4EJVA

Staphylococcus epidermidis tcar in complex with chloramphenicol
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
147
structure length
135
Chain Sequence
IEDHISFLEKFINDVNTLTAKLLKDLQTEYGISAEQSHVLNMLSIEALTVGQITEKQGVNKAAVSRRVKKLLNAELVKLIIKLSNKGKKYIKERKAIMSHIASDMTSDFDSKEIEKVRQVLEIIDYRIQSYTSKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Transcriptional regulator TcaR
publication title Structural analysis of the antibiotic recognition mechanism of MarR family proteins
rcsb
source organism Staphylococcus epidermidis
total genus 48
structure length 135
sequence length 147
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4ejvA00
4AD9A 5L3DA 3IRQA 1FT9A 2EFQA 1TW3A 3FHZA 2NRAC 4G8XA 1PP7U 5ILVA 3KP2A 1TNTA 3G73A 4YIFA 1IN7A 3LA3A 2OD5A 2RDPA 4R8HA 1T2KA 2D2WA 2LDUA 1W7PA 1K78A 1S3JA 4HDUA 2GXGA 4S04A 4IVNA 5ICCA 2XHKA 5D4SA 4EM0B 2ACJA 3KETA 4I0BA 1YLFA 2IW5A 3CUOA 4EQQA 2OZ6A 3TQNA 2EFPA 4IF4A 5D5VB 4HQMA 4KFCA 1S7AA 2PI0A 1ON2A 5CVIA 3I53A 2XRNA 2OU2A 3VODA 3F22A 2W84A 4Y17A 4B8XA 4Q47A 5HDNA 2DTRA 3P7NA 3ABTA 1G3TA 3RPQA 2BBYA 1XB4A 1IF1A 2Y75A 4JK1X 4XLPF 1KQ0A 1O3QA 3Q5FA 5JR3A 3HRSA 3TOAA 5ERIA 2CW0F 4RGUA 3R0JA 4FX4A 1XCVA 4LK0F 1T98A 2DI3A 2P5KA 4KICA 2F5EA 5D8LB 1RNLA 4P9FA 4OOIA 2F2EA 4LJZF 2VODA 3VOEA 1W4MA 3F6VA 1H0MA 1HKTA 3GLXA 3G3ZA 1G4DA 2BV6A 4IHTA 4A0YA 1C0WA 2AXLA 2A6HF 1HW1A 4XLNF 5AONA 4HQEA 1QPMA 1JGSA 3WU1B 4PDKA 3E5QA 5HS7A 5LHHA 1MJ9A 5JI6A 3RPUA 5JVTA 4EGYA 4M72A 1ONVA 2QLZA 4U0VA 2A6EF 2KIUA 4ZZDA 5AIQA 1LDJA 3CO7C 4EJWA 1L3LA 2Y48A 4I98B 3K0LA 4BAYA 4ESJA 1HKSA 2NS0A 1B6AA 2L4MA 1FYMA 2VE9A 4ZZLA 5HVQC 2BYVE 1CF7B 2K27A 2E7WA 3E6BA 4KYWA 3V8KA 4WXHA 3MCZA 1BI0A 1T0FA 5FD5A 4ETSA 1U5TA 1FSEA 3FXQA 1ZGAA 3T8RA 3KFWX 3J80K 4M9ZA 5K5OA 4GGGA 4WF2A 4ENMA 3C1DA 1SMYF 2HDCA 1V3FA 1SD4A 1F9NA 4RGSA 2QM3A 3HSFA 2YU3A 2R7DA 4MQVA 5D5XB 3RYRA 3CO6C 4AVPA 1TBXA 1RI7A 3AAFA 3PFIA 1BIBA 1LEAA 2ETHA 1YYVA 3WTZA 3HTUA 2A5YB 4QLCU 5D6EA 4KNYA 3SFZA 1UHMA 1R1TA 4ASNA 4YIIA 4ENJA 5E8IA 1T38A 2O61A 2PJPA 5DYMA 1J59A 2PFBA 4XSXF 3ZMDA 4L5IA 3U9GA 3ZMZA 3L00A 3PQJA 4PCQA 5KVRA 2UXXA 5ILSA 1FP2A 3ECOA 1WQ2A 3E97A 2FMYA 1QGPA 2M5WA 3FM5A 3QP6A 2YX7A 2FRHA 1Y0UA 2BE5F 1S29A 3EDPA 2EA4A 3DEUA 2XIGA 5D6FA 2VC1A 4CDGA 4TV7A 3RKWA 3FMQA 4HX7A 2ISZA 2HQRA 1SMTA 1U8RA 3ZMSA 2FXAA 5LEJA 2L3DA 3HTSB 4RAYA 2DU9A 2IA2A 5TJJA 1X3UA 1EH7A 4H0EA 1STZA 1K78B 4WX9A 2XASA 5LHIA 3ULQB 1K6OA 1I6XA 3DFGA 2IPQX 3FMSA 3BY6A 5K5RA 1ZREA 4XRFA 2H09A 2C6YA 2V9VA 2W85A 3DPLC 1OMIA 3C18A 3R61A 1ZGJA 3Q9SA 2FNAA 3TO6A 1OYIA 2JZYA 3KE2A 4EVIA 1R5HA 2FOKA 1E17A 3MAJA 4M73A 4MHGA 1TQMA 3MWMA 1XGNA 3BROA 3J81K 3LFKA 2YPRA 1PUEE 1TQPA 2XAJA 1O3RA 1U2WA 2CWEA 1IN4A 4GCVA 5HS8A 2IRFG 1XSXA 4BYYA 4A5NA 1R22A 4ZYEA 2L01A 2M87A 1R1UA 2Z9OA 3HOTA 2VT3A 4EV0A 3KCCA 1JHHA 1IW7F 1BI3A 3QRFF 3K1NA 3O3KA 4CHUA 5LGTA 5EEHA 4KIFA 2RNJA 2EB7A 1SD5A 2DPDA 4E70A 1O3TA 2Q8KA 4MQ9F 4UUVA 5IT9K 4UVBA 1BI2A 1JE8A 4IXAA 2QBYA 5IT9Z 3TOBA 3R0AA 1G3SA 5FFXA 3F23A 3COAC 2VE8A 4LK1F 3GZ5A 5DCMB 5HS9A 2RQPA 2Z33A 2CGPA 5L3CA 3EUHA 1U5TB 2E1NA 3KZZA 3FZVA 2DLLA 3P9CA 2XV4S 4RB0A 5DDGA 3U2RA 4G7HF 3ZMVA 1TNSA 1BN5A 3V4GA 3C3WA 4L5JA 1UFMA 1Z6TA 4G94A 1Z05A 4LG0A 5E1WA 1FSHA 2JPBA 4RS8A 2FMLA 1QZZA 3ZMUA 1MKMA 3ERED 1GXPA 1B9MA 1ZRCA 1R5GA 2W57A 2PMHA 4L9TA 3MEXA 1QBJA 2LF8A 2VXZA 3B02A 5LRRA 1QNTA 2HR3A 2ESNA 4KA4A 1A04A 3I59B 2EV5A 3BJAA 4HF2A 2CYYA 2GA2A 4G6DA 4LGWA 1ZLJA 1K79A 2EFNA 2KIFA 5JFRA 2A61A 3E3VA 2H94A 3TDZC 3TO7A 3HSRA 4OIPF 1LDKB 3E6DA 3ELKA 3CUQC 3GFLA 3D5LA 4ENNA 4AIHA 3ZP5A 2GQQA 3MQ0A 1TQIA 3JW4A 5JHUA 3RKYA 3R4KA 3DP7A 3LQQA 2GA1A 1MDMA 3HSEA 2GAUA 3CUQA 1G3WA 5FB2A 1S7OA 4UNOA 3JSOA 1SAXA 2G7HA 2NNYA 1IUYA 1OKRA 2A69F 4HF1A 1H9GA 3DKWA 4KDPA 1XMAA 2EA2A 1BC8C 4PGGA 2FU4A 1USTA 1DPRA 2MH2A 2VBXA 4R79A 2FBHA 1F1ZA 2QZ8A 3BJOA 4OINF 4DNCA 2VBYA 3RJPA 4OMZA 2K86A 4AIJA 2GZWA 3MZHA 1XCBA 5K5QA 4Q48A 3K69A 4YFNF 5D5WB 1XDSA 2HZTA 2HYFA 2QQAA 5D8KB 3HHHA 2DQRA 3HRUA 2YX4A 4ON0A 1L0OC 4RB1A 3GFIA 4OU0A 1W5SA 4L18B 2HOEA 1BI1A 1IZ1A 2YR2A 4EM1A 2NYXA 1SD6A 2HKXA 2HWVA 2WWYA 5ICFA 3M8EA 4M71A 4O5VA 5HOOA 3HHGA 1ZN2A 2FA5A 4CZZA 3WG9A 2OAZA 2ELHA 3RKXA 5EEGA 4RGXA 3QOPA 4HYEA 4IRIA 2P7CB 2XVCA 3GVAA 1J9IA 2ZCWA 2STWA 4BHBA 3HIFA 5ILUA 2F5FA 4Y15A 3L9FA 4U0WA 1ZRFA 3KZYA 3SXYA 5AIPA 2FQ3A 5DD4A 2V1UA 3GWZA 1Q1HA 1KU3A 5CVRA 2ESHA 3ZN0A 3J80Z 3LA7A 2LKPA 3RIRA 2HEOA 2LNBA 3IWFA 4KN4X 1R36A 3JTGA 2FF4A 3JSPA 1YO5C 1JHFA 3QAHA 2MBFA 3WGIA 2W25A 1BBYA 4D0PA 5BOXA 1BOAA 2PN6A 3GYHX 2XUBA 3HRTA 2LSOA 2HFHA 2JPCA 5LGUA 3FM3A 3I0TA 5BQTA 2M45A 1SFUA 4BHPA 2PBIA 2R7FA 1RUOA 5CVJA 3JAMK 1LVAA 4HLXA 4L0YB 3T5XA 4KIGA 3JAMZ 1U3EM 2G7UA 2XAFA 5LLQA 3BP8A 2UXNA 3DXJF 2OZUA 1B4AA 2GWRA 1MZBA 3KP7A 3RDIA 5CVUA 1F5TA 3WGGA 4F7ZA 4LG0B 3LWFA 2M8EA 4FX0A 2G9WA 1UHWA 2EFOA 5E1ZB 3Q9VA 3WODF 4O6JA 2CQKA 1YG2A 1DP7P 1D8JA 3QPTA 3KP6A 4BNCA 4FHTA 1D3YA 5H6RA 3NRVA 4L0ZB 1JXSA 1WWXA 4DQ2A 1Z7UA 2OA4A 2EWNA 1CGPA 1Z1DA 3EYYA 1BJAA 2UWMA 1PDNC 1TW2A 3H92A 5DUIA 4R1HA 2VN2A 3F8FA 3SQNA 4KUMA 5CJ9A 1KGSA 1WSUA 5LHGA 2HQNA 2UZKA 5TRDA 1FOKA 3L2CA 4GO1A 1W7PB 1G6NA 4I01A 1FWZA 1MDMB 3BWGA 5FLXK 5LBQA 3O2PE 2E7XA 2IJLA 5J8FA 4GYIA 3WGHA 4JQFA 3WTTC 3I4PA 5FLXZ 3KEQA 3E6CC 4HDVA 1LQ1A 2QUFA 1I5ZA 4ESBA 4I2OA 4HZFA 3IC7A 2A68F 1ZG1A 3FX3A 5E17F 1SD7A 1FPQA 3ZN1A 3F21A 2Z5UA 1B9NA 5BPDA 4KT5C 1QQIA 2DPUA 4UVCA 2DK8A 4IRGA 3B73A 1XGMA 2M30A 1LEBA 3VB2A 4M9SA 1XDUA 2XGXA 4LB6B 2X4HA 3BOQA 3LAPA 1F4KA 3H3ZA 4GYGA 4LFUA 1B59A 1P4WA 2QWWA 2RC4A 1W5TA 3T8TA 2IT0A 1O57A 3GFMA 3WTUC 4HV5A 1FLIA 1KA8A 3J81Z 5DV5A 3T0YA 2JSCA 4JBAA 4BQAA 1YS7A 2P5VA 3DV8A 1ZHFA 2QQBA 4LB5A 4ZH4F 3GEZA 3KLOA 4EJVA 1T39A 1MJAA 2HTSA 5K1YA 4CGZA 2ADUA 1DUXC 4GXOA 3BDDA 1XSVA 4AWXB 1IRGA 4YFKF 4M6YA 4BH9A 5L3FA 1W7PD 1G3YA 3V7RA 5L3EA 2OQGA 2P8TA 1I27A 2CSOA 3LQRA 2ISYA 5KK1A 4IJAA 2MA3A 1R00A 3WU0A 4I0AA 3TO9A 4Y13A 2YSRA 4XSZF 3DPTA 2F5DA 4NB5A 1OPCA 4UV8A 1FYLA 1MD0A 1S6LA 1FBUA 5LGNA 3TDUC 3L09A 4A5MA 1FBQA 5HLHA 4MGRA 3GX4X 3V8JA 2FSWA 1IXRC 4MTDA 4EJTA 1SFEA 4P5OA 2VOPA 2O03A 4CXFA 4LD5A 2MLKA 3MFKA 2IA1A 3OOPA 3CTAA 3ZMTA 2ZMEA 5E18F 1XD7A 2HTJA 2A3SA 2HGCA 5A2QK 2VOOA 4IHSA 2K7LA 1D8KA 1YW9A 4UXNA 4LLNA 1LDDA 5ICEA 1YQAA 3CLOA 4WWCA 1FNNA 2QQ9A 4MTEA 2O6GE 4LMYA 1DDNA 3S2WA 1P4AA 4A6EA 3I58A 1Z91A 3O6BB 2DO7A 5HDGA 3N4MA 2RVCA 4AIKA 2ZJ2A 2V1DA 4A6DA 2RGVA 1IAWA 1BIAA 2J5PA 4U88A 3E6MA 3K1MA 5FGMA 1RIOH 4YG2F 2XKOA 3KP4A 1R7JA 3FF5A 1ULYA 3KP3A 3ISPA 5F6FA 2XAGA 5BS6A 1REPC 3VFZA 1U6GA 1BM9A 3BJ6A 2XKPA 2ZFWA 3F72A 1KYWA 3ZQ7A 1MJBA 1FZPB 4CO8A 1OYWA 2OBPA 5E1XA 1AWCA 5HDKA 4N9HA 1P6RA 2K02A 3F3XA 4RB3C 3GUDA 3SZPA 4HBLA 2ZBKA 1J0RA 2VC0A 1Z6RA 3FMRA 4L9JA 5FD6A 1GVJA 4LLGF 1BC7C 4KIBA 3ZPLA 1LJ9A 1E2XA 2PMUA 2PEXA 2BGCA 5F64A 1WKMA 1YW7A 1ZG3A 2Q0OA 5J6XA 1XN7A 3E5XA 4EJUA 1HXDA 3KLNA 2XAQA 4M74A 1R23A 3P9IA 4UHTA 2QENA 3IRRA 2CG4A 2L02A 2BEOA 5DUKA 3ML6A 3EYIA 1P2FA 2VBWA 2AS5F 2Q2EA 3SZTA 4OIOF 4WK8F 2Y0MA 3QP5A 4RAZA 4BXUA 4HW0A 2M1BA 4WCGA 3ABUA 2FBIA 3DQVC 2RV8A 2D1HA 2B0LA 1I1SA 2MC3A 1IN8A 4KMFA 1XGSA 2EK5A 1R58A 1RZ4A 1KU9A 1WRJA 3IKTA 4HOBA 4Z2YA 2KJBA 3V7SA 3K2ZA 2PQ8A 2JTVA 2FBKA 2J5OA 3HYIA 3BPVA 4CYDA 4HA8A 4ESFA 5IT3A 1HSJA 2P6SA 3RYPA 4UVAA 1H9TA 2O3FA 2L4AA 2KRFA 3V7CA 1P4XA 2VBZA 3NQOA 3E5UA 3HOSA 3TKYA 4OIQF 2DK5A 1K7AA 3F8NA 4Q5SF 3NEUA 2LF7A 4ZYHA 4G6QA 5CYVA 3F8MA 3QU6A 3D0SA 5E8GA 1B1BA 2WTEA 5L3GA 3KEOA 4UV9A 2W24A 3LA2A 5CVVA 2DFIA 3W6JB 4EMSA 3F8BA 2JT1A 1U5TC 2H6CA 4EJOA 2NAZA 3PQKA 3QU3A 5DCMA 3GW2A 2RN7A 1YIOA 2A07F 1FX7A 5HLGA 1R1VA 1FYKA 1ZARA 2EV6A 3FXRA 2QBYB 3SHFA 1U78A 3WE3A 4PGHA 3GXOA 1O3SA 3GFJA 1USSA 4G9YA 4ZYDA 3K9TA 2F5CA 2GIVA 1HBXG 5FO5A 2K4BA 5BMZA 1IRFA 4HX4A 2TDXA 5FFZA 2R3SA 2CFXA 1KYZA 3I54A 2ZMEB 5LEKA 3R6SA 2NNNA 4I7HA 3QPHA 3F8CA 3LAJA 5ICGA 2FEZA 3I59A 3MZYA 3IKVA 4U0YA 4A12A 3P9KA 1T6SA 4U7DA 3T1BA 2O8XA 2MD5A 1KQ8A 3IWZA 5H20A 4ENKA 1P92A 5H6QA 3GZ6A 4P96A 2H6BA 1VTNC 3ROUA 2Z99A 2IP2A 4IRHA 2P6TA 1UCRA 4OMYA 2COMA 3WTYC 1HSTA 1ON1A 2RKHA 4K2EA 3WTSC 2PG4A 4HLYA 1ZG5A 4P9UA 2EV0A 1ZH5A 4Q4ZF 1MGTA 2ZXJA 3FWEA 1HKQA 5CLSA 4BHCA 2HS5A 2D1VA 3C7JA 1TLHB 4M6XA 1J75A 3M9AA 5J8CA 5D4RA 3WE2A 4U7BA 1XSDA 2XROA 6PAXA 3L7WA 2VONA 4MEYF 4WXDA 1IN5A 4PZJA 2DW4A 3CUQB 4L9VA 2VT2A 3EQLF 5F1RA 1NHAA 2P4WA 1J7KA 1XMKA 1HQCA 1EH8A 2D45A 3I71A 3RTRA 2KKOA 1RUNA 1YTYA 1AOYA 1ZRDA 1EH6A 1ZLKA 5HLIA 2V79A 4NQWA 1OR7A 4YFXF 3DF8A 3W6KB 2DQLA 4G7ZF 1WI9A 5LRSA 2E1CA 4LLLA 3I64A 3OV8A 2DBBA 2P5LC 3M1EA 1Z9CA 3F6OA 3N97A 3BPXA 3VEPA 4MEXF 4WXCA 1O7LA 2FE3A 3TGNA 3J7AO 3HUGA 2DAOA 2MH9A 3REOA 1V4RA 1EV7A 4S05A 2WV0A 3WTVC 2FNPA 2STTA 1ZYRF 2P7VB 4A0ZA 2GXBA 3EETA 4RGRA 1DPUA 4KMUX 1KU2A 3V8LA 4IPAA 2CO5A 5DD8A 4OIRF 3ECHA 4M9XA 5DCFA 2QVOA 3KP5A 3FXUA 4KN7X 2ZO4A 4N9IA 1KU7A 1ODDA 5BPIA 4XBFA 2O0YA 2HYGD 1KQ9A 1CF7A 1SFXA 5DEQA 1J2XA 3JTHA 4L9NA 4ZYGA 4I02A 1FBSA 1LNWA 3K1PA 1QO0D 5L3BA 3M8FA 2KJCA 1HW2A 5D5UB 3R60A 2XAHA 4B09A 4QWQA 4NHJA 1IN6A 2WC2A 2EJRA 2IA0A 4EM2A 3I5UA 4CICA 3CJNA 2MLGA 5ED4A 2DT5A 2PLYA 2H27A 1OYYA 1O7FA 3U1DA 1FC3A 4N0BA 5E20A 1FY7A 3H3UA 3CDHA 2K4JA 2ZKZA 3GF2A 4EGZA 4HV6A 2X0LA 4HX8A 4HAMA 4G7OF 3IHUA 1PP8F 5A2QZ 1I1GA 1J5YA 1D5VA 1FP1D 1LB2A 2L54A 2QYOA 4P55A 3LSTA 1YFHA 4O3MA 2V1XA 2HKOA 2ZNYA 3BZ6A 1QZYA 2KIMA 3IL2A 1UB9A 4MNUA 1GHCA 3GO5A 3M7GA 1HW5A 4RB2C 1IXCA 2EFWA 4HF0A 4A0XA 3RI4A 2IVMA 2Z3YA 3WTWC 2JRTA 3WTXC 1S8NA 4I09A 1YS6A 1TTYA 4A2UA 4FT8A 2OQRA 2ZNZA 1IXSB 1ZAOA 3HRMA 1XGOA 1GXQA 1YW8A 2V6CA
chains in the Genus database with same CATH superfamily
4AD9A 2R7ZJ 5L3DA 3IRQA 2FUG2 1FT9A 2EFQA 1TW3A 3FHZA 1JJ8C 1TT0A 1MBKA 3OYLA 1UELB 2NRAC 2DFHA 2DDBA 5EF6A 3WHCA 5K7HA 2HVSA 4G8XA 1PP7U 5GPAA 4XKWA 1H8AC 5ILVA 3BG9A 3KP2A 1TNTA 2ZXHA 4E4HA 3G73A 4YIFA 1IN7A 3LA3A 1HCRA 5CKTA 2OD5A 2Y0SA 4BACA 2CMPA 1JUSA 2RDPA 2LKSA 4R8HA 1YI2I 3E0JB 1MNDA 3HOVJ 1T2KA 2D2WA 4A3LJ 2LDUA 2LG4A 5FKNA 1W7PA 1K78A 4CYCB 1S3JA 2VPRA 4HDUA 2GXGA 4S04A 4J01A 4IVNA 5ICCA 1ETKA 4XORA 2XHKA 4M6VA 1OFCX 5D4SA 1S5LC 3KYDB 4C30A 2NVQJ 4EM0B 2ACJA 3KETA 4BY1J 4I0BA 1YLFA 1ZGWA 2IW5A 3CUOA 4EQQA 2EIMH 2OZ6A 2KRHA 3LFUA 4RA2A 2L9NA 5F08A 3TQNA 2XC7A 2EFPA 4IF4A 5D5VB 1MIJA 1EF4A 4HQMA 4KFCA 1XC5A 4KISA 3HPHA 2Y0SN 2Z2SB 2YU9J 2VQHA 1S7AA 2PI0A 5JVGF 3Q0WA 1ON2A 5CVIA 3I53A 4IEJA 1RESA 3HKZA 3HOUJ 2XRNA 2OU2A 3VODA 3F22A 1JI8A 2I5UA 2W84A 2NVYJ 4Y17A 4B8XA 3QOEA 4Q47A 5HDNA 2DTRA 1TWHJ 1X1BA 3ABTA 3P7NA 1G3TA 3NAUA 1K83J 1A36A 4A3IJ 2WY7Q 3RPQA 2BBYA 1JUMA 4QSHA 4QPQA 3CCJI 4H4KC 3FISA 4PJJA 1XB4A 1D0ZA 1IF1A 3B6CA 3GTKJ 2WAQA 4C2TA 2Y75A 2JMWA 4JK1X 4XLPF 3W2WA 3HXLA 1KQ0A 2CUJA 1WJAA 3ZRGA 4QPOA 1VQ4I 1GLNA 1O3QA 4DBQA 1QVTA 4RM3A 5JR3A 3Q5FA 5C4JJ 3HRSA 2M4KA 4NQWB 3FK6A 3TOAA 1WJCA 5ERIA 2CW0F 4RGUA 5J4YA 3D1NI 3R0JA 3HKZN 4FX4A 1XCVA 4LK0F 1T98A 2DI3A 2P5KA 4E7KA 1D1BA 4KICA 2F5EA 5D8LB 2R7RA 2DT6A 1RNLA 3GTPJ 2Q1ZB 4RDUA 4P9FA 4IOCF 4OOIA 1CQTA 2F2EA 9ANTA 4LJZF 3OR2C 1MNEA 2VODA 3VOEA 1W4MA 2WAQN 1ETWA 3F6VA 1NH3A 1H0MA 1HKTA 3GLXA 3G3ZA 3S93A 1G4DA 2E35A 2BV6A 3OYCA 4IHTA 4A0YA 3HUGB 1C0WA 2AXLA 1HDDC 2A6HF 1HW1A 4CA0A 4XLNF 5AONA 1YRNB 4HQEA 4BJ6C 1QPMA 1MMDA 3JRBA 3ABMH 2WV1A 4PJ0C 1JGSA 3WU1B 2DMTA 4PDKA 3BR0A 4BS9A 3E5QA 5HS7A 5LHHA 1MJ9A 5JI6A 3RPUA 1U8BA 5JVTA 4C2UA 3CC2I 3A2KA 4CCJA 1NK2P 3BC8A 4EGYA 4M72A 1ONVA 2QLZA 1RR7A 4U0VA 2A6EF 2KIUA 4ZZDA 5AIQA 2GIZA 1HOMA 1LDJA 3CO7C 4BL0B 4EJWA 1L3LA 4BE1A 2IGMA 2Y48A 3BTIA 1GVDA 4I98B 2XPWA 3K0LA 4BAYA 3CCSI 4ESJA 1HKSA 2G0EA 2IS6A 3H9JA 2NS0A 1ORKA 1T0FC 1IG7A 1B6AA 2L4MA 2DA3A 1OCPA 2XF7A 2VE9A 1FYMA 2V1NA 3X2QH 4ZZLA 4BUPA 4Z6YA 5HVQC 2BYVE 1ZELA 1CF7B 3IH2A 2K27A 2E7WA 3QPLA 3E6BA 2IGKA 4RBOA 5FRNA 4PK4A 1GT0C 5E3OA 4KYWA 3V8KA 2E5ZA 4WXHA 2E19A 2LR8A 3K4KA 4JX5A 3MCZA 1BI0A 1T0FA 3OR1C 5FD5A 4ETSA 4HNTA 1Z7LA 1U5TA 4E7JA 1FSEA 3FXQA 1ZGAA 1AKHA 3T8RA 3KFWX 3J80K 4M9ZA 5K5OA 4GGGA 4WF2A 5M3FJ 4ENMA 3C1DA 4RLQA 1SMYF 2KZGA 2HDCA 1V3FA 3L2UA 1IRXA 1SD4A 1WH5A 1F9NA 3L2RA 4RGSA 2QM3A 3HSFA 1QHHD 3OYAA 4NBQA 3IV5A 2YU3A 2DTZA 2R7DA 4MQVA 5D5XB 1X3WB 1XTAA 3RYRA 3CESA 2KL4A 2VIXA 2L9SA 4AVPA 1TBXA 1RI7A 3CO6C 1P7JA 1N75A 3L2QA 2DFEA 3AAFA 3PFIA 1D0XA 1JT6A 1BIBA 2X9DA 1LEAA 2I8DA 1I3AA 2ETHA 1WVRA 1YYVA 3WTZA 3HTUA 2DMPA 1YE9A 4NC7A 2X6OA 1LE8A 5EGOA 3FDYA 2O9LA 2A5YB 4QLCU 3BQZA 5D6EA 4G6TB 5M3MJ 4KNYA 3SFZA 2BZTA 1Z0XA 1UHMA 3JRIA 1R1TA 2K85A 4ASNA 4YIIA 3LNQA 2KDZA 4ENJA 3OYNA 3BTLA 5E8IA 1EJ9A 1T38A 1R9TJ 5B5EC 2O61A 2PJPA 5DYMA 1IC8A 1J59A 3DPUA 2PFBA 4XSXF 2Y2ZA 1QPIA 3OYIA 2W82A 3ZMDA 1LVKA 2KMUA 3BT9A 4L5IA 3U9GA 1X2MA 2V4JC 3ZMZA 4IQJA 3L00A 2X6XA 5GPCA 3PQJA 1UG0A 3DKYA 4PCQA 4RAGA 1JJ6C 5KVRA 2UXXA 5ILSA 2RREA 1M1EB 3TMOA 1FP2A 3ECOA 2ZSIB 1WQ2A 4AC0A 3E97A 2FMYA 4FQGA 3FIWA 1QGPA 2M5WA 3OOUA 1IUFA 4A3MJ 4HSTA 3E7LA 3FM5A 3QP6A 2YX7A 2FRHA 2LBFB 1HF0A 2KQRA 1Y0UA 2BE5F 1S29A 3EDPA 1R49A 4DOZA 4PFOA 2EIJH 2K9LA 4BBSJ 1IDZA 4BJTA 2EA4A 3IAM2 3DU6A 3DEUA 5IY5H 2XIGA 5D6FA 4CCKA 2VC1A 4CDGA 4IHYA 4TV7A 3RKWA 3FMQA 4HX7A 2VKDA 1QHGA 4YELA 2ISZA 4FE7A 2HQRA 1SMTA 2LLKA 1A31A 1U8RA 2PJRA 4ZJZA 4XM3A 3ZMSA 1YJNI 2FXAA 1Y1WJ 5LEJA 4A3GJ 4LITA 2L3DA 2R5YB 3HTSB 1APLC 4RAYA 2DU9A 4PUSA 2IA2A 5TJJA 1X3UA 1DGWY 1EH7A 1X1CA 1PVEA 2VJ5A 3GTJJ 2E2HJ 2R0QC 2BY2A 3M8JA 4H0EA 1STZA 1X2NA 3LSRA 1K78B 4WX9A 4NDLA 1MBHA 4NNJA 2XASA 4X0GA 1WI3A 5LHIA 3K4NA 3ULQB 2VJ4A 3H35A 1I6XA 2GOMA 5GAGJ 1K6OA 5H2FC 3NARA 3S3MA 1IJWC 3DFGA 2IPQX 3FMSA 3KX2A 3BY6A 3OYEA 2DA7A 1NTCA 5K5RA 4XRFA 2BXYA 3H5AA 1ZREA 2H09A 1AHDP 2XB5A 2C6YA 3FXJA 2V9VA 4HNVA 2W85A 3DPLC 3TP0A 1IO2A 1OMIA 3VSLA 3C18A 5BNGA 3R61A 1ZGJA 2COBA 3Q9SA 2FNAA 3TO6A 2K9QA 1OYIA 2JZYA 2DMQA 3KE2A 2DOEA 4EVIA 4A93J 1R5HA 3PO3J 2FOKA 2YUSA 3MAJA 1E17A 5EZGA 3MD2A 1WFXA 4M73A 1YIJI 4NC8A 4A3BJ 4MHGA 4XRMA 5IP7J 1TQMA 3MWMA 1XGNA 2M7AA 4ANJA 3BROA 3J81K 4JYKA 3LFKA 3K4CA 3A0HC 2CJJA 2YPRA 5EZHA 2H1KA 1PUEE 2M4GA 2QSGX 2AQFA 3QYBA 1TQPA 1X19A 3CMAI 1Y8RB 2XAJA 1T8IA 2MG4A 4II2A 2LH9A 4CUGA 1O3RA 4AYBN 1H89C 4W1UA 1U2WA 2LY1A 5EG0A 4RLFA 4XOTA 4FISA 3JR9A 2CWEA 2FOWA 1IN4A 4GCVA 5HS8A 2IRFG 2UV1A 2GLOA 2JVGA 1XSXA 4BYYA 4XN3A 1U9NA 3OYFA 4A5NA 1R22A 5GAEJ 2BY0A 2EZLA 1RR8C 4FCYA 2ID3A 4ZYEA 3A01A 2L01A 2EH3A 2M87A 2RNGA 1R1UA 2CRGA 3ERMA 4J00A 3BQYA 2Z9OA 1VQ6I 3MVPA 3HOTA 2VT3A 3HOYJ 2L2OA 2M0CA 4EV0A 4JX6A 5GADJ 3KCCA 1JHHA 1IW7F 1BI3A 3ZQIA 3QRFF 1W0UA 2DYRH 1JTYA 4N4OB 3K1NA 3J7YJ 3O3KA 1P7IA 4CHUA 5LGTA 5DM6F 4BBRJ 2XB0X 3LSIA 5EEHA 4CCOA 3H9QA 1W5CC 4KIFA 2RNJA 2EB7A 1SD5A 2DPDA 2XSJC 4E70A 3O8GA 1O3TA 2F5VA 2Q8KA 3EPZA 4MQ9F 1JTXA 4UUVA 4XNFA 2WB1N 3LSPA 4XKVA 2NXNB 5IT9K 4UVBA 3LMMA 1BI2A 1JE8A 2YS9A 2GOXB 3I55I 4IXAA 1JKQC 4DZJA 3CJRB 5JHFA 3RZOJ 2QBYA 5IT9Z 5TISC 2WAFA 3EUHC 2R7OA 3TOBA 1MMAA 4F55A 3TEDA 3R0AA 1G3SA 5FFXA 2VB6A 1HDPA 3F23A 3COAC 2VE8A 4LK1F 3GZ5A 3PJRA 4XR6A 2CQXA 5DCMB 5HS9A 3HL2A 2OC6A 2RQPA 2CW7A 2ZMEC 2ELKA 2Z33A 2CGPA 3CCRI 5L3CA 3EUHA 4ABZA 5KAIC 1LPQA 1U5TB 2E1NA 3KZZA 3FZVA 1AKHB 4D1QA 2DLLA 4PJMA 3ZGKA 1X1DA 3P9CA 2O7OA 2O5RA 2XV4S 3G6EI 4RB0A 5DDGA 3ZQLA 3U2RA 4G7HF 3ZMVA 3BTCA 1TNSA 1BN5A 3LSMA 5J1YA 4F52A 3GTQJ 3W3CA 3Q0VA 3V4GA 3C3WA 4L5JA 1Y39A 1UFMA 1B72B 1Z6TA 1Y0NA 4G94A 1BOBA 4DGWB 3BTJA 1Z05A 3OMYA 3W6VA 4LG0A 2KFDA 4MLOA 5E1WA 1FSHA 2JPBA 2QKMB 4RS8A 1PUFA 4C3JJ 3CMMA 2FMLA 2ZFUA 1QZZA 1W1WE 1I6HJ 5J1UA 3ZMUA 1MKMA 4A3KJ 2HOSA 3ERED 3BG5A 1GXPA 1B9MA 1ZRCA 3D5SC 2F4OB 5EGOB 1LE8B 1R5GA 1RRJA 2W57A 3FXMA 5HNFA 3OYHA 3CCQI 1EA3A 1JUPA 2PMHA 4L9TA 2L9VA 3MEXA 1QBJA 2LF8A 1T56A 2VXZA 3B02A 5LRRA 1QNTA 2HR3A 3DWLE 2RQQA 4XIDA 3Q0UA 3RPUD 1DU6A 2ESNA 4KA4A 1A04A 3I59B 2EV5A 1R5ID 3BJAA 5E3NA 4HF2A 2CYYA 3ZOBA 1BJZA 2GA2A 4G6DA 1ZQ3P 2HDDA 5FRMA 4LGWA 2JUCA 3FKJA 5B3SH 1ZLJA 3S16J 3S2DJ 2N8GA 2K5CA 2EILH 1K79A 2EFNA 2KIFA 5JFRA 1WZ2A 3PNYA 3H5NA 1TWAJ 2A61A 3E3VA 5GAHJ 2DA5A 2H94A 3TDZC 3TO7A 1WHUA 3HSRA 4OIPF 1ZR4A 1LDKB 5B1BH 3E6DA 2XGEA 2BVMA 3ELKA 3CUQC 3GFLA 3D5LA 4ENNA 2X1CA 4AIHA 1TC3C 3SDGA 3ZP5A 2GQQA 3MQ0A 1TQIA 3JW4A 2BXZA 2E60A 5JHUA 2Y30A 3RKYA 3R4KA 3DP7A 3LQQA 2GA1A 3DCFA 2HU9A 3BR1A 2ECCA 1MDMA 1S7EA 3HSEA 5J3LA 2GAUA 2CFOA 4XRSA 3CUQA 1G3WA 1V55H 5FB2A 1S7OA 2XDVA 4UNOA 3JSOA 2JJ7A 1AU7A 2LK2A 1SAXA 2G7HA 2NNYA 2KT0A 1TL8A 1IUYA 1OKRA 3OYMA 2A69F 4HF1A 1H9GA 2E1MC 3DKWA 3IH3A 3BR5A 1UJ8A 4CCMA 1BL0A 2PJRB 4KDPA 3LSHA 1XMAA 4ZDLA 2EA2A 3PM1A 1BC8C 3TL4X 2DXIA 4PGGA 3S2HJ 1KZHA 1NK3P 2FU4A 1USTA 1DPRA 2MH2A 2VBXA 4R79A 2FBHA 3HGYA 1F1ZA 2QZ8A 3BJOA 4OINF 3CMEI 4DNCA 4XQFA 4P1WA 2VBYA 4Y4RA 3RJPA 5K7FA 4OMZA 1VQNI 2NS8A 1TZLA 2K86A 4AIJA 3GTMJ 2DA2A 2GZWA 3MZHA 1XCBA 2DA4A 5K5QA 4Q48A 3K69A 1X4PA 3DTIA 2ME6A 4YFNF 5D5WB 1XDSA 2HZTA 2ZC2A 2HYFA 4Y33A 2F6CA 2QQAA 5D8KB 4AU7A 3HHHA 1V54H 2XGDA 3ASOH 4ZDOA 2DQRA 2XF5A 3HRUA 3A03A 3MKLA 3TBIA 2YX4A 4ON0A 1L0OC 2DMNA 2LTPA 4RB1A 3GFIA 1Z67A 4OU0A 4M3DA 1W5SA 4L18B 2HOEA 2DJNA 5IYDJ 1BI1A 1IZ1A 2NOGA 2YR2A 4D7NA 5M5XJ 1BW6A 3OYGA 1BW5A 1R4MB 3HEFA 4EM1A 2CV2A 2NYXA 4RM2A 1SD6A 4KITB 3OS2A 1TWCJ 1JKPC 2HKXA 5FKLA 1SANA 4F92B 2HWVA 2WWYA 4AIDA 3DLLF 3OSFA 5ICFA 2TCTA 5JLWA 4DW6A 2VKHA 2CS3A 3M8EA 4M71A 4O5VA 2W00A 5HOOA 3H36A 3HHGA 1ZN2A 2QEXI 3GTLJ 2XPUA 2JK3A 2FA5A 3PFYA 4CZZA 2R7SA 1DU0A 3WG9A 3HOZJ 2OAZA 3M07A 2ELHA 1JKRC 3RKXA 3M3YJ 1V5EA 5EEGA 3H0GJ 2K40A 3UKGA 1OCRH 2CUFA 4RGXA 2M2EA 3QOPA 4HYEA 2FD5A 2FX0A 3SJMA 4IRIA 3PO2J 2VQCA 2P7CB 3QYEA 3HDDA 2XVCA 3PNVA 3GVAA 1QA6A 1WJFA 1J9IA 1HA8A 2ZCWA 3K6GA 2STWA 2VUMJ 4BHBA 1X3ZB 3HIFA 1ZKGA 3DBRB 5ILUA 5F0CA 2F5FA 5E3MA 4Y15A 5FKKA 3L9FA 4U0WA 2EZHA 1ZRFA 2W4SA 3KZYA 1OLTA 3SXYA 3AL0C 3H9GA 5AIPA 2FQ3A 5DD4A 2W7NA 1XS9A 2BY3A 1ZR2A 2VJJA 1I39A 2V1UA 1X1PA 1Q1HA 1KU3A 2PX9A 3GWZA 5CVRA 2ESHA 3ZN0A 3J80Z 5EEAA 3DTEA 3LA7A 2LKPA 2CH0A 3RSNA 4X6AJ 3RIRA 4XLHA 3K4LA 4XLEA 2HEOA 1FEXA 2LNBA 2X6WA 3IWFA 4KN4X 2L7ZA 1K4SA 1VI0A 1R36A 2VL8A 1FTZA 3JTGA 2M9HA 2FF4A 3JSPA 1YO5C 3IH4A 1JHFA 3QAHA 3QQAA 2MBFA 3WGIA 2W25A 1BBYA 1E3HA 4D0PA 5FROA 5BOXA 1BOAA 3ABKH 2BW3B 3OS1A 2PN6A 3GYHX 2XF6A 2XUBA 3CCYA 3HRTA 3SDBA 4IO9F 2Y9ZA 4BEHB 2LSOA 2HFHA 2JPCA 3UR3C 2DODA 5LGUA 3JRAA 5K7ZA 1NG6A 1SEUA 3FM3A 1Z77A 4IHXA 3I0TA 1RPWA 4CH7A 5BQTA 2M45A 1SFUA 3CJTB 4BHPA 3L2WA 2PBIA 2R7FA 1RUOA 3N05A 2GXAA 5CVJA 3JAMK 2KZVA 1LVAA 4HLXA 3CC7I 3KYLA 4L0YB 3T5XA 2L7MP 4KIGA 3JAMZ 1U3EM 1E3PA 2G7UA 4AVZA 2XAFA 5LLQA 3S17J 3BP8A 2UXNA 3DXJF 4XKBA 2OZUA 1B4AA 1VQ7I 2GWRA 1MZBA 3KP7A 3RDIA 2B9SA 4LOCA 5CVUA 4HPQA 3HOWJ 2Y69H 3DEEA 1F5TA 3WGGA 4F7ZA 4LG0B 3QYFA 3LWFA 2XPVA 2IAIA 1PUFB 4DYCA 2L0KA 2M8EA 2QCOA 4I76A 4FX0A 2VQGA 3MMYB 2G9WA 3PUFA 5F27A 1UHWA 1ZTRA 2EFOA 2H8RA 5E1ZB 3Q9VA 1RETA 3WODF 5J1RA 4E7ZA 2LFBA 1FOWA 4O6JA 2CU7A 2CQKA 4A3DJ 2OV7A 1YG2A 1DP7P 2M3AA 1D8JA 3QPTA 3KP6A 4A3FJ 2M34A 3GTGJ 4BNCA 3MZ8A 3K2AA 1GV5A 1LUJB 2F4MB 3F9KA 3SEZA 4FHTA 1FIAA 1D3YA 2E34A 1YOVB 3CLQA 5H6RA 3SZGA 3NRVA 4L0ZB 2TRTA 4CYCA 3Q3SA 1JXSA 1WWXA 2W48A 1Z7UA 4G12A 4DQ2A 2M8GX 2OA4A 3CDLA 2Z16A 2EWNA 3DBLB 1CGPA 5IP9J 1Z1DA 3EYYA 2RAEA 3C2GA 1BJAA 2UWMA 4DBRA 1PDNC 1TW2A 3H92A 4R1HA 5DUIA 5GTIC 2BVLA 2VN2A 3F8FA 3SQNA 4KUMA 5CJ9A 1KGSA 1MBJA 3KEYA 1WSUA 5LHGA 2HQNA 4S0HB 2UZKA 5TRDA 2AHQA 2R7XA 1FOKA 3ZR8X 3L2CA 1G8XA 4UUSA 2P0WA 4GO1A 5FKOA 1MMSA 2HPIA 5J47A 1W7PB 2NOJB 2L5QA 3MN2A 4ZDPA 1G6NA 4BKXA 1A35A 4I01A 5F0FA 5HNHA 1FWZA 3UNGC 1MDMB 4PFPA 3BWGA 2DN0A 5FLXK 5LBQA 4UY8I 2HYJA 1ERDA 2JA7J 3O2PE 3I56I 3KZIC 2E7XA 2IJLA 5IP6A 5J8FA 4XL9A 4GYIA 1DQUA 3WGHA 4YRVA 4JQFA 3WTTC 2X6YA 3I4PA 5FLXZ 3KEQA 1OCTC 4OWRB 1OR7C 1V5GA 3E6CC 3CZ6A 4HDVA 4MFEA 1LQ1A 2QUFA 1I5ZA 4XN0A 4ESBA 3FXKA 2XGCA 5IYBJ 4F91B 4I2OA 4HZFA 1ETVA 3GZNB 3IC7A 3K10A 3SFIA 2IS1A 2A68F 4IQ4A 4EATA 1ZG1A 3FX3A 5E17F 1ENHA 1SD7A 2JA5J 1FPQA 3ZN1A 1IGNA 3F21A 2Z5UA 3KYCB 1B9NA 3HGGA 5BPDA 2DJIA 4AYBA 2KHMA 4KT5C 1QQIA 2DPUA 4UVCA 2DK8A 4IRGA 1YITI 3B73A 1XGMA 2M30A 2AO9A 4PSWA 5CPRB 1LEBA 3VB2A 4M9SA 1XDUA 2XGXA 4LB6B 4BJ5C 4D7MA 2X4HA 2NVUB 3BOQA 3LAPA 1F4KA 4IOAF 3H3ZA 2DFFA 3CP2A 4GYGA 4LFUA 5C4XJ 1B59A 1P4WA 2QWWA 2RC4A 1W5TA 3T8TA 5C3EJ 1FMVA 2IT0A 2X1DA 1O57A 3GFMA 3WTUC 2ZJPF 4PJNA 4HV5A 1FLIA 2IS4A 1KA8A 1RKWA 1LFBA 1K4TA 3J81Z 3K70D 5DV5A 2NS7A 1VQ8I 3T0YA 3CF5F 2CV0A 4HRIA 1BR1A 1SFKA 2JSCA 4JOMA 4JBAA 4BQAA 2I10A 1YS7A 2P5VA 3DV8A 1JGGA 4CZCA 4C3IJ 4DJAA 1JKOC 1ZHFA 2QQBA 4LB5A 4ITVA 1VFCA 1YRNA 1B8IA 3GCMA 1ETOA 3FKIJ 4ZH4F 2ZJRF 2OTLI 3GEZA 3KLOA 4EJVA 1T39A 3OIQA 1MJAA 1POGA 3RZDJ 4D5CA 3K7AJ 2HTSA 5K1YA 2BHYA 2PMZA 3OYJA 2WB1A 4CGZA 2ADUA 4LIVA 1DUXC 3EUKL 4DIQA 4F93B 1XMXA 1D1CA 2OPTA 4C2MJ 4GXOA 3PSFA 2R4GA 3BDDA 1XSVA 3JRCA 4AWXB 1IRGA 4YFKF 4M6YA 4BH9A 5L3FA 5F0HA 1W7PD 1N78A 1G3YA 3VYSB 3V7RA 5L3EA 4BGDA 2OQGA 1W36C 2P8TA 1I27A 4J19A 2CSOA 4BDZA 4C9YA 1WJDA 3LQRA 2CUEA 2ISYA 5KK1A 4IJAA 2MA3A 3BG6A 1R00A 3WU0A 1BR2A 4I0AA 1A6QA 1YX5A 3TO9A 2QA4I 1S9HA 3BG7A 3KPHA 4XLCA 4Y13A 2PMZN 4IL6C 1N77A 2YSRA 3OL3A 4XSZF 3I9V2 4IHVA 3DPTA 2F5DA 4NB5A 1OPCA 2M7BA 4UV8A 3BCBA 4UUTA 2QQ8A 1FYLA 1MSFC 1WCMJ 1MD0A 2JVHA 1S6LA 2L7FP 3G4SI 1FBUA 1VQPI 5LGNA 3TDUC 3I4NJ 4W97A 5GP9A 3L09A 4A5MA 1FBQA 5HLHA 4MGRA 3GX4X 3V8JA 4MO7A 2FSWA 1IXRC 2WA0A 4MTDA 3S3OA 4Y3OA 4MIMA 4EJTA 1SFEA 4P5OA 2VOPA 2VLAA 1TWGJ 1TWFJ 4XLAA 4B43A 2ZXWH 5LFAA 4RAFA 2HPMA 1QRYA 2O03A 1I50J 4CXFA 5M5WJ 4LD5A 2MLKA 3MFKA 1RC9A 1WJBA 3NWSA 2GBYA 4NC6A 2CUZA 2IA1A 3CTAA 3OOPA 1KONA 1VF9A 2LP0A 2ZMEA 4LG3A 3ZMTA 3MKYB 2HNHA 1FTTA 3OY9A 5E18F 2K3PA 1IV8A 2HTJA 1XD7A 2A3SA 2HGCA 5A2QK 2KPMA 1Y6IA 3VWBA 2VOOA 1E0EA 4IHSA 1NG7A 2K7LA 1D8KA 4V19K 1YW9A 5KCMA 4UXNA 3AFHA 4LLNA 1WJ5A 1FIPA 2KP6A 1YHQI 1LDDA 1OQYA 5ICEA 1YQAA 1UMQA 3CLOA 4WWCA 3U1KA 4PSXA 3WHBA 3PL8A 2L9RA 3CP8A 1FNNA 2QQ9A 4ZYAA 2MGQA 3BR6A 2OF7A 5DTDA 4MTEA 2O6GE 2LRDA 2B63J 4LMYA 1DDNA 4N4NB 3S2WA 2XRLA 1P4AA 1P9QC 1X58A 4A6EA 2M0MA 2E1OA 1ETXA 3I58A 4A69C 4B44A 1Z91A 2QSFX 3O6BB 2DDAA 2DO7A 5HDGA 3N4MA 2RVCA 4AIKA 2DT7B 2ZJ2A 2V1DA 2A5WA 4A6DA 2RGVA 1IAWA 1BIAA 2J5PA 4JP0A 3S1QJ 4U88A 3E6MA 3K1MA 3HZJA 1AA7A 5FGMA 2EZKA 1SVLA 3S8PA 1RIOH 3D5RC 4FETA 1GUUA 2LBFA 4E6KG 4YG2F 3OIPA 1T33A 2XKOA 4F3QA 3KP4A 3OWTA 1R7JA 2OTJI 2CQ7A 3FF5A 1ULYA 2LVSA 5IYCJ 2E36A 3KP3A 2DA6A 3ISPA 1MMGA 2XAGA 5F6FA 5BS6A 1REPC 3VFZA 1IV6A 1U6GA 3EUAA 1BM9A 3BJ6A 2XKPA 2ZFWA 3F72A 3JCUC 1KYWA 3ZQ7A 1MJBA 1FZPB 4CO8A 2FJ1A 3OYBA 2JWTA 1OYWA 2OBPA 5E1XA 1AWCA 1MSEC 2IGOA 5HDKA 5C44J 4N9HA 1P6RA 2R5YA 2K02A 1Z21A 3VYUB 5J4VA 1ITYA 3F3XA 4RB3C 3HJEA 2H8WA 3GUDA 1LKXA 3G1MA 3SZPA 4X1EA 1Y1VJ 4QTRA 4HBLA 2ZBKA 1J0RA 3DLAA 2X85A 5IOYA 2VC0A 1U9OA 1Z6RA 3FMRA 4LIUA 1FJLA 4L9JA 5FD6A 3K4BA 1R4NB 2IBDA 1GVJA 2ECBA 1MW7A 2DOAA 2EQRA 4LLGF 1BC7C 4C3HJ 2ZXIA 4KIBA 3ZPLA 1LJ9A 2R7TA 4V2FA 1E2XA 3BZKA 2PMUA 2PEXA 2BGCA 5F64A 1WKMA 1YW7A 1ZG3A 2Q0OA 2V9KA 3AG4H 5J6XA 1XN7A 3E5XA 3PSIA 4EJUA 3TW6A 1HXDA 3KLNA 2XAQA 1N25A 1XX5A 4M74A 1R23A 3ZQQA 3P9IA 3OYKA 4UHTA 4A3EJ 4E7HA 1D5YA 4CSWA 2QENA 3IRRA 3U21A 2CG4A 3PIOF 4UUSB 2QGUA 2A6TA 4CCLA 1A5JA 3CMYA 1GV2A 2L02A 3G2BA 2BEOA 2VI6A 5DUKA 3ML6A 3EYIA 2K9SA 1P2FA 2VBWA 4IX7A 3AG2H 2AS5F 2Q2EA 3QPSA 3SZTA 3ZCOA 4OIOF 4WK8F 3RCOA 4CCNA 2Y0MA 3QP5A 4RAZA 3ESWB 4BXUA 3A02A 4B1RA 3DTKA 4HW0A 4XLFA 2M1BA 5DS9A 4WCGA 3ABUA 3OYDA 2R7VA 2FBIA 3DQVC 1FMWA 1TT5B 3H5RA 4I6ZA 2RV8A 4XRSG 3GMEA 2D1HA 3OL4A 2B0LA 4ZTJA 2D5VA 1I1SA 2NVXJ 2MC3A 3A0BC 1IN8A 3VDXA 1Y8QB 4KMFA 1XGSA 1UAAA 1G59A 2EK5A 3C2HA 2R7UA 1R58A 1RZ4A 3S15J 1KU9A 1Z3XA 1WRJA 3IKTA 4HOBA 2HZDA 4Z2YA 2KJBA 2K9NA 4M3EA 3BR2A 4XK4A 3V7SA 1VQ9I 3K2ZA 2PQ8A 1SAUA 4GFBA 2JTVA 3RQIA 3CC4I 2FBKA 5IPAA 3FXOA 2J5OA 3GLLA 3HYIA 3BPVA 5LD2C 3CD6I 2LREA 4HA8A 1WH7A 4CYDA 3CJQB 4BXFA 4ESFA 5IT3A 2VASA 2V26A 1HSJA 2P6SA 3FBNB 4I99C 3E1SA 3RYPA 5IOZA 4UVAA 1H9TA 4AUXA 2O3FA 2L4AA 2KRFA 2EINH 3V7CA 1P4XA 2VBZA 2WADA 2LC2A 3PUBA 3M1CA 5EG0B 3NQOA 3E5UA 1B8IB 3HOSA 3TKYA 4OIQF 3HM5A 1YJWI 2DK5A 4DYQA 2ME0A 1K7AA 1QU3A 3P5JA 5B66C 4Y52J 4BDYA 3DBHB 4AM3A 3F8NA 3A1YA 4Q5SF 3ZXSA 4GDFA 3NEUA 2LF7A 1LFUP 4ZYHA 4G6QA 3A01B 4XKCA 5CYVA 3H1CA 5HLTA 1X1AA 3F8MA 1O4XA 3QU6A 3DU5A 3GBGA 3D0SA 2LYCA 5E8GA 5E79C 3WU2C 1FOYA 1B1BA 2WTEA 5L3GA 3KEOA 4UV9A 2W24A 3LA2A 5CVVA 3J7ZI 2B7EA 2DFIA 3W6JB 2R5ZA 4EMSA 2ID6A 3F8BA 2JT1A 1U5TC 1EKEA 2H6CA 4EJOA 5F04A 1MH4A 5FKMA 2NAZA 3I4MJ 3PQKA 2EBIA 3QU3A 5EDNA 1S72I 3S1MJ 5DCMA 4XOPA 3GW2A 4A3JJ 3CF2A 1G2HA 2RN7A 1YIOA 2A07F 1FX7A 1YX3A 1F43A 5HLGA 1R1VA 3PNTA 3S32A 1OISA 3JRDA 1WGXA 2UUZA 4IZZA 1ZARA 1FYKA 2A05A 1D0YA 4BE2A 2EV6A 3FXRA 2QBYB 3SHFA 2QF7A 3HOXJ 1UZCA 1U78A 1ACIA 2CQNA 2MD0A 3WE3A 1VNDA 3GXOA 2KRCA 4PGHA 1IRZA 4QIWN 3W2VA 1O3SA 1MNMC 5FJ8J 3GFJA 1USSA 3KIOA 3VYRB 2IEKA 2QKLB 4G9YA 1MBGA 4ZYDA 2IGNA 2X51A 2LY2A 3DEWA 1B72A 3K9TA 1OCCH 1BA5A 2F5CA 2GIVA 3AG1H 1HBXG 4XICA 5FO5A 2K4BA 2K3FA 5JLXA 5BMZA 1IRFA 2F48A 4HX4A 2TDXA 5FFZA 2R3SA 4DZPA 2CFXA 1KYZA 3I54A 2ZMEB 1VQ5I 3K4JA 5LEKA 4GRIA 4M3GA 4M3BA 3R6SA 3OS0A 2NNNA 2WAEA 2HXIA 2JN6A 4I7HA 3QPHA 3F8CA 3LAJA 2MSYA 5ICGA 1U0JA 4B48A 3I3LA 2QSHX 4KJZA 2FEZA 2VQLA 3I59A 3MZYA 3IKVA 3M4OJ 2OJED 4U0YA 3P9KA 4A12A 1WPKA 2KIQA 3ZQFA 1T6SA 4U7DA 2K9MA 1WJEA 3T1BA 1ZK8A 2O8XA 3JRGA 2MD5A 2IS2A 1KQ8A 3IWZA 2VKEA 3LSKA 5H20A 1OCOH 4ENKA 1A6IA 1P92A 2XAUA 4M3FA 4P96A 2EZIA 2H6BA 2AQEA 5H6QA 3GZ6A 1VTNC 4XMYA 3BR3A 3ROUA 2Z99A 2IP2A 4IRHA 2X1EA 2P6TA 1RKTA 3CQZJ 4UB6C 2JQ7A 1UCRA 1HLVA 4OMYA 2COMA 3SYTA 1R71A 3WTYC 1VQOI 1HSTA 2LMDA 1ON1A 3H3VK 3ZQCA 2RKHA 1HC8A 2VPLA 4K2EA 3WTSC 2HI3A 2PG4A 3CCUI 1J09A 2KISA 3J7AY 1GDTA 4HLYA 1ZG5A 4JX4A 4P9UA 1OCZH 2EV0A 2L7KA 1W36D 1ZH5A 3AKZA 4Q4ZF 2MABA 1SFOJ 1FOXA 1MGTA 4B47A 2OCEA 2BHZA 2ZXJA 4OAZA 3FWEA 1HKQA 5CLSA 5CQGA 2HS5A 4BHCA 2V7FA 3F0CA 4BQNA 2FQ4A 1SVMA 2D1VA 1XG1A 2KDOA 5GTHC 4B3XA 3G71I 5KAFC 1IDYA 3C7JA 1D1AA 5KHDA 1TLHB 4M6XA 1J75A 3M9AA 5J8CA 4II3A 1DP3A 5D4RA 4BQQA 1T95A 3A4CA 3WE2A 4U7BA 4B3AA 1XSDA 2DOFA 1I3QJ 3CCMI 2XROA 2R92J 1VQMI 6PAXA 3L7WA 2VONA 2HQ5A 4MEYF 4WXDA 1IN5A 4PZJA 2DW4A 3CUQB 4L9VA 2VT2A 4L5EA 3EQLF 5M5YJ 3S1NJ 1SVOA 5F1RA 2JA6J 2BOLA 3LL7A 2JA2A 1NHAA 2P4WA 1J7KA 1XMKA 2X48A 1HQCA 4U87A 3S3NA 1EH8A 1PJRA 2D45A 3I71A 3JREA 3S14J 3RTRA 3ONQA 2KKOA 1RUNA 2H1LA 3HPGA 2OUMA 2HVQA 1YTYA 3LSGA 1MBFA 1AOYA 1ZRDA 1EH6A 1ZLKA 2WBMA 5HLIA 2V79A 4NQWA 1OR7A 1K61A 4YFXF 3DF8A 3W6KB 2DQLA 4G7ZF 1WI9A 3VYTB 5LRSA 1QVUA 2E1CA 1V5FA 4LLLA 2P81A 2E1MB 3B6AA 1ETQA 3I64A 3OV8A 5E3LA 2DBBA 2HQAA 1VQKI 2P5LC 1ETYA 4PJLA 3M1EA 1Z9CA 3F6OA 2HDWA 3QODA 4IKFA 3BLYA 4V2GA 3N97A 2GM4A 4FASD 3HC7A 2VJIA 3BPXA 1TP4A 5J40A 3VEPA 3LSJA 2Q2EB 4MEXF 2R7WA 4WXCA 1O7LA 2FE3A 3ZQGA 2Y9YA 3OIOA 4NUBA 3TGNA 3S1RJ 3J7AO 2WY8Q 3HUGA 1OJLA 2DAOA 2MH9A 3REOA 3BZCA 3TW7A 5HODA 5DM7F 3ZQHA 1V4RA 2ZJQF 1EV7A 4S05A 3VPRA 2WV0A 3WTVC 4E7SA 2FNPA 2STTA 1ZYRF 2P7VB 4A0ZA 2GXBA 3RQ4A 2ZSHB 3G1LA 3QWLA 3EETA 3L2VA 1H88C 2CV1A 4HG2A 4RGRA 4BU2A 3HBLA 3H0DA 4BE0A 5TGTA 1VZ0A 1DPUA 1X4OA 1R6RA 2OCCH 2O8KA 4KMUX 1KU2A 3V8LA 4IPAA 2EPFA 2CO5A 2VKVA 4ZC3A 1F36A 3MKZA 1LFPA 5DD8A 4OIRF 2MC4A 2Y31A 3ECHA 4M9XA 5DCFA 2QVOA 3HB9A 1Z3YA 3KP5A 3K4MA 3SEQA 2KLOA 3FXUA 3FHNA 2CW8A 3PIPF 5EJCA 4KN7X 2ZO4A 2R7QA 2LY9A 4N9IA 2E71A 2F4IA 3FK7A 3C2BA 1KU7A 1SC7A 3FXLA 1ODDA 2MYSA 5BPIA 4XBFA 2O0YA 4MFDA 3ABLH 3WG7H 2EIKH 2HYGD 2HOTA 1KQ9A 2DCEA 3CCEI 3FBIB 1CF7A 4DYRA 2ZB9A 2LKXA 1SFXA 4BY7J 5DEQA 1J2XA 2Z1DA 3JTHA 4FTHA 4L9NA 2DYSH 2VXDA 2NVTJ 4ZYGA 2IXSA 1Q1VA 2W1OA 3AG3H 4I02A 4BXXJ 2HVRA 1FBSA 3HG9A 1LNWA 3K1PA 3VSKA 1QO0D 4RMNA 1MMNA 1XPXA 4YEJA 5L3BA 3M8FA 3OSGA 3CDIA 2KJCA 5F1JA 1HW2A 3R60A 2JSPA 2XAHA 4B09A 5D5UB 2LD5A 4QWQA 3DKXA 1BR4A 4NHJA 1IN6A 2AXTC 2EJRA 2IA0A 2WC2A 3IP4B 4EM2A 3JRFA 3I5UA 4CICA 3CJNA 3LOCA 2MLGA 4E7IA 5ED4A 2DT5A 3NWTA 2PLYA 2H27A 2BY1A 4EEFG 1OYYA 2R5ZB 1O7FA 5B1AH 3U1DA 4YIRX 4Y7NJ 1FC3A 4N0BA 5E20A 1FY7A 2BW3A 2MFZA 3H3UA 3RKQA 3CDHA 2JUGA 4FE4A 4BEHA 1K6YA 2ICWG 3G1OA 4HSRA 4BQOA 1QZEA 2K4JA 2ZKZA 4KT6A 3GF2A 2V6EA 4EGZA 3AL0B 3CCLI 4IHWA 1JT0A 4HV6A 2X0LA 4HX8A 4E7LA 1UHSA 4HAMA 1W0TA 2E2IJ 4G7OF 3IHUA 2JA8J 3BCAA 3L1PA 1PP8F 5A2QZ 1I1GA 4HNUA 4HEA2 1J5YA 1MH3A 5EYRA 1D5VA 2LOOA 1FP1D 2CQQA 1LB2A 2L54A 2QYOA 4P55A 3LSTA 1YFHA 1Y56A 4O3MA 1MBEA 2V1XA 1T08B 2HKOA 2ZNYA 1DGRM 3BZ6A 3TP3A 3BG3A 1QZYA 2DA1A 4XONA 2KIMA 2HXOA 3IL2A 3V42A 1UB9A 4MNUA 1PYVA 3GO5A 1GHCA 3M7GA 1HW5A 4RB2C 1IXCA 3GTOJ 2EFWA 2DMUA 4HF0A 2R93J 1UG2A 3O8HA 4A0XA 5KNLA 5FLVA 3RI4A 4A3CJ 2IVMA 2Z3YA 1E3OC 4D9JA 3WTWC 2V9PA 2JRTA 4D5FA 3K70C 2MW8A 3WTXC 1S8NA 3JRHA 2E5NA 4I09A 1YS6A 1TTYA 5FLMJ 4A2UA 4FT8A 4ZTFA 1YJ9I 3ASNH 2ELJA 2HOAA 2OQRA 1IXSB 2ZNZA 1ZAOA 3HRMA 4OAYA 3CCVI 3IAS2 3IUOA 4B4CA 1VQLI 1XGOA 2E2JJ 4UB8C 2JRMA 1GXQA 2XSDC 1YW8A 2V6CA 5CQEA 3W2AA 3MKWB
chains in the Genus database with same CATH topology
4AD9A 5L3DA 3IRQA 1FT9A 2EFQA 1TW3A 3FHZA 2NRAC 4G8XA 1PP7U 5ILVA 3KP2A 1TNTA 3G73A 4YIFA 1IN7A 3LA3A 2OD5A 2RDPA 4R8HA 1T2KA 2D2WA 2LDUA 1W7PA 1K78A 1S3JA 4HDUA 2GXGA 4S04A 4IVNA 5ICCA 2XHKA 5D4SA 4EM0B 2ACJA 3KETA 4I0BA 1YLFA 2IW5A 3CUOA 4EQQA 2OZ6A 3TQNA 2EFPA 4IF4A 5D5VB 4HQMA 4KFCA 1S7AA 2PI0A 1ON2A 5CVIA 3I53A 2XRNA 2OU2A 3VODA 3F22A 2W84A 4Y17A 4B8XA 4Q47A 5HDNA 2DTRA 3P7NA 3ABTA 1G3TA 3RPQA 2BBYA 1XB4A 1IF1A 2Y75A 4JK1X 4XLPF 1KQ0A 1O3QA 3Q5FA 5JR3A 3HRSA 3TOAA 5ERIA 2CW0F 4RGUA 3R0JA 4FX4A 1XCVA 4LK0F 1T98A 2DI3A 2P5KA 4KICA 2F5EA 5D8LB 1RNLA 4P9FA 4OOIA 2F2EA 4LJZF 2VODA 3VOEA 1W4MA 3F6VA 1H0MA 1HKTA 3GLXA 3G3ZA 1G4DA 2BV6A 4IHTA 4A0YA 1C0WA 2AXLA 2A6HF 1HW1A 4XLNF 5AONA 4HQEA 1QPMA 1JGSA 3WU1B 4PDKA 3E5QA 5HS7A 5LHHA 1MJ9A 5JI6A 3RPUA 5JVTA 4EGYA 4M72A 1ONVA 2QLZA 4U0VA 2A6EF 2KIUA 4ZZDA 5AIQA 1LDJA 3CO7C 4EJWA 1L3LA 2Y48A 4I98B 3K0LA 4BAYA 4ESJA 1HKSA 2NS0A 1B6AA 2L4MA 1FYMA 2VE9A 4ZZLA 5HVQC 2BYVE 1CF7B 2K27A 2E7WA 3E6BA 4KYWA 3V8KA 4WXHA 3MCZA 1BI0A 1T0FA 5FD5A 4ETSA 1U5TA 1FSEA 3FXQA 1ZGAA 3T8RA 3KFWX 3J80K 4M9ZA 5K5OA 4GGGA 4WF2A 4ENMA 3C1DA 1SMYF 2HDCA 1V3FA 1SD4A 1F9NA 4RGSA 2QM3A 3HSFA 2YU3A 2R7DA 4MQVA 5D5XB 3RYRA 3CO6C 4AVPA 1TBXA 1RI7A 3AAFA 3PFIA 1BIBA 1LEAA 2ETHA 1YYVA 3WTZA 3HTUA 2A5YB 4QLCU 5D6EA 4KNYA 3SFZA 1UHMA 1R1TA 4ASNA 4YIIA 4ENJA 5E8IA 1T38A 2O61A 2PJPA 5DYMA 1J59A 2PFBA 4XSXF 3ZMDA 4L5IA 3U9GA 3ZMZA 3L00A 3PQJA 4PCQA 5KVRA 2UXXA 5ILSA 1FP2A 3ECOA 1WQ2A 3E97A 2FMYA 1QGPA 2M5WA 3FM5A 3QP6A 2YX7A 2FRHA 1Y0UA 2BE5F 1S29A 3EDPA 2EA4A 3DEUA 2XIGA 5D6FA 2VC1A 4CDGA 4TV7A 3RKWA 3FMQA 4HX7A 2ISZA 2HQRA 1SMTA 1U8RA 3ZMSA 2FXAA 5LEJA 2L3DA 3HTSB 4RAYA 2DU9A 2IA2A 5TJJA 1X3UA 1EH7A 4H0EA 1STZA 1K78B 4WX9A 2XASA 5LHIA 3ULQB 1K6OA 1I6XA 3DFGA 2IPQX 3FMSA 3BY6A 5K5RA 1ZREA 4XRFA 2H09A 2C6YA 2V9VA 2W85A 3DPLC 1OMIA 3C18A 3R61A 1ZGJA 3Q9SA 2FNAA 3TO6A 1OYIA 2JZYA 3KE2A 4EVIA 1R5HA 2FOKA 1E17A 3MAJA 4M73A 4MHGA 1TQMA 3MWMA 1XGNA 3BROA 3J81K 3LFKA 2YPRA 1PUEE 1TQPA 2XAJA 1O3RA 1U2WA 2CWEA 1IN4A 4GCVA 5HS8A 2IRFG 1XSXA 4BYYA 4A5NA 1R22A 4ZYEA 2L01A 2M87A 1R1UA 2Z9OA 3HOTA 2VT3A 4EV0A 3KCCA 1JHHA 1IW7F 1BI3A 3QRFF 3K1NA 3O3KA 4CHUA 5LGTA 5EEHA 4KIFA 2RNJA 2EB7A 1SD5A 2DPDA 4E70A 1O3TA 2Q8KA 4MQ9F 4UUVA 5IT9K 4UVBA 1BI2A 1JE8A 4IXAA 2QBYA 5IT9Z 3TOBA 3R0AA 1G3SA 5FFXA 3F23A 3COAC 2VE8A 4LK1F 3GZ5A 5DCMB 5HS9A 2RQPA 2Z33A 2CGPA 5L3CA 3EUHA 1U5TB 2E1NA 3KZZA 3FZVA 2DLLA 3P9CA 2XV4S 4RB0A 5DDGA 3U2RA 4G7HF 3ZMVA 1TNSA 1BN5A 3V4GA 3C3WA 4L5JA 1UFMA 1Z6TA 4G94A 1Z05A 4LG0A 5E1WA 1FSHA 2JPBA 4RS8A 2FMLA 1QZZA 3ZMUA 1MKMA 3ERED 1GXPA 1B9MA 1ZRCA 1R5GA 2W57A 2PMHA 4L9TA 3MEXA 1QBJA 2LF8A 2VXZA 3B02A 5LRRA 1QNTA 2HR3A 2ESNA 4KA4A 1A04A 3I59B 2EV5A 3BJAA 4HF2A 2CYYA 2GA2A 4G6DA 4LGWA 1ZLJA 1K79A 2EFNA 2KIFA 5JFRA 2A61A 3E3VA 2H94A 3TDZC 3TO7A 3HSRA 4OIPF 1LDKB 3E6DA 3ELKA 3CUQC 3GFLA 3D5LA 4ENNA 4AIHA 3ZP5A 2GQQA 3MQ0A 1TQIA 3JW4A 5JHUA 3RKYA 3R4KA 3DP7A 3LQQA 2GA1A 1MDMA 3HSEA 2GAUA 3CUQA 1G3WA 5FB2A 1S7OA 4UNOA 3JSOA 1SAXA 2G7HA 2NNYA 1IUYA 1OKRA 2A69F 4HF1A 1H9GA 3DKWA 4KDPA 1XMAA 2EA2A 1BC8C 4PGGA 2FU4A 1USTA 1DPRA 2MH2A 2VBXA 4R79A 2FBHA 1F1ZA 2QZ8A 3BJOA 4OINF 4DNCA 2VBYA 3RJPA 4OMZA 2K86A 4AIJA 2GZWA 3MZHA 1XCBA 5K5QA 4Q48A 3K69A 4YFNF 5D5WB 1XDSA 2HZTA 2HYFA 2QQAA 5D8KB 3HHHA 2DQRA 3HRUA 2YX4A 4ON0A 1L0OC 4RB1A 3GFIA 4OU0A 1W5SA 4L18B 2HOEA 1BI1A 1IZ1A 2YR2A 4EM1A 2NYXA 1SD6A 2HKXA 2HWVA 2WWYA 5ICFA 3M8EA 4M71A 4O5VA 5HOOA 3HHGA 1ZN2A 2FA5A 4CZZA 3WG9A 2OAZA 2ELHA 3RKXA 5EEGA 4RGXA 3QOPA 4HYEA 4IRIA 2P7CB 2XVCA 3GVAA 1J9IA 2ZCWA 2STWA 4BHBA 3HIFA 5ILUA 2F5FA 4Y15A 3L9FA 4U0WA 1ZRFA 3KZYA 3SXYA 5AIPA 2FQ3A 5DD4A 2V1UA 3GWZA 1Q1HA 1KU3A 5CVRA 2ESHA 3ZN0A 3J80Z 3LA7A 2LKPA 3RIRA 2HEOA 2LNBA 3IWFA 4KN4X 1R36A 3JTGA 2FF4A 3JSPA 1YO5C 1JHFA 3QAHA 2MBFA 3WGIA 2W25A 1BBYA 4D0PA 5BOXA 1BOAA 2PN6A 3GYHX 2XUBA 3HRTA 2LSOA 2HFHA 2JPCA 5LGUA 3FM3A 3I0TA 5BQTA 2M45A 1SFUA 4BHPA 2PBIA 2R7FA 1RUOA 5CVJA 3JAMK 1LVAA 4HLXA 4L0YB 3T5XA 4KIGA 3JAMZ 1U3EM 2G7UA 2XAFA 5LLQA 3BP8A 2UXNA 3DXJF 2OZUA 1B4AA 2GWRA 1MZBA 3KP7A 3RDIA 5CVUA 1F5TA 3WGGA 4F7ZA 4LG0B 3LWFA 2M8EA 4FX0A 2G9WA 1UHWA 2EFOA 5E1ZB 3Q9VA 3WODF 4O6JA 2CQKA 1YG2A 1DP7P 1D8JA 3QPTA 3KP6A 4BNCA 4FHTA 1D3YA 5H6RA 3NRVA 4L0ZB 1JXSA 1WWXA 4DQ2A 1Z7UA 2OA4A 2EWNA 1CGPA 1Z1DA 3EYYA 1BJAA 2UWMA 1PDNC 1TW2A 3H92A 5DUIA 4R1HA 2VN2A 3F8FA 3SQNA 4KUMA 5CJ9A 1KGSA 1WSUA 5LHGA 2HQNA 2UZKA 5TRDA 1FOKA 3L2CA 4GO1A 1W7PB 1G6NA 4I01A 1FWZA 1MDMB 3BWGA 5FLXK 5LBQA 3O2PE 2E7XA 2IJLA 5J8FA 4GYIA 3WGHA 4JQFA 3WTTC 3I4PA 5FLXZ 3KEQA 3E6CC 4HDVA 1LQ1A 2QUFA 1I5ZA 4ESBA 4I2OA 4HZFA 3IC7A 2A68F 1ZG1A 3FX3A 5E17F 1SD7A 1FPQA 3ZN1A 3F21A 2Z5UA 1B9NA 5BPDA 4KT5C 1QQIA 2DPUA 4UVCA 2DK8A 4IRGA 3B73A 1XGMA 2M30A 1LEBA 3VB2A 4M9SA 1XDUA 2XGXA 4LB6B 2X4HA 3BOQA 3LAPA 1F4KA 3H3ZA 4GYGA 4LFUA 1B59A 1P4WA 2QWWA 2RC4A 1W5TA 3T8TA 2IT0A 1O57A 3GFMA 3WTUC 4HV5A 1FLIA 1KA8A 3J81Z 5DV5A 3T0YA 2JSCA 4JBAA 4BQAA 1YS7A 2P5VA 3DV8A 1ZHFA 2QQBA 4LB5A 4ZH4F 3GEZA 3KLOA 4EJVA 1T39A 1MJAA 2HTSA 5K1YA 4CGZA 2ADUA 1DUXC 4GXOA 3BDDA 1XSVA 4AWXB 1IRGA 4YFKF 4M6YA 4BH9A 5L3FA 1W7PD 1G3YA 3V7RA 5L3EA 2OQGA 2P8TA 1I27A 2CSOA 3LQRA 2ISYA 5KK1A 4IJAA 2MA3A 1R00A 3WU0A 4I0AA 3TO9A 4Y13A 2YSRA 4XSZF 3DPTA 2F5DA 4NB5A 1OPCA 4UV8A 1FYLA 1MD0A 1S6LA 1FBUA 5LGNA 3TDUC 3L09A 4A5MA 1FBQA 5HLHA 4MGRA 3GX4X 3V8JA 2FSWA 1IXRC 4MTDA 4EJTA 1SFEA 4P5OA 2VOPA 2O03A 4CXFA 4LD5A 2MLKA 3MFKA 2IA1A 3OOPA 3CTAA 3ZMTA 2ZMEA 5E18F 1XD7A 2HTJA 2A3SA 2HGCA 5A2QK 2VOOA 4IHSA 2K7LA 1D8KA 1YW9A 4UXNA 4LLNA 1LDDA 5ICEA 1YQAA 3CLOA 4WWCA 1FNNA 2QQ9A 4MTEA 2O6GE 4LMYA 1DDNA 3S2WA 1P4AA 4A6EA 3I58A 1Z91A 3O6BB 2DO7A 5HDGA 3N4MA 2RVCA 4AIKA 2ZJ2A 2V1DA 4A6DA 2RGVA 1IAWA 1BIAA 2J5PA 4U88A 3E6MA 3K1MA 5FGMA 1RIOH 4YG2F 2XKOA 3KP4A 1R7JA 3FF5A 1ULYA 3KP3A 3ISPA 5F6FA 2XAGA 5BS6A 1REPC 3VFZA 1U6GA 1BM9A 3BJ6A 2XKPA 2ZFWA 3F72A 1KYWA 3ZQ7A 1MJBA 1FZPB 4CO8A 1OYWA 2OBPA 5E1XA 1AWCA 5HDKA 4N9HA 1P6RA 2K02A 3F3XA 4RB3C 3GUDA 3SZPA 4HBLA 2ZBKA 1J0RA 2VC0A 1Z6RA 3FMRA 4L9JA 5FD6A 1GVJA 4LLGF 1BC7C 4KIBA 3ZPLA 1LJ9A 1E2XA 2PMUA 2PEXA 2BGCA 5F64A 1WKMA 1YW7A 1ZG3A 2Q0OA 5J6XA 1XN7A 3E5XA 4EJUA 1HXDA 3KLNA 2XAQA 4M74A 1R23A 3P9IA 4UHTA 2QENA 3IRRA 2CG4A 2L02A 2BEOA 5DUKA 3ML6A 3EYIA 1P2FA 2VBWA 2AS5F 2Q2EA 3SZTA 4OIOF 4WK8F 2Y0MA 3QP5A 4RAZA 4BXUA 4HW0A 2M1BA 4WCGA 3ABUA 2FBIA 3DQVC 2RV8A 2D1HA 2B0LA 1I1SA 2MC3A 1IN8A 4KMFA 1XGSA 2EK5A 1R58A 1RZ4A 1KU9A 1WRJA 3IKTA 4HOBA 4Z2YA 2KJBA 3V7SA 3K2ZA 2PQ8A 2JTVA 2FBKA 2J5OA 3HYIA 3BPVA 4CYDA 4HA8A 4ESFA 5IT3A 1HSJA 2P6SA 3RYPA 4UVAA 1H9TA 2O3FA 2L4AA 2KRFA 3V7CA 1P4XA 2VBZA 3NQOA 3E5UA 3HOSA 3TKYA 4OIQF 2DK5A 1K7AA 3F8NA 4Q5SF 3NEUA 2LF7A 4ZYHA 4G6QA 5CYVA 3F8MA 3QU6A 3D0SA 5E8GA 1B1BA 2WTEA 5L3GA 3KEOA 4UV9A 2W24A 3LA2A 5CVVA 2DFIA 3W6JB 4EMSA 3F8BA 2JT1A 1U5TC 2H6CA 4EJOA 2NAZA 3PQKA 3QU3A 5DCMA 3GW2A 2RN7A 1YIOA 2A07F 1FX7A 5HLGA 1R1VA 1FYKA 1ZARA 2EV6A 3FXRA 2QBYB 3SHFA 1U78A 3WE3A 4PGHA 3GXOA 1O3SA 3GFJA 1USSA 4G9YA 4ZYDA 3K9TA 2F5CA 2GIVA 1HBXG 5FO5A 2K4BA 5BMZA 1IRFA 4HX4A 2TDXA 5FFZA 2R3SA 2CFXA 1KYZA 3I54A 2ZMEB 5LEKA 3R6SA 2NNNA 4I7HA 3QPHA 3F8CA 3LAJA 5ICGA 2FEZA 3I59A 3MZYA 3IKVA 4U0YA 4A12A 3P9KA 1T6SA 4U7DA 3T1BA 2O8XA 2MD5A 1KQ8A 3IWZA 5H20A 4ENKA 1P92A 5H6QA 3GZ6A 4P96A 2H6BA 1VTNC 3ROUA 2Z99A 2IP2A 4IRHA 2P6TA 1UCRA 4OMYA 2COMA 3WTYC 1HSTA 1ON1A 2RKHA 4K2EA 3WTSC 2PG4A 4HLYA 1ZG5A 4P9UA 2EV0A 1ZH5A 4Q4ZF 1MGTA 2ZXJA 3FWEA 1HKQA 5CLSA 4BHCA 2HS5A 2D1VA 3C7JA 1TLHB 4M6XA 1J75A 3M9AA 5J8CA 5D4RA 3WE2A 4U7BA 1XSDA 2XROA 6PAXA 3L7WA 2VONA 4MEYF 4WXDA 1IN5A 4PZJA 2DW4A 3CUQB 4L9VA 2VT2A 3EQLF 5F1RA 1NHAA 2P4WA 1J7KA 1XMKA 1HQCA 1EH8A 2D45A 3I71A 3RTRA 2KKOA 1RUNA 1YTYA 1AOYA 1ZRDA 1EH6A 1ZLKA 5HLIA 2V79A 4NQWA 1OR7A 4YFXF 3DF8A 3W6KB 2DQLA 4G7ZF 1WI9A 5LRSA 2E1CA 4LLLA 3I64A 3OV8A 2DBBA 2P5LC 3M1EA 1Z9CA 3F6OA 3N97A 3BPXA 3VEPA 4MEXF 4WXCA 1O7LA 2FE3A 3TGNA 3J7AO 3HUGA 2DAOA 2MH9A 3REOA 1V4RA 1EV7A 4S05A 2WV0A 3WTVC 2FNPA 2STTA 1ZYRF 2P7VB 4A0ZA 2GXBA 3EETA 4RGRA 1DPUA 4KMUX 1KU2A 3V8LA 4IPAA 2CO5A 5DD8A 4OIRF 3ECHA 4M9XA 5DCFA 2QVOA 3KP5A 3FXUA 4KN7X 2ZO4A 4N9IA 1KU7A 1ODDA 5BPIA 4XBFA 2O0YA 2HYGD 1KQ9A 1CF7A 1SFXA 5DEQA 1J2XA 3JTHA 4L9NA 4ZYGA 4I02A 1FBSA 1LNWA 3K1PA 1QO0D 5L3BA 3M8FA 2KJCA 1HW2A 5D5UB 3R60A 2XAHA 4B09A 4QWQA 4NHJA 1IN6A 2WC2A 2EJRA 2IA0A 4EM2A 3I5UA 4CICA 3CJNA 2MLGA 5ED4A 2DT5A 2PLYA 2H27A 1OYYA 1O7FA 3U1DA 1FC3A 4N0BA 5E20A 1FY7A 3H3UA 3CDHA 2K4JA 2ZKZA 3GF2A 4EGZA 4HV6A 2X0LA 4HX8A 4HAMA 4G7OF 3IHUA 1PP8F 5A2QZ 1I1GA 1J5YA 1D5VA 1FP1D 1LB2A 2L54A 2QYOA 4P55A 3LSTA 1YFHA 4O3MA 2V1XA 2HKOA 2ZNYA 3BZ6A 1QZYA 2KIMA 3IL2A 1UB9A 4MNUA 1GHCA 3GO5A 3M7GA 1HW5A 4RB2C 1IXCA 2EFWA 4HF0A 4A0XA 3RI4A 2IVMA 2Z3YA 3WTWC 2JRTA 3WTXC 1S8NA 4I09A 1YS6A 1TTYA 4A2UA 4FT8A 2OQRA 2ZNZA 1IXSB 1ZAOA 3HRMA 1XGOA 1GXQA 1YW8A 2V6CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AD9 A;  5L3D A;  3IRQ A;  1FT9 A;  2EFQ A;  1TW3 A;  3FHZ A;  2NRA C;  4G8X A;  1PP7 U;  5ILV A;  3KP2 A;  1TNT A;  3G73 A;  4YIF A;  1IN7 A;  3LA3 A;  2OD5 A;  2RDP A;  4R8H A;  1T2K A;  2D2W A;  2LDU A;  1W7P A;  1K78 A;  1S3J A;  4HDU A;  2GXG A;  4S04 A;  4IVN A;  5ICC A;  2XHK A;  5D4S A;  4EM0 B;  2ACJ A;  3KET A;  4I0B A;  1YLF A;  2IW5 A;  3CUO A;  4EQQ A;  2OZ6 A;  3TQN A;  2EFP A;  4IF4 A;  5D5V B;  4HQM A;  4KFC A;  1S7A A;  2PI0 A;  1ON2 A;  5CVI A;  3I53 A;  2XRN A;  2OU2 A;  3VOD A;  3F22 A;  2W84 A;  4Y17 A;  4B8X A;  4Q47 A;  5HDN A;  2DTR A;  3P7N A;  3ABT A;  1G3T A;  3RPQ A;  2BBY A;  1XB4 A;  1IF1 A;  2Y75 A;  4JK1 X;  4XLP F;  1KQ0 A;  1O3Q A;  3Q5F A;  5JR3 A;  3HRS A;  3TOA A;  5ERI A;  2CW0 F;  4RGU A;  3R0J A;  4FX4 A;  1XCV A;  4LK0 F;  1T98 A;  2DI3 A;  2P5K A;  4KIC A;  2F5E A;  5D8L B;  1RNL A;  4P9F A;  4OOI A;  2F2E A;  4LJZ F;  2VOD A;  3VOE A;  1W4M A;  3F6V A;  1H0M A;  1HKT A;  3GLX A;  3G3Z A;  1G4D A;  2BV6 A;  4IHT A;  4A0Y A;  1C0W A;  2AXL A;  2A6H F;  1HW1 A;  4XLN F;  5AON A;  4HQE A;  1QPM A;  1JGS A;  3WU1 B;  4PDK A;  3E5Q A;  5HS7 A;  5LHH A;  1MJ9 A;  5JI6 A;  3RPU A;  5JVT A;  4EGY A;  4M72 A;  1ONV A;  2QLZ A;  4U0V A;  2A6E F;  2KIU A;  4ZZD A;  5AIQ A;  1LDJ A;  3CO7 C;  4EJW A;  1L3L A;  2Y48 A;  4I98 B;  3K0L A;  4BAY A;  4ESJ A;  1HKS A;  2NS0 A;  1B6A A;  2L4M A;  1FYM A;  2VE9 A;  4ZZL A;  5HVQ C;  2BYV E;  1CF7 B;  2K27 A;  2E7W A;  3E6B A;  4KYW A;  3V8K A;  4WXH A;  3MCZ A;  1BI0 A;  1T0F A;  5FD5 A;  4ETS A;  1U5T A;  1FSE A;  3FXQ A;  1ZGA A;  3T8R A;  3KFW X;  3J80 K;  4M9Z A;  5K5O A;  4GGG A;  4WF2 A;  4ENM A;  3C1D A;  1SMY F;  2HDC A;  1V3F A;  1SD4 A;  1F9N A;  4RGS A;  2QM3 A;  3HSF A;  2YU3 A;  2R7D A;  4MQV A;  5D5X B;  3RYR A;  3CO6 C;  4AVP A;  1TBX A;  1RI7 A;  3AAF A;  3PFI A;  1BIB A;  1LEA A;  2ETH A;  1YYV A;  3WTZ A;  3HTU A;  2A5Y B;  4QLC U;  5D6E A;  4KNY A;  3SFZ A;  1UHM A;  1R1T A;  4ASN A;  4YII A;  4ENJ A;  5E8I A;  1T38 A;  2O61 A;  2PJP A;  5DYM A;  1J59 A;  2PFB A;  4XSX F;  3ZMD A;  4L5I A;  3U9G A;  3ZMZ A;  3L00 A;  3PQJ A;  4PCQ A;  5KVR A;  2UXX A;  5ILS A;  1FP2 A;  3ECO A;  1WQ2 A;  3E97 A;  2FMY A;  1QGP A;  2M5W A;  3FM5 A;  3QP6 A;  2YX7 A;  2FRH A;  1Y0U A;  2BE5 F;  1S29 A;  3EDP A;  2EA4 A;  3DEU A;  2XIG A;  5D6F A;  2VC1 A;  4CDG A;  4TV7 A;  3RKW A;  3FMQ A;  4HX7 A;  2ISZ A;  2HQR A;  1SMT A;  1U8R A;  3ZMS A;  2FXA A;  5LEJ A;  2L3D A;  3HTS B;  4RAY A;  2DU9 A;  2IA2 A;  5TJJ A;  1X3U A;  1EH7 A;  4H0E A;  1STZ A;  1K78 B;  4WX9 A;  2XAS A;  5LHI A;  3ULQ B;  1K6O A;  1I6X A;  3DFG A;  2IPQ X;  3FMS A;  3BY6 A;  5K5R A;  1ZRE A;  4XRF A;  2H09 A;  2C6Y A;  2V9V A;  2W85 A;  3DPL C;  1OMI A;  3C18 A;  3R61 A;  1ZGJ A;  3Q9S A;  2FNA A;  3TO6 A;  1OYI A;  2JZY A;  3KE2 A;  4EVI A;  1R5H A;  2FOK A;  1E17 A;  3MAJ A;  4M73 A;  4MHG A;  1TQM A;  3MWM A;  1XGN A;  3BRO A;  3J81 K;  3LFK A;  2YPR A;  1PUE E;  1TQP A;  2XAJ A;  1O3R A;  1U2W A;  2CWE A;  1IN4 A;  4GCV A;  5HS8 A;  2IRF G;  1XSX A;  4BYY A;  4A5N A;  1R22 A;  4ZYE A;  2L01 A;  2M87 A;  1R1U A;  2Z9O A;  3HOT A;  2VT3 A;  4EV0 A;  3KCC A;  1JHH A;  1IW7 F;  1BI3 A;  3QRF F;  3K1N A;  3O3K A;  4CHU A;  5LGT A;  5EEH A;  4KIF A;  2RNJ A;  2EB7 A;  1SD5 A;  2DPD A;  4E70 A;  1O3T A;  2Q8K A;  4MQ9 F;  4UUV A;  5IT9 K;  4UVB A;  1BI2 A;  1JE8 A;  4IXA A;  2QBY A;  5IT9 Z;  3TOB A;  3R0A A;  1G3S A;  5FFX A;  3F23 A;  3COA C;  2VE8 A;  4LK1 F;  3GZ5 A;  5DCM B;  5HS9 A;  2RQP A;  2Z33 A;  2CGP A;  5L3C A;  3EUH A;  1U5T B;  2E1N A;  3KZZ A;  3FZV A;  2DLL A;  3P9C A;  2XV4 S;  4RB0 A;  5DDG A;  3U2R A;  4G7H F;  3ZMV A;  1TNS A;  1BN5 A;  3V4G A;  3C3W A;  4L5J A;  1UFM A;  1Z6T A;  4G94 A;  1Z05 A;  4LG0 A;  5E1W A;  1FSH A;  2JPB A;  4RS8 A;  2FML A;  1QZZ A;  3ZMU A;  1MKM A;  3ERE D;  1GXP A;  1B9M A;  1ZRC A;  1R5G A;  2W57 A;  2PMH A;  4L9T A;  3MEX A;  1QBJ A;  2LF8 A;  2VXZ A;  3B02 A;  5LRR A;  1QNT A;  2HR3 A;  2ESN A;  4KA4 A;  1A04 A;  3I59 B;  2EV5 A;  3BJA A;  4HF2 A;  2CYY A;  2GA2 A;  4G6D A;  4LGW A;  1ZLJ A;  1K79 A;  2EFN A;  2KIF A;  5JFR A;  2A61 A;  3E3V A;  2H94 A;  3TDZ C;  3TO7 A;  3HSR A;  4OIP F;  1LDK B;  3E6D A;  3ELK A;  3CUQ C;  3GFL A;  3D5L A;  4ENN A;  4AIH A;  3ZP5 A;  2GQQ A;  3MQ0 A;  1TQI A;  3JW4 A;  5JHU A;  3RKY A;  3R4K A;  3DP7 A;  3LQQ A;  2GA1 A;  1MDM A;  3HSE A;  2GAU A;  3CUQ A;  1G3W A;  5FB2 A;  1S7O A;  4UNO A;  3JSO A;  1SAX A;  2G7H A;  2NNY A;  1IUY A;  1OKR A;  2A69 F;  4HF1 A;  1H9G A;  3DKW A;  4KDP A;  1XMA A;  2EA2 A;  1BC8 C;  4PGG A;  2FU4 A;  1UST A;  1DPR A;  2MH2 A;  2VBX A;  4R79 A;  2FBH A;  1F1Z A;  2QZ8 A;  3BJO A;  4OIN F;  4DNC A;  2VBY A;  3RJP A;  4OMZ A;  2K86 A;  4AIJ A;  2GZW A;  3MZH A;  1XCB A;  5K5Q A;  4Q48 A;  3K69 A;  4YFN F;  5D5W B;  1XDS A;  2HZT A;  2HYF A;  2QQA A;  5D8K B;  3HHH A;  2DQR A;  3HRU A;  2YX4 A;  4ON0 A;  1L0O C;  4RB1 A;  3GFI A;  4OU0 A;  1W5S A;  4L18 B;  2HOE A;  1BI1 A;  1IZ1 A;  2YR2 A;  4EM1 A;  2NYX A;  1SD6 A;  2HKX A;  2HWV A;  2WWY A;  5ICF A;  3M8E A;  4M71 A;  4O5V A;  5HOO A;  3HHG A;  1ZN2 A;  2FA5 A;  4CZZ A;  3WG9 A;  2OAZ A;  2ELH A;  3RKX A;  5EEG A;  4RGX A;  3QOP A;  4HYE A;  4IRI A;  2P7C B;  2XVC A;  3GVA A;  1J9I A;  2ZCW A;  2STW A;  4BHB A;  3HIF A;  5ILU A;  2F5F A;  4Y15 A;  3L9F A;  4U0W A;  1ZRF A;  3KZY A;  3SXY A;  5AIP A;  2FQ3 A;  5DD4 A;  2V1U A;  3GWZ A;  1Q1H A;  1KU3 A;  5CVR A;  2ESH A;  3ZN0 A;  3J80 Z;  3LA7 A;  2LKP A;  3RIR A;  2HEO A;  2LNB A;  3IWF A;  4KN4 X;  1R36 A;  3JTG A;  2FF4 A;  3JSP A;  1YO5 C;  1JHF A;  3QAH A;  2MBF A;  3WGI A;  2W25 A;  1BBY A;  4D0P A;  5BOX A;  1BOA A;  2PN6 A;  3GYH X;  2XUB A;  3HRT A;  2LSO A;  2HFH A;  2JPC A;  5LGU A;  3FM3 A;  3I0T A;  5BQT A;  2M45 A;  1SFU A;  4BHP A;  2PBI A;  2R7F A;  1RUO A;  5CVJ A;  3JAM K;  1LVA A;  4HLX A;  4L0Y B;  3T5X A;  4KIG A;  3JAM Z;  1U3E M;  2G7U A;  2XAF A;  5LLQ A;  3BP8 A;  2UXN A;  3DXJ F;  2OZU A;  1B4A A;  2GWR A;  1MZB A;  3KP7 A;  3RDI A;  5CVU A;  1F5T A;  3WGG A;  4F7Z A;  4LG0 B;  3LWF A;  2M8E A;  4FX0 A;  2G9W A;  1UHW A;  2EFO A;  5E1Z B;  3Q9V A;  3WOD F;  4O6J A;  2CQK A;  1YG2 A;  1DP7 P;  1D8J A;  3QPT A;  3KP6 A;  4BNC A;  4FHT A;  1D3Y A;  5H6R A;  3NRV A;  4L0Z B;  1JXS A;  1WWX A;  4DQ2 A;  1Z7U A;  2OA4 A;  2EWN A;  1CGP A;  1Z1D A;  3EYY A;  1BJA A;  2UWM A;  1PDN C;  1TW2 A;  3H92 A;  5DUI A;  4R1H A;  2VN2 A;  3F8F A;  3SQN A;  4KUM A;  5CJ9 A;  1KGS A;  1WSU A;  5LHG A;  2HQN A;  2UZK A;  5TRD A;  1FOK A;  3L2C A;  4GO1 A;  1W7P B;  1G6N A;  4I01 A;  1FWZ A;  1MDM B;  3BWG A;  5FLX K;  5LBQ A;  3O2P E;  2E7X A;  2IJL A;  5J8F A;  4GYI A;  3WGH A;  4JQF A;  3WTT C;  3I4P A;  5FLX Z;  3KEQ A;  3E6C C;  4HDV A;  1LQ1 A;  2QUF A;  1I5Z A;  4ESB A;  4I2O A;  4HZF A;  3IC7 A;  2A68 F;  1ZG1 A;  3FX3 A;  5E17 F;  1SD7 A;  1FPQ A;  3ZN1 A;  3F21 A;  2Z5U A;  1B9N A;  5BPD A;  4KT5 C;  1QQI A;  2DPU A;  4UVC A;  2DK8 A;  4IRG A;  3B73 A;  1XGM A;  2M30 A;  1LEB A;  3VB2 A;  4M9S A;  1XDU A;  2XGX A;  4LB6 B;  2X4H A;  3BOQ A;  3LAP A;  1F4K A;  3H3Z A;  4GYG A;  4LFU A;  1B59 A;  1P4W A;  2QWW A;  2RC4 A;  1W5T A;  3T8T A;  2IT0 A;  1O57 A;  3GFM A;  3WTU C;  4HV5 A;  1FLI A;  1KA8 A;  3J81 Z;  5DV5 A;  3T0Y A;  2JSC A;  4JBA A;  4BQA A;  1YS7 A;  2P5V A;  3DV8 A;  1ZHF A;  2QQB A;  4LB5 A;  4ZH4 F;  3GEZ A;  3KLO A;  4EJV A;  1T39 A;  1MJA A;  2HTS A;  5K1Y A;  4CGZ A;  2ADU A;  1DUX C;  4GXO A;  3BDD A;  1XSV A;  4AWX B;  1IRG A;  4YFK F;  4M6Y A;  4BH9 A;  5L3F A;  1W7P D;  1G3Y A;  3V7R A;  5L3E A;  2OQG A;  2P8T A;  1I27 A;  2CSO A;  3LQR A;  2ISY A;  5KK1 A;  4IJA A;  2MA3 A;  1R00 A;  3WU0 A;  4I0A A;  3TO9 A;  4Y13 A;  2YSR A;  4XSZ F;  3DPT A;  2F5D A;  4NB5 A;  1OPC A;  4UV8 A;  1FYL A;  1MD0 A;  1S6L A;  1FBU A;  5LGN A;  3TDU C;  3L09 A;  4A5M A;  1FBQ A;  5HLH A;  4MGR A;  3GX4 X;  3V8J A;  2FSW A;  1IXR C;  4MTD A;  4EJT A;  1SFE A;  4P5O A;  2VOP A;  2O03 A;  4CXF A;  4LD5 A;  2MLK A;  3MFK A;  2IA1 A;  3OOP A;  3CTA A;  3ZMT A;  2ZME A;  5E18 F;  1XD7 A;  2HTJ A;  2A3S A;  2HGC A;  5A2Q K;  2VOO A;  4IHS A;  2K7L A;  1D8K A;  1YW9 A;  4UXN A;  4LLN A;  1LDD A;  5ICE A;  1YQA A;  3CLO A;  4WWC A;  1FNN A;  2QQ9 A;  4MTE A;  2O6G E;  4LMY A;  1DDN A;  3S2W A;  1P4A A;  4A6E A;  3I58 A;  1Z91 A;  3O6B B;  2DO7 A;  5HDG A;  3N4M A;  2RVC A;  4AIK A;  2ZJ2 A;  2V1D A;  4A6D A;  2RGV A;  1IAW A;  1BIA A;  2J5P A;  4U88 A;  3E6M A;  3K1M A;  5FGM A;  1RIO H;  4YG2 F;  2XKO A;  3KP4 A;  1R7J A;  3FF5 A;  1ULY A;  3KP3 A;  3ISP A;  5F6F A;  2XAG A;  5BS6 A;  1REP C;  3VFZ A;  1U6G A;  1BM9 A;  3BJ6 A;  2XKP A;  2ZFW A;  3F72 A;  1KYW A;  3ZQ7 A;  1MJB A;  1FZP B;  4CO8 A;  1OYW A;  2OBP A;  5E1X A;  1AWC A;  5HDK A;  4N9H A;  1P6R A;  2K02 A;  3F3X A;  4RB3 C;  3GUD A;  3SZP A;  4HBL A;  2ZBK A;  1J0R A;  2VC0 A;  1Z6R A;  3FMR A;  4L9J A;  5FD6 A;  1GVJ A;  4LLG F;  1BC7 C;  4KIB A;  3ZPL A;  1LJ9 A;  1E2X A;  2PMU A;  2PEX A;  2BGC A;  5F64 A;  1WKM A;  1YW7 A;  1ZG3 A;  2Q0O A;  5J6X A;  1XN7 A;  3E5X A;  4EJU A;  1HXD A;  3KLN A;  2XAQ A;  4M74 A;  1R23 A;  3P9I A;  4UHT A;  2QEN A;  3IRR A;  2CG4 A;  2L02 A;  2BEO A;  5DUK A;  3ML6 A;  3EYI A;  1P2F A;  2VBW A;  2AS5 F;  2Q2E A;  3SZT A;  4OIO F;  4WK8 F;  2Y0M A;  3QP5 A;  4RAZ A;  4BXU A;  4HW0 A;  2M1B A;  4WCG A;  3ABU A;  2FBI A;  3DQV C;  2RV8 A;  2D1H A;  2B0L A;  1I1S A;  2MC3 A;  1IN8 A;  4KMF A;  1XGS A;  2EK5 A;  1R58 A;  1RZ4 A;  1KU9 A;  1WRJ A;  3IKT A;  4HOB A;  4Z2Y A;  2KJB A;  3V7S A;  3K2Z A;  2PQ8 A;  2JTV A;  2FBK A;  2J5O A;  3HYI A;  3BPV A;  4CYD A;  4HA8 A;  4ESF A;  5IT3 A;  1HSJ A;  2P6S A;  3RYP A;  4UVA A;  1H9T A;  2O3F A;  2L4A A;  2KRF A;  3V7C A;  1P4X A;  2VBZ A;  3NQO A;  3E5U A;  3HOS A;  3TKY A;  4OIQ F;  2DK5 A;  1K7A A;  3F8N A;  4Q5S F;  3NEU A;  2LF7 A;  4ZYH A;  4G6Q A;  5CYV A;  3F8M A;  3QU6 A;  3D0S A;  5E8G A;  1B1B A;  2WTE A;  5L3G A;  3KEO A;  4UV9 A;  2W24 A;  3LA2 A;  5CVV A;  2DFI A;  3W6J B;  4EMS A;  3F8B A;  2JT1 A;  1U5T C;  2H6C A;  4EJO A;  2NAZ A;  3PQK A;  3QU3 A;  5DCM A;  3GW2 A;  2RN7 A;  1YIO A;  2A07 F;  1FX7 A;  5HLG A;  1R1V A;  1FYK A;  1ZAR A;  2EV6 A;  3FXR A;  2QBY B;  3SHF A;  1U78 A;  3WE3 A;  4PGH A;  3GXO A;  1O3S A;  3GFJ A;  1USS A;  4G9Y A;  4ZYD A;  3K9T A;  2F5C A;  2GIV A;  1HBX G;  5FO5 A;  2K4B A;  5BMZ A;  1IRF A;  4HX4 A;  2TDX A;  5FFZ A;  2R3S A;  2CFX A;  1KYZ A;  3I54 A;  2ZME B;  5LEK A;  3R6S A;  2NNN A;  4I7H A;  3QPH A;  3F8C A;  3LAJ A;  5ICG A;  2FEZ A;  3I59 A;  3MZY A;  3IKV A;  4U0Y A;  4A12 A;  3P9K A;  1T6S A;  4U7D A;  3T1B A;  2O8X A;  2MD5 A;  1KQ8 A;  3IWZ A;  5H20 A;  4ENK A;  1P92 A;  5H6Q A;  3GZ6 A;  4P96 A;  2H6B A;  1VTN C;  3ROU A;  2Z99 A;  2IP2 A;  4IRH A;  2P6T A;  1UCR A;  4OMY A;  2COM A;  3WTY C;  1HST A;  1ON1 A;  2RKH A;  4K2E A;  3WTS C;  2PG4 A;  4HLY A;  1ZG5 A;  4P9U A;  2EV0 A;  1ZH5 A;  4Q4Z F;  1MGT A;  2ZXJ A;  3FWE A;  1HKQ A;  5CLS A;  4BHC A;  2HS5 A;  2D1V A;  3C7J A;  1TLH B;  4M6X A;  1J75 A;  3M9A A;  5J8C A;  5D4R A;  3WE2 A;  4U7B A;  1XSD A;  2XRO A;  6PAX A;  3L7W A;  2VON A;  4MEY F;  4WXD A;  1IN5 A;  4PZJ A;  2DW4 A;  3CUQ B;  4L9V A;  2VT2 A;  3EQL F;  5F1R A;  1NHA A;  2P4W A;  1J7K A;  1XMK A;  1HQC A;  1EH8 A;  2D45 A;  3I71 A;  3RTR A;  2KKO A;  1RUN A;  1YTY A;  1AOY A;  1ZRD A;  1EH6 A;  1ZLK A;  5HLI A;  2V79 A;  4NQW A;  1OR7 A;  4YFX F;  3DF8 A;  3W6K B;  2DQL A;  4G7Z F;  1WI9 A;  5LRS A;  2E1C A;  4LLL A;  3I64 A;  3OV8 A;  2DBB A;  2P5L C;  3M1E A;  1Z9C A;  3F6O A;  3N97 A;  3BPX A;  3VEP A;  4MEX F;  4WXC A;  1O7L A;  2FE3 A;  3TGN A;  3J7A O;  3HUG A;  2DAO A;  2MH9 A;  3REO A;  1V4R A;  1EV7 A;  4S05 A;  2WV0 A;  3WTV C;  2FNP A;  2STT A;  1ZYR F;  2P7V B;  4A0Z A;  2GXB A;  3EET A;  4RGR A;  1DPU A;  4KMU X;  1KU2 A;  3V8L A;  4IPA A;  2CO5 A;  5DD8 A;  4OIR F;  3ECH A;  4M9X A;  5DCF A;  2QVO A;  3KP5 A;  3FXU A;  4KN7 X;  2ZO4 A;  4N9I A;  1KU7 A;  1ODD A;  5BPI A;  4XBF A;  2O0Y A;  2HYG D;  1KQ9 A;  1CF7 A;  1SFX A;  5DEQ A;  1J2X A;  3JTH A;  4L9N A;  4ZYG A;  4I02 A;  1FBS A;  1LNW A;  3K1P A;  1QO0 D;  5L3B A;  3M8F A;  2KJC A;  1HW2 A;  5D5U B;  3R60 A;  2XAH A;  4B09 A;  4QWQ A;  4NHJ A;  1IN6 A;  2WC2 A;  2EJR A;  2IA0 A;  4EM2 A;  3I5U A;  4CIC A;  3CJN A;  2MLG A;  5ED4 A;  2DT5 A;  2PLY A;  2H27 A;  1OYY A;  1O7F A;  3U1D A;  1FC3 A;  4N0B A;  5E20 A;  1FY7 A;  3H3U A;  3CDH A;  2K4J A;  2ZKZ A;  3GF2 A;  4EGZ A;  4HV6 A;  2X0L A;  4HX8 A;  4HAM A;  4G7O F;  3IHU A;  1PP8 F;  5A2Q Z;  1I1G A;  1J5Y A;  1D5V A;  1FP1 D;  1LB2 A;  2L54 A;  2QYO A;  4P55 A;  3LST A;  1YFH A;  4O3M A;  2V1X A;  2HKO A;  2ZNY A;  3BZ6 A;  1QZY A;  2KIM A;  3IL2 A;  1UB9 A;  4MNU A;  1GHC A;  3GO5 A;  3M7G A;  1HW5 A;  4RB2 C;  1IXC A;  2EFW A;  4HF0 A;  4A0X A;  3RI4 A;  2IVM A;  2Z3Y A;  3WTW C;  2JRT A;  3WTX C;  1S8N A;  4I09 A;  1YS6 A;  1TTY A;  4A2U A;  4FT8 A;  2OQR A;  2ZNZ A;  1IXS B;  1ZAO A;  3HRM A;  1XGO A;  1GXQ A;  1YW8 A;  2V6C A; 
#chains in the Genus database with same CATH topology
 4AD9 A;  2R7Z J;  5L3D A;  3IRQ A;  2FUG 2;  1FT9 A;  2EFQ A;  1TW3 A;  3FHZ A;  1JJ8 C;  1TT0 A;  1MBK A;  3OYL A;  1UEL B;  2NRA C;  2DFH A;  2DDB A;  5EF6 A;  3WHC A;  5K7H A;  2HVS A;  4G8X A;  1PP7 U;  5GPA A;  4XKW A;  1H8A C;  5ILV A;  3BG9 A;  3KP2 A;  1TNT A;  2ZXH A;  4E4H A;  3G73 A;  4YIF A;  1IN7 A;  3LA3 A;  1HCR A;  5CKT A;  2OD5 A;  2Y0S A;  4BAC A;  2CMP A;  1JUS A;  2RDP A;  2LKS A;  4R8H A;  1YI2 I;  3E0J B;  1MND A;  3HOV J;  1T2K A;  2D2W A;  4A3L J;  2LDU A;  2LG4 A;  5FKN A;  1W7P A;  1K78 A;  4CYC B;  1S3J A;  2VPR A;  4HDU A;  2GXG A;  4S04 A;  4J01 A;  4IVN A;  5ICC A;  1ETK A;  4XOR A;  2XHK A;  4M6V A;  1OFC X;  5D4S A;  1S5L C;  3KYD B;  4C30 A;  2NVQ J;  4EM0 B;  2ACJ A;  3KET A;  4BY1 J;  4I0B A;  1YLF A;  1ZGW A;  2IW5 A;  3CUO A;  4EQQ A;  2EIM H;  2OZ6 A;  2KRH A;  3LFU A;  4RA2 A;  2L9N A;  5F08 A;  3TQN A;  2XC7 A;  2EFP A;  4IF4 A;  5D5V B;  1MIJ A;  1EF4 A;  4HQM A;  4KFC A;  1XC5 A;  4KIS A;  3HPH A;  2Y0S N;  2Z2S B;  2YU9 J;  2VQH A;  1S7A A;  2PI0 A;  5JVG F;  3Q0W A;  1ON2 A;  5CVI A;  3I53 A;  4IEJ A;  1RES A;  3HKZ A;  3HOU J;  2XRN A;  2OU2 A;  3VOD A;  3F22 A;  1JI8 A;  2I5U A;  2W84 A;  2NVY J;  4Y17 A;  4B8X A;  3QOE A;  4Q47 A;  5HDN A;  2DTR A;  1TWH J;  1X1B A;  3ABT A;  3P7N A;  1G3T A;  3NAU A;  1K83 J;  1A36 A;  4A3I J;  2WY7 Q;  3RPQ A;  2BBY A;  1JUM A;  4QSH A;  4QPQ A;  3CCJ I;  4H4K C;  3FIS A;  4PJJ A;  1XB4 A;  1D0Z A;  1IF1 A;  3B6C A;  3GTK J;  2WAQ A;  4C2T A;  2Y75 A;  2JMW A;  4JK1 X;  4XLP F;  3W2W A;  3HXL A;  1KQ0 A;  2CUJ A;  1WJA A;  3ZRG A;  4QPO A;  1VQ4 I;  1GLN A;  1O3Q A;  4DBQ A;  1QVT A;  4RM3 A;  5JR3 A;  3Q5F A;  5C4J J;  3HRS A;  2M4K A;  4NQW B;  3FK6 A;  3TOA A;  1WJC A;  5ERI A;  2CW0 F;  4RGU A;  5J4Y A;  3D1N I;  3R0J A;  3HKZ N;  4FX4 A;  1XCV A;  4LK0 F;  1T98 A;  2DI3 A;  2P5K A;  4E7K A;  1D1B A;  4KIC A;  2F5E A;  5D8L B;  2R7R A;  2DT6 A;  1RNL A;  3GTP J;  2Q1Z B;  4RDU A;  4P9F A;  4IOC F;  4OOI A;  1CQT A;  2F2E A;  9ANT A;  4LJZ F;  3OR2 C;  1MNE A;  2VOD A;  3VOE A;  1W4M A;  2WAQ N;  1ETW A;  3F6V A;  1NH3 A;  1H0M A;  1HKT A;  3GLX A;  3G3Z A;  3S93 A;  1G4D A;  2E35 A;  2BV6 A;  3OYC A;  4IHT A;  4A0Y A;  3HUG B;  1C0W A;  2AXL A;  1HDD C;  2A6H F;  1HW1 A;  4CA0 A;  4XLN F;  5AON A;  1YRN B;  4HQE A;  4BJ6 C;  1QPM A;  1MMD A;  3JRB A;  3ABM H;  2WV1 A;  4PJ0 C;  1JGS A;  3WU1 B;  2DMT A;  4PDK A;  3BR0 A;  4BS9 A;  3E5Q A;  5HS7 A;  5LHH A;  1MJ9 A;  5JI6 A;  3RPU A;  1U8B A;  5JVT A;  4C2U A;  3CC2 I;  3A2K A;  4CCJ A;  1NK2 P;  3BC8 A;  4EGY A;  4M72 A;  1ONV A;  2QLZ A;  1RR7 A;  4U0V A;  2A6E F;  2KIU A;  4ZZD A;  5AIQ A;  2GIZ A;  1HOM A;  1LDJ A;  3CO7 C;  4BL0 B;  4EJW A;  1L3L A;  4BE1 A;  2IGM A;  2Y48 A;  3BTI A;  1GVD A;  4I98 B;  2XPW A;  3K0L A;  4BAY A;  3CCS I;  4ESJ A;  1HKS A;  2G0E A;  2IS6 A;  3H9J A;  2NS0 A;  1ORK A;  1T0F C;  1IG7 A;  1B6A A;  2L4M A;  2DA3 A;  1OCP A;  2XF7 A;  2VE9 A;  1FYM A;  2V1N A;  3X2Q H;  4ZZL A;  4BUP A;  4Z6Y A;  5HVQ C;  2BYV E;  1ZEL A;  1CF7 B;  3IH2 A;  2K27 A;  2E7W A;  3QPL A;  3E6B A;  2IGK A;  4RBO A;  5FRN A;  4PK4 A;  1GT0 C;  5E3O A;  4KYW A;  3V8K A;  2E5Z A;  4WXH A;  2E19 A;  2LR8 A;  3K4K A;  4JX5 A;  3MCZ A;  1BI0 A;  1T0F A;  3OR1 C;  5FD5 A;  4ETS A;  4HNT A;  1Z7L A;  1U5T A;  4E7J A;  1FSE A;  3FXQ A;  1ZGA A;  1AKH A;  3T8R A;  3KFW X;  3J80 K;  4M9Z A;  5K5O A;  4GGG A;  4WF2 A;  5M3F J;  4ENM A;  3C1D A;  4RLQ A;  1SMY F;  2KZG A;  2HDC A;  1V3F A;  3L2U A;  1IRX A;  1SD4 A;  1WH5 A;  1F9N A;  3L2R A;  4RGS A;  2QM3 A;  3HSF A;  1QHH D;  3OYA A;  4NBQ A;  3IV5 A;  2YU3 A;  2DTZ A;  2R7D A;  4MQV A;  5D5X B;  1X3W B;  1XTA A;  3RYR A;  3CES A;  2KL4 A;  2VIX A;  2L9S A;  4AVP A;  1TBX A;  1RI7 A;  3CO6 C;  1P7J A;  1N75 A;  3L2Q A;  2DFE A;  3AAF A;  3PFI A;  1D0X A;  1JT6 A;  1BIB A;  2X9D A;  1LEA A;  2I8D A;  1I3A A;  2ETH A;  1WVR A;  1YYV A;  3WTZ A;  3HTU A;  2DMP A;  1YE9 A;  4NC7 A;  2X6O A;  1LE8 A;  5EGO A;  3FDY A;  2O9L A;  2A5Y B;  4QLC U;  3BQZ A;  5D6E A;  4G6T B;  5M3M J;  4KNY A;  3SFZ A;  2BZT A;  1Z0X A;  1UHM A;  3JRI A;  1R1T A;  2K85 A;  4ASN A;  4YII A;  3LNQ A;  2KDZ A;  4ENJ A;  3OYN A;  3BTL A;  5E8I A;  1EJ9 A;  1T38 A;  1R9T J;  5B5E C;  2O61 A;  2PJP A;  5DYM A;  1IC8 A;  1J59 A;  3DPU A;  2PFB A;  4XSX F;  2Y2Z A;  1QPI A;  3OYI A;  2W82 A;  3ZMD A;  1LVK A;  2KMU A;  3BT9 A;  4L5I A;  3U9G A;  1X2M A;  2V4J C;  3ZMZ A;  4IQJ A;  3L00 A;  2X6X A;  5GPC A;  3PQJ A;  1UG0 A;  3DKY A;  4PCQ A;  4RAG A;  1JJ6 C;  5KVR A;  2UXX A;  5ILS A;  2RRE A;  1M1E B;  3TMO A;  1FP2 A;  3ECO A;  2ZSI B;  1WQ2 A;  4AC0 A;  3E97 A;  2FMY A;  4FQG A;  3FIW A;  1QGP A;  2M5W A;  3OOU A;  1IUF A;  4A3M J;  4HST A;  3E7L A;  3FM5 A;  3QP6 A;  2YX7 A;  2FRH A;  2LBF B;  1HF0 A;  2KQR A;  1Y0U A;  2BE5 F;  1S29 A;  3EDP A;  1R49 A;  4DOZ A;  4PFO A;  2EIJ H;  2K9L A;  4BBS J;  1IDZ A;  4BJT A;  2EA4 A;  3IAM 2;  3DU6 A;  3DEU A;  5IY5 H;  2XIG A;  5D6F A;  4CCK A;  2VC1 A;  4CDG A;  4IHY A;  4TV7 A;  3RKW A;  3FMQ A;  4HX7 A;  2VKD A;  1QHG A;  4YEL A;  2ISZ A;  4FE7 A;  2HQR A;  1SMT A;  2LLK A;  1A31 A;  1U8R A;  2PJR A;  4ZJZ A;  4XM3 A;  3ZMS A;  1YJN I;  2FXA A;  1Y1W J;  5LEJ A;  4A3G J;  4LIT A;  2L3D A;  2R5Y B;  3HTS B;  1APL C;  4RAY A;  2DU9 A;  4PUS A;  2IA2 A;  5TJJ A;  1X3U A;  1DGW Y;  1EH7 A;  1X1C A;  1PVE A;  2VJ5 A;  3GTJ J;  2E2H J;  2R0Q C;  2BY2 A;  3M8J A;  4H0E A;  1STZ A;  1X2N A;  3LSR A;  1K78 B;  4WX9 A;  4NDL A;  1MBH A;  4NNJ A;  2XAS A;  4X0G A;  1WI3 A;  5LHI A;  3K4N A;  3ULQ B;  2VJ4 A;  3H35 A;  1I6X A;  2GOM A;  5GAG J;  1K6O A;  5H2F C;  3NAR A;  3S3M A;  1IJW C;  3DFG A;  2IPQ X;  3FMS A;  3KX2 A;  3BY6 A;  3OYE A;  2DA7 A;  1NTC A;  5K5R A;  4XRF A;  2BXY A;  3H5A A;  1ZRE A;  2H09 A;  1AHD P;  2XB5 A;  2C6Y A;  3FXJ A;  2V9V A;  4HNV A;  2W85 A;  3DPL C;  3TP0 A;  1IO2 A;  1OMI A;  3VSL A;  3C18 A;  5BNG A;  3R61 A;  1ZGJ A;  2COB A;  3Q9S A;  2FNA A;  3TO6 A;  2K9Q A;  1OYI A;  2JZY A;  2DMQ A;  3KE2 A;  2DOE A;  4EVI A;  4A93 J;  1R5H A;  3PO3 J;  2FOK A;  2YUS A;  3MAJ A;  1E17 A;  5EZG A;  3MD2 A;  1WFX A;  4M73 A;  1YIJ I;  4NC8 A;  4A3B J;  4MHG A;  4XRM A;  5IP7 J;  1TQM A;  3MWM A;  1XGN A;  2M7A A;  4ANJ A;  3BRO A;  3J81 K;  4JYK A;  3LFK A;  3K4C A;  3A0H C;  2CJJ A;  2YPR A;  5EZH A;  2H1K A;  1PUE E;  2M4G A;  2QSG X;  2AQF A;  3QYB A;  1TQP A;  1X19 A;  3CMA I;  1Y8R B;  2XAJ A;  1T8I A;  2MG4 A;  4II2 A;  2LH9 A;  4CUG A;  1O3R A;  4AYB N;  1H89 C;  4W1U A;  1U2W A;  2LY1 A;  5EG0 A;  4RLF A;  4XOT A;  4FIS A;  3JR9 A;  2CWE A;  2FOW A;  1IN4 A;  4GCV A;  5HS8 A;  2IRF G;  2UV1 A;  2GLO A;  2JVG A;  1XSX A;  4BYY A;  4XN3 A;  1U9N A;  3OYF A;  4A5N A;  1R22 A;  5GAE J;  2BY0 A;  2EZL A;  1RR8 C;  4FCY A;  2ID3 A;  4ZYE A;  3A01 A;  2L01 A;  2EH3 A;  2M87 A;  2RNG A;  1R1U A;  2CRG A;  3ERM A;  4J00 A;  3BQY A;  2Z9O A;  1VQ6 I;  3MVP A;  3HOT A;  2VT3 A;  3HOY J;  2L2O A;  2M0C A;  4EV0 A;  4JX6 A;  5GAD J;  3KCC A;  1JHH A;  1IW7 F;  1BI3 A;  3ZQI A;  3QRF F;  1W0U A;  2DYR H;  1JTY A;  4N4O B;  3K1N A;  3J7Y J;  3O3K A;  1P7I A;  4CHU A;  5LGT A;  5DM6 F;  4BBR J;  2XB0 X;  3LSI A;  5EEH A;  4CCO A;  3H9Q A;  1W5C C;  4KIF A;  2RNJ A;  2EB7 A;  1SD5 A;  2DPD A;  2XSJ C;  4E70 A;  3O8G A;  1O3T A;  2F5V A;  2Q8K A;  3EPZ A;  4MQ9 F;  1JTX A;  4UUV A;  4XNF A;  2WB1 N;  3LSP A;  4XKV A;  2NXN B;  5IT9 K;  4UVB A;  3LMM A;  1BI2 A;  1JE8 A;  2YS9 A;  2GOX B;  3I55 I;  4IXA A;  1JKQ C;  4DZJ A;  3CJR B;  5JHF A;  3RZO J;  2QBY A;  5IT9 Z;  5TIS C;  2WAF A;  3EUH C;  2R7O A;  3TOB A;  1MMA A;  4F55 A;  3TED A;  3R0A A;  1G3S A;  5FFX A;  2VB6 A;  1HDP A;  3F23 A;  3COA C;  2VE8 A;  4LK1 F;  3GZ5 A;  3PJR A;  4XR6 A;  2CQX A;  5DCM B;  5HS9 A;  3HL2 A;  2OC6 A;  2RQP A;  2CW7 A;  2ZME C;  2ELK A;  2Z33 A;  2CGP A;  3CCR I;  5L3C A;  3EUH A;  4ABZ A;  5KAI C;  1LPQ A;  1U5T B;  2E1N A;  3KZZ A;  3FZV A;  1AKH B;  4D1Q A;  2DLL A;  4PJM A;  3ZGK A;  1X1D A;  3P9C A;  2O7O A;  2O5R A;  2XV4 S;  3G6E I;  4RB0 A;  5DDG A;  3ZQL A;  3U2R A;  4G7H F;  3ZMV A;  3BTC A;  1TNS A;  1BN5 A;  3LSM A;  5J1Y A;  4F52 A;  3GTQ J;  3W3C A;  3Q0V A;  3V4G A;  3C3W A;  4L5J A;  1Y39 A;  1UFM A;  1B72 B;  1Z6T A;  1Y0N A;  4G94 A;  1BOB A;  4DGW B;  3BTJ A;  1Z05 A;  3OMY A;  3W6V A;  4LG0 A;  2KFD A;  4MLO A;  5E1W A;  1FSH A;  2JPB A;  2QKM B;  4RS8 A;  1PUF A;  4C3J J;  3CMM A;  2FML A;  2ZFU A;  1QZZ A;  1W1W E;  1I6H J;  5J1U A;  3ZMU A;  1MKM A;  4A3K J;  2HOS A;  3ERE D;  3BG5 A;  1GXP A;  1B9M A;  1ZRC A;  3D5S C;  2F4O B;  5EGO B;  1LE8 B;  1R5G A;  1RRJ A;  2W57 A;  3FXM A;  5HNF A;  3OYH A;  3CCQ I;  1EA3 A;  1JUP A;  2PMH A;  4L9T A;  2L9V A;  3MEX A;  1QBJ A;  2LF8 A;  1T56 A;  2VXZ A;  3B02 A;  5LRR A;  1QNT A;  2HR3 A;  3DWL E;  2RQQ A;  4XID A;  3Q0U A;  3RPU D;  1DU6 A;  2ESN A;  4KA4 A;  1A04 A;  3I59 B;  2EV5 A;  1R5I D;  3BJA A;  5E3N A;  4HF2 A;  2CYY A;  3ZOB A;  1BJZ A;  2GA2 A;  4G6D A;  1ZQ3 P;  2HDD A;  5FRM A;  4LGW A;  2JUC A;  3FKJ A;  5B3S H;  1ZLJ A;  3S16 J;  3S2D J;  2N8G A;  2K5C A;  2EIL H;  1K79 A;  2EFN A;  2KIF A;  5JFR A;  1WZ2 A;  3PNY A;  3H5N A;  1TWA J;  2A61 A;  3E3V A;  5GAH J;  2DA5 A;  2H94 A;  3TDZ C;  3TO7 A;  1WHU A;  3HSR A;  4OIP F;  1ZR4 A;  1LDK B;  5B1B H;  3E6D A;  2XGE A;  2BVM A;  3ELK A;  3CUQ C;  3GFL A;  3D5L A;  4ENN A;  2X1C A;  4AIH A;  1TC3 C;  3SDG A;  3ZP5 A;  2GQQ A;  3MQ0 A;  1TQI A;  3JW4 A;  2BXZ A;  2E60 A;  5JHU A;  2Y30 A;  3RKY A;  3R4K A;  3DP7 A;  3LQQ A;  2GA1 A;  3DCF A;  2HU9 A;  3BR1 A;  2ECC A;  1MDM A;  1S7E A;  3HSE A;  5J3L A;  2GAU A;  2CFO A;  4XRS A;  3CUQ A;  1G3W A;  1V55 H;  5FB2 A;  1S7O A;  2XDV A;  4UNO A;  3JSO A;  2JJ7 A;  1AU7 A;  2LK2 A;  1SAX A;  2G7H A;  2NNY A;  2KT0 A;  1TL8 A;  1IUY A;  1OKR A;  3OYM A;  2A69 F;  4HF1 A;  1H9G A;  2E1M C;  3DKW A;  3IH3 A;  3BR5 A;  1UJ8 A;  4CCM A;  1BL0 A;  2PJR B;  4KDP A;  3LSH A;  1XMA A;  4ZDL A;  2EA2 A;  3PM1 A;  1BC8 C;  3TL4 X;  2DXI A;  4PGG A;  3S2H J;  1KZH A;  1NK3 P;  2FU4 A;  1UST A;  1DPR A;  2MH2 A;  2VBX A;  4R79 A;  2FBH A;  3HGY A;  1F1Z A;  2QZ8 A;  3BJO A;  4OIN F;  3CME I;  4DNC A;  4XQF A;  4P1W A;  2VBY A;  4Y4R A;  3RJP A;  5K7F A;  4OMZ A;  1VQN I;  2NS8 A;  1TZL A;  2K86 A;  4AIJ A;  3GTM J;  2DA2 A;  2GZW A;  3MZH A;  1XCB A;  2DA4 A;  5K5Q A;  4Q48 A;  3K69 A;  1X4P A;  3DTI A;  2ME6 A;  4YFN F;  5D5W B;  1XDS A;  2HZT A;  2ZC2 A;  2HYF A;  4Y33 A;  2F6C A;  2QQA A;  5D8K B;  4AU7 A;  3HHH A;  1V54 H;  2XGD A;  3ASO H;  4ZDO A;  2DQR A;  2XF5 A;  3HRU A;  3A03 A;  3MKL A;  3TBI A;  2YX4 A;  4ON0 A;  1L0O C;  2DMN A;  2LTP A;  4RB1 A;  3GFI A;  1Z67 A;  4OU0 A;  4M3D A;  1W5S A;  4L18 B;  2HOE A;  2DJN A;  5IYD J;  1BI1 A;  1IZ1 A;  2NOG A;  2YR2 A;  4D7N A;  5M5X J;  1BW6 A;  3OYG A;  1BW5 A;  1R4M B;  3HEF A;  4EM1 A;  2CV2 A;  2NYX A;  4RM2 A;  1SD6 A;  4KIT B;  3OS2 A;  1TWC J;  1JKP C;  2HKX A;  5FKL A;  1SAN A;  4F92 B;  2HWV A;  2WWY A;  4AID A;  3DLL F;  3OSF A;  5ICF A;  2TCT A;  5JLW A;  4DW6 A;  2VKH A;  2CS3 A;  3M8E A;  4M71 A;  4O5V A;  2W00 A;  5HOO A;  3H36 A;  3HHG A;  1ZN2 A;  2QEX I;  3GTL J;  2XPU A;  2JK3 A;  2FA5 A;  3PFY A;  4CZZ A;  2R7S A;  1DU0 A;  3WG9 A;  3HOZ J;  2OAZ A;  3M07 A;  2ELH A;  1JKR C;  3RKX A;  3M3Y J;  1V5E A;  5EEG A;  3H0G J;  2K40 A;  3UKG A;  1OCR H;  2CUF A;  4RGX A;  2M2E A;  3QOP A;  4HYE A;  2FD5 A;  2FX0 A;  3SJM A;  4IRI A;  3PO2 J;  2VQC A;  2P7C B;  3QYE A;  3HDD A;  2XVC A;  3PNV A;  3GVA A;  1QA6 A;  1WJF A;  1J9I A;  1HA8 A;  2ZCW A;  3K6G A;  2STW A;  2VUM J;  4BHB A;  1X3Z B;  3HIF A;  1ZKG A;  3DBR B;  5ILU A;  5F0C A;  2F5F A;  5E3M A;  4Y15 A;  5FKK A;  3L9F A;  4U0W A;  2EZH A;  1ZRF A;  2W4S A;  3KZY A;  1OLT A;  3SXY A;  3AL0 C;  3H9G A;  5AIP A;  2FQ3 A;  5DD4 A;  2W7N A;  1XS9 A;  2BY3 A;  1ZR2 A;  2VJJ A;  1I39 A;  2V1U A;  1X1P A;  1Q1H A;  1KU3 A;  2PX9 A;  3GWZ A;  5CVR A;  2ESH A;  3ZN0 A;  3J80 Z;  5EEA A;  3DTE A;  3LA7 A;  2LKP A;  2CH0 A;  3RSN A;  4X6A J;  3RIR A;  4XLH A;  3K4L A;  4XLE A;  2HEO A;  1FEX A;  2LNB A;  2X6W A;  3IWF A;  4KN4 X;  2L7Z A;  1K4S A;  1VI0 A;  1R36 A;  2VL8 A;  1FTZ A;  3JTG A;  2M9H A;  2FF4 A;  3JSP A;  1YO5 C;  3IH4 A;  1JHF A;  3QAH A;  3QQA A;  2MBF A;  3WGI A;  2W25 A;  1BBY A;  1E3H A;  4D0P A;  5FRO A;  5BOX A;  1BOA A;  3ABK H;  2BW3 B;  3OS1 A;  2PN6 A;  3GYH X;  2XF6 A;  2XUB A;  3CCY A;  3HRT A;  3SDB A;  4IO9 F;  2Y9Z A;  4BEH B;  2LSO A;  2HFH A;  2JPC A;  3UR3 C;  2DOD A;  5LGU A;  3JRA A;  5K7Z A;  1NG6 A;  1SEU A;  3FM3 A;  1Z77 A;  4IHX A;  3I0T A;  1RPW A;  4CH7 A;  5BQT A;  2M45 A;  1SFU A;  3CJT B;  4BHP A;  3L2W A;  2PBI A;  2R7F A;  1RUO A;  3N05 A;  2GXA A;  5CVJ A;  3JAM K;  2KZV A;  1LVA A;  4HLX A;  3CC7 I;  3KYL A;  4L0Y B;  3T5X A;  2L7M P;  4KIG A;  3JAM Z;  1U3E M;  1E3P A;  2G7U A;  4AVZ A;  2XAF A;  5LLQ A;  3S17 J;  3BP8 A;  2UXN A;  3DXJ F;  4XKB A;  2OZU A;  1B4A A;  1VQ7 I;  2GWR A;  1MZB A;  3KP7 A;  3RDI A;  2B9S A;  4LOC A;  5CVU A;  4HPQ A;  3HOW J;  2Y69 H;  3DEE A;  1F5T A;  3WGG A;  4F7Z A;  4LG0 B;  3QYF A;  3LWF A;  2XPV A;  2IAI A;  1PUF B;  4DYC A;  2L0K A;  2M8E A;  2QCO A;  4I76 A;  4FX0 A;  2VQG A;  3MMY B;  2G9W A;  3PUF A;  5F27 A;  1UHW A;  1ZTR A;  2EFO A;  2H8R A;  5E1Z B;  3Q9V A;  1RET A;  3WOD F;  5J1R A;  4E7Z A;  2LFB A;  1FOW A;  4O6J A;  2CU7 A;  2CQK A;  4A3D J;  2OV7 A;  1YG2 A;  1DP7 P;  2M3A A;  1D8J A;  3QPT A;  3KP6 A;  4A3F J;  2M34 A;  3GTG J;  4BNC A;  3MZ8 A;  3K2A A;  1GV5 A;  1LUJ B;  2F4M B;  3F9K A;  3SEZ A;  4FHT A;  1FIA A;  1D3Y A;  2E34 A;  1YOV B;  3CLQ A;  5H6R A;  3SZG A;  3NRV A;  4L0Z B;  2TRT A;  4CYC A;  3Q3S A;  1JXS A;  1WWX A;  2W48 A;  1Z7U A;  4G12 A;  4DQ2 A;  2M8G X;  2OA4 A;  3CDL A;  2Z16 A;  2EWN A;  3DBL B;  1CGP A;  5IP9 J;  1Z1D A;  3EYY A;  2RAE A;  3C2G A;  1BJA A;  2UWM A;  4DBR A;  1PDN C;  1TW2 A;  3H92 A;  4R1H A;  5DUI A;  5GTI C;  2BVL A;  2VN2 A;  3F8F A;  3SQN A;  4KUM A;  5CJ9 A;  1KGS A;  1MBJ A;  3KEY A;  1WSU A;  5LHG A;  2HQN A;  4S0H B;  2UZK A;  5TRD A;  2AHQ A;  2R7X A;  1FOK A;  3ZR8 X;  3L2C A;  1G8X A;  4UUS A;  2P0W A;  4GO1 A;  5FKO A;  1MMS A;  2HPI A;  5J47 A;  1W7P B;  2NOJ B;  2L5Q A;  3MN2 A;  4ZDP A;  1G6N A;  4BKX A;  1A35 A;  4I01 A;  5F0F A;  5HNH A;  1FWZ A;  3UNG C;  1MDM B;  4PFP A;  3BWG A;  2DN0 A;  5FLX K;  5LBQ A;  4UY8 I;  2HYJ A;  1ERD A;  2JA7 J;  3O2P E;  3I56 I;  3KZI C;  2E7X A;  2IJL A;  5IP6 A;  5J8F A;  4XL9 A;  4GYI A;  1DQU A;  3WGH A;  4YRV A;  4JQF A;  3WTT C;  2X6Y A;  3I4P A;  5FLX Z;  3KEQ A;  1OCT C;  4OWR B;  1OR7 C;  1V5G A;  3E6C C;  3CZ6 A;  4HDV A;  4MFE A;  1LQ1 A;  2QUF A;  1I5Z A;  4XN0 A;  4ESB A;  3FXK A;  2XGC A;  5IYB J;  4F91 B;  4I2O A;  4HZF A;  1ETV A;  3GZN B;  3IC7 A;  3K10 A;  3SFI A;  2IS1 A;  2A68 F;  4IQ4 A;  4EAT A;  1ZG1 A;  3FX3 A;  5E17 F;  1ENH A;  1SD7 A;  2JA5 J;  1FPQ A;  3ZN1 A;  1IGN A;  3F21 A;  2Z5U A;  3KYC B;  1B9N A;  3HGG A;  5BPD A;  2DJI A;  4AYB A;  2KHM A;  4KT5 C;  1QQI A;  2DPU A;  4UVC A;  2DK8 A;  4IRG A;  1YIT I;  3B73 A;  1XGM A;  2M30 A;  2AO9 A;  4PSW A;  5CPR B;  1LEB A;  3VB2 A;  4M9S A;  1XDU A;  2XGX A;  4LB6 B;  4BJ5 C;  4D7M A;  2X4H A;  2NVU B;  3BOQ A;  3LAP A;  1F4K A;  4IOA F;  3H3Z A;  2DFF A;  3CP2 A;  4GYG A;  4LFU A;  5C4X J;  1B59 A;  1P4W A;  2QWW A;  2RC4 A;  1W5T A;  3T8T A;  5C3E J;  1FMV A;  2IT0 A;  2X1D A;  1O57 A;  3GFM A;  3WTU C;  2ZJP F;  4PJN A;  4HV5 A;  1FLI A;  2IS4 A;  1KA8 A;  1RKW A;  1LFB A;  1K4T A;  3J81 Z;  3K70 D;  5DV5 A;  2NS7 A;  1VQ8 I;  3T0Y A;  3CF5 F;  2CV0 A;  4HRI A;  1BR1 A;  1SFK A;  2JSC A;  4JOM A;  4JBA A;  4BQA A;  2I10 A;  1YS7 A;  2P5V A;  3DV8 A;  1JGG A;  4CZC A;  4C3I J;  4DJA A;  1JKO C;  1ZHF A;  2QQB A;  4LB5 A;  4ITV A;  1VFC A;  1YRN A;  1B8I A;  3GCM A;  1ETO A;  3FKI J;  4ZH4 F;  2ZJR F;  2OTL I;  3GEZ A;  3KLO A;  4EJV A;  1T39 A;  3OIQ A;  1MJA A;  1POG A;  3RZD J;  4D5C A;  3K7A J;  2HTS A;  5K1Y A;  2BHY A;  2PMZ A;  3OYJ A;  2WB1 A;  4CGZ A;  2ADU A;  4LIV A;  1DUX C;  3EUK L;  4DIQ A;  4F93 B;  1XMX A;  1D1C A;  2OPT A;  4C2M J;  4GXO A;  3PSF A;  2R4G A;  3BDD A;  1XSV A;  3JRC A;  4AWX B;  1IRG A;  4YFK F;  4M6Y A;  4BH9 A;  5L3F A;  5F0H A;  1W7P D;  1N78 A;  1G3Y A;  3VYS B;  3V7R A;  5L3E A;  4BGD A;  2OQG A;  1W36 C;  2P8T A;  1I27 A;  4J19 A;  2CSO A;  4BDZ A;  4C9Y A;  1WJD A;  3LQR A;  2CUE A;  2ISY A;  5KK1 A;  4IJA A;  2MA3 A;  3BG6 A;  1R00 A;  3WU0 A;  1BR2 A;  4I0A A;  1A6Q A;  1YX5 A;  3TO9 A;  2QA4 I;  1S9H A;  3BG7 A;  3KPH A;  4XLC A;  4Y13 A;  2PMZ N;  4IL6 C;  1N77 A;  2YSR A;  3OL3 A;  4XSZ F;  3I9V 2;  4IHV A;  3DPT A;  2F5D A;  4NB5 A;  1OPC A;  2M7B A;  4UV8 A;  3BCB A;  4UUT A;  2QQ8 A;  1FYL A;  1MSF C;  1WCM J;  1MD0 A;  2JVH A;  1S6L A;  2L7F P;  3G4S I;  1FBU A;  1VQP I;  5LGN A;  3TDU C;  3I4N J;  4W97 A;  5GP9 A;  3L09 A;  4A5M A;  1FBQ A;  5HLH A;  4MGR A;  3GX4 X;  3V8J A;  4MO7 A;  2FSW A;  1IXR C;  2WA0 A;  4MTD A;  3S3O A;  4Y3O A;  4MIM A;  4EJT A;  1SFE A;  4P5O A;  2VOP A;  2VLA A;  1TWG J;  1TWF J;  4XLA A;  4B43 A;  2ZXW H;  5LFA A;  4RAF A;  2HPM A;  1QRY A;  2O03 A;  1I50 J;  4CXF A;  5M5W J;  4LD5 A;  2MLK A;  3MFK A;  1RC9 A;  1WJB A;  3NWS A;  2GBY A;  4NC6 A;  2CUZ A;  2IA1 A;  3CTA A;  3OOP A;  1KON A;  1VF9 A;  2LP0 A;  2ZME A;  4LG3 A;  3ZMT A;  3MKY B;  2HNH A;  1FTT A;  3OY9 A;  5E18 F;  2K3P A;  1IV8 A;  2HTJ A;  1XD7 A;  2A3S A;  2HGC A;  5A2Q K;  2KPM A;  1Y6I A;  3VWB A;  2VOO A;  1E0E A;  4IHS A;  1NG7 A;  2K7L A;  1D8K A;  4V19 K;  1YW9 A;  5KCM A;  4UXN A;  3AFH A;  4LLN A;  1WJ5 A;  1FIP A;  2KP6 A;  1YHQ I;  1LDD A;  1OQY A;  5ICE A;  1YQA A;  1UMQ A;  3CLO A;  4WWC A;  3U1K A;  4PSX A;  3WHB A;  3PL8 A;  2L9R A;  3CP8 A;  1FNN A;  2QQ9 A;  4ZYA A;  2MGQ A;  3BR6 A;  2OF7 A;  5DTD A;  4MTE A;  2O6G E;  2LRD A;  2B63 J;  4LMY A;  1DDN A;  4N4N B;  3S2W A;  2XRL A;  1P4A A;  1P9Q C;  1X58 A;  4A6E A;  2M0M A;  2E1O A;  1ETX A;  3I58 A;  4A69 C;  4B44 A;  1Z91 A;  2QSF X;  3O6B B;  2DDA A;  2DO7 A;  5HDG A;  3N4M A;  2RVC A;  4AIK A;  2DT7 B;  2ZJ2 A;  2V1D A;  2A5W A;  4A6D A;  2RGV A;  1IAW A;  1BIA A;  2J5P A;  4JP0 A;  3S1Q J;  4U88 A;  3E6M A;  3K1M A;  3HZJ A;  1AA7 A;  5FGM A;  2EZK A;  1SVL A;  3S8P A;  1RIO H;  3D5R C;  4FET A;  1GUU A;  2LBF A;  4E6K G;  4YG2 F;  3OIP A;  1T33 A;  2XKO A;  4F3Q A;  3KP4 A;  3OWT A;  1R7J A;  2OTJ I;  2CQ7 A;  3FF5 A;  1ULY A;  2LVS A;  5IYC J;  2E36 A;  3KP3 A;  2DA6 A;  3ISP A;  1MMG A;  2XAG A;  5F6F A;  5BS6 A;  1REP C;  3VFZ A;  1IV6 A;  1U6G A;  3EUA A;  1BM9 A;  3BJ6 A;  2XKP A;  2ZFW A;  3F72 A;  3JCU C;  1KYW A;  3ZQ7 A;  1MJB A;  1FZP B;  4CO8 A;  2FJ1 A;  3OYB A;  2JWT A;  1OYW A;  2OBP A;  5E1X A;  1AWC A;  1MSE C;  2IGO A;  5HDK A;  5C44 J;  4N9H A;  1P6R A;  2R5Y A;  2K02 A;  1Z21 A;  3VYU B;  5J4V A;  1ITY A;  3F3X A;  4RB3 C;  3HJE A;  2H8W A;  3GUD A;  1LKX A;  3G1M A;  3SZP A;  4X1E A;  1Y1V J;  4QTR A;  4HBL A;  2ZBK A;  1J0R A;  3DLA A;  2X85 A;  5IOY A;  2VC0 A;  1U9O A;  1Z6R A;  3FMR A;  4LIU A;  1FJL A;  4L9J A;  5FD6 A;  3K4B A;  1R4N B;  2IBD A;  1GVJ A;  2ECB A;  1MW7 A;  2DOA A;  2EQR A;  4LLG F;  1BC7 C;  4C3H J;  2ZXI A;  4KIB A;  3ZPL A;  1LJ9 A;  2R7T A;  4V2F A;  1E2X A;  3BZK A;  2PMU A;  2PEX A;  2BGC A;  5F64 A;  1WKM A;  1YW7 A;  1ZG3 A;  2Q0O A;  2V9K A;  3AG4 H;  5J6X A;  1XN7 A;  3E5X A;  3PSI A;  4EJU A;  3TW6 A;  1HXD A;  3KLN A;  2XAQ A;  1N25 A;  1XX5 A;  4M74 A;  1R23 A;  3ZQQ A;  3P9I A;  3OYK A;  4UHT A;  4A3E J;  4E7H A;  1D5Y A;  4CSW A;  2QEN A;  3IRR A;  3U21 A;  2CG4 A;  3PIO F;  4UUS B;  2QGU A;  2A6T A;  4CCL A;  1A5J A;  3CMY A;  1GV2 A;  2L02 A;  3G2B A;  2BEO A;  2VI6 A;  5DUK A;  3ML6 A;  3EYI A;  2K9S A;  1P2F A;  2VBW A;  4IX7 A;  3AG2 H;  2AS5 F;  2Q2E A;  3QPS A;  3SZT A;  3ZCO A;  4OIO F;  4WK8 F;  3RCO A;  4CCN A;  2Y0M A;  3QP5 A;  4RAZ A;  3ESW B;  4BXU A;  3A02 A;  4B1R A;  3DTK A;  4HW0 A;  4XLF A;  2M1B A;  5DS9 A;  4WCG A;  3ABU A;  3OYD A;  2R7V A;  2FBI A;  3DQV C;  1FMW A;  1TT5 B;  3H5R A;  4I6Z A;  2RV8 A;  4XRS G;  3GME A;  2D1H A;  3OL4 A;  2B0L A;  4ZTJ A;  2D5V A;  1I1S A;  2NVX J;  2MC3 A;  3A0B C;  1IN8 A;  3VDX A;  1Y8Q B;  4KMF A;  1XGS A;  1UAA A;  1G59 A;  2EK5 A;  3C2H A;  2R7U A;  1R58 A;  1RZ4 A;  3S15 J;  1KU9 A;  1Z3X A;  1WRJ A;  3IKT A;  4HOB A;  2HZD A;  4Z2Y A;  2KJB A;  2K9N A;  4M3E A;  3BR2 A;  4XK4 A;  3V7S A;  1VQ9 I;  3K2Z A;  2PQ8 A;  1SAU A;  4GFB A;  2JTV A;  3RQI A;  3CC4 I;  2FBK A;  5IPA A;  3FXO A;  2J5O A;  3GLL A;  3HYI A;  3BPV A;  5LD2 C;  3CD6 I;  2LRE A;  4HA8 A;  1WH7 A;  4CYD A;  3CJQ B;  4BXF A;  4ESF A;  5IT3 A;  2VAS A;  2V26 A;  1HSJ A;  2P6S A;  3FBN B;  4I99 C;  3E1S A;  3RYP A;  5IOZ A;  4UVA A;  1H9T A;  4AUX A;  2O3F A;  2L4A A;  2KRF A;  2EIN H;  3V7C A;  1P4X A;  2VBZ A;  2WAD A;  2LC2 A;  3PUB A;  3M1C A;  5EG0 B;  3NQO A;  3E5U A;  1B8I B;  3HOS A;  3TKY A;  4OIQ F;  3HM5 A;  1YJW I;  2DK5 A;  4DYQ A;  2ME0 A;  1K7A A;  1QU3 A;  3P5J A;  5B66 C;  4Y52 J;  4BDY A;  3DBH B;  4AM3 A;  3F8N A;  3A1Y A;  4Q5S F;  3ZXS A;  4GDF A;  3NEU A;  2LF7 A;  1LFU P;  4ZYH A;  4G6Q A;  3A01 B;  4XKC A;  5CYV A;  3H1C A;  5HLT A;  1X1A A;  3F8M A;  1O4X A;  3QU6 A;  3DU5 A;  3GBG A;  3D0S A;  2LYC A;  5E8G A;  5E79 C;  3WU2 C;  1FOY A;  1B1B A;  2WTE A;  5L3G A;  3KEO A;  4UV9 A;  2W24 A;  3LA2 A;  5CVV A;  3J7Z I;  2B7E A;  2DFI A;  3W6J B;  2R5Z A;  4EMS A;  2ID6 A;  3F8B A;  2JT1 A;  1U5T C;  1EKE A;  2H6C A;  4EJO A;  5F04 A;  1MH4 A;  5FKM A;  2NAZ A;  3I4M J;  3PQK A;  2EBI A;  3QU3 A;  5EDN A;  1S72 I;  3S1M J;  5DCM A;  4XOP A;  3GW2 A;  4A3J J;  3CF2 A;  1G2H A;  2RN7 A;  1YIO A;  2A07 F;  1FX7 A;  1YX3 A;  1F43 A;  5HLG A;  1R1V A;  3PNT A;  3S32 A;  1OIS A;  3JRD A;  1WGX A;  2UUZ A;  4IZZ A;  1ZAR A;  1FYK A;  2A05 A;  1D0Y A;  4BE2 A;  2EV6 A;  3FXR A;  2QBY B;  3SHF A;  2QF7 A;  3HOX J;  1UZC A;  1U78 A;  1ACI A;  2CQN A;  2MD0 A;  3WE3 A;  1VND A;  3GXO A;  2KRC A;  4PGH A;  1IRZ A;  4QIW N;  3W2V A;  1O3S A;  1MNM C;  5FJ8 J;  3GFJ A;  1USS A;  3KIO A;  3VYR B;  2IEK A;  2QKL B;  4G9Y A;  1MBG A;  4ZYD A;  2IGN A;  2X51 A;  2LY2 A;  3DEW A;  1B72 A;  3K9T A;  1OCC H;  1BA5 A;  2F5C A;  2GIV A;  3AG1 H;  1HBX G;  4XIC A;  5FO5 A;  2K4B A;  2K3F A;  5JLX A;  5BMZ A;  1IRF A;  2F48 A;  4HX4 A;  2TDX A;  5FFZ A;  2R3S A;  4DZP A;  2CFX A;  1KYZ A;  3I54 A;  2ZME B;  1VQ5 I;  3K4J A;  5LEK A;  4GRI A;  4M3G A;  4M3B A;  3R6S A;  3OS0 A;  2NNN A;  2WAE A;  2HXI A;  2JN6 A;  4I7H A;  3QPH A;  3F8C A;  3LAJ A;  2MSY A;  5ICG A;  1U0J A;  4B48 A;  3I3L A;  2QSH X;  4KJZ A;  2FEZ A;  2VQL A;  3I59 A;  3MZY A;  3IKV A;  3M4O J;  2OJE D;  4U0Y A;  3P9K A;  4A12 A;  1WPK A;  2KIQ A;  3ZQF A;  1T6S A;  4U7D A;  2K9M A;  1WJE A;  3T1B A;  1ZK8 A;  2O8X A;  3JRG A;  2MD5 A;  2IS2 A;  1KQ8 A;  3IWZ A;  2VKE A;  3LSK A;  5H20 A;  1OCO H;  4ENK A;  1A6I A;  1P92 A;  2XAU A;  4M3F A;  4P96 A;  2EZI A;  2H6B A;  2AQE A;  5H6Q A;  3GZ6 A;  1VTN C;  4XMY A;  3BR3 A;  3ROU A;  2Z99 A;  2IP2 A;  4IRH A;  2X1E A;  2P6T A;  1RKT A;  3CQZ J;  4UB6 C;  2JQ7 A;  1UCR A;  1HLV A;  4OMY A;  2COM A;  3SYT A;  1R71 A;  3WTY C;  1VQO I;  1HST A;  2LMD A;  1ON1 A;  3H3V K;  3ZQC A;  2RKH A;  1HC8 A;  2VPL A;  4K2E A;  3WTS C;  2HI3 A;  2PG4 A;  3CCU I;  1J09 A;  2KIS A;  3J7A Y;  1GDT A;  4HLY A;  1ZG5 A;  4JX4 A;  4P9U A;  1OCZ H;  2EV0 A;  2L7K A;  1W36 D;  1ZH5 A;  3AKZ A;  4Q4Z F;  2MAB A;  1SFO J;  1FOX A;  1MGT A;  4B47 A;  2OCE A;  2BHZ A;  2ZXJ A;  4OAZ A;  3FWE A;  1HKQ A;  5CLS A;  5CQG A;  2HS5 A;  4BHC A;  2V7F A;  3F0C A;  4BQN A;  2FQ4 A;  1SVM A;  2D1V A;  1XG1 A;  2KDO A;  5GTH C;  4B3X A;  3G71 I;  5KAF C;  1IDY A;  3C7J A;  1D1A A;  5KHD A;  1TLH B;  4M6X A;  1J75 A;  3M9A A;  5J8C A;  4II3 A;  1DP3 A;  5D4R A;  4BQQ A;  1T95 A;  3A4C A;  3WE2 A;  4U7B A;  4B3A A;  1XSD A;  2DOF A;  1I3Q J;  3CCM I;  2XRO A;  2R92 J;  1VQM I;  6PAX A;  3L7W A;  2VON A;  2HQ5 A;  4MEY F;  4WXD A;  1IN5 A;  4PZJ A;  2DW4 A;  3CUQ B;  4L9V A;  2VT2 A;  4L5E A;  3EQL F;  5M5Y J;  3S1N J;  1SVO A;  5F1R A;  2JA6 J;  2BOL A;  3LL7 A;  2JA2 A;  1NHA A;  2P4W A;  1J7K A;  1XMK A;  2X48 A;  1HQC A;  4U87 A;  3S3N A;  1EH8 A;  1PJR A;  2D45 A;  3I71 A;  3JRE A;  3S14 J;  3RTR A;  3ONQ A;  2KKO A;  1RUN A;  2H1L A;  3HPG A;  2OUM A;  2HVQ A;  1YTY A;  3LSG A;  1MBF A;  1AOY A;  1ZRD A;  1EH6 A;  1ZLK A;  2WBM A;  5HLI A;  2V79 A;  4NQW A;  1OR7 A;  1K61 A;  4YFX F;  3DF8 A;  3W6K B;  2DQL A;  4G7Z F;  1WI9 A;  3VYT B;  5LRS A;  1QVU A;  2E1C A;  1V5F A;  4LLL A;  2P81 A;  2E1M B;  3B6A A;  1ETQ A;  3I64 A;  3OV8 A;  5E3L A;  2DBB A;  2HQA A;  1VQK I;  2P5L C;  1ETY A;  4PJL A;  3M1E A;  1Z9C A;  3F6O A;  2HDW A;  3QOD A;  4IKF A;  3BLY A;  4V2G A;  3N97 A;  2GM4 A;  4FAS D;  3HC7 A;  2VJI A;  3BPX A;  1TP4 A;  5J40 A;  3VEP A;  3LSJ A;  2Q2E B;  4MEX F;  2R7W A;  4WXC A;  1O7L A;  2FE3 A;  3ZQG A;  2Y9Y A;  3OIO A;  4NUB A;  3TGN A;  3S1R J;  3J7A O;  2WY8 Q;  3HUG A;  1OJL A;  2DAO A;  2MH9 A;  3REO A;  3BZC A;  3TW7 A;  5HOD A;  5DM7 F;  3ZQH A;  1V4R A;  2ZJQ F;  1EV7 A;  4S05 A;  3VPR A;  2WV0 A;  3WTV C;  4E7S A;  2FNP A;  2STT A;  1ZYR F;  2P7V B;  4A0Z A;  2GXB A;  3RQ4 A;  2ZSH B;  3G1L A;  3QWL A;  3EET A;  3L2V A;  1H88 C;  2CV1 A;  4HG2 A;  4RGR A;  4BU2 A;  3HBL A;  3H0D A;  4BE0 A;  5TGT A;  1VZ0 A;  1DPU A;  1X4O A;  1R6R A;  2OCC H;  2O8K A;  4KMU X;  1KU2 A;  3V8L A;  4IPA A;  2EPF A;  2CO5 A;  2VKV A;  4ZC3 A;  1F36 A;  3MKZ A;  1LFP A;  5DD8 A;  4OIR F;  2MC4 A;  2Y31 A;  3ECH A;  4M9X A;  5DCF A;  2QVO A;  3HB9 A;  1Z3Y A;  3KP5 A;  3K4M A;  3SEQ A;  2KLO A;  3FXU A;  3FHN A;  2CW8 A;  3PIP F;  5EJC A;  4KN7 X;  2ZO4 A;  2R7Q A;  2LY9 A;  4N9I A;  2E71 A;  2F4I A;  3FK7 A;  3C2B A;  1KU7 A;  1SC7 A;  3FXL A;  1ODD A;  2MYS A;  5BPI A;  4XBF A;  2O0Y A;  4MFD A;  3ABL H;  3WG7 H;  2EIK H;  2HYG D;  2HOT A;  1KQ9 A;  2DCE A;  3CCE I;  3FBI B;  1CF7 A;  4DYR A;  2ZB9 A;  2LKX A;  1SFX A;  4BY7 J;  5DEQ A;  1J2X A;  2Z1D A;  3JTH A;  4FTH A;  4L9N A;  2DYS H;  2VXD A;  2NVT J;  4ZYG A;  2IXS A;  1Q1V A;  2W1O A;  3AG3 H;  4I02 A;  4BXX J;  2HVR A;  1FBS A;  3HG9 A;  1LNW A;  3K1P A;  3VSK A;  1QO0 D;  4RMN A;  1MMN A;  1XPX A;  4YEJ A;  5L3B A;  3M8F A;  3OSG A;  3CDI A;  2KJC A;  5F1J A;  1HW2 A;  3R60 A;  2JSP A;  2XAH A;  4B09 A;  5D5U B;  2LD5 A;  4QWQ A;  3DKX A;  1BR4 A;  4NHJ A;  1IN6 A;  2AXT C;  2EJR A;  2IA0 A;  2WC2 A;  3IP4 B;  4EM2 A;  3JRF A;  3I5U A;  4CIC A;  3CJN A;  3LOC A;  2MLG A;  4E7I A;  5ED4 A;  2DT5 A;  3NWT A;  2PLY A;  2H27 A;  2BY1 A;  4EEF G;  1OYY A;  2R5Z B;  1O7F A;  5B1A H;  3U1D A;  4YIR X;  4Y7N J;  1FC3 A;  4N0B A;  5E20 A;  1FY7 A;  2BW3 A;  2MFZ A;  3H3U A;  3RKQ A;  3CDH A;  2JUG A;  4FE4 A;  4BEH A;  1K6Y A;  2ICW G;  3G1O A;  4HSR A;  4BQO A;  1QZE A;  2K4J A;  2ZKZ A;  4KT6 A;  3GF2 A;  2V6E A;  4EGZ A;  3AL0 B;  3CCL I;  4IHW A;  1JT0 A;  4HV6 A;  2X0L A;  4HX8 A;  4E7L A;  1UHS A;  4HAM A;  1W0T A;  2E2I J;  4G7O F;  3IHU A;  2JA8 J;  3BCA A;  3L1P A;  1PP8 F;  5A2Q Z;  1I1G A;  4HNU A;  4HEA 2;  1J5Y A;  1MH3 A;  5EYR A;  1D5V A;  2LOO A;  1FP1 D;  2CQQ A;  1LB2 A;  2L54 A;  2QYO A;  4P55 A;  3LST A;  1YFH A;  1Y56 A;  4O3M A;  1MBE A;  2V1X A;  1T08 B;  2HKO A;  2ZNY A;  1DGR M;  3BZ6 A;  3TP3 A;  3BG3 A;  1QZY A;  2DA1 A;  4XON A;  2KIM A;  2HXO A;  3IL2 A;  3V42 A;  1UB9 A;  4MNU A;  1PYV A;  3GO5 A;  1GHC A;  3M7G A;  1HW5 A;  4RB2 C;  1IXC A;  3GTO J;  2EFW A;  2DMU A;  4HF0 A;  2R93 J;  1UG2 A;  3O8H A;  4A0X A;  5KNL A;  5FLV A;  3RI4 A;  4A3C J;  2IVM A;  2Z3Y A;  1E3O C;  4D9J A;  3WTW C;  2V9P A;  2JRT A;  4D5F A;  3K70 C;  2MW8 A;  3WTX C;  1S8N A;  3JRH A;  2E5N A;  4I09 A;  1YS6 A;  1TTY A;  5FLM J;  4A2U A;  4FT8 A;  4ZTF A;  1YJ9 I;  3ASN H;  2ELJ A;  2HOA A;  2OQR A;  1IXS B;  2ZNZ A;  1ZAO A;  3HRM A;  4OAY A;  3CCV I;  3IAS 2;  3IUO A;  4B4C A;  1VQL I;  1XGO A;  2E2J J;  4UB8 C;  2JRM A;  1GXQ A;  2XSD C;  1YW8 A;  2V6C A;  5CQE A;  3W2A A;  3MKW B; 
#chains in the Genus database with same CATH homology
 4AD9 A;  5L3D A;  3IRQ A;  1FT9 A;  2EFQ A;  1TW3 A;  3FHZ A;  2NRA C;  4G8X A;  1PP7 U;  5ILV A;  3KP2 A;  1TNT A;  3G73 A;  4YIF A;  1IN7 A;  3LA3 A;  2OD5 A;  2RDP A;  4R8H A;  1T2K A;  2D2W A;  2LDU A;  1W7P A;  1K78 A;  1S3J A;  4HDU A;  2GXG A;  4S04 A;  4IVN A;  5ICC A;  2XHK A;  5D4S A;  4EM0 B;  2ACJ A;  3KET A;  4I0B A;  1YLF A;  2IW5 A;  3CUO A;  4EQQ A;  2OZ6 A;  3TQN A;  2EFP A;  4IF4 A;  5D5V B;  4HQM A;  4KFC A;  1S7A A;  2PI0 A;  1ON2 A;  5CVI A;  3I53 A;  2XRN A;  2OU2 A;  3VOD A;  3F22 A;  2W84 A;  4Y17 A;  4B8X A;  4Q47 A;  5HDN A;  2DTR A;  3P7N A;  3ABT A;  1G3T A;  3RPQ A;  2BBY A;  1XB4 A;  1IF1 A;  2Y75 A;  4JK1 X;  4XLP F;  1KQ0 A;  1O3Q A;  3Q5F A;  5JR3 A;  3HRS A;  3TOA A;  5ERI A;  2CW0 F;  4RGU A;  3R0J A;  4FX4 A;  1XCV A;  4LK0 F;  1T98 A;  2DI3 A;  2P5K A;  4KIC A;  2F5E A;  5D8L B;  1RNL A;  4P9F A;  4OOI A;  2F2E A;  4LJZ F;  2VOD A;  3VOE A;  1W4M A;  3F6V A;  1H0M A;  1HKT A;  3GLX A;  3G3Z A;  1G4D A;  2BV6 A;  4IHT A;  4A0Y A;  1C0W A;  2AXL A;  2A6H F;  1HW1 A;  4XLN F;  5AON A;  4HQE A;  1QPM A;  1JGS A;  3WU1 B;  4PDK A;  3E5Q A;  5HS7 A;  5LHH A;  1MJ9 A;  5JI6 A;  3RPU A;  5JVT A;  4EGY A;  4M72 A;  1ONV A;  2QLZ A;  4U0V A;  2A6E F;  2KIU A;  4ZZD A;  5AIQ A;  1LDJ A;  3CO7 C;  4EJW A;  1L3L A;  2Y48 A;  4I98 B;  3K0L A;  4BAY A;  4ESJ A;  1HKS A;  2NS0 A;  1B6A A;  2L4M A;  1FYM A;  2VE9 A;  4ZZL A;  5HVQ C;  2BYV E;  1CF7 B;  2K27 A;  2E7W A;  3E6B A;  4KYW A;  3V8K A;  4WXH A;  3MCZ A;  1BI0 A;  1T0F A;  5FD5 A;  4ETS A;  1U5T A;  1FSE A;  3FXQ A;  1ZGA A;  3T8R A;  3KFW X;  3J80 K;  4M9Z A;  5K5O A;  4GGG A;  4WF2 A;  4ENM A;  3C1D A;  1SMY F;  2HDC A;  1V3F A;  1SD4 A;  1F9N A;  4RGS A;  2QM3 A;  3HSF A;  2YU3 A;  2R7D A;  4MQV A;  5D5X B;  3RYR A;  3CO6 C;  4AVP A;  1TBX A;  1RI7 A;  3AAF A;  3PFI A;  1BIB A;  1LEA A;  2ETH A;  1YYV A;  3WTZ A;  3HTU A;  2A5Y B;  4QLC U;  5D6E A;  4KNY A;  3SFZ A;  1UHM A;  1R1T A;  4ASN A;  4YII A;  4ENJ A;  5E8I A;  1T38 A;  2O61 A;  2PJP A;  5DYM A;  1J59 A;  2PFB A;  4XSX F;  3ZMD A;  4L5I A;  3U9G A;  3ZMZ A;  3L00 A;  3PQJ A;  4PCQ A;  5KVR A;  2UXX A;  5ILS A;  1FP2 A;  3ECO A;  1WQ2 A;  3E97 A;  2FMY A;  1QGP A;  2M5W A;  3FM5 A;  3QP6 A;  2YX7 A;  2FRH A;  1Y0U A;  2BE5 F;  1S29 A;  3EDP A;  2EA4 A;  3DEU A;  2XIG A;  5D6F A;  2VC1 A;  4CDG A;  4TV7 A;  3RKW A;  3FMQ A;  4HX7 A;  2ISZ A;  2HQR A;  1SMT A;  1U8R A;  3ZMS A;  2FXA A;  5LEJ A;  2L3D A;  3HTS B;  4RAY A;  2DU9 A;  2IA2 A;  5TJJ A;  1X3U A;  1EH7 A;  4H0E A;  1STZ A;  1K78 B;  4WX9 A;  2XAS A;  5LHI A;  3ULQ B;  1K6O A;  1I6X A;  3DFG A;  2IPQ X;  3FMS A;  3BY6 A;  5K5R A;  1ZRE A;  4XRF A;  2H09 A;  2C6Y A;  2V9V A;  2W85 A;  3DPL C;  1OMI A;  3C18 A;  3R61 A;  1ZGJ A;  3Q9S A;  2FNA A;  3TO6 A;  1OYI A;  2JZY A;  3KE2 A;  4EVI A;  1R5H A;  2FOK A;  1E17 A;  3MAJ A;  4M73 A;  4MHG A;  1TQM A;  3MWM A;  1XGN A;  3BRO A;  3J81 K;  3LFK A;  2YPR A;  1PUE E;  1TQP A;  2XAJ A;  1O3R A;  1U2W A;  2CWE A;  1IN4 A;  4GCV A;  5HS8 A;  2IRF G;  1XSX A;  4BYY A;  4A5N A;  1R22 A;  4ZYE A;  2L01 A;  2M87 A;  1R1U A;  2Z9O A;  3HOT A;  2VT3 A;  4EV0 A;  3KCC A;  1JHH A;  1IW7 F;  1BI3 A;  3QRF F;  3K1N A;  3O3K A;  4CHU A;  5LGT A;  5EEH A;  4KIF A;  2RNJ A;  2EB7 A;  1SD5 A;  2DPD A;  4E70 A;  1O3T A;  2Q8K A;  4MQ9 F;  4UUV A;  5IT9 K;  4UVB A;  1BI2 A;  1JE8 A;  4IXA A;  2QBY A;  5IT9 Z;  3TOB A;  3R0A A;  1G3S A;  5FFX A;  3F23 A;  3COA C;  2VE8 A;  4LK1 F;  3GZ5 A;  5DCM B;  5HS9 A;  2RQP A;  2Z33 A;  2CGP A;  5L3C A;  3EUH A;  1U5T B;  2E1N A;  3KZZ A;  3FZV A;  2DLL A;  3P9C A;  2XV4 S;  4RB0 A;  5DDG A;  3U2R A;  4G7H F;  3ZMV A;  1TNS A;  1BN5 A;  3V4G A;  3C3W A;  4L5J A;  1UFM A;  1Z6T A;  4G94 A;  1Z05 A;  4LG0 A;  5E1W A;  1FSH A;  2JPB A;  4RS8 A;  2FML A;  1QZZ A;  3ZMU A;  1MKM A;  3ERE D;  1GXP A;  1B9M A;  1ZRC A;  1R5G A;  2W57 A;  2PMH A;  4L9T A;  3MEX A;  1QBJ A;  2LF8 A;  2VXZ A;  3B02 A;  5LRR A;  1QNT A;  2HR3 A;  2ESN A;  4KA4 A;  1A04 A;  3I59 B;  2EV5 A;  3BJA A;  4HF2 A;  2CYY A;  2GA2 A;  4G6D A;  4LGW A;  1ZLJ A;  1K79 A;  2EFN A;  2KIF A;  5JFR A;  2A61 A;  3E3V A;  2H94 A;  3TDZ C;  3TO7 A;  3HSR A;  4OIP F;  1LDK B;  3E6D A;  3ELK A;  3CUQ C;  3GFL A;  3D5L A;  4ENN A;  4AIH A;  3ZP5 A;  2GQQ A;  3MQ0 A;  1TQI A;  3JW4 A;  5JHU A;  3RKY A;  3R4K A;  3DP7 A;  3LQQ A;  2GA1 A;  1MDM A;  3HSE A;  2GAU A;  3CUQ A;  1G3W A;  5FB2 A;  1S7O A;  4UNO A;  3JSO A;  1SAX A;  2G7H A;  2NNY A;  1IUY A;  1OKR A;  2A69 F;  4HF1 A;  1H9G A;  3DKW A;  4KDP A;  1XMA A;  2EA2 A;  1BC8 C;  4PGG A;  2FU4 A;  1UST A;  1DPR A;  2MH2 A;  2VBX A;  4R79 A;  2FBH A;  1F1Z A;  2QZ8 A;  3BJO A;  4OIN F;  4DNC A;  2VBY A;  3RJP A;  4OMZ A;  2K86 A;  4AIJ A;  2GZW A;  3MZH A;  1XCB A;  5K5Q A;  4Q48 A;  3K69 A;  4YFN F;  5D5W B;  1XDS A;  2HZT A;  2HYF A;  2QQA A;  5D8K B;  3HHH A;  2DQR A;  3HRU A;  2YX4 A;  4ON0 A;  1L0O C;  4RB1 A;  3GFI A;  4OU0 A;  1W5S A;  4L18 B;  2HOE A;  1BI1 A;  1IZ1 A;  2YR2 A;  4EM1 A;  2NYX A;  1SD6 A;  2HKX A;  2HWV A;  2WWY A;  5ICF A;  3M8E A;  4M71 A;  4O5V A;  5HOO A;  3HHG A;  1ZN2 A;  2FA5 A;  4CZZ A;  3WG9 A;  2OAZ A;  2ELH A;  3RKX A;  5EEG A;  4RGX A;  3QOP A;  4HYE A;  4IRI A;  2P7C B;  2XVC A;  3GVA A;  1J9I A;  2ZCW A;  2STW A;  4BHB A;  3HIF A;  5ILU A;  2F5F A;  4Y15 A;  3L9F A;  4U0W A;  1ZRF A;  3KZY A;  3SXY A;  5AIP A;  2FQ3 A;  5DD4 A;  2V1U A;  3GWZ A;  1Q1H A;  1KU3 A;  5CVR A;  2ESH A;  3ZN0 A;  3J80 Z;  3LA7 A;  2LKP A;  3RIR A;  2HEO A;  2LNB A;  3IWF A;  4KN4 X;  1R36 A;  3JTG A;  2FF4 A;  3JSP A;  1YO5 C;  1JHF A;  3QAH A;  2MBF A;  3WGI A;  2W25 A;  1BBY A;  4D0P A;  5BOX A;  1BOA A;  2PN6 A;  3GYH X;  2XUB A;  3HRT A;  2LSO A;  2HFH A;  2JPC A;  5LGU A;  3FM3 A;  3I0T A;  5BQT A;  2M45 A;  1SFU A;  4BHP A;  2PBI A;  2R7F A;  1RUO A;  5CVJ A;  3JAM K;  1LVA A;  4HLX A;  4L0Y B;  3T5X A;  4KIG A;  3JAM Z;  1U3E M;  2G7U A;  2XAF A;  5LLQ A;  3BP8 A;  2UXN A;  3DXJ F;  2OZU A;  1B4A A;  2GWR A;  1MZB A;  3KP7 A;  3RDI A;  5CVU A;  1F5T A;  3WGG A;  4F7Z A;  4LG0 B;  3LWF A;  2M8E A;  4FX0 A;  2G9W A;  1UHW A;  2EFO A;  5E1Z B;  3Q9V A;  3WOD F;  4O6J A;  2CQK A;  1YG2 A;  1DP7 P;  1D8J A;  3QPT A;  3KP6 A;  4BNC A;  4FHT A;  1D3Y A;  5H6R A;  3NRV A;  4L0Z B;  1JXS A;  1WWX A;  4DQ2 A;  1Z7U A;  2OA4 A;  2EWN A;  1CGP A;  1Z1D A;  3EYY A;  1BJA A;  2UWM A;  1PDN C;  1TW2 A;  3H92 A;  5DUI A;  4R1H A;  2VN2 A;  3F8F A;  3SQN A;  4KUM A;  5CJ9 A;  1KGS A;  1WSU A;  5LHG A;  2HQN A;  2UZK A;  5TRD A;  1FOK A;  3L2C A;  4GO1 A;  1W7P B;  1G6N A;  4I01 A;  1FWZ A;  1MDM B;  3BWG A;  5FLX K;  5LBQ A;  3O2P E;  2E7X A;  2IJL A;  5J8F A;  4GYI A;  3WGH A;  4JQF A;  3WTT C;  3I4P A;  5FLX Z;  3KEQ A;  3E6C C;  4HDV A;  1LQ1 A;  2QUF A;  1I5Z A;  4ESB A;  4I2O A;  4HZF A;  3IC7 A;  2A68 F;  1ZG1 A;  3FX3 A;  5E17 F;  1SD7 A;  1FPQ A;  3ZN1 A;  3F21 A;  2Z5U A;  1B9N A;  5BPD A;  4KT5 C;  1QQI A;  2DPU A;  4UVC A;  2DK8 A;  4IRG A;  3B73 A;  1XGM A;  2M30 A;  1LEB A;  3VB2 A;  4M9S A;  1XDU A;  2XGX A;  4LB6 B;  2X4H A;  3BOQ A;  3LAP A;  1F4K A;  3H3Z A;  4GYG A;  4LFU A;  1B59 A;  1P4W A;  2QWW A;  2RC4 A;  1W5T A;  3T8T A;  2IT0 A;  1O57 A;  3GFM A;  3WTU C;  4HV5 A;  1FLI A;  1KA8 A;  3J81 Z;  5DV5 A;  3T0Y A;  2JSC A;  4JBA A;  4BQA A;  1YS7 A;  2P5V A;  3DV8 A;  1ZHF A;  2QQB A;  4LB5 A;  4ZH4 F;  3GEZ A;  3KLO A;  4EJV A;  1T39 A;  1MJA A;  2HTS A;  5K1Y A;  4CGZ A;  2ADU A;  1DUX C;  4GXO A;  3BDD A;  1XSV A;  4AWX B;  1IRG A;  4YFK F;  4M6Y A;  4BH9 A;  5L3F A;  1W7P D;  1G3Y A;  3V7R A;  5L3E A;  2OQG A;  2P8T A;  1I27 A;  2CSO A;  3LQR A;  2ISY A;  5KK1 A;  4IJA A;  2MA3 A;  1R00 A;  3WU0 A;  4I0A A;  3TO9 A;  4Y13 A;  2YSR A;  4XSZ F;  3DPT A;  2F5D A;  4NB5 A;  1OPC A;  4UV8 A;  1FYL A;  1MD0 A;  1S6L A;  1FBU A;  5LGN A;  3TDU C;  3L09 A;  4A5M A;  1FBQ A;  5HLH A;  4MGR A;  3GX4 X;  3V8J A;  2FSW A;  1IXR C;  4MTD A;  4EJT A;  1SFE A;  4P5O A;  2VOP A;  2O03 A;  4CXF A;  4LD5 A;  2MLK A;  3MFK A;  2IA1 A;  3OOP A;  3CTA A;  3ZMT A;  2ZME A;  5E18 F;  1XD7 A;  2HTJ A;  2A3S A;  2HGC A;  5A2Q K;  2VOO A;  4IHS A;  2K7L A;  1D8K A;  1YW9 A;  4UXN A;  4LLN A;  1LDD A;  5ICE A;  1YQA A;  3CLO A;  4WWC A;  1FNN A;  2QQ9 A;  4MTE A;  2O6G E;  4LMY A;  1DDN A;  3S2W A;  1P4A A;  4A6E A;  3I58 A;  1Z91 A;  3O6B B;  2DO7 A;  5HDG A;  3N4M A;  2RVC A;  4AIK A;  2ZJ2 A;  2V1D A;  4A6D A;  2RGV A;  1IAW A;  1BIA A;  2J5P A;  4U88 A;  3E6M A;  3K1M A;  5FGM A;  1RIO H;  4YG2 F;  2XKO A;  3KP4 A;  1R7J A;  3FF5 A;  1ULY A;  3KP3 A;  3ISP A;  5F6F A;  2XAG A;  5BS6 A;  1REP C;  3VFZ A;  1U6G A;  1BM9 A;  3BJ6 A;  2XKP A;  2ZFW A;  3F72 A;  1KYW A;  3ZQ7 A;  1MJB A;  1FZP B;  4CO8 A;  1OYW A;  2OBP A;  5E1X A;  1AWC A;  5HDK A;  4N9H A;  1P6R A;  2K02 A;  3F3X A;  4RB3 C;  3GUD A;  3SZP A;  4HBL A;  2ZBK A;  1J0R A;  2VC0 A;  1Z6R A;  3FMR A;  4L9J A;  5FD6 A;  1GVJ A;  4LLG F;  1BC7 C;  4KIB A;  3ZPL A;  1LJ9 A;  1E2X A;  2PMU A;  2PEX A;  2BGC A;  5F64 A;  1WKM A;  1YW7 A;  1ZG3 A;  2Q0O A;  5J6X A;  1XN7 A;  3E5X A;  4EJU A;  1HXD A;  3KLN A;  2XAQ A;  4M74 A;  1R23 A;  3P9I A;  4UHT A;  2QEN A;  3IRR A;  2CG4 A;  2L02 A;  2BEO A;  5DUK A;  3ML6 A;  3EYI A;  1P2F A;  2VBW A;  2AS5 F;  2Q2E A;  3SZT A;  4OIO F;  4WK8 F;  2Y0M A;  3QP5 A;  4RAZ A;  4BXU A;  4HW0 A;  2M1B A;  4WCG A;  3ABU A;  2FBI A;  3DQV C;  2RV8 A;  2D1H A;  2B0L A;  1I1S A;  2MC3 A;  1IN8 A;  4KMF A;  1XGS A;  2EK5 A;  1R58 A;  1RZ4 A;  1KU9 A;  1WRJ A;  3IKT A;  4HOB A;  4Z2Y A;  2KJB A;  3V7S A;  3K2Z A;  2PQ8 A;  2JTV A;  2FBK A;  2J5O A;  3HYI A;  3BPV A;  4CYD A;  4HA8 A;  4ESF A;  5IT3 A;  1HSJ A;  2P6S A;  3RYP A;  4UVA A;  1H9T A;  2O3F A;  2L4A A;  2KRF A;  3V7C A;  1P4X A;  2VBZ A;  3NQO A;  3E5U A;  3HOS A;  3TKY A;  4OIQ F;  2DK5 A;  1K7A A;  3F8N A;  4Q5S F;  3NEU A;  2LF7 A;  4ZYH A;  4G6Q A;  5CYV A;  3F8M A;  3QU6 A;  3D0S A;  5E8G A;  1B1B A;  2WTE A;  5L3G A;  3KEO A;  4UV9 A;  2W24 A;  3LA2 A;  5CVV A;  2DFI A;  3W6J B;  4EMS A;  3F8B A;  2JT1 A;  1U5T C;  2H6C A;  4EJO A;  2NAZ A;  3PQK A;  3QU3 A;  5DCM A;  3GW2 A;  2RN7 A;  1YIO A;  2A07 F;  1FX7 A;  5HLG A;  1R1V A;  1FYK A;  1ZAR A;  2EV6 A;  3FXR A;  2QBY B;  3SHF A;  1U78 A;  3WE3 A;  4PGH A;  3GXO A;  1O3S A;  3GFJ A;  1USS A;  4G9Y A;  4ZYD A;  3K9T A;  2F5C A;  2GIV A;  1HBX G;  5FO5 A;  2K4B A;  5BMZ A;  1IRF A;  4HX4 A;  2TDX A;  5FFZ A;  2R3S A;  2CFX A;  1KYZ A;  3I54 A;  2ZME B;  5LEK A;  3R6S A;  2NNN A;  4I7H A;  3QPH A;  3F8C A;  3LAJ A;  5ICG A;  2FEZ A;  3I59 A;  3MZY A;  3IKV A;  4U0Y A;  4A12 A;  3P9K A;  1T6S A;  4U7D A;  3T1B A;  2O8X A;  2MD5 A;  1KQ8 A;  3IWZ A;  5H20 A;  4ENK A;  1P92 A;  5H6Q A;  3GZ6 A;  4P96 A;  2H6B A;  1VTN C;  3ROU A;  2Z99 A;  2IP2 A;  4IRH A;  2P6T A;  1UCR A;  4OMY A;  2COM A;  3WTY C;  1HST A;  1ON1 A;  2RKH A;  4K2E A;  3WTS C;  2PG4 A;  4HLY A;  1ZG5 A;  4P9U A;  2EV0 A;  1ZH5 A;  4Q4Z F;  1MGT A;  2ZXJ A;  3FWE A;  1HKQ A;  5CLS A;  4BHC A;  2HS5 A;  2D1V A;  3C7J A;  1TLH B;  4M6X A;  1J75 A;  3M9A A;  5J8C A;  5D4R A;  3WE2 A;  4U7B A;  1XSD A;  2XRO A;  6PAX A;  3L7W A;  2VON A;  4MEY F;  4WXD A;  1IN5 A;  4PZJ A;  2DW4 A;  3CUQ B;  4L9V A;  2VT2 A;  3EQL F;  5F1R A;  1NHA A;  2P4W A;  1J7K A;  1XMK A;  1HQC A;  1EH8 A;  2D45 A;  3I71 A;  3RTR A;  2KKO A;  1RUN A;  1YTY A;  1AOY A;  1ZRD A;  1EH6 A;  1ZLK A;  5HLI A;  2V79 A;  4NQW A;  1OR7 A;  4YFX F;  3DF8 A;  3W6K B;  2DQL A;  4G7Z F;  1WI9 A;  5LRS A;  2E1C A;  4LLL A;  3I64 A;  3OV8 A;  2DBB A;  2P5L C;  3M1E A;  1Z9C A;  3F6O A;  3N97 A;  3BPX A;  3VEP A;  4MEX F;  4WXC A;  1O7L A;  2FE3 A;  3TGN A;  3J7A O;  3HUG A;  2DAO A;  2MH9 A;  3REO A;  1V4R A;  1EV7 A;  4S05 A;  2WV0 A;  3WTV C;  2FNP A;  2STT A;  1ZYR F;  2P7V B;  4A0Z A;  2GXB A;  3EET A;  4RGR A;  1DPU A;  4KMU X;  1KU2 A;  3V8L A;  4IPA A;  2CO5 A;  5DD8 A;  4OIR F;  3ECH A;  4M9X A;  5DCF A;  2QVO A;  3KP5 A;  3FXU A;  4KN7 X;  2ZO4 A;  4N9I A;  1KU7 A;  1ODD A;  5BPI A;  4XBF A;  2O0Y A;  2HYG D;  1KQ9 A;  1CF7 A;  1SFX A;  5DEQ A;  1J2X A;  3JTH A;  4L9N A;  4ZYG A;  4I02 A;  1FBS A;  1LNW A;  3K1P A;  1QO0 D;  5L3B A;  3M8F A;  2KJC A;  1HW2 A;  5D5U B;  3R60 A;  2XAH A;  4B09 A;  4QWQ A;  4NHJ A;  1IN6 A;  2WC2 A;  2EJR A;  2IA0 A;  4EM2 A;  3I5U A;  4CIC A;  3CJN A;  2MLG A;  5ED4 A;  2DT5 A;  2PLY A;  2H27 A;  1OYY A;  1O7F A;  3U1D A;  1FC3 A;  4N0B A;  5E20 A;  1FY7 A;  3H3U A;  3CDH A;  2K4J A;  2ZKZ A;  3GF2 A;  4EGZ A;  4HV6 A;  2X0L A;  4HX8 A;  4HAM A;  4G7O F;  3IHU A;  1PP8 F;  5A2Q Z;  1I1G A;  1J5Y A;  1D5V A;  1FP1 D;  1LB2 A;  2L54 A;  2QYO A;  4P55 A;  3LST A;  1YFH A;  4O3M A;  2V1X A;  2HKO A;  2ZNY A;  3BZ6 A;  1QZY A;  2KIM A;  3IL2 A;  1UB9 A;  4MNU A;  1GHC A;  3GO5 A;  3M7G A;  1HW5 A;  4RB2 C;  1IXC A;  2EFW A;  4HF0 A;  4A0X A;  3RI4 A;  2IVM A;  2Z3Y A;  3WTW C;  2JRT A;  3WTX C;  1S8N A;  4I09 A;  1YS6 A;  1TTY A;  4A2U A;  4FT8 A;  2OQR A;  2ZNZ A;  1IXS B;  1ZAO A;  3HRM A;  1XGO A;  1GXQ A;  1YW8 A;  2V6C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...