1PUEE

Pu.1 ets domain-dna complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
88
structure length
88
Chain Sequence
KIRLYQFLLDLLRSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKGNRKKMTYEKMARALRNYGKTGEVKKVKKKLTYQFSGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A new pattern for helix-turn-helix recognition revealed by the PU.1 ETS-domain-DNA complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*AP*AP*AP*AP*AP*GP*GP*GP*GP*AP*AP*GP*TP*GP*GP*G)-3
total genus 22
structure length 88
sequence length 88
chains with identical sequence F
ec nomenclature
pdb deposition date 1996-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1pueE00
4AD9A 3L9FA 3SZTA 3F8CA 2L4MA 4L9NA 3BZ6A 3C3WA 4B8XA 5EEGA 2QQ9A 4OIPF 1R00A 5D5XB 4U88A 4MQVA 3TKYA 2DO7A 3JW4A 1A04A 3L7WA 2RV8A 2EA4A 2EWNA 3I71A 2L01A 3LAJA 4DNCA 3ROUA 5L3DA 4IXAA 4L5JA 2BYVE 4L18B 5DEQA 4RS8A 2F5FA 3DV8A 3PFIA 4NHJA 4A0XA 5ICEA 4RAYA 4LK0F 3NRVA 3EDPA 3I54A 1CF7A 2ZCWA 1SAXA 4G94A 3DPTA 1EH7A 3Q5FA 3G73A 2CFXA 3CUQB 2GWRA 5K5RA 3FM5A 1B9MA 2W25A 2XROA 4YFKF 3JTHA 3T0YA 2TDXA 3E5QA 1E17A 1USSA 1R23A 2MBFA 4HQMA 5HDKA 4GXOA 2MC3A 1SD5A 2XAGA 4XLPF 3HRMA 3WGIA 3KLNA 1XDUA 4EMSA 1IXSB 2KRFA 2P4WA 1BBYA 3HHGA 3O6BB 3IRRA 2K4JA 2E7XA 3HRUA 1WQ2A 5TRDA 2DI3A 1H0MA 2V1XA 4ETSA 1KQ0A 1YW9A 2ISZA 1KYZA 5FFZA 1ZN2A 4AIKA 5FLXZ 1QQIA 3FXRA 3GF2A 2GA1A 1YO5C 1GXPA 2GXBA 3T8TA 4WF2A 5A2QZ 3F22A 4PGGA 1C0WA 4KN7X 1KQ9A 4OIRF 2PLYA 3GFJA 3EUHA 2FRHA 3RTRA 2ZMEB 2FOKA 5ICGA 4HF1A 3V7SA 2PFBA 3QPHA 2RN7A 3CUOA 3MFKA 1D8KA 1I6XA 2QBYA 2LF8A 4EJWA 2X4HA 4Q5SF 1WI9A 4FT8A 2O03A 4LGWA 1IRFA 1ON2A 1FC3A 1FBUA 1T2KA 3GEZA 4KA4A 2FA5A 2Z9OA 3KCCA 3LFKA 4PZJA 5EEHA 3HRTA 1RIOH 2A6EF 2OQGA 1S7OA 3CTAA 4OINF 5DDGA 3EYYA 3FMRA 3O3KA 4BHBA 1Z1DA 3M8FA 3R6SA 5D8KB 2IA1A 4L9JA 2HOEA 4JK1X 3LQQA 4ENJA 3R60A 5DUIA 3ZMUA 2XGXA 4P5OA 4D0PA 4IPAA 3SHFA 2V9VA 4GYIA 3BOQA 4HV5A 3JAMZ 4HF0A 3NEUA 3E3VA 5BS6A 3DF8A 2V1DA 2ZKZA 1QO0D 3JSOA 2A5YB 1GVJA 3P9KA 3GLXA 1LVAA 3HSRA 1F4KA 4UNOA 4OOIA 2VBXA 3F8NA 4U0VA 1I5ZA 2QUFA 3BROA 5E20A 4EJOA 1DPUA 2DPUA 4A6EA 4U7DA 4IRHA 1P4XA 3KP4A 4YIIA 4HLXA 4CGZA 3KEOA 3C18A 1SFXA 2DFIA 5HS8A 2A61A 2YX7A 3L09A 4Z2YA 3E6DA 4G7ZF 3M8EA 5E1XA 3KFWX 5DYMA 2QBYB 2P5KA 1R36A 3K1PA 1W4MA 4M73A 3WTXC 1ZHFA 1T0FA 1B9NA 1LJ9A 2L3DA 3KP5A 3TOBA 4QWQA 4A2UA 3F21A 2ZNYA 4ENKA 2RGVA 3FHZA 2Y0MA 3CO7C 1HQCA 3R0AA 1D3YA 2K27A 4MEYF 4EQQA 4CDGA 1K79A 1W7PB 3WTVC 1BIBA 3COAC 1XGSA 4KIBA 4CZZA 1TLHB 1ZG1A 1Z91A 1RNLA 3MCZA 4LB5A 1YTYA 2RC4A 3IC7A 5LGUA 3F6VA 1J0RA 4L9TA 5JHUA 2W24A 4RB2C 1JHFA 1RZ4A 1YS7A 3CDHA 5L3GA 3P7NA 2RDPA 2IA0A 1J5YA 3QRFF 4M72A 4IF4A 2HS5A 2VC1A 2EV5A 3BJAA 3KEQA 2P8TA 2EV6A 3L00A 4UVCA 4G7HF 1OYYA 4M9ZA 1FBSA 2H94A 5HOOA 4MQ9F 2YPRA 1DP7P 4LG0B 4AIHA 1H9TA 3WTWC 3OV8A 4QLCU 3KETA 2KJBA 3KLOA 2PBIA 5ED4A 4RGRA 1S8NA 2EFQA 3T8RA 4BXUA 2FU4A 1WRJA 3U9GA 1NHAA 2M1BA 2FNAA 1LB2A 3GWZA 5D4SA 5DCMA 2R7DA 1L3LA 4Y13A 4EV0A 2ZNZA 1FNNA 1TNTA 1P92A 2GXGA 4KFCA 4CXFA 2HYFA 3ZMVA 4KMUX 3E6CC 4MNUA 2JZYA 2CW0F 5LHGA 4CICA 2ISYA 3RPQA 2W85A 4IJAA 2ADUA 3SFZA 5L3EA 3GFLA 2ETHA 4UVBA 1PP8F 1G3WA 2M30A 2P6TA 2Q0OA 4Q47A 3FM3A 2RQPA 3QP5A 1FLIA 2CG4A 5H6RA 3J7AO 1S7AA 3E97A 5AIQA 3V7CA 1Y0UA 5J8FA 3IKVA 1YQAA 1WWXA 1YLFA 2FQ3A 2GQQA 1ZG5A 5AIPA 4A5NA 4RGSA 4UXNA 2XHKA 2WTEA 4HOBA 3I64A 4EM0B 2YU3A 3NQOA 5JR3A 5F6FA 2D1HA 3I5UA 4KDPA 3VFZA 2FMLA 2Z3YA 4P9FA 3RJPA 3KP6A 4G6DA 3QP6A 2HFHA 2HTSA 3ML6A 4EM2A 3W6JB 3V8LA 1P6RA 2HR3A 4HV6A 4BQAA 3LWFA 3U2RA 1XGNA 1FYKA 1TW3A 5FLXK 5K1YA 4ZYHA 2LDUA 4B09A 3IWZA 2XASA 1FT9A 2YX4A 4I02A 1ZREA 2VBWA 2FF4A 3KP2A 1T38A 2OBPA 1DUXC 3T5XA 2DT5A 1ON1A 5ILUA 2HDCA 4WX9A 1O3QA 2F5EA 3KZYA 1S29A 2ZBKA 4ENMA 5FO5A 3DKWA 1R22A 2FNPA 3HSFA 3WG9A 2CO5A 2Z99A 3WU0A 2WWYA 1QBJA 2K4BA 4UV9A 3LAPA 1LEAA 2NYXA 3DQVC 1Z6TA 4HA8A 1SD6A 1O7FA 2IVMA 2HQRA 4KNYA 1ZRFA 1FP2A 2FXAA 1E2XA 3RYPA 1HSJA 2VBZA 4GCVA 5D6EA 2RNJA 4F7ZA 1PUEE 2OQRA 4WXCA 1LQ1A 3I59A 1LDKB 4ZYGA 5BOXA 4L0YB 3J81K 1IN8A 1OYIA 2EFWA 2M87A 1EV7A 3MAJA 1AWCA 2UXNA 5F1RA 2G7HA 3CUQA 2A68F 2X0LA 2ESHA 2FSWA 4LMYA 3R4KA 1KU3A 1FY7A 2O61A 2VXZA 2PG4A 1KA8A 4I2OA 1STZA 4BHPA 2HWVA 3BP8A 3QU3A 2DLLA 3RKXA 3GW2A 1D5VA 2MA3A 3CLOA 4DQ2A 2WV0A 3BJOA 2XIGA 2UWMA 5FGMA 1W5SA 3M1EA 4KICA 1FPQA 3ZMDA 1YFHA 3ZMTA 1U6GA 2E1CA 5CVIA 1LDJA 4JBAA 3GUDA 1XGMA 1KU7A 2LSOA 3K69A 1EH6A 3BJ6A 1O7LA 3H92A 5BMZA 5L3BA 4IRIA 5E8IA 1K78B 1IXCA 2ELHA 3B73A 5D5UB 1YW8A 1YYVA 3LA3A 4XRFA 1ZARA 4I09A 3RKYA 4Q48A 1IUYA 2IA2A 4G9YA 2XKOA 3K9TA 1L0OC 2AXLA 3CUQC 3DP7A 3IWFA 2CGPA 2Q2EA 1V4RA 1W7PD 4I7HA 3WGHA 1QZYA 4IVNA 3VEPA 2HGCA 1BI1A 4U0WA 4R79A 4I98B 1F9NA 2ZFWA 4WWCA 3E5UA 3GZ5A 4KIGA 3WE3A 3BPVA 1AOYA 4LB6B 4EGYA 4MTEA 4A0YA 3J80K 2BE5F 1F5TA 2D2WA 1KU2A 1HBXG 2C6YA 3I53A 1HKTA 1G3YA 3WTUC 3WTTC 3ECOA 4ASNA 2MD5A 1P4AA 1SD7A 4ENNA 4ON0A 1LEBA 3TQNA 2D45A 3V4GA 1PDNC 3LQRA 2DAOA 3FX3A 1MD0A 5L3CA 1OPCA 2STWA 5CLSA 6PAXA 1XB4A 3DXJF 2XAQA 2DTRA 5J8CA 1KU9A 5DD4A 2A07F 2EFOA 1ZLJA 3DPLC 5FD6A 5CYVA 4PCQA 3F23A 3HTUA 4LJZF 1ZGJA 1BC8C 1TNSA 1ZRCA 3E6MA 3KE2A 2XV4S 2HEOA 5DD8A 2VE8A 3HRSA 3TOAA 1O3TA 2QWWA 5HVQC 4O3MA 2EA2A 2VE9A 4BHCA 3ZPLA 2XRNA 4MGRA 2Z33A 2F5DA 2O6GE 4L5IA 2HKOA 1U3EM 4EM1A 3TO7A 3O2PE 5TJJA 3SQNA 2HKXA 2IT0A 3GZ6A 2UZKA 4EVIA 2KIFA 5FFXA 1DDNA 3K1MA 2NNNA 1XDSA 2JSCA 5HLHA 1FZPB 2HYGD 1QGPA 1EH8A 3ISPA 4BAYA 1RUOA 4CYDA 3ABTA 3P9CA 3MEXA 1TQMA 5F64A 1XD7A 4IHSA 5H6QA 5L3FA 4H0EA 1REPC 3MQ0A 2O8XA 1TQPA 2MH9A 4ESBA 5D5VB 3F3XA 5LEKA 1ZH5A 1FYLA 1FOKA 1UHWA 3ZN1A 3F72A 3E6BA 2XAJA 4RGXA 5LRSA 5HDNA 2E1NA 4CO8A 3Q9VA 5DUKA 4A6DA 4P96A 1F1ZA 5HS9A 1U5TA 1UHMA 3CJNA 2ESNA 2F5CA 3H3ZA 5K5QA 1IW7F 2PI0A 5IT9Z 3PQKA 2L02A 2JPCA 4I0AA 1TW2A 2H27A 4N0BA 3H3UA 1ZGAA 2JPBA 1RI7A 3ZMZA 5DCFA 4A5MA 3ZN0A 4I01A 1BN5A 2QYOA 4U0YA 3N97A 5CJ9A 1ONVA 1CGPA 1G3TA 1I27A 2RVCA 4GYGA 3DFGA 5H20A 4UUVA 1DPRA 1O3RA 3M7GA 4AWXB 3GFMA 4G8XA 1ZG3A 2DK8A 3RDIA 1U5TB 3TDZC 5LEJA 2W57A 4Y15A 2FBHA 2EK5A 3DEUA 3C1DA 2DW4A 3TGNA 1Z6RA 5DV5A 1FSEA 1WSUA 4ESFA 3S2WA 2K86A 4OMYA 1R1TA 1HKQA 4OIOF 4G6QA 4M74A 4U7BA 2E7WA 3IKTA 4KT5C 2XAFA 3FMQA 3QU6A 1YW7A 5K5OA 1QPMA 1VTNC 1LNWA 2MH2A 2GA2A 4S05A 1U2WA 3FMSA 3ZMSA 4FX0A 1SFUA 3EYIA 3R61A 4KMFA 1BM9A 2JTVA 2FBKA 2CSOA 1JGSA 2NRAC 2KIMA 1OMIA 3ULQB 1XSVA 2MLGA 2NNYA 2GAUA 4HYEA 3K0LA 3K2ZA 3F8BA 5IT3A 3FF5A 3GXOA 2VN2A 4M71A 2FMYA 1T6SA 1USTA 1MJ9A 2A69F 4K2EA 2A6HF 2XKPA 5D5WB 1FSHA 5ICFA 5ICCA 1HW2A 4G7OF 1J2XA 5E1ZB 2OZ6A 2QM3A 2YR2A 5CVVA 3LA2A 1W5TA 1HW5A 4ZZDA 3VOEA 2VONA 1IAWA 5KVRA 3N4MA 1T98A 4OIQF 2OA4A 2IP2A 4HW0A 3BDDA 3QPTA 2LKPA 1IRGA 2HZTA 4L0ZB 4N9IA 2G9WA 2EV0A 1T39A 4FHTA 4ZZLA 5ILSA 1J59A 1B1BA 5E8GA 4ZH4F 1K78A 2P5VA 1Z9CA 2WC2A 2BEOA 4UHTA 2V79A 4R8HA 4A0ZA 1FX7A 1QNTA 1TQIA 5HLGA 2DPDA 3GVAA 1IN7A 4MHGA 3HIFA 2QENA 4LLNA 2VC0A 2QVOA 4WXHA 4XSZF 1IN4A 3HOTA 1I1GA 1P2FA 1XSXA 2O3FA 1MJAA 3FXQA 1FYMA 3JAMK 5CVRA 3RIRA 2Y75A 1SMTA 3F6OA 1PP7U 1MDMB 3QAHA 3TO9A 2COMA 4NQWA 4FX4A 3GX4X 1UCRA 1XSDA 3FZVA 4R1HA 5E18F 1X3UA 4IHTA 2JRTA 3VODA 2VT3A 1CF7B 2A3SA 1S6LA 1MKMA 2DK5A 3JTGA 4GO1A 5AONA 1H9GA 3OOPA 5HS7A 1HKSA 2DU9A 3ECHA 2CYYA 1B4AA 5IT9K 2F2EA 3R0JA 1SD4A 3RKWA 3BWGA 4HX7A 5KK1A 4N9HA 1ZLKA 1V3FA 4JQFA 2MLKA 3GFIA 2Y48A 1U78A 3QOPA 1MZBA 3EETA 3ERED 3BPXA 2H6BA 1ULYA 4YFNF 3L2CA 1BI0A 4HX4A 4YIFA 1MDMA 3GO5A 1GXQA 3P9IA 2V1UA 1G6NA 3FXUA 3MZYA 2M8EA 1B6AA 3B02A 1UB9A 2O0YA 2XVCA 2VODA 2EFPA 4LLGF 3I0TA 3I58A 1JE8A 4LFUA 4XSXF 1IN5A 4M6XA 1K6OA 1OKRA 2K7LA 1XMKA 1YS6A 5D6FA 4LK1F 2V6CA 5J6XA 2ZMEA 4S04A 3WU1B 2EB7A 2W84A 1KGSA 1XCBA 3AAFA 1JXSA 2BBYA 2H09A 4HX8A 3V8JA 4MEXF 1KYWA 4MTDA 1KQ8A 5HLIA 4E70A 2DQLA 4I0BA 4RGUA 4HDUA 2UXXA 3I4PA 2QQAA 3RYRA 5LRRA 3HYIA 1RUNA 3KP3A 1K7AA 3WGGA 1ZAOA 2BV6A 4KYWA 2M5WA 1TTYA 5LHHA 1IN6A 1BI3A 1SFEA 4EJTA 1XN7A 4UV8A 2VBYA 1FBQA 2HTJA 5LBQA 2P5LC 2Z5UA 3KZZA 4RB0A 1QZZA 4A12A 3LA7A 3SZPA 5ILVA 4M9SA 2L4AA 1GHCA 1R5HA 1TBXA 3F8MA 5LHIA 2D1VA 1HXDA 4NB5A 4WXDA 1XMAA 4KIFA 4XLNF 1IF1A 2PQ8A 4TV7A 2DQRA 2FE3A 3Q9SA 1FP1D 2L54A 1BC7C 2R7FA 5JI6A 3LSTA 4HDVA 3I59B 1OR7A 3ABUA 2AS5F 1JHHA 5A2QK 3ZP5A 4UVAA 3IRQA 1B59A 4L9VA 1O57A 4HAMA 5CVJA 1HSTA 3K1NA 3REOA 4M6YA 3KP7A 4EJVA 1ZRDA 5LGNA 2J5PA 2PMHA 1J9IA 1YIOA 4GGGA 2IPQX 3FWEA 4ESJA 1S3JA 2LNBA 1FWZA 2ZXJA 4P55A 4KN4X 2Q8KA 2ACJA 1MGTA 3V7RA 3WTZA 2NAZA 2IRFG 3WTYC 2OD5A 3IL2A 5BPIA 2NS0A 2FBIA 2IW5A 2PMUA 4WCGA 3GYHX 1G4DA 5CVUA 3TO6A 1OYWA 4YFXF 2R3SA 3F8FA 5D4RA 1R5GA 4Q4ZF 3ELKA 2HQNA 1XCVA 3VB2A 1D8JA 1O3SA 1I1SA 1Z7UA 1J7KA 2VOPA 2DBBA 3PQJA 2P6SA 1MJBA 3SXYA 2CQKA 4XBFA 2EFNA 1W7PA 3J81Z 2BGCA 1ZYRF 4RB1A 2P7VB 2YSRA 4ZYDA 1Z05A 4HBLA 5ERIA 3WE2A 3WTSC 1WKMA 2ZJ2A 3MWMA 2VOOA 3HHHA 4KUMA 2LF7A 1BIAA 4IRGA 4RB3C 2FEZA 3CO6C 2KJCA 3RPUA 3T1BA 1R7JA 4HF2A 2VT2A 1U8RA 2KIUA 2P7CB 1R1UA 2K02A 4PDKA 3WODF 3V8KA 4OU0A 3EQLF 4YG2F 1R58A 4M9XA 3ZQ7A 4HLYA 3RI4A 4ZYEA 4BYYA 1G3SA 3D5LA 4BH9A 4HZFA 3HTSB 4PGHA 2H6CA 4EGZA 1YG2A 1UFMA 2JT1A 4RAZA 5LLQA 4EJUA 2ZO4A 2GIVA 3C7JA 4AVPA 4WK8F 4LD5A 1J75A 3HUGA 5D8LB 1U5TC 5JFRA 4BNCA 5BQTA 5DCMB 3G3ZA 1LDDA 1HW1A 4Y17A 2PN6A 2EJRA 4AIJA 1XGOA 3W6KB 3HSEA 1SMYF 2OAZA 1ODDA 1Q1HA 2QZ8A 1IZ1A 5FB2A 2OU2A 3TDUC 5JVTA 4O5VA 4P9UA 4LLLA 3D0SA 2KKOA 3HOSA 1P4WA 1BI2A 2RKHA 2PJPA 2STTA 2OZUA 4OMZA 2M45A 3M9AA 3MZHA 2CWEA 3E5XA 3J80Z 4LG0A 2J5OA 2B0LA 2XUBA 1BOAA 5HDGA 5E17F 2XAHA 2QLZA 2PEXA 4HQEA 2IJLA 5FD5A 1R1VA 5E1WA 1IXRC 2G7UA 2GZWA 2QQBA 5LGTA 4O6JA 3JSPA 5BPDA 3U1DA 4CHUA 3BY6A 3IHUA 1BJAA
chains in the Genus database with same CATH superfamily
2DFFA 2WV1A 2N8GA 3A01B 2YS9A 3ZCOA 4AD9A 3MKYB 2KZVA 5EEAA 5FRNA 3L9FA 1MBKA 3SZTA 2Z2SB 3PO3J 2ZXHA 3I3LA 3F8CA 4YRVA 1R4MB 2L4MA 1MNDA 4L9NA 3BZ6A 3C3WA 2FUG2 3QYBA 4B8XA 3OIPA 1YOVB 2R5ZB 1A35A 4CH7A 4XICA 2P0WA 4B3XA 5EEGA 2QQ9A 3OS1A 4ZDPA 4OIPF 1R00A 5D5XB 4U88A 2BXZA 3KX2A 4MQVA 3TKYA 2DO7A 1SVMA 5HNHA 4XN3A 5F27A 3A2KA 1JI8A 1D1AA 2MGQA 3JW4A 2XF6A 1A04A 3L7WA 2RV8A 2EA4A 1LPQA 1LE8A 2A05A 3L2WA 2EWNA 3I71A 2CRGA 5IP7J 3SDGA 2L01A 1QRYA 3GZNB 3P5JA 3LAJA 3CC2I 4DNCA 2IS4A 1S72I 4IO9F 4CCMA 3ROUA 5L3DA 3LSPA 2ZFUA 4IXAA 4L5JA 2BYVE 4L18B 5DEQA 5EZHA 5CQEA 4RS8A 2F5FA 4J00A 5M3MJ 2KRCA 3DV8A 3PFIA 4LG3A 4BBRJ 4DBRA 2MW8A 2R0QC 4NHJA 3BTLA 2KDOA 1Z77A 1YI2I 3HOUJ 4A0XA 3OYKA 4BEHA 5ICEA 4HEA2 5M5YJ 3GTJJ 2HOAA 4RAYA 4LK0F 4IOAF 3NRVA 3EDPA 3I54A 1NG6A 4C3IJ 1CF7A 3PSIA 2CV2A 2ZCWA 1SAXA 4G94A 3DPTA 1TT5B 4IQ4A 1EH7A 3K4KA 3Q5FA 4D9JA 2CFXA 3CUQB 2GWRA 3G73A 1PUFB 5K5RA 4RLQA 3FM5A 4LIUA 4QPOA 1B9MA 2W25A 2XROA 1WH7A 4YFKF 3JTHA 4F55A 3W2WA 3T0YA 2TDXA 3E5QA 1E17A 5KAFC 1USSA 1R23A 2BOLA 5H2FC 1RESA 2MBFA 4FISA 4HQMA 5HDKA 1Z3YA 4GXOA 2MC3A 1SD5A 1UG0A 5E3OA 1SAUA 2XAGA 3LSKA 4XLPF 3HRMA 3ASNH 3WGIA 4NUBA 4NDLA 3KLNA 1XDUA 4EMSA 1IXSB 2KRFA 3AG4H 2P4WA 1TWHJ 3HHGA 1BBYA 2M3AA 1XMXA 3H36A 3LSHA 3O6BB 3IRRA 2K4JA 2E7XA 3HRUA 1WQ2A 5TRDA 2DI3A 1H0MA 2V1XA 3CCLI 4C30A 4ETSA 1KQ0A 2DOEA 2QEXI 1YW9A 2ISZA 2VKHA 2KL4A 4Y3OA 1KYZA 4W1UA 3OYEA 3ZGKA 2O5RA 5FFZA 1ZN2A 4AIKA 5FLXZ 1QQIA 3FXRA 3VPRA 3IV5A 3GF2A 3D5RC 2GA1A 1KZHA 3CMEI 2FD5A 4BDZA 1YO5C 1ETQA 3DTEA 1GXPA 4C2TA 3CESA 2GXBA 5FLMJ 5LD2C 4Y7NJ 3T8TA 4ZDLA 4WF2A 4HSRA 1BR2A 2JSPA 3SDBA 5A2QZ 3Q3SA 1BW5A 3F22A 1VQ6I 4PGGA 1C0WA 2HVRA 4XKCA 2HQ5A 4KN7X 1KQ9A 1VQNI 4OIRF 3BG6A 3M3YJ 4XLEA 2PLYA 3GFJA 3EUHA 2FRHA 3RTRA 3H5AA 3UR3C 4I99C 2ZMEB 2EPFA 2FOKA 5ICGA 4HF1A 4BQNA 4BY7J 3V7SA 3LSGA 1KONA 2GBYA 3BTJA 5J47A 3CP8A 4CYCB 2PFBA 3QPHA 1R49A 2RN7A 3CUOA 3MFKA 1D8KA 5DTDA 1W0TA 2DJIA 4ANJA 1I6XA 4AUXA 2QBYA 4NC7A 2LF8A 1ERDA 1IGNA 4UB8C 2AHQA 1D0XA 4EJWA 5FKNA 2X4HA 1AKHB 4Q5SF 1UG2A 2F48A 5HODA 1WI9A 1IJWC 4FT8A 2O03A 4OWRB 4G6TB 3ZXSA 4LGWA 1IRFA 1ON2A 1FC3A 2M4GA 5IOZA 2KDZA 1TZLA 1ZELA 3QODA 4J19A 1FBUA 1WCMJ 1T2KA 3BR3A 1GLNA 1N78A 3GEZA 2ZSIB 3H35A 4KA4A 3OL3A 1M1EB 2FA5A 5B1BH 5GTIC 2Z9OA 2Q2EB 3KCCA 5IOYA 3HKZA 4HRIA 3LFKA 3FIWA 1OCPA 2MC4A 4PZJA 5EEHA 1Y1VJ 3HRTA 5DM7F 1RIOH 2A6EF 2OQGA 1S7OA 3S3MA 3CTAA 4OINF 1MBFA 5DDGA 1ZK8A 3EYYA 3FMRA 3O3KA 2WB1N 4BHBA 1Z1DA 2LY1A 2DN0A 2PJRA 3M8FA 3HOWJ 1FOWA 4ABZA 4C2MJ 3R6SA 3TP3A 5D8KB 1V54H 2IA1A 4L9JA 1OISA 2HOEA 4JK1X 5F1JA 1W36D 2VPLA 3LQQA 5M3FJ 3R60A 4ENJA 1HF0A 4XKWA 1HOMA 1NK3P 1GUUA 3ZMUA 5F0CA 1EA3A 4FASD 5DUIA 4YEJA 5C44J 2XGXA 4P5OA 2QSFX 4D0PA 3VYUB 2KQRA 3PIPF 2BW3A 4IPAA 4RAFA 2ZSHB 1B8IB 3SHFA 5F0HA 2V9VA 4GYIA 4AC0A 2H8WA 2JA2A 1YRNA 1X1PA 3BOQA 4HV5A 5JHFA 3JAMZ 4HF0A 3NEUA 3E3VA 4PSXA 5BS6A 2QQ8A 1QHGA 3DF8A 2V1DA 3G2BA 2ZKZA 3V42A 3JRIA 1A6IA 1QO0D 3BCAA 3JSOA 3CLQA 4OAZA 2A5YB 3CQZJ 1GVJA 3P9KA 3A02A 3GLXA 1LVAA 3HSRA 1MSFC 1F4KA 4UNOA 4OOIA 2VBXA 5J1UA 1MW7A 3F8NA 3A0BC 4U0VA 5FKOA 1I5ZA 2QUFA 2ELKA 2IGKA 3BROA 5E20A 4XRSG 4EJOA 2LLKA 3L2QA 2BHYA 2DPUA 3KEYA 1DPUA 3FBNB 4A6EA 1DGWY 3I4MJ 1Q1VA 2DFHA 3G1OA 4U7DA 4FE7A 4IRHA 1VFCA 5JLWA 1P4XA 3GTMJ 5CPRB 1DP3A 1N75A 2B63J 1UAAA 3KP4A 1GVDA 4XQFA 4YIIA 1ZKGA 2WBMA 3M4OJ 3I56I 2GLOA 4HLXA 4CGZA 2LYCA 2JQ7A 3KEOA 3C18A 3EUKL 2IEKA 3HBLA 1LE8B 1SFXA 2DFIA 2QGUA 5HS8A 2A61A 1SFOJ 1U8BA 2YX7A 2Y69H 3OYBA 2E1OA 3L09A 4Z2YA 3GTLJ 4BUPA 3E6DA 4G7ZF 4CZCA 1R5ID 3M8EA 3GLLA 4V2GA 2OV7A 5E1XA 3KFWX 5CQGA 1QZEA 5DYMA 3WG7H 2QBYB 2P5KA 3NWSA 1R36A 3K1PA 1W4MA 4M73A 3WTXC 2X6OA 1ZHFA 1T0FA 1B9NA 1UHSA 3BT9A 1Z0XA 1LJ9A 2L3DA 2XF7A 2P81A 1FOYA 3KP5A 3TOBA 2R5ZA 2LTPA 4QWQA 4A2UA 3S8PA 4A3EJ 3F21A 2ZNYA 4ENKA 4D1QA 2RGVA 3FHZA 2Y0MA 4A93J 4JYKA 3CO7C 1HQCA 3R0AA 5GPCA 3ESWB 3M8JA 1D3YA 2K27A 3FK7A 4PUSA 4MEYF 4EQQA 4CDGA 2MABA 4XRMA 1K79A 2ECCA 5EG0A 5F04A 3S2HJ 1W7PB 3WTVC 1BIBA 5GPAA 2DOAA 1XGSA 2F4OB 4KIBA 4CZZA 3COAC 1T8IA 4DW6A 1TLHB 1ZGWA 1ZG1A 3FBIB 1Z91A 3JCUC 1RNLA 3JREA 3E0JB 2XPVA 2X1CA 3MCZA 4LB5A 3TL4X 2VXDA 2L0KA 2OC6A 4XLCA 1YTYA 2RC4A 3IC7A 5LGUA 4RM2A 4Z6YA 3F6VA 3OSGA 2EIKH 3OS0A 4FETA 1SEUA 2IGNA 1HC8A 2L9RA 1BJZA 1J0RA 2XGEA 4A3KJ 4L9TA 5JHUA 2W24A 4RB2C 4NNJA 5KHDA 1JHFA 5HNFA 1RZ4A 1YS7A 4PJ0C 2YU9J 3CDHA 5L3GA 2HDWA 2XPWA 2HVSA 3GTOJ 3P7NA 2RDPA 2IA0A 1J5YA 2LMDA 1A36A 3QRFF 2EZIA 1FTTA 4M72A 1Z3XA 4IF4A 2HS5A 2VC1A 2EV5A 3BJAA 3KEQA 1B72B 2P8TA 1MMSA 2EV6A 3L00A 3RZOJ 4UVCA 3DEEA 4G7HF 3HZJA 1OYYA 2ID3A 1ZTRA 4M9ZA 2DYSH 4E4HA 1FBSA 2H94A 5HOOA 4MQ9F 2XPUA 2YPRA 1DP7P 4LG0B 2K9NA 1NG7A 4AIHA 1A6QA 2TCTA 1H9TA 2LY2A 3VDXA 3WTWC 2CFOA 3K70D 3OV8A 2JWTA 4QLCU 3KETA 4NC6A 2VASA 2KJBA 2DA7A 3KLOA 2PBIA 5ED4A 1H89C 5IP9J 4RGRA 1OCOH 1S8NA 3ASOH 4A69C 2R92J 1G59A 3FHNA 1VF9A 3RSNA 2EFQA 3T8RA 3RPUD 4HG2A 4BXUA 2FU4A 4DYQA 1WRJA 4AIDA 3BG7A 3U9GA 1NHAA 4W97A 2M1BA 4JOMA 1WJAA 4QIWN 1SVOA 2XF5A 4E7KA 4A3MJ 3PL8A 2LOOA 3AFHA 3J7AY 3OWTA 2FNAA 1LB2A 3BC8A 3GWZA 5D4SA 5DCMA 5LFAA 2X6XA 1FIPA 1X3ZB 2R7DA 1L3LA 2KT0A 4Y13A 4EV0A 2ZNZA 1FNNA 1APLC 2R5YA 3A0HC 3RZDJ 1TNTA 2E34A 1X3WB 3ZQGA 1UJ8A 1P92A 3CC7I 2GXGA 4KFCA 4CXFA 2HYFA 2AXTC 5F08A 3ZMVA 3PUBA 4KMUX 3PNVA 4XLAA 3E6CC 4MNUA 1X2MA 2JZYA 3W2VA 2CW0F 1FOXA 5FLVA 2XDVA 2ZJPF 4RBOA 5LHGA 4CICA 5B3SH 2ISYA 5B1AH 2E2IJ 3RPQA 3OYGA 1BR4A 2W85A 3SFIA 4IJAA 3OYFA 2ADUA 3SFZA 5L3EA 3GFLA 2ETHA 4UVBA 1PP8F 1G3WA 3GTPJ 3AL0B 2M30A 2EINH 5EGOA 2A6TA 3CJRB 1OCRH 2P6TA 1LFUP 2Q0OA 3CDLA 2NVQJ 4Q47A 4M3GA 3FM3A 2RQPA 2ELJA 3QP5A 1FLIA 3B6CA 2CG4A 5H6RA 3J7AO 2M8GX 3L2VA 2HOSA 1S7AA 4QTRA 1LUJB 3E97A 1VQMI 5AIQA 3V7CA 1Y0UA 3WHBA 5J8FA 2HOTA 2DXIA 3IKVA 1YQAA 1WWXA 1YLFA 3H9GA 2FQ3A 2GQQA 4BJTA 1ZG5A 3S1NJ 1S5LC 5AIPA 4A5NA 4RGSA 4UXNA 3DBRB 3K70C 2XHKA 2HPMA 2CV0A 2WTEA 2WAQA 4HOBA 3I64A 4EM0B 3DEWA 2KIQA 2E5ZA 2YU3A 5EZGA 3NQOA 2X6WA 2X51A 1ETWA 5KAIC 5JR3A 2DOFA 3PUFA 5F6FA 2D1HA 3TEDA 1NK2P 4GRIA 4ZTFA 2R7XA 1W5CC 2KHMA 3I5UA 4KDPA 3VFZA 2FMLA 3A01A 2Z3YA 4P9FA 4RLFA 3RJPA 4A3FJ 3G6EI 4DYCA 3KP6A 4G6DA 3QP6A 2M7AA 2HFHA 2HTSA 1LVKA 3CC4I 1VQPI 3D1NI 3SEZA 2JA8J 4IEJA 2W00A 3ML6A 4EM2A 3E1SA 3W6JB 3NWTA 2LD5A 3V8LA 1P6RA 2HR3A 4HV6A 4BQAA 1RR7A 3Q0UA 3LWFA 3U2RA 4IX7A 1AU7A 1XGNA 2X1EA 2LC2A 3ABKH 4CA0A 1TW3A 1FYKA 2VPRA 1YJWI 5K7HA 1WJCA 5FLXK 2DMQA 5K1YA 1Z67A 4ZYHA 4XLHA 2LDUA 1JKOC 2XRLA 4B09A 3PO2J 3RQ4A 2QCOA 2VB6A 3IWZA 2XASA 1FT9A 2YX4A 2Z16A 3CJQB 4I02A 1BL0A 1ZREA 2VBWA 2E5NA 2FF4A 3KP2A 1T38A 2OBPA 1DUXC 3T5XA 1VQLI 2DT5A 1ON1A 1VNDA 3ZQFA 2LY9A 5ILUA 2HDCA 4WX9A 1QA6A 4GDFA 1O3QA 3EPZA 3CMYA 1MMAA 2F5EA 3KZYA 1S29A 2ZBKA 1JJ6C 2L2OA 4ENMA 3FXLA 5FO5A 1Y8RB 3DKWA 3SJMA 1R22A 1T33A 2FNPA 3HSFA 3WG9A 3L2RA 4IKFA 4PJNA 3HJEA 2CO5A 2Z99A 5FROA 3WU0A 2R7SA 2WWYA 5B66C 5HLTA 1I6HJ 4RAGA 2VQLA 4CCOA 1QBJA 1WPKA 3KZIC 1OR7C 2K4BA 1WJEA 2B9SA 4IZZA 2JUGA 3PFYA 4LIVA 1OCCH 4XIDA 4F91B 3S15J 4UV9A 1GV2A 3LAPA 1LEAA 3WU2C 2NYXA 3DQVC 1Z6TA 1OCZH 4HA8A 2M4KA 1SD6A 1O7FA 2IVMA 3C2HA 3H0GJ 4X0GA 1JUSA 2E1MC 2HQRA 1VZ0A 1X1AA 3L1PA 4KNYA 4UY8I 2O7OA 1ZRFA 1FP2A 2FXAA 1E2XA 3RYPA 1HSJA 2VBZA 4GCVA 3VSLA 3L2UA 1GDTA 2KLOA 5D6EA 2RNJA 3S16J 4F7ZA 3HL2A 1PUEE 2OQRA 1ITYA 4WXCA 4CSWA 3IH3A 1LQ1A 2EQRA 1RR8C 3I59A 1LDKB 2VJIA 1HCRA 3OYDA 3IP4B 4ZYGA 5BOXA 3I4NJ 2DODA 3VYSB 4L0YB 3ZR8X 3J81K 1IN8A 1OYIA 5M5XJ 2EFWA 2M87A 3IAM2 1EV7A 3MAJA 1WI3A 2HXIA 2OPTA 2UXNA 5F1RA 1AWCA 2G7HA 1YE9A 3CUQA 1LFPA 1FMVA 4AVZA 2A68F 4ZTJA 2DA1A 4B43A 2WAFA 2WA0A 3HC7A 2X0LA 2CH0A 3J7ZI 2ESHA 2FSWA 2BY2A 2JN6A 4LMYA 3R4KA 1KU3A 1FY7A 1TWGJ 3ZOBA 2O61A 2VXZA 3U1KA 2PG4A 4BU2A 2NOJB 2V7FA 1KA8A 2QKLB 1STZA 2VI6A 2HWVA 2LH9A 4RA2A 1ETKA 3BP8A 3NARA 4QPQA 4BHPA 3QU3A 1VQOI 2DLLA 3RKXA 2MFZA 4E7HA 5EG0B 4AYBA 2W7NA 2Q1ZB 1X1DA 3GW2A 1G2HA 1D5VA 2LP0A 2MA3A 3CLOA 3HDDA 1HDDC 2L7ZA 2WV0A 4DQ2A 1OCTC 2E2JJ 3BJOA 2XIGA 2UWMA 1Z21A 5FGMA 1LKXA 1W5SA 2DA6A 2VQGA 3M1EA 3UNGC 3KYLA 4V19K 3RQIA 1ETYA 4KICA 4IQJA 1FPQA 1B8IA 3ZMDA 1YFHA 3CF5F 3ZMTA 1U6GA 3HGGA 2E1CA 5CVIA 1LDJA 3O8GA 4JBAA 4LITA 3U21A 3GUDA 1XGMA 1Y39A 1E3PA 1KU7A 2LSOA 2XAUA 3K69A 4NBQA 2VL8A 1HDPA 1MSEC 1EH6A 2WB1A 1O7LA 3BJ6A 3H92A 5BMZA 5E3LA 1V5FA 5L3BA 3HM5A 4IRIA 5E8IA 2QA4I 2X9DA 1K78B 1IXCA 2WY7Q 1A31A 2ELHA 3B73A 5D5UB 1X1BA 1YW8A 1YYVA 3LA3A 1WVRA 2NXNB 4XRFA 3S17J 2VQHA 4M3FA 1ZARA 4I09A 4A3JJ 3RKYA 3G4SI 4BY1J 4Q48A 3HEFA 1IUYA 2JVHA 2IA2A 4XRSA 4G9YA 5IPAA 2XKOA 3K9TA 1L0OC 2AXLA 2HDDA 3CUQC 2EH3A 2H1LA 1ORKA 1V5EA 1IO2A 4M3DA 1RKTA 1TWCJ 3DP7A 3E7LA 3IWFA 2CGPA 3FXKA 4C9YA 3CCQI 2Q2EA 1V4RA 1W7PD 4I7HA 2A5WA 3WGHA 2V4JC 4J01A 1QZYA 4IVNA 3TMOA 2IGOA 1D0ZA 3VEPA 2HGCA 1BI1A 4UUSB 4U0WA 3LSJA 4R79A 5EJCA 2L7MP 3H5RA 2FX0A 4I98B 4B4CA 4D5FA 5EGOB 1F9NA 2ZFWA 4WWCA 3QPSA 3E5UA 3GZ5A 2LKXA 2F4IA 4KIGA 3WE3A 2K3PA 1A5JA 2K85A 3BPVA 3H1CA 2HZDA 2JA5J 1AOYA 3QOEA 4LB6B 4IHVA 3RCOA 3MVPA 4PFPA 2KMUA 1UMQA 2XSJC 3CJTB 2Y31A 4UUTA 4EGYA 1R9TJ 3HOZJ 2HVQA 4MTEA 4A0YA 1X4OA 4CCLA 2L7KA 3J80K 2F5VA 5BNGA 2BE5F 1F5TA 3I9V2 5F0FA 2D2WA 1KU2A 1HBXG 1OQYA 2C6YA 3JRGA 3I53A 1HKTA 1W1WE 2LFBA 1G3YA 3MKWB 3WTUC 3WTTC 3ECOA 2DA4A 4ASNA 1U9OA 2MD5A 3JRFA 1P4AA 2DT6A 1SD7A 4ENNA 4ON0A 1LEBA 1QPIA 3TQNA 2D45A 2JVGA 2GXAA 3V4GA 1PDNC 3LQRA 2DAOA 4A3GJ 1JT6A 1MH3A 2K9LA 3DWLE 2PJRB 3FX3A 3W6VA 1MD0A 4BJ6C 1OPCA 5L3CA 2STWA 5CLSA 2K9QA 6PAXA 4C3JJ 1XB4A 3DXJF 3F0CA 2XAQA 2DTRA 2BY0A 3MKLA 1RKWA 4F52A 5J8CA 4BACA 1KU9A 4BE0A 5DD4A 1MH4A 2BHZA 4BS9A 2EFOA 2A07F 1FTZA 1ZLJA 3DPLC 3OIQA 5FD6A 2ZMEC 5CYVA 2Y2ZA 3HOVJ 3HUGB 1U0JA 4XOPA 4PCQA 3F23A 3M1CA 3PIOF 4BXFA 1WZ2A 3G1LA 4II2A 2OUMA 3HTUA 4LJZF 5GP9A 5J40A 3JR9A 2BXYA 3BTIA 1B72A 1ZGJA 2WAQN 3BCBA 1BC8C 5GAHJ 2M7BA 1IG7A 1TNSA 2IGMA 1ZRCA 3E6MA 3KE2A 4NC8A 4IHXA 2NS7A 2XV4S 2HEOA 5DD8A 1YX3A 2VE8A 3WHCA 2MYSA 4H4KC 3HRSA 3TOAA 2Y0SN 3ZQQA 1O3TA 2DMTA 2QWWA 5HVQC 3CCUI 4O3MA 2EA2A 2VE9A 4BHCA 2K9SA 4MIMA 3BR5A 3BZKA 5EYRA 3ZPLA 2XRNA 3AG1H 4MGRA 4KITB 2Z33A 2F5DA 2YUSA 5IY5H 2O6GE 3BG9A 3C2GA 3MMYB 2X1DA 2R7QA 4L5IA 2HKOA 1P7JA 1U3EM 4EM1A 3TO7A 3O2PE 5TJJA 5E3NA 3OYMA 5J1RA 1P9QC 3SQNA 3S32A 2HKXA 3J7YJ 1K83J 2IBDA 2IT0A 3GZ6A 2UZKA 4EVIA 4IL6C 2KIFA 1MBJA 1EKEA 2LBFA 5FFXA 4X6AJ 1DDNA 3K1MA 2NNNA 1XDSA 2JSCA 5HLHA 1FZPB 2HYGD 1QGPA 1EH8A 3ISPA 5M5WJ 2JK3A 4BAYA 4B3AA 1RUOA 5EDNA 2DDAA 4CYDA 2HU9A 3ABTA 3P9CA 3MEXA 1TQMA 3OYLA 5F64A 1MBHA 1XD7A 2CUFA 1VI0A 4IHSA 2MD0A 2JRMA 1K4TA 5H6QA 1XPXA 3JRAA 1Z7LA 5L3FA 4F93B 3GBGA 4H0EA 2ECBA 3CP2A 3MQ0A 1REPC 2O8XA 1YIJI 1TQPA 2MH9A 1T56A 2CW7A 4EATA 5J1YA 2CW8A 1R4NB 4ESBA 5D5VB 4B1RA 2W1OA 2CS3A 3F3XA 5LEKA 5FKKA 1ZH5A 4I6ZA 1FYLA 4DIQA 1FOKA 1UHWA 3FKIJ 3ZN1A 5IYBJ 1AHDP 3KIOA 1MNEA 3F72A 3C2BA 2KFDA 3E6BA 2XAJA 4BQQA 4RGXA 4Y33A 5LRSA 1TC3C 5HDNA 2E1NA 4CO8A 5J3LA 2NVYJ 3Q9VA 4PJMA 2CUZA 1YX5A 5DUKA 4UUSA 4BQOA 4A6DA 4CCNA 4P96A 3BR2A 3B6AA 2HI3A 1F1ZA 2RNGA 3SYTA 1JT0A 5HS9A 1U5TA 2E35A 1UHMA 3CJNA 4RDUA 2ESNA 2F5CA 3H3ZA 4HNVA 4JX5A 5K5QA 1IW7F 3ZQIA 3DLLF 2PI0A 3OSFA 1X1CA 3FXOA 5IT9Z 3PQKA 3PSFA 2L02A 4DZJA 2JPCA 4I0AA 1S9HA 1TW2A 2WADA 3K4MA 4D7MA 2H27A 2JA7J 2E36A 4N0BA 1NH3A 5C4XJ 3CCSI 2LRDA 3H3UA 1ZGAA 2JPBA 1RI7A 3K4JA 3OYCA 5J4YA 3ZMZA 3BQYA 5DCFA 4A5MA 2K40A 3ZN0A 4I01A 1BN5A 2QYOA 1IC8A 2BVMA 4U0YA 3N97A 5CJ9A 5GAEJ 2VIXA 1ONVA 1DQUA 3W2AA 2M0CA 4MO7A 2KP6A 1Y56A 1CGPA 1G3TA 2IAIA 2LKSA 1IRZA 1I27A 1QVTA 2DMUA 2RVCA 4GYGA 3DFGA 5H20A 4UUVA 1DPRA 1O3RA 4I2OA 4Y4RA 3M7GA 2XGCA 4HSTA 4AWXB 3GFMA 1QHHD 4CCJA 4G8XA 4A3BJ 1ZG3A 2DK8A 4YELA 3RDIA 1U5TB 3EUAA 3A03A 3FISA 3TDZC 5LEJA 3CDIA 1ENHA 2W57A 4Y15A 2FBHA 2FJ1A 1I3QJ 3BLYA 2EK5A 1TL8A 3DEUA 3C1DA 3VYTB 3PJRA 2DW4A 4E7ZA 3K4NA 1XC5A 3TGNA 2O8KA 4AM3A 2R7VA 3BR0A 1Z6RA 5DV5A 3PNTA 2LBFB 2DDBA 1FSEA 1WSUA 4ESFA 1X19A 3S2WA 2K86A 4P1WA 4DGWB 2NVUB 4OMYA 3HGYA 1R1TA 1HKQA 2I5UA 4OIOF 4G6QA 1RPWA 1T0FC 4M74A 4QSHA 2XGDA 4MFDA 4G12A 4U7BA 1JTXA 2E7WA 3IKTA 4KT5C 3FMQA 2XAFA 2W48A 2R7OA 3QU6A 4BEHB 3QWLA 3HKZN 1YW7A 4BGDA 1QPMA 5K5OA 1VTNC 1D1CA 1LNWA 1JJ8C 2MH2A 3JRCA 2CQ7A 2GA2A 3QYFA 4KT6A 4PK4A 4S05A 2XB5A 3CCEI 1U2WA 3FMSA 2IXSA 3ZMSA 2V9KA 2RQQA 4FX0A 3BTCA 1SC7A 1SFUA 1FEXA 2ZJRF 1JGGA 3EYIA 2BVLA 3GMEA 3R61A 5C4JJ 1BM9A 2JTVA 4KMFA 2FBKA 2CSOA 4FQGA 1JGSA 4MLOA 2XC7A 2NRAC 4DZPA 3LSIA 2KIMA 4ZJZA 1OMIA 3ULQB 4Y52J 3H5NA 1XSVA 2MLGA 2NNYA 3DPUA 1TP4A 1G8XA 2GAUA 4HYEA 1PJRA 1IRXA 3K0LA 3K2ZA 3ABLH 3F8BA 5IT3A 3FF5A 5FRMA 3GXOA 2VN2A 4M71A 1MMNA 2FMYA 2X48A 1T6SA 3K6GA 2R93J 2QSHX 1USTA 1MJ9A 2A69F 4K2EA 2A6HF 2O9LA 2LR8A 2L9NA 2XKPA 3A4CA 5D5WB 1TT0A 2OTLI 3BR1A 5B5EC 4LOCA 3S1MJ 1W36C 1FSHA 5ICFA 5ICCA 1GT0C 1HW2A 1EF4A 4G7OF 1J2XA 3PM1A 5E1ZB 3CMMA 1WJ5A 1UELB 2COBA 4HNUA 2OZ6A 2JUCA 2QM3A 2IS1A 4JX4A 1I39A 1WH5A 2YR2A 5CVVA 3LA2A 1ZR4A 1W5TA 1HW5A 4DOZA 1P7IA 4KJZA 4ZZDA 3VOEA 2GIZA 1ETXA 1HLVA 2VONA 1IAWA 1DU0A 5TISC 3EUHC 5KVRA 3N4MA 1T98A 4OIQF 1CQTA 1MMGA 2E2HJ 2OA4A 2IP2A 4HW0A 3BDDA 3QPTA 2LKPA 4XR6A 1ETOA 1IRGA 4ZYAA 2ME0A 3D5SC 5C3EJ 2HZTA 2M2EA 4N9IA 4L0ZB 2G9WA 4XOTA 2EV0A 1T39A 4FHTA 4ZZLA 2QF7A 5ILSA 4BE2A 1J59A 1B1BA 2TRTA 1YITI 3ZQCA 1J09A 5E8GA 3NAUA 3G1MA 4ZH4F 3DU5A 1LFBA 1K78A 1MBEA 2P5VA 1Z9CA 2M34A 1YRNB 5TGTA 2LVSA 2WC2A 1JTYA 2BEOA 3RKQA 1DU6A 4UHTA 2CQXA 4XL9A 2NS8A 2V79A 4X1EA 3BZCA 2ICWG 4R8HA 3BQZA 2DTZA 2CMPA 4A0ZA 1FX7A 2M9HA 1QNTA 3CCMI 1TQIA 1I50J 2KPMA 5HLGA 5KCMA 2DPDA 3GVAA 1IN7A 4MHGA 3HIFA 2QENA 4LLNA 2VC0A 3S1QJ 4V2FA 3SEQA 2QVOA 4WXHA 4XSZF 4CCKA 1IN4A 3HOTA 1I1GA 1P2FA 4XKBA 2G0EA 1XSXA 4JP0A 2O3FA 1MJAA 4OAYA 3IUOA 3FXQA 4HNTA 2DMNA 3TP0A 1FYMA 2E71A 2BY3A 5FKLA 3JAMK 1V5GA 5CVRA 3RIRA 1BW6A 2Y75A 1SMTA 3F6OA 2EZHA 1PP7U 1MDMB 3QAHA 3TO9A 2COMA 4NQWA 3DCFA 1RETA 1MNMC 2L7FP 4FX4A 4A3DJ 3GX4X 1UCRA 1XSDA 1D1BA 5K7ZA 3FZVA 1IDYA 1K6YA 3TBIA 3VSKA 4R1HA 5E18F 1X3UA 2BY1A 4IHTA 4YIRX 4IHYA 4GFBA 2K9MA 2BZTA 2AO9A 2JRTA 3VODA 4N4NB 2VT3A 1CF7B 2VKEA 2A3SA 3DLAA 1S6LA 1MKMA 3BG5A 2DK5A 3MN2A 3JTGA 4B47A 1X4PA 2L5QA 2V1NA 4GO1A 4C2UA 2LG4A 5IP6A 5IYDJ 5AONA 1H9GA 3OOPA 2RAEA 5HS7A 2KZGA 1HKSA 1OLTA 2DU9A 1BA5A 3ECHA 2CYYA 1B4AA 5FJ8J 5IT9K 2F2EA 2NVXJ 3R0JA 4BKXA 1SD4A 3RKWA 3BWGA 2R7RA 4HX7A 5KK1A 4N9HA 3ZQLA 1ZLKA 3LMMA 2CU7A 1V3FA 4JQFA 3DKXA 2VQCA 3OR2C 3FK6A 2HYJA 2MLKA 3GFIA 2Y48A 4M3BA 1U78A 4XNFA 3BR6A 3DBLB 2DFEA 1MZBA 3QOPA 3EETA 3ERED 5JVGF 2R7ZJ 2L9SA 3BPXA 2H6BA 1VQ7I 1ULYA 3H3VK 3A1YA 4YFNF 1AA7A 4NQWB 4F3QA 5GAGJ 1BI0A 3IAS2 1BOBA 3L2CA 3ERMA 4HX4A 1JKRC 4YIFA 1MDMA 3GO5A 1GXQA 2HNHA 4DJAA 3P9IA 2V1UA 1G6NA 3FXUA 3MZYA 2M8EA 2EILH 1B6AA 3B02A 1UB9A 1SFKA 2O0YA 2XVCA 2VODA 3JRHA 1YJNI 2EFPA 2UV1A 4LLGF 3I0TA 2F6CA 2K5CA 3I58A 3KPHA 1JE8A 2H8RA 4LFUA 4FE4A 3S14J 2MSYA 3ZRGA 4XSXF 1IN5A 4M6XA 4A3CJ 3OS2A 4BL0B 1K6OA 3CCRI 2VJ5A 1OKRA 2X85A 2I10A 2K7LA 3K7AJ 3LOCA 1ZR2A 3M07A 2W82A 1XMKA 1YS6A 2ZXIA 2R4GA 3AG2H 5D6FA 3CMAI 4LK1F 2V6CA 2L9VA 4B48A 5J6XA 1Y8QB 3PNYA 2H1KA 5DS9A 2ZMEA 1T95A 4S04A 1N77A 1MIJA 1XS9A 3WU1B 2EB7A 2W84A 4ITVA 2DA5A 1KGSA 1XCBA 3AAFA 1JXSA 4EEFG 2BBYA 3FKJA 1MBGA 2H09A 1XX5A 4HX8A 3V8JA 4MEXF 2PMZN 1KYWA 4MTDA 2VJ4A 2FQ4A 1KQ8A 2CUEA 5HLIA 3LSRA 4E70A 1U9NA 3HXLA 2EZKA 3LNQA 2DQLA 4I0BA 2E60A 4RGUA 4DBQA 4DYRA 4HDUA 2DYRH 2UXXA 3I4PA 2QQAA 1RRJA 3RYRA 5LRRA 3HYIA 2DT7B 1RUNA 3KP3A 1K7AA 2R7TA 3H9JA 1ZAOA 3WGGA 2XSDC 1MMDA 1TWAJ 2WY8Q 2BV6A 4KYWA 1BR1A 2M5WA 1TTYA 5LHHA 2CV1A 3ABMH 1IN6A 2OCEA 4A3LJ 1BI3A 2Z1DA 1SFEA 3DTIA 4EJTA 1XN7A 4UV8A 2VBYA 1FBQA 2HTJA 1E3HA 1WJBA 5LBQA 2P5LC 2Z5UA 3KZZA 4RB0A 1F43A 2NOGA 1SVLA 2QKMB 2VUMJ 2EBIA 1O4XA 3HB9A 1T08B 1QZZA 4A12A 4XM3A 3LA7A 3SZPA 5ILVA 4M9SA 2L4AA 1GHCA 4M3EA 3N05A 1R5HA 1TBXA 3F8MA 5LHIA 2D1VA 1HXDA 4KISA 4NB5A 4WXDA 1XMAA 1H88C 1K4SA 1PYVA 4KIFA 2HXOA 4XMYA 4XLNF 3QPLA 3KYCB 1IF1A 2PQ8A 2ZC2A 4TV7A 4JX6A 2DQRA 5K7FA 4ZDOA 2FE3A 1VQ9I 3Q9SA 1FP1D 2L54A 1WFXA 1E0EA 1BC7C 2R7FA 4HPQA 3S1RJ 5JI6A 3OL4A 3DBHB 4D5CA 3LSTA 4HDVA 2R7UA 3I59B 2XB0X 4PFOA 1OR7A 2OCCH 1VQKI 3S3OA 1ACIA 3ABUA 2AS5F 1JHHA 5A2QK 3DKYA 1D0YA 2ID6A 3K10A 2OTJI 3ZP5A 4UVAA 1VQ8I 3IRQA 1B59A 1H8AC 2IS6A 3LFUA 1FMWA 1E3OC 4L9VA 1O57A 4HAMA 5CVJA 1HSTA 3K1NA 3REOA 4M6YA 3KP7A 4II3A 4EJVA 1ZRDA 5LGNA 2J5PA 3CCYA 2PMHA 3TW7A 1J9IA 3W3CA 1YIOA 2ZB9A 2WAEA 2UUZA 5CKTA 4GGGA 2IPQX 3FWEA 4ESJA 4CUGA 4UB6C 4XKVA 4XN0A 1PUFA 1S3JA 2LNBA 2NVTJ 2MG4A 3QYEA 1WJFA 1FWZA 2ZXJA 1EJ9A 2EZLA 4P55A 2K3FA 1N25A 4KN4X 3O8HA 2Q8KA 3OYAA 2ACJA 4IOCF 4RMNA 1MGTA 3CF2A 3GCMA 3V7RA 3WTZA 1FJLA 2NAZA 4BDYA 1FIAA 2IRFG 2FOWA 3WTYC 2OD5A 3FXJA 3K4CA 3IL2A 1OJLA 5BPIA 4F92B 1PVEA 2NS0A 1YJ9I 2F4MB 3FXMA 3OMYA 2FBIA 2V9PA 3ONQA 2ZJQF 2E19A 2IW5A 2PMUA 2LK2A 3LSMA 3JRDA 3CZ6A 4WCGA 4PJJA 2Y9YA 3GYHX 1G4DA 5CVUA 3TO6A 2QSGX 1JUMA 3DU6A 1OYWA 4YFXF 1F36A 3HPGA 2R3SA 3F8FA 5D4RA 1R5GA 2DCEA 2DJNA 3H9QA 4Q4ZF 3ELKA 1JKPC 3IH2A 5FKMA 2CUJA 4S0HB 4XLFA 3CD6I 1X2NA 3HOXJ 2HQNA 1XCVA 3VB2A 1D8JA 1O3SA 3S2DJ 3QQAA 1I1SA 1Z7UA 1J7KA 2VOPA 2DBBA 3PQJA 4I76A 1V55H 2P6SA 1MJBA 3CCVI 3VWBA 3SXYA 2CQKA 4XBFA 1QVUA 3CCJI 2JA6J 2EFNA 2M0MA 1W7PA 3J81Z 2BGCA 1ZYRF 2P7VB 4RB1A 2YSRA 4ZYDA 3MD2A 1Z05A 2CJJA 3KYDB 3DTKA 4HBLA 1NTCA 3Q0VA 5ERIA 3WE2A 2X6YA 3WTSC 1TWFJ 5E79C 5JLXA 4XORA 1IUFA 1Y6IA 1Y0NA 3UKGA 1IDZA 2DA3A 3TW6A 3OYIA 1WKMA 3AG3H 1JKQC 2ZJ2A 2BW3B 3MWMA 5EF6A 5IYCJ 3K4LA 2VOOA 2D5VA 3HHHA 4KUMA 3HPHA 2LF7A 3IH4A 2VJJA 3I55I 4CYCA 1BIAA 4IRGA 5E3MA 2JMWA 3G71I 2OJED 4RB3C 3MZ8A 4RM3A 1VQ5I 2FEZA 1OFCX 1POGA 3CO6C 2ME6A 2AQEA 2W4SA 2KJCA 3RPUA 3T1BA 2Y30A 3X2QH 1UZCA 1R7JA 4HF2A 2VT2A 1U8RA 2KIUA 2P7CB 1ZQ3P 2B7EA 2R7WA 2HPIA 2GM4A 1Y1WJ 3GTQJ 3OIOA 3ZQHA 5GADJ 4C3HJ 1QU3A 1R1UA 2K02A 4PDKA 1AKHA 3WODF 2KISA 2ZXWH 3V8KA 2R5YB 4OU0A 4BXXJ 2GOMA 2I8DA 3EQLF 1R6RA 4PJLA 1SANA 4YG2F 1R58A 4U87A 4M9XA 3ZQ7A 4D7NA 4HLYA 3RI4A 4BE1A 1VQ4I 4ZYEA 3BG3A 4B44A 4BYYA 3K2AA 1G3SA 3D5LA 4BH9A 4HZFA 3HTSB 4PGHA 2LREA 2H6CA 2AQFA 4XONA 4EGZA 1YG2A 4A3IJ 1R71A 2VKVA 3FDYA 1UFMA 2Y0SA 3OYHA 2JT1A 1GV5A 4RAZA 5LLQA 4N4OB 3S3NA 4EJUA 2ZO4A 1DGRM 2GIVA 3C7JA 5KNLA 4AVPA 4WK8F 2CQQA 2CQNA 4LD5A 1J75A 9ANTA 2E1MB 4AYBN 3HUGA 5D8LB 1U5TC 5JFRA 4FTHA 2KRHA 3OYJA 4BNCA 5BQTA 1WGXA 4PSWA 5DCMB 3G3ZA 3VYRB 1LDDA 1HW1A 2DMPA 3S93A 1D5YA 2DA2A 1JUPA 3K4BA 4Y17A 1WHUA 1WJDA 5DM6F 2PN6A 4FCYA 2EJRA 3JRBA 4AIJA 1XGOA 3HOYJ 3W6KB 1ETVA 3HSEA 1RC9A 2V26A 1SMYF 2OF7A 1XTAA 2OAZA 3OR1C 1S7EA 1ODDA 3F9KA 1Q1HA 3H0DA 4E7SA 2QZ8A 1IZ1A 4M6VA 1K61A 4E7IA 5FB2A 2OU2A 3TDUC 5JVTA 4O5VA 4L5EA 2VKDA 4P9UA 4LLLA 3AKZA 3D0SA 1IV6A 2KKOA 3HOSA 1P4WA 4E7JA 3HG9A 4MFEA 1BI2A 2HQAA 2RKHA 3Q0WA 3MKZA 4E7LA 4ZC3A 2STTA 2PJPA 4BJ5C 5J4VA 2OZUA 4E6KG 4OMZA 3GTKJ 3OY9A 2M45A 3M9AA 2RREA 3LL7A 2PMZA 3MZHA 2JJ7A 4XK4A 2VLAA 2CWEA 3E5XA 3OOUA 3J80Z 3SZGA 4IHWA 1XG1A 4LG0A 4AU7A 2J5OA 5GTHC 2EIMH 2B0LA 2XUBA 1BOAA 1W0UA 5HDGA 5E17F 1HA8A 2EIJH 2XAHA 2QLZA 3AL0C 2PEXA 4HQEA 2IJLA 5FD5A 1I3AA 1R1VA 5E1WA 2Y9ZA 1IXRC 3OYNA 2G7UA 2GZWA 1IV8A 2QQBA 5LGTA 4BBSJ 2PX9A 4O6JA 3JSPA 1YHQI 5BPDA 3GTGJ 2IS2A 3U1DA 4CHUA 3BY6A 1X58A 3IHUA 2GOXB 1BJAA 2V6EA
chains in the Genus database with same CATH topology
4AD9A 3L9FA 3SZTA 3F8CA 2L4MA 4L9NA 3BZ6A 3C3WA 4B8XA 5EEGA 2QQ9A 4OIPF 1R00A 5D5XB 4U88A 4MQVA 3TKYA 2DO7A 3JW4A 1A04A 3L7WA 2RV8A 2EA4A 2EWNA 3I71A 2L01A 3LAJA 4DNCA 3ROUA 5L3DA 4IXAA 4L5JA 2BYVE 4L18B 5DEQA 4RS8A 2F5FA 3DV8A 3PFIA 4NHJA 4A0XA 5ICEA 4RAYA 4LK0F 3NRVA 3EDPA 3I54A 1CF7A 2ZCWA 1SAXA 4G94A 3DPTA 1EH7A 3Q5FA 3G73A 2CFXA 3CUQB 2GWRA 5K5RA 3FM5A 1B9MA 2W25A 2XROA 4YFKF 3JTHA 3T0YA 2TDXA 3E5QA 1E17A 1USSA 1R23A 2MBFA 4HQMA 5HDKA 4GXOA 2MC3A 1SD5A 2XAGA 4XLPF 3HRMA 3WGIA 3KLNA 1XDUA 4EMSA 1IXSB 2KRFA 2P4WA 1BBYA 3HHGA 3O6BB 3IRRA 2K4JA 2E7XA 3HRUA 1WQ2A 5TRDA 2DI3A 1H0MA 2V1XA 4ETSA 1KQ0A 1YW9A 2ISZA 1KYZA 5FFZA 1ZN2A 4AIKA 5FLXZ 1QQIA 3FXRA 3GF2A 2GA1A 1YO5C 1GXPA 2GXBA 3T8TA 4WF2A 5A2QZ 3F22A 4PGGA 1C0WA 4KN7X 1KQ9A 4OIRF 2PLYA 3GFJA 3EUHA 2FRHA 3RTRA 2ZMEB 2FOKA 5ICGA 4HF1A 3V7SA 2PFBA 3QPHA 2RN7A 3CUOA 3MFKA 1D8KA 1I6XA 2QBYA 2LF8A 4EJWA 2X4HA 4Q5SF 1WI9A 4FT8A 2O03A 4LGWA 1IRFA 1ON2A 1FC3A 1FBUA 1T2KA 3GEZA 4KA4A 2FA5A 2Z9OA 3KCCA 3LFKA 4PZJA 5EEHA 3HRTA 1RIOH 2A6EF 2OQGA 1S7OA 3CTAA 4OINF 5DDGA 3EYYA 3FMRA 3O3KA 4BHBA 1Z1DA 3M8FA 3R6SA 5D8KB 2IA1A 4L9JA 2HOEA 4JK1X 3LQQA 4ENJA 3R60A 5DUIA 3ZMUA 2XGXA 4P5OA 4D0PA 4IPAA 3SHFA 2V9VA 4GYIA 3BOQA 4HV5A 3JAMZ 4HF0A 3NEUA 3E3VA 5BS6A 3DF8A 2V1DA 2ZKZA 1QO0D 3JSOA 2A5YB 1GVJA 3P9KA 3GLXA 1LVAA 3HSRA 1F4KA 4UNOA 4OOIA 2VBXA 3F8NA 4U0VA 1I5ZA 2QUFA 3BROA 5E20A 4EJOA 1DPUA 2DPUA 4A6EA 4U7DA 4IRHA 1P4XA 3KP4A 4YIIA 4HLXA 4CGZA 3KEOA 3C18A 1SFXA 2DFIA 5HS8A 2A61A 2YX7A 3L09A 4Z2YA 3E6DA 4G7ZF 3M8EA 5E1XA 3KFWX 5DYMA 2QBYB 2P5KA 1R36A 3K1PA 1W4MA 4M73A 3WTXC 1ZHFA 1T0FA 1B9NA 1LJ9A 2L3DA 3KP5A 3TOBA 4QWQA 4A2UA 3F21A 2ZNYA 4ENKA 2RGVA 3FHZA 2Y0MA 3CO7C 1HQCA 3R0AA 1D3YA 2K27A 4MEYF 4EQQA 4CDGA 1K79A 1W7PB 3WTVC 1BIBA 3COAC 1XGSA 4KIBA 4CZZA 1TLHB 1ZG1A 1Z91A 1RNLA 3MCZA 4LB5A 1YTYA 2RC4A 3IC7A 5LGUA 3F6VA 1J0RA 4L9TA 5JHUA 2W24A 4RB2C 1JHFA 1RZ4A 1YS7A 3CDHA 5L3GA 3P7NA 2RDPA 2IA0A 1J5YA 3QRFF 4M72A 4IF4A 2HS5A 2VC1A 2EV5A 3BJAA 3KEQA 2P8TA 2EV6A 3L00A 4UVCA 4G7HF 1OYYA 4M9ZA 1FBSA 2H94A 5HOOA 4MQ9F 2YPRA 1DP7P 4LG0B 4AIHA 1H9TA 3WTWC 3OV8A 4QLCU 3KETA 2KJBA 3KLOA 2PBIA 5ED4A 4RGRA 1S8NA 2EFQA 3T8RA 4BXUA 2FU4A 1WRJA 3U9GA 1NHAA 2M1BA 2FNAA 1LB2A 3GWZA 5D4SA 5DCMA 2R7DA 1L3LA 4Y13A 4EV0A 2ZNZA 1FNNA 1TNTA 1P92A 2GXGA 4KFCA 4CXFA 2HYFA 3ZMVA 4KMUX 3E6CC 4MNUA 2JZYA 2CW0F 5LHGA 4CICA 2ISYA 3RPQA 2W85A 4IJAA 2ADUA 3SFZA 5L3EA 3GFLA 2ETHA 4UVBA 1PP8F 1G3WA 2M30A 2P6TA 2Q0OA 4Q47A 3FM3A 2RQPA 3QP5A 1FLIA 2CG4A 5H6RA 3J7AO 1S7AA 3E97A 5AIQA 3V7CA 1Y0UA 5J8FA 3IKVA 1YQAA 1WWXA 1YLFA 2FQ3A 2GQQA 1ZG5A 5AIPA 4A5NA 4RGSA 4UXNA 2XHKA 2WTEA 4HOBA 3I64A 4EM0B 2YU3A 3NQOA 5JR3A 5F6FA 2D1HA 3I5UA 4KDPA 3VFZA 2FMLA 2Z3YA 4P9FA 3RJPA 3KP6A 4G6DA 3QP6A 2HFHA 2HTSA 3ML6A 4EM2A 3W6JB 3V8LA 1P6RA 2HR3A 4HV6A 4BQAA 3LWFA 3U2RA 1XGNA 1FYKA 1TW3A 5FLXK 5K1YA 4ZYHA 2LDUA 4B09A 3IWZA 2XASA 1FT9A 2YX4A 4I02A 1ZREA 2VBWA 2FF4A 3KP2A 1T38A 2OBPA 1DUXC 3T5XA 2DT5A 1ON1A 5ILUA 2HDCA 4WX9A 1O3QA 2F5EA 3KZYA 1S29A 2ZBKA 4ENMA 5FO5A 3DKWA 1R22A 2FNPA 3HSFA 3WG9A 2CO5A 2Z99A 3WU0A 2WWYA 1QBJA 2K4BA 4UV9A 3LAPA 1LEAA 2NYXA 3DQVC 1Z6TA 4HA8A 1SD6A 1O7FA 2IVMA 2HQRA 4KNYA 1ZRFA 1FP2A 2FXAA 1E2XA 3RYPA 1HSJA 2VBZA 4GCVA 5D6EA 2RNJA 4F7ZA 1PUEE 2OQRA 4WXCA 1LQ1A 3I59A 1LDKB 4ZYGA 5BOXA 4L0YB 3J81K 1IN8A 1OYIA 2EFWA 2M87A 1EV7A 3MAJA 1AWCA 2UXNA 5F1RA 2G7HA 3CUQA 2A68F 2X0LA 2ESHA 2FSWA 4LMYA 3R4KA 1KU3A 1FY7A 2O61A 2VXZA 2PG4A 1KA8A 4I2OA 1STZA 4BHPA 2HWVA 3BP8A 3QU3A 2DLLA 3RKXA 3GW2A 1D5VA 2MA3A 3CLOA 4DQ2A 2WV0A 3BJOA 2XIGA 2UWMA 5FGMA 1W5SA 3M1EA 4KICA 1FPQA 3ZMDA 1YFHA 3ZMTA 1U6GA 2E1CA 5CVIA 1LDJA 4JBAA 3GUDA 1XGMA 1KU7A 2LSOA 3K69A 1EH6A 3BJ6A 1O7LA 3H92A 5BMZA 5L3BA 4IRIA 5E8IA 1K78B 1IXCA 2ELHA 3B73A 5D5UB 1YW8A 1YYVA 3LA3A 4XRFA 1ZARA 4I09A 3RKYA 4Q48A 1IUYA 2IA2A 4G9YA 2XKOA 3K9TA 1L0OC 2AXLA 3CUQC 3DP7A 3IWFA 2CGPA 2Q2EA 1V4RA 1W7PD 4I7HA 3WGHA 1QZYA 4IVNA 3VEPA 2HGCA 1BI1A 4U0WA 4R79A 4I98B 1F9NA 2ZFWA 4WWCA 3E5UA 3GZ5A 4KIGA 3WE3A 3BPVA 1AOYA 4LB6B 4EGYA 4MTEA 4A0YA 3J80K 2BE5F 1F5TA 2D2WA 1KU2A 1HBXG 2C6YA 3I53A 1HKTA 1G3YA 3WTUC 3WTTC 3ECOA 4ASNA 2MD5A 1P4AA 1SD7A 4ENNA 4ON0A 1LEBA 3TQNA 2D45A 3V4GA 1PDNC 3LQRA 2DAOA 3FX3A 1MD0A 5L3CA 1OPCA 2STWA 5CLSA 6PAXA 1XB4A 3DXJF 2XAQA 2DTRA 5J8CA 1KU9A 5DD4A 2A07F 2EFOA 1ZLJA 3DPLC 5FD6A 5CYVA 4PCQA 3F23A 3HTUA 4LJZF 1ZGJA 1BC8C 1TNSA 1ZRCA 3E6MA 3KE2A 2XV4S 2HEOA 5DD8A 2VE8A 3HRSA 3TOAA 1O3TA 2QWWA 5HVQC 4O3MA 2EA2A 2VE9A 4BHCA 3ZPLA 2XRNA 4MGRA 2Z33A 2F5DA 2O6GE 4L5IA 2HKOA 1U3EM 4EM1A 3TO7A 3O2PE 5TJJA 3SQNA 2HKXA 2IT0A 3GZ6A 2UZKA 4EVIA 2KIFA 5FFXA 1DDNA 3K1MA 2NNNA 1XDSA 2JSCA 5HLHA 1FZPB 2HYGD 1QGPA 1EH8A 3ISPA 4BAYA 1RUOA 4CYDA 3ABTA 3P9CA 3MEXA 1TQMA 5F64A 1XD7A 4IHSA 5H6QA 5L3FA 4H0EA 1REPC 3MQ0A 2O8XA 1TQPA 2MH9A 4ESBA 5D5VB 3F3XA 5LEKA 1ZH5A 1FYLA 1FOKA 1UHWA 3ZN1A 3F72A 3E6BA 2XAJA 4RGXA 5LRSA 5HDNA 2E1NA 4CO8A 3Q9VA 5DUKA 4A6DA 4P96A 1F1ZA 5HS9A 1U5TA 1UHMA 3CJNA 2ESNA 2F5CA 3H3ZA 5K5QA 1IW7F 2PI0A 5IT9Z 3PQKA 2L02A 2JPCA 4I0AA 1TW2A 2H27A 4N0BA 3H3UA 1ZGAA 2JPBA 1RI7A 3ZMZA 5DCFA 4A5MA 3ZN0A 4I01A 1BN5A 2QYOA 4U0YA 3N97A 5CJ9A 1ONVA 1CGPA 1G3TA 1I27A 2RVCA 4GYGA 3DFGA 5H20A 4UUVA 1DPRA 1O3RA 3M7GA 4AWXB 3GFMA 4G8XA 1ZG3A 2DK8A 3RDIA 1U5TB 3TDZC 5LEJA 2W57A 4Y15A 2FBHA 2EK5A 3DEUA 3C1DA 2DW4A 3TGNA 1Z6RA 5DV5A 1FSEA 1WSUA 4ESFA 3S2WA 2K86A 4OMYA 1R1TA 1HKQA 4OIOF 4G6QA 4M74A 4U7BA 2E7WA 3IKTA 4KT5C 2XAFA 3FMQA 3QU6A 1YW7A 5K5OA 1QPMA 1VTNC 1LNWA 2MH2A 2GA2A 4S05A 1U2WA 3FMSA 3ZMSA 4FX0A 1SFUA 3EYIA 3R61A 4KMFA 1BM9A 2JTVA 2FBKA 2CSOA 1JGSA 2NRAC 2KIMA 1OMIA 3ULQB 1XSVA 2MLGA 2NNYA 2GAUA 4HYEA 3K0LA 3K2ZA 3F8BA 5IT3A 3FF5A 3GXOA 2VN2A 4M71A 2FMYA 1T6SA 1USTA 1MJ9A 2A69F 4K2EA 2A6HF 2XKPA 5D5WB 1FSHA 5ICFA 5ICCA 1HW2A 4G7OF 1J2XA 5E1ZB 2OZ6A 2QM3A 2YR2A 5CVVA 3LA2A 1W5TA 1HW5A 4ZZDA 3VOEA 2VONA 1IAWA 5KVRA 3N4MA 1T98A 4OIQF 2OA4A 2IP2A 4HW0A 3BDDA 3QPTA 2LKPA 1IRGA 2HZTA 4L0ZB 4N9IA 2G9WA 2EV0A 1T39A 4FHTA 4ZZLA 5ILSA 1J59A 1B1BA 5E8GA 4ZH4F 1K78A 2P5VA 1Z9CA 2WC2A 2BEOA 4UHTA 2V79A 4R8HA 4A0ZA 1FX7A 1QNTA 1TQIA 5HLGA 2DPDA 3GVAA 1IN7A 4MHGA 3HIFA 2QENA 4LLNA 2VC0A 2QVOA 4WXHA 4XSZF 1IN4A 3HOTA 1I1GA 1P2FA 1XSXA 2O3FA 1MJAA 3FXQA 1FYMA 3JAMK 5CVRA 3RIRA 2Y75A 1SMTA 3F6OA 1PP7U 1MDMB 3QAHA 3TO9A 2COMA 4NQWA 4FX4A 3GX4X 1UCRA 1XSDA 3FZVA 4R1HA 5E18F 1X3UA 4IHTA 2JRTA 3VODA 2VT3A 1CF7B 2A3SA 1S6LA 1MKMA 2DK5A 3JTGA 4GO1A 5AONA 1H9GA 3OOPA 5HS7A 1HKSA 2DU9A 3ECHA 2CYYA 1B4AA 5IT9K 2F2EA 3R0JA 1SD4A 3RKWA 3BWGA 4HX7A 5KK1A 4N9HA 1ZLKA 1V3FA 4JQFA 2MLKA 3GFIA 2Y48A 1U78A 3QOPA 1MZBA 3EETA 3ERED 3BPXA 2H6BA 1ULYA 4YFNF 3L2CA 1BI0A 4HX4A 4YIFA 1MDMA 3GO5A 1GXQA 3P9IA 2V1UA 1G6NA 3FXUA 3MZYA 2M8EA 1B6AA 3B02A 1UB9A 2O0YA 2XVCA 2VODA 2EFPA 4LLGF 3I0TA 3I58A 1JE8A 4LFUA 4XSXF 1IN5A 4M6XA 1K6OA 1OKRA 2K7LA 1XMKA 1YS6A 5D6FA 4LK1F 2V6CA 5J6XA 2ZMEA 4S04A 3WU1B 2EB7A 2W84A 1KGSA 1XCBA 3AAFA 1JXSA 2BBYA 2H09A 4HX8A 3V8JA 4MEXF 1KYWA 4MTDA 1KQ8A 5HLIA 4E70A 2DQLA 4I0BA 4RGUA 4HDUA 2UXXA 3I4PA 2QQAA 3RYRA 5LRRA 3HYIA 1RUNA 3KP3A 1K7AA 3WGGA 1ZAOA 2BV6A 4KYWA 2M5WA 1TTYA 5LHHA 1IN6A 1BI3A 1SFEA 4EJTA 1XN7A 4UV8A 2VBYA 1FBQA 2HTJA 5LBQA 2P5LC 2Z5UA 3KZZA 4RB0A 1QZZA 4A12A 3LA7A 3SZPA 5ILVA 4M9SA 2L4AA 1GHCA 1R5HA 1TBXA 3F8MA 5LHIA 2D1VA 1HXDA 4NB5A 4WXDA 1XMAA 4KIFA 4XLNF 1IF1A 2PQ8A 4TV7A 2DQRA 2FE3A 3Q9SA 1FP1D 2L54A 1BC7C 2R7FA 5JI6A 3LSTA 4HDVA 3I59B 1OR7A 3ABUA 2AS5F 1JHHA 5A2QK 3ZP5A 4UVAA 3IRQA 1B59A 4L9VA 1O57A 4HAMA 5CVJA 1HSTA 3K1NA 3REOA 4M6YA 3KP7A 4EJVA 1ZRDA 5LGNA 2J5PA 2PMHA 1J9IA 1YIOA 4GGGA 2IPQX 3FWEA 4ESJA 1S3JA 2LNBA 1FWZA 2ZXJA 4P55A 4KN4X 2Q8KA 2ACJA 1MGTA 3V7RA 3WTZA 2NAZA 2IRFG 3WTYC 2OD5A 3IL2A 5BPIA 2NS0A 2FBIA 2IW5A 2PMUA 4WCGA 3GYHX 1G4DA 5CVUA 3TO6A 1OYWA 4YFXF 2R3SA 3F8FA 5D4RA 1R5GA 4Q4ZF 3ELKA 2HQNA 1XCVA 3VB2A 1D8JA 1O3SA 1I1SA 1Z7UA 1J7KA 2VOPA 2DBBA 3PQJA 2P6SA 1MJBA 3SXYA 2CQKA 4XBFA 2EFNA 1W7PA 3J81Z 2BGCA 1ZYRF 4RB1A 2P7VB 2YSRA 4ZYDA 1Z05A 4HBLA 5ERIA 3WE2A 3WTSC 1WKMA 2ZJ2A 3MWMA 2VOOA 3HHHA 4KUMA 2LF7A 1BIAA 4IRGA 4RB3C 2FEZA 3CO6C 2KJCA 3RPUA 3T1BA 1R7JA 4HF2A 2VT2A 1U8RA 2KIUA 2P7CB 1R1UA 2K02A 4PDKA 3WODF 3V8KA 4OU0A 3EQLF 4YG2F 1R58A 4M9XA 3ZQ7A 4HLYA 3RI4A 4ZYEA 4BYYA 1G3SA 3D5LA 4BH9A 4HZFA 3HTSB 4PGHA 2H6CA 4EGZA 1YG2A 1UFMA 2JT1A 4RAZA 5LLQA 4EJUA 2ZO4A 2GIVA 3C7JA 4AVPA 4WK8F 4LD5A 1J75A 3HUGA 5D8LB 1U5TC 5JFRA 4BNCA 5BQTA 5DCMB 3G3ZA 1LDDA 1HW1A 4Y17A 2PN6A 2EJRA 4AIJA 1XGOA 3W6KB 3HSEA 1SMYF 2OAZA 1ODDA 1Q1HA 2QZ8A 1IZ1A 5FB2A 2OU2A 3TDUC 5JVTA 4O5VA 4P9UA 4LLLA 3D0SA 2KKOA 3HOSA 1P4WA 1BI2A 2RKHA 2PJPA 2STTA 2OZUA 4OMZA 2M45A 3M9AA 3MZHA 2CWEA 3E5XA 3J80Z 4LG0A 2J5OA 2B0LA 2XUBA 1BOAA 5HDGA 5E17F 2XAHA 2QLZA 2PEXA 4HQEA 2IJLA 5FD5A 1R1VA 5E1WA 1IXRC 2G7UA 2GZWA 2QQBA 5LGTA 4O6JA 3JSPA 5BPDA 3U1DA 4CHUA 3BY6A 3IHUA 1BJAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AD9 A;  3L9F A;  3SZT A;  3F8C A;  2L4M A;  4L9N A;  3BZ6 A;  3C3W A;  4B8X A;  5EEG A;  2QQ9 A;  4OIP F;  1R00 A;  5D5X B;  4U88 A;  4MQV A;  3TKY A;  2DO7 A;  3JW4 A;  1A04 A;  3L7W A;  2RV8 A;  2EA4 A;  2EWN A;  3I71 A;  2L01 A;  3LAJ A;  4DNC A;  3ROU A;  5L3D A;  4IXA A;  4L5J A;  2BYV E;  4L18 B;  5DEQ A;  4RS8 A;  2F5F A;  3DV8 A;  3PFI A;  4NHJ A;  4A0X A;  5ICE A;  4RAY A;  4LK0 F;  3NRV A;  3EDP A;  3I54 A;  1CF7 A;  2ZCW A;  1SAX A;  4G94 A;  3DPT A;  1EH7 A;  3Q5F A;  3G73 A;  2CFX A;  3CUQ B;  2GWR A;  5K5R A;  3FM5 A;  1B9M A;  2W25 A;  2XRO A;  4YFK F;  3JTH A;  3T0Y A;  2TDX A;  3E5Q A;  1E17 A;  1USS A;  1R23 A;  2MBF A;  4HQM A;  5HDK A;  4GXO A;  2MC3 A;  1SD5 A;  2XAG A;  4XLP F;  3HRM A;  3WGI A;  3KLN A;  1XDU A;  4EMS A;  1IXS B;  2KRF A;  2P4W A;  1BBY A;  3HHG A;  3O6B B;  3IRR A;  2K4J A;  2E7X A;  3HRU A;  1WQ2 A;  5TRD A;  2DI3 A;  1H0M A;  2V1X A;  4ETS A;  1KQ0 A;  1YW9 A;  2ISZ A;  1KYZ A;  5FFZ A;  1ZN2 A;  4AIK A;  5FLX Z;  1QQI A;  3FXR A;  3GF2 A;  2GA1 A;  1YO5 C;  1GXP A;  2GXB A;  3T8T A;  4WF2 A;  5A2Q Z;  3F22 A;  4PGG A;  1C0W A;  4KN7 X;  1KQ9 A;  4OIR F;  2PLY A;  3GFJ A;  3EUH A;  2FRH A;  3RTR A;  2ZME B;  2FOK A;  5ICG A;  4HF1 A;  3V7S A;  2PFB A;  3QPH A;  2RN7 A;  3CUO A;  3MFK A;  1D8K A;  1I6X A;  2QBY A;  2LF8 A;  4EJW A;  2X4H A;  4Q5S F;  1WI9 A;  4FT8 A;  2O03 A;  4LGW A;  1IRF A;  1ON2 A;  1FC3 A;  1FBU A;  1T2K A;  3GEZ A;  4KA4 A;  2FA5 A;  2Z9O A;  3KCC A;  3LFK A;  4PZJ A;  5EEH A;  3HRT A;  1RIO H;  2A6E F;  2OQG A;  1S7O A;  3CTA A;  4OIN F;  5DDG A;  3EYY A;  3FMR A;  3O3K A;  4BHB A;  1Z1D A;  3M8F A;  3R6S A;  5D8K B;  2IA1 A;  4L9J A;  2HOE A;  4JK1 X;  3LQQ A;  4ENJ A;  3R60 A;  5DUI A;  3ZMU A;  2XGX A;  4P5O A;  4D0P A;  4IPA A;  3SHF A;  2V9V A;  4GYI A;  3BOQ A;  4HV5 A;  3JAM Z;  4HF0 A;  3NEU A;  3E3V A;  5BS6 A;  3DF8 A;  2V1D A;  2ZKZ A;  1QO0 D;  3JSO A;  2A5Y B;  1GVJ A;  3P9K A;  3GLX A;  1LVA A;  3HSR A;  1F4K A;  4UNO A;  4OOI A;  2VBX A;  3F8N A;  4U0V A;  1I5Z A;  2QUF A;  3BRO A;  5E20 A;  4EJO A;  1DPU A;  2DPU A;  4A6E A;  4U7D A;  4IRH A;  1P4X A;  3KP4 A;  4YII A;  4HLX A;  4CGZ A;  3KEO A;  3C18 A;  1SFX A;  2DFI A;  5HS8 A;  2A61 A;  2YX7 A;  3L09 A;  4Z2Y A;  3E6D A;  4G7Z F;  3M8E A;  5E1X A;  3KFW X;  5DYM A;  2QBY B;  2P5K A;  1R36 A;  3K1P A;  1W4M A;  4M73 A;  3WTX C;  1ZHF A;  1T0F A;  1B9N A;  1LJ9 A;  2L3D A;  3KP5 A;  3TOB A;  4QWQ A;  4A2U A;  3F21 A;  2ZNY A;  4ENK A;  2RGV A;  3FHZ A;  2Y0M A;  3CO7 C;  1HQC A;  3R0A A;  1D3Y A;  2K27 A;  4MEY F;  4EQQ A;  4CDG A;  1K79 A;  1W7P B;  3WTV C;  1BIB A;  3COA C;  1XGS A;  4KIB A;  4CZZ A;  1TLH B;  1ZG1 A;  1Z91 A;  1RNL A;  3MCZ A;  4LB5 A;  1YTY A;  2RC4 A;  3IC7 A;  5LGU A;  3F6V A;  1J0R A;  4L9T A;  5JHU A;  2W24 A;  4RB2 C;  1JHF A;  1RZ4 A;  1YS7 A;  3CDH A;  5L3G A;  3P7N A;  2RDP A;  2IA0 A;  1J5Y A;  3QRF F;  4M72 A;  4IF4 A;  2HS5 A;  2VC1 A;  2EV5 A;  3BJA A;  3KEQ A;  2P8T A;  2EV6 A;  3L00 A;  4UVC A;  4G7H F;  1OYY A;  4M9Z A;  1FBS A;  2H94 A;  5HOO A;  4MQ9 F;  2YPR A;  1DP7 P;  4LG0 B;  4AIH A;  1H9T A;  3WTW C;  3OV8 A;  4QLC U;  3KET A;  2KJB A;  3KLO A;  2PBI A;  5ED4 A;  4RGR A;  1S8N A;  2EFQ A;  3T8R A;  4BXU A;  2FU4 A;  1WRJ A;  3U9G A;  1NHA A;  2M1B A;  2FNA A;  1LB2 A;  3GWZ A;  5D4S A;  5DCM A;  2R7D A;  1L3L A;  4Y13 A;  4EV0 A;  2ZNZ A;  1FNN A;  1TNT A;  1P92 A;  2GXG A;  4KFC A;  4CXF A;  2HYF A;  3ZMV A;  4KMU X;  3E6C C;  4MNU A;  2JZY A;  2CW0 F;  5LHG A;  4CIC A;  2ISY A;  3RPQ A;  2W85 A;  4IJA A;  2ADU A;  3SFZ A;  5L3E A;  3GFL A;  2ETH A;  4UVB A;  1PP8 F;  1G3W A;  2M30 A;  2P6T A;  2Q0O A;  4Q47 A;  3FM3 A;  2RQP A;  3QP5 A;  1FLI A;  2CG4 A;  5H6R A;  3J7A O;  1S7A A;  3E97 A;  5AIQ A;  3V7C A;  1Y0U A;  5J8F A;  3IKV A;  1YQA A;  1WWX A;  1YLF A;  2FQ3 A;  2GQQ A;  1ZG5 A;  5AIP A;  4A5N A;  4RGS A;  4UXN A;  2XHK A;  2WTE A;  4HOB A;  3I64 A;  4EM0 B;  2YU3 A;  3NQO A;  5JR3 A;  5F6F A;  2D1H A;  3I5U A;  4KDP A;  3VFZ A;  2FML A;  2Z3Y A;  4P9F A;  3RJP A;  3KP6 A;  4G6D A;  3QP6 A;  2HFH A;  2HTS A;  3ML6 A;  4EM2 A;  3W6J B;  3V8L A;  1P6R A;  2HR3 A;  4HV6 A;  4BQA A;  3LWF A;  3U2R A;  1XGN A;  1FYK A;  1TW3 A;  5FLX K;  5K1Y A;  4ZYH A;  2LDU A;  4B09 A;  3IWZ A;  2XAS A;  1FT9 A;  2YX4 A;  4I02 A;  1ZRE A;  2VBW A;  2FF4 A;  3KP2 A;  1T38 A;  2OBP A;  1DUX C;  3T5X A;  2DT5 A;  1ON1 A;  5ILU A;  2HDC A;  4WX9 A;  1O3Q A;  2F5E A;  3KZY A;  1S29 A;  2ZBK A;  4ENM A;  5FO5 A;  3DKW A;  1R22 A;  2FNP A;  3HSF A;  3WG9 A;  2CO5 A;  2Z99 A;  3WU0 A;  2WWY A;  1QBJ A;  2K4B A;  4UV9 A;  3LAP A;  1LEA A;  2NYX A;  3DQV C;  1Z6T A;  4HA8 A;  1SD6 A;  1O7F A;  2IVM A;  2HQR A;  4KNY A;  1ZRF A;  1FP2 A;  2FXA A;  1E2X A;  3RYP A;  1HSJ A;  2VBZ A;  4GCV A;  5D6E A;  2RNJ A;  4F7Z A;  1PUE E;  2OQR A;  4WXC A;  1LQ1 A;  3I59 A;  1LDK B;  4ZYG A;  5BOX A;  4L0Y B;  3J81 K;  1IN8 A;  1OYI A;  2EFW A;  2M87 A;  1EV7 A;  3MAJ A;  1AWC A;  2UXN A;  5F1R A;  2G7H A;  3CUQ A;  2A68 F;  2X0L A;  2ESH A;  2FSW A;  4LMY A;  3R4K A;  1KU3 A;  1FY7 A;  2O61 A;  2VXZ A;  2PG4 A;  1KA8 A;  4I2O A;  1STZ A;  4BHP A;  2HWV A;  3BP8 A;  3QU3 A;  2DLL A;  3RKX A;  3GW2 A;  1D5V A;  2MA3 A;  3CLO A;  4DQ2 A;  2WV0 A;  3BJO A;  2XIG A;  2UWM A;  5FGM A;  1W5S A;  3M1E A;  4KIC A;  1FPQ A;  3ZMD A;  1YFH A;  3ZMT A;  1U6G A;  2E1C A;  5CVI A;  1LDJ A;  4JBA A;  3GUD A;  1XGM A;  1KU7 A;  2LSO A;  3K69 A;  1EH6 A;  3BJ6 A;  1O7L A;  3H92 A;  5BMZ A;  5L3B A;  4IRI A;  5E8I A;  1K78 B;  1IXC A;  2ELH A;  3B73 A;  5D5U B;  1YW8 A;  1YYV A;  3LA3 A;  4XRF A;  1ZAR A;  4I09 A;  3RKY A;  4Q48 A;  1IUY A;  2IA2 A;  4G9Y A;  2XKO A;  3K9T A;  1L0O C;  2AXL A;  3CUQ C;  3DP7 A;  3IWF A;  2CGP A;  2Q2E A;  1V4R A;  1W7P D;  4I7H A;  3WGH A;  1QZY A;  4IVN A;  3VEP A;  2HGC A;  1BI1 A;  4U0W A;  4R79 A;  4I98 B;  1F9N A;  2ZFW A;  4WWC A;  3E5U A;  3GZ5 A;  4KIG A;  3WE3 A;  3BPV A;  1AOY A;  4LB6 B;  4EGY A;  4MTE A;  4A0Y A;  3J80 K;  2BE5 F;  1F5T A;  2D2W A;  1KU2 A;  1HBX G;  2C6Y A;  3I53 A;  1HKT A;  1G3Y A;  3WTU C;  3WTT C;  3ECO A;  4ASN A;  2MD5 A;  1P4A A;  1SD7 A;  4ENN A;  4ON0 A;  1LEB A;  3TQN A;  2D45 A;  3V4G A;  1PDN C;  3LQR A;  2DAO A;  3FX3 A;  1MD0 A;  5L3C A;  1OPC A;  2STW A;  5CLS A;  6PAX A;  1XB4 A;  3DXJ F;  2XAQ A;  2DTR A;  5J8C A;  1KU9 A;  5DD4 A;  2A07 F;  2EFO A;  1ZLJ A;  3DPL C;  5FD6 A;  5CYV A;  4PCQ A;  3F23 A;  3HTU A;  4LJZ F;  1ZGJ A;  1BC8 C;  1TNS A;  1ZRC A;  3E6M A;  3KE2 A;  2XV4 S;  2HEO A;  5DD8 A;  2VE8 A;  3HRS A;  3TOA A;  1O3T A;  2QWW A;  5HVQ C;  4O3M A;  2EA2 A;  2VE9 A;  4BHC A;  3ZPL A;  2XRN A;  4MGR A;  2Z33 A;  2F5D A;  2O6G E;  4L5I A;  2HKO A;  1U3E M;  4EM1 A;  3TO7 A;  3O2P E;  5TJJ A;  3SQN A;  2HKX A;  2IT0 A;  3GZ6 A;  2UZK A;  4EVI A;  2KIF A;  5FFX A;  1DDN A;  3K1M A;  2NNN A;  1XDS A;  2JSC A;  5HLH A;  1FZP B;  2HYG D;  1QGP A;  1EH8 A;  3ISP A;  4BAY A;  1RUO A;  4CYD A;  3ABT A;  3P9C A;  3MEX A;  1TQM A;  5F64 A;  1XD7 A;  4IHS A;  5H6Q A;  5L3F A;  4H0E A;  1REP C;  3MQ0 A;  2O8X A;  1TQP A;  2MH9 A;  4ESB A;  5D5V B;  3F3X A;  5LEK A;  1ZH5 A;  1FYL A;  1FOK A;  1UHW A;  3ZN1 A;  3F72 A;  3E6B A;  2XAJ A;  4RGX A;  5LRS A;  5HDN A;  2E1N A;  4CO8 A;  3Q9V A;  5DUK A;  4A6D A;  4P96 A;  1F1Z A;  5HS9 A;  1U5T A;  1UHM A;  3CJN A;  2ESN A;  2F5C A;  3H3Z A;  5K5Q A;  1IW7 F;  2PI0 A;  5IT9 Z;  3PQK A;  2L02 A;  2JPC A;  4I0A A;  1TW2 A;  2H27 A;  4N0B A;  3H3U A;  1ZGA A;  2JPB A;  1RI7 A;  3ZMZ A;  5DCF A;  4A5M A;  3ZN0 A;  4I01 A;  1BN5 A;  2QYO A;  4U0Y A;  3N97 A;  5CJ9 A;  1ONV A;  1CGP A;  1G3T A;  1I27 A;  2RVC A;  4GYG A;  3DFG A;  5H20 A;  4UUV A;  1DPR A;  1O3R A;  3M7G A;  4AWX B;  3GFM A;  4G8X A;  1ZG3 A;  2DK8 A;  3RDI A;  1U5T B;  3TDZ C;  5LEJ A;  2W57 A;  4Y15 A;  2FBH A;  2EK5 A;  3DEU A;  3C1D A;  2DW4 A;  3TGN A;  1Z6R A;  5DV5 A;  1FSE A;  1WSU A;  4ESF A;  3S2W A;  2K86 A;  4OMY A;  1R1T A;  1HKQ A;  4OIO F;  4G6Q A;  4M74 A;  4U7B A;  2E7W A;  3IKT A;  4KT5 C;  2XAF A;  3FMQ A;  3QU6 A;  1YW7 A;  5K5O A;  1QPM A;  1VTN C;  1LNW A;  2MH2 A;  2GA2 A;  4S05 A;  1U2W A;  3FMS A;  3ZMS A;  4FX0 A;  1SFU A;  3EYI A;  3R61 A;  4KMF A;  1BM9 A;  2JTV A;  2FBK A;  2CSO A;  1JGS A;  2NRA C;  2KIM A;  1OMI A;  3ULQ B;  1XSV A;  2MLG A;  2NNY A;  2GAU A;  4HYE A;  3K0L A;  3K2Z A;  3F8B A;  5IT3 A;  3FF5 A;  3GXO A;  2VN2 A;  4M71 A;  2FMY A;  1T6S A;  1UST A;  1MJ9 A;  2A69 F;  4K2E A;  2A6H F;  2XKP A;  5D5W B;  1FSH A;  5ICF A;  5ICC A;  1HW2 A;  4G7O F;  1J2X A;  5E1Z B;  2OZ6 A;  2QM3 A;  2YR2 A;  5CVV A;  3LA2 A;  1W5T A;  1HW5 A;  4ZZD A;  3VOE A;  2VON A;  1IAW A;  5KVR A;  3N4M A;  1T98 A;  4OIQ F;  2OA4 A;  2IP2 A;  4HW0 A;  3BDD A;  3QPT A;  2LKP A;  1IRG A;  2HZT A;  4L0Z B;  4N9I A;  2G9W A;  2EV0 A;  1T39 A;  4FHT A;  4ZZL A;  5ILS A;  1J59 A;  1B1B A;  5E8G A;  4ZH4 F;  1K78 A;  2P5V A;  1Z9C A;  2WC2 A;  2BEO A;  4UHT A;  2V79 A;  4R8H A;  4A0Z A;  1FX7 A;  1QNT A;  1TQI A;  5HLG A;  2DPD A;  3GVA A;  1IN7 A;  4MHG A;  3HIF A;  2QEN A;  4LLN A;  2VC0 A;  2QVO A;  4WXH A;  4XSZ F;  1IN4 A;  3HOT A;  1I1G A;  1P2F A;  1XSX A;  2O3F A;  1MJA A;  3FXQ A;  1FYM A;  3JAM K;  5CVR A;  3RIR A;  2Y75 A;  1SMT A;  3F6O A;  1PP7 U;  1MDM B;  3QAH A;  3TO9 A;  2COM A;  4NQW A;  4FX4 A;  3GX4 X;  1UCR A;  1XSD A;  3FZV A;  4R1H A;  5E18 F;  1X3U A;  4IHT A;  2JRT A;  3VOD A;  2VT3 A;  1CF7 B;  2A3S A;  1S6L A;  1MKM A;  2DK5 A;  3JTG A;  4GO1 A;  5AON A;  1H9G A;  3OOP A;  5HS7 A;  1HKS A;  2DU9 A;  3ECH A;  2CYY A;  1B4A A;  5IT9 K;  2F2E A;  3R0J A;  1SD4 A;  3RKW A;  3BWG A;  4HX7 A;  5KK1 A;  4N9H A;  1ZLK A;  1V3F A;  4JQF A;  2MLK A;  3GFI A;  2Y48 A;  1U78 A;  3QOP A;  1MZB A;  3EET A;  3ERE D;  3BPX A;  2H6B A;  1ULY A;  4YFN F;  3L2C A;  1BI0 A;  4HX4 A;  4YIF A;  1MDM A;  3GO5 A;  1GXQ A;  3P9I A;  2V1U A;  1G6N A;  3FXU A;  3MZY A;  2M8E A;  1B6A A;  3B02 A;  1UB9 A;  2O0Y A;  2XVC A;  2VOD A;  2EFP A;  4LLG F;  3I0T A;  3I58 A;  1JE8 A;  4LFU A;  4XSX F;  1IN5 A;  4M6X A;  1K6O A;  1OKR A;  2K7L A;  1XMK A;  1YS6 A;  5D6F A;  4LK1 F;  2V6C A;  5J6X A;  2ZME A;  4S04 A;  3WU1 B;  2EB7 A;  2W84 A;  1KGS A;  1XCB A;  3AAF A;  1JXS A;  2BBY A;  2H09 A;  4HX8 A;  3V8J A;  4MEX F;  1KYW A;  4MTD A;  1KQ8 A;  5HLI A;  4E70 A;  2DQL A;  4I0B A;  4RGU A;  4HDU A;  2UXX A;  3I4P A;  2QQA A;  3RYR A;  5LRR A;  3HYI A;  1RUN A;  3KP3 A;  1K7A A;  3WGG A;  1ZAO A;  2BV6 A;  4KYW A;  2M5W A;  1TTY A;  5LHH A;  1IN6 A;  1BI3 A;  1SFE A;  4EJT A;  1XN7 A;  4UV8 A;  2VBY A;  1FBQ A;  2HTJ A;  5LBQ A;  2P5L C;  2Z5U A;  3KZZ A;  4RB0 A;  1QZZ A;  4A12 A;  3LA7 A;  3SZP A;  5ILV A;  4M9S A;  2L4A A;  1GHC A;  1R5H A;  1TBX A;  3F8M A;  5LHI A;  2D1V A;  1HXD A;  4NB5 A;  4WXD A;  1XMA A;  4KIF A;  4XLN F;  1IF1 A;  2PQ8 A;  4TV7 A;  2DQR A;  2FE3 A;  3Q9S A;  1FP1 D;  2L54 A;  1BC7 C;  2R7F A;  5JI6 A;  3LST A;  4HDV A;  3I59 B;  1OR7 A;  3ABU A;  2AS5 F;  1JHH A;  5A2Q K;  3ZP5 A;  4UVA A;  3IRQ A;  1B59 A;  4L9V A;  1O57 A;  4HAM A;  5CVJ A;  1HST A;  3K1N A;  3REO A;  4M6Y A;  3KP7 A;  4EJV A;  1ZRD A;  5LGN A;  2J5P A;  2PMH A;  1J9I A;  1YIO A;  4GGG A;  2IPQ X;  3FWE A;  4ESJ A;  1S3J A;  2LNB A;  1FWZ A;  2ZXJ A;  4P55 A;  4KN4 X;  2Q8K A;  2ACJ A;  1MGT A;  3V7R A;  3WTZ A;  2NAZ A;  2IRF G;  3WTY C;  2OD5 A;  3IL2 A;  5BPI A;  2NS0 A;  2FBI A;  2IW5 A;  2PMU A;  4WCG A;  3GYH X;  1G4D A;  5CVU A;  3TO6 A;  1OYW A;  4YFX F;  2R3S A;  3F8F A;  5D4R A;  1R5G A;  4Q4Z F;  3ELK A;  2HQN A;  1XCV A;  3VB2 A;  1D8J A;  1O3S A;  1I1S A;  1Z7U A;  1J7K A;  2VOP A;  2DBB A;  3PQJ A;  2P6S A;  1MJB A;  3SXY A;  2CQK A;  4XBF A;  2EFN A;  1W7P A;  3J81 Z;  2BGC A;  1ZYR F;  4RB1 A;  2P7V B;  2YSR A;  4ZYD A;  1Z05 A;  4HBL A;  5ERI A;  3WE2 A;  3WTS C;  1WKM A;  2ZJ2 A;  3MWM A;  2VOO A;  3HHH A;  4KUM A;  2LF7 A;  1BIA A;  4IRG A;  4RB3 C;  2FEZ A;  3CO6 C;  2KJC A;  3RPU A;  3T1B A;  1R7J A;  4HF2 A;  2VT2 A;  1U8R A;  2KIU A;  2P7C B;  1R1U A;  2K02 A;  4PDK A;  3WOD F;  3V8K A;  4OU0 A;  3EQL F;  4YG2 F;  1R58 A;  4M9X A;  3ZQ7 A;  4HLY A;  3RI4 A;  4ZYE A;  4BYY A;  1G3S A;  3D5L A;  4BH9 A;  4HZF A;  3HTS B;  4PGH A;  2H6C A;  4EGZ A;  1YG2 A;  1UFM A;  2JT1 A;  4RAZ A;  5LLQ A;  4EJU A;  2ZO4 A;  2GIV A;  3C7J A;  4AVP A;  4WK8 F;  4LD5 A;  1J75 A;  3HUG A;  5D8L B;  1U5T C;  5JFR A;  4BNC A;  5BQT A;  5DCM B;  3G3Z A;  1LDD A;  1HW1 A;  4Y17 A;  2PN6 A;  2EJR A;  4AIJ A;  1XGO A;  3W6K B;  3HSE A;  1SMY F;  2OAZ A;  1ODD A;  1Q1H A;  2QZ8 A;  1IZ1 A;  5FB2 A;  2OU2 A;  3TDU C;  5JVT A;  4O5V A;  4P9U A;  4LLL A;  3D0S A;  2KKO A;  3HOS A;  1P4W A;  1BI2 A;  2RKH A;  2PJP A;  2STT A;  2OZU A;  4OMZ A;  2M45 A;  3M9A A;  3MZH A;  2CWE A;  3E5X A;  3J80 Z;  4LG0 A;  2J5O A;  2B0L A;  2XUB A;  1BOA A;  5HDG A;  5E17 F;  2XAH A;  2QLZ A;  2PEX A;  4HQE A;  2IJL A;  5FD5 A;  1R1V A;  5E1W A;  1IXR C;  2G7U A;  2GZW A;  2QQB A;  5LGT A;  4O6J A;  3JSP A;  5BPD A;  3U1D A;  4CHU A;  3BY6 A;  3IHU A;  1BJA A; 
#chains in the Genus database with same CATH topology
 2DFF A;  2WV1 A;  2N8G A;  3A01 B;  2YS9 A;  3ZCO A;  4AD9 A;  3MKY B;  2KZV A;  5EEA A;  5FRN A;  3L9F A;  1MBK A;  3SZT A;  2Z2S B;  3PO3 J;  2ZXH A;  3I3L A;  3F8C A;  4YRV A;  1R4M B;  2L4M A;  1MND A;  4L9N A;  3BZ6 A;  3C3W A;  2FUG 2;  3QYB A;  4B8X A;  3OIP A;  1YOV B;  2R5Z B;  1A35 A;  4CH7 A;  4XIC A;  2P0W A;  4B3X A;  5EEG A;  2QQ9 A;  3OS1 A;  4ZDP A;  4OIP F;  1R00 A;  5D5X B;  4U88 A;  2BXZ A;  3KX2 A;  4MQV A;  3TKY A;  2DO7 A;  1SVM A;  5HNH A;  4XN3 A;  5F27 A;  3A2K A;  1JI8 A;  1D1A A;  2MGQ A;  3JW4 A;  2XF6 A;  1A04 A;  3L7W A;  2RV8 A;  2EA4 A;  1LPQ A;  1LE8 A;  2A05 A;  3L2W A;  2EWN A;  3I71 A;  2CRG A;  5IP7 J;  3SDG A;  2L01 A;  1QRY A;  3GZN B;  3P5J A;  3LAJ A;  3CC2 I;  4DNC A;  2IS4 A;  1S72 I;  4IO9 F;  4CCM A;  3ROU A;  5L3D A;  3LSP A;  2ZFU A;  4IXA A;  4L5J A;  2BYV E;  4L18 B;  5DEQ A;  5EZH A;  5CQE A;  4RS8 A;  2F5F A;  4J00 A;  5M3M J;  2KRC A;  3DV8 A;  3PFI A;  4LG3 A;  4BBR J;  4DBR A;  2MW8 A;  2R0Q C;  4NHJ A;  3BTL A;  2KDO A;  1Z77 A;  1YI2 I;  3HOU J;  4A0X A;  3OYK A;  4BEH A;  5ICE A;  4HEA 2;  5M5Y J;  3GTJ J;  2HOA A;  4RAY A;  4LK0 F;  4IOA F;  3NRV A;  3EDP A;  3I54 A;  1NG6 A;  4C3I J;  1CF7 A;  3PSI A;  2CV2 A;  2ZCW A;  1SAX A;  4G94 A;  3DPT A;  1TT5 B;  4IQ4 A;  1EH7 A;  3K4K A;  3Q5F A;  4D9J A;  2CFX A;  3CUQ B;  2GWR A;  3G73 A;  1PUF B;  5K5R A;  4RLQ A;  3FM5 A;  4LIU A;  4QPO A;  1B9M A;  2W25 A;  2XRO A;  1WH7 A;  4YFK F;  3JTH A;  4F55 A;  3W2W A;  3T0Y A;  2TDX A;  3E5Q A;  1E17 A;  5KAF C;  1USS A;  1R23 A;  2BOL A;  5H2F C;  1RES A;  2MBF A;  4FIS A;  4HQM A;  5HDK A;  1Z3Y A;  4GXO A;  2MC3 A;  1SD5 A;  1UG0 A;  5E3O A;  1SAU A;  2XAG A;  3LSK A;  4XLP F;  3HRM A;  3ASN H;  3WGI A;  4NUB A;  4NDL A;  3KLN A;  1XDU A;  4EMS A;  1IXS B;  2KRF A;  3AG4 H;  2P4W A;  1TWH J;  3HHG A;  1BBY A;  2M3A A;  1XMX A;  3H36 A;  3LSH A;  3O6B B;  3IRR A;  2K4J A;  2E7X A;  3HRU A;  1WQ2 A;  5TRD A;  2DI3 A;  1H0M A;  2V1X A;  3CCL I;  4C30 A;  4ETS A;  1KQ0 A;  2DOE A;  2QEX I;  1YW9 A;  2ISZ A;  2VKH A;  2KL4 A;  4Y3O A;  1KYZ A;  4W1U A;  3OYE A;  3ZGK A;  2O5R A;  5FFZ A;  1ZN2 A;  4AIK A;  5FLX Z;  1QQI A;  3FXR A;  3VPR A;  3IV5 A;  3GF2 A;  3D5R C;  2GA1 A;  1KZH A;  3CME I;  2FD5 A;  4BDZ A;  1YO5 C;  1ETQ A;  3DTE A;  1GXP A;  4C2T A;  3CES A;  2GXB A;  5FLM J;  5LD2 C;  4Y7N J;  3T8T A;  4ZDL A;  4WF2 A;  4HSR A;  1BR2 A;  2JSP A;  3SDB A;  5A2Q Z;  3Q3S A;  1BW5 A;  3F22 A;  1VQ6 I;  4PGG A;  1C0W A;  2HVR A;  4XKC A;  2HQ5 A;  4KN7 X;  1KQ9 A;  1VQN I;  4OIR F;  3BG6 A;  3M3Y J;  4XLE A;  2PLY A;  3GFJ A;  3EUH A;  2FRH A;  3RTR A;  3H5A A;  3UR3 C;  4I99 C;  2ZME B;  2EPF A;  2FOK A;  5ICG A;  4HF1 A;  4BQN A;  4BY7 J;  3V7S A;  3LSG A;  1KON A;  2GBY A;  3BTJ A;  5J47 A;  3CP8 A;  4CYC B;  2PFB A;  3QPH A;  1R49 A;  2RN7 A;  3CUO A;  3MFK A;  1D8K A;  5DTD A;  1W0T A;  2DJI A;  4ANJ A;  1I6X A;  4AUX A;  2QBY A;  4NC7 A;  2LF8 A;  1ERD A;  1IGN A;  4UB8 C;  2AHQ A;  1D0X A;  4EJW A;  5FKN A;  2X4H A;  1AKH B;  4Q5S F;  1UG2 A;  2F48 A;  5HOD A;  1WI9 A;  1IJW C;  4FT8 A;  2O03 A;  4OWR B;  4G6T B;  3ZXS A;  4LGW A;  1IRF A;  1ON2 A;  1FC3 A;  2M4G A;  5IOZ A;  2KDZ A;  1TZL A;  1ZEL A;  3QOD A;  4J19 A;  1FBU A;  1WCM J;  1T2K A;  3BR3 A;  1GLN A;  1N78 A;  3GEZ A;  2ZSI B;  3H35 A;  4KA4 A;  3OL3 A;  1M1E B;  2FA5 A;  5B1B H;  5GTI C;  2Z9O A;  2Q2E B;  3KCC A;  5IOY A;  3HKZ A;  4HRI A;  3LFK A;  3FIW A;  1OCP A;  2MC4 A;  4PZJ A;  5EEH A;  1Y1V J;  3HRT A;  5DM7 F;  1RIO H;  2A6E F;  2OQG A;  1S7O A;  3S3M A;  3CTA A;  4OIN F;  1MBF A;  5DDG A;  1ZK8 A;  3EYY A;  3FMR A;  3O3K A;  2WB1 N;  4BHB A;  1Z1D A;  2LY1 A;  2DN0 A;  2PJR A;  3M8F A;  3HOW J;  1FOW A;  4ABZ A;  4C2M J;  3R6S A;  3TP3 A;  5D8K B;  1V54 H;  2IA1 A;  4L9J A;  1OIS A;  2HOE A;  4JK1 X;  5F1J A;  1W36 D;  2VPL A;  3LQQ A;  5M3F J;  3R60 A;  4ENJ A;  1HF0 A;  4XKW A;  1HOM A;  1NK3 P;  1GUU A;  3ZMU A;  5F0C A;  1EA3 A;  4FAS D;  5DUI A;  4YEJ A;  5C44 J;  2XGX A;  4P5O A;  2QSF X;  4D0P A;  3VYU B;  2KQR A;  3PIP F;  2BW3 A;  4IPA A;  4RAF A;  2ZSH B;  1B8I B;  3SHF A;  5F0H A;  2V9V A;  4GYI A;  4AC0 A;  2H8W A;  2JA2 A;  1YRN A;  1X1P A;  3BOQ A;  4HV5 A;  5JHF A;  3JAM Z;  4HF0 A;  3NEU A;  3E3V A;  4PSX A;  5BS6 A;  2QQ8 A;  1QHG A;  3DF8 A;  2V1D A;  3G2B A;  2ZKZ A;  3V42 A;  3JRI A;  1A6I A;  1QO0 D;  3BCA A;  3JSO A;  3CLQ A;  4OAZ A;  2A5Y B;  3CQZ J;  1GVJ A;  3P9K A;  3A02 A;  3GLX A;  1LVA A;  3HSR A;  1MSF C;  1F4K A;  4UNO A;  4OOI A;  2VBX A;  5J1U A;  1MW7 A;  3F8N A;  3A0B C;  4U0V A;  5FKO A;  1I5Z A;  2QUF A;  2ELK A;  2IGK A;  3BRO A;  5E20 A;  4XRS G;  4EJO A;  2LLK A;  3L2Q A;  2BHY A;  2DPU A;  3KEY A;  1DPU A;  3FBN B;  4A6E A;  1DGW Y;  3I4M J;  1Q1V A;  2DFH A;  3G1O A;  4U7D A;  4FE7 A;  4IRH A;  1VFC A;  5JLW A;  1P4X A;  3GTM J;  5CPR B;  1DP3 A;  1N75 A;  2B63 J;  1UAA A;  3KP4 A;  1GVD A;  4XQF A;  4YII A;  1ZKG A;  2WBM A;  3M4O J;  3I56 I;  2GLO A;  4HLX A;  4CGZ A;  2LYC A;  2JQ7 A;  3KEO A;  3C18 A;  3EUK L;  2IEK A;  3HBL A;  1LE8 B;  1SFX A;  2DFI A;  2QGU A;  5HS8 A;  2A61 A;  1SFO J;  1U8B A;  2YX7 A;  2Y69 H;  3OYB A;  2E1O A;  3L09 A;  4Z2Y A;  3GTL J;  4BUP A;  3E6D A;  4G7Z F;  4CZC A;  1R5I D;  3M8E A;  3GLL A;  4V2G A;  2OV7 A;  5E1X A;  3KFW X;  5CQG A;  1QZE A;  5DYM A;  3WG7 H;  2QBY B;  2P5K A;  3NWS A;  1R36 A;  3K1P A;  1W4M A;  4M73 A;  3WTX C;  2X6O A;  1ZHF A;  1T0F A;  1B9N A;  1UHS A;  3BT9 A;  1Z0X A;  1LJ9 A;  2L3D A;  2XF7 A;  2P81 A;  1FOY A;  3KP5 A;  3TOB A;  2R5Z A;  2LTP A;  4QWQ A;  4A2U A;  3S8P A;  4A3E J;  3F21 A;  2ZNY A;  4ENK A;  4D1Q A;  2RGV A;  3FHZ A;  2Y0M A;  4A93 J;  4JYK A;  3CO7 C;  1HQC A;  3R0A A;  5GPC A;  3ESW B;  3M8J A;  1D3Y A;  2K27 A;  3FK7 A;  4PUS A;  4MEY F;  4EQQ A;  4CDG A;  2MAB A;  4XRM A;  1K79 A;  2ECC A;  5EG0 A;  5F04 A;  3S2H J;  1W7P B;  3WTV C;  1BIB A;  5GPA A;  2DOA A;  1XGS A;  2F4O B;  4KIB A;  4CZZ A;  3COA C;  1T8I A;  4DW6 A;  1TLH B;  1ZGW A;  1ZG1 A;  3FBI B;  1Z91 A;  3JCU C;  1RNL A;  3JRE A;  3E0J B;  2XPV A;  2X1C A;  3MCZ A;  4LB5 A;  3TL4 X;  2VXD A;  2L0K A;  2OC6 A;  4XLC A;  1YTY A;  2RC4 A;  3IC7 A;  5LGU A;  4RM2 A;  4Z6Y A;  3F6V A;  3OSG A;  2EIK H;  3OS0 A;  4FET A;  1SEU A;  2IGN A;  1HC8 A;  2L9R A;  1BJZ A;  1J0R A;  2XGE A;  4A3K J;  4L9T A;  5JHU A;  2W24 A;  4RB2 C;  4NNJ A;  5KHD A;  1JHF A;  5HNF A;  1RZ4 A;  1YS7 A;  4PJ0 C;  2YU9 J;  3CDH A;  5L3G A;  2HDW A;  2XPW A;  2HVS A;  3GTO J;  3P7N A;  2RDP A;  2IA0 A;  1J5Y A;  2LMD A;  1A36 A;  3QRF F;  2EZI A;  1FTT A;  4M72 A;  1Z3X A;  4IF4 A;  2HS5 A;  2VC1 A;  2EV5 A;  3BJA A;  3KEQ A;  1B72 B;  2P8T A;  1MMS A;  2EV6 A;  3L00 A;  3RZO J;  4UVC A;  3DEE A;  4G7H F;  3HZJ A;  1OYY A;  2ID3 A;  1ZTR A;  4M9Z A;  2DYS H;  4E4H A;  1FBS A;  2H94 A;  5HOO A;  4MQ9 F;  2XPU A;  2YPR A;  1DP7 P;  4LG0 B;  2K9N A;  1NG7 A;  4AIH A;  1A6Q A;  2TCT A;  1H9T A;  2LY2 A;  3VDX A;  3WTW C;  2CFO A;  3K70 D;  3OV8 A;  2JWT A;  4QLC U;  3KET A;  4NC6 A;  2VAS A;  2KJB A;  2DA7 A;  3KLO A;  2PBI A;  5ED4 A;  1H89 C;  5IP9 J;  4RGR A;  1OCO H;  1S8N A;  3ASO H;  4A69 C;  2R92 J;  1G59 A;  3FHN A;  1VF9 A;  3RSN A;  2EFQ A;  3T8R A;  3RPU D;  4HG2 A;  4BXU A;  2FU4 A;  4DYQ A;  1WRJ A;  4AID A;  3BG7 A;  3U9G A;  1NHA A;  4W97 A;  2M1B A;  4JOM A;  1WJA A;  4QIW N;  1SVO A;  2XF5 A;  4E7K A;  4A3M J;  3PL8 A;  2LOO A;  3AFH A;  3J7A Y;  3OWT A;  2FNA A;  1LB2 A;  3BC8 A;  3GWZ A;  5D4S A;  5DCM A;  5LFA A;  2X6X A;  1FIP A;  1X3Z B;  2R7D A;  1L3L A;  2KT0 A;  4Y13 A;  4EV0 A;  2ZNZ A;  1FNN A;  1APL C;  2R5Y A;  3A0H C;  3RZD J;  1TNT A;  2E34 A;  1X3W B;  3ZQG A;  1UJ8 A;  1P92 A;  3CC7 I;  2GXG A;  4KFC A;  4CXF A;  2HYF A;  2AXT C;  5F08 A;  3ZMV A;  3PUB A;  4KMU X;  3PNV A;  4XLA A;  3E6C C;  4MNU A;  1X2M A;  2JZY A;  3W2V A;  2CW0 F;  1FOX A;  5FLV A;  2XDV A;  2ZJP F;  4RBO A;  5LHG A;  4CIC A;  5B3S H;  2ISY A;  5B1A H;  2E2I J;  3RPQ A;  3OYG A;  1BR4 A;  2W85 A;  3SFI A;  4IJA A;  3OYF A;  2ADU A;  3SFZ A;  5L3E A;  3GFL A;  2ETH A;  4UVB A;  1PP8 F;  1G3W A;  3GTP J;  3AL0 B;  2M30 A;  2EIN H;  5EGO A;  2A6T A;  3CJR B;  1OCR H;  2P6T A;  1LFU P;  2Q0O A;  3CDL A;  2NVQ J;  4Q47 A;  4M3G A;  3FM3 A;  2RQP A;  2ELJ A;  3QP5 A;  1FLI A;  3B6C A;  2CG4 A;  5H6R A;  3J7A O;  2M8G X;  3L2V A;  2HOS A;  1S7A A;  4QTR A;  1LUJ B;  3E97 A;  1VQM I;  5AIQ A;  3V7C A;  1Y0U A;  3WHB A;  5J8F A;  2HOT A;  2DXI A;  3IKV A;  1YQA A;  1WWX A;  1YLF A;  3H9G A;  2FQ3 A;  2GQQ A;  4BJT A;  1ZG5 A;  3S1N J;  1S5L C;  5AIP A;  4A5N A;  4RGS A;  4UXN A;  3DBR B;  3K70 C;  2XHK A;  2HPM A;  2CV0 A;  2WTE A;  2WAQ A;  4HOB A;  3I64 A;  4EM0 B;  3DEW A;  2KIQ A;  2E5Z A;  2YU3 A;  5EZG A;  3NQO A;  2X6W A;  2X51 A;  1ETW A;  5KAI C;  5JR3 A;  2DOF A;  3PUF A;  5F6F A;  2D1H A;  3TED A;  1NK2 P;  4GRI A;  4ZTF A;  2R7X A;  1W5C C;  2KHM A;  3I5U A;  4KDP A;  3VFZ A;  2FML A;  3A01 A;  2Z3Y A;  4P9F A;  4RLF A;  3RJP A;  4A3F J;  3G6E I;  4DYC A;  3KP6 A;  4G6D A;  3QP6 A;  2M7A A;  2HFH A;  2HTS A;  1LVK A;  3CC4 I;  1VQP I;  3D1N I;  3SEZ A;  2JA8 J;  4IEJ A;  2W00 A;  3ML6 A;  4EM2 A;  3E1S A;  3W6J B;  3NWT A;  2LD5 A;  3V8L A;  1P6R A;  2HR3 A;  4HV6 A;  4BQA A;  1RR7 A;  3Q0U A;  3LWF A;  3U2R A;  4IX7 A;  1AU7 A;  1XGN A;  2X1E A;  2LC2 A;  3ABK H;  4CA0 A;  1TW3 A;  1FYK A;  2VPR A;  1YJW I;  5K7H A;  1WJC A;  5FLX K;  2DMQ A;  5K1Y A;  1Z67 A;  4ZYH A;  4XLH A;  2LDU A;  1JKO C;  2XRL A;  4B09 A;  3PO2 J;  3RQ4 A;  2QCO A;  2VB6 A;  3IWZ A;  2XAS A;  1FT9 A;  2YX4 A;  2Z16 A;  3CJQ B;  4I02 A;  1BL0 A;  1ZRE A;  2VBW A;  2E5N A;  2FF4 A;  3KP2 A;  1T38 A;  2OBP A;  1DUX C;  3T5X A;  1VQL I;  2DT5 A;  1ON1 A;  1VND A;  3ZQF A;  2LY9 A;  5ILU A;  2HDC A;  4WX9 A;  1QA6 A;  4GDF A;  1O3Q A;  3EPZ A;  3CMY A;  1MMA A;  2F5E A;  3KZY A;  1S29 A;  2ZBK A;  1JJ6 C;  2L2O A;  4ENM A;  3FXL A;  5FO5 A;  1Y8R B;  3DKW A;  3SJM A;  1R22 A;  1T33 A;  2FNP A;  3HSF A;  3WG9 A;  3L2R A;  4IKF A;  4PJN A;  3HJE A;  2CO5 A;  2Z99 A;  5FRO A;  3WU0 A;  2R7S A;  2WWY A;  5B66 C;  5HLT A;  1I6H J;  4RAG A;  2VQL A;  4CCO A;  1QBJ A;  1WPK A;  3KZI C;  1OR7 C;  2K4B A;  1WJE A;  2B9S A;  4IZZ A;  2JUG A;  3PFY A;  4LIV A;  1OCC H;  4XID A;  4F91 B;  3S15 J;  4UV9 A;  1GV2 A;  3LAP A;  1LEA A;  3WU2 C;  2NYX A;  3DQV C;  1Z6T A;  1OCZ H;  4HA8 A;  2M4K A;  1SD6 A;  1O7F A;  2IVM A;  3C2H A;  3H0G J;  4X0G A;  1JUS A;  2E1M C;  2HQR A;  1VZ0 A;  1X1A A;  3L1P A;  4KNY A;  4UY8 I;  2O7O A;  1ZRF A;  1FP2 A;  2FXA A;  1E2X A;  3RYP A;  1HSJ A;  2VBZ A;  4GCV A;  3VSL A;  3L2U A;  1GDT A;  2KLO A;  5D6E A;  2RNJ A;  3S16 J;  4F7Z A;  3HL2 A;  1PUE E;  2OQR A;  1ITY A;  4WXC A;  4CSW A;  3IH3 A;  1LQ1 A;  2EQR A;  1RR8 C;  3I59 A;  1LDK B;  2VJI A;  1HCR A;  3OYD A;  3IP4 B;  4ZYG A;  5BOX A;  3I4N J;  2DOD A;  3VYS B;  4L0Y B;  3ZR8 X;  3J81 K;  1IN8 A;  1OYI A;  5M5X J;  2EFW A;  2M87 A;  3IAM 2;  1EV7 A;  3MAJ A;  1WI3 A;  2HXI A;  2OPT A;  2UXN A;  5F1R A;  1AWC A;  2G7H A;  1YE9 A;  3CUQ A;  1LFP A;  1FMV A;  4AVZ A;  2A68 F;  4ZTJ A;  2DA1 A;  4B43 A;  2WAF A;  2WA0 A;  3HC7 A;  2X0L A;  2CH0 A;  3J7Z I;  2ESH A;  2FSW A;  2BY2 A;  2JN6 A;  4LMY A;  3R4K A;  1KU3 A;  1FY7 A;  1TWG J;  3ZOB A;  2O61 A;  2VXZ A;  3U1K A;  2PG4 A;  4BU2 A;  2NOJ B;  2V7F A;  1KA8 A;  2QKL B;  1STZ A;  2VI6 A;  2HWV A;  2LH9 A;  4RA2 A;  1ETK A;  3BP8 A;  3NAR A;  4QPQ A;  4BHP A;  3QU3 A;  1VQO I;  2DLL A;  3RKX A;  2MFZ A;  4E7H A;  5EG0 B;  4AYB A;  2W7N A;  2Q1Z B;  1X1D A;  3GW2 A;  1G2H A;  1D5V A;  2LP0 A;  2MA3 A;  3CLO A;  3HDD A;  1HDD C;  2L7Z A;  2WV0 A;  4DQ2 A;  1OCT C;  2E2J J;  3BJO A;  2XIG A;  2UWM A;  1Z21 A;  5FGM A;  1LKX A;  1W5S A;  2DA6 A;  2VQG A;  3M1E A;  3UNG C;  3KYL A;  4V19 K;  3RQI A;  1ETY A;  4KIC A;  4IQJ A;  1FPQ A;  1B8I A;  3ZMD A;  1YFH A;  3CF5 F;  3ZMT A;  1U6G A;  3HGG A;  2E1C A;  5CVI A;  1LDJ A;  3O8G A;  4JBA A;  4LIT A;  3U21 A;  3GUD A;  1XGM A;  1Y39 A;  1E3P A;  1KU7 A;  2LSO A;  2XAU A;  3K69 A;  4NBQ A;  2VL8 A;  1HDP A;  1MSE C;  1EH6 A;  2WB1 A;  1O7L A;  3BJ6 A;  3H92 A;  5BMZ A;  5E3L A;  1V5F A;  5L3B A;  3HM5 A;  4IRI A;  5E8I A;  2QA4 I;  2X9D A;  1K78 B;  1IXC A;  2WY7 Q;  1A31 A;  2ELH A;  3B73 A;  5D5U B;  1X1B A;  1YW8 A;  1YYV A;  3LA3 A;  1WVR A;  2NXN B;  4XRF A;  3S17 J;  2VQH A;  4M3F A;  1ZAR A;  4I09 A;  4A3J J;  3RKY A;  3G4S I;  4BY1 J;  4Q48 A;  3HEF A;  1IUY A;  2JVH A;  2IA2 A;  4XRS A;  4G9Y A;  5IPA A;  2XKO A;  3K9T A;  1L0O C;  2AXL A;  2HDD A;  3CUQ C;  2EH3 A;  2H1L A;  1ORK A;  1V5E A;  1IO2 A;  4M3D A;  1RKT A;  1TWC J;  3DP7 A;  3E7L A;  3IWF A;  2CGP A;  3FXK A;  4C9Y A;  3CCQ I;  2Q2E A;  1V4R A;  1W7P D;  4I7H A;  2A5W A;  3WGH A;  2V4J C;  4J01 A;  1QZY A;  4IVN A;  3TMO A;  2IGO A;  1D0Z A;  3VEP A;  2HGC A;  1BI1 A;  4UUS B;  4U0W A;  3LSJ A;  4R79 A;  5EJC A;  2L7M P;  3H5R A;  2FX0 A;  4I98 B;  4B4C A;  4D5F A;  5EGO B;  1F9N A;  2ZFW A;  4WWC A;  3QPS A;  3E5U A;  3GZ5 A;  2LKX A;  2F4I A;  4KIG A;  3WE3 A;  2K3P A;  1A5J A;  2K85 A;  3BPV A;  3H1C A;  2HZD A;  2JA5 J;  1AOY A;  3QOE A;  4LB6 B;  4IHV A;  3RCO A;  3MVP A;  4PFP A;  2KMU A;  1UMQ A;  2XSJ C;  3CJT B;  2Y31 A;  4UUT A;  4EGY A;  1R9T J;  3HOZ J;  2HVQ A;  4MTE A;  4A0Y A;  1X4O A;  4CCL A;  2L7K A;  3J80 K;  2F5V A;  5BNG A;  2BE5 F;  1F5T A;  3I9V 2;  5F0F A;  2D2W A;  1KU2 A;  1HBX G;  1OQY A;  2C6Y A;  3JRG A;  3I53 A;  1HKT A;  1W1W E;  2LFB A;  1G3Y A;  3MKW B;  3WTU C;  3WTT C;  3ECO A;  2DA4 A;  4ASN A;  1U9O A;  2MD5 A;  3JRF A;  1P4A A;  2DT6 A;  1SD7 A;  4ENN A;  4ON0 A;  1LEB A;  1QPI A;  3TQN A;  2D45 A;  2JVG A;  2GXA A;  3V4G A;  1PDN C;  3LQR A;  2DAO A;  4A3G J;  1JT6 A;  1MH3 A;  2K9L A;  3DWL E;  2PJR B;  3FX3 A;  3W6V A;  1MD0 A;  4BJ6 C;  1OPC A;  5L3C A;  2STW A;  5CLS A;  2K9Q A;  6PAX A;  4C3J J;  1XB4 A;  3DXJ F;  3F0C A;  2XAQ A;  2DTR A;  2BY0 A;  3MKL A;  1RKW A;  4F52 A;  5J8C A;  4BAC A;  1KU9 A;  4BE0 A;  5DD4 A;  1MH4 A;  2BHZ A;  4BS9 A;  2EFO A;  2A07 F;  1FTZ A;  1ZLJ A;  3DPL C;  3OIQ A;  5FD6 A;  2ZME C;  5CYV A;  2Y2Z A;  3HOV J;  3HUG B;  1U0J A;  4XOP A;  4PCQ A;  3F23 A;  3M1C A;  3PIO F;  4BXF A;  1WZ2 A;  3G1L A;  4II2 A;  2OUM A;  3HTU A;  4LJZ F;  5GP9 A;  5J40 A;  3JR9 A;  2BXY A;  3BTI A;  1B72 A;  1ZGJ A;  2WAQ N;  3BCB A;  1BC8 C;  5GAH J;  2M7B A;  1IG7 A;  1TNS A;  2IGM A;  1ZRC A;  3E6M A;  3KE2 A;  4NC8 A;  4IHX A;  2NS7 A;  2XV4 S;  2HEO A;  5DD8 A;  1YX3 A;  2VE8 A;  3WHC A;  2MYS A;  4H4K C;  3HRS A;  3TOA A;  2Y0S N;  3ZQQ A;  1O3T A;  2DMT A;  2QWW A;  5HVQ C;  3CCU I;  4O3M A;  2EA2 A;  2VE9 A;  4BHC A;  2K9S A;  4MIM A;  3BR5 A;  3BZK A;  5EYR A;  3ZPL A;  2XRN A;  3AG1 H;  4MGR A;  4KIT B;  2Z33 A;  2F5D A;  2YUS A;  5IY5 H;  2O6G E;  3BG9 A;  3C2G A;  3MMY B;  2X1D A;  2R7Q A;  4L5I A;  2HKO A;  1P7J A;  1U3E M;  4EM1 A;  3TO7 A;  3O2P E;  5TJJ A;  5E3N A;  3OYM A;  5J1R A;  1P9Q C;  3SQN A;  3S32 A;  2HKX A;  3J7Y J;  1K83 J;  2IBD A;  2IT0 A;  3GZ6 A;  2UZK A;  4EVI A;  4IL6 C;  2KIF A;  1MBJ A;  1EKE A;  2LBF A;  5FFX A;  4X6A J;  1DDN A;  3K1M A;  2NNN A;  1XDS A;  2JSC A;  5HLH A;  1FZP B;  2HYG D;  1QGP A;  1EH8 A;  3ISP A;  5M5W J;  2JK3 A;  4BAY A;  4B3A A;  1RUO A;  5EDN A;  2DDA A;  4CYD A;  2HU9 A;  3ABT A;  3P9C A;  3MEX A;  1TQM A;  3OYL A;  5F64 A;  1MBH A;  1XD7 A;  2CUF A;  1VI0 A;  4IHS A;  2MD0 A;  2JRM A;  1K4T A;  5H6Q A;  1XPX A;  3JRA A;  1Z7L A;  5L3F A;  4F93 B;  3GBG A;  4H0E A;  2ECB A;  3CP2 A;  3MQ0 A;  1REP C;  2O8X A;  1YIJ I;  1TQP A;  2MH9 A;  1T56 A;  2CW7 A;  4EAT A;  5J1Y A;  2CW8 A;  1R4N B;  4ESB A;  5D5V B;  4B1R A;  2W1O A;  2CS3 A;  3F3X A;  5LEK A;  5FKK A;  1ZH5 A;  4I6Z A;  1FYL A;  4DIQ A;  1FOK A;  1UHW A;  3FKI J;  3ZN1 A;  5IYB J;  1AHD P;  3KIO A;  1MNE A;  3F72 A;  3C2B A;  2KFD A;  3E6B A;  2XAJ A;  4BQQ A;  4RGX A;  4Y33 A;  5LRS A;  1TC3 C;  5HDN A;  2E1N A;  4CO8 A;  5J3L A;  2NVY J;  3Q9V A;  4PJM A;  2CUZ A;  1YX5 A;  5DUK A;  4UUS A;  4BQO A;  4A6D A;  4CCN A;  4P96 A;  3BR2 A;  3B6A A;  2HI3 A;  1F1Z A;  2RNG A;  3SYT A;  1JT0 A;  5HS9 A;  1U5T A;  2E35 A;  1UHM A;  3CJN A;  4RDU A;  2ESN A;  2F5C A;  3H3Z A;  4HNV A;  4JX5 A;  5K5Q A;  1IW7 F;  3ZQI A;  3DLL F;  2PI0 A;  3OSF A;  1X1C A;  3FXO A;  5IT9 Z;  3PQK A;  3PSF A;  2L02 A;  4DZJ A;  2JPC A;  4I0A A;  1S9H A;  1TW2 A;  2WAD A;  3K4M A;  4D7M A;  2H27 A;  2JA7 J;  2E36 A;  4N0B A;  1NH3 A;  5C4X J;  3CCS I;  2LRD A;  3H3U A;  1ZGA A;  2JPB A;  1RI7 A;  3K4J A;  3OYC A;  5J4Y A;  3ZMZ A;  3BQY A;  5DCF A;  4A5M A;  2K40 A;  3ZN0 A;  4I01 A;  1BN5 A;  2QYO A;  1IC8 A;  2BVM A;  4U0Y A;  3N97 A;  5CJ9 A;  5GAE J;  2VIX A;  1ONV A;  1DQU A;  3W2A A;  2M0C A;  4MO7 A;  2KP6 A;  1Y56 A;  1CGP A;  1G3T A;  2IAI A;  2LKS A;  1IRZ A;  1I27 A;  1QVT A;  2DMU A;  2RVC A;  4GYG A;  3DFG A;  5H20 A;  4UUV A;  1DPR A;  1O3R A;  4I2O A;  4Y4R A;  3M7G A;  2XGC A;  4HST A;  4AWX B;  3GFM A;  1QHH D;  4CCJ A;  4G8X A;  4A3B J;  1ZG3 A;  2DK8 A;  4YEL A;  3RDI A;  1U5T B;  3EUA A;  3A03 A;  3FIS A;  3TDZ C;  5LEJ A;  3CDI A;  1ENH A;  2W57 A;  4Y15 A;  2FBH A;  2FJ1 A;  1I3Q J;  3BLY A;  2EK5 A;  1TL8 A;  3DEU A;  3C1D A;  3VYT B;  3PJR A;  2DW4 A;  4E7Z A;  3K4N A;  1XC5 A;  3TGN A;  2O8K A;  4AM3 A;  2R7V A;  3BR0 A;  1Z6R A;  5DV5 A;  3PNT A;  2LBF B;  2DDB A;  1FSE A;  1WSU A;  4ESF A;  1X19 A;  3S2W A;  2K86 A;  4P1W A;  4DGW B;  2NVU B;  4OMY A;  3HGY A;  1R1T A;  1HKQ A;  2I5U A;  4OIO F;  4G6Q A;  1RPW A;  1T0F C;  4M74 A;  4QSH A;  2XGD A;  4MFD A;  4G12 A;  4U7B A;  1JTX A;  2E7W A;  3IKT A;  4KT5 C;  3FMQ A;  2XAF A;  2W48 A;  2R7O A;  3QU6 A;  4BEH B;  3QWL A;  3HKZ N;  1YW7 A;  4BGD A;  1QPM A;  5K5O A;  1VTN C;  1D1C A;  1LNW A;  1JJ8 C;  2MH2 A;  3JRC A;  2CQ7 A;  2GA2 A;  3QYF A;  4KT6 A;  4PK4 A;  4S05 A;  2XB5 A;  3CCE I;  1U2W A;  3FMS A;  2IXS A;  3ZMS A;  2V9K A;  2RQQ A;  4FX0 A;  3BTC A;  1SC7 A;  1SFU A;  1FEX A;  2ZJR F;  1JGG A;  3EYI A;  2BVL A;  3GME A;  3R61 A;  5C4J J;  1BM9 A;  2JTV A;  4KMF A;  2FBK A;  2CSO A;  4FQG A;  1JGS A;  4MLO A;  2XC7 A;  2NRA C;  4DZP A;  3LSI A;  2KIM A;  4ZJZ A;  1OMI A;  3ULQ B;  4Y52 J;  3H5N A;  1XSV A;  2MLG A;  2NNY A;  3DPU A;  1TP4 A;  1G8X A;  2GAU A;  4HYE A;  1PJR A;  1IRX A;  3K0L A;  3K2Z A;  3ABL H;  3F8B A;  5IT3 A;  3FF5 A;  5FRM A;  3GXO A;  2VN2 A;  4M71 A;  1MMN A;  2FMY A;  2X48 A;  1T6S A;  3K6G A;  2R93 J;  2QSH X;  1UST A;  1MJ9 A;  2A69 F;  4K2E A;  2A6H F;  2O9L A;  2LR8 A;  2L9N A;  2XKP A;  3A4C A;  5D5W B;  1TT0 A;  2OTL I;  3BR1 A;  5B5E C;  4LOC A;  3S1M J;  1W36 C;  1FSH A;  5ICF A;  5ICC A;  1GT0 C;  1HW2 A;  1EF4 A;  4G7O F;  1J2X A;  3PM1 A;  5E1Z B;  3CMM A;  1WJ5 A;  1UEL B;  2COB A;  4HNU A;  2OZ6 A;  2JUC A;  2QM3 A;  2IS1 A;  4JX4 A;  1I39 A;  1WH5 A;  2YR2 A;  5CVV A;  3LA2 A;  1ZR4 A;  1W5T A;  1HW5 A;  4DOZ A;  1P7I A;  4KJZ A;  4ZZD A;  3VOE A;  2GIZ A;  1ETX A;  1HLV A;  2VON A;  1IAW A;  1DU0 A;  5TIS C;  3EUH C;  5KVR A;  3N4M A;  1T98 A;  4OIQ F;  1CQT A;  1MMG A;  2E2H J;  2OA4 A;  2IP2 A;  4HW0 A;  3BDD A;  3QPT A;  2LKP A;  4XR6 A;  1ETO A;  1IRG A;  4ZYA A;  2ME0 A;  3D5S C;  5C3E J;  2HZT A;  2M2E A;  4N9I A;  4L0Z B;  2G9W A;  4XOT A;  2EV0 A;  1T39 A;  4FHT A;  4ZZL A;  2QF7 A;  5ILS A;  4BE2 A;  1J59 A;  1B1B A;  2TRT A;  1YIT I;  3ZQC A;  1J09 A;  5E8G A;  3NAU A;  3G1M A;  4ZH4 F;  3DU5 A;  1LFB A;  1K78 A;  1MBE A;  2P5V A;  1Z9C A;  2M34 A;  1YRN B;  5TGT A;  2LVS A;  2WC2 A;  1JTY A;  2BEO A;  3RKQ A;  1DU6 A;  4UHT A;  2CQX A;  4XL9 A;  2NS8 A;  2V79 A;  4X1E A;  3BZC A;  2ICW G;  4R8H A;  3BQZ A;  2DTZ A;  2CMP A;  4A0Z A;  1FX7 A;  2M9H A;  1QNT A;  3CCM I;  1TQI A;  1I50 J;  2KPM A;  5HLG A;  5KCM A;  2DPD A;  3GVA A;  1IN7 A;  4MHG A;  3HIF A;  2QEN A;  4LLN A;  2VC0 A;  3S1Q J;  4V2F A;  3SEQ A;  2QVO A;  4WXH A;  4XSZ F;  4CCK A;  1IN4 A;  3HOT A;  1I1G A;  1P2F A;  4XKB A;  2G0E A;  1XSX A;  4JP0 A;  2O3F A;  1MJA A;  4OAY A;  3IUO A;  3FXQ A;  4HNT A;  2DMN A;  3TP0 A;  1FYM A;  2E71 A;  2BY3 A;  5FKL A;  3JAM K;  1V5G A;  5CVR A;  3RIR A;  1BW6 A;  2Y75 A;  1SMT A;  3F6O A;  2EZH A;  1PP7 U;  1MDM B;  3QAH A;  3TO9 A;  2COM A;  4NQW A;  3DCF A;  1RET A;  1MNM C;  2L7F P;  4FX4 A;  4A3D J;  3GX4 X;  1UCR A;  1XSD A;  1D1B A;  5K7Z A;  3FZV A;  1IDY A;  1K6Y A;  3TBI A;  3VSK A;  4R1H A;  5E18 F;  1X3U A;  2BY1 A;  4IHT A;  4YIR X;  4IHY A;  4GFB A;  2K9M A;  2BZT A;  2AO9 A;  2JRT A;  3VOD A;  4N4N B;  2VT3 A;  1CF7 B;  2VKE A;  2A3S A;  3DLA A;  1S6L A;  1MKM A;  3BG5 A;  2DK5 A;  3MN2 A;  3JTG A;  4B47 A;  1X4P A;  2L5Q A;  2V1N A;  4GO1 A;  4C2U A;  2LG4 A;  5IP6 A;  5IYD J;  5AON A;  1H9G A;  3OOP A;  2RAE A;  5HS7 A;  2KZG A;  1HKS A;  1OLT A;  2DU9 A;  1BA5 A;  3ECH A;  2CYY A;  1B4A A;  5FJ8 J;  5IT9 K;  2F2E A;  2NVX J;  3R0J A;  4BKX A;  1SD4 A;  3RKW A;  3BWG A;  2R7R A;  4HX7 A;  5KK1 A;  4N9H A;  3ZQL A;  1ZLK A;  3LMM A;  2CU7 A;  1V3F A;  4JQF A;  3DKX A;  2VQC A;  3OR2 C;  3FK6 A;  2HYJ A;  2MLK A;  3GFI A;  2Y48 A;  4M3B A;  1U78 A;  4XNF A;  3BR6 A;  3DBL B;  2DFE A;  1MZB A;  3QOP A;  3EET A;  3ERE D;  5JVG F;  2R7Z J;  2L9S A;  3BPX A;  2H6B A;  1VQ7 I;  1ULY A;  3H3V K;  3A1Y A;  4YFN F;  1AA7 A;  4NQW B;  4F3Q A;  5GAG J;  1BI0 A;  3IAS 2;  1BOB A;  3L2C A;  3ERM A;  4HX4 A;  1JKR C;  4YIF A;  1MDM A;  3GO5 A;  1GXQ A;  2HNH A;  4DJA A;  3P9I A;  2V1U A;  1G6N A;  3FXU A;  3MZY A;  2M8E A;  2EIL H;  1B6A A;  3B02 A;  1UB9 A;  1SFK A;  2O0Y A;  2XVC A;  2VOD A;  3JRH A;  1YJN I;  2EFP A;  2UV1 A;  4LLG F;  3I0T A;  2F6C A;  2K5C A;  3I58 A;  3KPH A;  1JE8 A;  2H8R A;  4LFU A;  4FE4 A;  3S14 J;  2MSY A;  3ZRG A;  4XSX F;  1IN5 A;  4M6X A;  4A3C J;  3OS2 A;  4BL0 B;  1K6O A;  3CCR I;  2VJ5 A;  1OKR A;  2X85 A;  2I10 A;  2K7L A;  3K7A J;  3LOC A;  1ZR2 A;  3M07 A;  2W82 A;  1XMK A;  1YS6 A;  2ZXI A;  2R4G A;  3AG2 H;  5D6F A;  3CMA I;  4LK1 F;  2V6C A;  2L9V A;  4B48 A;  5J6X A;  1Y8Q B;  3PNY A;  2H1K A;  5DS9 A;  2ZME A;  1T95 A;  4S04 A;  1N77 A;  1MIJ A;  1XS9 A;  3WU1 B;  2EB7 A;  2W84 A;  4ITV A;  2DA5 A;  1KGS A;  1XCB A;  3AAF A;  1JXS A;  4EEF G;  2BBY A;  3FKJ A;  1MBG A;  2H09 A;  1XX5 A;  4HX8 A;  3V8J A;  4MEX F;  2PMZ N;  1KYW A;  4MTD A;  2VJ4 A;  2FQ4 A;  1KQ8 A;  2CUE A;  5HLI A;  3LSR A;  4E70 A;  1U9N A;  3HXL A;  2EZK A;  3LNQ A;  2DQL A;  4I0B A;  2E60 A;  4RGU A;  4DBQ A;  4DYR A;  4HDU A;  2DYR H;  2UXX A;  3I4P A;  2QQA A;  1RRJ A;  3RYR A;  5LRR A;  3HYI A;  2DT7 B;  1RUN A;  3KP3 A;  1K7A A;  2R7T A;  3H9J A;  1ZAO A;  3WGG A;  2XSD C;  1MMD A;  1TWA J;  2WY8 Q;  2BV6 A;  4KYW A;  1BR1 A;  2M5W A;  1TTY A;  5LHH A;  2CV1 A;  3ABM H;  1IN6 A;  2OCE A;  4A3L J;  1BI3 A;  2Z1D A;  1SFE A;  3DTI A;  4EJT A;  1XN7 A;  4UV8 A;  2VBY A;  1FBQ A;  2HTJ A;  1E3H A;  1WJB A;  5LBQ A;  2P5L C;  2Z5U A;  3KZZ A;  4RB0 A;  1F43 A;  2NOG A;  1SVL A;  2QKM B;  2VUM J;  2EBI A;  1O4X A;  3HB9 A;  1T08 B;  1QZZ A;  4A12 A;  4XM3 A;  3LA7 A;  3SZP A;  5ILV A;  4M9S A;  2L4A A;  1GHC A;  4M3E A;  3N05 A;  1R5H A;  1TBX A;  3F8M A;  5LHI A;  2D1V A;  1HXD A;  4KIS A;  4NB5 A;  4WXD A;  1XMA A;  1H88 C;  1K4S A;  1PYV A;  4KIF A;  2HXO A;  4XMY A;  4XLN F;  3QPL A;  3KYC B;  1IF1 A;  2PQ8 A;  2ZC2 A;  4TV7 A;  4JX6 A;  2DQR A;  5K7F A;  4ZDO A;  2FE3 A;  1VQ9 I;  3Q9S A;  1FP1 D;  2L54 A;  1WFX A;  1E0E A;  1BC7 C;  2R7F A;  4HPQ A;  3S1R J;  5JI6 A;  3OL4 A;  3DBH B;  4D5C A;  3LST A;  4HDV A;  2R7U A;  3I59 B;  2XB0 X;  4PFO A;  1OR7 A;  2OCC H;  1VQK I;  3S3O A;  1ACI A;  3ABU A;  2AS5 F;  1JHH A;  5A2Q K;  3DKY A;  1D0Y A;  2ID6 A;  3K10 A;  2OTJ I;  3ZP5 A;  4UVA A;  1VQ8 I;  3IRQ A;  1B59 A;  1H8A C;  2IS6 A;  3LFU A;  1FMW A;  1E3O C;  4L9V A;  1O57 A;  4HAM A;  5CVJ A;  1HST A;  3K1N A;  3REO A;  4M6Y A;  3KP7 A;  4II3 A;  4EJV A;  1ZRD A;  5LGN A;  2J5P A;  3CCY A;  2PMH A;  3TW7 A;  1J9I A;  3W3C A;  1YIO A;  2ZB9 A;  2WAE A;  2UUZ A;  5CKT A;  4GGG A;  2IPQ X;  3FWE A;  4ESJ A;  4CUG A;  4UB6 C;  4XKV A;  4XN0 A;  1PUF A;  1S3J A;  2LNB A;  2NVT J;  2MG4 A;  3QYE A;  1WJF A;  1FWZ A;  2ZXJ A;  1EJ9 A;  2EZL A;  4P55 A;  2K3F A;  1N25 A;  4KN4 X;  3O8H A;  2Q8K A;  3OYA A;  2ACJ A;  4IOC F;  4RMN A;  1MGT A;  3CF2 A;  3GCM A;  3V7R A;  3WTZ A;  1FJL A;  2NAZ A;  4BDY A;  1FIA A;  2IRF G;  2FOW A;  3WTY C;  2OD5 A;  3FXJ A;  3K4C A;  3IL2 A;  1OJL A;  5BPI A;  4F92 B;  1PVE A;  2NS0 A;  1YJ9 I;  2F4M B;  3FXM A;  3OMY A;  2FBI A;  2V9P A;  3ONQ A;  2ZJQ F;  2E19 A;  2IW5 A;  2PMU A;  2LK2 A;  3LSM A;  3JRD A;  3CZ6 A;  4WCG A;  4PJJ A;  2Y9Y A;  3GYH X;  1G4D A;  5CVU A;  3TO6 A;  2QSG X;  1JUM A;  3DU6 A;  1OYW A;  4YFX F;  1F36 A;  3HPG A;  2R3S A;  3F8F A;  5D4R A;  1R5G A;  2DCE A;  2DJN A;  3H9Q A;  4Q4Z F;  3ELK A;  1JKP C;  3IH2 A;  5FKM A;  2CUJ A;  4S0H B;  4XLF A;  3CD6 I;  1X2N A;  3HOX J;  2HQN A;  1XCV A;  3VB2 A;  1D8J A;  1O3S A;  3S2D J;  3QQA A;  1I1S A;  1Z7U A;  1J7K A;  2VOP A;  2DBB A;  3PQJ A;  4I76 A;  1V55 H;  2P6S A;  1MJB A;  3CCV I;  3VWB A;  3SXY A;  2CQK A;  4XBF A;  1QVU A;  3CCJ I;  2JA6 J;  2EFN A;  2M0M A;  1W7P A;  3J81 Z;  2BGC A;  1ZYR F;  2P7V B;  4RB1 A;  2YSR A;  4ZYD A;  3MD2 A;  1Z05 A;  2CJJ A;  3KYD B;  3DTK A;  4HBL A;  1NTC A;  3Q0V A;  5ERI A;  3WE2 A;  2X6Y A;  3WTS C;  1TWF J;  5E79 C;  5JLX A;  4XOR A;  1IUF A;  1Y6I A;  1Y0N A;  3UKG A;  1IDZ A;  2DA3 A;  3TW6 A;  3OYI A;  1WKM A;  3AG3 H;  1JKQ C;  2ZJ2 A;  2BW3 B;  3MWM A;  5EF6 A;  5IYC J;  3K4L A;  2VOO A;  2D5V A;  3HHH A;  4KUM A;  3HPH A;  2LF7 A;  3IH4 A;  2VJJ A;  3I55 I;  4CYC A;  1BIA A;  4IRG A;  5E3M A;  2JMW A;  3G71 I;  2OJE D;  4RB3 C;  3MZ8 A;  4RM3 A;  1VQ5 I;  2FEZ A;  1OFC X;  1POG A;  3CO6 C;  2ME6 A;  2AQE A;  2W4S A;  2KJC A;  3RPU A;  3T1B A;  2Y30 A;  3X2Q H;  1UZC A;  1R7J A;  4HF2 A;  2VT2 A;  1U8R A;  2KIU A;  2P7C B;  1ZQ3 P;  2B7E A;  2R7W A;  2HPI A;  2GM4 A;  1Y1W J;  3GTQ J;  3OIO A;  3ZQH A;  5GAD J;  4C3H J;  1QU3 A;  1R1U A;  2K02 A;  4PDK A;  1AKH A;  3WOD F;  2KIS A;  2ZXW H;  3V8K A;  2R5Y B;  4OU0 A;  4BXX J;  2GOM A;  2I8D A;  3EQL F;  1R6R A;  4PJL A;  1SAN A;  4YG2 F;  1R58 A;  4U87 A;  4M9X A;  3ZQ7 A;  4D7N A;  4HLY A;  3RI4 A;  4BE1 A;  1VQ4 I;  4ZYE A;  3BG3 A;  4B44 A;  4BYY A;  3K2A A;  1G3S A;  3D5L A;  4BH9 A;  4HZF A;  3HTS B;  4PGH A;  2LRE A;  2H6C A;  2AQF A;  4XON A;  4EGZ A;  1YG2 A;  4A3I J;  1R71 A;  2VKV A;  3FDY A;  1UFM A;  2Y0S A;  3OYH A;  2JT1 A;  1GV5 A;  4RAZ A;  5LLQ A;  4N4O B;  3S3N A;  4EJU A;  2ZO4 A;  1DGR M;  2GIV A;  3C7J A;  5KNL A;  4AVP A;  4WK8 F;  2CQQ A;  2CQN A;  4LD5 A;  1J75 A;  9ANT A;  2E1M B;  4AYB N;  3HUG A;  5D8L B;  1U5T C;  5JFR A;  4FTH A;  2KRH A;  3OYJ A;  4BNC A;  5BQT A;  1WGX A;  4PSW A;  5DCM B;  3G3Z A;  3VYR B;  1LDD A;  1HW1 A;  2DMP A;  3S93 A;  1D5Y A;  2DA2 A;  1JUP A;  3K4B A;  4Y17 A;  1WHU A;  1WJD A;  5DM6 F;  2PN6 A;  4FCY A;  2EJR A;  3JRB A;  4AIJ A;  1XGO A;  3HOY J;  3W6K B;  1ETV A;  3HSE A;  1RC9 A;  2V26 A;  1SMY F;  2OF7 A;  1XTA A;  2OAZ A;  3OR1 C;  1S7E A;  1ODD A;  3F9K A;  1Q1H A;  3H0D A;  4E7S A;  2QZ8 A;  1IZ1 A;  4M6V A;  1K61 A;  4E7I A;  5FB2 A;  2OU2 A;  3TDU C;  5JVT A;  4O5V A;  4L5E A;  2VKD A;  4P9U A;  4LLL A;  3AKZ A;  3D0S A;  1IV6 A;  2KKO A;  3HOS A;  1P4W A;  4E7J A;  3HG9 A;  4MFE A;  1BI2 A;  2HQA A;  2RKH A;  3Q0W A;  3MKZ A;  4E7L A;  4ZC3 A;  2STT A;  2PJP A;  4BJ5 C;  5J4V A;  2OZU A;  4E6K G;  4OMZ A;  3GTK J;  3OY9 A;  2M45 A;  3M9A A;  2RRE A;  3LL7 A;  2PMZ A;  3MZH A;  2JJ7 A;  4XK4 A;  2VLA A;  2CWE A;  3E5X A;  3OOU A;  3J80 Z;  3SZG A;  4IHW A;  1XG1 A;  4LG0 A;  4AU7 A;  2J5O A;  5GTH C;  2EIM H;  2B0L A;  2XUB A;  1BOA A;  1W0U A;  5HDG A;  5E17 F;  1HA8 A;  2EIJ H;  2XAH A;  2QLZ A;  3AL0 C;  2PEX A;  4HQE A;  2IJL A;  5FD5 A;  1I3A A;  1R1V A;  5E1W A;  2Y9Z A;  1IXR C;  3OYN A;  2G7U A;  2GZW A;  1IV8 A;  2QQB A;  5LGT A;  4BBS J;  2PX9 A;  4O6J A;  3JSP A;  1YHQ I;  5BPD A;  3GTG J;  2IS2 A;  3U1D A;  4CHU A;  3BY6 A;  1X58 A;  3IHU A;  2GOX B;  1BJA A;  2V6E A; 
#chains in the Genus database with same CATH homology
 4AD9 A;  3L9F A;  3SZT A;  3F8C A;  2L4M A;  4L9N A;  3BZ6 A;  3C3W A;  4B8X A;  5EEG A;  2QQ9 A;  4OIP F;  1R00 A;  5D5X B;  4U88 A;  4MQV A;  3TKY A;  2DO7 A;  3JW4 A;  1A04 A;  3L7W A;  2RV8 A;  2EA4 A;  2EWN A;  3I71 A;  2L01 A;  3LAJ A;  4DNC A;  3ROU A;  5L3D A;  4IXA A;  4L5J A;  2BYV E;  4L18 B;  5DEQ A;  4RS8 A;  2F5F A;  3DV8 A;  3PFI A;  4NHJ A;  4A0X A;  5ICE A;  4RAY A;  4LK0 F;  3NRV A;  3EDP A;  3I54 A;  1CF7 A;  2ZCW A;  1SAX A;  4G94 A;  3DPT A;  1EH7 A;  3Q5F A;  3G73 A;  2CFX A;  3CUQ B;  2GWR A;  5K5R A;  3FM5 A;  1B9M A;  2W25 A;  2XRO A;  4YFK F;  3JTH A;  3T0Y A;  2TDX A;  3E5Q A;  1E17 A;  1USS A;  1R23 A;  2MBF A;  4HQM A;  5HDK A;  4GXO A;  2MC3 A;  1SD5 A;  2XAG A;  4XLP F;  3HRM A;  3WGI A;  3KLN A;  1XDU A;  4EMS A;  1IXS B;  2KRF A;  2P4W A;  1BBY A;  3HHG A;  3O6B B;  3IRR A;  2K4J A;  2E7X A;  3HRU A;  1WQ2 A;  5TRD A;  2DI3 A;  1H0M A;  2V1X A;  4ETS A;  1KQ0 A;  1YW9 A;  2ISZ A;  1KYZ A;  5FFZ A;  1ZN2 A;  4AIK A;  5FLX Z;  1QQI A;  3FXR A;  3GF2 A;  2GA1 A;  1YO5 C;  1GXP A;  2GXB A;  3T8T A;  4WF2 A;  5A2Q Z;  3F22 A;  4PGG A;  1C0W A;  4KN7 X;  1KQ9 A;  4OIR F;  2PLY A;  3GFJ A;  3EUH A;  2FRH A;  3RTR A;  2ZME B;  2FOK A;  5ICG A;  4HF1 A;  3V7S A;  2PFB A;  3QPH A;  2RN7 A;  3CUO A;  3MFK A;  1D8K A;  1I6X A;  2QBY A;  2LF8 A;  4EJW A;  2X4H A;  4Q5S F;  1WI9 A;  4FT8 A;  2O03 A;  4LGW A;  1IRF A;  1ON2 A;  1FC3 A;  1FBU A;  1T2K A;  3GEZ A;  4KA4 A;  2FA5 A;  2Z9O A;  3KCC A;  3LFK A;  4PZJ A;  5EEH A;  3HRT A;  1RIO H;  2A6E F;  2OQG A;  1S7O A;  3CTA A;  4OIN F;  5DDG A;  3EYY A;  3FMR A;  3O3K A;  4BHB A;  1Z1D A;  3M8F A;  3R6S A;  5D8K B;  2IA1 A;  4L9J A;  2HOE A;  4JK1 X;  3LQQ A;  4ENJ A;  3R60 A;  5DUI A;  3ZMU A;  2XGX A;  4P5O A;  4D0P A;  4IPA A;  3SHF A;  2V9V A;  4GYI A;  3BOQ A;  4HV5 A;  3JAM Z;  4HF0 A;  3NEU A;  3E3V A;  5BS6 A;  3DF8 A;  2V1D A;  2ZKZ A;  1QO0 D;  3JSO A;  2A5Y B;  1GVJ A;  3P9K A;  3GLX A;  1LVA A;  3HSR A;  1F4K A;  4UNO A;  4OOI A;  2VBX A;  3F8N A;  4U0V A;  1I5Z A;  2QUF A;  3BRO A;  5E20 A;  4EJO A;  1DPU A;  2DPU A;  4A6E A;  4U7D A;  4IRH A;  1P4X A;  3KP4 A;  4YII A;  4HLX A;  4CGZ A;  3KEO A;  3C18 A;  1SFX A;  2DFI A;  5HS8 A;  2A61 A;  2YX7 A;  3L09 A;  4Z2Y A;  3E6D A;  4G7Z F;  3M8E A;  5E1X A;  3KFW X;  5DYM A;  2QBY B;  2P5K A;  1R36 A;  3K1P A;  1W4M A;  4M73 A;  3WTX C;  1ZHF A;  1T0F A;  1B9N A;  1LJ9 A;  2L3D A;  3KP5 A;  3TOB A;  4QWQ A;  4A2U A;  3F21 A;  2ZNY A;  4ENK A;  2RGV A;  3FHZ A;  2Y0M A;  3CO7 C;  1HQC A;  3R0A A;  1D3Y A;  2K27 A;  4MEY F;  4EQQ A;  4CDG A;  1K79 A;  1W7P B;  3WTV C;  1BIB A;  3COA C;  1XGS A;  4KIB A;  4CZZ A;  1TLH B;  1ZG1 A;  1Z91 A;  1RNL A;  3MCZ A;  4LB5 A;  1YTY A;  2RC4 A;  3IC7 A;  5LGU A;  3F6V A;  1J0R A;  4L9T A;  5JHU A;  2W24 A;  4RB2 C;  1JHF A;  1RZ4 A;  1YS7 A;  3CDH A;  5L3G A;  3P7N A;  2RDP A;  2IA0 A;  1J5Y A;  3QRF F;  4M72 A;  4IF4 A;  2HS5 A;  2VC1 A;  2EV5 A;  3BJA A;  3KEQ A;  2P8T A;  2EV6 A;  3L00 A;  4UVC A;  4G7H F;  1OYY A;  4M9Z A;  1FBS A;  2H94 A;  5HOO A;  4MQ9 F;  2YPR A;  1DP7 P;  4LG0 B;  4AIH A;  1H9T A;  3WTW C;  3OV8 A;  4QLC U;  3KET A;  2KJB A;  3KLO A;  2PBI A;  5ED4 A;  4RGR A;  1S8N A;  2EFQ A;  3T8R A;  4BXU A;  2FU4 A;  1WRJ A;  3U9G A;  1NHA A;  2M1B A;  2FNA A;  1LB2 A;  3GWZ A;  5D4S A;  5DCM A;  2R7D A;  1L3L A;  4Y13 A;  4EV0 A;  2ZNZ A;  1FNN A;  1TNT A;  1P92 A;  2GXG A;  4KFC A;  4CXF A;  2HYF A;  3ZMV A;  4KMU X;  3E6C C;  4MNU A;  2JZY A;  2CW0 F;  5LHG A;  4CIC A;  2ISY A;  3RPQ A;  2W85 A;  4IJA A;  2ADU A;  3SFZ A;  5L3E A;  3GFL A;  2ETH A;  4UVB A;  1PP8 F;  1G3W A;  2M30 A;  2P6T A;  2Q0O A;  4Q47 A;  3FM3 A;  2RQP A;  3QP5 A;  1FLI A;  2CG4 A;  5H6R A;  3J7A O;  1S7A A;  3E97 A;  5AIQ A;  3V7C A;  1Y0U A;  5J8F A;  3IKV A;  1YQA A;  1WWX A;  1YLF A;  2FQ3 A;  2GQQ A;  1ZG5 A;  5AIP A;  4A5N A;  4RGS A;  4UXN A;  2XHK A;  2WTE A;  4HOB A;  3I64 A;  4EM0 B;  2YU3 A;  3NQO A;  5JR3 A;  5F6F A;  2D1H A;  3I5U A;  4KDP A;  3VFZ A;  2FML A;  2Z3Y A;  4P9F A;  3RJP A;  3KP6 A;  4G6D A;  3QP6 A;  2HFH A;  2HTS A;  3ML6 A;  4EM2 A;  3W6J B;  3V8L A;  1P6R A;  2HR3 A;  4HV6 A;  4BQA A;  3LWF A;  3U2R A;  1XGN A;  1FYK A;  1TW3 A;  5FLX K;  5K1Y A;  4ZYH A;  2LDU A;  4B09 A;  3IWZ A;  2XAS A;  1FT9 A;  2YX4 A;  4I02 A;  1ZRE A;  2VBW A;  2FF4 A;  3KP2 A;  1T38 A;  2OBP A;  1DUX C;  3T5X A;  2DT5 A;  1ON1 A;  5ILU A;  2HDC A;  4WX9 A;  1O3Q A;  2F5E A;  3KZY A;  1S29 A;  2ZBK A;  4ENM A;  5FO5 A;  3DKW A;  1R22 A;  2FNP A;  3HSF A;  3WG9 A;  2CO5 A;  2Z99 A;  3WU0 A;  2WWY A;  1QBJ A;  2K4B A;  4UV9 A;  3LAP A;  1LEA A;  2NYX A;  3DQV C;  1Z6T A;  4HA8 A;  1SD6 A;  1O7F A;  2IVM A;  2HQR A;  4KNY A;  1ZRF A;  1FP2 A;  2FXA A;  1E2X A;  3RYP A;  1HSJ A;  2VBZ A;  4GCV A;  5D6E A;  2RNJ A;  4F7Z A;  1PUE E;  2OQR A;  4WXC A;  1LQ1 A;  3I59 A;  1LDK B;  4ZYG A;  5BOX A;  4L0Y B;  3J81 K;  1IN8 A;  1OYI A;  2EFW A;  2M87 A;  1EV7 A;  3MAJ A;  1AWC A;  2UXN A;  5F1R A;  2G7H A;  3CUQ A;  2A68 F;  2X0L A;  2ESH A;  2FSW A;  4LMY A;  3R4K A;  1KU3 A;  1FY7 A;  2O61 A;  2VXZ A;  2PG4 A;  1KA8 A;  4I2O A;  1STZ A;  4BHP A;  2HWV A;  3BP8 A;  3QU3 A;  2DLL A;  3RKX A;  3GW2 A;  1D5V A;  2MA3 A;  3CLO A;  4DQ2 A;  2WV0 A;  3BJO A;  2XIG A;  2UWM A;  5FGM A;  1W5S A;  3M1E A;  4KIC A;  1FPQ A;  3ZMD A;  1YFH A;  3ZMT A;  1U6G A;  2E1C A;  5CVI A;  1LDJ A;  4JBA A;  3GUD A;  1XGM A;  1KU7 A;  2LSO A;  3K69 A;  1EH6 A;  3BJ6 A;  1O7L A;  3H92 A;  5BMZ A;  5L3B A;  4IRI A;  5E8I A;  1K78 B;  1IXC A;  2ELH A;  3B73 A;  5D5U B;  1YW8 A;  1YYV A;  3LA3 A;  4XRF A;  1ZAR A;  4I09 A;  3RKY A;  4Q48 A;  1IUY A;  2IA2 A;  4G9Y A;  2XKO A;  3K9T A;  1L0O C;  2AXL A;  3CUQ C;  3DP7 A;  3IWF A;  2CGP A;  2Q2E A;  1V4R A;  1W7P D;  4I7H A;  3WGH A;  1QZY A;  4IVN A;  3VEP A;  2HGC A;  1BI1 A;  4U0W A;  4R79 A;  4I98 B;  1F9N A;  2ZFW A;  4WWC A;  3E5U A;  3GZ5 A;  4KIG A;  3WE3 A;  3BPV A;  1AOY A;  4LB6 B;  4EGY A;  4MTE A;  4A0Y A;  3J80 K;  2BE5 F;  1F5T A;  2D2W A;  1KU2 A;  1HBX G;  2C6Y A;  3I53 A;  1HKT A;  1G3Y A;  3WTU C;  3WTT C;  3ECO A;  4ASN A;  2MD5 A;  1P4A A;  1SD7 A;  4ENN A;  4ON0 A;  1LEB A;  3TQN A;  2D45 A;  3V4G A;  1PDN C;  3LQR A;  2DAO A;  3FX3 A;  1MD0 A;  5L3C A;  1OPC A;  2STW A;  5CLS A;  6PAX A;  1XB4 A;  3DXJ F;  2XAQ A;  2DTR A;  5J8C A;  1KU9 A;  5DD4 A;  2A07 F;  2EFO A;  1ZLJ A;  3DPL C;  5FD6 A;  5CYV A;  4PCQ A;  3F23 A;  3HTU A;  4LJZ F;  1ZGJ A;  1BC8 C;  1TNS A;  1ZRC A;  3E6M A;  3KE2 A;  2XV4 S;  2HEO A;  5DD8 A;  2VE8 A;  3HRS A;  3TOA A;  1O3T A;  2QWW A;  5HVQ C;  4O3M A;  2EA2 A;  2VE9 A;  4BHC A;  3ZPL A;  2XRN A;  4MGR A;  2Z33 A;  2F5D A;  2O6G E;  4L5I A;  2HKO A;  1U3E M;  4EM1 A;  3TO7 A;  3O2P E;  5TJJ A;  3SQN A;  2HKX A;  2IT0 A;  3GZ6 A;  2UZK A;  4EVI A;  2KIF A;  5FFX A;  1DDN A;  3K1M A;  2NNN A;  1XDS A;  2JSC A;  5HLH A;  1FZP B;  2HYG D;  1QGP A;  1EH8 A;  3ISP A;  4BAY A;  1RUO A;  4CYD A;  3ABT A;  3P9C A;  3MEX A;  1TQM A;  5F64 A;  1XD7 A;  4IHS A;  5H6Q A;  5L3F A;  4H0E A;  1REP C;  3MQ0 A;  2O8X A;  1TQP A;  2MH9 A;  4ESB A;  5D5V B;  3F3X A;  5LEK A;  1ZH5 A;  1FYL A;  1FOK A;  1UHW A;  3ZN1 A;  3F72 A;  3E6B A;  2XAJ A;  4RGX A;  5LRS A;  5HDN A;  2E1N A;  4CO8 A;  3Q9V A;  5DUK A;  4A6D A;  4P96 A;  1F1Z A;  5HS9 A;  1U5T A;  1UHM A;  3CJN A;  2ESN A;  2F5C A;  3H3Z A;  5K5Q A;  1IW7 F;  2PI0 A;  5IT9 Z;  3PQK A;  2L02 A;  2JPC A;  4I0A A;  1TW2 A;  2H27 A;  4N0B A;  3H3U A;  1ZGA A;  2JPB A;  1RI7 A;  3ZMZ A;  5DCF A;  4A5M A;  3ZN0 A;  4I01 A;  1BN5 A;  2QYO A;  4U0Y A;  3N97 A;  5CJ9 A;  1ONV A;  1CGP A;  1G3T A;  1I27 A;  2RVC A;  4GYG A;  3DFG A;  5H20 A;  4UUV A;  1DPR A;  1O3R A;  3M7G A;  4AWX B;  3GFM A;  4G8X A;  1ZG3 A;  2DK8 A;  3RDI A;  1U5T B;  3TDZ C;  5LEJ A;  2W57 A;  4Y15 A;  2FBH A;  2EK5 A;  3DEU A;  3C1D A;  2DW4 A;  3TGN A;  1Z6R A;  5DV5 A;  1FSE A;  1WSU A;  4ESF A;  3S2W A;  2K86 A;  4OMY A;  1R1T A;  1HKQ A;  4OIO F;  4G6Q A;  4M74 A;  4U7B A;  2E7W A;  3IKT A;  4KT5 C;  2XAF A;  3FMQ A;  3QU6 A;  1YW7 A;  5K5O A;  1QPM A;  1VTN C;  1LNW A;  2MH2 A;  2GA2 A;  4S05 A;  1U2W A;  3FMS A;  3ZMS A;  4FX0 A;  1SFU A;  3EYI A;  3R61 A;  4KMF A;  1BM9 A;  2JTV A;  2FBK A;  2CSO A;  1JGS A;  2NRA C;  2KIM A;  1OMI A;  3ULQ B;  1XSV A;  2MLG A;  2NNY A;  2GAU A;  4HYE A;  3K0L A;  3K2Z A;  3F8B A;  5IT3 A;  3FF5 A;  3GXO A;  2VN2 A;  4M71 A;  2FMY A;  1T6S A;  1UST A;  1MJ9 A;  2A69 F;  4K2E A;  2A6H F;  2XKP A;  5D5W B;  1FSH A;  5ICF A;  5ICC A;  1HW2 A;  4G7O F;  1J2X A;  5E1Z B;  2OZ6 A;  2QM3 A;  2YR2 A;  5CVV A;  3LA2 A;  1W5T A;  1HW5 A;  4ZZD A;  3VOE A;  2VON A;  1IAW A;  5KVR A;  3N4M A;  1T98 A;  4OIQ F;  2OA4 A;  2IP2 A;  4HW0 A;  3BDD A;  3QPT A;  2LKP A;  1IRG A;  2HZT A;  4L0Z B;  4N9I A;  2G9W A;  2EV0 A;  1T39 A;  4FHT A;  4ZZL A;  5ILS A;  1J59 A;  1B1B A;  5E8G A;  4ZH4 F;  1K78 A;  2P5V A;  1Z9C A;  2WC2 A;  2BEO A;  4UHT A;  2V79 A;  4R8H A;  4A0Z A;  1FX7 A;  1QNT A;  1TQI A;  5HLG A;  2DPD A;  3GVA A;  1IN7 A;  4MHG A;  3HIF A;  2QEN A;  4LLN A;  2VC0 A;  2QVO A;  4WXH A;  4XSZ F;  1IN4 A;  3HOT A;  1I1G A;  1P2F A;  1XSX A;  2O3F A;  1MJA A;  3FXQ A;  1FYM A;  3JAM K;  5CVR A;  3RIR A;  2Y75 A;  1SMT A;  3F6O A;  1PP7 U;  1MDM B;  3QAH A;  3TO9 A;  2COM A;  4NQW A;  4FX4 A;  3GX4 X;  1UCR A;  1XSD A;  3FZV A;  4R1H A;  5E18 F;  1X3U A;  4IHT A;  2JRT A;  3VOD A;  2VT3 A;  1CF7 B;  2A3S A;  1S6L A;  1MKM A;  2DK5 A;  3JTG A;  4GO1 A;  5AON A;  1H9G A;  3OOP A;  5HS7 A;  1HKS A;  2DU9 A;  3ECH A;  2CYY A;  1B4A A;  5IT9 K;  2F2E A;  3R0J A;  1SD4 A;  3RKW A;  3BWG A;  4HX7 A;  5KK1 A;  4N9H A;  1ZLK A;  1V3F A;  4JQF A;  2MLK A;  3GFI A;  2Y48 A;  1U78 A;  3QOP A;  1MZB A;  3EET A;  3ERE D;  3BPX A;  2H6B A;  1ULY A;  4YFN F;  3L2C A;  1BI0 A;  4HX4 A;  4YIF A;  1MDM A;  3GO5 A;  1GXQ A;  3P9I A;  2V1U A;  1G6N A;  3FXU A;  3MZY A;  2M8E A;  1B6A A;  3B02 A;  1UB9 A;  2O0Y A;  2XVC A;  2VOD A;  2EFP A;  4LLG F;  3I0T A;  3I58 A;  1JE8 A;  4LFU A;  4XSX F;  1IN5 A;  4M6X A;  1K6O A;  1OKR A;  2K7L A;  1XMK A;  1YS6 A;  5D6F A;  4LK1 F;  2V6C A;  5J6X A;  2ZME A;  4S04 A;  3WU1 B;  2EB7 A;  2W84 A;  1KGS A;  1XCB A;  3AAF A;  1JXS A;  2BBY A;  2H09 A;  4HX8 A;  3V8J A;  4MEX F;  1KYW A;  4MTD A;  1KQ8 A;  5HLI A;  4E70 A;  2DQL A;  4I0B A;  4RGU A;  4HDU A;  2UXX A;  3I4P A;  2QQA A;  3RYR A;  5LRR A;  3HYI A;  1RUN A;  3KP3 A;  1K7A A;  3WGG A;  1ZAO A;  2BV6 A;  4KYW A;  2M5W A;  1TTY A;  5LHH A;  1IN6 A;  1BI3 A;  1SFE A;  4EJT A;  1XN7 A;  4UV8 A;  2VBY A;  1FBQ A;  2HTJ A;  5LBQ A;  2P5L C;  2Z5U A;  3KZZ A;  4RB0 A;  1QZZ A;  4A12 A;  3LA7 A;  3SZP A;  5ILV A;  4M9S A;  2L4A A;  1GHC A;  1R5H A;  1TBX A;  3F8M A;  5LHI A;  2D1V A;  1HXD A;  4NB5 A;  4WXD A;  1XMA A;  4KIF A;  4XLN F;  1IF1 A;  2PQ8 A;  4TV7 A;  2DQR A;  2FE3 A;  3Q9S A;  1FP1 D;  2L54 A;  1BC7 C;  2R7F A;  5JI6 A;  3LST A;  4HDV A;  3I59 B;  1OR7 A;  3ABU A;  2AS5 F;  1JHH A;  5A2Q K;  3ZP5 A;  4UVA A;  3IRQ A;  1B59 A;  4L9V A;  1O57 A;  4HAM A;  5CVJ A;  1HST A;  3K1N A;  3REO A;  4M6Y A;  3KP7 A;  4EJV A;  1ZRD A;  5LGN A;  2J5P A;  2PMH A;  1J9I A;  1YIO A;  4GGG A;  2IPQ X;  3FWE A;  4ESJ A;  1S3J A;  2LNB A;  1FWZ A;  2ZXJ A;  4P55 A;  4KN4 X;  2Q8K A;  2ACJ A;  1MGT A;  3V7R A;  3WTZ A;  2NAZ A;  2IRF G;  3WTY C;  2OD5 A;  3IL2 A;  5BPI A;  2NS0 A;  2FBI A;  2IW5 A;  2PMU A;  4WCG A;  3GYH X;  1G4D A;  5CVU A;  3TO6 A;  1OYW A;  4YFX F;  2R3S A;  3F8F A;  5D4R A;  1R5G A;  4Q4Z F;  3ELK A;  2HQN A;  1XCV A;  3VB2 A;  1D8J A;  1O3S A;  1I1S A;  1Z7U A;  1J7K A;  2VOP A;  2DBB A;  3PQJ A;  2P6S A;  1MJB A;  3SXY A;  2CQK A;  4XBF A;  2EFN A;  1W7P A;  3J81 Z;  2BGC A;  1ZYR F;  4RB1 A;  2P7V B;  2YSR A;  4ZYD A;  1Z05 A;  4HBL A;  5ERI A;  3WE2 A;  3WTS C;  1WKM A;  2ZJ2 A;  3MWM A;  2VOO A;  3HHH A;  4KUM A;  2LF7 A;  1BIA A;  4IRG A;  4RB3 C;  2FEZ A;  3CO6 C;  2KJC A;  3RPU A;  3T1B A;  1R7J A;  4HF2 A;  2VT2 A;  1U8R A;  2KIU A;  2P7C B;  1R1U A;  2K02 A;  4PDK A;  3WOD F;  3V8K A;  4OU0 A;  3EQL F;  4YG2 F;  1R58 A;  4M9X A;  3ZQ7 A;  4HLY A;  3RI4 A;  4ZYE A;  4BYY A;  1G3S A;  3D5L A;  4BH9 A;  4HZF A;  3HTS B;  4PGH A;  2H6C A;  4EGZ A;  1YG2 A;  1UFM A;  2JT1 A;  4RAZ A;  5LLQ A;  4EJU A;  2ZO4 A;  2GIV A;  3C7J A;  4AVP A;  4WK8 F;  4LD5 A;  1J75 A;  3HUG A;  5D8L B;  1U5T C;  5JFR A;  4BNC A;  5BQT A;  5DCM B;  3G3Z A;  1LDD A;  1HW1 A;  4Y17 A;  2PN6 A;  2EJR A;  4AIJ A;  1XGO A;  3W6K B;  3HSE A;  1SMY F;  2OAZ A;  1ODD A;  1Q1H A;  2QZ8 A;  1IZ1 A;  5FB2 A;  2OU2 A;  3TDU C;  5JVT A;  4O5V A;  4P9U A;  4LLL A;  3D0S A;  2KKO A;  3HOS A;  1P4W A;  1BI2 A;  2RKH A;  2PJP A;  2STT A;  2OZU A;  4OMZ A;  2M45 A;  3M9A A;  3MZH A;  2CWE A;  3E5X A;  3J80 Z;  4LG0 A;  2J5O A;  2B0L A;  2XUB A;  1BOA A;  5HDG A;  5E17 F;  2XAH A;  2QLZ A;  2PEX A;  4HQE A;  2IJL A;  5FD5 A;  1R1V A;  5E1W A;  1IXR C;  2G7U A;  2GZW A;  2QQB A;  5LGT A;  4O6J A;  3JSP A;  5BPD A;  3U1D A;  4CHU A;  3BY6 A;  3IHU A;  1BJA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...