1I1GA

Crystal structure of the lrp-like transcriptional regulator from the archaeon pyrococcus furiosus
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
140
structure length
140
Chain Sequence
IDERDKIILEILEKDARTPFTEIAKKLGISETAVRKRVKALEEKGIIEGYTIKINPKKLGYSLVTITGVDTKPEKLFEVAEKLKEYDFVKELYLSSGDHMIMAVIWAKDGEDLAEIISNKIGKIEGVTKVCPAIILEKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTIONAL REGULATOR LRPA
publication title Crystal structure of the Lrp-like transcriptional regulator from the archaeon Pyrococcus furiosus.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Transcription
total genus 34
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01037 AsnC_trans_reg Lrp/AsnC ligand binding domain
A PF13412 HTH_24 Winged helix-turn-helix DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1i1gA01
3.30.70.920 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1i1gA02
1FBSA 5BMZA 3QAHA 2K27A 3RKWA 5DCFA 3E5QA 2IJLA 2IT0A 3QPHA 4HQEA 4HW0A 2EFOA 2PLYA 1HSJA 3D5LA 5D6FA 1D8JA 4KIBA 1IN4A 3F8CA 5K5QA 5F64A 2G9WA 2OD5A 3GF2A 1OYIA 4M74A 1RZ4A 3RYPA 2P6TA 1XGMA 3ZMTA 1PP8F 2ZJ2A 5HDNA 1SFXA 1ON1A 4KMUX 4HQMA 1FPQA 1K7AA 1ZREA 1I1SA 3IL2A 1Z6TA 3SQNA 5HLIA 2DW4A 2ZCWA 1ZAOA 2A3SA 3FHZA 4GGGA 2KIMA 2EJRA 3L09A 3QU6A 4RB2C 1KU3A 2F5EA 3TOAA 3ZMDA 2A6HF 1LVAA 4XLPF 2JRTA 5CVVA 4KUMA 4MNUA 3RIRA 1ONVA 5ILVA 2RV8A 1B9NA 1IZ1A 4IJAA 2WTEA 3DPLC 4A0XA 4L9JA 3ML6A 1KYZA 4BH9A 3IRQA 3N97A 4BHBA 2QZ8A 5E18F 3E97A 3MZYA 3V7CA 4HLYA 1U78A 2X4HA 1R58A 4HV6A 1G3WA 3ZN0A 1U8RA 5HVQC 5A2QK 1TW2A 1T38A 5D5UB 5IT3A 3F6OA 3O2PE 3REOA 1ZGAA 3KLOA 4EJVA 5DV5A 1H0MA 1U5TC 1ODDA 2VOOA 4ASNA 5LLQA 3LAJA 3GLXA 4IPAA 3C7JA 1BI0A 5ICCA 4TV7A 3LQRA 4OU0A 1V4RA 3T8TA 3DQVC 4LG0A 1SAXA 4NB5A 1UCRA 5IT9Z 2PMUA 1R1UA 5CJ9A 1A04A 3FMQA 1BIAA 1ZHFA 3SFZA 4IRGA 5LHHA 4HYEA 4I7HA 3TKYA 4M73A 4OOIA 1I27A 4Y15A 3JAMZ 3ISPA 4HAMA 2XGXA 4M6XA 3TOBA 1MJ9A 2ESHA 2NRAC 1YW7A 3DF8A 2ZBCA 3WTSC 1TNSA 2RNJA 2QENA 2HYFA 2E7WA 4WXDA 2J5PA 3IRRA 2OU2A 3J7AO 5HLGA 3SZTA 2V79A 1P92A 3DKWA 3IHUA 3KE2A 2QLZA 4HX8A 3M8FA 2EFWA 3BPVA 3KP2A 2A07F 2MC3A 1F5TA 3V8LA 1BJAA 1B1BA 4G9YA 3RI4A 2OAZA 3V8KA 3GFLA 5L3FA 4XSZF 5KK1A 3JSPA 4ZZLA 2YSRA 3DFGA 2FNPA 3TO9A 2XKOA 3MFKA 2QM3A 3T1BA 3MAJA 3P7NA 4LK1F 2CG4A 1XN7A 2FEZA 1OPCA 3I64A 1FNNA 1T0FA 2HTJA 2F5CA 1XSXA 5LEJA 3BY6A 4EMSA 1MZBA 2OZ6A 5L3EA 2MH9A 3B02A 2GXGA 1BBYA 3E5UA 4ZZDA 1BOAA 3LA2A 1Z6RA 1QBJA 5HDGA 1R23A 4OIPF 2A5YB 5E8IA 2HFHA 2DPUA 4YFNF 1WQ2A 4LB6B 5E20A 1FP1D 4HV5A 2XKPA 4HF2A 5HS8A 2CO5A 2DO7A 2CSOA 2V9VA 3WU0A 3I5UA 2O03A 5BPIA 3H3ZA 5E8GA 2K02A 4ENJA 2GA1A 3R0AA 2ZXJA 3AAFA 4O5VA 2DK5A 1QNTA 4ON0A 1CF7B 3HRSA 3VEPA 1XMAA 4ZYGA 4OIRF 3T0YA 2VBXA 3GFIA 4RB3C 4WCGA 5JR3A 3ZN1A 3BZ6A 3F8MA 1AWCA 1PP7U 4WX9A 3K0LA 4U0VA 4FX4A 3I71A 4LG0B 3KFWX 5FB2A 2COMA 2W84A 1S29A 3EYYA 1FZPB 4N9HA 1NHAA 2E7XA 4P5OA 5HS7A 1EH6A 2GWRA 1T39A 3ECHA 2FU4A 1ZRDA 2IPQX 1F1ZA 1UB9A 2JPCA 4PGGA 2ZO4A 2VBWA 1SD7A 3ZMSA 3KP5A 1YTYA 3TDUC 4RAYA 1SD6A 5LGUA 2EA4A 5D6EA 5AIPA 1RNLA 2W25A 2DQLA 1FX7A 3FXRA 2ISYA 5D4SA 1QO0D 4KT5C 4IVNA 3HOTA 3VOEA 2K86A 2L01A 3K69A 1FSHA 3U9GA 3WTUC 2EK5A 3IKTA 1IF1A 1YS7A 5H6RA 4JBAA 3G3ZA 4RAZA 2UXXA 4ENMA 4RGSA 3E6MA 3KETA 1XGNA 2HKXA 5LGTA 2LSOA 2NYXA 2H94A 2DPDA 1BI1A 1ZLKA 4WXHA 3HRUA 1HKTA 2BE5F 2B0LA 3KZYA 1D3YA 3M8EA 1TQMA 1HBXG 3G73A 1QZZA 1U3EM 1SMTA 3FM3A 3BP8A 1AOYA 4L5IA 3CDHA 3HSRA 4CGZA 2PQ8A 1G3TA 4U0WA 5K1YA 1WI9A 3SXYA 4YFXF 1ON2A 3QPTA 2QWWA 5ICFA 1UFMA 2ZFWA 4Y17A 1GHCA 1O3TA 2PI0A 3HYIA 3KP4A 3L00A 3LQQA 3RYRA 4MQ9F 2Y48A 3CUQB 4JQFA 1MD0A 5IT9K 2IP2A 3C3WA 1LEAA 4HA8A 1ZRFA 2C6YA 2LF7A 5E1WA 1PDNC 1O3RA 4MHGA 4L18B 2A6EF 4RGRA 3ZMZA 3TO6A 2YX7A 1IXCA 3JAMK 1UHMA 1XGOA 5LBQA 4PDKA 3L7WA 3COAC 2Z3YA 4EQQA 1FYKA 2IRFG 4EJUA 2IW5A 1CGPA 3LA7A 5F1RA 1YS6A 2XAFA 1Z1DA 1KQ8A 3GFJA 2FF4A 5ICEA 4L5JA 4ZYHA 2O0YA 2H09A 3S2WA 4IRIA 2VBYA 3FXUA 3M1EA 2WV0A 3U2RA 1JHHA 3F8FA 1BC8C 4CDGA 3TQNA 5FD5A 4RB1A 1V3FA 4HLXA 4R8HA 3R60A 2VONA 1YIOA 3BDDA 6PAXA 2RKHA 2VT2A 1KU9A 3GWZA 2DJWA 5H20A 1FOKA 4IRHA 3GVAA 5FLXZ 2OBPA 1O7LA 1KU7A 5LGNA 3DPTA 1T98A 2CQKA 1TQIA 1XGSA 4LLLA 2FE3A 2EA2A 2UXNA 2E1CA 2TDXA 2P5LC 4P9UA 4LLGF 1USTA 4CXFA 5AONA 2QBYB 5F6FA 4B8XA 2O61A 4KIFA 1QQIA 2A69F 1OMIA 4UNOA 1GVJA 3B73A 2BBYA 3E6CC 3HRTA 2FXAA 2G7UA 1JE8A 1CF7A 3ZMUA 4LB5A 5J8CA 2DQRA 1RIOH 5DDGA 5LRSA 4UVBA 1YFHA 1R00A 1XMKA 3K1PA 1FP2A 3WU1B 4CO8A 4EJWA 1B59A 3FM5A 4YIFA 5HOOA 2UZKA 4M9SA 3MEXA 4MTDA 4L0YB 2A68F 4F7ZA 4MQVA 4GYGA 4HBLA 5D4RA 3CLOA 5BOXA 2IA1A 3GXOA 2M30A 2NNYA 2L54A 1XDUA 1LJ9A 3HRMA 4CICA 3CUQC 3M9AA 3ABTA 2KJBA 1FYMA 2HQNA 4DNCA 5LRRA 3ZQ7A 1K78A 2YU3A 2PJPA 4QLCU 2K4JA 1FBQA 2ZNZA 5E1XA 3WGGA 2DBBA 3BOQA 3MQ0A 2EFPA 4LLNA 1KQ0A 2D2WA 2V6CA 3CJNA 1K79A 3E6BA 2Q0OA 1I5ZA 1YG2A 1KYWA 2CVIA 1B9MA 1KU2A 1XSVA 3QP5A 3I0TA 1ZRCA 3GUDA 2ACJA 4P55A 3SHFA 1O7FA 1ZN2A 1IN7A 2RN7A 2KKOA 4KMFA 3J80Z 3IWFA 2M45A 2OA4A 2QYOA 1G6NA 1R22A 2PBIA 4L0ZB 2FQ3A 3F3XA 2GQQA 2IVMA 5E1ZB 1FYLA 2J5OA 2BGCA 4AIHA 2D1HA 4R1HA 3I53A 5J6XA 3Q5FA 1IRGA 2Z4PA 4IF4A 1R5GA 4UHTA 2HQRA 3R4KA 5CVJA 2RQPA 3VODA 3FX3A 3HSEA 3IKVA 4E70A 4OMZA 3GYHX 4Y13A 1S6LA 1EV7A 1WRJA 1HW1A 1L0OC 1G4DA 5CLSA 4I0AA 3BWGA 4NQWA 1SMYF 1FBUA 2W85A 2VC1A 2HS5A 4ZH4F 5KVRA 2W24A 3RKXA 1J59A 1XB4A 1Q1HA 3KEQA 4MTEA 2JSXA 4AVPA 4A6DA 4YG2F 1WWXA 1TTYA 1S7OA 1DUXC 1LB2A 3CUQA 5FD6A 3KLNA 1XD7A 2BEOA 5EEHA 4ETSA 4M9XA 5L3BA 4QWQA 3JTGA 4XBFA 1XCBA 4XRFA 1R36A 4OMYA 4I2OA 3NRVA 4GXOA 4ENKA 1F4KA 4G6DA 2X0LA 4PGHA 3OOPA 5ILSA 3LAPA 3H3UA 4U88A 1DP7P 4N9IA 4UV9A 2P7VB 2M8EA 1TQPA 3BJ6A 4KA4A 3O6BB 4JK1X 3R6SA 4S04A 1IN8A 2XASA 1YQAA 1DPUA 3V7SA 3KEOA 1PUEE 1XSDA 2MLKA 2KRFA 4HZFA 1G3YA 4WK8F 5FGMA 1BI2A 5JFRA 5L3DA 2MH2A 2NNNA 5D8KB 1P4AA 2STTA 2ADUA 1R1VA 2CYYA 3JTHA 3P9CA 4BNCA 1BIBA 4A2UA 1K78B 1U2WA 2Y0MA 3T8RA 4L9NA 5JVTA 3GZ5A 4KNYA 1GXQA 1TW3A 1FSEA 2LDUA 2EV6A 1RUOA 1EH7A 5FFZA 4YFKF 3BPXA 3KP3A 2QBYA 4IHSA 5E17F 1JXSA 2E1NA 5FLXK 2P5VA 1IAWA 4KN4X 1Z05A 2L3DA 4Q48A 1HKQA 3JSOA 4HX4A 2GIVA 1I1GA 2DAOA 3TDZC 4P9FA 1IXRC 5JHUA 5AIQA 1LDKB 2YPRA 3P9IA 4DQ2A 1LEBA 2XIGA 2FBIA 2VC0A 3E3VA 3K9TA 1HW2A 1IXSB 2AS5F 4ESBA 1STZA 1BM9A 4UUVA 3PFIA 4I02A 5H6QA 1RUNA 3IWZA 3I58A 4UVCA 1P6RA 2Z33A 2MLGA 2P6SA 3HHHA 1WSUA 4XSXF 5DUKA 1H9GA 2E1AA 3E6DA 3ZP5A 3ULQB 1HSTA 4G7ZF 2ISZA 3EUHA 3FF5A 3I59B 4G6QA 2CFXA 3FWEA 4ZYDA 3RPUA 4O6JA 2R7FA 2FMLA 3WG9A 1LNWA 3GW2A 4PZJA 1BC7C 4NHJA 2DLLA 2V1UA 1RI7A 1YLFA 5EEGA 1OR7A 4BHPA 1HQCA 4WWCA 1QPMA 3K1NA 3O3KA 2VOPA 5BS6A 3HTSB 2EV5A 4YIIA 4UV8A 2P7CB 1FC3A 4IXAA 4Z2YA 4HX7A 3C1DA 3BJOA 2L02A 4A5NA 3K2ZA 3HUGA 4KICA 4AIJA 2RC4A 1BN5A 2MD5A 4H0EA 1G3SA 5LHIA 4IHTA 3WODF 3F8BA 3J80K 3VFZA 4CZZA 4MEYF 4MEXF 3V8JA 3KZZA 3NQOA 4BXUA 2BV6A 1FY7A 2M5WA 1MJAA 3I4PA 3P9KA 3WE3A 2HEOA 3FZVA 4AIKA 2FNAA 2PG4A 4ESFA 5DCMA 4A0ZA 2ELHA 3QU3A 4GO1A 3GO5A 3FXQA 5LHGA 2FA5A 3V4GA 3TGNA 3H92A 4ZYEA 1R5HA 5TRDA 2VODA 4HDVA 4G8XA 2XROA 3GX4X 3T5XA 1IRFA 5HS9A 1O3QA 5DD4A 2EFQA 4OINF 5HDKA 4R79A 3DP7A 5FFXA 3F23A 2STWA 2DT5A 2UWMA 1Z9CA 3OV8A 3WTYC 1C0WA 4LMYA 4U0YA 3Q9VA 1TLHB 2PMHA 3WTTC 3KCCA 2XRNA 1TBXA 4HF0A 3J81K 3QRFF 1EH8A 3NEUA 4A6EA 4U7DA 2R3SA 3EETA 2HZTA 1B6AA 3PQKA 5K5OA 4BYYA 2RVCA 1ZG1A 1ZH5A 2L4MA 2ZKZA 2FRHA 4GCVA 1USSA 3W6KB 5K5RA 3C18A 2KJCA 4EVIA 3Q9SA 3HHGA 2QQAA 4I01A 4UVAA 3W6JB 1T6SA 2VT3A 2QQBA 3CO7C 1HXDA 4FT8A 4KFCA 1LDDA 4EM2A 5TJJA 4P96A 3LWFA 2VN2A 4ESJA 1JGSA 2FBHA 1W7PD 4ENNA 2JSCA 4EM0B 2FSWA 2Z5UA 3F6VA 1J0RA 3R0JA 1U6GA 3R61A 2V1DA 1YW8A 3GZ6A 1VTNC 2KIUA 1YO5C 4MGRA 2CW0F 1TNTA 2OQRA 3ERED 3MZHA 3F22A 4HF1A 5CVIA 3WTXC 4HOBA 3U1DA 3HOSA 1DDNA 1IN5A 3D0SA 5CVUA 1ULYA 2A61A 3VB2A 2RDPA 3RTRA 3F8NA 2XAQA 1OYWA 3DV8A 1D8KA 1ZGJA 2LNBA 4Q47A 3ZPLA 1J75A 4CHUA 2GXBA 3JW4A 4U7BA 3F21A 3HTUA 4L9VA 2ZMEA 4KDPA 2R7DA 2QVOA 1D5VA 1P2FA 2D1VA 2EFNA 2ESNA 3K1MA 4M9ZA 1HW5A 4XLNF 2P4WA 3WE2A 1XDSA 2O3FA 2Q8KA 3V7RA 4LJZF 1W7PA 2F5FA 2HDCA 4BAYA 3RDIA 2DI3A 1J7KA 3MWMA 3LSTA 4FX0A 4A0YA 4O3MA 1ZG3A 1UHWA 2MA3A 2CGPA 4HDUA 5L3CA 4EJOA 1Y0UA 1OKRA 4EV0A 1Z7UA 2LKPA 2Q2EA 4S05A 1MKMA 1MDMA 2IA2A 1JHFA 2XAGA 2M1BA 2HGCA 1SFUA 2AXLA 2FOKA 5DCMB 1L3LA 3I59A 4AWXB 2JPBA 2Y75A 4M6YA 2IA0A 3M7GA 5CVRA 1KQ9A 1OYYA 2QUFA 5D5XB 4LD5A 2QQ9A 2GA2A 2NAZA 3EQLF 3GFMA 3PQJA 4LGWA 1P4WA 1U5TA 4Q4ZF 2K7LA 3QOPA 2HKOA 5DUIA 2G7HA 5ERIA 1MGTA 3DEUA 3J81Z 1KGSA 2L4AA 1ZYRF 2W57A 2H6CA 2HR3A 2ETHA 2DFIA 4A12A 2KIFA 2JT1A 5A2QZ 2V1XA 3RKYA 2F5DA 2HTSA 1ZG5A 3WTZA 3LFKA 4AD9A 1IW7F 4GYIA 5J8FA 1R7JA 3EDPA 2Z99A 5ICGA 5DD8A 2FBKA 1W4MA 1S3JA 2GAUA 4EJTA 1W5TA 4LFUA 3WGIA 3L2CA 1SFEA 2XAHA 2PFBA 2YR2A 5D5WB 1BI3A 2YX4A 2WWYA 3WTVC 4B09A 1O3SA 5CYVA 4KYWA 2M87A 3FMSA 3TO7A 2EV0A 2HOEA 5JI6A 1K6OA 4OIQF 4UXNA 5BQTA 1ZARA 3IC7A 3RJPA 4G94A 5FO5A 4N0BA 2XHKA 3ECOA 4K2EA 4L9TA 4LK0F 4CYDA 3KP6A 3F72A 3N4MA 3CO6C 3WGHA 2RGVA 1J2XA 1QGPA 4PCQA 3QP6A 2FMYA 3HIFA 3ABUA 5BPDA 1FWZA 2JTVA 4I09A 1QZYA 1FT9A 3GEZA 1SD4A 3ROUA 2ZMEB 1F9NA 4BQAA 4KN7X 1YW9A 2DU9A 2P5KA 1H9TA 3HSFA 1E17A 4M72A 1HKSA 2D45A 4EM1A 1KA8A 3WTWC 2ZNYA 3ELKA 1E2XA 2JZYA 1W7PB 2OQGA 2BYVE 1W5SA 2VBZA 2HWVA 1GXPA 4Q5SF 1X3UA 1YYVA 1S7AA 1R1TA 1P4XA 1XCVA 5DYMA 3MCZA 1REPC 2O8XA 4WXCA 3KP7A 1ZLJA 4RGUA 4BHCA 2XAJA 4EGYA 2WC2A 2EB7A 3FMRA 2H6BA 5ED4A 5D8LB 3I54A 1B4AA 4RB0A 1S8NA 2DTRA 2DK8A 2PEXA 4EGZA 1MDMB 2CWEA 2LF8A 5DEQA 3RPQA 5ILUA 4D0PA 2H27A 1IN6A 1LDJA 1IUYA 2Z9OA 1T2KA 2VE9A 2OZUA 1J9IA 3CTAA 2F2EA 1SD5A 3SZPA 4RGXA 1Z91A 3ZMVA 4G7HF 1FLIA 3EYIA 3BJAA 3CUOA 4WF2A 2ZBKA 1U5TB 4I0BA 5HLHA 3E5XA 1LQ1A 1J5YA 2K4BA 2HYGD 4OIOF 2VXZA 2NS0A 2XUBA 4KIGA 2O6GE 3LA3A 4I98B 3DXJF 2XVCA 1MJBA 2XV4S 2P8TA 2GZWA 5LEKA 3BROA 2EWNA 3L9FA 1O57A 4A5MA 2VE8A 5D5VB 1I6XA 2PN6A 1WKMA 4G7OF 4M71A 5L3GA 2MBFA 1DPRA 4FHTA 4RS8A
chains in the Genus database with same CATH superfamily
4OLPA 2R8KA 1U0JA 1GMUA 2GW8A 3E01B 1DLOA 3JYTB 2LRDA 4BDPA 1VLOA 2Z30B 2K27A 3M8PA 1VRTB 2VA2A 3FCWA 3J7ZT 1X3ZB 5T7LB 3QPHA 4ED8A 4MIAA 3VWSA 3QT8A 4LF9F 2QSHX 2G13A 1GK8A 3LOCA 3D5LA 3OIOA 2KT5A 2BW3B 1VQ8S 4KIBA 2FHMA 2G9WA 3Q8PB 3PIPF 2GO8A 2DR9A 1RZ4A 1NBEB 5GAHU 1Q1KA 5GADU 1Z3XA 1RT1A 2P6TA 1OYDA 1SFXA 5KG1A 1JQGA 3TARA 2XDVA 1T3NA 3CD6I 1PIEA 3IXQA 3QZ8A 1Q5VA 3KJFB 3NAIA 3IL2A 3S01A 5A0YA 2E5ZA 1JUMA 2VZ9A 1ZAOA 2ZMEC 1IKYA 3L09A 4HI2A 3Q0AA 4PQUB 2JRTA 1CULA 5IWAF 2HURA 4KUMA 4E7ZA 1S5LC 2X6OA 4I6AA 1VQYA 5ILVA 2RV8A 3OTBA 2L7MP 3THTA 2BJ1A 4JYAF 3ML6A 1B0PA 5DG9A 1SC7A 4BH9A 4B3TF 2BVZA 4OHYA 1X4PA 4WFAQ 3AOBA 1X4OA 5E18F 4ES2A 2D3ZA 3QT6A 2MGQA 2XLKA 2IRUA 4OFZA 3CD6S 2KI2A 3E97A 5FD1A 1TU0B 3NGDA 4HLBA 2MG4A 1R58A 3PCOB 1EIYB 2QSFA 2DTJA 4KHRA 1EA3A 3GIRA 3DEEA 3ZN0A 3NCRA 1TW2A 4KHMA 1IKWB 3S6EA 5D5UB 2JA5J 4K4TA 1Y3KA 4OHZA 3HF5A 4R5PB 3R9LA 4RWWA 2BVLA 3IG1A 3NL0A 4DR1F 1KP6A 2XSJC 4TQSA 1NK8A 3OSNA 4ILLA 2YKOA 1X19A 2H9ZA 5F0WA 3IWXA 4FVCA 5IS2A 1U5TC 2WAEA 2QJ3A 4IKAA 4ETXA 3DLAA 4ASNA 1UW9A 3C7JA 1U2RA 3O3LA 2VG7B 5ICCA 3DTIA 1WKKA 2XBPA 4TY9A 3LAKA 5A6WA 3BBFA 1V4RA 1WJCA 3DQVC 1VRQC 4DW6A 2C3MA 1CLFA 1WEYA 3IMQJ 2YQ1A 2OELA 5CJ9A 4RUAA 4Y00A 4ER8A 1HQ2A 3CMYA 2X1AA 1Z0XA 4IR1A 2BW7A 2IDLA 1XNRJ 1VK3A 2HGNA 2MLZA 5LHHA 4CH0S 2ELJA 3CC2I 1T9WA 2EC0A 4I7HA 4BGDA 1VGYA 3TKYA 4XAKA 3IA0A 4OOIA 1EF4A 2A1BA 2Y1IA 3M2UA 4ZITA 4L6V3 3JAMZ 2X1EA 4ZP8A 2PJRA 3ISPA 3ETOA 1NDPA 2XGXA 4GKJF 2OMOA 5JVGF 1ZELA 4M6XA 3DTKA 4JBCA 3TOBA 3JSMB 3GJTB 1MJ9A 3TW0A 2CQ2A 4HH0A 3A01A 2OTLI 3IS9A 2ASYA 2ESHA 3HHLD 1V55H 1VZ0A 1TUGB 3RRKA 1DLOB 3OBIA 4WXDA 3M8PB 4XONA 2OU2A 1JLFA 3V6DA 3MM6A 2AGPA 3KK2A 2RUGA 3TWZA 2V79A 3DKWA 3S3MA 2F63A 3IHUA 5B66C 2V0NA 2M4MA 4WP8A 4XLHA 2JA8J 2G2YA 4N41A 3BR0A 2LG4A 3PW0A 1BJAA 3M8JA 1T03A 1OQ3A 3GYGA 1S12A 3PKMA 4ZS6A 4NLWA 4I64A 3PFOA 2E1RA 3T19A 1RT1B 5DS7A 2GGPA 1IN0A 3CDWA 4ZZLA 1O5JA 1OQYA 3BTLA 4CNYA 3UI3A 2IY5B 2OGUA 4PEOA 2OTLS 3FBCA 4QW8A 2QLFB 3H25A 3NARA 3BKTA 2FVSA 5A0YB 2FEZA 5IT9Y 2GNKA 4XDCA 3ZGKA 4P9SA 3KLIA 3K17A 2J0SD 4EO8A 3FEXB 2H5JB 1IKYB 3OL6A 1UZCA 4W97A 3LP2A 3QIDA 1XSXA 1HQUA 3SCIE 3P5TL 3V42A 1OCZH 1DBDA 4ZK7M 4MO7A 1CULB 2VPRA 2DISA 3AA8A 5JMNA 1NJYA 1XG1A 1LEOA 2HS3A 1WJDA 4ZZDA 1D8YA 1BOAA 2DRBA 2QC3A 3PDNA 3TAMB 2LYVA 1U1KA 2O67A 2WB1A 1R23A 5E79C 2DODA 1R71A 1WQ2A 3CULA 2GVZB 1LPQA 3PJ9A 4P71A 3T3FA 2PA3A 2KRBA 2JEJA 4DX7A 1KLNA 4MK9A 3I5UA 5B0DA 1YHQI 4L5EA 1EQ0A 3THPA 1MBJA 3LSJA 3H0GJ 2K02A 1OCCH 3UN3A 3R0AA 2F1FA 1GQEA 4PUOA 4ON0A 3B82A 2B9EA 4K4WA 1KQKA 2UVWA 1F5AA 3I9V9 1VIOA 5CQGA 2VFTA 2QA4G 1FOWA 3CMES 5KFWA 1FTTA 4GKKJ 2W1BA 2K5CA 2IM0A 1S7IA 3IWNC 3A4CA 2DKOB 1B8IA 2KZZA 5HQLA 4DSFA 3PEHA 3F8MA 2FJXA 1WJ5A 3EPGA 2BQRA 4AUXA 1PG5B 3DDKA 5EDNA 1NK5A 4WX9A 2BVMA 3M6VA 4DPYA 1YHQS 2KFNA 4U0VA 1HHQA 2W7OA 4TYAA 4F92B 2M3DA 4ZJQA 3AD7C 5KT4A 1ZM9A 3TEGA 3SZGA 1MSWD 4N9HA 1P9YA 1NHAA 1UEKA 3EJMA 3PYGA 1WZ2A 2WAQN 1AXQA 1ZRDA 4DUYF 2AYBA 3MPWA 3BSCA 1UB9A 2JPCA 2AYMA 1N34J 3GYXB 4C8OA 4LITA 2CRGA 2VBWA 1YK9A 3W5XA 3ZMSA 2AQ4A 3M2UB 2NPIA 5LGUA 2PX9A 3H20A 4B3SJ 1ZS6A 2PJRB 2Z0GA 5DGBA 1JB0C 3J7YI 2W25A 4QPQA 3UCGA 3VYUB 4QZVB 4LF7F 3A01B 1NH3A 3O6QA 3MR5A 1TAUA 1DQ8A 1SEUA 1LW2A 1MMSA 4K4SA 3ENQA 2HQCA 4DV0J 2FQ4A 1Q78A 2LLZA 1U1QA 1D0EA 3Q22A 3RPUD 3IKTA 2BJ8A 3V6DB 3ULHA 1FRIA 3I9V2 2LA4A 3MM6B 3KK2B 4JBAA 3QGHA 4LFAF 4ILMA 4RAZA 2UXXA 3DC2A 2YH0A 2HNHA 2CQQA 2RU3A 4UQGA 1Y00A 2Y1JA 5LGTA 2LSOA 2N8GA 1OO0B 4DG1A 2NVQJ 1LXJA 1BI1A 3JS9A 1T03B 4WXHA 3PVXA 1Q8LA 3DFEA 5B0AA 3G9CA 3OFEA 2BE5F 2CU7A 2F8HA 2B5JB 3M8EA 2GGPB 2RNGA 1QZZA 1YRTA 1LKXA 1EX8A 1KONA 4KV8A 4F02A 2R4GA 3MFIA 1RETA 3M32A 5DLGA 2LBFA 4DL7A 4V2FA 4L5IA 3GTKJ 4MK8A 1G3TA 1GTHA 4UUWA 2MDAA 4XTTA 3IBCB 2BJ9A 1HD0A 2PD1A 4JV0A 2Y3YA 1ON2A 4B4CA 3ZTSA 4DBRA 3BG7A 3QPTA 3GG0A 3KLIB 2UU9F 4IH7A 4C2UA 2KYXA 3CDBA 4NEYA 2QWWA 4NRUA 3S1TA 3LP2B 4DOZA 1HQUB 1UFMA 1SKRA 1GHCA 3A0HC 1RR7A 5GTIC 4DIQA 1H74A 4M5HA 2FZKB 4I2QA 1IQTA 1SBRA 1RLDA 5A8KA 2Y48A 3H2LA 3HPOA 2X3DA 4R0JA 4JQFA 1MD0A 2OSQA 1X4AA 1JJ8C 1F43A 1S9EA 4K0KJ 3K4BA 2KJVA 4DHVA 2QEXS 2KFZA 1RK8A 5DM6F 1N0VC 4L18B 4DV7F 2F4MB 2AF6A 3OL7A 1XK8A 2NOGA 4DDFA 4Q8FA 1Y10A 2M2BA 1FJCA 3AD9C 4QIVA 4PUOB 3Q8VA 4Y3OA 2XCAA 1UHMA 4MAKA 5LBQA 3COAC 5JLXA 2GBYA 4RUCA 1FYKA 4LIVA 4B1RA 2IW5A 1LE8A 4X62F 1WNEA 1M1EB 2ROPA 3X3UA 1YS6A 3BBBA 2XAFA 1GT8A 4K8RA 2FF4A 4ZKAA 4ZHRB 1XR7A 3OIQA 2O0YA 1B8IB 5L1IA 3S2WA 4PPDA 1H2UX 2G2OA 1N54B 3FXUA 4YR0A 3OD2A 1BC8C 2HDDA 4CDGA 2FGCA 1QAJA 1UG0A 3CTRA 4DCOB 2NLWA 5FD5A 4RB1A 4HLXA 4IOAF 4I6YA 1FJLA 3V4IA 1NJIT 6PAXA 4XN0A 1MNMC 2NZ4A 2VT2A 2OPSB 1CQTA 2R7SA 2R7RA 2DJWA 4BWMA 1FOKA 2K06A 3AG2H 4D5FA 2KT3A 3A3NB 3EVOA 1O7LA 1HNIA 1NK7A 3HSZA 2F3JA 2XTJP 3EGNA 1T98A 3IC1A 1Y0NA 4NPOA 2HWHA 1TQIA 1MBGA 3IM8A 4CRJA 2HHTA 5F8JA 1F36A 2E1CA 4DPXA 2DGVA 4P9UA 1FA0A 2CPHA 2DNLA 2ZZMA 2UVVA 3KHRA 4PAAA 2XB5A 1J2VA 3EPIA 2UUCF 4YS2A 3MKLA 4BEHA 1IBMF 4J9LA 3SI8A 2XGEA 2XMJA 1OMIA 1GVJA 1LW2B 1QD1A 3QAEA 4N8OA 4OYXA 1IJEB 1APSA 2FXAA 3PNTA 2DO0A 2GIQA 4ZOSA 3G96A 4LB5A 2CH0A 3GTJJ 2VKDA 2E36A 5IQQA 2LP0A 4FF3A 2VQGA 1FP2A 3WU1B 1S57A 3K4KA 3D0HE 1FVQA 4OWRB 2AGOA 1RCOB 3S14J 3ZC4A 2HHXA 2UUBJ 4F4XA 1UWBA 3TR5A 4K2XA 3M32B 2LBFB 2QA4I 2VFUA 2W9CA 4CO0A 3GXOA 3CF2A 1U7LA 1SJ4P 2RHQB 2MSSA 3O44A 5AE2A 3M9AA 4Q2MA 2KJBA 2H8RA 1NPRA 4BE2A 2XG8A 5IOYA 1FJ7A 3GSIA 5FLXY 4J9OA 4O44A 4XICA 2YU3A 3WC0A 4DZDA 4DF8A 4I2QB 2ZITA 2DBBA 4DU8A 5KFMA 4LLNA 3R5GA 2D2WA 2RDJA 1L3UA 4NXMJ 2CUYA 3R5BA 3HT3A 1HWKA 5A8KB 1VI7A 3DPUA 2DJIA 4DV6J 1EP4A 3W3CA 4DV5F 1U49A 2AJQA 5T14A 2Y1RI 1B9MA 4HKQA 1GAOA 1S9EB 5K20B 2R8IA 2C28A 3FK7A 2LVSA 4AIDA 5IZHA 1WH7A 2JNJA 4P55A 3WBZA 5GAGI 3VDXA 3SHFA 4LF1A 1HR0J 4Y65A 3KJVA 2MD0A 4IFVA 3J80Z 3ZZOA 1QVUA 2C2EA 2JDJA 2E9ZA 9ATCB 2ADBA 3J7YJ 1G6NA 5FROA 2LQ5A 2W9AA 1PAUB 4NRTA 2FQ3A 2DA2A 3GJQB 1LE8B 4ES3A 2UP1A 4ZJZA 2LMDA 3BO2A 2PSZA 5E3AA 2KH9A 2J5OA 3OJSA 3OIPA 3W9IA 4AIHA 4C8NA 1G2EA 5J6XA 4DPWA 4IF4A 3L7UA 5CVJA 1FXDA 3FX3A 4DGWB 1U9OA 2QKLB 3EE3A 4Y13A 3ITHA 4F04B 4I67A 4WTOB 2EZHA 3KJQB 5D4LA 3V4IB 3LPEA 1FDAA 5E3MA 1L0OC 3BH7B 2IGKA 3WHCA 4UW2A 2VC1A 2HS5A 2DHHA 1T3OA 2W24A 1J59A 4QYZJ 2HNYA 4MTEA 2VDIA 2DOFA 1N36F 4AVPA 1Z2LA 1IRZA 4NL5A 1DUXC 1RAOA 5KFKA 4LG3A 4FNHA 2OMLA 1WF2A 1C0TB 2ILZA 2RS2A 5L3BA 2ZC3A 2IHR1 3OV7A 5HI7A 3V2UC 4BEHB 1MBFA 4XRFA 4I2OA 1IWGA 2EFGA 4GXOA 3C19A 2R8JA 1F4KA 5F9NA 4Y2CA 3FSXA 4XN3A 3QJPA 3FSIA 3OOPA 1RC9A 4I6ZA 3H3UA 1A36A 3DI6B 2IFXA 5E41A 4N9IA 2ME0A 2MGZB 1TQPA 4HRIA 3S15J 3HP6A 3HDDA 4OJHA 4P1WA 3R6SA 4QIWD 3H42A 3AJ1A 3ZTQA 3D67A 4ZPDA 1S6OA 4XKVA 1K6YA 2CQPA 3GIJA 3D1NI 2CJAA 2DFFA 2D41A 2MLKA 4JI1J 1FO1A 3MMYB 1QPIA 1SV5B 1UWBB 3H7HB 4QWAA 1UJ5A 2QYGA 4NLUA 4V2GA 5F41A 2L7KA 1QDUB 1ETQA 2VKZG 3BC8A 2XMAA 4NEZA 2W9CB 3PNYA 1UVLA 1LOUA 7FD1A 4DQSA 3PX6A 4OHXA 3OYHA 5EF6A 4I1TA 2A6OA 5EN1A 5IT0A 2ATCB 5HVGA 1Y3JA 1W2IA 3W8PA 1Q16B 1IJWC 1VQKI 4DFMA 3UNGC 2GX8A 4A2UA 4O44B 2RU9A 1U1RA 3R97A 3T8RA 5IC6B 4IEJA 1P7JA 4M3DA 1RTIB 3R8YA 3AOAA 2KL4A 5DQIA 2EV6A 4EYHB 1EP4B 1EH7A 5FFZA 2VJVA 1U26A 2ZC2A 5M5XJ 3BPXA 1V3ZA 4PXCA 3C2BA 3KP3A 2QBYA 3H9GA 1MMGA 4HR2A 1IG7A 3K4MA 4YEJA 2KDZA 3VCDA 1X4HA 4I0WA 1MMAA 1HWIA 5A2QU 4IO9Q 3X2QH 2AP6A 2RQQA 2Q43A 2GIVA 4HI1A 1I1GA 4E98A 3TDZC 1RAHB 3G82B 1IXRC 2XF6A 5D0GA 4O3RA 5CYQA 1QRYA 2CPFA 3KJVB 4FP9A 1S1UA 3P9IA 4Q44A 1RBLA 5KT7A 1I3OB 1UP1A 5M3MJ 4PYAA 1VQKS 2DTZA 3CLQA 3I96A 1LEBA 4G6VB 5FDLA 5EGOB 3OYIA 3MXHP 1G2HA 2M0GB 3E3VA 1HW2A 4A3GJ 4JI4F 3K5LA 2GIFA 2X1FA 3R5JB 1RT3A 5ETMA 1HWJA 1R8AA 1VQPI 2LVWA 2E66A 4RAGA 3HFZB 3CCRI 1WJ9A 3SV3A 3RB4A 2P6SA 1WSUA 1EARA 5EWFA 1H9GA 2E1AA 4ZTFA 5BNGA 3CJQA 4RL1A 1N25A 5B0EA 4NYZA 1I51B 2CFXA 2C2NA 5KT6A 4UOGA 2HQGA 1D1UA 1NJXA 1RT6A 2OPRB 1GEHA 3TI0A 2FMLA 3RKQA 3BQYA 4IHWA 3JTNA 3BBCA 2C2DA 3F41A 4HG2A 4NHJA 2DLLA 3LANA 3PRBA 4PXBA 1F60B 3HM9A 1WJEA 2PMWA 1RAGB 3LO3A 4HYKA 3T1YJ 3JQJA 3JRIA 2G9OA 4BHPA 4X4PA 3SSQA 1NG6A 1H72C 1VOMA 2HLTA 3CP2A 4DS5A 1TWAJ 2HQAA 3M9NB 1JT6A 1RT4A 3CCRS 1BWVA 2E44A 2C3YA 3NG8A 3P96A 4L72B 3SFGA 2CNKB 1DQAA 3UDLA 1U24A 2DGTA 4U87A 3GP9A 3DXSX 2H54B 4YB5A 4IG0A 2L3MA 2IMWP 2P9EA 3G8SA 4OL8A 2GIRA 2V7FA 2DIVA 4KE5A 1RT2A 5LFAA 3N9UC 3CJ5A 1BN5A 4DV1J 3DN9A 4ID5A 2ROGA 4H0EA 4EI2A 2KVIA 1BW5A 1HLVA 4K2JA 4OZ3A 5GAGJ 4DR5J 3F8BA 5HROA 3VFZA 3HSJA 4CZZA 4MEYF 4FS1A 1J09A 4MEXF 1PBUA 3LMMA 1IM6A 3NQOA 4BXUA 1X5PA 1U8WA 2BV6A 3N5BA 4M1KA 3WE3A 2HEOA 2FNAA 1TV6A 4JI3J 2PG4A 3QAUA 2Q1LA 2IVFB 3HG9A 2ACMA 4LBHA 1WTFA 4KGZB 2WOMB 3KIOA 5F08A 1N5SA 2OPPB 5LHGA 1HKAA 3CJRA 2AV5A 4R25A 1ZZNA 2FA5A 4MKAA 1R5HA 4RM2A 1P6TA 4PK4A 3GPAA 3WIVA 2EIJH 1R0BG 4ECYA 3R27A 3NAHA 4AYBN 4G1QA 4OINF 4QIEA 2XY5A 3BYPA 1IBLF 3L2VA 2QYCA 3PXGa 2RF2A 2SXLA 4HACA 3DP7A 5FFXA 1U1OA 1TK0A 4E7HA 4OZ2A 3K5MA 4XL9A 1XNQF 2BJDA 4U0YA 1U02A 4RW7A 3GTGJ 4YB1P 3WTTC 4DL0C 4OI2A 1B70B 4JI2J 1F2HA 3K4JA 2Y8WA 5CYQB 2XRNA 2AYGA 2XB2D 1TBXA 1S1UB 2AHOB 4LR8A 2HZAA 1VBYA 2V94A 1FJGJ 4IOCF 1XQIA 3JTOA 4A6EA 4U7DA 5FDLB 2KB2A 2F4IA 1FK9B 1Z3YA 1JKHB 1YBTA 2DB1A 3I5BA 1USSA 4ZP7A 1RT3B 4EVIA 3HD1A 3CDIA 3BDEA 4ZCMA 4I01A 4M8LA 2F5GA 1YJUA 2BE2A 2LK2A 4P7VA 3ZZZA 1WGXA 1OWXA 2YY3A 4P96A 3S1QJ 4CZCA 3TVKA 4YRVA 1W7PD 4EM0B 2JVHA 2FSWA 3S8SA 4EBCA 1J0RA 4OX8A 2BY1A 2V1DA 1RKWA 3PSIA 5F0HA 4MGRA 1DRZA 1SH0A 2OQRA 1R6VA 2OIHA 3HI9A 3Q8SB 2J9CA 1TKTA 1RT6B 1YJ7A 2JMWA 3U1DA 2ZH9A 4IG3B 1DDNA 1NMEB 4OJ3A 1ULYA 3CJ3A 3VB2A 1WC0A 2CJ9A 1SPBP 4QYZK 2XM3A 2RDPA 2VQEJ 1K1SA 1VI0A 3BO4A 1S77D 1ZGJA 4BQOA 4TLQA 2LNBA 4Q47A 3ZPLA 3PYDA 4ZVHA 1G59A 3RR8A 3JW4A 3L95X 1BL0A 5IM0A 1IQZA 1RT4B 3F21A 3HTUA 1KVIA 2BE9B 2FDNA 1D5VA 2R2UA 1P2FA 2D1VA 4DZ6A 3PEJA 3IM9A 4IG0B 1ELOA 4UF4A 4NDLA 5KFOA 3QBCA 3OL3A 2HYIB 4IKFA 2ZXWH 1RT2B 1WOOA 4F4ZA 1N32J 5LMUF 1Q1VA 3MWMA 1KKHA 1JIHA 5C25A 4A0YA 1HD1A 3I82A 1LFUP 2GJ2A 3CF5Q 2WB1D 1ZG3A 3FJ2A 1UHWA 2MA3A 5HROB 3HPGA 3K6GA 1OISA 4NLRA 4HDUA 3RW6A 3OVAA 2E9RX 1W0TA 3PM9A 4EV0A 5HANA 1RISA 4S05A 1MKMA 2HNZB 1HHTP 1NM2A 2IXSA 2LU2A 2Q6CA 3OL4A 1L3LA 3IV5A 4KFBA 5L1JA 2O9LA 3RJMB 4A3KJ 9ANTA 2L7FP 2HIQA 1AA7A 5D0EA 3RGIA 3CJRB 2QUFA 4EZ6A 5D5XB 5IT9U 3QODA 1RTZA 2JK3A 3QWLA 5M3FJ 2QSGX 3PQJA 3UN5A 2NXCA 1PYVA 2HKOA 2M7SA 2K7JA 1WD6A 4G1QB 2NS1B 5ERIA 1K83J 3LH2S 4LRAA 1YLXA 2CVEA 2NXJA 1N5YA 3TBIA 3T5KA 2H6CA 1FRMA 2RF2B 3QJJA 2HR3A 2V9PA 4HACB 2R4FA 4DV2J 1RTHA 3LUYA 8ATCB 1Z1ZA 3G1MA 3PUFA 4U7CA 2JT1A 2R7VA 4RW7B 3MTJA 2BOLA 1XERA 3U1KA 1UVNA 1VJQA 2IAJA 2KRRA 3O8GA 1GVDA 5B1BH 1YZ7A 4MYUA 2ZH5A 3LFKA 3KLEA 2ZOFA 3PJXA 5HJXA 2EZIA 5J1NA 3FISA 1IW7F 4AD9A 4ITSA 3EDPA 2O8KA 3MEKA 5CA5A 2PEBA 4AQYJ 5KG2A 3A3PB 3GBGA 4DMZA 2IRYA 5DD8A 3L3CA 3DEWA 4XLFA 1BUXA 3N0VA 3NGKA 3MUTP 5IC4B 1U2CA 4P52A 1GX5A 4EJTA 4F25A 4P2XA 2G0CA 3ASNH 3FKBA 2N82B 1SFEA 3KLGA 2XAHA 3MM5B 4DZPA 2PFBA 4Y2IA 2FLLA 3WTVC 4Q2LA 2CZ4A 3CD0A 1J27A 5EGYA 4TLRA 4DN9A 3AKZA 5ETRA 2M87A 3PZPA 3TO7A 2GHVC 4WJBA 4LFBJ 2E35A 2DFEA 4C3JJ 4JI0J 2HOEA 1U1PA 4FNIA 4A8FA 1UZDA 1RACB 2ZJRQ 1TKTB 1K47A 5DO2A 5EWEA 2PO4A 5KFGA 2Y0SA 2AJ4A 2W9BB 4N0BA 2JUCA 1YJVA 2WONB 1WORA 4L9TA 5M5WJ 4HHUA 3N4MA 2R8HA 3TUZC 2BXZA 4DCJB 3WGHA 4F0HA 1J2XA 2L9VA 1NK0A 3ABUA 2PIIA 2IVYA 5IM0B 2W7NA 2HVEA 2LU1A 1QZYA 1N4LA 2Y9YA 2RREA 2VL8A 2ZH6A 1DAXA 5HLTA 1F9NA 4ZVTB 4KN7X 2P5KA 4UB6C 3V81A 3HSFA 3TA2A 4FVMA 4Q45A 3D1OA 2D45A 1YJ9S 3WTWC 3VGSA 1S9GA 4PABA 1PBAA 3KHGA 5AJ3F 1GTEA 2YXLA 4CTAA 1ZK8A 1MMDA 2W4DA 4F67A 2HMIA 4JV1A 1ZM2A 2HFZA 4A3IJ 2IBDA 1LVKA 4Q5SF 4Y34A 1R1TA 5C25B 3NGRA 3BSNA 1SVLA 5DYMA 3CDEA 2BR0A 2K9SA 3GTPJ 3BKFA 2WC2A 3P5BP 4EATA 2H6BA 2VL1A 1UVIA 2J8AA 4WYWA 4M5KA 4JOMA 4BWJA 1KLMA 1S8NA 2RE1A 2VDHA 2MLYA 1VS3A 4C0HA 3BQZA 2ILYA 2CWEA 4NLGA 5HATA 5ILUA 3RPQA 3HOZJ 2X9DA 2MLXA 2H27A 2L9NA 4M5LA 3LQVA 4KFBB 1RKIA 1Q4RA 1HHSA 5KG4A 4LF5J 4KGKA 2F2EA 2DT9A 1T94A 3G6YA 3BG9A 4FETA 2RMLA 1KTVA 4QTRA 3ERMA 1IDYA 3CUOA 2XO6A 3A03A 1DTTA 2EFVA 4Q5VA 3HX9A 3K89A 3ABLH 1S76D 1SH3A 2K1RA 5I3QA 2PFFB 3RZOJ 2O6GE 1N5YB 4I98B 5FKMA 4P2SA 1RBAA 3G8QA 3AG4H 3I4NJ 2GZWA 1RTHB 3D68A 3L9FA 1VQ7I 3KTQA 2XGQA 1T9UA 1H73A 4FXDA 4TNOA 5D5VB 1JKQC 3TA0A 2PN6A 4MKVA 1C4AA 2IAJB 2E5LJ 2C2MB 1KVJA 2NXNA 1FNMA 2DA4A 4CCMA 2EWHA 4B3AA 3KLEB 4KGXB 4UY8T 5DETA 3GYNA 2YKPA 5D3GA 2H51B 1DHMA 1CVJA 2A05A 4OI1A 4BACA 1BE4A 5DCFA 1VFJA 1U8SA 5IOLA 3E5QA 5HMWA 1HMVA 2ZOMA 3PR5B 3IGNA 5GADI 2KT2A 4HW0A 2ZVIA 3W60A 1R43A 5D6FA 4JI8J 3S1MJ 2W2NP 1D8JA 5K5QA 5F64A 3GZNB 2OD5A 3GF2A 1Y6IA 1JWWA 2IM2A 3BO3A 5A8RA 1QSLA 1SCJB 4FZVA 1FDNA 4CYCA 1VQ7S 4E7IA 2ZSHB 1XGMA 2V2VA 3ZMTA 1PP8F 1SC3B 2AKWB 2CQ4A 3GTQJ 1TWGJ 1XIQA 4KMUX 1W5CC 4ID8A 3CIZA 1FFGB 1TWFJ 2RB7A 3T1HJ 3BTJA 1ZREA 2ABYA 1MSFC 1W36D 1Z6TA 5HLIA 4B9MA 4L3KA 1SQGA 4LF6J 2DW4A 3OYAA 3K70C 2COBA 3CT9A 4GGGA 2EJRA 4RB2C 1KU3A 3POTA 2A6HF 4XLPF 3FSYA 2ALYB 3CP8A 4MNUA 3RIRA 1NRKA 2RH3A 4RLEA 5CD4H 2IEKA 3PHEA 2KZMA 3RTVA 1NPPA 4HTJA 1B9NA 4IJAA 5J1UA 1ETOA 4LBIA 4NLVA 1T08B 3D1QA 1CJTA 2EK6A 3BQ1A 3LSPA 3B4DA 3M7VA 3HOYJ 1N33J 3OSPA 4OX7A 3V81B 4RNOA 2D9PA 4X4OA 1S9GB 4XNFA 3V7CA 3M2RA 1XNRF 4CTAB 2HMIB 5F8IA 1ZR4A 4HV6A 2BEFA 3MMCA 1VRUA 4BS2A 2AEMA 3EZ5A 1E6VA 3FMBA 2FLPA 1T38A 3KK3A 2KFDA 2OAUA 3O2PE 2KXHA 3REOA 1ZGAA 1Y1WJ 1RUSA 1SVDA 2VPXB 3KLOA 3IP0A 1ZETA 2FZGB 4F4AA 2F4FA 1AFJA 4ANJA 3PNIA 2IM3A 5C2CA 3IAM9 4DFKA 1ODDA 2DIUA 4PR6A 5LLQA 2ZJPF 1JKPC 3LAJA 3CDLA 2N7CA 2BE7D 2VF3A 3QYEA 1JLGA 4GO5X 2MC4A 1XC9A 2NVYJ 3TJ9A 4DS4A 1K73T 4IDKA 1HBMA 3T8TA 1SAXA 2P0WA 2M88A 5KG0A 1UCRA 1JGGA 2X6XA 1DTTB 4CT8A 5FLXU 1RAIB 3DRXA 4L76A 4ZDNA 3BSOA 1RXOB 1BGXT 2B9WA 3D5MA 1D9DA 2HBQB 2K3IA 1DGWY 5F8HA 3S2HJ 4M73A 3H2VE 3OPKA 2YQ0A 1QE1A 3SQGA 4Y15A 5TISC 3ELHA 3ZNUA 4HNVA 3D6HB 2AZ1A 5DDOC 1AT1B 4FF4A 5CQEA 1TFYA 1SI9A 4OZJA 1D5YA 2JX2A 4RLQA 2NXNB 1YW7A 1WDTA 3D2WA 3RRHA 2ADCA 3M8WA 1TNSA 5JLWA 3TJAA 2VB6A 4USTA 3J7AO 2CZVC 5RUBA 4ED7A 3SZTA 2QIFA 3ZQLA 4II3A 3UD5A 2FLNA 1HMVB 2CQBA 3DOLA 2CPDA 1JLBA 4URGA 4HX8A 1FD2A 3OFHA 3LSKA 3B78A 3IAM2 4BBYA 1WI3A 4QU7A 4CLKA 2XS7A 2A07F 1JJ6C 2A10A 1D09B 4NLDA 2MC3A 5BYSA 2OC6A 3LAMA 3GTLJ 3V8LA 4NLQA 4MFBA 1HBUA 1FFWB 4G9YA 1ULRA 1ZOTA 2DITA 3V8KA 2CG8A 3VAMA 3MM8A 5EYRA 5A8RB 5K9FA 4CYCB 2DGXA 5KK1A 2JC1A 3A8IA 2YSRA 3UDVA 4BC7A 3KPHA 3DFGA 2FNPA 3TO9A 2WZ1A 2ZBIA 4W1UA 2QM3A 3T1BA 1UKUA 3MAJA 3TAPA 4PWUA 3BDPA 2CG4A 2G1DA 1HLWA 2GXAA 1YBUA 4CO1A 3ILJA 2K9NA 5JXSA 1VQMS 4NXNJ 5D78A 2DNYA 3PIPQ 3PSFA 4E6KG 3HHLA 3VAFA 3I64A 3I56I 2NPFA 4CM0A 2ZWPA 2F5CA 2QGUA 2OEJA 1T9YA 2P9CA 2J6SA 2OTJI 4GKKF 2XNRA 1W1WE 3LGHA 5L3EA 2RNEA 3BN4A 3MGJA 4A8YA 1BBYA 4YIRX 1WKLA 3IN5A 1T8IA 1Z6RA 1RQ0A 1RYSA 2MKKA 1TK5A 5LSRA 2GFFA 3SDEA 4U8VA 2PFDA 3JAMY 5KG3A 4OIPF 1CJTB 4A69C 4YFNF 5E20A 4RX6A 2RD5C 4NWBA 3OYCA 1T8EA 2CO5A 2CSOA 2DO7A 1EKSA 1V5EA 2O5RA 3OLBA 2AT1B 4OMFG 2O03A 1U9NA 1I3QJ 1X58A 1PGZA 2YPYA 5IYCJ 1WF1A 3M2RB 4X4VA 2GA1A 1UELB 3PO3J 1FKOA 2X7IA 1FRJA 4EEFG 3R7NB 4ZYAA 4O5VA 2DK5A 3EUNA 1N34F 4KGVB 2BJ7A 2ICWG 5KFHA 5J2PA 1HDPA 3I56S 1E6VB 3KK3B 3HRSA 4ECZA 1T05A 2E1MB 4B3SF 3VVUA 2M7AA 1SUQA 2OTJS 4FF1A 2JA7J 4Y0FA 5CPRB 4CO4A 5KT2A 4ZYGA 2DNZA 4OIRF 1S6QA 3FXJA 2VBXA 3T0YA 1OQ6A 2CQNA 3HKZD 3HHKA 3HGYA 4F3QA 2HG4A 1IBCB 4DV0F 2IS1A 1JLGB 1F0XA 2AJ1A 5GAHJ 5GADJ 1JJCB 1B64A 3LPYA 1ZM3A 4IDKB 3HVRA 1HBMB 4FX4A 2AD9A 3SXLA 1IR2A 1RB0A 2BY2A 4WFYA 3SBMA 2W84A 1PAEX 1S29A 2LLKA 2MKIA 3DU5A 1FZPB 2XSDC 1QSYA 3PW5A 3TZWA 1WC1A 1T39A 2V9KA 1DY3A 1F1ZA 1I50J 2R7XA 3QPIA 4PGGA 4WZQA 2XNQA 2EH3A 1SD7A 4I99C 1QE1B 3VZIA 3DLJA 3SQGB 2DHXA 2H3EB 4S0MA 3CVKA 2YUSA 3K4LA 1A0OB 5AIPA 1RNLA 2F4VJ 4YHHJ 2DQLA 1KFDA 2VFSA 2CV1A 3H8YA 4KT5C 2WY7Q 2FZCB 3V4MA 3HOTA 2CJBA 2E19A 2VHGA 2L01A 2DH7A 2Y1LB 2AX1A 2EK5A 1MMLA 4AVZA 5LMNJ 2JSPA 3CCEI 2IRXA 2WK4A 5JVGQ 3DOLB 1JLBB 4ENMA 2QTWA 4WPAA 4UZCA 1EETA 3MFHA 4RBVA 3MEGA 1XGNA 2KIQA 2DNGA 1RHQB 2IM1A 1T95A 1NZAA 4MFBB 1HBUB 4K0KF 1ZLKA 4L75A 4XLAA 3HRUA 2DMPA 2MQPA 1HI1A 3MM8B 2B0LA 3KOAA 2JH3A 3KZYA 1D3YA 3L1PA 2WVCA 1TQMA 1HBXG 1NK2P 3BGOP 1SMTA 4IHYA 2IC3A 3DMJA 4CGZA 1S79A 3HHDA 5K1YA 2QMXA 3CC4S 3GFXA 2V4QA 3ZR8X 3DTEA 1FWLA 1ETVA 4XRMA 1LWXA 1VJWA 3HHLB 2I1RA 1P7IA 1KQFB 4CNZA 4PG7A 3JB9k 2RILA 3KUHA 1CJKA 2TRTA 1O3TA 4FXWA 3CCES 4P73A 1L3SA 2DGSA 2VLAA 2F65A 2PI0A 4J7CA 5KFPA 3OFFA 2U1AA 3MMAA 3L00A 3KYCB 3LQQA 3PYFA 3RYRA 4DWIA 3CUQB 2CPEA 1Y7PA 4NC7A 3C3WA 5KFRA 1R8HA 4HA8A 3L4BC 2E1MC 2LF7A 3UWTA 1RR8C 1JUPA 5E1WA 1C0UA 1O3RA 2HFOA 1RWUA 2LXUA 1H2VZ 1FMVA 1UG2A 3ZMZA 1NHKL 3Q2SC 2FVQA 1FKOB 4ZN1A 1NHVA 4KR0B 3UFCX 1FT8A 2B63J 5J2PB 2Y9ZA 1G7CB 3ICLA 4EO6A 2Z3YA 2JLEA 4OX9F 3UD3P 2L08A 1MBEA 2IRFG 4ZDPA 1T05B 3LP1A 2MQMA 1SUQB 1W25A 1CGPA 3LA7A 1IUJA 5K8PA 1JUSA 5KG6A 3HC7A 1M5VC 3T5JA 1S6QB 2I2YA 2VPWB 2ID3A 4OYPA 1FXLA 1IRXA 2H09A 2FB0A 3CCJI 2JN6A 4IRIA 2MPUA 4KQZA 2WBRA 2R5YA 3MOJB 2RRNA 3L9ZA 2Z16A 2WV0A 4E7LA 2Z8QA 3TQNA 4BJ5C 5LT5A 2LD5A 3BDDA 3KMQA 3TZZA 4E7KA 1KU9A 2E29A 2JFKA 3HPHA 2UUAJ 3OYNA 2CNLB 3DNCA 5H20A 4AU7A 4BXFA 1YI2I 2B8QA 3BQ0A 2LA6A 2ZFHA 3DPTA 5GVQA 1YGYA 1RBOB 3AFGA 1XGSA 5B08A 2UUBF 2FE3A 3CJSA 1NDCA 4DSIA 2UXNA 3IRWP 1RPWA 2TDXA 3NNAA 3CCMS 2Z2YB 3S1RJ 3M1VB 4PRFA 2WHOA 2CQ7A 1X1BA 1QU3A 4B8XA 2XF5A 3CCJS 3M9MB 1EZZB 4XKCA 4ZPWR 3B73A 5BXIA 1FNOA 1XR6A 2BBYA 3E6CC 1YRUA 3BR2A 3HRTA 5K8NA 2YNHA 3AXMA 3MD3A 3K7AJ 2XLJA 4ECXA 2E7VA 4MK7A 3K2AA 1CF7A 4NXMF 5A6PA 1EETB 1Y4ZB 1YI2S 1R7IA 4DV6F 2EZLA 1VMBA 3M8RA 3AB4B 1R00A 3MEGB 4B9TA 3M05A 4CO8A 4YQWA 1AUDA 2DNPA 5CZVA 1VISA 3FM5A 4YIFA 3FNNA 3HHLC 4UTGA 5E3RA 1X2NA 4X6AJ 1U0HA 1NJWA 1FTCA 4F7ZA 4MQVA 1UPPA 1BMQB 2Z2MA 4UOFA 2IC3B 3DMJB 1HR0F 3W63A 3AQOA 4ZCKA 1FMWA 2HHVA 4LQ3A 2NNYA 2HEKA 2L54A 1XDUA 3SZ2A 2NVTJ 3CUQC 1S1VA 5DJBA 1QM9A 4RJVA 1MW7A 4DNCA 3C6UA 3SJMA 4ALZA 3ZQ7A 4TY8A 3Q83A 1K78A 1CJKB 4O4RA 4BKXA 2K4JA 1R5ID 1FBQA 2ZNZA 3WGGA 4PFPA 4LIWA 3H5RA 1LFPA 1DQ9A 1K79A 2Q0OA 1QAXA 3N4WA 5M2PA 5K14A 4HL9A 1H7WA 3VWBA 5SZTA 1MNDA 1ZKGA 5F0FA 2JLFA 4KRWA 4NLOA 3NOCA 1ZRCA 2JRSA 3WX4A 2ACJA 1HNVB 1A7GE 4YY3J 4B08A 2KYZA 1IO2A 1FOYA 1IN7A 3HMJG 3D6MB 3KEYA 3U21A 3QSIA 1B3TA 2M45A 2QYOA 3LGMA 3LP1B 3BR5A 2PBIA 1SL1A 2GQQA 2K2PA 2XZWA 3MD1A 2IVMA 5DM6Q 2ZVSA 3TW7A 2K3PA 1AB8A 3L2WA 3PTWA 2HBRB 5ITHA 4R1HA 3Q5FA 3D6TB 1X60A 1R5GA 4UHTA 4XPCA 2HBZB 3S32A 2V50A 3MWBA 2HQRA 3AB2B 3VHQA 2R5YB 1K1QA 3HSEA 1YVFA 4XLEA 3GYHX 1ZZFA 1S6LA 2L48A 1JI8A 4CM2A 2DYRH 3QPSA 3CD7A 2ZH2A 3EUKL 3GTOJ 3K5NA 3HSDA 3FXOA 3BWGA 4C7QA 4KGMA 3R2CJ 3T6JA 1I94J 2W85A 4MIMA 1SJ1A 4XPEA 2QMWA 2OHDA 2CNNB 3NGSA 1NU4A 1GXTA 1Q1HA 3KYLA 2JSXA 2KP6A 3O1LA 1SJ3P 2QL5B 4MLOA 1WWXA 1TTYA 3MKZA 1MSEC 1C1CA 2VG6A 1S7OA 5LJ3Y 3NOGA 4JI1F 1HNWJ 1LB2A 2MQLA 3J81j 4IOAQ 3H0PA 3C6TA 2HI3A 3B8HA 2EIKH 1KEKA 1XD7A 4M9XA 4NCGA 4LBPA 4Z2XA 1NSPA 2J7UA 2R0QC 4I2PB 3KMSA 1ITYA 2WAFA 4ES1A 4O23A 5D15A 1Z77A 3NRVA 4ENKA 3RU0A 4DZJA 2HAFA 3LSGA 2YNHB 3LAPA 4UOCA 2YU9J 3MPUB 1YG0A 3J80Y 5IP7J 3I5AA 1AU7A 5AXMA 2P7VB 2Y0SD 2LKXA 2AO9A 3BJ6A 1TL1A 5GMDA 3AFHA 5GPAA 2V2QA 3ETMA 1DFDA 2C3OA 3S7RA 4M3GA 2L0KA 1UFKA 4FE7A 1FX4A 3WZ0A 2N4CA 1DPUA 2KHDA 3ZXSA 3E2EA 4DV4J 1U0HB 3KEOA 1GXUA 2KRFA 2WCXA 1G3YA 3EDQB 2MFZA 5FGMA 1S1WA 3NRBA 1EB0A 2MH2A 4OYIA 2DR5A 5D4NA 1VHFA 5D8KB 2AHQA 2STTA 3N05A 1TP7A 2ADUA 2DNHA 3DYAB 5HMYA 1R1VA 1WH5A 2L5QA 4K4VA 2W8KA 1X1CA 1SJQA 3C6UB 3FXMA 1NKCA 1FWKA 4J01A 4TY8B 2D5VA 2FVCA 1K78B 1U2WA 1KVKA 2LEAA 1N5QA 2M7BA 1D9FA 4L9NA 1FERA 4A8OA 3GZ5A 5K7HA 1GMWD 4UUSA 4YFUA 2LDUA 4PJJA 4FF2A 4OV1A 2V34A 3KK1A 5K14B 2L7ZA 3CCWA 2VD3A 3NCPA 3BGRA 4M5GA 4YFKF 1X9WA 1WHXA 5L38A 3J81Y 4FYXB 1TL7A 5F0CA 1HBNB 1WHYA 4AYBD 2P5VA 1FHTA 4KN4X 1RWVB 1Z05A 1RU1A 2N7YA 3TUIC 1HKQA 3JSOA 2C2RA 4YR2A 2NQPA 3ZZPA 1K0VA 2KG0A 5J1EA 3R5DA 2ZHBA 5GAEU 1S6UA 4DQ2A 4KTQA 1QLNA 4C2TA 3T1YF 4ZN3A 1WWHA 2BM1A 4NCBA 2O01C 1OLTA 2KMUA 4YR3A 4BQNA 4Y6IA 2XZDB 2B43A 1TTHB 4UUVA 4XRSA 4OZ5A 2V5HG 4ATNA 4PZVA 1RGVA 5H9FJ 4KH0B 2CPIA 2RDIA 4CLLA 3A3OB 4Z6YA 2MXYA 2Z33A 3HHHA 4XSXF 2WBMA 1XN9A 4DR4J 5DUKA 1PO6A 3IR7B 5C44J 2CQDA 5J2MA 3EUHA 4RW4A 5ETOA 4WZMA 3G1OA 3I59B 1RCXB 2BQ3A 2DR8A 3N6NA 4G6QA 4DV1F 5IXUA 3CB4A 1Y1VJ 4Y52J 2GQ2A 1FRLA 5IOZA 4UUTA 3OS2A 1OS5A 2FY1A 2WW4A 1C1CB 2ERRA 2VG6B 2VKEA 3M6UA 3WG9A 4DR5F 4OZNA 1LNWA 1H3DA 3GW2A 2ZZTA 1BR4A 1A9NB 4A3LJ 4PZJA 2ELKA 3UE2A 2V1UA 1TAQA 3C6TB 4RW8A 2TCTA 4GC7A 2E1PA 2Q6BA 2W01A 4NCGB 2V8DA 5EEGA 1OR7A 4JI3F 1HQCA 4WWCA 1LW0A 1H0HB 4BL0B 3BGUA 3ET6A 2MZTA 3O3KA 1R9TJ 4BBSJ 5AT1B 2VOPA 2HK2A 5BS6A 1IC8A 4XR6A 1RWXB 4O3PA 2Z58B 1TMJA 2W82A 3HFKA 3GR1A 4F91B 3JR9A 5D77A 4IXAA 4DQIA 1TT0A 4ABZA 1HNZJ 4HX7A 1V6HA 3BSAA 2L02A 4HT7A 2FY8A 4ZCLA 4DV3J 1QTNB 3CC7S 1YWXA 4WBFA 3K2ZA 1TL1B 2H5EA 1M90T 3AD8C 3HJEA 4J37A 4KICA 4C98A 2CQ1A 5E7OB 1RSCA 4KJIA 1SFOJ 1JK9B 4YMEA 2EKNA 2XMWA 3BCBA 1X9SA 3RB6A 1G3SA 5LHIA 4IHTA 1RA6A 2ZH4A 4ILRA 4RUHA 3KZZA 4JI2F 4EBDA 1S1WB 2OO4A 1MJAA 3FZVA 4JV5J 2QLXA 3BF4A 4CLSA 1FJGF 4HT5A 4DR6J 4BU2A 1O4XA 2HHUA 1EHWA 4ESFA 1TELA 1X4DA 3DRYA 2J9DE 3HVAA 4LREA 4DR3J 3QU3A 1BY9A 1GDTA 5E3CA 1NTCA 1FWPA 2AZ3A 2Y0BB 2XYHB 3H92A 4GMKA 5KFAA 3QMQA 1BR2A 5TRDA 1S72I 4Y33A 2O66A 2M9KA 4ICLB 2AEFA 4UUSB 1X0FA 4B3MJ 1Q81T 3GX4X 3T5XA 1SIWB 5I3UB 2LDIA 2VQFJ 3ZQQA 2ZKUA 4N5SA 1VF9A 1I5OB 1V5FA 1W26A 1F9EB 4ZVOB 1TL7B 3JQMA 4NZ0A 4W90B 2AJ0A 3DLEA 3M6WA 3UR0A 2L41A 2H1KA 1Z9CA 4Y2MA 1CC8A 2UUZA 3MZIA 1X4FA 3Q9VA 1XWLA 1RAAB 4IH5A 1DTQA 1TLHB 4CUGA 5BYQA 5J1EB 1N8RT 1VC6A 2XLIA 3F44A 2FJWA 1YKWA 4CT9A 2LY2A 3Q8RB 9RUBA 3VPRA 4LJMA 3HHNB 1B6AA 1S72S 3F56A 3PQKA 2VQEF 3H9JA 3H5XA 5K5OA 1TKXA 1BA5A 4BYYA 1V5VA 4IOBA 2XYGB 1OCPA 1FOXA 2XO7A 2L4MA 2HHPA 2GM4A 3KDOA 3RB0A 4XKBA 4GCVA 4F4YA 3RZDJ 1UAWA 3Q9SA 2XMMA 1K8AT 2QQAA 4TU9A 3VAJA 1FF2A 4BJTA 1MBHA 1T6SA 2VT3A 2YNIB 1URRA 3MDFA 2D3UA 2ZOGA 3QIPA 2M0CA 3W9JA 2X51A 1HXDA 1YITI 1KHVA 2AJFE 3I0SA 4WIIA 4ZC3A 2OV7A 3L2QA 4ESJA 5J2MB 1JGSA 4RW4B 1UZHA 4ENNA 2IMOA 2JSCA 4FDFA 2Z5UA 3R0JA 1N32F 2A6TA 3GZ6A 2J8SA 2KIUA 3HZJA 2HVSA 3ERED 2B8PA 4GO7X 3F22A 1WCMJ 4IO9F 2J76E 5KFJA 2OD6A 3NNHA 5CVIA 5IP6A 3RG6A 5TGTA 4NLPA 3D0SA 1FCAA 4CLWA 2RRBA 2UXDJ 1KNZA 4C6AA 1N6QA 3CCUI 4XK8C 3F8NA 2DXIA 1HW9A 2XAQA 1OYWA 3DV8A 4K50A 3K57A 3US5A 5KAIC 1LW0B 2K85A 4CHUA 1VQ9I 3UVJA 2IIHA 3ET6B 4DPTA 2E34A 3DHWC 1YITS 2YS9A 3TP2A 2X1GA 1XS9A 3R1HA 3MUVP 4W98A 4J9QA 1B7FA 1HW5A 2UXCJ 1NKEA 2P4WA 1HW8A 3WE2A 3D6FB 5E3NA 2RAEA 1IWAA 1TVRA 4LJZF 3FDSA 1W7PA 3QYYA 5GTHC 3FBNB 4KPCA 4A48A 1MG7A 1S59A 3OYGA 5F8MA 2YVSA 1HIYA 3V5RA 1CQMA 5D4OA 3TVZA 1NXIA 4QPOA 3MM9A 3RBZA 4MIWA 1WHWA 4DV2F 2JLGA 1FRHA 4O3MA 4NMLA 2MZ1A 4C9DA 4CCHA 2RT3A 2LH9A 3CCUS 3AOCA 4CI0B 3CC2S 4E4HA 3HEFA 1Y0UA 2V8HA 2CZ9A 3QWPA 2B7CB 3CUNA 5K8OA 3S1NJ 1VQ9S 2LKPA 2Q2EA 2GJFA 1MDMA 4JI5J 3FVYA 3VSKA 3KUGA 1SFUA 4CO3A 2AXLA 2FOKA 3RR7A 3D5RC 4WU2A 4AWXB 4AQYF 3BN7A 1V9OA 2Y75A 4M6YA 2R2TA 3GFHA 5CVRA 2NUHA 1SKUB 3TJ8A 4LD5A 3DKXA 2NSBA 4RU2A 3HZGA 3DOMA 1HYSA 3C2GA 4RA2A 2COLA 4Q4ZF 3R5CA 2K7LA 3QOPA 4P10A 5DUIA 4JP0A 4DBQA 2G7HA 4XQFA 2RVJA 2W7AA 3MTKA 5KFXA 1KGSA 1S48A 3MI7X 4DFPA 4JUZA 1Y5NB 5C4JJ 4CYUA 3DLEB 3NWTA 3JAMU 3TUPA 2DFIA 4NYOA 1WI6A 3FEZA 4LFBF 3OWTA 5AXLA 4EEYA 1JJ4A 5DG8A 3SFIA 4JI0F 3TO8A 4EUVA 4ED5A 1DTQB 2ZH7A 1S7HA 3RKYA 5KFNA 3OYKA 2KN4A 4DN0A 3V6HA 1S99A 1R31A 2F5DA 2P81A 4DUZJ 5CCMA 4PJNA 3CCSI 3W5ZA 1UWAA 2YKQA 4GYIA 1T9XA 3IH4A 4DEZA 4QR0A 3N5FA 1M0SA 3GWCA 4R0EA 1C4CA 5CXTA 4ZLLA 4KC5A 4A8MP 4RDUA 4WFZA 2N3OA 1QTMA 1ITPA 3EUHC 1R0CB 2FBKA 3LSRA 3BS9A 4RZRA 4J5OA 1S3JA 4Z7YA 4O3NA 1TP4A 5FJ8J 3IG1B 4IOCQ 2YR2A 5D5WB 3NGUA 3QIPB 4PWDA 2EPFA 1BI3A 1FIPA 2YX4A 4U6PA 3I0SB 2V69A 4UOHA 2B0GA 1X2MA 3EWGA 4B09A 3D7SB 5CYVA 2WRMA 3FMSA 1V3RA 2HHWA 4F3MA 5H9FK 1GLNA 3PFEA 1OR7C 2EV0A 4M5NA 7AT1B 2I0XA 1R0AA 5C2GA 5BQTA 1ZARA 2HBYB 1X31C 3HDSA 4FPRA 3TQEA 4ZJOA 2JC0A 3IC7A 1V3SA 3EXCX 4G94A 5FKLA 2NYHA 2ZEJA 4CLPA 2I5JA 2XHKA 1NO8A 1WDDA 3BTCA 4PJ0C 3KP6A 1GH8A 2IBKA 3OR2A 2XMTA 5JUMA 1QGPA 1FESA 5HSPA 2FMYA 2ASDA 4ETZA 2JWTA 4ANEA 4CH1A 1UVKA 3UVJB 2ZBQA 4CA0A 4I09A 1A5JA 1SD4A 2WVEA 4R8UA 4LF5F 4BE1A 1L3TA 1YW9A 5CABA 2M8DB 4LF2A 2IS2A 2HXOA 4XM3A 2B9SA 3DHXA 2BW2A 3IS9B 1FDBA 2FGOA 3CMQA 5H2FC 3ELKA 4N4OB 1TVRB 3HCXA 2JZYA 1W7PB 2OQGA 2HGLA 4Z7CA 3H5YA 2VKHA 4CCKA 2RAQA 4F36A 4I76A 4EGLA 1REVA 2VBZA 2B9YA 2F6CA 3R6GB 1JLFB 3HULA 4WE1A 1GXPA 4P6QA 1X3UA 1YYVA 1S7AA 3PW2A 3M6XA 3MM9B 3MCZA 4F3OA 4RGUA 2CW8A 1U48A 1LFBA 1VNDA 2R7QA 4EGYA 2EILH 5B7WA 3OUYA 2UV8G 1S1XA 5ED4A 4NA2A 3ZXWA 2O7OA 4AM3A 3R7BB 2E5LF 3I54A 2RIJA 2DK8A 3M8YA 4C8YA 2DNQA 2UZAA 2XMVA 2Q2EB 1MDMB 1KDNA 4YUDA 5M2UA 5DEQA 2XRLA 4D0PA 2NS7A 3ZCOA 1KD1T 2UV1A 4OYBA 1FEEA 4Y7NJ 3KJNB 1J9IA 2ZDOA 3CTAA 4RBUA 1Z91A 3KX2A 4LRDA 3MM7A 1N56A 2GO9A 4WF2A 1HYSB 2HQIA 3NP5A 4JI8F 2DJNA 1OCTC 3U27A 1J5YA 2F9JA 2HYGD 4OIOF 2DMUA 3PO4A 3OVSA 4M94A 2V63A 2QT7A 5GMKa 3MKYB 4KIGA 3LA3A 1BHNA 4CYUB 2XVCA 5LEKA 1BXNA 3T1HF 1RAEB 3UKGA 1O57A 1VQ6I 1HL6A 2ASJA 4ED6A 4B9NA 2VE8A 1TT5B 1I6XA 2XHCA 4WU3A 3ILLA 3FCVA 1JT0A 4LIRA 3H3VK 3H59A 2DEIA 4LF6F 4Y3CA 1KSPA 2BABA 4FHTA 4RS8A 2BZ2A 1FBSA 1NB7A 5BMZA 1BJZA 4OIXA 3W64A 1KFSA 2B4VA 3QAHA 2YPZA 1RHJB 1QAYA 1RE1B 1VR6A 5KFDA 1RWKB 3EGVA 2X6WA 2CQ3A 4FYWB 1N5VA 4OI6A 3NWGA 1X5SA 3G86A 1Y5IB 3F8CA 3KNGA 1N33F 2LDYA 2FHKA 2RRAA 4M74A 2YNGA 4EBEA 3M8ZA 3RYPA 1VBXA 2DOAA 4LOCA 2XB0X 5JVHQ 3ZTPA 1VQ6S 1D1BA 1MU2A 2ZJ2A 5HDNA 4HQMA 4UQTA 1K7AA 4PKDB 2ID6A 1I1SA 1PYOB 1PUFA 2E2HJ 4DPUA 2I38A 2GC8A 2DT7B 4J9MA 4GFBA 3PHTA 2KIMA 5K5MA 3S17J 3ZMDA 2I5JB 2HHHJ 3OYLA 1SVOA 1YE9A 4YEAA 1UL3A 4X66J 4K59A 4USJC 3J7ZI 4HSRA 2BM0A 3TOQA 3U7JA 2VICA 2Y31A 2OH2A 4CLYA 4RMNA 1QAIA 4L9JA 1H88C 2HQ3A 3CCTA 1K9MT 1EAYC 2XEXA 3IRQA 3CCLI 2MHNA 3MR2A 4MFDA 4BHBA 2QZ8A 2DGOA 2LKSA 2OP5A 3C14A 4NZ7A 4ZLPA 1BR1A 1U78A 2X4HA 3HJVA 4RAFA 2L9SA 4AL6A 2M34A 1REVB 4BUPA 1SAUA 2HQDA 1G3WA 3CSKA 4WE1B 1XMQJ 1U8RA 4C8LA 5A2QK 4B9VA 3GJSB 1X3WB 3F6OA 2RUSA 1JXVA 3RAQA 3OUYB 3H40A 1S1XB 2WVDA 2EG1A 4DG1B 4EJVA 4JB8B 1QVGR 1H0MA 5KT5A 3KNAA 2MKYA 1FRXA 2VOOA 1JLQA 2BJ3A 4IPAA 2GCFA 3TVYA 2KLOA 4KV8B 4EYIB 3CCLS 5I42A 5KFCA 3K8WA 4TV7A 3OYFA 3T5HA 3OLAA 3LQRA 3T9ZA 4X4UA 4XKWA 1B0VA 4LG0A 4ZCIA 3MM7B 3ZTRA 4NB5A 2IGOA 3HFVA 2EBGA 1R1UA 4B9LA 4B3RJ 3FMQA 1BIAA 1ZHFA 4ANCA 4ZP9A 3ZZTA 1Q7YT 4IRGA 1JLCA 1FEXA 3OY9A 1Y39A 4DSLA 4ELUA 3LL7A 5L9NA 3M1CA 1I27A 2GOMA 5E3LA 4W4MA 4BCAA 4M5JA 2MQQA 3SEQA 2R7ZJ 2QRRA 3OXFA 5HNHA 1PC5A 1GV5A 3GU0A 1SL0A 4RNHA 3HOUJ 2O3DA 4NXNF 5K7FA 2NRAC 2M3AA 3ISZA 2MZSA 1RADB 1MWZA 4N56A 2QA4S 2OEMA 1F3FA 1D1CA 2J7KA 4P2MA 3WTSC 1F9FA 3I9ZA 2K7KA 2HYFA 2E7WA 8AT1B 5E33A 3IRRA 2A6MA 4QW9A 1U6FA 1HQEA 1P92A 1U45A 2RQ4A 3KE2A 2QLZA 2BRKA 2ZE2A 3M8FA 2EFWA 1GNKA 2WVBA 6AT1B 3BQ2A 1B4SA 1ICEB 3KP2A 1YJRA 2BANA 1F5TA 2MJNA 2V4JA 5H9EJ 1UEUA 2A5WA 2OJ3A 3RI4A 1TL3A 2YNGB 3GFLA 1T56A 3OXGA 5L3FA 3ILIA 5IQ6A 2AQFA 1MU2B 3F9KA 1LK7A 2POKA 2L2OA 2CQ0A 2A2DA 4LK1F 3MMBA 2V67A 1PJRA 1B7YB 1HARA 1UCNA 1S6PA 1PUFB 2WW8A 3CPWR 4NC8A 1Q8IA 1XN7A 5CH7B 1G4CA 4ECUA 1E3PA 5C42A 2VFVA 1OPCA 4Q7AA 4KYZA 2K9QA 4IQ4A 1FNNA 2HTJA 4RKUC 1HA1A 1ZAVA 2QFJA 4EMSA 1MZBA 1HNIB 4NCAA 3EGZA 8RUCA 3L2RA 1E6YA 2OZ6A 3MHYA 2DNOA 3ZQCA 1NK4A 3P4UB 4DR2J 5EZGA 1RHRB 3LA2A 1QBJA 1JX4A 5HDGA 1RAFB 1HBOA 3GZ7A 2JVRA 3G1LA 2A5YB 2X1DA 2HFHA 4LB6B 3DCAA 1FP1D 4HV5A 2N4DA 2XKPA 4HF2A 2J6TA 2MZJA 3DKYA 3C16A 1NPKA 2V9VA 3WU0A 3UQSA 2BA9A 3I87A 2XI3A 3CJKA 1C2PA 3JSYA 2ZHOA 4F2RA 3MKWB 4FS2A 4ENJA 2CDRB 4C8MA 4RWXA 3KYDB 3J80U 3GV7B 3AAFA 4A4JA 2MYSA 2V8VA 2CW7A 3QGIA 4FCYA 1WOSA 3M2VA 3TP3A 2GV1A 1R3NA 2MKCA 4LR9A 4NI2A 1XMAA 2ZH3A 3QNWB 2F4VF 4YHHF 3BR9A 4X64J 4PYDA 3GFIA 2QL7B 4C3HJ 4IHVA 1QUPA 2EIMH 2AWZA 4WCGA 1JLQB 2UVRA 3ZN1A 4IRKA 2DPIA 3BZ6A 3N6LA 3B4MA 4NUBA 2XYPB 4A3MJ 3UD4P 1PP7U 3OHBA 5I42B 5LMNF 3J7AY 1WEXA 3K0LA 2JEIA 2CWKA 4USIA 1S49A 4LG0B 2FHJD 3KFWX 2M8HA 3AXKA 5FB2A 2COMA 4LVNP 1PJ6A 3EYYA 2V26A 2E7XA 5HS7A 4PQUA 1EH6A 2GWRA 4K4XA 2DRAA 1U25A 3OQ2A 2FU4A 3VGTA 2ZO4A 1U2FA 3KP5A 1CJUA 1SD6A 3CZ6A 3J81U 5J2QA 2VASA 4RR5A 1KC8T 2ISYA 1QO0D 3GIKA 3W61A 4Y2KA 3HKZA 1U0SA 2QGFB 2C3UA 4IVNA 2I8EA 1XEZA 5C5JA 3VOEA 2K86A 2M8GX 5KFBA 1U1MA 2B4PA 1M1GA 2HGMA 2NCKL 1ZAXA 1FSHA 3U9GA 4DX8H 2QE5A 3WTUC 3ZZ0A 2DR6A 2VJ4A 4JX4A 1IF1A 4PPZA 5HK4A 1R4NB 5DDRC 3W2AA 4CLFA 2WB1N 4IFVB 1HQEB 3G3ZA 1KN6A 2FJBB 1ZGWA 3E6MA 5E2QA 2ZE2B 3QT5A 4UUXA 3KETA 3DM2A 2F7VA 1RYRA 5AE1A 2E60A 3OR1A 2HKXA 2UUTA 4A8SA 2BANB 3V6KA 2V4JB 1ZTWA 2K40A 1HKTA 1I39A 4O0IA 1TL3B 2BKPA 3BPSP 3BR3A 1E3HA 4CWBA 3H2UB 3G73A 1U3EM 2E2IJ 2NUUG 2U2FA 1T9TA 3FM3A 1AOYA 1MBKA 2M52A 2PQ8A 3MECA 4D3GA 4U0WA 3E3XA 2FHOB 3ITHB 1S6PB 2ZC4A 5F8GA 1WI9A 2FOWA 3SXYA 2BRLA 5C42B 3CJTA 4M5DA 3QFWA 2HFSA 5ICFA 3AHPA 4Y17A 1R8BA 2D3O1 2WA0A 4C2MJ 2HNYB 4KT0C 1VQ8I 1Y9OA 4AD6A 3CCZA 1RKJA 2W2OP 3MAAA 1UMQA 4C9YA 3KP4A 2W4SA 2V2KA 1O0PA 3IBWA 1HBOB 4P2FA 5IT9K 1KQSR 1LEAA 1W36C 2XHWA 3OYMA 3EZOA 1ZRFA 3C16B 2BY3A 3PV8A 2RQCA 2XY6A 1VQPS 3CJKB 4F4KA 2OJED 4MHGA 3DDNA 4J9KA 2UUAF 3HBLA 4UY85 4RNNA 3I0RA 1YJNI 1F1BB 4RGRA 3WHBA 5M2RA 3TO6A 4NLSA 4GVLA 1IXCA 2VQHA 3MN2A 3DBHB 4TN2A 4PDKA 3L7WA 2JZ5A 2KRHA 1HI0P 3M2VB 4EQQA 3SIPB 2WSEC 2IGNA 4IQJA 2AX0A 3EYZA 4NI2B 4A8XA 3PW7A 4ZA1A 1S5ZA 3BYRA 2H8WA 1KQ8A 3GFJA 3CCYA 4L5JA 2XGDA 2HK3A 3AY0A 4URQU 3NS6A 3N79A 4NMXA 5L8RC 3PACA 2PMZD 2VBYA 4CO2A 3KZIC 3M1EA 2MSYA 4KITB 2J0WA 3UW1A 2W4PA 2D1CA 3MEEA 1SKSA 1YIOA 3GMGA 1YJNS 2RKHA 4ZDLA 2B6AA 1RABB 3GWZA 2P8IA 3GV5B 1RAJA 4IRHA 3RBEA 3VZHA 2E5GA 5LGNA 2B9XA 1FD8A 1GFWB 4LLLA 3DLBA 3ZQFA 3JREA 2VUMJ 3TAMA 4F93B 1CJUB 1ZQ3P 4QQBA 2P5LC 1WACA 2RQMA 2BDPA 4LLGF 1USTA 5J2QB 4CXFA 2GHPA 2QBYB 2GVZA 5F6FA 3SQOP 1YJWI 4KIFA 1QQIA 1FNXH 2A69F 5B0BA 1U47A 1IV8A 1ZYQA 1PJ5A 1RWWB 3PR4A 2V4JC 2MKSA 4QWBA 1POGA 4CP5A 2IBOA 2G7UA 4JI7F 2J5AA 4WYLA 1JE8A 1S4FA 3RQ4A 3ZMUA 4V1Ak 2RKIA 3R2DJ 5J8CA 2V1NA 2LFBA 2HVQA 3DM2B 3D0IE 4U9RA 1YFHA 4U96A 3OR1B 3S16J 1XMKA 3K1PA 3HJFA 2QFIA 4M63A 4M3FA 4EJWA 4X0GA 1B59A 3KHHA 4J9SA 2DCEA 2UZKA 3MEXA 2ZDPA 4WCEQ 2HS0A 4MTDA 5HMZA 4GRIA 4YY3F 2Z57B 1XJWB 1YJWS 3CLOA 2D69A 5H9EK 3MECB 4KHPJ 5A8WA 5J2NA 1DP3A 1H8AC 3JRBA 3HRMA 2HZCA 4CICA 4LF8J 2QL9B 3CJTB 3CJQB 4M5DB 1FYMA 2XGPA 2ZZNA 3CDAA 5LRRA 4ZPTR 1TKDA 4ZVRB 3OL9A 5DM7F 2WSCC 1HFEL 4PJLA 2PJPA 3RUBL 1Z7LA 3LNQA 1T11A 4ZPVR 3MAAB 2CUEA 2CKWA 1KQ0A 2V6CA 4DJAA 3DLLF 4K5RA 4KIAA 1SFKA 2OPTA 1RWMB 2DGWA 2MW8A 3CWJA 4IX7A 2LREA 1KU2A 1HI8A 3J7AN 2MZQA 3QYFA 3BZCA 4NYPA 3DRRA 3E51A 1WG4A 3RAXA 3MF5A 4KT6A 2G1HA 2JVOA 3VAHA 3GUDA 1I94F 2A3JA 1SJRA 3MPYA 3I0RB 4PWWA 2HRTA 3HD2A 4KBIA 4RU9A 4F0MA 1O7FA 1WTBA 3P6YC 3W3SA 2KKOA 4KMFA 1K44A 5BYRA 1HNWF 3IWFA 2R5ZA 3UDEA 2OA4A 2AU0A 1R22A 3KUEA 5KFIA 2HPMA 1W7WA 1M5KC 2BOPA 5DTDA 5E1ZB 2ZUGA 4ID5B 3S93A 4O0NA 3FGVA 3TYTA 3UR3C 4FKYA 2D1HA 3HOWJ 2B5JA 1IRGA 2Z4PA 3NBPA 3ISND 3R4KA 3LW5C 2HNDA 2F9DA 4F4WA 1NK6A 3VAIA 4LFCJ 3EZUA 3IKVA 2OKQA 2X6YA 4OMZA 5HMXA 4RPFA 3CO0P 1ERDA 1EV7A 1WRJA 3MEEB 1WC6A 2M0MA 1AFIA 1Y8RB 2FIUA 1TV6B 3Q0WA 3OTCA 5CLSA 2B6AB 4I0AA 2RS8A 3R6LB 1FBUA 5KVRA 3RKXA 4ITVA 4NBQA 4N7TA 3KEQA 3QRPA 4ECVA 1MNEA 3P45B 4YG2F 2XMUA 4DV4F