1HDDC

Crystal structure of an engrailed homeodomain-dna complex at 2.8 angstroms resolution: a framework for understanding homeodomain-dna interactions
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
57
structure length
57
Chain Sequence
RPRTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFQNKRAKIKKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*TP*TP*TP*TP*GP*CP*CP*AP*TP*GP*TP*AP*AP*TP*TP*AP*C
publication title Crystal structure of an engrailed homeodomain-DNA complex at 2.8 A resolution: a framework for understanding homeodomain-DNA interactions.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 16
structure length 57
sequence length 57
chains with identical sequence D
ec nomenclature
pdb deposition date 1991-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1hddC00
4A3GJ 4MLOA 1A5JA 1IUFA 1GV5A 1IDYA 2HQ5A 3IH2A 1IJWC 1ZQ3P 5F0HA 3S1MJ 1U9OA 3BR2A 2JA7J 4GFBA 1MBJA 5JLXA 3CCYA 2D5VA 4HNVA 4QIWN 5M3FJ 3BTJA 3JRGA 2ECBA 3HGYA 4QSHA 3WHBA 1JTYA 4DW6A 1B72A 3GTGJ 4CYCB 3M3YJ 1IG7A 3LSJA 3FK7A 1NK3P 1H8AC 1TWGJ 5C4JJ 2X48A 2LKXA 2ELKA 1MNMC 2XPVA 2CUEA 3SJMA 2DA5A 3BR0A 2HYJA 3BQZA 1PUFB 5J1RA 3CQZJ 5C4XJ 2PMZN 2JMWA 4A3JJ 1JKQC 4BY7J 1JGGA 2XRLA 2DA4A 2L7MP 3OSGA 1HDDC 3ZQCA 5IP9J 4DZJA 3E7LA 5EZHA 3HOXJ 5EG0B 2R5ZA 3IH3A 1X2MA 2EH3A 5F1JA 4BKXA 1TWHJ 2E1OA 2K9SA 1JKOC 1OFCX 3HM5A 4A3EJ 3S16J 1EF4A 2R5YA 2CQXA 5FKNA 2ECCA 3HGGA 2MG4A 1YRNB 1WH7A 2CQQA 4S0HB 1MBEA 4M3FA 1IDZA 1H88C 2WAQN 2LY9A 2JN6A 1UHSA 2DMQA 4JYKA 1Z0XA 2R93J 2TCTA 3BG5A 2EZHA 3Q0VA 1F36A 3GTQJ 5FKLA 2WV1A 5F27A 9ANTA 2HXOA 2NOGA 1B8IB 1QPIA 1HF0A 1BW5A 5IOZA 2DA2A 3BTLA 1GV2A 3M4OJ 2KT0A 1JT0A 3HDDA 4B1RA 4UUSB 5K7HA 2FD5A 2HOTA 1WH5A 2MGQA 1R9TJ 1LE8A 2Y9ZA 3HOWJ 4MFDA 4BBRJ 2EBIA 1I3QJ 5E3OA 1RPWA 2XGDA 5E3NA 2HXIA 4Y52J 3QPLA 2JJ7A 3GBGA 5C3EJ 2IBDA 1GVDA 3D1NI 3LSGA 1WPKA 2R0QC 5M5YJ 5GPAA 3HKZN 4M3EA 4A3IJ 1VFCA 1RKTA 4UUSA 4MIMA 1APLC 4W97A 2TRTA 3JRCA 1JJ8C 2K9QA 4D7MA 3FK6A 2DMPA 3IV5A 3JR9A 5FLMJ 4IHXA 2RAEA 2EQRA 4XIDA 2LLKA 3GTKJ 1U8BA 2QF7A 5FKOA 1VNDA 4D5FA 3JRBA 1JT6A 2HOSA 4A3DJ 4C2MJ 3SDGA 1NK2P 4C3JJ 3A01A 2K40A 1UG2A 5F0FA 2ME6A 5IP6A 1U9NA 4NDLA 2IEKA 2CJJA 5J1UA 4Y7NJ 3BR6A 1LFUP 1ETYA 2P81A 3RZOJ 4AYBN 3GTJJ 1ZKGA 2H8RA 5M5WJ 4XRMA 1I50J 3QPSA 3FKIJ 4V2GA 3LNQA 4FISA 4JP0A 3UKGA 1AKHA 5JLWA 2M0CA 2ME0A 4A3BJ 4DYQA 1AHDP 2EZIA 3G1MA 1A6IA 1ZR2A 4IHWA 3LOCA 2JK3A 3S1QJ 1RESA 3OSFA 1ETQA 4ABZA 4D7NA 5FJ8J 1WGXA 5GP9A 3A02A 1MH4A 3O8HA 2L7ZA 3ZQLA 3W6VA 5E3LA 2ID3A 2ZB9A 2XB5A 3FISA 4CYCA 3HOZJ 4XK4A 3S2DJ 2QCOA 2R92J 1JUPA 4AUXA 4QTRA 2OPTA 3CDLA 3TEDA 5FKMA 2X6OA 2LR8A 2AHQA 4BY1J 2YUSA 1O4XA 1PUFA 2LFBA 2O7OA 3C2BA 5M3MJ 1FTTA 2B63J 1FTZA 4XICA 5BNGA 2E19A 1ENHA 2N8GA 5HODA 1JJ6C 1FEXA 2FQ4A 4RBOA 1XC5A 3GTOJ 2M8GX 3I4NJ 3JRAA 5EGOB 3PO3J 1JKPC 5IPAA 2XPUA 2YS9A 2O8KA 5EG0A 1MBGA 3S2HJ 3SFIA 2COBA 2K9NA 3O8GA 2VKEA 2E2HJ 5F04A 1DU6A 1SANA 4M3GA 2WB1N 2DMTA 1Z77A 4XRSG 1JUMA 4X1EA 2CRGA 4MO7A 4FCYA 3HOUJ 1YRNA 3MVPA 3JRIA 3RQIA 3IH4A 1Y1WJ 1TC3C 4A3MJ 3B6CA 2M2EA 3BG3A 4LOCA 3I4MJ 1T56A 2CUFA 2HI3A 3HBLA 2L7FP 1G2HA 1MBHA 2FJ1A 1UMQA 2DTZA 1B8IA 3H3VK 2ID6A 1Q1VA 1T33A 5DTDA 3L1PA 1GT0C 2KDZA 2Y0SN 1IRZA 1AU7A 3GTPJ 3BR5A 5EEAA 2MW8A 2R7ZJ 1FIPA 4DYRA 2DN0A 1D5YA 4IHYA 2JWTA 3BTIA 5IYBJ 1JKRC 1JTXA 3S15J 5E3MA 2CU7A 1FJLA 5K7ZA 2NVQJ 4AC0A 2GLOA 1ZGWA 5FKKA 3BR1A 4BBSJ 1Y1VJ 2L0KA 1MSFC 1RKWA 4D5CA 1S7EA 1P7JA 3S14J 2H1KA 4MFEA 2DJNA 3PM1A 4BXXJ 4V2FA 3MKLA 2DA7A 5IOYA 3K7AJ 4X6AJ 2M34A 1I6HJ 3Q0WA 4B3AA 4L5EA 2Y2ZA 2JA6J 3JRFA 2G0EA 2VI6A 1K61A 5J3LA 2OF7A 2LD5A 2DMNA 1OCPA 1B72B 3HB9A 3HOYJ 5EYRA 1FIAA 3K2AA 1XG1A 3OOUA 2M9HA 3TW7A 3S1NJ 2E2JJ 2VPRA 2EZKA 2DA3A 4EEFG 5IP7J 2NVTJ 4DZPA 3JRHA 2Y31A 1F43A 1QVTA 5EF6A 1K83J 4B4CA 5FLVA 2DA1A 2VUMJ 1TWCJ 2LVSA 2AO9A 5K7FA 3RKQA 3S17J 3G1OA 3ZOBA 3MN2A 3Q3SA 1TWAJ 1H89C 4XRSA 3BTCA 1ITYA 1RR7A 1BJZA 1XS9A 3LSRA 3TW6A 1IC8A 1BA5A 2R5ZB 1ZR4A 1BL0A 3QQAA 3ZQHA 3OIOA 4M3BA 4I76A 4A3CJ 1X2NA 5IYCJ 4RDUA 1ORKA 4C3IJ 2JA5J 2FX0A 2GBYA 3H0GJ 4IHVA 4A3FJ 1RETA 1QRYA 3TP0A 1ETXA 1ETKA 4W1UA 2R5YB 2X9DA 1DU0A 4FE4A 1MBFA 3BG9A 2YU9J 2NVYJ 4G12A 2HDDA 4JX6A 3A03A 2Y9YA 4I6ZA 4JX5A 1IGNA 1HOMA 3Q0UA 2XPWA 4A93J 3WHCA 3JRDA 1E3OC 3B6AA 4M6VA 1HLVA 3G1LA 3DCFA 1ZTRA 3BQYA 2NS7A 1GDTA 1TWFJ 5EGOA 4UUTA 2XGCA 1HCRA 5J1YA 3NAUA 1SFOJ 1LE8B 4IEJA 3F0CA 1VI0A 5EZGA 3BR3A 2GM4A 2DMUA 5EDNA 5C44J 3ZQIA 1CQTA 1VF9A 3LSPA 2E2IJ 2XB0X 5F0CA 5F08A 2LP0A 2NVXJ 1IV6A 2W48A 1MBKA 5GPCA 3VPRA 3ZQGA 2NS8A 1WCMJ 1JUSA 2MSYA 1MH3A 2IAIA 4M3DA 3ZQFA 3DEWA 3GTLJ 3BT9A 2O9LA 1WI3A 2XSDC 1W0TA 2XGEA 4A3LJ 3FIWA 3HOVJ 2I10A 1P7IA 2DA6A 4FTHA 1LFBA 4JX4A 4DYCA 3A01B 4J19A 1MSEC 4A69C 2LK2A 3GTMJ 2LTPA 3HEFA 1ETVA 3NARA 1ETWA 2JA8J 5DS9A 1ZK8A 3PO2J 1X58A 4C3HJ 1NTCA 1GUUA 1W0UA 1OCTC 2HOAA 1OJLA 2VKVA 3S1RJ 2L9RA 1HDPA 4A3KJ 2Y30A 3RZDJ 3TP3A 1ETOA 1BW6A 3CMYA 3JREA 1QVUA 2EZLA 5M5XJ 1U78A 5IYDJ 1POGA 4FE7A 1AKHB
chains in the Genus database with same CATH superfamily
1A5JA 4PJJA 5L3DA 2OU2A 1GV5A 2X1DA 3CDHA 4RMNA 1IJWC 3AFHA 4OINF 1ZQ3P 1SD4A 2JA7J 1YQAA 2FSWA 1KGSA 1W5CC 2A5YB 2DW4A 1VQ6I 1R7JA 4HSTA 2HYFA 1MJ9A 2K3FA 2Z1DA 1E3PA 3BTJA 2ECBA 3HGYA 4NC7A 4QSHA 3WHBA 2JTVA 5LGUA 2R7WA 2NNYA 2BXZA 2QKMB 1LEBA 3OR1C 5JHFA 1IG7A 2FA5A 1R4MB 3FK7A 3M7GA 1LPQA 3HYIA 3ZMUA 4JK1X 5HDNA 4ZTJA 1TWGJ 1LNWA 2LKXA 4XLCA 2IS2A 3V8KA 1MNMC 3AL0C 2EFPA 2XAHA 5JVTA 3QU6A 1S3JA 4E7KA 5LGTA 5J1RA 4OIPF 5F64A 3V4GA 1QA6A 3HOSA 1TQPA 5DYMA 1S7OA 3BPVA 2JMWA 4A3JJ 2E7XA 1R36A 3LSKA 2MLKA 3DLAA 2LG4A 3LA3A 2NS0A 3GFLA 3ZQCA 4MHGA 5IP9J 4YIFA 3EETA 4HW0A 3J81Z 2JSPA 1XGNA 1QBJA 5EG0B 4PGHA 1X2MA 2ZFUA 1F1ZA 4XLEA 3PJRA 2K9SA 5BS6A 1OFCX 4AIHA 1BIBA 3HM5A 2G7UA 2UV1A 3HXLA 2M8EA 3P5JA 1K4SA 2CQXA 2CW8A 2ECCA 4BQAA 1YE9A 5K5QA 2AS5F 3U9GA 1YRNB 5EEGA 3MQ0A 3QU3A 1WH7A 4A6DA 4IRHA 2W7NA 2VBYA 4XOTA 1BC8C 2WAQN 2DT7B 1YITI 3DEEA 4CHUA 2TCTA 3BG5A 2YPRA 1ZREA 4G9YA 1LB2A 1XTAA 4PSXA 3LAPA 1B8IB 9ANTA 4UVAA 4RM3A 2ESHA 5IOZA 4IQ4A 1SEUA 3BTLA 1S7AA 2HDWA 4HF1A 5EEHA 1O3SA 3HDDA 2EFOA 4DGWB 4UUSB 4HSRA 2QLZA 3SHFA 1WH5A 2MGQA 1R9TJ 1LE8A 3GF2A 1KYWA 4JBAA 3NWTA 4BBRJ 2UZKA 3WTUC 3NEUA 2EBIA 3BC8A 3O6BB 1TLHB 1LDDA 1RPWA 1J09A 1ON1A 1YJWI 1H9TA 3QPLA 3LAJA 1DDNA 2JJ7A 3VYTB 2FEZA 3M07A 2Q1ZB 2IBDA 2OZ6A 2FBIA 1X19A 1WPKA 3ZMVA 2R0QC 1TP4A 4ZJZA 2IS4A 5GPAA 2OCCH 4WF2A 4YG2F 1VFCA 1N25A 2COMA 1APLC 1Z6TA 4PSWA 2IW5A 2LF7A 3JR9A 2M4KA 3FK6A 5DM6F 5ICFA 1I6XA 5HVQC 5J40A 2FNPA 1QHGA 5HLHA 4C2MJ 3SDGA 3ZMSA 2HFHA 2K40A 5B66C 5F0FA 2R7DA 2CJJA 1K79A 2HNHA 3BR6A 1LFUP 2DPDA 2CFOA 1FMVA 1FNNA 1SAUA 2K5CA 1DPRA 1PVEA 1UG0A 2VQHA 1JGSA 2H1LA 2V9KA 5D4SA 3IWFA 3K4LA 5M5WJ 4XRMA 3OL4A 2BVMA 4KITB 4F93B 4LJZF 3FKIJ 1FSHA 2Q8KA 4JP0A 1QNTA 1FOXA 1TT5B 5LLQA 1AKHA 3MKWB 5LRSA 2M0CA 4DYQA 4FX0A 1V3FA 3H0DA 2ZBKA 1Z1DA 3TOBA 4YFXF 2WV0A 1A31A 4F7ZA 2P5KA 3LOCA 1U2WA 3VYRB 5BQTA 1ZG5A 3AAFA 5FRNA 2CFXA 3EUHC 2ACJA 1WGXA 2LDUA 3FBNB 3FZVA 3M1EA 2YSRA 5ICCA 2W82A 4LMYA 3H3UA 5LBQA 2LSOA 2EIKH 4ZYDA 1LUJB 1YX3A 2M30A 1E0EA 2VXZA 4CICA 1HBXG 3S2DJ 3OIPA 2R92J 4AUXA 4P55A 3WU0A 2G9WA 4QTRA 3CDLA 2HKOA 3CMAI 3QOEA 2X6OA 2LR8A 2UWMA 2FBKA 1DQUA 1YYVA 3CJTB 1R1UA 2O7OA 2IGKA 1FWZA 4S04A 2Z33A 2O3FA 5BNGA 2XROA 2HTJA 2N8GA 3ABMH 4EM1A 3EUHA 4I0AA 4BH9A 3E5QA 2KIMA 1XC5A 4ETSA 4RBOA 3GTOJ 2HZTA 5JVGF 4PJNA 5EGOB 3PO3J 2DOFA 4XL9A 3QOPA 2M7AA 4MTEA 3IL2A 5IPAA 2YS9A 1ACIA 2O8KA 3ASNH 2LYCA 2HOEA 3S2HJ 3COAC 3O8GA 2OQGA 2VKEA 5JI6A 5F04A 1SANA 1ZELA 3DKYA 3A0HC 1Z77A 1MNEA 3H5AA 2BW3A 3JCUC 3F22A 2XF5A 4Q5SF 2F5EA 4B3XA 5GADJ 3BJ6A 2MC4A 5FROA 5DEQA 3MVPA 4LFUA 2MH2A 3IH4A 4HV6A 5F6FA 4A3MJ 1TC3C 2M2EA 3H5RA 2FU4A 3SEQA 4RM2A 3HUGB 1B9NA 5FD5A 2CUFA 5D8KB 3ESWB 4L5JA 4TV7A 1XSDA 1ZLKA 3M1CA 2LKSA 1P2FA 2O61A 1R22A 2FJ1A 4FETA 2CW0F 2BGCA 3ERMA 1B4AA 3OR2C 1T33A 3VSKA 2Q2EA 1B59A 1SFKA 1O3TA 1GT0C 2OTLI 2EINH 4HX7A 4CUGA 3CCSI 3KP7A 4S05A 3BG6A 3G71I 3GTPJ 1DPUA 4NQWB 2MW8A 3FHZA 1FIPA 3ECHA 3FBIB 3H92A 4DYRA 3U21A 5A2QZ 4BNCA 1IV8A 2JWTA 4XLHA 1JKRC 4XOPA 3CF5F 1JTXA 1VQ9I 5E3MA 2CU7A 2R7QA 1N78A 1FJLA 4DBQA 1T38A 4HEA2 2ZJRF 3GFIA 2EIMH 1NG6A 5CVVA 2IT0A 1ZGWA 3GX4X 2BY2A 3LSHA 2Z16A 2C6YA 4EJUA 2PJRA 1GXQA 1KA8A 1Y1VJ 3D5SC 4YFKF 4D5CA 4I0BA 2Z99A 1UHWA 4MFEA 2E1MB 3PM1A 4NNJA 3WG7H 2M5WA 2OZUA 2VT3A 1XSVA 1F4KA 4X6AJ 4BQOA 2M34A 4B47A 1OPCA 3K6GA 1ERDA 3Q9SA 3JRFA 2G0EA 5D6EA 3CLOA 1K61A 2L54A 2QWWA 5KCMA 2DFHA 2DPUA 2I5UA 1VZ0A 3HB9A 3TGNA 1G3SA 1OLTA 1Z7LA 5HS7A 1BI3A 3CUQC 1BOAA 1FIAA 3OOUA 2M9HA 2NYXA 2HEOA 2QSGX 2E2JJ 3S1NJ 3RKXA 2IGNA 1H9GA 5BPDA 4LGWA 1CF7A 4DQ2A 4G94A 1WWXA 1QVTA 2L4AA 4CH7A 2DA1A 1O3RA 3O2PE 4X0GA 2CQKA 2R7OA 1IN7A 5HS8A 3G1OA 4UB6C 1IN5A 4Y17A 2J5OA 3C1DA 2XF6A 2OC6A 4EV0A 1BJZA 4IVNA 5HDGA 4HNUA 1SAXA 4HX8A 2LOOA 4RAZA 4XLNF 4BS9A 2W84A 1V55H 1R00A 2EJRA 4FHTA 1JI8A 3QQAA 3ZQHA 3CUQA 2KRCA 2GOXB 4A3CJ 3HHGA 3FX3A 5IYCJ 4RDUA 2JUCA 4GCVA 1W7PA 5L3GA 4NC6A 3OV8A 4BACA 2STTA 3H0GJ 3H1CA 2R7RA 2YX7A 3WGIA 5IT9Z 3K70D 5CVUA 1UB9A 3KP3A 4G12A 3I56I 1UCRA 5D8LB 2DXIA 1XGOA 3A03A 3E6CC 2GIVA 1VQKI 3U1KA 3GYHX 4ZZDA 1ZARA 1J9IA 3KYDB 3Q9VA 1KONA 3PFYA 3FXJA 1O57A 1XX5A 5E1XA 1HLVA 4A0XA 4ESFA 3AKZA 1IN8A 1TNSA 1GDTA 1J0RA 2FUG2 2CH0A 5E1ZB 3DWLE 4MTDA 1ZGAA 2X85A 4XSXF 1QZEA 4IEJA 1TQMA 1G3TA 3BR3A 2GM4A 1U0JA 4I98B 2MD0A 2O6GE 1XPXA 1K6OA 1CQTA 2IGMA 3LSPA 2E2IJ 3LSTA 2LF8A 3F8FA 1RUNA 2LP0A 1QO0D 4CA0A 3DTIA 2OCEA 3T8RA 2L9NA 5GPCA 1SFXA 4E70A 5KNLA 3WTZA 2A6TA 2UXXA 2FE3A 1TZLA 1RRJA 4JQFA 3S32A 2UXNA 1LDJA 3QAHA 3DEWA 3V8LA 4CZZA 6PAXA 3GTLJ 4AU7A 5DCMB 3PSFA 2M3AA 3FIWA 4CDGA 2IVMA 2FBHA 2I10A 1P7IA 4Q48A 1LFBA 1WHUA 1FT9A 2A68F 2ISYA 4J19A 4EJOA 3HKZA 3F8BA 2VONA 3F3XA 2LTPA 3HEFA 1ETVA 2JA8J 1RC9A 1OCRH 5ERIA 3FF5A 1HXDA 1ZK8A 1WVRA 3PO2J 2YR2A 1NTCA 3GFMA 1GUUA 2HOAA 3WE2A 2P6TA 2W57A 3I64A 3TP3A 4BE1A 1BR2A 5BPIA 1Z9CA 4ENNA 4G7ZF 1QVUA 2EZLA 2V79A 5M5XJ 1U78A 1POGA 1OKRA 4E7HA 1MW7A 3GVAA 2CV2A 1JHFA 1IDYA 2W00A 3A4CA 5ED4A 2CUJA 2HQ5A 3RYRA 2AXLA 1U9OA 1IN6A 1WSUA 2HU9A 2RC4A 1CGPA 4EGYA 3JAMZ 2M4GA 2WA0A 3CCLI 5CPRB 4AYBA 1SC7A 4V19K 2DK8A 2ZJ2A 3QYBA 2PLYA 1HW5A 4QIWN 3ISPA 3OYLA 3TO9A 4KMFA 3CLQA 2P5LC 1R58A 4I02A 1TT0A 1F5TA 3I3LA 4DW6A 2R7VA 2Z3YA 1B72A 4CYCB 3M3YJ 4LLNA 2WAEA 4ZH4F 2GOMA 1H8AC 2QUFA 1D1CA 2DODA 2PG4A 2F5VA 4CCNA 4MEXF 2XPVA 3IP4B 1PJRA 5ICGA 3MFKA 3DV8A 2CUEA 3FXQA 2E60A 3K10A 3IRRA 3BR0A 5AIPA 3PUBA 4A5MA 4BDYA 5C4XJ 3LFUA 4ZZLA 4UV9A 2PMZN 3S2WA 1ZG1A 2LNBA 4PDKA 4EATA 2XRLA 2L01A 4HA8A 2DA4A 2L7MP 1R71A 1R1VA 3OSGA 2A07F 1D1BA 3WTXC 2VQGA 2IP2A 4DZJA 2KIQA 3L2VA 1ZN2A 3R4KA 1HQCA 3ZQ7A 5L3EA 1T39A 4H0EA 2BYVE 2DYSH 2BXYA 4BKXA 3A2KA 4HOBA 2LY2A 3QWLA 4DBRA 2L02A 2A6HF 4A3EJ 1A6QA 2X6YA 3F8CA 4UVBA 4EVIA 1AA7A 4YRVA 3H36A 4H4KC 1Y0NA 4MGRA 4S0HB 4IQJA 1TL8A 4M3FA 1X1AA 1IDZA 2JSCA 1H88C 2XGXA 2JN6A 4A12A 3GEZA 2DMQA 4JYKA 3HJEA 1E3HA 2EZHA 3V8JA 1VQNI 1R6RA 5FKLA 2XDVA 5F27A 4DJAA 2HXOA 1QPIA 1Y56A 3FMQA 4XKWA 3BOQA 1BW5A 1QHHD 3K2ZA 3ONQA 3BZ6A 4RGRA 4BYYA 4IOCF 1JT0A 2M87A 2FQ3A 4LLGF 4LK1F 5LHGA 4G6DA 2K4BA 5E8IA 4WK8F 3DP7A 4O5VA 1SVOA 1T8IA 2VE8A 2V1UA 1I3QJ 4I7HA 4XONA 5E3NA 4CCOA 2HXIA 3RPUA 3PQKA 3DPLC 4Y52J 4PJMA 1LVKA 4AVZA 1GVDA 2D45A 4WX9A 2PEXA 1X4OA 3C3WA 4BE2A 3SFZA 2HPIA 1C0WA 4UUSA 2BVLA 3K4BA 3VODA 1DGRM 4KDPA 3JRCA 2V9VA 1Y8RB 1SMYF 2DMPA 4U7DA 2EQRA 2LLKA 5DDGA 2QF7A 2VXDA 1VNDA 3DXJF 4D5FA 2IXSA 4RB1A 4WWCA 1X4PA 2HTSA 1QGPA 1I39A 4A3DJ 2DQLA 5FRMA 2ZXJA 3UNGC 1U5TB 2ELHA 3A01A 4BQQA 2FOKA 4BHPA 2ME6A 1U9NA 3JTHA 1YO5C 5J1UA 2OAZA 3CMMA 3ULQB 3RZOJ 4LG0A 3J80Z 2CO5A 3ZCOA 3ABKH 3GTJJ 1W5TA 1ZKGA 5K5OA 3AG4H 3F72A 2VBWA 3M8JA 3VYUB 3H9QA 1W36D 1I50J 3OYJA 4V2GA 4FISA 3CP8A 3HSFA 3RIRA 3V7SA 4BHCA 2HYGD 3ZRGA 1T95A 1R4NB 3DTEA 4E6KG 1WZ2A 5JLWA 2XAGA 5CYVA 2EZIA 3OIQA 2RQQA 4IHWA 3TQNA 3WTWC 1K78A 1W1WE 2O03A 3K1PA 2X0LA 2KIFA 4U88A 2GWRA 2L4MA 4D7NA 4IRGA 2BEOA 1ZAOA 2GQQA 1FOWA 2JT1A 1MH4A 3ZQLA 5E3LA 2ID3A 1FX7A 3CF2A 1Z3XA 4XK4A 3LFKA 1JUPA 1P4XA 2OPTA 3WTYC 3U2RA 3KLOA 5ICEA 2P7VB 1FOYA 2VQLA 4KT6A 1W4MA 2E5NA 4P9UA 2AHQA 4PK4A 1XMXA 2EA2A 1PUFA 4C2UA 1XDUA 1ZRFA 5CVJA 2Y75A 4XICA 2KQRA 2E19A 3H9JA 3OYHA 3CP2A 1QQIA 5LEKA 2FQ4A 1DUXC 2Z5UA 2M8GX 4I09A 3I4NJ 5ILSA 3JRAA 4ENJA 2JZYA 2QKLB 4DIQA 1JKPC 3DTKA 4N9HA 4PJ0C 2A3SA 2P6SA 2COBA 4O6JA 3SFIA 4EJTA 1Z91A 5JHUA 3KP2A 1X1CA 2X1EA 2WB1N 2DMTA 1SD5A 2VKDA 2NVUB 1RNLA 2XRNA 4LLLA 3RCOA 2XC7A 2VJ4A 2IS1A 2NOJB 3N05A 3JRIA 3MZHA 3RQIA 1Y1WJ 2ZMEB 1LEAA 4LOCA 3I4MJ 4FX4A 3PQJA 1TQIA 2VODA 4I2OA 3VFZA 1G2HA 2DJIA 3IRQA 2YX4A 4EGZA 4BDZA 4OIOF 1MD0A 2DTZA 1KU9A 5D6FA 1UZCA 1HC8A 4HYEA 3C2HA 1N75A 1XD7A 2A05A 3L1PA 1U8RA 4M72A 4B44A 3E97A 4KIBA 2Y0SN 1IRZA 3BR5A 1YHQI 3HUGA 1XCBA 1EA3A 5FLXZ 1YS6A 4QWQA 4MEYF 4ESJA 3BTIA 5IYBJ 2K9MA 1J5YA 3EUKL 5A2QK 3OYGA 3OYIA 3VDXA 1SVLA 1IXRC 2Y69H 5E79C 5K7ZA 3H35A 1UELB 1XMAA 2NNNA 3J7AO 1BR4A 5AIQA 3MKYB 4CCKA 2ZSHB 4P1WA 1ZRCA 2H1KA 3BPXA 4U7BA 3HTUA 4XKCA 3KP5A 2EWNA 2QZ8A 4HG2A 1KU2A 4BXXJ 3LQQA 4AIJA 1KZHA 3EPZA 3QODA 1RUOA 1I6HJ 1IRFA 3VSLA 3HPGA 3W2VA 4Z6YA 2KIUA 4RGSA 1Z7UA 2Y2ZA 2KFDA 2QSHX 3IAM2 4RAYA 5J3LA 4ZYHA 5KAIC 2KZVA 3KE2A 5H2FC 2LD5A 4NHJA 1MKMA 1OCPA 4CXFA 3HOYJ 1WJBA 1R5HA 4ZDPA 3LA7A 2DYRH 1SFEA 4M6YA 2K4JA 1OYIA 4G7OF 2VPRA 2EZKA 3GZ6A 3OYNA 2DA3A 2OD5A 5IP7J 2NVTJ 4DZPA 5CKTA 3JRHA 2Y31A 2EFWA 1X3WB 5EF6A 2LBFA 2QQ8A 2Y48A 2CW7A 1R5ID 1TWCJ 3RKQA 3RKWA 2FRHA 1TWAJ 3BTCA 3HSRA 1ITYA 1RR7A 3W6JB 1XS9A 3ZN1A 3LSRA 2DK5A 2MC3A 1BA5A 1O7LA 1BL0A 2VQCA 1FPQA 1E17A 1S72I 2L9VA 3OIOA 4FQGA 3K69A 4I76A 4NB5A 4R79A 1X2NA 2MFZA 4N9IA 1ORKA 4C3IJ 5CQEA 3BP8A 2JA5J 5BMZA 4IHVA 1WRJA 3TP0A 2VBZA 1MBFA 1Q1HA 3IKVA 1GHCA 2CSOA 3OL3A 2HDDA 5IT9K 2RNGA 2VKHA 2HWVA 2CGPA 3EUAA 4I6ZA 1EKEA 4RB2C 1IGNA 5K1YA 3Q0UA 2F4OB 3P7NA 4NBQA 3W3CA 3WHCA 3S93A 4M6VA 5TGTA 3G1LA 2DDBA 3DCFA 4A0ZA 4IO9F 4F3QA 1S6LA 4F52A 4R1HA 3OWTA 1HCRA 2VN2A 5J1YA 4MQ9F 2HGCA 5K5RA 2DT5A 3NAUA 3V42A 1SFOJ 2WAQA 1LE8B 3GZNB 1BI0A 4U87A 3F0CA 3PFIA 5FGMA 2OJED 4YIIA 2A61A 3FM3A 3V7RA 3CC7I 2VJ5A 2JVGA 1VQ4I 3CJNA 1R49A 5DV5A 3GMEA 1WQ2A 2E35A 3P9KA 3VPRA 3DBRB 3FHNA 3ZQGA 2K9LA 3WTSC 3DPUA 3ZMZA 1MH3A 4GO1A 1VQ5I 2ZXIA 1WJCA 3BT9A 2PI0A 1BJAA 3IKTA 2QEXI 2F6CA 1W0TA 2KP6A 2XGEA 1FP1D 4G6TB 3HOVJ 3K1NA 3E5UA 2DA6A 4B09A 1V4RA 2QQBA 2O5RA 3QYEA 1Z3YA 1J59A 2PMHA 2W24A 3K4MA 4DYCA 3NRVA 3G6EI 2R7FA 2ZXHA 3GTMJ 2LK2A 3GO5A 1BOBA 1ETWA 1P6RA 5D5VB 1X58A 4C3HJ 3PIPF 2OQRA 2EA4A 3FKJA 4UY8I 2VKVA 1FMWA 1HDPA 3OS2A 2Y30A 1SD7A 3OYCA 5GTIC 5BOXA 3P9IA 2PN6A 1MMSA 3KZZA 3JREA 1I1SA 4FE7A 4A6EA 4FT8A 1AKHB 5B5EC 4MLOA 1A04A 1HKSA 4A3GJ 1IUFA 1Y8QB 4ENKA 1FZPB 3IH2A 2FOWA 3MAJA 4LD5A 5F0HA 3D5RC 3S1MJ 1HSJA 4YELA 4GFBA 1MBJA 2V7FA 2FXAA 3RJPA 1LQ1A 5JLXA 3CCYA 1FOKA 2E34A 2Y0MA 4BAYA 1FLIA 3JAMK 1ODDA 4HNVA 3K4JA 3CMEI 3I59A 1MDMA 4UB8C 3ZR8X 2F5CA 2H94A 4D9JA 1XDSA 3F6VA 3L09A 4M9SA 5L3BA 1JTYA 4I01A 4M9ZA 1P4AA 2RDPA 2XAJA 4XLPF 2DOAA 4KT5C 1KU7A 2DT6A 3M8FA 3F8MA 5C4JJ 2X48A 4RLFA 2JRTA 2ELKA 4LITA 2GXGA 4ON0A 4BXUA 2P7CB 2ETHA 2HYJA 1FYLA 1UFMA 3PL8A 3RI4A 4N4OB 4E7SA 4QLCU 2RQPA 4BEHA 5L3CA 1JKQC 2K27A 3AG3H 1JGGA 4UNOA 1H0MA 1ON2A 1HDDC 3R60A 4Z2YA 1MIJA 1IO2A 3VB2A 2JA2A 3E7LA 3GUDA 3WU1B 3HOXJ 3GXOA 3DLLF 2R5ZA 2F5DA 2STWA 3IH3A 2R7UA 3SZPA 2M1BA 1OYWA 2BY0A 2EH3A 1G59A 5F1JA 2VJJA 2DAOA 2E1OA 1JKOC 4M74A 4Y33A 2HVQA 2R3SA 3BWGA 4Q47A 3BJAA 2FMYA 2O8XA 4NUBA 4BGDA 3S16J 1EF4A 2R5YA 4XLFA 4O3MA 3HGGA 2MG4A 1X3UA 2CV0A 1D0YA 3DQVC 4LB6B 3R0AA 2CQQA 3F6OA 1MBEA 2LY9A 1ULYA 2V1NA 3ZQQA 2BE5F 1YS7A 2R93J 1O7FA 3HRTA 1ZG3A 5HOOA 2QA4I 3Q0VA 2ADUA 2O0YA 1P9QC 2WV1A 2NOGA 3LA2A 5D5XB 3U1DA 4G6QA 3MD2A 3ZMTA 1HF0A 1G4DA 3DKWA 4GRIA 2Q2EB 1KQ9A 3M4OJ 4XN0A 1A36A 1D8KA 3OYDA 5DUKA 2W25A 2FD5A 2BHYA 3OS1A 2Y9ZA 5CJ9A 5AONA 4AWXB 3HOWJ 3ZP5A 1WKMA 2NXNB 3E6BA 1VTNC 4LIUA 2EB7A 3RKYA 1EJ9A 2DI3A 5E3OA 4XLAA 4XKBA 1KYZA 1J7KA 2DCEA 3L00A 3LSGA 4L5IA 2FMLA 3JSPA 1HW2A 2MA3A 2PJRB 4M3EA 4A3IJ 3E0JB 2E5ZA 1RKTA 4MIMA 2CS3A 4W97A 2TRTA 1VQ7I 4EQQA 4BHBA 4M9XA 2K9QA 2GA1A 3IV5A 4RA2A 5FLMJ 3R0JA 1BR1A 1L3LA 3GTKJ 5FKOA 4CSWA 3JRBA 4LB5A 3FM5A 3K1MA 5LGNA 1JT6A 4IHSA 5GTHC 4A2UA 2R4GA 2MH9A 5E8GA 1UG2A 2QBYA 1G8XA 5FO5A 3BG7A 2ZFWA 4NDLA 2IEKA 3W6KB 4Y7NJ 3I53A 2D1HA 2Z9OA 4XKVA 5DUIA 4HDVA 3W2AA 4XORA 4F55A 3WTTC 2ZSIB 3WG9A 3TO7A 2H8RA 3J80K 2G7HA 3ZGKA 1NH3A 3PSIA 4OIQF 2RN7A 1CF7B 4HQMA 5E18F 4MQVA 4M71A 3LNQA 2GXBA 5D4RA 3UKGA 4Q4ZF 3CESA 3QYFA 1WI9A 4KUMA 5D5WB 1FBUA 4A3BJ 3BY6A 2RGVA 1J75A 4N4NB 1AHDP 3G1MA 1ZGJA 2KDOA 3CCJI 1RI7A 3K70C 2IGOA 4UHTA 4XNFA 3IHUA 4CZCA 3J7ZI 4NC8A 2JK3A 3CJRB 4U0WA 3S1QJ 1RESA 3OSFA 4ABZA 4J01A 3RTRA 3M8EA 3JW4A 3L2CA 3A02A 2EFNA 2L7ZA 2HZDA 1D0XA 1YJNI 4RAGA 3W6VA 4XQFA 2KLOA 1W7PB 2ZB9A 2LY1A 2XB5A 3FISA 1M1EB 2HQAA 5H20A 2KISA 1U3EM 1QZYA 4II3A 4RLQA 5FKMA 5KHDA 2A69F 2NAZA 1FP2A 2RVCA 3GZ5A 3LWFA 4G7HF 1O4XA 1XMKA 2LFBA 2KKOA 4ASNA 4ZYGA 1B1BA 5M3MJ 2JVHA 1MMAA 1ENHA 2WTEA 3PUFA 1JJ6C 1FEXA 4EMSA 1GXPA 2AQFA 3CDIA 3CCEI 3BCAA 1YIOA 4EJVA 2JRMA 2GA2A 5B1AH 1FYMA 1LFPA 4IX7A 1T0FC 4KICA 3I54A 2ZXWH 5EG0A 2QM3A 2K9NA 4M73A 3T8TA 2E2HJ 4II2A 2HVRA 4KA4A 1T98A 3KCCA 1G3YA 2ZMEC 4M3GA 1VQPI 2RV8A 4HLXA 1JUMA 4X1EA 4XRFA 4MO7A 4RS8A 5LEJA 4FCYA 2E36A 4HLYA 1YRNA 1I5ZA 3KYLA 4KISA 1T56A 2QQAA 4ZTFA 1WJFA 1EH7A 2HI3A 3VOEA 2L7FP 4LK0F 4AIKA 3IWZA 1YW7A 1BN5A 1K6YA 1V54H 4KN7X 3CO7C 4L9VA 1T0FA 1NHAA 1X1PA 1B8IA 3DU5A 3EDPA 5HNHA 1Q1VA 4KN4X 5DTDA 3BCBA 2IS6A 5KVRA 3ECOA 3K0LA 1STZA 1KQ8A 2KJCA 2BV6A 1AU7A 3SXYA 2B7EA 2WAFA 5EEAA 1XB4A 2R7ZJ 1G3WA 3F9KA 3CD6I 3KP6A 4IHYA 1QPMA 1PP8F 4ESBA 1OCOH 3EYIA 5FLXK 2X4HA 4LG3A 3TKYA 3RPQA 3KEYA 2HQNA 4P9FA 2GLOA 3G3ZA 3BR1A 3AG1H 5HLGA 3AG2H 3KETA 4CCLA 1MSFC 1L0OC 2K85A 3TMOA 2KRFA 2WY7Q 1P7JA 3JSOA 3DF8A 3IUOA 3SEZA 1HW1A 2IPQX 1MGTA 2DJNA 2M0MA 3SDBA 4V2FA 3MZ8A 2X51A 5IOYA 3K7AJ 2LREA 3FMRA 4B3AA 1HKTA 4E4HA 4L5EA 1BI1A 2VI6A 4AM3A 4CYDA 2HKXA 2VC1A 2Z2SB 3PNVA 4GDFA 1B72B 3OOPA 2WWYA 2VL8A 5ILUA 5EYRA 1XG1A 3TW7A 2ZNYA 2HR3A 1XGSA 3ELKA 3MZYA 3KPHA 3RSNA 1OMIA 2VC0A 1V5GA 1K83J 1HKQA 2F4IA 5FLVA 1MMGA 2IA1A 3IAS2 2LVSA 5K7FA 2AO9A 2DFFA 1XCVA 1XGMA 2DLLA 5J8FA 3S17J 3MN2A 1D8JA 4XRSA 2L2OA 2MYSA 2PX9A 2PMUA 2NRAC 1Z21A 2XKPA 4ZYAA 3R61A 3TW6A 2D2WA 1YTYA 1IC8A 2K3PA 1ZR4A 2XAQA 1PP7U 2PFBA 2VOPA 4M3BA 4U0VA 1RIOH 2MLGA 5JFRA 4HPQA 2PMZA 2FX0A 4OWRB 3KEQA 3LSMA 1Y6IA 1EH8A 5LD2C 1T2KA 1QRYA 2LKPA 4U0YA 2H09A 5HNFA 2X9DA 1TBXA 3H5NA 4FE4A 3SYTA 3A0BC 3BG9A 2YU9J 2NVYJ 5TISC 2CV1A 5J8CA 4JX6A 4KFCA 1MNDA 1FBQA 2Y9YA 5FD6A 4JX5A 3TDUC 1HOMA 2ICWG 2XPWA 3O3KA 2P8TA 1IRGA 3FWEA 4XSZF 3CZ6A 4EM2A 4WXDA 3HRSA 1ZTRA 2XIGA 3BQYA 3J7AY 5EGOA 2VBXA 3KFWX 3FXKA 4E7LA 4M6XA 2E7WA 2XGCA 4HZFA 1YJ9I 3B02A 2DMUA 3ABLH 5C44J 3ZQIA 4L9JA 2XB0X 1NG7A 2QVOA 2LC2A 4QPQA 3GFJA 2CUZA 3I71A 5LHHA 1UJ8A 3PNYA 4BJTA 2E1CA 2NS8A 1WCMJ 1JUSA 2MSYA 1YFHA 3GWZA 3HL2A 1I3AA 4XM3A 5E17F 3ZQFA 3OMYA 3SQNA 5GAEJ 4ITVA 2M45A 2V26A 1WI3A 4RB0A 3FMSA 5KK1A 4UXNA 3KIOA 3JTGA 1W36C 3T0YA 4BUPA 1VQLI 1S9HA 2MD5A 4A3LJ 2E1MC 4FTHA 3TL4X 3CTAA 1IXCA 1WJ5A 2R7XA 2P4WA 4BQNA 3A01B 1MSEC 3MEXA 3C7JA 3NARA 4NQWA 5J4VA 3LSIA 2XUBA 3T1BA 1Z05A 4LG0B 2LH9A 1W0UA 3E6MA 1OCTC 1K4TA 4IRIA 2L9RA 4A3KJ 4UVCA 3F8NA 3RZDJ 4XN3A 4HV5A 1ETOA 1BW6A 2KJBA 1IUYA 3WGHA 1S5LC 5IYDJ 3D5LA 3NWSA 3FXLA 1YOVB 2QSFX 4IL6C 2DOEA 4J00A 2F48A 1RR8C 4P5OA 4HF2A 2Q0OA 3BR2A 1K78B 3EYYA 2K86A 3HRMA 4BE0A 5KAFC 2LRDA 2D5VA 3E3VA 4PUSA 4DOZA 5M3FJ 2J5PA 1SD6A 3JRGA 2DDAA 2UUZA 2OBPA 4A0YA 3CC4I 1YW8A 1TTYA 4CCMA 1YW9A 3CUOA 3GTGJ 1TNTA 3ABUA 3LSJA 4IF4A 1NK3P 2BY1A 1F9NA 1U6GA 3BJOA 4XMYA 1D0ZA 1R23A 5FFZA 3CCQI 3LQRA 2V9PA 4AD9A 2AQEA 2EPFA 2L9SA 4IOAF 3SJMA 2DA5A 2EIJH 3L2RA 3BQZA 1PUFB 1MJAA 1IAWA 3OY9A 3OYFA 3BZKA 2V6EA 3CQZJ 3HOTA 1HSTA 4EJWA 1XN7A 3L2UA 3AL0B 1OCZH 4BY7J 1YIJI 4YIRX 1T6SA 3HRUA 1ZYRF 3CJQB 1FSEA 3WGGA 1XSXA 4QPOA 5EZHA 3IC7A 3NQOA 3OYAA 1BIAA 1W7PD 1K7AA 3W2WA 3EQLF 1YLFA 4YEJA 1VQ8I 1IXSB 3DU6A 4D1QA 4XBFA 1TWHJ 2RREA 4HRIA 1PYVA 2HVSA 2IA0A 2BOLA 3J7YJ 4B8XA 3RDIA 5FKNA 3OYMA 1GVJA 2ZKZA 3P9CA 2MABA 3QPTA 1IN4A 3K4CA 2WC2A 2VE9A 1MMNA 3KZYA 1D3YA 1Y0UA 4RGUA 1UHSA 1Z0XA 1OISA 3E5XA 2EV0A 1F36A 1LJ9A 4C30A 3UR3C 2VIXA 5DD4A 2WB1A 4K2EA 3ASOH 3GTQJ 1DP7P 1BC7C 4OAYA 2QENA 3REOA 1IW7F 2DA2A 2X6WA 1GV2A 1A35A 1I1GA 2V4JC 4KIGA 2KT0A 3KZIC 4KJZA 2D1VA 4B1RA 2KHMA 2DTRA 3PNTA 5K7HA 2HOTA 4WXHA 1B9MA 1SVMA 4MFDA 4IXAA 3HG9A 3HSEA 4HAMA 4L0ZB 4CGZA 5TRDA 2JPCA 1JXSA 5HLTA 3GLLA 3N97A 2JQ7A 2XGDA 1YI2I 2CYYA 5H6QA 3H9GA 3GBGA 4BJ6C 4L9TA 5C3EJ 2A6EF 2BZTA 2E1NA 3I0TA 4IJAA 3D1NI 1B6AA 3ZN0A 4KYWA 5M5YJ 3HKZN 1WJEA 4GYIA 1V5FA 1VQMI 2Y0SA 4F92B 2XSJC 2P0WA 3T5XA 2ESNA 1JJ8C 4HF0A 4D7MA 4C2TA 3DBLB 2PBIA 3KYCB 1PUEE 4IHXA 4E7JA 5DCMA 2RAEA 4XIDA 1FC3A 1U8BA 1USSA 2X1CA 3I58A 4Y3OA 3ROUA 3TBIA 4A5NA 5IY5H 2HOSA 1NK2P 1V5EA 4C3JJ 2K02A 1P92A 3DEUA 2DFEA 3FDYA 4Y15A 2GAUA 5IP6A 4XR6A 2GIZA 1ETYA 1DGWY 1BBYA 2P81A 3TDZC 4KIFA 3RQ4A 4AYBN 2CQNA 4E7IA 2EFQA 4HNTA 4P96A 3OYKA 4OMZA 3QPSA 4G8XA 2B0LA 4RGXA 2H8WA 4KNYA 2W1OA 1AOYA 1HA8A 1KU3A 2LBFB 2A5WA 2ME0A 3I9V2 1Z6RA 3ABTA 4HDUA 4AIDA 1S29A 5LFAA 2DU9A 2GZWA 1A6IA 1ZR2A 3GCMA 5CVIA 4L9NA 2EV6A 1ETQA 3ML6A 3WODF 3N4MA 3I55I 5FJ8J 4BJ5C 2ELJA 3R6SA 3Q5FA 5GP9A 4PCQA 3I4PA 3O8HA 4Y13A 5GAHJ 1E2XA 3B73A 1WJAA 4CYCA 3HOZJ 3WE3A 3VYSB 2QQ9A 2QCOA 2E71A 3GLXA 3TEDA 1FBSA 2L3DA 2WBMA 4ENMA 5L3FA 2RKHA 4N0BA 4GYGA 5J6XA 2W85A 4BY1J 2YUSA 5B3SH 1PDNC 3C2BA 3ZXSA 5GAGJ 1FTTA 4ZYEA 2B63J 4MNUA 4OAZA 1FTZA 4UUVA 2ZCWA 1OYYA 3FXUA 2B9SA 3FXOA 5HODA 1SFUA 3KLNA 2BW3B 3E6DA 5DD8A 5IT3A 3BLYA 2XPUA 3VEPA 1MBGA 3MMYB 4GGGA 3K4KA 2VOOA 2OA4A 1DU6A 2CG4A 4OU0A 4WXCA 2R7SA 5HDKA 2VASA 4XRSG 2CRGA 1N77A 1BM9A 3HOUJ 2QGUA 2X6XA 2XHKA 3CCUI 2K7LA 3M9AA 3X2QH 4AVPA 2OV7A 2H27A 1VQOI 3D0SA 3S3MA 3B6CA 3SZTA 3BG3A 2CWEA 3ZPLA 1TW2A 2XF7A 2BBYA 2W4SA 3HBLA 4L18B 1R1TA 2HS5A 1MBHA 1FYKA 2L5QA 1UMQA 4RAFA 3OYBA 3H3VK 1EV7A 4B43A 2ZJPF 2F4MB 2ID6A 2L7KA 1QU3A 4YFNF 5CLSA 1OR7C 1REPC 3S3NA 5TJJA 2KDZA 3K9TA 1JE8A 4PFOA 3QP6A 1YG2A 3RPUD 2DN0A 3G4SI 2XASA 1D5YA 5FB2A 2XAFA 3MCZA 1U5TC 2DO7A 3G2BA 5E20A 2ZJQF 3S15J 4IHTA 2NVQJ 4AC0A 1OCCH 2AXTC 1ZLJA 5FKKA 3HHHA 3S3OA 1X3ZB 1R5GA 1IZ1A 3A1YA 4BBSJ 4ZDOA 2L0KA 1ZHFA 1RKWA 4ZDLA 1I27A 1S7EA 3L7WA 3HC7A 3S14J 1JHHA 2MBFA 3LL7A 1J2XA 5FFXA 2OTJI 3ERED 1D1AA 1OR7A 3MKLA 3F21A 2VLAA 2DA7A 5J4YA 3Q0WA 4BU2A 3L9FA 3I59B 1MDMB 2M7BA 2VT2A 1ONVA 3TO6A 2ISZA 2JA6J 2KMUA 1U5TA 5HS9A 2OF7A 3DKXA 1MZBA 5D5UB 2DMNA 2KRHA 3KX2A 1EH6A 2R7TA 1LKXA 2FNAA 4CCJA 2HDCA 3HPHA 3K2AA 1QZZA 4ANJA 2XAUA 1FY7A 4LIVA 4D0PA 3MKZA 4EEFG 2VJIA 3HZJA 3CUQB 1F43A 3C2GA 3H3ZA 3GW2A 4B4CA 2I8DA 2LMDA 2VUMJ 3CCVI 3FXMA 4BEHB 1LDKB 1WFXA 2DQRA 2JPBA 3ZOBA 3VWBA 1W5SA 3I5UA 3Q3SA 1H89C 3KEOA 2PQ8A 4L0YB 1TW3A 3HIFA 2HQRA 3CC2I 2V1DA 2FF4A 5B1BH 2R5ZB 2DBBA 2TDXA 5LHIA 1MMDA 2XKOA 5ILVA 5H6RA 4R8HA 3S8PA 2GXAA 4F91B 4PGGA 3SZGA 4GXOA 5DM7F 4CO8A 4KMUX 2IA2A 2KL4A 2GBYA 2IJLA 1ZRDA 5CQGA 4A3FJ 2IRFG 1RETA 1ETXA 4ZC3A 1ETKA 4W1UA 5F1RA 2R5YB 1DU0A 1ZH5A 2ZNZA 2DFIA 1UHMA 2EK5A 4HBLA 3RYPA 3J81K 1MJBA 4I99C 3WTVC 4B48A 1AWCA 3HTSB 3LMMA 4PFPA 3F23A 1D5VA 1Z67A 4HX4A 2CMPA 3K4NA 5CVRA 4A93J 5JR3A 3JRDA 3QP5A 1E3OC 3B6AA 3C18A 3OS0A 4IPAA 1OQYA 2NS7A 3ZMDA 3KP4A 1TWFJ 2BY3A 3QRFF 4UUTA 3TOAA 4IKFA 2ZC2A 4FASD 2WADA 1IRXA 3MWMA 3DPTA 2WY8Q 2ZO4A 3E1SA 1SMTA 2VPLA 4PZJA 5J47A 1VI0A 5EZGA 1UAAA 2F2EA 3L2QA 1Y39A 5EDNA 2V1XA 3BROA 1VF9A 1RZ4A 5F0CA 4BXFA 1KQ0A 3CCRI 5F08A 2QYOA 2EILH 1O3QA 2NVXJ 1IV6A 1WJDA 4DNCA 2W48A 1MBKA 4OIRF 4WCGA 3FXRA 1DP3A 2H6BA 2ZMEA 5DCFA 1G6NA 2EV5A 2KPMA 3CCMI 5HLIA 4C9YA 2VB6A 3V7CA 4IZZA 4UV8A 2IAIA 2P5VA 4M3DA 2OUMA 4JOMA 2V6CA 2O9LA 2YU3A 4OOIA 2XSDC 1LVAA 4RB3C 5E1WA 2XVCA 1IF1A 2HPMA 2CQ7A 1BI2A 3WU2C 3DFGA 4HQEA 1P4WA 2H6CA 2BHZA 4Y4RA 4JX4A 2JUGA 4A69C 2QBYB 4PJLA 1T08B 2XV4S 1GLNA 2RNJA 3BZCA 3CO6C 5DS9A 1YX5A 3G73A 3DBHB 4BL0B 3OYEA 1S8NA 2PJPA 1X1DA 1OJLA 3S1RJ 3PIOF 4EM0B 4OMYA 2KZGA 3CMYA 3QPHA 5LRRA 3BDDA 3L2WA 1X1BA 1USTA 2F5FA 4E7ZA 5EJCA
chains in the Genus database with same CATH topology
4A3GJ 4MLOA 1A5JA 1IUFA 1GV5A 1IDYA 2HQ5A 3IH2A 1IJWC 1ZQ3P 5F0HA 3S1MJ 1U9OA 3BR2A 2JA7J 4GFBA 1MBJA 5JLXA 3CCYA 2D5VA 4HNVA 4QIWN 5M3FJ 3BTJA 3JRGA 2ECBA 3HGYA 4QSHA 3WHBA 1JTYA 4DW6A 1B72A 3GTGJ 4CYCB 3M3YJ 1IG7A 3LSJA 3FK7A 1NK3P 1H8AC 1TWGJ 5C4JJ 2X48A 2LKXA 2ELKA 1MNMC 2XPVA 2CUEA 3SJMA 2DA5A 3BR0A 2HYJA 3BQZA 1PUFB 5J1RA 3CQZJ 5C4XJ 2PMZN 2JMWA 4A3JJ 1JKQC 4BY7J 1JGGA 2XRLA 2DA4A 2L7MP 3OSGA 1HDDC 3ZQCA 5IP9J 4DZJA 3E7LA 5EZHA 3HOXJ 5EG0B 2R5ZA 3IH3A 1X2MA 2EH3A 5F1JA 4BKXA 1TWHJ 2E1OA 2K9SA 1JKOC 1OFCX 3HM5A 4A3EJ 3S16J 1EF4A 2R5YA 2CQXA 5FKNA 2ECCA 3HGGA 2MG4A 1YRNB 1WH7A 2CQQA 4S0HB 1MBEA 4M3FA 1IDZA 1H88C 2WAQN 2LY9A 2JN6A 1UHSA 2DMQA 4JYKA 1Z0XA 2R93J 2TCTA 3BG5A 2EZHA 3Q0VA 1F36A 3GTQJ 5FKLA 2WV1A 5F27A 9ANTA 2HXOA 2NOGA 1B8IB 1QPIA 1HF0A 1BW5A 5IOZA 2DA2A 3BTLA 1GV2A 3M4OJ 2KT0A 1JT0A 3HDDA 4B1RA 4UUSB 5K7HA 2FD5A 2HOTA 1WH5A 2MGQA 1R9TJ 1LE8A 2Y9ZA 3HOWJ 4MFDA 4BBRJ 2EBIA 1I3QJ 5E3OA 1RPWA 2XGDA 5E3NA 2HXIA 4Y52J 3QPLA 2JJ7A 3GBGA 5C3EJ 2IBDA 1GVDA 3D1NI 3LSGA 1WPKA 2R0QC 5M5YJ 5GPAA 3HKZN 4M3EA 4A3IJ 1VFCA 1RKTA 4UUSA 4MIMA 1APLC 4W97A 2TRTA 3JRCA 1JJ8C 2K9QA 4D7MA 3FK6A 2DMPA 3IV5A 3JR9A 5FLMJ 4IHXA 2RAEA 2EQRA 4XIDA 2LLKA 3GTKJ 1U8BA 2QF7A 5FKOA 1VNDA 4D5FA 3JRBA 1JT6A 2HOSA 4A3DJ 4C2MJ 3SDGA 1NK2P 4C3JJ 3A01A 2K40A 1UG2A 5F0FA 2ME6A 5IP6A 1U9NA 4NDLA 2IEKA 2CJJA 5J1UA 4Y7NJ 3BR6A 1LFUP 1ETYA 2P81A 3RZOJ 4AYBN 3GTJJ 1ZKGA 2H8RA 5M5WJ 4XRMA 1I50J 3QPSA 3FKIJ 4V2GA 3LNQA 4FISA 4JP0A 3UKGA 1AKHA 5JLWA 2M0CA 2ME0A 4A3BJ 4DYQA 1AHDP 2EZIA 3G1MA 1A6IA 1ZR2A 4IHWA 3LOCA 2JK3A 3S1QJ 1RESA 3OSFA 1ETQA 4ABZA 4D7NA 5FJ8J 1WGXA 5GP9A 3A02A 1MH4A 3O8HA 2L7ZA 3ZQLA 3W6VA 5E3LA 2ID3A 2ZB9A 2XB5A 3FISA 4CYCA 3HOZJ 4XK4A 3S2DJ 2QCOA 2R92J 1JUPA 4AUXA 4QTRA 2OPTA 3CDLA 3TEDA 5FKMA 2X6OA 2LR8A 2AHQA 4BY1J 2YUSA 1O4XA 1PUFA 2LFBA 2O7OA 3C2BA 5M3MJ 1FTTA 2B63J 1FTZA 4XICA 5BNGA 2E19A 1ENHA 2N8GA 5HODA 1JJ6C 1FEXA 2FQ4A 4RBOA 1XC5A 3GTOJ 2M8GX 3I4NJ 3JRAA 5EGOB 3PO3J 1JKPC 5IPAA 2XPUA 2YS9A 2O8KA 5EG0A 1MBGA 3S2HJ 3SFIA 2COBA 2K9NA 3O8GA 2VKEA 2E2HJ 5F04A 1DU6A 1SANA 4M3GA 2WB1N 2DMTA 1Z77A 4XRSG 1JUMA 4X1EA 2CRGA 4MO7A 4FCYA 3HOUJ 1YRNA 3MVPA 3JRIA 3RQIA 3IH4A 1Y1WJ 1TC3C 4A3MJ 3B6CA 2M2EA 3BG3A 4LOCA 3I4MJ 1T56A 2CUFA 2HI3A 3HBLA 2L7FP 1G2HA 1MBHA 2FJ1A 1UMQA 2DTZA 1B8IA 3H3VK 2ID6A 1Q1VA 1T33A 5DTDA 3L1PA 1GT0C 2KDZA 2Y0SN 1IRZA 1AU7A 3GTPJ 3BR5A 5EEAA 2MW8A 2R7ZJ 1FIPA 4DYRA 2DN0A 1D5YA 4IHYA 2JWTA 3BTIA 5IYBJ 1JKRC 1JTXA 3S15J 5E3MA 2CU7A 1FJLA 5K7ZA 2NVQJ 4AC0A 2GLOA 1ZGWA 5FKKA 3BR1A 4BBSJ 1Y1VJ 2L0KA 1MSFC 1RKWA 4D5CA 1S7EA 1P7JA 3S14J 2H1KA 4MFEA 2DJNA 3PM1A 4BXXJ 4V2FA 3MKLA 2DA7A 5IOYA 3K7AJ 4X6AJ 2M34A 1I6HJ 3Q0WA 4B3AA 4L5EA 2Y2ZA 2JA6J 3JRFA 2G0EA 2VI6A 1K61A 5J3LA 2OF7A 2LD5A 2DMNA 1OCPA 1B72B 3HB9A 3HOYJ 5EYRA 1FIAA 3K2AA 1XG1A 3OOUA 2M9HA 3TW7A 3S1NJ 2E2JJ 2VPRA 2EZKA 2DA3A 4EEFG 5IP7J 2NVTJ 4DZPA 3JRHA 2Y31A 1F43A 1QVTA 5EF6A 1K83J 4B4CA 5FLVA 2DA1A 2VUMJ 1TWCJ 2LVSA 2AO9A 5K7FA 3RKQA 3S17J 3G1OA 3ZOBA 3MN2A 3Q3SA 1TWAJ 1H89C 4XRSA 3BTCA 1ITYA 1RR7A 1BJZA 1XS9A 3LSRA 3TW6A 1IC8A 1BA5A 2R5ZB 1ZR4A 1BL0A 3QQAA 3ZQHA 3OIOA 4M3BA 4I76A 4A3CJ 1X2NA 5IYCJ 4RDUA 1ORKA 4C3IJ 2JA5J 2FX0A 2GBYA 3H0GJ 4IHVA 4A3FJ 1RETA 1QRYA 3TP0A 1ETXA 1ETKA 4W1UA 2R5YB 2X9DA 1DU0A 4FE4A 1MBFA 3BG9A 2YU9J 2NVYJ 4G12A 2HDDA 4JX6A 3A03A 2Y9YA 4I6ZA 4JX5A 1IGNA 1HOMA 3Q0UA 2XPWA 4A93J 3WHCA 3JRDA 1E3OC 3B6AA 4M6VA 1HLVA 3G1LA 3DCFA 1ZTRA 3BQYA 2NS7A 1GDTA 1TWFJ 5EGOA 4UUTA 2XGCA 1HCRA 5J1YA 3NAUA 1SFOJ 1LE8B 4IEJA 3F0CA 1VI0A 5EZGA 3BR3A 2GM4A 2DMUA 5EDNA 5C44J 3ZQIA 1CQTA 1VF9A 3LSPA 2E2IJ 2XB0X 5F0CA 5F08A 2LP0A 2NVXJ 1IV6A 2W48A 1MBKA 5GPCA 3VPRA 3ZQGA 2NS8A 1WCMJ 1JUSA 2MSYA 1MH3A 2IAIA 4M3DA 3ZQFA 3DEWA 3GTLJ 3BT9A 2O9LA 1WI3A 2XSDC 1W0TA 2XGEA 4A3LJ 3FIWA 3HOVJ 2I10A 1P7IA 2DA6A 4FTHA 1LFBA 4JX4A 4DYCA 3A01B 4J19A 1MSEC 4A69C 2LK2A 3GTMJ 2LTPA 3HEFA 1ETVA 3NARA 1ETWA 2JA8J 5DS9A 1ZK8A 3PO2J 1X58A 4C3HJ 1NTCA 1GUUA 1W0UA 1OCTC 2HOAA 1OJLA 2VKVA 3S1RJ 2L9RA 1HDPA 4A3KJ 2Y30A 3RZDJ 3TP3A 1ETOA 1BW6A 3CMYA 3JREA 1QVUA 2EZLA 5M5XJ 1U78A 5IYDJ 1POGA 4FE7A 1AKHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3G J;  4MLO A;  1A5J A;  1IUF A;  1GV5 A;  1IDY A;  2HQ5 A;  3IH2 A;  1IJW C;  1ZQ3 P;  5F0H A;  3S1M J;  1U9O A;  3BR2 A;  2JA7 J;  4GFB A;  1MBJ A;  5JLX A;  3CCY A;  2D5V A;  4HNV A;  4QIW N;  5M3F J;  3BTJ A;  3JRG A;  2ECB A;  3HGY A;  4QSH A;  3WHB A;  1JTY A;  4DW6 A;  1B72 A;  3GTG J;  4CYC B;  3M3Y J;  1IG7 A;  3LSJ A;  3FK7 A;  1NK3 P;  1H8A C;  1TWG J;  5C4J J;  2X48 A;  2LKX A;  2ELK A;  1MNM C;  2XPV A;  2CUE A;  3SJM A;  2DA5 A;  3BR0 A;  2HYJ A;  3BQZ A;  1PUF B;  5J1R A;  3CQZ J;  5C4X J;  2PMZ N;  2JMW A;  4A3J J;  1JKQ C;  4BY7 J;  1JGG A;  2XRL A;  2DA4 A;  2L7M P;  3OSG A;  1HDD C;  3ZQC A;  5IP9 J;  4DZJ A;  3E7L A;  5EZH A;  3HOX J;  5EG0 B;  2R5Z A;  3IH3 A;  1X2M A;  2EH3 A;  5F1J A;  4BKX A;  1TWH J;  2E1O A;  2K9S A;  1JKO C;  1OFC X;  3HM5 A;  4A3E J;  3S16 J;  1EF4 A;  2R5Y A;  2CQX A;  5FKN A;  2ECC A;  3HGG A;  2MG4 A;  1YRN B;  1WH7 A;  2CQQ A;  4S0H B;  1MBE A;  4M3F A;  1IDZ A;  1H88 C;  2WAQ N;  2LY9 A;  2JN6 A;  1UHS A;  2DMQ A;  4JYK A;  1Z0X A;  2R93 J;  2TCT A;  3BG5 A;  2EZH A;  3Q0V A;  1F36 A;  3GTQ J;  5FKL A;  2WV1 A;  5F27 A;  9ANT A;  2HXO A;  2NOG A;  1B8I B;  1QPI A;  1HF0 A;  1BW5 A;  5IOZ A;  2DA2 A;  3BTL A;  1GV2 A;  3M4O J;  2KT0 A;  1JT0 A;  3HDD A;  4B1R A;  4UUS B;  5K7H A;  2FD5 A;  2HOT A;  1WH5 A;  2MGQ A;  1R9T J;  1LE8 A;  2Y9Z A;  3HOW J;  4MFD A;  4BBR J;  2EBI A;  1I3Q J;  5E3O A;  1RPW A;  2XGD A;  5E3N A;  2HXI A;  4Y52 J;  3QPL A;  2JJ7 A;  3GBG A;  5C3E J;  2IBD A;  1GVD A;  3D1N I;  3LSG A;  1WPK A;  2R0Q C;  5M5Y J;  5GPA A;  3HKZ N;  4M3E A;  4A3I J;  1VFC A;  1RKT A;  4UUS A;  4MIM A;  1APL C;  4W97 A;  2TRT A;  3JRC A;  1JJ8 C;  2K9Q A;  4D7M A;  3FK6 A;  2DMP A;  3IV5 A;  3JR9 A;  5FLM J;  4IHX A;  2RAE A;  2EQR A;  4XID A;  2LLK A;  3GTK J;  1U8B A;  2QF7 A;  5FKO A;  1VND A;  4D5F A;  3JRB A;  1JT6 A;  2HOS A;  4A3D J;  4C2M J;  3SDG A;  1NK2 P;  4C3J J;  3A01 A;  2K40 A;  1UG2 A;  5F0F A;  2ME6 A;  5IP6 A;  1U9N A;  4NDL A;  2IEK A;  2CJJ A;  5J1U A;  4Y7N J;  3BR6 A;  1LFU P;  1ETY A;  2P81 A;  3RZO J;  4AYB N;  3GTJ J;  1ZKG A;  2H8R A;  5M5W J;  4XRM A;  1I50 J;  3QPS A;  3FKI J;  4V2G A;  3LNQ A;  4FIS A;  4JP0 A;  3UKG A;  1AKH A;  5JLW A;  2M0C A;  2ME0 A;  4A3B J;  4DYQ A;  1AHD P;  2EZI A;  3G1M A;  1A6I A;  1ZR2 A;  4IHW A;  3LOC A;  2JK3 A;  3S1Q J;  1RES A;  3OSF A;  1ETQ A;  4ABZ A;  4D7N A;  5FJ8 J;  1WGX A;  5GP9 A;  3A02 A;  1MH4 A;  3O8H A;  2L7Z A;  3ZQL A;  3W6V A;  5E3L A;  2ID3 A;  2ZB9 A;  2XB5 A;  3FIS A;  4CYC A;  3HOZ J;  4XK4 A;  3S2D J;  2QCO A;  2R92 J;  1JUP A;  4AUX A;  4QTR A;  2OPT A;  3CDL A;  3TED A;  5FKM A;  2X6O A;  2LR8 A;  2AHQ A;  4BY1 J;  2YUS A;  1O4X A;  1PUF A;  2LFB A;  2O7O A;  3C2B A;  5M3M J;  1FTT A;  2B63 J;  1FTZ A;  4XIC A;  5BNG A;  2E19 A;  1ENH A;  2N8G A;  5HOD A;  1JJ6 C;  1FEX A;  2FQ4 A;  4RBO A;  1XC5 A;  3GTO J;  2M8G X;  3I4N J;  3JRA A;  5EGO B;  3PO3 J;  1JKP C;  5IPA A;  2XPU A;  2YS9 A;  2O8K A;  5EG0 A;  1MBG A;  3S2H J;  3SFI A;  2COB A;  2K9N A;  3O8G A;  2VKE A;  2E2H J;  5F04 A;  1DU6 A;  1SAN A;  4M3G A;  2WB1 N;  2DMT A;  1Z77 A;  4XRS G;  1JUM A;  4X1E A;  2CRG A;  4MO7 A;  4FCY A;  3HOU J;  1YRN A;  3MVP A;  3JRI A;  3RQI A;  3IH4 A;  1Y1W J;  1TC3 C;  4A3M J;  3B6C A;  2M2E A;  3BG3 A;  4LOC A;  3I4M J;  1T56 A;  2CUF A;  2HI3 A;  3HBL A;  2L7F P;  1G2H A;  1MBH A;  2FJ1 A;  1UMQ A;  2DTZ A;  1B8I A;  3H3V K;  2ID6 A;  1Q1V A;  1T33 A;  5DTD A;  3L1P A;  1GT0 C;  2KDZ A;  2Y0S N;  1IRZ A;  1AU7 A;  3GTP J;  3BR5 A;  5EEA A;  2MW8 A;  2R7Z J;  1FIP A;  4DYR A;  2DN0 A;  1D5Y A;  4IHY A;  2JWT A;  3BTI A;  5IYB J;  1JKR C;  1JTX A;  3S15 J;  5E3M A;  2CU7 A;  1FJL A;  5K7Z A;  2NVQ J;  4AC0 A;  2GLO A;  1ZGW A;  5FKK A;  3BR1 A;  4BBS J;  1Y1V J;  2L0K A;  1MSF C;  1RKW A;  4D5C A;  1S7E A;  1P7J A;  3S14 J;  2H1K A;  4MFE A;  2DJN A;  3PM1 A;  4BXX J;  4V2F A;  3MKL A;  2DA7 A;  5IOY A;  3K7A J;  4X6A J;  2M34 A;  1I6H J;  3Q0W A;  4B3A A;  4L5E A;  2Y2Z A;  2JA6 J;  3JRF A;  2G0E A;  2VI6 A;  1K61 A;  5J3L A;  2OF7 A;  2LD5 A;  2DMN A;  1OCP A;  1B72 B;  3HB9 A;  3HOY J;  5EYR A;  1FIA A;  3K2A A;  1XG1 A;  3OOU A;  2M9H A;  3TW7 A;  3S1N J;  2E2J J;  2VPR A;  2EZK A;  2DA3 A;  4EEF G;  5IP7 J;  2NVT J;  4DZP A;  3JRH A;  2Y31 A;  1F43 A;  1QVT A;  5EF6 A;  1K83 J;  4B4C A;  5FLV A;  2DA1 A;  2VUM J;  1TWC J;  2LVS A;  2AO9 A;  5K7F A;  3RKQ A;  3S17 J;  3G1O A;  3ZOB A;  3MN2 A;  3Q3S A;  1TWA J;  1H89 C;  4XRS A;  3BTC A;  1ITY A;  1RR7 A;  1BJZ A;  1XS9 A;  3LSR A;  3TW6 A;  1IC8 A;  1BA5 A;  2R5Z B;  1ZR4 A;  1BL0 A;  3QQA A;  3ZQH A;  3OIO A;  4M3B A;  4I76 A;  4A3C J;  1X2N A;  5IYC J;  4RDU A;  1ORK A;  4C3I J;  2JA5 J;  2FX0 A;  2GBY A;  3H0G J;  4IHV A;  4A3F J;  1RET A;  1QRY A;  3TP0 A;  1ETX A;  1ETK A;  4W1U A;  2R5Y B;  2X9D A;  1DU0 A;  4FE4 A;  1MBF A;  3BG9 A;  2YU9 J;  2NVY J;  4G12 A;  2HDD A;  4JX6 A;  3A03 A;  2Y9Y A;  4I6Z A;  4JX5 A;  1IGN A;  1HOM A;  3Q0U A;  2XPW A;  4A93 J;  3WHC A;  3JRD A;  1E3O C;  3B6A A;  4M6V A;  1HLV A;  3G1L A;  3DCF A;  1ZTR A;  3BQY A;  2NS7 A;  1GDT A;  1TWF J;  5EGO A;  4UUT A;  2XGC A;  1HCR A;  5J1Y A;  3NAU A;  1SFO J;  1LE8 B;  4IEJ A;  3F0C A;  1VI0 A;  5EZG A;  3BR3 A;  2GM4 A;  2DMU A;  5EDN A;  5C44 J;  3ZQI A;  1CQT A;  1VF9 A;  3LSP A;  2E2I J;  2XB0 X;  5F0C A;  5F08 A;  2LP0 A;  2NVX J;  1IV6 A;  2W48 A;  1MBK A;  5GPC A;  3VPR A;  3ZQG A;  2NS8 A;  1WCM J;  1JUS A;  2MSY A;  1MH3 A;  2IAI A;  4M3D A;  3ZQF A;  3DEW A;  3GTL J;  3BT9 A;  2O9L A;  1WI3 A;  2XSD C;  1W0T A;  2XGE A;  4A3L J;  3FIW A;  3HOV J;  2I10 A;  1P7I A;  2DA6 A;  4FTH A;  1LFB A;  4JX4 A;  4DYC A;  3A01 B;  4J19 A;  1MSE C;  4A69 C;  2LK2 A;  3GTM J;  2LTP A;  3HEF A;  1ETV A;  3NAR A;  1ETW A;  2JA8 J;  5DS9 A;  1ZK8 A;  3PO2 J;  1X58 A;  4C3H J;  1NTC A;  1GUU A;  1W0U A;  1OCT C;  2HOA A;  1OJL A;  2VKV A;  3S1R J;  2L9R A;  1HDP A;  4A3K J;  2Y30 A;  3RZD J;  3TP3 A;  1ETO A;  1BW6 A;  3CMY A;  3JRE A;  1QVU A;  2EZL A;  5M5X J;  1U78 A;  5IYD J;  1POG A;  4FE7 A;  1AKH B; 
#chains in the Genus database with same CATH topology
 1A5J A;  4PJJ A;  5L3D A;  2OU2 A;  1GV5 A;  2X1D A;  3CDH A;  4RMN A;  1IJW C;  3AFH A;  4OIN F;  1ZQ3 P;  1SD4 A;  2JA7 J;  1YQA A;  2FSW A;  1KGS A;  1W5C C;  2A5Y B;  2DW4 A;  1VQ6 I;  1R7J A;  4HST A;  2HYF A;  1MJ9 A;  2K3F A;  2Z1D A;  1E3P A;  3BTJ A;  2ECB A;  3HGY A;  4NC7 A;  4QSH A;  3WHB A;  2JTV A;  5LGU A;  2R7W A;  2NNY A;  2BXZ A;  2QKM B;  1LEB A;  3OR1 C;  5JHF A;  1IG7 A;  2FA5 A;  1R4M B;  3FK7 A;  3M7G A;  1LPQ A;  3HYI A;  3ZMU A;  4JK1 X;  5HDN A;  4ZTJ A;  1TWG J;  1LNW A;  2LKX A;  4XLC A;  2IS2 A;  3V8K A;  1MNM C;  3AL0 C;  2EFP A;  2XAH A;  5JVT A;  3QU6 A;  1S3J A;  4E7K A;  5LGT A;  5J1R A;  4OIP F;  5F64 A;  3V4G A;  1QA6 A;  3HOS A;  1TQP A;  5DYM A;  1S7O A;  3BPV A;  2JMW A;  4A3J J;  2E7X A;  1R36 A;  3LSK A;  2MLK A;  3DLA A;  2LG4 A;  3LA3 A;  2NS0 A;  3GFL A;  3ZQC A;  4MHG A;  5IP9 J;  4YIF A;  3EET A;  4HW0 A;  3J81 Z;  2JSP A;  1XGN A;  1QBJ A;  5EG0 B;  4PGH A;  1X2M A;  2ZFU A;  1F1Z A;  4XLE A;  3PJR A;  2K9S A;  5BS6 A;  1OFC X;  4AIH A;  1BIB A;  3HM5 A;  2G7U A;  2UV1 A;  3HXL A;  2M8E A;  3P5J A;  1K4S A;  2CQX A;  2CW8 A;  2ECC A;  4BQA A;  1YE9 A;  5K5Q A;  2AS5 F;  3U9G A;  1YRN B;  5EEG A;  3MQ0 A;  3QU3 A;  1WH7 A;  4A6D A;  4IRH A;  2W7N A;  2VBY A;  4XOT A;  1BC8 C;  2WAQ N;  2DT7 B;  1YIT I;  3DEE A;  4CHU A;  2TCT A;  3BG5 A;  2YPR A;  1ZRE A;  4G9Y A;  1LB2 A;  1XTA A;  4PSX A;  3LAP A;  1B8I B;  9ANT A;  4UVA A;  4RM3 A;  2ESH A;  5IOZ A;  4IQ4 A;  1SEU A;  3BTL A;  1S7A A;  2HDW A;  4HF1 A;  5EEH A;  1O3S A;  3HDD A;  2EFO A;  4DGW B;  4UUS B;  4HSR A;  2QLZ A;  3SHF A;  1WH5 A;  2MGQ A;  1R9T J;  1LE8 A;  3GF2 A;  1KYW A;  4JBA A;  3NWT A;  4BBR J;  2UZK A;  3WTU C;  3NEU A;  2EBI A;  3BC8 A;  3O6B B;  1TLH B;  1LDD A;  1RPW A;  1J09 A;  1ON1 A;  1YJW I;  1H9T A;  3QPL A;  3LAJ A;  1DDN A;  2JJ7 A;  3VYT B;  2FEZ A;  3M07 A;  2Q1Z B;  2IBD A;  2OZ6 A;  2FBI A;  1X19 A;  1WPK A;  3ZMV A;  2R0Q C;  1TP4 A;  4ZJZ A;  2IS4 A;  5GPA A;  2OCC H;  4WF2 A;  4YG2 F;  1VFC A;  1N25 A;  2COM A;  1APL C;  1Z6T A;  4PSW A;  2IW5 A;  2LF7 A;  3JR9 A;  2M4K A;  3FK6 A;  5DM6 F;  5ICF A;  1I6X A;  5HVQ C;  5J40 A;  2FNP A;  1QHG A;  5HLH A;  4C2M J;  3SDG A;  3ZMS A;  2HFH A;  2K40 A;  5B66 C;  5F0F A;  2R7D A;  2CJJ A;  1K79 A;  2HNH A;  3BR6 A;  1LFU P;  2DPD A;  2CFO A;  1FMV A;  1FNN A;  1SAU A;  2K5C A;  1DPR A;  1PVE A;  1UG0 A;  2VQH A;  1JGS A;  2H1L A;  2V9K A;  5D4S A;  3IWF A;  3K4L A;  5M5W J;  4XRM A;  3OL4 A;  2BVM A;  4KIT B;  4F93 B;  4LJZ F;  3FKI J;  1FSH A;  2Q8K A;  4JP0 A;  1QNT A;  1FOX A;  1TT5 B;  5LLQ A;  1AKH A;  3MKW B;  5LRS A;  2M0C A;  4DYQ A;  4FX0 A;  1V3F A;  3H0D A;  2ZBK A;  1Z1D A;  3TOB A;  4YFX F;  2WV0 A;  1A31 A;  4F7Z A;  2P5K A;  3LOC A;  1U2W A;  3VYR B;  5BQT A;  1ZG5 A;  3AAF A;  5FRN A;  2CFX A;  3EUH C;  2ACJ A;  1WGX A;  2LDU A;  3FBN B;  3FZV A;  3M1E A;  2YSR A;  5ICC A;  2W82 A;  4LMY A;  3H3U A;  5LBQ A;  2LSO A;  2EIK H;  4ZYD A;  1LUJ B;  1YX3 A;  2M30 A;  1E0E A;  2VXZ A;  4CIC A;  1HBX G;  3S2D J;  3OIP A;  2R92 J;  4AUX A;  4P55 A;  3WU0 A;  2G9W A;  4QTR A;  3CDL A;  2HKO A;  3CMA I;  3QOE A;  2X6O A;  2LR8 A;  2UWM A;  2FBK A;  1DQU A;  1YYV A;  3CJT B;  1R1U A;  2O7O A;  2IGK A;  1FWZ A;  4S04 A;  2Z33 A;  2O3F A;  5BNG A;  2XRO A;  2HTJ A;  2N8G A;  3ABM H;  4EM1 A;  3EUH A;  4I0A A;  4BH9 A;  3E5Q A;  2KIM A;  1XC5 A;  4ETS A;  4RBO A;  3GTO J;  2HZT A;  5JVG F;  4PJN A;  5EGO B;  3PO3 J;  2DOF A;  4XL9 A;  3QOP A;  2M7A A;  4MTE A;  3IL2 A;  5IPA A;  2YS9 A;  1ACI A;  2O8K A;  3ASN H;  2LYC A;  2HOE A;  3S2H J;  3COA C;  3O8G A;  2OQG A;  2VKE A;  5JI6 A;  5F04 A;  1SAN A;  1ZEL A;  3DKY A;  3A0H C;  1Z77 A;  1MNE A;  3H5A A;  2BW3 A;  3JCU C;  3F22 A;  2XF5 A;  4Q5S F;  2F5E A;  4B3X A;  5GAD J;  3BJ6 A;  2MC4 A;  5FRO A;  5DEQ A;  3MVP A;  4LFU A;  2MH2 A;  3IH4 A;  4HV6 A;  5F6F A;  4A3M J;  1TC3 C;  2M2E A;  3H5R A;  2FU4 A;  3SEQ A;  4RM2 A;  3HUG B;  1B9N A;  5FD5 A;  2CUF A;  5D8K B;  3ESW B;  4L5J A;  4TV7 A;  1XSD A;  1ZLK A;  3M1C A;  2LKS A;  1P2F A;  2O61 A;  1R22 A;  2FJ1 A;  4FET A;  2CW0 F;  2BGC A;  3ERM A;  1B4A A;  3OR2 C;  1T33 A;  3VSK A;  2Q2E A;  1B59 A;  1SFK A;  1O3T A;  1GT0 C;  2OTL I;  2EIN H;  4HX7 A;  4CUG A;  3CCS I;  3KP7 A;  4S05 A;  3BG6 A;  3G71 I;  3GTP J;  1DPU A;  4NQW B;  2MW8 A;  3FHZ A;  1FIP A;  3ECH A;  3FBI B;  3H92 A;  4DYR A;  3U21 A;  5A2Q Z;  4BNC A;  1IV8 A;  2JWT A;  4XLH A;  1JKR C;  4XOP A;  3CF5 F;  1JTX A;  1VQ9 I;  5E3M A;  2CU7 A;  2R7Q A;  1N78 A;  1FJL A;  4DBQ A;  1T38 A;  4HEA 2;  2ZJR F;  3GFI A;  2EIM H;  1NG6 A;  5CVV A;  2IT0 A;  1ZGW A;  3GX4 X;  2BY2 A;  3LSH A;  2Z16 A;  2C6Y A;  4EJU A;  2PJR A;  1GXQ A;  1KA8 A;  1Y1V J;  3D5S C;  4YFK F;  4D5C A;  4I0B A;  2Z99 A;  1UHW A;  4MFE A;  2E1M B;  3PM1 A;  4NNJ A;  3WG7 H;  2M5W A;  2OZU A;  2VT3 A;  1XSV A;  1F4K A;  4X6A J;  4BQO A;  2M34 A;  4B47 A;  1OPC A;  3K6G A;  1ERD A;  3Q9S A;  3JRF A;  2G0E A;  5D6E A;  3CLO A;  1K61 A;  2L54 A;  2QWW A;  5KCM A;  2DFH A;  2DPU A;  2I5U A;  1VZ0 A;  3HB9 A;  3TGN A;  1G3S A;  1OLT A;  1Z7L A;  5HS7 A;  1BI3 A;  3CUQ C;  1BOA A;  1FIA A;  3OOU A;  2M9H A;  2NYX A;  2HEO A;  2QSG X;  2E2J J;  3S1N J;  3RKX A;  2IGN A;  1H9G A;  5BPD A;  4LGW A;  1CF7 A;  4DQ2 A;  4G94 A;  1WWX A;  1QVT A;  2L4A A;  4CH7 A;  2DA1 A;  1O3R A;  3O2P E;  4X0G A;  2CQK A;  2R7O A;  1IN7 A;  5HS8 A;  3G1O A;  4UB6 C;  1IN5 A;  4Y17 A;  2J5O A;  3C1D A;  2XF6 A;  2OC6 A;  4EV0 A;  1BJZ A;  4IVN A;  5HDG A;  4HNU A;  1SAX A;  4HX8 A;  2LOO A;  4RAZ A;  4XLN F;  4BS9 A;  2W84 A;  1V55 H;  1R00 A;  2EJR A;  4FHT A;  1JI8 A;  3QQA A;  3ZQH A;  3CUQ A;  2KRC A;  2GOX B;  4A3C J;  3HHG A;  3FX3 A;  5IYC J;  4RDU A;  2JUC A;  4GCV A;  1W7P A;  5L3G A;  4NC6 A;  3OV8 A;  4BAC A;  2STT A;  3H0G J;  3H1C A;  2R7R A;  2YX7 A;  3WGI A;  5IT9 Z;  3K70 D;  5CVU A;  1UB9 A;  3KP3 A;  4G12 A;  3I56 I;  1UCR A;  5D8L B;  2DXI A;  1XGO A;  3A03 A;  3E6C C;  2GIV A;  1VQK I;  3U1K A;  3GYH X;  4ZZD A;  1ZAR A;  1J9I A;  3KYD B;  3Q9V A;  1KON A;  3PFY A;  3FXJ A;  1O57 A;  1XX5 A;  5E1X A;  1HLV A;  4A0X A;  4ESF A;  3AKZ A;  1IN8 A;  1TNS A;  1GDT A;  1J0R A;  2FUG 2;  2CH0 A;  5E1Z B;  3DWL E;  4MTD A;  1ZGA A;  2X85 A;  4XSX F;  1QZE A;  4IEJ A;  1TQM A;  1G3T A;  3BR3 A;  2GM4 A;  1U0J A;  4I98 B;  2MD0 A;  2O6G E;  1XPX A;  1K6O A;  1CQT A;  2IGM A;  3LSP A;  2E2I J;  3LST A;  2LF8 A;  3F8F A;  1RUN A;  2LP0 A;  1QO0 D;  4CA0 A;  3DTI A;  2OCE A;  3T8R A;  2L9N A;  5GPC A;  1SFX A;  4E70 A;  5KNL A;  3WTZ A;  2A6T A;  2UXX A;  2FE3 A;  1TZL A;  1RRJ A;  4JQF A;  3S32 A;  2UXN A;  1LDJ A;  3QAH A;  3DEW A;  3V8L A;  4CZZ A;  6PAX A;  3GTL J;  4AU7 A;  5DCM B;  3PSF A;  2M3A A;  3FIW A;  4CDG A;  2IVM A;  2FBH A;  2I10 A;  1P7I A;  4Q48 A;  1LFB A;  1WHU A;  1FT9 A;  2A68 F;  2ISY A;  4J19 A;  4EJO A;  3HKZ A;  3F8B A;  2VON A;  3F3X A;  2LTP A;  3HEF A;  1ETV A;  2JA8 J;  1RC9 A;  1OCR H;  5ERI A;  3FF5 A;  1HXD A;  1ZK8 A;  1WVR A;  3PO2 J;  2YR2 A;  1NTC A;  3GFM A;  1GUU A;  2HOA A;  3WE2 A;  2P6T A;  2W57 A;  3I64 A;  3TP3 A;  4BE1 A;  1BR2 A;  5BPI A;  1Z9C A;  4ENN A;  4G7Z F;  1QVU A;  2EZL A;  2V79 A;  5M5X J;  1U78 A;  1POG A;  1OKR A;  4E7H A;  1MW7 A;  3GVA A;  2CV2 A;  1JHF A;  1IDY A;  2W00 A;  3A4C A;  5ED4 A;  2CUJ A;  2HQ5 A;  3RYR A;  2AXL A;  1U9O A;  1IN6 A;  1WSU A;  2HU9 A;  2RC4 A;  1CGP A;  4EGY A;  3JAM Z;  2M4G A;  2WA0 A;  3CCL I;  5CPR B;  4AYB A;  1SC7 A;  4V19 K;  2DK8 A;  2ZJ2 A;  3QYB A;  2PLY A;  1HW5 A;  4QIW N;  3ISP A;  3OYL A;  3TO9 A;  4KMF A;  3CLQ A;  2P5L C;  1R58 A;  4I02 A;  1TT0 A;  1F5T A;  3I3L A;  4DW6 A;  2R7V A;  2Z3Y A;  1B72 A;  4CYC B;  3M3Y J;  4LLN A;  2WAE A;  4ZH4 F;  2GOM A;  1H8A C;  2QUF A;  1D1C A;  2DOD A;  2PG4 A;  2F5V A;  4CCN A;  4MEX F;  2XPV A;  3IP4 B;  1PJR A;  5ICG A;  3MFK A;  3DV8 A;  2CUE A;  3FXQ A;  2E60 A;  3K10 A;  3IRR A;  3BR0 A;  5AIP A;  3PUB A;  4A5M A;  4BDY A;  5C4X J;  3LFU A;  4ZZL A;  4UV9 A;  2PMZ N;  3S2W A;  1ZG1 A;  2LNB A;  4PDK A;  4EAT A;  2XRL A;  2L01 A;  4HA8 A;  2DA4 A;  2L7M P;  1R71 A;  1R1V A;  3OSG A;  2A07 F;  1D1B A;  3WTX C;  2VQG A;  2IP2 A;  4DZJ A;  2KIQ A;  3L2V A;  1ZN2 A;  3R4K A;  1HQC A;  3ZQ7 A;  5L3E A;  1T39 A;  4H0E A;  2BYV E;  2DYS H;  2BXY A;  4BKX A;  3A2K A;  4HOB A;  2LY2 A;  3QWL A;  4DBR A;  2L02 A;  2A6H F;  4A3E J;  1A6Q A;  2X6Y A;  3F8C A;  4UVB A;  4EVI A;  1AA7 A;  4YRV A;  3H36 A;  4H4K C;  1Y0N A;  4MGR A;  4S0H B;  4IQJ A;  1TL8 A;  4M3F A;  1X1A A;  1IDZ A;  2JSC A;  1H88 C;  2XGX A;  2JN6 A;  4A12 A;  3GEZ A;  2DMQ A;  4JYK A;  3HJE A;  1E3H A;  2EZH A;  3V8J A;  1VQN I;  1R6R A;  5FKL A;  2XDV A;  5F27 A;  4DJA A;  2HXO A;  1QPI A;  1Y56 A;  3FMQ A;  4XKW A;  3BOQ A;  1BW5 A;  1QHH D;  3K2Z A;  3ONQ A;  3BZ6 A;  4RGR A;  4BYY A;  4IOC F;  1JT0 A;  2M87 A;  2FQ3 A;  4LLG F;  4LK1 F;  5LHG A;  4G6D A;  2K4B A;  5E8I A;  4WK8 F;  3DP7 A;  4O5V A;  1SVO A;  1T8I A;  2VE8 A;  2V1U A;  1I3Q J;  4I7H A;  4XON A;  5E3N A;  4CCO A;  2HXI A;  3RPU A;  3PQK A;  3DPL C;  4Y52 J;  4PJM A;  1LVK A;  4AVZ A;  1GVD A;  2D45 A;  4WX9 A;  2PEX A;  1X4O A;  3C3W A;  4BE2 A;  3SFZ A;  2HPI A;  1C0W A;  4UUS A;  2BVL A;  3K4B A;  3VOD A;  1DGR M;  4KDP A;  3JRC A;  2V9V A;  1Y8R B;  1SMY F;  2DMP A;  4U7D A;  2EQR A;  2LLK A;  5DDG A;  2QF7 A;  2VXD A;  1VND A;  3DXJ F;  4D5F A;  2IXS A;  4RB1 A;  4WWC A;  1X4P A;  2HTS A;  1QGP A;  1I39 A;  4A3D J;  2DQL A;  5FRM A;  2ZXJ A;  3UNG C;  1U5T B;  2ELH A;  3A01 A;  4BQQ A;  2FOK A;  4BHP A;  2ME6 A;  1U9N A;  3JTH A;  1YO5 C;  5J1U A;  2OAZ A;  3CMM A;  3ULQ B;  3RZO J;  4LG0 A;  3J80 Z;  2CO5 A;  3ZCO A;  3ABK H;  3GTJ J;  1W5T A;  1ZKG A;  5K5O A;  3AG4 H;  3F72 A;  2VBW A;  3M8J A;  3VYU B;  3H9Q A;  1W36 D;  1I50 J;  3OYJ A;  4V2G A;  4FIS A;  3CP8 A;  3HSF A;  3RIR A;  3V7S A;  4BHC A;  2HYG D;  3ZRG A;  1T95 A;  1R4N B;  3DTE A;  4E6K G;  1WZ2 A;  5JLW A;  2XAG A;  5CYV A;  2EZI A;  3OIQ A;  2RQQ A;  4IHW A;  3TQN A;  3WTW C;  1K78 A;  1W1W E;  2O03 A;  3K1P A;  2X0L A;  2KIF A;  4U88 A;  2GWR A;  2L4M A;  4D7N A;  4IRG A;  2BEO A;  1ZAO A;  2GQQ A;  1FOW A;  2JT1 A;  1MH4 A;  3ZQL A;  5E3L A;  2ID3 A;  1FX7 A;  3CF2 A;  1Z3X A;  4XK4 A;  3LFK A;  1JUP A;  1P4X A;  2OPT A;  3WTY C;  3U2R A;  3KLO A;  5ICE A;  2P7V B;  1FOY A;  2VQL A;  4KT6 A;  1W4M A;  2E5N A;  4P9U A;  2AHQ A;  4PK4 A;  1XMX A;  2EA2 A;  1PUF A;  4C2U A;  1XDU A;  1ZRF A;  5CVJ A;  2Y75 A;  4XIC A;  2KQR A;  2E19 A;  3H9J A;  3OYH A;  3CP2 A;  1QQI A;  5LEK A;  2FQ4 A;  1DUX C;  2Z5U A;  2M8G X;  4I09 A;  3I4N J;  5ILS A;  3JRA A;  4ENJ A;  2JZY A;  2QKL B;  4DIQ A;  1JKP C;  3DTK A;  4N9H A;  4PJ0 C;  2A3S A;  2P6S A;  2COB A;  4O6J A;  3SFI A;  4EJT A;  1Z91 A;  5JHU A;  3KP2 A;  1X1C A;  2X1E A;  2WB1 N;  2DMT A;  1SD5 A;  2VKD A;  2NVU B;  1RNL A;  2XRN A;  4LLL A;  3RCO A;  2XC7 A;  2VJ4 A;  2IS1 A;  2NOJ B;  3N05 A;  3JRI A;  3MZH A;  3RQI A;  1Y1W J;  2ZME B;  1LEA A;  4LOC A;  3I4M J;  4FX4 A;  3PQJ A;  1TQI A;  2VOD A;  4I2O A;  3VFZ A;  1G2H A;  2DJI A;  3IRQ A;  2YX4 A;  4EGZ A;  4BDZ A;  4OIO F;  1MD0 A;  2DTZ A;  1KU9 A;  5D6F A;  1UZC A;  1HC8 A;  4HYE A;  3C2H A;  1N75 A;  1XD7 A;  2A05 A;  3L1P A;  1U8R A;  4M72 A;  4B44 A;  3E97 A;  4KIB A;  2Y0S N;  1IRZ A;  3BR5 A;  1YHQ I;  3HUG A;  1XCB A;  1EA3 A;  5FLX Z;  1YS6 A;  4QWQ A;  4MEY F;  4ESJ A;  3BTI A;  5IYB J;  2K9M A;  1J5Y A;  3EUK L;  5A2Q K;  3OYG A;  3OYI A;  3VDX A;  1SVL A;  1IXR C;  2Y69 H;  5E79 C;  5K7Z A;  3H35 A;  1UEL B;  1XMA A;  2NNN A;  3J7A O;  1BR4 A;  5AIQ A;  3MKY B;  4CCK A;  2ZSH B;  4P1W A;  1ZRC A;  2H1K A;  3BPX A;  4U7B A;  3HTU A;  4XKC A;  3KP5 A;  2EWN A;  2QZ8 A;  4HG2 A;  1KU2 A;  4BXX J;  3LQQ A;  4AIJ A;  1KZH A;  3EPZ A;  3QOD A;  1RUO A;  1I6H J;  1IRF A;  3VSL A;  3HPG A;  3W2V A;  4Z6Y A;  2KIU A;  4RGS A;  1Z7U A;  2Y2Z A;  2KFD A;  2QSH X;  3IAM 2;  4RAY A;  5J3L A;  4ZYH A;  5KAI C;  2KZV A;  3KE2 A;  5H2F C;  2LD5 A;  4NHJ A;  1MKM A;  1OCP A;  4CXF A;  3HOY J;  1WJB A;  1R5H A;  4ZDP A;  3LA7 A;  2DYR H;  1SFE A;  4M6Y A;  2K4J A;  1OYI A;  4G7O F;  2VPR A;  2EZK A;  3GZ6 A;  3OYN A;  2DA3 A;  2OD5 A;  5IP7 J;  2NVT J;  4DZP A;  5CKT A;  3JRH A;  2Y31 A;  2EFW A;  1X3W B;  5EF6 A;  2LBF A;  2QQ8 A;  2Y48 A;  2CW7 A;  1R5I D;  1TWC J;  3RKQ A;  3RKW A;  2FRH A;  1TWA J;  3BTC A;  3HSR A;  1ITY A;  1RR7 A;  3W6J B;  1XS9 A;  3ZN1 A;  3LSR A;  2DK5 A;  2MC3 A;  1BA5 A;  1O7L A;  1BL0 A;  2VQC A;  1FPQ A;  1E17 A;  1S72 I;  2L9V A;  3OIO A;  4FQG A;  3K69 A;  4I76 A;  4NB5 A;  4R79 A;  1X2N A;  2MFZ A;  4N9I A;  1ORK A;  4C3I J;  5CQE A;  3BP8 A;  2JA5 J;  5BMZ A;  4IHV A;  1WRJ A;  3TP0 A;  2VBZ A;  1MBF A;  1Q1H A;  3IKV A;  1GHC A;  2CSO A;  3OL3 A;  2HDD A;  5IT9 K;  2RNG A;  2VKH A;  2HWV A;  2CGP A;  3EUA A;  4I6Z A;  1EKE A;  4RB2 C;  1IGN A;  5K1Y A;  3Q0U A;  2F4O B;  3P7N A;  4NBQ A;  3W3C A;  3WHC A;  3S93 A;  4M6V A;  5TGT A;  3G1L A;  2DDB A;  3DCF A;  4A0Z A;  4IO9 F;  4F3Q A;  1S6L A;  4F52 A;  4R1H A;  3OWT A;  1HCR A;  2VN2 A;  5J1Y A;  4MQ9 F;  2HGC A;  5K5R A;  2DT5 A;  3NAU A;  3V42 A;  1SFO J;  2WAQ A;  1LE8 B;  3GZN B;  1BI0 A;  4U87 A;  3F0C A;  3PFI A;  5FGM A;  2OJE D;  4YII A;  2A61 A;  3FM3 A;  3V7R A;  3CC7 I;  2VJ5 A;  2JVG A;  1VQ4 I;  3CJN A;  1R49 A;  5DV5 A;  3GME A;  1WQ2 A;  2E35 A;  3P9K A;  3VPR A;  3DBR B;  3FHN A;  3ZQG A;  2K9L A;  3WTS C;  3DPU A;  3ZMZ A;  1MH3 A;  4GO1 A;  1VQ5 I;  2ZXI A;  1WJC A;  3BT9 A;  2PI0 A;  1BJA A;  3IKT A;  2QEX I;  2F6C A;  1W0T A;  2KP6 A;  2XGE A;  1FP1 D;  4G6T B;  3HOV J;  3K1N A;  3E5U A;  2DA6 A;  4B09 A;  1V4R A;  2QQB A;  2O5R A;  3QYE A;  1Z3Y A;  1J59 A;  2PMH A;  2W24 A;  3K4M A;  4DYC A;  3NRV A;  3G6E I;  2R7F A;  2ZXH A;  3GTM J;  2LK2 A;  3GO5 A;  1BOB A;  1ETW A;  1P6R A;  5D5V B;  1X58 A;  4C3H J;  3PIP F;  2OQR A;  2EA4 A;  3FKJ A;  4UY8 I;  2VKV A;  1FMW A;  1HDP A;  3OS2 A;  2Y30 A;  1SD7 A;  3OYC A;  5GTI C;  5BOX A;  3P9I A;  2PN6 A;  1MMS A;  3KZZ A;  3JRE A;  1I1S A;  4FE7 A;  4A6E A;  4FT8 A;  1AKH B;  5B5E C;  4MLO A;  1A04 A;  1HKS A;  4A3G J;  1IUF A;  1Y8Q B;  4ENK A;  1FZP B;  3IH2 A;  2FOW A;  3MAJ A;  4LD5 A;  5F0H A;  3D5R C;  3S1M J;  1HSJ A;  4YEL A;  4GFB A;  1MBJ A;  2V7F A;  2FXA A;  3RJP A;  1LQ1 A;  5JLX A;  3CCY A;  1FOK A;  2E34 A;  2Y0M A;  4BAY A;  1FLI A;  3JAM K;  1ODD A;  4HNV A;  3K4J A;  3CME I;  3I59 A;  1MDM A;  4UB8 C;  3ZR8 X;  2F5C A;  2H94 A;  4D9J A;  1XDS A;  3F6V A;  3L09 A;  4M9S A;  5L3B A;  1JTY A;  4I01 A;  4M9Z A;  1P4A A;  2RDP A;  2XAJ A;  4XLP F;  2DOA A;  4KT5 C;  1KU7 A;  2DT6 A;  3M8F A;  3F8M A;  5C4J J;  2X48 A;  4RLF A;  2JRT A;  2ELK A;  4LIT A;  2GXG A;  4ON0 A;  4BXU A;  2P7C B;  2ETH A;  2HYJ A;  1FYL A;  1UFM A;  3PL8 A;  3RI4 A;  4N4O B;  4E7S A;  4QLC U;  2RQP A;  4BEH A;  5L3C A;  1JKQ C;  2K27 A;  3AG3 H;  1JGG A;  4UNO A;  1H0M A;  1ON2 A;  1HDD C;  3R60 A;  4Z2Y A;  1MIJ A;  1IO2 A;  3VB2 A;  2JA2 A;  3E7L A;  3GUD A;  3WU1 B;  3HOX J;  3GXO A;  3DLL F;  2R5Z A;  2F5D A;  2STW A;  3IH3 A;  2R7U A;  3SZP A;  2M1B A;  1OYW A;  2BY0 A;  2EH3 A;  1G59 A;  5F1J A;  2VJJ A;  2DAO A;  2E1O A;  1JKO C;  4M74 A;  4Y33 A;  2HVQ A;  2R3S A;  3BWG A;  4Q47 A;  3BJA A;  2FMY A;  2O8X A;  4NUB A;  4BGD A;  3S16 J;  1EF4 A;  2R5Y A;  4XLF A;  4O3M A;  3HGG A;  2MG4 A;  1X3U A;  2CV0 A;  1D0Y A;  3DQV C;  4LB6 B;  3R0A A;  2CQQ A;  3F6O A;  1MBE A;  2LY9 A;  1ULY A;  2V1N A;  3ZQQ A;  2BE5 F;  1YS7 A;  2R93 J;  1O7F A;  3HRT A;  1ZG3 A;  5HOO A;  2QA4 I;  3Q0V A;  2ADU A;  2O0Y A;  1P9Q C;  2WV1 A;  2NOG A;  3LA2 A;  5D5X B;  3U1D A;  4G6Q A;  3MD2 A;  3ZMT A;  1HF0 A;  1G4D A;  3DKW A;  4GRI A;  2Q2E B;  1KQ9 A;  3M4O J;  4XN0 A;  1A36 A;  1D8K A;  3OYD A;  5DUK A;  2W25 A;  2FD5 A;  2BHY A;  3OS1 A;  2Y9Z A;  5CJ9 A;  5AON A;  4AWX B;  3HOW J;  3ZP5 A;  1WKM A;  2NXN B;  3E6B A;  1VTN C;  4LIU A;  2EB7 A;  3RKY A;  1EJ9 A;  2DI3 A;  5E3O A;  4XLA A;  4XKB A;  1KYZ A;  1J7K A;  2DCE A;  3L00 A;  3LSG A;  4L5I A;  2FML A;  3JSP A;  1HW2 A;  2MA3 A;  2PJR B;  4M3E A;  4A3I J;  3E0J B;  2E5Z A;  1RKT A;  4MIM A;  2CS3 A;  4W97 A;  2TRT A;  1VQ7 I;  4EQQ A;  4BHB A;  4M9X A;  2K9Q A;  2GA1 A;  3IV5 A;  4RA2 A;  5FLM J;  3R0J A;  1BR1 A;  1L3L A;  3GTK J;  5FKO A;  4CSW A;  3JRB A;  4LB5 A;  3FM5 A;  3K1M A;  5LGN A;  1JT6 A;  4IHS A;  5GTH C;  4A2U A;  2R4G A;  2MH9 A;  5E8G A;  1UG2 A;  2QBY A;  1G8X A;  5FO5 A;  3BG7 A;  2ZFW A;  4NDL A;  2IEK A;  3W6K B;  4Y7N J;  3I53 A;  2D1H A;  2Z9O A;  4XKV A;  5DUI A;  4HDV A;  3W2A A;  4XOR A;  4F55 A;  3WTT C;  2ZSI B;  3WG9 A;  3TO7 A;  2H8R A;  3J80 K;  2G7H A;  3ZGK A;  1NH3 A;  3PSI A;  4OIQ F;  2RN7 A;  1CF7 B;  4HQM A;  5E18 F;  4MQV A;  4M71 A;  3LNQ A;  2GXB A;  5D4R A;  3UKG A;  4Q4Z F;  3CES A;  3QYF A;  1WI9 A;  4KUM A;  5D5W B;  1FBU A;  4A3B J;  3BY6 A;  2RGV A;  1J75 A;  4N4N B;  1AHD P;  3G1M A;  1ZGJ A;  2KDO A;  3CCJ I;  1RI7 A;  3K70 C;  2IGO A;  4UHT A;  4XNF A;  3IHU A;  4CZC A;  3J7Z I;  4NC8 A;  2JK3 A;  3CJR B;  4U0W A;  3S1Q J;  1RES A;  3OSF A;  4ABZ A;  4J01 A;  3RTR A;  3M8E A;  3JW4 A;  3L2C A;  3A02 A;  2EFN A;  2L7Z A;  2HZD A;  1D0X A;  1YJN I;  4RAG A;  3W6V A;  4XQF A;  2KLO A;  1W7P B;  2ZB9 A;  2LY1 A;  2XB5 A;  3FIS A;  1M1E B;  2HQA A;  5H20 A;  2KIS A;  1U3E M;  1QZY A;  4II3 A;  4RLQ A;  5FKM A;  5KHD A;  2A69 F;  2NAZ A;  1FP2 A;  2RVC A;  3GZ5 A;  3LWF A;  4G7H F;  1O4X A;  1XMK A;  2LFB A;  2KKO A;  4ASN A;  4ZYG A;  1B1B A;  5M3M J;  2JVH A;  1MMA A;  1ENH A;  2WTE A;  3PUF A;  1JJ6 C;  1FEX A;  4EMS A;  1GXP A;  2AQF A;  3CDI A;  3CCE I;  3BCA A;  1YIO A;  4EJV A;  2JRM A;  2GA2 A;  5B1A H;  1FYM A;  1LFP A;  4IX7 A;  1T0F C;  4KIC A;  3I54 A;  2ZXW H;  5EG0 A;  2QM3 A;  2K9N A;  4M73 A;  3T8T A;  2E2H J;  4II2 A;  2HVR A;  4KA4 A;  1T98 A;  3KCC A;  1G3Y A;  2ZME C;  4M3G A;  1VQP I;  2RV8 A;  4HLX A;  1JUM A;  4X1E A;  4XRF A;  4MO7 A;  4RS8 A;  5LEJ A;  4FCY A;  2E36 A;  4HLY A;  1YRN A;  1I5Z A;  3KYL A;  4KIS A;  1T56 A;  2QQA A;  4ZTF A;  1WJF A;  1EH7 A;  2HI3 A;  3VOE A;  2L7F P;  4LK0 F;  4AIK A;  3IWZ A;  1YW7 A;  1BN5 A;  1K6Y A;  1V54 H;  4KN7 X;  3CO7 C;  4L9V A;  1T0F A;  1NHA A;  1X1P A;  1B8I A;  3DU5 A;  3EDP A;  5HNH A;  1Q1V A;  4KN4 X;  5DTD A;  3BCB A;  2IS6 A;  5KVR A;  3ECO A;  3K0L A;  1STZ A;  1KQ8 A;  2KJC A;  2BV6 A;  1AU7 A;  3SXY A;  2B7E A;  2WAF A;  5EEA A;  1XB4 A;  2R7Z J;  1G3W A;  3F9K A;  3CD6 I;  3KP6 A;  4IHY A;  1QPM A;  1PP8 F;  4ESB A;  1OCO H;  3EYI A;  5FLX K;  2X4H A;  4LG3 A;  3TKY A;  3RPQ A;  3KEY A;  2HQN A;  4P9F A;  2GLO A;  3G3Z A;  3BR1 A;  3AG1 H;  5HLG A;  3AG2 H;  3KET A;  4CCL A;  1MSF C;  1L0O C;  2K85 A;  3TMO A;  2KRF A;  2WY7 Q;  1P7J A;  3JSO A;  3DF8 A;  3IUO A;  3SEZ A;  1HW1 A;  2IPQ X;  1MGT A;  2DJN A;  2M0M A;  3SDB A;  4V2F A;  3MZ8 A;  2X51 A;  5IOY A;  3K7A J;  2LRE A;  3FMR A;  4B3A A;  1HKT A;  4E4H A;  4L5E A;  1BI1 A;  2VI6 A;  4AM3 A;  4CYD A;  2HKX A;  2VC1 A;  2Z2S B;  3PNV A;  4GDF A;  1B72 B;  3OOP A;  2WWY A;  2VL8 A;  5ILU A;  5EYR A;  1XG1 A;  3TW7 A;  2ZNY A;  2HR3 A;  1XGS A;  3ELK A;  3MZY A;  3KPH A;  3RSN A;  1OMI A;  2VC0 A;  1V5G A;  1K83 J;  1HKQ A;  2F4I A;  5FLV A;  1MMG A;  2IA1 A;  3IAS 2;  2LVS A;  5K7F A;  2AO9 A;  2DFF A;  1XCV A;  1XGM A;  2DLL A;  5J8F A;  3S17 J;  3MN2 A;  1D8J A;  4XRS A;  2L2O A;  2MYS A;  2PX9 A;  2PMU A;  2NRA C;  1Z21 A;  2XKP A;  4ZYA A;  3R61 A;  3TW6 A;  2D2W A;  1YTY A;  1IC8 A;  2K3P A;  1ZR4 A;  2XAQ A;  1PP7 U;  2PFB A;  2VOP A;  4M3B A;  4U0V A;  1RIO H;  2MLG A;  5JFR A;  4HPQ A;  2PMZ A;  2FX0 A;  4OWR B;  3KEQ A;  3LSM A;  1Y6I A;  1EH8 A;  5LD2 C;  1T2K A;  1QRY A;  2LKP A;  4U0Y A;  2H09 A;  5HNF A;  2X9D A;  1TBX A;  3H5N A;  4FE4 A;  3SYT A;  3A0B C;  3BG9 A;  2YU9 J;  2NVY J;  5TIS C;  2CV1 A;  5J8C A;  4JX6 A;  4KFC A;  1MND A;  1FBQ A;  2Y9Y A;  5FD6 A;  4JX5 A;  3TDU C;  1HOM A;  2ICW G;  2XPW A;  3O3K A;  2P8T A;  1IRG A;  3FWE A;  4XSZ F;  3CZ6 A;  4EM2 A;  4WXD A;  3HRS A;  1ZTR A;  2XIG A;  3BQY A;  3J7A Y;  5EGO A;  2VBX A;  3KFW X;  3FXK A;  4E7L A;  4M6X A;  2E7W A;  2XGC A;  4HZF A;  1YJ9 I;  3B02 A;  2DMU A;  3ABL H;  5C44 J;  3ZQI A;  4L9J A;  2XB0 X;  1NG7 A;  2QVO A;  2LC2 A;  4QPQ A;  3GFJ A;  2CUZ A;  3I71 A;  5LHH A;  1UJ8 A;  3PNY A;  4BJT A;  2E1C A;  2NS8 A;  1WCM J;  1JUS A;  2MSY A;  1YFH A;  3GWZ A;  3HL2 A;  1I3A A;  4XM3 A;  5E17 F;  3ZQF A;  3OMY A;  3SQN A;  5GAE J;  4ITV A;  2M45 A;  2V26 A;  1WI3 A;  4RB0 A;  3FMS A;  5KK1 A;  4UXN A;  3KIO A;  3JTG A;  1W36 C;  3T0Y A;  4BUP A;  1VQL I;  1S9H A;  2MD5 A;  4A3L J;  2E1M C;  4FTH A;  3TL4 X;  3CTA A;  1IXC A;  1WJ5 A;  2R7X A;  2P4W A;  4BQN A;  3A01 B;  1MSE C;  3MEX A;  3C7J A;  3NAR A;  4NQW A;  5J4V A;  3LSI A;  2XUB A;  3T1B A;  1Z05 A;  4LG0 B;  2LH9 A;  1W0U A;  3E6M A;  1OCT C;  1K4T A;  4IRI A;  2L9R A;  4A3K J;  4UVC A;  3F8N A;  3RZD J;  4XN3 A;  4HV5 A;  1ETO A;  1BW6 A;  2KJB A;  1IUY A;  3WGH A;  1S5L C;  5IYD J;  3D5L A;  3NWS A;  3FXL A;  1YOV B;  2QSF X;  4IL6 C;  2DOE A;  4J00 A;  2F48 A;  1RR8 C;  4P5O A;  4HF2 A;  2Q0O A;  3BR2 A;  1K78 B;  3EYY A;  2K86 A;  3HRM A;  4BE0 A;  5KAF C;  2LRD A;  2D5V A;  3E3V A;  4PUS A;  4DOZ A;  5M3F J;  2J5P A;  1SD6 A;  3JRG A;  2DDA A;  2UUZ A;  2OBP A;  4A0Y A;  3CC4 I;  1YW8 A;  1TTY A;  4CCM A;  1YW9 A;  3CUO A;  3GTG J;  1TNT A;  3ABU A;  3LSJ A;  4IF4 A;  1NK3 P;  2BY1 A;  1F9N A;  1U6G A;  3BJO A;  4XMY A;  1D0Z A;  1R23 A;  5FFZ A;  3CCQ I;  3LQR A;  2V9P A;  4AD9 A;  2AQE A;  2EPF A;  2L9S A;  4IOA F;  3SJM A;  2DA5 A;  2EIJ H;  3L2R A;  3BQZ A;  1PUF B;  1MJA A;  1IAW A;  3OY9 A;  3OYF A;  3BZK A;  2V6E A;  3CQZ J;  3HOT A;  1HST A;  4EJW A;  1XN7 A;  3L2U A;  3AL0 B;  1OCZ H;  4BY7 J;  1YIJ I;  4YIR X;  1T6S A;  3HRU A;  1ZYR F;  3CJQ B;  1FSE A;  3WGG A;  1XSX A;  4QPO A;  5EZH A;  3IC7 A;  3NQO A;  3OYA A;  1BIA A;  1W7P D;  1K7A A;  3W2W A;  3EQL F;  1YLF A;  4YEJ A;  1VQ8 I;  1IXS B;  3DU6 A;  4D1Q A;  4XBF A;  1TWH J;  2RRE A;  4HRI A;  1PYV A;  2HVS A;  2IA0 A;  2BOL A;  3J7Y J;  4B8X A;  3RDI A;  5FKN A;  3OYM A;  1GVJ A;  2ZKZ A;  3P9C A;  2MAB A;  3QPT A;  1IN4 A;  3K4C A;  2WC2 A;  2VE9 A;  1MMN A;  3KZY A;  1D3Y A;  1Y0U A;  4RGU A;  1UHS A;  1Z0X A;  1OIS A;  3E5X A;  2EV0 A;  1F36 A;  1LJ9 A;  4C30 A;  3UR3 C;  2VIX A;  5DD4 A;  2WB1 A;  4K2E A;  3ASO H;  3GTQ J;  1DP7 P;  1BC7 C;  4OAY A;  2QEN A;  3REO A;  1IW7 F;  2DA2 A;  2X6W A;  1GV2 A;  1A35 A;  1I1G A;  2V4J C;  4KIG A;  2KT0 A;  3KZI C;  4KJZ A;  2D1V A;  4B1R A;  2KHM A;  2DTR A;  3PNT A;  5K7H A;  2HOT A;  4WXH A;  1B9M A;  1SVM A;  4MFD A;  4IXA A;  3HG9 A;  3HSE A;  4HAM A;  4L0Z B;  4CGZ A;  5TRD A;  2JPC A;  1JXS A;  5HLT A;  3GLL A;  3N97 A;  2JQ7 A;  2XGD A;  1YI2 I;  2CYY A;  5H6Q A;  3H9G A;  3GBG A;  4BJ6 C;  4L9T A;  5C3E J;  2A6E F;  2BZT A;  2E1N A;  3I0T A;  4IJA A;  3D1N I;  1B6A A;  3ZN0 A;  4KYW A;  5M5Y J;  3HKZ N;  1WJE A;  4GYI A;  1V5F A;  1VQM I;  2Y0S A;  4F92 B;  2XSJ C;  2P0W A;  3T5X A;  2ESN A;  1JJ8 C;  4HF0 A;  4D7M A;  4C2T A;  3DBL B;  2PBI A;  3KYC B;  1PUE E;  4IHX A;  4E7J A;  5DCM A;  2RAE A;  4XID A;  1FC3 A;  1U8B A;  1USS A;  2X1C A;  3I58 A;  4Y3O A;  3ROU A;  3TBI A;  4A5N A;  5IY5 H;  2HOS A;  1NK2 P;  1V5E A;  4C3J J;  2K02 A;  1P92 A;  3DEU A;  2DFE A;  3FDY A;  4Y15 A;  2GAU A;  5IP6 A;  4XR6 A;  2GIZ A;  1ETY A;  1DGW Y;  1BBY A;  2P81 A;  3TDZ C;  4KIF A;  3RQ4 A;  4AYB N;  2CQN A;  4E7I A;  2EFQ A;  4HNT A;  4P96 A;  3OYK A;  4OMZ A;  3QPS A;  4G8X A;  2B0L A;  4RGX A;  2H8W A;  4KNY A;  2W1O A;  1AOY A;  1HA8 A;  1KU3 A;  2LBF B;  2A5W A;  2ME0 A;  3I9V 2;  1Z6R A;  3ABT A;  4HDU A;  4AID A;  1S29 A;  5LFA A;  2DU9 A;  2GZW A;  1A6I A;  1ZR2 A;  3GCM A;  5CVI A;  4L9N A;  2EV6 A;  1ETQ A;  3ML6 A;  3WOD F;  3N4M A;  3I55 I;  5FJ8 J;  4BJ5 C;  2ELJ A;  3R6S A;  3Q5F A;  5GP9 A;  4PCQ A;  3I4P A;  3O8H A;  4Y13 A;  5GAH J;  1E2X A;  3B73 A;  1WJA A;  4CYC A;  3HOZ J;  3WE3 A;  3VYS B;  2QQ9 A;  2QCO A;  2E71 A;  3GLX A;  3TED A;  1FBS A;  2L3D A;  2WBM A;  4ENM A;  5L3F A;  2RKH A;  4N0B A;  4GYG A;  5J6X A;  2W85 A;  4BY1 J;  2YUS A;  5B3S H;  1PDN C;  3C2B A;  3ZXS A;  5GAG J;  1FTT A;  4ZYE A;  2B63 J;  4MNU A;  4OAZ A;  1FTZ A;  4UUV A;  2ZCW A;  1OYY A;  3FXU A;  2B9S A;  3FXO A;  5HOD A;  1SFU A;  3KLN A;  2BW3 B;  3E6D A;  5DD8 A;  5IT3 A;  3BLY A;  2XPU A;  3VEP A;  1MBG A;  3MMY B;  4GGG A;  3K4K A;  2VOO A;  2OA4 A;  1DU6 A;  2CG4 A;  4OU0 A;  4WXC A;  2R7S A;  5HDK A;  2VAS A;  4XRS G;  2CRG A;  1N77 A;  1BM9 A;  3HOU J;  2QGU A;  2X6X A;  2XHK A;  3CCU I;  2K7L A;  3M9A A;  3X2Q H;  4AVP A;  2OV7 A;  2H27 A;  1VQO I;  3D0S A;  3S3M A;  3B6C A;  3SZT A;  3BG3 A;  2CWE A;  3ZPL A;  1TW2 A;  2XF7 A;  2BBY A;  2W4S A;  3HBL A;  4L18 B;  1R1T A;  2HS5 A;  1MBH A;  1FYK A;  2L5Q A;  1UMQ A;  4RAF A;  3OYB A;  3H3V K;  1EV7 A;  4B43 A;  2ZJP F;  2F4M B;  2ID6 A;  2L7K A;  1QU3 A;  4YFN F;  5CLS A;  1OR7 C;  1REP C;  3S3N A;  5TJJ A;  2KDZ A;  3K9T A;  1JE8 A;  4PFO A;  3QP6 A;  1YG2 A;  3RPU D;  2DN0 A;  3G4S I;  2XAS A;  1D5Y A;  5FB2 A;  2XAF A;  3MCZ A;  1U5T C;  2DO7 A;  3G2B A;  5E20 A;  2ZJQ F;  3S15 J;  4IHT A;  2NVQ J;  4AC0 A;  1OCC H;  2AXT C;  1ZLJ A;  5FKK A;  3HHH A;  3S3O A;  1X3Z B;  1R5G A;  1IZ1 A;  3A1Y A;  4BBS J;  4ZDO A;  2L0K A;  1ZHF A;  1RKW A;  4ZDL A;  1I27 A;  1S7E A;  3L7W A;  3HC7 A;  3S14 J;  1JHH A;  2MBF A;  3LL7 A;  1J2X A;  5FFX A;  2OTJ I;  3ERE D;  1D1A A;  1OR7 A;  3MKL A;  3F21 A;  2VLA A;  2DA7 A;  5J4Y A;  3Q0W A;  4BU2 A;  3L9F A;  3I59 B;  1MDM B;  2M7B A;  2VT2 A;  1ONV A;  3TO6 A;  2ISZ A;  2JA6 J;  2KMU A;  1U5T A;  5HS9 A;  2OF7 A;  3DKX A;  1MZB A;  5D5U B;  2DMN A;  2KRH A;  3KX2 A;  1EH6 A;  2R7T A;  1LKX A;  2FNA A;  4CCJ A;  2HDC A;  3HPH A;  3K2A A;  1QZZ A;  4ANJ A;  2XAU A;  1FY7 A;  4LIV A;  4D0P A;  3MKZ A;  4EEF G;  2VJI A;  3HZJ A;  3CUQ B;  1F43 A;  3C2G A;  3H3Z A;  3GW2 A;  4B4C A;  2I8D A;  2LMD A;  2VUM J;  3CCV I;  3FXM A;  4BEH B;  1LDK B;  1WFX A;  2DQR A;  2JPB A;  3ZOB A;  3VWB A;  1W5S A;  3I5U A;  3Q3S A;  1H89 C;  3KEO A;  2PQ8 A;  4L0Y B;  1TW3 A;  3HIF A;  2HQR A;  3CC2 I;  2V1D A;  2FF4 A;  5B1B H;  2R5Z B;  2DBB A;  2TDX A;  5LHI A;  1MMD A;  2XKO A;  5ILV A;  5H6R A;  4R8H A;  3S8P A;  2GXA A;  4F91 B;  4PGG A;  3SZG A;  4GXO A;  5DM7 F;  4CO8 A;  4KMU X;  2IA2 A;  2KL4 A;  2GBY A;  2IJL A;  1ZRD A;  5CQG A;  4A3F J;  2IRF G;  1RET A;  1ETX A;  4ZC3 A;  1ETK A;  4W1U A;  5F1R A;  2R5Y B;  1DU0 A;  1ZH5 A;  2ZNZ A;  2DFI A;  1UHM A;  2EK5 A;  4HBL A;  3RYP A;  3J81 K;  1MJB A;  4I99 C;  3WTV C;  4B48 A;  1AWC A;  3HTS B;  3LMM A;  4PFP A;  3F23 A;  1D5V A;  1Z67 A;  4HX4 A;  2CMP A;  3K4N A;  5CVR A;  4A93 J;  5JR3 A;  3JRD A;  3QP5 A;  1E3O C;  3B6A A;  3C18 A;  3OS0 A;  4IPA A;  1OQY A;  2NS7 A;  3ZMD A;  3KP4 A;  1TWF J;  2BY3 A;  3QRF F;  4UUT A;  3TOA A;  4IKF A;  2ZC2 A;  4FAS D;  2WAD A;  1IRX A;  3MWM A;  3DPT A;  2WY8 Q;  2ZO4 A;  3E1S A;  1SMT A;  2VPL A;  4PZJ A;  5J47 A;  1VI0 A;  5EZG A;  1UAA A;  2F2E A;  3L2Q A;  1Y39 A;  5EDN A;  2V1X A;  3BRO A;  1VF9 A;  1RZ4 A;  5F0C A;  4BXF A;  1KQ0 A;  3CCR I;  5F08 A;  2QYO A;  2EIL H;  1O3Q A;  2NVX J;  1IV6 A;  1WJD A;  4DNC A;  2W48 A;  1MBK A;  4OIR F;  4WCG A;  3FXR A;  1DP3 A;  2H6B A;  2ZME A;  5DCF A;  1G6N A;  2EV5 A;  2KPM A;  3CCM I;  5HLI A;  4C9Y A;  2VB6 A;  3V7C A;  4IZZ A;  4UV8 A;  2IAI A;  2P5V A;  4M3D A;  2OUM A;  4JOM A;  2V6C A;  2O9L A;  2YU3 A;  4OOI A;  2XSD C;  1LVA A;  4RB3 C;  5E1W A;  2XVC A;  1IF1 A;  2HPM A;  2CQ7 A;  1BI2 A;  3WU2 C;  3DFG A;  4HQE A;  1P4W A;  2H6C A;  2BHZ A;  4Y4R A;  4JX4 A;  2JUG A;  4A69 C;  2QBY B;  4PJL A;  1T08 B;  2XV4 S;  1GLN A;  2RNJ A;  3BZC A;  3CO6 C;  5DS9 A;  1YX5 A;  3G73 A;  3DBH B;  4BL0 B;  3OYE A;  1S8N A;  2PJP A;  1X1D A;  1OJL A;  3S1R J;  3PIO F;  4EM0 B;  4OMY A;  2KZG A;  3CMY A;  3QPH A;  5LRR A;  3BDD A;  3L2W A;  1X1B A;  1UST A;  2F5F A;  4E7Z A;  5EJC A; 
#chains in the Genus database with same CATH homology
 4A3G J;  4MLO A;  1A5J A;  1IUF A;  1GV5 A;  1IDY A;  2HQ5 A;  3IH2 A;  1IJW C;  1ZQ3 P;  5F0H A;  3S1M J;  1U9O A;  3BR2 A;  2JA7 J;  4GFB A;  1MBJ A;  5JLX A;  3CCY A;  2D5V A;  4HNV A;  4QIW N;  5M3F J;  3BTJ A;  3JRG A;  2ECB A;  3HGY A;  4QSH A;  3WHB A;  1JTY A;  4DW6 A;  1B72 A;  3GTG J;  4CYC B;  3M3Y J;  1IG7 A;  3LSJ A;  3FK7 A;  1NK3 P;  1H8A C;  1TWG J;  5C4J J;  2X48 A;  2LKX A;  2ELK A;  1MNM C;  2XPV A;  2CUE A;  3SJM A;  2DA5 A;  3BR0 A;  2HYJ A;  3BQZ A;  1PUF B;  5J1R A;  3CQZ J;  5C4X J;  2PMZ N;  2JMW A;  4A3J J;  1JKQ C;  4BY7 J;  1JGG A;  2XRL A;  2DA4 A;  2L7M P;  3OSG A;  1HDD C;  3ZQC A;  5IP9 J;  4DZJ A;  3E7L A;  5EZH A;  3HOX J;  5EG0 B;  2R5Z A;  3IH3 A;  1X2M A;  2EH3 A;  5F1J A;  4BKX A;  1TWH J;  2E1O A;  2K9S A;  1JKO C;  1OFC X;  3HM5 A;  4A3E J;  3S16 J;  1EF4 A;  2R5Y A;  2CQX A;  5FKN A;  2ECC A;  3HGG A;  2MG4 A;  1YRN B;  1WH7 A;  2CQQ A;  4S0H B;  1MBE A;  4M3F A;  1IDZ A;  1H88 C;  2WAQ N;  2LY9 A;  2JN6 A;  1UHS A;  2DMQ A;  4JYK A;  1Z0X A;  2R93 J;  2TCT A;  3BG5 A;  2EZH A;  3Q0V A;  1F36 A;  3GTQ J;  5FKL A;  2WV1 A;  5F27 A;  9ANT A;  2HXO A;  2NOG A;  1B8I B;  1QPI A;  1HF0 A;  1BW5 A;  5IOZ A;  2DA2 A;  3BTL A;  1GV2 A;  3M4O J;  2KT0 A;  1JT0 A;  3HDD A;  4B1R A;  4UUS B;  5K7H A;  2FD5 A;  2HOT A;  1WH5 A;  2MGQ A;  1R9T J;  1LE8 A;  2Y9Z A;  3HOW J;  4MFD A;  4BBR J;  2EBI A;  1I3Q J;  5E3O A;  1RPW A;  2XGD A;  5E3N A;  2HXI A;  4Y52 J;  3QPL A;  2JJ7 A;  3GBG A;  5C3E J;  2IBD A;  1GVD A;  3D1N I;  3LSG A;  1WPK A;  2R0Q C;  5M5Y J;  5GPA A;  3HKZ N;  4M3E A;  4A3I J;  1VFC A;  1RKT A;  4UUS A;  4MIM A;  1APL C;  4W97 A;  2TRT A;  3JRC A;  1JJ8 C;  2K9Q A;  4D7M A;  3FK6 A;  2DMP A;  3IV5 A;  3JR9 A;  5FLM J;  4IHX A;  2RAE A;  2EQR A;  4XID A;  2LLK A;  3GTK J;  1U8B A;  2QF7 A;  5FKO A;  1VND A;  4D5F A;  3JRB A;  1JT6 A;  2HOS A;  4A3D J;  4C2M J;  3SDG A;  1NK2 P;  4C3J J;  3A01 A;  2K40 A;  1UG2 A;  5F0F A;  2ME6 A;  5IP6 A;  1U9N A;  4NDL A;  2IEK A;  2CJJ A;  5J1U A;  4Y7N J;  3BR6 A;  1LFU P;  1ETY A;  2P81 A;  3RZO J;  4AYB N;  3GTJ J;  1ZKG A;  2H8R A;  5M5W J;  4XRM A;  1I50 J;  3QPS A;  3FKI J;  4V2G A;  3LNQ A;  4FIS A;  4JP0 A;  3UKG A;  1AKH A;  5JLW A;  2M0C A;  2ME0 A;  4A3B J;  4DYQ A;  1AHD P;  2EZI A;  3G1M A;  1A6I A;  1ZR2 A;  4IHW A;  3LOC A;  2JK3 A;  3S1Q J;  1RES A;  3OSF A;  1ETQ A;  4ABZ A;  4D7N A;  5FJ8 J;  1WGX A;  5GP9 A;  3A02 A;  1MH4 A;  3O8H A;  2L7Z A;  3ZQL A;  3W6V A;  5E3L A;  2ID3 A;  2ZB9 A;  2XB5 A;  3FIS A;  4CYC A;  3HOZ J;  4XK4 A;  3S2D J;  2QCO A;  2R92 J;  1JUP A;  4AUX A;  4QTR A;  2OPT A;  3CDL A;  3TED A;  5FKM A;  2X6O A;  2LR8 A;  2AHQ A;  4BY1 J;  2YUS A;  1O4X A;  1PUF A;  2LFB A;  2O7O A;  3C2B A;  5M3M J;  1FTT A;  2B63 J;  1FTZ A;  4XIC A;  5BNG A;  2E19 A;  1ENH A;  2N8G A;  5HOD A;  1JJ6 C;  1FEX A;  2FQ4 A;  4RBO A;  1XC5 A;  3GTO J;  2M8G X;  3I4N J;  3JRA A;  5EGO B;  3PO3 J;  1JKP C;  5IPA A;  2XPU A;  2YS9 A;  2O8K A;  5EG0 A;  1MBG A;  3S2H J;  3SFI A;  2COB A;  2K9N A;  3O8G A;  2VKE A;  2E2H J;  5F04 A;  1DU6 A;  1SAN A;  4M3G A;  2WB1 N;  2DMT A;  1Z77 A;  4XRS G;  1JUM A;  4X1E A;  2CRG A;  4MO7 A;  4FCY A;  3HOU J;  1YRN A;  3MVP A;  3JRI A;  3RQI A;  3IH4 A;  1Y1W J;  1TC3 C;  4A3M J;  3B6C A;  2M2E A;  3BG3 A;  4LOC A;  3I4M J;  1T56 A;  2CUF A;  2HI3 A;  3HBL A;  2L7F P;  1G2H A;  1MBH A;  2FJ1 A;  1UMQ A;  2DTZ A;  1B8I A;  3H3V K;  2ID6 A;  1Q1V A;  1T33 A;  5DTD A;  3L1P A;  1GT0 C;  2KDZ A;  2Y0S N;  1IRZ A;  1AU7 A;  3GTP J;  3BR5 A;  5EEA A;  2MW8 A;  2R7Z J;  1FIP A;  4DYR A;  2DN0 A;  1D5Y A;  4IHY A;  2JWT A;  3BTI A;  5IYB J;  1JKR C;  1JTX A;  3S15 J;  5E3M A;  2CU7 A;  1FJL A;  5K7Z A;  2NVQ J;  4AC0 A;  2GLO A;  1ZGW A;  5FKK A;  3BR1 A;  4BBS J;  1Y1V J;  2L0K A;  1MSF C;  1RKW A;  4D5C A;  1S7E A;  1P7J A;  3S14 J;  2H1K A;  4MFE A;  2DJN A;  3PM1 A;  4BXX J;  4V2F A;  3MKL A;  2DA7 A;  5IOY A;  3K7A J;  4X6A J;  2M34 A;  1I6H J;  3Q0W A;  4B3A A;  4L5E A;  2Y2Z A;  2JA6 J;  3JRF A;  2G0E A;  2VI6 A;  1K61 A;  5J3L A;  2OF7 A;  2LD5 A;  2DMN A;  1OCP A;  1B72 B;  3HB9 A;  3HOY J;  5EYR A;  1FIA A;  3K2A A;  1XG1 A;  3OOU A;  2M9H A;  3TW7 A;  3S1N J;  2E2J J;  2VPR A;  2EZK A;  2DA3 A;  4EEF G;  5IP7 J;  2NVT J;  4DZP A;  3JRH A;  2Y31 A;  1F43 A;  1QVT A;  5EF6 A;  1K83 J;  4B4C A;  5FLV A;  2DA1 A;  2VUM J;  1TWC J;  2LVS A;  2AO9 A;  5K7F A;  3RKQ A;  3S17 J;  3G1O A;  3ZOB A;  3MN2 A;  3Q3S A;  1TWA J;  1H89 C;  4XRS A;  3BTC A;  1ITY A;  1RR7 A;  1BJZ A;  1XS9 A;  3LSR A;  3TW6 A;  1IC8 A;  1BA5 A;  2R5Z B;  1ZR4 A;  1BL0 A;  3QQA A;  3ZQH A;  3OIO A;  4M3B A;  4I76 A;  4A3C J;  1X2N A;  5IYC J;  4RDU A;  1ORK A;  4C3I J;  2JA5 J;  2FX0 A;  2GBY A;  3H0G J;  4IHV A;  4A3F J;  1RET A;  1QRY A;  3TP0 A;  1ETX A;  1ETK A;  4W1U A;  2R5Y B;  2X9D A;  1DU0 A;  4FE4 A;  1MBF A;  3BG9 A;  2YU9 J;  2NVY J;  4G12 A;  2HDD A;  4JX6 A;  3A03 A;  2Y9Y A;  4I6Z A;  4JX5 A;  1IGN A;  1HOM A;  3Q0U A;  2XPW A;  4A93 J;  3WHC A;  3JRD A;  1E3O C;  3B6A A;  4M6V A;  1HLV A;  3G1L A;  3DCF A;  1ZTR A;  3BQY A;  2NS7 A;  1GDT A;  1TWF J;  5EGO A;  4UUT A;  2XGC A;  1HCR A;  5J1Y A;  3NAU A;  1SFO J;  1LE8 B;  4IEJ A;  3F0C A;  1VI0 A;  5EZG A;  3BR3 A;  2GM4 A;  2DMU A;  5EDN A;  5C44 J;  3ZQI A;  1CQT A;  1VF9 A;  3LSP A;  2E2I J;  2XB0 X;  5F0C A;  5F08 A;  2LP0 A;  2NVX J;  1IV6 A;  2W48 A;  1MBK A;  5GPC A;  3VPR A;  3ZQG A;  2NS8 A;  1WCM J;  1JUS A;  2MSY A;  1MH3 A;  2IAI A;  4M3D A;  3ZQF A;  3DEW A;  3GTL J;  3BT9 A;  2O9L A;  1WI3 A;  2XSD C;  1W0T A;  2XGE A;  4A3L J;  3FIW A;  3HOV J;  2I10 A;  1P7I A;  2DA6 A;  4FTH A;  1LFB A;  4JX4 A;  4DYC A;  3A01 B;  4J19 A;  1MSE C;  4A69 C;  2LK2 A;  3GTM J;  2LTP A;  3HEF A;  1ETV A;  3NAR A;  1ETW A;  2JA8 J;  5DS9 A;  1ZK8 A;  3PO2 J;  1X58 A;  4C3H J;  1NTC A;  1GUU A;  1W0U A;  1OCT C;  2HOA A;  1OJL A;  2VKV A;  3S1R J;  2L9R A;  1HDP A;  4A3K J;  2Y30 A;  3RZD J;  3TP3 A;  1ETO A;  1BW6 A;  3CMY A;  3JRE A;  1QVU A;  2EZL A;  5M5X J;  1U78 A;  5IYD J;  1POG A;  4FE7 A;  1AKH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...