1PUEE

Pu.1 ets domain-dna complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
88
structure length
88
Chain Sequence
KIRLYQFLLDLLRSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKGNRKKMTYEKMARALRNYGKTGEVKKVKKKLTYQFSGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*AP*AP*AP*AP*AP*GP*GP*GP*GP*AP*AP*GP*TP*GP*GP*G)-3
publication title A new pattern for helix-turn-helix recognition revealed by the PU.1 ETS-domain-DNA complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 22
structure length 88
sequence length 88
chains with identical sequence F
ec nomenclature
pdb deposition date 1996-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1pueE00
3OOPA 2WV0A 4CYDA 3LQRA 2FQ3A 1BIBA 5J6XA 5L3EA 1IN7A 1W7PB 5E1XA 2HS5A 4G6DA 5ERIA 3I64A 3J80Z 1IN8A 3QPTA 4M9ZA 1KYZA 4WX9A 4OINF 1FX7A 1RUNA 4RGXA 2L3DA 1F1ZA 4IRGA 3F8NA 4ENNA 1Z9CA 3FMQA 1L3LA 4HYEA 3WODF 3N97A 5HLHA 2A6HF 1VTNC 2HWVA 3HIFA 1G3TA 2IVMA 2PEXA 3ZMDA 2IA1A 3U1DA 1UCRA 3HRSA 4HZFA 1ZARA 1WI9A 2XAHA 2FF4A 3RI4A 5HVQC 5E8IA 2LKPA 1JGSA 4AD9A 1O7LA 1IRGA 3RKXA 2Y0MA 2XAFA 3J81K 4HLYA 2IP2A 1UHWA 2CSOA 2QQBA 1P6RA 2MH2A 1F4KA 1TLHB 5LGTA 1YFHA 5DD8A 5FO5A 1ZHFA 1KQ9A 2XUBA 1SFEA 3F72A 1JHHA 5LEJA 4EJWA 2QQ9A 2Z5UA 1P4AA 2EFOA 2W84A 4G94A 4XLPF 4Z2YA 1QNTA 4ZYHA 4P9UA 4R1HA 2ZNZA 2GA2A 1IW7F 2DK5A 1XCBA 1IN5A 2VN2A 2MC3A 3F8BA 4UXNA 1ZLJA 5HOOA 2VT3A 3K1NA 5FLXK 2VOPA 4OMZA 4YIIA 2IW5A 5E20A 3F21A 4L9NA 2QM3A 5F64A 4ASNA 5ICCA 1OKRA 4KDPA 1Z05A 3QU3A 2F5DA 4KN4X 3SQNA 1SD6A 1OR7A 2XRNA 1Y0UA 1ULYA 2CQKA 4P9FA 3E3VA 1X3UA 5CVRA 4EJUA 4AWXB 4FT8A 2HZTA 4IRIA 1SD5A 2PG4A 1LVAA 4RGUA 3PFIA 4U7BA 3FXQA 4JQFA 5IT9Z 2B0LA 2OA4A 2M1BA 3F8MA 5LHGA 1W5SA 5H20A 2J5OA 4G9YA 5DDGA 1ONVA 2YPRA 3LA7A 2ELHA 3RIRA 3REOA 2IJLA 4OIPF 4HDVA 1U5TB 3O6BB 2HGCA 4A2UA 3JAMZ 3HTSB 2IA2A 4KUMA 4ZZLA 4EQQA 1ZG1A 1LDJA 2R7FA 3H3UA 3GX4X 1G3YA 3V8JA 3FHZA 1T2KA 2LF8A 4XLNF 4N0BA 2A3SA 1D3YA 1BC7C 3RYRA 4OIOF 6PAXA 2FE3A 2NNYA 3G3ZA 2ETHA 3GXOA 3DV8A 2M45A 4OIQF 1PDNC 3BP8A 3IRQA 4A12A 2FRHA 2CFXA 1LQ1A 4DQ2A 4KIGA 5AIPA 3BROA 1Z6RA 4NHJA 4LK0F 4NB5A 3TO6A 4N9IA 4M9XA 3FMSA 5E17F 5CYVA 1B9MA 5LBQA 4P5OA 3WU0A 3EQLF 3E6DA 2F2EA 2L4AA 2M30A 1D8JA 1CGPA 5E1WA 4U0YA 1BM9A 1T0FA 2H94A 1ODDA 3HOSA 1P92A 3IRRA 4EV0A 1IXSB 5EEGA 5ILUA 3KP5A 3BY6A 1XSXA 1FYKA 3FX3A 4ZYGA 2VC0A 4MGRA 1L0OC 1IRFA 3MEXA 3LA2A 3IKTA 3QPHA 3JW4A 4PDKA 4YIFA 1FOKA 1XMKA 1Z91A 2FU4A 1XSDA 2CW0F 2DLLA 1XDSA 3FWEA 3T8TA 2K27A 1K78A 4I2OA 4L9VA 3TKYA 3WTUC 2FMLA 2L4MA 2G7UA 2EV6A 1G3WA 4P55A 1YYVA 1W5TA 3GFMA 2EFPA 1ZRDA 1UHMA 2FNAA 5LRSA 2PBIA 1YW7A 5CJ9A 2GXGA 3V8KA 1KA8A 1G3SA 4RS8A 4HV6A 2QVOA 1R23A 1RI7A 3ISPA 4MNUA 5EEHA 1YG2A 2EWNA 4HAMA 4LG0B 3WU1B 3EYYA 4E70A 3JTHA 1QQIA 1RZ4A 1J9IA 1LB2A 4ENKA 5L3BA 5L3FA 1TQMA 3M1EA 4U7DA 4AIJA 1LNWA 2E1NA 3LAJA 4ZZDA 2DTRA 2PMUA 4LK1F 3F6VA 5CVUA 1FYMA 3C18A 1S8NA 2P8TA 1S6LA 5E1ZB 3E6BA 3TDUC 4U0VA 4EM0B 5FD6A 2O6GE 1OYIA 3C1DA 4Q5SF 3WTZA 5LHIA 2RVCA 1QZZA 5IT3A 4IVNA 4QLCU 1E2XA 3ZPLA 4G7ZF 2HR3A 2VBYA 1MD0A 1YS7A 5JFRA 5HS7A 4RB2C 2LF7A 1B4AA 4R79A 1QPMA 3ROUA 3NQOA 2P5KA 3TOAA 3P7NA 2BE5F 1BC8C 5D5XB 4D0PA 2QENA 1V4RA 2RDPA 1RNLA 4IRHA 4XSXF 4O3MA 2ZMEB 3Q5FA 5FLXZ 3M8EA 3I58A 3MCZA 1IAWA 1BN5A 1R5GA 2Q0OA 1F5TA 1WSUA 1SAXA 4KFCA 4M72A 3MQ0A 5D6FA 5HDNA 2OU2A 1HKSA 3WTXC 2GA1A 3COAC 3RTRA 3ML6A 1QO0D 4HX8A 1V3FA 5JR3A 2F5FA 4R8HA 3CTAA 1MJAA 2V1UA 4U0WA 3I5UA 1KQ0A 1SFUA 5E8GA 1KGSA 2R3SA 2IA0A 4IHSA 5FD5A 5BMZA 2DK8A 3R60A 3ECOA 4BHPA 1HBXG 3QAHA 1ZLKA 3Q9VA 3EYIA 2QQAA 4GO1A 4JBAA 3U9GA 2LDUA 3RJPA 4LB6B 2YR2A 1R22A 3Q9SA 3B02A 2Z9OA 1R58A 4TV7A 3HUGA 2K02A 2GZWA 5L3CA 2HFHA 3O2PE 1R7JA 2P5LC 1FBQA 5HS8A 5ED4A 1BBYA 5D5UB 2KJBA 3WGHA 4I98B 3CUOA 4LMYA 5A2QZ 2ZKZA 3WG9A 4A0ZA 1FP1D 1E17A 1FNNA 3L9FA 1FPQA 3VB2A 3RKYA 1TNTA 3DXJF 1KU2A 3K0LA 2YU3A 2V1XA 2GXBA 2XVCA 1BI2A 2DBBA 1EV7A 2HEOA 1FBUA 1XSVA 1FLIA 5BOXA 2DW4A 3E6MA 1BOAA 3MZHA 4WXHA 4LFUA 4WWCA 1HQCA 4CGZA 3F3XA 1TW3A 2V9VA 4YFKF 4BAYA 2UXNA 4GCVA 2O3FA 2P4WA 2VE9A 2O03A 2NYXA 4KMUX 4GXOA 1O57A 1SMYF 5LEKA 4WCGA 5TRDA 1SD4A 4UNOA 1O7FA 3GFLA 3KZYA 3ULQB 4OU0A 2JPCA 5H6QA 2EFWA 1U6GA 2P7VB 1U3EM 2QLZA 3GWZA 5DV5A 3F23A 4CZZA 4HA8A 3DKWA 2QUFA 4RGSA 1J2XA 4A0YA 4EM1A 2P6TA 1LJ9A 5DUIA 2MLGA 4ON0A 3DPTA 1SD7A 1OYWA 3E5UA 3WTYC 5DCMA 1D8KA 2DQLA 2JPBA 2BBYA 2XROA 5AIQA 1XB4A 2OQRA 1HXDA 4LLGF 2MBFA 3K2ZA 3EDPA 2D45A 3H92A 5F1RA 2KRFA 2QBYA 2DAOA 1R5HA 1BI1A 3MZYA 3SHFA 3HHHA 4RB1A 2JZYA 2BYVE 2DI3A 3PQKA 4QWQA 5DEQA 4G8XA 3DPLC 5DCMB 2VBWA 3KEQA 5D8LB 4HDUA 2UWMA 2W85A 2HTSA 5K5RA 2EFQA 4RB0A 3TGNA 2F5CA 2WC2A 3SFZA 1WRJA 1IXCA 3CUQA 2RNJA 5JHUA 1O3SA 2A5YB 4MHGA 3LQQA 4KNYA 3GO5A 3DP7A 1CF7A 3C7JA 3BJOA 1I1SA 1Z1DA 4UHTA 2GQQA 1HW2A 4RGRA 3VFZA 5HLGA 5KK1A 5LRRA 2O8XA 3T1BA 2FA5A 2Z99A 1CF7B 1S3JA 3WGGA 2FBHA 1PP8F 1DPUA 1IXRC 2YX4A 5E18F 3ZQ7A 3ABTA 2AXLA 2NNNA 1LEBA 2DO7A 1DUXC 2XAJA 4HF1A 4GYIA 4IJAA 1C0WA 1FYLA 2RKHA 4L0YB 4I02A 3BPXA 3GZ6A 1MGTA 1QBJA 2KKOA 2O0YA 5A2QK 2PI0A 1IUYA 4A6EA 1R00A 4A5MA 3LWFA 4KT5C 3ECHA 2NAZA 2DFIA 4FX4A 4BYYA 1Z6TA 4GYGA 4HV5A 3FM5A 5DUKA 5BQTA 1U2WA 3GVAA 2QYOA 5ILSA 4I0AA 1HSTA 5FGMA 2HKOA 4EJTA 2E7XA 1K6OA 1TBXA 4PGHA 3V7CA 4I09A 2H09A 2D1VA 3VOEA 3I53A 5AONA 3GZ5A 1UB9A 2VBXA 1FBSA 4K2EA 1I5ZA 3FF5A 3PQJA 1IN6A 2ADUA 3KEOA 1ZN2A 2GWRA 3RYPA 3QRFF 2A6EF 4L5IA 4KA4A 2STWA 1O3RA 4WXCA 4AIHA 1W4MA 4AIKA 2C6YA 3IHUA 4ENJA 1JE8A 2Q8KA 2K86A 4ESFA 1H9TA 3VEPA 1B9NA 3KP6A 3LAPA 1U78A 2XAGA 5D5WB 4IF4A 3P9IA 1I1GA 3ZN0A 3MWMA 3OV8A 4LLLA 1W7PD 1G4DA 4BHBA 1K78B 3L7WA 5D4RA 2P5VA 3I59A 4ETSA 2VT2A 2VXZA 2V79A 3HSFA 4KN7X 2UZKA 1H9GA 3ZP5A 1ZG5A 4IHTA 1GXQA 3BJAA 2Z3YA 2L54A 2GAUA 1ZAOA 3D0SA 4XBFA 1DDNA 3KETA 4CO8A 3I59B 4WF2A 3H3ZA 2YX7A 2Y48A 3FM3A 3BPVA 4M74A 4HLXA 3W6JB 1G6NA 5FFXA 3F8FA 1YTYA 2M8EA 4HF0A 2E1CA 1J75A 3IWFA 2FEZA 2MH9A 4OIRF 3E5XA 5DD4A 2A61A 2QWWA 3IWZA 3CO6C 3E5QA 2ZNYA 3MAJA 3JSPA 2ISZA 1FY7A 2JT1A 1USSA 3QOPA 4BXUA 3WE3A 2XKOA 4HX4A 3T0YA 4LD5A 1XGOA 1QZYA 2ZXJA 4UVBA 2JRTA 3ZMTA 2W57A 4S04A 2M5WA 2XIGA 3HRMA 2HKXA 4UUVA 1STZA 1LDKB 4PGGA 3HSEA 5FB2A 2IRFG 4EGZA 1XDUA 4L9JA 4G6QA 1SMTA 3S2WA 4UV9A 4G7OF 4XSZF 1IZ1A 2ZO4A 2FOKA 4EVIA 1B1BA 2E7WA 2YSRA 3BZ6A 3SZPA 1ZRFA 5ICEA 2RGVA 5BS6A 1FSEA 3J7AO 1WKMA 3SXYA 1BJAA 2PJPA 1IN4A 1O3TA 3ZN1A 3KE2A 4MTEA 5TJJA 1HSJA 5LLQA 4OMYA 3F8CA 3KP4A 3BJ6A 1OMIA 3R0JA 4FHTA 2WTEA 2FBKA 4HQMA 3KCCA 2WWYA 3FXRA 2TDXA 3M7GA 2ZBKA 1RIOH 2XHKA 2MD5A 1BI3A 2K7LA 2MA3A 4ENMA 2O61A 3CUQC 1TQIA 4M9SA 1P4WA 3ERED 5D5VB 1YO5C 4BNCA 3C3WA 1XMAA 3CDHA 4CICA 4Q4ZF 1WQ2A 4H0EA 1PP7U 1W7PA 2CWEA 4Y17A 1HKQA 4B09A 3TQNA 4A5NA 2XKPA 1GVJA 3IKVA 4DNCA 3JTGA 1ZGJA 2RV8A 1RUOA 5L3DA 3R6SA 3FXUA 2BGCA 4U88A 1YLFA 2OD5A 4RB3C 2ESNA 1U5TC 5D6EA 1MZBA 1TW2A 4S05A 4WK8F 4CXFA 2HYFA 4HQEA 5J8CA 4MTDA 3WTSC 1KU9A 3O3KA 1T6SA 2HTJA 2ESHA 2K4BA 1A04A 1XN7A 1K79A 3F6OA 2A68F 1Z7UA 4FX0A 4KYWA 4MEXF 2UXXA 5ICFA 1B59A 2EV5A 2PLYA 3RKWA 3QU6A 1GXPA 5DCFA 3B73A 2IPQX 5HS9A 3V7SA 4EJOA 5H6RA 1YIOA 3T8RA 4M6YA 2PFBA 4B8XA 1BI0A 1R1UA 3CLOA 3DFGA 3MFKA 1LEAA 4Y13A 1AWCA 4BQAA 4O5VA 5LGUA 3KP3A 3G73A 2Q2EA 3F22A 2M87A 4LJZF 1WWXA 1NHAA 1MJ9A 3TOBA 3VODA 3HHGA 5D8KB 1ON1A 3KLNA 3RDIA 4EM2A 1EH6A 2CGPA 1XGMA 2DPUA 4HW0A 1R1TA 1J5YA 2X0LA 3LFKA 2ISYA 3KZZA 1JHFA 3GW2A 3FMRA 1FP2A 4NQWA 2STTA 2H6BA 2G9WA 4ZH4F 2A07F 2DPDA 4ZYDA 2VODA 4I7HA 3U2RA 1I27A 4N9HA 2D1HA 2NS0A 1KU3A 2CYYA 3TO7A 4ESBA 1ZH5A 2QBYB 5K5QA 3NEUA 5LHHA 5BPIA 2EJRA 2DT5A 1XCVA 4KICA 4ESJA 4LB5A 1JXSA 3RPUA 3DF8A 1ZRCA 3BDDA 3L00A 2BEOA 3CUQB 2EV0A 1EH8A 5J8FA 3TDZC 1LDDA 3M9AA 1OYYA 1FC3A 3WGIA 2L01A 1GHCA 4I0BA 1REPC 2RC4A 2EB7A 4Q47A 1AOYA 2DQRA 1P2FA 4PCQA 2VE8A 2V1DA 1K7AA 1KQ8A 3L2CA 3I54A 4BH9A 5L3GA 2AS5F 1U5TA 5ICGA 1XGNA 5F6FA 2GIVA 3ZMSA 4EJVA 4YFXF 3WTWC 4HBLA 4L5JA 2PMHA 4RAYA 2EFNA 3GLXA 1QGPA 2EA2A 1J7KA 4GGGA 1EH7A 5K5OA 2FBIA 2HDCA 4A0XA 4EMSA 2VBZA 2F5EA 2LNBA 2Z33A 2DU9A 2KIMA 3R4KA 3J80K 3QP6A 4A6DA 2R7DA 3I71A 2V6CA 3IC7A 4HF2A 3ZMZA 3ABUA 2FMYA 4HX7A 3NRVA 1FZPB 2OQGA 2ZJ2A 4LGWA 4MQ9F 4L0ZB 3HRTA 5HLIA 4M71A 3V8LA 2KJCA 4P96A 3N4MA 2D2WA 2OBPA 3GEZA 4YFNF 3L09A 3KFWX 1O3QA 5DYMA 3K69A 1ZG3A 1KYWA 4I01A 2VC1A 2X4HA 3HRUA 2XAQA 3ZMVA 1OPCA 3LA3A 5KVRA 3D5LA 2XGXA 5D4SA 1Q1HA 1BIAA 4XRFA 2NRAC 4IXAA 2QZ8A 4JK1X 2H27A 2BV6A 2EA4A 4M73A 1XD7A 1MJBA 1FT9A 1J59A 2OAZA 3K9TA 1YW8A 3KP2A 1T38A 4G7HF 3V4GA 1TNSA 2P6SA 1R1VA 2COMA 2VONA 4CHUA 2H6CA 5JI6A 3HOTA 4Y15A 3GUDA 3DEUA 3EUHA 5HDKA 2LSOA 2CG4A 4EGYA 2CO5A 4YG2F 3EETA 5CLSA 1SFXA 1FWZA 2XASA 1T98A 3KP7A 3GYHX 4LG0A 4LLNA 2OZ6A 4CDGA 2HQNA 3V7RA 4Q48A 2HOEA 4M6XA 2MLKA 3IL2A 4KMFA 4MQVA 4WXDA 4RAZA 3CO7C 1DPRA 1YS6A 1XGSA 1ZREA 1B6AA 2K4JA 3E6CC 2ZFWA 2XV4S 2PN6A 1D5VA 4F7ZA 5HDGA 3SZTA 3WTVC 5LGNA 2KIUA 5IT9K 4AVPA 3R0AA 3QP5A 1KU7A 1R36A 2KIFA 1S7OA 3HTUA 3TO9A 5JVTA 3J81Z 2FSWA 5CVVA 1F9NA 2OZUA 1HW5A 2JTVA 2JSCA 3T5XA 5FFZA 2ZCWA 1ZGAA 3M8FA 1DP7P 2W24A 2ACJA 2HQRA 1TTYA 3FZVA 3JAMK 2EK5A 3CJNA 4HOBA 1I6XA 2ZMEA 3DQVC 1UFMA 4O6JA 4UV8A 2G7HA 1YQAA 2HYGD 1HKTA 1FSHA 4OOIA 1P4XA 1S29A 3HSRA 1IF1A 3RPQA 1ON2A 5CVJA 2IT0A 2Y75A 2A69F 2FNPA 3W6KB 5K1YA 3R61A 3KLOA 5ILVA 3K1PA 1PUEE 1U8RA 3GFJA 4L18B 4MEYF 1H0MA 4IPAA 5CVIA 1MDMA 4BHCA 3JSOA 3I0TA 3BOQA 4KIFA 3GFIA 4UVAA 2P7CB 1HW1A 1TQPA 3K1MA 2FXAA 4L9TA 4UVCA 4KIBA 2J5PA 1ZYRF 1MDMB 1S7AA 3GF2A 1USTA 3AAFA 4ZYEA 2VOOA 1J0RA 3P9CA 1YW9A 3HYIA 4PZJA 1MKMA 2RN7A 2PQ8A 3ZMUA 2W25A 3E97A 3P9KA 3ELKA 3LSTA 3BWGA 5BPDA 1T39A 3WE2A 2L02A 3I4PA 2RQPA 3WTTC
chains in the Genus database with same CATH superfamily
3RZDJ 2AXTC 2KMUA 1W0UA 2JA8J 3OOPA 3DKYA 2WV0A 4CYDA 2LC2A 3LQRA 1GUUA 2FQ3A 1BIBA 4XRSG 4IO9F 2DXIA 4F93B 5C4JJ 1LE8B 5J6XA 5L3EA 2H8WA 1Z21A 1IN7A 3JCUC 4BQNA 3CJRB 1W7PB 4PJ0C 5E1XA 2NVXJ 1K83J 4A3LJ 2DTZA 2HS5A 3PIOF 3SZGA 1X58A 2A05A 1JJ8C 2NVTJ 3HG9A 2XPWA 2QKLB 4G6DA 5ERIA 4BEHB 2FX0A 4J00A 3I64A 3J80Z 1IN8A 5EZHA 4GRIA 1X1CA 3HXLA 2XB5A 3QPTA 1KYZA 4M9ZA 5GTIC 4WX9A 2OV7A 1MBHA 1X1PA 2HU9A 2DJNA 2KQRA 4QPQA 4OINF 1LFUP 2WAQN 1FX7A 1MMGA 1RUNA 4RGXA 2P0WA 5EYRA 3BR6A 3ERMA 2L3DA 1F1ZA 4IRGA 3F8NA 4ENNA 1ZKGA 1Z9CA 3ZXSA 4L5EA 3FMQA 4KISA 1L3LA 4HYEA 2QQ8A 3OWTA 3WODF 2VJIA 3N97A 5HLHA 2A6HF 3IAM2 1VTNC 2HWVA 3HIFA 1APLC 1G3TA 2E35A 2IVMA 3GTLJ 1MMDA 3DBHB 2JRMA 2KFDA 2PEXA 2Y0SA 3ZMDA 4Y4RA 2IA1A 4YEJA 3U1DA 1UCRA 3HRSA 3LNQA 4FASD 1SFKA 4HZFA 3QYFA 1XS9A 1T33A 2QSHX 2R7QA 1ZARA 1WI9A 2XAHA 4AU7A 4Y3OA 3X2QH 2FF4A 3ABKH 1Z77A 3RI4A 5HVQC 5E8IA 2LKPA 5GADJ 2AQFA 4IQ4A 1JGSA 1RKTA 4AD9A 1UJ8A 1O7LA 4IQJA 1IRGA 1LFBA 3RKXA 3KZIC 2XF6A 2Y0MA 2XAFA 1QVUA 4CZCA 1N78A 2MG4A 3J81K 4XONA 5GAEJ 2F4MB 4BJTA 4HLYA 3OYGA 2IP2A 1UHWA 2CSOA 4ZJZA 1MNMC 2QQBA 3TMOA 1P6RA 1K61A 2MH2A 1F4KA 3HM5A 4RA2A 2IS1A 1TLHB 5LGTA 5FJ8J 4S0HB 1YFHA 2DFFA 5DD8A 5FO5A 1ZHFA 1KQ9A 2L7KA 3OYIA 2XUBA 1SFEA 2E5NA 3F72A 4BGDA 4F55A 1JHHA 5LEJA 5F0FA 3HC7A 2X85A 4EJWA 4KITB 3CMYA 4CUGA 2QQ9A 3S14J 2O7OA 3K4JA 1YHQI 2IAIA 2R7OA 3AL0C 2Z5UA 1KZHA 4QIWN 1T0FC 1P4AA 2EFOA 2W84A 3VYSB 3H1CA 4M3EA 4G94A 4XLPF 4Z2YA 1QNTA 4ZYHA 4P9UA 4R1HA 2ZNZA 1N25A 3BZCA 2GA2A 3GTPJ 4OAZA 1BW5A 3RSNA 5J3LA 1XPXA 1Y1VJ 1FOXA 3A02A 1IW7F 2DK5A 3S17J 1XCBA 1FMWA 1IN5A 2VN2A 3K4NA 1JTXA 5IYCJ 2MC3A 3F8BA 5F0CA 3JR9A 4UXNA 1ZLJA 2L7ZA 1P7IA 2VT3A 3K1NA 5HOOA 5FLXK 4X0GA 2VOPA 4NQWB 4OMZA 4YIIA 4HNTA 3OYMA 2IW5A 2V6EA 1BA5A 5E20A 1NG6A 5F27A 4HSTA 3ZQGA 2ZJQF 2E1MC 2CV1A 3F21A 4L9NA 1IG7A 4E6KG 2QM3A 1MBEA 2LOOA 4DYQA 5F64A 3RQ4A 4ASNA 5ICCA 1OKRA 4KDPA 2LY9A 1Z05A 3FXMA 3QU3A 2F5DA 3G1OA 4KN4X 4X1EA 3SQNA 1SD6A 1OR7A 2XRNA 1Y0UA 3SJMA 3J7AY 1ULYA 5C4XJ 3B6AA 3EUHC 2CQKA 4P9FA 2O9LA 1JT6A 3E3VA 5IOZA 1X3UA 3C2BA 4N4OB 4YRVA 5CVRA 4EJUA 4AWXB 5HNFA 3WHBA 1F43A 4MIMA 4FT8A 2HZTA 2M7BA 1D1CA 1ORKA 1UELB 4IRIA 1M1EB 1SD5A 1MNEA 2PG4A 1LVAA 4RGUA 3PFIA 4U7BA 2XF5A 1VF9A 2NVQJ 1SVMA 3FXQA 4JQFA 5IT9Z 4CCJA 3OYHA 2B0LA 2DA3A 3QODA 1SC7A 2OA4A 2M1BA 3F8MA 5LHGA 1W5SA 1Z7LA 2WADA 5GP9A 2EBIA 5H20A 3CMAI 2DA6A 3CCYA 4GDFA 4BJ6C 2X6YA 2J5OA 4G9YA 1ETQA 2Y0SN 5FKMA 4B4CA 5DDGA 2Z16A 1KONA 1ONVA 5E79C 2YPRA 2DYSH 3BTIA 2M4GA 2QEXI 3EPZA 1MH4A 3C2GA 2ELHA 3LA7A 3RIRA 3REOA 2IJLA 1D0XA 4OIPF 3S1RJ 1XMXA 4HDVA 1U5TB 3O6BB 4CCKA 2XROA 2HGCA 3A01A 4A2UA 3JAMZ 2CV0A 3HTSB 2IA2A 4KUMA 4ZZLA 1T8IA 4EQQA 3PJRA 1ZG1A 1LDJA 2R7FA 3H3UA 2M9HA 3OIQA 3GX4X 3G6EI 1G3YA 3CMMA 4LG3A 3V8JA 3ZCOA 3FHZA 1T2KA 2LF8A 1R4MB 4XLNF 4N0BA 2A3SA 1D3YA 1BC7C 3JREA 1YE9A 3RYRA 4OIOF 3HJEA 6PAXA 2FE3A 1LPQA 3I55I 2NNYA 1VZ0A 1XTAA 2COBA 3G3ZA 2BHYA 2ETHA 2XC7A 2BY2A 2K9QA 3GXOA 3DV8A 2M45A 1S9HA 1WVRA 3JRAA 4OIQF 1PDNC 1TWHJ 3BP8A 3IRQA 4A12A 2FRHA 2CFXA 1LQ1A 1W36D 4DQ2A 4KIGA 3MVPA 5AIPA 1G2HA 3FK7A 1UG0A 3BROA 2DA4A 4BKXA 4J19A 3BTCA 2VB6A 3GTGJ 2VQCA 2LLKA 2Q1ZB 1Z6RA 4NHJA 3DLAA 4C30A 2LH9A 2ZMEC 4LK0F 4NB5A 1Y56A 1I3QJ 3TO6A 4N9IA 4M9XA 3FMSA 5KHDA 5E17F 1HDPA 5J4YA 1S72I 3LSGA 1B9MA 5CYVA 4E7SA 5LBQA 2WB1A 4P5OA 3WU0A 2ZJPF 3OR2C 2X9DA 4BU2A 1W36C 2M0CA 4FQGA 1IO2A 3EQLF 3E6DA 2F2EA 2L4AA 1AA7A 1X1BA 1R5ID 4II3A 2MC4A 2M30A 1D8JA 2ECCA 1CGPA 4W97A 5E1WA 1BM9A 4HNUA 1OFCX 1T0FA 4U0YA 2H94A 3LSKA 1ODDA 3HOSA 1P92A 3GCMA 1MSFC 5EZGA 3IRRA 4EV0A 1JTYA 1IXSB 5EEGA 5ILUA 3KP5A 3BY6A 3BTLA 1ZTRA 1XSXA 1FYKA 4UY8I 3FX3A 2VPRA 1NH3A 4XQFA 3AFHA 4ZYGA 2VC0A 4AIDA 3PIPF 4MGRA 1L0OC 2RQQA 2CV2A 3M3YJ 1IRFA 2BY3A 3MEXA 3LA2A 3IKTA 3QPHA 3AL0B 2JVGA 3JW4A 1DP3A 4PDKA 3MKYB 4YIFA 1FOKA 4RDUA 1XMKA 4XN0A 1Z91A 5GPCA 2FU4A 1XSDA 4I99C 2CW0F 1HOMA 2V1NA 2JA7J 2CU7A 1TT5B 2DLLA 1XDSA 1X4OA 3FWEA 1ZGWA 5IPAA 3T8TA 2GM4A 5HNHA 1MH3A 2R5YB 2B7EA 4E4HA 2K27A 1K78A 3H36A 3S1MJ 4XLCA 4I2OA 4L9VA 3TKYA 3WTUC 4Y33A 2FMLA 3BG5A 4V2FA 3ZQIA 2O8KA 2EILH 2L4MA 2G7UA 3ZQQA 1G3WA 2EV6A 2KL4A 4P55A 2EZIA 1X2MA 1YYVA 2DN0A 3OIPA 2E1MB 3OYLA 3DTKA 1W5TA 1ZR2A 1SAUA 3ZGKA 3GFMA 4G6TB 4C9YA 5C44J 2IXSA 2EFPA 5K7HA 3TBIA 1ZRDA 1UHMA 2FNAA 1N77A 5LRSA 1R71A 2PBIA 3HZJA 1YW7A 5M3MJ 4BDZA 2L2OA 2MABA 3VWBA 1IDZA 5CJ9A 2GXGA 3V8KA 2HVSA 2CUZA 1KA8A 1BR4A 2F48A 4A3GJ 1G3SA 4UUSA 4RS8A 4HV6A 2QVOA 1D1BA 1R23A 1ENHA 4CYCB 1RI7A 3ISPA 4MNUA 4NDLA 5EEHA 1YG2A 4XICA 2F4IA 2EWNA 2PJRB 1UMQA 3BG6A 4HAMA 3OIOA 4LG0B 3WU1B 3EYYA 4E70A 3JTHA 2DA7A 1ZELA 1QQIA 1O4XA 3W6VA 2E36A 1RZ4A 2LREA 4BUPA 2CH0A 1J9IA 2UUZA 1LB2A 4ENKA 2A6TA 3A03A 2OUMA 5L3BA 1B8IA 3RQIA 5L3FA 1TQMA 3M1EA 2VLAA 4U7DA 4XORA 1LNWA 4AIJA 2E1NA 3LAJA 4ZZDA 2DTRA 2PMUA 1V5GA 4LK1F 1A6QA 3F6VA 3GZNB 5CVUA 1FYMA 4QTRA 2BHZA 4A3EJ 3K7AJ 4XOTA 3C18A 5IOYA 4F3QA 1S8NA 2P8TA 1S6LA 2DOFA 5E1ZB 3FKIJ 3S32A 1D5YA 3E6BA 3TDUC 4U0VA 1TWGJ 1B8IB 4EM0B 5FD6A 2O6GE 1OYIA 4BQQA 3C1DA 1RR8C 3FBIB 1MMSA 4Q5SF 1RKWA 1Z3XA 3WTZA 5LHIA 2RVCA 1QZZA 5IT3A 4IVNA 4QLCU 2W00A 1YX3A 2WB1N 1E2XA 3ZPLA 1K6YA 4G7ZF 2HR3A 2VBYA 3L2WA 1MD0A 2QGUA 1YS7A 5JFRA 3GLLA 5HS7A 4RB2C 1AU7A 2LF7A 1B4AA 4R79A 1QPMA 3ROUA 1FJLA 3NQOA 3HGGA 2CUFA 2P5KA 3TOAA 3OYAA 2LKSA 3P7NA 2BE5F 1OISA 1BC8C 5D5XB 1V54H 5FLMJ 4D0PA 2QENA 1V4RA 2RDPA 1RNLA 4IRHA 4XSXF 1DGWY 2PMZA 1BW6A 2VKVA 4O3MA 3NAUA 2OF7A 3OYNA 1PYVA 5EG0A 3U21A 2ZMEB 2ZXWH 3OSGA 3Q5FA 5FLXZ 3M8EA 3I58A 3MCZA 1IAWA 3M1CA 2HOAA 1A36A 3BZKA 4ZDOA 1BN5A 1R5GA 2Q0OA 1F5TA 1WSUA 2LR8A 1SAXA 3VSLA 4KFCA 1A5JA 4M72A 2DCEA 1EA3A 3MD2A 3MQ0A 2L7FP 5D6FA 5HDNA 2JQ7A 2OU2A 2DA2A 1HKSA 4BBRJ 3WTXC 2GA1A 2WBMA 3JRFA 3COAC 3RTRA 3ML6A 1QO0D 4HX8A 3S1QJ 1V3FA 5JR3A 2F5FA 4R8HA 3KX2A 3CTAA 1MJAA 2V1UA 3CC7I 4U0WA 2HZDA 4PJLA 3G2BA 1GV2A 2VI6A 3I5UA 4XN3A 1OCZH 2HI3A 1KQ0A 1LKXA 3MN2A 2QKMB 3ZQCA 1SFUA 5E8GA 4V19K 1KGSA 4E7JA 1Y0NA 2DT6A 2X1DA 3JRBA 2R3SA 2IA0A 3QPLA 3ZQLA 3D1NI 1DU0A 3BTJA 5FD5A 4IHSA 1MBFA 5BMZA 3S1NJ 2DK8A 3R60A 3ECOA 3H0GJ 4BHPA 2NOGA 1HBXG 3QAHA 4IL6C 2AO9A 4PUSA 3W2VA 1ZLKA 3Q9VA 3EYIA 2X1CA 2QQAA 2TRTA 4GO1A 3D5RC 2KZVA 2WY8Q 4JBAA 2LDUA 3U9GA 3RJPA 3HOXJ 4LB6B 1ETOA 4CCLA 2YR2A 1R22A 3CJQB 3Q9SA 3G1LA 3B02A 1D1AA 2Z9OA 1R58A 2R7WA 2TCTA 3CZ6A 5JLXA 4A3MJ 4TV7A 4NC7A 2HVQA 3KEYA 3HUGA 1Y8QB 4AC0A 4RBOA 2K02A 2GZWA 1RETA 5GPAA 5L3CA 4D1QA 5E3OA 2HFHA 3O2PE 1R7JA 2HXIA 4X6AJ 3DU5A 1T56A 2P5LC 4A3KJ 1V55H 1FBQA 3BG7A 5HS8A 5ED4A 3OYKA 4B1RA 3GBGA 4BJ5C 1BBYA 4CA0A 3PNTA 5D5UB 2KJBA 3WGHA 2DJIA 4XKBA 1ZK8A 5J4VA 2R7ZJ 4I98B 3CUOA 4LMYA 5A2QZ 2ZKZA 3S2HJ 1ZQ3P 4J01A 3IH2A 1ACIA 3WG9A 3VYRB 1FP1D 4A0ZA 2IBDA 1E17A 2DA5A 1FNNA 3L9FA 3HUGB 5EJCA 1AHDP 1FPQA 3VB2A 4U87A 2HVRA 3RKYA 1P7JA 5EGOA 2H8RA 2LK2A 3CQZJ 1TNTA 3DXJF 3AG1H 2VL8A 1KU2A 3K0LA 2YU3A 2VKEA 4C3JJ 2V1XA 2VJ5A 4GFBA 5E3NA 2GXBA 2XVCA 5FKNA 1BI2A 2DBBA 1PVEA 1EV7A 2HEOA 1FBUA 1XSVA 1FLIA 5BOXA 1A35A 2DW4A 3E6MA 4BE1A 2KDOA 2ZXIA 1JKOC 1BOAA 3KPHA 5J40A 3OL3A 1A6IA 3MZHA 3CDLA 1YI2I 4WXHA 2L9RA 5EGOB 4LFUA 4WWCA 1HQCA 4CGZA 3F3XA 1TW3A 3BCBA 2V9VA 4YFKF 3N05A 4BAYA 2UXNA 3CCSI 2V9PA 5IP7J 2Y69H 4GCVA 1DGRM 2O3FA 1VQPI 2W1OA 2WV1A 2P4WA 3MZ8A 5TGTA 2PMZN 2VE9A 2KRHA 2O03A 2DOAA 3E7LA 2NYXA 4KMUX 4GXOA 1O57A 1SMYF 5LEKA 2KDZA 4WCGA 5TRDA 1SD4A 4XKWA 4UNOA 4YELA 1IF1A 2DMQA 1O7FA 3GFLA 3PFYA 5JVGF 3KZYA 4E7ZA 4A3BJ 3ULQB 4OU0A 2HPIA 2YU9J 2JPCA 3L2UA 5H6QA 2EFWA 4IX7A 4A3JJ 1U6GA 2P7VB 1U3EM 2GBYA 5GTHC 4XLAA 5B3SH 2QLZA 2Y2ZA 3GWZA 5DV5A 2XGCA 3HOVJ 2W4SA 5M5YJ 3F23A 4CZZA 2CQQA 3HOYJ 1IV6A 3L1PA 4HA8A 3HOUJ 3DKWA 3FXKA 3U1KA 2HPMA 2QUFA 4RGSA 1SVOA 1J2XA 4A0YA 4EM1A 3W3CA 2OCCH 1IDYA 2P6TA 3JRGA 1LJ9A 5DUIA 2MLGA 2HYJA 3CMEI 4ON0A 5GAGJ 3DPTA 1SD7A 4CSWA 1OYWA 3E5UA 5EDNA 4IOCF 3WTYC 2HNHA 3MMYB 5DCMA 2IGOA 4D9JA 1D8KA 1NG7A 1D0ZA 1GVDA 2DQLA 2ZB9A 2JPBA 4NC6A 2BBYA 4XLEA 3BR0A 1QRYA 1XB4A 1HXDA 2OQRA 2MBFA 4LLGF 5AIQA 3FXLA 5IP6A 2HQ5A 3K2ZA 3EDPA 2D45A 3H92A 5F1RA 1MMAA 1UHSA 2KRFA 3H9GA 1VQLI 4C2UA 2QBYA 3SYTA 2DAOA 1R5HA 1BI1A 3MZYA 3SHFA 3HHHA 4RB1A 2LYCA 2JZYA 1N75A 2BYVE 1P9QC 2DI3A 2ICWG 3PQKA 3QOEA 4QWQA 4CH7A 1OCOH 2I8DA 1GLNA 4G8XA 5DEQA 3DPLC 2ZSIB 3OL4A 1TT0A 2VBWA 2XB0X 5DCMB 3KEQA 2JN6A 1YITI 5D8LB 1U9NA 4HDUA 3VPRA 2W85A 2UWMA 3OYBA 2HTSA 5K5RA 2W48A 2EFQA 4RB0A 3TGNA 2F5CA 2WC2A 2X1EA 5J1RA 3SFZA 1WRJA 1FEXA 4Y7NJ 3DTEA 1IXCA 3CUQA 4AVZA 3G71I 2RNJA 5JHUA 3UNGC 1O3SA 1UG2A 2A5YB 2BZTA 3LQQA 4MHGA 5C3EJ 3GO5A 4KNYA 1RRJA 3DP7A 2XGEA 3TW7A 1CF7A 3C7JA 3BJOA 3PSIA 1TWCJ 3DU6A 1I1SA 1Z1DA 4UHTA 3CD6I 2GQQA 1HW2A 4D7NA 4RGRA 3VFZA 3B6CA 2MW8A 2RAEA 5HLGA 1U8BA 1BL0A 3Q0WA 5KK1A 5LRRA 1H89C 1Z3YA 1Z0XA 3LSMA 2DMUA 4ABZA 3PO3J 2O8XA 3T1BA 2FA5A 4XNFA 2Z99A 3MKWB 2LBFA 3K10A 2OTLI 1CF7B 1S3JA 3WGGA 2FBHA 2WA0A 4DW6A 1PP8F 1ZR4A 1DPUA 3S16J 1MIJA 3E0JB 1IXRC 2YX4A 1EF4A 5E18F 3ZQ7A 3CDIA 3ABTA 1WJFA 4PJJA 1G8XA 1W0TA 4DYRA 2DOEA 3J7YJ 2AXLA 2R7RA 5LD2C 2NNNA 2LP0A 3RZOJ 4A3DJ 1LEBA 2DO7A 2HOTA 2LBFB 1DUXC 3J7ZI 2XAJA 4NBQA 3PNVA 4HF1A 4GYIA 2EZHA 5FROA 3L2RA 4IJAA 1WH5A 1C0WA 1FYLA 2RKHA 4L0YB 1X1DA 4I02A 5F08A 4IHVA 3HKZA 3A4CA 3BPXA 5FRMA 3K4LA 4LIUA 1MW7A 3GZ6A 1MGTA 3JRDA 1QBJA 4AM3A 2KKOA 2O0YA 5A2QK 5J1UA 2PI0A 2K3FA 4FE4A 1IUYA 1SEUA 3PNYA 3WG7H 2M3AA 1VQ4I 1ERDA 4XKVA 4JX6A 3Q3SA 1R00A 4A6EA 2BVMA 2Y9YA 1GDTA 2M2EA 1TWFJ 3KIOA 3A01B 2R4GA 4A5MA 3OY9A 4IOAF 3LWFA 2CW8A 4KT5C 3BR2A 2EINH 2OJED 3ECHA 1OCCH 4QSHA 3TW6A 2CQ7A 3H5NA 2KP6A 2NAZA 2DFIA 4FX4A 1ETXA 5J1YA 4BYYA 1Z6TA 4LIVA 4GYGA 3DPUA 1RR7A 2FOWA 3FM5A 4HV5A 4XRMA 5DUKA 3ONQA 5BQTA 1U2WA 2KHMA 3GVAA 2QYOA 2JA2A 5ILSA 3JRIA 4I0AA 4F91B 1HSTA 5FGMA 3K4CA 2L9SA 2VXDA 2FQ4A 2HKOA 4EJTA 1WHUA 2MYSA 1I50J 2E7XA 1K6OA 2Z1DA 1EJ9A 2HDWA 2X6WA 1TBXA 1VQ8I 4PGHA 3CCVI 3V7CA 1HCRA 5EF6A 1VQNI 1BR2A 1MBGA 4I09A 2R7SA 2F5VA 2D1VA 2H09A 3VOEA 3I53A 2WAFA 5AONA 3GZ5A 5FKKA 3H0DA 4XRSA 3BR1A 1UB9A 2VBXA 1VQMI 1FBSA 2P81A 4K2EA 1I5ZA 2KLOA 3FF5A 3V42A 3FKJA 3QQAA 2OCEA 3TL4X 2XSJC 3PQJA 1IV8A 1IN6A 2ADUA 3KEOA 4BY1J 1ZN2A 2GWRA 3RYPA 3OS0A 3QRFF 2A6EF 3W2AA 2LG4A 1NK2P 4L5IA 1W5CC 2E71A 1GV5A 4DIQA 4KA4A 2STWA 2B63J 1I3AA 4CCMA 1O3RA 2W7NA 4WXCA 2R0QC 4IZZA 4AIHA 3I4NJ 1W4MA 2NS8A 4HSRA 2OPTA 4UUTA 1MMNA 1V5EA 3BG3A 4V2GA 4ZC3A 4AIKA 1HF0A 2C6YA 3IHUA 3DKXA 4ENJA 1AKHA 1JE8A 4ZTJA 2Q8KA 5BNGA 2K86A 2M8GX 4ESFA 4BQOA 4DBQA 3IH3A 1H9TA 2DT7B 3VEPA 1WJDA 1B9NA 2M34A 3KP6A 1DU6A 1VQKI 3LAPA 1U78A 1IRXA 2XAGA 5D5WB 4IF4A 4N4NB 1ETKA 1R6RA 3P9IA 2EPFA 1I1GA 3ZN0A 3MWMA 3OV8A 5IY5H 2K9SA 3CC4I 2L0KA 2W82A 1LFPA 2IS2A 4LLLA 3ZQHA 5F1JA 1W7PD 3ZR8X 3S2DJ 2QF7A 2ZC2A 1G4DA 4IHWA 2CUEA 4BHBA 1K78B 2QSGX 2X48A 5HLTA 2NS7A 2V4JC 3L7WA 5D4RA 2P5VA 3I59A 4ETSA 2VT2A 2VXZA 2V79A 3HSFA 4KN7X 2BW3A 2UZKA 1H9GA 1V5FA 3ZP5A 1ZG5A 1Y39A 4FISA 4IHTA 1GXQA 3I9V2 3BJAA 1X19A 2Z3YA 2L54A 4ZYAA 2HOSA 4ITVA 2KISA 2GAUA 1ZAOA 4PSWA 3D0SA 2RNGA 4XBFA 1DDNA 1D0YA 1Z67A 3KETA 2JVHA 4CO8A 2MFZA 2CW7A 3I59B 3BR3A 3HKZN 4WF2A 2IGMA 3OS2A 2EIJH 1H8AC 3H3ZA 3O8HA 1R4NB 2VJ4A 1LUJB 2ID3A 2YX7A 2Y48A 5M5WJ 4D5FA 3FM3A 4PSXA 2FD5A 4UUSB 3BPVA 4PJMA 4M74A 4HLXA 1HA8A 3W6JB 1G6NA 5FFXA 3F8FA 1YTYA 2VQGA 3CCRI 1T95A 2M8EA 3FHNA 4HF0A 2QA4I 2E1CA 3DLLF 3PUFA 1J75A 3H3VK 5J47A 4W1UA 3IWFA 2FEZA 3F0CA 1RESA 2MH9A 3H9QA 4OIRF 3E5XA 4RAFA 4CCOA 5DD4A 4BBSJ 2A61A 2QWWA 3RKQA 2WY7Q 3IWZA 3CO6C 1IGNA 3E5QA 2ZNYA 2DFEA 1UZCA 3MAJA 1DQUA 4FETA 3JSPA 2ISZA 1FY7A 2JT1A 1SVLA 2JUGA 3K2AA 1USSA 3QOPA 4BXUA 3WE3A 3C2HA 1QHHD 2XKOA 2Y30A 2JA6J 4HX4A 4ZDLA 3T0YA 4LD5A 2CMPA 3HGYA 2WAQA 1XGOA 3S8PA 1IJWC 1QZYA 2ZXJA 1E3PA 3CJTB 4UVBA 2JRTA 4CCNA 2XRLA 3OYJA 3ZMTA 2W57A 4S04A 2XF7A 2M5WA 2XIGA 1VI0A 3HRMA 1OCRH 2MGQA 2HKXA 2CS3A 3ZRGA 3BC8A 1FOWA 1OCPA 2GOMA 3LSHA 1H88C 4UUVA 2JA5J 4M3GA 2FJ1A 2V26A 1U9OA 1STZA 1LDKB 4PGGA 3LSPA 1YJWI 3HSEA 5FB2A 1IC8A 2IRFG 4EGZA 1XDUA 4L9JA 4G6QA 4C2TA 4I76A 1SMTA 1TP4A 3S2WA 3A0HC 3K4BA 4UV9A 1QPIA 3VYUB 3SDGA 5GAHJ 4XSZF 4G7OF 1IZ1A 2ME0A 2ZO4A 5KAIC 2FOKA 4EVIA 1VFCA 1B1BA 2XGDA 2E7WA 2YSRA 3BZ6A 3GTQJ 1EKEA 4A3CJ 1FTZA 3SZPA 2R7TA 1E3HA 5HODA 3LMMA 1ZRFA 4HNVA 5ICEA 2RGVA 5BS6A 2V9KA 1WGXA 1FSEA 3J7AO 3BT9A 1WKMA 1VQ9I 3SXYA 3EUAA 2DMTA 2IEKA 1BJAA 5EG0B 2PJPA 3GTKJ 5B5EC 1IN4A 4BE0A 1PUFA 1O3TA 3ZN1A 3KE2A 1JKQC 2FUG2 4MTEA 5TJJA 1JT0A 1HSJA 5KNLA 1Y6IA 5LLQA 1GT0C 3F8CA 3KP4A 4B47A 1JJ6C 4OMYA 2VUMJ 3BJ6A 2DA1A 2K3PA 3JRHA 1OMIA 3R0JA 4EEFG 4FHTA 2ELKA 2WTEA 2OC6A 1ITYA 3ASNH 4D7MA 2FBKA 3HDDA 5H2FC 4HQMA 1SFOJ 3KCCA 2NVUB 5FKLA 2WWYA 1PUFB 3FXRA 2TDXA 3HPHA 3M7GA 2ZBKA 3RPUD 5E3LA 1RIOH 2XHKA 4E7IA 1JUMA 2H1LA 4DZPA 3CP8A 2MD5A 1BI3A 2K7LA 2MA3A 3IP4B 1JUSA 4E7KA 4ENMA 3CUQC 2O61A 2VQLA 2GIZA 3EUKL 3ZOBA 2I5UA 5E3MA 1U0JA 1TQIA 2HXOA 4M9SA 3ZQFA 2E2JJ 3BG9A 3PM1A 4UB6C 3I4MJ 1P4WA 3ERED 5D5VB 1YO5C 2ZSHB 4BNCA 3C3WA 4MO7A 5B66C 1XMAA 3CDHA 4C3HJ 2R7XA 3FXOA 2CQXA 4II2A 4CICA 5DS9A 4Q4ZF 1WQ2A 4H0EA 2LVSA 3NARA 3DBLB 2CFOA 3AG2H 1PP7U 1W7PA 2VIXA 1Y8RB 2CWEA 2IS4A 4Y17A 1HKQA 3S93A 4B09A 3TQNA 4BEHA 2QSFX 2GLOA 2EZLA 3I56I 3BLYA 4A5NA 2XKPA 2ZXHA 1GVJA 3D5SC 3IKVA 4DNCA 3JTGA 1ZGJA 2O5RA 3DCFA 4JYKA 1IUFA 2RV8A 4PJNA 1WJAA 3RCOA 4ZDPA 4DBRA 1W1WE 1JKRC 1RUOA 2MD0A 5L3DA 3FXUA 2BGCA 4U88A 3R6SA 1B72A 1YLFA 2WAEA 2OD5A 5M3FJ 4A93J 1E3OC 1QU3A 4RB3C 2ESNA 1NTCA 2YUSA 1U5TC 5D6EA 1MZBA 1TW2A 2KRCA 4S05A 2BXZA 3LL7A 2LY1A 4WK8F 4CXFA 2B9SA 2HYFA 4HQEA 1YIJI 5J8CA 1WI3A 1WH7A 1WJEA 4MTDA 3WTSC 2L9VA 1KU9A 1FTTA 4IHYA 3O3KA 1B72B 3WHCA 2ZFUA 1T6SA 2HTJA 2ESHA 2K4BA 2AHQA 2DYRH 1A04A 4XR6A 4B3AA 1ETYA 1XN7A 5F0HA 5TISC 1WJCA 4F92B 1K79A 3F6OA 2D5VA 2A68F 1Z7UA 4FX0A 4KYWA 4XL9A 2UXXA 4MEXF 5ICFA 3OYFA 1B59A 4RMNA 2EV5A 2PLYA 1POGA 1FIAA 3RKWA 3QU6A 1GXPA 1WJBA 5DCFA 2VKHA 3B73A 2IPQX 3Q0UA 5HS9A 3V7SA 1XC5A 2LY2A 4EJOA 5H6RA 2JK3A 1YIOA 2ELJA 4M6YA 3T8RA 2Z2SB 2PFBA 4B8XA 2XPUA 1BI0A 2K9MA 4BXFA 1R1UA 3CLOA 3GTOJ 3CF2A 3DFGA 3LSIA 3MFKA 1LEAA 3SEQA 4A3FJ 2X6XA 2BVLA 4Y13A 1AWCA 3ABMH 4BQAA 4O5VA 5LGUA 3KP3A 5IP9J 3TEDA 3S3OA 3G73A 1X3WB 1WZ2A 3TP0A 2Q2EA 3F22A 2IGKA 2M87A 4LJZF 1WWXA 1NHAA 2L7MP 3BQYA 1MJ9A 3TOBA 3VODA 3HHGA 5D8KB 2M4KA 1ON1A 3KLNA 3IAS2 3RDIA 4NNJA 1EH6A 4RM2A 1XGMA 4EM2A 2CGPA 2R92J 1TWAJ 2DPUA 4HW0A 2M7AA 1R1TA 1J5YA 2X0LA 3LFKA 2E2HJ 2ISYA 3KZZA 5CQEA 1QHGA 1JHFA 3GW2A 3FMRA 3K4MA 1FP2A 3A1YA 4NQWA 2STTA 2H6BA 2Q2EB 2Y31A 3FXJA 4PFOA 4A3IJ 4LOCA 2G9WA 3CCLI 4ZH4F 3A0BC 2A07F 2V7FA 1JI8A 4KT6A 2DPDA 2VKDA 4ZYDA 2VODA 4I7HA 1MNDA 3U2RA 3CLQA 5K7ZA 5CKTA 2EZKA 2DMNA 1I27A 3DEEA 1BJZA 2K40A 4N9HA 2D1HA 2NS0A 4P1WA 5JHFA 4MFDA 1KU3A 2CYYA 3TO7A 4ESBA 2YS9A 1ZH5A 3HEFA 2QBYB 4XM3A 4HEA2 1MSEC 3LOCA 2ZJRF 1YRNA 5K5QA 3NEUA 2R93J 5LHHA 4IHXA 5BPIA 1BOBA 1ETVA 2EJRA 2F4OB 5DM6F 2ME6A 2DT5A 3W2WA 1XCVA 3CESA 4KICA 4ESJA 4LB5A 3HOZJ 3OMYA 3OYEA 1JXSA 3RPUA 2LD5A 4BE2A 1WJ5A 3DF8A 1ZRCA 3BDDA 2HQAA 3K70D 3L00A 4JOMA 2BEOA 3TP3A 3CUQB 2EV0A 1EH8A 2DMPA 1YRNB 3SFIA 2XDVA 5J8FA 3TDZC 1LDDA 3DTIA 3DWLE 3FBNB 3M9AA 1OYYA 1FC3A 3WGIA 2L01A 1TL8A 3QYBA 1GHCA 4OAYA 4I0BA 4RM3A 1REPC 1NK3P 2CRGA 2RC4A 2EB7A 1JUPA 2X6OA 3NWTA 4Q47A 4C2MJ 1AOYA 2DQRA 5CQGA 1P2FA 4PCQA 3K70C 2VE8A 4RAGA 5KCMA 2JMWA 2L9NA 2V1DA 1K7AA 1KQ8A 2KPMA 3L2CA 3I54A 1FIPA 2VJJA 4BH9A 5L3GA 2AS5F 1U5TA 5ICGA 4DZJA 1XGNA 5F6FA 2KIQA 2GIVA 3ZMSA 4EJVA 4YFXF 5M5XJ 3FIWA 3WTWC 9ANTA 4AUXA 4HBLA 1K4SA 4L5JA 1WPKA 2PMHA 4RAYA 3MKZA 3CCJI 2EFNA 2K85A 3GLXA 3CCEI 1JGGA 3K6GA 2IGNA 1QGPA 4G12A 5K7FA 1R9TJ 3HPGA 2EA2A 2E5ZA 1J7KA 4GGGA 3M8JA 1EH7A 5K5OA 2FBIA 1F36A 1E0EA 1MBKA 2HDCA 4A0XA 2E19A 4UB8C 1ETWA 4EMSA 2VBZA 2F5EA 1Y1WJ 2AQEA 2LNBA 2Z33A 1X2NA 2DU9A 3Q0VA 1X1AA 4PK4A 2KIMA 3R4KA 3J80K 1J09A 3GTMJ 3QP6A 4A6DA 2R7DA 3I71A 4JP0A 2V6CA 1VQ7I 1YX5A 3IC7A 2F6CA 4HF2A 3ZMZA 3ABUA 1PJRA 3SEZA 2FMYA 4HX7A 2BY1A 3NRVA 1QVTA 1FZPB 3HOWJ 2K9NA 2EQRA 2OQGA 2ZJ2A 3MKLA 4XOPA 4LGWA 4MQ9F 4L0ZB 3HRTA 5HLIA 4B48A 4M71A 4BS9A 2XAUA 4KJZA 3V8LA 2KJCA 2JJ7A 4P96A 3O8GA 3N4MA 2EIKH 2EH3A 3WU2C 1RC9A 2D2WA 4HRIA 2OBPA 3GEZA 4YFNF 2M0MA 3L09A 3KFWX 3OS1A 1O3QA 3CCUI 5DYMA 3K69A 4DYCA 1ZG3A 2VQHA 1IRZA 1KYWA 2GOXB 4I01A 2VC1A 3NWSA 2X4HA 2NVYJ 4XIDA 3HRUA 2XAQA 3ZMVA 1OPCA 3LA3A 5KVRA 2E60A 3D5LA 3LSJA 2XGXA 5D4SA 3S3MA 1Q1HA 4H4KC 1BIAA 2NOJB 3BCAA 3DBRB 4XRFA 2DODA 2NRAC 4IXAA 2A5WA 2QZ8A 3A2KA 2E34A 4JK1X 2JUCA 3AKZA 3HL2A 2R7VA 4FCYA 1OQYA 1LVKA 2H27A 2XSDC 2BV6A 2EA4A 5B1AH 4BL0B 4M73A 2R5YA 5IYDJ 1XD7A 1MJBA 2K5CA 1FT9A 1J59A 2E1OA 2HDDA 2OAZA 3K9TA 4BXXJ 4JX4A 1YW8A 3KP2A 2L5QA 4XKCA 3F9KA 1T38A 5DTDA 3P5JA 4G7HF 3GTJJ 1YOVB 3V4GA 1TNSA 4M3DA 2P6SA 1R1VA 2COMA 4NUBA 4AYBA 3GMEA 4C3IJ 2E2IJ 1AKHB 3H35A 2VONA 3IV5A 4CHUA 4XLHA 2N8GA 4JX5A 2H6CA 4EATA 5JI6A 1QA6A 3HOTA 4Y15A 3GUDA 5F04A 3CP2A 2H1KA 3KYCB 1TC3C 3IH4A 3AG3H 3DEUA 4Z6YA 1X3ZB 3EUHA 3LFUA 4HG2A 5HDKA 3KYLA 2LSOA 3L2VA 1A31A 2CG4A 4EGYA 2IS6A 3BR5A 3K4KA 2CO5A 4YG2F 4CYCA 3EETA 3AG4H 1I39A 5CLSA 1SFXA 1FWZA 2XASA 1K4TA 2PJRA 1T98A 2GXAA 3KP7A 3GYHX 4LG0A 3QPSA 4LLNA 3M07A 5FRNA 1TZLA 2OZ6A 1SANA 4CDGA 4RLQA 3OSFA 3VDXA 2HQNA 4HPQA 3OOUA 2BW3B 2LMDA 4IEJA 1OJLA 3V7RA 4Q48A 2HOEA 4M6XA 2MLKA 3DEWA 3IL2A 4E7HA 4KMFA 4MQVA 4WXDA 3KYDB 2R5ZA 2UV1A 1G59A 2CQNA 2DDAA 4XLFA 4RAZA 3CO7C 5FKOA 1DPRA 5DM7F 1OCTC 3L2QA 1YS6A 3ESWB 4RLFA 1XGSA 1ZREA 3H9JA 1B6AA 2K4JA 4M6VA 3E6CC 2DFHA 2ECBA 3H5RA 2LKXA 2ZFWA 2XV4S 4BDYA 4I6ZA 2PN6A 3VSKA 3BQZA 1HC8A 4F7ZA 1D5VA 5HDGA 3SZTA 3VYTB 4F52A 3CF5F 5LGNA 3WTVC 2KIUA 4IKFA 4E7LA 1FMVA 5IT9K 4AVPA 1RPWA 2CUJA 5B1BH 2R5ZB 1OLTA 3R0AA 4QPOA 3QP5A 3OYDA 2ID6A 1KU7A 1R36A 2KIFA 1S7OA 2LFBA 3FK6A 3HTUA 3TO9A 5JVTA 1CQTA 2KZGA 2OTJI 3PO2J 1YJ9I 3J81Z 2FSWA 1XX5A 4M3FA 5CVVA 1F9NA 2BOLA 2OZUA 1S5LC 1JKPC 1HW5A 2XPVA 4ZTFA 3FISA 5LFAA 2JTVA 2JSCA 3PSFA 3OYCA 3QYEA 3T5XA 3PL8A 3UR3C 3S15J 2JSPA 2ZCWA 5FFZA 1ZGAA 3M8FA 1DP7P 4LITA 4BY7J 4B44A 3LSRA 2W24A 3H5AA 2ACJA 5JLWA 2HQRA 1TTYA 3I3LA 5FLVA 3PUBA 3FZVA 3SDBA 2JWTA 2EK5A 3CJNA 3JAMK 1R49A 4HOBA 1I6XA 1UAAA 2ZMEA 1WFXA 3JRCA 3DQVC 4B3XA 3QWLA 1UFMA 3ASOH 3IUOA 4O6JA 1QZEA 4PFPA 2G7HA 4UV8A 1S7EA 1YQAA 1HLVA 1MBJA 2HYGD 1WCMJ 4DOZA 1HKTA 1FSHA 1I6HJ 4FTHA 4MLOA 4OOIA 1P4XA 1S29A 3HSRA 4XMYA 4DJAA 3RPQA 1VNDA 1ON2A 1T08B 2KT0A 2VASA 3G1MA 5CVJA 2IT0A 2Y75A 5EEAA 2RREA 2A69F 2FNPA 4MFEA 3W6KB 3R61A 5K1YA 2QCOA 3G4SI 3KLOA 4XK4A 2LRDA 4A69C 5ILVA 1VQ6I 1HDDC 3K1PA 1PUEE 1U8RA 3M4OJ 2G0EA 3HB9A 3GFJA 4L18B 4MEYF 1H0MA 4IPAA 5CVIA 1MDMA 2K9LA 3CC2I 4BHCA 3JSOA 3S3NA 3HBLA 4FE7A 3I0TA 4AYBN 2NXNB 3BOQA 4KIFA 5IYBJ 3OR1C 1BR1A 2BXYA 3CCMI 2EIMH 4YIRX 3GFIA 4UVAA 2P7CB 1HW1A 1TQPA 4OWRB 2PX9A 2Y9ZA 3K1MA 2FXAA 4L9TA 3ABLH 4UVCA 4KIBA 2J5PA 1YJNI 1ZYRF 1MDMB 2LTPA 5CPRB 3CCQI 4BACA 1S7AA 3GF2A 2I10A 4ANJA 1USTA 3FDYA 4DGWB 3AAFA 4ZYEA 2X51A 2VOOA 1J0RA 3P9CA 4M3BA 1YW9A 3HYIA 5KAFC 4PZJA 4NC8A 1MKMA 2RN7A 2PQ8A 1FOYA 2CJJA 1VQ5I 3ZMUA 1X4PA 2W25A 3UKGA 2MSYA 4B43A 4Y52J 3E97A 4D5CA 3P9KA 1LE8A 1Q1VA 3ELKA 3E1SA 3LSTA 2BY0A 1VQOI 3BWGA 5BPDA 1T39A 2R7UA 3WE2A 1OR7C 2VPLA 2DDBA 2L02A 3I4PA 2RQPA 3WTTC 1XG1A
chains in the Genus database with same CATH topology
3OOPA 2WV0A 4CYDA 3LQRA 2FQ3A 1BIBA 5J6XA 5L3EA 1IN7A 1W7PB 5E1XA 2HS5A 4G6DA 5ERIA 3I64A 3J80Z 1IN8A 3QPTA 4M9ZA 1KYZA 4WX9A 4OINF 1FX7A 1RUNA 4RGXA 2L3DA 1F1ZA 4IRGA 3F8NA 4ENNA 1Z9CA 3FMQA 1L3LA 4HYEA 3WODF 3N97A 5HLHA 2A6HF 1VTNC 2HWVA 3HIFA 1G3TA 2IVMA 2PEXA 3ZMDA 2IA1A 3U1DA 1UCRA 3HRSA 4HZFA 1ZARA 1WI9A 2XAHA 2FF4A 3RI4A 5HVQC 5E8IA 2LKPA 1JGSA 4AD9A 1O7LA 1IRGA 3RKXA 2Y0MA 2XAFA 3J81K 4HLYA 2IP2A 1UHWA 2CSOA 2QQBA 1P6RA 2MH2A 1F4KA 1TLHB 5LGTA 1YFHA 5DD8A 5FO5A 1ZHFA 1KQ9A 2XUBA 1SFEA 3F72A 1JHHA 5LEJA 4EJWA 2QQ9A 2Z5UA 1P4AA 2EFOA 2W84A 4G94A 4XLPF 4Z2YA 1QNTA 4ZYHA 4P9UA 4R1HA 2ZNZA 2GA2A 1IW7F 2DK5A 1XCBA 1IN5A 2VN2A 2MC3A 3F8BA 4UXNA 1ZLJA 5HOOA 2VT3A 3K1NA 5FLXK 2VOPA 4OMZA 4YIIA 2IW5A 5E20A 3F21A 4L9NA 2QM3A 5F64A 4ASNA 5ICCA 1OKRA 4KDPA 1Z05A 3QU3A 2F5DA 4KN4X 3SQNA 1SD6A 1OR7A 2XRNA 1Y0UA 1ULYA 2CQKA 4P9FA 3E3VA 1X3UA 5CVRA 4EJUA 4AWXB 4FT8A 2HZTA 4IRIA 1SD5A 2PG4A 1LVAA 4RGUA 3PFIA 4U7BA 3FXQA 4JQFA 5IT9Z 2B0LA 2OA4A 2M1BA 3F8MA 5LHGA 1W5SA 5H20A 2J5OA 4G9YA 5DDGA 1ONVA 2YPRA 3LA7A 2ELHA 3RIRA 3REOA 2IJLA 4OIPF 4HDVA 1U5TB 3O6BB 2HGCA 4A2UA 3JAMZ 3HTSB 2IA2A 4KUMA 4ZZLA 4EQQA 1ZG1A 1LDJA 2R7FA 3H3UA 3GX4X 1G3YA 3V8JA 3FHZA 1T2KA 2LF8A 4XLNF 4N0BA 2A3SA 1D3YA 1BC7C 3RYRA 4OIOF 6PAXA 2FE3A 2NNYA 3G3ZA 2ETHA 3GXOA 3DV8A 2M45A 4OIQF 1PDNC 3BP8A 3IRQA 4A12A 2FRHA 2CFXA 1LQ1A 4DQ2A 4KIGA 5AIPA 3BROA 1Z6RA 4NHJA 4LK0F 4NB5A 3TO6A 4N9IA 4M9XA 3FMSA 5E17F 5CYVA 1B9MA 5LBQA 4P5OA 3WU0A 3EQLF 3E6DA 2F2EA 2L4AA 2M30A 1D8JA 1CGPA 5E1WA 4U0YA 1BM9A 1T0FA 2H94A 1ODDA 3HOSA 1P92A 3IRRA 4EV0A 1IXSB 5EEGA 5ILUA 3KP5A 3BY6A 1XSXA 1FYKA 3FX3A 4ZYGA 2VC0A 4MGRA 1L0OC 1IRFA 3MEXA 3LA2A 3IKTA 3QPHA 3JW4A 4PDKA 4YIFA 1FOKA 1XMKA 1Z91A 2FU4A 1XSDA 2CW0F 2DLLA 1XDSA 3FWEA 3T8TA 2K27A 1K78A 4I2OA 4L9VA 3TKYA 3WTUC 2FMLA 2L4MA 2G7UA 2EV6A 1G3WA 4P55A 1YYVA 1W5TA 3GFMA 2EFPA 1ZRDA 1UHMA 2FNAA 5LRSA 2PBIA 1YW7A 5CJ9A 2GXGA 3V8KA 1KA8A 1G3SA 4RS8A 4HV6A 2QVOA 1R23A 1RI7A 3ISPA 4MNUA 5EEHA 1YG2A 2EWNA 4HAMA 4LG0B 3WU1B 3EYYA 4E70A 3JTHA 1QQIA 1RZ4A 1J9IA 1LB2A 4ENKA 5L3BA 5L3FA 1TQMA 3M1EA 4U7DA 4AIJA 1LNWA 2E1NA 3LAJA 4ZZDA 2DTRA 2PMUA 4LK1F 3F6VA 5CVUA 1FYMA 3C18A 1S8NA 2P8TA 1S6LA 5E1ZB 3E6BA 3TDUC 4U0VA 4EM0B 5FD6A 2O6GE 1OYIA 3C1DA 4Q5SF 3WTZA 5LHIA 2RVCA 1QZZA 5IT3A 4IVNA 4QLCU 1E2XA 3ZPLA 4G7ZF 2HR3A 2VBYA 1MD0A 1YS7A 5JFRA 5HS7A 4RB2C 2LF7A 1B4AA 4R79A 1QPMA 3ROUA 3NQOA 2P5KA 3TOAA 3P7NA 2BE5F 1BC8C 5D5XB 4D0PA 2QENA 1V4RA 2RDPA 1RNLA 4IRHA 4XSXF 4O3MA 2ZMEB 3Q5FA 5FLXZ 3M8EA 3I58A 3MCZA 1IAWA 1BN5A 1R5GA 2Q0OA 1F5TA 1WSUA 1SAXA 4KFCA 4M72A 3MQ0A 5D6FA 5HDNA 2OU2A 1HKSA 3WTXC 2GA1A 3COAC 3RTRA 3ML6A 1QO0D 4HX8A 1V3FA 5JR3A 2F5FA 4R8HA 3CTAA 1MJAA 2V1UA 4U0WA 3I5UA 1KQ0A 1SFUA 5E8GA 1KGSA 2R3SA 2IA0A 4IHSA 5FD5A 5BMZA 2DK8A 3R60A 3ECOA 4BHPA 1HBXG 3QAHA 1ZLKA 3Q9VA 3EYIA 2QQAA 4GO1A 4JBAA 3U9GA 2LDUA 3RJPA 4LB6B 2YR2A 1R22A 3Q9SA 3B02A 2Z9OA 1R58A 4TV7A 3HUGA 2K02A 2GZWA 5L3CA 2HFHA 3O2PE 1R7JA 2P5LC 1FBQA 5HS8A 5ED4A 1BBYA 5D5UB 2KJBA 3WGHA 4I98B 3CUOA 4LMYA 5A2QZ 2ZKZA 3WG9A 4A0ZA 1FP1D 1E17A 1FNNA 3L9FA 1FPQA 3VB2A 3RKYA 1TNTA 3DXJF 1KU2A 3K0LA 2YU3A 2V1XA 2GXBA 2XVCA 1BI2A 2DBBA 1EV7A 2HEOA 1FBUA 1XSVA 1FLIA 5BOXA 2DW4A 3E6MA 1BOAA 3MZHA 4WXHA 4LFUA 4WWCA 1HQCA 4CGZA 3F3XA 1TW3A 2V9VA 4YFKF 4BAYA 2UXNA 4GCVA 2O3FA 2P4WA 2VE9A 2O03A 2NYXA 4KMUX 4GXOA 1O57A 1SMYF 5LEKA 4WCGA 5TRDA 1SD4A 4UNOA 1O7FA 3GFLA 3KZYA 3ULQB 4OU0A 2JPCA 5H6QA 2EFWA 1U6GA 2P7VB 1U3EM 2QLZA 3GWZA 5DV5A 3F23A 4CZZA 4HA8A 3DKWA 2QUFA 4RGSA 1J2XA 4A0YA 4EM1A 2P6TA 1LJ9A 5DUIA 2MLGA 4ON0A 3DPTA 1SD7A 1OYWA 3E5UA 3WTYC 5DCMA 1D8KA 2DQLA 2JPBA 2BBYA 2XROA 5AIQA 1XB4A 2OQRA 1HXDA 4LLGF 2MBFA 3K2ZA 3EDPA 2D45A 3H92A 5F1RA 2KRFA 2QBYA 2DAOA 1R5HA 1BI1A 3MZYA 3SHFA 3HHHA 4RB1A 2JZYA 2BYVE 2DI3A 3PQKA 4QWQA 5DEQA 4G8XA 3DPLC 5DCMB 2VBWA 3KEQA 5D8LB 4HDUA 2UWMA 2W85A 2HTSA 5K5RA 2EFQA 4RB0A 3TGNA 2F5CA 2WC2A 3SFZA 1WRJA 1IXCA 3CUQA 2RNJA 5JHUA 1O3SA 2A5YB 4MHGA 3LQQA 4KNYA 3GO5A 3DP7A 1CF7A 3C7JA 3BJOA 1I1SA 1Z1DA 4UHTA 2GQQA 1HW2A 4RGRA 3VFZA 5HLGA 5KK1A 5LRRA 2O8XA 3T1BA 2FA5A 2Z99A 1CF7B 1S3JA 3WGGA 2FBHA 1PP8F 1DPUA 1IXRC 2YX4A 5E18F 3ZQ7A 3ABTA 2AXLA 2NNNA 1LEBA 2DO7A 1DUXC 2XAJA 4HF1A 4GYIA 4IJAA 1C0WA 1FYLA 2RKHA 4L0YB 4I02A 3BPXA 3GZ6A 1MGTA 1QBJA 2KKOA 2O0YA 5A2QK 2PI0A 1IUYA 4A6EA 1R00A 4A5MA 3LWFA 4KT5C 3ECHA 2NAZA 2DFIA 4FX4A 4BYYA 1Z6TA 4GYGA 4HV5A 3FM5A 5DUKA 5BQTA 1U2WA 3GVAA 2QYOA 5ILSA 4I0AA 1HSTA 5FGMA 2HKOA 4EJTA 2E7XA 1K6OA 1TBXA 4PGHA 3V7CA 4I09A 2H09A 2D1VA 3VOEA 3I53A 5AONA 3GZ5A 1UB9A 2VBXA 1FBSA 4K2EA 1I5ZA 3FF5A 3PQJA 1IN6A 2ADUA 3KEOA 1ZN2A 2GWRA 3RYPA 3QRFF 2A6EF 4L5IA 4KA4A 2STWA 1O3RA 4WXCA 4AIHA 1W4MA 4AIKA 2C6YA 3IHUA 4ENJA 1JE8A 2Q8KA 2K86A 4ESFA 1H9TA 3VEPA 1B9NA 3KP6A 3LAPA 1U78A 2XAGA 5D5WB 4IF4A 3P9IA 1I1GA 3ZN0A 3MWMA 3OV8A 4LLLA 1W7PD 1G4DA 4BHBA 1K78B 3L7WA 5D4RA 2P5VA 3I59A 4ETSA 2VT2A 2VXZA 2V79A 3HSFA 4KN7X 2UZKA 1H9GA 3ZP5A 1ZG5A 4IHTA 1GXQA 3BJAA 2Z3YA 2L54A 2GAUA 1ZAOA 3D0SA 4XBFA 1DDNA 3KETA 4CO8A 3I59B 4WF2A 3H3ZA 2YX7A 2Y48A 3FM3A 3BPVA 4M74A 4HLXA 3W6JB 1G6NA 5FFXA 3F8FA 1YTYA 2M8EA 4HF0A 2E1CA 1J75A 3IWFA 2FEZA 2MH9A 4OIRF 3E5XA 5DD4A 2A61A 2QWWA 3IWZA 3CO6C 3E5QA 2ZNYA 3MAJA 3JSPA 2ISZA 1FY7A 2JT1A 1USSA 3QOPA 4BXUA 3WE3A 2XKOA 4HX4A 3T0YA 4LD5A 1XGOA 1QZYA 2ZXJA 4UVBA 2JRTA 3ZMTA 2W57A 4S04A 2M5WA 2XIGA 3HRMA 2HKXA 4UUVA 1STZA 1LDKB 4PGGA 3HSEA 5FB2A 2IRFG 4EGZA 1XDUA 4L9JA 4G6QA 1SMTA 3S2WA 4UV9A 4G7OF 4XSZF 1IZ1A 2ZO4A 2FOKA 4EVIA 1B1BA 2E7WA 2YSRA 3BZ6A 3SZPA 1ZRFA 5ICEA 2RGVA 5BS6A 1FSEA 3J7AO 1WKMA 3SXYA 1BJAA 2PJPA 1IN4A 1O3TA 3ZN1A 3KE2A 4MTEA 5TJJA 1HSJA 5LLQA 4OMYA 3F8CA 3KP4A 3BJ6A 1OMIA 3R0JA 4FHTA 2WTEA 2FBKA 4HQMA 3KCCA 2WWYA 3FXRA 2TDXA 3M7GA 2ZBKA 1RIOH 2XHKA 2MD5A 1BI3A 2K7LA 2MA3A 4ENMA 2O61A 3CUQC 1TQIA 4M9SA 1P4WA 3ERED 5D5VB 1YO5C 4BNCA 3C3WA 1XMAA 3CDHA 4CICA 4Q4ZF 1WQ2A 4H0EA 1PP7U 1W7PA 2CWEA 4Y17A 1HKQA 4B09A 3TQNA 4A5NA 2XKPA 1GVJA 3IKVA 4DNCA 3JTGA 1ZGJA 2RV8A 1RUOA 5L3DA 3R6SA 3FXUA 2BGCA 4U88A 1YLFA 2OD5A 4RB3C 2ESNA 1U5TC 5D6EA 1MZBA 1TW2A 4S05A 4WK8F 4CXFA 2HYFA 4HQEA 5J8CA 4MTDA 3WTSC 1KU9A 3O3KA 1T6SA 2HTJA 2ESHA 2K4BA 1A04A 1XN7A 1K79A 3F6OA 2A68F 1Z7UA 4FX0A 4KYWA 4MEXF 2UXXA 5ICFA 1B59A 2EV5A 2PLYA 3RKWA 3QU6A 1GXPA 5DCFA 3B73A 2IPQX 5HS9A 3V7SA 4EJOA 5H6RA 1YIOA 3T8RA 4M6YA 2PFBA 4B8XA 1BI0A 1R1UA 3CLOA 3DFGA 3MFKA 1LEAA 4Y13A 1AWCA 4BQAA 4O5VA 5LGUA 3KP3A 3G73A 2Q2EA 3F22A 2M87A 4LJZF 1WWXA 1NHAA 1MJ9A 3TOBA 3VODA 3HHGA 5D8KB 1ON1A 3KLNA 3RDIA 4EM2A 1EH6A 2CGPA 1XGMA 2DPUA 4HW0A 1R1TA 1J5YA 2X0LA 3LFKA 2ISYA 3KZZA 1JHFA 3GW2A 3FMRA 1FP2A 4NQWA 2STTA 2H6BA 2G9WA 4ZH4F 2A07F 2DPDA 4ZYDA 2VODA 4I7HA 3U2RA 1I27A 4N9HA 2D1HA 2NS0A 1KU3A 2CYYA 3TO7A 4ESBA 1ZH5A 2QBYB 5K5QA 3NEUA 5LHHA 5BPIA 2EJRA 2DT5A 1XCVA 4KICA 4ESJA 4LB5A 1JXSA 3RPUA 3DF8A 1ZRCA 3BDDA 3L00A 2BEOA 3CUQB 2EV0A 1EH8A 5J8FA 3TDZC 1LDDA 3M9AA 1OYYA 1FC3A 3WGIA 2L01A 1GHCA 4I0BA 1REPC 2RC4A 2EB7A 4Q47A 1AOYA 2DQRA 1P2FA 4PCQA 2VE8A 2V1DA 1K7AA 1KQ8A 3L2CA 3I54A 4BH9A 5L3GA 2AS5F 1U5TA 5ICGA 1XGNA 5F6FA 2GIVA 3ZMSA 4EJVA 4YFXF 3WTWC 4HBLA 4L5JA 2PMHA 4RAYA 2EFNA 3GLXA 1QGPA 2EA2A 1J7KA 4GGGA 1EH7A 5K5OA 2FBIA 2HDCA 4A0XA 4EMSA 2VBZA 2F5EA 2LNBA 2Z33A 2DU9A 2KIMA 3R4KA 3J80K 3QP6A 4A6DA 2R7DA 3I71A 2V6CA 3IC7A 4HF2A 3ZMZA 3ABUA 2FMYA 4HX7A 3NRVA 1FZPB 2OQGA 2ZJ2A 4LGWA 4MQ9F 4L0ZB 3HRTA 5HLIA 4M71A 3V8LA 2KJCA 4P96A 3N4MA 2D2WA 2OBPA 3GEZA 4YFNF 3L09A 3KFWX 1O3QA 5DYMA 3K69A 1ZG3A 1KYWA 4I01A 2VC1A 2X4HA 3HRUA 2XAQA 3ZMVA 1OPCA 3LA3A 5KVRA 3D5LA 2XGXA 5D4SA 1Q1HA 1BIAA 4XRFA 2NRAC 4IXAA 2QZ8A 4JK1X 2H27A 2BV6A 2EA4A 4M73A 1XD7A 1MJBA 1FT9A 1J59A 2OAZA 3K9TA 1YW8A 3KP2A 1T38A 4G7HF 3V4GA 1TNSA 2P6SA 1R1VA 2COMA 2VONA 4CHUA 2H6CA 5JI6A 3HOTA 4Y15A 3GUDA 3DEUA 3EUHA 5HDKA 2LSOA 2CG4A 4EGYA 2CO5A 4YG2F 3EETA 5CLSA 1SFXA 1FWZA 2XASA 1T98A 3KP7A 3GYHX 4LG0A 4LLNA 2OZ6A 4CDGA 2HQNA 3V7RA 4Q48A 2HOEA 4M6XA 2MLKA 3IL2A 4KMFA 4MQVA 4WXDA 4RAZA 3CO7C 1DPRA 1YS6A 1XGSA 1ZREA 1B6AA 2K4JA 3E6CC 2ZFWA 2XV4S 2PN6A 1D5VA 4F7ZA 5HDGA 3SZTA 3WTVC 5LGNA 2KIUA 5IT9K 4AVPA 3R0AA 3QP5A 1KU7A 1R36A 2KIFA 1S7OA 3HTUA 3TO9A 5JVTA 3J81Z 2FSWA 5CVVA 1F9NA 2OZUA 1HW5A 2JTVA 2JSCA 3T5XA 5FFZA 2ZCWA 1ZGAA 3M8FA 1DP7P 2W24A 2ACJA 2HQRA 1TTYA 3FZVA 3JAMK 2EK5A 3CJNA 4HOBA 1I6XA 2ZMEA 3DQVC 1UFMA 4O6JA 4UV8A 2G7HA 1YQAA 2HYGD 1HKTA 1FSHA 4OOIA 1P4XA 1S29A 3HSRA 1IF1A 3RPQA 1ON2A 5CVJA 2IT0A 2Y75A 2A69F 2FNPA 3W6KB 5K1YA 3R61A 3KLOA 5ILVA 3K1PA 1PUEE 1U8RA 3GFJA 4L18B 4MEYF 1H0MA 4IPAA 5CVIA 1MDMA 4BHCA 3JSOA 3I0TA 3BOQA 4KIFA 3GFIA 4UVAA 2P7CB 1HW1A 1TQPA 3K1MA 2FXAA 4L9TA 4UVCA 4KIBA 2J5PA 1ZYRF 1MDMB 1S7AA 3GF2A 1USTA 3AAFA 4ZYEA 2VOOA 1J0RA 3P9CA 1YW9A 3HYIA 4PZJA 1MKMA 2RN7A 2PQ8A 3ZMUA 2W25A 3E97A 3P9KA 3ELKA 3LSTA 3BWGA 5BPDA 1T39A 3WE2A 2L02A 3I4PA 2RQPA 3WTTC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OOP A;  2WV0 A;  4CYD A;  3LQR A;  2FQ3 A;  1BIB A;  5J6X A;  5L3E A;  1IN7 A;  1W7P B;  5E1X A;  2HS5 A;  4G6D A;  5ERI A;  3I64 A;  3J80 Z;  1IN8 A;  3QPT A;  4M9Z A;  1KYZ A;  4WX9 A;  4OIN F;  1FX7 A;  1RUN A;  4RGX A;  2L3D A;  1F1Z A;  4IRG A;  3F8N A;  4ENN A;  1Z9C A;  3FMQ A;  1L3L A;  4HYE A;  3WOD F;  3N97 A;  5HLH A;  2A6H F;  1VTN C;  2HWV A;  3HIF A;  1G3T A;  2IVM A;  2PEX A;  3ZMD A;  2IA1 A;  3U1D A;  1UCR A;  3HRS A;  4HZF A;  1ZAR A;  1WI9 A;  2XAH A;  2FF4 A;  3RI4 A;  5HVQ C;  5E8I A;  2LKP A;  1JGS A;  4AD9 A;  1O7L A;  1IRG A;  3RKX A;  2Y0M A;  2XAF A;  3J81 K;  4HLY A;  2IP2 A;  1UHW A;  2CSO A;  2QQB A;  1P6R A;  2MH2 A;  1F4K A;  1TLH B;  5LGT A;  1YFH A;  5DD8 A;  5FO5 A;  1ZHF A;  1KQ9 A;  2XUB A;  1SFE A;  3F72 A;  1JHH A;  5LEJ A;  4EJW A;  2QQ9 A;  2Z5U A;  1P4A A;  2EFO A;  2W84 A;  4G94 A;  4XLP F;  4Z2Y A;  1QNT A;  4ZYH A;  4P9U A;  4R1H A;  2ZNZ A;  2GA2 A;  1IW7 F;  2DK5 A;  1XCB A;  1IN5 A;  2VN2 A;  2MC3 A;  3F8B A;  4UXN A;  1ZLJ A;  5HOO A;  2VT3 A;  3K1N A;  5FLX K;  2VOP A;  4OMZ A;  4YII A;  2IW5 A;  5E20 A;  3F21 A;  4L9N A;  2QM3 A;  5F64 A;  4ASN A;  5ICC A;  1OKR A;  4KDP A;  1Z05 A;  3QU3 A;  2F5D A;  4KN4 X;  3SQN A;  1SD6 A;  1OR7 A;  2XRN A;  1Y0U A;  1ULY A;  2CQK A;  4P9F A;  3E3V A;  1X3U A;  5CVR A;  4EJU A;  4AWX B;  4FT8 A;  2HZT A;  4IRI A;  1SD5 A;  2PG4 A;  1LVA A;  4RGU A;  3PFI A;  4U7B A;  3FXQ A;  4JQF A;  5IT9 Z;  2B0L A;  2OA4 A;  2M1B A;  3F8M A;  5LHG A;  1W5S A;  5H20 A;  2J5O A;  4G9Y A;  5DDG A;  1ONV A;  2YPR A;  3LA7 A;  2ELH A;  3RIR A;  3REO A;  2IJL A;  4OIP F;  4HDV A;  1U5T B;  3O6B B;  2HGC A;  4A2U A;  3JAM Z;  3HTS B;  2IA2 A;  4KUM A;  4ZZL A;  4EQQ A;  1ZG1 A;  1LDJ A;  2R7F A;  3H3U A;  3GX4 X;  1G3Y A;  3V8J A;  3FHZ A;  1T2K A;  2LF8 A;  4XLN F;  4N0B A;  2A3S A;  1D3Y A;  1BC7 C;  3RYR A;  4OIO F;  6PAX A;  2FE3 A;  2NNY A;  3G3Z A;  2ETH A;  3GXO A;  3DV8 A;  2M45 A;  4OIQ F;  1PDN C;  3BP8 A;  3IRQ A;  4A12 A;  2FRH A;  2CFX A;  1LQ1 A;  4DQ2 A;  4KIG A;  5AIP A;  3BRO A;  1Z6R A;  4NHJ A;  4LK0 F;  4NB5 A;  3TO6 A;  4N9I A;  4M9X A;  3FMS A;  5E17 F;  5CYV A;  1B9M A;  5LBQ A;  4P5O A;  3WU0 A;  3EQL F;  3E6D A;  2F2E A;  2L4A A;  2M30 A;  1D8J A;  1CGP A;  5E1W A;  4U0Y A;  1BM9 A;  1T0F A;  2H94 A;  1ODD A;  3HOS A;  1P92 A;  3IRR A;  4EV0 A;  1IXS B;  5EEG A;  5ILU A;  3KP5 A;  3BY6 A;  1XSX A;  1FYK A;  3FX3 A;  4ZYG A;  2VC0 A;  4MGR A;  1L0O C;  1IRF A;  3MEX A;  3LA2 A;  3IKT A;  3QPH A;  3JW4 A;  4PDK A;  4YIF A;  1FOK A;  1XMK A;  1Z91 A;  2FU4 A;  1XSD A;  2CW0 F;  2DLL A;  1XDS A;  3FWE A;  3T8T A;  2K27 A;  1K78 A;  4I2O A;  4L9V A;  3TKY A;  3WTU C;  2FML A;  2L4M A;  2G7U A;  2EV6 A;  1G3W A;  4P55 A;  1YYV A;  1W5T A;  3GFM A;  2EFP A;  1ZRD A;  1UHM A;  2FNA A;  5LRS A;  2PBI A;  1YW7 A;  5CJ9 A;  2GXG A;  3V8K A;  1KA8 A;  1G3S A;  4RS8 A;  4HV6 A;  2QVO A;  1R23 A;  1RI7 A;  3ISP A;  4MNU A;  5EEH A;  1YG2 A;  2EWN A;  4HAM A;  4LG0 B;  3WU1 B;  3EYY A;  4E70 A;  3JTH A;  1QQI A;  1RZ4 A;  1J9I A;  1LB2 A;  4ENK A;  5L3B A;  5L3F A;  1TQM A;  3M1E A;  4U7D A;  4AIJ A;  1LNW A;  2E1N A;  3LAJ A;  4ZZD A;  2DTR A;  2PMU A;  4LK1 F;  3F6V A;  5CVU A;  1FYM A;  3C18 A;  1S8N A;  2P8T A;  1S6L A;  5E1Z B;  3E6B A;  3TDU C;  4U0V A;  4EM0 B;  5FD6 A;  2O6G E;  1OYI A;  3C1D A;  4Q5S F;  3WTZ A;  5LHI A;  2RVC A;  1QZZ A;  5IT3 A;  4IVN A;  4QLC U;  1E2X A;  3ZPL A;  4G7Z F;  2HR3 A;  2VBY A;  1MD0 A;  1YS7 A;  5JFR A;  5HS7 A;  4RB2 C;  2LF7 A;  1B4A A;  4R79 A;  1QPM A;  3ROU A;  3NQO A;  2P5K A;  3TOA A;  3P7N A;  2BE5 F;  1BC8 C;  5D5X B;  4D0P A;  2QEN A;  1V4R A;  2RDP A;  1RNL A;  4IRH A;  4XSX F;  4O3M A;  2ZME B;  3Q5F A;  5FLX Z;  3M8E A;  3I58 A;  3MCZ A;  1IAW A;  1BN5 A;  1R5G A;  2Q0O A;  1F5T A;  1WSU A;  1SAX A;  4KFC A;  4M72 A;  3MQ0 A;  5D6F A;  5HDN A;  2OU2 A;  1HKS A;  3WTX C;  2GA1 A;  3COA C;  3RTR A;  3ML6 A;  1QO0 D;  4HX8 A;  1V3F A;  5JR3 A;  2F5F A;  4R8H A;  3CTA A;  1MJA A;  2V1U A;  4U0W A;  3I5U A;  1KQ0 A;  1SFU A;  5E8G A;  1KGS A;  2R3S A;  2IA0 A;  4IHS A;  5FD5 A;  5BMZ A;  2DK8 A;  3R60 A;  3ECO A;  4BHP A;  1HBX G;  3QAH A;  1ZLK A;  3Q9V A;  3EYI A;  2QQA A;  4GO1 A;  4JBA A;  3U9G A;  2LDU A;  3RJP A;  4LB6 B;  2YR2 A;  1R22 A;  3Q9S A;  3B02 A;  2Z9O A;  1R58 A;  4TV7 A;  3HUG A;  2K02 A;  2GZW A;  5L3C A;  2HFH A;  3O2P E;  1R7J A;  2P5L C;  1FBQ A;  5HS8 A;  5ED4 A;  1BBY A;  5D5U B;  2KJB A;  3WGH A;  4I98 B;  3CUO A;  4LMY A;  5A2Q Z;  2ZKZ A;  3WG9 A;  4A0Z A;  1FP1 D;  1E17 A;  1FNN A;  3L9F A;  1FPQ A;  3VB2 A;  3RKY A;  1TNT A;  3DXJ F;  1KU2 A;  3K0L A;  2YU3 A;  2V1X A;  2GXB A;  2XVC A;  1BI2 A;  2DBB A;  1EV7 A;  2HEO A;  1FBU A;  1XSV A;  1FLI A;  5BOX A;  2DW4 A;  3E6M A;  1BOA A;  3MZH A;  4WXH A;  4LFU A;  4WWC A;  1HQC A;  4CGZ A;  3F3X A;  1TW3 A;  2V9V A;  4YFK F;  4BAY A;  2UXN A;  4GCV A;  2O3F A;  2P4W A;  2VE9 A;  2O03 A;  2NYX A;  4KMU X;  4GXO A;  1O57 A;  1SMY F;  5LEK A;  4WCG A;  5TRD A;  1SD4 A;  4UNO A;  1O7F A;  3GFL A;  3KZY A;  3ULQ B;  4OU0 A;  2JPC A;  5H6Q A;  2EFW A;  1U6G A;  2P7V B;  1U3E M;  2QLZ A;  3GWZ A;  5DV5 A;  3F23 A;  4CZZ A;  4HA8 A;  3DKW A;  2QUF A;  4RGS A;  1J2X A;  4A0Y A;  4EM1 A;  2P6T A;  1LJ9 A;  5DUI A;  2MLG A;  4ON0 A;  3DPT A;  1SD7 A;  1OYW A;  3E5U A;  3WTY C;  5DCM A;  1D8K A;  2DQL A;  2JPB A;  2BBY A;  2XRO A;  5AIQ A;  1XB4 A;  2OQR A;  1HXD A;  4LLG F;  2MBF A;  3K2Z A;  3EDP A;  2D45 A;  3H92 A;  5F1R A;  2KRF A;  2QBY A;  2DAO A;  1R5H A;  1BI1 A;  3MZY A;  3SHF A;  3HHH A;  4RB1 A;  2JZY A;  2BYV E;  2DI3 A;  3PQK A;  4QWQ A;  5DEQ A;  4G8X A;  3DPL C;  5DCM B;  2VBW A;  3KEQ A;  5D8L B;  4HDU A;  2UWM A;  2W85 A;  2HTS A;  5K5R A;  2EFQ A;  4RB0 A;  3TGN A;  2F5C A;  2WC2 A;  3SFZ A;  1WRJ A;  1IXC A;  3CUQ A;  2RNJ A;  5JHU A;  1O3S A;  2A5Y B;  4MHG A;  3LQQ A;  4KNY A;  3GO5 A;  3DP7 A;  1CF7 A;  3C7J A;  3BJO A;  1I1S A;  1Z1D A;  4UHT A;  2GQQ A;  1HW2 A;  4RGR A;  3VFZ A;  5HLG A;  5KK1 A;  5LRR A;  2O8X A;  3T1B A;  2FA5 A;  2Z99 A;  1CF7 B;  1S3J A;  3WGG A;  2FBH A;  1PP8 F;  1DPU A;  1IXR C;  2YX4 A;  5E18 F;  3ZQ7 A;  3ABT A;  2AXL A;  2NNN A;  1LEB A;  2DO7 A;  1DUX C;  2XAJ A;  4HF1 A;  4GYI A;  4IJA A;  1C0W A;  1FYL A;  2RKH A;  4L0Y B;  4I02 A;  3BPX A;  3GZ6 A;  1MGT A;  1QBJ A;  2KKO A;  2O0Y A;  5A2Q K;  2PI0 A;  1IUY A;  4A6E A;  1R00 A;  4A5M A;  3LWF A;  4KT5 C;  3ECH A;  2NAZ A;  2DFI A;  4FX4 A;  4BYY A;  1Z6T A;  4GYG A;  4HV5 A;  3FM5 A;  5DUK A;  5BQT A;  1U2W A;  3GVA A;  2QYO A;  5ILS A;  4I0A A;  1HST A;  5FGM A;  2HKO A;  4EJT A;  2E7X A;  1K6O A;  1TBX A;  4PGH A;  3V7C A;  4I09 A;  2H09 A;  2D1V A;  3VOE A;  3I53 A;  5AON A;  3GZ5 A;  1UB9 A;  2VBX A;  1FBS A;  4K2E A;  1I5Z A;  3FF5 A;  3PQJ A;  1IN6 A;  2ADU A;  3KEO A;  1ZN2 A;  2GWR A;  3RYP A;  3QRF F;  2A6E F;  4L5I A;  4KA4 A;  2STW A;  1O3R A;  4WXC A;  4AIH A;  1W4M A;  4AIK A;  2C6Y A;  3IHU A;  4ENJ A;  1JE8 A;  2Q8K A;  2K86 A;  4ESF A;  1H9T A;  3VEP A;  1B9N A;  3KP6 A;  3LAP A;  1U78 A;  2XAG A;  5D5W B;  4IF4 A;  3P9I A;  1I1G A;  3ZN0 A;  3MWM A;  3OV8 A;  4LLL A;  1W7P D;  1G4D A;  4BHB A;  1K78 B;  3L7W A;  5D4R A;  2P5V A;  3I59 A;  4ETS A;  2VT2 A;  2VXZ A;  2V79 A;  3HSF A;  4KN7 X;  2UZK A;  1H9G A;  3ZP5 A;  1ZG5 A;  4IHT A;  1GXQ A;  3BJA A;  2Z3Y A;  2L54 A;  2GAU A;  1ZAO A;  3D0S A;  4XBF A;  1DDN A;  3KET A;  4CO8 A;  3I59 B;  4WF2 A;  3H3Z A;  2YX7 A;  2Y48 A;  3FM3 A;  3BPV A;  4M74 A;  4HLX A;  3W6J B;  1G6N A;  5FFX A;  3F8F A;  1YTY A;  2M8E A;  4HF0 A;  2E1C A;  1J75 A;  3IWF A;  2FEZ A;  2MH9 A;  4OIR F;  3E5X A;  5DD4 A;  2A61 A;  2QWW A;  3IWZ A;  3CO6 C;  3E5Q A;  2ZNY A;  3MAJ A;  3JSP A;  2ISZ A;  1FY7 A;  2JT1 A;  1USS A;  3QOP A;  4BXU A;  3WE3 A;  2XKO A;  4HX4 A;  3T0Y A;  4LD5 A;  1XGO A;  1QZY A;  2ZXJ A;  4UVB A;  2JRT A;  3ZMT A;  2W57 A;  4S04 A;  2M5W A;  2XIG A;  3HRM A;  2HKX A;  4UUV A;  1STZ A;  1LDK B;  4PGG A;  3HSE A;  5FB2 A;  2IRF G;  4EGZ A;  1XDU A;  4L9J A;  4G6Q A;  1SMT A;  3S2W A;  4UV9 A;  4G7O F;  4XSZ F;  1IZ1 A;  2ZO4 A;  2FOK A;  4EVI A;  1B1B A;  2E7W A;  2YSR A;  3BZ6 A;  3SZP A;  1ZRF A;  5ICE A;  2RGV A;  5BS6 A;  1FSE A;  3J7A O;  1WKM A;  3SXY A;  1BJA A;  2PJP A;  1IN4 A;  1O3T A;  3ZN1 A;  3KE2 A;  4MTE A;  5TJJ A;  1HSJ A;  5LLQ A;  4OMY A;  3F8C A;  3KP4 A;  3BJ6 A;  1OMI A;  3R0J A;  4FHT A;  2WTE A;  2FBK A;  4HQM A;  3KCC A;  2WWY A;  3FXR A;  2TDX A;  3M7G A;  2ZBK A;  1RIO H;  2XHK A;  2MD5 A;  1BI3 A;  2K7L A;  2MA3 A;  4ENM A;  2O61 A;  3CUQ C;  1TQI A;  4M9S A;  1P4W A;  3ERE D;  5D5V B;  1YO5 C;  4BNC A;  3C3W A;  1XMA A;  3CDH A;  4CIC A;  4Q4Z F;  1WQ2 A;  4H0E A;  1PP7 U;  1W7P A;  2CWE A;  4Y17 A;  1HKQ A;  4B09 A;  3TQN A;  4A5N A;  2XKP A;  1GVJ A;  3IKV A;  4DNC A;  3JTG A;  1ZGJ A;  2RV8 A;  1RUO A;  5L3D A;  3R6S A;  3FXU A;  2BGC A;  4U88 A;  1YLF A;  2OD5 A;  4RB3 C;  2ESN A;  1U5T C;  5D6E A;  1MZB A;  1TW2 A;  4S05 A;  4WK8 F;  4CXF A;  2HYF A;  4HQE A;  5J8C A;  4MTD A;  3WTS C;  1KU9 A;  3O3K A;  1T6S A;  2HTJ A;  2ESH A;  2K4B A;  1A04 A;  1XN7 A;  1K79 A;  3F6O A;  2A68 F;  1Z7U A;  4FX0 A;  4KYW A;  4MEX F;  2UXX A;  5ICF A;  1B59 A;  2EV5 A;  2PLY A;  3RKW A;  3QU6 A;  1GXP A;  5DCF A;  3B73 A;  2IPQ X;  5HS9 A;  3V7S A;  4EJO A;  5H6R A;  1YIO A;  3T8R A;  4M6Y A;  2PFB A;  4B8X A;  1BI0 A;  1R1U A;  3CLO A;  3DFG A;  3MFK A;  1LEA A;  4Y13 A;  1AWC A;  4BQA A;  4O5V A;  5LGU A;  3KP3 A;  3G73 A;  2Q2E A;  3F22 A;  2M87 A;  4LJZ F;  1WWX A;  1NHA A;  1MJ9 A;  3TOB A;  3VOD A;  3HHG A;  5D8K B;  1ON1 A;  3KLN A;  3RDI A;  4EM2 A;  1EH6 A;  2CGP A;  1XGM A;  2DPU A;  4HW0 A;  1R1T A;  1J5Y A;  2X0L A;  3LFK A;  2ISY A;  3KZZ A;  1JHF A;  3GW2 A;  3FMR A;  1FP2 A;  4NQW A;  2STT A;  2H6B A;  2G9W A;  4ZH4 F;  2A07 F;  2DPD A;  4ZYD A;  2VOD A;  4I7H A;  3U2R A;  1I27 A;  4N9H A;  2D1H A;  2NS0 A;  1KU3 A;  2CYY A;  3TO7 A;  4ESB A;  1ZH5 A;  2QBY B;  5K5Q A;  3NEU A;  5LHH A;  5BPI A;  2EJR A;  2DT5 A;  1XCV A;  4KIC A;  4ESJ A;  4LB5 A;  1JXS A;  3RPU A;  3DF8 A;  1ZRC A;  3BDD A;  3L00 A;  2BEO A;  3CUQ B;  2EV0 A;  1EH8 A;  5J8F A;  3TDZ C;  1LDD A;  3M9A A;  1OYY A;  1FC3 A;  3WGI A;  2L01 A;  1GHC A;  4I0B A;  1REP C;  2RC4 A;  2EB7 A;  4Q47 A;  1AOY A;  2DQR A;  1P2F A;  4PCQ A;  2VE8 A;  2V1D A;  1K7A A;  1KQ8 A;  3L2C A;  3I54 A;  4BH9 A;  5L3G A;  2AS5 F;  1U5T A;  5ICG A;  1XGN A;  5F6F A;  2GIV A;  3ZMS A;  4EJV A;  4YFX F;  3WTW C;  4HBL A;  4L5J A;  2PMH A;  4RAY A;  2EFN A;  3GLX A;  1QGP A;  2EA2 A;  1J7K A;  4GGG A;  1EH7 A;  5K5O A;  2FBI A;  2HDC A;  4A0X A;  4EMS A;  2VBZ A;  2F5E A;  2LNB A;  2Z33 A;  2DU9 A;  2KIM A;  3R4K A;  3J80 K;  3QP6 A;  4A6D A;  2R7D A;  3I71 A;  2V6C A;  3IC7 A;  4HF2 A;  3ZMZ A;  3ABU A;  2FMY A;  4HX7 A;  3NRV A;  1FZP B;  2OQG A;  2ZJ2 A;  4LGW A;  4MQ9 F;  4L0Z B;  3HRT A;  5HLI A;  4M71 A;  3V8L A;  2KJC A;  4P96 A;  3N4M A;  2D2W A;  2OBP A;  3GEZ A;  4YFN F;  3L09 A;  3KFW X;  1O3Q A;  5DYM A;  3K69 A;  1ZG3 A;  1KYW A;  4I01 A;  2VC1 A;  2X4H A;  3HRU A;  2XAQ A;  3ZMV A;  1OPC A;  3LA3 A;  5KVR A;  3D5L A;  2XGX A;  5D4S A;  1Q1H A;  1BIA A;  4XRF A;  2NRA C;  4IXA A;  2QZ8 A;  4JK1 X;  2H27 A;  2BV6 A;  2EA4 A;  4M73 A;  1XD7 A;  1MJB A;  1FT9 A;  1J59 A;  2OAZ A;  3K9T A;  1YW8 A;  3KP2 A;  1T38 A;  4G7H F;  3V4G A;  1TNS A;  2P6S A;  1R1V A;  2COM A;  2VON A;  4CHU A;  2H6C A;  5JI6 A;  3HOT A;  4Y15 A;  3GUD A;  3DEU A;  3EUH A;  5HDK A;  2LSO A;  2CG4 A;  4EGY A;  2CO5 A;  4YG2 F;  3EET A;  5CLS A;  1SFX A;  1FWZ A;  2XAS A;  1T98 A;  3KP7 A;  3GYH X;  4LG0 A;  4LLN A;  2OZ6 A;  4CDG A;  2HQN A;  3V7R A;  4Q48 A;  2HOE A;  4M6X A;  2MLK A;  3IL2 A;  4KMF A;  4MQV A;  4WXD A;  4RAZ A;  3CO7 C;  1DPR A;  1YS6 A;  1XGS A;  1ZRE A;  1B6A A;  2K4J A;  3E6C C;  2ZFW A;  2XV4 S;  2PN6 A;  1D5V A;  4F7Z A;  5HDG A;  3SZT A;  3WTV C;  5LGN A;  2KIU A;  5IT9 K;  4AVP A;  3R0A A;  3QP5 A;  1KU7 A;  1R36 A;  2KIF A;  1S7O A;  3HTU A;  3TO9 A;  5JVT A;  3J81 Z;  2FSW A;  5CVV A;  1F9N A;  2OZU A;  1HW5 A;  2JTV A;  2JSC A;  3T5X A;  5FFZ A;  2ZCW A;  1ZGA A;  3M8F A;  1DP7 P;  2W24 A;  2ACJ A;  2HQR A;  1TTY A;  3FZV A;  3JAM K;  2EK5 A;  3CJN A;  4HOB A;  1I6X A;  2ZME A;  3DQV C;  1UFM A;  4O6J A;  4UV8 A;  2G7H A;  1YQA A;  2HYG D;  1HKT A;  1FSH A;  4OOI A;  1P4X A;  1S29 A;  3HSR A;  1IF1 A;  3RPQ A;  1ON2 A;  5CVJ A;  2IT0 A;  2Y75 A;  2A69 F;  2FNP A;  3W6K B;  5K1Y A;  3R61 A;  3KLO A;  5ILV A;  3K1P A;  1PUE E;  1U8R A;  3GFJ A;  4L18 B;  4MEY F;  1H0M A;  4IPA A;  5CVI A;  1MDM A;  4BHC A;  3JSO A;  3I0T A;  3BOQ A;  4KIF A;  3GFI A;  4UVA A;  2P7C B;  1HW1 A;  1TQP A;  3K1M A;  2FXA A;  4L9T A;  4UVC A;  4KIB A;  2J5P A;  1ZYR F;  1MDM B;  1S7A A;  3GF2 A;  1UST A;  3AAF A;  4ZYE A;  2VOO A;  1J0R A;  3P9C A;  1YW9 A;  3HYI A;  4PZJ A;  1MKM A;  2RN7 A;  2PQ8 A;  3ZMU A;  2W25 A;  3E97 A;  3P9K A;  3ELK A;  3LST A;  3BWG A;  5BPD A;  1T39 A;  3WE2 A;  2L02 A;  3I4P A;  2RQP A;  3WTT C; 
#chains in the Genus database with same CATH topology
 3RZD J;  2AXT C;  2KMU A;  1W0U A;  2JA8 J;  3OOP A;  3DKY A;  2WV0 A;  4CYD A;  2LC2 A;  3LQR A;  1GUU A;  2FQ3 A;  1BIB A;  4XRS G;  4IO9 F;  2DXI A;  4F93 B;  5C4J J;  1LE8 B;  5J6X A;  5L3E A;  2H8W A;  1Z21 A;  1IN7 A;  3JCU C;  4BQN A;  3CJR B;  1W7P B;  4PJ0 C;  5E1X A;  2NVX J;  1K83 J;  4A3L J;  2DTZ A;  2HS5 A;  3PIO F;  3SZG A;  1X58 A;  2A05 A;  1JJ8 C;  2NVT J;  3HG9 A;  2XPW A;  2QKL B;  4G6D A;  5ERI A;  4BEH B;  2FX0 A;  4J00 A;  3I64 A;  3J80 Z;  1IN8 A;  5EZH A;  4GRI A;  1X1C A;  3HXL A;  2XB5 A;  3QPT A;  1KYZ A;  4M9Z A;  5GTI C;  4WX9 A;  2OV7 A;  1MBH A;  1X1P A;  2HU9 A;  2DJN A;  2KQR A;  4QPQ A;  4OIN F;  1LFU P;  2WAQ N;  1FX7 A;  1MMG A;  1RUN A;  4RGX A;  2P0W A;  5EYR A;  3BR6 A;  3ERM A;  2L3D A;  1F1Z A;  4IRG A;  3F8N A;  4ENN A;  1ZKG A;  1Z9C A;  3ZXS A;  4L5E A;  3FMQ A;  4KIS A;  1L3L A;  4HYE A;  2QQ8 A;  3OWT A;  3WOD F;  2VJI A;  3N97 A;  5HLH A;  2A6H F;  3IAM 2;  1VTN C;  2HWV A;  3HIF A;  1APL C;  1G3T A;  2E35 A;  2IVM A;  3GTL J;  1MMD A;  3DBH B;  2JRM A;  2KFD A;  2PEX A;  2Y0S A;  3ZMD A;  4Y4R A;  2IA1 A;  4YEJ A;  3U1D A;  1UCR A;  3HRS A;  3LNQ A;  4FAS D;  1SFK A;  4HZF A;  3QYF A;  1XS9 A;  1T33 A;  2QSH X;  2R7Q A;  1ZAR A;  1WI9 A;  2XAH A;  4AU7 A;  4Y3O A;  3X2Q H;  2FF4 A;  3ABK H;  1Z77 A;  3RI4 A;  5HVQ C;  5E8I A;  2LKP A;  5GAD J;  2AQF A;  4IQ4 A;  1JGS A;  1RKT A;  4AD9 A;  1UJ8 A;  1O7L A;  4IQJ A;  1IRG A;  1LFB A;  3RKX A;  3KZI C;  2XF6 A;  2Y0M A;  2XAF A;  1QVU A;  4CZC A;  1N78 A;  2MG4 A;  3J81 K;  4XON A;  5GAE J;  2F4M B;  4BJT A;  4HLY A;  3OYG A;  2IP2 A;  1UHW A;  2CSO A;  4ZJZ A;  1MNM C;  2QQB A;  3TMO A;  1P6R A;  1K61 A;  2MH2 A;  1F4K A;  3HM5 A;  4RA2 A;  2IS1 A;  1TLH B;  5LGT A;  5FJ8 J;  4S0H B;  1YFH A;  2DFF A;  5DD8 A;  5FO5 A;  1ZHF A;  1KQ9 A;  2L7K A;  3OYI A;  2XUB A;  1SFE A;  2E5N A;  3F72 A;  4BGD A;  4F55 A;  1JHH A;  5LEJ A;  5F0F A;  3HC7 A;  2X85 A;  4EJW A;  4KIT B;  3CMY A;  4CUG A;  2QQ9 A;  3S14 J;  2O7O A;  3K4J A;  1YHQ I;  2IAI A;  2R7O A;  3AL0 C;  2Z5U A;  1KZH A;  4QIW N;  1T0F C;  1P4A A;  2EFO A;  2W84 A;  3VYS B;  3H1C A;  4M3E A;  4G94 A;  4XLP F;  4Z2Y A;  1QNT A;  4ZYH A;  4P9U A;  4R1H A;  2ZNZ A;  1N25 A;  3BZC A;  2GA2 A;  3GTP J;  4OAZ A;  1BW5 A;  3RSN A;  5J3L A;  1XPX A;  1Y1V J;  1FOX A;  3A02 A;  1IW7 F;  2DK5 A;  3S17 J;  1XCB A;  1FMW A;  1IN5 A;  2VN2 A;  3K4N A;  1JTX A;  5IYC J;  2MC3 A;  3F8B A;  5F0C A;  3JR9 A;  4UXN A;  1ZLJ A;  2L7Z A;  1P7I A;  2VT3 A;  3K1N A;  5HOO A;  5FLX K;  4X0G A;  2VOP A;  4NQW B;  4OMZ A;  4YII A;  4HNT A;  3OYM A;  2IW5 A;  2V6E A;  1BA5 A;  5E20 A;  1NG6 A;  5F27 A;  4HST A;  3ZQG A;  2ZJQ F;  2E1M C;  2CV1 A;  3F21 A;  4L9N A;  1IG7 A;  4E6K G;  2QM3 A;  1MBE A;  2LOO A;  4DYQ A;  5F64 A;  3RQ4 A;  4ASN A;  5ICC A;  1OKR A;  4KDP A;  2LY9 A;  1Z05 A;  3FXM A;  3QU3 A;  2F5D A;  3G1O A;  4KN4 X;  4X1E A;  3SQN A;  1SD6 A;  1OR7 A;  2XRN A;  1Y0U A;  3SJM A;  3J7A Y;  1ULY A;  5C4X J;  3B6A A;  3EUH C;  2CQK A;  4P9F A;  2O9L A;  1JT6 A;  3E3V A;  5IOZ A;  1X3U A;  3C2B A;  4N4O B;  4YRV A;  5CVR A;  4EJU A;  4AWX B;  5HNF A;  3WHB A;  1F43 A;  4MIM A;  4FT8 A;  2HZT A;  2M7B A;  1D1C A;  1ORK A;  1UEL B;  4IRI A;  1M1E B;  1SD5 A;  1MNE A;  2PG4 A;  1LVA A;  4RGU A;  3PFI A;  4U7B A;  2XF5 A;  1VF9 A;  2NVQ J;  1SVM A;  3FXQ A;  4JQF A;  5IT9 Z;  4CCJ A;  3OYH A;  2B0L A;  2DA3 A;  3QOD A;  1SC7 A;  2OA4 A;  2M1B A;  3F8M A;  5LHG A;  1W5S A;  1Z7L A;  2WAD A;  5GP9 A;  2EBI A;  5H20 A;  3CMA I;  2DA6 A;  3CCY A;  4GDF A;  4BJ6 C;  2X6Y A;  2J5O A;  4G9Y A;  1ETQ A;  2Y0S N;  5FKM A;  4B4C A;  5DDG A;  2Z16 A;  1KON A;  1ONV A;  5E79 C;  2YPR A;  2DYS H;  3BTI A;  2M4G A;  2QEX I;  3EPZ A;  1MH4 A;  3C2G A;  2ELH A;  3LA7 A;  3RIR A;  3REO A;  2IJL A;  1D0X A;  4OIP F;  3S1R J;  1XMX A;  4HDV A;  1U5T B;  3O6B B;  4CCK A;  2XRO A;  2HGC A;  3A01 A;  4A2U A;  3JAM Z;  2CV0 A;  3HTS B;  2IA2 A;  4KUM A;  4ZZL A;  1T8I A;  4EQQ A;  3PJR A;  1ZG1 A;  1LDJ A;  2R7F A;  3H3U A;  2M9H A;  3OIQ A;  3GX4 X;  3G6E I;  1G3Y A;  3CMM A;  4LG3 A;  3V8J A;  3ZCO A;  3FHZ A;  1T2K A;  2LF8 A;  1R4M B;  4XLN F;  4N0B A;  2A3S A;  1D3Y A;  1BC7 C;  3JRE A;  1YE9 A;  3RYR A;  4OIO F;  3HJE A;  6PAX A;  2FE3 A;  1LPQ A;  3I55 I;  2NNY A;  1VZ0 A;  1XTA A;  2COB A;  3G3Z A;  2BHY A;  2ETH A;  2XC7 A;  2BY2 A;  2K9Q A;  3GXO A;  3DV8 A;  2M45 A;  1S9H A;  1WVR A;  3JRA A;  4OIQ F;  1PDN C;  1TWH J;  3BP8 A;  3IRQ A;  4A12 A;  2FRH A;  2CFX A;  1LQ1 A;  1W36 D;  4DQ2 A;  4KIG A;  3MVP A;  5AIP A;  1G2H A;  3FK7 A;  1UG0 A;  3BRO A;  2DA4 A;  4BKX A;  4J19 A;  3BTC A;  2VB6 A;  3GTG J;  2VQC A;  2LLK A;  2Q1Z B;  1Z6R A;  4NHJ A;  3DLA A;  4C30 A;  2LH9 A;  2ZME C;  4LK0 F;  4NB5 A;  1Y56 A;  1I3Q J;  3TO6 A;  4N9I A;  4M9X A;  3FMS A;  5KHD A;  5E17 F;  1HDP A;  5J4Y A;  1S72 I;  3LSG A;  1B9M A;  5CYV A;  4E7S A;  5LBQ A;  2WB1 A;  4P5O A;  3WU0 A;  2ZJP F;  3OR2 C;  2X9D A;  4BU2 A;  1W36 C;  2M0C A;  4FQG A;  1IO2 A;  3EQL F;  3E6D A;  2F2E A;  2L4A A;  1AA7 A;  1X1B A;  1R5I D;  4II3 A;  2MC4 A;  2M30 A;  1D8J A;  2ECC A;  1CGP A;  4W97 A;  5E1W A;  1BM9 A;  4HNU A;  1OFC X;  1T0F A;  4U0Y A;  2H94 A;  3LSK A;  1ODD A;  3HOS A;  1P92 A;  3GCM A;  1MSF C;  5EZG A;  3IRR A;  4EV0 A;  1JTY A;  1IXS B;  5EEG A;  5ILU A;  3KP5 A;  3BY6 A;  3BTL A;  1ZTR A;  1XSX A;  1FYK A;  4UY8 I;  3FX3 A;  2VPR A;  1NH3 A;  4XQF A;  3AFH A;  4ZYG A;  2VC0 A;  4AID A;  3PIP F;  4MGR A;  1L0O C;  2RQQ A;  2CV2 A;  3M3Y J;  1IRF A;  2BY3 A;  3MEX A;  3LA2 A;  3IKT A;  3QPH A;  3AL0 B;  2JVG A;  3JW4 A;  1DP3 A;  4PDK A;  3MKY B;  4YIF A;  1FOK A;  4RDU A;  1XMK A;  4XN0 A;  1Z91 A;  5GPC A;  2FU4 A;  1XSD A;  4I99 C;  2CW0 F;  1HOM A;  2V1N A;  2JA7 J;  2CU7 A;  1TT5 B;  2DLL A;  1XDS A;  1X4O A;  3FWE A;  1ZGW A;  5IPA A;  3T8T A;  2GM4 A;  5HNH A;  1MH3 A;  2R5Y B;  2B7E A;  4E4H A;  2K27 A;  1K78 A;  3H36 A;  3S1M J;  4XLC A;  4I2O A;  4L9V A;  3TKY A;  3WTU C;  4Y33 A;  2FML A;  3BG5 A;  4V2F A;  3ZQI A;  2O8K A;  2EIL H;  2L4M A;  2G7U A;  3ZQQ A;  1G3W A;  2EV6 A;  2KL4 A;  4P55 A;  2EZI A;  1X2M A;  1YYV A;  2DN0 A;  3OIP A;  2E1M B;  3OYL A;  3DTK A;  1W5T A;  1ZR2 A;  1SAU A;  3ZGK A;  3GFM A;  4G6T B;  4C9Y A;  5C44 J;  2IXS A;  2EFP A;  5K7H A;  3TBI A;  1ZRD A;  1UHM A;  2FNA A;  1N77 A;  5LRS A;  1R71 A;  2PBI A;  3HZJ A;  1YW7 A;  5M3M J;  4BDZ A;  2L2O A;  2MAB A;  3VWB A;  1IDZ A;  5CJ9 A;  2GXG A;  3V8K A;  2HVS A;  2CUZ A;  1KA8 A;  1BR4 A;  2F48 A;  4A3G J;  1G3S A;  4UUS A;  4RS8 A;  4HV6 A;  2QVO A;  1D1B A;  1R23 A;  1ENH A;  4CYC B;  1RI7 A;  3ISP A;  4MNU A;  4NDL A;  5EEH A;  1YG2 A;  4XIC A;  2F4I A;  2EWN A;  2PJR B;  1UMQ A;  3BG6 A;  4HAM A;  3OIO A;  4LG0 B;  3WU1 B;  3EYY A;  4E70 A;  3JTH A;  2DA7 A;  1ZEL A;  1QQI A;  1O4X A;  3W6V A;  2E36 A;  1RZ4 A;  2LRE A;  4BUP A;  2CH0 A;  1J9I A;  2UUZ A;  1LB2 A;  4ENK A;  2A6T A;  3A03 A;  2OUM A;  5L3B A;  1B8I A;  3RQI A;  5L3F A;  1TQM A;  3M1E A;  2VLA A;  4U7D A;  4XOR A;  1LNW A;  4AIJ A;  2E1N A;  3LAJ A;  4ZZD A;  2DTR A;  2PMU A;  1V5G A;  4LK1 F;  1A6Q A;  3F6V A;  3GZN B;  5CVU A;  1FYM A;  4QTR A;  2BHZ A;  4A3E J;  3K7A J;  4XOT A;  3C18 A;  5IOY A;  4F3Q A;  1S8N A;  2P8T A;  1S6L A;  2DOF A;  5E1Z B;  3FKI J;  3S32 A;  1D5Y A;  3E6B A;  3TDU C;  4U0V A;  1TWG J;  1B8I B;  4EM0 B;  5FD6 A;  2O6G E;  1OYI A;  4BQQ A;  3C1D A;  1RR8 C;  3FBI B;  1MMS A;  4Q5S F;  1RKW A;  1Z3X A;  3WTZ A;  5LHI A;  2RVC A;  1QZZ A;  5IT3 A;  4IVN A;  4QLC U;  2W00 A;  1YX3 A;  2WB1 N;  1E2X A;  3ZPL A;  1K6Y A;  4G7Z F;  2HR3 A;  2VBY A;  3L2W A;  1MD0 A;  2QGU A;  1YS7 A;  5JFR A;  3GLL A;  5HS7 A;  4RB2 C;  1AU7 A;  2LF7 A;  1B4A A;  4R79 A;  1QPM A;  3ROU A;  1FJL A;  3NQO A;  3HGG A;  2CUF A;  2P5K A;  3TOA A;  3OYA A;  2LKS A;  3P7N A;  2BE5 F;  1OIS A;  1BC8 C;  5D5X B;  1V54 H;  5FLM J;  4D0P A;  2QEN A;  1V4R A;  2RDP A;  1RNL A;  4IRH A;  4XSX F;  1DGW Y;  2PMZ A;  1BW6 A;  2VKV A;  4O3M A;  3NAU A;  2OF7 A;  3OYN A;  1PYV A;  5EG0 A;  3U21 A;  2ZME B;  2ZXW H;  3OSG A;  3Q5F A;  5FLX Z;  3M8E A;  3I58 A;  3MCZ A;  1IAW A;  3M1C A;  2HOA A;  1A36 A;  3BZK A;  4ZDO A;  1BN5 A;  1R5G A;  2Q0O A;  1F5T A;  1WSU A;  2LR8 A;  1SAX A;  3VSL A;  4KFC A;  1A5J A;  4M72 A;  2DCE A;  1EA3 A;  3MD2 A;  3MQ0 A;  2L7F P;  5D6F A;  5HDN A;  2JQ7 A;  2OU2 A;  2DA2 A;  1HKS A;  4BBR J;  3WTX C;  2GA1 A;  2WBM A;  3JRF A;  3COA C;  3RTR A;  3ML6 A;  1QO0 D;  4HX8 A;  3S1Q J;  1V3F A;  5JR3 A;  2F5F A;  4R8H A;  3KX2 A;  3CTA A;  1MJA A;  2V1U A;  3CC7 I;  4U0W A;  2HZD A;  4PJL A;  3G2B A;  1GV2 A;  2VI6 A;  3I5U A;  4XN3 A;  1OCZ H;  2HI3 A;  1KQ0 A;  1LKX A;  3MN2 A;  2QKM B;  3ZQC A;  1SFU A;  5E8G A;  4V19 K;  1KGS A;  4E7J A;  1Y0N A;  2DT6 A;  2X1D A;  3JRB A;  2R3S A;  2IA0 A;  3QPL A;  3ZQL A;  3D1N I;  1DU0 A;  3BTJ A;  5FD5 A;  4IHS A;  1MBF A;  5BMZ A;  3S1N J;  2DK8 A;  3R60 A;  3ECO A;  3H0G J;  4BHP A;  2NOG A;  1HBX G;  3QAH A;  4IL6 C;  2AO9 A;  4PUS A;  3W2V A;  1ZLK A;  3Q9V A;  3EYI A;  2X1C A;  2QQA A;  2TRT A;  4GO1 A;  3D5R C;  2KZV A;  2WY8 Q;  4JBA A;  2LDU A;  3U9G A;  3RJP A;  3HOX J;  4LB6 B;  1ETO A;  4CCL A;  2YR2 A;  1R22 A;  3CJQ B;  3Q9S A;  3G1L A;  3B02 A;  1D1A A;  2Z9O A;  1R58 A;  2R7W A;  2TCT A;  3CZ6 A;  5JLX A;  4A3M J;  4TV7 A;  4NC7 A;  2HVQ A;  3KEY A;  3HUG A;  1Y8Q B;  4AC0 A;  4RBO A;  2K02 A;  2GZW A;  1RET A;  5GPA A;  5L3C A;  4D1Q A;  5E3O A;  2HFH A;  3O2P E;  1R7J A;  2HXI A;  4X6A J;  3DU5 A;  1T56 A;  2P5L C;  4A3K J;  1V55 H;  1FBQ A;  3BG7 A;  5HS8 A;  5ED4 A;  3OYK A;  4B1R A;  3GBG A;  4BJ5 C;  1BBY A;  4CA0 A;  3PNT A;  5D5U B;  2KJB A;  3WGH A;  2DJI A;  4XKB A;  1ZK8 A;  5J4V A;  2R7Z J;  4I98 B;  3CUO A;  4LMY A;  5A2Q Z;  2ZKZ A;  3S2H J;  1ZQ3 P;  4J01 A;  3IH2 A;  1ACI A;  3WG9 A;  3VYR B;  1FP1 D;  4A0Z A;  2IBD A;  1E17 A;  2DA5 A;  1FNN A;  3L9F A;  3HUG B;  5EJC A;  1AHD P;  1FPQ A;  3VB2 A;  4U87 A;  2HVR A;  3RKY A;  1P7J A;  5EGO A;  2H8R A;  2LK2 A;  3CQZ J;  1TNT A;  3DXJ F;  3AG1 H;  2VL8 A;  1KU2 A;  3K0L A;  2YU3 A;  2VKE A;  4C3J J;  2V1X A;  2VJ5 A;  4GFB A;  5E3N A;  2GXB A;  2XVC A;  5FKN A;  1BI2 A;  2DBB A;  1PVE A;  1EV7 A;  2HEO A;  1FBU A;  1XSV A;  1FLI A;  5BOX A;  1A35 A;  2DW4 A;  3E6M A;  4BE1 A;  2KDO A;  2ZXI A;  1JKO C;  1BOA A;  3KPH A;  5J40 A;  3OL3 A;  1A6I A;  3MZH A;  3CDL A;  1YI2 I;  4WXH A;  2L9R A;  5EGO B;  4LFU A;  4WWC A;  1HQC A;  4CGZ A;  3F3X A;  1TW3 A;  3BCB A;  2V9V A;  4YFK F;  3N05 A;  4BAY A;  2UXN A;  3CCS I;  2V9P A;  5IP7 J;  2Y69 H;  4GCV A;  1DGR M;  2O3F A;  1VQP I;  2W1O A;  2WV1 A;  2P4W A;  3MZ8 A;  5TGT A;  2PMZ N;  2VE9 A;  2KRH A;  2O03 A;  2DOA A;  3E7L A;  2NYX A;  4KMU X;  4GXO A;  1O57 A;  1SMY F;  5LEK A;  2KDZ A;  4WCG A;  5TRD A;  1SD4 A;  4XKW A;  4UNO A;  4YEL A;  1IF1 A;  2DMQ A;  1O7F A;  3GFL A;  3PFY A;  5JVG F;  3KZY A;  4E7Z A;  4A3B J;  3ULQ B;  4OU0 A;  2HPI A;  2YU9 J;  2JPC A;  3L2U A;  5H6Q A;  2EFW A;  4IX7 A;  4A3J J;  1U6G A;  2P7V B;  1U3E M;  2GBY A;  5GTH C;  4XLA A;  5B3S H;  2QLZ A;  2Y2Z A;  3GWZ A;  5DV5 A;  2XGC A;  3HOV J;  2W4S A;  5M5Y J;  3F23 A;  4CZZ A;  2CQQ A;  3HOY J;  1IV6 A;  3L1P A;  4HA8 A;  3HOU J;  3DKW A;  3FXK A;  3U1K A;  2HPM A;  2QUF A;  4RGS A;  1SVO A;  1J2X A;  4A0Y A;  4EM1 A;  3W3C A;  2OCC H;  1IDY A;  2P6T A;  3JRG A;  1LJ9 A;  5DUI A;  2MLG A;  2HYJ A;  3CME I;  4ON0 A;  5GAG J;  3DPT A;  1SD7 A;  4CSW A;  1OYW A;  3E5U A;  5EDN A;  4IOC F;  3WTY C;  2HNH A;  3MMY B;  5DCM A;  2IGO A;  4D9J A;  1D8K A;  1NG7 A;  1D0Z A;  1GVD A;  2DQL A;  2ZB9 A;  2JPB A;  4NC6 A;  2BBY A;  4XLE A;  3BR0 A;  1QRY A;  1XB4 A;  1HXD A;  2OQR A;  2MBF A;  4LLG F;  5AIQ A;  3FXL A;  5IP6 A;  2HQ5 A;  3K2Z A;  3EDP A;  2D45 A;  3H92 A;  5F1R A;  1MMA A;  1UHS A;  2KRF A;  3H9G A;  1VQL I;  4C2U A;  2QBY A;  3SYT A;  2DAO A;  1R5H A;  1BI1 A;  3MZY A;  3SHF A;  3HHH A;  4RB1 A;  2LYC A;  2JZY A;  1N75 A;  2BYV E;  1P9Q C;  2DI3 A;  2ICW G;  3PQK A;  3QOE A;  4QWQ A;  4CH7 A;  1OCO H;  2I8D A;  1GLN A;  4G8X A;  5DEQ A;  3DPL C;  2ZSI B;  3OL4 A;  1TT0 A;  2VBW A;  2XB0 X;  5DCM B;  3KEQ A;  2JN6 A;  1YIT I;  5D8L B;  1U9N A;  4HDU A;  3VPR A;  2W85 A;  2UWM A;  3OYB A;  2HTS A;  5K5R A;  2W48 A;  2EFQ A;  4RB0 A;  3TGN A;  2F5C A;  2WC2 A;  2X1E A;  5J1R A;  3SFZ A;  1WRJ A;  1FEX A;  4Y7N J;  3DTE A;  1IXC A;  3CUQ A;  4AVZ A;  3G71 I;  2RNJ A;  5JHU A;  3UNG C;  1O3S A;  1UG2 A;  2A5Y B;  2BZT A;  3LQQ A;  4MHG A;  5C3E J;  3GO5 A;  4KNY A;  1RRJ A;  3DP7 A;  2XGE A;  3TW7 A;  1CF7 A;  3C7J A;  3BJO A;  3PSI A;  1TWC J;  3DU6 A;  1I1S A;  1Z1D A;  4UHT A;  3CD6 I;  2GQQ A;  1HW2 A;  4D7N A;  4RGR A;  3VFZ A;  3B6C A;  2MW8 A;  2RAE A;  5HLG A;  1U8B A;  1BL0 A;  3Q0W A;  5KK1 A;  5LRR A;  1H89 C;  1Z3Y A;  1Z0X A;  3LSM A;  2DMU A;  4ABZ A;  3PO3 J;  2O8X A;  3T1B A;  2FA5 A;  4XNF A;  2Z99 A;  3MKW B;  2LBF A;  3K10 A;  2OTL I;  1CF7 B;  1S3J A;  3WGG A;  2FBH A;  2WA0 A;  4DW6 A;  1PP8 F;  1ZR4 A;  1DPU A;  3S16 J;  1MIJ A;  3E0J B;  1IXR C;  2YX4 A;  1EF4 A;  5E18 F;  3ZQ7 A;  3CDI A;  3ABT A;  1WJF A;  4PJJ A;  1G8X A;  1W0T A;  4DYR A;  2DOE A;  3J7Y J;  2AXL A;  2R7R A;  5LD2 C;  2NNN A;  2LP0 A;  3RZO J;  4A3D J;  1LEB A;  2DO7 A;  2HOT A;  2LBF B;  1DUX C;  3J7Z I;  2XAJ A;  4NBQ A;  3PNV A;  4HF1 A;  4GYI A;  2EZH A;  5FRO A;  3L2R A;  4IJA A;  1WH5 A;  1C0W A;  1FYL A;  2RKH A;  4L0Y B;  1X1D A;  4I02 A;  5F08 A;  4IHV A;  3HKZ A;  3A4C A;  3BPX A;  5FRM A;  3K4L A;  4LIU A;  1MW7 A;  3GZ6 A;  1MGT A;  3JRD A;  1QBJ A;  4AM3 A;  2KKO A;  2O0Y A;  5A2Q K;  5J1U A;  2PI0 A;  2K3F A;  4FE4 A;  1IUY A;  1SEU A;  3PNY A;  3WG7 H;  2M3A A;  1VQ4 I;  1ERD A;  4XKV A;  4JX6 A;  3Q3S A;  1R00 A;  4A6E A;  2BVM A;  2Y9Y A;  1GDT A;  2M2E A;  1TWF J;  3KIO A;  3A01 B;  2R4G A;  4A5M A;  3OY9 A;  4IOA F;  3LWF A;  2CW8 A;  4KT5 C;  3BR2 A;  2EIN H;  2OJE D;  3ECH A;  1OCC H;  4QSH A;  3TW6 A;  2CQ7 A;  3H5N A;  2KP6 A;  2NAZ A;  2DFI A;  4FX4 A;  1ETX A;  5J1Y A;  4BYY A;  1Z6T A;  4LIV A;  4GYG A;  3DPU A;  1RR7 A;  2FOW A;  3FM5 A;  4HV5 A;  4XRM A;  5DUK A;  3ONQ A;  5BQT A;  1U2W A;  2KHM A;  3GVA A;  2QYO A;  2JA2 A;  5ILS A;  3JRI A;  4I0A A;  4F91 B;  1HST A;  5FGM A;  3K4C A;  2L9S A;  2VXD A;  2FQ4 A;  2HKO A;  4EJT A;  1WHU A;  2MYS A;  1I50 J;  2E7X A;  1K6O A;  2Z1D A;  1EJ9 A;  2HDW A;  2X6W A;  1TBX A;  1VQ8 I;  4PGH A;  3CCV I;  3V7C A;  1HCR A;  5EF6 A;  1VQN I;  1BR2 A;  1MBG A;  4I09 A;  2R7S A;  2F5V A;  2D1V A;  2H09 A;  3VOE A;  3I53 A;  2WAF A;  5AON A;  3GZ5 A;  5FKK A;  3H0D A;  4XRS A;  3BR1 A;  1UB9 A;  2VBX A;  1VQM I;  1FBS A;  2P81 A;  4K2E A;  1I5Z A;  2KLO A;  3FF5 A;  3V42 A;  3FKJ A;  3QQA A;  2OCE A;  3TL4 X;  2XSJ C;  3PQJ A;  1IV8 A;  1IN6 A;  2ADU A;  3KEO A;  4BY1 J;  1ZN2 A;  2GWR A;  3RYP A;  3OS0 A;  3QRF F;  2A6E F;  3W2A A;  2LG4 A;  1NK2 P;  4L5I A;  1W5C C;  2E71 A;  1GV5 A;  4DIQ A;  4KA4 A;  2STW A;  2B63 J;  1I3A A;  4CCM A;  1O3R A;  2W7N A;  4WXC A;  2R0Q C;  4IZZ A;  4AIH A;  3I4N J;  1W4M A;  2NS8 A;  4HSR A;  2OPT A;  4UUT A;  1MMN A;  1V5E A;  3BG3 A;  4V2G A;  4ZC3 A;  4AIK A;  1HF0 A;  2C6Y A;  3IHU A;  3DKX A;  4ENJ A;  1AKH A;  1JE8 A;  4ZTJ A;  2Q8K A;  5BNG A;  2K86 A;  2M8G X;  4ESF A;  4BQO A;  4DBQ A;  3IH3 A;  1H9T A;  2DT7 B;  3VEP A;  1WJD A;  1B9N A;  2M34 A;  3KP6 A;  1DU6 A;  1VQK I;  3LAP A;  1U78 A;  1IRX A;  2XAG A;  5D5W B;  4IF4 A;  4N4N B;  1ETK A;  1R6R A;  3P9I A;  2EPF A;  1I1G A;  3ZN0 A;  3MWM A;  3OV8 A;  5IY5 H;  2K9S A;  3CC4 I;  2L0K A;  2W82 A;  1LFP A;  2IS2 A;  4LLL A;  3ZQH A;  5F1J A;  1W7P D;  3ZR8 X;  3S2D J;  2QF7 A;  2ZC2 A;  1G4D A;  4IHW A;  2CUE A;  4BHB A;  1K78 B;  2QSG X;  2X48 A;  5HLT A;  2NS7 A;  2V4J C;  3L7W A;  5D4R A;  2P5V A;  3I59 A;  4ETS A;  2VT2 A;  2VXZ A;  2V79 A;  3HSF A;  4KN7 X;  2BW3 A;  2UZK A;  1H9G A;  1V5F A;  3ZP5 A;  1ZG5 A;  1Y39 A;  4FIS A;  4IHT A;  1GXQ A;  3I9V 2;  3BJA A;  1X19 A;  2Z3Y A;  2L54 A;  4ZYA A;  2HOS A;  4ITV A;  2KIS A;  2GAU A;  1ZAO A;  4PSW A;  3D0S A;  2RNG A;  4XBF A;  1DDN A;  1D0Y A;  1Z67 A;  3KET A;  2JVH A;  4CO8 A;  2MFZ A;  2CW7 A;  3I59 B;  3BR3 A;  3HKZ N;  4WF2 A;  2IGM A;  3OS2 A;  2EIJ H;  1H8A C;  3H3Z A;  3O8H A;  1R4N B;  2VJ4 A;  1LUJ B;  2ID3 A;  2YX7 A;  2Y48 A;  5M5W J;  4D5F A;  3FM3 A;  4PSX A;  2FD5 A;  4UUS B;  3BPV A;  4PJM A;  4M74 A;  4HLX A;  1HA8 A;  3W6J B;  1G6N A;  5FFX A;  3F8F A;  1YTY A;  2VQG A;  3CCR I;  1T95 A;  2M8E A;  3FHN A;  4HF0 A;  2QA4 I;  2E1C A;  3DLL F;  3PUF A;  1J75 A;  3H3V K;  5J47 A;  4W1U A;  3IWF A;  2FEZ A;  3F0C A;  1RES A;  2MH9 A;  3H9Q A;  4OIR F;  3E5X A;  4RAF A;  4CCO A;  5DD4 A;  4BBS J;  2A61 A;  2QWW A;  3RKQ A;  2WY7 Q;  3IWZ A;  3CO6 C;  1IGN A;  3E5Q A;  2ZNY A;  2DFE A;  1UZC A;  3MAJ A;  1DQU A;  4FET A;  3JSP A;  2ISZ A;  1FY7 A;  2JT1 A;  1SVL A;  2JUG A;  3K2A A;  1USS A;  3QOP A;  4BXU A;  3WE3 A;  3C2H A;  1QHH D;  2XKO A;  2Y30 A;  2JA6 J;  4HX4 A;  4ZDL A;  3T0Y A;  4LD5 A;  2CMP A;  3HGY A;  2WAQ A;  1XGO A;  3S8P A;  1IJW C;  1QZY A;  2ZXJ A;  1E3P A;  3CJT B;  4UVB A;  2JRT A;  4CCN A;  2XRL A;  3OYJ A;  3ZMT A;  2W57 A;  4S04 A;  2XF7 A;  2M5W A;  2XIG A;  1VI0 A;  3HRM A;  1OCR H;  2MGQ A;  2HKX A;  2CS3 A;  3ZRG A;  3BC8 A;  1FOW A;  1OCP A;  2GOM A;  3LSH A;  1H88 C;  4UUV A;  2JA5 J;  4M3G A;  2FJ1 A;  2V26 A;  1U9O A;  1STZ A;  1LDK B;  4PGG A;  3LSP A;  1YJW I;  3HSE A;  5FB2 A;  1IC8 A;  2IRF G;  4EGZ A;  1XDU A;  4L9J A;  4G6Q A;  4C2T A;  4I76 A;  1SMT A;  1TP4 A;  3S2W A;  3A0H C;  3K4B A;  4UV9 A;  1QPI A;  3VYU B;  3SDG A;  5GAH J;  4XSZ F;  4G7O F;  1IZ1 A;  2ME0 A;  2ZO4 A;  5KAI C;  2FOK A;  4EVI A;  1VFC A;  1B1B A;  2XGD A;  2E7W A;  2YSR A;  3BZ6 A;  3GTQ J;  1EKE A;  4A3C J;  1FTZ A;  3SZP A;  2R7T A;  1E3H A;  5HOD A;  3LMM A;  1ZRF A;  4HNV A;  5ICE A;  2RGV A;  5BS6 A;  2V9K A;  1WGX A;  1FSE A;  3J7A O;  3BT9 A;  1WKM A;  1VQ9 I;  3SXY A;  3EUA A;  2DMT A;  2IEK A;  1BJA A;  5EG0 B;  2PJP A;  3GTK J;  5B5E C;  1IN4 A;  4BE0 A;  1PUF A;  1O3T A;  3ZN1 A;  3KE2 A;  1JKQ C;  2FUG 2;  4MTE A;  5TJJ A;  1JT0 A;  1HSJ A;  5KNL A;  1Y6I A;  5LLQ A;  1GT0 C;  3F8C A;  3KP4 A;  4B47 A;  1JJ6 C;  4OMY A;  2VUM J;  3BJ6 A;  2DA1 A;  2K3P A;  3JRH A;  1OMI A;  3R0J A;  4EEF G;  4FHT A;  2ELK A;  2WTE A;  2OC6 A;  1ITY A;  3ASN H;  4D7M A;  2FBK A;  3HDD A;  5H2F C;  4HQM A;  1SFO J;  3KCC A;  2NVU B;  5FKL A;  2WWY A;  1PUF B;  3FXR A;  2TDX A;  3HPH A;  3M7G A;  2ZBK A;  3RPU D;  5E3L A;  1RIO H;  2XHK A;  4E7I A;  1JUM A;  2H1L A;  4DZP A;  3CP8 A;  2MD5 A;  1BI3 A;  2K7L A;  2MA3 A;  3IP4 B;  1JUS A;  4E7K A;  4ENM A;  3CUQ C;  2O61 A;  2VQL A;  2GIZ A;  3EUK L;  3ZOB A;  2I5U A;  5E3M A;  1U0J A;  1TQI A;  2HXO A;  4M9S A;  3ZQF A;  2E2J J;  3BG9 A;  3PM1 A;  4UB6 C;  3I4M J;  1P4W A;  3ERE D;  5D5V B;  1YO5 C;  2ZSH B;  4BNC A;  3C3W A;  4MO7 A;  5B66 C;  1XMA A;  3CDH A;  4C3H J;  2R7X A;  3FXO A;  2CQX A;  4II2 A;  4CIC A;  5DS9 A;  4Q4Z F;  1WQ2 A;  4H0E A;  2LVS A;  3NAR A;  3DBL B;  2CFO A;  3AG2 H;  1PP7 U;  1W7P A;  2VIX A;  1Y8R B;  2CWE A;  2IS4 A;  4Y17 A;  1HKQ A;  3S93 A;  4B09 A;  3TQN A;  4BEH A;  2QSF X;  2GLO A;  2EZL A;  3I56 I;  3BLY A;  4A5N A;  2XKP A;  2ZXH A;  1GVJ A;  3D5S C;  3IKV A;  4DNC A;  3JTG A;  1ZGJ A;  2O5R A;  3DCF A;  4JYK A;  1IUF A;  2RV8 A;  4PJN A;  1WJA A;  3RCO A;  4ZDP A;  4DBR A;  1W1W E;  1JKR C;  1RUO A;  2MD0 A;  5L3D A;  3FXU A;  2BGC A;  4U88 A;  3R6S A;  1B72 A;  1YLF A;  2WAE A;  2OD5 A;  5M3F J;  4A93 J;  1E3O C;  1QU3 A;  4RB3 C;  2ESN A;  1NTC A;  2YUS A;  1U5T C;  5D6E A;  1MZB A;  1TW2 A;  2KRC A;  4S05 A;  2BXZ A;  3LL7 A;  2LY1 A;  4WK8 F;  4CXF A;  2B9S A;  2HYF A;  4HQE A;  1YIJ I;  5J8C A;  1WI3 A;  1WH7 A;  1WJE A;  4MTD A;  3WTS C;  2L9V A;  1KU9 A;  1FTT A;  4IHY A;  3O3K A;  1B72 B;  3WHC A;  2ZFU A;  1T6S A;  2HTJ A;  2ESH A;  2K4B A;  2AHQ A;  2DYR H;  1A04 A;  4XR6 A;  4B3A A;  1ETY A;  1XN7 A;  5F0H A;  5TIS C;  1WJC A;  4F92 B;  1K79 A;  3F6O A;  2D5V A;  2A68 F;  1Z7U A;  4FX0 A;  4KYW A;  4XL9 A;  2UXX A;  4MEX F;  5ICF A;  3OYF A;  1B59 A;  4RMN A;  2EV5 A;  2PLY A;  1POG A;  1FIA A;  3RKW A;  3QU6 A;  1GXP A;  1WJB A;  5DCF A;  2VKH A;  3B73 A;  2IPQ X;  3Q0U A;  5HS9 A;  3V7S A;  1XC5 A;  2LY2 A;  4EJO A;  5H6R A;  2JK3 A;  1YIO A;  2ELJ A;  4M6Y A;  3T8R A;  2Z2S B;  2PFB A;  4B8X A;  2XPU A;  1BI0 A;  2K9M A;  4BXF A;  1R1U A;  3CLO A;  3GTO J;  3CF2 A;  3DFG A;  3LSI A;  3MFK A;  1LEA A;  3SEQ A;  4A3F J;  2X6X A;  2BVL A;  4Y13 A;  1AWC A;  3ABM H;  4BQA A;  4O5V A;  5LGU A;  3KP3 A;  5IP9 J;  3TED A;  3S3O A;  3G73 A;  1X3W B;  1WZ2 A;  3TP0 A;  2Q2E A;  3F22 A;  2IGK A;  2M87 A;  4LJZ F;  1WWX A;  1NHA A;  2L7M P;  3BQY A;  1MJ9 A;  3TOB A;  3VOD A;  3HHG A;  5D8K B;  2M4K A;  1ON1 A;  3KLN A;  3IAS 2;  3RDI A;  4NNJ A;  1EH6 A;  4RM2 A;  1XGM A;  4EM2 A;  2CGP A;  2R92 J;  1TWA J;  2DPU A;  4HW0 A;  2M7A A;  1R1T A;  1J5Y A;  2X0L A;  3LFK A;  2E2H J;  2ISY A;  3KZZ A;  5CQE A;  1QHG A;  1JHF A;  3GW2 A;  3FMR A;  3K4M A;  1FP2 A;  3A1Y A;  4NQW A;  2STT A;  2H6B A;  2Q2E B;  2Y31 A;  3FXJ A;  4PFO A;  4A3I J;  4LOC A;  2G9W A;  3CCL I;  4ZH4 F;  3A0B C;  2A07 F;  2V7F A;  1JI8 A;  4KT6 A;  2DPD A;  2VKD A;  4ZYD A;  2VOD A;  4I7H A;  1MND A;  3U2R A;  3CLQ A;  5K7Z A;  5CKT A;  2EZK A;  2DMN A;  1I27 A;  3DEE A;  1BJZ A;  2K40 A;  4N9H A;  2D1H A;  2NS0 A;  4P1W A;  5JHF A;  4MFD A;  1KU3 A;  2CYY A;  3TO7 A;  4ESB A;  2YS9 A;  1ZH5 A;  3HEF A;  2QBY B;  4XM3 A;  4HEA 2;  1MSE C;  3LOC A;  2ZJR F;  1YRN A;  5K5Q A;  3NEU A;  2R93 J;  5LHH A;  4IHX A;  5BPI A;  1BOB A;  1ETV A;  2EJR A;  2F4O B;  5DM6 F;  2ME6 A;  2DT5 A;  3W2W A;  1XCV A;  3CES A;  4KIC A;  4ESJ A;  4LB5 A;  3HOZ J;  3OMY A;  3OYE A;  1JXS A;  3RPU A;  2LD5 A;  4BE2 A;  1WJ5 A;  3DF8 A;  1ZRC A;  3BDD A;  2HQA A;  3K70 D;  3L00 A;  4JOM A;  2BEO A;  3TP3 A;  3CUQ B;  2EV0 A;  1EH8 A;  2DMP A;  1YRN B;  3SFI A;  2XDV A;  5J8F A;  3TDZ C;  1LDD A;  3DTI A;  3DWL E;  3FBN B;  3M9A A;  1OYY A;  1FC3 A;  3WGI A;  2L01 A;  1TL8 A;  3QYB A;  1GHC A;  4OAY A;  4I0B A;  4RM3 A;  1REP C;  1NK3 P;  2CRG A;  2RC4 A;  2EB7 A;  1JUP A;  2X6O A;  3NWT A;  4Q47 A;  4C2M J;  1AOY A;  2DQR A;  5CQG A;  1P2F A;  4PCQ A;  3K70 C;  2VE8 A;  4RAG A;  5KCM A;  2JMW A;  2L9N A;  2V1D A;  1K7A A;  1KQ8 A;  2KPM A;  3L2C A;  3I54 A;  1FIP A;  2VJJ A;  4BH9 A;  5L3G A;  2AS5 F;  1U5T A;  5ICG A;  4DZJ A;  1XGN A;  5F6F A;  2KIQ A;  2GIV A;  3ZMS A;  4EJV A;  4YFX F;  5M5X J;  3FIW A;  3WTW C;  9ANT A;  4AUX A;  4HBL A;  1K4S A;  4L5J A;  1WPK A;  2PMH A;  4RAY A;  3MKZ A;  3CCJ I;  2EFN A;  2K85 A;  3GLX A;  3CCE I;  1JGG A;  3K6G A;  2IGN A;  1QGP A;  4G12 A;  5K7F A;  1R9T J;  3HPG A;  2EA2 A;  2E5Z A;  1J7K A;  4GGG A;  3M8J A;  1EH7 A;  5K5O A;  2FBI A;  1F36 A;  1E0E A;  1MBK A;  2HDC A;  4A0X A;  2E19 A;  4UB8 C;  1ETW A;  4EMS A;  2VBZ A;  2F5E A;  1Y1W J;  2AQE A;  2LNB A;  2Z33 A;  1X2N A;  2DU9 A;  3Q0V A;  1X1A A;  4PK4 A;  2KIM A;  3R4K A;  3J80 K;  1J09 A;  3GTM J;  3QP6 A;  4A6D A;  2R7D A;  3I71 A;  4JP0 A;  2V6C A;  1VQ7 I;  1YX5 A;  3IC7 A;  2F6C A;  4HF2 A;  3ZMZ A;  3ABU A;  1PJR A;  3SEZ A;  2FMY A;  4HX7 A;  2BY1 A;  3NRV A;  1QVT A;  1FZP B;  3HOW J;  2K9N A;  2EQR A;  2OQG A;  2ZJ2 A;  3MKL A;  4XOP A;  4LGW A;  4MQ9 F;  4L0Z B;  3HRT A;  5HLI A;  4B48 A;  4M71 A;  4BS9 A;  2XAU A;  4KJZ A;  3V8L A;  2KJC A;  2JJ7 A;  4P96 A;  3O8G A;  3N4M A;  2EIK H;  2EH3 A;  3WU2 C;  1RC9 A;  2D2W A;  4HRI A;  2OBP A;  3GEZ A;  4YFN F;  2M0M A;  3L09 A;  3KFW X;  3OS1 A;  1O3Q A;  3CCU I;  5DYM A;  3K69 A;  4DYC A;  1ZG3 A;  2VQH A;  1IRZ A;  1KYW A;  2GOX B;  4I01 A;  2VC1 A;  3NWS A;  2X4H A;  2NVY J;  4XID A;  3HRU A;  2XAQ A;  3ZMV A;  1OPC A;  3LA3 A;  5KVR A;  2E60 A;  3D5L A;  3LSJ A;  2XGX A;  5D4S A;  3S3M A;  1Q1H A;  4H4K C;  1BIA A;  2NOJ B;  3BCA A;  3DBR B;  4XRF A;  2DOD A;  2NRA C;  4IXA A;  2A5W A;  2QZ8 A;  3A2K A;  2E34 A;  4JK1 X;  2JUC A;  3AKZ A;  3HL2 A;  2R7V A;  4FCY A;  1OQY A;  1LVK A;  2H27 A;  2XSD C;  2BV6 A;  2EA4 A;  5B1A H;  4BL0 B;  4M73 A;  2R5Y A;  5IYD J;  1XD7 A;  1MJB A;  2K5C A;  1FT9 A;  1J59 A;  2E1O A;  2HDD A;  2OAZ A;  3K9T A;  4BXX J;  4JX4 A;  1YW8 A;  3KP2 A;  2L5Q A;  4XKC A;  3F9K A;  1T38 A;  5DTD A;  3P5J A;  4G7H F;  3GTJ J;  1YOV B;  3V4G A;  1TNS A;  4M3D A;  2P6S A;  1R1V A;  2COM A;  4NUB A;  4AYB A;  3GME A;  4C3I J;  2E2I J;  1AKH B;  3H35 A;  2VON A;  3IV5 A;  4CHU A;  4XLH A;  2N8G A;  4JX5 A;  2H6C A;  4EAT A;  5JI6 A;  1QA6 A;  3HOT A;  4Y15 A;  3GUD A;  5F04 A;  3CP2 A;  2H1K A;  3KYC B;  1TC3 C;  3IH4 A;  3AG3 H;  3DEU A;  4Z6Y A;  1X3Z B;  3EUH A;  3LFU A;  4HG2 A;  5HDK A;  3KYL A;  2LSO A;  3L2V A;  1A31 A;  2CG4 A;  4EGY A;  2IS6 A;  3BR5 A;  3K4K A;  2CO5 A;  4YG2 F;  4CYC A;  3EET A;  3AG4 H;  1I39 A;  5CLS A;  1SFX A;  1FWZ A;  2XAS A;  1K4T A;  2PJR A;  1T98 A;  2GXA A;  3KP7 A;  3GYH X;  4LG0 A;  3QPS A;  4LLN A;  3M07 A;  5FRN A;  1TZL A;  2OZ6 A;  1SAN A;  4CDG A;  4RLQ A;  3OSF A;  3VDX A;  2HQN A;  4HPQ A;  3OOU A;  2BW3 B;  2LMD A;  4IEJ A;  1OJL A;  3V7R A;  4Q48 A;  2HOE A;  4M6X A;  2MLK A;  3DEW A;  3IL2 A;  4E7H A;  4KMF A;  4MQV A;  4WXD A;  3KYD B;  2R5Z A;  2UV1 A;  1G59 A;  2CQN A;  2DDA A;  4XLF A;  4RAZ A;  3CO7 C;  5FKO A;  1DPR A;  5DM7 F;  1OCT C;  3L2Q A;  1YS6 A;  3ESW B;  4RLF A;  1XGS A;  1ZRE A;  3H9J A;  1B6A A;  2K4J A;  4M6V A;  3E6C C;  2DFH A;  2ECB A;  3H5R A;  2LKX A;  2ZFW A;  2XV4 S;  4BDY A;  4I6Z A;  2PN6 A;  3VSK A;  3BQZ A;  1HC8 A;  4F7Z A;  1D5V A;  5HDG A;  3SZT A;  3VYT B;  4F52 A;  3CF5 F;  5LGN A;  3WTV C;  2KIU A;  4IKF A;  4E7L A;  1FMV A;  5IT9 K;  4AVP A;  1RPW A;  2CUJ A;  5B1B H;  2R5Z B;  1OLT A;  3R0A A;  4QPO A;  3QP5 A;  3OYD A;  2ID6 A;  1KU7 A;  1R36 A;  2KIF A;  1S7O A;  2LFB A;  3FK6 A;  3HTU A;  3TO9 A;  5JVT A;  1CQT A;  2KZG A;  2OTJ I;  3PO2 J;  1YJ9 I;  3J81 Z;  2FSW A;  1XX5 A;  4M3F A;  5CVV A;  1F9N A;  2BOL A;  2OZU A;  1S5L C;  1JKP C;  1HW5 A;  2XPV A;  4ZTF A;  3FIS A;  5LFA A;  2JTV A;  2JSC A;  3PSF A;  3OYC A;  3QYE A;  3T5X A;  3PL8 A;  3UR3 C;  3S15 J;  2JSP A;  2ZCW A;  5FFZ A;  1ZGA A;  3M8F A;  1DP7 P;  4LIT A;  4BY7 J;  4B44 A;  3LSR A;  2W24 A;  3H5A A;  2ACJ A;  5JLW A;  2HQR A;  1TTY A;  3I3L A;  5FLV A;  3PUB A;  3FZV A;  3SDB A;  2JWT A;  2EK5 A;  3CJN A;  3JAM K;  1R49 A;  4HOB A;  1I6X A;  1UAA A;  2ZME A;  1WFX A;  3JRC A;  3DQV C;  4B3X A;  3QWL A;  1UFM A;  3ASO H;  3IUO A;  4O6J A;  1QZE A;  4PFP A;  2G7H A;  4UV8 A;  1S7E A;  1YQA A;  1HLV A;  1MBJ A;  2HYG D;  1WCM J;  4DOZ A;  1HKT A;  1FSH A;  1I6H J;  4FTH A;  4MLO A;  4OOI A;  1P4X A;  1S29 A;  3HSR A;  4XMY A;  4DJA A;  3RPQ A;  1VND A;  1ON2 A;  1T08 B;  2KT0 A;  2VAS A;  3G1M A;  5CVJ A;  2IT0 A;  2Y75 A;  5EEA A;  2RRE A;  2A69 F;  2FNP A;  4MFE A;  3W6K B;  3R61 A;  5K1Y A;  2QCO A;  3G4S I;  3KLO A;  4XK4 A;  2LRD A;  4A69 C;  5ILV A;  1VQ6 I;  1HDD C;  3K1P A;  1PUE E;  1U8R A;  3M4O J;  2G0E A;  3HB9 A;  3GFJ A;  4L18 B;  4MEY F;  1H0M A;  4IPA A;  5CVI A;  1MDM A;  2K9L A;  3CC2 I;  4BHC A;  3JSO A;  3S3N A;  3HBL A;  4FE7 A;  3I0T A;  4AYB N;  2NXN B;  3BOQ A;  4KIF A;  5IYB J;  3OR1 C;  1BR1 A;  2BXY A;  3CCM I;  2EIM H;  4YIR X;  3GFI A;  4UVA A;  2P7C B;  1HW1 A;  1TQP A;  4OWR B;  2PX9 A;  2Y9Z A;  3K1M A;  2FXA A;  4L9T A;  3ABL H;  4UVC A;  4KIB A;  2J5P A;  1YJN I;  1ZYR F;  1MDM B;  2LTP A;  5CPR B;  3CCQ I;  4BAC A;  1S7A A;  3GF2 A;  2I10 A;  4ANJ A;  1UST A;  3FDY A;  4DGW B;  3AAF A;  4ZYE A;  2X51 A;  2VOO A;  1J0R A;  3P9C A;  4M3B A;  1YW9 A;  3HYI A;  5KAF C;  4PZJ A;  4NC8 A;  1MKM A;  2RN7 A;  2PQ8 A;  1FOY A;  2CJJ A;  1VQ5 I;  3ZMU A;  1X4P A;  2W25 A;  3UKG A;  2MSY A;  4B43 A;  4Y52 J;  3E97 A;  4D5C A;  3P9K A;  1LE8 A;  1Q1V A;  3ELK A;  3E1S A;  3LST A;  2BY0 A;  1VQO I;  3BWG A;  5BPD A;  1T39 A;  2R7U A;  3WE2 A;  1OR7 C;  2VPL A;  2DDB A;  2L02 A;  3I4P A;  2RQP A;  3WTT C;  1XG1 A; 
#chains in the Genus database with same CATH homology
 3OOP A;  2WV0 A;  4CYD A;  3LQR A;  2FQ3 A;  1BIB A;  5J6X A;  5L3E A;  1IN7 A;  1W7P B;  5E1X A;  2HS5 A;  4G6D A;  5ERI A;  3I64 A;  3J80 Z;  1IN8 A;  3QPT A;  4M9Z A;  1KYZ A;  4WX9 A;  4OIN F;  1FX7 A;  1RUN A;  4RGX A;  2L3D A;  1F1Z A;  4IRG A;  3F8N A;  4ENN A;  1Z9C A;  3FMQ A;  1L3L A;  4HYE A;  3WOD F;  3N97 A;  5HLH A;  2A6H F;  1VTN C;  2HWV A;  3HIF A;  1G3T A;  2IVM A;  2PEX A;  3ZMD A;  2IA1 A;  3U1D A;  1UCR A;  3HRS A;  4HZF A;  1ZAR A;  1WI9 A;  2XAH A;  2FF4 A;  3RI4 A;  5HVQ C;  5E8I A;  2LKP A;  1JGS A;  4AD9 A;  1O7L A;  1IRG A;  3RKX A;  2Y0M A;  2XAF A;  3J81 K;  4HLY A;  2IP2 A;  1UHW A;  2CSO A;  2QQB A;  1P6R A;  2MH2 A;  1F4K A;  1TLH B;  5LGT A;  1YFH A;  5DD8 A;  5FO5 A;  1ZHF A;  1KQ9 A;  2XUB A;  1SFE A;  3F72 A;  1JHH A;  5LEJ A;  4EJW A;  2QQ9 A;  2Z5U A;  1P4A A;  2EFO A;  2W84 A;  4G94 A;  4XLP F;  4Z2Y A;  1QNT A;  4ZYH A;  4P9U A;  4R1H A;  2ZNZ A;  2GA2 A;  1IW7 F;  2DK5 A;  1XCB A;  1IN5 A;  2VN2 A;  2MC3 A;  3F8B A;  4UXN A;  1ZLJ A;  5HOO A;  2VT3 A;  3K1N A;  5FLX K;  2VOP A;  4OMZ A;  4YII A;  2IW5 A;  5E20 A;  3F21 A;  4L9N A;  2QM3 A;  5F64 A;  4ASN A;  5ICC A;  1OKR A;  4KDP A;  1Z05 A;  3QU3 A;  2F5D A;  4KN4 X;  3SQN A;  1SD6 A;  1OR7 A;  2XRN A;  1Y0U A;  1ULY A;  2CQK A;  4P9F A;  3E3V A;  1X3U A;  5CVR A;  4EJU A;  4AWX B;  4FT8 A;  2HZT A;  4IRI A;  1SD5 A;  2PG4 A;  1LVA A;  4RGU A;  3PFI A;  4U7B A;  3FXQ A;  4JQF A;  5IT9 Z;  2B0L A;  2OA4 A;  2M1B A;  3F8M A;  5LHG A;  1W5S A;  5H20 A;  2J5O A;  4G9Y A;  5DDG A;  1ONV A;  2YPR A;  3LA7 A;  2ELH A;  3RIR A;  3REO A;  2IJL A;  4OIP F;  4HDV A;  1U5T B;  3O6B B;  2HGC A;  4A2U A;  3JAM Z;  3HTS B;  2IA2 A;  4KUM A;  4ZZL A;  4EQQ A;  1ZG1 A;  1LDJ A;  2R7F A;  3H3U A;  3GX4 X;  1G3Y A;  3V8J A;  3FHZ A;  1T2K A;  2LF8 A;  4XLN F;  4N0B A;  2A3S A;  1D3Y A;  1BC7 C;  3RYR A;  4OIO F;  6PAX A;  2FE3 A;  2NNY A;  3G3Z A;  2ETH A;  3GXO A;  3DV8 A;  2M45 A;  4OIQ F;  1PDN C;  3BP8 A;  3IRQ A;  4A12 A;  2FRH A;  2CFX A;  1LQ1 A;  4DQ2 A;  4KIG A;  5AIP A;  3BRO A;  1Z6R A;  4NHJ A;  4LK0 F;  4NB5 A;  3TO6 A;  4N9I A;  4M9X A;  3FMS A;  5E17 F;  5CYV A;  1B9M A;  5LBQ A;  4P5O A;  3WU0 A;  3EQL F;  3E6D A;  2F2E A;  2L4A A;  2M30 A;  1D8J A;  1CGP A;  5E1W A;  4U0Y A;  1BM9 A;  1T0F A;  2H94 A;  1ODD A;  3HOS A;  1P92 A;  3IRR A;  4EV0 A;  1IXS B;  5EEG A;  5ILU A;  3KP5 A;  3BY6 A;  1XSX A;  1FYK A;  3FX3 A;  4ZYG A;  2VC0 A;  4MGR A;  1L0O C;  1IRF A;  3MEX A;  3LA2 A;  3IKT A;  3QPH A;  3JW4 A;  4PDK A;  4YIF A;  1FOK A;  1XMK A;  1Z91 A;  2FU4 A;  1XSD A;  2CW0 F;  2DLL A;  1XDS A;  3FWE A;  3T8T A;  2K27 A;  1K78 A;  4I2O A;  4L9V A;  3TKY A;  3WTU C;  2FML A;  2L4M A;  2G7U A;  2EV6 A;  1G3W A;  4P55 A;  1YYV A;  1W5T A;  3GFM A;  2EFP A;  1ZRD A;  1UHM A;  2FNA A;  5LRS A;  2PBI A;  1YW7 A;  5CJ9 A;  2GXG A;  3V8K A;  1KA8 A;  1G3S A;  4RS8 A;  4HV6 A;  2QVO A;  1R23 A;  1RI7 A;  3ISP A;  4MNU A;  5EEH A;  1YG2 A;  2EWN A;  4HAM A;  4LG0 B;  3WU1 B;  3EYY A;  4E70 A;  3JTH A;  1QQI A;  1RZ4 A;  1J9I A;  1LB2 A;  4ENK A;  5L3B A;  5L3F A;  1TQM A;  3M1E A;  4U7D A;  4AIJ A;  1LNW A;  2E1N A;  3LAJ A;  4ZZD A;  2DTR A;  2PMU A;  4LK1 F;  3F6V A;  5CVU A;  1FYM A;  3C18 A;  1S8N A;  2P8T A;  1S6L A;  5E1Z B;  3E6B A;  3TDU C;  4U0V A;  4EM0 B;  5FD6 A;  2O6G E;  1OYI A;  3C1D A;  4Q5S F;  3WTZ A;  5LHI A;  2RVC A;  1QZZ A;  5IT3 A;  4IVN A;  4QLC U;  1E2X A;  3ZPL A;  4G7Z F;  2HR3 A;  2VBY A;  1MD0 A;  1YS7 A;  5JFR A;  5HS7 A;  4RB2 C;  2LF7 A;  1B4A A;  4R79 A;  1QPM A;  3ROU A;  3NQO A;  2P5K A;  3TOA A;  3P7N A;  2BE5 F;  1BC8 C;  5D5X B;  4D0P A;  2QEN A;  1V4R A;  2RDP A;  1RNL A;  4IRH A;  4XSX F;  4O3M A;  2ZME B;  3Q5F A;  5FLX Z;  3M8E A;  3I58 A;  3MCZ A;  1IAW A;  1BN5 A;  1R5G A;  2Q0O A;  1F5T A;  1WSU A;  1SAX A;  4KFC A;  4M72 A;  3MQ0 A;  5D6F A;  5HDN A;  2OU2 A;  1HKS A;  3WTX C;  2GA1 A;  3COA C;  3RTR A;  3ML6 A;  1QO0 D;  4HX8 A;  1V3F A;  5JR3 A;  2F5F A;  4R8H A;  3CTA A;  1MJA A;  2V1U A;  4U0W A;  3I5U A;  1KQ0 A;  1SFU A;  5E8G A;  1KGS A;  2R3S A;  2IA0 A;  4IHS A;  5FD5 A;  5BMZ A;  2DK8 A;  3R60 A;  3ECO A;  4BHP A;  1HBX G;  3QAH A;  1ZLK A;  3Q9V A;  3EYI A;  2QQA A;  4GO1 A;  4JBA A;  3U9G A;  2LDU A;  3RJP A;  4LB6 B;  2YR2 A;  1R22 A;  3Q9S A;  3B02 A;  2Z9O A;  1R58 A;  4TV7 A;  3HUG A;  2K02 A;  2GZW A;  5L3C A;  2HFH A;  3O2P E;  1R7J A;  2P5L C;  1FBQ A;  5HS8 A;  5ED4 A;  1BBY A;  5D5U B;  2KJB A;  3WGH A;  4I98 B;  3CUO A;  4LMY A;  5A2Q Z;  2ZKZ A;  3WG9 A;  4A0Z A;  1FP1 D;  1E17 A;  1FNN A;  3L9F A;  1FPQ A;  3VB2 A;  3RKY A;  1TNT A;  3DXJ F;  1KU2 A;  3K0L A;  2YU3 A;  2V1X A;  2GXB A;  2XVC A;  1BI2 A;  2DBB A;  1EV7 A;  2HEO A;  1FBU A;  1XSV A;  1FLI A;  5BOX A;  2DW4 A;  3E6M A;  1BOA A;  3MZH A;  4WXH A;  4LFU A;  4WWC A;  1HQC A;  4CGZ A;  3F3X A;  1TW3 A;  2V9V A;  4YFK F;  4BAY A;  2UXN A;  4GCV A;  2O3F A;  2P4W A;  2VE9 A;  2O03 A;  2NYX A;  4KMU X;  4GXO A;  1O57 A;  1SMY F;  5LEK A;  4WCG A;  5TRD A;  1SD4 A;  4UNO A;  1O7F A;  3GFL A;  3KZY A;  3ULQ B;  4OU0 A;  2JPC A;  5H6Q A;  2EFW A;  1U6G A;  2P7V B;  1U3E M;  2QLZ A;  3GWZ A;  5DV5 A;  3F23 A;  4CZZ A;  4HA8 A;  3DKW A;  2QUF A;  4RGS A;  1J2X A;  4A0Y A;  4EM1 A;  2P6T A;  1LJ9 A;  5DUI A;  2MLG A;  4ON0 A;  3DPT A;  1SD7 A;  1OYW A;  3E5U A;  3WTY C;  5DCM A;  1D8K A;  2DQL A;  2JPB A;  2BBY A;  2XRO A;  5AIQ A;  1XB4 A;  2OQR A;  1HXD A;  4LLG F;  2MBF A;  3K2Z A;  3EDP A;  2D45 A;  3H92 A;  5F1R A;  2KRF A;  2QBY A;  2DAO A;  1R5H A;  1BI1 A;  3MZY A;  3SHF A;  3HHH A;  4RB1 A;  2JZY A;  2BYV E;  2DI3 A;  3PQK A;  4QWQ A;  5DEQ A;  4G8X A;  3DPL C;  5DCM B;  2VBW A;  3KEQ A;  5D8L B;  4HDU A;  2UWM A;  2W85 A;  2HTS A;  5K5R A;  2EFQ A;  4RB0 A;  3TGN A;  2F5C A;  2WC2 A;  3SFZ A;  1WRJ A;  1IXC A;  3CUQ A;  2RNJ A;  5JHU A;  1O3S A;  2A5Y B;  4MHG A;  3LQQ A;  4KNY A;  3GO5 A;  3DP7 A;  1CF7 A;  3C7J A;  3BJO A;  1I1S A;  1Z1D A;  4UHT A;  2GQQ A;  1HW2 A;  4RGR A;  3VFZ A;  5HLG A;  5KK1 A;  5LRR A;  2O8X A;  3T1B A;  2FA5 A;  2Z99 A;  1CF7 B;  1S3J A;  3WGG A;  2FBH A;  1PP8 F;  1DPU A;  1IXR C;  2YX4 A;  5E18 F;  3ZQ7 A;  3ABT A;  2AXL A;  2NNN A;  1LEB A;  2DO7 A;  1DUX C;  2XAJ A;  4HF1 A;  4GYI A;  4IJA A;  1C0W A;  1FYL A;  2RKH A;  4L0Y B;  4I02 A;  3BPX A;  3GZ6 A;  1MGT A;  1QBJ A;  2KKO A;  2O0Y A;  5A2Q K;  2PI0 A;  1IUY A;  4A6E A;  1R00 A;  4A5M A;  3LWF A;  4KT5 C;  3ECH A;  2NAZ A;  2DFI A;  4FX4 A;  4BYY A;  1Z6T A;  4GYG A;  4HV5 A;  3FM5 A;  5DUK A;  5BQT A;  1U2W A;  3GVA A;  2QYO A;  5ILS A;  4I0A A;  1HST A;  5FGM A;  2HKO A;  4EJT A;  2E7X A;  1K6O A;  1TBX A;  4PGH A;  3V7C A;  4I09 A;  2H09 A;  2D1V A;  3VOE A;  3I53 A;  5AON A;  3GZ5 A;  1UB9 A;  2VBX A;  1FBS A;  4K2E A;  1I5Z A;  3FF5 A;  3PQJ A;  1IN6 A;  2ADU A;  3KEO A;  1ZN2 A;  2GWR A;  3RYP A;  3QRF F;  2A6E F;  4L5I A;  4KA4 A;  2STW A;  1O3R A;  4WXC A;  4AIH A;  1W4M A;  4AIK A;  2C6Y A;  3IHU A;  4ENJ A;  1JE8 A;  2Q8K A;  2K86 A;  4ESF A;  1H9T A;  3VEP A;  1B9N A;  3KP6 A;  3LAP A;  1U78 A;  2XAG A;  5D5W B;  4IF4 A;  3P9I A;  1I1G A;  3ZN0 A;  3MWM A;  3OV8 A;  4LLL A;  1W7P D;  1G4D A;  4BHB A;  1K78 B;  3L7W A;  5D4R A;  2P5V A;  3I59 A;  4ETS A;  2VT2 A;  2VXZ A;  2V79 A;  3HSF A;  4KN7 X;  2UZK A;  1H9G A;  3ZP5 A;  1ZG5 A;  4IHT A;  1GXQ A;  3BJA A;  2Z3Y A;  2L54 A;  2GAU A;  1ZAO A;  3D0S A;  4XBF A;  1DDN A;  3KET A;  4CO8 A;  3I59 B;  4WF2 A;  3H3Z A;  2YX7 A;  2Y48 A;  3FM3 A;  3BPV A;  4M74 A;  4HLX A;  3W6J B;  1G6N A;  5FFX A;  3F8F A;  1YTY A;  2M8E A;  4HF0 A;  2E1C A;  1J75 A;  3IWF A;  2FEZ A;  2MH9 A;  4OIR F;  3E5X A;  5DD4 A;  2A61 A;  2QWW A;  3IWZ A;  3CO6 C;  3E5Q A;  2ZNY A;  3MAJ A;  3JSP A;  2ISZ A;  1FY7 A;  2JT1 A;  1USS A;  3QOP A;  4BXU A;  3WE3 A;  2XKO A;  4HX4 A;  3T0Y A;  4LD5 A;  1XGO A;  1QZY A;  2ZXJ A;  4UVB A;  2JRT A;  3ZMT A;  2W57 A;  4S04 A;  2M5W A;  2XIG A;  3HRM A;  2HKX A;  4UUV A;  1STZ A;  1LDK B;  4PGG A;  3HSE A;  5FB2 A;  2IRF G;  4EGZ A;  1XDU A;  4L9J A;  4G6Q A;  1SMT A;  3S2W A;  4UV9 A;  4G7O F;  4XSZ F;  1IZ1 A;  2ZO4 A;  2FOK A;  4EVI A;  1B1B A;  2E7W A;  2YSR A;  3BZ6 A;  3SZP A;  1ZRF A;  5ICE A;  2RGV A;  5BS6 A;  1FSE A;  3J7A O;  1WKM A;  3SXY A;  1BJA A;  2PJP A;  1IN4 A;  1O3T A;  3ZN1 A;  3KE2 A;  4MTE A;  5TJJ A;  1HSJ A;  5LLQ A;  4OMY A;  3F8C A;  3KP4 A;  3BJ6 A;  1OMI A;  3R0J A;  4FHT A;  2WTE A;  2FBK A;  4HQM A;  3KCC A;  2WWY A;  3FXR A;  2TDX A;  3M7G A;  2ZBK A;  1RIO H;  2XHK A;  2MD5 A;  1BI3 A;  2K7L A;  2MA3 A;  4ENM A;  2O61 A;  3CUQ C;  1TQI A;  4M9S A;  1P4W A;  3ERE D;  5D5V B;  1YO5 C;  4BNC A;  3C3W A;  1XMA A;  3CDH A;  4CIC A;  4Q4Z F;  1WQ2 A;  4H0E A;  1PP7 U;  1W7P A;  2CWE A;  4Y17 A;  1HKQ A;  4B09 A;  3TQN A;  4A5N A;  2XKP A;  1GVJ A;  3IKV A;  4DNC A;  3JTG A;  1ZGJ A;  2RV8 A;  1RUO A;  5L3D A;  3R6S A;  3FXU A;  2BGC A;  4U88 A;  1YLF A;  2OD5 A;  4RB3 C;  2ESN A;  1U5T C;  5D6E A;  1MZB A;  1TW2 A;  4S05 A;  4WK8 F;  4CXF A;  2HYF A;  4HQE A;  5J8C A;  4MTD A;  3WTS C;  1KU9 A;  3O3K A;  1T6S A;  2HTJ A;  2ESH A;  2K4B A;  1A04 A;  1XN7 A;  1K79 A;  3F6O A;  2A68 F;  1Z7U A;  4FX0 A;  4KYW A;  4MEX F;  2UXX A;  5ICF A;  1B59 A;  2EV5 A;  2PLY A;  3RKW A;  3QU6 A;  1GXP A;  5DCF A;  3B73 A;  2IPQ X;  5HS9 A;  3V7S A;  4EJO A;  5H6R A;  1YIO A;  3T8R A;  4M6Y A;  2PFB A;  4B8X A;  1BI0 A;  1R1U A;  3CLO A;  3DFG A;  3MFK A;  1LEA A;  4Y13 A;  1AWC A;  4BQA A;  4O5V A;  5LGU A;  3KP3 A;  3G73 A;  2Q2E A;  3F22 A;  2M87 A;  4LJZ F;  1WWX A;  1NHA A;  1MJ9 A;  3TOB A;  3VOD A;  3HHG A;  5D8K B;  1ON1 A;  3KLN A;  3RDI A;  4EM2 A;  1EH6 A;  2CGP A;  1XGM A;  2DPU A;  4HW0 A;  1R1T A;  1J5Y A;  2X0L A;  3LFK A;  2ISY A;  3KZZ A;  1JHF A;  3GW2 A;  3FMR A;  1FP2 A;  4NQW A;  2STT A;  2H6B A;  2G9W A;  4ZH4 F;  2A07 F;  2DPD A;  4ZYD A;  2VOD A;  4I7H A;  3U2R A;  1I27 A;  4N9H A;  2D1H A;  2NS0 A;  1KU3 A;  2CYY A;  3TO7 A;  4ESB A;  1ZH5 A;  2QBY B;  5K5Q A;  3NEU A;  5LHH A;  5BPI A;  2EJR A;  2DT5 A;  1XCV A;  4KIC A;  4ESJ A;  4LB5 A;  1JXS A;  3RPU A;  3DF8 A;  1ZRC A;  3BDD A;  3L00 A;  2BEO A;  3CUQ B;  2EV0 A;  1EH8 A;  5J8F A;  3TDZ C;  1LDD A;  3M9A A;  1OYY A;  1FC3 A;  3WGI A;  2L01 A;  1GHC A;  4I0B A;  1REP C;  2RC4 A;  2EB7 A;  4Q47 A;  1AOY A;  2DQR A;  1P2F A;  4PCQ A;  2VE8 A;  2V1D A;  1K7A A;  1KQ8 A;  3L2C A;  3I54 A;  4BH9 A;  5L3G A;  2AS5 F;  1U5T A;  5ICG A;  1XGN A;  5F6F A;  2GIV A;  3ZMS A;  4EJV A;  4YFX F;  3WTW C;  4HBL A;  4L5J A;  2PMH A;  4RAY A;  2EFN A;  3GLX A;  1QGP A;  2EA2 A;  1J7K A;  4GGG A;  1EH7 A;  5K5O A;  2FBI A;  2HDC A;  4A0X A;  4EMS A;  2VBZ A;  2F5E A;  2LNB A;  2Z33 A;  2DU9 A;  2KIM A;  3R4K A;  3J80 K;  3QP6 A;  4A6D A;  2R7D A;  3I71 A;  2V6C A;  3IC7 A;  4HF2 A;  3ZMZ A;  3ABU A;  2FMY A;  4HX7 A;  3NRV A;  1FZP B;  2OQG A;  2ZJ2 A;  4LGW A;  4MQ9 F;  4L0Z B;  3HRT A;  5HLI A;  4M71 A;  3V8L A;  2KJC A;  4P96 A;  3N4M A;  2D2W A;  2OBP A;  3GEZ A;  4YFN F;  3L09 A;  3KFW X;  1O3Q A;  5DYM A;  3K69 A;  1ZG3 A;  1KYW A;  4I01 A;  2VC1 A;  2X4H A;  3HRU A;  2XAQ A;  3ZMV A;  1OPC A;  3LA3 A;  5KVR A;  3D5L A;  2XGX A;  5D4S A;  1Q1H A;  1BIA A;  4XRF A;  2NRA C;  4IXA A;  2QZ8 A;  4JK1 X;  2H27 A;  2BV6 A;  2EA4 A;  4M73 A;  1XD7 A;  1MJB A;  1FT9 A;  1J59 A;  2OAZ A;  3K9T A;  1YW8 A;  3KP2 A;  1T38 A;  4G7H F;  3V4G A;  1TNS A;  2P6S A;  1R1V A;  2COM A;  2VON A;  4CHU A;  2H6C A;  5JI6 A;  3HOT A;  4Y15 A;  3GUD A;  3DEU A;  3EUH A;  5HDK A;  2LSO A;  2CG4 A;  4EGY A;  2CO5 A;  4YG2 F;  3EET A;  5CLS A;  1SFX A;  1FWZ A;  2XAS A;  1T98 A;  3KP7 A;  3GYH X;  4LG0 A;  4LLN A;  2OZ6 A;  4CDG A;  2HQN A;  3V7R A;  4Q48 A;  2HOE A;  4M6X A;  2MLK A;  3IL2 A;  4KMF A;  4MQV A;  4WXD A;  4RAZ A;  3CO7 C;  1DPR A;  1YS6 A;  1XGS A;  1ZRE A;  1B6A A;  2K4J A;  3E6C C;  2ZFW A;  2XV4 S;  2PN6 A;  1D5V A;  4F7Z A;  5HDG A;  3SZT A;  3WTV C;  5LGN A;  2KIU A;  5IT9 K;  4AVP A;  3R0A A;  3QP5 A;  1KU7 A;  1R36 A;  2KIF A;  1S7O A;  3HTU A;  3TO9 A;  5JVT A;  3J81 Z;  2FSW A;  5CVV A;  1F9N A;  2OZU A;  1HW5 A;  2JTV A;  2JSC A;  3T5X A;  5FFZ A;  2ZCW A;  1ZGA A;  3M8F A;  1DP7 P;  2W24 A;  2ACJ A;  2HQR A;  1TTY A;  3FZV A;  3JAM K;  2EK5 A;  3CJN A;  4HOB A;  1I6X A;  2ZME A;  3DQV C;  1UFM A;  4O6J A;  4UV8 A;  2G7H A;  1YQA A;  2HYG D;  1HKT A;  1FSH A;  4OOI A;  1P4X A;  1S29 A;  3HSR A;  1IF1 A;  3RPQ A;  1ON2 A;  5CVJ A;  2IT0 A;  2Y75 A;  2A69 F;  2FNP A;  3W6K B;  5K1Y A;  3R61 A;  3KLO A;  5ILV A;  3K1P A;  1PUE E;  1U8R A;  3GFJ A;  4L18 B;  4MEY F;  1H0M A;  4IPA A;  5CVI A;  1MDM A;  4BHC A;  3JSO A;  3I0T A;  3BOQ A;  4KIF A;  3GFI A;  4UVA A;  2P7C B;  1HW1 A;  1TQP A;  3K1M A;  2FXA A;  4L9T A;  4UVC A;  4KIB A;  2J5P A;  1ZYR F;  1MDM B;  1S7A A;  3GF2 A;  1UST A;  3AAF A;  4ZYE A;  2VOO A;  1J0R A;  3P9C A;  1YW9 A;  3HYI A;  4PZJ A;  1MKM A;  2RN7 A;  2PQ8 A;  3ZMU A;  2W25 A;  3E97 A;  3P9K A;  3ELK A;  3LST A;  3BWG A;  5BPD A;  1T39 A;  3WE2 A;  2L02 A;  3I4P A;  2RQP A;  3WTT C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...