4EJVA

Staphylococcus epidermidis tcar in complex with chloramphenicol
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
147
structure length
135
Chain Sequence
IEDHISFLEKFINDVNTLTAKLLKDLQTEYGISAEQSHVLNMLSIEALTVGQITEKQGVNKAAVSRRVKKLLNAELVKLIIKLSNKGKKYIKERKAIMSHIASDMTSDFDSKEIEKVRQVLEIIDYRIQSYTSKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator TcaR
publication title Structural analysis of the antibiotic recognition mechanism of MarR family proteins
rcsb
source organism Staphylococcus epidermidis
molecule tags Transcription regulator
total genus 48
structure length 135
sequence length 147
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4ejvA00
2FRHA 1RI7A 2STTA 3BPVA 2VBYA 4RAZA 5F64A 1FX7A 1IAWA 3VOEA 2FNAA 2CYYA 2HOEA 4L9VA 2AS5F 1QBJA 1CGPA 2COMA 5CVRA 4IXAA 2QQ9A 2YPRA 1HQCA 2DW4A 1ZREA 2XGXA 2A07F 3FM5A 2DPDA 5JVTA 5A2QK 1ZRFA 1J5YA 2HZTA 3HHGA 2K27A 4GO1A 1Z6TA 1R58A 1UFMA 2MH9A 1D5VA 2KIFA 3BJ6A 5KK1A 3BZ6A 2HS5A 3WU0A 2XHKA 3DEUA 3DPTA 1IXSB 2KIUA 3V8LA 3KEQA 1JGSA 4G94A 3BDDA 3I4PA 2FMLA 1TQPA 3M7GA 4BHPA 1GHCA 4EJOA 1FYMA 5CVVA 2XV4S 4I7HA 4M74A 5L3EA 1J9IA 4I0BA 2IVMA 3I58A 2FBHA 4E70A 3I0TA 1FWZA 2ESHA 4L9TA 2XKPA 3SZPA 3QP5A 2Q2EA 1YYVA 4KIBA 4CDGA 3LFKA 3BWGA 3IKVA 4EJTA 4RB2C 3TQNA 2FMYA 2GA1A 3WU1B 2H6CA 4CHUA 2LNBA 5AONA 4BHBA 1JXSA 2BYVE 1FSHA 4ZYHA 1IXRC 3ELKA 2KIMA 5BMZA 4KYWA 1W7PD 4B8XA 4OIPF 2BE5F 5DCMB 1HSTA 4Z2YA 3J80Z 4HQEA 1XMAA 2M87A 1MKMA 1S8NA 4XLPF 2VBZA 2DQLA 2P4WA 5IT9K 1Z9CA 4UVAA 1FP1D 3KP5A 1G3SA 5HS9A 3C7JA 1ODDA 1PP8F 3LSTA 2MLKA 5TRDA 1BI0A 4G7OF 1OYIA 3TKYA 1XSVA 2DQRA 3LAJA 3GFLA 1F4KA 3KP3A 4KN7X 2FEZA 2PEXA 2L4MA 1YIOA 2QQBA 1SD7A 4AIKA 2KKOA 2GAUA 1D8KA 4RAYA 2UZKA 5D4SA 2P5VA 5DCMA 4I98B 3P9IA 1R1VA 1BI1A 4WXHA 1IRFA 2DTRA 4XBFA 3P9CA 1HW2A 2ETHA 4LK1F 2ISYA 3HTUA 3ZMDA 3SXYA 3RYPA 3ABUA 3CTAA 1R5GA 2FBIA 4OIRF 2MA3A 3F22A 5D5UB 5H6RA 3QRFF 4G8XA 1U2WA 5H6QA 1PUEE 4BXUA 3KP2A 2ZFWA 2GXGA 3M8FA 6PAXA 1U8RA 4P9UA 1B6AA 4XSZF 2FXAA 3RPUA 3JW4A 3E6MA 5DUKA 3SQNA 1KU3A 4BQAA 3U9GA 4BAYA 2UXNA 2A6EF 5HDGA 4L0ZB 4HLYA 4LK0F 2ZCWA 1T39A 4NB5A 4EGZA 5ILSA 4BYYA 3GXOA 1FNNA 3NEUA 4UV8A 1O3RA 2C6YA 3CUQB 2FA5A 1G3TA 2XVCA 5CYVA 3BROA 4KDPA 4UUVA 2ZKZA 4HA8A 3WGHA 4EQQA 2VN2A 1ZRDA 2YSRA 3B73A 1WSUA 3FXRA 4O5VA 4U88A 1B9NA 3DXJF 2Y75A 1GXPA 4LB5A 1NHAA 4L9JA 3CO7C 2VC1A 5FFXA 5FFZA 2EFOA 5DEQA 3K0LA 1MDMB 1LNWA 1OKRA 1YLFA 2V9VA 3TDZC 3F3XA 2KRFA 4L0YB 3TOAA 2L01A 2IP2A 2RC4A 3MCZA 1O3SA 2HTSA 5H20A 2A69F 3GFJA 3R0JA 1PP7U 3CUQA 1XN7A 1R23A 1B4AA 2DBBA 1P4WA 1T2KA 3LAPA 1W4MA 3KCCA 3HOTA 1QGPA 1F9NA 5E1ZB 3CDHA 4ESBA 2EFWA 3ERED 3GUDA 4CZZA 2ZNYA 4IRHA 1YFHA 2H09A 2IA0A 2DU9A 3ML6A 2W84A 3VEPA 1ZN2A 3QP6A 2JPBA 1MDMA 1IN8A 2R7DA 3TO6A 3GX4X 3DFGA 2VOPA 1YTYA 2XAFA 2QUFA 1XGMA 3FF5A 3ZP5A 4MHGA 2E7WA 3K1NA 3JTHA 1P2FA 1TW3A 2VONA 2HR3A 4L18B 2V79A 4LB6B 1WRJA 2Y0MA 1EH7A 1SMTA 5AIQA 1I1GA 2MC3A 3E5UA 1X3UA 3LA7A 4RGUA 4UXNA 5ICEA 4Y15A 4P55A 1CF7B 2HYGD 2R7FA 1JHFA 2Z9OA 1XDSA 2GWRA 3KETA 4U0YA 3TGNA 2H6BA 1IN5A 4IPAA 3I53A 3HIFA 2X4HA 3Q5FA 2E7XA 2GIVA 4UVBA 1HKSA 3IHUA 4OOIA 3U2RA 1O7LA 2Q8KA 1XGOA 2QQAA 2EA2A 1U5TC 3ZN0A 2L02A 5A2QZ 4HLXA 2D45A 1RUOA 1IN7A 3QAHA 1IW7F 4LFUA 4YIFA 3HRTA 4HX4A 1UCRA 2FQ3A 1YS7A 3I59B 4HZFA 1CF7A 4A12A 3TDUC 5LGUA 3NRVA 4CYDA 1LDJA 3KP6A 4KFCA 2BGCA 1XGNA 4Q47A 2V1XA 1ZG1A 2YX4A 4HOBA 1SFUA 2E1NA 3EQLF 4YFXF 4A0XA 3F8NA 1L3LA 1USSA 5FO5A 3HRUA 4EJVA 3GZ6A 2HWVA 3QPTA 2WWYA 2XAHA 3R0AA 2JPCA 2VT3A 2QYOA 1XCBA 1FLIA 4LLLA 5JHUA 2LKPA 4AD9A 2P7VB 2BV6A 2PI0A 3IRQA 4ENMA 2K02A 3O2PE 3K2ZA 1FT9A 5L3BA 4WF2A 2ZNZA 2OZUA 3F21A 4PCQA 2A68F 2Y48A 4OINF 4WX9A 3I59A 3MZYA 5E8IA 1I5ZA 1LJ9A 5TJJA 1SAXA 2LF7A 3MWMA 3GFIA 3CO6C 4IHTA 3F8MA 3WTUC 2RDPA 4G7ZF 5BS6A 5FLXK 4Y17A 5HOOA 4CO8A 2HTJA 5ICFA 4G6QA 3RKYA 1HW5A 3HSFA 3M8EA 1FP2A 2X0LA 3CUOA 2Z3YA 3FMRA 3J7AO 4M71A 3DP7A 1QZYA 1AWCA 4XLNF 4JQFA 4XRFA 3GFMA 3GWZA 1XSDA 1KA8A 3WGGA 2K7LA 3E6DA 2FSWA 4AWXB 4JBAA 5L3DA 2FNPA 3QU6A 4R1HA 4HF2A 1B9MA 2R3SA 4I2OA 1IF1A 3PFIA 2W85A 5L3CA 4UHTA 3E6CC 4G7HF 1KQ8A 1IN4A 3KE2A 3KP4A 3C18A 3F6VA 1RZ4A 2F2EA 2MBFA 3V7SA 2FU4A 3WTXC 4ZYDA 3GF2A 2RQPA 3D5LA 4M6YA 1J75A 1ZLKA 3LA2A 2DFIA 1JE8A 2A5YB 3I71A 3GZ5A 3TOBA 4CXFA 4ZYEA 1KYZA 3ISPA 1GVJA 3LWFA 4L5IA 2HEOA 1MJ9A 1BBYA 4DNCA 1T0FA 4IF4A 3OV8A 1ON2A 3GW2A 5IT3A 4MTDA 3WTYC 3QU3A 3KZZA 4I09A 5E20A 5E8GA 2LSOA 3E3VA 3ECHA 1KQ9A 5HDNA 2NYXA 3EDPA 3DV8A 2EJRA 2EA4A 2DI3A 3HTSB 3VODA 1J59A 4EJWA 3B02A 3T0YA 3MEXA 1IXCA 5BQTA 1ZARA 2EWNA 4HQMA 3U1DA 4BH9A 2VOOA 2CGPA 3KFWX 2GXBA 5F6FA 2IT0A 1BM9A 2H27A 5ICCA 4LJZF 4G9YA 1MJAA 3I64A 2EFPA 3L09A 1KU2A 3WTTC 1YS6A 2KJCA 2MD5A 1K6OA 1F1ZA 4YG2F 4U0VA 1IUYA 3FWEA 4BNCA 4KIGA 4GCVA 4ENJA 1BN5A 1EV7A 3FMQA 3RPQA 5LGNA 1MD0A 5ILUA 2W57A 2XASA 3T8RA 3WE3A 3IC7A 5D5XB 4MQ9F 2PMUA 3FHZA 4I0AA 4I02A 2M1BA 3TO9A 3HSEA 5CVIA 1SFEA 2GA2A 2OAZA 4N9HA 1B59A 2DO7A 2A3SA 2CQKA 2CW0F 2P6TA 4HV6A 3L2CA 3CLOA 3QPHA 3WTZA 1YW9A 4ETSA 3EYIA 5E1WA 2IPQX 1ZGJA 3ZMUA 3WODF 2H94A 1FY7A 3J80K 1DUXC 5D8LB 4A2UA 1FYLA 5LRRA 1QZZA 1Z7UA 4U7DA 2V6CA 2E1CA 1O3TA 3ECOA 5L3FA 1AOYA 2VBXA 5FD5A 3ZMZA 4R79A 4AIHA 4UNOA 2VXZA 3HHHA 5L3GA 4MGRA 1P6RA 4P9FA 4PZJA 2PFBA 3LQQA 1SD6A 2DK8A 2TDXA 3COAC 1O7FA 4HW0A 1IN6A 3P7NA 1LDDA 4OIQF 4Q4ZF 1LB2A 1EH6A 1MGTA 2NS0A 3WE2A 2F5CA 3HUGA 3RJPA 5HDKA 4S05A 4HAMA 1MJBA 2RV8A 1ZG5A 3RIRA 1P4XA 3W6JB 1PDNC 4Q5SF 5ED4A 1E2XA 3CUQC 2WTEA 4M73A 2XKOA 4BHCA 2LF8A 4L9NA 1BIAA 2JT1A 5BOXA 4TV7A 3R4KA 3HRSA 1REPC 4JK1X 4LG0B 2ZXJA 3BPXA 3D0SA 2PBIA 3ULQB 3K9TA 4Y13A 4D0PA 2P8TA 1Q1HA 2QZ8A 2MH2A 2BBYA 5HS7A 3E5XA 1YW7A 2LDUA 2CG4A 2RVCA 5J6XA 2VODA 5KVRA 2NNYA 1A04A 1S7OA 4OMYA 2W25A 4FX4A 3EUHA 3F8FA 3PQJA 1TBXA 1Z1DA 1FBQA 2YR2A 1ZRCA 1C0WA 1F5TA 4M9SA 1R1UA 3KZYA 2A61A 3C1DA 3MFKA 2HKXA 4LG0A 1KQ0A 4MQVA 3ZMSA 3FMSA 2O0YA 4UVCA 3JAMK 1OPCA 2F5FA 3FXUA 2PJPA 2XRNA 2FOKA 3ABTA 3E6BA 2M45A 1L0OC 1ZHFA 2K4JA 5E1XA 5JR3A 2VE8A 2G7HA 5DD4A 3E97A 1U6GA 4OIOF 2D1HA 2EK5A 1QQIA 4MEXF 4HV5A 2P7CB 4NHJA 3Q9VA 4FT8A 2VC0A 5K5OA 4WXDA 5F1RA 1S3JA 4HX8A 2P5KA 1G4DA 1WI9A 4M9XA 3RTRA 2CWEA 4RB0A 5HLIA 4MTEA 4Q48A 3T5XA 2IA2A 1BIBA 5FLXZ 3WTWC 5E17F 3GLXA 3T8TA 2ZMEB 1LDKB 5LRSA 3W6KB 5D8KB 3L9FA 5FB2A 1YG2A 1XGSA 4XSXF 1I6XA 2QENA 4ESJA 4ZH4F 3SFZA 3V4GA 3K1PA 3BOQA 1RIOH 2FE3A 3DPLC 5HS8A 5DDGA 4ZYGA 1UB9A 2HGCA 2M5WA 5D4RA 5HLGA 2PN6A 1SFXA 1Z91A 5CVUA 4RGSA 5CJ9A 2NRAC 1QNTA 1R22A 4NQWA 3RYRA 1FC3A 3P9KA 1U3EM 3DF8A 1TTYA 2ZMEA 1HKTA 1R7JA 4KMFA 1XMKA 3GEZA 2J5OA 4KUMA 1BI3A 3ZMTA 4F7ZA 3LA3A 3G73A 4KICA 4EMSA 3KLNA 5HVQC 5HLHA 3J81K 5LEJA 1XB4A 3IL2A 1FBSA 1V4RA 2PG4A 5K1YA 3HOSA 2O8XA 3C3WA 1HXDA 4YFKF 5DV5A 5D5VB 3F72A 3SHFA 3KLOA 3M9AA 3H3UA 4AIJA 1UHMA 3GVAA 5DYMA 5BPIA 1O3QA 2Z33A 5DUIA 2F5DA 4LLGF 3JTGA 2DK5A 5IT9Z 1ZLJA 1V3FA 2Z5UA 2WC2A 3NQOA 3H92A 2RN7A 1MZBA 1HBXG 3I5UA 2IRFG 4KIFA 1ULYA 2M8EA 3R61A 2PQ8A 4EM1A 2DAOA 2XAJA 5K5RA 4ZZDA 1USTA 4A0YA 5ICGA 2QBYB 3DQVC 1BJAA 4N9IA 5LHHA 4LLNA 1DP7P 3I54A 4KA4A 3M1EA 3K69A 1EH8A 2RNJA 5LLQA 3QOPA 2OD5A 2HFHA 4RB3C 4RS8A 1SMYF 4PGHA 5FD6A 2DT5A 4PGGA 4B09A 5LHIA 4FX0A 4ENKA 3Q9SA 1W7PB 1WQ2A 3ROUA 4G6DA 5D6EA 1ZG3A 2OQGA 4KNYA 3HRMA 1Y0UA 2UXXA 2JZYA 4M6XA 1P92A 2M30A 2L4AA 4WK8F 1GXQA 4EVIA 1OYWA 4HDVA 1TNTA 3R6SA 1FOKA 2J5PA 2NNNA 3JSOA 3O6BB 3LQRA 4UV9A 2QBYA 4HBLA 3F8CA 2P5LC 1W5TA 3FXQA 1RUNA 1YW8A 1S7AA 4H0EA 2EV0A 4WWCA 3T1BA 1D3YA 3BJAA 2HKOA 2F5EA 1BC7C 2L3DA 2K4BA 5E18F 1W7PA 1XD7A 4LD5A 4YFNF 5CVJA 1I27A 1VTNC 1K79A 3IWFA 4M9ZA 3G3ZA 1OYYA 1G3WA 1T98A 3WGIA 4LGWA 2PMHA 4A6EA 1WWXA 2O6GE 1R5HA 1J2XA 5D6FA 2QM3A 1R1TA 1K78B 1FBUA 1XCVA 1FZPB 2O61A 2EV5A 3OOPA 3BJOA 4EJUA 3RDIA 4EV0A 2IJLA 4O3MA 2L54A 1DPRA 4N0BA 2Q0OA 3ZN1A 4K2EA 2QVOA 2O3FA 2ESNA 5AIPA 4MEYF 4WXCA 1SD5A 3V7RA 4I01A 4HF1A 3GO5A 4EM0B 2V1UA 5DCFA 1FYKA 3CJNA 1HW1A 3V8KA 2W24A 2OA4A 3SZTA 1K78A 3E5QA 1ZGAA 1FPQA 2WV0A 1LQ1A 2FBKA 1JHHA 1IZ1A 1B1BA 3GYHX 4FHTA 3F8BA 1K7AA 3BP8A 4HYEA 2G7UA 3ZQ7A 2HYFA 4R8HA 2CO5A 3MQ0A 4ENNA 3FM3A 1Z05A 3DKWA 1TLHB 4LMYA 1P4AA 4IHSA 1YQAA 2DLLA 5ILVA 3BY6A 2GZWA 4P5OA 3N4MA 3O3KA 3JAMZ 1T6SA 2K86A 2OZ6A 2JRTA 3L00A 2KJBA 3FX3A 4GXOA 1LEBA 3RKWA 3ZMVA 4KT5C 2XAGA 3IRRA 2VE9A 1ZH5A 2A6HF 2CSOA 2DPUA 3R60A 4A6DA 2XIGA 3K1MA 4U7BA 3V8JA 1E17A 1H0MA 1FSEA 5BPDA 1R00A 2YX7A 2HDCA 1ZYRF 1DPUA 1S29A 1RNLA 3TO7A 5J8FA 4IVNA 3F23A 4WCGA 2V1DA 4IRIA 1XDUA 2IW5A 2YU3A 4ZZLA 3HYIA 1TQIA 2XAQA 4GYIA 2NAZA 1BC8C 1BOAA 5JI6A 4OMZA 4S04A 1S6LA 1TNSA 2ELHA 2EB7A 2GQQA 1XSXA 4PDKA 4KN4X 1KYWA 1D8JA 5LHGA 4RGRA 2ZO4A 3RI4A 5EEGA 4O6JA 1UHWA 1U78A 1DDNA 1LEAA 3S2WA 3FZVA 3JSPA 4QWQA 3KEOA 5CLSA 4DQ2A 2IA1A 1Z6RA 4YIIA 2HQRA 4RGXA 1IRGA 4GGGA 1SD4A 4U0WA 1ON1A 2AXLA 1ONVA 2JTVA 5FGMA 2G9WA 1KU7A 1STZA 5JFRA 1R36A 2O03A 3AAFA 1QPMA 4AVPA 5D5WB 4M72A 4CGZA 1I1SA 1HSJA 1QO0D 4P96A 5DD8A 3REOA 4ASNA 3F6OA 3N97A 1H9GA 2JSCA 1TW2A 4HF0A 1U5TB 2XROA 3J81Z 1T38A 5J8CA 2FF4A 2HQNA 4ESFA 4HX7A 3H3ZA 1H9TA 3HSRA 2VT2A 1KGSA 1KU9A 2B0LA 2D2WA 1G3YA 2OBPA 2CFXA 1ZAOA 4EM2A 2OU2A 4IRGA 3EYYA 2STWA 4QLCU 1TQMA 2ZBKA 3WG9A 4OU0A 3WTVC 2EFNA 4KMUX 4A5MA 3V7CA 3IWZA 3KP7A 4RB1A 5EEHA 4HDUA 2QLZA 2RKHA 2ADUA 1W5SA 5LEKA 2BEOA 5ERIA 3RKXA 2P6SA 2UWMA 1LVAA 1J0RA 5LGTA 2ISZA 2QWWA 3L7WA 2ACJA 1U5TA 4A0ZA 3PQKA 3MAJA 1HKQA 2VBWA 1J7KA 4GYGA 2MLGA 2RGVA 4MNUA 1YO5C 3VB2A 2PLYA 4IJAA 1WKMA 4A5NA 4L5JA 2XUBA 2D1VA 5K5QA 3VFZA 3ZPLA 3MZHA 3IKTA 2ZJ2A 3EETA 4ON0A 2OQRA 4EGYA 4CICA 2Z99A 1OMIA 2EFQA 3WTSC 1OR7A 1BI2A 5LBQA 2EV6A 1O57A 1G6NA
chains in the Genus database with same CATH superfamily
2FRHA 1RI7A 2STTA 2L0KA 4IEJA 1FIAA 3H9JA 3BPVA 2VBYA 4RAZA 5F64A 1FX7A 1IAWA 2JA2A 1DU0A 3DTIA 3VOEA 2WAQN 2FNAA 2HU9A 1VQNI 2CYYA 2HOEA 4L9VA 2AS5F 3K4KA 1QBJA 4DW6A 1CGPA 3G6EI 1GLNA 1X19A 1AA7A 2COMA 3LSRA 1RR7A 4A69C 5CVRA 2QSFX 4IXAA 3JRGA 2KLOA 2H8WA 2QQ9A 2Y69H 2YPRA 4BXXJ 4B44A 1HQCA 2DW4A 5J4YA 1ZREA 3JRIA 4F91B 5FLVA 2XGXA 2AQEA 2A07F 2JA8J 3FM5A 2DPDA 2WY7Q 5JVTA 4FCYA 5A2QK 2EH3A 3CCUI 1ZRFA 1J5YA 2HZTA 3HHGA 2K27A 4GO1A 1Z6TA 1D1AA 1R58A 2DOAA 1UFMA 2MW8A 1D5YA 1WJFA 2MH9A 1D5VA 2KIFA 3BJ6A 2XF5A 1K4SA 2Q2EB 2R7SA 5KK1A 4UUSA 3BZ6A 1I39A 4B48A 2HS5A 3DBRB 3WU0A 2XHKA 2JUGA 4HNVA 3S15J 3DEUA 3QWLA 3DPTA 1ZQ3P 1IXSB 2KIUA 3V8LA 4PFOA 2IGNA 4RDUA 4X6AJ 2M2EA 3KEQA 2DXIA 3DLAA 1JGSA 3H3VK 3ERMA 3ONQA 4G94A 2CQQA 3RZOJ 3BR2A 3BDDA 4C3IJ 3I4PA 2VQLA 2M0MA 2FMLA 3JREA 1Z77A 1TQPA 2HVRA 2R7QA 3M7GA 4BHPA 4DGWB 2VJJA 1QZEA 1R4NB 4EJOA 1GHCA 2DMQA 3H5NA 2G0EA 1FYMA 5CVVA 2XV4S 4I7HA 3OWTA 3A0HC 2M8GX 4M74A 2LKSA 5L3EA 1IUFA 1J9IA 4I0BA 1TC3C 2IVMA 3I58A 4A3LJ 2VQCA 3HBLA 2FBHA 4Y4RA 2R4GA 4E70A 1X1CA 3I0TA 1FWZA 2ESHA 4NNJA 2XF7A 3VWBA 1A36A 5M3MJ 4M3BA 4XL9A 1WHUA 4L9TA 2XKPA 2R7OA 3SZPA 4HSRA 1SFOJ 3QP5A 1IV6A 1Y8RB 2Q2EA 1YYVA 4KIBA 4CDGA 3LFKA 3BWGA 3O8HA 4U87A 1POGA 3IKVA 4EJTA 2NVTJ 4RB2C 2HOSA 2M7AA 1X3ZB 3TQNA 1OCZH 1WVRA 2FMYA 2GA1A 4RLQA 3WU1B 2H6CA 1K61A 2E60A 4BACA 3FBNB 2V7FA 4IO9F 3HOYJ 4CHUA 3HEFA 2LNBA 3L2UA 5AONA 4BHBA 1JXSA 3E0JB 4FASD 3HOUJ 2NXNB 1MBEA 2BYVE 1FSHA 2GOMA 4ZYHA 5HODA 1IXRC 1XMXA 3KYLA 3ELKA 2JA6J 2KIMA 1UELB 5BMZA 2TCTA 4KYWA 1S7EA 2E5NA 1X1DA 1W7PD 3TMOA 1K83J 3NARA 5J40A 4B8XA 2HI3A 3IUOA 4OIPF 4IQJA 2BE5F 3IH4A 5DCMB 1AHDP 1HSTA 4Z2YA 5IOZA 5EYRA 3J80Z 4HQEA 1XMAA 2LD5A 2IGOA 2M87A 5TGTA 2LG4A 4MLOA 1MKMA 2BXYA 2EPFA 1S8NA 3W2VA 4XLPF 1X58A 2VBZA 2DQLA 2P4WA 5IT9K 4JOMA 1Z9CA 4UVAA 1FP1D 2HDWA 3J7ZI 3KP5A 3F9KA 1G3SA 5HS9A 3TP3A 3C7JA 1ODDA 1PP8F 3LSTA 2MLKA 2KFDA 3GTKJ 2MYSA 3CQZJ 5TRDA 4PJ0C 1HF0A 1BI0A 1OCCH 1WFXA 4G7OF 1V5EA 1OYIA 1T95A 4E7ZA 3S3NA 2E2IJ 1BR4A 2DA4A 3TKYA 1XSVA 4BGDA 2DQRA 1ZTRA 3LAJA 3GFLA 1F4KA 3KP3A 4KN7X 2FEZA 2MC4A 2PEXA 4I99C 2L4MA 2A6TA 4G12A 1YIOA 1H8AC 2QQBA 2BVLA 2Q1ZB 4FTHA 1SD7A 4AIKA 1ETKA 2KKOA 2GAUA 4BDZA 1D8KA 4LIVA 4RAYA 4Y3OA 2UZKA 5D4SA 3H9GA 2VKHA 1OISA 3PM1A 2P5VA 2KQRA 4C3JJ 5DCMA 2OF7A 4I98B 3P9IA 2X48A 2VKEA 1R1VA 1T56A 1BI1A 1A35A 2LR8A 4I76A 2JVGA 2KISA 3Q0WA 4KT6A 3FKJA 4WXHA 1IRFA 1MH4A 2DTRA 3LOCA 4XBFA 3HL2A 2I5UA 3CMAI 1I3QJ 4IHVA 3P9CA 1VQPI 5FLMJ 3BCAA 1HW2A 2ETHA 4LK1F 2ISYA 1DU6A 3HTUA 1QHHD 3ZMDA 3SXYA 4A3CJ 3RYPA 3ABUA 3CTAA 2DT6A 5J1YA 3BCBA 1JKOC 1R5GA 2FBIA 4OIRF 2MA3A 1HCRA 1OCRH 3OIQA 4C3HJ 5D5UB 3F22A 5H6RA 3QRFF 4QPOA 4G8XA 4DYRA 2L7MP 2LYCA 1U2WA 5H6QA 2VLAA 4I6ZA 3FXJA 4BXUA 1PUEE 3KP2A 3CMMA 2WADA 2ZFWA 1W5CC 5KNLA 2ECCA 3DEWA 2GXGA 3OYLA 5BNGA 2EILH 4C30A 3M8FA 3BTIA 6PAXA 3CCRI 1U8RA 4P9UA 2X85A 2JA7J 1B6AA 4XSZF 5JLWA 3M07A 2FXAA 3RPUA 2F4IA 2RNGA 3JW4A 3E6MA 5DUKA 3SQNA 1KU3A 4BQAA 3U9GA 1IRXA 4BAYA 2UXNA 5GAEJ 1UG0A 2A6EF 5HDGA 4L0ZB 4QPQA 4HLYA 4LK0F 1RKTA 1EF4A 2ZCWA 3FXLA 1T39A 4NB5A 2ZSHB 2L7FP 3ZXSA 4EGZA 2V26A 5ILSA 4C9YA 4BYYA 3GXOA 1FNNA 3NEUA 4UV8A 1O3RA 2F6CA 2C6YA 2XB5A 3CUQB 2FA5A 2M9HA 1NH3A 4D9JA 1G3TA 5KAFC 2XVCA 5CYVA 3BROA 4KDPA 2M3AA 2XGCA 4XICA 4UUVA 2ZKZA 1TP4A 4HA8A 3WGHA 4EQQA 2L7ZA 1W0UA 1IJWC 2VN2A 1N78A 1WJCA 3IP4B 1ZRDA 2YSRA 4J01A 3B73A 4XQFA 4P1WA 2IBDA 2O7OA 1WSUA 3FXRA 4O5VA 4BQOA 2EIKH 4U88A 3OS1A 1B9NA 2UUZA 3BG3A 1SEUA 3DXJF 2Y0SN 2Y75A 1GXPA 4LB5A 2B7EA 1NHAA 1HC8A 2WY8Q 1VQ9I 4L9JA 3CO7C 2VC1A 5FFXA 5FFZA 2EFOA 1E3OC 2IGMA 5DEQA 3K0LA 5LFAA 4C2UA 2GOXB 1MDMB 1LNWA 1Q1VA 2DOFA 5JHFA 2FUG2 5F0HA 5E3MA 1OKRA 2Z16A 4CCMA 1YLFA 2V9VA 2MD0A 3TDZC 2QKLB 4QTRA 1X2NA 3F3XA 3C2BA 2KRFA 4IX7A 2X1DA 3TOAA 4L0YB 2ID3A 2XGEA 4CCNA 2L01A 2IP2A 3GTLJ 2RC4A 2NVQJ 3MCZA 3K70C 1MBHA 1JTYA 1B8IB 1WCMJ 1O3SA 2HTSA 5H20A 2A69F 1JT6A 1SANA 3GFJA 2DMTA 3R0JA 1PP7U 3CUQA 1XN7A 1R23A 1B4AA 2DBBA 3DU5A 2RREA 3S14J 1P4WA 1UHSA 3PFYA 2LLKA 1T2KA 2E2HJ 2QQ8A 3LAPA 2O9LA 2LBFB 3K70D 1W4MA 3KCCA 3JRHA 1QGPA 3HOTA 1F9NA 5E1ZB 1X4OA 3CDHA 4ESBA 4XRSA 2EFWA 3ERED 2ELJA 3FXKA 3GUDA 2DA5A 4CZZA 2ZNYA 2CV2A 3AL0C 2JJ7A 2DFHA 4IRHA 3CLQA 3CJTB 1YFHA 2H09A 3FIWA 2IA0A 3GMEA 2DU9A 5GTHC 3ML6A 5DS9A 4A3IJ 2W84A 3C2GA 3W2AA 5H2FC 2K3PA 3VEPA 1ZN2A 3QP6A 3LMMA 2JPBA 1FOXA 1MDMA 1IN8A 1PUFB 3BG7A 2R7DA 3SYTA 3TO6A 3GX4X 3DFGA 2VOPA 1YTYA 3J7YJ 2XAFA 3HOZJ 2QUFA 3OSGA 1LE8B 3PIPF 3L2QA 1XGMA 2DMPA 4DYCA 1FMVA 2FD5A 3FF5A 2E7WA 4MHGA 3ZP5A 3BC8A 1MW7A 3CCEI 3K1NA 1B8IA 3JTHA 3K4NA 1P2FA 1TW3A 2ZJRF 4FE4A 3BR1A 2VONA 2HR3A 4L18B 1VQKI 2V79A 4LB6B 2VQGA 1WRJA 2Y0MA 3G1LA 1EH7A 1SMTA 2LBFA 5AIQA 1I1GA 4BKXA 3CCVI 2MC3A 1VQ7I 3E5UA 3ASOH 5FROA 4ANJA 1X3UA 4HNUA 3LA7A 1TWAJ 4RGUA 3HG9A 4UXNA 1G8XA 5C44J 5ICEA 4Y15A 1R71A 4P55A 1CF7B 2M0CA 2HYGD 2R7FA 1YRNB 1JHFA 2Z9OA 1XDSA 4DBRA 1YHQI 1HA8A 2GWRA 3KETA 4U0YA 2W1OA 3NAUA 2JK3A 3CMEI 3TGNA 1RETA 3CJQB 1Z67A 2H6BA 1IN5A 4IPAA 5B5EC 3KYDB 3VSLA 3MKYB 1PUFA 3I53A 1G59A 1OFCX 5J1UA 3HIFA 1A6QA 2H1LA 5GADJ 2VPLA 2ELKA 2KIQA 2X4HA 3DBLB 3Q5FA 1LE8A 2CH0A 1S9HA 3CCJI 2E7XA 1JUSA 4IOCF 2GIVA 4UVBA 3DBHB 1HKSA 1MMAA 3IHUA 4OOIA 5F0CA 3U2RA 3FISA 1O7LA 4B1RA 3KZIC 2Q8KA 1XGOA 2QQAA 5E3NA 2EA2A 1U5TC 2ICWG 1JTXA 3ZN0A 3S3MA 3HOVJ 2L02A 5A2QZ 4L5EA 4HLXA 2D45A 1DP3A 1RUOA 1T33A 4M3DA 4IHWA 1IN7A 2CU7A 3QAHA 3PO3J 1IW7F 4LFUA 4YIFA 4NDLA 2VPRA 1Y8QB 1WGXA 3HRTA 4HX4A 1UCRA 2CV0A 2O5RA 2FQ3A 1YS7A 3WHBA 2QEXI 1MSFC 3I59B 4HZFA 1ZR2A 1CF7A 4A12A 4BJ6C 3HOWJ 3TDUC 5LGUA 1YRNA 2IS1A 5JLXA 3NRVA 2CV1A 4CYDA 2COBA 3RKQA 1R5ID 3CC7I 1LDJA 3KP6A 4B47A 4KFCA 2BGCA 4C2TA 1XGNA 2RAEA 2V6EA 1TZLA 4Q47A 2V1XA 1Z21A 1ZG1A 2YX4A 1OR7C 5GTIC 1MNDA 3GBGA 5JVGF 3HB9A 4HOBA 1WJ5A 3HPHA 1SFUA 2E1NA 1PJRA 1JJ6C 3EQLF 4YFXF 4A0XA 3DPUA 3F8NA 1L3LA 1SAUA 1USSA 3HZJA 5FO5A 2HOTA 2IS2A 3HRUA 4EJVA 3GZ6A 2XSDC 2HWVA 3QPTA 2WWYA 2XAHA 3R0AA 2JPCA 2VT3A 1VZ0A 1XCBA 2QYOA 5B1BH 1FLIA 2DJNA 4HRIA 4LLLA 1LKXA 2EZKA 5JHUA 3W3CA 1P9QC 2LKPA 3TL4X 3K10A 2LY2A 4A3MJ 1HOMA 4AD9A 2P7VB 2M4KA 2H1KA 2BV6A 4RAFA 2PI0A 3IRQA 2E71A 2K02A 3O2PE 4ENMA 3K2ZA 1FT9A 5L3BA 4WF2A 4II2A 2ZNZA 2OZUA 5B1AH 2FJ1A 3IAM2 2A68F 1I3AA 2Y48A 4LG3A 4PCQA 3ZQIA 4CH7A 3F21A 4OINF 1BL0A 2OC6A 4WX9A 2MFZA 3I59A 3MZYA 1BA5A 1YI2I 5E8IA 1I5ZA 1RRJA 1IGNA 5DM6F 3AG3H 1LJ9A 4A3EJ 1X2MA 4FETA 3HJEA 5FKNA 5TJJA 1R9TJ 3GTOJ 1SAXA 1V55H 2R7VA 2LF7A 3FK7A 3MWMA 3GFIA 3CO6C 3L2WA 3F8MA 4IHTA 3WTUC 4HPQA 2RDPA 4IKFA 2R7WA 2E1MB 4G7ZF 3VPRA 3S3OA 5BS6A 3ASNH 5FLXK 4Y17A 5HOOA 4ZDOA 4CO8A 3FDYA 1W1WE 2HTJA 4NC7A 5ICFA 4G6QA 3RKYA 1HW5A 3HSFA 3WHCA 3M8EA 1FP2A 2MG4A 2X0LA 3CUOA 2Z3YA 5KCMA 3FMRA 3J7AO 4M71A 2X1CA 1EJ9A 3DP7A 3L1PA 1QZYA 1AWCA 4XLNF 4JQFA 4XRFA 3ZCOA 3GFMA 3GWZA 4MIMA 4NBQA 1XTAA 3ZGKA 2VB6A 1XSDA 1KA8A 3WGGA 2KPMA 2K7LA 3E6DA 4A93J 2FSWA 5FKLA 3LSHA 2KDZA 4AWXB 2QCOA 4JBAA 5L3DA 2FNPA 5LD2C 2L9SA 3QU6A 4R1HA 2JUCA 1VQLI 4HF2A 1B9MA 2V9PA 2R3SA 4I2OA 1IF1A 3BZCA 2BHZA 2AO9A 2BZTA 5K7FA 3PFIA 2W85A 5L3CA 4UHTA 3E6CC 3OR1C 3L2VA 4G7HF 1KQ8A 2R0QC 1WZ2A 4DYQA 3PSIA 1IN4A 2EINH 2B63J 1VQ8I 2VXDA 3KE2A 3K7AJ 3KP4A 3C18A 3F6VA 1RZ4A 2F2EA 2MBFA 2JQ7A 3OR2C 3ZQQA 3V7SA 3JRAA 5IP6A 4YIRX 2R5ZB 4XORA 2FU4A 3D5SC 3WTXC 1X4PA 4ZYDA 3GF2A 2JSPA 2V4JC 2RQPA 3D5LA 4M6YA 1QVUA 4OAZA 1J75A 4JX4A 3LA2A 1ZLKA 2JN6A 4XLAA 2DFIA 1UG2A 4PSXA 5HNFA 4ZDPA 1SVMA 2A5YB 3I71A 1JE8A 1ENHA 2HNHA 3GZ5A 1MMSA 2NS8A 4BE1A 3TOBA 3CDLA 1V5GA 4CXFA 2ID6A 3SZGA 2X6YA 2HPMA 4ZYEA 4UB6C 2DODA 1KYZA 1MMGA 3ISPA 1GVJA 3Q0UA 2XPWA 3LSIA 1VQ4I 3LWFA 3S93A 4L5IA 1MMDA 3HC7A 2HEOA 3PJRA 2VKVA 2JMWA 1MJ9A 1BBYA 1JKRC 4DNCA 2I8DA 2DFFA 1T0FA 3CZ6A 4BDYA 1YOVB 4IF4A 3LNQA 3OV8A 1ON2A 3GW2A 2LVSA 5IT3A 4MTDA 3WTYC 3QU3A 2V1NA 1IO2A 4EEFG 4J19A 2Y31A 3KZZA 4I09A 5E20A 5E8GA 2BW3B 2LSOA 3HGGA 1WI3A 3E3VA 3ECHA 1KQ9A 3OYJA 2QA4I 5HDNA 2NYXA 3EDPA 2R5ZA 3FHNA 3DV8A 1U8BA 3BLYA 2VJ4A 4XR6A 2EJRA 1OCPA 2EA4A 2DI3A 3HTSB 1NTCA 2W48A 3VODA 2WV1A 3PNTA 3M3YJ 3LSKA 1J59A 4EJWA 1ETOA 3MZ8A 3B6CA 3OS2A 4PK4A 1XS9A 2F48A 2WB1A 3B02A 3T0YA 3MEXA 1IXCA 4AIDA 5BQTA 5J4VA 1ZARA 2EWNA 4HQMA 3U1DA 4BH9A 2VOOA 3Q3SA 4GRIA 1ZGWA 2CGPA 2GIZA 3KFWX 2CFOA 2GXBA 5F6FA 2IT0A 2PMZA 3OYNA 3FK6A 1BM9A 3BG5A 3PNYA 4CCLA 5ICCA 2H27A 4LJZF 2XF6A 4G9YA 3OYHA 3V42A 2E19A 1SC7A 4CCOA 3EUAA 1ACIA 2DJIA 1MJAA 3I64A 3VSKA 3OL3A 4BBSJ 5KHDA 2EFPA 3DKYA 3L09A 1APLC 4IHXA 1KU2A 3WTTC 1YS6A 2KJCA 3IAS2 3OYAA 2XAUA 2MD5A 1LUJB 1K6OA 3H5AA 2GLOA 3K4CA 5CPRB 1F1ZA 4YG2F 4U0VA 1IUYA 4DJAA 3FWEA 4BNCA 1F43A 4KIGA 4GCVA 2HPIA 4JYKA 2BW3A 2X6XA 4ENJA 1BN5A 1GT0C 1CQTA 3CJRB 2FX0A 1EV7A 4B3AA 3FMQA 1NK3P 5F0FA 3A2KA 3RPQA 5LGNA 1MD0A 5ILUA 2W57A 2XASA 4BJTA 3T8RA 3ZQFA 3WE3A 4BE2A 3IC7A 5D5XB 4MQ9F 2PMUA 3FHZA 2QSHX 4I0AA 1EA3A 4I02A 3OYBA 2M1BA 3TO9A 2X6OA 3HSEA 1XG1A 3BTJA 5CVIA 1SFEA 2GA2A 2OAZA 5EZGA 5FJ8J 3M1CA 3OYEA 4N9HA 1VQMI 1B59A 1Z3YA 2DYRH 2DO7A 1E0EA 2A3SA 3HUGB 2CQKA 2CW0F 2DN0A 2P6TA 4HV6A 3L2CA 4E6KG 4ABZA 4D7NA 3S1MJ 1WJAA 1N75A 1SFKA 3OYMA 4W1UA 3CLOA 4XNFA 2LH9A 3QPHA 3WTZA 1YW9A 4ETSA 4F55A 3H5RA 3EYIA 5E1WA 2IPQX 1ZGJA 3ZMUA 1OJLA 3J7AY 1Y39A 3CDIA 3WODF 2H94A 2K9MA 1FY7A 3CCQI 3CP8A 3J80K 2DMNA 2ZSIB 3QODA 1MBKA 5F04A 5FKMA 1DUXC 1VQ5I 5D8LB 4A2UA 1FYLA 5LRRA 1QZZA 1Z7UA 2E2JJ 3O8GA 3I4MJ 4U7DA 1Z7LA 2V6CA 2E1CA 1XPXA 2JWTA 1O3TA 4IZZA 5IP7J 3ECOA 5L3FA 1AOYA 4E7LA 5TISC 5EEAA 2VBXA 5FD5A 3ZMZA 2LP0A 3FBIB 3TW7A 4AIHA 4R79A 2D5VA 2VXZA 3HHHA 5L3GA 3PUBA 4E7SA 4B3XA 4MGRA 1P6RA 3OYFA 4P9FA 5IY5H 1PYVA 4PZJA 2PFBA 2NVXJ 1T08B 1QVTA 5J3LA 5EG0B 2ZJPF 3LQQA 5HNHA 1SD6A 3HXLA 2DK8A 2TDXA 3COAC 1GV2A 1O7FA 4HW0A 1IN6A 4OAYA 5E3LA 4ZTFA 3P7NA 1LDDA 4OIQF 4Q4ZF 3HOXJ 1LB2A 4PJJA 1EH6A 4M3FA 2L7KA 3I56I 1BOBA 1F36A 1MGTA 2NS0A 3WE2A 2F5CA 3HUGA 3RJPA 1UMQA 2HQAA 5HDKA 4S05A 4HAMA 1MJBA 1D0XA 2K9QA 2RV8A 4BJ5C 1ZG5A 3CCLI 3RIRA 1P4XA 3W6JB 2W7NA 4F93B 3DLLF 4ZTJA 1PDNC 2BY0A 5ED4A 1LFBA 1E2XA 4E7HA 3S2DJ 2PJRB 3CF2A 3CUQC 2WTEA 4M73A 2XKOA 4XLEA 4BHCA 2LF8A 4E7IA 3CESA 5C4XJ 2HVQA 4BU2A 2ZXHA 2JA5J 2VASA 1YX5A 1BIAA 4L9NA 3VDXA 2GM4A 2JT1A 1BW6A 5BOXA 4OWRB 1Y1VJ 4TV7A 2DTZA 3R4KA 3HRSA 4RA2A 1REPC 1R49A 4JK1X 4LG0B 2L5QA 4V2GA 2ZXJA 3BPXA 3D0SA 2PBIA 5K7HA 3ULQB 4RMNA 2W82A 3IV5A 3K9TA 4Y13A 4D0PA 2P8TA 3K6GA 1Z3XA 3RQIA 1FTTA 2OV7A 1Q1HA 3JCUC 2QZ8A 2MH2A 2BBYA 2DOEA 3KEYA 1H88C 2KRCA 2R7ZJ 2BOLA 2RQQA 4FE7A 5HS7A 3E5XA 5EG0A 5M5YJ 1E3HA 3A0BC 1YW7A 2BXZA 2LDUA 3DEEA 4W97A 4HG2A 5GP9A 1DGRM 2K9NA 1BW5A 2E34A 2CG4A 1FEXA 2RVCA 2Y9YA 1IV8A 3IH3A 4XKVA 5J6XA 3OYGA 1W36C 4BEHB 2VODA 2R7RA 5KVRA 2R7TA 2NNYA 1A04A 3H35A 1S7OA 3CC2I 4OMYA 2W25A 4FX4A 3EUHA 4A3GJ 3F8FA 2HXIA 2PJRA 2QKMB 3PQJA 1W36D 1TBXA 3DTKA 1Z1DA 1FBQA 2MABA 1A5JA 2YR2A 4B43A 4KJZA 1ZRCA 1C0WA 3GTPJ 3OYIA 1F5TA 2CW8A 3ABMH 4M9SA 1R1UA 3KZYA 2A61A 3C1DA 3MFKA 3QYEA 4G6TB 1KONA 2HKXA 4LG0A 3QPLA 4M3GA 1KQ0A 4Y52J 4MQVA 3ZMSA 3FMSA 1P7JA 2HZDA 2O0YA 4UVCA 3JAMK 1OPCA 2F5FA 3FXUA 2R92J 2PJPA 5IYCJ 2XRNA 2VQHA 4A3BJ 2BY3A 2FOKA 2HXOA 2MSYA 4S0HB 1WJDA 3ABTA 3E6BA 4H4KC 2CJJA 1TWCJ 2DYSH 2EZHA 2M45A 4AC0A 1W0TA 2H8RA 1L0OC 1ZHFA 2K4JA 5F27A 1U9NA 5E1XA 3S1RJ 3SFIA 2V9KA 4MO7A 2VE8A 5JR3A 2QGUA 2G7HA 5DD4A 4D1QA 4XOPA 2HOAA 1A6IA 3E97A 1U6GA 2KT0A 4BEHA 4ZDLA 1FOYA 4OIOF 4JX5A 5GAGJ 2D1HA 2P0WA 2EK5A 3A4CA 2KRHA 4FQGA 1QQIA 4MEXF 4HV5A 2P7CB 4HEA2 2L9RA 1TT0A 4NHJA 3Q9VA 4FT8A 4AYBN 2VC0A 5IPAA 5K5OA 5IYBJ 4RBOA 3C2HA 3BQZA 4WXDA 5F1RA 1S3JA 4HX8A 2P5KA 1G4DA 4IOAF 1X1PA 1WI9A 1R4MB 4AYBA 4F3QA 2ZJQF 4M9XA 3RTRA 2O8KA 4ZYAA 2CWEA 2PX9A 3KX2A 1FIPA 4RB0A 5HLIA 4A3DJ 1D0YA 4MTEA 1HDPA 4NQWB 4Q48A 4D5CA 3T5XA 2IA2A 3M4OJ 1BIBA 2YS9A 5FLXZ 3WTWC 3JRDA 5E17F 3TEDA 2XC7A 4QSHA 5J1RA 3GLXA 1ZR4A 3T8TA 2ZMEB 4E7JA 3UNGC 1LDKB 4XK4A 4V2FA 5LRSA 4XONA 3CMYA 3W6KB 2ZXWH 5D8KB 3CC4I 1UJ8A 1VNDA 3A03A 3VYSB 3L9FA 5FB2A 1YG2A 2KP6A 1XGSA 2ZC2A 1AU7A 3QYBA 4XSXF 1I6XA 2IXSA 2HDDA 4ITVA 1Y6IA 4NUBA 2QENA 3HGYA 4EATA 4ESJA 4DOZA 4ZH4F 1LFPA 3DU6A 3SFZA 3V4GA 3OS0A 3K1PA 2LFBA 3BOQA 4AUXA 1RIOH 2FE3A 3DPLC 3HKZA 1JJ8C 5GAHJ 1JKPC 3BR6A 5HS8A 2DT7B 2CQ7A 5DDGA 1OLTA 2K9LA 4ZYGA 1UB9A 2HGCA 3BT9A 1TL8A 4AU7A 2ECBA 2P81A 2M5WA 3KYCB 3LSJA 3NWSA 4V19K 5D4RA 1GV5A 2FQ4A 5HLGA 2PN6A 1VI0A 3UKGA 1SFXA 1DQUA 2YU9J 1Z91A 5CVUA 2VI6A 4RGSA 5CJ9A 2NRAC 4NC6A 1QNTA 1R22A 4NQWA 1WJBA 4BE0A 3RYRA 1FMWA 1FC3A 3P9KA 2VL8A 3LSMA 1U3EM 3DF8A 1TTYA 2W00A 2ZMEA 1HKTA 1R7JA 4DIQA 4KMFA 1XMKA 3GEZA 3DTEA 2J5OA 2BVMA 5DTDA 1QRYA 4KUMA 1UAAA 1BI3A 2BHYA 3ZMTA 4MFEA 1YITI 4F7ZA 3LA3A 3G73A 4KICA 4EMSA 3KLNA 5HVQC 5HLHA 3J81K 5LEJA 4X0GA 1XB4A 3IL2A 1FBSA 1V4RA 2PG4A 5M5WJ 5K1YA 3HOSA 2O8XA 3OYDA 2N8GA 3C3WA 2BY2A 1HXDA 4YFKF 2NS7A 5DV5A 5D5VB 3F72A 3SHFA 3GTJJ 1U9OA 3KLOA 5F08A 2DMUA 1MNEA 2F4OB 2EIMH 3M9AA 3PUFA 2R5YB 3H3UA 5B3SH 3WU2C 4AIJA 3FXOA 5M3FJ 2QF7A 3ZQHA 4F92B 3EPZA 5FRMA 1DGWY 1UHMA 2KZVA 2WAQA 3GVAA 5DYMA 3MKZA 5BPIA 1O3QA 5DUIA 2Z33A 2F5DA 4LLGF 3RQ4A 3JTGA 2DK5A 5IT9Z 2NVUB 1ZLJA 2MGQA 4BXFA 1V3FA 2CUJA 4II3A 5E3OA 2Z5UA 2LK2A 4LOCA 2WC2A 3NQOA 2DFEA 3H92A 2RN7A 1MZBA 1HBXG 3I5UA 2IRFG 4KIFA 1ULYA 2M8EA 2LOOA 2DA6A 2E36A 3R61A 2PQ8A 4XMYA 4EM1A 1T8IA 3HDDA 2DAOA 2XAJA 4Q5SF 5K5RA 2AHQA 4ZZDA 1USTA 4A0YA 5ICGA 3AKZA 2QBYB 3DQVC 1BJAA 3I4NJ 2W4SA 3GZNB 4N9IA 4XN3A 2E1MC 2IEKA 5LHHA 4LLNA 1DP7P 2LY9A 3I54A 3PNVA 4KA4A 3M1EA 5CKTA 1RPWA 1Z0XA 3K69A 3CCSI 3W6VA 3PL8A 4CZCA 1EH8A 3ZRGA 2RNJA 5LLQA 3ABKH 3QOPA 3BZKA 1I6HJ 2OD5A 3OMYA 2HFHA 3MKLA 1FJLA 4RB3C 4RS8A 4F52A 1SMYF 1WH5A 1IDZA 2IS6A 1OCOH 4PGHA 5FD6A 2DT5A 4PGGA 4XKWA 2Z2SB 2KZGA 4B09A 5LHIA 4FX0A 4ENKA 3Q9SA 1IG7A 2R5YA 1W7PB 1WQ2A 3ROUA 5EF6A 4G6DA 2KMUA 4BY1J 3ZQGA 5D6EA 1ZG3A 2OQGA 3DCFA 4KNYA 3S2HJ 2CQNA 4NC8A 3HRMA 1Y0UA 2UXXA 2K85A 2JZYA 4M6XA 1RKWA 1MBJA 1WH7A 3H1CA 4RAGA 3I9V2 1P92A 2M30A 3VYRB 2WA0A 2L4AA 4DZPA 1D0ZA 4WK8F 3QQAA 1GXQA 2GBYA 4EVIA 1OYWA 3I55I 3L2RA 2XSJC 4BS9A 2M4GA 1T0FC 4HDVA 1QHGA 3OL4A 1JUMA 1TNTA 5EJCA 3R6SA 4XOTA 1FOKA 2J5PA 2NNNA 3JSOA 3O6BB 3LQRA 4UV9A 3CCYA 4CYCB 2QBYA 2R7UA 1VFCA 5B66C 1MMNA 3W2WA 4HBLA 3F8CA 4PJMA 4X1EA 2P5LC 4CSWA 1ETVA 1W5TA 3JRCA 2XGDA 2AQFA 3OYCA 4GDFA 3FXQA 3OOUA 1RUNA 5F1JA 1YW8A 1S7AA 4ZJZA 4H0EA 1HLVA 1ITYA 3S16J 4M6VA 4J00A 2EV0A 2IGKA 4WWCA 1RC9A 3T1BA 1D3YA 3BJAA 2BY1A 1S5LC 2F5VA 2HKOA 2M7BA 2ZFUA 2F5EA 1BC7C 2L3DA 2K4BA 2OUMA 2CRGA 5E18F 1JI8A 4RM3A 1W7PA 3PIOF 2WB1N 1XD7A 4LD5A 4YFNF 5CVJA 4Y33A 1I27A 1VTNC 1K79A 3IWFA 3LSGA 4M9ZA 4BL0B 3G3ZA 3PO2J 1OYYA 1G3WA 1T98A 3WGIA 3P5JA 4LGWA 2PMHA 4A6EA 3HM5A 2HQ5A 1ZELA 2EQRA 1WWXA 2PMZN 3BR3A 4N4NB 4A3JJ 1BR2A 3A1YA 2AXTC 2ME6A 4PUSA 1AKHB 5C3EJ 2O6GE 2R7XA 1Y56A 1R5HA 1J2XA 1X3WB 1MNMC 5GPCA 5D6FA 2KDOA 2QM3A 1R1TA 4UUTA 4D5FA 2DA7A 4XLHA 4B4CA 2Z1DA 1Y1WJ 1K78B 3DKXA 1FBUA 1XCVA 1FZPB 2OTJI 3U21A 4CYCA 1H89C 2O61A 3UR3C 2EV5A 5IYDJ 4PJLA 3OOPA 3MVPA 3TP0A 2HYJA 1LPQA 3BJOA 4EJUA 3H9QA 3RDIA 3N05A 4EV0A 2IJLA 4XRMA 4YRVA 4O3MA 2L54A 1DPRA 4N0BA 4RM2A 4Z6YA 4AM3A 2WAFA 2X6WA 2K40A 4JX6A 2Q0OA 3ZN1A 3Q0VA 4K2EA 1P7IA 2B9SA 3S1NJ 2QVOA 3QYFA 4N4OB 2O3FA 2ESNA 1RESA 5AIPA 1IDYA 1VQ6I 4MEYF 4WXCA 1SD5A 1FOWA 3V7RA 3E1SA 4BQNA 1SVLA 4I01A 1S72I 4HF1A 3GO5A 2A5WA 4A3FJ 4BY7J 4EM0B 3BR0A 2V1UA 5DCFA 4JP0A 1NG7A 1FYKA 1AKHA 3CJNA 2VJIA 3VYTB 1HW1A 3V8KA 2W24A 3OIOA 1YX3A 2JVHA 2L2OA 1WJEA 3MD2A 4YELA 2OA4A 3SZTA 3KIOA 1K78A 3E5QA 2K9SA 3WG7H 4FISA 3G2BA 1ZGAA 3RPUD 3LL7A 3K4JA 1FPQA 1U0JA 2WV0A 1LQ1A 2FBKA 1JHHA 1IZ1A 3GTGJ 1B1BA 3GYHX 3S17J 4FHTA 3GTMJ 3F8BA 1N25A 1K7AA 3BP8A 4LIUA 4HYEA 2KL4A 3SDBA 2G7UA 3ZQ7A 4DZJA 2HYFA 4R8HA 4HSTA 3S32A 1N77A 2CO5A 3MQ0A 4ENNA 3FM3A 2NOJB 3H0DA 3BTLA 4ZC3A 1Z05A 1UZCA 3DKWA 4XM3A 4HNTA 2TRTA 1TLHB 4LMYA 3K4BA 1P4AA 4IHSA 2K3FA 2KHMA 3RZDJ 1YQAA 2DLLA 5ILVA 3BY6A 2GZWA 4UB8C 4P5OA 3ZQCA 3N4MA 1D1CA 5E79C 3A02A 3O3KA 1A31A 3JAMZ 4CUGA 1T6SA 2I10A 3DWLE 2K86A 2OZ6A 2JRTA 3L00A 3MMYB 2KJBA 1OCTC 3LFUA 3FX3A 3JR9A 4XLFA 1TWHJ 3BG6A 2VUMJ 3HPGA 3A01B 4GXOA 1LEBA 3RKWA 2CQXA 4IQ4A 4UNOA 3ZMVA 5DM7F 2K5CA 3FXMA 3U1KA 4KT5C 4QIWN 2XAGA 5EDNA 4KISA 4XKCA 3SJMA 1QA6A 3IRRA 2XPUA 2VE9A 4XN0A 3H0GJ 3D5RC 3JRFA 1ZH5A 2A6HF 2CSOA 2DPUA 3R60A 4A6DA 1BJZA 2XIGA 3K1MA 4PJNA 1IRZA 4U7BA 3V8JA 2ME0A 3VYUB 1H0MA 1E17A 1JUPA 1BR1A 1FSEA 4E4HA 2LREA 1MIJA 3AG2H 3SEZA 5BPDA 3I3LA 1R00A 2Y0SA 2YX7A 3M8JA 3G4SI 1NK2P 1MBGA 3G1OA 2HDCA 3AL0B 3TBIA 1ZYRF 2XDVA 1DPUA 1S29A 1KZHA 1RNLA 1M1EB 3TO7A 1ETYA 3RSNA 5J8FA 4IVNA 3AFHA 1SVOA 3F23A 3G71I 1VF9A 2LY1A 1LVKA 2UV1A 2WAEA 2DCEA 4WCGA 4C2MJ 1HDDC 1XC5A 2V1DA 1I50J 2L9NA 2NOGA 3FKIJ 2M34A 1JKQC 3RCOA 3D1NI 3EUHC 4IRIA 4XLCA 1XDUA 2IW5A 2YU3A 2DDBA 4ZZLA 1YJNI 3HYIA 1QU3A 2FOWA 1TQIA 2XAQA 4GYIA 3BTCA 2NAZA 3CP2A 3QPSA 1BC8C 1BOAA 5JI6A 3A01A 4OMZA 5KAIC 4S04A 5CQEA 4CCKA 1S6LA 1TNSA 2ELHA 2NVYJ 2EB7A 2L9VA 2GQQA 2WBMA 1XSXA 4PDKA 2CUFA 5FKKA 4XKBA 1V54H 4KN4X 1FTZA 3S1QJ 5FRNA 4Y7NJ 1LFUP 1KYWA 3PSFA 4PSWA 5LHGA 1D8JA 3X2QH 4RGRA 2EIJH 2ZO4A 2OTLI 3RI4A 2A05A 5EEGA 3TW6A 3CCMI 4O6JA 1UHWA 1U78A 4CA0A 1LEAA 5K7ZA 1DDNA 3S2WA 1J09A 3FZVA 2HVSA 2VIXA 1K4TA 3MN2A 1PVEA 3JSPA 1B72B 4QWQA 1YJ9I 3KEOA 1V5FA 1GUUA 5CLSA 4DQ2A 2IA1A 1Z6RA 4YIIA 2HQRA 4RGXA 1IRGA 2E1OA 4GGGA 1SD4A 5EGOB 4U0WA 1ON1A 1R6RA 5EZHA 4XIDA 2AXLA 1ONVA 1TT5B 3SEQA 2JTVA 5FGMA 2G9WA 1KU7A 1STZA 3ABLH 5FKOA 4XRSG 2Y2ZA 4GFBA 3SDGA 5JFRA 1R36A 2LTPA 2O03A 3AAFA 2E35A 1QPMA 3KPHA 5GPAA 3G1MA 5M5XJ 4AVPA 3BR5A 5D5WB 4M72A 1MBFA 1E3PA 3BG9A 1G2HA 1ETQA 4CGZA 1I1SA 1HSJA 1QO0D 5IOYA 2F4MB 3B6AA 4P96A 5DD8A 3REOA 4ASNA 4KITB 3F6OA 1ZK8A 3E7LA 1ZKGA 3N97A 4DBQA 1H9GA 2JSCA 3OIPA 4BQQA 2GXAA 1TW2A 3F0CA 4HF0A 1U5TB 3K4LA 2XROA 2ZXIA 3J81Z 2LKXA 3BQYA 1T38A 2IS4A 5J8CA 3NWTA 1MSEC 2FF4A 2HQNA 1ETXA 2EZLA 3ESWB 5CQGA 4YEJA 4ESFA 1OQYA 4HX7A 3H3ZA 3JRBA 2OCCH 2OJED 9ANTA 4PFPA 4IL6C 2X51A 1H9TA 2XPVA 3HSRA 1B72A 2DDAA 2VT2A 2YUSA 1KGSA 1KU9A 2B0LA 2D2WA 2DA2A 1G3YA 3GTQJ 2OBPA 2CFXA 1ZAOA 3GLLA 4EM2A 2OU2A 4IRGA 2VJ5A 2ZB9A 3EYYA 2STWA 1ORKA 4QLCU 4E7KA 1TQMA 2ZBKA 3WG9A 2QSGX 3IH2A 4OU0A 5EGOA 3K2AA 3WTVC 2EFNA 4M3EA 2JRMA 4KMUX 4A5MA 1O4XA 3V7CA 3IWZA 3KP7A 4RB1A 4MFDA 2LC2A 2X9DA 5IP9J 2VKDA 1D1BA 2CUEA 5EEHA 1NG6A 4HDUA 2QLZA 2RKHA 1XX5A 2ADUA 3ZOBA 1TWGJ 1W5SA 5LEKA 4IHYA 4BUPA 2E5ZA 1EKEA 3ZR8X 2DA1A 1VQOI 2BEOA 1MH3A 5ERIA 3RKXA 2LRDA 2P6SA 3HKZN 4CCJA 4D7MA 2UWMA 2R93J 1LVAA 1J0RA 2EZIA 5LGTA 1WPKA 2ISZA 2X1EA 2QWWA 3L7WA 1YJWI 2OPTA 2ACJA 1U5TA 3EUKL 2XB0X 3H36A 4RLFA 4A0ZA 2OCEA 3AG1H 3PQKA 1GDTA 1X1AA 3QOEA 1ETWA 3OY9A 3MAJA 1HKQA 2CW7A 2EBIA 3MKWB 3AG4H 2VBWA 1J7KA 2CUZA 2ZMEC 4GYGA 3OSFA 2MLGA 2RGVA 1TWFJ 3CF5F 1QPIA 4MNUA 2CS3A 1JGGA 5HLTA 1YO5C 4A3KJ 3VB2A 4LITA 2PLYA 4IJAA 4AVZA 1WKMA 4BBRJ 1IC8A 3OYKA 4A5NA 4L5JA 2XUBA 3K4MA 2D1VA 5K5QA 1YE9A 1JT0A 2XRLA 3VFZA 1GVDA 5C4JJ 2IAIA 2Y30A 3GCMA 1YIJI 3ZPLA 5J47A 3IKTA 3MZHA 3ZQLA 2ZJ2A 3EETA 4ON0A 2OQRA 3LSPA 2CMPA 4EGYA 2Y9ZA 4CICA 2Z99A 4UUSB 1K6YA 1OMIA 2DA3A 2EFQA 1RR8C 3WTSC 1OR7A 1BI2A 1X1BA 2LMDA 5LBQA 1ERDA 3S8PA 1Y0NA 2EV6A 1O57A 1G6NA 3CD6I 4UY8I
chains in the Genus database with same CATH topology
2FRHA 1RI7A 2STTA 3BPVA 2VBYA 4RAZA 5F64A 1FX7A 1IAWA 3VOEA 2FNAA 2CYYA 2HOEA 4L9VA 2AS5F 1QBJA 1CGPA 2COMA 5CVRA 4IXAA 2QQ9A 2YPRA 1HQCA 2DW4A 1ZREA 2XGXA 2A07F 3FM5A 2DPDA 5JVTA 5A2QK 1ZRFA 1J5YA 2HZTA 3HHGA 2K27A 4GO1A 1Z6TA 1R58A 1UFMA 2MH9A 1D5VA 2KIFA 3BJ6A 5KK1A 3BZ6A 2HS5A 3WU0A 2XHKA 3DEUA 3DPTA 1IXSB 2KIUA 3V8LA 3KEQA 1JGSA 4G94A 3BDDA 3I4PA 2FMLA 1TQPA 3M7GA 4BHPA 1GHCA 4EJOA 1FYMA 5CVVA 2XV4S 4I7HA 4M74A 5L3EA 1J9IA 4I0BA 2IVMA 3I58A 2FBHA 4E70A 3I0TA 1FWZA 2ESHA 4L9TA 2XKPA 3SZPA 3QP5A 2Q2EA 1YYVA 4KIBA 4CDGA 3LFKA 3BWGA 3IKVA 4EJTA 4RB2C 3TQNA 2FMYA 2GA1A 3WU1B 2H6CA 4CHUA 2LNBA 5AONA 4BHBA 1JXSA 2BYVE 1FSHA 4ZYHA 1IXRC 3ELKA 2KIMA 5BMZA 4KYWA 1W7PD 4B8XA 4OIPF 2BE5F 5DCMB 1HSTA 4Z2YA 3J80Z 4HQEA 1XMAA 2M87A 1MKMA 1S8NA 4XLPF 2VBZA 2DQLA 2P4WA 5IT9K 1Z9CA 4UVAA 1FP1D 3KP5A 1G3SA 5HS9A 3C7JA 1ODDA 1PP8F 3LSTA 2MLKA 5TRDA 1BI0A 4G7OF 1OYIA 3TKYA 1XSVA 2DQRA 3LAJA 3GFLA 1F4KA 3KP3A 4KN7X 2FEZA 2PEXA 2L4MA 1YIOA 2QQBA 1SD7A 4AIKA 2KKOA 2GAUA 1D8KA 4RAYA 2UZKA 5D4SA 2P5VA 5DCMA 4I98B 3P9IA 1R1VA 1BI1A 4WXHA 1IRFA 2DTRA 4XBFA 3P9CA 1HW2A 2ETHA 4LK1F 2ISYA 3HTUA 3ZMDA 3SXYA 3RYPA 3ABUA 3CTAA 1R5GA 2FBIA 4OIRF 2MA3A 3F22A 5D5UB 5H6RA 3QRFF 4G8XA 1U2WA 5H6QA 1PUEE 4BXUA 3KP2A 2ZFWA 2GXGA 3M8FA 6PAXA 1U8RA 4P9UA 1B6AA 4XSZF 2FXAA 3RPUA 3JW4A 3E6MA 5DUKA 3SQNA 1KU3A 4BQAA 3U9GA 4BAYA 2UXNA 2A6EF 5HDGA 4L0ZB 4HLYA 4LK0F 2ZCWA 1T39A 4NB5A 4EGZA 5ILSA 4BYYA 3GXOA 1FNNA 3NEUA 4UV8A 1O3RA 2C6YA 3CUQB 2FA5A 1G3TA 2XVCA 5CYVA 3BROA 4KDPA 4UUVA 2ZKZA 4HA8A 3WGHA 4EQQA 2VN2A 1ZRDA 2YSRA 3B73A 1WSUA 3FXRA 4O5VA 4U88A 1B9NA 3DXJF 2Y75A 1GXPA 4LB5A 1NHAA 4L9JA 3CO7C 2VC1A 5FFXA 5FFZA 2EFOA 5DEQA 3K0LA 1MDMB 1LNWA 1OKRA 1YLFA 2V9VA 3TDZC 3F3XA 2KRFA 4L0YB 3TOAA 2L01A 2IP2A 2RC4A 3MCZA 1O3SA 2HTSA 5H20A 2A69F 3GFJA 3R0JA 1PP7U 3CUQA 1XN7A 1R23A 1B4AA 2DBBA 1P4WA 1T2KA 3LAPA 1W4MA 3KCCA 3HOTA 1QGPA 1F9NA 5E1ZB 3CDHA 4ESBA 2EFWA 3ERED 3GUDA 4CZZA 2ZNYA 4IRHA 1YFHA 2H09A 2IA0A 2DU9A 3ML6A 2W84A 3VEPA 1ZN2A 3QP6A 2JPBA 1MDMA 1IN8A 2R7DA 3TO6A 3GX4X 3DFGA 2VOPA 1YTYA 2XAFA 2QUFA 1XGMA 3FF5A 3ZP5A 4MHGA 2E7WA 3K1NA 3JTHA 1P2FA 1TW3A 2VONA 2HR3A 4L18B 2V79A 4LB6B 1WRJA 2Y0MA 1EH7A 1SMTA 5AIQA 1I1GA 2MC3A 3E5UA 1X3UA 3LA7A 4RGUA 4UXNA 5ICEA 4Y15A 4P55A 1CF7B 2HYGD 2R7FA 1JHFA 2Z9OA 1XDSA 2GWRA 3KETA 4U0YA 3TGNA 2H6BA 1IN5A 4IPAA 3I53A 3HIFA 2X4HA 3Q5FA 2E7XA 2GIVA 4UVBA 1HKSA 3IHUA 4OOIA 3U2RA 1O7LA 2Q8KA 1XGOA 2QQAA 2EA2A 1U5TC 3ZN0A 2L02A 5A2QZ 4HLXA 2D45A 1RUOA 1IN7A 3QAHA 1IW7F 4LFUA 4YIFA 3HRTA 4HX4A 1UCRA 2FQ3A 1YS7A 3I59B 4HZFA 1CF7A 4A12A 3TDUC 5LGUA 3NRVA 4CYDA 1LDJA 3KP6A 4KFCA 2BGCA 1XGNA 4Q47A 2V1XA 1ZG1A 2YX4A 4HOBA 1SFUA 2E1NA 3EQLF 4YFXF 4A0XA 3F8NA 1L3LA 1USSA 5FO5A 3HRUA 4EJVA 3GZ6A 2HWVA 3QPTA 2WWYA 2XAHA 3R0AA 2JPCA 2VT3A 2QYOA 1XCBA 1FLIA 4LLLA 5JHUA 2LKPA 4AD9A 2P7VB 2BV6A 2PI0A 3IRQA 4ENMA 2K02A 3O2PE 3K2ZA 1FT9A 5L3BA 4WF2A 2ZNZA 2OZUA 3F21A 4PCQA 2A68F 2Y48A 4OINF 4WX9A 3I59A 3MZYA 5E8IA 1I5ZA 1LJ9A 5TJJA 1SAXA 2LF7A 3MWMA 3GFIA 3CO6C 4IHTA 3F8MA 3WTUC 2RDPA 4G7ZF 5BS6A 5FLXK 4Y17A 5HOOA 4CO8A 2HTJA 5ICFA 4G6QA 3RKYA 1HW5A 3HSFA 3M8EA 1FP2A 2X0LA 3CUOA 2Z3YA 3FMRA 3J7AO 4M71A 3DP7A 1QZYA 1AWCA 4XLNF 4JQFA 4XRFA 3GFMA 3GWZA 1XSDA 1KA8A 3WGGA 2K7LA 3E6DA 2FSWA 4AWXB 4JBAA 5L3DA 2FNPA 3QU6A 4R1HA 4HF2A 1B9MA 2R3SA 4I2OA 1IF1A 3PFIA 2W85A 5L3CA 4UHTA 3E6CC 4G7HF 1KQ8A 1IN4A 3KE2A 3KP4A 3C18A 3F6VA 1RZ4A 2F2EA 2MBFA 3V7SA 2FU4A 3WTXC 4ZYDA 3GF2A 2RQPA 3D5LA 4M6YA 1J75A 1ZLKA 3LA2A 2DFIA 1JE8A 2A5YB 3I71A 3GZ5A 3TOBA 4CXFA 4ZYEA 1KYZA 3ISPA 1GVJA 3LWFA 4L5IA 2HEOA 1MJ9A 1BBYA 4DNCA 1T0FA 4IF4A 3OV8A 1ON2A 3GW2A 5IT3A 4MTDA 3WTYC 3QU3A 3KZZA 4I09A 5E20A 5E8GA 2LSOA 3E3VA 3ECHA 1KQ9A 5HDNA 2NYXA 3EDPA 3DV8A 2EJRA 2EA4A 2DI3A 3HTSB 3VODA 1J59A 4EJWA 3B02A 3T0YA 3MEXA 1IXCA 5BQTA 1ZARA 2EWNA 4HQMA 3U1DA 4BH9A 2VOOA 2CGPA 3KFWX 2GXBA 5F6FA 2IT0A 1BM9A 2H27A 5ICCA 4LJZF 4G9YA 1MJAA 3I64A 2EFPA 3L09A 1KU2A 3WTTC 1YS6A 2KJCA 2MD5A 1K6OA 1F1ZA 4YG2F 4U0VA 1IUYA 3FWEA 4BNCA 4KIGA 4GCVA 4ENJA 1BN5A 1EV7A 3FMQA 3RPQA 5LGNA 1MD0A 5ILUA 2W57A 2XASA 3T8RA 3WE3A 3IC7A 5D5XB 4MQ9F 2PMUA 3FHZA 4I0AA 4I02A 2M1BA 3TO9A 3HSEA 5CVIA 1SFEA 2GA2A 2OAZA 4N9HA 1B59A 2DO7A 2A3SA 2CQKA 2CW0F 2P6TA 4HV6A 3L2CA 3CLOA 3QPHA 3WTZA 1YW9A 4ETSA 3EYIA 5E1WA 2IPQX 1ZGJA 3ZMUA 3WODF 2H94A 1FY7A 3J80K 1DUXC 5D8LB 4A2UA 1FYLA 5LRRA 1QZZA 1Z7UA 4U7DA 2V6CA 2E1CA 1O3TA 3ECOA 5L3FA 1AOYA 2VBXA 5FD5A 3ZMZA 4R79A 4AIHA 4UNOA 2VXZA 3HHHA 5L3GA 4MGRA 1P6RA 4P9FA 4PZJA 2PFBA 3LQQA 1SD6A 2DK8A 2TDXA 3COAC 1O7FA 4HW0A 1IN6A 3P7NA 1LDDA 4OIQF 4Q4ZF 1LB2A 1EH6A 1MGTA 2NS0A 3WE2A 2F5CA 3HUGA 3RJPA 5HDKA 4S05A 4HAMA 1MJBA 2RV8A 1ZG5A 3RIRA 1P4XA 3W6JB 1PDNC 4Q5SF 5ED4A 1E2XA 3CUQC 2WTEA 4M73A 2XKOA 4BHCA 2LF8A 4L9NA 1BIAA 2JT1A 5BOXA 4TV7A 3R4KA 3HRSA 1REPC 4JK1X 4LG0B 2ZXJA 3BPXA 3D0SA 2PBIA 3ULQB 3K9TA 4Y13A 4D0PA 2P8TA 1Q1HA 2QZ8A 2MH2A 2BBYA 5HS7A 3E5XA 1YW7A 2LDUA 2CG4A 2RVCA 5J6XA 2VODA 5KVRA 2NNYA 1A04A 1S7OA 4OMYA 2W25A 4FX4A 3EUHA 3F8FA 3PQJA 1TBXA 1Z1DA 1FBQA 2YR2A 1ZRCA 1C0WA 1F5TA 4M9SA 1R1UA 3KZYA 2A61A 3C1DA 3MFKA 2HKXA 4LG0A 1KQ0A 4MQVA 3ZMSA 3FMSA 2O0YA 4UVCA 3JAMK 1OPCA 2F5FA 3FXUA 2PJPA 2XRNA 2FOKA 3ABTA 3E6BA 2M45A 1L0OC 1ZHFA 2K4JA 5E1XA 5JR3A 2VE8A 2G7HA 5DD4A 3E97A 1U6GA 4OIOF 2D1HA 2EK5A 1QQIA 4MEXF 4HV5A 2P7CB 4NHJA 3Q9VA 4FT8A 2VC0A 5K5OA 4WXDA 5F1RA 1S3JA 4HX8A 2P5KA 1G4DA 1WI9A 4M9XA 3RTRA 2CWEA 4RB0A 5HLIA 4MTEA 4Q48A 3T5XA 2IA2A 1BIBA 5FLXZ 3WTWC 5E17F 3GLXA 3T8TA 2ZMEB 1LDKB 5LRSA 3W6KB 5D8KB 3L9FA 5FB2A 1YG2A 1XGSA 4XSXF 1I6XA 2QENA 4ESJA 4ZH4F 3SFZA 3V4GA 3K1PA 3BOQA 1RIOH 2FE3A 3DPLC 5HS8A 5DDGA 4ZYGA 1UB9A 2HGCA 2M5WA 5D4RA 5HLGA 2PN6A 1SFXA 1Z91A 5CVUA 4RGSA 5CJ9A 2NRAC 1QNTA 1R22A 4NQWA 3RYRA 1FC3A 3P9KA 1U3EM 3DF8A 1TTYA 2ZMEA 1HKTA 1R7JA 4KMFA 1XMKA 3GEZA 2J5OA 4KUMA 1BI3A 3ZMTA 4F7ZA 3LA3A 3G73A 4KICA 4EMSA 3KLNA 5HVQC 5HLHA 3J81K 5LEJA 1XB4A 3IL2A 1FBSA 1V4RA 2PG4A 5K1YA 3HOSA 2O8XA 3C3WA 1HXDA 4YFKF 5DV5A 5D5VB 3F72A 3SHFA 3KLOA 3M9AA 3H3UA 4AIJA 1UHMA 3GVAA 5DYMA 5BPIA 1O3QA 2Z33A 5DUIA 2F5DA 4LLGF 3JTGA 2DK5A 5IT9Z 1ZLJA 1V3FA 2Z5UA 2WC2A 3NQOA 3H92A 2RN7A 1MZBA 1HBXG 3I5UA 2IRFG 4KIFA 1ULYA 2M8EA 3R61A 2PQ8A 4EM1A 2DAOA 2XAJA 5K5RA 4ZZDA 1USTA 4A0YA 5ICGA 2QBYB 3DQVC 1BJAA 4N9IA 5LHHA 4LLNA 1DP7P 3I54A 4KA4A 3M1EA 3K69A 1EH8A 2RNJA 5LLQA 3QOPA 2OD5A 2HFHA 4RB3C 4RS8A 1SMYF 4PGHA 5FD6A 2DT5A 4PGGA 4B09A 5LHIA 4FX0A 4ENKA 3Q9SA 1W7PB 1WQ2A 3ROUA 4G6DA 5D6EA 1ZG3A 2OQGA 4KNYA 3HRMA 1Y0UA 2UXXA 2JZYA 4M6XA 1P92A 2M30A 2L4AA 4WK8F 1GXQA 4EVIA 1OYWA 4HDVA 1TNTA 3R6SA 1FOKA 2J5PA 2NNNA 3JSOA 3O6BB 3LQRA 4UV9A 2QBYA 4HBLA 3F8CA 2P5LC 1W5TA 3FXQA 1RUNA 1YW8A 1S7AA 4H0EA 2EV0A 4WWCA 3T1BA 1D3YA 3BJAA 2HKOA 2F5EA 1BC7C 2L3DA 2K4BA 5E18F 1W7PA 1XD7A 4LD5A 4YFNF 5CVJA 1I27A 1VTNC 1K79A 3IWFA 4M9ZA 3G3ZA 1OYYA 1G3WA 1T98A 3WGIA 4LGWA 2PMHA 4A6EA 1WWXA 2O6GE 1R5HA 1J2XA 5D6FA 2QM3A 1R1TA 1K78B 1FBUA 1XCVA 1FZPB 2O61A 2EV5A 3OOPA 3BJOA 4EJUA 3RDIA 4EV0A 2IJLA 4O3MA 2L54A 1DPRA 4N0BA 2Q0OA 3ZN1A 4K2EA 2QVOA 2O3FA 2ESNA 5AIPA 4MEYF 4WXCA 1SD5A 3V7RA 4I01A 4HF1A 3GO5A 4EM0B 2V1UA 5DCFA 1FYKA 3CJNA 1HW1A 3V8KA 2W24A 2OA4A 3SZTA 1K78A 3E5QA 1ZGAA 1FPQA 2WV0A 1LQ1A 2FBKA 1JHHA 1IZ1A 1B1BA 3GYHX 4FHTA 3F8BA 1K7AA 3BP8A 4HYEA 2G7UA 3ZQ7A 2HYFA 4R8HA 2CO5A 3MQ0A 4ENNA 3FM3A 1Z05A 3DKWA 1TLHB 4LMYA 1P4AA 4IHSA 1YQAA 2DLLA 5ILVA 3BY6A 2GZWA 4P5OA 3N4MA 3O3KA 3JAMZ 1T6SA 2K86A 2OZ6A 2JRTA 3L00A 2KJBA 3FX3A 4GXOA 1LEBA 3RKWA 3ZMVA 4KT5C 2XAGA 3IRRA 2VE9A 1ZH5A 2A6HF 2CSOA 2DPUA 3R60A 4A6DA 2XIGA 3K1MA 4U7BA 3V8JA 1E17A 1H0MA 1FSEA 5BPDA 1R00A 2YX7A 2HDCA 1ZYRF 1DPUA 1S29A 1RNLA 3TO7A 5J8FA 4IVNA 3F23A 4WCGA 2V1DA 4IRIA 1XDUA 2IW5A 2YU3A 4ZZLA 3HYIA 1TQIA 2XAQA 4GYIA 2NAZA 1BC8C 1BOAA 5JI6A 4OMZA 4S04A 1S6LA 1TNSA 2ELHA 2EB7A 2GQQA 1XSXA 4PDKA 4KN4X 1KYWA 1D8JA 5LHGA 4RGRA 2ZO4A 3RI4A 5EEGA 4O6JA 1UHWA 1U78A 1DDNA 1LEAA 3S2WA 3FZVA 3JSPA 4QWQA 3KEOA 5CLSA 4DQ2A 2IA1A 1Z6RA 4YIIA 2HQRA 4RGXA 1IRGA 4GGGA 1SD4A 4U0WA 1ON1A 2AXLA 1ONVA 2JTVA 5FGMA 2G9WA 1KU7A 1STZA 5JFRA 1R36A 2O03A 3AAFA 1QPMA 4AVPA 5D5WB 4M72A 4CGZA 1I1SA 1HSJA 1QO0D 4P96A 5DD8A 3REOA 4ASNA 3F6OA 3N97A 1H9GA 2JSCA 1TW2A 4HF0A 1U5TB 2XROA 3J81Z 1T38A 5J8CA 2FF4A 2HQNA 4ESFA 4HX7A 3H3ZA 1H9TA 3HSRA 2VT2A 1KGSA 1KU9A 2B0LA 2D2WA 1G3YA 2OBPA 2CFXA 1ZAOA 4EM2A 2OU2A 4IRGA 3EYYA 2STWA 4QLCU 1TQMA 2ZBKA 3WG9A 4OU0A 3WTVC 2EFNA 4KMUX 4A5MA 3V7CA 3IWZA 3KP7A 4RB1A 5EEHA 4HDUA 2QLZA 2RKHA 2ADUA 1W5SA 5LEKA 2BEOA 5ERIA 3RKXA 2P6SA 2UWMA 1LVAA 1J0RA 5LGTA 2ISZA 2QWWA 3L7WA 2ACJA 1U5TA 4A0ZA 3PQKA 3MAJA 1HKQA 2VBWA 1J7KA 4GYGA 2MLGA 2RGVA 4MNUA 1YO5C 3VB2A 2PLYA 4IJAA 1WKMA 4A5NA 4L5JA 2XUBA 2D1VA 5K5QA 3VFZA 3ZPLA 3MZHA 3IKTA 2ZJ2A 3EETA 4ON0A 2OQRA 4EGYA 4CICA 2Z99A 1OMIA 2EFQA 3WTSC 1OR7A 1BI2A 5LBQA 2EV6A 1O57A 1G6NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FRH A;  1RI7 A;  2STT A;  3BPV A;  2VBY A;  4RAZ A;  5F64 A;  1FX7 A;  1IAW A;  3VOE A;  2FNA A;  2CYY A;  2HOE A;  4L9V A;  2AS5 F;  1QBJ A;  1CGP A;  2COM A;  5CVR A;  4IXA A;  2QQ9 A;  2YPR A;  1HQC A;  2DW4 A;  1ZRE A;  2XGX A;  2A07 F;  3FM5 A;  2DPD A;  5JVT A;  5A2Q K;  1ZRF A;  1J5Y A;  2HZT A;  3HHG A;  2K27 A;  4GO1 A;  1Z6T A;  1R58 A;  1UFM A;  2MH9 A;  1D5V A;  2KIF A;  3BJ6 A;  5KK1 A;  3BZ6 A;  2HS5 A;  3WU0 A;  2XHK A;  3DEU A;  3DPT A;  1IXS B;  2KIU A;  3V8L A;  3KEQ A;  1JGS A;  4G94 A;  3BDD A;  3I4P A;  2FML A;  1TQP A;  3M7G A;  4BHP A;  1GHC A;  4EJO A;  1FYM A;  5CVV A;  2XV4 S;  4I7H A;  4M74 A;  5L3E A;  1J9I A;  4I0B A;  2IVM A;  3I58 A;  2FBH A;  4E70 A;  3I0T A;  1FWZ A;  2ESH A;  4L9T A;  2XKP A;  3SZP A;  3QP5 A;  2Q2E A;  1YYV A;  4KIB A;  4CDG A;  3LFK A;  3BWG A;  3IKV A;  4EJT A;  4RB2 C;  3TQN A;  2FMY A;  2GA1 A;  3WU1 B;  2H6C A;  4CHU A;  2LNB A;  5AON A;  4BHB A;  1JXS A;  2BYV E;  1FSH A;  4ZYH A;  1IXR C;  3ELK A;  2KIM A;  5BMZ A;  4KYW A;  1W7P D;  4B8X A;  4OIP F;  2BE5 F;  5DCM B;  1HST A;  4Z2Y A;  3J80 Z;  4HQE A;  1XMA A;  2M87 A;  1MKM A;  1S8N A;  4XLP F;  2VBZ A;  2DQL A;  2P4W A;  5IT9 K;  1Z9C A;  4UVA A;  1FP1 D;  3KP5 A;  1G3S A;  5HS9 A;  3C7J A;  1ODD A;  1PP8 F;  3LST A;  2MLK A;  5TRD A;  1BI0 A;  4G7O F;  1OYI A;  3TKY A;  1XSV A;  2DQR A;  3LAJ A;  3GFL A;  1F4K A;  3KP3 A;  4KN7 X;  2FEZ A;  2PEX A;  2L4M A;  1YIO A;  2QQB A;  1SD7 A;  4AIK A;  2KKO A;  2GAU A;  1D8K A;  4RAY A;  2UZK A;  5D4S A;  2P5V A;  5DCM A;  4I98 B;  3P9I A;  1R1V A;  1BI1 A;  4WXH A;  1IRF A;  2DTR A;  4XBF A;  3P9C A;  1HW2 A;  2ETH A;  4LK1 F;  2ISY A;  3HTU A;  3ZMD A;  3SXY A;  3RYP A;  3ABU A;  3CTA A;  1R5G A;  2FBI A;  4OIR F;  2MA3 A;  3F22 A;  5D5U B;  5H6R A;  3QRF F;  4G8X A;  1U2W A;  5H6Q A;  1PUE E;  4BXU A;  3KP2 A;  2ZFW A;  2GXG A;  3M8F A;  6PAX A;  1U8R A;  4P9U A;  1B6A A;  4XSZ F;  2FXA A;  3RPU A;  3JW4 A;  3E6M A;  5DUK A;  3SQN A;  1KU3 A;  4BQA A;  3U9G A;  4BAY A;  2UXN A;  2A6E F;  5HDG A;  4L0Z B;  4HLY A;  4LK0 F;  2ZCW A;  1T39 A;  4NB5 A;  4EGZ A;  5ILS A;  4BYY A;  3GXO A;  1FNN A;  3NEU A;  4UV8 A;  1O3R A;  2C6Y A;  3CUQ B;  2FA5 A;  1G3T A;  2XVC A;  5CYV A;  3BRO A;  4KDP A;  4UUV A;  2ZKZ A;  4HA8 A;  3WGH A;  4EQQ A;  2VN2 A;  1ZRD A;  2YSR A;  3B73 A;  1WSU A;  3FXR A;  4O5V A;  4U88 A;  1B9N A;  3DXJ F;  2Y75 A;  1GXP A;  4LB5 A;  1NHA A;  4L9J A;  3CO7 C;  2VC1 A;  5FFX A;  5FFZ A;  2EFO A;  5DEQ A;  3K0L A;  1MDM B;  1LNW A;  1OKR A;  1YLF A;  2V9V A;  3TDZ C;  3F3X A;  2KRF A;  4L0Y B;  3TOA A;  2L01 A;  2IP2 A;  2RC4 A;  3MCZ A;  1O3S A;  2HTS A;  5H20 A;  2A69 F;  3GFJ A;  3R0J A;  1PP7 U;  3CUQ A;  1XN7 A;  1R23 A;  1B4A A;  2DBB A;  1P4W A;  1T2K A;  3LAP A;  1W4M A;  3KCC A;  3HOT A;  1QGP A;  1F9N A;  5E1Z B;  3CDH A;  4ESB A;  2EFW A;  3ERE D;  3GUD A;  4CZZ A;  2ZNY A;  4IRH A;  1YFH A;  2H09 A;  2IA0 A;  2DU9 A;  3ML6 A;  2W84 A;  3VEP A;  1ZN2 A;  3QP6 A;  2JPB A;  1MDM A;  1IN8 A;  2R7D A;  3TO6 A;  3GX4 X;  3DFG A;  2VOP A;  1YTY A;  2XAF A;  2QUF A;  1XGM A;  3FF5 A;  3ZP5 A;  4MHG A;  2E7W A;  3K1N A;  3JTH A;  1P2F A;  1TW3 A;  2VON A;  2HR3 A;  4L18 B;  2V79 A;  4LB6 B;  1WRJ A;  2Y0M A;  1EH7 A;  1SMT A;  5AIQ A;  1I1G A;  2MC3 A;  3E5U A;  1X3U A;  3LA7 A;  4RGU A;  4UXN A;  5ICE A;  4Y15 A;  4P55 A;  1CF7 B;  2HYG D;  2R7F A;  1JHF A;  2Z9O A;  1XDS A;  2GWR A;  3KET A;  4U0Y A;  3TGN A;  2H6B A;  1IN5 A;  4IPA A;  3I53 A;  3HIF A;  2X4H A;  3Q5F A;  2E7X A;  2GIV A;  4UVB A;  1HKS A;  3IHU A;  4OOI A;  3U2R A;  1O7L A;  2Q8K A;  1XGO A;  2QQA A;  2EA2 A;  1U5T C;  3ZN0 A;  2L02 A;  5A2Q Z;  4HLX A;  2D45 A;  1RUO A;  1IN7 A;  3QAH A;  1IW7 F;  4LFU A;  4YIF A;  3HRT A;  4HX4 A;  1UCR A;  2FQ3 A;  1YS7 A;  3I59 B;  4HZF A;  1CF7 A;  4A12 A;  3TDU C;  5LGU A;  3NRV A;  4CYD A;  1LDJ A;  3KP6 A;  4KFC A;  2BGC A;  1XGN A;  4Q47 A;  2V1X A;  1ZG1 A;  2YX4 A;  4HOB A;  1SFU A;  2E1N A;  3EQL F;  4YFX F;  4A0X A;  3F8N A;  1L3L A;  1USS A;  5FO5 A;  3HRU A;  4EJV A;  3GZ6 A;  2HWV A;  3QPT A;  2WWY A;  2XAH A;  3R0A A;  2JPC A;  2VT3 A;  2QYO A;  1XCB A;  1FLI A;  4LLL A;  5JHU A;  2LKP A;  4AD9 A;  2P7V B;  2BV6 A;  2PI0 A;  3IRQ A;  4ENM A;  2K02 A;  3O2P E;  3K2Z A;  1FT9 A;  5L3B A;  4WF2 A;  2ZNZ A;  2OZU A;  3F21 A;  4PCQ A;  2A68 F;  2Y48 A;  4OIN F;  4WX9 A;  3I59 A;  3MZY A;  5E8I A;  1I5Z A;  1LJ9 A;  5TJJ A;  1SAX A;  2LF7 A;  3MWM A;  3GFI A;  3CO6 C;  4IHT A;  3F8M A;  3WTU C;  2RDP A;  4G7Z F;  5BS6 A;  5FLX K;  4Y17 A;  5HOO A;  4CO8 A;  2HTJ A;  5ICF A;  4G6Q A;  3RKY A;  1HW5 A;  3HSF A;  3M8E A;  1FP2 A;  2X0L A;  3CUO A;  2Z3Y A;  3FMR A;  3J7A O;  4M71 A;  3DP7 A;  1QZY A;  1AWC A;  4XLN F;  4JQF A;  4XRF A;  3GFM A;  3GWZ A;  1XSD A;  1KA8 A;  3WGG A;  2K7L A;  3E6D A;  2FSW A;  4AWX B;  4JBA A;  5L3D A;  2FNP A;  3QU6 A;  4R1H A;  4HF2 A;  1B9M A;  2R3S A;  4I2O A;  1IF1 A;  3PFI A;  2W85 A;  5L3C A;  4UHT A;  3E6C C;  4G7H F;  1KQ8 A;  1IN4 A;  3KE2 A;  3KP4 A;  3C18 A;  3F6V A;  1RZ4 A;  2F2E A;  2MBF A;  3V7S A;  2FU4 A;  3WTX C;  4ZYD A;  3GF2 A;  2RQP A;  3D5L A;  4M6Y A;  1J75 A;  1ZLK A;  3LA2 A;  2DFI A;  1JE8 A;  2A5Y B;  3I71 A;  3GZ5 A;  3TOB A;  4CXF A;  4ZYE A;  1KYZ A;  3ISP A;  1GVJ A;  3LWF A;  4L5I A;  2HEO A;  1MJ9 A;  1BBY A;  4DNC A;  1T0F A;  4IF4 A;  3OV8 A;  1ON2 A;  3GW2 A;  5IT3 A;  4MTD A;  3WTY C;  3QU3 A;  3KZZ A;  4I09 A;  5E20 A;  5E8G A;  2LSO A;  3E3V A;  3ECH A;  1KQ9 A;  5HDN A;  2NYX A;  3EDP A;  3DV8 A;  2EJR A;  2EA4 A;  2DI3 A;  3HTS B;  3VOD A;  1J59 A;  4EJW A;  3B02 A;  3T0Y A;  3MEX A;  1IXC A;  5BQT A;  1ZAR A;  2EWN A;  4HQM A;  3U1D A;  4BH9 A;  2VOO A;  2CGP A;  3KFW X;  2GXB A;  5F6F A;  2IT0 A;  1BM9 A;  2H27 A;  5ICC A;  4LJZ F;  4G9Y A;  1MJA A;  3I64 A;  2EFP A;  3L09 A;  1KU2 A;  3WTT C;  1YS6 A;  2KJC A;  2MD5 A;  1K6O A;  1F1Z A;  4YG2 F;  4U0V A;  1IUY A;  3FWE A;  4BNC A;  4KIG A;  4GCV A;  4ENJ A;  1BN5 A;  1EV7 A;  3FMQ A;  3RPQ A;  5LGN A;  1MD0 A;  5ILU A;  2W57 A;  2XAS A;  3T8R A;  3WE3 A;  3IC7 A;  5D5X B;  4MQ9 F;  2PMU A;  3FHZ A;  4I0A A;  4I02 A;  2M1B A;  3TO9 A;  3HSE A;  5CVI A;  1SFE A;  2GA2 A;  2OAZ A;  4N9H A;  1B59 A;  2DO7 A;  2A3S A;  2CQK A;  2CW0 F;  2P6T A;  4HV6 A;  3L2C A;  3CLO A;  3QPH A;  3WTZ A;  1YW9 A;  4ETS A;  3EYI A;  5E1W A;  2IPQ X;  1ZGJ A;  3ZMU A;  3WOD F;  2H94 A;  1FY7 A;  3J80 K;  1DUX C;  5D8L B;  4A2U A;  1FYL A;  5LRR A;  1QZZ A;  1Z7U A;  4U7D A;  2V6C A;  2E1C A;  1O3T A;  3ECO A;  5L3F A;  1AOY A;  2VBX A;  5FD5 A;  3ZMZ A;  4R79 A;  4AIH A;  4UNO A;  2VXZ A;  3HHH A;  5L3G A;  4MGR A;  1P6R A;  4P9F A;  4PZJ A;  2PFB A;  3LQQ A;  1SD6 A;  2DK8 A;  2TDX A;  3COA C;  1O7F A;  4HW0 A;  1IN6 A;  3P7N A;  1LDD A;  4OIQ F;  4Q4Z F;  1LB2 A;  1EH6 A;  1MGT A;  2NS0 A;  3WE2 A;  2F5C A;  3HUG A;  3RJP A;  5HDK A;  4S05 A;  4HAM A;  1MJB A;  2RV8 A;  1ZG5 A;  3RIR A;  1P4X A;  3W6J B;  1PDN C;  4Q5S F;  5ED4 A;  1E2X A;  3CUQ C;  2WTE A;  4M73 A;  2XKO A;  4BHC A;  2LF8 A;  4L9N A;  1BIA A;  2JT1 A;  5BOX A;  4TV7 A;  3R4K A;  3HRS A;  1REP C;  4JK1 X;  4LG0 B;  2ZXJ A;  3BPX A;  3D0S A;  2PBI A;  3ULQ B;  3K9T A;  4Y13 A;  4D0P A;  2P8T A;  1Q1H A;  2QZ8 A;  2MH2 A;  2BBY A;  5HS7 A;  3E5X A;  1YW7 A;  2LDU A;  2CG4 A;  2RVC A;  5J6X A;  2VOD A;  5KVR A;  2NNY A;  1A04 A;  1S7O A;  4OMY A;  2W25 A;  4FX4 A;  3EUH A;  3F8F A;  3PQJ A;  1TBX A;  1Z1D A;  1FBQ A;  2YR2 A;  1ZRC A;  1C0W A;  1F5T A;  4M9S A;  1R1U A;  3KZY A;  2A61 A;  3C1D A;  3MFK A;  2HKX A;  4LG0 A;  1KQ0 A;  4MQV A;  3ZMS A;  3FMS A;  2O0Y A;  4UVC A;  3JAM K;  1OPC A;  2F5F A;  3FXU A;  2PJP A;  2XRN A;  2FOK A;  3ABT A;  3E6B A;  2M45 A;  1L0O C;  1ZHF A;  2K4J A;  5E1X A;  5JR3 A;  2VE8 A;  2G7H A;  5DD4 A;  3E97 A;  1U6G A;  4OIO F;  2D1H A;  2EK5 A;  1QQI A;  4MEX F;  4HV5 A;  2P7C B;  4NHJ A;  3Q9V A;  4FT8 A;  2VC0 A;  5K5O A;  4WXD A;  5F1R A;  1S3J A;  4HX8 A;  2P5K A;  1G4D A;  1WI9 A;  4M9X A;  3RTR A;  2CWE A;  4RB0 A;  5HLI A;  4MTE A;  4Q48 A;  3T5X A;  2IA2 A;  1BIB A;  5FLX Z;  3WTW C;  5E17 F;  3GLX A;  3T8T A;  2ZME B;  1LDK B;  5LRS A;  3W6K B;  5D8K B;  3L9F A;  5FB2 A;  1YG2 A;  1XGS A;  4XSX F;  1I6X A;  2QEN A;  4ESJ A;  4ZH4 F;  3SFZ A;  3V4G A;  3K1P A;  3BOQ A;  1RIO H;  2FE3 A;  3DPL C;  5HS8 A;  5DDG A;  4ZYG A;  1UB9 A;  2HGC A;  2M5W A;  5D4R A;  5HLG A;  2PN6 A;  1SFX A;  1Z91 A;  5CVU A;  4RGS A;  5CJ9 A;  2NRA C;  1QNT A;  1R22 A;  4NQW A;  3RYR A;  1FC3 A;  3P9K A;  1U3E M;  3DF8 A;  1TTY A;  2ZME A;  1HKT A;  1R7J A;  4KMF A;  1XMK A;  3GEZ A;  2J5O A;  4KUM A;  1BI3 A;  3ZMT A;  4F7Z A;  3LA3 A;  3G73 A;  4KIC A;  4EMS A;  3KLN A;  5HVQ C;  5HLH A;  3J81 K;  5LEJ A;  1XB4 A;  3IL2 A;  1FBS A;  1V4R A;  2PG4 A;  5K1Y A;  3HOS A;  2O8X A;  3C3W A;  1HXD A;  4YFK F;  5DV5 A;  5D5V B;  3F72 A;  3SHF A;  3KLO A;  3M9A A;  3H3U A;  4AIJ A;  1UHM A;  3GVA A;  5DYM A;  5BPI A;  1O3Q A;  2Z33 A;  5DUI A;  2F5D A;  4LLG F;  3JTG A;  2DK5 A;  5IT9 Z;  1ZLJ A;  1V3F A;  2Z5U A;  2WC2 A;  3NQO A;  3H92 A;  2RN7 A;  1MZB A;  1HBX G;  3I5U A;  2IRF G;  4KIF A;  1ULY A;  2M8E A;  3R61 A;  2PQ8 A;  4EM1 A;  2DAO A;  2XAJ A;  5K5R A;  4ZZD A;  1UST A;  4A0Y A;  5ICG A;  2QBY B;  3DQV C;  1BJA A;  4N9I A;  5LHH A;  4LLN A;  1DP7 P;  3I54 A;  4KA4 A;  3M1E A;  3K69 A;  1EH8 A;  2RNJ A;  5LLQ A;  3QOP A;  2OD5 A;  2HFH A;  4RB3 C;  4RS8 A;  1SMY F;  4PGH A;  5FD6 A;  2DT5 A;  4PGG A;  4B09 A;  5LHI A;  4FX0 A;  4ENK A;  3Q9S A;  1W7P B;  1WQ2 A;  3ROU A;  4G6D A;  5D6E A;  1ZG3 A;  2OQG A;  4KNY A;  3HRM A;  1Y0U A;  2UXX A;  2JZY A;  4M6X A;  1P92 A;  2M30 A;  2L4A A;  4WK8 F;  1GXQ A;  4EVI A;  1OYW A;  4HDV A;  1TNT A;  3R6S A;  1FOK A;  2J5P A;  2NNN A;  3JSO A;  3O6B B;  3LQR A;  4UV9 A;  2QBY A;  4HBL A;  3F8C A;  2P5L C;  1W5T A;  3FXQ A;  1RUN A;  1YW8 A;  1S7A A;  4H0E A;  2EV0 A;  4WWC A;  3T1B A;  1D3Y A;  3BJA A;  2HKO A;  2F5E A;  1BC7 C;  2L3D A;  2K4B A;  5E18 F;  1W7P A;  1XD7 A;  4LD5 A;  4YFN F;  5CVJ A;  1I27 A;  1VTN C;  1K79 A;  3IWF A;  4M9Z A;  3G3Z A;  1OYY A;  1G3W A;  1T98 A;  3WGI A;  4LGW A;  2PMH A;  4A6E A;  1WWX A;  2O6G E;  1R5H A;  1J2X A;  5D6F A;  2QM3 A;  1R1T A;  1K78 B;  1FBU A;  1XCV A;  1FZP B;  2O61 A;  2EV5 A;  3OOP A;  3BJO A;  4EJU A;  3RDI A;  4EV0 A;  2IJL A;  4O3M A;  2L54 A;  1DPR A;  4N0B A;  2Q0O A;  3ZN1 A;  4K2E A;  2QVO A;  2O3F A;  2ESN A;  5AIP A;  4MEY F;  4WXC A;  1SD5 A;  3V7R A;  4I01 A;  4HF1 A;  3GO5 A;  4EM0 B;  2V1U A;  5DCF A;  1FYK A;  3CJN A;  1HW1 A;  3V8K A;  2W24 A;  2OA4 A;  3SZT A;  1K78 A;  3E5Q A;  1ZGA A;  1FPQ A;  2WV0 A;  1LQ1 A;  2FBK A;  1JHH A;  1IZ1 A;  1B1B A;  3GYH X;  4FHT A;  3F8B A;  1K7A A;  3BP8 A;  4HYE A;  2G7U A;  3ZQ7 A;  2HYF A;  4R8H A;  2CO5 A;  3MQ0 A;  4ENN A;  3FM3 A;  1Z05 A;  3DKW A;  1TLH B;  4LMY A;  1P4A A;  4IHS A;  1YQA A;  2DLL A;  5ILV A;  3BY6 A;  2GZW A;  4P5O A;  3N4M A;  3O3K A;  3JAM Z;  1T6S A;  2K86 A;  2OZ6 A;  2JRT A;  3L00 A;  2KJB A;  3FX3 A;  4GXO A;  1LEB A;  3RKW A;  3ZMV A;  4KT5 C;  2XAG A;  3IRR A;  2VE9 A;  1ZH5 A;  2A6H F;  2CSO A;  2DPU A;  3R60 A;  4A6D A;  2XIG A;  3K1M A;  4U7B A;  3V8J A;  1E17 A;  1H0M A;  1FSE A;  5BPD A;  1R00 A;  2YX7 A;  2HDC A;  1ZYR F;  1DPU A;  1S29 A;  1RNL A;  3TO7 A;  5J8F A;  4IVN A;  3F23 A;  4WCG A;  2V1D A;  4IRI A;  1XDU A;  2IW5 A;  2YU3 A;  4ZZL A;  3HYI A;  1TQI A;  2XAQ A;  4GYI A;  2NAZ A;  1BC8 C;  1BOA A;  5JI6 A;  4OMZ A;  4S04 A;  1S6L A;  1TNS A;  2ELH A;  2EB7 A;  2GQQ A;  1XSX A;  4PDK A;  4KN4 X;  1KYW A;  1D8J A;  5LHG A;  4RGR A;  2ZO4 A;  3RI4 A;  5EEG A;  4O6J A;  1UHW A;  1U78 A;  1DDN A;  1LEA A;  3S2W A;  3FZV A;  3JSP A;  4QWQ A;  3KEO A;  5CLS A;  4DQ2 A;  2IA1 A;  1Z6R A;  4YII A;  2HQR A;  4RGX A;  1IRG A;  4GGG A;  1SD4 A;  4U0W A;  1ON1 A;  2AXL A;  1ONV A;  2JTV A;  5FGM A;  2G9W A;  1KU7 A;  1STZ A;  5JFR A;  1R36 A;  2O03 A;  3AAF A;  1QPM A;  4AVP A;  5D5W B;  4M72 A;  4CGZ A;  1I1S A;  1HSJ A;  1QO0 D;  4P96 A;  5DD8 A;  3REO A;  4ASN A;  3F6O A;  3N97 A;  1H9G A;  2JSC A;  1TW2 A;  4HF0 A;  1U5T B;  2XRO A;  3J81 Z;  1T38 A;  5J8C A;  2FF4 A;  2HQN A;  4ESF A;  4HX7 A;  3H3Z A;  1H9T A;  3HSR A;  2VT2 A;  1KGS A;  1KU9 A;  2B0L A;  2D2W A;  1G3Y A;  2OBP A;  2CFX A;  1ZAO A;  4EM2 A;  2OU2 A;  4IRG A;  3EYY A;  2STW A;  4QLC U;  1TQM A;  2ZBK A;  3WG9 A;  4OU0 A;  3WTV C;  2EFN A;  4KMU X;  4A5M A;  3V7C A;  3IWZ A;  3KP7 A;  4RB1 A;  5EEH A;  4HDU A;  2QLZ A;  2RKH A;  2ADU A;  1W5S A;  5LEK A;  2BEO A;  5ERI A;  3RKX A;  2P6S A;  2UWM A;  1LVA A;  1J0R A;  5LGT A;  2ISZ A;  2QWW A;  3L7W A;  2ACJ A;  1U5T A;  4A0Z A;  3PQK A;  3MAJ A;  1HKQ A;  2VBW A;  1J7K A;  4GYG A;  2MLG A;  2RGV A;  4MNU A;  1YO5 C;  3VB2 A;  2PLY A;  4IJA A;  1WKM A;  4A5N A;  4L5J A;  2XUB A;  2D1V A;  5K5Q A;  3VFZ A;  3ZPL A;  3MZH A;  3IKT A;  2ZJ2 A;  3EET A;  4ON0 A;  2OQR A;  4EGY A;  4CIC A;  2Z99 A;  1OMI A;  2EFQ A;  3WTS C;  1OR7 A;  1BI2 A;  5LBQ A;  2EV6 A;  1O57 A;  1G6N A; 
#chains in the Genus database with same CATH topology
 2FRH A;  1RI7 A;  2STT A;  2L0K A;  4IEJ A;  1FIA A;  3H9J A;  3BPV A;  2VBY A;  4RAZ A;  5F64 A;  1FX7 A;  1IAW A;  2JA2 A;  1DU0 A;  3DTI A;  3VOE A;  2WAQ N;  2FNA A;  2HU9 A;  1VQN I;  2CYY A;  2HOE A;  4L9V A;  2AS5 F;  3K4K A;  1QBJ A;  4DW6 A;  1CGP A;  3G6E I;  1GLN A;  1X19 A;  1AA7 A;  2COM A;  3LSR A;  1RR7 A;  4A69 C;  5CVR A;  2QSF X;  4IXA A;  3JRG A;  2KLO A;  2H8W A;  2QQ9 A;  2Y69 H;  2YPR A;  4BXX J;  4B44 A;  1HQC A;  2DW4 A;  5J4Y A;  1ZRE A;  3JRI A;  4F91 B;  5FLV A;  2XGX A;  2AQE A;  2A07 F;  2JA8 J;  3FM5 A;  2DPD A;  2WY7 Q;  5JVT A;  4FCY A;  5A2Q K;  2EH3 A;  3CCU I;  1ZRF A;  1J5Y A;  2HZT A;  3HHG A;  2K27 A;  4GO1 A;  1Z6T A;  1D1A A;  1R58 A;  2DOA A;  1UFM A;  2MW8 A;  1D5Y A;  1WJF A;  2MH9 A;  1D5V A;  2KIF A;  3BJ6 A;  2XF5 A;  1K4S A;  2Q2E B;  2R7S A;  5KK1 A;  4UUS A;  3BZ6 A;  1I39 A;  4B48 A;  2HS5 A;  3DBR B;  3WU0 A;  2XHK A;  2JUG A;  4HNV A;  3S15 J;  3DEU A;  3QWL A;  3DPT A;  1ZQ3 P;  1IXS B;  2KIU A;  3V8L A;  4PFO A;  2IGN A;  4RDU A;  4X6A J;  2M2E A;  3KEQ A;  2DXI A;  3DLA A;  1JGS A;  3H3V K;  3ERM A;  3ONQ A;  4G94 A;  2CQQ A;  3RZO J;  3BR2 A;  3BDD A;  4C3I J;  3I4P A;  2VQL A;  2M0M A;  2FML A;  3JRE A;  1Z77 A;  1TQP A;  2HVR A;  2R7Q A;  3M7G A;  4BHP A;  4DGW B;  2VJJ A;  1QZE A;  1R4N B;  4EJO A;  1GHC A;  2DMQ A;  3H5N A;  2G0E A;  1FYM A;  5CVV A;  2XV4 S;  4I7H A;  3OWT A;  3A0H C;  2M8G X;  4M74 A;  2LKS A;  5L3E A;  1IUF A;  1J9I A;  4I0B A;  1TC3 C;  2IVM A;  3I58 A;  4A3L J;  2VQC A;  3HBL A;  2FBH A;  4Y4R A;  2R4G A;  4E70 A;  1X1C A;  3I0T A;  1FWZ A;  2ESH A;  4NNJ A;  2XF7 A;  3VWB A;  1A36 A;  5M3M J;  4M3B A;  4XL9 A;  1WHU A;  4L9T A;  2XKP A;  2R7O A;  3SZP A;  4HSR A;  1SFO J;  3QP5 A;  1IV6 A;  1Y8R B;  2Q2E A;  1YYV A;  4KIB A;  4CDG A;  3LFK A;  3BWG A;  3O8H A;  4U87 A;  1POG A;  3IKV A;  4EJT A;  2NVT J;  4RB2 C;  2HOS A;  2M7A A;  1X3Z B;  3TQN A;  1OCZ H;  1WVR A;  2FMY A;  2GA1 A;  4RLQ A;  3WU1 B;  2H6C A;  1K61 A;  2E60 A;  4BAC A;  3FBN B;  2V7F A;  4IO9 F;  3HOY J;  4CHU A;  3HEF A;  2LNB A;  3L2U A;  5AON A;  4BHB A;  1JXS A;  3E0J B;  4FAS D;  3HOU J;  2NXN B;  1MBE A;  2BYV E;  1FSH A;  2GOM A;  4ZYH A;  5HOD A;  1IXR C;  1XMX A;  3KYL A;  3ELK A;  2JA6 J;  2KIM A;  1UEL B;  5BMZ A;  2TCT A;  4KYW A;  1S7E A;  2E5N A;  1X1D A;  1W7P D;  3TMO A;  1K83 J;  3NAR A;  5J40 A;  4B8X A;  2HI3 A;  3IUO A;  4OIP F;  4IQJ A;  2BE5 F;  3IH4 A;  5DCM B;  1AHD P;  1HST A;  4Z2Y A;  5IOZ A;  5EYR A;  3J80 Z;  4HQE A;  1XMA A;  2LD5 A;  2IGO A;  2M87 A;  5TGT A;  2LG4 A;  4MLO A;  1MKM A;  2BXY A;  2EPF A;  1S8N A;  3W2V A;  4XLP F;  1X58 A;  2VBZ A;  2DQL A;  2P4W A;  5IT9 K;  4JOM A;  1Z9C A;  4UVA A;  1FP1 D;  2HDW A;  3J7Z I;  3KP5 A;  3F9K A;  1G3S A;  5HS9 A;  3TP3 A;  3C7J A;  1ODD A;  1PP8 F;  3LST A;  2MLK A;  2KFD A;  3GTK J;  2MYS A;  3CQZ J;  5TRD A;  4PJ0 C;  1HF0 A;  1BI0 A;  1OCC H;  1WFX A;  4G7O F;  1V5E A;  1OYI A;  1T95 A;  4E7Z A;  3S3N A;  2E2I J;  1BR4 A;  2DA4 A;  3TKY A;  1XSV A;  4BGD A;  2DQR A;  1ZTR A;  3LAJ A;  3GFL A;  1F4K A;  3KP3 A;  4KN7 X;  2FEZ A;  2MC4 A;  2PEX A;  4I99 C;  2L4M A;  2A6T A;  4G12 A;  1YIO A;  1H8A C;  2QQB A;  2BVL A;  2Q1Z B;  4FTH A;  1SD7 A;  4AIK A;  1ETK A;  2KKO A;  2GAU A;  4BDZ A;  1D8K A;  4LIV A;  4RAY A;  4Y3O A;  2UZK A;  5D4S A;  3H9G A;  2VKH A;  1OIS A;  3PM1 A;  2P5V A;  2KQR A;  4C3J J;  5DCM A;  2OF7 A;  4I98 B;  3P9I A;  2X48 A;  2VKE A;  1R1V A;  1T56 A;  1BI1 A;  1A35 A;  2LR8 A;  4I76 A;  2JVG A;  2KIS A;  3Q0W A;  4KT6 A;  3FKJ A;  4WXH A;  1IRF A;  1MH4 A;  2DTR A;  3LOC A;  4XBF A;  3HL2 A;  2I5U A;  3CMA I;  1I3Q J;  4IHV A;  3P9C A;  1VQP I;  5FLM J;  3BCA A;  1HW2 A;  2ETH A;  4LK1 F;  2ISY A;  1DU6 A;  3HTU A;  1QHH D;  3ZMD A;  3SXY A;  4A3C J;  3RYP A;  3ABU A;  3CTA A;  2DT6 A;  5J1Y A;  3BCB A;  1JKO C;  1R5G A;  2FBI A;  4OIR F;  2MA3 A;  1HCR A;  1OCR H;  3OIQ A;  4C3H J;  5D5U B;  3F22 A;  5H6R A;  3QRF F;  4QPO A;  4G8X A;  4DYR A;  2L7M P;  2LYC A;  1U2W A;  5H6Q A;  2VLA A;  4I6Z A;  3FXJ A;  4BXU A;  1PUE E;  3KP2 A;  3CMM A;  2WAD A;  2ZFW A;  1W5C C;  5KNL A;  2ECC A;  3DEW A;  2GXG A;  3OYL A;  5BNG A;  2EIL H;  4C30 A;  3M8F A;  3BTI A;  6PAX A;  3CCR I;  1U8R A;  4P9U A;  2X85 A;  2JA7 J;  1B6A A;  4XSZ F;  5JLW A;  3M07 A;  2FXA A;  3RPU A;  2F4I A;  2RNG A;  3JW4 A;  3E6M A;  5DUK A;  3SQN A;  1KU3 A;  4BQA A;  3U9G A;  1IRX A;  4BAY A;  2UXN A;  5GAE J;  1UG0 A;  2A6E F;  5HDG A;  4L0Z B;  4QPQ A;  4HLY A;  4LK0 F;  1RKT A;  1EF4 A;  2ZCW A;  3FXL A;  1T39 A;  4NB5 A;  2ZSH B;  2L7F P;  3ZXS A;  4EGZ A;  2V26 A;  5ILS A;  4C9Y A;  4BYY A;  3GXO A;  1FNN A;  3NEU A;  4UV8 A;  1O3R A;  2F6C A;  2C6Y A;  2XB5 A;  3CUQ B;  2FA5 A;  2M9H A;  1NH3 A;  4D9J A;  1G3T A;  5KAF C;  2XVC A;  5CYV A;  3BRO A;  4KDP A;  2M3A A;  2XGC A;  4XIC A;  4UUV A;  2ZKZ A;  1TP4 A;  4HA8 A;  3WGH A;  4EQQ A;  2L7Z A;  1W0U A;  1IJW C;  2VN2 A;  1N78 A;  1WJC A;  3IP4 B;  1ZRD A;  2YSR A;  4J01 A;  3B73 A;  4XQF A;  4P1W A;  2IBD A;  2O7O A;  1WSU A;  3FXR A;  4O5V A;  4BQO A;  2EIK H;  4U88 A;  3OS1 A;  1B9N A;  2UUZ A;  3BG3 A;  1SEU A;  3DXJ F;  2Y0S N;  2Y75 A;  1GXP A;  4LB5 A;  2B7E A;  1NHA A;  1HC8 A;  2WY8 Q;  1VQ9 I;  4L9J A;  3CO7 C;  2VC1 A;  5FFX A;  5FFZ A;  2EFO A;  1E3O C;  2IGM A;  5DEQ A;  3K0L A;  5LFA A;  4C2U A;  2GOX B;  1MDM B;  1LNW A;  1Q1V A;  2DOF A;  5JHF A;  2FUG 2;  5F0H A;  5E3M A;  1OKR A;  2Z16 A;  4CCM A;  1YLF A;  2V9V A;  2MD0 A;  3TDZ C;  2QKL B;  4QTR A;  1X2N A;  3F3X A;  3C2B A;  2KRF A;  4IX7 A;  2X1D A;  3TOA A;  4L0Y B;  2ID3 A;  2XGE A;  4CCN A;  2L01 A;  2IP2 A;  3GTL J;  2RC4 A;  2NVQ J;  3MCZ A;  3K70 C;  1MBH A;  1JTY A;  1B8I B;  1WCM J;  1O3S A;  2HTS A;  5H20 A;  2A69 F;  1JT6 A;  1SAN A;  3GFJ A;  2DMT A;  3R0J A;  1PP7 U;  3CUQ A;  1XN7 A;  1R23 A;  1B4A A;  2DBB A;  3DU5 A;  2RRE A;  3S14 J;  1P4W A;  1UHS A;  3PFY A;  2LLK A;  1T2K A;  2E2H J;  2QQ8 A;  3LAP A;  2O9L A;  2LBF B;  3K70 D;  1W4M A;  3KCC A;  3JRH A;  1QGP A;  3HOT A;  1F9N A;  5E1Z B;  1X4O A;  3CDH A;  4ESB A;  4XRS A;  2EFW A;  3ERE D;  2ELJ A;  3FXK A;  3GUD A;  2DA5 A;  4CZZ A;  2ZNY A;  2CV2 A;  3AL0 C;  2JJ7 A;  2DFH A;  4IRH A;  3CLQ A;  3CJT B;  1YFH A;  2H09 A;  3FIW A;  2IA0 A;  3GME A;  2DU9 A;  5GTH C;  3ML6 A;  5DS9 A;  4A3I J;  2W84 A;  3C2G A;  3W2A A;  5H2F C;  2K3P A;  3VEP A;  1ZN2 A;  3QP6 A;  3LMM A;  2JPB A;  1FOX A;  1MDM A;  1IN8 A;  1PUF B;  3BG7 A;  2R7D A;  3SYT A;  3TO6 A;  3GX4 X;  3DFG A;  2VOP A;  1YTY A;  3J7Y J;  2XAF A;  3HOZ J;  2QUF A;  3OSG A;  1LE8 B;  3PIP F;  3L2Q A;  1XGM A;  2DMP A;  4DYC A;  1FMV A;  2FD5 A;  3FF5 A;  2E7W A;  4MHG A;  3ZP5 A;  3BC8 A;  1MW7 A;  3CCE I;  3K1N A;  1B8I A;  3JTH A;  3K4N A;  1P2F A;  1TW3 A;  2ZJR F;  4FE4 A;  3BR1 A;  2VON A;  2HR3 A;  4L18 B;  1VQK I;  2V79 A;  4LB6 B;  2VQG A;  1WRJ A;  2Y0M A;  3G1L A;  1EH7 A;  1SMT A;  2LBF A;  5AIQ A;  1I1G A;  4BKX A;  3CCV I;  2MC3 A;  1VQ7 I;  3E5U A;  3ASO H;  5FRO A;  4ANJ A;  1X3U A;  4HNU A;  3LA7 A;  1TWA J;  4RGU A;  3HG9 A;  4UXN A;  1G8X A;  5C44 J;  5ICE A;  4Y15 A;  1R71 A;  4P55 A;  1CF7 B;  2M0C A;  2HYG D;  2R7F A;  1YRN B;  1JHF A;  2Z9O A;  1XDS A;  4DBR A;  1YHQ I;  1HA8 A;  2GWR A;  3KET A;  4U0Y A;  2W1O A;  3NAU A;  2JK3 A;  3CME I;  3TGN A;  1RET A;  3CJQ B;  1Z67 A;  2H6B A;  1IN5 A;  4IPA A;  5B5E C;  3KYD B;  3VSL A;  3MKY B;  1PUF A;  3I53 A;  1G59 A;  1OFC X;  5J1U A;  3HIF A;  1A6Q A;  2H1L A;  5GAD J;  2VPL A;  2ELK A;  2KIQ A;  2X4H A;  3DBL B;  3Q5F A;  1LE8 A;  2CH0 A;  1S9H A;  3CCJ I;  2E7X A;  1JUS A;  4IOC F;  2GIV A;  4UVB A;  3DBH B;  1HKS A;  1MMA A;  3IHU A;  4OOI A;  5F0C A;  3U2R A;  3FIS A;  1O7L A;  4B1R A;  3KZI C;  2Q8K A;  1XGO A;  2QQA A;  5E3N A;  2EA2 A;  1U5T C;  2ICW G;  1JTX A;  3ZN0 A;  3S3M A;  3HOV J;  2L02 A;  5A2Q Z;  4L5E A;  4HLX A;  2D45 A;  1DP3 A;  1RUO A;  1T33 A;  4M3D A;  4IHW A;  1IN7 A;  2CU7 A;  3QAH A;  3PO3 J;  1IW7 F;  4LFU A;  4YIF A;  4NDL A;  2VPR A;  1Y8Q B;  1WGX A;  3HRT A;  4HX4 A;  1UCR A;  2CV0 A;  2O5R A;  2FQ3 A;  1YS7 A;  3WHB A;  2QEX I;  1MSF C;  3I59 B;  4HZF A;  1ZR2 A;  1CF7 A;  4A12 A;  4BJ6 C;  3HOW J;  3TDU C;  5LGU A;  1YRN A;  2IS1 A;  5JLX A;  3NRV A;  2CV1 A;  4CYD A;  2COB A;  3RKQ A;  1R5I D;  3CC7 I;  1LDJ A;  3KP6 A;  4B47 A;  4KFC A;  2BGC A;  4C2T A;  1XGN A;  2RAE A;  2V6E A;  1TZL A;  4Q47 A;  2V1X A;  1Z21 A;  1ZG1 A;  2YX4 A;  1OR7 C;  5GTI C;  1MND A;  3GBG A;  5JVG F;  3HB9 A;  4HOB A;  1WJ5 A;  3HPH A;  1SFU A;  2E1N A;  1PJR A;  1JJ6 C;  3EQL F;  4YFX F;  4A0X A;  3DPU A;  3F8N A;  1L3L A;  1SAU A;  1USS A;  3HZJ A;  5FO5 A;  2HOT A;  2IS2 A;  3HRU A;  4EJV A;  3GZ6 A;  2XSD C;  2HWV A;  3QPT A;  2WWY A;  2XAH A;  3R0A A;  2JPC A;  2VT3 A;  1VZ0 A;  1XCB A;  2QYO A;  5B1B H;  1FLI A;  2DJN A;  4HRI A;  4LLL A;  1LKX A;  2EZK A;  5JHU A;  3W3C A;  1P9Q C;  2LKP A;  3TL4 X;  3K10 A;  2LY2 A;  4A3M J;  1HOM A;  4AD9 A;  2P7V B;  2M4K A;  2H1K A;  2BV6 A;  4RAF A;  2PI0 A;  3IRQ A;  2E71 A;  2K02 A;  3O2P E;  4ENM A;  3K2Z A;  1FT9 A;  5L3B A;  4WF2 A;  4II2 A;  2ZNZ A;  2OZU A;  5B1A H;  2FJ1 A;  3IAM 2;  2A68 F;  1I3A A;  2Y48 A;  4LG3 A;  4PCQ A;  3ZQI A;  4CH7 A;  3F21 A;  4OIN F;  1BL0 A;  2OC6 A;  4WX9 A;  2MFZ A;  3I59 A;  3MZY A;  1BA5 A;  1YI2 I;  5E8I A;  1I5Z A;  1RRJ A;  1IGN A;  5DM6 F;  3AG3 H;  1LJ9 A;  4A3E J;  1X2M A;  4FET A;  3HJE A;  5FKN A;  5TJJ A;  1R9T J;  3GTO J;  1SAX A;  1V55 H;  2R7V A;  2LF7 A;  3FK7 A;  3MWM A;  3GFI A;  3CO6 C;  3L2W A;  3F8M A;  4IHT A;  3WTU C;  4HPQ A;  2RDP A;  4IKF A;  2R7W A;  2E1M B;  4G7Z F;  3VPR A;  3S3O A;  5BS6 A;  3ASN H;  5FLX K;  4Y17 A;  5HOO A;  4ZDO A;  4CO8 A;  3FDY A;  1W1W E;  2HTJ A;  4NC7 A;  5ICF A;  4G6Q A;  3RKY A;  1HW5 A;  3HSF A;  3WHC A;  3M8E A;  1FP2 A;  2MG4 A;  2X0L A;  3CUO A;  2Z3Y A;  5KCM A;  3FMR A;  3J7A O;  4M71 A;  2X1C A;  1EJ9 A;  3DP7 A;  3L1P A;  1QZY A;  1AWC A;  4XLN F;  4JQF A;  4XRF A;  3ZCO A;  3GFM A;  3GWZ A;  4MIM A;  4NBQ A;  1XTA A;  3ZGK A;  2VB6 A;  1XSD A;  1KA8 A;  3WGG A;  2KPM A;  2K7L A;  3E6D A;  4A93 J;  2FSW A;  5FKL A;  3LSH A;  2KDZ A;  4AWX B;  2QCO A;  4JBA A;  5L3D A;  2FNP A;  5LD2 C;  2L9S A;  3QU6 A;  4R1H A;  2JUC A;  1VQL I;  4HF2 A;  1B9M A;  2V9P A;  2R3S A;  4I2O A;  1IF1 A;  3BZC A;  2BHZ A;  2AO9 A;  2BZT A;  5K7F A;  3PFI A;  2W85 A;  5L3C A;  4UHT A;  3E6C C;  3OR1 C;  3L2V A;  4G7H F;  1KQ8 A;  2R0Q C;  1WZ2 A;  4DYQ A;  3PSI A;  1IN4 A;  2EIN H;  2B63 J;  1VQ8 I;  2VXD A;  3KE2 A;  3K7A J;  3KP4 A;  3C18 A;  3F6V A;  1RZ4 A;  2F2E A;  2MBF A;  2JQ7 A;  3OR2 C;  3ZQQ A;  3V7S A;  3JRA A;  5IP6 A;  4YIR X;  2R5Z B;  4XOR A;  2FU4 A;  3D5S C;  3WTX C;  1X4P A;  4ZYD A;  3GF2 A;  2JSP A;  2V4J C;  2RQP A;  3D5L A;  4M6Y A;  1QVU A;  4OAZ A;  1J75 A;  4JX4 A;  3LA2 A;  1ZLK A;  2JN6 A;  4XLA A;  2DFI A;  1UG2 A;  4PSX A;  5HNF A;  4ZDP A;  1SVM A;  2A5Y B;  3I71 A;  1JE8 A;  1ENH A;  2HNH A;  3GZ5 A;  1MMS A;  2NS8 A;  4BE1 A;  3TOB A;  3CDL A;  1V5G A;  4CXF A;  2ID6 A;  3SZG A;  2X6Y A;  2HPM A;  4ZYE A;  4UB6 C;  2DOD A;  1KYZ A;  1MMG A;  3ISP A;  1GVJ A;  3Q0U A;  2XPW A;  3LSI A;  1VQ4 I;  3LWF A;  3S93 A;  4L5I A;  1MMD A;  3HC7 A;  2HEO A;  3PJR A;  2VKV A;  2JMW A;  1MJ9 A;  1BBY A;  1JKR C;  4DNC A;  2I8D A;  2DFF A;  1T0F A;  3CZ6 A;  4BDY A;  1YOV B;  4IF4 A;  3LNQ A;  3OV8 A;  1ON2 A;  3GW2 A;  2LVS A;  5IT3 A;  4MTD A;  3WTY C;  3QU3 A;  2V1N A;  1IO2 A;  4EEF G;  4J19 A;  2Y31 A;  3KZZ A;  4I09 A;  5E20 A;  5E8G A;  2BW3 B;  2LSO A;  3HGG A;  1WI3 A;  3E3V A;  3ECH A;  1KQ9 A;  3OYJ A;  2QA4 I;  5HDN A;  2NYX A;  3EDP A;  2R5Z A;  3FHN A;  3DV8 A;  1U8B A;  3BLY A;  2VJ4 A;  4XR6 A;  2EJR A;  1OCP A;  2EA4 A;  2DI3 A;  3HTS B;  1NTC A;  2W48 A;  3VOD A;  2WV1 A;  3PNT A;  3M3Y J;  3LSK A;  1J59 A;  4EJW A;  1ETO A;  3MZ8 A;  3B6C A;  3OS2 A;  4PK4 A;  1XS9 A;  2F48 A;  2WB1 A;  3B02 A;  3T0Y A;  3MEX A;  1IXC A;  4AID A;  5BQT A;  5J4V A;  1ZAR A;  2EWN A;  4HQM A;  3U1D A;  4BH9 A;  2VOO A;  3Q3S A;  4GRI A;  1ZGW A;  2CGP A;  2GIZ A;  3KFW X;  2CFO A;  2GXB A;  5F6F A;  2IT0 A;  2PMZ A;  3OYN A;  3FK6 A;  1BM9 A;  3BG5 A;  3PNY A;  4CCL A;  5ICC A;  2H27 A;  4LJZ F;  2XF6 A;  4G9Y A;  3OYH A;  3V42 A;  2E19 A;  1SC7 A;  4CCO A;  3EUA A;  1ACI A;  2DJI A;  1MJA A;  3I64 A;  3VSK A;  3OL3 A;  4BBS J;  5KHD A;  2EFP A;  3DKY A;  3L09 A;  1APL C;  4IHX A;  1KU2 A;  3WTT C;  1YS6 A;  2KJC A;  3IAS 2;  3OYA A;  2XAU A;  2MD5 A;  1LUJ B;  1K6O A;  3H5A A;  2GLO A;  3K4C A;  5CPR B;  1F1Z A;  4YG2 F;  4U0V A;  1IUY A;  4DJA A;  3FWE A;  4BNC A;  1F43 A;  4KIG A;  4GCV A;  2HPI A;  4JYK A;  2BW3 A;  2X6X A;  4ENJ A;  1BN5 A;  1GT0 C;  1CQT A;  3CJR B;  2FX0 A;  1EV7 A;  4B3A A;  3FMQ A;  1NK3 P;  5F0F A;  3A2K A;  3RPQ A;  5LGN A;  1MD0 A;  5ILU A;  2W57 A;  2XAS A;  4BJT A;  3T8R A;  3ZQF A;  3WE3 A;  4BE2 A;  3IC7 A;  5D5X B;  4MQ9 F;  2PMU A;  3FHZ A;  2QSH X;  4I0A A;  1EA3 A;  4I02 A;  3OYB A;  2M1B A;  3TO9 A;  2X6O A;  3HSE A;  1XG1 A;  3BTJ A;  5CVI A;  1SFE A;  2GA2 A;  2OAZ A;  5EZG A;  5FJ8 J;  3M1C A;  3OYE A;  4N9H A;  1VQM I;  1B59 A;  1Z3Y A;  2DYR H;  2DO7 A;  1E0E A;  2A3S A;  3HUG B;  2CQK A;  2CW0 F;  2DN0 A;  2P6T A;  4HV6 A;  3L2C A;  4E6K G;  4ABZ A;  4D7N A;  3S1M J;  1WJA A;  1N75 A;  1SFK A;  3OYM A;  4W1U A;  3CLO A;  4XNF A;  2LH9 A;  3QPH A;  3WTZ A;  1YW9 A;  4ETS A;  4F55 A;  3H5R A;  3EYI A;  5E1W A;  2IPQ X;  1ZGJ A;  3ZMU A;  1OJL A;  3J7A Y;  1Y39 A;  3CDI A;  3WOD F;  2H94 A;  2K9M A;  1FY7 A;  3CCQ I;  3CP8 A;  3J80 K;  2DMN A;  2ZSI B;  3QOD A;  1MBK A;  5F04 A;  5FKM A;  1DUX C;  1VQ5 I;  5D8L B;  4A2U A;  1FYL A;  5LRR A;  1QZZ A;  1Z7U A;  2E2J J;  3O8G A;  3I4M J;  4U7D A;  1Z7L A;  2V6C A;  2E1C A;  1XPX A;  2JWT A;  1O3T A;  4IZZ A;  5IP7 J;  3ECO A;  5L3F A;  1AOY A;  4E7L A;  5TIS C;  5EEA A;  2VBX A;  5FD5 A;  3ZMZ A;  2LP0 A;  3FBI B;  3TW7 A;  4AIH A;  4R79 A;  2D5V A;  2VXZ A;  3HHH A;  5L3G A;  3PUB A;  4E7S A;  4B3X A;  4MGR A;  1P6R A;  3OYF A;  4P9F A;  5IY5 H;  1PYV A;  4PZJ A;  2PFB A;  2NVX J;  1T08 B;  1QVT A;  5J3L A;  5EG0 B;  2ZJP F;  3LQQ A;  5HNH A;  1SD6 A;  3HXL A;  2DK8 A;  2TDX A;  3COA C;  1GV2 A;  1O7F A;  4HW0 A;  1IN6 A;  4OAY A;  5E3L A;  4ZTF A;  3P7N A;  1LDD A;  4OIQ F;  4Q4Z F;  3HOX J;  1LB2 A;  4PJJ A;  1EH6 A;  4M3F A;  2L7K A;  3I56 I;  1BOB A;  1F36 A;  1MGT A;  2NS0 A;  3WE2 A;  2F5C A;  3HUG A;  3RJP A;  1UMQ A;  2HQA A;  5HDK A;  4S05 A;  4HAM A;  1MJB A;  1D0X A;  2K9Q A;  2RV8 A;  4BJ5 C;  1ZG5 A;  3CCL I;  3RIR A;  1P4X A;  3W6J B;  2W7N A;  4F93 B;  3DLL F;  4ZTJ A;  1PDN C;  2BY0 A;  5ED4 A;  1LFB A;  1E2X A;  4E7H A;  3S2D J;  2PJR B;  3CF2 A;  3CUQ C;  2WTE A;  4M73 A;  2XKO A;  4XLE A;  4BHC A;  2LF8 A;  4E7I A;  3CES A;  5C4X J;  2HVQ A;  4BU2 A;  2ZXH A;  2JA5 J;  2VAS A;  1YX5 A;  1BIA A;  4L9N A;  3VDX A;  2GM4 A;  2JT1 A;  1BW6 A;  5BOX A;  4OWR B;  1Y1V J;  4TV7 A;  2DTZ A;  3R4K A;  3HRS A;  4RA2 A;  1REP C;  1R49 A;  4JK1 X;  4LG0 B;  2L5Q A;  4V2G A;  2ZXJ A;  3BPX A;  3D0S A;  2PBI A;  5K7H A;  3ULQ B;  4RMN A;  2W82 A;  3IV5 A;  3K9T A;  4Y13 A;  4D0P A;  2P8T A;  3K6G A;  1Z3X A;  3RQI A;  1FTT A;  2OV7 A;  1Q1H A;  3JCU C;  2QZ8 A;  2MH2 A;  2BBY A;  2DOE A;  3KEY A;  1H88 C;  2KRC A;  2R7Z J;  2BOL A;  2RQQ A;  4FE7 A;  5HS7 A;  3E5X A;  5EG0 A;  5M5Y J;  1E3H A;  3A0B C;  1YW7 A;  2BXZ A;  2LDU A;  3DEE A;  4W97 A;  4HG2 A;  5GP9 A;  1DGR M;  2K9N A;  1BW5 A;  2E34 A;  2CG4 A;  1FEX A;  2RVC A;  2Y9Y A;  1IV8 A;  3IH3 A;  4XKV A;  5J6X A;  3OYG A;  1W36 C;  4BEH B;  2VOD A;  2R7R A;  5KVR A;  2R7T A;  2NNY A;  1A04 A;  3H35 A;  1S7O A;  3CC2 I;  4OMY A;  2W25 A;  4FX4 A;  3EUH A;  4A3G J;  3F8F A;  2HXI A;  2PJR A;  2QKM B;  3PQJ A;  1W36 D;  1TBX A;  3DTK A;  1Z1D A;  1FBQ A;  2MAB A;  1A5J A;  2YR2 A;  4B43 A;  4KJZ A;  1ZRC A;  1C0W A;  3GTP J;  3OYI A;  1F5T A;  2CW8 A;  3ABM H;  4M9S A;  1R1U A;  3KZY A;  2A61 A;  3C1D A;  3MFK A;  3QYE A;  4G6T B;  1KON A;  2HKX A;  4LG0 A;  3QPL A;  4M3G A;  1KQ0 A;  4Y52 J;  4MQV A;  3ZMS A;  3FMS A;  1P7J A;  2HZD A;  2O0Y A;  4UVC A;  3JAM K;  1OPC A;  2F5F A;  3FXU A;  2R92 J;  2PJP A;  5IYC J;  2XRN A;  2VQH A;  4A3B J;  2BY3 A;  2FOK A;  2HXO A;  2MSY A;  4S0H B;  1WJD A;  3ABT A;  3E6B A;  4H4K C;  2CJJ A;  1TWC J;  2DYS H;  2EZH A;  2M45 A;  4AC0 A;  1W0T A;  2H8R A;  1L0O C;  1ZHF A;  2K4J A;  5F27 A;  1U9N A;  5E1X A;  3S1R J;  3SFI A;  2V9K A;  4MO7 A;  2VE8 A;  5JR3 A;  2QGU A;  2G7H A;  5DD4 A;  4D1Q A;  4XOP A;  2HOA A;  1A6I A;  3E97 A;  1U6G A;  2KT0 A;  4BEH A;  4ZDL A;  1FOY A;  4OIO F;  4JX5 A;  5GAG J;  2D1H A;  2P0W A;  2EK5 A;  3A4C A;  2KRH A;  4FQG A;  1QQI A;  4MEX F;  4HV5 A;  2P7C B;  4HEA 2;  2L9R A;  1TT0 A;  4NHJ A;  3Q9V A;  4FT8 A;  4AYB N;  2VC0 A;  5IPA A;  5K5O A;  5IYB J;  4RBO A;  3C2H A;  3BQZ A;  4WXD A;  5F1R A;  1S3J A;  4HX8 A;  2P5K A;  1G4D A;  4IOA F;  1X1P A;  1WI9 A;  1R4M B;  4AYB A;  4F3Q A;  2ZJQ F;  4M9X A;  3RTR A;  2O8K A;  4ZYA A;  2CWE A;  2PX9 A;  3KX2 A;  1FIP A;  4RB0 A;  5HLI A;  4A3D J;  1D0Y A;  4MTE A;  1HDP A;  4NQW B;  4Q48 A;  4D5C A;  3T5X A;  2IA2 A;  3M4O J;  1BIB A;  2YS9 A;  5FLX Z;  3WTW C;  3JRD A;  5E17 F;  3TED A;  2XC7 A;  4QSH A;  5J1R A;  3GLX A;  1ZR4 A;  3T8T A;  2ZME B;  4E7J A;  3UNG C;  1LDK B;  4XK4 A;  4V2F A;  5LRS A;  4XON A;  3CMY A;  3W6K B;  2ZXW H;  5D8K B;  3CC4 I;  1UJ8 A;  1VND A;  3A03 A;  3VYS B;  3L9F A;  5FB2 A;  1YG2 A;  2KP6 A;  1XGS A;  2ZC2 A;  1AU7 A;  3QYB A;  4XSX F;  1I6X A;  2IXS A;  2HDD A;  4ITV A;  1Y6I A;  4NUB A;  2QEN A;  3HGY A;  4EAT A;  4ESJ A;  4DOZ A;  4ZH4 F;  1LFP A;  3DU6 A;  3SFZ A;  3V4G A;  3OS0 A;  3K1P A;  2LFB A;  3BOQ A;  4AUX A;  1RIO H;  2FE3 A;  3DPL C;  3HKZ A;  1JJ8 C;  5GAH J;  1JKP C;  3BR6 A;  5HS8 A;  2DT7 B;  2CQ7 A;  5DDG A;  1OLT A;  2K9L A;  4ZYG A;  1UB9 A;  2HGC A;  3BT9 A;  1TL8 A;  4AU7 A;  2ECB A;  2P81 A;  2M5W A;  3KYC B;  3LSJ A;  3NWS A;  4V19 K;  5D4R A;  1GV5 A;  2FQ4 A;  5HLG A;  2PN6 A;  1VI0 A;  3UKG A;  1SFX A;  1DQU A;  2YU9 J;  1Z91 A;  5CVU A;  2VI6 A;  4RGS A;  5CJ9 A;  2NRA C;  4NC6 A;  1QNT A;  1R22 A;  4NQW A;  1WJB A;  4BE0 A;  3RYR A;  1FMW A;  1FC3 A;  3P9K A;  2VL8 A;  3LSM A;  1U3E M;  3DF8 A;  1TTY A;  2W00 A;  2ZME A;  1HKT A;  1R7J A;  4DIQ A;  4KMF A;  1XMK A;  3GEZ A;  3DTE A;  2J5O A;  2BVM A;  5DTD A;  1QRY A;  4KUM A;  1UAA A;  1BI3 A;  2BHY A;  3ZMT A;  4MFE A;  1YIT I;  4F7Z A;  3LA3 A;  3G73 A;  4KIC A;  4EMS A;  3KLN A;  5HVQ C;  5HLH A;  3J81 K;  5LEJ A;  4X0G A;  1XB4 A;  3IL2 A;  1FBS A;  1V4R A;  2PG4 A;  5M5W J;  5K1Y A;  3HOS A;  2O8X A;  3OYD A;  2N8G A;  3C3W A;  2BY2 A;  1HXD A;  4YFK F;  2NS7 A;  5DV5 A;  5D5V B;  3F72 A;  3SHF A;  3GTJ J;  1U9O A;  3KLO A;  5F08 A;  2DMU A;  1MNE A;  2F4O B;  2EIM H;  3M9A A;  3PUF A;  2R5Y B;  3H3U A;  5B3S H;  3WU2 C;  4AIJ A;  3FXO A;  5M3F J;  2QF7 A;  3ZQH A;  4F92 B;  3EPZ A;  5FRM A;  1DGW Y;  1UHM A;  2KZV A;  2WAQ A;  3GVA A;  5DYM A;  3MKZ A;  5BPI A;  1O3Q A;  5DUI A;  2Z33 A;  2F5D A;  4LLG F;  3RQ4 A;  3JTG A;  2DK5 A;  5IT9 Z;  2NVU B;  1ZLJ A;  2MGQ A;  4BXF A;  1V3F A;  2CUJ A;  4II3 A;  5E3O A;  2Z5U A;  2LK2 A;  4LOC A;  2WC2 A;  3NQO A;  2DFE A;  3H92 A;  2RN7 A;  1MZB A;  1HBX G;  3I5U A;  2IRF G;  4KIF A;  1ULY A;  2M8E A;  2LOO A;  2DA6 A;  2E36 A;  3R61 A;  2PQ8 A;  4XMY A;  4EM1 A;  1T8I A;  3HDD A;  2DAO A;  2XAJ A;  4Q5S F;  5K5R A;  2AHQ A;  4ZZD A;  1UST A;  4A0Y A;  5ICG A;  3AKZ A;  2QBY B;  3DQV C;  1BJA A;  3I4N J;  2W4S A;  3GZN B;  4N9I A;  4XN3 A;  2E1M C;  2IEK A;  5LHH A;  4LLN A;  1DP7 P;  2LY9 A;  3I54 A;  3PNV A;  4KA4 A;  3M1E A;  5CKT A;  1RPW A;  1Z0X A;  3K69 A;  3CCS I;  3W6V A;  3PL8 A;  4CZC A;  1EH8 A;  3ZRG A;  2RNJ A;  5LLQ A;  3ABK H;  3QOP A;  3BZK A;  1I6H J;  2OD5 A;  3OMY A;  2HFH A;  3MKL A;  1FJL A;  4RB3 C;  4RS8 A;  4F52 A;  1SMY F;  1WH5 A;  1IDZ A;  2IS6 A;  1OCO H;  4PGH A;  5FD6 A;  2DT5 A;  4PGG A;  4XKW A;  2Z2S B;  2KZG A;  4B09 A;  5LHI A;  4FX0 A;  4ENK A;  3Q9S A;  1IG7 A;  2R5Y A;  1W7P B;  1WQ2 A;  3ROU A;  5EF6 A;  4G6D A;  2KMU A;  4BY1 J;  3ZQG A;  5D6E A;  1ZG3 A;  2OQG A;  3DCF A;  4KNY A;  3S2H J;  2CQN A;  4NC8 A;  3HRM A;  1Y0U A;  2UXX A;  2K85 A;  2JZY A;  4M6X A;  1RKW A;  1MBJ A;  1WH7 A;  3H1C A;  4RAG A;  3I9V 2;  1P92 A;  2M30 A;  3VYR B;  2WA0 A;  2L4A A;  4DZP A;  1D0Z A;  4WK8 F;  3QQA A;  1GXQ A;  2GBY A;  4EVI A;  1OYW A;  3I55 I;  3L2R A;  2XSJ C;  4BS9 A;  2M4G A;  1T0F C;  4HDV A;  1QHG A;  3OL4 A;  1JUM A;  1TNT A;  5EJC A;  3R6S A;  4XOT A;  1FOK A;  2J5P A;  2NNN A;  3JSO A;  3O6B B;  3LQR A;  4UV9 A;  3CCY A;  4CYC B;  2QBY A;  2R7U A;  1VFC A;  5B66 C;  1MMN A;  3W2W A;  4HBL A;  3F8C A;  4PJM A;  4X1E A;  2P5L C;  4CSW A;  1ETV A;  1W5T A;  3JRC A;  2XGD A;  2AQF A;  3OYC A;  4GDF A;  3FXQ A;  3OOU A;  1RUN A;  5F1J A;  1YW8 A;  1S7A A;  4ZJZ A;  4H0E A;  1HLV A;  1ITY A;  3S16 J;  4M6V A;  4J00 A;  2EV0 A;  2IGK A;  4WWC A;  1RC9 A;  3T1B A;  1D3Y A;  3BJA A;  2BY1 A;  1S5L C;  2F5V A;  2HKO A;  2M7B A;  2ZFU A;  2F5E A;  1BC7 C;  2L3D A;  2K4B A;  2OUM A;  2CRG A;  5E18 F;  1JI8 A;  4RM3 A;  1W7P A;  3PIO F;  2WB1 N;  1XD7 A;  4LD5 A;  4YFN F;  5CVJ A;  4Y33 A;  1I27 A;  1VTN C;  1K79 A;  3IWF A;  3LSG A;  4M9Z A;  4BL0 B;  3G3Z A;  3PO2 J;  1OYY A;  1G3W A;  1T98 A;  3WGI A;  3P5J A;  4LGW A;  2PMH A;  4A6E A;  3HM5 A;  2HQ5 A;  1ZEL A;  2EQR A;  1WWX A;  2PMZ N;  3BR3 A;  4N4N B;  4A3J J;  1BR2 A;  3A1Y A;  2AXT C;  2ME6 A;  4PUS A;  1AKH B;  5C3E J;  2O6G E;  2R7X A;  1Y56 A;  1R5H A;  1J2X A;  1X3W B;  1MNM C;  5GPC A;  5D6F A;  2KDO A;  2QM3 A;  1R1T A;  4UUT A;  4D5F A;  2DA7 A;  4XLH A;  4B4C A;  2Z1D A;  1Y1W J;  1K78 B;  3DKX A;  1FBU A;  1XCV A;  1FZP B;  2OTJ I;  3U21 A;  4CYC A;  1H89 C;  2O61 A;  3UR3 C;  2EV5 A;  5IYD J;  4PJL A;  3OOP A;  3MVP A;  3TP0 A;  2HYJ A;  1LPQ A;  3BJO A;  4EJU A;  3H9Q A;  3RDI A;  3N05 A;  4EV0 A;  2IJL A;  4XRM A;  4YRV A;  4O3M A;  2L54 A;  1DPR A;  4N0B A;  4RM2 A;  4Z6Y A;  4AM3 A;  2WAF A;  2X6W A;  2K40 A;  4JX6 A;  2Q0O A;  3ZN1 A;  3Q0V A;  4K2E A;  1P7I A;  2B9S A;  3S1N J;  2QVO A;  3QYF A;  4N4O B;  2O3F A;  2ESN A;  1RES A;  5AIP A;  1IDY A;  1VQ6 I;  4MEY F;  4WXC A;  1SD5 A;  1FOW A;  3V7R A;  3E1S A;  4BQN A;  1SVL A;  4I01 A;  1S72 I;  4HF1 A;  3GO5 A;  2A5W A;  4A3F J;  4BY7 J;  4EM0 B;  3BR0 A;  2V1U A;  5DCF A;  4JP0 A;  1NG7 A;  1FYK A;  1AKH A;  3CJN A;  2VJI A;  3VYT B;  1HW1 A;  3V8K A;  2W24 A;  3OIO A;  1YX3 A;  2JVH A;  2L2O A;  1WJE A;  3MD2 A;  4YEL A;  2OA4 A;  3SZT A;  3KIO A;  1K78 A;  3E5Q A;  2K9S A;  3WG7 H;  4FIS A;  3G2B A;  1ZGA A;  3RPU D;  3LL7 A;  3K4J A;  1FPQ A;  1U0J A;  2WV0 A;  1LQ1 A;  2FBK A;  1JHH A;  1IZ1 A;  3GTG J;  1B1B A;  3GYH X;  3S17 J;  4FHT A;  3GTM J;  3F8B A;  1N25 A;  1K7A A;  3BP8 A;  4LIU A;  4HYE A;  2KL4 A;  3SDB A;  2G7U A;  3ZQ7 A;  4DZJ A;  2HYF A;  4R8H A;  4HST A;  3S32 A;  1N77 A;  2CO5 A;  3MQ0 A;  4ENN A;  3FM3 A;  2NOJ B;  3H0D A;  3BTL A;  4ZC3 A;  1Z05 A;  1UZC A;  3DKW A;  4XM3 A;  4HNT A;  2TRT A;  1TLH B;  4LMY A;  3K4B A;  1P4A A;  4IHS A;  2K3F A;  2KHM A;  3RZD J;  1YQA A;  2DLL A;  5ILV A;  3BY6 A;  2GZW A;  4UB8 C;  4P5O A;  3ZQC A;  3N4M A;  1D1C A;  5E79 C;  3A02 A;  3O3K A;  1A31 A;  3JAM Z;  4CUG A;  1T6S A;  2I10 A;  3DWL E;  2K86 A;  2OZ6 A;  2JRT A;  3L00 A;  3MMY B;  2KJB A;  1OCT C;  3LFU A;  3FX3 A;  3JR9 A;  4XLF A;  1TWH J;  3BG6 A;  2VUM J;  3HPG A;  3A01 B;  4GXO A;  1LEB A;  3RKW A;  2CQX A;  4IQ4 A;  4UNO A;  3ZMV A;  5DM7 F;  2K5C A;  3FXM A;  3U1K A;  4KT5 C;  4QIW N;  2XAG A;  5EDN A;  4KIS A;  4XKC A;  3SJM A;  1QA6 A;  3IRR A;  2XPU A;  2VE9 A;  4XN0 A;  3H0G J;  3D5R C;  3JRF A;  1ZH5 A;  2A6H F;  2CSO A;  2DPU A;  3R60 A;  4A6D A;  1BJZ A;  2XIG A;  3K1M A;  4PJN A;  1IRZ A;  4U7B A;  3V8J A;  2ME0 A;  3VYU B;  1H0M A;  1E17 A;  1JUP A;  1BR1 A;  1FSE A;  4E4H A;  2LRE A;  1MIJ A;  3AG2 H;  3SEZ A;  5BPD A;  3I3L A;  1R00 A;  2Y0S A;  2YX7 A;  3M8J A;  3G4S I;  1NK2 P;  1MBG A;  3G1O A;  2HDC A;  3AL0 B;  3TBI A;  1ZYR F;  2XDV A;  1DPU A;  1S29 A;  1KZH A;  1RNL A;  1M1E B;  3TO7 A;  1ETY A;  3RSN A;  5J8F A;  4IVN A;  3AFH A;  1SVO A;  3F23 A;  3G71 I;  1VF9 A;  2LY1 A;  1LVK A;  2UV1 A;  2WAE A;  2DCE A;  4WCG A;  4C2M J;  1HDD C;  1XC5 A;  2V1D A;  1I50 J;  2L9N A;  2NOG A;  3FKI J;  2M34 A;  1JKQ C;  3RCO A;  3D1N I;  3EUH C;  4IRI A;  4XLC A;  1XDU A;  2IW5 A;  2YU3 A;  2DDB A;  4ZZL A;  1YJN I;  3HYI A;  1QU3 A;  2FOW A;  1TQI A;  2XAQ A;  4GYI A;  3BTC A;  2NAZ A;  3CP2 A;  3QPS A;  1BC8 C;  1BOA A;  5JI6 A;  3A01 A;  4OMZ A;  5KAI C;  4S04 A;  5CQE A;  4CCK A;  1S6L A;  1TNS A;  2ELH A;  2NVY J;  2EB7 A;  2L9V A;  2GQQ A;  2WBM A;  1XSX A;  4PDK A;  2CUF A;  5FKK A;  4XKB A;  1V54 H;  4KN4 X;  1FTZ A;  3S1Q J;  5FRN A;  4Y7N J;  1LFU P;  1KYW A;  3PSF A;  4PSW A;  5LHG A;  1D8J A;  3X2Q H;  4RGR A;  2EIJ H;  2ZO4 A;  2OTL I;  3RI4 A;  2A05 A;  5EEG A;  3TW6 A;  3CCM I;  4O6J A;  1UHW A;  1U78 A;  4CA0 A;  1LEA A;  5K7Z A;  1DDN A;  3S2W A;  1J09 A;  3FZV A;  2HVS A;  2VIX A;  1K4T A;  3MN2 A;  1PVE A;  3JSP A;  1B72 B;  4QWQ A;  1YJ9 I;  3KEO A;  1V5F A;  1GUU A;  5CLS A;  4DQ2 A;  2IA1 A;  1Z6R A;  4YII A;  2HQR A;  4RGX A;  1IRG A;  2E1O A;  4GGG A;  1SD4 A;  5EGO B;  4U0W A;  1ON1 A;  1R6R A;  5EZH A;  4XID A;  2AXL A;  1ONV A;  1TT5 B;  3SEQ A;  2JTV A;  5FGM A;  2G9W A;  1KU7 A;  1STZ A;  3ABL H;  5FKO A;  4XRS G;  2Y2Z A;  4GFB A;  3SDG A;  5JFR A;  1R36 A;  2LTP A;  2O03 A;  3AAF A;  2E35 A;  1QPM A;  3KPH A;  5GPA A;  3G1M A;  5M5X J;  4AVP A;  3BR5 A;  5D5W B;  4M72 A;  1MBF A;  1E3P A;  3BG9 A;  1G2H A;  1ETQ A;  4CGZ A;  1I1S A;  1HSJ A;  1QO0 D;  5IOY A;  2F4M B;  3B6A A;  4P96 A;  5DD8 A;  3REO A;  4ASN A;  4KIT B;  3F6O A;  1ZK8 A;  3E7L A;  1ZKG A;  3N97 A;  4DBQ A;  1H9G A;  2JSC A;  3OIP A;  4BQQ A;  2GXA A;  1TW2 A;  3F0C A;  4HF0 A;  1U5T B;  3K4L A;  2XRO A;  2ZXI A;  3J81 Z;  2LKX A;  3BQY A;  1T38 A;  2IS4 A;  5J8C A;  3NWT A;  1MSE C;  2FF4 A;  2HQN A;  1ETX A;  2EZL A;  3ESW B;  5CQG A;  4YEJ A;  4ESF A;  1OQY A;  4HX7 A;  3H3Z A;  3JRB A;  2OCC H;  2OJE D;  9ANT A;  4PFP A;  4IL6 C;  2X51 A;  1H9T A;  2XPV A;  3HSR A;  1B72 A;  2DDA A;  2VT2 A;  2YUS A;  1KGS A;  1KU9 A;  2B0L A;  2D2W A;  2DA2 A;  1G3Y A;  3GTQ J;  2OBP A;  2CFX A;  1ZAO A;  3GLL A;  4EM2 A;  2OU2 A;  4IRG A;  2VJ5 A;  2ZB9 A;  3EYY A;  2STW A;  1ORK A;  4QLC U;  4E7K A;  1TQM A;  2ZBK A;  3WG9 A;  2QSG X;  3IH2 A;  4OU0 A;  5EGO A;  3K2A A;  3WTV C;  2EFN A;  4M3E A;  2JRM A;  4KMU X;  4A5M A;  1O4X A;  3V7C A;  3IWZ A;  3KP7 A;  4RB1 A;  4MFD A;  2LC2 A;  2X9D A;  5IP9 J;  2VKD A;  1D1B A;  2CUE A;  5EEH A;  1NG6 A;  4HDU A;  2QLZ A;  2RKH A;  1XX5 A;  2ADU A;  3ZOB A;  1TWG J;  1W5S A;  5LEK A;  4IHY A;  4BUP A;  2E5Z A;  1EKE A;  3ZR8 X;  2DA1 A;  1VQO I;  2BEO A;  1MH3 A;  5ERI A;  3RKX A;  2LRD A;  2P6S A;  3HKZ N;  4CCJ A;  4D7M A;  2UWM A;  2R93 J;  1LVA A;  1J0R A;  2EZI A;  5LGT A;  1WPK A;  2ISZ A;  2X1E A;  2QWW A;  3L7W A;  1YJW I;  2OPT A;  2ACJ A;  1U5T A;  3EUK L;  2XB0 X;  3H36 A;  4RLF A;  4A0Z A;  2OCE A;  3AG1 H;  3PQK A;  1GDT A;  1X1A A;  3QOE A;  1ETW A;  3OY9 A;  3MAJ A;  1HKQ A;  2CW7 A;  2EBI A;  3MKW B;  3AG4 H;  2VBW A;  1J7K A;  2CUZ A;  2ZME C;  4GYG A;  3OSF A;  2MLG A;  2RGV A;  1TWF J;  3CF5 F;  1QPI A;  4MNU A;  2CS3 A;  1JGG A;  5HLT A;  1YO5 C;  4A3K J;  3VB2 A;  4LIT A;  2PLY A;  4IJA A;  4AVZ A;  1WKM A;  4BBR J;  1IC8 A;  3OYK A;  4A5N A;  4L5J A;  2XUB A;  3K4M A;  2D1V A;  5K5Q A;  1YE9 A;  1JT0 A;  2XRL A;  3VFZ A;  1GVD A;  5C4J J;  2IAI A;  2Y30 A;  3GCM A;  1YIJ I;  3ZPL A;  5J47 A;  3IKT A;  3MZH A;  3ZQL A;  2ZJ2 A;  3EET A;  4ON0 A;  2OQR A;  3LSP A;  2CMP A;  4EGY A;  2Y9Z A;  4CIC A;  2Z99 A;  4UUS B;  1K6Y A;  1OMI A;  2DA3 A;  2EFQ A;  1RR8 C;  3WTS C;  1OR7 A;  1BI2 A;  1X1B A;  2LMD A;  5LBQ A;  1ERD A;  3S8P A;  1Y0N A;  2EV6 A;  1O57 A;  1G6N A;  3CD6 I;  4UY8 I; 
#chains in the Genus database with same CATH homology
 2FRH A;  1RI7 A;  2STT A;  3BPV A;  2VBY A;  4RAZ A;  5F64 A;  1FX7 A;  1IAW A;  3VOE A;  2FNA A;  2CYY A;  2HOE A;  4L9V A;  2AS5 F;  1QBJ A;  1CGP A;  2COM A;  5CVR A;  4IXA A;  2QQ9 A;  2YPR A;  1HQC A;  2DW4 A;  1ZRE A;  2XGX A;  2A07 F;  3FM5 A;  2DPD A;  5JVT A;  5A2Q K;  1ZRF A;  1J5Y A;  2HZT A;  3HHG A;  2K27 A;  4GO1 A;  1Z6T A;  1R58 A;  1UFM A;  2MH9 A;  1D5V A;  2KIF A;  3BJ6 A;  5KK1 A;  3BZ6 A;  2HS5 A;  3WU0 A;  2XHK A;  3DEU A;  3DPT A;  1IXS B;  2KIU A;  3V8L A;  3KEQ A;  1JGS A;  4G94 A;  3BDD A;  3I4P A;  2FML A;  1TQP A;  3M7G A;  4BHP A;  1GHC A;  4EJO A;  1FYM A;  5CVV A;  2XV4 S;  4I7H A;  4M74 A;  5L3E A;  1J9I A;  4I0B A;  2IVM A;  3I58 A;  2FBH A;  4E70 A;  3I0T A;  1FWZ A;  2ESH A;  4L9T A;  2XKP A;  3SZP A;  3QP5 A;  2Q2E A;  1YYV A;  4KIB A;  4CDG A;  3LFK A;  3BWG A;  3IKV A;  4EJT A;  4RB2 C;  3TQN A;  2FMY A;  2GA1 A;  3WU1 B;  2H6C A;  4CHU A;  2LNB A;  5AON A;  4BHB A;  1JXS A;  2BYV E;  1FSH A;  4ZYH A;  1IXR C;  3ELK A;  2KIM A;  5BMZ A;  4KYW A;  1W7P D;  4B8X A;  4OIP F;  2BE5 F;  5DCM B;  1HST A;  4Z2Y A;  3J80 Z;  4HQE A;  1XMA A;  2M87 A;  1MKM A;  1S8N A;  4XLP F;  2VBZ A;  2DQL A;  2P4W A;  5IT9 K;  1Z9C A;  4UVA A;  1FP1 D;  3KP5 A;  1G3S A;  5HS9 A;  3C7J A;  1ODD A;  1PP8 F;  3LST A;  2MLK A;  5TRD A;  1BI0 A;  4G7O F;  1OYI A;  3TKY A;  1XSV A;  2DQR A;  3LAJ A;  3GFL A;  1F4K A;  3KP3 A;  4KN7 X;  2FEZ A;  2PEX A;  2L4M A;  1YIO A;  2QQB A;  1SD7 A;  4AIK A;  2KKO A;  2GAU A;  1D8K A;  4RAY A;  2UZK A;  5D4S A;  2P5V A;  5DCM A;  4I98 B;  3P9I A;  1R1V A;  1BI1 A;  4WXH A;  1IRF A;  2DTR A;  4XBF A;  3P9C A;  1HW2 A;  2ETH A;  4LK1 F;  2ISY A;  3HTU A;  3ZMD A;  3SXY A;  3RYP A;  3ABU A;  3CTA A;  1R5G A;  2FBI A;  4OIR F;  2MA3 A;  3F22 A;  5D5U B;  5H6R A;  3QRF F;  4G8X A;  1U2W A;  5H6Q A;  1PUE E;  4BXU A;  3KP2 A;  2ZFW A;  2GXG A;  3M8F A;  6PAX A;  1U8R A;  4P9U A;  1B6A A;  4XSZ F;  2FXA A;  3RPU A;  3JW4 A;  3E6M A;  5DUK A;  3SQN A;  1KU3 A;  4BQA A;  3U9G A;  4BAY A;  2UXN A;  2A6E F;  5HDG A;  4L0Z B;  4HLY A;  4LK0 F;  2ZCW A;  1T39 A;  4NB5 A;  4EGZ A;  5ILS A;  4BYY A;  3GXO A;  1FNN A;  3NEU A;  4UV8 A;  1O3R A;  2C6Y A;  3CUQ B;  2FA5 A;  1G3T A;  2XVC A;  5CYV A;  3BRO A;  4KDP A;  4UUV A;  2ZKZ A;  4HA8 A;  3WGH A;  4EQQ A;  2VN2 A;  1ZRD A;  2YSR A;  3B73 A;  1WSU A;  3FXR A;  4O5V A;  4U88 A;  1B9N A;  3DXJ F;  2Y75 A;  1GXP A;  4LB5 A;  1NHA A;  4L9J A;  3CO7 C;  2VC1 A;  5FFX A;  5FFZ A;  2EFO A;  5DEQ A;  3K0L A;  1MDM B;  1LNW A;  1OKR A;  1YLF A;  2V9V A;  3TDZ C;  3F3X A;  2KRF A;  4L0Y B;  3TOA A;  2L01 A;  2IP2 A;  2RC4 A;  3MCZ A;  1O3S A;  2HTS A;  5H20 A;  2A69 F;  3GFJ A;  3R0J A;  1PP7 U;  3CUQ A;  1XN7 A;  1R23 A;  1B4A A;  2DBB A;  1P4W A;  1T2K A;  3LAP A;  1W4M A;  3KCC A;  3HOT A;  1QGP A;  1F9N A;  5E1Z B;  3CDH A;  4ESB A;  2EFW A;  3ERE D;  3GUD A;  4CZZ A;  2ZNY A;  4IRH A;  1YFH A;  2H09 A;  2IA0 A;  2DU9 A;  3ML6 A;  2W84 A;  3VEP A;  1ZN2 A;  3QP6 A;  2JPB A;  1MDM A;  1IN8 A;  2R7D A;  3TO6 A;  3GX4 X;  3DFG A;  2VOP A;  1YTY A;  2XAF A;  2QUF A;  1XGM A;  3FF5 A;  3ZP5 A;  4MHG A;  2E7W A;  3K1N A;  3JTH A;  1P2F A;  1TW3 A;  2VON A;  2HR3 A;  4L18 B;  2V79 A;  4LB6 B;  1WRJ A;  2Y0M A;  1EH7 A;  1SMT A;  5AIQ A;  1I1G A;  2MC3 A;  3E5U A;  1X3U A;  3LA7 A;  4RGU A;  4UXN A;  5ICE A;  4Y15 A;  4P55 A;  1CF7 B;  2HYG D;  2R7F A;  1JHF A;  2Z9O A;  1XDS A;  2GWR A;  3KET A;  4U0Y A;  3TGN A;  2H6B A;  1IN5 A;  4IPA A;  3I53 A;  3HIF A;  2X4H A;  3Q5F A;  2E7X A;  2GIV A;  4UVB A;  1HKS A;  3IHU A;  4OOI A;  3U2R A;  1O7L A;  2Q8K A;  1XGO A;  2QQA A;  2EA2 A;  1U5T C;  3ZN0 A;  2L02 A;  5A2Q Z;  4HLX A;  2D45 A;  1RUO A;  1IN7 A;  3QAH A;  1IW7 F;  4LFU A;  4YIF A;  3HRT A;  4HX4 A;  1UCR A;  2FQ3 A;  1YS7 A;  3I59 B;  4HZF A;  1CF7 A;  4A12 A;  3TDU C;  5LGU A;  3NRV A;  4CYD A;  1LDJ A;  3KP6 A;  4KFC A;  2BGC A;  1XGN A;  4Q47 A;  2V1X A;  1ZG1 A;  2YX4 A;  4HOB A;  1SFU A;  2E1N A;  3EQL F;  4YFX F;  4A0X A;  3F8N A;  1L3L A;  1USS A;  5FO5 A;  3HRU A;  4EJV A;  3GZ6 A;  2HWV A;  3QPT A;  2WWY A;  2XAH A;  3R0A A;  2JPC A;  2VT3 A;  2QYO A;  1XCB A;  1FLI A;  4LLL A;  5JHU A;  2LKP A;  4AD9 A;  2P7V B;  2BV6 A;  2PI0 A;  3IRQ A;  4ENM A;  2K02 A;  3O2P E;  3K2Z A;  1FT9 A;  5L3B A;  4WF2 A;  2ZNZ A;  2OZU A;  3F21 A;  4PCQ A;  2A68 F;  2Y48 A;  4OIN F;  4WX9 A;  3I59 A;  3MZY A;  5E8I A;  1I5Z A;  1LJ9 A;  5TJJ A;  1SAX A;  2LF7 A;  3MWM A;  3GFI A;  3CO6 C;  4IHT A;  3F8M A;  3WTU C;  2RDP A;  4G7Z F;  5BS6 A;  5FLX K;  4Y17 A;  5HOO A;  4CO8 A;  2HTJ A;  5ICF A;  4G6Q A;  3RKY A;  1HW5 A;  3HSF A;  3M8E A;  1FP2 A;  2X0L A;  3CUO A;  2Z3Y A;  3FMR A;  3J7A O;  4M71 A;  3DP7 A;  1QZY A;  1AWC A;  4XLN F;  4JQF A;  4XRF A;  3GFM A;  3GWZ A;  1XSD A;  1KA8 A;  3WGG A;  2K7L A;  3E6D A;  2FSW A;  4AWX B;  4JBA A;  5L3D A;  2FNP A;  3QU6 A;  4R1H A;  4HF2 A;  1B9M A;  2R3S A;  4I2O A;  1IF1 A;  3PFI A;  2W85 A;  5L3C A;  4UHT A;  3E6C C;  4G7H F;  1KQ8 A;  1IN4 A;  3KE2 A;  3KP4 A;  3C18 A;  3F6V A;  1RZ4 A;  2F2E A;  2MBF A;  3V7S A;  2FU4 A;  3WTX C;  4ZYD A;  3GF2 A;  2RQP A;  3D5L A;  4M6Y A;  1J75 A;  1ZLK A;  3LA2 A;  2DFI A;  1JE8 A;  2A5Y B;  3I71 A;  3GZ5 A;  3TOB A;  4CXF A;  4ZYE A;  1KYZ A;  3ISP A;  1GVJ A;  3LWF A;  4L5I A;  2HEO A;  1MJ9 A;  1BBY A;  4DNC A;  1T0F A;  4IF4 A;  3OV8 A;  1ON2 A;  3GW2 A;  5IT3 A;  4MTD A;  3WTY C;  3QU3 A;  3KZZ A;  4I09 A;  5E20 A;  5E8G A;  2LSO A;  3E3V A;  3ECH A;  1KQ9 A;  5HDN A;  2NYX A;  3EDP A;  3DV8 A;  2EJR A;  2EA4 A;  2DI3 A;  3HTS B;  3VOD A;  1J59 A;  4EJW A;  3B02 A;  3T0Y A;  3MEX A;  1IXC A;  5BQT A;  1ZAR A;  2EWN A;  4HQM A;  3U1D A;  4BH9 A;  2VOO A;  2CGP A;  3KFW X;  2GXB A;  5F6F A;  2IT0 A;  1BM9 A;  2H27 A;  5ICC A;  4LJZ F;  4G9Y A;  1MJA A;  3I64 A;  2EFP A;  3L09 A;  1KU2 A;  3WTT C;  1YS6 A;  2KJC A;  2MD5 A;  1K6O A;  1F1Z A;  4YG2 F;  4U0V A;  1IUY A;  3FWE A;  4BNC A;  4KIG A;  4GCV A;  4ENJ A;  1BN5 A;  1EV7 A;  3FMQ A;  3RPQ A;  5LGN A;  1MD0 A;  5ILU A;  2W57 A;  2XAS A;  3T8R A;  3WE3 A;  3IC7 A;  5D5X B;  4MQ9 F;  2PMU A;  3FHZ A;  4I0A A;  4I02 A;  2M1B A;  3TO9 A;  3HSE A;  5CVI A;  1SFE A;  2GA2 A;  2OAZ A;  4N9H A;  1B59 A;  2DO7 A;  2A3S A;  2CQK A;  2CW0 F;  2P6T A;  4HV6 A;  3L2C A;  3CLO A;  3QPH A;  3WTZ A;  1YW9 A;  4ETS A;  3EYI A;  5E1W A;  2IPQ X;  1ZGJ A;  3ZMU A;  3WOD F;  2H94 A;  1FY7 A;  3J80 K;  1DUX C;  5D8L B;  4A2U A;  1FYL A;  5LRR A;  1QZZ A;  1Z7U A;  4U7D A;  2V6C A;  2E1C A;  1O3T A;  3ECO A;  5L3F A;  1AOY A;  2VBX A;  5FD5 A;  3ZMZ A;  4R79 A;  4AIH A;  4UNO A;  2VXZ A;  3HHH A;  5L3G A;  4MGR A;  1P6R A;  4P9F A;  4PZJ A;  2PFB A;  3LQQ A;  1SD6 A;  2DK8 A;  2TDX A;  3COA C;  1O7F A;  4HW0 A;  1IN6 A;  3P7N A;  1LDD A;  4OIQ F;  4Q4Z F;  1LB2 A;  1EH6 A;  1MGT A;  2NS0 A;  3WE2 A;  2F5C A;  3HUG A;  3RJP A;  5HDK A;  4S05 A;  4HAM A;  1MJB A;  2RV8 A;  1ZG5 A;  3RIR A;  1P4X A;  3W6J B;  1PDN C;  4Q5S F;  5ED4 A;  1E2X A;  3CUQ C;  2WTE A;  4M73 A;  2XKO A;  4BHC A;  2LF8 A;  4L9N A;  1BIA A;  2JT1 A;  5BOX A;  4TV7 A;  3R4K A;  3HRS A;  1REP C;  4JK1 X;  4LG0 B;  2ZXJ A;  3BPX A;  3D0S A;  2PBI A;  3ULQ B;  3K9T A;  4Y13 A;  4D0P A;  2P8T A;  1Q1H A;  2QZ8 A;  2MH2 A;  2BBY A;  5HS7 A;  3E5X A;  1YW7 A;  2LDU A;  2CG4 A;  2RVC A;  5J6X A;  2VOD A;  5KVR A;  2NNY A;  1A04 A;  1S7O A;  4OMY A;  2W25 A;  4FX4 A;  3EUH A;  3F8F A;  3PQJ A;  1TBX A;  1Z1D A;  1FBQ A;  2YR2 A;  1ZRC A;  1C0W A;  1F5T A;  4M9S A;  1R1U A;  3KZY A;  2A61 A;  3C1D A;  3MFK A;  2HKX A;  4LG0 A;  1KQ0 A;  4MQV A;  3ZMS A;  3FMS A;  2O0Y A;  4UVC A;  3JAM K;  1OPC A;  2F5F A;  3FXU A;  2PJP A;  2XRN A;  2FOK A;  3ABT A;  3E6B A;  2M45 A;  1L0O C;  1ZHF A;  2K4J A;  5E1X A;  5JR3 A;  2VE8 A;  2G7H A;  5DD4 A;  3E97 A;  1U6G A;  4OIO F;  2D1H A;  2EK5 A;  1QQI A;  4MEX F;  4HV5 A;  2P7C B;  4NHJ A;  3Q9V A;  4FT8 A;  2VC0 A;  5K5O A;  4WXD A;  5F1R A;  1S3J A;  4HX8 A;  2P5K A;  1G4D A;  1WI9 A;  4M9X A;  3RTR A;  2CWE A;  4RB0 A;  5HLI A;  4MTE A;  4Q48 A;  3T5X A;  2IA2 A;  1BIB A;  5FLX Z;  3WTW C;  5E17 F;  3GLX A;  3T8T A;  2ZME B;  1LDK B;  5LRS A;  3W6K B;  5D8K B;  3L9F A;  5FB2 A;  1YG2 A;  1XGS A;  4XSX F;  1I6X A;  2QEN A;  4ESJ A;  4ZH4 F;  3SFZ A;  3V4G A;  3K1P A;  3BOQ A;  1RIO H;  2FE3 A;  3DPL C;  5HS8 A;  5DDG A;  4ZYG A;  1UB9 A;  2HGC A;  2M5W A;  5D4R A;  5HLG A;  2PN6 A;  1SFX A;  1Z91 A;  5CVU A;  4RGS A;  5CJ9 A;  2NRA C;  1QNT A;  1R22 A;  4NQW A;  3RYR A;  1FC3 A;  3P9K A;  1U3E M;  3DF8 A;  1TTY A;  2ZME A;  1HKT A;  1R7J A;  4KMF A;  1XMK A;  3GEZ A;  2J5O A;  4KUM A;  1BI3 A;  3ZMT A;  4F7Z A;  3LA3 A;  3G73 A;  4KIC A;  4EMS A;  3KLN A;  5HVQ C;  5HLH A;  3J81 K;  5LEJ A;  1XB4 A;  3IL2 A;  1FBS A;  1V4R A;  2PG4 A;  5K1Y A;  3HOS A;  2O8X A;  3C3W A;  1HXD A;  4YFK F;  5DV5 A;  5D5V B;  3F72 A;  3SHF A;  3KLO A;  3M9A A;  3H3U A;  4AIJ A;  1UHM A;  3GVA A;  5DYM A;  5BPI A;  1O3Q A;  2Z33 A;  5DUI A;  2F5D A;  4LLG F;  3JTG A;  2DK5 A;  5IT9 Z;  1ZLJ A;  1V3F A;  2Z5U A;  2WC2 A;  3NQO A;  3H92 A;  2RN7 A;  1MZB A;  1HBX G;  3I5U A;  2IRF G;  4KIF A;  1ULY A;  2M8E A;  3R61 A;  2PQ8 A;  4EM1 A;  2DAO A;  2XAJ A;  5K5R A;  4ZZD A;  1UST A;  4A0Y A;  5ICG A;  2QBY B;  3DQV C;  1BJA A;  4N9I A;  5LHH A;  4LLN A;  1DP7 P;  3I54 A;  4KA4 A;  3M1E A;  3K69 A;  1EH8 A;  2RNJ A;  5LLQ A;  3QOP A;  2OD5 A;  2HFH A;  4RB3 C;  4RS8 A;  1SMY F;  4PGH A;  5FD6 A;  2DT5 A;  4PGG A;  4B09 A;  5LHI A;  4FX0 A;  4ENK A;  3Q9S A;  1W7P B;  1WQ2 A;  3ROU A;  4G6D A;  5D6E A;  1ZG3 A;  2OQG A;  4KNY A;  3HRM A;  1Y0U A;  2UXX A;  2JZY A;  4M6X A;  1P92 A;  2M30 A;  2L4A A;  4WK8 F;  1GXQ A;  4EVI A;  1OYW A;  4HDV A;  1TNT A;  3R6S A;  1FOK A;  2J5P A;  2NNN A;  3JSO A;  3O6B B;  3LQR A;  4UV9 A;  2QBY A;  4HBL A;  3F8C A;  2P5L C;  1W5T A;  3FXQ A;  1RUN A;  1YW8 A;  1S7A A;  4H0E A;  2EV0 A;  4WWC A;  3T1B A;  1D3Y A;  3BJA A;  2HKO A;  2F5E A;  1BC7 C;  2L3D A;  2K4B A;  5E18 F;  1W7P A;  1XD7 A;  4LD5 A;  4YFN F;  5CVJ A;  1I27 A;  1VTN C;  1K79 A;  3IWF A;  4M9Z A;  3G3Z A;  1OYY A;  1G3W A;  1T98 A;  3WGI A;  4LGW A;  2PMH A;  4A6E A;  1WWX A;  2O6G E;  1R5H A;  1J2X A;  5D6F A;  2QM3 A;  1R1T A;  1K78 B;  1FBU A;  1XCV A;  1FZP B;  2O61 A;  2EV5 A;  3OOP A;  3BJO A;  4EJU A;  3RDI A;  4EV0 A;  2IJL A;  4O3M A;  2L54 A;  1DPR A;  4N0B A;  2Q0O A;  3ZN1 A;  4K2E A;  2QVO A;  2O3F A;  2ESN A;  5AIP A;  4MEY F;  4WXC A;  1SD5 A;  3V7R A;  4I01 A;  4HF1 A;  3GO5 A;  4EM0 B;  2V1U A;  5DCF A;  1FYK A;  3CJN A;  1HW1 A;  3V8K A;  2W24 A;  2OA4 A;  3SZT A;  1K78 A;  3E5Q A;  1ZGA A;  1FPQ A;  2WV0 A;  1LQ1 A;  2FBK A;  1JHH A;  1IZ1 A;  1B1B A;  3GYH X;  4FHT A;  3F8B A;  1K7A A;  3BP8 A;  4HYE A;  2G7U A;  3ZQ7 A;  2HYF A;  4R8H A;  2CO5 A;  3MQ0 A;  4ENN A;  3FM3 A;  1Z05 A;  3DKW A;  1TLH B;  4LMY A;  1P4A A;  4IHS A;  1YQA A;  2DLL A;  5ILV A;  3BY6 A;  2GZW A;  4P5O A;  3N4M A;  3O3K A;  3JAM Z;  1T6S A;  2K86 A;  2OZ6 A;  2JRT A;  3L00 A;  2KJB A;  3FX3 A;  4GXO A;  1LEB A;  3RKW A;  3ZMV A;  4KT5 C;  2XAG A;  3IRR A;  2VE9 A;  1ZH5 A;  2A6H F;  2CSO A;  2DPU A;  3R60 A;  4A6D A;  2XIG A;  3K1M A;  4U7B A;  3V8J A;  1E17 A;  1H0M A;  1FSE A;  5BPD A;  1R00 A;  2YX7 A;  2HDC A;  1ZYR F;  1DPU A;  1S29 A;  1RNL A;  3TO7 A;  5J8F A;  4IVN A;  3F23 A;  4WCG A;  2V1D A;  4IRI A;  1XDU A;  2IW5 A;  2YU3 A;  4ZZL A;  3HYI A;  1TQI A;  2XAQ A;  4GYI A;  2NAZ A;  1BC8 C;  1BOA A;  5JI6 A;  4OMZ A;  4S04 A;  1S6L A;  1TNS A;  2ELH A;  2EB7 A;  2GQQ A;  1XSX A;  4PDK A;  4KN4 X;  1KYW A;  1D8J A;  5LHG A;  4RGR A;  2ZO4 A;  3RI4 A;  5EEG A;  4O6J A;  1UHW A;  1U78 A;  1DDN A;  1LEA A;  3S2W A;  3FZV A;  3JSP A;  4QWQ A;  3KEO A;  5CLS A;  4DQ2 A;  2IA1 A;  1Z6R A;  4YII A;  2HQR A;  4RGX A;  1IRG A;  4GGG A;  1SD4 A;  4U0W A;  1ON1 A;  2AXL A;  1ONV A;  2JTV A;  5FGM A;  2G9W A;  1KU7 A;  1STZ A;  5JFR A;  1R36 A;  2O03 A;  3AAF A;  1QPM A;  4AVP A;  5D5W B;  4M72 A;  4CGZ A;  1I1S A;  1HSJ A;  1QO0 D;  4P96 A;  5DD8 A;  3REO A;  4ASN A;  3F6O A;  3N97 A;  1H9G A;  2JSC A;  1TW2 A;  4HF0 A;  1U5T B;  2XRO A;  3J81 Z;  1T38 A;  5J8C A;  2FF4 A;  2HQN A;  4ESF A;  4HX7 A;  3H3Z A;  1H9T A;  3HSR A;  2VT2 A;  1KGS A;  1KU9 A;  2B0L A;  2D2W A;  1G3Y A;  2OBP A;  2CFX A;  1ZAO A;  4EM2 A;  2OU2 A;  4IRG A;  3EYY A;  2STW A;  4QLC U;  1TQM A;  2ZBK A;  3WG9 A;  4OU0 A;  3WTV C;  2EFN A;  4KMU X;  4A5M A;  3V7C A;  3IWZ A;  3KP7 A;  4RB1 A;  5EEH A;  4HDU A;  2QLZ A;  2RKH A;  2ADU A;  1W5S A;  5LEK A;  2BEO A;  5ERI A;  3RKX A;  2P6S A;  2UWM A;  1LVA A;  1J0R A;  5LGT A;  2ISZ A;  2QWW A;  3L7W A;  2ACJ A;  1U5T A;  4A0Z A;  3PQK A;  3MAJ A;  1HKQ A;  2VBW A;  1J7K A;  4GYG A;  2MLG A;  2RGV A;  4MNU A;  1YO5 C;  3VB2 A;  2PLY A;  4IJA A;  1WKM A;  4A5N A;  4L5J A;  2XUB A;  2D1V A;  5K5Q A;  3VFZ A;  3ZPL A;  3MZH A;  3IKT A;  2ZJ2 A;  3EET A;  4ON0 A;  2OQR A;  4EGY A;  4CIC A;  2Z99 A;  1OMI A;  2EFQ A;  3WTS C;  1OR7 A;  1BI2 A;  5LBQ A;  2EV6 A;  1O57 A;  1G6N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...