4EJVA

Staphylococcus epidermidis tcar in complex with chloramphenicol
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
147
structure length
135
Chain Sequence
IEDHISFLEKFINDVNTLTAKLLKDLQTEYGISAEQSHVLNMLSIEALTVGQITEKQGVNKAAVSRRVKKLLNAELVKLIIKLSNKGKKYIKERKAIMSHIASDMTSDFDSKEIEKVRQVLEIIDYRIQSYTSKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of the antibiotic recognition mechanism of MarR family proteins
rcsb
source organism Staphylococcus epidermidis
molecule tags Transcription regulator
molecule keywords Transcriptional regulator TcaR
total genus 48
structure length 135
sequence length 147
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4ejvA00
1KQ9A 2HR3A 2G9WA 1PUEE 3N97A 2OD5A 4CICA 5K5OA 3DP7A 2M45A 4KIGA 1P6RA 1SAXA 4KNYA 3ERED 1BI2A 1R1TA 5E1ZB 5LHHA 1ZG1A 1HBXG 5D8KB 1LEAA 2YX4A 3PFIA 3BOQA 3HUGA 1SFEA 1P2FA 1FNNA 1P4AA 4ZZLA 5D5VB 3KETA 1XSXA 3FM5A 3TO6A 3J7AO 2H6CA 4CGZA 2J5PA 3M8EA 2CG4A 1QGPA 1ZREA 1LNWA 2KJBA 5D8LB 5CVUA 4WK8F 3B02A 2VONA 1HW1A 1HQCA 3Q9SA 1YTYA 4UHTA 4LG0B 1D8JA 1HXDA 4U7DA 4M9SA 4A0XA 4M6YA 3CUOA 4BHBA 2QQ9A 2KIFA 4U0YA 4LLLA 1ZN2A 3FXRA 5HLHA 1X3UA 3MZYA 4O5VA 3NRVA 4IRGA 2K27A 5EEGA 1UCRA 1LVAA 1SFXA 4G7ZF 3DV8A 4YIIA 5HS9A 2XHKA 3JAMK 5LEKA 2VE8A 2ZKZA 4GGGA 3KP2A 1ULYA 2FU4A 4XSZF 1SD4A 3DQVC 2E1NA 4N9HA 3H3UA 4R1HA 1U8RA 2DI3A 4YFKF 1KQ8A 2HTJA 1IAWA 3VEPA 4A12A 2J5OA 3LA2A 3TO7A 4EJUA 2F5EA 3QOPA 1CGPA 4AIJA 3G3ZA 4N0BA 2L3DA 3FHZA 1IF1A 1J9IA 1ON1A 3IRRA 1BN5A 2A3SA 4M71A 5J6XA 2UXXA 3K0LA 4IVNA 4KN7X 1F9NA 1HKQA 2HWVA 3IL2A 5HDNA 2A6HF 5J8CA 2DAOA 3QU3A 4U88A 4EM1A 4QLCU 5JHUA 4ENMA 4LLGF 1E17A 1T39A 1L0OC 4OOIA 2MD5A 5IT9Z 3GFJA 3CO7C 2FRHA 5K1YA 4FHTA 1ZH5A 1CF7A 4L5IA 2RVCA 3J81Z 4A5NA 1OYYA 3MFKA 3HSFA 1KU2A 1WSUA 1JGSA 1T6SA 2G7HA 1LDDA 1UB9A 4Y15A 1RZ4A 2BEOA 5A2QZ 3PQKA 5HVQC 4M9ZA 1YG2A 3RIRA 4EM0B 2ZO4A 2H27A 1FP2A 4G9YA 2P7VB 1FWZA 2DQRA 3WU1B 1MKMA 3KE2A 3MAJA 3E3VA 4L9JA 2JPBA 5ILUA 1O3SA 1FLIA 2YU3A 1DP7P 2UZKA 1J0RA 3DF8A 3P7NA 1V3FA 4HX4A 4CO8A 2VBYA 2P4WA 3ZMTA 2LDUA 3GFMA 3ULQB 3RKYA 3DEUA 4L9VA 1FC3A 2YSRA 2OU2A 2EFNA 2QZ8A 2VBWA 3WTYC 4I09A 4LG0A 1YO5C 3ZN1A 4IHTA 3T8RA 1WI9A 4D0PA 1USTA 2A07F 1S8NA 2FNPA 2MBFA 5L3BA 1J5YA 2WC2A 4NQWA 1BM9A 1YW9A 2GAUA 5L3GA 2Q0OA 2EV6A 3F22A 2FBKA 2EFPA 2LF7A 1IXSB 3LWFA 2OAZA 4U0VA 4WX9A 2VT3A 3VODA 4GCVA 4AWXB 1B59A 5DCMB 3ZMZA 2PBIA 2P5KA 2VXZA 4HX8A 3AAFA 3WG9A 3DXJF 3QP6A 3E5QA 5ICEA 4RAYA 2HQNA 2ESNA 2IP2A 5FB2A 3T5XA 3FWEA 2GQQA 2DK5A 3CJNA 2XRNA 1LDJA 1O57A 5L3EA 3JW4A 3QPTA 3JSOA 2FMLA 4RGSA 3CUQB 2EFQA 3EYIA 2P6TA 4JBAA 4ESBA 1D5VA 2V9VA 2OQRA 3SXYA 4YFXF 1A04A 4UNOA 3VFZA 2GIVA 2PN6A 2F2EA 3HOSA 3ZMSA 2A61A 1B4AA 2UXNA 4PGGA 2H09A 2MA3A 1ZRCA 4HW0A 3SZPA 4RB0A 1ZRDA 1IXRC 5DYMA 1BOAA 1TW3A 1J2XA 3RKXA 3G73A 3BDDA 1XD7A 5LGUA 4M73A 1U5TB 1FP1D 3RYRA 3U9GA 3KEQA 4WCGA 5D5WB 2PMHA 1I1SA 1FT9A 1EH6A 1FYMA 3I58A 3CUQC 5ILVA 1U5TA 5K5QA 3J81K 2FBHA 1USSA 1XSVA 3LA3A 3F72A 3VB2A 3LAJA 4KMUX 4LD5A 2IRFG 1PP8F 2MC3A 3W6JB 3T8TA 4EM2A 4RB2C 1W5TA 1DPUA 4LK1F 4HA8A 4RGRA 3QRFF 2P6SA 3HRUA 4HBLA 2L54A 3LQQA 2R7FA 1R22A 2HEOA 2VT2A 5H20A 4HQEA 2HYGD 3WE2A 4XRFA 5E18F 3COAC 4KICA 3CO6C 2HKOA 3IKVA 5FFZA 1IN6A 1U78A 2F5CA 2ZBKA 5BOXA 2FBIA 1R5HA 4ON0A 2K7LA 4BHCA 1YYVA 4E70A 2FOKA 3LA7A 3V7RA 1UHWA 4ENNA 2YPRA 5FD6A 1KQ0A 5BPDA 2CGPA 3H92A 2L01A 3F3XA 2O0YA 2M1BA 1B1BA 2PFBA 2XAFA 2FEZA 4RB3C 4ESJA 3HHHA 4WXCA 2V1UA 4IRIA 2VOPA 1TTYA 1TLHB 2FNAA 1ZHFA 2PI0A 3I5UA 2CYYA 2HYFA 4B09A 3JTGA 3GUDA 4BXUA 1BIAA 4HDUA 2O8XA 2LKPA 5ED4A 1FYLA 2Z3YA 1S3JA 4IJAA 3S2WA 5LRRA 4KUMA 5L3CA 1U6GA 5TRDA 4LLNA 2QLZA 2QBYB 2DT5A 4P55A 4HX7A 2FA5A 1DPRA 4R8HA 1DDNA 3M1EA 1Q1HA 2CFXA 4HOBA 4ZZDA 5ILSA 3WGHA 5LBQA 1IW7F 1GXQA 5ICCA 2RGVA 3R61A 3RYPA 3V4GA 2XAHA 4OMZA 4P5OA 2X0LA 4OIRF 3R0AA 1P4XA 4HF0A 4KIBA 3L2CA 3U1DA 2TDXA 3I59A 1IRFA 2QBYA 3FF5A 4HDVA 1IN5A 4N9IA 1D8KA 4ESFA 2IW5A 1I5ZA 1J7KA 3GZ5A 4OMYA 2FF4A 2NNYA 3ZMVA 3M8FA 3F21A 4ZYEA 2XKPA 1ODDA 4I98B 1G4DA 1KA8A 1O7FA 1T98A 2ADUA 2YX7A 4GO1A 4HYEA 3J80K 2O61A 1ZRFA 3C18A 1HW5A 4XLNF 2ZCWA 5DEQA 2Y75A 4BNCA 5LRSA 2H94A 4A2UA 2JTVA 3F8NA 1AOYA 3RTRA 3HRMA 2ELHA 3FXUA 2ZFWA 2STTA 2WWYA 1I27A 2E7XA 4IRHA 1O3QA 4OINF 3DKWA 2HKXA 4Z2YA 3ZPLA 2EFWA 3F8FA 1ZAOA 1TNTA 5CLSA 1KGSA 2VOOA 1YFHA 4S05A 3GYHX 1IRGA 5HDGA 1R58A 2P5LC 3WU0A 3MQ0A 2RQPA 4I01A 3HTSB 2ISZA 2Y48A 2E1CA 2PLYA 3F6OA 3NEUA 4K2EA 1TBXA 1WRJA 2BGCA 2NYXA 1R00A 1O3TA 2KIMA 4G8XA 2GA1A 1FZPB 3V7CA 1XMKA 1GHCA 1Z1DA 2ZJ2A 3GLXA 4WXHA 3EDPA 1RI7A 1W7PB 3KP5A 4IHSA 2HFHA 5CVIA 3ZN0A 4WXDA 2P5VA 4ZYDA 1PP7U 4KN4X 4MTEA 3LFKA 2DPUA 1SMYF 3KP4A 3ABUA 5DD8A 1LQ1A 1KYZA 2MH2A 5HLGA 3WTZA 5HDKA 2BYVE 4YFNF 2B0LA 5FGMA 5D4SA 5FO5A 2OZ6A 4EJVA 4MEYF 3HRSA 1HW2A 3HSRA 1XMAA 1S29A 1JE8A 1TNSA 5L3FA 1ONVA 3EUHA 4HV6A 3V7SA 3KZYA 4G7OF 5E1WA 3WE3A 1WKMA 3SZTA 5HLIA 1CF7B 1IN4A 2P8TA 4RGXA 3LQRA 3FXQA 2MLKA 4EJWA 3E97A 4KFCA 2FXAA 2BBYA 3BZ6A 3DPTA 3I0TA 2V1XA 3WTVC 5H6RA 3TOBA 2D1VA 2W57A 2VC1A 4PZJA 1QZYA 4DQ2A 5LHGA 2EV5A 1MJBA 1U2WA 1D3YA 1R23A 3J80Z 3KEOA 1YS7A 3K1PA 5ICFA 2XVCA 2RC4A 2FSWA 1MGTA 1YW7A 1SD5A 1XB4A 2JPCA 1MJ9A 3GEZA 4TV7A 2JRTA 1BJAA 4I0BA 3GWZA 1OYIA 4UVAA 3CLOA 2RN7A 4UUVA 4ENKA 2V6CA 4KDPA 1QO0D 2RNJA 4H0EA 2VN2A 4IF4A 3RPQA 1GVJA 2ACJA 1R1UA 2FQ3A 2Q8KA 3IWZA 3V8JA 4B8XA 3R6SA 2VBZA 3WTUC 1RUOA 1W4MA 4A5MA 1JHFA 3GX4X 1EV7A 3IHUA 3IC7A 2ZMEA 3OV8A 2OZUA 3Q9VA 3RI4A 1Z6TA 2LSOA 5AIPA 1FSEA 1W5SA 1XSDA 2XGXA 5DUKA 5KVRA 1OKRA 4OIPF 2CQKA 2XIGA 2V79A 2A68F 2RDPA 1MZBA 2ZNZA 1REPC 2DU9A 3TO9A 3F6VA 4KMFA 6PAXA 2GXGA 1AWCA 1XGNA 2R7DA 3ZQ7A 5J8FA 4XBFA 3E5UA 3MCZA 2FMYA 1XGSA 3ZP5A 3E6DA 2HQRA 1JHHA 2K4JA 3K9TA 3BPVA 4OIOF 1QQIA 1Z05A 1F1ZA 5CJ9A 2DBBA 2EA2A 3O3KA 2JT1A 5CVJA 3LSTA 3VOEA 1S7OA 2X4HA 3REOA 2MH9A 3RJPA 3NQOA 2DQLA 3E6BA 3M9AA 3BY6A 2F5DA 1B9MA 2F5FA 1P92A 5JFRA 2VODA 4P9UA 4ZYGA 4UV9A 2HOEA 2EWNA 4ASNA 3T0YA 2EK5A 2BV6A 1ZGAA 1V4RA 3KFWX 2NNNA 4KA4A 1FBSA 2NAZA 3GXOA 3ZMDA 2H6BA 1SD7A 3T1BA 1ZGJA 2KIUA 5E17F 1JXSA 1HSJA 3L00A 4I2OA 2EFOA 1B9NA 1H9TA 4EJOA 5IT3A 5FLXZ 2XROA 2KRFA 2DW4A 3RKWA 1BC8C 1C0WA 1I6XA 1Y0UA 3F23A 3KP3A 2CO5A 3FMSA 2M5WA 1MDMB 3WGIA 3GO5A 1U3EM 5TJJA 3U2RA 4G6QA 2IA0A 1S6LA 3MWMA 4M74A 5IT9K 3I54A 3TOAA 2QUFA 3QP5A 1OYWA 3F8MA 2ETHA 1XDUA 3P9IA 2HGCA 1Z6RA 2JSCA 1K78A 4BQAA 4A0YA 3FX3A 4A6DA 1Z9CA 4CYDA 2A69F 5DV5A 2M87A 1R7JA 2M30A 3E6CC 4PGHA 3ECHA 4LJZF 3D0SA 3IKTA 5LGTA 1R1VA 2XAQA 1YQAA 1R5GA 4QWQA 1I1GA 2HS5A 2Z33A 2Z99A 2DTRA 3FMQA 1FBQA 1W7PD 5HS7A 4LMYA 4L18B 2ESHA 1YW8A 1O7LA 2QWWA 4O3MA 1LDKB 1IN7A 2Z5UA 4NB5A 4HF2A 2E7WA 2XKOA 2GZWA 4GXOA 1YLFA 2CSOA 1G3YA 1KU3A 2QVOA 5BMZA 2L4AA 3F8CA 4RGUA 2IJLA 5F64A 4O6JA 1G3WA 4ETSA 4XSXF 4I0AA 3W6KB 2ZNYA 3TKYA 4OU0A 3GVAA 4A0ZA 4EGZA 3GW2A 5H6QA 2Z9OA 5E8IA 5ERIA 5LGNA 2IA1A 3KP7A 4AVPA 1ZG5A 1TW2A 1BIBA 3FMRA 5CYVA 5LHIA 1L3LA 1RUNA 3EQLF 2COMA 4LB6B 2D45A 5FFXA 2OBPA 3L09A 3GF2A 1XN7A 3C7JA 4S04A 1IZ1A 4EV0A 1RNLA 3EETA 1XGMA 3R60A 2O3FA 2WV0A 4I02A 2HDCA 2EB7A 3KCCA 3HOTA 4BYYA 4Q47A 1HKSA 4BH9A 1T38A 1NHAA 1F4KA 4MEXF 3DPLC 2DK8A 5FLXK 2DPDA 2HTSA 1FX7A 4DNCA 3ELKA 3C1DA 4UV8A 2W84A 4RS8A 1P4WA 3WODF 4LGWA 4G94A 3SFZA 4BAYA 2HZTA 1KYWA 2D1HA 3HRTA 5AIQA 3KP6A 1FYKA 3FM3A 2YR2A 3OOPA 5DCFA 3BJ6A 1G6NA 5E1XA 3C3WA 1YS6A 5JR3A 2CWEA 4MTDA 4HZFA 2LNBA 5JVTA 3I4PA 4CZZA 1Z91A 2O6GE 4CXFA 1O3RA 4XLPF 4KT5C 4A6EA 4Q5SF 4OIQF 2Y0MA 2L02A 2G7UA 1OMIA 1BI0A 3CTAA 3CUQA 2A5YB 4F7ZA 2OA4A 2VE9A 2GA2A 1T0FA 2XASA 4GYGA 1R36A 1KU9A 1QNTA 3KLNA 4Y13A 4HF1A 4MQ9F 3KLOA 5A2QK 4I7HA 1B6AA 1K7AA 1ZG3A 2W25A 5HOOA 4JQFA 3WGGA 4JK1X 2KKOA 3BWGA 1MJAA 3K69A 2GWRA 4NHJA 1ON2A 2LF8A 2V1DA 1XGOA 1LEBA 5BPIA 3TDZC 4CDGA 3QAHA 3HIFA 2RV8A 2VBXA 4U7BA 1FOKA 3WTWC 3WTXC 4HV5A 5AONA 4P96A 1HSTA 3K1NA 4PDKA 1OR7A 4UVCA 1FBUA 2AS5F 3RDIA 1QPMA 2PG4A 1UHMA 4KIFA 1HKTA 2QQBA 4KYWA 1QBJA 4MNUA 5BQTA 2OQGA 3KZZA 2L4MA 4EJTA 2RKHA 1FPQA 2PJPA 5DDGA 3O6BB 4LB5A 1BI1A 2W24A 4FX0A 3R0JA 1RIOH 3CDHA 3QU6A 2DFIA 1PDNC 1OPCA 2PQ8A 2PEXA 1GXPA 5D5UB 2ZMEB 4WF2A 3BP8A 4CHUA 3ROUA 3SHFA 2QM3A 1SD6A 4LK0F 3K1MA 3TDUC 3ZMUA 3R4KA 5E8GA 4Q4ZF 4GYIA 4AIHA 3I59B 2D2WA 3B73A 1W7PA 2UWMA 4AD9A 4L5JA 3I53A 2JZYA 4M6XA 2DLLA 2K4BA 5EEHA 1EH7A 1VTNC 5L3DA 4M72A 1H9GA 4EQQA 4LFUA 2XV4S 3BPXA 3HTUA 3RPUA 1T2KA 3IWFA 2NS0A 4HQMA 2P7CB 3QPHA 1XDSA 3EYYA 5D5XB 3JAMZ 2STWA 5ICGA 3D5LA 3GZ6A 3BROA 5JI6A 1K79A 3E5XA 5D4RA 3N4MA 4R79A 5LLQA 1U5TC 3MEXA 3HYIA 1ZARA 3GFLA 3WTTC 2IVMA 4EVIA 4MQVA 1FY7A 3L7WA 1KU7A 5BS6A 3PQJA 3LAPA 4L0YB 5LEJA 3ECOA 2NRAC 1IXCA 4RAZA 2EV0A 1STZA 5DCMA 1BI3A 3BJAA 3HHGA 5KK1A 3GFIA 2DO7A 3P9KA 4UXNA 1YIOA 3ML6A 1IUYA 1Z7UA 4MGRA 1G3SA 4PCQA 1WQ2A 4L9TA 4EGYA 2W85A 1FSHA 3FZVA 1SFUA 3HSEA 4ZYHA 2XAJA 4P9FA 3MZHA 1F5TA 2IPQX 1TQPA 2XAGA 2A6EF 4YG2F 4Y17A 5E20A 3H3ZA 2IA2A 4EMSA 3ABTA 5K5RA 4FX4A 4G7HF 2ZXJA 3K2ZA 3L9FA 2K02A 1SMTA 3WTSC 1ZYRF 5CVVA 3Q5FA 1G3TA 2QQAA 4L0ZB 4L9NA 2EA4A 2C6YA 4U0WA 4YIFA 1UFMA 1MD0A 3IRQA 3O2PE 1BC7C 1ZLJA 5DUIA 1J75A 4WWCA 4HLXA 3I71A 5D6EA 1TQIA 1E2XA 2QENA 3JSPA 5DD4A 2FE3A 2AXLA 2GXBA 5HS8A 2BE5F 3M7GA 2CW0F 4BHPA 4FT8A 1MDMA 5F1RA 3TGNA 2R3SA 1K78B 2Q2EA 3F8BA 3V8KA 3V8LA 4G6DA 1S7AA 4IPAA 3E6MA 4ZH4F 1LB2A 1H0MA 2QYOA 2IT0A 2KJCA 1EH8A 1LJ9A 2EJRA 5D6FA 3P9CA 1J59A 4ENJA 2ISYA 3BJOA 3SQNA 1ZLKA 1TQMA 1WWXA 4Q48A 1IN8A 2O03A 2K86A 1XCVA 4IXAA 4AIKA 1K6OA 4HLYA 4RB1A 1BBYA 4HAMA 2XUBA 4MHGA 3DFGA 4UVBA 2WTEA 5CVRA 1XCBA 2M8EA 2PMUA 2MLGA 1QZZA 1DUXC 5F6FA 3TQNA 2VC0A 3JTHA 4M9XA 3I64A 5FD5A 3ISPA
chains in the Genus database with same CATH superfamily
2KRCA 4PJLA 1IO2A 1KQ9A 2HR3A 3BQYA 1X3ZB 2G9WA 4A3JJ 4ZDOA 1PUEE 3HOUJ 3N97A 2OD5A 2R0QC 1QU3A 4F55A 4CICA 1ZK8A 2X6XA 5K5OA 3DP7A 3DBRB 3OYHA 5CQEA 2M45A 2X85A 1H89C 1Z3YA 2LG4A 3ESWB 4XRSG 2LY1A 4KIGA 1P6RA 2EBIA 3FHNA 1SAXA 4KNYA 2AXTC 3ERED 1HDPA 1BI2A 1R1TA 3FXOA 5E1ZB 4MLOA 5LHHA 1ZG1A 1HBXG 5D8KB 1LEAA 2YX4A 3PFIA 4XLFA 4QIWN 1IGNA 4BJ5C 3BOQA 2R7UA 1XX5A 2JSPA 3ZQHA 2QCOA 3HUGA 1SFEA 1P2FA 1FNNA 4G12A 1P4AA 4ZZLA 5D5VB 3I4MJ 3CMEI 3KETA 1XSXA 3FM5A 3TO6A 3J7AO 1WJ5A 4V19K 4D7MA 1WH5A 2H6CA 2M4KA 4CGZA 2J5PA 3LSJA 3BTCA 5EDNA 3M8EA 3A01B 2CG4A 9ANTA 1MSEC 2R7QA 3SDGA 1QGPA 3JREA 1ZREA 1LNWA 5EZGA 2KJBA 1POGA 5D8LB 1WHUA 4AYBN 4C3HJ 2CV1A 4NNJA 5CVUA 4WK8F 3B02A 2VONA 1HW1A 1TWGJ 1HQCA 2DOFA 4II3A 3Q9SA 4W97A 1YTYA 1FOYA 2CUFA 2P0WA 4UHTA 3ZQCA 4BJ6C 1BR1A 1I50J 2WBMA 4LG0B 1D8JA 1HXDA 2WAFA 2WAQA 5CQGA 4U7DA 2DN0A 4M9SA 2L9VA 4A0XA 1LUJB 2ZXIA 1HOMA 4M6YA 1Z3XA 3CUOA 4BHBA 2QQ9A 4F92B 2KIFA 1JJ8C 4U0YA 4LLLA 1FMVA 1ZN2A 4HNVA 3OR2C 3DWLE 3FXRA 5HLHA 1X3UA 2OUMA 3MZYA 4O5VA 3HOVJ 3HEFA 3NRVA 4IRGA 2K27A 5EEGA 1UCRA 2FQ4A 1LVAA 2JN6A 1G59A 1SFXA 4G7ZF 3DV8A 4XONA 2O7OA 1O4XA 4YIIA 5HS9A 2DMTA 3LSMA 2XHKA 3S3NA 3JAMK 5LEKA 2WB1N 2VE8A 2ZXWH 3QYEA 2ZKZA 2F4OB 4GGGA 2ELKA 1X1AA 3KP2A 4RM3A 5M3MJ 1W36C 1ULYA 2FU4A 3RQ4A 4XSZF 2WB1A 1SD4A 2O8KA 2NVYJ 4PJNA 4B43A 3DQVC 3LOCA 4PJJA 3S1QJ 2E1NA 4N9HA 3BR6A 3H3UA 4R1HA 3CC4I 1U8RA 2DI3A 4YFKF 2NVXJ 3TW6A 4FQGA 4Z6YA 1KQ8A 2HTJA 4LIVA 1IAWA 3K4JA 3OIQA 5IOYA 2JVGA 3VEPA 4PSWA 5KHDA 4A12A 4B4CA 1P7JA 4XLEA 5J1UA 5C4XJ 1X2NA 2J5OA 3LA2A 3TO7A 4EJUA 2F5EA 4JYKA 3BQZA 3IAS2 3QOPA 1CGPA 3IH3A 4AIJA 3G3ZA 4N0BA 2L3DA 3FHZA 2A05A 1IF1A 2HNHA 1J9IA 1ON1A 4NBQA 3IRRA 4JX4A 3GCMA 3BG6A 1BN5A 2A3SA 4M71A 5J6XA 4BDZA 2M3AA 2UXXA 4UUTA 3LSKA 3J7AY 3K0LA 4IVNA 1R5ID 1F9NA 4KN7X 2CRGA 2V9KA 1HKQA 1UHSA 2HWVA 2M9HA 3DTEA 3IL2A 2A6HF 5HDNA 5J8CA 2DAOA 3QU3A 4U88A 5DM6F 2AQFA 2DA7A 3CCMI 1K61A 4EM1A 1YX5A 4QLCU 1QVTA 5JHUA 4LLGF 4ENMA 1T39A 1E17A 1L0OC 4OOIA 2MD5A 3OYKA 3GFJA 5IT9Z 3CO7C 1IRXA 1D0YA 1P7IA 1D1AA 2FRHA 1HA8A 5K1YA 4FHTA 1ZH5A 1CF7A 4L5IA 4CUGA 2RVCA 3J81Z 4A5NA 1OYYA 3MFKA 1JUSA 3JRCA 3G2BA 3HSFA 1X1PA 1KU2A 4FTHA 4A3KJ 1WSUA 3SJMA 1JGSA 1T6SA 3X2QH 3HZJA 4P1WA 2G7HA 2KLOA 1LDDA 3A1YA 4BBRJ 4CYCA 3LNQA 1SC7A 3ERMA 1UB9A 4Y15A 4RLQA 3O8GA 1RZ4A 3S3MA 1S5LC 2BEOA 2F4MB 5A2QZ 3LSRA 1N77A 3PQKA 5HVQC 4M9ZA 3U21A 4BQNA 1A35A 2Y9ZA 2V26A 1YG2A 2KDZA 3RIRA 1YRNA 4ZJZA 4EM0B 4RLFA 3DU6A 2R7WA 2V6EA 3OYMA 1MBFA 2ZO4A 1RR8C 2H27A 1FP2A 4G9YA 2P7VB 1FWZA 1HDDC 3KZIC 5J4VA 1WJAA 2Z16A 1ACIA 2DQRA 3AG1H 3WU1B 3FBIB 1MKMA 1UG2A 4M3DA 3KE2A 3MAJA 2JA6J 3E3VA 4L9JA 1JJ6C 3PJRA 2Y0SN 2JPBA 3BG5A 1U9OA 3LSHA 3ZOBA 5ILUA 3RKQA 4HG2A 3PNYA 1GV5A 2VIXA 1O3SA 3G6EI 1WI3A 1FLIA 2YU3A 3BTIA 1DP7P 4N4NB 2X51A 2KT0A 2UZKA 5LD2C 1J0RA 3DF8A 3P7NA 4F3QA 5E3NA 3W2AA 2CQNA 2F6CA 1J09A 4PK4A 4E7SA 2FOWA 3PL8A 1V3FA 4HX4A 4CO8A 1YHQI 3DKYA 2VBYA 2P4WA 3ZMTA 2LDUA 2ZSIB 3GFMA 3ULQB 3RKYA 3Q0UA 2CUEA 2FJ1A 3DEUA 4L9VA 1FC3A 2YSRA 3OYAA 2FX0A 2QKLB 4BBSJ 1T95A 4AC0A 2XSJC 2OU2A 2R7VA 2EFNA 2QZ8A 1A36A 2VBWA 3WTYC 2KIQA 2X6YA 4I09A 4LG0A 1YO5C 3JRAA 3ZN1A 3ZQGA 4IHTA 1VQ4I 4M3EA 3T8RA 1WI9A 1B8IA 2DYRH 4XNFA 3GTJJ 4GRIA 3NWSA 1V5EA 1A6QA 4D0PA 1USTA 2XB5A 2A07F 4D5CA 1S8NA 2FNPA 2MBFA 5L3BA 1DGRM 4BEHB 2IS1A 1YRNB 1J5YA 2WC2A 4NQWA 4YIRX 4IHWA 1BM9A 3QQAA 2K3FA 2E5ZA 2JA8J 1YW9A 2VL8A 2GAUA 1TWFJ 5L3GA 2Q0OA 2EV6A 2R93J 3F22A 2FBKA 2EFPA 2E1MC 2JK3A 2X48A 2COBA 2LF7A 2MFZA 1IXSB 2IGKA 3LWFA 1LFUP 5F0CA 2OAZA 4U0VA 4WX9A 2VT3A 3TEDA 3VODA 4GCVA 4AWXB 2K3PA 5FLMJ 2DFHA 1B59A 5DCMB 4AM3A 1V5GA 4ITVA 3ZMZA 2R7ZJ 2PBIA 2IXSA 2P5KA 2VXZA 1VQNI 4D5FA 4HX8A 4F91B 4Y7NJ 3CP8A 5M5XJ 2KZVA 3WG9A 3AAFA 3DXJF 3QP6A 1RC9A 1VF9A 2RAEA 3E5QA 1MMDA 5ICEA 1AU7A 3MKLA 4RAYA 2GOXB 3H0GJ 2VASA 4FE7A 2HQNA 4XKVA 2ESNA 1JKOC 2IP2A 5C44J 5FB2A 3T5XA 3FWEA 1D1BA 2GQQA 2DK5A 1ETXA 2HDDA 2XAUA 3CJNA 1WJFA 2XRNA 4CCMA 3ABKH 2DMQA 2BY3A 3S3OA 1LDJA 1O57A 1XG1A 2AHQA 5L3EA 3JW4A 3HOYJ 1ETKA 3RZDJ 2DJIA 3QPTA 3JSOA 2ZB9A 5FROA 2WY7Q 2FMLA 3LL7A 2DA4A 5C4JJ 4RGSA 1MBKA 1X3WB 2L7MP 3CUQB 2EFQA 2VB6A 3EYIA 4LOCA 2P6TA 4JBAA 5IYBJ 4ESBA 1D5VA 5FLVA 1RKWA 4JP0A 2V9VA 5F08A 2OQRA 2I8DA 4L5EA 5EJCA 3SXYA 4G6TB 1SVMA 5B1BH 4YFXF 1A04A 4UNOA 3V42A 3VFZA 2GIVA 3L2QA 2PN6A 1HF0A 2F2EA 4HEA2 3HOSA 3DLLF 2A61A 3ZMSA 1B4AA 5EG0A 2UXNA 4PJMA 4PGGA 2H09A 2MA3A 1NK3P 1ZRCA 4FASD 4UB6C 4BQOA 4HW0A 3MVPA 3SZPA 3H9QA 4RB0A 1ZRDA 4BEHA 3PIPF 3MKWB 1IXRC 3PUBA 1YITI 2M0MA 2XF5A 3OIOA 5DYMA 5GP9A 1FTZA 1W0TA 4XQFA 1BOAA 1TW3A 1J2XA 4MFDA 3RKXA 3FXKA 3G73A 2P81A 3BDDA 1XD7A 4DW6A 5LGUA 4M73A 3ABMH 1U5TB 1FP1D 1TWCJ 3E7LA 3FISA 2DFFA 3RYRA 1TC3C 3U9GA 4XOTA 3KEQA 1X1CA 4CSWA 2DODA 2X1CA 5J40A 4WCGA 1SAUA 5D5WB 2H8WA 2VKVA 3CP2A 2PMHA 4UUSB 5EF6A 1I1SA 1FT9A 3AG3H 4RBOA 1LE8A 1EH6A 4B1RA 5GPCA 1R9TJ 1FYMA 4CH7A 4IKFA 2QSFX 4RM2A 3I58A 2K40A 3CUQC 3U1KA 4B3AA 5ILVA 4XKCA 1U5TA 5K5QA 3J81K 2PJRB 2FBHA 1USSA 1XSVA 3CJTB 3LA3A 3IP4B 3F72A 3VB2A 2EIJH 3LAJA 1JGGA 4KMUX 4LD5A 4C2UA 2IRFG 1PP8F 1YI2I 2DFEA 2MC3A 3W6JB 3CCVI 2NOGA 1VQ5I 3HPHA 3P5JA 3T8TA 4EM2A 2ID3A 4RB2C 1W5TA 4LIUA 4PUSA 1DPUA 3KX2A 2DTZA 4LK1F 4HA8A 2A5WA 4RGRA 3QRFF 2HVSA 3QPSA 4YELA 2P6SA 3HG9A 3HRUA 1Y39A 3H3VK 4HBLA 3HPGA 1H8AC 3UKGA 2L54A 3LQQA 3OYIA 2IEKA 2E2IJ 2R7FA 1R22A 4Y33A 2HEOA 2VT2A 5H20A 4HQEA 4M3GA 5F0FA 2XGDA 2HYGD 2K9NA 1Y0NA 3WE2A 4XRFA 5E18F 3COAC 4KICA 3DKXA 3CO6C 3CC2I 2HKOA 3IKVA 2VLAA 5FFZA 1IN6A 1U78A 2F5CA 2ZBKA 5BOXA 4JX6A 2FBIA 1R5HA 3K70D 4ON0A 1X19A 3CCSI 2K7LA 2KL4A 2K9QA 1YYVA 4BHCA 1OR7C 4E70A 2FOKA 1MMNA 3A4CA 3LA7A 3J7YJ 1SFOJ 1R4NB 3V7RA 2KDOA 1UHWA 2WY8Q 4ENNA 5JLXA 2YPRA 1EF4A 5FD6A 1KQ0A 1YJWI 1OQYA 2DA1A 5BPDA 2W82A 2XPVA 3M1CA 1K83J 1VQ7I 2CGPA 3H92A 2L01A 2DMPA 3BR5A 3F3XA 2O0YA 3ZQIA 1GUUA 2BVMA 2M1BA 1WPKA 2NVTJ 1B1BA 2PFBA 2NOJB 2XAFA 2FEZA 4RB3C 1ERDA 1E3OC 1D5YA 4ESJA 2JVHA 4BU2A 5K7HA 3HHHA 4WXCA 2V1UA 2M7AA 5M5YJ 4BE0A 4IRIA 2VOPA 3CMAI 1TTYA 1TLHB 3MMYB 2ME6A 2FNAA 2HXOA 1ZHFA 2E71A 5GTIC 2F5VA 1ETYA 2CYYA 3I5UA 2PI0A 3OSGA 4IHVA 2G0EA 1KONA 2HYFA 3A03A 4B09A 3CESA 3AG4H 5E3OA 3JTGA 3GUDA 3FXMA 4BXUA 1BIAA 2NS8A 3OYNA 5FRMA 3G4SI 4BE1A 4HDUA 2O8XA 3VSKA 2LKPA 3UNGC 2HPIA 5ED4A 2VKDA 1FYLA 2BY0A 1LE8B 4C30A 2Z3YA 2Z2SB 1S3JA 4IJAA 3S2WA 1K4SA 1BOBA 2JQ7A 3D1NI 2GLOA 5LRRA 1XPXA 4KUMA 5L3CA 1U6GA 3PSFA 5TRDA 4LLNA 2QLZA 2QBYB 2DT5A 4P55A 3OR1C 5J1RA 4HX7A 2ZFUA 2FA5A 1DPRA 3KIOA 3CDIA 4R8HA 1DDNA 3M1EA 1LVKA 3F0CA 1Q1HA 2BY1A 2CFXA 4HOBA 1VQ8I 4ZZDA 1XS9A 1F36A 2VQGA 2PJRA 4BXXJ 4BXFA 1TT5B 5ILSA 3K6GA 3WGHA 4F52A 5LBQA 2GBYA 3BTJA 1IW7F 1GXQA 3CMMA 4IEJA 5ICCA 2RGVA 3R61A 3RYPA 2GOMA 3V4GA 5J1YA 3QWLA 2XAHA 4CCOA 1T33A 1JKPC 4OMZA 4P5OA 2X0LA 4KITB 4OIRF 3R0AA 5C3EJ 2EILH 1P4XA 4LG3A 1K6YA 3OYBA 3BZKA 4HF0A 4KIBA 3L2CA 3HKZN 4GDFA 2H1LA 3HJEA 3U1DA 2Y2ZA 1R49A 2TDXA 3I59A 1IRFA 2QBYA 3FF5A 4HDVA 4XL9A 4BE2A 2DMNA 4NDLA 1FJLA 5FD5A 1IN5A 4N9IA 1D8KA 2IW5A 1I5ZA 4II2A 4ESFA 1J7KA 2RREA 3GZ5A 2E2JJ 4OMYA 2LVSA 1A31A 1ORKA 2FF4A 2NNYA 3BR3A 2QQ8A 4KT6A 3ZMVA 3M8FA 3F21A 4ZYEA 3IH4A 3RZOJ 2XKPA 1ODDA 4I98B 4BUPA 1G4DA 1KA8A 4XRSA 1O7FA 2KQRA 1T98A 2ADUA 2DA3A 2YX7A 1FMWA 4GO1A 1RESA 1ZKGA 4HYEA 5HODA 3J80K 2O61A 4BY7J 1ZRFA 3C18A 3PM1A 3CZ6A 1UAAA 1HW5A 4XLNF 2ZCWA 5DEQA 2Y75A 5KAIC 3S14J 4BNCA 5LRSA 1BJZA 1Y56A 3MN2A 2OTLI 2H94A 4CYCB 4A2UA 2JTVA 3F8NA 3K10A 1MBHA 4UB8C 1AOYA 2PMZA 3RTRA 3HRMA 4B47A 2ELHA 3FXUA 2ZFWA 2STTA 4FE4A 2WWYA 1I27A 2E7XA 2R5YB 1TP4A 4IRHA 4E7JA 1O3QA 1X4PA 3G1OA 5TISC 4OINF 1W36D 3DKWA 2HKXA 2LC2A 4Z2YA 3ZPLA 2CH0A 2ID6A 3D5RC 2LP0A 3JRIA 2EFWA 3F8FA 3FK7A 1ZAOA 5FKLA 1JKRC 2VJ4A 2WAQN 2VI6A 3PO3J 2F4IA 1TNTA 5CLSA 1KGSA 2VOOA 2L7FP 3HGYA 2QGUA 3DEWA 1NH3A 2EZHA 1YFHA 3H5AA 4ZYAA 4S05A 4I76A 3GYHX 1IRGA 5HDGA 1R58A 3QOEA 3L2RA 2P5LC 5FRNA 4XLAA 3WU0A 3MQ0A 3OY9A 2RQPA 3OYCA 4I01A 3KPHA 3HTSB 2ISZA 2Y48A 2E1CA 4YRVA 3WHCA 5EZHA 1GV2A 3S17J 4X0GA 2PLYA 3F6OA 3NEUA 4K2EA 1TBXA 1WRJA 4CA0A 2BGCA 1X2MA 1W0UA 2NYXA 4DOZA 1R00A 1O3TA 2KIMA 4G8XA 2GA1A 3S93A 2R92J 2OPTA 2HXIA 4AUXA 3OMYA 1Z0XA 3PSIA 1FZPB 4PFPA 4B3XA 3V7CA 1XMKA 1GHCA 1Z1DA 2ZJ2A 3OS2A 1OCRH 2DJNA 2Q2EB 1S7EA 2LR8A 5GTHC 2EIKH 3GLXA 1WGXA 4WXHA 3EDPA 4XIDA 2QKMB 1RI7A 1W7PB 2LBFA 3KP5A 4IHSA 1VQ9I 2HFHA 2PX9A 1SVLA 1X1BA 5CVIA 3ZN0A 4C3IJ 2JWTA 1MMGA 4WXDA 2P5VA 4UUSA 2LD5A 4ZYDA 3MKZA 5FKKA 1PP7U 4KN4X 1F43A 5E79C 3LFKA 4MTEA 3OSFA 4DYRA 3NAUA 2DPUA 1SMYF 2EPFA 2HU9A 3KP4A 2LKXA 1YJNI 2K9LA 3ABUA 5DD8A 1LQ1A 1KYZA 4BDYA 2VKEA 1RKTA 3WG7H 4RMNA 4RAGA 1OCCH 2MH2A 1MBGA 1AA7A 5F0HA 5EGOA 4A3CJ 1VQ6I 3BG3A 5HLGA 4UY8I 3WTZA 5HDKA 2BYVE 2QF7A 2B0LA 4YFNF 4HNTA 1JKQC 5FGMA 3K2AA 5D4SA 2L5QA 5CPRB 5FO5A 3E1SA 2OZ6A 2PMZN 1MNDA 4EJVA 4A93J 4MEYF 4ZDPA 5FJ8J 1MMAA 3L2WA 2ECCA 4OAZA 3HRSA 1HW2A 3HSRA 2BW3B 2L9RA 1XMAA 2JA2A 1Y6IA 1S29A 1JE8A 1TNSA 5L3FA 4BACA 2XPWA 3HL2A 1ONVA 2X6WA 4MIMA 3EUHA 1IJWC 4HV6A 3V7SA 3KZYA 1X58A 4G7OF 5E1WA 4BQQA 3WE3A 2DOAA 1QHGA 1WKMA 2R7OA 3SZTA 2LKSA 4XKWA 1MMSA 1GVDA 5HLIA 1CF7B 1IN4A 2P8TA 4RGXA 2LLKA 3LQRA 3FXQA 2MLKA 2Q1ZB 3E97A 4EJWA 2HQAA 4KFCA 2FXAA 2KFDA 1R4MB 2BBYA 4J19A 3BZ6A 3H36A 3DPTA 1B72A 1OFCX 3I0TA 2V1XA 3I56I 3DBLB 1DGWY 3WTVC 5H6RA 3TOBA 2D1VA 2W57A 2VC1A 2JA7J 4PZJA 1RRJA 4MFEA 1QZYA 4DQ2A 3K4CA 5E3MA 5LHGA 2EV5A 1MJBA 5HNHA 1U2WA 1D3YA 5E3LA 5LFAA 1R23A 3J80Z 3KEOA 1YS7A 3K1PA 2MD0A 1AKHB 5ICFA 1ENHA 2XVCA 1X4OA 2RC4A 4Y3OA 3QYFA 3OL3A 3GMEA 4CCNA 2ICWG 4NUBA 2FSWA 1MGTA 2MC4A 1YW7A 1SD5A 3K4BA 1XB4A 1R6RA 2JPCA 2DMUA 1E3HA 1MJ9A 2CV0A 3GEZA 4TV7A 2JRTA 1VQKI 1BJAA 2HQ5A 1I3AA 4I0BA 3GWZA 4AYBA 2AO9A 1OYIA 4UVAA 2VUMJ 1X1DA 1JUPA 3CLOA 2IGNA 1BW5A 4CCKA 2RN7A 4UUVA 4QTRA 3EUAA 2YU9J 1N75A 4ENKA 5GAHJ 3I9V2 2V6CA 1UELB 3RCOA 1H88C 4KDPA 2HOSA 2B9SA 2XDVA 1QO0D 4IQJA 4HNUA 4NQWB 2BVLA 2IGMA 2RNJA 4H0EA 1UJ8A 2L9NA 4XLHA 2VN2A 4IF4A 4U87A 3M3YJ 3RPQA 1GVJA 4DBRA 3W2VA 2ACJA 1R1UA 1SVOA 2FQ3A 3IWZA 2Q8KA 5EEAA 3V8JA 2UUZA 3D5SC 1WJCA 4B8XA 1YX3A 4D7NA 3R6SA 2VBZA 5IP7J 3WTUC 1RUOA 1W4MA 4A5MA 5GAGJ 1JHFA 2OJED 2VPRA 3GX4X 2R5ZA 2X9DA 4YEJA 1EV7A 2L0KA 2V1NA 3Q0WA 2V4JC 1GDTA 3IHUA 4NC7A 2RNGA 2IS6A 3IC7A 4DZPA 1Y8RB 2ZMEA 1OLTA 3OV8A 2OZUA 2CJJA 3Q9VA 4IZZA 3H9JA 3PO2J 1N78A 3RI4A 3FBNB 4A3GJ 1JUMA 1Z6TA 2LSOA 2CUJA 5AIPA 2VPLA 2CU7A 1OISA 1FSEA 1T0FC 1KZHA 1W5SA 1XSDA 1IDYA 2XGXA 1UZCA 5DUKA 5KVRA 3CDLA 2OTJI 3EUHC 4HSRA 3DTKA 1OKRA 4OIPF 1TT0A 2EQRA 2CQKA 2XIGA 5FKNA 3A01A 2V79A 2A68F 3MD2A 3RSNA 3DTIA 3K4KA 4B48A 4PFOA 2RDPA 1IRZA 2WV1A 1MZBA 2IBDA 2MSYA 2ZNZA 2MGQA 2R5ZB 1VFCA 1REPC 2CS3A 2DU9A 3TO9A 3F6VA 1LKXA 4KMFA 4M6VA 5IP6A 6PAXA 2GXGA 1AWCA 2IS2A 1XGNA 3LMMA 2R7DA 3ZQ7A 3ZXSA 1XTAA 5J8FA 4XBFA 5GADJ 1HC8A 3E5UA 3MCZA 2L7KA 4A3MJ 2CQ7A 2FMYA 4QPOA 1XGSA 3ZP5A 3E6DA 4I99C 2HQRA 2JRMA 1JHHA 2K4JA 2MABA 2R7SA 4DIQA 2L9SA 3S15J 3K9TA 2WAEA 3BPVA 4M3FA 3KYDB 4NC8A 4OIOF 4E6KG 2DT7B 1QQIA 4ZTJA 2HPMA 1FOXA 1Z05A 1F1ZA 4X1EA 1E0EA 3SDBA 3HB9A 3O8HA 3BG9A 5CJ9A 5DS9A 2DBBA 2EA2A 3O3KA 1NK2P 2CQXA 3PNVA 2B7EA 1JTXA 3GTLJ 2JT1A 5CVJA 3H0DA 3LSTA 1RPWA 2B63J 2IAIA 3VOEA 1S7OA 3GZNB 2X4HA 3REOA 3MKYB 2MH9A 3RJPA 2MG4A 3OYDA 3NQOA 3G1MA 2DQLA 1VI0A 3E6BA 1ZTRA 3M9AA 1VQMI 3BY6A 2NS7A 2F5DA 1EJ9A 1B9MA 2F5FA 1P92A 3OL4A 5JFRA 2VODA 2R7TA 2Z1DA 4P9UA 4ZYGA 3K4LA 4UV9A 3ZQQA 2HOEA 1IG7A 3AFHA 2EWNA 4ASNA 3T0YA 1LPQA 1MIJA 2EK5A 3M4OJ 4H4KC 3EPZA 2AQEA 2BV6A 1ZGAA 1V4RA 2YS9A 3KFWX 2NNNA 4KA4A 3CCLI 1FBSA 4Y52J 2NAZA 1ITYA 3GXOA 2H6BA 1SD7A 3ZMDA 3T1BA 2H8RA 2XF6A 2L2OA 1ZGJA 2KIUA 3CCQI 3GTGJ 5E17F 1JXSA 1HSJA 5F27A 1RETA 3L00A 1T08B 1V54H 1WJDA 2BW3A 4I2OA 2EFOA 1GT0C 1B9NA 1H9TA 4EJOA 4J01A 5IT3A 4BY1J 4BL0B 2N8GA 5FLXZ 3TL4X 2XROA 2E5NA 2KRFA 2DW4A 3PNTA 3RKWA 1Z77A 2KZGA 1IUFA 1SANA 1BC8C 1DU0A 1C0WA 3OS1A 1QPIA 2E60A 1FOWA 4RDUA 1I6XA 2GM4A 2ZMEC 4XRMA 3OWTA 1Y0UA 1MW7A 3F23A 3KP3A 2CO5A 3FMSA 2M5WA 3SEQA 1MDMB 3WGIA 1S9HA 3GO5A 5B3SH 4CCLA 1U3EM 4XOPA 3SYTA 1ZR2A 5TJJA 3HXLA 3LFUA 3U2RA 4G6QA 2IA0A 3L2UA 1RR7A 1T8IA 1S6LA 4ABZA 4XLCA 3DEEA 3MWMA 4M74A 5IT9K 4N4OB 2LRDA 3I54A 3AG2H 1GLNA 2QUFA 3TOAA 3C2HA 3QP5A 1MNMC 1OYWA 3F8MA 2ETHA 1IV6A 1XDUA 3HOWJ 1PVEA 2VKHA 1I3QJ 3P9IA 2BHZA 2HGCA 1Z6RA 2BXZA 2JSCA 2Y30A 1K78A 3GTQJ 3J7ZI 3ONQA 4BQAA 4A0YA 3FX3A 4A6DA 5GAEJ 3QYBA 1Z9CA 4CYDA 2KISA 5F04A 2A69F 1WCMJ 3VYTB 5DV5A 1QRYA 3CCEI 1T56A 2M87A 3H5NA 1R7JA 2CV2A 3CCUI 2JA5J 3IUOA 2EINH 2M30A 3E6CC 4IQ4A 1FIAA 4PGHA 3BR1A 3ECHA 3MZ8A 4LJZF 3D0SA 4BGDA 3N05A 3IKTA 5LGTA 1R1VA 4RAFA 4E7KA 2XGEA 2ZSHB 2BHYA 4E7LA 4XICA 2LTPA 1D0XA 2XAQA 1YQAA 2R4GA 4IHXA 1R5GA 2IGOA 4QWQA 5F1JA 3OYGA 2JUCA 3PUFA 2K9SA 1I1GA 1LFBA 4CZCA 2HS5A 5HNFA 1VZ0A 2ELJA 2Z33A 2W7NA 2Z99A 1BR2A 1FIPA 2DTRA 5FKOA 3FMQA 3DLAA 1FBQA 4C2TA 1W7PD 5HS7A 4LMYA 3ZQFA 1CQTA 1U0JA 1WFXA 4DZJA 4L18B 3GTPJ 2WA0A 2CUZA 2ESHA 4IX7A 1WVRA 1YW8A 4A3FJ 1O7LA 2QWWA 4O3MA 4BKXA 1LDKB 1IN7A 2Z5UA 5K7ZA 4NB5A 4HF2A 2E7WA 3CLQA 3VWBA 1SFKA 1MBJA 2GIZA 2XKOA 2GZWA 4GXOA 3W6VA 1YLFA 2X1DA 2CSOA 1G3YA 1KU3A 1PYVA 2E2HJ 2QVOA 5BMZA 1JT0A 3JRBA 3DCFA 2EZKA 2L4AA 2M2EA 3F8CA 1Z67A 4RGUA 5IPAA 1MNEA 2V7FA 3HM5A 3CCJI 2IJLA 2E35A 2HI3A 3CJRB 5F64A 2DYSH 2FUG2 1WZ2A 4O6JA 1G3WA 4ETSA 5HLTA 4JOMA 1OCZH 4XSXF 4I0AA 3W6KB 2ZNYA 3TKYA 3I55I 2E19A 4OU0A 2TRTA 3NWTA 3GVAA 4A0ZA 3TMOA 5B1AH 3S8PA 4EGZA 1U8BA 3GW2A 1YIJI 5H6QA 2Z9OA 3NARA 3HOZJ 2CFOA 3UR3C 2ZC2A 4W1UA 3BTLA 5E8IA 2QSGX 5ERIA 3AL0B 5LGNA 2IA1A 3VYSB 3KP7A 3SFIA 4AVPA 4C9YA 2DA5A 2OC6A 1ZG5A 1TW2A 2LK2A 2LY2A 3A0BC 4PSXA 1BIBA 3FMRA 4V2GA 5BNGA 4ZTFA 5CYVA 1JT6A 4HRIA 2DT6A 3WU2C 1TZLA 1G2HA 4BS9A 4A3DJ 5LHIA 3KEYA 1L3LA 1RUNA 1QVUA 2DXIA 2EZLA 3EQLF 2HZDA 2CMPA 2COMA 1QZEA 2CQQA 3BG7A 2Y9YA 2IS4A 1AKHA 4LB6B 1EA3A 1NG7A 2D45A 5FFXA 3GTKJ 2OBPA 2KP6A 2KMUA 3GF2A 3L09A 1XN7A 2ZJQF 1P9QC 4DJAA 2V9PA 3C7JA 5KNLA 4S04A 2M7BA 2HOAA 1IZ1A 3CF5F 2O5RA 4B44A 2EH3A 1RNLA 3EETA 4EV0A 1XGMA 3R60A 2O3FA 2WV0A 4I02A 2HDCA 4FCYA 2EB7A 3KCCA 3HOTA 1MBEA 2TCTA 4Q47A 5TGTA 1OJLA 4BYYA 1HKSA 4RA2A 4BH9A 1T38A 1NHAA 1F4KA 5J3LA 1BA5A 3GTOJ 4DBQA 4MEXF 3HC7A 3DPLC 2DK8A 4ZDLA 4OAYA 5FLXK 4EEFG 3PIOF 3H35A 5JLWA 2HTSA 5EGOB 1FX7A 4DNCA 3JRGA 2DPDA 3LSIA 2E34A 2Y0SA 3ELKA 2MYSA 5M3FJ 3C1DA 4UV8A 2W84A 4RS8A 2KPMA 4AU7A 1P4WA 3WODF 4LGWA 2W4SA 4DGWB 2ECBA 4G94A 3ZRGA 4IHYA 4AVZA 2DA2A 2X6OA 3SFZA 4MO7A 2HVQA 4BAYA 2HZTA 3W3CA 3I3LA 1KYWA 2D1HA 1JTYA 3HRTA 1LFPA 3CF2A 1Z21A 5AIQA 5IYCJ 1WJEA 2ME0A 3KP6A 1FYKA 3FM3A 3FXJA 2YR2A 3HDDA 1BW6A 3OOPA 5DCFA 1HCRA 4A3EJ 3BJ6A 1G6NA 5E1XA 3C3WA 1YS6A 3SEZA 2X1EA 2GXAA 5JR3A 3FDYA 1ZGWA 2CWEA 4DYQA 1M1EB 2FD5A 1ETQA 4MTDA 4HZFA 2LNBA 5JVTA 3I4PA 5EG0B 4CZZA 3VYUB 1Z91A 4EATA 2O6GE 3AL0C 2R7RA 3VSLA 4CXFA 1DU6A 1A5JA 5KAFC 3BR0A 2VQLA 1O3RA 1VQOI 4XLPF 1VQLI 1TL8A 2HYJA 4KT5C 2XRLA 4KJZA 4A6EA 4OIQF 4Q5SF 4HPQA 2Y0MA 2L02A 3B6AA 1OMIA 1BI0A 2G7UA 3CTAA 1Q1VA 1V55H 3CUQA 4PJ0C 1APLC 2A5YB 4F7ZA 3OIPA 1A6IA 2OA4A 3OYLA 2VE9A 5M5WJ 2Y31A 2XPUA 2GA2A 1T0FA 2VXDA 3S1RJ 3OS0A 3SZGA 2XASA 3GBGA 1ZELA 4FETA 4GYGA 1R36A 1KU9A 1QNTA 3QODA 3KLNA 4Y13A 2E1MB 4HF1A 3CCRI 4MQ9F 3KLOA 5A2QK 4I7HA 1B6AA 1W1WE 1K7AA 1ZG3A 2W25A 5HOOA 4JQFA 3WGGA 1Y8QB 4JK1X 2W1OA 2KKOA 4XKBA 3BWGA 4ZC3A 2LH9A 1MJAA 3K69A 4GFBA 2GWRA 2VJJA 4NHJA 2KRHA 4A3LJ 4S0HB 2M0CA 1ON2A 2LF8A 2V1DA 1XGOA 2VQCA 1LEBA 2VQHA 1B72B 5BPIA 1PUFB 3TDZC 4CDGA 3QAHA 3HIFA 2O9LA 4D9JA 2RV8A 4A3BJ 1FTTA 2VBXA 4U7BA 1FOKA 1HLVA 3WTWC 3WTXC 2OCEA 3IAM2 1DP3A 4HV5A 2R5YA 2RQQA 5AONA 4P96A 1HSTA 4XN0A 4BJTA 1BR4A 1E3PA 3K1NA 4PDKA 4XM3A 3LSPA 1OR7A 4UVCA 1FBUA 3TW7A 3LSGA 2AS5F 3RDIA 1QPMA 2R7XA 3VYRB 2PG4A 1S72I 1UHMA 4KIFA 4F93B 2BXYA 1HKTA 2QQBA 3H9GA 3DU5A 4ANJA 1WJBA 4KYWA 1QBJA 4MNUA 2H1KA 5BQTA 3KYCB 2LYCA 2OQGA 3KZZA 3A0HC 2L4MA 3GLLA 4EJTA 2RKHA 2OV7A 1FPQA 2PJPA 5DDGA 3O6BB 3K70C 3HBLA 3CQZJ 3Q0VA 3JRFA 3S2HJ 3S1NJ 1ZQ3P 2XB0X 1IC8A 4LB5A 4XK4A 1BI1A 2QEXI 2W24A 3ZQLA 4FX0A 2NVQJ 2K5CA 4XN3A 1UMQA 3R0JA 4QPQA 1RIOH 3CDHA 2JJ7A 2JMWA 3QU6A 2DFIA 1PDNC 1OPCA 1XC5A 2NXNB 2PEXA 3BR2A 1OCOH 2XF7A 2ZMEB 2PQ8A 4WF2A 3Q3SA 1GXPA 2HVRA 3B6CA 3BP8A 4CHUA 1ETVA 2E36A 3ROUA 3SHFA 1TWHJ 3L2VA 2QM3A 1SD6A 4LK0F 2HOTA 3K1MA 3TDUC 3ZMUA 3R4KA 5E8GA 4Q4ZF 4GYIA 5DTDA 3IH2A 4LITA 4E7ZA 4AIHA 3L1PA 3I59B 2D2WA 2LMDA 3BLYA 3B73A 1W7PA 2LBFB 2UWMA 4AD9A 2LREA 4L5JA 3I53A 2JZYA 4M6XA 2DLLA 2K4BA 3A2KA 5EEHA 1EH7A 1VTNC 5L3DA 4M72A 1H9GA 4EQQA 4LFUA 4XORA 2XV4S 2XC7A 5KCMA 4JX5A 3VPRA 3BPXA 2CW8A 3BCAA 3HTUA 2L7ZA 4V2FA 3RPUA 3ZGKA 1T2KA 1N25A 3IWFA 2MW8A 2NS0A 1QHHD 1WH7A 2K9MA 4HQMA 1K4TA 2P7CB 3QPHA 1XDSA 1VNDA 2BZTA 3OYFA 3H5RA 3EYYA 3C2BA 5D5XB 3HGGA 1QA6A 2E1OA 2ZJRF 1FEXA 3G1LA 2LY9A 4E4HA 2QA4I 1MSFC 3JAMZ 3JR9A 2STWA 5ICGA 3E0JB 1XMXA 3HUGB 3HOXJ 3D5LA 3GZ6A 3BROA 2F48A 1VQPI 5JI6A 1K79A 2DCEA 3E5XA 5D4RA 3N4MA 1IDZA 2I5UA 4R79A 1ZR4A 1MH4A 5LLQA 1U5TC 3MEXA 3HYIA 1ZARA 1PUFA 3GFLA 4XMYA 3WTTC 3K4MA 2IVMA 4EVIA 4MQVA 1FY7A 3L7WA 1KU7A 5BS6A 3PQJA 3LAPA 3CD6I 4L0YB 5LEJA 4IOCF 5JVGF 3ECOA 1Y1VJ 3H1CA 3K7AJ 1IXCA 4I6ZA 2EV0A 4RAZA 2NRAC 1STZA 5DCMA 1BI3A 3BJAA 3HHGA 4OWRB 5KK1A 1V5FA 3GFIA 4E7IA 2ZXHA 3S2DJ 3CJQB 4QSHA 2DO7A 3PFYA 3S16J 3P9KA 2UV1A 4UXNA 2DDAA 3ZCOA 1G8XA 1YIOA 5IP9J 3GTMJ 4NC6A 3ML6A 3EUKL 3RPUD 1IUYA 1Z7UA 4MGRA 1G3SA 4PCQA 1WQ2A 4L9TA 2EZIA 4EGYA 1MH3A 2W85A 5IY5H 2DOEA 2KHMA 3OOUA 1FSHA 3FZVA 3JCUC 3OYJA 3TP0A 1SFUA 3HSEA 4ZYHA 2XAJA 3BT9A 5GPAA 5B66C 4P9FA 1YJ9I 3MZHA 1F5TA 3ASOH 4C2MJ 1DQUA 2IPQX 3BC8A 1EKEA 1TQPA 2XAGA 3WHBA 3FXLA 1I6HJ 1AHDP 2A6EF 2XSDC 3TBIA 3VDXA 1JI8A 3A02A 4YG2F 4Y17A 5E20A 5JHFA 3H3ZA 3ZR8X 2BOLA 2IA2A 4EMSA 3ABTA 4C3JJ 5K5RA 3ABLH 4FX4A 2VJ5A 4G7HF 2W00A 2M4GA 3DPUA 2A6TA 2ZXJA 2Y69H 4Y4RA 3K2ZA 3L9FA 5K7FA 3AKZA 2K02A 1SMTA 3WTSC 2WADA 3RQIA 1ZYRF 1SEUA 3Q5FA 1G3TA 2QQAA 4IO9F 4L0ZB 4L9NA 2DDBA 5J4YA 2EA4A 2C6YA 4U0WA 4YIFA 1UFMA 4A69C 5EYRA 4E7HA 2XGCA 4AIDA 1MD0A 1BL0A 1D0ZA 1W5CC 1R71A 3IRQA 3O2PE 1PJRA 5DM7F 4X6AJ 1B8IB 5H2FC 3JRHA 1J59A 1BC7C 2OCCH 1ZLJA 5DUIA 1U9NA 2W48A 1J75A 4WWCA 5IOZA 4HLXA 3I71A 3FKIJ 4CCJA 3JRDA 5D6EA 5D5UB 1D1CA 1TQIA 1E2XA 2QENA 5DD4A 3JSPA 2FE3A 2AXLA 2GXBA 5HS8A 2BE5F 2NVUB 3M7GA 1YOVB 5FKMA 3HKZA 1YE9A 3K4NA 2CW0F 3BCBA 4BHPA 2D5VA 4FT8A 1MDMA 5F1RA 4IL6C 4D1QA 3TGNA 2YUSA 2M8GX 2R3SA 4DYCA 2ZJPF 3S1MJ 2VJIA 3S32A 1K78B 2Q2EA 3C2GA 4M3BA 3W2WA 3F8BA 3IV5A 1ETOA 3FKJA 3V8KA 3OYEA 2M34A 1UG0A 3CCYA 3V8LA 4G6DA 5CKTA 3TP3A 3F9KA 1S7AA 4IPAA 3E6MA 4ZH4F 4XR6A 1LB2A 1NG6A 4IOAF 1Y1WJ 1H0MA 3G71I 3KYLA 1IV8A 2QYOA 2IT0A 2KJCA 1EH8A 5IYDJ 1TWAJ 1LJ9A 2EJRA 5D6FA 1ETWA 2LFBA 3ASNH 3P9CA 4ENJA 4A3IJ 2ISYA 5B5EC 1OCPA 1OCTC 3BJOA 2LOOA 2HDWA 3SQNA 1ZLKA 2DA6A 1TQMA 1WWXA 4Q48A 4HSTA 1IN8A 2O03A 2BY2A 3CMYA 2K86A 1XCVA 4IXAA 2QSHX 5J47A 2OF7A 4AIKA 3I4NJ 3DBHB 1K6OA 2JUGA 3M8JA 4HLYA 4RB1A 1BBYA 4HAMA 2K85A 1NTCA 4J00A 3FIWA 2XUBA 4MHGA 3CC7I 3DFGA 4UVBA 3M07A 3BZCA 2WTEA 3QPLA 2I10A 2CW7A 5CVRA 1XCBA 2M8EA 2PMUA 2MLGA 1QZZA 4FISA 1DUXC 5F6FA 3TQNA 1I39A 2VC0A 3JTHA 4M9XA 3I64A 4KISA 1Z7LA 2EIMH 5CVVA 3ISPA 3FK6A
chains in the Genus database with same CATH topology
1KQ9A 2HR3A 2G9WA 1PUEE 3N97A 2OD5A 4CICA 5K5OA 3DP7A 2M45A 4KIGA 1P6RA 1SAXA 4KNYA 3ERED 1BI2A 1R1TA 5E1ZB 5LHHA 1ZG1A 1HBXG 5D8KB 1LEAA 2YX4A 3PFIA 3BOQA 3HUGA 1SFEA 1P2FA 1FNNA 1P4AA 4ZZLA 5D5VB 3KETA 1XSXA 3FM5A 3TO6A 3J7AO 2H6CA 4CGZA 2J5PA 3M8EA 2CG4A 1QGPA 1ZREA 1LNWA 2KJBA 5D8LB 5CVUA 4WK8F 3B02A 2VONA 1HW1A 1HQCA 3Q9SA 1YTYA 4UHTA 4LG0B 1D8JA 1HXDA 4U7DA 4M9SA 4A0XA 4M6YA 3CUOA 4BHBA 2QQ9A 2KIFA 4U0YA 4LLLA 1ZN2A 3FXRA 5HLHA 1X3UA 3MZYA 4O5VA 3NRVA 4IRGA 2K27A 5EEGA 1UCRA 1LVAA 1SFXA 4G7ZF 3DV8A 4YIIA 5HS9A 2XHKA 3JAMK 5LEKA 2VE8A 2ZKZA 4GGGA 3KP2A 1ULYA 2FU4A 4XSZF 1SD4A 3DQVC 2E1NA 4N9HA 3H3UA 4R1HA 1U8RA 2DI3A 4YFKF 1KQ8A 2HTJA 1IAWA 3VEPA 4A12A 2J5OA 3LA2A 3TO7A 4EJUA 2F5EA 3QOPA 1CGPA 4AIJA 3G3ZA 4N0BA 2L3DA 3FHZA 1IF1A 1J9IA 1ON1A 3IRRA 1BN5A 2A3SA 4M71A 5J6XA 2UXXA 3K0LA 4IVNA 4KN7X 1F9NA 1HKQA 2HWVA 3IL2A 5HDNA 2A6HF 5J8CA 2DAOA 3QU3A 4U88A 4EM1A 4QLCU 5JHUA 4ENMA 4LLGF 1E17A 1T39A 1L0OC 4OOIA 2MD5A 5IT9Z 3GFJA 3CO7C 2FRHA 5K1YA 4FHTA 1ZH5A 1CF7A 4L5IA 2RVCA 3J81Z 4A5NA 1OYYA 3MFKA 3HSFA 1KU2A 1WSUA 1JGSA 1T6SA 2G7HA 1LDDA 1UB9A 4Y15A 1RZ4A 2BEOA 5A2QZ 3PQKA 5HVQC 4M9ZA 1YG2A 3RIRA 4EM0B 2ZO4A 2H27A 1FP2A 4G9YA 2P7VB 1FWZA 2DQRA 3WU1B 1MKMA 3KE2A 3MAJA 3E3VA 4L9JA 2JPBA 5ILUA 1O3SA 1FLIA 2YU3A 1DP7P 2UZKA 1J0RA 3DF8A 3P7NA 1V3FA 4HX4A 4CO8A 2VBYA 2P4WA 3ZMTA 2LDUA 3GFMA 3ULQB 3RKYA 3DEUA 4L9VA 1FC3A 2YSRA 2OU2A 2EFNA 2QZ8A 2VBWA 3WTYC 4I09A 4LG0A 1YO5C 3ZN1A 4IHTA 3T8RA 1WI9A 4D0PA 1USTA 2A07F 1S8NA 2FNPA 2MBFA 5L3BA 1J5YA 2WC2A 4NQWA 1BM9A 1YW9A 2GAUA 5L3GA 2Q0OA 2EV6A 3F22A 2FBKA 2EFPA 2LF7A 1IXSB 3LWFA 2OAZA 4U0VA 4WX9A 2VT3A 3VODA 4GCVA 4AWXB 1B59A 5DCMB 3ZMZA 2PBIA 2P5KA 2VXZA 4HX8A 3AAFA 3WG9A 3DXJF 3QP6A 3E5QA 5ICEA 4RAYA 2HQNA 2ESNA 2IP2A 5FB2A 3T5XA 3FWEA 2GQQA 2DK5A 3CJNA 2XRNA 1LDJA 1O57A 5L3EA 3JW4A 3QPTA 3JSOA 2FMLA 4RGSA 3CUQB 2EFQA 3EYIA 2P6TA 4JBAA 4ESBA 1D5VA 2V9VA 2OQRA 3SXYA 4YFXF 1A04A 4UNOA 3VFZA 2GIVA 2PN6A 2F2EA 3HOSA 3ZMSA 2A61A 1B4AA 2UXNA 4PGGA 2H09A 2MA3A 1ZRCA 4HW0A 3SZPA 4RB0A 1ZRDA 1IXRC 5DYMA 1BOAA 1TW3A 1J2XA 3RKXA 3G73A 3BDDA 1XD7A 5LGUA 4M73A 1U5TB 1FP1D 3RYRA 3U9GA 3KEQA 4WCGA 5D5WB 2PMHA 1I1SA 1FT9A 1EH6A 1FYMA 3I58A 3CUQC 5ILVA 1U5TA 5K5QA 3J81K 2FBHA 1USSA 1XSVA 3LA3A 3F72A 3VB2A 3LAJA 4KMUX 4LD5A 2IRFG 1PP8F 2MC3A 3W6JB 3T8TA 4EM2A 4RB2C 1W5TA 1DPUA 4LK1F 4HA8A 4RGRA 3QRFF 2P6SA 3HRUA 4HBLA 2L54A 3LQQA 2R7FA 1R22A 2HEOA 2VT2A 5H20A 4HQEA 2HYGD 3WE2A 4XRFA 5E18F 3COAC 4KICA 3CO6C 2HKOA 3IKVA 5FFZA 1IN6A 1U78A 2F5CA 2ZBKA 5BOXA 2FBIA 1R5HA 4ON0A 2K7LA 4BHCA 1YYVA 4E70A 2FOKA 3LA7A 3V7RA 1UHWA 4ENNA 2YPRA 5FD6A 1KQ0A 5BPDA 2CGPA 3H92A 2L01A 3F3XA 2O0YA 2M1BA 1B1BA 2PFBA 2XAFA 2FEZA 4RB3C 4ESJA 3HHHA 4WXCA 2V1UA 4IRIA 2VOPA 1TTYA 1TLHB 2FNAA 1ZHFA 2PI0A 3I5UA 2CYYA 2HYFA 4B09A 3JTGA 3GUDA 4BXUA 1BIAA 4HDUA 2O8XA 2LKPA 5ED4A 1FYLA 2Z3YA 1S3JA 4IJAA 3S2WA 5LRRA 4KUMA 5L3CA 1U6GA 5TRDA 4LLNA 2QLZA 2QBYB 2DT5A 4P55A 4HX7A 2FA5A 1DPRA 4R8HA 1DDNA 3M1EA 1Q1HA 2CFXA 4HOBA 4ZZDA 5ILSA 3WGHA 5LBQA 1IW7F 1GXQA 5ICCA 2RGVA 3R61A 3RYPA 3V4GA 2XAHA 4OMZA 4P5OA 2X0LA 4OIRF 3R0AA 1P4XA 4HF0A 4KIBA 3L2CA 3U1DA 2TDXA 3I59A 1IRFA 2QBYA 3FF5A 4HDVA 1IN5A 4N9IA 1D8KA 4ESFA 2IW5A 1I5ZA 1J7KA 3GZ5A 4OMYA 2FF4A 2NNYA 3ZMVA 3M8FA 3F21A 4ZYEA 2XKPA 1ODDA 4I98B 1G4DA 1KA8A 1O7FA 1T98A 2ADUA 2YX7A 4GO1A 4HYEA 3J80K 2O61A 1ZRFA 3C18A 1HW5A 4XLNF 2ZCWA 5DEQA 2Y75A 4BNCA 5LRSA 2H94A 4A2UA 2JTVA 3F8NA 1AOYA 3RTRA 3HRMA 2ELHA 3FXUA 2ZFWA 2STTA 2WWYA 1I27A 2E7XA 4IRHA 1O3QA 4OINF 3DKWA 2HKXA 4Z2YA 3ZPLA 2EFWA 3F8FA 1ZAOA 1TNTA 5CLSA 1KGSA 2VOOA 1YFHA 4S05A 3GYHX 1IRGA 5HDGA 1R58A 2P5LC 3WU0A 3MQ0A 2RQPA 4I01A 3HTSB 2ISZA 2Y48A 2E1CA 2PLYA 3F6OA 3NEUA 4K2EA 1TBXA 1WRJA 2BGCA 2NYXA 1R00A 1O3TA 2KIMA 4G8XA 2GA1A 1FZPB 3V7CA 1XMKA 1GHCA 1Z1DA 2ZJ2A 3GLXA 4WXHA 3EDPA 1RI7A 1W7PB 3KP5A 4IHSA 2HFHA 5CVIA 3ZN0A 4WXDA 2P5VA 4ZYDA 1PP7U 4KN4X 4MTEA 3LFKA 2DPUA 1SMYF 3KP4A 3ABUA 5DD8A 1LQ1A 1KYZA 2MH2A 5HLGA 3WTZA 5HDKA 2BYVE 4YFNF 2B0LA 5FGMA 5D4SA 5FO5A 2OZ6A 4EJVA 4MEYF 3HRSA 1HW2A 3HSRA 1XMAA 1S29A 1JE8A 1TNSA 5L3FA 1ONVA 3EUHA 4HV6A 3V7SA 3KZYA 4G7OF 5E1WA 3WE3A 1WKMA 3SZTA 5HLIA 1CF7B 1IN4A 2P8TA 4RGXA 3LQRA 3FXQA 2MLKA 4EJWA 3E97A 4KFCA 2FXAA 2BBYA 3BZ6A 3DPTA 3I0TA 2V1XA 3WTVC 5H6RA 3TOBA 2D1VA 2W57A 2VC1A 4PZJA 1QZYA 4DQ2A 5LHGA 2EV5A 1MJBA 1U2WA 1D3YA 1R23A 3J80Z 3KEOA 1YS7A 3K1PA 5ICFA 2XVCA 2RC4A 2FSWA 1MGTA 1YW7A 1SD5A 1XB4A 2JPCA 1MJ9A 3GEZA 4TV7A 2JRTA 1BJAA 4I0BA 3GWZA 1OYIA 4UVAA 3CLOA 2RN7A 4UUVA 4ENKA 2V6CA 4KDPA 1QO0D 2RNJA 4H0EA 2VN2A 4IF4A 3RPQA 1GVJA 2ACJA 1R1UA 2FQ3A 2Q8KA 3IWZA 3V8JA 4B8XA 3R6SA 2VBZA 3WTUC 1RUOA 1W4MA 4A5MA 1JHFA 3GX4X 1EV7A 3IHUA 3IC7A 2ZMEA 3OV8A 2OZUA 3Q9VA 3RI4A 1Z6TA 2LSOA 5AIPA 1FSEA 1W5SA 1XSDA 2XGXA 5DUKA 5KVRA 1OKRA 4OIPF 2CQKA 2XIGA 2V79A 2A68F 2RDPA 1MZBA 2ZNZA 1REPC 2DU9A 3TO9A 3F6VA 4KMFA 6PAXA 2GXGA 1AWCA 1XGNA 2R7DA 3ZQ7A 5J8FA 4XBFA 3E5UA 3MCZA 2FMYA 1XGSA 3ZP5A 3E6DA 2HQRA 1JHHA 2K4JA 3K9TA 3BPVA 4OIOF 1QQIA 1Z05A 1F1ZA 5CJ9A 2DBBA 2EA2A 3O3KA 2JT1A 5CVJA 3LSTA 3VOEA 1S7OA 2X4HA 3REOA 2MH9A 3RJPA 3NQOA 2DQLA 3E6BA 3M9AA 3BY6A 2F5DA 1B9MA 2F5FA 1P92A 5JFRA 2VODA 4P9UA 4ZYGA 4UV9A 2HOEA 2EWNA 4ASNA 3T0YA 2EK5A 2BV6A 1ZGAA 1V4RA 3KFWX 2NNNA 4KA4A 1FBSA 2NAZA 3GXOA 3ZMDA 2H6BA 1SD7A 3T1BA 1ZGJA 2KIUA 5E17F 1JXSA 1HSJA 3L00A 4I2OA 2EFOA 1B9NA 1H9TA 4EJOA 5IT3A 5FLXZ 2XROA 2KRFA 2DW4A 3RKWA 1BC8C 1C0WA 1I6XA 1Y0UA 3F23A 3KP3A 2CO5A 3FMSA 2M5WA 1MDMB 3WGIA 3GO5A 1U3EM 5TJJA 3U2RA 4G6QA 2IA0A 1S6LA 3MWMA 4M74A 5IT9K 3I54A 3TOAA 2QUFA 3QP5A 1OYWA 3F8MA 2ETHA 1XDUA 3P9IA 2HGCA 1Z6RA 2JSCA 1K78A 4BQAA 4A0YA 3FX3A 4A6DA 1Z9CA 4CYDA 2A69F 5DV5A 2M87A 1R7JA 2M30A 3E6CC 4PGHA 3ECHA 4LJZF 3D0SA 3IKTA 5LGTA 1R1VA 2XAQA 1YQAA 1R5GA 4QWQA 1I1GA 2HS5A 2Z33A 2Z99A 2DTRA 3FMQA 1FBQA 1W7PD 5HS7A 4LMYA 4L18B 2ESHA 1YW8A 1O7LA 2QWWA 4O3MA 1LDKB 1IN7A 2Z5UA 4NB5A 4HF2A 2E7WA 2XKOA 2GZWA 4GXOA 1YLFA 2CSOA 1G3YA 1KU3A 2QVOA 5BMZA 2L4AA 3F8CA 4RGUA 2IJLA 5F64A 4O6JA 1G3WA 4ETSA 4XSXF 4I0AA 3W6KB 2ZNYA 3TKYA 4OU0A 3GVAA 4A0ZA 4EGZA 3GW2A 5H6QA 2Z9OA 5E8IA 5ERIA 5LGNA 2IA1A 3KP7A 4AVPA 1ZG5A 1TW2A 1BIBA 3FMRA 5CYVA 5LHIA 1L3LA 1RUNA 3EQLF 2COMA 4LB6B 2D45A 5FFXA 2OBPA 3L09A 3GF2A 1XN7A 3C7JA 4S04A 1IZ1A 4EV0A 1RNLA 3EETA 1XGMA 3R60A 2O3FA 2WV0A 4I02A 2HDCA 2EB7A 3KCCA 3HOTA 4BYYA 4Q47A 1HKSA 4BH9A 1T38A 1NHAA 1F4KA 4MEXF 3DPLC 2DK8A 5FLXK 2DPDA 2HTSA 1FX7A 4DNCA 3ELKA 3C1DA 4UV8A 2W84A 4RS8A 1P4WA 3WODF 4LGWA 4G94A 3SFZA 4BAYA 2HZTA 1KYWA 2D1HA 3HRTA 5AIQA 3KP6A 1FYKA 3FM3A 2YR2A 3OOPA 5DCFA 3BJ6A 1G6NA 5E1XA 3C3WA 1YS6A 5JR3A 2CWEA 4MTDA 4HZFA 2LNBA 5JVTA 3I4PA 4CZZA 1Z91A 2O6GE 4CXFA 1O3RA 4XLPF 4KT5C 4A6EA 4Q5SF 4OIQF 2Y0MA 2L02A 2G7UA 1OMIA 1BI0A 3CTAA 3CUQA 2A5YB 4F7ZA 2OA4A 2VE9A 2GA2A 1T0FA 2XASA 4GYGA 1R36A 1KU9A 1QNTA 3KLNA 4Y13A 4HF1A 4MQ9F 3KLOA 5A2QK 4I7HA 1B6AA 1K7AA 1ZG3A 2W25A 5HOOA 4JQFA 3WGGA 4JK1X 2KKOA 3BWGA 1MJAA 3K69A 2GWRA 4NHJA 1ON2A 2LF8A 2V1DA 1XGOA 1LEBA 5BPIA 3TDZC 4CDGA 3QAHA 3HIFA 2RV8A 2VBXA 4U7BA 1FOKA 3WTWC 3WTXC 4HV5A 5AONA 4P96A 1HSTA 3K1NA 4PDKA 1OR7A 4UVCA 1FBUA 2AS5F 3RDIA 1QPMA 2PG4A 1UHMA 4KIFA 1HKTA 2QQBA 4KYWA 1QBJA 4MNUA 5BQTA 2OQGA 3KZZA 2L4MA 4EJTA 2RKHA 1FPQA 2PJPA 5DDGA 3O6BB 4LB5A 1BI1A 2W24A 4FX0A 3R0JA 1RIOH 3CDHA 3QU6A 2DFIA 1PDNC 1OPCA 2PQ8A 2PEXA 1GXPA 5D5UB 2ZMEB 4WF2A 3BP8A 4CHUA 3ROUA 3SHFA 2QM3A 1SD6A 4LK0F 3K1MA 3TDUC 3ZMUA 3R4KA 5E8GA 4Q4ZF 4GYIA 4AIHA 3I59B 2D2WA 3B73A 1W7PA 2UWMA 4AD9A 4L5JA 3I53A 2JZYA 4M6XA 2DLLA 2K4BA 5EEHA 1EH7A 1VTNC 5L3DA 4M72A 1H9GA 4EQQA 4LFUA 2XV4S 3BPXA 3HTUA 3RPUA 1T2KA 3IWFA 2NS0A 4HQMA 2P7CB 3QPHA 1XDSA 3EYYA 5D5XB 3JAMZ 2STWA 5ICGA 3D5LA 3GZ6A 3BROA 5JI6A 1K79A 3E5XA 5D4RA 3N4MA 4R79A 5LLQA 1U5TC 3MEXA 3HYIA 1ZARA 3GFLA 3WTTC 2IVMA 4EVIA 4MQVA 1FY7A 3L7WA 1KU7A 5BS6A 3PQJA 3LAPA 4L0YB 5LEJA 3ECOA 2NRAC 1IXCA 4RAZA 2EV0A 1STZA 5DCMA 1BI3A 3BJAA 3HHGA 5KK1A 3GFIA 2DO7A 3P9KA 4UXNA 1YIOA 3ML6A 1IUYA 1Z7UA 4MGRA 1G3SA 4PCQA 1WQ2A 4L9TA 4EGYA 2W85A 1FSHA 3FZVA 1SFUA 3HSEA 4ZYHA 2XAJA 4P9FA 3MZHA 1F5TA 2IPQX 1TQPA 2XAGA 2A6EF 4YG2F 4Y17A 5E20A 3H3ZA 2IA2A 4EMSA 3ABTA 5K5RA 4FX4A 4G7HF 2ZXJA 3K2ZA 3L9FA 2K02A 1SMTA 3WTSC 1ZYRF 5CVVA 3Q5FA 1G3TA 2QQAA 4L0ZB 4L9NA 2EA4A 2C6YA 4U0WA 4YIFA 1UFMA 1MD0A 3IRQA 3O2PE 1BC7C 1ZLJA 5DUIA 1J75A 4WWCA 4HLXA 3I71A 5D6EA 1TQIA 1E2XA 2QENA 3JSPA 5DD4A 2FE3A 2AXLA 2GXBA 5HS8A 2BE5F 3M7GA 2CW0F 4BHPA 4FT8A 1MDMA 5F1RA 3TGNA 2R3SA 1K78B 2Q2EA 3F8BA 3V8KA 3V8LA 4G6DA 1S7AA 4IPAA 3E6MA 4ZH4F 1LB2A 1H0MA 2QYOA 2IT0A 2KJCA 1EH8A 1LJ9A 2EJRA 5D6FA 3P9CA 1J59A 4ENJA 2ISYA 3BJOA 3SQNA 1ZLKA 1TQMA 1WWXA 4Q48A 1IN8A 2O03A 2K86A 1XCVA 4IXAA 4AIKA 1K6OA 4HLYA 4RB1A 1BBYA 4HAMA 2XUBA 4MHGA 3DFGA 4UVBA 2WTEA 5CVRA 1XCBA 2M8EA 2PMUA 2MLGA 1QZZA 1DUXC 5F6FA 3TQNA 2VC0A 3JTHA 4M9XA 3I64A 5FD5A 3ISPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KQ9 A;  2HR3 A;  2G9W A;  1PUE E;  3N97 A;  2OD5 A;  4CIC A;  5K5O A;  3DP7 A;  2M45 A;  4KIG A;  1P6R A;  1SAX A;  4KNY A;  3ERE D;  1BI2 A;  1R1T A;  5E1Z B;  5LHH A;  1ZG1 A;  1HBX G;  5D8K B;  1LEA A;  2YX4 A;  3PFI A;  3BOQ A;  3HUG A;  1SFE A;  1P2F A;  1FNN A;  1P4A A;  4ZZL A;  5D5V B;  3KET A;  1XSX A;  3FM5 A;  3TO6 A;  3J7A O;  2H6C A;  4CGZ A;  2J5P A;  3M8E A;  2CG4 A;  1QGP A;  1ZRE A;  1LNW A;  2KJB A;  5D8L B;  5CVU A;  4WK8 F;  3B02 A;  2VON A;  1HW1 A;  1HQC A;  3Q9S A;  1YTY A;  4UHT A;  4LG0 B;  1D8J A;  1HXD A;  4U7D A;  4M9S A;  4A0X A;  4M6Y A;  3CUO A;  4BHB A;  2QQ9 A;  2KIF A;  4U0Y A;  4LLL A;  1ZN2 A;  3FXR A;  5HLH A;  1X3U A;  3MZY A;  4O5V A;  3NRV A;  4IRG A;  2K27 A;  5EEG A;  1UCR A;  1LVA A;  1SFX A;  4G7Z F;  3DV8 A;  4YII A;  5HS9 A;  2XHK A;  3JAM K;  5LEK A;  2VE8 A;  2ZKZ A;  4GGG A;  3KP2 A;  1ULY A;  2FU4 A;  4XSZ F;  1SD4 A;  3DQV C;  2E1N A;  4N9H A;  3H3U A;  4R1H A;  1U8R A;  2DI3 A;  4YFK F;  1KQ8 A;  2HTJ A;  1IAW A;  3VEP A;  4A12 A;  2J5O A;  3LA2 A;  3TO7 A;  4EJU A;  2F5E A;  3QOP A;  1CGP A;  4AIJ A;  3G3Z A;  4N0B A;  2L3D A;  3FHZ A;  1IF1 A;  1J9I A;  1ON1 A;  3IRR A;  1BN5 A;  2A3S A;  4M71 A;  5J6X A;  2UXX A;  3K0L A;  4IVN A;  4KN7 X;  1F9N A;  1HKQ A;  2HWV A;  3IL2 A;  5HDN A;  2A6H F;  5J8C A;  2DAO A;  3QU3 A;  4U88 A;  4EM1 A;  4QLC U;  5JHU A;  4ENM A;  4LLG F;  1E17 A;  1T39 A;  1L0O C;  4OOI A;  2MD5 A;  5IT9 Z;  3GFJ A;  3CO7 C;  2FRH A;  5K1Y A;  4FHT A;  1ZH5 A;  1CF7 A;  4L5I A;  2RVC A;  3J81 Z;  4A5N A;  1OYY A;  3MFK A;  3HSF A;  1KU2 A;  1WSU A;  1JGS A;  1T6S A;  2G7H A;  1LDD A;  1UB9 A;  4Y15 A;  1RZ4 A;  2BEO A;  5A2Q Z;  3PQK A;  5HVQ C;  4M9Z A;  1YG2 A;  3RIR A;  4EM0 B;  2ZO4 A;  2H27 A;  1FP2 A;  4G9Y A;  2P7V B;  1FWZ A;  2DQR A;  3WU1 B;  1MKM A;  3KE2 A;  3MAJ A;  3E3V A;  4L9J A;  2JPB A;  5ILU A;  1O3S A;  1FLI A;  2YU3 A;  1DP7 P;  2UZK A;  1J0R A;  3DF8 A;  3P7N A;  1V3F A;  4HX4 A;  4CO8 A;  2VBY A;  2P4W A;  3ZMT A;  2LDU A;  3GFM A;  3ULQ B;  3RKY A;  3DEU A;  4L9V A;  1FC3 A;  2YSR A;  2OU2 A;  2EFN A;  2QZ8 A;  2VBW A;  3WTY C;  4I09 A;  4LG0 A;  1YO5 C;  3ZN1 A;  4IHT A;  3T8R A;  1WI9 A;  4D0P A;  1UST A;  2A07 F;  1S8N A;  2FNP A;  2MBF A;  5L3B A;  1J5Y A;  2WC2 A;  4NQW A;  1BM9 A;  1YW9 A;  2GAU A;  5L3G A;  2Q0O A;  2EV6 A;  3F22 A;  2FBK A;  2EFP A;  2LF7 A;  1IXS B;  3LWF A;  2OAZ A;  4U0V A;  4WX9 A;  2VT3 A;  3VOD A;  4GCV A;  4AWX B;  1B59 A;  5DCM B;  3ZMZ A;  2PBI A;  2P5K A;  2VXZ A;  4HX8 A;  3AAF A;  3WG9 A;  3DXJ F;  3QP6 A;  3E5Q A;  5ICE A;  4RAY A;  2HQN A;  2ESN A;  2IP2 A;  5FB2 A;  3T5X A;  3FWE A;  2GQQ A;  2DK5 A;  3CJN A;  2XRN A;  1LDJ A;  1O57 A;  5L3E A;  3JW4 A;  3QPT A;  3JSO A;  2FML A;  4RGS A;  3CUQ B;  2EFQ A;  3EYI A;  2P6T A;  4JBA A;  4ESB A;  1D5V A;  2V9V A;  2OQR A;  3SXY A;  4YFX F;  1A04 A;  4UNO A;  3VFZ A;  2GIV A;  2PN6 A;  2F2E A;  3HOS A;  3ZMS A;  2A61 A;  1B4A A;  2UXN A;  4PGG A;  2H09 A;  2MA3 A;  1ZRC A;  4HW0 A;  3SZP A;  4RB0 A;  1ZRD A;  1IXR C;  5DYM A;  1BOA A;  1TW3 A;  1J2X A;  3RKX A;  3G73 A;  3BDD A;  1XD7 A;  5LGU A;  4M73 A;  1U5T B;  1FP1 D;  3RYR A;  3U9G A;  3KEQ A;  4WCG A;  5D5W B;  2PMH A;  1I1S A;  1FT9 A;  1EH6 A;  1FYM A;  3I58 A;  3CUQ C;  5ILV A;  1U5T A;  5K5Q A;  3J81 K;  2FBH A;  1USS A;  1XSV A;  3LA3 A;  3F72 A;  3VB2 A;  3LAJ A;  4KMU X;  4LD5 A;  2IRF G;  1PP8 F;  2MC3 A;  3W6J B;  3T8T A;  4EM2 A;  4RB2 C;  1W5T A;  1DPU A;  4LK1 F;  4HA8 A;  4RGR A;  3QRF F;  2P6S A;  3HRU A;  4HBL A;  2L54 A;  3LQQ A;  2R7F A;  1R22 A;  2HEO A;  2VT2 A;  5H20 A;  4HQE A;  2HYG D;  3WE2 A;  4XRF A;  5E18 F;  3COA C;  4KIC A;  3CO6 C;  2HKO A;  3IKV A;  5FFZ A;  1IN6 A;  1U78 A;  2F5C A;  2ZBK A;  5BOX A;  2FBI A;  1R5H A;  4ON0 A;  2K7L A;  4BHC A;  1YYV A;  4E70 A;  2FOK A;  3LA7 A;  3V7R A;  1UHW A;  4ENN A;  2YPR A;  5FD6 A;  1KQ0 A;  5BPD A;  2CGP A;  3H92 A;  2L01 A;  3F3X A;  2O0Y A;  2M1B A;  1B1B A;  2PFB A;  2XAF A;  2FEZ A;  4RB3 C;  4ESJ A;  3HHH A;  4WXC A;  2V1U A;  4IRI A;  2VOP A;  1TTY A;  1TLH B;  2FNA A;  1ZHF A;  2PI0 A;  3I5U A;  2CYY A;  2HYF A;  4B09 A;  3JTG A;  3GUD A;  4BXU A;  1BIA A;  4HDU A;  2O8X A;  2LKP A;  5ED4 A;  1FYL A;  2Z3Y A;  1S3J A;  4IJA A;  3S2W A;  5LRR A;  4KUM A;  5L3C A;  1U6G A;  5TRD A;  4LLN A;  2QLZ A;  2QBY B;  2DT5 A;  4P55 A;  4HX7 A;  2FA5 A;  1DPR A;  4R8H A;  1DDN A;  3M1E A;  1Q1H A;  2CFX A;  4HOB A;  4ZZD A;  5ILS A;  3WGH A;  5LBQ A;  1IW7 F;  1GXQ A;  5ICC A;  2RGV A;  3R61 A;  3RYP A;  3V4G A;  2XAH A;  4OMZ A;  4P5O A;  2X0L A;  4OIR F;  3R0A A;  1P4X A;  4HF0 A;  4KIB A;  3L2C A;  3U1D A;  2TDX A;  3I59 A;  1IRF A;  2QBY A;  3FF5 A;  4HDV A;  1IN5 A;  4N9I A;  1D8K A;  4ESF A;  2IW5 A;  1I5Z A;  1J7K A;  3GZ5 A;  4OMY A;  2FF4 A;  2NNY A;  3ZMV A;  3M8F A;  3F21 A;  4ZYE A;  2XKP A;  1ODD A;  4I98 B;  1G4D A;  1KA8 A;  1O7F A;  1T98 A;  2ADU A;  2YX7 A;  4GO1 A;  4HYE A;  3J80 K;  2O61 A;  1ZRF A;  3C18 A;  1HW5 A;  4XLN F;  2ZCW A;  5DEQ A;  2Y75 A;  4BNC A;  5LRS A;  2H94 A;  4A2U A;  2JTV A;  3F8N A;  1AOY A;  3RTR A;  3HRM A;  2ELH A;  3FXU A;  2ZFW A;  2STT A;  2WWY A;  1I27 A;  2E7X A;  4IRH A;  1O3Q A;  4OIN F;  3DKW A;  2HKX A;  4Z2Y A;  3ZPL A;  2EFW A;  3F8F A;  1ZAO A;  1TNT A;  5CLS A;  1KGS A;  2VOO A;  1YFH A;  4S05 A;  3GYH X;  1IRG A;  5HDG A;  1R58 A;  2P5L C;  3WU0 A;  3MQ0 A;  2RQP A;  4I01 A;  3HTS B;  2ISZ A;  2Y48 A;  2E1C A;  2PLY A;  3F6O A;  3NEU A;  4K2E A;  1TBX A;  1WRJ A;  2BGC A;  2NYX A;  1R00 A;  1O3T A;  2KIM A;  4G8X A;  2GA1 A;  1FZP B;  3V7C A;  1XMK A;  1GHC A;  1Z1D A;  2ZJ2 A;  3GLX A;  4WXH A;  3EDP A;  1RI7 A;  1W7P B;  3KP5 A;  4IHS A;  2HFH A;  5CVI A;  3ZN0 A;  4WXD A;  2P5V A;  4ZYD A;  1PP7 U;  4KN4 X;  4MTE A;  3LFK A;  2DPU A;  1SMY F;  3KP4 A;  3ABU A;  5DD8 A;  1LQ1 A;  1KYZ A;  2MH2 A;  5HLG A;  3WTZ A;  5HDK A;  2BYV E;  4YFN F;  2B0L A;  5FGM A;  5D4S A;  5FO5 A;  2OZ6 A;  4EJV A;  4MEY F;  3HRS A;  1HW2 A;  3HSR A;  1XMA A;  1S29 A;  1JE8 A;  1TNS A;  5L3F A;  1ONV A;  3EUH A;  4HV6 A;  3V7S A;  3KZY A;  4G7O F;  5E1W A;  3WE3 A;  1WKM A;  3SZT A;  5HLI A;  1CF7 B;  1IN4 A;  2P8T A;  4RGX A;  3LQR A;  3FXQ A;  2MLK A;  4EJW A;  3E97 A;  4KFC A;  2FXA A;  2BBY A;  3BZ6 A;  3DPT A;  3I0T A;  2V1X A;  3WTV C;  5H6R A;  3TOB A;  2D1V A;  2W57 A;  2VC1 A;  4PZJ A;  1QZY A;  4DQ2 A;  5LHG A;  2EV5 A;  1MJB A;  1U2W A;  1D3Y A;  1R23 A;  3J80 Z;  3KEO A;  1YS7 A;  3K1P A;  5ICF A;  2XVC A;  2RC4 A;  2FSW A;  1MGT A;  1YW7 A;  1SD5 A;  1XB4 A;  2JPC A;  1MJ9 A;  3GEZ A;  4TV7 A;  2JRT A;  1BJA A;  4I0B A;  3GWZ A;  1OYI A;  4UVA A;  3CLO A;  2RN7 A;  4UUV A;  4ENK A;  2V6C A;  4KDP A;  1QO0 D;  2RNJ A;  4H0E A;  2VN2 A;  4IF4 A;  3RPQ A;  1GVJ A;  2ACJ A;  1R1U A;  2FQ3 A;  2Q8K A;  3IWZ A;  3V8J A;  4B8X A;  3R6S A;  2VBZ A;  3WTU C;  1RUO A;  1W4M A;  4A5M A;  1JHF A;  3GX4 X;  1EV7 A;  3IHU A;  3IC7 A;  2ZME A;  3OV8 A;  2OZU A;  3Q9V A;  3RI4 A;  1Z6T A;  2LSO A;  5AIP A;  1FSE A;  1W5S A;  1XSD A;  2XGX A;  5DUK A;  5KVR A;  1OKR A;  4OIP F;  2CQK A;  2XIG A;  2V79 A;  2A68 F;  2RDP A;  1MZB A;  2ZNZ A;  1REP C;  2DU9 A;  3TO9 A;  3F6V A;  4KMF A;  6PAX A;  2GXG A;  1AWC A;  1XGN A;  2R7D A;  3ZQ7 A;  5J8F A;  4XBF A;  3E5U A;  3MCZ A;  2FMY A;  1XGS A;  3ZP5 A;  3E6D A;  2HQR A;  1JHH A;  2K4J A;  3K9T A;  3BPV A;  4OIO F;  1QQI A;  1Z05 A;  1F1Z A;  5CJ9 A;  2DBB A;  2EA2 A;  3O3K A;  2JT1 A;  5CVJ A;  3LST A;  3VOE A;  1S7O A;  2X4H A;  3REO A;  2MH9 A;  3RJP A;  3NQO A;  2DQL A;  3E6B A;  3M9A A;  3BY6 A;  2F5D A;  1B9M A;  2F5F A;  1P92 A;  5JFR A;  2VOD A;  4P9U A;  4ZYG A;  4UV9 A;  2HOE A;  2EWN A;  4ASN A;  3T0Y A;  2EK5 A;  2BV6 A;  1ZGA A;  1V4R A;  3KFW X;  2NNN A;  4KA4 A;  1FBS A;  2NAZ A;  3GXO A;  3ZMD A;  2H6B A;  1SD7 A;  3T1B A;  1ZGJ A;  2KIU A;  5E17 F;  1JXS A;  1HSJ A;  3L00 A;  4I2O A;  2EFO A;  1B9N A;  1H9T A;  4EJO A;  5IT3 A;  5FLX Z;  2XRO A;  2KRF A;  2DW4 A;  3RKW A;  1BC8 C;  1C0W A;  1I6X A;  1Y0U A;  3F23 A;  3KP3 A;  2CO5 A;  3FMS A;  2M5W A;  1MDM B;  3WGI A;  3GO5 A;  1U3E M;  5TJJ A;  3U2R A;  4G6Q A;  2IA0 A;  1S6L A;  3MWM A;  4M74 A;  5IT9 K;  3I54 A;  3TOA A;  2QUF A;  3QP5 A;  1OYW A;  3F8M A;  2ETH A;  1XDU A;  3P9I A;  2HGC A;  1Z6R A;  2JSC A;  1K78 A;  4BQA A;  4A0Y A;  3FX3 A;  4A6D A;  1Z9C A;  4CYD A;  2A69 F;  5DV5 A;  2M87 A;  1R7J A;  2M30 A;  3E6C C;  4PGH A;  3ECH A;  4LJZ F;  3D0S A;  3IKT A;  5LGT A;  1R1V A;  2XAQ A;  1YQA A;  1R5G A;  4QWQ A;  1I1G A;  2HS5 A;  2Z33 A;  2Z99 A;  2DTR A;  3FMQ A;  1FBQ A;  1W7P D;  5HS7 A;  4LMY A;  4L18 B;  2ESH A;  1YW8 A;  1O7L A;  2QWW A;  4O3M A;  1LDK B;  1IN7 A;  2Z5U A;  4NB5 A;  4HF2 A;  2E7W A;  2XKO A;  2GZW A;  4GXO A;  1YLF A;  2CSO A;  1G3Y A;  1KU3 A;  2QVO A;  5BMZ A;  2L4A A;  3F8C A;  4RGU A;  2IJL A;  5F64 A;  4O6J A;  1G3W A;  4ETS A;  4XSX F;  4I0A A;  3W6K B;  2ZNY A;  3TKY A;  4OU0 A;  3GVA A;  4A0Z A;  4EGZ A;  3GW2 A;  5H6Q A;  2Z9O A;  5E8I A;  5ERI A;  5LGN A;  2IA1 A;  3KP7 A;  4AVP A;  1ZG5 A;  1TW2 A;  1BIB A;  3FMR A;  5CYV A;  5LHI A;  1L3L A;  1RUN A;  3EQL F;  2COM A;  4LB6 B;  2D45 A;  5FFX A;  2OBP A;  3L09 A;  3GF2 A;  1XN7 A;  3C7J A;  4S04 A;  1IZ1 A;  4EV0 A;  1RNL A;  3EET A;  1XGM A;  3R60 A;  2O3F A;  2WV0 A;  4I02 A;  2HDC A;  2EB7 A;  3KCC A;  3HOT A;  4BYY A;  4Q47 A;  1HKS A;  4BH9 A;  1T38 A;  1NHA A;  1F4K A;  4MEX F;  3DPL C;  2DK8 A;  5FLX K;  2DPD A;  2HTS A;  1FX7 A;  4DNC A;  3ELK A;  3C1D A;  4UV8 A;  2W84 A;  4RS8 A;  1P4W A;  3WOD F;  4LGW A;  4G94 A;  3SFZ A;  4BAY A;  2HZT A;  1KYW A;  2D1H A;  3HRT A;  5AIQ A;  3KP6 A;  1FYK A;  3FM3 A;  2YR2 A;  3OOP A;  5DCF A;  3BJ6 A;  1G6N A;  5E1X A;  3C3W A;  1YS6 A;  5JR3 A;  2CWE A;  4MTD A;  4HZF A;  2LNB A;  5JVT A;  3I4P A;  4CZZ A;  1Z91 A;  2O6G E;  4CXF A;  1O3R A;  4XLP F;  4KT5 C;  4A6E A;  4Q5S F;  4OIQ F;  2Y0M A;  2L02 A;  2G7U A;  1OMI A;  1BI0 A;  3CTA A;  3CUQ A;  2A5Y B;  4F7Z A;  2OA4 A;  2VE9 A;  2GA2 A;  1T0F A;  2XAS A;  4GYG A;  1R36 A;  1KU9 A;  1QNT A;  3KLN A;  4Y13 A;  4HF1 A;  4MQ9 F;  3KLO A;  5A2Q K;  4I7H A;  1B6A A;  1K7A A;  1ZG3 A;  2W25 A;  5HOO A;  4JQF A;  3WGG A;  4JK1 X;  2KKO A;  3BWG A;  1MJA A;  3K69 A;  2GWR A;  4NHJ A;  1ON2 A;  2LF8 A;  2V1D A;  1XGO A;  1LEB A;  5BPI A;  3TDZ C;  4CDG A;  3QAH A;  3HIF A;  2RV8 A;  2VBX A;  4U7B A;  1FOK A;  3WTW C;  3WTX C;  4HV5 A;  5AON A;  4P96 A;  1HST A;  3K1N A;  4PDK A;  1OR7 A;  4UVC A;  1FBU A;  2AS5 F;  3RDI A;  1QPM A;  2PG4 A;  1UHM A;  4KIF A;  1HKT A;  2QQB A;  4KYW A;  1QBJ A;  4MNU A;  5BQT A;  2OQG A;  3KZZ A;  2L4M A;  4EJT A;  2RKH A;  1FPQ A;  2PJP A;  5DDG A;  3O6B B;  4LB5 A;  1BI1 A;  2W24 A;  4FX0 A;  3R0J A;  1RIO H;  3CDH A;  3QU6 A;  2DFI A;  1PDN C;  1OPC A;  2PQ8 A;  2PEX A;  1GXP A;  5D5U B;  2ZME B;  4WF2 A;  3BP8 A;  4CHU A;  3ROU A;  3SHF A;  2QM3 A;  1SD6 A;  4LK0 F;  3K1M A;  3TDU C;  3ZMU A;  3R4K A;  5E8G A;  4Q4Z F;  4GYI A;  4AIH A;  3I59 B;  2D2W A;  3B73 A;  1W7P A;  2UWM A;  4AD9 A;  4L5J A;  3I53 A;  2JZY A;  4M6X A;  2DLL A;  2K4B A;  5EEH A;  1EH7 A;  1VTN C;  5L3D A;  4M72 A;  1H9G A;  4EQQ A;  4LFU A;  2XV4 S;  3BPX A;  3HTU A;  3RPU A;  1T2K A;  3IWF A;  2NS0 A;  4HQM A;  2P7C B;  3QPH A;  1XDS A;  3EYY A;  5D5X B;  3JAM Z;  2STW A;  5ICG A;  3D5L A;  3GZ6 A;  3BRO A;  5JI6 A;  1K79 A;  3E5X A;  5D4R A;  3N4M A;  4R79 A;  5LLQ A;  1U5T C;  3MEX A;  3HYI A;  1ZAR A;  3GFL A;  3WTT C;  2IVM A;  4EVI A;  4MQV A;  1FY7 A;  3L7W A;  1KU7 A;  5BS6 A;  3PQJ A;  3LAP A;  4L0Y B;  5LEJ A;  3ECO A;  2NRA C;  1IXC A;  4RAZ A;  2EV0 A;  1STZ A;  5DCM A;  1BI3 A;  3BJA A;  3HHG A;  5KK1 A;  3GFI A;  2DO7 A;  3P9K A;  4UXN A;  1YIO A;  3ML6 A;  1IUY A;  1Z7U A;  4MGR A;  1G3S A;  4PCQ A;  1WQ2 A;  4L9T A;  4EGY A;  2W85 A;  1FSH A;  3FZV A;  1SFU A;  3HSE A;  4ZYH A;  2XAJ A;  4P9F A;  3MZH A;  1F5T A;  2IPQ X;  1TQP A;  2XAG A;  2A6E F;  4YG2 F;  4Y17 A;  5E20 A;  3H3Z A;  2IA2 A;  4EMS A;  3ABT A;  5K5R A;  4FX4 A;  4G7H F;  2ZXJ A;  3K2Z A;  3L9F A;  2K02 A;  1SMT A;  3WTS C;  1ZYR F;  5CVV A;  3Q5F A;  1G3T A;  2QQA A;  4L0Z B;  4L9N A;  2EA4 A;  2C6Y A;  4U0W A;  4YIF A;  1UFM A;  1MD0 A;  3IRQ A;  3O2P E;  1BC7 C;  1ZLJ A;  5DUI A;  1J75 A;  4WWC A;  4HLX A;  3I71 A;  5D6E A;  1TQI A;  1E2X A;  2QEN A;  3JSP A;  5DD4 A;  2FE3 A;  2AXL A;  2GXB A;  5HS8 A;  2BE5 F;  3M7G A;  2CW0 F;  4BHP A;  4FT8 A;  1MDM A;  5F1R A;  3TGN A;  2R3S A;  1K78 B;  2Q2E A;  3F8B A;  3V8K A;  3V8L A;  4G6D A;  1S7A A;  4IPA A;  3E6M A;  4ZH4 F;  1LB2 A;  1H0M A;  2QYO A;  2IT0 A;  2KJC A;  1EH8 A;  1LJ9 A;  2EJR A;  5D6F A;  3P9C A;  1J59 A;  4ENJ A;  2ISY A;  3BJO A;  3SQN A;  1ZLK A;  1TQM A;  1WWX A;  4Q48 A;  1IN8 A;  2O03 A;  2K86 A;  1XCV A;  4IXA A;  4AIK A;  1K6O A;  4HLY A;  4RB1 A;  1BBY A;  4HAM A;  2XUB A;  4MHG A;  3DFG A;  4UVB A;  2WTE A;  5CVR A;  1XCB A;  2M8E A;  2PMU A;  2MLG A;  1QZZ A;  1DUX C;  5F6F A;  3TQN A;  2VC0 A;  3JTH A;  4M9X A;  3I64 A;  5FD5 A;  3ISP A; 
#chains in the Genus database with same CATH topology
 2KRC A;  4PJL A;  1IO2 A;  1KQ9 A;  2HR3 A;  3BQY A;  1X3Z B;  2G9W A;  4A3J J;  4ZDO A;  1PUE E;  3HOU J;  3N97 A;  2OD5 A;  2R0Q C;  1QU3 A;  4F55 A;  4CIC A;  1ZK8 A;  2X6X A;  5K5O A;  3DP7 A;  3DBR B;  3OYH A;  5CQE A;  2M45 A;  2X85 A;  1H89 C;  1Z3Y A;  2LG4 A;  3ESW B;  4XRS G;  2LY1 A;  4KIG A;  1P6R A;  2EBI A;  3FHN A;  1SAX A;  4KNY A;  2AXT C;  3ERE D;  1HDP A;  1BI2 A;  1R1T A;  3FXO A;  5E1Z B;  4MLO A;  5LHH A;  1ZG1 A;  1HBX G;  5D8K B;  1LEA A;  2YX4 A;  3PFI A;  4XLF A;  4QIW N;  1IGN A;  4BJ5 C;  3BOQ A;  2R7U A;  1XX5 A;  2JSP A;  3ZQH A;  2QCO A;  3HUG A;  1SFE A;  1P2F A;  1FNN A;  4G12 A;  1P4A A;  4ZZL A;  5D5V B;  3I4M J;  3CME I;  3KET A;  1XSX A;  3FM5 A;  3TO6 A;  3J7A O;  1WJ5 A;  4V19 K;  4D7M A;  1WH5 A;  2H6C A;  2M4K A;  4CGZ A;  2J5P A;  3LSJ A;  3BTC A;  5EDN A;  3M8E A;  3A01 B;  2CG4 A;  9ANT A;  1MSE C;  2R7Q A;  3SDG A;  1QGP A;  3JRE A;  1ZRE A;  1LNW A;  5EZG A;  2KJB A;  1POG A;  5D8L B;  1WHU A;  4AYB N;  4C3H J;  2CV1 A;  4NNJ A;  5CVU A;  4WK8 F;  3B02 A;  2VON A;  1HW1 A;  1TWG J;  1HQC A;  2DOF A;  4II3 A;  3Q9S A;  4W97 A;  1YTY A;  1FOY A;  2CUF A;  2P0W A;  4UHT A;  3ZQC A;  4BJ6 C;  1BR1 A;  1I50 J;  2WBM A;  4LG0 B;  1D8J A;  1HXD A;  2WAF A;  2WAQ A;  5CQG A;  4U7D A;  2DN0 A;  4M9S A;  2L9V A;  4A0X A;  1LUJ B;  2ZXI A;  1HOM A;  4M6Y A;  1Z3X A;  3CUO A;  4BHB A;  2QQ9 A;  4F92 B;  2KIF A;  1JJ8 C;  4U0Y A;  4LLL A;  1FMV A;  1ZN2 A;  4HNV A;  3OR2 C;  3DWL E;  3FXR A;  5HLH A;  1X3U A;  2OUM A;  3MZY A;  4O5V A;  3HOV J;  3HEF A;  3NRV A;  4IRG A;  2K27 A;  5EEG A;  1UCR A;  2FQ4 A;  1LVA A;  2JN6 A;  1G59 A;  1SFX A;  4G7Z F;  3DV8 A;  4XON A;  2O7O A;  1O4X A;  4YII A;  5HS9 A;  2DMT A;  3LSM A;  2XHK A;  3S3N A;  3JAM K;  5LEK A;  2WB1 N;  2VE8 A;  2ZXW H;  3QYE A;  2ZKZ A;  2F4O B;  4GGG A;  2ELK A;  1X1A A;  3KP2 A;  4RM3 A;  5M3M J;  1W36 C;  1ULY A;  2FU4 A;  3RQ4 A;  4XSZ F;  2WB1 A;  1SD4 A;  2O8K A;  2NVY J;  4PJN A;  4B43 A;  3DQV C;  3LOC A;  4PJJ A;  3S1Q J;  2E1N A;  4N9H A;  3BR6 A;  3H3U A;  4R1H A;  3CC4 I;  1U8R A;  2DI3 A;  4YFK F;  2NVX J;  3TW6 A;  4FQG A;  4Z6Y A;  1KQ8 A;  2HTJ A;  4LIV A;  1IAW A;  3K4J A;  3OIQ A;  5IOY A;  2JVG A;  3VEP A;  4PSW A;  5KHD A;  4A12 A;  4B4C A;  1P7J A;  4XLE A;  5J1U A;  5C4X J;  1X2N A;  2J5O A;  3LA2 A;  3TO7 A;  4EJU A;  2F5E A;  4JYK A;  3BQZ A;  3IAS 2;  3QOP A;  1CGP A;  3IH3 A;  4AIJ A;  3G3Z A;  4N0B A;  2L3D A;  3FHZ A;  2A05 A;  1IF1 A;  2HNH A;  1J9I A;  1ON1 A;  4NBQ A;  3IRR A;  4JX4 A;  3GCM A;  3BG6 A;  1BN5 A;  2A3S A;  4M71 A;  5J6X A;  4BDZ A;  2M3A A;  2UXX A;  4UUT A;  3LSK A;  3J7A Y;  3K0L A;  4IVN A;  1R5I D;  1F9N A;  4KN7 X;  2CRG A;  2V9K A;  1HKQ A;  1UHS A;  2HWV A;  2M9H A;  3DTE A;  3IL2 A;  2A6H F;  5HDN A;  5J8C A;  2DAO A;  3QU3 A;  4U88 A;  5DM6 F;  2AQF A;  2DA7 A;  3CCM I;  1K61 A;  4EM1 A;  1YX5 A;  4QLC U;  1QVT A;  5JHU A;  4LLG F;  4ENM A;  1T39 A;  1E17 A;  1L0O C;  4OOI A;  2MD5 A;  3OYK A;  3GFJ A;  5IT9 Z;  3CO7 C;  1IRX A;  1D0Y A;  1P7I A;  1D1A A;  2FRH A;  1HA8 A;  5K1Y A;  4FHT A;  1ZH5 A;  1CF7 A;  4L5I A;  4CUG A;  2RVC A;  3J81 Z;  4A5N A;  1OYY A;  3MFK A;  1JUS A;  3JRC A;  3G2B A;  3HSF A;  1X1P A;  1KU2 A;  4FTH A;  4A3K J;  1WSU A;  3SJM A;  1JGS A;  1T6S A;  3X2Q H;  3HZJ A;  4P1W A;  2G7H A;  2KLO A;  1LDD A;  3A1Y A;  4BBR J;  4CYC A;  3LNQ A;  1SC7 A;  3ERM A;  1UB9 A;  4Y15 A;  4RLQ A;  3O8G A;  1RZ4 A;  3S3M A;  1S5L C;  2BEO A;  2F4M B;  5A2Q Z;  3LSR A;  1N77 A;  3PQK A;  5HVQ C;  4M9Z A;  3U21 A;  4BQN A;  1A35 A;  2Y9Z A;  2V26 A;  1YG2 A;  2KDZ A;  3RIR A;  1YRN A;  4ZJZ A;  4EM0 B;  4RLF A;  3DU6 A;  2R7W A;  2V6E A;  3OYM A;  1MBF A;  2ZO4 A;  1RR8 C;  2H27 A;  1FP2 A;  4G9Y A;  2P7V B;  1FWZ A;  1HDD C;  3KZI C;  5J4V A;  1WJA A;  2Z16 A;  1ACI A;  2DQR A;  3AG1 H;  3WU1 B;  3FBI B;  1MKM A;  1UG2 A;  4M3D A;  3KE2 A;  3MAJ A;  2JA6 J;  3E3V A;  4L9J A;  1JJ6 C;  3PJR A;  2Y0S N;  2JPB A;  3BG5 A;  1U9O A;  3LSH A;  3ZOB A;  5ILU A;  3RKQ A;  4HG2 A;  3PNY A;  1GV5 A;  2VIX A;  1O3S A;  3G6E I;  1WI3 A;  1FLI A;  2YU3 A;  3BTI A;  1DP7 P;  4N4N B;  2X51 A;  2KT0 A;  2UZK A;  5LD2 C;  1J0R A;  3DF8 A;  3P7N A;  4F3Q A;  5E3N A;  3W2A A;  2CQN A;  2F6C A;  1J09 A;  4PK4 A;  4E7S A;  2FOW A;  3PL8 A;  1V3F A;  4HX4 A;  4CO8 A;  1YHQ I;  3DKY A;  2VBY A;  2P4W A;  3ZMT A;  2LDU A;  2ZSI B;  3GFM A;  3ULQ B;  3RKY A;  3Q0U A;  2CUE A;  2FJ1 A;  3DEU A;  4L9V A;  1FC3 A;  2YSR A;  3OYA A;  2FX0 A;  2QKL B;  4BBS J;  1T95 A;  4AC0 A;  2XSJ C;  2OU2 A;  2R7V A;  2EFN A;  2QZ8 A;  1A36 A;  2VBW A;  3WTY C;  2KIQ A;  2X6Y A;  4I09 A;  4LG0 A;  1YO5 C;  3JRA A;  3ZN1 A;  3ZQG A;  4IHT A;  1VQ4 I;  4M3E A;  3T8R A;  1WI9 A;  1B8I A;  2DYR H;  4XNF A;  3GTJ J;  4GRI A;  3NWS A;  1V5E A;  1A6Q A;  4D0P A;  1UST A;  2XB5 A;  2A07 F;  4D5C A;  1S8N A;  2FNP A;  2MBF A;  5L3B A;  1DGR M;  4BEH B;  2IS1 A;  1YRN B;  1J5Y A;  2WC2 A;  4NQW A;  4YIR X;  4IHW A;  1BM9 A;  3QQA A;  2K3F A;  2E5Z A;  2JA8 J;  1YW9 A;  2VL8 A;  2GAU A;  1TWF J;  5L3G A;  2Q0O A;  2EV6 A;  2R93 J;  3F22 A;  2FBK A;  2EFP A;  2E1M C;  2JK3 A;  2X48 A;  2COB A;  2LF7 A;  2MFZ A;  1IXS B;  2IGK A;  3LWF A;  1LFU P;  5F0C A;  2OAZ A;  4U0V A;  4WX9 A;  2VT3 A;  3TED A;  3VOD A;  4GCV A;  4AWX B;  2K3P A;  5FLM J;  2DFH A;  1B59 A;  5DCM B;  4AM3 A;  1V5G A;  4ITV A;  3ZMZ A;  2R7Z J;  2PBI A;  2IXS A;  2P5K A;  2VXZ A;  1VQN I;  4D5F A;  4HX8 A;  4F91 B;  4Y7N J;  3CP8 A;  5M5X J;  2KZV A;  3WG9 A;  3AAF A;  3DXJ F;  3QP6 A;  1RC9 A;  1VF9 A;  2RAE A;  3E5Q A;  1MMD A;  5ICE A;  1AU7 A;  3MKL A;  4RAY A;  2GOX B;  3H0G J;  2VAS A;  4FE7 A;  2HQN A;  4XKV A;  2ESN A;  1JKO C;  2IP2 A;  5C44 J;  5FB2 A;  3T5X A;  3FWE A;  1D1B A;  2GQQ A;  2DK5 A;  1ETX A;  2HDD A;  2XAU A;  3CJN A;  1WJF A;  2XRN A;  4CCM A;  3ABK H;  2DMQ A;  2BY3 A;  3S3O A;  1LDJ A;  1O57 A;  1XG1 A;  2AHQ A;  5L3E A;  3JW4 A;  3HOY J;  1ETK A;  3RZD J;  2DJI A;  3QPT A;  3JSO A;  2ZB9 A;  5FRO A;  2WY7 Q;  2FML A;  3LL7 A;  2DA4 A;  5C4J J;  4RGS A;  1MBK A;  1X3W B;  2L7M P;  3CUQ B;  2EFQ A;  2VB6 A;  3EYI A;  4LOC A;  2P6T A;  4JBA A;  5IYB J;  4ESB A;  1D5V A;  5FLV A;  1RKW A;  4JP0 A;  2V9V A;  5F08 A;  2OQR A;  2I8D A;  4L5E A;  5EJC A;  3SXY A;  4G6T B;  1SVM A;  5B1B H;  4YFX F;  1A04 A;  4UNO A;  3V42 A;  3VFZ A;  2GIV A;  3L2Q A;  2PN6 A;  1HF0 A;  2F2E A;  4HEA 2;  3HOS A;  3DLL F;  2A61 A;  3ZMS A;  1B4A A;  5EG0 A;  2UXN A;  4PJM A;  4PGG A;  2H09 A;  2MA3 A;  1NK3 P;  1ZRC A;  4FAS D;  4UB6 C;  4BQO A;  4HW0 A;  3MVP A;  3SZP A;  3H9Q A;  4RB0 A;  1ZRD A;  4BEH A;  3PIP F;  3MKW B;  1IXR C;  3PUB A;  1YIT I;  2M0M A;  2XF5 A;  3OIO A;  5DYM A;  5GP9 A;  1FTZ A;  1W0T A;  4XQF A;  1BOA A;  1TW3 A;  1J2X A;  4MFD A;  3RKX A;  3FXK A;  3G73 A;  2P81 A;  3BDD A;  1XD7 A;  4DW6 A;  5LGU A;  4M73 A;  3ABM H;  1U5T B;  1FP1 D;  1TWC J;  3E7L A;  3FIS A;  2DFF A;  3RYR A;  1TC3 C;  3U9G A;  4XOT A;  3KEQ A;  1X1C A;  4CSW A;  2DOD A;  2X1C A;  5J40 A;  4WCG A;  1SAU A;  5D5W B;  2H8W A;  2VKV A;  3CP2 A;  2PMH A;  4UUS B;  5EF6 A;  1I1S A;  1FT9 A;  3AG3 H;  4RBO A;  1LE8 A;  1EH6 A;  4B1R A;  5GPC A;  1R9T J;  1FYM A;  4CH7 A;  4IKF A;  2QSF X;  4RM2 A;  3I58 A;  2K40 A;  3CUQ C;  3U1K A;  4B3A A;  5ILV A;  4XKC A;  1U5T A;  5K5Q A;  3J81 K;  2PJR B;  2FBH A;  1USS A;  1XSV A;  3CJT B;  3LA3 A;  3IP4 B;  3F72 A;  3VB2 A;  2EIJ H;  3LAJ A;  1JGG A;  4KMU X;  4LD5 A;  4C2U A;  2IRF G;  1PP8 F;  1YI2 I;  2DFE A;  2MC3 A;  3W6J B;  3CCV I;  2NOG A;  1VQ5 I;  3HPH A;  3P5J A;  3T8T A;  4EM2 A;  2ID3 A;  4RB2 C;  1W5T A;  4LIU A;  4PUS A;  1DPU A;  3KX2 A;  2DTZ A;  4LK1 F;  4HA8 A;  2A5W A;  4RGR A;  3QRF F;  2HVS A;  3QPS A;  4YEL A;  2P6S A;  3HG9 A;  3HRU A;  1Y39 A;  3H3V K;  4HBL A;  3HPG A;  1H8A C;  3UKG A;  2L54 A;  3LQQ A;  3OYI A;  2IEK A;  2E2I J;  2R7F A;  1R22 A;  4Y33 A;  2HEO A;  2VT2 A;  5H20 A;  4HQE A;  4M3G A;  5F0F A;  2XGD A;  2HYG D;  2K9N A;  1Y0N A;  3WE2 A;  4XRF A;  5E18 F;  3COA C;  4KIC A;  3DKX A;  3CO6 C;  3CC2 I;  2HKO A;  3IKV A;  2VLA A;  5FFZ A;  1IN6 A;  1U78 A;  2F5C A;  2ZBK A;  5BOX A;  4JX6 A;  2FBI A;  1R5H A;  3K70 D;  4ON0 A;  1X19 A;  3CCS I;  2K7L A;  2KL4 A;  2K9Q A;  1YYV A;  4BHC A;  1OR7 C;  4E70 A;  2FOK A;  1MMN A;  3A4C A;  3LA7 A;  3J7Y J;  1SFO J;  1R4N B;  3V7R A;  2KDO A;  1UHW A;  2WY8 Q;  4ENN A;  5JLX A;  2YPR A;  1EF4 A;  5FD6 A;  1KQ0 A;  1YJW I;  1OQY A;  2DA1 A;  5BPD A;  2W82 A;  2XPV A;  3M1C A;  1K83 J;  1VQ7 I;  2CGP A;  3H92 A;  2L01 A;  2DMP A;  3BR5 A;  3F3X A;  2O0Y A;  3ZQI A;  1GUU A;  2BVM A;  2M1B A;  1WPK A;  2NVT J;  1B1B A;  2PFB A;  2NOJ B;  2XAF A;  2FEZ A;  4RB3 C;  1ERD A;  1E3O C;  1D5Y A;  4ESJ A;  2JVH A;  4BU2 A;  5K7H A;  3HHH A;  4WXC A;  2V1U A;  2M7A A;  5M5Y J;  4BE0 A;  4IRI A;  2VOP A;  3CMA I;  1TTY A;  1TLH B;  3MMY B;  2ME6 A;  2FNA A;  2HXO A;  1ZHF A;  2E71 A;  5GTI C;  2F5V A;  1ETY A;  2CYY A;  3I5U A;  2PI0 A;  3OSG A;  4IHV A;  2G0E A;  1KON A;  2HYF A;  3A03 A;  4B09 A;  3CES A;  3AG4 H;  5E3O A;  3JTG A;  3GUD A;  3FXM A;  4BXU A;  1BIA A;  2NS8 A;  3OYN A;  5FRM A;  3G4S I;  4BE1 A;  4HDU A;  2O8X A;  3VSK A;  2LKP A;  3UNG C;  2HPI A;  5ED4 A;  2VKD A;  1FYL A;  2BY0 A;  1LE8 B;  4C30 A;  2Z3Y A;  2Z2S B;  1S3J A;  4IJA A;  3S2W A;  1K4S A;  1BOB A;  2JQ7 A;  3D1N I;  2GLO A;  5LRR A;  1XPX A;  4KUM A;  5L3C A;  1U6G A;  3PSF A;  5TRD A;  4LLN A;  2QLZ A;  2QBY B;  2DT5 A;  4P55 A;  3OR1 C;  5J1R A;  4HX7 A;  2ZFU A;  2FA5 A;  1DPR A;  3KIO A;  3CDI A;  4R8H A;  1DDN A;  3M1E A;  1LVK A;  3F0C A;  1Q1H A;  2BY1 A;  2CFX A;  4HOB A;  1VQ8 I;  4ZZD A;  1XS9 A;  1F36 A;  2VQG A;  2PJR A;  4BXX J;  4BXF A;  1TT5 B;  5ILS A;  3K6G A;  3WGH A;  4F52 A;  5LBQ A;  2GBY A;  3BTJ A;  1IW7 F;  1GXQ A;  3CMM A;  4IEJ A;  5ICC A;  2RGV A;  3R61 A;  3RYP A;  2GOM A;  3V4G A;  5J1Y A;  3QWL A;  2XAH A;  4CCO A;  1T33 A;  1JKP C;  4OMZ A;  4P5O A;  2X0L A;  4KIT B;  4OIR F;  3R0A A;  5C3E J;  2EIL H;  1P4X A;  4LG3 A;  1K6Y A;  3OYB A;  3BZK A;  4HF0 A;  4KIB A;  3L2C A;  3HKZ N;  4GDF A;  2H1L A;  3HJE A;  3U1D A;  2Y2Z A;  1R49 A;  2TDX A;  3I59 A;  1IRF A;  2QBY A;  3FF5 A;  4HDV A;  4XL9 A;  4BE2 A;  2DMN A;  4NDL A;  1FJL A;  5FD5 A;  1IN5 A;  4N9I A;  1D8K A;  2IW5 A;  1I5Z A;  4II2 A;  4ESF A;  1J7K A;  2RRE A;  3GZ5 A;  2E2J J;  4OMY A;  2LVS A;  1A31 A;  1ORK A;  2FF4 A;  2NNY A;  3BR3 A;  2QQ8 A;  4KT6 A;  3ZMV A;  3M8F A;  3F21 A;  4ZYE A;  3IH4 A;  3RZO J;  2XKP A;  1ODD A;  4I98 B;  4BUP A;  1G4D A;  1KA8 A;  4XRS A;  1O7F A;  2KQR A;  1T98 A;  2ADU A;  2DA3 A;  2YX7 A;  1FMW A;  4GO1 A;  1RES A;  1ZKG A;  4HYE A;  5HOD A;  3J80 K;  2O61 A;  4BY7 J;  1ZRF A;  3C18 A;  3PM1 A;  3CZ6 A;  1UAA A;  1HW5 A;  4XLN F;  2ZCW A;  5DEQ A;  2Y75 A;  5KAI C;  3S14 J;  4BNC A;  5LRS A;  1BJZ A;  1Y56 A;  3MN2 A;  2OTL I;  2H94 A;  4CYC B;  4A2U A;  2JTV A;  3F8N A;  3K10 A;  1MBH A;  4UB8 C;  1AOY A;  2PMZ A;  3RTR A;  3HRM A;  4B47 A;  2ELH A;  3FXU A;  2ZFW A;  2STT A;  4FE4 A;  2WWY A;  1I27 A;  2E7X A;  2R5Y B;  1TP4 A;  4IRH A;  4E7J A;  1O3Q A;  1X4P A;  3G1O A;  5TIS C;  4OIN F;  1W36 D;  3DKW A;  2HKX A;  2LC2 A;  4Z2Y A;  3ZPL A;  2CH0 A;  2ID6 A;  3D5R C;  2LP0 A;  3JRI A;  2EFW A;  3F8F A;  3FK7 A;  1ZAO A;  5FKL A;  1JKR C;  2VJ4 A;  2WAQ N;  2VI6 A;  3PO3 J;  2F4I A;  1TNT A;  5CLS A;  1KGS A;  2VOO A;  2L7F P;  3HGY A;  2QGU A;  3DEW A;  1NH3 A;  2EZH A;  1YFH A;  3H5A A;  4ZYA A;  4S05 A;  4I76 A;  3GYH X;  1IRG A;  5HDG A;  1R58 A;  3QOE A;  3L2R A;  2P5L C;  5FRN A;  4XLA A;  3WU0 A;  3MQ0 A;  3OY9 A;  2RQP A;  3OYC A;  4I01 A;  3KPH A;  3HTS B;  2ISZ A;  2Y48 A;  2E1C A;  4YRV A;  3WHC A;  5EZH A;  1GV2 A;  3S17 J;  4X0G A;  2PLY A;  3F6O A;  3NEU A;  4K2E A;  1TBX A;  1WRJ A;  4CA0 A;  2BGC A;  1X2M A;  1W0U A;  2NYX A;  4DOZ A;  1R00 A;  1O3T A;  2KIM A;  4G8X A;  2GA1 A;  3S93 A;  2R92 J;  2OPT A;  2HXI A;  4AUX A;  3OMY A;  1Z0X A;  3PSI A;  1FZP B;  4PFP A;  4B3X A;  3V7C A;  1XMK A;  1GHC A;  1Z1D A;  2ZJ2 A;  3OS2 A;  1OCR H;  2DJN A;  2Q2E B;  1S7E A;  2LR8 A;  5GTH C;  2EIK H;  3GLX A;  1WGX A;  4WXH A;  3EDP A;  4XID A;  2QKM B;  1RI7 A;  1W7P B;  2LBF A;  3KP5 A;  4IHS A;  1VQ9 I;  2HFH A;  2PX9 A;  1SVL A;  1X1B A;  5CVI A;  3ZN0 A;  4C3I J;  2JWT A;  1MMG A;  4WXD A;  2P5V A;  4UUS A;  2LD5 A;  4ZYD A;  3MKZ A;  5FKK A;  1PP7 U;  4KN4 X;  1F43 A;  5E79 C;  3LFK A;  4MTE A;  3OSF A;  4DYR A;  3NAU A;  2DPU A;  1SMY F;  2EPF A;  2HU9 A;  3KP4 A;  2LKX A;  1YJN I;  2K9L A;  3ABU A;  5DD8 A;  1LQ1 A;  1KYZ A;  4BDY A;  2VKE A;  1RKT A;  3WG7 H;  4RMN A;  4RAG A;  1OCC H;  2MH2 A;  1MBG A;  1AA7 A;  5F0H A;  5EGO A;  4A3C J;  1VQ6 I;  3BG3 A;  5HLG A;  4UY8 I;  3WTZ A;  5HDK A;  2BYV E;  2QF7 A;  2B0L A;  4YFN F;  4HNT A;  1JKQ C;  5FGM A;  3K2A A;  5D4S A;  2L5Q A;  5CPR B;  5FO5 A;  3E1S A;  2OZ6 A;  2PMZ N;  1MND A;  4EJV A;  4A93 J;  4MEY F;  4ZDP A;  5FJ8 J;  1MMA A;  3L2W A;  2ECC A;  4OAZ A;  3HRS A;  1HW2 A;  3HSR A;  2BW3 B;  2L9R A;  1XMA A;  2JA2 A;  1Y6I A;  1S29 A;  1JE8 A;  1TNS A;  5L3F A;  4BAC A;  2XPW A;  3HL2 A;  1ONV A;  2X6W A;  4MIM A;  3EUH A;  1IJW C;  4HV6 A;  3V7S A;  3KZY A;  1X58 A;  4G7O F;  5E1W A;  4BQQ A;  3WE3 A;  2DOA A;  1QHG A;  1WKM A;  2R7O A;  3SZT A;  2LKS A;  4XKW A;  1MMS A;  1GVD A;  5HLI A;  1CF7 B;  1IN4 A;  2P8T A;  4RGX A;  2LLK A;  3LQR A;  3FXQ A;  2MLK A;  2Q1Z B;  3E97 A;  4EJW A;  2HQA A;  4KFC A;  2FXA A;  2KFD A;  1R4M B;  2BBY A;  4J19 A;  3BZ6 A;  3H36 A;  3DPT A;  1B72 A;  1OFC X;  3I0T A;  2V1X A;  3I56 I;  3DBL B;  1DGW Y;  3WTV C;  5H6R A;  3TOB A;  2D1V A;  2W57 A;  2VC1 A;  2JA7 J;  4PZJ A;  1RRJ A;  4MFE A;  1QZY A;  4DQ2 A;  3K4C A;  5E3M A;  5LHG A;  2EV5 A;  1MJB A;  5HNH A;  1U2W A;  1D3Y A;  5E3L A;  5LFA A;  1R23 A;  3J80 Z;  3KEO A;  1YS7 A;  3K1P A;  2MD0 A;  1AKH B;  5ICF A;  1ENH A;  2XVC A;  1X4O A;  2RC4 A;  4Y3O A;  3QYF A;  3OL3 A;  3GME A;  4CCN A;  2ICW G;  4NUB A;  2FSW A;  1MGT A;  2MC4 A;  1YW7 A;  1SD5 A;  3K4B A;  1XB4 A;  1R6R A;  2JPC A;  2DMU A;  1E3H A;  1MJ9 A;  2CV0 A;  3GEZ A;  4TV7 A;  2JRT A;  1VQK I;  1BJA A;  2HQ5 A;  1I3A A;  4I0B A;  3GWZ A;  4AYB A;  2AO9 A;  1OYI A;  4UVA A;  2VUM J;  1X1D A;  1JUP A;  3CLO A;  2IGN A;  1BW5 A;  4CCK A;  2RN7 A;  4UUV A;  4QTR A;  3EUA A;  2YU9 J;  1N75 A;  4ENK A;  5GAH J;  3I9V 2;  2V6C A;  1UEL B;  3RCO A;  1H88 C;  4KDP A;  2HOS A;  2B9S A;  2XDV A;  1QO0 D;  4IQJ A;  4HNU A;  4NQW B;  2BVL A;  2IGM A;  2RNJ A;  4H0E A;  1UJ8 A;  2L9N A;  4XLH A;  2VN2 A;  4IF4 A;  4U87 A;  3M3Y J;  3RPQ A;  1GVJ A;  4DBR A;  3W2V A;  2ACJ A;  1R1U A;  1SVO A;  2FQ3 A;  3IWZ A;  2Q8K A;  5EEA A;  3V8J A;  2UUZ A;  3D5S C;  1WJC A;  4B8X A;  1YX3 A;  4D7N A;  3R6S A;  2VBZ A;  5IP7 J;  3WTU C;  1RUO A;  1W4M A;  4A5M A;  5GAG J;  1JHF A;  2OJE D;  2VPR A;  3GX4 X;  2R5Z A;  2X9D A;  4YEJ A;  1EV7 A;  2L0K A;  2V1N A;  3Q0W A;  2V4J C;  1GDT A;  3IHU A;  4NC7 A;  2RNG A;  2IS6 A;  3IC7 A;  4DZP A;  1Y8R B;  2ZME A;  1OLT A;  3OV8 A;  2OZU A;  2CJJ A;  3Q9V A;  4IZZ A;  3H9J A;  3PO2 J;  1N78 A;  3RI4 A;  3FBN B;  4A3G J;  1JUM A;  1Z6T A;  2LSO A;  2CUJ A;  5AIP A;  2VPL A;  2CU7 A;  1OIS A;  1FSE A;  1T0F C;  1KZH A;  1W5S A;  1XSD A;  1IDY A;  2XGX A;  1UZC A;  5DUK A;  5KVR A;  3CDL A;  2OTJ I;  3EUH C;  4HSR A;  3DTK A;  1OKR A;  4OIP F;  1TT0 A;  2EQR A;  2CQK A;  2XIG A;  5FKN A;  3A01 A;  2V79 A;  2A68 F;  3MD2 A;  3RSN A;  3DTI A;  3K4K A;  4B48 A;  4PFO A;  2RDP A;  1IRZ A;  2WV1 A;  1MZB A;  2IBD A;  2MSY A;  2ZNZ A;  2MGQ A;  2R5Z B;  1VFC A;  1REP C;  2CS3 A;  2DU9 A;  3TO9 A;  3F6V A;  1LKX A;  4KMF A;  4M6V A;  5IP6 A;  6PAX A;  2GXG A;  1AWC A;  2IS2 A;  1XGN A;  3LMM A;  2R7D A;  3ZQ7 A;  3ZXS A;  1XTA A;  5J8F A;  4XBF A;  5GAD J;  1HC8 A;  3E5U A;  3MCZ A;  2L7K A;  4A3M J;  2CQ7 A;  2FMY A;  4QPO A;  1XGS A;  3ZP5 A;  3E6D A;  4I99 C;  2HQR A;  2JRM A;  1JHH A;  2K4J A;  2MAB A;  2R7S A;  4DIQ A;  2L9S A;  3S15 J;  3K9T A;  2WAE A;  3BPV A;  4M3F A;  3KYD B;  4NC8 A;  4OIO F;  4E6K G;  2DT7 B;  1QQI A;  4ZTJ A;  2HPM A;  1FOX A;  1Z05 A;  1F1Z A;  4X1E A;  1E0E A;  3SDB A;  3HB9 A;  3O8H A;  3BG9 A;  5CJ9 A;  5DS9 A;  2DBB A;  2EA2 A;  3O3K A;  1NK2 P;  2CQX A;  3PNV A;  2B7E A;  1JTX A;  3GTL J;  2JT1 A;  5CVJ A;  3H0D A;  3LST A;  1RPW A;  2B63 J;  2IAI A;  3VOE A;  1S7O A;  3GZN B;  2X4H A;  3REO A;  3MKY B;  2MH9 A;  3RJP A;  2MG4 A;  3OYD A;  3NQO A;  3G1M A;  2DQL A;  1VI0 A;  3E6B A;  1ZTR A;  3M9A A;  1VQM I;  3BY6 A;  2NS7 A;  2F5D A;  1EJ9 A;  1B9M A;  2F5F A;  1P92 A;  3OL4 A;  5JFR A;  2VOD A;  2R7T A;  2Z1D A;  4P9U A;  4ZYG A;  3K4L A;  4UV9 A;  3ZQQ A;  2HOE A;  1IG7 A;  3AFH A;  2EWN A;  4ASN A;  3T0Y A;  1LPQ A;  1MIJ A;  2EK5 A;  3M4O J;  4H4K C;  3EPZ A;  2AQE A;  2BV6 A;  1ZGA A;  1V4R A;  2YS9 A;  3KFW X;  2NNN A;  4KA4 A;  3CCL I;  1FBS A;  4Y52 J;  2NAZ A;  1ITY A;  3GXO A;  2H6B A;  1SD7 A;  3ZMD A;  3T1B A;  2H8R A;  2XF6 A;  2L2O A;  1ZGJ A;  2KIU A;  3CCQ I;  3GTG J;  5E17 F;  1JXS A;  1HSJ A;  5F27 A;  1RET A;  3L00 A;  1T08 B;  1V54 H;  1WJD A;  2BW3 A;  4I2O A;  2EFO A;  1GT0 C;  1B9N A;  1H9T A;  4EJO A;  4J01 A;  5IT3 A;  4BY1 J;  4BL0 B;  2N8G A;  5FLX Z;  3TL4 X;  2XRO A;  2E5N A;  2KRF A;  2DW4 A;  3PNT A;  3RKW A;  1Z77 A;  2KZG A;  1IUF A;  1SAN A;  1BC8 C;  1DU0 A;  1C0W A;  3OS1 A;  1QPI A;  2E60 A;  1FOW A;  4RDU A;  1I6X A;  2GM4 A;  2ZME C;  4XRM A;  3OWT A;  1Y0U A;  1MW7 A;  3F23 A;  3KP3 A;  2CO5 A;  3FMS A;  2M5W A;  3SEQ A;  1MDM B;  3WGI A;  1S9H A;  3GO5 A;  5B3S H;  4CCL A;  1U3E M;  4XOP A;  3SYT A;  1ZR2 A;  5TJJ A;  3HXL A;  3LFU A;  3U2R A;  4G6Q A;  2IA0 A;  3L2U A;  1RR7 A;  1T8I A;  1S6L A;  4ABZ A;  4XLC A;  3DEE A;  3MWM A;  4M74 A;  5IT9 K;  4N4O B;  2LRD A;  3I54 A;  3AG2 H;  1GLN A;  2QUF A;  3TOA A;  3C2H A;  3QP5 A;  1MNM C;  1OYW A;  3F8M A;  2ETH A;  1IV6 A;  1XDU A;  3HOW J;  1PVE A;  2VKH A;  1I3Q J;  3P9I A;  2BHZ A;  2HGC A;  1Z6R A;  2BXZ A;  2JSC A;  2Y30 A;  1K78 A;  3GTQ J;  3J7Z I;  3ONQ A;  4BQA A;  4A0Y A;  3FX3 A;  4A6D A;  5GAE J;  3QYB A;  1Z9C A;  4CYD A;  2KIS A;  5F04 A;  2A69 F;  1WCM J;  3VYT B;  5DV5 A;  1QRY A;  3CCE I;  1T56 A;  2M87 A;  3H5N A;  1R7J A;  2CV2 A;  3CCU I;  2JA5 J;  3IUO A;  2EIN H;  2M30 A;  3E6C C;  4IQ4 A;  1FIA A;  4PGH A;  3BR1 A;  3ECH A;  3MZ8 A;  4LJZ F;  3D0S A;  4BGD A;  3N05 A;  3IKT A;  5LGT A;  1R1V A;  4RAF A;  4E7K A;  2XGE A;  2ZSH B;  2BHY A;  4E7L A;  4XIC A;  2LTP A;  1D0X A;  2XAQ A;  1YQA A;  2R4G A;  4IHX A;  1R5G A;  2IGO A;  4QWQ A;  5F1J A;  3OYG A;  2JUC A;  3PUF A;  2K9S A;  1I1G A;  1LFB A;  4CZC A;  2HS5 A;  5HNF A;  1VZ0 A;  2ELJ A;  2Z33 A;  2W7N A;  2Z99 A;  1BR2 A;  1FIP A;  2DTR A;  5FKO A;  3FMQ A;  3DLA A;  1FBQ A;  4C2T A;  1W7P D;  5HS7 A;  4LMY A;  3ZQF A;  1CQT A;  1U0J A;  1WFX A;  4DZJ A;  4L18 B;  3GTP J;  2WA0 A;  2CUZ A;  2ESH A;  4IX7 A;  1WVR A;  1YW8 A;  4A3F J;  1O7L A;  2QWW A;  4O3M A;  4BKX A;  1LDK B;  1IN7 A;  2Z5U A;  5K7Z A;  4NB5 A;  4HF2 A;  2E7W A;  3CLQ A;  3VWB A;  1SFK A;  1MBJ A;  2GIZ A;  2XKO A;  2GZW A;  4GXO A;  3W6V A;  1YLF A;  2X1D A;  2CSO A;  1G3Y A;  1KU3 A;  1PYV A;  2E2H J;  2QVO A;  5BMZ A;  1JT0 A;  3JRB A;  3DCF A;  2EZK A;  2L4A A;  2M2E A;  3F8C A;  1Z67 A;  4RGU A;  5IPA A;  1MNE A;  2V7F A;  3HM5 A;  3CCJ I;  2IJL A;  2E35 A;  2HI3 A;  3CJR B;  5F64 A;  2DYS H;  2FUG 2;  1WZ2 A;  4O6J A;  1G3W A;  4ETS A;  5HLT A;  4JOM A;  1OCZ H;  4XSX F;  4I0A A;  3W6K B;  2ZNY A;  3TKY A;  3I55 I;  2E19 A;  4OU0 A;  2TRT A;  3NWT A;  3GVA A;  4A0Z A;  3TMO A;  5B1A H;  3S8P A;  4EGZ A;  1U8B A;  3GW2 A;  1YIJ I;  5H6Q A;  2Z9O A;  3NAR A;  3HOZ J;  2CFO A;  3UR3 C;  2ZC2 A;  4W1U A;  3BTL A;  5E8I A;  2QSG X;  5ERI A;  3AL0 B;  5LGN A;  2IA1 A;  3VYS B;  3KP7 A;  3SFI A;  4AVP A;  4C9Y A;  2DA5 A;  2OC6 A;  1ZG5 A;  1TW2 A;  2LK2 A;  2LY2 A;  3A0B C;  4PSX A;  1BIB A;  3FMR A;  4V2G A;  5BNG A;  4ZTF A;  5CYV A;  1JT6 A;  4HRI A;  2DT6 A;  3WU2 C;  1TZL A;  1G2H A;  4BS9 A;  4A3D J;  5LHI A;  3KEY A;  1L3L A;  1RUN A;  1QVU A;  2DXI A;  2EZL A;  3EQL F;  2HZD A;  2CMP A;  2COM A;  1QZE A;  2CQQ A;  3BG7 A;  2Y9Y A;  2IS4 A;  1AKH A;  4LB6 B;  1EA3 A;  1NG7 A;  2D45 A;  5FFX A;  3GTK J;  2OBP A;  2KP6 A;  2KMU A;  3GF2 A;  3L09 A;  1XN7 A;  2ZJQ F;  1P9Q C;  4DJA A;  2V9P A;  3C7J A;  5KNL A;  4S04 A;  2M7B A;  2HOA A;  1IZ1 A;  3CF5 F;  2O5R A;  4B44 A;  2EH3 A;  1RNL A;  3EET A;  4EV0 A;  1XGM A;  3R60 A;  2O3F A;  2WV0 A;  4I02 A;  2HDC A;  4FCY A;  2EB7 A;  3KCC A;  3HOT A;  1MBE A;  2TCT A;  4Q47 A;  5TGT A;  1OJL A;  4BYY A;  1HKS A;  4RA2 A;  4BH9 A;  1T38 A;  1NHA A;  1F4K A;  5J3L A;  1BA5 A;  3GTO J;  4DBQ A;  4MEX F;  3HC7 A;  3DPL C;  2DK8 A;  4ZDL A;  4OAY A;  5FLX K;  4EEF G;  3PIO F;  3H35 A;  5JLW A;  2HTS A;  5EGO B;  1FX7 A;  4DNC A;  3JRG A;  2DPD A;  3LSI A;  2E34 A;  2Y0S A;  3ELK A;  2MYS A;  5M3F J;  3C1D A;  4UV8 A;  2W84 A;  4RS8 A;  2KPM A;  4AU7 A;  1P4W A;  3WOD F;  4LGW A;  2W4S A;  4DGW B;  2ECB A;  4G94 A;  3ZRG A;  4IHY A;  4AVZ A;  2DA2 A;  2X6O A;  3SFZ A;  4MO7 A;  2HVQ A;  4BAY A;  2HZT A;  3W3C A;  3I3L A;  1KYW A;  2D1H A;  1JTY A;  3HRT A;  1LFP A;  3CF2 A;  1Z21 A;  5AIQ A;  5IYC J;  1WJE A;  2ME0 A;  3KP6 A;  1FYK A;  3FM3 A;  3FXJ A;  2YR2 A;  3HDD A;  1BW6 A;  3OOP A;  5DCF A;  1HCR A;  4A3E J;  3BJ6 A;  1G6N A;  5E1X A;  3C3W A;  1YS6 A;  3SEZ A;  2X1E A;  2GXA A;  5JR3 A;  3FDY A;  1ZGW A;  2CWE A;  4DYQ A;  1M1E B;  2FD5 A;  1ETQ A;  4MTD A;  4HZF A;  2LNB A;  5JVT A;  3I4P A;  5EG0 B;  4CZZ A;  3VYU B;  1Z91 A;  4EAT A;  2O6G E;  3AL0 C;  2R7R A;  3VSL A;  4CXF A;  1DU6 A;  1A5J A;  5KAF C;  3BR0 A;  2VQL A;  1O3R A;  1VQO I;  4XLP F;  1VQL I;  1TL8 A;  2HYJ A;  4KT5 C;  2XRL A;  4KJZ A;  4A6E A;  4OIQ F;  4Q5S F;  4HPQ A;  2Y0M A;  2L02 A;  3B6A A;  1OMI A;  1BI0 A;  2G7U A;  3CTA A;  1Q1V A;  1V55 H;  3CUQ A;  4PJ0 C;  1APL C;  2A5Y B;  4F7Z A;  3OIP A;  1A6I A;  2OA4 A;  3OYL A;  2VE9 A;  5M5W J;  2Y31 A;  2XPU A;  2GA2 A;  1T0F A;  2VXD A;  3S1R J;  3OS0 A;  3SZG A;  2XAS A;  3GBG A;  1ZEL A;  4FET A;  4GYG A;  1R36 A;  1KU9 A;  1QNT A;  3QOD A;  3KLN A;  4Y13 A;  2E1M B;  4HF1 A;  3CCR I;  4MQ9 F;  3KLO A;  5A2Q K;  4I7H A;  1B6A A;  1W1W E;  1K7A A;  1ZG3 A;  2W25 A;  5HOO A;  4JQF A;  3WGG A;  1Y8Q B;  4JK1 X;  2W1O A;  2KKO A;  4XKB A;  3BWG A;  4ZC3 A;  2LH9 A;  1MJA A;  3K69 A;  4GFB A;  2GWR A;  2VJJ A;  4NHJ A;  2KRH A;  4A3L J;  4S0H B;  2M0C A;  1ON2 A;  2LF8 A;  2V1D A;  1XGO A;  2VQC A;  1LEB A;  2VQH A;  1B72 B;  5BPI A;  1PUF B;  3TDZ C;  4CDG A;  3QAH A;  3HIF A;  2O9L A;  4D9J A;  2RV8 A;  4A3B J;  1FTT A;  2VBX A;  4U7B A;  1FOK A;  1HLV A;  3WTW C;  3WTX C;  2OCE A;  3IAM 2;  1DP3 A;  4HV5 A;  2R5Y A;  2RQQ A;  5AON A;  4P96 A;  1HST A;  4XN0 A;  4BJT A;  1BR4 A;  1E3P A;  3K1N A;  4PDK A;  4XM3 A;  3LSP A;  1OR7 A;  4UVC A;  1FBU A;  3TW7 A;  3LSG A;  2AS5 F;  3RDI A;  1QPM A;  2R7X A;  3VYR B;  2PG4 A;  1S72 I;  1UHM A;  4KIF A;  4F93 B;  2BXY A;  1HKT A;  2QQB A;  3H9G A;  3DU5 A;  4ANJ A;  1WJB A;  4KYW A;  1QBJ A;  4MNU A;  2H1K A;  5BQT A;  3KYC B;  2LYC A;  2OQG A;  3KZZ A;  3A0H C;  2L4M A;  3GLL A;  4EJT A;  2RKH A;  2OV7 A;  1FPQ A;  2PJP A;  5DDG A;  3O6B B;  3K70 C;  3HBL A;  3CQZ J;  3Q0V A;  3JRF A;  3S2H J;  3S1N J;  1ZQ3 P;  2XB0 X;  1IC8 A;  4LB5 A;  4XK4 A;  1BI1 A;  2QEX I;  2W24 A;  3ZQL A;  4FX0 A;  2NVQ J;  2K5C A;  4XN3 A;  1UMQ A;  3R0J A;  4QPQ A;  1RIO H;  3CDH A;  2JJ7 A;  2JMW A;  3QU6 A;  2DFI A;  1PDN C;  1OPC A;  1XC5 A;  2NXN B;  2PEX A;  3BR2 A;  1OCO H;  2XF7 A;  2ZME B;  2PQ8 A;  4WF2 A;  3Q3S A;  1GXP A;  2HVR A;  3B6C A;  3BP8 A;  4CHU A;  1ETV A;  2E36 A;  3ROU A;  3SHF A;  1TWH J;  3L2V A;  2QM3 A;  1SD6 A;  4LK0 F;  2HOT A;  3K1M A;  3TDU C;  3ZMU A;  3R4K A;  5E8G A;  4Q4Z F;  4GYI A;  5DTD A;  3IH2 A;  4LIT A;  4E7Z A;  4AIH A;  3L1P A;  3I59 B;  2D2W A;  2LMD A;  3BLY A;  3B73 A;  1W7P A;  2LBF B;  2UWM A;  4AD9 A;  2LRE A;  4L5J A;  3I53 A;  2JZY A;  4M6X A;  2DLL A;  2K4B A;  3A2K A;  5EEH A;  1EH7 A;  1VTN C;  5L3D A;  4M72 A;  1H9G A;  4EQQ A;  4LFU A;  4XOR A;  2XV4 S;  2XC7 A;  5KCM A;  4JX5 A;  3VPR A;  3BPX A;  2CW8 A;  3BCA A;  3HTU A;  2L7Z A;  4V2F A;  3RPU A;  3ZGK A;  1T2K A;  1N25 A;  3IWF A;  2MW8 A;  2NS0 A;  1QHH D;  1WH7 A;  2K9M A;  4HQM A;  1K4T A;  2P7C B;  3QPH A;  1XDS A;  1VND A;  2BZT A;  3OYF A;  3H5R A;  3EYY A;  3C2B A;  5D5X B;  3HGG A;  1QA6 A;  2E1O A;  2ZJR F;  1FEX A;  3G1L A;  2LY9 A;  4E4H A;  2QA4 I;  1MSF C;  3JAM Z;  3JR9 A;  2STW A;  5ICG A;  3E0J B;  1XMX A;  3HUG B;  3HOX J;  3D5L A;  3GZ6 A;  3BRO A;  2F48 A;  1VQP I;  5JI6 A;  1K79 A;  2DCE A;  3E5X A;  5D4R A;  3N4M A;  1IDZ A;  2I5U A;  4R79 A;  1ZR4 A;  1MH4 A;  5LLQ A;  1U5T C;  3MEX A;  3HYI A;  1ZAR A;  1PUF A;  3GFL A;  4XMY A;  3WTT C;  3K4M A;  2IVM A;  4EVI A;  4MQV A;  1FY7 A;  3L7W A;  1KU7 A;  5BS6 A;  3PQJ A;  3LAP A;  3CD6 I;  4L0Y B;  5LEJ A;  4IOC F;  5JVG F;  3ECO A;  1Y1V J;  3H1C A;  3K7A J;  1IXC A;  4I6Z A;  2EV0 A;  4RAZ A;  2NRA C;  1STZ A;  5DCM A;  1BI3 A;  3BJA A;  3HHG A;  4OWR B;  5KK1 A;  1V5F A;  3GFI A;  4E7I A;  2ZXH A;  3S2D J;  3CJQ B;  4QSH A;  2DO7 A;  3PFY A;  3S16 J;  3P9K A;  2UV1 A;  4UXN A;  2DDA A;  3ZCO A;  1G8X A;  1YIO A;  5IP9 J;  3GTM J;  4NC6 A;  3ML6 A;  3EUK L;  3RPU D;  1IUY A;  1Z7U A;  4MGR A;  1G3S A;  4PCQ A;  1WQ2 A;  4L9T A;  2EZI A;  4EGY A;  1MH3 A;  2W85 A;  5IY5 H;  2DOE A;  2KHM A;  3OOU A;  1FSH A;  3FZV A;  3JCU C;  3OYJ A;  3TP0 A;  1SFU A;  3HSE A;  4ZYH A;  2XAJ A;  3BT9 A;  5GPA A;  5B66 C;  4P9F A;  1YJ9 I;  3MZH A;  1F5T A;  3ASO H;  4C2M J;  1DQU A;  2IPQ X;  3BC8 A;  1EKE A;  1TQP A;  2XAG A;  3WHB A;  3FXL A;  1I6H J;  1AHD P;  2A6E F;  2XSD C;  3TBI A;  3VDX A;  1JI8 A;  3A02 A;  4YG2 F;  4Y17 A;  5E20 A;  5JHF A;  3H3Z A;  3ZR8 X;  2BOL A;  2IA2 A;  4EMS A;  3ABT A;  4C3J J;  5K5R A;  3ABL H;  4FX4 A;  2VJ5 A;  4G7H F;  2W00 A;  2M4G A;  3DPU A;  2A6T A;  2ZXJ A;  2Y69 H;  4Y4R A;  3K2Z A;  3L9F A;  5K7F A;  3AKZ A;  2K02 A;  1SMT A;  3WTS C;  2WAD A;  3RQI A;  1ZYR F;  1SEU A;  3Q5F A;  1G3T A;  2QQA A;  4IO9 F;  4L0Z B;  4L9N A;  2DDB A;  5J4Y A;  2EA4 A;  2C6Y A;  4U0W A;  4YIF A;  1UFM A;  4A69 C;  5EYR A;  4E7H A;  2XGC A;  4AID A;  1MD0 A;  1BL0 A;  1D0Z A;  1W5C C;  1R71 A;  3IRQ A;  3O2P E;  1PJR A;  5DM7 F;  4X6A J;  1B8I B;  5H2F C;  3JRH A;  1J59 A;  1BC7 C;  2OCC H;  1ZLJ A;  5DUI A;  1U9N A;  2W48 A;  1J75 A;  4WWC A;  5IOZ A;  4HLX A;  3I71 A;  3FKI J;  4CCJ A;  3JRD A;  5D6E A;  5D5U B;  1D1C A;  1TQI A;  1E2X A;  2QEN A;  5DD4 A;  3JSP A;  2FE3 A;  2AXL A;  2GXB A;  5HS8 A;  2BE5 F;  2NVU B;  3M7G A;  1YOV B;  5FKM A;  3HKZ A;  1YE9 A;  3K4N A;  2CW0 F;  3BCB A;  4BHP A;  2D5V A;  4FT8 A;  1MDM A;  5F1R A;  4IL6 C;  4D1Q A;  3TGN A;  2YUS A;  2M8G X;  2R3S A;  4DYC A;  2ZJP F;  3S1M J;  2VJI A;  3S32 A;  1K78 B;  2Q2E A;  3C2G A;  4M3B A;  3W2W A;  3F8B A;  3IV5 A;  1ETO A;  3FKJ A;  3V8K A;  3OYE A;  2M34 A;  1UG0 A;  3CCY A;  3V8L A;  4G6D A;  5CKT A;  3TP3 A;  3F9K A;  1S7A A;  4IPA A;  3E6M A;  4ZH4 F;  4XR6 A;  1LB2 A;  1NG6 A;  4IOA F;  1Y1W J;  1H0M A;  3G71 I;  3KYL A;  1IV8 A;  2QYO A;  2IT0 A;  2KJC A;  1EH8 A;  5IYD J;  1TWA J;  1LJ9 A;  2EJR A;  5D6F A;  1ETW A;  2LFB A;  3ASN H;  3P9C A;  4ENJ A;  4A3I J;  2ISY A;  5B5E C;  1OCP A;  1OCT C;  3BJO A;  2LOO A;  2HDW A;  3SQN A;  1ZLK A;  2DA6 A;  1TQM A;  1WWX A;  4Q48 A;  4HST A;  1IN8 A;  2O03 A;  2BY2 A;  3CMY A;  2K86 A;  1XCV A;  4IXA A;  2QSH X;  5J47 A;  2OF7 A;  4AIK A;  3I4N J;  3DBH B;  1K6O A;  2JUG A;  3M8J A;  4HLY A;  4RB1 A;  1BBY A;  4HAM A;  2K85 A;  1NTC A;  4J00 A;  3FIW A;  2XUB A;  4MHG A;  3CC7 I;  3DFG A;  4UVB A;  3M07 A;  3BZC A;  2WTE A;  3QPL A;  2I10 A;  2CW7 A;  5CVR A;  1XCB A;  2M8E A;  2PMU A;  2MLG A;  1QZZ A;  4FIS A;  1DUX C;  5F6F A;  3TQN A;  1I39 A;  2VC0 A;  3JTH A;  4M9X A;  3I64 A;  4KIS A;  1Z7L A;  2EIM H;  5CVV A;  3ISP A;  3FK6 A; 
#chains in the Genus database with same CATH homology
 1KQ9 A;  2HR3 A;  2G9W A;  1PUE E;  3N97 A;  2OD5 A;  4CIC A;  5K5O A;  3DP7 A;  2M45 A;  4KIG A;  1P6R A;  1SAX A;  4KNY A;  3ERE D;  1BI2 A;  1R1T A;  5E1Z B;  5LHH A;  1ZG1 A;  1HBX G;  5D8K B;  1LEA A;  2YX4 A;  3PFI A;  3BOQ A;  3HUG A;  1SFE A;  1P2F A;  1FNN A;  1P4A A;  4ZZL A;  5D5V B;  3KET A;  1XSX A;  3FM5 A;  3TO6 A;  3J7A O;  2H6C A;  4CGZ A;  2J5P A;  3M8E A;  2CG4 A;  1QGP A;  1ZRE A;  1LNW A;  2KJB A;  5D8L B;  5CVU A;  4WK8 F;  3B02 A;  2VON A;  1HW1 A;  1HQC A;  3Q9S A;  1YTY A;  4UHT A;  4LG0 B;  1D8J A;  1HXD A;  4U7D A;  4M9S A;  4A0X A;  4M6Y A;  3CUO A;  4BHB A;  2QQ9 A;  2KIF A;  4U0Y A;  4LLL A;  1ZN2 A;  3FXR A;  5HLH A;  1X3U A;  3MZY A;  4O5V A;  3NRV A;  4IRG A;  2K27 A;  5EEG A;  1UCR A;  1LVA A;  1SFX A;  4G7Z F;  3DV8 A;  4YII A;  5HS9 A;  2XHK A;  3JAM K;  5LEK A;  2VE8 A;  2ZKZ A;  4GGG A;  3KP2 A;  1ULY A;  2FU4 A;  4XSZ F;  1SD4 A;  3DQV C;  2E1N A;  4N9H A;  3H3U A;  4R1H A;  1U8R A;  2DI3 A;  4YFK F;  1KQ8 A;  2HTJ A;  1IAW A;  3VEP A;  4A12 A;  2J5O A;  3LA2 A;  3TO7 A;  4EJU A;  2F5E A;  3QOP A;  1CGP A;  4AIJ A;  3G3Z A;  4N0B A;  2L3D A;  3FHZ A;  1IF1 A;  1J9I A;  1ON1 A;  3IRR A;  1BN5 A;  2A3S A;  4M71 A;  5J6X A;  2UXX A;  3K0L A;  4IVN A;  4KN7 X;  1F9N A;  1HKQ A;  2HWV A;  3IL2 A;  5HDN A;  2A6H F;  5J8C A;  2DAO A;  3QU3 A;  4U88 A;  4EM1 A;  4QLC U;  5JHU A;  4ENM A;  4LLG F;  1E17 A;  1T39 A;  1L0O C;  4OOI A;  2MD5 A;  5IT9 Z;  3GFJ A;  3CO7 C;  2FRH A;  5K1Y A;  4FHT A;  1ZH5 A;  1CF7 A;  4L5I A;  2RVC A;  3J81 Z;  4A5N A;  1OYY A;  3MFK A;  3HSF A;  1KU2 A;  1WSU A;  1JGS A;  1T6S A;  2G7H A;  1LDD A;  1UB9 A;  4Y15 A;  1RZ4 A;  2BEO A;  5A2Q Z;  3PQK A;  5HVQ C;  4M9Z A;  1YG2 A;  3RIR A;  4EM0 B;  2ZO4 A;  2H27 A;  1FP2 A;  4G9Y A;  2P7V B;  1FWZ A;  2DQR A;  3WU1 B;  1MKM A;  3KE2 A;  3MAJ A;  3E3V A;  4L9J A;  2JPB A;  5ILU A;  1O3S A;  1FLI A;  2YU3 A;  1DP7 P;  2UZK A;  1J0R A;  3DF8 A;  3P7N A;  1V3F A;  4HX4 A;  4CO8 A;  2VBY A;  2P4W A;  3ZMT A;  2LDU A;  3GFM A;  3ULQ B;  3RKY A;  3DEU A;  4L9V A;  1FC3 A;  2YSR A;  2OU2 A;  2EFN A;  2QZ8 A;  2VBW A;  3WTY C;  4I09 A;  4LG0 A;  1YO5 C;  3ZN1 A;  4IHT A;  3T8R A;  1WI9 A;  4D0P A;  1UST A;  2A07 F;  1S8N A;  2FNP A;  2MBF A;  5L3B A;  1J5Y A;  2WC2 A;  4NQW A;  1BM9 A;  1YW9 A;  2GAU A;  5L3G A;  2Q0O A;  2EV6 A;  3F22 A;  2FBK A;  2EFP A;  2LF7 A;  1IXS B;  3LWF A;  2OAZ A;  4U0V A;  4WX9 A;  2VT3 A;  3VOD A;  4GCV A;  4AWX B;  1B59 A;  5DCM B;  3ZMZ A;  2PBI A;  2P5K A;  2VXZ A;  4HX8 A;  3AAF A;  3WG9 A;  3DXJ F;  3QP6 A;  3E5Q A;  5ICE A;  4RAY A;  2HQN A;  2ESN A;  2IP2 A;  5FB2 A;  3T5X A;  3FWE A;  2GQQ A;  2DK5 A;  3CJN A;  2XRN A;  1LDJ A;  1O57 A;  5L3E A;  3JW4 A;  3QPT A;  3JSO A;  2FML A;  4RGS A;  3CUQ B;  2EFQ A;  3EYI A;  2P6T A;  4JBA A;  4ESB A;  1D5V A;  2V9V A;  2OQR A;  3SXY A;  4YFX F;  1A04 A;  4UNO A;  3VFZ A;  2GIV A;  2PN6 A;  2F2E A;  3HOS A;  3ZMS A;  2A61 A;  1B4A A;  2UXN A;  4PGG A;  2H09 A;  2MA3 A;  1ZRC A;  4HW0 A;  3SZP A;  4RB0 A;  1ZRD A;  1IXR C;  5DYM A;  1BOA A;  1TW3 A;  1J2X A;  3RKX A;  3G73 A;  3BDD A;  1XD7 A;  5LGU A;  4M73 A;  1U5T B;  1FP1 D;  3RYR A;  3U9G A;  3KEQ A;  4WCG A;  5D5W B;  2PMH A;  1I1S A;  1FT9 A;  1EH6 A;  1FYM A;  3I58 A;  3CUQ C;  5ILV A;  1U5T A;  5K5Q A;  3J81 K;  2FBH A;  1USS A;  1XSV A;  3LA3 A;  3F72 A;  3VB2 A;  3LAJ A;  4KMU X;  4LD5 A;  2IRF G;  1PP8 F;  2MC3 A;  3W6J B;  3T8T A;  4EM2 A;  4RB2 C;  1W5T A;  1DPU A;  4LK1 F;  4HA8 A;  4RGR A;  3QRF F;  2P6S A;  3HRU A;  4HBL A;  2L54 A;  3LQQ A;  2R7F A;  1R22 A;  2HEO A;  2VT2 A;  5H20 A;  4HQE A;  2HYG D;  3WE2 A;  4XRF A;  5E18 F;  3COA C;  4KIC A;  3CO6 C;  2HKO A;  3IKV A;  5FFZ A;  1IN6 A;  1U78 A;  2F5C A;  2ZBK A;  5BOX A;  2FBI A;  1R5H A;  4ON0 A;  2K7L A;  4BHC A;  1YYV A;  4E70 A;  2FOK A;  3LA7 A;  3V7R A;  1UHW A;  4ENN A;  2YPR A;  5FD6 A;  1KQ0 A;  5BPD A;  2CGP A;  3H92 A;  2L01 A;  3F3X A;  2O0Y A;  2M1B A;  1B1B A;  2PFB A;  2XAF A;  2FEZ A;  4RB3 C;  4ESJ A;  3HHH A;  4WXC A;  2V1U A;  4IRI A;  2VOP A;  1TTY A;  1TLH B;  2FNA A;  1ZHF A;  2PI0 A;  3I5U A;  2CYY A;  2HYF A;  4B09 A;  3JTG A;  3GUD A;  4BXU A;  1BIA A;  4HDU A;  2O8X A;  2LKP A;  5ED4 A;  1FYL A;  2Z3Y A;  1S3J A;  4IJA A;  3S2W A;  5LRR A;  4KUM A;  5L3C A;  1U6G A;  5TRD A;  4LLN A;  2QLZ A;  2QBY B;  2DT5 A;  4P55 A;  4HX7 A;  2FA5 A;  1DPR A;  4R8H A;  1DDN A;  3M1E A;  1Q1H A;  2CFX A;  4HOB A;  4ZZD A;  5ILS A;  3WGH A;  5LBQ A;  1IW7 F;  1GXQ A;  5ICC A;  2RGV A;  3R61 A;  3RYP A;  3V4G A;  2XAH A;  4OMZ A;  4P5O A;  2X0L A;  4OIR F;  3R0A A;  1P4X A;  4HF0 A;  4KIB A;  3L2C A;  3U1D A;  2TDX A;  3I59 A;  1IRF A;  2QBY A;  3FF5 A;  4HDV A;  1IN5 A;  4N9I A;  1D8K A;  4ESF A;  2IW5 A;  1I5Z A;  1J7K A;  3GZ5 A;  4OMY A;  2FF4 A;  2NNY A;  3ZMV A;  3M8F A;  3F21 A;  4ZYE A;  2XKP A;  1ODD A;  4I98 B;  1G4D A;  1KA8 A;  1O7F A;  1T98 A;  2ADU A;  2YX7 A;  4GO1 A;  4HYE A;  3J80 K;  2O61 A;  1ZRF A;  3C18 A;  1HW5 A;  4XLN F;  2ZCW A;  5DEQ A;  2Y75 A;  4BNC A;  5LRS A;  2H94 A;  4A2U A;  2JTV A;  3F8N A;  1AOY A;  3RTR A;  3HRM A;  2ELH A;  3FXU A;  2ZFW A;  2STT A;  2WWY A;  1I27 A;  2E7X A;  4IRH A;  1O3Q A;  4OIN F;  3DKW A;  2HKX A;  4Z2Y A;  3ZPL A;  2EFW A;  3F8F A;  1ZAO A;  1TNT A;  5CLS A;  1KGS A;  2VOO A;  1YFH A;  4S05 A;  3GYH X;  1IRG A;  5HDG A;  1R58 A;  2P5L C;  3WU0 A;  3MQ0 A;  2RQP A;  4I01 A;  3HTS B;  2ISZ A;  2Y48 A;  2E1C A;  2PLY A;  3F6O A;  3NEU A;  4K2E A;  1TBX A;  1WRJ A;  2BGC A;  2NYX A;  1R00 A;  1O3T A;  2KIM A;  4G8X A;  2GA1 A;  1FZP B;  3V7C A;  1XMK A;  1GHC A;  1Z1D A;  2ZJ2 A;  3GLX A;  4WXH A;  3EDP A;  1RI7 A;  1W7P B;  3KP5 A;  4IHS A;  2HFH A;  5CVI A;  3ZN0 A;  4WXD A;  2P5V A;  4ZYD A;  1PP7 U;  4KN4 X;  4MTE A;  3LFK A;  2DPU A;  1SMY F;  3KP4 A;  3ABU A;  5DD8 A;  1LQ1 A;  1KYZ A;  2MH2 A;  5HLG A;  3WTZ A;  5HDK A;  2BYV E;  4YFN F;  2B0L A;  5FGM A;  5D4S A;  5FO5 A;  2OZ6 A;  4EJV A;  4MEY F;  3HRS A;  1HW2 A;  3HSR A;  1XMA A;  1S29 A;  1JE8 A;  1TNS A;  5L3F A;  1ONV A;  3EUH A;  4HV6 A;  3V7S A;  3KZY A;  4G7O F;  5E1W A;  3WE3 A;  1WKM A;  3SZT A;  5HLI A;  1CF7 B;  1IN4 A;  2P8T A;  4RGX A;  3LQR A;  3FXQ A;  2MLK A;  4EJW A;  3E97 A;  4KFC A;  2FXA A;  2BBY A;  3BZ6 A;  3DPT A;  3I0T A;  2V1X A;  3WTV C;  5H6R A;  3TOB A;  2D1V A;  2W57 A;  2VC1 A;  4PZJ A;  1QZY A;  4DQ2 A;  5LHG A;  2EV5 A;  1MJB A;  1U2W A;  1D3Y A;  1R23 A;  3J80 Z;  3KEO A;  1YS7 A;  3K1P A;  5ICF A;  2XVC A;  2RC4 A;  2FSW A;  1MGT A;  1YW7 A;  1SD5 A;  1XB4 A;  2JPC A;  1MJ9 A;  3GEZ A;  4TV7 A;  2JRT A;  1BJA A;  4I0B A;  3GWZ A;  1OYI A;  4UVA A;  3CLO A;  2RN7 A;  4UUV A;  4ENK A;  2V6C A;  4KDP A;  1QO0 D;  2RNJ A;  4H0E A;  2VN2 A;  4IF4 A;  3RPQ A;  1GVJ A;  2ACJ A;  1R1U A;  2FQ3 A;  2Q8K A;  3IWZ A;  3V8J A;  4B8X A;  3R6S A;  2VBZ A;  3WTU C;  1RUO A;  1W4M A;  4A5M A;  1JHF A;  3GX4 X;  1EV7 A;  3IHU A;  3IC7 A;  2ZME A;  3OV8 A;  2OZU A;  3Q9V A;  3RI4 A;  1Z6T A;  2LSO A;  5AIP A;  1FSE A;  1W5S A;  1XSD A;  2XGX A;  5DUK A;  5KVR A;  1OKR A;  4OIP F;  2CQK A;  2XIG A;  2V79 A;  2A68 F;  2RDP A;  1MZB A;  2ZNZ A;  1REP C;  2DU9 A;  3TO9 A;  3F6V A;  4KMF A;  6PAX A;  2GXG A;  1AWC A;  1XGN A;  2R7D A;  3ZQ7 A;  5J8F A;  4XBF A;  3E5U A;  3MCZ A;  2FMY A;  1XGS A;  3ZP5 A;  3E6D A;  2HQR A;  1JHH A;  2K4J A;  3K9T A;  3BPV A;  4OIO F;  1QQI A;  1Z05 A;  1F1Z A;  5CJ9 A;  2DBB A;  2EA2 A;  3O3K A;  2JT1 A;  5CVJ A;  3LST A;  3VOE A;  1S7O A;  2X4H A;  3REO A;  2MH9 A;  3RJP A;  3NQO A;  2DQL A;  3E6B A;  3M9A A;  3BY6 A;  2F5D A;  1B9M A;  2F5F A;  1P92 A;  5JFR A;  2VOD A;  4P9U A;  4ZYG A;  4UV9 A;  2HOE A;  2EWN A;  4ASN A;  3T0Y A;  2EK5 A;  2BV6 A;  1ZGA A;  1V4R A;  3KFW X;  2NNN A;  4KA4 A;  1FBS A;  2NAZ A;  3GXO A;  3ZMD A;  2H6B A;  1SD7 A;  3T1B A;  1ZGJ A;  2KIU A;  5E17 F;  1JXS A;  1HSJ A;  3L00 A;  4I2O A;  2EFO A;  1B9N A;  1H9T A;  4EJO A;  5IT3 A;  5FLX Z;  2XRO A;  2KRF A;  2DW4 A;  3RKW A;  1BC8 C;  1C0W A;  1I6X A;  1Y0U A;  3F23 A;  3KP3 A;  2CO5 A;  3FMS A;  2M5W A;  1MDM B;  3WGI A;  3GO5 A;  1U3E M;  5TJJ A;  3U2R A;  4G6Q A;  2IA0 A;  1S6L A;  3MWM A;  4M74 A;  5IT9 K;  3I54 A;  3TOA A;  2QUF A;  3QP5 A;  1OYW A;  3F8M A;  2ETH A;  1XDU A;  3P9I A;  2HGC A;  1Z6R A;  2JSC A;  1K78 A;  4BQA A;  4A0Y A;  3FX3 A;  4A6D A;  1Z9C A;  4CYD A;  2A69 F;  5DV5 A;  2M87 A;  1R7J A;  2M30 A;  3E6C C;  4PGH A;  3ECH A;  4LJZ F;  3D0S A;  3IKT A;  5LGT A;  1R1V A;  2XAQ A;  1YQA A;  1R5G A;  4QWQ A;  1I1G A;  2HS5 A;  2Z33 A;  2Z99 A;  2DTR A;  3FMQ A;  1FBQ A;  1W7P D;  5HS7 A;  4LMY A;  4L18 B;  2ESH A;  1YW8 A;  1O7L A;  2QWW A;  4O3M A;  1LDK B;  1IN7 A;  2Z5U A;  4NB5 A;  4HF2 A;  2E7W A;  2XKO A;  2GZW A;  4GXO A;  1YLF A;  2CSO A;  1G3Y A;  1KU3 A;  2QVO A;  5BMZ A;  2L4A A;  3F8C A;  4RGU A;  2IJL A;  5F64 A;  4O6J A;  1G3W A;  4ETS A;  4XSX F;  4I0A A;  3W6K B;  2ZNY A;  3TKY A;  4OU0 A;  3GVA A;  4A0Z A;  4EGZ A;  3GW2 A;  5H6Q A;  2Z9O A;  5E8I A;  5ERI A;  5LGN A;  2IA1 A;  3KP7 A;  4AVP A;  1ZG5 A;  1TW2 A;  1BIB A;  3FMR A;  5CYV A;  5LHI A;  1L3L A;  1RUN A;  3EQL F;  2COM A;  4LB6 B;  2D45 A;  5FFX A;  2OBP A;  3L09 A;  3GF2 A;  1XN7 A;  3C7J A;  4S04 A;  1IZ1 A;  4EV0 A;  1RNL A;  3EET A;  1XGM A;  3R60 A;  2O3F A;  2WV0 A;  4I02 A;  2HDC A;  2EB7 A;  3KCC A;  3HOT A;  4BYY A;  4Q47 A;  1HKS A;  4BH9 A;  1T38 A;  1NHA A;  1F4K A;  4MEX F;  3DPL C;  2DK8 A;  5FLX K;  2DPD A;  2HTS A;  1FX7 A;  4DNC A;  3ELK A;  3C1D A;  4UV8 A;  2W84 A;  4RS8 A;  1P4W A;  3WOD F;  4LGW A;  4G94 A;  3SFZ A;  4BAY A;  2HZT A;  1KYW A;  2D1H A;  3HRT A;  5AIQ A;  3KP6 A;  1FYK A;  3FM3 A;  2YR2 A;  3OOP A;  5DCF A;  3BJ6 A;  1G6N A;  5E1X A;  3C3W A;  1YS6 A;  5JR3 A;  2CWE A;  4MTD A;  4HZF A;  2LNB A;  5JVT A;  3I4P A;  4CZZ A;  1Z91 A;  2O6G E;  4CXF A;  1O3R A;  4XLP F;  4KT5 C;  4A6E A;  4Q5S F;  4OIQ F;  2Y0M A;  2L02 A;  2G7U A;  1OMI A;  1BI0 A;  3CTA A;  3CUQ A;  2A5Y B;  4F7Z A;  2OA4 A;  2VE9 A;  2GA2 A;  1T0F A;  2XAS A;  4GYG A;  1R36 A;  1KU9 A;  1QNT A;  3KLN A;  4Y13 A;  4HF1 A;  4MQ9 F;  3KLO A;  5A2Q K;  4I7H A;  1B6A A;  1K7A A;  1ZG3 A;  2W25 A;  5HOO A;  4JQF A;  3WGG A;  4JK1 X;  2KKO A;  3BWG A;  1MJA A;  3K69 A;  2GWR A;  4NHJ A;  1ON2 A;  2LF8 A;  2V1D A;  1XGO A;  1LEB A;  5BPI A;  3TDZ C;  4CDG A;  3QAH A;  3HIF A;  2RV8 A;  2VBX A;  4U7B A;  1FOK A;  3WTW C;  3WTX C;  4HV5 A;  5AON A;  4P96 A;  1HST A;  3K1N A;  4PDK A;  1OR7 A;  4UVC A;  1FBU A;  2AS5 F;  3RDI A;  1QPM A;  2PG4 A;  1UHM A;  4KIF A;  1HKT A;  2QQB A;  4KYW A;  1QBJ A;  4MNU A;  5BQT A;  2OQG A;  3KZZ A;  2L4M A;  4EJT A;  2RKH A;  1FPQ A;  2PJP A;  5DDG A;  3O6B B;  4LB5 A;  1BI1 A;  2W24 A;  4FX0 A;  3R0J A;  1RIO H;  3CDH A;  3QU6 A;  2DFI A;  1PDN C;  1OPC A;  2PQ8 A;  2PEX A;  1GXP A;  5D5U B;  2ZME B;  4WF2 A;  3BP8 A;  4CHU A;  3ROU A;  3SHF A;  2QM3 A;  1SD6 A;  4LK0 F;  3K1M A;  3TDU C;  3ZMU A;  3R4K A;  5E8G A;  4Q4Z F;  4GYI A;  4AIH A;  3I59 B;  2D2W A;  3B73 A;  1W7P A;  2UWM A;  4AD9 A;  4L5J A;  3I53 A;  2JZY A;  4M6X A;  2DLL A;  2K4B A;  5EEH A;  1EH7 A;  1VTN C;  5L3D A;  4M72 A;  1H9G A;  4EQQ A;  4LFU A;  2XV4 S;  3BPX A;  3HTU A;  3RPU A;  1T2K A;  3IWF A;  2NS0 A;  4HQM A;  2P7C B;  3QPH A;  1XDS A;  3EYY A;  5D5X B;  3JAM Z;  2STW A;  5ICG A;  3D5L A;  3GZ6 A;  3BRO A;  5JI6 A;  1K79 A;  3E5X A;  5D4R A;  3N4M A;  4R79 A;  5LLQ A;  1U5T C;  3MEX A;  3HYI A;  1ZAR A;  3GFL A;  3WTT C;  2IVM A;  4EVI A;  4MQV A;  1FY7 A;  3L7W A;  1KU7 A;  5BS6 A;  3PQJ A;  3LAP A;  4L0Y B;  5LEJ A;  3ECO A;  2NRA C;  1IXC A;  4RAZ A;  2EV0 A;  1STZ A;  5DCM A;  1BI3 A;  3BJA A;  3HHG A;  5KK1 A;  3GFI A;  2DO7 A;  3P9K A;  4UXN A;  1YIO A;  3ML6 A;  1IUY A;  1Z7U A;  4MGR A;  1G3S A;  4PCQ A;  1WQ2 A;  4L9T A;  4EGY A;  2W85 A;  1FSH A;  3FZV A;  1SFU A;  3HSE A;  4ZYH A;  2XAJ A;  4P9F A;  3MZH A;  1F5T A;  2IPQ X;  1TQP A;  2XAG A;  2A6E F;  4YG2 F;  4Y17 A;  5E20 A;  3H3Z A;  2IA2 A;  4EMS A;  3ABT A;  5K5R A;  4FX4 A;  4G7H F;  2ZXJ A;  3K2Z A;  3L9F A;  2K02 A;  1SMT A;  3WTS C;  1ZYR F;  5CVV A;  3Q5F A;  1G3T A;  2QQA A;  4L0Z B;  4L9N A;  2EA4 A;  2C6Y A;  4U0W A;  4YIF A;  1UFM A;  1MD0 A;  3IRQ A;  3O2P E;  1BC7 C;  1ZLJ A;  5DUI A;  1J75 A;  4WWC A;  4HLX A;  3I71 A;  5D6E A;  1TQI A;  1E2X A;  2QEN A;  3JSP A;  5DD4 A;  2FE3 A;  2AXL A;  2GXB A;  5HS8 A;  2BE5 F;  3M7G A;  2CW0 F;  4BHP A;  4FT8 A;  1MDM A;  5F1R A;  3TGN A;  2R3S A;  1K78 B;  2Q2E A;  3F8B A;  3V8K A;  3V8L A;  4G6D A;  1S7A A;  4IPA A;  3E6M A;  4ZH4 F;  1LB2 A;  1H0M A;  2QYO A;  2IT0 A;  2KJC A;  1EH8 A;  1LJ9 A;  2EJR A;  5D6F A;  3P9C A;  1J59 A;  4ENJ A;  2ISY A;  3BJO A;  3SQN A;  1ZLK A;  1TQM A;  1WWX A;  4Q48 A;  1IN8 A;  2O03 A;  2K86 A;  1XCV A;  4IXA A;  4AIK A;  1K6O A;  4HLY A;  4RB1 A;  1BBY A;  4HAM A;  2XUB A;  4MHG A;  3DFG A;  4UVB A;  2WTE A;  5CVR A;  1XCB A;  2M8E A;  2PMU A;  2MLG A;  1QZZ A;  1DUX C;  5F6F A;  3TQN A;  2VC0 A;  3JTH A;  4M9X A;  3I64 A;  5FD5 A;  3ISP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...