1TTYA

Solution structure of sigma a region 4 from thermotoga maritima
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
87
structure length
87
Chain Sequence
KEAMRMLMREELEKVLKTLSPREAMVLRMRYGLLDGKPKTLEEVGQYFNVTRERIRQIEVKALRKLRHPSRSKYLKSLLSLMDENEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords RNA polymerase sigma factor rpoD
publication title T4 AsiA blocks DNA recognition by remodeling sigma(70) region 4
pubmed doi rcsb
source organism Thermotoga maritima
total genus 19
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2004-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04545 Sigma70_r4 Sigma-70, region 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1ttyA00
2EB7A 3L2CA 1ZG1A 2CSOA 4ZH4F 1P4AA 1HQCA 4R1HA 3ZPLA 3V7SA 1SD5A 5L3BA 5D5VB 5D6FA 1WKMA 2EFOA 5ERIA 4UVCA 5HDNA 1G3WA 3GFIA 2KJCA 1YS7A 5E1XA 3BDDA 1XGNA 3BJAA 4XRFA 5JHUA 4HDUA 3VB2A 2XAFA 4EM0B 2DFIA 1BI3A 3CUQB 4LJZF 4R8HA 4G6QA 3F23A 4M72A 4JQFA 1LEBA 2UZKA 3V7RA 4LFUA 1C0WA 1W5TA 4M6XA 4A6DA 1U78A 3VODA 2L4AA 3BZ6A 1BN5A 4OINF 2OA4A 3Q5FA 4GYIA 2P6TA 4KIFA 5LEKA 5KK1A 2MH2A 3J80Z 4CGZA 2H94A 4Z2YA 2GIVA 5HS8A 1XGSA 2BV6A 3CTAA 3R0JA 3F22A 2RGVA 3ECHA 1H9GA 4IVNA 2IRFG 2L02A 4UV9A 4EJVA 3I59B 1IN6A 3J7AO 5L3DA 3IC7A 1XD7A 3NRVA 2GZWA 5H6RA 2O6GE 3SXYA 2HDCA 1Z6TA 1MKMA 2XAJA 2EA2A 3TDUC 3E6DA 2VT3A 1OYYA 4Y15A 1D8JA 2OZ6A 3IL2A 3DFGA 3BPVA 4YFKF 2V1DA 4EQQA 1J0RA 1Z6RA 3V8JA 2BEOA 4KIBA 2MD5A 5D8LB 4U7DA 5E1ZB 1RUOA 5D8KB 2DK5A 5LGNA 4IF4A 4JK1X 2Q8KA 1SMYF 4Y17A 2ZXJA 5CVRA 2HR3A 2VBZA 4YG2F 4PDKA 1U5TB 3FMQA 4GGGA 5ILUA 1MGTA 4MGRA 4M74A 4Q47A 3ZMUA 5HVQC 3JTGA 1J7KA 3E6BA 3W6KB 2NAZA 1I1GA 5L3EA 4EJWA 1SD6A 2FEZA 1ODDA 1UB9A 2FBKA 1ZHFA 2Y48A 2WC2A 3SQNA 4RAYA 4RS8A 1YO5C 3TOAA 1R5GA 3REOA 2P4WA 4LK0F 1V3FA 3GFLA 2A07F 5DUKA 3G3ZA 2STTA 1J5YA 4KA4A 3ZN0A 1FYMA 3WTUC 4F7ZA 4XLNF 5D5WB 4U0VA 5CVJA 2RNJA 3LAJA 3ZMDA 4FHTA 2GAUA 3RJPA 2F5DA 3KE2A 2XVCA 4KYWA 3Q9SA 4DQ2A 1TLHB 3JAMZ 4YIFA 5J8CA 2NRAC 4HF1A 1GHCA 1MJBA 2E7WA 1B9MA 3K2ZA 1OYWA 1LVAA 3K1MA 3Q9VA 4HOBA 3BPXA 1XSDA 1IW7F 5FFXA 1Z1DA 2XGXA 1B1BA 1XMKA 4Q4ZF 1D5VA 2KIFA 2MH9A 3O6BB 5DEQA 1GXPA 2VXZA 4XSZF 3SZTA 3LSTA 1V4RA 4RB3C 1DUXC 5HS9A 1B6AA 4EJUA 2NNYA 4AD9A 2M8EA 2QENA 1FP2A 4EMSA 3ERED 2RDPA 3I58A 4OIPF 4G7ZF 4ZYDA 3MEXA 1U3EM 3GVAA 3U1DA 1ON1A 3W6JB 4A6EA 5BPIA 1XSVA 3HHHA 1UCRA 1WQ2A 1T2KA 2IPQX 2O8XA 1FYLA 2DT5A 4CICA 5ILSA 4ZYEA 3I71A 2Z33A 1FT9A 2YX7A 2ZJ2A 3FWEA 5LGTA 1USTA 4HLXA 1AWCA 4LD5A 2R7DA 2CQKA 2K02A 3CUOA 2K27A 1JHHA 2Q2EA 5AIPA 1ZG5A 1HSJA 3DF8A 3MWMA 4ENNA 5L3FA 4EV0A 2QQBA 3V4GA 1RI7A 4OOIA 4ENKA 4HX4A 4PGHA 5LHHA 3BP8A 5TRDA 2PFBA 3QAHA 2PG4A 2GXBA 2BYVE 4HV6A 5E8GA 5DV5A 2QLZA 3R60A 3LWFA 3FX3A 5CLSA 5HS7A 2JT1A 1YG2A 1ZGAA 4IRGA 3D0SA 2P8TA 3K9TA 4XSXF 3R0AA 3WODF 4HBLA 1KU9A 2O03A 4EVIA 3DPLC 5FD6A 3WE2A 3RIRA 3QPTA 1ONVA 2V79A 5IT9K 4FX0A 1ZH5A 4CO8A 4CXFA 1S7AA 4Q5SF 4A0XA 5FGMA 4A0YA 2K4BA 1UHWA 2QQAA 1KU3A 2P7CB 1HKTA 1QGPA 4KMUX 1ZARA 2OZUA 2CYYA 1SFXA 1JHFA 3QP6A 5JFRA 1OMIA 3HUGA 3M8EA 3ZMVA 3TQNA 2L54A 5JI6A 3ROUA 5ICFA 1BI1A 1J9IA 2A6HF 2O0YA 3GO5A 5D5XB 4LG0B 3LFKA 4I0BA 1P6RA 5A2QK 3I4PA 2HFHA 4N9IA 1PUEE 4H0EA 3HSRA 2YR2A 1DPRA 3K69A 5AONA 3ZMSA 1XCVA 1ZAOA 5F6FA 3HTUA 2K86A 3CJNA 4ESBA 4LK1F 3IKVA 2O3FA 4DNCA 1H0MA 2X4HA 2NNNA 5E1WA 5D5UB 3PQJA 4GCVA 2DO7A 2L3DA 2R7FA 1FPQA 1T6SA 3RYPA 1YFHA 4HF2A 5LRRA 4RGSA 1ZRDA 4O3MA 2LF8A 3GFJA 1F5TA 1FNNA 3GYHX 3JW4A 3ZP5A 2OD5A 2JSCA 3K1NA 3NEUA 2NS0A 1MDMA 4KMFA 1SD7A 2YPRA 2A6EF 1TTYA 1WI9A 3ZMTA 4U0WA 3RI4A 3E5UA 2GWRA 2EJRA 3GX4X 4YIIA 4R79A 1W7PA 1WSUA 4L0ZB 2HEOA 6PAXA 4M9SA 2B0LA 2EV0A 1MZBA 2W24A 2LNBA 4ENJA 5K1YA 1H9TA 5FD5A 4EJOA 3CUQC 1IRFA 3K0LA 1S8NA 4AWXB 5DD4A 1FSEA 5ICCA 4MEYF 1KU7A 1L3LA 4HQEA 1U2WA 3V7CA 1K78A 4IXAA 3LA3A 4S04A 2QBYA 2F5EA 1IN7A 2J5PA 2KJBA 2CG4A 3TGNA 2RV8A 2E7XA 2QZ8A 3WTWC 1CF7A 2A61A 3EYIA 1ZRFA 1MJ9A 2V6CA 3DKWA 4U0YA 2DPUA 3WTTC 1O3QA 1IAWA 3T0YA 1HW5A 3QRFF 3C7JA 2A3SA 1AOYA 5ED4A 5E8IA 2HKXA 4M71A 3N4MA 5H20A 1YW8A 5EEGA 4KIGA 2PJPA 3WU0A 4IRIA 3EQLF 3DV8A 1O7FA 3EUHA 4ZZLA 4RB1A 2HYGD 1X3UA 5E20A 2HKOA 5TJJA 1U8RA 2XRNA 1O3RA 2IA2A 4OIQF 1G6NA 1IUYA 1XCBA 1K79A 5LLQA 3TO6A 2QVOA 2PMUA 4PCQA 4P9UA 2ESNA 2PLYA 2P5VA 3IHUA 1J59A 4A12A 4AIKA 5E17F 4KN7X 4TV7A 3WU1B 1B9NA 1FC3A 1FBUA 3H3ZA 4I98B 2HGCA 3DXJF 3FM3A 5DCFA 2G7UA 2FBIA 2AXLA 3TO9A 3F8BA 3RPQA 1BBYA 4MEXF 1U5TC 3H92A 2F5CA 1EH8A 3KP2A 2XROA 1SAXA 2LF7A 1HW1A 1G3SA 1BI2A 2HQRA 4BYYA 5J6XA 2GQQA 1J75A 4JBAA 2ESHA 1FP1D 4LB5A 4M73A 3T8RA 3C1DA 2W57A 1P4XA 2P5LC 1O7LA 1Z9CA 3CO7C 3LA2A 3ML6A 1UFMA 3KCCA 2CFXA 4PZJA 1G4DA 3KP3A 2ACJA 2YX4A 4M9ZA 1FBQA 3KLOA 1I1SA 3ZN1A 4WWCA 3QU6A 2L01A 2XIGA 2NYXA 2WTEA 3N97A 1EH7A 1R1TA 2QYOA 2UWMA 3S2WA 2IA1A 3C18A 1IRGA 2EFNA 4LLGF 2E1NA 3D5LA 1F9NA 3P9IA 1PP7U 3T5XA 3FMSA 1QZZA 1KU2A 3TO7A 1R1UA 2ZKZA 2H09A 2F2EA 3HYIA 2DQLA 4EM2A 2YU3A 2DI3A 3I54A 4AIJA 4G94A 3F6VA 2LKPA 4WCGA 4P9FA 2HWVA 2KKOA 2CO5A 4HQMA 4UVBA 4D0PA 4G9YA 3LQQA 5BQTA 5IT9Z 5CVVA 5DYMA 3VFZA 3HHGA 3E3VA 3GEZA 4AVPA 3KEOA 4HW0A 1OR7A 2BBYA 2EV5A 4ENMA 5ICEA 1W4MA 3BJ6A 3DQVC 1HXDA 3KFWX 4BHPA 1BI0A 2VBXA 4WXDA 2D2WA 2KRFA 4I2OA 3HOSA 4HV5A 2HTJA 3AAFA 3KETA 4HAMA 4MNUA 2ZCWA 3BWGA 1KYWA 3HTSB 5A2QZ 2QUFA 3J81Z 2KIUA 2X0LA 2Z3YA 1WWXA 1KQ0A 2FXAA 3HIFA 4I7HA 1B4AA 1KYZA 4BHCA 3FHZA 3GZ6A 4LLLA 4AIHA 3WG9A 1IN5A 1DDNA 2GA2A 2E1CA 2QQ9A 5HOOA 2JPCA 3I64A 4XBFA 1FSHA 2DPDA 1HKQA 4I02A 1NHAA 4ZZDA 1ZLJA 2R3SA 3KP4A 4CDGA 1ZYRF 1VTNC 3M8FA 3FM5A 3B02A 1XSXA 1SFUA 3KP7A 4BH9A 1LEAA 5ICGA 3TOBA 3DP7A 4A5MA 3ECOA 3KEQA 3ELKA 3G73A 2O61A 4ETSA 2DAOA 4RGRA 2UXNA 2MC3A 3LA7A 5FO5A 3KZZA 1KA8A 1YW9A 2XAHA 4L9TA 5E18F 1KQ8A 4WK8F 2VBWA 2FBHA 2VC0A 4UV8A 3R6SA 1FOKA 4NQWA 3MZYA 4L0YB 1T38A 4L5IA 2IJLA 1R1VA 1OYIA 2P7VB 2FMYA 2FE3A 2W25A 4ESJA 5D4SA 2HQNA 3FZVA 3ABUA 4I09A 3GZ5A 2DQRA 3BJOA 2XASA 1FLIA 1STZA 1REPC 2DLLA 4B8XA 1G3TA 2F5FA 3I5UA 3TDZC 5BMZA 3ULQB 2XHKA 3EYYA 3RKXA 3CLOA 3F8CA 3HRUA 2UXXA 2FRHA 2VONA 3NQOA 3OV8A 1OKRA 1W5SA 2V1UA 1XMAA 3IKTA 1F4KA 2MLKA 4P55A 2HYFA 2XAQA 4G7OF 1FYKA 2M45A 1SFEA 1LDDA 3KP6A 1CGPA 5K5OA 3FMRA 4BQAA 4MQ9F 1W7PD 4KT5C 3IRRA 2VOOA 3RPUA 2C6YA 5FLXK 4YFXF 4L9NA 4RB2C 1EV7A 2VBYA 2ZBKA 5KVRA 1BJAA 4ZYHA 3BOQA 2PI0A 2WWYA 3FF5A 1JGSA 1R36A 1A04A 3GLXA 3J81K 2QM3A 2XUBA 1R00A 2K4JA 4L5JA 3IRQA 3U9GA 4CHUA 4HX7A 4MQVA 2XV4S 3I59A 4KN4X 2M30A 1P4WA 5FB2A 4EGZA 4EGYA 1ZN2A 2G7HA 1DPUA 1QQIA 1RUNA 2PEXA 1IXCA 3FXUA 5EEHA 4EM1A 4P5OA 3K1PA 1Q1HA 3WTSC 3P7NA 4BNCA 4OIOF 2XKOA 4OU0A 2EFQA 4WX9A 1O3SA 4HZFA 1E2XA 5IT3A 1T98A 4G8XA 2A5YB 2OQRA 2RN7A 3DPTA 2M1BA 2M87A 2FNPA 5L3CA 3COAC 1FBSA 4K2EA 4Y13A 2ISYA 1JXSA 4L9JA 3KZYA 1U5TA 3P9KA 2OQGA 3JTHA 5CJ9A 1YYVA 5BPDA 3F8NA 2VE9A 3RDIA 4LB6B 2ADUA 4WXCA 2OAZA 3GWZA 2W85A 1L0OC 2Y75A 2Z9OA 1LJ9A 5JVTA 3GW2A 3H3UA 2J5OA 1R58A 3BROA 1FWZA 3L9FA 2H6CA 2JTVA 4M6YA 1IXRC 3MZHA 5HLGA 1ULYA 2Q0OA 2VODA 3L09A 4GO1A 1USSA 1J2XA 4L18B 5LRSA 4IHSA 3SHFA 4UNOA 5LHIA 1P92A 4EJTA 1LQ1A 1XB4A 2ZMEA 3PFIA 4BAYA 3T1BA 2HTSA 2DTRA 4HA8A 2FSWA 3EETA 2FU4A 4RGUA 4BXUA 1JE8A 1E17A 4NHJA 4O5VA 4LLNA 3C3WA 3I0TA 1UHMA 3ZQ7A 4ASNA 4U88A 5LBQA 1S6LA 4HX8A 1TBXA 3HSEA 5K5RA 3OOPA 5CVIA 4E70A 2L4MA 4RGXA 1ON2A 4OMZA 1IF1A 1YTYA 1ZGJA 3V8LA 1FZPB 2MLGA 5L3GA 5LGUA 2Y0MA 1LDKB 3F6OA 2DU9A 3I53A 2LDUA 4QLCU 3V8KA 5LEJA 3KLNA 3O3KA 3L00A 4KDPA 1LDJA 2D1HA 2FOKA 2ZO4A 1DP7P 1XGMA 2WV0A 4UVAA 1BIBA 3RYRA 2P5KA 4HF0A 1K6OA 3FXRA 3F8FA 2FF4A 2P6SA 2K7LA 3FXQA 2ZFWA 3WGGA 3DEUA 1MDMB 1FY7A 5HDKA 4WXHA 5CYVA 5DD8A 3EDPA 1Y0UA 1YQAA 4LMYA 1RNLA 1OPCA 1W7PB 4YFNF 1GXQA 5BS6A 4M9XA 1ZRCA 2YSRA 2A69F 2BGCA 2FNAA 3F3XA 2VC1A 1ZREA 1ZG3A 1YW7A 3M7GA 5HDGA 5H6QA 3QU3A 2EA4A 3VOEA 4PGGA 1IXSB 4IRHA 1K78B 1D3YA 3KP5A 3JSPA 1O3TA 2DK8A 2QBYB 4HDVA 2EWNA 1R22A 2HZTA 3GFMA 4UHTA 2EFWA 3ISPA 2FA5A 1BOAA 5D4RA 5DCMA 2MA3A 1CF7B 1EH6A 1T39A 2COMA 1BIAA 3ABTA 3R61A 5DUIA 3MAJA 2ZMEB 2JZYA 3RTRA 3RKYA 1IN4A 3J80K 1P2FA 1HBXG 2RC4A 1O57A 1U6GA 1XDSA 3VEPA 5ILVA 1TQPA 3E97A 3WGIA 2TDXA 4UUVA 2H6BA 2V9VA 3WTZA 1MD0A 2PBIA 3O2PE 1LB2A 3WTVC 2PQ8A 2D1VA 3E5QA 4GXOA 4LGWA 2D45A 2IT0A 2EV6A 4Q48A 4KUMA 4MHGA 4MTEA 3M9AA 2ISZA 3ZMZA 2BE5F 2RVCA 1S3JA 3F8MA 4B09A 1Z7UA 2PN6A 3LAPA 4NB5A 5J8FA 3SFZA 3SZPA 1RIOH 4S05A 5FLXZ 1R5HA 4I0AA 3CDHA 1YIOA 1ZLKA 2V1XA 1TQIA 3T8TA 3F72A 5D6EA 2IA0A 2VE8A 1SD4A 4CZZA 4OIRF 4IHTA 4BHBA 1Z91A 1TNTA 2ZNZA 2STWA 4KICA 1LNWA 3GF2A 4U7BA 5AIQA 1HW2A 1BC8C 2OBPA 3HOTA 1WRJA 2PMHA 2JRTA 1XDUA 2RQPA 3MCZA 1SMTA 1PDNC 4LG0A 2HS5A 3F21A 1I27A 4HYEA 1D8KA 2M5WA 2FQ3A 5F64A 5DCMB 4IJAA 1I6XA 1RZ4A 4P96A 4ON0A 1QO0D 2FMLA 5FFZA 3GXOA 2XKPA 1QNTA 3E6CC 1IN8A 3RKWA 4XLPF 1MJAA 2IVMA 1F1ZA 4N9HA 3QPHA 1G3YA 4ZYGA 2DW4A 1IZ1A 2AS5F 2CGPA 2DBBA 3E6MA 1B59A 3R4KA 1YS6A 1R23A 4HLYA 1R7JA 3WE3A 2Z99A 5CVUA 2XAGA 4N0BA 1S7OA 1BM9A 4RAZA 2LSOA 1TNSA 3PQKA 1HSTA 2H27A 3HRMA 5BOXA 3MFKA 2QWWA 3BY6A 4IPAA 2MBFA 3P9CA 1TW3A 3JSOA 4QWQA 4MTDA 5JR3A 5K5QA 3JAMK 2OU2A 3MQ0A 2GA1A 1TW2A 2Z5UA 5HLIA 1I5ZA 3IWZA 3CUQA 3U2RA 3M1EA 2GXGA 1Z05A 1GVJA 1QZYA 1YLFA 2CWEA 4KFCA 2RKHA 4ESFA 1K7AA 2VN2A 3HRSA 3L7WA 2ELHA 1HKSA 3TKYA 1TQMA 1BC7C 2VT2A 1QBJA 2W84A 4G6DA 5F1RA 1S29A 3CO6C 4A5NA 4FX4A 5HLHA 3E5XA 3WGHA 2IP2A 3HRTA 1KQ9A 1XN7A 3QOPA 2HOEA 4L9VA 2A68F 2CW0F 4G7HF 4KNYA 2EFPA 4CYDA 1XGOA 4A0ZA 3HSFA 1QPMA 2G9WA 2VOPA 1FX7A 4WF2A 5LHGA 3LQRA 3WTYC 2JPBA 2EK5A 4RB0A 2ZNYA 4OMYA 4A2UA 4GYGA 3B73A 2KIMA 4UXNA 3GUDA 3WTXC 2IW5A 1KGSA 2ETHA 1T0FA 3IWFA 1PP8F 4O6JA 4I01A 3QP5A 5DDGA 4FT8A
chains in the Genus database with same CATH superfamily
2EB7A 3L2CA 4HSTA 2OV7A 1ZG1A 4IX7A 3BG3A 2CSOA 4ZH4F 3S2HJ 1P4AA 1HQCA 2EBIA 4R1HA 3ZPLA 3PO3J 1V5FA 3V7SA 1SD5A 1UG2A 2EZIA 4NQWB 3EPZA 5L3BA 5D5VB 2K9SA 5D6FA 1LKXA 3DLAA 1DGWY 1WKMA 2EFOA 5ERIA 2K9QA 3CCRI 4UVCA 5HDNA 2HXIA 1X1CA 2JRMA 1G3WA 3GFIA 2KJCA 1YS7A 5E1XA 3QPSA 4M3GA 1V54H 5BNGA 4ZTFA 2H8WA 3BDDA 1XGNA 3BJAA 2NVQJ 4XRFA 3HOYJ 4A3JJ 5JHUA 4HDUA 1WGXA 3VPRA 1K4SA 2R7OA 3ZQCA 1Z3YA 3VB2A 2XAFA 2ZXIA 4EM0B 2DFIA 1BI3A 3CUQB 4LJZF 2LMDA 4R8HA 4X0GA 3I4NJ 4G6QA 3F23A 4M72A 3CC2I 4JQFA 2MG4A 1LEBA 2UZKA 3V7RA 5F0FA 4LFUA 1C0WA 1W5TA 1UG0A 4M6XA 4H4KC 4A6DA 4RA2A 2EIKH 2GOMA 2JUGA 3VODA 1U78A 2L4AA 3BZ6A 3DKXA 1BN5A 3PL8A 2IEKA 3CF5F 4IHXA 4OINF 4AC0A 3G1OA 2OA4A 3Q5FA 3M4OJ 3FBIB 2JA5J 4GYIA 4BDYA 2P6TA 3S93A 2ICWG 4KIFA 3S3NA 5LEKA 5KK1A 1AU7A 3MKZA 2JWTA 3OYMA 1XPXA 2BHYA 2MH2A 5M5YJ 3J80Z 3CCJI 4CGZA 2H94A 3BC8A 3OYHA 2CUZA 4Z2YA 2GIVA 1JUSA 1HDPA 5HS8A 4A3IJ 2M4KA 2DXIA 1XGSA 2BV6A 3BR0A 3CTAA 4CSWA 4XRSA 3CJTB 3R0JA 4N4OB 3FK7A 2FQ4A 1RESA 4RAGA 1MNMC 4DZJA 3F22A 1JT6A 2RGVA 3ECHA 1H9GA 3B6CA 4IVNA 4XLCA 3FIWA 2IRFG 2L02A 4UV9A 4EJVA 4RBOA 1IC8A 3K6GA 3I59B 1IN6A 3J7AO 3LSHA 5L3DA 3IC7A 1MBJA 1K4TA 2YS9A 1XD7A 4A3CJ 3QQAA 3ZQQA 3NRVA 4PSWA 2GZWA 5H6RA 2O6GE 3SXYA 2HDCA 1Z6TA 4XL9A 1MKMA 1U8BA 4YEJA 2XAJA 3CC7I 2PJRA 2EA2A 5IY5H 3TDUC 1W0UA 1D0ZA 3E6DA 2VT3A 3G1MA 1OYYA 2IS6A 3VYTB 1W36C 4ZDPA 2JMWA 4Y15A 1D8JA 2OZ6A 2LY1A 2M8GX 3IL2A 3DFGA 3BPVA 2HU9A 2YU9J 4YFKF 2V1DA 4W97A 3S1RJ 4EQQA 2BW3A 1J0RA 3ZQGA 1U9NA 2V1NA 1Z6RA 3PNTA 1AHDP 1KZHA 3H1CA 1VQ4I 1Y56A 3V8JA 2DA3A 2BEOA 2VJ5A 3GMEA 4KIBA 2VXDA 4E7SA 4HEA2 2MD5A 5D8LB 4U7DA 2X48A 5E1ZB 1RUOA 3OWTA 5D8KB 2DK5A 5LGNA 4IF4A 4JK1X 4BY7J 2Q8KA 2LP0A 2Z2SB 3OR1C 3MN2A 1SMYF 4Y17A 3HC7A 2ZXJA 3AG2H 5CVRA 4JX4A 1VI0A 1YX3A 1PYVA 2HR3A 3OL4A 3GBGA 2VBZA 4DZPA 2GOXB 1OCCH 4PDKA 4YG2F 1U5TB 3FMQA 5JHFA 1P9QC 4GGGA 2X85A 2XF5A 3DBHB 5ILUA 1MGTA 1O4XA 4MGRA 4QPOA 4M74A 4OAYA 2CU7A 2CV0A 1HDDC 4Q47A 3A02A 4JX5A 3ZMUA 4P1WA 2E2JJ 2CH0A 3FKIJ 5HVQC 2DDBA 4S0HB 4E7HA 3CQZJ 4XR6A 1YITI 2ID6A 1FOXA 3JTGA 4DJAA 1J7KA 3BG9A 3M1CA 4ZTJA 3E6BA 4B4CA 1ETQA 3W6KB 3JRCA 2DA5A 4B3XA 2NAZA 1X4PA 3HJEA 1I1GA 2X51A 2XPWA 5L3EA 2BXYA 4EJWA 2CV2A 1SD6A 2FEZA 1ODDA 1UB9A 2FBKA 1ZHFA 2ZFUA 2Y48A 2WC2A 3SQNA 4RAYA 4RS8A 2NOGA 1BR4A 2COBA 5J1RA 1TT0A 4UB6C 1YO5C 3H0GJ 2NVTJ 5IPAA 1ITYA 3TOAA 2VQLA 1R5GA 4Y33A 3REOA 2JA7J 5FKLA 2P4WA 4LK0F 5E3OA 4V2FA 4AU7A 3K70C 1ERDA 5E3LA 1V3FA 3GFLA 3K4MA 2A07F 5DUKA 4KITB 3G3ZA 2L2OA 2STTA 1J5YA 4LG3A 2WADA 4KA4A 3ZN0A 2X6OA 1FYMA 2R7ZJ 3WTUC 2EZHA 5LFAA 4F7ZA 3I4MJ 4XLNF 3FBNB 5D5WB 4M3FA 1JGGA 2HOTA 3PO2J 2EINH 4U0VA 5CVJA 2VB6A 2RNJA 4J19A 3LAJA 2VQCA 1JT0A 1F43A 3ZMDA 2LC2A 2VL8A 4FHTA 1J09A 2GAUA 4CCLA 3RJPA 2MW8A 5F04A 3S32A 4IOAF 1F36A 5HLTA 2F5DA 1AKHA 4IL6C 4XKVA 3KE2A 4ZC3A 3JR9A 2XVCA 4KYWA 4XKWA 3Q9SA 4DQ2A 1TLHB 3JAMZ 4YIFA 5J8CA 4RM3A 3CCMI 2ZMEC 4BE1A 1ETWA 2NRAC 1MIJA 2X1EA 3CCQI 4HF1A 5JLWA 2XGCA 1GHCA 4RM2A 2A5WA 4DOZA 1MJBA 2E7WA 2PMZA 1HC8A 3PSIA 1B9MA 3K2ZA 1OYWA 1LVAA 2DA1A 3K1MA 3Q9VA 4NNJA 2PX9A 4HOBA 3BPXA 1XSDA 3SFIA 1IW7F 3EUAA 1MW7A 5FFXA 1MMNA 1Z1DA 1B1BA 2XGXA 3PJRA 2ZSHB 1XMKA 3QWLA 4HSRA 2E1OA 3A1YA 2DYSH 3CCLI 1E3OC 5EGOA 1QPIA 4Q4ZF 1D5VA 3LSGA 2KIFA 1TWHJ 2DMQA 3OYCA 3OYBA 5KAIC 2MH9A 3O6BB 5DEQA 4LITA 1IJWC 3EUHC 1GXPA 2VXZA 2M34A 2HVSA 2MSYA 1R5ID 4XSZF 3LOCA 3OIQA 4CYCA 2JQ7A 3SZTA 3LSTA 1V4RA 4RB3C 1Y6IA 1YIJI 1DUXC 3W3CA 1I39A 4CZCA 2BZTA 5HS9A 2KZGA 3TBIA 2ME0A 1B6AA 1RC9A 4EJUA 3H9JA 2HI3A 4BUPA 3BG7A 4LIUA 3N05A 1T08B 2NNYA 4AD9A 1V5GA 2M8EA 4XRMA 2QENA 1FP2A 4EMSA 4E7ZA 3ERED 2RDPA 3OYJA 1UMQA 3I58A 4OIPF 4G7ZF 5J40A 4UUSA 3MKLA 2WY8Q 4ZYDA 3TL4X 3MEXA 3JRAA 1U3EM 3GVAA 3U1DA 1MNDA 1ON1A 3W6JB 4PUSA 3TMOA 4A6EA 5BPIA 5TISC 3HBLA 1RR8C 2DFHA 3CDLA 1XSVA 3HHHA 4E7IA 3L2WA 1UCRA 3KX2A 1WQ2A 1T2KA 4NDLA 2IPQX 2NVYJ 3OS2A 2QSGX 2O8XA 3HPHA 4V2GA 3KYDB 1Y39A 2HZDA 1FYLA 4QSHA 2CW8A 1PUFA 2DT5A 2Q1ZB 2XF7A 1TL8A 1T56A 1D1AA 5FKMA 3ZXSA 4CICA 1GT0C 2M0CA 3LSJA 5ILSA 4HNVA 1YRNA 1OISA 2KRHA 5E3MA 4ZYEA 1DP3A 3I71A 2Z33A 1FT9A 2YX7A 2ZJ2A 1ETOA 3FWEA 5LGTA 2V6EA 1USTA 4HLXA 3G71I 1AWCA 1VQLI 4LD5A 2HOSA 2Y69H 2ZJPF 1X19A 2R7DA 2CQKA 2K02A 3CUOA 3SJMA 3WU2C 2R7SA 2K27A 1JHHA 2E1MB 1A31A 2Q2EA 5AIPA 5GAHJ 1ZG5A 1HSJA 2ELKA 3DF8A 3FXJA 5HNHA 3MWMA 2F4OB 4ENNA 4B44A 5L3FA 4RDUA 4EV0A 3CCVI 1LFPA 1A5JA 1IRZA 2NS7A 2PMZN 3SEQA 4E6KG 3BG6A 1LFUP 2QQBA 2CMPA 1Z77A 4PJ0C 1JUPA 3ABKH 2DMPA 3QOEA 4JYKA 5IOYA 2Y30A 4BACA 2WBMA 3LMMA 3V4GA 2X9DA 3SYTA 1RI7A 2QA4I 4OOIA 2IAIA 4ENKA 4HX4A 4PGHA 1QVUA 5LHHA 3ZQLA 1OCTC 2CQQA 3PFYA 3BP8A 5TRDA 2PFBA 1ETVA 2H1KA 3QAHA 2PG4A 4BXXJ 2GXBA 2BYVE 3KYCB 4HV6A 5E8GA 5DV5A 1N78A 2QLZA 3R60A 1WJBA 2BY2A 4XNFA 2R5YB 3LWFA 3FX3A 3NWTA 5CLSA 5B66C 1HCRA 4XOTA 5HS7A 2AXTC 2JT1A 2HDWA 1YG2A 1ZGAA 4IRGA 1YOVB 2DA2A 3D0SA 5E3NA 2P8TA 1JJ8C 2NXNB 4HRIA 1AA7A 4XN0A 3K9TA 4XSXF 3R0AA 3H5NA 3LSRA 4CYCB 3WODF 4GDFA 4HBLA 1KU9A 2O03A 3RSNA 2ZJRF 4EVIA 1UZCA 2ECBA 3G4SI 3DPLC 2WAEA 5FD6A 4C3JJ 3WE2A 3RIRA 4V19K 1OR7C 4XRSG 3QPTA 1ONVA 2V79A 5IT9K 4FX0A 3ASNH 1ZH5A 4CO8A 1K83J 1V5EA 3CCSI 2F6CA 4BS9A 4CXFA 3CMEI 2MC4A 1S7AA 1R71A 1QHHD 4Q5SF 4A0XA 5FGMA 4A0YA 1R6RA 2K4BA 1UHWA 3QPLA 2B9SA 2QQAA 4UUSB 5K7FA 1KU3A 2P7CB 1HKTA 3Q0UA 1QGPA 2OTJI 4KMUX 1ZARA 5EEAA 1S7EA 2OZUA 2CYYA 1SFXA 1JHFA 3QP6A 5JFRA 3BR3A 1X58A 4A3BJ 1OMIA 3UNGC 1Y8RB 3HUGA 1DU6A 3M8EA 3KIOA 3ZMVA 3TQNA 1TWFJ 4LIVA 2L54A 5JI6A 3ROUA 5ICFA 3EUKL 4ANJA 3PNVA 1BI1A 1J9IA 2A6HF 2O0YA 3GO5A 5D5XB 4BBRJ 4LG0B 3LFKA 2CUFA 5F27A 1WJDA 2LKSA 1VQ8I 1OCRH 4I0BA 1P6RA 4CCKA 5A2QK 2E34A 4A3EJ 3I4PA 2HFHA 1FIAA 4N9IA 1PUEE 2R93J 4H0EA 3QYFA 3HSRA 1Z21A 4FQGA 1MH3A 2YR2A 1DPRA 1IDZA 3K69A 3FDYA 1MBGA 5AONA 5DTDA 3ZMSA 4ZDLA 1XCVA 1ZAOA 5F6FA 3HTUA 4A3FJ 3H0DA 2R7VA 2K86A 5TGTA 1VFCA 3CJNA 1MBEA 4ESBA 2L5QA 3QYBA 2DJNA 4LK1F 3CD6I 3IKVA 1BL0A 3S2DJ 2O3FA 3DU6A 4DNCA 1MSEC 1H0MA 3OS0A 3I55I 1NK2P 2LRDA 2LR8A 1WJEA 2B7EA 3DEWA 2X4HA 2XC7A 3ZCOA 1X3ZB 3PNYA 4A3GJ 2LKXA 2R92J 5B1AH 4XICA 2NNNA 4BBSJ 5E1WA 3VWBA 5D5UB 3PQJA 4GCVA 5GPAA 1DGRM 4G12A 4BEHA 2DO7A 4BE0A 2L3DA 2R7FA 2F48A 2KZVA 5B5EC 4MLOA 1FPQA 1T6SA 2M0MA 3RYPA 1M1EB 1YFHA 3H9QA 4HF2A 5LRRA 2LBFA 4RGSA 1IGNA 1ZRDA 4O3MA 2LF8A 3CJQB 1H88C 4RLFA 3S1NJ 3GFJA 1F5TA 1A36A 1FNNA 3GYHX 3JW4A 3ZQFA 3ZP5A 4IO9F 2GLOA 2OD5A 2JSCA 2HPMA 1FIPA 3K1NA 2CW7A 3NEUA 4BJ6C 2NS0A 4F91B 1MDMA 4KMFA 1MMAA 2OC6A 5EJCA 1SD7A 2YPRA 3L2QA 2A6EF 1TTYA 3U21A 1WI9A 3GTOJ 3ZMTA 4U0WA 3SEZA 3RI4A 3E5UA 5KCMA 2GWRA 2EJRA 3VSKA 3X2QH 3GX4X 3S1MJ 1G2HA 4YIIA 4R79A 5C4JJ 1W7PA 1WSUA 4L0ZB 2HEOA 3DEEA 2B63J 6PAXA 4M9SA 2B0LA 1MMDA 3VYRB 3TEDA 2EV0A 1WJCA 1MH4A 1MZBA 2W24A 3Q0WA 1P7IA 5FKKA 3A4CA 2LNBA 4JOMA 2KISA 4ENJA 5K1YA 1ZQ3P 3AL0B 5CPRB 4AIDA 1H9TA 5FD5A 4EJOA 3CUQC 3FXKA 1IRFA 4X6AJ 2E36A 4ZJZA 3K0LA 5F08A 1SANA 3AG4H 3U1KA 1S8NA 4AWXB 5DD4A 1FSEA 1FJLA 5ICCA 4MEYF 1KU7A 3L2VA 4CA0A 3DKYA 1L3LA 4HQEA 2W4SA 1U2WA 3V7CA 1K78A 1UJ8A 3BR1A 3MVPA 4IXAA 3DLLF 2IGMA 3LA3A 4S04A 2QBYA 2F5EA 1IN7A 2J5PA 2KJBA 2CG4A 1X2MA 2KLOA 5C4XJ 3KYLA 2P81A 3TGNA 2RV8A 2E7XA 2QZ8A 4CUGA 2DA6A 4C30A 2VKDA 4BQNA 3WTWC 3P5JA 1CF7A 2A61A 2RREA 3PUBA 1FMWA 2BY1A 2FJ1A 1ZRFA 1V55H 3H5AA 3EYIA 1MJ9A 2V6CA 3DKWA 3L2UA 3Q0VA 4RAFA 4U0YA 1B72A 4D7MA 4PFOA 2DPUA 2L7KA 3BTIA 3WTTC 1G59A 4D1QA 1O3QA 1IAWA 1XS9A 2R5ZB 2X6WA 3T0YA 3JRBA 1HW5A 4FASD 4CCMA 3VYSB 3QRFF 3C7JA 4XM3A 2A3SA 3G2BA 1AOYA 3AG3H 5FLMJ 5ED4A 1VZ0A 1R49A 2LREA 2KIQA 5E8IA 2Y9YA 2HKXA 4M71A 1IO2A 3N4MA 5H20A 4ZDOA 1YW8A 5F1JA 5EEGA 4E7KA 4IEJA 4KIGA 2PJPA 2VKVA 3WU0A 1JKQC 4IRIA 3EQLF 3DV8A 2DOAA 4RLQA 4B48A 1TC3C 4ABZA 1O7FA 3EUHA 4ZZLA 4RB1A 2HYGD 1X3UA 3IAS2 3K4LA 1QU3A 4XN3A 5E20A 4XONA 2HKOA 5TJJA 3PIPF 1U8RA 2WAFA 2XRNA 4MO7A 1O3RA 2NS8A 2IA2A 4OIQF 1G6NA 1IUYA 1XCBA 2QF7A 1W1WE 5FRMA 1K79A 3HOVJ 5LLQA 4QPQA 3TO6A 2QVOA 4A3LJ 2CFOA 4C2MJ 2PMUA 4PCQA 2JK3A 4P9UA 4IHYA 2ESNA 2PLYA 2P5VA 1SVMA 3DPUA 1MBHA 3IHUA 2IS4A 3S3OA 1J59A 4A12A 1X2NA 3L1PA 4AIKA 5E17F 4KN7X 4TV7A 3WU1B 3AFHA 2UUZA 2XAUA 1B9NA 1FC3A 1FBUA 3H3ZA 4I98B 1X4OA 2HGCA 2KHMA 3DXJF 3FM3A 5DCFA 4BU2A 2G7UA 2FBIA 2AXLA 4BE2A 3TO9A 3F8BA 4DYQA 3BQYA 2IS1A 3RPQA 5J47A 1X1AA 2I10A 1BBYA 4D5FA 5EDNA 2KT0A 4MEXF 1U5TC 3H92A 3LSMA 2F5CA 1EH8A 5LD2C 3KP2A 2XSDC 5HNFA 3CCEI 1VQ6I 2XROA 1SAXA 4Y52J 2EH3A 3OYDA 2EIJH 2LF7A 3PUFA 1HW1A 1G3SA 1BI2A 2HQRA 4QTRA 1X3WB 3LSPA 3S16J 2AQEA 4BYYA 1DQUA 5J6XA 1LE8A 1VQPI 2GQQA 1J75A 4JBAA 2ESHA 4BJ5C 2FUG2 1FP1D 5CQGA 4IOCF 1X1PA 4M73A 2LLKA 3LSKA 3T8RA 3C1DA 4LB5A 2W57A 1P4XA 4GRIA 2P5LC 2EZLA 1O7LA 2QEXI 4C2UA 1TWGJ 1Z9CA 3CO7C 3RZOJ 2MABA 3LA2A 3M3YJ 1GDTA 4BL0B 2M7BA 3CCUI 3ML6A 1UFMA 3KCCA 2CFXA 1ZTRA 4PZJA 5C3EJ 1G4DA 2DA7A 4C2TA 3I3LA 3KP3A 2ACJA 2YX4A 2DMTA 4M9ZA 1FBQA 3KLOA 3CZ6A 1I1SA 3ZN1A 3JREA 4WWCA 4EEFG 2WB1A 2IGKA 2CQXA 3QU6A 2L01A 2XIGA 2ZXHA 3BQZA 2NYXA 4D5CA 5H2FC 4J00A 3PSFA 1B72B 2WTEA 4AM3A 2L9VA 1EH7A 3N97A 1R1TA 4UUTA 2LY2A 2QYOA 2PJRB 2UWMA 1GVDA 2R4GA 3S2WA 2IA1A 3C18A 1IRGA 3RQIA 1ZR4A 2EFNA 4LLGF 2E1NA 3DBLB 3D5LA 1ORKA 1F9NA 5B3SH 2RNGA 1OCOH 3P9IA 1PP7U 1G8XA 3CLQA 3T5XA 3FMSA 3HDDA 1QZZA 5E79C 5EZHA 1H89C 1I6HJ 1KU2A 3TO7A 1R1UA 2ZKZA 2H09A 5HODA 2F2EA 4DGWB 3HYIA 2DQLA 2HQAA 2BW3B 4ZYAA 4EM2A 2YU3A 2DI3A 3I54A 4AIJA 4G94A 3F6VA 2DMNA 2LKPA 4WCGA 4P9FA 2HWVA 2KKOA 2Z16A 2CO5A 4HQMA 2V26A 2WA0A 3RCOA 2M3AA 4UVBA 4D0PA 4G9YA 1S5LC 3LQQA 5BQTA 5IT9Z 2EQRA 3HPGA 3JRDA 5CVVA 5DYMA 3VFZA 3HHGA 3E3VA 3GEZA 4AVPA 3KEOA 4AYBA 5GTHC 1OCPA 2QGUA 3NAUA 1ZGWA 1FTTA 2KPMA 3LL7A 4HW0A 3S1QJ 1OR7A 3MMYB 2BBYA 2EV5A 4ENMA 3GLLA 5ICEA 1BOBA 3QYEA 4PJJA 1W4MA 3BJ6A 3DQVC 5FRNA 1HXDA 2L0KA 3KFWX 2R7UA 3FXMA 4BHPA 5J4YA 4ITVA 1BI0A 2ZC2A 2VBXA 4WXDA 2D2WA 2KRFA 2ELJA 4MFDA 1XG1A 4I2OA 3HOSA 4HV5A 4XLEA 5JVGF 1WVRA 5FKOA 4YRVA 2DFEA 2HTJA 3AAFA 3KETA 4HAMA 4MNUA 2XDVA 2HDDA 2W82A 2ZCWA 3BWGA 2ZXWH 1KYWA 3HTSB 3DTIA 4BXFA 2XGDA 5A2QZ 2P0WA 1MSFC 3SZGA 1WH5A 2QUFA 3CP8A 3J81Z 4XLHA 2VJ4A 2KIUA 2X0LA 2Z3YA 1FTZA 1WWXA 1KQ0A 2FXAA 3HIFA 4I7HA 1B4AA 1KYZA 4BHCA 1LE8B 1OJLA 5GPCA 1IV6A 5J3LA 3ASOH 3FHZA 5JLXA 5J1YA 3GZ6A 4LLLA 4AIHA 3WG9A 1IN5A 4KT6A 4UB8C 5EG0A 2HNHA 4MIMA 1DDNA 2GA2A 2E1CA 5CQEA 3FKJA 2ZSIB 2QQ9A 4Y3OA 1Z7LA 1EF4A 5HOOA 2JPCA 5GAEJ 3CMYA 3HG9A 1FOWA 3I64A 1B8IA 1BR2A 2K9NA 2GXAA 4XBFA 3E7LA 3M07A 1FSHA 5FKNA 3OR2C 2DPDA 1HKQA 4I02A 1HF0A 2GM4A 1NHAA 2ID3A 4ZZDA 1ZLJA 2R3SA 2HVQA 3KP4A 3OIPA 4CDGA 4GFBA 1ZYRF 2EPFA 2QCOA 1VTNC 3M8FA 1EA3A 3FM5A 3B02A 1AKHB 4IHWA 4A69C 1XSXA 1SFUA 4LOCA 2Y31A 2DT6A 3KP7A 3I56I 2CV1A 4BH9A 1T8IA 3K4BA 5EYRA 1LEAA 1Q1VA 4IQ4A 5ICGA 1TZLA 2VQGA 2X6XA 3TOBA 2M7AA 2E1MC 3DP7A 1JJ6C 4A5MA 3ECOA 3KEQA 1W36D 4DYCA 3ELKA 3G73A 2O61A 4ETSA 1FOYA 2DAOA 2L9SA 1YJWI 4IQJA 2QKMB 4RGRA 2Y2ZA 2CUJA 2MC3A 2UXNA 2W1OA 3G1LA 3KZZA 3LA7A 5FO5A 1BA5A 1KA8A 2VJIA 1YW9A 2XAHA 4BJTA 4L9TA 2R7QA 5E18F 3D1NI 3WHBA 1KQ8A 1T33A 4WK8F 4AYBN 2VBWA 2FBHA 2VC0A 1VF9A 2W7NA 1RPWA 4UV8A 3R6SA 3UR3C 5M5WJ 1IRXA 3CP2A 4NQWA 1FOKA 3MZYA 2NVXJ 4L0YB 1T38A 4L5IA 5EGOB 1VQ5I 2IJLA 2R0QC 1R1VA 1Y1WJ 1OYIA 2P7VB 2FMYA 1H8AC 1LVKA 2FE3A 2W25A 4ESJA 5D4SA 2HQNA 3FZVA 3ABUA 4CCNA 1I3AA 1Y1VJ 2RQQA 4I09A 1VNDA 3GZ5A 2DQRA 3BJOA 3OOUA 2XASA 1FLIA 1STZA 2BVLA 2CRGA 4A93J 2DJIA 3K4JA 1REPC 2KDOA 5IYBJ 2DLLA 2M9HA 4B8XA 1G3TA 2E5ZA 2F5FA 3I5UA 3TDZC 5BMZA 3ULQB 2HXOA 2Y0SA 2XHKA 2JUCA 2LYCA 1N75A 4F92B 3OYFA 3EYYA 3RKXA 3CLOA 3F8CA 1UELB 2I8DA 3HRUA 1XMXA 2UXXA 3HOXJ 3HL2A 3H9GA 2FRHA 2VONA 4JP0A 3NQOA 3OV8A 1OKRA 1W5SA 3A0HC 2V1UA 1XMAA 3IKTA 1F4KA 2MLKA 4P55A 2HYFA 2XAQA 4G7OF 1FYKA 2M45A 1SFEA 3ABMH 3LSIA 1WI3A 1LDDA 1SFKA 1ENHA 3HB9A 3KP6A 3E1SA 3FMRA 5K5OA 1CGPA 4BQAA 4MQ9F 1W7PD 4KT5C 2OPTA 2V9PA 2RAEA 3IRRA 2VOOA 2MYSA 3RPUA 2C6YA 5FLXK 4YFXF 4L9NA 4XOPA 2MGQA 4RB2C 1EV7A 1PUFB 2VBYA 2VPLA 4BGDA 4IZZA 1SVLA 2ZBKA 1VQOI 1JKPC 4A3DJ 5KVRA 4MFEA 1BJAA 3TW7A 2XRLA 4ZYHA 1YRNB 3BOQA 2PI0A 2O7OA 5K7HA 1QZEA 2WWYA 2XB5A 3BG5A 1RKWA 5EG0B 3FF5A 1JGSA 2L9RA 1R36A 1A04A 3GLXA 3J81K 2QM3A 2OF7A 4BKXA 2H1LA 2XUBA 2DFFA 1R00A 2K4JA 4L5JA 3IRQA 3K4NA 3U9GA 4CHUA 4HX7A 4MQVA 2XV4S 1JTYA 1B8IB 4A3MJ 2CUEA 3I59A 4KN4X 2UV1A 4YELA 2M30A 3ZOBA 4Y7NJ 1VQKI 1P4WA 2Q2EB 3BTLA 4NBQA 5FB2A 4EGZA 4EGYA 1ZN2A 3OSFA 4UY8I 1RR7A 1VQNI 2G7HA 3W2VA 2BY0A 4KJZA 1DPUA 5EZGA 1QQIA 2W00A 3K4KA 4M3EA 5FJ8J 3HOZJ 2L9NA 2PEXA 1RUNA 3D5RC 1IXCA 3FXUA 5EEHA 4EM1A 3MD2A 2AHQA 2WY7Q 4P5OA 2E2IJ 4CH7A 3K1PA 4BQQA 1Q1HA 1E3HA 3WTSC 2KDZA 3ZRGA 2JA8J 3P7NA 4BQOA 2XGEA 3GTJJ 5J1UA 4BNCA 3A03A 4OIOF 2XKOA 4OU0A 4B47A 2JVGA 2EFQA 3F9KA 4WX9A 1UAAA 1D0XA 1O3SA 1FEXA 5IYCJ 4HZFA 1E2XA 5IT3A 3LFUA 1SEUA 1T98A 4G8XA 2A5YB 4FCYA 2OQRA 2RN7A 3BZKA 3DPTA 1BJZA 3FHNA 2M1BA 2V9KA 2M87A 2FNPA 1VQ9I 4DW6A 5L3CA 2CQ7A 2A05A 3COAC 1FBSA 2HQ5A 2JJ7A 1R4NB 4K2EA 2K40A 2NVUB 2LH9A 1NH3A 4Y13A 2ISYA 1JXSA 1A6IA 4L9JA 1W0TA 4EATA 2E35A 3TW6A 3IH2A 3KZYA 1U5TA 2DYRH 3P9KA 2OQGA 3K10A 2Y0SN 3JTHA 3ONQA 2M4GA 3H35A 5CJ9A 2XPVA 4C3HJ 4W1UA 1YYVA 5BPDA 2DN0A 3F8NA 5C44J 2VE9A 1D5YA 3RDIA 4LB6B 2ADUA 4WXCA 2OAZA 3BR6A 3GWZA 3HKZA 1WCMJ 2W85A 5K7ZA 1MMGA 1LUJB 1L0OC 3H36A 2K3FA 3CMAI 4PSXA 1IG7A 1R4MB 1MBFA 2LK2A 1S72I 4HNTA 1RRJA 2Y75A 1EJ9A 2AO9A 3F0CA 2Z9OA 3BCBA 1LJ9A 5JVTA 3GW2A 3H3UA 3AKZA 2J5OA 4PK4A 1R58A 3BROA 1IV8A 1FWZA 1X1BA 3L9FA 2H6CA 2JTVA 4M6YA 3SDGA 2DT7B 1IXRC 2E60A 4G6TB 2K9MA 3MZHA 5HLGA 1GLNA 1ULYA 3ZR8X 1U9OA 3HUGB 1Z67A 2Q0OA 4NC7A 2VODA 5GADJ 3CDIA 3QODA 4I99C 1K61A 1DU0A 3L09A 3AL0C 4GO1A 3IH4A 1USSA 3VYUB 1J2XA 4L18B 4QIWN 2KL4A 2VJJA 5IP7J 5LRSA 2M2EA 1QVTA 2CS3A 2V4JC 4IHSA 3SHFA 4UNOA 5LHIA 1P92A 4XORA 1ETKA 3W6VA 3RQ4A 2BHZA 4EJTA 3FXLA 3OY9A 3AG1H 1LQ1A 2R7TA 1TWAJ 1XB4A 1XX5A 2ZMEA 3C2BA 3PFIA 5F0CA 4BAYA 3VDXA 3T1BA 2HTSA 2DTRA 4HA8A 2FSWA 1TT5B 3EETA 4OAZA 3H3VK 2FU4A 3FK6A 4RGUA 3OYIA 2DOFA 4BXUA 4II2A 1JE8A 1E17A 4NHJA 3HOWJ 5KNLA 2L7ZA 4O5VA 3C3WA 4LLNA 3I0TA 1BW6A 4OWRB 4FETA 1UHMA 3ZQ7A 4ASNA 4U88A 5M5XJ 5LBQA 1S6LA 3OYKA 3DBRB 3BR2A 4HX8A 1VQMI 1TBXA 3HSEA 5K5RA 3OOPA 5CVIA 4E70A 1WHUA 2L4MA 4RGXA 4HG2A 1ON2A 4XK4A 5B1BH 2VPRA 4OMZA 2KMUA 4RMNA 2NOJB 1BW5A 2G0EA 1IF1A 2QSHX 1YTYA 1ZGJA 4X1EA 3V8LA 1FZPB 3O8GA 2K9LA 2IXSA 2MLGA 5L3GA 1MNEA 5LGUA 4BEHB 1OCZH 4Z6YA 3D5SC 2Y0MA 2IGNA 1LDKB 2X1DA 3F6OA 2DU9A 3I53A 2LDUA 1ETYA 4QLCU 1T0FC 3V8KA 2VLAA 2LBFB 5LEJA 3OMYA 3KLNA 3O3KA 4A3KJ 3L00A 4KDPA 1LDJA 2D1HA 2FOKA 2ZO4A 1DP7P 1WFXA 1I3QJ 1XGMA 4PJNA 2I5UA 1FMVA 3ZQHA 2WV0A 2HYJA 4NC8A 3CF2A 4UVAA 2X6YA 2HVRA 1WJ5A 1BIBA 3RYRA 2FX0A 2P5KA 4HF0A 1K6OA 1XTAA 3FXRA 3F8FA 2JA2A 2FF4A 2P6SA 2HPIA 2K7LA 3FXQA 2ZFWA 4B3AA 3WGGA 3DEUA 1MDMB 1FY7A 5HDKA 3KPHA 1GUUA 4WXHA 5CYVA 4BY1J 3KZIC 4E7JA 3HKZN 5DD8A 4I76A 3EDPA 1Y0UA 1S9HA 3OYNA 1YQAA 4LMYA 3S14J 1RNLA 2LY9A 3BLYA 3TP3A 4XIDA 1OPCA 5CKTA 2R7RA 1W7PB 1ZELA 4YFNF 1GXQA 5BS6A 1SC7A 4M9XA 2E2HJ 1ZRCA 2K5CA 2D5VA 3GZNB 3WG7H 4Y4RA 5DM7F 2VUMJ 2YSRA 1Y0NA 4F3QA 4B43A 3GTLJ 3HGYA 3VSLA 2A69F 2BGCA 1QRYA 1E3PA 2FNAA 2FOWA 3F3XA 4M3DA 4DIQA 1N25A 1YX5A 2JA6J 2OCCH 5DS9A 4HNUA 1ZR2A 2VC1A 3JRGA 1ZREA 1ZG3A 1YW7A 3M7GA 4J01A 5HDGA 5H6QA 3QU3A 2EA4A 3VOEA 3BR5A 4PGGA 1IXSB 4IRHA 1K78B 2W48A 3ESWB 3IP4B 2VKHA 5KHDA 1D3YA 3KP5A 3JSPA 1O3TA 2DK8A 2QBYB 1NG6A 2R7XA 3BZCA 3B6AA 3IUOA 4AVZA 4HDVA 4PJLA 2EWNA 1R22A 2HZTA 3GFMA 4UHTA 2EFWA 3ISPA 3K2AA 2KRCA 2FA5A 4M6VA 3FISA 3FXOA 3J7ZI 1JUMA 1BOAA 5D4RA 3GTPJ 4CCOA 2GIZA 5DCMA 2MA3A 2DODA 3CCYA 1CF7B 1EH6A 1T39A 2COMA 3GTGJ 1BIAA 3ABTA 3HXLA 3ZGKA 3R61A 5DUIA 3IV5A 3MAJA 3MZ8A 2ZMEB 2JZYA 1U0JA 2O9LA 3RTRA 2N8GA 2CQNA 1PJRA 3RKYA 1T95A 3HEFA 1IN4A 3J80K 1P2FA 2L7FP 2TRTA 3JRFA 1HBXG 4KISA 2RC4A 4CCJA 1O57A 1U6GA 1A6QA 1XDSA 4XKBA 3CMMA 3VEPA 5ILVA 1TQPA 3DCFA 3E97A 3WGIA 1Y8QB 4C3IJ 2TDXA 4HPQA 4NUBA 2OJED 4UUVA 2QQ8A 5IP9J 1WZ2A 2EZKA 2Y9ZA 2H6BA 4L5EA 1YI2I 3NWSA 3SDBA 3C2GA 4FISA 1HA8A 1LPQA 2V9VA 3WTZA 1MD0A 2PBIA 3O2PE 1LB2A 2MFZA 3WTVC 2LD5A 1GV5A 4XMYA 1HOMA 2L7MP 3JCUC 2PQ8A 3E0JB 2D1VA 3ABLH 4PFPA 1SAUA 3E5QA 4GXOA 2LTPA 2R7WA 3CC4I 4LGWA 4U87A 1JTXA 2DCEA 2D45A 1JKRC 2IT0A 2ZJQF 2EV6A 1WPKA 4Q48A 4KUMA 2BOLA 4MHGA 3S17J 2R5YA 4MTEA 3M9AA 2ISZA 3ZMZA 5EF6A 3W2AA 2BE5F 4FTHA 2RVCA 1S3JA 1YHQI 2E71A 3DWLE 3F8MA 4B09A 1Z7UA 3S3MA 3HM5A 2WAQA 2PN6A 3LAPA 9ANTA 2QKLB 2K3PA 4NB5A 3S8PA 4II3A 5J8FA 3L2RA 3SFZA 5FLVA 1RETA 3SZPA 1LFBA 1RIOH 1K6YA 4S05A 5FLXZ 3V42A 5GP9A 2HOAA 2KFDA 1R5HA 4I0AA 5F0HA 4F93B 3OYLA 3HZJA 1XC5A 3CDHA 1YIOA 5M3FJ 4XLAA 4I6ZA 1ZLKA 2BVMA 2ECCA 1P7JA 1QHGA 2V1XA 1TQIA 5IYDJ 3T8TA 3DTEA 2F4IA 1CQTA 3F72A 2O5RA 5D6EA 2IA0A 2VE8A 1SD4A 4CZZA 4YIRX 1OLTA 4OIRF 1NK3P 4IHTA 3G6EI 3S15J 4BHBA 1TWCJ 1Z91A 3C2HA 3ZQIA 4JX6A 1TNTA 2ZNZA 2STWA 4KICA 1LNWA 4FE7A 3GF2A 3PM1A 4U7BA 1JI8A 1NG7A 2F4MB 3A01A 1Z0XA 5AIQA 4DBQA 1HW2A 1WJFA 5GTIC 2OBPA 1BC8C 3HOTA 1HLVA 3A2KA 1WRJA 2WB1N 2PMHA 2JRTA 1XDUA 2RQPA 3MCZA 1SMTA 1NTCA 1PDNC 1TP4A 4LG0A 2HS5A 4B1RA 3F21A 1I27A 2KP6A 3BT9A 4HYEA 1D8KA 2LG4A 2M5WA 4F55A 2FQ3A 3IH3A 4N4NB 5F64A 5DCMB 4IHVA 4IJAA 2V7FA 1I6XA 3RZDJ 1RZ4A 4P96A 2A6TA 2CJJA 4ON0A 3RPUD 1R9TJ 1QO0D 2FMLA 2GBYA 5FFZA 3GXOA 2MD0A 2IGOA 3K4CA 2XKPA 4NC6A 1QNTA 2IS2A 3OS1A 3E6CC 1IN8A 3RKWA 4XLPF 1MJAA 1D1CA 2IVMA 2ME6A 3I9V2 1F1ZA 1GV2A 4N9HA 1SFOJ 3QPHA 3DTKA 1G3YA 4ZYGA 2DW4A 3JRIA 4E4HA 5IP6A 1WJAA 4DYRA 1IZ1A 2AS5F 2CGPA 2DBBA 4XLFA 2VQHA 3E6MA 4D7NA 2O8KA 1B59A 3R4KA 1YS6A 1R23A 4HLYA 1R7JA 3WE3A 3BTJA 2FD5A 1MMSA 2Z99A 5CVUA 2JVHA 2XAGA 4N0BA 3WHCA 1S7OA 2JN6A 1QA6A 1BM9A 2OCEA 4RAZA 2LSOA 1X1DA 3LNQA 1TNSA 2VI6A 3PQKA 1HSTA 2IBDA 1YJNI 2H27A 1D0YA 3UKGA 3HOUJ 4E7LA 2VKEA 3HRMA 3PIOF 1ZK8A 3IAM2 3Q3SA 3MKWB 4D9JA 3O8HA 3MFKA 5BOXA 2QWWA 1PVEA 1JKOC 3BY6A 4IPAA 2MBFA 3P9CA 3OYAA 1TW3A 3JSOA 4QWQA 4MTDA 2WAQN 5JR3A 2VIXA 5K5QA 1A35A 3JAMK 3OYGA 4AUXA 2OU2A 2XPUA 3MQ0A 2GA1A 1POGA 3OSGA 3BTCA 3K7AJ 1TW2A 2Z5UA 5HLIA 3H5RA 1ZKGA 1YJ9I 1I5ZA 3IWZA 4XQFA 3CUQA 2KQRA 3U2RA 3M1EA 3NARA 2GXGA 1Z05A 3OL3A 2E19A 2E5NA 2DMUA 1GVJA 5M3MJ 1QZYA 2XF6A 1YLFA 3CESA 2CWEA 4KFCA 3ERMA 3OYEA 4IKFA 4F52A 3M8JA 5FROA 4BDZA 2RKHA 3GTQJ 5DM6F 4ESFA 1BR1A 1MBKA 3GCMA 1K7AA 2EILH 1YE9A 2WV1A 3W2WA 2VN2A 3HRSA 3OIOA 3L7WA 2ELHA 3MKYB 3RKQA 2BXZA 1HKSA 3HGGA 3DU5A 3KEYA 2YUSA 3TKYA 1TQMA 1APLC 1BC7C 2VT2A 1ETXA 1WH7A 1QBJA 2W84A 1SVOA 4G6DA 1IDYA 5F1RA 1E0EA 5GAGJ 1S29A 3CO6C 4A5NA 4FE4A 4FX4A 5HLHA 5J4VA 3E5XA 3WGHA 2IP2A 2DDAA 2XB0X 3HRTA 5IOZA 1KQ9A 2F5VA 1XN7A 3K70D 2AQFA 3QOPA 2HOEA 5KAFC 1KONA 3J7YJ 2LOOA 4L9VA 2A68F 3A01B 4XKCA 3BCAA 2CW0F 4G7HF 4KNYA 2Z1DA 2OUMA 1N77A 2EFPA 1OQYA 1UHSA 2QSFX 4PJMA 4CYDA 2EIMH 1XGOA 4A0ZA 1Z3XA 2DTZA 3GTKJ 1W5CC 3HSFA 4M3BA 2X1CA 1QPMA 1ACIA 1RKTA 2BY3A 2G9WA 1I50J 2VOPA 1FX7A 3JRHA 4WF2A 5LHGA 3LQRA 1D1BA 2JPBA 2EK5A 3WTYC 2JSPA 4RB0A 2ZNYA 4DBRA 4OMYA 3TP0A 2OTLI 3CJRB 1VQ7I 2TCTA 2DOEA 4A2UA 1OFCX 2H8RA 4GYGA 3B73A 2R5ZA 1IUFA 4C9YA 2KIMA 2K85A 4UXNA 3GTMJ 2LFBA 1EKEA 3GUDA 2VASA 2IW5A 3WTXC 1KGSA 2ETHA 2XSJC 2DA4A 3J7AY 1T0FA 3IWFA 2ZB9A 3A0BC 1PP8F 2LVSA 4O6JA 4I01A 3QP5A 5DDGA 4FT8A
chains in the Genus database with same CATH topology
2EB7A 3L2CA 1ZG1A 2CSOA 4ZH4F 1P4AA 1HQCA 4R1HA 3ZPLA 3V7SA 1SD5A 5L3BA 5D5VB 5D6FA 1WKMA 2EFOA 5ERIA 4UVCA 5HDNA 1G3WA 3GFIA 2KJCA 1YS7A 5E1XA 3BDDA 1XGNA 3BJAA 4XRFA 5JHUA 4HDUA 3VB2A 2XAFA 4EM0B 2DFIA 1BI3A 3CUQB 4LJZF 4R8HA 4G6QA 3F23A 4M72A 4JQFA 1LEBA 2UZKA 3V7RA 4LFUA 1C0WA 1W5TA 4M6XA 4A6DA 1U78A 3VODA 2L4AA 3BZ6A 1BN5A 4OINF 2OA4A 3Q5FA 4GYIA 2P6TA 4KIFA 5LEKA 5KK1A 2MH2A 3J80Z 4CGZA 2H94A 4Z2YA 2GIVA 5HS8A 1XGSA 2BV6A 3CTAA 3R0JA 3F22A 2RGVA 3ECHA 1H9GA 4IVNA 2IRFG 2L02A 4UV9A 4EJVA 3I59B 1IN6A 3J7AO 5L3DA 3IC7A 1XD7A 3NRVA 2GZWA 5H6RA 2O6GE 3SXYA 2HDCA 1Z6TA 1MKMA 2XAJA 2EA2A 3TDUC 3E6DA 2VT3A 1OYYA 4Y15A 1D8JA 2OZ6A 3IL2A 3DFGA 3BPVA 4YFKF 2V1DA 4EQQA 1J0RA 1Z6RA 3V8JA 2BEOA 4KIBA 2MD5A 5D8LB 4U7DA 5E1ZB 1RUOA 5D8KB 2DK5A 5LGNA 4IF4A 4JK1X 2Q8KA 1SMYF 4Y17A 2ZXJA 5CVRA 2HR3A 2VBZA 4YG2F 4PDKA 1U5TB 3FMQA 4GGGA 5ILUA 1MGTA 4MGRA 4M74A 4Q47A 3ZMUA 5HVQC 3JTGA 1J7KA 3E6BA 3W6KB 2NAZA 1I1GA 5L3EA 4EJWA 1SD6A 2FEZA 1ODDA 1UB9A 2FBKA 1ZHFA 2Y48A 2WC2A 3SQNA 4RAYA 4RS8A 1YO5C 3TOAA 1R5GA 3REOA 2P4WA 4LK0F 1V3FA 3GFLA 2A07F 5DUKA 3G3ZA 2STTA 1J5YA 4KA4A 3ZN0A 1FYMA 3WTUC 4F7ZA 4XLNF 5D5WB 4U0VA 5CVJA 2RNJA 3LAJA 3ZMDA 4FHTA 2GAUA 3RJPA 2F5DA 3KE2A 2XVCA 4KYWA 3Q9SA 4DQ2A 1TLHB 3JAMZ 4YIFA 5J8CA 2NRAC 4HF1A 1GHCA 1MJBA 2E7WA 1B9MA 3K2ZA 1OYWA 1LVAA 3K1MA 3Q9VA 4HOBA 3BPXA 1XSDA 1IW7F 5FFXA 1Z1DA 2XGXA 1B1BA 1XMKA 4Q4ZF 1D5VA 2KIFA 2MH9A 3O6BB 5DEQA 1GXPA 2VXZA 4XSZF 3SZTA 3LSTA 1V4RA 4RB3C 1DUXC 5HS9A 1B6AA 4EJUA 2NNYA 4AD9A 2M8EA 2QENA 1FP2A 4EMSA 3ERED 2RDPA 3I58A 4OIPF 4G7ZF 4ZYDA 3MEXA 1U3EM 3GVAA 3U1DA 1ON1A 3W6JB 4A6EA 5BPIA 1XSVA 3HHHA 1UCRA 1WQ2A 1T2KA 2IPQX 2O8XA 1FYLA 2DT5A 4CICA 5ILSA 4ZYEA 3I71A 2Z33A 1FT9A 2YX7A 2ZJ2A 3FWEA 5LGTA 1USTA 4HLXA 1AWCA 4LD5A 2R7DA 2CQKA 2K02A 3CUOA 2K27A 1JHHA 2Q2EA 5AIPA 1ZG5A 1HSJA 3DF8A 3MWMA 4ENNA 5L3FA 4EV0A 2QQBA 3V4GA 1RI7A 4OOIA 4ENKA 4HX4A 4PGHA 5LHHA 3BP8A 5TRDA 2PFBA 3QAHA 2PG4A 2GXBA 2BYVE 4HV6A 5E8GA 5DV5A 2QLZA 3R60A 3LWFA 3FX3A 5CLSA 5HS7A 2JT1A 1YG2A 1ZGAA 4IRGA 3D0SA 2P8TA 3K9TA 4XSXF 3R0AA 3WODF 4HBLA 1KU9A 2O03A 4EVIA 3DPLC 5FD6A 3WE2A 3RIRA 3QPTA 1ONVA 2V79A 5IT9K 4FX0A 1ZH5A 4CO8A 4CXFA 1S7AA 4Q5SF 4A0XA 5FGMA 4A0YA 2K4BA 1UHWA 2QQAA 1KU3A 2P7CB 1HKTA 1QGPA 4KMUX 1ZARA 2OZUA 2CYYA 1SFXA 1JHFA 3QP6A 5JFRA 1OMIA 3HUGA 3M8EA 3ZMVA 3TQNA 2L54A 5JI6A 3ROUA 5ICFA 1BI1A 1J9IA 2A6HF 2O0YA 3GO5A 5D5XB 4LG0B 3LFKA 4I0BA 1P6RA 5A2QK 3I4PA 2HFHA 4N9IA 1PUEE 4H0EA 3HSRA 2YR2A 1DPRA 3K69A 5AONA 3ZMSA 1XCVA 1ZAOA 5F6FA 3HTUA 2K86A 3CJNA 4ESBA 4LK1F 3IKVA 2O3FA 4DNCA 1H0MA 2X4HA 2NNNA 5E1WA 5D5UB 3PQJA 4GCVA 2DO7A 2L3DA 2R7FA 1FPQA 1T6SA 3RYPA 1YFHA 4HF2A 5LRRA 4RGSA 1ZRDA 4O3MA 2LF8A 3GFJA 1F5TA 1FNNA 3GYHX 3JW4A 3ZP5A 2OD5A 2JSCA 3K1NA 3NEUA 2NS0A 1MDMA 4KMFA 1SD7A 2YPRA 2A6EF 1TTYA 1WI9A 3ZMTA 4U0WA 3RI4A 3E5UA 2GWRA 2EJRA 3GX4X 4YIIA 4R79A 1W7PA 1WSUA 4L0ZB 2HEOA 6PAXA 4M9SA 2B0LA 2EV0A 1MZBA 2W24A 2LNBA 4ENJA 5K1YA 1H9TA 5FD5A 4EJOA 3CUQC 1IRFA 3K0LA 1S8NA 4AWXB 5DD4A 1FSEA 5ICCA 4MEYF 1KU7A 1L3LA 4HQEA 1U2WA 3V7CA 1K78A 4IXAA 3LA3A 4S04A 2QBYA 2F5EA 1IN7A 2J5PA 2KJBA 2CG4A 3TGNA 2RV8A 2E7XA 2QZ8A 3WTWC 1CF7A 2A61A 3EYIA 1ZRFA 1MJ9A 2V6CA 3DKWA 4U0YA 2DPUA 3WTTC 1O3QA 1IAWA 3T0YA 1HW5A 3QRFF 3C7JA 2A3SA 1AOYA 5ED4A 5E8IA 2HKXA 4M71A 3N4MA 5H20A 1YW8A 5EEGA 4KIGA 2PJPA 3WU0A 4IRIA 3EQLF 3DV8A 1O7FA 3EUHA 4ZZLA 4RB1A 2HYGD 1X3UA 5E20A 2HKOA 5TJJA 1U8RA 2XRNA 1O3RA 2IA2A 4OIQF 1G6NA 1IUYA 1XCBA 1K79A 5LLQA 3TO6A 2QVOA 2PMUA 4PCQA 4P9UA 2ESNA 2PLYA 2P5VA 3IHUA 1J59A 4A12A 4AIKA 5E17F 4KN7X 4TV7A 3WU1B 1B9NA 1FC3A 1FBUA 3H3ZA 4I98B 2HGCA 3DXJF 3FM3A 5DCFA 2G7UA 2FBIA 2AXLA 3TO9A 3F8BA 3RPQA 1BBYA 4MEXF 1U5TC 3H92A 2F5CA 1EH8A 3KP2A 2XROA 1SAXA 2LF7A 1HW1A 1G3SA 1BI2A 2HQRA 4BYYA 5J6XA 2GQQA 1J75A 4JBAA 2ESHA 1FP1D 4LB5A 4M73A 3T8RA 3C1DA 2W57A 1P4XA 2P5LC 1O7LA 1Z9CA 3CO7C 3LA2A 3ML6A 1UFMA 3KCCA 2CFXA 4PZJA 1G4DA 3KP3A 2ACJA 2YX4A 4M9ZA 1FBQA 3KLOA 1I1SA 3ZN1A 4WWCA 3QU6A 2L01A 2XIGA 2NYXA 2WTEA 3N97A 1EH7A 1R1TA 2QYOA 2UWMA 3S2WA 2IA1A 3C18A 1IRGA 2EFNA 4LLGF 2E1NA 3D5LA 1F9NA 3P9IA 1PP7U 3T5XA 3FMSA 1QZZA 1KU2A 3TO7A 1R1UA 2ZKZA 2H09A 2F2EA 3HYIA 2DQLA 4EM2A 2YU3A 2DI3A 3I54A 4AIJA 4G94A 3F6VA 2LKPA 4WCGA 4P9FA 2HWVA 2KKOA 2CO5A 4HQMA 4UVBA 4D0PA 4G9YA 3LQQA 5BQTA 5IT9Z 5CVVA 5DYMA 3VFZA 3HHGA 3E3VA 3GEZA 4AVPA 3KEOA 4HW0A 1OR7A 2BBYA 2EV5A 4ENMA 5ICEA 1W4MA 3BJ6A 3DQVC 1HXDA 3KFWX 4BHPA 1BI0A 2VBXA 4WXDA 2D2WA 2KRFA 4I2OA 3HOSA 4HV5A 2HTJA 3AAFA 3KETA 4HAMA 4MNUA 2ZCWA 3BWGA 1KYWA 3HTSB 5A2QZ 2QUFA 3J81Z 2KIUA 2X0LA 2Z3YA 1WWXA 1KQ0A 2FXAA 3HIFA 4I7HA 1B4AA 1KYZA 4BHCA 3FHZA 3GZ6A 4LLLA 4AIHA 3WG9A 1IN5A 1DDNA 2GA2A 2E1CA 2QQ9A 5HOOA 2JPCA 3I64A 4XBFA 1FSHA 2DPDA 1HKQA 4I02A 1NHAA 4ZZDA 1ZLJA 2R3SA 3KP4A 4CDGA 1ZYRF 1VTNC 3M8FA 3FM5A 3B02A 1XSXA 1SFUA 3KP7A 4BH9A 1LEAA 5ICGA 3TOBA 3DP7A 4A5MA 3ECOA 3KEQA 3ELKA 3G73A 2O61A 4ETSA 2DAOA 4RGRA 2UXNA 2MC3A 3LA7A 5FO5A 3KZZA 1KA8A 1YW9A 2XAHA 4L9TA 5E18F 1KQ8A 4WK8F 2VBWA 2FBHA 2VC0A 4UV8A 3R6SA 1FOKA 4NQWA 3MZYA 4L0YB 1T38A 4L5IA 2IJLA 1R1VA 1OYIA 2P7VB 2FMYA 2FE3A 2W25A 4ESJA 5D4SA 2HQNA 3FZVA 3ABUA 4I09A 3GZ5A 2DQRA 3BJOA 2XASA 1FLIA 1STZA 1REPC 2DLLA 4B8XA 1G3TA 2F5FA 3I5UA 3TDZC 5BMZA 3ULQB 2XHKA 3EYYA 3RKXA 3CLOA 3F8CA 3HRUA 2UXXA 2FRHA 2VONA 3NQOA 3OV8A 1OKRA 1W5SA 2V1UA 1XMAA 3IKTA 1F4KA 2MLKA 4P55A 2HYFA 2XAQA 4G7OF 1FYKA 2M45A 1SFEA 1LDDA 3KP6A 1CGPA 5K5OA 3FMRA 4BQAA 4MQ9F 1W7PD 4KT5C 3IRRA 2VOOA 3RPUA 2C6YA 5FLXK 4YFXF 4L9NA 4RB2C 1EV7A 2VBYA 2ZBKA 5KVRA 1BJAA 4ZYHA 3BOQA 2PI0A 2WWYA 3FF5A 1JGSA 1R36A 1A04A 3GLXA 3J81K 2QM3A 2XUBA 1R00A 2K4JA 4L5JA 3IRQA 3U9GA 4CHUA 4HX7A 4MQVA 2XV4S 3I59A 4KN4X 2M30A 1P4WA 5FB2A 4EGZA 4EGYA 1ZN2A 2G7HA 1DPUA 1QQIA 1RUNA 2PEXA 1IXCA 3FXUA 5EEHA 4EM1A 4P5OA 3K1PA 1Q1HA 3WTSC 3P7NA 4BNCA 4OIOF 2XKOA 4OU0A 2EFQA 4WX9A 1O3SA 4HZFA 1E2XA 5IT3A 1T98A 4G8XA 2A5YB 2OQRA 2RN7A 3DPTA 2M1BA 2M87A 2FNPA 5L3CA 3COAC 1FBSA 4K2EA 4Y13A 2ISYA 1JXSA 4L9JA 3KZYA 1U5TA 3P9KA 2OQGA 3JTHA 5CJ9A 1YYVA 5BPDA 3F8NA 2VE9A 3RDIA 4LB6B 2ADUA 4WXCA 2OAZA 3GWZA 2W85A 1L0OC 2Y75A 2Z9OA 1LJ9A 5JVTA 3GW2A 3H3UA 2J5OA 1R58A 3BROA 1FWZA 3L9FA 2H6CA 2JTVA 4M6YA 1IXRC 3MZHA 5HLGA 1ULYA 2Q0OA 2VODA 3L09A 4GO1A 1USSA 1J2XA 4L18B 5LRSA 4IHSA 3SHFA 4UNOA 5LHIA 1P92A 4EJTA 1LQ1A 1XB4A 2ZMEA 3PFIA 4BAYA 3T1BA 2HTSA 2DTRA 4HA8A 2FSWA 3EETA 2FU4A 4RGUA 4BXUA 1JE8A 1E17A 4NHJA 4O5VA 4LLNA 3C3WA 3I0TA 1UHMA 3ZQ7A 4ASNA 4U88A 5LBQA 1S6LA 4HX8A 1TBXA 3HSEA 5K5RA 3OOPA 5CVIA 4E70A 2L4MA 4RGXA 1ON2A 4OMZA 1IF1A 1YTYA 1ZGJA 3V8LA 1FZPB 2MLGA 5L3GA 5LGUA 2Y0MA 1LDKB 3F6OA 2DU9A 3I53A 2LDUA 4QLCU 3V8KA 5LEJA 3KLNA 3O3KA 3L00A 4KDPA 1LDJA 2D1HA 2FOKA 2ZO4A 1DP7P 1XGMA 2WV0A 4UVAA 1BIBA 3RYRA 2P5KA 4HF0A 1K6OA 3FXRA 3F8FA 2FF4A 2P6SA 2K7LA 3FXQA 2ZFWA 3WGGA 3DEUA 1MDMB 1FY7A 5HDKA 4WXHA 5CYVA 5DD8A 3EDPA 1Y0UA 1YQAA 4LMYA 1RNLA 1OPCA 1W7PB 4YFNF 1GXQA 5BS6A 4M9XA 1ZRCA 2YSRA 2A69F 2BGCA 2FNAA 3F3XA 2VC1A 1ZREA 1ZG3A 1YW7A 3M7GA 5HDGA 5H6QA 3QU3A 2EA4A 3VOEA 4PGGA 1IXSB 4IRHA 1K78B 1D3YA 3KP5A 3JSPA 1O3TA 2DK8A 2QBYB 4HDVA 2EWNA 1R22A 2HZTA 3GFMA 4UHTA 2EFWA 3ISPA 2FA5A 1BOAA 5D4RA 5DCMA 2MA3A 1CF7B 1EH6A 1T39A 2COMA 1BIAA 3ABTA 3R61A 5DUIA 3MAJA 2ZMEB 2JZYA 3RTRA 3RKYA 1IN4A 3J80K 1P2FA 1HBXG 2RC4A 1O57A 1U6GA 1XDSA 3VEPA 5ILVA 1TQPA 3E97A 3WGIA 2TDXA 4UUVA 2H6BA 2V9VA 3WTZA 1MD0A 2PBIA 3O2PE 1LB2A 3WTVC 2PQ8A 2D1VA 3E5QA 4GXOA 4LGWA 2D45A 2IT0A 2EV6A 4Q48A 4KUMA 4MHGA 4MTEA 3M9AA 2ISZA 3ZMZA 2BE5F 2RVCA 1S3JA 3F8MA 4B09A 1Z7UA 2PN6A 3LAPA 4NB5A 5J8FA 3SFZA 3SZPA 1RIOH 4S05A 5FLXZ 1R5HA 4I0AA 3CDHA 1YIOA 1ZLKA 2V1XA 1TQIA 3T8TA 3F72A 5D6EA 2IA0A 2VE8A 1SD4A 4CZZA 4OIRF 4IHTA 4BHBA 1Z91A 1TNTA 2ZNZA 2STWA 4KICA 1LNWA 3GF2A 4U7BA 5AIQA 1HW2A 1BC8C 2OBPA 3HOTA 1WRJA 2PMHA 2JRTA 1XDUA 2RQPA 3MCZA 1SMTA 1PDNC 4LG0A 2HS5A 3F21A 1I27A 4HYEA 1D8KA 2M5WA 2FQ3A 5F64A 5DCMB 4IJAA 1I6XA 1RZ4A 4P96A 4ON0A 1QO0D 2FMLA 5FFZA 3GXOA 2XKPA 1QNTA 3E6CC 1IN8A 3RKWA 4XLPF 1MJAA 2IVMA 1F1ZA 4N9HA 3QPHA 1G3YA 4ZYGA 2DW4A 1IZ1A 2AS5F 2CGPA 2DBBA 3E6MA 1B59A 3R4KA 1YS6A 1R23A 4HLYA 1R7JA 3WE3A 2Z99A 5CVUA 2XAGA 4N0BA 1S7OA 1BM9A 4RAZA 2LSOA 1TNSA 3PQKA 1HSTA 2H27A 3HRMA 5BOXA 3MFKA 2QWWA 3BY6A 4IPAA 2MBFA 3P9CA 1TW3A 3JSOA 4QWQA 4MTDA 5JR3A 5K5QA 3JAMK 2OU2A 3MQ0A 2GA1A 1TW2A 2Z5UA 5HLIA 1I5ZA 3IWZA 3CUQA 3U2RA 3M1EA 2GXGA 1Z05A 1GVJA 1QZYA 1YLFA 2CWEA 4KFCA 2RKHA 4ESFA 1K7AA 2VN2A 3HRSA 3L7WA 2ELHA 1HKSA 3TKYA 1TQMA 1BC7C 2VT2A 1QBJA 2W84A 4G6DA 5F1RA 1S29A 3CO6C 4A5NA 4FX4A 5HLHA 3E5XA 3WGHA 2IP2A 3HRTA 1KQ9A 1XN7A 3QOPA 2HOEA 4L9VA 2A68F 2CW0F 4G7HF 4KNYA 2EFPA 4CYDA 1XGOA 4A0ZA 3HSFA 1QPMA 2G9WA 2VOPA 1FX7A 4WF2A 5LHGA 3LQRA 3WTYC 2JPBA 2EK5A 4RB0A 2ZNYA 4OMYA 4A2UA 4GYGA 3B73A 2KIMA 4UXNA 3GUDA 3WTXC 2IW5A 1KGSA 2ETHA 1T0FA 3IWFA 1PP8F 4O6JA 4I01A 3QP5A 5DDGA 4FT8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EB7 A;  3L2C A;  1ZG1 A;  2CSO A;  4ZH4 F;  1P4A A;  1HQC A;  4R1H A;  3ZPL A;  3V7S A;  1SD5 A;  5L3B A;  5D5V B;  5D6F A;  1WKM A;  2EFO A;  5ERI A;  4UVC A;  5HDN A;  1G3W A;  3GFI A;  2KJC A;  1YS7 A;  5E1X A;  3BDD A;  1XGN A;  3BJA A;  4XRF A;  5JHU A;  4HDU A;  3VB2 A;  2XAF A;  4EM0 B;  2DFI A;  1BI3 A;  3CUQ B;  4LJZ F;  4R8H A;  4G6Q A;  3F23 A;  4M72 A;  4JQF A;  1LEB A;  2UZK A;  3V7R A;  4LFU A;  1C0W A;  1W5T A;  4M6X A;  4A6D A;  1U78 A;  3VOD A;  2L4A A;  3BZ6 A;  1BN5 A;  4OIN F;  2OA4 A;  3Q5F A;  4GYI A;  2P6T A;  4KIF A;  5LEK A;  5KK1 A;  2MH2 A;  3J80 Z;  4CGZ A;  2H94 A;  4Z2Y A;  2GIV A;  5HS8 A;  1XGS A;  2BV6 A;  3CTA A;  3R0J A;  3F22 A;  2RGV A;  3ECH A;  1H9G A;  4IVN A;  2IRF G;  2L02 A;  4UV9 A;  4EJV A;  3I59 B;  1IN6 A;  3J7A O;  5L3D A;  3IC7 A;  1XD7 A;  3NRV A;  2GZW A;  5H6R A;  2O6G E;  3SXY A;  2HDC A;  1Z6T A;  1MKM A;  2XAJ A;  2EA2 A;  3TDU C;  3E6D A;  2VT3 A;  1OYY A;  4Y15 A;  1D8J A;  2OZ6 A;  3IL2 A;  3DFG A;  3BPV A;  4YFK F;  2V1D A;  4EQQ A;  1J0R A;  1Z6R A;  3V8J A;  2BEO A;  4KIB A;  2MD5 A;  5D8L B;  4U7D A;  5E1Z B;  1RUO A;  5D8K B;  2DK5 A;  5LGN A;  4IF4 A;  4JK1 X;  2Q8K A;  1SMY F;  4Y17 A;  2ZXJ A;  5CVR A;  2HR3 A;  2VBZ A;  4YG2 F;  4PDK A;  1U5T B;  3FMQ A;  4GGG A;  5ILU A;  1MGT A;  4MGR A;  4M74 A;  4Q47 A;  3ZMU A;  5HVQ C;  3JTG A;  1J7K A;  3E6B A;  3W6K B;  2NAZ A;  1I1G A;  5L3E A;  4EJW A;  1SD6 A;  2FEZ A;  1ODD A;  1UB9 A;  2FBK A;  1ZHF A;  2Y48 A;  2WC2 A;  3SQN A;  4RAY A;  4RS8 A;  1YO5 C;  3TOA A;  1R5G A;  3REO A;  2P4W A;  4LK0 F;  1V3F A;  3GFL A;  2A07 F;  5DUK A;  3G3Z A;  2STT A;  1J5Y A;  4KA4 A;  3ZN0 A;  1FYM A;  3WTU C;  4F7Z A;  4XLN F;  5D5W B;  4U0V A;  5CVJ A;  2RNJ A;  3LAJ A;  3ZMD A;  4FHT A;  2GAU A;  3RJP A;  2F5D A;  3KE2 A;  2XVC A;  4KYW A;  3Q9S A;  4DQ2 A;  1TLH B;  3JAM Z;  4YIF A;  5J8C A;  2NRA C;  4HF1 A;  1GHC A;  1MJB A;  2E7W A;  1B9M A;  3K2Z A;  1OYW A;  1LVA A;  3K1M A;  3Q9V A;  4HOB A;  3BPX A;  1XSD A;  1IW7 F;  5FFX A;  1Z1D A;  2XGX A;  1B1B A;  1XMK A;  4Q4Z F;  1D5V A;  2KIF A;  2MH9 A;  3O6B B;  5DEQ A;  1GXP A;  2VXZ A;  4XSZ F;  3SZT A;  3LST A;  1V4R A;  4RB3 C;  1DUX C;  5HS9 A;  1B6A A;  4EJU A;  2NNY A;  4AD9 A;  2M8E A;  2QEN A;  1FP2 A;  4EMS A;  3ERE D;  2RDP A;  3I58 A;  4OIP F;  4G7Z F;  4ZYD A;  3MEX A;  1U3E M;  3GVA A;  3U1D A;  1ON1 A;  3W6J B;  4A6E A;  5BPI A;  1XSV A;  3HHH A;  1UCR A;  1WQ2 A;  1T2K A;  2IPQ X;  2O8X A;  1FYL A;  2DT5 A;  4CIC A;  5ILS A;  4ZYE A;  3I71 A;  2Z33 A;  1FT9 A;  2YX7 A;  2ZJ2 A;  3FWE A;  5LGT A;  1UST A;  4HLX A;  1AWC A;  4LD5 A;  2R7D A;  2CQK A;  2K02 A;  3CUO A;  2K27 A;  1JHH A;  2Q2E A;  5AIP A;  1ZG5 A;  1HSJ A;  3DF8 A;  3MWM A;  4ENN A;  5L3F A;  4EV0 A;  2QQB A;  3V4G A;  1RI7 A;  4OOI A;  4ENK A;  4HX4 A;  4PGH A;  5LHH A;  3BP8 A;  5TRD A;  2PFB A;  3QAH A;  2PG4 A;  2GXB A;  2BYV E;  4HV6 A;  5E8G A;  5DV5 A;  2QLZ A;  3R60 A;  3LWF A;  3FX3 A;  5CLS A;  5HS7 A;  2JT1 A;  1YG2 A;  1ZGA A;  4IRG A;  3D0S A;  2P8T A;  3K9T A;  4XSX F;  3R0A A;  3WOD F;  4HBL A;  1KU9 A;  2O03 A;  4EVI A;  3DPL C;  5FD6 A;  3WE2 A;  3RIR A;  3QPT A;  1ONV A;  2V79 A;  5IT9 K;  4FX0 A;  1ZH5 A;  4CO8 A;  4CXF A;  1S7A A;  4Q5S F;  4A0X A;  5FGM A;  4A0Y A;  2K4B A;  1UHW A;  2QQA A;  1KU3 A;  2P7C B;  1HKT A;  1QGP A;  4KMU X;  1ZAR A;  2OZU A;  2CYY A;  1SFX A;  1JHF A;  3QP6 A;  5JFR A;  1OMI A;  3HUG A;  3M8E A;  3ZMV A;  3TQN A;  2L54 A;  5JI6 A;  3ROU A;  5ICF A;  1BI1 A;  1J9I A;  2A6H F;  2O0Y A;  3GO5 A;  5D5X B;  4LG0 B;  3LFK A;  4I0B A;  1P6R A;  5A2Q K;  3I4P A;  2HFH A;  4N9I A;  1PUE E;  4H0E A;  3HSR A;  2YR2 A;  1DPR A;  3K69 A;  5AON A;  3ZMS A;  1XCV A;  1ZAO A;  5F6F A;  3HTU A;  2K86 A;  3CJN A;  4ESB A;  4LK1 F;  3IKV A;  2O3F A;  4DNC A;  1H0M A;  2X4H A;  2NNN A;  5E1W A;  5D5U B;  3PQJ A;  4GCV A;  2DO7 A;  2L3D A;  2R7F A;  1FPQ A;  1T6S A;  3RYP A;  1YFH A;  4HF2 A;  5LRR A;  4RGS A;  1ZRD A;  4O3M A;  2LF8 A;  3GFJ A;  1F5T A;  1FNN A;  3GYH X;  3JW4 A;  3ZP5 A;  2OD5 A;  2JSC A;  3K1N A;  3NEU A;  2NS0 A;  1MDM A;  4KMF A;  1SD7 A;  2YPR A;  2A6E F;  1TTY A;  1WI9 A;  3ZMT A;  4U0W A;  3RI4 A;  3E5U A;  2GWR A;  2EJR A;  3GX4 X;  4YII A;  4R79 A;  1W7P A;  1WSU A;  4L0Z B;  2HEO A;  6PAX A;  4M9S A;  2B0L A;  2EV0 A;  1MZB A;  2W24 A;  2LNB A;  4ENJ A;  5K1Y A;  1H9T A;  5FD5 A;  4EJO A;  3CUQ C;  1IRF A;  3K0L A;  1S8N A;  4AWX B;  5DD4 A;  1FSE A;  5ICC A;  4MEY F;  1KU7 A;  1L3L A;  4HQE A;  1U2W A;  3V7C A;  1K78 A;  4IXA A;  3LA3 A;  4S04 A;  2QBY A;  2F5E A;  1IN7 A;  2J5P A;  2KJB A;  2CG4 A;  3TGN A;  2RV8 A;  2E7X A;  2QZ8 A;  3WTW C;  1CF7 A;  2A61 A;  3EYI A;  1ZRF A;  1MJ9 A;  2V6C A;  3DKW A;  4U0Y A;  2DPU A;  3WTT C;  1O3Q A;  1IAW A;  3T0Y A;  1HW5 A;  3QRF F;  3C7J A;  2A3S A;  1AOY A;  5ED4 A;  5E8I A;  2HKX A;  4M71 A;  3N4M A;  5H20 A;  1YW8 A;  5EEG A;  4KIG A;  2PJP A;  3WU0 A;  4IRI A;  3EQL F;  3DV8 A;  1O7F A;  3EUH A;  4ZZL A;  4RB1 A;  2HYG D;  1X3U A;  5E20 A;  2HKO A;  5TJJ A;  1U8R A;  2XRN A;  1O3R A;  2IA2 A;  4OIQ F;  1G6N A;  1IUY A;  1XCB A;  1K79 A;  5LLQ A;  3TO6 A;  2QVO A;  2PMU A;  4PCQ A;  4P9U A;  2ESN A;  2PLY A;  2P5V A;  3IHU A;  1J59 A;  4A12 A;  4AIK A;  5E17 F;  4KN7 X;  4TV7 A;  3WU1 B;  1B9N A;  1FC3 A;  1FBU A;  3H3Z A;  4I98 B;  2HGC A;  3DXJ F;  3FM3 A;  5DCF A;  2G7U A;  2FBI A;  2AXL A;  3TO9 A;  3F8B A;  3RPQ A;  1BBY A;  4MEX F;  1U5T C;  3H92 A;  2F5C A;  1EH8 A;  3KP2 A;  2XRO A;  1SAX A;  2LF7 A;  1HW1 A;  1G3S A;  1BI2 A;  2HQR A;  4BYY A;  5J6X A;  2GQQ A;  1J75 A;  4JBA A;  2ESH A;  1FP1 D;  4LB5 A;  4M73 A;  3T8R A;  3C1D A;  2W57 A;  1P4X A;  2P5L C;  1O7L A;  1Z9C A;  3CO7 C;  3LA2 A;  3ML6 A;  1UFM A;  3KCC A;  2CFX A;  4PZJ A;  1G4D A;  3KP3 A;  2ACJ A;  2YX4 A;  4M9Z A;  1FBQ A;  3KLO A;  1I1S A;  3ZN1 A;  4WWC A;  3QU6 A;  2L01 A;  2XIG A;  2NYX A;  2WTE A;  3N97 A;  1EH7 A;  1R1T A;  2QYO A;  2UWM A;  3S2W A;  2IA1 A;  3C18 A;  1IRG A;  2EFN A;  4LLG F;  2E1N A;  3D5L A;  1F9N A;  3P9I A;  1PP7 U;  3T5X A;  3FMS A;  1QZZ A;  1KU2 A;  3TO7 A;  1R1U A;  2ZKZ A;  2H09 A;  2F2E A;  3HYI A;  2DQL A;  4EM2 A;  2YU3 A;  2DI3 A;  3I54 A;  4AIJ A;  4G94 A;  3F6V A;  2LKP A;  4WCG A;  4P9F A;  2HWV A;  2KKO A;  2CO5 A;  4HQM A;  4UVB A;  4D0P A;  4G9Y A;  3LQQ A;  5BQT A;  5IT9 Z;  5CVV A;  5DYM A;  3VFZ A;  3HHG A;  3E3V A;  3GEZ A;  4AVP A;  3KEO A;  4HW0 A;  1OR7 A;  2BBY A;  2EV5 A;  4ENM A;  5ICE A;  1W4M A;  3BJ6 A;  3DQV C;  1HXD A;  3KFW X;  4BHP A;  1BI0 A;  2VBX A;  4WXD A;  2D2W A;  2KRF A;  4I2O A;  3HOS A;  4HV5 A;  2HTJ A;  3AAF A;  3KET A;  4HAM A;  4MNU A;  2ZCW A;  3BWG A;  1KYW A;  3HTS B;  5A2Q Z;  2QUF A;  3J81 Z;  2KIU A;  2X0L A;  2Z3Y A;  1WWX A;  1KQ0 A;  2FXA A;  3HIF A;  4I7H A;  1B4A A;  1KYZ A;  4BHC A;  3FHZ A;  3GZ6 A;  4LLL A;  4AIH A;  3WG9 A;  1IN5 A;  1DDN A;  2GA2 A;  2E1C A;  2QQ9 A;  5HOO A;  2JPC A;  3I64 A;  4XBF A;  1FSH A;  2DPD A;  1HKQ A;  4I02 A;  1NHA A;  4ZZD A;  1ZLJ A;  2R3S A;  3KP4 A;  4CDG A;  1ZYR F;  1VTN C;  3M8F A;  3FM5 A;  3B02 A;  1XSX A;  1SFU A;  3KP7 A;  4BH9 A;  1LEA A;  5ICG A;  3TOB A;  3DP7 A;  4A5M A;  3ECO A;  3KEQ A;  3ELK A;  3G73 A;  2O61 A;  4ETS A;  2DAO A;  4RGR A;  2UXN A;  2MC3 A;  3LA7 A;  5FO5 A;  3KZZ A;  1KA8 A;  1YW9 A;  2XAH A;  4L9T A;  5E18 F;  1KQ8 A;  4WK8 F;  2VBW A;  2FBH A;  2VC0 A;  4UV8 A;  3R6S A;  1FOK A;  4NQW A;  3MZY A;  4L0Y B;  1T38 A;  4L5I A;  2IJL A;  1R1V A;  1OYI A;  2P7V B;  2FMY A;  2FE3 A;  2W25 A;  4ESJ A;  5D4S A;  2HQN A;  3FZV A;  3ABU A;  4I09 A;  3GZ5 A;  2DQR A;  3BJO A;  2XAS A;  1FLI A;  1STZ A;  1REP C;  2DLL A;  4B8X A;  1G3T A;  2F5F A;  3I5U A;  3TDZ C;  5BMZ A;  3ULQ B;  2XHK A;  3EYY A;  3RKX A;  3CLO A;  3F8C A;  3HRU A;  2UXX A;  2FRH A;  2VON A;  3NQO A;  3OV8 A;  1OKR A;  1W5S A;  2V1U A;  1XMA A;  3IKT A;  1F4K A;  2MLK A;  4P55 A;  2HYF A;  2XAQ A;  4G7O F;  1FYK A;  2M45 A;  1SFE A;  1LDD A;  3KP6 A;  1CGP A;  5K5O A;  3FMR A;  4BQA A;  4MQ9 F;  1W7P D;  4KT5 C;  3IRR A;  2VOO A;  3RPU A;  2C6Y A;  5FLX K;  4YFX F;  4L9N A;  4RB2 C;  1EV7 A;  2VBY A;  2ZBK A;  5KVR A;  1BJA A;  4ZYH A;  3BOQ A;  2PI0 A;  2WWY A;  3FF5 A;  1JGS A;  1R36 A;  1A04 A;  3GLX A;  3J81 K;  2QM3 A;  2XUB A;  1R00 A;  2K4J A;  4L5J A;  3IRQ A;  3U9G A;  4CHU A;  4HX7 A;  4MQV A;  2XV4 S;  3I59 A;  4KN4 X;  2M30 A;  1P4W A;  5FB2 A;  4EGZ A;  4EGY A;  1ZN2 A;  2G7H A;  1DPU A;  1QQI A;  1RUN A;  2PEX A;  1IXC A;  3FXU A;  5EEH A;  4EM1 A;  4P5O A;  3K1P A;  1Q1H A;  3WTS C;  3P7N A;  4BNC A;  4OIO F;  2XKO A;  4OU0 A;  2EFQ A;  4WX9 A;  1O3S A;  4HZF A;  1E2X A;  5IT3 A;  1T98 A;  4G8X A;  2A5Y B;  2OQR A;  2RN7 A;  3DPT A;  2M1B A;  2M87 A;  2FNP A;  5L3C A;  3COA C;  1FBS A;  4K2E A;  4Y13 A;  2ISY A;  1JXS A;  4L9J A;  3KZY A;  1U5T A;  3P9K A;  2OQG A;  3JTH A;  5CJ9 A;  1YYV A;  5BPD A;  3F8N A;  2VE9 A;  3RDI A;  4LB6 B;  2ADU A;  4WXC A;  2OAZ A;  3GWZ A;  2W85 A;  1L0O C;  2Y75 A;  2Z9O A;  1LJ9 A;  5JVT A;  3GW2 A;  3H3U A;  2J5O A;  1R58 A;  3BRO A;  1FWZ A;  3L9F A;  2H6C A;  2JTV A;  4M6Y A;  1IXR C;  3MZH A;  5HLG A;  1ULY A;  2Q0O A;  2VOD A;  3L09 A;  4GO1 A;  1USS A;  1J2X A;  4L18 B;  5LRS A;  4IHS A;  3SHF A;  4UNO A;  5LHI A;  1P92 A;  4EJT A;  1LQ1 A;  1XB4 A;  2ZME A;  3PFI A;  4BAY A;  3T1B A;  2HTS A;  2DTR A;  4HA8 A;  2FSW A;  3EET A;  2FU4 A;  4RGU A;  4BXU A;  1JE8 A;  1E17 A;  4NHJ A;  4O5V A;  4LLN A;  3C3W A;  3I0T A;  1UHM A;  3ZQ7 A;  4ASN A;  4U88 A;  5LBQ A;  1S6L A;  4HX8 A;  1TBX A;  3HSE A;  5K5R A;  3OOP A;  5CVI A;  4E70 A;  2L4M A;  4RGX A;  1ON2 A;  4OMZ A;  1IF1 A;  1YTY A;  1ZGJ A;  3V8L A;  1FZP B;  2MLG A;  5L3G A;  5LGU A;  2Y0M A;  1LDK B;  3F6O A;  2DU9 A;  3I53 A;  2LDU A;  4QLC U;  3V8K A;  5LEJ A;  3KLN A;  3O3K A;  3L00 A;  4KDP A;  1LDJ A;  2D1H A;  2FOK A;  2ZO4 A;  1DP7 P;  1XGM A;  2WV0 A;  4UVA A;  1BIB A;  3RYR A;  2P5K A;  4HF0 A;  1K6O A;  3FXR A;  3F8F A;  2FF4 A;  2P6S A;  2K7L A;  3FXQ A;  2ZFW A;  3WGG A;  3DEU A;  1MDM B;  1FY7 A;  5HDK A;  4WXH A;  5CYV A;  5DD8 A;  3EDP A;  1Y0U A;  1YQA A;  4LMY A;  1RNL A;  1OPC A;  1W7P B;  4YFN F;  1GXQ A;  5BS6 A;  4M9X A;  1ZRC A;  2YSR A;  2A69 F;  2BGC A;  2FNA A;  3F3X A;  2VC1 A;  1ZRE A;  1ZG3 A;  1YW7 A;  3M7G A;  5HDG A;  5H6Q A;  3QU3 A;  2EA4 A;  3VOE A;  4PGG A;  1IXS B;  4IRH A;  1K78 B;  1D3Y A;  3KP5 A;  3JSP A;  1O3T A;  2DK8 A;  2QBY B;  4HDV A;  2EWN A;  1R22 A;  2HZT A;  3GFM A;  4UHT A;  2EFW A;  3ISP A;  2FA5 A;  1BOA A;  5D4R A;  5DCM A;  2MA3 A;  1CF7 B;  1EH6 A;  1T39 A;  2COM A;  1BIA A;  3ABT A;  3R61 A;  5DUI A;  3MAJ A;  2ZME B;  2JZY A;  3RTR A;  3RKY A;  1IN4 A;  3J80 K;  1P2F A;  1HBX G;  2RC4 A;  1O57 A;  1U6G A;  1XDS A;  3VEP A;  5ILV A;  1TQP A;  3E97 A;  3WGI A;  2TDX A;  4UUV A;  2H6B A;  2V9V A;  3WTZ A;  1MD0 A;  2PBI A;  3O2P E;  1LB2 A;  3WTV C;  2PQ8 A;  2D1V A;  3E5Q A;  4GXO A;  4LGW A;  2D45 A;  2IT0 A;  2EV6 A;  4Q48 A;  4KUM A;  4MHG A;  4MTE A;  3M9A A;  2ISZ A;  3ZMZ A;  2BE5 F;  2RVC A;  1S3J A;  3F8M A;  4B09 A;  1Z7U A;  2PN6 A;  3LAP A;  4NB5 A;  5J8F A;  3SFZ A;  3SZP A;  1RIO H;  4S05 A;  5FLX Z;  1R5H A;  4I0A A;  3CDH A;  1YIO A;  1ZLK A;  2V1X A;  1TQI A;  3T8T A;  3F72 A;  5D6E A;  2IA0 A;  2VE8 A;  1SD4 A;  4CZZ A;  4OIR F;  4IHT A;  4BHB A;  1Z91 A;  1TNT A;  2ZNZ A;  2STW A;  4KIC A;  1LNW A;  3GF2 A;  4U7B A;  5AIQ A;  1HW2 A;  1BC8 C;  2OBP A;  3HOT A;  1WRJ A;  2PMH A;  2JRT A;  1XDU A;  2RQP A;  3MCZ A;  1SMT A;  1PDN C;  4LG0 A;  2HS5 A;  3F21 A;  1I27 A;  4HYE A;  1D8K A;  2M5W A;  2FQ3 A;  5F64 A;  5DCM B;  4IJA A;  1I6X A;  1RZ4 A;  4P96 A;  4ON0 A;  1QO0 D;  2FML A;  5FFZ A;  3GXO A;  2XKP A;  1QNT A;  3E6C C;  1IN8 A;  3RKW A;  4XLP F;  1MJA A;  2IVM A;  1F1Z A;  4N9H A;  3QPH A;  1G3Y A;  4ZYG A;  2DW4 A;  1IZ1 A;  2AS5 F;  2CGP A;  2DBB A;  3E6M A;  1B59 A;  3R4K A;  1YS6 A;  1R23 A;  4HLY A;  1R7J A;  3WE3 A;  2Z99 A;  5CVU A;  2XAG A;  4N0B A;  1S7O A;  1BM9 A;  4RAZ A;  2LSO A;  1TNS A;  3PQK A;  1HST A;  2H27 A;  3HRM A;  5BOX A;  3MFK A;  2QWW A;  3BY6 A;  4IPA A;  2MBF A;  3P9C A;  1TW3 A;  3JSO A;  4QWQ A;  4MTD A;  5JR3 A;  5K5Q A;  3JAM K;  2OU2 A;  3MQ0 A;  2GA1 A;  1TW2 A;  2Z5U A;  5HLI A;  1I5Z A;  3IWZ A;  3CUQ A;  3U2R A;  3M1E A;  2GXG A;  1Z05 A;  1GVJ A;  1QZY A;  1YLF A;  2CWE A;  4KFC A;  2RKH A;  4ESF A;  1K7A A;  2VN2 A;  3HRS A;  3L7W A;  2ELH A;  1HKS A;  3TKY A;  1TQM A;  1BC7 C;  2VT2 A;  1QBJ A;  2W84 A;  4G6D A;  5F1R A;  1S29 A;  3CO6 C;  4A5N A;  4FX4 A;  5HLH A;  3E5X A;  3WGH A;  2IP2 A;  3HRT A;  1KQ9 A;  1XN7 A;  3QOP A;  2HOE A;  4L9V A;  2A68 F;  2CW0 F;  4G7H F;  4KNY A;  2EFP A;  4CYD A;  1XGO A;  4A0Z A;  3HSF A;  1QPM A;  2G9W A;  2VOP A;  1FX7 A;  4WF2 A;  5LHG A;  3LQR A;  3WTY C;  2JPB A;  2EK5 A;  4RB0 A;  2ZNY A;  4OMY A;  4A2U A;  4GYG A;  3B73 A;  2KIM A;  4UXN A;  3GUD A;  3WTX C;  2IW5 A;  1KGS A;  2ETH A;  1T0F A;  3IWF A;  1PP8 F;  4O6J A;  4I01 A;  3QP5 A;  5DDG A;  4FT8 A; 
#chains in the Genus database with same CATH topology
 2EB7 A;  3L2C A;  4HST A;  2OV7 A;  1ZG1 A;  4IX7 A;  3BG3 A;  2CSO A;  4ZH4 F;  3S2H J;  1P4A A;  1HQC A;  2EBI A;  4R1H A;  3ZPL A;  3PO3 J;  1V5F A;  3V7S A;  1SD5 A;  1UG2 A;  2EZI A;  4NQW B;  3EPZ A;  5L3B A;  5D5V B;  2K9S A;  5D6F A;  1LKX A;  3DLA A;  1DGW Y;  1WKM A;  2EFO A;  5ERI A;  2K9Q A;  3CCR I;  4UVC A;  5HDN A;  2HXI A;  1X1C A;  2JRM A;  1G3W A;  3GFI A;  2KJC A;  1YS7 A;  5E1X A;  3QPS A;  4M3G A;  1V54 H;  5BNG A;  4ZTF A;  2H8W A;  3BDD A;  1XGN A;  3BJA A;  2NVQ J;  4XRF A;  3HOY J;  4A3J J;  5JHU A;  4HDU A;  1WGX A;  3VPR A;  1K4S A;  2R7O A;  3ZQC A;  1Z3Y A;  3VB2 A;  2XAF A;  2ZXI A;  4EM0 B;  2DFI A;  1BI3 A;  3CUQ B;  4LJZ F;  2LMD A;  4R8H A;  4X0G A;  3I4N J;  4G6Q A;  3F23 A;  4M72 A;  3CC2 I;  4JQF A;  2MG4 A;  1LEB A;  2UZK A;  3V7R A;  5F0F A;  4LFU A;  1C0W A;  1W5T A;  1UG0 A;  4M6X A;  4H4K C;  4A6D A;  4RA2 A;  2EIK H;  2GOM A;  2JUG A;  3VOD A;  1U78 A;  2L4A A;  3BZ6 A;  3DKX A;  1BN5 A;  3PL8 A;  2IEK A;  3CF5 F;  4IHX A;  4OIN F;  4AC0 A;  3G1O A;  2OA4 A;  3Q5F A;  3M4O J;  3FBI B;  2JA5 J;  4GYI A;  4BDY A;  2P6T A;  3S93 A;  2ICW G;  4KIF A;  3S3N A;  5LEK A;  5KK1 A;  1AU7 A;  3MKZ A;  2JWT A;  3OYM A;  1XPX A;  2BHY A;  2MH2 A;  5M5Y J;  3J80 Z;  3CCJ I;  4CGZ A;  2H94 A;  3BC8 A;  3OYH A;  2CUZ A;  4Z2Y A;  2GIV A;  1JUS A;  1HDP A;  5HS8 A;  4A3I J;  2M4K A;  2DXI A;  1XGS A;  2BV6 A;  3BR0 A;  3CTA A;  4CSW A;  4XRS A;  3CJT B;  3R0J A;  4N4O B;  3FK7 A;  2FQ4 A;  1RES A;  4RAG A;  1MNM C;  4DZJ A;  3F22 A;  1JT6 A;  2RGV A;  3ECH A;  1H9G A;  3B6C A;  4IVN A;  4XLC A;  3FIW A;  2IRF G;  2L02 A;  4UV9 A;  4EJV A;  4RBO A;  1IC8 A;  3K6G A;  3I59 B;  1IN6 A;  3J7A O;  3LSH A;  5L3D A;  3IC7 A;  1MBJ A;  1K4T A;  2YS9 A;  1XD7 A;  4A3C J;  3QQA A;  3ZQQ A;  3NRV A;  4PSW A;  2GZW A;  5H6R A;  2O6G E;  3SXY A;  2HDC A;  1Z6T A;  4XL9 A;  1MKM A;  1U8B A;  4YEJ A;  2XAJ A;  3CC7 I;  2PJR A;  2EA2 A;  5IY5 H;  3TDU C;  1W0U A;  1D0Z A;  3E6D A;  2VT3 A;  3G1M A;  1OYY A;  2IS6 A;  3VYT B;  1W36 C;  4ZDP A;  2JMW A;  4Y15 A;  1D8J A;  2OZ6 A;  2LY1 A;  2M8G X;  3IL2 A;  3DFG A;  3BPV A;  2HU9 A;  2YU9 J;  4YFK F;  2V1D A;  4W97 A;  3S1R J;  4EQQ A;  2BW3 A;  1J0R A;  3ZQG A;  1U9N A;  2V1N A;  1Z6R A;  3PNT A;  1AHD P;  1KZH A;  3H1C A;  1VQ4 I;  1Y56 A;  3V8J A;  2DA3 A;  2BEO A;  2VJ5 A;  3GME A;  4KIB A;  2VXD A;  4E7S A;  4HEA 2;  2MD5 A;  5D8L B;  4U7D A;  2X48 A;  5E1Z B;  1RUO A;  3OWT A;  5D8K B;  2DK5 A;  5LGN A;  4IF4 A;  4JK1 X;  4BY7 J;  2Q8K A;  2LP0 A;  2Z2S B;  3OR1 C;  3MN2 A;  1SMY F;  4Y17 A;  3HC7 A;  2ZXJ A;  3AG2 H;  5CVR A;  4JX4 A;  1VI0 A;  1YX3 A;  1PYV A;  2HR3 A;  3OL4 A;  3GBG A;  2VBZ A;  4DZP A;  2GOX B;  1OCC H;  4PDK A;  4YG2 F;  1U5T B;  3FMQ A;  5JHF A;  1P9Q C;  4GGG A;  2X85 A;  2XF5 A;  3DBH B;  5ILU A;  1MGT A;  1O4X A;  4MGR A;  4QPO A;  4M74 A;  4OAY A;  2CU7 A;  2CV0 A;  1HDD C;  4Q47 A;  3A02 A;  4JX5 A;  3ZMU A;  4P1W A;  2E2J J;  2CH0 A;  3FKI J;  5HVQ C;  2DDB A;  4S0H B;  4E7H A;  3CQZ J;  4XR6 A;  1YIT I;  2ID6 A;  1FOX A;  3JTG A;  4DJA A;  1J7K A;  3BG9 A;  3M1C A;  4ZTJ A;  3E6B A;  4B4C A;  1ETQ A;  3W6K B;  3JRC A;  2DA5 A;  4B3X A;  2NAZ A;  1X4P A;  3HJE A;  1I1G A;  2X51 A;  2XPW A;  5L3E A;  2BXY A;  4EJW A;  2CV2 A;  1SD6 A;  2FEZ A;  1ODD A;  1UB9 A;  2FBK A;  1ZHF A;  2ZFU A;  2Y48 A;  2WC2 A;  3SQN A;  4RAY A;  4RS8 A;  2NOG A;  1BR4 A;  2COB A;  5J1R A;  1TT0 A;  4UB6 C;  1YO5 C;  3H0G J;  2NVT J;  5IPA A;  1ITY A;  3TOA A;  2VQL A;  1R5G A;  4Y33 A;  3REO A;  2JA7 J;  5FKL A;  2P4W A;  4LK0 F;  5E3O A;  4V2F A;  4AU7 A;  3K70 C;  1ERD A;  5E3L A;  1V3F A;  3GFL A;  3K4M A;  2A07 F;  5DUK A;  4KIT B;  3G3Z A;  2L2O A;  2STT A;  1J5Y A;  4LG3 A;  2WAD A;  4KA4 A;  3ZN0 A;  2X6O A;  1FYM A;  2R7Z J;  3WTU C;  2EZH A;  5LFA A;  4F7Z A;  3I4M J;  4XLN F;  3FBN B;  5D5W B;  4M3F A;  1JGG A;  2HOT A;  3PO2 J;  2EIN H;  4U0V A;  5CVJ A;  2VB6 A;  2RNJ A;  4J19 A;  3LAJ A;  2VQC A;  1JT0 A;  1F43 A;  3ZMD A;  2LC2 A;  2VL8 A;  4FHT A;  1J09 A;  2GAU A;  4CCL A;  3RJP A;  2MW8 A;  5F04 A;  3S32 A;  4IOA F;  1F36 A;  5HLT A;  2F5D A;  1AKH A;  4IL6 C;  4XKV A;  3KE2 A;  4ZC3 A;  3JR9 A;  2XVC A;  4KYW A;  4XKW A;  3Q9S A;  4DQ2 A;  1TLH B;  3JAM Z;  4YIF A;  5J8C A;  4RM3 A;  3CCM I;  2ZME C;  4BE1 A;  1ETW A;  2NRA C;  1MIJ A;  2X1E A;  3CCQ I;  4HF1 A;  5JLW A;  2XGC A;  1GHC A;  4RM2 A;  2A5W A;  4DOZ A;  1MJB A;  2E7W A;  2PMZ A;  1HC8 A;  3PSI A;  1B9M A;  3K2Z A;  1OYW A;  1LVA A;  2DA1 A;  3K1M A;  3Q9V A;  4NNJ A;  2PX9 A;  4HOB A;  3BPX A;  1XSD A;  3SFI A;  1IW7 F;  3EUA A;  1MW7 A;  5FFX A;  1MMN A;  1Z1D A;  1B1B A;  2XGX A;  3PJR A;  2ZSH B;  1XMK A;  3QWL A;  4HSR A;  2E1O A;  3A1Y A;  2DYS H;  3CCL I;  1E3O C;  5EGO A;  1QPI A;  4Q4Z F;  1D5V A;  3LSG A;  2KIF A;  1TWH J;  2DMQ A;  3OYC A;  3OYB A;  5KAI C;  2MH9 A;  3O6B B;  5DEQ A;  4LIT A;  1IJW C;  3EUH C;  1GXP A;  2VXZ A;  2M34 A;  2HVS A;  2MSY A;  1R5I D;  4XSZ F;  3LOC A;  3OIQ A;  4CYC A;  2JQ7 A;  3SZT A;  3LST A;  1V4R A;  4RB3 C;  1Y6I A;  1YIJ I;  1DUX C;  3W3C A;  1I39 A;  4CZC A;  2BZT A;  5HS9 A;  2KZG A;  3TBI A;  2ME0 A;  1B6A A;  1RC9 A;  4EJU A;  3H9J A;  2HI3 A;  4BUP A;  3BG7 A;  4LIU A;  3N05 A;  1T08 B;  2NNY A;  4AD9 A;  1V5G A;  2M8E A;  4XRM A;  2QEN A;  1FP2 A;  4EMS A;  4E7Z A;  3ERE D;  2RDP A;  3OYJ A;  1UMQ A;  3I58 A;  4OIP F;  4G7Z F;  5J40 A;  4UUS A;  3MKL A;  2WY8 Q;  4ZYD A;  3TL4 X;  3MEX A;  3JRA A;  1U3E M;  3GVA A;  3U1D A;  1MND A;  1ON1 A;  3W6J B;  4PUS A;  3TMO A;  4A6E A;  5BPI A;  5TIS C;  3HBL A;  1RR8 C;  2DFH A;  3CDL A;  1XSV A;  3HHH A;  4E7I A;  3L2W A;  1UCR A;  3KX2 A;  1WQ2 A;  1T2K A;  4NDL A;  2IPQ X;  2NVY J;  3OS2 A;  2QSG X;  2O8X A;  3HPH A;  4V2G A;  3KYD B;  1Y39 A;  2HZD A;  1FYL A;  4QSH A;  2CW8 A;  1PUF A;  2DT5 A;  2Q1Z B;  2XF7 A;  1TL8 A;  1T56 A;  1D1A A;  5FKM A;  3ZXS A;  4CIC A;  1GT0 C;  2M0C A;  3LSJ A;  5ILS A;  4HNV A;  1YRN A;  1OIS A;  2KRH A;  5E3M A;  4ZYE A;  1DP3 A;  3I71 A;  2Z33 A;  1FT9 A;  2YX7 A;  2ZJ2 A;  1ETO A;  3FWE A;  5LGT A;  2V6E A;  1UST A;  4HLX A;  3G71 I;  1AWC A;  1VQL I;  4LD5 A;  2HOS A;  2Y69 H;  2ZJP F;  1X19 A;  2R7D A;  2CQK A;  2K02 A;  3CUO A;  3SJM A;  3WU2 C;  2R7S A;  2K27 A;  1JHH A;  2E1M B;  1A31 A;  2Q2E A;  5AIP A;  5GAH J;  1ZG5 A;  1HSJ A;  2ELK A;  3DF8 A;  3FXJ A;  5HNH A;  3MWM A;  2F4O B;  4ENN A;  4B44 A;  5L3F A;  4RDU A;  4EV0 A;  3CCV I;  1LFP A;  1A5J A;  1IRZ A;  2NS7 A;  2PMZ N;  3SEQ A;  4E6K G;  3BG6 A;  1LFU P;  2QQB A;  2CMP A;  1Z77 A;  4PJ0 C;  1JUP A;  3ABK H;  2DMP A;  3QOE A;  4JYK A;  5IOY A;  2Y30 A;  4BAC A;  2WBM A;  3LMM A;  3V4G A;  2X9D A;  3SYT A;  1RI7 A;  2QA4 I;  4OOI A;  2IAI A;  4ENK A;  4HX4 A;  4PGH A;  1QVU A;  5LHH A;  3ZQL A;  1OCT C;  2CQQ A;  3PFY A;  3BP8 A;  5TRD A;  2PFB A;  1ETV A;  2H1K A;  3QAH A;  2PG4 A;  4BXX J;  2GXB A;  2BYV E;  3KYC B;  4HV6 A;  5E8G A;  5DV5 A;  1N78 A;  2QLZ A;  3R60 A;  1WJB A;  2BY2 A;  4XNF A;  2R5Y B;  3LWF A;  3FX3 A;  3NWT A;  5CLS A;  5B66 C;  1HCR A;  4XOT A;  5HS7 A;  2AXT C;  2JT1 A;  2HDW A;  1YG2 A;  1ZGA A;  4IRG A;  1YOV B;  2DA2 A;  3D0S A;  5E3N A;  2P8T A;  1JJ8 C;  2NXN B;  4HRI A;  1AA7 A;  4XN0 A;  3K9T A;  4XSX F;  3R0A A;  3H5N A;  3LSR A;  4CYC B;  3WOD F;  4GDF A;  4HBL A;  1KU9 A;  2O03 A;  3RSN A;  2ZJR F;  4EVI A;  1UZC A;  2ECB A;  3G4S I;  3DPL C;  2WAE A;  5FD6 A;  4C3J J;  3WE2 A;  3RIR A;  4V19 K;  1OR7 C;  4XRS G;  3QPT A;  1ONV A;  2V79 A;  5IT9 K;  4FX0 A;  3ASN H;  1ZH5 A;  4CO8 A;  1K83 J;  1V5E A;  3CCS I;  2F6C A;  4BS9 A;  4CXF A;  3CME I;  2MC4 A;  1S7A A;  1R71 A;  1QHH D;  4Q5S F;  4A0X A;  5FGM A;  4A0Y A;  1R6R A;  2K4B A;  1UHW A;  3QPL A;  2B9S A;  2QQA A;  4UUS B;  5K7F A;  1KU3 A;  2P7C B;  1HKT A;  3Q0U A;  1QGP A;  2OTJ I;  4KMU X;  1ZAR A;  5EEA A;  1S7E A;  2OZU A;  2CYY A;  1SFX A;  1JHF A;  3QP6 A;  5JFR A;  3BR3 A;  1X58 A;  4A3B J;  1OMI A;  3UNG C;  1Y8R B;  3HUG A;  1DU6 A;  3M8E A;  3KIO A;  3ZMV A;  3TQN A;  1TWF J;  4LIV A;  2L54 A;  5JI6 A;  3ROU A;  5ICF A;  3EUK L;  4ANJ A;  3PNV A;  1BI1 A;  1J9I A;  2A6H F;  2O0Y A;  3GO5 A;  5D5X B;  4BBR J;  4LG0 B;  3LFK A;  2CUF A;  5F27 A;  1WJD A;  2LKS A;  1VQ8 I;  1OCR H;  4I0B A;  1P6R A;  4CCK A;  5A2Q K;  2E34 A;  4A3E J;  3I4P A;  2HFH A;  1FIA A;  4N9I A;  1PUE E;  2R93 J;  4H0E A;  3QYF A;  3HSR A;  1Z21 A;  4FQG A;  1MH3 A;  2YR2 A;  1DPR A;  1IDZ A;  3K69 A;  3FDY A;  1MBG A;  5AON A;  5DTD A;  3ZMS A;  4ZDL A;  1XCV A;  1ZAO A;  5F6F A;  3HTU A;  4A3F J;  3H0D A;  2R7V A;  2K86 A;  5TGT A;  1VFC A;  3CJN A;  1MBE A;  4ESB A;  2L5Q A;  3QYB A;  2DJN A;  4LK1 F;  3CD6 I;  3IKV A;  1BL0 A;  3S2D J;  2O3F A;  3DU6 A;  4DNC A;  1MSE C;  1H0M A;  3OS0 A;  3I55 I;  1NK2 P;  2LRD A;  2LR8 A;  1WJE A;  2B7E A;  3DEW A;  2X4H A;  2XC7 A;  3ZCO A;  1X3Z B;  3PNY A;  4A3G J;  2LKX A;  2R92 J;  5B1A H;  4XIC A;  2NNN A;  4BBS J;  5E1W A;  3VWB A;  5D5U B;  3PQJ A;  4GCV A;  5GPA A;  1DGR M;  4G12 A;  4BEH A;  2DO7 A;  4BE0 A;  2L3D A;  2R7F A;  2F48 A;  2KZV A;  5B5E C;  4MLO A;  1FPQ A;  1T6S A;  2M0M A;  3RYP A;  1M1E B;  1YFH A;  3H9Q A;  4HF2 A;  5LRR A;  2LBF A;  4RGS A;  1IGN A;  1ZRD A;  4O3M A;  2LF8 A;  3CJQ B;  1H88 C;  4RLF A;  3S1N J;  3GFJ A;  1F5T A;  1A36 A;  1FNN A;  3GYH X;  3JW4 A;  3ZQF A;  3ZP5 A;  4IO9 F;  2GLO A;  2OD5 A;  2JSC A;  2HPM A;  1FIP A;  3K1N A;  2CW7 A;  3NEU A;  4BJ6 C;  2NS0 A;  4F91 B;  1MDM A;  4KMF A;  1MMA A;  2OC6 A;  5EJC A;  1SD7 A;  2YPR A;  3L2Q A;  2A6E F;  1TTY A;  3U21 A;  1WI9 A;  3GTO J;  3ZMT A;  4U0W A;  3SEZ A;  3RI4 A;  3E5U A;  5KCM A;  2GWR A;  2EJR A;  3VSK A;  3X2Q H;  3GX4 X;  3S1M J;  1G2H A;  4YII A;  4R79 A;  5C4J J;  1W7P A;  1WSU A;  4L0Z B;  2HEO A;  3DEE A;  2B63 J;  6PAX A;  4M9S A;  2B0L A;  1MMD A;  3VYR B;  3TED A;  2EV0 A;  1WJC A;  1MH4 A;  1MZB A;  2W24 A;  3Q0W A;  1P7I A;  5FKK A;  3A4C A;  2LNB A;  4JOM A;  2KIS A;  4ENJ A;  5K1Y A;  1ZQ3 P;  3AL0 B;  5CPR B;  4AID A;  1H9T A;  5FD5 A;  4EJO A;  3CUQ C;  3FXK A;  1IRF A;  4X6A J;  2E36 A;  4ZJZ A;  3K0L A;  5F08 A;  1SAN A;  3AG4 H;  3U1K A;  1S8N A;  4AWX B;  5DD4 A;  1FSE A;  1FJL A;  5ICC A;  4MEY F;  1KU7 A;  3L2V A;  4CA0 A;  3DKY A;  1L3L A;  4HQE A;  2W4S A;  1U2W A;  3V7C A;  1K78 A;  1UJ8 A;  3BR1 A;  3MVP A;  4IXA A;  3DLL F;  2IGM A;  3LA3 A;  4S04 A;  2QBY A;  2F5E A;  1IN7 A;  2J5P A;  2KJB A;  2CG4 A;  1X2M A;  2KLO A;  5C4X J;  3KYL A;  2P81 A;  3TGN A;  2RV8 A;  2E7X A;  2QZ8 A;  4CUG A;  2DA6 A;  4C30 A;  2VKD A;  4BQN A;  3WTW C;  3P5J A;  1CF7 A;  2A61 A;  2RRE A;  3PUB A;  1FMW A;  2BY1 A;  2FJ1 A;  1ZRF A;  1V55 H;  3H5A A;  3EYI A;  1MJ9 A;  2V6C A;  3DKW A;  3L2U A;  3Q0V A;  4RAF A;  4U0Y A;  1B72 A;  4D7M A;  4PFO A;  2DPU A;  2L7K A;  3BTI A;  3WTT C;  1G59 A;  4D1Q A;  1O3Q A;  1IAW A;  1XS9 A;  2R5Z B;  2X6W A;  3T0Y A;  3JRB A;  1HW5 A;  4FAS D;  4CCM A;  3VYS B;  3QRF F;  3C7J A;  4XM3 A;  2A3S A;  3G2B A;  1AOY A;  3AG3 H;  5FLM J;  5ED4 A;  1VZ0 A;  1R49 A;  2LRE A;  2KIQ A;  5E8I A;  2Y9Y A;  2HKX A;  4M71 A;  1IO2 A;  3N4M A;  5H20 A;  4ZDO A;  1YW8 A;  5F1J A;  5EEG A;  4E7K A;  4IEJ A;  4KIG A;  2PJP A;  2VKV A;  3WU0 A;  1JKQ C;  4IRI A;  3EQL F;  3DV8 A;  2DOA A;  4RLQ A;  4B48 A;  1TC3 C;  4ABZ A;  1O7F A;  3EUH A;  4ZZL A;  4RB1 A;  2HYG D;  1X3U A;  3IAS 2;  3K4L A;  1QU3 A;  4XN3 A;  5E20 A;  4XON A;  2HKO A;  5TJJ A;  3PIP F;  1U8R A;  2WAF A;  2XRN A;  4MO7 A;  1O3R A;  2NS8 A;  2IA2 A;  4OIQ F;  1G6N A;  1IUY A;  1XCB A;  2QF7 A;  1W1W E;  5FRM A;  1K79 A;  3HOV J;  5LLQ A;  4QPQ A;  3TO6 A;  2QVO A;  4A3L J;  2CFO A;  4C2M J;  2PMU A;  4PCQ A;  2JK3 A;  4P9U A;  4IHY A;  2ESN A;  2PLY A;  2P5V A;  1SVM A;  3DPU A;  1MBH A;  3IHU A;  2IS4 A;  3S3O A;  1J59 A;  4A12 A;  1X2N A;  3L1P A;  4AIK A;  5E17 F;  4KN7 X;  4TV7 A;  3WU1 B;  3AFH A;  2UUZ A;  2XAU A;  1B9N A;  1FC3 A;  1FBU A;  3H3Z A;  4I98 B;  1X4O A;  2HGC A;  2KHM A;  3DXJ F;  3FM3 A;  5DCF A;  4BU2 A;  2G7U A;  2FBI A;  2AXL A;  4BE2 A;  3TO9 A;  3F8B A;  4DYQ A;  3BQY A;  2IS1 A;  3RPQ A;  5J47 A;  1X1A A;  2I10 A;  1BBY A;  4D5F A;  5EDN A;  2KT0 A;  4MEX F;  1U5T C;  3H92 A;  3LSM A;  2F5C A;  1EH8 A;  5LD2 C;  3KP2 A;  2XSD C;  5HNF A;  3CCE I;  1VQ6 I;  2XRO A;  1SAX A;  4Y52 J;  2EH3 A;  3OYD A;  2EIJ H;  2LF7 A;  3PUF A;  1HW1 A;  1G3S A;  1BI2 A;  2HQR A;  4QTR A;  1X3W B;  3LSP A;  3S16 J;  2AQE A;  4BYY A;  1DQU A;  5J6X A;  1LE8 A;  1VQP I;  2GQQ A;  1J75 A;  4JBA A;  2ESH A;  4BJ5 C;  2FUG 2;  1FP1 D;  5CQG A;  4IOC F;  1X1P A;  4M73 A;  2LLK A;  3LSK A;  3T8R A;  3C1D A;  4LB5 A;  2W57 A;  1P4X A;  4GRI A;  2P5L C;  2EZL A;  1O7L A;  2QEX I;  4C2U A;  1TWG J;  1Z9C A;  3CO7 C;  3RZO J;  2MAB A;  3LA2 A;  3M3Y J;  1GDT A;  4BL0 B;  2M7B A;  3CCU I;  3ML6 A;  1UFM A;  3KCC A;  2CFX A;  1ZTR A;  4PZJ A;  5C3E J;  1G4D A;  2DA7 A;  4C2T A;  3I3L A;  3KP3 A;  2ACJ A;  2YX4 A;  2DMT A;  4M9Z A;  1FBQ A;  3KLO A;  3CZ6 A;  1I1S A;  3ZN1 A;  3JRE A;  4WWC A;  4EEF G;  2WB1 A;  2IGK A;  2CQX A;  3QU6 A;  2L01 A;  2XIG A;  2ZXH A;  3BQZ A;  2NYX A;  4D5C A;  5H2F C;  4J00 A;  3PSF A;  1B72 B;  2WTE A;  4AM3 A;  2L9V A;  1EH7 A;  3N97 A;  1R1T A;  4UUT A;  2LY2 A;  2QYO A;  2PJR B;  2UWM A;  1GVD A;  2R4G A;  3S2W A;  2IA1 A;  3C18 A;  1IRG A;  3RQI A;  1ZR4 A;  2EFN A;  4LLG F;  2E1N A;  3DBL B;  3D5L A;  1ORK A;  1F9N A;  5B3S H;  2RNG A;  1OCO H;  3P9I A;  1PP7 U;  1G8X A;  3CLQ A;  3T5X A;  3FMS A;  3HDD A;  1QZZ A;  5E79 C;  5EZH A;  1H89 C;  1I6H J;  1KU2 A;  3TO7 A;  1R1U A;  2ZKZ A;  2H09 A;  5HOD A;  2F2E A;  4DGW B;  3HYI A;  2DQL A;  2HQA A;  2BW3 B;  4ZYA A;  4EM2 A;  2YU3 A;  2DI3 A;  3I54 A;  4AIJ A;  4G94 A;  3F6V A;  2DMN A;  2LKP A;  4WCG A;  4P9F A;  2HWV A;  2KKO A;  2Z16 A;  2CO5 A;  4HQM A;  2V26 A;  2WA0 A;  3RCO A;  2M3A A;  4UVB A;  4D0P A;  4G9Y A;  1S5L C;  3LQQ A;  5BQT A;  5IT9 Z;  2EQR A;  3HPG A;  3JRD A;  5CVV A;  5DYM A;  3VFZ A;  3HHG A;  3E3V A;  3GEZ A;  4AVP A;  3KEO A;  4AYB A;  5GTH C;  1OCP A;  2QGU A;  3NAU A;  1ZGW A;  1FTT A;  2KPM A;  3LL7 A;  4HW0 A;  3S1Q J;  1OR7 A;  3MMY B;  2BBY A;  2EV5 A;  4ENM A;  3GLL A;  5ICE A;  1BOB A;  3QYE A;  4PJJ A;  1W4M A;  3BJ6 A;  3DQV C;  5FRN A;  1HXD A;  2L0K A;  3KFW X;  2R7U A;  3FXM A;  4BHP A;  5J4Y A;  4ITV A;  1BI0 A;  2ZC2 A;  2VBX A;  4WXD A;  2D2W A;  2KRF A;  2ELJ A;  4MFD A;  1XG1 A;  4I2O A;  3HOS A;  4HV5 A;  4XLE A;  5JVG F;  1WVR A;  5FKO A;  4YRV A;  2DFE A;  2HTJ A;  3AAF A;  3KET A;  4HAM A;  4MNU A;  2XDV A;  2HDD A;  2W82 A;  2ZCW A;  3BWG A;  2ZXW H;  1KYW A;  3HTS B;  3DTI A;  4BXF A;  2XGD A;  5A2Q Z;  2P0W A;  1MSF C;  3SZG A;  1WH5 A;  2QUF A;  3CP8 A;  3J81 Z;  4XLH A;  2VJ4 A;  2KIU A;  2X0L A;  2Z3Y A;  1FTZ A;  1WWX A;  1KQ0 A;  2FXA A;  3HIF A;  4I7H A;  1B4A A;  1KYZ A;  4BHC A;  1LE8 B;  1OJL A;  5GPC A;  1IV6 A;  5J3L A;  3ASO H;  3FHZ A;  5JLX A;  5J1Y A;  3GZ6 A;  4LLL A;  4AIH A;  3WG9 A;  1IN5 A;  4KT6 A;  4UB8 C;  5EG0 A;  2HNH A;  4MIM A;  1DDN A;  2GA2 A;  2E1C A;  5CQE A;  3FKJ A;  2ZSI B;  2QQ9 A;  4Y3O A;  1Z7L A;  1EF4 A;  5HOO A;  2JPC A;  5GAE J;  3CMY A;  3HG9 A;  1FOW A;  3I64 A;  1B8I A;  1BR2 A;  2K9N A;  2GXA A;  4XBF A;  3E7L A;  3M07 A;  1FSH A;  5FKN A;  3OR2 C;  2DPD A;  1HKQ A;  4I02 A;  1HF0 A;  2GM4 A;  1NHA A;  2ID3 A;  4ZZD A;  1ZLJ A;  2R3S A;  2HVQ A;  3KP4 A;  3OIP A;  4CDG A;  4GFB A;  1ZYR F;  2EPF A;  2QCO A;  1VTN C;  3M8F A;  1EA3 A;  3FM5 A;  3B02 A;  1AKH B;  4IHW A;  4A69 C;  1XSX A;  1SFU A;  4LOC A;  2Y31 A;  2DT6 A;  3KP7 A;  3I56 I;  2CV1 A;  4BH9 A;  1T8I A;  3K4B A;  5EYR A;  1LEA A;  1Q1V A;  4IQ4 A;  5ICG A;  1TZL A;  2VQG A;  2X6X A;  3TOB A;  2M7A A;  2E1M C;  3DP7 A;  1JJ6 C;  4A5M A;  3ECO A;  3KEQ A;  1W36 D;  4DYC A;  3ELK A;  3G73 A;  2O61 A;  4ETS A;  1FOY A;  2DAO A;  2L9S A;  1YJW I;  4IQJ A;  2QKM B;  4RGR A;  2Y2Z A;  2CUJ A;  2MC3 A;  2UXN A;  2W1O A;  3G1L A;  3KZZ A;  3LA7 A;  5FO5 A;  1BA5 A;  1KA8 A;  2VJI A;  1YW9 A;  2XAH A;  4BJT A;  4L9T A;  2R7Q A;  5E18 F;  3D1N I;  3WHB A;  1KQ8 A;  1T33 A;  4WK8 F;  4AYB N;  2VBW A;  2FBH A;  2VC0 A;  1VF9 A;  2W7N A;  1RPW A;  4UV8 A;  3R6S A;  3UR3 C;  5M5W J;  1IRX A;  3CP2 A;  4NQW A;  1FOK A;  3MZY A;  2NVX J;  4L0Y B;  1T38 A;  4L5I A;  5EGO B;  1VQ5 I;  2IJL A;  2R0Q C;  1R1V A;  1Y1W J;  1OYI A;  2P7V B;  2FMY A;  1H8A C;  1LVK A;  2FE3 A;  2W25 A;  4ESJ A;  5D4S A;  2HQN A;  3FZV A;  3ABU A;  4CCN A;  1I3A A;  1Y1V J;  2RQQ A;  4I09 A;  1VND A;  3GZ5 A;  2DQR A;  3BJO A;  3OOU A;  2XAS A;  1FLI A;  1STZ A;  2BVL A;  2CRG A;  4A93 J;  2DJI A;  3K4J A;  1REP C;  2KDO A;  5IYB J;  2DLL A;  2M9H A;  4B8X A;  1G3T A;  2E5Z A;  2F5F A;  3I5U A;  3TDZ C;  5BMZ A;  3ULQ B;  2HXO A;  2Y0S A;  2XHK A;  2JUC A;  2LYC A;  1N75 A;  4F92 B;  3OYF A;  3EYY A;  3RKX A;  3CLO A;  3F8C A;  1UEL B;  2I8D A;  3HRU A;  1XMX A;  2UXX A;  3HOX J;  3HL2 A;  3H9G A;  2FRH A;  2VON A;  4JP0 A;  3NQO A;  3OV8 A;  1OKR A;  1W5S A;  3A0H C;  2V1U A;  1XMA A;  3IKT A;  1F4K A;  2MLK A;  4P55 A;  2HYF A;  2XAQ A;  4G7O F;  1FYK A;  2M45 A;  1SFE A;  3ABM H;  3LSI A;  1WI3 A;  1LDD A;  1SFK A;  1ENH A;  3HB9 A;  3KP6 A;  3E1S A;  3FMR A;  5K5O A;  1CGP A;  4BQA A;  4MQ9 F;  1W7P D;  4KT5 C;  2OPT A;  2V9P A;  2RAE A;  3IRR A;  2VOO A;  2MYS A;  3RPU A;  2C6Y A;  5FLX K;  4YFX F;  4L9N A;  4XOP A;  2MGQ A;  4RB2 C;  1EV7 A;  1PUF B;  2VBY A;  2VPL A;  4BGD A;  4IZZ A;  1SVL A;  2ZBK A;  1VQO I;  1JKP C;  4A3D J;  5KVR A;  4MFE A;  1BJA A;  3TW7 A;  2XRL A;  4ZYH A;  1YRN B;  3BOQ A;  2PI0 A;  2O7O A;  5K7H A;  1QZE A;  2WWY A;  2XB5 A;  3BG5 A;  1RKW A;  5EG0 B;  3FF5 A;  1JGS A;  2L9R A;  1R36 A;  1A04 A;  3GLX A;  3J81 K;  2QM3 A;  2OF7 A;  4BKX A;  2H1L A;  2XUB A;  2DFF A;  1R00 A;  2K4J A;  4L5J A;  3IRQ A;  3K4N A;  3U9G A;  4CHU A;  4HX7 A;  4MQV A;  2XV4 S;  1JTY A;  1B8I B;  4A3M J;  2CUE A;  3I59 A;  4KN4 X;  2UV1 A;  4YEL A;  2M30 A;  3ZOB A;  4Y7N J;  1VQK I;  1P4W A;  2Q2E B;  3BTL A;  4NBQ A;  5FB2 A;  4EGZ A;  4EGY A;  1ZN2 A;  3OSF A;  4UY8 I;  1RR7 A;  1VQN I;  2G7H A;  3W2V A;  2BY0 A;  4KJZ A;  1DPU A;  5EZG A;  1QQI A;  2W00 A;  3K4K A;  4M3E A;  5FJ8 J;  3HOZ J;  2L9N A;  2PEX A;  1RUN A;  3D5R C;  1IXC A;  3FXU A;  5EEH A;  4EM1 A;  3MD2 A;  2AHQ A;  2WY7 Q;  4P5O A;  2E2I J;  4CH7 A;  3K1P A;  4BQQ A;  1Q1H A;  1E3H A;  3WTS C;  2KDZ A;  3ZRG A;  2JA8 J;  3P7N A;  4BQO A;  2XGE A;  3GTJ J;  5J1U A;  4BNC A;  3A03 A;  4OIO F;  2XKO A;  4OU0 A;  4B47 A;  2JVG A;  2EFQ A;  3F9K A;  4WX9 A;  1UAA A;  1D0X A;  1O3S A;  1FEX A;  5IYC J;  4HZF A;  1E2X A;  5IT3 A;  3LFU A;  1SEU A;  1T98 A;  4G8X A;  2A5Y B;  4FCY A;  2OQR A;  2RN7 A;  3BZK A;  3DPT A;  1BJZ A;  3FHN A;  2M1B A;  2V9K A;  2M87 A;  2FNP A;  1VQ9 I;  4DW6 A;  5L3C A;  2CQ7 A;  2A05 A;  3COA C;  1FBS A;  2HQ5 A;  2JJ7 A;  1R4N B;  4K2E A;  2K40 A;  2NVU B;  2LH9 A;  1NH3 A;  4Y13 A;  2ISY A;  1JXS A;  1A6I A;  4L9J A;  1W0T A;  4EAT A;  2E35 A;  3TW6 A;  3IH2 A;  3KZY A;  1U5T A;  2DYR H;  3P9K A;  2OQG A;  3K10 A;  2Y0S N;  3JTH A;  3ONQ A;  2M4G A;  3H35 A;  5CJ9 A;  2XPV A;  4C3H J;  4W1U A;  1YYV A;  5BPD A;  2DN0 A;  3F8N A;  5C44 J;  2VE9 A;  1D5Y A;  3RDI A;  4LB6 B;  2ADU A;  4WXC A;  2OAZ A;  3BR6 A;  3GWZ A;  3HKZ A;  1WCM J;  2W85 A;  5K7Z A;  1MMG A;  1LUJ B;  1L0O C;  3H36 A;  2K3F A;  3CMA I;  4PSX A;  1IG7 A;  1R4M B;  1MBF A;  2LK2 A;  1S72 I;  4HNT A;  1RRJ A;  2Y75 A;  1EJ9 A;  2AO9 A;  3F0C A;  2Z9O A;  3BCB A;  1LJ9 A;  5JVT A;  3GW2 A;  3H3U A;  3AKZ A;  2J5O A;  4PK4 A;  1R58 A;  3BRO A;  1IV8 A;  1FWZ A;  1X1B A;  3L9F A;  2H6C A;  2JTV A;  4M6Y A;  3SDG A;  2DT7 B;  1IXR C;  2E60 A;  4G6T B;  2K9M A;  3MZH A;  5HLG A;  1GLN A;  1ULY A;  3ZR8 X;  1U9O A;  3HUG B;  1Z67 A;  2Q0O A;  4NC7 A;  2VOD A;  5GAD J;  3CDI A;  3QOD A;  4I99 C;  1K61 A;  1DU0 A;  3L09 A;  3AL0 C;  4GO1 A;  3IH4 A;  1USS A;  3VYU B;  1J2X A;  4L18 B;  4QIW N;  2KL4 A;  2VJJ A;  5IP7 J;  5LRS A;  2M2E A;  1QVT A;  2CS3 A;  2V4J C;  4IHS A;  3SHF A;  4UNO A;  5LHI A;  1P92 A;  4XOR A;  1ETK A;  3W6V A;  3RQ4 A;  2BHZ A;  4EJT A;  3FXL A;  3OY9 A;  3AG1 H;  1LQ1 A;  2R7T A;  1TWA J;  1XB4 A;  1XX5 A;  2ZME A;  3C2B A;  3PFI A;  5F0C A;  4BAY A;  3VDX A;  3T1B A;  2HTS A;  2DTR A;  4HA8 A;  2FSW A;  1TT5 B;  3EET A;  4OAZ A;  3H3V K;  2FU4 A;  3FK6 A;  4RGU A;  3OYI A;  2DOF A;  4BXU A;  4II2 A;  1JE8 A;  1E17 A;  4NHJ A;  3HOW J;  5KNL A;  2L7Z A;  4O5V A;  3C3W A;  4LLN A;  3I0T A;  1BW6 A;  4OWR B;  4FET A;  1UHM A;  3ZQ7 A;  4ASN A;  4U88 A;  5M5X J;  5LBQ A;  1S6L A;  3OYK A;  3DBR B;  3BR2 A;  4HX8 A;  1VQM I;  1TBX A;  3HSE A;  5K5R A;  3OOP A;  5CVI A;  4E70 A;  1WHU A;  2L4M A;  4RGX A;  4HG2 A;  1ON2 A;  4XK4 A;  5B1B H;  2VPR A;  4OMZ A;  2KMU A;  4RMN A;  2NOJ B;  1BW5 A;  2G0E A;  1IF1 A;  2QSH X;  1YTY A;  1ZGJ A;  4X1E A;  3V8L A;  1FZP B;  3O8G A;  2K9L A;  2IXS A;  2MLG A;  5L3G A;  1MNE A;  5LGU A;  4BEH B;  1OCZ H;  4Z6Y A;  3D5S C;  2Y0M A;  2IGN A;  1LDK B;  2X1D A;  3F6O A;  2DU9 A;  3I53 A;  2LDU A;  1ETY A;  4QLC U;  1T0F C;  3V8K A;  2VLA A;  2LBF B;  5LEJ A;  3OMY A;  3KLN A;  3O3K A;  4A3K J;  3L00 A;  4KDP A;  1LDJ A;  2D1H A;  2FOK A;  2ZO4 A;  1DP7 P;  1WFX A;  1I3Q J;  1XGM A;  4PJN A;  2I5U A;  1FMV A;  3ZQH A;  2WV0 A;  2HYJ A;  4NC8 A;  3CF2 A;  4UVA A;  2X6Y A;  2HVR A;  1WJ5 A;  1BIB A;  3RYR A;  2FX0 A;  2P5K A;  4HF0 A;  1K6O A;  1XTA A;  3FXR A;  3F8F A;  2JA2 A;  2FF4 A;  2P6S A;  2HPI A;  2K7L A;  3FXQ A;  2ZFW A;  4B3A A;  3WGG A;  3DEU A;  1MDM B;  1FY7 A;  5HDK A;  3KPH A;  1GUU A;  4WXH A;  5CYV A;  4BY1 J;  3KZI C;  4E7J A;  3HKZ N;  5DD8 A;  4I76 A;  3EDP A;  1Y0U A;  1S9H A;  3OYN A;  1YQA A;  4LMY A;  3S14 J;  1RNL A;  2LY9 A;  3BLY A;  3TP3 A;  4XID A;  1OPC A;  5CKT A;  2R7R A;  1W7P B;  1ZEL A;  4YFN F;  1GXQ A;  5BS6 A;  1SC7 A;  4M9X A;  2E2H J;  1ZRC A;  2K5C A;  2D5V A;  3GZN B;  3WG7 H;  4Y4R A;  5DM7 F;  2VUM J;  2YSR A;  1Y0N A;  4F3Q A;  4B43 A;  3GTL J;  3HGY A;  3VSL A;  2A69 F;  2BGC A;  1QRY A;  1E3P A;  2FNA A;  2FOW A;  3F3X A;  4M3D A;  4DIQ A;  1N25 A;  1YX5 A;  2JA6 J;  2OCC H;  5DS9 A;  4HNU A;  1ZR2 A;  2VC1 A;  3JRG A;  1ZRE A;  1ZG3 A;  1YW7 A;  3M7G A;  4J01 A;  5HDG A;  5H6Q A;  3QU3 A;  2EA4 A;  3VOE A;  3BR5 A;  4PGG A;  1IXS B;  4IRH A;  1K78 B;  2W48 A;  3ESW B;  3IP4 B;  2VKH A;  5KHD A;  1D3Y A;  3KP5 A;  3JSP A;  1O3T A;  2DK8 A;  2QBY B;  1NG6 A;  2R7X A;  3BZC A;  3B6A A;  3IUO A;  4AVZ A;  4HDV A;  4PJL A;  2EWN A;  1R22 A;  2HZT A;  3GFM A;  4UHT A;  2EFW A;  3ISP A;  3K2A A;  2KRC A;  2FA5 A;  4M6V A;  3FIS A;  3FXO A;  3J7Z I;  1JUM A;  1BOA A;  5D4R A;  3GTP J;  4CCO A;  2GIZ A;  5DCM A;  2MA3 A;  2DOD A;  3CCY A;  1CF7 B;  1EH6 A;  1T39 A;  2COM A;  3GTG J;  1BIA A;  3ABT A;  3HXL A;  3ZGK A;  3R61 A;  5DUI A;  3IV5 A;  3MAJ A;  3MZ8 A;  2ZME B;  2JZY A;  1U0J A;  2O9L A;  3RTR A;  2N8G A;  2CQN A;  1PJR A;  3RKY A;  1T95 A;  3HEF A;  1IN4 A;  3J80 K;  1P2F A;  2L7F P;  2TRT A;  3JRF A;  1HBX G;  4KIS A;  2RC4 A;  4CCJ A;  1O57 A;  1U6G A;  1A6Q A;  1XDS A;  4XKB A;  3CMM A;  3VEP A;  5ILV A;  1TQP A;  3DCF A;  3E97 A;  3WGI A;  1Y8Q B;  4C3I J;  2TDX A;  4HPQ A;  4NUB A;  2OJE D;  4UUV A;  2QQ8 A;  5IP9 J;  1WZ2 A;  2EZK A;  2Y9Z A;  2H6B A;  4L5E A;  1YI2 I;  3NWS A;  3SDB A;  3C2G A;  4FIS A;  1HA8 A;  1LPQ A;  2V9V A;  3WTZ A;  1MD0 A;  2PBI A;  3O2P E;  1LB2 A;  2MFZ A;  3WTV C;  2LD5 A;  1GV5 A;  4XMY A;  1HOM A;  2L7M P;  3JCU C;  2PQ8 A;  3E0J B;  2D1V A;  3ABL H;  4PFP A;  1SAU A;  3E5Q A;  4GXO A;  2LTP A;  2R7W A;  3CC4 I;  4LGW A;  4U87 A;  1JTX A;  2DCE A;  2D45 A;  1JKR C;  2IT0 A;  2ZJQ F;  2EV6 A;  1WPK A;  4Q48 A;  4KUM A;  2BOL A;  4MHG A;  3S17 J;  2R5Y A;  4MTE A;  3M9A A;  2ISZ A;  3ZMZ A;  5EF6 A;  3W2A A;  2BE5 F;  4FTH A;  2RVC A;  1S3J A;  1YHQ I;  2E71 A;  3DWL E;  3F8M A;  4B09 A;  1Z7U A;  3S3M A;  3HM5 A;  2WAQ A;  2PN6 A;  3LAP A;  9ANT A;  2QKL B;  2K3P A;  4NB5 A;  3S8P A;  4II3 A;  5J8F A;  3L2R A;  3SFZ A;  5FLV A;  1RET A;  3SZP A;  1LFB A;  1RIO H;  1K6Y A;  4S05 A;  5FLX Z;  3V42 A;  5GP9 A;  2HOA A;  2KFD A;  1R5H A;  4I0A A;  5F0H A;  4F93 B;  3OYL A;  3HZJ A;  1XC5 A;  3CDH A;  1YIO A;  5M3F J;  4XLA A;  4I6Z A;  1ZLK A;  2BVM A;  2ECC A;  1P7J A;  1QHG A;  2V1X A;  1TQI A;  5IYD J;  3T8T A;  3DTE A;  2F4I A;  1CQT A;  3F72 A;  2O5R A;  5D6E A;  2IA0 A;  2VE8 A;  1SD4 A;  4CZZ A;  4YIR X;  1OLT A;  4OIR F;  1NK3 P;  4IHT A;  3G6E I;  3S15 J;  4BHB A;  1TWC J;  1Z91 A;  3C2H A;  3ZQI A;  4JX6 A;  1TNT A;  2ZNZ A;  2STW A;  4KIC A;  1LNW A;  4FE7 A;  3GF2 A;  3PM1 A;  4U7B A;  1JI8 A;  1NG7 A;  2F4M B;  3A01 A;  1Z0X A;  5AIQ A;  4DBQ A;  1HW2 A;  1WJF A;  5GTI C;  2OBP A;  1BC8 C;  3HOT A;  1HLV A;  3A2K A;  1WRJ A;  2WB1 N;  2PMH A;  2JRT A;  1XDU A;  2RQP A;  3MCZ A;  1SMT A;  1NTC A;  1PDN C;  1TP4 A;  4LG0 A;  2HS5 A;  4B1R A;  3F21 A;  1I27 A;  2KP6 A;  3BT9 A;  4HYE A;  1D8K A;  2LG4 A;  2M5W A;  4F55 A;  2FQ3 A;  3IH3 A;  4N4N B;  5F64 A;  5DCM B;  4IHV A;  4IJA A;  2V7F A;  1I6X A;  3RZD J;  1RZ4 A;  4P96 A;  2A6T A;  2CJJ A;  4ON0 A;  3RPU D;  1R9T J;  1QO0 D;  2FML A;  2GBY A;  5FFZ A;  3GXO A;  2MD0 A;  2IGO A;  3K4C A;  2XKP A;  4NC6 A;  1QNT A;  2IS2 A;  3OS1 A;  3E6C C;  1IN8 A;  3RKW A;  4XLP F;  1MJA A;  1D1C A;  2IVM A;  2ME6 A;  3I9V 2;  1F1Z A;  1GV2 A;  4N9H A;  1SFO J;  3QPH A;  3DTK A;  1G3Y A;  4ZYG A;  2DW4 A;  3JRI A;  4E4H A;  5IP6 A;  1WJA A;  4DYR A;  1IZ1 A;  2AS5 F;  2CGP A;  2DBB A;  4XLF A;  2VQH A;  3E6M A;  4D7N A;  2O8K A;  1B59 A;  3R4K A;  1YS6 A;  1R23 A;  4HLY A;  1R7J A;  3WE3 A;  3BTJ A;  2FD5 A;  1MMS A;  2Z99 A;  5CVU A;  2JVH A;  2XAG A;  4N0B A;  3WHC A;  1S7O A;  2JN6 A;  1QA6 A;  1BM9 A;  2OCE A;  4RAZ A;  2LSO A;  1X1D A;  3LNQ A;  1TNS A;  2VI6 A;  3PQK A;  1HST A;  2IBD A;  1YJN I;  2H27 A;  1D0Y A;  3UKG A;  3HOU J;  4E7L A;  2VKE A;  3HRM A;  3PIO F;  1ZK8 A;  3IAM 2;  3Q3S A;  3MKW B;  4D9J A;  3O8H A;  3MFK A;  5BOX A;  2QWW A;  1PVE A;  1JKO C;  3BY6 A;  4IPA A;  2MBF A;  3P9C A;  3OYA A;  1TW3 A;  3JSO A;  4QWQ A;  4MTD A;  2WAQ N;  5JR3 A;  2VIX A;  5K5Q A;  1A35 A;  3JAM K;  3OYG A;  4AUX A;  2OU2 A;  2XPU A;  3MQ0 A;  2GA1 A;  1POG A;  3OSG A;  3BTC A;  3K7A J;  1TW2 A;  2Z5U A;  5HLI A;  3H5R A;  1ZKG A;  1YJ9 I;  1I5Z A;  3IWZ A;  4XQF A;  3CUQ A;  2KQR A;  3U2R A;  3M1E A;  3NAR A;  2GXG A;  1Z05 A;  3OL3 A;  2E19 A;  2E5N A;  2DMU A;  1GVJ A;  5M3M J;  1QZY A;  2XF6 A;  1YLF A;  3CES A;  2CWE A;  4KFC A;  3ERM A;  3OYE A;  4IKF A;  4F52 A;  3M8J A;  5FRO A;  4BDZ A;  2RKH A;  3GTQ J;  5DM6 F;  4ESF A;  1BR1 A;  1MBK A;  3GCM A;  1K7A A;  2EIL H;  1YE9 A;  2WV1 A;  3W2W A;  2VN2 A;  3HRS A;  3OIO A;  3L7W A;  2ELH A;  3MKY B;  3RKQ A;  2BXZ A;  1HKS A;  3HGG A;  3DU5 A;  3KEY A;  2YUS A;  3TKY A;  1TQM A;  1APL C;  1BC7 C;  2VT2 A;  1ETX A;  1WH7 A;  1QBJ A;  2W84 A;  1SVO A;  4G6D A;  1IDY A;  5F1R A;  1E0E A;  5GAG J;  1S29 A;  3CO6 C;  4A5N A;  4FE4 A;  4FX4 A;  5HLH A;  5J4V A;  3E5X A;  3WGH A;  2IP2 A;  2DDA A;  2XB0 X;  3HRT A;  5IOZ A;  1KQ9 A;  2F5V A;  1XN7 A;  3K70 D;  2AQF A;  3QOP A;  2HOE A;  5KAF C;  1KON A;  3J7Y J;  2LOO A;  4L9V A;  2A68 F;  3A01 B;  4XKC A;  3BCA A;  2CW0 F;  4G7H F;  4KNY A;  2Z1D A;  2OUM A;  1N77 A;  2EFP A;  1OQY A;  1UHS A;  2QSF X;  4PJM A;  4CYD A;  2EIM H;  1XGO A;  4A0Z A;  1Z3X A;  2DTZ A;  3GTK J;  1W5C C;  3HSF A;  4M3B A;  2X1C A;  1QPM A;  1ACI A;  1RKT A;  2BY3 A;  2G9W A;  1I50 J;  2VOP A;  1FX7 A;  3JRH A;  4WF2 A;  5LHG A;  3LQR A;  1D1B A;  2JPB A;  2EK5 A;  3WTY C;  2JSP A;  4RB0 A;  2ZNY A;  4DBR A;  4OMY A;  3TP0 A;  2OTL I;  3CJR B;  1VQ7 I;  2TCT A;  2DOE A;  4A2U A;  1OFC X;  2H8R A;  4GYG A;  3B73 A;  2R5Z A;  1IUF A;  4C9Y A;  2KIM A;  2K85 A;  4UXN A;  3GTM J;  2LFB A;  1EKE A;  3GUD A;  2VAS A;  2IW5 A;  3WTX C;  1KGS A;  2ETH A;  2XSJ C;  2DA4 A;  3J7A Y;  1T0F A;  3IWF A;  2ZB9 A;  3A0B C;  1PP8 F;  2LVS A;  4O6J A;  4I01 A;  3QP5 A;  5DDG A;  4FT8 A; 
#chains in the Genus database with same CATH homology
 2EB7 A;  3L2C A;  1ZG1 A;  2CSO A;  4ZH4 F;  1P4A A;  1HQC A;  4R1H A;  3ZPL A;  3V7S A;  1SD5 A;  5L3B A;  5D5V B;  5D6F A;  1WKM A;  2EFO A;  5ERI A;  4UVC A;  5HDN A;  1G3W A;  3GFI A;  2KJC A;  1YS7 A;  5E1X A;  3BDD A;  1XGN A;  3BJA A;  4XRF A;  5JHU A;  4HDU A;  3VB2 A;  2XAF A;  4EM0 B;  2DFI A;  1BI3 A;  3CUQ B;  4LJZ F;  4R8H A;  4G6Q A;  3F23 A;  4M72 A;  4JQF A;  1LEB A;  2UZK A;  3V7R A;  4LFU A;  1C0W A;  1W5T A;  4M6X A;  4A6D A;  1U78 A;  3VOD A;  2L4A A;  3BZ6 A;  1BN5 A;  4OIN F;  2OA4 A;  3Q5F A;  4GYI A;  2P6T A;  4KIF A;  5LEK A;  5KK1 A;  2MH2 A;  3J80 Z;  4CGZ A;  2H94 A;  4Z2Y A;  2GIV A;  5HS8 A;  1XGS A;  2BV6 A;  3CTA A;  3R0J A;  3F22 A;  2RGV A;  3ECH A;  1H9G A;  4IVN A;  2IRF G;  2L02 A;  4UV9 A;  4EJV A;  3I59 B;  1IN6 A;  3J7A O;  5L3D A;  3IC7 A;  1XD7 A;  3NRV A;  2GZW A;  5H6R A;  2O6G E;  3SXY A;  2HDC A;  1Z6T A;  1MKM A;  2XAJ A;  2EA2 A;  3TDU C;  3E6D A;  2VT3 A;  1OYY A;  4Y15 A;  1D8J A;  2OZ6 A;  3IL2 A;  3DFG A;  3BPV A;  4YFK F;  2V1D A;  4EQQ A;  1J0R A;  1Z6R A;  3V8J A;  2BEO A;  4KIB A;  2MD5 A;  5D8L B;  4U7D A;  5E1Z B;  1RUO A;  5D8K B;  2DK5 A;  5LGN A;  4IF4 A;  4JK1 X;  2Q8K A;  1SMY F;  4Y17 A;  2ZXJ A;  5CVR A;  2HR3 A;  2VBZ A;  4YG2 F;  4PDK A;  1U5T B;  3FMQ A;  4GGG A;  5ILU A;  1MGT A;  4MGR A;  4M74 A;  4Q47 A;  3ZMU A;  5HVQ C;  3JTG A;  1J7K A;  3E6B A;  3W6K B;  2NAZ A;  1I1G A;  5L3E A;  4EJW A;  1SD6 A;  2FEZ A;  1ODD A;  1UB9 A;  2FBK A;  1ZHF A;  2Y48 A;  2WC2 A;  3SQN A;  4RAY A;  4RS8 A;  1YO5 C;  3TOA A;  1R5G A;  3REO A;  2P4W A;  4LK0 F;  1V3F A;  3GFL A;  2A07 F;  5DUK A;  3G3Z A;  2STT A;  1J5Y A;  4KA4 A;  3ZN0 A;  1FYM A;  3WTU C;  4F7Z A;  4XLN F;  5D5W B;  4U0V A;  5CVJ A;  2RNJ A;  3LAJ A;  3ZMD A;  4FHT A;  2GAU A;  3RJP A;  2F5D A;  3KE2 A;  2XVC A;  4KYW A;  3Q9S A;  4DQ2 A;  1TLH B;  3JAM Z;  4YIF A;  5J8C A;  2NRA C;  4HF1 A;  1GHC A;  1MJB A;  2E7W A;  1B9M A;  3K2Z A;  1OYW A;  1LVA A;  3K1M A;  3Q9V A;  4HOB A;  3BPX A;  1XSD A;  1IW7 F;  5FFX A;  1Z1D A;  2XGX A;  1B1B A;  1XMK A;  4Q4Z F;  1D5V A;  2KIF A;  2MH9 A;  3O6B B;  5DEQ A;  1GXP A;  2VXZ A;  4XSZ F;  3SZT A;  3LST A;  1V4R A;  4RB3 C;  1DUX C;  5HS9 A;  1B6A A;  4EJU A;  2NNY A;  4AD9 A;  2M8E A;  2QEN A;  1FP2 A;  4EMS A;  3ERE D;  2RDP A;  3I58 A;  4OIP F;  4G7Z F;  4ZYD A;  3MEX A;  1U3E M;  3GVA A;  3U1D A;  1ON1 A;  3W6J B;  4A6E A;  5BPI A;  1XSV A;  3HHH A;  1UCR A;  1WQ2 A;  1T2K A;  2IPQ X;  2O8X A;  1FYL A;  2DT5 A;  4CIC A;  5ILS A;  4ZYE A;  3I71 A;  2Z33 A;  1FT9 A;  2YX7 A;  2ZJ2 A;  3FWE A;  5LGT A;  1UST A;  4HLX A;  1AWC A;  4LD5 A;  2R7D A;  2CQK A;  2K02 A;  3CUO A;  2K27 A;  1JHH A;  2Q2E A;  5AIP A;  1ZG5 A;  1HSJ A;  3DF8 A;  3MWM A;  4ENN A;  5L3F A;  4EV0 A;  2QQB A;  3V4G A;  1RI7 A;  4OOI A;  4ENK A;  4HX4 A;  4PGH A;  5LHH A;  3BP8 A;  5TRD A;  2PFB A;  3QAH A;  2PG4 A;  2GXB A;  2BYV E;  4HV6 A;  5E8G A;  5DV5 A;  2QLZ A;  3R60 A;  3LWF A;  3FX3 A;  5CLS A;  5HS7 A;  2JT1 A;  1YG2 A;  1ZGA A;  4IRG A;  3D0S A;  2P8T A;  3K9T A;  4XSX F;  3R0A A;  3WOD F;  4HBL A;  1KU9 A;  2O03 A;  4EVI A;  3DPL C;  5FD6 A;  3WE2 A;  3RIR A;  3QPT A;  1ONV A;  2V79 A;  5IT9 K;  4FX0 A;  1ZH5 A;  4CO8 A;  4CXF A;  1S7A A;  4Q5S F;  4A0X A;  5FGM A;  4A0Y A;  2K4B A;  1UHW A;  2QQA A;  1KU3 A;  2P7C B;  1HKT A;  1QGP A;  4KMU X;  1ZAR A;  2OZU A;  2CYY A;  1SFX A;  1JHF A;  3QP6 A;  5JFR A;  1OMI A;  3HUG A;  3M8E A;  3ZMV A;  3TQN A;  2L54 A;  5JI6 A;  3ROU A;  5ICF A;  1BI1 A;  1J9I A;  2A6H F;  2O0Y A;  3GO5 A;  5D5X B;  4LG0 B;  3LFK A;  4I0B A;  1P6R A;  5A2Q K;  3I4P A;  2HFH A;  4N9I A;  1PUE E;  4H0E A;  3HSR A;  2YR2 A;  1DPR A;  3K69 A;  5AON A;  3ZMS A;  1XCV A;  1ZAO A;  5F6F A;  3HTU A;  2K86 A;  3CJN A;  4ESB A;  4LK1 F;  3IKV A;  2O3F A;  4DNC A;  1H0M A;  2X4H A;  2NNN A;  5E1W A;  5D5U B;  3PQJ A;  4GCV A;  2DO7 A;  2L3D A;  2R7F A;  1FPQ A;  1T6S A;  3RYP A;  1YFH A;  4HF2 A;  5LRR A;  4RGS A;  1ZRD A;  4O3M A;  2LF8 A;  3GFJ A;  1F5T A;  1FNN A;  3GYH X;  3JW4 A;  3ZP5 A;  2OD5 A;  2JSC A;  3K1N A;  3NEU A;  2NS0 A;  1MDM A;  4KMF A;  1SD7 A;  2YPR A;  2A6E F;  1TTY A;  1WI9 A;  3ZMT A;  4U0W A;  3RI4 A;  3E5U A;  2GWR A;  2EJR A;  3GX4 X;  4YII A;  4R79 A;  1W7P A;  1WSU A;  4L0Z B;  2HEO A;  6PAX A;  4M9S A;  2B0L A;  2EV0 A;  1MZB A;  2W24 A;  2LNB A;  4ENJ A;  5K1Y A;  1H9T A;  5FD5 A;  4EJO A;  3CUQ C;  1IRF A;  3K0L A;  1S8N A;  4AWX B;  5DD4 A;  1FSE A;  5ICC A;  4MEY F;  1KU7 A;  1L3L A;  4HQE A;  1U2W A;  3V7C A;  1K78 A;  4IXA A;  3LA3 A;  4S04 A;  2QBY A;  2F5E A;  1IN7 A;  2J5P A;  2KJB A;  2CG4 A;  3TGN A;  2RV8 A;  2E7X A;  2QZ8 A;  3WTW C;  1CF7 A;  2A61 A;  3EYI A;  1ZRF A;  1MJ9 A;  2V6C A;  3DKW A;  4U0Y A;  2DPU A;  3WTT C;  1O3Q A;  1IAW A;  3T0Y A;  1HW5 A;  3QRF F;  3C7J A;  2A3S A;  1AOY A;  5ED4 A;  5E8I A;  2HKX A;  4M71 A;  3N4M A;  5H20 A;  1YW8 A;  5EEG A;  4KIG A;  2PJP A;  3WU0 A;  4IRI A;  3EQL F;  3DV8 A;  1O7F A;  3EUH A;  4ZZL A;  4RB1 A;  2HYG D;  1X3U A;  5E20 A;  2HKO A;  5TJJ A;  1U8R A;  2XRN A;  1O3R A;  2IA2 A;  4OIQ F;  1G6N A;  1IUY A;  1XCB A;  1K79 A;  5LLQ A;  3TO6 A;  2QVO A;  2PMU A;  4PCQ A;  4P9U A;  2ESN A;  2PLY A;  2P5V A;  3IHU A;  1J59 A;  4A12 A;  4AIK A;  5E17 F;  4KN7 X;  4TV7 A;  3WU1 B;  1B9N A;  1FC3 A;  1FBU A;  3H3Z A;  4I98 B;  2HGC A;  3DXJ F;  3FM3 A;  5DCF A;  2G7U A;  2FBI A;  2AXL A;  3TO9 A;  3F8B A;  3RPQ A;  1BBY A;  4MEX F;  1U5T C;  3H92 A;  2F5C A;  1EH8 A;  3KP2 A;  2XRO A;  1SAX A;  2LF7 A;  1HW1 A;  1G3S A;  1BI2 A;  2HQR A;  4BYY A;  5J6X A;  2GQQ A;  1J75 A;  4JBA A;  2ESH A;  1FP1 D;  4LB5 A;  4M73 A;  3T8R A;  3C1D A;  2W57 A;  1P4X A;  2P5L C;  1O7L A;  1Z9C A;  3CO7 C;  3LA2 A;  3ML6 A;  1UFM A;  3KCC A;  2CFX A;  4PZJ A;  1G4D A;  3KP3 A;  2ACJ A;  2YX4 A;  4M9Z A;  1FBQ A;  3KLO A;  1I1S A;  3ZN1 A;  4WWC A;  3QU6 A;  2L01 A;  2XIG A;  2NYX A;  2WTE A;  3N97 A;  1EH7 A;  1R1T A;  2QYO A;  2UWM A;  3S2W A;  2IA1 A;  3C18 A;  1IRG A;  2EFN A;  4LLG F;  2E1N A;  3D5L A;  1F9N A;  3P9I A;  1PP7 U;  3T5X A;  3FMS A;  1QZZ A;  1KU2 A;  3TO7 A;  1R1U A;  2ZKZ A;  2H09 A;  2F2E A;  3HYI A;  2DQL A;  4EM2 A;  2YU3 A;  2DI3 A;  3I54 A;  4AIJ A;  4G94 A;  3F6V A;  2LKP A;  4WCG A;  4P9F A;  2HWV A;  2KKO A;  2CO5 A;  4HQM A;  4UVB A;  4D0P A;  4G9Y A;  3LQQ A;  5BQT A;  5IT9 Z;  5CVV A;  5DYM A;  3VFZ A;  3HHG A;  3E3V A;  3GEZ A;  4AVP A;  3KEO A;  4HW0 A;  1OR7 A;  2BBY A;  2EV5 A;  4ENM A;  5ICE A;  1W4M A;  3BJ6 A;  3DQV C;  1HXD A;  3KFW X;  4BHP A;  1BI0 A;  2VBX A;  4WXD A;  2D2W A;  2KRF A;  4I2O A;  3HOS A;  4HV5 A;  2HTJ A;  3AAF A;  3KET A;  4HAM A;  4MNU A;  2ZCW A;  3BWG A;  1KYW A;  3HTS B;  5A2Q Z;  2QUF A;  3J81 Z;  2KIU A;  2X0L A;  2Z3Y A;  1WWX A;  1KQ0 A;  2FXA A;  3HIF A;  4I7H A;  1B4A A;  1KYZ A;  4BHC A;  3FHZ A;  3GZ6 A;  4LLL A;  4AIH A;  3WG9 A;  1IN5 A;  1DDN A;  2GA2 A;  2E1C A;  2QQ9 A;  5HOO A;  2JPC A;  3I64 A;  4XBF A;  1FSH A;  2DPD A;  1HKQ A;  4I02 A;  1NHA A;  4ZZD A;  1ZLJ A;  2R3S A;  3KP4 A;  4CDG A;  1ZYR F;  1VTN C;  3M8F A;  3FM5 A;  3B02 A;  1XSX A;  1SFU A;  3KP7 A;  4BH9 A;  1LEA A;  5ICG A;  3TOB A;  3DP7 A;  4A5M A;  3ECO A;  3KEQ A;  3ELK A;  3G73 A;  2O61 A;  4ETS A;  2DAO A;  4RGR A;  2UXN A;  2MC3 A;  3LA7 A;  5FO5 A;  3KZZ A;  1KA8 A;  1YW9 A;  2XAH A;  4L9T A;  5E18 F;  1KQ8 A;  4WK8 F;  2VBW A;  2FBH A;  2VC0 A;  4UV8 A;  3R6S A;  1FOK A;  4NQW A;  3MZY A;  4L0Y B;  1T38 A;  4L5I A;  2IJL A;  1R1V A;  1OYI A;  2P7V B;  2FMY A;  2FE3 A;  2W25 A;  4ESJ A;  5D4S A;  2HQN A;  3FZV A;  3ABU A;  4I09 A;  3GZ5 A;  2DQR A;  3BJO A;  2XAS A;  1FLI A;  1STZ A;  1REP C;  2DLL A;  4B8X A;  1G3T A;  2F5F A;  3I5U A;  3TDZ C;  5BMZ A;  3ULQ B;  2XHK A;  3EYY A;  3RKX A;  3CLO A;  3F8C A;  3HRU A;  2UXX A;  2FRH A;  2VON A;  3NQO A;  3OV8 A;  1OKR A;  1W5S A;  2V1U A;  1XMA A;  3IKT A;  1F4K A;  2MLK A;  4P55 A;  2HYF A;  2XAQ A;  4G7O F;  1FYK A;  2M45 A;  1SFE A;  1LDD A;  3KP6 A;  1CGP A;  5K5O A;  3FMR A;  4BQA A;  4MQ9 F;  1W7P D;  4KT5 C;  3IRR A;  2VOO A;  3RPU A;  2C6Y A;  5FLX K;  4YFX F;  4L9N A;  4RB2 C;  1EV7 A;  2VBY A;  2ZBK A;  5KVR A;  1BJA A;  4ZYH A;  3BOQ A;  2PI0 A;  2WWY A;  3FF5 A;  1JGS A;  1R36 A;  1A04 A;  3GLX A;  3J81 K;  2QM3 A;  2XUB A;  1R00 A;  2K4J A;  4L5J A;  3IRQ A;  3U9G A;  4CHU A;  4HX7 A;  4MQV A;  2XV4 S;  3I59 A;  4KN4 X;  2M30 A;  1P4W A;  5FB2 A;  4EGZ A;  4EGY A;  1ZN2 A;  2G7H A;  1DPU A;  1QQI A;  1RUN A;  2PEX A;  1IXC A;  3FXU A;  5EEH A;  4EM1 A;  4P5O A;  3K1P A;  1Q1H A;  3WTS C;  3P7N A;  4BNC A;  4OIO F;  2XKO A;  4OU0 A;  2EFQ A;  4WX9 A;  1O3S A;  4HZF A;  1E2X A;  5IT3 A;  1T98 A;  4G8X A;  2A5Y B;  2OQR A;  2RN7 A;  3DPT A;  2M1B A;  2M87 A;  2FNP A;  5L3C A;  3COA C;  1FBS A;  4K2E A;  4Y13 A;  2ISY A;  1JXS A;  4L9J A;  3KZY A;  1U5T A;  3P9K A;  2OQG A;  3JTH A;  5CJ9 A;  1YYV A;  5BPD A;  3F8N A;  2VE9 A;  3RDI A;  4LB6 B;  2ADU A;  4WXC A;  2OAZ A;  3GWZ A;  2W85 A;  1L0O C;  2Y75 A;  2Z9O A;  1LJ9 A;  5JVT A;  3GW2 A;  3H3U A;  2J5O A;  1R58 A;  3BRO A;  1FWZ A;  3L9F A;  2H6C A;  2JTV A;  4M6Y A;  1IXR C;  3MZH A;  5HLG A;  1ULY A;  2Q0O A;  2VOD A;  3L09 A;  4GO1 A;  1USS A;  1J2X A;  4L18 B;  5LRS A;  4IHS A;  3SHF A;  4UNO A;  5LHI A;  1P92 A;  4EJT A;  1LQ1 A;  1XB4 A;  2ZME A;  3PFI A;  4BAY A;  3T1B A;  2HTS A;  2DTR A;  4HA8 A;  2FSW A;  3EET A;  2FU4 A;  4RGU A;  4BXU A;  1JE8 A;  1E17 A;  4NHJ A;  4O5V A;  4LLN A;  3C3W A;  3I0T A;  1UHM A;  3ZQ7 A;  4ASN A;  4U88 A;  5LBQ A;  1S6L A;  4HX8 A;  1TBX A;  3HSE A;  5K5R A;  3OOP A;  5CVI A;  4E70 A;  2L4M A;  4RGX A;  1ON2 A;  4OMZ A;  1IF1 A;  1YTY A;  1ZGJ A;  3V8L A;  1FZP B;  2MLG A;  5L3G A;  5LGU A;  2Y0M A;  1LDK B;  3F6O A;  2DU9 A;  3I53 A;  2LDU A;  4QLC U;  3V8K A;  5LEJ A;  3KLN A;  3O3K A;  3L00 A;  4KDP A;  1LDJ A;  2D1H A;  2FOK A;  2ZO4 A;  1DP7 P;  1XGM A;  2WV0 A;  4UVA A;  1BIB A;  3RYR A;  2P5K A;  4HF0 A;  1K6O A;  3FXR A;  3F8F A;  2FF4 A;  2P6S A;  2K7L A;  3FXQ A;  2ZFW A;  3WGG A;  3DEU A;  1MDM B;  1FY7 A;  5HDK A;  4WXH A;  5CYV A;  5DD8 A;  3EDP A;  1Y0U A;  1YQA A;  4LMY A;  1RNL A;  1OPC A;  1W7P B;  4YFN F;  1GXQ A;  5BS6 A;  4M9X A;  1ZRC A;  2YSR A;  2A69 F;  2BGC A;  2FNA A;  3F3X A;  2VC1 A;  1ZRE A;  1ZG3 A;  1YW7 A;  3M7G A;  5HDG A;  5H6Q A;  3QU3 A;  2EA4 A;  3VOE A;  4PGG A;  1IXS B;  4IRH A;  1K78 B;  1D3Y A;  3KP5 A;  3JSP A;  1O3T A;  2DK8 A;  2QBY B;  4HDV A;  2EWN A;  1R22 A;  2HZT A;  3GFM A;  4UHT A;  2EFW A;  3ISP A;  2FA5 A;  1BOA A;  5D4R A;  5DCM A;  2MA3 A;  1CF7 B;  1EH6 A;  1T39 A;  2COM A;  1BIA A;  3ABT A;  3R61 A;  5DUI A;  3MAJ A;  2ZME B;  2JZY A;  3RTR A;  3RKY A;  1IN4 A;  3J80 K;  1P2F A;  1HBX G;  2RC4 A;  1O57 A;  1U6G A;  1XDS A;  3VEP A;  5ILV A;  1TQP A;  3E97 A;  3WGI A;  2TDX A;  4UUV A;  2H6B A;  2V9V A;  3WTZ A;  1MD0 A;  2PBI A;  3O2P E;  1LB2 A;  3WTV C;  2PQ8 A;  2D1V A;  3E5Q A;  4GXO A;  4LGW A;  2D45 A;  2IT0 A;  2EV6 A;  4Q48 A;  4KUM A;  4MHG A;  4MTE A;  3M9A A;  2ISZ A;  3ZMZ A;  2BE5 F;  2RVC A;  1S3J A;  3F8M A;  4B09 A;  1Z7U A;  2PN6 A;  3LAP A;  4NB5 A;  5J8F A;  3SFZ A;  3SZP A;  1RIO H;  4S05 A;  5FLX Z;  1R5H A;  4I0A A;  3CDH A;  1YIO A;  1ZLK A;  2V1X A;  1TQI A;  3T8T A;  3F72 A;  5D6E A;  2IA0 A;  2VE8 A;  1SD4 A;  4CZZ A;  4OIR F;  4IHT A;  4BHB A;  1Z91 A;  1TNT A;  2ZNZ A;  2STW A;  4KIC A;  1LNW A;  3GF2 A;  4U7B A;  5AIQ A;  1HW2 A;  1BC8 C;  2OBP A;  3HOT A;  1WRJ A;  2PMH A;  2JRT A;  1XDU A;  2RQP A;  3MCZ A;  1SMT A;  1PDN C;  4LG0 A;  2HS5 A;  3F21 A;  1I27 A;  4HYE A;  1D8K A;  2M5W A;  2FQ3 A;  5F64 A;  5DCM B;  4IJA A;  1I6X A;  1RZ4 A;  4P96 A;  4ON0 A;  1QO0 D;  2FML A;  5FFZ A;  3GXO A;  2XKP A;  1QNT A;  3E6C C;  1IN8 A;  3RKW A;  4XLP F;  1MJA A;  2IVM A;  1F1Z A;  4N9H A;  3QPH A;  1G3Y A;  4ZYG A;  2DW4 A;  1IZ1 A;  2AS5 F;  2CGP A;  2DBB A;  3E6M A;  1B59 A;  3R4K A;  1YS6 A;  1R23 A;  4HLY A;  1R7J A;  3WE3 A;  2Z99 A;  5CVU A;  2XAG A;  4N0B A;  1S7O A;  1BM9 A;  4RAZ A;  2LSO A;  1TNS A;  3PQK A;  1HST A;  2H27 A;  3HRM A;  5BOX A;  3MFK A;  2QWW A;  3BY6 A;  4IPA A;  2MBF A;  3P9C A;  1TW3 A;  3JSO A;  4QWQ A;  4MTD A;  5JR3 A;  5K5Q A;  3JAM K;  2OU2 A;  3MQ0 A;  2GA1 A;  1TW2 A;  2Z5U A;  5HLI A;  1I5Z A;  3IWZ A;  3CUQ A;  3U2R A;  3M1E A;  2GXG A;  1Z05 A;  1GVJ A;  1QZY A;  1YLF A;  2CWE A;  4KFC A;  2RKH A;  4ESF A;  1K7A A;  2VN2 A;  3HRS A;  3L7W A;  2ELH A;  1HKS A;  3TKY A;  1TQM A;  1BC7 C;  2VT2 A;  1QBJ A;  2W84 A;  4G6D A;  5F1R A;  1S29 A;  3CO6 C;  4A5N A;  4FX4 A;  5HLH A;  3E5X A;  3WGH A;  2IP2 A;  3HRT A;  1KQ9 A;  1XN7 A;  3QOP A;  2HOE A;  4L9V A;  2A68 F;  2CW0 F;  4G7H F;  4KNY A;  2EFP A;  4CYD A;  1XGO A;  4A0Z A;  3HSF A;  1QPM A;  2G9W A;  2VOP A;  1FX7 A;  4WF2 A;  5LHG A;  3LQR A;  3WTY C;  2JPB A;  2EK5 A;  4RB0 A;  2ZNY A;  4OMY A;  4A2U A;  4GYG A;  3B73 A;  2KIM A;  4UXN A;  3GUD A;  3WTX C;  2IW5 A;  1KGS A;  2ETH A;  1T0F A;  3IWF A;  1PP8 F;  4O6J A;  4I01 A;  3QP5 A;  5DDG A;  4FT8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...