1I1GA

Crystal structure of the lrp-like transcriptional regulator from the archaeon pyrococcus furiosus
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
140
structure length
140
Chain Sequence
IDERDKIILEILEKDARTPFTEIAKKLGISETAVRKRVKALEEKGIIEGYTIKINPKKLGYSLVTITGVDTKPEKLFEVAEKLKEYDFVKELYLSSGDHMIMAVIWAKDGEDLAEIISNKIGKIEGVTKVCPAIILEKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the Lrp-like transcriptional regulator from the archaeon Pyrococcus furiosus.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Transcription
molecule keywords TRANSCRIPTIONAL REGULATOR LRPA
total genus 34
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01037 AsnC_trans_reg Lrp/AsnC ligand binding domain
A PF13412 HTH_24 Winged helix-turn-helix DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1i1gA01
3.30.70.920 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1i1gA02
2MH2A 3BP8A 1DDNA 2HEOA 1D8KA 2LSOA 3Q5FA 2ZBKA 4U7BA 2HTJA 1Z6RA 2PBIA 4RAZA 4KIGA 1JXSA 5D8KB 4ENMA 4EJWA 2M5WA 2DLLA 1REPC 2D1VA 4AWXB 4UHTA 2P7VB 2RKHA 2Z4PA 3O6BB 1FSHA 4FT8A 2Y48A 3E6CC 4I2OA 2JSCA 1OYYA 3F22A 3NQOA 3U1DA 1IW7F 3DP7A 1R36A 5DD4A 3RPQA 4TV7A 4OIRF 2HFHA 2Q2EA 1I1GA 3I71A 1XGMA 4EJOA 5ILUA 4ASNA 4HDUA 4O6JA 3CO6C 1PP7U 4BQAA 2EFPA 3L7WA 5BPDA 2FE3A 1YLFA 2VBZA 5FD5A 3HSRA 4XLPF 5CYVA 1HQCA 5ILVA 2YPRA 2IW5A 4OMZA 1UB9A 2ZMEA 2L01A 2CG4A 1FBSA 4M6YA 4U0WA 3JAMZ 4Y15A 3HHGA 4M6XA 1O3QA 2HQRA 4RGXA 3F8NA 1E2XA 1FC3A 4U7DA 4YG2F 2HOEA 5FLXZ 3L09A 4S05A 1RUNA 2KKOA 1Z7UA 2GWRA 4GCVA 4A2UA 3J7AO 2IRFG 5EEGA 4HBLA 5CVRA 3HOSA 1T39A 2AS5F 3W6JB 2L54A 2DK8A 2CVIA 4G8XA 4L9TA 2V1UA 3LSTA 2HGCA 4S04A 3HRUA 1ZLKA 4EVIA 4IHSA 2J5PA 1FP2A 3EYIA 1ONVA 3LA7A 3MZHA 4RAYA 3CUQB 4UVAA 2PLYA 4CO8A 1FYMA 3IKTA 4M9XA 3GX4X 5LGUA 3WTYC 3GXOA 1MZBA 2V9VA 2A61A 1J0RA 4EQQA 3GZ5A 2P5VA 3KETA 1R5HA 4R1HA 3F8FA 2QQ9A 2RV8A 3HRTA 3C18A 2ZFWA 3ZMSA 3RKYA 2STTA 3KP6A 5HDGA 3DPLC 4RGUA 3RKWA 4UXNA 3J81Z 2CGPA 2DPUA 4HV6A 4MTDA 3T5XA 1XSVA 3FHZA 3I64A 4UUVA 4U0YA 2JSXA 3MAJA 2Q0OA 5K5OA 3KP2A 4XSXF 1SFUA 3MFKA 1KU3A 4ZYEA 1MKMA 2HTSA 2CSOA 2GA1A 2FU4A 4ON0A 4WK8F 4MGRA 4WX9A 1ZGJA 1S7OA 3OV8A 2IA1A 4I0BA 3P7NA 1BC8C 3TO7A 4HDVA 3HUGA 1LEAA 2PQ8A 3K1MA 4ESFA 4WWCA 5HVQC 3ROUA 4WCGA 1WWXA 2HZTA 3ZMDA 3J80Z 1SMTA 3H3ZA 4QWQA 1QQIA 1E17A 3F6OA 1Z6TA 4G7ZF 4HLXA 2VBYA 4IJAA 2KRFA 1Z9CA 2VBWA 1MGTA 2PFBA 4BHBA 3DPTA 1VTNC 5HDKA 1BM9A 1KU9A 4KIFA 1ODDA 1BI2A 1K78A 3Q9SA 5E20A 2IA2A 4HLYA 1BJAA 1W7PB 2YSRA 1SD7A 3I53A 5JHUA 1F9NA 1XCBA 2L02A 4LB5A 3Q9VA 2NS0A 4CDGA 2ZNZA 5E1ZB 3V7CA 1FSEA 1TNSA 1BIAA 1XGOA 1K78B 4KFCA 1KYZA 2RC4A 4OIQF 3BROA 1FYKA 2V79A 3R60A 4Q4ZF 4XSZF 1T6SA 1CF7A 3F23A 3ISPA 1GVJA 4JBAA 3I4PA 4PGHA 1ZAOA 3F6VA 5ICEA 3IRQA 1FYLA 1O3RA 4O3MA 2ZJ2A 2OZUA 2L3DA 5FB2A 1MJBA 1XMAA 2M30A 1ZH5A 4Y13A 3ML6A 3HIFA 4KUMA 2XUBA 1YO5C 3KP3A 1BI1A 3V8LA 1YW8A 1RNLA 1WKMA 5FFXA 4L0ZB 1IXCA 3KEOA 1ON1A 5CLSA 1YYVA 5D8LB 4KA4A 5KVRA 3CUQA 5DV5A 4CXFA 3M1EA 1IN8A 2EFOA 4WXHA 3QRFF 1P4WA 1K6OA 4HQEA 2P7CB 4ZYDA 5DYMA 1W7PD 5H20A 5DCMA 4HX4A 2XHKA 3T8TA 4P96A 1XD7A 4K2EA 2V1XA 1USTA 5BMZA 4ENJA 4YIFA 4RB2C 2QLZA 3CO7C 3HRSA 3SZTA 2DTRA 1SD4A 4ESBA 5DCMB 5D5VB 4HF0A 3FX3A 2FMLA 1P92A 3F8MA 2P4WA 2ISYA 4LGWA 5LGNA 5FO5A 2F2EA 3WTUC 1Z1DA 1T2KA 1G3SA 1ZHFA 5CVUA 1AOYA 1JHHA 2HYGD 3KP7A 5LRSA 2IA0A 3D0SA 3ECHA 1U5TC 4CZZA 4CICA 2FXAA 3HSFA 3QU6A 2BGCA 3LA2A 1IN6A 3SHFA 5LLQA 4ZZLA 3LWFA 5HLIA 2IT0A 3KCCA 1FZPB 4ETSA 3FXUA 3IC7A 2PMUA 2QQAA 3I58A 1F1ZA 3OOPA 5HDNA 1QZZA 1O57A 4PGGA 3W6KB 1D3YA 2K86A 3EQLF 2WTEA 1ZRFA 3LQQA 1BI0A 3M7GA 1H9TA 3EDPA 2OBPA 2FOKA 2LDUA 1Z05A 3D5LA 1R1UA 3T8RA 3WODF 2BE5F 3WU1B 2VXZA 3TOAA 2A68F 4Z2YA 3T1BA 5DUKA 1CF7B 5BQTA 5L3EA 2GIVA 3I59A 2CQKA 1W4MA 3KP4A 3SZPA 1G3YA 4Q47A 4XBFA 2GQQA 2KIMA 2IPQX 3E6MA 3R0AA 3R61A 2B0LA 3WTWC 1I1SA 3RDIA 4KICA 1JE8A 4U0VA 1SFEA 2YR2A 1FP1D 1FY7A 2Y0MA 4P9FA 4B09A 2CYYA 1RZ4A 3CLOA 3VEPA 4ENNA 4WXDA 2CWEA 2FBHA 3VFZA 1W5TA 2FSWA 2O0YA 3MWMA 2D1HA 5ILSA 2ZMEB 5LHIA 1BI3A 1C0WA 2FBIA 2ESNA 3MZYA 4LLGF 5L3CA 2X0LA 2UWMA 3G3ZA 3NEUA 2VODA 2EA2A 1UFMA 3IKVA 3JSPA 3NRVA 2QYOA 3C3WA 4JK1X 3JW4A 2DFIA 1BC7C 4UVCA 2GXGA 3E3VA 3SXYA 3E6DA 3FMSA 1IN7A 1YTYA 2XV4S 3P9KA 2KJCA 3TO9A 3KFWX 1O3SA 5E8GA 3CUOA 5D5UB 2BEOA 3TO6A 1O7LA 4L9VA 4LLLA 5F6FA 2GZWA 3GFIA 2A5YB 2RGVA 3KEQA 5TRDA 1XMKA 5F1RA 3ZMUA 3E5UA 2P5KA 5LRRA 1L3LA 4CYDA 5TJJA 2WC2A 5ICFA 2E7XA 1H9GA 5HLGA 1IUYA 1Z91A 3F21A 2LNBA 5D5WB 2J5OA 2OD5A 3GYHX 4OU0A 4ZYHA 1FT9A 2XROA 3QP5A 5D4SA 2ISZA 2GAUA 1F4KA 3GWZA 3FM3A 5K5RA 1OKRA 1OYIA 4N9IA 1XN7A 3COAC 1MJ9A 3RYPA 2MC3A 4N9HA 1GHCA 4NQWA 1WQ2A 3EETA 3TGNA 1J9IA 1LJ9A 2RNJA 5L3FA 3KLOA 4OOIA 4LB6B 4LG0A 4D0PA 4QLCU 4CHUA 4A6EA 1K79A 2CO5A 1PP8F 4KIBA 4IF4A 4YIIA 3WG9A 1IXRC 2JZYA 2G9WA 3E5QA 3REOA 4HAMA 3L9FA 3FWEA 4HX7A 4EJVA 1EH8A 4AVPA 3WTZA 1UCRA 3QPTA 2F5FA 3HTUA 2A07F 2COMA 3I54A 2RN7A 4MHGA 3ZQ7A 4A5NA 1B59A 1ULYA 3JSOA 4M74A 3CDHA 4HF1A 4GYIA 4E70A 3P9IA 1KQ0A 1LDDA 1STZA 3GW2A 2KIFA 1FBQA 4ZZDA 3F3XA 4P55A 1U78A 2ETHA 1XGNA 3C1DA 2A3SA 4OINF 1FPQA 1NHAA 2W84A 4EM0B 1HSTA 3FMRA 2OQRA 2XKPA 4EGYA 2Q8KA 5BPIA 4P5OA 2CFXA 1LVAA 1ZRDA 1ZREA 1B6AA 2XASA 4IRHA 5J8CA 1X3UA 1FNNA 2LKPA 4RB3C 5EEHA 1FLIA 4GO1A 3R4KA 2M8EA 1HKSA 2O8XA 2TDXA 4FX0A 1TQPA 4L5IA 5D6FA 2FF4A 4EM2A 2ZCWA 2Z33A 1S3JA 1MDMB 1R58A 4BHPA 3EYYA 2M1BA 2G7UA 4IHTA 1B4AA 2QBYB 2ESHA 2HKOA 3TOBA 1MDMA 2W85A 2A6EF 4I0AA 1R22A 2XIGA 1ZG1A 2VT2A 4UV9A 4FHTA 2H6BA 3VODA 2MD5A 4BNCA 4P9UA 4EM1A 2UZKA 1W5SA 3IHUA 1T98A 2XGXA 2R7DA 2EV6A 2OQGA 1S6LA 1BBYA 2ZXJA 2OA4A 5D4RA 2FQ3A 2IP2A 3I5UA 2PJPA 4H0EA 3U9GA 2MBFA 5LEJA 2EWNA 3G73A 3VB2A 1Y0UA 3DEUA 4IPAA 2ZBCA 1QBJA 4LK0F 4I01A 2XRNA 5LBQA 1LDJA 2PI0A 2KIUA 2FBKA 5CJ9A 1U5TB 2VONA 1R23A 3ZN1A 2DBBA 2HS5A 2W25A 1SD5A 2FMYA 5FLXK 1R5GA 1SMYF 3H92A 3KP5A 1XCVA 4N0BA 2QM3A 1IN5A 1DUXC 2A69F 1J2XA 3K1PA 3ABTA 5IT3A 3GLXA 3QOPA 2NNNA 2IJLA 5HLHA 2VC1A 1IN4A 4HF2A 4HQMA 2W57A 1XSDA 3BJAA 3ULQB 1DPRA 3ZMTA 1TBXA 3BOQA 2JT1A 5A2QK 2R3SA 4I7HA 1EH7A 4B8XA 4PZJA 3K1NA 4YFXF 2Z5UA 1TNTA 2P6SA 4XLNF 1SD6A 1TW3A 4I09A 2XAGA 3SFZA 3I59B 1B9NA 2VOPA 1XB4A 1CGPA 2UXXA 4A0XA 4KNYA 1A04A 2F5DA 2OAZA 2JPCA 2DT5A 3J80K 4G6DA 1P4XA 2BYVE 3GFJA 4LMYA 4GGGA 1BOAA 1QZYA 4MEXF 4F7ZA 2NNYA 2IVMA 3L2CA 2NRAC 1OMIA 1HSJA 5JVTA 3R0JA 4KMFA 3BPVA 4M71A 4M9SA 4EGZA 3F72A 5IT9Z 3HSEA 2D45A 3RIRA 4WXCA 1S7AA 2YU3A 3KZYA 4UVBA 2L4MA 1HW5A 3GEZA 3WTTC 5HOOA 3DKWA 5H6RA 5LEKA 2WV0A 1V4RA 3FZVA 2Y75A 4LG0B 2LF8A 3TDZC 5J6XA 3BWGA 4JQFA 3BDDA 3WTXC 3BZ6A 3N97A 1YW9A 4G7OF 3RI4A 3J81K 1IRFA 4RGRA 5ERIA 1MD0A 1MJAA 5FFZA 2HQNA 4OIPF 3BJ6A 3HOTA 4ZYGA 3LA3A 3JTGA 2O3FA 4I02A 1TW2A 3DV8A 4M9ZA 2UXNA 2DW4A 1HBXG 3IWFA 5L3BA 3IRRA 3RYRA 3DQVC 3RTRA 1GXQA 3DXJF 4BAYA 2FNPA 3F8BA 1D5VA 3WTVC 4MQVA 5BOXA 3JAMK 2VOOA 2E1AA 1ZN2A 1GXPA 3T0YA 1I5ZA 3ZPLA 2V6CA 2X4HA 3GVAA 3ECOA 1G3TA 1PUEE 2ADUA 2GXBA 3E97A 3IWZA 2QVOA 2Z3YA 4Y17A 5FGMA 3FF5A 1ZARA 4NB5A 2DI3A 2DU9A 2Z9OA 1U2WA 3TQNA 4YFKF 4HW0A 1S8NA 2OZ6A 1FWZA 2DK5A 2M87A 4G9YA 4CGZA 3HYIA 1YW7A 3RKXA 1HW2A 2XAJA 1S29A 2XAHA 4Q48A 2MLKA 2M45A 2ACJA 2E7WA 4AIHA 1W7PA 5LHGA 2H09A 3DFGA 4RB0A 2EK5A 1WSUA 3WE3A 1XDSA 1OR7A 3QPHA 3B73A 2NAZA 3MQ0A 3TKYA 1J5YA 4OIOF 1LEBA 4DNCA 4FX4A 1R1TA 4A12A 2KJBA 1RUOA 2K4BA 2RVCA 3L00A 1KGSA 1TLHB 5DD8A 1FX7A 4AIJA 3PQKA 1YFHA 4L0YB 4IRIA 2JTVA 4RS8A 2PG4A 4O5VA 4LLNA 2YX4A 1SFXA 1YIOA 3V8JA 4M72A 3N4MA 1TTYA 2E1CA 1PDNC 2P6TA 2VE8A 1LB2A 2JPBA 1KQ8A 2VN2A 4IRGA 2HKXA 3ABUA 3GO5A 3RJPA 1F5TA 1RI7A 1FBUA 1UHMA 4R8HA 1ON2A 2K4JA 4BYYA 2K27A 4U88A 3ZP5A 2QZ8A 2EFNA 1UHWA 2XVCA 3P9CA 5CVIA 4ESJA 2HDCA 3WGIA 1B1BA 2VE9A 2QQBA 4LD5A 2STWA 4XRFA 2HYFA 4KDPA 1ZRCA 1KQ9A 3DF8A 3ZMZA 5E1WA 4EV0A 2EA4A 2OU2A 3K9TA 4ENKA 3ZN0A 1HKTA 5K5QA 2RDPA 5HS8A 4DQ2A 5CVVA 2XAQA 1RIOH 4BHCA 1LQ1A 5DEQA 3F8CA 2FRHA 1IXSB 2K02A 4KN7X 2DAOA 2EFQA 1ZG3A 1KU7A 2ZO4A 1QO0D 4HOBA 3I0TA 2H94A 5DDGA 3VOEA 1FOKA 5E17F 4MTEA 4KN4X 2V1DA 4BXUA 1TQIA 4A5MA 1O3TA 5KK1A 3V4GA 4R79A 1O7FA 5HS9A 1DPUA 4MNUA 5HS7A 5FD6A 5IT9K 2K7LA 3GF2A 1G4DA 2DQRA 4G7HF 4NHJA 1XDUA 1ZG5A 3FXQA 3K2ZA 2NYXA 4L5JA 4L9NA 1ZYRF 2ZKZA 2LF7A 1T38A 1IRGA 4G6QA 2F5CA 2O6GE 2FNAA 3ELKA 3BPXA 3E5XA 2A6HF 1P2FA 1WI9A 3LAPA 2HR3A 4AIKA 4HV5A 4L9JA 3QP6A 1BN5A 1KU2A 1L0OC 2MA3A 1OYWA 5D5XB 3ERED 1EH6A 2DPDA 1IAWA 1YG2A 4HA8A 3R6SA 5H6QA 5A2QZ 3HRMA 1G3WA 1R7JA 3K0LA 4A6DA 4G94A 4EMSA 5LHHA 2MH9A 3MCZA 1T0FA 4UV8A 1QPMA 1B9MA 1U5TA 2QUFA 2JRTA 3B02A 1JHFA 2O03A 1WRJA 1D8JA 2XKOA 5ICCA 2QENA 4YFNF 4ZH4F 4Q5SF 1QGPA 4HZFA 2VT3A 4L18B 1J7KA 1IZ1A 3KE2A 3M9AA 3RPUA 1U8RA 3WGGA 5ICGA 1I6XA 2CW0F 4MQ9F 3V7SA 5ED4A 2VC0A 3V8KA 3KZZA 4EJTA 3KLNA 2G7HA 4WF2A 4A0ZA 5AIPA 4MEYF 3BJOA 3CTAA 1OPCA 2EJRA 2W24A 3WE2A 2F5EA 3LQRA 2FEZA 4RGSA 2PEXA 3IL2A 5L3GA 4A0YA 1R1VA 4LJZF 5DUIA 3GZ6A 3QAHA 1R00A 3BY6A 1ZGAA 1LNWA 4GYGA 2BV6A 1V3FA 1U3EM 4KYWA 2P8TA 1DP7P 2WWYA 3SQNA 5JI6A 1HXDA 3LFKA 1ZLJA 2AXLA 3HHHA 2RQPA 2D2WA 3FXRA 4M73A 4GXOA 4OMYA 1AWCA 5D6EA 1K7AA 2QWWA 1YS6A 2DQLA 4UNOA 1I27A 1Q1HA 5JR3A 1EV7A 3AAFA 3PFIA 3E6BA 4KT5C 1BIBA 3V7RA 3EUHA 1YS7A 1YQAA 2H27A 4PCQA 3CUQC 1XSXA 1TQMA 3K69A 1U6GA 3CJNA 2XAFA 1H0MA 3O3KA 2EB7A 3FM5A 3HTSB 2H6CA 5J8FA 1HKQA 1P6RA 3WGHA 2P5LC 2BBYA 2ELHA 4LK1F 2EV0A 4HX8A 2GA2A 3S2WA 3LAJA 5K1YA 1LDKB 5L3DA 3H3UA 3WU0A 1IF1A 5AONA 1SAXA 4RB1A 2O61A 3QU3A 2PN6A 2HWVA 5LGTA 1JGSA 1P4AA 4IVNA 3M8FA 1HW1A 5BS6A 2DO7A 2C6YA 5F64A 2E1NA 4LFUA 5E8IA 2YX7A 5CVJA 3GFMA 3ZMVA 3FMQA 1KYWA 4EJUA 3PQJA 2DJWA 4BH9A 5JFRA 4AD9A 2Z99A 2MLGA 2EFWA 4IXAA 2VBXA 2L4AA 1XGSA 5DCFA 2FA5A 5AIQA 4PDKA 3O2PE 1J75A 3JTHA 3GFLA 2EV5A 4HYEA 2ZNYA 2QBYA 2R7FA 4KMUX 2PMHA 1G6NA 1KA8A 1J59A 3WTSC 1QNTA 4I98B 3M8EA 1USSA 5E18F 3MEXA 6PAXA 3U2RA 3TDUC 3GUDA 5E1XA 3C7JA
chains in the Genus database with same CATH superfamily
2CU7A 4QW8A 2W8LA 4DV6J 3NMAA 2FUG2 3WIVA 2HFUA 4U7BA 3EM1A 2HTJA 1Z6RA 1E0EA 5J1EB 4KIGA 4UOGA 1UKUA 2XZTB 2OEKA 4OAYA 4IHWA 1RAIB 2M5WA 2CA9A 4LRDA 3M6UA 4TXSA 4HSTA 2IJRA 2W2QP 1X4EA 4DXLA 1FJGJ 1FSHA 2LMDA 3ILJA 3WHIA 3FBNB 4XLFA 2V4RA 2NVTJ 2HVHA 1OYYA 3K7AJ 2ECCA 4DX6A 2KG1A 2QMWA 3TNVA 1X9MA 3RPQA 4TV7A 1HBOB 3OVAA 2BANA 2HFHA 5CZXA 2Q2EA 5ILUA 2MFZA 4ASNA 2NS8A 3PFEA 1BR1A 5E0OA 1AFIA 1S7IA 2KI2A 4BQAA 3L7WA 3F41A 5GAGJ 2GFFA 1X4FA 3S1TA 2WAEA 3R5DA 3PY8A 1WJDA 5CYVA 2V9PA 4DCPB 2MZRA 1PC5A 1UTAA 2DIUA 4ZC3A 2L01A 2FJ1A 1HNWF 2RILA 2E5HA 2HVDA 3OTOF 2XWXA 3JR9A 4JI2F 4U0WA 2WAFA 3VQSA 1HC8A 3NCQA 3MM5A 4LSLB 2NZ4A 1U02A 2XMAA 1X31C 1F5AA 4M6XA 2AU0A 4LQ3A 4PQUB 4J9VA 1DHMA 3TQ1A 1O3QA 2HQRA 3ISZA 2ZB9A 4YG2F 3W8PA 4AIDA 1TZLA 4S05A 2F4VF 3UN5A 3I55I 1KQKA 1C4CA 2HW3A 2E60A 3I4HX 3HVTA 4I2PA 4YR3A 4LRFA 3TJ9A 3BQZA 5EEGA 2KRRA 5J1UA 3GTOJ 2H65B 2LFBA 2DK8A 5C5JA 2HOTA 1IRXA 1KBRA 1M5VC 2V1UA 1YZ6A 2DGUA 4S04A 4K5RA 3EYIA 1HBUB 4LREA 3HSGA 3HDDA 2DOAA 3G86A 2OGUA 2RRNA 4XKVA 5HL7Q 3HMJG 2JA7J 5KT5A 1JLAA 1U0HA 3CUQB 4RAYA 2YPYA 3OL4A 5JLWA 4R0JA 4CO8A 1FYMA 3IKTA 1FOWA 3I82A 5KFIA 2D3O1 1VBZA 1N56A 4LFCF 4LIWA 1MZBA 5EDWA 2V9VA 3VQTA 4XM3A 2A61A 1X9SA 3GZ5A 2P5VA 3BH6B 2FD2A 1K4SA 1R5HA 4R1HA 1LWEB 3CC2S 3F8FA 5KTQA 3B82A 4NBQA 3A13A 2RV8A 1Y56A 4G65A 3G6EI 3POTB 2MXYA 4V1Ak 3HVWA 5GADJ 5DM6Q 3HPOA 3SEQA 2OPPB 5K14B 3KP6A 3D6FB 1ZTTA 4LT6A 3G2BA 4JI8J 3A02A 3OHAA 1WHUA 2CQCA 5C25A 3K5NA 3J81Z 2CGPA 1JLBA 2DPUA 5DDRC 3KJNB 2I5JB 2IIHA 1XSVA 1FRIA 3W66A 4BHQA 1W5CC 4UUVA 3CCES 4DL3A 3MAJA 3LH2S 1MW7A 1XEZA 4DUYF 1V6HA 2BY0A 1CJKA 1O0PA 5K5OA 1PJRA 1M90T 1P9QC 1A31A 1FWLA 1R6YA 3LSJA 2GGPB 2CSOA 5EGYA 1PAEX 1M1EB 4WK8F 4LF6J 3L7PA 4WX9A 1KS2A 1ZGJA 5KT4A 4Z7YA 5FDLA 5KFDA 5D3GA 2M3DA 1MWQA 1RHRB 1BWEA 3U7JA 1TKTA 3MAAB 5GMEA 3DKDA 2MQ8A 2M5YA 1LEAA 3MMCB 5EDNA 1ZKGA 3P45B 2UVRA 2QA4I 5F9LA 1D1UA 2YNFA 4WWCA 5HVQC 4ZPTR 1RCOB 3DCFA 4XOPA 2MSTA 3J80Z 1F2GA 1SMTA 3EICA 1N36J 4ECSA 1I5OB 2AIRB 2Y1IA 5DZ7A 1F1BB 3F6OA 1Q8KA 1Z6TA 1VFJA 1RT2B 1Y7PA 5SUHA 1VF9A 5HAOA 4IJAA 3OYNA 1OY8A 2VBWA 3HKZD 3FKBA 4DEZA 3SCKE 3FFIA 3DPTA 4XLAA 3P5TL 3QYFA 1BM9A 2OPTA 1ODDA 5L39A 1UJ4A 2LG4A 3Q9SA 5E20A 1RXOB 3JRHA 2ME0A 4B43A 1BJAA 1RKTA 2L7FP 4PWDA 3I53A 3DTKA 4C9YA 4PXCA 5JVGQ 5HVGA 3AY0A 2VUGA 4LIRA 5HMWA 2NS0A 1DJ0A 2VIHA 3Q8YA 3TUIC 5E1ZB 3V7CA 2WVFA 3OIQA 5DDOC 5FLXY 4KFCA 3FQLA 1ZYQA 3CCMS 5CABA 3FQKA 2FGCA 5KFBA 1N54B 1FYKA 3U1MA 2V79A 2P0WA 3R60A 1CF7A 2JSPA 3GILA 2IYIA 1UAWA 2L48A 3ISPA 4HHJA 4GC7A 3K8VA 1ZAXA 3OL6A 3G9CA 1V5IB 4JBAA 2XB5A 4IOCF 1ZAOA 4DCJB 4NWBA 2BY3A 2DT7B 4AT1B 1O3RA 4BCAA 4RL1A 4O3MA 2ZJ2A 2G9OA 1OQ3A 2L3DA 2O01C 1XMAA 1WEXA 1ZH5A 4AVZA 5GMDA 1TL3A 1T9UA 2GVZA 2Y9YA 2B8PA 2PFFB 2EC2A 1WKKA 2XUBA 3VAFA 4FCYA 2E1RA 3MCOA 4M3DA 1I94F 2KDZA 3M30A 3A8EA 2MKIA 5FFXA 4L0ZB 4CLYA 1HW9A 3J81Y 2KDOA 2FUG9 1SJFA 2VPWB 3D6HB 2AJ2A 2M7AA 5KVRA 2NVXJ 2PIIA 2HFVA 3GB0A 1JK9B 1R4MB 4B9NA 3I32A 2ZH6A 1C1CB 2CPHA 2R2RA 3PJXA 1IR2A 4NCAA 3TR5A 1K6OA 4HQEA 2P7CB 4PR6A 2JK3A 1ZM4A 3AD7C 5H20A 1WHWA 2JZ5A 5FJ8J 1R49A 2C2OB 5DQHA 3T8TA 8RUCA 1WI8A 2BQ3A 4M6VA 4UOCA 1USTA 1CJUB 5BMZA 4EEYA 5J1PA 1RHKB 4XN3A 3FEYB 2WB1D 2IPOB 2K5CA 2EH3A 2DTRA 3GTLJ 2FPHX 4ESBA 3OLAA 5DCMB 1Q79A 2EXUA 2V4JC 2GVDB 3CP8A 2OMOA 2D69A 1CC7A 2JVHA 2EIMH 2A5WA 2L0KA 3PSIA 4KH0B 5FO5A 4FVMA 1U25A 1XC5A 5CZVA 1A6QA 3BGFA 4U95A 4KGZB 4G1IA 1ZHFA 4BE2A 3L3CA 3QWLA 5CVUA 1DURA 2CQ4A 3OIPA 1IM6A 2XBPA 1MMDA 3QYEA 3POTA 3D0SA 3ECHA 4CYUA 3W64A 3D4JA 3CMQA 2FXAA 2EI5A 1B64A 3DU5A 5I3PA 5HLTA 3CB4A 3LWFA 3IFEA 2HKEA 4XPEA 2B9EA 1TQLA 2ME6A 4OWRB 3IC7A 1LKZA 2PMUA 4AUKA 4GVBA 1CPZA 1O57A 1D3YA 5KG3A 1ZRFA 1OCPA 2ZHBA 2I5JA 4LF8J 1HIYA 4J37A 1TVRB 3EDPA 2OBPA 1DTTB 1ZZFA 3EJMA 3PNIA 3QATA 4FYXB 2DRBA 1FK9B 4CO5A 2PD1A 1Z7LA 2VXZA 4DR1F 2W2PP 2RQQA 4Z2XA 1VK8A 2CUFA 4M5HA 2L9NA 3N28A 2Y1JA 2DPJA 4U8YA 1NHKL 2GIVA 1QSSA 3I59A 2K3FA 5JXSA 2QKLB 2Y69H 2CNLB 3SZPA 3V81A 5KFJA 4X65J 4ED0A 1VQPI 3EYZA 3R61A 2B0LA 1S9GA 4OI6A 1G59A 1WJ5A 5C4JJ 1PJ7A 2VDIA 1JE8A 2KJVA 2DEJA 3CD0A 2YR2A 1FP1D 1FY7A 2R7QA 4P9FA 1C0UA 1EX8A 4PG6A 4ENNA 3VFZA 2ASDA 4CH0S 2XULA 1YI2I 3M32A 4D7MA 1QAYA 2QMUB 4E7HA 3WHCA 3JRIA 1BI3A 3VSKA 1C0WA 5KFPA 4Z37A 3SXLA 2X0LA 2AW0A 1SJRA 2H1LA 2VQEF 1J5EJ 2GMLA 2EA2A 2ZH1A 2CADA 2KXNB 1JXEA 1B0VA 2MD0A 2LU2A 3C3WA 2XB2D 3DXSX 4HT7A 3JW4A 1BC7C 1ZS6A 4UVCA 3S1MJ 2Q2EB 1IN7A 4DV3J 2WK4A 5KFAA 2L9DA 4ILLA 2HBYB 3RG6A 2CZVC 4NC8A 3TEDA 1F3FA 5E8GA 2J6TA 5IPAA 3V6DB 3M2UA 3CUOA 3T9ZA 5D5UB 1RC9A 2XLIA 1QZEA 4KJIA 3OYBA 2BJEA 1KDNA 3T1YJ 2UUBJ 5F8IA 4LLLA 3J80U 5F6FA 2GZWA 3GFIA 1RJJA 2HK2A 1YLXA 2XPUA 5TRDA 1XMKA 2LEBA 4XKWA 3Q8QB 4M63A 3UCGA 5F1RA 2HWHA 2VB6A 3DOMB 3E5UA 5J1EA 1MSWD 5KFTA 2HMIA 3K5LA 5B7WA 2F40A 1F6TA 2E5GA 3SCJE 1NM2A 3GJRB 1V3ZA 3M1CA 2WVEA 4CQ1A 4OU0A 3A03A 2JA5J 2J7WA 4BC9A 3P5BP 3CCRS 1HNXJ 2YNFB 3QNWB 2B9XA 2I8DA 1HQEA 3WC0A 2WAQA 1IJWC 2CPJA 1LW2B 4W1UA 1R0AA 4CLLA 2AHOB 4N9IA 2PEBA 1XN7A 1MJ9A 3I56I 4I0WA 2CH0A 3EETA 2KG0A 4JV2A 1ELOA 3EPGA 1YIJI 1T9WA 1IN0A 4LB6B 2HVSA 3V4IB 3ABMH 2IBDA 2QSHX 4CHUA 2GJFA 1S4EA 3DI6A 1K1QA 1PP8F 3UD3P 5F08A 4NCGB 4Y0FA 5LSOA 4YIIA 2IJFA 3E5QA 2NPIA 4HX7A 1EH8A 5KOXA 2F5FA 3IP0A 3HTUA 1HKAA 1N32J 3WIUA 5I42A 2VG6A 2COMA 4UUWA 2B9SA 3I54A 4AYBA 3NL0A 2DTJA 2RN7A 1FRXA 3ZZRA 4HRIA 1IWGA 3PW5A 4TU8A 2RREA 4A5NA 1ULYA 1MSEC 2R7ZJ 1T9TA 3OSPA 4M74A 5ITHA 5L9NA 3WDOA 1EIYB 3P9IA 2A1BA 3M8ZA 2DPIA 1KNZA 2K9QA 5E3OA 5FKMA 3UD4P 2DNKA 1ZM9A 1KFSA 1U49A 2F9DA 4DX8H 4FYVB 3GW2A 2KIFA 1FDAA 1FBQA 2BW2A 4ZZDA 1ITPA 2WADA 3S32A 1RT5A 1U78A 2MPUA 2UUCJ 1SVMA 2ETHA 1J5OA 4KQZA 2UUAJ 4C0BA 1QUVA 4DFMA 2A3SA 3RAXA 1FPQA 2K1RB 2W84A 1HSTA 1RDRA 1XNQF 2LQJA 2DNRA 2OQRA 4EGYA 1SL1A 2A6TA 2JEIA 4WKYA 2HQAA 2YKPA 4NXMJ 2LOOA 2MABA 2QFIA 2HIYA 4ZP6A 2JC0A 1SQFA 2K1RA 2WSEC 1WACA 4BJ6C 3D0GE 5EEHA 4PG5A 4KKOA 3CCUS 1QAXA 3MFHA 4IUFA 1RBLA 1TQPA 2BBEA 2DNYA 3DLEB 3TQEA 3HX9A 1S48A 1YHQI 5D0EA 2L7KA 4EM2A 1HYSB 2JVOA 1H72C 1D1AA 1IJFB 3HO1A 2W9BB 3ET6A 1LW0B 1FF2A 2MQMA 1R58A 2E66A 3IAS2 2VA3A 3HJFA 4IHTA 1QVGR 3GTKJ 2VQGA 2ESHA 4LF2A 5DG7A 3BBFA 3TOBA 1TL1B 2W85A 5T7LB 2VV5A 2ZFUA 4I0AA 1ZG1A 3JTNA 3CUNA 2V1NA 2BRKA 2HFZA 4BNCA 1RK8A 2ACYA 4DV0J 3R2DJ 2VQHA 1EARA 1ZA1B 1BQMA 3MWBA 2WB4A 1W5SA 3GZNB 3MM6A 1NZ8A 2VFVA 1T9VA 2ZEJA 2BM0A 3OJSA 4K8RA 3JSRA 2YH0A 2FOWA 2DITA 5JUMA 2YWFA 3OYHA 5D4RA 1HNVB 2FQ3A 4HEA2 3DRRB 1XMBA 1NK7A 2DO0A 2HRTA 4FXVA 5DG9A 1TFYA 3S01A 1LWXA 3RZDJ 1DARA 5IT0A 3R27A 4USWA 1U8BA 1HPZA 1KOOA 1QBJA 4A48A 4ED3A 3WZ0A 4I01A 4Y4RA 3TVYA 4J01A 3QBCA 1RR8C 1RAAB 1JX4A 2PI0A 5DS7A 3KDNA 4AYBD 1U5TB 1R0AB 2VONA 3ITHA 3O1LA 2E5LF 1ITYA 3GIMA 2DXDA 1HF0A 3QMQA 5EX3A 4BWMA 3CJTA 5E33A 1V9OA 1RAHB 4C2UA 1LVKA 3DRSB 4M95A 2DGTA 4PPDA 4L6V3 1VQKS 1XCVA 1L3SA 2OFGX 2XY7A 1DUXC 2A69F 1J2XA 1QAJA 5D6GA 2LLZA 4OYMA 5IOYA 4WIIA 5KFQA 2YNGA 1IBMJ 4A8MP 1JLGB 3US5A 2J76E 2QLJB 4KSEB 4F2SA 2J9DE 3NS7B 3DGVA 4A8KA 2DYAA 4DQSA 3FISA 3WC2A 1PC4A 4LIUA 2FLPA 2NPFA 5DGBA 2JT1A 1HWKA 4A3LJ 1N52B 2H3EB 3MD3A 2ZSHB 2CJYB 4N4NB 5JLXA 1FX2A 2HZVA 3EPZA 3CJ8A 4HKQA 2JRMA 1SD6A 1TW3A 3DN9A 3M32B 4BUPA 5CD4A 2RH3A 1H98A 4MFEA 1JIHA 1CGPA 3CMYA 4A0XA 4KNYA 1Q81T 3H98A 2F5DA 3MMBA 2X85A 3I9V9 3TJ8A 2EG1A 3T5HA 3H59A 3OS2A 3BF4A 1X7VA 1CVJA 1BOAA 4MEXF 3MMCA 4F7ZA 2NNYA 2IVMA 3BREA 1OMIA 4RNFA 1O4XA 2OPQA 1RSCA 1T56A 5JVTA 4DV4J 3GTYX 4RAFA 5D77A 2RE1A 2K8GA 1FA0A 2O5RA 3NOGA 3F72A 3CXCR 5M2RA 1I6JA 4LBPA 1JMTA 2D45A 3H5RA 3PRVA 1S7AA 2PJRB 1K4TA 5E3NA 1U09A 1IWAA 1YJNS 1RBOB 1N6QA 3MVPA 1WHYA 1CJTB 3DRXA 1NEEA 1AKHB 2L4MA 4ZVQB 3GEZA 2DH8A 3OYEA 1FFGB 3DM2A 2DY1A 5HLFB 2B7BB 4AYBN 2VJUA 2E5LJ 3PYDA 4C11A 2R93J 4OJ3A 3DKWA 4UY8I 2FLNA 3R5AA 2IMWP 1IDYA 5LEKA 4A3MJ 2BE7D 2IDLA 3MR2A 1SAUA 1VGYA 1RYRA 1X3WB 4JQFA 1U24A 1FJLA 2XZWA 2HNYB 1RYSA 4N41A 4DLEA 1IRFA 1RAJA 1SPBP 2B43A 4LF9J 4L73A 1D8ZA 3PL8A 4OIPF 2NVUB 3FXOA 3UO0A 4ZYGA 3LA3A 3D68A 2O3FA 4A8OA 2CWXA 3DV8A 4B3MF 5DM7F 2UXNA 2B3TB 2DW4A 4B9SA 1HBXG 5L3BA 3IRRA 1FHTA 1HDPA 3M6WA 5HLFA 2L3MA 1GXUA 3DQVC 3TW6A 1VFCA 1RTZA 2CAJA 5F0FA 4N77A 2HNDB 5AT1B 5FROA 4QYZK 3FEXB 3JAMK 4MYTA 1NKBA 4RX6A 1JLQB 4CDIA 3EGNA 4F91B 3FIWA 2PSZA 2Z30B 1H2TZ 3ILOA 1KTQA 3PX4A 1OCCH 2F7VA 1WELA 2V6CA 2X4HA 1R27B 1JLFA 3ITHB 3W65A 1PUEE 5EG0B 3E97A 1NSKL 1B0TA 2F3JA 4ECQA 4CWBA 5IT4A 2QVOA 4MFBB 4Y17A 3BO3A 3FF5A 2Z2MA 2LQ8A 1JWWA 1U2WA 2V8HA 2MB0B 1D5YA 1ERDA 1XIQA 3KLHA 4A8FA 3AOCA 4KAIA 2RQCA 2M87A 4G9YA 3AL0B 5K8OA 4QYZJ 2DR5A 3OMYA 4NXMF 2KL4A 2NXNB 3GLJA 2BVLA 4AIHA 1W7PA 4ZKAA 3CDIA 1C4AA 1L3TA 3PW7A 2WTFA 5F0CA 5LHGA 5IC4B 2BZ2A 4LF7F 2WHOA 3I0SB 3DU6A 4DR4F 1RP5A 1WSUA 4XN0A 3VPRA 4Y34A 3A4CA 3TAMB 2NAZA 4YOEA 4CT9A 2ZSIB 3TKYA 1OJ4A 2N4DA 2HK3A 2ZDPA 4X4TA 2L2OA 3OYMA 2PGCA 2UXCJ 2KJBA 1P1LA 2K4BA 3K57A 3HZEA 3FXJA 4WFYA 1KGSA 2OLWA 5DD8A 1NK0A 1FX7A 1MN9A 3PKYA 1YFHA 3ZQCA 2HNZA 2OJED 1SFXA 3A01B 3V8JA 2M4GA 2YKAA 1PAUB 4FPIA 1TTYA 4H4OA 4IOBA 2DOFA 5E3RA 4I1TA 1ZTWA 2JPBA 2X1EA 4IZZA 3H20A 3F56A 2ZZNA 4DJBA 1IKYA 1WOOA 4DMZA 3ABUA 3RJPA 1YOVB 5IYDJ 3MXHP 4BE1A 1ON2A 2Q6CA 4MKAA 3G71I 3QOEA 2R42A 3K8WA 1RISA 2QZ8A 2EFNA 3MECA 4R5PA 1UHWA 3G8QA 5CA5A 2L08A 3P9CA 3TW0A 3DRRA 3SSQA 5CVIA 4HEA9 1OWXA 4LF8F 1SL0A 2STWA 1P6TA 8AT1B 3MM9A 2DYRH 1PKUA 3HOVJ 3HULA 1S6PB 3KLGB 4PG8A 3WBZA 1B99A 4Q2MA 2OU2A 4CO4A 2W2NP 5K5QA 8ATCB 5HS8A 5EWFA 4IR1A 4KGMA 2VF3A 4BHCA 3J7Z5 4P2SA 2FRHA 2GV1A 4ZIWA 3AT1B 3OQ2A 3ZR8X 4F3OA 3J81j 5EEAA 1B70B 1LNQA 3AG2H 2V94A 2PI4A 5A6PA 2FQQB 3I0TA 1ZAVA 2R7VA 3S17J 2KFNA 5IT9Y 3LTOA 5H1SV 4ED5A 3VYRB 4KN4X 4C3JJ 2V1DA 2BV3A 2BRLA 4BXUA 1CJKB 5KK1A 4L3NA 4Y2IA 3R9LA 4CSWA 2F4MB 1GMWA 3EVMA 5HS7A 1P1TA 5FD6A 3AH6A 4P2FA 4X4UA 2QL5B 3QFHA 2UXDJ 3GF2A 3ZQLA 1UVMA 2DQRA 1RPWA 1HD0A 3V2UC 4DBQA 3JSBA 1N6QB 3VCDA 1RAEB 3RCOA 3FXQA 4NLDA 1RWXB 3IXQA 4FNHA 1FXRA 2VFUA 5I4MA 3H3VK 4HACB 3ZZYA 2HS0A 4XRMA 2W82A 4C8LA 4L5JA 4L9NA 5A8RB 4LG3A 4JI3F 3ELHA 2JFDA 3AODA 3FK7A 2F5CA 4I2PB 1UCNA 1U6FA 3W7BA 4AFFA 2CJ9A 4CIOA 2HR3A 5K7FA 1X1AA 2Q1LA 4L9JA 2DO4A 3IA0A 3ERED 4ATNA 4BJTA 3E01B 1I94J 4ED6A 1X19A 2F48A 2C2EA 1RTHB 2BA9A 4NLWA 1APSA 3K0LA 4A6DA 1FWKA 2MH9A 2R3VA 3MCZA 3PRBA 2KM8B 3QZ7A 2GO8A 3AHPA 1QPMA 1FRLA 3H1CA 2EPFA 3SYTA 4ID5B 4C3MA 3KLIB 2IAJB 3BC8A 1D8JA 3ETOA 3DM2B 3BGOP 4I6AA 2WVDA 4TNOA 3DHWC 3M05A 4DV2F 1N5VA 4HYKA 2VT3A 1J7KA 3ZZUA 1G2HA 1G1XA 4P9SA 2VI6A 3WGGA 1KHVA 2EINH 2LP0A 4MQ9F 3T1YF 5DDPC 3PW4A 4RLFA 3JRGA 3VVTA 1NH3A 1SBRA 1FNXH 3DDNA 3KLNA 3G4SI 4QR0A 2DMQA 1REVA 2D41A 1RTIA 5G0RA 5T41A 4MEYF 3MM8A 2VG5A 1I51B 3DLJA 2VIXA 2LDYA 2MDAA 5HSPA 3RR8A 2F5EA 1GV2A 1EA3A 3W9JA 2HOAA 1OY6A 3CT9A 3L2QA 3LQRA 1R0CB 4RGSA 2X6XA 3JREA 5L3GA 4A0YA 2XWYA 5E7OB 4X4PA 1LE8A 5GAEJ 1HBMB 3VAMA 4OHYA 3GZ6A 3QAHA 3MPWA 1OS5A 2E36A 2LMIA 2XMTA 1Z77A 1KLMA 1VIOA 4NLGA 1RT3B 2R5YA 1S9GB 1TELA 2G1DA 4AXIA 3BY6A 2QRRA 2VQFF 3RQIA 1FMVA 4F93B 3B4DA 4X4NA 2XYPB 3PHEA 4KH1B 1HBOA 4NLVA 5B09A 1UELB 1TKXB 3SYZA 2RQPA 4ES3A 4P73A 1IM4A 4OMYA 3R5CA 5D6EA 1N48A 5D4PA 4UUSA 2KRHA 4GVBB 1K7AA 2QWWA 2UU9F 4A3IJ 1YS6A 4JX6A 3EDRB 4AL7A 3DGPB 1S10A 3CIZA 3OPKA 1Q1HA 4PEOA 3SZGA 3AOBA 3T6BA 2Y1RI 1QDUB 2BJ8A 3VGUA 2A6MA 2AZ1A 2ZZMA 1YKWA 3D9BA 1YS7A 2ZHAA 1IUJA 1SIZA 4YDDB 4QIEA 1KQFB 2BMBA 3DGPA 3CUQC 2BYCA 1U9NA 5A2QU 4X4RA 4IHVA 4NE9C 3BR8A 2R5YB 3W1YC 3LP2B 5M3MJ 1UFLA 4DUTA 3N5FA 3OW2R 3A3PB 3O3KA 2VQLA 1K61A 2EB7A 4RWWA 2IDEA 3LSRA 1U6BA 2HXOA 3JYTB 3LUYA 1RA7A 4J9PA 4G6VB 2ELHA 1BE4A 3NOCA 3MUMP 2BW3A 1QE1A 4OI0A 3WG7H 4DR5J 1NLKL 2QL7B 1ETXA 1LDKB 3L95X 3M2VB 1C0UB 1Q95G 5AONA 1SAXA 1C1BA 1ULRA 2PN6A 2DA4A 1LE8B 3MCSA 2G2OA 4EEFG 2IMOA 3L7OA 2WAQD 2M8GX 4CO3A 3A8IA 1WF2A 1ZQ3P 2RUSA 2ZITA 1JJ4A 2CJJA 3PYGA 2D3ZA 2VKZG 4LFUA 3GFXA 4TLQA 3NCPA 2YX7A 2KT2A 4HTIA 3ZMVA 3CJ4A 2LLKA 3SFIA 2DDAA 3N6NA 2LBFA 2XS7A 1IQZA 5KFXA 2PE8A 5IM0B 3M4XA 1FE0A 3FBEA 2DJWA 5LSRA 3HVAA 4KGVB 2CQDA 2FVSA 1RHMB 1RT4A 2CQBA 2VJVA 1FDNA 4B9VA 2MLGA 2X1DA 4LOCA 2ZBQA 4IXAA 2COBA 1PYOB 1OQYA 4P6QA 3O2PE 4Y28C 2W2MP 2W7OA 5LXRA 3BR0A 4OZLA 3A0HC 2PMHA 1G6NA 1J59A 4XQFA 3WTSC 1QNTA 4F4ZA 2F9JA 3G96A 3M8EA 1HQ2A 3MEXA 1TAQA 1X3ZB 2QC3A 5J2MA 4I99C 3U2RA 3CQZJ 2HQIA 5E1XA 1ZGAA 1LNWA 3C7JA 2ZH8A 2JQ7A 4BEHB 2HEOA 1S1XA 1MMLA 2R7UA 1NPKA 4DL4A 1A35A 4ICLA 1VQ8I 1D8KA 2LSOA 2ZBKA 3U21A 2PBIA 4RAZA 5IV3A 5D15A 2ZJPQ 3GG1A 4F02A 4H54A 4ENMA 5E3QA 1SQGA 1FVSA 2VJ5A 1UAAA 4OQJA 2CG8A 3V5RA 2RKHA 4LF4F 3M4OJ 3BG6A 3UDVA 4ETZA 3E6CC 2JSCA 1PGZA 1REVB 1X1DA 3F22A 3NQOA 1MROB 1WHXA 4DL5A 4QWBA 3IUOA 3CC4S 3D5RC 4C3IJ 2CQ1A 1T0TV 4Q0BB 2UU9J 1YWXA 2GQ2A 1RLDA 1I1GA 1XGMA 1SV5B 3PACA 1S9EA 4DU8A 2UVWA 4O6JA 3CO6C 2HLUA 4XDDA 1D0EA 1HI0P 1IKYB 5BPDA 5HI7A 1VIXA 3W3CA 4CCNA 2DA2A 3B6BA 1IR0A 1RTDA 2ZMEA 4ZLNA 3TX8A 4QWEA 2OFHX 1FBSA 1JUPA 3QIPA 3KDOA 1LK7A 4Y15A 2Z57B 4X65F 3PO2J 2DJNA 1VRTB 2QEXS 1OCTC 1UWBA 1YE9A 1RHUB 4IOAQ 3C8YA 1FC3A 2HOEA 3O5TB 2OPSA 4NEYA 3TP2A 1M0SA 3PV8A 4F4AA 3MR7A 1TT5B 1D9FA 4OIXA 4JB8B 3KLEB 4DSIA 4HBLA 1JNRB 2V63A 2UZAA 2AS5F 1LPQA 3W6JB 2OUGA 4J9UE 2EG2A 4OX7A 2JVRA 2W1BA 4WZQA 1F2HA 2C3UA 3H2UB 4HVZA 3FBIB 5HATA 1WZ2A 3UKGA 2XRLA 2XSJB 3LSTA 1H7XA 1BHNA 5HNFA 3HM5A 4EVIA 2MTLA 1YJWI 4IHSA 2J5PA 2YH1A 1D9DA 4ZTJA 3JYTA 3LA7A 3CDUA 4A8YA 1QHGA 3MZHA 3PM1A 1H2VZ 4LJMA 2BHZA 4UB8C 4UVAA 1MH4A 5D3GB 1HNVA 1W0TA 4PUOB 2VJJA 5E3CA 4M9XA 1WF0A 4Y3OA 2IS4A 3PYEA 5KFUA 5LGUA 2ICWG 3WTYC 2HVQA 4ELVA 3JTOA 4LSNB 4EQQA 3IRWP 1TVRA 3PEJA 1KN6A 4FKYA 2MZQA 5KFKA 4PK4A 2J0QD 1RTDB 3UVJB 2KFYA 2ZFWA 2IY5B 1U7LA 2MYSA 5G4DA 4F52A 1DGRM 4XMYA 3CMES 2DKOB 3EGWB 1XR5A 3BQ1A 4DV3F 4BL0B 2K85A 3EVWA 3CCTA 3VHQA 2BW7A 2STTA 3UCUP 5HDGA 2IRUA 4RGUA 4E7KA 4JP8A 3TUJC 2C3OA 2RNGA 2H51B 4XICA 3BKTA 2LQ5A 3P6YC 1JXVA 4ECVA 2V6EA 2YNIB 4MIAA 4MTDA 2O7OA 3PXGa 3SQOP 2GNKA 3FHZA 3KPHA 1W7WA 3S3NA 4QU6A 4U67Q 1NKEA 2JSXA 1GH8A 2ZVSA 5DQGA 2B4PA 4OHWA 1O5JA 3KP2A 2K3IA 3MD1A 1SFUA 3MFKA 5A0YA 2IGMA 2X6YA 4F7VA 4DR4J 3PFOA 2BW3B 4E7ZA 3BZQA 4FZVA 4I7FB 4FBUA 2MLYA 4II3A 3S1RJ 4ZYEA 1MKMA 2HTSA 4PXDA 1SANA 1TKTB 1YJWS 2GHVC 5AXLA 3OHBA 4ON0A 3J7ZT 3OYLA 1B72A 3PKMA 2X51A 4E4HA 1L3UA 2QT7A 4ZHRA 3K4KA 5HNHA 4HDVA 1S5ZA 1JKHB 1X5SA 4U96A 3K5MA 1H3DA 1MLAA 4RW7B 4PPZA 3GV5B 4R8UB 3B6CA 3JSMA 4ESFA 1HW8A 4CLFA 1FFSB 2QL9B 2ZH5A 4ZP7A 4ANDA 3A1YA 1WWXA 5KFRA 4A47A 3MTJA 5D78A 3UDEA 3CEDA 2EBGA 1NG6A 4O4RA 1UJ5A 4M5GA 4IQJA 3G2XA 2D5VA 1T33A 5KG7A 4X64J 1E17A 3ZQGA 3HOWJ 3S7RA 3NGUA 2DFHA 2B51A 4I7FA 3MFIA 2VBYA 4USVA 1XMQJ 1L5UA 1Z9CA 1RT1B 3RAMA 2YXLA 2CUYA 1VTNC 5HDKA 4KIFA 1S6UA 4USTA 4D3HA 3J81U 3O6QA 4HLYA 4WE1A 2LQBA 2HZDA 1T3OA 3KJFB 2HVEA 2QMXA 2BE2A 2R8JA 1ETOA 3ASOH 3CMMA 5GP9A 3PJWA 2Z56B 2LH9A 4GKKJ 3Q8PB 3G1MA 3F44A 2I9SA 1K78B 3RB3A 2L41A 4WFAQ 3W2WA 2CW8A 3AQOA 2X3GA 3J7YI 4FXWA 4OIQF 1N77A 2Z58B 4M5NA 3BROA 1BLUA 1K83J 2CQHA 1H8AC 4Q4ZF 4XSZF 1T03A 1B4SA 3E2EA 5EZGA 5ETPA 1KVIA 1UJ6A 3PRDA 4ECWA 4JI6J 3NS6A 1UVIA 2KP6A 5ICEA 3IRQA 1FYLA 5E3AA 1EQ0A 4U87A 3A3NB 5FB2A 2NR0A 1AW0A 1FOXA 1WORA 4TQSA 1LWCB 1YJNI 5M2UA 1SH2A 3ML6A 4BXXJ 5B1AH 3JRDA 1HBMA 2AJ0A 4UW2A 4WTOB 1BI1A 1SH3A 1YW8A 3EVOA 4OZNA 1JI8A 4Q44A 2LKSA 2IRYA 2VKVA 3JSYA 1S79A 3GU0A 4GVLA 2U2FA 4OX8A 3OBIA 1YQHA 4S0HB 4FVCA 1MBJA 3DWLE 2QLBB 3MM8B 1IN8A 1VS3A 2EFOA 3ZNJ1 1RWMB 2ZOFA 3QRFF 4DI6A 4C3HJ 4G6TB 1R4NB 3LQVA 2V8GA 4ZYDA 5IOZA 2XCPA 1W2IA 1X4CA 3TEHB 4F26A 3NNAA 5DCMA 4HX4A 1I6HJ 2XHKA 4XO0A 3MUVP 3TP0A 1CG2A 3SMZA 4USUA 3LSHA 2V1XA 4CCLA 3KK3A 1P27B 2KZVA 1KFDA 5IYCJ 3OYFA 5KAKA 1HL6A 3MECB 4PABA 4RB2C 2AEJA 1TWFJ 3H42A 3GPAA 3CCMI 1IQTA 5D5VB 4HF0A 3S15J 5I3UA 2GM4A 5KG2A 2FMLA 2D3OR 4F8RA 4QZVB 3RRHA 2ISYA 4LGWA 4O0IA 4GKKF 2V4QA 3MEEB 4EZ9A 1RHJB 1T2KA 3MAHA 1G3SA 3BSAA 3R8YA 1AOYA 1WKLA 4LUBA 3B54A 3V6KA 2AF6A 1MWYA 4I67A 2IA0A 2GIRA 3J7YU 3GQCA 2ZMEC 3TJAA 4Q7AA 3CC7S 4CICA 4RW7A 1HWIA 3CTRA 2JN6A 4B47A 2AEFA 2KB2A 2HQFA 1BJZA 3LPYA 1FZPB 2KT0A 4KV8B 1JJ6C 2QQAA 1IKVB 4FXDA 1DU0A 1JTXA 3OOPA 5HDNA 1LW0A 1Y8QB 2NZCA 3CF2A 1RT6A 3MF5A 2WTEA 1QY7A 1X1CA 4RBUA 3OYKA 4HPQA 5KFWA 1RT2A 4QWCA 3K10A 3CPWR 2LY2A 5H9EJ 4KPCA 1R8BA 3GCMA 2KVIA 3IG1B 3ZOBA 3T8RA 4F3QA 2MEWA 4BXFA 4Z2YA 1J5OB 3T1BA 4XL9A 2HWTA 2HHXA 2OD4A 4FF2A 1LXNA 4NLOA 3H5NA 2HMIB 3CCLI 4AC0A 3KP4A 4JV1A 1AA1B 2XMUA 1G3YA 4LF6F 4Q47A 4WU2A 2GQQA 4NZ7A 2KIMA 1VQLI 5J2QB 3R0AA 1NG7A 1D8YA 3WTWC 1I1SA 1VLYA 1JKRC 1VC0A 4KICA 1C1CA 4U0VA 4NLRA 1XNRJ 2Y0MA 3QWUA 2LA4A 5EG0A 4DUYJ 2DVIA 3CLOA 4B09A 1XS9A 3VEPA 1VQ7S 3ZTPA 1XQIA 1JLAB 4CH7A 2A0FB 3ZTQA 2O0YA 2XS2A 3NXZA 2PMZD 2D1HA 5ILSA 1TKZA 2ZMEB 4AU7A 5LHIA 2FBIA 2ESNA 1T02A 4LLGF 2LCWA 3TEGA 2I2YA 5CPRB 2VODA 1YJ9S 1WJCA 2WSCC 2IGKA 3ZC4A 3O8HA 1UFMA 4HLBA 2R2SA 2FVQA 3NRVA 1IC8A 1MSFC 4O44A 2DFIA 2DGXA 2GXGA 3OYCA 3DRSA 4HHUA 2XV4S 5C24B 2R8GA 4CM0A 1FJGF 7AT1B 3PX6A 2E9RX 1MBKA 1RWNB 3E1SA 4C8KA 2R7SA 3QGIA 2KHMA 4FNIA 4RW4A 1Y0NA 4B4CA 2LY9A 3TYTA 2R5ZB 1O7LA 2WV1A 3ZCOA 3KTQA 3Q8VA 3IC1A 2A5YB 3G6VA 4XLCA 5FD1A 3LANA 1EJ9A 2HHVA 4I6WA 1PILA 3EXYA 3KUHA 4U8VA 2DK2A 5HLGA 1I50J 2GMHA 2J5OA 3GYHX 4URSA 3T5JA 1B8IB 2DIVA 3C6TB 2IFXA 1R89A 5D4SA 2Q66A 1PCAA 2B9YA 3CLQA 4RO0A 2GAUA 2WBRA 4RW8A 2VFRA 3C66A 1QLNA 2K7KA 4HDGA 5K5RA 1X9WA 3EUAA 3SJMA 4WWSA 4OHZA 4N9HA 1GHCA 5A8WB 5C2CA 3TGNA 3GTQJ 2GMJA 1LJ9A 2RNJA 5L3FA 4E98A 3KLOA 4LG0A 1Z4UA 4IFVA 4QLCU 2K2PA 1XC9A 4A6EA 2E9ZA 1K79A 3ULHA 3CD6S 4IF4A 1IXRC 4BACA 4HI2A 3CCQS 4JI3J 2EK1A 2ZD1B 2O9LA 4LR8A 3H7HB 4EJVA 4KJZA 4AVPA 2H8RA 1C2PA 3OOUA 5B66C 3BGRA 2C2DA 4ZVEA 3QQAA 2K3KA 2A07F 4WKRA 1HQEB 4MHGA 1TK5A 2ZJPF 4ZVUB 4QW9A 1V5VA 4ZVHA 1FRMA 3RUBL 4DF4A 3UD5A 3L2WA 1S6QB 2J7UA 1SL2A 3A3OB 4IH5A 2UVUA 2CPIA 1RU2A 1LDDA 2HHHJ 3G8TA 3HHLA 3DBHB 1NCLA 4FYWB 4IHXA 1JUMA 3BM7A 3F3XA 4P55A 5EYRA 1XG1A 2RS2A 3DTEA 1YX3A 2A05A 3DLKA 5EN1A 3C1DA 3DDIA 5CH7B 3CCQI 2B56A 2W4DA 2N82B 2R7WA 2M7SA 4M5MA 1K6YA 1T08B 4KT6A 2F8EX 2AZ3A 1NHAA 3GLLA 1X5PA 3CDLA 4EGLA 4JI1F 3FRZA 4C2TA 1VJQA 4DHVA 5F3TA 3QSIA 3Q8RB 4YEJA 1ZRDA 3HPHA 2XASA 4IRHA 5J8CA 2W48A 1X3UA 2MKHA 3BSCA 4PUOA 1FNNA 3IH2A 3G6YA 4UUSB 3OD2A 2M8EA 4DYQA 1JLCA 1KZHA 1DZ5A 3RBEA 4CO2A 5HN0A 1NJXA 4L5IA 1SC4B 4X4VA 4K7QA 4IR9A 1A36A 2XLKA 1XMOF 1Y3JA 1S3JA 5DQIA 2J5AA 2ZBRA 1MDMB 2WW4A 4BHPA 1UEVA 4F04B 3DLKB 4OZ2A 3KHRA 3N05A 2HDWA 3HHDA 2EQRA 2LU1A 4A93J 4DDFA 1V5GA 1S0MA 2FY1A 2QBYB 1M5HA 3PSFA 2UP1A 2AQEA 2JLEA 2VL1A 1MDMA 3ZXWA 4Z6YA 1BC6A 1ZELA 2VT2A 2O1PA 3I9V2 2AJQA 2H6BA 1SEUA 3VODA 2GAGC 4MTPA 2UZKA 2GJIA 1ZAWA 3HSZA 3MD2A 2KFDA 3BZKA 4M5DA 3MKLA 1TV6A 2DODA 3I3LA 3E51A 3IHUA 3GTMJ 2OSQA 2R7DA 2EV6A 2OQGA 4KRWA 1BBYA 3ZZPA 2LEAA 4B17A 2OA4A 4DV2J 3ETMA 4B3TF 4B3SF 2E1MC 5K5MA 1H7WA 1M5OC 3DOMA 3VAKA 2EZHA 3KUEA 3FMBA 2ZKTA 1RAFB 2DGQA 3ZGKA 2MBFA 3H40A 1YITS 3R97A 3U27A 3G73A 3VB2A 2DGWA 2QSWA 1JLQA 4IPAA 5B0GA 1LOUA 2PA3A 1URNA 2ZBCA 6FD1A 5LBQA 5D4NA 5HQLA 1X5TA 1UPMB 1TKZB 4YIRX 3H9GA 1ETKA 2F5VA 4RA2A 3ZN1A 2DBBA 4EZ6A 1TL7A 1SD5A 1WVRA 5DG8A 4DWIA 1F5CA 5GMKa 4DL2A 4PJLA 4QIFA 2R7RA 2MSSA 1PBUA 2CNKB 3EE3A 4N8OA 1R5GA 2IA6A 1SMYF 3I5CA 3KG4A 3HOXJ 2IM3A 4IO1A 4XNFA 5D0RA 3LFUA 3A1YG 3G1LA 2QM3A 3Q89A 1RE1B 2KO1A 3UI3A 3MN2A 2XB0X 3ABTA 5IT3A 3N79A 3TANA 5LOQA 1S9FA 2NNNA 1OY9A 5F0UA 3MR3A 2IJLA 1FXDA 5E3PA 2VC1A 4HF2A 4HQMA 3EZOA 2W57A 1XSDA 1DPRA 3ZMTA 4USHA 3BOQA 4DOZA 1HR0J 5EWEA 1NJZA 3G82B 5A2QK 1FKPB 2ASJA 4NXNF 2LY1A 3SDGA 4I7HA 4ABZA 1SJQA 4XKBA 4PZJA 3KK1B 1RABB 3FSYA 1TC3C 4YFXF 2DNLA 3N01A 2FZGB 1TNTA 2P6SA 1D1CA 2NLWA 1POGA 2AWZA 5EUHA 1AZSA 4BKXA 2XAGA 1FEXA 4P2XA 4ZCMA 5HMXA 1SJ1A 3I59B 1JJHA 2XF6A 3OL8A 4RW8B 2QYGA 5FRMA 4XR6A 4IOCQ 3UN3A 2DT5A 2RAEA 3J80K 4G6DA 1A9NB 3PHTA 1U8SA 4NEZA 4ZCKA 2NRAC 5F8MA 1H2UX 3CE8A 3NP5A 1R8HA 2IVYA 2V8VA 4G1PA 4CNYA 4KMFA 3ZQIA 4EGZA 2OTLI 2FLLA 4I2QA 3C19A 2ROGA 1WI6A 3MMJA 4ZVTB 1M5KC 3K4MA 1NDPA 5IT9Z 3HSEA 1MMGA 5F3ZA 2RD5C 5DS9A 4DQPA 2K3PA 2V26A 5F04A 2L5QA 4RW4B 3SSSA 3D3BJ 3ENQA 2W8KA 3N0VA 5LSLA 1WFXA 4NRUA 3PNYA 4A3CJ 3D54A 3UNGC 4A3BJ 2NUUG 3S2DJ 4USJC 4WF9Q 5IFMA 1Q5YA 2R0QC 2F8MA 3HOYJ 3D5MA 2N7YA 2GA7A 2WV0A 4FF1A 1V4RA 2EIKH 3NMRA 2R92J 3TDZC 2YTCA 1FVQA 3BDDA 1T95A 4FDFA 3BZ6A 4DQIA 2RQMA 4ZVSB 1S0OA 4G7OF 3RI4A 3J81K 3HT0A 2CMPA 3K2YA 1MD0A 1NH7A 4F2RA 3BO2A 3M6XA 2MZTA 3QSYB 1TFWA 2XHWA 3HOTA 1VQSA 2JEGA 2ALZA 3HG9A 1SC1B 3OSFA 1QD1A 4M9ZA 2O67A 1NUEA 2D9OA 2E2IJ 3VGSA 5KT7A 2LKXA 3GIRA 1URRA 3RTRA 1GXQA 4D5CA 4DL7A 4O3RA 4PAAA 4ALZA 3R3TA 3D2WA 3WTVC 1IBLJ 6FDRA 1HPZB 2CPYA 3T0YA 1I5ZA 3FCHA 5IXUA 4BDYA 4V19K 3SV4A 1M1GA 3FC9A 5J4VA 3PNTA 2Q3PA 2GIFA 3IH3A 2LECA 3DBLB 3ECOA 4N47A 3MDFA 1XMOJ 3AAWB 1YX2A 3H90A 2BOAA 1EETB 2U1AA 1NJYA 2HSEB 2TCTA 5FDLB 4E7IA 1BR4A 4TYBA 4A3GJ 4NB5A 2OKQA 2EFVA 2IXSA 4FISA 3LL7A 2DU9A 1RT5B 2OZ6A 2DK5A 5FRNA 3CP2A 1IUFA 4CGZA 3HYIA 1YW7A 2VG5B 2MLKA 2M45A 3K70C 3OTCA 3U1KA 2QIFA 1DQAA 4PRFA 2V69A 4CI0B 4ECTA 3IGNA 3VZIA 1K47A 4CUGA 4E2FB 4EI2A 1SIWB 3TA1A 1WTBA 2PX9A 4CZCA 2B5JA 5KFCA 1Y00A 4ZP8A 3DFGA 1WJFA 5GAGI 5HVHA 2V8DA 3WE3A 4O3SA 1SFKA 1S76D 2NSCA 5BR8F 3QPHA 4L76A 3MQ0A 5BYRA 4CLUA 2L9VA 1JLCB 1U1KA 2ZWPA 1BY9A 3N9UC 1R1TA 3A01A 1HQUA 4KFBA 1VBYA 2Y9ZA 4NA3A 4R25A 1N5YA 2AP6A 4KHPF 5ETVA 3TL4X 1ETVA 1W1WE 1MU2B 3PQKA 4L0YB 4YELA 4IRIA 3CIMA 4O5VA 3RGIA 4IFYB 4O3QA 2NXNA 1JJ8C 4A3FJ 1WF1A 3DTIA 4IG0A 1KKHA 2P6TA 3OR1A 2VE8A 2LVWA 4EK2A 1XMXA 4P74A 4J9QA 1JKOC 1Y0HA 3T1HF 2VG7A 2VN2A 3A8KA 3I0SA 4PJNA 4E0DA 1FJ7A 3WHBA 4K2JA 3OUYB 3SI8A 3GTPJ 1UHMA 1A5JA 2YKMA 2OAUA 4DR3F 2K27A 4U7UK 1OYDA 3HZJA 1UFWA 3ZP5A 5FLVA 2KU7A 2DJIA 3DLGB 3MZIA 3FMWA 1VK3A 2LEPA 2COLA 3RSNA 2ZBIA 3QPLA 2YWHA 3OTDA 4F0KA 1WSRA 2DTZA 2L9SA 3ENAA 4C0OC 1HBUA 2D3UA 2JA8J 2Y31A 2V67A 2JMWA 3UVJA 2VE9A 2QQBA 3C2HA 1XTAA 2HYFA 3CMAS 2JL9A 4DSJA 4WYLA 2DNGA 2M8DB 2EA4A 1S7EA 2LC2A 4URQU 3K9TA 1WCMJ 2RT3A 3LP1A 4R8UA 4ZJQA 1W0UA 4NPOA 1OIAA 3O8WA 4XTTA 4DQ2A 1UHSA 1CJUA 2DD8S 2WVCA 1BQNA 4DPUA 3H8YA 1VQOS 1OFCX 1RIOH 4JYAJ 2CNNB 4UZBA 1LQ1A 5DEQA 4ZLJA 1CS4A 1SH0A 1IXSB 2ZJQF 1VLOA 3ADAC 4KN7X 3CF5Q 1S49A 4DFJA 5F8HA 5KG0A 4CH1A 1MG7A 3KMQA 1ZG3A 3MM5B 4LSLA 5BJRA 5JMNA 3ZZZA 4LF5J 4M5LA 1LUJB 4JYKA 3CCSI 2H94A 1YGYA 2UUAF 3VOEA 3JRCA 2EVZA 4J9KA 1TP4A 1IBKF 4Y2KA 2AJ1A 3M8JA 4A5MA 4DUZJ 1O3TA 3DRYA 2HVRA 4R79A 1U48A 1DPUA 2XC9A 2FLOA 4MNUA 1JLEB 2KTQA 1MH3A 2OUMA 4RW6A 4JI2J 2JA6J 5HMZA 4YR0A 2FJWA 4HDHA 4YMEA 3HPGA 3DCAA 2KRCA 4MH8A 3LSPA 2YNIA 3HDSA 4TLRA 2VFSA 2DA3A 2VD3A 3GFHA 3MEDA 1ZETA 2R8KA 5F0HA 1V54H 2JDJA 2KRBA 2XG8A 2KZGA 2VKEA 4ZP9A 4ZPCA 3PIOQ 2LF7A 1IRGA 3KK2B 1ZK8A 4PWUA 5C3EJ 4OLPA 1U0JA 1AZSB 3WX4A 2HYIB 5D0HA 2P9GA 5IP7J 1FK9A 2I5UA 3Q24A 2HPIA 1KC8T 4G1QB 1TTHB 2YNHB 5L46A 3MEGA 2BKOA 2B8QA 3QP6A 3QPIA 1KU2A 1L0OC 2MA3A 2LP4A 2IRXA 3ZZ0A 1P7JA 3PM9A 4MJKA 2DNOA 1WJ9A 1IAWA 1YG2A 1B8IA 2HHWA 4HA8A 3R6SA 1QSLA 1FEEA 1T11A 2YKQA 3HRMA 3KNAA 3NAHA 4OYXA 5J2QA 2M70A 4JX5A 4EMSA 5LHHA 5FJ4A 1EKEA 3J7AY 5HJXA 1HWJA 3K4JA 1QRYA 3GCXP 4LVNP 4LR9A 1FERA 1U5TA 3OYIA 1ETYA 2LXFA 3S3OA 4J5OA 1WC6A 2O03A 1ZGWA 1WRJA 3LSKA 5A6WA 2EZKA 1TWAJ 2G0CA 2ELJA 1R8CA 5ICCA 2QENA 4Q5SF 2DXEA 5D8HB 3I4MJ 1VQYA 2KT3A 3M9AA 1U8RA 4WK1A 2VA2A 2DHSA 1S0VA 2F8HA 4BLGA 4JI0F 1I6XA 4BJ5C 4A3DJ 2JJ7A 5ED4A 3CCSS 2V4JA 2RVJA 4O44B 1HWUA 1BOBA 2GOMA 4EJTA 4DFKA 4K2XA 2ADCA 2G7HA 5L1JA 4WF2A 2WY7Q 3AXKA 4I56A 4O3PA 4CLWA 3BJOA 1OPCA 5GAEU 2J0WA 2EJRA 3PFYA 3G8SA 4ITVA 1V5FA 1YJVA 3D0HE 5LXYA 3KHHA 2FEZA 4DPTA 2IHR1 4XDCA 4KITB 1MMSA 4KPYA 1TK8A 2QCOA 5HBMA 1HNIA 4ZYAA 3ET6B 5GAHI 4ZIVA 3C2PA 5K20B 1X4GA 4LFAJ 3LA0A 2RDDA 3VAGA 3KX2A 2BV6A 4OYWA 1V3FA 1U3EM 3X1LB 3ZZOA 1SVLA 1NPRA 3M8YA 4B3RF 2WWYA 5JI6A 2LKZA 5HANA 3W2VA 2BXJA 1FTTA 1NNDA 4YDXA 2RU9A 1ZLJA 2AXLA 3HHHA 1TL3B 3FXRA 2UV8A 1OPZA 3C6UA 1ETWA 4M73A 3RZOJ 4M5JA 4UUXA 4YS2A 2LVSA 1PVEA 1KEKA 4ER8A 2CQNA 3GV7B 3S8PA 3LPEA 5F27A 3FJ2A 1I27A 1SKWA 1V55H 1YSJA 2Y2ZA 3GJTB 3MM6B 2VJ4A 3M1VB 5LFAA 5B0FA 1FX4A 3AAFA 3PFIA 3E6BA 1ZM2A 2XAUA 3K17A 3L4BC 3LMMA 4M3FA 3SIPB 1ZZNA 1BIBA 3JRFA 3V7RA 4PWWA 3EUHA 4UOHA 1Q82T 1BWVA 2CQGA 5EGOB 1H88C 4ZPVR 5C24A 3IWXA 2HHTA 2UXBJ 3BCBA 2JEFA 2DXIA 5GTHC 2XAFA 1U9OA 2IEKA 2O3DA 3I6PA 5GAGU 4RBOA 5F41A 3HT3A 4B3RJ 4A8WA 2Z2ZA 2IS6A 3GJSB 2H6CA 3U1NA 2BXZA 3WGHA 2QO3A 2P5LC 1ZPWX 2HNYA 1TR0A 1YRUA 2C28A 1BW6A 1Z2ZA 2OPSB 3GONA 4EUVA 4HX8A 2GA2A 3O2IA 4Y52J 2H1KA 3CD7A 1HYSA 3VWSA 2MSYA 1PYVA 4QOTA 4ERDA 2MKKA 5MLCV 2YVSA 3WU0A 3EWGA 2JHEA 3N6MA 4RB1A 2EFGA 4PSWA 1VQ9S 1WDDA 3NRBA 2DT6A 4FQGA 3QU3A 1TT0A 2I8EA 4JI8F 1F5BA 3NWRA 3X2QH 3V4MA 3IRXA 1YG0A 1D3WA 5LGTA 3T6JA 1P4AA 2PMWA 5FKLA 4WIQA 5KAIC 4ZJOA 1FTCA 3IBFB 2C6YA 5F64A 3R7SB 5CQGA 1ACMB 3GWCA 2KT5A 2E1NA 2AJ4A 1EZZB 2LQ9A 2OPRA 1FOYA 3HEFA 2VPXB 3BTIA 1AB8A 1AFJA 5KT2A 4CT8A 3R7NB 4BBRJ 1DLOA 4C8NA 4LFBF 3ILLA 3AG4H 4ZPWR 2KXHA 1HNXF 1AUSL 2GOXB 5DCFA 5AIQA 3I4NJ 2KM8C 4OAZA 3JTHA 2BKNA 4FF4A 2R7FA 1N36F 4ICLB 4F55A 2NXEA 2G13A 4I98B 4BY7J 1USSA 1WDTA 3B4MA 4UOFA 4ZDOA 2HVIA 1ZTRA 2ILZA 3BKUA 3BP8A 3ESWB 1DDNA 3PR5B 1UVNA 1S1UB 2XEXA 2OO4A 4A69C 2RAQA 3CJKA 1OLTA 1WKJA 1ZOTA 2ZH2A 5ETSA 2Y0SD 4D5FA 4H4KC 4MT1A 4UHTA 1NBEB 2HWIA 2XS5A 4FT8A 4WXWA 2J9DA 3THVA 3MHYA 1RWUA 4C97A 1BQNB 4RW9B 2H1YA 4N76A 4DCOB 4ZDLA 3U1DA 1VNDA 3AG3H 1F43A 1IW7F 2FVRA 1JKHA 1FWPA 2HQ5A 1P8GA 1RZMA 4BQOA 4OIRF 2D1CA 2VKDA 3FHNA 2E35A 1PUFA 1I39A 4EJOA 2IBOA 2WVBA 4IO9Q 2OCEA 1SKRA 3QRRA 3OL9A 2CUJA 2FE3A 1YLFA 2VBZA 4F92B 4X6AJ 1HNWJ 1QU3A 2G4BA 3HSRA 4NLXA 2RJZA 4M3EA 1JGGA 4MIBA 2IW5A 4IX7A 3TZYA 5F8JA 2JEJA 1UPPA 5GVQA 2CXEA 1HNZF 4KO0B 2M8HA 2W01A 2E5JA 3OLBA 3QGGA 3H0GJ 4M6YA 2DHXA 4ANJA 3JAMZ 2JWTA 4C48A 4AXJA 3FBFA 3F73A 1U1LA 1FMWA 2PC6A 3RKQA 1IBKJ 1X1PA 3GR1A 2BM1A 2R4FA 1Y5LB 2MW8A 2GCFA 1X4PA 4U7DA 5FLXZ 3M2UB 1Z7UA 2GWRA 4GCVA 3HB9A 4A2UA 4LF4J 2MQOA 3A0BC 2CPZA 4K0KF 2FGOA 3J7AO 4DZDA 2V6AA 4M1KA 1T39A 1RHQB 3BR9A 1RT4B 1J27A 3QT7A 4P71A 4RBTA 1BMQB 4FE4A 4L9TA 2HGCA 3LF0A 2JNJA 1ZLKA 2HNDA 4M5DB 4IHYA 2NSBA 1G6BA 5BYSA 1ONVA 3LSIA 4NYOA 2DMUA 3D1NI 1Y10A 3P3DA 3C6TA 4J19A 5DTDA 2DRDA 3SCLE 1S57A 1A6IA 1Q5VA 3RR7A 4MMOA 4ED4A 3Q0VA 2YKMB 3GX4X 1DY3A 5TISC 1ROFA 5JVHQ 5KHDA 3GXOA 2XGCA 2MKJA 1TL5A 2CV2A 2MHNA 2UUBF 1YIJS 4LFBJ 1J0RA 4A4JA 2EPIA 2F6CA 4RLQA 3VYTB 1APLC 2CPFA 2CPDA 4RM3A 2YUSA 2BOLA 2UUTA 2IM0A 2QQ9A 4A3JJ 3EPIA 4D9JA 2OIHA 1U2CA 1CJVA 3QT8A 5DGAA 1T7PA 3PDNA 4URGA 3RKYA 1VHFA 1NDKA 1IXKA 2ZC4A 2QGFB 1RT1A 3H5UA 4RZRA 3I87A 3DPLC 3PIPF 1IBCB 4YRVA 4UXNA 2X1CA 2UV1A 4IEJA 2FHJA 2BEFA 3RBDA 5CCMA 4HV6A 4DFPA 2UXCF 2CZ9A 4C8OA 3Q3SA 2HGNA 4DGWB 2VH7A 3QWPA 4Q5VA 4OYIA 4U0YA 4LBHA 1N25A 2QX0A 2Q0OA 3CDAA 4LITA 5KOWA 2KISA 4OX6A 4H4KA 4XSXF 3T3FA 2XI3A 2FHKA 4RDUA 1N88A 1EHWA 1KU3A 3DRPB 3EGZA 4UB6C 3BN7A 4MGRA 2HZAA 2XMVA 2DH7A 1J09A 1MBEA 1BC8C 1XR6A 4W92B 3HUGA 3PX0A 2OH2A 4KGXB 2EIJH 3QGHA 3K1MA 1UA0A 4EYIB 1T94A 4RPFA 3ROUA 4WCGA 3ZMDA 3JS9A 1CULB 4K4TA 2NXUA 3CW2C 1VBKA 2XMWA 4HHHA 1I3OB 4QWQA 2L9RA 1KVJA 4NQWB 3K5PA 4BDPA 2VQFJ 3VWBA 2NS7A 4G7ZF 3TAMA 4Y00A 4HLXA 5A2QY 2ZUAA 4B44A 1SVOA 2EKNA 4CM2A 4ZS6A 1MIJA 2Y3YA 2OC6A 2KRFA 1OQ6A 2CQXA 5ETMA 1ZM3A 4L72B 2JLGA 5F8LA 4X4OA 3S93A 3P5JA 4WFZA 1HNIB 3K89A 5H9EK 2LA6A 4I6ZA 2FD5A 2IA2A 1NSQA 3L2UA 5JHUA 4IG3A 3BT9A 2MQNA 1XCBA 3VTIA 1YX5A 1SKSA 2L02A 5A8WA 2TRTA 3HGYA 4CDGA 2J6UA 1FSEA 1XGOA 3HKZA 4QSHA 1V3RA 4ZCLA 4BQQA 3R7BB 4GKJF 1KYZA 5J1YA 2RC4A 3OIOA 5JVGF 5KFSA 5D4OA 2IJNA 1HNZJ 1T6SA 4YQWA 2W00A 1MBFA 5CYMB 3OYJA 2VQCA 3S1NJ 1CQTA 5L9XA 5I3UB 4C2MJ 2XHCA 1NH8A 1LWEA 1B3TA 2ZJQQ 3NCRA 3F6VA 1SUQA 1JKPC 3PTWA 1C1BB 3HD1A 2KHDA 1TZ0A 4DR6J 1UW4A 2MKCA 2OPPA 4N8NA 1S1TB 4IL6C 2M30A 3H5YA 3KJQB 1HCRA 2P9EA 4CCMA 2ZJRQ 1FTRA 2QEXI 1Q7YT 4ED1A 1N34J 1RT7A 4CCKA 3KP3A 3V8LA 3KYLA 2MGZB 3P49B 3CD6I 4E7JA 3SCIE 1IXCA 3V42A 3NGTA 2FHJD 3IN5A 1YYVA 1IKVA 3LP0A 5D8LB 4KA4A 3L2RA 3CUQA 5DV5A 1SI9A 1VZ0A 2X1GA 4N7TA 1Z21A 1HD1A 4WXHA 4WTYA 3TUPA 2ID3A 3AB4B 2H8WA 1RADB 2V2ZA 3TAPA 2WCXA 3S14J 3BG7A 3MI7X 4L74A 1W7PD 5F8GA 9RUBA 1Z2LA 4OYOA 4AE5A 4KHRA 1S1VA 3DI6B 3KLFA 2B7EA 3AFGA 3KK2A 1JTYA 4P96A 1XD7A 4EU0A 1KWMA 5CYQB 3KLIA 4LFAF 4ENJA 4YIFA 2QLZA 3CZ6A 3QT5A 1Q8LA 3HRSA 3SZTA 2O8KA 1NPPA 5KG1A 5KT6A 4BWJA 3S2HJ 3PO5A 1X0PA 4NXNJ 2VDHA 2VZ9A 1T8IA 3F8MA 1K0TA 2P4WA 3K58A 3KZIC 4NUBA 2QFJA 3PUFA 3J7A1 2F2EA 2ZUGA 3WTUC 3MMYB 2BABA 2P9CA 2HYGD 3KP7A 5LRSA 4L75A 3ZXSA 4YN3B 4R5PB 5HJYA 1U5TC 2K9NA 5J40A 2FJXA 4CZZA 3BG3A 4JYAF 2N3OA 2QV6A 1BUXA 3HSFA 1FO1A 2HPUA 4J9SA 3QU6A 2BGCA 2GC8A 4RU9A 2HRUA 3SHFA 4X84A 5HLIA 2IT0A 1NK4A 3KCCA 2DB1A 3J7YJ 3FXUA 3H25A 2M9KA 4CTAA 4IG0B 4DN9A 3RYLA 3AG1H 1QZZA 3C16A 2K86A 2CQ2A 3EQLF 3BR3A 1YJ9I 3LQQA 3IM8A 2PA8D 1BI0A 2HVZA 2GXAA 3M7GA 1LFUP 4QYRA 3W62A 2F5GA 2LDUA 5L1IA 3M9NB 3UR0A 1FNOA 5DUKA 2IAJA 2ZXHA 3FZ2A 5BQTA 5L3EA 3VGVA 1HMVB 3SDBA 1HDDC 1UEUA 3K70D 2HFOA 4NLYA 3GJQB 4B3SJ 2CQKA 4XAKA 2RSQA 1TV6B 1WC0A 1PYSB 4XBFA 5K8MA 3GZ7A 2AYMA 1T0FC 2IPQX 4HSRA 3E6MA 3IS9B 1O6XA 4Z7CA 5K7ZA 3IR6B 1UETA 2KKHA 2CFOA 2DNMA 1QUPA 3P8BB 3B78A 5J4YA 2WOMB 1KRPA 4Y65A 5CYJA 3KYDB 1JB0C 2OTJS 4JV5F 1O8BA 5U47A 2CYYA 1RZ4A 3BO4A 1VISA 2LREA 2CWEA 4JI4J 3GMEA 2AYBA 5T14A 1CS4B 3MWMA 4A8QA 4KB7A 4IH7A 4PZVA 2YWKA 4ZLPA 2IYGA 4C8MA 2E5IA 3D66A 2KLOA 5L3CA 1WG4A 1DGWY 1RCXB 3LGNA 3NEUA 2RNEA 2OTJI 4M3BA 1GXTA 3IKVA 4IFVB 4IRCA 3IWLA 2QYOA 1X4BA 4CP5A 3UPFA 4C11B 3SXYA 4CNZA 5HVFA 3FMSA 1WC3A 3RB4A 3P9KA 5GADU 3IS9A 3TO9A 2AJFE 1Y5NB 4ZVFA 3SDEB 3KFWX 1GQEA 1O3SA 2M3AA 5H2FC 3TZZA 2YKNA 3JQJA 3RW7A 1TMJA 3TO6A 5ETOA 2NVQJ 5K7HA 4EWTA 1NK5A 2MY7A 1NDLA 3GSDA 2HGLA 1L3LA 3OT9A 5TJJA 2HFSA 2IBKA 1JJCB 5ICFA 2E7XA 3PR4A 3HFVA 1H9GA 1IUYA 3D1OA 4QTRA 5D5WB 3JQKA 4ZYHA 2ALYB 4DV5F 1EETA 3TI0A 2XROA 2DA5A 2EWHA 2VL8A 5HQMA 2A18A 2XPWA 1HI1A 2ISZA 2HURA 3DYAB 2KMUA 3EUHC 2WOMA 2W9CB 2PEHA 3OR1C 1D0XA 1S6PA 4F36A 2UUWA 3COAC 2GZOA 1IBLF 2MC3A 4NQWA 3BR1A 1PUFB 5L8RC 1Q7LB 2ZE2B 1WQ2A 2CZ4A 3DFEA 1XN9A 3PZPA 1NK3P 1J9IA 4E8UA 1RTIB 4M3GA 1UWBB 2V2QA 2FZKB 5M2PA 4OOIA 4D0PA 3D6TB 5GPAA 2FIUA 4ECYA 3W8GA 1GXLA 3HCXA 3K4NA 1DTQA 2X7IA 4C2MA 1NAQA 3WG9A 1EKSA 2JZYA 2G9WA 4HACA 2IS2A 4HAMA 2OTLS 3L9FA 3VALA 3FWEA 4BBYA 3I5AA 1MNMC 4J9MA 5GADI 1VQMI 4DL6A 1N75A 2CDRB 4WCEQ 2QA4S 5LMNF 4DV7J 4CTAB 1F9HA 1JLBB 1S59A 2BJ1A 3WX8A 3CDHA 4HF1A 1EQMA 2F4FA 5KFGA 1KQ0A 2VU5A 3I55S 3ERMA 3DNCA 4N56A 4QIWD 1SFOJ 1GMVA 1X4AA 4DUZF 1RTHA 3IMQJ 4MK9A 3CC7I 2PO4A 1XGNA 2QYCA 4EO8A 2VG7B 1N78A 4A46A 1D09B 1RWOB 2KQRA 3IAM2 3UW1A 1QE1B 2JX2A 3OWTA 2RRAA 4OINF 2KH9A 4TY8B 2DYSH 2ZC2A 4EM0B 2XI2A 3CMEI 4LR7A 3CJQB 1UMJA 3WU2C 1ZPVA 3HJVA 2Q8KA 2O66A 5BPIA 5L38A 4P5OA 4DYRA 3QT6A 1LVAA 1ZREA 3T9NA 5ETNA 3HOUJ 4XLEA 2E9TA 3LP2A 2M34A 3IBWA 2LKPA 4RB3C 1FLIA 2ASYA 4GO1A 3R4KA 1E6YB 4IDKB 1HKSA 4DX5A 3PJRA 2TDXA 5KAFC 3DRPA 1KD1T 1WOSA 4NC6A 3CCYA 1UA1A 5D6FA 2HI3A 4PKDB 3QQCD 4B3OA 4PSXA 3QAEA 4C3KA 4DW6A 2Z33A 3AD9C 1GEHA 2MLZA 4X62F 1U1OA 3FVYA 4ITSA 1H73A 2FB0A 2GIZA 1WD6A 1NDCA 1E3OC 1FD2A 2G7UA 3TA2A 5I42B 1B4AA 1AYEA 1K0VA 3ONQA 5F1JA 1SKUB 5AE2A 2ZH4A 4DR3J 1JJ2R 3HGGA 2DMNA 3BTLA 2HKOA 5J2NA 2QTWA 5E3LA 3FFIB 3JCUC 2A6EF 3FXKA 3R1HA 2F4IA 1R22A 2XIGA 4UV9A 4FHTA 2XPVA 1JQGA 3T1HJ