFB A;  5KHD A;  2L01 A;  2DFI A;  2AXT C;  1E3H A;  1FTZ A;  3CMY A;  3E5U A;  2EZK A;  1NK2 P;  4HEA 2;  2XAQ A;  1NTC A;  2L7Z A;  1ZYR F;  4ZYG A;  2WAD A;  3CCY A;  4XMY A;  2H27 A;  2DOF A;  3EQL F;  3HGG A;  4RGU A;  5BPD A;  4IRI A;  5EEA A;  1K4S A;  2XRL A;  3GFM A;  3CD6 I;  2DA6 A;  1SVO A;  3LQQ A;  2BVL A;  3F3X A;  3QOD A;  5FKN A;  1ZRE A;  2H94 A;  2XAF A;  4B48 A;  4LK0 F;  4KJZ A;  5BNG A;  2VXZ A;  2VB6 A;  4O6J A;  3G4S I;  1T0F A;  1GDT A;  1MD0 A;  1H8A C;  3BTJ A;  1D3Y A;  3HOU J;  3FIS A;  3BY6 A;  2HU9 A;  3P5J A;  3QPL A;  2DTZ A;  4ZZD A;  2CUE A;  4WXD A;  5AIP A;  3OYE A;  4DYR A;  3UNG C;  2JVG A;  2EQR A;  5IOY A;  4IHY A;  2O8X A;  1SVM A;  2FBH A;  3G3Z A;  4QIW N;  3ZQ7 A;  2ELH A;  2QCO A;  2GLO A;  1XCV A;  1X3Z B;  2ECC A;  4I02 A;  3ZMD A;  1MSF C;  2O7O A;  1P9Q C;  1P2F A;  4E7J A;  2X6W A;  2EZL A;  3DEE A;  3F6O A;  1FIA A;  2ISZ A;  1O7F A;  1WKM A;  3DQV C;  1U78 A;  4L9V A;  1UZC A;  4MEX F;  4DZJ A;  3V8L A;  1FTT A;  3I4N J;  3ABU A;  1BI0 A;  4ITV A;  1U2W A;  4CGZ A;  2ZXW H;  3D5S C;  3A4C A;  3L09 A;  3IRQ A;  3QPT A;  4EM0 B;  2ZJP F;  4AVZ A;  1OYW A;  5DTD A;  1Z6R A;  4MFD A;  2H8R A;  5HS9 A;  2XC7 A;  4IX7 A;  4KDP A;  3KYD B;  2KL4 A;  3Q9S A;  2XGX A;  2Y31 A;  2M34 A;  1RR8 C;  1P4X A;  1S7E A;  1ON2 A;  5ICC A;  1WFX A;  5BQT A;  2K9Q A;  3COA C;  3ZN0 A;  2E1M C;  5LHH A;  2XAG A;  3HDD A;  4BU2 A;  4LLG F;  1MBG A;  2VE8 A;  1MNM C;  2E71 A;  4NBQ A;  2NYX A;  2DLL A;  3VYU B;  3FHN A;  3BPX A;  3F8N A;  5TJJ A;  1R7J A;  3KEY A;  1LNW A;  1K4T A;  3M3Y J;  2FBK A;  3HM5 A;  4QSH A;  2V1U A;  4BBS J;  2MH9 A;  2NS0 A;  2FXA A;  4MGR A;  4UB6 C;  5DUK A;  1F9N A;  4G9Y A;  1S9H A;  1XMA A;  3RTR A;  1K78 A;  2IA0 A;  2RNJ A;  2NOG A;  1S6L A;  2EFW A;  5GTH C;  5E18 F;  3ZQC A;  1R58 A;  4OIO F;  2R7X A;  3HZJ A;  4BE0 A;  4KNY A;  5ED4 A;  5JHF A;  4H4K C;  2AQF A;  5LGT A;  3CUQ C;  3AAF A;  2IGN A;  1LPQ A;  2V1X A;  4E7H A;  2F5D A;  2L02 A;  1QNT A;  4RA2 A;  5F04 A;  1TC3 C;  1X3U A;  2MLK A;  1U5T C;  1ON1 A;  2IS6 A;  2X51 A;  4HW0 A;  4Y4R A;  3TMO A;  2PBI A;  3J7Y J;  2RV8 A;  3E6D A;  3J81 K;  2VOD A;  1UG0 A;  3L2Q A;  2IT0 A;  3TO6 A;  4D7M A;  2IXS A;  4AWX B;  2M2E A;  1Z1D A;  3FKJ A;  1P7I A;  1TQP A;  1O7L A;  5DUI A;  4XLN F;  4IQJ A;  1ODD A;  3W2W A;  2CSO A;  5K5O A;  2PMH A;  1L0O C;  2FA5 A;  3HIF A;  5FRM A;  2FNP A;  4AYB A;  5LHG A;  3DPU A;  4FTH A;  2R3S A;  2NNY A;  3NWS A;  5LHI A;  2Y9Z A;  4M6X A;  2GIZ A;  4BHB A;  4AYB N;  3KP4 A;  5D5W B;  2HOT A;  3QOE A;  1I5Z A;  1TWF J;  1DUX C;  2L7K A;  3IH3 A;  2CV2 A;  3WHB A;  4PCQ A;  3OY9 A;  4Q47 A;  4M3E A;  4CCN A;  2B7E A;  1OCC H;  4M72 A;  4XOR A;  2LKP A;  4ANJ A;  4W97 A;  1HQC A;  3FXO A;  2JA5 J;  3GWZ A;  2L9S A;  4HST A;  3TP0 A;  2LF7 A;  2QLZ A;  1T38 A;  2QF7 A;  5L3D A;  2FF4 A;  5HS8 A;  2CO5 A;  4XKV A;  2ZSI B;  4I7H A;  4AIH A;  2LBF B;  3F9K A;  4GFB A;  3KEQ A;  3U1D A;  2GOM A;  1IXC A;  4RAF A;  5K7H A;  1XB4 A;  2K3F A;  3OS0 A;  1VQO I;  4IHV A;  1VQK I;  3PUB A;  2QQA A;  1XGS A;  3DBR B;  2M4K A;  4OMZ A;  3LSH A;  1SFU A;  5J47 A;  4PGG A;  3K4K A;  2X6O A;  3V7C A;  3VB2 A;  4CSW A;  4IRG A;  1MMG A;  3T8T A;  2HPI A;  1R6R A;  2V7F A;  3MN2 A;  1C0W A;  1ZTR A;  1S8N A;  2LMD A;  3ABK H;  1X1D A;  3ZQQ A;  2OC6 A;  3LFU A;  4NNJ A;  3V8J A;  4XLP F;  5IYD J;  2HEO A;  4MEY F;  3HRS A;  4HG2 A;  2NVX J;  3PSF A;  1F36 A;  1ZH5 A;  4MTD A;  3G2B A;  3JCU C;  1XSX A;  1U9N A;  1OPC A;  2RKH A;  1AHD P;  1CQT A;  2MGQ A;  1TWH J;  3S16 J;  1I50 J;  1ITY A;  4BH9 A;  2DOA A;  4ZYE A;  2EV6 A;  3K4L A;  1EKE A;  2WA0 A;  2LY9 A;  2OCC H;  3EET A;  1GXP A;  1WGX A;  3LA7 A;  5IT9 K;  4RGR A;  3FXQ A;  1QQI A;  3X2Q H;  1HKQ A;  2G7H A;  2NS8 A;  2O5R A;  1ZG5 A;  1BR2 A;  1K6O A;  5E3O A;  3U9G A;  3DV8 A;  4X0G A;  3PQJ A;  1Z7U A;  4JYK A;  4DGW B;  3BG7 A;  2E5N A;  2EV0 A;  3NAU A;  2HTS A;  4NDL A;  1YIT I;  1VQ9 I;  3T0Y A;  1YIO A;  3G1M A;  4LGW A;  4E4H A;  1XCB A;  1B8I A;  2R5Z B;  4B3X A;  4CCK A;  3S1Q J;  3SEZ A;  4RS8 A;  4UY8 I;  3M07 A;  5A2Q K;  3M8E A;  4C3J J;  3H36 A;  3MFK A;  2FNA A;  1BR1 A;  4EEF G;  1RZ4 A;  1JI8 A;  5GAE J;  1ACI A;  5CPR B;  3BQZ A;  4BYY A;  5IT9 Z;  2ZC2 A;  2PG4 A;  4A0Z A;  3R60 A;  3H9Q A;  2G7U A;  1Y56 A;  2IS4 A;  3OL3 A;  3H0D A;  1YQA A;  3DKW A;  3S8P A;  1A36 A;  2DJN A;  2V79 A;  1IN4 A;  3ERE D;  3HOZ J;  4RMN A;  1BM9 A;  3GVA A;  2R0Q C;  1LQ1 A;  5L3F A;  3PO2 J;  1DQU A;  3CP2 A;  5FB2 A;  1I1G A;  1ZLK A;  3A01 B;  2JK3 A;  3N05 A;  1WJD A;  3IP4 B;  4Y17 A;  2VAS A;  4LG3 A;  3OR1 C;  4L9N A;  4XL9 A;  2BHZ A;  5FKL A;  2M7A A;  2EZH A;  2HDC A;  2XGE A;  3DBL B;  2FML A;  2BBY A;  4XN0 A;  3GZ6 A;  2IS1 A;  2KRH A;  4L0Y B;  1IRG A;  5JHU A;  5DYM A;  2HQA A;  2W85 A;  2M3A A;  4U0W A;  4MHG A;  4KIF A;  3OR2 C;  2K4J A;  3GZ5 A;  1J5Y A;  4XLE A;  2CW0 F;  3FX3 A;  2ELJ A;  4JBA A;  3WTS C;  2A69 F;  1WSU A;  3GX4 X;  4K2E A;  4Z2Y A;  3JRF A;  4JP0 A;  1I6H J;  3QYE A;  2M8G X;  1EV7 A;  3F23 A;  3PJR A;  2K9L A;  4FE7 A;  2ZXI A;  3RPU A;  4RBO A;  2GWR A;  4UUT A;  3KET A;  1W7P D;  1MH3 A;  3HBL A;  2WTE A;  5LLQ A;  3H3Z A;  2IAI A;  2L3D A;  3EYI A;  1FP2 A;  1WI9 A;  2KT0 A;  4M3B A;  5L3G A;  4ENM A;  4A3E J;  4PJL A;  4WWC A;  1MBF A;  3K4J A;  2DN0 A;  3CMA I;  1W4M A;  2V6C A;  3ZQI A;  3KX2 A;  2CQK A;  4FX4 A;  2FQ4 A;  4EVI A;  1HC8 A;  3GZN B;  3M1C A;  4YEJ A;  3ZQL A;  2MLG A;  2ACJ A;  5DDG A;  1SMT A;  4BXU A;  1WQ2 A;  2LTP A;  3RYR A;  2HFH A;  4KIG A;  2KLO A;  3GEZ A;  4XBF A;  1JUM A;  2VUM J;  1BW5 A;  1D1C A;  1IDY A;  2XAJ A;  3DBH B;  4L5E A;  1OR7 C;  3TOA A;  3OYA A;  3MD2 A;  4LFU A;  2P81 A;  4J01 A;  2W1O A;  3IKT A;  2VC1 A;  1BIA A;  4CYC A;  2HXO A;  4HOB A;  4NQW A;  1R4M B;  1B1B A;  3WG7 H;  1ETX A;  4L18 B;  4A3J J;  1WHU A;  2FSW A;  3FK7 A;  3GLX A;  5HLH A;  3WE2 A;  4KT5 C;  1FOK A;  4G6T B;  2HXI A;  2EZI A;  1IF1 A;  5LGN A;  3PM1 A;  2ME0 A;  4KIS A;  4GGG A;  4BS9 A;  1OQY A;  5EDN A;  1Y8R B;  1LE8 B;  3NQO A;  3ZMT A;  5M5W J;  1LDK B;  4F52 A;  3G1L A;  1HCR A;  2CMP A;  3LFK A;  3KE2 A;  4BJT A;  5FRN A;  4ZDO A;  3ABT A;  3D1N I;  4Y13 A;  4A3F J;  3K9T A;  4CDG A;  3IV5 A;  4QTR A;  1LJ9 A;  1S7O A;  2HI3 A;  3CCV I;  4YIF A;  2HQ5 A;  3G6E I;  3CO6 C;  3K2A A;  1I6X A;  3SJM A;  4XSZ F;  4J19 A;  1BW6 A;  4AC0 A;  1A6I A;  1E3P A;  2I10 A;  5JR3 A;  3H3U A;  2ADU A;  1G6N A;  3WTX C;  1ZAO A;  4XLF A;  2KIQ A;  5CLS A;  3A0B C;  5LFA A;  2OZ6 A;  2DA4 A;  2E5Z A;  1W36 C;  1VQ5 I;  3PL8 A;  2IRF G;  5D8K B;  3WTV C;  3ZGK A;  4ZTJ A;  2CV0 A;  3PO3 J;  2H8W A;  3GUD A;  3Q9V A;  3SZT A;  2P6T A;  4GCV A;  2W7N A;  3TP3 A;  2QSF X;  2X1E A;  1KZH A;  3S14 J;  1JGG A;  2BE5 F;  2DAO A;  1O3Q A;  3JAM K;  3AG1 H;  4C3H J;  2CGP A;  4IPA A;  1Z3X A;  4YRV A;  2IP2 A;  2LBF A;  1ENH A;  5F0F A;  5E3N A;  1CF7 A;  3TW7 A;  4BY7 J;  3LL7 A;  5H20 A;  4A6D A;  5HDK A;  3J80 Z;  5JFR A;  2E35 A;  1MGT A;  4OAZ A;  2JN6 A;  1ZG3 A;  1W0T A;  1O57 A;  3B6C A;  4JX5 A;  2DT7 B;  4CCM A;  2D45 A;  1KU9 A;  2KZV A;  3SEQ A;  4CYC B;  3GTL J;  2YS9 A;  4C2U A;  3SZG A;  1W36 D;  2FMY A;  2WAE A;  1KQ9 A;  1SEU A;  2UV1 A;  3CLO A;  3K4C A;  3JRG A;  4X6A J;  3EYY A;  2R4G A;  5TRD A;  2OU2 A;  4EJT A;  1HDD C;  1JXS A;  2CG4 A;  2DDA A;  5ILU A;  2QEX I;  2EK5 A;  3HTU A;  1D5V A;  2XPW A;  4A3M J;  4Q5S F;  1W7P B;  2DFE A;  2Y2Z A;  1QGP A;  2IEK A;  2LYC A;  3H5R A;  3FKI J;  3H9J A;  3BZK A;  1FIP A;  2VPL A;  2A61 A;  3M9A A;  4P55 A;  1HST A;  5CVU A;  4LIU A;  4DNC A;  2HNH A;  3OMY A;  2Z2S B;  1IO2 A;  3FXK A;  3R0A A;  1G59 A;  1DPR A;  1KON A;  3M8F A;  2VON A;  4C3I J;  4I09 A;  5FD5 A;  2GA2 A;  3WU0 A;  5GAH J;  4RAZ A;  4I76 A;  4UVC A;  2PN6 A;  5ILS A;  1ZN2 A;  5IP6 A;  2LG4 A;  4OWR B;  2GA1 A;  1PP8 F;  1K7A A;  1UEL B;  3HJE A;  5C44 J;  4XM3 A;  5D4S A;  4HV5 A;  3HSE A;  1HDP A;  3SZP A;  4BL0 B;  2KRF A;  5M5X J;  2R5Z A;  2WY8 Q;  4D5F A;  4LG0 B;  1R5I D;  4A3B J;  2BZT A;  1YLF A;  3E97 A;  1R4N B;  1SD5 A;  2K9N A;  1QZE A;  3HYI A;  2BY1 A;  4HQE A;  2HYJ A;  3O2P E;  2QGU A;  2XDV A;  4HF0 A;  4G94 A;  1JGS A;  1P92 A;  3OOP A;  4AD9 A;  5KVR A;  5FLX K;  3G1O A;  2WB1 N;  3I59 A;  1WJ5 A;  1IDZ A;  3FMR A;  1CGP A;  2IA1 A;  2LK2 A;  1FOW A;  3S3M A;  2A6E F;  4FQG A;  1U9O A;  4IKF A;  5ERI A;  1ZGA A;  3DLA A;  1HKS A;  4M3F A;  2V9V A;  3A0H C;  3OYL A;  3FBN B;  4HX8 A;  4RGS A;  1HA8 A;  3CQZ J;  4OIP F;  2ZME B;  2EPF A;  5M5Y J;  1R00 A;  2E1C A;  2DOD A;  4M6Y A;  3OL4 A;  4AUX A;  4WX9 A;  1XSD A;  1O4X A;  2HQR A;  4DW6 A;  1O3S A;  2OQR A;  4DQ2 A;  4AIJ A;  3ZQG A;  3J80 K;  2STT A;  1JJ8 C;  2E2J J;  4NHJ A;  4U0V A;  1T2K A;  2E1N A;  2E2I J;  3BQY A;  1MKM A;  2PI0 A;  4HX4 A;  4XRS G;  4R8H A;  5J40 A;  3C7J A;  2MSY A;  1ORK A;  1TWG J;  2L0K A;  4F55 A;  4UV8 A;  2VBY A;  3Q0V A;  2XRN A;  3QWL A;  2QWW A;  3GFJ A;  5GAG J;  4S05 A;  3BR0 A;  2VL8 A;  3OS2 A;  4XQF A;  2VQG A;  4KIT B;  1MJ9 A;  4B8X A;  3H5N A;  3MEX A;  1U3E M;  3S32 A;  4O5V A;  1IG7 A;  1A5J A;  3I3L A;  2ZJ2 A;  3QU3 A;  3RQI A;  4F7Z A;  2DBB A;  2Q1Z B;  3CCL I;  5F1R A;  1NH3 A;  2VXD A;  2VKV A;  2XSJ C;  1SD4 A; 
#chains in the Genus database with same CATH homology
 2YSR A;  2FQ3 A;  3JTH A;  1KU2 A;  3SFZ A;  3W6J B;  1G4D A;  3P7N A;  1KYZ A;  3TKY A;  3SXY A;  1QBJ A;  1B9N A;  5DV5 A;  5D6F A;  4OMY A;  5HS7 A;  4M74 A;  1U8R A;  5HOO A;  2YPR A;  1LB2 A;  1DPU A;  2HS5 A;  4U0Y A;  4IHS A;  5E1W A;  2Z9O A;  2Q8K A;  1RUO A;  2DO7 A;  4EM1 A;  1B4A A;  1MZB A;  3PFI A;  4G7O F;  1JHF A;  1EH8 A;  5CVV A;  2MH2 A;  3I0T A;  1XD7 A;  2ZXJ A;  1HW1 A;  2VC0 A;  5E8I A;  2A6H F;  1UST A;  5D6E A;  4UV9 A;  1K78 B;  3CO7 C;  1J0R A;  4BQA A;  4M9X A;  4KIC A;  3DXJ F;  4HLX A;  1PDN C;  5D4R A;  1SMY F;  1FYM A;  3WGG A;  2P5L C;  3K1M A;  3I5U A;  2ZFW A;  2YU3 A;  3D0S A;  4LG0 A;  3WTZ A;  4EMS A;  4L0Z B;  3WGI A;  3KFW X;  2P7V B;  1XGN A;  3RPQ A;  2DW4 A;  4BNC A;  1Z6T A;  1YO5 C;  1KU7 A;  1LDJ A;  2EFQ A;  1CF7 B;  3TO9 A;  1YW7 A;  2KIU A;  4LJZ F;  4CHU A;  4A0Y A;  1FYK A;  1UB9 A;  4HLY A;  1FLI A;  1J75 A;  3BZ6 A;  1D8J A;  5JI6 A;  1GXQ A;  1TW3 A;  2QUF A;  1IN5 A;  2PEX A;  2YX7 A;  5FFZ A;  2MBF A;  4ETS A;  3QAH A;  3EDP A;  3QU6 A;  3WTT C;  3MWM A;  5D5U B;  4CZZ A;  4WCG A;  3DP7 A;  4OIN F;  2ZBK A;  1SAX A;  1YS7 A;  1YTY A;  3P9I A;  2K4B A;  3HHG A;  5LBQ A;  1OR7 A;  2DK5 A;  1PUE E;  3TDU C;  3BRO A;  1JHH A;  3JAM Z;  3KLN A;  5HVQ C;  4MTE A;  1IW7 F;  2W24 A;  3IHU A;  1FSE A;  4A12 A;  2HWV A;  2KJB A;  3WTY C;  3HRU A;  1FBS A;  1P4W A;  5E8G A;  5J6X A;  2UZK A;  5HDN A;  3T1B A;  4ESJ A;  4CXF A;  3IRR A;  4BHP A;  4ZZL A;  2P6S A;  5DD8 A;  4A0X A;  3KZY A;  1K79 A;  3CTA A;  1J9I A;  1R1T A;  4QLC U;  2HZT A;  4D0P A;  3RDI A;  4IVN A;  2ZNZ A;  1OYY A;  4LB5 A;  3F8B A;  1Z05 A;  1J59 A;  5D5V B;  4I01 A;  3IWF A;  3IC7 A;  5DCF A;  3M7G A;  3GO5 A;  3TOB A;  2XVC A;  3F22 A;  2MA3 A;  2GXB A;  4YII A;  3RKW A;  4YFX F;  2FRH A;  1V3F A;  1ZRC A;  1TLH B;  1FNN A;  3ELK A;  2JRT A;  3MCZ A;  3N97 A;  1H9T A;  4P96 A;  4ESF A;  1DP7 P;  1QPM A;  1P4A A;  2OQG A;  4LLL A;  4KMU X;  2P5V A;  3RKX A;  3F8M A;  3FF5 A;  3JSO A;  4I0A A;  2Y48 A;  1YS6 A;  1F1Z A;  2J5P A;  4UUV A;  4EJU A;  1W5T A;  5DCM A;  4IJA A;  5KK1 A;  3ZMS A;  2VOP A;  4MQ9 F;  2X4H A;  1ZLJ A;  3K1N A;  1UFM A;  4HX7 A;  1XMK A;  2HGC A;  5F64 A;  1R23 A;  3ECO A;  1RI7 A;  1BC8 C;  4ZYH A;  3J7A O;  3TO7 A;  4M73 A;  4N9H A;  2NNN A;  2QBY A;  3IWZ A;  4RB1 A;  3VOE A;  5K5R A;  4I2O A;  4KMF A;  3D5L A;  4LD5 A;  2OAZ A;  2DTR A;  5K1Y A;  2IPQ X;  4HYE A;  1R22 A;  3FWE A;  4YG2 F;  4UVB A;  2X0L A;  5CVI A;  2KIF A;  2QQB A;  2NAZ A;  4OOI A;  2QYO A;  2B0L A;  2UXN A;  4L5I A;  1T6S A;  3KP7 A;  3SHF A;  2GIV A;  2RN7 A;  1BJA A;  2ISY A;  2O61 A;  2WC2 A;  5E17 F;  3BWG A;  2QQ9 A;  5L3E A;  4HQM A;  2G9W A;  5DCM B;  2O03 A;  4LK1 F;  4A2U A;  1IN8 A;  4FX0 A;  3G73 A;  1TBX A;  4JK1 X;  2WV0 A;  1FP1 D;  4ASN A;  1XDU A;  1XN7 A;  3WU1 B;  1U5T A;  1YYV A;  3DPT A;  4KN4 X;  3V8K A;  4CO8 A;  4L9J A;  5BPI A;  1UHW A;  3V7R A;  2H09 A;  1B6A A;  5CVJ A;  2L4M A;  2HOE A;  2EV5 A;  1IXS B;  1IXR C;  2VT2 A;  4UNO A;  4HBL A;  2IW5 A;  5EEG A;  3KP3 A;  1BI1 A;  4A6E A;  1FYL A;  3QP6 A;  3T5X A;  1B59 A;  1P6R A;  3R0J A;  3WGH A;  2MD5 A;  1YFH A;  4ZYD A;  1VTN C;  4U88 A;  1V4R A;  1SFX A;  1RIO H;  4GYI A;  2DPU A;  4Q4Z F;  2QM3 A;  2VBW A;  4CIC A;  4HF2 A;  3GW2 A;  2EA2 A;  4A5M A;  4WXH A;  2HQN A;  1KQ8 A;  3F72 A;  2AXL A;  2NRA C;  4RAY A;  3I59 B;  3RYP A;  3R4K A;  1UCR A;  1KGS A;  2W84 A;  1FSH A;  1SD7 A;  3F8C A;  4RB3 C;  2ZKZ A;  1TQI A;  1KYW A;  4EJO A;  2YX4 A;  4P5O A;  1E2X A;  2PQ8 A;  1MJA A;  2EFO A;  1WWX A;  5FO5 A;  3LA3 A;  4G6Q A;  4KFC A;  2VN2 A;  3FXR A;  2M5W A;  2XRO A;  4EJV A;  2Z33 A;  4EJW A;  3BP8 A;  4KIB A;  2VE9 A;  2E7X A;  2DQR A;  3IKV A;  1IN7 A;  1REP C;  1HXD A;  1FC3 A;  1SD6 A;  2IA2 A;  4HV6 A;  5JVT A;  1BOA A;  2M1B A;  2XAH A;  4M9Z A;  4GO1 A;  4ENJ A;  3BJ6 A;  3HOT A;  1LEB A;  3F8F A;  1FWZ A;  4S04 A;  3WE3 A;  3K69 A;  2LF8 A;  1Z91 A;  2BV6 A;  3TGN A;  2Q2E A;  4Y15 A;  2QEN A;  1O3R A;  4P9F A;  4ESB A;  1I27 A;  1FT9 A;  4FT8 A;  2ETH A;  1TNT A;  3HTS B;  3WTW C;  1R1V A;  4EGZ A;  3VEP A;  2Z3Y A;  4NB5 A;  4LLN A;  3GXO A;  4YFK F;  1G3T A;  1U6G A;  2JT1 A;  4HF1 A;  2M30 A;  3GFL A;  3ZN1 A;  2O3F A;  5D8L B;  2ESH A;  1HW2 A;  5EEH A;  5CVR A;  3KZZ A;  2K7L A;  2JPC A;  4HZF A;  1D8K A;  4L5J A;  1XSV A;  4OU0 A;  3C1D A;  1PP7 U;  3F6V A;  1IRF A;  2DI3 A;  1O3T A;  2BGC A;  5K5Q A;  3I64 A;  1XDS A;  2DQL A;  1MDM B;  4AIK A;  2CFX A;  4MNU A;  2A07 F;  2Q0O A;  1FPQ A;  2LSO A;  1R36 A;  3ZMZ A;  2OBP A;  2W57 A;  1J7K A;  3JW4 A;  2M8E A;  3DFG A;  1B9M A;  1U5T B;  3NRV A;  3HRT A;  4EQQ A;  1BI3 A;  1OMI A;  3QP5 A;  2P8T A;  4E70 A;  2JSC A;  2D1H A;  2R7D A;  1W5S A;  3CUQ A;  1E17 A;  4O3M A;  1TTY A;  2RGV A;  1HSJ A;  4TV7 A;  2RC4 A;  5LRS A;  1YG2 A;  3V4G A;  3JTG A;  3E5Q A;  2W25 A;  2FEZ A;  5LEJ A;  4IF4 A;  3ZPL A;  3FZV A;  2EFP A;  4I98 B;  5L3B A;  2AS5 F;  1MJB A;  5LRR A;  2LNB A;  2MC3 A;  1OKR A;  2M45 A;  5HLI A;  3CUO A;  1S7A A;  3E6B A;  1Y0U A;  5ICG A;  2ZO4 A;  4EV0 A;  4RB0 A;  3GYH X;  2H6C A;  1G3S A;  4M9S A;  4ZH4 F;  2XUB A;  3J81 Z;  3FMS A;  1HBX G;  4CYD A;  3C3W A;  1R1U A;  2HTJ A;  5CYV A;  2O6G E;  2UXX A;  1W7P A;  2J5O A;  4ENK A;  3RKY A;  2A68 F;  3DF8 A;  3HOS A;  1BC7 C;  1QZZ A;  4OIR F;  3GF2 A;  3BOQ A;  1JE8 A;  2EJR A;  1LDD A;  3OV8 A;  3ZMU A;  4GYG A;  5AON A;  1KA8 A;  5ILV A;  3I58 A;  2RVC A;  4PDK A;  5HLG A;  3I4P A;  3O3K A;  4UVA A;  1H0M A;  3MZY A;  2EWN A;  4FHT A;  3ULQ B;  1IZ1 A;  2L54 A;  3ROU A;  4LMY A;  2GAU A;  5CJ9 A;  3I53 A;  1UHM A;  2HYG D;  2COM A;  4U7D A;  2XKO A;  1FX7 A;  2L4A A;  3FHZ A;  4N0B A;  1FBQ A;  1YW8 A;  1F4K A;  2P4W A;  2DU9 A;  2ZME A;  1LEA A;  1R5G A;  1BN5 A;  4UXN A;  4KN7 X;  5L3C A;  3P9K A;  4IRH A;  2A5Y B;  1FBU A;  1YW9 A;  3LAP A;  2QBY B;  5E20 A;  1S3J A;  2FU4 A;  3E5X A;  4GXO A;  2YR2 A;  1TW2 A;  4Q48 A;  1HW5 A;  3RI4 A;  1FY7 A;  4G7Z F;  2F5F A;  3I54 A;  4IHT A;  3Q5F A;  1BBY A;  2HKX A;  3L2C A;  3V7S A;  3HSF A;  1WRJ A;  2XIG A;  1EH7 A;  3KEO A;  4HAM A;  2BEO A;  1Z9C A;  2R7F A;  1TQM A;  2Z5U A;  2PMU A;  1USS A;  2M87 A;  2FE3 A;  4JQF A;  4EGY A;  1MDM A;  6PAX A;  3IL2 A;  2K02 A;  5ICF A;  1EH6 A;  2Z99 A;  3BJO A;  2Y75 A;  3DEU A;  2XAS A;  4RB2 C;  3MAJ A;  4XRF A;  4U7B A;  3GFI A;  1A04 A;  4KA4 A;  3VFZ A;  4QWQ A;  3QPH A;  3L00 A;  4KUM A;  1QZY A;  3WG9 A;  3VOD A;  1BI2 A;  3CUQ B;  1T39 A;  3L9F A;  2V1D A;  4WK8 F;  2RDP A;  4RGX A;  1DDN A;  2GXG A;  2BYV E;  3P9C A;  3HHH A;  2XHK A;  3TDZ C;  3JSP A;  1AOY A;  3KCC A;  3HRM A;  2XKP A;  3HSR A;  3R6S A;  2QZ8 A;  4HDV A;  1J2X A;  4HA8 A;  3H92 A;  1IAW A;  3KP2 A;  2DPD A;  1AWC A;  4UHT A;  1ZRD A;  3K2Z A;  4R1H A;  3LAJ A;  4I0B A;  3BDD A;  4H0E A;  2O0Y A;  2VOO A;  4EM2 A;  3FM3 A;  4ON0 A;  5H6R A;  2Y0M A;  2ZCW A;  3BJA A;  5H6Q A;  4PGH A;  1S29 A;  2XV4 S;  3F21 A;  3QRF F;  3KP5 A;  1H9G A;  1OYI A;  1T98 A;  3KP6 A;  2LDU A;  4N9I A;  2EA4 A;  2CYY A;  2JZY A;  5E1Z B;  3MZH A;  3FM5 A;  1ULY A;  2D2W A;  2EB7 A;  5LGU A;  1NHA A;  3I71 A;  3N4M A;  2EFN A;  3ZMV A;  1ZGJ A;  3R61 A;  1RNL A;  4LB6 B;  2VT3 A;  4BHC A;  4PZJ A;  5E1X A;  2HYF A;  1FZP B;  3LQR A;  3B73 A;  3WTU C;  2ESN A;  5DEQ A;  1HKT A;  2A3S A;  4WF2 A;  3CJN A;  1IN6 A;  1GVJ A;  5LEK A;  2HKO A;  5DD4 A;  4ENN A;  2IVM A;  3DPL C;  3REO A;  4YFN F;  2P5K A;  1BIB A;  5BS6 A;  3SQN A;  2DT5 A;  3LA2 A;  2IJL A;  4MQV A;  5BOX A;  3CDH A;  1ZG1 A;  3WOD F;  3O6B B;  5J8F A;  1IUY A;  3RJP A;  2KJC A;  2C6Y A;  1I1S A;  2P7C B;  1Q1H A;  3B02 A;  1SFE A;  3ML6 A;  2RQP A;  2ZNY A;  4M71 A;  3K0L A;  4G8X A;  2OD5 A;  4OIQ F;  2DK8 A;  3S2W A;  3FXU A;  3M1E A;  3L7W A;  4BAY A;  1ZAR A;  3E6M A;  2VBZ A;  3TQN A;  1G3Y A;  2K27 A;  3ISP A;  2H6B A;  3E6C C;  1R5H A;  5HDG A;  4G7H F;  1LVA A;  5FLX Z;  1KU3 A;  5J8C A;  2PLY A;  3PQK A;  1XGO A;  5ICE A;  2K86 A;  3W6K B;  3QOP A;  5FGM A;  2PJP A;  5A2Q Z;  4L9T A;  3LWF A;  4AVP A;  2KIM A;  2WWY A;  4WXC A;  3RIR A;  3FMQ A;  1ZHF A;  2D1V A;  1G3W A;  2FOK A;  3BPV A;  2F2E A;  2OZU A;  4B09 A;  3E3V A;  1F5T A;  1KQ0 A;  4R79 A;  5BMZ A;  4KYW A;  2UWM A;  4P9U A;  3T8R A;  2KKO A;  1L3L A;  4XSX F;  2CWE A;  4G6D A;  2GQQ A;  1ONV A;  3EUH A;  2TDX A;  3ECH A;  2STW A;  3ZP5 A;  2HR3 A;  1STZ A;  2F5C A;  2VBX A;  3MQ0 A;  2F5E A;  1ZRF A;  1GHC A;  3KLO A;  1XGM A;  2JPB A;  2E7W A;  2QVO A;  5F6F A;  2JTV A;  1TNS A;  4HDU A;  5IT3 A;  2FBI A;  3U2R A;  3LST A;  5AIQ A;  2OA4 A;  4A5N A;  2GZW A;  3NEU A;  5FD6 A;  4IXA A;  5FFX A;  1QO0 D;  1RUN A;  5D5X B;  3C18 A;  3HUG A;  3K1P A;  2PFB A;  2L01 A;  2DFI A;  3E5U A;  2XAQ A;  1ZYR F;  4ZYG A;  2H27 A;  3EQL F;  4RGU A;  5BPD A;  4IRI A;  3GFM A;  3LQQ A;  3F3X A;  1ZRE A;  2H94 A;  2XAF A;  4LK0 F;  2VXZ A;  4O6J A;  1T0F A;  1MD0 A;  1D3Y A;  3BY6 A;  4ZZD A;  4WXD A;  5AIP A;  2O8X A;  2FBH A;  3G3Z A;  3ZQ7 A;  2ELH A;  1XCV A;  4I02 A;  3ZMD A;  1P2F A;  3F6O A;  2ISZ A;  1O7F A;  1WKM A;  3DQV C;  1U78 A;  4L9V A;  4MEX F;  3V8L A;  3ABU A;  1BI0 A;  1U2W A;  4CGZ A;  3L09 A;  3IRQ A;  3QPT A;  4EM0 B;  1OYW A;  1Z6R A;  5HS9 A;  4KDP A;  3Q9S A;  2XGX A;  1P4X A;  5ICC A;  1ON2 A;  5BQT A;  3COA C;  3ZN0 A;  5LHH A;  2XAG A;  4LLG F;  2VE8 A;  2NYX A;  2DLL A;  3BPX A;  3F8N A;  5TJJ A;  1R7J A;  1LNW A;  2FBK A;  2V1U A;  2MH9 A;  2NS0 A;  2FXA A;  4MGR A;  5DUK A;  1F9N A;  4G9Y A;  1XMA A;  3RTR A;  1K78 A;  2IA0 A;  2RNJ A;  1S6L A;  2EFW A;  5E18 F;  1R58 A;  4OIO F;  4KNY A;  5ED4 A;  5LGT A;  3CUQ C;  3AAF A;  2V1X A;  2F5D A;  2L02 A;  1QNT A;  1X3U A;  2MLK A;  1U5T C;  1ON1 A;  4HW0 A;  2PBI A;  2RV8 A;  3E6D A;  3J81 K;  2VOD A;  2IT0 A;  3TO6 A;  4AWX B;  1Z1D A;  1TQP A;  1O7L A;  5DUI A;  4XLN F;  1ODD A;  2CSO A;  5K5O A;  2PMH A;  1L0O C;  2FA5 A;  3HIF A;  2FNP A;  5LHG A;  2R3S A;  2NNY A;  5LHI A;  4M6X A;  4BHB A;  5D5W B;  3KP4 A;  1I5Z A;  1DUX C;  4PCQ A;  4Q47 A;  4M72 A;  2LKP A;  1HQC A;  3GWZ A;  2LF7 A;  2QLZ A;  1T38 A;  5L3D A;  2FF4 A;  5HS8 A;  2CO5 A;  4I7H A;  4AIH A;  3KEQ A;  3U1D A;  1IXC A;  1XB4 A;  2QQA A;  1XGS A;  4OMZ A;  1SFU A;  4PGG A;  3V7C A;  3VB2 A;  4IRG A;  3T8T A;  1C0W A;  1S8N A;  3V8J A;  4XLP F;  2HEO A;  4MEY F;  3HRS A;  1ZH5 A;  4MTD A;  1XSX A;  2RKH A;  1OPC A;  4BH9 A;  4ZYE A;  2EV6 A;  3EET A;  1GXP A;  3LA7 A;  5IT9 K;  4RGR A;  3FXQ A;  1QQI A;  1HKQ A;  2G7H A;  1ZG5 A;  1K6O A;  3U9G A;  3DV8 A;  3PQJ A;  1Z7U A;  2EV0 A;  2HTS A;  3T0Y A;  1YIO A;  4LGW A;  1XCB A;  4RS8 A;  5A2Q K;  3M8E A;  3MFK A;  2FNA A;  1RZ4 A;  4BYY A;  5IT9 Z;  2PG4 A;  4A0Z A;  3R60 A;  2G7U A;  1YQA A;  3DKW A;  2V79 A;  1IN4 A;  3ERE D;  1BM9 A;  3GVA A;  1LQ1 A;  5L3F A;  5FB2 A;  1I1G A;  1ZLK A;  4Y17 A;  4L9N A;  2HDC A;  2FML A;  2BBY A;  3GZ6 A;  4L0Y B;  1IRG A;  5JHU A;  5DYM A;  2W85 A;  4U0W A;  4MHG A;  4KIF A;  2K4J A;  3GZ5 A;  1J5Y A;  2CW0 F;  3FX3 A;  4JBA A;  3WTS C;  2A69 F;  1WSU A;  3GX4 X;  4K2E A;  4Z2Y A;  1EV7 A;  3F23 A;  3RPU A;  2GWR A;  3KET A;  1W7P D;  2WTE A;  5LLQ A;  3H3Z A;  2L3D A;  3EYI A;  1FP2 A;  1WI9 A;  5L3G A;  4ENM A;  4WWC A;  1W4M A;  2V6C A;  2CQK A;  4FX4 A;  4EVI A;  2MLG A;  2ACJ A;  5DDG A;  1SMT A;  4BXU A;  1WQ2 A;  3RYR A;  2HFH A;  4KIG A;  3GEZ A;  4XBF A;  2XAJ A;  3TOA A;  4LFU A;  3IKT A;  2VC1 A;  1BIA A;  4HOB A;  4NQW A;  1B1B A;  4L18 B;  2FSW A;  3GLX A;  5HLH A;  3WE2 A;  4KT5 C;  1FOK A;  1IF1 A;  5LGN A;  4GGG A;  3NQO A;  3ZMT A;  1LDK B;  3LFK A;  3KE2 A;  3ABT A;  4Y13 A;  3K9T A;  4CDG A;  1LJ9 A;  1S7O A;  4YIF A;  3CO6 C;  1I6X A;  4XSZ F;  5JR3 A;  3H3U A;  2ADU A;  1G6N A;  3WTX C;  1ZAO A;  5CLS A;  2OZ6 A;  2IRF G;  5D8K B;  3WTV C;  3GUD A;  3Q9V A;  3SZT A;  2P6T A;  4GCV A;  2BE5 F;  2DAO A;  1O3Q A;  3JAM K;  2CGP A;  4IPA A;  2IP2 A;  1CF7 A;  5H20 A;  4A6D A;  5HDK A;  3J80 Z;  5JFR A;  1MGT A;  1ZG3 A;  1O57 A;  2D45 A;  1KU9 A;  2FMY A;  1KQ9 A;  3CLO A;  3EYY A;  5TRD A;  2OU2 A;  4EJT A;  1JXS A;  2CG4 A;  5ILU A;  2EK5 A;  3HTU A;  1D5V A;  4Q5S F;  1W7P B;  1QGP A;  2A61 A;  3M9A A;  4P55 A;  1HST A;  5CVU A;  4DNC A;  3R0A A;  1DPR A;  3M8F A;  2VON A;  4I09 A;  5FD5 A;  3WU0 A;  2GA2 A;  4RAZ A;  4UVC A;  2PN6 A;  5ILS A;  1ZN2 A;  2GA1 A;  1PP8 F;  1K7A A;  5D4S A;  4HV5 A;  3HSE A;  3SZP A;  2KRF A;  4LG0 B;  1YLF A;  3E97 A;  1SD5 A;  3HYI A;  4HQE A;  3O2P E;  4HF0 A;  4G94 A;  1JGS A;  1P92 A;  3OOP A;  4AD9 A;  5KVR A;  5FLX K;  3I59 A;  3FMR A;  1CGP A;  2IA1 A;  2A6E F;  5ERI A;  1ZGA A;  1HKS A;  2V9V A;  4HX8 A;  4RGS A;  4OIP F;  2ZME B;  2E1C A;  1R00 A;  4M6Y A;  4WX9 A;  1XSD A;  2HQR A;  1O3S A;  2OQR A;  4DQ2 A;  4AIJ A;  3J80 K;  2STT A;  4NHJ A;  4U0V A;  1T2K A;  2E1N A;  1MKM A;  2PI0 A;  4HX4 A;  4R8H A;  3C7J A;  4UV8 A;  2VBY A;  2XRN A;  2QWW A;  3GFJ A;  4S05 A;  1MJ9 A;  4B8X A;  3MEX A;  1U3E M;  4O5V A;  3QU3 A;  2ZJ2 A;  4F7Z A;  2DBB A;  5F1R A;  1SD4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...