1I1GA

Crystal structure of the lrp-like transcriptional regulator from the archaeon pyrococcus furiosus
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
140
structure length
140
Chain Sequence
IDERDKIILEILEKDARTPFTEIAKKLGISETAVRKRVKALEEKGIIEGYTIKINPKKLGYSLVTITGVDTKPEKLFEVAEKLKEYDFVKELYLSSGDHMIMAVIWAKDGEDLAEIISNKIGKIEGVTKVCPAIILEKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the Lrp-like transcriptional regulator from the archaeon Pyrococcus furiosus.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Transcription
molecule keywords TRANSCRIPTIONAL REGULATOR LRPA
total genus 34
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01037 AsnC_trans_reg Lrp/AsnC ligand binding domain
A PF13412 HTH_24 Winged helix-turn-helix DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1i1gA01
3.30.70.920 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1i1gA02
3KP5A 1IRGA 4DQ2A 2RQPA 3MZYA 2VODA 4YFKF 3ZMZA 1UB9A 2AS5F 3V8LA 1HW1A 5CVJA 3CO7C 3DPTA 2HOEA 3ZQ7A 2GA1A 4CICA 4B09A 2Z3YA 2STTA 1G3SA 4OIQF 4AD9A 5J8FA 1I1SA 4N0BA 2OBPA 5D8LB 5DD4A 2H27A 4LLLA 3GLXA 1LQ1A 4EJTA 5CVIA 1QGPA 1MDMB 4L18B 1S3JA 4QWQA 2QYOA 2OD5A 2Z5UA 5L3GA 3R0JA 3ELKA 2FEZA 3IC7A 1XSVA 5HDNA 3JW4A 3RDIA 4WF2A 1Z9CA 4KICA 2DQRA 1U8RA 4KNYA 3EDPA 2DK8A 4A0XA 3ABUA 2ZJ2A 2VE9A 3D0SA 5K1YA 4QLCU 3BWGA 3FMRA 4HA8A 2UZKA 3C18A 4OIOF 1PUEE 4OIRF 2HKXA 1F9NA 3T5XA 4G7ZF 3I59B 3W6KB 1LDKB 4L9TA 1MZBA 1IN8A 2K4BA 1TTYA 1K78A 1O3QA 4RAZA 1G4DA 1IN4A 3TGNA 5L3DA 2W25A 5HLIA 2PQ8A 2VC0A 2HKOA 4GYIA 2KIFA 1YG2A 1HKTA 4RGUA 1R58A 1QPMA 3L00A 4U88A 1LEAA 1S7AA 4RB0A 1OYIA 3P9CA 3F3XA 2A68F 3ECHA 2P5KA 1HKQA 3GUDA 3HRUA 4ON0A 4WX9A 1BIAA 3H3ZA 2MLKA 1SMTA 4ETSA 1XDUA 4OINF 5LHHA 2L02A 1P4WA 2YX7A 1UHWA 4HBLA 2M1BA 4CGZA 2RNJA 3M7GA 3ISPA 1FNNA 4HYEA 1S29A 4GGGA 4M6XA 4LGWA 3BJ6A 1LNWA 3Q5FA 2CYYA 1Z7UA 2HQNA 2TDXA 3TKYA 2MLGA 1BI2A 5HS9A 2ZXJA 3KZZA 3R0AA 2FBKA 1W4MA 5DCMA 3KP4A 2YU3A 1LEBA 3LA2A 4U0VA 3BDDA 1U78A 5HOOA 2NRAC 2ETHA 2KIMA 5D8KB 4I98B 4I0AA 1XGOA 4KIBA 4DNCA 1OKRA 3F8FA 5HS7A 3NEUA 3QOPA 5CJ9A 1DP7P 2J5PA 1B4AA 2W85A 2ACJA 1MDMA 4M9ZA 2IVMA 1QQIA 2XAQA 3HYIA 2DK5A 3EUHA 2L3DA 2O61A 5FFZA 4L0YB 2ZNYA 4G6QA 1WKMA 4LB5A 1FBQA 4WXDA 5E1WA 3KLOA 4KIFA 1TNTA 1X3UA 4N9HA 2P5LC 3J80Z 3REOA 3V7RA 1B9NA 4LFUA 4ZYEA 3JTHA 1RI7A 2W84A 2EFNA 5AIPA 4MQ9F 2XROA 4LK1F 2VBXA 2G9WA 4MTDA 4EVIA 1EV7A 4WK8F 3P9KA 3JTGA 3IL2A 3TO6A 1EH6A 1KQ9A 1J7KA 3DXJF 2NNYA 3C7JA 1SAXA 1HSJA 1RUNA 5K5OA 4IPAA 2UXNA 3WODF 1R22A 3ZN1A 3I58A 2QWWA 1U5TC 3DP7A 1HW2A 3KE2A 3LWFA 3RKXA 4UUVA 1ZAOA 4LK0F 1MD0A 2QM3A 3RYPA 5BQTA 4RGSA 4LLGF 1U5TB 5D5VB 5D5WB 2QZ8A 1ONVA 3SZPA 2A61A 2V9VA 3K1PA 4AVPA 1KYWA 4I02A 3ULQB 2CG4A 2IA2A 3JSPA 1EH8A 3L9FA 1RZ4A 2ZCWA 4LG0A 2LNBA 1VTNC 1UCRA 3NQOA 2STWA 1J2XA 1A04A 4YIIA 3W6JB 4N9IA 1B9MA 3FM3A 1IF1A 5LEKA 4OIPF 1ZREA 3AAFA 1G3YA 2CWEA 5HS8A 1K79A 3GO5A 4YFXF 2VN2A 4P9FA 1IN5A 1LVAA 3BJAA 5JI6A 3QRFF 1RIOH 5HLHA 1ZRFA 1J5YA 1T2KA 4I01A 5DYMA 1ZG3A 1XD7A 2OZ6A 1KU7A 3BJOA 1K6OA 4ZZLA 4EGZA 2VE8A 2LKPA 2YSRA 2IW5A 4L0ZB 5A2QZ 2FBIA 5F6FA 5JVTA 1TNSA 4CO8A 1YFHA 2P5VA 1XB4A 2M8EA 5BPDA 2MD5A 3HHGA 3E3VA 3QPHA 2M30A 1L0OC 2OQGA 3P7NA 4P55A 1FY7A 2ADUA 3VB2A 3RI4A 3QU6A 3MFKA 3COAC 3VODA 3GYHX 1FOKA 1O7LA 4D0PA 3E5UA 2CQKA 4A0YA 3ZMDA 4M74A 4MNUA 4HF2A 2IA1A 4CZZA 4TV7A 2EB7A 3GFMA 2HFHA 4ENKA 2GAUA 3K1MA 4HV6A 2ZMEA 5FO5A 3ECOA 2HQRA 3T8RA 3L09A 5FD5A 2FBHA 1QNTA 1W7PD 1G3TA 4ZYHA 1R23A 4AIKA 5E20A 3LA3A 2FNAA 2FXAA 5BOXA 2O6GE 2XGXA 2PBIA 3I4PA 3ABTA 4ZYDA 1KQ8A 3V8JA 4R79A 3RYRA 4HDUA 5K5RA 1T6SA 4IRHA 3GVAA 2EV0A 5ICGA 4JQFA 3GFJA 3VFZA 3P9IA 4G8XA 2E7WA 2XASA 5LHIA 2WTEA 2YPRA 3T8TA 4Y13A 1TBXA 3WE3A 4Y17A 1T0FA 3BOQA 1BC7C 1OMIA 5A2QK 4OOIA 3HRSA 2Q2EA 1U5TA 3DKWA 4E70A 1R36A 1YS6A 4YG2F 3LAJA 3RKYA 1ZGAA 2FE3A 3K9TA 3MAJA 3E6BA 5D5XB 2H6BA 2VONA 2OU2A 4HV5A 5IT9Z 4HLXA 1SD7A 4Z2YA 4P5OA 4MQVA 4KA4A 1YTYA 1RUOA 3EQLF 3ZP5A 2OQRA 2PFBA 1JHHA 3K2ZA 2EFOA 3BP8A 3BPXA 2R7DA 2L01A 3QPTA 4YFNF 3JAMZ 3FHZA 1NHAA 1FSEA 3FMQA 1IRFA 1WI9A 2JTVA 3N4MA 4ZYGA 2O3FA 2K4JA 2L54A 4RS8A 2DFIA 2EJRA 1MJ9A 4CXFA 2HZTA 3SQNA 2QVOA 3OOPA 2YR2A 5L3CA 3I0TA 5CVVA 1KU2A 5EEHA 4CYDA 2Z4PA 2DQLA 5D4SA 4R1HA 3F21A 3WTTC 3V7SA 2W24A 4BHBA 3MEXA 3WU0A 3E6DA 1DPUA 4WXCA 3I54A 3KETA 1K78B 2BBYA 1F5TA 5E8GA 2GZWA 4PGGA 2K86A 5IT9K 1KU9A 2F5CA 2FA5A 2D1HA 4OMYA 3NRVA 3GXOA 1XGSA 1GVJA 3MQ0A 2EFWA 1FBSA 3HSFA 1IZ1A 1H9GA 2VBYA 3IWFA 2B0LA 1GHCA 4M72A 5AONA 5BPIA 4RGRA 2M87A 5ED4A 4BAYA 1O3TA 1SD4A 1PDNC 3L7WA 3MZHA 3DV8A 4HX7A 4IHSA 3KEOA 1MJBA 2QQAA 4IRIA 5IT3A 3WU1B 2M5WA 1XGNA 1W5SA 4HX8A 1EH7A 2RV8A 3J80K 1MJAA 5FFXA 1V4RA 2DJWA 3CDHA 2L4MA 3O2PE 4IHTA 1BJAA 4G9YA 1G6NA 1WRJA 4A6DA 5DCMB 3SFZA 3LFKA 1B1BA 1XMKA 1H0MA 3SXYA 1SFEA 3J81K 4HOBA 2XAFA 1OR7A 1REPC 2NYXA 3WTUC 2KKOA 3K1NA 2LF7A 2PN6A 3E6MA 3PQJA 3PQKA 4UVBA 4G6DA 1KU3A 1FLIA 4RB1A 1O7FA 4ZZDA 3HRTA 1SFUA 1U6GA 1XMAA 2R7FA 4OMZA 4ENNA 1QBJA 4LMYA 4KN7X 1CF7A 3Q9SA 1QO0D 6PAXA 1P6RA 1WWXA 5HVQC 2MA3A 3HTUA 5LGNA 2D45A 4M9SA 4XBFA 1JE8A 2ESNA 3QP6A 3M8FA 1ON1A 3SZTA 2C6YA 2A3SA 2VT3A 2MC3A 2EFPA 3GEZA 2COMA 2WC2A 4BYYA 3JAMK 1J75A 4G7HF 3E5QA 4NB5A 5LGTA 1XSDA 3TQNA 5KK1A 4K2EA 4L5JA 3LQQA 1ZHFA 4KUMA 3E6CC 2HR3A 3CUOA 1TQPA 3BPVA 3M8EA 2CGPA 2JSXA 3CUQB 5CVRA 5ILSA 4EGYA 1ZRCA 2W57A 4PGHA 4HX4A 4NQWA 5TJJA 3HRMA 2GWRA 4EM0B 5K5QA 4HQEA 4U7DA 3LQRA 4ZH4F 5HDKA 1FYMA 1I6XA 2AXLA 4U0YA 3DF8A 1WQ2A 3RTRA 3TDUC 4BNCA 5H6RA 5HLGA 5DEQA 3I71A 1V3FA 3E5XA 2JZYA 1OPCA 3KFWX 3WTSC 2H09A 3DPLC 3KZYA 4O3MA 2PLYA 2A5YB 2JSCA 5DV5A 3WE2A 1UFMA 5DUKA 2MH2A 3WTXC 4ESFA 1JGSA 1DUXC 1R00A 2EK5A 3GZ6A 3HHHA 2QENA 4Y15A 1TLHB 1BOAA 3ZMTA 4L9JA 2CFXA 5E8IA 3J81Z 4MTEA 4KIGA 3T1BA 4JK1X 1R1TA 1F4KA 5E18F 1E17A 2QQBA 3GWZA 2HTSA 1J0RA 2JT1A 3ZN0A 1YO5C 2FMYA 1FPQA 3JSOA 1XN7A 3LSTA 1ZLKA 3HUGA 3N97A 2P6SA 4L9VA 1XGMA 4BHCA 2A6HF 3F8CA 2A6EF 5ERIA 5JHUA 2JPBA 2H6CA 2ESHA 1DPRA 5FB2A 3F6VA 5LLQA 1T98A 3Q9VA 1FBUA 1IN7A 5CYVA 2F5DA 4ESBA 2EV5A 3FM5A 5TRDA 4O6JA 2FSWA 1ODDA 2PG4A 3BZ6A 3D5LA 1KYZA 1J9IA 1D8KA 4KN4X 1R1VA 1KGSA 4B8XA 1ZG1A 2Y48A 1XCVA 4KDPA 3FMSA 2O0YA 2FU4A 3CLOA 2UWMA 5H6QA 3EYYA 3HOSA 3FX3A 5BMZA 2QUFA 2X0LA 5JFRA 4EQQA 3WGIA 2GXBA 2K27A 2ELHA 3ROUA 5ICEA 3CJNA 3ZMVA 4UNOA 5L3EA 2DBBA 4HLYA 3U2RA 4S04A 4RB3C 3KP2A 3ZMSA 2J5OA 2GIVA 5FD6A 1ZG5A 1YQAA 4EJWA 1YW7A 4WCGA 1I27A 3TDZC 3CO6C 5D4RA 3RPQA 2XAJA 3O3KA 1O3RA 5EEGA 1QZZA 2P6TA 4A5NA 3ERED 1FSHA 3F22A 1S7OA 2CVIA 1BM9A 2XAHA 2FRHA 3WTWC 3HOTA 4BXUA 2QLZA 4UV9A 4FX0A 3WGGA 4CDGA 1FWZA 3U9GA 2HTJA 3C1DA 1S6LA 1USTA 3R60A 5E1ZB 1FC3A 2X4HA 2E7XA 3FXQA 4I2OA 3IRQA 3RJPA 3QAHA 2XIGA 1AOYA 1ZN2A 3QU3A 2FQ3A 4XSXF 2DPDA 5LBQA 2D1VA 1IW7F 3G3ZA 2IPQX 2QBYA 2VOOA 5BS6A 2KRFA 5E1XA 2VOPA 2BEOA 2DPUA 3DEUA 4IRGA 2ZKZA 1RNLA 4M6YA 1O3SA 5E17F 1PP7U 4O5VA 2DU9A 1OYWA 2VXZA 2K7LA 4GO1A 4P96A 1L3LA 3L2CA 3F8BA 1H9TA 1SFXA 3HIFA 2P4WA 2HDCA 4HW0A 3V4GA 1ZGJA 4G7OF 1HKSA 1D8JA 3ZPLA 3TOAA 4EJUA 5DCFA 3CUQA 4WWCA 1AWCA 1XCBA 4EJOA 4ESJA 2LDUA 2DW4A 3G73A 4R8HA 2OA4A 1Z05A 2H94A 4GXOA 2ZBCA 1FYLA 2EA2A 4HDVA 1YLFA 4FX4A 2HWVA 4LD5A 3VOEA 1GXQA 2RC4A 3F8NA 1YYVA 3FXUA 3TOBA 3I64A 2BGCA 3KP7A 1IXCA 4UHTA 2HS5A 3F72A 2EWNA 4HQMA 1JXSA 4XLPF 1TW2A 3K69A 2DO7A 1I1GA 2V1UA 2VC1A 5ICFA 4HF0A 2JRTA 3V8KA 5L3FA 4PDKA 1BIBA 4BQAA 3FWEA 3F23A 5FLXK 4A5MA 2RN7A 3GW2A 5ILVA 2ISYA 1OYYA 2LSOA 1WSUA 4YIFA 2DLLA 5DUIA 1T39A 2Z9OA 2E1CA 1STZA 4KMUX 1R7JA 2BE5F 4H0EA 2V1XA 2XV4S 3GF2A 5ICCA 5CLSA 1W7PB 1R5GA 2V79A 3S2WA 1MGTA 1SD6A 4BH9A 3CTAA 3CUQC 2CW0F 3GX4X 3HSRA 1XSXA 1FYKA 4L5IA 3H3UA 4AIHA 1BI0A 5D5UB 4FHTA 4GCVA 1JHFA 4XSZF 3VEPA 4LLNA 5FLXZ 2G7UA 4NHJA 4WXHA 1HXDA 1KQ0A 1FP1D 1F1ZA 2M45A 1TQMA 4EM1A 3EYIA 4OU0A 2RDPA 4BHPA 2XUBA 3B02A 5DDGA 2DI3A 1IAWA 5DD8A 1IXSB 2IJLA 4UV8A 1Z1DA 4L9NA 4CHUA 4AIJA 5J6XA 2ZBKA 2Y0MA 1ZLJA 3O6BB 4UXNA 3WTZA 4EM2A 3C3WA 1YW8A 1DDNA 3V7CA 4JBAA 1ON2A 2O8XA 4UVCA 4Q4ZF 3K0LA 2ZNZA 2V1DA 4M73A 3LA7A 3RKWA 2Z99A 1FT9A 4ASNA 1SD5A 2QBYB 3WG9A 4XRFA 3MWMA 4HAMA 4FT8A 2A69F 4I0BA 2R3SA 2LF8A 2XKPA 4F7ZA 2QQ9A 5CVUA 2XHKA 1TQIA 1IN6A 2RKHA 4G94A 2XAGA 1USSA 2F2EA 1U3EM 3EETA 2NNNA 1YIOA 3H92A 2MH9A 4KT5C 2WWYA 4KFCA 5F1RA 3DFGA 3HTSB 3HSEA 2RVCA 1Z6RA 4I09A 3U1DA 3E97A 2DT5A 5KVRA 4LJZF 5H20A 2ZFWA 3M9AA 2Y75A 2DAOA 4EMSA 4MEYF 4A12A 2FMLA 2FNPA 2Q8KA 3FZVA 5LRSA 1P4XA 2CSOA 2HYFA 3GZ5A 4A0ZA 1K7AA 4M71A 3R4KA 2HEOA 3IHUA 5LEJA 4S05A 1I5ZA 4PZJA 2XRNA 5LHGA 3IKTA 2PMUA 1B59A 5ILUA 3B73A 2O03A 4IJAA 2JPCA 3R6SA 3ML6A 4AWXB 1U2WA 3FXRA 1D3YA 2GXGA 4EV0A 1W5TA 2P7CB 2IT0A 1W7PA 4EJVA 4IXAA 2YX4A 3MCZA 4U7BA 2XVCA 3M1EA 4P9UA 1B6AA 1XDSA 2V6CA 2ISZA 3R61A 2P7VB 3IWZA 4U0WA 2CO5A 3I53A 3KP6A 1HBXG 5HDGA 2ZMEB 5D6EA 4ENJA 2PEXA 1HQCA 4MEXF 2Q0OA 3BROA 1Z6TA 5L3BA 3J7AO 1R1UA 4Q47A 1ZYRF 1P4AA 3SHFA 3GFLA 4HF1A 1P92A 4ENMA 3T0YA 1LJ9A 1TW3A 2FOKA 2P8TA 4Q48A 2L4AA 1BC8C 3KEQA 3WTVC 3TO9A 3KP3A 2VT2A 4Q5SF 2WV0A 1LDDA 2ZO4A 3RPUA 3QP5A 3IRRA 1YS7A 1FZPB 1ZARA 1ZH5A 1E2XA 3PFIA 3LAPA 1GXPA 2F5EA 3KLNA 1Q1HA 2K02A 1SMYF 2EFQA 3F8MA 5J8CA 1LDJA 1MKMA 1C0WA 5LGUA 3FF5A 2Z33A 2KJBA 2PI0A 4M9XA 2PJPA 3WTYC 4A2UA 5F64A 4I7HA 3OV8A 3F6OA 2HYGD 5D6FA 1D5VA 2PMHA 2IA0A 4RGXA 2BV6A 2HGCA 5JR3A 3WGHA 1YW9A 2NAZA 1CGPA 2OAZA 1PP8F 2IP2A 1ZRDA 4IVNA 4UVAA 4MHGA 4LB6B 3IKVA 3RIRA 1R5HA 1P2FA 3TO7A 2KJCA 1S8NA 2OZUA 1BBYA 4XLNF 2F5FA 4GYGA 3GFIA 3KCCA 1BN5A 3DQVC 1J59A 2VBWA 2GA2A 4KMFA 1FX7A 1FP2A 5AIQA 1BI3A 2VBZA 3BY6A 4A6EA 1IXRC 1LB2A 2E1NA 1ULYA 1Z91A 2XKOA 1T38A 1QZYA 2E1AA 4PCQA 4KYWA 3ZMUA 3I5UA 4MGRA 1HSTA 4RB2C 2UXXA 2FF4A 2EV6A 1IUYA 5LRRA 5FGMA 2G7HA 2EA4A 4HZFA 1HW5A 4IF4A 2MBFA 2KIUA 3I59A 1UHMA 2A07F 1CF7B 1G3WA 4LG0B 1KA8A 2IRFG 4RAYA 1BI1A 2BYVE 2RGVA 1Y0UA 1O57A 2DTRA 2GQQA 2D2WA 2NS0A
chains in the Genus database with same CATH superfamily
1FJCA 4RAGA 2ZBRA 2BXYA 4DL6A 3VHQA 1DZ5A 4PWWA 4AC0A 2VODA 5EUHA 1VIXA 4O3QA 2G0IA 4CLTA 5C24B 3PW2A 3RAMA 2STTA 5HMZA 4HLBA 3FCVA 2OBPA 3NOCA 4O44A 2H27A 4XIDA 1PUFA 5CQEA 3QZ7A 3HXMA 4RNNA 3NG8A 1SEUA 1QGPA 1MDMB 3CQZJ 5HMYA 1S3JA 1S9EA 4E7SA 3R0JA 1V5EA 1GV5A 3CE8A 3JW4A 1T9XA 3JXOA 5DGAA 4ID5B 5A8RA 1HLWA 4KICA 2F65A 3KK1B 3D9BA 2OPPB 1WACA 4C4WA 1KNZA 5FKOA 3ABUA 4X64F 4NLVA 2IEKA 4HA8A 2FLNA 1SCJB 3NCPA 5EDNA 2BVZA 2BA9A 3PYFA 3LP1B 5EGOB 5GADI 1KR4A 4NMXA 1ZTTA 1CLFA 4CYUB 3ZZ0A 5B66C 4OMFG 1S77D 4OIRF 3P3DA 1HPZB 5M2RA 4KY3A 4EYHB 5BJRA 2ZSIB 3T5XA 4G7ZF 1M90T 2ZC4A 3NGUA 4IZZA 1YI2I 4OJGA 4HSTA 2BE9B 4P2SA 2B5JA 4L9TA 4ZA1A 3WZ0A 1C4AA 1YKWA 3LAMA 2KN4A 2GHPA 3B54A 1FXDA 1TTYA 5FLXY 1IBMF 1O3QA 2JFKA 2JVOA 4TN2A 3UCUP 4LVNP 4QWBA 2LA6A 1HKTA 4RGUA 2HNZA 1R58A 1HNVA 1NTCA 1NLKL 1MBJA 4E2FB 5MLCV 1LEAA 4RB0A 2OD4A 2V2ZA 4CLZA 5KFYA 2EIKH 2P5KA 3ECHA 2XI2A 4WX9A 2YNGB 3H3ZA 4RW6B 1SMTA 4ETSA 4OINF 3GPAA 1M1KT 4BDYA 1RADB 4R5PB 2L02A 1OY8A 3V2UC 2ZDPA 3SV3A 5E33A 1UHWA 2M1BA 4CGZA 1C1CA 4ED3A 3OYAA 1K0VA 3NP5A 5B3SH 1GMWD 4M6XA 3BJ6A 3VZHA 1X1PA 3DBRB 2KZMA 4E7ZA 3QLHA 2HQNA 3MOZA 5CCLA 3DRSA 1H73A 1AYEA 3HHLB 3CMAS 2P9GA 1GQEA 3R9LA 3BGRB 3MAHA 2RQCA 2C2OB 2I8EA 1ZYQA 1FK9A 3R0AA 3H4DA 5LL6d 2FBKA 2XB2D 1W4MA 3POTA 3KP4A 3LA2A 3VYRB 4U0VA 1Y3KA 3JRDA 3SEZA 2V7FA 2KIMA 1FWKA 2IDEA 1FT8A 2F8HA 4I98B 4TY8B 3PEHA 3BN7A 3AFHA 1XGOA 4I0AA 5IOZA 2YKAA 3TJ9A 1F5AA 1WH7A 5HS7A 2YWFA 1CSJA 3Q23A 4RW6A 3JQJA 3QOPA 3HOXJ 4TKTA 4ZVUB 4N4OB 2J5PA 4UB8C 2W7OA 4I6AA 2GBYA 3M4XA 1EKEA 3AFGA 1VQLI 2HQDA 2WRMA 3HDSA 5J2NB 4MK8A 3N6NA 3V6HA 2DK5A 3CD5A 4DV3J 4AQYJ 4G6QA 1R9TJ 1SAUA 1OS5A 3VCDA 3LALA 4C8OA 5A8KB 2DH8A 3I31A 2MLZA 3LOCA 1Y4ZB 4WCEQ 2DOFA 1RTIA 4WBFA 5GAGI 3MECB 4KIFA 1TNTA 1X3UA 2ZWOA 1Z2ZA 3PIPF 5AE3A 2HNDA 5BR8J 3DBHB 3J80Z 2ZJRF 2C28A 5HAOA 3VAMA 4IQJA 5HO4A 1R43A 1VYAA 2X6WA 2W84A 1XR7A 3DBLB 4TU8A 2W01A 2FZCB 1S1WB 3ZFVA 2UXDJ 5IQQA 3K5OA 5GAHU 1R4NB 4F3QA 4MQ9F 1XEZA 8ATCB 2HQFA 2BW3A 4U87A 5FRMA 4QU7A 4WK8F 2W2PP 4NA1A 3VV2B 5B09A 3DU5A 4E7IA 4IFVA 3DC2A 4RBTA 2HHQA 4AIDA 1J7KA 1KQ9A 5B0EA 1WJ9A 1SAXA 3CUNA 1PO6A 2ZZNA 3K58A 1VDHA 4IPAA 3WODF 4G6TB 3F9KA 2NPIA 4NOHA 5KT5A 1JXVA 1R22A 3ZN1A 2HPMA 1M1EB 4HNVA 1EAYC 3BPSP 3GCWP 1UWAA 4F7VA 5THWA 1U5TC 3DP7A 1Q8BA 2EG1A 2YPYA 2K5CA 2R5ZA 3LWFA 2XGPA 1NJXA 1HQEA 2AQEA 3RYPA 4EI2A 2FVRA 3GYNA 4QYRA 3KHRA 2QZ8A 4J37A 3BSNA 3CCSI 4YELA 2V9VA 2Q3PA 3K57A 4DIQA 3VAFA 1HWIA 2VHGA 2FVPA 4I02A 3ULQB 3VGSA 2CG4A 1PJ5A 2BE2B 2MKKA 4YR0A 4ECWA 5E41A 3HGYA 5LSRA 3GZ7A 4EU0A 4HPQA 1CPZA 2RAQA 2JH3A 1VTNC 3R2DJ 4FXWA 1VBYA 4K2JA 4PG7A 4KO0A 3U27A 4A69C 4HNUA 2JX2A 4K8RA 1IF1A 5LEKA 1TKXA 3AAFA 2GC8A 3IR7B 1ZPWX 2CWEA 1K79A 3GO5A 1RT3B 2Z1DA 1RAJA 3L95X 5EG0A 2VJUA 1RIOH 5HLHA 4PXBA 4HRIA 1ZRFA 3AQPA 1T2KA 2Z58B 3Q2SC 4ZVOB 1ZG3A 2R7QA 2JA2A 5FKLA 5E2QA 5ITHA 2LKPA 5F04A 4MKVA 4FP9A 5ETMA 4A48A 3GR1A 4GO5X 1MH4A 2QGUA 5A2QZ 2HOSA 5F6FA 5JVTA 3MD1A 4NLUA 2P5VA 1XB4A 3CEDA 3C66A 3J7ZT 3QT6A 3NNAA 3HULA 3UD5A 1Q53A 3IH2A 3OS2A 3TR5A 3OOUA 2M30A 3E01B 1L0OC 1FY7A 1P9YA 3VB2A 5E3OA 1H89C 3QU6A 3LO3A 4I2PA 2G9OA 1RBAA 3MCMA 2WB4A 1VRTB 2IS6A 3HOVJ 2JK3A 3LP1A 3BSCA 1NUEA 5A6PA 2BY1A 5FLMJ 2RUSA 3KYDB 2HIQA 3G6EI 4CO0A 2QLXA 4M74A 2DMQA 5GAGJ 1RACB 2PE8A 3KJVA 2IA1A 4G1PA 2EB7A 2QCOA 2V50A 4L73A 2L7KA 3CMYA 2XYGB 2HFHA 1IKYB 4ENKA 4EUVA 1XX5A 5KCMA 2EZLA 2VFVA 4K4UA 3ECOA 4B4CA 4I64A 3K7AJ 2AZ1A 4ZHRB 5HBMB 3JAMU 4X0GA 5AJ3J 5FD5A 2FBHA 4USJC 3V6JA 2I38A 1FRIA 2XYHB 4ZYHA 3M8QB 1MSEC 4LF4F 2AXTC 5E20A 2R7WA 3NAUA 2FNAA 4NNJA 3RBDA 1X19A 3OQ2A 4OX8A 2KRCA 4Y2CA 3GJRB 2Y9ZA 3JSYA 2X6YA 2XGXA 4RO0A 1AFIA 3MEEB 2JRMA 5KAKA 2DGQA 3K4CA 4R79A 1S0OA 5J2PA 3RYRA 2CQPA 3W9HA 3BDPA 3H4BA 2R4GA 1HNWJ 4JQFA 1KC8T 1VBZA 1FX4A 4G8XA 4DXLA 2YPRA 4Y13A 3WE3A 1FDNA 2BV3A 1TWGJ 5GTHC 1C1BB 2AO9A 4P10A 3BOQA 4J9OA 4WFNQ 2E1OA 3GIMA 1FFGB 1U5TA 2DGTA 1GMWA 4E70A 2V4JC 4KHPJ 1U8SA 4PFPA 2GJFA 3DU6A 3BR2A 2C2ZB 2A5WA 5I3QA 2ZHBA 1CULB 4YG2F 2FD2A 2X48A 4NDLA 1YHQS 1ZGAA 4N41A 3K9TA 4HG2A 4IEJA 4I0WA 5D5XB 3EUKL 1GX6A 3BKUA 4J9KA 2W4CA 2CPIA 1GXLA 3KLEB 3V6DB 3ZQGA 1UMQA 3DDKA 4Z2YA 1K8AT 4NLSA 3C2BA 5EZHA 3QYYA 3ILOA 3H9JA 4IYQA 4N5SA 4KA4A 2FJXA 3ZP5A 4IR9A 1SUQA 1JHHA 3RR7A 3BSOA 2R7DA 3CCEI 5EWFA 5L38A 3JAMZ 4AYBD 1NHAA 3FMQA 1P7IA 3E01A 1JLBA 1IRFA 1T56A 2XULA 2CJYB 2DFFA 4L3NA 1T95A 2O3FA 2K4JA 2YH1A 4RS8A 1UVMA 3IA0A 4FNHA 4CXFA 2VQCA 3RG6A 2RS2A 4JI3J 4ILLA 2YR2A 1WSVA 1WI6A 2IMWP 3UWTA 4LBHA 5CVVA 3M1VB 4QSHA 5EEHA 2DQLA 2J6SA 3QYEA 4CP5A 1NBEB 4DUZJ 3IV5A 2GX8A 2R8GA 1QHHD 3MEXA 2ZKTA 1N8RT 1C0UB 3E6DA 5GTIC 3RPUD 3ICLA 1KSPA 2OTLI 3I54A 3KETA 2MDAA 3UN2A 5KFWA 4IRCA 3PHEA 2K9LA 3MUTP 3CCJI 2U2FA 2OIHA 4PJLA 2V1NA 3DMJA 3OT9A 2E66A 4D9JA 3C15A 1VQ6I 4X84A 2YNFA 2HHXA 2HWHA 1WFXA 3NRVA 2CUZA 3GXOA 1GVJA 1DHMA 2CJXB 3OSPA 2OCEA 2RF2A 4LF5J 3DGVA 4F26A 2HFOA 3S14J 4FPRA 2XMMA 3A1YG 5HVGA 4FYYB 4RA2A 2BOPA 1S72S 4IX7A 2NXNB 1PDNC 3HD2A 5CPRB 2XO7A 3L7WA 4YB7A 3MZHA 1TWCJ 1ZTRA 1ACIA 2XB5A 2QQAA 5HQMA 2ZH5A 2M5WA 2OSRA 3PW5A 3LWMA 1W5SA 3HHLD 2UZAA 4NX9A 1NK7A 2HNHA 4DR3F 2DTZA 4KV8B 4F3OA 4F93B 2IBDA 4IHTA 2OUMA 4IH5A 2DR8A 4KSEB 4A6DA 1FKOA 2BUNA 4H4OB 1KLMB 1Q81T 2LA4A 4WXWA 3OYBA 4ZCMA 4ZCLA 5EWGA 2OH2A 2XAFA 1EKRA 1OR7A 3TUJC 4ANCA 3WTUC 1ITYA 2MYFA 1S48A 1WDTA 1VRUA 3NCRA 2QIFA 3HGGA 2M5YA 1HNXF 4Q2MA 2EIMH 3DOKA 3IMQJ 3LPYA 1S6UA 3U7JA 3HRTA 1SFUA 1I3QJ 2AQFA 4OYOA 5M2UA 1Q5VA 2YWWA 3QRRA 4OV1A 1N52B 1S1WA 4LMYA 2J6TA 4KN7X 2DOEA 5E3LA 3G1LA 5EJCA 1T0TV 4CLUA 1E0EA 3MM8B 6PAXA 1WWXA 2XG8A 1XNQF 5K7HA 1JJ4A 4C8ZA 3HTUA 1FVQA 4OAZA 3T1AA 1I6JA 3DLLQ 4B1RA 2D45A 1Y1WJ 4XBFA 3QYFA 4URSA 4G65A 3IH3A 5EEAA 2FX0A 3FSIA 4IG0B 3SZTA 2C6YA 4JP8A 4X4OA 1H2TZ 2MC3A 4HTJA 3ZOBA 1FNOA 1HD0A 2WC2A 4BYYA 2CQGA 3KG4A 3GTQJ 4LFBF 3JAMK 1J75A 3CT9A 4N47A 2Y69H 1VI7A 1AT1B 2L2OA 4C8MA 3LW5C 1KFSA 5LGTA 1TMJA 2WAEA 3C6TA 4JI7J 4LRCA 2X1GA 1D0YA 2HG4A 4ZLPA 1ZHFA 4KUMA 3E6CC 1UCNA 3A4TA 4UY8T 1VQPS 3BPVA 3H2UB 2GO9A 2CGPA 4IHYA 3UNGC 2B4VA 4I68A 3OSNA 2ZKUA 2XGQA 1G8XA 3E3XA 1BQXA 5H9FK 1FO1A 2VJVA 3QPIA 4RUHA 4NCGA 1RU1A 2ZEJA 2OLWA 1RE1B 4Z37A 2BMBA 1IJWC 2Z57B 4K2XA 2GWRA 4MLOA 1RT6B 1YDLA 3SSQA 4M1KA 4RW7A 2BW2A 4ZITA 1SQGA 3MPYA 1RAGB 2V9PA 1PYVA 2J0QD 3CMAI 3SYZA 1N0UA 3TDUC 4ZDLA 3OS0A 5B0AA 2AQ4A 2NVQJ 3R5AA 1IRZA 5IYCJ 2D7SA 1LQ9A 2F5GA 2FC9A 4IOAF 3KPHA 2GXAA 3EICA 4JUZA 3KFWX 2WSCC 1APLC 3OL7A 4USTA 3GIRA 4DS5A 3KZYA 3ULHA 1LWFA 2PLYA 2A5YB 1SKRA 3PYGA 1O6XA 3AA8A 2HVSA 3WE2A 2V0NA 3BREA 4ZPBA 3ETOA 3BC8A 1UFMA 4CH0S 2FHKA 4DF4A 2E1RA 2V9KA 1UG2A 4ATNA 3J7AN 4DSEA 3KX2A 3HHHA 3SDGA 5AT1B 4QWAA 2DR6A 2IS2A 2I5UA 3UR0A 1BOAA 3B4MA 1XPXA 4RMNA 2ZWPA 1IWAA 1OFCX 3PNYA 1T11A 2HVEA 4XLAA 4KIGA 3BGFA 4I2QB 1MROA 1R1TA 1F60B 1N36F 3JRHA 3H5XA 1X4CA 2Y0BB 3Q89A 2E5ZA 2QQBA 1NK9A 4JV1A 2JT1A 1PJ6A 2FMYA 3BR0A 3BKTA 2HNDB 3CCMI 1UZDA 3GTPJ 3HUGA 3N97A 1IV6A 4F92B 1IUFA 5EF6A 1RHJB 4FYWB 3EGWB 3S17J 1XGMA 1WHVA 2ACMA 2DXIA 5ERIA 5JHUA 5EGYA 2H6CA 4C11B 4ECQA 1FTZA 3SSRA 3F6VA 3Q9VA 4LR8A 4DV0F 2F5DA 5I4MA 4ESBA 3M8QA 4F0KA 1CJUB 1S12A 2JHEA 5DDQC 3FM5A 4M5DB 3JAMY 4O6JA 1FD8A 1LV5A 5B0BA 1PAEX 2L9DA 3ZXWA 2YKQA 1X1BA 1WG5A 3EJMA 2CQNA 4DSFA 2V34A 4YN3B 3WC2A 1J9IA 1D8KA 1N36J 4KN4X 3DHXA 1R1VA 4BKXA 3M07A 2OMLA 4BY1J 2CNNB 4A47A 3OD2A 2O0YA 1HMVB 3HXLA 4AUXA 2UWMA 2X1CA 4IDKB 3CWJA 3EYYA 1NHKL 3BPDA 4V2FA 2GA7A 1Y0HA 4HVZA 1FXLA 4KB7A 4ER8A 2QUFA 4HT7A 2H1KA 4ED1A 5JFRA 4R5PA 4EQQA 5C2GA 4WP9A 5I3UA 4CH1A 3CC2S 3MEDA 5L3EA 3FBIB 2MSYA 1PIEA 2MZ1A 1BLUA 2RRBA 3U2RA 1OR7C 3S3MA 4DUYJ 1SJRA 2CADA 2DNZA 4PSWA 1N5SA 4XKVA 1TT5B 1YG0A 5HMXA 2LLKA 4E6KG 2L0KA 2JEFA 1YJTA 1DFDA 2FQ4A 5DM7Q 1GNKA 1T9UA 3FBFA 1KOOA 2YNGA 4XL9A 1ZG5A 3PNIA 2IAJB 2M4MA 3W1YC 4EFAC 4WCGA 1I27A 5L1KA 5ETRA 1GAOA 4PJ0C 5D4RA 2XMUA 3OFHA 1WC6A 1O3RA 3I5AA 2IAIA 2LD5A 1LWEA 4L74A 1LWCA 1FSHA 1WJDA 3CB4A 3CDEA 4C7QA 1BM9A 1FDAA 1KZHA 1AA7A 2FRHA 1XMOF 3Q8RB 3CMMA 4I6YA 2PC6A 2HFZA 1U4BA 3TNVA 2K9MA 4K5RA 4EZ9A 3U9GA 2R7SA 3FSYA 2XZTB 2YXLA 1USTA 3A4CA 1FC3A 2XY7A 1NM2A 3Q83A 3GYGA 1RAEB 2QLBB 1AZSA 3OLAA 2B3TB 2KIQA 2F4FA 3TEGA 2XIGA 1U0HA 4Q44A 1GVDA 2ZUAA 3HL2A 3QU3A 2VXDA 4QW8A 2FQ3A 4DJBA 1E6VA 3RB4A 4XOTA 4NA2A 5KFUA 4R25A 1U8WA 2VPZB 5LBQA 4Q0BB 3FBEA 3GB0A 2ECBA 4L3KA 4N7TA 5AXLA 4XOPA 3DEUA 1DARA 2O8KA 2BOAA 2XC9A 4XPEA 1O3SA 4KGMA 2DB1A 4O5VA 1IQZA 4AL7A 4C0BA 2AKWB 3EDQB 2CW7A 4P96A 2YKPA 2HMIB 5L39A 4HHJA 3F8BA 2R3VA 3C6TB 1WCMJ 3TA0A 1H9TA 2LCWA 4DU7A 2P4WA 2ZVSA 2HDCA 3V4GA 4G7OF 5J4VA 3C6UA 2HPUA 3TOAA 3I96A 3EZUA 2HVIA 3CUQA 4WWCA 2PX9A 1AWCA 2VUMJ 4X4NA 1XCBA 3T6BA 4ESJA 2W2OP 2LDUA 3CJ8A 3M2UB 1YJNS 4WU3A 1Z05A 3BQ1A 2HZVA 4B9MA 5E3PA 3MAAB 4B3AA 7AT1B 2EA2A 3RW6A 4L6V3 1BW5A 4RNOA 1JTYA 4DX8H 4HTIA 1ETYA 5J3LA 1YRNA 2E5LF 3QAUA 3S16J 3FXUA 3TOBA 3G8SA 3T5HA 3MEEA 4ZHRA 4A8YA 4UHTA 3X1LB 3T41A 3TYTA 5JXSA 3UN5A 4GFBA 4WIQA 1JXSA 2XRLA 4XLPF 3IM9A 4C6AA 5HK4A 4LF7F 1ZR4A 3TO8A 5KFAA 2DISA 3SQOP 1TKTA 1H7WA 1VQ4I 2GV1A 2AGQA 4LF2A 2KVQE 5ICFA 1TWAJ 4M5NA 2BDPA 3AOAA 1D09B 3T9ZA 2QYGA 5C2CA 1BIBA 3PKMA 5C7PA 3FWEA 5FLXK 1U02A 4QBUA 3VYTB 2PI5A 1WSUA 1ZK8A 4YIFA 1AZSB 1BQMB 3HJVA 1LFWA 2HIYA 2L9WA 2KT2A 3QIDA 4DX5A 4A8WA 4KMUX 2CQIA 2EI5A 3H98A 4H0EA 2FJEB 1FRHA 1Z3XA 2CQHA 1UHSA 1Q78A 2UUBF 1SD6A 3CTAA 3HSRA 2FLOA 5KTQA 3I82A 3D5RC 3POTB 1XSXA 1QVFR 1FYKA 5D5UB 1X5PA 2V2QA 1RT2A 4QR2A 1TC3C 3JTPA 3W64A 2HZDA 4FXDA 3JQKA 3EPZA 4ECTA 4FF3A 3ISND 2ME6A 2WAFA 3KNAA 1RYRA 2PT0A 2L41A 1FOWA 3H5SA 4WXHA 5DQIA 3Q2TC 4DV2J 4RW4B 1R49A 2CUFA 3DDNA 2RVJA 2XBPA 1VFJA 2M45A 1NH7A 4P71A 1CQTA 1GMVA 3WIUA 4LRAA 2FHJD 5GPCA 1Z77A 3UCGA 5HROB 4BHPA 4DJAA 2UUZA 1RT3A 3M6XA 2H8RA 4NLOA 2CXEA 3GFZA 2Y9YA 2V26A 4D5FA 3VQTA 2OTLS 3GFYA 4AIJA 2UUAF 2ZBKA 2HNZB 2XLKA 2Y0MA 1N34F 4EEFG 4LJMA 3O6BB 4DR2J 4KO0B 3L7PA 3WTZA 2OPSB 2HLUA 3WIVA 4FS2A 1DDNA 1SJ1A 3V7CA 1SQFA 3CCYA 4F55A 4FF2A 1BE4A 5DLFA 2AGOA 1ON2A 2O8XA 2XSDC 2BJ1A 1WEZA 3HOYJ 2HVZA 2CJKA 4NEZA 1YI2S 3K0LA 4N4NB 1U25A 3OR2A 3H36A 5IOYA 2B5JB 2HOAA 3RKWA 4XN0A 1JXEA 4OZ0A 3UO0A 4JI4F 2HWTA 4BC7A 1FRKA 2ICWG 4UOHA 4KC5A 2PEHA 2O3DA 4U6PA 1SD5A 3WG9A 1X0PA 1QVGR 3FXKA 3OBIA 3K4LA 1ZM9A 3OTOJ 5DQHA 1SUQB 4TLQA 3M30B 5HMWA 4I0BA 2A69F 4ELTA 1NK2P 2XWXA 1NJIT 3JRIA 4K4SA 2MJUA 2LF8A 3K4JA 4K5SA 4H4OA 4E7HA 2ZVIA 3V6DA 2EXUA 4G94A 2C22A 1YOVB 2HHHF 1TAQA 4O3PA 5DS7A 3H90A 2AEJA 1N78A 2NNNA 3O44A 3H92A 2O5RA 3PRBA 1RCXB 1VQ4S 2IGOA 2XS5A 4K4ZA 2NOJB 4KT5C 4BE0A 3BGOP 4NCBA 1KVJA 2L48A 2DNLA 4QIWD 2AYGA 2RVCA 1JLQA 4X4RA 1Z6RA 3KTQA 1Y7PA 4E98A 2DT5A 5KVRA 4P75A 4ZPCA 2E35A 3ZQFA 4X4SA 3QGGA 1QD1A 2B7EA 1NO8A 1W5CC 1TL7A 2DR7A 1RLCL 5JVHQ 4LF9J 3H7HB 3IC1A 4EMDA 3K70C 2ZH9A 2W7NA 3FXOA 2Q8KA 3EVWA 1HQUB 1R0CB 3OMYA 2HYFA 5K20B 1XNRF 2EEYA 2FUG2 3GZ5A 2MG4A 4WKRA 4PK4A 4M71A 3R4KA 2WVBA 2HSEB 1FIAA 4PXDA 3ENQA 5CQGA 3QO9B 3ZTPA 4USKA 1OCOH 1YITI 3MUMP 3Q24A 3NKYA 3Q8PB 3NS5A 4OJ1A 5JUMA 2NS7A 3IKTA 2HGMA 1NH8A 2ZH4A 4LF5F 1PCAA 3HHNB 2UVUA 2R7XA 4B44A 1W26A 5K8OA 2OTJI 2Q43A 1GT8A 3FXRA 3FUYA 5D78A 3OVBA 1WGXA 5IV3A 1W7PA 2FJDB 1FEHA 3MCZA 3OTBA 4LQ3A 3AA9A 2LEAA 3PUBA 3TX8A 3J80U 1S9GB 2X1DA 5KT6A 2ALZA 4P9UA 2QSFX 4IH7A 4LRFA 2UU9F 5F0CA 3OYFA 1XDSA 3KLHA 1B4SA 2DXDA 4N8NA 1NKCA 3I53A 3CC4I 4NCGB 4DLEA 5KG6A 2C2EA 5D6EA 1F9EB 2VPRA 4MEXF 1UKUA 3A3NB 4JI3F 1SIZA 1J5EF 3J7AO 2HQIA 2PSZA 2XMVA 3RQIA 4EBCA 3L7OA 3V4IB 4Q47A 1ZYRF 2HDWA 1P4AA 2XO6A 4BEHB 3QRQA 4HF1A 4ENMA 1LJ9A 3BR9A 1X4HA 3S32A 1R5ID 5KNLA 1XS9A 3B82A 2F8MA 4M3EA 1YRXA 2NSCA 3OFFA 4TNOA 1HL6A 3H59A 4ZVSB 5JLWA 2VT2A 3BH7B 5KFIA 3G1OA 3Q3SA 4M8LA 1IBLJ 1WJEA 1YIJI 4RAFA 4ZOSA 1ZH5A 3DEEA 1REGX 2BW3B 3CNQP 2KYXA 3CJ4A 4MK9A 4DV6F 2LR8A 3PR5B 1L3TA 2B4OA 4JP0A 3U1LA 3MI7X 2OUGA 4OYZA 1O8BA 2FVQA 3BM7A 3HT0A 2W2MP 2CNKB 2MQ8A 1L3KA 4KHPF 4QYZJ 4K4VA 1DAXA 2W7AA 1JLGA 4I7HA 3T1HF 1B0VA 2UXBJ 3M8YA 2EC0A 2NYHA 1S7IA 4HT5A 4XKWA 3MR5A 5D6FA 1D5VA 2PO4A 4DG1A 3K8VA 3HO1A 5GAEU 1FEXA 2BV6A 1WNEA 2MKIA 2HGCA 1S4FA 2VASA 4DYQA 4GC7A 3THPA 1U6ZA 1JKOC 2DKOB 4B3OA 2ELJA 2NAZA 1CGPA 2J7KA 2OAZA 3EPIA 2JEGA 1TWHJ 3CCTA 3OYLA 3OS1A 1RCOB 1ZRDA 1GUUA 2CH0A 4LB6B 3MKYB 1WHWA 2OAUA 4NLPA 1YRTA 2KJCA 1SPBP 1G2EA 5HANA 1XR6A 3KJVB 2A1BA 3OYEA 3H5AA 3OYJA 2EKNA 4W97A 3DLEB 2BQUA 3SEQA 3LAKA 1J27A 1S1UA 5AJ3F 3DQVC 1MH3A 1Q4RA 5FD1A 1S10A 3BB5A 1I3OB 2M70A 3QAEA 1A9NB 4EYIB 4KMFA 1BI3A 5BR8F 4M3FA 3SSSA 3BKFA 3CF2A 4A6EA 1NK3P 3UDVA 5IT4A 4JX4A 4WTOB 3DTKA 3LPEA 1T38A 2F9DA 5C4XJ 3I5UA 3PX6A 3WQPA 4AQYF 2VQEJ 5FGMA 3LOUA 2BR0A 2EFVA 2EA4A 2GMLA 4B9VA 2E9RX 1HW5A 3FFIA 3HK2A 4IF4A 3CC2I 4CZCA 2DA5A 3ITHB 2MGZB 4C2MJ 3Q0VA 4OX9J 3GV7B 4X2BA 1CF7B 5T41A 4LG0B 1JLAB 1RZMA 3CJ3A 1CJVB 3OYKA 4RAYA 3VSLA 3SV4A 1Q16B 1X1CA 5B1BH 1FXRA 5LJ3Y 3W8PA 4JI0F 2HBYB 2RQPA 1FRMA 3ZMZA 3DLHA 4ZDPA 1HW1A 1V6HA 2NZCA 4MMOA 3I0SB 4B09A 2Z3YA 4XK4A 4KITB 4OYMA 5J8FA 3VAIA 1CC8A 2WA0A 5DD4A 1WWHA 3U1MA 3W5YA 1GTEA 1LQ1A 2MC4A 3DCFA 4EJTA 1SQEA 1UVLA 5CVIA 3SQGA 4XM3A 1TV6B 3C2GA 2UUTA 1G6BA 3C2HA 2OD5A 4I69A 1ERDA 1FK9B 5E0OA 1DTTA 2FEZA 3IC7A 4DCJB 1NKBA 1XSVA 2R5ZB 2TCTA 1WORA 2VF3A 3LANA 2VG7B 3RDIA 3UFCX 2BKNA 3FRZA 2PJRA 1U8RA 1QSYA 1JT0A 4OHXA 4YB6A 4J9PA 4HYKA 2ZJ2A 5K1YA 2CV1A 2W2QP 3BWGA 3FMRA 3PSFA 2H65B 2UZKA 1MMNA 2HQ5A 3ENAA 1Q7YT 3S2HJ 2JNJA 2LQ9A 2ZOFA 3KEYA 2ZJQF 4A3CJ 1IBMJ 3GV5B 1RBOB 2FHJA 2J8SA 3MMJA 4NYZA 4WKYA 3I59B 1VQOI 4XR6A 3GTMJ 4DQRA 4KT6A 5IS2A 1K83J 1MZBA 2OCCH 1RT7B 3NMRA 3QPSA 3H40A 3Q8QB 3MUVP 2J0XA 2JDJA 3OR2B 5F8NA 4RAZA 3PX4A 2O67A 3GV8B 1UA1A 1SVOA 1TQLA 2ZOGA 3TGNA 2W25A 3CGIA 1YJNI 3HX9A 2P9CA 2EWHA 2DPJA 1WVRA 4GVBB 1YG2A 1RAHB 2O01C 1DQAA 1FRXA 3OHBA 5A8KA 4U88A 2DT7B 2QV6A 2H8WA 2A68F 2AEMA 2GIZA 3HRUA 4BXXJ 2F3JA 1VQ5I 2IC3A 3OW2R 2MLKA 3J7YI 4WYLA 2V6AA 5LHHA 4CH7A 2WW4A 3H5UA 1HNZF 1EP4B 3VWSA 5K8MA 4HBLA 2I6WA 2L7ZA 3ISPA 3N79A 2CYYA 1Z7UA 3AH6A 4WYWA 1KN6A 2HFSA 2TDXA 4QIFA 2BJ9A 4OWRB 5G4DA 2XGDA 1NJWA 2MLGA 2AYEA 5ADZA 2LKSA 1S9EB 3KZZA 2LFBA 2NXEA 3JQMA 5KFBA 2L7FP 3BQ2A 4B3RJ 5DCMA 3HF5A 3BG5A 5GADU 3PX0A 1N32J 1Y5NB 1FFWB 3GZNB 4JI0J 1DGWY 5HOOA 4JX6A 2NRAC 2ETHA 5D8KB 1CJTA 5EX3A 1RT4B 4KIBA 1OKRA 2CV2A 2VG5B 3BTLA 2CIMA 1WG1A 4P2MA 3KHLA 1DQ8A 2WSFC 2DYSH 3AOBA 5CJ9A 3HFZB 4OX9F 2ELKA 2BXZA 1B4AA 3I0SA 2ACJA 1JXLA 3HSJA 1UL3A 2Q6CA 4QIWN 3NAIA 3UD3P 2XAQA 3U1KA 1V5IB 3GWCA 2F4VJ 3CLQA 2L3DA 2KL4A 5FFZA 1SH2A 2QKMB 4DOZA 4YHHJ 3L7UA 2R7UA 3JCUC 3QQAA 1KLNA 3S1TA 1F0XA 2CU7A 2P5LC 2PMZA 2IM2A 2QA1A 2CPFA 4DWIA 1Y10A 1B9NA 2EZIA 4LFUA 2GIFA 2YX1A 3W9JA 1FFSB 2POKA 3NLCA 1IRXA 2EFNA 1RABB 3RQ4A 4ITVA 3FQLA 2VU5A 3BCBA 1HOMA 1UPPA 3PHTA 5HJYA 5B7WA 3CC7S 2VBXA 2ZC2A 2G9WA 2YPZA 1K6YA 1SI9A 4OZLA 3VAGA 1VMBA 2MZSA 1Q0NA 2BEFA 3J7A1 1XTAA 3OJUA 3P9KA 3QWUA 2J6UA 1UVJA 1AUSL 3JTGA 5FJ8J 2GCFA 3DXJF 2W9BB 4ZMMA 1RWPB 1HSJA 1ETVA 1QAJA 4XDDA 2IPOB 2NR0A 4WF9Q 4MFBA 1JJHA 3I58A 3RSNA 4U7UK 5K7ZA 3GFHA 4YRVA 2QWWA 3LH2S 5KFTA 3UCZP 2UP1A 1NNDA 1TU0B 1S9FA 2QJ3A 3QGIA 3MM7A 2GM4A 4R8UB 2AHQA 4LK0F 4NYOA 2JRSA 2EPFA 5BQTA 4PWUA 3OLBA 1CQMA 1X9WA 2VKZG 1CJKA 3GJSB 1BD6A 1U5TB 3D2WA 5HODA 5D5WB 1UFWA 3GSDA 4B3OB 3I56S 4DL4A 1RWVB 3G6VA 3J81U 4P52A 3KUHA 1HC8A 5ETOA 1KYWA 3AG3H 4DR1J 1WJCA 4NLTA 4UT4A 2OJ3A 3MM7B 3EZOA 3JSPA 4ED5A 2DFHA 4DV6J 2ZCWA 1YBUA 1X4AA 1Q1VA 1OPIA 2LNBA 3F0NA 1T08B 2STWA 2C2NA 4ECUA 4JI8J 1J2XA 1IBLF 1VQKI 1A04A 2BJ3A 2JJ4D 1U2RA 2LDYA 4CLWA 3W6JB 3EDRB 3ZZUA 1ETWA 1NG7A 5F08A 1CS4A 5J2QB 4OIPF 4W90B 1G3YA 3OL6A 1F9FA 2P81A 1M5HA 1XMBA 4P7VA 1IN5A 3BJAA 1I5OB 2DNOA 4DZPA 4QR1A 3N5FA 3P6YC 3KHGA 2DR5A 1W7WA 5CAAA 1J5YA 3ESWB 3FK7A 1IJEB 1RAFB 4UF4A 5ETNA 2OZ6A 2O66A 3BJOA 2W1OA 1K6OA 8AT1B 3CP8A 1PGZA 2IW5A 4L0ZB 5C44J 2FBIA 5D4OA 1TNSA 4CO8A 2WBMA 1IQTA 1HYSB 4DSLA 4A8XA 1JKQC 3O6QA 1B99A 2F63A 2M8EA 2MQLA 2R93J 3E3VA 3QPHA 1OIAA 4KHMA 3C16B 2OQGA 4N77A 2UUWA 2DD8S 1LUJB 3MFHA 1AU7A 4RU9A 3CCRI 2YQ0A 3BG7A 3I3LA 4QTRA 3MFKA 3COAC 2G0JA 3ENVA 1T3NA 3GYHX 1FOKA 1O7LA 4E7KA 1HDDC 3BGRA 2NUUG 1FJ7A 5KFEA 2KQRA 3T6JA 4UY8I 3OYMA 5LD2C 2GIQA 3ZMDA 4ED8A 2QRRA 1RT1A 5D0GA 3LGNA 4NXNF 1HQ2A 2ZC3A 3ZZYA 3GFMA 4URGA 2PEBA 2V8PA 2HVRA 5FKKA 2DR9A 2GAUA 1BJZA 2ZMEA 2ZSHB 3LSGA 3CCMS 2VG5A 1LKXA 1W36D 2Q1ZB 3H8YA 1IR2A 3MMCB 3OHAA 1MMGA 5D3GA 2KMUA 2YWKA 1G3TA 4LIWA 4JI1J 1FD2A 1R6YA 2CA9A 3LA3A 1D3WA 1MMDA 2LG4A 5BOXA 2Z2YB 4ZK7M 2B6AB 5DETA 2IHR1 2O6GE 2V4JA 4BL0B 1NK6A 1ENHA 3O2IA 4J7CA 4FN5A 1IKVB 1Q86T 5D4LA 1FF2A 1X31C 2MZRA 3DKDA 3L2VA 3KK3B 1ICEB 3UVJB 3AHPA 3AKZA 2UV8A 1ZOTA 2EVZA 3HSDA 2BHYA 1WZ2A 1QE1B 2I5JA 4HDUA 4OI1A 4IRHA 5RUBA 1HBUA 4PJNA 3KYCB 5ICGA 2V68A 1MLAA 1VC0A 4DLGA 2KFZA 1BC6A 3F73A 1ZS6A 2RRNA 4CDIA 2LXIA 4PWDB 2DNQA 1ZZFA 3CF5Q 3M7VA 4NMLA 1DTQB 1T94A 3MFIA 2J9DA 1UWBA 2DH7A 1P8GA 2CW8A 1XTZA 3TZYA 3UN3A 1R36A 3KUGA 4F25A 1R7IA 4OHVA 2OF7A 3RKYA 2LC2A 2FE3A 4LF6J 3AJ2A 4ID5A 1UJ6A 3EWGA 3KMQA 2PA3A 2OU2A 4HV5A 1Q8KA 5J1NA 1J09A 5IT9Z 5D0RA 4NUBA 3G8TA 5M5WJ 2NVUB 3JRCA 4MQVA 1NEEA 5D4NA 2VKHA 3CJSA 3EQLF 2PFBA 2WK4A 2VG7A 3BP8A 3P49B 3RZDJ 5J1EB 2L01A 4DHVA 1F3FA 4F91B 2B9EA 4YFNF 4CO2A 2W9BA 3GIKA 4K4XA 2ZBPA 1QVTA 4TY9A 3W3SA 2DGVA 3S3OA 3OYCA 2EPIA 2VQHA 1DQUA 3V5RA 2L54A 3SQGB 3HPGA 3OYDA 3G1MA 5F8IA 3PR4A 1EA3A 3I0TA 1UETA 5F27A 2AYMA 1VLOA 3KLGB 1F1BB 4CYDA 5F3TA 2Z4PA 5D4SA 5D77A 2ZE2B 5J4YA 3F21A 3D5MA 3PJWA 2Y0SD 4DV1J 2W24A 3G2XA 4I56A 3CDUA 2UU9J 3OIQA 4U7UD 4WXCA 1X60A 2EBIA 1K78B 1RR7A 5AXMA 1TZLA 4Q8FA 2K86A 1ETKA 2HHPA 3QPLA 3IS9B 4RW9A 3FKBA 2DGXA 3ET6B 1U0JA 2MXYA 2N4CA 3RGIA 4ECYA 4NC7A 5K9FA 3FFIB 1LK7A 1UVNA 3MQ0A 2JN6A 5KFKA 3HSFA 2B7BB 3I4MJ 2G0CA 4QW9A 4AM3A 1S4EA 3RRHA 2CVEA 2DHGA 1WF0A 4RGRA 5E3RA 2P9EA 4QYZK 4BAYA 3R5DA 1RHKB 1N0VC 2HZAA 1O3TA 4LFCJ 2A2DA 4A3MJ 1DQ9A 4HX7A 3GG0A 1E6YB 3MM9A 4IHSA 1CJTB 1U2CA 1MJBA 4C3LA 5IT3A 3WU1B 5A2QU 4X1EA 4LG3A 4HDHA 4HX8A 2GMJA 1EH7A 1XNRJ 3S7RA 4ZJZA 5A6WA 3MR7A 1V4RA 1S1UB 4ES2A 2OPTA 1D9DA 3H0GJ 3O2PE 5HNHA 3AQOA 4DU8A 1BJAA 4G9YA 2FZKB 2F5VA 3ILIA 1WRJA 3VYSB 4I7FB 3UKGA 3SFZA 2MW8A 1I6HJ 1B1BA 3D3CJ 1V5GA 3SXYA 1QU3A 1A36A 5GAHI 1SFEA 2AGPA 3FDYA 4WU2A 2QA4S 3QNWB 1A31A 2KKOA 3JSBA 3RB3A 2PN6A 1VQLS 3VTIA 2WONB 3PQKA 2FJ1A 8RUCA 1U1PA 1ZGWA 1T02A 1L3VA 1UG0A 2HHHJ 2R7FA 3SIPB 1F2GA 4ENNA 1QBJA 1RT5B 1OCPA 1X4OA 3W5ZA 1AROP 1XMQF 1B8IA 3Q9SA 2ZXHA 3WX8A 4CCNA 3PJ9A 2VL1A 5LGNA 3WU2C 2BANB 1JE8A 3DGPB 4W4MA 3WHIA 1HWLA 4L72B 3U21A 4ZVHA 2JUCA 4JI4J 1VQOS 2LK2A 2XPWA 2AJ0A 2CPDA 4DCPB 1OISA 4NZ7A 2VT3A 3PM9A 3JS9A 2HFUA 2LLZA 1RKTA 4F3MA 4DSJA 1U24A 3NGTA 3E5QA 2L3MA 1XSDA 1PBAA 3TQNA 3ZGKA 1QE1A 3PIOF 4DR2F 4L5EA 1TFYA 3VGUA 5K8PA 2ILZA 2DNGA 2HR3A 2NS8A 3CUOA 1TQPA 2CPZA 3GP9A 5I42A 1URRA 4CLKA 3JSMA 3CCVS 4YDDB 1WUUA 4PGHA 2MY7A 1M1GA 2RILA 4NQWA 1OWXA 3CPWR 3I9V9 3HRMA 5M5XJ 2FJWA 1XMOJ 4NC8A 2B9YA 2YY3A 1FYMA 4I4BA 2ATLA 3W5XA 2XCPA 1I6XA 2AXLA 3DF8A 3V42A 5M5YJ 5H1SV 3RTRA 2COBA 4A3EJ 4BNCA 1D8ZA 1REVA 3R8YA 1NSAA 5H6RA 1YK9A 2XWYA 5CD4H 4Y65A 3MMBA 1WHYA 1YJ9S 5DEQA 4MIMA 4FYDA 3I71A 1V3FA 3E5XA 2JZYA 4Y33A 3I32A 1OPCA 3DTEA 3CD0A 2H09A 3DPLC 1QUPA 2D1CA 3QWPA 1R8HA 2VH7A 2XM3A 3H42A 3ZTOA 2GS8A 1W25A 2PMZD 1Z4UA 2OJED 2J9DE 1OSCA 2VA2A 1WDDA 4IO1A 3DYAB 4YR3A 4ESFA 1JGSA 3QJPA 4HDGA 4R0EA 1DUXC 3ONQA 4BJTA 5JHFA 1NSPA 1Z1ZA 1MNEA 2DNPA 4NLXA 4RX6A 2AIRB 3GU0A 2QO3A 1WHUA 3SFIA 2IM3A 3VF0B 2ZM6F 5IQ6A 4Y52J 3GQCA 2ID3A 2LY2A 2E44A 1RWXB 3BO2A 4LSLA 4C3MA 4LF7J 4ICLB 2GO8A 2Z30B 2CQ3A 4CLSA 4XMYA 5CD4A 2XQCA 4JK1X 1HR0J 5I3UB 1WKLA 1K4TA 1HW8A 2L9SA 3OY9A 1CVJA 1E17A 3GWZA 1J0RA 2ZBQA 3QIPB 1MU2A 3JSOA 4ZVGA 2FY8A 3D66A 1BHNA 4JB8B 2WAQN 1JLQB 3HPHA 1JQGA 4GKJF 1Q5YA 3C6UB 2B4PA 1F9HA 4DV0J 1G1XA 3TI0A 3SXLA 4DI6A 3TANA 3IRWP 2H3EB 5FB2A 3CC4S 5CYVA 5KFNA 3K59A 4JBCA 3DOKB 3FK6A 2RREA 5SZTA 3CJTB 1P9QC 3I55S 3RBZA 3OXGA 4G3IA 2FHMA 5GADJ 2BQRA 3OWTA 2C3PA 1IUJA 4MIBA 2UXCF 1Z3YA 1CJKB 1RA7A 3W8GA 3RU0A 3CJKB 1OCZH 4FNIA 1KGSA 4B8XA 4BQNA 4C11A 2NUHA 2Y48A 2MQMA 4MYUA 2DY1A 1L5UA 4Q43A 2LVWA 1TKTB 4MO7A 2CAJA 4CSWA 1EHWA 1JGGA 3FX3A 3HOSA 1TVRB 3SEOA 4KJIA 1XC9A 3PY8A 1X3WB 3WX4A 2KFDA 3WGIA 3MGJA 2GXBA 4WK3A 2K27A 2ELHA 1OQ6A 5F0WA 3K6GA 5E3MA 3LSMA 2R5YB 3CJNA 4K50A 2OGUA 2CPXA 4HLYA 2QC3A 2LRDA 4ZVEA 4RB3C 3KP2A 1S5ZA 3HKZD 3OVAA 4JI5F 1U49A 1I94J 4ZDOA 2RSQA 2DVIA 3BF4A 3GCXP 2H4YB 2ADBA 3H35A 2K3FA 1RU2A 3M8SA 2GIVA 3D54A 1N5QA 4RNHA 2JA7J 1SIWB 2MKSA 5DRKA 3Q8SB 2FTRA 4EJWA 2QEXS 3BGUA 1R8AA 2IRXA 3GR0A 1SXLA 2HHVA 2K85A 2BKOA 3O3KA 4KRWA 4XIUA 5E7OB 1UJ8A 1YBAA 2WAQD 5EEGA 1QZZA 2P6TA 2XTJP 4A5NA 1UP1A 3ERED 2ALYB 2CNOB 4KYZA 1B0TA 1LWFB 1YIJS 1YRUA 1QLNA 5MAOA 2AJ4A 3HOTA 4KGZB 1D9AA 4UV9A 4B08A 3MKLA 3EYZA 1UEKA 4LBPA 3A1YA 4JOMA 4WJBA 1S6LA 4EBDA 1Y00A 3DRPB 3OL8A 3CMEI 4W92B 2RD5C 4K4WA 2D41A 4DV7J 4RW4A 3PACA 3IRQA 3P4UB 3QAHA 2XLIA 2CQ7A 4ZLJA 1AOYA 2VQLA 1S49A 1U26A 3RZOJ 4XSXF 4A3FJ 5EX0A 2D1VA 5KFOA 1PJ7A 1VQNS 3MM6B 4PZVA 2KHMA 1QA6A 1M5OC 2BEOA 4M5GA 3V81A 4IRGA 2ZKZA 4OYAA 2M4GA 4M6YA 3C46A 3QGPA 2DU9A 1YJVA 4I1TA 1OCRH 1POGA 3N6MA 2KG1A 1S97A 1OYWA 1R8CA 2CKWA 1IVZA 4GO1A 4YY3J 3LSKA 3L2CA 2M8GX 4R0JA 2MZTA 3B78A 4WTYA 1AA1B 4XK8C 2GVZB 4DR4F 1SFXA 3VQSA 2V4QA 1H6KX 2ME0A 2DRAA 1D8JA 3E8OA 3QGHA 3I5BA 2ZHOA 4NXMJ 3VSKA 1YJWI 2YNIA 1AKHA 2Z2MA 1E3HA 4RW9B 1HD1A 2DW4A 1BWEA 3G73A 5ETQA 3CP2A 2JFDA 4JV5F 3IBWA 4IFVB 1S9HA 3OR1C 4DPXA 1YLFA 3NWRA 3HVRA 2HWVA 3M6UA 4LD5A 2DCLA 1C1BA 1DBDA 3LQVA 4NLGA 4BJ5C 2RC4A 1R6VA 2ZJQQ 1DP3A 3A01B 2DT9A 2BGCA 3PZPA 3S1MJ 2HS5A 5B0CA 3H9QA 2VUGA 4USMA 1IKWA 3KZIC 3K4KA 2G13A 2YKNA 3OIPA 2DO7A 2BYCA 4IDKA 2F40A 3ZRGA 2C3YA 2CZVC 2V1UA 3LSPA 1GH8A 1WC3A 4RR5A 4HF0A 2EG2A 2JRTA 5IT0A 4NEYA 4OZ3A 4PDKA 2LOOA 4BQAA 1TKZB 2QLFB 2EKYA 1SV5B 1CQNA 1VI0A 2HKEA 2RN7A 1ZPVA 3GJQB 2XYPB 3CD7A 3W2VB 1RQ0A 1Q1KA 2NVXJ 3SCLE 5A2QY 2XY5A 4JI8F 2DLLA 2D9OA 2GAHC 4KTQA 4F4YA 2GFFA 4ES3A 3K2AA 2Z9OA 3K89A 2I10A 4NRTA 4IHVA 2BE5F 3FMWA 2XV4S 4XKBA 5ICCA 4XDCA 2Y1LB 1LK5A 2V79A 4DPTA 2EILH 5LFAA 5IP9J 1R0AA 2EINH 2RAEA 1AXQA 4TY8A 3PW4A 5TGTA 4AIHA 3PFYA 3US5A 1U6BA 2QF7A 4AVZA 2VA3A 5F8LA 5AXNA 2VFUA 4FKXA 3VEPA 4DG1B 4RBVA 3BYPA 2DMPA 3OL4A 5LXYA 2D3ZA 2RU3A 1HW9A 4QWEA 5GP9A 1KQ0A 2RUGA 4HH0A 3QFWA 1S0MA 1F1ZA 4LUBA 2C2DA 4EM1A 3CO9A 5C5JA 3EYIA 4WIIA 1MSWD 4LIVA 3S93A 4I6WA 2XUBA 3B02A 4Y28C 5DD8A 3PM1A 1LXNA 6FDRA 1Z1DA 2G2ZA 4L9NA 3K7RA 4PQAA 1FNMA 4UXNA 3MKZA 2M7AA 1H74A 4EM2A 1TL3A 1I39A 2YNHB 4LF1A 5CABA 3ET6A 3R5BA 4OIXA 5D4PA 2ROPA 4DV5F 4PFOA 1NHVA 1KP6A 3QT7A 4L75A 2H1LA 2CPJA 4CI0B 4D5CA 5A8WA 4DQSA 3LP0A 2V1DA 4X4VA 2EBEA 3M6WA 3MM5A 1XMXA 2OD6A 3RW7A 2Z99A 4Q2LA 1FT9A 4QU6A 2F4MB 4FQGA 4KIAA 1ACMB 4ASNA 1VBKA 1X4EA 3OR1B 5KG7A 1JJ8C 4ECVA 1RRJA 3A8KA 3PFOA 3M8ZA 2JEJA 3DHWC 1RT6A 1HPZA 2F4IA 2R3SA 4OLPA 2HOTA 2QQ9A 1S6PB 1KHWA 1TQIA 4PEOA 1QHGA 1SH0A 3ADAC 4OZ5A 5CHCB 1HBOB 4M3BA 1HNXJ 4DYCA 3D6TB 4WZMA 1U3EM 4TLRA 3EETA 3E1SA 2Y1IA 2XMJA 2M0GB 4AE5A 1S9GA 1YIOA 1FMVA 2BZ2A 2CDQA 3KK1A 3NGKA 1SVMA 5IC4B 2IDLA 4ID8A 1RWOB 3PW7A 2RS8A 4JI2J 4RW8B 4DX6A 4PPDA 5DJBA 5FLVA 3DLJA 4I09A 2D69A 1YX2A 3R5GA 2DJNA 4GC6A 2WAQA 5CH7B 2ZFWA 3M9AA 3JRAA 3FCWA 3H0PA 1ZETA 2HBRB 5B5EC 4MEYF 2EK1A 2OPQA 2OTJS 4DR3J 3FXMA 3A01A 2FNPA 3DRXA 3L3CA 2AJFE 5HP1A 3PJRA 2QTWA 2Q6BA 1OCCH 3SCKE 1LOUA 4KH1B 2WHOA 3TAPA 3PV8A 1K7AA 5EZGA 5KG5A 2A6MA 2ZH7A 5IWAF 2B7CB 2E7VA 4EWTA 4KKOA 5U47A 3HZGA 1IJFB 4F8RA 5KFLA 3G6ES 1JJCB 1JLEA 1E3OC 4I6ZA 3DOLA 1TUWA 1SC4B 4Y2IA 5ILUA 2XS2A 2O03A 2JPCA 3HM5A 1QDUB 5K7FA 1JJ6C 1A7GE 3ML6A 2HDDA 2A10A 2KT3A 2X7IA 3CCLS 1B72B 2HEKA 4MT1A 2VQFJ 2MB0B 5IPAA 2QL5B 1W5TA 5F0UA 1WHXA 2IT0A 2ZUGA 4LRDA 4EJVA 2H5JB 5IFMA 3H5NA 1Q8IA 2IMOA 2L5QA 4J19A 2JMWA 3G2BA 4EEYA 2YKMB 2DHHA 2FB0A 2MSTA 2V6CA 2Y2ZA 1PG5B 2ISZA 2N4DA 2D9PA 3M3YJ 2ZFHA 3IWZA 4C3JJ 2OHDA 3KP6A 3CC7I 4LQ9A 1HI8A 2OP5A 5HDGA 2ZMEB 2JA6J 4PRFA 1HQCA 2RHSB 2Q0OA 1APSA 4YOEA 5L3BA 4UOCA 1WH5A 1HNIB 3ZZTA 1T9YA 3HOZJ 2DPIA 3P5TL 3DRPA 2M3DA 2HRUA 1RTJA 3GFLA 3T0YA 2XNQA 4HL9A 2ZM6J 1WOSA 1UFKA 3FBNB 4FASD 3WC0A 1IG7A 5KG1A 4DR5F 3TO9A 3TARA 4YFUA 3C16A 4KR0B 3QRPA 2V63A 4LSLB 1FEEA 3KMSA 5CYMA 4Q5SF 2JC1A 2I2YA 1X1DA 4C8YA 2WV0A 1N33F 5EWEA 2ZO4A 3M8JA 3M4OJ 3DLBA 3P8BB 4CRJA 3QP5A 1KQKA 3DMJB 4PYDA 3IR5B 3LAPA 2OPRA 2MZQA 4FXVA 4KGXB 1Q1HA 1TP7A 2C2MB 4LRBA 3QSYB 3HHDA 4J9SA 3AG1H 1WI3A 1HBMB 4OX7A 1N4LA 5LGUA 5T7LB 2YQ3A 3FF5A 2Z33A 1JUMA 2RE1A 4F36A 1Y56A 3WTYC 3OUYB 4A2UA 4NCAA 2LY1A 5F64A 2R5YA 1X4FA 3W63A 4DFPA 5T14A 5CYMB 4DN9A 2KPMA 1CS4B 2DIUA 2ILYA 5B08A 1X58A 1HMVA 3DTIA 2DEJA 2OV7A 2VPLA 3KLIB 1PYTA 2IA0A 4RGXA 1V5FA 2QN6B 4OV6A 4PUOB 2U1AA 3M2VB 1IKXA 1JLBB 2JLFA 1NZAA 3Q8UA 4FPIA 1OQ3A 3WGHA 2YWGA 1FWPA 3B6CA 1Y11A 4J01A 1VR6A 3SJMA 3W6VA 4IVNA 4DPOA 4UVAA 5KFCA 2DOAA 2DJIA 2IA6A 1SANA 3NWSA 3QATA 2R8IA 1S8NA 2HNYA 4OI3A 3R7NB 3H9GA 2CZ4A 5B0GA 2OZUA 5TISC 1BBYA 4XICA 3TAMA 3LA0A 1NU4A 1NDLA 3NMAA 3GCMA 2R2RA 4ANEA 2F5FA 4LF4J 4GYGA 5GAEI 4BWJA 1NJYA 3HFKA 5J1YA 1YSJA 3GFIA 2HWIA 4NC6A 2BJ8A 5K8NA 2R8KA 1J59A 2K3PA 3EUNA 5L46A 3IGNA 1FJEB 2GA2A 3M30A 1VRTA 1S1VB 5BYQA 3PSIA 2JA8J 1RGVA 3I6PA 3W60A 3WBZA 3BY6A 2AD9A 1B72A 1LB2A 1WEXA 2E1NA 2D5VA 1QSSA 4ZCKA 1S0NA 4Z7YA 2WY8Q 3RCOA 4N8OA 4O44B 1F36A 4PCQA 3ZXSA 4KYWA 2V8HA 4HHUA 4WZQA 1HSTA 2X6OA 1JTXA 2UXXA 2YU9J 1IUYA 2OEMA 4MTPA 1Z0XA 3A8IA 3HCXA 4Z7CA 4EBEA 3PJXA 4F4WA 5JVGF 3HM9A 2BANA 4KKOB 4UOFA 3NCQA 4KPCA 1EETB 4P2XA 2Y1RI 4D7NA 2VDHA 1LW2A 2FLPA 4ZVRB 1VCTA 3KWMA 4XLEA 4JI6F 3I59A 2B43A 2YKOA 1KA8A 2IRFG 4B9TA 4C2MA 5F9LA 3MWBA 3AD8C 2YVSA 2HFVA 2I0XA 2GQQA 4DL0C 2NS0A 3KP5A 1TKXB 2Z0GA 1PILA 1H72C 2J76E 4DQ2A 3I4NJ 4OHZA 3BTJA 4P2FA 4F4AA 1VS3A 1V3SA 3I9ZA 5IOLA 2DH9A 4OIQF 4AD9A 1I1SA 3VAJA 3BCAA 3HVTB 4OJ3A 2NOGA 4LLLA 3ELHA 2BBEA 2KXHA 2OO4A 3EGVA 5CCMA 4DV4F 1LXJA 2E9ZA 3LSJA 2WVFA 4OYBA 4D3HA 1LVKA 2DODA 2XC7A 1S6OA 4L18B 5A0YB 2ASJA 2HYJA 2K9QA 3S6EA 2LREA 2DNNA 3ELKA 4K59A 1S59A 1MBEA 2P2CB 1Q95G 3PVXA 2K9SA 5HDNA 1RA6A 1XJWB 1F5CA 2W9CB 4DPWA 2Q1LA 2DQRA 1IBCB 1U0SA 4NWBA 3CCZA 1U1KA 2DK8A 4A0XA 2M3AA 2ZD1A 1FOYA 3QLHB 4H4MA 4QLCU 1RXOB 3N05A 1VQNI 1UPMB 1JI8A 4Q45A 3T5JA 3C18A 4OIOF 1PUEE 2DNRA 2HKXA 4OZ2A 1NB7A 3MMAA 4HH1A 5ETTA 5F1JA 3FEXB 1ETQA 3D1HA 4PJMA 1FDDA 1VQ5S 4IQMA 3ABMH 4M95A 1VQPI 3KLEA 3MEDB 5KFMA 3C3LA 1IN8A 3GMGA 3LL7A 2XLJA 1OSDA 4IHXA 4IFYB 5L9XA 3ZNJ1 3CW2C 2K4BA 5GVQA 3F41A 4MH8A 4CTAA 1K78A 4C3IJ 4B3XA 4O4RA 4XTTA 1ZAWA 4RWWA 3KLFB 5KAFC 1IN4A 1JLEB 3MM8A 1N25A 2B0GA 4GYIA 4CO3A 1HI0P 2KIFA 2AEFA 1WC4A 3OR2C 2NZ4A 3L00A 1S7AA 1OYIA 1IDZA 3QJLA 1IV8A 3P9CA 3F3XA 1RTIB 3AD7C 4ON0A 1BIAA 3HG9A 3ZQIA 2CJ9A 2DGUA 2IM1A 2RQ4A 4NZ6A 1MG7A 2OSQA 2K06A 3IP0A 1XDUA 2AMCB 2LKZA 5BYRA 4FF1A 2WVEA 4AT1B 5ETVA 4HYEA 3G6XA 4GGGA 3H1CA 5AXKA 4RBOA 2L7MP 1LNWA 3Q5FA 3UI3A 3M32A 4HI1A 2WONA 4FTHA 4CYCB 4AXJA 1SV5A 4ZP8A 1BI2A 5HS9A 4DV3F 4ZJOA 2KXFA 2KJWA 3FISA 5D0EA 2KRBA 3S8PA 2QA4I 3BDDA 1U78A 3R1LA 3IH4A 1X9MA 4UY85 1SFKA 3DXSX 5DGBA 5KFQA 4DNCA 3OVSA 5FKNA 1NK8A 1Q79A 4ZYAA 3I9V2 1A6QA 4ZDNA 1JUSA 3DRSB 2Y0SN 4M6VA 2IVMA 2ADCA 5J2MA 3HYIA 4PWDA 3EUHA 1FERA 4L0YB 1D1BA 2ZNYA 3AY0A 3MM5B 5HL7Q 1M5VC 1FHTA 4GKKJ 3L1PA 2VIHA 4O3SA 1WKMA 2KRRA 2QLJB 2VKDA 4J90A 4LB5A 3H5YA 1UVKA 1HIYA 4WXDA 2KXNB 3FVYA 4B43A 3KLOA 4N9HA 2CV0A 3V7RA 5EYRA 2MMYA 4ZYEA 3BBBA 3JTHA 2DT6A 3BT9A 1C2PA 1G59A 1Y5IB 4F0MA 5LMUJ 1AKHB 2ACYA 4YDXA 2XROA 4LK1F 2K8GA 2QL9B 2VI6A 4QR0A 4NXNJ 3SDEA 5E5NA 2C3OA 1N34J 2A3JA 1RHUB 2F1FA 2ZE2A 1EV7A 2BW7A 4C30A 1ZAVA 1S79A 4M5LA 1RAAB 3IL2A 1OCTC 1RTHA 4KBIA 3TO6A 1EH6A 3A2KA 3BR1A 4MIWA 2NNYA 4KT0C 3RAXA 2R7VA 4NBQA 3ISNC 1NRKA 5F3ZA 4A3BJ 2JLGA 4NI2B 1JMTA 4II2A 2ATCB 3QOEA 1NZ8A 2CQBA 5K5OA 5AE1A 3DKYA 2KZVA 1OO0B 1UEVA 2KI2A 4K4TA 4Q8EA 2IXSA 1T3OA 4QIGA 4S0MA 1HW2A 1P1LA 2DDAA 2LMIA 3F0CA 1U7LA 3KE2A 4NL5A 2K9NA 1ZAOA 1KWMA 5AE2A 3GTYX 3PRDA 1MD0A 4F2SA 2QM3A 3R5CA 4HKQA 5D5VB 2AU0A 2LY9A 4ERDA 3TW6A 2VPWB 4DR6J 4WE1B 1CJUA 1V55H 2IA2A 1URNA 1EH8A 5F8HA 3M9MB 4A3IJ 1K4SA 3EXCX 3N01A 3QO9A 1KFDA 1UCRA 2W00A 5SUHA 3R7BB 1HCRA 3FEZA 4DEZA 4ZVQB 4M5MA 2XGEA 1B64A 4YIIA 2N3OA 4TQRA 1L3UA 4N9IA 2GOXB 2LXFA 1RHQB 2LQ8A 3FM3A 1K1SA 1K61A 3MAQA 4OFZA 1UAWA 1PC5A 3KJNB 2ABYA 1LVAA 3CD6S 3QRFF 1WF2A 4BQOA 4EK2A 4J9UE 4X6AJ 1KQFB 4I01A 4WFBQ 5DYMA 1TK5A 3K5MA 4XRMA 4E4HA 5H2FC 4QPQA 4Y4RA 1KU7A 2FC8A 2GQ2A 4EGZA 2VE8A 1BQNB 4Y6IA 4F67A 3HB9A 1S5LC 2DFEA 1YFHA 2QL7B 2HYIB 2QFJA 1HLVA 2H51B 4ECXA 1SJ3P 1D9FA 5BPDA 5KFHA 5L8RC 3HHGA 3AL0B 5DZ7A 5A8RB 3MMCA 4UQGA 3QZ8A 2VLAA 2ZZTA 4CCKA 2FJAB 1N56A 4AUKA 1TAUA 2IYGA 1B7YB 2IYIA 1W1WE 1ZM4A 3CSKA 4AYBA 3EGZA 2DRDA 2CQKA 1ZAXA 2JZ5A 2QLWA 2H5EA 4NXMF 1IBKJ 2UV1A 3GG1A 1I51B 2PIIA 3BG9A 3KDOA 4WK1A 3OSGA 4MNUA 2ZD1B 4CZZA 4TV7A 3BSAA 1U1MA 1KS2A 1X2NA 2CJAA 3HKWA 3A8JA 5FO5A 1GDTA 3A3PB 2CDRB 2K3IA 4OZ1A 3L09A 4ALZA 1OY6A 5F41A 3R6LB 3QJJA 1QNTA 3EUHC 4RW7B 4ZLNA 2JA5J 1W7PD 1S7EA 4P74A 2EZHA 2OEKA 1X4BA 4JYAF 3K10A 4XORA 4ANJA 3HVTA 2VB6A 2DY9A 5EG0B 1U48A 2EW9A 4Y2KA 2WW8A 5DG8A 1LW0B 1UELB 1PKUA 2F7VA 1H88C 4XQFA 4DV7F 1KQ8A 1HNVB 1TP4A 3GMEA 3V8JA 1GXTA 1ZZNA 1HHQA 5K5RA 1T6SA 4IUFA 2V4RA 3HJFA 2EV0A 3VFZA 3P9IA 2QEXI 3DOMA 2V9WA 1HYSA 1X5OA 2XASA 2VJ5A 2WTEA 1FJLA 1TBXA 4Y2MA 2XHWA 1BW6A 2GGPB 3ZZRA 4RM3A 1NCLA 4ED6A 2E34A 3KDNA 2RT3A 2AJ1A 2BRLA 2O1PA 1T0FA 1BC7C 2LU2A 2QMWA 3DKWA 2QQ8A 4LT6A 4ELVA 5DQGA 1MWZA 3DLGB 4AD6A 4XPCA 4B3RF 1V3ZA 3LAJA 4MIAA 3QQCD 1TL7B 1QJHA 4IQXA 2M88A 2H6BA 4YMEA 2VONA 4P7TA 5HN0A 1RISA 2XZDB 4CM0A 2LYVA 5CXTA 2B8QA 4BU2A 1EARA 1YTYA 1RUOA 2OQRA 1HNZJ 4Q5VA 2EFOA 2DA6A 2CPEA 4Y00A 5C4JJ 3QPTA 3M05A 4PUSA 3FHZA 3HP6A 3OYNA 3H2LA 1GV2A 4LIUA 5KFRA 1H2UX 5KFPA 3GIIA 3N4MA 1OLTA 4B02A 4ZYGA 4MYTA 4RUAA 3DXBA 2DFIA 1NK4A 3FEYB 4MKBA 3AL0C 3SQNA 1BQNA 4EO6A 1EF4A 4CM2A 3PKYA 2D3O1 3TEDA 1KRPA 1KU2A 4XRSG 1MNDA 4PR6A 2XSJC 2X85A 2KJVA 3WDOA 5KT2A 3WTTC 1YRNB 3G87A 4DL7A 4LR9A 2JJ7A 1C4CA 4BHBA 2PMWA 3A12A 2FHOB 4BUPA 2GZWA 2LEPA 2AP6A 3CJRA 2QKLB 4CUGA 3J80Y 1TK8A 5IT9K 3H5RA 4X4UA 4GKJJ 2F5CA 3ABKH 3LFUA 2D1HA 4OMYA 4RU2A 1SB6A 2FVCA 2XI3A 1XGSA 1N5YB 2WVDA 2EFWA 1FBSA 1V54H 1IZ1A 2VBYA 3G4SI 4Y0FA 2B0LA 4ED0A 3KXDA 4UB6C 3MN2A 3MD2A 4N56A 5HBMA 4M72A 2DEIA 1HR0F 4YEJA 1BR2A 1SC7A 1SD4A 3EXYA 1HA1A 2DCEA 3E0JB 3HLUA 2JWNA 2ZB9A 1NXIA 4IRIA 3PYDA 3DLAA 3GYXB 1XGNA 2QMUB 4DR7J 2MQNA 2RV8A 3Q22A 5IT9Y 1SVDA 2X3DA 3J80K 2R9LA 2GLOA 4NE9C 2F48A 5FFXA 3ASNH 2BY0A 2IGNA 4I2PB 5ETKA 2DCUB 2NXUA 2QMXA 1RT2B 2Q66A 3CDHA 2L4MA 2N8GA 1N48A 3TL4X 1M5PC 2XNRA 2AX1A 1G6NA 2CUEA 3T5LA 4A8OA 2VFRA 5DCMB 3LFKA 2DGOA 1BA5A 3UR3C 4YIRX 2QYCA 3IRXB 1GLNA 3J81K 4IRKA 3H3VK 4HOBA 1REPC 2EFGA 2NYXA 1VQMI 2DITA 2RQQA 3K1NA 2LF7A 3JYTA 4Y2AA 3NBPA 4ZN1A 4G6DA 2OI2A 1KU3A 3FHNA 3SDEB 1FLIA 4JI6J 4RB1A 4PG8A 1WTBA 1O7FA 3NWGA 4PAAA 2B8PA 1XMAA 1E6YA 3ZQCA 5EHHA 2KFYA 2IC3B 3MPUB 4DBQA 4IO9Q 1VOMA 1CF7A 1WJAA 3HFVA 2M0MA 1QO0D 2W7PA 2JOQA 4A3LJ 3RZAA 1X5TA 2VJJA 2MA3A 2XS7A 2LU1A 5GAHJ 4DS4A 3E2EA 2H1YA 5DDOC 3TOQA 4M9SA 4Z6YA 3GTKJ 2PFFB 2HQGA 3M8FA 3CCVI 4FISA 1FKAF 1ULRA 4O23A 4XKCA 3CIMA 1EQMA 2AV5A 4K0KJ 2A3SA 2AHOB 4AL5A 1SL2A 2P8IA 3DN9A 3UW1A 4C8LA 2COMA 4UUXA 4BQQA 3FSXA 4JI7F