4EJVA

Staphylococcus epidermidis tcar in complex with chloramphenicol
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
147
structure length
135
Chain Sequence
b'IEDHISFLEKFINDVNTLTAKLLKDLQTEYGISAEQSHVLNMLSIEALTVGQITEKQGVNKAAVSRRVKKLLNAELVKLIIKLSNKGKKYIKERKAIMSHIASDMTSDFDSKEIEKVRQVLEIIDYRIQSYTSKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator TcaR
publication title Structural analysis of the antibiotic recognition mechanism of MarR family proteins
rcsb
source organism Staphylococcus epidermidis
molecule tags Transcription regulator
total genus 48
structure length 135
sequence length 147
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4ejvA00
2ZNZA 2C6YA 1OR7A 1W7PA 3GXOA 1Y0UA 3LA7A 4A0YA 4M9ZA 1R00A 3G73A 1ZHFA 1FBQA 2M87A 1ODDA 4KDPA 4ENMA 4PGHA 2VBZA 1KQ9A 1LJ9A 4CZZA 4JQFA 1HSJA 3DQVC 4KA4A 5LHHA 1ZG1A 3EETA 1U2WA 4P5OA 4LLGF 1HKSA 4HW0A 2FU4A 3RKXA 3JSOA 2NRAC 1IN8A 2X4HA 2RDPA 2HOEA 1XGOA 1OYWA 2COMA 1ZRDA 3DPTA 3F23A 3BPVA 4AIHA 1WKMA 4NQWA 2KRFA 4EV0A 3M8EA 4L9TA 5KVRA 4IF4A 4UNOA 2FMLA 2QLZA 3RDIA 3EQLF 1R7JA 4L9NA 4MNUA 5BOXA 2FMYA 3U2RA 5FO5A 2VE8A 4OU0A 1TQIA 3V7CA 2A68F 3ZMTA 2ZXJA 1OPCA 3DEUA 3T5XA 4MQ9F 3F8MA 4OMYA 1G4DA 3RJPA 2ZMEA 3TQNA 1CF7A 1FP1D 3M8FA 3R4KA 4BHCA 2IVMA 4GXOA 3WGHA 2D1VA 1ZLKA 4LFUA 4I0AA 4U7BA 2CYYA 3FHZA 1B9NA 3K1MA 1U5TB 1IRFA 1AWCA 1WWXA 5F6FA 2EA4A 4P96A 3EUHA 3L00A 2TDXA 2GZWA 2LNBA 2K02A 2X0LA 4KIGA 3QP6A 1XCBA 2CQKA 3WU0A 4LK1F 2WWYA 3RPQA 2Z9OA 5LBQA 2V1UA 4LB5A 5E18F 2MA3A 1K78B 4IVNA 2L3DA 3OV8A 2BE5F 1MJAA 2QQAA 3V8LA 2RQPA 2Y48A 2EFWA 2PEXA 4O3MA 1QNTA 4HV5A 3E5UA 3F8FA 3V8KA 3FM5A 3E97A 2XHKA 2GWRA 4RGXA 3JSPA 4RGRA 3RPUA 1FYLA 3LA2A 5BPIA 1TQMA 2WV0A 2STTA 3M7GA 3ZMDA 4UVAA 4ZYGA 3ISPA 1T98A 3F8CA 3LFKA 3JW4A 1IXRC 4OOIA 3TO7A 1LB2A 3HRSA 3AAFA 2D1HA 2E7XA 2VT2A 2OU2A 2DPDA 1IZ1A 2OZUA 2FNPA 1L0OC 3R0AA 3M1EA 1ZGJA 5TRDA 1OYIA 3R61A 4BNCA 1B1BA 3ECOA 2JT1A 1J5YA 2KIFA 3KP6A 1HQCA 1BI1A 4IHTA 4NHJA 1O7FA 1F5TA 1G3WA 2K4JA 4GO1A 1P4AA 1EV7A 5LLQA 2HR3A 1ZN2A 3I4PA 4O5VA 2ELHA 5HLHA 1QO0D 1W5TA 1K6OA 2GA1A 5HDGA 4A0XA 1TTYA 5FD6A 1HW2A 3ZN1A 4KICA 3JTHA 3O6BB 4A6DA 3DF8A 1YG2A 4KNYA 2PMUA 4Y15A 2Z3YA 2O8XA 1UB9A 1O3QA 2LF8A 4G94A 1BC7C 1DUXC 4HAMA 4KN4X 3LSTA 1P4XA 1ZARA 1R1VA 2OA4A 4XLNF 5ILVA 2RNJA 4NB5A 4P55A 4OIPF 1ONVA 4UVCA 3V7RA 2V6CA 1DPUA 2EV6A 1FSHA 1VTNC 1FZPB 1HSTA 4UV9A 4MGRA 5H6QA 2MH9A 4HBLA 1UCRA 2W84A 5HS8A 1KGSA 3E6DA 2FEZA 4IRGA 2E1NA 3KLOA 3F22A 2K7LA 5CVRA 3VB2A 4XSXF 1LDKB 2YSRA 4G6QA 2RKHA 5DCFA 3ELKA 3QU3A 1H0MA 1BI2A 1O3TA 1HW5A 2HYFA 4A5MA 4HYEA 4I98B 4EQQA 4M71A 2VONA 1T0FA 3QRFF 4ETSA 1LEBA 3L09A 1ZH5A 1U5TA 3MEXA 2IRFG 2A07F 2XKPA 3ML6A 5D4SA 3I59A 4YIFA 1YFHA 2A6HF 1EH6A 2K4BA 2FF4A 3WTTC 5HDNA 4A6EA 2PMHA 3J81K 3GEZA 3WODF 3ZMSA 1O57A 4HLXA 4OMZA 5A2QK 5HVQC 1XCVA 2QVOA 4A0ZA 1WQ2A 4JK1X 2P6TA 2DFIA 1MJ9A 4XRFA 2VOPA 4H0EA 4ZZLA 1FP2A 2Q2EA 3VFZA 1ZAOA 3D0SA 4DQ2A 2NS0A 5D6EA 4GGGA 4MEXF 5CLSA 1S29A 1QBJA 2J5OA 2AXLA 5JHUA 1TQPA 3HHGA 4CICA 5DCMB 2A69F 4EJUA 1J2XA 3V7SA 1SD7A 3B02A 2G7UA 5BMZA 2E7WA 1XGSA 3SZTA 4RGSA 1K79A 4AD9A 2ZMEB 1MKMA 2PBIA 1BN5A 3HUGA 4EM1A 4O6JA 1FX7A 2F5CA 2M8EA 3FWEA 1Z9CA 2KKOA 4WWCA 1LEAA 3COAC 2FNAA 2VOOA 1DDNA 4BXUA 3F72A 4N9IA 2P7VB 4F7ZA 4G6DA 3MWMA 3MCZA 3E3VA 2JTVA 2JRTA 5K5RA 3HRMA 1U5TC 4A5NA 4I09A 4CO8A 4L0YB 1G3SA 2DBBA 2HQNA 3G3ZA 1FPQA 1IN5A 3CUQB 1TW3A 1HBXG 1KA8A 4KFCA 2BYVE 4LLLA 4HQMA 1ZYRF 1I1SA 1SFEA 4MHGA 5HOOA 1J59A 2XAGA 1K7AA 3BJAA 4YIIA 5FGMA 4L5IA 2GXBA 4Q48A 1ULYA 4EVIA 2Z33A 2FQ3A 1F4KA 1ZREA 3PQJA 1IUYA 4EJVA 2IP2A 3E5XA 2PN6A 1H9TA 3ABTA 5ICFA 2JPBA 1KQ8A 2EFNA 1J9IA 3C1DA 1KQ0A 1DP7P 1UHMA 4ESBA 3QOPA 2CWEA 1LVAA 2CFXA 4S05A 3I5UA 2MBFA 2PJPA 3F8NA 3ECHA 2JSCA 5CVJA 4LMYA 5L3DA 3RYRA 3J80K 2HYGD 2CGPA 1FYMA 3IL2A 1SMTA 1HKQA 5E1XA 4Q4ZF 2R3SA 5L3EA 5BS6A 2DO7A 2H27A 1B9MA 5FLXK 3HTSB 1U78A 1O3RA 1REPC 2VXZA 2D2WA 2V1XA 4Z2YA 1WSUA 2QYOA 3GWZA 4GYIA 4EGZA 1T6SA 2ZO4A 2MD5A 5D5XB 2H09A 5ICGA 1ON2A 3R6SA 1FBUA 1S3JA 3HYIA 3LWFA 5K5OA 1E2XA 1KU2A 1D8KA 2Z99A 4DNCA 1BIAA 4BAYA 2GXGA 2W85A 1J75A 3CUOA 2XASA 5J6XA 4P9FA 2PLYA 3F3XA 5D8LB 4ESFA 1IN6A 3QP5A 4IJAA 4B09A 3K2ZA 2DW4A 2HDCA 3IRQA 2WC2A 4L5JA 1HXDA 1HKTA 5KK1A 1RIOH 4HDUA 2QWWA 1XGMA 4IRHA 1TNSA 2Y0MA 5DCMA 5D4RA 3FZVA 1XMKA 1RZ4A 2RGVA 3WTXC 5E20A 4HV6A 1Z7UA 2DQRA 5JFRA 5E1WA 4OIQF 3QPHA 3WE3A 1IAWA 2UXXA 2LDUA 4WK8F 3EYIA 2Z5UA 5CYVA 3QU6A 4I7HA 3PFIA 2ZJ2A 3I64A 3K9TA 5FB2A 3I59B 1P2FA 2L02A 1LDDA 2L4AA 2BEOA 1S6LA 2W57A 2GA2A 3HSFA 2UXNA 4BQAA 4PCQA 3ROUA 1IW7F 3M9AA 4ZYEA 5K1YA 3KP5A 1I5ZA 3KZZA 5D5UB 3HOTA 2FBHA 1BIBA 2H6BA 4EJWA 2B0LA 1P4WA 3TDUC 1R5HA 1F1ZA 4CGZA 2RV8A 2ETHA 3CUQA 2Q8KA 2XAQA 4ASNA 1JHFA 1R1TA 2FOKA 4I0BA 3H3ZA 2A5YB 3ULQB 4M9XA 3FMRA 5F64A 5EEHA 3QAHA 4MEYF 2XAJA 2EA2A 1XSDA 1GHCA 2CSOA 4KMUX 1XDUA 2AS5F 2ZKZA 3TO6A 2O0YA 2J5PA 3MZHA 5LRRA 4RAYA 4LG0A 1TW2A 3B73A 3HHHA 1MD0A 4WF2A 3RTRA 4M73A 2O3FA 1QZYA 4L0ZB 4Y17A 3DPLC 4RB0A 5D6FA 4ZZDA 2LF7A 1ZLJA 3J81Z 2QBYA 4KIBA 1XD7A 1FNNA 5A2QZ 1KYZA 5D8KB 4Q47A 3RKYA 4LLNA 1FSEA 3K1PA 1Z6RA 2W24A 4ESJA 4UVBA 4EGYA 4HF2A 4ZH4F 4LK0F 2XVCA 2P4WA 1J7KA 1BI3A 1KU3A 2W25A 2HS5A 2GIVA 2VC0A 1SFXA 3REOA 3HSEA 4HX7A 2XAHA 4BYYA 1S7OA 1YS6A 3FX3A 3SQNA 2DK5A 4M9SA 2LKPA 2VBXA 2KIMA 2ACJA 2M45A 4HOBA 4I01A 4IHSA 1B59A 4M6XA 2KIUA 2WTEA 3NRVA 1SAXA 3ZPLA 3CUQC 3GUDA 4HX8A 1Z91A 5FFXA 2IPQX 2IA2A 1GXPA 3HIFA 2OAZA 2R7FA 2GQQA 4UHTA 3IKVA 1YW8A 4QWQA 4EM0B 1O7LA 3F21A 5BPDA 2ISZA 3QPTA 3D5LA 3SFZA 1FLIA 4PGGA 2NAZA 3RYPA 1YO5C 3EDPA 2IJLA 2EWNA 2OBPA 3GFIA 4LB6B 4M74A 2XGXA 1C0WA 1LNWA 1D3YA 4K2EA 3P9KA 4RB2C 2IA0A 4N9HA 2G7HA 5E17F 1I6XA 3JTGA 3GLXA 3BP8A 2QENA 2EFOA 2BGCA 2PI0A 2FA5A 2ADUA 1PUEE 4G7HF 4PZJA 1J0RA 4UV8A 4EJOA 3IC7A 4D0PA 2Q0OA 1FWZA 3WTSC 4QLCU 3EYYA 1MJBA 2V79A 3K1NA 1RUNA 5ICCA 1WI9A 3MAJA 5L3BA 3BDDA 4KYWA 2CW0F 4B8XA 1T39A 3C7JA 2QQ9A 2K27A 1HW1A 1FOKA 3J80Z 1BC8C 2FXAA 3K69A 2KJBA 4YFKF 4YG2F 4M6YA 1KU7A 3FXUA 3FMSA 3P7NA 4U88A 3NEUA 2FSWA 2MC3A 3W6JB 3ZN0A 2DTRA 5CVVA 4G8XA 5FLXZ 4G9YA 5DDGA 3TO9A 4E70A 4EJTA 1Z1DA 2IA1A 4KMFA 2IW5A 4EMSA 2K86A 2M30A 5ICEA 5DD8A 1PDNC 2EFPA 3HRTA 4OINF 4U7DA 5IT9K 1I27A 3FXRA 4Y13A 4MQVA 3CO6C 2YR2A 4CXFA 5HLGA 1MGTA 4ENJA 1BOAA 2FRHA 2BBYA 1IRGA 1EH8A 1T38A 3SXYA 4FX4A 1USTA 5TJJA 5H6RA 2BV6A 2EK5A 2V9VA 3JAMK 1Q1HA 4WXCA 1MZBA 1V4RA 3Q5FA 1GXQA 2VODA 2IT0A 2M5WA 5L3CA 1G3TA 2QQBA 2HTSA 4R1HA 3GFMA 3N4MA 3WTVC 4UXNA 4R8HA 5HLIA 3WTYC 1YTYA 2P8TA 3L2CA 3FXQA 3I54A 2L01A 4BHBA 1V3FA 1XGNA 2XIGA 1JHHA 2ZCWA 4WXDA 2DPUA 5J8CA 4HQEA 3FMQA 4LG0B 2EJRA 4R79A 3FM3A 3F8BA 1QQIA 4ZYHA 2XRNA 1OYYA 5DEQA 1CGPA 3BY6A 2FBIA 3T0YA 2HKXA 3VODA 4L9JA 3TOBA 3V4GA 2QBYB 5LEJA 1STZA 1D8JA 3FF5A 5DV5A 1BJAA 2GAUA 3HRUA 4P9UA 2CG4A 4M72A 1AOYA 3BZ6A 5FD5A 5LGUA 6PAXA 1PP8F 1KYWA 4YFNF 1YIOA 2ISYA 2L54A 3LA3A 5E8IA 2FBKA 2H6CA 2A61A 1R22A 3T1BA 3KP2A 5H20A 5DD4A 3TDZC 1W5SA 1QZZA 3WG9A 1BI0A 4WCGA 1E17A 2P7CB 4I02A 3SZPA 3DV8A 3BPXA 3H92A 4KN7X 3F6VA 4KT5C 1FYKA 5E8GA 5AONA 4A12A 1R36A 4L9VA 2VT3A 3R0JA 2VBWA 5LEKA 3IHUA 4BHPA 2O6GE 3C18A 2XV4S 4HX4A 1W7PD 3ZMVA 1H9GA 2M1BA 3O2PE 1EH7A 3T8RA 1UFMA 2UZKA 2QUFA 1MDMA 2P6SA 4I2OA 3GF2A 4XBFA 1IXCA 3LAJA 1WRJA 3NQOA 1RUOA 3GFLA 1IN4A 2F5DA 1IF1A 1IXSB 4FT8A 5K5QA 3OOPA 2P5KA 1U6GA 2ESHA 1TNTA 3CTAA 4N0BA 4A2UA 1XSVA 1FT9A 3BROA 2A3SA 3KP4A 4AIJA 5LGTA 2VN2A 4Q5SF 3I58A 5CVIA 3GYHX 3V8JA 3L9FA 1ZG3A 4GYGA 5LGNA 1DPRA 3I71A 2DT5A 2YX4A 5BQTA 2KJCA 4MTDA 3LAPA 4CYDA 5F1RA 2EV5A 4LGWA 4RAZA 3E6BA 3MQ0A 1QGPA 2QZ8A 2DAOA 1FBSA 2RC4A 1ZRCA 3HOSA 3VOEA 1TBXA 5JVTA 4RB3C 4IRIA 1SFUA 3WGIA 3KEOA 5HS9A 5E1ZB 2O03A 1YS7A 2XUBA 2XKOA 3RI4A 1SMYF 1Z05A 2JZYA 3I0TA 3GVAA 2NNNA 5LHGA 2VBYA 3R60A 1JGSA 5FFZA 1XMAA 3KE2A 2XROA 2HWVA 5AIQA 1ON1A 5LHIA 2HTJA 1XB4A 2E1CA 2A6EF 4PDKA 1SD5A 5IT3A 2YU3A 3S2WA 3L7WA 2CO5A 4ENKA 4U0YA 2ZNYA 5HS7A 3BJOA 1SD4A 3KFWX 3BOQA 2XAFA 2OD5A 5L3GA 2NNYA 2L4MA 2LSOA 3KP3A 3RKWA 1JXSA 2MLGA 1YLFA 3KZYA 2RN7A 1U8RA 3ZMUA 1TLHB 5ILUA 2QM3A 4KIFA 4GCVA 3KETA 3IWFA 2OQGA 3WTWC 1F9NA 3K0LA 3C3WA 2YPRA 5L3FA 1OKRA 5CJ9A 3GO5A 5AIPA 2EV0A 4ENNA 2Y75A 5IT9Z 3GFJA 1YQAA 3E5QA 2HZTA 1R5GA 5D5VB 1G3YA 3I53A 5ERIA 1NHAA 1X3UA 1B4AA 4LD5A 3ZP5A 4OIOF 4IXAA 5ILSA 1D5VA 3P9CA 2VC1A 4WX9A 2RVCA 2DK8A 3JAMZ 2ZFWA 3IKTA 4XSZF 3CDHA 2D45A 2G9WA 2O61A 1S8NA 4ON0A 2OZ6A 1FY7A 3H3UA 1P6RA 1LDJA 5CVUA 1W7PB 4IPAA 1UHWA 3PQKA 1W4MA 2HKOA 1BBYA 2ZBKA 1ZG5A 4RS8A 5JI6A 4HF1A 3GZ5A 1JE8A 2F5FA 4EM2A 3DKWA 3ZMZA 1RI7A 4MTEA 3P9IA 4S04A 3T8TA 2DI3A 2JPCA 3U9GA 2DLLA 1A04A 2HQRA 2ESNA 1Z6TA 2HGCA 5EEGA 2PG4A 3TOAA 1K78A 3KEQA 3WGGA 4CHUA 4BH9A 1USSA 3F6OA 3VEPA 1MDMB 5DUKA 1R1UA 3DFGA 4ZYDA 2EB7A 3MFKA 3E6MA 3TGNA 3WTZA 3HSRA 3CO7C 3E6CC 3IRRA 1ZRFA 5ED4A 2OQRA 4YFXF 3ERED 1G6NA 3WE2A 3GZ6A 1XDSA 2P5LC 1SD6A 3IWZA 4LJZF 1S7AA 4FX0A 3KCCA 5DUIA 3MZYA 2VE9A 1T2KA 4HDVA 1CF7B 3N97A 1U3EM 3O3KA 1LQ1A 2MH2A 3WTUC 1O3SA 3CJNA 2MLKA 3J7AO 1BM9A 1P92A 1L3LA 3DXJF 4FHTA 5DYMA 4RB1A 1KU9A 5D5WB 4UUVA 2PQ8A 2NYXA 3WU1B 4CDGA 2UWMA 1PP7U 1RNLA 1OMIA 2EFQA 2HEOA 2DU9A 4HZFA 3CLOA 4U0VA 1XN7A 3SHFA 1IN7A 3KLNA 4G7ZF 3Q9SA 5LRSA 1B6AA 4RGUA 4L18B 3DP7A 4AVPA 4OIRF 2H94A 2DQLA 3BWGA 1YYVA 3LQQA 4HF0A 2STWA 1YW7A 1QPMA 4WXHA 2YX7A 1I1GA 3HTUA 2V1DA 3LQRA 1GVJA 2FE3A 1XSXA 2F2EA 5J8FA 4G7OF 2PFBA 5JR3A 1R23A 2R7DA 3KP7A 4TV7A 4AWXB 4KUMA 1FC3A 3TKYA 3RIRA 1ZGAA 3Q9VA 4HA8A 3BJ6A 4U0WA 2F5EA 3GW2A 4HLYA 4AIKA 3U1DA 1R58A 5HDKA 3W6KB 4JBAA 3GX4X 3ABUA 3ZQ7A 4XLPF 1YW9A 2HFHA 2P5VA
chains in the Genus database with same CATH superfamily
3BZCA 5E3NA 4E7KA 2ZNZA 3PUBA 3U1KA 2E5NA 2C6YA 1OR7A 1W7PA 2HZDA 3GXOA 3NWSA 1Y0UA 2W1OA 3LA7A 4A0YA 5IY5H 5TISC 4C2UA 3JRCA 1TWCJ 4M9ZA 1OCCH 1R00A 3G73A 4PJMA 4KISA 2BVMA 3H5NA 3PSIA 1ZHFA 1FBQA 1WH5A 2M87A 1YRNB 3HEFA 2AXTC 3GLLA 3L2VA 1ODDA 2LR8A 2MFZA 4KDPA 4ENMA 4PGHA 2VBZA 5B66C 4M3EA 2FOWA 1KQ9A 1UAAA 4V2GA 1LJ9A 2IEKA 1LE8B 4CZZA 4JQFA 1HSJA 3DQVC 2CW8A 1TT0A 1FTTA 3JRIA 1GVDA 3CCVI 4KA4A 5LHHA 2K85A 3MVPA 1V55H 1ZG1A 3EETA 1U2WA 4J01A 3FKIJ 4P5OA 3W2VA 2E1MB 4LLGF 4ZDLA 1HKSA 4UUSA 3QPSA 2X1EA 3EUKL 1J09A 3ZXSA 2GXAA 2IAIA 4HW0A 2FU4A 3DTEA 1YE9A 1A6QA 1D0YA 5HODA 2WB1A 3RKXA 1XPXA 5J3LA 1ITYA 1WCMJ 3JSOA 4ZYAA 2NRAC 1RRJA 1IN8A 2X4HA 2X1CA 2RDPA 2HOEA 1XGOA 1X1DA 1OYWA 2COMA 2DA6A 1ZRDA 3DPTA 3F23A 3BPVA 1MMGA 5IYBJ 4AIHA 3CMEI 4QPQA 1I3QJ 4DJAA 1WKMA 5FKKA 4NQWA 2KRFA 4EV0A 2L0KA 3ASNH 2EILH 3CP8A 1JUSA 3M8EA 4L9TA 5KVRA 4IF4A 4ZC3A 2V7FA 4UNOA 2FMLA 3OR2C 2QLZA 3RDIA 1EA3A 1R7JA 3EQLF 1JUPA 4XQFA 4L9NA 4BACA 4MNUA 2R92J 5BOXA 2FMYA 2FJ1A 4QSHA 5CKTA 3BCBA 3U2RA 4A3KJ 3K4KA 4FQGA 3BG7A 5FO5A 2VE8A 4OU0A 1TQIA 2ME6A 5JLXA 1NTCA 2G0EA 3V7CA 2A68F 2QKMB 4XLAA 3K70C 3ZMTA 2ZXJA 3CMMA 2ICWG 1OPCA 2LY9A 3P5JA 3FBIB 3DEUA 3T5XA 4MQ9F 3F8MA 5EF6A 2ME0A 4OMYA 4E7SA 1G4DA 3PNVA 4PFPA 3RJPA 4B4CA 2ZMEA 3TQNA 1CF7A 5M5YJ 4BKXA 1FP1D 3A03A 3M8FA 3OR1C 1SAUA 3R4KA 4BHCA 3H1CA 2JUGA 4OWRB 2IVMA 4GXOA 1A6IA 3WGHA 2D1VA 1ZLKA 1WZ2A 2LVSA 4I0AA 4LFUA 4U7BA 2CYYA 3FHZA 1B9NA 5KCMA 2L9RA 3K1MA 1ETYA 1U5TB 1ZR4A 3TP3A 1D1BA 3HOVJ 2WBMA 1IRFA 3BQZA 1AWCA 4BU2A 1OCTC 1WWXA 3TMOA 5F6FA 1HCRA 1ZELA 2EA4A 1OR7C 1LPQA 1O4XA 1FOXA 4P96A 1GLNA 4DZPA 3EUHA 2VQHA 3L00A 1A35A 4YELA 1ETVA 2TDXA 2W4SA 2GZWA 2LNBA 2K02A 1SEUA 3AL0B 1K83J 4NBQA 2X0LA 4KIGA 3OYIA 4C2MJ 3QP6A 2QSFX 3L2QA 1XCBA 2CQKA 3WU0A 2E1OA 3BCAA 1OJLA 4LK1F 2WWYA 3OYDA 3FXMA 3RPQA 3CCSI 2Z9OA 5LBQA 2V1UA 4LB5A 5E18F 2MA3A 1K78B 1X1BA 4IVNA 2Q2EB 2L3DA 3OV8A 2BHYA 2JA2A 5M5WJ 3X2QH 2H8RA 2BE5F 4M3GA 1MJAA 4NC8A 2QQAA 4FISA 4HSRA 3V8LA 2EBIA 2RQPA 2Y48A 2EFWA 2PEXA 4O3MA 1IDYA 1QNTA 3DBHB 4HV5A 3E5UA 3F8FA 2KP6A 3V8KA 3FM5A 3E97A 2XHKA 2GWRA 4RGXA 3NWTA 3JSPA 4RGRA 2NOGA 3UKGA 2BOLA 1GV2A 1Y39A 3RPUA 1FYLA 3LA2A 3ZQFA 5BPIA 1TQMA 2WV0A 2ZFUA 2STTA 3M7GA 2FUG2 3ZMDA 4UVAA 3HGYA 4ZYGA 3I9V2 3ISPA 1T98A 2VXDA 3F8CA 4A3MJ 3UR3C 3LFKA 2XPVA 3JW4A 1IXRC 3K6GA 4OOIA 4XONA 3TO7A 2LTPA 1LB2A 2DMTA 3HRSA 5M3MJ 3AAFA 2DJIA 1VQ8I 1ACIA 2DDAA 2D1HA 4BJ6C 2E7XA 2VT2A 3PO2J 3VSKA 2OU2A 2DPDA 3HDDA 1IZ1A 1MMDA 3L2UA 2OZUA 2FNPA 1L0OC 4UB6C 4ZDOA 3R0AA 2LLKA 3M1EA 3G6EI 1ZGJA 5TRDA 3DLAA 1OYIA 3R61A 4BNCA 1B1BA 2O5RA 2OCEA 2JT1A 2ZMEC 3ECOA 4IOCF 3KX2A 1IDZA 1BR4A 1J5YA 2KIFA 5KAIC 3KP6A 1HQCA 3V42A 2WAQN 5E79C 1ZK8A 4BDYA 1BI1A 4IHTA 4NHJA 1O7FA 2HVRA 3ZQCA 3S2HJ 1F5TA 1G3WA 3S1MJ 2K4JA 1UELB 4GO1A 1P4AA 4E4HA 1EV7A 5LLQA 1RPWA 2L7KA 3OYNA 2GM4A 2HR3A 1ZN2A 1MBGA 3I4PA 4O5VA 4RMNA 2DA1A 2ELHA 4BUPA 3DLLF 3M8JA 5HLHA 2LD5A 1DU0A 1QO0D 1W5TA 2QKLB 2XPWA 2EQRA 2W7NA 1RR7A 1K6OA 2GA1A 5HDGA 5C3EJ 3EUHC 1DGWY 4A0XA 2EIKH 2DA4A 1TTYA 5FD6A 1HW2A 1FTZA 4FE4A 3VYTB 5FLMJ 1D0ZA 3ZN1A 4KICA 3Q3SA 2DYSH 1ZQ3P 3JTHA 1Z77A 3F0CA 3O6BB 2DA3A 4A6DA 1R49A 3DF8A 1YG2A 2KRHA 3ESWB 1LE8A 4KNYA 2PMUA 4YRVA 2NOJB 1FIAA 1YJ9I 4Y15A 2Z3YA 2R7RA 2O8XA 1UB9A 1O3QA 2LF8A 5B1BH 2OJED 1KONA 4G94A 1BC7C 2XSJC 1E3OC 1VQOI 1DUXC 4HAMA 3KYCB 5B3SH 1D1CA 4KN4X 1BW5A 1Z67A 3LSTA 1P4XA 1ZARA 1R1VA 2OA4A 5FKOA 4XLNF 5ILVA 2RNJA 2WV1A 4NB5A 1IUFA 4D7NA 2IGOA 4P55A 3Q0WA 3OYAA 4OIPF 4BXXJ 1ONVA 3L1PA 4UVCA 3V7RA 2M7BA 2V6CA 4XOTA 3CCEI 1DPUA 2EV6A 1FSHA 3ZQGA 1LVKA 1VTNC 1FZPB 1OCOH 1HSTA 3ZQIA 1OFCX 4GRIA 4PJJA 1P7IA 5F08A 4BJ5C 4UV9A 4MGRA 2LK2A 2MH9A 1OCPA 4HBLA 5H6QA 2X6OA 1UCRA 4H4KC 2QA4I 1X2MA 3CMAI 2W84A 5HS8A 4XLEA 1KGSA 1Z21A 4A3CJ 3E6DA 2FEZA 4IRGA 4HSTA 3SEZA 2E1NA 3KLOA 3RZOJ 2NVUB 1RETA 2K7LA 3F22A 1WGXA 5CVRA 3VB2A 4XSXF 1HDPA 5C44J 4A3LJ 1LDKB 2YSRA 4G6QA 2RKHA 5DCFA 3ELKA 2JA6J 2BY0A 3QU3A 1F43A 1XMXA 1SVMA 1W0TA 1H0MA 1BI2A 1W36C 4X0GA 1MBFA 3UNGC 1O3TA 3CCUI 1HW5A 2LKXA 2HYFA 4A5MA 3OYKA 3IP4B 3FBNB 4HYEA 4I98B 3H36A 3MKYB 4EQQA 2COBA 4FTHA 4M71A 2VONA 1T0FA 5HNHA 3A1YA 3QRFF 4ETSA 2RREA 5LFAA 1LEBA 2DA7A 2GIZA 3L09A 1ZH5A 3G2BA 1U5TA 1H8AC 3TBIA 1R4NB 3ABLH 4IL6C 3MEXA 2IRFG 2YS9A 2Y0SA 2A07F 2XKPA 1WH7A 2JK3A 2R7QA 3I59A 3ML6A 5D4SA 4YIFA 3H0DA 1YFHA 1U0JA 2A6HF 3DEWA 4C3JJ 4BQOA 1EH6A 2K4BA 4C9YA 2VPLA 2FF4A 2K9LA 5EZGA 5H2FC 5HDNA 3WTTC 1IV6A 4A6EA 4CUGA 2PMHA 3J81K 3GEZA 4UUSB 3WODF 3ZMSA 1O57A 3TL4X 4HLXA 4OMZA 5A2QK 5HVQC 4XKCA 4PJLA 3HZJA 2QVOA 1XCVA 4A0ZA 1WQ2A 3S3OA 4CZCA 1VQ4I 1YJWI 4JK1X 2P6TA 4EEFG 5J1UA 2AQEA 2DFIA 4W97A 2E19A 1MJ9A 2E35A 4XRFA 3BLYA 4BQQA 1IJWC 2VOPA 4H0EA 3VPRA 4ZZLA 1MW7A 1MMNA 1FP2A 2Q2EA 4B3XA 3VFZA 1ZAOA 3D0SA 3G4SI 3C2GA 3KPHA 2E1MC 3I56I 3CCMI 4DQ2A 3BG9A 2MSYA 2NS0A 5D6EA 3RKQA 4GGGA 2R5YB 2Z2SB 4MEXF 3HOZJ 3OYMA 2HXIA 5CLSA 1S29A 1A36A 2KIQA 1QBJA 2YUSA 2J5OA 2M3AA 2CUJA 3CESA 2AXLA 2I10A 2R4GA 3CZ6A 5JHUA 1B8IB 1TQPA 2X6WA 3HHGA 3OIOA 2A69F 1Z3YA 5DCMB 4CICA 1TC3C 4A3BJ 2DFFA 4EJUA 1VQ7I 1J2XA 4XRMA 4CCLA 3A0HC 3NAUA 3V7SA 1SD7A 3B02A 2G7UA 5BMZA 2E7WA 4HPQA 1XGSA 2JWTA 3BZKA 3SZTA 4RGSA 1K79A 4AD9A 1S7EA 4KT6A 3PNYA 3JR9A 2ZMEB 1YJNI 1MKMA 2PBIA 1BN5A 4A3EJ 3HUGA 1U9OA 4EM1A 3OYGA 4BY7J 3DCFA 4O6JA 1FX7A 2F5CA 4HRIA 2M8EA 3FWEA 1MBHA 1Z9CA 4IKFA 2KKOA 2KDZA 3DEEA 4WWCA 1LEAA 3COAC 3LSRA 1GUUA 2FNAA 2VOOA 1QU3A 1DDNA 4BXUA 3F72A 4E7JA 3S3NA 4N9IA 2P7VB 4F7ZA 4G6DA 3HOYJ 3MWMA 2CW7A 3MCZA 3E3VA 2JTVA 4JX6A 1WJ5A 2P0WA 3QQAA 4XRSG 2JRTA 4LIVA 4E7ZA 2WAFA 5K5RA 1ETOA 2HOTA 3HRMA 3J7AY 2BW3A 5GP9A 1U5TC 2X6XA 2NXNB 4A5NA 2EZIA 3HM5A 4I09A 4CO8A 4L0YB 1G3SA 2DBBA 2CH0A 1ZR2A 2Z1DA 4DZJA 1TT5B 5FRNA 2HQNA 3G3ZA 1FPQA 3ERMA 1WJFA 2OC6A 1IN5A 3CUQB 1TW3A 1HBXG 1TWAJ 1KA8A 2R7OA 4KFCA 2B63J 3AL0C 2F5VA 2BYVE 4LLLA 4HQMA 1ZYRF 1I1SA 1YX3A 1V5EA 5B5EC 1SFEA 2M8GX 4MHGA 5F04A 5HOOA 1J59A 2XAGA 1K7AA 1QZEA 3BJAA 4J19A 4YIIA 2AQFA 5FGMA 1HA8A 4L5IA 2GXBA 1JI8A 4Q48A 1ULYA 4EVIA 2X85A 2Z33A 2FQ3A 1T8IA 1BL0A 1F4KA 3KIOA 3PQJA 1ZREA 5KNLA 5C4JJ 4IHYA 1IUYA 4EJVA 2IP2A 5EJCA 1TWGJ 3E5XA 1ETKA 2HYJA 2PN6A 1H9TA 4F91B 2F48A 3ABTA 3DBRB 5ICFA 2JPBA 3H35A 1KQ8A 3WHCA 3PM1A 2EFNA 1J9IA 3BG5A 3C1DA 3HOXJ 1MMSA 1KQ0A 1DP7P 1UHMA 3S1QJ 2M2EA 4ESBA 3QOPA 3HBLA 2CWEA 1LVAA 2CFXA 4S05A 1POGA 2L7FP 1X4PA 3FK7A 2BY1A 3AG4H 3I5UA 2HOAA 2MBFA 2PJPA 4KITB 3F8NA 5J40A 3ECHA 2JSCA 2W00A 5CVJA 4LMYA 5L3DA 3RYRA 3J80K 2HYGD 3FXLA 2CGPA 3K10A 1FYMA 2FD5A 3IL2A 1SMTA 1TL8A 3K4BA 3DU6A 1HKQA 5E1XA 2ZSIB 4Q4ZF 2R3SA 5L3EA 2O9LA 5BS6A 2DO7A 3K4CA 1X19A 1SVLA 4CCKA 4FETA 3CLQA 2H27A 2ECCA 1B9MA 5FLXK 2VI6A 2LBFB 4XKVA 1T56A 1U78A 1IV8A 3HTSB 1TWFJ 5F0HA 1RR8C 1O3RA 1REPC 2ZXIA 3QYFA 2VXZA 2D2WA 2V1XA 4Z2YA 1WSUA 2EIJH 3OIQA 2QYOA 3GWZA 4XK4A 4GYIA 4EGZA 1T6SA 2F6CA 2HQAA 2ZO4A 1SANA 1UG0A 2MD5A 5D5XB 4XN3A 1ETWA 2H09A 2JJ7A 5ICGA 4PK4A 1ON2A 4M3FA 3ABMH 3K70D 3R6SA 1FBUA 1Q1VA 1RESA 4YIRX 4ZTJA 1S3JA 5CQGA 5K7FA 3HYIA 3LWFA 3CDLA 5GTIC 5K5OA 1E2XA 1KU2A 1D8KA 2Z99A 1VQ9I 4RAFA 4DNCA 2OUMA 1BIAA 4BAYA 2MD0A 2GXGA 4HNUA 2W85A 1J75A 3CUOA 2XASA 4D1QA 5J6XA 3S2DJ 4P9FA 2E71A 2PLYA 3F3XA 1SFKA 5D8LB 3GTGJ 5IOYA 4ESFA 4S0HB 2R7UA 3RCOA 1IN6A 2VL8A 3QP5A 2DOFA 2PJRA 4IJAA 1VZ0A 4B09A 3HOWJ 3K2ZA 2DW4A 2HDCA 3IRQA 2WC2A 4L5JA 2R5YA 1HXDA 3EPZA 1IO2A 1HKTA 5KK1A 3IH3A 1RIOH 4AUXA 2QWWA 2XF6A 1XGMA 4HDUA 2V4JC 2DA2A 4IRHA 2LP0A 1B8IA 1TNSA 2Y0MA 3NARA 2X9DA 5DCMA 5D4RA 3FZVA 4CCMA 2B9SA 1XMKA 2DODA 1RZ4A 4B1RA 1CQTA 1JJ6C 1I50J 2RGVA 3WTXC 5E20A 3JCUC 3CJRB 4DBQA 1QPIA 2WAEA 4HV6A 4RM2A 2KFDA 4HNTA 1Z7UA 2DQRA 5JFRA 5E1WA 1JUMA 4OIQF 3S32A 3QPHA 1DU6A 4A3GJ 2DMUA 2CRGA 2Y30A 3WE3A 1IAWA 3GTLJ 3A0BC 1OCRH 2LDUA 2UXXA 4IEJA 1SFOJ 4WK8F 3EYIA 3IUOA 2X6YA 3ZRGA 2Z5UA 5CYVA 3QU6A 3BC8A 3PFIA 4I7HA 1VI0A 2O8KA 2ZJ2A 3I64A 2IXSA 4L5EA 1N75A 3K9TA 5FB2A 3I59B 5DTDA 1P2FA 2L02A 2NS7A 1LDDA 4F3QA 2AO9A 2L4AA 2BEOA 1S6LA 2W57A 1K4TA 2GA2A 1K6YA 3G71I 3HSFA 2UXNA 4BQAA 4PCQA 3ROUA 4NNJA 3QYEA 2BY2A 3OS0A 1DGRM 1FMVA 3W6VA 1IW7F 2K5CA 3M9AA 4ZYEA 5K1YA 2VLAA 1JGGA 3KP5A 1I5ZA 3KZZA 5D5UB 3HOTA 2FBHA 2VQGA 1I3AA 1BIBA 2H6BA 1G59A 4EJWA 2B0LA 2A05A 1P4WA 3LSIA 3HC7A 3TDUC 1R5HA 2LOOA 2PMZN 4BS9A 2ZXHA 3ZQQA 1F1ZA 4CGZA 2RV8A 3AG3H 2ETHA 3CUQA 1IC8A 2K40A 2Q8KA 1Y6IA 2XAQA 4ASNA 4IZZA 1JHFA 1R1TA 2FOKA 4I0BA 3CF5F 3H3ZA 2A5YB 4FASD 1JT0A 3LSGA 4JP0A 3ULQB 1EKEA 4M6VA 1U8BA 2XF7A 4M9XA 2XSDC 2D5VA 3GTKJ 3FMRA 5F64A 4RBOA 5EEHA 2CS3A 3QAHA 4MEYF 3DBLB 2RAEA 4JX4A 3OYEA 2XAJA 2EA2A 3LSPA 1XSDA 4DIQA 5EZHA 2CSOA 1GHCA 4KMUX 1XDUA 2R5ZB 2CUEA 4CCOA 4CYCB 2AS5F 1BR1A 2UUZA 2KRCA 2ZKZA 2XF5A 3TO6A 2O0YA 2KZVA 2J5PA 4XN0A 3MZHA 2F4MB 5LRRA 3HUGB 4RAYA 4LG0A 1TW2A 3B73A 3HHHA 1FMWA 1MD0A 4IHSA 3DPUA 4WF2A 3RTRA 4M73A 3KYLA 2O3FA 1QZYA 4L0ZB 4Y17A 3FXKA 3CF2A 1PJRA 3DPLC 4AYBA 2F4OB 4RB0A 3VYSB 5D6FA 1ENHA 4ZZDA 2LF7A 1ZLJA 3J81Z 4BE0A 2X51A 2W48A 4KIBA 1XD7A 3ZQLA 2QBYA 1FNNA 3OIPA 5A2QZ 1KYZA 2HNHA 2LY1A 1MMAA 2R7SA 5D8KB 4E7IA 4Q47A 3RKYA 4LLNA 1FSEA 3K1PA 1Z6RA 2W24A 1IRXA 4ESJA 4UVBA 4EGYA 3BTJA 2BW3B 4HF2A 4QPOA 2HQ5A 4ZH4F 4LK0F 2XVCA 2P4WA 1J7KA 3HKZN 1BI3A 1KU3A 4AVZA 2W25A 2HS5A 2GIVA 3PL8A 2N8GA 2L7ZA 2M0CA 2VC0A 1SFXA 3REOA 4C3HJ 4A93J 2DT6A 3HSEA 4HX7A 3H9GA 4B44A 2ZJQF 4HEA2 3BR5A 1EJ9A 2LBFA 2GBYA 1ZKGA 3L2RA 4Y4RA 2XAHA 4BYYA 1JJ8C 1S7OA 3BG3A 3GTMJ 5IPAA 5IYCJ 1YS6A 2K9MA 3FX3A 3DWLE 3SQNA 4AM3A 2DK5A 3HOUJ 4M9SA 2DFHA 1B72B 2LKPA 2VBXA 3JRHA 1BW6A 2KIMA 2ACJA 1X1PA 2M45A 4BY1J 4HOBA 4I01A 2L7MP 4E7HA 1B59A 4M6XA 2KIUA 2WTEA 2OF7A 3NRVA 1SAXA 3ZPLA 4XKBA 4P1WA 3BR3A 3CUQC 2LRDA 2HI3A 4YEJA 3GUDA 4HX8A 5DM6F 1QHGA 3Q0VA 1Z91A 5FFXA 1PUFA 2ECBA 4B47A 2XAUA 3S93A 2IPQX 3QODA 2IA2A 2IS6A 1GXPA 2R0QC 2ZB9A 3LSKA 3O8HA 2TCTA 3HIFA 2OAZA 2R7FA 2GQQA 3FDYA 3HJEA 4UHTA 3IKVA 1VQMI 1NH3A 1YW8A 4QWQA 4EM0B 2K9QA 1O7LA 1YOVB 3F21A 5BPDA 1IGNA 2ISZA 3CCRI 3OOUA 2VKEA 5IP9J 3QPTA 3LFUA 3DKXA 3TP0A 1OQYA 1R5ID 3D5LA 2MYSA 3SFZA 4D7MA 1FLIA 4PGGA 2NAZA 3RYPA 3I4MJ 3BR6A 1S9HA 3CQZJ 1WJEA 4XORA 2VIXA 1YO5C 3EDPA 1E3HA 2IJLA 2E34A 2EWNA 2LY2A 2OBPA 3GFIA 1E3PA 4LB6B 4M74A 2XGXA 2WA0A 1ETXA 3MMYB 3VWBA 1C0WA 1LNWA 1D3YA 1ORKA 4K2EA 3P9KA 3ZQHA 4RB2C 2IA0A 3HPGA 3RQ4A 2XDVA 1LKXA 3GBGA 4N9HA 1T33A 4ABZA 1Y1WJ 2G7HA 1UJ8A 1S5LC 3D1NI 5E17F 3PFYA 2LREA 1X1AA 2QQ8A 4IO9F 2CQ7A 1I6XA 4IQ4A 2XPUA 3M1CA 1N78A 2R7XA 1ETQA 4BE2A 2E2HJ 3JTGA 4QTRA 3GLXA 2CV0A 2GOMA 3BP8A 3IV5A 2WB1N 2QENA 2EFOA 4OAYA 2BGCA 2PI0A 3PSFA 2FA5A 3GTJJ 1UG2A 3MD2A 2ADUA 1PUEE 4G7HF 4PZJA 1J0RA 4UV8A 4A3IJ 1YITI 2EPFA 4EJOA 3IC7A 4D0PA 3QWLA 4AU7A 2Q0OA 1FWZA 3WTSC 3I4NJ 3S1RJ 4QLCU 4U87A 3EYYA 1MJBA 2V79A 3K1NA 1BR2A 2E36A 1RUNA 1WJAA 1JKQC 4G6TB 5ICCA 3ZOBA 1WI9A 2L9NA 3CC4I 1GDTA 1VNDA 4PJNA 3MAJA 5L3BA 2VB6A 3FHNA 3BDDA 4KYWA 2CW0F 4B8XA 1T39A 3C7JA 2PJRB 3WG7H 4E6KG 1K61A 2QQ9A 5KHDA 2XRLA 1FOWA 3TW7A 3HL2A 2K27A 1HW1A 4XR6A 5F0FA 4F52A 1FOKA 1MH4A 3J80Z 1VQ6I 3E7LA 1AU7A 1HDDC 3W2WA 1BC8C 4G12A 2FXAA 2JA7J 3QOEA 3K69A 2KJBA 4YFKF 4YG2F 2CV1A 4M6YA 3VYRB 2PX9A 1KU7A 3FXUA 2JMWA 2EZLA 3FMSA 3P7NA 2R5ZA 4U88A 3NEUA 4CYCA 4DGWB 2FSWA 2MC3A 3W6JB 3WHBA 3ZN0A 3VSLA 4OAZA 2DTRA 5CVVA 1TWHJ 4G8XA 5FLXZ 1AHDP 3K4JA 4G9YA 5HLTA 2FQ4A 4M3BA 5DDGA 3TO9A 4C3IJ 4Z6YA 4RA2A 3S3MA 3DTIA 1NK3P 4E70A 2MG4A 2GOXB 5GAHJ 1SC7A 4EJTA 1Z1DA 1Z3XA 1WJDA 2IA1A 2E5ZA 1LFUP 4KMFA 2IW5A 2R7ZJ 4EMSA 2K86A 2M30A 5ICEA 3A02A 4ZJZA 5DD8A 1PDNC 4C30A 1MSEC 2P81A 2EFPA 3HRTA 2EH3A 3D5SC 4OINF 4U7DA 3CC2I 5IT9K 4B48A 1Z0XA 3S14J 4GDFA 1W0UA 1I27A 2R7VA 4B43A 3FXRA 1X3ZB 4Y13A 2VKVA 1I39A 4LITA 4MQVA 2Y2ZA 3SDGA 3JRFA 3CO6C 1XS9A 2YR2A 1T0FC 4CXFA 2E2JJ 4ZDPA 5HLGA 1MGTA 3OL3A 4ENJA 1BOAA 2FRHA 3GCMA 2BBYA 1IRGA 1EH8A 1T38A 3CCJI 3SXYA 2ELJA 4FX4A 1USTA 5TJJA 3OS1A 1QVUA 5H6RA 2BV6A 2EK5A 2LG4A 2V9VA 3RQIA 3JAMK 1VQLI 1Q1HA 4WXCA 2WY8Q 4XIDA 4JYKA 2M0MA 1G8XA 1UMQA 3OYHA 1MZBA 1HC8A 2DMPA 3OWTA 5J4VA 1V4RA 2DXIA 2OTJI 3G1OA 3Q5FA 1GXQA 2VODA 2IT0A 3BR1A 2M5WA 2MABA 5L3CA 1IRZA 1G3TA 1MBKA 2QQBA 2HTSA 4R1HA 5FRMA 3GFMA 3HPHA 4I99C 3N4MA 3WTVC 1B72A 4UXNA 4NUBA 4R8HA 2ID6A 5HLIA 3WTYC 1YTYA 1T08B 2P8TA 5GAEJ 3L2CA 2Y31A 3FXQA 3I54A 2VQLA 2L01A 1RKWA 4A69C 1V3FA 1WFXA 1XGNA 4BHBA 2GLOA 2CUZA 1OCZH 1Y0NA 2WAQA 2XIGA 5IOZA 2LC2A 2DT7B 2HPIA 2RQQA 3CC7I 2EIMH 1JHHA 4XNFA 2ZCWA 4JOMA 5KAFC 2M34A 4WXDA 2DPUA 1YX5A 3KEYA 5J8CA 4HQEA 3FMQA 1Y8RB 1LFBA 2VKHA 5CQEA 2EJRA 4EATA 3L2WA 4LG0B 4V19K 4R79A 3S17J 4PSWA 5EGOA 3SJMA 5E3MA 4FE7A 3FM3A 3F8BA 1QQIA 4ZYHA 5M3FJ 3GMEA 2M7AA 2XRNA 5JHFA 1OYYA 2IGMA 1V5FA 5DEQA 1CGPA 3BY6A 1XG1A 2FBIA 3T0YA 2KHMA 2HKXA 3VODA 4L9JA 5IYDJ 1LFPA 3TOBA 3V4GA 3A4CA 3BTLA 2QBYB 5LEJA 1STZA 3M3YJ 2HU9A 1D8JA 3FF5A 5DV5A 2X1DA 4BEHB 3ONQA 1BJAA 2GAUA 3HRUA 4IHXA 2ELKA 4P9UA 1APLC 3OYCA 2CG4A 4M72A 1AOYA 3CMYA 3BZ6A 5FD5A 2MGQA 4RM3A 1VQKI 5LGUA 6PAXA 4J00A 3E0JB 1PP8F 3AG2H 3S15J 3MKLA 4KJZA 3K4MA 3LSMA 4DBRA 1KYWA 2Y9ZA 2VUMJ 4YFNF 1YIOA 2ISYA 2L54A 3LA3A 5E8IA 4N4NB 1X58A 2FBKA 2ZC2A 1MNMC 3TEDA 2H6CA 2CFOA 2A61A 5B1AH 1R22A 3T1BA 1BJZA 3KP2A 5H20A 3W3CA 2ZJPF 5DD4A 2BZTA 3TDZC 1W5SA 1QZZA 5FROA 4MFEA 3WG9A 1BI0A 4WCGA 2LFBA 3FIWA 1E17A 3BR0A 4DW6A 2P7CB 2M4KA 4I02A 3DV8A 3BPXA 3SZPA 3H92A 4KN7X 3F6VA 4KT5C 1FYKA 5E8GA 5AONA 5C4XJ 4A12A 1R6RA 1R36A 1PUFB 5K7ZA 4L9VA 1N77A 4Y52J 2VT3A 1UHSA 3R0JA 2VBWA 5LEKA 1WJBA 5J1RA 3IHUA 1WI3A 4BHPA 2DMNA 5EEAA 2BY3A 2O6GE 2LKSA 2KPMA 3C18A 3MN2A 4XMYA 3RSNA 2JA8J 1YIJI 2XV4S 4HX4A 1W7PD 3ZMVA 1WJCA 1H9GA 4BGDA 3PUFA 1IG7A 1Y8QB 3HXLA 5DM7F 1YI2I 2F4IA 2M1BA 2VJ4A 2M9HA 3O2PE 1EH7A 3T8RA 1UFMA 2DA5A 2OTLI 1X4OA 2QUFA 2UZKA 5FKMA 1QHHD 2M4GA 2P6SA 3OMYA 1YHQI 4XRSA 1MDMA 5TGTA 2LYCA 4I2OA 2OV7A 2R7WA 3GF2A 4XLFA 4XBFA 1IXCA 2Y0SN 4AC0A 4D9JA 3LAJA 3FISA 2QEXI 1WRJA 3NQOA 1RUOA 3GFLA 3OYFA 2QCOA 1IN4A 2F5DA 1IF1A 1IXSB 4FCYA 2OCCH 3O8GA 4FT8A 3OOPA 5K5QA 4RLQA 1Z7LA 1Y56A 2P5KA 1U6GA 3H5RA 4IHVA 2ESHA 2BXZA 1D5YA 1TNTA 2K9NA 3CTAA 1QA6A 4N0BA 1KZHA 4A2UA 1XSVA 4PFOA 5GAGJ 2BVLA 1FT9A 3BROA 1OISA 1TP4A 2A3SA 1PYVA 3HGGA 1UZCA 3KP4A 4II3A 4AIJA 5M5XJ 2IGNA 4W1UA 3H5AA 5F1JA 5LGTA 2VN2A 4Q5SF 3I58A 5E3LA 4B3AA 3JREA 4X6AJ 2JRMA 4ITVA 2MW8A 5CVIA 2HVSA 1HOMA 3ZR8X 2VJ5A 3I3LA 2JUCA 3GTPJ 3GYHX 3V8JA 3L9FA 3PO3J 1ZG3A 2W82A 4DYQA 3D5RC 2V6EA 4GYGA 3ABKH 5LGNA 2CQQA 3CCQI 3B6AA 1DPRA 3I71A 3SFIA 2DT5A 4IX7A 2DOAA 2YX4A 4D5FA 5BQTA 2KJCA 1MIJA 4MTDA 1V54H 3LAPA 4CYDA 2L9SA 4F55A 5F1RA 2EV5A 4LGWA 4D5CA 4RAZA 3E6BA 3MQ0A 5F0CA 3A01A 2H1LA 2K3FA 1QGPA 4NC7A 2QZ8A 1H89C 3J7YJ 2DAOA 2KT0A 1FBSA 4BXFA 2EZHA 1JKOC 2RC4A 1ZRCA 4GFBA 3HOSA 3VOEA 3OSGA 3CCYA 2ZXWH 4CH7A 4II2A 3FXJA 3FK6A 1TBXA 5JVTA 5EG0B 2Q1ZB 1XX5A 4RB3C 4XICA 4IRIA 1BA5A 1SFUA 5E3OA 1P9QC 3WGIA 3KEOA 5HS9A 5E1ZB 4E7LA 2O03A 1YS7A 4BBSJ 2XUBA 3ZGKA 3B6CA 2JVHA 3SYTA 2XKOA 3K4LA 1S72I 1GV5A 1SMYF 3RI4A 1Z05A 3LL7A 4IOAF 2Z16A 2JZYA 3I0TA 3GVAA 4RDUA 2DCEA 2R93J 2NNNA 5LHGA 2HOSA 4PUSA 2VBYA 3G1LA 1AKHA 1SVOA 5EYRA 1G2HA 3R60A 1JGSA 2KMUA 5FFZA 1XMAA 3KE2A 1JT6A 2XROA 1I6HJ 3BG6A 2HWVA 2DYRH 1R9TJ 5AIQA 4X1EA 4CSWA 3CD6I 1ON1A 4CA0A 5LHIA 2HTJA 1XB4A 4BEHA 2E1CA 2L2OA 4BQNA 2XGDA 5FKLA 2WY7Q 3CCLI 2A6EF 2KDOA 4PDKA 5J47A 1SD5A 5IT3A 4DYCA 2YU3A 2BHZA 3IAM2 3S2WA 1W5CC 3L7WA 5GTHC 2CO5A 4ENKA 1K4SA 5GPAA 1FEXA 2A6TA 4PJ0C 4U0YA 3F9KA 5JLWA 2ZNYA 3PIOF 5HS7A 5K7HA 3BJOA 3OY9A 1SD4A 3AG1H 3RPUD 1MBEA 3KFWX 1VQ5I 1RKTA 3BOQA 2XAFA 1R71A 2OD5A 5L3GA 5GADJ 3H3VK 2NNYA 1A31A 2L4MA 2LSOA 2ID3A 4NC6A 3KP3A 3RKWA 1A5JA 1JXSA 2MLGA 2XGCA 1EF4A 2CV2A 1YLFA 3KZYA 2DOEA 2RN7A 4Y7NJ 1U8RA 2TRTA 3ZMUA 4LIUA 1TLHB 3H0GJ 5ILUA 2QM3A 4KIFA 4GCVA 4Y3OA 3KETA 3A2KA 1YRNA 1W36D 3IWFA 2OQGA 3WTWC 1VQNI 3BR2A 1F9NA 2K3PA 2Y9YA 3K0LA 3LMMA 3C3WA 4BBRJ 1NK2P 2YPRA 5L3FA 3N05A 1ZTRA 2DMQA 5HNFA 2JN6A 1OKRA 2VASA 3WU2C 4UUTA 5CJ9A 2Y69H 3DKYA 3FXOA 4LOCA 3GO5A 5EGOB 5AIPA 2EV0A 4ENNA 1WHUA 2Y75A 5IT9Z 3GFJA 1YQAA 3E5QA 3BTIA 4ANJA 2HZTA 1R5GA 5D5VB 4CCJA 3S16J 4HG2A 1G3YA 3I53A 4XL9A 2H1KA 2R7TA 5ERIA 1NHAA 1P7JA 2K9SA 2I8DA 3DTKA 1X3UA 1WPKA 2AHQA 4AIDA 1B4AA 4LD5A 3ZP5A 4OIOF 4IXAA 3HG9A 5EDNA 5ILSA 1D5VA 3P9CA 2VC1A 4WX9A 2WADA 3KZIC 2CU7A 2RVCA 1U9NA 1MNDA 2DK8A 1WVRA 3VYUB 2NVYJ 2V9PA 2VPRA 5GPCA 3OYLA 2JVGA 3JAMZ 1OLTA 2MC4A 2ZFWA 3IKTA 2VJIA 3W2AA 4XSZF 2JQ7A 5IP6A 1X2NA 3CDHA 3TW6A 3OSFA 2D45A 2G9WA 3K4NA 2O61A 3FKJA 4MFDA 4XOPA 2LH9A 2H8WA 3VDXA 1S8NA 5LD2C 3MKWB 2QSGX 4XLHA 4ON0A 3LSJA 2OZ6A 5JVGF 3MZ8A 3GZNB 1M1EB 1FY7A 3IAS2 3H3UA 1P6RA 3OL4A 1LDJA 5CVUA 1W7PB 2HVQA 2E2IJ 9ANTA 4IPAA 1UHWA 4BL0B 3PQKA 4XLCA 1N25A 4PSXA 3QYBA 1W4MA 1MSFC 2HKOA 4DYRA 2NS8A 1BBYA 2ZBKA 1ZG5A 4RS8A 5JI6A 4HF1A 2I5UA 3GZ5A 4A3DJ 3CJTB 4IQJA 1R4MB 3BTCA 1JE8A 2F5FA 4EM2A 1MH3A 4I6ZA 2QGUA 3DKWA 3G1MA 3ZMZA 3OYJA 2IS1A 1RI7A 4MTEA 3P9IA 3AKZA 3BQYA 4S04A 2QSHX 1FIPA 1Y1VJ 4BJTA 3T8TA 2DI3A 2JPCA 1QRYA 3U9GA 2DLLA 5F27A 5J1YA 1D1AA 1A04A 2NVTJ 3Q0UA 2KZGA 2HQRA 2ZJRF 2ESNA 1Z6TA 1JTYA 2JSPA 3JRGA 1PVEA 2HGCA 2KLOA 4XKWA 1ERDA 3GTQJ 5EEGA 2PG4A 3C2HA 1FJLA 3H9JA 3EUAA 3TOAA 2FX0A 3OS2A 2CJJA 2OPTA 3KEQA 1K78A 3WGGA 4CHUA 5FLVA 4BH9A 4Y33A 1USSA 4NQWB 3F6OA 4JX5A 1JKPC 3VEPA 1MDMB 1JKRC 4C2TA 5DS9A 5DUKA 4N4OB 1R1UA 4A3FJ 2CMPA 2O7OA 2IGKA 3H9QA 3DFGA 2VJJA 5EG0A 3M4OJ 2B7EA 5FJ8J 4ZYDA 2L9VA 2VQCA 2EB7A 2V9KA 3MFKA 1HF0A 2BXYA 3E6MA 3HB9A 5BNGA 1H88C 1X3WB 4RAGA 1V5GA 3TGNA 3WTZA 3HSRA 3CO7C 3E6CC 2DJNA 2KQRA 3IRRA 3PIPF 5FKNA 1ZRFA 2PMZA 4BDZA 5ED4A 2OQRA 4YFXF 3ERED 1G6NA 3WE2A 3GZ6A 1XDSA 2IBDA 2P5LC 1SD6A 3JRDA 3IWZA 4LJZF 1S7AA 3DU5A 4UB8C 1XC5A 4FX0A 2NVXJ 3KCCA 1VQPI 2DDBA 5DUIA 3MZYA 2VE9A 1T2KA 4HDVA 4MLOA 1CF7B 3J7ZI 3N97A 3K7AJ 3PNTA 2XC7A 1U3EM 4I76A 2DN0A 2CQNA 3O3KA 2CQXA 2MH2A 1LQ1A 2XGEA 3WTUC 2EINH 1O3SA 3LSHA 3LOCA 3CJNA 3CDIA 1QVTA 2MLKA 2UV1A 2VKDA 3J7AO 1BM9A 1P92A 1L3LA 2CUFA 3DXJF 2IS2A 4FHTA 1T95A 5DYMA 2IS4A 3QPLA 2V1NA 3SDBA 3BT9A 1KU9A 4RB1A 5D5WB 4UUVA 2PQ8A 2A5WA 2NYXA 4F93B 2YU9J 1RC9A 3WU1B 4QIWN 4BE1A 1W1WE 4CDGA 5J4YA 2UWMA 2RNGA 1PP7U 1RNLA 3A01B 1D0XA 3CJQB 4NDLA 1OMIA 3E1SA 2LMDA 1AA7A 2EFQA 5CPRB 2HEOA 2NVQJ 2DU9A 4HZFA 1LUJB 1HLVA 3CLOA 4U0VA 1XN7A 3SHFA 2EZKA 1IN7A 3KLNA 4G7ZF 3Q9SA 4LG3A 5LRSA 2KISA 1B6AA 3C2BA 4HNVA 4XM3A 3ZCOA 4RGUA 4L18B 3SZGA 1E0EA 3MKZA 4A3JJ 2XB0X 3DP7A 1TZLA 4AVPA 4OIRF 2H94A 2HPMA 4AYBN 2DQLA 4UY8I 1JTXA 3BWGA 2KL4A 4IHWA 1YYVA 1DP3A 2XB5A 3S1NJ 4MIMA 2L5QA 1NG7A 3LQQA 3HKZA 2DFEA 3SEQA 4HF0A 2STWA 1MBJA 1YW7A 2QF7A 1QPMA 4WXHA 1NG6A 2YX7A 1I1GA 3HTUA 4F92B 2V1DA 3LQRA 2HDDA 1GVJA 1FOYA 3PJRA 2FE3A 3JRBA 1XSXA 2F2EA 2X48A 5J8FA 4G7OF 2PFBA 2JA5J 1AKHB 3IH4A 1BOBA 5JR3A 3I55I 1R23A 2R7DA 3M07A 3KP7A 3AFHA 1ZGWA 3KYDB 4CCNA 4TV7A 4AWXB 4KUMA 1VFCA 1FC3A 1MNEA 3JRAA 3TKYA 1DQUA 2E60A 3RIRA 1ZGAA 3Q9VA 3GTOJ 3IH2A 4ZTFA 4HA8A 3BJ6A 1VF9A 4U0WA 2F5EA 3GW2A 3LNQA 1F36A 3U1DA 4HLYA 4AIKA 1XTAA 1R58A 3CP2A 2ZSHB 2HXOA 3K2AA 4MO7A 3W6KB 5HDKA 2DTZA 1X1CA 4JBAA 4M3DA 4RLFA 3GX4X 4DOZA 3ABUA 3RZDJ 5IP7J 2HDWA 3S8PA 2V26A 1GT0C 3ZQ7A 4V2FA 4XLPF 1YW9A 2HFHA 2P5VA 3OYBA 3U21A 3ASOH
chains in the Genus database with same CATH topology
2ZNZA 2C6YA 1OR7A 1W7PA 3GXOA 1Y0UA 3LA7A 4A0YA 4M9ZA 1R00A 3G73A 1ZHFA 1FBQA 2M87A 1ODDA 4KDPA 4ENMA 4PGHA 2VBZA 1KQ9A 1LJ9A 4CZZA 4JQFA 1HSJA 3DQVC 4KA4A 5LHHA 1ZG1A 3EETA 1U2WA 4P5OA 4LLGF 1HKSA 4HW0A 2FU4A 3RKXA 3JSOA 2NRAC 1IN8A 2X4HA 2RDPA 2HOEA 1XGOA 1OYWA 2COMA 1ZRDA 3DPTA 3F23A 3BPVA 4AIHA 1WKMA 4NQWA 2KRFA 4EV0A 3M8EA 4L9TA 5KVRA 4IF4A 4UNOA 2FMLA 2QLZA 3RDIA 3EQLF 1R7JA 4L9NA 4MNUA 5BOXA 2FMYA 3U2RA 5FO5A 2VE8A 4OU0A 1TQIA 3V7CA 2A68F 3ZMTA 2ZXJA 1OPCA 3DEUA 3T5XA 4MQ9F 3F8MA 4OMYA 1G4DA 3RJPA 2ZMEA 3TQNA 1CF7A 1FP1D 3M8FA 3R4KA 4BHCA 2IVMA 4GXOA 3WGHA 2D1VA 1ZLKA 4LFUA 4I0AA 4U7BA 2CYYA 3FHZA 1B9NA 3K1MA 1U5TB 1IRFA 1AWCA 1WWXA 5F6FA 2EA4A 4P96A 3EUHA 3L00A 2TDXA 2GZWA 2LNBA 2K02A 2X0LA 4KIGA 3QP6A 1XCBA 2CQKA 3WU0A 4LK1F 2WWYA 3RPQA 2Z9OA 5LBQA 2V1UA 4LB5A 5E18F 2MA3A 1K78B 4IVNA 2L3DA 3OV8A 2BE5F 1MJAA 2QQAA 3V8LA 2RQPA 2Y48A 2EFWA 2PEXA 4O3MA 1QNTA 4HV5A 3E5UA 3F8FA 3V8KA 3FM5A 3E97A 2XHKA 2GWRA 4RGXA 3JSPA 4RGRA 3RPUA 1FYLA 3LA2A 5BPIA 1TQMA 2WV0A 2STTA 3M7GA 3ZMDA 4UVAA 4ZYGA 3ISPA 1T98A 3F8CA 3LFKA 3JW4A 1IXRC 4OOIA 3TO7A 1LB2A 3HRSA 3AAFA 2D1HA 2E7XA 2VT2A 2OU2A 2DPDA 1IZ1A 2OZUA 2FNPA 1L0OC 3R0AA 3M1EA 1ZGJA 5TRDA 1OYIA 3R61A 4BNCA 1B1BA 3ECOA 2JT1A 1J5YA 2KIFA 3KP6A 1HQCA 1BI1A 4IHTA 4NHJA 1O7FA 1F5TA 1G3WA 2K4JA 4GO1A 1P4AA 1EV7A 5LLQA 2HR3A 1ZN2A 3I4PA 4O5VA 2ELHA 5HLHA 1QO0D 1W5TA 1K6OA 2GA1A 5HDGA 4A0XA 1TTYA 5FD6A 1HW2A 3ZN1A 4KICA 3JTHA 3O6BB 4A6DA 3DF8A 1YG2A 4KNYA 2PMUA 4Y15A 2Z3YA 2O8XA 1UB9A 1O3QA 2LF8A 4G94A 1BC7C 1DUXC 4HAMA 4KN4X 3LSTA 1P4XA 1ZARA 1R1VA 2OA4A 4XLNF 5ILVA 2RNJA 4NB5A 4P55A 4OIPF 1ONVA 4UVCA 3V7RA 2V6CA 1DPUA 2EV6A 1FSHA 1VTNC 1FZPB 1HSTA 4UV9A 4MGRA 5H6QA 2MH9A 4HBLA 1UCRA 2W84A 5HS8A 1KGSA 3E6DA 2FEZA 4IRGA 2E1NA 3KLOA 3F22A 2K7LA 5CVRA 3VB2A 4XSXF 1LDKB 2YSRA 4G6QA 2RKHA 5DCFA 3ELKA 3QU3A 1H0MA 1BI2A 1O3TA 1HW5A 2HYFA 4A5MA 4HYEA 4I98B 4EQQA 4M71A 2VONA 1T0FA 3QRFF 4ETSA 1LEBA 3L09A 1ZH5A 1U5TA 3MEXA 2IRFG 2A07F 2XKPA 3ML6A 5D4SA 3I59A 4YIFA 1YFHA 2A6HF 1EH6A 2K4BA 2FF4A 3WTTC 5HDNA 4A6EA 2PMHA 3J81K 3GEZA 3WODF 3ZMSA 1O57A 4HLXA 4OMZA 5A2QK 5HVQC 1XCVA 2QVOA 4A0ZA 1WQ2A 4JK1X 2P6TA 2DFIA 1MJ9A 4XRFA 2VOPA 4H0EA 4ZZLA 1FP2A 2Q2EA 3VFZA 1ZAOA 3D0SA 4DQ2A 2NS0A 5D6EA 4GGGA 4MEXF 5CLSA 1S29A 1QBJA 2J5OA 2AXLA 5JHUA 1TQPA 3HHGA 4CICA 5DCMB 2A69F 4EJUA 1J2XA 3V7SA 1SD7A 3B02A 2G7UA 5BMZA 2E7WA 1XGSA 3SZTA 4RGSA 1K79A 4AD9A 2ZMEB 1MKMA 2PBIA 1BN5A 3HUGA 4EM1A 4O6JA 1FX7A 2F5CA 2M8EA 3FWEA 1Z9CA 2KKOA 4WWCA 1LEAA 3COAC 2FNAA 2VOOA 1DDNA 4BXUA 3F72A 4N9IA 2P7VB 4F7ZA 4G6DA 3MWMA 3MCZA 3E3VA 2JTVA 2JRTA 5K5RA 3HRMA 1U5TC 4A5NA 4I09A 4CO8A 4L0YB 1G3SA 2DBBA 2HQNA 3G3ZA 1FPQA 1IN5A 3CUQB 1TW3A 1HBXG 1KA8A 4KFCA 2BYVE 4LLLA 4HQMA 1ZYRF 1I1SA 1SFEA 4MHGA 5HOOA 1J59A 2XAGA 1K7AA 3BJAA 4YIIA 5FGMA 4L5IA 2GXBA 4Q48A 1ULYA 4EVIA 2Z33A 2FQ3A 1F4KA 1ZREA 3PQJA 1IUYA 4EJVA 2IP2A 3E5XA 2PN6A 1H9TA 3ABTA 5ICFA 2JPBA 1KQ8A 2EFNA 1J9IA 3C1DA 1KQ0A 1DP7P 1UHMA 4ESBA 3QOPA 2CWEA 1LVAA 2CFXA 4S05A 3I5UA 2MBFA 2PJPA 3F8NA 3ECHA 2JSCA 5CVJA 4LMYA 5L3DA 3RYRA 3J80K 2HYGD 2CGPA 1FYMA 3IL2A 1SMTA 1HKQA 5E1XA 4Q4ZF 2R3SA 5L3EA 5BS6A 2DO7A 2H27A 1B9MA 5FLXK 3HTSB 1U78A 1O3RA 1REPC 2VXZA 2D2WA 2V1XA 4Z2YA 1WSUA 2QYOA 3GWZA 4GYIA 4EGZA 1T6SA 2ZO4A 2MD5A 5D5XB 2H09A 5ICGA 1ON2A 3R6SA 1FBUA 1S3JA 3HYIA 3LWFA 5K5OA 1E2XA 1KU2A 1D8KA 2Z99A 4DNCA 1BIAA 4BAYA 2GXGA 2W85A 1J75A 3CUOA 2XASA 5J6XA 4P9FA 2PLYA 3F3XA 5D8LB 4ESFA 1IN6A 3QP5A 4IJAA 4B09A 3K2ZA 2DW4A 2HDCA 3IRQA 2WC2A 4L5JA 1HXDA 1HKTA 5KK1A 1RIOH 4HDUA 2QWWA 1XGMA 4IRHA 1TNSA 2Y0MA 5DCMA 5D4RA 3FZVA 1XMKA 1RZ4A 2RGVA 3WTXC 5E20A 4HV6A 1Z7UA 2DQRA 5JFRA 5E1WA 4OIQF 3QPHA 3WE3A 1IAWA 2UXXA 2LDUA 4WK8F 3EYIA 2Z5UA 5CYVA 3QU6A 4I7HA 3PFIA 2ZJ2A 3I64A 3K9TA 5FB2A 3I59B 1P2FA 2L02A 1LDDA 2L4AA 2BEOA 1S6LA 2W57A 2GA2A 3HSFA 2UXNA 4BQAA 4PCQA 3ROUA 1IW7F 3M9AA 4ZYEA 5K1YA 3KP5A 1I5ZA 3KZZA 5D5UB 3HOTA 2FBHA 1BIBA 2H6BA 4EJWA 2B0LA 1P4WA 3TDUC 1R5HA 1F1ZA 4CGZA 2RV8A 2ETHA 3CUQA 2Q8KA 2XAQA 4ASNA 1JHFA 1R1TA 2FOKA 4I0BA 3H3ZA 2A5YB 3ULQB 4M9XA 3FMRA 5F64A 5EEHA 3QAHA 4MEYF 2XAJA 2EA2A 1XSDA 1GHCA 2CSOA 4KMUX 1XDUA 2AS5F 2ZKZA 3TO6A 2O0YA 2J5PA 3MZHA 5LRRA 4RAYA 4LG0A 1TW2A 3B73A 3HHHA 1MD0A 4WF2A 3RTRA 4M73A 2O3FA 1QZYA 4L0ZB 4Y17A 3DPLC 4RB0A 5D6FA 4ZZDA 2LF7A 1ZLJA 3J81Z 2QBYA 4KIBA 1XD7A 1FNNA 5A2QZ 1KYZA 5D8KB 4Q47A 3RKYA 4LLNA 1FSEA 3K1PA 1Z6RA 2W24A 4ESJA 4UVBA 4EGYA 4HF2A 4ZH4F 4LK0F 2XVCA 2P4WA 1J7KA 1BI3A 1KU3A 2W25A 2HS5A 2GIVA 2VC0A 1SFXA 3REOA 3HSEA 4HX7A 2XAHA 4BYYA 1S7OA 1YS6A 3FX3A 3SQNA 2DK5A 4M9SA 2LKPA 2VBXA 2KIMA 2ACJA 2M45A 4HOBA 4I01A 4IHSA 1B59A 4M6XA 2KIUA 2WTEA 3NRVA 1SAXA 3ZPLA 3CUQC 3GUDA 4HX8A 1Z91A 5FFXA 2IPQX 2IA2A 1GXPA 3HIFA 2OAZA 2R7FA 2GQQA 4UHTA 3IKVA 1YW8A 4QWQA 4EM0B 1O7LA 3F21A 5BPDA 2ISZA 3QPTA 3D5LA 3SFZA 1FLIA 4PGGA 2NAZA 3RYPA 1YO5C 3EDPA 2IJLA 2EWNA 2OBPA 3GFIA 4LB6B 4M74A 2XGXA 1C0WA 1LNWA 1D3YA 4K2EA 3P9KA 4RB2C 2IA0A 4N9HA 2G7HA 5E17F 1I6XA 3JTGA 3GLXA 3BP8A 2QENA 2EFOA 2BGCA 2PI0A 2FA5A 2ADUA 1PUEE 4G7HF 4PZJA 1J0RA 4UV8A 4EJOA 3IC7A 4D0PA 2Q0OA 1FWZA 3WTSC 4QLCU 3EYYA 1MJBA 2V79A 3K1NA 1RUNA 5ICCA 1WI9A 3MAJA 5L3BA 3BDDA 4KYWA 2CW0F 4B8XA 1T39A 3C7JA 2QQ9A 2K27A 1HW1A 1FOKA 3J80Z 1BC8C 2FXAA 3K69A 2KJBA 4YFKF 4YG2F 4M6YA 1KU7A 3FXUA 3FMSA 3P7NA 4U88A 3NEUA 2FSWA 2MC3A 3W6JB 3ZN0A 2DTRA 5CVVA 4G8XA 5FLXZ 4G9YA 5DDGA 3TO9A 4E70A 4EJTA 1Z1DA 2IA1A 4KMFA 2IW5A 4EMSA 2K86A 2M30A 5ICEA 5DD8A 1PDNC 2EFPA 3HRTA 4OINF 4U7DA 5IT9K 1I27A 3FXRA 4Y13A 4MQVA 3CO6C 2YR2A 4CXFA 5HLGA 1MGTA 4ENJA 1BOAA 2FRHA 2BBYA 1IRGA 1EH8A 1T38A 3SXYA 4FX4A 1USTA 5TJJA 5H6RA 2BV6A 2EK5A 2V9VA 3JAMK 1Q1HA 4WXCA 1MZBA 1V4RA 3Q5FA 1GXQA 2VODA 2IT0A 2M5WA 5L3CA 1G3TA 2QQBA 2HTSA 4R1HA 3GFMA 3N4MA 3WTVC 4UXNA 4R8HA 5HLIA 3WTYC 1YTYA 2P8TA 3L2CA 3FXQA 3I54A 2L01A 4BHBA 1V3FA 1XGNA 2XIGA 1JHHA 2ZCWA 4WXDA 2DPUA 5J8CA 4HQEA 3FMQA 4LG0B 2EJRA 4R79A 3FM3A 3F8BA 1QQIA 4ZYHA 2XRNA 1OYYA 5DEQA 1CGPA 3BY6A 2FBIA 3T0YA 2HKXA 3VODA 4L9JA 3TOBA 3V4GA 2QBYB 5LEJA 1STZA 1D8JA 3FF5A 5DV5A 1BJAA 2GAUA 3HRUA 4P9UA 2CG4A 4M72A 1AOYA 3BZ6A 5FD5A 5LGUA 6PAXA 1PP8F 1KYWA 4YFNF 1YIOA 2ISYA 2L54A 3LA3A 5E8IA 2FBKA 2H6CA 2A61A 1R22A 3T1BA 3KP2A 5H20A 5DD4A 3TDZC 1W5SA 1QZZA 3WG9A 1BI0A 4WCGA 1E17A 2P7CB 4I02A 3SZPA 3DV8A 3BPXA 3H92A 4KN7X 3F6VA 4KT5C 1FYKA 5E8GA 5AONA 4A12A 1R36A 4L9VA 2VT3A 3R0JA 2VBWA 5LEKA 3IHUA 4BHPA 2O6GE 3C18A 2XV4S 4HX4A 1W7PD 3ZMVA 1H9GA 2M1BA 3O2PE 1EH7A 3T8RA 1UFMA 2UZKA 2QUFA 1MDMA 2P6SA 4I2OA 3GF2A 4XBFA 1IXCA 3LAJA 1WRJA 3NQOA 1RUOA 3GFLA 1IN4A 2F5DA 1IF1A 1IXSB 4FT8A 5K5QA 3OOPA 2P5KA 1U6GA 2ESHA 1TNTA 3CTAA 4N0BA 4A2UA 1XSVA 1FT9A 3BROA 2A3SA 3KP4A 4AIJA 5LGTA 2VN2A 4Q5SF 3I58A 5CVIA 3GYHX 3V8JA 3L9FA 1ZG3A 4GYGA 5LGNA 1DPRA 3I71A 2DT5A 2YX4A 5BQTA 2KJCA 4MTDA 3LAPA 4CYDA 5F1RA 2EV5A 4LGWA 4RAZA 3E6BA 3MQ0A 1QGPA 2QZ8A 2DAOA 1FBSA 2RC4A 1ZRCA 3HOSA 3VOEA 1TBXA 5JVTA 4RB3C 4IRIA 1SFUA 3WGIA 3KEOA 5HS9A 5E1ZB 2O03A 1YS7A 2XUBA 2XKOA 3RI4A 1SMYF 1Z05A 2JZYA 3I0TA 3GVAA 2NNNA 5LHGA 2VBYA 3R60A 1JGSA 5FFZA 1XMAA 3KE2A 2XROA 2HWVA 5AIQA 1ON1A 5LHIA 2HTJA 1XB4A 2E1CA 2A6EF 4PDKA 1SD5A 5IT3A 2YU3A 3S2WA 3L7WA 2CO5A 4ENKA 4U0YA 2ZNYA 5HS7A 3BJOA 1SD4A 3KFWX 3BOQA 2XAFA 2OD5A 5L3GA 2NNYA 2L4MA 2LSOA 3KP3A 3RKWA 1JXSA 2MLGA 1YLFA 3KZYA 2RN7A 1U8RA 3ZMUA 1TLHB 5ILUA 2QM3A 4KIFA 4GCVA 3KETA 3IWFA 2OQGA 3WTWC 1F9NA 3K0LA 3C3WA 2YPRA 5L3FA 1OKRA 5CJ9A 3GO5A 5AIPA 2EV0A 4ENNA 2Y75A 5IT9Z 3GFJA 1YQAA 3E5QA 2HZTA 1R5GA 5D5VB 1G3YA 3I53A 5ERIA 1NHAA 1X3UA 1B4AA 4LD5A 3ZP5A 4OIOF 4IXAA 5ILSA 1D5VA 3P9CA 2VC1A 4WX9A 2RVCA 2DK8A 3JAMZ 2ZFWA 3IKTA 4XSZF 3CDHA 2D45A 2G9WA 2O61A 1S8NA 4ON0A 2OZ6A 1FY7A 3H3UA 1P6RA 1LDJA 5CVUA 1W7PB 4IPAA 1UHWA 3PQKA 1W4MA 2HKOA 1BBYA 2ZBKA 1ZG5A 4RS8A 5JI6A 4HF1A 3GZ5A 1JE8A 2F5FA 4EM2A 3DKWA 3ZMZA 1RI7A 4MTEA 3P9IA 4S04A 3T8TA 2DI3A 2JPCA 3U9GA 2DLLA 1A04A 2HQRA 2ESNA 1Z6TA 2HGCA 5EEGA 2PG4A 3TOAA 1K78A 3KEQA 3WGGA 4CHUA 4BH9A 1USSA 3F6OA 3VEPA 1MDMB 5DUKA 1R1UA 3DFGA 4ZYDA 2EB7A 3MFKA 3E6MA 3TGNA 3WTZA 3HSRA 3CO7C 3E6CC 3IRRA 1ZRFA 5ED4A 2OQRA 4YFXF 3ERED 1G6NA 3WE2A 3GZ6A 1XDSA 2P5LC 1SD6A 3IWZA 4LJZF 1S7AA 4FX0A 3KCCA 5DUIA 3MZYA 2VE9A 1T2KA 4HDVA 1CF7B 3N97A 1U3EM 3O3KA 1LQ1A 2MH2A 3WTUC 1O3SA 3CJNA 2MLKA 3J7AO 1BM9A 1P92A 1L3LA 3DXJF 4FHTA 5DYMA 4RB1A 1KU9A 5D5WB 4UUVA 2PQ8A 2NYXA 3WU1B 4CDGA 2UWMA 1PP7U 1RNLA 1OMIA 2EFQA 2HEOA 2DU9A 4HZFA 3CLOA 4U0VA 1XN7A 3SHFA 1IN7A 3KLNA 4G7ZF 3Q9SA 5LRSA 1B6AA 4RGUA 4L18B 3DP7A 4AVPA 4OIRF 2H94A 2DQLA 3BWGA 1YYVA 3LQQA 4HF0A 2STWA 1YW7A 1QPMA 4WXHA 2YX7A 1I1GA 3HTUA 2V1DA 3LQRA 1GVJA 2FE3A 1XSXA 2F2EA 5J8FA 4G7OF 2PFBA 5JR3A 1R23A 2R7DA 3KP7A 4TV7A 4AWXB 4KUMA 1FC3A 3TKYA 3RIRA 1ZGAA 3Q9VA 4HA8A 3BJ6A 4U0WA 2F5EA 3GW2A 4HLYA 4AIKA 3U1DA 1R58A 5HDKA 3W6KB 4JBAA 3GX4X 3ABUA 3ZQ7A 4XLPF 1YW9A 2HFHA 2P5VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZNZ A;  2C6Y A;  1OR7 A;  1W7P A;  3GXO A;  1Y0U A;  3LA7 A;  4A0Y A;  4M9Z A;  1R00 A;  3G73 A;  1ZHF A;  1FBQ A;  2M87 A;  1ODD A;  4KDP A;  4ENM A;  4PGH A;  2VBZ A;  1KQ9 A;  1LJ9 A;  4CZZ A;  4JQF A;  1HSJ A;  3DQV C;  4KA4 A;  5LHH A;  1ZG1 A;  3EET A;  1U2W A;  4P5O A;  4LLG F;  1HKS A;  4HW0 A;  2FU4 A;  3RKX A;  3JSO A;  2NRA C;  1IN8 A;  2X4H A;  2RDP A;  2HOE A;  1XGO A;  1OYW A;  2COM A;  1ZRD A;  3DPT A;  3F23 A;  3BPV A;  4AIH A;  1WKM A;  4NQW A;  2KRF A;  4EV0 A;  3M8E A;  4L9T A;  5KVR A;  4IF4 A;  4UNO A;  2FML A;  2QLZ A;  3RDI A;  3EQL F;  1R7J A;  4L9N A;  4MNU A;  5BOX A;  2FMY A;  3U2R A;  5FO5 A;  2VE8 A;  4OU0 A;  1TQI A;  3V7C A;  2A68 F;  3ZMT A;  2ZXJ A;  1OPC A;  3DEU A;  3T5X A;  4MQ9 F;  3F8M A;  4OMY A;  1G4D A;  3RJP A;  2ZME A;  3TQN A;  1CF7 A;  1FP1 D;  3M8F A;  3R4K A;  4BHC A;  2IVM A;  4GXO A;  3WGH A;  2D1V A;  1ZLK A;  4LFU A;  4I0A A;  4U7B A;  2CYY A;  3FHZ A;  1B9N A;  3K1M A;  1U5T B;  1IRF A;  1AWC A;  1WWX A;  5F6F A;  2EA4 A;  4P96 A;  3EUH A;  3L00 A;  2TDX A;  2GZW A;  2LNB A;  2K02 A;  2X0L A;  4KIG A;  3QP6 A;  1XCB A;  2CQK A;  3WU0 A;  4LK1 F;  2WWY A;  3RPQ A;  2Z9O A;  5LBQ A;  2V1U A;  4LB5 A;  5E18 F;  2MA3 A;  1K78 B;  4IVN A;  2L3D A;  3OV8 A;  2BE5 F;  1MJA A;  2QQA A;  3V8L A;  2RQP A;  2Y48 A;  2EFW A;  2PEX A;  4O3M A;  1QNT A;  4HV5 A;  3E5U A;  3F8F A;  3V8K A;  3FM5 A;  3E97 A;  2XHK A;  2GWR A;  4RGX A;  3JSP A;  4RGR A;  3RPU A;  1FYL A;  3LA2 A;  5BPI A;  1TQM A;  2WV0 A;  2STT A;  3M7G A;  3ZMD A;  4UVA A;  4ZYG A;  3ISP A;  1T98 A;  3F8C A;  3LFK A;  3JW4 A;  1IXR C;  4OOI A;  3TO7 A;  1LB2 A;  3HRS A;  3AAF A;  2D1H A;  2E7X A;  2VT2 A;  2OU2 A;  2DPD A;  1IZ1 A;  2OZU A;  2FNP A;  1L0O C;  3R0A A;  3M1E A;  1ZGJ A;  5TRD A;  1OYI A;  3R61 A;  4BNC A;  1B1B A;  3ECO A;  2JT1 A;  1J5Y A;  2KIF A;  3KP6 A;  1HQC A;  1BI1 A;  4IHT A;  4NHJ A;  1O7F A;  1F5T A;  1G3W A;  2K4J A;  4GO1 A;  1P4A A;  1EV7 A;  5LLQ A;  2HR3 A;  1ZN2 A;  3I4P A;  4O5V A;  2ELH A;  5HLH A;  1QO0 D;  1W5T A;  1K6O A;  2GA1 A;  5HDG A;  4A0X A;  1TTY A;  5FD6 A;  1HW2 A;  3ZN1 A;  4KIC A;  3JTH A;  3O6B B;  4A6D A;  3DF8 A;  1YG2 A;  4KNY A;  2PMU A;  4Y15 A;  2Z3Y A;  2O8X A;  1UB9 A;  1O3Q A;  2LF8 A;  4G94 A;  1BC7 C;  1DUX C;  4HAM A;  4KN4 X;  3LST A;  1P4X A;  1ZAR A;  1R1V A;  2OA4 A;  4XLN F;  5ILV A;  2RNJ A;  4NB5 A;  4P55 A;  4OIP F;  1ONV A;  4UVC A;  3V7R A;  2V6C A;  1DPU A;  2EV6 A;  1FSH A;  1VTN C;  1FZP B;  1HST A;  4UV9 A;  4MGR A;  5H6Q A;  2MH9 A;  4HBL A;  1UCR A;  2W84 A;  5HS8 A;  1KGS A;  3E6D A;  2FEZ A;  4IRG A;  2E1N A;  3KLO A;  3F22 A;  2K7L A;  5CVR A;  3VB2 A;  4XSX F;  1LDK B;  2YSR A;  4G6Q A;  2RKH A;  5DCF A;  3ELK A;  3QU3 A;  1H0M A;  1BI2 A;  1O3T A;  1HW5 A;  2HYF A;  4A5M A;  4HYE A;  4I98 B;  4EQQ A;  4M71 A;  2VON A;  1T0F A;  3QRF F;  4ETS A;  1LEB A;  3L09 A;  1ZH5 A;  1U5T A;  3MEX A;  2IRF G;  2A07 F;  2XKP A;  3ML6 A;  5D4S A;  3I59 A;  4YIF A;  1YFH A;  2A6H F;  1EH6 A;  2K4B A;  2FF4 A;  3WTT C;  5HDN A;  4A6E A;  2PMH A;  3J81 K;  3GEZ A;  3WOD F;  3ZMS A;  1O57 A;  4HLX A;  4OMZ A;  5A2Q K;  5HVQ C;  1XCV A;  2QVO A;  4A0Z A;  1WQ2 A;  4JK1 X;  2P6T A;  2DFI A;  1MJ9 A;  4XRF A;  2VOP A;  4H0E A;  4ZZL A;  1FP2 A;  2Q2E A;  3VFZ A;  1ZAO A;  3D0S A;  4DQ2 A;  2NS0 A;  5D6E A;  4GGG A;  4MEX F;  5CLS A;  1S29 A;  1QBJ A;  2J5O A;  2AXL A;  5JHU A;  1TQP A;  3HHG A;  4CIC A;  5DCM B;  2A69 F;  4EJU A;  1J2X A;  3V7S A;  1SD7 A;  3B02 A;  2G7U A;  5BMZ A;  2E7W A;  1XGS A;  3SZT A;  4RGS A;  1K79 A;  4AD9 A;  2ZME B;  1MKM A;  2PBI A;  1BN5 A;  3HUG A;  4EM1 A;  4O6J A;  1FX7 A;  2F5C A;  2M8E A;  3FWE A;  1Z9C A;  2KKO A;  4WWC A;  1LEA A;  3COA C;  2FNA A;  2VOO A;  1DDN A;  4BXU A;  3F72 A;  4N9I A;  2P7V B;  4F7Z A;  4G6D A;  3MWM A;  3MCZ A;  3E3V A;  2JTV A;  2JRT A;  5K5R A;  3HRM A;  1U5T C;  4A5N A;  4I09 A;  4CO8 A;  4L0Y B;  1G3S A;  2DBB A;  2HQN A;  3G3Z A;  1FPQ A;  1IN5 A;  3CUQ B;  1TW3 A;  1HBX G;  1KA8 A;  4KFC A;  2BYV E;  4LLL A;  4HQM A;  1ZYR F;  1I1S A;  1SFE A;  4MHG A;  5HOO A;  1J59 A;  2XAG A;  1K7A A;  3BJA A;  4YII A;  5FGM A;  4L5I A;  2GXB A;  4Q48 A;  1ULY A;  4EVI A;  2Z33 A;  2FQ3 A;  1F4K A;  1ZRE A;  3PQJ A;  1IUY A;  4EJV A;  2IP2 A;  3E5X A;  2PN6 A;  1H9T A;  3ABT A;  5ICF A;  2JPB A;  1KQ8 A;  2EFN A;  1J9I A;  3C1D A;  1KQ0 A;  1DP7 P;  1UHM A;  4ESB A;  3QOP A;  2CWE A;  1LVA A;  2CFX A;  4S05 A;  3I5U A;  2MBF A;  2PJP A;  3F8N A;  3ECH A;  2JSC A;  5CVJ A;  4LMY A;  5L3D A;  3RYR A;  3J80 K;  2HYG D;  2CGP A;  1FYM A;  3IL2 A;  1SMT A;  1HKQ A;  5E1X A;  4Q4Z F;  2R3S A;  5L3E A;  5BS6 A;  2DO7 A;  2H27 A;  1B9M A;  5FLX K;  3HTS B;  1U78 A;  1O3R A;  1REP C;  2VXZ A;  2D2W A;  2V1X A;  4Z2Y A;  1WSU A;  2QYO A;  3GWZ A;  4GYI A;  4EGZ A;  1T6S A;  2ZO4 A;  2MD5 A;  5D5X B;  2H09 A;  5ICG A;  1ON2 A;  3R6S A;  1FBU A;  1S3J A;  3HYI A;  3LWF A;  5K5O A;  1E2X A;  1KU2 A;  1D8K A;  2Z99 A;  4DNC A;  1BIA A;  4BAY A;  2GXG A;  2W85 A;  1J75 A;  3CUO A;  2XAS A;  5J6X A;  4P9F A;  2PLY A;  3F3X A;  5D8L B;  4ESF A;  1IN6 A;  3QP5 A;  4IJA A;  4B09 A;  3K2Z A;  2DW4 A;  2HDC A;  3IRQ A;  2WC2 A;  4L5J A;  1HXD A;  1HKT A;  5KK1 A;  1RIO H;  4HDU A;  2QWW A;  1XGM A;  4IRH A;  1TNS A;  2Y0M A;  5DCM A;  5D4R A;  3FZV A;  1XMK A;  1RZ4 A;  2RGV A;  3WTX C;  5E20 A;  4HV6 A;  1Z7U A;  2DQR A;  5JFR A;  5E1W A;  4OIQ F;  3QPH A;  3WE3 A;  1IAW A;  2UXX A;  2LDU A;  4WK8 F;  3EYI A;  2Z5U A;  5CYV A;  3QU6 A;  4I7H A;  3PFI A;  2ZJ2 A;  3I64 A;  3K9T A;  5FB2 A;  3I59 B;  1P2F A;  2L02 A;  1LDD A;  2L4A A;  2BEO A;  1S6L A;  2W57 A;  2GA2 A;  3HSF A;  2UXN A;  4BQA A;  4PCQ A;  3ROU A;  1IW7 F;  3M9A A;  4ZYE A;  5K1Y A;  3KP5 A;  1I5Z A;  3KZZ A;  5D5U B;  3HOT A;  2FBH A;  1BIB A;  2H6B A;  4EJW A;  2B0L A;  1P4W A;  3TDU C;  1R5H A;  1F1Z A;  4CGZ A;  2RV8 A;  2ETH A;  3CUQ A;  2Q8K A;  2XAQ A;  4ASN A;  1JHF A;  1R1T A;  2FOK A;  4I0B A;  3H3Z A;  2A5Y B;  3ULQ B;  4M9X A;  3FMR A;  5F64 A;  5EEH A;  3QAH A;  4MEY F;  2XAJ A;  2EA2 A;  1XSD A;  1GHC A;  2CSO A;  4KMU X;  1XDU A;  2AS5 F;  2ZKZ A;  3TO6 A;  2O0Y A;  2J5P A;  3MZH A;  5LRR A;  4RAY A;  4LG0 A;  1TW2 A;  3B73 A;  3HHH A;  1MD0 A;  4WF2 A;  3RTR A;  4M73 A;  2O3F A;  1QZY A;  4L0Z B;  4Y17 A;  3DPL C;  4RB0 A;  5D6F A;  4ZZD A;  2LF7 A;  1ZLJ A;  3J81 Z;  2QBY A;  4KIB A;  1XD7 A;  1FNN A;  5A2Q Z;  1KYZ A;  5D8K B;  4Q47 A;  3RKY A;  4LLN A;  1FSE A;  3K1P A;  1Z6R A;  2W24 A;  4ESJ A;  4UVB A;  4EGY A;  4HF2 A;  4ZH4 F;  4LK0 F;  2XVC A;  2P4W A;  1J7K A;  1BI3 A;  1KU3 A;  2W25 A;  2HS5 A;  2GIV A;  2VC0 A;  1SFX A;  3REO A;  3HSE A;  4HX7 A;  2XAH A;  4BYY A;  1S7O A;  1YS6 A;  3FX3 A;  3SQN A;  2DK5 A;  4M9S A;  2LKP A;  2VBX A;  2KIM A;  2ACJ A;  2M45 A;  4HOB A;  4I01 A;  4IHS A;  1B59 A;  4M6X A;  2KIU A;  2WTE A;  3NRV A;  1SAX A;  3ZPL A;  3CUQ C;  3GUD A;  4HX8 A;  1Z91 A;  5FFX A;  2IPQ X;  2IA2 A;  1GXP A;  3HIF A;  2OAZ A;  2R7F A;  2GQQ A;  4UHT A;  3IKV A;  1YW8 A;  4QWQ A;  4EM0 B;  1O7L A;  3F21 A;  5BPD A;  2ISZ A;  3QPT A;  3D5L A;  3SFZ A;  1FLI A;  4PGG A;  2NAZ A;  3RYP A;  1YO5 C;  3EDP A;  2IJL A;  2EWN A;  2OBP A;  3GFI A;  4LB6 B;  4M74 A;  2XGX A;  1C0W A;  1LNW A;  1D3Y A;  4K2E A;  3P9K A;  4RB2 C;  2IA0 A;  4N9H A;  2G7H A;  5E17 F;  1I6X A;  3JTG A;  3GLX A;  3BP8 A;  2QEN A;  2EFO A;  2BGC A;  2PI0 A;  2FA5 A;  2ADU A;  1PUE E;  4G7H F;  4PZJ A;  1J0R A;  4UV8 A;  4EJO A;  3IC7 A;  4D0P A;  2Q0O A;  1FWZ A;  3WTS C;  4QLC U;  3EYY A;  1MJB A;  2V79 A;  3K1N A;  1RUN A;  5ICC A;  1WI9 A;  3MAJ A;  5L3B A;  3BDD A;  4KYW A;  2CW0 F;  4B8X A;  1T39 A;  3C7J A;  2QQ9 A;  2K27 A;  1HW1 A;  1FOK A;  3J80 Z;  1BC8 C;  2FXA A;  3K69 A;  2KJB A;  4YFK F;  4YG2 F;  4M6Y A;  1KU7 A;  3FXU A;  3FMS A;  3P7N A;  4U88 A;  3NEU A;  2FSW A;  2MC3 A;  3W6J B;  3ZN0 A;  2DTR A;  5CVV A;  4G8X A;  5FLX Z;  4G9Y A;  5DDG A;  3TO9 A;  4E70 A;  4EJT A;  1Z1D A;  2IA1 A;  4KMF A;  2IW5 A;  4EMS A;  2K86 A;  2M30 A;  5ICE A;  5DD8 A;  1PDN C;  2EFP A;  3HRT A;  4OIN F;  4U7D A;  5IT9 K;  1I27 A;  3FXR A;  4Y13 A;  4MQV A;  3CO6 C;  2YR2 A;  4CXF A;  5HLG A;  1MGT A;  4ENJ A;  1BOA A;  2FRH A;  2BBY A;  1IRG A;  1EH8 A;  1T38 A;  3SXY A;  4FX4 A;  1UST A;  5TJJ A;  5H6R A;  2BV6 A;  2EK5 A;  2V9V A;  3JAM K;  1Q1H A;  4WXC A;  1MZB A;  1V4R A;  3Q5F A;  1GXQ A;  2VOD A;  2IT0 A;  2M5W A;  5L3C A;  1G3T A;  2QQB A;  2HTS A;  4R1H A;  3GFM A;  3N4M A;  3WTV C;  4UXN A;  4R8H A;  5HLI A;  3WTY C;  1YTY A;  2P8T A;  3L2C A;  3FXQ A;  3I54 A;  2L01 A;  4BHB A;  1V3F A;  1XGN A;  2XIG A;  1JHH A;  2ZCW A;  4WXD A;  2DPU A;  5J8C A;  4HQE A;  3FMQ A;  4LG0 B;  2EJR A;  4R79 A;  3FM3 A;  3F8B A;  1QQI A;  4ZYH A;  2XRN A;  1OYY A;  5DEQ A;  1CGP A;  3BY6 A;  2FBI A;  3T0Y A;  2HKX A;  3VOD A;  4L9J A;  3TOB A;  3V4G A;  2QBY B;  5LEJ A;  1STZ A;  1D8J A;  3FF5 A;  5DV5 A;  1BJA A;  2GAU A;  3HRU A;  4P9U A;  2CG4 A;  4M72 A;  1AOY A;  3BZ6 A;  5FD5 A;  5LGU A;  6PAX A;  1PP8 F;  1KYW A;  4YFN F;  1YIO A;  2ISY A;  2L54 A;  3LA3 A;  5E8I A;  2FBK A;  2H6C A;  2A61 A;  1R22 A;  3T1B A;  3KP2 A;  5H20 A;  5DD4 A;  3TDZ C;  1W5S A;  1QZZ A;  3WG9 A;  1BI0 A;  4WCG A;  1E17 A;  2P7C B;  4I02 A;  3SZP A;  3DV8 A;  3BPX A;  3H92 A;  4KN7 X;  3F6V A;  4KT5 C;  1FYK A;  5E8G A;  5AON A;  4A12 A;  1R36 A;  4L9V A;  2VT3 A;  3R0J A;  2VBW A;  5LEK A;  3IHU A;  4BHP A;  2O6G E;  3C18 A;  2XV4 S;  4HX4 A;  1W7P D;  3ZMV A;  1H9G A;  2M1B A;  3O2P E;  1EH7 A;  3T8R A;  1UFM A;  2UZK A;  2QUF A;  1MDM A;  2P6S A;  4I2O A;  3GF2 A;  4XBF A;  1IXC A;  3LAJ A;  1WRJ A;  3NQO A;  1RUO A;  3GFL A;  1IN4 A;  2F5D A;  1IF1 A;  1IXS B;  4FT8 A;  5K5Q A;  3OOP A;  2P5K A;  1U6G A;  2ESH A;  1TNT A;  3CTA A;  4N0B A;  4A2U A;  1XSV A;  1FT9 A;  3BRO A;  2A3S A;  3KP4 A;  4AIJ A;  5LGT A;  2VN2 A;  4Q5S F;  3I58 A;  5CVI A;  3GYH X;  3V8J A;  3L9F A;  1ZG3 A;  4GYG A;  5LGN A;  1DPR A;  3I71 A;  2DT5 A;  2YX4 A;  5BQT A;  2KJC A;  4MTD A;  3LAP A;  4CYD A;  5F1R A;  2EV5 A;  4LGW A;  4RAZ A;  3E6B A;  3MQ0 A;  1QGP A;  2QZ8 A;  2DAO A;  1FBS A;  2RC4 A;  1ZRC A;  3HOS A;  3VOE A;  1TBX A;  5JVT A;  4RB3 C;  4IRI A;  1SFU A;  3WGI A;  3KEO A;  5HS9 A;  5E1Z B;  2O03 A;  1YS7 A;  2XUB A;  2XKO A;  3RI4 A;  1SMY F;  1Z05 A;  2JZY A;  3I0T A;  3GVA A;  2NNN A;  5LHG A;  2VBY A;  3R60 A;  1JGS A;  5FFZ A;  1XMA A;  3KE2 A;  2XRO A;  2HWV A;  5AIQ A;  1ON1 A;  5LHI A;  2HTJ A;  1XB4 A;  2E1C A;  2A6E F;  4PDK A;  1SD5 A;  5IT3 A;  2YU3 A;  3S2W A;  3L7W A;  2CO5 A;  4ENK A;  4U0Y A;  2ZNY A;  5HS7 A;  3BJO A;  1SD4 A;  3KFW X;  3BOQ A;  2XAF A;  2OD5 A;  5L3G A;  2NNY A;  2L4M A;  2LSO A;  3KP3 A;  3RKW A;  1JXS A;  2MLG A;  1YLF A;  3KZY A;  2RN7 A;  1U8R A;  3ZMU A;  1TLH B;  5ILU A;  2QM3 A;  4KIF A;  4GCV A;  3KET A;  3IWF A;  2OQG A;  3WTW C;  1F9N A;  3K0L A;  3C3W A;  2YPR A;  5L3F A;  1OKR A;  5CJ9 A;  3GO5 A;  5AIP A;  2EV0 A;  4ENN A;  2Y75 A;  5IT9 Z;  3GFJ A;  1YQA A;  3E5Q A;  2HZT A;  1R5G A;  5D5V B;  1G3Y A;  3I53 A;  5ERI A;  1NHA A;  1X3U A;  1B4A A;  4LD5 A;  3ZP5 A;  4OIO F;  4IXA A;  5ILS A;  1D5V A;  3P9C A;  2VC1 A;  4WX9 A;  2RVC A;  2DK8 A;  3JAM Z;  2ZFW A;  3IKT A;  4XSZ F;  3CDH A;  2D45 A;  2G9W A;  2O61 A;  1S8N A;  4ON0 A;  2OZ6 A;  1FY7 A;  3H3U A;  1P6R A;  1LDJ A;  5CVU A;  1W7P B;  4IPA A;  1UHW A;  3PQK A;  1W4M A;  2HKO A;  1BBY A;  2ZBK A;  1ZG5 A;  4RS8 A;  5JI6 A;  4HF1 A;  3GZ5 A;  1JE8 A;  2F5F A;  4EM2 A;  3DKW A;  3ZMZ A;  1RI7 A;  4MTE A;  3P9I A;  4S04 A;  3T8T A;  2DI3 A;  2JPC A;  3U9G A;  2DLL A;  1A04 A;  2HQR A;  2ESN A;  1Z6T A;  2HGC A;  5EEG A;  2PG4 A;  3TOA A;  1K78 A;  3KEQ A;  3WGG A;  4CHU A;  4BH9 A;  1USS A;  3F6O A;  3VEP A;  1MDM B;  5DUK A;  1R1U A;  3DFG A;  4ZYD A;  2EB7 A;  3MFK A;  3E6M A;  3TGN A;  3WTZ A;  3HSR A;  3CO7 C;  3E6C C;  3IRR A;  1ZRF A;  5ED4 A;  2OQR A;  4YFX F;  3ERE D;  1G6N A;  3WE2 A;  3GZ6 A;  1XDS A;  2P5L C;  1SD6 A;  3IWZ A;  4LJZ F;  1S7A A;  4FX0 A;  3KCC A;  5DUI A;  3MZY A;  2VE9 A;  1T2K A;  4HDV A;  1CF7 B;  3N97 A;  1U3E M;  3O3K A;  1LQ1 A;  2MH2 A;  3WTU C;  1O3S A;  3CJN A;  2MLK A;  3J7A O;  1BM9 A;  1P92 A;  1L3L A;  3DXJ F;  4FHT A;  5DYM A;  4RB1 A;  1KU9 A;  5D5W B;  4UUV A;  2PQ8 A;  2NYX A;  3WU1 B;  4CDG A;  2UWM A;  1PP7 U;  1RNL A;  1OMI A;  2EFQ A;  2HEO A;  2DU9 A;  4HZF A;  3CLO A;  4U0V A;  1XN7 A;  3SHF A;  1IN7 A;  3KLN A;  4G7Z F;  3Q9S A;  5LRS A;  1B6A A;  4RGU A;  4L18 B;  3DP7 A;  4AVP A;  4OIR F;  2H94 A;  2DQL A;  3BWG A;  1YYV A;  3LQQ A;  4HF0 A;  2STW A;  1YW7 A;  1QPM A;  4WXH A;  2YX7 A;  1I1G A;  3HTU A;  2V1D A;  3LQR A;  1GVJ A;  2FE3 A;  1XSX A;  2F2E A;  5J8F A;  4G7O F;  2PFB A;  5JR3 A;  1R23 A;  2R7D A;  3KP7 A;  4TV7 A;  4AWX B;  4KUM A;  1FC3 A;  3TKY A;  3RIR A;  1ZGA A;  3Q9V A;  4HA8 A;  3BJ6 A;  4U0W A;  2F5E A;  3GW2 A;  4HLY A;  4AIK A;  3U1D A;  1R58 A;  5HDK A;  3W6K B;  4JBA A;  3GX4 X;  3ABU A;  3ZQ7 A;  4XLP F;  1YW9 A;  2HFH A;  2P5V A; 
#chains in the Genus database with same CATH topology
 3BZC A;  5E3N A;  4E7K A;  2ZNZ A;  3PUB A;  3U1K A;  2E5N A;  2C6Y A;  1OR7 A;  1W7P A;  2HZD A;  3GXO A;  3NWS A;  1Y0U A;  2W1O A;  3LA7 A;  4A0Y A;  5IY5 H;  5TIS C;  4C2U A;  3JRC A;  1TWC J;  4M9Z A;  1OCC H;  1R00 A;  3G73 A;  4PJM A;  4KIS A;  2BVM A;  3H5N A;  3PSI A;  1ZHF A;  1FBQ A;  1WH5 A;  2M87 A;  1YRN B;  3HEF A;  2AXT C;  3GLL A;  3L2V A;  1ODD A;  2LR8 A;  2MFZ A;  4KDP A;  4ENM A;  4PGH A;  2VBZ A;  5B66 C;  4M3E A;  2FOW A;  1KQ9 A;  1UAA A;  4V2G A;  1LJ9 A;  2IEK A;  1LE8 B;  4CZZ A;  4JQF A;  1HSJ A;  3DQV C;  2CW8 A;  1TT0 A;  1FTT A;  3JRI A;  1GVD A;  3CCV I;  4KA4 A;  5LHH A;  2K85 A;  3MVP A;  1V55 H;  1ZG1 A;  3EET A;  1U2W A;  4J01 A;  3FKI J;  4P5O A;  3W2V A;  2E1M B;  4LLG F;  4ZDL A;  1HKS A;  4UUS A;  3QPS A;  2X1E A;  3EUK L;  1J09 A;  3ZXS A;  2GXA A;  2IAI A;  4HW0 A;  2FU4 A;  3DTE A;  1YE9 A;  1A6Q A;  1D0Y A;  5HOD A;  2WB1 A;  3RKX A;  1XPX A;  5J3L A;  1ITY A;  1WCM J;  3JSO A;  4ZYA A;  2NRA C;  1RRJ A;  1IN8 A;  2X4H A;  2X1C A;  2RDP A;  2HOE A;  1XGO A;  1X1D A;  1OYW A;  2COM A;  2DA6 A;  1ZRD A;  3DPT A;  3F23 A;  3BPV A;  1MMG A;  5IYB J;  4AIH A;  3CME I;  4QPQ A;  1I3Q J;  4DJA A;  1WKM A;  5FKK A;  4NQW A;  2KRF A;  4EV0 A;  2L0K A;  3ASN H;  2EIL H;  3CP8 A;  1JUS A;  3M8E A;  4L9T A;  5KVR A;  4IF4 A;  4ZC3 A;  2V7F A;  4UNO A;  2FML A;  3OR2 C;  2QLZ A;  3RDI A;  1EA3 A;  1R7J A;  3EQL F;  1JUP A;  4XQF A;  4L9N A;  4BAC A;  4MNU A;  2R92 J;  5BOX A;  2FMY A;  2FJ1 A;  4QSH A;  5CKT A;  3BCB A;  3U2R A;  4A3K J;  3K4K A;  4FQG A;  3BG7 A;  5FO5 A;  2VE8 A;  4OU0 A;  1TQI A;  2ME6 A;  5JLX A;  1NTC A;  2G0E A;  3V7C A;  2A68 F;  2QKM B;  4XLA A;  3K70 C;  3ZMT A;  2ZXJ A;  3CMM A;  2ICW G;  1OPC A;  2LY9 A;  3P5J A;  3FBI B;  3DEU A;  3T5X A;  4MQ9 F;  3F8M A;  5EF6 A;  2ME0 A;  4OMY A;  4E7S A;  1G4D A;  3PNV A;  4PFP A;  3RJP A;  4B4C A;  2ZME A;  3TQN A;  1CF7 A;  5M5Y J;  4BKX A;  1FP1 D;  3A03 A;  3M8F A;  3OR1 C;  1SAU A;  3R4K A;  4BHC A;  3H1C A;  2JUG A;  4OWR B;  2IVM A;  4GXO A;  1A6I A;  3WGH A;  2D1V A;  1ZLK A;  1WZ2 A;  2LVS A;  4I0A A;  4LFU A;  4U7B A;  2CYY A;  3FHZ A;  1B9N A;  5KCM A;  2L9R A;  3K1M A;  1ETY A;  1U5T B;  1ZR4 A;  3TP3 A;  1D1B A;  3HOV J;  2WBM A;  1IRF A;  3BQZ A;  1AWC A;  4BU2 A;  1OCT C;  1WWX A;  3TMO A;  5F6F A;  1HCR A;  1ZEL A;  2EA4 A;  1OR7 C;  1LPQ A;  1O4X A;  1FOX A;  4P96 A;  1GLN A;  4DZP A;  3EUH A;  2VQH A;  3L00 A;  1A35 A;  4YEL A;  1ETV A;  2TDX A;  2W4S A;  2GZW A;  2LNB A;  2K02 A;  1SEU A;  3AL0 B;  1K83 J;  4NBQ A;  2X0L A;  4KIG A;  3OYI A;  4C2M J;  3QP6 A;  2QSF X;  3L2Q A;  1XCB A;  2CQK A;  3WU0 A;  2E1O A;  3BCA A;  1OJL A;  4LK1 F;  2WWY A;  3OYD A;  3FXM A;  3RPQ A;  3CCS I;  2Z9O A;  5LBQ A;  2V1U A;  4LB5 A;  5E18 F;  2MA3 A;  1K78 B;  1X1B A;  4IVN A;  2Q2E B;  2L3D A;  3OV8 A;  2BHY A;  2JA2 A;  5M5W J;  3X2Q H;  2H8R A;  2BE5 F;  4M3G A;  1MJA A;  4NC8 A;  2QQA A;  4FIS A;  4HSR A;  3V8L A;  2EBI A;  2RQP A;  2Y48 A;  2EFW A;  2PEX A;  4O3M A;  1IDY A;  1QNT A;  3DBH B;  4HV5 A;  3E5U A;  3F8F A;  2KP6 A;  3V8K A;  3FM5 A;  3E97 A;  2XHK A;  2GWR A;  4RGX A;  3NWT A;  3JSP A;  4RGR A;  2NOG A;  3UKG A;  2BOL A;  1GV2 A;  1Y39 A;  3RPU A;  1FYL A;  3LA2 A;  3ZQF A;  5BPI A;  1TQM A;  2WV0 A;  2ZFU A;  2STT A;  3M7G A;  2FUG 2;  3ZMD A;  4UVA A;  3HGY A;  4ZYG A;  3I9V 2;  3ISP A;  1T98 A;  2VXD A;  3F8C A;  4A3M J;  3UR3 C;  3LFK A;  2XPV A;  3JW4 A;  1IXR C;  3K6G A;  4OOI A;  4XON A;  3TO7 A;  2LTP A;  1LB2 A;  2DMT A;  3HRS A;  5M3M J;  3AAF A;  2DJI A;  1VQ8 I;  1ACI A;  2DDA A;  2D1H A;  4BJ6 C;  2E7X A;  2VT2 A;  3PO2 J;  3VSK A;  2OU2 A;  2DPD A;  3HDD A;  1IZ1 A;  1MMD A;  3L2U A;  2OZU A;  2FNP A;  1L0O C;  4UB6 C;  4ZDO A;  3R0A A;  2LLK A;  3M1E A;  3G6E I;  1ZGJ A;  5TRD A;  3DLA A;  1OYI A;  3R61 A;  4BNC A;  1B1B A;  2O5R A;  2OCE A;  2JT1 A;  2ZME C;  3ECO A;  4IOC F;  3KX2 A;  1IDZ A;  1BR4 A;  1J5Y A;  2KIF A;  5KAI C;  3KP6 A;  1HQC A;  3V42 A;  2WAQ N;  5E79 C;  1ZK8 A;  4BDY A;  1BI1 A;  4IHT A;  4NHJ A;  1O7F A;  2HVR A;  3ZQC A;  3S2H J;  1F5T A;  1G3W A;  3S1M J;  2K4J A;  1UEL B;  4GO1 A;  1P4A A;  4E4H A;  1EV7 A;  5LLQ A;  1RPW A;  2L7K A;  3OYN A;  2GM4 A;  2HR3 A;  1ZN2 A;  1MBG A;  3I4P A;  4O5V A;  4RMN A;  2DA1 A;  2ELH A;  4BUP A;  3DLL F;  3M8J A;  5HLH A;  2LD5 A;  1DU0 A;  1QO0 D;  1W5T A;  2QKL B;  2XPW A;  2EQR A;  2W7N A;  1RR7 A;  1K6O A;  2GA1 A;  5HDG A;  5C3E J;  3EUH C;  1DGW Y;  4A0X A;  2EIK H;  2DA4 A;  1TTY A;  5FD6 A;  1HW2 A;  1FTZ A;  4FE4 A;  3VYT B;  5FLM J;  1D0Z A;  3ZN1 A;  4KIC A;  3Q3S A;  2DYS H;  1ZQ3 P;  3JTH A;  1Z77 A;  3F0C A;  3O6B B;  2DA3 A;  4A6D A;  1R49 A;  3DF8 A;  1YG2 A;  2KRH A;  3ESW B;  1LE8 A;  4KNY A;  2PMU A;  4YRV A;  2NOJ B;  1FIA A;  1YJ9 I;  4Y15 A;  2Z3Y A;  2R7R A;  2O8X A;  1UB9 A;  1O3Q A;  2LF8 A;  5B1B H;  2OJE D;  1KON A;  4G94 A;  1BC7 C;  2XSJ C;  1E3O C;  1VQO I;  1DUX C;  4HAM A;  3KYC B;  5B3S H;  1D1C A;  4KN4 X;  1BW5 A;  1Z67 A;  3LST A;  1P4X A;  1ZAR A;  1R1V A;  2OA4 A;  5FKO A;  4XLN F;  5ILV A;  2RNJ A;  2WV1 A;  4NB5 A;  1IUF A;  4D7N A;  2IGO A;  4P55 A;  3Q0W A;  3OYA A;  4OIP F;  4BXX J;  1ONV A;  3L1P A;  4UVC A;  3V7R A;  2M7B A;  2V6C A;  4XOT A;  3CCE I;  1DPU A;  2EV6 A;  1FSH A;  3ZQG A;  1LVK A;  1VTN C;  1FZP B;  1OCO H;  1HST A;  3ZQI A;  1OFC X;  4GRI A;  4PJJ A;  1P7I A;  5F08 A;  4BJ5 C;  4UV9 A;  4MGR A;  2LK2 A;  2MH9 A;  1OCP A;  4HBL A;  5H6Q A;  2X6O A;  1UCR A;  4H4K C;  2QA4 I;  1X2M A;  3CMA I;  2W84 A;  5HS8 A;  4XLE A;  1KGS A;  1Z21 A;  4A3C J;  3E6D A;  2FEZ A;  4IRG A;  4HST A;  3SEZ A;  2E1N A;  3KLO A;  3RZO J;  2NVU B;  1RET A;  2K7L A;  3F22 A;  1WGX A;  5CVR A;  3VB2 A;  4XSX F;  1HDP A;  5C44 J;  4A3L J;  1LDK B;  2YSR A;  4G6Q A;  2RKH A;  5DCF A;  3ELK A;  2JA6 J;  2BY0 A;  3QU3 A;  1F43 A;  1XMX A;  1SVM A;  1W0T A;  1H0M A;  1BI2 A;  1W36 C;  4X0G A;  1MBF A;  3UNG C;  1O3T A;  3CCU I;  1HW5 A;  2LKX A;  2HYF A;  4A5M A;  3OYK A;  3IP4 B;  3FBN B;  4HYE A;  4I98 B;  3H36 A;  3MKY B;  4EQQ A;  2COB A;  4FTH A;  4M71 A;  2VON A;  1T0F A;  5HNH A;  3A1Y A;  3QRF F;  4ETS A;  2RRE A;  5LFA A;  1LEB A;  2DA7 A;  2GIZ A;  3L09 A;  1ZH5 A;  3G2B A;  1U5T A;  1H8A C;  3TBI A;  1R4N B;  3ABL H;  4IL6 C;  3MEX A;  2IRF G;  2YS9 A;  2Y0S A;  2A07 F;  2XKP A;  1WH7 A;  2JK3 A;  2R7Q A;  3I59 A;  3ML6 A;  5D4S A;  4YIF A;  3H0D A;  1YFH A;  1U0J A;  2A6H F;  3DEW A;  4C3J J;  4BQO A;  1EH6 A;  2K4B A;  4C9Y A;  2VPL A;  2FF4 A;  2K9L A;  5EZG A;  5H2F C;  5HDN A;  3WTT C;  1IV6 A;  4A6E A;  4CUG A;  2PMH A;  3J81 K;  3GEZ A;  4UUS B;  3WOD F;  3ZMS A;  1O57 A;  3TL4 X;  4HLX A;  4OMZ A;  5A2Q K;  5HVQ C;  4XKC A;  4PJL A;  3HZJ A;  2QVO A;  1XCV A;  4A0Z A;  1WQ2 A;  3S3O A;  4CZC A;  1VQ4 I;  1YJW I;  4JK1 X;  2P6T A;  4EEF G;  5J1U A;  2AQE A;  2DFI A;  4W97 A;  2E19 A;  1MJ9 A;  2E35 A;  4XRF A;  3BLY A;  4BQQ A;  1IJW C;  2VOP A;  4H0E A;  3VPR A;  4ZZL A;  1MW7 A;  1MMN A;  1FP2 A;  2Q2E A;  4B3X A;  3VFZ A;  1ZAO A;  3D0S A;  3G4S I;  3C2G A;  3KPH A;  2E1M C;  3I56 I;  3CCM I;  4DQ2 A;  3BG9 A;  2MSY A;  2NS0 A;  5D6E A;  3RKQ A;  4GGG A;  2R5Y B;  2Z2S B;  4MEX F;  3HOZ J;  3OYM A;  2HXI A;  5CLS A;  1S29 A;  1A36 A;  2KIQ A;  1QBJ A;  2YUS A;  2J5O A;  2M3A A;  2CUJ A;  3CES A;  2AXL A;  2I10 A;  2R4G A;  3CZ6 A;  5JHU A;  1B8I B;  1TQP A;  2X6W A;  3HHG A;  3OIO A;  2A69 F;  1Z3Y A;  5DCM B;  4CIC A;  1TC3 C;  4A3B J;  2DFF A;  4EJU A;  1VQ7 I;  1J2X A;  4XRM A;  4CCL A;  3A0H C;  3NAU A;  3V7S A;  1SD7 A;  3B02 A;  2G7U A;  5BMZ A;  2E7W A;  4HPQ A;  1XGS A;  2JWT A;  3BZK A;  3SZT A;  4RGS A;  1K79 A;  4AD9 A;  1S7E A;  4KT6 A;  3PNY A;  3JR9 A;  2ZME B;  1YJN I;  1MKM A;  2PBI A;  1BN5 A;  4A3E J;  3HUG A;  1U9O A;  4EM1 A;  3OYG A;  4BY7 J;  3DCF A;  4O6J A;  1FX7 A;  2F5C A;  4HRI A;  2M8E A;  3FWE A;  1MBH A;  1Z9C A;  4IKF A;  2KKO A;  2KDZ A;  3DEE A;  4WWC A;  1LEA A;  3COA C;  3LSR A;  1GUU A;  2FNA A;  2VOO A;  1QU3 A;  1DDN A;  4BXU A;  3F72 A;  4E7J A;  3S3N A;  4N9I A;  2P7V B;  4F7Z A;  4G6D A;  3HOY J;  3MWM A;  2CW7 A;  3MCZ A;  3E3V A;  2JTV A;  4JX6 A;  1WJ5 A;  2P0W A;  3QQA A;  4XRS G;  2JRT A;  4LIV A;  4E7Z A;  2WAF A;  5K5R A;  1ETO A;  2HOT A;  3HRM A;  3J7A Y;  2BW3 A;  5GP9 A;  1U5T C;  2X6X A;  2NXN B;  4A5N A;  2EZI A;  3HM5 A;  4I09 A;  4CO8 A;  4L0Y B;  1G3S A;  2DBB A;  2CH0 A;  1ZR2 A;  2Z1D A;  4DZJ A;  1TT5 B;  5FRN A;  2HQN A;  3G3Z A;  1FPQ A;  3ERM A;  1WJF A;  2OC6 A;  1IN5 A;  3CUQ B;  1TW3 A;  1HBX G;  1TWA J;  1KA8 A;  2R7O A;  4KFC A;  2B63 J;  3AL0 C;  2F5V A;  2BYV E;  4LLL A;  4HQM A;  1ZYR F;  1I1S A;  1YX3 A;  1V5E A;  5B5E C;  1SFE A;  2M8G X;  4MHG A;  5F04 A;  5HOO A;  1J59 A;  2XAG A;  1K7A A;  1QZE A;  3BJA A;  4J19 A;  4YII A;  2AQF A;  5FGM A;  1HA8 A;  4L5I A;  2GXB A;  1JI8 A;  4Q48 A;  1ULY A;  4EVI A;  2X85 A;  2Z33 A;  2FQ3 A;  1T8I A;  1BL0 A;  1F4K A;  3KIO A;  3PQJ A;  1ZRE A;  5KNL A;  5C4J J;  4IHY A;  1IUY A;  4EJV A;  2IP2 A;  5EJC A;  1TWG J;  3E5X A;  1ETK A;  2HYJ A;  2PN6 A;  1H9T A;  4F91 B;  2F48 A;  3ABT A;  3DBR B;  5ICF A;  2JPB A;  3H35 A;  1KQ8 A;  3WHC A;  3PM1 A;  2EFN A;  1J9I A;  3BG5 A;  3C1D A;  3HOX J;  1MMS A;  1KQ0 A;  1DP7 P;  1UHM A;  3S1Q J;  2M2E A;  4ESB A;  3QOP A;  3HBL A;  2CWE A;  1LVA A;  2CFX A;  4S05 A;  1POG A;  2L7F P;  1X4P A;  3FK7 A;  2BY1 A;  3AG4 H;  3I5U A;  2HOA A;  2MBF A;  2PJP A;  4KIT B;  3F8N A;  5J40 A;  3ECH A;  2JSC A;  2W00 A;  5CVJ A;  4LMY A;  5L3D A;  3RYR A;  3J80 K;  2HYG D;  3FXL A;  2CGP A;  3K10 A;  1FYM A;  2FD5 A;  3IL2 A;  1SMT A;  1TL8 A;  3K4B A;  3DU6 A;  1HKQ A;  5E1X A;  2ZSI B;  4Q4Z F;  2R3S A;  5L3E A;  2O9L A;  5BS6 A;  2DO7 A;  3K4C A;  1X19 A;  1SVL A;  4CCK A;  4FET A;  3CLQ A;  2H27 A;  2ECC A;  1B9M A;  5FLX K;  2VI6 A;  2LBF B;  4XKV A;  1T56 A;  1U78 A;  1IV8 A;  3HTS B;  1TWF J;  5F0H A;  1RR8 C;  1O3R A;  1REP C;  2ZXI A;  3QYF A;  2VXZ A;  2D2W A;  2V1X A;  4Z2Y A;  1WSU A;  2EIJ H;  3OIQ A;  2QYO A;  3GWZ A;  4XK4 A;  4GYI A;  4EGZ A;  1T6S A;  2F6C A;  2HQA A;  2ZO4 A;  1SAN A;  1UG0 A;  2MD5 A;  5D5X B;  4XN3 A;  1ETW A;  2H09 A;  2JJ7 A;  5ICG A;  4PK4 A;  1ON2 A;  4M3F A;  3ABM H;  3K70 D;  3R6S A;  1FBU A;  1Q1V A;  1RES A;  4YIR X;  4ZTJ A;  1S3J A;  5CQG A;  5K7F A;  3HYI A;  3LWF A;  3CDL A;  5GTI C;  5K5O A;  1E2X A;  1KU2 A;  1D8K A;  2Z99 A;  1VQ9 I;  4RAF A;  4DNC A;  2OUM A;  1BIA A;  4BAY A;  2MD0 A;  2GXG A;  4HNU A;  2W85 A;  1J75 A;  3CUO A;  2XAS A;  4D1Q A;  5J6X A;  3S2D J;  4P9F A;  2E71 A;  2PLY A;  3F3X A;  1SFK A;  5D8L B;  3GTG J;  5IOY A;  4ESF A;  4S0H B;  2R7U A;  3RCO A;  1IN6 A;  2VL8 A;  3QP5 A;  2DOF A;  2PJR A;  4IJA A;  1VZ0 A;  4B09 A;  3HOW J;  3K2Z A;  2DW4 A;  2HDC A;  3IRQ A;  2WC2 A;  4L5J A;  2R5Y A;  1HXD A;  3EPZ A;  1IO2 A;  1HKT A;  5KK1 A;  3IH3 A;  1RIO H;  4AUX A;  2QWW A;  2XF6 A;  1XGM A;  4HDU A;  2V4J C;  2DA2 A;  4IRH A;  2LP0 A;  1B8I A;  1TNS A;  2Y0M A;  3NAR A;  2X9D A;  5DCM A;  5D4R A;  3FZV A;  4CCM A;  2B9S A;  1XMK A;  2DOD A;  1RZ4 A;  4B1R A;  1CQT A;  1JJ6 C;  1I50 J;  2RGV A;  3WTX C;  5E20 A;  3JCU C;  3CJR B;  4DBQ A;  1QPI A;  2WAE A;  4HV6 A;  4RM2 A;  2KFD A;  4HNT A;  1Z7U A;  2DQR A;  5JFR A;  5E1W A;  1JUM A;  4OIQ F;  3S32 A;  3QPH A;  1DU6 A;  4A3G J;  2DMU A;  2CRG A;  2Y30 A;  3WE3 A;  1IAW A;  3GTL J;  3A0B C;  1OCR H;  2LDU A;  2UXX A;  4IEJ A;  1SFO J;  4WK8 F;  3EYI A;  3IUO A;  2X6Y A;  3ZRG A;  2Z5U A;  5CYV A;  3QU6 A;  3BC8 A;  3PFI A;  4I7H A;  1VI0 A;  2O8K A;  2ZJ2 A;  3I64 A;  2IXS A;  4L5E A;  1N75 A;  3K9T A;  5FB2 A;  3I59 B;  5DTD A;  1P2F A;  2L02 A;  2NS7 A;  1LDD A;  4F3Q A;  2AO9 A;  2L4A A;  2BEO A;  1S6L A;  2W57 A;  1K4T A;  2GA2 A;  1K6Y A;  3G71 I;  3HSF A;  2UXN A;  4BQA A;  4PCQ A;  3ROU A;  4NNJ A;  3QYE A;  2BY2 A;  3OS0 A;  1DGR M;  1FMV A;  3W6V A;  1IW7 F;  2K5C A;  3M9A A;  4ZYE A;  5K1Y A;  2VLA A;  1JGG A;  3KP5 A;  1I5Z A;  3KZZ A;  5D5U B;  3HOT A;  2FBH A;  2VQG A;  1I3A A;  1BIB A;  2H6B A;  1G59 A;  4EJW A;  2B0L A;  2A05 A;  1P4W A;  3LSI A;  3HC7 A;  3TDU C;  1R5H A;  2LOO A;  2PMZ N;  4BS9 A;  2ZXH A;  3ZQQ A;  1F1Z A;  4CGZ A;  2RV8 A;  3AG3 H;  2ETH A;  3CUQ A;  1IC8 A;  2K40 A;  2Q8K A;  1Y6I A;  2XAQ A;  4ASN A;  4IZZ A;  1JHF A;  1R1T A;  2FOK A;  4I0B A;  3CF5 F;  3H3Z A;  2A5Y B;  4FAS D;  1JT0 A;  3LSG A;  4JP0 A;  3ULQ B;  1EKE A;  4M6V A;  1U8B A;  2XF7 A;  4M9X A;  2XSD C;  2D5V A;  3GTK J;  3FMR A;  5F64 A;  4RBO A;  5EEH A;  2CS3 A;  3QAH A;  4MEY F;  3DBL B;  2RAE A;  4JX4 A;  3OYE A;  2XAJ A;  2EA2 A;  3LSP A;  1XSD A;  4DIQ A;  5EZH A;  2CSO A;  1GHC A;  4KMU X;  1XDU A;  2R5Z B;  2CUE A;  4CCO A;  4CYC B;  2AS5 F;  1BR1 A;  2UUZ A;  2KRC A;  2ZKZ A;  2XF5 A;  3TO6 A;  2O0Y A;  2KZV A;  2J5P A;  4XN0 A;  3MZH A;  2F4M B;  5LRR A;  3HUG B;  4RAY A;  4LG0 A;  1TW2 A;  3B73 A;  3HHH A;  1FMW A;  1MD0 A;  4IHS A;  3DPU A;  4WF2 A;  3RTR A;  4M73 A;  3KYL A;  2O3F A;  1QZY A;  4L0Z B;  4Y17 A;  3FXK A;  3CF2 A;  1PJR A;  3DPL C;  4AYB A;  2F4O B;  4RB0 A;  3VYS B;  5D6F A;  1ENH A;  4ZZD A;  2LF7 A;  1ZLJ A;  3J81 Z;  4BE0 A;  2X51 A;  2W48 A;  4KIB A;  1XD7 A;  3ZQL A;  2QBY A;  1FNN A;  3OIP A;  5A2Q Z;  1KYZ A;  2HNH A;  2LY1 A;  1MMA A;  2R7S A;  5D8K B;  4E7I A;  4Q47 A;  3RKY A;  4LLN A;  1FSE A;  3K1P A;  1Z6R A;  2W24 A;  1IRX A;  4ESJ A;  4UVB A;  4EGY A;  3BTJ A;  2BW3 B;  4HF2 A;  4QPO A;  2HQ5 A;  4ZH4 F;  4LK0 F;  2XVC A;  2P4W A;  1J7K A;  3HKZ N;  1BI3 A;  1KU3 A;  4AVZ A;  2W25 A;  2HS5 A;  2GIV A;  3PL8 A;  2N8G A;  2L7Z A;  2M0C A;  2VC0 A;  1SFX A;  3REO A;  4C3H J;  4A93 J;  2DT6 A;  3HSE A;  4HX7 A;  3H9G A;  4B44 A;  2ZJQ F;  4HEA 2;  3BR5 A;  1EJ9 A;  2LBF A;  2GBY A;  1ZKG A;  3L2R A;  4Y4R A;  2XAH A;  4BYY A;  1JJ8 C;  1S7O A;  3BG3 A;  3GTM J;  5IPA A;  5IYC J;  1YS6 A;  2K9M A;  3FX3 A;  3DWL E;  3SQN A;  4AM3 A;  2DK5 A;  3HOU J;  4M9S A;  2DFH A;  1B72 B;  2LKP A;  2VBX A;  3JRH A;  1BW6 A;  2KIM A;  2ACJ A;  1X1P A;  2M45 A;  4BY1 J;  4HOB A;  4I01 A;  2L7M P;  4E7H A;  1B59 A;  4M6X A;  2KIU A;  2WTE A;  2OF7 A;  3NRV A;  1SAX A;  3ZPL A;  4XKB A;  4P1W A;  3BR3 A;  3CUQ C;  2LRD A;  2HI3 A;  4YEJ A;  3GUD A;  4HX8 A;  5DM6 F;  1QHG A;  3Q0V A;  1Z91 A;  5FFX A;  1PUF A;  2ECB A;  4B47 A;  2XAU A;  3S93 A;  2IPQ X;  3QOD A;  2IA2 A;  2IS6 A;  1GXP A;  2R0Q C;  2ZB9 A;  3LSK A;  3O8H A;  2TCT A;  3HIF A;  2OAZ A;  2R7F A;  2GQQ A;  3FDY A;  3HJE A;  4UHT A;  3IKV A;  1VQM I;  1NH3 A;  1YW8 A;  4QWQ A;  4EM0 B;  2K9Q A;  1O7L A;  1YOV B;  3F21 A;  5BPD A;  1IGN A;  2ISZ A;  3CCR I;  3OOU A;  2VKE A;  5IP9 J;  3QPT A;  3LFU A;  3DKX A;  3TP0 A;  1OQY A;  1R5I D;  3D5L A;  2MYS A;  3SFZ A;  4D7M A;  1FLI A;  4PGG A;  2NAZ A;  3RYP A;  3I4M J;  3BR6 A;  1S9H A;  3CQZ J;  1WJE A;  4XOR A;  2VIX A;  1YO5 C;  3EDP A;  1E3H A;  2IJL A;  2E34 A;  2EWN A;  2LY2 A;  2OBP A;  3GFI A;  1E3P A;  4LB6 B;  4M74 A;  2XGX A;  2WA0 A;  1ETX A;  3MMY B;  3VWB A;  1C0W A;  1LNW A;  1D3Y A;  1ORK A;  4K2E A;  3P9K A;  3ZQH A;  4RB2 C;  2IA0 A;  3HPG A;  3RQ4 A;  2XDV A;  1LKX A;  3GBG A;  4N9H A;  1T33 A;  4ABZ A;  1Y1W J;  2G7H A;  1UJ8 A;  1S5L C;  3D1N I;  5E17 F;  3PFY A;  2LRE A;  1X1A A;  2QQ8 A;  4IO9 F;  2CQ7 A;  1I6X A;  4IQ4 A;  2XPU A;  3M1C A;  1N78 A;  2R7X A;  1ETQ A;  4BE2 A;  2E2H J;  3JTG A;  4QTR A;  3GLX A;  2CV0 A;  2GOM A;  3BP8 A;  3IV5 A;  2WB1 N;  2QEN A;  2EFO A;  4OAY A;  2BGC A;  2PI0 A;  3PSF A;  2FA5 A;  3GTJ J;  1UG2 A;  3MD2 A;  2ADU A;  1PUE E;  4G7H F;  4PZJ A;  1J0R A;  4UV8 A;  4A3I J;  1YIT I;  2EPF A;  4EJO A;  3IC7 A;  4D0P A;  3QWL A;  4AU7 A;  2Q0O A;  1FWZ A;  3WTS C;  3I4N J;  3S1R J;  4QLC U;  4U87 A;  3EYY A;  1MJB A;  2V79 A;  3K1N A;  1BR2 A;  2E36 A;  1RUN A;  1WJA A;  1JKQ C;  4G6T B;  5ICC A;  3ZOB A;  1WI9 A;  2L9N A;  3CC4 I;  1GDT A;  1VND A;  4PJN A;  3MAJ A;  5L3B A;  2VB6 A;  3FHN A;  3BDD A;  4KYW A;  2CW0 F;  4B8X A;  1T39 A;  3C7J A;  2PJR B;  3WG7 H;  4E6K G;  1K61 A;  2QQ9 A;  5KHD A;  2XRL A;  1FOW A;  3TW7 A;  3HL2 A;  2K27 A;  1HW1 A;  4XR6 A;  5F0F A;  4F52 A;  1FOK A;  1MH4 A;  3J80 Z;  1VQ6 I;  3E7L A;  1AU7 A;  1HDD C;  3W2W A;  1BC8 C;  4G12 A;  2FXA A;  2JA7 J;  3QOE A;  3K69 A;  2KJB A;  4YFK F;  4YG2 F;  2CV1 A;  4M6Y A;  3VYR B;  2PX9 A;  1KU7 A;  3FXU A;  2JMW A;  2EZL A;  3FMS A;  3P7N A;  2R5Z A;  4U88 A;  3NEU A;  4CYC A;  4DGW B;  2FSW A;  2MC3 A;  3W6J B;  3WHB A;  3ZN0 A;  3VSL A;  4OAZ A;  2DTR A;  5CVV A;  1TWH J;  4G8X A;  5FLX Z;  1AHD P;  3K4J A;  4G9Y A;  5HLT A;  2FQ4 A;  4M3B A;  5DDG A;  3TO9 A;  4C3I J;  4Z6Y A;  4RA2 A;  3S3M A;  3DTI A;  1NK3 P;  4E70 A;  2MG4 A;  2GOX B;  5GAH J;  1SC7 A;  4EJT A;  1Z1D A;  1Z3X A;  1WJD A;  2IA1 A;  2E5Z A;  1LFU P;  4KMF A;  2IW5 A;  2R7Z J;  4EMS A;  2K86 A;  2M30 A;  5ICE A;  3A02 A;  4ZJZ A;  5DD8 A;  1PDN C;  4C30 A;  1MSE C;  2P81 A;  2EFP A;  3HRT A;  2EH3 A;  3D5S C;  4OIN F;  4U7D A;  3CC2 I;  5IT9 K;  4B48 A;  1Z0X A;  3S14 J;  4GDF A;  1W0U A;  1I27 A;  2R7V A;  4B43 A;  3FXR A;  1X3Z B;  4Y13 A;  2VKV A;  1I39 A;  4LIT A;  4MQV A;  2Y2Z A;  3SDG A;  3JRF A;  3CO6 C;  1XS9 A;  2YR2 A;  1T0F C;  4CXF A;  2E2J J;  4ZDP A;  5HLG A;  1MGT A;  3OL3 A;  4ENJ A;  1BOA A;  2FRH A;  3GCM A;  2BBY A;  1IRG A;  1EH8 A;  1T38 A;  3CCJ I;  3SXY A;  2ELJ A;  4FX4 A;  1UST A;  5TJJ A;  3OS1 A;  1QVU A;  5H6R A;  2BV6 A;  2EK5 A;  2LG4 A;  2V9V A;  3RQI A;  3JAM K;  1VQL I;  1Q1H A;  4WXC A;  2WY8 Q;  4XID A;  4JYK A;  2M0M A;  1G8X A;  1UMQ A;  3OYH A;  1MZB A;  1HC8 A;  2DMP A;  3OWT A;  5J4V A;  1V4R A;  2DXI A;  2OTJ I;  3G1O A;  3Q5F A;  1GXQ A;  2VOD A;  2IT0 A;  3BR1 A;  2M5W A;  2MAB A;  5L3C A;  1IRZ A;  1G3T A;  1MBK A;  2QQB A;  2HTS A;  4R1H A;  5FRM A;  3GFM A;  3HPH A;  4I99 C;  3N4M A;  3WTV C;  1B72 A;  4UXN A;  4NUB A;  4R8H A;  2ID6 A;  5HLI A;  3WTY C;  1YTY A;  1T08 B;  2P8T A;  5GAE J;  3L2C A;  2Y31 A;  3FXQ A;  3I54 A;  2VQL A;  2L01 A;  1RKW A;  4A69 C;  1V3F A;  1WFX A;  1XGN A;  4BHB A;  2GLO A;  2CUZ A;  1OCZ H;  1Y0N A;  2WAQ A;  2XIG A;  5IOZ A;  2LC2 A;  2DT7 B;  2HPI A;  2RQQ A;  3CC7 I;  2EIM H;  1JHH A;  4XNF A;  2ZCW A;  4JOM A;  5KAF C;  2M34 A;  4WXD A;  2DPU A;  1YX5 A;  3KEY A;  5J8C A;  4HQE A;  3FMQ A;  1Y8R B;  1LFB A;  2VKH A;  5CQE A;  2EJR A;  4EAT A;  3L2W A;  4LG0 B;  4V19 K;  4R79 A;  3S17 J;  4PSW A;  5EGO A;  3SJM A;  5E3M A;  4FE7 A;  3FM3 A;  3F8B A;  1QQI A;  4ZYH A;  5M3F J;  3GME A;  2M7A A;  2XRN A;  5JHF A;  1OYY A;  2IGM A;  1V5F A;  5DEQ A;  1CGP A;  3BY6 A;  1XG1 A;  2FBI A;  3T0Y A;  2KHM A;  2HKX A;  3VOD A;  4L9J A;  5IYD J;  1LFP A;  3TOB A;  3V4G A;  3A4C A;  3BTL A;  2QBY B;  5LEJ A;  1STZ A;  3M3Y J;  2HU9 A;  1D8J A;  3FF5 A;  5DV5 A;  2X1D A;  4BEH B;  3ONQ A;  1BJA A;  2GAU A;  3HRU A;  4IHX A;  2ELK A;  4P9U A;  1APL C;  3OYC A;  2CG4 A;  4M72 A;  1AOY A;  3CMY A;  3BZ6 A;  5FD5 A;  2MGQ A;  4RM3 A;  1VQK I;  5LGU A;  6PAX A;  4J00 A;  3E0J B;  1PP8 F;  3AG2 H;  3S15 J;  3MKL A;  4KJZ A;  3K4M A;  3LSM A;  4DBR A;  1KYW A;  2Y9Z A;  2VUM J;  4YFN F;  1YIO A;  2ISY A;  2L54 A;  3LA3 A;  5E8I A;  4N4N B;  1X58 A;  2FBK A;  2ZC2 A;  1MNM C;  3TED A;  2H6C A;  2CFO A;  2A61 A;  5B1A H;  1R22 A;  3T1B A;  1BJZ A;  3KP2 A;  5H20 A;  3W3C A;  2ZJP F;  5DD4 A;  2BZT A;  3TDZ C;  1W5S A;  1QZZ A;  5FRO A;  4MFE A;  3WG9 A;  1BI0 A;  4WCG A;  2LFB A;  3FIW A;  1E17 A;  3BR0 A;  4DW6 A;  2P7C B;  2M4K A;  4I02 A;  3DV8 A;  3BPX A;  3SZP A;  3H92 A;  4KN7 X;  3F6V A;  4KT5 C;  1FYK A;  5E8G A;  5AON A;  5C4X J;  4A12 A;  1R6R A;  1R36 A;  1PUF B;  5K7Z A;  4L9V A;  1N77 A;  4Y52 J;  2VT3 A;  1UHS A;  3R0J A;  2VBW A;  5LEK A;  1WJB A;  5J1R A;  3IHU A;  1WI3 A;  4BHP A;  2DMN A;  5EEA A;  2BY3 A;  2O6G E;  2LKS A;  2KPM A;  3C18 A;  3MN2 A;  4XMY A;  3RSN A;  2JA8 J;  1YIJ I;  2XV4 S;  4HX4 A;  1W7P D;  3ZMV A;  1WJC A;  1H9G A;  4BGD A;  3PUF A;  1IG7 A;  1Y8Q B;  3HXL A;  5DM7 F;  1YI2 I;  2F4I A;  2M1B A;  2VJ4 A;  2M9H A;  3O2P E;  1EH7 A;  3T8R A;  1UFM A;  2DA5 A;  2OTL I;  1X4O A;  2QUF A;  2UZK A;  5FKM A;  1QHH D;  2M4G A;  2P6S A;  3OMY A;  1YHQ I;  4XRS A;  1MDM A;  5TGT A;  2LYC A;  4I2O A;  2OV7 A;  2R7W A;  3GF2 A;  4XLF A;  4XBF A;  1IXC A;  2Y0S N;  4AC0 A;  4D9J A;  3LAJ A;  3FIS A;  2QEX I;  1WRJ A;  3NQO A;  1RUO A;  3GFL A;  3OYF A;  2QCO A;  1IN4 A;  2F5D A;  1IF1 A;  1IXS B;  4FCY A;  2OCC H;  3O8G A;  4FT8 A;  3OOP A;  5K5Q A;  4RLQ A;  1Z7L A;  1Y56 A;  2P5K A;  1U6G A;  3H5R A;  4IHV A;  2ESH A;  2BXZ A;  1D5Y A;  1TNT A;  2K9N A;  3CTA A;  1QA6 A;  4N0B A;  1KZH A;  4A2U A;  1XSV A;  4PFO A;  5GAG J;  2BVL A;  1FT9 A;  3BRO A;  1OIS A;  1TP4 A;  2A3S A;  1PYV A;  3HGG A;  1UZC A;  3KP4 A;  4II3 A;  4AIJ A;  5M5X J;  2IGN A;  4W1U A;  3H5A A;  5F1J A;  5LGT A;  2VN2 A;  4Q5S F;  3I58 A;  5E3L A;  4B3A A;  3JRE A;  4X6A J;  2JRM A;  4ITV A;  2MW8 A;  5CVI A;  2HVS A;  1HOM A;  3ZR8 X;  2VJ5 A;  3I3L A;  2JUC A;  3GTP J;  3GYH X;  3V8J A;  3L9F A;  3PO3 J;  1ZG3 A;  2W82 A;  4DYQ A;  3D5R C;  2V6E A;  4GYG A;  3ABK H;  5LGN A;  2CQQ A;  3CCQ I;  3B6A A;  1DPR A;  3I71 A;  3SFI A;  2DT5 A;  4IX7 A;  2DOA A;  2YX4 A;  4D5F A;  5BQT A;  2KJC A;  1MIJ A;  4MTD A;  1V54 H;  3LAP A;  4CYD A;  2L9S A;  4F55 A;  5F1R A;  2EV5 A;  4LGW A;  4D5C A;  4RAZ A;  3E6B A;  3MQ0 A;  5F0C A;  3A01 A;  2H1L A;  2K3F A;  1QGP A;  4NC7 A;  2QZ8 A;  1H89 C;  3J7Y J;  2DAO A;  2KT0 A;  1FBS A;  4BXF A;  2EZH A;  1JKO C;  2RC4 A;  1ZRC A;  4GFB A;  3HOS A;  3VOE A;  3OSG A;  3CCY A;  2ZXW H;  4CH7 A;  4II2 A;  3FXJ A;  3FK6 A;  1TBX A;  5JVT A;  5EG0 B;  2Q1Z B;  1XX5 A;  4RB3 C;  4XIC A;  4IRI A;  1BA5 A;  1SFU A;  5E3O A;  1P9Q C;  3WGI A;  3KEO A;  5HS9 A;  5E1Z B;  4E7L A;  2O03 A;  1YS7 A;  4BBS J;  2XUB A;  3ZGK A;  3B6C A;  2JVH A;  3SYT A;  2XKO A;  3K4L A;  1S72 I;  1GV5 A;  1SMY F;  3RI4 A;  1Z05 A;  3LL7 A;  4IOA F;  2Z16 A;  2JZY A;  3I0T A;  3GVA A;  4RDU A;  2DCE A;  2R93 J;  2NNN A;  5LHG A;  2HOS A;  4PUS A;  2VBY A;  3G1L A;  1AKH A;  1SVO A;  5EYR A;  1G2H A;  3R60 A;  1JGS A;  2KMU A;  5FFZ A;  1XMA A;  3KE2 A;  1JT6 A;  2XRO A;  1I6H J;  3BG6 A;  2HWV A;  2DYR H;  1R9T J;  5AIQ A;  4X1E A;  4CSW A;  3CD6 I;  1ON1 A;  4CA0 A;  5LHI A;  2HTJ A;  1XB4 A;  4BEH A;  2E1C A;  2L2O A;  4BQN A;  2XGD A;  5FKL A;  2WY7 Q;  3CCL I;  2A6E F;  2KDO A;  4PDK A;  5J47 A;  1SD5 A;  5IT3 A;  4DYC A;  2YU3 A;  2BHZ A;  3IAM 2;  3S2W A;  1W5C C;  3L7W A;  5GTH C;  2CO5 A;  4ENK A;  1K4S A;  5GPA A;  1FEX A;  2A6T A;  4PJ0 C;  4U0Y A;  3F9K A;  5JLW A;  2ZNY A;  3PIO F;  5HS7 A;  5K7H A;  3BJO A;  3OY9 A;  1SD4 A;  3AG1 H;  3RPU D;  1MBE A;  3KFW X;  1VQ5 I;  1RKT A;  3BOQ A;  2XAF A;  1R71 A;  2OD5 A;  5L3G A;  5GAD J;  3H3V K;  2NNY A;  1A31 A;  2L4M A;  2LSO A;  2ID3 A;  4NC6 A;  3KP3 A;  3RKW A;  1A5J A;  1JXS A;  2MLG A;  2XGC A;  1EF4 A;  2CV2 A;  1YLF A;  3KZY A;  2DOE A;  2RN7 A;  4Y7N J;  1U8R A;  2TRT A;  3ZMU A;  4LIU A;  1TLH B;  3H0G J;  5ILU A;  2QM3 A;  4KIF A;  4GCV A;  4Y3O A;  3KET A;  3A2K A;  1YRN A;  1W36 D;  3IWF A;  2OQG A;  3WTW C;  1VQN I;  3BR2 A;  1F9N A;  2K3P A;  2Y9Y A;  3K0L A;  3LMM A;  3C3W A;  4BBR J;  1NK2 P;  2YPR A;  5L3F A;  3N05 A;  1ZTR A;  2DMQ A;  5HNF A;  2JN6 A;  1OKR A;  2VAS A;  3WU2 C;  4UUT A;  5CJ9 A;  2Y69 H;  3DKY A;  3FXO A;  4LOC A;  3GO5 A;  5EGO B;  5AIP A;  2EV0 A;  4ENN A;  1WHU A;  2Y75 A;  5IT9 Z;  3GFJ A;  1YQA A;  3E5Q A;  3BTI A;  4ANJ A;  2HZT A;  1R5G A;  5D5V B;  4CCJ A;  3S16 J;  4HG2 A;  1G3Y A;  3I53 A;  4XL9 A;  2H1K A;  2R7T A;  5ERI A;  1NHA A;  1P7J A;  2K9S A;  2I8D A;  3DTK A;  1X3U A;  1WPK A;  2AHQ A;  4AID A;  1B4A A;  4LD5 A;  3ZP5 A;  4OIO F;  4IXA A;  3HG9 A;  5EDN A;  5ILS A;  1D5V A;  3P9C A;  2VC1 A;  4WX9 A;  2WAD A;  3KZI C;  2CU7 A;  2RVC A;  1U9N A;  1MND A;  2DK8 A;  1WVR A;  3VYU B;  2NVY J;  2V9P A;  2VPR A;  5GPC A;  3OYL A;  2JVG A;  3JAM Z;  1OLT A;  2MC4 A;  2ZFW A;  3IKT A;  2VJI A;  3W2A A;  4XSZ F;  2JQ7 A;  5IP6 A;  1X2N A;  3CDH A;  3TW6 A;  3OSF A;  2D45 A;  2G9W A;  3K4N A;  2O61 A;  3FKJ A;  4MFD A;  4XOP A;  2LH9 A;  2H8W A;  3VDX A;  1S8N A;  5LD2 C;  3MKW B;  2QSG X;  4XLH A;  4ON0 A;  3LSJ A;  2OZ6 A;  5JVG F;  3MZ8 A;  3GZN B;  1M1E B;  1FY7 A;  3IAS 2;  3H3U A;  1P6R A;  3OL4 A;  1LDJ A;  5CVU A;  1W7P B;  2HVQ A;  2E2I J;  9ANT A;  4IPA A;  1UHW A;  4BL0 B;  3PQK A;  4XLC A;  1N25 A;  4PSX A;  3QYB A;  1W4M A;  1MSF C;  2HKO A;  4DYR A;  2NS8 A;  1BBY A;  2ZBK A;  1ZG5 A;  4RS8 A;  5JI6 A;  4HF1 A;  2I5U A;  3GZ5 A;  4A3D J;  3CJT B;  4IQJ A;  1R4M B;  3BTC A;  1JE8 A;  2F5F A;  4EM2 A;  1MH3 A;  4I6Z A;  2QGU A;  3DKW A;  3G1M A;  3ZMZ A;  3OYJ A;  2IS1 A;  1RI7 A;  4MTE A;  3P9I A;  3AKZ A;  3BQY A;  4S04 A;  2QSH X;  1FIP A;  1Y1V J;  4BJT A;  3T8T A;  2DI3 A;  2JPC A;  1QRY A;  3U9G A;  2DLL A;  5F27 A;  5J1Y A;  1D1A A;  1A04 A;  2NVT J;  3Q0U A;  2KZG A;  2HQR A;  2ZJR F;  2ESN A;  1Z6T A;  1JTY A;  2JSP A;  3JRG A;  1PVE A;  2HGC A;  2KLO A;  4XKW A;  1ERD A;  3GTQ J;  5EEG A;  2PG4 A;  3C2H A;  1FJL A;  3H9J A;  3EUA A;  3TOA A;  2FX0 A;  3OS2 A;  2CJJ A;  2OPT A;  3KEQ A;  1K78 A;  3WGG A;  4CHU A;  5FLV A;  4BH9 A;  4Y33 A;  1USS A;  4NQW B;  3F6O A;  4JX5 A;  1JKP C;  3VEP A;  1MDM B;  1JKR C;  4C2T A;  5DS9 A;  5DUK A;  4N4O B;  1R1U A;  4A3F J;  2CMP A;  2O7O A;  2IGK A;  3H9Q A;  3DFG A;  2VJJ A;  5EG0 A;  3M4O J;  2B7E A;  5FJ8 J;  4ZYD A;  2L9V A;  2VQC A;  2EB7 A;  2V9K A;  3MFK A;  1HF0 A;  2BXY A;  3E6M A;  3HB9 A;  5BNG A;  1H88 C;  1X3W B;  4RAG A;  1V5G A;  3TGN A;  3WTZ A;  3HSR A;  3CO7 C;  3E6C C;  2DJN A;  2KQR A;  3IRR A;  3PIP F;  5FKN A;  1ZRF A;  2PMZ A;  4BDZ A;  5ED4 A;  2OQR A;  4YFX F;  3ERE D;  1G6N A;  3WE2 A;  3GZ6 A;  1XDS A;  2IBD A;  2P5L C;  1SD6 A;  3JRD A;  3IWZ A;  4LJZ F;  1S7A A;  3DU5 A;  4UB8 C;  1XC5 A;  4FX0 A;  2NVX J;  3KCC A;  1VQP I;  2DDB A;  5DUI A;  3MZY A;  2VE9 A;  1T2K A;  4HDV A;  4MLO A;  1CF7 B;  3J7Z I;  3N97 A;  3K7A J;  3PNT A;  2XC7 A;  1U3E M;  4I76 A;  2DN0 A;  2CQN A;  3O3K A;  2CQX A;  2MH2 A;  1LQ1 A;  2XGE A;  3WTU C;  2EIN H;  1O3S A;  3LSH A;  3LOC A;  3CJN A;  3CDI A;  1QVT A;  2MLK A;  2UV1 A;  2VKD A;  3J7A O;  1BM9 A;  1P92 A;  1L3L A;  2CUF A;  3DXJ F;  2IS2 A;  4FHT A;  1T95 A;  5DYM A;  2IS4 A;  3QPL A;  2V1N A;  3SDB A;  3BT9 A;  1KU9 A;  4RB1 A;  5D5W B;  4UUV A;  2PQ8 A;  2A5W A;  2NYX A;  4F93 B;  2YU9 J;  1RC9 A;  3WU1 B;  4QIW N;  4BE1 A;  1W1W E;  4CDG A;  5J4Y A;  2UWM A;  2RNG A;  1PP7 U;  1RNL A;  3A01 B;  1D0X A;  3CJQ B;  4NDL A;  1OMI A;  3E1S A;  2LMD A;  1AA7 A;  2EFQ A;  5CPR B;  2HEO A;  2NVQ J;  2DU9 A;  4HZF A;  1LUJ B;  1HLV A;  3CLO A;  4U0V A;  1XN7 A;  3SHF A;  2EZK A;  1IN7 A;  3KLN A;  4G7Z F;  3Q9S A;  4LG3 A;  5LRS A;  2KIS A;  1B6A A;  3C2B A;  4HNV A;  4XM3 A;  3ZCO A;  4RGU A;  4L18 B;  3SZG A;  1E0E A;  3MKZ A;  4A3J J;  2XB0 X;  3DP7 A;  1TZL A;  4AVP A;  4OIR F;  2H94 A;  2HPM A;  4AYB N;  2DQL A;  4UY8 I;  1JTX A;  3BWG A;  2KL4 A;  4IHW A;  1YYV A;  1DP3 A;  2XB5 A;  3S1N J;  4MIM A;  2L5Q A;  1NG7 A;  3LQQ A;  3HKZ A;  2DFE A;  3SEQ A;  4HF0 A;  2STW A;  1MBJ A;  1YW7 A;  2QF7 A;  1QPM A;  4WXH A;  1NG6 A;  2YX7 A;  1I1G A;  3HTU A;  4F92 B;  2V1D A;  3LQR A;  2HDD A;  1GVJ A;  1FOY A;  3PJR A;  2FE3 A;  3JRB A;  1XSX A;  2F2E A;  2X48 A;  5J8F A;  4G7O F;  2PFB A;  2JA5 J;  1AKH B;  3IH4 A;  1BOB A;  5JR3 A;  3I55 I;  1R23 A;  2R7D A;  3M07 A;  3KP7 A;  3AFH A;  1ZGW A;  3KYD B;  4CCN A;  4TV7 A;  4AWX B;  4KUM A;  1VFC A;  1FC3 A;  1MNE A;  3JRA A;  3TKY A;  1DQU A;  2E60 A;  3RIR A;  1ZGA A;  3Q9V A;  3GTO J;  3IH2 A;  4ZTF A;  4HA8 A;  3BJ6 A;  1VF9 A;  4U0W A;  2F5E A;  3GW2 A;  3LNQ A;  1F36 A;  3U1D A;  4HLY A;  4AIK A;  1XTA A;  1R58 A;  3CP2 A;  2ZSH B;  2HXO A;  3K2A A;  4MO7 A;  3W6K B;  5HDK A;  2DTZ A;  1X1C A;  4JBA A;  4M3D A;  4RLF A;  3GX4 X;  4DOZ A;  3ABU A;  3RZD J;  5IP7 J;  2HDW A;  3S8P A;  2V26 A;  1GT0 C;  3ZQ7 A;  4V2F A;  4XLP F;  1YW9 A;  2HFH A;  2P5V A;  3OYB A;  3U21 A;  3ASO H; 
#chains in the Genus database with same CATH homology
 2ZNZ A;  2C6Y A;  1OR7 A;  1W7P A;  3GXO A;  1Y0U A;  3LA7 A;  4A0Y A;  4M9Z A;  1R00 A;  3G73 A;  1ZHF A;  1FBQ A;  2M87 A;  1ODD A;  4KDP A;  4ENM A;  4PGH A;  2VBZ A;  1KQ9 A;  1LJ9 A;  4CZZ A;  4JQF A;  1HSJ A;  3DQV C;  4KA4 A;  5LHH A;  1ZG1 A;  3EET A;  1U2W A;  4P5O A;  4LLG F;  1HKS A;  4HW0 A;  2FU4 A;  3RKX A;  3JSO A;  2NRA C;  1IN8 A;  2X4H A;  2RDP A;  2HOE A;  1XGO A;  1OYW A;  2COM A;  1ZRD A;  3DPT A;  3F23 A;  3BPV A;  4AIH A;  1WKM A;  4NQW A;  2KRF A;  4EV0 A;  3M8E A;  4L9T A;  5KVR A;  4IF4 A;  4UNO A;  2FML A;  2QLZ A;  3RDI A;  3EQL F;  1R7J A;  4L9N A;  4MNU A;  5BOX A;  2FMY A;  3U2R A;  5FO5 A;  2VE8 A;  4OU0 A;  1TQI A;  3V7C A;  2A68 F;  3ZMT A;  2ZXJ A;  1OPC A;  3DEU A;  3T5X A;  4MQ9 F;  3F8M A;  4OMY A;  1G4D A;  3RJP A;  2ZME A;  3TQN A;  1CF7 A;  1FP1 D;  3M8F A;  3R4K A;  4BHC A;  2IVM A;  4GXO A;  3WGH A;  2D1V A;  1ZLK A;  4LFU A;  4I0A A;  4U7B A;  2CYY A;  3FHZ A;  1B9N A;  3K1M A;  1U5T B;  1IRF A;  1AWC A;  1WWX A;  5F6F A;  2EA4 A;  4P96 A;  3EUH A;  3L00 A;  2TDX A;  2GZW A;  2LNB A;  2K02 A;  2X0L A;  4KIG A;  3QP6 A;  1XCB A;  2CQK A;  3WU0 A;  4LK1 F;  2WWY A;  3RPQ A;  2Z9O A;  5LBQ A;  2V1U A;  4LB5 A;  5E18 F;  2MA3 A;  1K78 B;  4IVN A;  2L3D A;  3OV8 A;  2BE5 F;  1MJA A;  2QQA A;  3V8L A;  2RQP A;  2Y48 A;  2EFW A;  2PEX A;  4O3M A;  1QNT A;  4HV5 A;  3E5U A;  3F8F A;  3V8K A;  3FM5 A;  3E97 A;  2XHK A;  2GWR A;  4RGX A;  3JSP A;  4RGR A;  3RPU A;  1FYL A;  3LA2 A;  5BPI A;  1TQM A;  2WV0 A;  2STT A;  3M7G A;  3ZMD A;  4UVA A;  4ZYG A;  3ISP A;  1T98 A;  3F8C A;  3LFK A;  3JW4 A;  1IXR C;  4OOI A;  3TO7 A;  1LB2 A;  3HRS A;  3AAF A;  2D1H A;  2E7X A;  2VT2 A;  2OU2 A;  2DPD A;  1IZ1 A;  2OZU A;  2FNP A;  1L0O C;  3R0A A;  3M1E A;  1ZGJ A;  5TRD A;  1OYI A;  3R61 A;  4BNC A;  1B1B A;  3ECO A;  2JT1 A;  1J5Y A;  2KIF A;  3KP6 A;  1HQC A;  1BI1 A;  4IHT A;  4NHJ A;  1O7F A;  1F5T A;  1G3W A;  2K4J A;  4GO1 A;  1P4A A;  1EV7 A;  5LLQ A;  2HR3 A;  1ZN2 A;  3I4P A;  4O5V A;  2ELH A;  5HLH A;  1QO0 D;  1W5T A;  1K6O A;  2GA1 A;  5HDG A;  4A0X A;  1TTY A;  5FD6 A;  1HW2 A;  3ZN1 A;  4KIC A;  3JTH A;  3O6B B;  4A6D A;  3DF8 A;  1YG2 A;  4KNY A;  2PMU A;  4Y15 A;  2Z3Y A;  2O8X A;  1UB9 A;  1O3Q A;  2LF8 A;  4G94 A;  1BC7 C;  1DUX C;  4HAM A;  4KN4 X;  3LST A;  1P4X A;  1ZAR A;  1R1V A;  2OA4 A;  4XLN F;  5ILV A;  2RNJ A;  4NB5 A;  4P55 A;  4OIP F;  1ONV A;  4UVC A;  3V7R A;  2V6C A;  1DPU A;  2EV6 A;  1FSH A;  1VTN C;  1FZP B;  1HST A;  4UV9 A;  4MGR A;  5H6Q A;  2MH9 A;  4HBL A;  1UCR A;  2W84 A;  5HS8 A;  1KGS A;  3E6D A;  2FEZ A;  4IRG A;  2E1N A;  3KLO A;  3F22 A;  2K7L A;  5CVR A;  3VB2 A;  4XSX F;  1LDK B;  2YSR A;  4G6Q A;  2RKH A;  5DCF A;  3ELK A;  3QU3 A;  1H0M A;  1BI2 A;  1O3T A;  1HW5 A;  2HYF A;  4A5M A;  4HYE A;  4I98 B;  4EQQ A;  4M71 A;  2VON A;  1T0F A;  3QRF F;  4ETS A;  1LEB A;  3L09 A;  1ZH5 A;  1U5T A;  3MEX A;  2IRF G;  2A07 F;  2XKP A;  3ML6 A;  5D4S A;  3I59 A;  4YIF A;  1YFH A;  2A6H F;  1EH6 A;  2K4B A;  2FF4 A;  3WTT C;  5HDN A;  4A6E A;  2PMH A;  3J81 K;  3GEZ A;  3WOD F;  3ZMS A;  1O57 A;  4HLX A;  4OMZ A;  5A2Q K;  5HVQ C;  1XCV A;  2QVO A;  4A0Z A;  1WQ2 A;  4JK1 X;  2P6T A;  2DFI A;  1MJ9 A;  4XRF A;  2VOP A;  4H0E A;  4ZZL A;  1FP2 A;  2Q2E A;  3VFZ A;  1ZAO A;  3D0S A;  4DQ2 A;  2NS0 A;  5D6E A;  4GGG A;  4MEX F;  5CLS A;  1S29 A;  1QBJ A;  2J5O A;  2AXL A;  5JHU A;  1TQP A;  3HHG A;  4CIC A;  5DCM B;  2A69 F;  4EJU A;  1J2X A;  3V7S A;  1SD7 A;  3B02 A;  2G7U A;  5BMZ A;  2E7W A;  1XGS A;  3SZT A;  4RGS A;  1K79 A;  4AD9 A;  2ZME B;  1MKM A;  2PBI A;  1BN5 A;  3HUG A;  4EM1 A;  4O6J A;  1FX7 A;  2F5C A;  2M8E A;  3FWE A;  1Z9C A;  2KKO A;  4WWC A;  1LEA A;  3COA C;  2FNA A;  2VOO A;  1DDN A;  4BXU A;  3F72 A;  4N9I A;  2P7V B;  4F7Z A;  4G6D A;  3MWM A;  3MCZ A;  3E3V A;  2JTV A;  2JRT A;  5K5R A;  3HRM A;  1U5T C;  4A5N A;  4I09 A;  4CO8 A;  4L0Y B;  1G3S A;  2DBB A;  2HQN A;  3G3Z A;  1FPQ A;  1IN5 A;  3CUQ B;  1TW3 A;  1HBX G;  1KA8 A;  4KFC A;  2BYV E;  4LLL A;  4HQM A;  1ZYR F;  1I1S A;  1SFE A;  4MHG A;  5HOO A;  1J59 A;  2XAG A;  1K7A A;  3BJA A;  4YII A;  5FGM A;  4L5I A;  2GXB A;  4Q48 A;  1ULY A;  4EVI A;  2Z33 A;  2FQ3 A;  1F4K A;  1ZRE A;  3PQJ A;  1IUY A;  4EJV A;  2IP2 A;  3E5X A;  2PN6 A;  1H9T A;  3ABT A;  5ICF A;  2JPB A;  1KQ8 A;  2EFN A;  1J9I A;  3C1D A;  1KQ0 A;  1DP7 P;  1UHM A;  4ESB A;  3QOP A;  2CWE A;  1LVA A;  2CFX A;  4S05 A;  3I5U A;  2MBF A;  2PJP A;  3F8N A;  3ECH A;  2JSC A;  5CVJ A;  4LMY A;  5L3D A;  3RYR A;  3J80 K;  2HYG D;  2CGP A;  1FYM A;  3IL2 A;  1SMT A;  1HKQ A;  5E1X A;  4Q4Z F;  2R3S A;  5L3E A;  5BS6 A;  2DO7 A;  2H27 A;  1B9M A;  5FLX K;  3HTS B;  1U78 A;  1O3R A;  1REP C;  2VXZ A;  2D2W A;  2V1X A;  4Z2Y A;  1WSU A;  2QYO A;  3GWZ A;  4GYI A;  4EGZ A;  1T6S A;  2ZO4 A;  2MD5 A;  5D5X B;  2H09 A;  5ICG A;  1ON2 A;  3R6S A;  1FBU A;  1S3J A;  3HYI A;  3LWF A;  5K5O A;  1E2X A;  1KU2 A;  1D8K A;  2Z99 A;  4DNC A;  1BIA A;  4BAY A;  2GXG A;  2W85 A;  1J75 A;  3CUO A;  2XAS A;  5J6X A;  4P9F A;  2PLY A;  3F3X A;  5D8L B;  4ESF A;  1IN6 A;  3QP5 A;  4IJA A;  4B09 A;  3K2Z A;  2DW4 A;  2HDC A;  3IRQ A;  2WC2 A;  4L5J A;  1HXD A;  1HKT A;  5KK1 A;  1RIO H;  4HDU A;  2QWW A;  1XGM A;  4IRH A;  1TNS A;  2Y0M A;  5DCM A;  5D4R A;  3FZV A;  1XMK A;  1RZ4 A;  2RGV A;  3WTX C;  5E20 A;  4HV6 A;  1Z7U A;  2DQR A;  5JFR A;  5E1W A;  4OIQ F;  3QPH A;  3WE3 A;  1IAW A;  2UXX A;  2LDU A;  4WK8 F;  3EYI A;  2Z5U A;  5CYV A;  3QU6 A;  4I7H A;  3PFI A;  2ZJ2 A;  3I64 A;  3K9T A;  5FB2 A;  3I59 B;  1P2F A;  2L02 A;  1LDD A;  2L4A A;  2BEO A;  1S6L A;  2W57 A;  2GA2 A;  3HSF A;  2UXN A;  4BQA A;  4PCQ A;  3ROU A;  1IW7 F;  3M9A A;  4ZYE A;  5K1Y A;  3KP5 A;  1I5Z A;  3KZZ A;  5D5U B;  3HOT A;  2FBH A;  1BIB A;  2H6B A;  4EJW A;  2B0L A;  1P4W A;  3TDU C;  1R5H A;  1F1Z A;  4CGZ A;  2RV8 A;  2ETH A;  3CUQ A;  2Q8K A;  2XAQ A;  4ASN A;  1JHF A;  1R1T A;  2FOK A;  4I0B A;  3H3Z A;  2A5Y B;  3ULQ B;  4M9X A;  3FMR A;  5F64 A;  5EEH A;  3QAH A;  4MEY F;  2XAJ A;  2EA2 A;  1XSD A;  1GHC A;  2CSO A;  4KMU X;  1XDU A;  2AS5 F;  2ZKZ A;  3TO6 A;  2O0Y A;  2J5P A;  3MZH A;  5LRR A;  4RAY A;  4LG0 A;  1TW2 A;  3B73 A;  3HHH A;  1MD0 A;  4WF2 A;  3RTR A;  4M73 A;  2O3F A;  1QZY A;  4L0Z B;  4Y17 A;  3DPL C;  4RB0 A;  5D6F A;  4ZZD A;  2LF7 A;  1ZLJ A;  3J81 Z;  2QBY A;  4KIB A;  1XD7 A;  1FNN A;  5A2Q Z;  1KYZ A;  5D8K B;  4Q47 A;  3RKY A;  4LLN A;  1FSE A;  3K1P A;  1Z6R A;  2W24 A;  4ESJ A;  4UVB A;  4EGY A;  4HF2 A;  4ZH4 F;  4LK0 F;  2XVC A;  2P4W A;  1J7K A;  1BI3 A;  1KU3 A;  2W25 A;  2HS5 A;  2GIV A;  2VC0 A;  1SFX A;  3REO A;  3HSE A;  4HX7 A;  2XAH A;  4BYY A;  1S7O A;  1YS6 A;  3FX3 A;  3SQN A;  2DK5 A;  4M9S A;  2LKP A;  2VBX A;  2KIM A;  2ACJ A;  2M45 A;  4HOB A;  4I01 A;  4IHS A;  1B59 A;  4M6X A;  2KIU A;  2WTE A;  3NRV A;  1SAX A;  3ZPL A;  3CUQ C;  3GUD A;  4HX8 A;  1Z91 A;  5FFX A;  2IPQ X;  2IA2 A;  1GXP A;  3HIF A;  2OAZ A;  2R7F A;  2GQQ A;  4UHT A;  3IKV A;  1YW8 A;  4QWQ A;  4EM0 B;  1O7L A;  3F21 A;  5BPD A;  2ISZ A;  3QPT A;  3D5L A;  3SFZ A;  1FLI A;  4PGG A;  2NAZ A;  3RYP A;  1YO5 C;  3EDP A;  2IJL A;  2EWN A;  2OBP A;  3GFI A;  4LB6 B;  4M74 A;  2XGX A;  1C0W A;  1LNW A;  1D3Y A;  4K2E A;  3P9K A;  4RB2 C;  2IA0 A;  4N9H A;  2G7H A;  5E17 F;  1I6X A;  3JTG A;  3GLX A;  3BP8 A;  2QEN A;  2EFO A;  2BGC A;  2PI0 A;  2FA5 A;  2ADU A;  1PUE E;  4G7H F;  4PZJ A;  1J0R A;  4UV8 A;  4EJO A;  3IC7 A;  4D0P A;  2Q0O A;  1FWZ A;  3WTS C;  4QLC U;  3EYY A;  1MJB A;  2V79 A;  3K1N A;  1RUN A;  5ICC A;  1WI9 A;  3MAJ A;  5L3B A;  3BDD A;  4KYW A;  2CW0 F;  4B8X A;  1T39 A;  3C7J A;  2QQ9 A;  2K27 A;  1HW1 A;  1FOK A;  3J80 Z;  1BC8 C;  2FXA A;  3K69 A;  2KJB A;  4YFK F;  4YG2 F;  4M6Y A;  1KU7 A;  3FXU A;  3FMS A;  3P7N A;  4U88 A;  3NEU A;  2FSW A;  2MC3 A;  3W6J B;  3ZN0 A;  2DTR A;  5CVV A;  4G8X A;  5FLX Z;  4G9Y A;  5DDG A;  3TO9 A;  4E70 A;  4EJT A;  1Z1D A;  2IA1 A;  4KMF A;  2IW5 A;  4EMS A;  2K86 A;  2M30 A;  5ICE A;  5DD8 A;  1PDN C;  2EFP A;  3HRT A;  4OIN F;  4U7D A;  5IT9 K;  1I27 A;  3FXR A;  4Y13 A;  4MQV A;  3CO6 C;  2YR2 A;  4CXF A;  5HLG A;  1MGT A;  4ENJ A;  1BOA A;  2FRH A;  2BBY A;  1IRG A;  1EH8 A;  1T38 A;  3SXY A;  4FX4 A;  1UST A;  5TJJ A;  5H6R A;  2BV6 A;  2EK5 A;  2V9V A;  3JAM K;  1Q1H A;  4WXC A;  1MZB A;  1V4R A;  3Q5F A;  1GXQ A;  2VOD A;  2IT0 A;  2M5W A;  5L3C A;  1G3T A;  2QQB A;  2HTS A;  4R1H A;  3GFM A;  3N4M A;  3WTV C;  4UXN A;  4R8H A;  5HLI A;  3WTY C;  1YTY A;  2P8T A;  3L2C A;  3FXQ A;  3I54 A;  2L01 A;  4BHB A;  1V3F A;  1XGN A;  2XIG A;  1JHH A;  2ZCW A;  4WXD A;  2DPU A;  5J8C A;  4HQE A;  3FMQ A;  4LG0 B;  2EJR A;  4R79 A;  3FM3 A;  3F8B A;  1QQI A;  4ZYH A;  2XRN A;  1OYY A;  5DEQ A;  1CGP A;  3BY6 A;  2FBI A;  3T0Y A;  2HKX A;  3VOD A;  4L9J A;  3TOB A;  3V4G A;  2QBY B;  5LEJ A;  1STZ A;  1D8J A;  3FF5 A;  5DV5 A;  1BJA A;  2GAU A;  3HRU A;  4P9U A;  2CG4 A;  4M72 A;  1AOY A;  3BZ6 A;  5FD5 A;  5LGU A;  6PAX A;  1PP8 F;  1KYW A;  4YFN F;  1YIO A;  2ISY A;  2L54 A;  3LA3 A;  5E8I A;  2FBK A;  2H6C A;  2A61 A;  1R22 A;  3T1B A;  3KP2 A;  5H20 A;  5DD4 A;  3TDZ C;  1W5S A;  1QZZ A;  3WG9 A;  1BI0 A;  4WCG A;  1E17 A;  2P7C B;  4I02 A;  3SZP A;  3DV8 A;  3BPX A;  3H92 A;  4KN7 X;  3F6V A;  4KT5 C;  1FYK A;  5E8G A;  5AON A;  4A12 A;  1R36 A;  4L9V A;  2VT3 A;  3R0J A;  2VBW A;  5LEK A;  3IHU A;  4BHP A;  2O6G E;  3C18 A;  2XV4 S;  4HX4 A;  1W7P D;  3ZMV A;  1H9G A;  2M1B A;  3O2P E;  1EH7 A;  3T8R A;  1UFM A;  2UZK A;  2QUF A;  1MDM A;  2P6S A;  4I2O A;  3GF2 A;  4XBF A;  1IXC A;  3LAJ A;  1WRJ A;  3NQO A;  1RUO A;  3GFL A;  1IN4 A;  2F5D A;  1IF1 A;  1IXS B;  4FT8 A;  5K5Q A;  3OOP A;  2P5K A;  1U6G A;  2ESH A;  1TNT A;  3CTA A;  4N0B A;  4A2U A;  1XSV A;  1FT9 A;  3BRO A;  2A3S A;  3KP4 A;  4AIJ A;  5LGT A;  2VN2 A;  4Q5S F;  3I58 A;  5CVI A;  3GYH X;  3V8J A;  3L9F A;  1ZG3 A;  4GYG A;  5LGN A;  1DPR A;  3I71 A;  2DT5 A;  2YX4 A;  5BQT A;  2KJC A;  4MTD A;  3LAP A;  4CYD A;  5F1R A;  2EV5 A;  4LGW A;  4RAZ A;  3E6B A;  3MQ0 A;  1QGP A;  2QZ8 A;  2DAO A;  1FBS A;  2RC4 A;  1ZRC A;  3HOS A;  3VOE A;  1TBX A;  5JVT A;  4RB3 C;  4IRI A;  1SFU A;  3WGI A;  3KEO A;  5HS9 A;  5E1Z B;  2O03 A;  1YS7 A;  2XUB A;  2XKO A;  3RI4 A;  1SMY F;  1Z05 A;  2JZY A;  3I0T A;  3GVA A;  2NNN A;  5LHG A;  2VBY A;  3R60 A;  1JGS A;  5FFZ A;  1XMA A;  3KE2 A;  2XRO A;  2HWV A;  5AIQ A;  1ON1 A;  5LHI A;  2HTJ A;  1XB4 A;  2E1C A;  2A6E F;  4PDK A;  1SD5 A;  5IT3 A;  2YU3 A;  3S2W A;  3L7W A;  2CO5 A;  4ENK A;  4U0Y A;  2ZNY A;  5HS7 A;  3BJO A;  1SD4 A;  3KFW X;  3BOQ A;  2XAF A;  2OD5 A;  5L3G A;  2NNY A;  2L4M A;  2LSO A;  3KP3 A;  3RKW A;  1JXS A;  2MLG A;  1YLF A;  3KZY A;  2RN7 A;  1U8R A;  3ZMU A;  1TLH B;  5ILU A;  2QM3 A;  4KIF A;  4GCV A;  3KET A;  3IWF A;  2OQG A;  3WTW C;  1F9N A;  3K0L A;  3C3W A;  2YPR A;  5L3F A;  1OKR A;  5CJ9 A;  3GO5 A;  5AIP A;  2EV0 A;  4ENN A;  2Y75 A;  5IT9 Z;  3GFJ A;  1YQA A;  3E5Q A;  2HZT A;  1R5G A;  5D5V B;  1G3Y A;  3I53 A;  5ERI A;  1NHA A;  1X3U A;  1B4A A;  4LD5 A;  3ZP5 A;  4OIO F;  4IXA A;  5ILS A;  1D5V A;  3P9C A;  2VC1 A;  4WX9 A;  2RVC A;  2DK8 A;  3JAM Z;  2ZFW A;  3IKT A;  4XSZ F;  3CDH A;  2D45 A;  2G9W A;  2O61 A;  1S8N A;  4ON0 A;  2OZ6 A;  1FY7 A;  3H3U A;  1P6R A;  1LDJ A;  5CVU A;  1W7P B;  4IPA A;  1UHW A;  3PQK A;  1W4M A;  2HKO A;  1BBY A;  2ZBK A;  1ZG5 A;  4RS8 A;  5JI6 A;  4HF1 A;  3GZ5 A;  1JE8 A;  2F5F A;  4EM2 A;  3DKW A;  3ZMZ A;  1RI7 A;  4MTE A;  3P9I A;  4S04 A;  3T8T A;  2DI3 A;  2JPC A;  3U9G A;  2DLL A;  1A04 A;  2HQR A;  2ESN A;  1Z6T A;  2HGC A;  5EEG A;  2PG4 A;  3TOA A;  1K78 A;  3KEQ A;  3WGG A;  4CHU A;  4BH9 A;  1USS A;  3F6O A;  3VEP A;  1MDM B;  5DUK A;  1R1U A;  3DFG A;  4ZYD A;  2EB7 A;  3MFK A;  3E6M A;  3TGN A;  3WTZ A;  3HSR A;  3CO7 C;  3E6C C;  3IRR A;  1ZRF A;  5ED4 A;  2OQR A;  4YFX F;  3ERE D;  1G6N A;  3WE2 A;  3GZ6 A;  1XDS A;  2P5L C;  1SD6 A;  3IWZ A;  4LJZ F;  1S7A A;  4FX0 A;  3KCC A;  5DUI A;  3MZY A;  2VE9 A;  1T2K A;  4HDV A;  1CF7 B;  3N97 A;  1U3E M;  3O3K A;  1LQ1 A;  2MH2 A;  3WTU C;  1O3S A;  3CJN A;  2MLK A;  3J7A O;  1BM9 A;  1P92 A;  1L3L A;  3DXJ F;  4FHT A;  5DYM A;  4RB1 A;  1KU9 A;  5D5W B;  4UUV A;  2PQ8 A;  2NYX A;  3WU1 B;  4CDG A;  2UWM A;  1PP7 U;  1RNL A;  1OMI A;  2EFQ A;  2HEO A;  2DU9 A;  4HZF A;  3CLO A;  4U0V A;  1XN7 A;  3SHF A;  1IN7 A;  3KLN A;  4G7Z F;  3Q9S A;  5LRS A;  1B6A A;  4RGU A;  4L18 B;  3DP7 A;  4AVP A;  4OIR F;  2H94 A;  2DQL A;  3BWG A;  1YYV A;  3LQQ A;  4HF0 A;  2STW A;  1YW7 A;  1QPM A;  4WXH A;  2YX7 A;  1I1G A;  3HTU A;  2V1D A;  3LQR A;  1GVJ A;  2FE3 A;  1XSX A;  2F2E A;  5J8F A;  4G7O F;  2PFB A;  5JR3 A;  1R23 A;  2R7D A;  3KP7 A;  4TV7 A;  4AWX B;  4KUM A;  1FC3 A;  3TKY A;  3RIR A;  1ZGA A;  3Q9V A;  4HA8 A;  3BJ6 A;  4U0W A;  2F5E A;  3GW2 A;  4HLY A;  4AIK A;  3U1D A;  1R58 A;  5HDK A;  3W6K B;  4JBA A;  3GX4 X;  3ABU A;  3ZQ7 A;  4XLP F;  1YW9 A;  2HFH A;  2P5V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...