1I1GA

Crystal structure of the lrp-like transcriptional regulator from the archaeon pyrococcus furiosus
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
140
structure length
140
Chain Sequence
IDERDKIILEILEKDARTPFTEIAKKLGISETAVRKRVKALEEKGIIEGYTIKINPKKLGYSLVTITGVDTKPEKLFEVAEKLKEYDFVKELYLSSGDHMIMAVIWAKDGEDLAEIISNKIGKIEGVTKVCPAIILEKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the Lrp-like transcriptional regulator from the archaeon Pyrococcus furiosus.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Transcription
molecule keywords TRANSCRIPTIONAL REGULATOR LRPA
total genus 34
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01037 AsnC_trans_reg Lrp/AsnC ligand binding domain
A PF13412 HTH_24 Winged helix-turn-helix DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1i1gA01
3.30.70.920 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1i1gA02
1E2XA 5LEJA 2MC3A 3E6DA 3TDZC 4OU0A 2A69F 3KEQA 2D2WA 4G7OF 2RGVA 5FFXA 3JTGA 5HOOA 4IJAA 2KJCA 4WXDA 2NAZA 3E5QA 2FE3A 2RQPA 2ZJ2A 2A6EF 2DPDA 3V7CA 2VT3A 1HW5A 1O3SA 5JHUA 4UV8A 5DD4A 2XAGA 2GA1A 2X4HA 1K78B 2Y75A 1MJBA 4IRIA 5CVRA 4DNCA 2FSWA 4R8HA 2YU3A 1FNNA 3DPLC 4WXCA 4I98B 1Z9CA 5HDNA 3GO5A 1P2FA 5CVJA 5E20A 4K2EA 3J81K 1D8JA 3VEPA 1S6LA 4JQFA 2VE9A 4OIOF 4ZH4F 2K4BA 2FA5A 4HF2A 3TO9A 4XSZF 3LAJA 4PZJA 1Z91A 2C6YA 3M7GA 4M74A 5HDKA 4L18B 4EMSA 3K2ZA 5JVTA 4EJVA 1GXQA 2JT1A 3T0YA 1STZA 2Z4PA 2P5LC 4KN7X 2GZWA 3HSRA 2XRNA 5L3CA 4HZFA 4A6DA 3MZHA 4Z2YA 1WKMA 2R3SA 4UUVA 4KA4A 3BJOA 3K1PA 3HSFA 4RGXA 4IRGA 3CUQC 4AIJA 3H3ZA 2Z5UA 1U5TB 3VOEA 4LLNA 1G3SA 1XN7A 2PQ8A 5L3EA 4IVNA 2KIUA 3ZP5A 5IT9K 1BI1A 3TO6A 4F7ZA 2H6CA 3R4KA 1HW2A 2NNYA 2EA2A 2XASA 2RVCA 5TRDA 4ZYEA 2XAFA 1PUEE 3PQJA 3E6CC 2ZO4A 4FHTA 3WE3A 2P5VA 1T2KA 3KE2A 2EWNA 3JAMZ 4A2UA 4U7DA 3WG9A 3P9IA 1R22A 1IN6A 4AD9A 2XROA 1FX7A 3TOBA 4U0WA 5ED4A 1YW7A 5IT3A 4GCVA 4HLXA 5BPIA 3CUQB 2H27A 2BEOA 3SFZA 4OINF 1ODDA 4EM1A 1T0FA 3DFGA 3QOPA 3M1EA 3L00A 2HQNA 1L3LA 1FBQA 1K78A 5BS6A 2ZFWA 3C1DA 3BPVA 3FMRA 1BC7C 1MKMA 2PEXA 2NNNA 4ENJA 2VXZA 1OR7A 3GW2A 5HDGA 3SHFA 3BJ6A 3GYHX 2HDCA 4OIQF 1R1TA 2V1UA 1SD7A 5D4SA 3WE2A 3QP5A 1HKTA 5J8CA 2IA2A 5LHHA 1BIBA 1V4RA 1HKQA 5K5QA 1ZG3A 3I53A 1UHWA 3WTUC 2YX7A 2F5FA 2QM3A 2M1BA 5A2QK 1UFMA 3PQKA 2YSRA 1J7KA 2A6HF 4HX4A 2AS5F 3DV8A 1T98A 1YFHA 4LD5A 4M73A 1ZARA 3RDIA 3F8NA 4GYGA 3WTXC 4O3MA 3N4MA 3CO7C 3L09A 4Y13A 1SAXA 1SFUA 4YFKF 3RKXA 2HOEA 1OYIA 5D5WB 4A5NA 5TJJA 4MEYF 3I59A 3K69A 4RB3C 3KZYA 2H6BA 2M30A 3IWFA 1PDNC 3V8JA 3RKWA 3EYIA 5DCFA 4G94A 3SZPA 1EH7A 2QBYA 2VOPA 2ZXJA 2G7HA 4EM0B 2L4AA 1BI3A 3WGGA 4QLCU 4HLYA 5D6FA 2RN7A 3WGIA 1JGSA 3MWMA 2CSOA 2CGPA 1AWCA 2ESNA 5EEGA 3CUOA 1K6OA 5LLQA 2Z3YA 1DUXC 1B4AA 3BY6A 1LVAA 3IKTA 2H94A 1R36A 4IHSA 4AWXB 1VTNC 4BHCA 2HTSA 3KP2A 1SFXA 3GZ6A 1P4XA 1KU7A 5DYMA 3F23A 1TTYA 4HX8A 3M8EA 3GWZA 4GYIA 3IWZA 2EFQA 5HS7A 2J5PA 4TV7A 4ETSA 4M6XA 1IXCA 5E18F 3CLOA 3BPXA 1O57A 4L5IA 1JE8A 4L9TA 2EFOA 1RUOA 2J5OA 5DDGA 1U6GA 1XCVA 3FM3A 2W24A 4B8XA 4LG0B 1W7PB 3HOSA 3HRTA 4GGGA 3H92A 2O6GE 5CVIA 3CO6C 3GVAA 3KFWX 5FLXZ 1R1VA 4XRFA 5D5VB 2XIGA 4L0ZB 3B73A 2Q2EA 3LWFA 4M9SA 5JFRA 1O3RA 2DK5A 4ESFA 2VOOA 3L7WA 3GXOA 3E3VA 5ILUA 2LSOA 3E97A 5LHGA 3TQNA 1Q1HA 1YW9A 2DQRA 5D5UB 2QVOA 1QQIA 3U1DA 1HBXG 1G3TA 1WI9A 2IRFG 2UXNA 3ISPA 2L3DA 1XGOA 3SXYA 1J2XA 1KA8A 1TQIA 1AOYA 2VBYA 1YLFA 5E17F 2EB7A 1S7OA 2V1DA 5CVVA 4KICA 2DFIA 3FHZA 5DUKA 4A0XA 3BJAA 4N0BA 1QBJA 4IF4A 1Z6RA 4RAYA 2GAUA 3EQLF 2HZTA 3GLXA 3O3KA 3DXJF 3FXUA 4RGSA 4ZYHA 3Q9VA 1I27A 5K5OA 1PP8F 2A68F 3T5XA 3G3ZA 3WTVC 3MEXA 4WWCA 4FX4A 1ZG5A 2PI0A 2JPBA 3QU3A 5CVUA 2CFXA 2FU4A 5L3DA 4E70A 1FSHA 2DO7A 3WU0A 1R5GA 1DP7P 3F8BA 2KJBA 5E1ZB 4HDVA 1MDMA 2HYGD 2M5WA 3C3WA 3T8TA 1QZYA 3K9TA 3QAHA 4LLLA 4OOIA 3HHGA 1FBSA 2PBIA 4JK1X 2GQQA 2L4MA 2A5YB 2MD5A 2X0LA 5FB2A 3OV8A 1W5TA 1F5TA 3ECHA 2QLZA 4UV9A 1REPC 3TO7A 1MZBA 3I5UA 1HXDA 3MCZA 3VFZA 3IC7A 5LEKA 1CGPA 5K5RA 1ZG1A 4BAYA 1YYVA 4BH9A 2CG4A 2CO5A 2UXXA 4ESBA 4WF2A 3EYYA 4YFNF 4KDPA 3BOQA 2IPQX 2M45A 4P55A 2A3SA 3DP7A 3ML6A 1BC8C 4KT5C 4HX7A 3ZMDA 2EK5A 5JR3A 1UHMA 1YO5C 2R7FA 3ABTA 3J80Z 3F72A 1ON2A 4XBFA 2EV0A 1MJ9A 2E7WA 4HDUA 4HBLA 1HQCA 2O61A 3RIRA 3L2CA 1XGMA 2UWMA 3I59B 2JPCA 4ZYDA 2K7LA 2QQBA 1WWXA 2E7XA 3V7RA 4LGWA 1P6RA 3KP3A 3R61A 4UVBA 3R0JA 2Y48A 1IN7A 3BWGA 5FFZA 1QPMA 4EJUA 1H9GA 1FWZA 5ICCA 2WC2A 5F1RA 4G6DA 4ZZDA 1I1GA 1ZN2A 3IKVA 3J7AO 3HRMA 2FF4A 5CYVA 4BXUA 2RNJA 3NRVA 4S04A 5DV5A 3AAFA 2LKPA 4G8XA 1FT9A 1XCBA 2FEZA 2NYXA 3HTSB 4CDGA 1KU2A 1U78A 3G73A 4GXOA 3F8FA 1USSA 5LGNA 3WTSC 3E5XA 1ZRFA 2P6TA 3KLNA 2V1XA 2MH9A 1RIOH 1R7JA 1YG2A 2XV4S 3OOPA 1TW2A 5BOXA 3GFMA 4ENMA 1YS6A 2OZ6A 1Z6TA 1JHFA 1SMTA 4PGGA 3F8MA 3MFKA 1QNTA 3F22A 1WRJA 4Y17A 3I64A 3U2RA 1F1ZA 1OYYA 4EQQA 5CLSA 5HLHA 1EH6A 3V8KA 3ERED 5L3FA 4L9JA 1XGNA 2W25A 1ZGJA 1YIOA 4KN4X 3JSPA 4AIHA 1LDKB 3RYPA 5LGUA 2V6CA 4WCGA 2ELHA 3BDDA 4N9HA 1FP1D 2G9WA 4LLGF 1V3FA 1W7PD 2ETHA 2CYYA 4OIRF 2DTRA 5E1XA 4ZZLA 4EVIA 2V9VA 2OQRA 2PJPA 1G3WA 2FNAA 1B1BA 2XAQA 1BJAA 4BHPA 1XSVA 1RI7A 2HKXA 2MBFA 3GF2A 2OAZA 3CDHA 2D1HA 3CUQA 1LEBA 3CJNA 1J59A 4HW0A 2IVMA 2E1CA 3L9FA 2EJRA 4UNOA 2FNPA 3KP4A 4YIIA 3SZTA 3BROA 2A61A 1F4KA 4MTEA 1ZGAA 3LA3A 2HQRA 1XSDA 3JW4A 3D0SA 2JRTA 1ZH5A 2WV0A 5D5XB 1MJAA 2M8EA 2O8XA 2FRHA 3KLOA 4G9YA 4EGYA 4G6QA 2P7VB 1B6AA 1LDDA 4I01A 1CF7B 1IAWA 5CJ9A 2VC1A 3HUGA 3W6KB 1TQMA 1O7FA 4ENNA 2NS0A 2H09A 4NB5A 2CQKA 6PAXA 5FLXK 1KQ8A 4HF0A 2KRFA 1OKRA 5E8IA 2HWVA 1IN8A 2K86A 5ILSA 3IRRA 3ZPLA 3FF5A 1FYKA 4PCQA 1ZYRF 5D6EA 3JSOA 5DUIA 2XAJA 3ZN1A 3KZZA 1U3EM 1FC3A 4UXNA 3QPTA 1XSXA 3IRQA 3E6MA 3K1MA 5FO5A 3V7SA 2HKOA 2L02A 1P92A 2PMUA 4ZYGA 2FOKA 2A07F 4EJOA 4A0YA 3RI4A 4EGZA 3GEZA 1I1SA 1EH8A 3HSEA 4I0BA 2WWYA 2FMYA 1HW1A 3HIFA 2D45A 3ECOA 5AONA 1LB2A 4KNYA 4LG0A 4NQWA 5E8GA 2XVCA 4B09A 4MQ9F 4WXHA 2BBYA 1BIAA 2STTA 3GFLA 3FWEA 4I0AA 1FSEA 4HV5A 1B59A 2F5EA 3ULQB 1QO0D 2RC4A 3N97A 4BNCA 2DJWA 3FXQA 1Z05A 4P5OA 4HAMA 2K4JA 4HF1A 4HA8A 4RAZA 1W4MA 4YG2F 4CO8A 2QYOA 4NHJA 3NEUA 1I6XA 4IRHA 4I09A 3KCCA 4A0ZA 4OMZA 1BOAA 2PG4A 1HSJA 2Y0MA 1ZRCA 2W85A 2XUBA 2MA3A 4WK8F 2HS5A 1L0OC 2DI3A 3PFIA 2P8TA 4UVAA 1ON1A 3H3UA 5KK1A 3S2WA 2PFBA 2HEOA 1OYWA 4U7BA 1FY7A 1KU9A 2DBBA 4JBAA 1YS7A 2DPUA 3IL2A 3LQQA 4R79A 4M6YA 1BN5A 1HSTA 1XMKA 1R1UA 2M87A 5HLGA 2BYVE 5LHIA 5HS9A 3HHHA 4KIBA 2F2EA 3REOA 4BQAA 1X3UA 3JAMK 2JSXA 2ZMEA 4XLNF 2QQ9A 3C7JA 4LFUA 5DCMA 1KGSA 3E6BA 1XDUA 1RNLA 5DEQA 4M9ZA 1K7AA 1ZAOA 3I4PA 5ICEA 5LGTA 4XLPF 4L0YB 5FD6A 4U88A 2GXGA 4HOBA 1IN5A 3TOAA 5ICGA 1A04A 3MZYA 3WTYC 1XDSA 2FBIA 2F5DA 4CZZA 2OD5A 4KFCA 2ESHA 2HR3A 3WODF 1C0WA 2VC0A 4XSXF 2RDPA 2FBHA 3LQRA 2IP2A 2RV8A 2LF7A 1FZPB 2IA0A 3K0LA 1O7LA 1LNWA 3ZMTA 4RB1A 1MGTA 4PDKA 2IA1A 2ACJA 1UB9A 2VE8A 2QBYB 2ZNYA 1BI0A 2WTEA 2Q0OA 4EM2A 2Z99A 1YTYA 3F6OA 3M9AA 2XGXA 3RKYA 1YW8A 2GIVA 4M71A 1OMIA 2MLGA 4ASNA 4KYWA 2ZCWA 5L3BA 3MAJA 2DK8A 4LK0F 1EV7A 5A2QZ 5IT9Z 4L9NA 5D8KB 1LQ1A 4U0VA 3RPQA 2VBZA 2QQAA 2ISZA 2VN2A 5FGMA 3F8CA 5JI6A 4MNUA 1MDMB 1TNTA 3RYRA 4LB5A 4YIFA 1IW7F 4L5JA 2EA4A 2VODA 1R5HA 1U5TC 3FXRA 4HYEA 4KMFA 5K1YA 4CHUA 4LB6B 2IW5A 3ZMVA 5J6XA 4G7ZF 2F5CA 4Q48A 4RB0A 5E1WA 2EFPA 2YR2A 1GHCA 1DPRA 4BHBA 2FMLA 3W6JB 2K02A 1J0RA 3DPTA 1SFEA 4S05A 1FLIA 1SMYF 3O2PE 2TDXA 4Q5SF 1G3YA 1FYMA 1IRGA 2W57A 2CW0F 2O3FA 3LA2A 4MHGA 2LNBA 1ONVA 3E5UA 3ABUA 5LRRA 4A12A 4A6EA 3WTZA 2MH2A 3HRUA 1TQPA 1IRFA 5HLIA 2GA2A 2JSCA 2DT5A 1Z7UA 4I2OA 2ISYA 3GZ5A 1YQAA 2OA4A 3EDPA 2E1AA 2B0LA 1XD7A 1U2WA 3D5LA 3T8RA 3P7NA 3T1BA 2QZ8A 3M8FA 5ILVA 1T39A 4O6JA 4GO1A 4WX9A 2PLYA 4D0PA 1TLHB 3P9KA 4BYYA 4MTDA 1FBUA 1QZZA 2NRAC 5ERIA 2PN6A 3F6VA 4G7HF 4O5VA 3F21A 2QWWA 4I7HA 1MD0A 3I54A 3I71A 4YFXF 4H0EA 4DQ2A 1RUNA 4LK1F 1R23A 1U8RA 1BBYA 3ZN0A 3B02A 5H6RA 2VONA 4RGRA 1GXPA 3EUHA 5FD5A 4OMYA 1KU3A 3GX4X 1FOKA 4FX0A 1IZ1A 3RJPA 1E17A 5DD8A 1U5TA 1R00A 2DAOA 1WQ2A 2P6SA 3ZQ7A 2HTJA 2DU9A 3TKYA 4P9FA 3J81Z 4CYDA 5L3GA 1J9IA 3QPHA 1ZLKA 2HFHA 3ELKA 2XHKA 5AIQA 2Z9OA 4ON0A 5H20A 2GXBA 3Q5FA 1W7PA 2R7DA 2W84A 3FX3A 3KP7A 4CXFA 2KKOA 5ICFA 3TGNA 2CWEA 2Q8KA 3R6SA 4OIPF 3DF8A 3COAC 4EV0A 2DQLA 5F6FA 4HQEA 3FMSA 1NHAA 3R0AA 3O6BB 3TDUC 1ZRDA 1OPCA 2KIFA 2VBWA 4QWQA 1SD5A 4CICA 3BP8A 3J80K 5HS8A 4A5MA 1D8KA 2O0YA 4KUMA 2Z33A 3KEOA 4I02A 4Q4ZF 2V79A 1USTA 2IJLA 1SD6A 3I0TA 3EETA 2BE5F 3IHUA 4IPAA 3DQVC 5D8LB 1P4AA 2RKHA 4IXAA 5D4RA 3JTHA 4FT8A 4AVPA 3NQOA 4EJTA 5HVQC 1KYZA 3GFJA 4ENKA 1J5YA 1KYWA 4UVCA 3I58A 2VT2A 1UCRA 1S29A 2O03A 1W5SA 4MEXF 2EV5A 1TW3A 4M9XA 1T38A 1WSUA 1Y0UA 1O3TA 1FYLA 1JXSA 3QU6A 1Z1DA 2OBPA 1FPQA 4R1HA 2LDUA 3DKWA 2L01A 3K1NA 5KVRA 3QRFF 3WU1B 1G6NA 3HOTA 1S8NA 4RS8A 1QGPA 1JHHA 2DLLA 1S7AA 2DW4A 1KQ9A 2K27A 1ZREA 1IN4A 3FZVA 3KETA 2HYFA 1H9TA 1S3JA 4IHTA 3V4GA 5J8FA 1XGSA 2BV6A 4L9VA 5EEHA 2HGCA 1D5VA 2PMHA 2XKOA 3LSTA 2FXAA 4HQMA 1R58A 1G4DA 2XAHA 3RTRA 2L54A 2MLKA 1DDNA 1IXSB 2UZKA 2IT0A 4KMUX 4KIFA 2G7UA 2P4WA 3U9GA 4P9UA 1IXRC 3ROUA 2JTVA 3WGHA 1J75A 2P7CB 1KQ0A 5LBQA 1H0MA 3KP5A 3FMQA 3SQNA 4EJWA 1RZ4A 3QP6A 5BQTA 4AIKA 5BPDA 2AXLA 3GFIA 1XMAA 3Q9SA 4ESJA 4N9IA 4Y15A 4HV6A 2YX4A 3ZMSA 3R60A 2FQ3A 1BI2A 2OU2A 1LDJA 1B9NA 2ZNZA 4CGZA 1D3YA 1XB4A 3HYIA 3ZMUA 4LMYA 5LRSA 4RB2C 1PP7U 4PGHA 2E1NA 2QUFA 1IUYA 4Q47A 4MQVA 4KIGA 1F9NA 1BM9A 1TNSA 1K79A 3LAPA 1DPUA 2GWRA 2JZYA 3VB2A 1TBXA 3P9CA 3F3XA 2D1VA 1ZHFA 1FP2A 4P96A 4LJZF 3GUDA 2ZKZA 2XKPA 3HTUA 1ZLJA 4RGUA 5AIPA 4MGRA 2STWA 2EFNA 2EV6A 4UHTA 3WTTC 4M72A 2BGCA 2YPRA 2ZBCA 3BZ6A 5H6QA 2LF8A 3RPUA 2VBXA 1P4WA 2P5KA 1SD4A 3LA7A 3KP6A 3FM5A 2QENA 1ULYA 2KIMA 2ZBKA 3ZMZA 2CVIA 2OZUA 1I5ZA 3V8LA 1GVJA 2EFWA 1HKSA 4U0YA 2OQGA 1B9MA 3DEUA 3LFKA 3VODA 1IF1A 1LEAA 1LJ9A 3WTWC 3CTAA 3C18A 3MQ0A 1T6SA 2ZMEB 2ADUA 5BMZA 1O3QA 2COMA 2FBKA 3HRSA 1CF7A 5F64A 5DCMB
chains in the Genus database with same CATH superfamily
3M8ZA 4JI7F 2YWFA 3DXSX 2GC8A 2XMAA 2EK1A 5C44J 2RD5C 4OU0A 5F04A 3S8SA 3UKGA 3JRFA 1EP4B 2RGVA 3HSZA 1PIEA 9ATCB 2HNZA 3Q8QB 5D6GA 2RQPA 2XEXA 1SFOJ 2ZVSA 1XMOF 4M1KA 5JHUA 1UTAA 1M5OC 3TX8A 2RDIA 4AUKA 2DPJA 4BJ5C 5CVRA 4DNCA 3CDLA 3KYCB 1K47A 2L9WA 1XMQJ 2OCEA 2UVVA 5IYBJ 3CCMI 4CCKA 4FBUA 1UJ4A 1UAAA 1DTTA 1K1QA 4XL9A 1QA6A 1E6VB 1NJYA 3TAQA 2HXOA 2Y1RI 1S72S 3UCGA 4CRJA 3F41A 4QPOA 3PKMA 3OUYA 4LRFA 4KGZB 3ADAC 3QGGA 1DJ0A 1OCRH 2ASLA 4O0NA 4JQFA 3B4DA 2IS6A 4A4JA 1MMNA 5KFOA 2K4BA 3K4BA 5KFVA 1Z3XA 3ABKH 1VCTA 3IWXA 2VICA 4OZNA 3TUZC 4O4GA 2YVSA 2LR8A 2QN6B 3IRXA 2C6YA 1WH5A 3TNVA 3H5RA 1U8SA 4M5GA 1H74A 1NJZA 3VAJA 4CUGA 5IYCJ 3MEDB 1VQ7I 1B72B 1OCCH 3IP0A 1T11A 4DCPB 2GZWA 3MEDA 3DU6A 2AYMA 4XN0A 3CJ4A 1T05B 1T0FC 4Q0BA 3J7YJ 3EE3A 1WKMA 3TQ1A 2SXLA 4UF4A 2R3SA 2O1PA 3GIJA 1RB0A 4A48A 5EN1A 1J27A 3BJOA 4B3TJ 4IR9A 3K1PA 1VISA 4H4MB 5J1UA 2L7MP 4CWBA 4AIJA 3BTJA 5CQGA 2QG9B 4ENOA 3KLHB 1BQMA 1ACIA 2B5JA 3EGNA 2JDJA 4KHPF 3VOEA 2AF6A 3RQIA 2MZSA 3QFWA 2MMYA 4LLNA 1XMXA 2DY9A 1XN7A 3T1HF 3R5GA 2GGPB 5K8PA 3KNGA 1U47A 3FCHA 2Y3YA 1H0HB 3Q83A 4F7ZA 2H6CA 1HNWJ 3ZZRA 3R4KA 5C25B 4HT7A 2Z1DA 4JI6J 2DNNA 4FF4A 2RVCA 4MFBA 2DXIA 2QJ3A 4LMZA 4FYWB 1SL2A 3BR2A 4NZ0A 4AXIA 2UVRA 1UW4A 1UHSA 3GCXP 2B4OA 2AEFA 3M9NB 2JJ7A 3FCVA 2RF2A 2IY5B 4YOEA 3BREA 1T2KA 1T03B 4Z7CA 3DLGB 2EWNA 3ET6B 4U7DA 2QC3A 5IOZA 3PNIA 3FMBA 4ID8A 3RR7A 3CF5Q 2ZC4A 3P9IA 1R22A 2IMOA 4LRCA 1C4CA 2P81A 2HLUA 2MDAA 4ED2A 4X62F 4FCYA 5J1EB 2LFVA 4PFOA 5ED4A 1MW7A 1WJAA 1NUEA 5KAFC 2AKWB 1R0AB 2HHVA 2HNYB 3JSBA 4MTPA 5EWFA 3DI6A 1IM4A 1WF2A 1IR0A 3HO1A 4CZCA 3QOPA 2HZDA 2F8MA 3L00A 4GC6A 3W6VA 2DMTA 2OCCH 4UTGA 4C98A 3BPVA 1T08B 2IAJB 2X3GA 4RBUA 4ZPCA 1OR7A 5HDGA 3OYCA 4MMOA 2BRKA 4YHHJ 3GYHX 2K1RB 2J9CA 2C3PA 2V1UA 1BOBA 2Y0SN 1Y6IA 3QP5A 1AROP 4M3DA 2IA2A 5LHHA 1LKZA 3DTIA 1HKQA 3HMJG 4HVZA 2NQPA 3I53A 3ABLH 3AOBA 1TV6A 3IWNC 1EIYB 3MKZA 1CVJA 5A2QK 1UFMA 5I3PA 3PQKA 1Q79A 1P27B 3SFGA 4DU7A 1FA0A 5M5WJ 3H9GA 2AS5F 2CJJA 2JUCA 4HR2A 2V2ZA 4TU7A 1YFHA 4M73A 1S1TA 3PSIA 2PMZA 1WC6A 3NWRA 2J6UA 3UVJB 2L7KA 5HATA 2R7QA 2EG2A 2M0GB 3UDEA 2FJBB 2R42A 3D28A 2YH0A 1SFUA 2IPOB 7FD1A 4YFKF 1IO2A 2HOEA 3UN2A 1E6YA 5J2MB 4JX4A 4NC6A 3H5UA 3VVUA 3HKWA 1E0EA 4A5NA 2LYVA 5TJJA 2L3MA 4C8KA 2HURA 2FVPA 3IWFA 3BR9A 3OXFA 3V8JA 4ZP9A 3RKWA 3OW2R 3EYIA 5DCFA 4G94A 3HP6A 4ZJLA 4JI0F 4FKXA 1VHFA 2G7HA 4B3SJ 1IWGA 4CI0B 4IH6A 1D0YA 1LE8A 2ABYA 2DHXA 2GVDA 4NOHA 4QPTA 3DFEA 4F0HA 3KK2B 2KKHA 1JGSA 2QSFA 2CSOA 2FVRA 5EWEA 3FK6A 1UELB 2DOAA 3X3UA 5EEGA 1HWJA 3CUOA 2RHQB 1K6OA 4M3EA 2XCPA 1ZYQA 4DG1B 2IBOA 1RYRA 3GP9A 2XYPB 3PW7A 2XI3A 4TN2A 4W92B 2IDLA 5K14B 1LVAA 3IKTA 4ABZA 2CPXA 1F2GA 3OFHA 2EIJH 2HTSA 3I56I 3W2VB 2FJDB 1P4XA 4O4RA 4AL5A 1HNZF 1XBWA 3F23A 4Y2KA 2V8VA 4JI8F 4WKRA 3IM8A 2EWHA 4I69A 4ICLB 2HGMA 3IWZA 4OJ3A 2BKOA 2J5PA 4TV7A 4ETSA 1I51B 3UD5A 2JUGA 1IXCA 3GFHA 1Y0HA 2PX9A 2DDBA 2B4UA 2BE7D 2EFOA 1FJGF 1OWXA 2DR5A 3MMCB 2HIYA 2B9EA 3M6XA 3HM5A 2A6TA 2BE9B 4RUCA 3FM3A 3UR3C 4UY8I 4B8XA 4J9OA 4UOCA 4GC7A 3FXMA 4IHWA 4WZQA 1BL0A 2GVZA 3CCJS 3H92A 4JYKA 4DV2J 5DDOC 1S9HA 2V8DA 4OZ2A 3IUOA 1H72C 1DFDA 4USKA 3KFWX 5F9LA 1FXDA 1H3DA 2Q2EA 2FY8A 2HFVA 2NXUA 2HPMA 5JFRA 3OD2A 2G1HA 2UUCF 2DK5A 2WY7Q 3P49B 1SAUA 3DOMB 4UUXA 1AHDP 5ILUA 2F63A 4MIBA 3NKYA 3NP5A 5LHGA 1D8YA 3OJUA 5LOQA 2LXUA 1T33A 2WAFA 2IRXA 4C8NA 1SVDA 4Y2AA 3U1DA 4BE2A 3HOXJ 4CNZA 1HBXG 1G3TA 1WI9A 4L76A 1HFEL 1P7IA 2IRFG 4BGDA 3CJ3A 3SXYA 1RTJB 3EX7B 3KHGA 4LF5F 5IP6A 3LSMA 3W7BA 4IQJA 2O67A 1R0AA 1TP7A 2CUJA 5A8KB 1P9QC 3VVTA 2ZSIB 1Q53A 3OYNA 3OV7A 2K2PA 4C6AA 2DFIA 5DUKA 1CJKB 2LY2A 1XS9A 4A0XA 3BJAA 3B6AA 3CCES 1VRUB 3CJTA 2CW8A 2QKLB 2OMLA 1NK3P 4L5EA 4DN0A 1XR7A 4OL8A 1S7IA 2HZTA 2HQIA 3FXUA 4QIFA 5D3GB 5F8JA 4RGSA 3G3ZA 2BOLA 4FX4A 3Q8VA 1ZG5A 3A1YA 3QU3A 2CFXA 2X6YA 4J90A 2OPRB 2IC3B 3QT6A 2NZ4A 1FSHA 3PM1A 2MB0B 1B3TA 3WU0A 4IL6C 4MYTA 2CA9A 3MZ8A 3F8BA 3R5CA 4UB6C 3AFHA 3OWTA 3NNCA 1MDMA 2HYGD 1RAOA 4QU6A 3CP2A 1R71A 3QLHB 3T8TA 1IXKA 2Z2MA 4OX7A 5H9EK 3BGUA 3TZYA 2MPUA 1M90T 1JKQC 2XGQA 1TL1B 5A8KA 2XC7A 2EXUA 3OYJA 2D3ZA 4ETXA 3MPVA 2JEJA 3S3NA 2DT7B 1LW2A 1W5TA 3LSJA 3ECHA 3VDXA 1HMVA 1FWPA 2E5IA 2ZJPQ 1SJ3P 1C1BB 1FD2A 3G4SI 1FXLA 1RT3B 1LPQA 1UW9A 3SMZA 1HXDA 5F0WA 5HVGA 4OYZA 3MCZA 1UA0A 2HWIA 3IO1A 3IC7A 5K5RA 1REGX 1RKTA 4UY85 1A31A 4D7NA 3ZZ0A 4BH9A 1JQGA 2CG4A 4S0MA 3J81U 4ZJQA 4WF2A 1Q8LA 4DR6J 4KDPA 4RR5A 5KT3A 4JI3J 4V19J 4P55A 4U96A 2H4WB 2A3SA 3TAMA 3BQ2A 3VSKA 1T9XA 3CNQP 3K5OA 2CUYA 2J9EA 1CJVA 2K3IA 2ZJRQ 5JR3A 1UHMA 4HACB 4LSNA 3GG0A 4FVCA 2GMJA 1JGGA 4DX6A 3OIPA 5EDWA 3F72A 4XBFA 1S1XA 1B8IB 4OZ5A 4ZVQB 5L1IA 3R1LA 3GONA 3QJJA 4MKBA 1WZ2A 4FS1A 2DJIA 3RIRA 2AGPA 3L2CA 5HODA 3JRAA 1XGMA 3X2QH 2ACMA 2DNQA 4BC9A 1N75A 2BYCA 3IH4A 3OR2C 3L7OA 1DTTB 3X1LB 3AQPA 1WWXA 3IAM9 2YQ0A 4LGWA 3KP3A 1YITI 3BR3A 3O5TB 2ZH2A 3QRQA 1IN7A 4CP5A 3J7AY 4YDXA 2J8AA 3KHRA 4A8YA 3O8GA 4EJUA 1T3NA 3FQKA 3C2GA 2KRHA 5C3EJ 1I1GA 2ZM6F 2E66A 5IV3A 1KLMB 2IVYA 3LSRA 5C42B 1QD1A 4X4SA 4BXUA 5DJBA 4M8LA 4K4ZA 3NCRA 4P72A 2EFVA 2IJFA 3GTMJ 4OI1A 1QHHD 4WXOA 5DV5A 4G8XA 4ZYAA 1YJRA 2XGEA 2FEZA 4DX7A 1ETVA 2IVFB 3W65A 1USSA 2PMWA 5B0AA 3K17A 4DUYF 5HLFB 4DPOA 2UUBF 4OI2A 5HJYA 1RAHB 4WTOB 1VOMA 1ZRFA 4LRBA 3KLNA 3GFXA 1D0XA 4JV0A 1XIQA 1V3SA 1YJ9I 4ALZA 2W4PA 4DR7F 3IC1A 4DV3J 2LTPA 1TW2A 5BOXA 2X6WA 3PO2J 2E1PA 2FJEB 3F8MA 1WI8A 1BQMB 2HFUA 4ZP7A 4ECQA 4UUSB 1QNTA 4A3EJ 3HVRA 3PDNA 3KG1A 4Y17A 2XMMA 2Z2YB 4CIOA 1KLMA 2GS8A 4EQQA 3HOWJ 3V8KA 1CQNA 2QA4S 4USJC 2WB1D 3IR7B 5LT5A 1GTEA 2XDVA 2V8HA 1XGNA 3L3CA 3QSYB 1F3VA 4CH0S 1VQPS 1BWEA 2AYBA 4PG7A 4LF9J 1EZZB 1LDKB 3AG2H 5FRNA 2X9DA 3I0RA 4R25A 3BN7A 4WCGA 2ELHA 1XC9A 3JS9A 3HGYA 2ETHA 1AUDA 2ZBRA 4OIRF 5E1XA 3MWBA 3SCIE 1P7JA 2Z2LA 1RK8A 3KEYA 4DL7A 1MBFA 3T6BA 2X1DA 2HKXA 2XBPA 4F3QA 3W1YC 2MBFA 2QYCA 4JI4F 3CD0A 4IQ4A 2ZH9A 2A5WA 1ZAXA 3CQZJ 2B56A 4PXEA 3CUQA 1LEBA 3CJNA 4B4CA 3QWUA 4HW0A 4UNOA 3QGIA 2RB7A 2DTZA 4B08A 2VG7A 9RUBA 2VI6A 2HS3A 4F3MA 4Q45A 4X1EA 1F4KA 2LCWA 2IM2A 3H0DA 1WF0A 2X85A 2NXEA 4Y52J 2OTLS 3QYEA 2IYGA 3LA3A 2Q6CA 5D0RA 1LWXA 1D0ZA 4RJVA 4OX9J 2E34A 2HQRA 2OUGA 1GT8A 2VPXB 2DPIA 2PJRB 2NCKL 1ZH5A 3BSNA 4DV1F 1K4SA 1YJNS 4C3LA 4IOAF 5D5XB 4ED7A 2O8XA 2KPMA 1LV5A 3SI8A 1DARA 4CO4A 5IV4A 4EGYA 2F9DA 3SCKE 2W9CA 4RNOA 1UL3A 2J0XA 1FMVA 2DR7A 3OSGA 1FFGB 5JUMA 2VC1A 4I6WA 4WIQA 4PJ0C 2NS0A 2I1RA 2XMKA 6PAXA 3QIPB 3CB4A 3ZC4A 4CYCA 1M1GA 2HWVA 2ELJA 4RNHA 1MBEA 1H7XA 3DU5A 5ILSA 3WHBA 1UZDA 2DYAA 1R8PA 4IOBA 3BQYA 2C2NA 3W9JA 4OJ1A 4PCQA 3IRWP 3QYBA 4U7CA 2Z57B 3VF0B 4BQNA 2B63J 3KJVB 1P1LA 4TYBA 1JLQB 3KYDB 1U1PA 1VI7A 3B6BA 2XB0X 3I9V9 1H89C 1FOWA 1N33F 3OL3A 3AD9C 1MWYA 3QPTA 1XSXA 4LRAA 2U2FA 3OYLA 3SYZA 3W2WA 3K1MA 3ENQA 2HKOA 3A3NB 3BGRB 1HNVB 4PQAA 3OTEA 2XYHB 3CCQS 3J7ZI 3J81Y 4FPRA 5KFPA 4UUWA 1YX3A 4LUBA 3IWLA 4A0YA 3IG1B 3A1YG 3D6TB 1GXTA 3L4BC 4P2XA 5KT7A 5SZTA 5EG0B 1I1SA 5T41A 3HSEA 4I0BA 4PG8A 4AYBA 2FMYA 1HW1A 2WWYA 1URNA 4P7VA 4LG0A 2YWKA 4OJGA 5HROB 3S2HJ 3ZXWA 4MQ9F 4K0KJ 2HRUA 1MROB 1K9MT 2QEXI 3OJSA 1X4GA 3GFLA 4I0AA 4DSKA 3I87A 1B59A 1PSDA 1VC6A 1EQMA 1UMQA 4B3RJ 1U26A 1TWCJ 4GMKA 1NKCA 3KLFA 4HTIA 1MBKA 5FKOA 4HF1A 3A13A 4HA8A 4QTRA 1S10A 2BJ7A 2HMIB 4CO8A 2KMUA 2ATCB 4NHJA 4DJBA 4LFCJ 3KPHA 1I6XA 1CJTA 3TVYA 3KJNB 5KFIA 5FLVA 4OMZA 3ZQIA 4NLGA 3S3MA 1PG5B 3K59A 3G8TA 2YKOA 1JLBB 2ZZTA 1ON1A 2DNGA 2NXCA 2J0WA 3PSFA 4X6AJ 2CPYA 4XPCA 4KJZA 3U1LA 2GW8A 1N8RT 2FD5A 3WG7H 3FSIA 1WOOA 2VKEA 2KXHA 2E1OA 3S3OA 1XMKA 2L9NA 2NOJB 5HLGA 2BYVE 5ETLA 3KHHA 1ETXA 3REOA 4AYBN 1VQSA 3HF5A 1B0TA 1H98A 4XN3A 4QR1A 2JSXA 2ZMEA 3LGMA 4DR1J 2JFKA 3O1LA 1L3KA 4Y3OA 4M5DA 4F67A 3E6BA 5DEQA 3AXKA 3B8HA 1SKSA 1K7AA 1ZAOA 3I4PA 5ICEA 5LGTA 4XLPF 3DMJB 2BJ1A 4KRWA 2DKOB 3M4XA 2MD0A 4C9YA 4CA0A 2HHQA 1FKPA 5ICGA 1RUSA 3KYLA 6FD1A 2KQRA 2AXTC 1WG4A 1ZS6A 4CZZA 1WI6A 1TFWA 2I9SA 4F02A 3Q0UA 4K2JA 3IM9A 1ZM3A 3WODF 3S1RJ 4V2FA 1C0WA 2VC0A 4LF4J 5IC6B 2RDPA 3KLEB 3D5MA 3LQRA 4F92B 7AT1B 4C8YA 2LY1A 2RVJA 3RRHA 2L2OA 1VLYA 2HXIA 4PR6A 2NSCA 4RB1A 4PDKA 2HU9A 3HDDA 2ACJA 1SL1A 3HPHA 2N7YA 1FFWB 1ELOA 2VE8A 4IHYA 1SL0A 1Z67A 2OI2A 1WJEA 3SXLA 1SV5B 1DQUA 2Q0OA 3EVMA 3C6UB 2J6SA 1TL3B 1GV5A 4M95A 3KOAA 2XGXA 5F0HA 2VPLA 1VQKS 4NLTA 1I3QJ 1HNXJ 3RKYA 3OSFA 1SJRA 1H2VZ 1BGXT 4OZJA 2MLGA 4ASNA 4NL5A 4RUAA 1EETB 5L3BA 5LMUJ 1EV7A 1VQ6I 3TX0A 1VYAA 1VQ4I 4U0VA 4F4XA 1JUPA 5I3UA 2FD2A 3FDYA 1IRXA 2ZZNA 2ZE2A 3AG4H 4LIVA 5AXMA 4Q43A 4EO8A 4MNUA 1MDMB 3QATA 3BN4A 4ZK7M 4YIFA 4BCAA 4A8WA 1RWOB 2MQ8A 4KMFA 1WTBA 1HARA 4CCMA 4OYBA 3PIOQ 2VJJA 1P1TA 4G6TB 4B9VA 4BDPA 2RAQA 3HKZA 4BC7A 2UUTA 3ZMVA 4F7VA 1HQUA 4DSIA 3T5LA 3M1CA 2Z58B 4WE1B 1RSCA 4GRIA 4NLDA 1SVMA 5E1WA 3MZIA 2YR2A 2EFPA 1GHCA 1OSDA 1TVRB 1DPRA 1SH3A 4O23A 2KFYA 2BOPA 3W6JB 3G6YA 4LITA 3CC2I 3A8EA 5E7OB 4S05A 1XG1A 2CAJA 4PJMA 4Q5SF 3OLAA 2XLJA 1TUVA 4LR8A 2W57A 2FY1A 2O3FA 5GADJ 5IOYA 1JTYA 2I5JB 2VJ5A 4DV5J 2LNBA 3E5UA 2FLOA 4A12A 4A6EA 2MH2A 3HRUA 3EJMA 1X8DA 1U6ZA 3DBHB 2ZJPF 4ZMMA 2ZUGA 2X1EA 3LWMA 1WH7A 1U9NA 4RAGA 3EDPA 3CC4I 4ZN1A 5DRKA 5KFBA 2X51A 2ID3A 2DR6A 4IHXA 3M8FA 2O3DA 3LANA 1Q1KA 1W1WE 1BR1A 4WX9A 1NK4A 4D0PA 1TLHB 4BYYA 3EYZA 1F9HA 2I38A 4ZDPA 3M6UA 2W01A 4WTYA 1P8GA 3TANA 1QZZA 2NRAC 3GILA 3D4JA 4JI6F 4XDDA 2HBRB 3HPGA 1N78A 3NOCA 3EXYA 2Y9HA 4O5VA 3ENVA 4KKOA 3WQPA 3FISA 2LRDA 4KV8B 1APLC 4F4YA 4QWEA 4ECUA 4X4RA 3BG6A 3I71A 3LP2B 4D9JA 1R0BG 2GX8A 1OQYA 2D3O1 4DQ2A 1VF9A 3G1LA 1N5VA 1R23A 4DJAA 3CCLS 3PO5A 1BBYA 3CMQA 3B02A 3UQSA 4FYVB 4RGRA 1RABB 3FRYA 3EUHA 2CJKA 4ZVOB 3VHQA 1FIAA 3VGUA 4BDYA 4WFYA 2VJVA 2P9EA 1VQLS 3U02A 1T3OA 1JT0A 2B9WA 3H98A 4RL1A 4V19X 2VQHA 3DWLE 2CQ1A 1N25A 4BHQA 3CCVI 3HVTB 2DAOA 1Y3KA 3TRGA 1RA6A 4F4AA 3AD8C 4DV4J 2DU9A 3TP0A 1V9OA 3OBIA 4R5PA 3FZBA 3RB4A 1UP1A 5TGTA 3J81Z 5K7ZA 3RBXA 1JXLA 3CULA 2BMBA 1IBLJ 2ZD1A 4EUVA 3IS9B 1J9IA 3QPHA 4XONA 3NNAA 4YN3B 1FKAF 4ED5A 4DYCA 4OYXA 5EGOB 1WDDA 1WHYA 2M4KA 1SJFA 5H20A 1WKLA 2AX0A 2QX0A 3ILJA 1TELA 3OVAA 2PMZD 1K0VA 2Y8YA 4LR9A 4V2GA 3DLLQ 5GAHU 1NKEA 2AGQA 5LXRA 3TGNA 2CWEA 1KEKA 4WBFA 2Q8KA 2JRMA 3R6SA 1OYEA 2RQKA 3E01A 4PJLA 3JB9k 4EV0A 1HR0J 2D74B 2J5AA 4RW4B 3ZNUA 1VQNS 3K4NA 3BO4A 2CQ0A 3R0AA 3DGPB 4F4ZA 3T3FA 3PVXA 3CUNA 4ILRA 2J7WA 5IT9Y 2D7SA 2UXCJ 1FDDA 4BQQA 3KLEA 3MAAA 3TI0A 1X31C 2KFDA 4EMDA 1V3RA 1OO0B 2DYSH 3RB3A 1FTRA 2YBVA 4ED0A 3R2DJ 5HN0A 4JV5J 1KQSR 2E1MB 4ZTJA 1SD6A 3I0TA 1YSJA 2BE5F 2XF6A 1VQKI 5HLTA 1OQ3A 3W61A 1NZAA 1RT2B 5F0FA 3DQVC 1XQIA 3CJ2A 5EYRA 4DBQA 2RDJA 1H2UX 1L3VA 3AG3H 1AB8A 1Q8IA 1Q7LB 1Z2ZA 3POTA 4LIWA 3U27A 2M5YA 5KOWA 1TWGJ 4AVPA 3FSYA 4WP9A 3EMTA 3P3DA 4WP8A 2ZWOA 3CJ5A 4QIWD 3M2UB 3H20A 1J5YA 1Y5NB 3I58A 3ULHA 2VT2A 2RNGA 2RQCA 3MMBB 5E3CA 4PUOB 2HVDA 4Z7YA 5EX3A 1FX2A 1KR4A 5H9FK 3U21A 3F44A 5EZHA 2OAUA 1PGZA 1Y0UA 2GQCA 4OIXA 1K1SA 2HNYA 4C11A 3GCMA 1U6FA 3QU6A 1IDZA 5H9EJ 4ZHRA 2OBPA 4XNFA 3C19A 5M3FJ 4C3HJ 1DLOB 1SIZA 2O01C 1KQFB 1HPZA 1HPZB 1SKRA 1RTDA 4PYAA 2LDUA 3C15A 4ZC3A 2L9VA 2L9DA 4JYAF 4CCJA 1YWXA 3DKWA 3K1NA 2MHEA 1F1BB 4ZA1A 3QRFF 3FBNB 5GTIC 2CV0A 3MVPA 4QIGA 4RS8A 3CJRB 3C14B 4KFBB 1LE8B 2GVDB 3MM5A 2DW4A 1KQ9A 2GO8A 1ZREA 4FVMA 5IM0A 4E6KG 2QLFB 3KETA 4X66J 2NPFA 3V4GA 1AU7A 1SC4B 4JOUA 2DY1A 3GTJJ 2BV6A 2R8JA 3EUHC 4QQBA 2YKAA 1LUJB 2PMHA 2XMVA 5LXYA 3M8RA 2ZC2A 4J7CA 4NPOA 4DUTA 3QZ7A 2FXAA 5FD1A 1IR2A 3TOQA 1G4DA 2XZTB 3K58A 2I8DA 5MLCV 4CLWA 1DDNA 1IXSB 2LEBA 4KMUX 1A6QA 3FCWA 3AL0C 2XY7A 4DX5A 4GVBB 3EUAA 2IGNA 1VRTA 1IXRC 3CPWR 1TL4A 4HTJA 3RR8A 3FFIA 5LBQA 4F04B 3R1HA 4MH8A 3MOZA 3W8PA 1A36A 1X4OA 2WADA 1IM6A 2F8HA 1FX4A 1QVFR 1G7CB 4Q5VA 1XMAA 4AL6A 1VFCA 4ESJA 1XMQF 3R60A 3CLQA 1BI2A 4X2BA 4E0DA 4RAFA 3M6VA 2Y1LB 1D3YA 1XB4A 3HYIA 1YIJS 1UFWA 4N47A 4AL7A 2DK2A 3MCOA 2R5YA 2D3OR 1A7GE 4MFEA 2LQBA 1OPZA 2DEJA 3SZGA 1Y1WJ 1QRYA 4Q47A 2F5GA 3BTIA 4U9RA 3LGHA 5HLFA 4PWDA 3GTYX 2GWRA 1UAWA 2MABA 2BANB 3Q86A 3HXLA 1V5IB 1VQ9S 2HVSA 2PMZN 1WEZA 2XMJA 3F3XA 2K3KA 1G3OA 3DCFA 4DN9A 2H54B 4TYAA 2YKNB 4LJZF 1N6QA 1EF4A 5DS9A 3MM7B 1ZLJA 3RW7A 4ES2A 2EFNA 3P8BB 4I7FB 1OS5A 2I8EA 2ATLA 1JLAA 3A4TA 3TP3A 2XMTA 1H8AC 4ZOSA 1P4WA 1EA3A 4N56A 3OS2A 2P5KA 4ECRA 2R8GA 5HBMA 1AUSL 3K7RA 4CLSA 1ULYA 2KIMA 2ZBKA 4IG0A 1U1NA 4A3CJ 4BBSJ 1GVJA 1E6YB 2EFWA 4K4WA 3DEUA 4G6VB 1V55H 2JVOA 1IF1A 4O44A 5IWAJ 2GIRA 1JB0C 3SEOA 2DA5A 4ZS6A 3W5YA 4A8FA 3CJ0A 2R5ZB 4O44B 2HHUA 5LL6d 5G0RA 4URGA 2EKYA 1JKOC 1NPKA 1OQ6A 3IGVA 5F64A 4KQZA 3CJQA 1RDRA 1HBMA 1GNKA 1K8AT 2VFRA 3BG5A 3UW1A 1BD6A 1R3NA 3CJKA 4G1QA 1HNZJ 2MC3A 3E6DA 3G6ES 5LFAA 1GTHA 2UV8A 4CQ1A 4JI8J 2W4SA 2R7ZJ 2DNPA 1OY9A 4JI2F 1AA1B 3WHCA 1RHRB 1X5TA 1K4TA 2VH7A 1YE9A 3N6NA 4LSLA 2ZJ2A 3O6QA 3V7CA 5EUHA 2VT3A 4NRTA 4Y2MA 5M2PA 4I6YA 3OTBA 2CMPA 5HMYA 1K61A 1DP3A 2XAGA 4I4BA 3KIOA 2X4HA 2VZ9A 1MJBA 2UVWA 4R8HA 3OL8A 2YU3A 3MF5A 1X4CA 4R0EA 5BR8J 4P7TA 1XC5A 4WXCA 3DRRA 2LU2A 4LT6A 1AXQA 1Z9CA 3GO5A 1HBNA 2LMIA 1P2FA 1VQ5I 2ZXHA 4NMXA 3Q8UA 5E20A 4CNYA 3TZXA 1Z0XA 3F0CA 4RW8B 2QSGX 4XLCA 3J81K 5TISC 3OFEA 3VYUB 5JVGQ 1U02A 3R5BA 1DGRM 1NO8A 4EYIB 3TARA 3K70C 1WG1A 5F8GA 3J81j 4XKBA 3S8PA 3L95X 2XGCA 3DOKB 3TO9A 3LAJA 1U2FA 4LQ3A 2EK6A 1L3TA 1WHUA 3ZQQA 4ZKAA 1OISA 1Z7LA 2WBMA 3K2ZA 2V50A 2EBIA 4AD6A 1GXQA 1MROA 1STZA 1GK8A 1GAOA 1XN9A 3DDKA 4ETZA 1R43A 4K4YA 5M5YJ 2XRNA 1HBUB 3HHNB 2BVZA 5B09A 3MZHA 1I94F 3AKZA 3B78A 1X4BA 1TTHB 3TMOA 3Q8YA 1M1KT 4KHMA 1QHGA 2MKJA 3JSMA 1WSRA 4KA4A 4YB7A 1JUMA 4RGXA 2VB6A 5HNFA 2CKWA 1T9UA 3BV8A 4PXBA 3MEGB 3CO9A 4PYDA 4E7KA 4CLTA 3QYFA 1G3SA 4DZPA 3CF2A 4PUSA 4B3SF 2JC1A 3ZP5A 2JVHA 3FNNA 3HI9A 2LFBA 2RHSB 4DX8H 2HYIB 2X6XA 3SCLE 4RO0A 4Y34A 1ZBTA 2XASA 5TRDA 5C24B 4KR0B 2AJFE 2XAFA 2MKHA 3E6CC 1S6QA 2M34A 4M3BA 2HNDB 3H9QA 1FK9B 1ZA2B 3NLCA 4UZCA 4FHTA 2ZJQF 2P5VA 1S6PA 3KE2A 1F6TA 4ZIVA 1J2VA 1IBKJ 3OVSA 4DSEA 3HT3A 2I5UA 1FKPB 3CSKA 5KFQA 3LSKA 3J7YU 2OTJS 4AD9A 1NG6A 3RRGA 2FLNA 2G1DA 2R4FA 1FX7A 3TOBA 5GAHJ 1LFPA 4I6AA 5T7LB 3ZCOA 4U0WA 3NWSA 1YW7A 4BXXJ 5CCMA 2X1BA 2H27A 3SFZA 1ODDA 4FBTA 2CZ4A 3DFGA 4F55A 1NB7A 4UQGA 2HVQA 3ZQGA 4DQSA 3FKJA 3K5LA 4GO7X 2WVBA 4HYKA 4KT6A 1ZTTA 2E5LJ 3C1DA 2HAIA 3M07A 2PEXA 4EU0A 4XQFA 1D9AA 3IGNA 3HSJA 1HNIA 2L9RA 4OIQF 3W2AA 3C46A 3BLYA 1VK8A 5D4SA 3WE2A 2QKMB 1CULA 1QVGR 1G2HA 4UOGA 2G13A 1FEEA 1YRUA 3B4MA 1V4RA 2JOQA 4V1Ak 5K5QA 2FC8A 2NR0A 2PO4A 4ZLLA 4RWWA 1REVB 2G0EA 2YX7A 2VG5B 2M1BA 1C4AA 1J7KA 2A6OA 4FQGA 1RT4B 3DV8A 2R7UA 2CS3A 2IDEA 4LD5A 1LXNA 3RDIA 4DPYA 3F8NA 4GYGA 3CCUS 3TP2A 3N4MA 4DLGA 1NTCA 3MAAB 1S5ZA 4Q2MA 4NEYA 3CO7C 2AYEA 3L09A 4CM2A 1SAXA 1WJ9A 1YHQS 3RKXA 2DD8S 2ZBPA 2OEMA 3MURP 1H7WA 4RLEA 1S7EA 4FE7A 2DR8A 2A10A 5IS2A 5KFKA 4DL6A 3KZYA 2H6BA 2CIMA 2O5DA 4W90B 3QT7A 4E2FB 1R31A 1ZPVA 3SSQA 2VLAA 2L4AA 2XSDC 3KZIC 2JEGA 4OMFG 4QLCU 5SUHA 3D3CJ 4HLYA 2KFNA 4WP3A 4ZPWR 2HQDA 2N8GA 3M32A 1YJTA 3MR3A 3I5CA 3N28A 1MBJA 5KFMA 2CNNB 4NLWA 2K8GA 5DDPC 3LOCA 3JRCA 1FNMA 2ZKTA 3E2EA 4LOCA 4LF7F 2Q66A 2IM3A 1RKWA 1C0TB 2AGOA 3S6EA 3MCSA 1OSCA 3NARA 4G65A 3DRPB 4YFUA 3BY6A 2C2RA 4Y6IA 4YEAA 1UEVA 2H94A 3FBBA 2UUZA 1PJ6A 4AWXB 4QPQA 3KUEA 1QSYA 3KP2A 3NG8A 4K5SA 3FBEA 5DDRC 4DR2J 5A2QU 4ECTA 2QMWA 3K70D 3DHWC 3KXDA 3E0JB 3GU0A 2R3VA 3MD2A 4B3OB 4OAYA 4X4PA 4M6XA 1FNXH 5DDQC 2JFDA 1CS4B 1ETQA 3LSPA 2H65B 5LJ3Y 2V67A 3D2WA 1IQTA 2YWHA 4EATA 1X4DA 4LF1A 2J9DA 4MLOA 1ETWA 2JWTA 4Z37A 5DDGA 4A8SA 2YKMA 2AJQA 1S59A 2KHCA 4ZVRB 1W7PB 3HOSA 3HRTA 4TLRA 4OI3A 2M2EA 4GGGA 3SQGA 2XI2A 1N5TA 1M5HA 3BR5A 5FLXZ 2H4YB 1R1VA 1QUVA 4XRFA 1RTHB 4WYLA 2M88A 1U25A 3LWFA 3MMAA 2CRLA 1FJGJ 3GJSB 1PAUB 4ESFA 2KHDA 2W7AA 3GXOA 2V4JC 4XLEA 5J4YA 1ZZFA 4CLFA 2DMPA 1Y8RB 2FX0A 1TMMA 3I4HX 1YW9A 2DHSA 3DRSA 1IV8A 3EVWA 3PV8A 2DQRA 1KTVA 2QVOA 1QQIA 4OLOA 2BY1A 2OD6A 3RSNA 3IN5A 3ISPA 2Q43A 1XGOA 3HHLB 3C16B 3QRRA 4N4OB 4J9UE 1AOYA 3LH2S 3GSDA 2VBYA 1YLFA 4Y7NJ 3TR5A 3V2UC 3BGOP 5K8OA 1J09A 2RAEA 2Q79A 1S7OA 4B3XA 3NMAA 5L1KA 2V1DA 4IRDA 1NPPA 2QLJB 4KICA 4XR6A 3UNGC 3T9NA 1QBJA 4KB7A 2HOSA 3TVKA 3DOLA 1Z6RA 1GFWB 4YQWA 4PJJA 1UFKA 3JR9A 4IDKA 2WAQN 4AVZA 2X3DA 2YS9A 3H90A 8RUCA 1YRNA 3GLXA 2CPDA 2DOFA 1FDNA 3V4IA 3MM8A 1FTCA 2MC4A 1AYEA 3WTVC 5DETA 2XWYA 5CVUA 1FRIA 5L3DA 4E70A 4NYZA 3D67A 2DO7A 2P0WA 5BYSA 2YNFA 3CDEA 2KJBA 2NXNB 3VAIA 4A3MJ 4B3AA 1RAEB 2M5WA 3MECB 3E8OA 4OYPA 1BUXA 4LLLA 2DFFA 2KG1A 4BBYA 1HHSA 3H0GJ 3HHGA 4Q2LA 2JA8J 3AB2B 2BJEA 1NK2P 3PHEA 2QE5A 2L4MA 2FVSA 2A5YB 2MD5A 1JX4A 2QLZA 2KT3A 4HT5A 4UV9A 3CIZA 1REPC 2L7FP 3TO7A 2KP6A 3OHBA 1ZTWA 1CQMA 4R8UB 2MZTA 3H40A 1YJ7A 4F2RA 1D1AA 3ILOA 8ATCB 3S14J 1YYVA 3IV5A 2LDIA 3BTLA 3V6DA 4ESBA 3CMMA 4YFNF 2CNLB 1NK6A 1EP4A 2VJ4A 4AIDA 1AA7A 4IKFA 2M45A 5ETNA 2GNKA 1BC8C 5C4XJ 1FRLA 3ZOBA 4H4KA 3ZMDA 4JI0J 2KDOA 3DKXA 1YO5C 1UWBA 1IJEB 1IWAA 3O8HA 4B3TF 1LWCA 2PI4A 2WONA 2EVZA 2QL5B 2IRUA 2YQ3A 3SBMA 2Y9ZA 4WXWA 4P71A 1N4LA 2LBFA 3TEGA 2V6EA 3OTOF 2LBFB 4HBLA 2XM3A 4KHPJ 1HQCA 1X4AA 2V9KA 2XPWA 1NPRA 2V4RA 4F25A 4USMA 2RS8A 3I59B 2JPCA 2YKQA 3EGVA 5DLFA 3KG0A 4HDHA 4BEHB 2YNHA 2K7LA 4CTAA 2HW3A 1TZLA 3ASNH 2LQ5A 1GX6A 3VZIA 2E7XA 2K40A 4EBCA 1V3ZA 2MSYA 3R7BB 1HD1A 3BR0A 3R61A 1RU1A 2CW7A 3R9LA 2OLWA 5GMKa 3N6MA 2R7TA 3DLJA 1QPMA 1N36F 2WW4A 5KFLA 4J19A 2N7CA 4Q7AA 2ZDOA 2RJZA 1G6BA 4G6DA 5GMDA 4OHYA 1ZN2A 3IKVA 1G2EA 3J7AO 2HBQB 3HRMA 3OHAA 2PT0A 3NBPB 4GRSA 2XAUA 1RADB 2UXDJ 2RNJA 5KFXA 2HQCA 3JSRA 1KVKA 2LKPA 3HHKA 5T14A 1XCBA 2CPFA 4N5SA 2H51B 2WAEA 5KFYA 1X0PA 3G73A 3NGKA 3I55S 2LU1A 1J5EF 2KRCA 5LGNA 3MMYB 3LP1B 3KK1A 1NDCA 1TKZB 3Q0AA 2MH9A 3HVTA 3K8VA 4DPWA 1RIOH 4Y2CA 2KXNB 3DLLF 4RNFA 5KCMA 1YG2A 2WVFA 4Z2XA 4TVAB 2A2CA 1YS6A 2OZ6A 1WKJA 1TQLA 4PGGA 2OIHA 1M5SA 3A8KA 4NA3A 4YHHF 2FZGB 2E7VA 1OYYA 5CLSA 4RWXA 5HLHA 2JJ4D 1EH6A 2DMUA 1TFYA 2FLLA 3CCYA 4L9JA 1AFIA 3DTEA 2KZMA 4BJTA 4K4SA 1JJHA 3N0VA 5EZGA 4ANCA 5M2UA 4ER8A 2O7OA 1OFCX 3P6YC 3RYPA 5LGUA 3IH2A 2DEIA 1WORA 2BE2A 2DOEA 1HA1A 1W7PD 3RAXA 5LMUF 3FQLA 4EVIA 4CO0A 2GQ2A 2PJPA 2FYXA 1G3WA 2VD3A 1IGNA 3DRXA 3K10A 1U8BA 1RI7A 4F50A 3W5XA 3KLIB 4WFAQ 5DZ6A 2C2ZB 1LNQA 1OR7C 4P9SA 2D1HA 2OELA 4M5LA 1QAIA 3M8YA 2IVMA 3KX2A 3L9FA 2EJRA 1RWNB 3SZTA 3FBFA 3SDEB 2XCAA 3D0HE 4IFYA 3M8PB 2OMOA 5DZ7A 1WNEA 5F0CA 3MCNA 1J5OB 1KZHA 4MTEA 3MR2A 1R6RA 2XTJP 1U1LA 1RU2A 2E19A 2BQRA 1L3SA 3JW4A 2E2JJ 2B51A 1OCZH 3D0SA 4C2TA 4N77A 4C0BA 1YVFA 2DJNA 4XORA 1XTAA 3G96A 1ZM4A 5EGOA 1ULRA 2M8EA 3SIPB 2CQGA 3FXLA 3LSHA 3AB4B 2V8PA 1QLNA 5KT2A 3GR1A 5KT4A 1B6AA 3OPKA 3HLUA 1HOMA 4KGMA 1IDYA 4KO0A 2DRAA 1IAWA 1PBAA 1YX5A 1SJQA 2JLGA 2UXBF 1RE1B 4TY8B 3W6KB 1TQMA 3EUNA 4JI5J 4NB5A 1KONA 3BSOA 4QU7A 5FLXK 2HFNA 1X1AA 4DV1J 1OKRA 5E8IA 4WWSA 2HYJA 1RR7A 1IN8A 2K86A 3G71I 2WOMB 3MCMA 2B6AA 3ZPLA 3GJRB 3T1YF 1WSVA 5K8MA 3FF5A 1PBUA 1X3WB 5E2QA 2ZH6A 1Y7PA 3L9ZA 1MNEA 1JJ8C 2JMWA 3BB5A 3GWCA 3MXHP 3JSOA 3K57A 1ICEB 3TEHB 2XAJA 1S1WB 2DA7A 1WHXA 4RW9B 1TKZA 1U3EM 2L7ZA 2MKIA 1NRKA 2GJ2A 2WHOA 5IT4A 4RBOA 5THWA 2ELKA 1KFDA 3E6MA 4NYPA 3V7SA 1UVKA 3CCRS 5CCLA 2EFGA 2EZLA 2PMUA 2BXJA 4FF3A 2LVSA 2I0XA 3GTOJ 2KO1A 3DN9A 4HHHA 3OR1B 4EJOA 5F1JA 2JRSA 1EH8A 1HYSB 2IM1A 2I10A 5KG7A 3ECOA 3L2RA 1U7LA 3ZZYA 2IA6A 1LB2A 4NQWA 5E8GA 1SKUB 3PHTA 5L9XA 3RZAA 1PUFB 2L9SA 3BR6A 3CDUA 2F4VF 1GVDA 4XMYA 1IR1A 5BR8F 2W9BB 2CQPA 1FSEA 4HV5A 4BJ6C 3NCPA 3CZ6A 3RRKA 3ULQB 5HVHA 3FXQA 1U1MA 2LMDA 2G2YA 3I5BA 4P5OA 4DV0F 2AEMA 3S1MJ 3T41A 2EKNA 1ZR4A 3CWJA 3UNYA 2VQFF 1FJEB 2K4JA 5BYQA 4ED3A 3M6WA 4RAZA 2K06A 2G9OA 1W4MA 1S9GB 2IM0A 3LP0A 2QYOA 3NEUA 2D9PA 4I09A 3FBIB 3JRBA 1FRMA 1NK0A 2UUAF 1B70B 2FC9A 3HM9A 1NLKL 1RWPB 4OYMA 1ZRCA 3JSMB 2MA3A 2HS5A 4O3QA 4DUYJ 3PIOF 2P8TA 3KLGA 4UVAA 2JEFA 5KK1A 2PFBA 4U7BA 2NZCA 1TL8A 5E3AA 2M9KA 2DDAA 2RKIA 3JTOA 4QSHA 4DIQA 4Y0FA 3WX8A 3MTKA 3IL2A 1OLTA 1ROFA 5K8NA 4HPQA 1U8WA 1I94J 3PIPQ 4M6YA 2JA5J 2LDYA 5EF6A 3PRDA 2XG8A 1TK0A 3H8YA 3H2LA 1PO6A 3WBZA 4KJIA 5HS9A 4KIBA 2F2EA 2N82B 5AE1A 2VKRA 3ETMA 4U6PA 5DO2A 2QQ9A 2X7IA 1MG7A 4K4XA 4LFUA 1T94A 1KGSA 2V8GA 4S0HB 1FWKA 4USHA 4WJBA 3OYBA 1XDUA 4PAAA 3LQVA 2HRTA 4M9ZA 1NB2A 4CO2A 1MU2B 1SJ4P 1MNMC 2WK4A 4E4HA 5EJCA 4U88A 2GXGA 4HOBA 1IN5A 1A04A 2NXNA 1CS4A 3D6FB 2F5VA 2ZITA 1XDSA 3M8WA 4C4WA 3CMAI 3BO3A 2HR3A 3GLLA 4NLYA 2QF7A 2E5JA 1Z3YA 3ICLA 3R2CJ 2DNRA 4DL4A 2RV8A 2HLTA 2IA0A 3K0LA 1VC0A 2OPSA 2OPSB 3K4JA 2V4JB 1IJFB 2IA1A 1RWKB 2OPPB 5F0UA 3ZTRA 3OYAA 3ESWB 4PEOA 3IH3A 1EHWA 2XSJA 1FNOA 2GV1A 4LIUA 1Q16B 2KZZA 1YTYA 1T95A 1FERA 3F6OA 3M9AA 3EGWB 1S4EA 1CG2A 3OT9A 2V1NA 1OMIA 1TWHJ 2E5HA 4C9DA 2VXDA 4II2A 1YJUA 5A2QZ 3HOVJ 2QCOA 2JWNA 1LQ1A 2AWZA 1LWFB 4XRMA 3CMES 4W1UA 1LWCB 2VN2A 2ISZA 4CLLA 5FGMA 3F8CA 5JI6A 2MQPA 3GTGJ 3A0HC 3RYRA 2QT7A 2CQBA 1TKXB 1M5KC 4L5JA 3P4UB 4UZBA 3RBZA 4PJNA 3J80U 2VODA 2P2CB 2E9TA 1RT6B 4HYEA 1TUWA 4UY8T 3BSAA 5GAHI 3OS0A 4ECWA 4B3MF 5GP9A 5FKKA 2LA6A 4LB6B 1AFJA 1URRA 3BG7A 5E3MA 3K4MA 4G7ZF 2F5CA 4YR0A 1Q1VA 4Q48A 2YKNA 1FXRA 3S1QJ 1JLBA 4RB0A 3RB0A 4C3MA 2FMLA 2OTLI 3QAEA 1NJIT 1MH4A 2W2MP 4ECYA 3PX6A 3H3VK 1SMYF 2N3LA 1MMLA 2LD5A 3QQAA 1OIAA 2D1CA 1S1WA 5HMZA 4LFBF 3J7YI 1ZTRA 5M2RA 4D7MA 4HNTA 5E3LA 2A18A 4I2QB 4ZLNA 2OF7A 3WTZA 2DCEA 3V81A 4AE5A 1HLVA 2VHGA 2FVCA 1PC4A 3BH7B 2DT5A 2YNGB 5H2FC 1RT7A 3GCWP 4CT8A 3EM1A 2XS2A 2ISYA 3GZ5A 2OA4A 4G1PA 2B0LA 4HI2A 3JXOA 4JV5F 4DQPA 2MZ1A 1VQYA 3C6TA 2FGOA 5BNGA 3T1BA 5KFFA 2C2DA 2Y0SA 1JLGB 1YX2A 3MEEA 2MZQA 3S01A 1HC8A 2R92J 1UPMB 2V94A 2CQIA 2PC6A 4JBCA 1B64A 4MTDA 2DNKA 4B17A 2R9LA 1J5OA 1RKJA 3M1VB 4BDZA 1VQ8S 1VFJA 4DV6J 2ZUAA 1RHQB 1A35A 3ZZUA 2AHQA 1XNQF 4EZ9A 4I7HA 4D3GA 3I54A 2G2ZA 3BEGB 3NOGA 2R4GA 4H0EA 2MJNA 2NUUG 4KBIA 5EDNA 1NU4A 4WF9Q 4LK1F 3NAUA 3H5SA 4Y00A 1GXPA 5FD5A 5JHFA 2BY0A 2KLOA 1KU3A 4O3NA 4LRDA 4ECVA 3AJ1A 3KLIA 5AE2A 2M3AA 4YY3J 4K4TA 3OR2B 1GV2A 1U2RA 1E17A 3EPGA 1BQNB 1WQ2A 5T7LA 2BBEA 4XICA 3ZQ7A 1VS3A 1SCJB 3TKYA 4RBTA 3JRDA 1C2PA 4P9FA 2C1EB 1WJBA 5KFZA 8AT1B 3HPOA 4CYDA 2M8DB 4B9UA 4U8YA 2UV1A 5F8IA 4ID5A 2KXFA 3IS9A 3HD2A 3GQCA 4IZZA 3TUIC 1VLOA 2WVCA 1DLOA 3S15J 2LKXA 3CDAA 3M30A 3ZQLA 1TMJA 2Z9OA 3THPA 2GHPA 3Q5FA 1HI0P 3H36A 4F4WA 5EEAA 3J7A1 4A3BJ 4CXFA 4DLEA 3RJMB 4IR1A 3PCOB 3I0SA 1B99A 1I6JA 4HH1A 4GKKF 2BUNA 1RRJA 4OIPF 2DRBA 4ZCMA 1JWWA 2EIKH 3I4MJ 2X1CA 5CYJA 2DQLA 1UZCA 4CYUB 2XS5A 4OYWA 4DZ6A 5JXSA 1NHAA 2JC0A 4MIWA 3DRYA 3CCUI 1GH8A 2ROPA 1SD5A 2DGXA 4FF1A 3PG9A 1NK8A 1RCOB 4RW6B 3PY8A 1Y1VJ 2KN4A 3HHLA 3J80K 4M5MA 1HNXF 1KDNA 1D8KA 3ONQA 2O0YA 2P9GA 3DNCA 2Z33A 2Z8QA 1WKKA 4EI2A 2HHTA 3KEOA 4I02A 1HDPA 4Q4ZF 5J1RA 2V79A 1GQEA 1P9YA 3DXBA 2F65A 5A2QY 3NS6A 2IXSA 2IJLA 4IRCA 1UG2A 5CQEA 6AT1B 3K89A 3IHUA 4KGVB 3EWGA 5D8LB 1P4AA 2RKHA 2UXCF 2B8PA 3BZKA 3PM9A 4NYOA 5DS7A 4IXAA 2Z30B 2H8RA 3I5AA 3R5DA 3NQOA 3HOYJ 5JVHQ 1Q78A 2IGMA 4EJTA 4C8LA 5GAEU 5FIIA 5ETQA 4IEJA 3CVKA 4OI0A 3OR1A 3OFFA 2MKYA 1QAXA 1KYWA 4ERDA 4UUSA 1UCRA 1GXLA 2GCFA 3T5HA 1HBMB 5CHCB 1S29A 1IG7A 2O03A 1N77A 3GJTB 2RU3A 1VJWA 3L1PA 5KG6A 4K59A 4USVA 4FPIA 2CH0A 4MEXF 1MSFC 5L1LA 4N41A 3GSIA 1T38A 1O3TA 5J4VA 1H2TZ 5FLXY 2F6CA 2FJAB 3VSLA 1X5PA 1O6XA 3QNWB 1Z1DA 2LYCA 5DGBA 1FPQA 3PKYA 2MKSA 2FVQA 3K2YA 2YNGA 1JLEA 1LWEB 5RUBA 4Q8EA 3QWPA 3TUPA 5E3NA 5L46A 4PRFA 1EAYC 1BW6A 4M6VA 4J9SA 1HQUB 3L2QA 5CD4A 2HKEA 3HOTA 1FD8A 4OHVA 3RPUD 1JHHA 4DV5F 1N6QB 1RBOB 5FROA 1S7AA 3LPYA 1RT7B 3Q3SA 1EKSA 2C3YA 4BKXA 3TVZA 3T9ZA 4QWBA 4M94A 1S1VB 5F8LA 4OQJA 5J8FA 1NHUA 3D3BJ 5DQIA 3W3SA 1U1KA 1G59A 2W9AA 5EEHA 3U1NA 1RHKB 1D5VA 5CKTA 2CQQA 2M4MA 1Y00A 4TQSA 2C3UA 3MKLA 2OEKA 3BKFA 3PEHA 1R58A 1JJCB 2FB0A 1LVKA 2WAQA 2XAHA 1R6YA 2MLKA 2IT0A 3CJ8A 1K6YA 4PQUA 2WONB 1UA1A 1FOXA 2HMIA 3ROUA 5HAOA 3WGHA 1FRHA 5L38A 3V4IB 3HJFA 2HDDA 2P7CB 1KQ0A 2E5NA 2G0CA 2WY8Q 3KP5A 1XPXA 1FO1A 4WFNQ 4EJWA 2EH3A 5BQTA 4OJHA 5CYMB 3DLBA 4AIKA 9ANTA 2AXLA 1FK9A 4Q0BB 3CP8A 1X4PA 1RBLA 3Q9SA 3IMQJ 4HRIA 2EZIA 4W4MA 4Y15A 4C97A 2DFHA 1NHVA 1VQNI 4LFAJ 1VMBA 2J0QD 4M5JA 1WC5A 1B9NA 1RT5B 2ZNZA 2E44A 3EDRB 4RU9A 4BL0B 3NEKA 1FCAA 2MQLA 1UG0A 4LMYA 5LRSA 3UDLA 2G4BA 1QAJA 2DA4A 4RB2C 3PYEA 1HLWA 4DQRA 4PGHA 2E1NA 1MBHA 2QUFA 2CWXA 1K0TA 3PACA 1DRZA 2YKMB 2U1AA 5FDLA 4KIGA 4B43A 1F9NA 3Q89A 4PWDB 1JUSA 1EX8A 2BJ9A 2HQFA 3A2KA 2A6MA 3VB2A 2VF3A 2VV5A 2OPPA 1UVNA 2Y30A 3P9CA 3CMYA 2NVYJ 1I39A 1TU0B 2R8HA 2B7CB 4OZ0A 4BQOA 1RWUA 1NSKL 2D1VA 3GB0A 4P96A 1X4EA 1R8BA 2LQ8A 2ZKZA 2XKPA 4AXJA 1S6OA 2BOAA 1ZKGA 4Z6YA 5HI7A 3WTTC 3ZTPA 2MY7A 5CPRB 3BZ6A 5H6QA 2LF8A 2JA6J 4IOAQ 2VG5A 1Y0NA 4RNMA 3CESA 5D15A 4X4OA 1R8CA 4K5RA 1SD4A 2MLXA 3KLGB 1RETA 2PGCA 2HVHA 2AX1A 5IC4B 5ETKA 1I5ZA 3V8LA 3CGIA 5B08A 3CJTB 1VRUA 2MZJA 3OYKA 1HNIB 2OQGA 3EPIA 2AQ4A 2EQRA 3LFKA 4DQIA 1Q81T 4WFZA 3VODA 2DNLA 3BT9A 1B0PA 2BANA 2Y0BB 3EXCX 3MQ0A 2RSQA 5D4PA 2NLWA 3TEDA 1POGA 3TZZA 2A2DA 1VQPI 4R0JA 2BM0A 2F3JA 1CF7A 4WU3A 3V4MA 1S0NA 2L08A 3P5BP 4UQTA 3OMYA 2VA2A 5DCMB 4A3FJ 1ZELA 3MFHA 1E2XA 2JA7J 2LOOA 1XMBA 4FKYA 4BE1A 4GFBA 3TDZC 4DPXA 2A69F 2D2WA 4G7OF 4ZVEA 4LVNP 4IJAA 2KJCA 3G1OA 2X1GA 3A4CA 2NAZA 3E5QA 1N34F 2A6EF 2DPDA 2G0IA 3H1CA 4B47A 1HW5A 1O3SA 5KFTA 2JZ5A 4MFDA 2L41A 2VFUA 3DRPA 1H38A 4UV8A 4OAZA 1TKTA 2BACA 2PD1A 2W1OA 2Y75A 2MQOA 4YIRX 1KC8T 2FSWA 4ZPVR 4JI5F 1KOOA 2XRLA 4X4UA 3UCZP 4OLPA 1WD6A 4DR5J 2DFEA 1ORKA 4I98B 4JI2J 2HVRA 2B9YA 3V6HA 3LMMA 2H1YA 2B3TB 4FISA 1S6LA 2ALYB 1AW0A 2JNJA 4IHVA 4HF2A 1W0TA 3QOEA 3VGSA 4XSZF 4GVLA 1JK9B 1R4NB 2E2IJ 3LW5C 4ZVTB 3FC9A 4M74A 5HDKA 3UN5A 4IO1A 4L18B 4EMSA 2BE2B 2RKIB 1YRXA 4CCHA 3W62A 2NS8A 2LLKA 1ZQ3P 4EJVA 1J5EJ 4G1IA 3FZ2A 3T0YA 3D66A 2HFZA 2LA4A 1NBEB 2P5LC 5F8MA 2HQGA 2DISA 3RBEA 2JHEA 4NLXA 1RZMA 2LK2A 3T1AA 3HBLA 1XNRJ 3DRRB 4KTQA 3MKYB 4HZFA 1VBXA 3GLJA 3JRHA 1VQ9I 1KFSA 2EZKA 2HHHF 1Q95G 2W9CB 2BVLA 1XEZA 3K4KA 1KVJA 2YWEA 4QBUA 1SB6A 3G82A 4B9LA 3M8QA 3CUQC 1RACB 1XR5A 1CJTB 1S1VA 3H2UB 4TLQA 1YJVA 1XK8A 4OWRB 3DGVA 2Z5UA 2GXAA 4NZ6A 3GIRA 3H4DA 2AU0A 3I6PA 2Y69H 3A02A 3UDCA 1R27B 4PUOA 5L3EA 3BTCA 1V6HA 2MJUA 2M70A 2M7SA 3C3LA 2L0KA 2KISA 2KIUA 1HR0F 4ANDA 4DL0C 3D5RC 1BI1A 4KV8A 3GPAA 3EPZA 3CMAS 1HW2A 2XSFA 3QT8A 2EA2A 1JJ2R 4ZYEA 5C4JJ 2HK2A 2XSJC 4M3GA 2DXEA 1RR8C 3ZZZA 5B0CA 2UU9F 4I0WA 1FKOB 2ZSHB 2ZH8A 4TY8A 1IBMJ 1O8BA 5AXLA 3OLBA 3WE3A 3HZJA 5ETVA 3FGVA 2KTQA 2HNDA 1HQEB 1IRZA 1ITYA 4NMLA 3ZO7A 3WG9A 1FEXA 4U67Q 4DYQA 4EO6A 1IN6A 2K9NA 1X1CA 5CYMA 3Q0WA 2VIXA 5L1JA 2XROA 3LSIA 1QSSA 1T0TV 4CSWA 3G86A 3MEKA 4HSRA 5A6PA 1CJVB 1R4MB 5IT3A 4HLXA 4EEYA 4YRVA 3DM2A 4QW9A 5E0OA 2BEOA 4OINF 5JLXA 1FE4A 3ZXSA 1T0FA 5ADZA 3FEYB 1U49A 3R8YA 2MGZA 1YDLA 3K0JA 1FBQA 5GAEJ 4DFMA 3NWTA 1K78A 1JLCB 4HH0A 2H3EB 4LJMA 1BC7C 2CFOA 2NNNA 5B0BA 1YG0A 2H1LA 4ENJA 2JX2A 4UB8C 3BO2A 1U0HB 3SHFA 3MOJB 2HZCA 3QODA 2DCLA 1HKTA 1FKOA 4URSA 2FHMA 5KFGA 5J8CA 3Q8PB 3S16J 2BM1A 5KG3A 1WJDA 4XLHA 2R7OA 4DUZF 3QWLA 1ZG3A 2QSWA 4B1RA 5CD4H 4B9TA 4NQWB 2F5FA 3N9UC 4JYAJ 1X58A 5H9FJ 1N32F 2YSRA 4P6QA 2A6HF 2RH3A 2YWWA 4HX4A 3JTPA 2DN0A 1T98A 5C42A 5IQQA 1ZARA 1OMSA 1X9MA 2G2OA 2J8SA 4LSLB 2WW8A 2XZDB 4J5OA 5LSLA 3TUJC 2Z2ZA 1TKXA 4Y13A 1M0SA 2H9ZA 4OHZA 2LXIA 4MKYA 3GTQJ 3ILLA 1B0VA 1CJUA 1VQ7S 1OYIA 1U0HA 3MGJA 4ZCKA 2EILH 1YK9A 4MEYF 3I59A 4FDFA 4RB3C 4QYRA 1B7YB 3PFEA 1R9TJ 3HOUJ 4O0IA 1PDNC 3VAKA 2QBYA 5GAEI 3M32B 1CPZA 3L7PA 1ZETA 1BI3A 3G2XA 4LSZB 2C42A 1BJZA 4JP8A 1X19A 1XR6A 3OVBA 5A8WB 2L48A 4LF6F 5D77A 2CGPA 1BR4A 3SSRA 5KAKA 2RU9A 2NREA 2VFVA 2WB1N 2Z3YA 3WC0A 2FHOB 3NBPA 3SCJE 2BHZA 1DUXC 4P52A 1BR2A 4WYWA 1B4AA 4O3PA 4L6V3 2KVIA 2YUSA 1R36A 4IHSA 2XO7A 3ZQHA 2HHXA 4BHCA 4WK1A 5HNHA 3GZ6A 1BW5A 5DYMA 5IQ6A 1TTYA 2ACYA 3B6CA 4HX8A 3C2BA 1OCTC 3N01A 3GWZA 3BQ0A 4ZVHA 4JI1F 2UUAJ 3BR8A 2EFQA 5HS7A 1S9GA 2R8KA 2LKSA 4QJVA 4BEHA 2DGVA 1LK5A 1KVIA 4IG3B 3CLOA 3DBRB 3LP1A 3MDFA 1O57A 3HXMA 2R5ZA 3QQCD 3KJFB 1WOSA 2HWHA 1JE8A 4L9TA 2LH9A 1ETOA 3KK3B 4NX9A 1RUOA 1WEYA 1KD1T 3RAQA 2OH2A 4OYAA 1U6GA 1D9DA 4LG3A 2OJED 4HI1A 3V6DB 2W24A 3ZZOA 3QYYA 2GA7A 5J2NA 3NS7B 4XLFA 2AW0A 4PG5A 3GVAA 2MSTA 1B4SA 1Y9OA 4EYHB 5D5VB 4L0ZB 4M9SA 4ZTFA 2RF2B 2QMXA 3SEZA 1MN7A 1JXEA 4IH5A 4K4VA 4OV6A 1UEUA 4MYUA 3E3VA 1M5PC 4XM3A 1MU2A 2LSOA 3GR0A 4PABA 3TQNA 4NA2A 1QTNB 4NC7A 4TU9A 2ZH4A 2VG7B 2CJXB 4ZPAA 5D5UB 3ABMH 3DPUA 2KFZA 1D09B 3D1NI 3TA2A 2W2QP 3OFGA 5CZVA 3D54A 2Y1JA 2VUGA 1K83J 2V34A 4XO0A 2L3DA 2R5YB 4BBRJ 1J2XA 3KDOA 2BEFA 2UVUA 1TQIA 4KKOB 2DTJA 2CV1A 5E17F 4FTHA 2YQ1A 3TJ9A 4MIMA 4FASD 3WHIA 2DA2A 2B7BB 5CVVA 2W9BA 1FVSA 1G4CA 3FHZA 1V5EA 2UP1A 1Q82T 4N0BA 3ASOH 3HJEA 5J2NB 4BACA 1LK7A 4NLUA 2GLOA 4D1QA 3GFYA 4YEJA 2MEWA 3BBCA 1YRNB 2UXDF 4PSWA 3O3KA 3DXJF 3HT0A 4ZYHA 3Q9VA 5K5OA 1PP8F 3M2VB 3DOMA 3M2VA 1SH0A 3E3XA 2PI0A 4N76A 3THTA 4DCJB 1BWVA 4FYXB 3I32A 2WCXA 1R5GA 1SC1B 2BA9A 1NDPA 2ZOMA 4XOTA 1DP7P 3M4OJ 4NXNJ 2AO9A 4HDVA 1WC3A 4RW6A 1DAXA 1DQAA 1QY7A 2DB1A 4ZITA 3K9TA 3QAHA 5F8NA 3G6XA 4OOIA 3WX4A 1X1BA 3CTRA 4P10A 2MGZB 5HP1B 3NGRA 2E9RX 2CADA 4M5NA 3OL7A 4JK1X 4GKKJ 4B9NA 4CLKA 3F9KA 2V4JA 2D5VA 4ES1A 4PWWA 5E5NA 1K73T 1IVZA 5J2PA 1F5TA 1N5YB 5KTQA 4LVOP 4ZVSB 2OUMA 1OJLA 2EZHA 3DEEA 1X3ZB 2HZAA 3M30B 4IFVA 2VU5A 4KISA 2HVIA 3I5UA 1C1CA 4ZVGA 3VFZA 1ZG1A 3I55I 2OPRA 4BAYA 1KTQA 3OL4A 1OY6A 4RBVA 1KKHA 1Z4UA 2CO5A 5KAIC 2UXXA 4PSXA 2IPQX 4USTA 5EWGA 3DP7A 3ML6A 2ASYA 1VQOI 3HKZD 3W60A 4HX7A 1A6IA 2EK5A 4A3DJ 4KSEB 2W8KA 1SUQB 1GX5A 5AXKA 1ON2A 3U7JA 1X5OA 2WBRA 1TZ0A 3HG9A 2DIUA 2CDRB 2NPIA 4CH1A 2IHR1 2EV0A 4CM0A 2EG1A 4ATNA 2E7WA 4HDUA 4J00A 1I6HJ 2XY6A 5IY5H 2O61A 5H1SV 3BYPA 2HQ3A 4ZYDA 1N52B 2DGSA 4CO1A 3Q8SB 3NAIA 1KRPA 2Y8WA 2QQBA 3SJMA 3C6UA 3V7RA 4F2SA 4PG6A 4UVBA 3P96A 5ETOA 2Y48A 4B9MA 1APSA 1YJWS 3BWGA 4ED8A 2AHOB 3OTOJ 5KFSA 2TCTA 1FWZA 4P75A 5F1RA 4M5HA 2NVUB 4ZZDA 3SQGB 1XTZA 3BPSP 1S76D 4J91A 2DHHA 2ZJQQ 4BUPA 3HZEA 5CYVA 5IT9U 1A6LA 4ZDOA 3NRVA 2DH8A 4ZHRB 3AAFA 1HBUA 4IDKB 1MN9A 1FE0A 2OKQA 1FT9A 2MQQA 5CH7B 3HTSB 1N36J 1U78A 3AD7C 4RW9A 1IKXA 1KQGB 4GXOA 2YNHB 1HA8A 2QA1A 3WTSC 1ITPA 2LKZA 2GM4A 3E5XA 3V81B 4KAIA 5G0RB 3RG6A 3M8QB 2Y1IA 3VQSA 3O44A 4O3OA 1VIXA 1R7JA 3L2UA 4X65F 2XV4S 3CT9A 4OV1A 3UFCX 5F27A 3DTKA 3GFMA 3H5NA 4ENMA 2B8QA 1YBUA 1Z6TA 3D6MB 1SMTA 1D1BA 3I4NJ 2OPQB 3KNAA 3F22A 2J7KA 2GGPA 3LA0A 3I64A 1ZAWA 2VA3A 3LO3A 1JLGA 1HNWF 1CBKA 4RW7B 5LM7E 1VJQA 2OHDA 4CCLA 4BY1J 2PSZA 5CXTA 4EFAC 2W25A 1IBLF 1YIOA 4KN4X 1U1RA 4QWAA 3VAHA 2OJ3A 3OYMA 4J9VA 5HJXA 4I6ZA 3GTKJ 4LLGF 2NS7A 4IFVB 3BCAA 2CZ9A 3DOLB 4EWTA 3QIDA 4RPFA 1SV5A 3HZGA 4OI6A 2DTRA 4ZZLA 3D1HA 5U47A 3SZ2A 5LSOA 5IT0A 4QYZK 1CULB 1R0CB 1O0PA 3QZ8A 1T03A 5GADU 2LLZA 3T5KA 4BHPA 1V5FA 3HEFA 1DQ8A 1QJHA 3MM6A 4DV0J 4YR2A 2E1CA 3KP4A 2GMHA 2POKA 4A46A 2DMQA 3UCUP 4XKCA 3IRXB 4PKDB 3BROA 3ENAA 2WSFC 1FT8A 3ITHA 3D6HB 2QQ8A 2IMWP 1S1XB 5K7HA 2QYGA 2N4DA 4AU7A 4F26A 1NK9A 2NVXJ 1NXIA 4LF2A 2CJYB 1FWLA 3AJDA 1XSDA 4MJKA 2JRTA 4C2MJ 3PR5B 2V6AA 3DCAA 1WF1A 2WV0A 1YIJI 1MJAA 4QR0A 5A6WA 2XSJB 3HUGB 4JP0A 1EKRA 1C1CB 4G6QA 3BGRA 4I01A 4E7LA 1CF7B 2KT0A 1WWHA 5D4NA 1VQ8I 1O7FA 4ENNA 2H09A 4B9SA 2W2PP 2K3PA 3G6VA 1KQKA 1R7IA 2R7RA 1SC6A 1KQ8A 2QV6A 5EGYA 3GV8B 3CW2C 3SFUA 4XKWA 5DLGA 3IP4B 2KRFA 1U1OA 4ANJA 1LW0B 4ZVUB 2C2EA 2XB5A 3MM7A 2YKPA 3IRRA 2AP6A 3G8SA 1SUQA 1M1HA 1FYKA 4MK9A 2FJVA 2QRRA 3NGTA 2JK3A 2M4GA 1M1EB 5D6EA 2UXBJ 1JKHB