1I1GA

Crystal structure of the lrp-like transcriptional regulator from the archaeon pyrococcus furiosus
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
140
structure length
140
Chain Sequence
IDERDKIILEILEKDARTPFTEIAKKLGISETAVRKRVKALEEKGIIEGYTIKINPKKLGYSLVTITGVDTKPEKLFEVAEKLKEYDFVKELYLSSGDHMIMAVIWAKDGEDLAEIISNKIGKIEGVTKVCPAIILEKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords TRANSCRIPTIONAL REGULATOR LRPA
publication title Crystal structure of the Lrp-like transcriptional regulator from the archaeon Pyrococcus furiosus.
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 34
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01037 AsnC_trans_reg Lrp/AsnC ligand binding domain
A PF13412 HTH_24 Winged helix-turn-helix DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1i1gA01
3.30.70.920 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1i1gA02
4WK8F 1KQ8A 1T39A 4EJVA 2M8EA 3REOA 2E1AA 4CICA 2XAQA 1F1ZA 4OMZA 4L9VA 3GZ6A 2DK8A 2ZCWA 3VEPA 1P2FA 2DO7A 4NQWA 1K7AA 1IN8A 1P92A 1BM9A 3LQRA 1PP8F 5BPDA 2Z4PA 2H6BA 5D5UB 1Z7UA 4FHTA 2WC2A 1IUYA 1FBSA 2FNAA 1EH8A 4LJZF 2QUFA 2GXGA 1TQIA 4MNUA 2G9WA 3LA2A 1Y0UA 2CW0F 4G7OF 3Q9SA 3HHHA 2DI3A 2O0YA 4HX8A 1USTA 3RPQA 2WV0A 3BPVA 3ZN0A 1DPUA 1O3RA 1FP1D 2FXAA 2JZYA 3EETA 1BC7C 1ZAOA 4EJUA 3F8BA 2DW4A 1L0OC 4HZFA 2VC0A 3I53A 2MC3A 1BI1A 5DV5A 1ON1A 2EFPA 5K5OA 1IW7F 2DLLA 2MA3A 4ENKA 4P55A 1HSJA 3ZMZA 1YS6A 3RYRA 5ERIA 5LHHA 3HIFA 5EEHA 3CJNA 1IAWA 1LDKB 2W24A 1SFEA 3MEXA 3HSRA 5JHUA 1TW3A 4YIFA 3DP7A 2JSCA 5FO5A 5LGUA 1S6LA 5DDGA 2W84A 3QU3A 4YG2F 1F5TA 1UCRA 5LBQA 4OMYA 3F6VA 2HYFA 1LEAA 1V4RA 2GA2A 2EB7A 3ZMUA 3JSOA 1UFMA 2K86A 2BE5F 4HLXA 5D8KB 2ELHA 3VFZA 4ZH4F 4O6JA 4U88A 5FLXK 1HW1A 3I59B 1XGOA 1R1TA 3F8FA 4BXUA 2EJRA 1WQ2A 2V1XA 3B73A 1QZZA 5F6FA 2HGCA 1G3YA 1K6OA 2QQBA 4LG0A 2O03A 2ZNZA 4UV9A 4L9NA 4KN4X 4N0BA 1XDUA 1RUNA 3LAPA 1R1UA 3FM5A 4RS8A 3J80Z 5F1RA 1K78A 1B59A 5HDNA 1XB4A 2A6HF 4PCQA 1RNLA 2Z33A 2HTSA 1SD7A 5L3GA 3F23A 1Z91A 3E5QA 5HDKA 3ZMSA 4RAYA 3FXUA 1ULYA 2YSRA 3RYPA 5D6EA 1E17A 5E8IA 3V7CA 3ROUA 2ESHA 1EV7A 5LHIA 3P9IA 2JTVA 1JGSA 1LDDA 3F8NA 2F5CA 2FU4A 1ONVA 5J8FA 4CGZA 4HV6A 2ZMEB 2ZXJA 2PMHA 3IC7A 4CO8A 5DEQA 1SFUA 4L9TA 2VXZA 2A68F 3GF2A 3CUQA 2XGXA 5DUKA 2MD5A 3I4PA 1KQ0A 4H0EA 1YG2A 4ZYHA 3I0TA 3HYIA 1O7FA 2A69F 4U0WA 2P5VA 1TQPA 1XCBA 3M8EA 2XROA 3GFJA 2P7CB 3KETA 2GQQA 3SFZA 1YW9A 1W7PB 2Z5UA 2BV6A 3BP8A 1ZRFA 4I0BA 4GYGA 3GVAA 2ESNA 1YYVA 2EA4A 1JHHA 2RV8A 3LSTA 3I58A 2L4AA 3CUQC 4XSZF 4P9FA 5BS6A 1AWCA 4UV8A 2E7XA 1A04A 3NRVA 3BDDA 4KICA 2AS5F 4MGRA 2P7VB 3VODA 3M9AA 1G3TA 3T8TA 2OD5A 3MQ0A 4I0AA 4ASNA 3L2CA 2EFOA 4A6EA 4HF0A 3R60A 1L3LA 3LA3A 3FMSA 3GFIA 2NS0A 5IT3A 3TOBA 3ZQ7A 1LJ9A 1FZPB 1FBUA 1BJAA 4RGUA 2K27A 1HQCA 3QP5A 4ETSA 2XKOA 5LGNA 4A5NA 4XBFA 4L9JA 1ZLKA 1ZG5A 3F6OA 3ECHA 5L3FA 3OOPA 3O2PE 5EEGA 2J5OA 2MLKA 4XLPF 4WXDA 4FX4A 2W85A 4RB2C 3HSEA 1HKQA 6PAXA 4L0ZB 3IRQA 2HR3A 4BHCA 3ZMVA 4EJTA 2RVCA 4ZYGA 1H9TA 1YFHA 1RIOH 5HVQC 4YIIA 4YFNF 4OOIA 2RQPA 2OQRA 2DFIA 4IF4A 4LB6B 2Q2EA 4I02A 1SMTA 1U2WA 4XRFA 3I64A 4U7BA 2YX4A 1XSXA 4KDPA 2IPQX 1KU7A 1RI7A 2QWWA 2P5KA 3DPTA 2EK5A 2X4HA 5ICEA 3T0YA 4IRHA 1ZHFA 2HEOA 4EJWA 2XHKA 1KQ9A 4BHBA 3MZYA 2M1BA 4HA8A 2Y0MA 2FNPA 5AIPA 3VOEA 4Z2YA 2IA1A 3VB2A 2OZ6A 2EWNA 4L5IA 5L3DA 5K5QA 2FA5A 5KK1A 2E1CA 5LRRA 1IN6A 2VE9A 1WI9A 5KVRA 3KP4A 3BZ6A 1I27A 3BROA 4ENMA 3CDHA 1ON2A 3GWZA 3QP6A 2IW5A 5IT9Z 5CVJA 3TKYA 3QAHA 1MZBA 1T98A 3ML6A 5BPIA 2RC4A 1USSA 3JW4A 4AIKA 2EV0A 4HQMA 1KA8A 3JAMZ 3N97A 2FBKA 2AXLA 2RKHA 2NRAC 4D0PA 2A3SA 2FEZA 1XDSA 3B02A 3TDUC 5LRSA 3DEUA 1Z6RA 2E7WA 2ISZA 4HW0A 1B9MA 3K69A 4BHPA 1G6NA 1MDMB 4P96A 1W5TA 1B9NA 1NHAA 4QWQA 1Q1HA 2BBYA 2HKXA 5CVRA 5JR3A 4LGWA 5FFXA 3T1BA 2BYVE 3CO6C 4PGGA 4ESJA 1UHWA 4ZYEA 3WGHA 4B09A 4HLYA 1W7PD 2CVIA 4OIOF 1R00A 5ILUA 2UXXA 1J2XA 2KIMA 2PLYA 4L5JA 1OYWA 3SZTA 1J7KA 5L3EA 4F7ZA 1CF7B 4RGXA 1U3EM 4PZJA 3BWGA 4XLNF 3E97A 1BBYA 4M9ZA 2K7LA 4LLNA 3ABTA 4DNCA 1W5SA 2ZKZA 4HX7A 3V8KA 4G8XA 2V9VA 5FGMA 3SZPA 3JTHA 5DUIA 5BQTA 3AAFA 5DCMB 1ZRCA 3GX4X 3OV8A 3FMQA 1I6XA 2UZKA 2NNYA 4A0YA 2BGCA 2MH9A 1ZN2A 3KP6A 1FYMA 4ESFA 2DTRA 4LK0F 4Q5SF 3M1EA 2RGVA 2KIUA 5CVUA 4EGYA 3DXJF 4HF2A 2CWEA 4EJOA 4I98B 1T2KA 1JHFA 2F5EA 3WE3A 3U2RA 1QBJA 2XV4S 2QENA 4I2OA 2VT2A 4O3MA 1XSVA 3CTAA 3I71A 3RJPA 4KA4A 4B8XA 4EGZA 4BQAA 4A12A 3WGGA 5JVTA 4GCVA 1T38A 1KYWA 4M72A 2H27A 1S7OA 4EM2A 1KU3A 1JXSA 1U5TC 2HQNA 2P6SA 1K79A 5H6RA 3WTTC 4KMFA 1H9GA 2H09A 3QPTA 1QGPA 3TDZC 1KU2A 1ZG3A 1TBXA 4YFXF 4P9UA 2LSOA 4RB3C 1P4AA 4UHTA 2E1NA 5TRDA 4UUVA 1R5HA 3IL2A 5FLXZ 1LB2A 3O6BB 4CHUA 3MAJA 5FD5A 3HRMA 4RB0A 2JPCA 1IF1A 3WTSC 3I5UA 3ISPA 4LFUA 1I5ZA 2YX7A 3T5XA 3WTVC 2J5PA 5E1WA 3GUDA 1IN5A 3P9CA 4PGHA 5HS8A 2D1VA 2P4WA 3W6JB 5E1XA 1KYZA 2ADUA 4EM1A 4QLCU 2JPBA 1S8NA 4HQEA 3JSPA 1ZH5A 4GXOA 1TNSA 1BOAA 2DQRA 3K1MA 1LDJA 2HDCA 2R7FA 2IA0A 3FZVA 4MHGA 2A5YB 5AIQA 4S05A 3WGIA 2GWRA 3J7AO 4ZZLA 2CG4A 3R6SA 2IP2A 3K0LA 1PUEE 4G7ZF 5D5VB 3LWFA 4M9SA 3RTRA 3WODF 5LEJA 4WF2A 2ZBKA 4Y13A 2FMLA 3K9TA 4MQVA 4HX4A 2GA1A 3GO5A 4HBLA 1BIAA 4WXHA 1ZREA 2STTA 1OYIA 3ULQB 4HV5A 5E17F 4L18B 2NYXA 1BI2A 2QQAA 2P5LC 4MQ9F 3CUOA 2V1DA 4GGGA 4O5VA 1G3SA 1R5GA 4KIBA 2XAFA 5HLHA 3K2ZA 1ZGJA 2ACJA 1D8KA 2JRTA 2MBFA 2PEXA 1HW5A 2IRFG 3O3KA 4BH9A 2HZTA 3ELKA 3LA7A 4TV7A 4OINF 3F72A 3FWEA 4E70A 3WTUC 1J9IA 4ESBA 4JK1X 2GXBA 2QQ9A 2PN6A 1SD5A 4LG0B 1IN4A 1FWZA 3TO6A 1IZ1A 2BEOA 1SFXA 2L3DA 1I1GA 5ICCA 2DPUA 1K78B 4DQ2A 2M30A 3KZYA 5FFZA 1FYKA 3EYIA 2DU9A 2XKPA 2GAUA 3E6MA 2Q8KA 1S29A 5FD6A 2DPDA 2LF8A 3U1DA 4MEYF 5JI6A 1PDNC 5F64A 4EVIA 2VT3A 1P6RA 2HS5A 1U6GA 2H6CA 1BC8C 1FC3A 4R1HA 3T8RA 3U9GA 5DYMA 4IHSA 3EQLF 3KP3A 1XCVA 2ZNYA 5CLSA 1MJAA 4U0YA 3HSFA 4EV0A 3CO7C 2ETHA 1TNTA 3F8CA 1Z9CA 1HBXG 3E6DA 2PQ8A 3EUHA 4JQFA 2COMA 5E18F 1V3FA 2VODA 2XAGA 2F5DA 3S2WA 3CUQB 3HTUA 5K5RA 3RI4A 5BMZA 5CVIA 4CYDA 5LLQA 3WTXC 3LAJA 2K02A 1O3TA 1BI3A 3BJAA 2L54A 5ILVA 3HRTA 2PBIA 3TO7A 1GXQA 2IJLA 1UB9A 3FF5A 2MLGA 2O3FA 4G6QA 4S04A 5LEKA 1XMAA 2FQ3A 1FX7A 1IXRC 1DUXC 4LMYA 1DDNA 1YLFA 5D6FA 4IRGA 4IXAA 3R61A 4AD9A 3Q9VA 4HDUA 3MFKA 5CVVA 2ISYA 4GYIA 5H20A 2WTEA 4WX9A 1ZGAA 1H0MA 3GZ5A 2M45A 3QOPA 2XRNA 3L9FA 2LKPA 3HOSA 3R0AA 2KJBA 3F3XA 2G7UA 3ERED 2VOPA 2QVOA 2D45A 3V8JA 3KEQA 4A2UA 2QYOA 1KU9A 1J59A 2VBYA 3L00A 2V6CA 2RNJA 2LNBA 3IWFA 3ZMDA 4G94A 2VOOA 1D8JA 4KYWA 3JTGA 1O57A 1G4DA 1YTYA 3SQNA 1R7JA 4K2EA 2OQGA 1ZRDA 1STZA 3ZPLA 4AIHA 1HSTA 2HKOA 3TQNA 2PFBA 2Y75A 4NB5A 2MH2A 1RUOA 1PP7U 1XGMA 1FOKA 1QPMA 1GVJA 2OU2A 1S7AA 3HRUA 4EM0B 1OR7A 1B6AA 2A61A 5A2QK 1HKTA 4MTDA 2ZJ2A 1FPQA 4LB5A 3WTZA 2L01A 3D5LA 2TDXA 5DD4A 1TTYA 3GW2A 5BOXA 2NAZA 4CXFA 1ZYRF 3V4GA 4AIJA 1D5VA 3ABUA 3ECOA 4N9IA 2XIGA 3RDIA 3RIRA 2H94A 4L0YB 3L7WA 3KEOA 1FYLA 3MCZA 2PJPA 1FSEA 3V8LA 1GHCA 3EYYA 3BPXA 5CYVA 1GXPA 2XAHA 4G6DA 3W6KB 5D4SA 2HTJA 1E2XA 3R4KA 2YR2A 3J81K 1EH6A 4Y15A 3KCCA 5HS9A 5AONA 4FX0A 4LD5A 1X3UA 2PMUA 3ZMTA 2CQKA 1AOYA 1LVAA 3E6BA 2DJWA 1J5YA 1MJ9A 3M8FA 5HDGA 4PDKA 2RN7A 2O8XA 2HFHA 1HXDA 3MWMA 3CLOA 3I59A 2RDPA 3G73A 4A0XA 1WSUA 2L02A 1YIOA 1Z1DA 3H3UA 4I09A 3RKWA 1FSHA 2VBZA 1IRFA 5H6QA 5J6XA 1UHMA 1B1BA 3BOQA 4M74A 3F21A 4WXCA 3KLOA 3GXOA 3C1DA 1RZ4A 3WG9A 1ZLJA 5LGTA 4NHJA 3BJOA 4IJAA 2KKOA 3R0JA 4AWXB 1LNWA 5D8LB 1U5TA 5D4RA 3WTYC 2V79A 5FB2A 1SMYF 4ZZDA 1LQ1A 2ZFWA 5TJJA 2UWMA 2UXNA 4OU0A 1KGSA 1U8RA 4N9HA 1D3YA 2VE8A 2R7DA 1P4XA 3KZZA 5E8GA 2ZO4A 3KLNA 2EFWA 1REPC 4G9YA 1W4MA 1BN5A 2B0LA 2ZMEA 2DQLA 3P9KA 2JT1A 3IKVA 4LK1F 4KN7X 3HTSB 1R58A 4RB1A 2CSOA 3DPLC 2YU3A 4R8HA 2O6GE 2M87A 1OPCA 1O3SA 3QPHA 2O61A 3V7SA 2Z3YA 1OYYA 5L3BA 3BJ6A 5JFRA 3K1NA 1W7PA 1LEBA 2EFNA 1U78A 3E6CC 4OIQF 3HHGA 1TQMA 2HQRA 1WRJA 4M9XA 2VBXA 4HAMA 1F4KA 1DPRA 5D5XB 1I1SA 4P5OA 3FHZA 3V7RA 1XGNA 3H3ZA 1R1VA 2WWYA 4WWCA 2IT0A 2FSWA 2FBHA 1O3QA 3BY6A 2XVCA 1IXSB 4A6DA 3SXYA 2Q0OA 5ILSA 3HUGA 1U5TB 3H92A 1BI0A 1ZARA 1S3JA 4Y17A 2Z99A 1FLIA 5LHGA 3J80K 2OBPA 2V1UA 2QM3A 1QZYA 4UVCA 2EV6A 2FMYA 4A0ZA 2QLZA 3RPUA 4U7DA 2A6EF 4HF1A 2FF4A 3PQKA 1Z05A 4UNOA 2D1HA 2F2EA 4EQQA 1FT9A 3RKYA 3FXQA 5J8CA 4CZZA 3QU6A 3SHFA 4BNCA 2KIFA 4LLLA 4IPAA 1XSDA 3E5XA 2CO5A 4Q48A 1OKRA 1YW7A 3KP2A 2LF7A 2OA4A 3NEUA 3KP5A 2DAOA 2IA2A 3DKWA 3K1PA 2D2WA 2JSXA 2EFQA 3EDPA 3KE2A 4M6XA 3NQOA 3IHUA 5HLGA 4HYEA 3GEZA 3IKTA 2CGPA 4OIRF 2HWVA 1J0RA 3LFKA 3WU0A 2DBBA 5DCFA 1SD4A 2HOEA 5ED4A 2EV5A 2VBWA 3P7NA 3FM3A 2Y48A 1R23A 3L09A 1J75A 3KP7A 3HOTA 4KUMA 3DFGA 3GFLA 4XSXF 4KT5C 4LLGF 1F9NA 2CYYA 1OMIA 1TW2A 1FNNA 1MGTA 1T6SA 4UVAA 1R36A 2ZBCA 2DT5A 1CGPA 2P6TA 3DF8A 4BAYA 1QNTA 4KMUX 2YPRA 1IN7A 4MTEA 3I54A 3TGNA 2CFXA 2FOKA 2W25A 4I7HA 1MD0A 4AVPA 3RKXA 1XMKA 5ICFA 1IRGA 2M5WA 1YS7A 1TLHB 4G7HF 2EA2A 5E1ZB 4KFCA 2PG4A 1XGSA 4A5MA 5ICGA 3IWZA 1YW8A 1WWXA 4IHTA 4I01A 3QRFF 3WU1B 1MDMA 3FMRA 1QO0D 3FX3A 1R22A 1MJBA 2XAJA 4U0VA 3TO9A 2Z9OA 2OZUA 1VTNC 3LQQA 3TOAA 5D5WB 1G3WA 3N4MA 3WE2A 2QBYA 4ENNA 3D0SA 1C0WA 2DK5A 4M6YA 4ENJA 1YO5C 3FXRA 2X0LA 4M73A 1IXCA 4YFKF 1Z6TA 1ODDA 2L4MA 4RAZA 3COAC 4CDGA 4MEXF 2FE3A 3GYHX 4R79A 1CF7A 2K4JA 2VC1A 4EMSA 2W57A 2GZWA 1ZG1A 4RGRA 1HW2A 2KJCA 2P8TA 4JBAA 1XN7A 2K4BA 2PI0A 2R3SA 3F22A 5HOOA 3M7GA 2VONA 4OIPF 5DCMA 3ZN1A 4FT8A 1DP7P 3PFIA 5E20A 2FBIA 2LDUA 2VN2A 3DV8A 4IRIA 5L3CA 4HOBA 2F5FA 1P4WA 4Q47A 3KFWX 2FRHA 2G7HA 1SAXA 1SD6A 3WTWC 5IT9K 2HYGD 1MKMA 4M71A 5A2QZ 3DQVC 1YQAA 4WCGA 4HDVA 5CJ9A 5HLIA 3E3VA 3JAMK 1XD7A 1EH7A 1B4AA 1WKMA 1BIBA 4KIFA 5K1YA 1JE8A 4IVNA 1FY7A 2XASA 3F8MA 4ZYDA 3GFMA 2A07F 2STWA 1HKSA 2QBYB 4GO1A 4BYYA 1O7LA 2OAZA 3E5UA 3HRSA 2XUBA 1T0FA 4UVBA 2NNNA 2IVMA 3G3ZA 2QZ8A 3J81Z 2GIVA 3Q5FA 4ON0A 4RGSA 2C6YA 4UXNA 4KNYA 3GLXA 3C18A 2KRFA 3C7JA 4KIGA 3MZHA 1FBQA 5HS7A 3IRRA 4Q4ZF 3C3WA 1FP2A 1QQIA 3PQJA 3ZP5A 5DD8A
chains in the Genus database with same CATH superfamily
2R8GA 1S4EA 3A3PB 3REOA 2X1EA 4CICA 1NAQA 1R8BA 2XAQA 4LF4F 1NSQA 5IC4B 5IZHA 4I2QB 1XQIA 2GGPA 3RR7A 1P2FA 3EGZA 2DO7A 4Y2KA 1K7AA 5IYBJ 4UY85 1Z1ZA 3LO3A 1P92A 1SI9A 1BM9A 2X1DA 3LSRA 2GMHA 4LFCF 1MH3A 4EMDA 2Z4PA 4V19J 3MTKA 5E7OB 1PJ6A 1U02A 2WC2A 1RWMB 3GZ7A 1IUYA 2FNAA 2ZVIA 4ZPBA 5I3UA 3TAMB 2GXGA 5HQ8A 4KO0A 2G9WA 2LR8A 1NTCA 4XLAA 3UCUP 3OSFA 4G7OF 3QWLA 4ECSA 4WFZA 3K6GA 3RPQA 1RKJA 4F4ZA 1U6BA 1U8SA 2GO8A 1DPUA 1KLMA 2FVPA 1O3RA 1HF0A 1NKCA 1FP1D 2FXAA 4Q44A 3LALA 1OFCX 1AFIA 5FRMA 2CDQA 1FVQA 3R9LA 2DW4A 2VC0A 4B3TF 2Y9HA 5K5OA 2DLLA 1A36A 4B47A 3J7AY 3TMOA 3IP4B 5LHHA 3OTDA 1QTMA 1SJ1A 5EEHA 2MSSA 4J9NA 3CMAS 2GAGC 3A13A 2W24A 1V3RA 2IBOA 5DJBA 3MEXA 1P6TA 2EKYA 4OYZA 1BR4A 2KHCA 3M8JA 5JHUA 2DA6A 4CDIA 4NYZA 3R5JB 3DP7A 3GLJA 4E7IA 5A2QU 3I4NJ 2VASA 4Z7YA 3V81B 1ITYA 4NZ0A 5ETRA 1RR7A 1S6LA 3LH2S 4PR6A 3QU3A 1NCLA 2B63J 1U9NA 3NS7B 4G1QA 2ZBRA 4TLRA 5B3SH 1V4RA 1T9TA 3ZTSA 5E41A 2BE5F 3M3YJ 2CDRB 5F8JA 4TYAA 1VYAA 1ZM3A 2B6AA 5KTQA 2ELHA 1RGVA 2KFNA 4DQSA 2Y1LB 1TL5A 4LF4J 1SIWB 1HW1A 2KJVA 3TP2A 2ZKTA 2DVIA 4BXUA 3H90A 2EJRA 3DTEA 3UWTA 2FD2A 2XS5A 2K06A 4EZ6A 3B73A 1R5ID 2HGCA 1G3YA 4KYZA 4OV6A 4IFVA 2KQRA 2Q1ZB 1UWAA 1J5OA 4LFCJ 4R0JA 4L9NA 3CIMA 2IY5B 5G4DA 3DDNA 1RUNA 3HZEA 3CJKA 1X4DA 3J80Z 5K5MA 2JFKA 4RBTA 2Y69H 2A18A 2GIFA 4RNMA 3IWXA 2XC9A 2LYCA 3LSKA 1CJVA 3K58A 2A6HF 2BMBA 1N5YB 1P1LA 1RNLA 2KM8B 1IN0A 1HYSB 3HM9A 3SDGA 3AFHA 1SFKA 1S7HA 1Z91A 2KJWA 1S72I 2XI3A 3E3XA 2YSRA 3V7CA 2CADA 4JP0A 3NS5A 2BOPA 3CC7S 2AZ1A 5IYDJ 4B3TJ 3HJVA 1FTZA 1XBWA 5CYQB 5F0UA 1JGSA 2AYBA 3F8NA 1FDAA 5C5JA 2DA3A 3K2YA 1XTAA 2PMHA 3ADAC 1S48A 1SUQA 4CO8A 1C4AA 3FCHA 1VJQA 4RAFA 1X0FA 2A68F 2D3UA 2FJ1A 3GF2A 1PC5A 3CUQA 5DUKA 4XQFA 3CB4A 3FCWA 1H2TZ 1KQ0A 2QX0A 1YG2A 2B51A 3I0TA 7FDRA 1RWUA 3H20A 2P5VA 2XROA 2ZH4A 2I10A 1YKWA 2P7CB 2V8HA 2KT2A 4OX9F 3V4IA 2GQQA 3SFZA 4J90A 1W7PB 3H3VK 1KDNA 3LL7A 3D1QA 2K40A 1I3OB 2OD4A 1D1AA 2CFOA 2C3UA 3C2PA 3NAHA 4GYGA 3SIPB 2HHQA 2HWHA 3GVAA 1D09B 3JS9A 1YYVA 1A35A 5IT9Y 2RV8A 3LSTA 1REVA 3I58A 2DEIA 3OMYA 1B0TA 1X58A 3A0BC 2CJKA 2V8GA 3WU2C 2BY2A 4UUXA 3KK2A 3VAKA 5B5EC 2DNRA 3CCVS 1MSEC 3JAMY 2VLAA 2LXIA 1A04A 4KICA 5HJYA 1QVTA 3BS9A 5KFLA 5A8RB 3FCVA 1M1KT 3DBRB 4WP3A 3TARA 3L2CA 2ROGA 4A3BJ 2ZSIB 3TVZA 2M7SA 3D6FB 4J9UE 4KGMA 4KAIA 4A3FJ 2XBPA 3GV5B 3BBFA 3MECB 4P9SA 1FF2A 5T14A 1FZPB 2VQLA 3I0SB 3RSNA 4DN9A 2ASYA 1FD2A 1N33F 2OELA 2E35A 4ETSA 1A0OB 3POTA 4XBFA 1JB0C 3F6OA 3ECHA 1X5SA 3MMAA 2J9DE 1JUSA 3O2PE 2HQGA 5EEGA 3SV3A 4F92B 2QSFX 4XLPF 4WXDA 4FX4A 2OUGA 5L1LA 3O8HA 5ETLA 4NCAA 2X6WA 3BLYA 2HBYB 5L39A 1FRJA 1WJFA 3RYLA 1ETXA 1FDBA 1HL6A 3AHPA 2VG6B 2FHJD 3HSEA 2R5ZB 1R71A 3N9UC 2LLZA 2ZOMA 4D1QA 2BXYA 1RT1B 4GVBB 4DV0F 4C7QA 3GWCA 2LY9A 5GADU 4EJTA 2B43A 2V8PA 4DR2F 3QATA 2MW8A 5GMDA 2OSQA 4NLDA 2OIHA 4OOIA 3HHEA 5D15A 4OX9J 4I02A 1ZAVA 1FWKA 1TL4A 4UQGA 3OJSA 3CJQA 4CNYA 3S2DJ 2P9CA 5IC6B 2U1AA 4C8OA 5KFEA 1RI7A 1LPQA 2AYMA 3T0YA 3C6TB 2GMJA 3OR2B 3OUYA 1H7XA 2RNEA 4KV8B 3OIOA 2Y0MA 3V6JA 1JUMA 4C3HJ 4PJ0C 2L5QA 4FF1A 1VQ8I 4Z2YA 3LSHA 4DYQA 3ENVA 1IXKA 3OWTA 3ERMA 1XMOF 1JJHA 1N5QA 4PG8A 5D4NA 1HI1A 4ZITA 2C2KB 1W0TA 3M2UB 1KSPA 1IN6A 3R8YA 3V6HA 1WI9A 2Q1LA 3CMQA 5K8OA 1RT2B 5GAGU 3BZ6A 2BJ7A 1EETA 1VDHA 2UP1A 3MPWA 3QP6A 2IW5A 5EX0A 4QR0A 4ZTJA 4I2PA 5CVJA 1MZBA 4DIQA 1WKLA 1N33J 3JW4A 1N48A 3DEEA 1FEEA 4HQMA 1PUFB 3N97A 2ZFUA 2RB7A 2QSGX 3KYLA 2OMLA 2B9SA 1Q0NA 4CCHA 1HQ2A 5JHFA 1FTRA 3A1YG 1N5VA 3JRAA 1IRXA 2BOLA 3ASOH 3BG7A 1YLXA 3OT9A 4BHPA 4IOAF 1ELOA 1G6NA 2AQEA 4URQU 1VQ7S 4DR6J 4P96A 1CJTA 4BBSJ 2NUUG 1NHAA 4DV0J 3FRYA 4QWQA 1GMUA 4YR0A 1Q1HA 2XY5A 2BBYA 3EX7B 3IUOA 5GADI 4DR2J 4KT6A 5FFXA 3VYSB 3AD7C 2F48A 2BYVE 2XB2D 4WIIA 5KG5A 2DMQA 4JI0F 2PT0A 4DL4A 4PGGA 2DH9A 1MBEA 4HLYA 2BANB 2IC3A 5ILUA 4E4HA 2HYIB 1J2XA 1N75A 2QA4G 1PJ5A 2IRUA 2TRTA 3W1YC 1J7KA 3GONA 1M5HA 2OTJI 3CCJS 4DL5A 4ZVUB 1CF7B 2RHSB 8RUCA 4PZJA 4OWRB 4XLNF 4X4NA 1LWCB 1K44A 2IVYA 4XIUA 1M90T 4A8MP 3OFGA 1W5SA 4HHUA 1JXVA 3FSXA 1XMOJ 3UN3A 5FGMA 4J37A 1JJ6C 1TMMA 3OPKA 5DUIA 3M8SA 2HOSA 1S1XB 4GRIA 3M6XA 1CJUA 3NBPA 2AIRB 3R7BB 3T5HA 3OJUA 4RNFA 4CYCB 5DCMB 3G4SI 2LU1A 2EIMH 3S15J 5GAGI 4DF4A 1QVUA 3GYGA 2ZOGA 1VS3A 1YRXA 2RDJA 3GIRA 2VDIA 1RJJA 2OPQA 1HQEB 4H4KA 5H9EK 1UFKA 3OL8A 1V5FA 4NXNJ 1T05B 4ZVGA 3H2VE 1NG6A 2RGVA 1W7WA 2AV5A 2MLXA 4J91A 1NK9A 1JGGA 5I42B 1LFUP 3FK6A 2PA3A 5C4JJ 2CWEA 3C16B 3U2RA 1QBJA 3BF4A 4PSWA 4I2OA 1XSVA 4WJBA 5EGOA 3I71A 3P5BP 4I76A 4ED7A 5ETKA 4RX6A 4DV5F 3SSSA 3T1YF 2QJ3A 1TUVA 4A12A 2JLGA 1VQ6S 1T38A 4RNNA 4NASA 4IG3A 5IT9U 4DV2J 1QRYA 1SFOJ 4ETXA 1UVIA 2RKIA 4EM2A 1NHUA 2FYXA 1JXSA 4NLWA 1RABB 2I5UA 3JAMU 3OYGA 2HQNA 4JI0J 3HZJA 5H6RA 1U0SA 4CIOA 5DLFA 4YRVA 2H09A 3QPTA 3Q3SA 1ZA1B 1VQKS 1QGPA 1KU2A 5DS9A 3VTIA 5DM7Q 2HVIA 5F0FA 4LSNA 5C2CA 1VRUA 1P4AA 2E1NA 3I5BA 4F0KA 4IUFA 3RCOA 5TRDA 5GPCA 2V68A 1FJGJ 1C0TA 5E3LA 1WOOA 3LW5C 3HL2A 2PIIA 4CHUA 1YG0A 3BR9A 3HRMA 2RIJA 3CJRA 3HSZA 3J7AN 4NQWB 2GIRA 4U7CA 1Z3YA 4LRCA 3HBLA 1Y5IB 2OPRA 2DODA 3ZZYA 2EKNA 3WTVC 3ISND 2XSJB 4IKFA 1BQXA 2D3ZA 3GUDA 2RMLA 3DRPB 3SSQA 3RBEA 3P9CA 4PGHA 2H8WA 1RC9A 4D3GA 3ZFVA 4EYHB 1R4NB 2A05A 3QT7A 4EM1A 3L9ZA 1S8NA 4GXOA 5DM6Q 3S3MA 2WONA 1BOAA 1MBJA 3AJ2A 1ZM2A 4A69C 1N8RT 2UXDF 3QLHB 2VG5B 3MOZA 4OZ2A 3DLGB 4MHGA 3KJNB 2XEXA 5AIQA 2AKWB 4CLPA 2E5LF 3WGIA 2GWRA 6FDRA 4ZK7M 3J7AO 1WNEA 1S1TA 4TU7A 3K0LA 3GTQJ 3H98A 1D9FA 3NWRA 4DV5J 3T1YJ 4RM3A 2KXHA 4G7ZF 3K4LA 3WHIA 1U0JA 2BJDA 1LW2A 2KYXA 3RTRA 2O1PA 1FRIA 3BSOA 3A8EA 3EWGA 1PYTA 4MQVA 4LF8F 1NMEB 1HWUA 3FHNA 1B72B 5HBMB 4HBLA 2R7TA 5KFMA 1BIAA 2TCTA 3GJQB 5KFTA 4HV5A 2XMMA 4CCMA 3AJDA 1JLCB 5LOQA 3OYLA 2MLYA 1RA6A 1WTBA 4DR1F 3ABLH 3WHBA 4ZS6A 4M3FA 4YB5A 2F7VA 4BGDA 1UZHA 3I0RB 4B02A 1LFWA 1RDRA 3L7PA 2E5JA 3PJXA 5HLHA 2KLOA 2D9OA 3MR7A 1ZGJA 2BZ2A 3S1QJ 2JRTA 2Y8WA 4FBTA 1S0MA 1HW5A 5KT4A 1H0HB 4NC7A 1MU2B 3LA7A 2MABA 4OINF 2DITA 3FWEA 3WTUC 3NP5A 2JFDA 4ESBA 2P2CB 2GXBA 3CIZA 3MM5A 2HHPA 2IA6A 4QYZJ 4X4QA 4LG0B 4N77A 3W7BA 2LDYA 5HP1B 4DXLA 3CSKA 2WV1A 1D0EA 1RT4A 1K78B 4DQ2A 2M30A 1WG5A 2ZHAA 5FFZA 1JLFA 3EYIA 3AODA 2Q8KA 2XKPA 3ZGKA 3FFIB 2B3TB 3CD5A 2A6OA 4MEYF 2PGCA 2XZWA 4B9UA 2ZJQF 4RW6A 2JK3A 1YJUA 2W4DA 4O44B 4R1HA 4M3DA 2UXDJ 2X85A 3UNYA 5IXUA 3KNGA 2V4JC 3CDBA 5DYMA 2ZZMA 4F0HA 2XWYA 2QA4S 2E5LJ 3RBXA 2ZNYA 2HFUA 4Y4RA 5CLSA 2BJ8A 2IM2A 3D3BJ 1MWZA 1POGA 4F4AA 1J5EF 4EV0A 3BGFA 1K83J 1VC0A 2LXUA 1HW8A 2YKMA 1HPZA 1WJ9A 4A4JA 3OVBA 2W82A 1V3FA 5KOXA 4IO9F 3HTUA 4P7VA 4R8UB 3K57A 2J5AA 1VHIA 2DRAA 2DCLA 3TEHB 3MMJA 5BMZA 4IHWA 3SFUA 5LLQA 1RWNB 2XS2A 3G1LA 1OPIA 3I56S 1V5GA 5L38A 4E2FB 4DR1J 1O3TA 1K0TA 3CGIA 2L54A 2CMPA 3TAPA 1OIAA 3HRTA 1K1QA 5M5YJ 1YITI 4YOEA 1TKTA 2WTFA 2IJLA 2MXYA 1NJXA 4QU7A 5J2MB 5ETTA 1IKVA 2KHMA 4EU0A 2R3VA 4O3QA 2KRRA 1W36C 4RR5A 5LEKA 2R7QA 4D3HA 5FJ4A 3SYTA 2FQ3A 4A8YA 1XNRF 1IXRC 5EJCA 1HBNB 4LMYA 1N0VC 2LREA 5D6FA 4PUOA 2FC8A 3HPOA 4IRGA 3R61A 3C6UB 3Q9VA 1YRNA 1TL7B 3I31A 2JEFA 3MFKA 1FDDA 5A6PA 2X48A 1SVOA 4WX9A 1E6VB 4HG2A 4L3KA 3CC2S 3QAEA 3LGNA 3QOPA 2N4DA 3TUIC 4PYAA 3F3XA 1YJWI 2G7UA 2ZJRQ 3I3LA 4MIAA 1ZOTA 3Q8YA 4FKXA 3CCUS 1EKSA 2V6CA 2XZTB 3TZXA 2VHGA 2LNBA 1VZ0A 2FLOA 2LEAA 2BQ3A 2X6OA 1D3WA 3IV5A 3V5RA 4KYWA 2ZH6A 1T56A 2VPYB 4IQXA 4Y52J 1G4DA 2KZMA 4QOTA 1R7JA 1J5EJ 3QPLA 4K2EA 4O4RA 2J6SA 1UVMA 5F8GA 3TQNA 2PFBA 2EPFA 3PIOF 1QUPA 1RUOA 5E2QA 3DLJA 1F2HA 2OU2A 3VALA 3DXSX 3CDIA 4EK2A 4USIA 2M8HA 3HI9A 4EM0B 4J7CA 2J0QD 2RDIA 2Q2EB 1KN6A 2E36A 2LC2A 3SDEB 5BJRA 1S0VA 1BR2A 1IV6A 1YX5A 3WTZA 3IWNC 4GRSA 1S6UA 4OZ5A 2GAHC 4QSHA 1TTYA 3ENWA 1PGZA 5KFYA 1K0VA 3H4BA 3GZNB 3V4GA 5IPAA 5LM7E 4AIJA 4LVNP 2CQCA 2W8LA 2ZEJA 4O0NA 3D54A 2I9SA 1BGXT 1G6BA 3V2UC 1B64A 3BKFA 2PJPA 3MCZA 3EYYA 2P81A 3THTA 5CYVA 2C2EA 1D8YA 1ZELA 2HTJA 1E2XA 3EUAA 4DQQA 1FMVA 1DBDA 4F8RA 4GMKA 2HK3A 1XNRJ 3C8YA 1VQ5S 2EC2A 3KCCA 2DCEA 4LRDA 4TLQA 3FKBA 4FX0A 2DR8A 1Z77A 2M2BA 3PEJA 4L74A 2DR9A 1WHWA 1TFWA 1HNZF 5FKKA 3E6BA 2DJWA 2ZXIA 2PDAA 3J7ZI 3MMCB 2KXNB 3HJEA 4KB7A 2KKHA 1O5JA 2KZVA 5K14B 2CQ4A 2HFHA 2K7JA 3MWMA 3CLOA 1ACIA 4YELA 1VCTA 1U24A 1LFPA 4JV2A 2W1BA 4F52A 5EG0A 2NQPA 3BQ2A 2MFZA 1FSHA 5LFAA 2X51A 4JX5A 1WC5A 1T9XA 5F8NA 5E3MA 4WXCA 3GXOA 3C1DA 2J7UA 2RQ4A 3CD7A 3HFZB 4RWXA 3W9JA 2KKOA 3Q89A 4XK4A 5D8LB 3NMRA 4U9RA 2V79A 2V9KA 2BACA 3S17J 4Y7NJ 2HVRA 1N5YA 1FKPB 4FYDA 4UOFA 2BBEA 4OU0A 1FXRA 1KGSA 3R7SB 2HXIA 4QIVA 1HYSA 3ZZOA 3CCTA 2VI6A 4IFYB 2R7DA 4W1UA 3BBBA 2ELKA 3GBGA 3G6YA 2EFWA 4NCGB 1SAUA 4G9YA 5CYQA 1W4MA 2HRUA 1CG2A 1KOHA 2C2RA 4DS5A 2K9QA 4LK1F 2GA7A 1X1BA 1V3SA 2AX1A 4BS2A 3K89A 4A47A 2CSOA 3DPLC 3CCMS 2Y31A 4FQGA 3MM7A 4II2A 3RAQA 2O61A 3VVTA 2N4CA 2Z8QA 2M3DA 1BWVA 1RT3B 2Z3YA 1OYYA 3GTYX 3PW0A 4ZJLA 1X3WB 2YTCA 1MBFA 1SCJB 4RW8B 5JFRA 3RB3A 3K1NA 4LF6F 1W7PA 4HNTA 1LEBA 2GO9A 2HVSA 2NOGA 3MM9B 2Y2ZA 4MLOA 4L6V3 4MKBA 4WPAA 3SFGA 4PFOA 3HHGA 2WB4A 3BBCA 2FY1A 1HNZJ 1V6HA 5KHDA 3J7YU 2VBXA 2H5IB 2CW8A 5CAAA 4ES1A 5C25B 4KH0B 5TGTA 1UA1A 3KK1B 1HKAA 2IPOB 4WWCA 2IT0A 2FSWA 1ZETA 1SKRA 1S6OA 2DNQA 4EEYA 5A8RA 2MZJA 4M5HA 4KHRA 2Q0OA 2NUHA 5ILSA 3QFHA 1KQGB 1TUGB 4EBDA 2MQLA 3T41A 2CJXB 4DWIA 1BI0A 5LT5A 4Y17A 3DYAB 2K3PA 2B4VA 1VBYA 1IRZA 4L3NA 1MMAA 3FQKA 4JUZA 3MMBB 4FXDA 1CEZA 1ORKA 3H9JA 3BGUA 3MECA 4OIXA 4XLHA 1OCCH 3CF5F 1RR8C 3O3LA 3HHLC 1E6YB 3I0SA 4GC6A 4OV1A 3NAUA 1C1BB 3G6VA 3AB4B 2GJFA 5T7LB 2Y0SA 2A6EF 1D5YA 2JLEA 2ZZTA 2FZGB 4V1Ak 1DJ0A 1CS4B 4N8OA 3PO2J 2HFSA 4UNOA 1QA6A 3EUNA 2HVQA 2W4CA 3HF5A 3U02A 3G86A 1F36A 3BG9A 4NYOA 1JKPC 4ED6A 5J8CA 4CZZA 1FO1A 1BQNA 2V9PA 1RTIB 2QKLB 3MTJA 4BNCA 4LLLA 3GIJA 2VG6A 2R5ZA 2IVFB 3PO5A 2CO5A 4E7HA 1RT1A 4UTGA 4GVBA 3M9MB 1FE4A 3HFKA 1YW7A 3JTPA 3NEUA 2N82B 4R0EA 3BR3A 2XPVA 1LOUA 2E29A 5HVFA 3DKWA 1UFLA 1R0CB 3DDKA 4MKAA 1IWAA 4U95A 3BSAA 4USVA 2DMPA 4M5DB 5FDLB 3CXCR 2L9RA 4LF6J 3OS1A 3IKTA 2E1MB 4OHXA 1IBMF 4XTTA 2GW8A 3KYCB 2V4JA 3CWJA 2E2JJ 4BC7A 5DCFA 1CJKB 1SD4A 3J7YI 4IL6C 1QM9A 2HOEA 2OC6A 5E3AA 4DQRA 3C6TA 4AFFA 4AT1B 3Q0WA 4ENOA 1OSDA 2YQ3A 3OR2A 2B9EA 4B4CA 5F3TA 4UY8I 2BUNA 4KV8A 1QHGA 5L46A 1RCOB 4ELUA 3T1HF 1S0OA 1X0PA 1GMVA 3CCLI 4ECZA 3U7JA 1PJ7A 2FVRA 4A3JJ 3TW0A 1F6TA 2F4VF 3X1LB 3DFGA 1BY9A 4WTOB 3HZGA 4DFJA 2UV8G 1ZBTA 2NVYJ 1F9NA 2ZC3A 3M2UA 3EXCX 1NJWA 2XGEA 1OYEA 2PI4A 3G2XA 3NGKA 2HNDB 3N6NA 5HK4A 3DGPB 3ILIA 3CO9A 5EEAA 1A9NB 4UVAA 3TW7A 1E3PA 1RT2A 1R36A 1X19A 2DT5A 1W2BR 4BAYA 4KMUX 1SC7A 5KG1A 3I54A 2WB1A 4PQAA 3LOUA 2ICWG 2W25A 4AXJA 4BJTA 3KG4A 4AVPA 2Y1RI 4TU8A 3PHTA 1PUFA 4G7HF 2CQXA 2G1HA 3HK2A 3SSRA 5E1ZB 4I7FB 4QZVB 1XGSA 4A5MA 5ICGA 4DG1B 4O0IA 2DXFA 4QJVA 3QJPA 4I01A 3FBIB 3BZCA 4AYBA 4ZA1A 1YJTA 3OVAA 2JN6A 1S5ZA 3QRFF 3IS9B 2EZIA 2IGOA 2FLNA 1BA5A 3FMRA 2EFVA 3D2WA 3FX3A 4G65A 2XAJA 5BYQA 1HLVA 4AXIA 2C1EB 1X1AA 4X4VA 1VTNC 3A4CA 3G8SA 2MSYA 3N4MA 4ZP9A 2P9GA 3EM1A 2HQCA 2QBYA 1CPZA 4ENNA 3EXYA 3HD1A 1TL8A 3GTJJ 4DL3A 2XS7A 2FC9A 5HO4A 3KLFA 2KYZA 3Q22A 4F0MA 3UD5A 3FXRA 4XR6A 4ATNA 3W65A 2BANA 4QR2A 4KHPF 4YFKF 4HLBA 1IBMJ 4LIVA 2UVVA 4O3OA 2L0KA 2MZ1A 2L4MA 2HQAA 3COAC 3KDOA 3H5UA 4EO6A 4R79A 3LGHA 1CF7A 3PR4A 1U1NA 4NLGA 3NL0A 1WH5A 1LWCA 1NSAA 1F5CA 4URSA 1ZG1A 3BEGB 3R2CJ 4RGRA 3T1HJ 5DO2A 4KTQA 3CCSI 2X9DA 1HW2A 1R8PA 2GC8A 2K4BA 2HQ3A 2PI0A 2R3SA 1IUJA 2F4VJ 4MIMA 5HOOA 1IJEB 1IM4A 3K4KA 1M1GA 2CPJA 1EJ9A 4C8NA 3S1MJ 2Z1DA 2WRMA 2VONA 2MSTA 5D0EA 3DU5A 5DCMA 4ZDLA 3CCRI 3ICLA 2LDUA 2VN2A 4UW2A 1Z4UA 2DGQA 4WIQA 3QSIA 2OD6A 2E5ZA 2DNZA 4ZVOB 2FRHA 3DOMB 2W2MP 4C6AA 1SD6A 3K4CA 2K3KA 3K5MA 1F3FA 1IBLF 2HYGD 3D6MB 4JI7F 2L2OA 4M71A 2EK1A 5A2QZ 4WCGA 2CQ3A 1QLNA 1Y5NB 5I42A 5CJ9A 2LBFB 5JVGQ 3C16A 1B70B 4XO0A 1SB6A 4KIFA 3KHGA 3CDUA 5K1YA 2AJ4A 2GMLA 3MFHA 3CJSA 3MPDA 2XGQA 4ZYDA 3F56A 4KITB 2A07F 2OUMA 1VFJA 2IDLA 2COBA 2STWA 2Y1JA 3E51A 3NS6A 1HKSA 1OY6A 3NNAA 4DYRA 2AU0A 3BV8A 4JOMA 2EI5A 1P9YA 4NLQA 1EB0A 2DRBA 2FHMA 3GYXB 4XNFA 4HT7A 4ECUA 2YWEA 5GMKa 3G3ZA 5EHHA 3H5AA 2GIVA 3Q8UA 2QN6B 3SQGB 2VIXA 2XULA 4CLTA 3C18A 2DHAA 1SV5B 1RWXB 2R93J 4OYIA 4C8MA 4JI8F 4KIGA 1FBQA 4KHPJ 2MZRA 1XJWB 4Q4ZF 4DBRA 3FQLA 3C3WA 4TXSA 4DSJA 1FP2A 2DN0A 4DPYA 5DD8A 1VQ9I 3HOVJ 2XLIA 1X60A 3FSIA 1NK0A 3SJMA 4K4ZA 4EJVA 2E1AA 3HEFA 5JLWA 1LXJA 4ILLA 1GQEA 2RQQA 5A8WB 2J6UA 3GZ6A 5CXTA 3FGVA 4GVLA 1IR1A 2W7AA 4LR7A 4NQWA 4YHHF 3K59A 5KFKA 4BC9A 1UAWA 3I9V2 1S97A 3LQRA 2V63A 1RISA 4M5MA 4EFAC 1KTVA 3IR6B 5B0FA 1M5SA 1Z7UA 2XSJA 2GLOA 3RRKA 3DRPA 3QIDA 1FEXA 1FBSA 1I5OB 4LJZF 2AHQA 2MZQA 1DZ5A 1NH3A 1S5LC 4PJLA 2DYSH 3QRQA 1TQIA 3LA2A 4UZBA 2CW0F 2AJQA 2HBQB 1WWHA 3T1AA 2OLWA 5AJ3F 1LNQA 2WV0A 2BY1A 3V4MA 2WOMB 1IBLJ 2DNHA 2HHSA 3L2UA 4JI7J 2R0QC 1GV2A 1FNOA 1Q8KA 2JZYA 3QLHA 4HYKA 2W2OP 2VG5A 3U1LA 1ZAOA 2N3OA 3LNQA 1L3KA 2L9SA 1BI1A 3QYFA 1IW7F 2BW7A 1SVLA 4ENKA 1PVEA 3DRXA 4IR1A 1HSJA 2KTQA 2OFGX 2UUWA 1NDPA 1YJNS 3RYRA 4W4MA 1VGYA 4ZLNA 5FROA 3MM6B 2EIKH 2HQIA 5KFSA 1IAWA 4HNVA 2EIJH 4TNOA 2V4RA 1HD1A 4BJ5C 1HMVB 3IXQA 1TW3A 1RLDA 3G6ES 2YWHA 2Y8YA 5HBMA 2JSCA 3FBCA 1FJCA 4TKTA 5FO5A 2J9CA 2LKZA 1F2GA 4DZDA 1JLCA 2Y0SN 2L9DA 1DU6A 5DDGA 2W84A 4JI8J 4YG2F 3EPGA 1Y1VJ 1RHKB 2MEWA 4CCNA 3K5OA 3I0RA 2HYFA 4ILMA 1LEAA 2EB7A 4CLWA 2N7YA 5D8KB 3QYBA 2DPIA 1Q86T 2ID6A 1NK3P 1P27B 4U88A 5FLXK 3I59B 3QRPA 2HFVA 1XGOA 3BN7A 1MU2A 1RSCA 1B4SA 3JSBA 5A76A 4MYUA 1WQ2A 5HODA 1JNZB 2WVBA 4DV3F 5E3PA 3OXLA 1NK2P 4YHHJ 5K20B 5CYMB 4ABZA 1K6OA 4LG0A 2AWZA 4OHVA 1Z67A 5HP1A 2ZNZA 3EDRB 3GCWP 4UV9A 2BVLA 3R5GA 2Y1IA 4B3OB 1OSCA 3EZOA 1JKOC 1IVZA 1XDUA 2OPSB 3FM5A 4Y3CA 4Y2IA 4DX8H 1K78A 5HDNA 1SQGA 3Q8VA 4ERDA 4FCYA 4JX6A 3S6EA 2DIUA 2RH3A 1XB4A 2HS3A 3RR8A 2AW0A 1RPWA 4B43A 3FFIA 4PCQA 2EEYA 2HTSA 3CJ3A 1SD7A 3JYTB 5L3GA 3F23A 1DP3A 4O44A 4RAYA 1VOMA 3RYPA 4OI4A 2ESHA 3DKDA 2OTLI 1LWFA 3THPA 3P9IA 3FEZA 2HI3A 3FXKA 2ACMA 2R8IA 1GXTA 4ZJZA 3W2AA 3R97A 2BR0A 2ZMEB 2L41A 3RZAA 2DNNA 3IC7A 4IOCQ 3U1KA 3HPGA 1ZM4A 3PZPA 2NS8A 5DEQA 4ZKAA 4FVMA 3M8QB 1R31A 4RM2A 4TYBA 4L9TA 2QEXI 2VXZA 4K7QA 3GIIA 3DLBA 1X4BA 4P7TA 3W60A 2IS2A 1WELA 2M7AA 2E9RX 4R8UA 4ZYHA 3HYIA 2WB1N 3OR1C 4IOCF 4U0WA 2A10A 2FZKB 1TQPA 2WW4A 1XCBA 3CD6I 2EFGA 1VQLS 3KETA 2OEMA 3OYJA 4ETZA 3OL9A 3DLHA 1G4CA 3K4JA 2ALYB 1ZRFA 1WCMJ 1GK8A 4I0BA 3BPDA 4RW9B 8AT1B 1H8AC 3S32A 4AM3A 3E01B 1RE1B 5GTHC 2ESNA 2KFYA 4I1TA 4BE2A 4K2JA 2L4AA 4XSZF 1VLOA 1P9QC 2XMJA 1AWCA 5J2MA 3CMAI 1J2VA 1VR6A 4AYBN 2COLA 3TEGA 1YJ9I 2GOXB 2HS4A 5IY5H 2K85A 3MZ8A 3NRVA 3BDDA 5HLFB 1XC5A 3KHHA 4IYQA 2XLKA 2H1YA 2P7VB 5C44J 2ZHBA 3CMES 4DV3J 2CQGA 3IC1A 1HBNA 4NLRA 1U26A 5KFHA 3PY8A 4Q2LA 2EFOA 1X9MA 3C6UA 4XM3A 1TL7A 3JRGA 4ZPAA 4J9QA 3LA3A 3FMSA 5IP7J 1O4XA 2DYAA 2JA8J 3ZNJ1 3TOBA 1RACB 3QPIA 1JT6A 3G87A 4BCAA 2GIQA 4J9RA 1BJAA 4JV0A 2ZZNA 1GAOA 1XN9A 5HSPA 3J81Y 2K27A 3OVSA 4D7MA 3QP5A 5A6WA 2XKOA 1NSPA 1ZLKA 4U7UK 1ZG5A 3OOPA 3NOGA 4NLOA 1WKKA 4NOHA 5BXIA 3H9GA 5FLVA 1X5PA 3E0JB 3X2QH 1SUQB 2CG8A 4RB2C 1S7EA 1T3NA 3BR8A 4QYZK 4ZOSA 4OI2A 5KFBA 2DRDA 3BGRA 3ZZ0A 2FJBB 3P6YC 4ZCIA 5KG0A 3VDXA 4XLEA 1WJDA 2CQ0A 1WHYA 2MKIA 4K4WA 1S1VB 1ICEB 4L0ZB 3IRQA 1D0ZA 2A6TA 2HWTA 4BHCA 2I0XA 2JNJA 3QZ8A 4ZYGA 1H9TA 3U1NA 4N76A 1RETA 1S7IA 1IDYA 1GXLA 3A3OB 3HKZD 2OQRA 2DFIA 4D5CA 1KTQA 2Q2EA 2BVZA 2FHKA 5HNFA 1SMTA 3Q2SC 2EG1A 2FJXA 4N8NA 2VPLA 4GDFA 2AD9A 1REVB 2WZ1A 3PKMA 1XSXA 1N56A 1WC3A 2CJBA 3HX9A 4KDPA 3PYFA 2MYFA 2P5KA 3DPTA 1D1BA 1EKEA 2EK5A 5ICEA 1UVNA 4IRHA 4PXCA 3U1MA 1JJ2R 2E9ZA 4EJWA 2XHKA 1O6XA 3GV7B 1FOYA 2M4KA 3MZYA 3UCGA 3E2EA 4UF4A 2GNKA 2FNPA 2YNFB 4NBQA 3VOEA 4ZIVA 4OFZA 4HH1A 3UDVA 2LEBA 4RUAA 2IFXA 3GJTB 3I4HX 3QT5A 1CLFA 5K5QA 3JCUC 5LRRA 3M6VA 2KDZA 2MZTA 1QHHD 2J0XA 2BM1A 3KUHA 3CD0A 1N32F 1I27A 1MN7A 3AD8C 2M88A 3CDHA 5CYJA 2ZITA 3MMCA 3CCVI 2DMNA 3GWZA 1AHDP 4PFPA 5K14A 2VDHA 5IT9Z 3B4MA 3TKYA 3POTB 1T08B 4KQZA 1T98A 5DG8A 1NH8A 3ML6A 3S1NJ 1S1UB 2ME6A 3MMAB 5KOWA 4AIKA 1LEOA 2EV0A 3KPHA 1HOMA 3JAMZ 3A8IA 2FBKA 2HKEA 2VFVA 2NRAC 5B0GA 5GAEU 2KG1A 1V5VA 3BDEA 2A3SA 2A3JA 2WSCC 5H9FK 2AXTC 3B02A 5F1JA 1RYRA 4DQIA 3IN5A 1OQ3A 1G1XA 2F4OB 3VCDA 5LJ3Y 4USWA 5FLXY 4K5SA 1HNVB 1UJ8A 3K69A 2WAQD 4KISA 4DL7A 1W5TA 4F93B 1FKPA 1RZMA 2YWWA 2JUCA 4EBEA 1RA7A 2HKXA 3QWUA 3TUZC 3W6VA 1QVGR 1I51B 4IFYA 2RSQA 4Y00A 3W9IA 3BG3A 4A3GJ 2ZWPA 4QBUA 3T1BA 1SQFA 3CJQB 4EI2A 1U9OA 3OYDA 4X65F 4XLCA 4ZYEA 5IOLA 3FK4A 2W00A 4B09A 4NCGA 1W7PD 2VZ9A 4IEJA 3M6UA 3MD1A 2R2RA 3FXJA 3O2IA 4X66F 3J80Y 2FHJA 2NXEA 1RHUB 2CW7A 2V1NA 3SZTA 3DC2A 2M4MA 3MEEB 4J9PA 3BM7A 3B4DA 2CRGA 1RAHB 4XAKA 3KEYA 1TL1B 4QWCA 2CV1A 4A8FA 3BWGA 1VISA 5B08A 2HHWA 4EWTA 1NK6A 4M9ZA 1CC7A 2HZAA 1V9OA 3TZZA 4IQ4A 5F04A 2ZKZA 2ASLA 5D0HA 4MTPA 2V2KA 3SZPA 1RT3A 2DFFA 3ZRGA 1OJLA 4OJ3A 5HL7Q 1AKHB 4CUGA 4RW8A 3D28A 2A2CA 1S72S 3O6QA 2GHVC 3MM9A 3HB9A 4IDKB 2DNGA 3PHEA 4WWSA 1N32J 2JVHA 2FX0A 1RRJA 1LUJB 4I2PB 3FMQA 2UZKA 4A0YA 3R3TA 3T19A 5C25A 1ZN2A 4WFYA 5HMXA 2V8VA 4HPQA 3NARA 2WBMA 4OI6A 3ZNUA 1FERA 1SKSA 4PK4A 3UKGA 1JIHA 2DTRA 1J09A 3M1EA 5GAHI 3JRFA 4J00A 2Y0SD 3GTMJ 4B9SA 3N28A 3QAUA 2LKXA 1T2KA 5GAEI 2XV4S 2QENA 1A5JA 2JWTA 3JREA 1M5OC 3CTAA 1HQUB 3OD2A 3ZZUA 4CH1A 5JVHQ 2CXEA 1Y11A 1R8HA 3DYAA 3RJPA 4FNIA 4KA4A 1T94A 2YBVA 4BQAA 3MMBA 5JVTA 3F0NA 2CNLB 4GCVA 2KT5A 1C1CB 1ETYA 3C2GA 1V5EA 1E6YA 1KYWA 4C3LA 2E5NA 3CTRA 2RU3A 1C1BA 3OXFA 4DV7F 3H35A 5T7LA 2HLTA 4FF3A 3L2WA 1VQ4I 2IC3B 4X65J 2WSEC 1HBUA 4KMFA 4GO5X 2UXCF 1XS9A 2JZ5A 2X1AA 1V5IB 1N36F 4ZPDA 5B1AH 3A3NB 3A12A 4X66J 2BQRA 2X6XA 2XDVA 1Q8BA 2H4YB 4YMEA 3MUTP 1RTIA 4UHTA 2DO0A 4FBUA 2KIQA 2DGTA 3FXOA 3O6BB 5GADJ 3HSGA 1LE8B 2YS9A 3N01A 2IXSA 1FRLA 4NNJA 3VZIA 2LXFA 1WJ5A 3F41A 1IF1A 3J81U 4K4YA 3WTSC 3I5UA 4M5DA 5FDLA 1PO6A 4AE5A 2YX7A 2LQBA 2J5PA 5E1WA 1B7YB 1VFCA 9ATCB 4WZQA 7AT1B 2XYGB 4RLQA 3Q24A 5THWA 5HS8A 2MKSA 1CJKA 2P4WA 3W6JB 1TWHJ 2MQMA 4C0BA 1HLWA 2WB1D 4QLCU 1GV5A 1T9UA 3P45B 4HQEA 3JSPA 1ZH5A 4I0WA 3MR2A 1TELA 2MJUA 2K3FA 3CE8A 3V6DB 1LDJA 3BG5A 2R7FA 4XDCA 2IA0A 1NZAA 4NLTA 3Q23A 1IWGA 1WHXA 3FZVA 3MEDB 2VF3A 1MIJA 1W36D 4QQBA 3H0DA 2HGNA 3RRHA 4ZZLA 4U87A 2HNDA 2BOAA 5DGBA 2H51B 3DGPA 2QGUA 2CG4A 4KH1B 2IP2A 3OTCA 4UT4A 2FGOA 1TMJA 1W26A 4BLGA 4M9SA 1WHVA 1ULRA 3HSJA 4ZVTB 3LMMA 2A5WA 1RT6B 2JC0A 2ZBPA 4PJJA 1R4MB 3FC9A 2BHYA 1BC6A 5CKTA 4DV7J 2FMLA 3K9TA 4HX4A 2GA1A 3ABKH 3GO5A 3DPUA 4KE5A 1REGX 1ZREA 3ULQB 2RQMA 4CO3A 4I7FA 1T9WA 3C46A 3HJFA 2UXCJ 1SKUB 3L7OA 1VQ8S 4DG1A 1DGRM 1N36J 4HEA2 4L18B 2QQAA 4MQ9F 3CUOA 2V1DA 1GTHA 2DT7B 4DR7F 4O5VA 2ZHOA 5EX3A 1FRMA 3IGVA 1G3SA 1FIAA 4KIBA 5J1PA 2XAFA 1VQ6I 2DXDA 2CPDA 4C3MA 5DZ6A 3GSDA 4WXOA 4F4YA 4RMNA 2DDBA 2RQKA 3F72A 1WJBA 5IM0B 4M5KA 4JK1X 2PN6A 2VJ5A 4M1KA 2JMWA 2C3YA 1FWZA 1OY8A 2BEOA 1SFXA 2OSRA 3BDPA 3OTBA 2CUJA 5C3EJ 1I1GA 2QMWA 2DR7A 5HANA 4YB1P 3OSGA 2DU9A 2GAUA 1S29A 2LF8A 5FLXU 1CQMA 1DQUA 2VT3A 1P6RA 2ME0A 1Q7YT 2HS5A 3QZ7A 2IIHA 1FC3A 3T8RA 2RRNA 1H73A 1WHUA 2QO3A 4IHSA 4R25A 2XNRA 4UUWA 4FDFA 1F43A 2IS6A 2ZJPF 1FOWA 4U0YA 3HSFA 2Y3YA 1S6QB 5DDRC 4YDXA 3IH4A 3KJFB 3MM8B 1TKZB 3PIPF 3KX2A 3W9HA 4JQFA 3HP6A 4CLSA 2VODA 4IH7A 3DOMA 4TY8B 2OTJS 4Y65A 1URRA 2DH8A 1YQHA 2LMDA 4O23A 5CCMA 3WTXC 3ZTQA 3CW2C 4U67Q 1K6YA 2LBFA 3LAJA 3JQMA 1X7VA 3M8YA 2D3OR 1D9DA 4MH8A 5JLXA 1HBOA 4KR0B 4LIUA 4P6QA 3LF0A 3BJAA 4P2XA 3M32A 4P2MA 2B7BB 4DR7J 1OQ6A 1RU2A 1URNA 4YN3B 1DQAA 3W8GA 1H89C 2ERRA 4J9SA 1NEEA 3G4SS 1IJWC 3ZQFA 2MLGA 2O3FA 4S04A 4JYAF 3N6MA 4X4SA 3BGLA 4MFEA 3RG6A 2VJVA 2F4FA 4M5IA 4JI6F 3CPWR 3BR1A 4PXEA 1EQMA 2R7VA 4PZVA 1VNDA 1DDNA 4F50A 3SQGA 1APLC 1SV5A 1YWXA 1YOVB 3PYDA 4AL5A 1AW0A 4OHZA 2OI2A 3SCJE 1HHQA 1FRKA 3JSMB 1XR7A 4GYIA 2LOOA 2MQNA 3R27A 1EF4A 1CVJA 4LF5F 2WBRA 2VIHA 3I6PA 2V2QA 2XRNA 3PNVA 2OV7A 2HVZA 3BZQA 2KJBA 4E7KA 1KP6A 3QGHA 4PEOA 3OHBA 2VOPA 3MKZA 2DNOA 4WYWA 3IBFB 1SJRA 5HATA 5A8WA 1ZR4A 1TK5A 1J59A 1M5PC 2C2DA 2VBYA 1G3OA 3LGMA 3RUBL 1YZ6A 2UZAA 2DT6A 2L7MP 4PAAA 2R7XA 2VOOA 4DEZA 1D8JA 1S49A 1NHVA 2A0FB 1KHWA 2YKMB 1WDDA 1SPBP 4XKCA 3FKIJ 5I3QA 2LLKA 3S2HJ 2OQGA 2HKOA 2H5EA 1HHTP 3I5AA 5J40A 4LF7F 3PX0A 2QL9B 1FOKA 3QYYA 2C2OB 2WOMA 1QY7A 1B6AA 4F91B 4OI3A 1RAOA 3LP1A 1R27B 5B0BA 2MDAA 5HVGA 1HKTA 2AZ3A 2ZJ2A 3H5NA 1QAYA 3PUBA 4DLEA 4LB5A 1PYSB 3D5LA 4G6VB 3TX8A 4BKXA 4GC7A 2GFFA 2IS4A 2AGPA 1LVKA 2NAZA 4CXFA 1M0SA 1ZYRF 4Q8EA 1D5VA 2FJAB 2XIGA 3LAKA 3KOAA 3RIRA 5LMUF 2HIYA 2Z16A 1T33A 3D7SB 1OISA 3TBIA 2BX6A 1FYLA 2A1BA 3V8LA 1YI2I 4JYAJ 1RTJB 3DDIA 4JI2F 3R5DA 1HMVA 4WKYA 2XAHA 4G6DA 3W6KB 1PG5B 3VWSA 3KLHB 5D4SA 3EPZA 1JNRB 5KCMA 5A0YB 2QLWA 4RL1A 4F4KA 3GYNA 4DFMA 4HT5A 4Y15A 1TWGJ 3RW7A 3HHLD 2LTPA 2ID3A 1X3UA 2PMUA 3M4OJ 1W5CC 2XPWA 3CCEI 1JLEB 4B9VA 1FJEB 4BWMA 4A3MJ 1Q7LB 3AJ1A 4LF5J 4MFDA 3MKWB 3IAM2 4BACA 2E1RA 2X1GA 1TTHB 1MJ9A 4QCLA 3M8FA 3GMGA 1WORA 4PDKA 2ALZA 2O8XA 4FXVA 1RHRB 2APOA 3ENAA 3I59A 1AUSL 2RDPA 3G73A 2G13A 1WSUA 4KC5A 2L02A 4F04B 1YIOA 5FKLA 1Z1DA 2UV1A 3RQ4A 5L9XA 4YB6A 3BGOP 3CF2A 4I09A 3Q83A 2CS3A 1D9AA 4LRBA 1AU7A 1UHMA 5CYMA 1FT8A 2Z58B 5CD4A 4BU2A 3WG9A 4A8KA 1U45A 4B3OA 1XMXA 3BJOA 4IJAA 3CC2I 3R0JA 1DAXA 2B56A 2AYGA 4AWXB 1NPPA 3TR5A 2OPSA 4KGXB 4A8XA 5D4RA 3WTYC 3EVWA 3AL0C 5GPAA 4NC6A 1JT0A 3QMQA 2J8AA 2F9DA 5CCLA 4LF7J 5I4MA 4CNZA 3M1VB 4U8VA 2ZXHA 5KT5A 3JYTA 4I6AA 4DPWA 3BQZA 1FA0A 4JI5F 1R3NA 2XQCA 1S1WB 1P4XA 2DNPA 4C4WA 3PW5A 3KZZA 4OAYA 2G2ZA 2XSFA 2ZO4A 3KLNA 3DRSB 2XNQA 3ZQCA 1C0UB 1REPC 2PE8A 3GTKJ 3G71S 3M8PB 3GIMA 2MMYA 3CVKA 5E0OA 4K50A 5FKNA 1LXNA 1BN5A 4WXWA 2ZMEA 2DQLA 3P9KA 2JT1A 3IKVA 3MEGB 1ZK8A 5LMUJ 4XPCA 3M8QA 2VQFF 2H48B 4WZMA 1SKWA 3O44A 1NKEA 1LKXA 4R8HA 2WK4A 4JI2J 1OPCA 3QPHA 1NRKA 3IR7B 2DA2A 1RWOB 2HAFA 2LYVA 5DG9A 2MKCA 2R5YB 1UA0A 4DSKA 2B4UA 2Q79A 5B0DA 3BJ6A 4NXMF 3K5NA 2EFNA 1U78A 2R9LA 4E7LA 1MMSA 4ZLPA 1I50J 1X3ZB 4RW9A 3E01A 3W5ZA 2FIUA 3PKYA 3B6AA 3O8WA 1KD1T 4CWBA 5HLTA 2BRKA 1DPRA 4X4UA 4F4WA 4O3SA 1U4BA 3FHZA 3M1CA 4YUDA 3BKTA 1R1VA 3NKYA 2M4GA 3PFYA 1GFWB 1X4CA 4NI2A 2B9YA 5EG0B 1MG7A 2X3GA 1RBAA 1AUDA 4G1IA 4FYVB 1O3QA 5HLFA 3E1SA 4I6YA 5B09A 4CO2A 1IXSB 2POKA 4NMLA 4RUCA 2LK2A 1RBOB 3DMJB 4ED0A 3OSPA 1Q5YA 3SXYA 5IT0A 3K5LA 1X4GA 2L3MA 2ZDPA 3RGIA 5LMNF 1ZQ3P 4ZTFA 4X64F 3H92A 1ZARA 2YXLA 1S3JA 2KG0A 3S1TA 5KFNA 4F25A 1MMDA 1FLIA 2XYPB 1C4CA 1VJWA 4Y3OA 3CDAA 2V1UA 1LWEA 2H4WB 3OXGA 1QZYA 1Q82T 4HSTA 1IR2A 1UEKA 2JWNA 2W2PP 4PWUA 4CCOA 1UVJA 5FKMA 4KPCA 4LMZA 7FD1A 2M70A 4JI5J 4BY7J 4GFBA 2FF4A 2DISA 2ZD1B 1PBUA 3OYNA 2ZSHB 2PA8D 3CCWA 2RF2A 3ELHA 1Y0NA 2F2EA 5KFZA 4IHVA 2GZOA 3FNNA 4MAKA 2KIFA 1OCPA 4D5FA 4CZCA 1JJCB 2VD3A 1UHSA 4IPAA 3MM7B 1U7LA 4AL6A 3KYDB 2VQFJ 3E5XA 4PG6A 1S1VA 3ILLA 3EPIA 3A4TA 1ZPVA 2I38A 1RQ0A 4LF2A 2OA4A 3LP2B 2IS1A 2E66A 2D2WA 4CT8A 4E0DA 3ZXWA 2LQJA 1QSSA 3GV8B 1EX8A 3NQOA 1EA3A 4NXMJ 1HD0A 3IHUA 5HLGA 3C14B 3GR1A 4OJGA 4USJC 2RREA 4OLPA 2YNHA 4K4TA 2BXZA 4I6WA 4ECRA 1BQMB 2F8EX 1J0RA 3LFKA 3R1HA 2E19A 3D4JA 3WX8A 3DNCA 5D77A 3KG0A 1QPIA 2B8QA 5CQGA 5L8RC 2HVEA 4DMZA 3CCMI 2PC6A 4OX6A 5ED4A 2EV5A 4X1EA 5FIIA 4BDPA 1J75A 4XORA 2MQQA 1IKXB 1Y56A 4PKDB 2YNFA 3KP7A 4KUMA 1MSWD 1OLTA 1MMGA 4LR9A 2AX0A 4KT5C 1SL0A 5DQGA 4LLGF 4WTYA 5LMNJ 4X64J 4QW9A 2IM0A 2CYYA 2RHQB 1OMIA 1TW2A 2XMWA 1FNNA 2NPFA 1MGTA 1T6SA 1BJZA 2CUZA 2DGVA 1AT1B 5LL6d 3M05A 1CGPA 2P6TA 4ZP7A 1QNTA 1G7CB 2BXJA 4NRTA 4LVOP 2YPRA 1SQEA 3ZR8X 4H4MA 5HQLA 1F9FA 1C2PA 3FKJA 2O01C 4I7HA 2VJUA 1S1UA 5IV3A 1VRQC 1SXLA 1IRGA 1YS7A 3MXHP 2NCKL 2EG2A 3KK3B 3LPEA 1EAYC 4KFCA 2VXDA 1UW9A 5CABA 1LK5A 4KBIA 3IWZA 3FK7A 2V2VA 3D5SC 2DEJA 4JV1A 1PILA 1OPZA 1BQNB 2OEKA 4DCJB 4IHTA 4AUXA 2GOMA 2NSBA 3OTOF 4U8YA 4S0HB 1HNVA 3FBBA 4IOBA 2MKYA 3DCAA 2EW9A 1WC1A 1MWQA 1MJBA 4M3EA 3A2KA 4U0VA 2OZUA 3TOAA 5D5WB 3LTOA 1G3WA 1JLAA 2GQ2A 3MUVP 1SL1A 3D0SA 2F63A 1C0WA 2DK5A 1UWBB 5KFWA 4M6YA 1FWLA 4ENJA 4Z37A 1RTDA 1UELB 2CU7A 1FTCA 1AA1B 3DKYA 3GQCA 2C3MA 3VPRA 2NVXJ 2V4JB 4PWWA 4F36A 1IXCA 3LSPA 2PSZA 1Z6TA 3LSJA 3OTEA 4CO1A 3WC0A 3MEEA 4ZN1A 3VYTB 3RRGA 4WE1B 2D74B 2MLZA 2FE3A 5EZHA 1TL1A 3GYHX 5A8KB 4MT1A 1Q16B 3P5JA 2R7SA 1FKOB 5LSRA 4EMSA 4BE1A 3QO9A 3NMAA 3GU0A 4JBAA 4C98A 1L3UA 2ZDOA 3UNGC 1XN7A 4NLVA 3ULHA 1QUVA 1WOPA 2QE5A 4DPXA 3GFHA 3AT1B 1AKHA 1NDLA 5K7HA 2RQCA 2WADA 4Z7CA 2WCXA 4ZCKA 4J9MA 1FMWA 4IDKA 3BYRA 2R2UA 1S9FA 4DQPA 4L72B 4FT8A 5C24B 2AT1B 1WEYA 3HCXA 2FPHX 1TV6B 3ZO7A 5HMWA 4PJMA 4I4BA 4IRIA 3US5A 5FRNA 4HOBA 1HDDC 2F5FA 1DTTB 4OMFG 1IBKF 5E3OA 1VLYA 3O5TB 3L3CA 1ZS6A 3D1NI 2UV8A 2HOTA 1WH7A 4DL6A 2LU2A 4IOAQ 4NE9C 2JRSA 2R8JA 4K4XA 1WF0A 3D6HB 5ADZA 2W2QP 1B4AA 1WKMA 4PXBA 2XLJA 2XF5A 4HH0A 2IJFA 3GMEA 3OYMA 1YJVA 1HQUA 3F8MA 1W1WE 4XOTA 3GFMA 4CP5A 3OTOJ 2HW3A 5H9EJ 2XGPA 4ZDOA 2DO4A 1K4TA 4QPOA 3GG1A 1DLOB 1GT8A 2FOWA 4II3A 1T11A 3GG0A 5IWAF 1P7JA 3ITHB 1TL3B 2QBYB 1C1CA 3M30B 3B6BA 2DXIA 2JC1A 4CM2A 2J76E 4EO8A 3T6BA 2XUBA 1RP5A 4UVBA 3KLFB 4XIDA 4P73A 2O3DA 2QZ8A 2RDDA 4DUYF 4YQWA 2HPUA 4UXNA 1PKUA 4M5GA 4A3EJ 5F08A 3S8SA 4LF1A 2KRFA 3L1PA 5J1EB 5HS7A 2F8MA 3IRRA 4GKKF 2FUG2 2EH3A 1TU0B 3G96A 3ZTOA 1QQIA 3PQJA 4B3SF 3ZP5A 3K8VA 2YWGA 2CH0A 1XWLA 4MMOA 3CDLA 4WK8F 1T39A 2UUTA 4FF2A 2M8EA 2VPZB 3IM9A 1TAUA 4RDUA 4G1PA 4BXFA 4MKVA 1NG7A 4Q8FA 2R4GA 4QPTA 3R6GB 2DNYA 3RBDA 3N0VA 1QE1B 1LE8A 4USUA 3TANA 3HM5A 3OL7A 2DK8A 2I2YA 3VEPA 5D3GA 1X5OA 3QOEA 2MHNA 4RW7B 4A93J 3KG1A 3CCYA 3A01A 2H6BA 1SEUA 5M5WJ 2NXUA 3JB9k 3RKQA 3IRXB 4CI0B 4OZ1A 1K8AT 4ANCA 5ITHA 3KLGB 2E34A 2QUFA 1RHJB 4CCKA 3JRIA 4MNUA 2WHOA 1Y0UA 2P8IA 5K7FA 4K5RA 1IBKJ 2BE9B 3AOCA 2VA3A 2V50A 2PJRB 1USTA 2VPRA 3ZZTA 2D1CA 3BPVA 3MDFA 2DMTA 4RW4B 3ZN0A 3V6DA 1SH3A 5HMYA 3EETA 1BC7C 1N6QB 2HFNA 2W9BB 3MEDA 2XMTA 4EJUA 1IJFB 1L0OC 1BUXA 3I53A 3ZQLA 5DV5A 2NYIA 2MA3A 1MBGA 4P55A 4RAGA 4V2GA 3ZMZA 2WY8Q 4KRWA 1YS6A 2LRDA 4DX7A 5ERIA 3OYBA 2L48A 1R8AA 3DLLF 5KT3A 5IWAJ 2ABYA 3HIFA 1A6LA 3CJNA 1GEHA 2GX8A 1HWIA 2JEJA 1LDKB 3ZQQA 2X3DA 1SFEA 1VMBA 3HSRA 4ZHRB 2ECCA 1X1DA 2LFBA 1RT6A 4NLYA 3MKLA 1GUUA 4QIGA 1PBAA 4DUYJ 4U7UD 1WEXA 2MGQA 5LGUA 1ZTTA 1EHWA 1DFDA 3DRRB 4FN5A 1FJLA 2KB2A 4X84A 3CCLS 1Q1KA 5K8NA 1F5TA 1UCRA 1TZLA 4OMYA 3ONQA 1H6KX 4GKKJ 3PRBA 2EZLA 2MPUA 4B3SJ 2UXBF 3OFEA 5SZTA 1UFMA 2K86A 4HLXA 3N79A 2NS1B 4QIEA 2AJ1A 3VFZA 2OAUA 2K3IA 4ZH4F 2YKPA 2F5VA 4DSFA 1LQ9A 3ZZRA 1R1TA 2DMUA 3F8FA 3D67A 3MMYB 5IM0A 2V1XA 4Z2XA 2ZKUA 2G1DA 3IBWA 4WU3A 3H5YA 5F6FA 1YHQI 3WIVA 2QQBA 2O03A 1YIJS 4RNHA 4ZPCA 3CCQI 1D0XA 1UJ5A 3CJTB 4N0BA 4DBQA 3LAPA 2A6MA 1R1UA 2GIZA 3I5CA 2BY3A 4RS8A 1NB2A 2ZXWH 1Q8LA 2C3PA 3H7HB 4Y2AA 2BKPA 4DV1F 1Y5LB 3DM2B 4ZCLA 3JTOA 3W2VA 3PX4A 4QWAA 3AA8A 2Z33A 3PM9A 2ROEA 1YJ7A 2LY1A 2HWIA 2DOFA 3E5QA 4Q0BA 3FJ2A 1KONA 3FXUA 2NREA 5J3LA 5D6EA 2HNZA 1E17A 3K5PA 5E8IA 4UQTA 3ROUA 4W98A 1EV7A 5HMZA 3DKXA 2G0JA 2BRLA 4OX8A 4P2SA 2Z2SB 3PUFA 2FU4A 1ONVA 3R7NB 3EICA 4XPEA 1FJ7A 4HV6A 3H59A 3MEKA 1S6QA 2IJRA 3FXLA 3MM8A 4WFBQ 4ZPTR 1TKZA 4F55A 2B5JB 2LVWA 3AA9A 1BW5A 1UPPA 4E7JA 3VAJA 1W2IA 4B3XA 4TY8A 2XGXA 3I4PA 2Q66A 2NSCA 2A69F 1R89A 2YQ1A 4HACA 4GKJF 4TN2A 3GFJA 3HGYA 3QGPA 1LW0A 3CCSS 2Z5UA 2BV6A 3BP8A 2QLXA 5HJXA 2RD5C 3JRHA 3T9NA 1RAAB 2XGDA 2EA4A 4DSLA 1JHHA 2UXBJ 5KNLA 3CUQC 5K7ZA 3IR5B 4P9FA 1W25A 1OO0B 3MGJA 1SJFA 3WIUA 3CCRS 3HHNB 2E7XA 1DU0A 2MGZB 2XAUA 2CNOB 4N7TA 4Q5VA 2L9NA 2XY7A 2AS5F 1Q78A 3HHLB 3NNHA 4DR4F 1JTXA 4A8OA 1UJ4A 3GTOJ 3VODA 3OYFA 3M9AA 4C2MA 2V5HG 2V9WA 3I9V9 4ZN3A 5K8MA 4I0AA 4ASNA 3OL6A 2K9LA 2ZJQQ 2MY7A 4HF0A 2VJJA 3VSLA 1UKUA 1OS5A 4A8SA 3BPSP 4HR2A 2NPIA 1L3LA 1HNIB 1RCXB 5F27A 4DL0C 3JSMA 3AY0A 2B8PA 2NS0A 2HNHA 2VA2A 4CLLA 5IT3A 2GCFA 3QT8A 1SIZA 4DV1J 4OI1A 2KN4A 5D4OA 2IMOA 1WACA 3ZQ7A 4LSZB 3OYAA 5KFCA 5IP6A 4DX5A 1Q53A 2JX2A 3GFYA 3MPYA 3N5BA 1VBZA 3ET6B 3MAAB 4LIRA 5LGNA 1LWFB 3MD3A 4B9LA 1UEVA 3DN9A 1TWCJ 5L3FA 5J1YA 4IO9Q 2M5YA 1TT0A 1VQMS 1U1MA 2MLKA 3G1OA 4A3DJ 1LKZA 1VQYA 3BQ1A 2W85A 2CPIA 3LP0B 2YWFA 1RAFB 2FTRA 5J2QB 2UVRA 3CULA 4L75A 3CDEA 4RKUC 3FXMA 4DN0A 6PAXA 1YBUA 2G9OA 1QDUB 2AEFA 4ILRA 1DTQB 2HR3A 4LF8J 1KOOA 2DA4A 1VQ9S 3QRRA 2K2PA 4CYUB 3DI6B 3ZMVA 3VV2B 2RVCA 2O7OA 2ZBQA 2H5JB 3OIQA 1BHNA 4GKJJ 4YFNF 4K4SA 2OP5A 2RQPA 4LB6B 2WVCA 1Y1WJ 4WFNQ 1U2WA 2I8DA 3FZBA 4XRFA 2YPYA 3I64A 3SEOA 1NJIT 2W7NA 4LT6A 3UQSA 4RBUA 3H2LA 2QRRA 4PSXA 3BR5A 3BT9A 1ZHFA 1TWFJ 2HEOA 5DDOC 2L9WA 2F6CA 1FVSA 4ECTA 1N0UA 2XYHB 4D9JA 2M1BA 2AQFA 2BY0A 5L9NA 1RTJA 2BKNA 2DY9A 1U48A 5AIPA 1MW7A 1MMNA 3TOQA 3KLHA 1VQLI 4DR4J 2IA1A 3VB2A 5A0YA 2OZ6A 2XZDB 2X1FA 2DGUA 3MFIA 2FA5A 5F8IA 2OHDA 2DR5A 2E1CA 3HVRA 2C2MB 3KUGA 4HI2A 1U1QA 2CNNB 1Y10A 2YNIA 3MCOA 1WD6A 1FXDA 1JLEA 5KVRA 1TKDA 1NNDA 3KP4A 3SZGA 3C2BA 3HOYJ 4ER8A 2V4QA 4KSEB 1RT7A 1IGNA 2QCOA 1SH2A 4RUHA 2VG7A 2Y0BB 2M0CA 2H1LA 1WSRA 1JLQB 2FZCB 4J19A 3QAHA 3TL4X 1WI6A 2VKEA 4FVCA 2K9MA 1KFSA 5AXKA 1HWJA 3CMEI 3GJSB 3PIOQ 4A3IJ 2BV3A 2AXLA 4HTIA 3IH3A 2RKHA 4R5PB 2HVHA 4LRFA 1WG4A 4D0PA 2QV6A 3MR5A 1OCTC 3VHQA 1XDSA 2ZUGA 4F67A 3BGRB 5LRSA 4F26A 3UVJB 3DEUA 3WHCA 2W7PA 3TUPA 4M95A 4XRSG 4OQJA 2ISZA 4HW0A 5F3ZA 3BKUA 1B9MA 2CJQA 3GPAA 3C15B 1TK0A 2UU9F 1XMQF 6FD1A 4PRFA 3QFWA 1B9NA 4C3JJ 3M1VA 2MQPA 4DL2A 5CVRA 3CO0P 5H2FC 3C3LA 4LGWA 4NA1A 5IQQA 1IC8A 4C9DA 1GTEA 2VUGA 3D68A 3CO6C 1S1WA 5E33A 4NLXA 2RRBA 4ESJA 3OLBA 4Y33A 3DRSA 2FVCA 3LSMA 3QNWB 2NZCA 1C0UA 2L7FP 1SVMA 4OIOF 2CQPA 1R00A 2AGQA 2KRBA 3M8PA 2UXXA 2KIMA 4FPIA 3KLEB 4L5JA 1OYWA 4NEZA 4XRMA 1OR7C 5L3EA 3MEGA 4ZPWR 3CZ6A 3DEWA 4RGXA 1U3EM 5FD1A 2I5JB 4Y2MA 2XY6A 1ZM9A 3SEZA 1NB7A 2V8DA 3E97A 1BBYA 4IR9A 1F9HA 4YR2A 4BQQA 1T02A 2AGOA 4Y0FA 4WFAQ 3HKZA 4HX7A 3V8KA 1XMBA 2VJIA 5CZVA 2R5YA 3JTHA 2KZGA 2ZE2B 1HNXF 1JKQC 2GXAA 1Y4ZB 1UMJA 2EK6A 5F0CA 3DLAA 4WFXA 1VQNI 4IKAA 1VQOI 2UVWA 4LBIA 2QT7A 2XGCA 1ZRCA 3GX4X 4E98A 2OTLS 3OV8A 2YU9J 1UVKA 2Z30B 1RKWA 1N5TA 4UUSB 1I6XA 5DRKA 1FFGB 1VQPS 1ZAWA 2BGCA 2DA5A 2KVQE 3IAS9 3KP6A 4YEAA 4ESFA 3I4MJ 3ZXSA 3C19A 4LK0F 3CESA 4Q5SF 1QU3A 3LA0A 5SUHA 5KFRA 4RLEA 5CVUA 2QEXS 2Z0GA 5GVQA 5BNGA 2C42A 4EGYA 3DXJF 2AMCB 4X62F 4EJOA 2IHR1 3DMJA 1JHFA 4YR3A 1AFJA 2F5EA 3LQVA 3WE3A 3I55I 3SZ2A 2VT2A 3CD6S 3H5XA 4YIRX 4O3MA 2HPIA 4A3LJ 2R8KA 3H8YA 5BYSA 4H4KC 5KFAA 3PVXA 2W48A 4BWJA 4EGZA 3HOUJ 2UU9J 1XMQJ 1TZ0A 4E6KG 3MI7X 2E5IA 1KQFB 2HLUA 3W8PA 4M72A 1S7OA 4X4OA 3PDNA 1KU3A 1UJ6A 1D1CA 1YJ9S 3O8GA 4FPRA 4CLFA 1XR6A 3AQOA 1U5TC 2P6SA 4OYXA 4BY1J 3RB6A 1K79A 3G6XA 3W3SA 2ZD1A 4DUZF 2N7CA 3WTTC 1ZAXA 2CQDA 3N6LA 3QT6A 3CJ2A 3JRCA 2IRYA 2XPUA 3H9QA 4ED8A 1RBLA 3H40A 4C8ZA 2HEKA 2WAQA 4YFXF 4P9UA 4RB3C 1RAGB 4V19K 3PW4A 4HHHA 1R5HA 4ZVEA 5FLXZ 1LB2A 3TA2A 2BE7D 2ZVSA 4QW8A 3EZ5A 4RB0A 3LP2A 2E71A 3ABMH 2JRMA 1KS2A 4N4OB 1U1OA 2FJWA 4PG4A 3D1HA 1MNDA 3M7VA 2W1OA 2V69A 1IDZA 2KT3A 1UL3A 3ISPA 1HNXJ 4LFUA 1BWEA 1I5ZA 3C14A 5J4YA 4H4OB 2R7ZJ 1IN5A 4DYCA 2ELJA 1H38A 1BQMA 4XOPA 2ZFHA 5FJ8J 1X5TA 1O0PA 3R5CA 2JPBA 1Q1VA 3UDLA 2LH9A 3CMMA 2MKHA 1H2VZ 1BOBA 1TNSA 3QJJA 1IKXA 2DQRA 3VQSA 3K1MA 3GB0A 2WVDA 3D5RC 5IFMA 4DPTA 4X62J 2YX1A 3CF5Q 3S8PA 1JLGB 2A5YB 3S14J 4S05A 4C9YA 1L5UA 2LVSA 1D0YA 2OCEA 2GV1A 1IR0A 4WYLA 2MB0B 4BBYA 2KFZA 1PUEE 2HGMA 5D5VB 1IBCB 2HVDA 2DHHA 4UOGA 3VGSA 2K8GA 2HAIA 4FETA 3WODF 4HI1A 2FB0A 3T3FA 5LEJA 5GAHJ 3OYEA 4PQUB 4WF2A 4Y13A 3TJ8A 3IO1A 2VB6A 2MQ8A 1HBUB 2J9EA 4RO0A 5GAEJ 4WXHA 1NPRA 1OYIA 1WC0A 3KK3A 3P8BB 5DQIA