1I1GA

Crystal structure of the lrp-like transcriptional regulator from the archaeon pyrococcus furiosus
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
140
structure length
140
Chain Sequence
IDERDKIILEILEKDARTPFTEIAKKLGISETAVRKRVKALEEKGIIEGYTIKINPKKLGYSLVTITGVDTKPEKLFEVAEKLKEYDFVKELYLSSGDHMIMAVIWAKDGEDLAEIISNKIGKIEGVTKVCPAIILEKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the Lrp-like transcriptional regulator from the archaeon Pyrococcus furiosus.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Transcription
molecule keywords TRANSCRIPTIONAL REGULATOR LRPA
total genus 34
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01037 AsnC_trans_reg Lrp/AsnC ligand binding domain
A PF13412 HTH_24 Winged helix-turn-helix DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1i1gA01
3.30.70.920 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1i1gA02
1T2KA 3ZMUA 1HKTA 1J2XA 5DCFA 2O8XA 4M73A 2TDXA 2VT2A 5D5UB 4MEYF 4LB5A 2HGCA 1XCBA 4IRGA 3WTSC 1HKSA 4P5OA 3RYRA 3GYHX 1P6RA 4GYGA 2YU3A 1IN7A 3HRMA 3COAC 1J0RA 2RKHA 1FC3A 5HDKA 3GFMA 3IC7A 3Q9SA 1R23A 3EYYA 2JRTA 4ZYDA 3RIRA 2PMHA 4RB0A 3ZMSA 2DFIA 4BHCA 3TOBA 5H20A 1TQPA 3J7AO 2FE3A 3ISPA 2ISYA 4L5IA 5LEKA 3C1DA 1W5SA 5HLGA 2EFWA 1P92A 1IZ1A 1IF1A 4MEXF 3KZYA 5L3BA 3K69A 1BBYA 2MBFA 1MGTA 1ZG3A 1YW7A 4D0PA 1HSTA 3O2PE 3MCZA 4PCQA 3O6BB 2EB7A 1D8KA 1H9GA 4A0ZA 2PJPA 4RGRA 4LLLA 4M6YA 4Y13A 3DKWA 1R00A 1I1GA 2ZJ2A 3WTVC 3WTXC 5CJ9A 2LNBA 2E1AA 5DD4A 1MDMB 2X0LA 2QM3A 4HV6A 1SFXA 3IRRA 4UVBA 1GXPA 2EA2A 5JR3A 2IA0A 3D0SA 4L5JA 3DQVC 1ON1A 2HDCA 3SHFA 4M74A 5HS7A 3KFWX 3TO7A 2A07F 3R60A 2R3SA 1IN5A 2VC0A 2FMLA 3GW2A 3KZZA 2IA2A 3QP6A 3CO7C 2PLYA 4ZYEA 1U5TB 1SD6A 3K9TA 3M8FA 1WSUA 1T38A 2DU9A 2CWEA 4R8HA 2ZCWA 1LB2A 3CDHA 3IHUA 2QBYB 1O7LA 4XLPF 3FMSA 4OU0A 2QBYA 2HYFA 3I54A 3JW4A 1P2FA 2DW4A 2GAUA 3RKXA 4BXUA 1MJ9A 3BPXA 2XKPA 4BH9A 3HRSA 4CXFA 1RZ4A 3LSTA 1ZREA 5A2QK 4I7HA 2QVOA 4MTEA 3C3WA 1UB9A 2V1XA 1K78B 3R6SA 4G6QA 4OIRF 4HX8A 3V7RA 3CUOA 5ED4A 2YX4A 1R58A 2ACJA 3I5UA 5HS8A 2AXLA 5D6EA 3GZ6A 4KA4A 1PP7U 4O5VA 3VFZA 1EV7A 2VN2A 4RGXA 1IN6A 2XROA 2GXBA 1J5YA 2IP2A 1U8RA 2IT0A 1XGNA 4ZYGA 3P9IA 3HYIA 2FU4A 4E70A 3LAJA 2W57A 2DLLA 2DO7A 2A69F 5ILVA 2G9WA 1G3YA 1LJ9A 5JI6A 2H6BA 3JSOA 3V8KA 2OZ6A 5IT9K 3HTSB 2FBHA 5DUIA 4IHSA 1BJAA 2RNJA 5HVQC 3FXUA 3E5UA 2HKXA 2QENA 1FYLA 5LGTA 3KP4A 3HHGA 4CGZA 2CQKA 4HDUA 2XASA 2H94A 1DPRA 4P9UA 5E17F 1G4DA 1YYVA 4YFNF 1XSDA 2LF7A 3EDPA 1ZGAA 3KCCA 2M87A 2E1NA 1JXSA 3ZN1A 2RVCA 2FQ3A 2VE8A 2P6SA 4HF1A 3OV8A 1F5TA 1T39A 1QPMA 3L9FA 1BC7C 2K02A 3QP5A 4ASNA 3QPHA 3DP7A 1V3FA 1JHHA 2Z5UA 4A5NA 4UVCA 4Q48A 3ZMTA 2DPDA 1TTYA 2XIGA 1W7PB 2VBXA 2VODA 1BIAA 4A5MA 1STZA 1YQAA 5FFZA 4HX4A 1K6OA 1IRFA 4H0EA 1J59A 4ZH4F 5EEGA 4XLNF 2EWNA 1T98A 2EJRA 5H6RA 2VOPA 2XAGA 1J75A 1BOAA 1IN8A 4ENJA 2LSOA 5FLXZ 3O3KA 5FGMA 4EMSA 3ECHA 1ZHFA 1BI2A 2L02A 1FP1D 1HQCA 3R0JA 4AWXB 1FSEA 3S2WA 3L2CA 3E6DA 2L01A 2HEOA 4WX9A 4IRIA 1LNWA 1GXQA 1S8NA 4U7DA 2LF8A 2QQAA 4IXAA 2F5FA 3Q9VA 4CDGA 1WQ2A 4L0YB 4PDKA 3J81Z 2P8TA 2XGXA 4UUVA 3V7CA 3GFLA 3MQ0A 3T0YA 2OZUA 4R79A 1KU3A 2E7WA 3MWMA 4PGHA 3V4GA 1FSHA 4EJOA 1WKMA 4JK1X 2CW0F 1XDUA 3IL2A 2V79A 2W84A 4AIJA 2WC2A 3I71A 2CVIA 1K78A 2Q2EA 5BPDA 4N0BA 4HAMA 2ZBKA 2BGCA 1Z91A 3U2RA 2ZNYA 2F5EA 4QLCU 2K27A 5HLIA 4UHTA 2FXAA 5E8IA 4CZZA 2CSOA 3KP6A 1USTA 2Q0OA 3FXRA 5AIQA 4JQFA 5JFRA 1FY7A 2VBZA 5ICGA 4PZJA 2CG4A 1XSXA 5FLXK 3P9KA 3I0TA 3ULQB 4NHJA 3FXQA 3RPUA 4K2EA 1CGPA 3MZHA 3ECOA 2STTA 2XRNA 2Z99A 4U0YA 2FA5A 3R61A 3W6JB 2KIUA 3EQLF 1W5TA 2Y0MA 5K1YA 1UFMA 1U5TC 3R4KA 1TLHB 2P4WA 3QAHA 2ADUA 4KIGA 3BWGA 1IUYA 5IT3A 3FX3A 5CVJA 2P5LC 4G7ZF 1MDMA 4G7HF 3FZVA 3WODF 3BROA 2VC1A 5BMZA 5E1ZB 5KVRA 1B1BA 2W24A 1FLIA 4Y17A 2IRFG 5FD6A 5D4RA 5FB2A 3I59A 4I98B 2R7DA 5FO5A 2EFQA 1ZRCA 2O61A 4HLXA 2HOEA 4LG0B 1SD7A 3GX4X 4M72A 4CHUA 1B9NA 2O03A 2H27A 5L3CA 5F1RA 4RAYA 2M30A 3ABTA 3TQNA 2ZNZA 2ELHA 4EGZA 6PAXA 2HQRA 3H3ZA 4UV9A 4GO1A 1ODDA 3SZPA 3B73A 3CO6C 2LKPA 2QQ9A 2JTVA 2JPCA 3H92A 4IRHA 1NHAA 1IXSB 2VT3A 4G9YA 4LJZF 1KQ0A 2A61A 4LK0F 2FSWA 1TNTA 2FBIA 5D4SA 3J81K 3LWFA 3QOPA 4ENMA 1FBQA 1LEBA 5ICEA 3HRTA 4Q5SF 4WK8F 5HS9A 3I64A 4G6DA 2IA1A 2QLZA 2P5KA 2EV5A 2KJCA 2QQBA 3HRUA 2PI0A 4ZZLA 1LDJA 3WG9A 5TJJA 3ZMZA 3F8NA 3HSEA 2JSCA 4LMYA 2NAZA 1W7PA 1C0WA 1IAWA 4KICA 1FWZA 4G8XA 4NQWA 5D6FA 1G3WA 1AOYA 2X4HA 2NS0A 2FF4A 3KLNA 3L00A 3BJAA 3ML6A 2D45A 4TV7A 1HBXG 4IVNA 4HYEA 3C7JA 3LQRA 5L3FA 3BP8A 4KFCA 3FWEA 3QU3A 2K86A 2F5DA 5BOXA 1IN4A 3VEPA 3LQQA 4M9XA 3K1PA 4AVPA 1CF7B 2OA4A 4MHGA 3CUQA 2MLKA 1EH6A 4HF2A 3HIFA 5JHUA 1P4WA 3F6OA 4HOBA 2VE9A 3VOEA 5LLQA 3G73A 2GA1A 4L9JA 5E20A 1USSA 1QNTA 4LG0A 3JTGA 4KNYA 3GZ5A 2FOKA 2M1BA 1LDDA 2OQRA 3KLOA 1IXRC 2XVCA 5ICCA 2PMUA 4S04A 1U78A 3JTHA 1FZPB 2L4MA 2EK5A 4KMFA 2KKOA 5TRDA 1LQ1A 4HZFA 4L9NA 3L7WA 2Z33A 5IT9Z 4YIFA 1ZLKA 3E5QA 3HUGA 1OYYA 2YPRA 3F21A 1FBUA 5DEQA 2CYYA 4ENNA 2V1UA 1FYKA 3DPLC 1TW2A 1BI3A 4A6EA 3F3XA 4U0VA 1Z6RA 3KP7A 3RKYA 4HV5A 2J5PA 2RC4A 3BPVA 3E3VA 4JBAA 5D8KB 4AD9A 2B0LA 3GUDA 2H6CA 4HX7A 3TOAA 1ZH5A 3TKYA 4EGYA 1YLFA 3E6CC 5CVUA 2FEZA 3GFIA 5ICFA 1MJAA 1V4RA 2Z9OA 4BHBA 4HQEA 3WTZA 3RKWA 4OIPF 3IWFA 1H9TA 4R1HA 2M45A 1K79A 3KEOA 4QWQA 3LA7A 2D2WA 1R5GA 1BIBA 5LRSA 4M9SA 1P4AA 2CGPA 3M8EA 4OIQF 2PG4A 2VBWA 2J5OA 1XD7A 1XSVA 4IJAA 1T6SA 3K0LA 5LHGA 1D3YA 1O57A 2PEXA 1O3TA 1XGMA 1ZRFA 2ZO4A 4P96A 3RI4A 1OR7A 2K4BA 3T5XA 2HFHA 2WV0A 2RQPA 3TDUC 1HW2A 2HR3A 3HOSA 3IRQA 1HSJA 3RPQA 2RV8A 3GEZA 2HZTA 1XN7A 2ESNA 1UHWA 1Z9CA 1X3UA 3CUQB 4ESFA 1E17A 5F6FA 3E6BA 4OOIA 3FM5A 2STWA 2FNPA 1WWXA 4HF0A 3REOA 3G3ZA 1FYMA 5J6XA 3WTYC 5DCMA 1DP7P 1D5VA 1OPCA 3WE3A 2FBKA 4FHTA 1TNSA 2V1DA 1F1ZA 1ZLJA 1B59A 5CLSA 4B8XA 2W85A 5ILSA 2O0YA 3IWZA 2GZWA 3WE2A 3WGIA 3ROUA 3F8MA 2BBYA 3FHZA 3WGGA 4OMYA 2FMYA 1ZN2A 4BNCA 2OQGA 1P4XA 3HSRA 2JT1A 1Z1DA 3CLOA 5L3EA 2QYOA 3K1MA 1FX7A 1G3SA 3IKTA 5BPIA 2JZYA 1EH7A 2OD5A 1XB4A 3KETA 3PQKA 4L9VA 3DXJF 4OMZA 2UWMA 3LFKA 2VBYA 3OOPA 4HA8A 2IVMA 1DDNA 3ZQ7A 2DTRA 3F22A 4CYDA 3IKVA 2HWVA 2DBBA 3I53A 3GWZA 3KEQA 2HTJA 1PP8F 4LB6B 1LEAA 2RDPA 4NB5A 5D8LB 5LHIA 4S05A 4ESJA 4RS8A 3V8JA 4MQVA 3U9GA 5HDGA 1A04A 1R36A 4EJVA 1S7OA 2A68F 3LAPA 4A12A 1J7KA 3E6MA 1JGSA 4I09A 2L3DA 1BN5A 4HBLA 2EV0A 1YW8A 3SQNA 2DPUA 5EEHA 4I0AA 4YIIA 1F9NA 4KN7X 2CO5A 1BC8C 3BOQA 4RB2C 5J8CA 2MD5A 2NYXA 4ENKA 4N9IA 1VTNC 1YW9A 2MH9A 1G6NA 1R5HA 2BV6A 3F8FA 5AONA 5D5WB 4MTDA 1XDSA 2EFPA 1T0FA 1XMAA 2L4AA 5HLHA 4OIOF 2GXGA 2IPQX 5CYVA 3TO9A 2XUBA 1Z7UA 3ZPLA 3M7GA 5DV5A 4IPAA 3GO5A 2E1CA 4A0XA 2OU2A 3WU1B 2ZBCA 2IJLA 1YO5C 3P9CA 4Q47A 3I58A 3WTUC 4GYIA 3NQOA 2YR2A 1KU7A 2V9VA 4LLGF 2XAJA 1K7AA 3N97A 5CVIA 1R1VA 4OINF 2OBPA 4KMUX 2XHKA 4M71A 1U3EM 1Z05A 2ZFWA 3GF2A 2UZKA 3VB2A 4ZZDA 4Y15A 3HSFA 1J9IA 2HYGD 4P9FA 1W7PD 3ZP5A 1Z6TA 2COMA 2HTSA 1U6GA 5LHHA 3KP3A 2Q8KA 2KRFA 3F8CA 3DF8A 3L09A 1YG2A 3EUHA 3WTWC 4YFKF 1F4KA 1HW1A 3H3UA 4EJWA 5LGUA 4I2OA 1GHCA 1S3JA 1SD5A 4WXHA 3V7SA 4AIHA 1ZG5A 4P55A 2PFBA 4M6XA 2EFNA 3TGNA 3Q5FA 2M5WA 1S29A 3M1EA 1S7AA 2CFXA 1B4AA 4U7BA 3RJPA 2D1VA 2DI3A 2A6EF 4GGGA 3PQJA 3J80K 2UXNA 1OYWA 1BI1A 3MAJA 4UXNA 3J80Z 4FX4A 2DK5A 4YG2F 3EETA 4EJUA 5BS6A 5H6QA 4Q4ZF 4U0WA 3DEUA 1UHMA 1WRJA 5LBQA 3FMRA 3K2ZA 2DK8A 1WI9A 1SMYF 2P7CB 1OMIA 2ISZA 3RYPA 1REPC 5LEJA 3KP2A 2NNNA 2BYVE 4RAZA 1L3LA 3ERED 1IXCA 1DPUA 1GVJA 3V8LA 1FNNA 2XAQA 1YS6A 1D8JA 4EM1A 1YTYA 1TW3A 2VONA 1ZRDA 2O6GE 5K5OA 3FM3A 3T1BA 3CUQC 1L0OC 3U1DA 2DT5A 1B6AA 2E7XA 2PBIA 3F6VA 4XSZF 1I6XA 2IW5A 5JVTA 2QUFA 4KUMA 2D1HA 1QGPA 3P7NA 1E2XA 3B02A 4KIBA 4IHTA 2NNYA 4I02A 2C6YA 4YFXF 5J8FA 1MZBA 3D5LA 3JAMK 4MGRA 3N4MA 5CVRA 4L9TA 1SD4A 1KU2A 1LVAA 1FOKA 2H09A 1QZYA 1XCVA 4GXOA 4BHPA 3KP5A 2ETHA 1IW7F 4UVAA 1ON2A 4RGSA 3R0AA 2ZXJA 3WGHA 2DAOA 1TQMA 1QBJA 5L3DA 1MD0A 4RGUA 4N9HA 4UNOA 4ZYHA 5FFXA 4KYWA 4KIFA 2VOOA 1SMTA 2DQLA 4A2UA 3ELKA 1ONVA 5BQTA 4FT8A 4KT5C 4U88A 2GWRA 3GLXA 3I4PA 2XKOA 3FF5A 1TBXA 4CO8A 2AS5F 1R22A 2XAHA 5FD5A 5E1XA 3F23A 2M8EA 1ZYRF 2HQNA 4BQAA 3HHHA 4MNUA 4HQMA 2EV6A 2GIVA 1XGSA 4XBFA 2JPBA 4I0BA 4EVIA 2F2EA 5K5RA 2RGVA 3F72A 2P7VB 1HXDA 5DDGA 3HTUA 4IF4A 4L18B 2K4JA 4KN4X 2KIMA 5ERIA 4O3MA 2K7LA 1KGSA 1R7JA 1Q1HA 4G7OF 5HDNA 3SXYA 1U2WA 3ABUA 2ZMEB 3MEXA 2MH2A 1O3QA 4AIKA 3DPTA 2PQ8A 2EFOA 3QPTA 4GCVA 3PFIA 4MQ9F 1JHFA 2Y48A 3NRVA 4LK1F 4HLYA 2MC3A 2Z4PA 2ZKZA 5D5XB 3WTTC 3K1NA 4RB3C 3CJNA 4UV8A 5CVVA 1RI7A 4HDVA 3E5XA 1XGOA 2UXXA 1PUEE 4WWCA 2XV4S 4XRFA 3DFGA 4KDPA 5LGNA 1LDKB 1R1UA 5AIPA 3RDIA 1RUOA 2ZMEA 3C18A 2QWWA 2FRHA 2G7UA 2A5YB 4O6JA 1ZGJA 2MLGA 5D5VB 4WCGA 1I27A 4PGGA 4B09A 4WXCA 4A6DA 3TDZC 2ESHA 1YIOA 1HKQA 3T8RA 1FBSA 3W6KB 4I01A 4RB1A 1PDNC 5ILUA 3KE2A 3SZTA 3VODA 3SFZA 4DQ2A 1XMKA 3NEUA 3JAMZ 4F7ZA 2DJWA 3EYIA 1KU9A 2Y75A 3CTAA 1O3SA 1UCRA 1S6LA 1H0MA 3WU0A 2P6TA 4BAYA 2JSXA 2XAFA 2Z3YA 3LA3A 1YFHA 1G3TA 3E97A 2G7HA 3BY6A 3HOTA 4LLNA 5E1WA 2O3FA 5F64A 2GA2A 4L0ZB 3I59B 1RIOH 5DD8A 3BJ6A 4EV0A 1KQ9A 1U5TA 4Z2YA 1EH8A 1HW5A 3GFJA 3MZYA 4DNCA 1OYIA 4ETSA 3BJOA 2P5VA 5L3GA 2DQRA 1KYZA 1I5ZA 3TO6A 3T8TA 2LDUA 4EQQA 5K5QA 3FMQA 1MJBA 2EA4A 3ZMVA 2YX7A 1RUNA 2A6HF 2WTEA 1SAXA 2MA3A 2F5CA 4FX0A 3GVAA 1I1SA 2L54A 1TQIA 1ZARA 3BZ6A 2A3SA 1BM9A 1ZG1A 1KYWA 2HKOA 1FPQA 4CICA 3MFKA 2WWYA 2W25A 4ON0A 1O7FA 3DV8A 1QQIA 2FNAA 1O3RA 3M9AA 2NRAC 3AAFA 5KK1A 4LFUA 2BE5F 1QZZA 1ULYA 4BYYA 1ZAOA 1B9MA 2R7FA 3RTRA 2YSRA 5HOOA 5A2QZ 3F8BA 4EM2A 1Y0UA 4HW0A 3LA2A 1MKMA 2BEOA 5LRRA 1KA8A 3QU6A 2V6CA 2VXZA 4WXDA 3BDDA 3ZMDA 3QRFF 1SFEA 1FT9A 1YS7A 4A0YA 1JE8A 1IRGA 1AWCA 1DUXC 1W4MA 4XSXF 4EJTA 2HS5A 1BI0A 2PN6A 3GXOA 4LD5A 2KIFA 5DUKA 1OKRA 3ZN0A 2KJBA 5DCMB 4M9ZA 4G94A 1FP2A 1QO0D 1RNLA 5E18F 4ESBA 2GQQA 3JSPA 1CF7A 1KQ8A 4LGWA 4EM0B 2RN7A 1R1TA 5DYMA 4WF2A 5E8GA 2QZ8A 2OAZA 1SFUA
chains in the Genus database with same CATH superfamily
1VQPI 3ZCOA 3N4WA 1HKTA 2PJRB 5DCFA 4B48A 3U1LA 2KDZA 2J7WA 3ZXWA 3PW5A 3RQIA 3JRIA 2V8PA 1S72S 4MEYF 3GTYX 3HL2A 4LB5A 4IRGA 1TL7B 2DNNA 5A2QY 2CU7A 5J4YA 3GTGJ 2FHKA 2OPSB 3OXGA 3KG4A 4P5OA 2K06A 2XO6A 3GYHX 3FBBA 3JRDA 1P6RA 4ZDPA 2E60A 1EETA 2YU3A 1A0OB 3HRMA 2YKNA 5KT4A 1J0RA 3I0SA 2QLJB 2YPZA 2XLJA 4ZVSB 5A2QU 4U87A 3G6VA 2EKNA 1SANA 2G9OA 1F36A 2G0CA 2J6TA 5DM6F 1IDZA 2LXUA 3WHIA 4ED3A 1TV6B 3RBEA 4F52A 2QEXI 3V6KA 3JR9A 1RYSA 5B08A 3MZ8A 1HR0J 3VALA 2XI2A 4DXLA 1SKWA 2LEPA 4Y2KA 5EN1A 1VYAA 2BM1A 2FE3A 3ISPA 4B44A 2ISYA 2BYCA 1XERA 3H98A 1W5SA 4WP9A 4I4BA 4LFCJ 1IZ1A 3HEFA 2Z2ZA 1P9QC 3TUIC 4EO6A 3K69A 1BBYA 1XTZA 1N5YA 3DYAA 1XR5A 4GVBA 2GOMA 3R5JB 2YNGB 4BEHA 4AD6A 5IOYA 2PMZA 2ZMEC 4BWMA 5D0HA 4D0PA 3US5A 4P2FA 1HSTA 2G0EA 2KRCA 1LK7A 4A3BJ 4B3MJ 4PCQA 3O6BB 2DD8S 2EB7A 4D1QA 3N5FA 1X9WA 1YGYA 1CULB 5LMNF 4A0ZA 2OMOA 2XWXA 4ZDNA 4W90B 4BQOA 2HXOA 3W1YC 4LLLA 3DKWA 4XN0A 3J7ZT 4OMFG 1S6PB 1G7CB 4DV7F 1T03B 1RACB 5DD4A 1N8RT 1MDMB 2WTFA 1RLDA 3FEXB 4DL4A 2CDRB 3QOEA 4DHVA 1GXPA 2YKMB 4OI3A 2Y0SN 3CCVS 4DGWB 3CCRI 3CC2S 1Q4RA 4F0MA 4L5JA 3VQSA 2HDCA 2BXYA 3MM8B 5I3QA 4XO0A 5C4XJ 1SC6A 3GW2A 1ETQA 2PMWA 3KZZA 4KE5A 1ETXA 3W2WB 4X4OA 1SL1A 4BDYA 1QDUB 3RBDA 4JP0A 4URSA 2NSCA 3M8FA 4IRKA 2DHXA 5F8HA 3PUFA 1Q0NA 2ZCWA 5ETLA 1FNXH 1S0VA 1S76D 2ABYA 2BUNA 2NCKL 2XSJC 2QBYB 3FMSA 1N32F 5CYMB 1WG5A 2KJWA 3BR1A 2GAUA 3RKXA 4BXUA 2DDAA 1MJ9A 4BXFA 2WVFA 5IV4A 3RKQA 2H5IB 4AL7A 1RZ4A 2AWZA 1GXLA 1XMXA 3IWLA 2DFFA 3UKGA 4X4TA 2QVOA 3S16J 3PW2A 1X9SA 3IBFB 3K10A 2W2MP 1T7PA 2R7TA 4OZ3A 5A0YB 2IGNA 3R6SA 1MWZA 3LP2A 4MH8A 2OPQB 2IBKA 3HSGA 3TWZA 2LP0A 3BTJA 1VRQC 3MCOA 2CJ9A 2AXLA 4DR5J 1MSFC 2QMXA 2A18A 1YI2I 4O5VA 1FJGF 1FKOA 5GAGI 4J9LA 4IH7A 2VKVA 5RUBA 1IN6A 3OLBA 3BN4A 2XROA 3DYAB 1J5YA 2IP2A 3TMOA 2I5JA 3SDEB 2DA5A 3P9IA 4G1QA 2CQ1A 4E70A 2Q1LA 3CCJI 2YNGA 1S6UA 4PG6A 4CO4A 4PAAA 2FLNA 2DO7A 1V5IB 3GFHA 1K6YA 2YNFB 4A3IJ 3UDLA 2BV3A 4B47A 2Y8YA 2HBRB 2K5CA 1YE9A 1OJLA 4OZ2A 3BEGB 5JI6A 4OI0A 4A46A 1S9GA 4N7TA 2M8GX 3VCDA 1VQYA 1FCAA 2I9SA 2K85A 2MW8A 2FJ1A 3EM1A 3QPSA 4B08A 3DLAA 5DUIA 1N77A 5JVHQ 1T03A 4IHSA 2VFVA 1BJAA 3LSMA 3S32A 3AT1B 4TQSA 2UV1A 2NQPA 2XLKA 1MMNA 2HKXA 3GTLJ 4ED7A 5EJCA 3V6DA 2GMJA 4DZPA 5LMNJ 1T05A 1GMUA 4FVCA 3VAMA 4KV8A 3HHGA 1YRNA 4BL0B 1I6HJ 4CGZA 4HDUA 2V4JB 2HVZA 1TK0A 1WOSA 3DRRA 1DPRA 4WFZA 2C3PA 5E3NA 1JLEA 1G4DA 2EZHA 1YYVA 3K8VA 2HHSA 5F8NA 2MSSA 4URQU 2G4BA 3KK3B 2PJRA 3EDPA 1ZGAA 3G4SI 3DLKA 5F8IA 3ZN1A 3GIMA 4HSRA 3DLEB 5AE3A 5J1EA 2CQ2A 2FQ3A 2M8HA 4RNHA 3VAIA 2F6CA 3OV8A 3JTNA 4ITVA 1WEZA 4F02A 4K4VA 3L9FA 2DCLA 2K02A 4FASD 5ITHA 1RBAA 2BVLA 4DJBA 2RREA 3DP7A 3MAHA 1X0PA 2EK1A 4A5NA 1L5UA 3CW2C 4UVCA 1OIAA 2B51A 2RAQA 5A8RA 4FDFA 2DPDA 3WBZA 3EXCX 4LR9A 2WADA 4M5GA 5J2MB 1YQAA 1OY8A 5FFZA 3OYJA 4G3IA 2UUBJ 3FDSA 4ZH4F 1J59A 2BR0A 4FN5A 2EWNA 2HYIB 4RUAA 2EJRA 1T94A 2AU0A 4EBCA 1J75A 4ENJA 3ET6B 1TVRB 2KL4A 3BR6A 1ICEB 4ZP6A 1XNQF 2RDJA 5K7FA 3OPKA 3FK4A 3ZTPA 2L02A 3H1CA 4ZCIA 2QA4S 2HNYA 1FWLA 4X64J 2WY8Q 1S12A 1FSEA 3G6YA 3B8HA 1GXQA 2BE9B 3JAMU 4K50A 3DLHA 1VRTB 4CDGA 4N47A 4X65F 5F0CA 1FXLA 4CLFA 4PDKA 2V2VA 3JRFA 3OL3A 2XF7A 1IQZA 4G1IA 2DYAA 3V7CA 2YNFA 4PJMA 3I5CA 4O3QA 4DR2J 3HVAA 1ENHA 2HQGA 3MWMA 4J9VA 4AU7A 1LE8B 1IQTA 3P6YC 2KT0A 1FOXA 2XI3A 4M95A 1SVLA 2OMLA 4U9RA 3GU0A 1LVKA 1Z3XA 1YWXA 2OPRB 4NRUA 5IP9J 5F9LA 4X65J 1CJUA 3TW7A 3HVTA 1QE1A 1R43A 3GJRB 3U2RA 3C6TB 1GMWD 5L8RC 3KLEA 3CPWR 4QLCU 1HA8A 3M1CA 2D9OA 4K5SA 1MSWD 1XQIA 2XMAA 4UHTA 2FXAA 1NTCA 1QAXA 2CSOA 5AT1B 4JV5J 2ZJRF 4Y3CA 1XR7A 3KP6A 1T9UA 3OFHA 2Q0OA 2H1LA 2IM2A 3JRAA 1E6VB 4NXNJ 1N34F 1WH7A 2OCCH 4QYZK 1TWGJ 3HT0A 4DPYA 4ZTFA 1XSXA 5FLXK 2K9NA 1RGVA 2FJWA 1S1UB 4ZP9A 1P7JA 2BKPA 3EZUA 1B3TA 4ICLA 4DR1F 2UUBF 3I5AA 4PWWA 1UZCA 3PHEA 2QMUB 4DR1J 2HRUA 2Z99A 3A4TA 2HRYA 4LF5F 3OXLA 1IUFA 3R61A 3W6JB 5EHHA 1NJYA 3QT6A 4RW4A 3UWTA 1U5TC 3R4KA 1E6YB 3AODA 3RZAA 2G1HA 3M8QB 1TK5A 2P4WA 2F3JA 4ZPTR 2B5JA 3VAGA 3BSAA 1WJ9A 1IUYA 2YS9A 3MPYA 5KFSA 3GQCA 5CVJA 4G7ZF 3CJ3A 2QG9B 1QUPA 3SIPB 2VC1A 1I6JA 2E1PA 1UVMA 1EB0A 4ZKAA 2W24A 1FLIA 1SJ3P 3HJVA 2L5QA 5HLFB 3SSQA 1VI0A 3J7AY 5D4RA 3DMJB 5J2NB 4M5KA 4EZ6A 4DOZA 4P71A 3I59A 4I98B 1NK9A 4A3GJ 3GFXA 1Z4UA 3QO9A 1B9NA 1VHIA 1A6IA 4WJBA 2QL7B 1Z2LA 4RAYA 3OL7A 3IWXA 4Q0BA 2KI2A 1WKJA 3TQNA 1KQFB 2ELHA 1U9NA 3B6BA 3ELHA 4ZK7M 2D69A 1Y7PA 4CP5A 2ME0A 3AD7C 6PAXA 1H2TZ 2HQRA 2XPUA 2OSRA 2UUCJ 2LDYA 3UCGA 4XLHA 4UUSA 3JSRA 3RAMA 2JH3A 4C3HJ 2DR6A 3R97A 5BR8F 1HNXJ 3MM6A 1LFPA 4J19A 2X7IA 3JRGA 4UQTA 2JTVA 4J37A 3ZZOA 1YJ9I 2QSGX 4OJGA 1TFWA 1YI2S 4GKKJ 3PRDA 4IRHA 1MBFA 2X3GA 1WD6A 4ECUA 2VV5A 1EAYC 4D7NA 3HFZB 4YR2A 3ZQHA 1REVA 2E5LJ 4DUZJ 1WTFA 2FBIA 2UXBF 3IV5A 4ENMA 2PD1A 3L3CA 4IFYA 1C4AA 2I5UA 4P7VA 2LU2A 2FUG2 3DLKB 1PGZA 3DLEA 1BR2A 4WK8F 2CPDA 4DJAA 3SCJE 3I64A 2CKWA 3CDUA 5DDQC 5HQLA 4E2FB 4G6DA 2GLOA 2AJ2A 3RW7A 4M3BA 5F0FA 4Y65A 1FJGJ 2GHPA 4AYBD 4A48A 1T0FC 2KJCA 1CQTA 2IFXA 2F8MA 2YNHA 3VGVA 4NLDA 3S1TA 5DRKA 4R5PA 2FJDB 2ERRA 1TWAJ 3PUBA 2X6YA 1LDJA 1Y39A 2DY1A 3WG9A 5TJJA 3UW1A 2DA6A 3ZQGA 2NAZA 4Y2IA 1IAWA 1R8AA 3HOWJ 1WF1A 4V19K 2X3DA 2FB0A 3RG6A 2IRUA 3ZZPA 2BA9A 4X4SA 1G3WA 1AOYA 2X4HA 5JJBA 2FF4A 4CH7A 2L48A 4I99C 1QAYA 2EG1A 2IS2A 5KT2A 4TV7A 1U4BA 1T08B 2OEKA 2XS2A 1RPWA 4KFCA 2PE8A 4X4PA 1GX6A 3QU3A 3C2BA 2K86A 3MECB 4QWAA 4F93B 3QRQA 2QGFB 2BJEA 1JLCA 1IN4A 4M9XA 1NU4A 4LSLB 1QPIA 1WUUA 4JI5F 3MMJA 3D5RC 1EH6A 2LKXA 3DEEA 3X3UA 2QF7A 4DG1A 1U1MA 4LQ3A 3QQAA 3GTPJ 1UA1A 2GIFA 2R7OA 3CD6S 1ZETA 4JX4A 1DLOB 4KNYA 2CG8A 2HK3A 1GT8A 5DQHA 4PUSA 3UN5A 1UVLA 3JB9k 3DRSA 3LL7A 4MO7A 2BX6A 1U78A 2XEXA 2DJNA 3JTHA 3Q86A 3CF5F 1BUXA 2DNKA 5CQGA 4WIIA 5H9EK 4HZFA 4DZ6A 3R27A 1PBUA 4IUFA 4L9NA 3M6VA 3L7WA 1LUJB 5ETPA 3R8YA 4YIFA 1ZLKA 3HUGB 2QT7A 1VHFA 1Q78A 3MKWB 2V1UA 3TA1A 1WI6A 5A76A 4NUBA 1DJ0A 1NO8A 3D3CJ 3OW2R 4B9LA 4B3MF 4HI1A 5KFZA 4ZVHA 4NZ0A 1OY9A 1QE1B 1T9XA 1Z6RA 3KP7A 3RKYA 4HV5A 3IR6B 3BPVA 4JBAA 4TKTA 3BJYA 1EX8A 4PEOA 3FEYB 1REVB 1B99A 3QJPA 4C2MA 3KNAA 2GW8A 1MNDA 2RU3A 2MKSA 1RAHB 2U1AA 1YLFA 5GADI 2IDLA 3PFYA 3GFIA 3NBPA 2ZHBA 3RKWA 2VDIA 2HOAA 2L9NA 3IWFA 5KHDA 2CZ4A 3HK2A 1H9TA 3QRRA 4NLOA 2PGCA 2WCXA 4V19X 3KEOA 2Q43A 4ZLPA 1KLNA 1D1UA 3DOMA 4FKYA 1R5GA 2XY6A 5IOZA 1P4AA 3Q0AA 2QL9B 3M8EA 5B66C 1RT6B 4NA2A 4B17A 4OIQF 2PG4A 5H2FC 2CV0A 2PSZA 2FC9A 2IA6A 3RTVA 1FKPA 1XD7A 2ZKTA 1BR4A 2V50A 1WC1A 4KFBB 3KHRA 3K5LA 2CWXA 3DKDA 3JTOA 1NG6A 1ZRFA 4ZVOB 4RNNA 4P96A 1NUEA 1OR7A 5HMWA 3HHLA 4XLFA 4JOUA 4DR4F 4LT6A 4IDKB 4K2JA 3HHEA 2P0WA 1RWUA 3OYHA 2HQ5A 3S1QJ 1T9WA 2UXBJ 2VJUA 2EPFA 2Q2EB 3PSFA 1TMJA 3GEZA 5J2NA 2W4SA 2ASYA 2HZTA 2JK3A 1XN7A 4RUBA 5LSRA 4FYXB 1Z9CA 1RUSA 3UVJB 1BW5A 1F43A 4ESFA 4HTIA 2Q3PA 5FROA 6AT1B 1UPPA 1NB7A 3ZZ0A 2MSTA 4XLAA 2UXDJ 4G6VB 5M5YJ 3TW0A 1F60B 3REOA 3JQMA 4ID5B 1HNXF 2KLOA 4HI2A 3MKYB 3WTYC 1S1VB 2GC8A 3CE8A 3M05A 1OPCA 2FHMA 2KM8B 3WE3A 1UAAA 2FBKA 1TT5B 1HQEA 3FCVA 4DSLA 1ZLJA 3MKLA 4JI7J 3AY0A 2J6SA 5CLSA 4CQ1A 2O0YA 3LWLA 3IWZA 3WGIA 4J9PA 4HNTA 3IN5A 1VQKI 3MMCB 3CMQA 1KDNA 3WGGA 3ZTRA 4RW6B 4ER8A 1T3OA 1RLCL 5B3SH 3MEEB 1P4XA 4BBRJ 1N88A 4ZPVR 3CLOA 3DGVA 1S0OA 3H35A 3OYBA 2O66A 5DS7A 3J7ZI 2DISA 3IBWA 2JZYA 3H5XA 1FNMA 2DGTA 2C2ZB 3QSYB 4OMZA 2R42A 4EU0A 3LFKA 1RE1B 4HL9A 3M6UA 1MROB 3HJFA 3M3YJ 3P45B 3KHLA 2JMWA 4J9QA 5L1JA 1RC9A 2ZH8A 4KPYA 2Z2YB 1C1BA 3IKVA 3KDOA 3BYPA 2HWVA 3GWZA 4CDIA 2RDPA 2EK6A 1PJ5A 2B8QA 1VK3A 5M2RA 4PSXA 4MQVA 5J47A 3NNHA 3R7SB 4ILRA 3BDPA 1A04A 1R36A 3LSHA 3VYRB 2ZITA 2QA4G 3FC9A 3DOMB 4EJVA 4O44B 2XGQA 2XQCA 3W2VB 3KLVA 1VOMA 3GLJA 1S57A 4GO5X 4S0HB 3E6MA 3OYGA 4ECYA 4I09A 2UUZA 2H4YB 2ZFUA 3OS1A 3HKZN 2DPUA 2JOQA 3OUYA 2DMUA 1N34J 2ZH1A 2EPIA 4MAKA 2NPFA 5KFPA 2PMZD 3BOQA 2VKDA 1ZBTA 2ZE2A 2RQ4A 2NYXA 1PYVA 2R9LA 2K7KA 1M90T 2CJQA 1G6NA 5CAAA 5AONA 5D5WB 4MTDA 1R8BA 2CJBA 4WZQA 4OWRB 3THPA 1DZ5A 1XMAA 3DRXA 5HATA 2X1DA 3LAKA 2F65A 5E3OA 4OHXA 2FJEB 2ZOMA 3MXHP 2VASA 5DV5A 3C46A 3MKZA 2V7FA 5DDPC 3I82A 3D3BJ 4A0XA 3CJ2A 3FJ2A 2Y0SA 4MIBA 4UY8I 5C42B 4C8NA 3QYBA 2WVBA 1S9HA 2Z57B 3P9CA 1IKVB 4Q47A 2ZJQF 2C3YA 2GGPB 4MKYA 2YKMA 3AG2H 4PXDA 2VJ5A 2UU9F 4L6V3 3OHAA 1Y8QB 2WVDA 1ZAWA 4OIXA 2V9VA 3JS9A 2YTCA 2Y1IA 5FKMA 1AZSA 1UFKA 3J7Z5 4OINF 1EKSA 2XWYA 4KMUX 5BJRA 3KYLA 1SUQA 5DO2A 1HPZA 2UZKA 1VQKS 2DH7A 4ZZDA 4PJ0C 3HSFA 1J9IA 1FTCA 4J9OA 1GUUA 1W7PD 5CYQA 3FK6A 4DPTA 5LHHA 1DARA 3KP3A 3UDVA 3FKBA 2MYSA 4ZMMA 1YG2A 4XNFA 3EUHA 3WTWC 4O3SA 1U8BA 2KL8A 2N4DA 3OSFA 3H3UA 4NWBA 4X66F 3HZEA 3OVBA 4ED4A 2MLYA 3T6BA 1ZQ3P 2VFSA 3QPLA 4QWEA 2YUSA 4FYWB 4MK9A 2BXZA 5F41A 1YJRA 4C97A 4JI3F 3OYLA 1TUGB 4F25A 3R5CA 1YRTA 3O8GA 4NPOA 2DI3A 2CPJA 2BRKA 4A47A 3I5BA 4GGGA 1FKOB 4HYKA 3J80K 3LGMA 2UXNA 1IBMF 3MTKA 1RTJB 2B7CB 2J0SD 4M94A 1M5KC 1TWFJ 1ZELA 1BD6A 2D1CA 2KXNB 4LF1A 2W7PA 2I5JB 3CJQB 4OHZA 2HZDA 4X4RA 1PYTA 2DK8A 2XB0X 2BJ3A 3DBRB 2MTLA 3PYGA 3A02A 2ZBQA 1YQHA 2X1EA 3HOUJ 1REPC 1Q5VA 4KHPF 3SEOA 3KP2A 5LEJA 2ILZA 4ERDA 2C2KB 5J4VA 5EUHA 3HJEA 1GVJA 3JSYA 1B64A 1ZR4A 2XAQA 2LR8A 5C24B 3CO0P 2DTZA 1TL1B 1WWHA 2L9RA 1MMGA 5C42A 2A6TA 1ZRDA 3H5SA 5C25A 2O6GE 3FM3A 1I94J 1EIYB 3CUQC 1L0OC 3C19A 3W3CA 3F6VA 4XSZF 3QPIA 1KHVA 2NZCA 2Y8WA 4KIAA 3KNGA 2QUFA 1AB8A 2AYGA 4PFOA 3CCUS 1QGPA 1DQ8A 2JVOA 4RNOA 4TU9A 2QLWA 3VYTB 3MR2A 3P7NA 1E2XA 3O6QA 1APLC 4C8ZA 1S48A 1RT1B 2NNYA 4I02A 2GQCA 4UB8C 1MZBA 1Y3JA 4F67A 1IKXB 2HWTA 5CVRA 4X2BA 4A93J 1KU2A 3G6XA 5J1EB 2G13A 2QLXA 2V5HG 1FOKA 1UP1A 2HIQA 1MMLA 5LMUF 5DGBA 3TP2A 4RKUC 1SCJB 3KP5A 3LALA 3F0CA 3VAFA 3VDXA 3G96A 1U0SA 4I2PA 2RDDA 3W3SA 1TQMA 4B1RA 1L3TA 5L3DA 5D0RA 1HARA 5KFRA 3A1YG 4RGUA 2YKAA 4XTTA 3L2RA 2P9GA 4WFNQ 5ETVA 2ADBA 2HQ3A 5KTQA 5EGYA 1NSKL 2RKIA 4KIFA 4K4SA 2VOOA 4XLEA 3DI6B 4TY9A 4OYMA 5GTIC 5BQTA 1U6FA 1CJTB 4ELVA 4EATA 2E36A 1BE4A 1WOPA 3I4PA 3UNYA 4C0BA 4O44A 2VL8A 3FF5A 4KC5A 4DDFA 3FZ2A 4FPRA 5DLGA 5KFGA 2H1KA 2WV1A 3F23A 3GJQB 2ASJA 1AKHA 3JYTA 2W1OA 2EV6A 3B54A 2E7VA 1N36J 3PCOB 4QPQA 1H3DA 2HNZB 3BZCA 3NS6A 2FC8A 5K5RA 3A01B 3PW7A 3SQGA 4JI6J 5IFMA 3DU5A 3CULA 1BQNB 1OQ3A 4YHHF 5HO4A 4NLYA 5GTHC 4XQFA 3OYAA 2CJYB 2W4CA 3LP0A 4O3MA 5ETTA 1S5LC 1VQ9I 2GS8A 4UB6C 3QNWB 3D7SB 3ISND 3ZGKA 5HDNA 3N0VA 2BJ7A 3QAUA 3SXYA 3SCKE 4J9NA 2FOWA 4OX8A 3ABUA 2ZMEB 1HW8A 2VJVA 1IJFB 2FJAB 2M4MA 3FMWA 4NZ7A 2J7UA 4DQPA 3TZWA 2PQ8A 3OQ2A 3BPDA 1U2RA 3ZOBA 1S77D 3BS9A 3UR0A 2DNPA 1HWJA 1JHFA 1L3SA 2JLGA 4LMZA 1NSPA 2MC3A 3T1YF 3NGRA 5EWEA 5D5XB 3LANA 3WTTC 3PJRA 2OEMA 2W4DA 2JEGA 4Z2XA 3HVTB 1KS2A 1HNVB 2V68A 1RI7A 2FLPA 3E5XA 2KFZA 3ULHA 3MPWA 4M5IA 2GO8A 1D0EA 3MAAA 3NS5A 1NH8A 1FOYA 1QSLA 1QAIA 3O8HA 4X4NA 4KDPA 4YUDA 1NKEA 4P2SA 2DR9A 3Q23A 1B72B 3KLIB 1R1UA 2CRLA 3L7UA 1RUOA 3CCES 2V1NA 3H8YA 2VB6A 3GIKA 3OV7A 3AJDA 4AQYF 2A5YB 4I69A 4XKCA 2MLGA 2MDAA 2UZAA 1I27A 4WXCA 5LL6d 4A6DA 1RHKB 1HFEL 3BGFA 4EUVA 1FMVA 1U6BA 1X58A 5JLWA 1WJAA 5IC4B 3T8RA 1IBKF 2ZC4A 1BL0A 3W6KB 4CRJA 1PDNC 2FIUA 4BJ6C 4GC7A 1HR0F 2XGEA 2HGLA 3N6NA 1RWOB 3VODA 3DLLF 1XMKA 1RTIA 3ZZZA 1D3WA 3VAJA 2ZDPA 1AFJA 5F8JA 5DTDA 3CTAA 3T5LA 2OGUA 4OLPA 3FXMA 3MUTP 2VD3A 2JJ7A 1JLAA 4G65A 4J5OA 4OYWA 4LF4F 1VQ7I 2CA9A 2MQPA 1FNOA 3LSJA 1AKHB 1MU2A 5E1WA 2O3FA 5F64A 4AT1B 4GO7X 2JC0A 2VFUA 3I59B 2FHJA 2GJIA 2HNZA 4OI1A 5F8MA 4N4OB 4KGVB 3BLYA 2L7MP 2MQMA 3FHNA 2CV1A 2LQBA 3DKYA 2HS4A 1OYIA 4ETSA 1Q95G 1HD1A 2GA7A 1XR6A 5IQQA 2CW7A 2DB1A 2DQRA 5CH7B 5IS2A 2E5NA 4E7SA 1BGXT 4A8KA 3AL0B 1CJVB 1OS5A 4B3XA 4KGMA 3KMQA 1W7WA 2KO1A 1DQUA 1MJBA 3AD8C 2M7SA 2ZZNA 3G1OA 3VGUA 1XNRJ 3IRXB 3GVAA 1I1SA 3Q3SA 3FBFA 2L54A 1JJ6C 3SEZA 2N4CA 4F36A 3S3OA 1CS4A 3ESWB 2CMPA 5GADU 5DETA 1HQUA 2HKOA 2WWYA 2GMLA 1RU2A 3WG7H 1O7FA 3NMAA 4ZITA 1Q1VA 2D5VA 2V9KA 3M9AA 1S1TB 4O3RA 1HWLA 1JXLA 3C3LA 5KK1A 4FYDA 3GIIA 1QZZA 4ILLA 1SIZA 4C2TA 1FX4A 3CCLS 1IGNA 2FVCA 4A8XA 3BPSP 2OFHX 5CYMA 2E71A 3W8PA 2HZCA 4CLPA 5C2CA 1S10A 4EM2A 1PYOB 4HW0A 3GWCA 3LFUA 2IM3A 2J0QD 1KA8A 1MMDA 1H73A 4IQ4A 3PY8A 4RW7A 4K4TA 3LGHA 2KZVA 1YS7A 4RBTA 1CJTA 2FJVA 4JI0J 2FVQA 3D2WA 1W4MA 4XONA 4EJTA 1KTQA 2HS5A 2J8SA 2FY8A 2NSBA 4CTAB 4IHXA 1R9TJ 3HOXJ 4O3PA 2RNEA 3GXOA 1Z3YA 1EETB 2B7BB 1UJ4A 5HROB 2F9DA 1JXVA 4BS2A 2RHQB 3W66A 1G8XA 4PQUA 7AT1B 5HQ8A 2GQQA 1H2UX 3QWLA 5KNLA 3MMBB 3V4MA 2R7WA 4X4UA 1HHTP 4DSFA 3POTB 3FSXA 2M3DA 2QKLB 3HSJA 1LOUA 2APOA 4IQMA 3DBLB 2XGPA 3PEHA 2Z56B 3PJ9A 1SI9A 2QZ8A 2XY7A 2MYFA 1NLKL 2DGWA 2KDOA 1HBOA 3H2UB 1NSAA 3ZMUA 3T9NA 2LFBA 3D0HE 5FJ4A 2O8XA 2L0KA 4Q45A 4ZVFA 2QSHX 2JUCA 1FXRA 1BLUA 5D5UB 3ENQA 2LYCA 1IV6A 1DY3A 1P1TA 1X2MA 2DIVA 3DWLE 1BQMB 4USMA 3RYRA 3PKYA 5JLXA 3NGKA 5LOQA 4XKWA 2QQ8A 1IN7A 4BEHB 3COAC 2OC6A 2VDHA 1X1DA 2LQJA 4H4KA 1FC3A 3OSNA 5HDKA 2NXEA 5HBMB 3IC7A 4X62F 3EYYA 1D1CA 2JRTA 2BJ1A 1VF9A 3RIRA 2W2OP 1RDRA 4IFVA 1Q53A 3QIDA 4OZNA 1SV5B 2AKWB 3MFIA 2HXIA 3HVRA 2YWEA 1RTDA 3UN2A 1WI3A 5H20A 3DRRB 2V2ZA 3MPUB 4PXBA 3OR1C 3CDBA 5KAKA 2DHSA 5HLGA 3R1HA 3CCVI 3H40A 1IF1A 1GVDA 4MEXF 1OY6A 2ZM6F 2DOEA 2MQQA 4ZPDA 4JYAF 5L3BA 3E51A 1Y8RB 4MKAA 3K4MA 4DBRA 5U47A 1RRJA 3A3PB 1HOMA 2XULA 3VF0B 4DV4F 1R6RA 4BKXA 4D5FA 1HA1A 2NXCA 2X1CA 3ADAC 3H5UA 1RAJA 1JXEA 5HVFA 1SH3A 2VQEF 4C30A 2QA1A 4ES3A 3MPDA 1JGGA 4QJVA 4E7ZA 2IXSA 3A3NB 3TUPA 2HBQB 1ZGWA 5KFEA 1D8KA 2PJPA 4Z6YA 5AXMA 4ZJZA 1F6TA 4Y13A 2X6WA 2ZJ2A 3WTVC 3WTXC 5CJ9A 2JN6A 1B8IA 4XICA 3RB4A 4CO5A 4NZ6A 4B3RF 3IRRA 1OJ4A 2H8RA 2AXTC 5HVGA 5ETQA 7FDRA 2CADA 4KY3A 3TP0A 2AIRB 3SHFA 5TISC 5HS7A 2A07F 2NUHA 5A0YA 2R3SA 3IFEA 1IN5A 2CAJA 1KOHA 3RGIA 3TR5A 1PJ6A 4ETXA 2DOAA 3BBCA 2ID3A 4Y6IA 1HQ2A 2IA2A 4TY8B 3UVJA 3CCWA 1UJ6A 2QN6B 3PVXA 4ECRA 3K9TA 5HMYA 4NA1A 1TKTB 1WEXA 2DU9A 3OHBA 3V6JA 3HFKA 4XDCA 4B9VA 2VPZB 2MQOA 3G71I 4MK7A 4J7CA 5M5XJ 2Y2ZA 4OU0A 3A03A 1HIYA 2OPPA 2ZJPF 3JW4A 4HR2A 1RT3A 1UMJA 2DW4A 1J5EJ 4DBQA 4UUTA 2CQ4A 4A69C 3AG4H 1HNZF 5FD1A 1ZREA 5GMKa 1NK4A 1C1CB 1YK9A 4RR5A 2HPUA 1T56A 3AFGA 4BGDA 3CIZA 4FNIA 5HBMA 4E0DA 4HG2A 4I64A 4OJ1A 2PI4A 1CC8A 1U8WA 1S9GB 1WPKA 4BE2A 3OL6A 3CUOA 2HURA 1M1EB 3W9HA 2YX4A 4ZPCA 1R58A 1FHTA 4CT9A 4DL3A 3A4CA 4PWDA 5AJ3F 1NPKA 2HHHJ 3LSGA 3Q8UA 4XR6A 1SFOJ 3DXSX 5C5JA 3QT8A 3DRYA 4LBPA 3VFZA 2XMMA 3QMQA 4CCOA 2PT0A 4RGXA 2WW8A 1NH7A 3FMBA 5KFIA 1IBCB 1IRZA 1HBNA 1V5FA 1V3ZA 1XGNA 1R6YA 2B4VA 2BHYA 3HYIA 2YX1A 3VTIA 2VH7A 3KJQB 3K58A 2BANA 1R8CA 3LAJA 3LWMA 2W57A 2BM0A 2DLLA 2A69F 4LSNA 3OWTA 3FBIB 4RUCA 3TNVA 3HKZA 2ROGA 1W36C 1LJ9A 3CVKA 3K4KA 4QIGA 5B0AA 3LW5C 2X1BA 1R0AA 2M88A 4L73A 2OZ6A 3BG5A 4WCEQ 1JTYA 2KHDA 3HTSB 1XS9A 4P72A 3OR2B 2DFHA 3HF5A 2FLOA 2HK2A 2COLA 1O4XA 3I31A 4KGXB 2RNJA 2KH9A 2DCUB 3PNIA 3E5UA 2K3KA 4XPCA 4DZDA 2W00A 4WBFA 2SXLA 3J81Y 3M32A 3KLGB 2DHAA 4IH6A 5BNGA 5CABA 1YJ9S 4XLCA 2DXDA 2XASA 4OZJA 3DTEA 5E17F 2VG7A 4E4HA 1ZM3A 2PC6A 4HDHA 1EA3A 1FT8A 2I1RA 2NVUB 4YFNF 2ZHOA 4CM0A 1RCXB 3QLHB 3KCCA 1ETVA 2R93J 3PACA 2NVXJ 2RVCA 1EP4B 4Q0BB 1IKVA 2UUWA 2VE8A 3R2DJ 2B7EA 1FFSB 2R2RA 3HXLA 2RIJA 2W9AA 2L3MA 1R3NA 2HNDA 3U1MA 4HPQA 4ZJOA 2I2YA 1QPMA 1BC7C 2YY3A 2HNYB 4UY8T 3QP5A 5KFVA 4LJMA 2VQFF 2MPUA 1Y5IB 2ALZA 4R0EA 1T0TV 2HWIA 1SJ4P 1LQ9A 4OI2A 2F7VA 4M63A 1RKIA 1HNIA 1JNZB 1YJTA 3M9MB 1RT2B 2VODA 2MZSA 4DV2F 1BIAA 4OYPA 1STZA 3D66A 1NAQA 2E1MC 1SVOA 2H5JB 1NG7A 1XC5A 1W0UA 1IRFA 3MHYA 3HULA 3JRHA 2HFSA 5KAFC 2VOPA 2DXEA 2KYXA 2A10A 1GLNA 2XMVA 3OSPA 2LSOA 5A6PA 4DU8A 2CDQA 2X1FA 4IO9F 4WYWA 5FGMA 4Y28C 4EMSA 2OJ3A 1N52B 3BQ1A 3PFEA 2DHHA 2B9YA 2IS1A 4DV1F 2JEJA 1H2VZ 4NRTA 5GAEU 4X4QA 4M3GA 1BI2A 1FP1D 5CCMA 4V2FA 5E3LA 3S2WA 3E6DA 2UXCJ 4NC7A 1HBNB 1OSCA 2HEOA 4WX9A 2HBZB 2XC9A 1S8NA 2ECCA 3OJUA 4WK1A 3BGUA 1Q8IA 3EYZA 4F0KA 3AH6A 3Q9VA 4B3TJ 1LXJA 3Q0UA 2FVPA 5EG0A 3RYLA 1KONA 2CPHA 3I56S 1F5CA 3BH7B 2HAFA 4I7FA 3MQ0A 3T0YA 4C98A 2Q1ZB 1FESA 1BWEA 4PGHA 5DG8A 1FSHA 2XF5A 3FXLA 5KG6A 3OJSA 5E3CA 1FRLA 1WKMA 4JK1X 1NZ8A 4JV1A 2HS0A 4NMXA 2YKNB 5KFAA 1FX2A 1N54B 4ZVPB 2KHCA 3I4HX 2WSEC 4NC6A 4MIAA 3I71A 2F8HA 5B0BA 1Y0HA 2ICWG 4N0BA 4QIFA 2VICA 5F8LA 4E7LA 4RW4B 1TTHB 3EGWB 2JA6J 1JLQB 1PSDA 1HL6A 3C14B 2GXAA 4DV6J 2J6UA 3M8QA 1U45A 2ZNYA 4C2MJ 1B0PA 2DNZA 2VJIA 5HLIA 4G1PA 3RJMB 4ZCMA 1GX5A 1NJXA 1W26A 2QC3A 1USTA 1LWCB 1S0NA 1UCNA 2A6OA 4JQFA 5JFRA 1FY7A 4WK3A 4PJLA 3LSRA 1JKPC 1Q8BA 1WNEA 8ATCB 4IR1A 2XDVA 2OPPB 1YDLA 3Q8VA 1VR6A 3V4IA 4RNFA 2HHHF 2CG4A 2F5GA 1Q79A 1RKJA 4NHJA 2JZ5A 3RPUA 3G8SA 2HFVA 3HC7A 4LBHA 1CGPA 3BO3A 2O67A 4JI1F 2JUGA 3OL4A 4WXOA 3SJMA 2FD2A 5LSLA 2IGKA 4DLEA 4ED6A 4U0YA 3IG1A 3NGSA 3NAUA 1W5TA 1IKXA 3RAQA 3M1VA 4X0GA 3H9JA 2FJXA 4YS2A 1WF2A 5D0EA 3W60A 2HHXA 1FRIA 1Y0NA 3CT9A 2DTJA 3A0BC 5EYRA 3QAHA 2E2HJ 2PI5A 2ADUA 4ZOSA 5CA5A 1MBHA 4PSWA 1TUVA 1MDMA 4I2PB 5KG4A 4AIDA 4GKJF 2CVEA 4G7HF 2WY7Q 3BR9A 4YMEA 5BMZA 3KG1A 1V55H 3H5NA 5KVRA 4MIWA 1U25A 4CLLA 2R7QA 3SI8A 4C0HA 5KG0A 3TAMB 4JI2F 2RVJA 2LREA 5F0WA 5HODA 3GIRA 2R7DA 5FO5A 1WG1A 2HOEA 3K5OA 4CH0S 4HHUA 2W8KA 3E2EA 1IV8A 1SD7A 3GX4X 4M72A 3ZRGA 1ZM2A 4C3MA 4DUYF 1BOBA 4A3KJ 4CHUA 3UCZP 1G1XA 4LRCA 2MLXA 4F4WA 3OTBA 4EGZA 1K1QA 5J1YA 4TYBA 1MW7A 3G2XA 1TT0A 4UV9A 2WK4A 2R7XA 4DYCA 2OELA 4DFMA 2CPFA 3SZPA 2J9CA 4USWA 3JREA 2WVEA 1M0SA 3IUOA 3CO6C 2XB2D 1U1KA 4ZIWA 2Y69H 3G8QA 1U24A 1N4LA 3QGPA 1F9FA 3S8PA 3FKIJ 1EF4A 2HGNA 1SKSA 2IS4A 2PFDA 2JX2A 4DUYJ 3HP6A 2NXNB 1X4HA 1K9MT 3PZPA 4C48A 4LJZF 1VQMI 3AJ2A 4P75A 2A61A 3CJRB 1DHMA 1YJWS 5B0DA 3CO9A 1TNTA 3M07A 5EGOA 3QOPA 1M5SA 4H4OB 4WP8A 4ZN1A 1LEBA 5ICEA 4UZCA 4Q5SF 1LNQA 5GP9A 4EWTA 1R8PA 5M2PA 2O9LA 3KJVB 3PFOA 5KFJA 3S17J 2XSJB 2XZDB 3OL8A 2HZVA 2L08A 3HRUA 2PI0A 3ZC4A 1PO6A 3NCQA 2WB1N 5D3GA 4M8LA 2GHWA 4PZVA 5B09A 2C2EA 3ZMZA 2L41A 3U7JA 1RT2A 1X4PA 1DLOA 1C0WA 4KICA 3Q24A 1LFBA 4G8XA 2K7JA 2DXIA 3M1VB 5DZ6A 2NS0A 3CC7I 3L2WA 2JA7J 4ZCLA 2D45A 1P9YA 1HBXG 4E7IA 3R5AA 4IVNA 4HYEA 2M5YA 3C7JA 1IM6A 6FD1A 5K14A 1RXOB 3BP8A 5D4LA 3FWEA 5G0RA 2WRMA 1JB0C 2VPWB 3MCNA 3M9OB 2F4IA 5B7WA 5BOXA 5I42B 2HQFA 3KK1A 1Y3KA 1FRMA 1WACA 3LQQA 2BOAA 3W7BA 1YRNB 2NR0A 2HWHA 3OYIA 2V4JA 2YKPA 4LSZB 1XPXA 2BW7A 2R5YB 2VKHA 1WSVA 1JLEB 1UWBB 5E20A 5EG0B 1Q1KA 1QNTA 5GAHJ 4I6YA 4QYRA 5A8KB 5FLXY 3NCRA 4A8QA 2M1BA 2Z2SB 2C42A 4FVMA 4S04A 3J81U 1J09A 1LQ1A 1YSJA 3D6TB 2Z33A 3BKFA 2B3TB 5IT9Z 1E0EA 3O2IA 5L46A 4DPXA 1OYYA 2KMUA 1FBUA 3H0GJ 4WYLA 3MM9B 1U02A 2RD5C 5BYSA 1HBMB 3D9BA 3UE2A 1FYKA 3V81B 2UVVA 1LXNA 4M1KA 1TW2A 4MMOA 2O5RA 4DL5A 5D0GA 3M8SA 4A6EA 1QSYA 3CB4A 4OJ3A 4KFBA 1RTHA 2UXCF 4O4RA 3U02A 5D8KB 3IGNA 2VL1A 5D4NA 4GKJJ 1CC7A 3KUEA 3GUDA 3HHLB 2BHZA 2H6CA 1Q8KA 4N4NB 3PIOF 2GJFA 3CJ0A 4KH1B 1KLMA 2BZTA 5CVUA 2EW9A 2IRXA 1UHSA 3TP3A 4TLQA 2Z9OA 4HQEA 3A1YA 1CS4B 5K20B 2ACYA 1EKEA 4OIPF 2RE1A 5KT6A 2M45A 4QWQA 1U9OA 1A6QA 1AZSB 1JUSA 3DLJA 5LRSA 3GG1A 2CGPA 2PMZN 3N6LA 5H9EJ 2LG4A 1RWKB 2VUGA 3G86A 1JT0A 1JJ2R 1HBUA 3QAEA 3K0LA 1V3SA 5LHGA 2XMJA 3AA9A 2Y0SD 3PIPQ 4NOHA 4FS2A 4LF6J 4CCNA 5T14A 1K0TA 4YDXA 3K5PA 1B70B 3OYNA 2AT1B 2RQPA 3U1NA 2ZZMA 1V3RA 3F73A 2LVSA 5G0RB 3HOSA 1RP5A 4A3CJ 1WKLA 2YQ0A 2QGUA 1FD8A 1WZ2A 4RW7B 1HDPA 1UEKA 3MEGB 2BY0A 4RAFA 3D68A 4YN3B 1X3UA 3CF2A 2B4PA 3NNAA 1H6KX 4NCGA 1H98A 5F6FA 1WEYA 4CTAA 3C6TA 2IMOA 4M5NA 3M2VA 1WWXA 1UWBA 5KFUA 3RRHA 1LKZA 1WH5A 2XYPB 1NNDA 4IKAA 2AJQA 1ZPVA 1D5VA 1BR1A 1MROA 2WAQA 1W1WE 4WIQA 1JX4A 3CCSI 4PUOB 2V1DA 3G82B 4GDFA 3M2UB 4X4VA 3I32A 3BSNA 3FSYA 1F1ZA 3QRPA 4ED2A 2OHDA 4AM3A 3M6WA 5IP6A 1DQ9A 3POTA 4ZJQA 3F8MA 2BBYA 4ZLJA 3ERMA 4UTGA 4Y52J 5J2PB 2FMYA 4EBEA 1ZN2A 1HBMA 2XYGB 3GYXB 4BNCA 1I39A 3HSRA 1HW9A 2DNGA 2HHTA 1FVSA 3CJRA 1U0HB 3I9V9 1Z1DA 3HDSA 1SFKA 1UETA 3GTOJ 1FX7A 1GT0C 1RTHB 5BPIA 5K5MA 4BXXJ 1EH7A 1CG2A 1JQGA 2OD5A 1N6QB 1SEUA 3KETA 4L9VA 4U96A 4LOCA 1FFWB 2VBYA 3OOPA 2ZE2B 4W97A 5KT5A 2RSQA 3GILA 1HWUA 1GXUA 4NYPA 4Y2CA 2IVMA 1YJNI 1SL0A 1KLMB 1JTXA 2AJ1A 2XSJA 1WVRA 2DBBA 3I53A 3A3OB 4PJJA 3TA2A 1RT4A 1S1XB 3AOCA 4KQZA 5LHIA 3RBXA 3ENWA 5AXKA 5HJXA 1WHWA 1PIEA 4RS8A 2HLTA 5AE1A 3GZ7A 2D9PA 2VQFJ 2KTQA 4W98A 3K70C 2LC2A 2C3MA 4F04B 2AP6A 1J7KA 4ZVQB 1JGSA 2WB4A 2M52A 2L3DA 2I8EA 2YU9J 2BY2A 3R3TA 3ITHB 3W5XA 1HBUB 2C22A 3MM7B 4IZZA 1X4AA 1FK9B 1X7VA 2CJKA 5IYDJ 4QQBA 2DMTA 1VIXA 4KITB 4IOBA 1BC8C 5IV3A 2HI3A 4XIDA 3FSIA 1RAAB 1Y56A 4BDPA 4ENKA 4N9IA 3GP9A 4FXVA 4LFAJ 3IBCB 3DTKA 4UOFA 1F9EB 1VJQA 1J5OB 3EUAA 2XYHB 3GYGA 1XDSA 2EFPA 2MZ1A 2L4AA 3MURP 3MUVP 2FGCA 1M5VC 2IPQX 3TO9A 2I38A 2BJDA 2XUBA 3OYEA 4U7CA 5GMEA 3BC8A 1S49A 1FKAF 3CZ6A 1QY7A 5E33A 3GO5A 5J1UA 2E1CA 2LBFA 4W92B 3KXDA 2OU2A 4G12A 2ZBCA 1B8IB 2HSEB 2J5AA 2HEKA 1KP6A 2QSFX 2HGMA 1YO5C 3BN7A 5DM7F 4RWXA 1XMOJ 3CP8A 3U1KA 2BOPA 4K0KJ 3PRBA 2JQ7A 1TKXA 1K83J 1L3UA 4JI4F 2MHNA 2LTPA 4FYYB 4EYHB 1KU7A 1LPQA 1LWFB 2AMCB 4JI8F 3JYTB 3N97A 4XKBA 4KH0B 1FVQA 2OTJI 2QKMB 4RPFA 4WU3A 2YKQA 1BC6A 3LSKA 2ZFWA 1TKTA 4Y15A 4UF4A 3RB6A 2K3IA 2DNYA 1TFYA 2R7VA 4DYQA 2COMA 4M3FA 4WTOB 5CD4A 3M4OJ 1RWPB 3SFIA 3GIJA 3GB0A 5LMUJ 3L09A 3FQKA 2LEAA 3DU6A 1BQXA 2B43A 4OI6A 1HW1A 3MN2A 1H74A 1FTTA 2R92J 5LGUA 1FRHA 5MAOA 1RHUB 3HPOA 1ACIA 2ZM6J 2K40A 1RWNB 1YJVA 2C28A 1A9NB 4AIHA 3MR5A 4NA3A 4MJKA 2V6EA 4ES2A 3V42A 1QZEA 1IVZA 4ZC3A 2EFNA 1HD0A 2DR5A 4YQWA 2NZ4A 1S29A 3M1EA 2VHGA 4CIOA 1S7AA 1KTVA 2CW8A 2Z2MA 2D1VA 2CQ7A 4F50A 5IM0A 3UD5A 3IP0A 3KLFB 3HCXA 3FXJA 3PQJA 3GSDA 1OYWA 1TWCJ 5B0GA 3DRSB 4HNUA 2LY2A 2FDNA 1WG4A 2WSCC 1YBAA 4EJUA 1NJZA 4DL7A 2BVMA 2DA4A 5H6QA 1SAUA 2X6OA 1Z67A 2YVSA 5LBQA 1UHMA 4DUTA 3CGIA 2AEJA 3Q2SC 3K2ZA 3I0RB 2LU1A 3SCIE 1RK8A 1WI9A 1SMYF 3N79A 2P7CB 1QRYA 4LSNB 4YOEA 3ABLH 3D5MA 1DTQA 1WC4A 2R2TA 4ZPBA 4YEJA 3GV7B 2K2PA 5J1NA 1S6QA 4LUBA 3BTLA 2NNNA 1K1SA 4K2XA 1L3LA 4NC8A 4BC7A 5IY5H 1QUVA 3WDOA 1PG5B 1HMVA 3V8LA 4B3RJ 2GQ2A 1FNNA 5DDOC 2GV1A 1S6OA 3CCQI 5HAOA 2BY1A 4RBOA 4YP3A 1YTYA 3ZQFA 2VONA 2B9WA 4RDUA 1YJWI 4PUOA 3Q2TC 1TV6A 1FRJA 4ZDLA 3U1DA 2DT5A 3M2UA 2E7XA 3NBPB 1I6XA 1UTAA 2K9MA 3ILOA 2WAFA 1AXQA 3NWSA 2F4VF 5B0FA 3NP5A 2QIFA 1T9YA 4NLPA 2AEMA 1WC0A 1N0UA 4IHTA 3Q8YA 4IG0A 2C6YA 2XO7A 4YFXF 4JV2A 2ZC3A 4A8MP 1IXKA 3NWTA 4BCAA 1VBYA 4JI2J 3TQ1A 3T41A 4HACB 1D9FA 1N48A 3ETOA 4B3OB 4ATNA 5L1KA 2QLFB 4UVAA 2IGMA 4YIRX 2WOMB 3CESA 2DAOA 3AJ1A 2CNNB 1VQLI 5IT9Y 3HI9A 3FRYA 1U1NA 1FA0A 2DGOA 3CCMS 2C2OB 3M8JA 1TZ0A 4ZYHA 1FRKA 4AE5A 4BLGA 5CQEA 4A2UA 3ELKA 2XZTB 3BGOP 3DCFA 2VIXA 3CLQA 1JJ8C 4TU7A 2AO9A 2R5ZA 3H36A 4JI1J 1JKQC 3L7PA 2ID6A 4E6KG 3HD1A 2VQCA 5B0EA 4Z37A 5K8MA 2EBIA 2JNJA 2AS5F 1FRXA 3GE9A 1C0TA 3Q8RB 2HFNA 3CDWA 1PCAA 1XJWB 2TRTA 4CCLA 1JT6A 3HPHA 5KFQA 5JXSA 4BQAA 3HHHA 1D0ZA 2F1FA 3H0PA 3QYYA 2LECA 1XGSA 2YXLA 1UEVA 9ATCB 1W0TA 2J76E 2NXUA 1HNWF 2KXHA 3FCWA 4IO1A 3W9JA 2QX0A 2RGVA 4BE0A 3W9IA 3HTUA 4IF4A 3RAXA 1J5OA 4L18B 2K4JA 3M6XA 3CDLA 4XKVA 1KGSA 1S7IA 4ED0A 4I7FB 3QBCA 1X1BA 1URNA 3LTOA 1ZPWX 3MEXA 2HHPA 3T5HA 2EIKH 3D6MB 2KU7A 1LFWA 3DCAA 3DPTA 3CMYA 1WJDA 1Q8LA 2IMWP 1VQ4S 5HN0A 3KTQA 5F3ZA 4GCVA 4MQ9F 3HFVA 2UV8G 2IJNA 4LK1F 4FF3A 2Z4PA 6FDRA 3MZIA 3TX0A 3UR3C 3HSDA 4PPDA 4USUA 3CCEI 1U8SA 4XDDA 4UV8A 5L38A 4HDVA 3OOUA 3CC2I 3CCRS 4ZA1A 1XWLA 2DVIA 3CJ4A 1CBKA 3O5TB 2XV4S 3DFGA 5LGNA 1TELA 4P10A 5D4OA 5AIPA 4GRIA 3RDIA 1X4DA 2XPVA 3BCAA 1REGX 1D9AA 2FRHA 2EBGA 2YWFA 3M8RA 3S6EA 3SYZA 1FIAA 1DBDA 3OUYB 3MOJB 1ZK8A 1MSEC 1B0VA 4WPAA 2WOMA 1XN9A 5D5VB 2AQEA 1UZDA 4B09A 3TDZC 3A0HC 2J7KA 5B5EC 1RWMB 1G2EA 1YIOA 1HKQA 2ZBIA 2LFVA 2DH9A 1FBSA 1VQ8I 4IFVB 2M2BA 2WBRA 3C66A 2KM8C 2KVIA 3UCUP 5ILUA 1S99A 2GIRA 4USTA 1U47A 3L1PA 1CJVA 1GV5A 3LAMA 3ASNH 3AG1H 2E9ZA 4N41A 2HQAA 2DNMA 2V9WA 1TUWA 3E3XA 3EYIA 3Q22A 1O3SA 1S9EA 1IBLJ 4XM3A 1H0MA 4FF2A 2C3UA 5IWAF 4BAYA 3KUHA 2Z3YA 4C8OA 2CFOA 1FJLA 2BJ9A 2DJIA 1A7GE 2G7HA 5E0OA 2E1RA 1IM4A 2AGPA 3CC4S 4LIVA 3PXGa 4LF7F 4L0ZB 4L76A 2AHOB 3DXBA 1VS3A 5CXTA 2PDAA 5DD8A 3Q8PB 2F63A 1KQ9A 1U5TA 3ASOH 4OYZA 2KFNA 3K4JA 1EH8A 2GAHC 2E9RX 3TEGA 1HW5A 4C3IJ 1HPZB 4RUHA 3BG9A 3MZYA 4DNCA 4YHHJ 2P5VA 1KEKA 1LK5A 4JI6F 1SL2A 1VLOA 1VQNS 3G71S 1NJIT 3TO6A 3LPEA 2ZC2A 4K4ZA 1HDDC 5K5QA 3ZMVA 3LMMA 5DLFA 2A6HF 2WTEA 4OFZA 2F5CA 4FX0A 1FIPA 2HMIA 3CD6I 1VZ0A 5A8RB 2VPRA 3GG0A 4F26A 5CKTA 3CMMA 2A3SA 1IBKJ 2DNOA 2OP5A 1BM9A 1ZG1A 4OV1A 4CICA 3MFKA 4LF2A 4EEYA 4CUGA 4NLQA 2W25A 4ON0A 4UY85 3BR0A 5AE2A 1WOOA 1O3RA 2V67A 4AQYJ 2NRAC 3ET6A 3GV5B 3ILIA 2OTLI 2KIQA 3TVYA 2BE5F 4F3OA 1B9MA 2ECBA 2YWGA 3NL0A 1H38A 4KGZB 4A3LJ 2IC3A 2IGOA 3VV2B 2H8WA 2UUAF 4K4UA 3X1LB 2KFDA 2BMBA 1UA0A 1GEHA 1JK9B 2G2ZA 2YSRA 1KC8T 3MTJA 5HMZA 4ENOA 5LRRA 3JSMA 4JUZA 1HBOB 2V6CA 4W1UA 3SBMA 1VQSA 4XK8C 2VXZA 3M7VA 3BDDA 1LW0A 1SKUB 3T1YJ 1SFEA 2H51B 4A0YA 4DSEA 3ZR8X 1PC5A 1BI0A 5B0CA 2C2MB 2E1OA 2P9EA 2CPIA 1BQMA 5DUKA 2VPYB 2DO0A 3H5AA 5DCMB 3GJSB 4IOAQ 3RU0A 2C2RA 1YHQI 1L3VA 3BYRA 4PRFA 2XG8A 5E18F 1Q5YA 2RRBA 2QTWA 3F56A 3HLUA 4MKBA 3NNCA 3H4BA 1YVFA 1Y5NB 3D5SC 4LGWA 1X0FA 2L9SA 1CJUB 2RN7A 4QIVA 3BQYA 3ZQCA 4OJHA 1RYRA 1RAOA 3C2PA 2OAZA 3BGRB 1PBAA 1J2XA 2RDIA 1D0XA 2MG4A 4M73A 2VT2A 3PO2J 3T5JA 1X1CA 2CZ9A 2E9TA 3D6FB 2EKYA 1MIJA 4MT1A 3BTCA 2CV2A 2DRBA 4QIWN 3L7OA 2L9DA 2FPHX 1UKUA 3WTSC 1HKSA 3IO1A 3SSRA 3I4NJ 1TL7A 3G8TA 2B56A 2F8EX 1XG1A 3P4UB 2M0MA 3BKTA 3GFMA 3MI7X 3HKWA 3Q9SA 3H2LA 4ZYDA 3MCMA 2QLBB 2PMHA 4KJZA 4RB0A 3NGUA 1FWKA 3QJLA 1HI0P 1HCRA 4BHCA 1YBTA 2RKIB 4A3FJ 3TOBA 3CUNA 3UD4P 1TQPA 3J7AO 1G59A 4B02A 2DPIA 2ZBPA 3C1DA 3BM7A 1WGXA 2EFWA 3DDIA 2HVHA 4PWUA 1QHHD 4FE7A 5GPAA 4HHHA 3S1RJ 1PJRA 5F9NA 4DU7A 3B78A 9RUBA 2HHWA 2Z8QA 2DMNA 2CUEA 3D67A 4DUZF 1U09A 1MGTA 3DTIA 1V54H 3IH3A 3KLHB 1APSA 2XMKA 5EX3A 1PC4A 1IWAA 3D0GE 2ZJQQ 4BQQA 1FEXA 1X4OA 3JSBA 2G1DA 3TAQA 4Y00A 3O2PE 3MCZA 1LW2A 2YNIA 2B9SA 4OYXA 4U8YA 1H9GA 2NOJB 3CJ8A 4ZPAA 4C9YA 1CULA 1XMBA 3FUYA 1R00A 2A05A 4XOPA 1I1GA 4ANEA 1IDYA 4FNHA 1S6PA 2OH2A 3VYSB 4UUSB 4YFUA 1JLFA 2KPMA 1SJRA 5KG5A 4C3KA 2MJNA 3B4DA 2QSFA 1FOWA 2IA0A 3MM6B 2CQXA 4HT5A 1D1AA 3DQVC 1ON1A 1WJCA 4XORA 1NBEB 2HFZA 4M74A 3KFWX 3TO7A 2XMWA 4ZVTB 4O0IA 4ECVA 2VC0A 2FMLA 3WQPA 4QTRA 2OSQA 2I10A 3QP6A 2RB7A 2Z2LA 4NCGB 2Y0BB 3PIPF 1OO0B 1U5TB 1SD6A 3ISZA 1WSUA 2P8IA 3IS9B 3PYFA 3T19A 1X2NA 5GAGU 2R7SA 4R8HA 1GDTA 3RB0A 3IWNC 1EHWA 5JHFA 3CDHA 4FKXA 3W64A 3NOGA 3MF5A 2W4PA 1NK5A 1IBMJ 2QBYA 2LQ5A 2HYFA 1D0YA 4RMNA 3BZQA 1P2FA 4ED5A 2VJJA 4R5PB 3HRSA 4CXFA 2LMIA 4NXMF 5L1LA 2RU9A 5LSOA 3LSTA 3JQKA 2FX0A 3G87A 4LF5J 5M5WJ 5A2QK 4I7HA 3BF4A 4MTEA 3C3WA 5KFYA 4R0JA 2YQ3A 4OZ0A 3UI3A 3LNQA 4LIRA 2HIYA 2LKSA 2GOXB 1QLNA 4NEZA 4BU2A 3V7RA 2WHOA 1N78A 5ED4A 3OFEA 2CWKA 5HS8A 1MBJA 1VJWA 2E44A 4HEA9 1L3KA 4I68A 3SV4A 2FVRA 4YY3J 5M3FJ 4UT4A 4KA4A 1RESA 3SQOP 3D1HA 4O3OA 4JV5F 1EV7A 3WC2A 2VN2A 3AFHA 2Q6CA 4DX8H 3GFYA 4L3NA 4CYUA 4YB6A 2QRRA 2Z16A 3KX2A 2PA8D 1U8RA 4URGA 5E3MA 3V4IB 3PG9A 4BBSJ 5F3TA 3HBLA 1RWWB 1RT4B 1BHNA 4KAIA 2RILA 4NMLA 5FLMJ 3ETMA 1ZZNA 1NK0A 2EFGA 3T3FA 4DS5A 5ILVA 2G9WA 4NLGA 4KHRA 3FK7A 3DOLB 2OJED 2XGDA 1R6VA 2ZH2A 3PJWA 4Y2MA 5FIIA 3HO1A 4MTPA 4F4XA 2X48A 3PNVA 4K4WA 2EZKA 2QA2A 5IT9K 2UU9J 3CCZA 2DA1A 1S59A 4EMDA 4O0NA 2F5VA 4AFFA 1BMQB 1TL3B 2AW0A 3M8ZA 1ETOA 3KPHA 1X4GA 4KKOA 3ZQIA 4CLUA 1S4EA 5HVQC 3FNNA 4I0WA 2DA2A 3C16B 1OCPA 5F0HA 4RW9B 2QFJA 3FZBA 4B9SA 1JUPA 1OQYA 1P27B 1FYLA 5LGTA 3VVUA 4AYBA 2HDWA 1N33J 4Q5VA 3M8WA 3QYEA 4P9UA 2DFEA 3OTCA 1KZHA 4CH1A 3OFGA 4Y0FA 3BGRA 2DDBA 2XPWA 1XSDA 2LF7A 4ZIVA 4ES1A 4DV3J 2HU9A 1XNQJ 2M87A 4EYIB 2E1NA 1JXSA 5CZXA 3R6GB 4FF1A 2HHVA 1U1OA 2P6SA 4HF1A 2JVRA 3GLLA 4DR4J 3S3MA 4HT7A 3BG3A 5D77A 3HHDA 1JKOC 5EX0A 1DURA 1X9MA 1VC5A 3QPHA 1VLYA 4OV6A 1V3FA 3DLGA 4KTQA 2E34A 1R71A 2BKNA 4IG3A 3M9NB 2ZVSA 1NKCA 4Q48A 1TTYA 1RKWA 1RT6A 1CEZA 2XIGA 3OR2C 3MAQA 5J2MA 2RQMA 1UW9A 5E2QA 4LF9J 4A5MA 3M8PB 2BJ8A 5BXIA 4MYTA 1H8AC 4HX4A 1K6OA 1KBRA 4LVOP 4H0EA 5EEGA 4XLNF 3A2KA 3GMGA 5H6RA 4CYCB 3U27A 5SUHA 1BOAA 3IH4A 4WFXA 2X6XA 4WU2A 4K4YA 3X2QH 2E5ZA 1NHUA 5FLXZ 2WONA 3THVA 3O3KA 1NKBA 1TVRA 4ZLLA 3ECHA 1ZHFA 1F9HA 4KT6A 2LRDA 2COBA 4CWBA 3J7YJ 2I0XA 1POGA 2LK2A 2MD0A 2PIIA 2IAIA 3OLAA 1NK6A 3R0JA 3MOZA 3L2CA 4IRIA 1RZMA 1LNWA 2LQ9A 3C14A 4U7DA 3F0NA 2MY8A 1AFIA 2QQAA 4IXAA 4HSTA 3R7NB 2IJFA 3TX8A 5KT7A 4L0YB 3EPZA 2N82B 4JI7F 3J81Z 2P8TA 2XGXA 3CD5A 3QFHA 4UUVA 3GFLA 1YX2A 3KWMA 2OZUA 1KU3A 1K61A 3JRBA 1JKHB 2FZGB 4N8NA 2XMUA 3BR8A 3CCTA 5E41A 3V4GA 2EEYA 4LRAA 2AX1A 1NDLA 1OCZH 1VFCA 4EJOA 2CPXA 1JJCB 3M30A 3P8BB 1M5OC 1HYSB 4DN9A 3K4CA 3BQ0A 4UOCA 3IL2A 3QIPB 2V79A 3MM5A 2IVFB 3QT5A 4AIJA 3QWUA 2MHEA 4P2XA 1K78A 2ZJPQ 5BPDA 2IVYA 3T1HF 4HAMA 4RX6A 2JRSA 1NZAA 5GAEI 5AXNA 2ZBKA 2BGCA 3GTJJ 3DDNA 2DNHA 4WE1B 1S6QB 2OPRA 4J90A 4LR8A 3KHGA 4PK4A 1QJHA 2R3VA 4DR3J 2F5EA 4OZ1A 4PABA 1VGYA 2OD6A 1HMVB 2O1PA 4PXCA 3OTOF 1TR0A 1S97A 2EVZA 2CQDA 3FXRA 3BSOA 5AIQA 4CO0A 3OVAA 3NXZA 1XX5A 3TBIA 4NYZA 4A3DJ 2VBZA 1TKDA 3VYUB 1R0CB 4O4GB 4PZJA 1QVTA 3NS7B 1EJ9A 1RCOB 1MN9A 3I0TA 1MH4A 3FXQA 3DFEA 4DQSA 2EFVA 2N3OA 1S1UA 2QSWA 3ECOA 1MNEA 1SH2A 1DU0A 3R5DA 3DHXA 2QYCA 2STTA 2RS8A 1NDKA 2VKRA 4ECSA 4LF9F 3MM9A 5SZTA 1YZ7A 4MFEA 2VQHA 2FA5A 2HFOA 4ANDA 2K9LA 3EQLF 4P1WA 4XIUA 2XTJP 3MD2A 5K1YA 3DGPB 1UFMA 1TLHB 4FTHA 1E6YA 3KUGA 3HSZA 3P5TL 4QIWD 4KIGA 3FX3A 1JLBA 3P5JA 2P5LC 3IM8A 2HKEA 3FZVA 3WODF 1YZ6A 3BROA 1ZA2B 3UFCX 3ZZRA 5E1ZB 3HGYA 4KISA 1B1BA 4Y17A 4YRVA 3JCUC 2NXNA 1IR1A 3EWGA 5FD6A 3H0DA 5FB2A 2VKZG 5L1IA 4LIUA 3T1HJ 2RMLA 3SEQA 3TEDA 3BQZA 1YBUA 1CVJA 1RA7A 2LXIA 4LG0B 2H27A 3QO9B 1NDPA 4E7KA 5IWAJ 3ABTA 3CNQP 1N33F 3RB3A 5HSPA 4NLRA 2GGPA 2XZWA 2DEIA 4LVNP 3H3ZA 1ODDA 4RNMA 2TCTA 2KB2A 1N5SA 1SQEA 1XTAA 2JEFA 4RLQA 1X4EA 3NMRA 3B73A 4CLKA 3C16A 3M30B 3RCOA 2EIJH 3S2HJ 5HNHA 2JPCA 1Q7LB 3CEDA 3W61A 4JI5J 4KHPJ 1NHAA 1IXSB 2VT3A 2YKOA 4G9YA 4LBIA 5DQGA 4FBTA 3W2WA 1IG7A 4O23A 4LK0F 4I67A 4WE1A 4CO2A 2FSWA 3MR6A 1VQ8S 1XIQA 4WKRA 3G6ES 3J81K 2LH9A 1FBQA 3Q8QB 4IOCQ 1UEUA 4Y2AA 3M2VB 1VCTA 4YELA 3HRTA 2OIHA 5HS9A 1S1WB 2HG4A 2G2OA 3FBNB 4CLTA 1MNMC 1KVJA 2A5WA 2QLZA 4MFBB 2P5KA 1O8BA 4IH5A 1K73T 2F4OB 4YY3F 2BW2A 4IYQA 2M9HA 4X6AJ 4O4GA 2QQBA 3OTEA 3IAS9 1FWPA 2L9WA 4ZZLA 1B0TA 1IKYB 2XLIA 1ITYA 4FETA 2FVSA 2JSCA 2H4WB 4ILMA 4DFKA 3ZFVA 3QJJA 5J2PA 3IH2A 3L95X 1AUDA 2B0GA 4D5CA 2K1RA 5F8GA 1FWZA 5D6FA 3I4MJ 3PSIA 1U0HA 3KLNA 3L00A 3BJAA 3ML6A 3OR2A 4CYCA 4C8MA 4X66J 4CLWA 2ZFHA 2DKOB 1NK7A 4PKDB 3LQRA 4DCOB 3PW0A 5L3FA 4QIEA 4NXNF 1AROP 2XSDC 5KFOA 1U26A 3GR1A 3H7HB 1UG2A 1N6QA 2FGOA 1JLCB 4CCKA 2F5DA 3O8WA 3P49B 5KG3A 2CS3A 1UWAA 5KOWA 3OL9A 3VAHA 3GMEA 3K1PA 4AVPA 2OA4A 4BJTA 2CPEA 4GKKF 2HDDA 4F8RA 1A5JA 4HF2A 3HIFA 5IXUA 1P4WA 4HOBA 2VE9A 5FRMA 3K8WA 2W9CA 3OIOA 4CSWA 4OX6A 2GA1A 4L9JA 1OYEA 2Y1RI 1USSA 4LG0A 4F4ZA 1DP3A 3JTGA 1GMWA 2DITA 3QLHA 1LDDA 2UUCF 4CT8A 4XRSA 3KLOA 2XVCA 4NI2A 1RAGB 3G4SS 4L75A 2PMUA 2GZOA 4ECXA 3QATA 3NWRA 4ZN3A 2V69A 3IMQJ 3ITHA 4KMFA 2IEKA 1HYSA 2HNDB 3AAWB 3OY9A 3HX9A 4EBDA 3QIPA 3Q89A 4JBCA 4I2QB 2Y9YA 3HUGA 1MLAA 4RU9A 4JOMA 2DT6A 2RF2A 4FE4A 1GXTA 2CYYA 3AOBA 4ITSA 2V8HA 1T05B 3PTWA 1TP7A 2Y9HA 1JUMA 4KV8B 3G2BA 1PAUB 2DY9A 1FMWA 1VIOA 1RABB 4N5SA 1NB2A 3DPLC 3FVYA 1VQ9S 4LITA 1BI3A 3EJMA 1HF0A 3F3XA 4U0VA 2EI5A 4Q43A 1OCOH 2J5PA 2RC4A 3E3VA 3NARA 1TQLA 2XBPA 4R8UB 2IBOA 2RT3A 2B0LA 1SJQA 3O1LA 2XM3A 3WC0A 3TOAA 1FJEB 1A35A 2K9QA 2XAUA 1N5TA 2AEFA 2Z1DA 4EGYA 2FEZA 4EZ9A 5ICFA 4BHBA 3WTZA 1P1LA 4MFBA