1PUEE

Pu.1 ets domain-dna complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
88
structure length
88
Chain Sequence
KIRLYQFLLDLLRSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKGNRKKMTYEKMARALRNYGKTGEVKKVKKKLTYQFSGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords DNA (5'-D(*AP*AP*AP*AP*AP*GP*GP*GP*GP*AP*AP*GP*TP*GP*GP*G)-3
publication title A new pattern for helix-turn-helix recognition revealed by the PU.1 ETS-domain-DNA complex.
pubmed doi rcsb
source organism Mus musculus
total genus 22
structure length 88
sequence length 88
chains with identical sequence F
ec nomenclature
pdb deposition date 1996-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1pueE00
4MTDA 2EV5A 5A2QK 3FM3A 2QBYB 2XVCA 2ETHA 2JT1A 1G3SA 3BJAA 2MC3A 2K4BA 3E5QA 1J9IA 3MQ0A 2Z9OA 2QBYA 3P9CA 2NNNA 1BIBA 1OYYA 1IW7F 3WGHA 4MTEA 3GO5A 2FQ3A 4HDUA 5K5QA 5ED4A 2L4MA 3H3UA 5BPDA 3MZYA 2XKOA 4L0ZB 4HX7A 4KIBA 2BE5F 2IA1A 3FMSA 4O5VA 3F21A 4AD9A 1LDKB 5D4SA 3D5LA 1OYWA 1IN6A 1U5TC 4U7DA 5CVJA 2DAOA 3V8JA 1TQPA 3PFIA 4R79A 2G7HA 4GGGA 1XSVA 1RUNA 4RGUA 1XN7A 4XLNF 2G9WA 3E5UA 5E8IA 2DT5A 1TQMA 1LNWA 1DPRA 5DD4A 2HKXA 2IP2A 5FLXZ 4KMUX 4G6QA 3S2WA 4IHTA 4L5JA 2NYXA 1J7KA 4ZYHA 2O6GE 4KN7X 2CG4A 2VE9A 1YG2A 3I64A 4HV6A 1C0WA 2BEOA 5D8KB 3PQJA 5TRDA 2FNAA 4MEXF 4LK1F 5LLQA 2NS0A 4WXCA 3EYYA 1ZGJA 1BI0A 1D3YA 3N4MA 3HTSB 2J5PA 1AWCA 2ZNYA 4WK8F 1HW2A 1BC7C 2XASA 5DEQA 1R5HA 4AIJA 1LDDA 5FB2A 2EV6A 3ZMTA 1R5GA 3I0TA 1OYIA 1QNTA 2JZYA 1U78A 5FLXK 4HF2A 1HKTA 1R1TA 1Z1DA 2EB7A 5D6FA 3J7AO 1IN4A 1XGSA 2XROA 2P5LC 1RI7A 4O3MA 3FXRA 3RI4A 2JTVA 2O0YA 2F5EA 4ASNA 4RAYA 4M6YA 4CHUA 5HOOA 2H6CA 4S05A 5D5UB 1S7OA 5F1RA 3KLOA 2HR3A 1S29A 5L3CA 4M9SA 4Q48A 3GZ6A 3FM5A 1KU2A 5ICGA 5LHGA 2KRFA 1ZH5A 4PZJA 4KA4A 3SZTA 3BJOA 1XMAA 4IRGA 3HUGA 1XSXA 1D5VA 1IN8A 1XMKA 3FF5A 2XV4S 3E97A 3VEPA 3J81Z 3HRSA 4IRHA 4G9YA 3WTXC 3I54A 1XGOA 4RGSA 4KMFA 2PJPA 5EEHA 3QRFF 3DP7A 1ZREA 1W7PB 2ESNA 4P96A 1I27A 5JFRA 2XRNA 1U6GA 2UXXA 5L3EA 2WC2A 1EH8A 2D1VA 4UV9A 4XRFA 2GAUA 2ELHA 3GYHX 5LHIA 3P7NA 4KFCA 1OKRA 2VT3A 1YW8A 3N97A 3E5XA 3TOAA 1W5SA 4IVNA 3FWEA 5L3GA 5H6QA 3KP5A 3MEXA 3TDUC 2VOOA 2YX7A 4MQ9F 3F6OA 2PLYA 3LWFA 1I1GA 3SXYA 2HTSA 3J81K 1S7AA 3FXUA 4EJTA 4KUMA 3MFKA 1KU9A 5L3DA 1VTNC 3KP3A 2ZJ2A 3KCCA 1TNSA 1TW3A 2VT2A 4L9TA 3CUQB 2RKHA 2CGPA 3KEQA 3IWZA 1LB2A 3WGGA 1J59A 2QUFA 1MDMA 2DTRA 3BZ6A 4KIFA 3CUQA 1S6LA 1BI2A 4LG0A 1TNTA 1O57A 2ZKZA 1KGSA 4Y17A 4PGGA 3HIFA 1P4WA 1RUOA 2VBWA 3V7CA 4HAMA 1WI9A 3NEUA 3MAJA 4FT8A 1ON2A 3RYPA 3B02A 3F23A 2LSOA 1BN5A 2EFOA 1USTA 4AWXB 4HA8A 3R61A 2OU2A 2XGXA 2HQRA 1CGPA 1T98A 3WTYC 4HYEA 4CXFA 1LJ9A 2HYGD 2X0LA 1SFXA 4CGZA 5DCMB 4M74A 4GO1A 5CYVA 2A69F 3L9FA 2F5CA 4WXHA 1P92A 2W57A 4EGZA 2WTEA 2NRAC 1NHAA 4LB5A 3FMQA 1FT9A 2O8XA 3BP8A 4U7BA 1ZLKA 2ESHA 3TO9A 3RPUA 2VBXA 4XSZF 3CO6C 2A61A 1V3FA 4DQ2A 3EETA 1SD5A 2FNPA 4L9NA 2ZCWA 1HQCA 4BNCA 4DNCA 1I5ZA 2L54A 4UNOA 4LLLA 1ON1A 2R7FA 2HFHA 3JSOA 5ILVA 4HLYA 4OIRF 4CO8A 2Y0MA 4KICA 2Z33A 1XCVA 1L0OC 5IT3A 2EFPA 5HLHA 5DUIA 4L0YB 4ESJA 1MD0A 4P9FA 5E18F 4WF2A 3I58A 5BS6A 3K2ZA 4OMZA 2Y75A 4LD5A 2DK5A 2HGCA 4EM2A 3H92A 3HOTA 2Z99A 1IXSB 4I02A 3LA2A 4ENMA 4LLNA 3CO7C 2PMUA 4MQVA 1MJAA 2QM3A 2WV0A 4P55A 1T6SA 4LB6B 5ICCA 4WXDA 2H27A 4G6DA 1P4AA 4AIKA 2K86A 2JRTA 1D8KA 1ZN2A 1LDJA 3RTRA 3FXQA 3ZQ7A 2P7VB 1K7AA 3V8KA 1I6XA 2L4AA 4E70A 3WGIA 4OU0A 5AIQA 3JW4A 3KLNA 3E6BA 4EGYA 2EJRA 4H0EA 2GZWA 3I4PA 2K4JA 5A2QZ 4BYYA 1BJAA 4CDGA 3RJPA 4HF0A 3M9AA 5DYMA 1IRFA 2P5VA 1R00A 5D5XB 4A5MA 3DF8A 3KZZA 3MZHA 2J5OA 1BBYA 1YS6A 1B59A 4A12A 1REPC 1U5TB 1UCRA 4IHSA 4OIQF 3I59B 1MJ9A 2VBYA 2MBFA 3JTGA 4EJUA 3CJNA 4ZZDA 4ZH4F 2XAQA 2CFXA 3H3ZA 4A2UA 2KJCA 3I59A 3T8TA 5ICEA 2EV0A 5D4RA 3ELKA 2GWRA 1FNNA 3TDZC 3F3XA 2HKOA 2GXBA 4A6DA 2K27A 1ULYA 4NHJA 5AIPA 1QZZA 2VOPA 3ISPA 1R22A 2V9VA 1XGNA 2W84A 2BV6A 2P8TA 5HDKA 1GVJA 2QVOA 3D0SA 5LGNA 3KEOA 2C6YA 2M8EA 5AONA 3L2CA 2A6HF 1R23A 4G8XA 2FXAA 6PAXA 3REOA 4ON0A 1YIOA 3KP4A 3W6JB 3K1NA 4G7OF 3ABUA 2V79A 4R8HA 3KZYA 4NQWA 2VE8A 4M9ZA 1WWXA 1Z7UA 4HBLA 3QU6A 2OA4A 3E6DA 1EH6A 5J6XA 2FRHA 2EA2A 2HZTA 3C18A 3GEZA 2GA1A 1FBUA 4G7ZF 2EFWA 4I01A 4BHPA 2FEZA 4HZFA 2QZ8A 3W6KB 1KQ9A 5LEJA 3CUOA 5LRSA 1BIAA 4ZYGA 2W85A 4CZZA 1KYZA 5CVRA 2PBIA 3EYIA 2XIGA 1HXDA 3LFKA 2NNYA 3GF2A 3SQNA 3M8EA 3GFMA 3GZ5A 2H6BA 2DW4A 1WSUA 1ZLJA 2Z5UA 2V1UA 4A0ZA 5H6RA 2DFIA 1S3JA 3QP6A 3ZMDA 5D6EA 1SFEA 3LQQA 1Z9CA 4U0WA 5DUKA 3P9KA 4Z2YA 3CLOA 2XKPA 3GVAA 3FZVA 1IRGA 2YU3A 2XAGA 4YIFA 1Z6RA 3Q9VA 2ACJA 4ZYDA 4JBAA 1K6OA 1G3YA 3GFIA 2E7WA 2HYFA 1LQ1A 4UV8A 5E1XA 4AVPA 1KU7A 4I0BA 4Y13A 4BQAA 1F1ZA 5H20A 2EA4A 3RKWA 3WTWC 4L9JA 3LA3A 3WTUC 1V4RA 4AIHA 3WG9A 2K02A 5ILSA 3FMRA 4N9HA 3LAPA 3V7RA 2LDUA 5JI6A 2E1CA 1ZHFA 3T8RA 3VOEA 5E20A 5TJJA 3CTAA 3QU3A 1E2XA 3TGNA 5FD6A 3RIRA 3ECOA 2CWEA 1ZRDA 1QBJA 4L5IA 4UHTA 2QQAA 4NB5A 1ZGAA 2B0LA 4A6EA 1J0RA 2HTJA 4UVBA 4K2EA 2RDPA 3GW2A 3F8MA 2LF8A 1IN5A 2E7XA 2VONA 1IXRC 3HHGA 2FBKA 1HKSA 2Y48A 4MHGA 4EJOA 3GXOA 3LAJA 5FO5A 3EDPA 3C3WA 5FFZA 2EFNA 1UHMA 2DQLA 4HDVA 2XAHA 2UZKA 5BOXA 4U0YA 1ZG1A 1P4XA 1W7PA 5FGMA 3IL2A 3ERED 3R0AA 3U2RA 1JHFA 4KNYA 4LLGF 2OQGA 1FYLA 3FX3A 5HLIA 2DI3A 4GCVA 3B73A 4XLPF 1T2KA 2V6CA 4ENJA 3IKVA 1LEBA 1HBXG 2ADUA 3QPHA 1ZARA 2A3SA 2KKOA 2COMA 3RKYA 2ISYA 1UHWA 4XSXF 3BPVA 1FSHA 3HOSA 5EEGA 4U0VA 1KYWA 3QAHA 2DPUA 2XAJA 4BHBA 1TTYA 1QZYA 5HS9A 1FLIA 2AS5F 1Z6TA 3T5XA 3ZPLA 5HS8A 1FYMA 1W7PD 2EWNA 1QGPA 2PFBA 3MWMA 5HDNA 1J2XA 1ZRFA 3AAFA 2O03A 2PG4A 2MLKA 3BY6A 4EVIA 3VB2A 5HDGA 1YW9A 3M8FA 1XSDA 2FBHA 2L01A 3LQRA 2A68F 2OD5A 3I5UA 3ZN1A 4CYDA 4ZZLA 1FWZA 5J8CA 3PQKA 1W4MA 2IJLA 2DK8A 2CYYA 3KFWX 3BWGA 3ABTA 3JTHA 2IW5A 1O3QA 1QO0D 4RB2C 2K7LA 2PN6A 2EK5A 3ZP5A 2PQ8A 4RS8A 1B1BA 5ILUA 4PCQA 4A0XA 1T0FA 1BC8C 2P6SA 1XDSA 1S8NA 5DCMA 1J75A 5D8LB 4GYGA 2CW0F 2DU9A 2DLLA 4KIGA 4CICA 2AXLA 4Y15A 3CUQC 1OR7A 3ZMZA 3IWFA 4OOIA 4WWCA 2V1XA 1O3SA 2HDCA 1ONVA 4HX8A 1STZA 3R6SA 5KK1A 4M71A 2P5KA 1B6AA 2DBBA 1IXCA 4IF4A 2RGVA 1JGSA 2ZMEB 1YLFA 4RGRA 3IHUA 4TV7A 4M9XA 1O3RA 4Q4ZF 2UWMA 4PGHA 2FBIA 3VODA 2OBPA 2TDXA 2VODA 4G94A 2DO7A 5LRRA 4HW0A 1USSA 3KP6A 2A6EF 5DCFA 4A5NA 4MNUA 4EJWA 3K1MA 3IC7A 3BJ6A 3BOQA 4WCGA 1DUXC 1GXQA 4HLXA 2IRFG 1FOKA 5FD5A 1JHHA 4UVCA 1PP7U 1G4DA 2JSCA 3LSTA 4UXNA 4LFUA 2D1HA 3BPXA 2VBZA 4FX4A 2LNBA 2QQ9A 3T0YA 3R60A 1Q1HA 3L09A 1K78B 2YSRA 3F72A 4OINF 2A5YB 1KA8A 2RC4A 5D5WB 1K78A 2XUBA 2H09A 3KE2A 4N0BA 3V7SA 2GQQA 4YFKF 4UVAA 4YFXF 2YR2A 1ZAOA 4IRIA 3T1BA 4EM1A 2DQRA 3IRRA 4HOBA 2MA3A 5DV5A 2FSWA 3TQNA 2QYOA 4BH9A 3JSPA 3J80Z 4XBFA 3F6VA 1Z91A 4N9IA 1U5TA 3V4GA 1TW2A 3JAMZ 1EH7A 1BI1A 2KIMA 2XHKA 3WTSC 2HOEA 3TO7A 4JK1X 5FFXA 4WX9A 3CDHA 1G3TA 2PMHA 5JVTA 3GX4X 3HTUA 1KQ0A 5LGUA 3DFGA 3RPQA 1ODDA 1SFUA 5BQTA 2HQNA 1FYKA 4HQEA 1FP2A 3E6CC 4HF1A 2O61A 4I0AA 2NAZA 3ZMVA 3QOPA 4RB0A 1R36A 1H0MA 1RZ4A 4D0PA 5E17F 4JQFA 2ZFWA 5F64A 1W5TA 3GFJA 3J80K 2FF4A 1J5YA 2RN7A 2FMLA 5BMZA 2DPDA 1CF7B 2X4HA 3U9GA 3JAMK 1HSTA 2FOKA 1IN7A 3SZPA 2BBYA 1SMTA 4EQQA 2M45A 1CF7A 2M1BA 2PEXA 2M30A 1XGMA 2Q2EA 2BGCA 1FZPB 2R3SA 4G7HF 1T39A 4UUVA 2P7CB 5DD8A 2W25A 2ZNZA 3ZN0A 3VFZA 5LHHA 3WU0A 2LKPA 4KYWA 1SD7A 2HS5A 3QPTA 3C7JA 1UFMA 3NQOA 5BPIA 4F7ZA 2D45A 4M6XA 3R0JA 3WTZA 3BROA 5KVRA 3WE2A 4KT5C 1WKMA 2G7UA 1MJBA 1SD4A 3HRMA 2VXZA 2Q8KA 1FPQA 4QLCU 1WRJA 2KJBA 2YPRA 1R7JA 1IZ1A 3HRUA 4P9UA 3HSRA 5K5OA 4LK0F 1G3WA 3QP5A 1PP8F 2R7DA 2RV8A 5JHUA 4M73A 1GXPA 3ECHA 1OPCA 3DQVC 1DPUA 3HRTA 3L00A 2IVMA 3DEUA 1PDNC 2BYVE 1TQIA 1LEAA 3ZMSA 1HW1A 1KU3A 3E3VA 2ZXJA 4MEYF 3GWZA 1KQ8A 2F5DA 1TLHB 2CSOA 1FBSA 2MLGA 3FHZA 5HLGA 1YS7A 3DXJF 4LJZF 1QQIA 3F8BA 1DDNA 4PDKA 2IT0A 4YIIA 2MH9A 3RKXA 5LEKA 4I98B 3IKTA 2P4WA 2VN2A 3HYIA 4EM0B 5LBQA 4FHTA 4BHCA 2ZBKA 3WTTC 5HS7A 4OMYA 1O3TA 1YQAA 3WE3A 2JPBA 1YYVA 3ZMUA 3WTVC 4HV5A 2XAFA 3F8NA 2O3FA 4P5OA 2HEOA 1RNLA 1SD6A 2STWA 2GIVA 3HSEA 4OIPF 4BAYA 3K0LA 1H9GA 4OIOF 3K1PA 1D8JA 1YTYA 5J8FA 1G6NA 3I71A 2IPQX 4EV0A 1B9NA 2H94A 2VC0A 1GHCA 2WWYA 3RYRA 1IUYA 2RQPA 3M7GA 1P6RA 1O7LA 4IPAA 2FA5A 1Y0UA 2FMYA 3GLXA 1MDMB 3DKWA 2QENA 3EQLF 4LG0B 2RNJA 1U3EM 2V1DA 2P6TA 1DP7P 5IT9Z 2CO5A 3GFLA 4I09A 3R4KA 3G3ZA 2OZUA 4BXUA 3TKYA 1JXSA 4RGXA 1R1VA 2OAZA 1FSEA 2M5WA 5ICFA 2EFQA 1FX7A 2UXNA 2GXGA 3K9TA 2LF7A 2ZO4A 1HW5A 2QQBA 3Q9SA 1R1UA 4KN4X 2FE3A 3EUHA 3OV8A 1FBQA 3RDIA 5DDGA 1Z05A 2F2EA 4MGRA 3NRVA 3DV8A 4EJVA 1PUEE 3KETA 1U8RA 1XB4A 4RAZA 5IT9K 2ISZA 1IAWA 2STTA 4RB3C 1F9NA 5CVIA 2E1NA 4R1HA 1TBXA 2L3DA 4KDPA 1ZG3A 4IXAA 5LGTA 2HWVA 4LGWA 3KP7A 3U1DA 3WU1B 1SMYF 5D5VB 4YFNF 1LVAA 1QPMA 1B4AA 2RVCA 3HHHA 1IF1A 3LA7A 2CQKA 4Q47A 5K1YA 1HKQA 3TO6A 3P9IA 4M72A 4Q5SF 4ENNA 1F4KA 5E1ZB 4ZYEA 1ZG5A 4L18B 1UB9A 1OMIA 1I1SA 2ZMEA 5ERIA 3MCZA 2PI0A 1FC3A 1XD7A 1MZBA 1YW7A 1BI3A 2M87A 3O3KA 4ESBA 2GA2A 4O6JA 2FU4A 1MKMA 1JE8A 1E17A 4HQMA 5CVVA 1AOYA 3I53A 5E1WA 2IA0A 4L9VA 2W24A 1MGTA 1FY7A 2Q0OA 4HX4A 4ETSA 3IRQA 1R58A 3F8FA 3G73A 5L3FA 1SAXA 1ZRCA 3SHFA 3HSFA 3F8CA 4I7HA 2QLZA 2OZ6A 1F5TA 1YFHA 3KP2A 5K5RA 2IA2A 1T38A 3ROUA 4QWQA 1RIOH 4YG2F 2YX4A 3F22A 5HVQC 3COAC 4A0YA 1XCBA 2Z3YA 3O2PE 4ESFA 3DPTA 5L3BA 2JPCA 2MH2A 3Q5FA 1BM9A 2D2WA 5JR3A 4EMSA 1ZYRF 4GXOA 2L02A 4GYIA 4S04A 4ENKA 1L3LA 4B09A 2VC1A 4IJAA 3BDDA 3C1DA 1WQ2A 5F6FA 1BOAA 5CVUA 1O7FA 5CJ9A 4U88A 3E6MA 3WODF 2F5FA 1P2FA 2KIUA 1X3UA 1XDUA 4LMYA 2KIFA 5E8GA 1H9TA 4I2OA 3M1EA 1A04A 3TOBA 1FP1D 1K79A 3K69A 3ML6A 3ULQB 3V8LA 2MD5A 5CLSA 4B8XA 2QWWA 3O6BB 1B9MA 3L7WA 1EV7A 4FX0A 4RB1A 3DPLC 2A07F 3SFZA 3GUDA 3OOPA 1YO5C 1U2WA 2OQRA 1HSJA
chains in the Genus database with same CATH superfamily
3IP4B 4MTDA 1ETVA 1X1CA 2EV5A 2L9NA 1Q1VA 3S14J 1DP3A 5A2QK 1WGXA 1WHUA 3DEWA 3FM3A 2QBYB 2XVCA 2ETHA 4BUPA 1ETYA 1JJ6C 4DIQA 2JT1A 1G3SA 4CA0A 3MD2A 3BJAA 2MC3A 2K4BA 3DU6A 3CMAI 3ZOBA 2CFOA 3E5QA 1D0ZA 4MO7A 1J9IA 1BR4A 3MQ0A 2QBYA 2Z9OA 3P9CA 1FOYA 3QYFA 3OYHA 2NNNA 1BIBA 4IZZA 1OYYA 1IW7F 4XRSG 3WGHA 4MTEA 3GO5A 2YS9A 2FQ3A 3Q0UA 1MNDA 2ZJRF 2F6CA 3HB9A 4HDUA 5K5QA 5JHFA 1ETQA 5ED4A 1R71A 2ZFUA 2L4MA 5LD2C 2X9DA 4C3JJ 3H3UA 5BPDA 3MZYA 2XKOA 1W1WE 4L0ZB 4HX7A 3TEDA 5TGTA 2LOOA 4KIBA 2BE5F 2IA1A 3H5NA 3DCFA 1IC8A 1RRJA 3W3CA 4AUXA 2VQLA 3QODA 5F0CA 3FMSA 4O5VA 5J1UA 4QTRA 3F21A 4AD9A 1IG7A 5EGOA 1LDKB 2DOAA 2VKEA 3D5LA 5D4SA 1OYWA 1IN6A 5B1AH 1U5TC 4U7DA 3ABMH 5CVJA 2DAOA 3EUKL 3V8JA 4BXXJ 4ZTJA 3TW7A 1TQPA 3PFIA 4R79A 2G7HA 4BL0B 4GGGA 1XSVA 1RUNA 4RGUA 1XN7A 2I10A 4XLNF 1XG1A 4QPQA 1GDTA 3FKJA 3JRAA 2G9WA 3QPSA 3E5UA 4RA2A 5E8IA 2DT5A 3CC7I 1TQMA 1LNWA 4Y3OA 4CCNA 1DPRA 1D1CA 2HKXA 2IP2A 5DD4A 5FLXZ 4ZTFA 3I3LA 2W1OA 3FXMA 4KMUX 1X19A 2AQFA 4E6KG 2ZXHA 4G6QA 3S2WA 5EJCA 4RM2A 4IHTA 1UMQA 2NYXA 4L5JA 2PX9A 4BY7J 4A3CJ 2Z2SB 1J7KA 1ENHA 4C2UA 4ZYHA 2QSHX 1TP4A 2MG4A 2R7UA 2O6GE 3OWTA 4KN7X 3OYMA 2CG4A 1XTAA 2VE9A 1MMDA 1YG2A 1VZ0A 3I64A 4XM3A 3OYJA 1T8IA 3H1CA 4HV6A 4IQJA 1C0WA 2BEOA 5D8KB 2WB1N 3PQJA 2JVGA 3DPUA 3RZDJ 1P7JA 5TRDA 3AG2H 2BVMA 2FNAA 4MEXF 5IP7J 2E19A 4LK1F 5LLQA 5FRMA 4W1UA 3GTMJ 2NS0A 3JRDA 1SFOJ 4WXCA 2E2HJ 3EYYA 3WU2C 1ZGJA 1BI0A 1D3YA 3N4MA 3HTSB 2J5PA 1AWCA 3KPHA 3OIQA 3TW6A 2ZNYA 4WK8F 1HW2A 5FLVA 2XPVA 1V5GA 1BC7C 2XASA 5DEQA 1R5HA 4AIJA 1LDDA 3TBIA 5FB2A 1DU0A 2EV6A 3ZMTA 1R5GA 3I0TA 4DZJA 4AYBA 4E7SA 1OYIA 1QNTA 3PNYA 2JZYA 1LFPA 1U78A 2MFZA 4JX5A 5FLXK 5F0FA 4HF2A 1HKTA 1R1TA 2BY2A 3LMMA 1Z1DA 4ZDLA 2EB7A 5D6FA 3NWSA 3J7AO 1IN4A 1XGSA 2XROA 2P5LC 1RI7A 4O3MA 2QA4I 3FXRA 3RI4A 4ITVA 2JTVA 2O0YA 2F5EA 4ASNA 2O9LA 3RKQA 1SC7A 4RAYA 5FKLA 1IRZA 2BXYA 4H4KC 4M6YA 3SYTA 5M5YJ 2M3AA 5K7HA 4BJ5C 4CHUA 1Z77A 3IH4A 5HOOA 2FJ1A 1R49A 1WJDA 2XGEA 2H6CA 5FKOA 4RLQA 5IYCJ 4S05A 3H0DA 1VQPI 5D5UB 1S7OA 5F1RA 3KLOA 2HR3A 4XRSA 4IOCF 3K6GA 1S29A 5L3CA 4M9SA 4Q48A 3GZ6A 4XOPA 3FM5A 1KU2A 5GP9A 5ICGA 1YE9A 1OCPA 2F48A 1QPIA 3DWLE 2KRFA 5LHGA 1ZH5A 2COBA 2NOGA 3LSGA 4PZJA 4OAZA 3PSIA 4KA4A 4LIVA 3OY9A 3SZTA 2XSDC 3BJOA 1XMAA 3HPHA 4IRGA 2EIKH 3HUGA 1XSXA 1D5VA 1IN8A 1XMKA 3FF5A 2XV4S 3F9KA 3E97A 3VEPA 3J81Z 4UY8I 1G8XA 1M1EB 1V5FA 2ECBA 3HRSA 2EZKA 2LFBA 3QQAA 2EZLA 4CYCB 4FCYA 4IRHA 2QF7A 4G9YA 3WTXC 3BCBA 3I54A 1XGOA 5KAFC 4RGSA 2EBIA 2W48A 4KMFA 2PJPA 3M07A 1P9QC 5EEHA 3QRFF 3ASNH 2HNHA 3DP7A 1ZREA 4CYCA 1W7PB 2ESNA 4P96A 2EINH 1TWGJ 1I27A 5JFRA 2XRNA 3CQZJ 1U6GA 1Z21A 2L9VA 5HLTA 2UXXA 2LREA 3C2GA 5L3EA 2WC2A 1EH8A 2D1VA 4UV9A 4XRFA 2GAUA 2ELHA 3GYHX 2K5CA 5LHIA 4BE1A 2BOLA 2EIMH 2OUMA 2ICWG 3P7NA 3SEQA 2TRTA 1OKRA 3WHBA 4F91B 1PUFA 4KFCA 3CC2I 2VT3A 3O8HA 1YW8A 4GDFA 4DYQA 3CF2A 3OL4A 2QKMB 3HZJA 3OL3A 1VQ8I 3N97A 3E5XA 2ZB9A 3TOAA 1W5SA 2CQ7A 1RESA 4IVNA 4XORA 3A03A 3FWEA 5L3GA 4A3EJ 5H6QA 2JA2A 3KP5A 3MEXA 5E79C 3TDUC 2VOOA 3ZQLA 2KLOA 2VQCA 2YX7A 3KX2A 1MBFA 2LG4A 3WG7H 3CCVI 1GLNA 2BXZA 4MQ9F 3F6OA 2PLYA 3LWFA 4MFDA 1I1GA 1I50J 3SXYA 2HTSA 3J81K 2HVQA 1S7AA 3FXUA 4NNJA 4KUMA 4EJTA 3MFKA 1KU9A 5L3DA 3OR1C 1VTNC 1OCOH 3KP3A 2ZJ2A 3KCCA 1TNSA 1TW3A 2DA7A 2VT2A 3CUQB 4L9TA 2RKHA 2CGPA 2V9KA 3KEQA 5CKTA 2KFDA 2MGQA 3OR2C 3IWZA 1LB2A 3WGGA 1J59A 2QUFA 3CCMI 1YX5A 2X48A 2H8WA 1EJ9A 2R7VA 2QCOA 2VQGA 1MDMA 2M4GA 2DTRA 3BZ6A 2EIJH 3G6EI 2LY9A 4KIFA 4J00A 3CUQA 1S6LA 2JA7J 1BI2A 4LG0A 3EPZA 1TNTA 1IO2A 5C44J 1O57A 1ETXA 2DOFA 3ERMA 3BCAA 2ZKZA 3CCUI 3ZRGA 3RQIA 3OS1A 4HNVA 3ZCOA 5KHDA 3CMEI 1KGSA 2MSYA 4Y17A 1QA6A 3MKWB 4PGGA 3HIFA 1JKRC 2HXOA 4A3MJ 4AYBN 1JKOC 1P4WA 3QOEA 2UUZA 1RUOA 2VBWA 2VQHA 3V7CA 3AL0C 4HAMA 1WI9A 4D7MA 1YI2I 3NEUA 2X51A 3MAJA 4FT8A 1DU6A 1ON2A 2WAFA 2OCEA 3RYPA 3B02A 3F23A 1X1BA 2LSOA 2OCCH 1BN5A 2EFOA 1USTA 4XIDA 3DEEA 4AWXB 1H88C 4HA8A 4HG2A 3BG3A 3R61A 1HC8A 2OPTA 2OU2A 4M3BA 2XGXA 3K4CA 3LSIA 2DMNA 2HQRA 5C4JJ 3KYLA 5IOZA 1CGPA 1T98A 1OLTA 3S2HJ 2AHQA 3WTYC 4HYEA 5F0HA 4CXFA 3N05A 1LJ9A 2HYGD 2X0LA 1SFXA 4CGZA 1Y56A 4M74A 5DCMB 4GO1A 4CH7A 1MBGA 5FLMJ 5CYVA 3I55I 2A69F 1X1DA 3L9FA 1K83J 2KRCA 2F5CA 4WXHA 1DGRM 2MYSA 1P92A 2W57A 2M8GX 3K70C 2WTEA 4EGZA 4NC6A 1TL8A 1X58A 2NRAC 1N25A 1NHAA 3B6AA 4LB5A 3FMQA 1FT9A 5J4VA 2O8XA 3BP8A 4U7BA 1ZLKA 2ESHA 4XN0A 1MMAA 3FDYA 3PM1A 3TO9A 1XX5A 3PO3J 3SJMA 1UG0A 3BG9A 2QKLB 2NS8A 2KDZA 3RPUA 1VQOI 2VBXA 1B8IA 4XSZF 1X1AA 1MNEA 3CO6C 4BQQA 1I39A 1A5JA 2A61A 1V3FA 3CJTB 3OYNA 1HCRA 2DTZA 4KISA 2E1MC 4A3JJ 1SFKA 1X3ZB 4DQ2A 2LC2A 2L7MP 3EETA 2CJJA 1VF9A 1SD5A 2FNPA 4L9NA 4FETA 2ZCWA 2JVHA 3OYGA 1HQCA 1SVMA 4BNCA 4DNCA 1DQUA 1Z3XA 1I5ZA 2LYCA 2L54A 1N75A 4UNOA 4LLLA 1FOWA 1ON1A 1S7EA 2R7FA 2CMPA 2HFHA 4HPQA 4XLEA 3JSOA 4B43A 2W4SA 5FROA 2V9PA 5ILVA 1D1AA 4HLYA 4OIRF 4A3FJ 1S72I 4CO8A 4LG3A 4E7LA 3CMYA 3V42A 2Y0MA 4KICA 2Y30A 3H5RA 4EEFG 1JKPC 3RPUD 2L7ZA 2Z33A 1FIAA 1XCVA 3L2UA 1L0OC 4XKWA 3GTJJ 5IT3A 3EUHC 2EFPA 5HLHA 5DUIA 4L0YB 4ESJA 4B47A 3AKZA 1MD0A 2DA5A 3PL8A 4P9FA 5E18F 3OSFA 3BG6A 4WF2A 2DA4A 3I58A 1YHQI 5BS6A 3K2ZA 4OMZA 4XL9A 2DA2A 1X4PA 2Y75A 2HI3A 2DMPA 2X1CA 3DKYA 4LD5A 2DK5A 4BEHA 4ZDPA 2HGCA 1A6QA 3VYTB 2HU9A 4EM2A 1A6IA 3J7YJ 3DBLB 3H92A 1AA7A 1T33A 2A5WA 3HOTA 2IGKA 2Z99A 1IXSB 4I02A 3LA2A 4ENMA 4LLNA 3CO7C 2PJRB 2K3FA 2PMUA 2ME6A 1GV2A 3IAS2 4XICA 4MQVA 1MJAA 1LE8A 2QM3A 2WV0A 3LOCA 3I4MJ 3HXLA 1Y0NA 4P55A 1MNMC 2NVYJ 1T6SA 4LB6B 5ICCA 2YU9J 4WXDA 2PJRA 3CF5F 2KP6A 3LSPA 4G6DA 2H27A 1P4AA 3LSKA 4UUSB 1TZLA 4AIKA 2K86A 2JRTA 1D8KA 1ZN2A 3PNVA 4NC8A 1LDJA 2L5QA 3FXQA 3RTRA 5J1RA 3CP8A 3ZQ7A 2P7VB 3HL2A 1K7AA 3V8KA 1I6XA 2L4AA 4E70A 3WGIA 4OU0A 5AIQA 2GOMA 4UUSA 3JW4A 3KLNA 1NG7A 3E6BA 3OMYA 2ID3A 4EGYA 2EJRA 3S1MJ 4JOMA 1LFUP 2ZMEC 4H0EA 2GZWA 3I4PA 5H2FC 3E0JB 2K4JA 5A2QZ 2DDAA 1LUJB 4BYYA 3BTJA 3CCQI 1AKHB 1BJAA 2VL8A 4KITB 1BA5A 4CDGA 4HSTA 2KZVA 3RJPA 1OQYA 2R7RA 2X85A 1MBEA 4HF0A 3M9AA 2ECCA 5DYMA 1AKHA 1IRFA 3ZR8X 1YOVB 2P5VA 1R00A 5D5XB 3S2DJ 1WJEA 1P7IA 4M3FA 4A5MA 3DF8A 5GTHC 1FTZA 3KZZA 1EA3A 1RETA 1RKWA 3MZHA 3K4JA 9ANTA 1ETOA 2Y2ZA 2J5OA 1BBYA 1YS6A 2BZTA 2DT7B 3K4LA 4CCKA 1B59A 1RC9A 4A12A 1REPC 1U5TB 1UCRA 2IAIA 4IHSA 4A3BJ 4OIQF 1WH7A 3I59B 5IOYA 1MJ9A 1B72B 2VBYA 2MBFA 3LL7A 3JTGA 2EILH 4EJUA 3CJNA 4ZZDA 4ZH4F 1R4MB 2XAQA 3KIOA 3I9V2 5EYRA 3KEYA 3H9GA 5CPRB 2CFXA 3H3ZA 4A2UA 2KJCA 3I59A 1MBKA 3S3MA 3T8TA 1XPXA 5ICEA 2EV0A 2CRGA 2VXDA 5D4RA 3ELKA 4AVZA 2GWRA 1FEXA 1FNNA 3TDZC 3F3XA 2HKOA 3J7ZI 2CV1A 2KT0A 5E3NA 2GXBA 4A6DA 2K27A 2LKSA 1ULYA 4DJAA 3DLLF 4NHJA 1MIJA 5AIPA 1QZZA 1NTCA 2VB6A 5FKMA 2VOPA 2CUEA 2KQRA 3ISPA 3S15J 4Y52J 1R22A 3OYEA 2R7OA 1VQ5I 2R7WA 2V9VA 1XGNA 2W84A 3ASOH 5EG0B 2BV6A 4IO9F 2P8TA 5HDKA 1I3QJ 1GVJA 2QVOA 1JGGA 2M0CA 2K40A 2KISA 3D0SA 1VNDA 5LGNA 1VFCA 3KEOA 3OYDA 3CCYA 4D7NA 2C6YA 2K3PA 2M8EA 2O5RA 5AONA 3L2CA 4NQWB 2A6HF 2NVTJ 1R23A 4G8XA 2FXAA 6PAXA 3G1MA 5CQEA 4E7ZA 3GTPJ 3REOA 4ON0A 3ZQIA 3BT9A 1YIOA 1FMWA 2WV1A 3ESWB 3KP4A 5B1BH 2QSFX 2DN0A 3W6JB 2L9RA 3K1NA 4G7OF 1YRNB 3ABUA 2V79A 4R8HA 3KZYA 3S17J 4NQWA 4S0HB 2VE8A 4M9ZA 2CS3A 1WWXA 2OF7A 1XS9A 4BBSJ 3OSGA 5J3LA 1AHDP 1Z7UA 2LTPA 4HBLA 3IH2A 4HRIA 3OYFA 4AIDA 4E7KA 2Q2EB 2OA4A 3E6DA 1EH6A 3QU6A 2FRHA 5J6XA 2XB5A 3AG3H 2EA2A 2HZTA 3C18A 3GEZA 4P1WA 2GA1A 4FTHA 2L7KA 2MABA 1WJAA 1FBUA 4G7ZF 2LVSA 2EFWA 3VSKA 1W0TA 4I01A 4BHPA 2FEZA 3QPLA 4HZFA 2QZ8A 3W6KB 4C9YA 4XK4A 1RR7A 1KQ9A 3LSRA 1SVOA 3PSFA 3CUOA 5LEJA 5LRSA 1BL0A 1BIAA 2R4GA 3RQ4A 4ZYGA 3DLAA 2W85A 2P81A 3ABKH 3ZQGA 4CZZA 1KYZA 3S16J 2DFFA 2PBIA 4KJZA 5CVRA 2O7OA 3H36A 3BG5A 5JVGF 3EYIA 2XIGA 1WFXA 4D9JA 1O4XA 1HXDA 3LFKA 2NNYA 1ZGWA 3GF2A 1SEUA 3SQNA 3M8EA 3GLLA 1LKXA 3GFMA 3GZ5A 2H6BA 1W5CC 2DW4A 1WSUA 1ZLJA 2Z5UA 2V1UA 4A0ZA 5EZHA 5H6RA 2DFIA 4N4NB 1S3JA 3QP6A 3ZMDA 2ZC2A 5D6EA 1SFEA 3LQQA 1Z9CA 3ZQCA 3UKGA 4U0WA 3BQZA 1RPWA 5DUKA 3P9KA 1U0JA 4Z2YA 2E34A 4F3QA 3CLOA 2XKPA 4D1QA 1MBHA 3FZVA 3GVAA 1IRGA 2YU3A 2XAGA 4YIFA 1Z6RA 3K10A 3Q9VA 2ACJA 5EZGA 4ZYDA 4JBAA 1K6OA 1G3YA 1TWAJ 3GFIA 2E7WA 5M5XJ 2HYFA 4C2MJ 4UV8A 1LQ1A 3A01B 5E1XA 1FJLA 2Z1DA 4ABZA 4AVPA 1IV6A 1KU7A 1ETWA 4I0BA 4F52A 1T56A 4Y13A 4BQAA 2XF7A 3DKXA 1F1ZA 1TWCJ 4XN3A 2E36A 2W00A 5K7FA 2R7SA 5H20A 2EA4A 2JK3A 3RKWA 3H0GJ 4L9JA 3WTWC 3LA3A 4RLFA 3WTUC 3A01A 1V4RA 2DA6A 4AIHA 2EQRA 3WG9A 2K02A 2ID6A 1MBJA 3H9QA 4X6AJ 5ILSA 3FMRA 4N9HA 3LAPA 1ZR2A 1HDDC 3V7RA 4XKBA 2LDUA 5JI6A 2CQQA 2E1CA 1ZHFA 1EKEA 3T8RA 1SVLA 3VOEA 2IS2A 5E20A 2M7AA 5TJJA 3CTAA 4F55A 3A4CA 3QU3A 3I56I 2Y9YA 1TT5B 1DGWY 3HOYJ 1E2XA 2RREA 3JREA 1IJWC 3TGNA 1MMSA 5FD6A 3RIRA 3CZ6A 3ECOA 2K9SA 4FE7A 2DDBA 2CWEA 5FKNA 5EEAA 1VQ4I 1ZRDA 1QBJA 3JRFA 4L5IA 4UHTA 2QQAA 4LIUA 1VQ7I 3BQYA 3M8JA 4NB5A 3G2BA 1I6HJ 1ZGAA 5FKKA 1QZEA 2B0LA 2HOSA 4A6EA 3WHCA 1J0RA 2HTJA 4UVBA 2VJIA 4K2EA 1QVTA 2RDPA 3GW2A 1Y1WJ 2VKDA 3F8MA 4FQGA 3S1RJ 3PO2J 2LF8A 1IN5A 4F93B 2E7XA 3EUAA 1IXRC 3HHGA 4I99C 1VQLI 2VONA 2FBKA 4XKCA 3VDXA 2ZXIA 1HKSA 2Y48A 4MHGA 4EJOA 3GXOA 4EATA 2WA0A 4XR6A 3LAJA 2LY1A 1ACIA 3SDBA 3H35A 3CJQB 4BE2A 5FO5A 3EDPA 2DXIA 3BLYA 4LITA 3OS0A 3C3WA 5FFZA 2EFNA 2HVSA 1UHMA 2DQLA 3A0HC 4HDVA 1NK2P 2XAHA 2UZKA 5BOXA 4U0YA 1ZG1A 2LMDA 5HNHA 2NS7A 2LK2A 3G1LA 2M4KA 4CUGA 1P4XA 1W7PA 1X4OA 5FGMA 3IL2A 3ERED 3R0AA 1ZK8A 1JHFA 3U2RA 4KNYA 2HDWA 3CESA 4NUBA 4C2TA 4LLGF 3CP2A 2OQGA 1FYLA 3FX3A 1NK3P 5C4XJ 5HLIA 2GLOA 2DI3A 1X3WB 2DODA 4GCVA 3B73A 4XLPF 1T2KA 2V6CA 4ENJA 3C2BA 3CCJI 1OJLA 3IKVA 3CJRB 2O8KA 1LEBA 1HBXG 2ADUA 3BTCA 3Q0VA 3QPHA 4HNTA 1ZARA 4IQ4A 2A3SA 2BY1A 2KKOA 2COMA 3RKYA 2ISYA 2R7QA 1UHWA 1OISA 2JN6A 4XSXF 3HOWJ 3FK6A 2BY3A 2R0QC 3BPVA 1FSHA 2F5VA 1MH3A 2NVXJ 4U0VA 5EEGA 1KYWA 3QAHA 3HOSA 2DPUA 2XAJA 3CD6I 1HA8A 4BHBA 1TTYA 3ABLH 2HXIA 1QZYA 3LSMA 5HS9A 4XKVA 3G71I 1FLIA 2AS5F 1Z6TA 3T5XA 3KYDB 5C3EJ 3ZPLA 1BR1A 5HS8A 1FYMA 1W7PD 1TWFJ 2EWNA 2VKVA 2ME0A 1QGPA 2PFBA 3MWMA 5HDNA 1J2XA 3BR1A 2IGNA 2E5ZA 4XLCA 1ZRFA 3PFYA 3AAFA 3SEZA 3LSHA 1IDZA 1R9TJ 2GIZA 2O03A 2PG4A 1JT0A 2MLKA 4KT6A 1GT0C 5GADJ 3BY6A 4EVIA 4FISA 3VB2A 2NOJB 2E1MB 2DMUA 2V26A 2CUZA 2VIXA 5HDGA 2K9QA 2XGCA 2E71A 2D5VA 1YW9A 3M8FA 1JUPA 1XSDA 2FBHA 1E0EA 2L01A 3Q0WA 2F4OB 3LQRA 2A68F 2OD5A 3I5UA 3ZN1A 4CYDA 3S8PA 1FWZA 4ZZLA 3JRGA 5J8CA 3K4NA 3PQKA 4XONA 1W4MA 3FK7A 2IJLA 1ZQ3P 5IP6A 2CV2A 2DK8A 2LD5A 1R6RA 2JJ7A 2CYYA 2DJNA 3KFWX 4XQFA 2L9SA 2A05A 3BWGA 4QIWN 3ABTA 2CV0A 1E3HA 3JTHA 1V54H 2IW5A 1O3QA 1RR8C 1QO0D 4A3DJ 5F27A 4PJ0C 1PVEA 4RB2C 1Y39A 2K7LA 5J47A 4PSXA 2PN6A 3BTIA 2EK5A 3ZP5A 2PQ8A 4RS8A 2R7TA 1B1BA 5ILUA 3G4SI 4PCQA 4A0XA 2HZDA 3QYEA 1T0FA 2H1LA 1BC8C 2P6SA 1XDSA 2PMZA 3ONQA 2LBFB 1S8NA 3DBHB 5DCMA 1KZHA 1J75A 1X1PA 4A69C 2P0WA 2XGDA 1Z67A 5D8LB 2CQXA 4XOTA 4GYGA 3K4KA 1BOBA 2E1OA 4Z6YA 1WJCA 2CW0F 2JA6J 2LBFA 1E3PA 2DU9A 2DLLA 4A3GJ 2V1NA 4KIGA 4CICA 1WPKA 4DBRA 1UJ8A 2AXLA 4Y15A 1APLC 4E7IA 2G0EA 3CUQC 3FIWA 3D5RC 1OR7A 3SZGA 1WJBA 3ZMZA 1WCMJ 3IWFA 4OOIA 4WWCA 2V1XA 2M7BA 1O3SA 1ZR4A 2HDCA 3BR3A 3FISA 3BC8A 1PJRA 1OCZH 1ONVA 4HX8A 4DW6A 1FTTA 4F92B 1STZA 3R6SA 5KK1A 3PIPF 4M71A 4FE4A 5GTIC 2P5KA 1B6AA 2DBBA 3HG9A 3IH3A 1IXCA 4IF4A 2RGVA 1JGSA 2ZMEB 2R5YB 1YLFA 2WY8Q 3OOUA 4BDYA 1ZTRA 4RGRA 4YEJA 1OCTC 3IHUA 5DTDA 5FJ8J 4TV7A 1JTXA 4M9XA 4DGWB 3OYAA 2QEXI 2L0KA 4Q4ZF 1O3RA 1MSFC 3IV5A 2Y0SA 2UWMA 1KONA 4PGHA 2DMQA 1TWHJ 2FBIA 1U9NA 3VODA 2OBPA 2TDXA 4X0GA 2VODA 4G94A 2DO7A 3W2VA 2Y9ZA 4J01A 1VQ6I 2IS1A 1OFCX 4V2FA 4XLAA 4XRMA 4RDUA 3H5AA 5GPCA 5LRRA 2WAQA 4HW0A 1USSA 5DM6F 3KP6A 1D0YA 2A6EF 5B3SH 5DCFA 4A5NA 4C30A 4MNUA 4XMYA 1MMGA 2BHYA 4EJWA 3K1MA 2KDOA 3IC7A 3BJ6A 3BOQA 4WCGA 3GTOJ 1DUXC 1GXQA 1LPQA 4IHWA 2XDVA 4HLXA 2IRFG 3A1YA 4G6TB 1MSEC 1FOKA 4CSWA 1VI0A 5FD5A 1JHHA 4UVCA 2DCEA 1PP7U 3ZGKA 1G4DA 3W2WA 2JSCA 3LSTA 3MN2A 1YIJI 4UXNA 2M34A 4LFUA 2D1HA 3BPXA 4C3HJ 1UAAA 2X1DA 2VBZA 3DTIA 3PUBA 1IV8A 4FX4A 4V19K 3UR3C 2IS4A 2X6XA 2LNBA 3GTLJ 1QU3A 2QQ9A 3CCEI 2ZSIB 3T0YA 3PIOF 2KHMA 3R60A 3AG1H 1Q1HA 3FBNB 3L09A 2Y69H 2JRMA 1QHGA 3TP0A 3DTKA 2EPFA 1K78B 2JA5J 4OAYA 1ERDA 4IHVA 2YSRA 2KL4A 5GAHJ 5DS9A 3F72A 4OINF 2A5YB 1SANA 3K4BA 1KA8A 2XPUA 4ZJZA 2RC4A 4NC7A 5D5WB 2E35A 2VUMJ 1RKTA 2LLKA 1K78A 3M4OJ 2XUBA 2H09A 3KE2A 4N0BA 3U21A 3V7SA 3OYBA 2E5NA 2GQQA 2DYSH 1QVUA 4YFKF 4UVAA 4YFXF 2YR2A 4N4OB 2PMZN 1ZAOA 4IEJA 4IRIA 2V4JC 5KCMA 3CCRI 3PNTA 3T1BA 4JYKA 4EM1A 3OYKA 2DQRA 3IRRA 2W82A 1Y6IA 4HOBA 3UNGC 2MA3A 2OJED 4IKFA 2LY2A 2WY7Q 5DV5A 1N78A 1S5LC 2FSWA 3TQNA 2TCTA 3HOVJ 4QPOA 1FIPA 2QYOA 4BH9A 2Y31A 3JSPA 3J80Z 2XAUA 4XBFA 3LSJA 3J7AY 3PJRA 2N8GA 4PFPA 3F6VA 1Z91A 4BQNA 1NG6A 4N9IA 1UZCA 1U5TA 3V4GA 5IY5H 1TW2A 3JAMZ 1EH7A 2MC4A 3QWLA 1B72A 1BI1A 4AU7A 1G59A 2KIMA 2XHKA 3WTSC 2HOEA 3TO7A 1JUMA 1Z3YA 4JK1X 3JR9A 2X6WA 4PJJA 1UELB 1HLVA 2CW7A 1WJFA 2ZJPF 3ZQHA 5FFXA 5F08A 2YUSA 4FASD 4WX9A 2W7NA 3CDHA 1ORKA 5KAIC 4BACA 2LKXA 1G3TA 3BR5A 2PMHA 4BS9A 5JVTA 3GX4X 3HTUA 1KQ0A 2Q1ZB 5LGUA 3DFGA 3KYCB 3RPQA 1ODDA 3MKLA 1SFUA 5BQTA 2JMWA 2HQNA 4I6ZA 1FYKA 2JUGA 4ANJA 4CCOA 2FUG2 4HQEA 3PUFA 3AFHA 1FP2A 3E6CC 2AXTC 5LFAA 4HF1A 1R4NB 2O61A 4I0AA 4C3IJ 1E3OC 3HM5A 2NAZA 2Y0SN 3ZMVA 3QOPA 1K61A 3K4MA 4RB0A 3IAM2 5IP9J 4D5FA 4DYCA 1R36A 1H0MA 1FOXA 1RZ4A 1J09A 2BVLA 5EG0A 4D0PA 1LVKA 1BW5A 5E17F 4JQFA 1BR2A 2F4MB 2ZFWA 5F64A 4BE0A 1W5TA 3GFJA 3J80K 2FF4A 1J5YA 4E7JA 4II3A 2RN7A 2IGMA 2WAQN 2FMLA 5BMZA 3S3OA 2WAEA 3TP3A 2DPDA 1CF7B 2X4HA 3MKZA 3U9GA 3JAMK 3TMOA 1HSTA 2FOKA 3TL4X 3U1KA 1IN7A 4I76A 1YRNA 5EGOB 2UV1A 3SZPA 2BBYA 2DJIA 1SMTA 4EQQA 2M45A 1CF7A 3GMEA 2HVRA 3VWBA 2M1BA 3X2QH 2OTLI 2PEXA 3BTLA 2RNGA 2XSJC 2M30A 1XGMA 2XC7A 2Q2EA 3IUOA 4X1EA 1W0UA 1GVDA 2BGCA 2QQ8A 1JUSA 1FZPB 2R3SA 2QSGX 4G7HF 1T39A 4UUVA 5JLWA 1F36A 3S32A 2P7CB 5DD8A 2W25A 4IHXA 4CCLA 4IHYA 2ZNZA 3A2KA 1YJ9I 3ZN0A 3VFZA 5LHHA 3WU0A 2LKPA 4KYWA 1SD7A 2VJ5A 4B4CA 2HS5A 3QPTA 3FXKA 2LRDA 4L5EA 2CUFA 3C7JA 1UFMA 2JQ7A 4B3AA 1IGNA 3NQOA 5BPIA 5DM7F 1WZ2A 4F7ZA 2D45A 1ETKA 1EF4A 4M6XA 3R0JA 4Y33A 4YELA 3WTZA 4PSWA 3BROA 4XNFA 5KVRA 3WE2A 4KT5C 1WKMA 2G7UA 1JTYA 1MJBA 2RQQA 3HC7A 1LFBA 3HBLA 1SD4A 3HRMA 2VXZA 2Z16A 2Q8KA 1FPQA 4QLCU 1WRJA 2KJBA 2YPRA 1R7JA 4RAFA 2M0MA 1IZ1A 2OTJI 4RMNA 5E3MA 3HRUA 4P9UA 2VASA 4UB8C 3DBRB 2HPIA 5B5EC 2HQ5A 3HSRA 5K5OA 2KIQA 4LK0F 4DYRA 3H3VK 1TT0A 1G3WA 3QP5A 3FXOA 2R7DA 2RV8A 4BU2A 5JHUA 1PP8F 1OCRH 4JX4A 2B63J 4M73A 3CMMA 1GXPA 3ECHA 1OPCA 3DQVC 3KZIC 3GZNB 1DPUA 3HRTA 4BJTA 3NAUA 1K6YA 2VI6A 3L00A 2GOXB 2IVMA 3DEUA 1PDNC 2BYVE 1TQIA 1Y1VJ 1LEAA 4OWRB 3ZMSA 4DBQA 5K7ZA 1HW1A 1KU3A 1S9HA 3E3VA 2E2IJ 1T08B 2ZXJA 1Y8QB 4MEYF 3CDLA 4MFEA 3GWZA 1KQ8A 3G1OA 3ZQQA 2F5DA 1TLHB 4AM3A 3VYRB 2CSOA 1FBSA 2MLGA 3L2WA 2HQAA 2K9NA 2ELKA 3FHZA 2H1KA 2ZXWH 5HLGA 2I8DA 3HEFA 1Y8RB 2GXAA 1YS7A 3DXJF 4LJZF 1QQIA 3F8BA 2FOWA 4W97A 2A6TA 1DDNA 4PDKA 4IX7A 1IRXA 2IT0A 4YIIA 2MH9A 3RKXA 5LEKA 1QRYA 3FXJA 2DFHA 4RAGA 4I98B 3HJEA 2E2JJ 4RBOA 3O8GA 2B9SA 3IKTA 2P4WA 2VN2A 5BNGA 2DT6A 3HYIA 3NARA 4A93J 4UUTA 4EM0B 5LBQA 4FHTA 4BHCA 3GTQJ 2ZBKA 2VJJA 3WTTC 5HS7A 3GTKJ 1D1BA 3HUGB 3RCOA 4A3IJ 2HOAA 3K2AA 4OMYA 2GM4A 1O3TA 4B3XA 1YQAA 3WE3A 2JPBA 3S93A 1YYVA 4BKXA 3ZMUA 3WTVC 3OIOA 3VYUB 4HV5A 2XAFA 3A0BC 1CQTA 3F8NA 2LH9A 1JKQC 3AL0B 5IYBJ 2O3FA 4P5OA 2HEOA 3MZ8A 4A3LJ 2CH0A 3OYLA 1RNLA 1SD6A 3MKYB 2GIVA 3HSEA 2STWA 4OIPF 1YX3A 4BAYA 3K0LA 2MD0A 1HDPA 1H9GA 2OC6A 4OIOF 3K1PA 1D8JA 3FXLA 1YTYA 2IEKA 4E7HA 5J4YA 3GBGA 1PUFB 5J8FA 1G6NA 3I71A 4GRIA 2IPQX 2I5UA 2EZHA 4DOZA 4EV0A 1B9NA 2JSPA 2H94A 2VC0A 1GHCA 2NXNB 2WWYA 3CCSI 1U9OA 2JUCA 3RYRA 4YIRX 3JRHA 1IUYA 3S1NJ 4IOAF 2RQPA 3HGYA 3M7GA 1GUUA 1HF0A 1BW6A 1P6RA 4PK4A 5CQGA 2H8RA 3QYBA 2IBDA 2BY0A 2X1EA 1K4SA 2RAEA 1WVRA 4M3EA 1O7LA 4IPAA 2DOEA 4U87A 3ZQFA 2FA5A 1Y0UA 4PJNA 1D5YA 2FMYA 2K9MA 2MW8A 3GLXA 1MDMB 4PFOA 3DKWA 4BBRJ 1Z0XA 2QENA 3HPGA 3EQLF 4RM3A 3P5JA 4LG0B 2BW3B 2RNJA 1X2MA 2VPRA 5M5WJ 1U3EM 1X2NA 4ZC3A 2V1DA 2P6TA 1DP7P 2FX0A 5IT9Z 1POGA 2CO5A 2KPMA 3GFLA 4BXFA 4I09A 3CDIA 4NDLA 2BW3A 1A36A 5E3OA 3R4KA 1UHSA 1VQKI 3FBIB 2XPWA 3OIPA 3AG4H 1YITI 3DU5A 3G3ZA 2IXSA 2OZUA 4BXUA 2L2OA 2VJ4A 3SDGA 3TKYA 1JXSA 4RGXA 4DZPA 2OV7A 3K7AJ 1R1VA 2OAZA 4M6VA 5EDNA 1FSEA 3Q3SA 1IDYA 3B6CA 1G2HA 4UB6C 2E60A 3K70D 4YRVA 2M5WA 3C2HA 5ICFA 2L7FP 2EFQA 5EF6A 4AC0A 4NBQA 1FX7A 5F1JA 5M3MJ 2VLAA 2NVQJ 3HKZA 3D1NI 2UXNA 4CCMA 1I3AA 2GXGA 4HSRA 3CC4I 3K9TA 2K9LA 3NWTA 3OS2A 3L2RA 3GCMA 2LF7A 3SFIA 2BHZA 3L2QA 2ZO4A 4QSHA 2XRLA 2DFEA 4JX6A 1HW5A 2QQBA 3Q9SA 1AU7A 3D5SC 1R1UA 2B7EA 4KN4X 2FE3A 3EUHA 1A31A 3OV8A 3I4NJ 4MIMA 1FBQA 3RDIA 2F4IA 5DDGA 1ZKGA 2ELJA 4BDZA 1Z05A 1YJNI 2F2EA 4MGRA 3NRVA 2HYJA 3DV8A 4EJVA 4XLFA 1PUEE 3KETA 2WBMA 2X6YA 1U8RA 1XB4A 1PYVA 1TC3C 1YJWI 4LOCA 4RAZA 5IT9K 2ISZA 3HDDA 1IAWA 2STTA 3HOXJ 4RB3C 1F9NA 5CVIA 2E1NA 4R1HA 1VQMI 5GAGJ 1TBXA 2L3DA 3BR0A 2R5ZB 4KDPA 2V6EA 1ZG3A 4IXAA 4V2GA 3FHNA 2R7XA 5LGTA 1B8IB 1HOMA 2HWVA 4IL6C 4LGWA 2HPMA 3KP7A 3U1DA 3ZXSA 1V55H 3WU1B 4B48A 1VQ9I 1SMYF 5D5VB 2R5ZA 2M9HA 2K85A 3VSLA 4YFNF 2R93J 1LVAA 5HNFA 1QPMA 5GPAA 1IUFA 1H89C 2VPLA 1B4AA 2HDDA 3CLQA 2RVCA 1JT6A 3HHHA 3LA7A 3VYSB 3MVPA 5M3FJ 2CQKA 2LR8A 1IF1A 4Q47A 3JRIA 5K1YA 1HKQA 3TO6A 3P9IA 1MMNA 4M72A 4Q5SF 2NVUB 4ENNA 1F4KA 5E1ZB 4M3GA 4ZYEA 5E3LA 4GFBA 1ZG5A 4L18B 1UB9A 2ZSHB 1OMIA 1I1SA 5KNLA 4A3KJ 2KZGA 2ZMEA 2M2EA 3MCZA 5ERIA 2R5YA 2PI0A 1FC3A 2CUJA 2JWTA 4Y4RA 1XD7A 2XF6A 1MZBA 1YW7A 1BI3A 2CW8A 2M87A 3O3KA 4ESBA 3RZOJ 2GA2A 2ZJQF 2VKHA 4BJ6C 4O6JA 1SAUA 4Y7NJ 4ZDOA 2FU4A 1MKMA 4ZYAA 2FQ4A 2CU7A 2R7ZJ 3JRCA 1WI3A 1JE8A 1E17A 1QHHD 1OCCH 2V7FA 4HQMA 5CVVA 1AOYA 1T0FC 1MH4A 4CCJA 3W6VA 3DTEA 3BG7A 3E7LA 5IPAA 4BY1J 3S1QJ 3BR2A 3I53A 5E1WA 2IA0A 3H9JA 4L9VA 4BEHB 2W24A 1MGTA 1FY7A 2EH3A 2DA3A 4M3DA 2Q0OA 1V5EA 4HX4A 1D0XA 4ETSA 3IRQA 3OYCA 1R58A 3F8FA 4JP0A 2IGOA 4E4HA 3G73A 1Z7LA 5L3FA 3FKIJ 3LNQA 5HODA 1F43A 1LE8B 1SAXA 1ZELA 1ZRCA 3SHFA 2HOTA 3HSFA 2DMTA 3F8CA 2AO9A 4I7HA 2QLZA 5J40A 1OR7C 2OZ6A 1F5TA 1YFHA 3KP2A 1WJ5A 5K5RA 5J1YA 2IA2A 2DA1A 1T38A 3HOZJ 2WADA 3RSNA 2QGUA 3ROUA 1FMVA 4XLHA 4CZCA 4QWQA 1RIOH 4YG2F 2YX4A 3F22A 5HVQC 3COAC 3HGGA 1U8BA 1ITYA 4A0YA 1XCBA 4PJMA 5F04A 2Z3YA 3O2PE 2GBYA 2JA8J 1VQNI 3W2AA 4ESFA 3DPTA 4BQOA 5FRNA 3LFUA 5L3BA 2JPCA 2MH2A 1MW7A 3GTGJ 1XC5A 3Q5FA 3A02A 1JI8A 1BM9A 2D2WA 1UG2A 4D5CA 1W36D 3JRBA 5JR3A 1JJ8C 3HKZN 4MLOA 2X6OA 4EMSA 3E1SA 1ZYRF 3BZKA 3F0CA 3BR6A 4GXOA 4G12A 2XB0X 5IYDJ 2L02A 4B44A 3S3NA 4GYIA 1GV5A 4S04A 4ENKA 3M1CA 2WB1A 1L3LA 1R5ID 1T95A 2AQEA 4B09A 3MMYB 2VC1A 5JLXA 4IJAA 3BDDA 3C1DA 2XF5A 1WQ2A 5F6FA 1BOAA 1XMXA 5CVUA 1O7FA 5CJ9A 4U88A 3E6MA 3WODF 2F5FA 4J19A 2IS6A 1P2FA 1WH5A 2KIUA 3M3YJ 2FD5A 1X3UA 1XDUA 5B66C 3HOUJ 3JCUC 5GAEJ 4LMYA 2KIFA 5E8GA 1H9TA 4I2OA 3M1EA 1A04A 3TOBA 1K4TA 1A35A 1FP1D 3L2VA 4B1RA 3OYIA 2DYRH 1K79A 3K69A 2EZIA 3ML6A 4II2A 3ULQB 3V8LA 4PUSA 5TISC 2MD5A 5CLSA 1W36C 1N77A 4PJLA 1H8AC 2LP0A 1BJZA 1NH3A 4B8XA 2KMUA 2QWWA 3BZCA 3O6BB 4HEA2 1B9MA 3VPRA 2R92J 2KRHA 3L7WA 1EV7A 4FX0A 4HNUA 4RB1A 3DPLC 3L1PA 2A07F 3SFZA 4BGDA 3GUDA 3OOPA 1YO5C 2CQNA 3CCLI 1U2WA 2OQRA 1HSJA
chains in the Genus database with same CATH topology
4MTDA 2EV5A 5A2QK 3FM3A 2QBYB 2XVCA 2ETHA 2JT1A 1G3SA 3BJAA 2MC3A 2K4BA 3E5QA 1J9IA 3MQ0A 2Z9OA 2QBYA 3P9CA 2NNNA 1BIBA 1OYYA 1IW7F 3WGHA 4MTEA 3GO5A 2FQ3A 4HDUA 5K5QA 5ED4A 2L4MA 3H3UA 5BPDA 3MZYA 2XKOA 4L0ZB 4HX7A 4KIBA 2BE5F 2IA1A 3FMSA 4O5VA 3F21A 4AD9A 1LDKB 5D4SA 3D5LA 1OYWA 1IN6A 1U5TC 4U7DA 5CVJA 2DAOA 3V8JA 1TQPA 3PFIA 4R79A 2G7HA 4GGGA 1XSVA 1RUNA 4RGUA 1XN7A 4XLNF 2G9WA 3E5UA 5E8IA 2DT5A 1TQMA 1LNWA 1DPRA 5DD4A 2HKXA 2IP2A 5FLXZ 4KMUX 4G6QA 3S2WA 4IHTA 4L5JA 2NYXA 1J7KA 4ZYHA 2O6GE 4KN7X 2CG4A 2VE9A 1YG2A 3I64A 4HV6A 1C0WA 2BEOA 5D8KB 3PQJA 5TRDA 2FNAA 4MEXF 4LK1F 5LLQA 2NS0A 4WXCA 3EYYA 1ZGJA 1BI0A 1D3YA 3N4MA 3HTSB 2J5PA 1AWCA 2ZNYA 4WK8F 1HW2A 1BC7C 2XASA 5DEQA 1R5HA 4AIJA 1LDDA 5FB2A 2EV6A 3ZMTA 1R5GA 3I0TA 1OYIA 1QNTA 2JZYA 1U78A 5FLXK 4HF2A 1HKTA 1R1TA 1Z1DA 2EB7A 5D6FA 3J7AO 1IN4A 1XGSA 2XROA 2P5LC 1RI7A 4O3MA 3FXRA 3RI4A 2JTVA 2O0YA 2F5EA 4ASNA 4RAYA 4M6YA 4CHUA 5HOOA 2H6CA 4S05A 5D5UB 1S7OA 5F1RA 3KLOA 2HR3A 1S29A 5L3CA 4M9SA 4Q48A 3GZ6A 3FM5A 1KU2A 5ICGA 5LHGA 2KRFA 1ZH5A 4PZJA 4KA4A 3SZTA 3BJOA 1XMAA 4IRGA 3HUGA 1XSXA 1D5VA 1IN8A 1XMKA 3FF5A 2XV4S 3E97A 3VEPA 3J81Z 3HRSA 4IRHA 4G9YA 3WTXC 3I54A 1XGOA 4RGSA 4KMFA 2PJPA 5EEHA 3QRFF 3DP7A 1ZREA 1W7PB 2ESNA 4P96A 1I27A 5JFRA 2XRNA 1U6GA 2UXXA 5L3EA 2WC2A 1EH8A 2D1VA 4UV9A 4XRFA 2GAUA 2ELHA 3GYHX 5LHIA 3P7NA 4KFCA 1OKRA 2VT3A 1YW8A 3N97A 3E5XA 3TOAA 1W5SA 4IVNA 3FWEA 5L3GA 5H6QA 3KP5A 3MEXA 3TDUC 2VOOA 2YX7A 4MQ9F 3F6OA 2PLYA 3LWFA 1I1GA 3SXYA 2HTSA 3J81K 1S7AA 3FXUA 4EJTA 4KUMA 3MFKA 1KU9A 5L3DA 1VTNC 3KP3A 2ZJ2A 3KCCA 1TNSA 1TW3A 2VT2A 4L9TA 3CUQB 2RKHA 2CGPA 3KEQA 3IWZA 1LB2A 3WGGA 1J59A 2QUFA 1MDMA 2DTRA 3BZ6A 4KIFA 3CUQA 1S6LA 1BI2A 4LG0A 1TNTA 1O57A 2ZKZA 1KGSA 4Y17A 4PGGA 3HIFA 1P4WA 1RUOA 2VBWA 3V7CA 4HAMA 1WI9A 3NEUA 3MAJA 4FT8A 1ON2A 3RYPA 3B02A 3F23A 2LSOA 1BN5A 2EFOA 1USTA 4AWXB 4HA8A 3R61A 2OU2A 2XGXA 2HQRA 1CGPA 1T98A 3WTYC 4HYEA 4CXFA 1LJ9A 2HYGD 2X0LA 1SFXA 4CGZA 5DCMB 4M74A 4GO1A 5CYVA 2A69F 3L9FA 2F5CA 4WXHA 1P92A 2W57A 4EGZA 2WTEA 2NRAC 1NHAA 4LB5A 3FMQA 1FT9A 2O8XA 3BP8A 4U7BA 1ZLKA 2ESHA 3TO9A 3RPUA 2VBXA 4XSZF 3CO6C 2A61A 1V3FA 4DQ2A 3EETA 1SD5A 2FNPA 4L9NA 2ZCWA 1HQCA 4BNCA 4DNCA 1I5ZA 2L54A 4UNOA 4LLLA 1ON1A 2R7FA 2HFHA 3JSOA 5ILVA 4HLYA 4OIRF 4CO8A 2Y0MA 4KICA 2Z33A 1XCVA 1L0OC 5IT3A 2EFPA 5HLHA 5DUIA 4L0YB 4ESJA 1MD0A 4P9FA 5E18F 4WF2A 3I58A 5BS6A 3K2ZA 4OMZA 2Y75A 4LD5A 2DK5A 2HGCA 4EM2A 3H92A 3HOTA 2Z99A 1IXSB 4I02A 3LA2A 4ENMA 4LLNA 3CO7C 2PMUA 4MQVA 1MJAA 2QM3A 2WV0A 4P55A 1T6SA 4LB6B 5ICCA 4WXDA 2H27A 4G6DA 1P4AA 4AIKA 2K86A 2JRTA 1D8KA 1ZN2A 1LDJA 3RTRA 3FXQA 3ZQ7A 2P7VB 1K7AA 3V8KA 1I6XA 2L4AA 4E70A 3WGIA 4OU0A 5AIQA 3JW4A 3KLNA 3E6BA 4EGYA 2EJRA 4H0EA 2GZWA 3I4PA 2K4JA 5A2QZ 4BYYA 1BJAA 4CDGA 3RJPA 4HF0A 3M9AA 5DYMA 1IRFA 2P5VA 1R00A 5D5XB 4A5MA 3DF8A 3KZZA 3MZHA 2J5OA 1BBYA 1YS6A 1B59A 4A12A 1REPC 1U5TB 1UCRA 4IHSA 4OIQF 3I59B 1MJ9A 2VBYA 2MBFA 3JTGA 4EJUA 3CJNA 4ZZDA 4ZH4F 2XAQA 2CFXA 3H3ZA 4A2UA 2KJCA 3I59A 3T8TA 5ICEA 2EV0A 5D4RA 3ELKA 2GWRA 1FNNA 3TDZC 3F3XA 2HKOA 2GXBA 4A6DA 2K27A 1ULYA 4NHJA 5AIPA 1QZZA 2VOPA 3ISPA 1R22A 2V9VA 1XGNA 2W84A 2BV6A 2P8TA 5HDKA 1GVJA 2QVOA 3D0SA 5LGNA 3KEOA 2C6YA 2M8EA 5AONA 3L2CA 2A6HF 1R23A 4G8XA 2FXAA 6PAXA 3REOA 4ON0A 1YIOA 3KP4A 3W6JB 3K1NA 4G7OF 3ABUA 2V79A 4R8HA 3KZYA 4NQWA 2VE8A 4M9ZA 1WWXA 1Z7UA 4HBLA 3QU6A 2OA4A 3E6DA 1EH6A 5J6XA 2FRHA 2EA2A 2HZTA 3C18A 3GEZA 2GA1A 1FBUA 4G7ZF 2EFWA 4I01A 4BHPA 2FEZA 4HZFA 2QZ8A 3W6KB 1KQ9A 5LEJA 3CUOA 5LRSA 1BIAA 4ZYGA 2W85A 4CZZA 1KYZA 5CVRA 2PBIA 3EYIA 2XIGA 1HXDA 3LFKA 2NNYA 3GF2A 3SQNA 3M8EA 3GFMA 3GZ5A 2H6BA 2DW4A 1WSUA 1ZLJA 2Z5UA 2V1UA 4A0ZA 5H6RA 2DFIA 1S3JA 3QP6A 3ZMDA 5D6EA 1SFEA 3LQQA 1Z9CA 4U0WA 5DUKA 3P9KA 4Z2YA 3CLOA 2XKPA 3GVAA 3FZVA 1IRGA 2YU3A 2XAGA 4YIFA 1Z6RA 3Q9VA 2ACJA 4ZYDA 4JBAA 1K6OA 1G3YA 3GFIA 2E7WA 2HYFA 1LQ1A 4UV8A 5E1XA 4AVPA 1KU7A 4I0BA 4Y13A 4BQAA 1F1ZA 5H20A 2EA4A 3RKWA 3WTWC 4L9JA 3LA3A 3WTUC 1V4RA 4AIHA 3WG9A 2K02A 5ILSA 3FMRA 4N9HA 3LAPA 3V7RA 2LDUA 5JI6A 2E1CA 1ZHFA 3T8RA 3VOEA 5E20A 5TJJA 3CTAA 3QU3A 1E2XA 3TGNA 5FD6A 3RIRA 3ECOA 2CWEA 1ZRDA 1QBJA 4L5IA 4UHTA 2QQAA 4NB5A 1ZGAA 2B0LA 4A6EA 1J0RA 2HTJA 4UVBA 4K2EA 2RDPA 3GW2A 3F8MA 2LF8A 1IN5A 2E7XA 2VONA 1IXRC 3HHGA 2FBKA 1HKSA 2Y48A 4MHGA 4EJOA 3GXOA 3LAJA 5FO5A 3EDPA 3C3WA 5FFZA 2EFNA 1UHMA 2DQLA 4HDVA 2XAHA 2UZKA 5BOXA 4U0YA 1ZG1A 1P4XA 1W7PA 5FGMA 3IL2A 3ERED 3R0AA 3U2RA 1JHFA 4KNYA 4LLGF 2OQGA 1FYLA 3FX3A 5HLIA 2DI3A 4GCVA 3B73A 4XLPF 1T2KA 2V6CA 4ENJA 3IKVA 1LEBA 1HBXG 2ADUA 3QPHA 1ZARA 2A3SA 2KKOA 2COMA 3RKYA 2ISYA 1UHWA 4XSXF 3BPVA 1FSHA 3HOSA 5EEGA 4U0VA 1KYWA 3QAHA 2DPUA 2XAJA 4BHBA 1TTYA 1QZYA 5HS9A 1FLIA 2AS5F 1Z6TA 3T5XA 3ZPLA 5HS8A 1FYMA 1W7PD 2EWNA 1QGPA 2PFBA 3MWMA 5HDNA 1J2XA 1ZRFA 3AAFA 2O03A 2PG4A 2MLKA 3BY6A 4EVIA 3VB2A 5HDGA 1YW9A 3M8FA 1XSDA 2FBHA 2L01A 3LQRA 2A68F 2OD5A 3I5UA 3ZN1A 4CYDA 4ZZLA 1FWZA 5J8CA 3PQKA 1W4MA 2IJLA 2DK8A 2CYYA 3KFWX 3BWGA 3ABTA 3JTHA 2IW5A 1O3QA 1QO0D 4RB2C 2K7LA 2PN6A 2EK5A 3ZP5A 2PQ8A 4RS8A 1B1BA 5ILUA 4PCQA 4A0XA 1T0FA 1BC8C 2P6SA 1XDSA 1S8NA 5DCMA 1J75A 5D8LB 4GYGA 2CW0F 2DU9A 2DLLA 4KIGA 4CICA 2AXLA 4Y15A 3CUQC 1OR7A 3ZMZA 3IWFA 4OOIA 4WWCA 2V1XA 1O3SA 2HDCA 1ONVA 4HX8A 1STZA 3R6SA 5KK1A 4M71A 2P5KA 1B6AA 2DBBA 1IXCA 4IF4A 2RGVA 1JGSA 2ZMEB 1YLFA 4RGRA 3IHUA 4TV7A 4M9XA 1O3RA 4Q4ZF 2UWMA 4PGHA 2FBIA 3VODA 2OBPA 2TDXA 2VODA 4G94A 2DO7A 5LRRA 4HW0A 1USSA 3KP6A 2A6EF 5DCFA 4A5NA 4MNUA 4EJWA 3K1MA 3IC7A 3BJ6A 3BOQA 4WCGA 1DUXC 1GXQA 4HLXA 2IRFG 1FOKA 5FD5A 1JHHA 4UVCA 1PP7U 1G4DA 2JSCA 3LSTA 4UXNA 4LFUA 2D1HA 3BPXA 2VBZA 4FX4A 2LNBA 2QQ9A 3T0YA 3R60A 1Q1HA 3L09A 1K78B 2YSRA 3F72A 4OINF 2A5YB 1KA8A 2RC4A 5D5WB 1K78A 2XUBA 2H09A 3KE2A 4N0BA 3V7SA 2GQQA 4YFKF 4UVAA 4YFXF 2YR2A 1ZAOA 4IRIA 3T1BA 4EM1A 2DQRA 3IRRA 4HOBA 2MA3A 5DV5A 2FSWA 3TQNA 2QYOA 4BH9A 3JSPA 3J80Z 4XBFA 3F6VA 1Z91A 4N9IA 1U5TA 3V4GA 1TW2A 3JAMZ 1EH7A 1BI1A 2KIMA 2XHKA 3WTSC 2HOEA 3TO7A 4JK1X 5FFXA 4WX9A 3CDHA 1G3TA 2PMHA 5JVTA 3GX4X 3HTUA 1KQ0A 5LGUA 3DFGA 3RPQA 1ODDA 1SFUA 5BQTA 2HQNA 1FYKA 4HQEA 1FP2A 3E6CC 4HF1A 2O61A 4I0AA 2NAZA 3ZMVA 3QOPA 4RB0A 1R36A 1H0MA 1RZ4A 4D0PA 5E17F 4JQFA 2ZFWA 5F64A 1W5TA 3GFJA 3J80K 2FF4A 1J5YA 2RN7A 2FMLA 5BMZA 2DPDA 1CF7B 2X4HA 3U9GA 3JAMK 1HSTA 2FOKA 1IN7A 3SZPA 2BBYA 1SMTA 4EQQA 2M45A 1CF7A 2M1BA 2PEXA 2M30A 1XGMA 2Q2EA 2BGCA 1FZPB 2R3SA 4G7HF 1T39A 4UUVA 2P7CB 5DD8A 2W25A 2ZNZA 3ZN0A 3VFZA 5LHHA 3WU0A 2LKPA 4KYWA 1SD7A 2HS5A 3QPTA 3C7JA 1UFMA 3NQOA 5BPIA 4F7ZA 2D45A 4M6XA 3R0JA 3WTZA 3BROA 5KVRA 3WE2A 4KT5C 1WKMA 2G7UA 1MJBA 1SD4A 3HRMA 2VXZA 2Q8KA 1FPQA 4QLCU 1WRJA 2KJBA 2YPRA 1R7JA 1IZ1A 3HRUA 4P9UA 3HSRA 5K5OA 4LK0F 1G3WA 3QP5A 1PP8F 2R7DA 2RV8A 5JHUA 4M73A 1GXPA 3ECHA 1OPCA 3DQVC 1DPUA 3HRTA 3L00A 2IVMA 3DEUA 1PDNC 2BYVE 1TQIA 1LEAA 3ZMSA 1HW1A 1KU3A 3E3VA 2ZXJA 4MEYF 3GWZA 1KQ8A 2F5DA 1TLHB 2CSOA 1FBSA 2MLGA 3FHZA 5HLGA 1YS7A 3DXJF 4LJZF 1QQIA 3F8BA 1DDNA 4PDKA 2IT0A 4YIIA 2MH9A 3RKXA 5LEKA 4I98B 3IKTA 2P4WA 2VN2A 3HYIA 4EM0B 5LBQA 4FHTA 4BHCA 2ZBKA 3WTTC 5HS7A 4OMYA 1O3TA 1YQAA 3WE3A 2JPBA 1YYVA 3ZMUA 3WTVC 4HV5A 2XAFA 3F8NA 2O3FA 4P5OA 2HEOA 1RNLA 1SD6A 2STWA 2GIVA 3HSEA 4OIPF 4BAYA 3K0LA 1H9GA 4OIOF 3K1PA 1D8JA 1YTYA 5J8FA 1G6NA 3I71A 2IPQX 4EV0A 1B9NA 2H94A 2VC0A 1GHCA 2WWYA 3RYRA 1IUYA 2RQPA 3M7GA 1P6RA 1O7LA 4IPAA 2FA5A 1Y0UA 2FMYA 3GLXA 1MDMB 3DKWA 2QENA 3EQLF 4LG0B 2RNJA 1U3EM 2V1DA 2P6TA 1DP7P 5IT9Z 2CO5A 3GFLA 4I09A 3R4KA 3G3ZA 2OZUA 4BXUA 3TKYA 1JXSA 4RGXA 1R1VA 2OAZA 1FSEA 2M5WA 5ICFA 2EFQA 1FX7A 2UXNA 2GXGA 3K9TA 2LF7A 2ZO4A 1HW5A 2QQBA 3Q9SA 1R1UA 4KN4X 2FE3A 3EUHA 3OV8A 1FBQA 3RDIA 5DDGA 1Z05A 2F2EA 4MGRA 3NRVA 3DV8A 4EJVA 1PUEE 3KETA 1U8RA 1XB4A 4RAZA 5IT9K 2ISZA 1IAWA 2STTA 4RB3C 1F9NA 5CVIA 2E1NA 4R1HA 1TBXA 2L3DA 4KDPA 1ZG3A 4IXAA 5LGTA 2HWVA 4LGWA 3KP7A 3U1DA 3WU1B 1SMYF 5D5VB 4YFNF 1LVAA 1QPMA 1B4AA 2RVCA 3HHHA 1IF1A 3LA7A 2CQKA 4Q47A 5K1YA 1HKQA 3TO6A 3P9IA 4M72A 4Q5SF 4ENNA 1F4KA 5E1ZB 4ZYEA 1ZG5A 4L18B 1UB9A 1OMIA 1I1SA 2ZMEA 5ERIA 3MCZA 2PI0A 1FC3A 1XD7A 1MZBA 1YW7A 1BI3A 2M87A 3O3KA 4ESBA 2GA2A 4O6JA 2FU4A 1MKMA 1JE8A 1E17A 4HQMA 5CVVA 1AOYA 3I53A 5E1WA 2IA0A 4L9VA 2W24A 1MGTA 1FY7A 2Q0OA 4HX4A 4ETSA 3IRQA 1R58A 3F8FA 3G73A 5L3FA 1SAXA 1ZRCA 3SHFA 3HSFA 3F8CA 4I7HA 2QLZA 2OZ6A 1F5TA 1YFHA 3KP2A 5K5RA 2IA2A 1T38A 3ROUA 4QWQA 1RIOH 4YG2F 2YX4A 3F22A 5HVQC 3COAC 4A0YA 1XCBA 2Z3YA 3O2PE 4ESFA 3DPTA 5L3BA 2JPCA 2MH2A 3Q5FA 1BM9A 2D2WA 5JR3A 4EMSA 1ZYRF 4GXOA 2L02A 4GYIA 4S04A 4ENKA 1L3LA 4B09A 2VC1A 4IJAA 3BDDA 3C1DA 1WQ2A 5F6FA 1BOAA 5CVUA 1O7FA 5CJ9A 4U88A 3E6MA 3WODF 2F5FA 1P2FA 2KIUA 1X3UA 1XDUA 4LMYA 2KIFA 5E8GA 1H9TA 4I2OA 3M1EA 1A04A 3TOBA 1FP1D 1K79A 3K69A 3ML6A 3ULQB 3V8LA 2MD5A 5CLSA 4B8XA 2QWWA 3O6BB 1B9MA 3L7WA 1EV7A 4FX0A 4RB1A 3DPLC 2A07F 3SFZA 3GUDA 3OOPA 1YO5C 1U2WA 2OQRA 1HSJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MTD A;  2EV5 A;  5A2Q K;  3FM3 A;  2QBY B;  2XVC A;  2ETH A;  2JT1 A;  1G3S A;  3BJA A;  2MC3 A;  2K4B A;  3E5Q A;  1J9I A;  3MQ0 A;  2Z9O A;  2QBY A;  3P9C A;  2NNN A;  1BIB A;  1OYY A;  1IW7 F;  3WGH A;  4MTE A;  3GO5 A;  2FQ3 A;  4HDU A;  5K5Q A;  5ED4 A;  2L4M A;  3H3U A;  5BPD A;  3MZY A;  2XKO A;  4L0Z B;  4HX7 A;  4KIB A;  2BE5 F;  2IA1 A;  3FMS A;  4O5V A;  3F21 A;  4AD9 A;  1LDK B;  5D4S A;  3D5L A;  1OYW A;  1IN6 A;  1U5T C;  4U7D A;  5CVJ A;  2DAO A;  3V8J A;  1TQP A;  3PFI A;  4R79 A;  2G7H A;  4GGG A;  1XSV A;  1RUN A;  4RGU A;  1XN7 A;  4XLN F;  2G9W A;  3E5U A;  5E8I A;  2DT5 A;  1TQM A;  1LNW A;  1DPR A;  5DD4 A;  2HKX A;  2IP2 A;  5FLX Z;  4KMU X;  4G6Q A;  3S2W A;  4IHT A;  4L5J A;  2NYX A;  1J7K A;  4ZYH A;  2O6G E;  4KN7 X;  2CG4 A;  2VE9 A;  1YG2 A;  3I64 A;  4HV6 A;  1C0W A;  2BEO A;  5D8K B;  3PQJ A;  5TRD A;  2FNA A;  4MEX F;  4LK1 F;  5LLQ A;  2NS0 A;  4WXC A;  3EYY A;  1ZGJ A;  1BI0 A;  1D3Y A;  3N4M A;  3HTS B;  2J5P A;  1AWC A;  2ZNY A;  4WK8 F;  1HW2 A;  1BC7 C;  2XAS A;  5DEQ A;  1R5H A;  4AIJ A;  1LDD A;  5FB2 A;  2EV6 A;  3ZMT A;  1R5G A;  3I0T A;  1OYI A;  1QNT A;  2JZY A;  1U78 A;  5FLX K;  4HF2 A;  1HKT A;  1R1T A;  1Z1D A;  2EB7 A;  5D6F A;  3J7A O;  1IN4 A;  1XGS A;  2XRO A;  2P5L C;  1RI7 A;  4O3M A;  3FXR A;  3RI4 A;  2JTV A;  2O0Y A;  2F5E A;  4ASN A;  4RAY A;  4M6Y A;  4CHU A;  5HOO A;  2H6C A;  4S05 A;  5D5U B;  1S7O A;  5F1R A;  3KLO A;  2HR3 A;  1S29 A;  5L3C A;  4M9S A;  4Q48 A;  3GZ6 A;  3FM5 A;  1KU2 A;  5ICG A;  5LHG A;  2KRF A;  1ZH5 A;  4PZJ A;  4KA4 A;  3SZT A;  3BJO A;  1XMA A;  4IRG A;  3HUG A;  1XSX A;  1D5V A;  1IN8 A;  1XMK A;  3FF5 A;  2XV4 S;  3E97 A;  3VEP A;  3J81 Z;  3HRS A;  4IRH A;  4G9Y A;  3WTX C;  3I54 A;  1XGO A;  4RGS A;  4KMF A;  2PJP A;  5EEH A;  3QRF F;  3DP7 A;  1ZRE A;  1W7P B;  2ESN A;  4P96 A;  1I27 A;  5JFR A;  2XRN A;  1U6G A;  2UXX A;  5L3E A;  2WC2 A;  1EH8 A;  2D1V A;  4UV9 A;  4XRF A;  2GAU A;  2ELH A;  3GYH X;  5LHI A;  3P7N A;  4KFC A;  1OKR A;  2VT3 A;  1YW8 A;  3N97 A;  3E5X A;  3TOA A;  1W5S A;  4IVN A;  3FWE A;  5L3G A;  5H6Q A;  3KP5 A;  3MEX A;  3TDU C;  2VOO A;  2YX7 A;  4MQ9 F;  3F6O A;  2PLY A;  3LWF A;  1I1G A;  3SXY A;  2HTS A;  3J81 K;  1S7A A;  3FXU A;  4EJT A;  4KUM A;  3MFK A;  1KU9 A;  5L3D A;  1VTN C;  3KP3 A;  2ZJ2 A;  3KCC A;  1TNS A;  1TW3 A;  2VT2 A;  4L9T A;  3CUQ B;  2RKH A;  2CGP A;  3KEQ A;  3IWZ A;  1LB2 A;  3WGG A;  1J59 A;  2QUF A;  1MDM A;  2DTR A;  3BZ6 A;  4KIF A;  3CUQ A;  1S6L A;  1BI2 A;  4LG0 A;  1TNT A;  1O57 A;  2ZKZ A;  1KGS A;  4Y17 A;  4PGG A;  3HIF A;  1P4W A;  1RUO A;  2VBW A;  3V7C A;  4HAM A;  1WI9 A;  3NEU A;  3MAJ A;  4FT8 A;  1ON2 A;  3RYP A;  3B02 A;  3F23 A;  2LSO A;  1BN5 A;  2EFO A;  1UST A;  4AWX B;  4HA8 A;  3R61 A;  2OU2 A;  2XGX A;  2HQR A;  1CGP A;  1T98 A;  3WTY C;  4HYE A;  4CXF A;  1LJ9 A;  2HYG D;  2X0L A;  1SFX A;  4CGZ A;  5DCM B;  4M74 A;  4GO1 A;  5CYV A;  2A69 F;  3L9F A;  2F5C A;  4WXH A;  1P92 A;  2W57 A;  4EGZ A;  2WTE A;  2NRA C;  1NHA A;  4LB5 A;  3FMQ A;  1FT9 A;  2O8X A;  3BP8 A;  4U7B A;  1ZLK A;  2ESH A;  3TO9 A;  3RPU A;  2VBX A;  4XSZ F;  3CO6 C;  2A61 A;  1V3F A;  4DQ2 A;  3EET A;  1SD5 A;  2FNP A;  4L9N A;  2ZCW A;  1HQC A;  4BNC A;  4DNC A;  1I5Z A;  2L54 A;  4UNO A;  4LLL A;  1ON1 A;  2R7F A;  2HFH A;  3JSO A;  5ILV A;  4HLY A;  4OIR F;  4CO8 A;  2Y0M A;  4KIC A;  2Z33 A;  1XCV A;  1L0O C;  5IT3 A;  2EFP A;  5HLH A;  5DUI A;  4L0Y B;  4ESJ A;  1MD0 A;  4P9F A;  5E18 F;  4WF2 A;  3I58 A;  5BS6 A;  3K2Z A;  4OMZ A;  2Y75 A;  4LD5 A;  2DK5 A;  2HGC A;  4EM2 A;  3H92 A;  3HOT A;  2Z99 A;  1IXS B;  4I02 A;  3LA2 A;  4ENM A;  4LLN A;  3CO7 C;  2PMU A;  4MQV A;  1MJA A;  2QM3 A;  2WV0 A;  4P55 A;  1T6S A;  4LB6 B;  5ICC A;  4WXD A;  2H27 A;  4G6D A;  1P4A A;  4AIK A;  2K86 A;  2JRT A;  1D8K A;  1ZN2 A;  1LDJ A;  3RTR A;  3FXQ A;  3ZQ7 A;  2P7V B;  1K7A A;  3V8K A;  1I6X A;  2L4A A;  4E70 A;  3WGI A;  4OU0 A;  5AIQ A;  3JW4 A;  3KLN A;  3E6B A;  4EGY A;  2EJR A;  4H0E A;  2GZW A;  3I4P A;  2K4J A;  5A2Q Z;  4BYY A;  1BJA A;  4CDG A;  3RJP A;  4HF0 A;  3M9A A;  5DYM A;  1IRF A;  2P5V A;  1R00 A;  5D5X B;  4A5M A;  3DF8 A;  3KZZ A;  3MZH A;  2J5O A;  1BBY A;  1YS6 A;  1B59 A;  4A12 A;  1REP C;  1U5T B;  1UCR A;  4IHS A;  4OIQ F;  3I59 B;  1MJ9 A;  2VBY A;  2MBF A;  3JTG A;  4EJU A;  3CJN A;  4ZZD A;  4ZH4 F;  2XAQ A;  2CFX A;  3H3Z A;  4A2U A;  2KJC A;  3I59 A;  3T8T A;  5ICE A;  2EV0 A;  5D4R A;  3ELK A;  2GWR A;  1FNN A;  3TDZ C;  3F3X A;  2HKO A;  2GXB A;  4A6D A;  2K27 A;  1ULY A;  4NHJ A;  5AIP A;  1QZZ A;  2VOP A;  3ISP A;  1R22 A;  2V9V A;  1XGN A;  2W84 A;  2BV6 A;  2P8T A;  5HDK A;  1GVJ A;  2QVO A;  3D0S A;  5LGN A;  3KEO A;  2C6Y A;  2M8E A;  5AON A;  3L2C A;  2A6H F;  1R23 A;  4G8X A;  2FXA A;  6PAX A;  3REO A;  4ON0 A;  1YIO A;  3KP4 A;  3W6J B;  3K1N A;  4G7O F;  3ABU A;  2V79 A;  4R8H A;  3KZY A;  4NQW A;  2VE8 A;  4M9Z A;  1WWX A;  1Z7U A;  4HBL A;  3QU6 A;  2OA4 A;  3E6D A;  1EH6 A;  5J6X A;  2FRH A;  2EA2 A;  2HZT A;  3C18 A;  3GEZ A;  2GA1 A;  1FBU A;  4G7Z F;  2EFW A;  4I01 A;  4BHP A;  2FEZ A;  4HZF A;  2QZ8 A;  3W6K B;  1KQ9 A;  5LEJ A;  3CUO A;  5LRS A;  1BIA A;  4ZYG A;  2W85 A;  4CZZ A;  1KYZ A;  5CVR A;  2PBI A;  3EYI A;  2XIG A;  1HXD A;  3LFK A;  2NNY A;  3GF2 A;  3SQN A;  3M8E A;  3GFM A;  3GZ5 A;  2H6B A;  2DW4 A;  1WSU A;  1ZLJ A;  2Z5U A;  2V1U A;  4A0Z A;  5H6R A;  2DFI A;  1S3J A;  3QP6 A;  3ZMD A;  5D6E A;  1SFE A;  3LQQ A;  1Z9C A;  4U0W A;  5DUK A;  3P9K A;  4Z2Y A;  3CLO A;  2XKP A;  3GVA A;  3FZV A;  1IRG A;  2YU3 A;  2XAG A;  4YIF A;  1Z6R A;  3Q9V A;  2ACJ A;  4ZYD A;  4JBA A;  1K6O A;  1G3Y A;  3GFI A;  2E7W A;  2HYF A;  1LQ1 A;  4UV8 A;  5E1X A;  4AVP A;  1KU7 A;  4I0B A;  4Y13 A;  4BQA A;  1F1Z A;  5H20 A;  2EA4 A;  3RKW A;  3WTW C;  4L9J A;  3LA3 A;  3WTU C;  1V4R A;  4AIH A;  3WG9 A;  2K02 A;  5ILS A;  3FMR A;  4N9H A;  3LAP A;  3V7R A;  2LDU A;  5JI6 A;  2E1C A;  1ZHF A;  3T8R A;  3VOE A;  5E20 A;  5TJJ A;  3CTA A;  3QU3 A;  1E2X A;  3TGN A;  5FD6 A;  3RIR A;  3ECO A;  2CWE A;  1ZRD A;  1QBJ A;  4L5I A;  4UHT A;  2QQA A;  4NB5 A;  1ZGA A;  2B0L A;  4A6E A;  1J0R A;  2HTJ A;  4UVB A;  4K2E A;  2RDP A;  3GW2 A;  3F8M A;  2LF8 A;  1IN5 A;  2E7X A;  2VON A;  1IXR C;  3HHG A;  2FBK A;  1HKS A;  2Y48 A;  4MHG A;  4EJO A;  3GXO A;  3LAJ A;  5FO5 A;  3EDP A;  3C3W A;  5FFZ A;  2EFN A;  1UHM A;  2DQL A;  4HDV A;  2XAH A;  2UZK A;  5BOX A;  4U0Y A;  1ZG1 A;  1P4X A;  1W7P A;  5FGM A;  3IL2 A;  3ERE D;  3R0A A;  3U2R A;  1JHF A;  4KNY A;  4LLG F;  2OQG A;  1FYL A;  3FX3 A;  5HLI A;  2DI3 A;  4GCV A;  3B73 A;  4XLP F;  1T2K A;  2V6C A;  4ENJ A;  3IKV A;  1LEB A;  1HBX G;  2ADU A;  3QPH A;  1ZAR A;  2A3S A;  2KKO A;  2COM A;  3RKY A;  2ISY A;  1UHW A;  4XSX F;  3BPV A;  1FSH A;  3HOS A;  5EEG A;  4U0V A;  1KYW A;  3QAH A;  2DPU A;  2XAJ A;  4BHB A;  1TTY A;  1QZY A;  5HS9 A;  1FLI A;  2AS5 F;  1Z6T A;  3T5X A;  3ZPL A;  5HS8 A;  1FYM A;  1W7P D;  2EWN A;  1QGP A;  2PFB A;  3MWM A;  5HDN A;  1J2X A;  1ZRF A;  3AAF A;  2O03 A;  2PG4 A;  2MLK A;  3BY6 A;  4EVI A;  3VB2 A;  5HDG A;  1YW9 A;  3M8F A;  1XSD A;  2FBH A;  2L01 A;  3LQR A;  2A68 F;  2OD5 A;  3I5U A;  3ZN1 A;  4CYD A;  4ZZL A;  1FWZ A;  5J8C A;  3PQK A;  1W4M A;  2IJL A;  2DK8 A;  2CYY A;  3KFW X;  3BWG A;  3ABT A;  3JTH A;  2IW5 A;  1O3Q A;  1QO0 D;  4RB2 C;  2K7L A;  2PN6 A;  2EK5 A;  3ZP5 A;  2PQ8 A;  4RS8 A;  1B1B A;  5ILU A;  4PCQ A;  4A0X A;  1T0F A;  1BC8 C;  2P6S A;  1XDS A;  1S8N A;  5DCM A;  1J75 A;  5D8L B;  4GYG A;  2CW0 F;  2DU9 A;  2DLL A;  4KIG A;  4CIC A;  2AXL A;  4Y15 A;  3CUQ C;  1OR7 A;  3ZMZ A;  3IWF A;  4OOI A;  4WWC A;  2V1X A;  1O3S A;  2HDC A;  1ONV A;  4HX8 A;  1STZ A;  3R6S A;  5KK1 A;  4M71 A;  2P5K A;  1B6A A;  2DBB A;  1IXC A;  4IF4 A;  2RGV A;  1JGS A;  2ZME B;  1YLF A;  4RGR A;  3IHU A;  4TV7 A;  4M9X A;  1O3R A;  4Q4Z F;  2UWM A;  4PGH A;  2FBI A;  3VOD A;  2OBP A;  2TDX A;  2VOD A;  4G94 A;  2DO7 A;  5LRR A;  4HW0 A;  1USS A;  3KP6 A;  2A6E F;  5DCF A;  4A5N A;  4MNU A;  4EJW A;  3K1M A;  3IC7 A;  3BJ6 A;  3BOQ A;  4WCG A;  1DUX C;  1GXQ A;  4HLX A;  2IRF G;  1FOK A;  5FD5 A;  1JHH A;  4UVC A;  1PP7 U;  1G4D A;  2JSC A;  3LST A;  4UXN A;  4LFU A;  2D1H A;  3BPX A;  2VBZ A;  4FX4 A;  2LNB A;  2QQ9 A;  3T0Y A;  3R60 A;  1Q1H A;  3L09 A;  1K78 B;  2YSR A;  3F72 A;  4OIN F;  2A5Y B;  1KA8 A;  2RC4 A;  5D5W B;  1K78 A;  2XUB A;  2H09 A;  3KE2 A;  4N0B A;  3V7S A;  2GQQ A;  4YFK F;  4UVA A;  4YFX F;  2YR2 A;  1ZAO A;  4IRI A;  3T1B A;  4EM1 A;  2DQR A;  3IRR A;  4HOB A;  2MA3 A;  5DV5 A;  2FSW A;  3TQN A;  2QYO A;  4BH9 A;  3JSP A;  3J80 Z;  4XBF A;  3F6V A;  1Z91 A;  4N9I A;  1U5T A;  3V4G A;  1TW2 A;  3JAM Z;  1EH7 A;  1BI1 A;  2KIM A;  2XHK A;  3WTS C;  2HOE A;  3TO7 A;  4JK1 X;  5FFX A;  4WX9 A;  3CDH A;  1G3T A;  2PMH A;  5JVT A;  3GX4 X;  3HTU A;  1KQ0 A;  5LGU A;  3DFG A;  3RPQ A;  1ODD A;  1SFU A;  5BQT A;  2HQN A;  1FYK A;  4HQE A;  1FP2 A;  3E6C C;  4HF1 A;  2O61 A;  4I0A A;  2NAZ A;  3ZMV A;  3QOP A;  4RB0 A;  1R36 A;  1H0M A;  1RZ4 A;  4D0P A;  5E17 F;  4JQF A;  2ZFW A;  5F64 A;  1W5T A;  3GFJ A;  3J80 K;  2FF4 A;  1J5Y A;  2RN7 A;  2FML A;  5BMZ A;  2DPD A;  1CF7 B;  2X4H A;  3U9G A;  3JAM K;  1HST A;  2FOK A;  1IN7 A;  3SZP A;  2BBY A;  1SMT A;  4EQQ A;  2M45 A;  1CF7 A;  2M1B A;  2PEX A;  2M30 A;  1XGM A;  2Q2E A;  2BGC A;  1FZP B;  2R3S A;  4G7H F;  1T39 A;  4UUV A;  2P7C B;  5DD8 A;  2W25 A;  2ZNZ A;  3ZN0 A;  3VFZ A;  5LHH A;  3WU0 A;  2LKP A;  4KYW A;  1SD7 A;  2HS5 A;  3QPT A;  3C7J A;  1UFM A;  3NQO A;  5BPI A;  4F7Z A;  2D45 A;  4M6X A;  3R0J A;  3WTZ A;  3BRO A;  5KVR A;  3WE2 A;  4KT5 C;  1WKM A;  2G7U A;  1MJB A;  1SD4 A;  3HRM A;  2VXZ A;  2Q8K A;  1FPQ A;  4QLC U;  1WRJ A;  2KJB A;  2YPR A;  1R7J A;  1IZ1 A;  3HRU A;  4P9U A;  3HSR A;  5K5O A;  4LK0 F;  1G3W A;  3QP5 A;  1PP8 F;  2R7D A;  2RV8 A;  5JHU A;  4M73 A;  1GXP A;  3ECH A;  1OPC A;  3DQV C;  1DPU A;  3HRT A;  3L00 A;  2IVM A;  3DEU A;  1PDN C;  2BYV E;  1TQI A;  1LEA A;  3ZMS A;  1HW1 A;  1KU3 A;  3E3V A;  2ZXJ A;  4MEY F;  3GWZ A;  1KQ8 A;  2F5D A;  1TLH B;  2CSO A;  1FBS A;  2MLG A;  3FHZ A;  5HLG A;  1YS7 A;  3DXJ F;  4LJZ F;  1QQI A;  3F8B A;  1DDN A;  4PDK A;  2IT0 A;  4YII A;  2MH9 A;  3RKX A;  5LEK A;  4I98 B;  3IKT A;  2P4W A;  2VN2 A;  3HYI A;  4EM0 B;  5LBQ A;  4FHT A;  4BHC A;  2ZBK A;  3WTT C;  5HS7 A;  4OMY A;  1O3T A;  1YQA A;  3WE3 A;  2JPB A;  1YYV A;  3ZMU A;  3WTV C;  4HV5 A;  2XAF A;  3F8N A;  2O3F A;  4P5O A;  2HEO A;  1RNL A;  1SD6 A;  2STW A;  2GIV A;  3HSE A;  4OIP F;  4BAY A;  3K0L A;  1H9G A;  4OIO F;  3K1P A;  1D8J A;  1YTY A;  5J8F A;  1G6N A;  3I71 A;  2IPQ X;  4EV0 A;  1B9N A;  2H94 A;  2VC0 A;  1GHC A;  2WWY A;  3RYR A;  1IUY A;  2RQP A;  3M7G A;  1P6R A;  1O7L A;  4IPA A;  2FA5 A;  1Y0U A;  2FMY A;  3GLX A;  1MDM B;  3DKW A;  2QEN A;  3EQL F;  4LG0 B;  2RNJ A;  1U3E M;  2V1D A;  2P6T A;  1DP7 P;  5IT9 Z;  2CO5 A;  3GFL A;  4I09 A;  3R4K A;  3G3Z A;  2OZU A;  4BXU A;  3TKY A;  1JXS A;  4RGX A;  1R1V A;  2OAZ A;  1FSE A;  2M5W A;  5ICF A;  2EFQ A;  1FX7 A;  2UXN A;  2GXG A;  3K9T A;  2LF7 A;  2ZO4 A;  1HW5 A;  2QQB A;  3Q9S A;  1R1U A;  4KN4 X;  2FE3 A;  3EUH A;  3OV8 A;  1FBQ A;  3RDI A;  5DDG A;  1Z05 A;  2F2E A;  4MGR A;  3NRV A;  3DV8 A;  4EJV A;  1PUE E;  3KET A;  1U8R A;  1XB4 A;  4RAZ A;  5IT9 K;  2ISZ A;  1IAW A;  2STT A;  4RB3 C;  1F9N A;  5CVI A;  2E1N A;  4R1H A;  1TBX A;  2L3D A;  4KDP A;  1ZG3 A;  4IXA A;  5LGT A;  2HWV A;  4LGW A;  3KP7 A;  3U1D A;  3WU1 B;  1SMY F;  5D5V B;  4YFN F;  1LVA A;  1QPM A;  1B4A A;  2RVC A;  3HHH A;  1IF1 A;  3LA7 A;  2CQK A;  4Q47 A;  5K1Y A;  1HKQ A;  3TO6 A;  3P9I A;  4M72 A;  4Q5S F;  4ENN A;  1F4K A;  5E1Z B;  4ZYE A;  1ZG5 A;  4L18 B;  1UB9 A;  1OMI A;  1I1S A;  2ZME A;  5ERI A;  3MCZ A;  2PI0 A;  1FC3 A;  1XD7 A;  1MZB A;  1YW7 A;  1BI3 A;  2M87 A;  3O3K A;  4ESB A;  2GA2 A;  4O6J A;  2FU4 A;  1MKM A;  1JE8 A;  1E17 A;  4HQM A;  5CVV A;  1AOY A;  3I53 A;  5E1W A;  2IA0 A;  4L9V A;  2W24 A;  1MGT A;  1FY7 A;  2Q0O A;  4HX4 A;  4ETS A;  3IRQ A;  1R58 A;  3F8F A;  3G73 A;  5L3F A;  1SAX A;  1ZRC A;  3SHF A;  3HSF A;  3F8C A;  4I7H A;  2QLZ A;  2OZ6 A;  1F5T A;  1YFH A;  3KP2 A;  5K5R A;  2IA2 A;  1T38 A;  3ROU A;  4QWQ A;  1RIO H;  4YG2 F;  2YX4 A;  3F22 A;  5HVQ C;  3COA C;  4A0Y A;  1XCB A;  2Z3Y A;  3O2P E;  4ESF A;  3DPT A;  5L3B A;  2JPC A;  2MH2 A;  3Q5F A;  1BM9 A;  2D2W A;  5JR3 A;  4EMS A;  1ZYR F;  4GXO A;  2L02 A;  4GYI A;  4S04 A;  4ENK A;  1L3L A;  4B09 A;  2VC1 A;  4IJA A;  3BDD A;  3C1D A;  1WQ2 A;  5F6F A;  1BOA A;  5CVU A;  1O7F A;  5CJ9 A;  4U88 A;  3E6M A;  3WOD F;  2F5F A;  1P2F A;  2KIU A;  1X3U A;  1XDU A;  4LMY A;  2KIF A;  5E8G A;  1H9T A;  4I2O A;  3M1E A;  1A04 A;  3TOB A;  1FP1 D;  1K79 A;  3K69 A;  3ML6 A;  3ULQ B;  3V8L A;  2MD5 A;  5CLS A;  4B8X A;  2QWW A;  3O6B B;  1B9M A;  3L7W A;  1EV7 A;  4FX0 A;  4RB1 A;  3DPL C;  2A07 F;  3SFZ A;  3GUD A;  3OOP A;  1YO5 C;  1U2W A;  2OQR A;  1HSJ A; 
#chains in the Genus database with same CATH topology
 3IP4 B;  4MTD A;  1ETV A;  1X1C A;  2EV5 A;  2L9N A;  1Q1V A;  3S14 J;  1DP3 A;  5A2Q K;  1WGX A;  1WHU A;  3DEW A;  3FM3 A;  2QBY B;  2XVC A;  2ETH A;  4BUP A;  1ETY A;  1JJ6 C;  4DIQ A;  2JT1 A;  1G3S A;  4CA0 A;  3MD2 A;  3BJA A;  2MC3 A;  2K4B A;  3DU6 A;  3CMA I;  3ZOB A;  2CFO A;  3E5Q A;  1D0Z A;  4MO7 A;  1J9I A;  1BR4 A;  3MQ0 A;  2QBY A;  2Z9O A;  3P9C A;  1FOY A;  3QYF A;  3OYH A;  2NNN A;  1BIB A;  4IZZ A;  1OYY A;  1IW7 F;  4XRS G;  3WGH A;  4MTE A;  3GO5 A;  2YS9 A;  2FQ3 A;  3Q0U A;  1MND A;  2ZJR F;  2F6C A;  3HB9 A;  4HDU A;  5K5Q A;  5JHF A;  1ETQ A;  5ED4 A;  1R71 A;  2ZFU A;  2L4M A;  5LD2 C;  2X9D A;  4C3J J;  3H3U A;  5BPD A;  3MZY A;  2XKO A;  1W1W E;  4L0Z B;  4HX7 A;  3TED A;  5TGT A;  2LOO A;  4KIB A;  2BE5 F;  2IA1 A;  3H5N A;  3DCF A;  1IC8 A;  1RRJ A;  3W3C A;  4AUX A;  2VQL A;  3QOD A;  5F0C A;  3FMS A;  4O5V A;  5J1U A;  4QTR A;  3F21 A;  4AD9 A;  1IG7 A;  5EGO A;  1LDK B;  2DOA A;  2VKE A;  3D5L A;  5D4S A;  1OYW A;  1IN6 A;  5B1A H;  1U5T C;  4U7D A;  3ABM H;  5CVJ A;  2DAO A;  3EUK L;  3V8J A;  4BXX J;  4ZTJ A;  3TW7 A;  1TQP A;  3PFI A;  4R79 A;  2G7H A;  4BL0 B;  4GGG A;  1XSV A;  1RUN A;  4RGU A;  1XN7 A;  2I10 A;  4XLN F;  1XG1 A;  4QPQ A;  1GDT A;  3FKJ A;  3JRA A;  2G9W A;  3QPS A;  3E5U A;  4RA2 A;  5E8I A;  2DT5 A;  3CC7 I;  1TQM A;  1LNW A;  4Y3O A;  4CCN A;  1DPR A;  1D1C A;  2HKX A;  2IP2 A;  5DD4 A;  5FLX Z;  4ZTF A;  3I3L A;  2W1O A;  3FXM A;  4KMU X;  1X19 A;  2AQF A;  4E6K G;  2ZXH A;  4G6Q A;  3S2W A;  5EJC A;  4RM2 A;  4IHT A;  1UMQ A;  2NYX A;  4L5J A;  2PX9 A;  4BY7 J;  4A3C J;  2Z2S B;  1J7K A;  1ENH A;  4C2U A;  4ZYH A;  2QSH X;  1TP4 A;  2MG4 A;  2R7U A;  2O6G E;  3OWT A;  4KN7 X;  3OYM A;  2CG4 A;  1XTA A;  2VE9 A;  1MMD A;  1YG2 A;  1VZ0 A;  3I64 A;  4XM3 A;  3OYJ A;  1T8I A;  3H1C A;  4HV6 A;  4IQJ A;  1C0W A;  2BEO A;  5D8K B;  2WB1 N;  3PQJ A;  2JVG A;  3DPU A;  3RZD J;  1P7J A;  5TRD A;  3AG2 H;  2BVM A;  2FNA A;  4MEX F;  5IP7 J;  2E19 A;  4LK1 F;  5LLQ A;  5FRM A;  4W1U A;  3GTM J;  2NS0 A;  3JRD A;  1SFO J;  4WXC A;  2E2H J;  3EYY A;  3WU2 C;  1ZGJ A;  1BI0 A;  1D3Y A;  3N4M A;  3HTS B;  2J5P A;  1AWC A;  3KPH A;  3OIQ A;  3TW6 A;  2ZNY A;  4WK8 F;  1HW2 A;  5FLV A;  2XPV A;  1V5G A;  1BC7 C;  2XAS A;  5DEQ A;  1R5H A;  4AIJ A;  1LDD A;  3TBI A;  5FB2 A;  1DU0 A;  2EV6 A;  3ZMT A;  1R5G A;  3I0T A;  4DZJ A;  4AYB A;  4E7S A;  1OYI A;  1QNT A;  3PNY A;  2JZY A;  1LFP A;  1U78 A;  2MFZ A;  4JX5 A;  5FLX K;  5F0F A;  4HF2 A;  1HKT A;  1R1T A;  2BY2 A;  3LMM A;  1Z1D A;  4ZDL A;  2EB7 A;  5D6F A;  3NWS A;  3J7A O;  1IN4 A;  1XGS A;  2XRO A;  2P5L C;  1RI7 A;  4O3M A;  2QA4 I;  3FXR A;  3RI4 A;  4ITV A;  2JTV A;  2O0Y A;  2F5E A;  4ASN A;  2O9L A;  3RKQ A;  1SC7 A;  4RAY A;  5FKL A;  1IRZ A;  2BXY A;  4H4K C;  4M6Y A;  3SYT A;  5M5Y J;  2M3A A;  5K7H A;  4BJ5 C;  4CHU A;  1Z77 A;  3IH4 A;  5HOO A;  2FJ1 A;  1R49 A;  1WJD A;  2XGE A;  2H6C A;  5FKO A;  4RLQ A;  5IYC J;  4S05 A;  3H0D A;  1VQP I;  5D5U B;  1S7O A;  5F1R A;  3KLO A;  2HR3 A;  4XRS A;  4IOC F;  3K6G A;  1S29 A;  5L3C A;  4M9S A;  4Q48 A;  3GZ6 A;  4XOP A;  3FM5 A;  1KU2 A;  5GP9 A;  5ICG A;  1YE9 A;  1OCP A;  2F48 A;  1QPI A;  3DWL E;  2KRF A;  5LHG A;  1ZH5 A;  2COB A;  2NOG A;  3LSG A;  4PZJ A;  4OAZ A;  3PSI A;  4KA4 A;  4LIV A;  3OY9 A;  3SZT A;  2XSD C;  3BJO A;  1XMA A;  3HPH A;  4IRG A;  2EIK H;  3HUG A;  1XSX A;  1D5V A;  1IN8 A;  1XMK A;  3FF5 A;  2XV4 S;  3F9K A;  3E97 A;  3VEP A;  3J81 Z;  4UY8 I;  1G8X A;  1M1E B;  1V5F A;  2ECB A;  3HRS A;  2EZK A;  2LFB A;  3QQA A;  2EZL A;  4CYC B;  4FCY A;  4IRH A;  2QF7 A;  4G9Y A;  3WTX C;  3BCB A;  3I54 A;  1XGO A;  5KAF C;  4RGS A;  2EBI A;  2W48 A;  4KMF A;  2PJP A;  3M07 A;  1P9Q C;  5EEH A;  3QRF F;  3ASN H;  2HNH A;  3DP7 A;  1ZRE A;  4CYC A;  1W7P B;  2ESN A;  4P96 A;  2EIN H;  1TWG J;  1I27 A;  5JFR A;  2XRN A;  3CQZ J;  1U6G A;  1Z21 A;  2L9V A;  5HLT A;  2UXX A;  2LRE A;  3C2G A;  5L3E A;  2WC2 A;  1EH8 A;  2D1V A;  4UV9 A;  4XRF A;  2GAU A;  2ELH A;  3GYH X;  2K5C A;  5LHI A;  4BE1 A;  2BOL A;  2EIM H;  2OUM A;  2ICW G;  3P7N A;  3SEQ A;  2TRT A;  1OKR A;  3WHB A;  4F91 B;  1PUF A;  4KFC A;  3CC2 I;  2VT3 A;  3O8H A;  1YW8 A;  4GDF A;  4DYQ A;  3CF2 A;  3OL4 A;  2QKM B;  3HZJ A;  3OL3 A;  1VQ8 I;  3N97 A;  3E5X A;  2ZB9 A;  3TOA A;  1W5S A;  2CQ7 A;  1RES A;  4IVN A;  4XOR A;  3A03 A;  3FWE A;  5L3G A;  4A3E J;  5H6Q A;  2JA2 A;  3KP5 A;  3MEX A;  5E79 C;  3TDU C;  2VOO A;  3ZQL A;  2KLO A;  2VQC A;  2YX7 A;  3KX2 A;  1MBF A;  2LG4 A;  3WG7 H;  3CCV I;  1GLN A;  2BXZ A;  4MQ9 F;  3F6O A;  2PLY A;  3LWF A;  4MFD A;  1I1G A;  1I50 J;  3SXY A;  2HTS A;  3J81 K;  2HVQ A;  1S7A A;  3FXU A;  4NNJ A;  4KUM A;  4EJT A;  3MFK A;  1KU9 A;  5L3D A;  3OR1 C;  1VTN C;  1OCO H;  3KP3 A;  2ZJ2 A;  3KCC A;  1TNS A;  1TW3 A;  2DA7 A;  2VT2 A;  3CUQ B;  4L9T A;  2RKH A;  2CGP A;  2V9K A;  3KEQ A;  5CKT A;  2KFD A;  2MGQ A;  3OR2 C;  3IWZ A;  1LB2 A;  3WGG A;  1J59 A;  2QUF A;  3CCM I;  1YX5 A;  2X48 A;  2H8W A;  1EJ9 A;  2R7V A;  2QCO A;  2VQG A;  1MDM A;  2M4G A;  2DTR A;  3BZ6 A;  2EIJ H;  3G6E I;  2LY9 A;  4KIF A;  4J00 A;  3CUQ A;  1S6L A;  2JA7 J;  1BI2 A;  4LG0 A;  3EPZ A;  1TNT A;  1IO2 A;  5C44 J;  1O57 A;  1ETX A;  2DOF A;  3ERM A;  3BCA A;  2ZKZ A;  3CCU I;  3ZRG A;  3RQI A;  3OS1 A;  4HNV A;  3ZCO A;  5KHD A;  3CME I;  1KGS A;  2MSY A;  4Y17 A;  1QA6 A;  3MKW B;  4PGG A;  3HIF A;  1JKR C;  2HXO A;  4A3M J;  4AYB N;  1JKO C;  1P4W A;  3QOE A;  2UUZ A;  1RUO A;  2VBW A;  2VQH A;  3V7C A;  3AL0 C;  4HAM A;  1WI9 A;  4D7M A;  1YI2 I;  3NEU A;  2X51 A;  3MAJ A;  4FT8 A;  1DU6 A;  1ON2 A;  2WAF A;  2OCE A;  3RYP A;  3B02 A;  3F23 A;  1X1B A;  2LSO A;  2OCC H;  1BN5 A;  2EFO A;  1UST A;  4XID A;  3DEE A;  4AWX B;  1H88 C;  4HA8 A;  4HG2 A;  3BG3 A;  3R61 A;  1HC8 A;  2OPT A;  2OU2 A;  4M3B A;  2XGX A;  3K4C A;  3LSI A;  2DMN A;  2HQR A;  5C4J J;  3KYL A;  5IOZ A;  1CGP A;  1T98 A;  1OLT A;  3S2H J;  2AHQ A;  3WTY C;  4HYE A;  5F0H A;  4CXF A;  3N05 A;  1LJ9 A;  2HYG D;  2X0L A;  1SFX A;  4CGZ A;  1Y56 A;  4M74 A;  5DCM B;  4GO1 A;  4CH7 A;  1MBG A;  5FLM J;  5CYV A;  3I55 I;  2A69 F;  1X1D A;  3L9F A;  1K83 J;  2KRC A;  2F5C A;  4WXH A;  1DGR M;  2MYS A;  1P92 A;  2W57 A;  2M8G X;  3K70 C;  2WTE A;  4EGZ A;  4NC6 A;  1TL8 A;  1X58 A;  2NRA C;  1N25 A;  1NHA A;  3B6A A;  4LB5 A;  3FMQ A;  1FT9 A;  5J4V A;  2O8X A;  3BP8 A;  4U7B A;  1ZLK A;  2ESH A;  4XN0 A;  1MMA A;  3FDY A;  3PM1 A;  3TO9 A;  1XX5 A;  3PO3 J;  3SJM A;  1UG0 A;  3BG9 A;  2QKL B;  2NS8 A;  2KDZ A;  3RPU A;  1VQO I;  2VBX A;  1B8I A;  4XSZ F;  1X1A A;  1MNE A;  3CO6 C;  4BQQ A;  1I39 A;  1A5J A;  2A61 A;  1V3F A;  3CJT B;  3OYN A;  1HCR A;  2DTZ A;  4KIS A;  2E1M C;  4A3J J;  1SFK A;  1X3Z B;  4DQ2 A;  2LC2 A;  2L7M P;  3EET A;  2CJJ A;  1VF9 A;  1SD5 A;  2FNP A;  4L9N A;  4FET A;  2ZCW A;  2JVH A;  3OYG A;  1HQC A;  1SVM A;  4BNC A;  4DNC A;  1DQU A;  1Z3X A;  1I5Z A;  2LYC A;  2L54 A;  1N75 A;  4UNO A;  4LLL A;  1FOW A;  1ON1 A;  1S7E A;  2R7F A;  2CMP A;  2HFH A;  4HPQ A;  4XLE A;  3JSO A;  4B43 A;  2W4S A;  5FRO A;  2V9P A;  5ILV A;  1D1A A;  4HLY A;  4OIR F;  4A3F J;  1S72 I;  4CO8 A;  4LG3 A;  4E7L A;  3CMY A;  3V42 A;  2Y0M A;  4KIC A;  2Y30 A;  3H5R A;  4EEF G;  1JKP C;  3RPU D;  2L7Z A;  2Z33 A;  1FIA A;  1XCV A;  3L2U A;  1L0O C;  4XKW A;  3GTJ J;  5IT3 A;  3EUH C;  2EFP A;  5HLH A;  5DUI A;  4L0Y B;  4ESJ A;  4B47 A;  3AKZ A;  1MD0 A;  2DA5 A;  3PL8 A;  4P9F A;  5E18 F;  3OSF A;  3BG6 A;  4WF2 A;  2DA4 A;  3I58 A;  1YHQ I;  5BS6 A;  3K2Z A;  4OMZ A;  4XL9 A;  2DA2 A;  1X4P A;  2Y75 A;  2HI3 A;  2DMP A;  2X1C A;  3DKY A;  4LD5 A;  2DK5 A;  4BEH A;  4ZDP A;  2HGC A;  1A6Q A;  3VYT B;  2HU9 A;  4EM2 A;  1A6I A;  3J7Y J;  3DBL B;  3H92 A;  1AA7 A;  1T33 A;  2A5W A;  3HOT A;  2IGK A;  2Z99 A;  1IXS B;  4I02 A;  3LA2 A;  4ENM A;  4LLN A;  3CO7 C;  2PJR B;  2K3F A;  2PMU A;  2ME6 A;  1GV2 A;  3IAS 2;  4XIC A;  4MQV A;  1MJA A;  1LE8 A;  2QM3 A;  2WV0 A;  3LOC A;  3I4M J;  3HXL A;  1Y0N A;  4P55 A;  1MNM C;  2NVY J;  1T6S A;  4LB6 B;  5ICC A;  2YU9 J;  4WXD A;  2PJR A;  3CF5 F;  2KP6 A;  3LSP A;  4G6D A;  2H27 A;  1P4A A;  3LSK A;  4UUS B;  1TZL A;  4AIK A;  2K86 A;  2JRT A;  1D8K A;  1ZN2 A;  3PNV A;  4NC8 A;  1LDJ A;  2L5Q A;  3FXQ A;  3RTR A;  5J1R A;  3CP8 A;  3ZQ7 A;  2P7V B;  3HL2 A;  1K7A A;  3V8K A;  1I6X A;  2L4A A;  4E70 A;  3WGI A;  4OU0 A;  5AIQ A;  2GOM A;  4UUS A;  3JW4 A;  3KLN A;  1NG7 A;  3E6B A;  3OMY A;  2ID3 A;  4EGY A;  2EJR A;  3S1M J;  4JOM A;  1LFU P;  2ZME C;  4H0E A;  2GZW A;  3I4P A;  5H2F C;  3E0J B;  2K4J A;  5A2Q Z;  2DDA A;  1LUJ B;  4BYY A;  3BTJ A;  3CCQ I;  1AKH B;  1BJA A;  2VL8 A;  4KIT B;  1BA5 A;  4CDG A;  4HST A;  2KZV A;  3RJP A;  1OQY A;  2R7R A;  2X85 A;  1MBE A;  4HF0 A;  3M9A A;  2ECC A;  5DYM A;  1AKH A;  1IRF A;  3ZR8 X;  1YOV B;  2P5V A;  1R00 A;  5D5X B;  3S2D J;  1WJE A;  1P7I A;  4M3F A;  4A5M A;  3DF8 A;  5GTH C;  1FTZ A;  3KZZ A;  1EA3 A;  1RET A;  1RKW A;  3MZH A;  3K4J A;  9ANT A;  1ETO A;  2Y2Z A;  2J5O A;  1BBY A;  1YS6 A;  2BZT A;  2DT7 B;  3K4L A;  4CCK A;  1B59 A;  1RC9 A;  4A12 A;  1REP C;  1U5T B;  1UCR A;  2IAI A;  4IHS A;  4A3B J;  4OIQ F;  1WH7 A;  3I59 B;  5IOY A;  1MJ9 A;  1B72 B;  2VBY A;  2MBF A;  3LL7 A;  3JTG A;  2EIL H;  4EJU A;  3CJN A;  4ZZD A;  4ZH4 F;  1R4M B;  2XAQ A;  3KIO A;  3I9V 2;  5EYR A;  3KEY A;  3H9G A;  5CPR B;  2CFX A;  3H3Z A;  4A2U A;  2KJC A;  3I59 A;  1MBK A;  3S3M A;  3T8T A;  1XPX A;  5ICE A;  2EV0 A;  2CRG A;  2VXD A;  5D4R A;  3ELK A;  4AVZ A;  2GWR A;  1FEX A;  1FNN A;  3TDZ C;  3F3X A;  2HKO A;  3J7Z I;  2CV1 A;  2KT0 A;  5E3N A;  2GXB A;  4A6D A;  2K27 A;  2LKS A;  1ULY A;  4DJA A;  3DLL F;  4NHJ A;  1MIJ A;  5AIP A;  1QZZ A;  1NTC A;  2VB6 A;  5FKM A;  2VOP A;  2CUE A;  2KQR A;  3ISP A;  3S15 J;  4Y52 J;  1R22 A;  3OYE A;  2R7O A;  1VQ5 I;  2R7W A;  2V9V A;  1XGN A;  2W84 A;  3ASO H;  5EG0 B;  2BV6 A;  4IO9 F;  2P8T A;  5HDK A;  1I3Q J;  1GVJ A;  2QVO A;  1JGG A;  2M0C A;  2K40 A;  2KIS A;  3D0S A;  1VND A;  5LGN A;  1VFC A;  3KEO A;  3OYD A;  3CCY A;  4D7N A;  2C6Y A;  2K3P A;  2M8E A;  2O5R A;  5AON A;  3L2C A;  4NQW B;  2A6H F;  2NVT J;  1R23 A;  4G8X A;  2FXA A;  6PAX A;  3G1M A;  5CQE A;  4E7Z A;  3GTP J;  3REO A;  4ON0 A;  3ZQI A;  3BT9 A;  1YIO A;  1FMW A;  2WV1 A;  3ESW B;  3KP4 A;  5B1B H;  2QSF X;  2DN0 A;  3W6J B;  2L9R A;  3K1N A;  4G7O F;  1YRN B;  3ABU A;  2V79 A;  4R8H A;  3KZY A;  3S17 J;  4NQW A;  4S0H B;  2VE8 A;  4M9Z A;  2CS3 A;  1WWX A;  2OF7 A;  1XS9 A;  4BBS J;  3OSG A;  5J3L A;  1AHD P;  1Z7U A;  2LTP A;  4HBL A;  3IH2 A;  4HRI A;  3OYF A;  4AID A;  4E7K A;  2Q2E B;  2OA4 A;  3E6D A;  1EH6 A;  3QU6 A;  2FRH A;  5J6X A;  2XB5 A;  3AG3 H;  2EA2 A;  2HZT A;  3C18 A;  3GEZ A;  4P1W A;  2GA1 A;  4FTH A;  2L7K A;  2MAB A;  1WJA A;  1FBU A;  4G7Z F;  2LVS A;  2EFW A;  3VSK A;  1W0T A;  4I01 A;  4BHP A;  2FEZ A;  3QPL A;  4HZF A;  2QZ8 A;  3W6K B;  4C9Y A;  4XK4 A;  1RR7 A;  1KQ9 A;  3LSR A;  1SVO A;  3PSF A;  3CUO A;  5LEJ A;  5LRS A;  1BL0 A;  1BIA A;  2R4G A;  3RQ4 A;  4ZYG A;  3DLA A;  2W85 A;  2P81 A;  3ABK H;  3ZQG A;  4CZZ A;  1KYZ A;  3S16 J;  2DFF A;  2PBI A;  4KJZ A;  5CVR A;  2O7O A;  3H36 A;  3BG5 A;  5JVG F;  3EYI A;  2XIG A;  1WFX A;  4D9J A;  1O4X A;  1HXD A;  3LFK A;  2NNY A;  1ZGW A;  3GF2 A;  1SEU A;  3SQN A;  3M8E A;  3GLL A;  1LKX A;  3GFM A;  3GZ5 A;  2H6B A;  1W5C C;  2DW4 A;  1WSU A;  1ZLJ A;  2Z5U A;  2V1U A;  4A0Z A;  5EZH A;  5H6R A;  2DFI A;  4N4N B;  1S3J A;  3QP6 A;  3ZMD A;  2ZC2 A;  5D6E A;  1SFE A;  3LQQ A;  1Z9C A;  3ZQC A;  3UKG A;  4U0W A;  3BQZ A;  1RPW A;  5DUK A;  3P9K A;  1U0J A;  4Z2Y A;  2E34 A;  4F3Q A;  3CLO A;  2XKP A;  4D1Q A;  1MBH A;  3FZV A;  3GVA A;  1IRG A;  2YU3 A;  2XAG A;  4YIF A;  1Z6R A;  3K10 A;  3Q9V A;  2ACJ A;  5EZG A;  4ZYD A;  4JBA A;  1K6O A;  1G3Y A;  1TWA J;  3GFI A;  2E7W A;  5M5X J;  2HYF A;  4C2M J;  4UV8 A;  1LQ1 A;  3A01 B;  5E1X A;  1FJL A;  2Z1D A;  4ABZ A;  4AVP A;  1IV6 A;  1KU7 A;  1ETW A;  4I0B A;  4F52 A;  1T56 A;  4Y13 A;  4BQA A;  2XF7 A;  3DKX A;  1F1Z A;  1TWC J;  4XN3 A;  2E36 A;  2W00 A;  5K7F A;  2R7S A;  5H20 A;  2EA4 A;  2JK3 A;  3RKW A;  3H0G J;  4L9J A;  3WTW C;  3LA3 A;  4RLF A;  3WTU C;  3A01 A;  1V4R A;  2DA6 A;  4AIH A;  2EQR A;  3WG9 A;  2K02 A;  2ID6 A;  1MBJ A;  3H9Q A;  4X6A J;  5ILS A;  3FMR A;  4N9H A;  3LAP A;  1ZR2 A;  1HDD C;  3V7R A;  4XKB A;  2LDU A;  5JI6 A;  2CQQ A;  2E1C A;  1ZHF A;  1EKE A;  3T8R A;  1SVL A;  3VOE A;  2IS2 A;  5E20 A;  2M7A A;  5TJJ A;  3CTA A;  4F55 A;  3A4C A;  3QU3 A;  3I56 I;  2Y9Y A;  1TT5 B;  1DGW Y;  3HOY J;  1E2X A;  2RRE A;  3JRE A;  1IJW C;  3TGN A;  1MMS A;  5FD6 A;  3RIR A;  3CZ6 A;  3ECO A;  2K9S A;  4FE7 A;  2DDB A;  2CWE A;  5FKN A;  5EEA A;  1VQ4 I;  1ZRD A;  1QBJ A;  3JRF A;  4L5I A;  4UHT A;  2QQA A;  4LIU A;  1VQ7 I;  3BQY A;  3M8J A;  4NB5 A;  3G2B A;  1I6H J;  1ZGA A;  5FKK A;  1QZE A;  2B0L A;  2HOS A;  4A6E A;  3WHC A;  1J0R A;  2HTJ A;  4UVB A;  2VJI A;  4K2E A;  1QVT A;  2RDP A;  3GW2 A;  1Y1W J;  2VKD A;  3F8M A;  4FQG A;  3S1R J;  3PO2 J;  2LF8 A;  1IN5 A;  4F93 B;  2E7X A;  3EUA A;  1IXR C;  3HHG A;  4I99 C;  1VQL I;  2VON A;  2FBK A;  4XKC A;  3VDX A;  2ZXI A;  1HKS A;  2Y48 A;  4MHG A;  4EJO A;  3GXO A;  4EAT A;  2WA0 A;  4XR6 A;  3LAJ A;  2LY1 A;  1ACI A;  3SDB A;  3H35 A;  3CJQ B;  4BE2 A;  5FO5 A;  3EDP A;  2DXI A;  3BLY A;  4LIT A;  3OS0 A;  3C3W A;  5FFZ A;  2EFN A;  2HVS A;  1UHM A;  2DQL A;  3A0H C;  4HDV A;  1NK2 P;  2XAH A;  2UZK A;  5BOX A;  4U0Y A;  1ZG1 A;  2LMD A;  5HNH A;  2NS7 A;  2LK2 A;  3G1L A;  2M4K A;  4CUG A;  1P4X A;  1W7P A;  1X4O A;  5FGM A;  3IL2 A;  3ERE D;  3R0A A;  1ZK8 A;  1JHF A;  3U2R A;  4KNY A;  2HDW A;  3CES A;  4NUB A;  4C2T A;  4LLG F;  3CP2 A;  2OQG A;  1FYL A;  3FX3 A;  1NK3 P;  5C4X J;  5HLI A;  2GLO A;  2DI3 A;  1X3W B;  2DOD A;  4GCV A;  3B73 A;  4XLP F;  1T2K A;  2V6C A;  4ENJ A;  3C2B A;  3CCJ I;  1OJL A;  3IKV A;  3CJR B;  2O8K A;  1LEB A;  1HBX G;  2ADU A;  3BTC A;  3Q0V A;  3QPH A;  4HNT A;  1ZAR A;  4IQ4 A;  2A3S A;  2BY1 A;  2KKO A;  2COM A;  3RKY A;  2ISY A;  2R7Q A;  1UHW A;  1OIS A;  2JN6 A;  4XSX F;  3HOW J;  3FK6 A;  2BY3 A;  2R0Q C;  3BPV A;  1FSH A;  2F5V A;  1MH3 A;  2NVX J;  4U0V A;  5EEG A;  1KYW A;  3QAH A;  3HOS A;  2DPU A;  2XAJ A;  3CD6 I;  1HA8 A;  4BHB A;  1TTY A;  3ABL H;  2HXI A;  1QZY A;  3LSM A;  5HS9 A;  4XKV A;  3G71 I;  1FLI A;  2AS5 F;  1Z6T A;  3T5X A;  3KYD B;  5C3E J;  3ZPL A;  1BR1 A;  5HS8 A;  1FYM A;  1W7P D;  1TWF J;  2EWN A;  2VKV A;  2ME0 A;  1QGP A;  2PFB A;  3MWM A;  5HDN A;  1J2X A;  3BR1 A;  2IGN A;  2E5Z A;  4XLC A;  1ZRF A;  3PFY A;  3AAF A;  3SEZ A;  3LSH A;  1IDZ A;  1R9T J;  2GIZ A;  2O03 A;  2PG4 A;  1JT0 A;  2MLK A;  4KT6 A;  1GT0 C;  5GAD J;  3BY6 A;  4EVI A;  4FIS A;  3VB2 A;  2NOJ B;  2E1M B;  2DMU A;  2V26 A;  2CUZ A;  2VIX A;  5HDG A;  2K9Q A;  2XGC A;  2E71 A;  2D5V A;  1YW9 A;  3M8F A;  1JUP A;  1XSD A;  2FBH A;  1E0E A;  2L01 A;  3Q0W A;  2F4O B;  3LQR A;  2A68 F;  2OD5 A;  3I5U A;  3ZN1 A;  4CYD A;  3S8P A;  1FWZ A;  4ZZL A;  3JRG A;  5J8C A;  3K4N A;  3PQK A;  4XON A;  1W4M A;  3FK7 A;  2IJL A;  1ZQ3 P;  5IP6 A;  2CV2 A;  2DK8 A;  2LD5 A;  1R6R A;  2JJ7 A;  2CYY A;  2DJN A;  3KFW X;  4XQF A;  2L9S A;  2A05 A;  3BWG A;  4QIW N;  3ABT A;  2CV0 A;  1E3H A;  3JTH A;  1V54 H;  2IW5 A;  1O3Q A;  1RR8 C;  1QO0 D;  4A3D J;  5F27 A;  4PJ0 C;  1PVE A;  4RB2 C;  1Y39 A;  2K7L A;  5J47 A;  4PSX A;  2PN6 A;  3BTI A;  2EK5 A;  3ZP5 A;  2PQ8 A;  4RS8 A;  2R7T A;  1B1B A;  5ILU A;  3G4S I;  4PCQ A;  4A0X A;  2HZD A;  3QYE A;  1T0F A;  2H1L A;  1BC8 C;  2P6S A;  1XDS A;  2PMZ A;  3ONQ A;  2LBF B;  1S8N A;  3DBH B;  5DCM A;  1KZH A;  1J75 A;  1X1P A;  4A69 C;  2P0W A;  2XGD A;  1Z67 A;  5D8L B;  2CQX A;  4XOT A;  4GYG A;  3K4K A;  1BOB A;  2E1O A;  4Z6Y A;  1WJC A;  2CW0 F;  2JA6 J;  2LBF A;  1E3P A;  2DU9 A;  2DLL A;  4A3G J;  2V1N A;  4KIG A;  4CIC A;  1WPK A;  4DBR A;  1UJ8 A;  2AXL A;  4Y15 A;  1APL C;  4E7I A;  2G0E A;  3CUQ C;  3FIW A;  3D5R C;  1OR7 A;  3SZG A;  1WJB A;  3ZMZ A;  1WCM J;  3IWF A;  4OOI A;  4WWC A;  2V1X A;  2M7B A;  1O3S A;  1ZR4 A;  2HDC A;  3BR3 A;  3FIS A;  3BC8 A;  1PJR A;  1OCZ H;  1ONV A;  4HX8 A;  4DW6 A;  1FTT A;  4F92 B;  1STZ A;  3R6S A;  5KK1 A;  3PIP F;  4M71 A;  4FE4 A;  5GTI C;  2P5K A;  1B6A A;  2DBB A;  3HG9 A;  3IH3 A;  1IXC A;  4IF4 A;  2RGV A;  1JGS A;  2ZME B;  2R5Y B;  1YLF A;  2WY8 Q;  3OOU A;  4BDY A;  1ZTR A;  4RGR A;  4YEJ A;  1OCT C;  3IHU A;  5DTD A;  5FJ8 J;  4TV7 A;  1JTX A;  4M9X A;  4DGW B;  3OYA A;  2QEX I;  2L0K A;  4Q4Z F;  1O3R A;  1MSF C;  3IV5 A;  2Y0S A;  2UWM A;  1KON A;  4PGH A;  2DMQ A;  1TWH J;  2FBI A;  1U9N A;  3VOD A;  2OBP A;  2TDX A;  4X0G A;  2VOD A;  4G94 A;  2DO7 A;  3W2V A;  2Y9Z A;  4J01 A;  1VQ6 I;  2IS1 A;  1OFC X;  4V2F A;  4XLA A;  4XRM A;  4RDU A;  3H5A A;  5GPC A;  5LRR A;  2WAQ A;  4HW0 A;  1USS A;  5DM6 F;  3KP6 A;  1D0Y A;  2A6E F;  5B3S H;  5DCF A;  4A5N A;  4C30 A;  4MNU A;  4XMY A;  1MMG A;  2BHY A;  4EJW A;  3K1M A;  2KDO A;  3IC7 A;  3BJ6 A;  3BOQ A;  4WCG A;  3GTO J;  1DUX C;  1GXQ A;  1LPQ A;  4IHW A;  2XDV A;  4HLX A;  2IRF G;  3A1Y A;  4G6T B;  1MSE C;  1FOK A;  4CSW A;  1VI0 A;  5FD5 A;  1JHH A;  4UVC A;  2DCE A;  1PP7 U;  3ZGK A;  1G4D A;  3W2W A;  2JSC A;  3LST A;  3MN2 A;  1YIJ I;  4UXN A;  2M34 A;  4LFU A;  2D1H A;  3BPX A;  4C3H J;  1UAA A;  2X1D A;  2VBZ A;  3DTI A;  3PUB A;  1IV8 A;  4FX4 A;  4V19 K;  3UR3 C;  2IS4 A;  2X6X A;  2LNB A;  3GTL J;  1QU3 A;  2QQ9 A;  3CCE I;  2ZSI B;  3T0Y A;  3PIO F;  2KHM A;  3R60 A;  3AG1 H;  1Q1H A;  3FBN B;  3L09 A;  2Y69 H;  2JRM A;  1QHG A;  3TP0 A;  3DTK A;  2EPF A;  1K78 B;  2JA5 J;  4OAY A;  1ERD A;  4IHV A;  2YSR A;  2KL4 A;  5GAH J;  5DS9 A;  3F72 A;  4OIN F;  2A5Y B;  1SAN A;  3K4B A;  1KA8 A;  2XPU A;  4ZJZ A;  2RC4 A;  4NC7 A;  5D5W B;  2E35 A;  2VUM J;  1RKT A;  2LLK A;  1K78 A;  3M4O J;  2XUB A;  2H09 A;  3KE2 A;  4N0B A;  3U21 A;  3V7S A;  3OYB A;  2E5N A;  2GQQ A;  2DYS H;  1QVU A;  4YFK F;  4UVA A;  4YFX F;  2YR2 A;  4N4O B;  2PMZ N;  1ZAO A;  4IEJ A;  4IRI A;  2V4J C;  5KCM A;  3CCR I;  3PNT A;  3T1B A;  4JYK A;  4EM1 A;  3OYK A;  2DQR A;  3IRR A;  2W82 A;  1Y6I A;  4HOB A;  3UNG C;  2MA3 A;  2OJE D;  4IKF A;  2LY2 A;  2WY7 Q;  5DV5 A;  1N78 A;  1S5L C;  2FSW A;  3TQN A;  2TCT A;  3HOV J;  4QPO A;  1FIP A;  2QYO A;  4BH9 A;  2Y31 A;  3JSP A;  3J80 Z;  2XAU A;  4XBF A;  3LSJ A;  3J7A Y;  3PJR A;  2N8G A;  4PFP A;  3F6V A;  1Z91 A;  4BQN A;  1NG6 A;  4N9I A;  1UZC A;  1U5T A;  3V4G A;  5IY5 H;  1TW2 A;  3JAM Z;  1EH7 A;  2MC4 A;  3QWL A;  1B72 A;  1BI1 A;  4AU7 A;  1G59 A;  2KIM A;  2XHK A;  3WTS C;  2HOE A;  3TO7 A;  1JUM A;  1Z3Y A;  4JK1 X;  3JR9 A;  2X6W A;  4PJJ A;  1UEL B;  1HLV A;  2CW7 A;  1WJF A;  2ZJP F;  3ZQH A;  5FFX A;  5F08 A;  2YUS A;  4FAS D;  4WX9 A;  2W7N A;  3CDH A;  1ORK A;  5KAI C;  4BAC A;  2LKX A;  1G3T A;  3BR5 A;  2PMH A;  4BS9 A;  5JVT A;  3GX4 X;  3HTU A;  1KQ0 A;  2Q1Z B;  5LGU A;  3DFG A;  3KYC B;  3RPQ A;  1ODD A;  3MKL A;  1SFU A;  5BQT A;  2JMW A;  2HQN A;  4I6Z A;  1FYK A;  2JUG A;  4ANJ A;  4CCO A;  2FUG 2;  4HQE A;  3PUF A;  3AFH A;  1FP2 A;  3E6C C;  2AXT C;  5LFA A;  4HF1 A;  1R4N B;  2O61 A;  4I0A A;  4C3I J;  1E3O C;  3HM5 A;  2NAZ A;  2Y0S N;  3ZMV A;  3QOP A;  1K61 A;  3K4M A;  4RB0 A;  3IAM 2;  5IP9 J;  4D5F A;  4DYC A;  1R36 A;  1H0M A;  1FOX A;  1RZ4 A;  1J09 A;  2BVL A;  5EG0 A;  4D0P A;  1LVK A;  1BW5 A;  5E17 F;  4JQF A;  1BR2 A;  2F4M B;  2ZFW A;  5F64 A;  4BE0 A;  1W5T A;  3GFJ A;  3J80 K;  2FF4 A;  1J5Y A;  4E7J A;  4II3 A;  2RN7 A;  2IGM A;  2WAQ N;  2FML A;  5BMZ A;  3S3O A;  2WAE A;  3TP3 A;  2DPD A;  1CF7 B;  2X4H A;  3MKZ A;  3U9G A;  3JAM K;  3TMO A;  1HST A;  2FOK A;  3TL4 X;  3U1K A;  1IN7 A;  4I76 A;  1YRN A;  5EGO B;  2UV1 A;  3SZP A;  2BBY A;  2DJI A;  1SMT A;  4EQQ A;  2M45 A;  1CF7 A;  3GME A;  2HVR A;  3VWB A;  2M1B A;  3X2Q H;  2OTL I;  2PEX A;  3BTL A;  2RNG A;  2XSJ C;  2M30 A;  1XGM A;  2XC7 A;  2Q2E A;  3IUO A;  4X1E A;  1W0U A;  1GVD A;  2BGC A;  2QQ8 A;  1JUS A;  1FZP B;  2R3S A;  2QSG X;  4G7H F;  1T39 A;  4UUV A;  5JLW A;  1F36 A;  3S32 A;  2P7C B;  5DD8 A;  2W25 A;  4IHX A;  4CCL A;  4IHY A;  2ZNZ A;  3A2K A;  1YJ9 I;  3ZN0 A;  3VFZ A;  5LHH A;  3WU0 A;  2LKP A;  4KYW A;  1SD7 A;  2VJ5 A;  4B4C A;  2HS5 A;  3QPT A;  3FXK A;  2LRD A;  4L5E A;  2CUF A;  3C7J A;  1UFM A;  2JQ7 A;  4B3A A;  1IGN A;  3NQO A;  5BPI A;  5DM7 F;  1WZ2 A;  4F7Z A;  2D45 A;  1ETK A;  1EF4 A;  4M6X A;  3R0J A;  4Y33 A;  4YEL A;  3WTZ A;  4PSW A;  3BRO A;  4XNF A;  5KVR A;  3WE2 A;  4KT5 C;  1WKM A;  2G7U A;  1JTY A;  1MJB A;  2RQQ A;  3HC7 A;  1LFB A;  3HBL A;  1SD4 A;  3HRM A;  2VXZ A;  2Z16 A;  2Q8K A;  1FPQ A;  4QLC U;  1WRJ A;  2KJB A;  2YPR A;  1R7J A;  4RAF A;  2M0M A;  1IZ1 A;  2OTJ I;  4RMN A;  5E3M A;  3HRU A;  4P9U A;  2VAS A;  4UB8 C;  3DBR B;  2HPI A;  5B5E C;  2HQ5 A;  3HSR A;  5K5O A;  2KIQ A;  4LK0 F;  4DYR A;  3H3V K;  1TT0 A;  1G3W A;  3QP5 A;  3FXO A;  2R7D A;  2RV8 A;  4BU2 A;  5JHU A;  1PP8 F;  1OCR H;  4JX4 A;  2B63 J;  4M73 A;  3CMM A;  1GXP A;  3ECH A;  1OPC A;  3DQV C;  3KZI C;  3GZN B;  1DPU A;  3HRT A;  4BJT A;  3NAU A;  1K6Y A;  2VI6 A;  3L00 A;  2GOX B;  2IVM A;  3DEU A;  1PDN C;  2BYV E;  1TQI A;  1Y1V J;  1LEA A;  4OWR B;  3ZMS A;  4DBQ A;  5K7Z A;  1HW1 A;  1KU3 A;  1S9H A;  3E3V A;  2E2I J;  1T08 B;  2ZXJ A;  1Y8Q B;  4MEY F;  3CDL A;  4MFE A;  3GWZ A;  1KQ8 A;  3G1O A;  3ZQQ A;  2F5D A;  1TLH B;  4AM3 A;  3VYR B;  2CSO A;  1FBS A;  2MLG A;  3L2W A;  2HQA A;  2K9N A;  2ELK A;  3FHZ A;  2H1K A;  2ZXW H;  5HLG A;  2I8D A;  3HEF A;  1Y8R B;  2GXA A;  1YS7 A;  3DXJ F;  4LJZ F;  1QQI A;  3F8B A;  2FOW A;  4W97 A;  2A6T A;  1DDN A;  4PDK A;  4IX7 A;  1IRX A;  2IT0 A;  4YII A;  2MH9 A;  3RKX A;  5LEK A;  1QRY A;  3FXJ A;  2DFH A;  4RAG A;  4I98 B;  3HJE A;  2E2J J;  4RBO A;  3O8G A;  2B9S A;  3IKT A;  2P4W A;  2VN2 A;  5BNG A;  2DT6 A;  3HYI A;  3NAR A;  4A93 J;  4UUT A;  4EM0 B;  5LBQ A;  4FHT A;  4BHC A;  3GTQ J;  2ZBK A;  2VJJ A;  3WTT C;  5HS7 A;  3GTK J;  1D1B A;  3HUG B;  3RCO A;  4A3I J;  2HOA A;  3K2A A;  4OMY A;  2GM4 A;  1O3T A;  4B3X A;  1YQA A;  3WE3 A;  2JPB A;  3S93 A;  1YYV A;  4BKX A;  3ZMU A;  3WTV C;  3OIO A;  3VYU B;  4HV5 A;  2XAF A;  3A0B C;  1CQT A;  3F8N A;  2LH9 A;  1JKQ C;  3AL0 B;  5IYB J;  2O3F A;  4P5O A;  2HEO A;  3MZ8 A;  4A3L J;  2CH0 A;  3OYL A;  1RNL A;  1SD6 A;  3MKY B;  2GIV A;  3HSE A;  2STW A;  4OIP F;  1YX3 A;  4BAY A;  3K0L A;  2MD0 A;  1HDP A;  1H9G A;  2OC6 A;  4OIO F;  3K1P A;  1D8J A;  3FXL A;  1YTY A;  2IEK A;  4E7H A;  5J4Y A;  3GBG A;  1PUF B;  5J8F A;  1G6N A;  3I71 A;  4GRI A;  2IPQ X;  2I5U A;  2EZH A;  4DOZ A;  4EV0 A;  1B9N A;  2JSP A;  2H94 A;  2VC0 A;  1GHC A;  2NXN B;  2WWY A;  3CCS I;  1U9O A;  2JUC A;  3RYR A;  4YIR X;  3JRH A;  1IUY A;  3S1N J;  4IOA F;  2RQP A;  3HGY A;  3M7G A;  1GUU A;  1HF0 A;  1BW6 A;  1P6R A;  4PK4 A;  5CQG A;  2H8R A;  3QYB A;  2IBD A;  2BY0 A;  2X1E A;  1K4S A;  2RAE A;  1WVR A;  4M3E A;  1O7L A;  4IPA A;  2DOE A;  4U87 A;  3ZQF A;  2FA5 A;  1Y0U A;  4PJN A;  1D5Y A;  2FMY A;  2K9M A;  2MW8 A;  3GLX A;  1MDM B;  4PFO A;  3DKW A;  4BBR J;  1Z0X A;  2QEN A;  3HPG A;  3EQL F;  4RM3 A;  3P5J A;  4LG0 B;  2BW3 B;  2RNJ A;  1X2M A;  2VPR A;  5M5W J;  1U3E M;  1X2N A;  4ZC3 A;  2V1D A;  2P6T A;  1DP7 P;  2FX0 A;  5IT9 Z;  1POG A;  2CO5 A;  2KPM A;  3GFL A;  4BXF A;  4I09 A;  3CDI A;  4NDL A;  2BW3 A;  1A36 A;  5E3O A;  3R4K A;  1UHS A;  1VQK I;  3FBI B;  2XPW A;  3OIP A;  3AG4 H;  1YIT I;  3DU5 A;  3G3Z A;  2IXS A;  2OZU A;  4BXU A;  2L2O A;  2VJ4 A;  3SDG A;  3TKY A;  1JXS A;  4RGX A;  4DZP A;  2OV7 A;  3K7A J;  1R1V A;  2OAZ A;  4M6V A;  5EDN A;  1FSE A;  3Q3S A;  1IDY A;  3B6C A;  1G2H A;  4UB6 C;  2E60 A;  3K70 D;  4YRV A;  2M5W A;  3C2H A;  5ICF A;  2L7F P;  2EFQ A;  5EF6 A;  4AC0 A;  4NBQ A;  1FX7 A;  5F1J A;  5M3M J;  2VLA A;  2NVQ J;  3HKZ A;  3D1N I;  2UXN A;  4CCM A;  1I3A A;  2GXG A;  4HSR A;  3CC4 I;  3K9T A;  2K9L A;  3NWT A;  3OS2 A;  3L2R A;  3GCM A;  2LF7 A;  3SFI A;  2BHZ A;  3L2Q A;  2ZO4 A;  4QSH A;  2XRL A;  2DFE A;  4JX6 A;  1HW5 A;  2QQB A;  3Q9S A;  1AU7 A;  3D5S C;  1R1U A;  2B7E A;  4KN4 X;  2FE3 A;  3EUH A;  1A31 A;  3OV8 A;  3I4N J;  4MIM A;  1FBQ A;  3RDI A;  2F4I A;  5DDG A;  1ZKG A;  2ELJ A;  4BDZ A;  1Z05 A;  1YJN I;  2F2E A;  4MGR A;  3NRV A;  2HYJ A;  3DV8 A;  4EJV A;  4XLF A;  1PUE E;  3KET A;  2WBM A;  2X6Y A;  1U8R A;  1XB4 A;  1PYV A;  1TC3 C;  1YJW I;  4LOC A;  4RAZ A;  5IT9 K;  2ISZ A;  3HDD A;  1IAW A;  2STT A;  3HOX J;  4RB3 C;  1F9N A;  5CVI A;  2E1N A;  4R1H A;  1VQM I;  5GAG J;  1TBX A;  2L3D A;  3BR0 A;  2R5Z B;  4KDP A;  2V6E A;  1ZG3 A;  4IXA A;  4V2G A;  3FHN A;  2R7X A;  5LGT A;  1B8I B;  1HOM A;  2HWV A;  4IL6 C;  4LGW A;  2HPM A;  3KP7 A;  3U1D A;  3ZXS A;  1V55 H;  3WU1 B;  4B48 A;  1VQ9 I;  1SMY F;  5D5V B;  2R5Z A;  2M9H A;  2K85 A;  3VSL A;  4YFN F;  2R93 J;  1LVA A;  5HNF A;  1QPM A;  5GPA A;  1IUF A;  1H89 C;  2VPL A;  1B4A A;  2HDD A;  3CLQ A;  2RVC A;  1JT6 A;  3HHH A;  3LA7 A;  3VYS B;  3MVP A;  5M3F J;  2CQK A;  2LR8 A;  1IF1 A;  4Q47 A;  3JRI A;  5K1Y A;  1HKQ A;  3TO6 A;  3P9I A;  1MMN A;  4M72 A;  4Q5S F;  2NVU B;  4ENN A;  1F4K A;  5E1Z B;  4M3G A;  4ZYE A;  5E3L A;  4GFB A;  1ZG5 A;  4L18 B;  1UB9 A;  2ZSH B;  1OMI A;  1I1S A;  5KNL A;  4A3K J;  2KZG A;  2ZME A;  2M2E A;  3MCZ A;  5ERI A;  2R5Y A;  2PI0 A;  1FC3 A;  2CUJ A;  2JWT A;  4Y4R A;  1XD7 A;  2XF6 A;  1MZB A;  1YW7 A;  1BI3 A;  2CW8 A;  2M87 A;  3O3K A;  4ESB A;  3RZO J;  2GA2 A;  2ZJQ F;  2VKH A;  4BJ6 C;  4O6J A;  1SAU A;  4Y7N J;  4ZDO A;  2FU4 A;  1MKM A;  4ZYA A;  2FQ4 A;  2CU7 A;  2R7Z J;  3JRC A;  1WI3 A;  1JE8 A;  1E17 A;  1QHH D;  1OCC H;  2V7F A;  4HQM A;  5CVV A;  1AOY A;  1T0F C;  1MH4 A;  4CCJ A;  3W6V A;  3DTE A;  3BG7 A;  3E7L A;  5IPA A;  4BY1 J;  3S1Q J;  3BR2 A;  3I53 A;  5E1W A;  2IA0 A;  3H9J A;  4L9V A;  4BEH B;  2W24 A;  1MGT A;  1FY7 A;  2EH3 A;  2DA3 A;  4M3D A;  2Q0O A;  1V5E A;  4HX4 A;  1D0X A;  4ETS A;  3IRQ A;  3OYC A;  1R58 A;  3F8F A;  4JP0 A;  2IGO A;  4E4H A;  3G73 A;  1Z7L A;  5L3F A;  3FKI J;  3LNQ A;  5HOD A;  1F43 A;  1LE8 B;  1SAX A;  1ZEL A;  1ZRC A;  3SHF A;  2HOT A;  3HSF A;  2DMT A;  3F8C A;  2AO9 A;  4I7H A;  2QLZ A;  5J40 A;  1OR7 C;  2OZ6 A;  1F5T A;  1YFH A;  3KP2 A;  1WJ5 A;  5K5R A;  5J1Y A;  2IA2 A;  2DA1 A;  1T38 A;  3HOZ J;  2WAD A;  3RSN A;  2QGU A;  3ROU A;  1FMV A;  4XLH A;  4CZC A;  4QWQ A;  1RIO H;  4YG2 F;  2YX4 A;  3F22 A;  5HVQ C;  3COA C;  3HGG A;  1U8B A;  1ITY A;  4A0Y A;  1XCB A;  4PJM A;  5F04 A;  2Z3Y A;  3O2P E;  2GBY A;  2JA8 J;  1VQN I;  3W2A A;  4ESF A;  3DPT A;  4BQO A;  5FRN A;  3LFU A;  5L3B A;  2JPC A;  2MH2 A;  1MW7 A;  3GTG J;  1XC5 A;  3Q5F A;  3A02 A;  1JI8 A;  1BM9 A;  2D2W A;  1UG2 A;  4D5C A;  1W36 D;  3JRB A;  5JR3 A;  1JJ8 C;  3HKZ N;  4MLO A;  2X6O A;  4EMS A;  3E1S A;  1ZYR F;  3BZK A;  3F0C A;  3BR6 A;  4GXO A;  4G12 A;  2XB0 X;  5IYD J;  2L02 A;  4B44 A;  3S3N A;  4GYI A;  1GV5 A;  4S04 A;  4ENK A;  3M1C A;  2WB1 A;  1L3L A;  1R5I D;  1T95 A;  2AQE A;  4B09 A;  3MMY B;  2VC1 A;  5JLX A;  4IJA A;  3BDD A;  3C1D A;  2XF5 A;  1WQ2 A;  5F6F A;  1BOA A;  1XMX A;  5CVU A;  1O7F A;  5CJ9 A;  4U88 A;  3E6M A;  3WOD F;  2F5F A;  4J19 A;  2IS6 A;  1P2F A;  1WH5 A;  2KIU A;  3M3Y J;  2FD5 A;  1X3U A;  1XDU A;  5B66 C;  3HOU J;  3JCU C;  5GAE J;  4LMY A;  2KIF A;  5E8G A;  1H9T A;  4I2O A;  3M1E A;  1A04 A;  3TOB A;  1K4T A;  1A35 A;  1FP1 D;  3L2V A;  4B1R A;  3OYI A;  2DYR H;  1K79 A;  3K69 A;  2EZI A;  3ML6 A;  4II2 A;  3ULQ B;  3V8L A;  4PUS A;  5TIS C;  2MD5 A;  5CLS A;  1W36 C;  1N77 A;  4PJL A;  1H8A C;  2LP0 A;  1BJZ A;  1NH3 A;  4B8X A;  2KMU A;  2QWW A;  3BZC A;  3O6B B;  4HEA 2;  1B9M A;  3VPR A;  2R92 J;  2KRH A;  3L7W A;  1EV7 A;  4FX0 A;  4HNU A;  4RB1 A;  3DPL C;  3L1P A;  2A07 F;  3SFZ A;  4BGD A;  3GUD A;  3OOP A;  1YO5 C;  2CQN A;  3CCL I;  1U2W A;  2OQR A;  1HSJ A; 
#chains in the Genus database with same CATH homology
 4MTD A;  2EV5 A;  5A2Q K;  3FM3 A;  2QBY B;  2XVC A;  2ETH A;  2JT1 A;  1G3S A;  3BJA A;  2MC3 A;  2K4B A;  3E5Q A;  1J9I A;  3MQ0 A;  2Z9O A;  2QBY A;  3P9C A;  2NNN A;  1BIB A;  1OYY A;  1IW7 F;  3WGH A;  4MTE A;  3GO5 A;  2FQ3 A;  4HDU A;  5K5Q A;  5ED4 A;  2L4M A;  3H3U A;  5BPD A;  3MZY A;  2XKO A;  4L0Z B;  4HX7 A;  4KIB A;  2BE5 F;  2IA1 A;  3FMS A;  4O5V A;  3F21 A;  4AD9 A;  1LDK B;  5D4S A;  3D5L A;  1OYW A;  1IN6 A;  1U5T C;  4U7D A;  5CVJ A;  2DAO A;  3V8J A;  1TQP A;  3PFI A;  4R79 A;  2G7H A;  4GGG A;  1XSV A;  1RUN A;  4RGU A;  1XN7 A;  4XLN F;  2G9W A;  3E5U A;  5E8I A;  2DT5 A;  1TQM A;  1LNW A;  1DPR A;  5DD4 A;  2HKX A;  2IP2 A;  5FLX Z;  4KMU X;  4G6Q A;  3S2W A;  4IHT A;  4L5J A;  2NYX A;  1J7K A;  4ZYH A;  2O6G E;  4KN7 X;  2CG4 A;  2VE9 A;  1YG2 A;  3I64 A;  4HV6 A;  1C0W A;  2BEO A;  5D8K B;  3PQJ A;  5TRD A;  2FNA A;  4MEX F;  4LK1 F;  5LLQ A;  2NS0 A;  4WXC A;  3EYY A;  1ZGJ A;  1BI0 A;  1D3Y A;  3N4M A;  3HTS B;  2J5P A;  1AWC A;  2ZNY A;  4WK8 F;  1HW2 A;  1BC7 C;  2XAS A;  5DEQ A;  1R5H A;  4AIJ A;  1LDD A;  5FB2 A;  2EV6 A;  3ZMT A;  1R5G A;  3I0T A;  1OYI A;  1QNT A;  2JZY A;  1U78 A;  5FLX K;  4HF2 A;  1HKT A;  1R1T A;  1Z1D A;  2EB7 A;  5D6F A;  3J7A O;  1IN4 A;  1XGS A;  2XRO A;  2P5L C;  1RI7 A;  4O3M A;  3FXR A;  3RI4 A;  2JTV A;  2O0Y A;  2F5E A;  4ASN A;  4RAY A;  4M6Y A;  4CHU A;  5HOO A;  2H6C A;  4S05 A;  5D5U B;  1S7O A;  5F1R A;  3KLO A;  2HR3 A;  1S29 A;  5L3C A;  4M9S A;  4Q48 A;  3GZ6 A;  3FM5 A;  1KU2 A;  5ICG A;  5LHG A;  2KRF A;  1ZH5 A;  4PZJ A;  4KA4 A;  3SZT A;  3BJO A;  1XMA A;  4IRG A;  3HUG A;  1XSX A;  1D5V A;  1IN8 A;  1XMK A;  3FF5 A;  2XV4 S;  3E97 A;  3VEP A;  3J81 Z;  3HRS A;  4IRH A;  4G9Y A;  3WTX C;  3I54 A;  1XGO A;  4RGS A;  4KMF A;  2PJP A;  5EEH A;  3QRF F;  3DP7 A;  1ZRE A;  1W7P B;  2ESN A;  4P96 A;  1I27 A;  5JFR A;  2XRN A;  1U6G A;  2UXX A;  5L3E A;  2WC2 A;  1EH8 A;  2D1V A;  4UV9 A;  4XRF A;  2GAU A;  2ELH A;  3GYH X;  5LHI A;  3P7N A;  4KFC A;  1OKR A;  2VT3 A;  1YW8 A;  3N97 A;  3E5X A;  3TOA A;  1W5S A;  4IVN A;  3FWE A;  5L3G A;  5H6Q A;  3KP5 A;  3MEX A;  3TDU C;  2VOO A;  2YX7 A;  4MQ9 F;  3F6O A;  2PLY A;  3LWF A;  1I1G A;  3SXY A;  2HTS A;  3J81 K;  1S7A A;  3FXU A;  4EJT A;  4KUM A;  3MFK A;  1KU9 A;  5L3D A;  1VTN C;  3KP3 A;  2ZJ2 A;  3KCC A;  1TNS A;  1TW3 A;  2VT2 A;  4L9T A;  3CUQ B;  2RKH A;  2CGP A;  3KEQ A;  3IWZ A;  1LB2 A;  3WGG A;  1J59 A;  2QUF A;  1MDM A;  2DTR A;  3BZ6 A;  4KIF A;  3CUQ A;  1S6L A;  1BI2 A;  4LG0 A;  1TNT A;  1O57 A;  2ZKZ A;  1KGS A;  4Y17 A;  4PGG A;  3HIF A;  1P4W A;  1RUO A;  2VBW A;  3V7C A;  4HAM A;  1WI9 A;  3NEU A;  3MAJ A;  4FT8 A;  1ON2 A;  3RYP A;  3B02 A;  3F23 A;  2LSO A;  1BN5 A;  2EFO A;  1UST A;  4AWX B;  4HA8 A;  3R61 A;  2OU2 A;  2XGX A;  2HQR A;  1CGP A;  1T98 A;  3WTY C;  4HYE A;  4CXF A;  1LJ9 A;  2HYG D;  2X0L A;  1SFX A;  4CGZ A;  5DCM B;  4M74 A;  4GO1 A;  5CYV A;  2A69 F;  3L9F A;  2F5C A;  4WXH A;  1P92 A;  2W57 A;  4EGZ A;  2WTE A;  2NRA C;  1NHA A;  4LB5 A;  3FMQ A;  1FT9 A;  2O8X A;  3BP8 A;  4U7B A;  1ZLK A;  2ESH A;  3TO9 A;  3RPU A;  2VBX A;  4XSZ F;  3CO6 C;  2A61 A;  1V3F A;  4DQ2 A;  3EET A;  1SD5 A;  2FNP A;  4L9N A;  2ZCW A;  1HQC A;  4BNC A;  4DNC A;  1I5Z A;  2L54 A;  4UNO A;  4LLL A;  1ON1 A;  2R7F A;  2HFH A;  3JSO A;  5ILV A;  4HLY A;  4OIR F;  4CO8 A;  2Y0M A;  4KIC A;  2Z33 A;  1XCV A;  1L0O C;  5IT3 A;  2EFP A;  5HLH A;  5DUI A;  4L0Y B;  4ESJ A;  1MD0 A;  4P9F A;  5E18 F;  4WF2 A;  3I58 A;  5BS6 A;  3K2Z A;  4OMZ A;  2Y75 A;  4LD5 A;  2DK5 A;  2HGC A;  4EM2 A;  3H92 A;  3HOT A;  2Z99 A;  1IXS B;  4I02 A;  3LA2 A;  4ENM A;  4LLN A;  3CO7 C;  2PMU A;  4MQV A;  1MJA A;  2QM3 A;  2WV0 A;  4P55 A;  1T6S A;  4LB6 B;  5ICC A;  4WXD A;  2H27 A;  4G6D A;  1P4A A;  4AIK A;  2K86 A;  2JRT A;  1D8K A;  1ZN2 A;  1LDJ A;  3RTR A;  3FXQ A;  3ZQ7 A;  2P7V B;  1K7A A;  3V8K A;  1I6X A;  2L4A A;  4E70 A;  3WGI A;  4OU0 A;  5AIQ A;  3JW4 A;  3KLN A;  3E6B A;  4EGY A;  2EJR A;  4H0E A;  2GZW A;  3I4P A;  2K4J A;  5A2Q Z;  4BYY A;  1BJA A;  4CDG A;  3RJP A;  4HF0 A;  3M9A A;  5DYM A;  1IRF A;  2P5V A;  1R00 A;  5D5X B;  4A5M A;  3DF8 A;  3KZZ A;  3MZH A;  2J5O A;  1BBY A;  1YS6 A;  1B59 A;  4A12 A;  1REP C;  1U5T B;  1UCR A;  4IHS A;  4OIQ F;  3I59 B;  1MJ9 A;  2VBY A;  2MBF A;  3JTG A;  4EJU A;  3CJN A;  4ZZD A;  4ZH4 F;  2XAQ A;  2CFX A;  3H3Z A;  4A2U A;  2KJC A;  3I59 A;  3T8T A;  5ICE A;  2EV0 A;  5D4R A;  3ELK A;  2GWR A;  1FNN A;  3TDZ C;  3F3X A;  2HKO A;  2GXB A;  4A6D A;  2K27 A;  1ULY A;  4NHJ A;  5AIP A;  1QZZ A;  2VOP A;  3ISP A;  1R22 A;  2V9V A;  1XGN A;  2W84 A;  2BV6 A;  2P8T A;  5HDK A;  1GVJ A;  2QVO A;  3D0S A;  5LGN A;  3KEO A;  2C6Y A;  2M8E A;  5AON A;  3L2C A;  2A6H F;  1R23 A;  4G8X A;  2FXA A;  6PAX A;  3REO A;  4ON0 A;  1YIO A;  3KP4 A;  3W6J B;  3K1N A;  4G7O F;  3ABU A;  2V79 A;  4R8H A;  3KZY A;  4NQW A;  2VE8 A;  4M9Z A;  1WWX A;  1Z7U A;  4HBL A;  3QU6 A;  2OA4 A;  3E6D A;  1EH6 A;  5J6X A;  2FRH A;  2EA2 A;  2HZT A;  3C18 A;  3GEZ A;  2GA1 A;  1FBU A;  4G7Z F;  2EFW A;  4I01 A;  4BHP A;  2FEZ A;  4HZF A;  2QZ8 A;  3W6K B;  1KQ9 A;  5LEJ A;  3CUO A;  5LRS A;  1BIA A;  4ZYG A;  2W85 A;  4CZZ A;  1KYZ A;  5CVR A;  2PBI A;  3EYI A;  2XIG A;  1HXD A;  3LFK A;  2NNY A;  3GF2 A;  3SQN A;  3M8E A;  3GFM A;  3GZ5 A;  2H6B A;  2DW4 A;  1WSU A;  1ZLJ A;  2Z5U A;  2V1U A;  4A0Z A;  5H6R A;  2DFI A;  1S3J A;  3QP6 A;  3ZMD A;  5D6E A;  1SFE A;  3LQQ A;  1Z9C A;  4U0W A;  5DUK A;  3P9K A;  4Z2Y A;  3CLO A;  2XKP A;  3GVA A;  3FZV A;  1IRG A;  2YU3 A;  2XAG A;  4YIF A;  1Z6R A;  3Q9V A;  2ACJ A;  4ZYD A;  4JBA A;  1K6O A;  1G3Y A;  3GFI A;  2E7W A;  2HYF A;  1LQ1 A;  4UV8 A;  5E1X A;  4AVP A;  1KU7 A;  4I0B A;  4Y13 A;  4BQA A;  1F1Z A;  5H20 A;  2EA4 A;  3RKW A;  3WTW C;  4L9J A;  3LA3 A;  3WTU C;  1V4R A;  4AIH A;  3WG9 A;  2K02 A;  5ILS A;  3FMR A;  4N9H A;  3LAP A;  3V7R A;  2LDU A;  5JI6 A;  2E1C A;  1ZHF A;  3T8R A;  3VOE A;  5E20 A;  5TJJ A;  3CTA A;  3QU3 A;  1E2X A;  3TGN A;  5FD6 A;  3RIR A;  3ECO A;  2CWE A;  1ZRD A;  1QBJ A;  4L5I A;  4UHT A;  2QQA A;  4NB5 A;  1ZGA A;  2B0L A;  4A6E A;  1J0R A;  2HTJ A;  4UVB A;  4K2E A;  2RDP A;  3GW2 A;  3F8M A;  2LF8 A;  1IN5 A;  2E7X A;  2VON A;  1IXR C;  3HHG A;  2FBK A;  1HKS A;  2Y48 A;  4MHG A;  4EJO A;  3GXO A;  3LAJ A;  5FO5 A;  3EDP A;  3C3W A;  5FFZ A;  2EFN A;  1UHM A;  2DQL A;  4HDV A;  2XAH A;  2UZK A;  5BOX A;  4U0Y A;  1ZG1 A;  1P4X A;  1W7P A;  5FGM A;  3IL2 A;  3ERE D;  3R0A A;  3U2R A;  1JHF A;  4KNY A;  4LLG F;  2OQG A;  1FYL A;  3FX3 A;  5HLI A;  2DI3 A;  4GCV A;  3B73 A;  4XLP F;  1T2K A;  2V6C A;  4ENJ A;  3IKV A;  1LEB A;  1HBX G;  2ADU A;  3QPH A;  1ZAR A;  2A3S A;  2KKO A;  2COM A;  3RKY A;  2ISY A;  1UHW A;  4XSX F;  3BPV A;  1FSH A;  3HOS A;  5EEG A;  4U0V A;  1KYW A;  3QAH A;  2DPU A;  2XAJ A;  4BHB A;  1TTY A;  1QZY A;  5HS9 A;  1FLI A;  2AS5 F;  1Z6T A;  3T5X A;  3ZPL A;  5HS8 A;  1FYM A;  1W7P D;  2EWN A;  1QGP A;  2PFB A;  3MWM A;  5HDN A;  1J2X A;  1ZRF A;  3AAF A;  2O03 A;  2PG4 A;  2MLK A;  3BY6 A;  4EVI A;  3VB2 A;  5HDG A;  1YW9 A;  3M8F A;  1XSD A;  2FBH A;  2L01 A;  3LQR A;  2A68 F;  2OD5 A;  3I5U A;  3ZN1 A;  4CYD A;  4ZZL A;  1FWZ A;  5J8C A;  3PQK A;  1W4M A;  2IJL A;  2DK8 A;  2CYY A;  3KFW X;  3BWG A;  3ABT A;  3JTH A;  2IW5 A;  1O3Q A;  1QO0 D;  4RB2 C;  2K7L A;  2PN6 A;  2EK5 A;  3ZP5 A;  2PQ8 A;  4RS8 A;  1B1B A;  5ILU A;  4PCQ A;  4A0X A;  1T0F A;  1BC8 C;  2P6S A;  1XDS A;  1S8N A;  5DCM A;  1J75 A;  5D8L B;  4GYG A;  2CW0 F;  2DU9 A;  2DLL A;  4KIG A;  4CIC A;  2AXL A;  4Y15 A;  3CUQ C;  1OR7 A;  3ZMZ A;  3IWF A;  4OOI A;  4WWC A;  2V1X A;  1O3S A;  2HDC A;  1ONV A;  4HX8 A;  1STZ A;  3R6S A;  5KK1 A;  4M71 A;  2P5K A;  1B6A A;  2DBB A;  1IXC A;  4IF4 A;  2RGV A;  1JGS A;  2ZME B;  1YLF A;  4RGR A;  3IHU A;  4TV7 A;  4M9X A;  1O3R A;  4Q4Z F;  2UWM A;  4PGH A;  2FBI A;  3VOD A;  2OBP A;  2TDX A;  2VOD A;  4G94 A;  2DO7 A;  5LRR A;  4HW0 A;  1USS A;  3KP6 A;  2A6E F;  5DCF A;  4A5N A;  4MNU A;  4EJW A;  3K1M A;  3IC7 A;  3BJ6 A;  3BOQ A;  4WCG A;  1DUX C;  1GXQ A;  4HLX A;  2IRF G;  1FOK A;  5FD5 A;  1JHH A;  4UVC A;  1PP7 U;  1G4D A;  2JSC A;  3LST A;  4UXN A;  4LFU A;  2D1H A;  3BPX A;  2VBZ A;  4FX4 A;  2LNB A;  2QQ9 A;  3T0Y A;  3R60 A;  1Q1H A;  3L09 A;  1K78 B;  2YSR A;  3F72 A;  4OIN F;  2A5Y B;  1KA8 A;  2RC4 A;  5D5W B;  1K78 A;  2XUB A;  2H09 A;  3KE2 A;  4N0B A;  3V7S A;  2GQQ A;  4YFK F;  4UVA A;  4YFX F;  2YR2 A;  1ZAO A;  4IRI A;  3T1B A;  4EM1 A;  2DQR A;  3IRR A;  4HOB A;  2MA3 A;  5DV5 A;  2FSW A;  3TQN A;  2QYO A;  4BH9 A;  3JSP A;  3J80 Z;  4XBF A;  3F6V A;  1Z91 A;  4N9I A;  1U5T A;  3V4G A;  1TW2 A;  3JAM Z;  1EH7 A;  1BI1 A;  2KIM A;  2XHK A;  3WTS C;  2HOE A;  3TO7 A;  4JK1 X;  5FFX A;  4WX9 A;  3CDH A;  1G3T A;  2PMH A;  5JVT A;  3GX4 X;  3HTU A;  1KQ0 A;  5LGU A;  3DFG A;  3RPQ A;  1ODD A;  1SFU A;  5BQT A;  2HQN A;  1FYK A;  4HQE A;  1FP2 A;  3E6C C;  4HF1 A;  2O61 A;  4I0A A;  2NAZ A;  3ZMV A;  3QOP A;  4RB0 A;  1R36 A;  1H0M A;  1RZ4 A;  4D0P A;  5E17 F;  4JQF A;  2ZFW A;  5F64 A;  1W5T A;  3GFJ A;  3J80 K;  2FF4 A;  1J5Y A;  2RN7 A;  2FML A;  5BMZ A;  2DPD A;  1CF7 B;  2X4H A;  3U9G A;  3JAM K;  1HST A;  2FOK A;  1IN7 A;  3SZP A;  2BBY A;  1SMT A;  4EQQ A;  2M45 A;  1CF7 A;  2M1B A;  2PEX A;  2M30 A;  1XGM A;  2Q2E A;  2BGC A;  1FZP B;  2R3S A;  4G7H F;  1T39 A;  4UUV A;  2P7C B;  5DD8 A;  2W25 A;  2ZNZ A;  3ZN0 A;  3VFZ A;  5LHH A;  3WU0 A;  2LKP A;  4KYW A;  1SD7 A;  2HS5 A;  3QPT A;  3C7J A;  1UFM A;  3NQO A;  5BPI A;  4F7Z A;  2D45 A;  4M6X A;  3R0J A;  3WTZ A;  3BRO A;  5KVR A;  3WE2 A;  4KT5 C;  1WKM A;  2G7U A;  1MJB A;  1SD4 A;  3HRM A;  2VXZ A;  2Q8K A;  1FPQ A;  4QLC U;  1WRJ A;  2KJB A;  2YPR A;  1R7J A;  1IZ1 A;  3HRU A;  4P9U A;  3HSR A;  5K5O A;  4LK0 F;  1G3W A;  3QP5 A;  1PP8 F;  2R7D A;  2RV8 A;  5JHU A;  4M73 A;  1GXP A;  3ECH A;  1OPC A;  3DQV C;  1DPU A;  3HRT A;  3L00 A;  2IVM A;  3DEU A;  1PDN C;  2BYV E;  1TQI A;  1LEA A;  3ZMS A;  1HW1 A;  1KU3 A;  3E3V A;  2ZXJ A;  4MEY F;  3GWZ A;  1KQ8 A;  2F5D A;  1TLH B;  2CSO A;  1FBS A;  2MLG A;  3FHZ A;  5HLG A;  1YS7 A;  3DXJ F;  4LJZ F;  1QQI A;  3F8B A;  1DDN A;  4PDK A;  2IT0 A;  4YII A;  2MH9 A;  3RKX A;  5LEK A;  4I98 B;  3IKT A;  2P4W A;  2VN2 A;  3HYI A;  4EM0 B;  5LBQ A;  4FHT A;  4BHC A;  2ZBK A;  3WTT C;  5HS7 A;  4OMY A;  1O3T A;  1YQA A;  3WE3 A;  2JPB A;  1YYV A;  3ZMU A;  3WTV C;  4HV5 A;  2XAF A;  3F8N A;  2O3F A;  4P5O A;  2HEO A;  1RNL A;  1SD6 A;  2STW A;  2GIV A;  3HSE A;  4OIP F;  4BAY A;  3K0L A;  1H9G A;  4OIO F;  3K1P A;  1D8J A;  1YTY A;  5J8F A;  1G6N A;  3I71 A;  2IPQ X;  4EV0 A;  1B9N A;  2H94 A;  2VC0 A;  1GHC A;  2WWY A;  3RYR A;  1IUY A;  2RQP A;  3M7G A;  1P6R A;  1O7L A;  4IPA A;  2FA5 A;  1Y0U A;  2FMY A;  3GLX A;  1MDM B;  3DKW A;  2QEN A;  3EQL F;  4LG0 B;  2RNJ A;  1U3E M;  2V1D A;  2P6T A;  1DP7 P;  5IT9 Z;  2CO5 A;  3GFL A;  4I09 A;  3R4K A;  3G3Z A;  2OZU A;  4BXU A;  3TKY A;  1JXS A;  4RGX A;  1R1V A;  2OAZ A;  1FSE A;  2M5W A;  5ICF A;  2EFQ A;  1FX7 A;  2UXN A;  2GXG A;  3K9T A;  2LF7 A;  2ZO4 A;  1HW5 A;  2QQB A;  3Q9S A;  1R1U A;  4KN4 X;  2FE3 A;  3EUH A;  3OV8 A;  1FBQ A;  3RDI A;  5DDG A;  1Z05 A;  2F2E A;  4MGR A;  3NRV A;  3DV8 A;  4EJV A;  1PUE E;  3KET A;  1U8R A;  1XB4 A;  4RAZ A;  5IT9 K;  2ISZ A;  1IAW A;  2STT A;  4RB3 C;  1F9N A;  5CVI A;  2E1N A;  4R1H A;  1TBX A;  2L3D A;  4KDP A;  1ZG3 A;  4IXA A;  5LGT A;  2HWV A;  4LGW A;  3KP7 A;  3U1D A;  3WU1 B;  1SMY F;  5D5V B;  4YFN F;  1LVA A;  1QPM A;  1B4A A;  2RVC A;  3HHH A;  1IF1 A;  3LA7 A;  2CQK A;  4Q47 A;  5K1Y A;  1HKQ A;  3TO6 A;  3P9I A;  4M72 A;  4Q5S F;  4ENN A;  1F4K A;  5E1Z B;  4ZYE A;  1ZG5 A;  4L18 B;  1UB9 A;  1OMI A;  1I1S A;  2ZME A;  5ERI A;  3MCZ A;  2PI0 A;  1FC3 A;  1XD7 A;  1MZB A;  1YW7 A;  1BI3 A;  2M87 A;  3O3K A;  4ESB A;  2GA2 A;  4O6J A;  2FU4 A;  1MKM A;  1JE8 A;  1E17 A;  4HQM A;  5CVV A;  1AOY A;  3I53 A;  5E1W A;  2IA0 A;  4L9V A;  2W24 A;  1MGT A;  1FY7 A;  2Q0O A;  4HX4 A;  4ETS A;  3IRQ A;  1R58 A;  3F8F A;  3G73 A;  5L3F A;  1SAX A;  1ZRC A;  3SHF A;  3HSF A;  3F8C A;  4I7H A;  2QLZ A;  2OZ6 A;  1F5T A;  1YFH A;  3KP2 A;  5K5R A;  2IA2 A;  1T38 A;  3ROU A;  4QWQ A;  1RIO H;  4YG2 F;  2YX4 A;  3F22 A;  5HVQ C;  3COA C;  4A0Y A;  1XCB A;  2Z3Y A;  3O2P E;  4ESF A;  3DPT A;  5L3B A;  2JPC A;  2MH2 A;  3Q5F A;  1BM9 A;  2D2W A;  5JR3 A;  4EMS A;  1ZYR F;  4GXO A;  2L02 A;  4GYI A;  4S04 A;  4ENK A;  1L3L A;  4B09 A;  2VC1 A;  4IJA A;  3BDD A;  3C1D A;  1WQ2 A;  5F6F A;  1BOA A;  5CVU A;  1O7F A;  5CJ9 A;  4U88 A;  3E6M A;  3WOD F;  2F5F A;  1P2F A;  2KIU A;  1X3U A;  1XDU A;  4LMY A;  2KIF A;  5E8G A;  1H9T A;  4I2O A;  3M1E A;  1A04 A;  3TOB A;  1FP1 D;  1K79 A;  3K69 A;  3ML6 A;  3ULQ B;  3V8L A;  2MD5 A;  5CLS A;  4B8X A;  2QWW A;  3O6B B;  1B9M A;  3L7W A;  1EV7 A;  4FX0 A;  4RB1 A;  3DPL C;  2A07 F;  3SFZ A;  3GUD A;  3OOP A;  1YO5 C;  1U2W A;  2OQR A;  1HSJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...