1I1GA

Crystal structure of the lrp-like transcriptional regulator from the archaeon pyrococcus furiosus
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
140
structure length
140
Chain Sequence
IDERDKIILEILEKDARTPFTEIAKKLGISETAVRKRVKALEEKGIIEGYTIKINPKKLGYSLVTITGVDTKPEKLFEVAEKLKEYDFVKELYLSSGDHMIMAVIWAKDGEDLAEIISNKIGKIEGVTKVCPAIILEKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTIONAL REGULATOR LRPA
publication title Crystal structure of the Lrp-like transcriptional regulator from the archaeon Pyrococcus furiosus.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Transcription
total genus 34
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01037 AsnC_trans_reg Lrp/AsnC ligand binding domain
A PF13412 HTH_24 Winged helix-turn-helix DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1i1gA01
3.30.70.920 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1i1gA02
1ZG5A 1WKMA 3BP8A 5FLXK 1E2XA 3TOBA 3WTVC 4BH9A 2R7DA 3RJPA 3DV8A 5ICCA 2OZ6A 4G9YA 3W6KB 4MTEA 4M9ZA 1YO5C 1YW7A 2QM3A 2M30A 2VN2A 4A2UA 5E8IA 2PJPA 4UVCA 4HDUA 3FM3A 4L9NA 4BAYA 1WWXA 4FX0A 1LEAA 1CF7B 3ZMTA 1IF1A 2GQQA 1KU2A 4U7BA 3RKYA 2KKOA 4LFUA 2J5OA 3J81Z 5DCMB 3I58A 5TJJA 1U8RA 5K1YA 4R79A 2ZNYA 3KP7A 2VXZA 2VE9A 3Q9VA 2RVCA 3DF8A 2MH9A 3GLXA 2JZYA 5L3GA 2HTJA 3F8CA 1W7PB 3GFMA 4Y15A 2Q0OA 2XAJA 1SFXA 1IRFA 5BPIA 1UHMA 3EETA 2GXBA 2STTA 2K86A 3L00A 5FD6A 2WV0A 2FBKA 1LDKB 2XAQA 4BYYA 2PN6A 5HLIA 1QQIA 2YR2A 2PLYA 1U78A 4LK0F 4LJZF 4RGUA 1FYMA 2PMHA 4TV7A 4HQEA 4GCVA 1FP2A 2EJRA 3ERED 3REOA 3WG9A 2BV6A 1HQCA 2VONA 1B1BA 1UHWA 1Z91A 3WTXC 1AWCA 1T6SA 2PFBA 1FY7A 3DP7A 4KA4A 4ZZLA 2UXXA 3L09A 5HLHA 4PGHA 4R1HA 4DNCA 3O6BB 2ZCWA 2VE8A 4P96A 5HS7A 2QZ8A 3WTYC 3T8RA 3QU3A 3HOSA 2PQ8A 3G3ZA 2V9VA 1SAXA 4CICA 3JW4A 1HKSA 1I5ZA 1OPCA 3LSTA 2Y48A 4ESBA 1K79A 3GWZA 3LQQA 4IRGA 4N0BA 5HVQC 1KA8A 3GEZA 2UXNA 4OIPF 4LG0B 1ULYA 1HW1A 3R4KA 1O3QA 4RB3C 1LDJA 4I0BA 2G9WA 1SD7A 1S6LA 2NRAC 3HOTA 5D5XB 2ZO4A 2EV5A 2XAGA 3EQLF 3BJAA 4E70A 2FBIA 1U3EM 1OKRA 4UVAA 1QNTA 2E7XA 2OBPA 1TQPA 5J8FA 1Z05A 1FP1D 1R7JA 1H9TA 2STWA 5CLSA 1LNWA 5HOOA 3CO7C 1FNNA 2QQAA 1T38A 2UWMA 5LGTA 2PEXA 4ENJA 5TRDA 5KK1A 5LRSA 2P5LC 1IXSB 1XSXA 4YIFA 1SMTA 2RC4A 5ILUA 1DP7P 2A6EF 3RYPA 3BROA 3QAHA 3R6SA 1NHAA 1EH8A 1HSJA 4EJOA 4LK1F 1XD7A 5E1XA 1T0FA 4XSZF 2W57A 2QBYB 2GAUA 4M9SA 5BOXA 2P6TA 1ZREA 3KCCA 3KZZA 2KIUA 1MKMA 1IN7A 1DPRA 3IL2A 4FX4A 3F23A 2HWVA 4IXAA 1T39A 1KGSA 3KP2A 3E5XA 1HSTA 5DD4A 2QUFA 1KU3A 1L0OC 4M6YA 1ZYRF 1BN5A 2IA0A 5CVIA 4AWXB 1YLFA 3EYYA 1RIOH 1LB2A 2LKPA 3IHUA 2IT0A 4CGZA 2OZUA 4A12A 2XGXA 5JHUA 4IHTA 1DUXC 4UV8A 3ZN0A 4EMSA 1RNLA 1LDDA 5D4SA 2ESNA 4EM1A 2XRNA 4PZJA 1O3RA 2EB7A 2EFWA 1V4RA 2H94A 2ZJ2A 2Z99A 3COAC 3TO7A 1G3SA 1W7PD 3R61A 3WTWC 5LLQA 1R5GA 4OIRF 1O7FA 2K4JA 3BPVA 4I7HA 1ZLJA 2AS5F 2ZXJA 5DUIA 2YX7A 3WU1B 2YPRA 1FX7A 3T5XA 4RB2C 1K78A 3HUGA 3JAMK 3MZHA 2M8EA 5LRRA 3V8JA 3WTTC 1KYWA 2O6GE 1XSVA 3M9AA 4WF2A 4IPAA 1MJBA 4EJWA 1P4WA 3CO6C 1BIAA 1C0WA 2Q2EA 4YG2F 3C18A 4HX8A 2ISYA 3KEQA 4WXDA 2P6SA 4XLPF 5D5VB 4I2OA 3ULQB 2XV4S 1OYIA 3E97A 5F1RA 3QP5A 4O6JA 3I59A 3I64A 1TW2A 5L3CA 3P9IA 5FFZA 4EV0A 4LLLA 2GWRA 4CXFA 2HKOA 3CUQC 2CFXA 2XUBA 2ELHA 5CVUA 4KUMA 2FXAA 4KIGA 3RPQA 1XGMA 5DDGA 5D8LB 1PP7U 3E3VA 5L3BA 1PDNC 5ICFA 4RB1A 3GVAA 2FA5A 2CO5A 1TBXA 1TQMA 4N9IA 1I1SA 5BS6A 4OU0A 2A61A 3J80Z 4I09A 3HRMA 2DQRA 4EGYA 5H20A 3M8FA 1EH6A 1YQAA 1J75A 4U0VA 1IXCA 1BOAA 5H6RA 3HRSA 5HS8A 1R23A 3DQVC 2V1UA 2ZNZA 5CVVA 4S05A 1J5YA 4CYDA 4WWCA 3LQRA 1IN4A 2W84A 2K4BA 3CJNA 3QPHA 2V1XA 1Y0UA 5E8GA 4MEXF 2DW4A 2RGVA 3W6JB 2DU9A 3KP4A 2HR3A 5LHHA 3FX3A 4M73A 3WGIA 2L02A 1S3JA 2MBFA 2Y0MA 3E6CC 3V4GA 4WK8F 3MWMA 1Q1HA 1KYZA 2H6CA 1G3TA 2ZFWA 5FO5A 2EA2A 4N9HA 4BHBA 2EFNA 2PI0A 5LGNA 1SD5A 1HW5A 3SZPA 2BYVE 3HHHA 4IJAA 1J9IA 4EM2A 2CW0F 1XMAA 1YW9A 1JHFA 4G7OF 3F6OA 1KU9A 4K2EA 2F5FA 1S7OA 1OR7A 4LGWA 3RPUA 3BOQA 1P92A 3IC7A 3U9GA 3BY6A 2P7CB 1QZZA 3H3ZA 1P6RA 2P5KA 4G94A 4G6DA 5L3EA 1A04A 1R58A 1IN6A 4U7DA 5D6EA 1AOYA 3C1DA 4XSXF 3TKYA 2MLKA 1MGTA 2OU2A 3SHFA 3FMSA 2VOOA 4YFKF 3K1PA 4M71A 2K27A 3ECOA 3T1BA 2HEOA 2KIFA 5A2QZ 1P2FA 5J6XA 5DD8A 2F5EA 4RGRA 1U5TB 3E6BA 4ZYGA 4KT5C 1FYKA 3IWZA 1YW8A 1QBJA 1XMKA 3SZTA 1K6OA 4GGGA 2MD5A 1WI9A 4L0ZB 4U0YA 1USSA 2M87A 3TOAA 4P9FA 2FMYA 2ISZA 1H0MA 1CF7A 3R0AA 3CTAA 2FNAA 4HLYA 1BIBA 3EYIA 4KN7X 3D5LA 2DPUA 1LQ1A 1BI2A 1MDMA 4RB0A 2F5DA 1SFEA 2CQKA 3I0TA 3P9KA 4HOBA 1TLHB 1U5TC 1U6GA 2ZBKA 3F72A 4EJUA 4ESJA 4ENMA 1Z9CA 1G6NA 2V6CA 2OD5A 1ZGAA 4KMFA 4G7HF 3DXJF 2HDCA 4WXHA 5LEJA 2QLZA 5CJ9A 4LLNA 4OOIA 1YFHA 2DTRA 2ZMEB 1JGSA 4WXCA 3R60A 3FHZA 2TDXA 1MZBA 1UFMA 2IVMA 5DCFA 2K02A 3L2CA 3ZN1A 1DDNA 4RGXA 1RUOA 5JVTA 2L01A 4FT8A 1ON2A 3F8MA 3PFIA 2NNNA 2EFOA 4MGRA 4EJTA 4YIIA 4OMZA 5D4RA 3IKTA 2O61A 1B59A 2DI3A 2CGPA 3QRFF 5CVRA 4KMUX 5K5OA 3J81K 1FSHA 4ZZDA 2VBZA 1ZG3A 2FBHA 2D2WA 1HKTA 3OV8A 2LNBA 2XAHA 2QYOA 2P7VB 2DAOA 3V8KA 2AXLA 1Z7UA 1J2XA 4UVBA 2L4AA 4OIQF 4ENKA 3JTHA 4HF2A 2YU3A 1L3LA 2VT3A 3I71A 3Q9SA 4NB5A 4ZH4F 3NEUA 2JPBA 5DEQA 4PCQA 1QZYA 2KRFA 5E20A 3WGGA 2ADUA 2HQNA 1CGPA 4MEYF 5F6FA 1LJ9A 3HSRA 3HYIA 3VEPA 5JFRA 1HKQA 4BHPA 2QVOA 3JSOA 3TDUC 3DPTA 1ON1A 1QGPA 3ZMDA 4AIKA 2NNYA 3WGHA 2XKPA 5H6QA 4HQMA 4BXUA 2ZBCA 1I27A 3GW2A 1H9GA 3GFIA 3AAFA 3M8EA 3HHGA 4EGZA 1I6XA 2FMLA 2RV8A 3HTSB 4EM0B 5ICEA 1MJ9A 1MD0A 4Y17A 5ERIA 4XBFA 4A0XA 5F64A 1QPMA 3KLNA 4B8XA 2NYXA 3ZMVA 4U88A 3LFKA 3LA7A 4YFXF 4KICA 4ETSA 2CG4A 5ICGA 1XCVA 5HDNA 4L5IA 1WSUA 1PUEE 4F7ZA 2QBYA 2X4HA 1SMYF 2A69F 1IRGA 2E1NA 4AD9A 1GHCA 5ED4A 3KEOA 2XAFA 2E1AA 3K2ZA 5E18F 3B73A 4OIOF 5K5QA 2V79A 1OMIA 2H09A 2VBXA 4P5OA 1HBXG 1T2KA 2HKXA 4R8HA 3ZMZA 3ZQ7A 1UCRA 2HYFA 2P8TA 3MAJA 4UXNA 3KP6A 5FD5A 2QWWA 1W4MA 3ECHA 3HRUA 4BNCA 2RDPA 2WWYA 3M1EA 1TNTA 1P4XA 3F8BA 3GZ6A 4O3MA 2KJBA 2VC0A 3CUOA 3RKWA 3GF2A 2RQPA 3BJ6A 5E1ZB 4I0AA 1LVAA 2A6HF 1IN8A 2EWNA 2HS5A 1FWZA 3NRVA 3K1MA 2FF4A 4JBAA 1FBSA 3KP5A 4MHGA 2FSWA 2JPCA 5LGUA 2W85A 4RS8A 2HZTA 3GYHX 4HF1A 4RGSA 4LB5A 4WX9A 3I59B 5IT9Z 1FLIA 2R3SA 4P55A 3CUQA 1F9NA 3K0LA 3L7WA 4UV9A 5IT3A 2Q8KA 3GFJA 5JR3A 4KYWA 2W25A 4UUVA 2B0LA 2QQ9A 1ZARA 3CLOA 3MZYA 4DQ2A 3KZYA 2DBBA 2J5PA 4HX4A 3RIRA 2E1CA 3N97A 3VB2A 1J0RA 2IJLA 2QENA 4ESFA 2XIGA 3HRTA 1X3UA 2KIMA 3N4MA 4G6QA 1BC7C 1FC3A 5AIPA 2M1BA 1ZRDA 2O0YA 1IUYA 1Z6TA 2DLLA 2IA2A 4Q5SF 1R5HA 4L9VA 1JXSA 5FLXZ 2DPDA 4O5VA 3GUDA 4HF0A 1D8KA 2JTVA 3D0SA 4Z2YA 1KQ8A 4CO8A 1IZ1A 2GA1A 2EA4A 4U0WA 4P9UA 4Q47A 3DEUA 1FSEA 4UNOA 2K7LA 4A5MA 1FYLA 1XGNA 2OQRA 1IAWA 3IRRA 4MQ9F 3ZP5A 3SXYA 4BHCA 1S7AA 2YX4A 2NS0A 3E6MA 1XB4A 2GXGA 5LBQA 4LLGF 2OAZA 1SD6A 2PMUA 3P9CA 4GYGA 2D45A 4IHSA 4Q4ZF 3TO9A 1T98A 5L3DA 3F22A 1ONVA 1XCBA 1EV7A 3C3WA 4JQFA 2DJWA 5DUKA 2BE5F 1YS7A 2A68F 1FPQA 1R22A 2CWEA 5FFXA 1FZPB 4HDVA 3GFLA 2W24A 2E7WA 1KU7A 5J8CA 1XGOA 5FGMA 2JRTA 2NAZA 5D8KB 4ASNA 4LD5A 2RKHA 3ZPLA 2WTEA 2VT2A 1TTYA 4A6EA 3GO5A 4HV5A 2XHKA 3C7JA 4HZFA 2L4MA 3WTSC 1STZA 5LEKA 4M74A 5AIQA 4LMYA 1KQ9A 1R1UA 4EQQA 4RAYA 3HIFA 1G3YA 4CHUA 4YFNF 1WQ2A 2ZKZA 3MQ0A 2FEZA 1ZG1A 3QOPA 4A5NA 3S2WA 3LAJA 3E6DA 1RUNA 1XSDA 1ZHFA 3KLOA 2EFPA 3MEXA 1PP8F 2M5WA 4HLXA 3KP3A 3GZ5A 3VFZA 1MDMB 4A6DA 3F8FA 2P4WA 4I01A 2HTSA 1U5TA 5DCMA 1IXRC 5EEHA 1IN5A 3FXQA 2CYYA 3I54A 3PQJA 3J7AO 3LA3A 5KVRA 3M7GA 2MC3A 1W7PA 3ISPA 2Z33A 5E17F 5D6FA 3IRQA 3V7CA 2A07F 4FHTA 1D8JA 3V7SA 5D5UB 2HQRA 1FT9A 2XROA 3U2RA 2FE3A 1W5SA 2RN7A 3FMQA 4G7ZF 1BC8C 3FM5A 2KJCA 2FRHA 2CSOA 2Z4PA 3FZVA 1J7KA 3H92A 1JE8A 4LB6B 2A3SA 3F3XA 4XRFA 2ESHA 2IA1A 3SQNA 2VBWA 3U1DA 5A2QK 2G7HA 2ZMEA 3EDPA 5AONA 2BEOA 3E5UA 3T8TA 2X0LA 3TO6A 1O7LA 3HSFA 4QWQA 2L3DA 3I4PA 1TQIA 5CYVA 2HFHA 5BMZA 1BI1A 2EFQA 2H6BA 2COMA 3JSPA 1OYYA 1GXQA 1USTA 1YYVA 4ENNA 4M72A 2VOPA 2XKOA 4L9TA 3PQKA 1O3TA 2EV6A 3RDIA 2Z3YA 3BDDA 2LF7A 3QU6A 1W5TA 3ZMUA 2M45A 4Q48A 1HXDA 4G8XA 5HDGA 3VODA 1I1GA 3FWEA 1YS6A 1FOKA 4PDKA 4A0ZA 4L0YB 3T0YA 4B09A 4LG0A 3BWGA 2H27A 3DFGA 2F5CA 2OA4A 1IW7F 2BBYA 2LF8A 2MH2A 4IRIA 5HS9A 1RI7A 1G3WA 2LDUA 4CDGA 3H3UA 1GVJA 4XLNF 2IPQX 4MNUA 2D1HA 1WRJA 2QQBA 1BM9A 1KQ0A 5LHGA 1R00A 2G7UA 2LSOA 4AIHA 1ODDA 3I5UA 1O57A 3RKXA 3JTGA 4L9JA 3ABTA 4NHJA 3V7RA 2WC2A 3OOPA 2UZKA 2DFIA 1ZN2A 2P5VA 3IWFA 3ZMSA 4I98B 2GA2A 5BPDA 3SFZA 5JI6A 3QPTA 2IP2A 3K1NA 2CVIA 3JAMZ 1BBYA 1UB9A 4KIFA 3K9TA 1LEBA 3P7NA 1G4DA 3Q5FA 2FOKA 3WTUC 4IF4A 5BQTA 2IRFG 1ZH5A 2VODA 5LHIA 2IW5A 4D0PA 2RNJA 3RTRA 5CVJA 4ON0A 2DK8A 4KDPA 4S04A 3GXOA 3R0JA 3L9FA 4UHTA 1XGSA 3O2PE 1XDUA 5K5RA 3ABUA 4MQVA 5L3FA 3MFKA 3F8NA 4NQWA 1D5VA 1S8NA 3QP6A 4GYIA 4EVIA 1BI0A 4QLCU 2D1VA 4EJVA 5HDKA 3BZ6A 3K69A 4H0EA 1V3FA 4KN4X 1F4KA 1BI3A 2YSRA 1B9NA 3KE2A 3WE2A 3G73A 1XDSA 2HOEA 1MJAA 1K78B 3WU0A 2DO7A 2GZWA 5E1WA 1SD4A 4GO1A 4OINF 2O03A 2O3FA 4KFCA 1B6AA 4ZYEA 5D5WB 2C6YA 4AVPA 1ZAOA 4IRHA 2EK5A 4L5JA 4HYEA 3NQOA 2MLGA 5ILVA 2JSCA 2JSXA 4PGGA 3FXUA 5HLGA 1TNSA 3EUHA 2A5YB 3RYRA 1JHHA 1K7AA 3I53A 2DQLA 4MTDA 3LAPA 4KNYA 3CUQB 2XVCA 2L54A 3KFWX 5FB2A 6PAXA 4HV6A 1U2WA 1ZLKA 1BJAA 2JT1A 2R7FA 5EEGA 3ELKA 3DPLC 4OMYA 5DYMA 4I02A 3F6VA 3KETA 1FBUA 4HX7A 1F1ZA 1D3YA 2FQ3A 3WODF 3ROUA 1GXPA 2HGCA 3WTZA 1R1TA 3IKVA 3O3KA 3TQNA 4RAZA 2Z5UA 1XN7A 1OYWA 4A0YA 1DPUA 3GX4X 2PG4A 3DKWA 3F21A 1REPC 3TDZC 1Z1DA 1R1VA 2EV0A 2VBYA 1J59A 2PBIA 3RI4A 1ZGJA 2DK5A 1F5TA 2F2EA 2V1DA 2O8XA 4WCGA 5DV5A 4M9XA 1SFUA 3LWFA 4L18B 3BJOA 1P4AA 1YTYA 3HSEA 1ZRCA 2FNPA 3ML6A 4HBLA 4ZYDA 4BQAA 1O3SA 3BPXA 2VC1A 1VTNC 5IT9K 1FBQA 2ACJA 4IVNA 4JK1X 4Y13A 2Y75A 3FF5A 3LA2A 1B4AA 4CZZA 4GXOA 1S29A 1E17A 2HYGD 3FXRA 4HAMA 1YG2A 3E5QA 4M6XA 4AIJA 4HW0A 3WE3A 1R36A 5ILSA 1B9MA 3TGNA 1ZRFA 2FU4A 2BGCA 2MA3A 1QO0D 2GIVA 4HA8A 1YIOA 4KIBA 2XASA 1HW2A 3V8LA 1EH7A 3B02A 1RZ4A 3FMRA 2ETHA 3MCZA 2Z9OA 2OQGA 3HTUA 3CDHA 2DT5A 3J80K 1Z6RA 3VOEA 1TW3A 4ZYHA
chains in the Genus database with same CATH superfamily
3H2UB 2R4GA 2GJIA 1OFCX 3HHDA 1YJNI 5HNFA 4EI2A 1AB8A 2X6OA 4Y7NJ 1E2XA 2JFKA 2RUGA 4E8UA 4A8MP 3WTVC 3JRGA 3IRXB 2M9HA 4I69A 2A18A 3BPDA 2XMWA 3AY0A 2C3OA 4MKYA 3UNGC 2O7OA 1KSPA 1PJ7A 4IR9A 3DGVA 3NS7B 3BV8A 2QM3A 3VZHA 3K4NA 2M30A 2VN2A 4UVCA 4QWEA 2PEHA 1SL2A 4HDUA 2NZCA 2ZFUA 2ZWOA 4FXVA 2BY3A 4OX8A 4D9JA 2WB1D 2WVBA 2KRRA 4DG1B 2K3FA 5C25A 3HKWA 4GVBB 3ZO7A 2B43A 4DX7A 1SC3B 1RWWB 4BJ5C 3ZOBA 2JA6J 3CCRS 1A36A 1APSA 4CCMA 3CDBA 2KZVA 4I64A 1NUEA 3PY8A 3G82A 1Z21A 2B5JA 2DXFA 2UUBJ 2NLWA 5L3GA 5LMNF 2DGTA 3GCXP 2VJ5A 2HW3A 2WTFA 3IR7B 2XG8A 3MECA 4FE4A 5BPIA 3EETA 3TJ8A 3CULA 4HKQA 4WTYA 2K9SA 1TKTA 5FD6A 4K2XA 4OAYA 3BKTA 3DOMA 3THVA 5FDLB 4J5OA 2DH9A 3AJDA 1LDKB 2DGOA 2XAQA 3FEYB 4BYYA 2PN6A 5HLIA 2D3O1 1QQIA 2PLYA 1RCXB 1U78A 2DA5A 4LFAF 4JI6F 2ZM6J 4TV7A 1D1UA 4CTAA 4IQJA 2EJRA 2EG2A 4UQGA 2GIFA 3GMGA 4HVZA 1YRUA 2JZ5A 4H4MB 2C2DA 2KJVA 3ENWA 2DO4A 3PXGa 2F48A 1FY7A 4JI4J 2UXXA 3Q8QB 3L09A 3CDLA 3JYTA 4PGHA 3EMTA 4DNCA 1JLBB 4WKYA 2ZCWA 2GIZA 5HS7A 1PO6A 4TQSA 9ATCB 2HQ3A 1MN7A 1OPIA 2DB1A 1ICEB 4W92B 2VFSA 3MKWB 1EP4B 1Y9OA 4ZVTB 3LSKA 3JW4A 3W61A 1CULB 5GAEI 1I5ZA 1PC5A 2LQJA 1WFXA 1HNVA 3I0RB 4OV6A 2DNKA 3GWZA 3FKBA 3LQQA 2G1DA 1J09A 3PW7A 1RBLA 1Q1VA 4OIPF 2PDAA 1MWQA 4FETA 3R4KA 5C5JA 4RB3C 3PJWA 2C22A 1MG7A 1ZAXA 1V55H 2E36A 3PNIA 1MBGA 1C4AA 3IBFB 1WF0A 3BJAA 5B0EA 4HSTA 5KFCA 3VYSB 2KT2A 2WOMB 1CVJA 3HSZA 4FTHA 2Y69H 3PSIA 2IVFB 2R7XA 2KKHA 2WZ1A 4HNTA 1GX5A 2MLXA 3OHAA 5CLSA 1LNWA 5IV3A 5J2QB 1VQ8S 3DGPB 3CO7C 1FNNA 1T38A 4DV2J 5LGTA 4FBTA 3UKGA 5K8MA 1KWMA 4KPCA 2CPXA 1F6TA 3S32A 1LK7A 5LRSA 4CP5A 2W9BA 4XKWA 2L9SA 3D5SC 4ZITA 4RNMA 2O66A 4YIFA 1C0UB 1DU0A 3ENAA 2Y8WA 4O0IA 5ILUA 1OY9A 3HJEA 4JX4A 4ED2A 3VYUB 3R6SA 3DNCA 5E7OB 3MPYA 4QWBA 4EFAC 1S9GA 3BR9A 1GEHA 5L1LA 1F0XA 1JKHB 2CQPA 2CJAA 3D3CJ 4CNYA 5KFMA 4XSZF 2MGZA 4QW8A 5HSPA 1X0FA 2GAUA 4M9SA 3ZQCA 1WKJA 4MO7A 4DDFA 1PGZA 2KIUA 1OCOH 4LR8A 2XAUA 1BA5A 4QU6A 1CS4B 4IFYA 2YKNB 2B4OA 3W5ZA 4NA1A 3QFWA 4IXAA 1T39A 3ET6A 2QRRA 1OMSA 2WB1N 1EB0A 1KU3A 5LOQA 4L3NA 3IV5A 2MQNA 3UI3A 4KB7A 4BWMA 4M6YA 3OFGA 3HL2A 1MWZA 1SH2A 5EGOB 2VDHA 3EYYA 4A8YA 1RIOH 2ZJPF 1Q86T 2IT0A 2CUZA 5DQHA 5JHUA 3CCYA 3D68A 3LF0A 5KFOA 5HQMA 3M2UB 1TAQA 1LW0B 3GV7B 5J2MA 3RBXA 2BOPA 3QSIA 3C2PA 5BR8F 3HPGA 5D4SA 3FMBA 3WQPA 1OY6A 4A47A 3DLEB 3CMAI 1FKOB 1O3RA 1HD0A 1YE9A 1JUMA 2QKMB 3PACA 4XLAA 2E34A 3L3CA 3S6EA 1R8PA 3TUIC 2VB6A 4MJKA 1V4RA 1MWYA 2E5GA 1VK8A 2DYRH 3KZIC 3PTWA 4IFVB 3COAC 2K8GA 2HHQA 2W2PP 2CU7A 3C16B 4PK4A 1W7PD 2FJBB 1X5PA 2BE2A 1CJTB 1Y8QB 5GAGI 1KQSR 2LFBA 1O7FA 3EYZA 3KG0A 4IOAQ 5HQ8A 4EYIB 5DUIA 1I3AA 2YPRA 1FX7A 1K78A 3DDNA 1WORA 2E9RX 2X1BA 3HFVA 3VPRA 2V6AA 5EWGA 4YN3B 2VQCA 2XY6A 5B0CA 4N8NA 2MYFA 2OUMA 3V8JA 4BLGA 1NJIT 1K8AT 1VHFA 3TJ9A 4EYHB 3MKLA 5ETNA 3C2GA 3M9AA 3E51A 4M5DA 3P49B 4EJWA 1H6KX 3MKZA 2KYXA 5KFVA 4NMLA 1VRTA 1MBHA 1S99A 5TISC 4J00A 1HBNA 2UXDJ 2KDOA 3PRBA 4LRBA 2HWHA 3GQCA 1Y6IA 1OYIA 3E97A 1JKQC 1Q8IA 5LMUF 2BM1A 3QP5A 1UZHA 2OEMA 1D9FA 2I8DA 2Y31A 1FEHA 1LUJB 4I99C 4PWUA 3P9IA 5FFZA 4N41A 4DHVA 2E1MB 5DQIA 2GWRA 2BQ3A 2BANA 2JA2A 2Y9ZA 1K9MT 1U9NA 2C2OB 4OFZA 2HKOA 3PW5A 3CUQC 2XUBA 2ELHA 2HOSA 2NXUA 3RPQA 4K4TA 3TZWA 1LE8A 4R0JA 1IN0A 4Y2CA 5L3BA 1PDNC 1PKUA 1AKHB 4M5IA 3FFIB 4QU7A 1JUPA 4OHZA 2FA5A 3TW0A 1TBXA 4NCGB 1TQMA 1I1SA 1YJVA 3BKUA 2Y0BB 1NSQA 4WIIA 3HOUJ 4CLTA 4X4UA 2E1MC 4E4HA 4DV4F 4EGYA 4KFBB 5H20A 3EGZA 2MQMA 1J75A 2HYIB 3MM8B 5HS8A 1R23A 1WWHA 3D5RC 5IP6A 4R8UA 2DOAA 5CVVA 4UW2A 4S05A 3OYEA 2WW8A 2J7KA 3LQRA 3KLFB 1IN4A 3GV5B 4KGKA 5D78A 3M6UA 3BTLA 4WZQA 2K4BA 2WY8Q 1UVKA 1HBMA 3H59A 3OSPA 3PKMA 2GQCA 1IR1A 4BDYA 1S77D 3W6JB 2VL8A 1M5SA 4JOMA 3H9JA 3TJAA 1N5VA 3JRFA 2W4SA 3BYRA 4F25A 4AVZA 5BYRA 2M8DB 2GO9A 2Y0MA 2LA4A 3T9NA 3V4GA 1NHUA 3AQPA 2XHCA 2HFUA 2VDIA 4PQAA 2J0QD 1KYZA 4U6PA 2H6CA 4DZDA 1G3TA 2HBYB 1AZSB 5A8RA 2ZFWA 2NOJB 2WV1A 2HAIA 2EFNA 4ETXA 4K5RA 1HW5A 3CJRA 2BQUA 2BYVE 4X65F 4J9PA 4EM2A 1XMAA 4D5FA 3DEWA 2YS9A 4OLPA 3M6VA 3GV8B 1T8IA 2XULA 1OJLA 2JQ7A 4K2EA 2OMOA 3RPUA 3EGWB 2AT1B 5J3LA 3UR3C 3AD8C 1P92A 3BY6A 2RD5C 2P7CB 3WG7H 2P5KA 4G94A 2OGUA 1RHQB 1IQTA 4A3LJ 3OYIA 5F0WA 5LSLA 4RNHA 1W26A 2HFSA 2YKMB 1QTMA 2R5YB 3Q0AA 3OL8A 3BR0A 1FK9A 3CNQP 4JP0A 2HRYA 1NH7A 5KAFC 3AG4H 4DXLA 2JDJA 1S72S 2WVCA 3R6LB 2J7UA 4YFKF 4M71A 4B9NA 3A1YG 3T1BA 3BSNA 1MH3A 3OYDA 1FJ7A 4BJTA 3F0NA 3M1VB 5J6XA 4CLSA 4USWA 5HP1A 2F5EA 4RGRA 4B44A 3I31A 2ZH1A 1FYKA 3IWZA 2CNLB 2E35A 3SZTA 1P9QC 5FLMJ 1K6OA 3DLAA 4DUZF 2B8QA 4PWDB 3LNQA 2HVRA 1WI9A 4L0ZB 4U0YA 2VG7A 4OI1A 1H0MA 1IWAA 1TELA 2FNAA 1Q8BA 3DMJB 2E19A 4KN7X 1CJKB 1HKAA 2R8JA 3G8SA 2XI3A 1BI2A 2D9PA 4LIUA 2LDYA 3ASNH 2GVDB 4KO0A 1DQAA 2EZKA 1RQ0A 1X1PA 3PO3J 2ZBKA 2KN4A 3F72A 3TR5A 4EJUA 4ENMA 3AAWB 4C11A 4NLTA 3OYCA 4A8WA 3VAFA 4XN3A 1X8DA 5KFKA 1FJGF 4QWDA 3GFXA 2ZZMA 4X4SA 3D0HE 2JEGA 3PFOA 4WXHA 3QWPA 1PJ6A 4Q44A 5EJCA 3R7NB 3TW7A 1RKIA 3TP2A 3CC7S 2DTRA 2ZMEB 4WXCA 3P4UB 2F4MB 2XF6A 3R60A 2G1HA 4ID8A 2FLLA 2ASJA 4J9OA 4F0MA 3Q0UA 4ZPBA 3MR6A 2HVHA 3K5PA 1ZELA 3I55S 1P1LA 1DDNA 3CC4I 4RGXA 2WONB 4IO9F 1IV6A 1DQ8A 3DU6A 3F8MA 3GTPJ 2EFOA 2BEFA 3DOLA 2VI6A 2BY0A 3FC9A 1EKEA 4MIAA 1X4AA 2B0GA 2BKPA 2W8LA 2BOAA 3Q86A 4WE1A 1Q5VA 3MD3A 3TEGA 1I3OB 3PUBA 2KXNB 4ZZDA 1S6QB 4JI7F 1ZG3A 5T14A 2D2WA 1IRZA 2RVJA 1DAXA 1WI3A 1QVFR 2A0FB 2ZMEC 2QYOA 2D69A 3GTGJ 2DAOA 3HFKA 1Z7UA 3LA0A 2B7CB 3EUKL 1FO1A 3TX0A 1J2XA 4DGWB 5KFLA 5DDPC 4A3GJ 1T05B 3BCBA 3HHLB 3BBCA 1MMNA 2WY7Q 4HF2A 2YU3A 2IIHA 3I71A 5HVGA 4B43A 4P2SA 3BZCA 2JPBA 1PC4A 2MJNA 2WBRA 3LAKA 4YRVA 1YBTA 3CMES 1VC6A 2KRFA 1WHXA 1S4FA 2XNQA 1S9EB 3E01A 4NBQA 5KFQA 2LQBA 3N28A 4DSLA 2FIUA 4EWTA 4QOTA 2ATCB 2DNPA 3Q0WA 3TL4X 4ICLA 1FMVA 3LTOA 1POGA 3TNVA 4UUSA 4Q2MA 5HJXA 5HBMB 1FDAA 5E3MA 2FY1A 1VQLS 3TDUC 2ME0A 1HBOA 3D1NI 1QGPA 3S14J 4AIKA 2AX1A 3WGHA 5T7LA 5H6QA 3HHLC 4HQMA 2QA4G 4RW6A 1B70B 4DL7A 2ZC2A 4CZCA 1JNRB 1HHSA 5KFDA 1VBXA 2W2OP 4U8YA 1NK6A 4BQQA 2DR7A 1YITS 2ZZTA 1N5TA 2R92J 1FEXA 4CT9A 5CPRB 1I6XA 1DP3A 2LH9A 4ZVQB 3NGTA 4EM0B 5ICEA 3RRHA 4XBFA 4G1QA 4O3QA 1BQMB 3KLNA 2QEXI 2XCPA 4OI6A 4C0BA 2YNGA 3SCKE 3OYHA 1K0TA 3LA7A 4PG5A 1UJ4A 5I3UB 3VGUA 1RUSA 4LF2A 1RTIB 5A8KA 2Q1ZB 2M5YA 3RTVA 2CPZA 4IOCQ 5CZXA 4DV7F 3H5RA 3PM1A 2MFZA 4XQFA 1SMYF 2A69F 2MG4A 1T0TV 2ZDOA 3PV8A 2LVSA 2BJ8A 3RSNA 4PG7A 5ED4A 1S6PA 1FKAF 3K2ZA 5E18F 1GT8A 2QE5A 3M2VA 3FZBA 1I6HJ 4B08A 2V79A 2DJNA 1JLFB 2VBXA 4DL3A 3SCLE 1E3PA 2W00A 1YZ7A 4KJZA 2BM0A 1VI7A 1S72I 1HWKA 1RE1B 3AG1H 5L9NA 5ETKA 4CA0A 3SFIA 4N76A 1RWPB 4YQWA 2BKOA 3HRUA 4XK4A 2IS4A 3W2VB 1KQGB 1KLMB 1P4XA 1X1DA 2AU0A 1G1XA 1V3SA 4EMDA 2X3DA 2K9LA 3PL8A 3RKWA 1MW7A 3NAUA 5E1ZB 4I0AA 4A3EJ 5F08A 3J7ZI 1IN8A 2HS5A 3SBMA 3ZR8X 1REGX 2VFVA 2V2ZA 2FSWA 3ZZZA 2CVEA 2Q2EB 1Y10A 4U7CA 5KG5A 1P7IA 4KBIA 4J37A 2DGWA 2EC2A 4HF1A 3UDLA 4YR3A 4K4XA 4DR3J 1IKWA 4FS2A 2L9VA 2RDJA 2R3SA 4KJIA 1QVUA 4AQYF 3CJ5A 1F9NA 2F8EX 4NZ7A 1VHIA 1S5LC 1WELA 3FK4A 4UUXA 3PG9A 4DL2A 2PX9A 4UV9A 5IT3A 4IZZA 4N5SA 2OPTA 2MMYA 4KYWA 2DD8S 1Y1WJ 5GAEJ 4JV2A 2AF6A 2HBQB 2ECBA 2J5AA 1S57A 2C3UA 5KHDA 4ZDNA 2RQ4A 3IS9B 4PXDA 2DCLA 2ZOFA 2HNZA 3A4CA 1SB6A 1ZM4A 3MMAB 1M1KT 2E5HA 5D77A 5HAOA 3CF5Q 4JI1J 3NNHA 4DV0J 1REVA 1YHQS 2XIGA 3HMJG 1EKRA 1NHKL 2OP5A 4Q0BA 3BM7A 2DVIA 3N6MA 2JRMA 1S5ZA 1ZRDA 1IUYA 1TFYA 4C8YA 2FJ1A 3TA2A 3CEDA 1R5HA 4L9VA 1NKEA 2KIQA 3AD9C 1UWBA 5IOLA 1ENHA 3KK2B 1N54B 1S0VA 3VTIA 1TU0B 4BY7J 3OD2A 3WHBA 5A0YB 1D8KA 2JTVA 4KPYA 3D0SA 4UY8I 1R3NA 2QYGA 2JUGA 4Z2YA 3HBLA 4YB5A 1IZ1A 4KHMA 5L9XA 3BPSP 3KJQB 3MTKA 4U0WA 3AQOA 2HOTA 5KT2A 1HPZA 2NVUB 4P9UA 2RF2B 4O0NA 3QSYB 1FSEA 2UUZA 3BQYA 4E7HA 1XGNA 1FMWA 1IAWA 4M5MA 2LKZA 1JLCA 4GVLA 5E3QA 1H0HB 4BHCA 2LR8A 2E1PA 3M32A 2NS0A 3SQGB 3CJKB 3EM1A 5M5WJ 4TYBA 1FNMA 1N33F 1B7YB 3MKYB 1QU3A 2PT0A 4LRDA 1IG7A 2OAZA 3P9CA 3HGGA 1HR0F 1LOUA 1U1KA 1VQLI 2Q1LA 3EICA 4HT5A 4I6WA 4Q4ZF 5L3DA 1VBKA 4Q45A 1ONVA 3OUYB 1U9OA 2VQEF 2ZD1A 3KUGA 3OVAA 2JEFA 1T3OA 1D3WA 1S1WB 1FPQA 1R22A 3F73A 2OPQA 3OTCA 3J81U 4ZVGA 3HJFA 2CNKB 2UV8A 1FZPB 2CNNB 1N32J 1E6YA 1A6IA 4Y3OA 3EJMA 1W7WA 1BJZA 1U47A 4HSRA 1U2CA 2YNFB 3MCOA 2UP1A 2CQ4A 1KU7A 2MC4A 2H65B 2M0GB 2GNKA 1LKZA 1B72B 3KJNB 4F50A 3H20A 4ASNA 3CMYA 2CIMA 3HZEA 1ZYQA 4F3MA 1RTDB 1BC6A 2JWNA 2KFYA 2VT2A 1Q1KA 4LIRA 4NZ0A 4A6EA 3GO5A 2KG1A 1SKUB 5E3CA 4HV5A 1IBCB 4JI8F 2XHKA 1K6YA 3G96A 2RHQB 2V9PA 4RUAA 4PXEA 4C3KA 5K8OA 2RQKA 1S97A 4M74A 2MGQA 4C8MA 3IRXA 4LMYA 1KQ9A 4PR6A 3R8YA 3IH2A 2AJFE 1R0AA 1BMQB 4ITVA 2FJAB 4ECVA 2AHOB 5GAGJ 4EQQA 4RAYA 4ENOA 1OCRH 3DTEA 3HIFA 2K9NA 2ZZNA 4E7SA 1GFWB 1U02A 3S1NJ 3OT9A 2V8HA 2DFHA 3QOPA 4DN9A 2I2YA 4NPOA 4JYAJ 3U02A 3CJQB 1RUNA 2RMLA 3CQZJ 1UG2A 3KLOA 2E1RA 3VVUA 5G0RB 5L1JA 3NARA 3MWBA 2NOGA 3LL7A 5MAOA 4HLXA 5KFXA 1SAUA 3GZ5A 3KIOA 2FVQA 2E5ZA 4RLEA 3F8FA 1Y3KA 3CUNA 1U5TA 1R71A 4OJ3A 2GCFA 2BX6A 1IN5A 1WTFA 3H9GA 3FXMA 4RW4B 1N52B 5IFMA 2R7WA 1VQ7S 2CYYA 3I54A 4ECXA 3BQZA 2Z2MA 3FRZA 3ZQQA 2W1BA 2XGEA 1B0PA 2BJ1A 3GLLA 3A8IA 3PO2J 3ISPA 5KT7A 5E17F 3CC2S 5IY5H 2AQ4A 5IP9J 4L74A 2KVIA 5DDOC 3J7Z5 4LIWA 2A07F 4C8OA 4LJMA 1AU7A 3GJTB 4KH1B 3QQAA 2HQRA 2AXTC 3EDRB 1FT9A 2XROA 4W97A 2FE3A 2W9CA 2DPIA 2DODA 2KPMA 4QWAA 4A4JA 2R7VA 1NXIA 1OISA 3CSKA 4NLUA 2AGOA 4K4SA 4EATA 5IWAF 2CSOA 4A3BJ 3NRBA 3FZVA 4GKKJ 2R5ZA 1Q8LA 2EVZA 1J7KA 4ID5B 3H92A 2HQ5A 4B17A 2UVUA 3F56A 4JOUA 4XRFA 2LEPA 1DHMA 4FYYB 5GADU 3ZXSA 3I3LA 3PIOF 3U1DA 5A2QK 2CV1A 4H4MA 1EAYC 5IS2A 1NJZA 5A76A 4ZJQA 4C2MA 4DR5J 4ZVSB 3K6GA 1U1PA 1RT7B 4RW8B 1S1VB 4C48A 4LF8J 5M3MJ 4I6ZA 2HFHA 2EZIA 5BMZA 3OR2B 4HI1A 4C8ZA 2IYGA 2EFQA 2A6TA 3DM2B 3ETOA 1HNXJ 2COMA 1RXOB 3MFHA 2DYSH 4NYOA 3U21A 1FXRA 4EUVA 3DRPB 1YYVA 3HI9A 3GP9A 2PFDA 3M8PB 3RB3A 2KP6A 5KT4A 1XMXA 3PQKA 4PG8A 1EP4A 2V8GA 4DR4F 1HNZJ 1SVMA 2ZXHA 1DLOA 5C3EJ 2D9OA 2Z3YA 3KUEA 2OV7A 1NG7A 2M45A 4PJJA 1ZZFA 1HXDA 1NTCA 4ERDA 3AOBA 2XMMA 2RQQA 3M9MB 4PDKA 1S48A 4L0YB 3VWBA 3VYRB 1TTHB 2N3LA 1G7CB 3T0YA 1OIAA 2KM8C 4UY85 2IC3B 3OR2C 1NNDA 1VRQC 1IW7F 2F8HA 3R5AA 3DTIA 2K1RA 4IRIA 4OYZA 3CXCR 5K9FA 1RI7A 4LSNA 2ASYA 4CI0B 4C3HJ 2UVVA 1SH0A 1WJAA 1GVJA 5D15A 1B99A 3IM8A 2D1HA 4MNUA 2WOMA 1WRJA 4DOZA 1NO8A 1KQ0A 2RNGA 2G7UA 4XL9A 5LT5A 2LSOA 2E44A 2WRMA 3PFEA 2DY1A 1NK0A 2MSSA 3I5UA 3VAGA 5CYMA 3D0IE 3OLAA 4Y0FA 4IH6A 5J2QA 4L9JA 3DGPA 3V81B 2MZ1A 1TMMA 3H5YA 4IYQA 2N4CA 4E7JA 1IGNA 4E7LA 1F60B 4YUDA 1VIOA 5DLFA 2DFIA 1RR8C 3RPUD 2OTJS 1RLCL 2OMLA 2X6XA 1S9FA 4OQJA 2ZXIA 1TKZA 2HURA 3IWFA 3DRRB 2VKDA 4XKBA 4MK9A 4CYUB 1Z4UA 4I98B 5CA5A 3G6YA 2GA2A 5BPDA 2H4WB 2PEBA 5DRKA 2V8PA 1JLQA 2P9GA 1UA1A 2E29A 2Y1RI 1H7XA 1WC5A 3P5JA 5IQ6A 2AJ4A 4A8KA 3C6UA 3KDNA 2ZC3A 4QPQA 4B47A 4FYXB 3ENVA 1HMVB 1E3OC 1VQNI 2FOKA 5D4OA 3WTUC 2IRFG 1ZH5A 4FXWA 4LBHA 1JT0A 1N6QB 2IW5A 2YKNA 3M1CA 3V6DB 4ON0A 3CJTA 3FDSA 3R0JA 4AFFA 3KK3B 2GXAA 2C3MA 1XIQA 3IP4B 4X4PA 1XDUA 1B8IA 5K5RA 3ABUA 3BG6A 3FQKA 4XN0A 3F8NA 5B66C 3OY9A 5E3PA 1SJ4P 2CJKA 1T7PA 1YX3A 1NPRA 3QGHA 3EGNA 2X85A 3GTLJ 3LO3A 3QJLA 5EGOA 4K8RA 1BI0A 2UUCF 3GIIA 5FRNA 2D1VA 1XMQJ 5HDKA 1XTAA 1YG0A 2HI3A 4DFPA 5HNHA 4LREA 1V3FA 3UD3P 4KN4X 3G73A 2X6YA 5B7WA 1XDSA 4GFBA 4P75A 2DO7A 2PD1A 5E1WA 1VQMS 2CPDA 1PYTA 1X19A 3HUGB 3MZ8A 4ZCLA 3IRWP 2B6AA 1HNIB 4KFCA 1T9VA 1JKOC 4DR2J 1ZAOA 1WG1A 3ZQIA 4HEA2 2HNYB 4IFVA 1C0TA 1RABB 3C16A 4HYEA 3S17J 2BXJA 2OEJA 3W5XA 1W36C 2IBOA 1WVRA 4PGGA 4K4WA 4BC9A 3F44A 4KRWA 2O67A 2D74B 2DA2A 2OD4A 2C28A 1IXKA 1UTAA 5FLXU 5H9FK 3CC2I 3CCJI 3AXMA 1QSLA 2A6OA 2DR9A 4ZOSA 5DGAA 3ERMA 5B5EC 3SSRA 1J2VA 5LL6d 4IG0A 1ZLKA 1HOMA 1LW2B 4YDXA 1WJ5A 1EARA 4OMYA 4CO2A 2HWTA 4OX6A 2RH3A 3RG6A 2RKIA 5DYMA 4ZVFA 1D3YA 2FZGB 3CCLS 2XMTA 5HMXA 4M5LA 1IBMJ 3ROUA 5EYRA 5F0FA 4DS5A 3K4LA 3OSGA 2HGCA 3FK6A 3G6EI 3IKVA 3TQNA 5GPCA 3VAMA 1NZ8A 1OYWA 2K3KA 4NWBA 5CCLA 2XC9A 1UVMA 1J27A 1R1VA 2K3PA 3OYKA 3BR5A 2PBIA 1J59A 1WACA 3RI4A 3FQLA 5AXNA 1WSVA 2DK5A 1T94A 3PSFA 1SXLA 2B7BB 3Q8VA 1JJ6C 2HVSA 2IYIA 4DI6A 2LBFB 2FHJA 1T3NA 3WC2A 2XS5A 3DWLE 2FVPA 4RA2A 4FISA 2NR0A 1ZAWA 3LH2S 4KFBA 3V2UC 4LF7F 5HVFA 2H5IB 2AZ1A 2POKA 1ZZNA 4HBLA 4DCJB 2DHXA 2C2EA 4PG4A 4RDUA 4JK1X 4Y13A 4ECWA 3VV2B 3KLFA 3MN2A 2VQGA 1FVQA 4HHHA 5GMEA 2KHMA 4GXOA 1S29A 1E17A 2TCTA 2AEFA 3FXRA 1YG2A 4PFPA 3R1HA 3CD6I 3EPGA 4E0DA 5ILSA 1B9MA 1A0OB 4V19K 3HOYJ 2R2RA 2UXDF 5LMNJ 4YMEA 4NE9C 2OH2A 2GOXB 1QAJA 3VHQA 4HA8A 1Q8KA 2BRKA 3SV4A 2AZ3A 2H8WA 5K8PA 2XASA 2QIFA 3OYBA 1D0YA 2GOMA 1C1BB 3O2IA 2RRBA 3FMRA 2ETHA 3MCZA 2Z9OA 3NP5A 4CH7A 4LF6F 2YU9J 3H1CA 4XOPA 3SSSA 5KG3A 2VASA 2F4OB 1GMWA 1MBEA 2M2BA 2BW3B 3RRGA 1SVOA 1TW3A 2V50A 4ZYHA 4I0WA 4LFAJ 3UQSA 4JI6J 1ZG5A 3C14B 2XI2A 1WKMA 2QQ8A 2FHOB 3B6AA 5KG4A 1RAJA 4USIA 4DYQA 1GT0C 3RJPA 5BYQA 3DV8A 4BL0B 1IO2A 5ICCA 2J9EA 3VR1A 1XS9A 2K40A 4EBDA 1WG4A 3KMQA 4MTEA 1FIPA 2BXZA 3TVKA 2F6CA 2PMZA 3A3NB 4NYZA 3IP0A 5IZHA 4UOFA 3ZNUA 2F9JA 3BTCA 2YKMA 3J7YI 1NK2P 2DNNA 2VZ9A 4XK8C 3OFFA 3KLIA 3FM3A 4ZLLA 3CCVS 1WGXA 3EVMA 1SEUA 1JGGA 1N48A 2CQDA 2F3JA 1CF7B 1QPIA 4L6V3 3ZMTA 2QL7B 1KU2A 4U7BA 2KKOA 4J9UE 1VJWA 2J5OA 2VG5B 2M2EA 2EPIA 3J81Z 3ABKH 3I58A 3S15J 5TJJA 1KFSA 3CD0A 1U8RA 2JVOA 1NEEA 5DM7F 2ZNYA 3HLUA 4NRTA 4G3IA 1RPWA 4TY8A 1YVFA 1K83J 2VE9A 2XM3A 2FTRA 2DNQA 2QGFB 2MH9A 1VQMI 3E1SA 2MZJA 2XC7A 2JZYA 2HHSA 4AU7A 2B4UA 2X51A 1VF9A 4MKBA 2XAJA 1SFXA 1DU6A 1TWCJ 3NLCA 5FIIA 2STTA 2K86A 2VF3A 5E33A 1VIXA 1TP7A 2GVDA 4LFCF 2QSHX 1ZM3A 2CAJA 3GZNB 4LK0F 3GR0A 4OWRB 4LJZF 1B64A 4RGUA 3W63A 3DN9A 2NXJA 4RPFA 1IBKF 3T5JA 1W5CC 3HCXA 4GCVA 3REOA 4ZVUB 5F8NA 3QT5A 4FF1A 2E5LF 1N36F 3MURP 3KHLA 2JVRA 2VQLA 2ZSHB 1VQKS 1U0SA 2VONA 5DS7A 1B1BA 1GQEA 4CH0S 2G2ZA 5KFGA 3HM5A 4OZJA 4KA4A 2IM3A 2QYCA 3O6BB 1QM9A 2VE8A 1KONA 3DYAB 2J6UA 3CCLI 4U7UK 1OCCH 1TK5A 2JL9A 1KVJA 4HG2A 3T8RA 2PJRB 4XKVA 4U8VA 5K14A 1RTJA 4OI4A 1X1CA 3MEEB 2M3AA 1HQ2A 3IBCB 3P3DA 1LVKA 5BXIA 3KX2A 2X7IA 1KHVA 2ZH2A 4NLGA 2J0WA 3V4MA 1VBYA 2CRLA 1OPCA 5DJBA 5KFZA 3R27A 2E9ZA 3A2KA 1F3VA 4W90B 2BABA 4O3NA 2D3OR 3BN4A 3B8HA 3GIRA 1JTXA 1Q16B 5FLXY 8RUCA 2EKYA 3JAMU 1MMAA 2QFJA 1HW1A 3DCFA 1O3QA 2BY2A 5ADZA 1XMOF 2DKOB 2G9WA 4NLWA 1SD7A 1XN9A 1S6LA 4LF1A 3HOTA 4Y2KA 3SFGA 3EPZA 2ZO4A 4C4WA 1UFWA 2XAGA 3EQLF 3CP2A 5BR8J 3CCQS 1U3EM 1FJCA 1QY7A 2FLNA 4JB8B 2XCAA 2VHGA 1Z05A 1FP1D 4B9VA 2STWA 4M6VA 5KFFA 1U8SA 1R6VA 3T1HF 2RU3A 4YFUA 2UWMA 2B4VA 5KOXA 2PEXA 1TZLA 1JJHA 1TV6B 1NH8A 2FLOA 4MIWA 1I94F 5KK1A 2P5LC 1TKDA 1IXSB 3UNYA 1XSXA 3N6LA 2LLZA 1P8GA 2R8KA 4CH1A 3KLGA 4NLVA 4A46A 4ED5A 2A6EF 3RYPA 3QAHA 2OUGA 3KK1B 4DJBA 3C15A 4YY3F 1HSJA 3A0BC 1IKVA 3AG2H 3JB9k 3ENQA 4LK1F 2E60A 1XD7A 1Y5LB 5E1XA 1T0FA 3HM9A 4XTTA 2XGDA 1ETXA 3D1OA 4OZ5A 4QYRA 4MK8A 2M7SA 2N3OA 3LOUA 3KCCA 3KHRA 3KZZA 4KT6A 1DPRA 1CC8A 3TMOA 4FYWB 4FX4A 1NJYA 1BQMA 3G6VA 4KQZA 2W7NA 1HSTA 2JFDA 4IX7A 5LMUJ 2JVGA 1S1TB 4I6AA 3DC2A 1ZS6A 4X2BA 3JSMB 1D1BA 5H9EJ 1ERDA 3O5TB 2DMTA 2IGKA 1XNQF 4MTPA 1LB2A 5IPAA 1YZ6A 3IHUA 1WZ2A 4C2MJ 2DNZA 1X3ZB 1D8ZA 2QGUA 3VSKA 2J9CA 1DUXC 1JXEA 3VAJA 3ITHA 4UV8A 3GWCA 2BHYA 5GPAA 5SUHA 3OJUA 1LDDA 1Q0NA 3OVSA 2RSQA 4BQNA 2DGSA 1EHWA 2CZVC 1TK8A 3KTQA 1TKXA 3A8EA 2XRNA 2W48A 4PZJA 4FCYA 4FDFA 4JYKA 3CCVI 1L3TA 4Z37A 1G4CA 3PIOQ 4DFKA 1F3FA 4BC7A 1WSRA 2H94A 2ZJ2A 3LWMA 2RDDA 4AT1B 4DV4J 1RK8A 4BXXJ 3GSIA 4PAAA 5LLQA 4PG6A 4ED0A 1JXVA 5LXRA 2G2YA 4RMNA 3ELHA 3W2VA 3K59A 2AS5F 3LP2B 2WB1A 2C2NA 2YX7A 4ZPTR 5E3AA 3T5XA 3GONA 2QLWA 3DDKA 1LFPA 6FDRA 2CW7A 4CM2A 5AE1A 4CCLA 2BZTA 4DV5F 1VMBA 5LRRA 1GAOA 2ROEA 3SZGA 2GGPB 3RCOA 2MKSA 4Q2LA 5FKKA 1RAGB 1SANA 5EEAA 2JSPA 1NH3A 1ETWA 1EJ9A 1LQ9A 4OJ1A 5KFSA 1QUPA 1XSVA 2JEJA 4WF2A 4HTIA 4DV3F 1YI2S 2Q2EA 3RJMB 3C18A 2DRDA 3HZJA 3PM9A 4QBUA 2ISYA 3KEQA 3SEZA 3KEYA 4XLPF 2FJEB 5F1RA 4O6JA 2UV8G 1U1QA 5L3CA 3NXZA 2C2KB 2HPUA 3O8WA 4DPUA 2PGCA 2XY5A 4URGA 4X4QA 1DZ5A 3UR0A 1V6HA 4USVA 1F36A 5CVUA 1VQKI 4X65J 4KUMA 3CO9A 3D28A 1DURA 2Z16A 4HNVA 5EDNA 1UKUA 3E7LA 4K4YA 3E3VA 1S6UA 5HANA 1Y4ZB 4G65A 3FKJA 1SFOJ 2CV2A 2KL8A 4M5KA 3I5AA 3SZ2A 2PI4A 2R7TA 3N4WA 3UD4P 3EZOA 2KZMA 2B4PA 4OJHA 2MKHA 3QOEA 3CJ0A 1HLWA 1FDNA 4BXFA 2ZC4A 4B3TF 5BS6A 4OU0A 2X1FA 1JIHA 5CYJA 2IY5B 1NK5A 3AJ2A 4WK3A 2GAGC 5D3GB 2QG9B 2V4JC 2XWXA 4KH0B 4KTQA 3L2RA 1ZETA 2OF7A 3D1HA 5DZ6A 4YEAA 2KMUA 4BY1J 2MQQA 1FFGB 2ZNZA 3PX6A 2KZZA 3U1MA 4E7IA 1YRNB 4CCOA 3PHEA 5I42A 2XSDC 3CJNA 3QPHA 2CJJA 3S8PA 2DW4A 2DU9A 3BR8A 1VNDA 2HR3A 3QIPB 3E2EA 5J1YA 1X4BA 1FXLA 1Q7LB 4RLFA 4BKXA 5L46A 4DUZJ 1N5YA 1SJ1A 1IBLF 4XRSA 4UZCA 4YHHF 2MBFA 3Q24A 2GM4A 2E5NA 3E6CC 1U0HB 4PZVA 3Q0VA 3B6CA 2HS0A 2RU9A 3MWMA 4KAIA 1TWFJ 3V6HA 2WSCC 1FTCA 2BJ9A 1RWXB 2CQ3A 5FO5A 2AWZA 4BHBA 2XRLA 4LSLA 3QT8A 2KVQE 4H4KA 1SD5A 3SZPA 3CCWA 3KKFA 2GC8A 4M63A 3MFIA 2XGQA 1VRUA 5EG0B 1J9IA 1S1WA 4UOGA 2VG6A 2CW0F 3H5UA 1RLDA 4KGVB 5I3PA 3RB4A 1JHFA 1FJGJ 4PYDA 3GE9A 4HH0A 4TVAB 2F5FA 1OR7A 3DCAA 5GP9A 2B9EA 1D0EA 4BU2A 3JAMY 1H38A 3BOQA 2ZH8A 1HBUA 1QZZA 4ZVEA 2LK2A 3A01A 2VPLA 2Y0SD 4G6DA 1A04A 3GPAA 1WHWA 2W2MP 4LF5F 3FUYA 4CO3A 3MXHP 3OIOA 2LYCA 3N05A 5B08A 1F2HA 5D6EA 3PW0A 3H9QA 4K0KF 2R3VA 5KNLA 2V67A 3MM5B 5JXSA 1U1RA 1MNMC 1X1BA 2W4DA 2F4FA 3IAM9 3MCSA 4U87A 4ANDA 3BDEA 3HVTA 1FD2A 5DD8A 3ASOH 4JI7J 3E6BA 3S7RA 2NQPA 1KHWA 4EO8A 4Q8EA 3Q2TC 2JK3A 5KAIC 3BGRB 2COBA 3DOKB 2DGUA 4LSZB 4NEYA 4UTGA 3GCMA 1LXNA 3CJSA 2NYIA 3QGGA 3TANA 1K61A 5L39A 2ADBA 1RESA 4P9FA 4F55A 1HFEL 3CJQA 4UT4A 3MF5A 3CTAA 1D09B 4HLYA 3IG1B 5G0RA 4IH5A 3CW2C 2MPUA 3D5LA 1B0TA 1BUXA 2CQNA 2DPUA 5C7PA 3B54A 4RB0A 3IN5A 3S8SA 3JXOA 5KOWA 3N5FA 1SFEA 2R93J 4ED7A 4HOBA 2XB5A 2HLUA 1TLHB 3ZRGA 3I9V9 2QJ3A 1U6GA 3OTBA 2I5UA 2RDIA 3W2WA 4ZCKA 3IBWA 1G6NA 2HSEB 3LP0A 2MD0A 4EZ9A 3QO9A 4KMFA 3S3OA 2LXFA 2OSQA 2Y9YA 1WC4A 2EK1A 3R2CJ 2HQAA 2JLFA 4WFBQ 4RBUA 4NYPA 3S1QJ 4ECSA 5GVQA 3ZZOA 1YI2I 4CYCA 3FHZA 1P27B 2TDXA 3PNTA 2FD5A 1UFMA 5DCFA 1KD1T 3IM9A 5TGTA 4RUHA 3L2CA 4BWJA 3ZN1A 2R7UA 5JVTA 2L01A 3MVPA 2GJFA 1ON2A 2LVWA 1I5OB 1UW4A 3CGIA 4EJTA 3K70D 2GV1A 2DI3A 3H25A 2ATLA 2GHWA 3DLJA 1PSDA 4WXOA 5IP7J 1UAWA 2HPIA 1SKSA 2AGPA 5KTQA 1R8CA 3KJFB 1PBAA 1X4GA 1FX2A 3TAMB 2LNBA 2YTCA 1AFIA 3KWMA 2XAHA 3H3VK 1TL3B 4DV7J 3V8KA 2AXLA 1S1VA 4JYAF 2ZE2A 2DISA 2CJBA 1AUDA 3BH7B 4UVBA 3ZTPA 4N77A 4O3PA 2DHAA 3JTHA 1URNA 3WDOA 1G59A 2HRTA 2KB2A 3Q9SA 4ZH4F 3HFZB 4JV0A 1RKJA 3NEUA 4DLEA 3EUAA 3AXKA 4BBSJ 3M8WA 2ROPA 4J90A 3Q8YA 5HROB 2XQCA 2HVDA 2GHVC 4ECRA 4PUOA 1NAQA 3WGGA 2I1RA 2ADUA 1CGPA 4XMYA 3KUHA 4DPWA 3A8KA 3NBPB 3N9UC 4M5JA 5J2PA 3HSRA 1HKQA 1E0EA 4ZPAA 3R9LA 5AXKA 1A31A 2NVQJ 4BHPA 3JSOA 1J5OA 5C4JJ 1DBDA 3DPTA 3ZMDA 1JLAB 5L1KA 2XKPA 3ILJA 2QSFX 2NS8A 3SCIE 1HCRA 2QC3A 4XLCA 5J2NB 3THPA 1TL4A 4DUTA 4B9UA 4D3HA 4DX8H 1KNZA 1GMWD 4ZTJA 1TUGB 3K4JA 3AAFA 1BY9A 3M8EA 1R43A 3AA9A 5GMDA 5GTHC 2MSTA 3RRKA 2I0XA 3BSAA 3ZZ0A 4XO0A 3HTSB 2Y0SN 4P10A 3HPOA 3IC1A 4DEZA 4YB6A 2MDAA 5K7FA 5DM7Q 1RHRB 4B8XA 3GTYX 2NYXA 1F9EB 1QTNB 2QFIA 4QWCA 3QRRA 3BBBA 4GDFA 2WAQN 4HPQA 4KICA 3DRRA 1MMSA 2CG4A 1IJWC 3J7YJ 3MMBB 2NUHA 2PMZD 3TWZA 4WF9Q 4BQOA 1XCVA 4AQYJ 1M5VC 4DX6A 3PRVA 2QA4I 1WSUA 1PUEE 4WXWA 4X66F 2QBYA 5EZHA 2X4HA 2YPZA 2XPUA 5KFPA 2XMJA 4DF8A 1T9TA 3K7RA 1HMVA 2XAFA 2HHWA 5GADI 2VD3A 3SXLA 4B3OB 2V5HG 3S93A 3DLGA 3KJVB 1IKXB 3SI8A 3DLKA 3CDWA 2VKEA 1KVKA 3M4OJ 4ZA1A 2QKLB 2ZJRQ 2AIRB 1T03A 2Y3YA 2IM1A 3ZQ7A 3JTOA 3DLBA 1X9MA 4CLKA 3KP6A 1VC5A 2QWWA 1W4MA 4ZKAA 5CD4A 1U6BA 4BNCA 1RCOB 1QHGA 1FTTA 2RDPA 2WWYA 2RB7A 4DSKA 3M1EA 3W5YA 4C2UA 4USJC 4TY9A 2DJIA 3KDOA 3TAPA 2HDWA 2LDIA 4P73A 2KJBA 4E98A 2VC0A 3B78A 1L3UA 2HGLA 3FIWA 2UXCF 2ZJQF 2CJQA 5B1AH 3HX9A 4RX6A 1FWZA 4C8NA 3NRVA 1X4DA 1SKRA 4JBAA 3R97A 1FBSA 4MHGA 2CA9A 2JPCA 4XIUA 1HI0P 1YJ9I 5F9LA 1FRMA 3I0SB 2HZTA 2DFFA 1T08B 2DGQA 4LB5A 2XGCA 3OR1A 1N33J 2CRGA 1FLIA 3NWTA 1WDDA 2V2VA 4X6AJ 3BO4A 4Q43A 2J7WA 1HR0J 4P55A 1Z3YA 4YS2A 3K0LA 1F2GA 1ZOTA 1Y8RB 4KE5A 4O44B 2VFRA 2VQEJ 2O9LA 2PFFB 3O3LA 1NG6A 4OMFG 2LEAA 1VQ9S 3PVXA 2B0LA 2QQ9A 4M1KA 1Y00A 1LW2A 3DBLB 4HLBA 4HX4A 1ZR2A 2E1CA 3N97A 1UVIA 3VB2A 4A8FA 3M6XA 3QLHB 2ME6A 2IJLA 3N01A 4IL6C 2QENA 4P7TA 1TC3C 4I56A 3JSYA 1NPPA 3DBHB 1TAUA 3N4MA 4G6QA 5FJ8J 3DRSA 1FC3A 3NAIA 3HHLD 4IG3A 2M1BA 4G6TB 3EGVA 2CQHA 2O0YA 2VA3A 4UUWA 1VQ5S 1Z6TA 3IAS9 2BMBA 4F4AA 3RAQA 4JI8J 4B3RF 1IV8A 3HXLA 1NU4A 3QRQA 3LSMA 3UN2A 4F67A 4XAKA 3QT6A 5CYQB 1U09A 2GVZB 1Z3XA 3R7BB 1NM2A 3MM6A 1AUSL 2CPJA 1RB0A 3L4BC 3F9KA 4X64F 2JUCA 4Q47A 3IUOA 2MY8A 4UNOA 1OPZA 2K7LA 4IDKA 4URQU 1QAIA 4Y6IA 2OQRA 3IRRA 3IGVA 3L1PA 3ZP5A 3OYMA 1OCTC 1S7AA 4Q8FA 1T11A 2CQ7A 3OIPA 2LREA 1RBAA 4KY3A 2ASDA 4C3JJ 1GNKA 3Q83A 2GXGA 5FROA 2IRYA 4OYPA 3RAXA 2A10A 2PMUA 1K1QA 4GYGA 1R7IA 2D45A 2DNLA 2XYGB 3PEHA 2QCOA 1GV2A 1T98A 3TO9A 1DFDA 3NWRA 2Q6BA 2QLXA 2KISA 1TL1B 2V8VA 3VAIA 3BG9A 2LKSA 3C3WA 3J7AN 2C3PA 4NI2A 2DFEA 4QIVA 2KT0A 5DUKA 2BE5F 2XB0X 1YS7A 2A68F 1CJUB 3PHTA 1SUQB 3H5AA 2M52A 2Q43A 4DR6F 3K4CA 4HDVA 2C1EB 3D3BJ 2OSRA 2IHR1 2FVRA 1S12A 1WKLA 2W24A 5KT5A 2GFFA 5J8CA 3OVBA 3H5XA 4CO1A 4IKAA 2DDAA 1C1BA 2QV6A 2VKHA 1ZAVA 3SDBA 1LFWA 3T5KA 4X0GA 2D7SA 4IR1A 3ZPLA 5M2RA 2HU9A 3NGRA 2WTEA 1NPKA 1FKPA 2BOLA 1TTYA 1PJRA 2BW3A 5IWAJ 1WUUA 1RHJB 4JP8A 2M7BA 4A93J 4HZFA 3H0PA 2ZBQA 3SSQA 4RZRA 3W8GA 3H0GJ 1STZA 5LEKA 1RTHA 1RT4B 3H35A 3RU0A 1D1AA 2XSJA 1R1UA 5EZGA 3K17A 1G3YA 1MBKA 3M6WA 4FYVB 3BTJA 5K8NA 4YFNF 1WQ2A 4M3GA 3GG1A 1F5BA 4FPRA 1UMQA 3MQ0A 4ZDPA 1NDCA 2ZXWH 4DX5A 5F8GA 2KFZA 4A5NA 2XYHB 3G82B 2XEXA 3UVJA 3LAJA 4EO6A 2B5JB 2OC6A 5DS9A 4AL6A 2I5JA 2YWHA 4JI0F 3CCSS 3MEXA 1PP8F 2M8HA 1LPQA 5IOZA 1Y5NB 4PWWA 1MDMB 3DLHA 2HQFA 2CUFA 1X2MA 4I01A 2HTSA 1T9WA 1FTZA 1TKTB 2YQ0A 4KKOA 4DR4J 1S49A 4LQ9A 3DOMB 1WTBA 4ZS6A 3GZ7A 2H1LA 4NLXA 1GMVA 3FXQA 3OSFA 2CQXA 3UDVA 1HA8A 4QIFA 3I82A 3TP3A 3PQJA 2ZVSA 3CJ8A 4W98A 5F0UA 2ID3A 4A69C 3LA3A 2HNDB 3K2YA 3M7GA 2HFOA 3N79A 1TFWA 2FD2A 4CTAB 2Z33A 3IRQA 3R5CA 3O8GA 1VQPS 4ECUA 3K5LA 2JA7J 4XLEA 3U2RA 3T5LA 5JLXA 1DTQA 1IQZA 2RN7A 2WBMA 1ZA2B 3FMQA 1BC8C 3BGFA 3JYTB 4KT0C 1QVGR 1S59A 1XBWA 3GFHA 4H4OA 1D0ZA 1YGYA 2QA1A 1Q82T 4P72A 1YDLA 2A3SA 5CQEA 1KDNA 1S0NA 2GMJA 2ZKTA 5KFHA 2DITA 2G7HA 3LPYA 2Z2YB 2EBEA 1VQ9I 2MJUA 5AONA 3T8TA 3E5UA 1RZMA 5B09A 5ETOA 2HDDA 3EPIA 2L3DA 3WIVA 4DBQA 3MEGA 2ZB9A 1U6ZA 2MQ8A 4ZLNA 1SL1A 1RT2A 4MFBB 3WHIA 1T9UA 1RACB 2GS8A 4PUSA 3OL6A 3JSPA 2PJRA 2YNHA 3H42A 4J9MA 4QR0A 4L76A 3CLQA 3T1YF 5HLFA 1KS2A 3P8BB 1ETOA 1SC6A 1SI9A 1MROB 3A3OB 4DCOB 3QBCA 5D4LA 3MMCB 1PCAA 2J0SD 1D1CA 3QU6A 2DA7A 2O5DA 3ZMUA 4TLRA 3UCZP 4J9RA 3Q23A 3VODA 1I1GA 1MSFC 3FWEA 4C3LA 1WJCA 2HQIA 3OIQA 3P5TL 1ETYA 1Q7YT 2UUCJ 3BWGA 4I2PA 4OYBA 1CC7A 1RETA 2F5CA 3G4SI 2OA4A 1I6JA 4OX9F 2D1CA 3ZXWA 2W9BB 4C9DA 4HTJA 3T6JA 3J81j 2IS6A 2Y9HA 2ZH6A 4DFJA 4CDGA 1RT3A 1MBFA 2DPJA 1XR7A 2V7FA 2WSFC 2QQBA 1WC6A 1CJVA 5EDWA 1R00A 1T33A 4J9QA 4CNZA 5DETA 1NK7A 3PEJA 1O57A 3E8OA 3CIMA 4ZJLA 3GJRB 2BW7A 1TV6A 2RAQA 1DARA 3OOPA 1S7EA 2CPEA 3QJJA 2CQCA 4IFYB 1W25A 3HXMA 2P5VA 2EG1A 3H7HB 1AROP 1SJQA 3LGMA 5L38A 3BO3A 3K0JA 5K7HA 1BGXT 4DWIA 1QUVA 2GJ2A 2JRSA 4Y00A 4C30A 3QPTA 1DTTB 2IP2A 2X9DA 3K1NA 1ZM9A 3D67A 2M4GA 2J76E 3CTRA 3E0JB 5M2UA 3TX8A 4ZP7A 2MXYA 2K7KA 4N8OA 1Y7PA 3L2WA 4KIFA 2H5JB 3BS9A 1LEBA 3QMQA 2PC6A 5ITHA 3P7NA 4B4CA 2E1OA 2IJRA 3Q5FA 2RHSB 4IF4A 2IMWP 4B3SF 5LHIA 4EK2A 2XS7A 2GHPA 2DK8A 2HHXA 5J1EA 4KDPA 4S04A 1BWEA 3GXOA 1R31A 5J2MB 4LRFA 3L9FA 3BG7A 4P1WA 1T95A 1E6VB 3CO0P 2MZSA 4BGDA 3O2PE 3M30B 1KP6A 2P81A 3MHYA 4ZVPB 4ECTA 1ZM2A 3EVOA 2N82B 3CDIA 4NQWA 1D5VA 1RBOB 5H2FC 4GYIA 2EKNA 3OLBA 1IR2A 3PCOB 4F4WA 2BE2B 3NY0A 3TUJC 4DR7F 1NK9A 1FIAA 1F4KA 2JOQA 3PJ9A 4LVOP 3BQ2A 4E6KG 3WE2A 3KE2A 3EDQB 2HOEA 1IWGA 1K78B 1K47A 2HFZA 3L2VA 3CDAA 1SD4A 4OHVA 3DHXA 4OINF 4ZPVR 3P45B 3ICLA 2ZKUA 3OYJA 3KHHA 3CCSI 2VJVA 4WBFA 1B6AA 2C6YA 2MSYA 4AVPA 3CCRI 4Y2IA 3IXQA 3RKQA 4L5JA 2FB0A 1L5UA 2VV5A 4A3MJ 2I9SA 3MUVP 5F8IA 4LF7J 4WPAA 3QPIA 2JSXA 4TN2A 3J80U 3FXUA 2LC2A 2JLGA 2YWWA 3EUHA 2APOA 1WI6A 3HPHA 1P7JA 2R4FA 1WHUA 1MH4A 2VJJA 3IAM2 2DQLA 2EIMH 4XRSG 2D5VA 2LEBA 3LAPA 2RS8A 3CUQB 3PR4A 1ETQA 1T56A 1EJ7L 3KFWX 3OS2A 2CPHA 2HS3A 1RYSA 4UOHA 1VQPI 2FJXA 2BANB 2P9CA 2YH1A 4ZVHA 2DK2A 3L7PA 2M7AA 4FZVA 5F0HA 1QAYA 5ETTA 2R7FA 5HO4A 3FEZA 1XG1A 1JI8A 4YP3A 1O5JA 1LE8B 1WD6A 1MMDA 3TI0A 4HX7A 2DA3A 3NMRA 4JV1A 1ACMB 5F3TA 2FQ3A 2GBYA 3KG4A 3WODF 1GK8A 2CFOA 4X62F 2DNYA 3TVYA 1Q78A 3WTZA 2B51A 1S7HA 4M8LA 4LF6J 2NVXJ 2V4RA 3RYLA 3I9V2 5D6GA 2PMWA 3W64A 3OS1A 2HMIB 3GX4X 5E0OA 2PG4A 1A35A 4MMOA 4FQGA 3J7YU 2CJYB 2OI2A 4R5PA 2QSGX 5LXYA 4BS2A 2Q79A 2IJFA 3CCMS 4DV1F 3JRHA 2C2ZB 4U7UD 3BZQA 4R8UB 5D0EA 3K4KA 3LAMA 2M0MA 2HHPA 4F2SA 5DV5A 4X4NA 1Z67A 1TVRA 8AT1B 1NDPA 1SFUA 3LWFA 4L18B 3HDDA 3BJOA 4RLQA 5IXUA 1GUUA 1K4SA 3HSEA 2EQRA 2ELKA 4A8QA 1WNEA 1FNXH 1KFDA 4LOCA 4QTRA 2PA8D 2Y1IA 1O3SA 2LTPA 3IA0A 4WP8A 2VC1A 1VTNC 3ZZYA 2XLKA 5IT9K 2FY8A 2VPWB 3WU2C 4G12A 2DIVA 3FF5A 5A8RB 2AYBA 3R5GA 2KTQA 1G6BA 2AKWB 3RBEA 2XMVA 3E5QA 3B82A 1PG5B 3TYTA 5EF6A 2B9XA 2R7OA 3CJRB 4HW0A 3NAHA 1R36A 1ETKA 1FFWB 1VYAA 5A2QU 2VJUA 3TGNA 3QWUA 4CDIA 3UDEA 5KT3A 2MA3A 1UPPA 1MIJA 1VQ8I 4TNOA 4UQTA 4WIQA 1U0HA 1QO0D 1YIOA 2W82A 1ZKGA 3V8LA 2LP4A 4ZN3A 3OWTA 3DLLF 3B02A 1SC7A 1V5EA 3I87A 1RZ4A 3KYCB 2E9TA 5GADJ 3HTUA 2LP0A 3T19A 4NLDA 4ELUA 2IVYA 3RW7A 2OCCH 1YJRA 3JQJA 2Z30B 4LFCJ 1Z6RA 3P5BP 4RW7A 3AFGA 5KFEA 1L3KA 5EG0A 2HS4A 1IBKJ 3BP8A 4O3SA 5FLXK 3MAQA 3TO8A 1QSYA 3TOBA 1Y3JA 3LGHA 3OTOF 2BA9A 2B9SA 3PX0A 2R7DA 2E5LJ 1N36J 1MN9A 4F3OA 4Y2AA 1FFSB 2OZ6A 3HG9A 4DN0A 3W6KB 4URSA 5HP1B 3DU5A 4M9ZA 2R7ZJ 4I2QA 2CUEA 1YO5C 4PYAA 1GX6A 3ZFVA 5A8WA 1N4LA 1X4HA 1YW7A 3WIUA 2XGPA 2CWXA 5KG7A 2XBPA 4ZK7M 4A2UA 4UB6C 5E8IA 1Y39A 3H4DA 3R5BA 2YVSA 4GO5X 2M8GX 2Q66A 2Y1JA 4XLHA 1I51B 3TP0A 1R6YA 3GYGA 4NRUA 4BAYA 1WWXA 5IT4A 1IF1A 1AYEA 3D4JA 3U7JA 4X1EA 4C0OC 2V8DA 1XMBA 1TT0A 2LY9A 2W4CA 2X3GA 4Z7YA 2E2JJ 5GAHU 2ECCA 5K1YA 3BYPA 4R79A 2OPSA 4R25A 4KO0B 2VJIA 3MPDA 2PE8A 3DOKA 3Q9VA 1JXLA 4RNOA 4HT7A 1CBKA 2IBDA 2V0NA 2MTLA 3DF8A 1HL6A 1RU2A 3UFCX 2EINH 1N34F 3VQSA 3K5MA 3F8CA 4HDHA 1RT5B 3GFMA 4ZHRA 4ZDLA 1XMOJ 4Y15A 4WZMA 1UHMA 1BLUA 4N56A 4M5GA 1XC9A 2GXBA 3PRDA 1DRZA 4KHPF 7FDRA 1J5EF 2WV0A 3JQKA 4OYAA 1S76D 3SDEA 1IVZA 5KFNA 3Q89A 1TP4A 1TWHJ 5ETPA 1M0SA 2YR2A 5DZ7A 2K9QA 4ZCIA 3T1HJ 1R0CB 3GIMA 3FBCA 3Q22A 5CABA 3W9IA 3GR1A 5BYSA 4FNIA 1I94J 3DOLB 5HMYA 1P9YA 3M8ZA 3ERED 4ZC3A 4I1TA 5DM6Q 3WG9A 3NGDA 5JVGQ 1UFKA 3QJPA 4HH1A 4WE1B 1X5OA 3DKXA 1VQOS 2BV6A 1WF2A 5J1UA 1UHWA 4CLZA 1AWCA 2PFBA 4RWWA 5L8RC 4ZZLA 4YY3J 5HLHA 3FMWA 1IKYA 4R1HA 3L95X 3QYEA 2BRLA 4V19X 4P96A 2I8EA 4C97A 1U25A 4YB7A 2P2CB 5E3RA 3JRDA 4IHWA 3QU3A 2ELJA 4OYOA 2PQ8A 3G3ZA 5J4YA 4M5NA 1MSEC 1Z7LA 4OI0A 2IM0A 4J9LA 4CICA 4W1UA 4UB8C 3J80Y 3BEGB 3FBFA 3CCMI 1DQ9A 5D0RA 4ESBA 3E01B 1N0VC 2BZ2A 1TL3A 4IRGA 1WG5A 4N0BA 1JJ2R 4HI2A 4ICLB 5HVQC 1XNQJ 4GKJF 3M9NB 3GEZA 1RWVB 3W65A 4LG0B 1KOHA 4AUXA 4I0BA 1HBOB 3ZTQA 3EZ5A 2RILA 4DPYA 1OQYA 5T7LB 4J19A 1SL0A 4P2FA 2FBIA 1TK0A 2KT3A 4IUFA 2FVCA 1CLFA 1QJHA 1A7GE 1TT5B 3BQ1A 3R7SB 2OBPA 2J0XA 1N88A 1XR6A 1R7JA 1H9TA 1EQ0A 5HOOA 1O0PA 2LXIA 2MZQA 2QQAA 3ULHA 2CXEA 3IAS2 1FESA 3TQ1A 1U7LA 4AC0A 1WI8A 4A3KJ 3PJXA 4BS9A 2H9ZA 5C42B 2YNGB 2DTJA 1DP7P 1NKBA 4MIMA 4IQMA 2BYCA 1RR7A 4KITB 1EH8A 4WU2A 4TU7A 4K7QA 3C2HA 1PUFB 3H98A 5A8KB 4EJOA 2NXNB 5LJ3Y 4DV5J 5KFUA 1X4PA 3W66A 2AEMA 1V5IB 5BOXA 3C6TB 1ZREA 2FQQB 4Y33A 4DV6F 1MKMA 4DV3J 3DFEA 4RNNA 3F23A 4DZPA 4CLYA 5JLWA 3M2VB 1KGSA 1OO0B 1GVDA 3KP2A 3E5XA 5DD4A 4RBTA 1KTQA 5AJ3F 5HN0A 1Y11A 3D5MA 1L0OC 3Q8RB 2DNHA 2K5CA 1ZYRF 1UJ6A 1XK8A 5CVIA 5CAAA 1VDHA 1YLFA 4DZ6A 4KHRA 2C42A 1IM4A 2HG4A 1BQXA 1QHHD 1OSDA 4QYZJ 1MNEA 4NLOA 2KT5A 3EWGA 1WJDA 1FOXA 1AFJA 2XGXA 4K4UA 4WFXA 2FPHX 4IHTA 1NCLA 4B3OA 2ZHBA 1NDKA 3KJVA 1RNLA 1N78A 2QSWA 1APLC 2Z1DA 1WC1A 4EM1A 1U4BA 4B3TJ 1SJRA 3NL0A 2IAJA 4G6VB 5FKLA 1WH7A 2HGNA 1G3SA 1RT6B 1S1UB 4RNFA 3WTWC 1OCPA 4OZ2A 4YDDB 4KGXB 2K4JA 4OIRF 2A3JA 5DO2A 1FRXA 2AJ2A 4I7HA 1LKXA 2LD5A 5RUBA 1ZLJA 4RUBA 5LFAA 2FC9A 4BDZA 1RTZA 3WU1B 4RB2C 1TWGJ 1IKWB 1D9AA 3JAMK 2MHNA 5CH7B 1SV5A 3LP1A 4U95A 2M8EA 4LR7A 4ZIVA 4F93B 2KH9A 5EUHA 2LXUA 3WTTC 1JLEA 3EX7B 1WOOA 1KYWA 2O6GE 3BH6B 2R7QA 4IPAA 1MJBA 1P4WA 3CO6C 1UZDA 1CSJA 1IBLJ 2DGVA 4YHHJ 1C0WA 4DU7A 4JBCA 3ILOA 1VLYA 3K5NA 4YG2F 3I6PA 2AEJA 2EFVA 3MD2A 1JJ4A 1YBUA 4WXDA 2P6SA 1XTZA 2DIUA 5D5VB 2MYSA 3ULQB 4I2OA 2XV4S 1UMJA 4MH8A 2HNZB 4DSFA 2J6TA 2DA1A 3P96A 4EV0A 4OZ0A 3VDXA 2A1BA 4LLLA 2WVFA 3FSXA 1S1XA 1U2FA 1REVB 1D8YA 3CC7I 4CXFA 1S6OA 2CFXA 1SPBP 2NCKL 2OPPB 2RS2A 4Q0BB 3U27A 4C8LA 2HHHF 4KIGA 2LU2A 1XGMA 3CMMA 2OPRA 1VOMA 1PP7U 1JJCB 1H72C 1YLXA 3I5CA 3I55I 4UZBA 4KV8B 3GTKJ 2CZ4A 3MOJB 4D3GA 4XDCA 1UWBB 1XERA 3TVZA 1H98A 4USUA 3GVAA 4S0HB 1HYSA 2CO5A 3JRBA 1RT1A 3GTMJ 4N9IA 5HODA 5IYBJ 2IDEA 5LSOA 3MZIA 4DQQA 3K4BA 2CQQA 4PJ0C 3J80Z 1EKSA 1M5PC 2HK2A 1RJJA 1HPZB 5E3LA 4J91A 3OQ2A 4NLPA 4LF5J 2G13A 2DMPA 2BVZA 1EH6A 1YQAA 3QQCD 4EEYA 4U0VA 1IXCA 4K0KJ 5KFTA 2QA2A 2XZDB 3M32B 3AB4B 3PX4A 4NXMJ 4BACA 1J5YA 1RYRA 4CYDA 4I7FB 3AHPA 1Y0UA 1O4XA 1QE1A 3CDUA 4PQUA 1L3VA 2M34A 3CMEI 2G0EA 3FX3A 3QZ7A 2DNOA 4IRDA 3WGIA 1LWCA 3POTB 3GCWP 1CEZA 4HRIA 3QPSA 4TLQA 2OPQB 2G0IA 5I4MA 1NJWA 1WJFA 1KLNA 1E6YB 4Y52J 2ZJPQ 2YNIA 1Q1HA 4RWXA 3FCHA 5THWA 3MUMP 4XPEA 3DBRB 5KFAA 5C24A 5LGNA 4DUYF 4D7NA 3DRXA 2JVHA 3DPUA 1TL1A 2SXLA 4IJAA 1YITI 2M88A 1Y5IB 3S2DJ 3CDEA 1SUQA 2XS2A 4G7OF 2W7PA 4QPXA 1UEKA 1KU9A 3KLHA 3FSIA 2DHHA 4U96A 4LBPA 4PKDB 4PRFA 1FA0A 4RU9A 3FRYA 5CHCB 4UOCA 3U9GA 1PIEA 1R0AB 4BBRJ 4ECQA 3H2LA 2KDZA 2BKNA 3VF0B 3H3ZA 2DN0A 3TA1A 5L3EA 2RREA 5IM0A 1IN6A 1V9OA 2LYVA 2KRBA 2ILYA 4WP3A 1AOYA 4PFOA 3C1DA 3TKYA 2MLKA 3GIJA 4AE5A 3W3CA 3D7SB 1RISA 3CMAS 3G8TA 2OU2A 3SHFA 3ZZRA 4NZ6A 3K1PA 2K27A 2COLA 1RT4A 4F26A 3R2DJ 3KXDA 2DR6A 5B3SH 5A2QZ 4FVMA 2WCXA 3ADAC 1UEVA 4DSJA 1U5TB 3H0DA 4ZYGA 1G2HA 3NNAA 1YW8A 2A05A 1QBJA 1RAIB 4K50A 4I76A 3MPVA 4KR0B 1U1MA 4GGGA 5F04A 2MD5A 3FDYA 2V2KA 5ETVA 1USSA 1WF1A 2M87A 1HQUB 1OQ3A 2ISZA 3J7ZT 4CO0A 4DG1A 3R0AA 4GVBA 3DXSX 2YKPA 3NOCA 1VJQA 4ZP8A 2JX2A 4IOCF 1IJEB 1BIBA 4WFYA 3EYIA 4Q5VA 4YR2A 2BDPA 2NUUG 1MDMA 2K85A 3FVYA 3KPHA 3CE8A 2F5DA 2VIXA 4XR6A 4OAZA 2N7YA 4LT6A 2W9CB 3NCPA 2IFXA 1P1TA 4LF9F 2ALYB 2F5VA 1U5TC 3Q3SA 2EH3A 2HGMA 4ESJA 5FD1A 3OXLA 1Z9CA 3O1LA 1NZAA 2QSFA 2V6CA 2KRHA 2OD5A 3FCVA 4F4KA 1ZGAA 2HNDA 2R5ZB 4HACB 4G7HF 2XNRA 3M8SA 1PAUB 2HDCA 2QLZA 3VZIA 2X1CA 5HQLA 5CJ9A 1F9HA 4HL9A 2R8HA 3IH4A 5FRMA 3FXKA 5FDLA 1JGSA 1QLNA 2DNGA 1O51A 2HQGA 1MZBA 4D1QA 2IVMA 2BY1A 3ABMH 3ZQGA 2RE1A 2K02A 3PNYA 4BE0A 2BVMA 3CCZA 1HWJA 2NSCA 3PFIA 4X84A 2RJZA 4FS1A 4MGRA 4Y65A 4OMZA 2KG0A 5D4RA 3MPWA 1BQNB 2QL5B 3K5OA 3BGOP 1HHTP 2BQRA 4MFDA 2FDNA 2CGPA 1TL7B 3QRFF 4IO1A 4HR2A 3IWNC 4KMUX 4O4GB 1VGYA 5IC6B 2MY7A 2VBZA 3F41A 1HKTA 5EHHA 2HFNA 2FQ4A 4ZPCA 1DLOB 1JLBA 4U67Q 4DR1F 2KM8B 1XNRJ 1EETB 1HNWF 4X66J 1WH5A 1BHNA 1BR1A 3DLLQ 4UY8T 4MFBA 4UF4A 3PYGA 4NNJA 2L4AA 3PDNA 1YHQI 4ENKA 2DXIA 5CXTA 1JKRC 3ZGKA 2K1RB 1X4CA 4P52A 3NOGA 4LSNB 5DEQA 3JS9A 1MROA 1CULA 4PCQA 1QZYA 4IRCA 1Q79A 1VCTA 5DLGA 2GA7A 1VQYA 3MMCA 3I0RA 3X3UA 3V42A 4MEYF 3OBIA 3C19A 5F6FA 5CCMA 3ZQLA 3VEPA