1PUEE

Pu.1 ets domain-dna complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
88
structure length
88
Chain Sequence
b'KIRLYQFLLDLLRSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKGNRKKMTYEKMARALRNYGKTGEVKKVKKKLTYQFSGEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*AP*AP*AP*AP*AP*GP*GP*GP*GP*AP*AP*GP*TP*GP*GP*G)-3
publication title A new pattern for helix-turn-helix recognition revealed by the PU.1 ETS-domain-DNA complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 22
structure length 88
sequence length 88
chains with identical sequence F
ec nomenclature
pdb deposition date 1996-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1pueE00
2EK5A 1YW7A 3L7WA 3GLXA 3WU1B 2ACJA 2RC4A 1TNTA 2GA1A 3TKYA 1D8JA 5CVIA 1C0WA 5BPIA 5E20A 4UV9A 5LGNA 4IVNA 5E17F 1YS6A 1A04A 1GVJA 3RPQA 5FFXA 2GIVA 1BI1A 2KRFA 3K1NA 5LHIA 1TW2A 2M8EA 3ECHA 2L3DA 3BY6A 3H3UA 3M8FA 1H9TA 1SAXA 4U88A 1SD7A 5D5VB 5ED4A 4R8HA 4Y17A 3V7SA 3KP3A 3MFKA 1ODDA 2ZXJA 3L9FA 2FMYA 5D4SA 3RKXA 3M9AA 3JAMZ 3GXOA 5LHGA 4ZYEA 4HLYA 1Z9CA 4YIFA 5LHHA 1Z6RA 2HEOA 3JW4A 2W84A 1TQMA 2PEXA 5HOOA 2PI0A 3R61A 3JTGA 4LLLA 3TO9A 2P5KA 1LDKB 2Y48A 1IN8A 1F5TA 5LEKA 3I59B 1R23A 1SMTA 2FSWA 3P7NA 1I5ZA 4HZFA 4A6DA 4FHTA 5J8CA 2HR3A 1IRFA 4RS8A 4LJZF 3I71A 2P8TA 3F8BA 4I09A 5CLSA 2EFQA 2QENA 1U2WA 1KU7A 3RKWA 2HOEA 3BOQA 1FBUA 4M71A 2P4WA 1ZG1A 2QYOA 3MZHA 4HX4A 2DW4A 3TGNA 5E1WA 2M87A 2HTJA 2K27A 2VOOA 4I7HA 4GXOA 5AIPA 2XV4S 3KETA 3HRSA 4U0YA 1GXQA 3ZMUA 1O7LA 4G8XA 3GFLA 1J9IA 2J5PA 3H92A 1YYVA 1I27A 3WU0A 1IXRC 2VBWA 3H3ZA 3QU6A 4MHGA 3V7RA 2HGCA 4LLNA 2OAZA 3F8CA 3CLOA 5FLXK 2C6YA 4WCGA 1QZYA 3HRUA 3O2PE 3K2ZA 4Q47A 4CHUA 3RJPA 4RB1A 1HKSA 2B0LA 2IA2A 3N4MA 2IT0A 1FLIA 2ZNYA 1ZYRF 1YFHA 5H6QA 3LWFA 3WE3A 4BNCA 3ML6A 1U78A 4O3MA 2PQ8A 4I98B 4LG0B 4MNUA 4P96A 1BM9A 1R1TA 1PDNC 1ZAOA 5L3DA 4XLNF 2L02A 5LGTA 5FD6A 1TNSA 1SFXA 2H09A 4EJWA 4IHSA 1O3TA 2QLZA 3ISPA 1XDSA 4O5VA 3KP6A 3I58A 2Z3YA 5HDKA 1BBYA 2DAOA 3GZ6A 4G6QA 2YU3A 3CJNA 2MD5A 4ESBA 1HW2A 3EYIA 4TV7A 2AXLA 2ZMEB 2ZO4A 3EUHA 2XUBA 2IA0A 5CVVA 4KFCA 2FEZA 3HSEA 4XRFA 5ERIA 1QQIA 1IUYA 3LAPA 3R0JA 3NRVA 2O0YA 5DCMA 4WF2A 3QOPA 2V1UA 2UXNA 2Y0MA 4BHBA 1KA8A 2VC1A 1T0FA 4R1HA 4AWXB 2ISYA 2M45A 1B59A 3HSFA 1S6LA 2Z5UA 2XROA 1MDMB 3WGGA 3DPLC 4IRHA 1YLFA 3K9TA 2EJRA 2FBIA 1XCVA 3HYIA 1GXPA 1FP1D 5JI6A 2YR2A 3ZP5A 4EGYA 1P4AA 4U0VA 4L9VA 5BMZA 4U7BA 5LGUA 1EV7A 4F7ZA 3U1DA 3HIFA 3MZYA 2XRNA 3F8MA 5LRRA 2BV6A 4ZZDA 4L18B 2G7HA 4KN7X 3B73A 1Z05A 2QQAA 1FWZA 4UV8A 1KQ9A 4L0YB 2LF7A 4XSZF 4JQFA 3C3WA 2MH9A 4ZZLA 3ZMZA 4HF1A 2ESNA 5FFZA 3I54A 4R79A 2QBYB 2EA2A 2H6CA 3IRRA 3BJOA 4HOBA 4YIIA 1FZPB 4K2EA 5LEJA 5IT9K 2EV6A 4HDUA 1WSUA 2R3SA 3D0SA 2RVCA 3REOA 3R6SA 1P4WA 1OYYA 4RAYA 2DO7A 3WTXC 4RB0A 1K6OA 1KGSA 1EH8A 4NB5A 3O6BB 4Q48A 3GX4X 2DU9A 1XMAA 1FSHA 1X3UA 1S8NA 5ICGA 4KIBA 2F5EA 4BXUA 2QQBA 4EGZA 2K02A 5F6FA 1G3TA 3I59A 1OPCA 4M73A 1HKQA 3BZ6A 2OQGA 3F8NA 4L0ZB 4PGHA 3SQNA 2G9WA 1VTNC 5HLGA 1GHCA 2P6TA 4CZZA 3E6MA 2L01A 3B02A 5LRSA 3EETA 4B09A 2XGXA 4CYDA 4PZJA 4HV5A 3T0YA 4HQMA 2MLKA 1PUEE 2IP2A 2VBXA 2UXXA 4OIOF 3QPTA 4A12A 2VT3A 1I1SA 5BS6A 1Z6TA 1FY7A 3U9GA 4UXNA 4RAZA 4M9ZA 5JR3A 4ZYDA 2Q0OA 3R4KA 3GWZA 1SD5A 5A2QZ 1JGSA 3GVAA 2FOKA 3I4PA 1TW3A 5E1ZB 3LA2A 2Q8KA 2GAUA 4G7ZF 1FOKA 3ZPLA 3CDHA 3EYYA 1RNLA 3KLOA 1IAWA 4UVAA 1TQIA 1R5GA 3SZPA 1FC3A 1B9NA 2FE3A 3ECOA 1K78B 4A5NA 4L9TA 1B1BA 5L3CA 2V79A 5ICEA 1R5HA 3BJAA 5BQTA 4XLPF 2CFXA 3EQLF 2GZWA 4KYWA 3GEZA 3ZMVA 3HRMA 1WRJA 3E97A 3KP7A 1LQ1A 4KA4A 2RV8A 1TBXA 1USTA 2STTA 3BPXA 1W5TA 3TOBA 2VODA 3IL2A 2K86A 3NEUA 3WTVC 4L9JA 3F8FA 2A6EF 2EFWA 1HW1A 1OMIA 4UUVA 2RGVA 1W7PB 2BE5F 1EH7A 1WKMA 4QLCU 1LDJA 1FSEA 4HX7A 2FMLA 3SHFA 4OIQF 2QQ9A 2RNJA 4IHTA 3W6JB 1OR7A 5F1RA 3CO7C 5HDNA 4HF2A 2XKPA 3FF5A 5ILUA 1ZARA 4HQEA 5E1XA 2ZMEA 2ZCWA 2O8XA 1KYZA 2OZ6A 3LFKA 1SD6A 4RGSA 5K1YA 2H27A 3CUQB 2MBFA 1B4AA 1PP8F 4HAMA 1V3FA 3K1MA 2FRHA 1FT9A 1AWCA 2K7LA 2ADUA 4HV6A 2STWA 1LJ9A 3ZN1A 1ZG3A 1ZGJA 2FBHA 1ONVA 4ENMA 1U8RA 2UWMA 2O03A 1O3QA 3KP4A 3RYRA 1E2XA 2M30A 4A0XA 5E18F 1MDMA 3J7AO 4L9NA 4I01A 3JAMK 4M72A 1ZREA 3WGIA 3S2WA 1IN7A 2OD5A 2HKOA 2K4BA 1ZRFA 1J2XA 4A2UA 4EJUA 4HYEA 4KDPA 2CO5A 5L3EA 3RDIA 3VEPA 4YFXF 1V4RA 3K1PA 3M8EA 2K4JA 2RN7A 5DEQA 3WGHA 4GO1A 3LQQA 3ERED 2IW5A 4AIJA 2HWVA 4I0BA 1U3EM 5LLQA 3HHHA 3N97A 1D8KA 2HFHA 3VODA 3M1EA 2P7VB 2JPCA 4M6YA 2ETHA 2A5YB 1RIOH 2XAJA 5K5RA 2VOPA 5ILVA 4NQWA 1SFEA 5L3BA 3L2CA 1XGNA 3LA3A 3RPUA 4EJVA 5AONA 3WTTC 5DUKA 2BYVE 1OYIA 2D2WA 3KP2A 3VB2A 1G3SA 2EV5A 3CUQC 3F22A 2QBYA 4N9HA 1FPQA 4ZYHA 4CGZA 2EFOA 1UHMA 2R7DA 2DQRA 3EDPA 4KIFA 1P92A 2LKPA 1U6GA 4I0AA 1Z91A 4U7DA 1DPUA 4MGRA 1ON1A 4RGUA 3E6CC 2KJBA 2PMUA 2H6BA 3GYHX 3IC7A 2X0LA 1Z1DA 1ZHFA 2ELHA 3Q9VA 5E8GA 2VN2A 4I2OA 1P2FA 5HDGA 5E8IA 1XD7A 4KN4X 3SZTA 1YW8A 4HLXA 1KQ0A 4LGWA 4UVCA 5KVRA 2BGCA 4G9YA 3LSTA 1IRGA 2ISZA 2EV0A 4OU0A 1OYWA 2E1CA 2HQRA 4BAYA 3AAFA 4KUMA 1REPC 1D5VA 3F3XA 3MAJA 4G7OF 5D6EA 4GYIA 3V8JA 2WC2A 5FB2A 4L5JA 5DV5A 1BIAA 1UB9A 2HDCA 1TLHB 4Y15A 1R22A 1MD0A 4U0WA 4CXFA 4IJAA 1KYWA 2CSOA 2P5VA 4CO8A 1DUXC 1LEBA 4MTEA 4B8XA 2Z99A 3MWMA 3TOAA 1PP7U 2HQNA 1USSA 3RYPA 1XB4A 2QM3A 1JHFA 2YX7A 4A0ZA 3IWFA 1FX7A 3FXRA 2HYFA 2Z33A 2GA2A 4MTDA 1I1GA 3JSPA 2A69F 1BIBA 1UHWA 3OV8A 2EA4A 3J81Z 2IJLA 5ILSA 1K78A 4OIRF 3K69A 2P5LC 1RUOA 4EMSA 1MKMA 1ZRDA 2NRAC 3D5LA 2FNAA 4AVPA 3M7GA 1XN7A 3WG9A 1FBQA 2KKOA 4RGRA 4GCVA 3IKTA 4AIHA 4YG2F 2WWYA 3CO6C 2LF8A 1Z7UA 3BDDA 3W6KB 1YIOA 6PAXA 5D8LB 2Q2EA 2LNBA 2PLYA 3IKVA 3T1BA 3LA7A 2YPRA 5TRDA 1W7PA 1MZBA 5JFRA 2A61A 1ON2A 1YO5C 1G4DA 1RUNA 2QVOA 5J6XA 1RZ4A 5K5OA 1HQCA 3ROUA 2DK8A 3F6VA 5IT9Z 4DQ2A 3WE2A 1ZH5A 4D0PA 1K7AA 2L4AA 1QO0D 1G3WA 1LDDA 4ENJA 5FGMA 2DLLA 2L54A 1R58A 3CUQA 2ZNZA 2VC0A 1TQPA 2OQRA 1HBXG 2TDXA 4ESFA 2DBBA 2GQQA 2L4MA 3F6OA 2BEOA 1BOAA 4A5MA 3ELKA 4KICA 3KP5A 1ULYA 3BJ6A 4HDVA 2YSRA 1K79A 4MQVA 3KLNA 2CYYA 1XCBA 3K0LA 2F5DA 4G94A 1FYKA 1XGSA 1D3YA 5CVUA 1O3SA 3FWEA 3T5XA 5L3FA 2VXZA 4BHPA 5CYVA 4PGGA 2CWEA 3GFJA 3F23A 1KQ8A 4RB2C 4WXHA 5H6RA 3KZZA 4FX0A 1IF1A 2OA4A 3WTYC 2J5OA 3ZQ7A 1HW5A 2EWNA 4KMUX 3WODF 1MJAA 2D1VA 3DP7A 3QPHA 4DNCA 1YW9A 1XSVA 4L5IA 4ASNA 1U5TB 3WTWC 2V9VA 4QWQA 3HTUA 2KJCA 2XAQA 5D4RA 3R60A 1CGPA 4EJOA 3L09A 2NS0A 1BN5A 5D8KB 3E5QA 2PG4A 5F64A 1UCRA 1LB2A 1YQAA 3DFGA 2GXGA 2HKXA 2YX4A 4WXCA 1L3LA 2CW0F 4EJTA 4RGXA 3GW2A 3OOPA 4EM2A 2IRFG 2PN6A 2HYGD 2V1DA 5BPDA 5HS9A 3DQVC 1R1VA 1BJAA 5K5QA 1MGTA 3U2RA 5D5UB 4PDKA 1J5YA 3J80K 4CDGA 5CVRA 4A0YA 4FX4A 1SD4A 2VT2A 4WK8F 3ZMSA 4BH9A 3ABTA 2HTSA 1XMKA 2NNNA 4LB6B 2LDUA 3Q9SA 3DF8A 2XIGA 4UHTA 3CUOA 1RI7A 2VBZA 4YFKF 3SFZA 4MEYF 1W4MA 1YTYA 3FZVA 4N9IA 1HSTA 1ZLKA 1UFMA 3KCCA 1U5TC 5J8FA 5HS7A 3FXQA 4BQAA 2PBIA 1Y0UA 4I02A 2IPQX 1IN4A 2NNYA 4BYYA 1QNTA 4EVIA 2PJPA 2JSCA 3V7CA 4P5OA 4HW0A 3FM3A 2JPBA 2JT1A 2LSOA 1F1ZA 3HUGA 2W24A 5TJJA 1R7JA 3VOEA 2V6CA 4KMFA 3V8LA 3HOTA 2XAGA 2FA5A 1T2KA 5HLHA 2VBYA 3GF2A 3WTUC 2MA3A 4PCQA 4M6XA 4ENNA 1IW7F 3ZMTA 1WQ2A 1T6SA 4EM1A 3MQ0A 5D5XB 1YS7A 3DV8A 1DPRA 3R0AA 1FNNA 1QZZA 1S7AA 4HX8A 1ZGAA 1BC7C 2D45A 1O7FA 2F2EA 3GO5A 1AOYA 2DI3A 3FMQA 2RQPA 2DT5A 3BROA 2O61A 2NAZA 4P9FA 3IWZA 4M74A 2FF4A 3TDZC 4YFNF 1KU3A 4IF4A 5IT3A 2EFPA 5FLXZ 4EQQA 2W57A 4WX9A 1FYMA 2BBYA 1O3RA 1BI2A 2R7FA 1H0MA 5DD4A 1O57A 3FXUA 3COAC 4GYGA 1T39A 5CVJA 3E5XA 3GFMA 2KIFA 2OU2A 2DFIA 1ZG5A 1ZLJA 1JHHA 2DQLA 3KEQA 4LD5A 2D1HA 3E3VA 1HKTA 1FP2A 1DDNA 1R36A 2RKHA 2ZJ2A 4H0EA 1CF7A 4LK1F 2HS5A 5DUIA 3DKWA 4RB3C 3JTHA 1BC8C 4Y13A 3V4GA 1XDUA 2EB7A 3KEOA 3P9KA 2VE8A 2DTRA 2ZFWA 1G3YA 3PFIA 2OZUA 5BOXA 2VE9A 2P6SA 2GXBA 1LNWA 3VFZA 2A6HF 2JTVA 2DPUA 3P9CA 4HA8A 2PFBA 1QPMA 4JK1X 2H94A 3TDUC 5H20A 2FBKA 4O6JA 3KFWX 3NQOA 1HXDA 3RKYA 3HTSB 4HF0A 4AIKA 1XSXA 3QU3A 3I0TA 1EH6A 3O3KA 4S04A 2QWWA 3ABUA 5HVQC 2E7XA 1YG2A 2FQ3A 1BI3A 5JVTA 2MC3A 3RTRA 1H9GA 2MH2A 2IA1A 1ZN2A 1P4XA 3T8RA 3GZ5A 1G6NA 3FX3A 3QP6A 4MQ9F 1U5TA 3FHZA 4WXDA 5KK1A 5DYMA 2OBPA 3BPVA 5DDGA 1HSJA 4G6DA 2COMA 2XASA 3QP5A 3ZN0A 3WTSC 1QBJA 4P55A 1XGOA 1TTYA 4N0BA 1XSDA 3E6BA 2O6GE 3HHGA 1R00A 2E1NA 3LAJA 1BI0A 2X4HA 3J81K 3MCZA 5DD8A 1KU9A 5HLIA 5L3GA 3HRTA 2DPDA 3Q5FA 2FNPA 2AS5F 4KNYA 4IPAA 1F9NA 4JBAA 1OKRA 1J59A 3F72A 3GFIA 2G7UA 5D6FA 1IXSB 2ESHA 4LB5A 3KE2A 1S3JA 4AD9A 1I6XA 4S05A 3E5UA 4WWCA 2JZYA 3I53A 1FYLA 2KIMA 2M5WA 2XVCA 4XSXF 1SFUA 4MEXF 3SXYA 4LLGF 4XBFA 3JSOA 3PQJA 3T8TA 1IN5A 1S7OA 3DEUA 1XGMA 1T38A 1F4KA 4OINF 5JHUA 1IN6A 4LMYA 1QGPA 4LK0F 4EM0B 4OIPF 4ZH4F 3HSRA 4G7HF 2XAFA 3C18A 2WTEA 2Z9OA 4EV0A 1W7PD 2V1XA 3FMRA 4KT5C 3QAHA 2A07F 5HS8A 5CJ9A 4E70A 1CF7B 2JRTA 1LVAA 1B9MA 1L0OC 1S29A 3C7JA 3I5UA 3G3ZA 5LBQA 2CQKA 4P9UA 2F5FA 4NHJA 3C1DA 3TO7A 2A3SA 4IXAA 3BWGA 3IHUA 2M1BA 1MJBA 4OOIA 3DPTA 1T98A 3I64A 2VONA 2W25A 1WWXA 5DCFA 2IVMA 5AIQA 4HBLA 5ICFA 4ON0A 2HZTA 1ZRCA 2FXAA 5EEGA 4ENKA 2W85A 5EEHA 1DP7P 1NHAA 4ESJA 3HOSA 4M9XA 3TO6A 3P9IA 4UVBA 5FO5A 2E7WA 3V8KA 1J75A 1B6AA 4KIGA 4LFUA 3LQRA 4Q5SF 3RI4A 1E17A 1JE8A 1KU2A 3GUDA 2QUFA 5FD5A 4Q4ZF 3PQKA 2P7CB 2MLGA 5ICCA 1R1UA 4FT8A 2A68F 1J7KA 2DK5A 2QZ8A 5DCMB 2XKOA 3KZYA 3L00A 1P6RA 4UNOA 4IRIA 1MJ9A 1WI9A 3FMSA 2PMHA 1STZA 2CGPA 3BP8A 5A2QK 1IZ1A 2O3FA 3E6DA 1JXSA 2CG4A 3ZMDA 4CICA 2GWRA 1FBSA 1LEAA 1SMYF 3CTAA 4IRGA 3RIRA 3MEXA 2EFNA 2XAHA 1Q1HA 2F5CA 2Y75A 3QRFF 3TQNA 5D5WB 2WV0A 3IRQA 1IXCA 2UZKA 2RDPA 2XHKA 3G73A 4OMYA 1J0RA 2NYXA 3F21A 3FM5A 3ULQB 4BHCA 1W5SA 4M9SA 2ZKZA 4GGGA 4ZYGA 4Z2YA 4OMZA 2KIUA 4ETSA 2ZBKA 4A6EA 2FU4A 3DXJF 3WTZA 4LG0A 3J80Z
chains in the Genus database with same CATH superfamily
2EK5A 1YW7A 3L7WA 1MIJA 2LP0A 3BQZA 2LTPA 4NUBA 3GLXA 3HOYJ 3WU1B 2ACJA 3CMMA 4C3HJ 1OCRH 2RC4A 1TNTA 1VQ8I 2GA1A 3TKYA 1BA5A 2V26A 4NNJA 5GTHC 1D8JA 5CVIA 1C0WA 4C2UA 1SAUA 3EUHC 5EEAA 5BPIA 5E20A 2F4IA 2BXZA 3FK6A 4UV9A 5LGNA 4IVNA 4BE0A 1A5JA 5E17F 4D5CA 3QYEA 4E7JA 1YS6A 1A04A 2YS9A 1GVJA 3RPQA 5FFXA 2MG4A 2GIVA 1EKEA 1BI1A 2KRFA 3K1NA 5LHIA 1TW2A 2M8EA 4A3LJ 2OJED 3ECHA 4NBQA 5F0CA 1TWCJ 2CV1A 2IGMA 1TWFJ 2L3DA 3BY6A 2X6WA 3H3UA 3M8FA 4PK4A 1H9TA 1FOWA 2KRHA 1SAXA 4U88A 3G6EI 1SD7A 1Y8RB 3Q0WA 4JX4A 5D5VB 5EG0A 1KONA 5ED4A 1LUJB 1V55H 4R8HA 2HVSA 4Y17A 3V7SA 1BW5A 1T0FC 3KP3A 2V6EA 3MFKA 1ODDA 2DMUA 5FRNA 2K9SA 3FK7A 3PSIA 1Y1WJ 2ZSHB 2ZXJA 3L9FA 3NWSA 2FMYA 1VFCA 2Y9YA 5D4SA 2XF7A 3RKXA 3M9AA 3JAMZ 3GXOA 5LHGA 3ZGKA 4ZYEA 4HLYA 1Z9CA 4YIFA 2A05A 5LHHA 1Z6RA 2WA0A 3HG9A 2R7RA 2HEOA 3JW4A 3MKZA 2W84A 4IQJA 3LSPA 1TQMA 2PEXA 1X2MA 3BG3A 5HOOA 2PI0A 2XB0X 3R61A 3JTGA 2FQ4A 2ZJPF 1OFCX 1JUSA 4LLLA 3TO9A 2WY7Q 1IGNA 2P5KA 1LDKB 3GLLA 2Y48A 1IN8A 1F5TA 5LEKA 3I59B 1R23A 1SMTA 2FSWA 3P7NA 1I5ZA 4HZFA 3FXLA 4BL0B 4A6DA 3GTOJ 4IHYA 4FHTA 4A3KJ 3CC7I 5GADJ 5J8CA 2HR3A 3S14J 1IRFA 4RS8A 4LJZF 3I71A 2P8TA 4XKBA 1QHGA 2HU9A 3F8BA 4I09A 5HLTA 3CZ6A 3UR3C 1DU0A 5CLSA 2EFQA 2KIQA 2QENA 1U2WA 1KU7A 1M1EB 3RKWA 1UZCA 3WU2C 2X6OA 3W6VA 3MMYB 2JWTA 3RZOJ 3CJQB 2W48A 3BC8A 3S1NJ 2HOEA 3BOQA 1FBUA 4M71A 4XLCA 5M5YJ 2P4WA 2UUZA 3RCOA 1ZG1A 4XLEA 2QYOA 4LIVA 3MZHA 4HX4A 1E3PA 2DW4A 3ESWB 4W97A 3TGNA 3IAS2 5E1WA 1MNEA 1VQ4I 3KEYA 2VQHA 2M87A 2HTJA 3OL4A 1DQUA 3V42A 1NH3A 1W1WE 2K27A 4AYBA 2VOOA 1A36A 4I7HA 4GXOA 5AIPA 2I10A 3HOUJ 2H1LA 2XV4S 4DIQA 3CCVI 3KETA 3HRSA 3BTJA 4U0YA 3K4LA 1GXQA 1MSFC 3ZMUA 2ME0A 1O7LA 1Z0XA 4G8XA 2IBDA 3GFLA 3I4MJ 4QSHA 1J9IA 3VYUB 2J5PA 1WVRA 3H92A 1YYVA 1I27A 3WU0A 4E6KG 2Q1ZB 1XMXA 1IXRC 2BHYA 2VBWA 1V5FA 3H3ZA 3QU6A 4MHGA 5B3SH 1ERDA 3V7RA 3HBLA 2DJIA 3RPUD 2HGCA 3ZQQA 4LLNA 3OS0A 4MIMA 2OAZA 1A31A 2JJ7A 2E1OA 3CLOA 3F8CA 5FLXK 2C6YA 3J7ZI 4WCGA 1QZYA 3Q0UA 2HNHA 1W0UA 3HRUA 3O2PE 3K2ZA 4Q47A 2QEXI 4HRIA 4XLFA 4B44A 3I3LA 4OAZA 2L9VA 4CA0A 3RJPA 4RB1A 4CHUA 1HKSA 3ONQA 4E7ZA 2B0LA 2K3FA 2VJIA 3DU6A 4UB8C 1X3ZB 2IA2A 3HKZA 3N4MA 1WJDA 2IT0A 2AXTC 1FLIA 2ZNYA 1A6QA 1ZYRF 1YFHA 1MH4A 4C2MJ 3N05A 3UKGA 5H6QA 1N25A 2BY2A 1AA7A 3LWFA 3WE3A 4BNCA 3ML6A 1U78A 2YU9J 4O3MA 2PQ8A 2BHZA 2L5QA 4I98B 4LG0B 4MNUA 4P96A 1BM9A 1R1TA 1PDNC 1ZAOA 5L3DA 1MBHA 2F48A 4XLNF 2QF7A 2L02A 5LGTA 5DM7F 2DDBA 5FD6A 4FETA 1TNSA 1D0YA 5FKLA 1SFXA 2H09A 5FLMJ 3BR0A 4EJWA 2JRMA 1O3TA 4IHSA 2VASA 2QLZA 3ISPA 1XDSA 5C44J 4O5VA 3KP6A 3WHBA 3I58A 4X6AJ 4BBRJ 1BW6A 2Z3YA 4ZC3A 1BBYA 4QPQA 5HDKA 3JRCA 3CMEI 3CCQI 1MNMC 2DAOA 1LFPA 4G6QA 3GZ6A 2YU3A 3GTJJ 3CJNA 3BG5A 1YE9A 2MD5A 4N4NB 4ESBA 2XGCA 1HW2A 4XK4A 3EYIA 4FE4A 4TV7A 1D0ZA 2AXLA 1HOMA 2DTZA 4ZJZA 2NOJB 2ZO4A 2ZMEB 4B48A 3EUHA 1DU6A 3PL8A 2DN0A 1IV8A 2XUBA 5K7HA 2IA0A 2FUG2 5CVVA 3HL2A 3B6AA 4KFCA 2FEZA 3HSEA 4XRFA 1IDYA 5ERIA 3H9JA 1QQIA 3MKYB 3ZQGA 1VQMI 3LL7A 1IUYA 4RDUA 3LAPA 3EUKL 3QODA 1Y6IA 5H2FC 5F27A 3R0JA 3ABMH 3NRVA 2ECCA 4D7NA 2DMQA 2O0YA 2KQRA 5DCMA 4CUGA 1E0EA 4WF2A 3QOPA 2V1UA 2UXNA 2Y0MA 4BHBA 1KA8A 2VC1A 2VJ4A 1R9TJ 3BCAA 1T0FA 4R1HA 4AWXB 2E36A 2ISYA 2M45A 1B59A 3HSFA 2MYSA 4XR6A 2R0QC 1S6LA 2RREA 2Z5UA 2XROA 1MDMB 3WGGA 3DPLC 2M34A 4IRHA 1YLFA 3K9TA 2R5ZB 2EJRA 4V2GA 3K4CA 1LE8A 2FBIA 1GVDA 1XCVA 1MH3A 3HYIA 3C2GA 3VWBA 2LR8A 1FEXA 1GXPA 1B72A 2VJ5A 1FP1D 2KPMA 5CKTA 4B47A 2I8DA 3JRBA 5JI6A 2YR2A 2LY1A 3ZP5A 2GIZA 1OCCH 4EGYA 1P4AA 4U0VA 4L9VA 5BMZA 1NG6A 4U7BA 4C9YA 5M3FJ 5JLXA 5LGUA 5EDNA 1EV7A 2PX9A 4NC8A 3G1MA 2LBFA 3TP0A 4F7ZA 3U1DA 3HIFA 4BKXA 2E19A 3MZYA 1XS9A 1PYVA 4G12A 1JKQC 3W3CA 2B63J 2HQAA 2PJRB 2XRNA 3F8MA 5LRRA 2BV6A 4ZZDA 1BR4A 2G7HA 4KN7X 3B73A 1Z05A 5F0HA 1U8BA 4L18B 1OJLA 4L5EA 4OWRB 2L7MP 2QQAA 1QVUA 1WH7A 1N77A 2X1DA 5CQGA 1FWZA 2Z1DA 4BY7J 4NQWB 4OAYA 1J09A 4UV8A 1KQ9A 1OR7C 4YEJA 2A6TA 3OMYA 4MLOA 4L0YB 2LF7A 5E79C 2DA3A 4XSZF 2LYCA 4JQFA 2CUZA 4F93B 2HVRA 2DMTA 1FOXA 4M3DA 3AG2H 2OCCH 3C3WA 2MH9A 2ZMEC 3FXKA 1VQKI 4ZZLA 3A01B 2R93J 5DM6F 1WH5A 2ECBA 3ZMZA 4HF1A 4I76A 4A3IJ 2R7VA 2ESNA 3HC7A 5FFZA 3I54A 4R79A 2QBYB 3AL0B 2EA2A 2H6CA 3DWLE 2HOTA 1X2NA 3IRRA 3BJOA 5FLVA 4A3EJ 4HOBA 4YIIA 5M3MJ 4B3XA 1FZPB 2FD5A 3K7AJ 4K2EA 5LEJA 3S2DJ 1EF4A 2E2JJ 1LPQA 3SEQA 2EV6A 1TC3C 5IT9K 3CD6I 4HDUA 1WSUA 3PUFA 3CJTB 1MSEC 2R3SA 3D0SA 2RVCA 3REOA 3R6SA 1P4WA 2KZGA 1OYYA 2MW8A 4RAYA 2DO7A 3L1PA 4BBSJ 1TWAJ 1QPIA 5KHDA 3WTXC 4RB0A 1K6OA 2NS7A 3SDGA 5F04A 3BG6A 4LITA 2OUMA 1KGSA 1EH8A 4NB5A 3O6BB 4Q48A 3GX4X 5TISC 2DU9A 1XMAA 2A5WA 3DLLF 1FSHA 1X3UA 1S8NA 4XONA 5ICGA 4KIBA 2F5EA 5FKKA 2KLOA 4HG2A 4BXUA 1RRJA 2QQBA 4EGZA 2K02A 5F6FA 1I3QJ 4IL6C 3W2AA 1G3TA 1ETQA 3GMEA 3I59A 1OPCA 3C2HA 1VQPI 3DEEA 4M73A 1HKQA 3BZ6A 4D5FA 1RESA 2OQGA 3F8NA 2M0CA 4PFPA 1FOYA 1BR2A 4L0ZB 4PGHA 3J7AY 3SQNA 2G9WA 1VTNC 5HLGA 1V54H 3P5JA 1GHCA 2P6TA 4CZZA 2TCTA 3E6MA 3LSJA 1GV5A 3HM5A 2L01A 1P7JA 4ZTJA 3B02A 5LRSA 3EETA 4B09A 2XGXA 4CYDA 1K4TA 4CCOA 3LSMA 4PZJA 2I5UA 3OYJA 4HV5A 3T0YA 4HQMA 2CQXA 5B5EC 3I4NJ 2E35A 2MLKA 3FDYA 5HNFA 1PUEE 2IP2A 3BR6A 2VBXA 2UXXA 3SJMA 2W82A 4OIOF 3QPTA 4A12A 1D0XA 2VT3A 3JRDA 1JTYA 1I1SA 1DP3A 1VZ0A 2F4MB 5BS6A 1Z6TA 3FBNB 1FY7A 3U9GA 3PNVA 1ZKGA 4UXNA 2NVQJ 2QCOA 4RAZA 1Y1VJ 4M9ZA 3HOWJ 5JR3A 3S2HJ 2KRCA 4ZYDA 2Q0OA 2DFFA 3R4KA 4Y4RA 3GWZA 4IHXA 4PJJA 1SD5A 5A2QZ 1JGSA 3AL0C 3GVAA 4HNVA 2FOKA 3I4PA 5IP9J 3CCUI 2QA4I 1TW3A 5E1ZB 3LA2A 3JRAA 4BGDA 2Q8KA 3ABKH 2E71A 3FHNA 3H5RA 1GLNA 2GAUA 2P0WA 3A02A 3KYDB 4G7ZF 4JX6A 1FOKA 3ZPLA 1R71A 3CDHA 3EYYA 3CCEI 1RNLA 3KLOA 1IAWA 1YX5A 4IQ4A 1QU3A 4UVAA 1TQIA 2WAQN 2ME6A 1R5GA 3SZPA 3LFUA 1FC3A 3BR2A 4H4KC 2W00A 3OYDA 1B9NA 2FE3A 3ECOA 2CFOA 1K78B 2QQ8A 4A5NA 5EZHA 3KZIC 3S93A 4L9TA 1JJ6C 3S1QJ 1WHUA 1H89C 1B1BA 5L3CA 2V79A 2LBFB 5ICEA 1R5HA 3Q0VA 3BJAA 5BQTA 1Z3XA 3DTKA 4XLPF 1Z67A 3HDDA 2LC2A 2V7FA 2CFXA 3EQLF 2XGEA 2GZWA 4KYWA 3GEZA 1P9QC 4P1WA 4KJZA 3HRMA 1WRJA 3ZMVA 3JRGA 3E97A 1VF9A 3KP7A 1LQ1A 3GTLJ 2F4OB 1RC9A 4KA4A 2RV8A 1XC5A 1TBXA 4BE1A 3OR2C 1USTA 1X1BA 4BACA 2STTA 1POGA 3BPXA 3FIWA 2KP6A 1W5TA 2ZB9A 3TOBA 4XLAA 2VODA 2MABA 3TW7A 5KAIC 1X19A 3IL2A 2K86A 3DTIA 2Q2EB 2ELKA 3NEUA 3WTVC 4L9JA 1DGWY 3F8FA 2A6EF 2VPRA 5J1YA 3H35A 1HW1A 2EFWA 3TP3A 1OMIA 4UUVA 2RGVA 2X51A 4XOTA 1S7EA 1W7PB 4BQOA 3S3MA 4Y52J 2BE5F 1EH7A 1WKMA 3G1OA 2HVQA 4QLCU 5BNGA 1LDJA 3TBIA 2LD5A 4E7HA 1FSEA 4HX7A 2FMLA 3SHFA 4OIQF 2QQ9A 3HXLA 2RNJA 2L9NA 4IHTA 3W6JB 1YJWI 1OR7A 5F1RA 1R4NB 3CO7C 5HDNA 4HF2A 2XKPA 4A69C 3FF5A 4LOCA 3K4NA 1ZARA 5ILUA 4C2TA 3CCSI 4HQEA 1X1DA 2LY2A 2ZMEA 2LOOA 2ZCWA 5E1XA 4QIWN 1S5LC 5J1UA 2O8XA 1KYZA 2OZ6A 3LFKA 1YI2I 1SD6A 4RGSA 5K1YA 1X4PA 1X58A 2H27A 3CUQB 1IC8A 2MBFA 1B4AA 1PP8F 4HAMA 2VQLA 1V3FA 3K1MA 2FRHA 1FT9A 1AWCA 2QKMB 2K7LA 2ADUA 4HV6A 3L2QA 2STWA 1LJ9A 4PJ0C 3NWTA 1ZG3A 3ZN1A 1SANA 1ZGJA 2COBA 2FBHA 1ONVA 2NVTJ 4D7MA 4ENMA 1U8RA 3OOUA 2UWMA 2O03A 1O3QA 2L7KA 3KP4A 3RYRA 2ZJRF 5GP9A 1BOBA 4PJNA 3KIOA 2JA2A 2JUCA 3JR9A 4LG3A 1E2XA 1RETA 2M30A 4A0XA 5E18F 4FQGA 1MDMA 2R7TA 3J7AO 2DA4A 4RAGA 3CQZJ 3IUOA 4J01A 5B66C 4L9NA 5E3NA 3LSGA 4I01A 4Y3OA 4M72A 3JAMK 2R5ZA 1ZREA 4UY8I 1VQNI 3OYHA 1RPWA 2EZKA 3WGIA 3S2WA 1IN7A 2OD5A 2E2HJ 2DT7B 2HKOA 2K4BA 3K4MA 1ZRFA 1J2XA 4A2UA 3LSHA 4EJUA 1LVKA 3GZNB 4HYEA 4KDPA 2CO5A 5L3EA 3RDIA 3VEPA 3S32A 1NK3P 3OYEA 1VQ9I 2JK3A 4YFXF 1IRXA 2EBIA 3HPGA 4RLQA 3S3OA 3LSKA 1V4RA 1I50J 3K1PA 3M8EA 1WFXA 3E7LA 3SZGA 5K7FA 3IH3A 3PUBA 2BW3B 2K4JA 2RN7A 5DEQA 3WGHA 2Y2ZA 4GO1A 3ASNH 3CMAI 2EPFA 3LQQA 3ERED 3K70C 4GDFA 2LH9A 2IW5A 5M5WJ 2PJRA 4AIJA 2HWVA 4I0BA 2KDZA 1U3EM 5LLQA 4RA2A 3HHHA 3N97A 1HA8A 1D8KA 2HFHA 1TWGJ 1U0JA 2DDAA 3VODA 1VQ7I 3M1EA 2R7QA 1WJCA 2P7VB 3QQAA 5EYRA 2JPCA 3SEZA 4M6YA 2XF5A 4AM3A 2ETHA 2A5YB 4XL9A 5JVGF 3HGGA 1RIOH 1MW7A 2XAJA 5K5RA 2VOPA 2X6YA 5ILVA 1T33A 4NQWA 1SFEA 5L3BA 3L2CA 1XGNA 3LA3A 3RPUA 4EJVA 5AONA 5TGTA 2HOAA 4CCNA 3WTTC 5DUKA 2BYVE 2NVYJ 1OYIA 2D2WA 4W1UA 2DMNA 3KP2A 4X1EA 3VB2A 1G3SA 3A01A 3HPHA 1NK2P 3OYNA 2EV5A 4AYBN 3CUQC 4JP0A 3F22A 4IX7A 2QBYA 4N9HA 1FPQA 2DA6A 2R7OA 4ZYHA 1JKRC 4CGZA 4CCJA 2EFOA 2EZHA 1UHMA 2R7DA 3A1YA 2DQRA 3EDPA 4E4HA 4KIFA 1P92A 2LKPA 3F0CA 4YELA 1U6GA 4I0AA 4PSWA 5J47A 1Z91A 4U7DA 1WI3A 3HOVJ 1DPUA 4MGRA 1ON1A 4RGUA 3E6CC 2KJBA 3CDLA 2PMUA 1KZHA 4ABZA 2H6BA 4RAFA 3GYHX 3IC7A 4DZJA 3AG4H 2X0LA 3JREA 1Z1DA 1OCPA 4IEJA 1ZHFA 1CQTA 4E7IA 2ELHA 1ZR4A 3Q9VA 4UB6C 4CH7A 3K2AA 5E8GA 1JT0A 3OYCA 1JGGA 3CCRI 2VN2A 4I2OA 2F6CA 3VYRB 4IKFA 1P2FA 2OTLI 3EUAA 4DYCA 5IYCJ 3OY9A 2ZFUA 5HDGA 5E8IA 5E3LA 1UJ8A 3PM1A 1W36D 3BG7A 1XD7A 4KN4X 3HKZN 3LSIA 3SZTA 1YW8A 2HXIA 2KISA 3HB9A 4HLXA 1KQ0A 4LGWA 4M3GA 4UVCA 5KVRA 2BGCA 4G9YA 1RKTA 4XQFA 3LSTA 1IRGA 2ISZA 2EV0A 2DYRH 4OU0A 2XF6A 3CESA 1OYWA 3CCJI 2E1CA 4GRIA 2HQRA 1VQOI 4BAYA 3AAFA 2X48A 4KUMA 2CV2A 1REPC 1D5VA 3DEWA 3F3XA 2DA7A 1LKXA 2DFEA 3MAJA 4G7OF 5D6EA 4GYIA 3L2UA 2KT0A 3V8JA 3D5RC 2WC2A 5FB2A 2DT6A 2BZTA 2LRDA 2V1NA 3QOEA 4L5JA 1IV6A 1FJLA 5GAEJ 5DV5A 1BIAA 1MBEA 1UB9A 4QTRA 3TMOA 2X85A 2HDCA 1TLHB 1ETVA 5EGOB 4Y15A 1R22A 1MD0A 2CMPA 4XNFA 5F1JA 3MVPA 4U0WA 4CXFA 4IJAA 1K4SA 4IOCF 1KYWA 2CSOA 2P5VA 2V9KA 4CO8A 4FASD 1DUXC 3GTQJ 1LEBA 4XLHA 3M8JA 5B1AH 3GBGA 4MTEA 3OYIA 2X1EA 4B8XA 2Z99A 3MWMA 4II3A 3TOAA 1PP7U 2HQNA 1VQ5I 1USSA 3RYPA 1XB4A 3SYTA 5GPCA 2QM3A 2VKDA 1TT0A 2BVMA 1JHFA 2YX7A 4A0ZA 3IWFA 2P81A 2IGKA 2CW8A 3HUGB 1FX7A 3FXRA 2HYFA 2Z33A 3GTPJ 2GA2A 2K3PA 2KZVA 1IG7A 1WZ2A 4MTDA 1I1GA 3JSPA 2A69F 1BIBA 4ZDPA 3KYCB 1UHWA 2HYJA 3OV8A 3NARA 2EA4A 3J81Z 5DS9A 2IJLA 2LY9A 4Y33A 5ILSA 1K78A 4EATA 2LMDA 4OIRF 2HI3A 3K69A 2P5LC 5IY5H 1RUOA 1E3HA 4EMSA 1MKMA 2OCEA 1ZRDA 2NRAC 3OYAA 3D5LA 3OYGA 2FNAA 1MNDA 2M8GX 4AVPA 1ORKA 1ZTRA 3K6GA 5HODA 2VKHA 4ZTFA 4IHVA 4CCMA 3M7GA 1XN7A 3WG9A 1X1CA 1FBQA 1SC7A 3VYTB 4M6VA 1WGXA 2KKOA 2LFBA 4RGRA 4GCVA 3ZRGA 3DBHB 3IKTA 3BTLA 1K83J 1X1AA 4BQNA 3G71I 4AIHA 4RBOA 1TL8A 1NTCA 2QSFX 4YG2F 3IAM2 3WG7H 2WWYA 3CO6C 2R7SA 4C3JJ 2LF8A 1Z7UA 2ID6A 4Z6YA 1A35A 3S3NA 1R49A 2XSDC 3BDDA 3W6KB 1YIOA 6PAXA 5D8LB 2Q2EA 2LNBA 1N78A 3B6CA 1FTTA 2PLYA 3IKVA 3T1BA 3LA7A 3WHCA 2YPRA 5TRDA 1W7PA 4BJ5C 1MZBA 4B3AA 5JFRA 2KHMA 2R7UA 3PJRA 2KMUA 2A61A 1ON2A 4E7SA 4A93J 1YO5C 1G4DA 4IOAF 1RUNA 2EQRA 2QVOA 2IGOA 5J6XA 1RZ4A 5K5OA 1HQCA 2MGQA 3ROUA 3OR1C 3K4JA 2DK8A 2JVGA 1YRNB 3F6VA 5IT9Z 2EIJH 2HOSA 4DQ2A 3WE2A 4I6ZA 1ZH5A 4D0PA 1K7AA 1T08B 2L4AA 1AKHB 1QO0D 3ZR8X 1G3WA 1LDDA 4ENJA 5FGMA 2DLLA 2O9LA 2L54A 4FCYA 1R58A 3BR3A 3CUQA 3L2WA 2ZNZA 3IH2A 4I99C 3BG9A 1MMGA 4MO7A 2VC0A 1TQPA 2OQRA 1HBXG 2TDXA 2VXDA 4ESFA 2DBBA 3L2RA 4XOPA 2GQQA 2L4MA 3F6OA 1WCMJ 1S72I 2BEOA 4XN3A 1BOAA 1MMAA 1QZEA 1VQLI 2Z2SB 4A5MA 3ELKA 4KICA 3KP5A 1X3WB 2HQ5A 5J4YA 1ULYA 4PJLA 3BJ6A 3AG3H 4HDVA 2NS8A 4GFBA 2YSRA 1K79A 4XRMA 4MQVA 3KLNA 4DW6A 3CCLI 4II2A 2DA2A 2CYYA 1XCBA 3K0LA 2F5DA 1UELB 4G94A 3W2VA 1FYKA 1XGSA 3CP2A 3BCBA 1D3YA 4KISA 5CVUA 1O3SA 5EF6A 4JX5A 2XPUA 1XX5A 3FWEA 3T5XA 3U1KA 5L3FA 3A2KA 5C4XJ 4XKCA 1TT5B 4A3DJ 2LREA 1S9HA 3VSLA 2VXZA 2W4SA 4BY1J 3ZQHA 5E3MA 2XPVA 3F9KA 4BU2A 4BHPA 5CYVA 1ZELA 1T56A 2BW3A 4CYCB 1UMQA 2KDOA 4KT6A 4PGGA 3VSKA 4X0GA 4XRSG 2CWEA 2Y30A 3DCFA 3DTEA 1XPXA 3HZJA 2NVXJ 2XGDA 3GFJA 3F23A 1SFKA 3ZOBA 3ZQFA 2H1KA 1H8AC 2Y31A 3K4BA 1KQ8A 1E3OC 4RB2C 1T95A 2KFDA 4WXHA 4YRVA 5C4JJ 2GBYA 5B1BH 1SVLA 3CF2A 5F0FA 5H6RA 2ELJA 1Z7LA 2LVSA 3KZZA 4FX0A 1Y39A 1ETOA 1IF1A 1X1PA 2JQ7A 3PNTA 3OIOA 1ITYA 1OCZH 2CW7A 2OA4A 4C3IJ 1EJ9A 1QRYA 3WTYC 3H0GJ 5C3EJ 4RMNA 2X1CA 2J5OA 3C2BA 3ZQ7A 1HW5A 2EWNA 4KMUX 3WODF 1MJAA 2D1VA 3DP7A 1Z3YA 3QPHA 4DNCA 4ITVA 2CQNA 2X9DA 2CUJA 1YW9A 1XSVA 2CS3A 4L5IA 2NVUB 4ASNA 5LD2C 1SEUA 3OYLA 9ANTA 1U5TB 3WTWC 2V9VA 3X2QH 3OS1A 4QWQA 3W2WA 3L2VA 5IOYA 3HTUA 2KJCA 1PUFB 5FKOA 3E0JB 2XAQA 3OYBA 2K9NA 3CP8A 2JA8J 5D4RA 3R60A 1CGPA 2IGNA 4M3EA 2O5RA 4EJOA 2BOLA 3L09A 3J7YJ 3OIQA 1IDZA 2NS0A 1BN5A 1RKWA 5D8KB 3E5QA 2G0EA 2IS2A 3TW6A 2M4GA 2PG4A 5F64A 1UCRA 4J19A 2BY1A 2O8KA 1LB2A 1YQAA 4AC0A 3DFGA 2GXGA 2HKXA 2YX4A 4WXCA 4D1QA 1L3LA 2CW0F 4EJTA 1WJAA 4A3GJ 2VKEA 2MC4A 4RGXA 3GW2A 3OOPA 4EM2A 2HXOA 2PN6A 4CZCA 2IRFG 3K10A 1JKOC 3JRFA 2HYGD 2L9RA 2AHQA 2R5YB 4BQQA 2V1DA 2DA1A 5HS9A 2K9LA 3DQVC 5BPDA 1ZR2A 2ZXWH 2VQCA 2EIKH 4F55A 4CCLA 1BR1A 4XKWA 4E7KA 2OC6A 2E2IJ 1R1VA 2VI6A 2RAEA 1BJAA 1FTZA 5K5QA 1MGTA 1D1BA 1G59A 3U2RA 2Y0SA 4BJTA 5D5UB 1RR8C 4PDKA 2DODA 1D1CA 2ID3A 2WBMA 1J5YA 3IH4A 4F3QA 2DCEA 3EPZA 4C30A 3J80K 4CDGA 2M9HA 5CVRA 4A3MJ 2DA5A 2BY0A 2FX0A 4A0YA 1HDPA 4FX4A 1I39A 1SD4A 4AUXA 2VJJA 4HEA2 3ZCOA 3PFYA 2VT2A 3JCUC 4WK8F 3ZMSA 4BH9A 3ABTA 3A03A 2Z16A 3FBIB 2HTSA 1XMKA 4MFEA 5J40A 2NNNA 4HNTA 3DLAA 1O4XA 3PSFA 2BVLA 5F08A 5E3OA 4LB6B 3ERMA 2Y0SN 4BUPA 2LDUA 3Q9SA 3DF8A 4U87A 2XIGA 4UHTA 3CUOA 1RI7A 2ZSIB 2VBZA 2LKXA 5EGOA 4YFKF 2JN6A 3ZQCA 3SFZA 4MEYF 3BZCA 1W4MA 1YTYA 1A6IA 1GDTA 3FZVA 4N9IA 2XRLA 1AU7A 1HSTA 2E34A 4ZDLA 1R4MB 4DOZA 5JHFA 1ZLKA 1UFMA 3KCCA 1HLVA 1U5TC 1YIJI 5J8FA 2AQEA 3FXQA 5HS7A 2PBIA 1Y0UA 3QPSA 1R5ID 2DMPA 4BQAA 4I02A 2KL4A 2IPQX 4KITB 1IN4A 2NNYA 4BYYA 4PFOA 1QNTA 4EVIA 3D1NI 2JSCA 2PJPA 4RLFA 3V7CA 1WJFA 4P5OA 4HW0A 2JA5J 1IJWC 4ZYAA 5HNHA 3LSRA 5FRMA 3FM3A 2H8RA 2JPBA 2JT1A 3RZDJ 2LSOA 1F1ZA 5IYBJ 2R7XA 5IYDJ 4MFDA 3ASOH 1N75A 3HUGA 4F91B 2W24A 3A0HC 3KPHA 5TJJA 3OYMA 1R7JA 3VOEA 1IRZA 3M07A 2V6CA 3CMYA 1UAAA 2K9MA 4KMFA 3V8LA 1YX3A 5JLWA 3HOTA 2XAGA 2FA5A 1T2KA 1XG1A 4YIRX 5HLHA 2CQ7A 2VBYA 3GF2A 3WTUC 2MA3A 4PCQA 4M6XA 4ENNA 1IW7F 2PMZA 3ZMTA 1WQ2A 4IHWA 2ZJQF 1FIPA 1T6SA 4EM1A 3MQ0A 3CDIA 5EJCA 1SVMA 1MBFA 5D5XB 1YS7A 1D5YA 3DV8A 1DPRA 1ETWA 4UUSB 3VPRA 3SFIA 3R0AA 1FNNA 1QZZA 3M4OJ 3QYFA 2MFZA 1FIAA 2DOFA 3BTCA 2HZDA 2H8WA 1RR7A 4PUSA 5FKNA 1YJNI 1S7AA 2IS6A 1I6HJ 4HX8A 1JJ8C 2NXNB 4V19K 1ZGAA 2DOAA 1BC7C 2L9SA 1B8IB 3H3VK 2K9QA 2PMZN 3FXMA 2D45A 1O7FA 2F2EA 3GO5A 3Q3SA 2E60A 1AOYA 2DI3A 3FMQA 1T8IA 2RQPA 2XAUA 3H9QA 2DT5A 2LK2A 3BROA 4Y7NJ 2O61A 2NAZA 2VL8A 4P9FA 3MZ8A 3IWZA 4M74A 3H36A 2FF4A 3TDZC 4YFNF 4DZPA 1KU3A 4RM3A 2W7NA 3PIOF 2D5VA 4IF4A 2JUGA 5IT3A 1UHSA 2EFPA 4LIUA 3LNQA 2HPMA 1ETXA 5FLXZ 4EQQA 1FMVA 3DBLB 2W57A 2AO9A 5J1RA 4WX9A 1FYMA 2OF7A 2BBYA 1O3RA 1WPKA 2CV0A 2V4JC 1XTAA 1BI2A 3KYLA 3RQ4A 1YRNA 2R7FA 1H0MA 5DD4A 1O57A 4DYQA 3QPLA 3FXUA 3COAC 2E5NA 4GYGA 5KCMA 1T39A 5CVJA 1AKHA 3E5XA 3GFMA 1HF0A 2K40A 2KIFA 1GUUA 2OU2A 2DFIA 1ZG5A 3OSFA 2CU7A 4BEHB 1ZLJA 1JHHA 2DQLA 3CC4I 3KEQA 4A3BJ 4LD5A 4B4CA 2D1HA 2WV1A 3E3VA 3G1LA 1OCOH 1HKTA 1OISA 3S17J 1FP2A 3ZXSA 1DDNA 2X6XA 1Z21A 2XB5A 3RKQA 3I9V2 2E5ZA 1R36A 2RKHA 1ZGWA 3OWTA 2ZJ2A 2JA7J 3M1CA 2RQQA 4H0EA 1Y8QB 2CUEA 1HDDC 1CF7A 2Y69H 4LK1F 3G2BA 2HS5A 2IEKA 5DUIA 2XSJC 4E7LA 2R7ZJ 3UNGC 3DKWA 1ENHA 4NC7A 3RQIA 3PO3J 4RB3C 3JTHA 1IO2A 2EH3A 1BC8C 3HGYA 2FOWA 1Y0NA 2IS1A 4Y13A 3V4GA 4DBQA 2R4GA 3A4CA 2XPWA 4JYKA 1XDUA 3PIPF 4DGWB 3I56I 4BJ6C 2EB7A 1U9OA 5DTDA 3KEOA 4AVZA 3P9KA 2VE8A 2VB6A 2GXAA 2K85A 3H5AA 2DTRA 2EINH 2ZFWA 1BL0A 1G3YA 2EZIA 3PFIA 2OZUA 5BOXA 4HSTA 2VE9A 4F52A 2P6SA 2GXBA 2OTJI 3H1CA 2WB1A 2HDWA 1ETKA 3TEDA 1LNWA 2DXIA 1YJ9I 3DKYA 3VFZA 2A6HF 1LFUP 1IUFA 1ETYA 2JTVA 2DPUA 3P9CA 2CH0A 2CUFA 3BR1A 4HA8A 2PFBA 5CPRB 4AIDA 1QPMA 4JK1X 2H94A 4CYCA 3DBRB 3TDUC 1JUPA 2R7WA 5H20A 2FBKA 4O6JA 3KFWX 3H9GA 3NQOA 1HXDA 4CCKA 3RKYA 3HTSB 2IXSA 4HF0A 4XRSA 4AIKA 2L7FP 1XSXA 3QU3A 3I0TA 4A3JJ 1EH6A 3O3KA 5EG0B 4S04A 5KNLA 4JOMA 4NC6A 2ZXIA 3H0DA 2M2EA 2DYSH 3QYBA 2DJNA 2QWWA 3ABUA 1FMWA 3OS2A 5HVQC 2WB1N 3FISA 2E7XA 1YG2A 1JT6A 3BZKA 2FQ3A 1BI3A 5JVTA 1WJEA 2V9PA 2MC3A 3RTRA 1VI0A 2WADA 3I55I 1H9GA 1X4OA 4N4OB 3PO2J 3BT9A 2MH2A 2IA1A 1G8XA 1ZN2A 1R6RA 1VNDA 2B7EA 1ZK8A 3MD2A 4ANJA 1P4XA 4D9JA 2FJ1A 2M3AA 3T8RA 1ACIA 3GZ5A 1G6NA 3FX3A 3QP6A 4MQ9F 1APLC 1U5TA 2M4KA 3FHZA 4WXDA 5KK1A 3BLYA 2F5VA 5DYMA 2OBPA 3BPVA 5DDGA 1HSJA 1TWHJ 2VLAA 1PUFA 1SFOJ 4G6DA 3PNYA 3M3YJ 2COMA 3RSNA 2XASA 5IP6A 3FKIJ 3QP5A 2IAIA 3ZN0A 3WTSC 1QBJA 4M3BA 4P55A 4XORA 1OCTC 1XGOA 1TTYA 4F92B 4N0BA 1SVOA 2E1MB 3HJEA 5KAFC 1XSDA 3E6BA 4BDZA 2O6GE 3HHGA 4ZDOA 3ZQIA 4J00A 3A0BC 1R00A 2RNGA 5IOZA 2E1NA 3HOXJ 2LLKA 3LAJA 1BI0A 5FKMA 2MD0A 2X4HA 4QPOA 4HNUA 3GTKJ 3J81K 2JA6J 3FKJA 3MCZA 4DJAA 5DD8A 1KU9A 5HLIA 3O8HA 5L3GA 3HRTA 2DPDA 3Q5FA 4G6TB 1W0TA 2EILH 2FNPA 3LMMA 3JRHA 2R5YA 2AS5F 4KNYA 4IPAA 1F9NA 2ZC2A 2BXYA 4A3FJ 4JBAA 1QHHD 1OKRA 1J59A 3F72A 3GFIA 2VKVA 2G7UA 1MBJA 5D6FA 1IXSB 1GT0C 2GOXB 2YUSA 2MSYA 1D1AA 4B1RA 2ESHA 5GTIC 4LB5A 2OPTA 1TZLA 3KE2A 1S3JA 4AD9A 3CCMI 1UG2A 1I6XA 4S05A 1WJ5A 4HSRA 3E5UA 4WWCA 2JZYA 4XICA 3S15J 1UG0A 3MN2A 3I53A 1FYLA 2KIMA 1ZQ3P 2VPLA 1JI8A 2M5WA 3JRIA 2XVCA 4XSXF 1SFUA 4MEXF 3IV5A 3HOZJ 3SXYA 4LLGF 4XBFA 3JSOA 2K5CA 3PQJA 1YHQI 3DKXA 1JKPC 1I3AA 3NAUA 2JVHA 3KX2A 3T8TA 2VQGA 1IN5A 1S7OA 3DEUA 3OIPA 1XGMA 1T38A 1F4KA 4OINF 5JHUA 2HDDA 1IN6A 1YOVB 2N8GA 3E1SA 3GTGJ 1HC8A 2DFHA 2QGUA 4LMYA 1QGPA 4LK0F 1PJRA 3O8GA 4EM0B 3CJRB 3DPUA 1YITI 4OIPF 4ZH4F 3HSRA 3K70D 4G7HF 2XAFA 3BQYA 1K6YA 3C18A 3VDXA 1NG7A 2WTEA 1F43A 2WAEA 1V5GA 2HPIA 3S8PA 3H5NA 3MKWB 3D5SC 2Z9OA 5IPAA 4EV0A 1W7PD 3U21A 5IP7J 2V1XA 2DOEA 5M5XJ 3FMRA 4KT5C 3QAHA 2A07F 5HS8A 4XN0A 1MBKA 5CJ9A 5K7ZA 2M7AA 2L2OA 3OSGA 3G4SI 4E70A 1CF7B 2JRTA 4EEFG 1LVAA 4S0HB 1B9MA 1L0OC 1S29A 5GPAA 5GAHJ 1JUMA 3C7JA 3I5UA 3G3ZA 4UUTA 5J3LA 5LBQA 2CQKA 4P9UA 2QKLB 2F5FA 4NDLA 3ZQLA 2Y9ZA 4NHJA 3C1DA 3TO7A 2A3SA 1GV2A 4IXAA 3BWGA 3OYKA 3IHUA 2E1MC 2M1BA 1EA3A 1OLTA 1MJBA 4OOIA 1W5CC 3TL4X 3IP4B 3DPTA 1P7IA 1T98A 3CCYA 3SDBA 1PVEA 2OV7A 3I64A 1QA6A 2VONA 5GAGJ 2W25A 2GM4A 2QSHX 2AQFA 1WWXA 2M7BA 4FTHA 5DCFA 4RM2A 3AKZA 4BE2A 3FXOA 2CRGA 4DYRA 1U9NA 5FROA 1TP4A 4CSWA 2IVMA 4XM3A 4HBLA 5AIQA 4XIDA 5ICFA 4ON0A 2HZTA 3OL3A 1ZRCA 1LFBA 2FXAA 2LG4A 4XMYA 5EEGA 2L7ZA 2W85A 5EEHA 4ENKA 1DP7P 1NHAA 4ESJA 3HOSA 3GCMA 4M9XA 3TO6A 3P9IA 4UVBA 2L0KA 5FO5A 1MMNA 1OQYA 2E7WA 2W1OA 3DU5A 4UUSA 3CF5F 3V8KA 1J75A 1B6AA 4KIGA 4LFUA 3LQRA 4Q5SF 3RI4A 1E17A 1MMDA 1Q1VA 1JE8A 1KU2A 3GUDA 4XKVA 2QUFA 2CQQA 3AG1H 2EZLA 2XDVA 2WAFA 1JTXA 2JMWA 2EIMH 4PJMA 1AHDP 5FD5A 2ICWG 2WY8Q 3PQKA 4Q4ZF 4BXFA 1B8IA 4IO9F 2P7CB 5J4VA 2MLGA 5CQEA 5ICCA 1R1UA 2LKSA 1MBGA 4FISA 4FT8A 2A68F 2CJJA 1J7KA 2DK5A 2QZ8A 2UV1A 5DCMB 2XKOA 3KZYA 2WAQA 3GTMJ 3L00A 1P6RA 4BS9A 4UNOA 4IRIA 2VIXA 1MJ9A 1WI9A 2JSPA 3FMSA 1F36A 2PMHA 4DBRA 1H88C 2BY3A 4HPQA 1STZA 1HCRA 2CGPA 2XC7A 3BP8A 1V5EA 5EZGA 2VUMJ 1G2HA 4B43A 2B9SA 1WJBA 4IZZA 5A2QK 1IZ1A 2M0MA 2O3FA 1W36C 2R92J 3E6DA 1LE8B 1JXSA 1Z77A 3BR5A 2IS4A 2CG4A 3ZMDA 4CICA 1VQ6I 2GWRA 2QSGX 5FJ8J 3AFHA 2O7OA 1FBSA 1LEAA 1SMYF 3CTAA 1B72B 4IRGA 3RIRA 1K61A 1QVTA 3MEXA 2EFNA 1MMSA 4BDYA 3S16J 1BJZA 2XAHA 1Q1HA 2F5CA 2Y75A 3QRFF 3TQNA 4A3CJ 5D5WB 2WV0A 3IRQA 3S1MJ 4BEHA 1IXCA 3HEFA 2ZXHA 2UZKA 3VYSB 4FE7A 4BXXJ 2GOMA 2RDPA 2XHKA 3FXJA 3G73A 4OMYA 3K4KA 1J0RA 2NYXA 3F21A 2GLOA 3FM5A 3ULQB 3BTIA 4M3FA 4BHCA 3MKLA 3CC2I 3OYFA 1W5SA 4M9SA 2ZKZA 4GGGA 4V2FA 4ZYGA 2TRTA 3ABLH 1Y56A 3LOCA 3QWLA 4Z2YA 4OMZA 2KIUA 4ETSA 2ZBKA 4AU7A 4A6EA 2FU4A 3DXJF 3S1RJ 4PSXA 3WTZA 4LG0A 1DGRM 5LFAA 3CLQA 2NOGA 3J80Z
chains in the Genus database with same CATH topology
2EK5A 1YW7A 3L7WA 3GLXA 3WU1B 2ACJA 2RC4A 1TNTA 2GA1A 3TKYA 1D8JA 5CVIA 1C0WA 5BPIA 5E20A 4UV9A 5LGNA 4IVNA 5E17F 1YS6A 1A04A 1GVJA 3RPQA 5FFXA 2GIVA 1BI1A 2KRFA 3K1NA 5LHIA 1TW2A 2M8EA 3ECHA 2L3DA 3BY6A 3H3UA 3M8FA 1H9TA 1SAXA 4U88A 1SD7A 5D5VB 5ED4A 4R8HA 4Y17A 3V7SA 3KP3A 3MFKA 1ODDA 2ZXJA 3L9FA 2FMYA 5D4SA 3RKXA 3M9AA 3JAMZ 3GXOA 5LHGA 4ZYEA 4HLYA 1Z9CA 4YIFA 5LHHA 1Z6RA 2HEOA 3JW4A 2W84A 1TQMA 2PEXA 5HOOA 2PI0A 3R61A 3JTGA 4LLLA 3TO9A 2P5KA 1LDKB 2Y48A 1IN8A 1F5TA 5LEKA 3I59B 1R23A 1SMTA 2FSWA 3P7NA 1I5ZA 4HZFA 4A6DA 4FHTA 5J8CA 2HR3A 1IRFA 4RS8A 4LJZF 3I71A 2P8TA 3F8BA 4I09A 5CLSA 2EFQA 2QENA 1U2WA 1KU7A 3RKWA 2HOEA 3BOQA 1FBUA 4M71A 2P4WA 1ZG1A 2QYOA 3MZHA 4HX4A 2DW4A 3TGNA 5E1WA 2M87A 2HTJA 2K27A 2VOOA 4I7HA 4GXOA 5AIPA 2XV4S 3KETA 3HRSA 4U0YA 1GXQA 3ZMUA 1O7LA 4G8XA 3GFLA 1J9IA 2J5PA 3H92A 1YYVA 1I27A 3WU0A 1IXRC 2VBWA 3H3ZA 3QU6A 4MHGA 3V7RA 2HGCA 4LLNA 2OAZA 3F8CA 3CLOA 5FLXK 2C6YA 4WCGA 1QZYA 3HRUA 3O2PE 3K2ZA 4Q47A 4CHUA 3RJPA 4RB1A 1HKSA 2B0LA 2IA2A 3N4MA 2IT0A 1FLIA 2ZNYA 1ZYRF 1YFHA 5H6QA 3LWFA 3WE3A 4BNCA 3ML6A 1U78A 4O3MA 2PQ8A 4I98B 4LG0B 4MNUA 4P96A 1BM9A 1R1TA 1PDNC 1ZAOA 5L3DA 4XLNF 2L02A 5LGTA 5FD6A 1TNSA 1SFXA 2H09A 4EJWA 4IHSA 1O3TA 2QLZA 3ISPA 1XDSA 4O5VA 3KP6A 3I58A 2Z3YA 5HDKA 1BBYA 2DAOA 3GZ6A 4G6QA 2YU3A 3CJNA 2MD5A 4ESBA 1HW2A 3EYIA 4TV7A 2AXLA 2ZMEB 2ZO4A 3EUHA 2XUBA 2IA0A 5CVVA 4KFCA 2FEZA 3HSEA 4XRFA 5ERIA 1QQIA 1IUYA 3LAPA 3R0JA 3NRVA 2O0YA 5DCMA 4WF2A 3QOPA 2V1UA 2UXNA 2Y0MA 4BHBA 1KA8A 2VC1A 1T0FA 4R1HA 4AWXB 2ISYA 2M45A 1B59A 3HSFA 1S6LA 2Z5UA 2XROA 1MDMB 3WGGA 3DPLC 4IRHA 1YLFA 3K9TA 2EJRA 2FBIA 1XCVA 3HYIA 1GXPA 1FP1D 5JI6A 2YR2A 3ZP5A 4EGYA 1P4AA 4U0VA 4L9VA 5BMZA 4U7BA 5LGUA 1EV7A 4F7ZA 3U1DA 3HIFA 3MZYA 2XRNA 3F8MA 5LRRA 2BV6A 4ZZDA 4L18B 2G7HA 4KN7X 3B73A 1Z05A 2QQAA 1FWZA 4UV8A 1KQ9A 4L0YB 2LF7A 4XSZF 4JQFA 3C3WA 2MH9A 4ZZLA 3ZMZA 4HF1A 2ESNA 5FFZA 3I54A 4R79A 2QBYB 2EA2A 2H6CA 3IRRA 3BJOA 4HOBA 4YIIA 1FZPB 4K2EA 5LEJA 5IT9K 2EV6A 4HDUA 1WSUA 2R3SA 3D0SA 2RVCA 3REOA 3R6SA 1P4WA 1OYYA 4RAYA 2DO7A 3WTXC 4RB0A 1K6OA 1KGSA 1EH8A 4NB5A 3O6BB 4Q48A 3GX4X 2DU9A 1XMAA 1FSHA 1X3UA 1S8NA 5ICGA 4KIBA 2F5EA 4BXUA 2QQBA 4EGZA 2K02A 5F6FA 1G3TA 3I59A 1OPCA 4M73A 1HKQA 3BZ6A 2OQGA 3F8NA 4L0ZB 4PGHA 3SQNA 2G9WA 1VTNC 5HLGA 1GHCA 2P6TA 4CZZA 3E6MA 2L01A 3B02A 5LRSA 3EETA 4B09A 2XGXA 4CYDA 4PZJA 4HV5A 3T0YA 4HQMA 2MLKA 1PUEE 2IP2A 2VBXA 2UXXA 4OIOF 3QPTA 4A12A 2VT3A 1I1SA 5BS6A 1Z6TA 1FY7A 3U9GA 4UXNA 4RAZA 4M9ZA 5JR3A 4ZYDA 2Q0OA 3R4KA 3GWZA 1SD5A 5A2QZ 1JGSA 3GVAA 2FOKA 3I4PA 1TW3A 5E1ZB 3LA2A 2Q8KA 2GAUA 4G7ZF 1FOKA 3ZPLA 3CDHA 3EYYA 1RNLA 3KLOA 1IAWA 4UVAA 1TQIA 1R5GA 3SZPA 1FC3A 1B9NA 2FE3A 3ECOA 1K78B 4A5NA 4L9TA 1B1BA 5L3CA 2V79A 5ICEA 1R5HA 3BJAA 5BQTA 4XLPF 2CFXA 3EQLF 2GZWA 4KYWA 3GEZA 3ZMVA 3HRMA 1WRJA 3E97A 3KP7A 1LQ1A 4KA4A 2RV8A 1TBXA 1USTA 2STTA 3BPXA 1W5TA 3TOBA 2VODA 3IL2A 2K86A 3NEUA 3WTVC 4L9JA 3F8FA 2A6EF 2EFWA 1HW1A 1OMIA 4UUVA 2RGVA 1W7PB 2BE5F 1EH7A 1WKMA 4QLCU 1LDJA 1FSEA 4HX7A 2FMLA 3SHFA 4OIQF 2QQ9A 2RNJA 4IHTA 3W6JB 1OR7A 5F1RA 3CO7C 5HDNA 4HF2A 2XKPA 3FF5A 5ILUA 1ZARA 4HQEA 5E1XA 2ZMEA 2ZCWA 2O8XA 1KYZA 2OZ6A 3LFKA 1SD6A 4RGSA 5K1YA 2H27A 3CUQB 2MBFA 1B4AA 1PP8F 4HAMA 1V3FA 3K1MA 2FRHA 1FT9A 1AWCA 2K7LA 2ADUA 4HV6A 2STWA 1LJ9A 3ZN1A 1ZG3A 1ZGJA 2FBHA 1ONVA 4ENMA 1U8RA 2UWMA 2O03A 1O3QA 3KP4A 3RYRA 1E2XA 2M30A 4A0XA 5E18F 1MDMA 3J7AO 4L9NA 4I01A 3JAMK 4M72A 1ZREA 3WGIA 3S2WA 1IN7A 2OD5A 2HKOA 2K4BA 1ZRFA 1J2XA 4A2UA 4EJUA 4HYEA 4KDPA 2CO5A 5L3EA 3RDIA 3VEPA 4YFXF 1V4RA 3K1PA 3M8EA 2K4JA 2RN7A 5DEQA 3WGHA 4GO1A 3LQQA 3ERED 2IW5A 4AIJA 2HWVA 4I0BA 1U3EM 5LLQA 3HHHA 3N97A 1D8KA 2HFHA 3VODA 3M1EA 2P7VB 2JPCA 4M6YA 2ETHA 2A5YB 1RIOH 2XAJA 5K5RA 2VOPA 5ILVA 4NQWA 1SFEA 5L3BA 3L2CA 1XGNA 3LA3A 3RPUA 4EJVA 5AONA 3WTTC 5DUKA 2BYVE 1OYIA 2D2WA 3KP2A 3VB2A 1G3SA 2EV5A 3CUQC 3F22A 2QBYA 4N9HA 1FPQA 4ZYHA 4CGZA 2EFOA 1UHMA 2R7DA 2DQRA 3EDPA 4KIFA 1P92A 2LKPA 1U6GA 4I0AA 1Z91A 4U7DA 1DPUA 4MGRA 1ON1A 4RGUA 3E6CC 2KJBA 2PMUA 2H6BA 3GYHX 3IC7A 2X0LA 1Z1DA 1ZHFA 2ELHA 3Q9VA 5E8GA 2VN2A 4I2OA 1P2FA 5HDGA 5E8IA 1XD7A 4KN4X 3SZTA 1YW8A 4HLXA 1KQ0A 4LGWA 4UVCA 5KVRA 2BGCA 4G9YA 3LSTA 1IRGA 2ISZA 2EV0A 4OU0A 1OYWA 2E1CA 2HQRA 4BAYA 3AAFA 4KUMA 1REPC 1D5VA 3F3XA 3MAJA 4G7OF 5D6EA 4GYIA 3V8JA 2WC2A 5FB2A 4L5JA 5DV5A 1BIAA 1UB9A 2HDCA 1TLHB 4Y15A 1R22A 1MD0A 4U0WA 4CXFA 4IJAA 1KYWA 2CSOA 2P5VA 4CO8A 1DUXC 1LEBA 4MTEA 4B8XA 2Z99A 3MWMA 3TOAA 1PP7U 2HQNA 1USSA 3RYPA 1XB4A 2QM3A 1JHFA 2YX7A 4A0ZA 3IWFA 1FX7A 3FXRA 2HYFA 2Z33A 2GA2A 4MTDA 1I1GA 3JSPA 2A69F 1BIBA 1UHWA 3OV8A 2EA4A 3J81Z 2IJLA 5ILSA 1K78A 4OIRF 3K69A 2P5LC 1RUOA 4EMSA 1MKMA 1ZRDA 2NRAC 3D5LA 2FNAA 4AVPA 3M7GA 1XN7A 3WG9A 1FBQA 2KKOA 4RGRA 4GCVA 3IKTA 4AIHA 4YG2F 2WWYA 3CO6C 2LF8A 1Z7UA 3BDDA 3W6KB 1YIOA 6PAXA 5D8LB 2Q2EA 2LNBA 2PLYA 3IKVA 3T1BA 3LA7A 2YPRA 5TRDA 1W7PA 1MZBA 5JFRA 2A61A 1ON2A 1YO5C 1G4DA 1RUNA 2QVOA 5J6XA 1RZ4A 5K5OA 1HQCA 3ROUA 2DK8A 3F6VA 5IT9Z 4DQ2A 3WE2A 1ZH5A 4D0PA 1K7AA 2L4AA 1QO0D 1G3WA 1LDDA 4ENJA 5FGMA 2DLLA 2L54A 1R58A 3CUQA 2ZNZA 2VC0A 1TQPA 2OQRA 1HBXG 2TDXA 4ESFA 2DBBA 2GQQA 2L4MA 3F6OA 2BEOA 1BOAA 4A5MA 3ELKA 4KICA 3KP5A 1ULYA 3BJ6A 4HDVA 2YSRA 1K79A 4MQVA 3KLNA 2CYYA 1XCBA 3K0LA 2F5DA 4G94A 1FYKA 1XGSA 1D3YA 5CVUA 1O3SA 3FWEA 3T5XA 5L3FA 2VXZA 4BHPA 5CYVA 4PGGA 2CWEA 3GFJA 3F23A 1KQ8A 4RB2C 4WXHA 5H6RA 3KZZA 4FX0A 1IF1A 2OA4A 3WTYC 2J5OA 3ZQ7A 1HW5A 2EWNA 4KMUX 3WODF 1MJAA 2D1VA 3DP7A 3QPHA 4DNCA 1YW9A 1XSVA 4L5IA 4ASNA 1U5TB 3WTWC 2V9VA 4QWQA 3HTUA 2KJCA 2XAQA 5D4RA 3R60A 1CGPA 4EJOA 3L09A 2NS0A 1BN5A 5D8KB 3E5QA 2PG4A 5F64A 1UCRA 1LB2A 1YQAA 3DFGA 2GXGA 2HKXA 2YX4A 4WXCA 1L3LA 2CW0F 4EJTA 4RGXA 3GW2A 3OOPA 4EM2A 2IRFG 2PN6A 2HYGD 2V1DA 5BPDA 5HS9A 3DQVC 1R1VA 1BJAA 5K5QA 1MGTA 3U2RA 5D5UB 4PDKA 1J5YA 3J80K 4CDGA 5CVRA 4A0YA 4FX4A 1SD4A 2VT2A 4WK8F 3ZMSA 4BH9A 3ABTA 2HTSA 1XMKA 2NNNA 4LB6B 2LDUA 3Q9SA 3DF8A 2XIGA 4UHTA 3CUOA 1RI7A 2VBZA 4YFKF 3SFZA 4MEYF 1W4MA 1YTYA 3FZVA 4N9IA 1HSTA 1ZLKA 1UFMA 3KCCA 1U5TC 5J8FA 5HS7A 3FXQA 4BQAA 2PBIA 1Y0UA 4I02A 2IPQX 1IN4A 2NNYA 4BYYA 1QNTA 4EVIA 2PJPA 2JSCA 3V7CA 4P5OA 4HW0A 3FM3A 2JPBA 2JT1A 2LSOA 1F1ZA 3HUGA 2W24A 5TJJA 1R7JA 3VOEA 2V6CA 4KMFA 3V8LA 3HOTA 2XAGA 2FA5A 1T2KA 5HLHA 2VBYA 3GF2A 3WTUC 2MA3A 4PCQA 4M6XA 4ENNA 1IW7F 3ZMTA 1WQ2A 1T6SA 4EM1A 3MQ0A 5D5XB 1YS7A 3DV8A 1DPRA 3R0AA 1FNNA 1QZZA 1S7AA 4HX8A 1ZGAA 1BC7C 2D45A 1O7FA 2F2EA 3GO5A 1AOYA 2DI3A 3FMQA 2RQPA 2DT5A 3BROA 2O61A 2NAZA 4P9FA 3IWZA 4M74A 2FF4A 3TDZC 4YFNF 1KU3A 4IF4A 5IT3A 2EFPA 5FLXZ 4EQQA 2W57A 4WX9A 1FYMA 2BBYA 1O3RA 1BI2A 2R7FA 1H0MA 5DD4A 1O57A 3FXUA 3COAC 4GYGA 1T39A 5CVJA 3E5XA 3GFMA 2KIFA 2OU2A 2DFIA 1ZG5A 1ZLJA 1JHHA 2DQLA 3KEQA 4LD5A 2D1HA 3E3VA 1HKTA 1FP2A 1DDNA 1R36A 2RKHA 2ZJ2A 4H0EA 1CF7A 4LK1F 2HS5A 5DUIA 3DKWA 4RB3C 3JTHA 1BC8C 4Y13A 3V4GA 1XDUA 2EB7A 3KEOA 3P9KA 2VE8A 2DTRA 2ZFWA 1G3YA 3PFIA 2OZUA 5BOXA 2VE9A 2P6SA 2GXBA 1LNWA 3VFZA 2A6HF 2JTVA 2DPUA 3P9CA 4HA8A 2PFBA 1QPMA 4JK1X 2H94A 3TDUC 5H20A 2FBKA 4O6JA 3KFWX 3NQOA 1HXDA 3RKYA 3HTSB 4HF0A 4AIKA 1XSXA 3QU3A 3I0TA 1EH6A 3O3KA 4S04A 2QWWA 3ABUA 5HVQC 2E7XA 1YG2A 2FQ3A 1BI3A 5JVTA 2MC3A 3RTRA 1H9GA 2MH2A 2IA1A 1ZN2A 1P4XA 3T8RA 3GZ5A 1G6NA 3FX3A 3QP6A 4MQ9F 1U5TA 3FHZA 4WXDA 5KK1A 5DYMA 2OBPA 3BPVA 5DDGA 1HSJA 4G6DA 2COMA 2XASA 3QP5A 3ZN0A 3WTSC 1QBJA 4P55A 1XGOA 1TTYA 4N0BA 1XSDA 3E6BA 2O6GE 3HHGA 1R00A 2E1NA 3LAJA 1BI0A 2X4HA 3J81K 3MCZA 5DD8A 1KU9A 5HLIA 5L3GA 3HRTA 2DPDA 3Q5FA 2FNPA 2AS5F 4KNYA 4IPAA 1F9NA 4JBAA 1OKRA 1J59A 3F72A 3GFIA 2G7UA 5D6FA 1IXSB 2ESHA 4LB5A 3KE2A 1S3JA 4AD9A 1I6XA 4S05A 3E5UA 4WWCA 2JZYA 3I53A 1FYLA 2KIMA 2M5WA 2XVCA 4XSXF 1SFUA 4MEXF 3SXYA 4LLGF 4XBFA 3JSOA 3PQJA 3T8TA 1IN5A 1S7OA 3DEUA 1XGMA 1T38A 1F4KA 4OINF 5JHUA 1IN6A 4LMYA 1QGPA 4LK0F 4EM0B 4OIPF 4ZH4F 3HSRA 4G7HF 2XAFA 3C18A 2WTEA 2Z9OA 4EV0A 1W7PD 2V1XA 3FMRA 4KT5C 3QAHA 2A07F 5HS8A 5CJ9A 4E70A 1CF7B 2JRTA 1LVAA 1B9MA 1L0OC 1S29A 3C7JA 3I5UA 3G3ZA 5LBQA 2CQKA 4P9UA 2F5FA 4NHJA 3C1DA 3TO7A 2A3SA 4IXAA 3BWGA 3IHUA 2M1BA 1MJBA 4OOIA 3DPTA 1T98A 3I64A 2VONA 2W25A 1WWXA 5DCFA 2IVMA 5AIQA 4HBLA 5ICFA 4ON0A 2HZTA 1ZRCA 2FXAA 5EEGA 4ENKA 2W85A 5EEHA 1DP7P 1NHAA 4ESJA 3HOSA 4M9XA 3TO6A 3P9IA 4UVBA 5FO5A 2E7WA 3V8KA 1J75A 1B6AA 4KIGA 4LFUA 3LQRA 4Q5SF 3RI4A 1E17A 1JE8A 1KU2A 3GUDA 2QUFA 5FD5A 4Q4ZF 3PQKA 2P7CB 2MLGA 5ICCA 1R1UA 4FT8A 2A68F 1J7KA 2DK5A 2QZ8A 5DCMB 2XKOA 3KZYA 3L00A 1P6RA 4UNOA 4IRIA 1MJ9A 1WI9A 3FMSA 2PMHA 1STZA 2CGPA 3BP8A 5A2QK 1IZ1A 2O3FA 3E6DA 1JXSA 2CG4A 3ZMDA 4CICA 2GWRA 1FBSA 1LEAA 1SMYF 3CTAA 4IRGA 3RIRA 3MEXA 2EFNA 2XAHA 1Q1HA 2F5CA 2Y75A 3QRFF 3TQNA 5D5WB 2WV0A 3IRQA 1IXCA 2UZKA 2RDPA 2XHKA 3G73A 4OMYA 1J0RA 2NYXA 3F21A 3FM5A 3ULQB 4BHCA 1W5SA 4M9SA 2ZKZA 4GGGA 4ZYGA 4Z2YA 4OMZA 2KIUA 4ETSA 2ZBKA 4A6EA 2FU4A 3DXJF 3WTZA 4LG0A 3J80Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EK5 A;  1YW7 A;  3L7W A;  3GLX A;  3WU1 B;  2ACJ A;  2RC4 A;  1TNT A;  2GA1 A;  3TKY A;  1D8J A;  5CVI A;  1C0W A;  5BPI A;  5E20 A;  4UV9 A;  5LGN A;  4IVN A;  5E17 F;  1YS6 A;  1A04 A;  1GVJ A;  3RPQ A;  5FFX A;  2GIV A;  1BI1 A;  2KRF A;  3K1N A;  5LHI A;  1TW2 A;  2M8E A;  3ECH A;  2L3D A;  3BY6 A;  3H3U A;  3M8F A;  1H9T A;  1SAX A;  4U88 A;  1SD7 A;  5D5V B;  5ED4 A;  4R8H A;  4Y17 A;  3V7S A;  3KP3 A;  3MFK A;  1ODD A;  2ZXJ A;  3L9F A;  2FMY A;  5D4S A;  3RKX A;  3M9A A;  3JAM Z;  3GXO A;  5LHG A;  4ZYE A;  4HLY A;  1Z9C A;  4YIF A;  5LHH A;  1Z6R A;  2HEO A;  3JW4 A;  2W84 A;  1TQM A;  2PEX A;  5HOO A;  2PI0 A;  3R61 A;  3JTG A;  4LLL A;  3TO9 A;  2P5K A;  1LDK B;  2Y48 A;  1IN8 A;  1F5T A;  5LEK A;  3I59 B;  1R23 A;  1SMT A;  2FSW A;  3P7N A;  1I5Z A;  4HZF A;  4A6D A;  4FHT A;  5J8C A;  2HR3 A;  1IRF A;  4RS8 A;  4LJZ F;  3I71 A;  2P8T A;  3F8B A;  4I09 A;  5CLS A;  2EFQ A;  2QEN A;  1U2W A;  1KU7 A;  3RKW A;  2HOE A;  3BOQ A;  1FBU A;  4M71 A;  2P4W A;  1ZG1 A;  2QYO A;  3MZH A;  4HX4 A;  2DW4 A;  3TGN A;  5E1W A;  2M87 A;  2HTJ A;  2K27 A;  2VOO A;  4I7H A;  4GXO A;  5AIP A;  2XV4 S;  3KET A;  3HRS A;  4U0Y A;  1GXQ A;  3ZMU A;  1O7L A;  4G8X A;  3GFL A;  1J9I A;  2J5P A;  3H92 A;  1YYV A;  1I27 A;  3WU0 A;  1IXR C;  2VBW A;  3H3Z A;  3QU6 A;  4MHG A;  3V7R A;  2HGC A;  4LLN A;  2OAZ A;  3F8C A;  3CLO A;  5FLX K;  2C6Y A;  4WCG A;  1QZY A;  3HRU A;  3O2P E;  3K2Z A;  4Q47 A;  4CHU A;  3RJP A;  4RB1 A;  1HKS A;  2B0L A;  2IA2 A;  3N4M A;  2IT0 A;  1FLI A;  2ZNY A;  1ZYR F;  1YFH A;  5H6Q A;  3LWF A;  3WE3 A;  4BNC A;  3ML6 A;  1U78 A;  4O3M A;  2PQ8 A;  4I98 B;  4LG0 B;  4MNU A;  4P96 A;  1BM9 A;  1R1T A;  1PDN C;  1ZAO A;  5L3D A;  4XLN F;  2L02 A;  5LGT A;  5FD6 A;  1TNS A;  1SFX A;  2H09 A;  4EJW A;  4IHS A;  1O3T A;  2QLZ A;  3ISP A;  1XDS A;  4O5V A;  3KP6 A;  3I58 A;  2Z3Y A;  5HDK A;  1BBY A;  2DAO A;  3GZ6 A;  4G6Q A;  2YU3 A;  3CJN A;  2MD5 A;  4ESB A;  1HW2 A;  3EYI A;  4TV7 A;  2AXL A;  2ZME B;  2ZO4 A;  3EUH A;  2XUB A;  2IA0 A;  5CVV A;  4KFC A;  2FEZ A;  3HSE A;  4XRF A;  5ERI A;  1QQI A;  1IUY A;  3LAP A;  3R0J A;  3NRV A;  2O0Y A;  5DCM A;  4WF2 A;  3QOP A;  2V1U A;  2UXN A;  2Y0M A;  4BHB A;  1KA8 A;  2VC1 A;  1T0F A;  4R1H A;  4AWX B;  2ISY A;  2M45 A;  1B59 A;  3HSF A;  1S6L A;  2Z5U A;  2XRO A;  1MDM B;  3WGG A;  3DPL C;  4IRH A;  1YLF A;  3K9T A;  2EJR A;  2FBI A;  1XCV A;  3HYI A;  1GXP A;  1FP1 D;  5JI6 A;  2YR2 A;  3ZP5 A;  4EGY A;  1P4A A;  4U0V A;  4L9V A;  5BMZ A;  4U7B A;  5LGU A;  1EV7 A;  4F7Z A;  3U1D A;  3HIF A;  3MZY A;  2XRN A;  3F8M A;  5LRR A;  2BV6 A;  4ZZD A;  4L18 B;  2G7H A;  4KN7 X;  3B73 A;  1Z05 A;  2QQA A;  1FWZ A;  4UV8 A;  1KQ9 A;  4L0Y B;  2LF7 A;  4XSZ F;  4JQF A;  3C3W A;  2MH9 A;  4ZZL A;  3ZMZ A;  4HF1 A;  2ESN A;  5FFZ A;  3I54 A;  4R79 A;  2QBY B;  2EA2 A;  2H6C A;  3IRR A;  3BJO A;  4HOB A;  4YII A;  1FZP B;  4K2E A;  5LEJ A;  5IT9 K;  2EV6 A;  4HDU A;  1WSU A;  2R3S A;  3D0S A;  2RVC A;  3REO A;  3R6S A;  1P4W A;  1OYY A;  4RAY A;  2DO7 A;  3WTX C;  4RB0 A;  1K6O A;  1KGS A;  1EH8 A;  4NB5 A;  3O6B B;  4Q48 A;  3GX4 X;  2DU9 A;  1XMA A;  1FSH A;  1X3U A;  1S8N A;  5ICG A;  4KIB A;  2F5E A;  4BXU A;  2QQB A;  4EGZ A;  2K02 A;  5F6F A;  1G3T A;  3I59 A;  1OPC A;  4M73 A;  1HKQ A;  3BZ6 A;  2OQG A;  3F8N A;  4L0Z B;  4PGH A;  3SQN A;  2G9W A;  1VTN C;  5HLG A;  1GHC A;  2P6T A;  4CZZ A;  3E6M A;  2L01 A;  3B02 A;  5LRS A;  3EET A;  4B09 A;  2XGX A;  4CYD A;  4PZJ A;  4HV5 A;  3T0Y A;  4HQM A;  2MLK A;  1PUE E;  2IP2 A;  2VBX A;  2UXX A;  4OIO F;  3QPT A;  4A12 A;  2VT3 A;  1I1S A;  5BS6 A;  1Z6T A;  1FY7 A;  3U9G A;  4UXN A;  4RAZ A;  4M9Z A;  5JR3 A;  4ZYD A;  2Q0O A;  3R4K A;  3GWZ A;  1SD5 A;  5A2Q Z;  1JGS A;  3GVA A;  2FOK A;  3I4P A;  1TW3 A;  5E1Z B;  3LA2 A;  2Q8K A;  2GAU A;  4G7Z F;  1FOK A;  3ZPL A;  3CDH A;  3EYY A;  1RNL A;  3KLO A;  1IAW A;  4UVA A;  1TQI A;  1R5G A;  3SZP A;  1FC3 A;  1B9N A;  2FE3 A;  3ECO A;  1K78 B;  4A5N A;  4L9T A;  1B1B A;  5L3C A;  2V79 A;  5ICE A;  1R5H A;  3BJA A;  5BQT A;  4XLP F;  2CFX A;  3EQL F;  2GZW A;  4KYW A;  3GEZ A;  3ZMV A;  3HRM A;  1WRJ A;  3E97 A;  3KP7 A;  1LQ1 A;  4KA4 A;  2RV8 A;  1TBX A;  1UST A;  2STT A;  3BPX A;  1W5T A;  3TOB A;  2VOD A;  3IL2 A;  2K86 A;  3NEU A;  3WTV C;  4L9J A;  3F8F A;  2A6E F;  2EFW A;  1HW1 A;  1OMI A;  4UUV A;  2RGV A;  1W7P B;  2BE5 F;  1EH7 A;  1WKM A;  4QLC U;  1LDJ A;  1FSE A;  4HX7 A;  2FML A;  3SHF A;  4OIQ F;  2QQ9 A;  2RNJ A;  4IHT A;  3W6J B;  1OR7 A;  5F1R A;  3CO7 C;  5HDN A;  4HF2 A;  2XKP A;  3FF5 A;  5ILU A;  1ZAR A;  4HQE A;  5E1X A;  2ZME A;  2ZCW A;  2O8X A;  1KYZ A;  2OZ6 A;  3LFK A;  1SD6 A;  4RGS A;  5K1Y A;  2H27 A;  3CUQ B;  2MBF A;  1B4A A;  1PP8 F;  4HAM A;  1V3F A;  3K1M A;  2FRH A;  1FT9 A;  1AWC A;  2K7L A;  2ADU A;  4HV6 A;  2STW A;  1LJ9 A;  3ZN1 A;  1ZG3 A;  1ZGJ A;  2FBH A;  1ONV A;  4ENM A;  1U8R A;  2UWM A;  2O03 A;  1O3Q A;  3KP4 A;  3RYR A;  1E2X A;  2M30 A;  4A0X A;  5E18 F;  1MDM A;  3J7A O;  4L9N A;  4I01 A;  3JAM K;  4M72 A;  1ZRE A;  3WGI A;  3S2W A;  1IN7 A;  2OD5 A;  2HKO A;  2K4B A;  1ZRF A;  1J2X A;  4A2U A;  4EJU A;  4HYE A;  4KDP A;  2CO5 A;  5L3E A;  3RDI A;  3VEP A;  4YFX F;  1V4R A;  3K1P A;  3M8E A;  2K4J A;  2RN7 A;  5DEQ A;  3WGH A;  4GO1 A;  3LQQ A;  3ERE D;  2IW5 A;  4AIJ A;  2HWV A;  4I0B A;  1U3E M;  5LLQ A;  3HHH A;  3N97 A;  1D8K A;  2HFH A;  3VOD A;  3M1E A;  2P7V B;  2JPC A;  4M6Y A;  2ETH A;  2A5Y B;  1RIO H;  2XAJ A;  5K5R A;  2VOP A;  5ILV A;  4NQW A;  1SFE A;  5L3B A;  3L2C A;  1XGN A;  3LA3 A;  3RPU A;  4EJV A;  5AON A;  3WTT C;  5DUK A;  2BYV E;  1OYI A;  2D2W A;  3KP2 A;  3VB2 A;  1G3S A;  2EV5 A;  3CUQ C;  3F22 A;  2QBY A;  4N9H A;  1FPQ A;  4ZYH A;  4CGZ A;  2EFO A;  1UHM A;  2R7D A;  2DQR A;  3EDP A;  4KIF A;  1P92 A;  2LKP A;  1U6G A;  4I0A A;  1Z91 A;  4U7D A;  1DPU A;  4MGR A;  1ON1 A;  4RGU A;  3E6C C;  2KJB A;  2PMU A;  2H6B A;  3GYH X;  3IC7 A;  2X0L A;  1Z1D A;  1ZHF A;  2ELH A;  3Q9V A;  5E8G A;  2VN2 A;  4I2O A;  1P2F A;  5HDG A;  5E8I A;  1XD7 A;  4KN4 X;  3SZT A;  1YW8 A;  4HLX A;  1KQ0 A;  4LGW A;  4UVC A;  5KVR A;  2BGC A;  4G9Y A;  3LST A;  1IRG A;  2ISZ A;  2EV0 A;  4OU0 A;  1OYW A;  2E1C A;  2HQR A;  4BAY A;  3AAF A;  4KUM A;  1REP C;  1D5V A;  3F3X A;  3MAJ A;  4G7O F;  5D6E A;  4GYI A;  3V8J A;  2WC2 A;  5FB2 A;  4L5J A;  5DV5 A;  1BIA A;  1UB9 A;  2HDC A;  1TLH B;  4Y15 A;  1R22 A;  1MD0 A;  4U0W A;  4CXF A;  4IJA A;  1KYW A;  2CSO A;  2P5V A;  4CO8 A;  1DUX C;  1LEB A;  4MTE A;  4B8X A;  2Z99 A;  3MWM A;  3TOA A;  1PP7 U;  2HQN A;  1USS A;  3RYP A;  1XB4 A;  2QM3 A;  1JHF A;  2YX7 A;  4A0Z A;  3IWF A;  1FX7 A;  3FXR A;  2HYF A;  2Z33 A;  2GA2 A;  4MTD A;  1I1G A;  3JSP A;  2A69 F;  1BIB A;  1UHW A;  3OV8 A;  2EA4 A;  3J81 Z;  2IJL A;  5ILS A;  1K78 A;  4OIR F;  3K69 A;  2P5L C;  1RUO A;  4EMS A;  1MKM A;  1ZRD A;  2NRA C;  3D5L A;  2FNA A;  4AVP A;  3M7G A;  1XN7 A;  3WG9 A;  1FBQ A;  2KKO A;  4RGR A;  4GCV A;  3IKT A;  4AIH A;  4YG2 F;  2WWY A;  3CO6 C;  2LF8 A;  1Z7U A;  3BDD A;  3W6K B;  1YIO A;  6PAX A;  5D8L B;  2Q2E A;  2LNB A;  2PLY A;  3IKV A;  3T1B A;  3LA7 A;  2YPR A;  5TRD A;  1W7P A;  1MZB A;  5JFR A;  2A61 A;  1ON2 A;  1YO5 C;  1G4D A;  1RUN A;  2QVO A;  5J6X A;  1RZ4 A;  5K5O A;  1HQC A;  3ROU A;  2DK8 A;  3F6V A;  5IT9 Z;  4DQ2 A;  3WE2 A;  1ZH5 A;  4D0P A;  1K7A A;  2L4A A;  1QO0 D;  1G3W A;  1LDD A;  4ENJ A;  5FGM A;  2DLL A;  2L54 A;  1R58 A;  3CUQ A;  2ZNZ A;  2VC0 A;  1TQP A;  2OQR A;  1HBX G;  2TDX A;  4ESF A;  2DBB A;  2GQQ A;  2L4M A;  3F6O A;  2BEO A;  1BOA A;  4A5M A;  3ELK A;  4KIC A;  3KP5 A;  1ULY A;  3BJ6 A;  4HDV A;  2YSR A;  1K79 A;  4MQV A;  3KLN A;  2CYY A;  1XCB A;  3K0L A;  2F5D A;  4G94 A;  1FYK A;  1XGS A;  1D3Y A;  5CVU A;  1O3S A;  3FWE A;  3T5X A;  5L3F A;  2VXZ A;  4BHP A;  5CYV A;  4PGG A;  2CWE A;  3GFJ A;  3F23 A;  1KQ8 A;  4RB2 C;  4WXH A;  5H6R A;  3KZZ A;  4FX0 A;  1IF1 A;  2OA4 A;  3WTY C;  2J5O A;  3ZQ7 A;  1HW5 A;  2EWN A;  4KMU X;  3WOD F;  1MJA A;  2D1V A;  3DP7 A;  3QPH A;  4DNC A;  1YW9 A;  1XSV A;  4L5I A;  4ASN A;  1U5T B;  3WTW C;  2V9V A;  4QWQ A;  3HTU A;  2KJC A;  2XAQ A;  5D4R A;  3R60 A;  1CGP A;  4EJO A;  3L09 A;  2NS0 A;  1BN5 A;  5D8K B;  3E5Q A;  2PG4 A;  5F64 A;  1UCR A;  1LB2 A;  1YQA A;  3DFG A;  2GXG A;  2HKX A;  2YX4 A;  4WXC A;  1L3L A;  2CW0 F;  4EJT A;  4RGX A;  3GW2 A;  3OOP A;  4EM2 A;  2IRF G;  2PN6 A;  2HYG D;  2V1D A;  5BPD A;  5HS9 A;  3DQV C;  1R1V A;  1BJA A;  5K5Q A;  1MGT A;  3U2R A;  5D5U B;  4PDK A;  1J5Y A;  3J80 K;  4CDG A;  5CVR A;  4A0Y A;  4FX4 A;  1SD4 A;  2VT2 A;  4WK8 F;  3ZMS A;  4BH9 A;  3ABT A;  2HTS A;  1XMK A;  2NNN A;  4LB6 B;  2LDU A;  3Q9S A;  3DF8 A;  2XIG A;  4UHT A;  3CUO A;  1RI7 A;  2VBZ A;  4YFK F;  3SFZ A;  4MEY F;  1W4M A;  1YTY A;  3FZV A;  4N9I A;  1HST A;  1ZLK A;  1UFM A;  3KCC A;  1U5T C;  5J8F A;  5HS7 A;  3FXQ A;  4BQA A;  2PBI A;  1Y0U A;  4I02 A;  2IPQ X;  1IN4 A;  2NNY A;  4BYY A;  1QNT A;  4EVI A;  2PJP A;  2JSC A;  3V7C A;  4P5O A;  4HW0 A;  3FM3 A;  2JPB A;  2JT1 A;  2LSO A;  1F1Z A;  3HUG A;  2W24 A;  5TJJ A;  1R7J A;  3VOE A;  2V6C A;  4KMF A;  3V8L A;  3HOT A;  2XAG A;  2FA5 A;  1T2K A;  5HLH A;  2VBY A;  3GF2 A;  3WTU C;  2MA3 A;  4PCQ A;  4M6X A;  4ENN A;  1IW7 F;  3ZMT A;  1WQ2 A;  1T6S A;  4EM1 A;  3MQ0 A;  5D5X B;  1YS7 A;  3DV8 A;  1DPR A;  3R0A A;  1FNN A;  1QZZ A;  1S7A A;  4HX8 A;  1ZGA A;  1BC7 C;  2D45 A;  1O7F A;  2F2E A;  3GO5 A;  1AOY A;  2DI3 A;  3FMQ A;  2RQP A;  2DT5 A;  3BRO A;  2O61 A;  2NAZ A;  4P9F A;  3IWZ A;  4M74 A;  2FF4 A;  3TDZ C;  4YFN F;  1KU3 A;  4IF4 A;  5IT3 A;  2EFP A;  5FLX Z;  4EQQ A;  2W57 A;  4WX9 A;  1FYM A;  2BBY A;  1O3R A;  1BI2 A;  2R7F A;  1H0M A;  5DD4 A;  1O57 A;  3FXU A;  3COA C;  4GYG A;  1T39 A;  5CVJ A;  3E5X A;  3GFM A;  2KIF A;  2OU2 A;  2DFI A;  1ZG5 A;  1ZLJ A;  1JHH A;  2DQL A;  3KEQ A;  4LD5 A;  2D1H A;  3E3V A;  1HKT A;  1FP2 A;  1DDN A;  1R36 A;  2RKH A;  2ZJ2 A;  4H0E A;  1CF7 A;  4LK1 F;  2HS5 A;  5DUI A;  3DKW A;  4RB3 C;  3JTH A;  1BC8 C;  4Y13 A;  3V4G A;  1XDU A;  2EB7 A;  3KEO A;  3P9K A;  2VE8 A;  2DTR A;  2ZFW A;  1G3Y A;  3PFI A;  2OZU A;  5BOX A;  2VE9 A;  2P6S A;  2GXB A;  1LNW A;  3VFZ A;  2A6H F;  2JTV A;  2DPU A;  3P9C A;  4HA8 A;  2PFB A;  1QPM A;  4JK1 X;  2H94 A;  3TDU C;  5H20 A;  2FBK A;  4O6J A;  3KFW X;  3NQO A;  1HXD A;  3RKY A;  3HTS B;  4HF0 A;  4AIK A;  1XSX A;  3QU3 A;  3I0T A;  1EH6 A;  3O3K A;  4S04 A;  2QWW A;  3ABU A;  5HVQ C;  2E7X A;  1YG2 A;  2FQ3 A;  1BI3 A;  5JVT A;  2MC3 A;  3RTR A;  1H9G A;  2MH2 A;  2IA1 A;  1ZN2 A;  1P4X A;  3T8R A;  3GZ5 A;  1G6N A;  3FX3 A;  3QP6 A;  4MQ9 F;  1U5T A;  3FHZ A;  4WXD A;  5KK1 A;  5DYM A;  2OBP A;  3BPV A;  5DDG A;  1HSJ A;  4G6D A;  2COM A;  2XAS A;  3QP5 A;  3ZN0 A;  3WTS C;  1QBJ A;  4P55 A;  1XGO A;  1TTY A;  4N0B A;  1XSD A;  3E6B A;  2O6G E;  3HHG A;  1R00 A;  2E1N A;  3LAJ A;  1BI0 A;  2X4H A;  3J81 K;  3MCZ A;  5DD8 A;  1KU9 A;  5HLI A;  5L3G A;  3HRT A;  2DPD A;  3Q5F A;  2FNP A;  2AS5 F;  4KNY A;  4IPA A;  1F9N A;  4JBA A;  1OKR A;  1J59 A;  3F72 A;  3GFI A;  2G7U A;  5D6F A;  1IXS B;  2ESH A;  4LB5 A;  3KE2 A;  1S3J A;  4AD9 A;  1I6X A;  4S05 A;  3E5U A;  4WWC A;  2JZY A;  3I53 A;  1FYL A;  2KIM A;  2M5W A;  2XVC A;  4XSX F;  1SFU A;  4MEX F;  3SXY A;  4LLG F;  4XBF A;  3JSO A;  3PQJ A;  3T8T A;  1IN5 A;  1S7O A;  3DEU A;  1XGM A;  1T38 A;  1F4K A;  4OIN F;  5JHU A;  1IN6 A;  4LMY A;  1QGP A;  4LK0 F;  4EM0 B;  4OIP F;  4ZH4 F;  3HSR A;  4G7H F;  2XAF A;  3C18 A;  2WTE A;  2Z9O A;  4EV0 A;  1W7P D;  2V1X A;  3FMR A;  4KT5 C;  3QAH A;  2A07 F;  5HS8 A;  5CJ9 A;  4E70 A;  1CF7 B;  2JRT A;  1LVA A;  1B9M A;  1L0O C;  1S29 A;  3C7J A;  3I5U A;  3G3Z A;  5LBQ A;  2CQK A;  4P9U A;  2F5F A;  4NHJ A;  3C1D A;  3TO7 A;  2A3S A;  4IXA A;  3BWG A;  3IHU A;  2M1B A;  1MJB A;  4OOI A;  3DPT A;  1T98 A;  3I64 A;  2VON A;  2W25 A;  1WWX A;  5DCF A;  2IVM A;  5AIQ A;  4HBL A;  5ICF A;  4ON0 A;  2HZT A;  1ZRC A;  2FXA A;  5EEG A;  4ENK A;  2W85 A;  5EEH A;  1DP7 P;  1NHA A;  4ESJ A;  3HOS A;  4M9X A;  3TO6 A;  3P9I A;  4UVB A;  5FO5 A;  2E7W A;  3V8K A;  1J75 A;  1B6A A;  4KIG A;  4LFU A;  3LQR A;  4Q5S F;  3RI4 A;  1E17 A;  1JE8 A;  1KU2 A;  3GUD A;  2QUF A;  5FD5 A;  4Q4Z F;  3PQK A;  2P7C B;  2MLG A;  5ICC A;  1R1U A;  4FT8 A;  2A68 F;  1J7K A;  2DK5 A;  2QZ8 A;  5DCM B;  2XKO A;  3KZY A;  3L00 A;  1P6R A;  4UNO A;  4IRI A;  1MJ9 A;  1WI9 A;  3FMS A;  2PMH A;  1STZ A;  2CGP A;  3BP8 A;  5A2Q K;  1IZ1 A;  2O3F A;  3E6D A;  1JXS A;  2CG4 A;  3ZMD A;  4CIC A;  2GWR A;  1FBS A;  1LEA A;  1SMY F;  3CTA A;  4IRG A;  3RIR A;  3MEX A;  2EFN A;  2XAH A;  1Q1H A;  2F5C A;  2Y75 A;  3QRF F;  3TQN A;  5D5W B;  2WV0 A;  3IRQ A;  1IXC A;  2UZK A;  2RDP A;  2XHK A;  3G73 A;  4OMY A;  1J0R A;  2NYX A;  3F21 A;  3FM5 A;  3ULQ B;  4BHC A;  1W5S A;  4M9S A;  2ZKZ A;  4GGG A;  4ZYG A;  4Z2Y A;  4OMZ A;  2KIU A;  4ETS A;  2ZBK A;  4A6E A;  2FU4 A;  3DXJ F;  3WTZ A;  4LG0 A;  3J80 Z; 
#chains in the Genus database with same CATH topology
 2EK5 A;  1YW7 A;  3L7W A;  1MIJ A;  2LP0 A;  3BQZ A;  2LTP A;  4NUB A;  3GLX A;  3HOY J;  3WU1 B;  2ACJ A;  3CMM A;  4C3H J;  1OCR H;  2RC4 A;  1TNT A;  1VQ8 I;  2GA1 A;  3TKY A;  1BA5 A;  2V26 A;  4NNJ A;  5GTH C;  1D8J A;  5CVI A;  1C0W A;  4C2U A;  1SAU A;  3EUH C;  5EEA A;  5BPI A;  5E20 A;  2F4I A;  2BXZ A;  3FK6 A;  4UV9 A;  5LGN A;  4IVN A;  4BE0 A;  1A5J A;  5E17 F;  4D5C A;  3QYE A;  4E7J A;  1YS6 A;  1A04 A;  2YS9 A;  1GVJ A;  3RPQ A;  5FFX A;  2MG4 A;  2GIV A;  1EKE A;  1BI1 A;  2KRF A;  3K1N A;  5LHI A;  1TW2 A;  2M8E A;  4A3L J;  2OJE D;  3ECH A;  4NBQ A;  5F0C A;  1TWC J;  2CV1 A;  2IGM A;  1TWF J;  2L3D A;  3BY6 A;  2X6W A;  3H3U A;  3M8F A;  4PK4 A;  1H9T A;  1FOW A;  2KRH A;  1SAX A;  4U88 A;  3G6E I;  1SD7 A;  1Y8R B;  3Q0W A;  4JX4 A;  5D5V B;  5EG0 A;  1KON A;  5ED4 A;  1LUJ B;  1V55 H;  4R8H A;  2HVS A;  4Y17 A;  3V7S A;  1BW5 A;  1T0F C;  3KP3 A;  2V6E A;  3MFK A;  1ODD A;  2DMU A;  5FRN A;  2K9S A;  3FK7 A;  3PSI A;  1Y1W J;  2ZSH B;  2ZXJ A;  3L9F A;  3NWS A;  2FMY A;  1VFC A;  2Y9Y A;  5D4S A;  2XF7 A;  3RKX A;  3M9A A;  3JAM Z;  3GXO A;  5LHG A;  3ZGK A;  4ZYE A;  4HLY A;  1Z9C A;  4YIF A;  2A05 A;  5LHH A;  1Z6R A;  2WA0 A;  3HG9 A;  2R7R A;  2HEO A;  3JW4 A;  3MKZ A;  2W84 A;  4IQJ A;  3LSP A;  1TQM A;  2PEX A;  1X2M A;  3BG3 A;  5HOO A;  2PI0 A;  2XB0 X;  3R61 A;  3JTG A;  2FQ4 A;  2ZJP F;  1OFC X;  1JUS A;  4LLL A;  3TO9 A;  2WY7 Q;  1IGN A;  2P5K A;  1LDK B;  3GLL A;  2Y48 A;  1IN8 A;  1F5T A;  5LEK A;  3I59 B;  1R23 A;  1SMT A;  2FSW A;  3P7N A;  1I5Z A;  4HZF A;  3FXL A;  4BL0 B;  4A6D A;  3GTO J;  4IHY A;  4FHT A;  4A3K J;  3CC7 I;  5GAD J;  5J8C A;  2HR3 A;  3S14 J;  1IRF A;  4RS8 A;  4LJZ F;  3I71 A;  2P8T A;  4XKB A;  1QHG A;  2HU9 A;  3F8B A;  4I09 A;  5HLT A;  3CZ6 A;  3UR3 C;  1DU0 A;  5CLS A;  2EFQ A;  2KIQ A;  2QEN A;  1U2W A;  1KU7 A;  1M1E B;  3RKW A;  1UZC A;  3WU2 C;  2X6O A;  3W6V A;  3MMY B;  2JWT A;  3RZO J;  3CJQ B;  2W48 A;  3BC8 A;  3S1N J;  2HOE A;  3BOQ A;  1FBU A;  4M71 A;  4XLC A;  5M5Y J;  2P4W A;  2UUZ A;  3RCO A;  1ZG1 A;  4XLE A;  2QYO A;  4LIV A;  3MZH A;  4HX4 A;  1E3P A;  2DW4 A;  3ESW B;  4W97 A;  3TGN A;  3IAS 2;  5E1W A;  1MNE A;  1VQ4 I;  3KEY A;  2VQH A;  2M87 A;  2HTJ A;  3OL4 A;  1DQU A;  3V42 A;  1NH3 A;  1W1W E;  2K27 A;  4AYB A;  2VOO A;  1A36 A;  4I7H A;  4GXO A;  5AIP A;  2I10 A;  3HOU J;  2H1L A;  2XV4 S;  4DIQ A;  3CCV I;  3KET A;  3HRS A;  3BTJ A;  4U0Y A;  3K4L A;  1GXQ A;  1MSF C;  3ZMU A;  2ME0 A;  1O7L A;  1Z0X A;  4G8X A;  2IBD A;  3GFL A;  3I4M J;  4QSH A;  1J9I A;  3VYU B;  2J5P A;  1WVR A;  3H92 A;  1YYV A;  1I27 A;  3WU0 A;  4E6K G;  2Q1Z B;  1XMX A;  1IXR C;  2BHY A;  2VBW A;  1V5F A;  3H3Z A;  3QU6 A;  4MHG A;  5B3S H;  1ERD A;  3V7R A;  3HBL A;  2DJI A;  3RPU D;  2HGC A;  3ZQQ A;  4LLN A;  3OS0 A;  4MIM A;  2OAZ A;  1A31 A;  2JJ7 A;  2E1O A;  3CLO A;  3F8C A;  5FLX K;  2C6Y A;  3J7Z I;  4WCG A;  1QZY A;  3Q0U A;  2HNH A;  1W0U A;  3HRU A;  3O2P E;  3K2Z A;  4Q47 A;  2QEX I;  4HRI A;  4XLF A;  4B44 A;  3I3L A;  4OAZ A;  2L9V A;  4CA0 A;  3RJP A;  4RB1 A;  4CHU A;  1HKS A;  3ONQ A;  4E7Z A;  2B0L A;  2K3F A;  2VJI A;  3DU6 A;  4UB8 C;  1X3Z B;  2IA2 A;  3HKZ A;  3N4M A;  1WJD A;  2IT0 A;  2AXT C;  1FLI A;  2ZNY A;  1A6Q A;  1ZYR F;  1YFH A;  1MH4 A;  4C2M J;  3N05 A;  3UKG A;  5H6Q A;  1N25 A;  2BY2 A;  1AA7 A;  3LWF A;  3WE3 A;  4BNC A;  3ML6 A;  1U78 A;  2YU9 J;  4O3M A;  2PQ8 A;  2BHZ A;  2L5Q A;  4I98 B;  4LG0 B;  4MNU A;  4P96 A;  1BM9 A;  1R1T A;  1PDN C;  1ZAO A;  5L3D A;  1MBH A;  2F48 A;  4XLN F;  2QF7 A;  2L02 A;  5LGT A;  5DM7 F;  2DDB A;  5FD6 A;  4FET A;  1TNS A;  1D0Y A;  5FKL A;  1SFX A;  2H09 A;  5FLM J;  3BR0 A;  4EJW A;  2JRM A;  1O3T A;  4IHS A;  2VAS A;  2QLZ A;  3ISP A;  1XDS A;  5C44 J;  4O5V A;  3KP6 A;  3WHB A;  3I58 A;  4X6A J;  4BBR J;  1BW6 A;  2Z3Y A;  4ZC3 A;  1BBY A;  4QPQ A;  5HDK A;  3JRC A;  3CME I;  3CCQ I;  1MNM C;  2DAO A;  1LFP A;  4G6Q A;  3GZ6 A;  2YU3 A;  3GTJ J;  3CJN A;  3BG5 A;  1YE9 A;  2MD5 A;  4N4N B;  4ESB A;  2XGC A;  1HW2 A;  4XK4 A;  3EYI A;  4FE4 A;  4TV7 A;  1D0Z A;  2AXL A;  1HOM A;  2DTZ A;  4ZJZ A;  2NOJ B;  2ZO4 A;  2ZME B;  4B48 A;  3EUH A;  1DU6 A;  3PL8 A;  2DN0 A;  1IV8 A;  2XUB A;  5K7H A;  2IA0 A;  2FUG 2;  5CVV A;  3HL2 A;  3B6A A;  4KFC A;  2FEZ A;  3HSE A;  4XRF A;  1IDY A;  5ERI A;  3H9J A;  1QQI A;  3MKY B;  3ZQG A;  1VQM I;  3LL7 A;  1IUY A;  4RDU A;  3LAP A;  3EUK L;  3QOD A;  1Y6I A;  5H2F C;  5F27 A;  3R0J A;  3ABM H;  3NRV A;  2ECC A;  4D7N A;  2DMQ A;  2O0Y A;  2KQR A;  5DCM A;  4CUG A;  1E0E A;  4WF2 A;  3QOP A;  2V1U A;  2UXN A;  2Y0M A;  4BHB A;  1KA8 A;  2VC1 A;  2VJ4 A;  1R9T J;  3BCA A;  1T0F A;  4R1H A;  4AWX B;  2E36 A;  2ISY A;  2M45 A;  1B59 A;  3HSF A;  2MYS A;  4XR6 A;  2R0Q C;  1S6L A;  2RRE A;  2Z5U A;  2XRO A;  1MDM B;  3WGG A;  3DPL C;  2M34 A;  4IRH A;  1YLF A;  3K9T A;  2R5Z B;  2EJR A;  4V2G A;  3K4C A;  1LE8 A;  2FBI A;  1GVD A;  1XCV A;  1MH3 A;  3HYI A;  3C2G A;  3VWB A;  2LR8 A;  1FEX A;  1GXP A;  1B72 A;  2VJ5 A;  1FP1 D;  2KPM A;  5CKT A;  4B47 A;  2I8D A;  3JRB A;  5JI6 A;  2YR2 A;  2LY1 A;  3ZP5 A;  2GIZ A;  1OCC H;  4EGY A;  1P4A A;  4U0V A;  4L9V A;  5BMZ A;  1NG6 A;  4U7B A;  4C9Y A;  5M3F J;  5JLX A;  5LGU A;  5EDN A;  1EV7 A;  2PX9 A;  4NC8 A;  3G1M A;  2LBF A;  3TP0 A;  4F7Z A;  3U1D A;  3HIF A;  4BKX A;  2E19 A;  3MZY A;  1XS9 A;  1PYV A;  4G12 A;  1JKQ C;  3W3C A;  2B63 J;  2HQA A;  2PJR B;  2XRN A;  3F8M A;  5LRR A;  2BV6 A;  4ZZD A;  1BR4 A;  2G7H A;  4KN7 X;  3B73 A;  1Z05 A;  5F0H A;  1U8B A;  4L18 B;  1OJL A;  4L5E A;  4OWR B;  2L7M P;  2QQA A;  1QVU A;  1WH7 A;  1N77 A;  2X1D A;  5CQG A;  1FWZ A;  2Z1D A;  4BY7 J;  4NQW B;  4OAY A;  1J09 A;  4UV8 A;  1KQ9 A;  1OR7 C;  4YEJ A;  2A6T A;  3OMY A;  4MLO A;  4L0Y B;  2LF7 A;  5E79 C;  2DA3 A;  4XSZ F;  2LYC A;  4JQF A;  2CUZ A;  4F93 B;  2HVR A;  2DMT A;  1FOX A;  4M3D A;  3AG2 H;  2OCC H;  3C3W A;  2MH9 A;  2ZME C;  3FXK A;  1VQK I;  4ZZL A;  3A01 B;  2R93 J;  5DM6 F;  1WH5 A;  2ECB A;  3ZMZ A;  4HF1 A;  4I76 A;  4A3I J;  2R7V A;  2ESN A;  3HC7 A;  5FFZ A;  3I54 A;  4R79 A;  2QBY B;  3AL0 B;  2EA2 A;  2H6C A;  3DWL E;  2HOT A;  1X2N A;  3IRR A;  3BJO A;  5FLV A;  4A3E J;  4HOB A;  4YII A;  5M3M J;  4B3X A;  1FZP B;  2FD5 A;  3K7A J;  4K2E A;  5LEJ A;  3S2D J;  1EF4 A;  2E2J J;  1LPQ A;  3SEQ A;  2EV6 A;  1TC3 C;  5IT9 K;  3CD6 I;  4HDU A;  1WSU A;  3PUF A;  3CJT B;  1MSE C;  2R3S A;  3D0S A;  2RVC A;  3REO A;  3R6S A;  1P4W A;  2KZG A;  1OYY A;  2MW8 A;  4RAY A;  2DO7 A;  3L1P A;  4BBS J;  1TWA J;  1QPI A;  5KHD A;  3WTX C;  4RB0 A;  1K6O A;  2NS7 A;  3SDG A;  5F04 A;  3BG6 A;  4LIT A;  2OUM A;  1KGS A;  1EH8 A;  4NB5 A;  3O6B B;  4Q48 A;  3GX4 X;  5TIS C;  2DU9 A;  1XMA A;  2A5W A;  3DLL F;  1FSH A;  1X3U A;  1S8N A;  4XON A;  5ICG A;  4KIB A;  2F5E A;  5FKK A;  2KLO A;  4HG2 A;  4BXU A;  1RRJ A;  2QQB A;  4EGZ A;  2K02 A;  5F6F A;  1I3Q J;  4IL6 C;  3W2A A;  1G3T A;  1ETQ A;  3GME A;  3I59 A;  1OPC A;  3C2H A;  1VQP I;  3DEE A;  4M73 A;  1HKQ A;  3BZ6 A;  4D5F A;  1RES A;  2OQG A;  3F8N A;  2M0C A;  4PFP A;  1FOY A;  1BR2 A;  4L0Z B;  4PGH A;  3J7A Y;  3SQN A;  2G9W A;  1VTN C;  5HLG A;  1V54 H;  3P5J A;  1GHC A;  2P6T A;  4CZZ A;  2TCT A;  3E6M A;  3LSJ A;  1GV5 A;  3HM5 A;  2L01 A;  1P7J A;  4ZTJ A;  3B02 A;  5LRS A;  3EET A;  4B09 A;  2XGX A;  4CYD A;  1K4T A;  4CCO A;  3LSM A;  4PZJ A;  2I5U A;  3OYJ A;  4HV5 A;  3T0Y A;  4HQM A;  2CQX A;  5B5E C;  3I4N J;  2E35 A;  2MLK A;  3FDY A;  5HNF A;  1PUE E;  2IP2 A;  3BR6 A;  2VBX A;  2UXX A;  3SJM A;  2W82 A;  4OIO F;  3QPT A;  4A12 A;  1D0X A;  2VT3 A;  3JRD A;  1JTY A;  1I1S A;  1DP3 A;  1VZ0 A;  2F4M B;  5BS6 A;  1Z6T A;  3FBN B;  1FY7 A;  3U9G A;  3PNV A;  1ZKG A;  4UXN A;  2NVQ J;  2QCO A;  4RAZ A;  1Y1V J;  4M9Z A;  3HOW J;  5JR3 A;  3S2H J;  2KRC A;  4ZYD A;  2Q0O A;  2DFF A;  3R4K A;  4Y4R A;  3GWZ A;  4IHX A;  4PJJ A;  1SD5 A;  5A2Q Z;  1JGS A;  3AL0 C;  3GVA A;  4HNV A;  2FOK A;  3I4P A;  5IP9 J;  3CCU I;  2QA4 I;  1TW3 A;  5E1Z B;  3LA2 A;  3JRA A;  4BGD A;  2Q8K A;  3ABK H;  2E71 A;  3FHN A;  3H5R A;  1GLN A;  2GAU A;  2P0W A;  3A02 A;  3KYD B;  4G7Z F;  4JX6 A;  1FOK A;  3ZPL A;  1R71 A;  3CDH A;  3EYY A;  3CCE I;  1RNL A;  3KLO A;  1IAW A;  1YX5 A;  4IQ4 A;  1QU3 A;  4UVA A;  1TQI A;  2WAQ N;  2ME6 A;  1R5G A;  3SZP A;  3LFU A;  1FC3 A;  3BR2 A;  4H4K C;  2W00 A;  3OYD A;  1B9N A;  2FE3 A;  3ECO A;  2CFO A;  1K78 B;  2QQ8 A;  4A5N A;  5EZH A;  3KZI C;  3S93 A;  4L9T A;  1JJ6 C;  3S1Q J;  1WHU A;  1H89 C;  1B1B A;  5L3C A;  2V79 A;  2LBF B;  5ICE A;  1R5H A;  3Q0V A;  3BJA A;  5BQT A;  1Z3X A;  3DTK A;  4XLP F;  1Z67 A;  3HDD A;  2LC2 A;  2V7F A;  2CFX A;  3EQL F;  2XGE A;  2GZW A;  4KYW A;  3GEZ A;  1P9Q C;  4P1W A;  4KJZ A;  3HRM A;  1WRJ A;  3ZMV A;  3JRG A;  3E97 A;  1VF9 A;  3KP7 A;  1LQ1 A;  3GTL J;  2F4O B;  1RC9 A;  4KA4 A;  2RV8 A;  1XC5 A;  1TBX A;  4BE1 A;  3OR2 C;  1UST A;  1X1B A;  4BAC A;  2STT A;  1POG A;  3BPX A;  3FIW A;  2KP6 A;  1W5T A;  2ZB9 A;  3TOB A;  4XLA A;  2VOD A;  2MAB A;  3TW7 A;  5KAI C;  1X19 A;  3IL2 A;  2K86 A;  3DTI A;  2Q2E B;  2ELK A;  3NEU A;  3WTV C;  4L9J A;  1DGW Y;  3F8F A;  2A6E F;  2VPR A;  5J1Y A;  3H35 A;  1HW1 A;  2EFW A;  3TP3 A;  1OMI A;  4UUV A;  2RGV A;  2X51 A;  4XOT A;  1S7E A;  1W7P B;  4BQO A;  3S3M A;  4Y52 J;  2BE5 F;  1EH7 A;  1WKM A;  3G1O A;  2HVQ A;  4QLC U;  5BNG A;  1LDJ A;  3TBI A;  2LD5 A;  4E7H A;  1FSE A;  4HX7 A;  2FML A;  3SHF A;  4OIQ F;  2QQ9 A;  3HXL A;  2RNJ A;  2L9N A;  4IHT A;  3W6J B;  1YJW I;  1OR7 A;  5F1R A;  1R4N B;  3CO7 C;  5HDN A;  4HF2 A;  2XKP A;  4A69 C;  3FF5 A;  4LOC A;  3K4N A;  1ZAR A;  5ILU A;  4C2T A;  3CCS I;  4HQE A;  1X1D A;  2LY2 A;  2ZME A;  2LOO A;  2ZCW A;  5E1X A;  4QIW N;  1S5L C;  5J1U A;  2O8X A;  1KYZ A;  2OZ6 A;  3LFK A;  1YI2 I;  1SD6 A;  4RGS A;  5K1Y A;  1X4P A;  1X58 A;  2H27 A;  3CUQ B;  1IC8 A;  2MBF A;  1B4A A;  1PP8 F;  4HAM A;  2VQL A;  1V3F A;  3K1M A;  2FRH A;  1FT9 A;  1AWC A;  2QKM B;  2K7L A;  2ADU A;  4HV6 A;  3L2Q A;  2STW A;  1LJ9 A;  4PJ0 C;  3NWT A;  1ZG3 A;  3ZN1 A;  1SAN A;  1ZGJ A;  2COB A;  2FBH A;  1ONV A;  2NVT J;  4D7M A;  4ENM A;  1U8R A;  3OOU A;  2UWM A;  2O03 A;  1O3Q A;  2L7K A;  3KP4 A;  3RYR A;  2ZJR F;  5GP9 A;  1BOB A;  4PJN A;  3KIO A;  2JA2 A;  2JUC A;  3JR9 A;  4LG3 A;  1E2X A;  1RET A;  2M30 A;  4A0X A;  5E18 F;  4FQG A;  1MDM A;  2R7T A;  3J7A O;  2DA4 A;  4RAG A;  3CQZ J;  3IUO A;  4J01 A;  5B66 C;  4L9N A;  5E3N A;  3LSG A;  4I01 A;  4Y3O A;  4M72 A;  3JAM K;  2R5Z A;  1ZRE A;  4UY8 I;  1VQN I;  3OYH A;  1RPW A;  2EZK A;  3WGI A;  3S2W A;  1IN7 A;  2OD5 A;  2E2H J;  2DT7 B;  2HKO A;  2K4B A;  3K4M A;  1ZRF A;  1J2X A;  4A2U A;  3LSH A;  4EJU A;  1LVK A;  3GZN B;  4HYE A;  4KDP A;  2CO5 A;  5L3E A;  3RDI A;  3VEP A;  3S32 A;  1NK3 P;  3OYE A;  1VQ9 I;  2JK3 A;  4YFX F;  1IRX A;  2EBI A;  3HPG A;  4RLQ A;  3S3O A;  3LSK A;  1V4R A;  1I50 J;  3K1P A;  3M8E A;  1WFX A;  3E7L A;  3SZG A;  5K7F A;  3IH3 A;  3PUB A;  2BW3 B;  2K4J A;  2RN7 A;  5DEQ A;  3WGH A;  2Y2Z A;  4GO1 A;  3ASN H;  3CMA I;  2EPF A;  3LQQ A;  3ERE D;  3K70 C;  4GDF A;  2LH9 A;  2IW5 A;  5M5W J;  2PJR A;  4AIJ A;  2HWV A;  4I0B A;  2KDZ A;  1U3E M;  5LLQ A;  4RA2 A;  3HHH A;  3N97 A;  1HA8 A;  1D8K A;  2HFH A;  1TWG J;  1U0J A;  2DDA A;  3VOD A;  1VQ7 I;  3M1E A;  2R7Q A;  1WJC A;  2P7V B;  3QQA A;  5EYR A;  2JPC A;  3SEZ A;  4M6Y A;  2XF5 A;  4AM3 A;  2ETH A;  2A5Y B;  4XL9 A;  5JVG F;  3HGG A;  1RIO H;  1MW7 A;  2XAJ A;  5K5R A;  2VOP A;  2X6Y A;  5ILV A;  1T33 A;  4NQW A;  1SFE A;  5L3B A;  3L2C A;  1XGN A;  3LA3 A;  3RPU A;  4EJV A;  5AON A;  5TGT A;  2HOA A;  4CCN A;  3WTT C;  5DUK A;  2BYV E;  2NVY J;  1OYI A;  2D2W A;  4W1U A;  2DMN A;  3KP2 A;  4X1E A;  3VB2 A;  1G3S A;  3A01 A;  3HPH A;  1NK2 P;  3OYN A;  2EV5 A;  4AYB N;  3CUQ C;  4JP0 A;  3F22 A;  4IX7 A;  2QBY A;  4N9H A;  1FPQ A;  2DA6 A;  2R7O A;  4ZYH A;  1JKR C;  4CGZ A;  4CCJ A;  2EFO A;  2EZH A;  1UHM A;  2R7D A;  3A1Y A;  2DQR A;  3EDP A;  4E4H A;  4KIF A;  1P92 A;  2LKP A;  3F0C A;  4YEL A;  1U6G A;  4I0A A;  4PSW A;  5J47 A;  1Z91 A;  4U7D A;  1WI3 A;  3HOV J;  1DPU A;  4MGR A;  1ON1 A;  4RGU A;  3E6C C;  2KJB A;  3CDL A;  2PMU A;  1KZH A;  4ABZ A;  2H6B A;  4RAF A;  3GYH X;  3IC7 A;  4DZJ A;  3AG4 H;  2X0L A;  3JRE A;  1Z1D A;  1OCP A;  4IEJ A;  1ZHF A;  1CQT A;  4E7I A;  2ELH A;  1ZR4 A;  3Q9V A;  4UB6 C;  4CH7 A;  3K2A A;  5E8G A;  1JT0 A;  3OYC A;  1JGG A;  3CCR I;  2VN2 A;  4I2O A;  2F6C A;  3VYR B;  4IKF A;  1P2F A;  2OTL I;  3EUA A;  4DYC A;  5IYC J;  3OY9 A;  2ZFU A;  5HDG A;  5E8I A;  5E3L A;  1UJ8 A;  3PM1 A;  1W36 D;  3BG7 A;  1XD7 A;  4KN4 X;  3HKZ N;  3LSI A;  3SZT A;  1YW8 A;  2HXI A;  2KIS A;  3HB9 A;  4HLX A;  1KQ0 A;  4LGW A;  4M3G A;  4UVC A;  5KVR A;  2BGC A;  4G9Y A;  1RKT A;  4XQF A;  3LST A;  1IRG A;  2ISZ A;  2EV0 A;  2DYR H;  4OU0 A;  2XF6 A;  3CES A;  1OYW A;  3CCJ I;  2E1C A;  4GRI A;  2HQR A;  1VQO I;  4BAY A;  3AAF A;  2X48 A;  4KUM A;  2CV2 A;  1REP C;  1D5V A;  3DEW A;  3F3X A;  2DA7 A;  1LKX A;  2DFE A;  3MAJ A;  4G7O F;  5D6E A;  4GYI A;  3L2U A;  2KT0 A;  3V8J A;  3D5R C;  2WC2 A;  5FB2 A;  2DT6 A;  2BZT A;  2LRD A;  2V1N A;  3QOE A;  4L5J A;  1IV6 A;  1FJL A;  5GAE J;  5DV5 A;  1BIA A;  1MBE A;  1UB9 A;  4QTR A;  3TMO A;  2X85 A;  2HDC A;  1TLH B;  1ETV A;  5EGO B;  4Y15 A;  1R22 A;  1MD0 A;  2CMP A;  4XNF A;  5F1J A;  3MVP A;  4U0W A;  4CXF A;  4IJA A;  1K4S A;  4IOC F;  1KYW A;  2CSO A;  2P5V A;  2V9K A;  4CO8 A;  4FAS D;  1DUX C;  3GTQ J;  1LEB A;  4XLH A;  3M8J A;  5B1A H;  3GBG A;  4MTE A;  3OYI A;  2X1E A;  4B8X A;  2Z99 A;  3MWM A;  4II3 A;  3TOA A;  1PP7 U;  2HQN A;  1VQ5 I;  1USS A;  3RYP A;  1XB4 A;  3SYT A;  5GPC A;  2QM3 A;  2VKD A;  1TT0 A;  2BVM A;  1JHF A;  2YX7 A;  4A0Z A;  3IWF A;  2P81 A;  2IGK A;  2CW8 A;  3HUG B;  1FX7 A;  3FXR A;  2HYF A;  2Z33 A;  3GTP J;  2GA2 A;  2K3P A;  2KZV A;  1IG7 A;  1WZ2 A;  4MTD A;  1I1G A;  3JSP A;  2A69 F;  1BIB A;  4ZDP A;  3KYC B;  1UHW A;  2HYJ A;  3OV8 A;  3NAR A;  2EA4 A;  3J81 Z;  5DS9 A;  2IJL A;  2LY9 A;  4Y33 A;  5ILS A;  1K78 A;  4EAT A;  2LMD A;  4OIR F;  2HI3 A;  3K69 A;  2P5L C;  5IY5 H;  1RUO A;  1E3H A;  4EMS A;  1MKM A;  2OCE A;  1ZRD A;  2NRA C;  3OYA A;  3D5L A;  3OYG A;  2FNA A;  1MND A;  2M8G X;  4AVP A;  1ORK A;  1ZTR A;  3K6G A;  5HOD A;  2VKH A;  4ZTF A;  4IHV A;  4CCM A;  3M7G A;  1XN7 A;  3WG9 A;  1X1C A;  1FBQ A;  1SC7 A;  3VYT B;  4M6V A;  1WGX A;  2KKO A;  2LFB A;  4RGR A;  4GCV A;  3ZRG A;  3DBH B;  3IKT A;  3BTL A;  1K83 J;  1X1A A;  4BQN A;  3G71 I;  4AIH A;  4RBO A;  1TL8 A;  1NTC A;  2QSF X;  4YG2 F;  3IAM 2;  3WG7 H;  2WWY A;  3CO6 C;  2R7S A;  4C3J J;  2LF8 A;  1Z7U A;  2ID6 A;  4Z6Y A;  1A35 A;  3S3N A;  1R49 A;  2XSD C;  3BDD A;  3W6K B;  1YIO A;  6PAX A;  5D8L B;  2Q2E A;  2LNB A;  1N78 A;  3B6C A;  1FTT A;  2PLY A;  3IKV A;  3T1B A;  3LA7 A;  3WHC A;  2YPR A;  5TRD A;  1W7P A;  4BJ5 C;  1MZB A;  4B3A A;  5JFR A;  2KHM A;  2R7U A;  3PJR A;  2KMU A;  2A61 A;  1ON2 A;  4E7S A;  4A93 J;  1YO5 C;  1G4D A;  4IOA F;  1RUN A;  2EQR A;  2QVO A;  2IGO A;  5J6X A;  1RZ4 A;  5K5O A;  1HQC A;  2MGQ A;  3ROU A;  3OR1 C;  3K4J A;  2DK8 A;  2JVG A;  1YRN B;  3F6V A;  5IT9 Z;  2EIJ H;  2HOS A;  4DQ2 A;  3WE2 A;  4I6Z A;  1ZH5 A;  4D0P A;  1K7A A;  1T08 B;  2L4A A;  1AKH B;  1QO0 D;  3ZR8 X;  1G3W A;  1LDD A;  4ENJ A;  5FGM A;  2DLL A;  2O9L A;  2L54 A;  4FCY A;  1R58 A;  3BR3 A;  3CUQ A;  3L2W A;  2ZNZ A;  3IH2 A;  4I99 C;  3BG9 A;  1MMG A;  4MO7 A;  2VC0 A;  1TQP A;  2OQR A;  1HBX G;  2TDX A;  2VXD A;  4ESF A;  2DBB A;  3L2R A;  4XOP A;  2GQQ A;  2L4M A;  3F6O A;  1WCM J;  1S72 I;  2BEO A;  4XN3 A;  1BOA A;  1MMA A;  1QZE A;  1VQL I;  2Z2S B;  4A5M A;  3ELK A;  4KIC A;  3KP5 A;  1X3W B;  2HQ5 A;  5J4Y A;  1ULY A;  4PJL A;  3BJ6 A;  3AG3 H;  4HDV A;  2NS8 A;  4GFB A;  2YSR A;  1K79 A;  4XRM A;  4MQV A;  3KLN A;  4DW6 A;  3CCL I;  4II2 A;  2DA2 A;  2CYY A;  1XCB A;  3K0L A;  2F5D A;  1UEL B;  4G94 A;  3W2V A;  1FYK A;  1XGS A;  3CP2 A;  3BCB A;  1D3Y A;  4KIS A;  5CVU A;  1O3S A;  5EF6 A;  4JX5 A;  2XPU A;  1XX5 A;  3FWE A;  3T5X A;  3U1K A;  5L3F A;  3A2K A;  5C4X J;  4XKC A;  1TT5 B;  4A3D J;  2LRE A;  1S9H A;  3VSL A;  2VXZ A;  2W4S A;  4BY1 J;  3ZQH A;  5E3M A;  2XPV A;  3F9K A;  4BU2 A;  4BHP A;  5CYV A;  1ZEL A;  1T56 A;  2BW3 A;  4CYC B;  1UMQ A;  2KDO A;  4KT6 A;  4PGG A;  3VSK A;  4X0G A;  4XRS G;  2CWE A;  2Y30 A;  3DCF A;  3DTE A;  1XPX A;  3HZJ A;  2NVX J;  2XGD A;  3GFJ A;  3F23 A;  1SFK A;  3ZOB A;  3ZQF A;  2H1K A;  1H8A C;  2Y31 A;  3K4B A;  1KQ8 A;  1E3O C;  4RB2 C;  1T95 A;  2KFD A;  4WXH A;  4YRV A;  5C4J J;  2GBY A;  5B1B H;  1SVL A;  3CF2 A;  5F0F A;  5H6R A;  2ELJ A;  1Z7L A;  2LVS A;  3KZZ A;  4FX0 A;  1Y39 A;  1ETO A;  1IF1 A;  1X1P A;  2JQ7 A;  3PNT A;  3OIO A;  1ITY A;  1OCZ H;  2CW7 A;  2OA4 A;  4C3I J;  1EJ9 A;  1QRY A;  3WTY C;  3H0G J;  5C3E J;  4RMN A;  2X1C A;  2J5O A;  3C2B A;  3ZQ7 A;  1HW5 A;  2EWN A;  4KMU X;  3WOD F;  1MJA A;  2D1V A;  3DP7 A;  1Z3Y A;  3QPH A;  4DNC A;  4ITV A;  2CQN A;  2X9D A;  2CUJ A;  1YW9 A;  1XSV A;  2CS3 A;  4L5I A;  2NVU B;  4ASN A;  5LD2 C;  1SEU A;  3OYL A;  9ANT A;  1U5T B;  3WTW C;  2V9V A;  3X2Q H;  3OS1 A;  4QWQ A;  3W2W A;  3L2V A;  5IOY A;  3HTU A;  2KJC A;  1PUF B;  5FKO A;  3E0J B;  2XAQ A;  3OYB A;  2K9N A;  3CP8 A;  2JA8 J;  5D4R A;  3R60 A;  1CGP A;  2IGN A;  4M3E A;  2O5R A;  4EJO A;  2BOL A;  3L09 A;  3J7Y J;  3OIQ A;  1IDZ A;  2NS0 A;  1BN5 A;  1RKW A;  5D8K B;  3E5Q A;  2G0E A;  2IS2 A;  3TW6 A;  2M4G A;  2PG4 A;  5F64 A;  1UCR A;  4J19 A;  2BY1 A;  2O8K A;  1LB2 A;  1YQA A;  4AC0 A;  3DFG A;  2GXG A;  2HKX A;  2YX4 A;  4WXC A;  4D1Q A;  1L3L A;  2CW0 F;  4EJT A;  1WJA A;  4A3G J;  2VKE A;  2MC4 A;  4RGX A;  3GW2 A;  3OOP A;  4EM2 A;  2HXO A;  2PN6 A;  4CZC A;  2IRF G;  3K10 A;  1JKO C;  3JRF A;  2HYG D;  2L9R A;  2AHQ A;  2R5Y B;  4BQQ A;  2V1D A;  2DA1 A;  5HS9 A;  2K9L A;  3DQV C;  5BPD A;  1ZR2 A;  2ZXW H;  2VQC A;  2EIK H;  4F55 A;  4CCL A;  1BR1 A;  4XKW A;  4E7K A;  2OC6 A;  2E2I J;  1R1V A;  2VI6 A;  2RAE A;  1BJA A;  1FTZ A;  5K5Q A;  1MGT A;  1D1B A;  1G59 A;  3U2R A;  2Y0S A;  4BJT A;  5D5U B;  1RR8 C;  4PDK A;  2DOD A;  1D1C A;  2ID3 A;  2WBM A;  1J5Y A;  3IH4 A;  4F3Q A;  2DCE A;  3EPZ A;  4C30 A;  3J80 K;  4CDG A;  2M9H A;  5CVR A;  4A3M J;  2DA5 A;  2BY0 A;  2FX0 A;  4A0Y A;  1HDP A;  4FX4 A;  1I39 A;  1SD4 A;  4AUX A;  2VJJ A;  4HEA 2;  3ZCO A;  3PFY A;  2VT2 A;  3JCU C;  4WK8 F;  3ZMS A;  4BH9 A;  3ABT A;  3A03 A;  2Z16 A;  3FBI B;  2HTS A;  1XMK A;  4MFE A;  5J40 A;  2NNN A;  4HNT A;  3DLA A;  1O4X A;  3PSF A;  2BVL A;  5F08 A;  5E3O A;  4LB6 B;  3ERM A;  2Y0S N;  4BUP A;  2LDU A;  3Q9S A;  3DF8 A;  4U87 A;  2XIG A;  4UHT A;  3CUO A;  1RI7 A;  2ZSI B;  2VBZ A;  2LKX A;  5EGO A;  4YFK F;  2JN6 A;  3ZQC A;  3SFZ A;  4MEY F;  3BZC A;  1W4M A;  1YTY A;  1A6I A;  1GDT A;  3FZV A;  4N9I A;  2XRL A;  1AU7 A;  1HST A;  2E34 A;  4ZDL A;  1R4M B;  4DOZ A;  5JHF A;  1ZLK A;  1UFM A;  3KCC A;  1HLV A;  1U5T C;  1YIJ I;  5J8F A;  2AQE A;  3FXQ A;  5HS7 A;  2PBI A;  1Y0U A;  3QPS A;  1R5I D;  2DMP A;  4BQA A;  4I02 A;  2KL4 A;  2IPQ X;  4KIT B;  1IN4 A;  2NNY A;  4BYY A;  4PFO A;  1QNT A;  4EVI A;  3D1N I;  2JSC A;  2PJP A;  4RLF A;  3V7C A;  1WJF A;  4P5O A;  4HW0 A;  2JA5 J;  1IJW C;  4ZYA A;  5HNH A;  3LSR A;  5FRM A;  3FM3 A;  2H8R A;  2JPB A;  2JT1 A;  3RZD J;  2LSO A;  1F1Z A;  5IYB J;  2R7X A;  5IYD J;  4MFD A;  3ASO H;  1N75 A;  3HUG A;  4F91 B;  2W24 A;  3A0H C;  3KPH A;  5TJJ A;  3OYM A;  1R7J A;  3VOE A;  1IRZ A;  3M07 A;  2V6C A;  3CMY A;  1UAA A;  2K9M A;  4KMF A;  3V8L A;  1YX3 A;  5JLW A;  3HOT A;  2XAG A;  2FA5 A;  1T2K A;  1XG1 A;  4YIR X;  5HLH A;  2CQ7 A;  2VBY A;  3GF2 A;  3WTU C;  2MA3 A;  4PCQ A;  4M6X A;  4ENN A;  1IW7 F;  2PMZ A;  3ZMT A;  1WQ2 A;  4IHW A;  2ZJQ F;  1FIP A;  1T6S A;  4EM1 A;  3MQ0 A;  3CDI A;  5EJC A;  1SVM A;  1MBF A;  5D5X B;  1YS7 A;  1D5Y A;  3DV8 A;  1DPR A;  1ETW A;  4UUS B;  3VPR A;  3SFI A;  3R0A A;  1FNN A;  1QZZ A;  3M4O J;  3QYF A;  2MFZ A;  1FIA A;  2DOF A;  3BTC A;  2HZD A;  2H8W A;  1RR7 A;  4PUS A;  5FKN A;  1YJN I;  1S7A A;  2IS6 A;  1I6H J;  4HX8 A;  1JJ8 C;  2NXN B;  4V19 K;  1ZGA A;  2DOA A;  1BC7 C;  2L9S A;  1B8I B;  3H3V K;  2K9Q A;  2PMZ N;  3FXM A;  2D45 A;  1O7F A;  2F2E A;  3GO5 A;  3Q3S A;  2E60 A;  1AOY A;  2DI3 A;  3FMQ A;  1T8I A;  2RQP A;  2XAU A;  3H9Q A;  2DT5 A;  2LK2 A;  3BRO A;  4Y7N J;  2O61 A;  2NAZ A;  2VL8 A;  4P9F A;  3MZ8 A;  3IWZ A;  4M74 A;  3H36 A;  2FF4 A;  3TDZ C;  4YFN F;  4DZP A;  1KU3 A;  4RM3 A;  2W7N A;  3PIO F;  2D5V A;  4IF4 A;  2JUG A;  5IT3 A;  1UHS A;  2EFP A;  4LIU A;  3LNQ A;  2HPM A;  1ETX A;  5FLX Z;  4EQQ A;  1FMV A;  3DBL B;  2W57 A;  2AO9 A;  5J1R A;  4WX9 A;  1FYM A;  2OF7 A;  2BBY A;  1O3R A;  1WPK A;  2CV0 A;  2V4J C;  1XTA A;  1BI2 A;  3KYL A;  3RQ4 A;  1YRN A;  2R7F A;  1H0M A;  5DD4 A;  1O57 A;  4DYQ A;  3QPL A;  3FXU A;  3COA C;  2E5N A;  4GYG A;  5KCM A;  1T39 A;  5CVJ A;  1AKH A;  3E5X A;  3GFM A;  1HF0 A;  2K40 A;  2KIF A;  1GUU A;  2OU2 A;  2DFI A;  1ZG5 A;  3OSF A;  2CU7 A;  4BEH B;  1ZLJ A;  1JHH A;  2DQL A;  3CC4 I;  3KEQ A;  4A3B J;  4LD5 A;  4B4C A;  2D1H A;  2WV1 A;  3E3V A;  3G1L A;  1OCO H;  1HKT A;  1OIS A;  3S17 J;  1FP2 A;  3ZXS A;  1DDN A;  2X6X A;  1Z21 A;  2XB5 A;  3RKQ A;  3I9V 2;  2E5Z A;  1R36 A;  2RKH A;  1ZGW A;  3OWT A;  2ZJ2 A;  2JA7 J;  3M1C A;  2RQQ A;  4H0E A;  1Y8Q B;  2CUE A;  1HDD C;  1CF7 A;  2Y69 H;  4LK1 F;  3G2B A;  2HS5 A;  2IEK A;  5DUI A;  2XSJ C;  4E7L A;  2R7Z J;  3UNG C;  3DKW A;  1ENH A;  4NC7 A;  3RQI A;  3PO3 J;  4RB3 C;  3JTH A;  1IO2 A;  2EH3 A;  1BC8 C;  3HGY A;  2FOW A;  1Y0N A;  2IS1 A;  4Y13 A;  3V4G A;  4DBQ A;  2R4G A;  3A4C A;  2XPW A;  4JYK A;  1XDU A;  3PIP F;  4DGW B;  3I56 I;  4BJ6 C;  2EB7 A;  1U9O A;  5DTD A;  3KEO A;  4AVZ A;  3P9K A;  2VE8 A;  2VB6 A;  2GXA A;  2K85 A;  3H5A A;  2DTR A;  2EIN H;  2ZFW A;  1BL0 A;  1G3Y A;  2EZI A;  3PFI A;  2OZU A;  5BOX A;  4HST A;  2VE9 A;  4F52 A;  2P6S A;  2GXB A;  2OTJ I;  3H1C A;  2WB1 A;  2HDW A;  1ETK A;  3TED A;  1LNW A;  2DXI A;  1YJ9 I;  3DKY A;  3VFZ A;  2A6H F;  1LFU P;  1IUF A;  1ETY A;  2JTV A;  2DPU A;  3P9C A;  2CH0 A;  2CUF A;  3BR1 A;  4HA8 A;  2PFB A;  5CPR B;  4AID A;  1QPM A;  4JK1 X;  2H94 A;  4CYC A;  3DBR B;  3TDU C;  1JUP A;  2R7W A;  5H20 A;  2FBK A;  4O6J A;  3KFW X;  3H9G A;  3NQO A;  1HXD A;  4CCK A;  3RKY A;  3HTS B;  2IXS A;  4HF0 A;  4XRS A;  4AIK A;  2L7F P;  1XSX A;  3QU3 A;  3I0T A;  4A3J J;  1EH6 A;  3O3K A;  5EG0 B;  4S04 A;  5KNL A;  4JOM A;  4NC6 A;  2ZXI A;  3H0D A;  2M2E A;  2DYS H;  3QYB A;  2DJN A;  2QWW A;  3ABU A;  1FMW A;  3OS2 A;  5HVQ C;  2WB1 N;  3FIS A;  2E7X A;  1YG2 A;  1JT6 A;  3BZK A;  2FQ3 A;  1BI3 A;  5JVT A;  1WJE A;  2V9P A;  2MC3 A;  3RTR A;  1VI0 A;  2WAD A;  3I55 I;  1H9G A;  1X4O A;  4N4O B;  3PO2 J;  3BT9 A;  2MH2 A;  2IA1 A;  1G8X A;  1ZN2 A;  1R6R A;  1VND A;  2B7E A;  1ZK8 A;  3MD2 A;  4ANJ A;  1P4X A;  4D9J A;  2FJ1 A;  2M3A A;  3T8R A;  1ACI A;  3GZ5 A;  1G6N A;  3FX3 A;  3QP6 A;  4MQ9 F;  1APL C;  1U5T A;  2M4K A;  3FHZ A;  4WXD A;  5KK1 A;  3BLY A;  2F5V A;  5DYM A;  2OBP A;  3BPV A;  5DDG A;  1HSJ A;  1TWH J;  2VLA A;  1PUF A;  1SFO J;  4G6D A;  3PNY A;  3M3Y J;  2COM A;  3RSN A;  2XAS A;  5IP6 A;  3FKI J;  3QP5 A;  2IAI A;  3ZN0 A;  3WTS C;  1QBJ A;  4M3B A;  4P55 A;  4XOR A;  1OCT C;  1XGO A;  1TTY A;  4F92 B;  4N0B A;  1SVO A;  2E1M B;  3HJE A;  5KAF C;  1XSD A;  3E6B A;  4BDZ A;  2O6G E;  3HHG A;  4ZDO A;  3ZQI A;  4J00 A;  3A0B C;  1R00 A;  2RNG A;  5IOZ A;  2E1N A;  3HOX J;  2LLK A;  3LAJ A;  1BI0 A;  5FKM A;  2MD0 A;  2X4H A;  4QPO A;  4HNU A;  3GTK J;  3J81 K;  2JA6 J;  3FKJ A;  3MCZ A;  4DJA A;  5DD8 A;  1KU9 A;  5HLI A;  3O8H A;  5L3G A;  3HRT A;  2DPD A;  3Q5F A;  4G6T B;  1W0T A;  2EIL H;  2FNP A;  3LMM A;  3JRH A;  2R5Y A;  2AS5 F;  4KNY A;  4IPA A;  1F9N A;  2ZC2 A;  2BXY A;  4A3F J;  4JBA A;  1QHH D;  1OKR A;  1J59 A;  3F72 A;  3GFI A;  2VKV A;  2G7U A;  1MBJ A;  5D6F A;  1IXS B;  1GT0 C;  2GOX B;  2YUS A;  2MSY A;  1D1A A;  4B1R A;  2ESH A;  5GTI C;  4LB5 A;  2OPT A;  1TZL A;  3KE2 A;  1S3J A;  4AD9 A;  3CCM I;  1UG2 A;  1I6X A;  4S05 A;  1WJ5 A;  4HSR A;  3E5U A;  4WWC A;  2JZY A;  4XIC A;  3S15 J;  1UG0 A;  3MN2 A;  3I53 A;  1FYL A;  2KIM A;  1ZQ3 P;  2VPL A;  1JI8 A;  2M5W A;  3JRI A;  2XVC A;  4XSX F;  1SFU A;  4MEX F;  3IV5 A;  3HOZ J;  3SXY A;  4LLG F;  4XBF A;  3JSO A;  2K5C A;  3PQJ A;  1YHQ I;  3DKX A;  1JKP C;  1I3A A;  3NAU A;  2JVH A;  3KX2 A;  3T8T A;  2VQG A;  1IN5 A;  1S7O A;  3DEU A;  3OIP A;  1XGM A;  1T38 A;  1F4K A;  4OIN F;  5JHU A;  2HDD A;  1IN6 A;  1YOV B;  2N8G A;  3E1S A;  3GTG J;  1HC8 A;  2DFH A;  2QGU A;  4LMY A;  1QGP A;  4LK0 F;  1PJR A;  3O8G A;  4EM0 B;  3CJR B;  3DPU A;  1YIT I;  4OIP F;  4ZH4 F;  3HSR A;  3K70 D;  4G7H F;  2XAF A;  3BQY A;  1K6Y A;  3C18 A;  3VDX A;  1NG7 A;  2WTE A;  1F43 A;  2WAE A;  1V5G A;  2HPI A;  3S8P A;  3H5N A;  3MKW B;  3D5S C;  2Z9O A;  5IPA A;  4EV0 A;  1W7P D;  3U21 A;  5IP7 J;  2V1X A;  2DOE A;  5M5X J;  3FMR A;  4KT5 C;  3QAH A;  2A07 F;  5HS8 A;  4XN0 A;  1MBK A;  5CJ9 A;  5K7Z A;  2M7A A;  2L2O A;  3OSG A;  3G4S I;  4E70 A;  1CF7 B;  2JRT A;  4EEF G;  1LVA A;  4S0H B;  1B9M A;  1L0O C;  1S29 A;  5GPA A;  5GAH J;  1JUM A;  3C7J A;  3I5U A;  3G3Z A;  4UUT A;  5J3L A;  5LBQ A;  2CQK A;  4P9U A;  2QKL B;  2F5F A;  4NDL A;  3ZQL A;  2Y9Z A;  4NHJ A;  3C1D A;  3TO7 A;  2A3S A;  1GV2 A;  4IXA A;  3BWG A;  3OYK A;  3IHU A;  2E1M C;  2M1B A;  1EA3 A;  1OLT A;  1MJB A;  4OOI A;  1W5C C;  3TL4 X;  3IP4 B;  3DPT A;  1P7I A;  1T98 A;  3CCY A;  3SDB A;  1PVE A;  2OV7 A;  3I64 A;  1QA6 A;  2VON A;  5GAG J;  2W25 A;  2GM4 A;  2QSH X;  2AQF A;  1WWX A;  2M7B A;  4FTH A;  5DCF A;  4RM2 A;  3AKZ A;  4BE2 A;  3FXO A;  2CRG A;  4DYR A;  1U9N A;  5FRO A;  1TP4 A;  4CSW A;  2IVM A;  4XM3 A;  4HBL A;  5AIQ A;  4XID A;  5ICF A;  4ON0 A;  2HZT A;  3OL3 A;  1ZRC A;  1LFB A;  2FXA A;  2LG4 A;  4XMY A;  5EEG A;  2L7Z A;  2W85 A;  5EEH A;  4ENK A;  1DP7 P;  1NHA A;  4ESJ A;  3HOS A;  3GCM A;  4M9X A;  3TO6 A;  3P9I A;  4UVB A;  2L0K A;  5FO5 A;  1MMN A;  1OQY A;  2E7W A;  2W1O A;  3DU5 A;  4UUS A;  3CF5 F;  3V8K A;  1J75 A;  1B6A A;  4KIG A;  4LFU A;  3LQR A;  4Q5S F;  3RI4 A;  1E17 A;  1MMD A;  1Q1V A;  1JE8 A;  1KU2 A;  3GUD A;  4XKV A;  2QUF A;  2CQQ A;  3AG1 H;  2EZL A;  2XDV A;  2WAF A;  1JTX A;  2JMW A;  2EIM H;  4PJM A;  1AHD P;  5FD5 A;  2ICW G;  2WY8 Q;  3PQK A;  4Q4Z F;  4BXF A;  1B8I A;  4IO9 F;  2P7C B;  5J4V A;  2MLG A;  5CQE A;  5ICC A;  1R1U A;  2LKS A;  1MBG A;  4FIS A;  4FT8 A;  2A68 F;  2CJJ A;  1J7K A;  2DK5 A;  2QZ8 A;  2UV1 A;  5DCM B;  2XKO A;  3KZY A;  2WAQ A;  3GTM J;  3L00 A;  1P6R A;  4BS9 A;  4UNO A;  4IRI A;  2VIX A;  1MJ9 A;  1WI9 A;  2JSP A;  3FMS A;  1F36 A;  2PMH A;  4DBR A;  1H88 C;  2BY3 A;  4HPQ A;  1STZ A;  1HCR A;  2CGP A;  2XC7 A;  3BP8 A;  1V5E A;  5EZG A;  2VUM J;  1G2H A;  4B43 A;  2B9S A;  1WJB A;  4IZZ A;  5A2Q K;  1IZ1 A;  2M0M A;  2O3F A;  1W36 C;  2R92 J;  3E6D A;  1LE8 B;  1JXS A;  1Z77 A;  3BR5 A;  2IS4 A;  2CG4 A;  3ZMD A;  4CIC A;  1VQ6 I;  2GWR A;  2QSG X;  5FJ8 J;  3AFH A;  2O7O A;  1FBS A;  1LEA A;  1SMY F;  3CTA A;  1B72 B;  4IRG A;  3RIR A;  1K61 A;  1QVT A;  3MEX A;  2EFN A;  1MMS A;  4BDY A;  3S16 J;  1BJZ A;  2XAH A;  1Q1H A;  2F5C A;  2Y75 A;  3QRF F;  3TQN A;  4A3C J;  5D5W B;  2WV0 A;  3IRQ A;  3S1M J;  4BEH A;  1IXC A;  3HEF A;  2ZXH A;  2UZK A;  3VYS B;  4FE7 A;  4BXX J;  2GOM A;  2RDP A;  2XHK A;  3FXJ A;  3G73 A;  4OMY A;  3K4K A;  1J0R A;  2NYX A;  3F21 A;  2GLO A;  3FM5 A;  3ULQ B;  3BTI A;  4M3F A;  4BHC A;  3MKL A;  3CC2 I;  3OYF A;  1W5S A;  4M9S A;  2ZKZ A;  4GGG A;  4V2F A;  4ZYG A;  2TRT A;  3ABL H;  1Y56 A;  3LOC A;  3QWL A;  4Z2Y A;  4OMZ A;  2KIU A;  4ETS A;  2ZBK A;  4AU7 A;  4A6E A;  2FU4 A;  3DXJ F;  3S1R J;  4PSX A;  3WTZ A;  4LG0 A;  1DGR M;  5LFA A;  3CLQ A;  2NOG A;  3J80 Z; 
#chains in the Genus database with same CATH homology
 2EK5 A;  1YW7 A;  3L7W A;  3GLX A;  3WU1 B;  2ACJ A;  2RC4 A;  1TNT A;  2GA1 A;  3TKY A;  1D8J A;  5CVI A;  1C0W A;  5BPI A;  5E20 A;  4UV9 A;  5LGN A;  4IVN A;  5E17 F;  1YS6 A;  1A04 A;  1GVJ A;  3RPQ A;  5FFX A;  2GIV A;  1BI1 A;  2KRF A;  3K1N A;  5LHI A;  1TW2 A;  2M8E A;  3ECH A;  2L3D A;  3BY6 A;  3H3U A;  3M8F A;  1H9T A;  1SAX A;  4U88 A;  1SD7 A;  5D5V B;  5ED4 A;  4R8H A;  4Y17 A;  3V7S A;  3KP3 A;  3MFK A;  1ODD A;  2ZXJ A;  3L9F A;  2FMY A;  5D4S A;  3RKX A;  3M9A A;  3JAM Z;  3GXO A;  5LHG A;  4ZYE A;  4HLY A;  1Z9C A;  4YIF A;  5LHH A;  1Z6R A;  2HEO A;  3JW4 A;  2W84 A;  1TQM A;  2PEX A;  5HOO A;  2PI0 A;  3R61 A;  3JTG A;  4LLL A;  3TO9 A;  2P5K A;  1LDK B;  2Y48 A;  1IN8 A;  1F5T A;  5LEK A;  3I59 B;  1R23 A;  1SMT A;  2FSW A;  3P7N A;  1I5Z A;  4HZF A;  4A6D A;  4FHT A;  5J8C A;  2HR3 A;  1IRF A;  4RS8 A;  4LJZ F;  3I71 A;  2P8T A;  3F8B A;  4I09 A;  5CLS A;  2EFQ A;  2QEN A;  1U2W A;  1KU7 A;  3RKW A;  2HOE A;  3BOQ A;  1FBU A;  4M71 A;  2P4W A;  1ZG1 A;  2QYO A;  3MZH A;  4HX4 A;  2DW4 A;  3TGN A;  5E1W A;  2M87 A;  2HTJ A;  2K27 A;  2VOO A;  4I7H A;  4GXO A;  5AIP A;  2XV4 S;  3KET A;  3HRS A;  4U0Y A;  1GXQ A;  3ZMU A;  1O7L A;  4G8X A;  3GFL A;  1J9I A;  2J5P A;  3H92 A;  1YYV A;  1I27 A;  3WU0 A;  1IXR C;  2VBW A;  3H3Z A;  3QU6 A;  4MHG A;  3V7R A;  2HGC A;  4LLN A;  2OAZ A;  3F8C A;  3CLO A;  5FLX K;  2C6Y A;  4WCG A;  1QZY A;  3HRU A;  3O2P E;  3K2Z A;  4Q47 A;  4CHU A;  3RJP A;  4RB1 A;  1HKS A;  2B0L A;  2IA2 A;  3N4M A;  2IT0 A;  1FLI A;  2ZNY A;  1ZYR F;  1YFH A;  5H6Q A;  3LWF A;  3WE3 A;  4BNC A;  3ML6 A;  1U78 A;  4O3M A;  2PQ8 A;  4I98 B;  4LG0 B;  4MNU A;  4P96 A;  1BM9 A;  1R1T A;  1PDN C;  1ZAO A;  5L3D A;  4XLN F;  2L02 A;  5LGT A;  5FD6 A;  1TNS A;  1SFX A;  2H09 A;  4EJW A;  4IHS A;  1O3T A;  2QLZ A;  3ISP A;  1XDS A;  4O5V A;  3KP6 A;  3I58 A;  2Z3Y A;  5HDK A;  1BBY A;  2DAO A;  3GZ6 A;  4G6Q A;  2YU3 A;  3CJN A;  2MD5 A;  4ESB A;  1HW2 A;  3EYI A;  4TV7 A;  2AXL A;  2ZME B;  2ZO4 A;  3EUH A;  2XUB A;  2IA0 A;  5CVV A;  4KFC A;  2FEZ A;  3HSE A;  4XRF A;  5ERI A;  1QQI A;  1IUY A;  3LAP A;  3R0J A;  3NRV A;  2O0Y A;  5DCM A;  4WF2 A;  3QOP A;  2V1U A;  2UXN A;  2Y0M A;  4BHB A;  1KA8 A;  2VC1 A;  1T0F A;  4R1H A;  4AWX B;  2ISY A;  2M45 A;  1B59 A;  3HSF A;  1S6L A;  2Z5U A;  2XRO A;  1MDM B;  3WGG A;  3DPL C;  4IRH A;  1YLF A;  3K9T A;  2EJR A;  2FBI A;  1XCV A;  3HYI A;  1GXP A;  1FP1 D;  5JI6 A;  2YR2 A;  3ZP5 A;  4EGY A;  1P4A A;  4U0V A;  4L9V A;  5BMZ A;  4U7B A;  5LGU A;  1EV7 A;  4F7Z A;  3U1D A;  3HIF A;  3MZY A;  2XRN A;  3F8M A;  5LRR A;  2BV6 A;  4ZZD A;  4L18 B;  2G7H A;  4KN7 X;  3B73 A;  1Z05 A;  2QQA A;  1FWZ A;  4UV8 A;  1KQ9 A;  4L0Y B;  2LF7 A;  4XSZ F;  4JQF A;  3C3W A;  2MH9 A;  4ZZL A;  3ZMZ A;  4HF1 A;  2ESN A;  5FFZ A;  3I54 A;  4R79 A;  2QBY B;  2EA2 A;  2H6C A;  3IRR A;  3BJO A;  4HOB A;  4YII A;  1FZP B;  4K2E A;  5LEJ A;  5IT9 K;  2EV6 A;  4HDU A;  1WSU A;  2R3S A;  3D0S A;  2RVC A;  3REO A;  3R6S A;  1P4W A;  1OYY A;  4RAY A;  2DO7 A;  3WTX C;  4RB0 A;  1K6O A;  1KGS A;  1EH8 A;  4NB5 A;  3O6B B;  4Q48 A;  3GX4 X;  2DU9 A;  1XMA A;  1FSH A;  1X3U A;  1S8N A;  5ICG A;  4KIB A;  2F5E A;  4BXU A;  2QQB A;  4EGZ A;  2K02 A;  5F6F A;  1G3T A;  3I59 A;  1OPC A;  4M73 A;  1HKQ A;  3BZ6 A;  2OQG A;  3F8N A;  4L0Z B;  4PGH A;  3SQN A;  2G9W A;  1VTN C;  5HLG A;  1GHC A;  2P6T A;  4CZZ A;  3E6M A;  2L01 A;  3B02 A;  5LRS A;  3EET A;  4B09 A;  2XGX A;  4CYD A;  4PZJ A;  4HV5 A;  3T0Y A;  4HQM A;  2MLK A;  1PUE E;  2IP2 A;  2VBX A;  2UXX A;  4OIO F;  3QPT A;  4A12 A;  2VT3 A;  1I1S A;  5BS6 A;  1Z6T A;  1FY7 A;  3U9G A;  4UXN A;  4RAZ A;  4M9Z A;  5JR3 A;  4ZYD A;  2Q0O A;  3R4K A;  3GWZ A;  1SD5 A;  5A2Q Z;  1JGS A;  3GVA A;  2FOK A;  3I4P A;  1TW3 A;  5E1Z B;  3LA2 A;  2Q8K A;  2GAU A;  4G7Z F;  1FOK A;  3ZPL A;  3CDH A;  3EYY A;  1RNL A;  3KLO A;  1IAW A;  4UVA A;  1TQI A;  1R5G A;  3SZP A;  1FC3 A;  1B9N A;  2FE3 A;  3ECO A;  1K78 B;  4A5N A;  4L9T A;  1B1B A;  5L3C A;  2V79 A;  5ICE A;  1R5H A;  3BJA A;  5BQT A;  4XLP F;  2CFX A;  3EQL F;  2GZW A;  4KYW A;  3GEZ A;  3ZMV A;  3HRM A;  1WRJ A;  3E97 A;  3KP7 A;  1LQ1 A;  4KA4 A;  2RV8 A;  1TBX A;  1UST A;  2STT A;  3BPX A;  1W5T A;  3TOB A;  2VOD A;  3IL2 A;  2K86 A;  3NEU A;  3WTV C;  4L9J A;  3F8F A;  2A6E F;  2EFW A;  1HW1 A;  1OMI A;  4UUV A;  2RGV A;  1W7P B;  2BE5 F;  1EH7 A;  1WKM A;  4QLC U;  1LDJ A;  1FSE A;  4HX7 A;  2FML A;  3SHF A;  4OIQ F;  2QQ9 A;  2RNJ A;  4IHT A;  3W6J B;  1OR7 A;  5F1R A;  3CO7 C;  5HDN A;  4HF2 A;  2XKP A;  3FF5 A;  5ILU A;  1ZAR A;  4HQE A;  5E1X A;  2ZME A;  2ZCW A;  2O8X A;  1KYZ A;  2OZ6 A;  3LFK A;  1SD6 A;  4RGS A;  5K1Y A;  2H27 A;  3CUQ B;  2MBF A;  1B4A A;  1PP8 F;  4HAM A;  1V3F A;  3K1M A;  2FRH A;  1FT9 A;  1AWC A;  2K7L A;  2ADU A;  4HV6 A;  2STW A;  1LJ9 A;  3ZN1 A;  1ZG3 A;  1ZGJ A;  2FBH A;  1ONV A;  4ENM A;  1U8R A;  2UWM A;  2O03 A;  1O3Q A;  3KP4 A;  3RYR A;  1E2X A;  2M30 A;  4A0X A;  5E18 F;  1MDM A;  3J7A O;  4L9N A;  4I01 A;  3JAM K;  4M72 A;  1ZRE A;  3WGI A;  3S2W A;  1IN7 A;  2OD5 A;  2HKO A;  2K4B A;  1ZRF A;  1J2X A;  4A2U A;  4EJU A;  4HYE A;  4KDP A;  2CO5 A;  5L3E A;  3RDI A;  3VEP A;  4YFX F;  1V4R A;  3K1P A;  3M8E A;  2K4J A;  2RN7 A;  5DEQ A;  3WGH A;  4GO1 A;  3LQQ A;  3ERE D;  2IW5 A;  4AIJ A;  2HWV A;  4I0B A;  1U3E M;  5LLQ A;  3HHH A;  3N97 A;  1D8K A;  2HFH A;  3VOD A;  3M1E A;  2P7V B;  2JPC A;  4M6Y A;  2ETH A;  2A5Y B;  1RIO H;  2XAJ A;  5K5R A;  2VOP A;  5ILV A;  4NQW A;  1SFE A;  5L3B A;  3L2C A;  1XGN A;  3LA3 A;  3RPU A;  4EJV A;  5AON A;  3WTT C;  5DUK A;  2BYV E;  1OYI A;  2D2W A;  3KP2 A;  3VB2 A;  1G3S A;  2EV5 A;  3CUQ C;  3F22 A;  2QBY A;  4N9H A;  1FPQ A;  4ZYH A;  4CGZ A;  2EFO A;  1UHM A;  2R7D A;  2DQR A;  3EDP A;  4KIF A;  1P92 A;  2LKP A;  1U6G A;  4I0A A;  1Z91 A;  4U7D A;  1DPU A;  4MGR A;  1ON1 A;  4RGU A;  3E6C C;  2KJB A;  2PMU A;  2H6B A;  3GYH X;  3IC7 A;  2X0L A;  1Z1D A;  1ZHF A;  2ELH A;  3Q9V A;  5E8G A;  2VN2 A;  4I2O A;  1P2F A;  5HDG A;  5E8I A;  1XD7 A;  4KN4 X;  3SZT A;  1YW8 A;  4HLX A;  1KQ0 A;  4LGW A;  4UVC A;  5KVR A;  2BGC A;  4G9Y A;  3LST A;  1IRG A;  2ISZ A;  2EV0 A;  4OU0 A;  1OYW A;  2E1C A;  2HQR A;  4BAY A;  3AAF A;  4KUM A;  1REP C;  1D5V A;  3F3X A;  3MAJ A;  4G7O F;  5D6E A;  4GYI A;  3V8J A;  2WC2 A;  5FB2 A;  4L5J A;  5DV5 A;  1BIA A;  1UB9 A;  2HDC A;  1TLH B;  4Y15 A;  1R22 A;  1MD0 A;  4U0W A;  4CXF A;  4IJA A;  1KYW A;  2CSO A;  2P5V A;  4CO8 A;  1DUX C;  1LEB A;  4MTE A;  4B8X A;  2Z99 A;  3MWM A;  3TOA A;  1PP7 U;  2HQN A;  1USS A;  3RYP A;  1XB4 A;  2QM3 A;  1JHF A;  2YX7 A;  4A0Z A;  3IWF A;  1FX7 A;  3FXR A;  2HYF A;  2Z33 A;  2GA2 A;  4MTD A;  1I1G A;  3JSP A;  2A69 F;  1BIB A;  1UHW A;  3OV8 A;  2EA4 A;  3J81 Z;  2IJL A;  5ILS A;  1K78 A;  4OIR F;  3K69 A;  2P5L C;  1RUO A;  4EMS A;  1MKM A;  1ZRD A;  2NRA C;  3D5L A;  2FNA A;  4AVP A;  3M7G A;  1XN7 A;  3WG9 A;  1FBQ A;  2KKO A;  4RGR A;  4GCV A;  3IKT A;  4AIH A;  4YG2 F;  2WWY A;  3CO6 C;  2LF8 A;  1Z7U A;  3BDD A;  3W6K B;  1YIO A;  6PAX A;  5D8L B;  2Q2E A;  2LNB A;  2PLY A;  3IKV A;  3T1B A;  3LA7 A;  2YPR A;  5TRD A;  1W7P A;  1MZB A;  5JFR A;  2A61 A;  1ON2 A;  1YO5 C;  1G4D A;  1RUN A;  2QVO A;  5J6X A;  1RZ4 A;  5K5O A;  1HQC A;  3ROU A;  2DK8 A;  3F6V A;  5IT9 Z;  4DQ2 A;  3WE2 A;  1ZH5 A;  4D0P A;  1K7A A;  2L4A A;  1QO0 D;  1G3W A;  1LDD A;  4ENJ A;  5FGM A;  2DLL A;  2L54 A;  1R58 A;  3CUQ A;  2ZNZ A;  2VC0 A;  1TQP A;  2OQR A;  1HBX G;  2TDX A;  4ESF A;  2DBB A;  2GQQ A;  2L4M A;  3F6O A;  2BEO A;  1BOA A;  4A5M A;  3ELK A;  4KIC A;  3KP5 A;  1ULY A;  3BJ6 A;  4HDV A;  2YSR A;  1K79 A;  4MQV A;  3KLN A;  2CYY A;  1XCB A;  3K0L A;  2F5D A;  4G94 A;  1FYK A;  1XGS A;  1D3Y A;  5CVU A;  1O3S A;  3FWE A;  3T5X A;  5L3F A;  2VXZ A;  4BHP A;  5CYV A;  4PGG A;  2CWE A;  3GFJ A;  3F23 A;  1KQ8 A;  4RB2 C;  4WXH A;  5H6R A;  3KZZ A;  4FX0 A;  1IF1 A;  2OA4 A;  3WTY C;  2J5O A;  3ZQ7 A;  1HW5 A;  2EWN A;  4KMU X;  3WOD F;  1MJA A;  2D1V A;  3DP7 A;  3QPH A;  4DNC A;  1YW9 A;  1XSV A;  4L5I A;  4ASN A;  1U5T B;  3WTW C;  2V9V A;  4QWQ A;  3HTU A;  2KJC A;  2XAQ A;  5D4R A;  3R60 A;  1CGP A;  4EJO A;  3L09 A;  2NS0 A;  1BN5 A;  5D8K B;  3E5Q A;  2PG4 A;  5F64 A;  1UCR A;  1LB2 A;  1YQA A;  3DFG A;  2GXG A;  2HKX A;  2YX4 A;  4WXC A;  1L3L A;  2CW0 F;  4EJT A;  4RGX A;  3GW2 A;  3OOP A;  4EM2 A;  2IRF G;  2PN6 A;  2HYG D;  2V1D A;  5BPD A;  5HS9 A;  3DQV C;  1R1V A;  1BJA A;  5K5Q A;  1MGT A;  3U2R A;  5D5U B;  4PDK A;  1J5Y A;  3J80 K;  4CDG A;  5CVR A;  4A0Y A;  4FX4 A;  1SD4 A;  2VT2 A;  4WK8 F;  3ZMS A;  4BH9 A;  3ABT A;  2HTS A;  1XMK A;  2NNN A;  4LB6 B;  2LDU A;  3Q9S A;  3DF8 A;  2XIG A;  4UHT A;  3CUO A;  1RI7 A;  2VBZ A;  4YFK F;  3SFZ A;  4MEY F;  1W4M A;  1YTY A;  3FZV A;  4N9I A;  1HST A;  1ZLK A;  1UFM A;  3KCC A;  1U5T C;  5J8F A;  5HS7 A;  3FXQ A;  4BQA A;  2PBI A;  1Y0U A;  4I02 A;  2IPQ X;  1IN4 A;  2NNY A;  4BYY A;  1QNT A;  4EVI A;  2PJP A;  2JSC A;  3V7C A;  4P5O A;  4HW0 A;  3FM3 A;  2JPB A;  2JT1 A;  2LSO A;  1F1Z A;  3HUG A;  2W24 A;  5TJJ A;  1R7J A;  3VOE A;  2V6C A;  4KMF A;  3V8L A;  3HOT A;  2XAG A;  2FA5 A;  1T2K A;  5HLH A;  2VBY A;  3GF2 A;  3WTU C;  2MA3 A;  4PCQ A;  4M6X A;  4ENN A;  1IW7 F;  3ZMT A;  1WQ2 A;  1T6S A;  4EM1 A;  3MQ0 A;  5D5X B;  1YS7 A;  3DV8 A;  1DPR A;  3R0A A;  1FNN A;  1QZZ A;  1S7A A;  4HX8 A;  1ZGA A;  1BC7 C;  2D45 A;  1O7F A;  2F2E A;  3GO5 A;  1AOY A;  2DI3 A;  3FMQ A;  2RQP A;  2DT5 A;  3BRO A;  2O61 A;  2NAZ A;  4P9F A;  3IWZ A;  4M74 A;  2FF4 A;  3TDZ C;  4YFN F;  1KU3 A;  4IF4 A;  5IT3 A;  2EFP A;  5FLX Z;  4EQQ A;  2W57 A;  4WX9 A;  1FYM A;  2BBY A;  1O3R A;  1BI2 A;  2R7F A;  1H0M A;  5DD4 A;  1O57 A;  3FXU A;  3COA C;  4GYG A;  1T39 A;  5CVJ A;  3E5X A;  3GFM A;  2KIF A;  2OU2 A;  2DFI A;  1ZG5 A;  1ZLJ A;  1JHH A;  2DQL A;  3KEQ A;  4LD5 A;  2D1H A;  3E3V A;  1HKT A;  1FP2 A;  1DDN A;  1R36 A;  2RKH A;  2ZJ2 A;  4H0E A;  1CF7 A;  4LK1 F;  2HS5 A;  5DUI A;  3DKW A;  4RB3 C;  3JTH A;  1BC8 C;  4Y13 A;  3V4G A;  1XDU A;  2EB7 A;  3KEO A;  3P9K A;  2VE8 A;  2DTR A;  2ZFW A;  1G3Y A;  3PFI A;  2OZU A;  5BOX A;  2VE9 A;  2P6S A;  2GXB A;  1LNW A;  3VFZ A;  2A6H F;  2JTV A;  2DPU A;  3P9C A;  4HA8 A;  2PFB A;  1QPM A;  4JK1 X;  2H94 A;  3TDU C;  5H20 A;  2FBK A;  4O6J A;  3KFW X;  3NQO A;  1HXD A;  3RKY A;  3HTS B;  4HF0 A;  4AIK A;  1XSX A;  3QU3 A;  3I0T A;  1EH6 A;  3O3K A;  4S04 A;  2QWW A;  3ABU A;  5HVQ C;  2E7X A;  1YG2 A;  2FQ3 A;  1BI3 A;  5JVT A;  2MC3 A;  3RTR A;  1H9G A;  2MH2 A;  2IA1 A;  1ZN2 A;  1P4X A;  3T8R A;  3GZ5 A;  1G6N A;  3FX3 A;  3QP6 A;  4MQ9 F;  1U5T A;  3FHZ A;  4WXD A;  5KK1 A;  5DYM A;  2OBP A;  3BPV A;  5DDG A;  1HSJ A;  4G6D A;  2COM A;  2XAS A;  3QP5 A;  3ZN0 A;  3WTS C;  1QBJ A;  4P55 A;  1XGO A;  1TTY A;  4N0B A;  1XSD A;  3E6B A;  2O6G E;  3HHG A;  1R00 A;  2E1N A;  3LAJ A;  1BI0 A;  2X4H A;  3J81 K;  3MCZ A;  5DD8 A;  1KU9 A;  5HLI A;  5L3G A;  3HRT A;  2DPD A;  3Q5F A;  2FNP A;  2AS5 F;  4KNY A;  4IPA A;  1F9N A;  4JBA A;  1OKR A;  1J59 A;  3F72 A;  3GFI A;  2G7U A;  5D6F A;  1IXS B;  2ESH A;  4LB5 A;  3KE2 A;  1S3J A;  4AD9 A;  1I6X A;  4S05 A;  3E5U A;  4WWC A;  2JZY A;  3I53 A;  1FYL A;  2KIM A;  2M5W A;  2XVC A;  4XSX F;  1SFU A;  4MEX F;  3SXY A;  4LLG F;  4XBF A;  3JSO A;  3PQJ A;  3T8T A;  1IN5 A;  1S7O A;  3DEU A;  1XGM A;  1T38 A;  1F4K A;  4OIN F;  5JHU A;  1IN6 A;  4LMY A;  1QGP A;  4LK0 F;  4EM0 B;  4OIP F;  4ZH4 F;  3HSR A;  4G7H F;  2XAF A;  3C18 A;  2WTE A;  2Z9O A;  4EV0 A;  1W7P D;  2V1X A;  3FMR A;  4KT5 C;  3QAH A;  2A07 F;  5HS8 A;  5CJ9 A;  4E70 A;  1CF7 B;  2JRT A;  1LVA A;  1B9M A;  1L0O C;  1S29 A;  3C7J A;  3I5U A;  3G3Z A;  5LBQ A;  2CQK A;  4P9U A;  2F5F A;  4NHJ A;  3C1D A;  3TO7 A;  2A3S A;  4IXA A;  3BWG A;  3IHU A;  2M1B A;  1MJB A;  4OOI A;  3DPT A;  1T98 A;  3I64 A;  2VON A;  2W25 A;  1WWX A;  5DCF A;  2IVM A;  5AIQ A;  4HBL A;  5ICF A;  4ON0 A;  2HZT A;  1ZRC A;  2FXA A;  5EEG A;  4ENK A;  2W85 A;  5EEH A;  1DP7 P;  1NHA A;  4ESJ A;  3HOS A;  4M9X A;  3TO6 A;  3P9I A;  4UVB A;  5FO5 A;  2E7W A;  3V8K A;  1J75 A;  1B6A A;  4KIG A;  4LFU A;  3LQR A;  4Q5S F;  3RI4 A;  1E17 A;  1JE8 A;  1KU2 A;  3GUD A;  2QUF A;  5FD5 A;  4Q4Z F;  3PQK A;  2P7C B;  2MLG A;  5ICC A;  1R1U A;  4FT8 A;  2A68 F;  1J7K A;  2DK5 A;  2QZ8 A;  5DCM B;  2XKO A;  3KZY A;  3L00 A;  1P6R A;  4UNO A;  4IRI A;  1MJ9 A;  1WI9 A;  3FMS A;  2PMH A;  1STZ A;  2CGP A;  3BP8 A;  5A2Q K;  1IZ1 A;  2O3F A;  3E6D A;  1JXS A;  2CG4 A;  3ZMD A;  4CIC A;  2GWR A;  1FBS A;  1LEA A;  1SMY F;  3CTA A;  4IRG A;  3RIR A;  3MEX A;  2EFN A;  2XAH A;  1Q1H A;  2F5C A;  2Y75 A;  3QRF F;  3TQN A;  5D5W B;  2WV0 A;  3IRQ A;  1IXC A;  2UZK A;  2RDP A;  2XHK A;  3G73 A;  4OMY A;  1J0R A;  2NYX A;  3F21 A;  3FM5 A;  3ULQ B;  4BHC A;  1W5S A;  4M9S A;  2ZKZ A;  4GGG A;  4ZYG A;  4Z2Y A;  4OMZ A;  2KIU A;  4ETS A;  2ZBK A;  4A6E A;  2FU4 A;  3DXJ F;  3WTZ A;  4LG0 A;  3J80 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...