1PUEE

Pu.1 ets domain-dna complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
88
structure length
88
Chain Sequence
KIRLYQFLLDLLRSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKGNRKKMTYEKMARALRNYGKTGEVKKVKKKLTYQFSGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A new pattern for helix-turn-helix recognition revealed by the PU.1 ETS-domain-DNA complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*AP*AP*AP*AP*AP*GP*GP*GP*GP*AP*AP*GP*TP*GP*GP*G)-3
total genus 22
structure length 88
sequence length 88
chains with identical sequence F
ec nomenclature
pdb deposition date 1996-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1pueE00
1O3TA 2M87A 1G3WA 4JBAA 2XAHA 5LRSA 2XROA 4CGZA 1TQMA 1ZREA 1IUYA 2YU3A 3RJPA 1BM9A 2DT5A 3WG9A 5D5WB 3M7GA 3TOBA 4NB5A 2LDUA 1QPMA 2W85A 3E97A 3D0SA 4Y17A 1XMKA 3WTYC 4G7HF 2A07F 4YIFA 5KK1A 1JHFA 2MC3A 2EFPA 4BAYA 3ZPLA 5L3EA 2KJBA 2BGCA 2ZBKA 4MEYF 1D8JA 3KETA 4EV0A 3OOPA 2K4BA 2O0YA 2Q0OA 4AVPA 2EA2A 2COMA 3U2RA 1WKMA 1BIAA 5DD8A 4MEXF 5K5QA 2GZWA 3JTHA 3TDZC 5DCFA 2AXLA 2CO5A 1MKMA 2GQQA 5ILUA 3WU1B 2BBYA 1LEBA 3K1PA 1Z1DA 1SD4A 3GZ6A 3EYIA 2V6CA 5D5UB 1FYLA 2ELHA 3Q9VA 5FLXZ 3EETA 1FBQA 4HQEA 4OIRF 1W4MA 4BH9A 2ZMEA 4L9VA 3ECHA 4L5JA 2BYVE 3P9IA 5LBQA 4LFUA 2E7XA 3RIRA 4KA4A 2Y48A 1QO0D 5E17F 3J7AO 2Z3YA 2H94A 5D4SA 4EVIA 3HHGA 1ZYRF 2V1UA 5E1XA 3L2CA 4O6JA 1P2FA 5H20A 4KIFA 3ABTA 2CG4A 2R7FA 2R7DA 2Y0MA 2VBWA 1AWCA 1ZGJA 5L3GA 3GFJA 3ELKA 5DEQA 1U5TB 4Y13A 2PFBA 5HVQC 3I54A 4MTDA 2QBYA 4CXFA 2A3SA 2FA5A 5JHUA 2M8EA 1Z7UA 4ZH4F 4UUVA 4Q5SF 4S05A 1QGPA 4WX9A 2VE8A 4TV7A 4OOIA 3EDPA 2YSRA 3FHZA 4KFCA 3SZTA 2PN6A 1QZZA 3D5LA 3BPVA 1KGSA 1DPRA 2VOPA 3AAFA 1Y0UA 3ZQ7A 4OIQF 2EFNA 2JSCA 2ZO4A 2BE5F 2IA0A 1FOKA 2O03A 4LK1F 3SZPA 2HGCA 2DK5A 3K0LA 4A0YA 1J2XA 2ZNYA 1XCBA 1LDDA 1IZ1A 3IRQA 2DPUA 1G6NA 3WGHA 4Q47A 4OMZA 4B09A 3KP7A 4ZYHA 2EV6A 3QRFF 3HOSA 4KYWA 5BMZA 5LRRA 4LG0A 3CUOA 2PEXA 2HKXA 4IRIA 4EJOA 2IT0A 3EUHA 4GO1A 2GIVA 2OZUA 4LMYA 5E1WA 3KLNA 1A04A 2FXAA 1KU9A 3KEOA 2DI3A 4M6YA 3TDUC 2ZCWA 1TQIA 3JTGA 2RDPA 3RKXA 3FMSA 2MH2A 5K1YA 3V8KA 1TLHB 4KICA 4HX7A 2XIGA 5HDNA 1K79A 2P8TA 5FFXA 2E1NA 2KJCA 1J7KA 1YQAA 4M71A 5DCMB 1SMTA 3DFGA 4UVCA 1BN5A 3FXUA 4U0YA 4EJWA 1ZRFA 4A12A 1E2XA 3ZMSA 2M1BA 3V7SA 1IN5A 3DXJF 4BHPA 1OPCA 3F8BA 1Z05A 4D0PA 4ZZLA 5ERIA 1H0MA 1J75A 3HRTA 3E6MA 3HOTA 1XGSA 2V1DA 5HLHA 1BOAA 2XUBA 1I1SA 5HOOA 4HLXA 4ENKA 2LNBA 2CQKA 4AIHA 3BOQA 1DUXC 4YFKF 5A2QK 1BIBA 1XDUA 3FM3A 4HQMA 3T8TA 5D5XB 2H6CA 4ASNA 1R22A 3CTAA 2XHKA 3ROUA 1E17A 1BI1A 5L3FA 2XVCA 1LQ1A 1I6XA 3KEQA 4HAMA 1MJAA 2PJPA 2E1CA 2UWMA 1IRGA 3HSFA 5K5RA 2KIUA 2VBZA 5HLIA 2V1XA 2LSOA 1WSUA 3HYIA 2M5WA 3WE2A 1XGNA 4M9ZA 4XSZF 2LKPA 2J5OA 4RB3C 2DW4A 1HXDA 1SFEA 3K1MA 5HLGA 1DPUA 4PZJA 2UXXA 1YFHA 1C0WA 4LK0F 5H6RA 4OIOF 5CVRA 2Z9OA 1HKQA 2KIFA 4JQFA 4XRFA 3L09A 3TO9A 2NRAC 4CO8A 1IXRC 1KYZA 4LB5A 3WE3A 5FFZA 1LDJA 5FO5A 1FWZA 2L02A 3WTTC 3GFIA 2VT2A 3ZP5A 2GXGA 4L9JA 2WTEA 3FXRA 1EH8A 2NS0A 4R79A 3REOA 3DF8A 4KUMA 1QQIA 2XV4S 3RPUA 3BY6A 4FHTA 4PDKA 2F5FA 3VOEA 2GA2A 5DUKA 3U9GA 3B02A 2QBYB 1ONVA 3LQQA 3P7NA 2RGVA 3HIFA 3ULQB 5BOXA 2CGPA 6PAXA 3DPTA 4B8XA 5HDGA 5ICCA 5A2QZ 1VTNC 2IJLA 1P4XA 2FBIA 1J9IA 3RKYA 2ZFWA 2DU9A 2STTA 1U78A 3HHHA 2NAZA 3LA2A 1XSVA 1U5TA 5LGNA 2PLYA 2H09A 2XKOA 2ADUA 3JSOA 5LEKA 3F72A 3GEZA 1W7PB 3EQLF 3JAMZ 1B1BA 5ILVA 1P92A 1OYYA 2FE3A 1JE8A 4IHSA 4ZYGA 3CDHA 1G3TA 5ILSA 2F2EA 2WC2A 1SD7A 1MDMA 4MQ9F 2FEZA 1YYVA 4HX8A 3G3ZA 3H92A 2XASA 2HZTA 1DDNA 1S6LA 1FSHA 2JPCA 1TNTA 5FB2A 2VE9A 2L4AA 2P7CB 2DAOA 1KU2A 4S04A 5LEJA 4U7DA 4Q4ZF 4KMUX 1IN8A 1I1GA 4CYDA 3CUQC 3ZN1A 3MEXA 2HYFA 3SFZA 1IRFA 3FXQA 3E3VA 2P5KA 3FWEA 3IWZA 3K9TA 2IW5A 3J80K 2HDCA 3BPXA 4HOBA 3ZMVA 2GAUA 1BJAA 2Y75A 1BI2A 3HRUA 1F4KA 4YFXF 3CJNA 2HEOA 3E5UA 4WCGA 2C6YA 4HLYA 2Z5UA 1FP1D 1OR7A 2YPRA 3F3XA 3DV8A 4LLLA 3WTUC 2VXZA 4LGWA 2ZNZA 1CF7A 1S7AA 2H27A 2F5DA 5TJJA 1FZPB 4BYYA 1JGSA 1CF7B 1HKTA 2DLLA 3C3WA 1ZRCA 3R0JA 2VODA 3R60A 3G73A 2CSOA 3BJAA 1GXQA 1KQ8A 2HWVA 4E70A 2L01A 1G4DA 1P6RA 4DQ2A 1O7LA 4ESFA 4LLNA 1TBXA 4XLNF 3I71A 4LG0B 3GYHX 1KQ0A 1S29A 2IVMA 4L9TA 1D3YA 4Z2YA 4EGYA 2JT1A 1ULYA 2FQ3A 3ZMZA 4U7BA 1G3YA 1MD0A 3TOAA 3J81K 2PI0A 4O5VA 3V8JA 1ZLJA 1USSA 2CWEA 1MJ9A 4QLCU 2ESHA 1SD5A 1T39A 5DUIA 4XSXF 2RV8A 2P6SA 2K27A 2UXNA 5D6EA 2HTSA 1FBSA 2K86A 4L5IA 3KLOA 3MAJA 3ABUA 1XSDA 2NNYA 2K02A 3SXYA 1XN7A 1GXPA 3R6SA 3HUGA 4G9YA 3HSEA 2W24A 2H6BA 4P55A 2V9VA 3ISPA 3T8RA 2M30A 1WI9A 2VOOA 4K2EA 4I98B 2EWNA 4WXHA 2ETHA 1S7OA 1XGMA 1I27A 2W84A 5IT3A 2WWYA 5CJ9A 4GYGA 2D45A 2NNNA 1MDMB 2XAGA 4QWQA 2UZKA 4ESJA 3PFIA 3K2ZA 3SQNA 3QU6A 1U3EM 1O3RA 2P7VB 4KIBA 3FMQA 4BXUA 4PGHA 2KKOA 4CICA 3TO6A 2EV0A 2DFIA 1J0RA 4EM2A 3IKVA 1BC7C 2P6TA 1FPQA 2PBIA 3F8CA 1WRJA 3BJOA 3JAMK 4RGSA 1QNTA 2A6HF 4P5OA 1O57A 4A0ZA 1YW7A 3GF2A 5HS8A 4PGGA 1BC8C 1PP7U 4GXOA 5HDKA 1FLIA 1B9NA 3C1DA 4N0BA 4O3MA 3SHFA 1YW9A 2HYGD 3DKWA 2Q8KA 1Z6TA 2RC4A 2XAJA 1IN4A 3QP5A 2PG4A 5LGTA 1R1TA 3KZYA 3V7CA 3K69A 3ZMUA 2XGXA 4M9SA 2EK5A 3R61A 2NYXA 3VODA 3HRMA 1Z9CA 4RB1A 4IRGA 3KP6A 5J6XA 2MH9A 5LGUA 1DP7P 3IHUA 5CLSA 2VONA 2EFWA 1T98A 5ICFA 1U8RA 2XKPA 3VEPA 3V7RA 3HTSB 4H0EA 4I2OA 3KFWX 3GLXA 2QUFA 2QM3A 3F6OA 1ZH5A 3GVAA 1S3JA 3GW2A 4OU0A 4BHCA 5E8IA 1RNLA 1KA8A 3ML6A 3T1BA 3T0YA 2OD5A 1WWXA 2BV6A 2OQGA 1YG2A 4ZZDA 3NRVA 1EV7A 2FU4A 2ZJ2A 1R36A 1W7PD 2DO7A 1R23A 3CUQB 1RI7A 2KIMA 4G7ZF 4MGRA 1R58A 2HS5A 4HBLA 2WV0A 3KE2A 2O8XA 2OBPA 3KP3A 5AONA 2IP2A 4LD5A 4MQVA 5L3DA 4N9HA 2RQPA 5BQTA 4UXNA 3P9CA 3KP4A 2G7UA 2F5CA 4CHUA 2MLGA 1FY7A 5K5OA 5TRDA 3MQ0A 2FRHA 4OMYA 1KQ9A 2ESNA 2VBXA 4EGZA 2JTVA 5FD6A 2MLKA 2EFQA 1QBJA 4KN4X 1YO5C 4M74A 3WTVC 1YS7A 1ODDA 2HFHA 2EFOA 2Z99A 4U88A 1UFMA 3WODF 2FF4A 4M9XA 3ZN0A 4NHJA 3HRSA 1WQ2A 2CYYA 2XRNA 3QPHA 4EQQA 2P5LC 4F7ZA 2M45A 1JXSA 4U0VA 4A6DA 2L4MA 5F6FA 2D1HA 2IRFG 2XAQA 3M8FA 1XDSA 3E5QA 3FZVA 4G7OF 2ZKZA 3GZ5A 3JSPA 1LVAA 3GO5A 4Y15A 2QENA 1T2KA 3E6CC 5LHGA 1G3SA 1X3UA 2FBKA 2OZ6A 4HV6A 1USTA 2EA4A 2GA1A 1ZRDA 4RB0A 5D8LB 1IAWA 2DBBA 4RS8A 1ZARA 4ON0A 5BPIA 5CVJA 3RTRA 1ZG3A 2JZYA 2STWA 4IPAA 4I7HA 1P4AA 5LHHA 2LF8A 1T6SA 1RUOA 3I53A 3L00A 3F8FA 3FX3A 1IXSB 1PDNC 3HSRA 3IL2A 2MBFA 1FT9A 4EM0B 5J8FA 1SD6A 2QYOA 3BJ6A 3LAJA 1KU3A 1SFUA 2YX4A 2ZXJA 3BWGA 3ZMTA 4G6DA 4I09A 1FYKA 1ZGAA 1T38A 2HKOA 1KYWA 4WXDA 4ZYDA 1V4RA 3MCZA 1YS6A 2D2WA 4ESBA 4KN7X 4R8HA 5DDGA 1B6AA 4CDGA 1J5YA 4YIIA 3C7JA 3KP2A 2CW0F 3O2PE 5AIQA 2RKHA 3F22A 3FM5A 3F6VA 3Q9SA 4OINF 4NQWA 1K78A 2PQ8A 2QLZA 1PUEE 2B0LA 4A5MA 2P4WA 1LB2A 1OYIA 3TKYA 4GYIA 3M8EA 3LA7A 2HOEA 4M6XA 1STZA 1UB9A 4R1HA 1T0FA 5L3BA 3ZMDA 4ZYEA 3N4MA 4A6EA 1O3QA 2FMLA 4IJAA 2QQAA 5CVIA 3I58A 2CFXA 1UHWA 4P9FA 2HQRA 2OAZA 3TGNA 4OIPF 3GFMA 1K7AA 2A61A 3QPTA 3E6DA 1B9MA 4HV5A 1YW8A 3V8LA 1J59A 3LAPA 2YR2A 2DQRA 4LLGF 4AIJA 4FX0A 5EEHA 5ED4A 2OQRA 1MJBA 2R3SA 4UNOA 4IHTA 4EJVA 1CGPA 3S2WA 1HW5A 3I0TA 2E7WA 1HSJA 4GGGA 5D4RA 1ZG5A 2A68F 3RI4A 1BI3A 2K4JA 1IW7F 3E5XA 3E6BA 1O3SA 2GWRA 3LFKA 1QZYA 1FX7A 2RNJA 2W57A 4RGRA 1TW2A 1H9GA 2JPBA 3GXOA 5F1RA 1P4WA 1Z91A 1OKRA 4IVNA 1REPC 4IXAA 3LQRA 2G7HA 3I64A 3JW4A 3BZ6A 3T5XA 5E8GA 4L0ZB 2O61A 3RDIA 3WGIA 3L9FA 1FBUA 3KCCA 4RB2C 2L3DA 2TDXA 1ON2A 4A0XA 3RYPA 3COAC 4IF4A 3DPLC 2LF7A 3TQNA 3QU3A 1EH7A 4HF1A 3J80Z 1ZAOA 5F64A 2A69F 4L9NA 4HDUA 4KMFA 4DNCA 4PCQA 5BS6A 5FLXK 2D1VA 3DP7A 3WGGA 1OYWA 2YX7A 1FP2A 1YTYA 2PMUA 2EV5A 5JVTA 4UV9A 3Q5FA 3KP5A 2OA4A 4JK1X 3V4GA 3ERED 3HTUA 1YIOA 1ZHFA 4RAZA 2QWWA 3IRRA 1D5VA 2F5EA 4G8XA 1O7FA 1MZBA 1AOYA 1RZ4A 4HF2A 3O3KA 2J5PA 2EJRA 2PMHA 3C18A 1EH6A 1S8NA 3FF5A 3B73A 4EM1A 1RIOH 5E20A 3RKWA 1TTYA 5DV5A 1NHAA 3EYYA 3PQJA 2QVOA 3GWZA 1R00A 4WWCA 1V3FA 4MNUA 1XB4A 1K78B 3LA3A 4UV8A 4KDPA 3IC7A 3CO7C 5H6QA 1F9NA 3CUQA 4WF2A 2QQBA 5DYMA 3WU0A 1F1ZA 2ISYA 2ACJA 3I4PA 4ENMA 3I59B 5HS7A 4UVAA 4FX4A 1W5SA 4L0YB 2RVCA 2VT3A 4HDVA 1L0OC 5DCMA 5LLQA 4ENNA 1R5GA 5JFRA 2FMYA 1HSTA 2JRTA 1XMAA 2FSWA 3F8MA 4KNYA 1U6GA 1ZN2A 5J8CA 4KT5C 4A5NA 1FYMA 1IN7A 2VC0A 1TNSA 4L18B 2BEOA 2Q2EA 4M72A 4YFNF 2V79A 4WK8F 1R1UA 3NQOA 2RN7A 3IWFA 3M9AA 1F5TA 3WTZA 1XCVA 2VC1A 3H3UA 1HKSA 5LHIA 2W25A 2O6GE 3RPQA 1GHCA 4XBFA 2ISZA 3QAHA 3PQKA 2OU2A 4EJTA 3VB2A 3I5UA 4I0BA 3LWFA 5IT9K 4P9UA 3OV8A 5ICGA 1PP8F 5AIPA 3H3ZA 5DD4A 1LJ9A 4RAYA 3W6KB 5JR3A 3KZZA 1OMIA 2KRFA 1W7PA 2HQNA 3FMRA 1KU7A 3M1EA 4UHTA 4CZZA 1U2WA 2FOKA 2X4HA 5L3CA 3VFZA 5CYVA 3QOPA 3DEUA 5BPDA 3GUDA 1Q1HA 1LDKB 3DQVC 4ETSA 1XD7A 1B59A 4HX4A 1IN6A 5E18F 3MZHA 2P5VA 2Z33A 3F21A 1L3LA 2K7LA 2MA3A 3GFLA 2DPDA 1SFXA 1TQPA 2FBHA 5D6FA 3WTWC 5CVUA 1Z6RA 4HF0A 3IKTA 2ZMEB 2QZ8A 3NEUA 1ZG1A 2DK8A 4RGUA 3P9KA 1UHMA 3ECOA 4HA8A 2DQLA 1B4AA 4N9IA 1XSXA 2VN2A 1ZLKA 5IT9Z 3MFKA 4LB6B 2FNPA 4U0WA 4UVBA 1FNNA 4G6QA 3O6BB 3R4KA 3LSTA 1K6OA 4MTEA 3R0AA 1BBYA 1LNWA 4Q48A 4ENJA 5E1ZB 3BROA 1IXCA 5D8KB 4BNCA 4AWXB 2HTJA 4EMSA 4LJZF 1HBXG 1YLFA 2IA2A 2L54A 2X0LA 3F8NA 1JHHA 1HW1A 1R1VA 4EJUA 3J81Z 2O3FA 2XAFA 5FD5A 2DTRA 2IA1A 5D5VB 3RYRA 1W5TA 4I0AA 4YG2F 1XGOA 3QP6A 4XLPF 4BQAA 5ICEA 4IRHA 1FC3A 1H9TA 3BDDA 4AD9A 3MWMA 1R7JA 3K1NA 1FSEA 1LEAA 2GXBA 1TW3A 2A5YB 3TO7A 3CO6C 5FGMA 4P96A 2EB7A 1HW2A 1I5ZA 2FNAA 2MD5A 1HQCA 3CLOA 3I59A 4GCVA 4HW0A 2A6EF 1GVJA 1MGTA 5HS9A 4I02A 4M73A 3BP8A 5JI6A 1D8KA 2HR3A 1IF1A 2IPQX 3WTSC 4KIGA 1U5TC 5CVVA 1SAXA 1RUNA 1SMYF 4HZFA 5EEGA 3L7WA 4BHBA 3GX4X 3F23A 4A2UA 3W6JB 4MHGA 3U1DA 1BI0A 1ON1A 2VBYA 5KVRA 4I01A 2QQ9A 2AS5F 2G9WA 4FT8A 4AIKA 3MZYA 4RGXA 4HYEA 3N97A 3WTXC 4WXCA 1R5HA 4G94A 1UCRA
chains in the Genus database with same CATH superfamily
1O3TA 2CJJA 2M87A 1G3WA 2QSGX 2VQGA 4JBAA 1E3HA 2XAHA 4D7MA 5LRSA 2XROA 1TQMA 1ZREA 4CGZA 1IUYA 2F4MB 9ANTA 2YU3A 4DJAA 3RJPA 3FXLA 3LSGA 4IL6C 1BM9A 2DT5A 3WG9A 3L1PA 1GT0C 5D5WB 3M7GA 4JX6A 3TOBA 4NB5A 1XMXA 2LDUA 4XIDA 1QPMA 3MVPA 2W85A 1SVMA 3I4NJ 2MABA 2KFDA 3E97A 3D0SA 4C2MJ 4X1EA 4Y17A 3SDGA 1XMKA 3TW7A 2LRDA 3WTYC 1P7JA 4G7HF 2A07F 4YIFA 2FUG2 3FKJA 4EEFG 2HI3A 5KK1A 1JHFA 2MC3A 4CH7A 1D0ZA 2EFPA 2K40A 4BAYA 3ZPLA 5L3EA 2DXIA 1VQOI 4W97A 2KJBA 2ECCA 1VQMI 2BGCA 3PO3J 3Q0VA 2ZBKA 4MEYF 1UHSA 4CCNA 1NK3P 1D8JA 3KETA 4XLCA 4EV0A 3OOPA 2K4BA 2O0YA 2Q0OA 4AVPA 3OYBA 2EA2A 5FRNA 1LFBA 2COMA 3U2RA 3KYLA 2JMWA 3M3YJ 1ETXA 3FHNA 2ZXHA 1IO2A 2VPRA 3DBLB 1A5JA 1WKMA 1BIAA 5DD8A 4MEXF 2ZFUA 5K5QA 2GZWA 3JTHA 3QQAA 3TDZC 5DCFA 2AXLA 2L7KA 2CO5A 4FASD 1A31A 1X1DA 1MKMA 1MBFA 1WJ5A 3KYDB 4AUXA 3B6CA 2GQQA 5ILUA 3WU1B 4DW6A 2BBYA 1LEBA 3K1PA 1YIJI 2CMPA 1Z1DA 2DFFA 1SD4A 4BQNA 2QSFX 2ZXWH 3GZ6A 3EYIA 2V6CA 2O5RA 3KPHA 5D5UB 1FYLA 2ELHA 4DYCA 3GZNB 1WJCA 3BLYA 1I3QJ 1LPQA 3Q9VA 2VQLA 2G0EA 3EETA 5FLXZ 5J47A 2Y9ZA 1N77A 1FBQA 4HQEA 5F27A 2FD5A 4OIRF 2WAEA 1W4MA 4BH9A 4PJLA 3JRCA 2ZMEA 3S3MA 1G2HA 4L9VA 4XICA 3ECHA 4BEHA 2OTLI 4L5JA 5K7ZA 2BYVE 3P9IA 4JOMA 5LBQA 2E5ZA 4LFUA 2E7XA 2B7EA 4RBOA 3RIRA 3EUHC 3I3LA 3H9GA 4KA4A 3I56I 2K9LA 2Y48A 1QO0D 4HPQA 3A0BC 1Y1WJ 5E17F 4A3BJ 5M3FJ 3J7AO 1EA3A 2Z3YA 2H94A 5D4SA 1QVTA 2ELJA 3TP0A 3CMEI 4EVIA 3HHGA 3BR1A 4YELA 4Y7NJ 3RQ4A 1ZYRF 4AU7A 2HU9A 2V1UA 5E1XA 4V2FA 2EZLA 2M0MA 2H8WA 4O6JA 3I55I 3L2CA 1P2FA 4BE2A 3VYUB 5TGTA 5H20A 5FRMA 4KIFA 1H88C 3ABTA 4IO9F 1H8AC 2CG4A 3LOCA 2R7FA 2A5WA 2R7DA 1DGRM 2Y0MA 1ZKGA 3BZKA 2VBWA 1Z77A 1AWCA 5HNHA 1ZGJA 5L3GA 3GFJA 3ELKA 2VB6A 5DEQA 3TEDA 1U5TB 1V5GA 1R6RA 4Y13A 2JA8J 2PFBA 1Z3XA 4BEHB 2M7AA 5HVQC 3I54A 4MTDA 2QBYA 1ZTRA 4CXFA 3OIQA 2A3SA 2FA5A 3MMYB 2R7RA 2QKLB 1ENHA 2E36A 4NC7A 5JHUA 3DBHB 3IAS2 3LSMA 5GTIC 2M8EA 3J7AY 1Z7UA 4ZH4F 5EG0A 4UUVA 4BS9A 2XAUA 4Q5SF 4S05A 3CD6I 3U1KA 1QGPA 3IH2A 1TT5B 2V26A 4WX9A 2L0KA 2VE8A 3HGGA 4TV7A 4OOIA 3H5RA 1LVKA 1T0FC 3EDPA 2YSRA 3FHZA 4KFCA 3SZTA 1BJZA 3S1NJ 5KCMA 2O8KA 2PN6A 1QZZA 4DYRA 3D5LA 2BW3A 3BPVA 1P7IA 1KGSA 1G59A 4ZDLA 3K4NA 1DPRA 3MKLA 2IS6A 5H2FC 2VOPA 3AAFA 1Y0UA 1XG1A 3S1MJ 3ZQ7A 5M5XJ 4OIQF 2NOJB 2EFNA 4I76A 3ZQFA 1T56A 3M07A 2JSCA 2ZO4A 2BE5F 2IA0A 1FOKA 1JT6A 1UG0A 2WA0A 3OS1A 2O03A 4LK1F 2LYCA 3SZPA 2HGCA 2DK5A 3K0LA 4A0YA 1J2XA 2CFOA 1XCBA 2ZNYA 1LDDA 3D1NI 3JRFA 1XPXA 4XRSG 1IZ1A 2HDWA 5CKTA 3IRQA 2DPUA 4AC0A 3CMYA 1G6NA 3WGHA 4Q47A 4OMZA 4HSRA 4A3JJ 4B09A 3PUBA 3KP7A 1PUFB 4ZYHA 2EV6A 3LL7A 3QRFF 1IDYA 2F6CA 3HOSA 3PNVA 4KYWA 3A02A 5BMZA 5LRRA 4LG0A 2OTJI 3CUOA 2PEXA 1S7EA 2HKXA 1ITYA 1VQ6I 2H1LA 1YITI 3OYKA 4EJOA 1WVRA 3EUHA 4GO1A 2H8RA 4DBQA 2IT0A 2GIVA 4IRIA 4HEA2 4XRMA 3GTGJ 2OZUA 1MW7A 4LMYA 1QVUA 5E1WA 3KLNA 1A04A 2FXAA 1KU9A 3KEOA 2X1DA 2DI3A 2WAFA 4M6YA 2Q2EB 3CP2A 3TDUC 1VQ4I 3DU5A 2EZHA 2WY7Q 4LITA 3CC4I 2ZCWA 1TQIA 3JTGA 2RDPA 1HA8A 3LSHA 1Z7LA 2R92J 2ECBA 3RKXA 3FMSA 2MH2A 5K1YA 3C2HA 2VKHA 3CCJI 3V8KA 4LOCA 1AHDP 4ZDOA 3KYCB 1TLHB 2RREA 5GPCA 4KICA 2CUJA 4HX7A 2JA7J 2XIGA 3MKWB 2KZGA 2LKXA 4BQQA 2JA6J 5HDNA 1K79A 1OCPA 2P8TA 3I4MJ 2ME0A 5FFXA 2E1NA 3BR5A 2KJCA 1MH4A 3C2BA 1WFXA 1J7KA 1TL8A 2XPWA 1MMSA 2OCEA 1YQAA 4M71A 5DCMB 1LUJB 1SMTA 3DFGA 4UVCA 1BN5A 3FXUA 4U0YA 2JRMA 3PO2J 4EJWA 1UMQA 1ZRFA 4A12A 1E2XA 3ZMSA 1Y0NA 2M1BA 2VJ4A 3V7SA 3DEWA 1IN5A 3DXJF 3V42A 1OPCA 4BHPA 3F8BA 3OYLA 1Z05A 4D0PA 2OJED 3HOVJ 1OLTA 1JT0A 1IV8A 2HVSA 3H36A 1R5ID 4ZZLA 5ERIA 1H0MA 2WBMA 1J75A 3HRTA 3E6MA 1MH3A 3L2RA 2KL4A 3GCMA 1XGSA 3HOTA 2V1DA 2ELKA 5HLHA 1BOAA 2XUBA 4CCMA 1I1SA 5HOOA 3Q0UA 3K70D 5FLMJ 1VQLI 4Y52J 1I6HJ 1ORKA 1YHQI 2IS1A 2IGNA 2XF5A 4HLXA 3BR0A 4ENKA 3SDBA 2LNBA 2CQKA 2IBDA 4AIHA 1IC8A 3BOQA 3LNQA 1DUXC 4YFKF 2HOSA 4II3A 5A2QK 2W82A 3CCRI 1BIBA 1XDUA 3FM3A 1M1EB 4HQMA 3T8TA 1FMVA 3HJEA 5D5XB 2H6CA 4ASNA 5FJ8J 2LY1A 1JKRC 1R22A 3CTAA 2WY8Q 2E34A 1VQ5I 2XHKA 3ROUA 2DMUA 5JLXA 3QYFA 2DA1A 1E17A 1BI1A 5L3FA 1Y39A 2XVCA 3HPHA 2BY2A 1LQ1A 1I6XA 1N78A 3KEQA 2W00A 4AIDA 3BTJA 2Z1DA 4HAMA 2RNGA 1MJAA 2PJPA 3OYNA 2E1CA 2VJIA 2UWMA 1IRGA 3HSFA 3W2WA 5K5RA 2KIUA 1ZQ3P 2VBZA 5HLIA 2BHYA 2V1XA 3IV5A 2LSOA 1WSUA 3HG9A 1JUMA 2ZSIB 1UZCA 3HYIA 4ZTFA 3BCBA 5J40A 2M5WA 3M8JA 3WE2A 1NG7A 1XGNA 4M9ZA 4XSZF 4KJZA 4IHYA 1S9HA 2LKPA 2J5OA 4RB3C 3HGYA 2DW4A 1P9QC 3BQZA 1HXDA 2R4GA 1TWCJ 3BTCA 1SFEA 3K1MA 4DGWB 5HLGA 1DPUA 2X1CA 2GBYA 1APLC 1VQ8I 1ETYA 2XSDC 4A69C 3FK6A 4PZJA 2UXXA 1WJAA 1YFHA 1C0WA 4LK0F 2M3AA 1XS9A 4X0GA 5H6RA 2FJ1A 2LD5A 2Y31A 1EKEA 2HXOA 4OIOF 1J09A 3M4OJ 5EDNA 5CVRA 2Z9OA 2LLKA 1IRXA 1HKQA 1MSFC 3A1YA 1X2NA 3OS2A 2KIFA 1JGGA 4JQFA 4XRFA 3L09A 5DS9A 3TO9A 2NRAC 4CO8A 1IXRC 1KYZA 4LB5A 4M3DA 3WE3A 3ZR8X 5FFZA 1LDJA 5FO5A 1BA5A 1FWZA 2L02A 3WTTC 3DBRB 3GFIA 2VT2A 2Y69H 3ZP5A 3H5NA 2GXGA 2FX0A 4L9JA 4F3QA 2WTEA 3FXRA 5IYBJ 1EH8A 2NS0A 4R79A 5IP9J 4A3DJ 4MLOA 3ONQA 3REOA 2X1EA 1YJNI 3DF8A 4KUMA 1QQIA 4B3XA 2QSHX 2XV4S 3RPUA 3BY6A 4FHTA 4IOCF 2WB1A 4PDKA 2F5FA 3VOEA 2ID6A 2GA2A 1MMDA 1TWHJ 3BTLA 2JVHA 3CMAI 3EUAA 4D5FA 3CJQB 3S1RJ 5DUKA 5HODA 2DCEA 3U9GA 3B02A 4E4HA 2QBYB 2W4SA 1ONVA 2F4OB 2I5UA 3LQQA 3P7NA 2BY3A 2RGVA 3HIFA 3CJRB 1X19A 3ULQB 4E7IA 5BOXA 2CGPA 6PAXA 3DPTA 4B8XA 3OYHA 1WI3A 3VYSB 5HDGA 1E3OC 5IY5H 5ICCA 5A2QZ 1VTNC 2IJLA 3S3OA 1PUFA 1P4XA 2FBIA 2X9DA 2KP6A 1J9IA 3RKYA 1K6YA 2ZFWA 2JN6A 2DU9A 4E7KA 2STTA 1AKHA 4ZDPA 2R7ZJ 1U78A 3HHHA 3HOUJ 2NAZA 3DPUA 2R93J 4E7ZA 3LA2A 2OV7A 2L9SA 3TBIA 1HOMA 1KZHA 1XSVA 1U5TA 5LGNA 4XL9A 2PLYA 1B8IA 2DOFA 2H09A 4NQWB 3BR6A 3FBNB 2XKOA 2ADUA 3JSOA 5LEKA 4EATA 3BCAA 1ZK8A 4ABZA 3PNTA 2L5QA 3SZGA 3F72A 1ZGWA 3GEZA 1W7PB 3ABMH 3EQLF 3JAMZ 4IZZA 1B1BA 5ILVA 1P92A 5F0FA 3HXLA 4J01A 3NAUA 2ZJRF 1OYYA 1TP4A 2FE3A 4QSHA 1EJ9A 4G6TB 3DKYA 1JE8A 4IHSA 3PIPF 4CZCA 1FTTA 4ZYGA 4RAGA 3CDHA 2Z16A 2LMDA 1G3TA 5ILSA 2IGOA 4UY8I 2R7OA 1W0TA 1JUSA 2FQ4A 2F2EA 3H0DA 1YRNA 2R0QC 4XOTA 2HYJA 2WC2A 3HM5A 2E71A 1SD7A 1MDMA 1BW6A 4MQ9F 1X1CA 3AG4H 2JWTA 3ZQQA 2FEZA 1YYVA 4HX8A 2A6TA 3G3ZA 1NK2P 1ZELA 2F48A 3H92A 1WCMJ 2HZTA 2XASA 2VQHA 3EPZA 1DDNA 2XF6A 1S6LA 1BOBA 2M7BA 1FSHA 2JPCA 2M0CA 4DBRA 2E35A 1TNTA 2L9RA 1VI0A 2KIQA 5FB2A 3IP4B 4ANJA 2VE9A 2L4AA 3GMEA 2NS7A 2P7CB 1X1AA 2XGEA 4E7SA 1S72I 2DAOA 1KU2A 4RDUA 4S04A 5LEJA 3B6AA 4A3IJ 1D5YA 3HOZJ 4U7DA 5F0HA 5JVGF 4Q4ZF 4KMUX 2KRCA 1IN8A 1I1GA 3CZ6A 2ZC2A 2NVUB 4CYDA 5J4YA 3BT9A 3DCFA 4E6KG 3CUQC 3QPLA 1MNMC 1VQ7I 2A05A 5GP9A 1JKOC 2IEKA 2CV0A 3ZN1A 5B5EC 3MEXA 4BACA 2HYFA 3LSJA 2M4GA 1JTYA 3SFZA 1IRFA 3FXQA 1IUFA 3E3VA 2E2HJ 3K4KA 3JR9A 4ITVA 2P5KA 2K5CA 3FWEA 3IWZA 3K9TA 2F5VA 2IW5A 3J80K 2HDCA 3BPXA 3HB9A 1UELB 4HOBA 3ZMVA 3VYTB 2GAUA 1BJAA 2Y75A 4J19A 1BI2A 2DT6A 2LREA 3HRUA 3A4CA 1ETOA 4BBSJ 4XKVA 4RAFA 1F4KA 1K83J 4YFXF 3CJNA 2HEOA 3E5UA 4WCGA 2C6YA 4HLYA 4PJMA 2LOOA 2Z5UA 1FP1D 1OR7A 1QHHD 2NOGA 2YPRA 1BR2A 3F3XA 3DV8A 4LLLA 3WTUC 2VXZA 4LGWA 3J7ZI 1JI8A 2ZNZA 1CF7A 3OR2C 4YRVA 2LFBA 1S7AA 4XONA 2HDDA 4A93J 2H27A 2QA4I 1Z0XA 2CQQA 2F5DA 4NC6A 1T8IA 5TJJA 1X58A 5FLVA 1SVLA 1FZPB 4FE4A 4BYYA 3GTPJ 1FMWA 1MMNA 3OWTA 1JGSA 1CF7B 1HKTA 4C30A 3HPGA 2DLLA 3C3WA 1ZRCA 3R0JA 2VODA 2DFEA 1WGXA 2VIXA 3R60A 1Y56A 2EH3A 3G73A 3H35A 2CSOA 3BJAA 4FE7A 3SEZA 3VYRB 4CYCA 1YX3A 2AXTC 1X4PA 3K4LA 3OYJA 1GXQA 1KQ8A 3OYFA 2HWVA 2DN0A 2L01A 4CCLA 4E70A 1G4DA 1P6RA 2QGUA 4DOZA 1HCRA 4QTRA 4DQ2A 2IAIA 1O7LA 2DT7B 2EIJH 2WADA 1OCCH 4ESFA 2XC7A 4LLNA 1TBXA 4XLNF 3I71A 4XMYA 2V9KA 4LG0B 3GYHX 1KQ0A 1X3WB 1S29A 2YUSA 2IVMA 4L9TA 3S16J 2M34A 1D3YA 5F0CA 4Z2YA 4EGYA 2JT1A 1ULYA 3PL8A 2V4JC 2FQ3A 3ZMZA 4U7BA 2VJJA 1G3YA 3DLAA 1MD0A 3TOAA 3J81K 2PI0A 1VF9A 3K70C 4O5VA 4AYBA 4ZJZA 3V8JA 1ZLJA 2V9PA 1ERDA 1USSA 2CWEA 1MJ9A 5EYRA 4QLCU 2ESHA 3CQZJ 3OL3A 1Q1VA 1SD5A 3U21A 4BXFA 1T39A 4A3CJ 3NWSA 2PX9A 4XKBA 4F93B 5DUIA 4XSXF 2M2EA 4C2UA 2RV8A 2P6SA 3HBLA 3HEFA 2K27A 3GTQJ 2UXNA 3LSKA 5J3LA 2DODA 5D6EA 3O8HA 2HTSA 1FBSA 2K86A 4L5IA 3KLOA 2VUMJ 3MAJA 2XB5A 3ABUA 1XSDA 1I50J 3RZDJ 5JLWA 2NNYA 2K02A 3GTLJ 2EZKA 1QHGA 3SXYA 3ZQGA 2K9NA 5B1BH 3JRAA 4BJTA 1XN7A 1GXPA 3PSFA 5J1UA 3R6SA 3HUGA 4AYBN 4G9YA 3X2QH 2R7QA 3HSEA 3ZQHA 1B72A 3RSNA 2W24A 2H6BA 2HOAA 2V9VA 3ISPA 4P55A 1HF0A 3T8RA 2M30A 3IAM2 1WI9A 2VOOA 2L2OA 4K2EA 2I10A 3L2WA 4I98B 2EWNA 4XLEA 5E3LA 4WXHA 2ETHA 1S7OA 1XGMA 1YJ9I 2X6YA 1I27A 2W84A 4JX5A 5IT3A 3LSPA 2WWYA 5CJ9A 2MSYA 4GYGA 1F43A 3HOYJ 2D45A 2NNNA 1MDMB 2XAGA 4QWQA 2UZKA 5GAHJ 4ESJA 3PFIA 1GVDA 3K2ZA 3SQNA 3QU6A 4Y4RA 3ESWB 1U3EM 1O3RA 3HOWJ 2P7VB 4KIBA 3FMQA 4BXUA 4PGHA 3G6EI 2VQCA 3BR3A 2KKOA 3FISA 4CICA 3CMMA 3TW6A 4BJ5C 4ZC3A 1FOYA 3TO6A 2EV0A 4HSTA 2DFIA 4MFDA 1J0RA 4EM2A 2PJRB 3IKVA 5FROA 2EZIA 2VXDA 1BC7C 4BJ6C 3PJRA 2V1NA 5C44J 2P6TA 3S3NA 1FPQA 2RQQA 5CQGA 1TC3C 2PBIA 1H89C 4PSXA 4B1RA 4Z6YA 3F8CA 1WRJA 1SVOA 3BJOA 3KIOA 2XPVA 3JAMK 1LE8A 4RGSA 1QNTA 2A6HF 2E1OA 1O57A 2LH9A 4P5OA 1YW7A 2CQXA 3GF2A 2LG4A 4A0ZA 2ZSHB 1ETVA 4PGGA 1JTXA 5HS8A 1BC8C 1PP7U 4GXOA 2R5ZB 2EIMH 4JYKA 4UB6C 5HDKA 3W2VA 1FLIA 2IS2A 1B9NA 3C1DA 4N0BA 4O3MA 2NVXJ 3SHFA 1YW9A 2PMZN 2HYGD 2XB0X 3DKWA 4RM3A 1OJLA 1Z6TA 2RC4A 3OOUA 2Q8KA 2XAJA 5KAIC 2UV1A 1DU0A 1IN4A 4PFOA 1JJ6C 3QP5A 2WAQA 2PG4A 5LGTA 2ZJQF 1R1TA 4NBQA 1U9NA 3KZYA 3V7CA 2B9SA 2BY0A 2GIZA 3K69A 3ZMUA 2XGXA 3FDYA 3VPRA 4AM3A 4M9SA 1FIPA 2EK5A 1MBEA 1SAUA 4Y3OA 4IHXA 3R61A 5GTHC 2NYXA 2ICWG 3VODA 3SYTA 3HRMA 1Z9CA 4RB1A 4IRGA 3JRGA 2JQ7A 2AO9A 3KP6A 5J6XA 2MH9A 5LGUA 5C4JJ 1Y6IA 1FIAA 5DM7F 2R7TA 1DP7P 3IHUA 4W1UA 3DLLF 5CLSA 5EJCA 2VONA 2EFWA 5IP6A 1T98A 1F36A 4XK4A 5ICFA 4BE1A 1U8RA 2XKPA 2HQ5A 3VEPA 2DOAA 3V7RA 3HTSB 4RMNA 4H0EA 4I2OA 3KFWX 4M3GA 5EEAA 3D5SC 3BG3A 3GLXA 4KT6A 2QUFA 2QM3A 3F6OA 1TT0A 2V7FA 5J4VA 1ZH5A 2E2IJ 5EGOA 3GVAA 4IOAF 1S3JA 2LVSA 3GW2A 2DA4A 4OU0A 2MG4A 4F52A 4BHCA 5E8IA 1RNLA 1KA8A 3ML6A 1DGWY 3T1BA 1B8IB 1YOVB 3T0YA 2OD5A 4BBRJ 1WWXA 2ZB9A 2BV6A 2OQGA 3ZQCA 3S17J 3K10A 1YG2A 4ZZDA 3NRVA 3FXOA 1EV7A 3ASOH 2FU4A 3S93A 2ZJ2A 1VNDA 3J7YJ 1R36A 1W7PD 2DO7A 1R23A 3CUQB 1RI7A 2KIMA 4G7ZF 3P5JA 4MGRA 1R58A 2Y9YA 3OSGA 3CCUI 2HS5A 3OS0A 4HBLA 2WV0A 3K4CA 1A36A 2DA7A 3KE2A 4C3HJ 4IHVA 1Y1VJ 2O8XA 2OBPA 3KP3A 2KPMA 5AONA 2BOLA 2IP2A 4LD5A 4MQVA 1BR1A 1WHUA 5L3DA 3N05A 4N9HA 1NH3A 2IGMA 1RC9A 2RQPA 2MW8A 5BQTA 4UXNA 3P9CA 1V5FA 3KP4A 3OYIA 2G7UA 2F5CA 4CHUA 2MLGA 1FY7A 5K5OA 4RLQA 1DP3A 4M3FA 4UUSA 5TRDA 3MQ0A 2FRHA 4OMYA 1KQ9A 2ESNA 4QPOA 1LFPA 2VBXA 1FJLA 2XRLA 4EGZA 2JTVA 4A3LJ 4XOPA 5FD6A 2MLKA 3VSKA 2EFQA 1QBJA 2DA5A 2R5YA 4KN4X 4XQFA 1YO5C 1DU6A 2JSPA 4M74A 3WTVC 1YS7A 1ODDA 2E1MC 2EFOA 2Z99A 2HFHA 1XTAA 4IQ4A 4U88A 1UFMA 3WODF 4BGDA 3HC7A 1V5EA 2FF4A 2CV2A 2ID3A 1PJRA 4M9XA 4PUSA 3ZN0A 1IGNA 4NHJA 3HRSA 3TP3A 1WQ2A 3H1CA 3GTJJ 2CYYA 2XRNA 1MBHA 3AG1H 1RRJA 4PJNA 5F08A 3QPHA 4EQQA 2P5LC 4F7ZA 2M45A 1V54H 1JXSA 4U0VA 4XR6A 4A6DA 2L4MA 2XGDA 2D1HA 5F6FA 2IRFG 1OCRH 2XAQA 5LFAA 3M8FA 1XDSA 1D1CA 3E5QA 3FZVA 4G7OF 3OYGA 2ZKZA 3GZ5A 4HNTA 3OL4A 5HLTA 3JSPA 2OF7A 1LVAA 3ZCOA 3IH4A 3GO5A 2HPIA 1TZLA 1WH7A 4Y15A 2QENA 5CQEA 1T2KA 3H9QA 3JCUC 1Z67A 3OYMA 3E6CC 3GBGA 5TISC 5LHGA 1G3SA 4M3EA 1SC7A 1X3UA 2FBKA 1R71A 1X4OA 1QZEA 3FXMA 2OZ6A 4HV6A 3IH3A 1USTA 2EA4A 2GA1A 1OQYA 1ZRDA 4RB0A 5D8LB 1IAWA 2HPMA 2VKEA 2DBBA 3HL2A 2DA3A 4RS8A 1ZARA 1DQUA 5IP7J 4ON0A 5BPIA 3ABKH 5CVJA 3UR3C 2E5NA 3RTRA 2KISA 1ZG3A 3WU2C 2JZYA 2STWA 4IPAA 4I7HA 2L7MP 1ETWA 1Y8QB 1P4AA 5LHHA 3OYDA 3AL0B 3CCYA 2E19A 2LF8A 1T6SA 4XLAA 2KDZA 1RUOA 3I53A 2LBFA 3L00A 2ZJPF 2MYSA 3F8FA 3FX3A 1IXSB 1MMGA 4QIWN 1YRNB 4RM2A 3RPUD 3BR2A 3VSLA 2HQAA 3G2BA 5EZGA 1PDNC 2HOTA 3HSRA 1HDDC 3IL2A 2CUFA 1ZR2A 2MBFA 2PMZA 5B3SH 3AFHA 1FT9A 4EM0B 5J8FA 1SD6A 2QYOA 2X6XA 3NWTA 3BJ6A 1GV2A 3LAJA 1I39A 1KU3A 1U0JA 1SFUA 2YX4A 5C4XJ 2ZXJA 3BWGA 3ZMTA 2CQNA 2WAQN 2EINH 4G6DA 4I09A 1FYKA 2NS8A 2L9NA 1R4NB 1ZGAA 2Y0SN 2H1KA 1T38A 2HKOA 1KYWA 1MBJA 4WXDA 4ZYDA 2R7WA 2X51A 3SJMA 1V4RA 3MCZA 1YS6A 2D2WA 3PSIA 4ESBA 4KN7X 4R8HA 3H3VK 4B43A 5DDGA 1B6AA 4CDGA 2KZVA 2P0WA 1J5YA 3A0HC 4I99C 4YIIA 1VQNI 3C7JA 3KP2A 1QA6A 5IYDJ 2CW0F 3O2PE 5AIQA 5GPAA 1K4SA 1OCZH 2RKHA 3F22A 2EBIA 3FM5A 3LFUA 3F6VA 2QKMB 3Q9SA 2ZXIA 4OINF 2VL8A 4NQWA 3CF5F 1K78A 2PQ8A 5EGOB 2QLZA 1PUEE 2B0LA 2W48A 5FKNA 4A5MA 2P4WA 1IJWC 1LB2A 1OYIA 3TKYA 2BZTA 3M8EA 4GYIA 3LA7A 5BNGA 2EIKH 2TRTA 2L7ZA 4BY7J 2D5VA 2HOEA 3CF2A 1AKHB 1YJWI 3VDXA 4M6XA 1STZA 1UB9A 1RKTA 2YS9A 3BZCA 4R1HA 1T0FA 3MZ8A 5L3BA 2OCCH 5CPRB 2MD0A 3KX2A 5LD2C 3ZMDA 4ZYEA 3N4MA 3K6GA 4FTHA 4OAYA 4A6EA 2L9VA 5HNFA 1ETKA 1O3QA 4MIMA 2FMLA 4IJAA 2QQAA 2P81A 5CVIA 5M3MJ 3I58A 4I6ZA 2CFXA 1UHWA 4P9FA 4CCOA 5FKMA 2HQRA 1CQTA 2OAZA 3TGNA 4OIPF 4V19K 1WPKA 4B3AA 1W0UA 3GFMA 1K7AA 2A61A 3O8GA 3QPTA 3E6DA 1B9MA 4HV5A 2LC2A 1YW8A 5E79C 2OC6A 3V8LA 1X3ZB 1D1AA 4GRIA 1RPWA 1VZ0A 1J59A 5IOYA 3LAPA 2YR2A 1R49A 2DQRA 3SFIA 4B4CA 4E7JA 4LLGF 4AIJA 4FX0A 5EEHA 5ED4A 4A3FJ 3CC2I 2OQRA 1YI2I 1MJBA 3PNYA 1IRZA 2HVQA 2R3SA 3CDLA 3Q3SA 1U8BA 2GM4A 2DJNA 3G71I 3AKZA 4XM3A 2B63J 3DTEA 5E3MA 4IEJA 4UNOA 4HG2A 2BHZA 4IHTA 4EJVA 1CGPA 1OR7C 3C2GA 3LSIA 3S2WA 1HW5A 3I0TA 3S2HJ 2DJIA 2E7WA 3CDIA 3BG7A 1HSJA 1BR4A 2DYSH 1WJBA 2NVYJ 4GGGA 5D4RA 2VKDA 1ZG5A 2DMTA 1HDPA 2A68F 2FOWA 3L2UA 3HUGB 3RI4A 5E3OA 1BI3A 2K4JA 2CW7A 4ZTJA 1LFUP 5EG0B 3QWLA 1IW7F 1FOXA 3E5XA 1QU3A 3E6BA 3BTIA 4B47A 1O3SA 1RESA 2MC4A 2GWRA 1PVEA 4FETA 4C3IJ 3DTKA 2O9LA 3LFKA 1QZYA 1FX7A 3CC7I 2RNJA 1SANA 2W57A 2XDVA 2K9SA 2ZMEC 3K7AJ 4RGRA 1FOWA 1A6IA 1TW2A 1H9GA 2JPBA 3GXOA 5F1RA 1P4WA 3AL0C 1Z91A 2EILH 1OKRA 4IVNA 3K2AA 1REPC 1W1WE 5DM6F 2JK3A 4IXAA 4IHWA 3LQRA 5F1JA 3GTOJ 2G7HA 3I64A 1WJEA 3JW4A 1A35A 3BZ6A 3T5XA 3CCEI 5E8GA 1UJ8A 4BE0A 4L0ZB 1GUUA 2O61A 3RDIA 2BVLA 3WGIA 4E7HA 3L9FA 1FBUA 3KCCA 3QYBA 2NVTJ 4RB2C 2L3DA 2TDXA 1SFKA 4A3MJ 4N4NB 1ON2A 5FKKA 4A0XA 3RYPA 3COAC 4JP0A 4IF4A 4G12A 2MFZA 3OYCA 3DPLC 3MKYB 2LF7A 3RZOJ 1GDTA 3TQNA 3QU3A 2W7NA 2I8DA 1EH7A 4HF1A 1LE8B 4OAZA 2NVQJ 3J80Z 4XKWA 4XLHA 1ZAOA 5F64A 3KZIC 3KEYA 4C2TA 1TWGJ 2A69F 4L9NA 2GOXB 2LY9A 4YEJA 4HDUA 4P1WA 4A3KJ 2LR8A 4FQGA 4DNCA 3ZOBA 4KMFA 3DU6A 4PCQA 5BS6A 5FLXK 5GAGJ 2D1VA 3QPSA 3DP7A 3WGGA 1VQPI 1OYWA 2DA6A 2YX7A 1FP2A 1YTYA 4CCJA 3G4SI 3EUKL 2PMUA 5B66C 4S0HB 2EV5A 5JVTA 2WB1N 3OIOA 4UV9A 3A01B 3Q5FA 3IUOA 3KP5A 2GOMA 2OA4A 4JK1X 1LKXA 3G1OA 3V4GA 3ERED 3HTUA 1YIOA 1Z21A 1ZHFA 4XKCA 2R5ZA 4RAZA 1E3PA 2QWWA 3IRRA 2F5EA 4G8XA 4A3EJ 1W36D 2HVRA 1D5VA 2X6OA 5K7HA 1O7FA 1MZBA 2HXIA 1NTCA 1AOYA 4GDFA 1RZ4A 2VLAA 4HF2A 2QF7A 5IOZA 4L5EA 3O3KA 2J5PA 2EJRA 3L2QA 3K4JA 2PMHA 3C18A 1EH6A 1S8NA 3FF5A 3B73A 2KMUA 4EM1A 1RIOH 5E20A 3PUFA 3FK7A 2V6EA 1N25A 4XN3A 3CJTB 3RKWA 2OPTA 1TTYA 5DV5A 3MKZA 5FKOA 3OIPA 3DTIA 1NHAA 2K85A 3EYYA 3PQJA 2QVOA 2VASA 3GWZA 3JRBA 3OSFA 1R00A 1JKPC 4WWCA 1V3FA 4MNUA 1XB4A 1V55H 1GV5A 3QOEA 1K78B 4BXXJ 1TWFJ 3LA3A 4BY1J 3GTMJ 4UV8A 4KDPA 3IC7A 3CO7C 1JKQC 1A6QA 3LMMA 5H6QA 3OR1C 1JUPA 2E2JJ 1F9NA 3BG6A 2DMNA 2RAEA 3CUQA 3LSRA 2CW8A 4WF2A 2EQRA 2DOEA 3FKIJ 4FCYA 2GLOA 2QQBA 5DYMA 1OISA 3WU0A 1F1ZA 2ISYA 2K3PA 2ACJA 2JUGA 3JRHA 3I4PA 4PFPA 4ENMA 3I59B 1X2MA 2DMQA 5HS7A 5FKLA 4F55A 4MFEA 2COBA 3E0JB 5M5YJ 1B72B 4UVAA 4FX4A 2JVGA 1W5SA 1IV6A 4L0YB 5GAEJ 4BKXA 1FTZA 2NXNB 1MBGA 1WJFA 3ZQIA 2TCTA 2RVCA 3W2AA 2VT3A 3A01A 4HDVA 4HNVA 1L0OC 4NDLA 1RR7A 5DCMA 5LLQA 4BDZA 4ENNA 5M5WJ 1R5GA 1MMAA 5JFRA 3PFYA 1U9OA 1OCOH 2FMYA 1HSTA 2JRTA 1XMAA 3CCSI 3L2VA 4BU2A 2KQRA 1HC8A 3JRIA 4CYCB 4D7NA 2FSWA 2R5YB 2W1OA 3F8MA 1ZR4A 3AG2H 1WJDA 1XC5A 2AHQA 2BVMA 1IG7A 4KNYA 1U6GA 1ZN2A 1W36C 2MGQA 3NARA 5J8CA 2K3FA 4KT5C 4A5NA 1FYMA 4XLFA 1IN7A 2JJ7A 2VC0A 1TNSA 4L18B 2BEOA 4ZYAA 2Q2EA 3FIWA 4M72A 4YFNF 2V79A 4MO7A 2QQ8A 3FBIB 4WK8F 1R1UA 2R7UA 3NQOA 4NNJA 1O4XA 3RCOA 3HOXJ 1RR8C 4BDYA 3F9KA 2RN7A 2DYRH 3IWFA 2M4KA 3M9AA 3S2DJ 4CSWA 4F92B 1F5TA 3WTZA 4X6AJ 1XCVA 4OWRB 1AU7A 2VC1A 2KRHA 3H3UA 3DKXA 1HKSA 4NUBA 5LHIA 2W25A 2KHMA 3OY9A 3OYAA 4H4KC 2L7FP 5K7FA 2O6GE 3RPQA 2X85A 2M8GX 4XBFA 3QAHA 2ISZA 1GHCA 3PQKA 3ASNH 2OU2A 3CP8A 4EJTA 2Q1ZB 4RA2A 3CESA 3HDDA 2K9MA 3VB2A 3I5UA 4GFBA 4I0BA 4LIVA 3CCLI 4Y33A 3LWFA 5GADJ 4AVZA 5IT9K 2DDAA 3MD2A 4P9UA 3OV8A 4BUPA 5EF6A 3QYEA 5ICGA 2R7SA 4RLFA 1T08B 1UG2A 1PP8F 5AIPA 3H3ZA 5DD4A 1LJ9A 5KNLA 3GTKJ 4RAYA 1VFCA 3W6KB 5JR3A 3KZZA 2UUZA 3WG7H 4D1QA 1OMIA 2KRFA 1W7PA 3S14J 1E0EA 2HQNA 3FMRA 4XRSA 3CCQI 1KU7A 1YX5A 3M1EA 4UHTA 3BQYA 4CZZA 1U2WA 1OFCX 2FOKA 3ZXSA 3W6VA 2Y30A 2X4HA 2CS3A 4JX4A 4HNUA 5L3CA 2KT0A 5J1YA 3VFZA 5CYVA 3QOPA 3DEUA 3TL4X 5BPDA 3HKZA 2IXSA 4PK4A 3GUDA 1Q1HA 1VQ9I 1T95A 1LDKB 3E1SA 1NG6A 3DQVC 4LG3A 4ETSA 3PIOF 1XD7A 1B59A 4HX4A 5DTDA 1HLVA 2DDBA 4V2GA 3W3CA 1IN6A 5E18F 3MZHA 1Z3YA 3AG3H 2P5VA 2Z33A 3ZGKA 3F21A 4FISA 1K4TA 1L3LA 2K7LA 1D1BA 4UB8C 4PJJA 2R7XA 2JUCA 3FXJA 2MA3A 3FXKA 3GFLA 2HZDA 4M6VA 2DPDA 2Y2ZA 2Z2SB 2ME6A 1SFXA 1TQPA 2FBHA 1POGA 5D6FA 1KONA 3VWBA 3WTWC 4CUGA 3ZQLA 5CVUA 2LTPA 1K61A 1JJ8C 2X6WA 1Z6RA 4HF0A 3IKTA 1FEXA 4KITB 4PJ0C 2ZMEB 2QZ8A 3NEUA 1QRYA 5KAFC 1ZG1A 2DK8A 4RGUA 3S32A 5EZHA 3I9V2 2VPLA 1OCTC 2XPUA 3A2KA 4DIQA 3P9KA 4II2A 2YU9J 4D5CA 5KHDA 1UHMA 1R9TJ 3OMYA 4NC8A 3ECOA 3RQIA 2BXYA 2QCOA 4PSWA 4HA8A 2DQLA 1BL0A 4B48A 4IKFA 2DA2A 1B4AA 4N9IA 1XSXA 2VN2A 1ZLKA 3ABLH 5IT9Z 3WHCA 5F04A 1WH5A 2BXZA 3MFKA 4LB6B 2FNPA 4U0WA 2BW3B 4UVBA 1FNNA 4G6QA 3O6BB 3R4KA 2LY2A 2X48A 3S8PA 4B44A 3LSTA 2LK2A 2LKSA 2HNHA 3H0GJ 4MTEA 3R0AA 4XN0A 1K6OA 1BBYA 5IYCJ 2N8GA 2O7OA 3UKGA 4D9JA 1LNWA 4Q48A 4ENJA 3JREA 5E1ZB 2BY1A 2M9HA 1Y8RB 4HRIA 5IPAA 1R4MB 3BROA 1IXCA 5D8KB 4A3GJ 4C3JJ 2CUZA 2DTZA 4AWXB 4BNCA 2HTJA 1MNEA 2CUEA 2E60A 4EMSA 3CCMI 4LJZF 1VQKI 2LBFB 1HBXG 1YLFA 1ETQA 1MBKA 1W5CC 1X1PA 2IA2A 3TMOA 1S5LC 2L54A 3F8NA 2X0LA 1JHHA 4IQJA 3SEQA 1HW1A 1R1VA 4EJUA 5C3EJ 3J81Z 2IS4A 2R7VA 2Y0SA 3DEEA 2O3FA 2VI6A 3DWLE 1SEUA 4KISA 3BG9A 2XAFA 2CH0A 2IGKA 5FD5A 3JRDA 2DTRA 2IA1A 5D5VB 2EPFA 3RYRA 1RKWA 3H9JA 1W5TA 4I0AA 1MIJA 1MNDA 2XSJC 4YG2F 2KDOA 1WZ2A 1G8XA 2AQFA 1XGOA 3QP6A 4XLPF 3ZRGA 4BQAA 4BQOA 4IRHA 5ICEA 3OYEA 1UAAA 1FC3A 4LIUA 3G1LA 3E7LA 1H9TA 3GLLA 3BDDA 2PJRA 4AD9A 3MWMA 3RKQA 2XGCA 1D0YA 3HZJA 1R7JA 2VKVA 3K1NA 3MN2A 1FSEA 1X1BA 4YIRX 1LEAA 2GXBA 1GLNA 1TW3A 3BG5A 2A5YB 3TO7A 2K9QA 3CO6C 3M1CA 5FGMA 4QPQA 3BC8A 2LP0A 2JA2A 4E7LA 4BL0B 3D5RC 4P96A 2EB7A 1YE9A 1HW2A 1I5ZA 2FNAA 1RETA 2DMPA 4XNFA 4DZJA 2E1MB 2MD5A 1HQCA 3CLOA 3WHBA 2CU7A 3K4BA 3I59A 2OUMA 5JHFA 4CA0A 3F0CA 1I3AA 4GCVA 4HW0A 2A6EF 1GVJA 1MGTA 5HS9A 4I02A 4M73A 2DFHA 3BP8A 5JI6A 1D8KA 2HR3A 2XF7A 4N4OB 3Q0WA 2AQEA 1TWAJ 1T33A 1IF1A 3K4MA 2IPQX 2CV1A 4XORA 3WTSC 4KIGA 4IX7A 1BW5A 3H5AA 3QODA 1U5TC 5CVVA 2CQ7A 1SAXA 1ACIA 1RUNA 1N75A 1D0XA 1SMYF 4HZFA 5EEGA 5E3NA 2QEXI 2KLOA 4CCKA 4DZPA 2VJ5A 3L7WA 4BHBA 4U87A 3GX4X 3S1QJ 3F23A 3G1MA 4A2UA 3CLQA 3W6JB 2WV1A 4MHGA 4C9YA 1IDZA 3U1DA 1QPIA 1BI0A 4M3BA 3S15J 1ON1A 2VBYA 5KVRA 4DYQA 3CCVI 5B1AH 4I01A 1MSEC 4UUSB 3A03A 2QQ9A 4F91B 5J1RA 4UUTA 2AS5F 2GXAA 3HKZN 2G9WA 4FT8A 4AIKA 2F4IA 1EF4A 2CRGA 3MZYA 4RGXA 4HYEA 3N97A 2JA5J 3ERMA 3UNGC 3PM1A 3WTXC 1PYVA 4WXCA 4J00A 1R5HA 1AA7A 4G94A 1UCRA 1SFOJ 1XX5A
chains in the Genus database with same CATH topology
1O3TA 2M87A 1G3WA 4JBAA 2XAHA 5LRSA 2XROA 4CGZA 1TQMA 1ZREA 1IUYA 2YU3A 3RJPA 1BM9A 2DT5A 3WG9A 5D5WB 3M7GA 3TOBA 4NB5A 2LDUA 1QPMA 2W85A 3E97A 3D0SA 4Y17A 1XMKA 3WTYC 4G7HF 2A07F 4YIFA 5KK1A 1JHFA 2MC3A 2EFPA 4BAYA 3ZPLA 5L3EA 2KJBA 2BGCA 2ZBKA 4MEYF 1D8JA 3KETA 4EV0A 3OOPA 2K4BA 2O0YA 2Q0OA 4AVPA 2EA2A 2COMA 3U2RA 1WKMA 1BIAA 5DD8A 4MEXF 5K5QA 2GZWA 3JTHA 3TDZC 5DCFA 2AXLA 2CO5A 1MKMA 2GQQA 5ILUA 3WU1B 2BBYA 1LEBA 3K1PA 1Z1DA 1SD4A 3GZ6A 3EYIA 2V6CA 5D5UB 1FYLA 2ELHA 3Q9VA 5FLXZ 3EETA 1FBQA 4HQEA 4OIRF 1W4MA 4BH9A 2ZMEA 4L9VA 3ECHA 4L5JA 2BYVE 3P9IA 5LBQA 4LFUA 2E7XA 3RIRA 4KA4A 2Y48A 1QO0D 5E17F 3J7AO 2Z3YA 2H94A 5D4SA 4EVIA 3HHGA 1ZYRF 2V1UA 5E1XA 3L2CA 4O6JA 1P2FA 5H20A 4KIFA 3ABTA 2CG4A 2R7FA 2R7DA 2Y0MA 2VBWA 1AWCA 1ZGJA 5L3GA 3GFJA 3ELKA 5DEQA 1U5TB 4Y13A 2PFBA 5HVQC 3I54A 4MTDA 2QBYA 4CXFA 2A3SA 2FA5A 5JHUA 2M8EA 1Z7UA 4ZH4F 4UUVA 4Q5SF 4S05A 1QGPA 4WX9A 2VE8A 4TV7A 4OOIA 3EDPA 2YSRA 3FHZA 4KFCA 3SZTA 2PN6A 1QZZA 3D5LA 3BPVA 1KGSA 1DPRA 2VOPA 3AAFA 1Y0UA 3ZQ7A 4OIQF 2EFNA 2JSCA 2ZO4A 2BE5F 2IA0A 1FOKA 2O03A 4LK1F 3SZPA 2HGCA 2DK5A 3K0LA 4A0YA 1J2XA 2ZNYA 1XCBA 1LDDA 1IZ1A 3IRQA 2DPUA 1G6NA 3WGHA 4Q47A 4OMZA 4B09A 3KP7A 4ZYHA 2EV6A 3QRFF 3HOSA 4KYWA 5BMZA 5LRRA 4LG0A 3CUOA 2PEXA 2HKXA 4IRIA 4EJOA 2IT0A 3EUHA 4GO1A 2GIVA 2OZUA 4LMYA 5E1WA 3KLNA 1A04A 2FXAA 1KU9A 3KEOA 2DI3A 4M6YA 3TDUC 2ZCWA 1TQIA 3JTGA 2RDPA 3RKXA 3FMSA 2MH2A 5K1YA 3V8KA 1TLHB 4KICA 4HX7A 2XIGA 5HDNA 1K79A 2P8TA 5FFXA 2E1NA 2KJCA 1J7KA 1YQAA 4M71A 5DCMB 1SMTA 3DFGA 4UVCA 1BN5A 3FXUA 4U0YA 4EJWA 1ZRFA 4A12A 1E2XA 3ZMSA 2M1BA 3V7SA 1IN5A 3DXJF 4BHPA 1OPCA 3F8BA 1Z05A 4D0PA 4ZZLA 5ERIA 1H0MA 1J75A 3HRTA 3E6MA 3HOTA 1XGSA 2V1DA 5HLHA 1BOAA 2XUBA 1I1SA 5HOOA 4HLXA 4ENKA 2LNBA 2CQKA 4AIHA 3BOQA 1DUXC 4YFKF 5A2QK 1BIBA 1XDUA 3FM3A 4HQMA 3T8TA 5D5XB 2H6CA 4ASNA 1R22A 3CTAA 2XHKA 3ROUA 1E17A 1BI1A 5L3FA 2XVCA 1LQ1A 1I6XA 3KEQA 4HAMA 1MJAA 2PJPA 2E1CA 2UWMA 1IRGA 3HSFA 5K5RA 2KIUA 2VBZA 5HLIA 2V1XA 2LSOA 1WSUA 3HYIA 2M5WA 3WE2A 1XGNA 4M9ZA 4XSZF 2LKPA 2J5OA 4RB3C 2DW4A 1HXDA 1SFEA 3K1MA 5HLGA 1DPUA 4PZJA 2UXXA 1YFHA 1C0WA 4LK0F 5H6RA 4OIOF 5CVRA 2Z9OA 1HKQA 2KIFA 4JQFA 4XRFA 3L09A 3TO9A 2NRAC 4CO8A 1IXRC 1KYZA 4LB5A 3WE3A 5FFZA 1LDJA 5FO5A 1FWZA 2L02A 3WTTC 3GFIA 2VT2A 3ZP5A 2GXGA 4L9JA 2WTEA 3FXRA 1EH8A 2NS0A 4R79A 3REOA 3DF8A 4KUMA 1QQIA 2XV4S 3RPUA 3BY6A 4FHTA 4PDKA 2F5FA 3VOEA 2GA2A 5DUKA 3U9GA 3B02A 2QBYB 1ONVA 3LQQA 3P7NA 2RGVA 3HIFA 3ULQB 5BOXA 2CGPA 6PAXA 3DPTA 4B8XA 5HDGA 5ICCA 5A2QZ 1VTNC 2IJLA 1P4XA 2FBIA 1J9IA 3RKYA 2ZFWA 2DU9A 2STTA 1U78A 3HHHA 2NAZA 3LA2A 1XSVA 1U5TA 5LGNA 2PLYA 2H09A 2XKOA 2ADUA 3JSOA 5LEKA 3F72A 3GEZA 1W7PB 3EQLF 3JAMZ 1B1BA 5ILVA 1P92A 1OYYA 2FE3A 1JE8A 4IHSA 4ZYGA 3CDHA 1G3TA 5ILSA 2F2EA 2WC2A 1SD7A 1MDMA 4MQ9F 2FEZA 1YYVA 4HX8A 3G3ZA 3H92A 2XASA 2HZTA 1DDNA 1S6LA 1FSHA 2JPCA 1TNTA 5FB2A 2VE9A 2L4AA 2P7CB 2DAOA 1KU2A 4S04A 5LEJA 4U7DA 4Q4ZF 4KMUX 1IN8A 1I1GA 4CYDA 3CUQC 3ZN1A 3MEXA 2HYFA 3SFZA 1IRFA 3FXQA 3E3VA 2P5KA 3FWEA 3IWZA 3K9TA 2IW5A 3J80K 2HDCA 3BPXA 4HOBA 3ZMVA 2GAUA 1BJAA 2Y75A 1BI2A 3HRUA 1F4KA 4YFXF 3CJNA 2HEOA 3E5UA 4WCGA 2C6YA 4HLYA 2Z5UA 1FP1D 1OR7A 2YPRA 3F3XA 3DV8A 4LLLA 3WTUC 2VXZA 4LGWA 2ZNZA 1CF7A 1S7AA 2H27A 2F5DA 5TJJA 1FZPB 4BYYA 1JGSA 1CF7B 1HKTA 2DLLA 3C3WA 1ZRCA 3R0JA 2VODA 3R60A 3G73A 2CSOA 3BJAA 1GXQA 1KQ8A 2HWVA 4E70A 2L01A 1G4DA 1P6RA 4DQ2A 1O7LA 4ESFA 4LLNA 1TBXA 4XLNF 3I71A 4LG0B 3GYHX 1KQ0A 1S29A 2IVMA 4L9TA 1D3YA 4Z2YA 4EGYA 2JT1A 1ULYA 2FQ3A 3ZMZA 4U7BA 1G3YA 1MD0A 3TOAA 3J81K 2PI0A 4O5VA 3V8JA 1ZLJA 1USSA 2CWEA 1MJ9A 4QLCU 2ESHA 1SD5A 1T39A 5DUIA 4XSXF 2RV8A 2P6SA 2K27A 2UXNA 5D6EA 2HTSA 1FBSA 2K86A 4L5IA 3KLOA 3MAJA 3ABUA 1XSDA 2NNYA 2K02A 3SXYA 1XN7A 1GXPA 3R6SA 3HUGA 4G9YA 3HSEA 2W24A 2H6BA 4P55A 2V9VA 3ISPA 3T8RA 2M30A 1WI9A 2VOOA 4K2EA 4I98B 2EWNA 4WXHA 2ETHA 1S7OA 1XGMA 1I27A 2W84A 5IT3A 2WWYA 5CJ9A 4GYGA 2D45A 2NNNA 1MDMB 2XAGA 4QWQA 2UZKA 4ESJA 3PFIA 3K2ZA 3SQNA 3QU6A 1U3EM 1O3RA 2P7VB 4KIBA 3FMQA 4BXUA 4PGHA 2KKOA 4CICA 3TO6A 2EV0A 2DFIA 1J0RA 4EM2A 3IKVA 1BC7C 2P6TA 1FPQA 2PBIA 3F8CA 1WRJA 3BJOA 3JAMK 4RGSA 1QNTA 2A6HF 4P5OA 1O57A 4A0ZA 1YW7A 3GF2A 5HS8A 4PGGA 1BC8C 1PP7U 4GXOA 5HDKA 1FLIA 1B9NA 3C1DA 4N0BA 4O3MA 3SHFA 1YW9A 2HYGD 3DKWA 2Q8KA 1Z6TA 2RC4A 2XAJA 1IN4A 3QP5A 2PG4A 5LGTA 1R1TA 3KZYA 3V7CA 3K69A 3ZMUA 2XGXA 4M9SA 2EK5A 3R61A 2NYXA 3VODA 3HRMA 1Z9CA 4RB1A 4IRGA 3KP6A 5J6XA 2MH9A 5LGUA 1DP7P 3IHUA 5CLSA 2VONA 2EFWA 1T98A 5ICFA 1U8RA 2XKPA 3VEPA 3V7RA 3HTSB 4H0EA 4I2OA 3KFWX 3GLXA 2QUFA 2QM3A 3F6OA 1ZH5A 3GVAA 1S3JA 3GW2A 4OU0A 4BHCA 5E8IA 1RNLA 1KA8A 3ML6A 3T1BA 3T0YA 2OD5A 1WWXA 2BV6A 2OQGA 1YG2A 4ZZDA 3NRVA 1EV7A 2FU4A 2ZJ2A 1R36A 1W7PD 2DO7A 1R23A 3CUQB 1RI7A 2KIMA 4G7ZF 4MGRA 1R58A 2HS5A 4HBLA 2WV0A 3KE2A 2O8XA 2OBPA 3KP3A 5AONA 2IP2A 4LD5A 4MQVA 5L3DA 4N9HA 2RQPA 5BQTA 4UXNA 3P9CA 3KP4A 2G7UA 2F5CA 4CHUA 2MLGA 1FY7A 5K5OA 5TRDA 3MQ0A 2FRHA 4OMYA 1KQ9A 2ESNA 2VBXA 4EGZA 2JTVA 5FD6A 2MLKA 2EFQA 1QBJA 4KN4X 1YO5C 4M74A 3WTVC 1YS7A 1ODDA 2HFHA 2EFOA 2Z99A 4U88A 1UFMA 3WODF 2FF4A 4M9XA 3ZN0A 4NHJA 3HRSA 1WQ2A 2CYYA 2XRNA 3QPHA 4EQQA 2P5LC 4F7ZA 2M45A 1JXSA 4U0VA 4A6DA 2L4MA 5F6FA 2D1HA 2IRFG 2XAQA 3M8FA 1XDSA 3E5QA 3FZVA 4G7OF 2ZKZA 3GZ5A 3JSPA 1LVAA 3GO5A 4Y15A 2QENA 1T2KA 3E6CC 5LHGA 1G3SA 1X3UA 2FBKA 2OZ6A 4HV6A 1USTA 2EA4A 2GA1A 1ZRDA 4RB0A 5D8LB 1IAWA 2DBBA 4RS8A 1ZARA 4ON0A 5BPIA 5CVJA 3RTRA 1ZG3A 2JZYA 2STWA 4IPAA 4I7HA 1P4AA 5LHHA 2LF8A 1T6SA 1RUOA 3I53A 3L00A 3F8FA 3FX3A 1IXSB 1PDNC 3HSRA 3IL2A 2MBFA 1FT9A 4EM0B 5J8FA 1SD6A 2QYOA 3BJ6A 3LAJA 1KU3A 1SFUA 2YX4A 2ZXJA 3BWGA 3ZMTA 4G6DA 4I09A 1FYKA 1ZGAA 1T38A 2HKOA 1KYWA 4WXDA 4ZYDA 1V4RA 3MCZA 1YS6A 2D2WA 4ESBA 4KN7X 4R8HA 5DDGA 1B6AA 4CDGA 1J5YA 4YIIA 3C7JA 3KP2A 2CW0F 3O2PE 5AIQA 2RKHA 3F22A 3FM5A 3F6VA 3Q9SA 4OINF 4NQWA 1K78A 2PQ8A 2QLZA 1PUEE 2B0LA 4A5MA 2P4WA 1LB2A 1OYIA 3TKYA 4GYIA 3M8EA 3LA7A 2HOEA 4M6XA 1STZA 1UB9A 4R1HA 1T0FA 5L3BA 3ZMDA 4ZYEA 3N4MA 4A6EA 1O3QA 2FMLA 4IJAA 2QQAA 5CVIA 3I58A 2CFXA 1UHWA 4P9FA 2HQRA 2OAZA 3TGNA 4OIPF 3GFMA 1K7AA 2A61A 3QPTA 3E6DA 1B9MA 4HV5A 1YW8A 3V8LA 1J59A 3LAPA 2YR2A 2DQRA 4LLGF 4AIJA 4FX0A 5EEHA 5ED4A 2OQRA 1MJBA 2R3SA 4UNOA 4IHTA 4EJVA 1CGPA 3S2WA 1HW5A 3I0TA 2E7WA 1HSJA 4GGGA 5D4RA 1ZG5A 2A68F 3RI4A 1BI3A 2K4JA 1IW7F 3E5XA 3E6BA 1O3SA 2GWRA 3LFKA 1QZYA 1FX7A 2RNJA 2W57A 4RGRA 1TW2A 1H9GA 2JPBA 3GXOA 5F1RA 1P4WA 1Z91A 1OKRA 4IVNA 1REPC 4IXAA 3LQRA 2G7HA 3I64A 3JW4A 3BZ6A 3T5XA 5E8GA 4L0ZB 2O61A 3RDIA 3WGIA 3L9FA 1FBUA 3KCCA 4RB2C 2L3DA 2TDXA 1ON2A 4A0XA 3RYPA 3COAC 4IF4A 3DPLC 2LF7A 3TQNA 3QU3A 1EH7A 4HF1A 3J80Z 1ZAOA 5F64A 2A69F 4L9NA 4HDUA 4KMFA 4DNCA 4PCQA 5BS6A 5FLXK 2D1VA 3DP7A 3WGGA 1OYWA 2YX7A 1FP2A 1YTYA 2PMUA 2EV5A 5JVTA 4UV9A 3Q5FA 3KP5A 2OA4A 4JK1X 3V4GA 3ERED 3HTUA 1YIOA 1ZHFA 4RAZA 2QWWA 3IRRA 1D5VA 2F5EA 4G8XA 1O7FA 1MZBA 1AOYA 1RZ4A 4HF2A 3O3KA 2J5PA 2EJRA 2PMHA 3C18A 1EH6A 1S8NA 3FF5A 3B73A 4EM1A 1RIOH 5E20A 3RKWA 1TTYA 5DV5A 1NHAA 3EYYA 3PQJA 2QVOA 3GWZA 1R00A 4WWCA 1V3FA 4MNUA 1XB4A 1K78B 3LA3A 4UV8A 4KDPA 3IC7A 3CO7C 5H6QA 1F9NA 3CUQA 4WF2A 2QQBA 5DYMA 3WU0A 1F1ZA 2ISYA 2ACJA 3I4PA 4ENMA 3I59B 5HS7A 4UVAA 4FX4A 1W5SA 4L0YB 2RVCA 2VT3A 4HDVA 1L0OC 5DCMA 5LLQA 4ENNA 1R5GA 5JFRA 2FMYA 1HSTA 2JRTA 1XMAA 2FSWA 3F8MA 4KNYA 1U6GA 1ZN2A 5J8CA 4KT5C 4A5NA 1FYMA 1IN7A 2VC0A 1TNSA 4L18B 2BEOA 2Q2EA 4M72A 4YFNF 2V79A 4WK8F 1R1UA 3NQOA 2RN7A 3IWFA 3M9AA 1F5TA 3WTZA 1XCVA 2VC1A 3H3UA 1HKSA 5LHIA 2W25A 2O6GE 3RPQA 1GHCA 4XBFA 2ISZA 3QAHA 3PQKA 2OU2A 4EJTA 3VB2A 3I5UA 4I0BA 3LWFA 5IT9K 4P9UA 3OV8A 5ICGA 1PP8F 5AIPA 3H3ZA 5DD4A 1LJ9A 4RAYA 3W6KB 5JR3A 3KZZA 1OMIA 2KRFA 1W7PA 2HQNA 3FMRA 1KU7A 3M1EA 4UHTA 4CZZA 1U2WA 2FOKA 2X4HA 5L3CA 3VFZA 5CYVA 3QOPA 3DEUA 5BPDA 3GUDA 1Q1HA 1LDKB 3DQVC 4ETSA 1XD7A 1B59A 4HX4A 1IN6A 5E18F 3MZHA 2P5VA 2Z33A 3F21A 1L3LA 2K7LA 2MA3A 3GFLA 2DPDA 1SFXA 1TQPA 2FBHA 5D6FA 3WTWC 5CVUA 1Z6RA 4HF0A 3IKTA 2ZMEB 2QZ8A 3NEUA 1ZG1A 2DK8A 4RGUA 3P9KA 1UHMA 3ECOA 4HA8A 2DQLA 1B4AA 4N9IA 1XSXA 2VN2A 1ZLKA 5IT9Z 3MFKA 4LB6B 2FNPA 4U0WA 4UVBA 1FNNA 4G6QA 3O6BB 3R4KA 3LSTA 1K6OA 4MTEA 3R0AA 1BBYA 1LNWA 4Q48A 4ENJA 5E1ZB 3BROA 1IXCA 5D8KB 4BNCA 4AWXB 2HTJA 4EMSA 4LJZF 1HBXG 1YLFA 2IA2A 2L54A 2X0LA 3F8NA 1JHHA 1HW1A 1R1VA 4EJUA 3J81Z 2O3FA 2XAFA 5FD5A 2DTRA 2IA1A 5D5VB 3RYRA 1W5TA 4I0AA 4YG2F 1XGOA 3QP6A 4XLPF 4BQAA 5ICEA 4IRHA 1FC3A 1H9TA 3BDDA 4AD9A 3MWMA 1R7JA 3K1NA 1FSEA 1LEAA 2GXBA 1TW3A 2A5YB 3TO7A 3CO6C 5FGMA 4P96A 2EB7A 1HW2A 1I5ZA 2FNAA 2MD5A 1HQCA 3CLOA 3I59A 4GCVA 4HW0A 2A6EF 1GVJA 1MGTA 5HS9A 4I02A 4M73A 3BP8A 5JI6A 1D8KA 2HR3A 1IF1A 2IPQX 3WTSC 4KIGA 1U5TC 5CVVA 1SAXA 1RUNA 1SMYF 4HZFA 5EEGA 3L7WA 4BHBA 3GX4X 3F23A 4A2UA 3W6JB 4MHGA 3U1DA 1BI0A 1ON1A 2VBYA 5KVRA 4I01A 2QQ9A 2AS5F 2G9WA 4FT8A 4AIKA 3MZYA 4RGXA 4HYEA 3N97A 3WTXC 4WXCA 1R5HA 4G94A 1UCRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O3T A;  2M87 A;  1G3W A;  4JBA A;  2XAH A;  5LRS A;  2XRO A;  4CGZ A;  1TQM A;  1ZRE A;  1IUY A;  2YU3 A;  3RJP A;  1BM9 A;  2DT5 A;  3WG9 A;  5D5W B;  3M7G A;  3TOB A;  4NB5 A;  2LDU A;  1QPM A;  2W85 A;  3E97 A;  3D0S A;  4Y17 A;  1XMK A;  3WTY C;  4G7H F;  2A07 F;  4YIF A;  5KK1 A;  1JHF A;  2MC3 A;  2EFP A;  4BAY A;  3ZPL A;  5L3E A;  2KJB A;  2BGC A;  2ZBK A;  4MEY F;  1D8J A;  3KET A;  4EV0 A;  3OOP A;  2K4B A;  2O0Y A;  2Q0O A;  4AVP A;  2EA2 A;  2COM A;  3U2R A;  1WKM A;  1BIA A;  5DD8 A;  4MEX F;  5K5Q A;  2GZW A;  3JTH A;  3TDZ C;  5DCF A;  2AXL A;  2CO5 A;  1MKM A;  2GQQ A;  5ILU A;  3WU1 B;  2BBY A;  1LEB A;  3K1P A;  1Z1D A;  1SD4 A;  3GZ6 A;  3EYI A;  2V6C A;  5D5U B;  1FYL A;  2ELH A;  3Q9V A;  5FLX Z;  3EET A;  1FBQ A;  4HQE A;  4OIR F;  1W4M A;  4BH9 A;  2ZME A;  4L9V A;  3ECH A;  4L5J A;  2BYV E;  3P9I A;  5LBQ A;  4LFU A;  2E7X A;  3RIR A;  4KA4 A;  2Y48 A;  1QO0 D;  5E17 F;  3J7A O;  2Z3Y A;  2H94 A;  5D4S A;  4EVI A;  3HHG A;  1ZYR F;  2V1U A;  5E1X A;  3L2C A;  4O6J A;  1P2F A;  5H20 A;  4KIF A;  3ABT A;  2CG4 A;  2R7F A;  2R7D A;  2Y0M A;  2VBW A;  1AWC A;  1ZGJ A;  5L3G A;  3GFJ A;  3ELK A;  5DEQ A;  1U5T B;  4Y13 A;  2PFB A;  5HVQ C;  3I54 A;  4MTD A;  2QBY A;  4CXF A;  2A3S A;  2FA5 A;  5JHU A;  2M8E A;  1Z7U A;  4ZH4 F;  4UUV A;  4Q5S F;  4S05 A;  1QGP A;  4WX9 A;  2VE8 A;  4TV7 A;  4OOI A;  3EDP A;  2YSR A;  3FHZ A;  4KFC A;  3SZT A;  2PN6 A;  1QZZ A;  3D5L A;  3BPV A;  1KGS A;  1DPR A;  2VOP A;  3AAF A;  1Y0U A;  3ZQ7 A;  4OIQ F;  2EFN A;  2JSC A;  2ZO4 A;  2BE5 F;  2IA0 A;  1FOK A;  2O03 A;  4LK1 F;  3SZP A;  2HGC A;  2DK5 A;  3K0L A;  4A0Y A;  1J2X A;  2ZNY A;  1XCB A;  1LDD A;  1IZ1 A;  3IRQ A;  2DPU A;  1G6N A;  3WGH A;  4Q47 A;  4OMZ A;  4B09 A;  3KP7 A;  4ZYH A;  2EV6 A;  3QRF F;  3HOS A;  4KYW A;  5BMZ A;  5LRR A;  4LG0 A;  3CUO A;  2PEX A;  2HKX A;  4IRI A;  4EJO A;  2IT0 A;  3EUH A;  4GO1 A;  2GIV A;  2OZU A;  4LMY A;  5E1W A;  3KLN A;  1A04 A;  2FXA A;  1KU9 A;  3KEO A;  2DI3 A;  4M6Y A;  3TDU C;  2ZCW A;  1TQI A;  3JTG A;  2RDP A;  3RKX A;  3FMS A;  2MH2 A;  5K1Y A;  3V8K A;  1TLH B;  4KIC A;  4HX7 A;  2XIG A;  5HDN A;  1K79 A;  2P8T A;  5FFX A;  2E1N A;  2KJC A;  1J7K A;  1YQA A;  4M71 A;  5DCM B;  1SMT A;  3DFG A;  4UVC A;  1BN5 A;  3FXU A;  4U0Y A;  4EJW A;  1ZRF A;  4A12 A;  1E2X A;  3ZMS A;  2M1B A;  3V7S A;  1IN5 A;  3DXJ F;  4BHP A;  1OPC A;  3F8B A;  1Z05 A;  4D0P A;  4ZZL A;  5ERI A;  1H0M A;  1J75 A;  3HRT A;  3E6M A;  3HOT A;  1XGS A;  2V1D A;  5HLH A;  1BOA A;  2XUB A;  1I1S A;  5HOO A;  4HLX A;  4ENK A;  2LNB A;  2CQK A;  4AIH A;  3BOQ A;  1DUX C;  4YFK F;  5A2Q K;  1BIB A;  1XDU A;  3FM3 A;  4HQM A;  3T8T A;  5D5X B;  2H6C A;  4ASN A;  1R22 A;  3CTA A;  2XHK A;  3ROU A;  1E17 A;  1BI1 A;  5L3F A;  2XVC A;  1LQ1 A;  1I6X A;  3KEQ A;  4HAM A;  1MJA A;  2PJP A;  2E1C A;  2UWM A;  1IRG A;  3HSF A;  5K5R A;  2KIU A;  2VBZ A;  5HLI A;  2V1X A;  2LSO A;  1WSU A;  3HYI A;  2M5W A;  3WE2 A;  1XGN A;  4M9Z A;  4XSZ F;  2LKP A;  2J5O A;  4RB3 C;  2DW4 A;  1HXD A;  1SFE A;  3K1M A;  5HLG A;  1DPU A;  4PZJ A;  2UXX A;  1YFH A;  1C0W A;  4LK0 F;  5H6R A;  4OIO F;  5CVR A;  2Z9O A;  1HKQ A;  2KIF A;  4JQF A;  4XRF A;  3L09 A;  3TO9 A;  2NRA C;  4CO8 A;  1IXR C;  1KYZ A;  4LB5 A;  3WE3 A;  5FFZ A;  1LDJ A;  5FO5 A;  1FWZ A;  2L02 A;  3WTT C;  3GFI A;  2VT2 A;  3ZP5 A;  2GXG A;  4L9J A;  2WTE A;  3FXR A;  1EH8 A;  2NS0 A;  4R79 A;  3REO A;  3DF8 A;  4KUM A;  1QQI A;  2XV4 S;  3RPU A;  3BY6 A;  4FHT A;  4PDK A;  2F5F A;  3VOE A;  2GA2 A;  5DUK A;  3U9G A;  3B02 A;  2QBY B;  1ONV A;  3LQQ A;  3P7N A;  2RGV A;  3HIF A;  3ULQ B;  5BOX A;  2CGP A;  6PAX A;  3DPT A;  4B8X A;  5HDG A;  5ICC A;  5A2Q Z;  1VTN C;  2IJL A;  1P4X A;  2FBI A;  1J9I A;  3RKY A;  2ZFW A;  2DU9 A;  2STT A;  1U78 A;  3HHH A;  2NAZ A;  3LA2 A;  1XSV A;  1U5T A;  5LGN A;  2PLY A;  2H09 A;  2XKO A;  2ADU A;  3JSO A;  5LEK A;  3F72 A;  3GEZ A;  1W7P B;  3EQL F;  3JAM Z;  1B1B A;  5ILV A;  1P92 A;  1OYY A;  2FE3 A;  1JE8 A;  4IHS A;  4ZYG A;  3CDH A;  1G3T A;  5ILS A;  2F2E A;  2WC2 A;  1SD7 A;  1MDM A;  4MQ9 F;  2FEZ A;  1YYV A;  4HX8 A;  3G3Z A;  3H92 A;  2XAS A;  2HZT A;  1DDN A;  1S6L A;  1FSH A;  2JPC A;  1TNT A;  5FB2 A;  2VE9 A;  2L4A A;  2P7C B;  2DAO A;  1KU2 A;  4S04 A;  5LEJ A;  4U7D A;  4Q4Z F;  4KMU X;  1IN8 A;  1I1G A;  4CYD A;  3CUQ C;  3ZN1 A;  3MEX A;  2HYF A;  3SFZ A;  1IRF A;  3FXQ A;  3E3V A;  2P5K A;  3FWE A;  3IWZ A;  3K9T A;  2IW5 A;  3J80 K;  2HDC A;  3BPX A;  4HOB A;  3ZMV A;  2GAU A;  1BJA A;  2Y75 A;  1BI2 A;  3HRU A;  1F4K A;  4YFX F;  3CJN A;  2HEO A;  3E5U A;  4WCG A;  2C6Y A;  4HLY A;  2Z5U A;  1FP1 D;  1OR7 A;  2YPR A;  3F3X A;  3DV8 A;  4LLL A;  3WTU C;  2VXZ A;  4LGW A;  2ZNZ A;  1CF7 A;  1S7A A;  2H27 A;  2F5D A;  5TJJ A;  1FZP B;  4BYY A;  1JGS A;  1CF7 B;  1HKT A;  2DLL A;  3C3W A;  1ZRC A;  3R0J A;  2VOD A;  3R60 A;  3G73 A;  2CSO A;  3BJA A;  1GXQ A;  1KQ8 A;  2HWV A;  4E70 A;  2L01 A;  1G4D A;  1P6R A;  4DQ2 A;  1O7L A;  4ESF A;  4LLN A;  1TBX A;  4XLN F;  3I71 A;  4LG0 B;  3GYH X;  1KQ0 A;  1S29 A;  2IVM A;  4L9T A;  1D3Y A;  4Z2Y A;  4EGY A;  2JT1 A;  1ULY A;  2FQ3 A;  3ZMZ A;  4U7B A;  1G3Y A;  1MD0 A;  3TOA A;  3J81 K;  2PI0 A;  4O5V A;  3V8J A;  1ZLJ A;  1USS A;  2CWE A;  1MJ9 A;  4QLC U;  2ESH A;  1SD5 A;  1T39 A;  5DUI A;  4XSX F;  2RV8 A;  2P6S A;  2K27 A;  2UXN A;  5D6E A;  2HTS A;  1FBS A;  2K86 A;  4L5I A;  3KLO A;  3MAJ A;  3ABU A;  1XSD A;  2NNY A;  2K02 A;  3SXY A;  1XN7 A;  1GXP A;  3R6S A;  3HUG A;  4G9Y A;  3HSE A;  2W24 A;  2H6B A;  4P55 A;  2V9V A;  3ISP A;  3T8R A;  2M30 A;  1WI9 A;  2VOO A;  4K2E A;  4I98 B;  2EWN A;  4WXH A;  2ETH A;  1S7O A;  1XGM A;  1I27 A;  2W84 A;  5IT3 A;  2WWY A;  5CJ9 A;  4GYG A;  2D45 A;  2NNN A;  1MDM B;  2XAG A;  4QWQ A;  2UZK A;  4ESJ A;  3PFI A;  3K2Z A;  3SQN A;  3QU6 A;  1U3E M;  1O3R A;  2P7V B;  4KIB A;  3FMQ A;  4BXU A;  4PGH A;  2KKO A;  4CIC A;  3TO6 A;  2EV0 A;  2DFI A;  1J0R A;  4EM2 A;  3IKV A;  1BC7 C;  2P6T A;  1FPQ A;  2PBI A;  3F8C A;  1WRJ A;  3BJO A;  3JAM K;  4RGS A;  1QNT A;  2A6H F;  4P5O A;  1O57 A;  4A0Z A;  1YW7 A;  3GF2 A;  5HS8 A;  4PGG A;  1BC8 C;  1PP7 U;  4GXO A;  5HDK A;  1FLI A;  1B9N A;  3C1D A;  4N0B A;  4O3M A;  3SHF A;  1YW9 A;  2HYG D;  3DKW A;  2Q8K A;  1Z6T A;  2RC4 A;  2XAJ A;  1IN4 A;  3QP5 A;  2PG4 A;  5LGT A;  1R1T A;  3KZY A;  3V7C A;  3K69 A;  3ZMU A;  2XGX A;  4M9S A;  2EK5 A;  3R61 A;  2NYX A;  3VOD A;  3HRM A;  1Z9C A;  4RB1 A;  4IRG A;  3KP6 A;  5J6X A;  2MH9 A;  5LGU A;  1DP7 P;  3IHU A;  5CLS A;  2VON A;  2EFW A;  1T98 A;  5ICF A;  1U8R A;  2XKP A;  3VEP A;  3V7R A;  3HTS B;  4H0E A;  4I2O A;  3KFW X;  3GLX A;  2QUF A;  2QM3 A;  3F6O A;  1ZH5 A;  3GVA A;  1S3J A;  3GW2 A;  4OU0 A;  4BHC A;  5E8I A;  1RNL A;  1KA8 A;  3ML6 A;  3T1B A;  3T0Y A;  2OD5 A;  1WWX A;  2BV6 A;  2OQG A;  1YG2 A;  4ZZD A;  3NRV A;  1EV7 A;  2FU4 A;  2ZJ2 A;  1R36 A;  1W7P D;  2DO7 A;  1R23 A;  3CUQ B;  1RI7 A;  2KIM A;  4G7Z F;  4MGR A;  1R58 A;  2HS5 A;  4HBL A;  2WV0 A;  3KE2 A;  2O8X A;  2OBP A;  3KP3 A;  5AON A;  2IP2 A;  4LD5 A;  4MQV A;  5L3D A;  4N9H A;  2RQP A;  5BQT A;  4UXN A;  3P9C A;  3KP4 A;  2G7U A;  2F5C A;  4CHU A;  2MLG A;  1FY7 A;  5K5O A;  5TRD A;  3MQ0 A;  2FRH A;  4OMY A;  1KQ9 A;  2ESN A;  2VBX A;  4EGZ A;  2JTV A;  5FD6 A;  2MLK A;  2EFQ A;  1QBJ A;  4KN4 X;  1YO5 C;  4M74 A;  3WTV C;  1YS7 A;  1ODD A;  2HFH A;  2EFO A;  2Z99 A;  4U88 A;  1UFM A;  3WOD F;  2FF4 A;  4M9X A;  3ZN0 A;  4NHJ A;  3HRS A;  1WQ2 A;  2CYY A;  2XRN A;  3QPH A;  4EQQ A;  2P5L C;  4F7Z A;  2M45 A;  1JXS A;  4U0V A;  4A6D A;  2L4M A;  5F6F A;  2D1H A;  2IRF G;  2XAQ A;  3M8F A;  1XDS A;  3E5Q A;  3FZV A;  4G7O F;  2ZKZ A;  3GZ5 A;  3JSP A;  1LVA A;  3GO5 A;  4Y15 A;  2QEN A;  1T2K A;  3E6C C;  5LHG A;  1G3S A;  1X3U A;  2FBK A;  2OZ6 A;  4HV6 A;  1UST A;  2EA4 A;  2GA1 A;  1ZRD A;  4RB0 A;  5D8L B;  1IAW A;  2DBB A;  4RS8 A;  1ZAR A;  4ON0 A;  5BPI A;  5CVJ A;  3RTR A;  1ZG3 A;  2JZY A;  2STW A;  4IPA A;  4I7H A;  1P4A A;  5LHH A;  2LF8 A;  1T6S A;  1RUO A;  3I53 A;  3L00 A;  3F8F A;  3FX3 A;  1IXS B;  1PDN C;  3HSR A;  3IL2 A;  2MBF A;  1FT9 A;  4EM0 B;  5J8F A;  1SD6 A;  2QYO A;  3BJ6 A;  3LAJ A;  1KU3 A;  1SFU A;  2YX4 A;  2ZXJ A;  3BWG A;  3ZMT A;  4G6D A;  4I09 A;  1FYK A;  1ZGA A;  1T38 A;  2HKO A;  1KYW A;  4WXD A;  4ZYD A;  1V4R A;  3MCZ A;  1YS6 A;  2D2W A;  4ESB A;  4KN7 X;  4R8H A;  5DDG A;  1B6A A;  4CDG A;  1J5Y A;  4YII A;  3C7J A;  3KP2 A;  2CW0 F;  3O2P E;  5AIQ A;  2RKH A;  3F22 A;  3FM5 A;  3F6V A;  3Q9S A;  4OIN F;  4NQW A;  1K78 A;  2PQ8 A;  2QLZ A;  1PUE E;  2B0L A;  4A5M A;  2P4W A;  1LB2 A;  1OYI A;  3TKY A;  4GYI A;  3M8E A;  3LA7 A;  2HOE A;  4M6X A;  1STZ A;  1UB9 A;  4R1H A;  1T0F A;  5L3B A;  3ZMD A;  4ZYE A;  3N4M A;  4A6E A;  1O3Q A;  2FML A;  4IJA A;  2QQA A;  5CVI A;  3I58 A;  2CFX A;  1UHW A;  4P9F A;  2HQR A;  2OAZ A;  3TGN A;  4OIP F;  3GFM A;  1K7A A;  2A61 A;  3QPT A;  3E6D A;  1B9M A;  4HV5 A;  1YW8 A;  3V8L A;  1J59 A;  3LAP A;  2YR2 A;  2DQR A;  4LLG F;  4AIJ A;  4FX0 A;  5EEH A;  5ED4 A;  2OQR A;  1MJB A;  2R3S A;  4UNO A;  4IHT A;  4EJV A;  1CGP A;  3S2W A;  1HW5 A;  3I0T A;  2E7W A;  1HSJ A;  4GGG A;  5D4R A;  1ZG5 A;  2A68 F;  3RI4 A;  1BI3 A;  2K4J A;  1IW7 F;  3E5X A;  3E6B A;  1O3S A;  2GWR A;  3LFK A;  1QZY A;  1FX7 A;  2RNJ A;  2W57 A;  4RGR A;  1TW2 A;  1H9G A;  2JPB A;  3GXO A;  5F1R A;  1P4W A;  1Z91 A;  1OKR A;  4IVN A;  1REP C;  4IXA A;  3LQR A;  2G7H A;  3I64 A;  3JW4 A;  3BZ6 A;  3T5X A;  5E8G A;  4L0Z B;  2O61 A;  3RDI A;  3WGI A;  3L9F A;  1FBU A;  3KCC A;  4RB2 C;  2L3D A;  2TDX A;  1ON2 A;  4A0X A;  3RYP A;  3COA C;  4IF4 A;  3DPL C;  2LF7 A;  3TQN A;  3QU3 A;  1EH7 A;  4HF1 A;  3J80 Z;  1ZAO A;  5F64 A;  2A69 F;  4L9N A;  4HDU A;  4KMF A;  4DNC A;  4PCQ A;  5BS6 A;  5FLX K;  2D1V A;  3DP7 A;  3WGG A;  1OYW A;  2YX7 A;  1FP2 A;  1YTY A;  2PMU A;  2EV5 A;  5JVT A;  4UV9 A;  3Q5F A;  3KP5 A;  2OA4 A;  4JK1 X;  3V4G A;  3ERE D;  3HTU A;  1YIO A;  1ZHF A;  4RAZ A;  2QWW A;  3IRR A;  1D5V A;  2F5E A;  4G8X A;  1O7F A;  1MZB A;  1AOY A;  1RZ4 A;  4HF2 A;  3O3K A;  2J5P A;  2EJR A;  2PMH A;  3C18 A;  1EH6 A;  1S8N A;  3FF5 A;  3B73 A;  4EM1 A;  1RIO H;  5E20 A;  3RKW A;  1TTY A;  5DV5 A;  1NHA A;  3EYY A;  3PQJ A;  2QVO A;  3GWZ A;  1R00 A;  4WWC A;  1V3F A;  4MNU A;  1XB4 A;  1K78 B;  3LA3 A;  4UV8 A;  4KDP A;  3IC7 A;  3CO7 C;  5H6Q A;  1F9N A;  3CUQ A;  4WF2 A;  2QQB A;  5DYM A;  3WU0 A;  1F1Z A;  2ISY A;  2ACJ A;  3I4P A;  4ENM A;  3I59 B;  5HS7 A;  4UVA A;  4FX4 A;  1W5S A;  4L0Y B;  2RVC A;  2VT3 A;  4HDV A;  1L0O C;  5DCM A;  5LLQ A;  4ENN A;  1R5G A;  5JFR A;  2FMY A;  1HST A;  2JRT A;  1XMA A;  2FSW A;  3F8M A;  4KNY A;  1U6G A;  1ZN2 A;  5J8C A;  4KT5 C;  4A5N A;  1FYM A;  1IN7 A;  2VC0 A;  1TNS A;  4L18 B;  2BEO A;  2Q2E A;  4M72 A;  4YFN F;  2V79 A;  4WK8 F;  1R1U A;  3NQO A;  2RN7 A;  3IWF A;  3M9A A;  1F5T A;  3WTZ A;  1XCV A;  2VC1 A;  3H3U A;  1HKS A;  5LHI A;  2W25 A;  2O6G E;  3RPQ A;  1GHC A;  4XBF A;  2ISZ A;  3QAH A;  3PQK A;  2OU2 A;  4EJT A;  3VB2 A;  3I5U A;  4I0B A;  3LWF A;  5IT9 K;  4P9U A;  3OV8 A;  5ICG A;  1PP8 F;  5AIP A;  3H3Z A;  5DD4 A;  1LJ9 A;  4RAY A;  3W6K B;  5JR3 A;  3KZZ A;  1OMI A;  2KRF A;  1W7P A;  2HQN A;  3FMR A;  1KU7 A;  3M1E A;  4UHT A;  4CZZ A;  1U2W A;  2FOK A;  2X4H A;  5L3C A;  3VFZ A;  5CYV A;  3QOP A;  3DEU A;  5BPD A;  3GUD A;  1Q1H A;  1LDK B;  3DQV C;  4ETS A;  1XD7 A;  1B59 A;  4HX4 A;  1IN6 A;  5E18 F;  3MZH A;  2P5V A;  2Z33 A;  3F21 A;  1L3L A;  2K7L A;  2MA3 A;  3GFL A;  2DPD A;  1SFX A;  1TQP A;  2FBH A;  5D6F A;  3WTW C;  5CVU A;  1Z6R A;  4HF0 A;  3IKT A;  2ZME B;  2QZ8 A;  3NEU A;  1ZG1 A;  2DK8 A;  4RGU A;  3P9K A;  1UHM A;  3ECO A;  4HA8 A;  2DQL A;  1B4A A;  4N9I A;  1XSX A;  2VN2 A;  1ZLK A;  5IT9 Z;  3MFK A;  4LB6 B;  2FNP A;  4U0W A;  4UVB A;  1FNN A;  4G6Q A;  3O6B B;  3R4K A;  3LST A;  1K6O A;  4MTE A;  3R0A A;  1BBY A;  1LNW A;  4Q48 A;  4ENJ A;  5E1Z B;  3BRO A;  1IXC A;  5D8K B;  4BNC A;  4AWX B;  2HTJ A;  4EMS A;  4LJZ F;  1HBX G;  1YLF A;  2IA2 A;  2L54 A;  2X0L A;  3F8N A;  1JHH A;  1HW1 A;  1R1V A;  4EJU A;  3J81 Z;  2O3F A;  2XAF A;  5FD5 A;  2DTR A;  2IA1 A;  5D5V B;  3RYR A;  1W5T A;  4I0A A;  4YG2 F;  1XGO A;  3QP6 A;  4XLP F;  4BQA A;  5ICE A;  4IRH A;  1FC3 A;  1H9T A;  3BDD A;  4AD9 A;  3MWM A;  1R7J A;  3K1N A;  1FSE A;  1LEA A;  2GXB A;  1TW3 A;  2A5Y B;  3TO7 A;  3CO6 C;  5FGM A;  4P96 A;  2EB7 A;  1HW2 A;  1I5Z A;  2FNA A;  2MD5 A;  1HQC A;  3CLO A;  3I59 A;  4GCV A;  4HW0 A;  2A6E F;  1GVJ A;  1MGT A;  5HS9 A;  4I02 A;  4M73 A;  3BP8 A;  5JI6 A;  1D8K A;  2HR3 A;  1IF1 A;  2IPQ X;  3WTS C;  4KIG A;  1U5T C;  5CVV A;  1SAX A;  1RUN A;  1SMY F;  4HZF A;  5EEG A;  3L7W A;  4BHB A;  3GX4 X;  3F23 A;  4A2U A;  3W6J B;  4MHG A;  3U1D A;  1BI0 A;  1ON1 A;  2VBY A;  5KVR A;  4I01 A;  2QQ9 A;  2AS5 F;  2G9W A;  4FT8 A;  4AIK A;  3MZY A;  4RGX A;  4HYE A;  3N97 A;  3WTX C;  4WXC A;  1R5H A;  4G94 A;  1UCR A; 
#chains in the Genus database with same CATH topology
 1O3T A;  2CJJ A;  2M87 A;  1G3W A;  2QSG X;  2VQG A;  4JBA A;  1E3H A;  2XAH A;  4D7M A;  5LRS A;  2XRO A;  1TQM A;  1ZRE A;  4CGZ A;  1IUY A;  2F4M B;  9ANT A;  2YU3 A;  4DJA A;  3RJP A;  3FXL A;  3LSG A;  4IL6 C;  1BM9 A;  2DT5 A;  3WG9 A;  3L1P A;  1GT0 C;  5D5W B;  3M7G A;  4JX6 A;  3TOB A;  4NB5 A;  1XMX A;  2LDU A;  4XID A;  1QPM A;  3MVP A;  2W85 A;  1SVM A;  3I4N J;  2MAB A;  2KFD A;  3E97 A;  3D0S A;  4C2M J;  4X1E A;  4Y17 A;  3SDG A;  1XMK A;  3TW7 A;  2LRD A;  3WTY C;  1P7J A;  4G7H F;  2A07 F;  4YIF A;  2FUG 2;  3FKJ A;  4EEF G;  2HI3 A;  5KK1 A;  1JHF A;  2MC3 A;  4CH7 A;  1D0Z A;  2EFP A;  2K40 A;  4BAY A;  3ZPL A;  5L3E A;  2DXI A;  1VQO I;  4W97 A;  2KJB A;  2ECC A;  1VQM I;  2BGC A;  3PO3 J;  3Q0V A;  2ZBK A;  4MEY F;  1UHS A;  4CCN A;  1NK3 P;  1D8J A;  3KET A;  4XLC A;  4EV0 A;  3OOP A;  2K4B A;  2O0Y A;  2Q0O A;  4AVP A;  3OYB A;  2EA2 A;  5FRN A;  1LFB A;  2COM A;  3U2R A;  3KYL A;  2JMW A;  3M3Y J;  1ETX A;  3FHN A;  2ZXH A;  1IO2 A;  2VPR A;  3DBL B;  1A5J A;  1WKM A;  1BIA A;  5DD8 A;  4MEX F;  2ZFU A;  5K5Q A;  2GZW A;  3JTH A;  3QQA A;  3TDZ C;  5DCF A;  2AXL A;  2L7K A;  2CO5 A;  4FAS D;  1A31 A;  1X1D A;  1MKM A;  1MBF A;  1WJ5 A;  3KYD B;  4AUX A;  3B6C A;  2GQQ A;  5ILU A;  3WU1 B;  4DW6 A;  2BBY A;  1LEB A;  3K1P A;  1YIJ I;  2CMP A;  1Z1D A;  2DFF A;  1SD4 A;  4BQN A;  2QSF X;  2ZXW H;  3GZ6 A;  3EYI A;  2V6C A;  2O5R A;  3KPH A;  5D5U B;  1FYL A;  2ELH A;  4DYC A;  3GZN B;  1WJC A;  3BLY A;  1I3Q J;  1LPQ A;  3Q9V A;  2VQL A;  2G0E A;  3EET A;  5FLX Z;  5J47 A;  2Y9Z A;  1N77 A;  1FBQ A;  4HQE A;  5F27 A;  2FD5 A;  4OIR F;  2WAE A;  1W4M A;  4BH9 A;  4PJL A;  3JRC A;  2ZME A;  3S3M A;  1G2H A;  4L9V A;  4XIC A;  3ECH A;  4BEH A;  2OTL I;  4L5J A;  5K7Z A;  2BYV E;  3P9I A;  4JOM A;  5LBQ A;  2E5Z A;  4LFU A;  2E7X A;  2B7E A;  4RBO A;  3RIR A;  3EUH C;  3I3L A;  3H9G A;  4KA4 A;  3I56 I;  2K9L A;  2Y48 A;  1QO0 D;  4HPQ A;  3A0B C;  1Y1W J;  5E17 F;  4A3B J;  5M3F J;  3J7A O;  1EA3 A;  2Z3Y A;  2H94 A;  5D4S A;  1QVT A;  2ELJ A;  3TP0 A;  3CME I;  4EVI A;  3HHG A;  3BR1 A;  4YEL A;  4Y7N J;  3RQ4 A;  1ZYR F;  4AU7 A;  2HU9 A;  2V1U A;  5E1X A;  4V2F A;  2EZL A;  2M0M A;  2H8W A;  4O6J A;  3I55 I;  3L2C A;  1P2F A;  4BE2 A;  3VYU B;  5TGT A;  5H20 A;  5FRM A;  4KIF A;  1H88 C;  3ABT A;  4IO9 F;  1H8A C;  2CG4 A;  3LOC A;  2R7F A;  2A5W A;  2R7D A;  1DGR M;  2Y0M A;  1ZKG A;  3BZK A;  2VBW A;  1Z77 A;  1AWC A;  5HNH A;  1ZGJ A;  5L3G A;  3GFJ A;  3ELK A;  2VB6 A;  5DEQ A;  3TED A;  1U5T B;  1V5G A;  1R6R A;  4Y13 A;  2JA8 J;  2PFB A;  1Z3X A;  4BEH B;  2M7A A;  5HVQ C;  3I54 A;  4MTD A;  2QBY A;  1ZTR A;  4CXF A;  3OIQ A;  2A3S A;  2FA5 A;  3MMY B;  2R7R A;  2QKL B;  1ENH A;  2E36 A;  4NC7 A;  5JHU A;  3DBH B;  3IAS 2;  3LSM A;  5GTI C;  2M8E A;  3J7A Y;  1Z7U A;  4ZH4 F;  5EG0 A;  4UUV A;  4BS9 A;  2XAU A;  4Q5S F;  4S05 A;  3CD6 I;  3U1K A;  1QGP A;  3IH2 A;  1TT5 B;  2V26 A;  4WX9 A;  2L0K A;  2VE8 A;  3HGG A;  4TV7 A;  4OOI A;  3H5R A;  1LVK A;  1T0F C;  3EDP A;  2YSR A;  3FHZ A;  4KFC A;  3SZT A;  1BJZ A;  3S1N J;  5KCM A;  2O8K A;  2PN6 A;  1QZZ A;  4DYR A;  3D5L A;  2BW3 A;  3BPV A;  1P7I A;  1KGS A;  1G59 A;  4ZDL A;  3K4N A;  1DPR A;  3MKL A;  2IS6 A;  5H2F C;  2VOP A;  3AAF A;  1Y0U A;  1XG1 A;  3S1M J;  3ZQ7 A;  5M5X J;  4OIQ F;  2NOJ B;  2EFN A;  4I76 A;  3ZQF A;  1T56 A;  3M07 A;  2JSC A;  2ZO4 A;  2BE5 F;  2IA0 A;  1FOK A;  1JT6 A;  1UG0 A;  2WA0 A;  3OS1 A;  2O03 A;  4LK1 F;  2LYC A;  3SZP A;  2HGC A;  2DK5 A;  3K0L A;  4A0Y A;  1J2X A;  2CFO A;  1XCB A;  2ZNY A;  1LDD A;  3D1N I;  3JRF A;  1XPX A;  4XRS G;  1IZ1 A;  2HDW A;  5CKT A;  3IRQ A;  2DPU A;  4AC0 A;  3CMY A;  1G6N A;  3WGH A;  4Q47 A;  4OMZ A;  4HSR A;  4A3J J;  4B09 A;  3PUB A;  3KP7 A;  1PUF B;  4ZYH A;  2EV6 A;  3LL7 A;  3QRF F;  1IDY A;  2F6C A;  3HOS A;  3PNV A;  4KYW A;  3A02 A;  5BMZ A;  5LRR A;  4LG0 A;  2OTJ I;  3CUO A;  2PEX A;  1S7E A;  2HKX A;  1ITY A;  1VQ6 I;  2H1L A;  1YIT I;  3OYK A;  4EJO A;  1WVR A;  3EUH A;  4GO1 A;  2H8R A;  4DBQ A;  2IT0 A;  2GIV A;  4IRI A;  4HEA 2;  4XRM A;  3GTG J;  2OZU A;  1MW7 A;  4LMY A;  1QVU A;  5E1W A;  3KLN A;  1A04 A;  2FXA A;  1KU9 A;  3KEO A;  2X1D A;  2DI3 A;  2WAF A;  4M6Y A;  2Q2E B;  3CP2 A;  3TDU C;  1VQ4 I;  3DU5 A;  2EZH A;  2WY7 Q;  4LIT A;  3CC4 I;  2ZCW A;  1TQI A;  3JTG A;  2RDP A;  1HA8 A;  3LSH A;  1Z7L A;  2R92 J;  2ECB A;  3RKX A;  3FMS A;  2MH2 A;  5K1Y A;  3C2H A;  2VKH A;  3CCJ I;  3V8K A;  4LOC A;  1AHD P;  4ZDO A;  3KYC B;  1TLH B;  2RRE A;  5GPC A;  4KIC A;  2CUJ A;  4HX7 A;  2JA7 J;  2XIG A;  3MKW B;  2KZG A;  2LKX A;  4BQQ A;  2JA6 J;  5HDN A;  1K79 A;  1OCP A;  2P8T A;  3I4M J;  2ME0 A;  5FFX A;  2E1N A;  3BR5 A;  2KJC A;  1MH4 A;  3C2B A;  1WFX A;  1J7K A;  1TL8 A;  2XPW A;  1MMS A;  2OCE A;  1YQA A;  4M71 A;  5DCM B;  1LUJ B;  1SMT A;  3DFG A;  4UVC A;  1BN5 A;  3FXU A;  4U0Y A;  2JRM A;  3PO2 J;  4EJW A;  1UMQ A;  1ZRF A;  4A12 A;  1E2X A;  3ZMS A;  1Y0N A;  2M1B A;  2VJ4 A;  3V7S A;  3DEW A;  1IN5 A;  3DXJ F;  3V42 A;  1OPC A;  4BHP A;  3F8B A;  3OYL A;  1Z05 A;  4D0P A;  2OJE D;  3HOV J;  1OLT A;  1JT0 A;  1IV8 A;  2HVS A;  3H36 A;  1R5I D;  4ZZL A;  5ERI A;  1H0M A;  2WBM A;  1J75 A;  3HRT A;  3E6M A;  1MH3 A;  3L2R A;  2KL4 A;  3GCM A;  1XGS A;  3HOT A;  2V1D A;  2ELK A;  5HLH A;  1BOA A;  2XUB A;  4CCM A;  1I1S A;  5HOO A;  3Q0U A;  3K70 D;  5FLM J;  1VQL I;  4Y52 J;  1I6H J;  1ORK A;  1YHQ I;  2IS1 A;  2IGN A;  2XF5 A;  4HLX A;  3BR0 A;  4ENK A;  3SDB A;  2LNB A;  2CQK A;  2IBD A;  4AIH A;  1IC8 A;  3BOQ A;  3LNQ A;  1DUX C;  4YFK F;  2HOS A;  4II3 A;  5A2Q K;  2W82 A;  3CCR I;  1BIB A;  1XDU A;  3FM3 A;  1M1E B;  4HQM A;  3T8T A;  1FMV A;  3HJE A;  5D5X B;  2H6C A;  4ASN A;  5FJ8 J;  2LY1 A;  1JKR C;  1R22 A;  3CTA A;  2WY8 Q;  2E34 A;  1VQ5 I;  2XHK A;  3ROU A;  2DMU A;  5JLX A;  3QYF A;  2DA1 A;  1E17 A;  1BI1 A;  5L3F A;  1Y39 A;  2XVC A;  3HPH A;  2BY2 A;  1LQ1 A;  1I6X A;  1N78 A;  3KEQ A;  2W00 A;  4AID A;  3BTJ A;  2Z1D A;  4HAM A;  2RNG A;  1MJA A;  2PJP A;  3OYN A;  2E1C A;  2VJI A;  2UWM A;  1IRG A;  3HSF A;  3W2W A;  5K5R A;  2KIU A;  1ZQ3 P;  2VBZ A;  5HLI A;  2BHY A;  2V1X A;  3IV5 A;  2LSO A;  1WSU A;  3HG9 A;  1JUM A;  2ZSI B;  1UZC A;  3HYI A;  4ZTF A;  3BCB A;  5J40 A;  2M5W A;  3M8J A;  3WE2 A;  1NG7 A;  1XGN A;  4M9Z A;  4XSZ F;  4KJZ A;  4IHY A;  1S9H A;  2LKP A;  2J5O A;  4RB3 C;  3HGY A;  2DW4 A;  1P9Q C;  3BQZ A;  1HXD A;  2R4G A;  1TWC J;  3BTC A;  1SFE A;  3K1M A;  4DGW B;  5HLG A;  1DPU A;  2X1C A;  2GBY A;  1APL C;  1VQ8 I;  1ETY A;  2XSD C;  4A69 C;  3FK6 A;  4PZJ A;  2UXX A;  1WJA A;  1YFH A;  1C0W A;  4LK0 F;  2M3A A;  1XS9 A;  4X0G A;  5H6R A;  2FJ1 A;  2LD5 A;  2Y31 A;  1EKE A;  2HXO A;  4OIO F;  1J09 A;  3M4O J;  5EDN A;  5CVR A;  2Z9O A;  2LLK A;  1IRX A;  1HKQ A;  1MSF C;  3A1Y A;  1X2N A;  3OS2 A;  2KIF A;  1JGG A;  4JQF A;  4XRF A;  3L09 A;  5DS9 A;  3TO9 A;  2NRA C;  4CO8 A;  1IXR C;  1KYZ A;  4LB5 A;  4M3D A;  3WE3 A;  3ZR8 X;  5FFZ A;  1LDJ A;  5FO5 A;  1BA5 A;  1FWZ A;  2L02 A;  3WTT C;  3DBR B;  3GFI A;  2VT2 A;  2Y69 H;  3ZP5 A;  3H5N A;  2GXG A;  2FX0 A;  4L9J A;  4F3Q A;  2WTE A;  3FXR A;  5IYB J;  1EH8 A;  2NS0 A;  4R79 A;  5IP9 J;  4A3D J;  4MLO A;  3ONQ A;  3REO A;  2X1E A;  1YJN I;  3DF8 A;  4KUM A;  1QQI A;  4B3X A;  2QSH X;  2XV4 S;  3RPU A;  3BY6 A;  4FHT A;  4IOC F;  2WB1 A;  4PDK A;  2F5F A;  3VOE A;  2ID6 A;  2GA2 A;  1MMD A;  1TWH J;  3BTL A;  2JVH A;  3CMA I;  3EUA A;  4D5F A;  3CJQ B;  3S1R J;  5DUK A;  5HOD A;  2DCE A;  3U9G A;  3B02 A;  4E4H A;  2QBY B;  2W4S A;  1ONV A;  2F4O B;  2I5U A;  3LQQ A;  3P7N A;  2BY3 A;  2RGV A;  3HIF A;  3CJR B;  1X19 A;  3ULQ B;  4E7I A;  5BOX A;  2CGP A;  6PAX A;  3DPT A;  4B8X A;  3OYH A;  1WI3 A;  3VYS B;  5HDG A;  1E3O C;  5IY5 H;  5ICC A;  5A2Q Z;  1VTN C;  2IJL A;  3S3O A;  1PUF A;  1P4X A;  2FBI A;  2X9D A;  2KP6 A;  1J9I A;  3RKY A;  1K6Y A;  2ZFW A;  2JN6 A;  2DU9 A;  4E7K A;  2STT A;  1AKH A;  4ZDP A;  2R7Z J;  1U78 A;  3HHH A;  3HOU J;  2NAZ A;  3DPU A;  2R93 J;  4E7Z A;  3LA2 A;  2OV7 A;  2L9S A;  3TBI A;  1HOM A;  1KZH A;  1XSV A;  1U5T A;  5LGN A;  4XL9 A;  2PLY A;  1B8I A;  2DOF A;  2H09 A;  4NQW B;  3BR6 A;  3FBN B;  2XKO A;  2ADU A;  3JSO A;  5LEK A;  4EAT A;  3BCA A;  1ZK8 A;  4ABZ A;  3PNT A;  2L5Q A;  3SZG A;  3F72 A;  1ZGW A;  3GEZ A;  1W7P B;  3ABM H;  3EQL F;  3JAM Z;  4IZZ A;  1B1B A;  5ILV A;  1P92 A;  5F0F A;  3HXL A;  4J01 A;  3NAU A;  2ZJR F;  1OYY A;  1TP4 A;  2FE3 A;  4QSH A;  1EJ9 A;  4G6T B;  3DKY A;  1JE8 A;  4IHS A;  3PIP F;  4CZC A;  1FTT A;  4ZYG A;  4RAG A;  3CDH A;  2Z16 A;  2LMD A;  1G3T A;  5ILS A;  2IGO A;  4UY8 I;  2R7O A;  1W0T A;  1JUS A;  2FQ4 A;  2F2E A;  3H0D A;  1YRN A;  2R0Q C;  4XOT A;  2HYJ A;  2WC2 A;  3HM5 A;  2E71 A;  1SD7 A;  1MDM A;  1BW6 A;  4MQ9 F;  1X1C A;  3AG4 H;  2JWT A;  3ZQQ A;  2FEZ A;  1YYV A;  4HX8 A;  2A6T A;  3G3Z A;  1NK2 P;  1ZEL A;  2F48 A;  3H92 A;  1WCM J;  2HZT A;  2XAS A;  2VQH A;  3EPZ A;  1DDN A;  2XF6 A;  1S6L A;  1BOB A;  2M7B A;  1FSH A;  2JPC A;  2M0C A;  4DBR A;  2E35 A;  1TNT A;  2L9R A;  1VI0 A;  2KIQ A;  5FB2 A;  3IP4 B;  4ANJ A;  2VE9 A;  2L4A A;  3GME A;  2NS7 A;  2P7C B;  1X1A A;  2XGE A;  4E7S A;  1S72 I;  2DAO A;  1KU2 A;  4RDU A;  4S04 A;  5LEJ A;  3B6A A;  4A3I J;  1D5Y A;  3HOZ J;  4U7D A;  5F0H A;  5JVG F;  4Q4Z F;  4KMU X;  2KRC A;  1IN8 A;  1I1G A;  3CZ6 A;  2ZC2 A;  2NVU B;  4CYD A;  5J4Y A;  3BT9 A;  3DCF A;  4E6K G;  3CUQ C;  3QPL A;  1MNM C;  1VQ7 I;  2A05 A;  5GP9 A;  1JKO C;  2IEK A;  2CV0 A;  3ZN1 A;  5B5E C;  3MEX A;  4BAC A;  2HYF A;  3LSJ A;  2M4G A;  1JTY A;  3SFZ A;  1IRF A;  3FXQ A;  1IUF A;  3E3V A;  2E2H J;  3K4K A;  3JR9 A;  4ITV A;  2P5K A;  2K5C A;  3FWE A;  3IWZ A;  3K9T A;  2F5V A;  2IW5 A;  3J80 K;  2HDC A;  3BPX A;  3HB9 A;  1UEL B;  4HOB A;  3ZMV A;  3VYT B;  2GAU A;  1BJA A;  2Y75 A;  4J19 A;  1BI2 A;  2DT6 A;  2LRE A;  3HRU A;  3A4C A;  1ETO A;  4BBS J;  4XKV A;  4RAF A;  1F4K A;  1K83 J;  4YFX F;  3CJN A;  2HEO A;  3E5U A;  4WCG A;  2C6Y A;  4HLY A;  4PJM A;  2LOO A;  2Z5U A;  1FP1 D;  1OR7 A;  1QHH D;  2NOG A;  2YPR A;  1BR2 A;  3F3X A;  3DV8 A;  4LLL A;  3WTU C;  2VXZ A;  4LGW A;  3J7Z I;  1JI8 A;  2ZNZ A;  1CF7 A;  3OR2 C;  4YRV A;  2LFB A;  1S7A A;  4XON A;  2HDD A;  4A93 J;  2H27 A;  2QA4 I;  1Z0X A;  2CQQ A;  2F5D A;  4NC6 A;  1T8I A;  5TJJ A;  1X58 A;  5FLV A;  1SVL A;  1FZP B;  4FE4 A;  4BYY A;  3GTP J;  1FMW A;  1MMN A;  3OWT A;  1JGS A;  1CF7 B;  1HKT A;  4C30 A;  3HPG A;  2DLL A;  3C3W A;  1ZRC A;  3R0J A;  2VOD A;  2DFE A;  1WGX A;  2VIX A;  3R60 A;  1Y56 A;  2EH3 A;  3G73 A;  3H35 A;  2CSO A;  3BJA A;  4FE7 A;  3SEZ A;  3VYR B;  4CYC A;  1YX3 A;  2AXT C;  1X4P A;  3K4L A;  3OYJ A;  1GXQ A;  1KQ8 A;  3OYF A;  2HWV A;  2DN0 A;  2L01 A;  4CCL A;  4E70 A;  1G4D A;  1P6R A;  2QGU A;  4DOZ A;  1HCR A;  4QTR A;  4DQ2 A;  2IAI A;  1O7L A;  2DT7 B;  2EIJ H;  2WAD A;  1OCC H;  4ESF A;  2XC7 A;  4LLN A;  1TBX A;  4XLN F;  3I71 A;  4XMY A;  2V9K A;  4LG0 B;  3GYH X;  1KQ0 A;  1X3W B;  1S29 A;  2YUS A;  2IVM A;  4L9T A;  3S16 J;  2M34 A;  1D3Y A;  5F0C A;  4Z2Y A;  4EGY A;  2JT1 A;  1ULY A;  3PL8 A;  2V4J C;  2FQ3 A;  3ZMZ A;  4U7B A;  2VJJ A;  1G3Y A;  3DLA A;  1MD0 A;  3TOA A;  3J81 K;  2PI0 A;  1VF9 A;  3K70 C;  4O5V A;  4AYB A;  4ZJZ A;  3V8J A;  1ZLJ A;  2V9P A;  1ERD A;  1USS A;  2CWE A;  1MJ9 A;  5EYR A;  4QLC U;  2ESH A;  3CQZ J;  3OL3 A;  1Q1V A;  1SD5 A;  3U21 A;  4BXF A;  1T39 A;  4A3C J;  3NWS A;  2PX9 A;  4XKB A;  4F93 B;  5DUI A;  4XSX F;  2M2E A;  4C2U A;  2RV8 A;  2P6S A;  3HBL A;  3HEF A;  2K27 A;  3GTQ J;  2UXN A;  3LSK A;  5J3L A;  2DOD A;  5D6E A;  3O8H A;  2HTS A;  1FBS A;  2K86 A;  4L5I A;  3KLO A;  2VUM J;  3MAJ A;  2XB5 A;  3ABU A;  1XSD A;  1I50 J;  3RZD J;  5JLW A;  2NNY A;  2K02 A;  3GTL J;  2EZK A;  1QHG A;  3SXY A;  3ZQG A;  2K9N A;  5B1B H;  3JRA A;  4BJT A;  1XN7 A;  1GXP A;  3PSF A;  5J1U A;  3R6S A;  3HUG A;  4AYB N;  4G9Y A;  3X2Q H;  2R7Q A;  3HSE A;  3ZQH A;  1B72 A;  3RSN A;  2W24 A;  2H6B A;  2HOA A;  2V9V A;  3ISP A;  4P55 A;  1HF0 A;  3T8R A;  2M30 A;  3IAM 2;  1WI9 A;  2VOO A;  2L2O A;  4K2E A;  2I10 A;  3L2W A;  4I98 B;  2EWN A;  4XLE A;  5E3L A;  4WXH A;  2ETH A;  1S7O A;  1XGM A;  1YJ9 I;  2X6Y A;  1I27 A;  2W84 A;  4JX5 A;  5IT3 A;  3LSP A;  2WWY A;  5CJ9 A;  2MSY A;  4GYG A;  1F43 A;  3HOY J;  2D45 A;  2NNN A;  1MDM B;  2XAG A;  4QWQ A;  2UZK A;  5GAH J;  4ESJ A;  3PFI A;  1GVD A;  3K2Z A;  3SQN A;  3QU6 A;  4Y4R A;  3ESW B;  1U3E M;  1O3R A;  3HOW J;  2P7V B;  4KIB A;  3FMQ A;  4BXU A;  4PGH A;  3G6E I;  2VQC A;  3BR3 A;  2KKO A;  3FIS A;  4CIC A;  3CMM A;  3TW6 A;  4BJ5 C;  4ZC3 A;  1FOY A;  3TO6 A;  2EV0 A;  4HST A;  2DFI A;  4MFD A;  1J0R A;  4EM2 A;  2PJR B;  3IKV A;  5FRO A;  2EZI A;  2VXD A;  1BC7 C;  4BJ6 C;  3PJR A;  2V1N A;  5C44 J;  2P6T A;  3S3N A;  1FPQ A;  2RQQ A;  5CQG A;  1TC3 C;  2PBI A;  1H89 C;  4PSX A;  4B1R A;  4Z6Y A;  3F8C A;  1WRJ A;  1SVO A;  3BJO A;  3KIO A;  2XPV A;  3JAM K;  1LE8 A;  4RGS A;  1QNT A;  2A6H F;  2E1O A;  1O57 A;  2LH9 A;  4P5O A;  1YW7 A;  2CQX A;  3GF2 A;  2LG4 A;  4A0Z A;  2ZSH B;  1ETV A;  4PGG A;  1JTX A;  5HS8 A;  1BC8 C;  1PP7 U;  4GXO A;  2R5Z B;  2EIM H;  4JYK A;  4UB6 C;  5HDK A;  3W2V A;  1FLI A;  2IS2 A;  1B9N A;  3C1D A;  4N0B A;  4O3M A;  2NVX J;  3SHF A;  1YW9 A;  2PMZ N;  2HYG D;  2XB0 X;  3DKW A;  4RM3 A;  1OJL A;  1Z6T A;  2RC4 A;  3OOU A;  2Q8K A;  2XAJ A;  5KAI C;  2UV1 A;  1DU0 A;  1IN4 A;  4PFO A;  1JJ6 C;  3QP5 A;  2WAQ A;  2PG4 A;  5LGT A;  2ZJQ F;  1R1T A;  4NBQ A;  1U9N A;  3KZY A;  3V7C A;  2B9S A;  2BY0 A;  2GIZ A;  3K69 A;  3ZMU A;  2XGX A;  3FDY A;  3VPR A;  4AM3 A;  4M9S A;  1FIP A;  2EK5 A;  1MBE A;  1SAU A;  4Y3O A;  4IHX A;  3R61 A;  5GTH C;  2NYX A;  2ICW G;  3VOD A;  3SYT A;  3HRM A;  1Z9C A;  4RB1 A;  4IRG A;  3JRG A;  2JQ7 A;  2AO9 A;  3KP6 A;  5J6X A;  2MH9 A;  5LGU A;  5C4J J;  1Y6I A;  1FIA A;  5DM7 F;  2R7T A;  1DP7 P;  3IHU A;  4W1U A;  3DLL F;  5CLS A;  5EJC A;  2VON A;  2EFW A;  5IP6 A;  1T98 A;  1F36 A;  4XK4 A;  5ICF A;  4BE1 A;  1U8R A;  2XKP A;  2HQ5 A;  3VEP A;  2DOA A;  3V7R A;  3HTS B;  4RMN A;  4H0E A;  4I2O A;  3KFW X;  4M3G A;  5EEA A;  3D5S C;  3BG3 A;  3GLX A;  4KT6 A;  2QUF A;  2QM3 A;  3F6O A;  1TT0 A;  2V7F A;  5J4V A;  1ZH5 A;  2E2I J;  5EGO A;  3GVA A;  4IOA F;  1S3J A;  2LVS A;  3GW2 A;  2DA4 A;  4OU0 A;  2MG4 A;  4F52 A;  4BHC A;  5E8I A;  1RNL A;  1KA8 A;  3ML6 A;  1DGW Y;  3T1B A;  1B8I B;  1YOV B;  3T0Y A;  2OD5 A;  4BBR J;  1WWX A;  2ZB9 A;  2BV6 A;  2OQG A;  3ZQC A;  3S17 J;  3K10 A;  1YG2 A;  4ZZD A;  3NRV A;  3FXO A;  1EV7 A;  3ASO H;  2FU4 A;  3S93 A;  2ZJ2 A;  1VND A;  3J7Y J;  1R36 A;  1W7P D;  2DO7 A;  1R23 A;  3CUQ B;  1RI7 A;  2KIM A;  4G7Z F;  3P5J A;  4MGR A;  1R58 A;  2Y9Y A;  3OSG A;  3CCU I;  2HS5 A;  3OS0 A;  4HBL A;  2WV0 A;  3K4C A;  1A36 A;  2DA7 A;  3KE2 A;  4C3H J;  4IHV A;  1Y1V J;  2O8X A;  2OBP A;  3KP3 A;  2KPM A;  5AON A;  2BOL A;  2IP2 A;  4LD5 A;  4MQV A;  1BR1 A;  1WHU A;  5L3D A;  3N05 A;  4N9H A;  1NH3 A;  2IGM A;  1RC9 A;  2RQP A;  2MW8 A;  5BQT A;  4UXN A;  3P9C A;  1V5F A;  3KP4 A;  3OYI A;  2G7U A;  2F5C A;  4CHU A;  2MLG A;  1FY7 A;  5K5O A;  4RLQ A;  1DP3 A;  4M3F A;  4UUS A;  5TRD A;  3MQ0 A;  2FRH A;  4OMY A;  1KQ9 A;  2ESN A;  4QPO A;  1LFP A;  2VBX A;  1FJL A;  2XRL A;  4EGZ A;  2JTV A;  4A3L J;  4XOP A;  5FD6 A;  2MLK A;  3VSK A;  2EFQ A;  1QBJ A;  2DA5 A;  2R5Y A;  4KN4 X;  4XQF A;  1YO5 C;  1DU6 A;  2JSP A;  4M74 A;  3WTV C;  1YS7 A;  1ODD A;  2E1M C;  2EFO A;  2Z99 A;  2HFH A;  1XTA A;  4IQ4 A;  4U88 A;  1UFM A;  3WOD F;  4BGD A;  3HC7 A;  1V5E A;  2FF4 A;  2CV2 A;  2ID3 A;  1PJR A;  4M9X A;  4PUS A;  3ZN0 A;  1IGN A;  4NHJ A;  3HRS A;  3TP3 A;  1WQ2 A;  3H1C A;  3GTJ J;  2CYY A;  2XRN A;  1MBH A;  3AG1 H;  1RRJ A;  4PJN A;  5F08 A;  3QPH A;  4EQQ A;  2P5L C;  4F7Z A;  2M45 A;  1V54 H;  1JXS A;  4U0V A;  4XR6 A;  4A6D A;  2L4M A;  2XGD A;  2D1H A;  5F6F A;  2IRF G;  1OCR H;  2XAQ A;  5LFA A;  3M8F A;  1XDS A;  1D1C A;  3E5Q A;  3FZV A;  4G7O F;  3OYG A;  2ZKZ A;  3GZ5 A;  4HNT A;  3OL4 A;  5HLT A;  3JSP A;  2OF7 A;  1LVA A;  3ZCO A;  3IH4 A;  3GO5 A;  2HPI A;  1TZL A;  1WH7 A;  4Y15 A;  2QEN A;  5CQE A;  1T2K A;  3H9Q A;  3JCU C;  1Z67 A;  3OYM A;  3E6C C;  3GBG A;  5TIS C;  5LHG A;  1G3S A;  4M3E A;  1SC7 A;  1X3U A;  2FBK A;  1R71 A;  1X4O A;  1QZE A;  3FXM A;  2OZ6 A;  4HV6 A;  3IH3 A;  1UST A;  2EA4 A;  2GA1 A;  1OQY A;  1ZRD A;  4RB0 A;  5D8L B;  1IAW A;  2HPM A;  2VKE A;  2DBB A;  3HL2 A;  2DA3 A;  4RS8 A;  1ZAR A;  1DQU A;  5IP7 J;  4ON0 A;  5BPI A;  3ABK H;  5CVJ A;  3UR3 C;  2E5N A;  3RTR A;  2KIS A;  1ZG3 A;  3WU2 C;  2JZY A;  2STW A;  4IPA A;  4I7H A;  2L7M P;  1ETW A;  1Y8Q B;  1P4A A;  5LHH A;  3OYD A;  3AL0 B;  3CCY A;  2E19 A;  2LF8 A;  1T6S A;  4XLA A;  2KDZ A;  1RUO A;  3I53 A;  2LBF A;  3L00 A;  2ZJP F;  2MYS A;  3F8F A;  3FX3 A;  1IXS B;  1MMG A;  4QIW N;  1YRN B;  4RM2 A;  3RPU D;  3BR2 A;  3VSL A;  2HQA A;  3G2B A;  5EZG A;  1PDN C;  2HOT A;  3HSR A;  1HDD C;  3IL2 A;  2CUF A;  1ZR2 A;  2MBF A;  2PMZ A;  5B3S H;  3AFH A;  1FT9 A;  4EM0 B;  5J8F A;  1SD6 A;  2QYO A;  2X6X A;  3NWT A;  3BJ6 A;  1GV2 A;  3LAJ A;  1I39 A;  1KU3 A;  1U0J A;  1SFU A;  2YX4 A;  5C4X J;  2ZXJ A;  3BWG A;  3ZMT A;  2CQN A;  2WAQ N;  2EIN H;  4G6D A;  4I09 A;  1FYK A;  2NS8 A;  2L9N A;  1R4N B;  1ZGA A;  2Y0S N;  2H1K A;  1T38 A;  2HKO A;  1KYW A;  1MBJ A;  4WXD A;  4ZYD A;  2R7W A;  2X51 A;  3SJM A;  1V4R A;  3MCZ A;  1YS6 A;  2D2W A;  3PSI A;  4ESB A;  4KN7 X;  4R8H A;  3H3V K;  4B43 A;  5DDG A;  1B6A A;  4CDG A;  2KZV A;  2P0W A;  1J5Y A;  3A0H C;  4I99 C;  4YII A;  1VQN I;  3C7J A;  3KP2 A;  1QA6 A;  5IYD J;  2CW0 F;  3O2P E;  5AIQ A;  5GPA A;  1K4S A;  1OCZ H;  2RKH A;  3F22 A;  2EBI A;  3FM5 A;  3LFU A;  3F6V A;  2QKM B;  3Q9S A;  2ZXI A;  4OIN F;  2VL8 A;  4NQW A;  3CF5 F;  1K78 A;  2PQ8 A;  5EGO B;  2QLZ A;  1PUE E;  2B0L A;  2W48 A;  5FKN A;  4A5M A;  2P4W A;  1IJW C;  1LB2 A;  1OYI A;  3TKY A;  2BZT A;  3M8E A;  4GYI A;  3LA7 A;  5BNG A;  2EIK H;  2TRT A;  2L7Z A;  4BY7 J;  2D5V A;  2HOE A;  3CF2 A;  1AKH B;  1YJW I;  3VDX A;  4M6X A;  1STZ A;  1UB9 A;  1RKT A;  2YS9 A;  3BZC A;  4R1H A;  1T0F A;  3MZ8 A;  5L3B A;  2OCC H;  5CPR B;  2MD0 A;  3KX2 A;  5LD2 C;  3ZMD A;  4ZYE A;  3N4M A;  3K6G A;  4FTH A;  4OAY A;  4A6E A;  2L9V A;  5HNF A;  1ETK A;  1O3Q A;  4MIM A;  2FML A;  4IJA A;  2QQA A;  2P81 A;  5CVI A;  5M3M J;  3I58 A;  4I6Z A;  2CFX A;  1UHW A;  4P9F A;  4CCO A;  5FKM A;  2HQR A;  1CQT A;  2OAZ A;  3TGN A;  4OIP F;  4V19 K;  1WPK A;  4B3A A;  1W0U A;  3GFM A;  1K7A A;  2A61 A;  3O8G A;  3QPT A;  3E6D A;  1B9M A;  4HV5 A;  2LC2 A;  1YW8 A;  5E79 C;  2OC6 A;  3V8L A;  1X3Z B;  1D1A A;  4GRI A;  1RPW A;  1VZ0 A;  1J59 A;  5IOY A;  3LAP A;  2YR2 A;  1R49 A;  2DQR A;  3SFI A;  4B4C A;  4E7J A;  4LLG F;  4AIJ A;  4FX0 A;  5EEH A;  5ED4 A;  4A3F J;  3CC2 I;  2OQR A;  1YI2 I;  1MJB A;  3PNY A;  1IRZ A;  2HVQ A;  2R3S A;  3CDL A;  3Q3S A;  1U8B A;  2GM4 A;  2DJN A;  3G71 I;  3AKZ A;  4XM3 A;  2B63 J;  3DTE A;  5E3M A;  4IEJ A;  4UNO A;  4HG2 A;  2BHZ A;  4IHT A;  4EJV A;  1CGP A;  1OR7 C;  3C2G A;  3LSI A;  3S2W A;  1HW5 A;  3I0T A;  3S2H J;  2DJI A;  2E7W A;  3CDI A;  3BG7 A;  1HSJ A;  1BR4 A;  2DYS H;  1WJB A;  2NVY J;  4GGG A;  5D4R A;  2VKD A;  1ZG5 A;  2DMT A;  1HDP A;  2A68 F;  2FOW A;  3L2U A;  3HUG B;  3RI4 A;  5E3O A;  1BI3 A;  2K4J A;  2CW7 A;  4ZTJ A;  1LFU P;  5EG0 B;  3QWL A;  1IW7 F;  1FOX A;  3E5X A;  1QU3 A;  3E6B A;  3BTI A;  4B47 A;  1O3S A;  1RES A;  2MC4 A;  2GWR A;  1PVE A;  4FET A;  4C3I J;  3DTK A;  2O9L A;  3LFK A;  1QZY A;  1FX7 A;  3CC7 I;  2RNJ A;  1SAN A;  2W57 A;  2XDV A;  2K9S A;  2ZME C;  3K7A J;  4RGR A;  1FOW A;  1A6I A;  1TW2 A;  1H9G A;  2JPB A;  3GXO A;  5F1R A;  1P4W A;  3AL0 C;  1Z91 A;  2EIL H;  1OKR A;  4IVN A;  3K2A A;  1REP C;  1W1W E;  5DM6 F;  2JK3 A;  4IXA A;  4IHW A;  3LQR A;  5F1J A;  3GTO J;  2G7H A;  3I64 A;  1WJE A;  3JW4 A;  1A35 A;  3BZ6 A;  3T5X A;  3CCE I;  5E8G A;  1UJ8 A;  4BE0 A;  4L0Z B;  1GUU A;  2O61 A;  3RDI A;  2BVL A;  3WGI A;  4E7H A;  3L9F A;  1FBU A;  3KCC A;  3QYB A;  2NVT J;  4RB2 C;  2L3D A;  2TDX A;  1SFK A;  4A3M J;  4N4N B;  1ON2 A;  5FKK A;  4A0X A;  3RYP A;  3COA C;  4JP0 A;  4IF4 A;  4G12 A;  2MFZ A;  3OYC A;  3DPL C;  3MKY B;  2LF7 A;  3RZO J;  1GDT A;  3TQN A;  3QU3 A;  2W7N A;  2I8D A;  1EH7 A;  4HF1 A;  1LE8 B;  4OAZ A;  2NVQ J;  3J80 Z;  4XKW A;  4XLH A;  1ZAO A;  5F64 A;  3KZI C;  3KEY A;  4C2T A;  1TWG J;  2A69 F;  4L9N A;  2GOX B;  2LY9 A;  4YEJ A;  4HDU A;  4P1W A;  4A3K J;  2LR8 A;  4FQG A;  4DNC A;  3ZOB A;  4KMF A;  3DU6 A;  4PCQ A;  5BS6 A;  5FLX K;  5GAG J;  2D1V A;  3QPS A;  3DP7 A;  3WGG A;  1VQP I;  1OYW A;  2DA6 A;  2YX7 A;  1FP2 A;  1YTY A;  4CCJ A;  3G4S I;  3EUK L;  2PMU A;  5B66 C;  4S0H B;  2EV5 A;  5JVT A;  2WB1 N;  3OIO A;  4UV9 A;  3A01 B;  3Q5F A;  3IUO A;  3KP5 A;  2GOM A;  2OA4 A;  4JK1 X;  1LKX A;  3G1O A;  3V4G A;  3ERE D;  3HTU A;  1YIO A;  1Z21 A;  1ZHF A;  4XKC A;  2R5Z A;  4RAZ A;  1E3P A;  2QWW A;  3IRR A;  2F5E A;  4G8X A;  4A3E J;  1W36 D;  2HVR A;  1D5V A;  2X6O A;  5K7H A;  1O7F A;  1MZB A;  2HXI A;  1NTC A;  1AOY A;  4GDF A;  1RZ4 A;  2VLA A;  4HF2 A;  2QF7 A;  5IOZ A;  4L5E A;  3O3K A;  2J5P A;  2EJR A;  3L2Q A;  3K4J A;  2PMH A;  3C18 A;  1EH6 A;  1S8N A;  3FF5 A;  3B73 A;  2KMU A;  4EM1 A;  1RIO H;  5E20 A;  3PUF A;  3FK7 A;  2V6E A;  1N25 A;  4XN3 A;  3CJT B;  3RKW A;  2OPT A;  1TTY A;  5DV5 A;  3MKZ A;  5FKO A;  3OIP A;  3DTI A;  1NHA A;  2K85 A;  3EYY A;  3PQJ A;  2QVO A;  2VAS A;  3GWZ A;  3JRB A;  3OSF A;  1R00 A;  1JKP C;  4WWC A;  1V3F A;  4MNU A;  1XB4 A;  1V55 H;  1GV5 A;  3QOE A;  1K78 B;  4BXX J;  1TWF J;  3LA3 A;  4BY1 J;  3GTM J;  4UV8 A;  4KDP A;  3IC7 A;  3CO7 C;  1JKQ C;  1A6Q A;  3LMM A;  5H6Q A;  3OR1 C;  1JUP A;  2E2J J;  1F9N A;  3BG6 A;  2DMN A;  2RAE A;  3CUQ A;  3LSR A;  2CW8 A;  4WF2 A;  2EQR A;  2DOE A;  3FKI J;  4FCY A;  2GLO A;  2QQB A;  5DYM A;  1OIS A;  3WU0 A;  1F1Z A;  2ISY A;  2K3P A;  2ACJ A;  2JUG A;  3JRH A;  3I4P A;  4PFP A;  4ENM A;  3I59 B;  1X2M A;  2DMQ A;  5HS7 A;  5FKL A;  4F55 A;  4MFE A;  2COB A;  3E0J B;  5M5Y J;  1B72 B;  4UVA A;  4FX4 A;  2JVG A;  1W5S A;  1IV6 A;  4L0Y B;  5GAE J;  4BKX A;  1FTZ A;  2NXN B;  1MBG A;  1WJF A;  3ZQI A;  2TCT A;  2RVC A;  3W2A A;  2VT3 A;  3A01 A;  4HDV A;  4HNV A;  1L0O C;  4NDL A;  1RR7 A;  5DCM A;  5LLQ A;  4BDZ A;  4ENN A;  5M5W J;  1R5G A;  1MMA A;  5JFR A;  3PFY A;  1U9O A;  1OCO H;  2FMY A;  1HST A;  2JRT A;  1XMA A;  3CCS I;  3L2V A;  4BU2 A;  2KQR A;  1HC8 A;  3JRI A;  4CYC B;  4D7N A;  2FSW A;  2R5Y B;  2W1O A;  3F8M A;  1ZR4 A;  3AG2 H;  1WJD A;  1XC5 A;  2AHQ A;  2BVM A;  1IG7 A;  4KNY A;  1U6G A;  1ZN2 A;  1W36 C;  2MGQ A;  3NAR A;  5J8C A;  2K3F A;  4KT5 C;  4A5N A;  1FYM A;  4XLF A;  1IN7 A;  2JJ7 A;  2VC0 A;  1TNS A;  4L18 B;  2BEO A;  4ZYA A;  2Q2E A;  3FIW A;  4M72 A;  4YFN F;  2V79 A;  4MO7 A;  2QQ8 A;  3FBI B;  4WK8 F;  1R1U A;  2R7U A;  3NQO A;  4NNJ A;  1O4X A;  3RCO A;  3HOX J;  1RR8 C;  4BDY A;  3F9K A;  2RN7 A;  2DYR H;  3IWF A;  2M4K A;  3M9A A;  3S2D J;  4CSW A;  4F92 B;  1F5T A;  3WTZ A;  4X6A J;  1XCV A;  4OWR B;  1AU7 A;  2VC1 A;  2KRH A;  3H3U A;  3DKX A;  1HKS A;  4NUB A;  5LHI A;  2W25 A;  2KHM A;  3OY9 A;  3OYA A;  4H4K C;  2L7F P;  5K7F A;  2O6G E;  3RPQ A;  2X85 A;  2M8G X;  4XBF A;  3QAH A;  2ISZ A;  1GHC A;  3PQK A;  3ASN H;  2OU2 A;  3CP8 A;  4EJT A;  2Q1Z B;  4RA2 A;  3CES A;  3HDD A;  2K9M A;  3VB2 A;  3I5U A;  4GFB A;  4I0B A;  4LIV A;  3CCL I;  4Y33 A;  3LWF A;  5GAD J;  4AVZ A;  5IT9 K;  2DDA A;  3MD2 A;  4P9U A;  3OV8 A;  4BUP A;  5EF6 A;  3QYE A;  5ICG A;  2R7S A;  4RLF A;  1T08 B;  1UG2 A;  1PP8 F;  5AIP A;  3H3Z A;  5DD4 A;  1LJ9 A;  5KNL A;  3GTK J;  4RAY A;  1VFC A;  3W6K B;  5JR3 A;  3KZZ A;  2UUZ A;  3WG7 H;  4D1Q A;  1OMI A;  2KRF A;  1W7P A;  3S14 J;  1E0E A;  2HQN A;  3FMR A;  4XRS A;  3CCQ I;  1KU7 A;  1YX5 A;  3M1E A;  4UHT A;  3BQY A;  4CZZ A;  1U2W A;  1OFC X;  2FOK A;  3ZXS A;  3W6V A;  2Y30 A;  2X4H A;  2CS3 A;  4JX4 A;  4HNU A;  5L3C A;  2KT0 A;  5J1Y A;  3VFZ A;  5CYV A;  3QOP A;  3DEU A;  3TL4 X;  5BPD A;  3HKZ A;  2IXS A;  4PK4 A;  3GUD A;  1Q1H A;  1VQ9 I;  1T95 A;  1LDK B;  3E1S A;  1NG6 A;  3DQV C;  4LG3 A;  4ETS A;  3PIO F;  1XD7 A;  1B59 A;  4HX4 A;  5DTD A;  1HLV A;  2DDB A;  4V2G A;  3W3C A;  1IN6 A;  5E18 F;  3MZH A;  1Z3Y A;  3AG3 H;  2P5V A;  2Z33 A;  3ZGK A;  3F21 A;  4FIS A;  1K4T A;  1L3L A;  2K7L A;  1D1B A;  4UB8 C;  4PJJ A;  2R7X A;  2JUC A;  3FXJ A;  2MA3 A;  3FXK A;  3GFL A;  2HZD A;  4M6V A;  2DPD A;  2Y2Z A;  2Z2S B;  2ME6 A;  1SFX A;  1TQP A;  2FBH A;  1POG A;  5D6F A;  1KON A;  3VWB A;  3WTW C;  4CUG A;  3ZQL A;  5CVU A;  2LTP A;  1K61 A;  1JJ8 C;  2X6W A;  1Z6R A;  4HF0 A;  3IKT A;  1FEX A;  4KIT B;  4PJ0 C;  2ZME B;  2QZ8 A;  3NEU A;  1QRY A;  5KAF C;  1ZG1 A;  2DK8 A;  4RGU A;  3S32 A;  5EZH A;  3I9V 2;  2VPL A;  1OCT C;  2XPU A;  3A2K A;  4DIQ A;  3P9K A;  4II2 A;  2YU9 J;  4D5C A;  5KHD A;  1UHM A;  1R9T J;  3OMY A;  4NC8 A;  3ECO A;  3RQI A;  2BXY A;  2QCO A;  4PSW A;  4HA8 A;  2DQL A;  1BL0 A;  4B48 A;  4IKF A;  2DA2 A;  1B4A A;  4N9I A;  1XSX A;  2VN2 A;  1ZLK A;  3ABL H;  5IT9 Z;  3WHC A;  5F04 A;  1WH5 A;  2BXZ A;  3MFK A;  4LB6 B;  2FNP A;  4U0W A;  2BW3 B;  4UVB A;  1FNN A;  4G6Q A;  3O6B B;  3R4K A;  2LY2 A;  2X48 A;  3S8P A;  4B44 A;  3LST A;  2LK2 A;  2LKS A;  2HNH A;  3H0G J;  4MTE A;  3R0A A;  4XN0 A;  1K6O A;  1BBY A;  5IYC J;  2N8G A;  2O7O A;  3UKG A;  4D9J A;  1LNW A;  4Q48 A;  4ENJ A;  3JRE A;  5E1Z B;  2BY1 A;  2M9H A;  1Y8R B;  4HRI A;  5IPA A;  1R4M B;  3BRO A;  1IXC A;  5D8K B;  4A3G J;  4C3J J;  2CUZ A;  2DTZ A;  4AWX B;  4BNC A;  2HTJ A;  1MNE A;  2CUE A;  2E60 A;  4EMS A;  3CCM I;  4LJZ F;  1VQK I;  2LBF B;  1HBX G;  1YLF A;  1ETQ A;  1MBK A;  1W5C C;  1X1P A;  2IA2 A;  3TMO A;  1S5L C;  2L54 A;  3F8N A;  2X0L A;  1JHH A;  4IQJ A;  3SEQ A;  1HW1 A;  1R1V A;  4EJU A;  5C3E J;  3J81 Z;  2IS4 A;  2R7V A;  2Y0S A;  3DEE A;  2O3F A;  2VI6 A;  3DWL E;  1SEU A;  4KIS A;  3BG9 A;  2XAF A;  2CH0 A;  2IGK A;  5FD5 A;  3JRD A;  2DTR A;  2IA1 A;  5D5V B;  2EPF A;  3RYR A;  1RKW A;  3H9J A;  1W5T A;  4I0A A;  1MIJ A;  1MND A;  2XSJ C;  4YG2 F;  2KDO A;  1WZ2 A;  1G8X A;  2AQF A;  1XGO A;  3QP6 A;  4XLP F;  3ZRG A;  4BQA A;  4BQO A;  4IRH A;  5ICE A;  3OYE A;  1UAA A;  1FC3 A;  4LIU A;  3G1L A;  3E7L A;  1H9T A;  3GLL A;  3BDD A;  2PJR A;  4AD9 A;  3MWM A;  3RKQ A;  2XGC A;  1D0Y A;  3HZJ A;  1R7J A;  2VKV A;  3K1N A;  3MN2 A;  1FSE A;  1X1B A;  4YIR X;  1LEA A;  2GXB A;  1GLN A;  1TW3 A;  3BG5 A;  2A5Y B;  3TO7 A;  2K9Q A;  3CO6 C;  3M1C A;  5FGM A;  4QPQ A;  3BC8 A;  2LP0 A;  2JA2 A;  4E7L A;  4BL0 B;  3D5R C;  4P96 A;  2EB7 A;  1YE9 A;  1HW2 A;  1I5Z A;  2FNA A;  1RET A;  2DMP A;  4XNF A;  4DZJ A;  2E1M B;  2MD5 A;  1HQC A;  3CLO A;  3WHB A;  2CU7 A;  3K4B A;  3I59 A;  2OUM A;  5JHF A;  4CA0 A;  3F0C A;  1I3A A;  4GCV A;  4HW0 A;  2A6E F;  1GVJ A;  1MGT A;  5HS9 A;  4I02 A;  4M73 A;  2DFH A;  3BP8 A;  5JI6 A;  1D8K A;  2HR3 A;  2XF7 A;  4N4O B;  3Q0W A;  2AQE A;  1TWA J;  1T33 A;  1IF1 A;  3K4M A;  2IPQ X;  2CV1 A;  4XOR A;  3WTS C;  4KIG A;  4IX7 A;  1BW5 A;  3H5A A;  3QOD A;  1U5T C;  5CVV A;  2CQ7 A;  1SAX A;  1ACI A;  1RUN A;  1N75 A;  1D0X A;  1SMY F;  4HZF A;  5EEG A;  5E3N A;  2QEX I;  2KLO A;  4CCK A;  4DZP A;  2VJ5 A;  3L7W A;  4BHB A;  4U87 A;  3GX4 X;  3S1Q J;  3F23 A;  3G1M A;  4A2U A;  3CLQ A;  3W6J B;  2WV1 A;  4MHG A;  4C9Y A;  1IDZ A;  3U1D A;  1QPI A;  1BI0 A;  4M3B A;  3S15 J;  1ON1 A;  2VBY A;  5KVR A;  4DYQ A;  3CCV I;  5B1A H;  4I01 A;  1MSE C;  4UUS B;  3A03 A;  2QQ9 A;  4F91 B;  5J1R A;  4UUT A;  2AS5 F;  2GXA A;  3HKZ N;  2G9W A;  4FT8 A;  4AIK A;  2F4I A;  1EF4 A;  2CRG A;  3MZY A;  4RGX A;  4HYE A;  3N97 A;  2JA5 J;  3ERM A;  3UNG C;  3PM1 A;  3WTX C;  1PYV A;  4WXC A;  4J00 A;  1R5H A;  1AA7 A;  4G94 A;  1UCR A;  1SFO J;  1XX5 A; 
#chains in the Genus database with same CATH homology
 1O3T A;  2M87 A;  1G3W A;  4JBA A;  2XAH A;  5LRS A;  2XRO A;  4CGZ A;  1TQM A;  1ZRE A;  1IUY A;  2YU3 A;  3RJP A;  1BM9 A;  2DT5 A;  3WG9 A;  5D5W B;  3M7G A;  3TOB A;  4NB5 A;  2LDU A;  1QPM A;  2W85 A;  3E97 A;  3D0S A;  4Y17 A;  1XMK A;  3WTY C;  4G7H F;  2A07 F;  4YIF A;  5KK1 A;  1JHF A;  2MC3 A;  2EFP A;  4BAY A;  3ZPL A;  5L3E A;  2KJB A;  2BGC A;  2ZBK A;  4MEY F;  1D8J A;  3KET A;  4EV0 A;  3OOP A;  2K4B A;  2O0Y A;  2Q0O A;  4AVP A;  2EA2 A;  2COM A;  3U2R A;  1WKM A;  1BIA A;  5DD8 A;  4MEX F;  5K5Q A;  2GZW A;  3JTH A;  3TDZ C;  5DCF A;  2AXL A;  2CO5 A;  1MKM A;  2GQQ A;  5ILU A;  3WU1 B;  2BBY A;  1LEB A;  3K1P A;  1Z1D A;  1SD4 A;  3GZ6 A;  3EYI A;  2V6C A;  5D5U B;  1FYL A;  2ELH A;  3Q9V A;  5FLX Z;  3EET A;  1FBQ A;  4HQE A;  4OIR F;  1W4M A;  4BH9 A;  2ZME A;  4L9V A;  3ECH A;  4L5J A;  2BYV E;  3P9I A;  5LBQ A;  4LFU A;  2E7X A;  3RIR A;  4KA4 A;  2Y48 A;  1QO0 D;  5E17 F;  3J7A O;  2Z3Y A;  2H94 A;  5D4S A;  4EVI A;  3HHG A;  1ZYR F;  2V1U A;  5E1X A;  3L2C A;  4O6J A;  1P2F A;  5H20 A;  4KIF A;  3ABT A;  2CG4 A;  2R7F A;  2R7D A;  2Y0M A;  2VBW A;  1AWC A;  1ZGJ A;  5L3G A;  3GFJ A;  3ELK A;  5DEQ A;  1U5T B;  4Y13 A;  2PFB A;  5HVQ C;  3I54 A;  4MTD A;  2QBY A;  4CXF A;  2A3S A;  2FA5 A;  5JHU A;  2M8E A;  1Z7U A;  4ZH4 F;  4UUV A;  4Q5S F;  4S05 A;  1QGP A;  4WX9 A;  2VE8 A;  4TV7 A;  4OOI A;  3EDP A;  2YSR A;  3FHZ A;  4KFC A;  3SZT A;  2PN6 A;  1QZZ A;  3D5L A;  3BPV A;  1KGS A;  1DPR A;  2VOP A;  3AAF A;  1Y0U A;  3ZQ7 A;  4OIQ F;  2EFN A;  2JSC A;  2ZO4 A;  2BE5 F;  2IA0 A;  1FOK A;  2O03 A;  4LK1 F;  3SZP A;  2HGC A;  2DK5 A;  3K0L A;  4A0Y A;  1J2X A;  2ZNY A;  1XCB A;  1LDD A;  1IZ1 A;  3IRQ A;  2DPU A;  1G6N A;  3WGH A;  4Q47 A;  4OMZ A;  4B09 A;  3KP7 A;  4ZYH A;  2EV6 A;  3QRF F;  3HOS A;  4KYW A;  5BMZ A;  5LRR A;  4LG0 A;  3CUO A;  2PEX A;  2HKX A;  4IRI A;  4EJO A;  2IT0 A;  3EUH A;  4GO1 A;  2GIV A;  2OZU A;  4LMY A;  5E1W A;  3KLN A;  1A04 A;  2FXA A;  1KU9 A;  3KEO A;  2DI3 A;  4M6Y A;  3TDU C;  2ZCW A;  1TQI A;  3JTG A;  2RDP A;  3RKX A;  3FMS A;  2MH2 A;  5K1Y A;  3V8K A;  1TLH B;  4KIC A;  4HX7 A;  2XIG A;  5HDN A;  1K79 A;  2P8T A;  5FFX A;  2E1N A;  2KJC A;  1J7K A;  1YQA A;  4M71 A;  5DCM B;  1SMT A;  3DFG A;  4UVC A;  1BN5 A;  3FXU A;  4U0Y A;  4EJW A;  1ZRF A;  4A12 A;  1E2X A;  3ZMS A;  2M1B A;  3V7S A;  1IN5 A;  3DXJ F;  4BHP A;  1OPC A;  3F8B A;  1Z05 A;  4D0P A;  4ZZL A;  5ERI A;  1H0M A;  1J75 A;  3HRT A;  3E6M A;  3HOT A;  1XGS A;  2V1D A;  5HLH A;  1BOA A;  2XUB A;  1I1S A;  5HOO A;  4HLX A;  4ENK A;  2LNB A;  2CQK A;  4AIH A;  3BOQ A;  1DUX C;  4YFK F;  5A2Q K;  1BIB A;  1XDU A;  3FM3 A;  4HQM A;  3T8T A;  5D5X B;  2H6C A;  4ASN A;  1R22 A;  3CTA A;  2XHK A;  3ROU A;  1E17 A;  1BI1 A;  5L3F A;  2XVC A;  1LQ1 A;  1I6X A;  3KEQ A;  4HAM A;  1MJA A;  2PJP A;  2E1C A;  2UWM A;  1IRG A;  3HSF A;  5K5R A;  2KIU A;  2VBZ A;  5HLI A;  2V1X A;  2LSO A;  1WSU A;  3HYI A;  2M5W A;  3WE2 A;  1XGN A;  4M9Z A;  4XSZ F;  2LKP A;  2J5O A;  4RB3 C;  2DW4 A;  1HXD A;  1SFE A;  3K1M A;  5HLG A;  1DPU A;  4PZJ A;  2UXX A;  1YFH A;  1C0W A;  4LK0 F;  5H6R A;  4OIO F;  5CVR A;  2Z9O A;  1HKQ A;  2KIF A;  4JQF A;  4XRF A;  3L09 A;  3TO9 A;  2NRA C;  4CO8 A;  1IXR C;  1KYZ A;  4LB5 A;  3WE3 A;  5FFZ A;  1LDJ A;  5FO5 A;  1FWZ A;  2L02 A;  3WTT C;  3GFI A;  2VT2 A;  3ZP5 A;  2GXG A;  4L9J A;  2WTE A;  3FXR A;  1EH8 A;  2NS0 A;  4R79 A;  3REO A;  3DF8 A;  4KUM A;  1QQI A;  2XV4 S;  3RPU A;  3BY6 A;  4FHT A;  4PDK A;  2F5F A;  3VOE A;  2GA2 A;  5DUK A;  3U9G A;  3B02 A;  2QBY B;  1ONV A;  3LQQ A;  3P7N A;  2RGV A;  3HIF A;  3ULQ B;  5BOX A;  2CGP A;  6PAX A;  3DPT A;  4B8X A;  5HDG A;  5ICC A;  5A2Q Z;  1VTN C;  2IJL A;  1P4X A;  2FBI A;  1J9I A;  3RKY A;  2ZFW A;  2DU9 A;  2STT A;  1U78 A;  3HHH A;  2NAZ A;  3LA2 A;  1XSV A;  1U5T A;  5LGN A;  2PLY A;  2H09 A;  2XKO A;  2ADU A;  3JSO A;  5LEK A;  3F72 A;  3GEZ A;  1W7P B;  3EQL F;  3JAM Z;  1B1B A;  5ILV A;  1P92 A;  1OYY A;  2FE3 A;  1JE8 A;  4IHS A;  4ZYG A;  3CDH A;  1G3T A;  5ILS A;  2F2E A;  2WC2 A;  1SD7 A;  1MDM A;  4MQ9 F;  2FEZ A;  1YYV A;  4HX8 A;  3G3Z A;  3H92 A;  2XAS A;  2HZT A;  1DDN A;  1S6L A;  1FSH A;  2JPC A;  1TNT A;  5FB2 A;  2VE9 A;  2L4A A;  2P7C B;  2DAO A;  1KU2 A;  4S04 A;  5LEJ A;  4U7D A;  4Q4Z F;  4KMU X;  1IN8 A;  1I1G A;  4CYD A;  3CUQ C;  3ZN1 A;  3MEX A;  2HYF A;  3SFZ A;  1IRF A;  3FXQ A;  3E3V A;  2P5K A;  3FWE A;  3IWZ A;  3K9T A;  2IW5 A;  3J80 K;  2HDC A;  3BPX A;  4HOB A;  3ZMV A;  2GAU A;  1BJA A;  2Y75 A;  1BI2 A;  3HRU A;  1F4K A;  4YFX F;  3CJN A;  2HEO A;  3E5U A;  4WCG A;  2C6Y A;  4HLY A;  2Z5U A;  1FP1 D;  1OR7 A;  2YPR A;  3F3X A;  3DV8 A;  4LLL A;  3WTU C;  2VXZ A;  4LGW A;  2ZNZ A;  1CF7 A;  1S7A A;  2H27 A;  2F5D A;  5TJJ A;  1FZP B;  4BYY A;  1JGS A;  1CF7 B;  1HKT A;  2DLL A;  3C3W A;  1ZRC A;  3R0J A;  2VOD A;  3R60 A;  3G73 A;  2CSO A;  3BJA A;  1GXQ A;  1KQ8 A;  2HWV A;  4E70 A;  2L01 A;  1G4D A;  1P6R A;  4DQ2 A;  1O7L A;  4ESF A;  4LLN A;  1TBX A;  4XLN F;  3I71 A;  4LG0 B;  3GYH X;  1KQ0 A;  1S29 A;  2IVM A;  4L9T A;  1D3Y A;  4Z2Y A;  4EGY A;  2JT1 A;  1ULY A;  2FQ3 A;  3ZMZ A;  4U7B A;  1G3Y A;  1MD0 A;  3TOA A;  3J81 K;  2PI0 A;  4O5V A;  3V8J A;  1ZLJ A;  1USS A;  2CWE A;  1MJ9 A;  4QLC U;  2ESH A;  1SD5 A;  1T39 A;  5DUI A;  4XSX F;  2RV8 A;  2P6S A;  2K27 A;  2UXN A;  5D6E A;  2HTS A;  1FBS A;  2K86 A;  4L5I A;  3KLO A;  3MAJ A;  3ABU A;  1XSD A;  2NNY A;  2K02 A;  3SXY A;  1XN7 A;  1GXP A;  3R6S A;  3HUG A;  4G9Y A;  3HSE A;  2W24 A;  2H6B A;  4P55 A;  2V9V A;  3ISP A;  3T8R A;  2M30 A;  1WI9 A;  2VOO A;  4K2E A;  4I98 B;  2EWN A;  4WXH A;  2ETH A;  1S7O A;  1XGM A;  1I27 A;  2W84 A;  5IT3 A;  2WWY A;  5CJ9 A;  4GYG A;  2D45 A;  2NNN A;  1MDM B;  2XAG A;  4QWQ A;  2UZK A;  4ESJ A;  3PFI A;  3K2Z A;  3SQN A;  3QU6 A;  1U3E M;  1O3R A;  2P7V B;  4KIB A;  3FMQ A;  4BXU A;  4PGH A;  2KKO A;  4CIC A;  3TO6 A;  2EV0 A;  2DFI A;  1J0R A;  4EM2 A;  3IKV A;  1BC7 C;  2P6T A;  1FPQ A;  2PBI A;  3F8C A;  1WRJ A;  3BJO A;  3JAM K;  4RGS A;  1QNT A;  2A6H F;  4P5O A;  1O57 A;  4A0Z A;  1YW7 A;  3GF2 A;  5HS8 A;  4PGG A;  1BC8 C;  1PP7 U;  4GXO A;  5HDK A;  1FLI A;  1B9N A;  3C1D A;  4N0B A;  4O3M A;  3SHF A;  1YW9 A;  2HYG D;  3DKW A;  2Q8K A;  1Z6T A;  2RC4 A;  2XAJ A;  1IN4 A;  3QP5 A;  2PG4 A;  5LGT A;  1R1T A;  3KZY A;  3V7C A;  3K69 A;  3ZMU A;  2XGX A;  4M9S A;  2EK5 A;  3R61 A;  2NYX A;  3VOD A;  3HRM A;  1Z9C A;  4RB1 A;  4IRG A;  3KP6 A;  5J6X A;  2MH9 A;  5LGU A;  1DP7 P;  3IHU A;  5CLS A;  2VON A;  2EFW A;  1T98 A;  5ICF A;  1U8R A;  2XKP A;  3VEP A;  3V7R A;  3HTS B;  4H0E A;  4I2O A;  3KFW X;  3GLX A;  2QUF A;  2QM3 A;  3F6O A;  1ZH5 A;  3GVA A;  1S3J A;  3GW2 A;  4OU0 A;  4BHC A;  5E8I A;  1RNL A;  1KA8 A;  3ML6 A;  3T1B A;  3T0Y A;  2OD5 A;  1WWX A;  2BV6 A;  2OQG A;  1YG2 A;  4ZZD A;  3NRV A;  1EV7 A;  2FU4 A;  2ZJ2 A;  1R36 A;  1W7P D;  2DO7 A;  1R23 A;  3CUQ B;  1RI7 A;  2KIM A;  4G7Z F;  4MGR A;  1R58 A;  2HS5 A;  4HBL A;  2WV0 A;  3KE2 A;  2O8X A;  2OBP A;  3KP3 A;  5AON A;  2IP2 A;  4LD5 A;  4MQV A;  5L3D A;  4N9H A;  2RQP A;  5BQT A;  4UXN A;  3P9C A;  3KP4 A;  2G7U A;  2F5C A;  4CHU A;  2MLG A;  1FY7 A;  5K5O A;  5TRD A;  3MQ0 A;  2FRH A;  4OMY A;  1KQ9 A;  2ESN A;  2VBX A;  4EGZ A;  2JTV A;  5FD6 A;  2MLK A;  2EFQ A;  1QBJ A;  4KN4 X;  1YO5 C;  4M74 A;  3WTV C;  1YS7 A;  1ODD A;  2HFH A;  2EFO A;  2Z99 A;  4U88 A;  1UFM A;  3WOD F;  2FF4 A;  4M9X A;  3ZN0 A;  4NHJ A;  3HRS A;  1WQ2 A;  2CYY A;  2XRN A;  3QPH A;  4EQQ A;  2P5L C;  4F7Z A;  2M45 A;  1JXS A;  4U0V A;  4A6D A;  2L4M A;  5F6F A;  2D1H A;  2IRF G;  2XAQ A;  3M8F A;  1XDS A;  3E5Q A;  3FZV A;  4G7O F;  2ZKZ A;  3GZ5 A;  3JSP A;  1LVA A;  3GO5 A;  4Y15 A;  2QEN A;  1T2K A;  3E6C C;  5LHG A;  1G3S A;  1X3U A;  2FBK A;  2OZ6 A;  4HV6 A;  1UST A;  2EA4 A;  2GA1 A;  1ZRD A;  4RB0 A;  5D8L B;  1IAW A;  2DBB A;  4RS8 A;  1ZAR A;  4ON0 A;  5BPI A;  5CVJ A;  3RTR A;  1ZG3 A;  2JZY A;  2STW A;  4IPA A;  4I7H A;  1P4A A;  5LHH A;  2LF8 A;  1T6S A;  1RUO A;  3I53 A;  3L00 A;  3F8F A;  3FX3 A;  1IXS B;  1PDN C;  3HSR A;  3IL2 A;  2MBF A;  1FT9 A;  4EM0 B;  5J8F A;  1SD6 A;  2QYO A;  3BJ6 A;  3LAJ A;  1KU3 A;  1SFU A;  2YX4 A;  2ZXJ A;  3BWG A;  3ZMT A;  4G6D A;  4I09 A;  1FYK A;  1ZGA A;  1T38 A;  2HKO A;  1KYW A;  4WXD A;  4ZYD A;  1V4R A;  3MCZ A;  1YS6 A;  2D2W A;  4ESB A;  4KN7 X;  4R8H A;  5DDG A;  1B6A A;  4CDG A;  1J5Y A;  4YII A;  3C7J A;  3KP2 A;  2CW0 F;  3O2P E;  5AIQ A;  2RKH A;  3F22 A;  3FM5 A;  3F6V A;  3Q9S A;  4OIN F;  4NQW A;  1K78 A;  2PQ8 A;  2QLZ A;  1PUE E;  2B0L A;  4A5M A;  2P4W A;  1LB2 A;  1OYI A;  3TKY A;  4GYI A;  3M8E A;  3LA7 A;  2HOE A;  4M6X A;  1STZ A;  1UB9 A;  4R1H A;  1T0F A;  5L3B A;  3ZMD A;  4ZYE A;  3N4M A;  4A6E A;  1O3Q A;  2FML A;  4IJA A;  2QQA A;  5CVI A;  3I58 A;  2CFX A;  1UHW A;  4P9F A;  2HQR A;  2OAZ A;  3TGN A;  4OIP F;  3GFM A;  1K7A A;  2A61 A;  3QPT A;  3E6D A;  1B9M A;  4HV5 A;  1YW8 A;  3V8L A;  1J59 A;  3LAP A;  2YR2 A;  2DQR A;  4LLG F;  4AIJ A;  4FX0 A;  5EEH A;  5ED4 A;  2OQR A;  1MJB A;  2R3S A;  4UNO A;  4IHT A;  4EJV A;  1CGP A;  3S2W A;  1HW5 A;  3I0T A;  2E7W A;  1HSJ A;  4GGG A;  5D4R A;  1ZG5 A;  2A68 F;  3RI4 A;  1BI3 A;  2K4J A;  1IW7 F;  3E5X A;  3E6B A;  1O3S A;  2GWR A;  3LFK A;  1QZY A;  1FX7 A;  2RNJ A;  2W57 A;  4RGR A;  1TW2 A;  1H9G A;  2JPB A;  3GXO A;  5F1R A;  1P4W A;  1Z91 A;  1OKR A;  4IVN A;  1REP C;  4IXA A;  3LQR A;  2G7H A;  3I64 A;  3JW4 A;  3BZ6 A;  3T5X A;  5E8G A;  4L0Z B;  2O61 A;  3RDI A;  3WGI A;  3L9F A;  1FBU A;  3KCC A;  4RB2 C;  2L3D A;  2TDX A;  1ON2 A;  4A0X A;  3RYP A;  3COA C;  4IF4 A;  3DPL C;  2LF7 A;  3TQN A;  3QU3 A;  1EH7 A;  4HF1 A;  3J80 Z;  1ZAO A;  5F64 A;  2A69 F;  4L9N A;  4HDU A;  4KMF A;  4DNC A;  4PCQ A;  5BS6 A;  5FLX K;  2D1V A;  3DP7 A;  3WGG A;  1OYW A;  2YX7 A;  1FP2 A;  1YTY A;  2PMU A;  2EV5 A;  5JVT A;  4UV9 A;  3Q5F A;  3KP5 A;  2OA4 A;  4JK1 X;  3V4G A;  3ERE D;  3HTU A;  1YIO A;  1ZHF A;  4RAZ A;  2QWW A;  3IRR A;  1D5V A;  2F5E A;  4G8X A;  1O7F A;  1MZB A;  1AOY A;  1RZ4 A;  4HF2 A;  3O3K A;  2J5P A;  2EJR A;  2PMH A;  3C18 A;  1EH6 A;  1S8N A;  3FF5 A;  3B73 A;  4EM1 A;  1RIO H;  5E20 A;  3RKW A;  1TTY A;  5DV5 A;  1NHA A;  3EYY A;  3PQJ A;  2QVO A;  3GWZ A;  1R00 A;  4WWC A;  1V3F A;  4MNU A;  1XB4 A;  1K78 B;  3LA3 A;  4UV8 A;  4KDP A;  3IC7 A;  3CO7 C;  5H6Q A;  1F9N A;  3CUQ A;  4WF2 A;  2QQB A;  5DYM A;  3WU0 A;  1F1Z A;  2ISY A;  2ACJ A;  3I4P A;  4ENM A;  3I59 B;  5HS7 A;  4UVA A;  4FX4 A;  1W5S A;  4L0Y B;  2RVC A;  2VT3 A;  4HDV A;  1L0O C;  5DCM A;  5LLQ A;  4ENN A;  1R5G A;  5JFR A;  2FMY A;  1HST A;  2JRT A;  1XMA A;  2FSW A;  3F8M A;  4KNY A;  1U6G A;  1ZN2 A;  5J8C A;  4KT5 C;  4A5N A;  1FYM A;  1IN7 A;  2VC0 A;  1TNS A;  4L18 B;  2BEO A;  2Q2E A;  4M72 A;  4YFN F;  2V79 A;  4WK8 F;  1R1U A;  3NQO A;  2RN7 A;  3IWF A;  3M9A A;  1F5T A;  3WTZ A;  1XCV A;  2VC1 A;  3H3U A;  1HKS A;  5LHI A;  2W25 A;  2O6G E;  3RPQ A;  1GHC A;  4XBF A;  2ISZ A;  3QAH A;  3PQK A;  2OU2 A;  4EJT A;  3VB2 A;  3I5U A;  4I0B A;  3LWF A;  5IT9 K;  4P9U A;  3OV8 A;  5ICG A;  1PP8 F;  5AIP A;  3H3Z A;  5DD4 A;  1LJ9 A;  4RAY A;  3W6K B;  5JR3 A;  3KZZ A;  1OMI A;  2KRF A;  1W7P A;  2HQN A;  3FMR A;  1KU7 A;  3M1E A;  4UHT A;  4CZZ A;  1U2W A;  2FOK A;  2X4H A;  5L3C A;  3VFZ A;  5CYV A;  3QOP A;  3DEU A;  5BPD A;  3GUD A;  1Q1H A;  1LDK B;  3DQV C;  4ETS A;  1XD7 A;  1B59 A;  4HX4 A;  1IN6 A;  5E18 F;  3MZH A;  2P5V A;  2Z33 A;  3F21 A;  1L3L A;  2K7L A;  2MA3 A;  3GFL A;  2DPD A;  1SFX A;  1TQP A;  2FBH A;  5D6F A;  3WTW C;  5CVU A;  1Z6R A;  4HF0 A;  3IKT A;  2ZME B;  2QZ8 A;  3NEU A;  1ZG1 A;  2DK8 A;  4RGU A;  3P9K A;  1UHM A;  3ECO A;  4HA8 A;  2DQL A;  1B4A A;  4N9I A;  1XSX A;  2VN2 A;  1ZLK A;  5IT9 Z;  3MFK A;  4LB6 B;  2FNP A;  4U0W A;  4UVB A;  1FNN A;  4G6Q A;  3O6B B;  3R4K A;  3LST A;  1K6O A;  4MTE A;  3R0A A;  1BBY A;  1LNW A;  4Q48 A;  4ENJ A;  5E1Z B;  3BRO A;  1IXC A;  5D8K B;  4BNC A;  4AWX B;  2HTJ A;  4EMS A;  4LJZ F;  1HBX G;  1YLF A;  2IA2 A;  2L54 A;  2X0L A;  3F8N A;  1JHH A;  1HW1 A;  1R1V A;  4EJU A;  3J81 Z;  2O3F A;  2XAF A;  5FD5 A;  2DTR A;  2IA1 A;  5D5V B;  3RYR A;  1W5T A;  4I0A A;  4YG2 F;  1XGO A;  3QP6 A;  4XLP F;  4BQA A;  5ICE A;  4IRH A;  1FC3 A;  1H9T A;  3BDD A;  4AD9 A;  3MWM A;  1R7J A;  3K1N A;  1FSE A;  1LEA A;  2GXB A;  1TW3 A;  2A5Y B;  3TO7 A;  3CO6 C;  5FGM A;  4P96 A;  2EB7 A;  1HW2 A;  1I5Z A;  2FNA A;  2MD5 A;  1HQC A;  3CLO A;  3I59 A;  4GCV A;  4HW0 A;  2A6E F;  1GVJ A;  1MGT A;  5HS9 A;  4I02 A;  4M73 A;  3BP8 A;  5JI6 A;  1D8K A;  2HR3 A;  1IF1 A;  2IPQ X;  3WTS C;  4KIG A;  1U5T C;  5CVV A;  1SAX A;  1RUN A;  1SMY F;  4HZF A;  5EEG A;  3L7W A;  4BHB A;  3GX4 X;  3F23 A;  4A2U A;  3W6J B;  4MHG A;  3U1D A;  1BI0 A;  1ON1 A;  2VBY A;  5KVR A;  4I01 A;  2QQ9 A;  2AS5 F;  2G9W A;  4FT8 A;  4AIK A;  3MZY A;  4RGX A;  4HYE A;  3N97 A;  3WTX C;  4WXC A;  1R5H A;  4G94 A;  1UCR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...