1HDDC

Crystal structure of an engrailed homeodomain-dna complex at 2.8 angstroms resolution: a framework for understanding homeodomain-dna interactions
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
57
structure length
57
Chain Sequence
RPRTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFQNKRAKIKKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*TP*TP*TP*TP*GP*CP*CP*AP*TP*GP*TP*AP*AP*TP*TP*AP*C
publication title Crystal structure of an engrailed homeodomain-DNA complex at 2.8 A resolution: a framework for understanding homeodomain-DNA interactions.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription/dna
total genus 16
structure length 57
sequence length 57
chains with identical sequence D
ec nomenclature
pdb deposition date 1991-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1hddC00
2L9RA 1R9TJ 3ZQFA 1GDTA 2NVQJ 5DS9A 4AUXA 2NVYJ 4QIWN 1MH3A 2ID3A 1GUUA 1MBKA 2YUSA 4JP0A 4MLOA 1B72A 1X2NA 2JMWA 2NVXJ 4BXXJ 1NK2P 2O9LA 1XC5A 3QQAA 1OCTC 2E2HJ 5F08A 3JR9A 1P7JA 2JJ7A 2NS7A 2JWTA 3B6AA 4FE4A 4XK4A 2YS9A 3RKQA 5K7HA 2CRGA 2GM4A 3JRAA 1VI0A 2IBDA 2IEKA 3Q0UA 4IHVA 3ZQGA 1MSEC 3W6VA 1ZK8A 1FTTA 5EG0B 2ME6A 1LFBA 4RDUA 2RAEA 1GT0C 2O8KA 2HOTA 3BR5A 2Y0SN 5C44J 1DU0A 2JN6A 1JT6A 2DA2A 1POGA 4C2MJ 1MBJA 3HOUJ 3S15J 4V2GA 4XIDA 1FTZA 3BG5A 4JX6A 4EEFG 1OCPA 1IDYA 5FKOA 4C3JJ 5C4XJ 2XB0X 1ITYA 1OFCX 5IOZA 2KT0A 3PM1A 1EF4A 1UG2A 2JK3A 1WPKA 3GTLJ 2NOGA 1FJLA 4XRMA 3RZOJ 1AU7A 3OOUA 3I4NJ 5E3OA 2E1OA 2AO9A 1RR7A 2W48A 3S1MJ 1QPIA 3H0GJ 1W0UA 1Y1VJ 4JX4A 5J1RA 1ETOA 3IH2A 4BKXA 2WB1N 2R5YB 1IUFA 1ETYA 2FQ4A 3S16J 2K9NA 1WI3A 4M3EA 4IHYA 4D5FA 2E2JJ 2TCTA 2HQ5A 3BR6A 1HLVA 2Y2ZA 3S17J 3DCFA 3GTPJ 1U9OA 2K9QA 2DJNA 1WH7A 4A3CJ 1JGGA 3GTMJ 1JKOC 1B8IA 3IV5A 3HGGA 4A69C 1DU6A 4UUTA 1MNMC 3FK6A 2I10A 3TEDA 2XPWA 2XGCA 3HGYA 5E3LA 1JTYA 3FK7A 3UKGA 3JRGA 2ZB9A 5K7FA 1SANA 5IP6A 2XGEA 4JYKA 2LR8A 2EZIA 2R0QC 5BNGA 2NS8A 2JA7J 3GTOJ 4A3BJ 3GBGA 5IOYA 3G1OA 4A3EJ 2FD5A 1ZGWA 2B63J 4CYCA 1GV2A 2HXIA 3PO2J 1IC8A 1MBGA 1F43A 5GPCA 2HXOA 1S7EA 4A93J 3BQYA 3CQZJ 4G12A 4NDLA 5EZHA 4B3AA 4GFBA 5IP7J 5FKMA 2ELKA 2O7OA 5FKLA 5EGOB 2G0EA 3SDGA 1HF0A 1PUFA 3JRCA 1LFUP 1D5YA 1I6HJ 1G2HA 1LE8A 2DMUA 4BY1J 2VUMJ 1IRZA 1NTCA 4UUSA 3K7AJ 2DA3A 3ZQIA 2DA5A 1U9NA 3S1NJ 1QRYA 3Q0VA 2VI6A 4A3LJ 1IDZA 3PO3J 3SFIA 3QPSA 5GP9A 2XPVA 2R5ZB 2Y31A 1RESA 3HOXJ 1U78A 5C4JJ 1BW5A 5IYCJ 2CQXA 4MFEA 3HOZJ 3FIWA 1RPWA 1YRNB 3Q3SA 4DYQA 2X48A 1Y1WJ 3A01A 2X6OA 3TP0A 1H8AC 1ETQA 1QVTA 2M34A 4B4CA 2LP0A 3HOWJ 1HDPA 1U8BA 1TWCJ 5E3MA 1VNDA 1JT0A 3GTJJ 4M3FA 1HDDC 1F36A 3VPRA 3NAUA 4C3IJ 3HOVJ 4A3KJ 5F0HA 4BBRJ 1T56A 2VKVA 3G1LA 4Y7NJ 2DMQA 3HM5A 3QPLA 5J1YA 2LFBA 3LSJA 3WHCA 2COBA 5EEAA 2LVSA 2CUFA 5FKNA 4QSHA 4QTRA 2R93J 3TP3A 4IHWA 2M0CA 1ETVA 1MH4A 1VFCA 3HOYJ 2CJJA 1AKHB 4AC0A 4D7NA 2E19A 3B6CA 2XPUA 3GTKJ 2EH3A 1BA5A 4DYCA 2XB5A 5M3MJ 2ECBA 3RZDJ 5FLMJ 4I6ZA 4M3DA 2M9HA 1JKRC 1VF9A 1UMQA 4FCYA 1P7IA 2DN0A 2CQQA 5EG0A 2LD5A 3GTGJ 1ZKGA 5EZGA 3F0CA 2OF7A 2QF7A 2PMZN 1WGXA 4A3IJ 5IYDJ 4DZPA 2LY9A 3BR1A 3O8HA 1APLC 5HODA 2JA6J 4XICA 1BW6A 2YU9J 1FEXA 3FKIJ 2N8GA 4X6AJ 1ETWA 1Z0XA 3IH4A 1JKQC 2KDZA 2WV1A 2LKXA 1WCMJ 2H8RA 2K40A 1ZR2A 1QVUA 2L7MP 3ZOBA 5E3NA 3NARA 3HDDA 3MKLA 2L0KA 3BR0A 1X58A 2EZKA 1ETXA 3JREA 5JLXA 2HYJA 1MSFC 1MBEA 1IV6A 2DA6A 3CDLA 3BQZA 5JLWA 3DEWA 2FJ1A 2R5YA 4AYBN 2NVTJ 1I50J 4ABZA 2ME0A 1UHSA 4X1EA 4RBOA 4D5CA 3C2BA 5K7ZA 1H89C 2MSYA 3S14J 1RETA 2DMPA 1MBHA 1AHDP 3BTJA 3JRHA 3JRDA 2VPRA 3HKZN 1XG1A 1JTXA 5C3EJ 2R7ZJ 2R92J 1HOMA 1JKPC 3OIOA 1W0TA 3HBLA 2JA5J 4A3FJ 1CQTA 3LOCA 1GV5A 2ECCA 3S1QJ 5IP9J 2Y30A 5M5XJ 3FISA 3LSGA 2HOAA 2FX0A 3S2DJ 2GBYA 5EDNA 1TWGJ 5F0FA 3BTCA 2DTZA 9ANTA 5J3LA 2OPTA 1ENHA 4LOCA 2EQRA 4A3GJ 3OSFA 1E3OC 1GVDA 2Y9YA 3D1NI 1JUSA 1A5JA 4DW6A 2EZHA 1IJWC 4XRSG 1NK3P 5IPAA 2DA4A 2D5VA 1XS9A 3BT9A 5M3FJ 2X9DA 1A6IA 1TWHJ 4D7MA 3L1PA 4M3BA 1K61A 2LK2A 1SFOJ 3A03A 5EGOA 3I4MJ 1B8IB 3G1MA 4MO7A 5IYBJ 3SJMA 3LSPA 3BG9A 3IH3A 3ZQLA 2MGQA 2DA7A 4C3HJ 3BR2A 4J19A 3BR3A 4V2FA 2M8GX 2QCOA 4BY7J 4A3MJ 1ETKA 3TW7A 5F04A 4M6VA 1WH5A 2LLKA 1O4XA 4A3DJ 2HI3A 2LTPA 1JUPA 2TRTA 1ORKA 2K9SA 3A02A 5FLVA 2GLOA 2L7ZA 2VKEA 3HEFA 2WAQN 5GPAA 2R5ZA 3H3VK 3S2HJ 3JRBA 2M2EA 4MIMA 3RQIA 1MBFA 4CYCB 4M3GA 3M3YJ 1T33A 3ZQCA 1RKTA 2H1KA 5M5YJ 5F0CA 3OSGA 1YRNA 2P81A 5J1UA 3Q0WA 4HNVA 1ZTRA 2IAIA 3BTIA 3TW6A 1JUMA 4DYRA 3S1RJ 1RKWA 1TWAJ 2EZLA 2DMTA 3K2AA 2MG4A 3M4OJ 2E2IJ 1IG7A 2JA8J 4Y52J 3JRFA 2HDDA 2CU7A 1PUFB 2CUEA 1FIPA 5F27A 1Q1VA 2DMNA 3MVPA 3CCYA 5EF6A 1LE8B 1B72B 3JRIA 1JJ8C 4W1UA 2ID6A 1TWFJ 2AHQA 4UUSB 4IHXA 5FJ8J 3HB9A 3MN2A 1ZQ3P 2XRLA 4FISA 1BJZA 1K83J 4DZJA 4I76A 1IGNA 1I3QJ 5DTDA 4IEJA 4L5EA 3E7LA 1X2MA 3BG3A 3GTQJ 1AKHA 1OJLA 4JX5A 4FE7A 2HOSA 3BTLA 1H88C 1BL0A 1ZR4A 4BBSJ 3ZQHA 2DA1A 4MFDA 4S0HB 5EYRA 3A01B 3LSRA 1TC3C 4A3JJ 1HCRA 1Z77A 2EBIA 4XRSA 1FIAA 4B1RA 2Y9ZA 5FKKA 1JJ6C 3WHBA 2L7FP 4W97A 2MW8A 3LNQA 5M5WJ 5F1JA 2XGDA 3O8GA 4FTHA 3CMYA 2XSDC
chains in the Genus database with same CATH superfamily
1R9TJ 1OMIA 3ZQFA 3KEYA 4YEJA 1GDTA 2JT1A 5DS9A 4LGWA 1ZREA 1GLNA 2NVYJ 3DXJF 3GVAA 1X19A 2VBYA 2XASA 1R22A 2DQLA 2JRMA 5H20A 3N4MA 3MAJA 2DOFA 4E7LA 2QA4I 3JTHA 5GADJ 1F1ZA 3KYLA 1G4DA 3LFUA 3ABTA 2IA1A 5F08A 1OCRH 1P7JA 2PMZA 4QLCU 4ESBA 3K9TA 4UVBA 1TQPA 2YS9A 3BG7A 1VQ9I 3RKQA 5K7HA 2JA2A 2GM4A 2A05A 3GX4X 3JRAA 1XGSA 2IA2A 5H6QA 2DI3A 3U21A 3DWLE 3R0JA 2HGCA 5DUKA 2A6TA 1LFBA 4P96A 1GT0C 3AL0C 1S6LA 2Y0SN 1JT6A 2DA2A 1POGA 1XTAA 4F91B 4CXFA 3MMYB 4C2MJ 3L2UA 1R4NB 1YW8A 2A68F 4FX4A 1IRXA 2IGKA 5LLQA 2E35A 3HRTA 4LLNA 1FTZA 1FMVA 1X1AA 1HW1A 2OD5A 3N97A 2HEOA 4EEFG 2X85A 3C1DA 2KP6A 2QQAA 2JQ7A 2KKOA 2DQRA 2XB0X 3L00A 1OFCX 1KQ8A 3ROUA 4D9JA 1EF4A 1QHHD 2JK3A 3GTLJ 3VODA 3EETA 4XRMA 3ZR8X 2EV6A 4WXCA 4GYGA 3ZRGA 2GA2A 2BXZA 4E6KG 1FX7A 2AO9A 3HKZA 3I4PA 4E70A 3S1MJ 3H0GJ 4EJVA 1T8IA 3E97A 5CVJA 1SFXA 2FOWA 3J81K 2HVRA 4ZTFA 3K4NA 3K70C 5J1RA 5E8GA 3KLOA 3A2KA 1RIOH 4QPQA 2WB1N 2HDWA 2PMUA 4EJWA 3OYFA 3V7RA 1ETYA 2G7HA 1ZH5A 4GO1A 1FNNA 2VKDA 2HQ5A 3BR6A 2HZDA 2M7BA 2X6XA 1HLVA 1XD7A 4FQGA 4OIOF 3OL4A 4E7IA 4L5JA 2F6CA 5JR3A 2DJNA 1JGGA 1JKOC 1Y39A 1QPMA 3P5JA 1L0OC 1RRJA 3HGGA 4NHJA 3WU0A 2A69F 3VFZA 4LB5A 1I6XA 4AIJA 2R7TA 2XPWA 4MEXF 1VQ6I 1NG6A 3FK7A 5K1YA 5K7FA 2BVMA 2D1VA 3BZCA 5IP6A 3OYKA 1BI2A 4JYKA 5CVIA 2CMPA 2R0QC 1WRJA 1H0MA 2IGMA 3OIQA 2JA7J 1R7JA 1MW7A 4A3BJ 5DCMB 2IGOA 5IOYA 4LJZF 4IXAA 1D0YA 2MBFA 5LHIA 4U0WA 2HZTA 1EH6A 2XROA 3GFIA 1I3AA 3IC7A 2EIJH 2XF6A 1KZHA 3SZGA 4CZZA 3H9JA 5GPCA 2DU9A 1YLFA 1S7EA 2RQPA 3CQZJ 3GLXA 2ZO4A 4NDLA 4Y33A 2X0LA 3H5RA 4GXOA 4CGZA 3CUQB 2RV8A 4XRFA 1FYMA 5IP7J 3J81Z 5J8FA 3DPTA 3I64A 1EH7A 4XORA 5FKMA 1BR1A 2GXAA 2XAUA 3AG1H 3OY9A 1ZARA 3JRCA 1I6HJ 1WJ5A 2BVLA 4O6JA 2HPIA 1YS6A 1MMGA 2DMUA 4BY1J 4L0ZB 1IRZA 4PFPA 2KPMA 3MFKA 2CGPA 4UUSA 1WQ2A 3IRQA 3OYDA 3CO7C 3ZQIA 2BXYA 3H5NA 1S5LC 2GAUA 1B1BA 1JHFA 2E36A 2P7VB 3CESA 1QRYA 3ZXSA 4A3LJ 1NHAA 2EFNA 3V4GA 3K1MA 1IN6A 3QPSA 5BOXA 3G71I 5CQEA 4L5IA 2Y31A 4HSTA 2FOKA 5FO5A 4OWRB 3IAM2 2KRHA 1V5EA 4HRIA 1S72I 3CJNA 4A0ZA 2VLAA 4M6YA 4D1QA 5HLGA 3IWFA 3Q3SA 3V42A 1Y1WJ 3A01A 3BP8A 2BHZA 3Q9SA 1CGPA 2V1NA 3WG7H 1VQMI 2VONA 2DPUA 3BC8A 2CV2A 2E7XA 1ETQA 4BQQA 2LP0A 1XDUA 4U0VA 4ZYAA 3HOWJ 1VQKI 4RGXA 2GA1A 3L9FA 1SAXA 1JT0A 4B48A 2GQQA 3H9GA 2LRDA 4LFUA 3VPRA 3HOVJ 1SD6A 3W2VA 1XGNA 2OBPA 4XLAA 1P2FA 5DCFA 1K78B 1IUYA 3FWEA 5GTIC 1U2WA 1LPQA 3L2CA 1I5ZA 4ZZLA 3DTKA 4Z6YA 5LEKA 4C2TA 4LIUA 1Z05A 5L3DA 5J1YA 2HKOA 3DLAA 3WHCA 3MKWB 1P4AA 2COBA 1H9GA 3OIPA 2EILH 1F9NA 1FC3A 1EV7A 2QGUA 1DQUA 1MH4A 2VT2A 1TLHB 4U7BA 2CJJA 1ERDA 4PGHA 2EIKH 2CS3A 3OYHA 2XB5A 2EB7A 5M3MJ 3DKWA 4XLFA 5B66C 4I02A 4IRGA 5TRDA 3GZ5A 1P7IA 2DN0A 4YIIA 5L3CA 4B8XA 1WHUA 2VASA 3F8MA 3PL8A 2LD5A 1OR7C 1R1TA 1NH3A 5EZGA 4A3IJ 2QF7A 1SVOA 3S3MA 3BR1A 5D5XB 1X3UA 3G3ZA 1Y8QB 4XICA 2P8TA 3A1YA 5HDGA 2UV1A 4PJNA 1Z21A 2N8GA 2L9SA 4BHPA 4X6AJ 4Q4ZF 3HUGB 1JKQC 2Q8KA 2KDZA 4R8HA 1WCMJ 2VQHA 2K40A 3JSOA 1ZR2A 2Y0SA 2C6YA 3NARA 3UNGC 3BR0A 1X58A 3BG6A 3JREA 3T5XA 2FNPA 1WJFA 3R0AA 1I27A 3LSKA 3JTGA 1MSFC 3I9V2 1MBEA 4FASD 1IV6A 2DA6A 5CJ9A 3CDLA 3ZMZA 1YE9A 1LJ9A 4YELA 1SVLA 3CLOA 4AYBN 2CYYA 3FXUA 2NVTJ 4CICA 1IF1A 2K3FA 5B1AH 2AXTC 5K7ZA 1H89C 2MSYA 2EIMH 2P5VA 3MCZA 1K79A 2DMPA 4RGRA 1AHDP 3BTJA 4ZYGA 3J7YJ 4II3A 3L7WA 1XG1A 5C3EJ 4PSWA 4IOAF 1HOMA 4RB0A 3WE3A 1VQLI 2W57A 3KYDB 5E1XA 3VSKA 4HSRA 1UJ8A 3HBLA 3JCUC 1TTYA 1ZG3A 5D8LB 3Q9VA 1CQTA 3LOCA 1W5SA 2WB1A 3HTUA 4B44A 4BAYA 3PQJA 4ZDPA 1IRGA 5JVTA 5AIPA 2QQ8A 3NWSA 2DT5A 3S2DJ 2VC1A 5J3LA 2R7QA 2DFHA 2M7AA 1ENHA 3HRMA 4A3GJ 3K4KA 1E3OC 1GVDA 1V5FA 4EVIA 5DCMA 3RYPA 2Y9YA 1D1BA 3G2BA 2RVCA 4OIPF 1IJWC 1OLTA 5E17F 2EV5A 2RGVA 2VXZA 4PJJA 2D5VA 2DA4A 3OYBA 5D5VB 4HV6A 4A2UA 3WTWC 5FRMA 2QQBA 3CUQA 1Z6RA 1ZELA 4M3BA 2JUCA 2LREA 2NOJB 3AKZA 3I4MJ 1JXSA 2LNBA 2VJJA 1FP2A 1YQAA 4MO7A 1B8IB 2Z3YA 3SJMA 2G9WA 2LBFB 2W82A 3FXOA 4UNOA 3BG9A 2F4MB 4L9JA 1KU7A 2P4WA 3BR2A 3BR3A 2H94A 3U1KA 2M8GX 2QCOA 4M72A 2WWYA 4CCKA 3H1CA 4IOCF 1P4WA 1O4XA 3HSRA 2LTPA 1STZA 1JUPA 2TRTA 4HA8A 3TOAA 1LDDA 1ORKA 3A02A 1QZEA 4YFNF 5EJCA 2L7ZA 2BZTA 3HEFA 2WAQN 4G6DA 4AD9A 3H3VK 4G6TB 2NNYA 2XDVA 1GVJA 1J75A 3K6GA 4MIMA 1MBFA 4CYCB 4M3GA 4IHSA 1T33A 4YG2F 3ZQCA 1C0WA 1LNWA 2DT6A 4XM3A 5F0CA 2L54A 4D0PA 2QKMB 4HYEA 5J1UA 2ZJRF 4AM3A 2MYSA 1SMTA 4LITA 3S1RJ 2EZLA 1TWAJ 1VQOI 1J9IA 2ETHA 3GF2A 3TBIA 2DMTA 3WTTC 1R71A 4F55A 3M4OJ 2JA8J 4XLEA 2VOOA 5DD8A 2RC4A 3MQ0A 1U0JA 2RDPA 4P5OA 3EPZA 4JQFA 2L7KA 1Q1VA 2DMNA 1BR2A 1K78A 1F5TA 1TWFJ 4IRIA 4NC8A 1HW2A 1G3WA 3BJAA 3F22A 1FP1D 1YIOA 5J4YA 3CP2A 3KZZA 5CVVA 2GZWA 1HKQA 4FISA 1U5TB 2STWA 4EJTA 2J5PA 4G8XA 1Y0NA 2X51A 1IGNA 1Z7UA 5DTDA 1N25A 4FX0A 2NVUB 1X2MA 3FXJA 3S32A 4CSWA 3GTQJ 2W7NA 4RAGA 3GUDA 1XMXA 1BL0A 4GGGA 3OYGA 3L2VA 2W4SA 4ESJA 1ZR4A 3FKJA 2DA1A 2H8WA 2R7VA 4S0HB 2VJIA 5EYRA 2Z5UA 3K1NA 2EBIA 4EJUA 3L2QA 1BC7C 3LAJA 1KYWA 2KRFA 3CF5F 1S29A 3DKXA 3M07A 5LFAA 4ZZDA 1R5ID 2GOMA 1Y8RB 1PJRA 3H0DA 3RYRA 3C7JA 2XGDA 3OWTA 4DJAA 3FXMA 1Z7LA 4AIKA 2OUMA 2NVQJ 1MH3A 2F5VA 2ID3A 4IPAA 3CF2A 1GUUA 1MBKA 4MLOA 1B72A 4XBFA 3HUGA 3RPUD 4BXXJ 2VL8A 3WTXC 5FRNA 3GZ6A 4RB2C 1TL8A 1IRFA 3BZ6A 1Z3YA 3A0HC 4XSZF 3OR2C 2E2HJ 2NS7A 1LKXA 1LFPA 2BHYA 1D5VA 2FBHA 4RM2A 2WAEA 3CD6I 1S8NA 2CRGA 5HLTA 2QZ8A 1R5GA 2Q0OA 2L2OA 3ZQQA 1QHGA 2HWVA 1TT0A 3Q0UA 3ZQGA 3I53A 2P5KA 3W6VA 3DLLF 5CLSA 5EG0B 2ME6A 2RAEA 2O8KA 1IZ1A 2HOTA 4BQAA 3FMSA 3E1SA 3QU6A 1B6AA 5DD4A 1MBJA 2EFQA 2IXSA 3R61A 3S2WA 2KIMA 4B47A 1VZ0A 3HL2A 4YIFA 2DYRH 4KICA 3E6CC 4XLPF 4LK1F 3I54A 2R7FA 5JVGF 5C4XJ 1YJ9I 1YI2I 4AYBA 2XIGA 3ZCOA 1O3RA 3BDDA 4J01A 2NS0A 2KISA 3PIOF 1KGSA 3MWMA 4CCJA 3RZOJ 5DEQA 1QQIA 4RB3C 3I4NJ 1Y0UA 5E3OA 4MTDA 2D45A 3EQLF 1E17A 1Z3XA 4BYYA 3LQRA 2TDXA 4ETSA 4HQEA 1KQ9A 3DBRB 4WK8F 2X6YA 1W0UA 1FY7A 1KQ0A 4JX4A 1RUOA 1Y6IA 1R36A 2OTJI 1KYZA 4I7HA 1DGRM 2KRCA 4EGZA 2A5YB 3BJOA 2R5YB 4BL0B 4BJTA 2FQ4A 2DT7B 3S16J 2CSOA 4M3EA 3IUOA 4D5FA 2TCTA 2EWNA 3VEPA 2JSCA 1XMAA 2BY1A 3S17J 5HLIA 2KL4A 3DCFA 4DBQA 2EINH 2P7CB 3GTPJ 4FHTA 3ABLH 4LLLA 1WH7A 4U7DA 4A3CJ 1B8IA 1WJAA 2M4GA 2GIVA 4BQOA 1ON1A 2LBFA 2XKOA 3O2PE 4F3QA 2XUBA 1DU6A 4UUTA 2VPLA 5FFXA 2GOXB 3LA3A 4KDPA 2X1DA 3ELKA 3HGYA 3KP7A 3CLQA 4CA0A 3JRGA 2ZB9A 1SANA 2V1DA 2PG4A 1BIBA 2XGEA 1YITI 1J0RA 1W4MA 2QUFA 1T95A 3CMMA 4RA2A 4B09A 2HU9A 2R7OA 1DDNA 2QVOA 3RQ4A 1SD7A 2ZFUA 4BUPA 1ZGWA 2FD5A 2B63J 2BY3A 4CYCA 3GW2A 2VT3A 3D5RC 2AS5F 1EA3A 1T08B 3HG9A 3BQYA 2VBXA 3SZPA 2DAOA 3HTSB 2HS5A 5TJJA 1VTNC 4OMYA 4BQNA 4N4OB 2E1NA 3WTUC 2CUJA 3E5UA 1XGOA 2G7UA 3E6DA 3OYEA 3IAS2 3QAHA 3KX2A 2O7OA 4Q47A 2KJBA 3CTAA 4KMUX 3CUOA 4RM3A 1EH8A 2WAQA 4BU2A 2E5NA 5H6RA 3CC7I 3P9IA 3MKYB 2B9SA 1WSUA 3T8TA 2VUMJ 4A0XA 3ZGKA 4PUSA 4XONA 3IRRA 3F23A 2XAQA 2VXDA 4XMYA 2Z1DA 1IO2A 1I1GA 1U5TA 3Q0VA 5ICFA 2WTEA 1FPQA 2KZVA 2BOLA 1IDZA 3P7NA 2BY2A 3PO3J 2E1CA 5FGMA 1RESA 1TBXA 4KITB 1IW7F 5C4JJ 4U0YA 3HOXJ 2OZUA 4O3MA 2UXNA 3HOZJ 3ABMH 1RPWA 1LEBA 4C2UA 4X0GA 3CC2I 2ZMEB 5DV5A 1TNSA 4DYQA 2X48A 3X2QH 4M9SA 2Z9OA 4F52A 1T38A 5IT9K 5TGTA 3TP0A 1U8RA 2M34A 1HDPA 1U8BA 3F9KA 3RPUA 4M71A 3GTJJ 1HDDC 2MH2A 3HPHA 5F0HA 2P5LC 5JFRA 4DGWB 1W36D 2DMQA 2ELHA 4KJZA 2EJRA 3JSPA 1G3SA 3HM5A 3RKWA 1E2XA 4XKCA 1BJAA 2LVSA 5FKNA 2R93J 4PSXA 3V7SA 3GMEA 3M1CA 2M0CA 1JHHA 4IHWA 4A0YA 2PX9A 1PP8F 4GYIA 2MLGA 3HOYJ 4G7ZF 2E7WA 3KP4A 5IT3A 1E3HA 1U6GA 4DYCA 1J09A 2DK8A 1T0FA 5F1RA 2ECBA 1HC8A 4I6ZA 4M3DA 2M9HA 2GXGA 1W1WE 2Z16A 2CQQA 5EG0A 4XKBA 4Q5SF 3CUQC 4KNYA 4KN4X 3GTGJ 1LVKA 4WCGA 3CCJI 5IYDJ 3U1DA 1FMWA 1WGXA 1OKRA 1RR8C 5H2FC 4CHUA 4EJOA 1X3ZB 5FLXK 2LY9A 3O8HA 5HODA 2FA5A 2UUZA 5HDKA 2ADUA 5ICCA 3ISPA 1BW6A 1OCCH 3A0BC 4I09A 2D2WA 2CUZA 2YU9J 2IS2A 5IT9Z 1QGPA 4IJAA 3T0YA 3I56I 1B4AA 1BN5A 1J5YA 1BM9A 1Z0XA 2QWWA 2WY7Q 3OYLA 2LKXA 1MKMA 3EUKL 1QVUA 5E3NA 3BROA 4HG2A 4MQ9F 2WBMA 3BCBA 3I59B 1WWXA 4RAFA 1MJAA 3HDDA 1MZBA 5LGUA 4BJ5C 3BZKA 3OOPA 5LHGA 3M8FA 3NWTA 4H0EA 5JLXA 2PLYA 4OMZA 3AFHA 5E1WA 1K4SA 1QU3A 3BQZA 2FE3A 4AVPA 3H35A 5LEJA 2LY1A 2R5YA 2ME0A 2IRFG 4RBOA 2O03A 3S14J 1YTYA 5J8CA 2F48A 3JRHA 4MHGA 3ESWB 2OU2A 2VPRA 1JTXA 2R7ZJ 1GXQA 3I71A 4N0BA 3Q5FA 3K70D 1X3WB 3L2RA 4JBAA 4ZYDA 3M8EA 3FHZA 1QZZA 2ECCA 1D0ZA 2L4MA 1R58A 3A4CA 3M8JA 5IP9J 5M5XJ 4DQ2A 3GYHX 3F8BA 4A5NA 2P6SA 2DFEA 2FX0A 1FOWA 2GBYA 3ML6A 2ISYA 3BTCA 3TGNA 3HHHA 2OV7A 2DOAA 3FF5A 3REOA 4DIQA 5LD2C 2LKSA 2ZCWA 2OPTA 5FLXZ 4KUMA 1IAWA 4LOCA 2L02A 3OSFA 2H6BA 3PNVA 1K7AA 3CJTB 1JUSA 1A5JA 4DW6A 2EZHA 3KCCA 3DFGA 4XRSG 2ZC2A 1NK3P 1FBUA 4M73A 5HVQC 1YJWI 2JVGA 3K2ZA 3ERED 3E3VA 4KMFA 3BPXA 1N77A 3BOQA 1TWHJ 1WJDA 3F72A 3WGIA 1P4XA 2XF5A 4MTEA 3PSIA 1YO5C 3UR3C 4GDFA 4EQQA 2OZ6A 3WG9A 1UZCA 4F93B 4BE2A 1QZYA 1MJ9A 1R1UA 2LOOA 3G1MA 1UG0A 5IYBJ 2M30A 3U2RA 3VDXA 5JI6A 4A5MA 1ZGJA 2RQQA 2MGQA 1ZYRF 2YU3A 3KETA 3CC4I 1BOAA 1FSEA 4C3HJ 3BPVA 3ZMUA 5D8KB 2X6WA 2K86A 4M6VA 4HDUA 2Z99A 4BDYA 4RLFA 2PI0A 2HI3A 4OAYA 4OINF 3K1PA 5GAEJ 4NC7A 1D1AA 5FLVA 1W5TA 2Y48A 2VKEA 4J00A 1KU2A 2ZSIB 3JRBA 3B73A 4HF2A 2KZGA 2ZMEA 2H1KA 1TW3A 3D0SA 3FXRA 4ITVA 3OSGA 4NB5A 4WWCA 3CO6C 4XKVA 3R6SA 2IS6A 1ZTRA 3BTIA 1JUMA 5FROA 4HDVA 2O0YA 2QENA 2LF7A 3GZNB 2E2IJ 1IG7A 3IKVA 2HDDA 2DBBA 2CU7A 3ZMSA 1MMSA 1LEAA 3MVPA 1FOKA 4UB8C 3CCYA 1B72B 1LE8B 3FDYA 3JRIA 3GFLA 2L9VA 2K7LA 1UCRA 1OCOH 2AHQA 3QODA 3QP5A 3COAC 1XSDA 3PUBA 3JAMK 1XPXA 1A35A 2XRLA 2PEXA 5CPRB 4M9ZA 2V1UA 4HLYA 2W85A 4MQVA 2V79A 3LA2A 4U88A 3WE2A 4IEJA 4L5EA 4KT6A 2ZSHB 1OJLA 4S05A 4LG0B 1M1EB 4FE7A 2HOSA 3LL7A 3SXYA 1H88C 2V4JC 4M74A 4ZTJA 4BBSJ 1QA6A 5D5WB 2PFBA 2GXBA 3BY6A 5DUIA 1HCRA 1GXPA 2Y9ZA 5FKKA 1SMYF 3F6VA 2L7FP 1MNEA 3M1EA 3LNQA 4U87A 1R49A 2B7EA 3P9KA 4KT5C 3O8GA 2XAGA 1OQYA 5D4RA 4KYWA 2MABA 2XSDC 1AWCA 3DU6A 3K4BA 1ZGAA 4AUXA 2DTRA 1I1SA 4QIWN 5EEGA 2DCEA 2PJPA 3CZ6A 5D5UB 2NVXJ 4Y4RA 3TOBA 1NK2P 2O9LA 4BACA 3OYMA 4L18B 1RI7A 1XC5A 2UXXA 1FT9A 4ZYEA 4MEYF 3QQAA 3I59A 1OCTC 2WV0A 3KZIC 2ZKZA 3PIPF 2OQGA 3PNTA 1WVRA 2JWTA 4FE4A 1Z6TA 2Y75A 4UY8I 2CWEA 1NG7A 4XK4A 5K5RA 3KE2A 2J5OA 1B59A 3J7ZI 5KVRA 2BW3B 3NRVA 1VI0A 3JAMZ 2IBDA 2HYGD 1WFXA 3DPUA 1MSEC 3ZMTA 3K10A 2KFDA 1FTTA 3V7CA 3C3WA 4CCMA 2BGCA 3W6KB 1DU0A 5C44J 1DGWY 2JN6A 2VE8A 2HNHA 2RREA 3BLYA 2F5FA 3LSTA 3IHUA 4QWQA 3QYFA 1G3TA 3KIOA 1R00A 2K3PA 3KZYA 3BG5A 4JX6A 3QOEA 1OCPA 1IDYA 5FKOA 4C3JJ 1ACIA 2KIUA 3FMQA 4IL6C 2BEOA 4IZZA 1ITYA 4DBRA 5IOZA 3WTZA 2KT0A 2H27A 4WF2A 1UG2A 3DEUA 2NOGA 4YFKF 4F92B 3EYYA 2FU4A 3OOUA 3F8CA 4BEHB 2E1OA 1Q1HA 2K9MA 1RR7A 3OYCA 4HPQA 3CDIA 1QPIA 4RAZA 2ZFWA 1Y1VJ 4AWXB 1ETOA 3IH2A 2FEZA 3K4MA 2R7WA 1SC7A 3HRUA 1ZLJA 3QOPA 5ERIA 1ZN2A 1W5CC 2NXNB 2K9NA 2X4HA 4IHYA 1MIJA 2K9LA 2E2JJ 2XHKA 2A07F 4Q48A 3VB2A 3BJ6A 4KN7X 5LRSA 2OCEA 2Q2EB 4LLGF 2NYXA 1U9OA 2VQCA 4DNCA 1ZHFA 3ULQB 2K9QA 3L2WA 3EUHA 2ELJA 3DBLB 2EA2A 1G59A 3IV5A 3GCMA 3V8JA 5BQTA 3LSIA 4A69C 4I2OA 2M45A 2OAZA 4HOBA 1CF7A 1MNMC 3KP3A 5E8IA 2ZXHA 2I10A 2VC0A 4EM2A 4XNFA 1KU9A 2R7SA 3FBNB 3ONQA 4RMNA 5E3LA 3UKGA 1JTYA 5L3GA 2CQ7A 4HQMA 1BI1A 1HSTA 4TV7A 4ENJA 3N05A 2PN6A 1MDMA 3DU5A 2LR8A 1P92A 2ZNYA 3CMAI 1MJBA 2NS8A 4IRHA 3ZN0A 2O61A 2WY8Q 1TW2A 2H6CA 3GBGA 3HYIA 2OJED 2I5UA 4RGUA 3G1OA 4Y3OA 2W84A 5J4VA 4UV8A 2VQLA 2M4KA 1T39A 4L9NA 1GV2A 1T0FC 2IS4A 2VJ4A 1IC8A 1MBGA 2DFFA 4N4NB 2KJCA 1F43A 4ZDOA 1SFUA 3LMMA 3GFJA 1YS7A 3LAPA 2XVCA 5D6EA 3DQVC 5K5QA 4BHCA 2YX4A 4BJ6C 4BS9A 5EGOB 5FKLA 1PP7U 3WODF 1HF0A 2VODA 3K69A 1LFUP 1D5YA 2NRAC 3DKYA 1G2HA 3OYIA 4BDZA 1LE8A 2CFOA 3S8PA 1HSJA 3ZPLA 1FWZA 3SQNA 1U9NA 3ZQ7A 1LDKB 3S1NJ 1VQPI 2QEXI 3QU3A 4OAZA 2JUGA 5HS8A 2XPVA 1U78A 4LG0A 2E5ZA 2X1EA 1XCVA 3FHNA 5IYCJ 1XB4A 2CQXA 4MFEA 1IXRC 1G8XA 3GXOA 1Z1DA 3D5SC 4RAYA 3TO6A 1T6SA 1FYLA 1DUXC 4G7HF 4AIHA 3NEUA 5AONA 4Y17A 5KHDA 1QVTA 4B4CA 1TWCJ 5DM7F 1P6RA 4WX9A 3PSFA 5E3MA 3O6BB 2RKHA 3SFZA 1D0XA 2CW0F 2CH0A 4M3FA 1R5HA 3NAUA 4C3IJ 1MGTA 2YSRA 4A3KJ 2JVHA 2VQGA 4ENKA 2BBYA 1WZ2A 1A36A 3AG4H 3ZP5A 3V8LA 3B02A 2LFBA 2ISZA 3LSJA 2EV0A 3TKYA 1PYVA 2QQ9A 3CCLI 2LG4A 2E1MC 2LSOA 3QYEA 3HPGA 1ETVA 2M1BA 4HF0A 3ASOH 5L3EA 1ON2A 3RCOA 2E34A 2YX7A 3QYBA 4AC0A 2E19A 4D7NA 3GTKJ 2XPUA 2IGNA 1USTA 2L9NA 2LY2A 1IN8A 1ZRFA 5LBQA 2IJLA 3RZDJ 3TDUC 2BW3A 1YJNI 1X4OA 1VF9A 2F2EA 2FMLA 1UMQA 3VYTB 2ZJPF 4FCYA 1LB2A 5ICGA 1OISA 5E18F 3MD2A 2XC7A 4BNCA 3ASNH 4IQJA 3CCMI 2OF7A 2DFIA 2DPDA 5IY5H 1IXCA 2BYVE 3ECOA 1D1CA 2HVSA 2FF4A 3LA7A 4N9IA 1USSA 2DW4A 1ZAOA 2AQEA 3KYCB 4KIBA 2WV1A 4NQWB 2H8RA 4E7SA 2L4AA 1R1VA 3ZOBA 4BEHA 4CCOA 3F8NA 3GEZA 1FBSA 4C9YA 2OA4A 2H1LA 2Y69H 2F4OB 2A3SA 2FRHA 2HTJA 5LHHA 1RC9A 2FJ1A 5LGTA 1I50J 4ABZA 4BXUA 2PBIA 3AG3H 2XAFA 5DDGA 4LB6B 2DDBA 3WGHA 3C2BA 2W25A 2K5CA 1QO0D 4G94A 4XOTA 2A6EF 1RETA 2EFPA 2LYCA 3S3OA 3C2GA 5LRRA 1W36C 2Q2EA 1L3LA 2MFZA 1AOYA 5L3BA 2R92J 1V4RA 4IVNA 2HOEA 3VYUB 3OIOA 4NC6A 1W0TA 3F3XA 3I3LA 3TDZC 4HNTA 4A3FJ 4HBLA 4KFCA 4BXFA 2M5WA 2Y30A 3FISA 1S7OA 4UHTA 4IX7A 2HDCA 1ZG1A 1TWGJ 2E71A 1PDNC 1HQCA 2VBZA 1YX5A 2BE5F 3WTVC 4LK0F 3RKXA 3E6BA 2PJRB 2EQRA 4M6XA 2ZXWH 4XOPA 1E3PA 4XN0A 1JE8A 4I01A 1XSVA 5HS7A 4IO9F 4RB1A 1ULYA 4L9VA 4G6QA 2HQAA 4L0YB 1XS9A 1EJ9A 5KAFC 2K4JA 5M3FJ 1O3TA 5KAIC 1A6IA 4HX7A 3FM3A 2KHMA 1E0EA 5JHUA 3RDIA 4PCQA 1K61A 1N75A 1D8JA 3A03A 3LFKA 5EGOA 3MKZA 2JPCA 3LSPA 2CG4A 3ZMDA 3IH3A 1UHWA 3KLNA 4HLXA 1MMDA 5B5EC 3SYTA 2FSWA 2KMUA 4V2FA 4HEA2 2IW5A 4BY7J 5GTHC 2QLZA 4A3MJ 4ON0A 3H9QA 1WH5A 2LLKA 3KEOA 1PUEE 5E1ZB 1VQ4I 2JSPA 5EEHA 1A04A 3ABKH 3DEEA 3E0JB 1ZRDA 3DTIA 3PQKA 4E7JA 3MZHA 3G73A 1ZRCA 2JZYA 4KIGA 1T2KA 1Z67A 3S93A 1DP3A 2GLOA 3VOEA 5KK1A 3TO7A 2HTSA 5FB2A 5GPAA 3H3ZA 5JHFA 2R7DA 1X1CA 2Z2SB 3FM5A 1K6OA 2KIQA 4MGRA 3M3YJ 4LD5A 4Y15A 2QSFX 4ANJA 5M5YJ 4DOZA 3FZVA 2FNAA 5GAHJ 3OYAA 3DPLC 3Q0WA 3GLLA 4HNVA 3AL0B 1RNLA 3TW6A 3HC7A 4DYRA 4EV0A 1RKWA 3FX3A 1FZPB 3C18A 4XLHA 3G4SI 5BPDA 2CQKA 2HPMA 4Y13A 1PUFB 1XMKA 2B0LA 2QKLB 1OCZH 5DYMA 5F27A 2UWMA 1BC8C 1XN7A 1Z9CA 3KPHA 4FETA 4P9UA 3J7AY 5FJ8J 4ZYHA 4PJ0C 1X1DA 3CCSI 1BI0A 3MN2A 2AQFA 1ZQ3P 4E7KA 1BJZA 1MD0A 1R6RA 4F7ZA 1K83J 1H9TA 4I76A 2MC3A 3E7LA 3BG3A 3AG2H 5J40A 2V1XA 4PZJA 2Y0MA 4I99C 3BTLA 2W00A 4E4HA 3KP2A 3QPTA 2OTLI 1X1BA 2IP2A 2QBYB 3ZQHA 3NQOA 2V9VA 4MFDA 2ESNA 3LSRA 3PNYA 1Z77A 1YX3A 4XRSA 2CV1A 4BE1A 4B1RA 2R4GA 4GRIA 2P6TA 4BH9A 3J80K 4A12A 5HOOA 1LUJB 2JRTA 1MMAA 4XL9A 3HXLA 3DP7A 1SVMA 3EUHC 2DOEA 4PJMA 4M9XA 4I98B 2L9RA 4JK1X 1TZLA 2HVQA 2V7FA 3WGGA 3MEXA 5ICEA 2YUSA 4JP0A 1X2NA 2JMWA 2ICWG 3HZJA 4NQWA 4E7HA 5AIQA 3KEQA 1SAUA 3BCAA 2QSGX 5D6FA 3LSMA 2F5DA 4UV9A 2LDUA 1FBQA 3JR9A 2FMYA 4NUBA 2JJ7A 3EYIA 3B6AA 1WI9A 3WTYC 3MZ8A 2DXIA 1PVEA 1ZLKA 4AIDA 5K5OA 4HNUA 1G6NA 4ENNA 3W2AA 2AXLA 2IEKA 4CYDA 4YIRX 4IHVA 3CCVI 2M0MA 1KU3A 1ZK8A 4XSXF 4RDUA 2CFXA 2KQRA 4Z2YA 4I0BA 2COMA 3BR5A 1HW5A 2FBKA 2VBWA 1TNTA 5B3SH 4ZH4F 5CQGA 4XLCA 1R4MB 3HOUJ 1CF7B 1DP7P 3S15J 3WTSC 4V2GA 4UVCA 4XIDA 1U3EM 3TQNA 1XDSA 4L9TA 4BHBA 3PM1A 4KIFA 2O8XA 5CYVA 5CVUA 1MDMB 5CKTA 2X1CA 1WPKA 3J80Z 1RZ4A 4ZJZA 2ZNZA 1FJLA 2A5WA 1J7KA 2DODA 1AU7A 5GAGJ 1S3JA 3V8KA 5A2QK 2PJRA 2D1HA 2W48A 3K0LA 2IS1A 2MH9A 5HNHA 1RUNA 4ENMA 2XV4S 4NBQA 2H09A 3TO9A 4PGGA 2BY0A 1S9HA 3OYNA 4BKXA 2LMDA 4PFOA 1V55H 4XKWA 3QWLA 1JGSA 3BWGA 4P1WA 3PJRA 5BMZA 1IUFA 3AAFA 4I0AA 3I55I 2Z33A 1WI3A 3VSLA 1QNTA 3OS1A 1ZG5A 3LQQA 4K2EA 3K4LA 1OYYA 1BI3A 2Y2ZA 2IVMA 3JW4A 2KIFA 1BIAA 4CCNA 5ILSA 4UXNA 1X1PA 3GTMJ 3OS0A 4EGYA 1SFKA 1T98A 1WJEA 2NNNA 5TISC 3IL2A 1DPUA 2FUG2 4UB6C 3FK6A 3W2WA 2VJ5A 1A6QA 3LSHA 3TEDA 1B9NA 5HS9A 3CCEI 4ZC3A 3O3KA 1MNDA 2XGCA 4RGSA 2PQ8A 2V9KA 3RPQA 2HQNA 3CMEI 2EPFA 1O7LA 2EZIA 5J6XA 5BNGA 1K4TA 1FSHA 1OYWA 3GTOJ 5J47A 2V6EA 3HSEA 2MLKA 3D5LA 1XGMA 4A3EJ 5HDNA 5HLHA 2HXIA 3J7AO 3PO2J 3ERMA 1FYKA 2HXOA 4A93J 3KP6A 5A2QZ 4G12A 2ZBKA 5EZHA 4B3AA 4GFBA 2QM3A 1YW7A 3HJEA 2VN2A 2ZJ2A 1LDJA 1YW9A 1V54H 1JI8A 2ELKA 2CV0A 4ZDLA 2G0EA 1VQNI 3SDGA 1PUFA 3RJPA 1XSXA 4CO8A 3QRFF 4HZFA 5FFZA 2R7UA 2QSHX 3G6EI 1KONA 1NTCA 3RTRA 3K7AJ 2XF7A 2DA3A 3F21A 2O5RA 2DA5A 1FOXA 3W6JB 4ESFA 2HR3A 4PK4A 5KCMA 4ASNA 2VI6A 2RNJA 2M87A 3SFIA 5GP9A 2R5ZB 1O57A 2CO5A 1BW5A 3IWZA 3GWZA 4KA4A 3FIWA 6PAXA 2QYOA 2XSJC 2ZXJA 2QBYA 3HHGA 2A6HF 1YRNB 2X6OA 1AA7A 1UB9A 3W3CA 1H8AC 4RLQA 3CJQB 5BS6A 2DK5A 1TQMA 2A61A 3GO5A 5KNLA 2R7RA 3H5AA 2LKPA 1VNDA 1I39A 4H4KC 1S7AA 4EM1A 1P9QC 5D4SA 2VOPA 1F36A 1N78A 1D8KA 1MMNA 4BBRJ 4XR6A 1YHQI 1T56A 2VKVA 3PUFA 3G1LA 1BR4A 3R60A 4Y7NJ 4OIRF 2Q1ZB 2W24A 4XN3A 1O3QA 2IA0A 1U5TC 4P9FA 3QPLA 4G9YA 4EMSA 4CCLA 3PFIA 3I0TA 5EEAA 3SEZA 4E7ZA 2CUFA 2XGXA 3U9GA 4QSHA 4QTRA 2O6GE 3CCRI 3TP3A 5HNFA 1VQ7I 1W7PB 4PDKA 2K4BA 1A31A 1VFCA 3WU2C 1AKHB 1UELB 3SHFA 3OYJA 3HSFA 3B6CA 2EH3A 3SZTA 1SEUA 1BA5A 2ZJQF 2XAJA 2DYSH 2L01A 2M8EA 5E79C 5FLMJ 1HKSA 1HXDA 4CH7A 1JKRC 2OQRA 4IQ4A 2KLOA 1Y56A 4QPOA 3KP5A 4N9HA 1W7PD 1J59A 5ED4A 4GCVA 2DJIA 3CP8A 1ZKGA 2DO7A 4V19K 2DLLA 2BV6A 2MC4A 3F0CA 3VWBA 2PMZN 1QBJA 2IPQX 4DZPA 1SFEA 4BGDA 1WJBA 1APLC 4UVAA 1OPCA 3ECHA 3H36A 2JA6J 1YOVB 2F5CA 3HIFA 4HV5A 2ACJA 3VYRB 4CUGA 1FEXA 3OS2A 2WA0A 3FKIJ 3QP6A 2GWRA 1ETWA 3IH4A 4HF1A 1YFHA 3F6OA 4P55A 3ABUA 5L3FA 4EATA 2L7MP 5FD5A 3OR1C 3SDBA 2K85A 4FT8A 4LIVA 3H92A 3MKLA 2L0KA 3OV8A 3HOTA 2EZKA 1ETXA 1V5GA 1TP4A 2K27A 1VQ8I 1XX5A 2HYJA 1F4KA 2KDOA 2IT0A 3CCUI 5JLWA 3DEWA 3T1BA 4X1EA 1UHSA 1Z91A 2WADA 4D5CA 4S04A 3DBHB 5BPIA 1MBHA 2EA4A 1R23A 3JRDA 3T8RA 4B43A 3HKZN 2STTA 1D3YA 3DF8A 2WC2A 1JKPC 4LG3A 3I5UA 4YRVA 3WU1B 2JA5J 3IKTA 2O3FA 1GV5A 4A6DA 4YFXF 2RN7A 3S1QJ 1EKEA 3LSGA 3TL4X 2CW7A 2VB6A 2F5EA 3C2HA 2HOAA 2V26A 3H3UA 4OOIA 1X4PA 2P0WA 3FBIB 5EDNA 2UZKA 5F0FA 4XLNF 2DTZA 4UUVA 9ANTA 5F6FA 3S3NA 1FLIA 1XCBA 2ESHA 3SEQA 5B1BH 4AVZA 4OU0A 5CVRA 1BBYA 2EFWA 3K4CA 3D1NI 4IF4A 3DTEA 1HBXG 1V3FA 3P9CA 3VYSB 4HAMA 2OCCH 5IPAA 3M9AA 4RS8A 1J2XA 4B3XA 1IN4A 2ZXIA 4MNUA 3HRSA 3BT9A 4A6EA 2X9DA 3RSNA 4D7MA 4IHTA 4XQFA 1OR7A 1YYVA 3L1PA 3ZMVA 2DDAA 1ODDA 1UAAA 2LK2A 2HQRA 1SFOJ 3DV8A 2FBIA 3ZN1A 2JTVA 2M3AA 3FXLA 2JPBA 2CQNA 2HYFA 4JOMA 3ZQLA 2W1OA 4O5VA 2DA7A 3FXQA 4CZCA 4CDGA 2XAHA 4R1HA 3CJRB 3E6MA 3L09A 4J19A 2YPRA 1BOBA 3QPHA 1ETKA 3TW7A 5F04A 4A3DJ 2E60A 2L3DA 3PFYA 2LC2A 3LWFA 2V9PA 1KA8A 2K9SA 1HKTA 3E5QA 2VIXA 5ILVA 2F4IA 2LF8A 2R5ZA 2RNGA 3S2HJ 2M2EA 1WKMA 4II2A 3RQIA 4OIQF 4C30A 4WXHA 2R3SA 2XRNA 4HX4A 2LH9A 1RKTA 1K6YA 1TQIA 1YRNA 1LQ1A 2I8DA 2P81A 1WJCA 1OYIA 3MZYA 4HX8A 1VQ5I 5LGNA 2IAIA 1IV8A 5FD6A 3M7GA 3EDPA 2YR2A 3R4KA 1B9MA 2XKPA 1YIJI 2GIZA 1FOYA 2NAZA 3K2AA 2MG4A 3RKYA 3FXKA 1ONVA 4Y52J 3CDHA 3JRFA 1GHCA 2CUEA 3I58A 1FIPA 1SD5A 1SD4A 2HKXA 5EF6A 3GFMA 4PJLA 2K02A 1JJ8C 4IKFA 4W1UA 2ID6A 4UUSB 3FMRA 4IHXA 3E5XA 2R7XA 3HB9A 2WAFA 2FQ3A 2MD5A 1DPRA 1O7FA 1LVAA 3F8FA 2EFOA 4LMYA 4BE0A 5E20A 4DZJA 1I3QJ 1W7PA 4R79A 4KISA 1O3SA 3OMYA 1IXSB 2E1MB 2CW8A 1AKHA 2EK5A 4JX5A 2ZMEC 1IN7A 3K4JA 4AU7A 3KFWX 2L5QA 4HW0A 3TMOA 2FXAA 4EM0B 2MA3A 3A01B 3RI4A 1UFMA 1TT5B 1TC3C 4A3JJ 1REPC 1FIAA 1YG2A 3EUAA 1IN5A 5F64A 5DM6F 2OC6A 3RIRA 1JJ6C 2VKHA 3IP4B 3WHBA 2MD0A 4W97A 2PMHA 4WXDA 2VE9A 1UHMA 1G3YA 2MW8A 5M5WJ 4NNJA 2V6CA 4G7OF 5F1JA 3HOSA 3CCQI 5ILUA 3OL3A 4FTHA 3CMYA 2HFHA 1HA8A
chains in the Genus database with same CATH topology
2L9RA 1R9TJ 3ZQFA 1GDTA 2NVQJ 5DS9A 4AUXA 2NVYJ 4QIWN 1MH3A 2ID3A 1GUUA 1MBKA 2YUSA 4JP0A 4MLOA 1B72A 1X2NA 2JMWA 2NVXJ 4BXXJ 1NK2P 2O9LA 1XC5A 3QQAA 1OCTC 2E2HJ 5F08A 3JR9A 1P7JA 2JJ7A 2NS7A 2JWTA 3B6AA 4FE4A 4XK4A 2YS9A 3RKQA 5K7HA 2CRGA 2GM4A 3JRAA 1VI0A 2IBDA 2IEKA 3Q0UA 4IHVA 3ZQGA 1MSEC 3W6VA 1ZK8A 1FTTA 5EG0B 2ME6A 1LFBA 4RDUA 2RAEA 1GT0C 2O8KA 2HOTA 3BR5A 2Y0SN 5C44J 1DU0A 2JN6A 1JT6A 2DA2A 1POGA 4C2MJ 1MBJA 3HOUJ 3S15J 4V2GA 4XIDA 1FTZA 3BG5A 4JX6A 4EEFG 1OCPA 1IDYA 5FKOA 4C3JJ 5C4XJ 2XB0X 1ITYA 1OFCX 5IOZA 2KT0A 3PM1A 1EF4A 1UG2A 2JK3A 1WPKA 3GTLJ 2NOGA 1FJLA 4XRMA 3RZOJ 1AU7A 3OOUA 3I4NJ 5E3OA 2E1OA 2AO9A 1RR7A 2W48A 3S1MJ 1QPIA 3H0GJ 1W0UA 1Y1VJ 4JX4A 5J1RA 1ETOA 3IH2A 4BKXA 2WB1N 2R5YB 1IUFA 1ETYA 2FQ4A 3S16J 2K9NA 1WI3A 4M3EA 4IHYA 4D5FA 2E2JJ 2TCTA 2HQ5A 3BR6A 1HLVA 2Y2ZA 3S17J 3DCFA 3GTPJ 1U9OA 2K9QA 2DJNA 1WH7A 4A3CJ 1JGGA 3GTMJ 1JKOC 1B8IA 3IV5A 3HGGA 4A69C 1DU6A 4UUTA 1MNMC 3FK6A 2I10A 3TEDA 2XPWA 2XGCA 3HGYA 5E3LA 1JTYA 3FK7A 3UKGA 3JRGA 2ZB9A 5K7FA 1SANA 5IP6A 2XGEA 4JYKA 2LR8A 2EZIA 2R0QC 5BNGA 2NS8A 2JA7J 3GTOJ 4A3BJ 3GBGA 5IOYA 3G1OA 4A3EJ 2FD5A 1ZGWA 2B63J 4CYCA 1GV2A 2HXIA 3PO2J 1IC8A 1MBGA 1F43A 5GPCA 2HXOA 1S7EA 4A93J 3BQYA 3CQZJ 4G12A 4NDLA 5EZHA 4B3AA 4GFBA 5IP7J 5FKMA 2ELKA 2O7OA 5FKLA 5EGOB 2G0EA 3SDGA 1HF0A 1PUFA 3JRCA 1LFUP 1D5YA 1I6HJ 1G2HA 1LE8A 2DMUA 4BY1J 2VUMJ 1IRZA 1NTCA 4UUSA 3K7AJ 2DA3A 3ZQIA 2DA5A 1U9NA 3S1NJ 1QRYA 3Q0VA 2VI6A 4A3LJ 1IDZA 3PO3J 3SFIA 3QPSA 5GP9A 2XPVA 2R5ZB 2Y31A 1RESA 3HOXJ 1U78A 5C4JJ 1BW5A 5IYCJ 2CQXA 4MFEA 3HOZJ 3FIWA 1RPWA 1YRNB 3Q3SA 4DYQA 2X48A 1Y1WJ 3A01A 2X6OA 3TP0A 1H8AC 1ETQA 1QVTA 2M34A 4B4CA 2LP0A 3HOWJ 1HDPA 1U8BA 1TWCJ 5E3MA 1VNDA 1JT0A 3GTJJ 4M3FA 1HDDC 1F36A 3VPRA 3NAUA 4C3IJ 3HOVJ 4A3KJ 5F0HA 4BBRJ 1T56A 2VKVA 3G1LA 4Y7NJ 2DMQA 3HM5A 3QPLA 5J1YA 2LFBA 3LSJA 3WHCA 2COBA 5EEAA 2LVSA 2CUFA 5FKNA 4QSHA 4QTRA 2R93J 3TP3A 4IHWA 2M0CA 1ETVA 1MH4A 1VFCA 3HOYJ 2CJJA 1AKHB 4AC0A 4D7NA 2E19A 3B6CA 2XPUA 3GTKJ 2EH3A 1BA5A 4DYCA 2XB5A 5M3MJ 2ECBA 3RZDJ 5FLMJ 4I6ZA 4M3DA 2M9HA 1JKRC 1VF9A 1UMQA 4FCYA 1P7IA 2DN0A 2CQQA 5EG0A 2LD5A 3GTGJ 1ZKGA 5EZGA 3F0CA 2OF7A 2QF7A 2PMZN 1WGXA 4A3IJ 5IYDJ 4DZPA 2LY9A 3BR1A 3O8HA 1APLC 5HODA 2JA6J 4XICA 1BW6A 2YU9J 1FEXA 3FKIJ 2N8GA 4X6AJ 1ETWA 1Z0XA 3IH4A 1JKQC 2KDZA 2WV1A 2LKXA 1WCMJ 2H8RA 2K40A 1ZR2A 1QVUA 2L7MP 3ZOBA 5E3NA 3NARA 3HDDA 3MKLA 2L0KA 3BR0A 1X58A 2EZKA 1ETXA 3JREA 5JLXA 2HYJA 1MSFC 1MBEA 1IV6A 2DA6A 3CDLA 3BQZA 5JLWA 3DEWA 2FJ1A 2R5YA 4AYBN 2NVTJ 1I50J 4ABZA 2ME0A 1UHSA 4X1EA 4RBOA 4D5CA 3C2BA 5K7ZA 1H89C 2MSYA 3S14J 1RETA 2DMPA 1MBHA 1AHDP 3BTJA 3JRHA 3JRDA 2VPRA 3HKZN 1XG1A 1JTXA 5C3EJ 2R7ZJ 2R92J 1HOMA 1JKPC 3OIOA 1W0TA 3HBLA 2JA5J 4A3FJ 1CQTA 3LOCA 1GV5A 2ECCA 3S1QJ 5IP9J 2Y30A 5M5XJ 3FISA 3LSGA 2HOAA 2FX0A 3S2DJ 2GBYA 5EDNA 1TWGJ 5F0FA 3BTCA 2DTZA 9ANTA 5J3LA 2OPTA 1ENHA 4LOCA 2EQRA 4A3GJ 3OSFA 1E3OC 1GVDA 2Y9YA 3D1NI 1JUSA 1A5JA 4DW6A 2EZHA 1IJWC 4XRSG 1NK3P 5IPAA 2DA4A 2D5VA 1XS9A 3BT9A 5M3FJ 2X9DA 1A6IA 1TWHJ 4D7MA 3L1PA 4M3BA 1K61A 2LK2A 1SFOJ 3A03A 5EGOA 3I4MJ 1B8IB 3G1MA 4MO7A 5IYBJ 3SJMA 3LSPA 3BG9A 3IH3A 3ZQLA 2MGQA 2DA7A 4C3HJ 3BR2A 4J19A 3BR3A 4V2FA 2M8GX 2QCOA 4BY7J 4A3MJ 1ETKA 3TW7A 5F04A 4M6VA 1WH5A 2LLKA 1O4XA 4A3DJ 2HI3A 2LTPA 1JUPA 2TRTA 1ORKA 2K9SA 3A02A 5FLVA 2GLOA 2L7ZA 2VKEA 3HEFA 2WAQN 5GPAA 2R5ZA 3H3VK 3S2HJ 3JRBA 2M2EA 4MIMA 3RQIA 1MBFA 4CYCB 4M3GA 3M3YJ 1T33A 3ZQCA 1RKTA 2H1KA 5M5YJ 5F0CA 3OSGA 1YRNA 2P81A 5J1UA 3Q0WA 4HNVA 1ZTRA 2IAIA 3BTIA 3TW6A 1JUMA 4DYRA 3S1RJ 1RKWA 1TWAJ 2EZLA 2DMTA 3K2AA 2MG4A 3M4OJ 2E2IJ 1IG7A 2JA8J 4Y52J 3JRFA 2HDDA 2CU7A 1PUFB 2CUEA 1FIPA 5F27A 1Q1VA 2DMNA 3MVPA 3CCYA 5EF6A 1LE8B 1B72B 3JRIA 1JJ8C 4W1UA 2ID6A 1TWFJ 2AHQA 4UUSB 4IHXA 5FJ8J 3HB9A 3MN2A 1ZQ3P 2XRLA 4FISA 1BJZA 1K83J 4DZJA 4I76A 1IGNA 1I3QJ 5DTDA 4IEJA 4L5EA 3E7LA 1X2MA 3BG3A 3GTQJ 1AKHA 1OJLA 4JX5A 4FE7A 2HOSA 3BTLA 1H88C 1BL0A 1ZR4A 4BBSJ 3ZQHA 2DA1A 4MFDA 4S0HB 5EYRA 3A01B 3LSRA 1TC3C 4A3JJ 1HCRA 1Z77A 2EBIA 4XRSA 1FIAA 4B1RA 2Y9ZA 5FKKA 1JJ6C 3WHBA 2L7FP 4W97A 2MW8A 3LNQA 5M5WJ 5F1JA 2XGDA 3O8GA 4FTHA 3CMYA 2XSDC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L9R A;  1R9T J;  3ZQF A;  1GDT A;  2NVQ J;  5DS9 A;  4AUX A;  2NVY J;  4QIW N;  1MH3 A;  2ID3 A;  1GUU A;  1MBK A;  2YUS A;  4JP0 A;  4MLO A;  1B72 A;  1X2N A;  2JMW A;  2NVX J;  4BXX J;  1NK2 P;  2O9L A;  1XC5 A;  3QQA A;  1OCT C;  2E2H J;  5F08 A;  3JR9 A;  1P7J A;  2JJ7 A;  2NS7 A;  2JWT A;  3B6A A;  4FE4 A;  4XK4 A;  2YS9 A;  3RKQ A;  5K7H A;  2CRG A;  2GM4 A;  3JRA A;  1VI0 A;  2IBD A;  2IEK A;  3Q0U A;  4IHV A;  3ZQG A;  1MSE C;  3W6V A;  1ZK8 A;  1FTT A;  5EG0 B;  2ME6 A;  1LFB A;  4RDU A;  2RAE A;  1GT0 C;  2O8K A;  2HOT A;  3BR5 A;  2Y0S N;  5C44 J;  1DU0 A;  2JN6 A;  1JT6 A;  2DA2 A;  1POG A;  4C2M J;  1MBJ A;  3HOU J;  3S15 J;  4V2G A;  4XID A;  1FTZ A;  3BG5 A;  4JX6 A;  4EEF G;  1OCP A;  1IDY A;  5FKO A;  4C3J J;  5C4X J;  2XB0 X;  1ITY A;  1OFC X;  5IOZ A;  2KT0 A;  3PM1 A;  1EF4 A;  1UG2 A;  2JK3 A;  1WPK A;  3GTL J;  2NOG A;  1FJL A;  4XRM A;  3RZO J;  1AU7 A;  3OOU A;  3I4N J;  5E3O A;  2E1O A;  2AO9 A;  1RR7 A;  2W48 A;  3S1M J;  1QPI A;  3H0G J;  1W0U A;  1Y1V J;  4JX4 A;  5J1R A;  1ETO A;  3IH2 A;  4BKX A;  2WB1 N;  2R5Y B;  1IUF A;  1ETY A;  2FQ4 A;  3S16 J;  2K9N A;  1WI3 A;  4M3E A;  4IHY A;  4D5F A;  2E2J J;  2TCT A;  2HQ5 A;  3BR6 A;  1HLV A;  2Y2Z A;  3S17 J;  3DCF A;  3GTP J;  1U9O A;  2K9Q A;  2DJN A;  1WH7 A;  4A3C J;  1JGG A;  3GTM J;  1JKO C;  1B8I A;  3IV5 A;  3HGG A;  4A69 C;  1DU6 A;  4UUT A;  1MNM C;  3FK6 A;  2I10 A;  3TED A;  2XPW A;  2XGC A;  3HGY A;  5E3L A;  1JTY A;  3FK7 A;  3UKG A;  3JRG A;  2ZB9 A;  5K7F A;  1SAN A;  5IP6 A;  2XGE A;  4JYK A;  2LR8 A;  2EZI A;  2R0Q C;  5BNG A;  2NS8 A;  2JA7 J;  3GTO J;  4A3B J;  3GBG A;  5IOY A;  3G1O A;  4A3E J;  2FD5 A;  1ZGW A;  2B63 J;  4CYC A;  1GV2 A;  2HXI A;  3PO2 J;  1IC8 A;  1MBG A;  1F43 A;  5GPC A;  2HXO A;  1S7E A;  4A93 J;  3BQY A;  3CQZ J;  4G12 A;  4NDL A;  5EZH A;  4B3A A;  4GFB A;  5IP7 J;  5FKM A;  2ELK A;  2O7O A;  5FKL A;  5EGO B;  2G0E A;  3SDG A;  1HF0 A;  1PUF A;  3JRC A;  1LFU P;  1D5Y A;  1I6H J;  1G2H A;  1LE8 A;  2DMU A;  4BY1 J;  2VUM J;  1IRZ A;  1NTC A;  4UUS A;  3K7A J;  2DA3 A;  3ZQI A;  2DA5 A;  1U9N A;  3S1N J;  1QRY A;  3Q0V A;  2VI6 A;  4A3L J;  1IDZ A;  3PO3 J;  3SFI A;  3QPS A;  5GP9 A;  2XPV A;  2R5Z B;  2Y31 A;  1RES A;  3HOX J;  1U78 A;  5C4J J;  1BW5 A;  5IYC J;  2CQX A;  4MFE A;  3HOZ J;  3FIW A;  1RPW A;  1YRN B;  3Q3S A;  4DYQ A;  2X48 A;  1Y1W J;  3A01 A;  2X6O A;  3TP0 A;  1H8A C;  1ETQ A;  1QVT A;  2M34 A;  4B4C A;  2LP0 A;  3HOW J;  1HDP A;  1U8B A;  1TWC J;  5E3M A;  1VND A;  1JT0 A;  3GTJ J;  4M3F A;  1HDD C;  1F36 A;  3VPR A;  3NAU A;  4C3I J;  3HOV J;  4A3K J;  5F0H A;  4BBR J;  1T56 A;  2VKV A;  3G1L A;  4Y7N J;  2DMQ A;  3HM5 A;  3QPL A;  5J1Y A;  2LFB A;  3LSJ A;  3WHC A;  2COB A;  5EEA A;  2LVS A;  2CUF A;  5FKN A;  4QSH A;  4QTR A;  2R93 J;  3TP3 A;  4IHW A;  2M0C A;  1ETV A;  1MH4 A;  1VFC A;  3HOY J;  2CJJ A;  1AKH B;  4AC0 A;  4D7N A;  2E19 A;  3B6C A;  2XPU A;  3GTK J;  2EH3 A;  1BA5 A;  4DYC A;  2XB5 A;  5M3M J;  2ECB A;  3RZD J;  5FLM J;  4I6Z A;  4M3D A;  2M9H A;  1JKR C;  1VF9 A;  1UMQ A;  4FCY A;  1P7I A;  2DN0 A;  2CQQ A;  5EG0 A;  2LD5 A;  3GTG J;  1ZKG A;  5EZG A;  3F0C A;  2OF7 A;  2QF7 A;  2PMZ N;  1WGX A;  4A3I J;  5IYD J;  4DZP A;  2LY9 A;  3BR1 A;  3O8H A;  1APL C;  5HOD A;  2JA6 J;  4XIC A;  1BW6 A;  2YU9 J;  1FEX A;  3FKI J;  2N8G A;  4X6A J;  1ETW A;  1Z0X A;  3IH4 A;  1JKQ C;  2KDZ A;  2WV1 A;  2LKX A;  1WCM J;  2H8R A;  2K40 A;  1ZR2 A;  1QVU A;  2L7M P;  3ZOB A;  5E3N A;  3NAR A;  3HDD A;  3MKL A;  2L0K A;  3BR0 A;  1X58 A;  2EZK A;  1ETX A;  3JRE A;  5JLX A;  2HYJ A;  1MSF C;  1MBE A;  1IV6 A;  2DA6 A;  3CDL A;  3BQZ A;  5JLW A;  3DEW A;  2FJ1 A;  2R5Y A;  4AYB N;  2NVT J;  1I50 J;  4ABZ A;  2ME0 A;  1UHS A;  4X1E A;  4RBO A;  4D5C A;  3C2B A;  5K7Z A;  1H89 C;  2MSY A;  3S14 J;  1RET A;  2DMP A;  1MBH A;  1AHD P;  3BTJ A;  3JRH A;  3JRD A;  2VPR A;  3HKZ N;  1XG1 A;  1JTX A;  5C3E J;  2R7Z J;  2R92 J;  1HOM A;  1JKP C;  3OIO A;  1W0T A;  3HBL A;  2JA5 J;  4A3F J;  1CQT A;  3LOC A;  1GV5 A;  2ECC A;  3S1Q J;  5IP9 J;  2Y30 A;  5M5X J;  3FIS A;  3LSG A;  2HOA A;  2FX0 A;  3S2D J;  2GBY A;  5EDN A;  1TWG J;  5F0F A;  3BTC A;  2DTZ A;  9ANT A;  5J3L A;  2OPT A;  1ENH A;  4LOC A;  2EQR A;  4A3G J;  3OSF A;  1E3O C;  1GVD A;  2Y9Y A;  3D1N I;  1JUS A;  1A5J A;  4DW6 A;  2EZH A;  1IJW C;  4XRS G;  1NK3 P;  5IPA A;  2DA4 A;  2D5V A;  1XS9 A;  3BT9 A;  5M3F J;  2X9D A;  1A6I A;  1TWH J;  4D7M A;  3L1P A;  4M3B A;  1K61 A;  2LK2 A;  1SFO J;  3A03 A;  5EGO A;  3I4M J;  1B8I B;  3G1M A;  4MO7 A;  5IYB J;  3SJM A;  3LSP A;  3BG9 A;  3IH3 A;  3ZQL A;  2MGQ A;  2DA7 A;  4C3H J;  3BR2 A;  4J19 A;  3BR3 A;  4V2F A;  2M8G X;  2QCO A;  4BY7 J;  4A3M J;  1ETK A;  3TW7 A;  5F04 A;  4M6V A;  1WH5 A;  2LLK A;  1O4X A;  4A3D J;  2HI3 A;  2LTP A;  1JUP A;  2TRT A;  1ORK A;  2K9S A;  3A02 A;  5FLV A;  2GLO A;  2L7Z A;  2VKE A;  3HEF A;  2WAQ N;  5GPA A;  2R5Z A;  3H3V K;  3S2H J;  3JRB A;  2M2E A;  4MIM A;  3RQI A;  1MBF A;  4CYC B;  4M3G A;  3M3Y J;  1T33 A;  3ZQC A;  1RKT A;  2H1K A;  5M5Y J;  5F0C A;  3OSG A;  1YRN A;  2P81 A;  5J1U A;  3Q0W A;  4HNV A;  1ZTR A;  2IAI A;  3BTI A;  3TW6 A;  1JUM A;  4DYR A;  3S1R J;  1RKW A;  1TWA J;  2EZL A;  2DMT A;  3K2A A;  2MG4 A;  3M4O J;  2E2I J;  1IG7 A;  2JA8 J;  4Y52 J;  3JRF A;  2HDD A;  2CU7 A;  1PUF B;  2CUE A;  1FIP A;  5F27 A;  1Q1V A;  2DMN A;  3MVP A;  3CCY A;  5EF6 A;  1LE8 B;  1B72 B;  3JRI A;  1JJ8 C;  4W1U A;  2ID6 A;  1TWF J;  2AHQ A;  4UUS B;  4IHX A;  5FJ8 J;  3HB9 A;  3MN2 A;  1ZQ3 P;  2XRL A;  4FIS A;  1BJZ A;  1K83 J;  4DZJ A;  4I76 A;  1IGN A;  1I3Q J;  5DTD A;  4IEJ A;  4L5E A;  3E7L A;  1X2M A;  3BG3 A;  3GTQ J;  1AKH A;  1OJL A;  4JX5 A;  4FE7 A;  2HOS A;  3BTL A;  1H88 C;  1BL0 A;  1ZR4 A;  4BBS J;  3ZQH A;  2DA1 A;  4MFD A;  4S0H B;  5EYR A;  3A01 B;  3LSR A;  1TC3 C;  4A3J J;  1HCR A;  1Z77 A;  2EBI A;  4XRS A;  1FIA A;  4B1R A;  2Y9Z A;  5FKK A;  1JJ6 C;  3WHB A;  2L7F P;  4W97 A;  2MW8 A;  3LNQ A;  5M5W J;  5F1J A;  2XGD A;  3O8G A;  4FTH A;  3CMY A;  2XSD C; 
#chains in the Genus database with same CATH topology
 1R9T J;  1OMI A;  3ZQF A;  3KEY A;  4YEJ A;  1GDT A;  2JT1 A;  5DS9 A;  4LGW A;  1ZRE A;  1GLN A;  2NVY J;  3DXJ F;  3GVA A;  1X19 A;  2VBY A;  2XAS A;  1R22 A;  2DQL A;  2JRM A;  5H20 A;  3N4M A;  3MAJ A;  2DOF A;  4E7L A;  2QA4 I;  3JTH A;  5GAD J;  1F1Z A;  3KYL A;  1G4D A;  3LFU A;  3ABT A;  2IA1 A;  5F08 A;  1OCR H;  1P7J A;  2PMZ A;  4QLC U;  4ESB A;  3K9T A;  4UVB A;  1TQP A;  2YS9 A;  3BG7 A;  1VQ9 I;  3RKQ A;  5K7H A;  2JA2 A;  2GM4 A;  2A05 A;  3GX4 X;  3JRA A;  1XGS A;  2IA2 A;  5H6Q A;  2DI3 A;  3U21 A;  3DWL E;  3R0J A;  2HGC A;  5DUK A;  2A6T A;  1LFB A;  4P96 A;  1GT0 C;  3AL0 C;  1S6L A;  2Y0S N;  1JT6 A;  2DA2 A;  1POG A;  1XTA A;  4F91 B;  4CXF A;  3MMY B;  4C2M J;  3L2U A;  1R4N B;  1YW8 A;  2A68 F;  4FX4 A;  1IRX A;  2IGK A;  5LLQ A;  2E35 A;  3HRT A;  4LLN A;  1FTZ A;  1FMV A;  1X1A A;  1HW1 A;  2OD5 A;  3N97 A;  2HEO A;  4EEF G;  2X85 A;  3C1D A;  2KP6 A;  2QQA A;  2JQ7 A;  2KKO A;  2DQR A;  2XB0 X;  3L00 A;  1OFC X;  1KQ8 A;  3ROU A;  4D9J A;  1EF4 A;  1QHH D;  2JK3 A;  3GTL J;  3VOD A;  3EET A;  4XRM A;  3ZR8 X;  2EV6 A;  4WXC A;  4GYG A;  3ZRG A;  2GA2 A;  2BXZ A;  4E6K G;  1FX7 A;  2AO9 A;  3HKZ A;  3I4P A;  4E70 A;  3S1M J;  3H0G J;  4EJV A;  1T8I A;  3E97 A;  5CVJ A;  1SFX A;  2FOW A;  3J81 K;  2HVR A;  4ZTF A;  3K4N A;  3K70 C;  5J1R A;  5E8G A;  3KLO A;  3A2K A;  1RIO H;  4QPQ A;  2WB1 N;  2HDW A;  2PMU A;  4EJW A;  3OYF A;  3V7R A;  1ETY A;  2G7H A;  1ZH5 A;  4GO1 A;  1FNN A;  2VKD A;  2HQ5 A;  3BR6 A;  2HZD A;  2M7B A;  2X6X A;  1HLV A;  1XD7 A;  4FQG A;  4OIO F;  3OL4 A;  4E7I A;  4L5J A;  2F6C A;  5JR3 A;  2DJN A;  1JGG A;  1JKO C;  1Y39 A;  1QPM A;  3P5J A;  1L0O C;  1RRJ A;  3HGG A;  4NHJ A;  3WU0 A;  2A69 F;  3VFZ A;  4LB5 A;  1I6X A;  4AIJ A;  2R7T A;  2XPW A;  4MEX F;  1VQ6 I;  1NG6 A;  3FK7 A;  5K1Y A;  5K7F A;  2BVM A;  2D1V A;  3BZC A;  5IP6 A;  3OYK A;  1BI2 A;  4JYK A;  5CVI A;  2CMP A;  2R0Q C;  1WRJ A;  1H0M A;  2IGM A;  3OIQ A;  2JA7 J;  1R7J A;  1MW7 A;  4A3B J;  5DCM B;  2IGO A;  5IOY A;  4LJZ F;  4IXA A;  1D0Y A;  2MBF A;  5LHI A;  4U0W A;  2HZT A;  1EH6 A;  2XRO A;  3GFI A;  1I3A A;  3IC7 A;  2EIJ H;  2XF6 A;  1KZH A;  3SZG A;  4CZZ A;  3H9J A;  5GPC A;  2DU9 A;  1YLF A;  1S7E A;  2RQP A;  3CQZ J;  3GLX A;  2ZO4 A;  4NDL A;  4Y33 A;  2X0L A;  3H5R A;  4GXO A;  4CGZ A;  3CUQ B;  2RV8 A;  4XRF A;  1FYM A;  5IP7 J;  3J81 Z;  5J8F A;  3DPT A;  3I64 A;  1EH7 A;  4XOR A;  5FKM A;  1BR1 A;  2GXA A;  2XAU A;  3AG1 H;  3OY9 A;  1ZAR A;  3JRC A;  1I6H J;  1WJ5 A;  2BVL A;  4O6J A;  2HPI A;  1YS6 A;  1MMG A;  2DMU A;  4BY1 J;  4L0Z B;  1IRZ A;  4PFP A;  2KPM A;  3MFK A;  2CGP A;  4UUS A;  1WQ2 A;  3IRQ A;  3OYD A;  3CO7 C;  3ZQI A;  2BXY A;  3H5N A;  1S5L C;  2GAU A;  1B1B A;  1JHF A;  2E36 A;  2P7V B;  3CES A;  1QRY A;  3ZXS A;  4A3L J;  1NHA A;  2EFN A;  3V4G A;  3K1M A;  1IN6 A;  3QPS A;  5BOX A;  3G71 I;  5CQE A;  4L5I A;  2Y31 A;  4HST A;  2FOK A;  5FO5 A;  4OWR B;  3IAM 2;  2KRH A;  1V5E A;  4HRI A;  1S72 I;  3CJN A;  4A0Z A;  2VLA A;  4M6Y A;  4D1Q A;  5HLG A;  3IWF A;  3Q3S A;  3V42 A;  1Y1W J;  3A01 A;  3BP8 A;  2BHZ A;  3Q9S A;  1CGP A;  2V1N A;  3WG7 H;  1VQM I;  2VON A;  2DPU A;  3BC8 A;  2CV2 A;  2E7X A;  1ETQ A;  4BQQ A;  2LP0 A;  1XDU A;  4U0V A;  4ZYA A;  3HOW J;  1VQK I;  4RGX A;  2GA1 A;  3L9F A;  1SAX A;  1JT0 A;  4B48 A;  2GQQ A;  3H9G A;  2LRD A;  4LFU A;  3VPR A;  3HOV J;  1SD6 A;  3W2V A;  1XGN A;  2OBP A;  4XLA A;  1P2F A;  5DCF A;  1K78 B;  1IUY A;  3FWE A;  5GTI C;  1U2W A;  1LPQ A;  3L2C A;  1I5Z A;  4ZZL A;  3DTK A;  4Z6Y A;  5LEK A;  4C2T A;  4LIU A;  1Z05 A;  5L3D A;  5J1Y A;  2HKO A;  3DLA A;  3WHC A;  3MKW B;  1P4A A;  2COB A;  1H9G A;  3OIP A;  2EIL H;  1F9N A;  1FC3 A;  1EV7 A;  2QGU A;  1DQU A;  1MH4 A;  2VT2 A;  1TLH B;  4U7B A;  2CJJ A;  1ERD A;  4PGH A;  2EIK H;  2CS3 A;  3OYH A;  2XB5 A;  2EB7 A;  5M3M J;  3DKW A;  4XLF A;  5B66 C;  4I02 A;  4IRG A;  5TRD A;  3GZ5 A;  1P7I A;  2DN0 A;  4YII A;  5L3C A;  4B8X A;  1WHU A;  2VAS A;  3F8M A;  3PL8 A;  2LD5 A;  1OR7 C;  1R1T A;  1NH3 A;  5EZG A;  4A3I J;  2QF7 A;  1SVO A;  3S3M A;  3BR1 A;  5D5X B;  1X3U A;  3G3Z A;  1Y8Q B;  4XIC A;  2P8T A;  3A1Y A;  5HDG A;  2UV1 A;  4PJN A;  1Z21 A;  2N8G A;  2L9S A;  4BHP A;  4X6A J;  4Q4Z F;  3HUG B;  1JKQ C;  2Q8K A;  2KDZ A;  4R8H A;  1WCM J;  2VQH A;  2K40 A;  3JSO A;  1ZR2 A;  2Y0S A;  2C6Y A;  3NAR A;  3UNG C;  3BR0 A;  1X58 A;  3BG6 A;  3JRE A;  3T5X A;  2FNP A;  1WJF A;  3R0A A;  1I27 A;  3LSK A;  3JTG A;  1MSF C;  3I9V 2;  1MBE A;  4FAS D;  1IV6 A;  2DA6 A;  5CJ9 A;  3CDL A;  3ZMZ A;  1YE9 A;  1LJ9 A;  4YEL A;  1SVL A;  3CLO A;  4AYB N;  2CYY A;  3FXU A;  2NVT J;  4CIC A;  1IF1 A;  2K3F A;  5B1A H;  2AXT C;  5K7Z A;  1H89 C;  2MSY A;  2EIM H;  2P5V A;  3MCZ A;  1K79 A;  2DMP A;  4RGR A;  1AHD P;  3BTJ A;  4ZYG A;  3J7Y J;  4II3 A;  3L7W A;  1XG1 A;  5C3E J;  4PSW A;  4IOA F;  1HOM A;  4RB0 A;  3WE3 A;  1VQL I;  2W57 A;  3KYD B;  5E1X A;  3VSK A;  4HSR A;  1UJ8 A;  3HBL A;  3JCU C;  1TTY A;  1ZG3 A;  5D8L B;  3Q9V A;  1CQT A;  3LOC A;  1W5S A;  2WB1 A;  3HTU A;  4B44 A;  4BAY A;  3PQJ A;  4ZDP A;  1IRG A;  5JVT A;  5AIP A;  2QQ8 A;  3NWS A;  2DT5 A;  3S2D J;  2VC1 A;  5J3L A;  2R7Q A;  2DFH A;  2M7A A;  1ENH A;  3HRM A;  4A3G J;  3K4K A;  1E3O C;  1GVD A;  1V5F A;  4EVI A;  5DCM A;  3RYP A;  2Y9Y A;  1D1B A;  3G2B A;  2RVC A;  4OIP F;  1IJW C;  1OLT A;  5E17 F;  2EV5 A;  2RGV A;  2VXZ A;  4PJJ A;  2D5V A;  2DA4 A;  3OYB A;  5D5V B;  4HV6 A;  4A2U A;  3WTW C;  5FRM A;  2QQB A;  3CUQ A;  1Z6R A;  1ZEL A;  4M3B A;  2JUC A;  2LRE A;  2NOJ B;  3AKZ A;  3I4M J;  1JXS A;  2LNB A;  2VJJ A;  1FP2 A;  1YQA A;  4MO7 A;  1B8I B;  2Z3Y A;  3SJM A;  2G9W A;  2LBF B;  2W82 A;  3FXO A;  4UNO A;  3BG9 A;  2F4M B;  4L9J A;  1KU7 A;  2P4W A;  3BR2 A;  3BR3 A;  2H94 A;  3U1K A;  2M8G X;  2QCO A;  4M72 A;  2WWY A;  4CCK A;  3H1C A;  4IOC F;  1P4W A;  1O4X A;  3HSR A;  2LTP A;  1STZ A;  1JUP A;  2TRT A;  4HA8 A;  3TOA A;  1LDD A;  1ORK A;  3A02 A;  1QZE A;  4YFN F;  5EJC A;  2L7Z A;  2BZT A;  3HEF A;  2WAQ N;  4G6D A;  4AD9 A;  3H3V K;  4G6T B;  2NNY A;  2XDV A;  1GVJ A;  1J75 A;  3K6G A;  4MIM A;  1MBF A;  4CYC B;  4M3G A;  4IHS A;  1T33 A;  4YG2 F;  3ZQC A;  1C0W A;  1LNW A;  2DT6 A;  4XM3 A;  5F0C A;  2L54 A;  4D0P A;  2QKM B;  4HYE A;  5J1U A;  2ZJR F;  4AM3 A;  2MYS A;  1SMT A;  4LIT A;  3S1R J;  2EZL A;  1TWA J;  1VQO I;  1J9I A;  2ETH A;  3GF2 A;  3TBI A;  2DMT A;  3WTT C;  1R71 A;  4F55 A;  3M4O J;  2JA8 J;  4XLE A;  2VOO A;  5DD8 A;  2RC4 A;  3MQ0 A;  1U0J A;  2RDP A;  4P5O A;  3EPZ A;  4JQF A;  2L7K A;  1Q1V A;  2DMN A;  1BR2 A;  1K78 A;  1F5T A;  1TWF J;  4IRI A;  4NC8 A;  1HW2 A;  1G3W A;  3BJA A;  3F22 A;  1FP1 D;  1YIO A;  5J4Y A;  3CP2 A;  3KZZ A;  5CVV A;  2GZW A;  1HKQ A;  4FIS A;  1U5T B;  2STW A;  4EJT A;  2J5P A;  4G8X A;  1Y0N A;  2X51 A;  1IGN A;  1Z7U A;  5DTD A;  1N25 A;  4FX0 A;  2NVU B;  1X2M A;  3FXJ A;  3S32 A;  4CSW A;  3GTQ J;  2W7N A;  4RAG A;  3GUD A;  1XMX A;  1BL0 A;  4GGG A;  3OYG A;  3L2V A;  2W4S A;  4ESJ A;  1ZR4 A;  3FKJ A;  2DA1 A;  2H8W A;  2R7V A;  4S0H B;  2VJI A;  5EYR A;  2Z5U A;  3K1N A;  2EBI A;  4EJU A;  3L2Q A;  1BC7 C;  3LAJ A;  1KYW A;  2KRF A;  3CF5 F;  1S29 A;  3DKX A;  3M07 A;  5LFA A;  4ZZD A;  1R5I D;  2GOM A;  1Y8R B;  1PJR A;  3H0D A;  3RYR A;  3C7J A;  2XGD A;  3OWT A;  4DJA A;  3FXM A;  1Z7L A;  4AIK A;  2OUM A;  2NVQ J;  1MH3 A;  2F5V A;  2ID3 A;  4IPA A;  3CF2 A;  1GUU A;  1MBK A;  4MLO A;  1B72 A;  4XBF A;  3HUG A;  3RPU D;  4BXX J;  2VL8 A;  3WTX C;  5FRN A;  3GZ6 A;  4RB2 C;  1TL8 A;  1IRF A;  3BZ6 A;  1Z3Y A;  3A0H C;  4XSZ F;  3OR2 C;  2E2H J;  2NS7 A;  1LKX A;  1LFP A;  2BHY A;  1D5V A;  2FBH A;  4RM2 A;  2WAE A;  3CD6 I;  1S8N A;  2CRG A;  5HLT A;  2QZ8 A;  1R5G A;  2Q0O A;  2L2O A;  3ZQQ A;  1QHG A;  2HWV A;  1TT0 A;  3Q0U A;  3ZQG A;  3I53 A;  2P5K A;  3W6V A;  3DLL F;  5CLS A;  5EG0 B;  2ME6 A;  2RAE A;  2O8K A;  1IZ1 A;  2HOT A;  4BQA A;  3FMS A;  3E1S A;  3QU6 A;  1B6A A;  5DD4 A;  1MBJ A;  2EFQ A;  2IXS A;  3R61 A;  3S2W A;  2KIM A;  4B47 A;  1VZ0 A;  3HL2 A;  4YIF A;  2DYR H;  4KIC A;  3E6C C;  4XLP F;  4LK1 F;  3I54 A;  2R7F A;  5JVG F;  5C4X J;  1YJ9 I;  1YI2 I;  4AYB A;  2XIG A;  3ZCO A;  1O3R A;  3BDD A;  4J01 A;  2NS0 A;  2KIS A;  3PIO F;  1KGS A;  3MWM A;  4CCJ A;  3RZO J;  5DEQ A;  1QQI A;  4RB3 C;  3I4N J;  1Y0U A;  5E3O A;  4MTD A;  2D45 A;  3EQL F;  1E17 A;  1Z3X A;  4BYY A;  3LQR A;  2TDX A;  4ETS A;  4HQE A;  1KQ9 A;  3DBR B;  4WK8 F;  2X6Y A;  1W0U A;  1FY7 A;  1KQ0 A;  4JX4 A;  1RUO A;  1Y6I A;  1R36 A;  2OTJ I;  1KYZ A;  4I7H A;  1DGR M;  2KRC A;  4EGZ A;  2A5Y B;  3BJO A;  2R5Y B;  4BL0 B;  4BJT A;  2FQ4 A;  2DT7 B;  3S16 J;  2CSO A;  4M3E A;  3IUO A;  4D5F A;  2TCT A;  2EWN A;  3VEP A;  2JSC A;  1XMA A;  2BY1 A;  3S17 J;  5HLI A;  2KL4 A;  3DCF A;  4DBQ A;  2EIN H;  2P7C B;  3GTP J;  4FHT A;  3ABL H;  4LLL A;  1WH7 A;  4U7D A;  4A3C J;  1B8I A;  1WJA A;  2M4G A;  2GIV A;  4BQO A;  1ON1 A;  2LBF A;  2XKO A;  3O2P E;  4F3Q A;  2XUB A;  1DU6 A;  4UUT A;  2VPL A;  5FFX A;  2GOX B;  3LA3 A;  4KDP A;  2X1D A;  3ELK A;  3HGY A;  3KP7 A;  3CLQ A;  4CA0 A;  3JRG A;  2ZB9 A;  1SAN A;  2V1D A;  2PG4 A;  1BIB A;  2XGE A;  1YIT I;  1J0R A;  1W4M A;  2QUF A;  1T95 A;  3CMM A;  4RA2 A;  4B09 A;  2HU9 A;  2R7O A;  1DDN A;  2QVO A;  3RQ4 A;  1SD7 A;  2ZFU A;  4BUP A;  1ZGW A;  2FD5 A;  2B63 J;  2BY3 A;  4CYC A;  3GW2 A;  2VT3 A;  3D5R C;  2AS5 F;  1EA3 A;  1T08 B;  3HG9 A;  3BQY A;  2VBX A;  3SZP A;  2DAO A;  3HTS B;  2HS5 A;  5TJJ A;  1VTN C;  4OMY A;  4BQN A;  4N4O B;  2E1N A;  3WTU C;  2CUJ A;  3E5U A;  1XGO A;  2G7U A;  3E6D A;  3OYE A;  3IAS 2;  3QAH A;  3KX2 A;  2O7O A;  4Q47 A;  2KJB A;  3CTA A;  4KMU X;  3CUO A;  4RM3 A;  1EH8 A;  2WAQ A;  4BU2 A;  2E5N A;  5H6R A;  3CC7 I;  3P9I A;  3MKY B;  2B9S A;  1WSU A;  3T8T A;  2VUM J;  4A0X A;  3ZGK A;  4PUS A;  4XON A;  3IRR A;  3F23 A;  2XAQ A;  2VXD A;  4XMY A;  2Z1D A;  1IO2 A;  1I1G A;  1U5T A;  3Q0V A;  5ICF A;  2WTE A;  1FPQ A;  2KZV A;  2BOL A;  1IDZ A;  3P7N A;  2BY2 A;  3PO3 J;  2E1C A;  5FGM A;  1RES A;  1TBX A;  4KIT B;  1IW7 F;  5C4J J;  4U0Y A;  3HOX J;  2OZU A;  4O3M A;  2UXN A;  3HOZ J;  3ABM H;  1RPW A;  1LEB A;  4C2U A;  4X0G A;  3CC2 I;  2ZME B;  5DV5 A;  1TNS A;  4DYQ A;  2X48 A;  3X2Q H;  4M9S A;  2Z9O A;  4F52 A;  1T38 A;  5IT9 K;  5TGT A;  3TP0 A;  1U8R A;  2M34 A;  1HDP A;  1U8B A;  3F9K A;  3RPU A;  4M71 A;  3GTJ J;  1HDD C;  2MH2 A;  3HPH A;  5F0H A;  2P5L C;  5JFR A;  4DGW B;  1W36 D;  2DMQ A;  2ELH A;  4KJZ A;  2EJR A;  3JSP A;  1G3S A;  3HM5 A;  3RKW A;  1E2X A;  4XKC A;  1BJA A;  2LVS A;  5FKN A;  2R93 J;  4PSX A;  3V7S A;  3GME A;  3M1C A;  2M0C A;  1JHH A;  4IHW A;  4A0Y A;  2PX9 A;  1PP8 F;  4GYI A;  2MLG A;  3HOY J;  4G7Z F;  2E7W A;  3KP4 A;  5IT3 A;  1E3H A;  1U6G A;  4DYC A;  1J09 A;  2DK8 A;  1T0F A;  5F1R A;  2ECB A;  1HC8 A;  4I6Z A;  4M3D A;  2M9H A;  2GXG A;  1W1W E;  2Z16 A;  2CQQ A;  5EG0 A;  4XKB A;  4Q5S F;  3CUQ C;  4KNY A;  4KN4 X;  3GTG J;  1LVK A;  4WCG A;  3CCJ I;  5IYD J;  3U1D A;  1FMW A;  1WGX A;  1OKR A;  1RR8 C;  5H2F C;  4CHU A;  4EJO A;  1X3Z B;  5FLX K;  2LY9 A;  3O8H A;  5HOD A;  2FA5 A;  2UUZ A;  5HDK A;  2ADU A;  5ICC A;  3ISP A;  1BW6 A;  1OCC H;  3A0B C;  4I09 A;  2D2W A;  2CUZ A;  2YU9 J;  2IS2 A;  5IT9 Z;  1QGP A;  4IJA A;  3T0Y A;  3I56 I;  1B4A A;  1BN5 A;  1J5Y A;  1BM9 A;  1Z0X A;  2QWW A;  2WY7 Q;  3OYL A;  2LKX A;  1MKM A;  3EUK L;  1QVU A;  5E3N A;  3BRO A;  4HG2 A;  4MQ9 F;  2WBM A;  3BCB A;  3I59 B;  1WWX A;  4RAF A;  1MJA A;  3HDD A;  1MZB A;  5LGU A;  4BJ5 C;  3BZK A;  3OOP A;  5LHG A;  3M8F A;  3NWT A;  4H0E A;  5JLX A;  2PLY A;  4OMZ A;  3AFH A;  5E1W A;  1K4S A;  1QU3 A;  3BQZ A;  2FE3 A;  4AVP A;  3H35 A;  5LEJ A;  2LY1 A;  2R5Y A;  2ME0 A;  2IRF G;  4RBO A;  2O03 A;  3S14 J;  1YTY A;  5J8C A;  2F48 A;  3JRH A;  4MHG A;  3ESW B;  2OU2 A;  2VPR A;  1JTX A;  2R7Z J;  1GXQ A;  3I71 A;  4N0B A;  3Q5F A;  3K70 D;  1X3W B;  3L2R A;  4JBA A;  4ZYD A;  3M8E A;  3FHZ A;  1QZZ A;  2ECC A;  1D0Z A;  2L4M A;  1R58 A;  3A4C A;  3M8J A;  5IP9 J;  5M5X J;  4DQ2 A;  3GYH X;  3F8B A;  4A5N A;  2P6S A;  2DFE A;  2FX0 A;  1FOW A;  2GBY A;  3ML6 A;  2ISY A;  3BTC A;  3TGN A;  3HHH A;  2OV7 A;  2DOA A;  3FF5 A;  3REO A;  4DIQ A;  5LD2 C;  2LKS A;  2ZCW A;  2OPT A;  5FLX Z;  4KUM A;  1IAW A;  4LOC A;  2L02 A;  3OSF A;  2H6B A;  3PNV A;  1K7A A;  3CJT B;  1JUS A;  1A5J A;  4DW6 A;  2EZH A;  3KCC A;  3DFG A;  4XRS G;  2ZC2 A;  1NK3 P;  1FBU A;  4M73 A;  5HVQ C;  1YJW I;  2JVG A;  3K2Z A;  3ERE D;  3E3V A;  4KMF A;  3BPX A;  1N77 A;  3BOQ A;  1TWH J;  1WJD A;  3F72 A;  3WGI A;  1P4X A;  2XF5 A;  4MTE A;  3PSI A;  1YO5 C;  3UR3 C;  4GDF A;  4EQQ A;  2OZ6 A;  3WG9 A;  1UZC A;  4F93 B;  4BE2 A;  1QZY A;  1MJ9 A;  1R1U A;  2LOO A;  3G1M A;  1UG0 A;  5IYB J;  2M30 A;  3U2R A;  3VDX A;  5JI6 A;  4A5M A;  1ZGJ A;  2RQQ A;  2MGQ A;  1ZYR F;  2YU3 A;  3KET A;  3CC4 I;  1BOA A;  1FSE A;  4C3H J;  3BPV A;  3ZMU A;  5D8K B;  2X6W A;  2K86 A;  4M6V A;  4HDU A;  2Z99 A;  4BDY A;  4RLF A;  2PI0 A;  2HI3 A;  4OAY A;  4OIN F;  3K1P A;  5GAE J;  4NC7 A;  1D1A A;  5FLV A;  1W5T A;  2Y48 A;  2VKE A;  4J00 A;  1KU2 A;  2ZSI B;  3JRB A;  3B73 A;  4HF2 A;  2KZG A;  2ZME A;  2H1K A;  1TW3 A;  3D0S A;  3FXR A;  4ITV A;  3OSG A;  4NB5 A;  4WWC A;  3CO6 C;  4XKV A;  3R6S A;  2IS6 A;  1ZTR A;  3BTI A;  1JUM A;  5FRO A;  4HDV A;  2O0Y A;  2QEN A;  2LF7 A;  3GZN B;  2E2I J;  1IG7 A;  3IKV A;  2HDD A;  2DBB A;  2CU7 A;  3ZMS A;  1MMS A;  1LEA A;  3MVP A;  1FOK A;  4UB8 C;  3CCY A;  1B72 B;  1LE8 B;  3FDY A;  3JRI A;  3GFL A;  2L9V A;  2K7L A;  1UCR A;  1OCO H;  2AHQ A;  3QOD A;  3QP5 A;  3COA C;  1XSD A;  3PUB A;  3JAM K;  1XPX A;  1A35 A;  2XRL A;  2PEX A;  5CPR B;  4M9Z A;  2V1U A;  4HLY A;  2W85 A;  4MQV A;  2V79 A;  3LA2 A;  4U88 A;  3WE2 A;  4IEJ A;  4L5E A;  4KT6 A;  2ZSH B;  1OJL A;  4S05 A;  4LG0 B;  1M1E B;  4FE7 A;  2HOS A;  3LL7 A;  3SXY A;  1H88 C;  2V4J C;  4M74 A;  4ZTJ A;  4BBS J;  1QA6 A;  5D5W B;  2PFB A;  2GXB A;  3BY6 A;  5DUI A;  1HCR A;  1GXP A;  2Y9Z A;  5FKK A;  1SMY F;  3F6V A;  2L7F P;  1MNE A;  3M1E A;  3LNQ A;  4U87 A;  1R49 A;  2B7E A;  3P9K A;  4KT5 C;  3O8G A;  2XAG A;  1OQY A;  5D4R A;  4KYW A;  2MAB A;  2XSD C;  1AWC A;  3DU6 A;  3K4B A;  1ZGA A;  4AUX A;  2DTR A;  1I1S A;  4QIW N;  5EEG A;  2DCE A;  2PJP A;  3CZ6 A;  5D5U B;  2NVX J;  4Y4R A;  3TOB A;  1NK2 P;  2O9L A;  4BAC A;  3OYM A;  4L18 B;  1RI7 A;  1XC5 A;  2UXX A;  1FT9 A;  4ZYE A;  4MEY F;  3QQA A;  3I59 A;  1OCT C;  2WV0 A;  3KZI C;  2ZKZ A;  3PIP F;  2OQG A;  3PNT A;  1WVR A;  2JWT A;  4FE4 A;  1Z6T A;  2Y75 A;  4UY8 I;  2CWE A;  1NG7 A;  4XK4 A;  5K5R A;  3KE2 A;  2J5O A;  1B59 A;  3J7Z I;  5KVR A;  2BW3 B;  3NRV A;  1VI0 A;  3JAM Z;  2IBD A;  2HYG D;  1WFX A;  3DPU A;  1MSE C;  3ZMT A;  3K10 A;  2KFD A;  1FTT A;  3V7C A;  3C3W A;  4CCM A;  2BGC A;  3W6K B;  1DU0 A;  5C44 J;  1DGW Y;  2JN6 A;  2VE8 A;  2HNH A;  2RRE A;  3BLY A;  2F5F A;  3LST A;  3IHU A;  4QWQ A;  3QYF A;  1G3T A;  3KIO A;  1R00 A;  2K3P A;  3KZY A;  3BG5 A;  4JX6 A;  3QOE A;  1OCP A;  1IDY A;  5FKO A;  4C3J J;  1ACI A;  2KIU A;  3FMQ A;  4IL6 C;  2BEO A;  4IZZ A;  1ITY A;  4DBR A;  5IOZ A;  3WTZ A;  2KT0 A;  2H27 A;  4WF2 A;  1UG2 A;  3DEU A;  2NOG A;  4YFK F;  4F92 B;  3EYY A;  2FU4 A;  3OOU A;  3F8C A;  4BEH B;  2E1O A;  1Q1H A;  2K9M A;  1RR7 A;  3OYC A;  4HPQ A;  3CDI A;  1QPI A;  4RAZ A;  2ZFW A;  1Y1V J;  4AWX B;  1ETO A;  3IH2 A;  2FEZ A;  3K4M A;  2R7W A;  1SC7 A;  3HRU A;  1ZLJ A;  3QOP A;  5ERI A;  1ZN2 A;  1W5C C;  2NXN B;  2K9N A;  2X4H A;  4IHY A;  1MIJ A;  2K9L A;  2E2J J;  2XHK A;  2A07 F;  4Q48 A;  3VB2 A;  3BJ6 A;  4KN7 X;  5LRS A;  2OCE A;  2Q2E B;  4LLG F;  2NYX A;  1U9O A;  2VQC A;  4DNC A;  1ZHF A;  3ULQ B;  2K9Q A;  3L2W A;  3EUH A;  2ELJ A;  3DBL B;  2EA2 A;  1G59 A;  3IV5 A;  3GCM A;  3V8J A;  5BQT A;  3LSI A;  4A69 C;  4I2O A;  2M45 A;  2OAZ A;  4HOB A;  1CF7 A;  1MNM C;  3KP3 A;  5E8I A;  2ZXH A;  2I10 A;  2VC0 A;  4EM2 A;  4XNF A;  1KU9 A;  2R7S A;  3FBN B;  3ONQ A;  4RMN A;  5E3L A;  3UKG A;  1JTY A;  5L3G A;  2CQ7 A;  4HQM A;  1BI1 A;  1HST A;  4TV7 A;  4ENJ A;  3N05 A;  2PN6 A;  1MDM A;  3DU5 A;  2LR8 A;  1P92 A;  2ZNY A;  3CMA I;  1MJB A;  2NS8 A;  4IRH A;  3ZN0 A;  2O61 A;  2WY8 Q;  1TW2 A;  2H6C A;  3GBG A;  3HYI A;  2OJE D;  2I5U A;  4RGU A;  3G1O A;  4Y3O A;  2W84 A;  5J4V A;  4UV8 A;  2VQL A;  2M4K A;  1T39 A;  4L9N A;  1GV2 A;  1T0F C;  2IS4 A;  2VJ4 A;  1IC8 A;  1MBG A;  2DFF A;  4N4N B;  2KJC A;  1F43 A;  4ZDO A;  1SFU A;  3LMM A;  3GFJ A;  1YS7 A;  3LAP A;  2XVC A;  5D6E A;  3DQV C;  5K5Q A;  4BHC A;  2YX4 A;  4BJ6 C;  4BS9 A;  5EGO B;  5FKL A;  1PP7 U;  3WOD F;  1HF0 A;  2VOD A;  3K69 A;  1LFU P;  1D5Y A;  2NRA C;  3DKY A;  1G2H A;  3OYI A;  4BDZ A;  1LE8 A;  2CFO A;  3S8P A;  1HSJ A;  3ZPL A;  1FWZ A;  3SQN A;  1U9N A;  3ZQ7 A;  1LDK B;  3S1N J;  1VQP I;  2QEX I;  3QU3 A;  4OAZ A;  2JUG A;  5HS8 A;  2XPV A;  1U78 A;  4LG0 A;  2E5Z A;  2X1E A;  1XCV A;  3FHN A;  5IYC J;  1XB4 A;  2CQX A;  4MFE A;  1IXR C;  1G8X A;  3GXO A;  1Z1D A;  3D5S C;  4RAY A;  3TO6 A;  1T6S A;  1FYL A;  1DUX C;  4G7H F;  4AIH A;  3NEU A;  5AON A;  4Y17 A;  5KHD A;  1QVT A;  4B4C A;  1TWC J;  5DM7 F;  1P6R A;  4WX9 A;  3PSF A;  5E3M A;  3O6B B;  2RKH A;  3SFZ A;  1D0X A;  2CW0 F;  2CH0 A;  4M3F A;  1R5H A;  3NAU A;  4C3I J;  1MGT A;  2YSR A;  4A3K J;  2JVH A;  2VQG A;  4ENK A;  2BBY A;  1WZ2 A;  1A36 A;  3AG4 H;  3ZP5 A;  3V8L A;  3B02 A;  2LFB A;  2ISZ A;  3LSJ A;  2EV0 A;  3TKY A;  1PYV A;  2QQ9 A;  3CCL I;  2LG4 A;  2E1M C;  2LSO A;  3QYE A;  3HPG A;  1ETV A;  2M1B A;  4HF0 A;  3ASO H;  5L3E A;  1ON2 A;  3RCO A;  2E34 A;  2YX7 A;  3QYB A;  4AC0 A;  2E19 A;  4D7N A;  3GTK J;  2XPU A;  2IGN A;  1UST A;  2L9N A;  2LY2 A;  1IN8 A;  1ZRF A;  5LBQ A;  2IJL A;  3RZD J;  3TDU C;  2BW3 A;  1YJN I;  1X4O A;  1VF9 A;  2F2E A;  2FML A;  1UMQ A;  3VYT B;  2ZJP F;  4FCY A;  1LB2 A;  5ICG A;  1OIS A;  5E18 F;  3MD2 A;  2XC7 A;  4BNC A;  3ASN H;  4IQJ A;  3CCM I;  2OF7 A;  2DFI A;  2DPD A;  5IY5 H;  1IXC A;  2BYV E;  3ECO A;  1D1C A;  2HVS A;  2FF4 A;  3LA7 A;  4N9I A;  1USS A;  2DW4 A;  1ZAO A;  2AQE A;  3KYC B;  4KIB A;  2WV1 A;  4NQW B;  2H8R A;  4E7S A;  2L4A A;  1R1V A;  3ZOB A;  4BEH A;  4CCO A;  3F8N A;  3GEZ A;  1FBS A;  4C9Y A;  2OA4 A;  2H1L A;  2Y69 H;  2F4O B;  2A3S A;  2FRH A;  2HTJ A;  5LHH A;  1RC9 A;  2FJ1 A;  5LGT A;  1I50 J;  4ABZ A;  4BXU A;  2PBI A;  3AG3 H;  2XAF A;  5DDG A;  4LB6 B;  2DDB A;  3WGH A;  3C2B A;  2W25 A;  2K5C A;  1QO0 D;  4G94 A;  4XOT A;  2A6E F;  1RET A;  2EFP A;  2LYC A;  3S3O A;  3C2G A;  5LRR A;  1W36 C;  2Q2E A;  1L3L A;  2MFZ A;  1AOY A;  5L3B A;  2R92 J;  1V4R A;  4IVN A;  2HOE A;  3VYU B;  3OIO A;  4NC6 A;  1W0T A;  3F3X A;  3I3L A;  3TDZ C;  4HNT A;  4A3F J;  4HBL A;  4KFC A;  4BXF A;  2M5W A;  2Y30 A;  3FIS A;  1S7O A;  4UHT A;  4IX7 A;  2HDC A;  1ZG1 A;  1TWG J;  2E71 A;  1PDN C;  1HQC A;  2VBZ A;  1YX5 A;  2BE5 F;  3WTV C;  4LK0 F;  3RKX A;  3E6B A;  2PJR B;  2EQR A;  4M6X A;  2ZXW H;  4XOP A;  1E3P A;  4XN0 A;  1JE8 A;  4I01 A;  1XSV A;  5HS7 A;  4IO9 F;  4RB1 A;  1ULY A;  4L9V A;  4G6Q A;  2HQA A;  4L0Y B;  1XS9 A;  1EJ9 A;  5KAF C;  2K4J A;  5M3F J;  1O3T A;  5KAI C;  1A6I A;  4HX7 A;  3FM3 A;  2KHM A;  1E0E A;  5JHU A;  3RDI A;  4PCQ A;  1K61 A;  1N75 A;  1D8J A;  3A03 A;  3LFK A;  5EGO A;  3MKZ A;  2JPC A;  3LSP A;  2CG4 A;  3ZMD A;  3IH3 A;  1UHW A;  3KLN A;  4HLX A;  1MMD A;  5B5E C;  3SYT A;  2FSW A;  2KMU A;  4V2F A;  4HEA 2;  2IW5 A;  4BY7 J;  5GTH C;  2QLZ A;  4A3M J;  4ON0 A;  3H9Q A;  1WH5 A;  2LLK A;  3KEO A;  1PUE E;  5E1Z B;  1VQ4 I;  2JSP A;  5EEH A;  1A04 A;  3ABK H;  3DEE A;  3E0J B;  1ZRD A;  3DTI A;  3PQK A;  4E7J A;  3MZH A;  3G73 A;  1ZRC A;  2JZY A;  4KIG A;  1T2K A;  1Z67 A;  3S93 A;  1DP3 A;  2GLO A;  3VOE A;  5KK1 A;  3TO7 A;  2HTS A;  5FB2 A;  5GPA A;  3H3Z A;  5JHF A;  2R7D A;  1X1C A;  2Z2S B;  3FM5 A;  1K6O A;  2KIQ A;  4MGR A;  3M3Y J;  4LD5 A;  4Y15 A;  2QSF X;  4ANJ A;  5M5Y J;  4DOZ A;  3FZV A;  2FNA A;  5GAH J;  3OYA A;  3DPL C;  3Q0W A;  3GLL A;  4HNV A;  3AL0 B;  1RNL A;  3TW6 A;  3HC7 A;  4DYR A;  4EV0 A;  1RKW A;  3FX3 A;  1FZP B;  3C18 A;  4XLH A;  3G4S I;  5BPD A;  2CQK A;  2HPM A;  4Y13 A;  1PUF B;  1XMK A;  2B0L A;  2QKL B;  1OCZ H;  5DYM A;  5F27 A;  2UWM A;  1BC8 C;  1XN7 A;  1Z9C A;  3KPH A;  4FET A;  4P9U A;  3J7A Y;  5FJ8 J;  4ZYH A;  4PJ0 C;  1X1D A;  3CCS I;  1BI0 A;  3MN2 A;  2AQF A;  1ZQ3 P;  4E7K A;  1BJZ A;  1MD0 A;  1R6R A;  4F7Z A;  1K83 J;  1H9T A;  4I76 A;  2MC3 A;  3E7L A;  3BG3 A;  3AG2 H;  5J40 A;  2V1X A;  4PZJ A;  2Y0M A;  4I99 C;  3BTL A;  2W00 A;  4E4H A;  3KP2 A;  3QPT A;  2OTL I;  1X1B A;  2IP2 A;  2QBY B;  3ZQH A;  3NQO A;  2V9V A;  4MFD A;  2ESN A;  3LSR A;  3PNY A;  1Z77 A;  1YX3 A;  4XRS A;  2CV1 A;  4BE1 A;  4B1R A;  2R4G A;  4GRI A;  2P6T A;  4BH9 A;  3J80 K;  4A12 A;  5HOO A;  1LUJ B;  2JRT A;  1MMA A;  4XL9 A;  3HXL A;  3DP7 A;  1SVM A;  3EUH C;  2DOE A;  4PJM A;  4M9X A;  4I98 B;  2L9R A;  4JK1 X;  1TZL A;  2HVQ A;  2V7F A;  3WGG A;  3MEX A;  5ICE A;  2YUS A;  4JP0 A;  1X2N A;  2JMW A;  2ICW G;  3HZJ A;  4NQW A;  4E7H A;  5AIQ A;  3KEQ A;  1SAU A;  3BCA A;  2QSG X;  5D6F A;  3LSM A;  2F5D A;  4UV9 A;  2LDU A;  1FBQ A;  3JR9 A;  2FMY A;  4NUB A;  2JJ7 A;  3EYI A;  3B6A A;  1WI9 A;  3WTY C;  3MZ8 A;  2DXI A;  1PVE A;  1ZLK A;  4AID A;  5K5O A;  4HNU A;  1G6N A;  4ENN A;  3W2A A;  2AXL A;  2IEK A;  4CYD A;  4YIR X;  4IHV A;  3CCV I;  2M0M A;  1KU3 A;  1ZK8 A;  4XSX F;  4RDU A;  2CFX A;  2KQR A;  4Z2Y A;  4I0B A;  2COM A;  3BR5 A;  1HW5 A;  2FBK A;  2VBW A;  1TNT A;  5B3S H;  4ZH4 F;  5CQG A;  4XLC A;  1R4M B;  3HOU J;  1CF7 B;  1DP7 P;  3S15 J;  3WTS C;  4V2G A;  4UVC A;  4XID A;  1U3E M;  3TQN A;  1XDS A;  4L9T A;  4BHB A;  3PM1 A;  4KIF A;  2O8X A;  5CYV A;  5CVU A;  1MDM B;  5CKT A;  2X1C A;  1WPK A;  3J80 Z;  1RZ4 A;  4ZJZ A;  2ZNZ A;  1FJL A;  2A5W A;  1J7K A;  2DOD A;  1AU7 A;  5GAG J;  1S3J A;  3V8K A;  5A2Q K;  2PJR A;  2D1H A;  2W48 A;  3K0L A;  2IS1 A;  2MH9 A;  5HNH A;  1RUN A;  4ENM A;  2XV4 S;  4NBQ A;  2H09 A;  3TO9 A;  4PGG A;  2BY0 A;  1S9H A;  3OYN A;  4BKX A;  2LMD A;  4PFO A;  1V55 H;  4XKW A;  3QWL A;  1JGS A;  3BWG A;  4P1W A;  3PJR A;  5BMZ A;  1IUF A;  3AAF A;  4I0A A;  3I55 I;  2Z33 A;  1WI3 A;  3VSL A;  1QNT A;  3OS1 A;  1ZG5 A;  3LQQ A;  4K2E A;  3K4L A;  1OYY A;  1BI3 A;  2Y2Z A;  2IVM A;  3JW4 A;  2KIF A;  1BIA A;  4CCN A;  5ILS A;  4UXN A;  1X1P A;  3GTM J;  3OS0 A;  4EGY A;  1SFK A;  1T98 A;  1WJE A;  2NNN A;  5TIS C;  3IL2 A;  1DPU A;  2FUG 2;  4UB6 C;  3FK6 A;  3W2W A;  2VJ5 A;  1A6Q A;  3LSH A;  3TED A;  1B9N A;  5HS9 A;  3CCE I;  4ZC3 A;  3O3K A;  1MND A;  2XGC A;  4RGS A;  2PQ8 A;  2V9K A;  3RPQ A;  2HQN A;  3CME I;  2EPF A;  1O7L A;  2EZI A;  5J6X A;  5BNG A;  1K4T A;  1FSH A;  1OYW A;  3GTO J;  5J47 A;  2V6E A;  3HSE A;  2MLK A;  3D5L A;  1XGM A;  4A3E J;  5HDN A;  5HLH A;  2HXI A;  3J7A O;  3PO2 J;  3ERM A;  1FYK A;  2HXO A;  4A93 J;  3KP6 A;  5A2Q Z;  4G12 A;  2ZBK A;  5EZH A;  4B3A A;  4GFB A;  2QM3 A;  1YW7 A;  3HJE A;  2VN2 A;  2ZJ2 A;  1LDJ A;  1YW9 A;  1V54 H;  1JI8 A;  2ELK A;  2CV0 A;  4ZDL A;  2G0E A;  1VQN I;  3SDG A;  1PUF A;  3RJP A;  1XSX A;  4CO8 A;  3QRF F;  4HZF A;  5FFZ A;  2R7U A;  2QSH X;  3G6E I;  1KON A;  1NTC A;  3RTR A;  3K7A J;  2XF7 A;  2DA3 A;  3F21 A;  2O5R A;  2DA5 A;  1FOX A;  3W6J B;  4ESF A;  2HR3 A;  4PK4 A;  5KCM A;  4ASN A;  2VI6 A;  2RNJ A;  2M87 A;  3SFI A;  5GP9 A;  2R5Z B;  1O57 A;  2CO5 A;  1BW5 A;  3IWZ A;  3GWZ A;  4KA4 A;  3FIW A;  6PAX A;  2QYO A;  2XSJ C;  2ZXJ A;  2QBY A;  3HHG A;  2A6H F;  1YRN B;  2X6O A;  1AA7 A;  1UB9 A;  3W3C A;  1H8A C;  4RLQ A;  3CJQ B;  5BS6 A;  2DK5 A;  1TQM A;  2A61 A;  3GO5 A;  5KNL A;  2R7R A;  3H5A A;  2LKP A;  1VND A;  1I39 A;  4H4K C;  1S7A A;  4EM1 A;  1P9Q C;  5D4S A;  2VOP A;  1F36 A;  1N78 A;  1D8K A;  1MMN A;  4BBR J;  4XR6 A;  1YHQ I;  1T56 A;  2VKV A;  3PUF A;  3G1L A;  1BR4 A;  3R60 A;  4Y7N J;  4OIR F;  2Q1Z B;  2W24 A;  4XN3 A;  1O3Q A;  2IA0 A;  1U5T C;  4P9F A;  3QPL A;  4G9Y A;  4EMS A;  4CCL A;  3PFI A;  3I0T A;  5EEA A;  3SEZ A;  4E7Z A;  2CUF A;  2XGX A;  3U9G A;  4QSH A;  4QTR A;  2O6G E;  3CCR I;  3TP3 A;  5HNF A;  1VQ7 I;  1W7P B;  4PDK A;  2K4B A;  1A31 A;  1VFC A;  3WU2 C;  1AKH B;  1UEL B;  3SHF A;  3OYJ A;  3HSF A;  3B6C A;  2EH3 A;  3SZT A;  1SEU A;  1BA5 A;  2ZJQ F;  2XAJ A;  2DYS H;  2L01 A;  2M8E A;  5E79 C;  5FLM J;  1HKS A;  1HXD A;  4CH7 A;  1JKR C;  2OQR A;  4IQ4 A;  2KLO A;  1Y56 A;  4QPO A;  3KP5 A;  4N9H A;  1W7P D;  1J59 A;  5ED4 A;  4GCV A;  2DJI A;  3CP8 A;  1ZKG A;  2DO7 A;  4V19 K;  2DLL A;  2BV6 A;  2MC4 A;  3F0C A;  3VWB A;  2PMZ N;  1QBJ A;  2IPQ X;  4DZP A;  1SFE A;  4BGD A;  1WJB A;  1APL C;  4UVA A;  1OPC A;  3ECH A;  3H36 A;  2JA6 J;  1YOV B;  2F5C A;  3HIF A;  4HV5 A;  2ACJ A;  3VYR B;  4CUG A;  1FEX A;  3OS2 A;  2WA0 A;  3FKI J;  3QP6 A;  2GWR A;  1ETW A;  3IH4 A;  4HF1 A;  1YFH A;  3F6O A;  4P55 A;  3ABU A;  5L3F A;  4EAT A;  2L7M P;  5FD5 A;  3OR1 C;  3SDB A;  2K85 A;  4FT8 A;  4LIV A;  3H92 A;  3MKL A;  2L0K A;  3OV8 A;  3HOT A;  2EZK A;  1ETX A;  1V5G A;  1TP4 A;  2K27 A;  1VQ8 I;  1XX5 A;  2HYJ A;  1F4K A;  2KDO A;  2IT0 A;  3CCU I;  5JLW A;  3DEW A;  3T1B A;  4X1E A;  1UHS A;  1Z91 A;  2WAD A;  4D5C A;  4S04 A;  3DBH B;  5BPI A;  1MBH A;  2EA4 A;  1R23 A;  3JRD A;  3T8R A;  4B43 A;  3HKZ N;  2STT A;  1D3Y A;  3DF8 A;  2WC2 A;  1JKP C;  4LG3 A;  3I5U A;  4YRV A;  3WU1 B;  2JA5 J;  3IKT A;  2O3F A;  1GV5 A;  4A6D A;  4YFX F;  2RN7 A;  3S1Q J;  1EKE A;  3LSG A;  3TL4 X;  2CW7 A;  2VB6 A;  2F5E A;  3C2H A;  2HOA A;  2V26 A;  3H3U A;  4OOI A;  1X4P A;  2P0W A;  3FBI B;  5EDN A;  2UZK A;  5F0F A;  4XLN F;  2DTZ A;  4UUV A;  9ANT A;  5F6F A;  3S3N A;  1FLI A;  1XCB A;  2ESH A;  3SEQ A;  5B1B H;  4AVZ A;  4OU0 A;  5CVR A;  1BBY A;  2EFW A;  3K4C A;  3D1N I;  4IF4 A;  3DTE A;  1HBX G;  1V3F A;  3P9C A;  3VYS B;  4HAM A;  2OCC H;  5IPA A;  3M9A A;  4RS8 A;  1J2X A;  4B3X A;  1IN4 A;  2ZXI A;  4MNU A;  3HRS A;  3BT9 A;  4A6E A;  2X9D A;  3RSN A;  4D7M A;  4IHT A;  4XQF A;  1OR7 A;  1YYV A;  3L1P A;  3ZMV A;  2DDA A;  1ODD A;  1UAA A;  2LK2 A;  2HQR A;  1SFO J;  3DV8 A;  2FBI A;  3ZN1 A;  2JTV A;  2M3A A;  3FXL A;  2JPB A;  2CQN A;  2HYF A;  4JOM A;  3ZQL A;  2W1O A;  4O5V A;  2DA7 A;  3FXQ A;  4CZC A;  4CDG A;  2XAH A;  4R1H A;  3CJR B;  3E6M A;  3L09 A;  4J19 A;  2YPR A;  1BOB A;  3QPH A;  1ETK A;  3TW7 A;  5F04 A;  4A3D J;  2E60 A;  2L3D A;  3PFY A;  2LC2 A;  3LWF A;  2V9P A;  1KA8 A;  2K9S A;  1HKT A;  3E5Q A;  2VIX A;  5ILV A;  2F4I A;  2LF8 A;  2R5Z A;  2RNG A;  3S2H J;  2M2E A;  1WKM A;  4II2 A;  3RQI A;  4OIQ F;  4C30 A;  4WXH A;  2R3S A;  2XRN A;  4HX4 A;  2LH9 A;  1RKT A;  1K6Y A;  1TQI A;  1YRN A;  1LQ1 A;  2I8D A;  2P81 A;  1WJC A;  1OYI A;  3MZY A;  4HX8 A;  1VQ5 I;  5LGN A;  2IAI A;  1IV8 A;  5FD6 A;  3M7G A;  3EDP A;  2YR2 A;  3R4K A;  1B9M A;  2XKP A;  1YIJ I;  2GIZ A;  1FOY A;  2NAZ A;  3K2A A;  2MG4 A;  3RKY A;  3FXK A;  1ONV A;  4Y52 J;  3CDH A;  3JRF A;  1GHC A;  2CUE A;  3I58 A;  1FIP A;  1SD5 A;  1SD4 A;  2HKX A;  5EF6 A;  3GFM A;  4PJL A;  2K02 A;  1JJ8 C;  4IKF A;  4W1U A;  2ID6 A;  4UUS B;  3FMR A;  4IHX A;  3E5X A;  2R7X A;  3HB9 A;  2WAF A;  2FQ3 A;  2MD5 A;  1DPR A;  1O7F A;  1LVA A;  3F8F A;  2EFO A;  4LMY A;  4BE0 A;  5E20 A;  4DZJ A;  1I3Q J;  1W7P A;  4R79 A;  4KIS A;  1O3S A;  3OMY A;  1IXS B;  2E1M B;  2CW8 A;  1AKH A;  2EK5 A;  4JX5 A;  2ZME C;  1IN7 A;  3K4J A;  4AU7 A;  3KFW X;  2L5Q A;  4HW0 A;  3TMO A;  2FXA A;  4EM0 B;  2MA3 A;  3A01 B;  3RI4 A;  1UFM A;  1TT5 B;  1TC3 C;  4A3J J;  1REP C;  1FIA A;  1YG2 A;  3EUA A;  1IN5 A;  5F64 A;  5DM6 F;  2OC6 A;  3RIR A;  1JJ6 C;  2VKH A;  3IP4 B;  3WHB A;  2MD0 A;  4W97 A;  2PMH A;  4WXD A;  2VE9 A;  1UHM A;  1G3Y A;  2MW8 A;  5M5W J;  4NNJ A;  2V6C A;  4G7O F;  5F1J A;  3HOS A;  3CCQ I;  5ILU A;  3OL3 A;  4FTH A;  3CMY A;  2HFH A;  1HA8 A; 
#chains in the Genus database with same CATH homology
 2L9R A;  1R9T J;  3ZQF A;  1GDT A;  2NVQ J;  5DS9 A;  4AUX A;  2NVY J;  4QIW N;  1MH3 A;  2ID3 A;  1GUU A;  1MBK A;  2YUS A;  4JP0 A;  4MLO A;  1B72 A;  1X2N A;  2JMW A;  2NVX J;  4BXX J;  1NK2 P;  2O9L A;  1XC5 A;  3QQA A;  1OCT C;  2E2H J;  5F08 A;  3JR9 A;  1P7J A;  2JJ7 A;  2NS7 A;  2JWT A;  3B6A A;  4FE4 A;  4XK4 A;  2YS9 A;  3RKQ A;  5K7H A;  2CRG A;  2GM4 A;  3JRA A;  1VI0 A;  2IBD A;  2IEK A;  3Q0U A;  4IHV A;  3ZQG A;  1MSE C;  3W6V A;  1ZK8 A;  1FTT A;  5EG0 B;  2ME6 A;  1LFB A;  4RDU A;  2RAE A;  1GT0 C;  2O8K A;  2HOT A;  3BR5 A;  2Y0S N;  5C44 J;  1DU0 A;  2JN6 A;  1JT6 A;  2DA2 A;  1POG A;  4C2M J;  1MBJ A;  3HOU J;  3S15 J;  4V2G A;  4XID A;  1FTZ A;  3BG5 A;  4JX6 A;  4EEF G;  1OCP A;  1IDY A;  5FKO A;  4C3J J;  5C4X J;  2XB0 X;  1ITY A;  1OFC X;  5IOZ A;  2KT0 A;  3PM1 A;  1EF4 A;  1UG2 A;  2JK3 A;  1WPK A;  3GTL J;  2NOG A;  1FJL A;  4XRM A;  3RZO J;  1AU7 A;  3OOU A;  3I4N J;  5E3O A;  2E1O A;  2AO9 A;  1RR7 A;  2W48 A;  3S1M J;  1QPI A;  3H0G J;  1W0U A;  1Y1V J;  4JX4 A;  5J1R A;  1ETO A;  3IH2 A;  4BKX A;  2WB1 N;  2R5Y B;  1IUF A;  1ETY A;  2FQ4 A;  3S16 J;  2K9N A;  1WI3 A;  4M3E A;  4IHY A;  4D5F A;  2E2J J;  2TCT A;  2HQ5 A;  3BR6 A;  1HLV A;  2Y2Z A;  3S17 J;  3DCF A;  3GTP J;  1U9O A;  2K9Q A;  2DJN A;  1WH7 A;  4A3C J;  1JGG A;  3GTM J;  1JKO C;  1B8I A;  3IV5 A;  3HGG A;  4A69 C;  1DU6 A;  4UUT A;  1MNM C;  3FK6 A;  2I10 A;  3TED A;  2XPW A;  2XGC A;  3HGY A;  5E3L A;  1JTY A;  3FK7 A;  3UKG A;  3JRG A;  2ZB9 A;  5K7F A;  1SAN A;  5IP6 A;  2XGE A;  4JYK A;  2LR8 A;  2EZI A;  2R0Q C;  5BNG A;  2NS8 A;  2JA7 J;  3GTO J;  4A3B J;  3GBG A;  5IOY A;  3G1O A;  4A3E J;  2FD5 A;  1ZGW A;  2B63 J;  4CYC A;  1GV2 A;  2HXI A;  3PO2 J;  1IC8 A;  1MBG A;  1F43 A;  5GPC A;  2HXO A;  1S7E A;  4A93 J;  3BQY A;  3CQZ J;  4G12 A;  4NDL A;  5EZH A;  4B3A A;  4GFB A;  5IP7 J;  5FKM A;  2ELK A;  2O7O A;  5FKL A;  5EGO B;  2G0E A;  3SDG A;  1HF0 A;  1PUF A;  3JRC A;  1LFU P;  1D5Y A;  1I6H J;  1G2H A;  1LE8 A;  2DMU A;  4BY1 J;  2VUM J;  1IRZ A;  1NTC A;  4UUS A;  3K7A J;  2DA3 A;  3ZQI A;  2DA5 A;  1U9N A;  3S1N J;  1QRY A;  3Q0V A;  2VI6 A;  4A3L J;  1IDZ A;  3PO3 J;  3SFI A;  3QPS A;  5GP9 A;  2XPV A;  2R5Z B;  2Y31 A;  1RES A;  3HOX J;  1U78 A;  5C4J J;  1BW5 A;  5IYC J;  2CQX A;  4MFE A;  3HOZ J;  3FIW A;  1RPW A;  1YRN B;  3Q3S A;  4DYQ A;  2X48 A;  1Y1W J;  3A01 A;  2X6O A;  3TP0 A;  1H8A C;  1ETQ A;  1QVT A;  2M34 A;  4B4C A;  2LP0 A;  3HOW J;  1HDP A;  1U8B A;  1TWC J;  5E3M A;  1VND A;  1JT0 A;  3GTJ J;  4M3F A;  1HDD C;  1F36 A;  3VPR A;  3NAU A;  4C3I J;  3HOV J;  4A3K J;  5F0H A;  4BBR J;  1T56 A;  2VKV A;  3G1L A;  4Y7N J;  2DMQ A;  3HM5 A;  3QPL A;  5J1Y A;  2LFB A;  3LSJ A;  3WHC A;  2COB A;  5EEA A;  2LVS A;  2CUF A;  5FKN A;  4QSH A;  4QTR A;  2R93 J;  3TP3 A;  4IHW A;  2M0C A;  1ETV A;  1MH4 A;  1VFC A;  3HOY J;  2CJJ A;  1AKH B;  4AC0 A;  4D7N A;  2E19 A;  3B6C A;  2XPU A;  3GTK J;  2EH3 A;  1BA5 A;  4DYC A;  2XB5 A;  5M3M J;  2ECB A;  3RZD J;  5FLM J;  4I6Z A;  4M3D A;  2M9H A;  1JKR C;  1VF9 A;  1UMQ A;  4FCY A;  1P7I A;  2DN0 A;  2CQQ A;  5EG0 A;  2LD5 A;  3GTG J;  1ZKG A;  5EZG A;  3F0C A;  2OF7 A;  2QF7 A;  2PMZ N;  1WGX A;  4A3I J;  5IYD J;  4DZP A;  2LY9 A;  3BR1 A;  3O8H A;  1APL C;  5HOD A;  2JA6 J;  4XIC A;  1BW6 A;  2YU9 J;  1FEX A;  3FKI J;  2N8G A;  4X6A J;  1ETW A;  1Z0X A;  3IH4 A;  1JKQ C;  2KDZ A;  2WV1 A;  2LKX A;  1WCM J;  2H8R A;  2K40 A;  1ZR2 A;  1QVU A;  2L7M P;  3ZOB A;  5E3N A;  3NAR A;  3HDD A;  3MKL A;  2L0K A;  3BR0 A;  1X58 A;  2EZK A;  1ETX A;  3JRE A;  5JLX A;  2HYJ A;  1MSF C;  1MBE A;  1IV6 A;  2DA6 A;  3CDL A;  3BQZ A;  5JLW A;  3DEW A;  2FJ1 A;  2R5Y A;  4AYB N;  2NVT J;  1I50 J;  4ABZ A;  2ME0 A;  1UHS A;  4X1E A;  4RBO A;  4D5C A;  3C2B A;  5K7Z A;  1H89 C;  2MSY A;  3S14 J;  1RET A;  2DMP A;  1MBH A;  1AHD P;  3BTJ A;  3JRH A;  3JRD A;  2VPR A;  3HKZ N;  1XG1 A;  1JTX A;  5C3E J;  2R7Z J;  2R92 J;  1HOM A;  1JKP C;  3OIO A;  1W0T A;  3HBL A;  2JA5 J;  4A3F J;  1CQT A;  3LOC A;  1GV5 A;  2ECC A;  3S1Q J;  5IP9 J;  2Y30 A;  5M5X J;  3FIS A;  3LSG A;  2HOA A;  2FX0 A;  3S2D J;  2GBY A;  5EDN A;  1TWG J;  5F0F A;  3BTC A;  2DTZ A;  9ANT A;  5J3L A;  2OPT A;  1ENH A;  4LOC A;  2EQR A;  4A3G J;  3OSF A;  1E3O C;  1GVD A;  2Y9Y A;  3D1N I;  1JUS A;  1A5J A;  4DW6 A;  2EZH A;  1IJW C;  4XRS G;  1NK3 P;  5IPA A;  2DA4 A;  2D5V A;  1XS9 A;  3BT9 A;  5M3F J;  2X9D A;  1A6I A;  1TWH J;  4D7M A;  3L1P A;  4M3B A;  1K61 A;  2LK2 A;  1SFO J;  3A03 A;  5EGO A;  3I4M J;  1B8I B;  3G1M A;  4MO7 A;  5IYB J;  3SJM A;  3LSP A;  3BG9 A;  3IH3 A;  3ZQL A;  2MGQ A;  2DA7 A;  4C3H J;  3BR2 A;  4J19 A;  3BR3 A;  4V2F A;  2M8G X;  2QCO A;  4BY7 J;  4A3M J;  1ETK A;  3TW7 A;  5F04 A;  4M6V A;  1WH5 A;  2LLK A;  1O4X A;  4A3D J;  2HI3 A;  2LTP A;  1JUP A;  2TRT A;  1ORK A;  2K9S A;  3A02 A;  5FLV A;  2GLO A;  2L7Z A;  2VKE A;  3HEF A;  2WAQ N;  5GPA A;  2R5Z A;  3H3V K;  3S2H J;  3JRB A;  2M2E A;  4MIM A;  3RQI A;  1MBF A;  4CYC B;  4M3G A;  3M3Y J;  1T33 A;  3ZQC A;  1RKT A;  2H1K A;  5M5Y J;  5F0C A;  3OSG A;  1YRN A;  2P81 A;  5J1U A;  3Q0W A;  4HNV A;  1ZTR A;  2IAI A;  3BTI A;  3TW6 A;  1JUM A;  4DYR A;  3S1R J;  1RKW A;  1TWA J;  2EZL A;  2DMT A;  3K2A A;  2MG4 A;  3M4O J;  2E2I J;  1IG7 A;  2JA8 J;  4Y52 J;  3JRF A;  2HDD A;  2CU7 A;  1PUF B;  2CUE A;  1FIP A;  5F27 A;  1Q1V A;  2DMN A;  3MVP A;  3CCY A;  5EF6 A;  1LE8 B;  1B72 B;  3JRI A;  1JJ8 C;  4W1U A;  2ID6 A;  1TWF J;  2AHQ A;  4UUS B;  4IHX A;  5FJ8 J;  3HB9 A;  3MN2 A;  1ZQ3 P;  2XRL A;  4FIS A;  1BJZ A;  1K83 J;  4DZJ A;  4I76 A;  1IGN A;  1I3Q J;  5DTD A;  4IEJ A;  4L5E A;  3E7L A;  1X2M A;  3BG3 A;  3GTQ J;  1AKH A;  1OJL A;  4JX5 A;  4FE7 A;  2HOS A;  3BTL A;  1H88 C;  1BL0 A;  1ZR4 A;  4BBS J;  3ZQH A;  2DA1 A;  4MFD A;  4S0H B;  5EYR A;  3A01 B;  3LSR A;  1TC3 C;  4A3J J;  1HCR A;  1Z77 A;  2EBI A;  4XRS A;  1FIA A;  4B1R A;  2Y9Z A;  5FKK A;  1JJ6 C;  3WHB A;  2L7F P;  4W97 A;  2MW8 A;  3LNQ A;  5M5W J;  5F1J A;  2XGD A;  3O8G A;  4FTH A;  3CMY A;  2XSD C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...