3W6KB

Crystal structure of dimer of scpb n-terminal domain complexed with scpa peptide
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
82
structure length
82
Chain Sequence
GALKPAKAIVEALLFAAGDEGLSLSQIAAVLEVSELEAKAVIEELQQDCRREERGIQLVELGGVFLLATKKEHAPYLKKLVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords ScpA
publication title Molecular basis of SMC ATPase activation: role of internal structural changes of the regulatory subcomplex ScpAB
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 26
structure length 82
sequence length 82
chains with identical sequence C, E, F
ec nomenclature
pdb deposition date 2013-02-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3w6kB00
2K7LA 4MNUA 2DK5A 3HRSA 2L4MA 5F6FA 4IRIA 3HOTA 5E18F 3K1NA 4HF0A 2K4JA 3EUHA 5LGTA 4HW0A 4RB3C 2EV0A 4UVCA 3KEOA 4EJTA 5D6EA 5DDGA 1QZZA 1KA8A 1FZPB 4KYWA 1T39A 1WWXA 5L3EA 1LQ1A 2XRNA 2A61A 1FYLA 3F6OA 4WX9A 3R61A 4ENKA 5CLSA 1WQ2A 1EH8A 1O3QA 1K78A 1FSHA 2NYXA 4R1HA 3GFMA 4EQQA 4M72A 5HS9A 1SD7A 3K9TA 2MD5A 5K1YA 2LDUA 1O7LA 2MLKA 1IXCA 3L2CA 3JTHA 3ULQB 2PLYA 4KNYA 1MKMA 2XAQA 1UCRA 1SAXA 1UHWA 1FBUA 2F5DA 2Z5UA 3KZYA 4EJVA 4OIOF 1ZG1A 5LRSA 3TOBA 4IPAA 2CFXA 5ED4A 1BI0A 1PP7U 2FBKA 4LLGF 5TRDA 3HYIA 3DKWA 4H0EA 4O6JA 2RNJA 4OIPF 4UHTA 3CUOA 1P4AA 4EM1A 4P9FA 4RAZA 1K6OA 4FX4A 2WV0A 3GLXA 5H20A 1ZGJA 5E8GA 3BROA 1HW2A 1LDKB 1YW9A 2P4WA 4DNCA 2RKHA 3J80Z 3ROUA 4A12A 3IKVA 3L9FA 3I58A 1K78B 3BWGA 1YQAA 1R1TA 4A6EA 1JGSA 1QQIA 4YIIA 2DFIA 2E7XA 1XDUA 1ZG3A 3K1PA 3LAJA 3E3VA 3MQ0A 3FXRA 5BMZA 2NAZA 1YYVA 1LVAA 1J59A 3WTYC 3FHZA 1OYYA 5CVUA 1WI9A 3RPUA 1YTYA 5HDKA 2Y48A 1MD0A 1FWZA 3ZN1A 3M1EA 5JR3A 3I4PA 2EV5A 3R6SA 2ZNZA 3IHUA 1R1VA 1H0MA 3LQQA 4RAYA 2IT0A 3IRRA 4N9HA 1SD4A 3GZ6A 3LAPA 1YFHA 3HUGA 1SFEA 4HF2A 1WKMA 1QO0D 3IKTA 1IRFA 3ZN0A 1ZRFA 4FHTA 4AWXB 1HW5A 1FP2A 3K0LA 1MZBA 2QM3A 4A5NA 3E6CC 1J7KA 4YFXF 2L01A 1DPUA 2ETHA 3E5QA 2ZXJA 2F5CA 3F8CA 2M30A 1Z7UA 1EH6A 1XGSA 4NQWA 4IJAA 2HZTA 4M73A 5FLXK 1IN6A 3GZ5A 3VOEA 3WGHA 3ISPA 1KQ9A 2XAJA 2H09A 2UWMA 4S05A 3E5XA 1RUNA 2HKXA 2VBWA 2Z9OA 2ESNA 2LNBA 3HRMA 4E70A 4BYYA 3CO6C 4LB6B 1V4RA 2DK8A 5ILUA 2HTJA 2VC1A 3V4GA 4Y17A 5E20A 5DEQA 5HDNA 2XHKA 2QYOA 3V7CA 2VE8A 2F5EA 3GEZA 2HTSA 3KLOA 4GCVA 2FA5A 4PGGA 2IA2A 4A0YA 5JFRA 4ETSA 1SD5A 2VT2A 3RKXA 3ML6A 1UHMA 3VEPA 2EV6A 1CGPA 2CW0F 3WGIA 1ZGAA 1K79A 3HSRA 1TBXA 4A2UA 4F7ZA 1FOKA 1O7FA 3Q5FA 2EFQA 4LB5A 4PGHA 2JPBA 1MGTA 4L9JA 2ZO4A 4MEYF 2AS5F 1G3TA 4HF1A 3H3ZA 5LGNA 3IL2A 2B0LA 4CHUA 1B4AA 1RZ4A 2FE3A 2PJPA 4UVBA 3GFJA 3TO6A 3TDUC 5HS7A 1IN7A 4YFNF 2DU9A 4IHTA 2XUBA 4ZYEA 4WK8F 3ELKA 4PDKA 4ESFA 1IF1A 3EQLF 1FYMA 2VOPA 2NNYA 2RC4A 3J81Z 1I27A 5L3DA 3NRVA 1OR7A 4OIQF 2CO5A 4NHJA 1ONVA 1XN7A 4LG0A 1FYKA 3DV8A 1P4WA 4HAMA 3CDHA 2FOKA 1TLHB 2HGCA 2IA1A 2D45A 4I0BA 4HDVA 1G6NA 4P96A 5BS6A 2LF8A 3GWZA 5HDGA 2M1BA 3QP6A 3EDPA 4HLYA 4GGGA 1O3SA 4UV8A 4HZFA 4BHPA 2EJRA 3LA2A 3ZMTA 1BIAA 1J5YA 3WODF 1FT9A 1S7AA 5KVRA 1Z6RA 3F8FA 1MJBA 4IRHA 2Q8KA 2STWA 1A04A 5DUKA 1D8JA 2R3SA 2K02A 5D5WB 5JHUA 2OQRA 4A6DA 2K4BA 5LEJA 3RKWA 1T2KA 4LG0B 4MTDA 2O61A 4I98B 1LDDA 4S04A 1FX7A 3LA3A 3GFIA 5H6QA 1QNTA 4ON0A 1U3EM 1KYWA 3R0AA 3REOA 1D8KA 5DCMB 1JE8A 2NS0A 3MFKA 3BDDA 3RIRA 4KT5C 2O0YA 5FGMA 4M6YA 2DQRA 1XSXA 2GXBA 1EV7A 3QRFF 2XKOA 4OMYA 4LD5A 4HDUA 4PZJA 3E6DA 2D1VA 5K5OA 4M9ZA 3F22A 2CG4A 3I53A 3KP5A 3K1MA 5L3BA 2YPRA 2HKOA 2V6CA 1FLIA 2F5FA 2PMHA 3KP2A 5EEGA 4A5MA 1FBSA 3MAJA 3QPTA 3KZZA 1U6GA 2M45A 3J7AO 2RN7A 1FSEA 5DD4A 1IZ1A 1QPMA 4ZYGA 4R8HA 3RYPA 4YFKF 1DPRA 3DFGA 2UZKA 1ZLKA 4Q47A 1USSA 2BE5F 5L3CA 3U1DA 3HTUA 3CUQA 4BHBA 1S7OA 2D1HA 1W7PA 1F1ZA 2JT1A 1CF7A 4UV9A 3HSFA 4CICA 5CYVA 3KCCA 3ABUA 3L00A 4EJWA 2L02A 2ZCWA 5K5RA 3V8JA 5E1XA 2IW5A 2PI0A 1I1SA 3FMSA 1R23A 3EYIA 2QBYB 1AOYA 5BPDA 2HDCA 2HR3A 5D5UB 4AD9A 1EH7A 2VT3A 2EB7A 3VB2A 4U0VA 4FX0A 5FFZA 3SHFA 5E8IA 1DP7P 1USTA 3E5UA 4L18B 4AIHA 3L09A 2DW4A 4UUVA 4U7DA 1S6LA 2CWEA 3LSTA 4JK1X 3BOQA 3C18A 2CYYA 5J8CA 2ZBKA 5J8FA 4WWCA 1R22A 5CVJA 2Z33A 1TQMA 5DYMA 3GUDA 3CUQB 2J5PA 1W7PB 2K86A 2XVCA 3B02A 1CF7B 4JQFA 3AAFA 2XAFA 2G7HA 2CGPA 1MDMA 1OYIA 3GVAA 2FU4A 5FLXZ 3G73A 1TW2A 1XCBA 4HBLA 4Q5SF 4RGRA 2A6EF 1XGOA 4G7OF 4WXHA 5LLQA 4HQEA 1ZLJA 3GF2A 1HSJA 2V9VA 4FT8A 2D2WA 3DF8A 2P5VA 3ECHA 4LLLA 1IXRC 1XGNA 1LEBA 3KP6A 3HTSB 5L3GA 1IUYA 2IJLA 1YW7A 2W84A 2KKOA 3SZPA 5IT9K 5AIQA 1IRGA 1BI3A 2AXLA 2KIMA 4PCQA 1OMIA 4IF4A 2LF7A 2P8TA 1R5HA 3WG9A 4D0PA 4KIGA 3PFIA 2L3DA 2XIGA 2CSOA 1FNNA 4MQ9F 1FC3A 3U2RA 1F5TA 1HQCA 5HS8A 3TQNA 3KP7A 5DUIA 4NB5A 4O5VA 3VODA 2MC3A 5HLHA 4N0BA 2QLZA 1DUXC 3CTAA 2QQ9A 2VBZA 1TNSA 2Y75A 3O2PE 3O6BB 2HYGD 2QUFA 1Z6TA 4ENJA 4WF2A 3NEUA 3QPHA 2W24A 4CYDA 3ERED 3LWFA 2ESHA 4LGWA 5D5VB 5E1ZB 1R7JA 2GA2A 1MJAA 5CVRA 2PN6A 2GWRA 3M7GA 1B1BA 2FMLA 4RB0A 1W4MA 3DPTA 4K2EA 5HOOA 2HOEA 2MH9A 4U0WA 4CDGA 1ON1A 2RGVA 2KRFA 2VE9A 2BV6A 3IWZA 3F8MA 3SQNA 1KGSA 2YR2A 2O8XA 4RB2C 5AONA 1E17A 3GYHX 1W5TA 5J6XA 2HFHA 2BEOA 3JSPA 1WSUA 4LK1F 1QZYA 5HVQC 2V1UA 2M5WA 3R0JA 3W6JB 4G7ZF 3FXQA 1XMAA 4IRGA 4Y15A 1NHAA 3KFWX 2M8EA 3EETA 1OPCA 2LKPA 3V8LA 1R5GA 3D0SA 2VBYA 2DLLA 4EGZA 5AIPA 1ZAOA 2ISZA 2R7DA 4UXNA 1BI2A 2G7UA 1LJ9A 2KJCA 2ZNYA 2QZ8A 2XKPA 3I0TA 2P7VB 4WXDA 4WXCA 2L4AA 1GHCA 3FXUA 2VN2A 1AWCA 2HS5A 3HOSA 3R60A 3RPQA 3F8NA 1E2XA 1BN5A 4CZZA 2FEZA 2DTRA 2GA1A 1UFMA 1U2WA 2XROA 4G9YA 1P6RA 2W25A 4KFCA 2FNAA 2O03A 4EM0B 4LFUA 3N4MA 4P5OA 4I0AA 3F3XA 5ICFA 2FF4A 2R7FA 2DO7A 2PG4A 5JVTA 4Y13A 5F64A 3HSEA 3M8FA 1YG2A 4EMSA 2OZ6A 3IC7A 2UXNA 2Y0MA 4OIRF 3HHGA 1F4KA 1PUEE 1JHHA 1XD7A 2GXGA 2COMA 1T6SA 2A6HF 2FBHA 1Y0UA 3WTSC 4AIKA 1XMKA 4IHSA 1JHFA 3F21A 2ADUA 1OKRA 1XDSA 4RGXA 1I5ZA 3WTXC 1B9MA 4L9NA 3EYYA 4BQAA 2JRTA 1C0WA 3DXJF 4ZZDA 3FF5A 1LEAA 4ZYDA 4HA8A 2H94A 4ASNA 3CLOA 2EFPA 2FBIA 2QVOA 1BC8C 3T5XA 5K5QA 2A69F 1HKSA 5HLGA 3I54A 1PDNC 3GW2A 2P5LC 4UNOA 2EA4A 2BGCA 1B59A 3CUQC 1Q1HA 3I59A 4EGYA 4HV6A 3ZMDA 3I64A 1R1UA 5FFXA 4BNCA 3PQJA 3WU0A 4GYIA 5D8LB 2JZYA 4I2OA 2JSCA 2EK5A 2OBPA 1X3UA 3P7NA 5FB2A 3ZQ7A 1O57A 2DAOA 4BXUA 2IA0A 3JAMK 3RTRA 2MA3A 2MBFA 3DP7A 3GXOA 2YX4A 2EWNA 4P55A 3IRQA 3TO7A 2YX7A 3M8EA 4HX8A 3D5LA 2QENA 3I71A 1KU3A 3P9CA 2PMUA 4L9TA 3FM5A 4MGRA 1J9IA 2RVCA 4G8XA 4MTEA 4BH9A 4G6QA 3OV8A 3TOAA 1I1GA 4KA4A 3TKYA 5IT9Z 4G7HF 2HEOA 3C1DA 1TQIA 1ZRCA 1HW1A 2C6YA 3LA7A 1TTYA 3CJNA 2A5YB 2H27A 1IN8A 2W85A 2IPQX 3NQOA 3DQVC 2P6TA 4EM2A 1V3FA 5LHGA 1IN4A 1SMYF 3OOPA 1G3SA 3FM3A 1U8RA 2PBIA 3ABTA 3JSOA 4KN7X 4M9XA 3W6KB 1G3WA 2VXZA 4LMYA 2KIUA 2JPCA 1G4DA 2DBBA 3WE2A 3J81K 2BBYA 1ZN2A 2H6BA 2ZJ2A 3F72A 3GO5A 3V8KA 2RDPA 4ZH4F 3JTGA 3ZMUA 3JW4A 2K27A 5D6FA 2GQQA 4G94A 3CO7C 2H6CA 3TGNA 3BJ6A 1S3JA 1T38A 3O3KA 2P5KA 3E97A 2FMYA 2E1NA 5BQTA 3WGGA 1ZRDA 4B09A 1BI1A 4BAYA 2KIFA 2OZUA 1BC7C 5IT3A 1YO5C 1J2XA 3WE3A 5ICGA 1YIOA 4YG2F 5FD5A 1W5SA 5LEKA 5LHIA 3SFZA 2PQ8A 4HYEA 4BHCA 1F9NA 3BJAA 3F6VA 3N97A 4KIFA 3MWMA 3LQRA 1GXPA 2MH2A 2BYVE 3COAC 5D4SA 5D5XB 2X4HA 4HQMA 1P2FA 3H3UA 1K7AA 2ZFWA 3KLNA 1Z91A 1HKQA 3LFKA 4U0YA 3SZTA 2CQKA 2PFBA 1SFUA 1S8NA 3T8TA 3QAHA 4Q48A 3T8RA 5ICEA 2MLGA 1YLFA 2EFWA 5F1RA 4Q4ZF 2DPUA 2NNNA 4HX4A 2PEXA 1ON2A 1R36A 2Z3YA 4XRFA 1QBJA 1KU2A 1BM9A 3SXYA 4ESJA 2VODA 1L3LA 4QLCU 1MDMB 4I02A 2ELHA 3KP4A 3GFLA 5BPIA 2V1DA 3VFZA 1VTNC 3DPLC 4HOBA 4KUMA 2O6GE 2QWWA 2GZWA 3KETA 4ZYHA 4A0ZA 2RQPA 3K2ZA 4OINF 2RV8A 5D8KB 2VONA 3ZMZA 1HXDA 2P7CB 1PP8F 1TNTA 4M74A 1R58A 2HQNA 4A0XA 3L7WA 1BBYA 2VC0A 4OU0A 3RI4A 2QQBA 4I09A 1DDNA 5LGUA 1FP1D 4XLNF 3WTZA 4XSZF 2FRHA 1GXQA 3F23A 5CVIA 2NRAC 1XB4A 3V7RA 5KK1A 3PQKA 1U5TC 3T0YA 2A68F 5A2QK 4EJUA 3KE2A 1G3YA 5DCFA 1HSTA 1R00A 3WTUC 2WC2A 5DV5A 4U7BA 2J5OA 4LK0F 1FPQA 4L0ZB 1XSDA 2IVMA 4LLNA 3IWFA 4MEXF 4G6DA 1B9NA 4HX7A 3BPXA 4CO8A 1GVJA 3M9AA 5CVVA 6PAXA 2DQLA 1QGPA 5LRRA 5ERIA 5D4RA 1P92A 3HRUA 2TDXA 1ZG5A 1ZYRF 2EA2A 3GX4X 2FXAA 2ISYA 2GAUA 1ZHFA 3QOPA 1P4XA 4ZZLA 3B73A 2DT5A 4Z2YA 2OQGA 3C7JA 4CXFA 2KJBA 3FMQA 1J75A 4HV5A 2V1XA 3FWEA 3RYRA 3WTTC 3DEUA 4KIBA 4P9UA 4M71A 3BPVA 1JXSA 4M9SA 2XV4S 1STZA 2FSWA 3T1BA 4N9IA 2ZMEA 1KQ0A 3TDZC 2XASA 1BOAA 3JAMZ 3ZMSA 3J80K 2VBXA 3RJPA 4OMZA 4I01A 1U5TA 4MHGA 2L54A 1KU9A 4EJOA 5JI6A 4IXAA 2OAZA 3HHHA 2IP2A 5E1WA 1XGMA 3C3WA 4UVAA 1TQPA 5LBQA 2HWVA 2O3FA 2Z99A 4L9VA 4ESBA 4RS8A 2ZKZA 2HYFA 1BJAA 4KMUX 1ZREA 2E7WA 3G3ZA 5HLIA 4XSXF 2JTVA 1D3YA 2IRFG 1D5VA 1IN5A 1HKTA 2XAHA 3V7SA 1S29A 3F8BA 1J0RA 1XCVA 1YW8A 2OD5A 2FQ3A 2ZMEB 4M6XA 5FD6A 2A07F 3FZVA 1OYWA 1LB2A 3R4KA 2F2EA 3I5UA 3U9GA 4KN4X 3MZHA 2E1CA 1U5TB 4JBAA 1IXSB 3MCZA 1L0OC 5E17F 1ZARA 1ODDA 2XGXA 1SD6A 4QWQA 3S2WA 5CJ9A 4L5IA 2YSRA 1KYZA 1BIBA 1UB9A 1IW7F 1RUOA 4DQ2A 1Z1DA 4I7HA 4AVPA 5BOXA 2WTEA 2EFNA 5DCMA 2EFOA 2ACJA 2A3SA 1LDJA 5TJJA 4EV0A 4L5JA 3H92A 1MJ9A 4RGSA 4RGUA 4R79A 4RB1A 4MQVA 1O3TA 3BP8A 4YIFA 3QU6A 4ENNA 5L3FA 1I6XA 2OU2A 3HIFA 4HLXA 3FX3A 1REPC 2FNPA 3RKYA 1FBQA 5H6RA 5DD8A 4O3MA 4AIJA 3MEXA 3P9KA 4GXOA 2G9WA 1ULYA 1IAWA 1TW3A 2Q0OA 1XSVA 3E6MA 2VOOA 1LNWA 4WCGA 1RIOH 3ZPLA 3QP5A 4GO1A 2M87A 1SMTA 4B8XA 4XLPF 2V79A 4U88A 1YS7A 3I59B 3ZP5A 1T0FA 4L0YB 3WU1B 4TV7A 1RNLA 3Q9VA 4IVNA 1O3RA 2P6SA 1H9TA 3ZMVA 1Z05A 2XAGA 2W57A 3BJOA 1Z9CA 4ENMA 1SFXA 2YU3A 4CGZA 2UXXA 2QBYA 2HQRA 4OOIA 1KU7A 3HRTA 2Q2EA 3TO9A 4KDPA 1FY7A 3BZ6A 1T98A 2DI3A 5ILSA 2OA4A 3MZYA 3Q9SA 1YS6A 3WTWC 3ECOA 2X0LA 3P9IA 5ICCA 4LJZF 5EEHA 2QQAA 5LHHA 3RDIA 3E6BA 5FO5A 2LSOA 4GYGA 1H9GA 4KMFA 5ILVA 1RI7A 1U78A 2DPDA 3KP3A 1HBXG 1W7PD 3KEQA 4KICA 3FMRA 3WTVC 3K69A 2WWYA 4XBFA 1B6AA 2GIVA 3BY6A 3QU3A 1ZH5A 4EVIA 1WRJA 5A2QZ 1KQ8A 2STTA
chains in the Genus database with same CATH superfamily
2K7LA 2Q2EB 4MNUA 2DK5A 3BTIA 3HRSA 2L4MA 5F6FA 5HODA 4IRIA 3HOTA 5E18F 1X4OA 4RMNA 2ECCA 1YRNA 3ZQHA 3OYBA 1N78A 3K1NA 2MW8A 5M3FJ 4HF0A 2K4JA 4M3GA 2R5YA 3EUHA 1X19A 5LGTA 3LSJA 4HW0A 4RB3C 4G6TB 2DFEA 2EV0A 3K2AA 4XORA 4UVCA 3PIPF 2JVHA 1AHDP 2LRDA 1Z7LA 1MMSA 3KEOA 4EJTA 5D6EA 5DDGA 1QZZA 5C44J 1KA8A 2ZB9A 1FZPB 4KYWA 2DA2A 4KJZA 1T39A 4PJ0C 2CW8A 3BT9A 3L2QA 5F0CA 1D0XA 1WWXA 4XONA 5L3EA 1LQ1A 4DYCA 4JX5A 1UG2A 4NC6A 5C4XJ 2XRNA 4EATA 2A61A 1FYLA 3F6OA 4WX9A 3R61A 4ENKA 5CLSA 1WQ2A 1EH8A 1O3QA 3S32A 1K78A 1FSHA 2NYXA 4R1HA 3SFIA 4XIDA 3K4JA 2WV1A 3A02A 3GFMA 4EQQA 4M72A 2PMZA 4XKWA 5HS9A 1SD7A 1K83J 1K4TA 3K9TA 2RAEA 2MD5A 5K1YA 2LDUA 4XM3A 1O7LA 5GPAA 2MLKA 1IXCA 3L2CA 3JTHA 3ULQB 2PLYA 2L9RA 1A6QA 3OOUA 3QYEA 4KNYA 1MKMA 2XAQA 5IY5H 5B66C 3K4NA 2XPVA 1UCRA 2MABA 1SAXA 4CUGA 1UHWA 1FBUA 5KNLA 3H3VK 2F5DA 2Z5UA 3KZYA 4EJVA 4OIOF 1ZG1A 5LRSA 3TOBA 2DMPA 4C3IJ 1ZELA 1SFOJ 4KITB 4IPAA 1ZTRA 2CFXA 5ED4A 1S9HA 2HVRA 1BI0A 1N75A 3S3NA 4ZTFA 3VSKA 1PP7U 3I56I 2FBKA 3VYRB 4LLGF 2EZIA 4UUSA 3HYIA 2R5YB 5TRDA 3DKWA 4H0EA 3U1KA 4O6JA 3ZOBA 2RNJA 3OS2A 2V26A 4OIPF 4UHTA 3ONQA 3CUOA 1P4AA 3PFYA 4P9FA 4EM1A 4A3FJ 4RAZA 1K6OA 3CZ6A 3CC4I 4FX4A 2WV0A 3GLXA 1JI8A 2ZXIA 4X6AJ 5H20A 3JR9A 3FIWA 1ZGJA 3GLLA 3H5AA 5E8GA 3TMOA 2JA6J 3M3YJ 3BROA 2B9SA 1HW2A 1LDKB 1YW9A 2P4WA 4DNCA 2DYRH 2QGUA 5E3LA 2RKHA 5K7FA 3J80Z 1XX5A 3ROUA 4IOAF 4A12A 1G59A 1IDZA 3IKVA 4CCMA 2HI3A 4XKBA 1QVTA 3HB9A 4RLFA 3L9FA 1TC3C 3I58A 3N05A 1K78B 3S1MJ 3BWGA 2VQGA 2CUJA 1SFKA 2MFZA 2R5ZA 2BW3A 1YQAA 1R1TA 4A6EA 3H5RA 1JGSA 2CQXA 2LG4A 1QQIA 3FHNA 1X2MA 3BZCA 2DFIA 4YIIA 2K40A 4ABZA 4EEFG 2PJRB 1VQ4I 5JHFA 2E7XA 1ETOA 3ESWB 1XDUA 1ZKGA 1ZG3A 4OAYA 3K1PA 1ZQ3P 3LAJA 1XC5A 3E3VA 2FUG2 1MBHA 2X1DA 1YITI 2WB1N 3MQ0A 3FXRA 5BMZA 2VKHA 4IKFA 2NAZA 3W2WA 1YYVA 3CCRI 1LVAA 3DU6A 2IEKA 1J59A 4I99C 3WTYC 5B1AH 3FHZA 3IV5A 3G6EI 1OYYA 5CVUA 3TEDA 1WI9A 4UUSB 2H1LA 3S15J 3RPUA 2DOFA 3ZCOA 2E60A 3KPHA 1IDYA 5HDKA 1YTYA 4C9YA 2FOWA 2HXIA 3S3MA 4E7KA 2Y48A 1MD0A 2XF7A 5M5WJ 4FASD 1FWZA 3ZN1A 2B7EA 4A3EJ 3M1EA 4AIDA 2GBYA 5JR3A 2EH3A 2YUSA 4XLCA 1V5EA 4IO9F 4QIWN 1K61A 2CH0A 4PUSA 1FIPA 3I4PA 2EV5A 3R6SA 4E4HA 2ZNZA 3IHUA 1R1VA 1H0MA 3RKQA 1MNMC 3LQQA 1YHQI 4RAYA 2IT0A 4RDUA 3IRRA 4N9HA 2V4JC 1XG1A 2IS1A 1SD4A 1X3WB 4XOPA 3GZ6A 4ZJZA 3LAPA 4Y52J 2DT6A 4B47A 1YFHA 3HUGA 1SFEA 1V54H 2RQQA 3GTPJ 2YU9J 4HF2A 1WKMA 1QO0D 3IKTA 4IOCF 2BW3B 1IRFA 3ZN0A 1ZRFA 3OR2C 4FHTA 4HEA2 2EIKH 5CQGA 4D7MA 1IRZA 4AWXB 2IS6A 1OCCH 1HW5A 1FP2A 2DA1A 3K0LA 2JA5J 4XKVA 1MZBA 2QM3A 4A5NA 3E6CC 1J7KA 4A3BJ 4YFXF 2L01A 1A35A 1DPUA 2ETHA 3E5QA 5FKOA 3D5RC 3GTJJ 2ZXJA 4BQNA 2ELJA 2F5CA 4DJAA 2W00A 1B72A 3BTJA 3F8CA 2M30A 3QPSA 1Z7UA 1EH6A 1XGSA 2OJED 3C2GA 2W1OA 4NQWA 4IJAA 2LREA 2HZTA 4M73A 2A05A 3DKYA 1RKTA 2QA4I 5FLXK 1BL0A 2GOMA 2FQ4A 1IN6A 3GZ5A 3VOEA 3RZDJ 3GTLJ 3F9KA 3WGHA 2ZJPF 4IHYA 3DKXA 1UMQA 3PUFA 3ISPA 1KQ9A 2XAJA 4M3EA 1MBFA 2Z16A 2H09A 2KRCA 2UWMA 2OUMA 4S05A 4BQOA 3E5XA 4F91B 1RUNA 2HKXA 2VBWA 2Z9OA 2ESNA 2LNBA 2DJNA 3HUGB 1YOVB 1SAUA 3FBIB 3HRMA 4I76A 3CCQI 4E70A 4BYYA 1ENHA 1DU6A 3CO6C 3K4CA 2PX9A 4LB6B 4XK4A 1VQ8I 2MC4A 3KYCB 1V4RA 2DK8A 4V2FA 5ILUA 2HTJA 2VC1A 1LUJB 4BE1A 3V4GA 4Y17A 5E20A 3FKIJ 2X6OA 5DEQA 3JRCA 2VJJA 5HDNA 1X3ZB 3GZNB 2I5UA 2XHKA 1FOWA 2NOGA 2QYOA 3V7CA 3CC7I 2V6EA 2VE8A 2XSDC 1K6YA 1DQUA 2F4IA 1Y8QB 2F5EA 3GEZA 2HTSA 2HU9A 3KLOA 4F93B 2LY9A 4GCVA 2FA5A 4PGGA 3I3LA 2IA2A 4A93J 1SVOA 3AG3H 3SDGA 4A0YA 5JFRA 4ETSA 1SD5A 4FISA 2VT2A 3RKXA 4NQWB 3ML6A 1QRYA 2EZKA 2IAIA 2R7RA 1UHMA 2NS8A 3VEPA 2EV6A 1VQ7I 2KMUA 4QPOA 2CW0F 3WGIA 1ZGAA 2XAUA 1CGPA 2JJ7A 1RR7A 1EF4A 3NWTA 3HSRA 3CP8A 5IP9J 1K79A 1TBXA 1TZLA 2JA7J 4A2UA 4F7ZA 1FOKA 3KZIC 1O7FA 5E3OA 3FKJA 4DZJA 3Q5FA 2EFQA 1MH4A 4LB5A 2R7UA 3H9GA 4PGHA 2JPBA 1MGTA 4L9JA 2ZO4A 2EILH 2E1OA 3NAUA 3CF2A 4MEYF 2AS5F 4L5EA 1G3TA 3HPGA 4ZYAA 4HF1A 3H3ZA 5LGNA 1EKEA 3IL2A 2B0LA 2EIMH 2XF5A 2VPLA 1UG0A 4CHUA 2WBMA 1B4AA 1RZ4A 2FE3A 3FK7A 2PJPA 3AFHA 1NG6A 3SDBA 4UVBA 3GFJA 3TO6A 3TDUC 2DA6A 4C3HJ 5HS7A 1IN7A 4YFNF 2DU9A 5GTIC 5EF6A 1A31A 4IHTA 2XUBA 2VB6A 4ZYEA 4WK8F 1RESA 3ELKA 4PJMA 4YEJA 2HZDA 3BLYA 4PDKA 4CYCA 4E7LA 4ESFA 1T0FC 1IF1A 1LFPA 3EQLF 1FYMA 2VOPA 1NK3P 5EDNA 3V42A 2NNYA 2ZFUA 2RC4A 4J19A 3J81Z 1I27A 1UHSA 4UUTA 5L3DA 1YX5A 3NRVA 3AL0C 4IEJA 1OR7A 3B6AA 4OIQF 2CO5A 2E35A 5KAIC 4NHJA 1ONVA 1XN7A 4LG0A 1FYKA 3G71I 4U87A 2GM4A 3DV8A 1P4WA 4HAMA 4A3JJ 2STTA 3CDHA 2FOKA 3J7AY 1TLHB 2HGCA 3MZ8A 2JSPA 3BG6A 2IA1A 1F36A 2R93J 2QKMB 2D45A 4I0BA 5TGTA 3K4KA 3BR2A 3H1CA 4XOTA 1G6NA 4HDVA 4XL9A 3I4NJ 4P96A 5BS6A 2LF8A 3GWZA 2XC7A 5HDGA 1WI3A 1QHGA 1HLVA 2M1BA 3QP6A 3BQYA 4MIMA 3EDPA 4HLYA 2BVMA 4GGGA 1O3SA 4UV8A 4XLEA 1I39A 3CCLI 4HZFA 4BHPA 1APLC 4V2GA 3OYDA 1D5YA 2NVQJ 3CMEI 2EJRA 2LOOA 2IGOA 3LA2A 3ZMTA 3A03A 1BIAA 2IGKA 1J5YA 1MH3A 1JKOC 3WODF 1FT9A 1HCRA 1S7AA 4NDLA 5KVRA 2DA5A 1Z6RA 4CYCB 3F8FA 1R71A 1MJBA 2MSYA 2Q8KA 5DTDA 1W1WE 2XRLA 2STWA 4BACA 2X48A 1JGGA 1A04A 3BR5A 5DUKA 1D0YA 3CDIA 3VWBA 1D8JA 1RKWA 2X85A 2R3SA 4HG2A 2K02A 5D5WB 2I8DA 5JHUA 4BU2A 2OQRA 3OYAA 1VQLI 1ITYA 4A6DA 2K4BA 5LEJA 3H9JA 3RKWA 1T2KA 5E3NA 4LG0B 4MTDA 2O61A 4I98B 2XGDA 2OPTA 2VQCA 1FTTA 1LDDA 4PFOA 4S04A 1FX7A 3LA3A 3GFIA 3D5SC 5H6QA 3CC2I 4BBRJ 4HNUA 1N77A 1QNTA 1BW6A 2AQEA 4ON0A 1RR8C 4CZCA 1U3EM 1KYWA 4D7NA 5IYCJ 3R0AA 3REOA 1D8KA 5DCMB 1JE8A 4YIRX 3EUHC 2OTJI 2KRHA 2NS0A 2UUZA 2DA7A 3MFKA 2H8RA 2VKDA 3BDDA 4XICA 3CCJI 3RIRA 4KT5C 2O0YA 5FGMA 4M6YA 4E7SA 2DQRA 1XSXA 2GXBA 4FE7A 3E0JB 5J1UA 1EV7A 3QRFF 1X1PA 2AQFA 2CS3A 2XKOA 1W0UA 2E2HJ 3M8JA 4OMYA 3GTMJ 4LD5A 2DXIA 2HDDA 3KEYA 1V5FA 4HDUA 4PZJA 5E79C 2LD5A 5J47A 3E6DA 3FDYA 4A3IJ 2D1VA 5K5OA 4E6KG 2XB5A 4M9ZA 3F22A 1R5ID 2CG4A 2QQ8A 3I53A 3KP5A 3K1MA 2KP6A 1WFXA 2O7OA 5L3BA 3OYMA 2YPRA 2GIZA 3JRBA 2HKOA 2V6CA 1FLIA 3ASOH 4ZDOA 2F5FA 2PMHA 3KP2A 5EEGA 4A5MA 1FBSA 3MAJA 4RBOA 2E2IJ 3QPTA 3KZZA 2QSGX 1U6GA 2M45A 3J7AO 5C3EJ 2RN7A 1T95A 1FSEA 5DD4A 2Y2ZA 4F92B 1BW5A 3GTOJ 1IZ1A 2W7NA 5DM6F 1QPMA 1A6IA 4ZYGA 4IZZA 4F3QA 3I4MJ 2Z2SB 4UY8I 1D1BA 4R8HA 2OF7A 3RYPA 4A3GJ 4YFKF 1DPRA 3DFGA 2V9KA 4XKCA 2UZKA 1OCPA 1ZLKA 5IOZA 5GTHC 4Q47A 2HOSA 1OCRH 5FKNA 1U9NA 1PYVA 1USSA 3HBLA 1JUSA 2BE5F 5L3CA 1R4MB 5A2QZ 3U1DA 2Y9ZA 2KZGA 3HTUA 1N25A 3CUQA 3KYLA 4DIQA 4BHBA 4B1RA 1S7OA 2D1HA 2QF7A 3IH3A 1W7PA 3Q0WA 4PFPA 4A3CJ 1H89C 1F1ZA 1ETXA 2JT1A 1CF7A 4UV9A 3HSFA 4CICA 3DLAA 5CYVA 2L7FP 3OYKA 3KCCA 2QSHX 3ABUA 3L00A 2HVQA 4ITVA 4EJWA 2L02A 1Y1VJ 2ZCWA 4N4OB 5K5RA 1WH5A 3O8GA 3V8JA 3S93A 5E1XA 2IW5A 4E7HA 3OIQA 2PI0A 4B43A 1I1SA 2JMWA 4II2A 4ZTJA 3FMSA 1Y39A 4PJLA 1R23A 1OJLA 2LVSA 4XQFA 3EYIA 2QBYB 1I50J 5KHDA 1AOYA 5BPDA 2HDCA 2HR3A 5D5UB 4AD9A 1EH7A 2I10A 3VSLA 1Z67A 3PL8A 4V19K 2VT3A 4E7JA 1JUPA 2EB7A 3VB2A 4U0VA 4F52A 1WJAA 2KQRA 4FX0A 4UB6C 5FFZA 3SHFA 5E8IA 3S3OA 2OCEA 3FBNB 2CRGA 2WB1A 1DP7P 1BR4A 1USTA 3E5UA 4LG3A 3JREA 1Y6IA 3ERMA 4L18B 4AIHA 3L09A 2DW4A 2TRTA 2FX0A 4UUVA 5M5YJ 4U7DA 1S6LA 2CWEA 2LH9A 3LSTA 4JK1X 3BOQA 3C18A 2CYYA 5J8CA 2ZBKA 5IP6A 1MMAA 3LSHA 5J8FA 4WWCA 1R22A 4LITA 5CVJA 5GAEJ 4M6VA 2Z33A 1FMWA 5LD2C 1TQMA 5DYMA 2DOAA 1X1CA 3GUDA 3CUQB 3WHCA 2J5PA 1E3OC 1W7PB 2HPMA 2K86A 2XVCA 3B02A 4J00A 1CF7B 4JQFA 3AAFA 1OCTC 3MKWB 2XAFA 1P9QC 3UKGA 2G7HA 4PSXA 2CGPA 3MVPA 1H88C 1DGRM 1MDMA 1OYIA 3FXOA 1WGXA 3GVAA 2NXNB 4DBQA 1QPIA 1KZHA 4D5FA 2WAQN 2FU4A 5FLXZ 4X0GA 1XPXA 3G73A 1TW2A 1XCBA 4HBLA 4Q5SF 3CESA 4RGRA 4RM2A 3L2RA 2A6EF 3H5NA 1XGOA 1VQMI 4WXHA 4G7OF 5LLQA 1ORKA 4QSHA 1MBGA 4HQEA 1QHHD 1ZLJA 2LK2A 1YRNB 1XMXA 4Z6YA 3MKLA 3GF2A 1HSJA 2V9VA 3BTCA 4FT8A 2D2WA 2E2JJ 3DF8A 2P0WA 2P5VA 4A3MJ 3ECHA 1VZ0A 3BQZA 3UR3C 4DOZA 4LLLA 4CSWA 1IXRC 1XGNA 3JRIA 1LEBA 3Q0VA 3KP6A 2K9NA 3ASNH 3HTSB 5L3GA 1IUYA 2IJLA 2KDZA 1YW7A 1JT6A 2W84A 2KKOA 3SZPA 3DWLE 5IT9K 5AIQA 4C2MJ 1IRGA 1FJLA 4XR6A 1BI3A 2NOJB 2AXLA 2KIMA 2JA2A 3SEQA 4PCQA 1DP3A 3BCBA 5IP7J 2LFBA 1OMIA 2DDAA 2UV1A 2HXOA 4JYKA 4IX7A 3HOZJ 4IF4A 1TT0A 2LF7A 2P8TA 4JX6A 4D9JA 1R5HA 1S7EA 2DN0A 4DYQA 2L7ZA 3WG9A 2QEXI 1PUFA 4D0PA 4DZPA 1YIJI 4KIGA 3PM1A 5FLMJ 1KONA 3S14J 3PFIA 2R7OA 2L3DA 2XIGA 2EZHA 2CSOA 2DMTA 1FNNA 1IGNA 4MQ9F 1FC3A 3U2RA 1F5TA 1HQCA 2ECBA 2XSJC 5HS8A 1CQTA 3EUAA 3TQNA 3KP7A 1WJ5A 3K4BA 5DUIA 4NB5A 1BOBA 4PSWA 4O5VA 5GAHJ 3VODA 2MC3A 5HLHA 2N8GA 2X1CA 3GTGJ 4N0BA 1IV8A 3L2UA 2QLZA 1DUXC 1RC9A 3CTAA 5B5EC 2MGQA 2QQ9A 2RREA 2VBZA 1TNSA 2Y75A 1ETQA 4RA2A 1A36A 3O2PE 3O6BB 2HYGD 2QUFA 1Z6TA 4ENJA 2VI6A 2K3PA 4WF2A 1MW7A 3DTKA 3NEUA 3QPHA 3ZQLA 3S2HJ 2QSFX 1H8AC 3VYTB 2DT7B 3FK6A 3H0GJ 2ZC2A 2QCOA 1T33A 2X6XA 4XLAA 2W24A 4CYDA 3ERED 3LWFA 1IO2A 4W1UA 2DMQA 4BQQA 3CMAI 2ESHA 3AG4H 2OC6A 1I3AA 4YRVA 4NBQA 4LGWA 4XN3A 2R5ZB 1ZK8A 5D5VB 1FOXA 3ABMH 5E1ZB 4C3JJ 1G2HA 1LFBA 3ZGKA 1R7JA 2GA2A 1MJAA 5CVRA 3TP0A 2PN6A 1T56A 2GWRA 3M7GA 1B1BA 2FMLA 4RB0A 3S1NJ 3CMMA 1W4MA 3DPTA 4K2EA 3MKZA 3SJMA 2IXSA 2DMNA 2HOEA 5HOOA 4BBSJ 2MH9A 4LOCA 4Y4RA 4U0WA 4CDGA 2V1NA 5J4VA 1ON1A 2RGVA 2KRFA 1FIAA 2VE9A 4E7IA 2BV6A 3G1OA 3IWZA 3F8MA 3SQNA 2LP0A 1KGSA 1HDPA 1SEUA 2YR2A 2O8XA 1LVKA 4RB2C 3RCOA 3K4MA 3D1NI 5AONA 5FRNA 1E17A 3GYHX 1W5TA 5J6XA 3QOEA 2Z1DA 4XRSG 2HFHA 4BJ6C 3DBHB 1HDDC 2BEOA 2KLOA 3JSPA 1WSUA 4LK1F 1QZYA 2BY2A 5HVQC 5IYDJ 2V1UA 2JRMA 3HPHA 4B48A 2VLAA 2M5WA 3A1YA 3R0JA 2LTPA 3OR1C 3W6JB 3ZXSA 2R7WA 4G7ZF 4CA0A 2JK3A 1XMAA 3FXQA 3HGGA 4IRGA 4RM3A 1NHAA 1U0JA 4Y15A 3CCMI 3KFWX 2M8EA 3EETA 2ZJQF 1OR7C 3MN2A 1OPCA 2LKPA 3V8LA 1GUUA 1R5GA 2XDVA 3D0SA 3QWLA 3JRHA 2F4MB 3K10A 2VBYA 2DLLA 4EGZA 1LFUP 5AIPA 1OCZH 1AU7A 5CKTA 1ZAOA 2ISZA 2R7DA 4UXNA 2HOTA 1BI2A 5J1RA 5B3SH 1WJCA 2NVUB 3LSMA 2G7UA 1LJ9A 2KJCA 2LKXA 3OYGA 2ZNYA 4CCNA 4BY1J 2VUMJ 2QZ8A 1B8IA 4XNFA 3BG9A 3OYNA 3H0DA 2XKPA 3I0TA 2P7VB 4GDFA 4WXDA 4WXCA 2L4AA 2VJ5A 1B72B 2R7QA 4GRIA 3PO3J 4IQJA 1GHCA 3FXUA 2VN2A 2LYCA 4A3DJ 1AWCA 4LIVA 2HS5A 1W0TA 3HOSA 3P5JA 2LKSA 3FXJA 3R60A 3KYDB 3K4LA 2K3FA 2HDWA 2MD0A 3RPQA 1TWFJ 3F8NA 1E2XA 1BN5A 1WZ2A 3JRFA 4CZZA 3HKZN 2ZXHA 2CQ7A 2ID6A 5B1BH 2FEZA 2DTRA 2GA1A 1JTYA 2X6YA 1UFMA 3DTIA 5IOYA 1U2WA 2XROA 4J01A 4G9YA 4C2UA 1P6RA 2W25A 4XN0A 4W97A 3IP4B 1U8BA 4KFCA 2FNAA 4F55A 2O03A 4EM0B 1MNEA 3DU5A 2ZJRF 4LFUA 1XTAA 4P5OA 3N4MA 4I0AA 3F3XA 5ICFA 2FF4A 1X1BA 2R7FA 1PVEA 3VYUB 2DO7A 2PG4A 2ID3A 2HPIA 2Y31A 5JVTA 4MFDA 4E7ZA 4Y13A 1WH7A 3OL4A 5F64A 3HSEA 2Y69H 2CJJA 2E36A 3M8FA 1YG2A 2VQHA 4EMSA 2OZ6A 3IC7A 4BUPA 2UXNA 2Y0MA 2M2EA 3QPLA 4OIRF 1S72I 3NWSA 4M3BA 1IJWC 3HHGA 1F4KA 1PUEE 2XF6A 3TP3A 1B8IB 3OWTA 5C4JJ 1VQKI 1JHHA 2EQRA 1XD7A 3A0BC 2KL4A 2GXAA 2GXGA 5FKMA 3K70C 2COMA 1T6SA 2A6HF 2X6WA 2FBHA 1Y0UA 3WTSC 1HA8A 1JKRC 4AIKA 1XMKA 4IHSA 1JHFA 1V5GA 3F21A 5J40A 2ADUA 4CCJA 1VQPI 1OKRA 2CV0A 3VDXA 1XDSA 1W36C 2L9SA 3BR0A 4RGXA 3W6VA 2M3AA 2DJIA 1I5ZA 3WTXC 1B9MA 4L9NA 3QODA 1IG7A 3EYYA 3OS0A 2K85A 4BQAA 2JRTA 3PUBA 1C0WA 3DXJF 1WJFA 4ZZDA 3FF5A 1LEAA 4ZYDA 5FRMA 4HA8A 1UZCA 2H94A 1ETVA 3AG1H 1W5CC 4ASNA 3HM5A 3CLOA 2EFPA 2XGCA 2FBIA 2GOXB 2QVOA 1BC8C 3T5XA 3IAM2 1Z77A 2A6TA 5K5QA 2A69F 1HKSA 5HLGA 1TWHJ 1SVLA 3I54A 3JCUC 2EZLA 1PDNC 2O5RA 3GW2A 3OYCA 2P5LC 1YJNI 3RQIA 1QVUA 4UNOA 1ZGWA 4BE0A 2EA4A 2OCCH 4H4KC 2BGCA 4G12A 2EPFA 1B59A 3CUQC 1Z0XA 1Q1HA 3CCEI 1SC7A 4AM3A 3W3CA 1NG7A 1X2NA 3CQZJ 3I59A 4EGYA 4HV6A 3ZMDA 3I64A 1R1UA 2M7BA 5FFXA 1TWCJ 3CD6I 3RSNA 3HL2A 4BNCA 3PQJA 3WU0A 1J09A 4GYIA 5D8LB 2JZYA 3ZQIA 4I2OA 2JSCA 2LY1A 4UB8C 3GMEA 1E3PA 2EK5A 2BHZA 5F04A 3BG5A 2OBPA 1X3UA 3P7NA 5FB2A 3S16J 1ZR4A 3ZQ7A 4D5CA 1O57A 2BZTA 3OY9A 1X1AA 4I6ZA 1D1AA 2DAOA 1FTZA 1VI0A 1R9TJ 4BXUA 1JKQC 2IA0A 3JAMK 3RTRA 3HOVJ 3F0CA 4KT6A 2MA3A 4M3DA 5EEAA 2EBIA 2MYSA 2MBFA 2KDOA 3DP7A 4AUXA 3GXOA 2YX4A 2EWNA 3DEWA 3DPUA 4P55A 3IRQA 3OSGA 2VL8A 5CQEA 3TO7A 2YX7A 2CMPA 3M8EA 2JWTA 3D5LA 4HX8A 3BCAA 2QENA 3G1LA 2LC2A 3I71A 3ABKH 4NNJA 1KU3A 3P9CA 3JRDA 2PMUA 4L9TA 2K9QA 1XS9A 3FM5A 4MGRA 1J9IA 1MSEC 2RVCA 4JX4A 5K7HA 4G8XA 4MTEA 4BH9A 1R49A 4A3LJ 4G6QA 3BR1A 3M07A 3OV8A 4CH7A 3TOAA 1I1GA 4KA4A 4MLOA 2JN6A 2R4GA 4BDYA 2CUEA 2WAQA 3G2BA 3TKYA 2LY2A 5IT9Z 1OQYA 4G7HF 2HEOA 3C1DA 2R7ZJ 2L9VA 1A5JA 1TQIA 1ZRCA 4PJJA 2K9SA 1HW1A 2C6YA 3LA7A 1TTYA 2DCEA 3CJNA 2CW7A 2IGNA 2A5YB 2DTZA 2H27A 2LR8A 4Y3OA 2DMUA 5BNGA 1VQOI 1IN8A 2W85A 4CCLA 2LLKA 2IPQX 3BC8A 3NQOA 1EA3A 3DQVC 3DBRB 4BE2A 3B6CA 3CLQA 4BJ5C 1UJ8A 1EJ9A 2VJIA 2P6TA 4EM2A 1V3FA 5LHGA 2V9PA 1IN4A 1SMYF 3OOPA 2CQNA 1G3SA 4AVZA 3FM3A 4IHVA 2M0CA 1U8RA 2PBIA 2HNHA 3ABTA 4B44A 3JSOA 1TT5B 3PO2J 2FJ1A 1Z3XA 4KN7X 3ZQGA 3CMYA 4ANJA 4M9XA 1NTCA 3TW7A 3W6KB 2OTLI 2X51A 2F4OB 1G3WA 2GLOA 5H2FC 1K4SA 2VXZA 4LMYA 2KIUA 2H8WA 2JPCA 1G4DA 2DBBA 3WE2A 3J81K 3O8HA 4KISA 2BBYA 1ZN2A 2H6BA 2ZJ2A 3F72A 5EGOA 3L2WA 2CQQA 3G4SI 3GO5A 3V8KA 5F0FA 3OYIA 2RDPA 4ZH4F 3M4OJ 1JTXA 3TBIA 3JTGA 3ZMUA 3JW4A 3RQ4A 4II3A 4DGWB 2K27A 2VXDA 3HXLA 2O9LA 5D6FA 1MMGA 3L2VA 1DU0A 3I55I 2GQQA 4G94A 3CO7C 1GV5A 2H6CA 3OIOA 3TGNA 1VFCA 3BJ6A 1V55H 1YE9A 4HRIA 3E1SA 3CDLA 1S3JA 1T38A 2EIJH 3O3KA 3H35A 2P5KA 3E97A 2FMYA 1P7JA 2E1NA 5GP9A 1JJ6C 2JA8J 3C2HA 5BQTA 2NVTJ 3WGGA 4NC8A 1ZRDA 4B09A 1BI1A 3WG7H 1POGA 4BAYA 2L7MP 2KIFA 2F5VA 1VQ9I 5JLWA 2OZUA 4BEHA 4A69C 1BC7C 1OCOH 5KCMA 5IT3A 5EYRA 1YO5C 3CJTB 1J2XA 3PNYA 3ZRGA 5LFAA 3WE3A 5ICGA 1YIOA 4YG2F 5FD5A 3HEFA 4DYRA 2NS7A 4MFEA 1Y8RB 1W5SA 3CP2A 4RAGA 2ME0A 4C30A 3CJQB 5LEKA 5LHIA 3SFZA 4AU7A 2PQ8A 1D0ZA 4HYEA 1F9NA 2LMDA 4BHCA 3BJAA 5EGOB 2EINH 4GFBA 3LFUA 3S2DJ 3GBGA 3F6VA 3N97A 4KIFA 2BXZA 3MWMA 1WVRA 3LQRA 1GXPA 4NC7A 1WJDA 2H1KA 3CCYA 2MH2A 3LL7A 4HPQA 2E5NA 2BOLA 2G0EA 2BYVE 3BTLA 3COAC 5D4SA 5D5XB 2X4HA 4HQMA 1P2FA 5F08A 3S1RJ 2Q1ZB 3H3UA 1K7AA 1OLTA 2ZFWA 3QYBA 1E3HA 1VQ5I 3KLNA 1Z91A 3OS1A 1R6RA 2PJRA 1HKQA 3LFKA 3OYFA 4ZDPA 4U0YA 4JP0A 3SZTA 2CQKA 2PFBA 1SFUA 1S8NA 3T8TA 5DS9A 5FJ8J 3QAHA 4Q48A 1QZEA 3T8RA 5ICEA 3DLLF 1GV2A 4BY7J 4C2TA 2MLGA 3J7ZI 2L0KA 4BEHB 1YLFA 3LSKA 2EFWA 1RRJA 5F1RA 4Q4ZF 2DPUA 1IUFA 2DFHA 2DODA 2NNNA 4HX4A 1F43A 1QU3A 2PEXA 1ON2A 3BG3A 3J7YJ 1R36A 5JVGF 2BY0A 4AYBN 5HNFA 3HOWJ 2MG4A 2Z3YA 4XRFA 1QBJA 3H9QA 1KU2A 2X1EA 2BVLA 5KAFC 2HQ5A 1MSFC 1BM9A 3SXYA 4ESJA 2VODA 2B63J 1L3LA 4QLCU 1ACIA 1MDMB 2WADA 1Y1WJ 2XB0X 4RLQA 2M34A 4I02A 2ELHA 2ZSIB 3KP4A 3GFLA 5BPIA 2V1DA 3VFZA 1VTNC 3CCUI 3A01A 3DPLC 2BHYA 4HOBA 3KX2A 3JRAA 4B3AA 4KUMA 2O6GE 2QWWA 4IHXA 2GZWA 2D5VA 1AA7A 3KETA 4ZYHA 1D1CA 2E1MB 4A0ZA 2RQPA 3EUKL 3K2ZA 4OINF 2RV8A 4BJTA 5D8KB 2VONA 3A2KA 3BZKA 2Y0SN 1O4XA 2JVGA 5HNHA 2DDBA 3ZMZA 1JUMA 3CCSI 2IS2A 1HXDA 2P7CB 5F27A 1PP8F 4AC0A 5JLXA 1TNTA 4M74A 4BS9A 1R58A 2HQNA 4A0XA 5M3MJ 3L7WA 1BBYA 2VC0A 1BJZA 4OU0A 3RI4A 2QQBA 4I09A 1DDNA 2VKEA 5LGUA 2ZMEC 3A0HC 3LSGA 1FP1D 4IHWA 1RPWA 3E7LA 2K9MA 4XLNF 3WTZA 4XSZF 2FRHA 1GXQA 3F23A 1TWAJ 4PK4A 1MIJA 5CVIA 2DFFA 3M1CA 3HKZA 2NRAC 1XB4A 5IYBJ 3V7RA 1HC8A 3RPUD 2ICWG 3I9V2 3PQKA 3MD2A 1U5TC 5KK1A 3T0YA 1OFCX 2A68F 5A2QK 1VNDA 2Y9YA 4EJUA 5F1JA 3KE2A 1G3YA 3FXKA 5DCFA 1HSTA 2NVYJ 1PUFB 1X58A 1UELB 3VPRA 1U9OA 1R00A 3DEEA 3A01B 3LSPA 2M8GX 3G1MA 3WTUC 2WC2A 1G8XA 3BR3A 5DV5A 4U7BA 2PMZN 2ZXWH 5GPCA 2R92J 3MMYB 2J5OA 4LK0F 1FPQA 1YJ9I 2HVSA 4L0ZB 1XSDA 2COBA 2IVMA 3CCVI 2KIQA 4LLNA 2R7XA 2ELKA 3IWFA 1DGWY 4MEXF 4YELA 4G6DA 1B9NA 2CFOA 2L9NA 4S0HB 1I3QJ 1OISA 3TW6A 4HX7A 3BPXA 5EZHA 4CO8A 3ZQQA 4HSRA 1GVJA 3M9AA 1QA6A 5CVVA 6PAXA 3Q0UA 1Z21A 2DQLA 1QGPA 5LRRA 5ERIA 5D4RA 1P92A 3HRUA 2TDXA 1ZG5A 1ZYRF 2EA2A 3IH4A 3GX4X 2FXAA 2M0MA 2ISYA 2GAUA 2XPWA 3BR6A 1ZHFA 3OL3A 2KHMA 3QOPA 4CCOA 2VJ4A 1P4XA 3GTQJ 2HQAA 3B73A 2DT5A 4Z2YA 4ZZLA 2OQGA 3C7JA 3HOUJ 4CXFA 2KJBA 3FMQA 2OV7A 5GADJ 1ERDA 1WHUA 2WY8Q 1P7IA 2WY7Q 1J75A 2DYSH 4HV5A 2V1XA 3FWEA 3RYRA 2XPUA 2R7VA 1UAAA 3WTTC 3DEUA 4KIBA 4P9UA 1S5LC 2WA0A 4M71A 2R7TA 2YS9A 3BPVA 3PNVA 1RETA 3HOYJ 3HJEA 2E71A 1JXSA 4M9SA 2XV4S 1STZA 5M5XJ 2JQ7A 4FCYA 4Y7NJ 2FSWA 5GAGJ 3T1BA 4N9IA 2ZMEA 1GT0C 1KQ0A 3TL4X 4FETA 2DA4A 4PJNA 2K5CA 2TCTA 3WU2C 3TDZC 5E3MA 2KISA 2XASA 3DBLB 1BOAA 2M7AA 3JAMZ 3ZMSA 2IBDA 2WAFA 1WJEA 3FXMA 1X4PA 3J80K 2VBXA 3FISA 3RJPA 4OMZA 3MKYB 3HDDA 4I01A 1U5TA 4MHGA 2L54A 1KU9A 4EJOA 3ZQFA 5JI6A 4IXAA 2OAZA 3HHHA 2IP2A 4B4CA 5E1WA 5J4YA 1XGMA 3C3WA 4UVAA 2R0QC 1TQPA 3L1PA 5LBQA 4JOMA 3S17J 2HWVA 2O3FA 2Z99A 4L9VA 4ESBA 5K7ZA 4RS8A 2QKLB 2ZKZA 2L7KA 4OAZA 2HYFA 1BJAA 3OMYA 4KMUX 5J1YA 1GLNA 1ZREA 2E7WA 2M4GA 3G3ZA 4QTRA 3EPZA 2L2OA 5HLIA 5EZGA 2WAEA 4RAFA 4XSXF 2LBFA 2VQLA 2JTVA 2Y30A 1D3YA 1T8IA 2M9HA 2IRFG 1D5VA 5EG0A 1IN5A 5TISC 1HKTA 2XAHA 4A3KJ 4BDZA 4P1WA 1WJBA 3V7SA 1S29A 5F0HA 3F8BA 3H36A 1J0RA 1XCVA 2K9LA 1YW8A 2OD5A 2FQ3A 2ZMEB 4MO7A 1VQ6I 1E0EA 5DM7F 4M6XA 2HYJA 3SEZA 5FD6A 3ABLH 2A07F 1M1EB 3FZVA 1GVDA 1OYWA 3JRGA 1LB2A 3CJRB 3R4KA 2F2EA 3I5UA 3U9GA 4KN4X 3MZHA 1YI2I 2E1CA 1JJ8C 1FOYA 1Y0NA 3LNQA 1U5TB 3OYEA 4JBAA 9ANTA 1IXSB 3MCZA 4XLFA 1L0OC 5E17F 1IV6A 1ZARA 1ODDA 2XGXA 2KZVA 1SD6A 4QWQA 3LMMA 2P81A 3AKZA 3ZQCA 1IRXA 3LSIA 3K7AJ 3S2WA 4QPQA 2BY3A 4L5IA 5CJ9A 2YSRA 5FKKA 1KYZA 2IS4A 1VF9A 2F48A 1BIBA 1TP4A 3CF5F 5EJCA 1FMVA 4BXXJ 1UB9A 1IW7F 4N4NB 1RUOA 1MMDA 4DQ2A 1Z1DA 1T08B 2LBFB 3SZGA 4I7HA 4HSTA 4ZC3A 2BY1A 3OYLA 1ETKA 1MBJA 5EG0B 4AVPA 4HNVA 5BOXA 2WTEA 4BXFA 2IGMA 3PSFA 2EFNA 5DCMA 4CCKA 4XMYA 2EFOA 1R4NB 2ACJA 2VKVA 2RNGA 3KIOA 3K6GA 2CV2A 2VIXA 2A3SA 2HOAA 2X9DA 5HLTA 1LE8A 1MBEA 1LDJA 1FEXA 3HGYA 1I6HJ 5TJJA 4EV0A 3Q3SA 4L5JA 4XLHA 3FXLA 3H92A 1ZR2A 1MJ9A 1WPKA 3VYSB 4RGSA 4RGUA 1JKPC 4R79A 4RB1A 4MQVA 5FLVA 3DCFA 1O3TA 3BP8A 1NK2P 4YIFA 3HG9A 3QU6A 3LSRA 4ENNA 2M4KA 2DA3A 5L3FA 1I6XA 2OU2A 2AHQA 3HIFA 2L5QA 4BL0B 4HLXA 1BA5A 3FX3A 1HF0A 2E34A 1REPC 2FNPA 4D1QA 3RKYA 1FBQA 2V7FA 5H6RA 1HOMA 5DD8A 4O3MA 2CUZA 3OSFA 4Y33A 4IL6C 4AIJA 2A5WA 4FE4A 3MEXA 3P9KA 3IAS2 4FQGA 4GXOA 2G9WA 1ULYA 4B3XA 1IAWA 1TW3A 2Q0OA 2AO9A 4BGDA 2CUFA 1XSVA 3E6MA 1YJWI 2VOOA 1LNWA 4WCGA 3RZOJ 2FD5A 2W4SA 4XRSA 3DTEA 1JT0A 1RIOH 3ZPLA 1ETWA 3ZR8X 2W82A 1NH3A 4XRMA 3QP5A 4GO1A 2M87A 1SMTA 4B8XA 4XLPF 1GDTA 2V79A 1LPQA 4U88A 1AKHA 1YS7A 3HC7A 3I59B 4IQ4A 3ZP5A 1T0FA 1LE8B 4L0YB 3SYTA 3WU1B 4TV7A 1RNLA 3Q9VA 4IVNA 3U21A 1O3RA 1MBKA 1SVMA 1X1DA 2P6SA 1H9TA 5FROA 4NUBA 3ZMVA 3K70D 2NVXJ 2R7SA 1Z05A 2XAGA 2AXTC 2W57A 2CV1A 3BJOA 1Z9CA 4ENMA 2JUGA 4X1EA 1SFXA 2YU3A 1TL8A 2UXXA 4M3FA 2HQRA 2QBYA 4OOIA 2JUCA 3W2AA 4CGZA 3PJRA 1KU7A 3HRTA 2Q2EA 2E1MC 3A4CA 3TO9A 2KT0A 1W36D 1LKXA 4KDPA 1Y56A 1FY7A 1BR2A 3BZ6A 2KFDA 5FKLA 2DOEA 4ZDLA 1T98A 1Z3YA 2CU7A 2DI3A 5ILSA 1MMNA 2OA4A 3OYJA 1ETYA 3MZYA 3Q9SA 1SANA 1YS6A 3C2BA 3X2QH 3WTWC 2XGEA 3ECOA 2X0LA 3LOCA 3PNTA 3P9IA 3S1QJ 5ICCA 2ME6A 4BKXA 3UNGC 4LJZF 5EEHA 1PJRA 2KPMA 2QQAA 1Q1VA 3IUOA 3QYFA 4DBRA 4AYBA 2E19A 3BG7A 5CPRB 1IC8A 3OYHA 5LHHA 2O8KA 4LIUA 3RDIA 3QQAA 4DW6A 3E6BA 2E5ZA 1AKHB 3HZJA 3AG2H 5FO5A 3OIPA 3GTKJ 2F6CA 2LSOA 4GYGA 1H9GA 5IPAA 1MNDA 4HNTA 4KMFA 2VPRA 3PIOF 2W48A 5ILVA 3IH2A 1TWGJ 3NARA 3GCMA 1RI7A 1BR1A 1U78A 2DPDA 3KP3A 3WHBA 1W7PD 1HBXG 3KEQA 3AL0B 4KICA 3FMRA 3WTVC 2BXYA 3W2VA 2VASA 1VQNI 3K69A 2WWYA 3HOXJ 4FTHA 4XBFA 1YX3A 1B6AA 2GIVA 3BY6A 3QU3A 4OWRB 1ZH5A 4EVIA 1WRJA 1WCMJ 2Y0SA 2ZSHB 5J3LA 4IRHA 1KQ8A 3PSIA 3S8PA
chains in the Genus database with same CATH topology
2K7LA 4MNUA 2DK5A 3HRSA 2L4MA 5F6FA 4IRIA 3HOTA 5E18F 3K1NA 4HF0A 2K4JA 3EUHA 5LGTA 4HW0A 4RB3C 2EV0A 4UVCA 3KEOA 4EJTA 5D6EA 5DDGA 1QZZA 1KA8A 1FZPB 4KYWA 1T39A 1WWXA 5L3EA 1LQ1A 2XRNA 2A61A 1FYLA 3F6OA 4WX9A 3R61A 4ENKA 5CLSA 1WQ2A 1EH8A 1O3QA 1K78A 1FSHA 2NYXA 4R1HA 3GFMA 4EQQA 4M72A 5HS9A 1SD7A 3K9TA 2MD5A 5K1YA 2LDUA 1O7LA 2MLKA 1IXCA 3L2CA 3JTHA 3ULQB 2PLYA 4KNYA 1MKMA 2XAQA 1UCRA 1SAXA 1UHWA 1FBUA 2F5DA 2Z5UA 3KZYA 4EJVA 4OIOF 1ZG1A 5LRSA 3TOBA 4IPAA 2CFXA 5ED4A 1BI0A 1PP7U 2FBKA 4LLGF 5TRDA 3HYIA 3DKWA 4H0EA 4O6JA 2RNJA 4OIPF 4UHTA 3CUOA 1P4AA 4EM1A 4P9FA 4RAZA 1K6OA 4FX4A 2WV0A 3GLXA 5H20A 1ZGJA 5E8GA 3BROA 1HW2A 1LDKB 1YW9A 2P4WA 4DNCA 2RKHA 3J80Z 3ROUA 4A12A 3IKVA 3L9FA 3I58A 1K78B 3BWGA 1YQAA 1R1TA 4A6EA 1JGSA 1QQIA 4YIIA 2DFIA 2E7XA 1XDUA 1ZG3A 3K1PA 3LAJA 3E3VA 3MQ0A 3FXRA 5BMZA 2NAZA 1YYVA 1LVAA 1J59A 3WTYC 3FHZA 1OYYA 5CVUA 1WI9A 3RPUA 1YTYA 5HDKA 2Y48A 1MD0A 1FWZA 3ZN1A 3M1EA 5JR3A 3I4PA 2EV5A 3R6SA 2ZNZA 3IHUA 1R1VA 1H0MA 3LQQA 4RAYA 2IT0A 3IRRA 4N9HA 1SD4A 3GZ6A 3LAPA 1YFHA 3HUGA 1SFEA 4HF2A 1WKMA 1QO0D 3IKTA 1IRFA 3ZN0A 1ZRFA 4FHTA 4AWXB 1HW5A 1FP2A 3K0LA 1MZBA 2QM3A 4A5NA 3E6CC 1J7KA 4YFXF 2L01A 1DPUA 2ETHA 3E5QA 2ZXJA 2F5CA 3F8CA 2M30A 1Z7UA 1EH6A 1XGSA 4NQWA 4IJAA 2HZTA 4M73A 5FLXK 1IN6A 3GZ5A 3VOEA 3WGHA 3ISPA 1KQ9A 2XAJA 2H09A 2UWMA 4S05A 3E5XA 1RUNA 2HKXA 2VBWA 2Z9OA 2ESNA 2LNBA 3HRMA 4E70A 4BYYA 3CO6C 4LB6B 1V4RA 2DK8A 5ILUA 2HTJA 2VC1A 3V4GA 4Y17A 5E20A 5DEQA 5HDNA 2XHKA 2QYOA 3V7CA 2VE8A 2F5EA 3GEZA 2HTSA 3KLOA 4GCVA 2FA5A 4PGGA 2IA2A 4A0YA 5JFRA 4ETSA 1SD5A 2VT2A 3RKXA 3ML6A 1UHMA 3VEPA 2EV6A 1CGPA 2CW0F 3WGIA 1ZGAA 1K79A 3HSRA 1TBXA 4A2UA 4F7ZA 1FOKA 1O7FA 3Q5FA 2EFQA 4LB5A 4PGHA 2JPBA 1MGTA 4L9JA 2ZO4A 4MEYF 2AS5F 1G3TA 4HF1A 3H3ZA 5LGNA 3IL2A 2B0LA 4CHUA 1B4AA 1RZ4A 2FE3A 2PJPA 4UVBA 3GFJA 3TO6A 3TDUC 5HS7A 1IN7A 4YFNF 2DU9A 4IHTA 2XUBA 4ZYEA 4WK8F 3ELKA 4PDKA 4ESFA 1IF1A 3EQLF 1FYMA 2VOPA 2NNYA 2RC4A 3J81Z 1I27A 5L3DA 3NRVA 1OR7A 4OIQF 2CO5A 4NHJA 1ONVA 1XN7A 4LG0A 1FYKA 3DV8A 1P4WA 4HAMA 3CDHA 2FOKA 1TLHB 2HGCA 2IA1A 2D45A 4I0BA 4HDVA 1G6NA 4P96A 5BS6A 2LF8A 3GWZA 5HDGA 2M1BA 3QP6A 3EDPA 4HLYA 4GGGA 1O3SA 4UV8A 4HZFA 4BHPA 2EJRA 3LA2A 3ZMTA 1BIAA 1J5YA 3WODF 1FT9A 1S7AA 5KVRA 1Z6RA 3F8FA 1MJBA 4IRHA 2Q8KA 2STWA 1A04A 5DUKA 1D8JA 2R3SA 2K02A 5D5WB 5JHUA 2OQRA 4A6DA 2K4BA 5LEJA 3RKWA 1T2KA 4LG0B 4MTDA 2O61A 4I98B 1LDDA 4S04A 1FX7A 3LA3A 3GFIA 5H6QA 1QNTA 4ON0A 1U3EM 1KYWA 3R0AA 3REOA 1D8KA 5DCMB 1JE8A 2NS0A 3MFKA 3BDDA 3RIRA 4KT5C 2O0YA 5FGMA 4M6YA 2DQRA 1XSXA 2GXBA 1EV7A 3QRFF 2XKOA 4OMYA 4LD5A 4HDUA 4PZJA 3E6DA 2D1VA 5K5OA 4M9ZA 3F22A 2CG4A 3I53A 3KP5A 3K1MA 5L3BA 2YPRA 2HKOA 2V6CA 1FLIA 2F5FA 2PMHA 3KP2A 5EEGA 4A5MA 1FBSA 3MAJA 3QPTA 3KZZA 1U6GA 2M45A 3J7AO 2RN7A 1FSEA 5DD4A 1IZ1A 1QPMA 4ZYGA 4R8HA 3RYPA 4YFKF 1DPRA 3DFGA 2UZKA 1ZLKA 4Q47A 1USSA 2BE5F 5L3CA 3U1DA 3HTUA 3CUQA 4BHBA 1S7OA 2D1HA 1W7PA 1F1ZA 2JT1A 1CF7A 4UV9A 3HSFA 4CICA 5CYVA 3KCCA 3ABUA 3L00A 4EJWA 2L02A 2ZCWA 5K5RA 3V8JA 5E1XA 2IW5A 2PI0A 1I1SA 3FMSA 1R23A 3EYIA 2QBYB 1AOYA 5BPDA 2HDCA 2HR3A 5D5UB 4AD9A 1EH7A 2VT3A 2EB7A 3VB2A 4U0VA 4FX0A 5FFZA 3SHFA 5E8IA 1DP7P 1USTA 3E5UA 4L18B 4AIHA 3L09A 2DW4A 4UUVA 4U7DA 1S6LA 2CWEA 3LSTA 4JK1X 3BOQA 3C18A 2CYYA 5J8CA 2ZBKA 5J8FA 4WWCA 1R22A 5CVJA 2Z33A 1TQMA 5DYMA 3GUDA 3CUQB 2J5PA 1W7PB 2K86A 2XVCA 3B02A 1CF7B 4JQFA 3AAFA 2XAFA 2G7HA 2CGPA 1MDMA 1OYIA 3GVAA 2FU4A 5FLXZ 3G73A 1TW2A 1XCBA 4HBLA 4Q5SF 4RGRA 2A6EF 1XGOA 4G7OF 4WXHA 5LLQA 4HQEA 1ZLJA 3GF2A 1HSJA 2V9VA 4FT8A 2D2WA 3DF8A 2P5VA 3ECHA 4LLLA 1IXRC 1XGNA 1LEBA 3KP6A 3HTSB 5L3GA 1IUYA 2IJLA 1YW7A 2W84A 2KKOA 3SZPA 5IT9K 5AIQA 1IRGA 1BI3A 2AXLA 2KIMA 4PCQA 1OMIA 4IF4A 2LF7A 2P8TA 1R5HA 3WG9A 4D0PA 4KIGA 3PFIA 2L3DA 2XIGA 2CSOA 1FNNA 4MQ9F 1FC3A 3U2RA 1F5TA 1HQCA 5HS8A 3TQNA 3KP7A 5DUIA 4NB5A 4O5VA 3VODA 2MC3A 5HLHA 4N0BA 2QLZA 1DUXC 3CTAA 2QQ9A 2VBZA 1TNSA 2Y75A 3O2PE 3O6BB 2HYGD 2QUFA 1Z6TA 4ENJA 4WF2A 3NEUA 3QPHA 2W24A 4CYDA 3ERED 3LWFA 2ESHA 4LGWA 5D5VB 5E1ZB 1R7JA 2GA2A 1MJAA 5CVRA 2PN6A 2GWRA 3M7GA 1B1BA 2FMLA 4RB0A 1W4MA 3DPTA 4K2EA 5HOOA 2HOEA 2MH9A 4U0WA 4CDGA 1ON1A 2RGVA 2KRFA 2VE9A 2BV6A 3IWZA 3F8MA 3SQNA 1KGSA 2YR2A 2O8XA 4RB2C 5AONA 1E17A 3GYHX 1W5TA 5J6XA 2HFHA 2BEOA 3JSPA 1WSUA 4LK1F 1QZYA 5HVQC 2V1UA 2M5WA 3R0JA 3W6JB 4G7ZF 3FXQA 1XMAA 4IRGA 4Y15A 1NHAA 3KFWX 2M8EA 3EETA 1OPCA 2LKPA 3V8LA 1R5GA 3D0SA 2VBYA 2DLLA 4EGZA 5AIPA 1ZAOA 2ISZA 2R7DA 4UXNA 1BI2A 2G7UA 1LJ9A 2KJCA 2ZNYA 2QZ8A 2XKPA 3I0TA 2P7VB 4WXDA 4WXCA 2L4AA 1GHCA 3FXUA 2VN2A 1AWCA 2HS5A 3HOSA 3R60A 3RPQA 3F8NA 1E2XA 1BN5A 4CZZA 2FEZA 2DTRA 2GA1A 1UFMA 1U2WA 2XROA 4G9YA 1P6RA 2W25A 4KFCA 2FNAA 2O03A 4EM0B 4LFUA 3N4MA 4P5OA 4I0AA 3F3XA 5ICFA 2FF4A 2R7FA 2DO7A 2PG4A 5JVTA 4Y13A 5F64A 3HSEA 3M8FA 1YG2A 4EMSA 2OZ6A 3IC7A 2UXNA 2Y0MA 4OIRF 3HHGA 1F4KA 1PUEE 1JHHA 1XD7A 2GXGA 2COMA 1T6SA 2A6HF 2FBHA 1Y0UA 3WTSC 4AIKA 1XMKA 4IHSA 1JHFA 3F21A 2ADUA 1OKRA 1XDSA 4RGXA 1I5ZA 3WTXC 1B9MA 4L9NA 3EYYA 4BQAA 2JRTA 1C0WA 3DXJF 4ZZDA 3FF5A 1LEAA 4ZYDA 4HA8A 2H94A 4ASNA 3CLOA 2EFPA 2FBIA 2QVOA 1BC8C 3T5XA 5K5QA 2A69F 1HKSA 5HLGA 3I54A 1PDNC 3GW2A 2P5LC 4UNOA 2EA4A 2BGCA 1B59A 3CUQC 1Q1HA 3I59A 4EGYA 4HV6A 3ZMDA 3I64A 1R1UA 5FFXA 4BNCA 3PQJA 3WU0A 4GYIA 5D8LB 2JZYA 4I2OA 2JSCA 2EK5A 2OBPA 1X3UA 3P7NA 5FB2A 3ZQ7A 1O57A 2DAOA 4BXUA 2IA0A 3JAMK 3RTRA 2MA3A 2MBFA 3DP7A 3GXOA 2YX4A 2EWNA 4P55A 3IRQA 3TO7A 2YX7A 3M8EA 4HX8A 3D5LA 2QENA 3I71A 1KU3A 3P9CA 2PMUA 4L9TA 3FM5A 4MGRA 1J9IA 2RVCA 4G8XA 4MTEA 4BH9A 4G6QA 3OV8A 3TOAA 1I1GA 4KA4A 3TKYA 5IT9Z 4G7HF 2HEOA 3C1DA 1TQIA 1ZRCA 1HW1A 2C6YA 3LA7A 1TTYA 3CJNA 2A5YB 2H27A 1IN8A 2W85A 2IPQX 3NQOA 3DQVC 2P6TA 4EM2A 1V3FA 5LHGA 1IN4A 1SMYF 3OOPA 1G3SA 3FM3A 1U8RA 2PBIA 3ABTA 3JSOA 4KN7X 4M9XA 3W6KB 1G3WA 2VXZA 4LMYA 2KIUA 2JPCA 1G4DA 2DBBA 3WE2A 3J81K 2BBYA 1ZN2A 2H6BA 2ZJ2A 3F72A 3GO5A 3V8KA 2RDPA 4ZH4F 3JTGA 3ZMUA 3JW4A 2K27A 5D6FA 2GQQA 4G94A 3CO7C 2H6CA 3TGNA 3BJ6A 1S3JA 1T38A 3O3KA 2P5KA 3E97A 2FMYA 2E1NA 5BQTA 3WGGA 1ZRDA 4B09A 1BI1A 4BAYA 2KIFA 2OZUA 1BC7C 5IT3A 1YO5C 1J2XA 3WE3A 5ICGA 1YIOA 4YG2F 5FD5A 1W5SA 5LEKA 5LHIA 3SFZA 2PQ8A 4HYEA 4BHCA 1F9NA 3BJAA 3F6VA 3N97A 4KIFA 3MWMA 3LQRA 1GXPA 2MH2A 2BYVE 3COAC 5D4SA 5D5XB 2X4HA 4HQMA 1P2FA 3H3UA 1K7AA 2ZFWA 3KLNA 1Z91A 1HKQA 3LFKA 4U0YA 3SZTA 2CQKA 2PFBA 1SFUA 1S8NA 3T8TA 3QAHA 4Q48A 3T8RA 5ICEA 2MLGA 1YLFA 2EFWA 5F1RA 4Q4ZF 2DPUA 2NNNA 4HX4A 2PEXA 1ON2A 1R36A 2Z3YA 4XRFA 1QBJA 1KU2A 1BM9A 3SXYA 4ESJA 2VODA 1L3LA 4QLCU 1MDMB 4I02A 2ELHA 3KP4A 3GFLA 5BPIA 2V1DA 3VFZA 1VTNC 3DPLC 4HOBA 4KUMA 2O6GE 2QWWA 2GZWA 3KETA 4ZYHA 4A0ZA 2RQPA 3K2ZA 4OINF 2RV8A 5D8KB 2VONA 3ZMZA 1HXDA 2P7CB 1PP8F 1TNTA 4M74A 1R58A 2HQNA 4A0XA 3L7WA 1BBYA 2VC0A 4OU0A 3RI4A 2QQBA 4I09A 1DDNA 5LGUA 1FP1D 4XLNF 3WTZA 4XSZF 2FRHA 1GXQA 3F23A 5CVIA 2NRAC 1XB4A 3V7RA 5KK1A 3PQKA 1U5TC 3T0YA 2A68F 5A2QK 4EJUA 3KE2A 1G3YA 5DCFA 1HSTA 1R00A 3WTUC 2WC2A 5DV5A 4U7BA 2J5OA 4LK0F 1FPQA 4L0ZB 1XSDA 2IVMA 4LLNA 3IWFA 4MEXF 4G6DA 1B9NA 4HX7A 3BPXA 4CO8A 1GVJA 3M9AA 5CVVA 6PAXA 2DQLA 1QGPA 5LRRA 5ERIA 5D4RA 1P92A 3HRUA 2TDXA 1ZG5A 1ZYRF 2EA2A 3GX4X 2FXAA 2ISYA 2GAUA 1ZHFA 3QOPA 1P4XA 4ZZLA 3B73A 2DT5A 4Z2YA 2OQGA 3C7JA 4CXFA 2KJBA 3FMQA 1J75A 4HV5A 2V1XA 3FWEA 3RYRA 3WTTC 3DEUA 4KIBA 4P9UA 4M71A 3BPVA 1JXSA 4M9SA 2XV4S 1STZA 2FSWA 3T1BA 4N9IA 2ZMEA 1KQ0A 3TDZC 2XASA 1BOAA 3JAMZ 3ZMSA 3J80K 2VBXA 3RJPA 4OMZA 4I01A 1U5TA 4MHGA 2L54A 1KU9A 4EJOA 5JI6A 4IXAA 2OAZA 3HHHA 2IP2A 5E1WA 1XGMA 3C3WA 4UVAA 1TQPA 5LBQA 2HWVA 2O3FA 2Z99A 4L9VA 4ESBA 4RS8A 2ZKZA 2HYFA 1BJAA 4KMUX 1ZREA 2E7WA 3G3ZA 5HLIA 4XSXF 2JTVA 1D3YA 2IRFG 1D5VA 1IN5A 1HKTA 2XAHA 3V7SA 1S29A 3F8BA 1J0RA 1XCVA 1YW8A 2OD5A 2FQ3A 2ZMEB 4M6XA 5FD6A 2A07F 3FZVA 1OYWA 1LB2A 3R4KA 2F2EA 3I5UA 3U9GA 4KN4X 3MZHA 2E1CA 1U5TB 4JBAA 1IXSB 3MCZA 1L0OC 5E17F 1ZARA 1ODDA 2XGXA 1SD6A 4QWQA 3S2WA 5CJ9A 4L5IA 2YSRA 1KYZA 1BIBA 1UB9A 1IW7F 1RUOA 4DQ2A 1Z1DA 4I7HA 4AVPA 5BOXA 2WTEA 2EFNA 5DCMA 2EFOA 2ACJA 2A3SA 1LDJA 5TJJA 4EV0A 4L5JA 3H92A 1MJ9A 4RGSA 4RGUA 4R79A 4RB1A 4MQVA 1O3TA 3BP8A 4YIFA 3QU6A 4ENNA 5L3FA 1I6XA 2OU2A 3HIFA 4HLXA 3FX3A 1REPC 2FNPA 3RKYA 1FBQA 5H6RA 5DD8A 4O3MA 4AIJA 3MEXA 3P9KA 4GXOA 2G9WA 1ULYA 1IAWA 1TW3A 2Q0OA 1XSVA 3E6MA 2VOOA 1LNWA 4WCGA 1RIOH 3ZPLA 3QP5A 4GO1A 2M87A 1SMTA 4B8XA 4XLPF 2V79A 4U88A 1YS7A 3I59B 3ZP5A 1T0FA 4L0YB 3WU1B 4TV7A 1RNLA 3Q9VA 4IVNA 1O3RA 2P6SA 1H9TA 3ZMVA 1Z05A 2XAGA 2W57A 3BJOA 1Z9CA 4ENMA 1SFXA 2YU3A 4CGZA 2UXXA 2QBYA 2HQRA 4OOIA 1KU7A 3HRTA 2Q2EA 3TO9A 4KDPA 1FY7A 3BZ6A 1T98A 2DI3A 5ILSA 2OA4A 3MZYA 3Q9SA 1YS6A 3WTWC 3ECOA 2X0LA 3P9IA 5ICCA 4LJZF 5EEHA 2QQAA 5LHHA 3RDIA 3E6BA 5FO5A 2LSOA 4GYGA 1H9GA 4KMFA 5ILVA 1RI7A 1U78A 2DPDA 3KP3A 1HBXG 1W7PD 3KEQA 4KICA 3FMRA 3WTVC 3K69A 2WWYA 4XBFA 1B6AA 2GIVA 3BY6A 3QU3A 1ZH5A 4EVIA 1WRJA 5A2QZ 1KQ8A 2STTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K7L A;  4MNU A;  2DK5 A;  3HRS A;  2L4M A;  5F6F A;  4IRI A;  3HOT A;  5E18 F;  3K1N A;  4HF0 A;  2K4J A;  3EUH A;  5LGT A;  4HW0 A;  4RB3 C;  2EV0 A;  4UVC A;  3KEO A;  4EJT A;  5D6E A;  5DDG A;  1QZZ A;  1KA8 A;  1FZP B;  4KYW A;  1T39 A;  1WWX A;  5L3E A;  1LQ1 A;  2XRN A;  2A61 A;  1FYL A;  3F6O A;  4WX9 A;  3R61 A;  4ENK A;  5CLS A;  1WQ2 A;  1EH8 A;  1O3Q A;  1K78 A;  1FSH A;  2NYX A;  4R1H A;  3GFM A;  4EQQ A;  4M72 A;  5HS9 A;  1SD7 A;  3K9T A;  2MD5 A;  5K1Y A;  2LDU A;  1O7L A;  2MLK A;  1IXC A;  3L2C A;  3JTH A;  3ULQ B;  2PLY A;  4KNY A;  1MKM A;  2XAQ A;  1UCR A;  1SAX A;  1UHW A;  1FBU A;  2F5D A;  2Z5U A;  3KZY A;  4EJV A;  4OIO F;  1ZG1 A;  5LRS A;  3TOB A;  4IPA A;  2CFX A;  5ED4 A;  1BI0 A;  1PP7 U;  2FBK A;  4LLG F;  5TRD A;  3HYI A;  3DKW A;  4H0E A;  4O6J A;  2RNJ A;  4OIP F;  4UHT A;  3CUO A;  1P4A A;  4EM1 A;  4P9F A;  4RAZ A;  1K6O A;  4FX4 A;  2WV0 A;  3GLX A;  5H20 A;  1ZGJ A;  5E8G A;  3BRO A;  1HW2 A;  1LDK B;  1YW9 A;  2P4W A;  4DNC A;  2RKH A;  3J80 Z;  3ROU A;  4A12 A;  3IKV A;  3L9F A;  3I58 A;  1K78 B;  3BWG A;  1YQA A;  1R1T A;  4A6E A;  1JGS A;  1QQI A;  4YII A;  2DFI A;  2E7X A;  1XDU A;  1ZG3 A;  3K1P A;  3LAJ A;  3E3V A;  3MQ0 A;  3FXR A;  5BMZ A;  2NAZ A;  1YYV A;  1LVA A;  1J59 A;  3WTY C;  3FHZ A;  1OYY A;  5CVU A;  1WI9 A;  3RPU A;  1YTY A;  5HDK A;  2Y48 A;  1MD0 A;  1FWZ A;  3ZN1 A;  3M1E A;  5JR3 A;  3I4P A;  2EV5 A;  3R6S A;  2ZNZ A;  3IHU A;  1R1V A;  1H0M A;  3LQQ A;  4RAY A;  2IT0 A;  3IRR A;  4N9H A;  1SD4 A;  3GZ6 A;  3LAP A;  1YFH A;  3HUG A;  1SFE A;  4HF2 A;  1WKM A;  1QO0 D;  3IKT A;  1IRF A;  3ZN0 A;  1ZRF A;  4FHT A;  4AWX B;  1HW5 A;  1FP2 A;  3K0L A;  1MZB A;  2QM3 A;  4A5N A;  3E6C C;  1J7K A;  4YFX F;  2L01 A;  1DPU A;  2ETH A;  3E5Q A;  2ZXJ A;  2F5C A;  3F8C A;  2M30 A;  1Z7U A;  1EH6 A;  1XGS A;  4NQW A;  4IJA A;  2HZT A;  4M73 A;  5FLX K;  1IN6 A;  3GZ5 A;  3VOE A;  3WGH A;  3ISP A;  1KQ9 A;  2XAJ A;  2H09 A;  2UWM A;  4S05 A;  3E5X A;  1RUN A;  2HKX A;  2VBW A;  2Z9O A;  2ESN A;  2LNB A;  3HRM A;  4E70 A;  4BYY A;  3CO6 C;  4LB6 B;  1V4R A;  2DK8 A;  5ILU A;  2HTJ A;  2VC1 A;  3V4G A;  4Y17 A;  5E20 A;  5DEQ A;  5HDN A;  2XHK A;  2QYO A;  3V7C A;  2VE8 A;  2F5E A;  3GEZ A;  2HTS A;  3KLO A;  4GCV A;  2FA5 A;  4PGG A;  2IA2 A;  4A0Y A;  5JFR A;  4ETS A;  1SD5 A;  2VT2 A;  3RKX A;  3ML6 A;  1UHM A;  3VEP A;  2EV6 A;  1CGP A;  2CW0 F;  3WGI A;  1ZGA A;  1K79 A;  3HSR A;  1TBX A;  4A2U A;  4F7Z A;  1FOK A;  1O7F A;  3Q5F A;  2EFQ A;  4LB5 A;  4PGH A;  2JPB A;  1MGT A;  4L9J A;  2ZO4 A;  4MEY F;  2AS5 F;  1G3T A;  4HF1 A;  3H3Z A;  5LGN A;  3IL2 A;  2B0L A;  4CHU A;  1B4A A;  1RZ4 A;  2FE3 A;  2PJP A;  4UVB A;  3GFJ A;  3TO6 A;  3TDU C;  5HS7 A;  1IN7 A;  4YFN F;  2DU9 A;  4IHT A;  2XUB A;  4ZYE A;  4WK8 F;  3ELK A;  4PDK A;  4ESF A;  1IF1 A;  3EQL F;  1FYM A;  2VOP A;  2NNY A;  2RC4 A;  3J81 Z;  1I27 A;  5L3D A;  3NRV A;  1OR7 A;  4OIQ F;  2CO5 A;  4NHJ A;  1ONV A;  1XN7 A;  4LG0 A;  1FYK A;  3DV8 A;  1P4W A;  4HAM A;  3CDH A;  2FOK A;  1TLH B;  2HGC A;  2IA1 A;  2D45 A;  4I0B A;  4HDV A;  1G6N A;  4P96 A;  5BS6 A;  2LF8 A;  3GWZ A;  5HDG A;  2M1B A;  3QP6 A;  3EDP A;  4HLY A;  4GGG A;  1O3S A;  4UV8 A;  4HZF A;  4BHP A;  2EJR A;  3LA2 A;  3ZMT A;  1BIA A;  1J5Y A;  3WOD F;  1FT9 A;  1S7A A;  5KVR A;  1Z6R A;  3F8F A;  1MJB A;  4IRH A;  2Q8K A;  2STW A;  1A04 A;  5DUK A;  1D8J A;  2R3S A;  2K02 A;  5D5W B;  5JHU A;  2OQR A;  4A6D A;  2K4B A;  5LEJ A;  3RKW A;  1T2K A;  4LG0 B;  4MTD A;  2O61 A;  4I98 B;  1LDD A;  4S04 A;  1FX7 A;  3LA3 A;  3GFI A;  5H6Q A;  1QNT A;  4ON0 A;  1U3E M;  1KYW A;  3R0A A;  3REO A;  1D8K A;  5DCM B;  1JE8 A;  2NS0 A;  3MFK A;  3BDD A;  3RIR A;  4KT5 C;  2O0Y A;  5FGM A;  4M6Y A;  2DQR A;  1XSX A;  2GXB A;  1EV7 A;  3QRF F;  2XKO A;  4OMY A;  4LD5 A;  4HDU A;  4PZJ A;  3E6D A;  2D1V A;  5K5O A;  4M9Z A;  3F22 A;  2CG4 A;  3I53 A;  3KP5 A;  3K1M A;  5L3B A;  2YPR A;  2HKO A;  2V6C A;  1FLI A;  2F5F A;  2PMH A;  3KP2 A;  5EEG A;  4A5M A;  1FBS A;  3MAJ A;  3QPT A;  3KZZ A;  1U6G A;  2M45 A;  3J7A O;  2RN7 A;  1FSE A;  5DD4 A;  1IZ1 A;  1QPM A;  4ZYG A;  4R8H A;  3RYP A;  4YFK F;  1DPR A;  3DFG A;  2UZK A;  1ZLK A;  4Q47 A;  1USS A;  2BE5 F;  5L3C A;  3U1D A;  3HTU A;  3CUQ A;  4BHB A;  1S7O A;  2D1H A;  1W7P A;  1F1Z A;  2JT1 A;  1CF7 A;  4UV9 A;  3HSF A;  4CIC A;  5CYV A;  3KCC A;  3ABU A;  3L00 A;  4EJW A;  2L02 A;  2ZCW A;  5K5R A;  3V8J A;  5E1X A;  2IW5 A;  2PI0 A;  1I1S A;  3FMS A;  1R23 A;  3EYI A;  2QBY B;  1AOY A;  5BPD A;  2HDC A;  2HR3 A;  5D5U B;  4AD9 A;  1EH7 A;  2VT3 A;  2EB7 A;  3VB2 A;  4U0V A;  4FX0 A;  5FFZ A;  3SHF A;  5E8I A;  1DP7 P;  1UST A;  3E5U A;  4L18 B;  4AIH A;  3L09 A;  2DW4 A;  4UUV A;  4U7D A;  1S6L A;  2CWE A;  3LST A;  4JK1 X;  3BOQ A;  3C18 A;  2CYY A;  5J8C A;  2ZBK A;  5J8F A;  4WWC A;  1R22 A;  5CVJ A;  2Z33 A;  1TQM A;  5DYM A;  3GUD A;  3CUQ B;  2J5P A;  1W7P B;  2K86 A;  2XVC A;  3B02 A;  1CF7 B;  4JQF A;  3AAF A;  2XAF A;  2G7H A;  2CGP A;  1MDM A;  1OYI A;  3GVA A;  2FU4 A;  5FLX Z;  3G73 A;  1TW2 A;  1XCB A;  4HBL A;  4Q5S F;  4RGR A;  2A6E F;  1XGO A;  4G7O F;  4WXH A;  5LLQ A;  4HQE A;  1ZLJ A;  3GF2 A;  1HSJ A;  2V9V A;  4FT8 A;  2D2W A;  3DF8 A;  2P5V A;  3ECH A;  4LLL A;  1IXR C;  1XGN A;  1LEB A;  3KP6 A;  3HTS B;  5L3G A;  1IUY A;  2IJL A;  1YW7 A;  2W84 A;  2KKO A;  3SZP A;  5IT9 K;  5AIQ A;  1IRG A;  1BI3 A;  2AXL A;  2KIM A;  4PCQ A;  1OMI A;  4IF4 A;  2LF7 A;  2P8T A;  1R5H A;  3WG9 A;  4D0P A;  4KIG A;  3PFI A;  2L3D A;  2XIG A;  2CSO A;  1FNN A;  4MQ9 F;  1FC3 A;  3U2R A;  1F5T A;  1HQC A;  5HS8 A;  3TQN A;  3KP7 A;  5DUI A;  4NB5 A;  4O5V A;  3VOD A;  2MC3 A;  5HLH A;  4N0B A;  2QLZ A;  1DUX C;  3CTA A;  2QQ9 A;  2VBZ A;  1TNS A;  2Y75 A;  3O2P E;  3O6B B;  2HYG D;  2QUF A;  1Z6T A;  4ENJ A;  4WF2 A;  3NEU A;  3QPH A;  2W24 A;  4CYD A;  3ERE D;  3LWF A;  2ESH A;  4LGW A;  5D5V B;  5E1Z B;  1R7J A;  2GA2 A;  1MJA A;  5CVR A;  2PN6 A;  2GWR A;  3M7G A;  1B1B A;  2FML A;  4RB0 A;  1W4M A;  3DPT A;  4K2E A;  5HOO A;  2HOE A;  2MH9 A;  4U0W A;  4CDG A;  1ON1 A;  2RGV A;  2KRF A;  2VE9 A;  2BV6 A;  3IWZ A;  3F8M A;  3SQN A;  1KGS A;  2YR2 A;  2O8X A;  4RB2 C;  5AON A;  1E17 A;  3GYH X;  1W5T A;  5J6X A;  2HFH A;  2BEO A;  3JSP A;  1WSU A;  4LK1 F;  1QZY A;  5HVQ C;  2V1U A;  2M5W A;  3R0J A;  3W6J B;  4G7Z F;  3FXQ A;  1XMA A;  4IRG A;  4Y15 A;  1NHA A;  3KFW X;  2M8E A;  3EET A;  1OPC A;  2LKP A;  3V8L A;  1R5G A;  3D0S A;  2VBY A;  2DLL A;  4EGZ A;  5AIP A;  1ZAO A;  2ISZ A;  2R7D A;  4UXN A;  1BI2 A;  2G7U A;  1LJ9 A;  2KJC A;  2ZNY A;  2QZ8 A;  2XKP A;  3I0T A;  2P7V B;  4WXD A;  4WXC A;  2L4A A;  1GHC A;  3FXU A;  2VN2 A;  1AWC A;  2HS5 A;  3HOS A;  3R60 A;  3RPQ A;  3F8N A;  1E2X A;  1BN5 A;  4CZZ A;  2FEZ A;  2DTR A;  2GA1 A;  1UFM A;  1U2W A;  2XRO A;  4G9Y A;  1P6R A;  2W25 A;  4KFC A;  2FNA A;  2O03 A;  4EM0 B;  4LFU A;  3N4M A;  4P5O A;  4I0A A;  3F3X A;  5ICF A;  2FF4 A;  2R7F A;  2DO7 A;  2PG4 A;  5JVT A;  4Y13 A;  5F64 A;  3HSE A;  3M8F A;  1YG2 A;  4EMS A;  2OZ6 A;  3IC7 A;  2UXN A;  2Y0M A;  4OIR F;  3HHG A;  1F4K A;  1PUE E;  1JHH A;  1XD7 A;  2GXG A;  2COM A;  1T6S A;  2A6H F;  2FBH A;  1Y0U A;  3WTS C;  4AIK A;  1XMK A;  4IHS A;  1JHF A;  3F21 A;  2ADU A;  1OKR A;  1XDS A;  4RGX A;  1I5Z A;  3WTX C;  1B9M A;  4L9N A;  3EYY A;  4BQA A;  2JRT A;  1C0W A;  3DXJ F;  4ZZD A;  3FF5 A;  1LEA A;  4ZYD A;  4HA8 A;  2H94 A;  4ASN A;  3CLO A;  2EFP A;  2FBI A;  2QVO A;  1BC8 C;  3T5X A;  5K5Q A;  2A69 F;  1HKS A;  5HLG A;  3I54 A;  1PDN C;  3GW2 A;  2P5L C;  4UNO A;  2EA4 A;  2BGC A;  1B59 A;  3CUQ C;  1Q1H A;  3I59 A;  4EGY A;  4HV6 A;  3ZMD A;  3I64 A;  1R1U A;  5FFX A;  4BNC A;  3PQJ A;  3WU0 A;  4GYI A;  5D8L B;  2JZY A;  4I2O A;  2JSC A;  2EK5 A;  2OBP A;  1X3U A;  3P7N A;  5FB2 A;  3ZQ7 A;  1O57 A;  2DAO A;  4BXU A;  2IA0 A;  3JAM K;  3RTR A;  2MA3 A;  2MBF A;  3DP7 A;  3GXO A;  2YX4 A;  2EWN A;  4P55 A;  3IRQ A;  3TO7 A;  2YX7 A;  3M8E A;  4HX8 A;  3D5L A;  2QEN A;  3I71 A;  1KU3 A;  3P9C A;  2PMU A;  4L9T A;  3FM5 A;  4MGR A;  1J9I A;  2RVC A;  4G8X A;  4MTE A;  4BH9 A;  4G6Q A;  3OV8 A;  3TOA A;  1I1G A;  4KA4 A;  3TKY A;  5IT9 Z;  4G7H F;  2HEO A;  3C1D A;  1TQI A;  1ZRC A;  1HW1 A;  2C6Y A;  3LA7 A;  1TTY A;  3CJN A;  2A5Y B;  2H27 A;  1IN8 A;  2W85 A;  2IPQ X;  3NQO A;  3DQV C;  2P6T A;  4EM2 A;  1V3F A;  5LHG A;  1IN4 A;  1SMY F;  3OOP A;  1G3S A;  3FM3 A;  1U8R A;  2PBI A;  3ABT A;  3JSO A;  4KN7 X;  4M9X A;  3W6K B;  1G3W A;  2VXZ A;  4LMY A;  2KIU A;  2JPC A;  1G4D A;  2DBB A;  3WE2 A;  3J81 K;  2BBY A;  1ZN2 A;  2H6B A;  2ZJ2 A;  3F72 A;  3GO5 A;  3V8K A;  2RDP A;  4ZH4 F;  3JTG A;  3ZMU A;  3JW4 A;  2K27 A;  5D6F A;  2GQQ A;  4G94 A;  3CO7 C;  2H6C A;  3TGN A;  3BJ6 A;  1S3J A;  1T38 A;  3O3K A;  2P5K A;  3E97 A;  2FMY A;  2E1N A;  5BQT A;  3WGG A;  1ZRD A;  4B09 A;  1BI1 A;  4BAY A;  2KIF A;  2OZU A;  1BC7 C;  5IT3 A;  1YO5 C;  1J2X A;  3WE3 A;  5ICG A;  1YIO A;  4YG2 F;  5FD5 A;  1W5S A;  5LEK A;  5LHI A;  3SFZ A;  2PQ8 A;  4HYE A;  4BHC A;  1F9N A;  3BJA A;  3F6V A;  3N97 A;  4KIF A;  3MWM A;  3LQR A;  1GXP A;  2MH2 A;  2BYV E;  3COA C;  5D4S A;  5D5X B;  2X4H A;  4HQM A;  1P2F A;  3H3U A;  1K7A A;  2ZFW A;  3KLN A;  1Z91 A;  1HKQ A;  3LFK A;  4U0Y A;  3SZT A;  2CQK A;  2PFB A;  1SFU A;  1S8N A;  3T8T A;  3QAH A;  4Q48 A;  3T8R A;  5ICE A;  2MLG A;  1YLF A;  2EFW A;  5F1R A;  4Q4Z F;  2DPU A;  2NNN A;  4HX4 A;  2PEX A;  1ON2 A;  1R36 A;  2Z3Y A;  4XRF A;  1QBJ A;  1KU2 A;  1BM9 A;  3SXY A;  4ESJ A;  2VOD A;  1L3L A;  4QLC U;  1MDM B;  4I02 A;  2ELH A;  3KP4 A;  3GFL A;  5BPI A;  2V1D A;  3VFZ A;  1VTN C;  3DPL C;  4HOB A;  4KUM A;  2O6G E;  2QWW A;  2GZW A;  3KET A;  4ZYH A;  4A0Z A;  2RQP A;  3K2Z A;  4OIN F;  2RV8 A;  5D8K B;  2VON A;  3ZMZ A;  1HXD A;  2P7C B;  1PP8 F;  1TNT A;  4M74 A;  1R58 A;  2HQN A;  4A0X A;  3L7W A;  1BBY A;  2VC0 A;  4OU0 A;  3RI4 A;  2QQB A;  4I09 A;  1DDN A;  5LGU A;  1FP1 D;  4XLN F;  3WTZ A;  4XSZ F;  2FRH A;  1GXQ A;  3F23 A;  5CVI A;  2NRA C;  1XB4 A;  3V7R A;  5KK1 A;  3PQK A;  1U5T C;  3T0Y A;  2A68 F;  5A2Q K;  4EJU A;  3KE2 A;  1G3Y A;  5DCF A;  1HST A;  1R00 A;  3WTU C;  2WC2 A;  5DV5 A;  4U7B A;  2J5O A;  4LK0 F;  1FPQ A;  4L0Z B;  1XSD A;  2IVM A;  4LLN A;  3IWF A;  4MEX F;  4G6D A;  1B9N A;  4HX7 A;  3BPX A;  4CO8 A;  1GVJ A;  3M9A A;  5CVV A;  6PAX A;  2DQL A;  1QGP A;  5LRR A;  5ERI A;  5D4R A;  1P92 A;  3HRU A;  2TDX A;  1ZG5 A;  1ZYR F;  2EA2 A;  3GX4 X;  2FXA A;  2ISY A;  2GAU A;  1ZHF A;  3QOP A;  1P4X A;  4ZZL A;  3B73 A;  2DT5 A;  4Z2Y A;  2OQG A;  3C7J A;  4CXF A;  2KJB A;  3FMQ A;  1J75 A;  4HV5 A;  2V1X A;  3FWE A;  3RYR A;  3WTT C;  3DEU A;  4KIB A;  4P9U A;  4M71 A;  3BPV A;  1JXS A;  4M9S A;  2XV4 S;  1STZ A;  2FSW A;  3T1B A;  4N9I A;  2ZME A;  1KQ0 A;  3TDZ C;  2XAS A;  1BOA A;  3JAM Z;  3ZMS A;  3J80 K;  2VBX A;  3RJP A;  4OMZ A;  4I01 A;  1U5T A;  4MHG A;  2L54 A;  1KU9 A;  4EJO A;  5JI6 A;  4IXA A;  2OAZ A;  3HHH A;  2IP2 A;  5E1W A;  1XGM A;  3C3W A;  4UVA A;  1TQP A;  5LBQ A;  2HWV A;  2O3F A;  2Z99 A;  4L9V A;  4ESB A;  4RS8 A;  2ZKZ A;  2HYF A;  1BJA A;  4KMU X;  1ZRE A;  2E7W A;  3G3Z A;  5HLI A;  4XSX F;  2JTV A;  1D3Y A;  2IRF G;  1D5V A;  1IN5 A;  1HKT A;  2XAH A;  3V7S A;  1S29 A;  3F8B A;  1J0R A;  1XCV A;  1YW8 A;  2OD5 A;  2FQ3 A;  2ZME B;  4M6X A;  5FD6 A;  2A07 F;  3FZV A;  1OYW A;  1LB2 A;  3R4K A;  2F2E A;  3I5U A;  3U9G A;  4KN4 X;  3MZH A;  2E1C A;  1U5T B;  4JBA A;  1IXS B;  3MCZ A;  1L0O C;  5E17 F;  1ZAR A;  1ODD A;  2XGX A;  1SD6 A;  4QWQ A;  3S2W A;  5CJ9 A;  4L5I A;  2YSR A;  1KYZ A;  1BIB A;  1UB9 A;  1IW7 F;  1RUO A;  4DQ2 A;  1Z1D A;  4I7H A;  4AVP A;  5BOX A;  2WTE A;  2EFN A;  5DCM A;  2EFO A;  2ACJ A;  2A3S A;  1LDJ A;  5TJJ A;  4EV0 A;  4L5J A;  3H92 A;  1MJ9 A;  4RGS A;  4RGU A;  4R79 A;  4RB1 A;  4MQV A;  1O3T A;  3BP8 A;  4YIF A;  3QU6 A;  4ENN A;  5L3F A;  1I6X A;  2OU2 A;  3HIF A;  4HLX A;  3FX3 A;  1REP C;  2FNP A;  3RKY A;  1FBQ A;  5H6R A;  5DD8 A;  4O3M A;  4AIJ A;  3MEX A;  3P9K A;  4GXO A;  2G9W A;  1ULY A;  1IAW A;  1TW3 A;  2Q0O A;  1XSV A;  3E6M A;  2VOO A;  1LNW A;  4WCG A;  1RIO H;  3ZPL A;  3QP5 A;  4GO1 A;  2M87 A;  1SMT A;  4B8X A;  4XLP F;  2V79 A;  4U88 A;  1YS7 A;  3I59 B;  3ZP5 A;  1T0F A;  4L0Y B;  3WU1 B;  4TV7 A;  1RNL A;  3Q9V A;  4IVN A;  1O3R A;  2P6S A;  1H9T A;  3ZMV A;  1Z05 A;  2XAG A;  2W57 A;  3BJO A;  1Z9C A;  4ENM A;  1SFX A;  2YU3 A;  4CGZ A;  2UXX A;  2QBY A;  2HQR A;  4OOI A;  1KU7 A;  3HRT A;  2Q2E A;  3TO9 A;  4KDP A;  1FY7 A;  3BZ6 A;  1T98 A;  2DI3 A;  5ILS A;  2OA4 A;  3MZY A;  3Q9S A;  1YS6 A;  3WTW C;  3ECO A;  2X0L A;  3P9I A;  5ICC A;  4LJZ F;  5EEH A;  2QQA A;  5LHH A;  3RDI A;  3E6B A;  5FO5 A;  2LSO A;  4GYG A;  1H9G A;  4KMF A;  5ILV A;  1RI7 A;  1U78 A;  2DPD A;  3KP3 A;  1HBX G;  1W7P D;  3KEQ A;  4KIC A;  3FMR A;  3WTV C;  3K69 A;  2WWY A;  4XBF A;  1B6A A;  2GIV A;  3BY6 A;  3QU3 A;  1ZH5 A;  4EVI A;  1WRJ A;  5A2Q Z;  1KQ8 A;  2STT A; 
#chains in the Genus database with same CATH topology
 2K7L A;  2Q2E B;  4MNU A;  2DK5 A;  3BTI A;  3HRS A;  2L4M A;  5F6F A;  5HOD A;  4IRI A;  3HOT A;  5E18 F;  1X4O A;  4RMN A;  2ECC A;  1YRN A;  3ZQH A;  3OYB A;  1N78 A;  3K1N A;  2MW8 A;  5M3F J;  4HF0 A;  2K4J A;  4M3G A;  2R5Y A;  3EUH A;  1X19 A;  5LGT A;  3LSJ A;  4HW0 A;  4RB3 C;  4G6T B;  2DFE A;  2EV0 A;  3K2A A;  4XOR A;  4UVC A;  3PIP F;  2JVH A;  1AHD P;  2LRD A;  1Z7L A;  1MMS A;  3KEO A;  4EJT A;  5D6E A;  5DDG A;  1QZZ A;  5C44 J;  1KA8 A;  2ZB9 A;  1FZP B;  4KYW A;  2DA2 A;  4KJZ A;  1T39 A;  4PJ0 C;  2CW8 A;  3BT9 A;  3L2Q A;  5F0C A;  1D0X A;  1WWX A;  4XON A;  5L3E A;  1LQ1 A;  4DYC A;  4JX5 A;  1UG2 A;  4NC6 A;  5C4X J;  2XRN A;  4EAT A;  2A61 A;  1FYL A;  3F6O A;  4WX9 A;  3R61 A;  4ENK A;  5CLS A;  1WQ2 A;  1EH8 A;  1O3Q A;  3S32 A;  1K78 A;  1FSH A;  2NYX A;  4R1H A;  3SFI A;  4XID A;  3K4J A;  2WV1 A;  3A02 A;  3GFM A;  4EQQ A;  4M72 A;  2PMZ A;  4XKW A;  5HS9 A;  1SD7 A;  1K83 J;  1K4T A;  3K9T A;  2RAE A;  2MD5 A;  5K1Y A;  2LDU A;  4XM3 A;  1O7L A;  5GPA A;  2MLK A;  1IXC A;  3L2C A;  3JTH A;  3ULQ B;  2PLY A;  2L9R A;  1A6Q A;  3OOU A;  3QYE A;  4KNY A;  1MKM A;  2XAQ A;  5IY5 H;  5B66 C;  3K4N A;  2XPV A;  1UCR A;  2MAB A;  1SAX A;  4CUG A;  1UHW A;  1FBU A;  5KNL A;  3H3V K;  2F5D A;  2Z5U A;  3KZY A;  4EJV A;  4OIO F;  1ZG1 A;  5LRS A;  3TOB A;  2DMP A;  4C3I J;  1ZEL A;  1SFO J;  4KIT B;  4IPA A;  1ZTR A;  2CFX A;  5ED4 A;  1S9H A;  2HVR A;  1BI0 A;  1N75 A;  3S3N A;  4ZTF A;  3VSK A;  1PP7 U;  3I56 I;  2FBK A;  3VYR B;  4LLG F;  2EZI A;  4UUS A;  3HYI A;  2R5Y B;  5TRD A;  3DKW A;  4H0E A;  3U1K A;  4O6J A;  3ZOB A;  2RNJ A;  3OS2 A;  2V26 A;  4OIP F;  4UHT A;  3ONQ A;  3CUO A;  1P4A A;  3PFY A;  4P9F A;  4EM1 A;  4A3F J;  4RAZ A;  1K6O A;  3CZ6 A;  3CC4 I;  4FX4 A;  2WV0 A;  3GLX A;  1JI8 A;  2ZXI A;  4X6A J;  5H20 A;  3JR9 A;  3FIW A;  1ZGJ A;  3GLL A;  3H5A A;  5E8G A;  3TMO A;  2JA6 J;  3M3Y J;  3BRO A;  2B9S A;  1HW2 A;  1LDK B;  1YW9 A;  2P4W A;  4DNC A;  2DYR H;  2QGU A;  5E3L A;  2RKH A;  5K7F A;  3J80 Z;  1XX5 A;  3ROU A;  4IOA F;  4A12 A;  1G59 A;  1IDZ A;  3IKV A;  4CCM A;  2HI3 A;  4XKB A;  1QVT A;  3HB9 A;  4RLF A;  3L9F A;  1TC3 C;  3I58 A;  3N05 A;  1K78 B;  3S1M J;  3BWG A;  2VQG A;  2CUJ A;  1SFK A;  2MFZ A;  2R5Z A;  2BW3 A;  1YQA A;  1R1T A;  4A6E A;  3H5R A;  1JGS A;  2CQX A;  2LG4 A;  1QQI A;  3FHN A;  1X2M A;  3BZC A;  2DFI A;  4YII A;  2K40 A;  4ABZ A;  4EEF G;  2PJR B;  1VQ4 I;  5JHF A;  2E7X A;  1ETO A;  3ESW B;  1XDU A;  1ZKG A;  1ZG3 A;  4OAY A;  3K1P A;  1ZQ3 P;  3LAJ A;  1XC5 A;  3E3V A;  2FUG 2;  1MBH A;  2X1D A;  1YIT I;  2WB1 N;  3MQ0 A;  3FXR A;  5BMZ A;  2VKH A;  4IKF A;  2NAZ A;  3W2W A;  1YYV A;  3CCR I;  1LVA A;  3DU6 A;  2IEK A;  1J59 A;  4I99 C;  3WTY C;  5B1A H;  3FHZ A;  3IV5 A;  3G6E I;  1OYY A;  5CVU A;  3TED A;  1WI9 A;  4UUS B;  2H1L A;  3S15 J;  3RPU A;  2DOF A;  3ZCO A;  2E60 A;  3KPH A;  1IDY A;  5HDK A;  1YTY A;  4C9Y A;  2FOW A;  2HXI A;  3S3M A;  4E7K A;  2Y48 A;  1MD0 A;  2XF7 A;  5M5W J;  4FAS D;  1FWZ A;  3ZN1 A;  2B7E A;  4A3E J;  3M1E A;  4AID A;  2GBY A;  5JR3 A;  2EH3 A;  2YUS A;  4XLC A;  1V5E A;  4IO9 F;  4QIW N;  1K61 A;  2CH0 A;  4PUS A;  1FIP A;  3I4P A;  2EV5 A;  3R6S A;  4E4H A;  2ZNZ A;  3IHU A;  1R1V A;  1H0M A;  3RKQ A;  1MNM C;  3LQQ A;  1YHQ I;  4RAY A;  2IT0 A;  4RDU A;  3IRR A;  4N9H A;  2V4J C;  1XG1 A;  2IS1 A;  1SD4 A;  1X3W B;  4XOP A;  3GZ6 A;  4ZJZ A;  3LAP A;  4Y52 J;  2DT6 A;  4B47 A;  1YFH A;  3HUG A;  1SFE A;  1V54 H;  2RQQ A;  3GTP J;  2YU9 J;  4HF2 A;  1WKM A;  1QO0 D;  3IKT A;  4IOC F;  2BW3 B;  1IRF A;  3ZN0 A;  1ZRF A;  3OR2 C;  4FHT A;  4HEA 2;  2EIK H;  5CQG A;  4D7M A;  1IRZ A;  4AWX B;  2IS6 A;  1OCC H;  1HW5 A;  1FP2 A;  2DA1 A;  3K0L A;  2JA5 J;  4XKV A;  1MZB A;  2QM3 A;  4A5N A;  3E6C C;  1J7K A;  4A3B J;  4YFX F;  2L01 A;  1A35 A;  1DPU A;  2ETH A;  3E5Q A;  5FKO A;  3D5R C;  3GTJ J;  2ZXJ A;  4BQN A;  2ELJ A;  2F5C A;  4DJA A;  2W00 A;  1B72 A;  3BTJ A;  3F8C A;  2M30 A;  3QPS A;  1Z7U A;  1EH6 A;  1XGS A;  2OJE D;  3C2G A;  2W1O A;  4NQW A;  4IJA A;  2LRE A;  2HZT A;  4M73 A;  2A05 A;  3DKY A;  1RKT A;  2QA4 I;  5FLX K;  1BL0 A;  2GOM A;  2FQ4 A;  1IN6 A;  3GZ5 A;  3VOE A;  3RZD J;  3GTL J;  3F9K A;  3WGH A;  2ZJP F;  4IHY A;  3DKX A;  1UMQ A;  3PUF A;  3ISP A;  1KQ9 A;  2XAJ A;  4M3E A;  1MBF A;  2Z16 A;  2H09 A;  2KRC A;  2UWM A;  2OUM A;  4S05 A;  4BQO A;  3E5X A;  4F91 B;  1RUN A;  2HKX A;  2VBW A;  2Z9O A;  2ESN A;  2LNB A;  2DJN A;  3HUG B;  1YOV B;  1SAU A;  3FBI B;  3HRM A;  4I76 A;  3CCQ I;  4E70 A;  4BYY A;  1ENH A;  1DU6 A;  3CO6 C;  3K4C A;  2PX9 A;  4LB6 B;  4XK4 A;  1VQ8 I;  2MC4 A;  3KYC B;  1V4R A;  2DK8 A;  4V2F A;  5ILU A;  2HTJ A;  2VC1 A;  1LUJ B;  4BE1 A;  3V4G A;  4Y17 A;  5E20 A;  3FKI J;  2X6O A;  5DEQ A;  3JRC A;  2VJJ A;  5HDN A;  1X3Z B;  3GZN B;  2I5U A;  2XHK A;  1FOW A;  2NOG A;  2QYO A;  3V7C A;  3CC7 I;  2V6E A;  2VE8 A;  2XSD C;  1K6Y A;  1DQU A;  2F4I A;  1Y8Q B;  2F5E A;  3GEZ A;  2HTS A;  2HU9 A;  3KLO A;  4F93 B;  2LY9 A;  4GCV A;  2FA5 A;  4PGG A;  3I3L A;  2IA2 A;  4A93 J;  1SVO A;  3AG3 H;  3SDG A;  4A0Y A;  5JFR A;  4ETS A;  1SD5 A;  4FIS A;  2VT2 A;  3RKX A;  4NQW B;  3ML6 A;  1QRY A;  2EZK A;  2IAI A;  2R7R A;  1UHM A;  2NS8 A;  3VEP A;  2EV6 A;  1VQ7 I;  2KMU A;  4QPO A;  2CW0 F;  3WGI A;  1ZGA A;  2XAU A;  1CGP A;  2JJ7 A;  1RR7 A;  1EF4 A;  3NWT A;  3HSR A;  3CP8 A;  5IP9 J;  1K79 A;  1TBX A;  1TZL A;  2JA7 J;  4A2U A;  4F7Z A;  1FOK A;  3KZI C;  1O7F A;  5E3O A;  3FKJ A;  4DZJ A;  3Q5F A;  2EFQ A;  1MH4 A;  4LB5 A;  2R7U A;  3H9G A;  4PGH A;  2JPB A;  1MGT A;  4L9J A;  2ZO4 A;  2EIL H;  2E1O A;  3NAU A;  3CF2 A;  4MEY F;  2AS5 F;  4L5E A;  1G3T A;  3HPG A;  4ZYA A;  4HF1 A;  3H3Z A;  5LGN A;  1EKE A;  3IL2 A;  2B0L A;  2EIM H;  2XF5 A;  2VPL A;  1UG0 A;  4CHU A;  2WBM A;  1B4A A;  1RZ4 A;  2FE3 A;  3FK7 A;  2PJP A;  3AFH A;  1NG6 A;  3SDB A;  4UVB A;  3GFJ A;  3TO6 A;  3TDU C;  2DA6 A;  4C3H J;  5HS7 A;  1IN7 A;  4YFN F;  2DU9 A;  5GTI C;  5EF6 A;  1A31 A;  4IHT A;  2XUB A;  2VB6 A;  4ZYE A;  4WK8 F;  1RES A;  3ELK A;  4PJM A;  4YEJ A;  2HZD A;  3BLY A;  4PDK A;  4CYC A;  4E7L A;  4ESF A;  1T0F C;  1IF1 A;  1LFP A;  3EQL F;  1FYM A;  2VOP A;  1NK3 P;  5EDN A;  3V42 A;  2NNY A;  2ZFU A;  2RC4 A;  4J19 A;  3J81 Z;  1I27 A;  1UHS A;  4UUT A;  5L3D A;  1YX5 A;  3NRV A;  3AL0 C;  4IEJ A;  1OR7 A;  3B6A A;  4OIQ F;  2CO5 A;  2E35 A;  5KAI C;  4NHJ A;  1ONV A;  1XN7 A;  4LG0 A;  1FYK A;  3G71 I;  4U87 A;  2GM4 A;  3DV8 A;  1P4W A;  4HAM A;  4A3J J;  2STT A;  3CDH A;  2FOK A;  3J7A Y;  1TLH B;  2HGC A;  3MZ8 A;  2JSP A;  3BG6 A;  2IA1 A;  1F36 A;  2R93 J;  2QKM B;  2D45 A;  4I0B A;  5TGT A;  3K4K A;  3BR2 A;  3H1C A;  4XOT A;  1G6N A;  4HDV A;  4XL9 A;  3I4N J;  4P96 A;  5BS6 A;  2LF8 A;  3GWZ A;  2XC7 A;  5HDG A;  1WI3 A;  1QHG A;  1HLV A;  2M1B A;  3QP6 A;  3BQY A;  4MIM A;  3EDP A;  4HLY A;  2BVM A;  4GGG A;  1O3S A;  4UV8 A;  4XLE A;  1I39 A;  3CCL I;  4HZF A;  4BHP A;  1APL C;  4V2G A;  3OYD A;  1D5Y A;  2NVQ J;  3CME I;  2EJR A;  2LOO A;  2IGO A;  3LA2 A;  3ZMT A;  3A03 A;  1BIA A;  2IGK A;  1J5Y A;  1MH3 A;  1JKO C;  3WOD F;  1FT9 A;  1HCR A;  1S7A A;  4NDL A;  5KVR A;  2DA5 A;  1Z6R A;  4CYC B;  3F8F A;  1R71 A;  1MJB A;  2MSY A;  2Q8K A;  5DTD A;  1W1W E;  2XRL A;  2STW A;  4BAC A;  2X48 A;  1JGG A;  1A04 A;  3BR5 A;  5DUK A;  1D0Y A;  3CDI A;  3VWB A;  1D8J A;  1RKW A;  2X85 A;  2R3S A;  4HG2 A;  2K02 A;  5D5W B;  2I8D A;  5JHU A;  4BU2 A;  2OQR A;  3OYA A;  1VQL I;  1ITY A;  4A6D A;  2K4B A;  5LEJ A;  3H9J A;  3RKW A;  1T2K A;  5E3N A;  4LG0 B;  4MTD A;  2O61 A;  4I98 B;  2XGD A;  2OPT A;  2VQC A;  1FTT A;  1LDD A;  4PFO A;  4S04 A;  1FX7 A;  3LA3 A;  3GFI A;  3D5S C;  5H6Q A;  3CC2 I;  4BBR J;  4HNU A;  1N77 A;  1QNT A;  1BW6 A;  2AQE A;  4ON0 A;  1RR8 C;  4CZC A;  1U3E M;  1KYW A;  4D7N A;  5IYC J;  3R0A A;  3REO A;  1D8K A;  5DCM B;  1JE8 A;  4YIR X;  3EUH C;  2OTJ I;  2KRH A;  2NS0 A;  2UUZ A;  2DA7 A;  3MFK A;  2H8R A;  2VKD A;  3BDD A;  4XIC A;  3CCJ I;  3RIR A;  4KT5 C;  2O0Y A;  5FGM A;  4M6Y A;  4E7S A;  2DQR A;  1XSX A;  2GXB A;  4FE7 A;  3E0J B;  5J1U A;  1EV7 A;  3QRF F;  1X1P A;  2AQF A;  2CS3 A;  2XKO A;  1W0U A;  2E2H J;  3M8J A;  4OMY A;  3GTM J;  4LD5 A;  2DXI A;  2HDD A;  3KEY A;  1V5F A;  4HDU A;  4PZJ A;  5E79 C;  2LD5 A;  5J47 A;  3E6D A;  3FDY A;  4A3I J;  2D1V A;  5K5O A;  4E6K G;  2XB5 A;  4M9Z A;  3F22 A;  1R5I D;  2CG4 A;  2QQ8 A;  3I53 A;  3KP5 A;  3K1M A;  2KP6 A;  1WFX A;  2O7O A;  5L3B A;  3OYM A;  2YPR A;  2GIZ A;  3JRB A;  2HKO A;  2V6C A;  1FLI A;  3ASO H;  4ZDO A;  2F5F A;  2PMH A;  3KP2 A;  5EEG A;  4A5M A;  1FBS A;  3MAJ A;  4RBO A;  2E2I J;  3QPT A;  3KZZ A;  2QSG X;  1U6G A;  2M45 A;  3J7A O;  5C3E J;  2RN7 A;  1T95 A;  1FSE A;  5DD4 A;  2Y2Z A;  4F92 B;  1BW5 A;  3GTO J;  1IZ1 A;  2W7N A;  5DM6 F;  1QPM A;  1A6I A;  4ZYG A;  4IZZ A;  4F3Q A;  3I4M J;  2Z2S B;  4UY8 I;  1D1B A;  4R8H A;  2OF7 A;  3RYP A;  4A3G J;  4YFK F;  1DPR A;  3DFG A;  2V9K A;  4XKC A;  2UZK A;  1OCP A;  1ZLK A;  5IOZ A;  5GTH C;  4Q47 A;  2HOS A;  1OCR H;  5FKN A;  1U9N A;  1PYV A;  1USS A;  3HBL A;  1JUS A;  2BE5 F;  5L3C A;  1R4M B;  5A2Q Z;  3U1D A;  2Y9Z A;  2KZG A;  3HTU A;  1N25 A;  3CUQ A;  3KYL A;  4DIQ A;  4BHB A;  4B1R A;  1S7O A;  2D1H A;  2QF7 A;  3IH3 A;  1W7P A;  3Q0W A;  4PFP A;  4A3C J;  1H89 C;  1F1Z A;  1ETX A;  2JT1 A;  1CF7 A;  4UV9 A;  3HSF A;  4CIC A;  3DLA A;  5CYV A;  2L7F P;  3OYK A;  3KCC A;  2QSH X;  3ABU A;  3L00 A;  2HVQ A;  4ITV A;  4EJW A;  2L02 A;  1Y1V J;  2ZCW A;  4N4O B;  5K5R A;  1WH5 A;  3O8G A;  3V8J A;  3S93 A;  5E1X A;  2IW5 A;  4E7H A;  3OIQ A;  2PI0 A;  4B43 A;  1I1S A;  2JMW A;  4II2 A;  4ZTJ A;  3FMS A;  1Y39 A;  4PJL A;  1R23 A;  1OJL A;  2LVS A;  4XQF A;  3EYI A;  2QBY B;  1I50 J;  5KHD A;  1AOY A;  5BPD A;  2HDC A;  2HR3 A;  5D5U B;  4AD9 A;  1EH7 A;  2I10 A;  3VSL A;  1Z67 A;  3PL8 A;  4V19 K;  2VT3 A;  4E7J A;  1JUP A;  2EB7 A;  3VB2 A;  4U0V A;  4F52 A;  1WJA A;  2KQR A;  4FX0 A;  4UB6 C;  5FFZ A;  3SHF A;  5E8I A;  3S3O A;  2OCE A;  3FBN B;  2CRG A;  2WB1 A;  1DP7 P;  1BR4 A;  1UST A;  3E5U A;  4LG3 A;  3JRE A;  1Y6I A;  3ERM A;  4L18 B;  4AIH A;  3L09 A;  2DW4 A;  2TRT A;  2FX0 A;  4UUV A;  5M5Y J;  4U7D A;  1S6L A;  2CWE A;  2LH9 A;  3LST A;  4JK1 X;  3BOQ A;  3C18 A;  2CYY A;  5J8C A;  2ZBK A;  5IP6 A;  1MMA A;  3LSH A;  5J8F A;  4WWC A;  1R22 A;  4LIT A;  5CVJ A;  5GAE J;  4M6V A;  2Z33 A;  1FMW A;  5LD2 C;  1TQM A;  5DYM A;  2DOA A;  1X1C A;  3GUD A;  3CUQ B;  3WHC A;  2J5P A;  1E3O C;  1W7P B;  2HPM A;  2K86 A;  2XVC A;  3B02 A;  4J00 A;  1CF7 B;  4JQF A;  3AAF A;  1OCT C;  3MKW B;  2XAF A;  1P9Q C;  3UKG A;  2G7H A;  4PSX A;  2CGP A;  3MVP A;  1H88 C;  1DGR M;  1MDM A;  1OYI A;  3FXO A;  1WGX A;  3GVA A;  2NXN B;  4DBQ A;  1QPI A;  1KZH A;  4D5F A;  2WAQ N;  2FU4 A;  5FLX Z;  4X0G A;  1XPX A;  3G73 A;  1TW2 A;  1XCB A;  4HBL A;  4Q5S F;  3CES A;  4RGR A;  4RM2 A;  3L2R A;  2A6E F;  3H5N A;  1XGO A;  1VQM I;  4WXH A;  4G7O F;  5LLQ A;  1ORK A;  4QSH A;  1MBG A;  4HQE A;  1QHH D;  1ZLJ A;  2LK2 A;  1YRN B;  1XMX A;  4Z6Y A;  3MKL A;  3GF2 A;  1HSJ A;  2V9V A;  3BTC A;  4FT8 A;  2D2W A;  2E2J J;  3DF8 A;  2P0W A;  2P5V A;  4A3M J;  3ECH A;  1VZ0 A;  3BQZ A;  3UR3 C;  4DOZ A;  4LLL A;  4CSW A;  1IXR C;  1XGN A;  3JRI A;  1LEB A;  3Q0V A;  3KP6 A;  2K9N A;  3ASN H;  3HTS B;  5L3G A;  1IUY A;  2IJL A;  2KDZ A;  1YW7 A;  1JT6 A;  2W84 A;  2KKO A;  3SZP A;  3DWL E;  5IT9 K;  5AIQ A;  4C2M J;  1IRG A;  1FJL A;  4XR6 A;  1BI3 A;  2NOJ B;  2AXL A;  2KIM A;  2JA2 A;  3SEQ A;  4PCQ A;  1DP3 A;  3BCB A;  5IP7 J;  2LFB A;  1OMI A;  2DDA A;  2UV1 A;  2HXO A;  4JYK A;  4IX7 A;  3HOZ J;  4IF4 A;  1TT0 A;  2LF7 A;  2P8T A;  4JX6 A;  4D9J A;  1R5H A;  1S7E A;  2DN0 A;  4DYQ A;  2L7Z A;  3WG9 A;  2QEX I;  1PUF A;  4D0P A;  4DZP A;  1YIJ I;  4KIG A;  3PM1 A;  5FLM J;  1KON A;  3S14 J;  3PFI A;  2R7O A;  2L3D A;  2XIG A;  2EZH A;  2CSO A;  2DMT A;  1FNN A;  1IGN A;  4MQ9 F;  1FC3 A;  3U2R A;  1F5T A;  1HQC A;  2ECB A;  2XSJ C;  5HS8 A;  1CQT A;  3EUA A;  3TQN A;  3KP7 A;  1WJ5 A;  3K4B A;  5DUI A;  4NB5 A;  1BOB A;  4PSW A;  4O5V A;  5GAH J;  3VOD A;  2MC3 A;  5HLH A;  2N8G A;  2X1C A;  3GTG J;  4N0B A;  1IV8 A;  3L2U A;  2QLZ A;  1DUX C;  1RC9 A;  3CTA A;  5B5E C;  2MGQ A;  2QQ9 A;  2RRE A;  2VBZ A;  1TNS A;  2Y75 A;  1ETQ A;  4RA2 A;  1A36 A;  3O2P E;  3O6B B;  2HYG D;  2QUF A;  1Z6T A;  4ENJ A;  2VI6 A;  2K3P A;  4WF2 A;  1MW7 A;  3DTK A;  3NEU A;  3QPH A;  3ZQL A;  3S2H J;  2QSF X;  1H8A C;  3VYT B;  2DT7 B;  3FK6 A;  3H0G J;  2ZC2 A;  2QCO A;  1T33 A;  2X6X A;  4XLA A;  2W24 A;  4CYD A;  3ERE D;  3LWF A;  1IO2 A;  4W1U A;  2DMQ A;  4BQQ A;  3CMA I;  2ESH A;  3AG4 H;  2OC6 A;  1I3A A;  4YRV A;  4NBQ A;  4LGW A;  4XN3 A;  2R5Z B;  1ZK8 A;  5D5V B;  1FOX A;  3ABM H;  5E1Z B;  4C3J J;  1G2H A;  1LFB A;  3ZGK A;  1R7J A;  2GA2 A;  1MJA A;  5CVR A;  3TP0 A;  2PN6 A;  1T56 A;  2GWR A;  3M7G A;  1B1B A;  2FML A;  4RB0 A;  3S1N J;  3CMM A;  1W4M A;  3DPT A;  4K2E A;  3MKZ A;  3SJM A;  2IXS A;  2DMN A;  2HOE A;  5HOO A;  4BBS J;  2MH9 A;  4LOC A;  4Y4R A;  4U0W A;  4CDG A;  2V1N A;  5J4V A;  1ON1 A;  2RGV A;  2KRF A;  1FIA A;  2VE9 A;  4E7I A;  2BV6 A;  3G1O A;  3IWZ A;  3F8M A;  3SQN A;  2LP0 A;  1KGS A;  1HDP A;  1SEU A;  2YR2 A;  2O8X A;  1LVK A;  4RB2 C;  3RCO A;  3K4M A;  3D1N I;  5AON A;  5FRN A;  1E17 A;  3GYH X;  1W5T A;  5J6X A;  3QOE A;  2Z1D A;  4XRS G;  2HFH A;  4BJ6 C;  3DBH B;  1HDD C;  2BEO A;  2KLO A;  3JSP A;  1WSU A;  4LK1 F;  1QZY A;  2BY2 A;  5HVQ C;  5IYD J;  2V1U A;  2JRM A;  3HPH A;  4B48 A;  2VLA A;  2M5W A;  3A1Y A;  3R0J A;  2LTP A;  3OR1 C;  3W6J B;  3ZXS A;  2R7W A;  4G7Z F;  4CA0 A;  2JK3 A;  1XMA A;  3FXQ A;  3HGG A;  4IRG A;  4RM3 A;  1NHA A;  1U0J A;  4Y15 A;  3CCM I;  3KFW X;  2M8E A;  3EET A;  2ZJQ F;  1OR7 C;  3MN2 A;  1OPC A;  2LKP A;  3V8L A;  1GUU A;  1R5G A;  2XDV A;  3D0S A;  3QWL A;  3JRH A;  2F4M B;  3K10 A;  2VBY A;  2DLL A;  4EGZ A;  1LFU P;  5AIP A;  1OCZ H;  1AU7 A;  5CKT A;  1ZAO A;  2ISZ A;  2R7D A;  4UXN A;  2HOT A;  1BI2 A;  5J1R A;  5B3S H;  1WJC A;  2NVU B;  3LSM A;  2G7U A;  1LJ9 A;  2KJC A;  2LKX A;  3OYG A;  2ZNY A;  4CCN A;  4BY1 J;  2VUM J;  2QZ8 A;  1B8I A;  4XNF A;  3BG9 A;  3OYN A;  3H0D A;  2XKP A;  3I0T A;  2P7V B;  4GDF A;  4WXD A;  4WXC A;  2L4A A;  2VJ5 A;  1B72 B;  2R7Q A;  4GRI A;  3PO3 J;  4IQJ A;  1GHC A;  3FXU A;  2VN2 A;  2LYC A;  4A3D J;  1AWC A;  4LIV A;  2HS5 A;  1W0T A;  3HOS A;  3P5J A;  2LKS A;  3FXJ A;  3R60 A;  3KYD B;  3K4L A;  2K3F A;  2HDW A;  2MD0 A;  3RPQ A;  1TWF J;  3F8N A;  1E2X A;  1BN5 A;  1WZ2 A;  3JRF A;  4CZZ A;  3HKZ N;  2ZXH A;  2CQ7 A;  2ID6 A;  5B1B H;  2FEZ A;  2DTR A;  2GA1 A;  1JTY A;  2X6Y A;  1UFM A;  3DTI A;  5IOY A;  1U2W A;  2XRO A;  4J01 A;  4G9Y A;  4C2U A;  1P6R A;  2W25 A;  4XN0 A;  4W97 A;  3IP4 B;  1U8B A;  4KFC A;  2FNA A;  4F55 A;  2O03 A;  4EM0 B;  1MNE A;  3DU5 A;  2ZJR F;  4LFU A;  1XTA A;  4P5O A;  3N4M A;  4I0A A;  3F3X A;  5ICF A;  2FF4 A;  1X1B A;  2R7F A;  1PVE A;  3VYU B;  2DO7 A;  2PG4 A;  2ID3 A;  2HPI A;  2Y31 A;  5JVT A;  4MFD A;  4E7Z A;  4Y13 A;  1WH7 A;  3OL4 A;  5F64 A;  3HSE A;  2Y69 H;  2CJJ A;  2E36 A;  3M8F A;  1YG2 A;  2VQH A;  4EMS A;  2OZ6 A;  3IC7 A;  4BUP A;  2UXN A;  2Y0M A;  2M2E A;  3QPL A;  4OIR F;  1S72 I;  3NWS A;  4M3B A;  1IJW C;  3HHG A;  1F4K A;  1PUE E;  2XF6 A;  3TP3 A;  1B8I B;  3OWT A;  5C4J J;  1VQK I;  1JHH A;  2EQR A;  1XD7 A;  3A0B C;  2KL4 A;  2GXA A;  2GXG A;  5FKM A;  3K70 C;  2COM A;  1T6S A;  2A6H F;  2X6W A;  2FBH A;  1Y0U A;  3WTS C;  1HA8 A;  1JKR C;  4AIK A;  1XMK A;  4IHS A;  1JHF A;  1V5G A;  3F21 A;  5J40 A;  2ADU A;  4CCJ A;  1VQP I;  1OKR A;  2CV0 A;  3VDX A;  1XDS A;  1W36 C;  2L9S A;  3BR0 A;  4RGX A;  3W6V A;  2M3A A;  2DJI A;  1I5Z A;  3WTX C;  1B9M A;  4L9N A;  3QOD A;  1IG7 A;  3EYY A;  3OS0 A;  2K85 A;  4BQA A;  2JRT A;  3PUB A;  1C0W A;  3DXJ F;  1WJF A;  4ZZD A;  3FF5 A;  1LEA A;  4ZYD A;  5FRM A;  4HA8 A;  1UZC A;  2H94 A;  1ETV A;  3AG1 H;  1W5C C;  4ASN A;  3HM5 A;  3CLO A;  2EFP A;  2XGC A;  2FBI A;  2GOX B;  2QVO A;  1BC8 C;  3T5X A;  3IAM 2;  1Z77 A;  2A6T A;  5K5Q A;  2A69 F;  1HKS A;  5HLG A;  1TWH J;  1SVL A;  3I54 A;  3JCU C;  2EZL A;  1PDN C;  2O5R A;  3GW2 A;  3OYC A;  2P5L C;  1YJN I;  3RQI A;  1QVU A;  4UNO A;  1ZGW A;  4BE0 A;  2EA4 A;  2OCC H;  4H4K C;  2BGC A;  4G12 A;  2EPF A;  1B59 A;  3CUQ C;  1Z0X A;  1Q1H A;  3CCE I;  1SC7 A;  4AM3 A;  3W3C A;  1NG7 A;  1X2N A;  3CQZ J;  3I59 A;  4EGY A;  4HV6 A;  3ZMD A;  3I64 A;  1R1U A;  2M7B A;  5FFX A;  1TWC J;  3CD6 I;  3RSN A;  3HL2 A;  4BNC A;  3PQJ A;  3WU0 A;  1J09 A;  4GYI A;  5D8L B;  2JZY A;  3ZQI A;  4I2O A;  2JSC A;  2LY1 A;  4UB8 C;  3GME A;  1E3P A;  2EK5 A;  2BHZ A;  5F04 A;  3BG5 A;  2OBP A;  1X3U A;  3P7N A;  5FB2 A;  3S16 J;  1ZR4 A;  3ZQ7 A;  4D5C A;  1O57 A;  2BZT A;  3OY9 A;  1X1A A;  4I6Z A;  1D1A A;  2DAO A;  1FTZ A;  1VI0 A;  1R9T J;  4BXU A;  1JKQ C;  2IA0 A;  3JAM K;  3RTR A;  3HOV J;  3F0C A;  4KT6 A;  2MA3 A;  4M3D A;  5EEA A;  2EBI A;  2MYS A;  2MBF A;  2KDO A;  3DP7 A;  4AUX A;  3GXO A;  2YX4 A;  2EWN A;  3DEW A;  3DPU A;  4P55 A;  3IRQ A;  3OSG A;  2VL8 A;  5CQE A;  3TO7 A;  2YX7 A;  2CMP A;  3M8E A;  2JWT A;  3D5L A;  4HX8 A;  3BCA A;  2QEN A;  3G1L A;  2LC2 A;  3I71 A;  3ABK H;  4NNJ A;  1KU3 A;  3P9C A;  3JRD A;  2PMU A;  4L9T A;  2K9Q A;  1XS9 A;  3FM5 A;  4MGR A;  1J9I A;  1MSE C;  2RVC A;  4JX4 A;  5K7H A;  4G8X A;  4MTE A;  4BH9 A;  1R49 A;  4A3L J;  4G6Q A;  3BR1 A;  3M07 A;  3OV8 A;  4CH7 A;  3TOA A;  1I1G A;  4KA4 A;  4MLO A;  2JN6 A;  2R4G A;  4BDY A;  2CUE A;  2WAQ A;  3G2B A;  3TKY A;  2LY2 A;  5IT9 Z;  1OQY A;  4G7H F;  2HEO A;  3C1D A;  2R7Z J;  2L9V A;  1A5J A;  1TQI A;  1ZRC A;  4PJJ A;  2K9S A;  1HW1 A;  2C6Y A;  3LA7 A;  1TTY A;  2DCE A;  3CJN A;  2CW7 A;  2IGN A;  2A5Y B;  2DTZ A;  2H27 A;  2LR8 A;  4Y3O A;  2DMU A;  5BNG A;  1VQO I;  1IN8 A;  2W85 A;  4CCL A;  2LLK A;  2IPQ X;  3BC8 A;  3NQO A;  1EA3 A;  3DQV C;  3DBR B;  4BE2 A;  3B6C A;  3CLQ A;  4BJ5 C;  1UJ8 A;  1EJ9 A;  2VJI A;  2P6T A;  4EM2 A;  1V3F A;  5LHG A;  2V9P A;  1IN4 A;  1SMY F;  3OOP A;  2CQN A;  1G3S A;  4AVZ A;  3FM3 A;  4IHV A;  2M0C A;  1U8R A;  2PBI A;  2HNH A;  3ABT A;  4B44 A;  3JSO A;  1TT5 B;  3PO2 J;  2FJ1 A;  1Z3X A;  4KN7 X;  3ZQG A;  3CMY A;  4ANJ A;  4M9X A;  1NTC A;  3TW7 A;  3W6K B;  2OTL I;  2X51 A;  2F4O B;  1G3W A;  2GLO A;  5H2F C;  1K4S A;  2VXZ A;  4LMY A;  2KIU A;  2H8W A;  2JPC A;  1G4D A;  2DBB A;  3WE2 A;  3J81 K;  3O8H A;  4KIS A;  2BBY A;  1ZN2 A;  2H6B A;  2ZJ2 A;  3F72 A;  5EGO A;  3L2W A;  2CQQ A;  3G4S I;  3GO5 A;  3V8K A;  5F0F A;  3OYI A;  2RDP A;  4ZH4 F;  3M4O J;  1JTX A;  3TBI A;  3JTG A;  3ZMU A;  3JW4 A;  3RQ4 A;  4II3 A;  4DGW B;  2K27 A;  2VXD A;  3HXL A;  2O9L A;  5D6F A;  1MMG A;  3L2V A;  1DU0 A;  3I55 I;  2GQQ A;  4G94 A;  3CO7 C;  1GV5 A;  2H6C A;  3OIO A;  3TGN A;  1VFC A;  3BJ6 A;  1V55 H;  1YE9 A;  4HRI A;  3E1S A;  3CDL A;  1S3J A;  1T38 A;  2EIJ H;  3O3K A;  3H35 A;  2P5K A;  3E97 A;  2FMY A;  1P7J A;  2E1N A;  5GP9 A;  1JJ6 C;  2JA8 J;  3C2H A;  5BQT A;  2NVT J;  3WGG A;  4NC8 A;  1ZRD A;  4B09 A;  1BI1 A;  3WG7 H;  1POG A;  4BAY A;  2L7M P;  2KIF A;  2F5V A;  1VQ9 I;  5JLW A;  2OZU A;  4BEH A;  4A69 C;  1BC7 C;  1OCO H;  5KCM A;  5IT3 A;  5EYR A;  1YO5 C;  3CJT B;  1J2X A;  3PNY A;  3ZRG A;  5LFA A;  3WE3 A;  5ICG A;  1YIO A;  4YG2 F;  5FD5 A;  3HEF A;  4DYR A;  2NS7 A;  4MFE A;  1Y8R B;  1W5S A;  3CP2 A;  4RAG A;  2ME0 A;  4C30 A;  3CJQ B;  5LEK A;  5LHI A;  3SFZ A;  4AU7 A;  2PQ8 A;  1D0Z A;  4HYE A;  1F9N A;  2LMD A;  4BHC A;  3BJA A;  5EGO B;  2EIN H;  4GFB A;  3LFU A;  3S2D J;  3GBG A;  3F6V A;  3N97 A;  4KIF A;  2BXZ A;  3MWM A;  1WVR A;  3LQR A;  1GXP A;  4NC7 A;  1WJD A;  2H1K A;  3CCY A;  2MH2 A;  3LL7 A;  4HPQ A;  2E5N A;  2BOL A;  2G0E A;  2BYV E;  3BTL A;  3COA C;  5D4S A;  5D5X B;  2X4H A;  4HQM A;  1P2F A;  5F08 A;  3S1R J;  2Q1Z B;  3H3U A;  1K7A A;  1OLT A;  2ZFW A;  3QYB A;  1E3H A;  1VQ5 I;  3KLN A;  1Z91 A;  3OS1 A;  1R6R A;  2PJR A;  1HKQ A;  3LFK A;  3OYF A;  4ZDP A;  4U0Y A;  4JP0 A;  3SZT A;  2CQK A;  2PFB A;  1SFU A;  1S8N A;  3T8T A;  5DS9 A;  5FJ8 J;  3QAH A;  4Q48 A;  1QZE A;  3T8R A;  5ICE A;  3DLL F;  1GV2 A;  4BY7 J;  4C2T A;  2MLG A;  3J7Z I;  2L0K A;  4BEH B;  1YLF A;  3LSK A;  2EFW A;  1RRJ A;  5F1R A;  4Q4Z F;  2DPU A;  1IUF A;  2DFH A;  2DOD A;  2NNN A;  4HX4 A;  1F43 A;  1QU3 A;  2PEX A;  1ON2 A;  3BG3 A;  3J7Y J;  1R36 A;  5JVG F;  2BY0 A;  4AYB N;  5HNF A;  3HOW J;  2MG4 A;  2Z3Y A;  4XRF A;  1QBJ A;  3H9Q A;  1KU2 A;  2X1E A;  2BVL A;  5KAF C;  2HQ5 A;  1MSF C;  1BM9 A;  3SXY A;  4ESJ A;  2VOD A;  2B63 J;  1L3L A;  4QLC U;  1ACI A;  1MDM B;  2WAD A;  1Y1W J;  2XB0 X;  4RLQ A;  2M34 A;  4I02 A;  2ELH A;  2ZSI B;  3KP4 A;  3GFL A;  5BPI A;  2V1D A;  3VFZ A;  1VTN C;  3CCU I;  3A01 A;  3DPL C;  2BHY A;  4HOB A;  3KX2 A;  3JRA A;  4B3A A;  4KUM A;  2O6G E;  2QWW A;  4IHX A;  2GZW A;  2D5V A;  1AA7 A;  3KET A;  4ZYH A;  1D1C A;  2E1M B;  4A0Z A;  2RQP A;  3EUK L;  3K2Z A;  4OIN F;  2RV8 A;  4BJT A;  5D8K B;  2VON A;  3A2K A;  3BZK A;  2Y0S N;  1O4X A;  2JVG A;  5HNH A;  2DDB A;  3ZMZ A;  1JUM A;  3CCS I;  2IS2 A;  1HXD A;  2P7C B;  5F27 A;  1PP8 F;  4AC0 A;  5JLX A;  1TNT A;  4M74 A;  4BS9 A;  1R58 A;  2HQN A;  4A0X A;  5M3M J;  3L7W A;  1BBY A;  2VC0 A;  1BJZ A;  4OU0 A;  3RI4 A;  2QQB A;  4I09 A;  1DDN A;  2VKE A;  5LGU A;  2ZME C;  3A0H C;  3LSG A;  1FP1 D;  4IHW A;  1RPW A;  3E7L A;  2K9M A;  4XLN F;  3WTZ A;  4XSZ F;  2FRH A;  1GXQ A;  3F23 A;  1TWA J;  4PK4 A;  1MIJ A;  5CVI A;  2DFF A;  3M1C A;  3HKZ A;  2NRA C;  1XB4 A;  5IYB J;  3V7R A;  1HC8 A;  3RPU D;  2ICW G;  3I9V 2;  3PQK A;  3MD2 A;  1U5T C;  5KK1 A;  3T0Y A;  1OFC X;  2A68 F;  5A2Q K;  1VND A;  2Y9Y A;  4EJU A;  5F1J A;  3KE2 A;  1G3Y A;  3FXK A;  5DCF A;  1HST A;  2NVY J;  1PUF B;  1X58 A;  1UEL B;  3VPR A;  1U9O A;  1R00 A;  3DEE A;  3A01 B;  3LSP A;  2M8G X;  3G1M A;  3WTU C;  2WC2 A;  1G8X A;  3BR3 A;  5DV5 A;  4U7B A;  2PMZ N;  2ZXW H;  5GPC A;  2R92 J;  3MMY B;  2J5O A;  4LK0 F;  1FPQ A;  1YJ9 I;  2HVS A;  4L0Z B;  1XSD A;  2COB A;  2IVM A;  3CCV I;  2KIQ A;  4LLN A;  2R7X A;  2ELK A;  3IWF A;  1DGW Y;  4MEX F;  4YEL A;  4G6D A;  1B9N A;  2CFO A;  2L9N A;  4S0H B;  1I3Q J;  1OIS A;  3TW6 A;  4HX7 A;  3BPX A;  5EZH A;  4CO8 A;  3ZQQ A;  4HSR A;  1GVJ A;  3M9A A;  1QA6 A;  5CVV A;  6PAX A;  3Q0U A;  1Z21 A;  2DQL A;  1QGP A;  5LRR A;  5ERI A;  5D4R A;  1P92 A;  3HRU A;  2TDX A;  1ZG5 A;  1ZYR F;  2EA2 A;  3IH4 A;  3GX4 X;  2FXA A;  2M0M A;  2ISY A;  2GAU A;  2XPW A;  3BR6 A;  1ZHF A;  3OL3 A;  2KHM A;  3QOP A;  4CCO A;  2VJ4 A;  1P4X A;  3GTQ J;  2HQA A;  3B73 A;  2DT5 A;  4Z2Y A;  4ZZL A;  2OQG A;  3C7J A;  3HOU J;  4CXF A;  2KJB A;  3FMQ A;  2OV7 A;  5GAD J;  1ERD A;  1WHU A;  2WY8 Q;  1P7I A;  2WY7 Q;  1J75 A;  2DYS H;  4HV5 A;  2V1X A;  3FWE A;  3RYR A;  2XPU A;  2R7V A;  1UAA A;  3WTT C;  3DEU A;  4KIB A;  4P9U A;  1S5L C;  2WA0 A;  4M71 A;  2R7T A;  2YS9 A;  3BPV A;  3PNV A;  1RET A;  3HOY J;  3HJE A;  2E71 A;  1JXS A;  4M9S A;  2XV4 S;  1STZ A;  5M5X J;  2JQ7 A;  4FCY A;  4Y7N J;  2FSW A;  5GAG J;  3T1B A;  4N9I A;  2ZME A;  1GT0 C;  1KQ0 A;  3TL4 X;  4FET A;  2DA4 A;  4PJN A;  2K5C A;  2TCT A;  3WU2 C;  3TDZ C;  5E3M A;  2KIS A;  2XAS A;  3DBL B;  1BOA A;  2M7A A;  3JAM Z;  3ZMS A;  2IBD A;  2WAF A;  1WJE A;  3FXM A;  1X4P A;  3J80 K;  2VBX A;  3FIS A;  3RJP A;  4OMZ A;  3MKY B;  3HDD A;  4I01 A;  1U5T A;  4MHG A;  2L54 A;  1KU9 A;  4EJO A;  3ZQF A;  5JI6 A;  4IXA A;  2OAZ A;  3HHH A;  2IP2 A;  4B4C A;  5E1W A;  5J4Y A;  1XGM A;  3C3W A;  4UVA A;  2R0Q C;  1TQP A;  3L1P A;  5LBQ A;  4JOM A;  3S17 J;  2HWV A;  2O3F A;  2Z99 A;  4L9V A;  4ESB A;  5K7Z A;  4RS8 A;  2QKL B;  2ZKZ A;  2L7K A;  4OAZ A;  2HYF A;  1BJA A;  3OMY A;  4KMU X;  5J1Y A;  1GLN A;  1ZRE A;  2E7W A;  2M4G A;  3G3Z A;  4QTR A;  3EPZ A;  2L2O A;  5HLI A;  5EZG A;  2WAE A;  4RAF A;  4XSX F;  2LBF A;  2VQL A;  2JTV A;  2Y30 A;  1D3Y A;  1T8I A;  2M9H A;  2IRF G;  1D5V A;  5EG0 A;  1IN5 A;  5TIS C;  1HKT A;  2XAH A;  4A3K J;  4BDZ A;  4P1W A;  1WJB A;  3V7S A;  1S29 A;  5F0H A;  3F8B A;  3H36 A;  1J0R A;  1XCV A;  2K9L A;  1YW8 A;  2OD5 A;  2FQ3 A;  2ZME B;  4MO7 A;  1VQ6 I;  1E0E A;  5DM7 F;  4M6X A;  2HYJ A;  3SEZ A;  5FD6 A;  3ABL H;  2A07 F;  1M1E B;  3FZV A;  1GVD A;  1OYW A;  3JRG A;  1LB2 A;  3CJR B;  3R4K A;  2F2E A;  3I5U A;  3U9G A;  4KN4 X;  3MZH A;  1YI2 I;  2E1C A;  1JJ8 C;  1FOY A;  1Y0N A;  3LNQ A;  1U5T B;  3OYE A;  4JBA A;  9ANT A;  1IXS B;  3MCZ A;  4XLF A;  1L0O C;  5E17 F;  1IV6 A;  1ZAR A;  1ODD A;  2XGX A;  2KZV A;  1SD6 A;  4QWQ A;  3LMM A;  2P81 A;  3AKZ A;  3ZQC A;  1IRX A;  3LSI A;  3K7A J;  3S2W A;  4QPQ A;  2BY3 A;  4L5I A;  5CJ9 A;  2YSR A;  5FKK A;  1KYZ A;  2IS4 A;  1VF9 A;  2F48 A;  1BIB A;  1TP4 A;  3CF5 F;  5EJC A;  1FMV A;  4BXX J;  1UB9 A;  1IW7 F;  4N4N B;  1RUO A;  1MMD A;  4DQ2 A;  1Z1D A;  1T08 B;  2LBF B;  3SZG A;  4I7H A;  4HST A;  4ZC3 A;  2BY1 A;  3OYL A;  1ETK A;  1MBJ A;  5EG0 B;  4AVP A;  4HNV A;  5BOX A;  2WTE A;  4BXF A;  2IGM A;  3PSF A;  2EFN A;  5DCM A;  4CCK A;  4XMY A;  2EFO A;  1R4N B;  2ACJ A;  2VKV A;  2RNG A;  3KIO A;  3K6G A;  2CV2 A;  2VIX A;  2A3S A;  2HOA A;  2X9D A;  5HLT A;  1LE8 A;  1MBE A;  1LDJ A;  1FEX A;  3HGY A;  1I6H J;  5TJJ A;  4EV0 A;  3Q3S A;  4L5J A;  4XLH A;  3FXL A;  3H92 A;  1ZR2 A;  1MJ9 A;  1WPK A;  3VYS B;  4RGS A;  4RGU A;  1JKP C;  4R79 A;  4RB1 A;  4MQV A;  5FLV A;  3DCF A;  1O3T A;  3BP8 A;  1NK2 P;  4YIF A;  3HG9 A;  3QU6 A;  3LSR A;  4ENN A;  2M4K A;  2DA3 A;  5L3F A;  1I6X A;  2OU2 A;  2AHQ A;  3HIF A;  2L5Q A;  4BL0 B;  4HLX A;  1BA5 A;  3FX3 A;  1HF0 A;  2E34 A;  1REP C;  2FNP A;  4D1Q A;  3RKY A;  1FBQ A;  2V7F A;  5H6R A;  1HOM A;  5DD8 A;  4O3M A;  2CUZ A;  3OSF A;  4Y33 A;  4IL6 C;  4AIJ A;  2A5W A;  4FE4 A;  3MEX A;  3P9K A;  3IAS 2;  4FQG A;  4GXO A;  2G9W A;  1ULY A;  4B3X A;  1IAW A;  1TW3 A;  2Q0O A;  2AO9 A;  4BGD A;  2CUF A;  1XSV A;  3E6M A;  1YJW I;  2VOO A;  1LNW A;  4WCG A;  3RZO J;  2FD5 A;  2W4S A;  4XRS A;  3DTE A;  1JT0 A;  1RIO H;  3ZPL A;  1ETW A;  3ZR8 X;  2W82 A;  1NH3 A;  4XRM A;  3QP5 A;  4GO1 A;  2M87 A;  1SMT A;  4B8X A;  4XLP F;  1GDT A;  2V79 A;  1LPQ A;  4U88 A;  1AKH A;  1YS7 A;  3HC7 A;  3I59 B;  4IQ4 A;  3ZP5 A;  1T0F A;  1LE8 B;  4L0Y B;  3SYT A;  3WU1 B;  4TV7 A;  1RNL A;  3Q9V A;  4IVN A;  3U21 A;  1O3R A;  1MBK A;  1SVM A;  1X1D A;  2P6S A;  1H9T A;  5FRO A;  4NUB A;  3ZMV A;  3K70 D;  2NVX J;  2R7S A;  1Z05 A;  2XAG A;  2AXT C;  2W57 A;  2CV1 A;  3BJO A;  1Z9C A;  4ENM A;  2JUG A;  4X1E A;  1SFX A;  2YU3 A;  1TL8 A;  2UXX A;  4M3F A;  2HQR A;  2QBY A;  4OOI A;  2JUC A;  3W2A A;  4CGZ A;  3PJR A;  1KU7 A;  3HRT A;  2Q2E A;  2E1M C;  3A4C A;  3TO9 A;  2KT0 A;  1W36 D;  1LKX A;  4KDP A;  1Y56 A;  1FY7 A;  1BR2 A;  3BZ6 A;  2KFD A;  5FKL A;  2DOE A;  4ZDL A;  1T98 A;  1Z3Y A;  2CU7 A;  2DI3 A;  5ILS A;  1MMN A;  2OA4 A;  3OYJ A;  1ETY A;  3MZY A;  3Q9S A;  1SAN A;  1YS6 A;  3C2B A;  3X2Q H;  3WTW C;  2XGE A;  3ECO A;  2X0L A;  3LOC A;  3PNT A;  3P9I A;  3S1Q J;  5ICC A;  2ME6 A;  4BKX A;  3UNG C;  4LJZ F;  5EEH A;  1PJR A;  2KPM A;  2QQA A;  1Q1V A;  3IUO A;  3QYF A;  4DBR A;  4AYB A;  2E19 A;  3BG7 A;  5CPR B;  1IC8 A;  3OYH A;  5LHH A;  2O8K A;  4LIU A;  3RDI A;  3QQA A;  4DW6 A;  3E6B A;  2E5Z A;  1AKH B;  3HZJ A;  3AG2 H;  5FO5 A;  3OIP A;  3GTK J;  2F6C A;  2LSO A;  4GYG A;  1H9G A;  5IPA A;  1MND A;  4HNT A;  4KMF A;  2VPR A;  3PIO F;  2W48 A;  5ILV A;  3IH2 A;  1TWG J;  3NAR A;  3GCM A;  1RI7 A;  1BR1 A;  1U78 A;  2DPD A;  3KP3 A;  3WHB A;  1W7P D;  1HBX G;  3KEQ A;  3AL0 B;  4KIC A;  3FMR A;  3WTV C;  2BXY A;  3W2V A;  2VAS A;  1VQN I;  3K69 A;  2WWY A;  3HOX J;  4FTH A;  4XBF A;  1YX3 A;  1B6A A;  2GIV A;  3BY6 A;  3QU3 A;  4OWR B;  1ZH5 A;  4EVI A;  1WRJ A;  1WCM J;  2Y0S A;  2ZSH B;  5J3L A;  4IRH A;  1KQ8 A;  3PSI A;  3S8P A; 
#chains in the Genus database with same CATH homology
 2K7L A;  4MNU A;  2DK5 A;  3HRS A;  2L4M A;  5F6F A;  4IRI A;  3HOT A;  5E18 F;  3K1N A;  4HF0 A;  2K4J A;  3EUH A;  5LGT A;  4HW0 A;  4RB3 C;  2EV0 A;  4UVC A;  3KEO A;  4EJT A;  5D6E A;  5DDG A;  1QZZ A;  1KA8 A;  1FZP B;  4KYW A;  1T39 A;  1WWX A;  5L3E A;  1LQ1 A;  2XRN A;  2A61 A;  1FYL A;  3F6O A;  4WX9 A;  3R61 A;  4ENK A;  5CLS A;  1WQ2 A;  1EH8 A;  1O3Q A;  1K78 A;  1FSH A;  2NYX A;  4R1H A;  3GFM A;  4EQQ A;  4M72 A;  5HS9 A;  1SD7 A;  3K9T A;  2MD5 A;  5K1Y A;  2LDU A;  1O7L A;  2MLK A;  1IXC A;  3L2C A;  3JTH A;  3ULQ B;  2PLY A;  4KNY A;  1MKM A;  2XAQ A;  1UCR A;  1SAX A;  1UHW A;  1FBU A;  2F5D A;  2Z5U A;  3KZY A;  4EJV A;  4OIO F;  1ZG1 A;  5LRS A;  3TOB A;  4IPA A;  2CFX A;  5ED4 A;  1BI0 A;  1PP7 U;  2FBK A;  4LLG F;  5TRD A;  3HYI A;  3DKW A;  4H0E A;  4O6J A;  2RNJ A;  4OIP F;  4UHT A;  3CUO A;  1P4A A;  4EM1 A;  4P9F A;  4RAZ A;  1K6O A;  4FX4 A;  2WV0 A;  3GLX A;  5H20 A;  1ZGJ A;  5E8G A;  3BRO A;  1HW2 A;  1LDK B;  1YW9 A;  2P4W A;  4DNC A;  2RKH A;  3J80 Z;  3ROU A;  4A12 A;  3IKV A;  3L9F A;  3I58 A;  1K78 B;  3BWG A;  1YQA A;  1R1T A;  4A6E A;  1JGS A;  1QQI A;  4YII A;  2DFI A;  2E7X A;  1XDU A;  1ZG3 A;  3K1P A;  3LAJ A;  3E3V A;  3MQ0 A;  3FXR A;  5BMZ A;  2NAZ A;  1YYV A;  1LVA A;  1J59 A;  3WTY C;  3FHZ A;  1OYY A;  5CVU A;  1WI9 A;  3RPU A;  1YTY A;  5HDK A;  2Y48 A;  1MD0 A;  1FWZ A;  3ZN1 A;  3M1E A;  5JR3 A;  3I4P A;  2EV5 A;  3R6S A;  2ZNZ A;  3IHU A;  1R1V A;  1H0M A;  3LQQ A;  4RAY A;  2IT0 A;  3IRR A;  4N9H A;  1SD4 A;  3GZ6 A;  3LAP A;  1YFH A;  3HUG A;  1SFE A;  4HF2 A;  1WKM A;  1QO0 D;  3IKT A;  1IRF A;  3ZN0 A;  1ZRF A;  4FHT A;  4AWX B;  1HW5 A;  1FP2 A;  3K0L A;  1MZB A;  2QM3 A;  4A5N A;  3E6C C;  1J7K A;  4YFX F;  2L01 A;  1DPU A;  2ETH A;  3E5Q A;  2ZXJ A;  2F5C A;  3F8C A;  2M30 A;  1Z7U A;  1EH6 A;  1XGS A;  4NQW A;  4IJA A;  2HZT A;  4M73 A;  5FLX K;  1IN6 A;  3GZ5 A;  3VOE A;  3WGH A;  3ISP A;  1KQ9 A;  2XAJ A;  2H09 A;  2UWM A;  4S05 A;  3E5X A;  1RUN A;  2HKX A;  2VBW A;  2Z9O A;  2ESN A;  2LNB A;  3HRM A;  4E70 A;  4BYY A;  3CO6 C;  4LB6 B;  1V4R A;  2DK8 A;  5ILU A;  2HTJ A;  2VC1 A;  3V4G A;  4Y17 A;  5E20 A;  5DEQ A;  5HDN A;  2XHK A;  2QYO A;  3V7C A;  2VE8 A;  2F5E A;  3GEZ A;  2HTS A;  3KLO A;  4GCV A;  2FA5 A;  4PGG A;  2IA2 A;  4A0Y A;  5JFR A;  4ETS A;  1SD5 A;  2VT2 A;  3RKX A;  3ML6 A;  1UHM A;  3VEP A;  2EV6 A;  1CGP A;  2CW0 F;  3WGI A;  1ZGA A;  1K79 A;  3HSR A;  1TBX A;  4A2U A;  4F7Z A;  1FOK A;  1O7F A;  3Q5F A;  2EFQ A;  4LB5 A;  4PGH A;  2JPB A;  1MGT A;  4L9J A;  2ZO4 A;  4MEY F;  2AS5 F;  1G3T A;  4HF1 A;  3H3Z A;  5LGN A;  3IL2 A;  2B0L A;  4CHU A;  1B4A A;  1RZ4 A;  2FE3 A;  2PJP A;  4UVB A;  3GFJ A;  3TO6 A;  3TDU C;  5HS7 A;  1IN7 A;  4YFN F;  2DU9 A;  4IHT A;  2XUB A;  4ZYE A;  4WK8 F;  3ELK A;  4PDK A;  4ESF A;  1IF1 A;  3EQL F;  1FYM A;  2VOP A;  2NNY A;  2RC4 A;  3J81 Z;  1I27 A;  5L3D A;  3NRV A;  1OR7 A;  4OIQ F;  2CO5 A;  4NHJ A;  1ONV A;  1XN7 A;  4LG0 A;  1FYK A;  3DV8 A;  1P4W A;  4HAM A;  3CDH A;  2FOK A;  1TLH B;  2HGC A;  2IA1 A;  2D45 A;  4I0B A;  4HDV A;  1G6N A;  4P96 A;  5BS6 A;  2LF8 A;  3GWZ A;  5HDG A;  2M1B A;  3QP6 A;  3EDP A;  4HLY A;  4GGG A;  1O3S A;  4UV8 A;  4HZF A;  4BHP A;  2EJR A;  3LA2 A;  3ZMT A;  1BIA A;  1J5Y A;  3WOD F;  1FT9 A;  1S7A A;  5KVR A;  1Z6R A;  3F8F A;  1MJB A;  4IRH A;  2Q8K A;  2STW A;  1A04 A;  5DUK A;  1D8J A;  2R3S A;  2K02 A;  5D5W B;  5JHU A;  2OQR A;  4A6D A;  2K4B A;  5LEJ A;  3RKW A;  1T2K A;  4LG0 B;  4MTD A;  2O61 A;  4I98 B;  1LDD A;  4S04 A;  1FX7 A;  3LA3 A;  3GFI A;  5H6Q A;  1QNT A;  4ON0 A;  1U3E M;  1KYW A;  3R0A A;  3REO A;  1D8K A;  5DCM B;  1JE8 A;  2NS0 A;  3MFK A;  3BDD A;  3RIR A;  4KT5 C;  2O0Y A;  5FGM A;  4M6Y A;  2DQR A;  1XSX A;  2GXB A;  1EV7 A;  3QRF F;  2XKO A;  4OMY A;  4LD5 A;  4HDU A;  4PZJ A;  3E6D A;  2D1V A;  5K5O A;  4M9Z A;  3F22 A;  2CG4 A;  3I53 A;  3KP5 A;  3K1M A;  5L3B A;  2YPR A;  2HKO A;  2V6C A;  1FLI A;  2F5F A;  2PMH A;  3KP2 A;  5EEG A;  4A5M A;  1FBS A;  3MAJ A;  3QPT A;  3KZZ A;  1U6G A;  2M45 A;  3J7A O;  2RN7 A;  1FSE A;  5DD4 A;  1IZ1 A;  1QPM A;  4ZYG A;  4R8H A;  3RYP A;  4YFK F;  1DPR A;  3DFG A;  2UZK A;  1ZLK A;  4Q47 A;  1USS A;  2BE5 F;  5L3C A;  3U1D A;  3HTU A;  3CUQ A;  4BHB A;  1S7O A;  2D1H A;  1W7P A;  1F1Z A;  2JT1 A;  1CF7 A;  4UV9 A;  3HSF A;  4CIC A;  5CYV A;  3KCC A;  3ABU A;  3L00 A;  4EJW A;  2L02 A;  2ZCW A;  5K5R A;  3V8J A;  5E1X A;  2IW5 A;  2PI0 A;  1I1S A;  3FMS A;  1R23 A;  3EYI A;  2QBY B;  1AOY A;  5BPD A;  2HDC A;  2HR3 A;  5D5U B;  4AD9 A;  1EH7 A;  2VT3 A;  2EB7 A;  3VB2 A;  4U0V A;  4FX0 A;  5FFZ A;  3SHF A;  5E8I A;  1DP7 P;  1UST A;  3E5U A;  4L18 B;  4AIH A;  3L09 A;  2DW4 A;  4UUV A;  4U7D A;  1S6L A;  2CWE A;  3LST A;  4JK1 X;  3BOQ A;  3C18 A;  2CYY A;  5J8C A;  2ZBK A;  5J8F A;  4WWC A;  1R22 A;  5CVJ A;  2Z33 A;  1TQM A;  5DYM A;  3GUD A;  3CUQ B;  2J5P A;  1W7P B;  2K86 A;  2XVC A;  3B02 A;  1CF7 B;  4JQF A;  3AAF A;  2XAF A;  2G7H A;  2CGP A;  1MDM A;  1OYI A;  3GVA A;  2FU4 A;  5FLX Z;  3G73 A;  1TW2 A;  1XCB A;  4HBL A;  4Q5S F;  4RGR A;  2A6E F;  1XGO A;  4G7O F;  4WXH A;  5LLQ A;  4HQE A;  1ZLJ A;  3GF2 A;  1HSJ A;  2V9V A;  4FT8 A;  2D2W A;  3DF8 A;  2P5V A;  3ECH A;  4LLL A;  1IXR C;  1XGN A;  1LEB A;  3KP6 A;  3HTS B;  5L3G A;  1IUY A;  2IJL A;  1YW7 A;  2W84 A;  2KKO A;  3SZP A;  5IT9 K;  5AIQ A;  1IRG A;  1BI3 A;  2AXL A;  2KIM A;  4PCQ A;  1OMI A;  4IF4 A;  2LF7 A;  2P8T A;  1R5H A;  3WG9 A;  4D0P A;  4KIG A;  3PFI A;  2L3D A;  2XIG A;  2CSO A;  1FNN A;  4MQ9 F;  1FC3 A;  3U2R A;  1F5T A;  1HQC A;  5HS8 A;  3TQN A;  3KP7 A;  5DUI A;  4NB5 A;  4O5V A;  3VOD A;  2MC3 A;  5HLH A;  4N0B A;  2QLZ A;  1DUX C;  3CTA A;  2QQ9 A;  2VBZ A;  1TNS A;  2Y75 A;  3O2P E;  3O6B B;  2HYG D;  2QUF A;  1Z6T A;  4ENJ A;  4WF2 A;  3NEU A;  3QPH A;  2W24 A;  4CYD A;  3ERE D;  3LWF A;  2ESH A;  4LGW A;  5D5V B;  5E1Z B;  1R7J A;  2GA2 A;  1MJA A;  5CVR A;  2PN6 A;  2GWR A;  3M7G A;  1B1B A;  2FML A;  4RB0 A;  1W4M A;  3DPT A;  4K2E A;  5HOO A;  2HOE A;  2MH9 A;  4U0W A;  4CDG A;  1ON1 A;  2RGV A;  2KRF A;  2VE9 A;  2BV6 A;  3IWZ A;  3F8M A;  3SQN A;  1KGS A;  2YR2 A;  2O8X A;  4RB2 C;  5AON A;  1E17 A;  3GYH X;  1W5T A;  5J6X A;  2HFH A;  2BEO A;  3JSP A;  1WSU A;  4LK1 F;  1QZY A;  5HVQ C;  2V1U A;  2M5W A;  3R0J A;  3W6J B;  4G7Z F;  3FXQ A;  1XMA A;  4IRG A;  4Y15 A;  1NHA A;  3KFW X;  2M8E A;  3EET A;  1OPC A;  2LKP A;  3V8L A;  1R5G A;  3D0S A;  2VBY A;  2DLL A;  4EGZ A;  5AIP A;  1ZAO A;  2ISZ A;  2R7D A;  4UXN A;  1BI2 A;  2G7U A;  1LJ9 A;  2KJC A;  2ZNY A;  2QZ8 A;  2XKP A;  3I0T A;  2P7V B;  4WXD A;  4WXC A;  2L4A A;  1GHC A;  3FXU A;  2VN2 A;  1AWC A;  2HS5 A;  3HOS A;  3R60 A;  3RPQ A;  3F8N A;  1E2X A;  1BN5 A;  4CZZ A;  2FEZ A;  2DTR A;  2GA1 A;  1UFM A;  1U2W A;  2XRO A;  4G9Y A;  1P6R A;  2W25 A;  4KFC A;  2FNA A;  2O03 A;  4EM0 B;  4LFU A;  3N4M A;  4P5O A;  4I0A A;  3F3X A;  5ICF A;  2FF4 A;  2R7F A;  2DO7 A;  2PG4 A;  5JVT A;  4Y13 A;  5F64 A;  3HSE A;  3M8F A;  1YG2 A;  4EMS A;  2OZ6 A;  3IC7 A;  2UXN A;  2Y0M A;  4OIR F;  3HHG A;  1F4K A;  1PUE E;  1JHH A;  1XD7 A;  2GXG A;  2COM A;  1T6S A;  2A6H F;  2FBH A;  1Y0U A;  3WTS C;  4AIK A;  1XMK A;  4IHS A;  1JHF A;  3F21 A;  2ADU A;  1OKR A;  1XDS A;  4RGX A;  1I5Z A;  3WTX C;  1B9M A;  4L9N A;  3EYY A;  4BQA A;  2JRT A;  1C0W A;  3DXJ F;  4ZZD A;  3FF5 A;  1LEA A;  4ZYD A;  4HA8 A;  2H94 A;  4ASN A;  3CLO A;  2EFP A;  2FBI A;  2QVO A;  1BC8 C;  3T5X A;  5K5Q A;  2A69 F;  1HKS A;  5HLG A;  3I54 A;  1PDN C;  3GW2 A;  2P5L C;  4UNO A;  2EA4 A;  2BGC A;  1B59 A;  3CUQ C;  1Q1H A;  3I59 A;  4EGY A;  4HV6 A;  3ZMD A;  3I64 A;  1R1U A;  5FFX A;  4BNC A;  3PQJ A;  3WU0 A;  4GYI A;  5D8L B;  2JZY A;  4I2O A;  2JSC A;  2EK5 A;  2OBP A;  1X3U A;  3P7N A;  5FB2 A;  3ZQ7 A;  1O57 A;  2DAO A;  4BXU A;  2IA0 A;  3JAM K;  3RTR A;  2MA3 A;  2MBF A;  3DP7 A;  3GXO A;  2YX4 A;  2EWN A;  4P55 A;  3IRQ A;  3TO7 A;  2YX7 A;  3M8E A;  4HX8 A;  3D5L A;  2QEN A;  3I71 A;  1KU3 A;  3P9C A;  2PMU A;  4L9T A;  3FM5 A;  4MGR A;  1J9I A;  2RVC A;  4G8X A;  4MTE A;  4BH9 A;  4G6Q A;  3OV8 A;  3TOA A;  1I1G A;  4KA4 A;  3TKY A;  5IT9 Z;  4G7H F;  2HEO A;  3C1D A;  1TQI A;  1ZRC A;  1HW1 A;  2C6Y A;  3LA7 A;  1TTY A;  3CJN A;  2A5Y B;  2H27 A;  1IN8 A;  2W85 A;  2IPQ X;  3NQO A;  3DQV C;  2P6T A;  4EM2 A;  1V3F A;  5LHG A;  1IN4 A;  1SMY F;  3OOP A;  1G3S A;  3FM3 A;  1U8R A;  2PBI A;  3ABT A;  3JSO A;  4KN7 X;  4M9X A;  3W6K B;  1G3W A;  2VXZ A;  4LMY A;  2KIU A;  2JPC A;  1G4D A;  2DBB A;  3WE2 A;  3J81 K;  2BBY A;  1ZN2 A;  2H6B A;  2ZJ2 A;  3F72 A;  3GO5 A;  3V8K A;  2RDP A;  4ZH4 F;  3JTG A;  3ZMU A;  3JW4 A;  2K27 A;  5D6F A;  2GQQ A;  4G94 A;  3CO7 C;  2H6C A;  3TGN A;  3BJ6 A;  1S3J A;  1T38 A;  3O3K A;  2P5K A;  3E97 A;  2FMY A;  2E1N A;  5BQT A;  3WGG A;  1ZRD A;  4B09 A;  1BI1 A;  4BAY A;  2KIF A;  2OZU A;  1BC7 C;  5IT3 A;  1YO5 C;  1J2X A;  3WE3 A;  5ICG A;  1YIO A;  4YG2 F;  5FD5 A;  1W5S A;  5LEK A;  5LHI A;  3SFZ A;  2PQ8 A;  4HYE A;  4BHC A;  1F9N A;  3BJA A;  3F6V A;  3N97 A;  4KIF A;  3MWM A;  3LQR A;  1GXP A;  2MH2 A;  2BYV E;  3COA C;  5D4S A;  5D5X B;  2X4H A;  4HQM A;  1P2F A;  3H3U A;  1K7A A;  2ZFW A;  3KLN A;  1Z91 A;  1HKQ A;  3LFK A;  4U0Y A;  3SZT A;  2CQK A;  2PFB A;  1SFU A;  1S8N A;  3T8T A;  3QAH A;  4Q48 A;  3T8R A;  5ICE A;  2MLG A;  1YLF A;  2EFW A;  5F1R A;  4Q4Z F;  2DPU A;  2NNN A;  4HX4 A;  2PEX A;  1ON2 A;  1R36 A;  2Z3Y A;  4XRF A;  1QBJ A;  1KU2 A;  1BM9 A;  3SXY A;  4ESJ A;  2VOD A;  1L3L A;  4QLC U;  1MDM B;  4I02 A;  2ELH A;  3KP4 A;  3GFL A;  5BPI A;  2V1D A;  3VFZ A;  1VTN C;  3DPL C;  4HOB A;  4KUM A;  2O6G E;  2QWW A;  2GZW A;  3KET A;  4ZYH A;  4A0Z A;  2RQP A;  3K2Z A;  4OIN F;  2RV8 A;  5D8K B;  2VON A;  3ZMZ A;  1HXD A;  2P7C B;  1PP8 F;  1TNT A;  4M74 A;  1R58 A;  2HQN A;  4A0X A;  3L7W A;  1BBY A;  2VC0 A;  4OU0 A;  3RI4 A;  2QQB A;  4I09 A;  1DDN A;  5LGU A;  1FP1 D;  4XLN F;  3WTZ A;  4XSZ F;  2FRH A;  1GXQ A;  3F23 A;  5CVI A;  2NRA C;  1XB4 A;  3V7R A;  5KK1 A;  3PQK A;  1U5T C;  3T0Y A;  2A68 F;  5A2Q K;  4EJU A;  3KE2 A;  1G3Y A;  5DCF A;  1HST A;  1R00 A;  3WTU C;  2WC2 A;  5DV5 A;  4U7B A;  2J5O A;  4LK0 F;  1FPQ A;  4L0Z B;  1XSD A;  2IVM A;  4LLN A;  3IWF A;  4MEX F;  4G6D A;  1B9N A;  4HX7 A;  3BPX A;  4CO8 A;  1GVJ A;  3M9A A;  5CVV A;  6PAX A;  2DQL A;  1QGP A;  5LRR A;  5ERI A;  5D4R A;  1P92 A;  3HRU A;  2TDX A;  1ZG5 A;  1ZYR F;  2EA2 A;  3GX4 X;  2FXA A;  2ISY A;  2GAU A;  1ZHF A;  3QOP A;  1P4X A;  4ZZL A;  3B73 A;  2DT5 A;  4Z2Y A;  2OQG A;  3C7J A;  4CXF A;  2KJB A;  3FMQ A;  1J75 A;  4HV5 A;  2V1X A;  3FWE A;  3RYR A;  3WTT C;  3DEU A;  4KIB A;  4P9U A;  4M71 A;  3BPV A;  1JXS A;  4M9S A;  2XV4 S;  1STZ A;  2FSW A;  3T1B A;  4N9I A;  2ZME A;  1KQ0 A;  3TDZ C;  2XAS A;  1BOA A;  3JAM Z;  3ZMS A;  3J80 K;  2VBX A;  3RJP A;  4OMZ A;  4I01 A;  1U5T A;  4MHG A;  2L54 A;  1KU9 A;  4EJO A;  5JI6 A;  4IXA A;  2OAZ A;  3HHH A;  2IP2 A;  5E1W A;  1XGM A;  3C3W A;  4UVA A;  1TQP A;  5LBQ A;  2HWV A;  2O3F A;  2Z99 A;  4L9V A;  4ESB A;  4RS8 A;  2ZKZ A;  2HYF A;  1BJA A;  4KMU X;  1ZRE A;  2E7W A;  3G3Z A;  5HLI A;  4XSX F;  2JTV A;  1D3Y A;  2IRF G;  1D5V A;  1IN5 A;  1HKT A;  2XAH A;  3V7S A;  1S29 A;  3F8B A;  1J0R A;  1XCV A;  1YW8 A;  2OD5 A;  2FQ3 A;  2ZME B;  4M6X A;  5FD6 A;  2A07 F;  3FZV A;  1OYW A;  1LB2 A;  3R4K A;  2F2E A;  3I5U A;  3U9G A;  4KN4 X;  3MZH A;  2E1C A;  1U5T B;  4JBA A;  1IXS B;  3MCZ A;  1L0O C;  5E17 F;  1ZAR A;  1ODD A;  2XGX A;  1SD6 A;  4QWQ A;  3S2W A;  5CJ9 A;  4L5I A;  2YSR A;  1KYZ A;  1BIB A;  1UB9 A;  1IW7 F;  1RUO A;  4DQ2 A;  1Z1D A;  4I7H A;  4AVP A;  5BOX A;  2WTE A;  2EFN A;  5DCM A;  2EFO A;  2ACJ A;  2A3S A;  1LDJ A;  5TJJ A;  4EV0 A;  4L5J A;  3H92 A;  1MJ9 A;  4RGS A;  4RGU A;  4R79 A;  4RB1 A;  4MQV A;  1O3T A;  3BP8 A;  4YIF A;  3QU6 A;  4ENN A;  5L3F A;  1I6X A;  2OU2 A;  3HIF A;  4HLX A;  3FX3 A;  1REP C;  2FNP A;  3RKY A;  1FBQ A;  5H6R A;  5DD8 A;  4O3M A;  4AIJ A;  3MEX A;  3P9K A;  4GXO A;  2G9W A;  1ULY A;  1IAW A;  1TW3 A;  2Q0O A;  1XSV A;  3E6M A;  2VOO A;  1LNW A;  4WCG A;  1RIO H;  3ZPL A;  3QP5 A;  4GO1 A;  2M87 A;  1SMT A;  4B8X A;  4XLP F;  2V79 A;  4U88 A;  1YS7 A;  3I59 B;  3ZP5 A;  1T0F A;  4L0Y B;  3WU1 B;  4TV7 A;  1RNL A;  3Q9V A;  4IVN A;  1O3R A;  2P6S A;  1H9T A;  3ZMV A;  1Z05 A;  2XAG A;  2W57 A;  3BJO A;  1Z9C A;  4ENM A;  1SFX A;  2YU3 A;  4CGZ A;  2UXX A;  2QBY A;  2HQR A;  4OOI A;  1KU7 A;  3HRT A;  2Q2E A;  3TO9 A;  4KDP A;  1FY7 A;  3BZ6 A;  1T98 A;  2DI3 A;  5ILS A;  2OA4 A;  3MZY A;  3Q9S A;  1YS6 A;  3WTW C;  3ECO A;  2X0L A;  3P9I A;  5ICC A;  4LJZ F;  5EEH A;  2QQA A;  5LHH A;  3RDI A;  3E6B A;  5FO5 A;  2LSO A;  4GYG A;  1H9G A;  4KMF A;  5ILV A;  1RI7 A;  1U78 A;  2DPD A;  3KP3 A;  1HBX G;  1W7P D;  3KEQ A;  4KIC A;  3FMR A;  3WTV C;  3K69 A;  2WWY A;  4XBF A;  1B6A A;  2GIV A;  3BY6 A;  3QU3 A;  1ZH5 A;  4EVI A;  1WRJ A;  5A2Q Z;  1KQ8 A;  2STT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...