4EJVA

Staphylococcus epidermidis tcar in complex with chloramphenicol
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
147
structure length
135
Chain Sequence
IEDHISFLEKFINDVNTLTAKLLKDLQTEYGISAEQSHVLNMLSIEALTVGQITEKQGVNKAAVSRRVKKLLNAELVKLIIKLSNKGKKYIKERKAIMSHIASDMTSDFDSKEIEKVRQVLEIIDYRIQSYTSKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator TcaR
publication title Structural analysis of the antibiotic recognition mechanism of MarR family proteins
rcsb
source organism Staphylococcus epidermidis
molecule tags Transcription regulator
total genus 48
structure length 135
sequence length 147
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4ejvA00
5A2QZ 1HW2A 3J81Z 1FPQA 1R1UA 2XAQA 3E6DA 3HOSA 5FGMA 4EQQA 3CUQC 1KGSA 4XSXF 3TOAA 3EDPA 2NRAC 2RVCA 3HOTA 3VODA 3E5UA 3QPTA 4ASNA 3F22A 2K27A 5HDNA 4PCQA 3BDDA 2QQBA 3M7GA 3WE3A 1R23A 2A68F 3L2CA 5HLGA 2NYXA 3K2ZA 1B1BA 3F8MA 1XMAA 4IHTA 2GAUA 2P6SA 2HYGD 3DFGA 3WU0A 1W4MA 5LHGA 1Z6TA 2QZ8A 5JHUA 3WTXC 5ICFA 5HDKA 4UNOA 2DQLA 4L9NA 2L54A 3QAHA 1FBUA 5CVVA 3GFJA 4KT5C 2CO5A 4U7DA 1LDDA 2M8EA 4BXUA 1WSUA 2PI0A 5FD5A 2F2EA 4LFUA 4UV8A 4AWXB 3LA2A 2OD5A 3GWZA 4WXCA 1O3QA 3DF8A 2BV6A 2WV0A 2ETHA 2HKXA 4U7BA 1CF7B 4YFNF 3DEUA 5K5QA 3REOA 1KA8A 2F5DA 1F9NA 1G4DA 1TNTA 1PP8F 4M6YA 1FYLA 4HAMA 3DXJF 2ZJ2A 1YYVA 1W7PB 2A69F 1SMTA 3B02A 1OYYA 3WTSC 1STZA 1MDMB 1R5HA 2BGCA 2PJPA 1HQCA 1K79A 3Q5FA 2EFOA 3FM3A 1T6SA 1ZRCA 1C0WA 4A6EA 1IN4A 3SZTA 1QNTA 2ZCWA 1TTYA 1OMIA 2XVCA 4PGGA 4ZH4F 2AXLA 3IKTA 2TDXA 2O61A 1U3EM 1Z05A 3KCCA 1QO0D 4MQVA 2Y75A 2DBBA 1EV7A 1Z1DA 3GUDA 3IL2A 2KRFA 2ZO4A 1BC7C 4HOBA 2Y48A 3VFZA 2EFWA 4M9SA 4G7OF 3HHHA 3IWFA 1OR7A 3L7WA 2CGPA 1U8RA 2ZBKA 3ZQ7A 4BNCA 2X4HA 3E6BA 2MLKA 3M9AA 2ACJA 4DNCA 3V8KA 1Y0UA 1R7JA 4RB2C 5BPDA 4BAYA 1T98A 2HKOA 4U0VA 4L9VA 2H6CA 3IRRA 3O6BB 3VEPA 2O8XA 1D5VA 2HEOA 4A6DA 3HTSB 1XDUA 4MNUA 1R5GA 2DAOA 2FXAA 2VBWA 4RAZA 1FP2A 3ROUA 3FXQA 1T0FA 4N9IA 3RJPA 2KKOA 1OKRA 1IW7F 3TKYA 1ULYA 4U88A 1HXDA 3ZMDA 3BJAA 1R1VA 2JSCA 4EGYA 1UCRA 2NS0A 3KEQA 1YW7A 1QBJA 3R6SA 2CWEA 2PG4A 1HW5A 3L09A 2VOPA 2DI3A 2XUBA 2JTVA 3K0LA 1BIAA 3ZMUA 4PGHA 4XBFA 3H3UA 3SFZA 1S8NA 3CO6C 2MC3A 3WG9A 1BI1A 2YU3A 3U9GA 4HF2A 4P55A 2M87A 2ZKZA 4F7ZA 2VE9A 1IRFA 4RGRA 3TOBA 1RZ4A 2BYVE 3HSRA 2FRHA 1I5ZA 2Z9OA 4JBAA 2ZMEB 1HSJA 1YG2A 1G3YA 3C7JA 4EM0B 1KU7A 1FX7A 3R0AA 4K2EA 1DP7P 4KDPA 4MQ9F 2A3SA 5EEHA 1XB4A 2A07F 5ILUA 1IN5A 3F6OA 4I02A 3DV8A 4LG0A 4LB6B 4IRGA 1HKTA 4EM1A 5ERIA 2A6EF 1SFUA 1ZLKA 4CICA 2FMYA 3D5LA 1FP1D 4EM2A 1BM9A 2D45A 5E17F 3KZYA 5D4RA 2ZFWA 4YFXF 1ZYRF 2ZNZA 1O3RA 1JXSA 4KFCA 3K1MA 1FZPB 4IRHA 3BZ6A 2D1VA 2QVOA 4UVBA 2ZXJA 3WE2A 4G6DA 2DW4A 4FT8A 2HOEA 3ECHA 3GYHX 3ZN1A 1G3TA 1HKSA 4MGRA 1JHFA 1LJ9A 5KK1A 1DPUA 2EFQA 1R58A 5BOXA 1MZBA 1KU3A 1JE8A 1K78A 1O57A 3E97A 4MTDA 4TV7A 4GYIA 1O7LA 1D3YA 4S05A 3W6KB 3T8RA 3KP2A 3OOPA 3KP6A 1XGNA 5JFRA 2IJLA 3IWZA 5FFZA 3LQQA 2B0LA 3QOPA 1HW1A 1SD6A 3NQOA 1KU2A 1ZARA 5K1YA 4Z2YA 3JSPA 3FWEA 2DPUA 2QYOA 3J80K 2STTA 4HX4A 5JR3A 3J80Z 4HV5A 5LGUA 2IA2A 2V79A 1MJBA 4HF0A 4RB3C 4A0YA 1IZ1A 1TW3A 1YS7A 4HYEA 2Z99A 5E18F 1V3FA 2XAGA 1FT9A 4A2UA 1J9IA 4KNYA 2HGCA 2CFXA 1QQIA 2EFPA 4EJVA 1O3TA 3BJ6A 1W7PD 3N97A 2CQKA 3BP8A 2O3FA 4RB0A 1ZHFA 1BIBA 2P4WA 2E7WA 2M45A 3N4MA 2FEZA 1UHMA 1LEBA 3GVAA 3RPQA 5J8CA 1QZZA 3DQVC 4HBLA 4I01A 2HFHA 3MCZA 2QBYA 4WXHA 3ABUA 1G3SA 4OINF 5FFXA 2FBKA 5AIQA 3V7RA 2LF8A 2A6HF 2FBHA 3BROA 3KP3A 2IPQX 4UVCA 3O2PE 3WU1B 1K7AA 4EJTA 1ON2A 2QENA 2K86A 1LNWA 1O3SA 3QPHA 1VTNC 4DQ2A 1YW8A 1SFEA 2JRTA 1P4WA 3BWGA 3KZZA 4KN7X 1FBSA 1G6NA 2KIFA 3V8LA 2FOKA 1B4AA 4OU0A 3DPLC 3RDIA 4LD5A 4GXOA 1IXCA 4P5OA 1U5TA 4YG2F 4KA4A 4M71A 2V1XA 2H09A 3RYPA 3I71A 2XAFA 3H3ZA 5K5RA 1ZG1A 2CYYA 4I7HA 2A61A 5LRRA 3RYRA 2FU4A 2OU2A 2GIVA 4MEYF 5FB2A 1KQ9A 3IRQA 3WTZA 5D8KB 1R1TA 5CVUA 4LGWA 3LSTA 2KIUA 5F1RA 1ON1A 2L4MA 1YFHA 3ISPA 4ENJA 2CSOA 5TJJA 1OYWA 4ZZLA 2Q2EA 1BC8C 2P5VA 3K1NA 5E1ZB 2W24A 2HYFA 4L5IA 5LGTA 5E1WA 3MFKA 1WI9A 2V6CA 3KP5A 4Y17A 5DCFA 4I98B 3MZHA 3NEUA 2G9WA 3EYIA 2PQ8A 2IA1A 3CTAA 1O7FA 3R61A 4I09A 5D6FA 5L3CA 1W5SA 5TRDA 2VODA 1XD7A 3P7NA 2E1CA 4HZFA 2FE3A 4G7HF 1FSEA 3TQNA 1XGOA 5FD6A 4AVPA 2VT3A 3SQNA 3IKVA 3ZMTA 2W85A 2ISZA 1H9GA 1UB9A 4AIJA 2Z5UA 4ENNA 3I64A 5L3DA 4KUMA 1AOYA 1XSDA 4FX4A 4IHSA 1MKMA 4G8XA 2RKHA 1MJ9A 1H0MA 3V7SA 1FSHA 4LG0B 3FXUA 4BYYA 3E5QA 5D4SA 4L9TA 1TQPA 3FZVA 2IT0A 3D0SA 4KIBA 3V8JA 3QU3A 2W25A 5JI6A 2DO7A 2F5CA 2RN7A 1EH6A 1JHHA 3M1EA 1ZREA 5E8IA 1RUNA 2MH9A 5CVRA 4KMUX 2HQNA 1B9MA 4IJAA 4A12A 2MLGA 5ILVA 1Z9CA 3I59A 3KFWX 5ICEA 2UXNA 2DQRA 5IT9Z 4HLXA 3ZMZA 2CW0F 2QQAA 1P6RA 4ZYGA 4ZYDA 2FNPA 2KIMA 4XLPF 4XLNF 2JT1A 3GXOA 1OYIA 5L3GA 1FYMA 5CVIA 2XRNA 2QUFA 1K78B 1DDNA 1P4AA 1IAWA 5DD4A 2DPDA 3E6CC 4OIQF 1F5TA 1HKQA 1S6LA 1XMKA 3BPVA 1P4XA 2OQRA 1SMYF 3E6MA 3U2RA 3HUGA 1BI0A 1P92A 3RIRA 1SAXA 2PLYA 3WTVC 2P5KA 6PAXA 4NB5A 1KU9A 2QQ9A 5HS7A 1I6XA 3ERED 4RB1A 1S3JA 3LAJA 3I0TA 4WXDA 1CGPA 4KICA 2R7DA 2H27A 4HF1A 1FYKA 3P9CA 1NHAA 2VXZA 3IHUA 2GWRA 1BJAA 2YSRA 2D1HA 4P9UA 5BS6A 3VOEA 1FNNA 2EJRA 3VB2A 4IPAA 3KETA 3HRTA 3ZMVA 2ESHA 2GXBA 1IXSB 1F4KA 1ZRFA 5F6FA 1HBXG 4LLLA 2GXGA 5HDGA 2F5EA 5ICCA 1X3UA 3CDHA 1AWCA 5D5VB 2P8TA 4L0YB 3KLNA 1RNLA 5HLHA 4ENMA 3BOQA 1U78A 4UHTA 1IUYA 3PFIA 2BBYA 1PDNC 2HZTA 3FF5A 2OBPA 2IVMA 3EETA 2IA0A 2EV5A 5DDGA 1D8JA 1MGTA 1S7OA 1ZRDA 1I1SA 3I58A 1LQ1A 4M9XA 4YIIA 1I1GA 4L0ZB 2ZNYA 3HSEA 3FMRA 1MDMA 1GHCA 1TQIA 5AIPA 1U2WA 1GXPA 3SHFA 4RGUA 3WTYC 2OQGA 4WWCA 4L5JA 1YS6A 3R60A 5J8FA 5LEJA 5DV5A 3FX3A 3GZ6A 5D5XB 3F6VA 2V9VA 4A0ZA 5DCMA 1ZG3A 2YX4A 5JVTA 4UV9A 1L0OC 2D2WA 2YPRA 2GQQA 2W57A 1REPC 1JGSA 2GZWA 4R79A 2EFNA 3TO7A 2O6GE 4O3MA 4ZYEA 3GO5A 2Q0OA 4EJOA 4Q48A 5LLQA 1XN7A 3B73A 4A5NA 3ULQB 3HHGA 4CYDA 4GGGA 3BJOA 4UVAA 3F8NA 1I27A 5KVRA 3V7CA 3L9FA 3HYIA 3WTUC 3CLOA 2EA4A 2L01A 3QU6A 4CGZA 4KIGA 2L4AA 1KQ0A 2FF4A 2LF7A 3H92A 2LDUA 2K4JA 1IF1A 1Q1HA 3T5XA 1QGPA 2G7HA 1TNSA 1MJAA 3LFKA 4O6JA 4ZZDA 4LMYA 1OPCA 1U5TC 4A5MA 3KP7A 3HRMA 4HA8A 1QZYA 4EGZA 3ZMSA 4EV0A 3MAJA 2XAJA 2WWYA 5H6RA 5LBQA 3K9TA 3MQ0A 3QP5A 2FBIA 1LDJA 2RV8A 2QM3A 5D5UB 3FM5A 4B8XA 4FX0A 2STWA 3KLOA 2F5FA 2Z33A 1YQAA 4M73A 2EK5A 2UZKA 5CYVA 3JSOA 4GYGA 1J7KA 4IVNA 1E17A 2YR2A 4S04A 2MD5A 5L3EA 2XKPA 5DEQA 2ZMEA 4U0YA 5BPIA 4AD9A 5K5OA 1P2FA 2H94A 4ESJA 3I5UA 2DK8A 1QPMA 2P5LC 3CO7C 1TQMA 3PQKA 2O03A 5H20A 2QLZA 4P96A 3GEZA 2M5WA 4LK0F 4M6XA 2RQPA 1DPRA 4HDVA 4A0XA 1J2XA 3LA7A 3CJNA 1ZG5A 2IW5A 3Q9SA 4I0BA 1YTYA 3L00A 5LEKA 2MA3A 4ESFA 2DLLA 2OA4A 2XIGA 5DUKA 4CO8A 1FWZA 5J6XA 1FOKA 1KYWA 2UXXA 4B09A 3F72A 3F3XA 1Z7UA 5HOOA 4OOIA 4KN4X 3WODF 2CG4A 4HX7A 2EA2A 1U6GA 3TO9A 4BHCA 3HTUA 2FA5A 2J5OA 5E8GA 5CVJA 2DFIA 3DPTA 4E70A 2FQ3A 5ED4A 1WKMA 1SD5A 2HQRA 1SD7A 2MH2A 2VE8A 5LHHA 2VC1A 4ETSA 3GW2A 4G7ZF 2XV4S 4FHTA 4BQAA 4KMFA 2OZUA 2L3DA 4RS8A 4IXAA 3SZPA 2EWNA 3RI4A 4ENKA 3JTGA 4R8HA 1RIOH 5HS8A 4UXNA 1ONVA 5D8LB 1IXRC 2VONA 3ECOA 3G3ZA 3NRVA 4WX9A 3F8CA 3BPXA 1XGSA 2E7XA 4HW0A 2ADUA 4LLNA 2JZYA 4BHPA 2BE5F 3HIFA 2NNNA 4XSZF 3M8EA 3TGNA 2RC4A 2R7FA 3E3VA 2UWMA 2IP2A 5F64A 3COAC 2XGXA 1USSA 2BEOA 1PUEE 3DP7A 1KQ8A 3HRSA 4JQFA 4CHUA 4PZJA 3C3WA 2R3SA 2RDPA 1T38A 1H9TA 1V4RA 2VBZA 4EJUA 4G6QA 2KJBA 1R00A 1GXQA 2DU9A 3T0YA 3S2WA 1HSTA 3MEXA 4O5VA 4RGXA 2V1UA 4L18B 2RGVA 4RAYA 4AIHA 2PMUA 3Q9VA 4D0PA 4HX8A 2XASA 2DT5A 5ILSA 1IN6A 4EJWA 1T39A 1XCBA 5HS9A 5DCMB 1XSVA 3CUQA 5AONA 5LGNA 4P9FA 5IT9K 1LEAA 2O0YA 3W6JB 1J75A 2IRFG 5DUIA 1F1ZA 4MTEA 4HQEA 3IC7A 4M9ZA 3FMSA 5DYMA 2HTJA 4KIFA 1LVAA 2DK5A 4HDUA 5E20A 4NQWA 2NAZA 2ELHA 1SFXA 3P9IA 2K4BA 2K7LA 1EH8A 4HQMA 3V4GA 1USTA 4WF2A 3GZ5A 1IN7A 1B9NA 4CDGA 3WGIA 3DKWA 1S29A 2MBFA 5E1XA 2HTSA 3LA3A 3HRUA 3GFMA 3WGGA 1BOAA 1YW9A 2V1DA 3JAMK 4Q4ZF 3J7AO 1IN8A 2GA1A 3JAMZ 2X0LA 1B6AA 1BI2A 2WTEA 5BQTA 4Y13A 3QP6A 3KEOA 2EV0A 3ELKA 2VBXA 4CXFA 3U1DA 4OIRF 5D5WB 1TW2A 4LLGF 4Q47A 4CZZA 1J0RA 2L02A 4JK1X 1YIOA 2GA2A 2EV6A 2PBIA 3EUHA 3R4KA 2PMHA 1ZN2A 1BBYA 1KYZA 2P7CB 1WWXA 4RGSA 3RTRA 1UFMA 2ISYA 4HV6A 2RNJA 3TDUC 2P6TA 4GCVA 3RKXA 1FBQA 1ZGJA 1ZGAA 3ML6A 4GO1A 2FNAA 4ZYHA 3R0JA 1D8KA 3M8FA 1UHWA 1XSXA 2H6BA 1CF7A 3E5XA 3GFIA 2VOOA 2HS5A 1BN5A 4AIKA 2NNYA 4WK8F 3K1PA 2PEXA 3BY6A 5HLIA 1W7PA 2DTRA 2M30A 3F23A 2P7VB 2Z3YA 2QBYB 5FO5A 2OAZA 5LRSA 4R1HA 2W84A 4ESBA 3QRFF 2OZ6A 2WC2A 4OIPF 3WTWC 1LB2A 4XRFA 1ODDA 3GX4X 1WQ2A 3JTHA 5L3FA 3AAFA 2ESNA 4QWQA 1ZH5A 1Z6RA 3TDZC 3P9KA 1GVJA 3RKYA 2VT2A 1K6OA 2E1NA 4L9JA 1FLIA 3ZP5A 2G7UA 4LJZF 4UUVA 1YLFA 1LDKB 2Y0MA 1FC3A 2COMA 4N9HA 1TBXA 4LK1F 5L3BA 2K02A 1R22A 1U5TB 2HR3A 2AS5F 4MEXF 3GLXA 2XAHA 1W5TA 2PFBA 2C6YA 4BHBA 3FHZA 2HDCA 3K69A 3KE2A 4OMYA 3GF2A 4WCGA 3F8FA 3EQLF 4M74A 1ZLJA 1A04A 2YX7A 3KP4A 1MD0A 3LQRA 4N0BA 1XDSA 3ABTA 3FMQA 2FMLA 1L3LA 5ICGA 5DD8A 4LB5A 2XHKA 3GFLA 1EH7A 1BI3A 1TLHB 4OIOF 2VN2A 3OV8A 1E2XA 4IRIA 2FSWA 5CLSA 3T8TA 5CJ9A 3RKWA 3HSFA 3MZYA 3C1DA 3G73A 1RUOA 3EYYA 3I4PA 4EVIA 1ZAOA 4H0EA 5FLXK 1YO5C 1RI7A 1T2KA 5LHIA 1WRJA 2PN6A 4G94A 4ON0A 5FLXZ 4U0WA 3O3KA 1IRGA 3ZPLA 2LSOA 1XGMA 3FXRA 4BH9A 4YIFA 2JPBA 3F21A 2A5YB 3I54A 2Q8KA 2KJCA 3MWMA 3T1BA 1Z91A 4EMSA 1G3WA 2EB7A 1J5YA 2JPCA 3JW4A 3CUOA 1PP7U 4IF4A 4Y15A 4I0AA 1FY7A 2XROA 3LAPA 1S7AA 2J5PA 3WGHA 4HLYA 4NHJA 4Q5SF 4G9YA 3ZN0A 4KYWA 1SD4A 5HVQC 3TO6A 1R36A 5IT3A 3RPUA 5BMZA 2VC0A 4M72A 2LNBA 4MHGA 5H6QA 2VBYA 3LWFA 2M1BA 3C18A 3WTTC 2QWWA 4QLCU 4PDKA 3PQJA 3SXYA 3I59B 3CUQB 1XCVA 4I2OA 2HWVA 2LKPA 1DUXC 5D6EA 4YFKF 4OMZA 1B59A 2XKOA 3I53A 1J59A 3F8BA 5A2QK 5EEGA 3J81K
chains in the Genus database with same CATH superfamily
5IYDJ 4BQOA 5A2QZ 5GTIC 2CQQA 3J81Z 1HW2A 1MMAA 2XSDC 2JVGA 1FPQA 1R1UA 2X6WA 2XAQA 3E6DA 4KITB 3HOSA 2NVQJ 5FGMA 4EQQA 5J1RA 3CUQC 1KGSA 4NQWB 4XSXF 1VQPI 2L0KA 4BACA 3JRFA 4XORA 4XNFA 3TOAA 3EDPA 2NRAC 2RVCA 3SFIA 3HOTA 1X3ZB 1UJ8A 4PJLA 1XMXA 3E5UA 3QPTA 2M3AA 5GPAA 3VODA 4ASNA 4KT6A 4BE0A 3F22A 2AXTC 2K27A 5HDNA 4PCQA 1WHUA 3BDDA 1TWHJ 2CW7A 4NC8A 5J4VA 2BY0A 4AYBA 2WA0A 2QQBA 3LSJA 3M7GA 3HUGB 4JX4A 3WE3A 1R23A 4IEJA 3FDYA 2A68F 3HG9A 3L2CA 1VQ8I 1HF0A 5HLGA 2NYXA 1NH3A 3EUKL 3FBIB 2IXSA 1V54H 2CW8A 2VASA 3K2ZA 1B1BA 5HNHA 3F8MA 4C30A 3FKJA 2X48A 2D5VA 4BXXJ 1XMAA 1IJWC 4LIVA 4IHTA 2JJ7A 2GAUA 3W2AA 3HGYA 1ZKGA 4RMNA 2P6SA 2HYGD 1D1BA 3O8HA 3DFGA 4M3FA 3WU0A 4XIDA 4Y4RA 1W4MA 5LHGA 1Z6TA 2QZ8A 3H0GJ 1UZCA 5JHUA 4F52A 1VQ7I 3WTXC 5ICFA 2X6XA 5HDKA 4UNOA 2DQLA 4L9NA 3CLQA 2BVMA 2L54A 3QAHA 5FKNA 1FBUA 5EG0B 3ZOBA 3FISA 1OCZH 5CVVA 4LIUA 2CUEA 3GFJA 4KT5C 1GV2A 2CO5A 4U7DA 1LDDA 2M8EA 3OYFA 2I5UA 2HVSA 4BXUA 4RA2A 1WSUA 2PI0A 2WB1A 3H9GA 5FD5A 2HDWA 3H9JA 2F2EA 3GCMA 3OIPA 4LFUA 4UV8A 4AWXB 4CYCB 1ETVA 3LA2A 2MW8A 2OD5A 2LP0A 3GWZA 4WXCA 1O3QA 3DF8A 2BV6A 2WV0A 3OY9A 2ETHA 1W36D 2HKXA 4U7BA 2PMZN 2Y30A 3CCMI 2OCEA 1CF7B 4YFNF 2K3FA 2L5QA 3DEUA 4G12A 4F91B 5K5QA 3REOA 1KA8A 3ZQQA 2ZSHB 2F5DA 3DU6A 1F9NA 4CCLA 4DBQA 3OYMA 1G4DA 1TNTA 1PP8F 4M6YA 3CDIA 1FYLA 3MKLA 3B6AA 1QRYA 4HAMA 1N75A 2BY1A 3DXJF 2ZJ2A 1YYVA 2R93J 5C4XJ 1IRZA 3TL4X 1W7PB 2A69F 2VI6A 1SMTA 3B02A 3H5RA 1OYYA 1VQMI 3WTSC 2QA4I 1STZA 1MDMB 1R5HA 3OOUA 3GZNB 2BGCA 4BGDA 2JVHA 3ZQHA 3OL4A 2BW3A 4PSWA 2QSHX 3S32A 3FIWA 2PJPA 3CCRI 1HQCA 1K79A 3Q5FA 2V7FA 2HOAA 3A01B 2EFOA 3FM3A 1T6SA 1X4OA 2XF7A 1ZRCA 2ZB9A 4A6EA 1IN4A 2KIQA 3Q0UA 1C0WA 3SZTA 1MBGA 1QNTA 2H1LA 2ZCWA 1TTYA 1OMIA 2XVCA 4PGGA 4ZH4F 2AXLA 2JWTA 5IOZA 1ETKA 3IKTA 2TDXA 4CCNA 2K9NA 1JKRC 1B72B 2O61A 1U3EM 1N78A 2OC6A 1Z05A 1IV6A 2LR8A 3KCCA 1QO0D 4MQVA 2Y75A 1ETYA 5E3LA 2DBBA 2DFHA 4BDYA 2NXNB 1EV7A 1Z1DA 3GUDA 5DTDA 3IL2A 2KRFA 1S9HA 2ZO4A 1LVKA 4XK4A 4PUSA 3LL7A 4E7HA 1BC7C 4HOBA 4X1EA 3VYRB 4A3JJ 3BCAA 2Y48A 3VFZA 2EFWA 4M9SA 4G7OF 3H36A 3HHHA 1MH3A 3IWFA 3L2WA 2DA2A 2K9QA 3TP3A 1OR7A 1MNEA 3L7WA 5KAIC 2CGPA 5FRNA 1U8RA 2ZBKA 3ZQ7A 4BNCA 2KL4A 2X4HA 1ETXA 2MLKA 3E6BA 3M9AA 5IYBJ 2ACJA 1VQNI 2IS4A 1W0UA 1F36A 4DNCA 2XSJC 3V8KA 3DTIA 3KX2A 1Y0UA 4II3A 1R7JA 3BLYA 2NS8A 3DBLB 2FD5A 4RB2C 4C3HJ 5BPDA 4BAYA 2E5NA 4BY7J 1IC8A 3CC7I 1T98A 2HKOA 4U0VA 3FKIJ 5EGOA 4L9VA 2H6CA 3BR3A 3IRRA 3O6BB 3VEPA 2O8XA 1D5VA 2HEOA 4A6DA 2WV1A 4EEFG 3BR1A 1WVRA 3WU2C 3HTSB 1NG7A 1A6IA 1XDUA 4MLOA 1X1CA 1PYVA 2B7EA 1R5GA 4MNUA 2DAOA 2GXAA 2FXAA 2VBWA 4RAZA 1FP2A 1N25A 3ROUA 4CH7A 1X58A 3FXQA 1T0FA 2R7WA 4N9IA 1HDDC 3RJPA 2KKOA 1MMNA 1OKRA 1IW7F 3TKYA 1ULYA 4U88A 1HXDA 1R49A 3ZMDA 1EJ9A 3BJAA 2DYRH 4E7IA 1R1VA 4GRIA 5JHFA 2JSCA 4EGYA 3S17J 1UCRA 4XR6A 3QPSA 2NS0A 3KEQA 2EILH 1LFPA 1YW7A 1QBJA 3R6SA 2K3PA 1IRXA 3K4BA 2CWEA 1X2MA 5H2FC 3K4MA 4BU2A 2PG4A 1HW5A 3HOXJ 1K4SA 3L09A 2HU9A 3OSGA 1VQLI 2R7VA 2VOPA 1LUJB 2DI3A 2XUBA 3NWSA 2JTVA 5EZGA 1T56A 3K0LA 4X0GA 1BIAA 2TCTA 3ZMUA 4PGHA 4BJTA 1GV5A 4XBFA 3H3UA 3SFZA 2X85A 1FOYA 3SEZA 1E3OC 1S8NA 2FQ4A 1V5EA 3S3MA 4ZTFA 3CO6C 2MC3A 3WG9A 1BI1A 2YU3A 1BW5A 3U9GA 1A5JA 1BOBA 2KMUA 2P81A 4P55A 3ZRGA 4HF2A 2M87A 2E2JJ 2ZKZA 4C3IJ 1Z3YA 2M2EA 3JR9A 4F7ZA 2IAIA 2VE9A 1Y0NA 4FQGA 3GTQJ 1IRFA 4RGRA 3TOBA 2K9MA 1RZ4A 4XM3A 2BYVE 2E34A 3HSRA 1Y6IA 2FRHA 1I5ZA 2Z9OA 2XB0X 4JBAA 2ZMEB 3L1PA 1HSJA 1YG2A 4I6ZA 1G3YA 3C7JA 1MIJA 3HOVJ 2I8DA 4EM0B 1KU7A 4D5FA 1FEXA 4MFDA 2ELJA 4CZCA 3A02A 4XLFA 1FX7A 3BTJA 3S15J 3R0AA 4K2EA 2M7BA 1DP7P 4KDPA 3EPZA 3OMYA 3CDLA 3VSLA 4MQ9F 2LFBA 1Z7LA 2ME6A 2A3SA 1B8IB 5EEHA 3CC4I 1XB4A 2A07F 5ILUA 1IN5A 3F6OA 4V2FA 4H4KC 1XS9A 4A3DJ 4I02A 3J7AY 3DV8A 2GLOA 4LG0A 4RLQA 4LB6B 4BY1J 3M3YJ 3K70C 2QF7A 4IRGA 2W1OA 4EM1A 2E60A 5ERIA 5C3EJ 3LSPA 2B63J 1HKTA 3OYHA 2A6EF 1SFUA 1X1AA 1ZLKA 4CICA 1QA6A 2LTPA 2FMYA 3D5LA 4E7SA 5DM7F 1MBHA 1FP1D 3QWLA 3GTGJ 4EM2A 1BM9A 2D45A 3OYJA 2M4KA 3JRCA 2L2OA 1UHSA 2LC2A 2RAEA 2KP6A 1OCTC 5E17F 1ETOA 3KZYA 5D4RA 2B9SA 2IGOA 4V2GA 2ZFWA 1POGA 3PO3J 4YFXF 4GFBA 1ZYRF 1WZ2A 2ZNZA 1O3RA 1JXSA 4KFCA 3CMAI 3K1MA 1FZPB 4IRHA 3BZ6A 1FMWA 2D1VA 2QVOA 1ZGWA 4UVBA 3RQIA 3OYIA 3FXOA 2CQNA 3K6GA 2ZXJA 3CQZJ 4ZDPA 3WE2A 4G6DA 2E19A 2LVSA 3LSIA 2DW4A 4FT8A 4BJ6C 3OR2C 4XKWA 2HOEA 3ECHA 5FJ8J 1FTZA 3GYHX 2EZHA 2ID3A 3ZN1A 3CMYA 3SZGA 1W0TA 1G3TA 1TL8A 1YIJI 2IGKA 1HKSA 4MGRA 1JHFA 2CUZA 4BJ5C 1LJ9A 1Z77A 3SYTA 5KK1A 2JA6J 1JJ6C 1DPUA 1YHQI 2EFQA 2PJRB 1R58A 2LH9A 1X1BA 5BOXA 1MZBA 4D1QA 1KU3A 2EPFA 3HM5A 1JE8A 1K78A 1O57A 3E97A 4MTDA 4KJZA 2F4OB 1Y1WJ 4TV7A 4JOMA 3AG4H 4GYIA 1O7LA 1D3YA 1YITI 4S05A 1OLTA 4DJAA 3W6KB 4YIRX 3T8RA 3KP2A 3OOPA 1S5LC 3KP6A 1XGNA 1MBFA 5JFRA 4UUSA 3GTOJ 2IJLA 3IWZA 4HNTA 2JA5J 3L2VA 2V1NA 2ZXWH 3VWBA 2XRLA 5FFZA 3LQQA 2B0LA 3QOPA 5M5YJ 1HW1A 1SD6A 3DBHB 3NQOA 1KU2A 1MMDA 4XRMA 1V55H 1WJ5A 1ZARA 5K1YA 4Z2YA 3OS1A 3JSPA 1JGGA 3FWEA 4ABZA 1IO2A 2DPUA 2QYOA 3J80K 4XOPA 2STTA 3DTKA 4HX4A 2CJJA 3QQAA 5JR3A 3J80Z 1MW7A 4HV5A 2XF5A 5LGUA 4DYRA 2CV1A 1K4TA 3JRGA 3JRHA 1NK3P 2IA2A 2V79A 5IP7J 1MJBA 4HF0A 4RB3C 2VXDA 4A0YA 2W48A 1IZ1A 2HVQA 1TW3A 1D1CA 1WH5A 4RAGA 2VQHA 1YS7A 4HYEA 2Z99A 5E18F 1V3FA 1ZR4A 2XAGA 1FT9A 1VQOI 2BOLA 1WJEA 4A2UA 4KNYA 1J9IA 2OUMA 2HGCA 2CFXA 2W7NA 3PSFA 3HOWJ 1QQIA 2EFPA 4EJVA 4PSXA 1O3TA 1HC8A 3BR2A 2OV7A 3BJ6A 3QPLA 5HNFA 1W7PD 3N97A 3KYDB 2A05A 2ME0A 2CQKA 3BP8A 2O3FA 4ZDOA 1FOWA 4QIWN 1YOVB 4XLEA 3GMEA 2DMPA 2FUG2 3VYSB 3MD2A 4RB0A 1XPXA 2KISA 2PX9A 4P1WA 3CCSI 3OYKA 3DLAA 1ZHFA 1OCOH 5CQGA 3OS0A 1BIBA 4A3FJ 2DMTA 2P4WA 2E7WA 2M45A 3N4MA 2VIXA 2K5CA 2KLOA 1WFXA 3PNYA 2JMWA 2FEZA 1UHMA 2DA7A 1LEBA 3GVAA 5EEGA 2BW3B 3RPQA 1QZZA 3DQVC 4HBLA 5F27A 3S1QJ 5B3SH 4I01A 2HFHA 1YJNI 2O5RA 3MCZA 2QBYA 1XG1A 4XKBA 3I9V2 3HPGA 1G8XA 4V19K 4NDLA 4WXHA 2CRGA 3ABUA 2HPMA 1G3SA 2LY9A 4OINF 5FFXA 5CKTA 4XN0A 2FBKA 5AIQA 2KPMA 5TISC 2DA5A 2VKEA 4D7NA 4DZPA 3OYAA 4PJNA 2MFZA 3V7RA 5B66C 5LFAA 2LF8A 1UG0A 2A6HF 2FBHA 3G1OA 9ANTA 3BQYA 3BROA 3KP3A 3CCYA 2F4MB 2IPQX 4UVCA 2NVTJ 1LKXA 3O2PE 4NNJA 2DA6A 3WU1B 1HA8A 3CC2I 3M07A 4F93B 1K7AA 5EDNA 4EJTA 1ON2A 2DOFA 2QENA 3HOUJ 1TWCJ 2K86A 3RCOA 1LNWA 3OL3A 1O3SA 3QPHA 2UV1A 4DQ2A 3KEYA 3QYFA 1VTNC 4BBSJ 1YW8A 2IBDA 4X6AJ 1SFEA 2JRTA 3J81K 1P4WA 3BWGA 2LBFA 3KZZA 4KN7X 1FBSA 2Y0SN 4G6TB 1G6NA 2KIFA 3V8LA 2FOKA 2ZJQF 1B4AA 2Y0SA 4OU0A 3CF2A 3DPLC 3RDIA 4LD5A 2WADA 1JUMA 4W1UA 4GXOA 1IXCA 4P5OA 4IHYA 1U5TA 4YG2F 2M4GA 4KA4A 2DCEA 4M71A 2V1XA 5EGOB 2H09A 3RYPA 3NWTA 2VJ5A 2XAFA 3H3ZA 2KRHA 3I71A 4B43A 1OR7C 2L9VA 1R6RA 2X1DA 2CYYA 3BG7A 3PNVA 4I7HA 3G1LA 5K5RA 1ZG1A 1JT0A 2A6TA 1TT5B 2JUGA 1SC7A 2A61A 5LRRA 2L9RA 3HGGA 3L2UA 3RYRA 1OQYA 4UUTA 2FU4A 2OU2A 2COBA 2GIVA 2LRDA 4MEYF 5FB2A 1KQ9A 1OCRH 3S3OA 2MGQA 3RKQA 3IH4A 3IRQA 2YU9J 1DU0A 3WTZA 5D8KB 1R1TA 5CVUA 2KDOA 2Y31A 4YEJA 4LGWA 4LITA 4DZJA 3LSTA 2KIUA 5F1RA 2TRTA 1ON1A 4AUXA 2P0WA 2E1OA 2L4MA 1TWGJ 1YFHA 5J3LA 3ISPA 4ENJA 2CU7A 2CSOA 4Y7NJ 5TJJA 1OYWA 4ZZLA 2Q2EA 1BC8C 3TEDA 2K9SA 2P5VA 5GAHJ 3K1NA 5E1ZB 2W24A 1RETA 3DEEA 2HYFA 1IGNA 4L5IA 1T0FC 2H8RA 2DFEA 3K4KA 5LGTA 5E1WA 2F48A 3MFKA 1WI9A 2DOEA 2V6CA 3H35A 4CUGA 3CCVI 3KP5A 4Y17A 1UG2A 3PIOF 3K2AA 2Y2ZA 5DCFA 2HQ5A 3A4CA 2CH0A 1T8IA 2DA1A 3HOZJ 2EIJH 2LOOA 4I98B 3MZHA 3NEUA 2G9WA 3EYIA 2PQ8A 5IPAA 2VKHA 2IA1A 3LSGA 3CTAA 1O7FA 2E2IJ 2Y9YA 3RQ4A 4BBRJ 3LOCA 3WHBA 3O8GA 3ZR8X 2ELKA 2VLAA 1JUPA 4II2A 4FTHA 3R61A 3K70D 3QODA 4I09A 5D6FA 5L3CA 1W5SA 5TRDA 2VODA 4D5CA 1XD7A 3P7NA 2E1CA 4HZFA 2FE3A 3S16J 3W2WA 5FKOA 3PJRA 2G0EA 2PMZA 4G7HF 2R5ZA 1FSEA 4DYQA 3TQNA 1XGOA 5FD6A 1DQUA 1K83J 4AVPA 1RKWA 1HLVA 3G4SI 2VT3A 3SQNA 3IKVA 3ZMTA 2W85A 5C44J 2ISZA 4J01A 1ZQ3P 1H9GA 1UB9A 4AIJA 2Z5UA 4ENNA 3I64A 5L3DA 3BC8A 4KUMA 1AOYA 1XSDA 4FX4A 4IHSA 1MKMA 4G8XA 2RKHA 4Y3OA 1MJ9A 1H0MA 4XMYA 3V7SA 4I99C 3CP2A 1FSHA 4B48A 5FLVA 3BG9A 4LG0B 3FXUA 4BYYA 2LY2A 3E5QA 5D4SA 4L9TA 2N8GA 1TQPA 3FZVA 4BQNA 3H9QA 2VJIA 2IT0A 3GTLJ 3D0SA 1JKQC 4C3JJ 3BR6A 5EYRA 4IL6C 4KIBA 3V8JA 1PUFA 3OYNA 3QU3A 2W25A 4ITVA 5JI6A 4A3KJ 4IHWA 1QHHD 4MFEA 2DO7A 2F5CA 4DW6A 2X6OA 2ZXIA 3IUOA 3A0BC 3QOEA 4JX5A 2RN7A 4A93J 1EH6A 4NC7A 1JHHA 3M1EA 3ZQIA 5E8IA 1ZREA 4N4OB 3B6CA 1RUNA 4IQJA 3JRBA 2MH9A 5CVRA 2K9LA 4KMUX 3OYGA 2HQNA 1B9MA 4IJAA 3K7AJ 4XLHA 4A12A 2MLGA 5ILVA 1Z9CA 1SAUA 2M7AA 3I59A 2DT7B 3KFWX 5ICEA 2HI3A 3HZJA 2UXNA 2OF7A 2DQRA 5IT9Z 4HLXA 3ZMZA 2CW0F 2VJ4A 2HZDA 2QQAA 2R4GA 2DXIA 2VQLA 3H5NA 1P6RA 3BT9A 1MMGA 4ZYGA 3M8JA 4ZYDA 3WG7H 1T08B 4MO7A 1EF4A 4F3QA 3GBGA 2FNPA 2KIMA 1WH7A 4XLPF 5J40A 4DGWB 4XLNF 1VQ6I 2JT1A 3GXOA 2VPLA 2R7UA 4CCJA 1OYIA 2V4JC 5L3GA 1FYMA 5CVIA 4IOCF 2XRNA 2IS1A 2QUFA 1K78B 4M3GA 1DDNA 2E5ZA 1P4AA 1IAWA 5DD4A 4CCOA 3DBRB 2DPDA 1I3QJ 3E6CC 1SFOJ 4OIQF 2JA7J 2QCOA 3OYLA 1F5TA 3HKZN 1HKQA 1S6LA 1XMKA 3BPVA 1R71A 4JP0A 1P4XA 2NOGA 4ZTJA 2OQRA 1SMYF 3E6MA 2OJED 3HUGA 1BI0A 3U2RA 4U87A 3S93A 1Z3XA 1P92A 3RIRA 4RDUA 5KAFC 2FX0A 2H8WA 3NAUA 4LG3A 1SAXA 1PVEA 2DFFA 4Y52J 2PLYA 3ZCOA 3WTVC 2RNGA 2P5KA 6PAXA 1IDYA 2KFDA 4NB5A 3JRDA 1KU9A 1SEUA 1IUFA 2QQ9A 5HS7A 1I6XA 3ERED 4RB1A 2OTLI 4J19A 3BG3A 2R7TA 1S3JA 3IH3A 4A3EJ 3LAJA 3BCBA 3K4JA 3OR1C 3I0TA 4WXDA 1M1EB 3TMOA 1CGPA 4KICA 2R7DA 4B44A 5GTHC 2H27A 4HF1A 2L9SA 3JRAA 3IH2A 1A31A 1FYKA 3P9CA 1NK2P 2IS6A 3AG2H 1AU7A 1NHAA 4CSWA 2VXZA 3IHUA 2HXOA 3M4OJ 2CUJA 3BTCA 2GWRA 3X2QH 1BJAA 2YSRA 4FETA 2D1HA 3ZXSA 4DIQA 4P9UA 5BS6A 3VOEA 1FNNA 1V5GA 5EG0A 2EJRA 3VB2A 4IPAA 3KETA 2DMUA 3HRTA 3M1CA 1R4NB 1TWFJ 3ZMVA 2ESHA 4OAZA 2GXBA 2MABA 3CMEI 1IXSB 3KPHA 2DOAA 1X19A 1F4KA 2QEXI 1ZRFA 5F6FA 3I4NJ 5CPRB 5IOYA 4HSTA 4IQ4A 5IYCJ 2CS3A 2FJ1A 1HBXG 1U0JA 4CYCA 4LLLA 1QVTA 1CQTA 2GXGA 5HDGA 2CQXA 3I3LA 2F5EA 5ICCA 3RZDJ 2CV2A 4HEA2 1X3UA 1X1PA 3CDHA 1AWCA 5D5VB 2P8TA 4PK4A 2RREA 4L0YB 3KLNA 3ZQCA 1RNLA 5HLHA 2I10A 4ENMA 3AFHA 3BOQA 3OIOA 1GT0C 3EUAA 1MBJA 1K61A 1U78A 3S2HJ 4UHTA 4NC6A 2R5YA 1IUYA 3PFIA 4IOAF 3G71I 2BBYA 1IV8A 5K7ZA 2XPWA 1PDNC 3D5RC 3AL0C 3QYBA 2HZTA 2R7QA 3W3CA 1A35A 3FF5A 2OBPA 1HCRA 2IVMA 3EETA 2IA0A 2LKXA 2Z1DA 3IP4B 1QVUA 2EV5A 4E7KA 2DTZA 2QSGX 2JQ7A 5DDGA 2MSYA 3U21A 5J47A 2YS9A 1D8JA 1MGTA 1S7OA 1ZRDA 1I1SA 3I58A 1LQ1A 3OS2A 2LY1A 4M9XA 3FXKA 4YIIA 5FKKA 3BTLA 1I1GA 4L0ZB 4FCYA 4AIDA 2ZNYA 4QPQA 4A3LJ 3HSEA 3FMRA 1MDMA 2A5WA 1QZEA 1GHCA 1XC5A 2EBIA 4OAYA 4A3GJ 2NVYJ 1TQIA 5AIPA 1JT6A 3J7ZI 3HOYJ 3HC7A 5C4JJ 1MMSA 1U2WA 1GXPA 3SHFA 3CCEI 4XKCA 4RGUA 3WTYC 1W36C 2XPUA 3K4LA 2OQGA 3HBLA 3FXJA 2HPIA 4WWCA 4L5JA 1YS6A 2EQRA 3A01A 3R60A 5J8FA 5LEJA 2JK3A 5DV5A 3FX3A 2H1KA 4QTRA 3GZ6A 5D5XB 3F6VA 2V9VA 4A0ZA 5DCMA 5B5EC 2VKDA 1ZG3A 2YX4A 3SEQA 5JVTA 2R7ZJ 3FK7A 4UV9A 2CQ7A 4ZC3A 1VFCA 1L0OC 1WI3A 2D2WA 2YPRA 4B4CA 2HOTA 4Y33A 2GQQA 2W57A 2R7RA 2WAQN 1REPC 1JGSA 2GZWA 4R79A 2EFNA 3TO7A 2O6GE 4O3MA 4ZYEA 3GO5A 2Q0OA 2R7SA 4EJOA 3I55I 4Q48A 3BR0A 5LLQA 1MSFC 1XN7A 2LBFB 3B73A 3C2GA 4A5NA 3UKGA 1LE8A 1BR1A 3JRIA 4QSHA 3ULQB 5F0HA 3HHGA 4D9JA 4CYDA 2GBYA 4BXFA 4GGGA 1Q1VA 3E0JB 3BJOA 4UVAA 4E7ZA 3F8NA 1I27A 1YE9A 4XONA 5KVRA 3V7CA 5K7FA 1WCMJ 3L9FA 3CD6I 4B1RA 3HYIA 4FASD 3WTUC 2HOSA 3CLOA 1T33A 2EA4A 4BUPA 1K6YA 2L01A 3QU6A 4A3IJ 4IX7A 3KZIC 1U8BA 4CGZA 4KIGA 2NVXJ 2L4AA 4AC0A 1KQ0A 4UB6C 2XAUA 2FF4A 2VL8A 2LF7A 2QKLB 3H92A 2UUZA 1VF9A 2LDUA 2K4JA 1IF1A 1Q1HA 2R7XA 3PUFA 2XB5A 4HPQA 3T5XA 1QGPA 2G7HA 1TNSA 1MJAA 3E1SA 3LFKA 4O6JA 4ZZDA 1JTXA 4LMYA 4C2UA 1OPCA 1U5TC 4LOCA 3Q0VA 4A5MA 1MSEC 3KP7A 3HRMA 3ZQGA 4DYCA 3LSKA 4HA8A 1QZYA 1TT0A 2VQCA 5E79C 4BS9A 4PJMA 4EGZA 3ZMSA 4EV0A 3MAJA 2XAJA 2Q2EB 2ZSIB 4D7MA 2WWYA 5H6RA 4BEHA 2KRCA 1OISA 2XGCA 3P5JA 3K10A 5LBQA 3K9TA 3MQ0A 3J7YJ 3QP5A 3L2RA 2FBIA 1LDJA 1BA5A 2CFOA 4FISA 2RV8A 2QM3A 5D5UB 4PJJA 2W82A 1P7IA 2ZJRF 3FM5A 1RR8C 4B8XA 3S2DJ 3GTPJ 2AO9A 3FBNB 2BHYA 2XC7A 1OFCX 4FX0A 2STWA 3KLOA 2F5FA 4BDZA 5GADJ 5J1YA 3BG6A 2Z33A 3VPRA 3LSMA 2GIZA 1YQAA 4M73A 5M5WJ 2E2HJ 1VQKI 1GDTA 1EKEA 2ZFUA 2EK5A 2HXIA 2R5ZB 2UZKA 3S1MJ 1WJAA 5CYVA 3PNTA 3TBIA 3JSOA 4GDFA 4CCKA 4GYGA 1J7KA 4IVNA 2LYCA 1E17A 2YR2A 4S04A 1F43A 2MD5A 1LFBA 3C2HA 3UR3C 4YELA 5L3EA 2XKPA 4QPOA 2EZLA 5DEQA 2ZMEA 4U0YA 3CF5F 5BPIA 4AD9A 1W1WE 4F92B 1QU3A 1Z21A 5K5OA 3BQZA 1P2FA 2H94A 1Z0XA 1UAAA 1I39A 2BHZA 4ESJA 2Y9ZA 3I5UA 2DK8A 1QPMA 2P5LC 1FJLA 3CO7C 1TQMA 3PQKA 1JKOC 2O03A 5GAEJ 3PIPF 5H20A 1B8IA 2QLZA 4P96A 1X2NA 1MH4A 3ABMH 2E1MC 3GEZA 5B1AH 3CESA 4PJ0C 2M5WA 3BZKA 3CZ6A 1PUFB 3A03A 4LK0F 3VSKA 4M6XA 5FLMJ 1AKHA 3WHCA 2RQPA 1Y39A 1DPRA 3BG5A 4HDVA 1A36A 4A0XA 1J2XA 3LA7A 3CJNA 1ZG5A 2M0MA 3IV5A 2IW5A 3H0DA 2LLKA 1APLC 3PO2J 4E7LA 5EF6A 3MN2A 3Q9SA 5KCMA 4I0BA 1YTYA 3L00A 5IP9J 5FROA 5LEKA 2L9NA 2MA3A 2WY8Q 2RQQA 1FMVA 4ESFA 1VQ5I 2DLLA 2OA4A 2XIGA 1SVLA 5DUKA 1YX3A 3GTJJ 4CO8A 1R5ID 1FWZA 5J6XA 2DT6A 1FOKA 3L2QA 1ERDA 1KYWA 3LSHA 4RM3A 2UXXA 3ESWB 4B09A 2CUFA 3LFUA 3F72A 3F3XA 1Z7UA 5HOOA 2X9DA 3PL8A 4OOIA 3CCUI 1H88C 3OIQA 4KN4X 3WODF 1ZR2A 2CG4A 2KZVA 3DTEA 4HX7A 1MNDA 5GPCA 2EA2A 5F04A 1U6GA 3TO9A 4BHCA 3HTUA 1RRJA 2FA5A 2J5OA 5K7HA 4DOZA 4FE7A 5E8GA 3GLLA 2WBMA 5CVJA 2DFIA 3DPTA 2BY2A 1JTYA 2KHMA 3LMMA 2HYJA 4E70A 5EEAA 2ECCA 5ED4A 1H8AC 1WKMA 3DEWA 2L7FP 1SD5A 4XRSA 3AKZA 2PJRA 1JUSA 4AYBN 2HQRA 3MMYB 3PUBA 2Y69H 5JLXA 1SD7A 3G2BA 3DKYA 1GVDA 2MH2A 2VE8A 5LHHA 2VC1A 4C2MJ 4ETSA 3GW2A 3TW6A 4G7ZF 2DYSH 4C9YA 1AHDP 2XV4S 1WJFA 4IZZA 4FHTA 4XN3A 4BQAA 4KMFA 2OZUA 1D0ZA 2BY3A 2L3DA 3DWLE 3OWTA 4IXAA 4RS8A 3S8PA 3SZPA 4FE4A 5F1JA 1QPIA 1H89C 2EWNA 3RI4A 3ABKH 1D1AA 4HRIA 4ENKA 2AQEA 3JTGA 4R8HA 1RIOH 5HS8A 1SANA 2EZKA 1KZHA 4UXNA 2M8GX 1ONVA 2DA4A 3DKXA 5D8LB 1IXRC 2DA3A 3ERMA 3ECOA 3K4NA 2VONA 3G3ZA 1RR7A 4IKFA 1RESA 3S1NJ 4UY8I 4KISA 3NRVA 4WX9A 2KDZA 4HG2A 3F8CA 1EA3A 3BPXA 1ITYA 1NG6A 1XGSA 2DJIA 5J4YA 3OYCA 2O9LA 1P7JA 3ABLH 2E7XA 1VI0A 2ADUA 4HW0A 3S3NA 4LLNA 1WJBA 2JZYA 2M9HA 2BVLA 4BHPA 2VKVA 2BE5F 3KYLA 5DM6F 4IO9F 3HIFA 4YRVA 3HXLA 2NNNA 3PSIA 4XSZF 3M8EA 2WB1N 3TGNA 3CP8A 2EIMH 2RC4A 2R7FA 3H5AA 3CMMA 1ZELA 1TWAJ 3E3VA 2AHQA 2UWMA 1DU6A 2IP2A 5F64A 4M3BA 3COAC 4A3BJ 2XGXA 2W4SA 1D5YA 1USSA 2BEOA 1PUEE 3DP7A 4PFPA 1DGWY 1KQ8A 3HRSA 4DBRA 3EUHC 3RPUD 4JQFA 4CHUA 1ZK8A 4PZJA 2GM4A 3C3WA 2DMQA 2R5YB 2QQ8A 4RAFA 2R3SA 2RDPA 4A3MJ 1TZLA 1T38A 1VNDA 5TGTA 3W2VA 1H9TA 1V4RA 1J09A 1U9OA 2DDAA 4BQQA 2VBZA 1OCPA 2NVUB 4EJUA 4S0HB 1Y56A 1YRNA 4G6QA 2KJBA 3ZGKA 1NTCA 1R00A 2R92J 2V9PA 4IHVA 1GXQA 2DU9A 3T0YA 1TC3C 4I76A 3S2WA 1HSTA 3MEXA 4O5VA 4RGXA 4B47A 2V1UA 4L18B 2RGVA 4RAYA 4AIHA 2YUSA 2LKSA 5CQEA 2ICWG 2PMUA 3Q9VA 5M5XJ 4D0PA 4HX8A 2CV0A 2XASA 3HPHA 2DT5A 5ILSA 1IN6A 3UNGC 4EJWA 2HQAA 2X6YA 3ASNH 4B3AA 1T39A 1VQ4I 1XCBA 1WPKA 3E7LA 3CCLI 1IG7A 5HS9A 5DCMB 1XSVA 3CUQA 5AONA 5LGNA 4P9FA 2HDDA 3A2KA 1A6QA 2ZC2A 5IT9K 1DGRM 1LEAA 2QGUA 2O0YA 3W6JB 3MKZA 1J75A 2V6EA 1X1DA 2JSPA 2IRFG 5DUIA 1F1ZA 2MG4A 4MTEA 2DJNA 3C2BA 4HQEA 3IC7A 2XPVA 4M9ZA 3FMSA 5DYMA 2HTJA 1E0EA 1G59A 3KYCB 4KIFA 1LE8B 1LVAA 1P9QC 1S7EA 2DK5A 1OCCH 4HDUA 5E20A 4NQWA 2JN6A 1JJ8C 3F9KA 2F5VA 2NAZA 1S72I 2ELHA 2CMPA 1G2HA 5LD2C 3AG1H 1SFXA 3P9IA 1TP4A 2K4BA 2K7LA 5B1BH 1EH8A 4HQMA 3V4GA 1USTA 3SDGA 3F0CA 3A1YA 4WF2A 3GZ5A 1IN7A 1B9NA 1V5FA 3MKYB 3JCUC 5F0FA 3HKZA 4CDGA 2IEKA 2KQRA 2VJJA 3WGIA 3DKWA 3K4CA 4UUSB 2LREA 1S29A 2MBFA 2VQGA 1DP3A 5E1XA 2HTSA 1VQ9I 3LA3A 3HRUA 3GFMA 3WGGA 4AU7A 1E3HA 2LD5A 5E3OA 1BOAA 2IS2A 5JVGF 2XF6A 1YW9A 3JREA 1R9TJ 5IP6A 1AA7A 2E36A 2V1DA 2L7KA 3JAMK 4Q4ZF 1PJRA 3J7AO 3OYDA 2JRMA 2EZIA 1IN8A 2GA1A 3JAMZ 2X1EA 5M3FJ 3W6VA 1JKPC 1O4XA 5F08A 2X0LA 1B6AA 3Q3SA 1BI2A 2WTEA 5BQTA 4Y13A 4BEHB 3CJRB 2O8KA 2DDBA 3QP6A 3ZQFA 3KEOA 3OYEA 2EV0A 3ASOH 3HEFA 4CCMA 3ELKA 2VBXA 4CXFA 4PFOA 5BNGA 1ORKA 3U1DA 4OIRF 5D5WB 1YJWI 3S1RJ 3KIOA 1TW2A 4LLGF 4Q47A 3BR5A 4W97A 4CZZA 1J0RA 2L02A 2Q1ZB 4XL9A 4JK1X 3SJMA 1YIOA 3GTKJ 1WGXA 2GA2A 4AVZA 2EV6A 4ANJA 2PBIA 4MIMA 4XKVA 3EUHA 3R4KA 5GAGJ 5IY5H 1GLNA 2PMHA 3I56I 1ZN2A 2O7OA 2KZGA 1BBYA 1R4MB 1KYZA 2EIKH 2P7CB 4XQFA 1WWXA 4RGSA 4M3EA 2K40A 1UFMA 3RTRA 2ISYA 4HV6A 2IGNA 2RNJA 2P6TA 4GCVA 4ZYAA 3RKXA 3TDUC 4E6KG 3AL0B 2VPRA 2EH3A 5GP9A 3LNQA 2XGEA 1FBQA 1ZGJA 1D0YA 1ZGAA 3IAM2 2NS7A 1W5CC 2V9KA 3A0HC 3ML6A 4GO1A 2FNAA 2M0CA 4ZYHA 3R0JA 4M3DA 3U1KA 2HNHA 2KT0A 1D8KA 4CA0A 5F0CA 1SVOA 3MKWB 3M8FA 1UHWA 1XSXA 2H6BA 1CF7A 3E5XA 3GFIA 2VOOA 2HS5A 1BN5A 1Y8RB 1BJZA 4AIKA 2NNYA 2X1CA 4WK8F 3K1PA 2NOJB 2ECBA 2DODA 1Z67A 1ZTRA 2L7MP 2PEXA 3TP0A 3BY6A 2OPTA 5HLIA 3I4MJ 3CJTB 1W7PA 1X4PA 2DTRA 2M30A 3F23A 2P7VB 2Z3YA 5EJCA 1YJ9I 3GTMJ 2W00A 2QBYB 1RPWA 5FO5A 2GOMA 2QSFX 2OAZA 1Y8QB 1AKHB 2R0QC 5LRSA 1MNMC 1I3AA 1FIPA 4R1HA 2X51A 2W84A 4ESBA 2ZMEC 3QRFF 2AQFA 1D0XA 2OZ6A 1LPQA 2WC2A 3TW7A 4OIPF 3WTWC 1LB2A 3DPUA 2E71A 4XRFA 3N05A 1ODDA 3GX4X 1WQ2A 5J1UA 3JTHA 5L3FA 2Z16A 3AAFA 4F55A 2ESNA 4QWQA 1ZH5A 3PFYA 2BZTA 1Z6RA 3TDZC 4M6VA 3P9KA 2XGDA 1B72A 1GVJA 2MD0A 3IAS2 3G1MA 4JYKA 3RKYA 2VT2A 1K6OA 2E1NA 4L9JA 1FLIA 2WAQA 4XOTA 3CCJI 3DU5A 3ZP5A 2G7UA 4LJZF 3AG3H 4UUVA 4RM2A 3OYBA 4XICA 1YLFA 1SFKA 1BR4A 4NBQA 1LDKB 2MC4A 2Y0MA 3VDXA 1FC3A 2COMA 4N9HA 1UMQA 1TBXA 4ZDLA 4LK1F 5EZHA 2K02A 5L3BA 1R22A 1KONA 3QYEA 1U5TB 2HR3A 1WJDA 1HOMA 3HJEA 2AS5F 4UB8C 4MEXF 3FXMA 3ZQLA 3GLXA 4BE2A 1RC9A 5E3NA 2M34A 1W5TA 2XAHA 2PFBA 2C6YA 4BHBA 3FHZA 2R7OA 2HDCA 1MBKA 3D1NI 1YX5A 3K69A 3KE2A 4OMYA 3GF2A 1ENHA 4WCGA 3F8FA 3FK6A 3EQLF 4M74A 1ZLJA 5DS9A 2OTJI 3G6EI 1A04A 2YX7A 3KP4A 1MD0A 4RBOA 3H3VK 3SDBA 3LQRA 1XX5A 4N0BA 1XDSA 2ZJPF 1X3WB 3ABTA 3FMQA 3VYUB 2FMLA 1L3LA 1ACIA 1QHGA 4BKXA 5ICGA 2FOWA 2BXYA 2MYSA 5DD8A 4AM3A 3Q0WA 4LB5A 2XHKA 2ID6A 1EH7A 2VB6A 1BI3A 3GFLA 1BW6A 1TLHB 4OIOF 2VN2A 3OV8A 1E2XA 4IRIA 3MZ8A 3H1CA 4A3CJ 2DN0A 2FSWA 5CLSA 5E3MA 3T8TA 5CJ9A 5KNLA 3PM1A 1VZ0A 5HLTA 1RKTA 3HB9A 3RKWA 3NARA 3HSFA 2LK2A 3MZYA 4RLFA 3C1DA 3G73A 1RUOA 4EATA 1E3PA 2HVRA 3EYYA 2LMDA 3I4PA 1XTAA 1UELB 1MBEA 4EVIA 1ZAOA 2OCCH 3ONQA 1I50J 2VUMJ 4H0EA 5FLXK 1YO5C 5M3MJ 3HDDA 1RI7A 1T2KA 4HNUA 5LHIA 1WRJA 2PN6A 1HDPA 4BL0B 4G94A 1GUUA 4ON0A 5FLXZ 3DCFA 4U0WA 3O3KA 4Z6YA 2JA8J 1IRGA 3ZPLA 1LFUP 2LSOA 2QKMB 1XGMA 3FXRA 4BH9A 4YIFA 2JPBA 1ETQA 3F21A 2A5YB 3I54A 3MVPA 4NUBA 1BR2A 3V42A 2Q8KA 2KJCA 5JLWA 3MWMA 3T1BA 1Z91A 4EMSA 5KHDA 4ZJZA 1G3WA 2EB7A 3BZCA 4N4NB 1FIAA 1J5YA 2JPCA 3JW4A 3CUOA 3HL2A 4HSRA 1YI2I 3RZOJ 4C2TA 1PP7U 1IDZA 4IF4A 4J00A 3LSRA 4Y15A 2E1MB 4I0AA 1FY7A 2XROA 2LG4A 3LAPA 3CCQI 1S7AA 1OJLA 1Y1VJ 2J5PA 3D5SC 3WGHA 2IGMA 4BE1A 2GOXB 2JUCA 3OSFA 4HLYA 4NHJA 4Q5SF 4G9YA 5HODA 2EINH 1YRNB 3BTIA 2ZXHA 4E7JA 3ZN0A 1FOXA 2JA2A 3RSNA 4KYWA 5FRMA 1SD4A 4B3XA 1FTTA 2DMNA 5HVQC 3FHNA 3TO6A 2BXZA 2WY7Q 2V26A 2K85A 1R36A 2XDVA 5IT3A 3RPUA 4E4HA 3CJQB 2Z2SB 1T95A 5BMZA 4XRSG 2VC0A 4JX6A 4M72A 2LNBA 5FKLA 1U9NA 4MHGA 5H6QA 2VBYA 3LWFA 2F6CA 2M1BA 3C18A 3WTTC 1SVMA 1WJCA 1N77A 2QWWA 4QLCU 4PDKA 3PQJA 3FXLA 3SXYA 3I59B 2WAEA 3CUQB 4OWRB 2E35A 1JI8A 4HNVA 3DLLF 1XCVA 1ETWA 2WAFA 4I2OA 2F4IA 2HWVA 2LKPA 1DUXC 5D6EA 4YFKF 4IHXA 4OMZA 4XLCA 1B59A 4A69C 2L7ZA 2XKOA 3I53A 3VYTB 1J59A 3S14J 1I6HJ 3F8BA 1BL0A 5FKMA 4XLAA 5A2QK 4L5EA 2FQ3A 5J8CA
chains in the Genus database with same CATH topology
5A2QZ 1HW2A 3J81Z 1FPQA 1R1UA 2XAQA 3E6DA 3HOSA 5FGMA 4EQQA 3CUQC 1KGSA 4XSXF 3TOAA 3EDPA 2NRAC 2RVCA 3HOTA 3VODA 3E5UA 3QPTA 4ASNA 3F22A 2K27A 5HDNA 4PCQA 3BDDA 2QQBA 3M7GA 3WE3A 1R23A 2A68F 3L2CA 5HLGA 2NYXA 3K2ZA 1B1BA 3F8MA 1XMAA 4IHTA 2GAUA 2P6SA 2HYGD 3DFGA 3WU0A 1W4MA 5LHGA 1Z6TA 2QZ8A 5JHUA 3WTXC 5ICFA 5HDKA 4UNOA 2DQLA 4L9NA 2L54A 3QAHA 1FBUA 5CVVA 3GFJA 4KT5C 2CO5A 4U7DA 1LDDA 2M8EA 4BXUA 1WSUA 2PI0A 5FD5A 2F2EA 4LFUA 4UV8A 4AWXB 3LA2A 2OD5A 3GWZA 4WXCA 1O3QA 3DF8A 2BV6A 2WV0A 2ETHA 2HKXA 4U7BA 1CF7B 4YFNF 3DEUA 5K5QA 3REOA 1KA8A 2F5DA 1F9NA 1G4DA 1TNTA 1PP8F 4M6YA 1FYLA 4HAMA 3DXJF 2ZJ2A 1YYVA 1W7PB 2A69F 1SMTA 3B02A 1OYYA 3WTSC 1STZA 1MDMB 1R5HA 2BGCA 2PJPA 1HQCA 1K79A 3Q5FA 2EFOA 3FM3A 1T6SA 1ZRCA 1C0WA 4A6EA 1IN4A 3SZTA 1QNTA 2ZCWA 1TTYA 1OMIA 2XVCA 4PGGA 4ZH4F 2AXLA 3IKTA 2TDXA 2O61A 1U3EM 1Z05A 3KCCA 1QO0D 4MQVA 2Y75A 2DBBA 1EV7A 1Z1DA 3GUDA 3IL2A 2KRFA 2ZO4A 1BC7C 4HOBA 2Y48A 3VFZA 2EFWA 4M9SA 4G7OF 3HHHA 3IWFA 1OR7A 3L7WA 2CGPA 1U8RA 2ZBKA 3ZQ7A 4BNCA 2X4HA 3E6BA 2MLKA 3M9AA 2ACJA 4DNCA 3V8KA 1Y0UA 1R7JA 4RB2C 5BPDA 4BAYA 1T98A 2HKOA 4U0VA 4L9VA 2H6CA 3IRRA 3O6BB 3VEPA 2O8XA 1D5VA 2HEOA 4A6DA 3HTSB 1XDUA 4MNUA 1R5GA 2DAOA 2FXAA 2VBWA 4RAZA 1FP2A 3ROUA 3FXQA 1T0FA 4N9IA 3RJPA 2KKOA 1OKRA 1IW7F 3TKYA 1ULYA 4U88A 1HXDA 3ZMDA 3BJAA 1R1VA 2JSCA 4EGYA 1UCRA 2NS0A 3KEQA 1YW7A 1QBJA 3R6SA 2CWEA 2PG4A 1HW5A 3L09A 2VOPA 2DI3A 2XUBA 2JTVA 3K0LA 1BIAA 3ZMUA 4PGHA 4XBFA 3H3UA 3SFZA 1S8NA 3CO6C 2MC3A 3WG9A 1BI1A 2YU3A 3U9GA 4HF2A 4P55A 2M87A 2ZKZA 4F7ZA 2VE9A 1IRFA 4RGRA 3TOBA 1RZ4A 2BYVE 3HSRA 2FRHA 1I5ZA 2Z9OA 4JBAA 2ZMEB 1HSJA 1YG2A 1G3YA 3C7JA 4EM0B 1KU7A 1FX7A 3R0AA 4K2EA 1DP7P 4KDPA 4MQ9F 2A3SA 5EEHA 1XB4A 2A07F 5ILUA 1IN5A 3F6OA 4I02A 3DV8A 4LG0A 4LB6B 4IRGA 1HKTA 4EM1A 5ERIA 2A6EF 1SFUA 1ZLKA 4CICA 2FMYA 3D5LA 1FP1D 4EM2A 1BM9A 2D45A 5E17F 3KZYA 5D4RA 2ZFWA 4YFXF 1ZYRF 2ZNZA 1O3RA 1JXSA 4KFCA 3K1MA 1FZPB 4IRHA 3BZ6A 2D1VA 2QVOA 4UVBA 2ZXJA 3WE2A 4G6DA 2DW4A 4FT8A 2HOEA 3ECHA 3GYHX 3ZN1A 1G3TA 1HKSA 4MGRA 1JHFA 1LJ9A 5KK1A 1DPUA 2EFQA 1R58A 5BOXA 1MZBA 1KU3A 1JE8A 1K78A 1O57A 3E97A 4MTDA 4TV7A 4GYIA 1O7LA 1D3YA 4S05A 3W6KB 3T8RA 3KP2A 3OOPA 3KP6A 1XGNA 5JFRA 2IJLA 3IWZA 5FFZA 3LQQA 2B0LA 3QOPA 1HW1A 1SD6A 3NQOA 1KU2A 1ZARA 5K1YA 4Z2YA 3JSPA 3FWEA 2DPUA 2QYOA 3J80K 2STTA 4HX4A 5JR3A 3J80Z 4HV5A 5LGUA 2IA2A 2V79A 1MJBA 4HF0A 4RB3C 4A0YA 1IZ1A 1TW3A 1YS7A 4HYEA 2Z99A 5E18F 1V3FA 2XAGA 1FT9A 4A2UA 1J9IA 4KNYA 2HGCA 2CFXA 1QQIA 2EFPA 4EJVA 1O3TA 3BJ6A 1W7PD 3N97A 2CQKA 3BP8A 2O3FA 4RB0A 1ZHFA 1BIBA 2P4WA 2E7WA 2M45A 3N4MA 2FEZA 1UHMA 1LEBA 3GVAA 3RPQA 5J8CA 1QZZA 3DQVC 4HBLA 4I01A 2HFHA 3MCZA 2QBYA 4WXHA 3ABUA 1G3SA 4OINF 5FFXA 2FBKA 5AIQA 3V7RA 2LF8A 2A6HF 2FBHA 3BROA 3KP3A 2IPQX 4UVCA 3O2PE 3WU1B 1K7AA 4EJTA 1ON2A 2QENA 2K86A 1LNWA 1O3SA 3QPHA 1VTNC 4DQ2A 1YW8A 1SFEA 2JRTA 1P4WA 3BWGA 3KZZA 4KN7X 1FBSA 1G6NA 2KIFA 3V8LA 2FOKA 1B4AA 4OU0A 3DPLC 3RDIA 4LD5A 4GXOA 1IXCA 4P5OA 1U5TA 4YG2F 4KA4A 4M71A 2V1XA 2H09A 3RYPA 3I71A 2XAFA 3H3ZA 5K5RA 1ZG1A 2CYYA 4I7HA 2A61A 5LRRA 3RYRA 2FU4A 2OU2A 2GIVA 4MEYF 5FB2A 1KQ9A 3IRQA 3WTZA 5D8KB 1R1TA 5CVUA 4LGWA 3LSTA 2KIUA 5F1RA 1ON1A 2L4MA 1YFHA 3ISPA 4ENJA 2CSOA 5TJJA 1OYWA 4ZZLA 2Q2EA 1BC8C 2P5VA 3K1NA 5E1ZB 2W24A 2HYFA 4L5IA 5LGTA 5E1WA 3MFKA 1WI9A 2V6CA 3KP5A 4Y17A 5DCFA 4I98B 3MZHA 3NEUA 2G9WA 3EYIA 2PQ8A 2IA1A 3CTAA 1O7FA 3R61A 4I09A 5D6FA 5L3CA 1W5SA 5TRDA 2VODA 1XD7A 3P7NA 2E1CA 4HZFA 2FE3A 4G7HF 1FSEA 3TQNA 1XGOA 5FD6A 4AVPA 2VT3A 3SQNA 3IKVA 3ZMTA 2W85A 2ISZA 1H9GA 1UB9A 4AIJA 2Z5UA 4ENNA 3I64A 5L3DA 4KUMA 1AOYA 1XSDA 4FX4A 4IHSA 1MKMA 4G8XA 2RKHA 1MJ9A 1H0MA 3V7SA 1FSHA 4LG0B 3FXUA 4BYYA 3E5QA 5D4SA 4L9TA 1TQPA 3FZVA 2IT0A 3D0SA 4KIBA 3V8JA 3QU3A 2W25A 5JI6A 2DO7A 2F5CA 2RN7A 1EH6A 1JHHA 3M1EA 1ZREA 5E8IA 1RUNA 2MH9A 5CVRA 4KMUX 2HQNA 1B9MA 4IJAA 4A12A 2MLGA 5ILVA 1Z9CA 3I59A 3KFWX 5ICEA 2UXNA 2DQRA 5IT9Z 4HLXA 3ZMZA 2CW0F 2QQAA 1P6RA 4ZYGA 4ZYDA 2FNPA 2KIMA 4XLPF 4XLNF 2JT1A 3GXOA 1OYIA 5L3GA 1FYMA 5CVIA 2XRNA 2QUFA 1K78B 1DDNA 1P4AA 1IAWA 5DD4A 2DPDA 3E6CC 4OIQF 1F5TA 1HKQA 1S6LA 1XMKA 3BPVA 1P4XA 2OQRA 1SMYF 3E6MA 3U2RA 3HUGA 1BI0A 1P92A 3RIRA 1SAXA 2PLYA 3WTVC 2P5KA 6PAXA 4NB5A 1KU9A 2QQ9A 5HS7A 1I6XA 3ERED 4RB1A 1S3JA 3LAJA 3I0TA 4WXDA 1CGPA 4KICA 2R7DA 2H27A 4HF1A 1FYKA 3P9CA 1NHAA 2VXZA 3IHUA 2GWRA 1BJAA 2YSRA 2D1HA 4P9UA 5BS6A 3VOEA 1FNNA 2EJRA 3VB2A 4IPAA 3KETA 3HRTA 3ZMVA 2ESHA 2GXBA 1IXSB 1F4KA 1ZRFA 5F6FA 1HBXG 4LLLA 2GXGA 5HDGA 2F5EA 5ICCA 1X3UA 3CDHA 1AWCA 5D5VB 2P8TA 4L0YB 3KLNA 1RNLA 5HLHA 4ENMA 3BOQA 1U78A 4UHTA 1IUYA 3PFIA 2BBYA 1PDNC 2HZTA 3FF5A 2OBPA 2IVMA 3EETA 2IA0A 2EV5A 5DDGA 1D8JA 1MGTA 1S7OA 1ZRDA 1I1SA 3I58A 1LQ1A 4M9XA 4YIIA 1I1GA 4L0ZB 2ZNYA 3HSEA 3FMRA 1MDMA 1GHCA 1TQIA 5AIPA 1U2WA 1GXPA 3SHFA 4RGUA 3WTYC 2OQGA 4WWCA 4L5JA 1YS6A 3R60A 5J8FA 5LEJA 5DV5A 3FX3A 3GZ6A 5D5XB 3F6VA 2V9VA 4A0ZA 5DCMA 1ZG3A 2YX4A 5JVTA 4UV9A 1L0OC 2D2WA 2YPRA 2GQQA 2W57A 1REPC 1JGSA 2GZWA 4R79A 2EFNA 3TO7A 2O6GE 4O3MA 4ZYEA 3GO5A 2Q0OA 4EJOA 4Q48A 5LLQA 1XN7A 3B73A 4A5NA 3ULQB 3HHGA 4CYDA 4GGGA 3BJOA 4UVAA 3F8NA 1I27A 5KVRA 3V7CA 3L9FA 3HYIA 3WTUC 3CLOA 2EA4A 2L01A 3QU6A 4CGZA 4KIGA 2L4AA 1KQ0A 2FF4A 2LF7A 3H92A 2LDUA 2K4JA 1IF1A 1Q1HA 3T5XA 1QGPA 2G7HA 1TNSA 1MJAA 3LFKA 4O6JA 4ZZDA 4LMYA 1OPCA 1U5TC 4A5MA 3KP7A 3HRMA 4HA8A 1QZYA 4EGZA 3ZMSA 4EV0A 3MAJA 2XAJA 2WWYA 5H6RA 5LBQA 3K9TA 3MQ0A 3QP5A 2FBIA 1LDJA 2RV8A 2QM3A 5D5UB 3FM5A 4B8XA 4FX0A 2STWA 3KLOA 2F5FA 2Z33A 1YQAA 4M73A 2EK5A 2UZKA 5CYVA 3JSOA 4GYGA 1J7KA 4IVNA 1E17A 2YR2A 4S04A 2MD5A 5L3EA 2XKPA 5DEQA 2ZMEA 4U0YA 5BPIA 4AD9A 5K5OA 1P2FA 2H94A 4ESJA 3I5UA 2DK8A 1QPMA 2P5LC 3CO7C 1TQMA 3PQKA 2O03A 5H20A 2QLZA 4P96A 3GEZA 2M5WA 4LK0F 4M6XA 2RQPA 1DPRA 4HDVA 4A0XA 1J2XA 3LA7A 3CJNA 1ZG5A 2IW5A 3Q9SA 4I0BA 1YTYA 3L00A 5LEKA 2MA3A 4ESFA 2DLLA 2OA4A 2XIGA 5DUKA 4CO8A 1FWZA 5J6XA 1FOKA 1KYWA 2UXXA 4B09A 3F72A 3F3XA 1Z7UA 5HOOA 4OOIA 4KN4X 3WODF 2CG4A 4HX7A 2EA2A 1U6GA 3TO9A 4BHCA 3HTUA 2FA5A 2J5OA 5E8GA 5CVJA 2DFIA 3DPTA 4E70A 2FQ3A 5ED4A 1WKMA 1SD5A 2HQRA 1SD7A 2MH2A 2VE8A 5LHHA 2VC1A 4ETSA 3GW2A 4G7ZF 2XV4S 4FHTA 4BQAA 4KMFA 2OZUA 2L3DA 4RS8A 4IXAA 3SZPA 2EWNA 3RI4A 4ENKA 3JTGA 4R8HA 1RIOH 5HS8A 4UXNA 1ONVA 5D8LB 1IXRC 2VONA 3ECOA 3G3ZA 3NRVA 4WX9A 3F8CA 3BPXA 1XGSA 2E7XA 4HW0A 2ADUA 4LLNA 2JZYA 4BHPA 2BE5F 3HIFA 2NNNA 4XSZF 3M8EA 3TGNA 2RC4A 2R7FA 3E3VA 2UWMA 2IP2A 5F64A 3COAC 2XGXA 1USSA 2BEOA 1PUEE 3DP7A 1KQ8A 3HRSA 4JQFA 4CHUA 4PZJA 3C3WA 2R3SA 2RDPA 1T38A 1H9TA 1V4RA 2VBZA 4EJUA 4G6QA 2KJBA 1R00A 1GXQA 2DU9A 3T0YA 3S2WA 1HSTA 3MEXA 4O5VA 4RGXA 2V1UA 4L18B 2RGVA 4RAYA 4AIHA 2PMUA 3Q9VA 4D0PA 4HX8A 2XASA 2DT5A 5ILSA 1IN6A 4EJWA 1T39A 1XCBA 5HS9A 5DCMB 1XSVA 3CUQA 5AONA 5LGNA 4P9FA 5IT9K 1LEAA 2O0YA 3W6JB 1J75A 2IRFG 5DUIA 1F1ZA 4MTEA 4HQEA 3IC7A 4M9ZA 3FMSA 5DYMA 2HTJA 4KIFA 1LVAA 2DK5A 4HDUA 5E20A 4NQWA 2NAZA 2ELHA 1SFXA 3P9IA 2K4BA 2K7LA 1EH8A 4HQMA 3V4GA 1USTA 4WF2A 3GZ5A 1IN7A 1B9NA 4CDGA 3WGIA 3DKWA 1S29A 2MBFA 5E1XA 2HTSA 3LA3A 3HRUA 3GFMA 3WGGA 1BOAA 1YW9A 2V1DA 3JAMK 4Q4ZF 3J7AO 1IN8A 2GA1A 3JAMZ 2X0LA 1B6AA 1BI2A 2WTEA 5BQTA 4Y13A 3QP6A 3KEOA 2EV0A 3ELKA 2VBXA 4CXFA 3U1DA 4OIRF 5D5WB 1TW2A 4LLGF 4Q47A 4CZZA 1J0RA 2L02A 4JK1X 1YIOA 2GA2A 2EV6A 2PBIA 3EUHA 3R4KA 2PMHA 1ZN2A 1BBYA 1KYZA 2P7CB 1WWXA 4RGSA 3RTRA 1UFMA 2ISYA 4HV6A 2RNJA 3TDUC 2P6TA 4GCVA 3RKXA 1FBQA 1ZGJA 1ZGAA 3ML6A 4GO1A 2FNAA 4ZYHA 3R0JA 1D8KA 3M8FA 1UHWA 1XSXA 2H6BA 1CF7A 3E5XA 3GFIA 2VOOA 2HS5A 1BN5A 4AIKA 2NNYA 4WK8F 3K1PA 2PEXA 3BY6A 5HLIA 1W7PA 2DTRA 2M30A 3F23A 2P7VB 2Z3YA 2QBYB 5FO5A 2OAZA 5LRSA 4R1HA 2W84A 4ESBA 3QRFF 2OZ6A 2WC2A 4OIPF 3WTWC 1LB2A 4XRFA 1ODDA 3GX4X 1WQ2A 3JTHA 5L3FA 3AAFA 2ESNA 4QWQA 1ZH5A 1Z6RA 3TDZC 3P9KA 1GVJA 3RKYA 2VT2A 1K6OA 2E1NA 4L9JA 1FLIA 3ZP5A 2G7UA 4LJZF 4UUVA 1YLFA 1LDKB 2Y0MA 1FC3A 2COMA 4N9HA 1TBXA 4LK1F 5L3BA 2K02A 1R22A 1U5TB 2HR3A 2AS5F 4MEXF 3GLXA 2XAHA 1W5TA 2PFBA 2C6YA 4BHBA 3FHZA 2HDCA 3K69A 3KE2A 4OMYA 3GF2A 4WCGA 3F8FA 3EQLF 4M74A 1ZLJA 1A04A 2YX7A 3KP4A 1MD0A 3LQRA 4N0BA 1XDSA 3ABTA 3FMQA 2FMLA 1L3LA 5ICGA 5DD8A 4LB5A 2XHKA 3GFLA 1EH7A 1BI3A 1TLHB 4OIOF 2VN2A 3OV8A 1E2XA 4IRIA 2FSWA 5CLSA 3T8TA 5CJ9A 3RKWA 3HSFA 3MZYA 3C1DA 3G73A 1RUOA 3EYYA 3I4PA 4EVIA 1ZAOA 4H0EA 5FLXK 1YO5C 1RI7A 1T2KA 5LHIA 1WRJA 2PN6A 4G94A 4ON0A 5FLXZ 4U0WA 3O3KA 1IRGA 3ZPLA 2LSOA 1XGMA 3FXRA 4BH9A 4YIFA 2JPBA 3F21A 2A5YB 3I54A 2Q8KA 2KJCA 3MWMA 3T1BA 1Z91A 4EMSA 1G3WA 2EB7A 1J5YA 2JPCA 3JW4A 3CUOA 1PP7U 4IF4A 4Y15A 4I0AA 1FY7A 2XROA 3LAPA 1S7AA 2J5PA 3WGHA 4HLYA 4NHJA 4Q5SF 4G9YA 3ZN0A 4KYWA 1SD4A 5HVQC 3TO6A 1R36A 5IT3A 3RPUA 5BMZA 2VC0A 4M72A 2LNBA 4MHGA 5H6QA 2VBYA 3LWFA 2M1BA 3C18A 3WTTC 2QWWA 4QLCU 4PDKA 3PQJA 3SXYA 3I59B 3CUQB 1XCVA 4I2OA 2HWVA 2LKPA 1DUXC 5D6EA 4YFKF 4OMZA 1B59A 2XKOA 3I53A 1J59A 3F8BA 5A2QK 5EEGA 3J81K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A2Q Z;  1HW2 A;  3J81 Z;  1FPQ A;  1R1U A;  2XAQ A;  3E6D A;  3HOS A;  5FGM A;  4EQQ A;  3CUQ C;  1KGS A;  4XSX F;  3TOA A;  3EDP A;  2NRA C;  2RVC A;  3HOT A;  3VOD A;  3E5U A;  3QPT A;  4ASN A;  3F22 A;  2K27 A;  5HDN A;  4PCQ A;  3BDD A;  2QQB A;  3M7G A;  3WE3 A;  1R23 A;  2A68 F;  3L2C A;  5HLG A;  2NYX A;  3K2Z A;  1B1B A;  3F8M A;  1XMA A;  4IHT A;  2GAU A;  2P6S A;  2HYG D;  3DFG A;  3WU0 A;  1W4M A;  5LHG A;  1Z6T A;  2QZ8 A;  5JHU A;  3WTX C;  5ICF A;  5HDK A;  4UNO A;  2DQL A;  4L9N A;  2L54 A;  3QAH A;  1FBU A;  5CVV A;  3GFJ A;  4KT5 C;  2CO5 A;  4U7D A;  1LDD A;  2M8E A;  4BXU A;  1WSU A;  2PI0 A;  5FD5 A;  2F2E A;  4LFU A;  4UV8 A;  4AWX B;  3LA2 A;  2OD5 A;  3GWZ A;  4WXC A;  1O3Q A;  3DF8 A;  2BV6 A;  2WV0 A;  2ETH A;  2HKX A;  4U7B A;  1CF7 B;  4YFN F;  3DEU A;  5K5Q A;  3REO A;  1KA8 A;  2F5D A;  1F9N A;  1G4D A;  1TNT A;  1PP8 F;  4M6Y A;  1FYL A;  4HAM A;  3DXJ F;  2ZJ2 A;  1YYV A;  1W7P B;  2A69 F;  1SMT A;  3B02 A;  1OYY A;  3WTS C;  1STZ A;  1MDM B;  1R5H A;  2BGC A;  2PJP A;  1HQC A;  1K79 A;  3Q5F A;  2EFO A;  3FM3 A;  1T6S A;  1ZRC A;  1C0W A;  4A6E A;  1IN4 A;  3SZT A;  1QNT A;  2ZCW A;  1TTY A;  1OMI A;  2XVC A;  4PGG A;  4ZH4 F;  2AXL A;  3IKT A;  2TDX A;  2O61 A;  1U3E M;  1Z05 A;  3KCC A;  1QO0 D;  4MQV A;  2Y75 A;  2DBB A;  1EV7 A;  1Z1D A;  3GUD A;  3IL2 A;  2KRF A;  2ZO4 A;  1BC7 C;  4HOB A;  2Y48 A;  3VFZ A;  2EFW A;  4M9S A;  4G7O F;  3HHH A;  3IWF A;  1OR7 A;  3L7W A;  2CGP A;  1U8R A;  2ZBK A;  3ZQ7 A;  4BNC A;  2X4H A;  3E6B A;  2MLK A;  3M9A A;  2ACJ A;  4DNC A;  3V8K A;  1Y0U A;  1R7J A;  4RB2 C;  5BPD A;  4BAY A;  1T98 A;  2HKO A;  4U0V A;  4L9V A;  2H6C A;  3IRR A;  3O6B B;  3VEP A;  2O8X A;  1D5V A;  2HEO A;  4A6D A;  3HTS B;  1XDU A;  4MNU A;  1R5G A;  2DAO A;  2FXA A;  2VBW A;  4RAZ A;  1FP2 A;  3ROU A;  3FXQ A;  1T0F A;  4N9I A;  3RJP A;  2KKO A;  1OKR A;  1IW7 F;  3TKY A;  1ULY A;  4U88 A;  1HXD A;  3ZMD A;  3BJA A;  1R1V A;  2JSC A;  4EGY A;  1UCR A;  2NS0 A;  3KEQ A;  1YW7 A;  1QBJ A;  3R6S A;  2CWE A;  2PG4 A;  1HW5 A;  3L09 A;  2VOP A;  2DI3 A;  2XUB A;  2JTV A;  3K0L A;  1BIA A;  3ZMU A;  4PGH A;  4XBF A;  3H3U A;  3SFZ A;  1S8N A;  3CO6 C;  2MC3 A;  3WG9 A;  1BI1 A;  2YU3 A;  3U9G A;  4HF2 A;  4P55 A;  2M87 A;  2ZKZ A;  4F7Z A;  2VE9 A;  1IRF A;  4RGR A;  3TOB A;  1RZ4 A;  2BYV E;  3HSR A;  2FRH A;  1I5Z A;  2Z9O A;  4JBA A;  2ZME B;  1HSJ A;  1YG2 A;  1G3Y A;  3C7J A;  4EM0 B;  1KU7 A;  1FX7 A;  3R0A A;  4K2E A;  1DP7 P;  4KDP A;  4MQ9 F;  2A3S A;  5EEH A;  1XB4 A;  2A07 F;  5ILU A;  1IN5 A;  3F6O A;  4I02 A;  3DV8 A;  4LG0 A;  4LB6 B;  4IRG A;  1HKT A;  4EM1 A;  5ERI A;  2A6E F;  1SFU A;  1ZLK A;  4CIC A;  2FMY A;  3D5L A;  1FP1 D;  4EM2 A;  1BM9 A;  2D45 A;  5E17 F;  3KZY A;  5D4R A;  2ZFW A;  4YFX F;  1ZYR F;  2ZNZ A;  1O3R A;  1JXS A;  4KFC A;  3K1M A;  1FZP B;  4IRH A;  3BZ6 A;  2D1V A;  2QVO A;  4UVB A;  2ZXJ A;  3WE2 A;  4G6D A;  2DW4 A;  4FT8 A;  2HOE A;  3ECH A;  3GYH X;  3ZN1 A;  1G3T A;  1HKS A;  4MGR A;  1JHF A;  1LJ9 A;  5KK1 A;  1DPU A;  2EFQ A;  1R58 A;  5BOX A;  1MZB A;  1KU3 A;  1JE8 A;  1K78 A;  1O57 A;  3E97 A;  4MTD A;  4TV7 A;  4GYI A;  1O7L A;  1D3Y A;  4S05 A;  3W6K B;  3T8R A;  3KP2 A;  3OOP A;  3KP6 A;  1XGN A;  5JFR A;  2IJL A;  3IWZ A;  5FFZ A;  3LQQ A;  2B0L A;  3QOP A;  1HW1 A;  1SD6 A;  3NQO A;  1KU2 A;  1ZAR A;  5K1Y A;  4Z2Y A;  3JSP A;  3FWE A;  2DPU A;  2QYO A;  3J80 K;  2STT A;  4HX4 A;  5JR3 A;  3J80 Z;  4HV5 A;  5LGU A;  2IA2 A;  2V79 A;  1MJB A;  4HF0 A;  4RB3 C;  4A0Y A;  1IZ1 A;  1TW3 A;  1YS7 A;  4HYE A;  2Z99 A;  5E18 F;  1V3F A;  2XAG A;  1FT9 A;  4A2U A;  1J9I A;  4KNY A;  2HGC A;  2CFX A;  1QQI A;  2EFP A;  4EJV A;  1O3T A;  3BJ6 A;  1W7P D;  3N97 A;  2CQK A;  3BP8 A;  2O3F A;  4RB0 A;  1ZHF A;  1BIB A;  2P4W A;  2E7W A;  2M45 A;  3N4M A;  2FEZ A;  1UHM A;  1LEB A;  3GVA A;  3RPQ A;  5J8C A;  1QZZ A;  3DQV C;  4HBL A;  4I01 A;  2HFH A;  3MCZ A;  2QBY A;  4WXH A;  3ABU A;  1G3S A;  4OIN F;  5FFX A;  2FBK A;  5AIQ A;  3V7R A;  2LF8 A;  2A6H F;  2FBH A;  3BRO A;  3KP3 A;  2IPQ X;  4UVC A;  3O2P E;  3WU1 B;  1K7A A;  4EJT A;  1ON2 A;  2QEN A;  2K86 A;  1LNW A;  1O3S A;  3QPH A;  1VTN C;  4DQ2 A;  1YW8 A;  1SFE A;  2JRT A;  1P4W A;  3BWG A;  3KZZ A;  4KN7 X;  1FBS A;  1G6N A;  2KIF A;  3V8L A;  2FOK A;  1B4A A;  4OU0 A;  3DPL C;  3RDI A;  4LD5 A;  4GXO A;  1IXC A;  4P5O A;  1U5T A;  4YG2 F;  4KA4 A;  4M71 A;  2V1X A;  2H09 A;  3RYP A;  3I71 A;  2XAF A;  3H3Z A;  5K5R A;  1ZG1 A;  2CYY A;  4I7H A;  2A61 A;  5LRR A;  3RYR A;  2FU4 A;  2OU2 A;  2GIV A;  4MEY F;  5FB2 A;  1KQ9 A;  3IRQ A;  3WTZ A;  5D8K B;  1R1T A;  5CVU A;  4LGW A;  3LST A;  2KIU A;  5F1R A;  1ON1 A;  2L4M A;  1YFH A;  3ISP A;  4ENJ A;  2CSO A;  5TJJ A;  1OYW A;  4ZZL A;  2Q2E A;  1BC8 C;  2P5V A;  3K1N A;  5E1Z B;  2W24 A;  2HYF A;  4L5I A;  5LGT A;  5E1W A;  3MFK A;  1WI9 A;  2V6C A;  3KP5 A;  4Y17 A;  5DCF A;  4I98 B;  3MZH A;  3NEU A;  2G9W A;  3EYI A;  2PQ8 A;  2IA1 A;  3CTA A;  1O7F A;  3R61 A;  4I09 A;  5D6F A;  5L3C A;  1W5S A;  5TRD A;  2VOD A;  1XD7 A;  3P7N A;  2E1C A;  4HZF A;  2FE3 A;  4G7H F;  1FSE A;  3TQN A;  1XGO A;  5FD6 A;  4AVP A;  2VT3 A;  3SQN A;  3IKV A;  3ZMT A;  2W85 A;  2ISZ A;  1H9G A;  1UB9 A;  4AIJ A;  2Z5U A;  4ENN A;  3I64 A;  5L3D A;  4KUM A;  1AOY A;  1XSD A;  4FX4 A;  4IHS A;  1MKM A;  4G8X A;  2RKH A;  1MJ9 A;  1H0M A;  3V7S A;  1FSH A;  4LG0 B;  3FXU A;  4BYY A;  3E5Q A;  5D4S A;  4L9T A;  1TQP A;  3FZV A;  2IT0 A;  3D0S A;  4KIB A;  3V8J A;  3QU3 A;  2W25 A;  5JI6 A;  2DO7 A;  2F5C A;  2RN7 A;  1EH6 A;  1JHH A;  3M1E A;  1ZRE A;  5E8I A;  1RUN A;  2MH9 A;  5CVR A;  4KMU X;  2HQN A;  1B9M A;  4IJA A;  4A12 A;  2MLG A;  5ILV A;  1Z9C A;  3I59 A;  3KFW X;  5ICE A;  2UXN A;  2DQR A;  5IT9 Z;  4HLX A;  3ZMZ A;  2CW0 F;  2QQA A;  1P6R A;  4ZYG A;  4ZYD A;  2FNP A;  2KIM A;  4XLP F;  4XLN F;  2JT1 A;  3GXO A;  1OYI A;  5L3G A;  1FYM A;  5CVI A;  2XRN A;  2QUF A;  1K78 B;  1DDN A;  1P4A A;  1IAW A;  5DD4 A;  2DPD A;  3E6C C;  4OIQ F;  1F5T A;  1HKQ A;  1S6L A;  1XMK A;  3BPV A;  1P4X A;  2OQR A;  1SMY F;  3E6M A;  3U2R A;  3HUG A;  1BI0 A;  1P92 A;  3RIR A;  1SAX A;  2PLY A;  3WTV C;  2P5K A;  6PAX A;  4NB5 A;  1KU9 A;  2QQ9 A;  5HS7 A;  1I6X A;  3ERE D;  4RB1 A;  1S3J A;  3LAJ A;  3I0T A;  4WXD A;  1CGP A;  4KIC A;  2R7D A;  2H27 A;  4HF1 A;  1FYK A;  3P9C A;  1NHA A;  2VXZ A;  3IHU A;  2GWR A;  1BJA A;  2YSR A;  2D1H A;  4P9U A;  5BS6 A;  3VOE A;  1FNN A;  2EJR A;  3VB2 A;  4IPA A;  3KET A;  3HRT A;  3ZMV A;  2ESH A;  2GXB A;  1IXS B;  1F4K A;  1ZRF A;  5F6F A;  1HBX G;  4LLL A;  2GXG A;  5HDG A;  2F5E A;  5ICC A;  1X3U A;  3CDH A;  1AWC A;  5D5V B;  2P8T A;  4L0Y B;  3KLN A;  1RNL A;  5HLH A;  4ENM A;  3BOQ A;  1U78 A;  4UHT A;  1IUY A;  3PFI A;  2BBY A;  1PDN C;  2HZT A;  3FF5 A;  2OBP A;  2IVM A;  3EET A;  2IA0 A;  2EV5 A;  5DDG A;  1D8J A;  1MGT A;  1S7O A;  1ZRD A;  1I1S A;  3I58 A;  1LQ1 A;  4M9X A;  4YII A;  1I1G A;  4L0Z B;  2ZNY A;  3HSE A;  3FMR A;  1MDM A;  1GHC A;  1TQI A;  5AIP A;  1U2W A;  1GXP A;  3SHF A;  4RGU A;  3WTY C;  2OQG A;  4WWC A;  4L5J A;  1YS6 A;  3R60 A;  5J8F A;  5LEJ A;  5DV5 A;  3FX3 A;  3GZ6 A;  5D5X B;  3F6V A;  2V9V A;  4A0Z A;  5DCM A;  1ZG3 A;  2YX4 A;  5JVT A;  4UV9 A;  1L0O C;  2D2W A;  2YPR A;  2GQQ A;  2W57 A;  1REP C;  1JGS A;  2GZW A;  4R79 A;  2EFN A;  3TO7 A;  2O6G E;  4O3M A;  4ZYE A;  3GO5 A;  2Q0O A;  4EJO A;  4Q48 A;  5LLQ A;  1XN7 A;  3B73 A;  4A5N A;  3ULQ B;  3HHG A;  4CYD A;  4GGG A;  3BJO A;  4UVA A;  3F8N A;  1I27 A;  5KVR A;  3V7C A;  3L9F A;  3HYI A;  3WTU C;  3CLO A;  2EA4 A;  2L01 A;  3QU6 A;  4CGZ A;  4KIG A;  2L4A A;  1KQ0 A;  2FF4 A;  2LF7 A;  3H92 A;  2LDU A;  2K4J A;  1IF1 A;  1Q1H A;  3T5X A;  1QGP A;  2G7H A;  1TNS A;  1MJA A;  3LFK A;  4O6J A;  4ZZD A;  4LMY A;  1OPC A;  1U5T C;  4A5M A;  3KP7 A;  3HRM A;  4HA8 A;  1QZY A;  4EGZ A;  3ZMS A;  4EV0 A;  3MAJ A;  2XAJ A;  2WWY A;  5H6R A;  5LBQ A;  3K9T A;  3MQ0 A;  3QP5 A;  2FBI A;  1LDJ A;  2RV8 A;  2QM3 A;  5D5U B;  3FM5 A;  4B8X A;  4FX0 A;  2STW A;  3KLO A;  2F5F A;  2Z33 A;  1YQA A;  4M73 A;  2EK5 A;  2UZK A;  5CYV A;  3JSO A;  4GYG A;  1J7K A;  4IVN A;  1E17 A;  2YR2 A;  4S04 A;  2MD5 A;  5L3E A;  2XKP A;  5DEQ A;  2ZME A;  4U0Y A;  5BPI A;  4AD9 A;  5K5O A;  1P2F A;  2H94 A;  4ESJ A;  3I5U A;  2DK8 A;  1QPM A;  2P5L C;  3CO7 C;  1TQM A;  3PQK A;  2O03 A;  5H20 A;  2QLZ A;  4P96 A;  3GEZ A;  2M5W A;  4LK0 F;  4M6X A;  2RQP A;  1DPR A;  4HDV A;  4A0X A;  1J2X A;  3LA7 A;  3CJN A;  1ZG5 A;  2IW5 A;  3Q9S A;  4I0B A;  1YTY A;  3L00 A;  5LEK A;  2MA3 A;  4ESF A;  2DLL A;  2OA4 A;  2XIG A;  5DUK A;  4CO8 A;  1FWZ A;  5J6X A;  1FOK A;  1KYW A;  2UXX A;  4B09 A;  3F72 A;  3F3X A;  1Z7U A;  5HOO A;  4OOI A;  4KN4 X;  3WOD F;  2CG4 A;  4HX7 A;  2EA2 A;  1U6G A;  3TO9 A;  4BHC A;  3HTU A;  2FA5 A;  2J5O A;  5E8G A;  5CVJ A;  2DFI A;  3DPT A;  4E70 A;  2FQ3 A;  5ED4 A;  1WKM A;  1SD5 A;  2HQR A;  1SD7 A;  2MH2 A;  2VE8 A;  5LHH A;  2VC1 A;  4ETS A;  3GW2 A;  4G7Z F;  2XV4 S;  4FHT A;  4BQA A;  4KMF A;  2OZU A;  2L3D A;  4RS8 A;  4IXA A;  3SZP A;  2EWN A;  3RI4 A;  4ENK A;  3JTG A;  4R8H A;  1RIO H;  5HS8 A;  4UXN A;  1ONV A;  5D8L B;  1IXR C;  2VON A;  3ECO A;  3G3Z A;  3NRV A;  4WX9 A;  3F8C A;  3BPX A;  1XGS A;  2E7X A;  4HW0 A;  2ADU A;  4LLN A;  2JZY A;  4BHP A;  2BE5 F;  3HIF A;  2NNN A;  4XSZ F;  3M8E A;  3TGN A;  2RC4 A;  2R7F A;  3E3V A;  2UWM A;  2IP2 A;  5F64 A;  3COA C;  2XGX A;  1USS A;  2BEO A;  1PUE E;  3DP7 A;  1KQ8 A;  3HRS A;  4JQF A;  4CHU A;  4PZJ A;  3C3W A;  2R3S A;  2RDP A;  1T38 A;  1H9T A;  1V4R A;  2VBZ A;  4EJU A;  4G6Q A;  2KJB A;  1R00 A;  1GXQ A;  2DU9 A;  3T0Y A;  3S2W A;  1HST A;  3MEX A;  4O5V A;  4RGX A;  2V1U A;  4L18 B;  2RGV A;  4RAY A;  4AIH A;  2PMU A;  3Q9V A;  4D0P A;  4HX8 A;  2XAS A;  2DT5 A;  5ILS A;  1IN6 A;  4EJW A;  1T39 A;  1XCB A;  5HS9 A;  5DCM B;  1XSV A;  3CUQ A;  5AON A;  5LGN A;  4P9F A;  5IT9 K;  1LEA A;  2O0Y A;  3W6J B;  1J75 A;  2IRF G;  5DUI A;  1F1Z A;  4MTE A;  4HQE A;  3IC7 A;  4M9Z A;  3FMS A;  5DYM A;  2HTJ A;  4KIF A;  1LVA A;  2DK5 A;  4HDU A;  5E20 A;  4NQW A;  2NAZ A;  2ELH A;  1SFX A;  3P9I A;  2K4B A;  2K7L A;  1EH8 A;  4HQM A;  3V4G A;  1UST A;  4WF2 A;  3GZ5 A;  1IN7 A;  1B9N A;  4CDG A;  3WGI A;  3DKW A;  1S29 A;  2MBF A;  5E1X A;  2HTS A;  3LA3 A;  3HRU A;  3GFM A;  3WGG A;  1BOA A;  1YW9 A;  2V1D A;  3JAM K;  4Q4Z F;  3J7A O;  1IN8 A;  2GA1 A;  3JAM Z;  2X0L A;  1B6A A;  1BI2 A;  2WTE A;  5BQT A;  4Y13 A;  3QP6 A;  3KEO A;  2EV0 A;  3ELK A;  2VBX A;  4CXF A;  3U1D A;  4OIR F;  5D5W B;  1TW2 A;  4LLG F;  4Q47 A;  4CZZ A;  1J0R A;  2L02 A;  4JK1 X;  1YIO A;  2GA2 A;  2EV6 A;  2PBI A;  3EUH A;  3R4K A;  2PMH A;  1ZN2 A;  1BBY A;  1KYZ A;  2P7C B;  1WWX A;  4RGS A;  3RTR A;  1UFM A;  2ISY A;  4HV6 A;  2RNJ A;  3TDU C;  2P6T A;  4GCV A;  3RKX A;  1FBQ A;  1ZGJ A;  1ZGA A;  3ML6 A;  4GO1 A;  2FNA A;  4ZYH A;  3R0J A;  1D8K A;  3M8F A;  1UHW A;  1XSX A;  2H6B A;  1CF7 A;  3E5X A;  3GFI A;  2VOO A;  2HS5 A;  1BN5 A;  4AIK A;  2NNY A;  4WK8 F;  3K1P A;  2PEX A;  3BY6 A;  5HLI A;  1W7P A;  2DTR A;  2M30 A;  3F23 A;  2P7V B;  2Z3Y A;  2QBY B;  5FO5 A;  2OAZ A;  5LRS A;  4R1H A;  2W84 A;  4ESB A;  3QRF F;  2OZ6 A;  2WC2 A;  4OIP F;  3WTW C;  1LB2 A;  4XRF A;  1ODD A;  3GX4 X;  1WQ2 A;  3JTH A;  5L3F A;  3AAF A;  2ESN A;  4QWQ A;  1ZH5 A;  1Z6R A;  3TDZ C;  3P9K A;  1GVJ A;  3RKY A;  2VT2 A;  1K6O A;  2E1N A;  4L9J A;  1FLI A;  3ZP5 A;  2G7U A;  4LJZ F;  4UUV A;  1YLF A;  1LDK B;  2Y0M A;  1FC3 A;  2COM A;  4N9H A;  1TBX A;  4LK1 F;  5L3B A;  2K02 A;  1R22 A;  1U5T B;  2HR3 A;  2AS5 F;  4MEX F;  3GLX A;  2XAH A;  1W5T A;  2PFB A;  2C6Y A;  4BHB A;  3FHZ A;  2HDC A;  3K69 A;  3KE2 A;  4OMY A;  3GF2 A;  4WCG A;  3F8F A;  3EQL F;  4M74 A;  1ZLJ A;  1A04 A;  2YX7 A;  3KP4 A;  1MD0 A;  3LQR A;  4N0B A;  1XDS A;  3ABT A;  3FMQ A;  2FML A;  1L3L A;  5ICG A;  5DD8 A;  4LB5 A;  2XHK A;  3GFL A;  1EH7 A;  1BI3 A;  1TLH B;  4OIO F;  2VN2 A;  3OV8 A;  1E2X A;  4IRI A;  2FSW A;  5CLS A;  3T8T A;  5CJ9 A;  3RKW A;  3HSF A;  3MZY A;  3C1D A;  3G73 A;  1RUO A;  3EYY A;  3I4P A;  4EVI A;  1ZAO A;  4H0E A;  5FLX K;  1YO5 C;  1RI7 A;  1T2K A;  5LHI A;  1WRJ A;  2PN6 A;  4G94 A;  4ON0 A;  5FLX Z;  4U0W A;  3O3K A;  1IRG A;  3ZPL A;  2LSO A;  1XGM A;  3FXR A;  4BH9 A;  4YIF A;  2JPB A;  3F21 A;  2A5Y B;  3I54 A;  2Q8K A;  2KJC A;  3MWM A;  3T1B A;  1Z91 A;  4EMS A;  1G3W A;  2EB7 A;  1J5Y A;  2JPC A;  3JW4 A;  3CUO A;  1PP7 U;  4IF4 A;  4Y15 A;  4I0A A;  1FY7 A;  2XRO A;  3LAP A;  1S7A A;  2J5P A;  3WGH A;  4HLY A;  4NHJ A;  4Q5S F;  4G9Y A;  3ZN0 A;  4KYW A;  1SD4 A;  5HVQ C;  3TO6 A;  1R36 A;  5IT3 A;  3RPU A;  5BMZ A;  2VC0 A;  4M72 A;  2LNB A;  4MHG A;  5H6Q A;  2VBY A;  3LWF A;  2M1B A;  3C18 A;  3WTT C;  2QWW A;  4QLC U;  4PDK A;  3PQJ A;  3SXY A;  3I59 B;  3CUQ B;  1XCV A;  4I2O A;  2HWV A;  2LKP A;  1DUX C;  5D6E A;  4YFK F;  4OMZ A;  1B59 A;  2XKO A;  3I53 A;  1J59 A;  3F8B A;  5A2Q K;  5EEG A;  3J81 K; 
#chains in the Genus database with same CATH topology
 5IYD J;  4BQO A;  5A2Q Z;  5GTI C;  2CQQ A;  3J81 Z;  1HW2 A;  1MMA A;  2XSD C;  2JVG A;  1FPQ A;  1R1U A;  2X6W A;  2XAQ A;  3E6D A;  4KIT B;  3HOS A;  2NVQ J;  5FGM A;  4EQQ A;  5J1R A;  3CUQ C;  1KGS A;  4NQW B;  4XSX F;  1VQP I;  2L0K A;  4BAC A;  3JRF A;  4XOR A;  4XNF A;  3TOA A;  3EDP A;  2NRA C;  2RVC A;  3SFI A;  3HOT A;  1X3Z B;  1UJ8 A;  4PJL A;  1XMX A;  3E5U A;  3QPT A;  2M3A A;  5GPA A;  3VOD A;  4ASN A;  4KT6 A;  4BE0 A;  3F22 A;  2AXT C;  2K27 A;  5HDN A;  4PCQ A;  1WHU A;  3BDD A;  1TWH J;  2CW7 A;  4NC8 A;  5J4V A;  2BY0 A;  4AYB A;  2WA0 A;  2QQB A;  3LSJ A;  3M7G A;  3HUG B;  4JX4 A;  3WE3 A;  1R23 A;  4IEJ A;  3FDY A;  2A68 F;  3HG9 A;  3L2C A;  1VQ8 I;  1HF0 A;  5HLG A;  2NYX A;  1NH3 A;  3EUK L;  3FBI B;  2IXS A;  1V54 H;  2CW8 A;  2VAS A;  3K2Z A;  1B1B A;  5HNH A;  3F8M A;  4C30 A;  3FKJ A;  2X48 A;  2D5V A;  4BXX J;  1XMA A;  1IJW C;  4LIV A;  4IHT A;  2JJ7 A;  2GAU A;  3W2A A;  3HGY A;  1ZKG A;  4RMN A;  2P6S A;  2HYG D;  1D1B A;  3O8H A;  3DFG A;  4M3F A;  3WU0 A;  4XID A;  4Y4R A;  1W4M A;  5LHG A;  1Z6T A;  2QZ8 A;  3H0G J;  1UZC A;  5JHU A;  4F52 A;  1VQ7 I;  3WTX C;  5ICF A;  2X6X A;  5HDK A;  4UNO A;  2DQL A;  4L9N A;  3CLQ A;  2BVM A;  2L54 A;  3QAH A;  5FKN A;  1FBU A;  5EG0 B;  3ZOB A;  3FIS A;  1OCZ H;  5CVV A;  4LIU A;  2CUE A;  3GFJ A;  4KT5 C;  1GV2 A;  2CO5 A;  4U7D A;  1LDD A;  2M8E A;  3OYF A;  2I5U A;  2HVS A;  4BXU A;  4RA2 A;  1WSU A;  2PI0 A;  2WB1 A;  3H9G A;  5FD5 A;  2HDW A;  3H9J A;  2F2E A;  3GCM A;  3OIP A;  4LFU A;  4UV8 A;  4AWX B;  4CYC B;  1ETV A;  3LA2 A;  2MW8 A;  2OD5 A;  2LP0 A;  3GWZ A;  4WXC A;  1O3Q A;  3DF8 A;  2BV6 A;  2WV0 A;  3OY9 A;  2ETH A;  1W36 D;  2HKX A;  4U7B A;  2PMZ N;  2Y30 A;  3CCM I;  2OCE A;  1CF7 B;  4YFN F;  2K3F A;  2L5Q A;  3DEU A;  4G12 A;  4F91 B;  5K5Q A;  3REO A;  1KA8 A;  3ZQQ A;  2ZSH B;  2F5D A;  3DU6 A;  1F9N A;  4CCL A;  4DBQ A;  3OYM A;  1G4D A;  1TNT A;  1PP8 F;  4M6Y A;  3CDI A;  1FYL A;  3MKL A;  3B6A A;  1QRY A;  4HAM A;  1N75 A;  2BY1 A;  3DXJ F;  2ZJ2 A;  1YYV A;  2R93 J;  5C4X J;  1IRZ A;  3TL4 X;  1W7P B;  2A69 F;  2VI6 A;  1SMT A;  3B02 A;  3H5R A;  1OYY A;  1VQM I;  3WTS C;  2QA4 I;  1STZ A;  1MDM B;  1R5H A;  3OOU A;  3GZN B;  2BGC A;  4BGD A;  2JVH A;  3ZQH A;  3OL4 A;  2BW3 A;  4PSW A;  2QSH X;  3S32 A;  3FIW A;  2PJP A;  3CCR I;  1HQC A;  1K79 A;  3Q5F A;  2V7F A;  2HOA A;  3A01 B;  2EFO A;  3FM3 A;  1T6S A;  1X4O A;  2XF7 A;  1ZRC A;  2ZB9 A;  4A6E A;  1IN4 A;  2KIQ A;  3Q0U A;  1C0W A;  3SZT A;  1MBG A;  1QNT A;  2H1L A;  2ZCW A;  1TTY A;  1OMI A;  2XVC A;  4PGG A;  4ZH4 F;  2AXL A;  2JWT A;  5IOZ A;  1ETK A;  3IKT A;  2TDX A;  4CCN A;  2K9N A;  1JKR C;  1B72 B;  2O61 A;  1U3E M;  1N78 A;  2OC6 A;  1Z05 A;  1IV6 A;  2LR8 A;  3KCC A;  1QO0 D;  4MQV A;  2Y75 A;  1ETY A;  5E3L A;  2DBB A;  2DFH A;  4BDY A;  2NXN B;  1EV7 A;  1Z1D A;  3GUD A;  5DTD A;  3IL2 A;  2KRF A;  1S9H A;  2ZO4 A;  1LVK A;  4XK4 A;  4PUS A;  3LL7 A;  4E7H A;  1BC7 C;  4HOB A;  4X1E A;  3VYR B;  4A3J J;  3BCA A;  2Y48 A;  3VFZ A;  2EFW A;  4M9S A;  4G7O F;  3H36 A;  3HHH A;  1MH3 A;  3IWF A;  3L2W A;  2DA2 A;  2K9Q A;  3TP3 A;  1OR7 A;  1MNE A;  3L7W A;  5KAI C;  2CGP A;  5FRN A;  1U8R A;  2ZBK A;  3ZQ7 A;  4BNC A;  2KL4 A;  2X4H A;  1ETX A;  2MLK A;  3E6B A;  3M9A A;  5IYB J;  2ACJ A;  1VQN I;  2IS4 A;  1W0U A;  1F36 A;  4DNC A;  2XSJ C;  3V8K A;  3DTI A;  3KX2 A;  1Y0U A;  4II3 A;  1R7J A;  3BLY A;  2NS8 A;  3DBL B;  2FD5 A;  4RB2 C;  4C3H J;  5BPD A;  4BAY A;  2E5N A;  4BY7 J;  1IC8 A;  3CC7 I;  1T98 A;  2HKO A;  4U0V A;  3FKI J;  5EGO A;  4L9V A;  2H6C A;  3BR3 A;  3IRR A;  3O6B B;  3VEP A;  2O8X A;  1D5V A;  2HEO A;  4A6D A;  2WV1 A;  4EEF G;  3BR1 A;  1WVR A;  3WU2 C;  3HTS B;  1NG7 A;  1A6I A;  1XDU A;  4MLO A;  1X1C A;  1PYV A;  2B7E A;  1R5G A;  4MNU A;  2DAO A;  2GXA A;  2FXA A;  2VBW A;  4RAZ A;  1FP2 A;  1N25 A;  3ROU A;  4CH7 A;  1X58 A;  3FXQ A;  1T0F A;  2R7W A;  4N9I A;  1HDD C;  3RJP A;  2KKO A;  1MMN A;  1OKR A;  1IW7 F;  3TKY A;  1ULY A;  4U88 A;  1HXD A;  1R49 A;  3ZMD A;  1EJ9 A;  3BJA A;  2DYR H;  4E7I A;  1R1V A;  4GRI A;  5JHF A;  2JSC A;  4EGY A;  3S17 J;  1UCR A;  4XR6 A;  3QPS A;  2NS0 A;  3KEQ A;  2EIL H;  1LFP A;  1YW7 A;  1QBJ A;  3R6S A;  2K3P A;  1IRX A;  3K4B A;  2CWE A;  1X2M A;  5H2F C;  3K4M A;  4BU2 A;  2PG4 A;  1HW5 A;  3HOX J;  1K4S A;  3L09 A;  2HU9 A;  3OSG A;  1VQL I;  2R7V A;  2VOP A;  1LUJ B;  2DI3 A;  2XUB A;  3NWS A;  2JTV A;  5EZG A;  1T56 A;  3K0L A;  4X0G A;  1BIA A;  2TCT A;  3ZMU A;  4PGH A;  4BJT A;  1GV5 A;  4XBF A;  3H3U A;  3SFZ A;  2X85 A;  1FOY A;  3SEZ A;  1E3O C;  1S8N A;  2FQ4 A;  1V5E A;  3S3M A;  4ZTF A;  3CO6 C;  2MC3 A;  3WG9 A;  1BI1 A;  2YU3 A;  1BW5 A;  3U9G A;  1A5J A;  1BOB A;  2KMU A;  2P81 A;  4P55 A;  3ZRG A;  4HF2 A;  2M87 A;  2E2J J;  2ZKZ A;  4C3I J;  1Z3Y A;  2M2E A;  3JR9 A;  4F7Z A;  2IAI A;  2VE9 A;  1Y0N A;  4FQG A;  3GTQ J;  1IRF A;  4RGR A;  3TOB A;  2K9M A;  1RZ4 A;  4XM3 A;  2BYV E;  2E34 A;  3HSR A;  1Y6I A;  2FRH A;  1I5Z A;  2Z9O A;  2XB0 X;  4JBA A;  2ZME B;  3L1P A;  1HSJ A;  1YG2 A;  4I6Z A;  1G3Y A;  3C7J A;  1MIJ A;  3HOV J;  2I8D A;  4EM0 B;  1KU7 A;  4D5F A;  1FEX A;  4MFD A;  2ELJ A;  4CZC A;  3A02 A;  4XLF A;  1FX7 A;  3BTJ A;  3S15 J;  3R0A A;  4K2E A;  2M7B A;  1DP7 P;  4KDP A;  3EPZ A;  3OMY A;  3CDL A;  3VSL A;  4MQ9 F;  2LFB A;  1Z7L A;  2ME6 A;  2A3S A;  1B8I B;  5EEH A;  3CC4 I;  1XB4 A;  2A07 F;  5ILU A;  1IN5 A;  3F6O A;  4V2F A;  4H4K C;  1XS9 A;  4A3D J;  4I02 A;  3J7A Y;  3DV8 A;  2GLO A;  4LG0 A;  4RLQ A;  4LB6 B;  4BY1 J;  3M3Y J;  3K70 C;  2QF7 A;  4IRG A;  2W1O A;  4EM1 A;  2E60 A;  5ERI A;  5C3E J;  3LSP A;  2B63 J;  1HKT A;  3OYH A;  2A6E F;  1SFU A;  1X1A A;  1ZLK A;  4CIC A;  1QA6 A;  2LTP A;  2FMY A;  3D5L A;  4E7S A;  5DM7 F;  1MBH A;  1FP1 D;  3QWL A;  3GTG J;  4EM2 A;  1BM9 A;  2D45 A;  3OYJ A;  2M4K A;  3JRC A;  2L2O A;  1UHS A;  2LC2 A;  2RAE A;  2KP6 A;  1OCT C;  5E17 F;  1ETO A;  3KZY A;  5D4R A;  2B9S A;  2IGO A;  4V2G A;  2ZFW A;  1POG A;  3PO3 J;  4YFX F;  4GFB A;  1ZYR F;  1WZ2 A;  2ZNZ A;  1O3R A;  1JXS A;  4KFC A;  3CMA I;  3K1M A;  1FZP B;  4IRH A;  3BZ6 A;  1FMW A;  2D1V A;  2QVO A;  1ZGW A;  4UVB A;  3RQI A;  3OYI A;  3FXO A;  2CQN A;  3K6G A;  2ZXJ A;  3CQZ J;  4ZDP A;  3WE2 A;  4G6D A;  2E19 A;  2LVS A;  3LSI A;  2DW4 A;  4FT8 A;  4BJ6 C;  3OR2 C;  4XKW A;  2HOE A;  3ECH A;  5FJ8 J;  1FTZ A;  3GYH X;  2EZH A;  2ID3 A;  3ZN1 A;  3CMY A;  3SZG A;  1W0T A;  1G3T A;  1TL8 A;  1YIJ I;  2IGK A;  1HKS A;  4MGR A;  1JHF A;  2CUZ A;  4BJ5 C;  1LJ9 A;  1Z77 A;  3SYT A;  5KK1 A;  2JA6 J;  1JJ6 C;  1DPU A;  1YHQ I;  2EFQ A;  2PJR B;  1R58 A;  2LH9 A;  1X1B A;  5BOX A;  1MZB A;  4D1Q A;  1KU3 A;  2EPF A;  3HM5 A;  1JE8 A;  1K78 A;  1O57 A;  3E97 A;  4MTD A;  4KJZ A;  2F4O B;  1Y1W J;  4TV7 A;  4JOM A;  3AG4 H;  4GYI A;  1O7L A;  1D3Y A;  1YIT I;  4S05 A;  1OLT A;  4DJA A;  3W6K B;  4YIR X;  3T8R A;  3KP2 A;  3OOP A;  1S5L C;  3KP6 A;  1XGN A;  1MBF A;  5JFR A;  4UUS A;  3GTO J;  2IJL A;  3IWZ A;  4HNT A;  2JA5 J;  3L2V A;  2V1N A;  2ZXW H;  3VWB A;  2XRL A;  5FFZ A;  3LQQ A;  2B0L A;  3QOP A;  5M5Y J;  1HW1 A;  1SD6 A;  3DBH B;  3NQO A;  1KU2 A;  1MMD A;  4XRM A;  1V55 H;  1WJ5 A;  1ZAR A;  5K1Y A;  4Z2Y A;  3OS1 A;  3JSP A;  1JGG A;  3FWE A;  4ABZ A;  1IO2 A;  2DPU A;  2QYO A;  3J80 K;  4XOP A;  2STT A;  3DTK A;  4HX4 A;  2CJJ A;  3QQA A;  5JR3 A;  3J80 Z;  1MW7 A;  4HV5 A;  2XF5 A;  5LGU A;  4DYR A;  2CV1 A;  1K4T A;  3JRG A;  3JRH A;  1NK3 P;  2IA2 A;  2V79 A;  5IP7 J;  1MJB A;  4HF0 A;  4RB3 C;  2VXD A;  4A0Y A;  2W48 A;  1IZ1 A;  2HVQ A;  1TW3 A;  1D1C A;  1WH5 A;  4RAG A;  2VQH A;  1YS7 A;  4HYE A;  2Z99 A;  5E18 F;  1V3F A;  1ZR4 A;  2XAG A;  1FT9 A;  1VQO I;  2BOL A;  1WJE A;  4A2U A;  4KNY A;  1J9I A;  2OUM A;  2HGC A;  2CFX A;  2W7N A;  3PSF A;  3HOW J;  1QQI A;  2EFP A;  4EJV A;  4PSX A;  1O3T A;  1HC8 A;  3BR2 A;  2OV7 A;  3BJ6 A;  3QPL A;  5HNF A;  1W7P D;  3N97 A;  3KYD B;  2A05 A;  2ME0 A;  2CQK A;  3BP8 A;  2O3F A;  4ZDO A;  1FOW A;  4QIW N;  1YOV B;  4XLE A;  3GME A;  2DMP A;  2FUG 2;  3VYS B;  3MD2 A;  4RB0 A;  1XPX A;  2KIS A;  2PX9 A;  4P1W A;  3CCS I;  3OYK A;  3DLA A;  1ZHF A;  1OCO H;  5CQG A;  3OS0 A;  1BIB A;  4A3F J;  2DMT A;  2P4W A;  2E7W A;  2M45 A;  3N4M A;  2VIX A;  2K5C A;  2KLO A;  1WFX A;  3PNY A;  2JMW A;  2FEZ A;  1UHM A;  2DA7 A;  1LEB A;  3GVA A;  5EEG A;  2BW3 B;  3RPQ A;  1QZZ A;  3DQV C;  4HBL A;  5F27 A;  3S1Q J;  5B3S H;  4I01 A;  2HFH A;  1YJN I;  2O5R A;  3MCZ A;  2QBY A;  1XG1 A;  4XKB A;  3I9V 2;  3HPG A;  1G8X A;  4V19 K;  4NDL A;  4WXH A;  2CRG A;  3ABU A;  2HPM A;  1G3S A;  2LY9 A;  4OIN F;  5FFX A;  5CKT A;  4XN0 A;  2FBK A;  5AIQ A;  2KPM A;  5TIS C;  2DA5 A;  2VKE A;  4D7N A;  4DZP A;  3OYA A;  4PJN A;  2MFZ A;  3V7R A;  5B66 C;  5LFA A;  2LF8 A;  1UG0 A;  2A6H F;  2FBH A;  3G1O A;  9ANT A;  3BQY A;  3BRO A;  3KP3 A;  3CCY A;  2F4M B;  2IPQ X;  4UVC A;  2NVT J;  1LKX A;  3O2P E;  4NNJ A;  2DA6 A;  3WU1 B;  1HA8 A;  3CC2 I;  3M07 A;  4F93 B;  1K7A A;  5EDN A;  4EJT A;  1ON2 A;  2DOF A;  2QEN A;  3HOU J;  1TWC J;  2K86 A;  3RCO A;  1LNW A;  3OL3 A;  1O3S A;  3QPH A;  2UV1 A;  4DQ2 A;  3KEY A;  3QYF A;  1VTN C;  4BBS J;  1YW8 A;  2IBD A;  4X6A J;  1SFE A;  2JRT A;  3J81 K;  1P4W A;  3BWG A;  2LBF A;  3KZZ A;  4KN7 X;  1FBS A;  2Y0S N;  4G6T B;  1G6N A;  2KIF A;  3V8L A;  2FOK A;  2ZJQ F;  1B4A A;  2Y0S A;  4OU0 A;  3CF2 A;  3DPL C;  3RDI A;  4LD5 A;  2WAD A;  1JUM A;  4W1U A;  4GXO A;  1IXC A;  4P5O A;  4IHY A;  1U5T A;  4YG2 F;  2M4G A;  4KA4 A;  2DCE A;  4M71 A;  2V1X A;  5EGO B;  2H09 A;  3RYP A;  3NWT A;  2VJ5 A;  2XAF A;  3H3Z A;  2KRH A;  3I71 A;  4B43 A;  1OR7 C;  2L9V A;  1R6R A;  2X1D A;  2CYY A;  3BG7 A;  3PNV A;  4I7H A;  3G1L A;  5K5R A;  1ZG1 A;  1JT0 A;  2A6T A;  1TT5 B;  2JUG A;  1SC7 A;  2A61 A;  5LRR A;  2L9R A;  3HGG A;  3L2U A;  3RYR A;  1OQY A;  4UUT A;  2FU4 A;  2OU2 A;  2COB A;  2GIV A;  2LRD A;  4MEY F;  5FB2 A;  1KQ9 A;  1OCR H;  3S3O A;  2MGQ A;  3RKQ A;  3IH4 A;  3IRQ A;  2YU9 J;  1DU0 A;  3WTZ A;  5D8K B;  1R1T A;  5CVU A;  2KDO A;  2Y31 A;  4YEJ A;  4LGW A;  4LIT A;  4DZJ A;  3LST A;  2KIU A;  5F1R A;  2TRT A;  1ON1 A;  4AUX A;  2P0W A;  2E1O A;  2L4M A;  1TWG J;  1YFH A;  5J3L A;  3ISP A;  4ENJ A;  2CU7 A;  2CSO A;  4Y7N J;  5TJJ A;  1OYW A;  4ZZL A;  2Q2E A;  1BC8 C;  3TED A;  2K9S A;  2P5V A;  5GAH J;  3K1N A;  5E1Z B;  2W24 A;  1RET A;  3DEE A;  2HYF A;  1IGN A;  4L5I A;  1T0F C;  2H8R A;  2DFE A;  3K4K A;  5LGT A;  5E1W A;  2F48 A;  3MFK A;  1WI9 A;  2DOE A;  2V6C A;  3H35 A;  4CUG A;  3CCV I;  3KP5 A;  4Y17 A;  1UG2 A;  3PIO F;  3K2A A;  2Y2Z A;  5DCF A;  2HQ5 A;  3A4C A;  2CH0 A;  1T8I A;  2DA1 A;  3HOZ J;  2EIJ H;  2LOO A;  4I98 B;  3MZH A;  3NEU A;  2G9W A;  3EYI A;  2PQ8 A;  5IPA A;  2VKH A;  2IA1 A;  3LSG A;  3CTA A;  1O7F A;  2E2I J;  2Y9Y A;  3RQ4 A;  4BBR J;  3LOC A;  3WHB A;  3O8G A;  3ZR8 X;  2ELK A;  2VLA A;  1JUP A;  4II2 A;  4FTH A;  3R61 A;  3K70 D;  3QOD A;  4I09 A;  5D6F A;  5L3C A;  1W5S A;  5TRD A;  2VOD A;  4D5C A;  1XD7 A;  3P7N A;  2E1C A;  4HZF A;  2FE3 A;  3S16 J;  3W2W A;  5FKO A;  3PJR A;  2G0E A;  2PMZ A;  4G7H F;  2R5Z A;  1FSE A;  4DYQ A;  3TQN A;  1XGO A;  5FD6 A;  1DQU A;  1K83 J;  4AVP A;  1RKW A;  1HLV A;  3G4S I;  2VT3 A;  3SQN A;  3IKV A;  3ZMT A;  2W85 A;  5C44 J;  2ISZ A;  4J01 A;  1ZQ3 P;  1H9G A;  1UB9 A;  4AIJ A;  2Z5U A;  4ENN A;  3I64 A;  5L3D A;  3BC8 A;  4KUM A;  1AOY A;  1XSD A;  4FX4 A;  4IHS A;  1MKM A;  4G8X A;  2RKH A;  4Y3O A;  1MJ9 A;  1H0M A;  4XMY A;  3V7S A;  4I99 C;  3CP2 A;  1FSH A;  4B48 A;  5FLV A;  3BG9 A;  4LG0 B;  3FXU A;  4BYY A;  2LY2 A;  3E5Q A;  5D4S A;  4L9T A;  2N8G A;  1TQP A;  3FZV A;  4BQN A;  3H9Q A;  2VJI A;  2IT0 A;  3GTL J;  3D0S A;  1JKQ C;  4C3J J;  3BR6 A;  5EYR A;  4IL6 C;  4KIB A;  3V8J A;  1PUF A;  3OYN A;  3QU3 A;  2W25 A;  4ITV A;  5JI6 A;  4A3K J;  4IHW A;  1QHH D;  4MFE A;  2DO7 A;  2F5C A;  4DW6 A;  2X6O A;  2ZXI A;  3IUO A;  3A0B C;  3QOE A;  4JX5 A;  2RN7 A;  4A93 J;  1EH6 A;  4NC7 A;  1JHH A;  3M1E A;  3ZQI A;  5E8I A;  1ZRE A;  4N4O B;  3B6C A;  1RUN A;  4IQJ A;  3JRB A;  2MH9 A;  5CVR A;  2K9L A;  4KMU X;  3OYG A;  2HQN A;  1B9M A;  4IJA A;  3K7A J;  4XLH A;  4A12 A;  2MLG A;  5ILV A;  1Z9C A;  1SAU A;  2M7A A;  3I59 A;  2DT7 B;  3KFW X;  5ICE A;  2HI3 A;  3HZJ A;  2UXN A;  2OF7 A;  2DQR A;  5IT9 Z;  4HLX A;  3ZMZ A;  2CW0 F;  2VJ4 A;  2HZD A;  2QQA A;  2R4G A;  2DXI A;  2VQL A;  3H5N A;  1P6R A;  3BT9 A;  1MMG A;  4ZYG A;  3M8J A;  4ZYD A;  3WG7 H;  1T08 B;  4MO7 A;  1EF4 A;  4F3Q A;  3GBG A;  2FNP A;  2KIM A;  1WH7 A;  4XLP F;  5J40 A;  4DGW B;  4XLN F;  1VQ6 I;  2JT1 A;  3GXO A;  2VPL A;  2R7U A;  4CCJ A;  1OYI A;  2V4J C;  5L3G A;  1FYM A;  5CVI A;  4IOC F;  2XRN A;  2IS1 A;  2QUF A;  1K78 B;  4M3G A;  1DDN A;  2E5Z A;  1P4A A;  1IAW A;  5DD4 A;  4CCO A;  3DBR B;  2DPD A;  1I3Q J;  3E6C C;  1SFO J;  4OIQ F;  2JA7 J;  2QCO A;  3OYL A;  1F5T A;  3HKZ N;  1HKQ A;  1S6L A;  1XMK A;  3BPV A;  1R71 A;  4JP0 A;  1P4X A;  2NOG A;  4ZTJ A;  2OQR A;  1SMY F;  3E6M A;  2OJE D;  3HUG A;  1BI0 A;  3U2R A;  4U87 A;  3S93 A;  1Z3X A;  1P92 A;  3RIR A;  4RDU A;  5KAF C;  2FX0 A;  2H8W A;  3NAU A;  4LG3 A;  1SAX A;  1PVE A;  2DFF A;  4Y52 J;  2PLY A;  3ZCO A;  3WTV C;  2RNG A;  2P5K A;  6PAX A;  1IDY A;  2KFD A;  4NB5 A;  3JRD A;  1KU9 A;  1SEU A;  1IUF A;  2QQ9 A;  5HS7 A;  1I6X A;  3ERE D;  4RB1 A;  2OTL I;  4J19 A;  3BG3 A;  2R7T A;  1S3J A;  3IH3 A;  4A3E J;  3LAJ A;  3BCB A;  3K4J A;  3OR1 C;  3I0T A;  4WXD A;  1M1E B;  3TMO A;  1CGP A;  4KIC A;  2R7D A;  4B44 A;  5GTH C;  2H27 A;  4HF1 A;  2L9S A;  3JRA A;  3IH2 A;  1A31 A;  1FYK A;  3P9C A;  1NK2 P;  2IS6 A;  3AG2 H;  1AU7 A;  1NHA A;  4CSW A;  2VXZ A;  3IHU A;  2HXO A;  3M4O J;  2CUJ A;  3BTC A;  2GWR A;  3X2Q H;  1BJA A;  2YSR A;  4FET A;  2D1H A;  3ZXS A;  4DIQ A;  4P9U A;  5BS6 A;  3VOE A;  1FNN A;  1V5G A;  5EG0 A;  2EJR A;  3VB2 A;  4IPA A;  3KET A;  2DMU A;  3HRT A;  3M1C A;  1R4N B;  1TWF J;  3ZMV A;  2ESH A;  4OAZ A;  2GXB A;  2MAB A;  3CME I;  1IXS B;  3KPH A;  2DOA A;  1X19 A;  1F4K A;  2QEX I;  1ZRF A;  5F6F A;  3I4N J;  5CPR B;  5IOY A;  4HST A;  4IQ4 A;  5IYC J;  2CS3 A;  2FJ1 A;  1HBX G;  1U0J A;  4CYC A;  4LLL A;  1QVT A;  1CQT A;  2GXG A;  5HDG A;  2CQX A;  3I3L A;  2F5E A;  5ICC A;  3RZD J;  2CV2 A;  4HEA 2;  1X3U A;  1X1P A;  3CDH A;  1AWC A;  5D5V B;  2P8T A;  4PK4 A;  2RRE A;  4L0Y B;  3KLN A;  3ZQC A;  1RNL A;  5HLH A;  2I10 A;  4ENM A;  3AFH A;  3BOQ A;  3OIO A;  1GT0 C;  3EUA A;  1MBJ A;  1K61 A;  1U78 A;  3S2H J;  4UHT A;  4NC6 A;  2R5Y A;  1IUY A;  3PFI A;  4IOA F;  3G71 I;  2BBY A;  1IV8 A;  5K7Z A;  2XPW A;  1PDN C;  3D5R C;  3AL0 C;  3QYB A;  2HZT A;  2R7Q A;  3W3C A;  1A35 A;  3FF5 A;  2OBP A;  1HCR A;  2IVM A;  3EET A;  2IA0 A;  2LKX A;  2Z1D A;  3IP4 B;  1QVU A;  2EV5 A;  4E7K A;  2DTZ A;  2QSG X;  2JQ7 A;  5DDG A;  2MSY A;  3U21 A;  5J47 A;  2YS9 A;  1D8J A;  1MGT A;  1S7O A;  1ZRD A;  1I1S A;  3I58 A;  1LQ1 A;  3OS2 A;  2LY1 A;  4M9X A;  3FXK A;  4YII A;  5FKK A;  3BTL A;  1I1G A;  4L0Z B;  4FCY A;  4AID A;  2ZNY A;  4QPQ A;  4A3L J;  3HSE A;  3FMR A;  1MDM A;  2A5W A;  1QZE A;  1GHC A;  1XC5 A;  2EBI A;  4OAY A;  4A3G J;  2NVY J;  1TQI A;  5AIP A;  1JT6 A;  3J7Z I;  3HOY J;  3HC7 A;  5C4J J;  1MMS A;  1U2W A;  1GXP A;  3SHF A;  3CCE I;  4XKC A;  4RGU A;  3WTY C;  1W36 C;  2XPU A;  3K4L A;  2OQG A;  3HBL A;  3FXJ A;  2HPI A;  4WWC A;  4L5J A;  1YS6 A;  2EQR A;  3A01 A;  3R60 A;  5J8F A;  5LEJ A;  2JK3 A;  5DV5 A;  3FX3 A;  2H1K A;  4QTR A;  3GZ6 A;  5D5X B;  3F6V A;  2V9V A;  4A0Z A;  5DCM A;  5B5E C;  2VKD A;  1ZG3 A;  2YX4 A;  3SEQ A;  5JVT A;  2R7Z J;  3FK7 A;  4UV9 A;  2CQ7 A;  4ZC3 A;  1VFC A;  1L0O C;  1WI3 A;  2D2W A;  2YPR A;  4B4C A;  2HOT A;  4Y33 A;  2GQQ A;  2W57 A;  2R7R A;  2WAQ N;  1REP C;  1JGS A;  2GZW A;  4R79 A;  2EFN A;  3TO7 A;  2O6G E;  4O3M A;  4ZYE A;  3GO5 A;  2Q0O A;  2R7S A;  4EJO A;  3I55 I;  4Q48 A;  3BR0 A;  5LLQ A;  1MSF C;  1XN7 A;  2LBF B;  3B73 A;  3C2G A;  4A5N A;  3UKG A;  1LE8 A;  1BR1 A;  3JRI A;  4QSH A;  3ULQ B;  5F0H A;  3HHG A;  4D9J A;  4CYD A;  2GBY A;  4BXF A;  4GGG A;  1Q1V A;  3E0J B;  3BJO A;  4UVA A;  4E7Z A;  3F8N A;  1I27 A;  1YE9 A;  4XON A;  5KVR A;  3V7C A;  5K7F A;  1WCM J;  3L9F A;  3CD6 I;  4B1R A;  3HYI A;  4FAS D;  3WTU C;  2HOS A;  3CLO A;  1T33 A;  2EA4 A;  4BUP A;  1K6Y A;  2L01 A;  3QU6 A;  4A3I J;  4IX7 A;  3KZI C;  1U8B A;  4CGZ A;  4KIG A;  2NVX J;  2L4A A;  4AC0 A;  1KQ0 A;  4UB6 C;  2XAU A;  2FF4 A;  2VL8 A;  2LF7 A;  2QKL B;  3H92 A;  2UUZ A;  1VF9 A;  2LDU A;  2K4J A;  1IF1 A;  1Q1H A;  2R7X A;  3PUF A;  2XB5 A;  4HPQ A;  3T5X A;  1QGP A;  2G7H A;  1TNS A;  1MJA A;  3E1S A;  3LFK A;  4O6J A;  4ZZD A;  1JTX A;  4LMY A;  4C2U A;  1OPC A;  1U5T C;  4LOC A;  3Q0V A;  4A5M A;  1MSE C;  3KP7 A;  3HRM A;  3ZQG A;  4DYC A;  3LSK A;  4HA8 A;  1QZY A;  1TT0 A;  2VQC A;  5E79 C;  4BS9 A;  4PJM A;  4EGZ A;  3ZMS A;  4EV0 A;  3MAJ A;  2XAJ A;  2Q2E B;  2ZSI B;  4D7M A;  2WWY A;  5H6R A;  4BEH A;  2KRC A;  1OIS A;  2XGC A;  3P5J A;  3K10 A;  5LBQ A;  3K9T A;  3MQ0 A;  3J7Y J;  3QP5 A;  3L2R A;  2FBI A;  1LDJ A;  1BA5 A;  2CFO A;  4FIS A;  2RV8 A;  2QM3 A;  5D5U B;  4PJJ A;  2W82 A;  1P7I A;  2ZJR F;  3FM5 A;  1RR8 C;  4B8X A;  3S2D J;  3GTP J;  2AO9 A;  3FBN B;  2BHY A;  2XC7 A;  1OFC X;  4FX0 A;  2STW A;  3KLO A;  2F5F A;  4BDZ A;  5GAD J;  5J1Y A;  3BG6 A;  2Z33 A;  3VPR A;  3LSM A;  2GIZ A;  1YQA A;  4M73 A;  5M5W J;  2E2H J;  1VQK I;  1GDT A;  1EKE A;  2ZFU A;  2EK5 A;  2HXI A;  2R5Z B;  2UZK A;  3S1M J;  1WJA A;  5CYV A;  3PNT A;  3TBI A;  3JSO A;  4GDF A;  4CCK A;  4GYG A;  1J7K A;  4IVN A;  2LYC A;  1E17 A;  2YR2 A;  4S04 A;  1F43 A;  2MD5 A;  1LFB A;  3C2H A;  3UR3 C;  4YEL A;  5L3E A;  2XKP A;  4QPO A;  2EZL A;  5DEQ A;  2ZME A;  4U0Y A;  3CF5 F;  5BPI A;  4AD9 A;  1W1W E;  4F92 B;  1QU3 A;  1Z21 A;  5K5O A;  3BQZ A;  1P2F A;  2H94 A;  1Z0X A;  1UAA A;  1I39 A;  2BHZ A;  4ESJ A;  2Y9Z A;  3I5U A;  2DK8 A;  1QPM A;  2P5L C;  1FJL A;  3CO7 C;  1TQM A;  3PQK A;  1JKO C;  2O03 A;  5GAE J;  3PIP F;  5H20 A;  1B8I A;  2QLZ A;  4P96 A;  1X2N A;  1MH4 A;  3ABM H;  2E1M C;  3GEZ A;  5B1A H;  3CES A;  4PJ0 C;  2M5W A;  3BZK A;  3CZ6 A;  1PUF B;  3A03 A;  4LK0 F;  3VSK A;  4M6X A;  5FLM J;  1AKH A;  3WHC A;  2RQP A;  1Y39 A;  1DPR A;  3BG5 A;  4HDV A;  1A36 A;  4A0X A;  1J2X A;  3LA7 A;  3CJN A;  1ZG5 A;  2M0M A;  3IV5 A;  2IW5 A;  3H0D A;  2LLK A;  1APL C;  3PO2 J;  4E7L A;  5EF6 A;  3MN2 A;  3Q9S A;  5KCM A;  4I0B A;  1YTY A;  3L00 A;  5IP9 J;  5FRO A;  5LEK A;  2L9N A;  2MA3 A;  2WY8 Q;  2RQQ A;  1FMV A;  4ESF A;  1VQ5 I;  2DLL A;  2OA4 A;  2XIG A;  1SVL A;  5DUK A;  1YX3 A;  3GTJ J;  4CO8 A;  1R5I D;  1FWZ A;  5J6X A;  2DT6 A;  1FOK A;  3L2Q A;  1ERD A;  1KYW A;  3LSH A;  4RM3 A;  2UXX A;  3ESW B;  4B09 A;  2CUF A;  3LFU A;  3F72 A;  3F3X A;  1Z7U A;  5HOO A;  2X9D A;  3PL8 A;  4OOI A;  3CCU I;  1H88 C;  3OIQ A;  4KN4 X;  3WOD F;  1ZR2 A;  2CG4 A;  2KZV A;  3DTE A;  4HX7 A;  1MND A;  5GPC A;  2EA2 A;  5F04 A;  1U6G A;  3TO9 A;  4BHC A;  3HTU A;  1RRJ A;  2FA5 A;  2J5O A;  5K7H A;  4DOZ A;  4FE7 A;  5E8G A;  3GLL A;  2WBM A;  5CVJ A;  2DFI A;  3DPT A;  2BY2 A;  1JTY A;  2KHM A;  3LMM A;  2HYJ A;  4E70 A;  5EEA A;  2ECC A;  5ED4 A;  1H8A C;  1WKM A;  3DEW A;  2L7F P;  1SD5 A;  4XRS A;  3AKZ A;  2PJR A;  1JUS A;  4AYB N;  2HQR A;  3MMY B;  3PUB A;  2Y69 H;  5JLX A;  1SD7 A;  3G2B A;  3DKY A;  1GVD A;  2MH2 A;  2VE8 A;  5LHH A;  2VC1 A;  4C2M J;  4ETS A;  3GW2 A;  3TW6 A;  4G7Z F;  2DYS H;  4C9Y A;  1AHD P;  2XV4 S;  1WJF A;  4IZZ A;  4FHT A;  4XN3 A;  4BQA A;  4KMF A;  2OZU A;  1D0Z A;  2BY3 A;  2L3D A;  3DWL E;  3OWT A;  4IXA A;  4RS8 A;  3S8P A;  3SZP A;  4FE4 A;  5F1J A;  1QPI A;  1H89 C;  2EWN A;  3RI4 A;  3ABK H;  1D1A A;  4HRI A;  4ENK A;  2AQE A;  3JTG A;  4R8H A;  1RIO H;  5HS8 A;  1SAN A;  2EZK A;  1KZH A;  4UXN A;  2M8G X;  1ONV A;  2DA4 A;  3DKX A;  5D8L B;  1IXR C;  2DA3 A;  3ERM A;  3ECO A;  3K4N A;  2VON A;  3G3Z A;  1RR7 A;  4IKF A;  1RES A;  3S1N J;  4UY8 I;  4KIS A;  3NRV A;  4WX9 A;  2KDZ A;  4HG2 A;  3F8C A;  1EA3 A;  3BPX A;  1ITY A;  1NG6 A;  1XGS A;  2DJI A;  5J4Y A;  3OYC A;  2O9L A;  1P7J A;  3ABL H;  2E7X A;  1VI0 A;  2ADU A;  4HW0 A;  3S3N A;  4LLN A;  1WJB A;  2JZY A;  2M9H A;  2BVL A;  4BHP A;  2VKV A;  2BE5 F;  3KYL A;  5DM6 F;  4IO9 F;  3HIF A;  4YRV A;  3HXL A;  2NNN A;  3PSI A;  4XSZ F;  3M8E A;  2WB1 N;  3TGN A;  3CP8 A;  2EIM H;  2RC4 A;  2R7F A;  3H5A A;  3CMM A;  1ZEL A;  1TWA J;  3E3V A;  2AHQ A;  2UWM A;  1DU6 A;  2IP2 A;  5F64 A;  4M3B A;  3COA C;  4A3B J;  2XGX A;  2W4S A;  1D5Y A;  1USS A;  2BEO A;  1PUE E;  3DP7 A;  4PFP A;  1DGW Y;  1KQ8 A;  3HRS A;  4DBR A;  3EUH C;  3RPU D;  4JQF A;  4CHU A;  1ZK8 A;  4PZJ A;  2GM4 A;  3C3W A;  2DMQ A;  2R5Y B;  2QQ8 A;  4RAF A;  2R3S A;  2RDP A;  4A3M J;  1TZL A;  1T38 A;  1VND A;  5TGT A;  3W2V A;  1H9T A;  1V4R A;  1J09 A;  1U9O A;  2DDA A;  4BQQ A;  2VBZ A;  1OCP A;  2NVU B;  4EJU A;  4S0H B;  1Y56 A;  1YRN A;  4G6Q A;  2KJB A;  3ZGK A;  1NTC A;  1R00 A;  2R92 J;  2V9P A;  4IHV A;  1GXQ A;  2DU9 A;  3T0Y A;  1TC3 C;  4I76 A;  3S2W A;  1HST A;  3MEX A;  4O5V A;  4RGX A;  4B47 A;  2V1U A;  4L18 B;  2RGV A;  4RAY A;  4AIH A;  2YUS A;  2LKS A;  5CQE A;  2ICW G;  2PMU A;  3Q9V A;  5M5X J;  4D0P A;  4HX8 A;  2CV0 A;  2XAS A;  3HPH A;  2DT5 A;  5ILS A;  1IN6 A;  3UNG C;  4EJW A;  2HQA A;  2X6Y A;  3ASN H;  4B3A A;  1T39 A;  1VQ4 I;  1XCB A;  1WPK A;  3E7L A;  3CCL I;  1IG7 A;  5HS9 A;  5DCM B;  1XSV A;  3CUQ A;  5AON A;  5LGN A;  4P9F A;  2HDD A;  3A2K A;  1A6Q A;  2ZC2 A;  5IT9 K;  1DGR M;  1LEA A;  2QGU A;  2O0Y A;  3W6J B;  3MKZ A;  1J75 A;  2V6E A;  1X1D A;  2JSP A;  2IRF G;  5DUI A;  1F1Z A;  2MG4 A;  4MTE A;  2DJN A;  3C2B A;  4HQE A;  3IC7 A;  2XPV A;  4M9Z A;  3FMS A;  5DYM A;  2HTJ A;  1E0E A;  1G59 A;  3KYC B;  4KIF A;  1LE8 B;  1LVA A;  1P9Q C;  1S7E A;  2DK5 A;  1OCC H;  4HDU A;  5E20 A;  4NQW A;  2JN6 A;  1JJ8 C;  3F9K A;  2F5V A;  2NAZ A;  1S72 I;  2ELH A;  2CMP A;  1G2H A;  5LD2 C;  3AG1 H;  1SFX A;  3P9I A;  1TP4 A;  2K4B A;  2K7L A;  5B1B H;  1EH8 A;  4HQM A;  3V4G A;  1UST A;  3SDG A;  3F0C A;  3A1Y A;  4WF2 A;  3GZ5 A;  1IN7 A;  1B9N A;  1V5F A;  3MKY B;  3JCU C;  5F0F A;  3HKZ A;  4CDG A;  2IEK A;  2KQR A;  2VJJ A;  3WGI A;  3DKW A;  3K4C A;  4UUS B;  2LRE A;  1S29 A;  2MBF A;  2VQG A;  1DP3 A;  5E1X A;  2HTS A;  1VQ9 I;  3LA3 A;  3HRU A;  3GFM A;  3WGG A;  4AU7 A;  1E3H A;  2LD5 A;  5E3O A;  1BOA A;  2IS2 A;  5JVG F;  2XF6 A;  1YW9 A;  3JRE A;  1R9T J;  5IP6 A;  1AA7 A;  2E36 A;  2V1D A;  2L7K A;  3JAM K;  4Q4Z F;  1PJR A;  3J7A O;  3OYD A;  2JRM A;  2EZI A;  1IN8 A;  2GA1 A;  3JAM Z;  2X1E A;  5M3F J;  3W6V A;  1JKP C;  1O4X A;  5F08 A;  2X0L A;  1B6A A;  3Q3S A;  1BI2 A;  2WTE A;  5BQT A;  4Y13 A;  4BEH B;  3CJR B;  2O8K A;  2DDB A;  3QP6 A;  3ZQF A;  3KEO A;  3OYE A;  2EV0 A;  3ASO H;  3HEF A;  4CCM A;  3ELK A;  2VBX A;  4CXF A;  4PFO A;  5BNG A;  1ORK A;  3U1D A;  4OIR F;  5D5W B;  1YJW I;  3S1R J;  3KIO A;  1TW2 A;  4LLG F;  4Q47 A;  3BR5 A;  4W97 A;  4CZZ A;  1J0R A;  2L02 A;  2Q1Z B;  4XL9 A;  4JK1 X;  3SJM A;  1YIO A;  3GTK J;  1WGX A;  2GA2 A;  4AVZ A;  2EV6 A;  4ANJ A;  2PBI A;  4MIM A;  4XKV A;  3EUH A;  3R4K A;  5GAG J;  5IY5 H;  1GLN A;  2PMH A;  3I56 I;  1ZN2 A;  2O7O A;  2KZG A;  1BBY A;  1R4M B;  1KYZ A;  2EIK H;  2P7C B;  4XQF A;  1WWX A;  4RGS A;  4M3E A;  2K40 A;  1UFM A;  3RTR A;  2ISY A;  4HV6 A;  2IGN A;  2RNJ A;  2P6T A;  4GCV A;  4ZYA A;  3RKX A;  3TDU C;  4E6K G;  3AL0 B;  2VPR A;  2EH3 A;  5GP9 A;  3LNQ A;  2XGE A;  1FBQ A;  1ZGJ A;  1D0Y A;  1ZGA A;  3IAM 2;  2NS7 A;  1W5C C;  2V9K A;  3A0H C;  3ML6 A;  4GO1 A;  2FNA A;  2M0C A;  4ZYH A;  3R0J A;  4M3D A;  3U1K A;  2HNH A;  2KT0 A;  1D8K A;  4CA0 A;  5F0C A;  1SVO A;  3MKW B;  3M8F A;  1UHW A;  1XSX A;  2H6B A;  1CF7 A;  3E5X A;  3GFI A;  2VOO A;  2HS5 A;  1BN5 A;  1Y8R B;  1BJZ A;  4AIK A;  2NNY A;  2X1C A;  4WK8 F;  3K1P A;  2NOJ B;  2ECB A;  2DOD A;  1Z67 A;  1ZTR A;  2L7M P;  2PEX A;  3TP0 A;  3BY6 A;  2OPT A;  5HLI A;  3I4M J;  3CJT B;  1W7P A;  1X4P A;  2DTR A;  2M30 A;  3F23 A;  2P7V B;  2Z3Y A;  5EJC A;  1YJ9 I;  3GTM J;  2W00 A;  2QBY B;  1RPW A;  5FO5 A;  2GOM A;  2QSF X;  2OAZ A;  1Y8Q B;  1AKH B;  2R0Q C;  5LRS A;  1MNM C;  1I3A A;  1FIP A;  4R1H A;  2X51 A;  2W84 A;  4ESB A;  2ZME C;  3QRF F;  2AQF A;  1D0X A;  2OZ6 A;  1LPQ A;  2WC2 A;  3TW7 A;  4OIP F;  3WTW C;  1LB2 A;  3DPU A;  2E71 A;  4XRF A;  3N05 A;  1ODD A;  3GX4 X;  1WQ2 A;  5J1U A;  3JTH A;  5L3F A;  2Z16 A;  3AAF A;  4F55 A;  2ESN A;  4QWQ A;  1ZH5 A;  3PFY A;  2BZT A;  1Z6R A;  3TDZ C;  4M6V A;  3P9K A;  2XGD A;  1B72 A;  1GVJ A;  2MD0 A;  3IAS 2;  3G1M A;  4JYK A;  3RKY A;  2VT2 A;  1K6O A;  2E1N A;  4L9J A;  1FLI A;  2WAQ A;  4XOT A;  3CCJ I;  3DU5 A;  3ZP5 A;  2G7U A;  4LJZ F;  3AG3 H;  4UUV A;  4RM2 A;  3OYB A;  4XIC A;  1YLF A;  1SFK A;  1BR4 A;  4NBQ A;  1LDK B;  2MC4 A;  2Y0M A;  3VDX A;  1FC3 A;  2COM A;  4N9H A;  1UMQ A;  1TBX A;  4ZDL A;  4LK1 F;  5EZH A;  2K02 A;  5L3B A;  1R22 A;  1KON A;  3QYE A;  1U5T B;  2HR3 A;  1WJD A;  1HOM A;  3HJE A;  2AS5 F;  4UB8 C;  4MEX F;  3FXM A;  3ZQL A;  3GLX A;  4BE2 A;  1RC9 A;  5E3N A;  2M34 A;  1W5T A;  2XAH A;  2PFB A;  2C6Y A;  4BHB A;  3FHZ A;  2R7O A;  2HDC A;  1MBK A;  3D1N I;  1YX5 A;  3K69 A;  3KE2 A;  4OMY A;  3GF2 A;  1ENH A;  4WCG A;  3F8F A;  3FK6 A;  3EQL F;  4M74 A;  1ZLJ A;  5DS9 A;  2OTJ I;  3G6E I;  1A04 A;  2YX7 A;  3KP4 A;  1MD0 A;  4RBO A;  3H3V K;  3SDB A;  3LQR A;  1XX5 A;  4N0B A;  1XDS A;  2ZJP F;  1X3W B;  3ABT A;  3FMQ A;  3VYU B;  2FML A;  1L3L A;  1ACI A;  1QHG A;  4BKX A;  5ICG A;  2FOW A;  2BXY A;  2MYS A;  5DD8 A;  4AM3 A;  3Q0W A;  4LB5 A;  2XHK A;  2ID6 A;  1EH7 A;  2VB6 A;  1BI3 A;  3GFL A;  1BW6 A;  1TLH B;  4OIO F;  2VN2 A;  3OV8 A;  1E2X A;  4IRI A;  3MZ8 A;  3H1C A;  4A3C J;  2DN0 A;  2FSW A;  5CLS A;  5E3M A;  3T8T A;  5CJ9 A;  5KNL A;  3PM1 A;  1VZ0 A;  5HLT A;  1RKT A;  3HB9 A;  3RKW A;  3NAR A;  3HSF A;  2LK2 A;  3MZY A;  4RLF A;  3C1D A;  3G73 A;  1RUO A;  4EAT A;  1E3P A;  2HVR A;  3EYY A;  2LMD A;  3I4P A;  1XTA A;  1UEL B;  1MBE A;  4EVI A;  1ZAO A;  2OCC H;  3ONQ A;  1I50 J;  2VUM J;  4H0E A;  5FLX K;  1YO5 C;  5M3M J;  3HDD A;  1RI7 A;  1T2K A;  4HNU A;  5LHI A;  1WRJ A;  2PN6 A;  1HDP A;  4BL0 B;  4G94 A;  1GUU A;  4ON0 A;  5FLX Z;  3DCF A;  4U0W A;  3O3K A;  4Z6Y A;  2JA8 J;  1IRG A;  3ZPL A;  1LFU P;  2LSO A;  2QKM B;  1XGM A;  3FXR A;  4BH9 A;  4YIF A;  2JPB A;  1ETQ A;  3F21 A;  2A5Y B;  3I54 A;  3MVP A;  4NUB A;  1BR2 A;  3V42 A;  2Q8K A;  2KJC A;  5JLW A;  3MWM A;  3T1B A;  1Z91 A;  4EMS A;  5KHD A;  4ZJZ A;  1G3W A;  2EB7 A;  3BZC A;  4N4N B;  1FIA A;  1J5Y A;  2JPC A;  3JW4 A;  3CUO A;  3HL2 A;  4HSR A;  1YI2 I;  3RZO J;  4C2T A;  1PP7 U;  1IDZ A;  4IF4 A;  4J00 A;  3LSR A;  4Y15 A;  2E1M B;  4I0A A;  1FY7 A;  2XRO A;  2LG4 A;  3LAP A;  3CCQ I;  1S7A A;  1OJL A;  1Y1V J;  2J5P A;  3D5S C;  3WGH A;  2IGM A;  4BE1 A;  2GOX B;  2JUC A;  3OSF A;  4HLY A;  4NHJ A;  4Q5S F;  4G9Y A;  5HOD A;  2EIN H;  1YRN B;  3BTI A;  2ZXH A;  4E7J A;  3ZN0 A;  1FOX A;  2JA2 A;  3RSN A;  4KYW A;  5FRM A;  1SD4 A;  4B3X A;  1FTT A;  2DMN A;  5HVQ C;  3FHN A;  3TO6 A;  2BXZ A;  2WY7 Q;  2V26 A;  2K85 A;  1R36 A;  2XDV A;  5IT3 A;  3RPU A;  4E4H A;  3CJQ B;  2Z2S B;  1T95 A;  5BMZ A;  4XRS G;  2VC0 A;  4JX6 A;  4M72 A;  2LNB A;  5FKL A;  1U9N A;  4MHG A;  5H6Q A;  2VBY A;  3LWF A;  2F6C A;  2M1B A;  3C18 A;  3WTT C;  1SVM A;  1WJC A;  1N77 A;  2QWW A;  4QLC U;  4PDK A;  3PQJ A;  3FXL A;  3SXY A;  3I59 B;  2WAE A;  3CUQ B;  4OWR B;  2E35 A;  1JI8 A;  4HNV A;  3DLL F;  1XCV A;  1ETW A;  2WAF A;  4I2O A;  2F4I A;  2HWV A;  2LKP A;  1DUX C;  5D6E A;  4YFK F;  4IHX A;  4OMZ A;  4XLC A;  1B59 A;  4A69 C;  2L7Z A;  2XKO A;  3I53 A;  3VYT B;  1J59 A;  3S14 J;  1I6H J;  3F8B A;  1BL0 A;  5FKM A;  4XLA A;  5A2Q K;  4L5E A;  2FQ3 A;  5J8C A; 
#chains in the Genus database with same CATH homology
 5A2Q Z;  1HW2 A;  3J81 Z;  1FPQ A;  1R1U A;  2XAQ A;  3E6D A;  3HOS A;  5FGM A;  4EQQ A;  3CUQ C;  1KGS A;  4XSX F;  3TOA A;  3EDP A;  2NRA C;  2RVC A;  3HOT A;  3VOD A;  3E5U A;  3QPT A;  4ASN A;  3F22 A;  2K27 A;  5HDN A;  4PCQ A;  3BDD A;  2QQB A;  3M7G A;  3WE3 A;  1R23 A;  2A68 F;  3L2C A;  5HLG A;  2NYX A;  3K2Z A;  1B1B A;  3F8M A;  1XMA A;  4IHT A;  2GAU A;  2P6S A;  2HYG D;  3DFG A;  3WU0 A;  1W4M A;  5LHG A;  1Z6T A;  2QZ8 A;  5JHU A;  3WTX C;  5ICF A;  5HDK A;  4UNO A;  2DQL A;  4L9N A;  2L54 A;  3QAH A;  1FBU A;  5CVV A;  3GFJ A;  4KT5 C;  2CO5 A;  4U7D A;  1LDD A;  2M8E A;  4BXU A;  1WSU A;  2PI0 A;  5FD5 A;  2F2E A;  4LFU A;  4UV8 A;  4AWX B;  3LA2 A;  2OD5 A;  3GWZ A;  4WXC A;  1O3Q A;  3DF8 A;  2BV6 A;  2WV0 A;  2ETH A;  2HKX A;  4U7B A;  1CF7 B;  4YFN F;  3DEU A;  5K5Q A;  3REO A;  1KA8 A;  2F5D A;  1F9N A;  1G4D A;  1TNT A;  1PP8 F;  4M6Y A;  1FYL A;  4HAM A;  3DXJ F;  2ZJ2 A;  1YYV A;  1W7P B;  2A69 F;  1SMT A;  3B02 A;  1OYY A;  3WTS C;  1STZ A;  1MDM B;  1R5H A;  2BGC A;  2PJP A;  1HQC A;  1K79 A;  3Q5F A;  2EFO A;  3FM3 A;  1T6S A;  1ZRC A;  1C0W A;  4A6E A;  1IN4 A;  3SZT A;  1QNT A;  2ZCW A;  1TTY A;  1OMI A;  2XVC A;  4PGG A;  4ZH4 F;  2AXL A;  3IKT A;  2TDX A;  2O61 A;  1U3E M;  1Z05 A;  3KCC A;  1QO0 D;  4MQV A;  2Y75 A;  2DBB A;  1EV7 A;  1Z1D A;  3GUD A;  3IL2 A;  2KRF A;  2ZO4 A;  1BC7 C;  4HOB A;  2Y48 A;  3VFZ A;  2EFW A;  4M9S A;  4G7O F;  3HHH A;  3IWF A;  1OR7 A;  3L7W A;  2CGP A;  1U8R A;  2ZBK A;  3ZQ7 A;  4BNC A;  2X4H A;  3E6B A;  2MLK A;  3M9A A;  2ACJ A;  4DNC A;  3V8K A;  1Y0U A;  1R7J A;  4RB2 C;  5BPD A;  4BAY A;  1T98 A;  2HKO A;  4U0V A;  4L9V A;  2H6C A;  3IRR A;  3O6B B;  3VEP A;  2O8X A;  1D5V A;  2HEO A;  4A6D A;  3HTS B;  1XDU A;  4MNU A;  1R5G A;  2DAO A;  2FXA A;  2VBW A;  4RAZ A;  1FP2 A;  3ROU A;  3FXQ A;  1T0F A;  4N9I A;  3RJP A;  2KKO A;  1OKR A;  1IW7 F;  3TKY A;  1ULY A;  4U88 A;  1HXD A;  3ZMD A;  3BJA A;  1R1V A;  2JSC A;  4EGY A;  1UCR A;  2NS0 A;  3KEQ A;  1YW7 A;  1QBJ A;  3R6S A;  2CWE A;  2PG4 A;  1HW5 A;  3L09 A;  2VOP A;  2DI3 A;  2XUB A;  2JTV A;  3K0L A;  1BIA A;  3ZMU A;  4PGH A;  4XBF A;  3H3U A;  3SFZ A;  1S8N A;  3CO6 C;  2MC3 A;  3WG9 A;  1BI1 A;  2YU3 A;  3U9G A;  4HF2 A;  4P55 A;  2M87 A;  2ZKZ A;  4F7Z A;  2VE9 A;  1IRF A;  4RGR A;  3TOB A;  1RZ4 A;  2BYV E;  3HSR A;  2FRH A;  1I5Z A;  2Z9O A;  4JBA A;  2ZME B;  1HSJ A;  1YG2 A;  1G3Y A;  3C7J A;  4EM0 B;  1KU7 A;  1FX7 A;  3R0A A;  4K2E A;  1DP7 P;  4KDP A;  4MQ9 F;  2A3S A;  5EEH A;  1XB4 A;  2A07 F;  5ILU A;  1IN5 A;  3F6O A;  4I02 A;  3DV8 A;  4LG0 A;  4LB6 B;  4IRG A;  1HKT A;  4EM1 A;  5ERI A;  2A6E F;  1SFU A;  1ZLK A;  4CIC A;  2FMY A;  3D5L A;  1FP1 D;  4EM2 A;  1BM9 A;  2D45 A;  5E17 F;  3KZY A;  5D4R A;  2ZFW A;  4YFX F;  1ZYR F;  2ZNZ A;  1O3R A;  1JXS A;  4KFC A;  3K1M A;  1FZP B;  4IRH A;  3BZ6 A;  2D1V A;  2QVO A;  4UVB A;  2ZXJ A;  3WE2 A;  4G6D A;  2DW4 A;  4FT8 A;  2HOE A;  3ECH A;  3GYH X;  3ZN1 A;  1G3T A;  1HKS A;  4MGR A;  1JHF A;  1LJ9 A;  5KK1 A;  1DPU A;  2EFQ A;  1R58 A;  5BOX A;  1MZB A;  1KU3 A;  1JE8 A;  1K78 A;  1O57 A;  3E97 A;  4MTD A;  4TV7 A;  4GYI A;  1O7L A;  1D3Y A;  4S05 A;  3W6K B;  3T8R A;  3KP2 A;  3OOP A;  3KP6 A;  1XGN A;  5JFR A;  2IJL A;  3IWZ A;  5FFZ A;  3LQQ A;  2B0L A;  3QOP A;  1HW1 A;  1SD6 A;  3NQO A;  1KU2 A;  1ZAR A;  5K1Y A;  4Z2Y A;  3JSP A;  3FWE A;  2DPU A;  2QYO A;  3J80 K;  2STT A;  4HX4 A;  5JR3 A;  3J80 Z;  4HV5 A;  5LGU A;  2IA2 A;  2V79 A;  1MJB A;  4HF0 A;  4RB3 C;  4A0Y A;  1IZ1 A;  1TW3 A;  1YS7 A;  4HYE A;  2Z99 A;  5E18 F;  1V3F A;  2XAG A;  1FT9 A;  4A2U A;  1J9I A;  4KNY A;  2HGC A;  2CFX A;  1QQI A;  2EFP A;  4EJV A;  1O3T A;  3BJ6 A;  1W7P D;  3N97 A;  2CQK A;  3BP8 A;  2O3F A;  4RB0 A;  1ZHF A;  1BIB A;  2P4W A;  2E7W A;  2M45 A;  3N4M A;  2FEZ A;  1UHM A;  1LEB A;  3GVA A;  3RPQ A;  5J8C A;  1QZZ A;  3DQV C;  4HBL A;  4I01 A;  2HFH A;  3MCZ A;  2QBY A;  4WXH A;  3ABU A;  1G3S A;  4OIN F;  5FFX A;  2FBK A;  5AIQ A;  3V7R A;  2LF8 A;  2A6H F;  2FBH A;  3BRO A;  3KP3 A;  2IPQ X;  4UVC A;  3O2P E;  3WU1 B;  1K7A A;  4EJT A;  1ON2 A;  2QEN A;  2K86 A;  1LNW A;  1O3S A;  3QPH A;  1VTN C;  4DQ2 A;  1YW8 A;  1SFE A;  2JRT A;  1P4W A;  3BWG A;  3KZZ A;  4KN7 X;  1FBS A;  1G6N A;  2KIF A;  3V8L A;  2FOK A;  1B4A A;  4OU0 A;  3DPL C;  3RDI A;  4LD5 A;  4GXO A;  1IXC A;  4P5O A;  1U5T A;  4YG2 F;  4KA4 A;  4M71 A;  2V1X A;  2H09 A;  3RYP A;  3I71 A;  2XAF A;  3H3Z A;  5K5R A;  1ZG1 A;  2CYY A;  4I7H A;  2A61 A;  5LRR A;  3RYR A;  2FU4 A;  2OU2 A;  2GIV A;  4MEY F;  5FB2 A;  1KQ9 A;  3IRQ A;  3WTZ A;  5D8K B;  1R1T A;  5CVU A;  4LGW A;  3LST A;  2KIU A;  5F1R A;  1ON1 A;  2L4M A;  1YFH A;  3ISP A;  4ENJ A;  2CSO A;  5TJJ A;  1OYW A;  4ZZL A;  2Q2E A;  1BC8 C;  2P5V A;  3K1N A;  5E1Z B;  2W24 A;  2HYF A;  4L5I A;  5LGT A;  5E1W A;  3MFK A;  1WI9 A;  2V6C A;  3KP5 A;  4Y17 A;  5DCF A;  4I98 B;  3MZH A;  3NEU A;  2G9W A;  3EYI A;  2PQ8 A;  2IA1 A;  3CTA A;  1O7F A;  3R61 A;  4I09 A;  5D6F A;  5L3C A;  1W5S A;  5TRD A;  2VOD A;  1XD7 A;  3P7N A;  2E1C A;  4HZF A;  2FE3 A;  4G7H F;  1FSE A;  3TQN A;  1XGO A;  5FD6 A;  4AVP A;  2VT3 A;  3SQN A;  3IKV A;  3ZMT A;  2W85 A;  2ISZ A;  1H9G A;  1UB9 A;  4AIJ A;  2Z5U A;  4ENN A;  3I64 A;  5L3D A;  4KUM A;  1AOY A;  1XSD A;  4FX4 A;  4IHS A;  1MKM A;  4G8X A;  2RKH A;  1MJ9 A;  1H0M A;  3V7S A;  1FSH A;  4LG0 B;  3FXU A;  4BYY A;  3E5Q A;  5D4S A;  4L9T A;  1TQP A;  3FZV A;  2IT0 A;  3D0S A;  4KIB A;  3V8J A;  3QU3 A;  2W25 A;  5JI6 A;  2DO7 A;  2F5C A;  2RN7 A;  1EH6 A;  1JHH A;  3M1E A;  1ZRE A;  5E8I A;  1RUN A;  2MH9 A;  5CVR A;  4KMU X;  2HQN A;  1B9M A;  4IJA A;  4A12 A;  2MLG A;  5ILV A;  1Z9C A;  3I59 A;  3KFW X;  5ICE A;  2UXN A;  2DQR A;  5IT9 Z;  4HLX A;  3ZMZ A;  2CW0 F;  2QQA A;  1P6R A;  4ZYG A;  4ZYD A;  2FNP A;  2KIM A;  4XLP F;  4XLN F;  2JT1 A;  3GXO A;  1OYI A;  5L3G A;  1FYM A;  5CVI A;  2XRN A;  2QUF A;  1K78 B;  1DDN A;  1P4A A;  1IAW A;  5DD4 A;  2DPD A;  3E6C C;  4OIQ F;  1F5T A;  1HKQ A;  1S6L A;  1XMK A;  3BPV A;  1P4X A;  2OQR A;  1SMY F;  3E6M A;  3U2R A;  3HUG A;  1BI0 A;  1P92 A;  3RIR A;  1SAX A;  2PLY A;  3WTV C;  2P5K A;  6PAX A;  4NB5 A;  1KU9 A;  2QQ9 A;  5HS7 A;  1I6X A;  3ERE D;  4RB1 A;  1S3J A;  3LAJ A;  3I0T A;  4WXD A;  1CGP A;  4KIC A;  2R7D A;  2H27 A;  4HF1 A;  1FYK A;  3P9C A;  1NHA A;  2VXZ A;  3IHU A;  2GWR A;  1BJA A;  2YSR A;  2D1H A;  4P9U A;  5BS6 A;  3VOE A;  1FNN A;  2EJR A;  3VB2 A;  4IPA A;  3KET A;  3HRT A;  3ZMV A;  2ESH A;  2GXB A;  1IXS B;  1F4K A;  1ZRF A;  5F6F A;  1HBX G;  4LLL A;  2GXG A;  5HDG A;  2F5E A;  5ICC A;  1X3U A;  3CDH A;  1AWC A;  5D5V B;  2P8T A;  4L0Y B;  3KLN A;  1RNL A;  5HLH A;  4ENM A;  3BOQ A;  1U78 A;  4UHT A;  1IUY A;  3PFI A;  2BBY A;  1PDN C;  2HZT A;  3FF5 A;  2OBP A;  2IVM A;  3EET A;  2IA0 A;  2EV5 A;  5DDG A;  1D8J A;  1MGT A;  1S7O A;  1ZRD A;  1I1S A;  3I58 A;  1LQ1 A;  4M9X A;  4YII A;  1I1G A;  4L0Z B;  2ZNY A;  3HSE A;  3FMR A;  1MDM A;  1GHC A;  1TQI A;  5AIP A;  1U2W A;  1GXP A;  3SHF A;  4RGU A;  3WTY C;  2OQG A;  4WWC A;  4L5J A;  1YS6 A;  3R60 A;  5J8F A;  5LEJ A;  5DV5 A;  3FX3 A;  3GZ6 A;  5D5X B;  3F6V A;  2V9V A;  4A0Z A;  5DCM A;  1ZG3 A;  2YX4 A;  5JVT A;  4UV9 A;  1L0O C;  2D2W A;  2YPR A;  2GQQ A;  2W57 A;  1REP C;  1JGS A;  2GZW A;  4R79 A;  2EFN A;  3TO7 A;  2O6G E;  4O3M A;  4ZYE A;  3GO5 A;  2Q0O A;  4EJO A;  4Q48 A;  5LLQ A;  1XN7 A;  3B73 A;  4A5N A;  3ULQ B;  3HHG A;  4CYD A;  4GGG A;  3BJO A;  4UVA A;  3F8N A;  1I27 A;  5KVR A;  3V7C A;  3L9F A;  3HYI A;  3WTU C;  3CLO A;  2EA4 A;  2L01 A;  3QU6 A;  4CGZ A;  4KIG A;  2L4A A;  1KQ0 A;  2FF4 A;  2LF7 A;  3H92 A;  2LDU A;  2K4J A;  1IF1 A;  1Q1H A;  3T5X A;  1QGP A;  2G7H A;  1TNS A;  1MJA A;  3LFK A;  4O6J A;  4ZZD A;  4LMY A;  1OPC A;  1U5T C;  4A5M A;  3KP7 A;  3HRM A;  4HA8 A;  1QZY A;  4EGZ A;  3ZMS A;  4EV0 A;  3MAJ A;  2XAJ A;  2WWY A;  5H6R A;  5LBQ A;  3K9T A;  3MQ0 A;  3QP5 A;  2FBI A;  1LDJ A;  2RV8 A;  2QM3 A;  5D5U B;  3FM5 A;  4B8X A;  4FX0 A;  2STW A;  3KLO A;  2F5F A;  2Z33 A;  1YQA A;  4M73 A;  2EK5 A;  2UZK A;  5CYV A;  3JSO A;  4GYG A;  1J7K A;  4IVN A;  1E17 A;  2YR2 A;  4S04 A;  2MD5 A;  5L3E A;  2XKP A;  5DEQ A;  2ZME A;  4U0Y A;  5BPI A;  4AD9 A;  5K5O A;  1P2F A;  2H94 A;  4ESJ A;  3I5U A;  2DK8 A;  1QPM A;  2P5L C;  3CO7 C;  1TQM A;  3PQK A;  2O03 A;  5H20 A;  2QLZ A;  4P96 A;  3GEZ A;  2M5W A;  4LK0 F;  4M6X A;  2RQP A;  1DPR A;  4HDV A;  4A0X A;  1J2X A;  3LA7 A;  3CJN A;  1ZG5 A;  2IW5 A;  3Q9S A;  4I0B A;  1YTY A;  3L00 A;  5LEK A;  2MA3 A;  4ESF A;  2DLL A;  2OA4 A;  2XIG A;  5DUK A;  4CO8 A;  1FWZ A;  5J6X A;  1FOK A;  1KYW A;  2UXX A;  4B09 A;  3F72 A;  3F3X A;  1Z7U A;  5HOO A;  4OOI A;  4KN4 X;  3WOD F;  2CG4 A;  4HX7 A;  2EA2 A;  1U6G A;  3TO9 A;  4BHC A;  3HTU A;  2FA5 A;  2J5O A;  5E8G A;  5CVJ A;  2DFI A;  3DPT A;  4E70 A;  2FQ3 A;  5ED4 A;  1WKM A;  1SD5 A;  2HQR A;  1SD7 A;  2MH2 A;  2VE8 A;  5LHH A;  2VC1 A;  4ETS A;  3GW2 A;  4G7Z F;  2XV4 S;  4FHT A;  4BQA A;  4KMF A;  2OZU A;  2L3D A;  4RS8 A;  4IXA A;  3SZP A;  2EWN A;  3RI4 A;  4ENK A;  3JTG A;  4R8H A;  1RIO H;  5HS8 A;  4UXN A;  1ONV A;  5D8L B;  1IXR C;  2VON A;  3ECO A;  3G3Z A;  3NRV A;  4WX9 A;  3F8C A;  3BPX A;  1XGS A;  2E7X A;  4HW0 A;  2ADU A;  4LLN A;  2JZY A;  4BHP A;  2BE5 F;  3HIF A;  2NNN A;  4XSZ F;  3M8E A;  3TGN A;  2RC4 A;  2R7F A;  3E3V A;  2UWM A;  2IP2 A;  5F64 A;  3COA C;  2XGX A;  1USS A;  2BEO A;  1PUE E;  3DP7 A;  1KQ8 A;  3HRS A;  4JQF A;  4CHU A;  4PZJ A;  3C3W A;  2R3S A;  2RDP A;  1T38 A;  1H9T A;  1V4R A;  2VBZ A;  4EJU A;  4G6Q A;  2KJB A;  1R00 A;  1GXQ A;  2DU9 A;  3T0Y A;  3S2W A;  1HST A;  3MEX A;  4O5V A;  4RGX A;  2V1U A;  4L18 B;  2RGV A;  4RAY A;  4AIH A;  2PMU A;  3Q9V A;  4D0P A;  4HX8 A;  2XAS A;  2DT5 A;  5ILS A;  1IN6 A;  4EJW A;  1T39 A;  1XCB A;  5HS9 A;  5DCM B;  1XSV A;  3CUQ A;  5AON A;  5LGN A;  4P9F A;  5IT9 K;  1LEA A;  2O0Y A;  3W6J B;  1J75 A;  2IRF G;  5DUI A;  1F1Z A;  4MTE A;  4HQE A;  3IC7 A;  4M9Z A;  3FMS A;  5DYM A;  2HTJ A;  4KIF A;  1LVA A;  2DK5 A;  4HDU A;  5E20 A;  4NQW A;  2NAZ A;  2ELH A;  1SFX A;  3P9I A;  2K4B A;  2K7L A;  1EH8 A;  4HQM A;  3V4G A;  1UST A;  4WF2 A;  3GZ5 A;  1IN7 A;  1B9N A;  4CDG A;  3WGI A;  3DKW A;  1S29 A;  2MBF A;  5E1X A;  2HTS A;  3LA3 A;  3HRU A;  3GFM A;  3WGG A;  1BOA A;  1YW9 A;  2V1D A;  3JAM K;  4Q4Z F;  3J7A O;  1IN8 A;  2GA1 A;  3JAM Z;  2X0L A;  1B6A A;  1BI2 A;  2WTE A;  5BQT A;  4Y13 A;  3QP6 A;  3KEO A;  2EV0 A;  3ELK A;  2VBX A;  4CXF A;  3U1D A;  4OIR F;  5D5W B;  1TW2 A;  4LLG F;  4Q47 A;  4CZZ A;  1J0R A;  2L02 A;  4JK1 X;  1YIO A;  2GA2 A;  2EV6 A;  2PBI A;  3EUH A;  3R4K A;  2PMH A;  1ZN2 A;  1BBY A;  1KYZ A;  2P7C B;  1WWX A;  4RGS A;  3RTR A;  1UFM A;  2ISY A;  4HV6 A;  2RNJ A;  3TDU C;  2P6T A;  4GCV A;  3RKX A;  1FBQ A;  1ZGJ A;  1ZGA A;  3ML6 A;  4GO1 A;  2FNA A;  4ZYH A;  3R0J A;  1D8K A;  3M8F A;  1UHW A;  1XSX A;  2H6B A;  1CF7 A;  3E5X A;  3GFI A;  2VOO A;  2HS5 A;  1BN5 A;  4AIK A;  2NNY A;  4WK8 F;  3K1P A;  2PEX A;  3BY6 A;  5HLI A;  1W7P A;  2DTR A;  2M30 A;  3F23 A;  2P7V B;  2Z3Y A;  2QBY B;  5FO5 A;  2OAZ A;  5LRS A;  4R1H A;  2W84 A;  4ESB A;  3QRF F;  2OZ6 A;  2WC2 A;  4OIP F;  3WTW C;  1LB2 A;  4XRF A;  1ODD A;  3GX4 X;  1WQ2 A;  3JTH A;  5L3F A;  3AAF A;  2ESN A;  4QWQ A;  1ZH5 A;  1Z6R A;  3TDZ C;  3P9K A;  1GVJ A;  3RKY A;  2VT2 A;  1K6O A;  2E1N A;  4L9J A;  1FLI A;  3ZP5 A;  2G7U A;  4LJZ F;  4UUV A;  1YLF A;  1LDK B;  2Y0M A;  1FC3 A;  2COM A;  4N9H A;  1TBX A;  4LK1 F;  5L3B A;  2K02 A;  1R22 A;  1U5T B;  2HR3 A;  2AS5 F;  4MEX F;  3GLX A;  2XAH A;  1W5T A;  2PFB A;  2C6Y A;  4BHB A;  3FHZ A;  2HDC A;  3K69 A;  3KE2 A;  4OMY A;  3GF2 A;  4WCG A;  3F8F A;  3EQL F;  4M74 A;  1ZLJ A;  1A04 A;  2YX7 A;  3KP4 A;  1MD0 A;  3LQR A;  4N0B A;  1XDS A;  3ABT A;  3FMQ A;  2FML A;  1L3L A;  5ICG A;  5DD8 A;  4LB5 A;  2XHK A;  3GFL A;  1EH7 A;  1BI3 A;  1TLH B;  4OIO F;  2VN2 A;  3OV8 A;  1E2X A;  4IRI A;  2FSW A;  5CLS A;  3T8T A;  5CJ9 A;  3RKW A;  3HSF A;  3MZY A;  3C1D A;  3G73 A;  1RUO A;  3EYY A;  3I4P A;  4EVI A;  1ZAO A;  4H0E A;  5FLX K;  1YO5 C;  1RI7 A;  1T2K A;  5LHI A;  1WRJ A;  2PN6 A;  4G94 A;  4ON0 A;  5FLX Z;  4U0W A;  3O3K A;  1IRG A;  3ZPL A;  2LSO A;  1XGM A;  3FXR A;  4BH9 A;  4YIF A;  2JPB A;  3F21 A;  2A5Y B;  3I54 A;  2Q8K A;  2KJC A;  3MWM A;  3T1B A;  1Z91 A;  4EMS A;  1G3W A;  2EB7 A;  1J5Y A;  2JPC A;  3JW4 A;  3CUO A;  1PP7 U;  4IF4 A;  4Y15 A;  4I0A A;  1FY7 A;  2XRO A;  3LAP A;  1S7A A;  2J5P A;  3WGH A;  4HLY A;  4NHJ A;  4Q5S F;  4G9Y A;  3ZN0 A;  4KYW A;  1SD4 A;  5HVQ C;  3TO6 A;  1R36 A;  5IT3 A;  3RPU A;  5BMZ A;  2VC0 A;  4M72 A;  2LNB A;  4MHG A;  5H6Q A;  2VBY A;  3LWF A;  2M1B A;  3C18 A;  3WTT C;  2QWW A;  4QLC U;  4PDK A;  3PQJ A;  3SXY A;  3I59 B;  3CUQ B;  1XCV A;  4I2O A;  2HWV A;  2LKP A;  1DUX C;  5D6E A;  4YFK F;  4OMZ A;  1B59 A;  2XKO A;  3I53 A;  1J59 A;  3F8B A;  5A2Q K;  5EEG A;  3J81 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...