1I1SA

Solution structure of the transcriptional activation domain of the bacteriophage t4 protein mota
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
96
structure length
96
Chain Sequence
MSKVTYIIKASNDVLNEKTATILITIAKKDFITAAEVREVHPDLGNAVVNSNIGVLIKKGLVEKSGDGLIITGEAQDIISNAATLYAQENAPELLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the transcriptional activation domain of the bacteriophage T4 protein, MotA.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Transcription
molecule keywords MOTA
total genus 21
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2001-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09114 MotA_activ Transcription factor MotA, activation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1i1sA00
1QGPA 3HHGA 4G7HF 2M30A 4RGUA 5FFZA 1B1BA 4LLLA 4RGXA 2OA4A 3GXOA 3IKTA 3DXJF 3PQJA 5HLGA 5HS7A 3W6KB 2DK8A 3JSOA 1K79A 1CF7A 2YX4A 5FLXZ 3E5UA 1USSA 3MEXA 2RDPA 2IJLA 1IW7F 3CUOA 1FBUA 1H9TA 2NYXA 3FMSA 4GXOA 1BOAA 2WWYA 4HDUA 4A12A 3GX4X 1NHAA 4UHTA 2QQBA 2IVMA 1G3TA 2RGVA 1HBXG 5E17F 5DCMB 1TQPA 2H27A 3EYIA 2A3SA 3KP7A 3M8EA 3HOSA 4KICA 1IRGA 3RJPA 3ZMTA 5ERIA 4YFNF 4WXCA 2E1CA 2IW5A 3CUQA 3JAMK 5LHGA 3SQNA 1J59A 3TKYA 2H09A 2PG4A 4K2EA 5DUKA 4I7HA 1OPCA 1HW5A 3QRFF 1ZG1A 5JHUA 2R3SA 2CWEA 2P4WA 3WGHA 4I01A 1IXCA 1J2XA 1XSDA 3H3UA 2KIMA 5CVVA 4G6DA 1R1UA 5CVJA 2G9WA 5F6FA 1YS6A 1BIAA 3KP6A 1HKQA 3F6VA 4ON0A 3WTVC 2P5KA 1MJBA 1XMAA 3P9IA 5D4SA 5DD4A 4KNYA 2PMUA 4UNOA 4O3MA 2QZ8A 1I1SA 2OBPA 1LDKB 3BROA 4ESJA 4MTEA 4NHJA 4LB5A 4ZYGA 2R7FA 1ZN2A 2CO5A 1T2KA 2RV8A 2A69F 2CQKA 3B73A 2AXLA 2L4AA 4RS8A 5A2QK 4H0EA 4WXDA 3ABUA 2HDCA 5IT9K 1MGTA 4A0YA 1G4DA 1SD4A 1R5GA 2EFNA 3FZVA 2ELHA 1YW8A 1Z1DA 1EH7A 1IXRC 5E1WA 5K5RA 4IVNA 4O5VA 3KEOA 1BI1A 1S6LA 1G3YA 1ZH5A 1KYWA 2DT5A 5L3CA 3C7JA 4R79A 2XIGA 1ZGAA 3N97A 1KU9A 2W84A 1L3LA 1XGMA 5H20A 5LRSA 1XCBA 3M7GA 2JPBA 3M8FA 3JW4A 1Z6RA 3HRTA 3PFIA 2V1UA 4LGWA 4WWCA 2MH9A 2IP2A 5L3GA 3P7NA 2EK5A 2OZUA 5CVIA 4U0WA 3ROUA 2MC3A 2XROA 2VBZA 1H9GA 2DI3A 2XAFA 1MJAA 2Q8KA 2EFQA 2XUBA 2OAZA 5EEHA 3GUDA 1B4AA 2EV0A 3IWFA 3EDPA 2VE9A 1V4RA 1FC3A 5ILVA 5J8FA 3FMQA 2EV6A 2L3DA 3KZZA 4N9HA 3L7WA 3ISPA 1MD0A 2BBYA 2ESHA 1FBSA 4M71A 5LBQA 2ESNA 3HIFA 1YLFA 3ERED 2QLZA 2K02A 1EV7A 2KJCA 3BY6A 3LA7A 1K78B 4B09A 3VFZA 2RVCA 3V7RA 3Q9SA 3ZN1A 2HFHA 3I54A 1U5TA 1WWXA 1DUXC 2BEOA 1B9MA 5BMZA 5EEGA 1R1TA 4B8XA 4ZYHA 4I0BA 5HOOA 2M8EA 3RPQA 3VEPA 5CVUA 5LHIA 2GAUA 4OINF 3RKXA 1GXPA 1IF1A 2FU4A 4RB2C 4FHTA 1KQ0A 3LWFA 2VODA 1WKMA 4GGGA 4FX4A 5L3FA 5K5OA 4G7OF 3LA3A 3JTGA 1F1ZA 2HTJA 3I59B 4A6DA 2L54A 4RAZA 4OIOF 2EJRA 1FP1D 1ZLKA 4A0ZA 3RPUA 4KMFA 1HW2A 1WRJA 3KP2A 2QM3A 5L3EA 4L9JA 1KQ8A 4G94A 4S04A 3WTWC 4IJAA 3MAJA 1KU2A 4AVPA 4KIFA 1LEAA 3WU0A 2HOEA 1JHHA 5E1XA 3ECOA 3DPLC 5HLIA 2OQRA 2GWRA 5FD5A 4RAYA 3C3WA 2V6CA 5DD8A 3D0SA 2EA2A 1EH6A 1IZ1A 1F4KA 2ZKZA 4CO8A 1IN5A 5FLXK 2VC1A 5CVRA 3F6OA 4LD5A 3F72A 2RC4A 2O8XA 2PEXA 4CXFA 3WE3A 3DF8A 1J5YA 2KRFA 2VBWA 3HTUA 4ZYEA 3ZN0A 2GXBA 1D8KA 1ZGJA 3GW2A 4RB3C 2KIFA 1MZBA 3TQNA 4M72A 4JK1X 2P7CB 5J6XA 2ZFWA 4EJVA 1RI7A 4BHPA 1DPUA 4AIJA 5CLSA 2L01A 4BQAA 2O61A 4A2UA 4Q47A 2YX7A 1GVJA 2CYYA 3KLOA 1O3TA 1P92A 3T0YA 1FLIA 1RZ4A 5HDGA 2ZO4A 4HV5A 1D5VA 4U88A 3VB2A 1Z05A 2MLKA 2VT3A 4UVBA 3QPTA 1PP7U 3ZPLA 1W7PB 1YW7A 2HZTA 3ABTA 2GA1A 2JZYA 1FY7A 3GLXA 4UVAA 4HF2A 2ZMEB 4MTDA 4GO1A 3QAHA 4AIKA 4KIBA 2PI0A 3RYRA 4DQ2A 2E7XA 1U8RA 1LDJA 2K86A 4XSZF 3FXRA 1YG2A 4P9UA 1R5HA 1XDUA 3D5LA 1I5ZA 2FNPA 1YYVA 2FBIA 4L9NA 2YU3A 4PZJA 1LEBA 1FYLA 2LKPA 2M45A 2K27A 5DUIA 4YIIA 2QVOA 5LGUA 4L9TA 1XGOA 2HS5A 2YSRA 3E97A 3F3XA 4HLYA 4KUMA 2J5OA 3SXYA 2XAHA 3R0JA 3DQVC 1D8JA 2HWVA 2M1BA 3F21A 3ECHA 4P96A 3H92A 3W6JB 3GFIA 1RIOH 3J7AO 3J80K 3KP3A 2GZWA 3FM3A 3KLNA 1G3SA 2XKOA 1HSTA 2EV5A 2X0LA 2VBXA 4XSXF 1XD7A 2JTVA 1JHFA 5D5VB 3ELKA 2F5FA 4HOBA 3ML6A 4CZZA 2OQGA 2ZNYA 3RTRA 4M74A 1OYIA 5D6EA 4KT5C 4GYGA 3ZMUA 4L18B 1ZREA 6PAXA 1OKRA 1KU3A 4FX0A 3JSPA 1BI2A 1BC8C 2QQ9A 5HS8A 3T1BA 4Z2YA 3PQKA 4IRHA 1IN8A 2AS5F 3DEUA 2ZMEA 1GXQA 3QP5A 4XBFA 2RKHA 3MWMA 2O03A 3JAMZ 4AWXB 2Z3YA 1KGSA 4JQFA 3M9AA 3SHFA 3E3VA 3K1MA 3MQ0A 1X3UA 3TOAA 2XHKA 3WTUC 4PDKA 5LLQA 3C18A 2XVCA 2B0LA 4EGZA 4G6QA 1S7OA 4EM0B 1P2FA 3U9GA 1ZAOA 4GCVA 2PJPA 2QBYB 2VBYA 2HR3A 4AIHA 1TNTA 3HSFA 1ZYRF 2L02A 3KP5A 2H94A 2V1DA 1YQAA 4OU0A 3MFKA 2P5LC 1RUOA 3VOEA 1R58A 4L5IA 1K6OA 4OIRF 3GF2A 1HKSA 1J75A 1OYYA 4ENNA 1DP7P 1V3FA 2Z9OA 3R0AA 2ZJ2A 2OU2A 3BZ6A 2KJBA 5IT9Z 1HW1A 4XLNF 4JBAA 4HQEA 4NQWA 1T98A 3WTZA 1LQ1A 3LAPA 1VTNC 4LLGF 1KA8A 1QZYA 1ULYA 3IRQA 2CW0F 2COMA 3QP6A 2FBKA 3HSRA 2XAJA 3IWZA 2D1VA 2YR2A 1XCVA 5E8GA 1SAXA 4PCQA 3HOTA 4IHTA 4KYWA 3MZYA 4HF1A 4ASNA 4N9IA 1HSJA 1YS7A 1UB9A 3TGNA 3G73A 1CF7B 3BPVA 3LA2A 1FSHA 4BH9A 5ICEA 1ZRFA 4XRFA 3RDIA 3V7CA 2F5CA 4F7ZA 1DPRA 4R8HA 5CJ9A 1ZARA 1OR7A 2RNJA 1SMTA 4U7DA 2ADUA 1P4XA 4A0XA 5HDNA 4D0PA 3R6SA 5AONA 1Y0UA 3HYIA 3SFZA 1B6AA 1J9IA 3CO7C 2DPDA 3L09A 3GEZA 2RQPA 3ZMSA 2DK5A 2IT0A 4FT8A 3BJOA 1FPQA 2FNAA 4M9XA 4LG0B 1IAWA 1T38A 2ACJA 3K1PA 1UHMA 1IRFA 1T39A 5E18F 2WTEA 2MA3A 4MNUA 2A6EF 3F22A 1F9NA 2V9VA 1USTA 2PN6A 4UVCA 1SMYF 2C6YA 4IPAA 3T8RA 4IF4A 1QBJA 3GZ5A 1R7JA 4WK8F 5ICCA 3E5XA 3BOQA 3CLOA 3VODA 5AIQA 2A61A 1IN4A 1TW3A 3SZTA 1JE8A 1FYKA 2A07F 1KYZA 4U0VA 1I6XA 1O3QA 3AAFA 3TDZC 2Z33A 2XKPA 3EUHA 2F5DA 2QQAA 1T6SA 2NNYA 2XRNA 2MLGA 2W85A 3NRVA 4LK1F 1P4AA 5BQTA 2V79A 2LSOA 5CYVA 2EA4A 1U5TC 2GIVA 3M1EA 1TBXA 3SZPA 3COAC 2HEOA 1QPMA 1BI0A 5BPIA 4BYYA 1W7PD 2G7HA 5LRRA 1IN6A 2E7WA 3K2ZA 3RI4A 1W7PA 3WODF 3EYYA 1UFMA 4L0ZB 2WC2A 4QWQA 1TQMA 3DP7A 4LK0F 1HQCA 5HS9A 3FF5A 1W5SA 3FWEA 1J7KA 3OOPA 1BI3A 4L0YB 4HAMA 1G3WA 3BDDA 3Q9VA 3RKYA 3IL2A 2FE3A 1FP2A 4E70A 5JVTA 2VT2A 2J5PA 3CDHA 2F2EA 5D8LB 3G3ZA 1TQIA 2RN7A 2QBYA 1ZHFA 4I02A 4I98B 4Q4ZF 4RB0A 2STWA 2PMHA 4KMUX 3LQQA 3HTSB 4HX4A 3CUQC 5KK1A 1ZLJA 3IC7A 4EM1A 4KIGA 5TRDA 3O2PE 2VXZA 3FXUA 1YO5C 2BGCA 4ENKA 2FA5A 5BPDA 1Z91A 1T0FA 3WTTC 3MZHA 1XSVA 2EB7A 4RB1A 5DCMA 3NQOA 3WTSC 2K7LA 4M73A 1J0RA 1IUYA 2VC0A 4OOIA 4CYDA 2DQLA 3L9FA 2HQRA 2K4BA 1H0MA 5ILSA 4EJWA 1YFHA 3WGGA 2DLLA 1LJ9A 3K0LA 3I5UA 3NEUA 3LQRA 5J8CA 4UV9A 1Z9CA 2DW4A 2Y48A 4HDVA 3JTHA 2FSWA 3F23A 2HYGD 4U7BA 2V1XA 3T5XA 1L0OC 4NB5A 2P5VA 2DBBA 3FX3A 2DU9A 5F1RA 3J81K 4RGRA 1S8NA 2UXXA 2JSCA 3R61A 1U5TB 4UV8A 2PFBA 3LSTA 2W57A 3F8CA 3WE2A 3V8KA 4KDPA 3IHUA 4MEYF 3V8LA 2QYOA 1LVAA 1W4MA 4ZZLA 2CFXA 1F5TA 4KN4X 3BJAA 1YIOA 2UXNA 4OMZA 4EGYA 5D8KB 1U2WA 1MDMA 2MH2A 3QPHA 3HUGA 1P4WA 4XLPF 1FZPB 3WTYC 4TV7A 2KKOA 1HXDA 4M6YA 4LJZF 2FF4A 4BXUA 4HV6A 1IN7A 1ZRDA 2D2WA 2IA0A 3L2CA 2Z99A 2EFOA 1IXSB 4PGHA 5LHHA 5K5QA 2ZXJA 3IRRA 3WTXC 5FGMA 3CO6C 3R60A 5ILUA 2R7DA 3FM5A 2ETHA 1XMKA 1R1VA 2ZCWA 4S05A 5LGNA 1STZA 4IRIA 1FSEA 5DYMA 4ESBA 2L4MA 1Z6TA 1I1GA 2H6CA 2IRFG 4BNCA 3ZMVA 5JI6A 3K1NA 1Z7UA 5D5UB 2XV4S 4G7ZF 4LB6B 3KETA 2ISZA 1XN7A 3BWGA 5LEKA 2FRHA 3C1DA 2BV6A 2HQNA 1K7AA 3EETA 4A6EA 2HKOA 1KU7A 4A5NA 2JT1A 3R4KA 3OV8A 2MD5A 3DPTA 2JRTA 5D6FA 3LAJA 1MKMA 2DO7A 4HA8A 4LFUA 1SFXA 5FO5A 1D3YA 4DNCA 3HRSA 4HF0A 2GA2A 2FMYA 3QU6A 5IT3A 2ZBKA 2FMLA 3L00A 5ED4A 5KVRA 3V8JA 2Z5UA 2E1NA 5BS6A 3CTAA 1B9NA 4I0AA 1JXSA 2QENA 3I58A 4HLXA 2VOPA 3GWZA 3HSEA 4CGZA 1ONVA 1FBQA 4EJOA 1R00A 3FHZA 2O6GE 1C0WA 1MDMB 2NNNA 3TO6A 2K4JA 3V4GA 2OD5A 2WV0A 5FB2A 1YTYA 3P9KA 5A2QZ 4Y13A 2DTRA 2G7UA 4Q48A 1OYWA 4MQVA 2QUFA 1BN5A 1TW2A 3KP4A 5K1YA 4RGSA 3DV8A 1XSXA 3REOA 1S7AA 1TNSA 4M9SA 4G9YA 4HX8A 3P9CA 2W24A 1FYMA 4LLNA 3I59A 2XAQA 2UWMA 3ZMDA 4OIQF 5H6RA 1HKTA 2GQQA 4UUVA 3F8MA 3TO9A 2DFIA 5HVQC 5BOXA 3B02A 2IA1A 1BIBA 1RNLA 2FEZA 4IXAA 2P7VB 2XAGA 1SD5A 3I64A 1QNTA 2IPQX 2CG4A 1KQ9A 2Q0OA 1SD6A 4OIPF 4HYEA 4I09A 1BJAA 2VE8A 1LDDA 1G6NA 1U6GA 2CGPA 1FWZA 2NS0A 1BBYA 4ZZDA 4BHBA 2XASA 4EV0A 1RUNA 1YW9A 4LMYA 4OMYA 3RYPA 4G8XA 2X4HA 4IHSA 3S2WA 3I4PA 1ODDA 1U3EM 4YFKF 3ZMZA 4KN7X 4KA4A 1R23A 5JFRA 2D1HA 1GHCA 5D5XB 3Q5FA 4ENMA 1FX7A 5JR3A 2HTSA 3BPXA 3GO5A 1FT9A 3J81Z 4M6XA 4Y17A 3WU1B 2XGXA 1I27A 4WF2A 1SD7A 2TDXA 3WG9A 1AWCA 3F8FA 1QQIA 3DFGA 4YG2F 4QLCU 2Q2EA 2STTA 1O3RA 5DDGA 2VN2A 3E6DA 4WX9A 1O3SA 4N0BA 2PBIA 4HZFA 4CHUA 4GYIA 2GXGA 1PDNC 3F8NA 1P6RA 2W25A 3EQLF 4ETSA 2D45A 2P8TA 1ZG5A 1AOYA 3E5QA 4P5OA 1XGNA 2PLYA 1MJ9A 3DKWA 5F64A 1A04A 1BC7C 2Y0MA 1ON1A 4U0YA 4Q5SF 1BM9A 2NRAC 1ON2A 1O57A 1TLHB 2O0YA 4KFCA 4M9ZA 2Y75A 2EWNA 5DEQA 3WGIA 5HLHA 4HQMA 3GYHX 3K69A 3E6BA 4Y15A 3CUQB 2PQ8A 2LNBA 1E2XA 2P6TA 5AIPA 4HW0A 5LGTA 2H6BA 1R36A 4CDGA 2VOOA 5LEJA 3TO7A 1XGSA 3J80Z 3GFLA 1QO0D 1W5TA 3K9TA 3V7SA 3TOBA 2FBHA 4MGRA 4MQ9F 1S29A 3ZP5A 1FNNA 4ESFA 2HKXA 5DV5A 3KZYA 1SFUA 3N4MA 1WI9A 4MHGA 2CSOA 5HDKA 1XDSA 3IKVA 3KEQA 2FXAA 1WSUA 1REPC 1XB4A 2ZNZA 4MEXF 3U1DA 3GVAA 3O3KA 2OZ6A 3HRUA 2YPRA 1O7LA 4EVIA 4LG0A 3GFMA 1O7FA 1JGSA 3H3ZA 2BE5F 3TDUC 3ULQB 5H6QA 1TTYA 2M5WA 2DPUA 1LNWA 3LFKA 1ZG3A 4EM2A 5E1ZB 2KIUA 2O3FA 2FQ3A 2VONA 2P6SA 1PP8F 5FD6A 5DCFA 2A6HF 4UXNA 1U78A 5FFXA 2HGCA 4AD9A 1B59A 4YIFA 1UCRA 3QU3A 2A68F 2MBFA 4I2OA 1UHWA 4HX7A 1DDNA 3GZ6A 4CICA 3RKWA 4O6JA 3F8BA 1R22A 5ICFA 3KCCA 4WXHA 1CGPA 1EH8A 1ZRCA 4ENJA 1Q1HA 2JPCA 1SFEA 5ICGA 2UZKA 1WQ2A 2LF8A 3BJ6A 1S3JA 3I71A 2DQRA 5L3BA 2EFPA 1PUEE 2DAOA 3E6CC 1QZZA 4BAYA 2M87A 4R1HA 4ZH4F 1FOKA 4EJTA 3CJNA 2NAZA 4L5JA 3BP8A 4WCGA 5D5WB 3MCZA 4EMSA 3E6MA 3I0TA 3O6BB 5E20A 3HRMA 1K78A 1LB2A 2IA2A 3ZQ7A 3QOPA 3FMRA 3KE2A 4EJUA 4P9FA 4YFXF 4BHCA 3HHHA 3I53A 2A5YB 2QWWA 2LDUA 5L3DA 4ZYDA 3U2RA 4EQQA 2ISYA 2FOKA 2HYFA 3FXQA 5TJJA 3RIRA 3KFWX 2EFWA 4P55A 5D4RA 2BYVE 2LF7A 4IRGA 4L9VA 4HBLA 1E17A 3GFJA 1OMIA 2F5EA 4A5MA 4PGGA 3T8TA 5E8IA
chains in the Genus database with same CATH superfamily
1QGPA 4BJ6C 1H88C 3HHGA 4G7HF 3OSFA 3BQYA 1BJZA 3L2QA 2M30A 5IP9J 1IV6A 4BKXA 4RGUA 5FFZA 1VZ0A 4BJ5C 1B1BA 3JRGA 3IH4A 4LLLA 3HB9A 1EJ9A 4PJLA 4W97A 4RGXA 3H0DA 3CMEI 3O8GA 1ETOA 2OA4A 3GXOA 1JUMA 3IKTA 3DXJF 2K9MA 3PQJA 1HDPA 2E19A 2K40A 5HLGA 4ABZA 2L0KA 2IGNA 5HS7A 3W6KB 2DK8A 3JSOA 1K79A 1CF7A 2CQ7A 4LG3A 2YX4A 5FLXZ 3E5UA 3FXMA 3HGGA 1USSA 3MEXA 3A4CA 4CCKA 2EZIA 2HI3A 1XS9A 2CU7A 1K4TA 1MBFA 1Z3XA 1MMNA 2RDPA 5KHDA 2QEXI 2IJLA 3QOEA 3OYNA 3VWBA 1IW7F 3CUOA 2VPRA 4IL6C 3CCMI 5IOZA 1MNMC 1FBUA 1X4OA 4XKVA 1H9TA 2R0QC 3OYIA 1VQ8I 1FOYA 2NYXA 3FMSA 4GXOA 4CUGA 1F36A 1BOAA 2WWYA 4HDUA 4A12A 3GX4X 1NHAA 2JVGA 4UHTA 2QQBA 4RLFA 3OYGA 5FLVA 2DJIA 2EIJH 2IVMA 2RAEA 1G3TA 2RGVA 1HBXG 5E17F 1A5JA 3BR0A 2M7AA 5DCMB 1TQPA 2H27A 3EYIA 2F4MB 2VKEA 1WI3A 2AXTC 2VB6A 2ZC2A 2A3SA 3ONQA 4W1UA 3KP7A 3SDBA 1R4NB 2ZJQF 3CCQI 3FDYA 2IS1A 3M8EA 3HOSA 4KICA 1IRGA 1I3AA 3I56I 3RJPA 3ZMTA 4I76A 5ERIA 4YFNF 2RNGA 2LLKA 4WXCA 3HOVJ 2E1CA 4BDYA 2CV2A 2IW5A 3KYLA 5EEAA 3G1LA 2CFOA 3WG7H 3CUQA 4E4HA 3Q0UA 3JAMK 5LHGA 3SQNA 4XQFA 4M3BA 1J59A 1G8XA 3VYRB 3TKYA 1AKHB 3S93A 2H09A 3K4KA 2PG4A 1NTCA 2OUMA 4K2EA 4XLCA 2X6YA 5DUKA 2R93J 4I7HA 1OPCA 2ECBA 1HW5A 2HQ5A 4JX6A 4IOCF 3QRFF 1XG1A 1ZG1A 1FMVA 4XN0A 5JHUA 2OCEA 5B5EC 3A03A 2R3SA 1YITI 1BR1A 2DFHA 5IP6A 2CWEA 2R5YA 2DA4A 2P4WA 3WGHA 2F5VA 4I01A 5B1BH 1IXCA 1J2XA 3CF5F 1XSDA 3H3UA 1FIAA 2X9DA 2KIMA 5CVVA 4A3CJ 4G6DA 1JKQC 1R1UA 2NS8A 4IQ4A 5CVJA 4BL0B 2G9WA 1ZK8A 2BY2A 1D1CA 2L5QA 3PM1A 2IGMA 5DM7F 4D7MA 3CF2A 4FE7A 5F6FA 1YS6A 1BIAA 3KP6A 3VPRA 1HKQA 3D5RC 2E2HJ 2EZKA 3F6VA 4ON0A 3OYMA 2LY9A 3FBNB 2E1MC 3WTVC 5EG0B 2P5KA 1MJBA 1XMAA 3P9IA 5D4SA 4ZJZA 5DD4A 4KNYA 2PMUA 4UNOA 4O3MA 2W48A 2QZ8A 4IKFA 3K70D 1I1SA 2OBPA 1LDKB 3BROA 1HC8A 4XL9A 2F4OB 3BTJA 4CH7A 4ESJA 4D7NA 3PSIA 2KIQA 4MTEA 4A3MJ 1QA6A 4EATA 2MG4A 2HOAA 1X1DA 2JA8J 4NHJA 1MMAA 4LB5A 4ZYGA 2R7FA 2OTJI 3BG7A 1ZN2A 2WV1A 2AO9A 2CO5A 2LP0A 4G12A 1TC3C 1T2KA 3KEYA 2RV8A 2LG4A 2A69F 2CQKA 4IOAF 3B73A 4PUSA 2AXLA 2L4AA 4RS8A 2DT6A 5A2QK 4WXDA 4H0EA 4HSTA 4A3GJ 3ABUA 2HDCA 5JLXA 5IT9K 3CCSI 1AKHA 1A6IA 2DTZA 1MGTA 1GLNA 4A0YA 2O9LA 1G4DA 4A69C 4BDZA 3S16J 2AQFA 1SD4A 1R5GA 4F52A 1TL8A 2EFNA 3FZVA 2ELHA 1PVEA 1YIJI 1YW8A 1Z1DA 2WAQN 1EH7A 4B1RA 3OIQA 1IXRC 5E1WA 5K5RA 4IVNA 4O5VA 4C30A 3KEOA 3LSPA 1BI1A 1S6LA 1G3YA 2NVQJ 1HLVA 3LOCA 1ZH5A 2WY8Q 1KYWA 2LKXA 5EZHA 1IGNA 1OCPA 2MSYA 2L7MP 2DT5A 5L3CA 3H35A 3GBGA 1MNEA 3C7JA 4R79A 1X19A 4PSXA 2AQEA 4I99C 1ZR4A 2CW7A 1ZGAA 2WA0A 2XIGA 3N97A 3S8PA 1B8IB 3A01B 1KU9A 3FXLA 2W84A 2YUSA 5EGOA 1L3LA 1XC5A 1XGMA 5H20A 5LRSA 1H89C 2L9NA 5DTDA 2LY2A 1XCBA 3M7GA 3CCJI 4Y52J 2JPBA 1OCRH 3M8FA 3JW4A 1Z6RA 5EG0A 3HRTA 3PFIA 2V1UA 4LGWA 2FX0A 4WWCA 1DGRM 2MH9A 3DU5A 1W0TA 2IP2A 2X1DA 5L3GA 5C3EJ 3P7NA 3G1MA 2EK5A 2OZUA 2LH9A 5CVIA 4KITB 4CCJA 4U0WA 3ROUA 2MC3A 2XROA 2VBZA 2KPMA 1H9GA 1RKTA 3CCLI 2DFEA 2CQXA 4DYQA 1LFBA 2DI3A 2XAFA 3TP3A 1MJAA 2Q8KA 3JRFA 1U9NA 2EFQA 2XUBA 1OCOH 2XPVA 1AHDP 2OAZA 4Y33A 1LE8B 1FJLA 5EEHA 4MFDA 3GUDA 1B4AA 2EV0A 1QU3A 4Y4RA 3SEQA 3IWFA 3EDPA 2VE9A 3CJRB 1V4RA 4NQWB 1FC3A 2MD0A 5ILVA 5J8FA 2M4GA 1P7JA 1FOWA 3FMQA 3HXLA 1OQYA 2EQRA 2EV6A 2L3DA 3KZZA 1N75A 4N9HA 2A5WA 3K7AJ 3L7WA 4QPOA 2O7OA 3HUGB 4E7KA 3LSJA 1WH7A 3ISPA 1MD0A 4XKBA 2BBYA 2ESHA 1JI8A 1FBSA 1R71A 1VQ4I 4KISA 4M71A 2E36A 5LBQA 2ESNA 4E7HA 3HIFA 3EUHC 2NVXJ 1OCCH 1YLFA 3ERED 2QLZA 2K02A 1EV7A 2KJCA 3BY6A 3LA7A 1K78B 4B09A 3VFZA 2RVCA 5LFAA 3JCUC 3V7RA 3UNGC 2M4KA 4FETA 3Q0VA 3Q9SA 4AC0A 3ZN1A 2HFHA 3KYCB 3I54A 1U5TA 1WWXA 1DUXC 2QSGX 5IY5H 2BEOA 2OF7A 4XIDA 3DKXA 3SDGA 1B9MA 2E71A 5BMZA 3ESWB 1UG0A 2ZJPF 5EEGA 3VYUB 1R1TA 4B8XA 4ZYHA 4I0BA 1G2HA 5HOOA 2M8EA 3RPQA 3VEPA 5CVUA 5LHIA 3OYEA 2GAUA 4OINF 3RKXA 2BW3B 1SFKA 3RPUD 1GXPA 2M3AA 1IF1A 2FU4A 1WJEA 4RB2C 4FHTA 1KQ0A 3LWFA 1X4PA 2VODA 1WKMA 4GGGA 2DA7A 1Y0NA 4FX4A 5L3FA 1IRXA 5K5OA 1NG6A 4G7OF 3LA3A 5CQEA 3JTGA 3MN2A 1F1ZA 2LBFB 2HTJA 3I59B 4A6DA 2L54A 2R5ZB 1MH3A 3FK7A 4RAZA 4B3XA 1IG7A 3CQZJ 4OIOF 2EJRA 1UJ8A 2IS4A 3VSLA 1FP1D 1ZLKA 4A0ZA 3RPUA 4KMFA 2LREA 5J1YA 1HW2A 1WRJA 3KP2A 2QM3A 5L3EA 4L9JA 3PIPF 1ORKA 1KQ8A 1WJ5A 2V9PA 4RM3A 3JREA 2Z2SB 4GDFA 4G94A 1JJ6C 2DMNA 4S04A 3PIOF 3HC7A 2WAQA 4IJAA 3WTWC 1IJWC 3MAJA 2K9QA 1KU2A 3ASOH 2KDZA 4AVPA 2Q1ZB 2QQ8A 4KIFA 4PSWA 3BC8A 3TEDA 3GTMJ 1LEAA 3WU0A 3RZDJ 2HOEA 3MVPA 1JHHA 5E1XA 1SVLA 4RAFA 5M3MJ 3ECOA 3DPLC 5HLIA 4HNVA 3HL2A 2OQRA 2XF7A 3JRHA 2GWRA 5FD5A 4RAYA 3C3WA 3JRCA 2VQHA 3OYDA 2V6CA 3B6CA 5DD8A 3D0SA 2EA2A 1VQ7I 4J01A 3G4SI 2QGUA 5HLTA 1EH6A 1IZ1A 1F4KA 4OWRB 2ZKZA 4CO8A 4CYCB 3S32A 1IN5A 1MBJA 1VQPI 5FLXK 4AUXA 3M3YJ 5J3LA 2I8DA 2VC1A 5CVRA 4V19K 3F6OA 4LD5A 3F72A 2RC4A 2O8XA 4CCMA 5EYRA 2PEXA 2GOMA 4CXFA 4H4KC 3WE3A 2WAEA 3DF8A 4B47A 3CLQA 1J5YA 2KLOA 2KRFA 2VBWA 3HTUA 4ZYEA 3ZN0A 2GXBA 3QQAA 1D8KA 2ELKA 5GTIC 1MSEC 1ZGJA 3GW2A 3S3OA 4RB3C 4IHYA 2KIFA 3HG9A 2M2EA 1MZBA 3TQNA 1WJDA 2QKLB 1T0FC 4FE4A 1Z21A 1I50J 3CMMA 4GRIA 2GOXB 4M72A 4JK1X 1JJ8C 4BE0A 2CH0A 3RSNA 5J40A 2P7CB 3OIPA 1ZR2A 5J6XA 2ZFWA 4EJVA 1RI7A 3K10A 4BHPA 1DPUA 4AIJA 5CLSA 2L01A 3SZGA 5GP9A 4IZZA 4BQAA 3DBHB 2O61A 1MBKA 3H9QA 3TP0A 2HPIA 4A2UA 4Q47A 2YX7A 4GFBA 1GVJA 2CYYA 1LVKA 3KLOA 4NNJA 1O3TA 1JT0A 1P92A 3T0YA 3TL4X 3ZOBA 1FLIA 1RZ4A 1MBEA 4XK4A 5HDGA 2ZO4A 3FKIJ 2E5NA 5GAHJ 3RKQA 4HV5A 1D5VA 4U88A 3VB2A 5JHFA 1Z05A 2O5RA 2MLKA 2VT3A 2CUJA 5HNHA 3GMEA 4UVBA 1MNDA 2ELJA 1D0XA 3CCVI 3QPTA 4OAZA 1PP7U 3CC2I 3ZPLA 2K3FA 1BR2A 3QWLA 2XDVA 1W7PB 1YW7A 2LTPA 4M6VA 2HZTA 3ABTA 3S3MA 2H8WA 3S14J 2DDAA 5TGTA 1B72A 3H9JA 4HRIA 2GA1A 4BY7J 2JZYA 1FY7A 2XPUA 3GLXA 4XOTA 4UVAA 4HF2A 2MYSA 3BG5A 4CCOA 4A3IJ 2IEKA 2ZMEB 4MTDA 4GO1A 5GPCA 4B44A 2M8GX 1JKPC 4RLQA 1TT5B 3QAHA 4AIKA 3PNVA 2IS6A 2Y31A 3DEEA 4KIBA 3RYRA 3WHBA 4DQ2A 2E7XA 1U8RA 2PI0A 4XNFA 1LDJA 1BOBA 2K86A 3EPZA 4XSZF 3GTJJ 3FXRA 2X6OA 2D5VA 3GTGJ 4XOPA 1YG2A 4P9UA 1DQUA 1R5HA 1XDUA 3D5LA 1I5ZA 3PSFA 2CUEA 2FNPA 1YYVA 3JR9A 2FBIA 2KDOA 4L9NA 2YU3A 4PZJA 4AVZA 4QTRA 3FIWA 1LEBA 1D5YA 1EF4A 1FYLA 4A3BJ 3BR1A 2LKPA 2M45A 3E1SA 2K27A 4DBRA 5DUIA 4YIIA 1LE8A 2BOLA 3SFIA 1W1WE 2QVOA 3S17J 1S72I 2DYRH 5FKLA 5LGUA 4L9TA 3TW7A 3S1NJ 3K2AA 1XGOA 2HS5A 4QPQA 1QZEA 3D5SC 4NUBA 2DA6A 2DT7B 1WHUA 3E7LA 2KRHA 2YSRA 3E97A 3F3XA 1YJNI 2R7XA 4HLYA 4KUMA 2ZXWH 1ZKGA 3H5NA 1KZHA 4FASD 1P7IA 2JSPA 3MKLA 2J5OA 3LFUA 1WCMJ 3LSMA 3SXYA 2XAHA 3R0JA 3DQVC 1D8JA 2Y0SN 2HWVA 5IYBJ 2M1BA 1X1CA 3F21A 3ECHA 4P96A 3H92A 2EH3A 1QHHD 3W6JB 3GFIA 1RIOH 5K7HA 1Y8QB 3CJTB 3KP3A 3QPSA 3J80K 2GZWA 3J7AO 1HA8A 2NOGA 1RKWA 3MD2A 3FM3A 3KLNA 1H8AC 1F43A 1XPXA 1VI0A 1G3SA 2XKOA 1VFCA 3K4CA 1HSTA 4YELA 3TBIA 2EV5A 3AKZA 2X0LA 2CMPA 2VBXA 4XSXF 3ZR8X 4BXXJ 1V5GA 1XD7A 2HNHA 2JTVA 3PO3J 1JHFA 1EKEA 1X1BA 2Y0SA 3ELKA 5D5VB 4UY8I 3H3VK 2F5FA 2X6XA 3IH3A 4HOBA 3ML6A 3LNQA 3I4NJ 4CZZA 2NXNB 2OQGA 1Y56A 2ZNYA 3RTRA 4M74A 1OYIA 3EUAA 5D6EA 2LMDA 2R7SA 3KX2A 3L2WA 2OCCH 4KT5C 1HDDC 1TZLA 4GYGA 3J7ZI 2XRLA 3ZMUA 4L18B 1GV2A 4E7JA 1B72B 1ZREA 4DZPA 2HDDA 6PAXA 3U21A 1OKRA 2DCEA 3HJEA 1KU3A 3AG2H 4FX0A 3JSPA 1BI2A 1E3PA 2NS7A 1GDTA 1WJAA 1YE9A 1BC8C 2QQ9A 2KQRA 4YIRX 1FTZA 5HS8A 3T1BA 4Z2YA 4BU2A 3W6VA 3PQKA 2R7OA 4IRHA 1IN8A 2VQGA 3BCBA 4FISA 2AS5F 1T95A 2WADA 2Y9ZA 3DEUA 2ZMEA 1DU6A 1GXQA 1V54H 3QP5A 1G59A 2EBIA 1D1BA 4XBFA 4UUTA 2RKHA 3MWMA 2O03A 3JAMZ 5GAEJ 4AWXB 2Z3YA 3KZIC 1KGSA 4JQFA 3M9AA 3SHFA 3E3VA 3K1MA 3MQ0A 1X3UA 3TOAA 1UZCA 2XHKA 3ZRGA 1QVUA 3WTUC 3C2GA 4PDKA 4AYBA 4XLAA 5J4YA 3LSRA 1ACIA 5LLQA 3C18A 2XVCA 4XORA 5FRMA 2B0LA 2CJJA 2ZSIB 3MMYB 4EGZA 1Y8RB 4G6QA 3LMMA 1XMXA 1S7OA 3FXJA 3IP4B 1TP4A 4EM0B 1WJCA 1P2FA 3U9GA 1ZAOA 4A3DJ 2V9KA 4GCVA 1YX5A 2PJPA 1XTAA 3FHNA 2QBYB 2VBYA 2HR3A 4XRSA 2VLAA 4AIHA 2HOSA 1I3QJ 3F9KA 1TNTA 2JWTA 3QYBA 2L7KA 3HSFA 1ZYRF 3AG4H 3ZGKA 2HVSA 5CQGA 1SAUA 4F55A 2IS2A 2L02A 2LKSA 3KP5A 4PFOA 1YRNB 3PO2J 2W00A 2H94A 2KHMA 2V1DA 1YQAA 3HBLA 4OU0A 3MFKA 3G6EI 4NC8A 3ZQIA 2RREA 4LOCA 4JYKA 2P5LC 1RUOA 2W1OA 1ENHA 5K7ZA 1POGA 1J09A 3VOEA 1R58A 4IHWA 3ABMH 4L5IA 2FOWA 1K6OA 1V5FA 2KRCA 4OIRF 5F04A 3GF2A 1BW5A 3CCUI 4X6AJ 1HKSA 2JMWA 1J75A 1OYYA 4ENNA 5F0HA 1D1AA 1DP7P 3GTKJ 5EZGA 1V3FA 2HXOA 2ZXIA 4FCYA 4XKCA 3QYEA 1WJFA 2Z9OA 3R0AA 2ZJ2A 2OU2A 1E3OC 3BZ6A 2KJBA 5E3MA 5IT9Z 3RQIA 3HOUJ 3AL0B 1HW1A 4XLNF 4JBAA 4KT6A 3L2UA 4HQEA 1VQLI 4RA2A 4IEJA 4NQWA 1NK2P 1T98A 1HOMA 1TWFJ 3WTZA 9ANTA 2OPTA 1LQ1A 2PX9A 4C3JJ 3LAPA 1BA5A 3FISA 2EZLA 2W4SA 2JA2A 5E3OA 1BW6A 1X58A 4LLGF 1KA8A 1QZYA 1VTNC 1W36D 3H5RA 1T33A 1ULYA 3IRQA 2R7ZJ 4M3GA 2LY1A 2CW0F 2COMA 3DKYA 3OR2C 4FTHA 2JRMA 3O8HA 3OSGA 3QP6A 2FBKA 2X51A 3HSRA 2A6TA 2XAJA 3MKYB 5C44J 1MBHA 3BTIA 3IWZA 2HPMA 2L9VA 2D1VA 1ERDA 2YR2A 2IGOA 2KMUA 4BE1A 1NK3P 1XCVA 5E8GA 1SAXA 2HXIA 4PCQA 1LPQA 3HOTA 4IHTA 2QF7A 2LD5A 3MZYA 4B48A 4KYWA 1MSFC 4HF1A 1MBGA 2CQQA 2R4GA 4ASNA 4N9IA 2IBDA 3GZNB 2GM4A 4C3HJ 1HSJA 3L2VA 3HKZN 1RRJA 3OWTA 2NVYJ 1DP3A 1YS7A 3CD6I 1UB9A 3TGNA 3G73A 2DA2A 1KONA 1CF7B 2V6EA 3S3NA 2DA5A 3BPVA 1RR8C 3HDDA 3LA2A 2CS3A 1X3ZB 4XRSG 3K4LA 1FSHA 4BH9A 5ICEA 3HOWJ 2CUZA 1ZRFA 3PNYA 4XRFA 3RDIA 4F92B 1OISA 3PL8A 2F5CA 3V7CA 1DPRA 4ZDPA 4R8HA 4F7ZA 5CJ9A 4A3EJ 2K9LA 1MIJA 1ZARA 1GUUA 1OR7A 2BVMA 5H2FC 2BW3A 2RNJA 4Y7NJ 3W2WA 1SMTA 1WVRA 5FLMJ 4U7DA 2ADUA 4MFEA 3HOYJ 4BEHB 1R5ID 3S1QJ 1P4XA 4A0XA 5HDNA 4D0PA 3H5AA 3K4NA 3OYLA 4IHXA 3R6SA 5AONA 1Y0UA 3HYIA 4XLFA 3SFZA 1B6AA 2DMTA 1J9IA 3DTIA 2DODA 3CO7C 2LFBA 4JOMA 2DPDA 3KIOA 5F27A 3L09A 1X2MA 3BTCA 3GEZA 4CYCA 2RQPA 3ZMSA 3L1PA 2DK5A 1D0YA 3OR1C 4J19A 2IT0A 1R4MB 4FT8A 1VQ5I 3BJOA 1FPQA 2GXAA 3CP2A 2FNAA 4M9XA 5GPAA 1IC8A 4LG0B 1IAWA 3BG3A 2VJJA 1T38A 3ABKH 2ACJA 3K1PA 1UHMA 2M9HA 1IRFA 1T39A 2ZB9A 5E18F 3QPLA 3DBLB 3S2DJ 2WTEA 2MA3A 3S15J 4BEHA 2WB1N 4MNUA 3S2HJ 3OYAA 2A6EF 5GAGJ 4BBRJ 1F9NA 2V9VA 3F22A 3CCEI 1USTA 2PN6A 4UVCA 4JX4A 3S1RJ 1SMYF 1LUJB 2C6YA 2ZSHB 4IPAA 3T8RA 4IHVA 4E7ZA 4IF4A 1QBJA 3RZOJ 2WBMA 3MKZA 2F4IA 3GZ5A 1ETWA 4X1EA 3OS2A 1R7JA 4WK8F 5ICCA 3E5XA 3BOQA 3CLOA 1APLC 5J1UA 1S9HA 2EILH 2ID6A 4S0HB 3L2RA 2R5ZA 3VODA 5AIQA 2A61A 1IN4A 1W5CC 3UR3C 4DYCA 3M4OJ 2LBFA 1TW3A 3SZTA 2E35A 1R9TJ 1JE8A 4C9YA 1FYKA 2A07F 1ETXA 4QSHA 1KYZA 4P1WA 4U0VA 1I6XA 1O3QA 2R92J 3AAFA 3TDZC 2Z33A 2XGCA 2XKPA 2MW8A 1OCZH 4DIQA 3OYFA 3EUHA 2F5DA 4XR6A 4BQNA 2QQAA 3KPHA 4D5CA 3M8JA 5FJ8J 1T6SA 2W82A 2NNYA 3BR3A 5M3FJ 2XRNA 2MLGA 2W85A 3MZ8A 3NRVA 1FOXA 4PJNA 3GTPJ 4LK1F 2HDWA 2MC4A 1P4AA 4LITA 5BQTA 1RETA 1WZ2A 2V79A 3OYJA 2LSOA 5CYVA 2EA4A 2E1OA 2JUGA 2K5CA 2CUFA 3FKJA 5IP7J 4A3JJ 1U5TC 2HVQA 4CCNA 2GIVA 5JVGF 3M1EA 4E7SA 1UHSA 1TBXA 3SZPA 3COAC 2HEOA 1IV8A 1QPMA 1BI0A 2H1KA 2JUCA 5BPIA 3SEZA 1N77A 2CRGA 4BYYA 1W7PD 1AA7A 2VI6A 2G7HA 1IRZA 3I9V2 5LRRA 1IN6A 3BLYA 1X1AA 4BGDA 2DMPA 2E7WA 3K2ZA 3BG6A 3OS1A 3RI4A 3I4MJ 1OJLA 3G1OA 4HNTA 5BNGA 1W7PA 5GADJ 3WODF 2M0MA 4CCLA 3EYYA 3CC7I 1ZTRA 1UFMA 2BXYA 4L0ZB 2WC2A 4QWQA 1TQMA 5FROA 3DP7A 4LK0F 1HQCA 3CCRI 2HVRA 5HS9A 1HF0A 3FF5A 4NDLA 1W5SA 3I55I 4A3LJ 1A6QA 3FWEA 5HODA 1J7KA 2HOTA 1DU0A 3KYDB 3J7AY 5E3LA 3OOPA 1BI3A 3U1KA 4ZTFA 5J1RA 2BHYA 4L0YB 4HAMA 1G3WA 2B9SA 3BDDA 3Q9VA 1D0ZA 2DMQA 3RKYA 3IL2A 2FE3A 1FP2A 4E70A 5JVTA 1MW7A 2VT2A 4E6KG 2B7EA 2J5PA 3CDHA 2GLOA 2F2EA 5D8LB 1Y6IA 3G3ZA 2L9RA 4Z6YA 1TQIA 2RN7A 2QBYA 3FK6A 1ZHFA 4I02A 4I98B 4Q4ZF 3JRAA 4RB0A 2STWA 5EF6A 2RQQA 2PMHA 3BR5A 4XLEA 4KMUX 3D1NI 1MH4A 2X1EA 3BTLA 3LQQA 3HTSB 3PJRA 4HX4A 3CUQC 1TWHJ 5KK1A 1JTYA 1ZLJA 1PJRA 3IC7A 4EM1A 2UV1A 4II2A 4KIGA 5TRDA 4D5FA 3O2PE 5JLWA 2VXZA 3FXUA 1YO5C 3JRDA 4I6ZA 1YHQI 4D1QA 2BGCA 4ENKA 2FA5A 5BPDA 5F0CA 4HEA2 4BE2A 5LD2C 2R5YB 1Z91A 1T56A 2L7ZA 4BACA 3VYTB 3ABLH 2Y9YA 1T0FA 3WTTC 3W2AA 2ZMEC 4C3IJ 2R7VA 3MZHA 1XSVA 2EB7A 4RB1A 5DCMA 3NQOA 3WTSC 2K7LA 4M73A 2Y30A 1MMDA 1J0RA 4RBOA 1K4SA 2VC0A 1IUYA 4OOIA 3OY9A 4CYDA 2DQLA 3RCOA 3L9FA 4B3AA 2HQRA 2K4BA 2LR8A 5M5XJ 1H0MA 2Y69H 3WU2C 5ILSA 4EJWA 1VNDA 5B1AH 3ZQCA 1YFHA 2VXDA 3H1CA 3WGGA 2DLLA 1T08B 2VJ4A 1OR7C 2E1MB 2KL4A 1LJ9A 2Y2ZA 3K0LA 5E3NA 4XKWA 2KZVA 3I5UA 3NEUA 2BXZA 3GTLJ 2VIXA 3LQRA 2QA4I 4EEFG 5J8CA 5HNFA 4UV9A 2XC7A 1WPKA 2KFDA 2WB1A 4HSRA 3LSKA 1Z9CA 2HZDA 2XGDA 1I39A 2BY3A 2DW4A 2Y48A 3H36A 2DA1A 2JJ7A 4MLOA 4HDVA 3FXKA 5FKMA 3JTHA 2FSWA 3F23A 2HYGD 3HKZA 4U7BA 2V1XA 4DZJA 3T5XA 2R7QA 1ETYA 1L0OC 1Z77A 4NB5A 4IX7A 3K6GA 2P5VA 1TWAJ 2DBBA 3FX3A 3BG9A 2DU9A 5EJCA 3A0BC 2X1CA 5F1RA 3CZ6A 3H0GJ 4PJMA 4CSWA 1RPWA 3J81K 4RGRA 4F91B 4ANJA 3A02A 1S8NA 3DU6A 2QCOA 1U9OA 3ZQGA 1YJ9I 2UXXA 2JSCA 3R61A 1U5TB 1VQOI 1T8IA 4UV8A 2PFBA 3GTOJ 3LSTA 4HPQA 3PFYA 2E5ZA 2K9SA 3DTKA 2W57A 1IDYA 3F8CA 3DCFA 3WHCA 3WE2A 3V8KA 4E7IA 3DTEA 4KDPA 3IHUA 2MGQA 4MEYF 3V8LA 2QYOA 4ZDOA 3DWLE 1LVAA 1W4MA 2K85A 3LSGA 3GCMA 4ZZLA 2CFXA 1F5TA 3N05A 1UMQA 4KN4X 1K83J 3BJAA 1YIOA 2UXNA 1Z67A 4OMZA 4LIUA 2LC2A 1WJBA 4AU7A 4EGYA 1PUFA 5D8KB 4BBSJ 1U2WA 2QSHX 1MDMA 2CV0A 2MH2A 3QPHA 3HUGA 3M1CA 1P4WA 3I3LA 1ETVA 4XLPF 1FZPB 2XSJC 3HM5A 4V2FA 3WTYC 4TV7A 1JUSA 2KKOA 4PJJA 1PUFB 1HXDA 4M6YA 2JA7J 3MKWB 4LJZF 2FF4A 4XMYA 4BXUA 4BQOA 4HV6A 1IN7A 3DLAA 4PJ0C 3RQ4A 1ZRDA 2D2WA 2IA0A 2V1NA 3L2CA 2Z99A 2EFOA 1IXSB 4PGHA 5LHHA 2HQAA 5K5QA 3BCAA 2ZXJA 3IRRA 3OL4A 3WTXC 3Q3SA 5FGMA 2DFFA 3CO6C 3R60A 5ILUA 4ZC3A 2R7DA 4AYBN 2I10A 3FM5A 2ZXHA 2ETHA 1XMKA 1R1VA 3K4BA 3IH2A 2ZCWA 4S05A 1LFUP 5LGNA 2ZJRF 1STZA 4IRIA 2E2IJ 1FSEA 5DYMA 4ESBA 2L4MA 1RR7A 1Z6TA 2BHZA 1YI2I 3DLLF 1I1GA 2H6CA 2IRFG 3UKGA 4BNCA 3CMAI 4E7LA 3ZMVA 5JI6A 1A35A 3K1NA 3A2KA 3GTQJ 5KCMA 1Z7UA 2A05A 2XV4S 5D5UB 3CCYA 4G7ZF 2JQ7A 2VPLA 4LB6B 2DA3A 3KETA 2ISZA 1XN7A 3BWGA 3C1DA 2FRHA 5LEKA 3ZCOA 2M0CA 1ITYA 5KAIC 2W7NA 1U8BA 2BV6A 2HQNA 1FMWA 2FUG2 1QPIA 1K7AA 3EETA 4A6EA 2HKOA 1KU7A 4A5NA 2JT1A 2M7BA 3R4KA 4AIDA 3OV8A 3TW6A 2YS9A 4XN3A 2MD5A 3DPTA 3DPUA 2IXSA 2JRTA 2K3PA 5D6FA 3LAJA 1Y1VJ 1MKMA 2DO7A 4HA8A 4LFUA 4YRVA 4IO9F 1SFXA 1M1EB 5FO5A 1D3YA 2AHQA 4NC7A 4DNCA 3HRSA 4HF0A 2FMYA 2EPFA 2GA2A 1QVTA 3QU6A 1RESA 3QYFA 1VQ9I 5IPAA 5IT3A 2ZBKA 2FMLA 3L00A 5ED4A 4C2TA 5KVRA 1Z0XA 4V2GA 2VJ5A 4U87A 3A1YA 1E0EA 3V8JA 2Z5UA 2E1NA 5BS6A 3BQZA 3CTAA 3LL7A 1OCTC 4A93J 4ZYAA 4KJZA 4N4OB 1B9NA 4I0AA 1JXSA 2E34A 2DXIA 1VQMI 2QENA 1ZQ3P 2F48A 3I58A 4HLXA 2VOPA 3F0CA 3GWZA 3HSEA 4BQQA 3OS0A 2QKMB 3PUBA 2DOAA 4CGZA 1ONVA 1FBQA 3VYSB 4EJOA 1R00A 3FHZA 4ZTJA 1VQKI 2COBA 2O6GE 2DJNA 5C4JJ 2BVLA 4MIMA 2ZFUA 1C0WA 1MDMB 2NNNA 2OJED 3TO6A 2K4JA 3V4GA 2OD5A 1WGXA 3IUOA 2WV0A 5DS9A 1K61A 2YU9J 5C4XJ 2H1LA 2KISA 5FB2A 1YTYA 3P9KA 2M34A 4BJTA 5A2QZ 4Y13A 1JKOC 2DTRA 3SJMA 1R6RA 2G7UA 3SYTA 4Q48A 1UG2A 1JUPA 1YX3A 2E60A 1OYWA 4MQVA 1GV5A 2QUFA 1BN5A 1TW2A 2TCTA 3X2QH 3IV5A 2PJRB 1DGWY 3KP4A 5K1YA 4RGSA 3DV8A 1XSXA 1XX5A 3REOA 4A3KJ 2FQ4A 1UELB 1S7AA 1TNSA 4IQJA 4M9SA 4G9YA 4HX8A 3P9CA 4JX5A 2W24A 5IYDJ 1B8IA 2UUZA 1FYMA 4LLNA 2Q2EB 2XF6A 3I59A 2XAQA 2UWMA 3AG1H 3ZMDA 1U0JA 4OIQF 2ID3A 5H6RA 1HKTA 2GQQA 4UUVA 3F8MA 3TO9A 2ECCA 2DFIA 5HVQC 2Z16A 3ASNH 5BOXA 2MABA 3S1MJ 3FBIB 2EZHA 3B02A 2IA1A 1BIBA 1RNLA 2X48A 1V5EA 2FEZA 4IXAA 2P7VB 3BZKA 4M3EA 2XAGA 1SD5A 3I64A 1QNTA 4ITVA 4F3QA 3ZQLA 2IPQX 2OTLI 2CG4A 1CQTA 1KQ9A 2Q0OA 2VKDA 1SD6A 4OIPF 2PMZN 3ZXSA 4HYEA 4C2MJ 4I09A 3OYBA 1BJAA 2GIZA 2VE8A 1LDDA 2KT0A 1G6NA 1U6GA 4PFPA 2CGPA 1FWZA 2NS0A 1BBYA 5F1JA 2G0EA 3OOUA 3CESA 4ZZDA 3E0JB 4BHBA 3HOXJ 2XASA 5FRNA 2X85A 3G2BA 2O8KA 4EV0A 1RUNA 1YW9A 1X2NA 4D9JA 4LMYA 2EINH 2EIMH 4OMYA 1JGGA 3RYPA 4G8XA 2X4HA 4IHSA 3S2WA 5KAFC 3I4PA 3JRBA 1ODDA 1I6HJ 4RMNA 1U3EM 1SVOA 4YFKF 1SANA 3AFHA 3ZMZA 2L7FP 2PMZA 3BZCA 4KN7X 3C2HA 2NVUB 1S5LC 2XPWA 4KA4A 2R7UA 1R23A 3V42A 5JFRA 2D1HA 1GHCA 1K6YA 5D5XB 3Q5FA 1TT0A 1TWCJ 3VSKA 4ENMA 1FX7A 3DBRB 5JR3A 3LSIA 4B4CA 2HTSA 3BPXA 3GO5A 4HG2A 4PK4A 1FT9A 2BY1A 4RDUA 2R7TA 3J81Z 1W36C 4M6XA 4Y17A 3WU1B 2XGXA 1I27A 4WF2A 4UUSB 2XSDC 1O4XA 2NOJB 1SD7A 2TDXA 4M3DA 5J4VA 4DW6A 3J7YJ 3WG9A 1WH5A 1Z7LA 1AWCA 4G6TB 3F8FA 1FTTA 1W0UA 2TRTA 1QQIA 4QIWN 2DMUA 3HPGA 4BXFA 3DFGA 4YG2F 2CW8A 2FD5A 2CQNA 4QLCU 3NWSA 2Q2EA 5FKKA 2STTA 1O3RA 4YEJA 4CZCA 5DDGA 2JN6A 1MMGA 2VN2A 2WY7Q 3E6DA 4WX9A 1O3SA 4N0BA 3FXOA 2PBIA 4HZFA 2B63J 2VUMJ 2IGKA 4CHUA 2PJRA 4GYIA 1WFXA 2GXGA 1Z3YA 2V26A 3ZQFA 1PDNC 3F8NA 3A0HC 1P6RA 1P9QC 4FQGA 2W25A 3G71I 3EQLF 2HU9A 3A01A 4ETSA 2D45A 2KZGA 2P8TA 2H8RA 1ZG5A 1JT6A 1AOYA 2KP6A 3E5QA 4P5OA 1XGNA 2PLYA 1MJ9A 3DKWA 3H9GA 5F64A 2IAIA 2MFZA 3W3CA 1A04A 1BC7C 2Y0MA 1ON1A 4U0YA 4Q5SF 4XICA 1BM9A 2QSFX 1V55H 2Z1DA 1IUFA 4DOZA 2NRAC 1ON2A 4XONA 3HGYA 1VQ6I 1ZGWA 1O57A 1TLHB 2O0YA 4KFCA 1ETQA 4M9ZA 2Y75A 5EDNA 3GLLA 1MMSA 2EWNA 5DEQA 2DYSH 3BR6A 5HLHA 3WGIA 1OFCX 4HQMA 3GYHX 3K69A 2ME0A 3E6BA 4RAGA 1BL0A 3DEWA 3CUQB 4Y15A 2PQ8A 1HCRA 2LNBA 1E2XA 2P6TA 3CDIA 5AIPA 4HW0A 3W2VA 4HNUA 5LGTA 2H6BA 1JKRC 3QODA 2V4JC 2VKHA 1R36A 4CDGA 2VOOA 5LEJA 3TO7A 1Y1WJ 1XGSA 4NC6A 1GVDA 5M5WJ 3J80Z 3ZQHA 3GFLA 1SFOJ 1UAAA 1QO0D 3NAUA 2P81A 3HOZJ 1FEXA 2F6CA 1W5TA 3K9TA 5J47A 3IAM2 4M3FA 3V7SA 3TOBA 2FBHA 4F93B 2DDBA 4MGRA 4MQ9F 1S29A 4DJAA 3ZP5A 2X6WA 3PUFA 2NVTJ 3ERMA 2L2OA 1FNNA 4ESFA 3BR2A 1EA3A 4UB6C 2HKXA 3CDLA 1A36A 4LIVA 3AL0C 1ZELA 4BUPA 2LVSA 4II3A 5DV5A 1X3WB 5FKNA 1IO2A 3C2BA 3KZYA 1FIPA 1SFUA 3N4MA 2XGEA 2DOEA 1WI9A 4MHGA 2CSOA 5HDKA 4BS9A 1XDSA 3OYKA 3K4JA 3IKVA 1QRYA 3KEQA 2FXAA 1WSUA 1REPC 5B3SH 4NBQA 2XB0X 1XB4A 3HEFA 4OAYA 2JK3A 2ZNZA 2LK2A 4MEXF 3U1DA 3GVAA 3O3KA 2OZ6A 3HRUA 5FKOA 2L9SA 2YPRA 3VDXA 3CC4I 1O7LA 4EVIA 4LG0A 4L5EA 3GFMA 3LSHA 1O7FA 3OYCA 1JGSA 2N8GA 3H3ZA 4UUSA 2BE5F 4JP0A 3TDUC 3TMOA 3ULQB 5H6QA 1TTYA 4N4NB 1SVMA 4CA0A 3OMYA 4X0GA 2LOOA 4XM3A 2JA5J 2M5WA 2DPUA 1LNWA 4DYRA 3LFKA 1ZG3A 3K70C 4EM2A 5E1ZB 2KIUA 2O3FA 2FQ3A 5B66C 2VONA 2P6SA 4AM3A 1PP8F 2BZTA 4XLHA 5FD6A 1Y39A 4UB8C 1VF9A 1SEUA 3BT9A 4UXNA 2A6HF 2VQLA 5DCFA 1U78A 5FFXA 2HGCA 4AD9A 1B59A 4YIFA 1UCRA 3QU3A 3PNTA 4ZDLA 1N78A 2DOFA 4RM2A 2A68F 2BY0A 2MBFA 4I2OA 1IDZA 2I5UA 5DM6F 1UHWA 4B43A 4HX7A 1DDNA 4BY1J 1E3HA 4Y3OA 3GZ6A 1S7EA 3B6AA 4CICA 3RKWA 2ICWG 5F08A 4DBQA 4O6JA 2K9NA 5CKTA 3F8BA 1R22A 2JVHA 1PYVA 5ICFA 2FJ1A 3KCCA 4XRMA 4WXHA 1CGPA 1EH8A 5IOYA 2LRDA 1ZRCA 3JRIA 4ENJA 1GT0C 1Q1HA 2JPCA 1SFEA 5ICGA 2UZKA 1WQ2A 1BR4A 2LF8A 2VKVA 3CP8A 2VASA 3M07A 3BJ6A 3P5JA 1S3JA 2DN0A 3I71A 2DQRA 2XF5A 5L3BA 2EFPA 1JTXA 1PUEE 2DAOA 3E6CC 1QZZA 5EGOB 3OYHA 4BAYA 2M87A 4R1HA 4ZH4F 1FOKA 4EJTA 3CJNA 1ETKA 2NAZA 1VQNI 3NWTA 1OLTA 4L5JA 3EUKL 3BP8A 5K7FA 4J00A 3IAS2 4WCGA 1N25A 4DGWB 5D5WB 3MCZA 4EMSA 2OC6A 2R7WA 1NH3A 5GTHC 2OV7A 3E6MA 3I0TA 3K4MA 3O6BB 5E20A 5KNLA 3HRMA 5M5YJ 1K78A 1A31A 5F0FA 1NG7A 1Q1VA 1LB2A 2R7RA 2IA2A 3CJQB 3ZQ7A 5CPRB 3QOPA 3FMRA 3KE2A 5TISC 4EJUA 4P9FA 1YJWI 3OL3A 1SC7A 2XAUA 4YFXF 4BHCA 1AU7A 2WAFA 3HHHA 3I53A 5IYCJ 2A5YB 2LYCA 1R49A 3HZJA 2QWWA 2LDUA 5L3DA 4ZYDA 1LKXA 3U2RA 4MO7A 3Q0WA 4EQQA 3NARA 4A3FJ 2ISYA 2FOKA 2HYFA 3FXQA 2CV1A 5TJJA 1X1PA 3RIRA 4C2UA 3OIOA 3HPHA 2HYJA 3KFWX 2EFWA 4P55A 5D4RA 2BYVE 2XB5A 1YOVB 2EIKH 2LF7A 2V7FA 4IRGA 2JA6J 4L9VA 2E2JJ 2VJIA 3ZQQA 1QHGA 1LFPA 3AG3H 1TWGJ 2GBYA 4HBLA 2VL8A 1E17A 3GFJA 1OMIA 2F5EA 4A5MA 1RC9A 3CMYA 5E79C 2P0WA 1YRNA 2VQCA 2ME6A 4PGGA 3T8TA 5E8IA
chains in the Genus database with same CATH topology
1QGPA 3HHGA 4G7HF 2M30A 4RGUA 5FFZA 1B1BA 4LLLA 4RGXA 2OA4A 3GXOA 3IKTA 3DXJF 3PQJA 5HLGA 5HS7A 3W6KB 2DK8A 3JSOA 1K79A 1CF7A 2YX4A 5FLXZ 3E5UA 1USSA 3MEXA 2RDPA 2IJLA 1IW7F 3CUOA 1FBUA 1H9TA 2NYXA 3FMSA 4GXOA 1BOAA 2WWYA 4HDUA 4A12A 3GX4X 1NHAA 4UHTA 2QQBA 2IVMA 1G3TA 2RGVA 1HBXG 5E17F 5DCMB 1TQPA 2H27A 3EYIA 2A3SA 3KP7A 3M8EA 3HOSA 4KICA 1IRGA 3RJPA 3ZMTA 5ERIA 4YFNF 4WXCA 2E1CA 2IW5A 3CUQA 3JAMK 5LHGA 3SQNA 1J59A 3TKYA 2H09A 2PG4A 4K2EA 5DUKA 4I7HA 1OPCA 1HW5A 3QRFF 1ZG1A 5JHUA 2R3SA 2CWEA 2P4WA 3WGHA 4I01A 1IXCA 1J2XA 1XSDA 3H3UA 2KIMA 5CVVA 4G6DA 1R1UA 5CVJA 2G9WA 5F6FA 1YS6A 1BIAA 3KP6A 1HKQA 3F6VA 4ON0A 3WTVC 2P5KA 1MJBA 1XMAA 3P9IA 5D4SA 5DD4A 4KNYA 2PMUA 4UNOA 4O3MA 2QZ8A 1I1SA 2OBPA 1LDKB 3BROA 4ESJA 4MTEA 4NHJA 4LB5A 4ZYGA 2R7FA 1ZN2A 2CO5A 1T2KA 2RV8A 2A69F 2CQKA 3B73A 2AXLA 2L4AA 4RS8A 5A2QK 4H0EA 4WXDA 3ABUA 2HDCA 5IT9K 1MGTA 4A0YA 1G4DA 1SD4A 1R5GA 2EFNA 3FZVA 2ELHA 1YW8A 1Z1DA 1EH7A 1IXRC 5E1WA 5K5RA 4IVNA 4O5VA 3KEOA 1BI1A 1S6LA 1G3YA 1ZH5A 1KYWA 2DT5A 5L3CA 3C7JA 4R79A 2XIGA 1ZGAA 3N97A 1KU9A 2W84A 1L3LA 1XGMA 5H20A 5LRSA 1XCBA 3M7GA 2JPBA 3M8FA 3JW4A 1Z6RA 3HRTA 3PFIA 2V1UA 4LGWA 4WWCA 2MH9A 2IP2A 5L3GA 3P7NA 2EK5A 2OZUA 5CVIA 4U0WA 3ROUA 2MC3A 2XROA 2VBZA 1H9GA 2DI3A 2XAFA 1MJAA 2Q8KA 2EFQA 2XUBA 2OAZA 5EEHA 3GUDA 1B4AA 2EV0A 3IWFA 3EDPA 2VE9A 1V4RA 1FC3A 5ILVA 5J8FA 3FMQA 2EV6A 2L3DA 3KZZA 4N9HA 3L7WA 3ISPA 1MD0A 2BBYA 2ESHA 1FBSA 4M71A 5LBQA 2ESNA 3HIFA 1YLFA 3ERED 2QLZA 2K02A 1EV7A 2KJCA 3BY6A 3LA7A 1K78B 4B09A 3VFZA 2RVCA 3V7RA 3Q9SA 3ZN1A 2HFHA 3I54A 1U5TA 1WWXA 1DUXC 2BEOA 1B9MA 5BMZA 5EEGA 1R1TA 4B8XA 4ZYHA 4I0BA 5HOOA 2M8EA 3RPQA 3VEPA 5CVUA 5LHIA 2GAUA 4OINF 3RKXA 1GXPA 1IF1A 2FU4A 4RB2C 4FHTA 1KQ0A 3LWFA 2VODA 1WKMA 4GGGA 4FX4A 5L3FA 5K5OA 4G7OF 3LA3A 3JTGA 1F1ZA 2HTJA 3I59B 4A6DA 2L54A 4RAZA 4OIOF 2EJRA 1FP1D 1ZLKA 4A0ZA 3RPUA 4KMFA 1HW2A 1WRJA 3KP2A 2QM3A 5L3EA 4L9JA 1KQ8A 4G94A 4S04A 3WTWC 4IJAA 3MAJA 1KU2A 4AVPA 4KIFA 1LEAA 3WU0A 2HOEA 1JHHA 5E1XA 3ECOA 3DPLC 5HLIA 2OQRA 2GWRA 5FD5A 4RAYA 3C3WA 2V6CA 5DD8A 3D0SA 2EA2A 1EH6A 1IZ1A 1F4KA 2ZKZA 4CO8A 1IN5A 5FLXK 2VC1A 5CVRA 3F6OA 4LD5A 3F72A 2RC4A 2O8XA 2PEXA 4CXFA 3WE3A 3DF8A 1J5YA 2KRFA 2VBWA 3HTUA 4ZYEA 3ZN0A 2GXBA 1D8KA 1ZGJA 3GW2A 4RB3C 2KIFA 1MZBA 3TQNA 4M72A 4JK1X 2P7CB 5J6XA 2ZFWA 4EJVA 1RI7A 4BHPA 1DPUA 4AIJA 5CLSA 2L01A 4BQAA 2O61A 4A2UA 4Q47A 2YX7A 1GVJA 2CYYA 3KLOA 1O3TA 1P92A 3T0YA 1FLIA 1RZ4A 5HDGA 2ZO4A 4HV5A 1D5VA 4U88A 3VB2A 1Z05A 2MLKA 2VT3A 4UVBA 3QPTA 1PP7U 3ZPLA 1W7PB 1YW7A 2HZTA 3ABTA 2GA1A 2JZYA 1FY7A 3GLXA 4UVAA 4HF2A 2ZMEB 4MTDA 4GO1A 3QAHA 4AIKA 4KIBA 2PI0A 3RYRA 4DQ2A 2E7XA 1U8RA 1LDJA 2K86A 4XSZF 3FXRA 1YG2A 4P9UA 1R5HA 1XDUA 3D5LA 1I5ZA 2FNPA 1YYVA 2FBIA 4L9NA 2YU3A 4PZJA 1LEBA 1FYLA 2LKPA 2M45A 2K27A 5DUIA 4YIIA 2QVOA 5LGUA 4L9TA 1XGOA 2HS5A 2YSRA 3E97A 3F3XA 4HLYA 4KUMA 2J5OA 3SXYA 2XAHA 3R0JA 3DQVC 1D8JA 2HWVA 2M1BA 3F21A 3ECHA 4P96A 3H92A 3W6JB 3GFIA 1RIOH 3J7AO 3J80K 3KP3A 2GZWA 3FM3A 3KLNA 1G3SA 2XKOA 1HSTA 2EV5A 2X0LA 2VBXA 4XSXF 1XD7A 2JTVA 1JHFA 5D5VB 3ELKA 2F5FA 4HOBA 3ML6A 4CZZA 2OQGA 2ZNYA 3RTRA 4M74A 1OYIA 5D6EA 4KT5C 4GYGA 3ZMUA 4L18B 1ZREA 6PAXA 1OKRA 1KU3A 4FX0A 3JSPA 1BI2A 1BC8C 2QQ9A 5HS8A 3T1BA 4Z2YA 3PQKA 4IRHA 1IN8A 2AS5F 3DEUA 2ZMEA 1GXQA 3QP5A 4XBFA 2RKHA 3MWMA 2O03A 3JAMZ 4AWXB 2Z3YA 1KGSA 4JQFA 3M9AA 3SHFA 3E3VA 3K1MA 3MQ0A 1X3UA 3TOAA 2XHKA 3WTUC 4PDKA 5LLQA 3C18A 2XVCA 2B0LA 4EGZA 4G6QA 1S7OA 4EM0B 1P2FA 3U9GA 1ZAOA 4GCVA 2PJPA 2QBYB 2VBYA 2HR3A 4AIHA 1TNTA 3HSFA 1ZYRF 2L02A 3KP5A 2H94A 2V1DA 1YQAA 4OU0A 3MFKA 2P5LC 1RUOA 3VOEA 1R58A 4L5IA 1K6OA 4OIRF 3GF2A 1HKSA 1J75A 1OYYA 4ENNA 1DP7P 1V3FA 2Z9OA 3R0AA 2ZJ2A 2OU2A 3BZ6A 2KJBA 5IT9Z 1HW1A 4XLNF 4JBAA 4HQEA 4NQWA 1T98A 3WTZA 1LQ1A 3LAPA 1VTNC 4LLGF 1KA8A 1QZYA 1ULYA 3IRQA 2CW0F 2COMA 3QP6A 2FBKA 3HSRA 2XAJA 3IWZA 2D1VA 2YR2A 1XCVA 5E8GA 1SAXA 4PCQA 3HOTA 4IHTA 4KYWA 3MZYA 4HF1A 4ASNA 4N9IA 1HSJA 1YS7A 1UB9A 3TGNA 3G73A 1CF7B 3BPVA 3LA2A 1FSHA 4BH9A 5ICEA 1ZRFA 4XRFA 3RDIA 3V7CA 2F5CA 4F7ZA 1DPRA 4R8HA 5CJ9A 1ZARA 1OR7A 2RNJA 1SMTA 4U7DA 2ADUA 1P4XA 4A0XA 5HDNA 4D0PA 3R6SA 5AONA 1Y0UA 3HYIA 3SFZA 1B6AA 1J9IA 3CO7C 2DPDA 3L09A 3GEZA 2RQPA 3ZMSA 2DK5A 2IT0A 4FT8A 3BJOA 1FPQA 2FNAA 4M9XA 4LG0B 1IAWA 1T38A 2ACJA 3K1PA 1UHMA 1IRFA 1T39A 5E18F 2WTEA 2MA3A 4MNUA 2A6EF 3F22A 1F9NA 2V9VA 1USTA 2PN6A 4UVCA 1SMYF 2C6YA 4IPAA 3T8RA 4IF4A 1QBJA 3GZ5A 1R7JA 4WK8F 5ICCA 3E5XA 3BOQA 3CLOA 3VODA 5AIQA 2A61A 1IN4A 1TW3A 3SZTA 1JE8A 1FYKA 2A07F 1KYZA 4U0VA 1I6XA 1O3QA 3AAFA 3TDZC 2Z33A 2XKPA 3EUHA 2F5DA 2QQAA 1T6SA 2NNYA 2XRNA 2MLGA 2W85A 3NRVA 4LK1F 1P4AA 5BQTA 2V79A 2LSOA 5CYVA 2EA4A 1U5TC 2GIVA 3M1EA 1TBXA 3SZPA 3COAC 2HEOA 1QPMA 1BI0A 5BPIA 4BYYA 1W7PD 2G7HA 5LRRA 1IN6A 2E7WA 3K2ZA 3RI4A 1W7PA 3WODF 3EYYA 1UFMA 4L0ZB 2WC2A 4QWQA 1TQMA 3DP7A 4LK0F 1HQCA 5HS9A 3FF5A 1W5SA 3FWEA 1J7KA 3OOPA 1BI3A 4L0YB 4HAMA 1G3WA 3BDDA 3Q9VA 3RKYA 3IL2A 2FE3A 1FP2A 4E70A 5JVTA 2VT2A 2J5PA 3CDHA 2F2EA 5D8LB 3G3ZA 1TQIA 2RN7A 2QBYA 1ZHFA 4I02A 4I98B 4Q4ZF 4RB0A 2STWA 2PMHA 4KMUX 3LQQA 3HTSB 4HX4A 3CUQC 5KK1A 1ZLJA 3IC7A 4EM1A 4KIGA 5TRDA 3O2PE 2VXZA 3FXUA 1YO5C 2BGCA 4ENKA 2FA5A 5BPDA 1Z91A 1T0FA 3WTTC 3MZHA 1XSVA 2EB7A 4RB1A 5DCMA 3NQOA 3WTSC 2K7LA 4M73A 1J0RA 1IUYA 2VC0A 4OOIA 4CYDA 2DQLA 3L9FA 2HQRA 2K4BA 1H0MA 5ILSA 4EJWA 1YFHA 3WGGA 2DLLA 1LJ9A 3K0LA 3I5UA 3NEUA 3LQRA 5J8CA 4UV9A 1Z9CA 2DW4A 2Y48A 4HDVA 3JTHA 2FSWA 3F23A 2HYGD 4U7BA 2V1XA 3T5XA 1L0OC 4NB5A 2P5VA 2DBBA 3FX3A 2DU9A 5F1RA 3J81K 4RGRA 1S8NA 2UXXA 2JSCA 3R61A 1U5TB 4UV8A 2PFBA 3LSTA 2W57A 3F8CA 3WE2A 3V8KA 4KDPA 3IHUA 4MEYF 3V8LA 2QYOA 1LVAA 1W4MA 4ZZLA 2CFXA 1F5TA 4KN4X 3BJAA 1YIOA 2UXNA 4OMZA 4EGYA 5D8KB 1U2WA 1MDMA 2MH2A 3QPHA 3HUGA 1P4WA 4XLPF 1FZPB 3WTYC 4TV7A 2KKOA 1HXDA 4M6YA 4LJZF 2FF4A 4BXUA 4HV6A 1IN7A 1ZRDA 2D2WA 2IA0A 3L2CA 2Z99A 2EFOA 1IXSB 4PGHA 5LHHA 5K5QA 2ZXJA 3IRRA 3WTXC 5FGMA 3CO6C 3R60A 5ILUA 2R7DA 3FM5A 2ETHA 1XMKA 1R1VA 2ZCWA 4S05A 5LGNA 1STZA 4IRIA 1FSEA 5DYMA 4ESBA 2L4MA 1Z6TA 1I1GA 2H6CA 2IRFG 4BNCA 3ZMVA 5JI6A 3K1NA 1Z7UA 5D5UB 2XV4S 4G7ZF 4LB6B 3KETA 2ISZA 1XN7A 3BWGA 5LEKA 2FRHA 3C1DA 2BV6A 2HQNA 1K7AA 3EETA 4A6EA 2HKOA 1KU7A 4A5NA 2JT1A 3R4KA 3OV8A 2MD5A 3DPTA 2JRTA 5D6FA 3LAJA 1MKMA 2DO7A 4HA8A 4LFUA 1SFXA 5FO5A 1D3YA 4DNCA 3HRSA 4HF0A 2GA2A 2FMYA 3QU6A 5IT3A 2ZBKA 2FMLA 3L00A 5ED4A 5KVRA 3V8JA 2Z5UA 2E1NA 5BS6A 3CTAA 1B9NA 4I0AA 1JXSA 2QENA 3I58A 4HLXA 2VOPA 3GWZA 3HSEA 4CGZA 1ONVA 1FBQA 4EJOA 1R00A 3FHZA 2O6GE 1C0WA 1MDMB 2NNNA 3TO6A 2K4JA 3V4GA 2OD5A 2WV0A 5FB2A 1YTYA 3P9KA 5A2QZ 4Y13A 2DTRA 2G7UA 4Q48A 1OYWA 4MQVA 2QUFA 1BN5A 1TW2A 3KP4A 5K1YA 4RGSA 3DV8A 1XSXA 3REOA 1S7AA 1TNSA 4M9SA 4G9YA 4HX8A 3P9CA 2W24A 1FYMA 4LLNA 3I59A 2XAQA 2UWMA 3ZMDA 4OIQF 5H6RA 1HKTA 2GQQA 4UUVA 3F8MA 3TO9A 2DFIA 5HVQC 5BOXA 3B02A 2IA1A 1BIBA 1RNLA 2FEZA 4IXAA 2P7VB 2XAGA 1SD5A 3I64A 1QNTA 2IPQX 2CG4A 1KQ9A 2Q0OA 1SD6A 4OIPF 4HYEA 4I09A 1BJAA 2VE8A 1LDDA 1G6NA 1U6GA 2CGPA 1FWZA 2NS0A 1BBYA 4ZZDA 4BHBA 2XASA 4EV0A 1RUNA 1YW9A 4LMYA 4OMYA 3RYPA 4G8XA 2X4HA 4IHSA 3S2WA 3I4PA 1ODDA 1U3EM 4YFKF 3ZMZA 4KN7X 4KA4A 1R23A 5JFRA 2D1HA 1GHCA 5D5XB 3Q5FA 4ENMA 1FX7A 5JR3A 2HTSA 3BPXA 3GO5A 1FT9A 3J81Z 4M6XA 4Y17A 3WU1B 2XGXA 1I27A 4WF2A 1SD7A 2TDXA 3WG9A 1AWCA 3F8FA 1QQIA 3DFGA 4YG2F 4QLCU 2Q2EA 2STTA 1O3RA 5DDGA 2VN2A 3E6DA 4WX9A 1O3SA 4N0BA 2PBIA 4HZFA 4CHUA 4GYIA 2GXGA 1PDNC 3F8NA 1P6RA 2W25A 3EQLF 4ETSA 2D45A 2P8TA 1ZG5A 1AOYA 3E5QA 4P5OA 1XGNA 2PLYA 1MJ9A 3DKWA 5F64A 1A04A 1BC7C 2Y0MA 1ON1A 4U0YA 4Q5SF 1BM9A 2NRAC 1ON2A 1O57A 1TLHB 2O0YA 4KFCA 4M9ZA 2Y75A 2EWNA 5DEQA 3WGIA 5HLHA 4HQMA 3GYHX 3K69A 3E6BA 4Y15A 3CUQB 2PQ8A 2LNBA 1E2XA 2P6TA 5AIPA 4HW0A 5LGTA 2H6BA 1R36A 4CDGA 2VOOA 5LEJA 3TO7A 1XGSA 3J80Z 3GFLA 1QO0D 1W5TA 3K9TA 3V7SA 3TOBA 2FBHA 4MGRA 4MQ9F 1S29A 3ZP5A 1FNNA 4ESFA 2HKXA 5DV5A 3KZYA 1SFUA 3N4MA 1WI9A 4MHGA 2CSOA 5HDKA 1XDSA 3IKVA 3KEQA 2FXAA 1WSUA 1REPC 1XB4A 2ZNZA 4MEXF 3U1DA 3GVAA 3O3KA 2OZ6A 3HRUA 2YPRA 1O7LA 4EVIA 4LG0A 3GFMA 1O7FA 1JGSA 3H3ZA 2BE5F 3TDUC 3ULQB 5H6QA 1TTYA 2M5WA 2DPUA 1LNWA 3LFKA 1ZG3A 4EM2A 5E1ZB 2KIUA 2O3FA 2FQ3A 2VONA 2P6SA 1PP8F 5FD6A 5DCFA 2A6HF 4UXNA 1U78A 5FFXA 2HGCA 4AD9A 1B59A 4YIFA 1UCRA 3QU3A 2A68F 2MBFA 4I2OA 1UHWA 4HX7A 1DDNA 3GZ6A 4CICA 3RKWA 4O6JA 3F8BA 1R22A 5ICFA 3KCCA 4WXHA 1CGPA 1EH8A 1ZRCA 4ENJA 1Q1HA 2JPCA 1SFEA 5ICGA 2UZKA 1WQ2A 2LF8A 3BJ6A 1S3JA 3I71A 2DQRA 5L3BA 2EFPA 1PUEE 2DAOA 3E6CC 1QZZA 4BAYA 2M87A 4R1HA 4ZH4F 1FOKA 4EJTA 3CJNA 2NAZA 4L5JA 3BP8A 4WCGA 5D5WB 3MCZA 4EMSA 3E6MA 3I0TA 3O6BB 5E20A 3HRMA 1K78A 1LB2A 2IA2A 3ZQ7A 3QOPA 3FMRA 3KE2A 4EJUA 4P9FA 4YFXF 4BHCA 3HHHA 3I53A 2A5YB 2QWWA 2LDUA 5L3DA 4ZYDA 3U2RA 4EQQA 2ISYA 2FOKA 2HYFA 3FXQA 5TJJA 3RIRA 3KFWX 2EFWA 4P55A 5D4RA 2BYVE 2LF7A 4IRGA 4L9VA 4HBLA 1E17A 3GFJA 1OMIA 2F5EA 4A5MA 4PGGA 3T8TA 5E8IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QGP A;  3HHG A;  4G7H F;  2M30 A;  4RGU A;  5FFZ A;  1B1B A;  4LLL A;  4RGX A;  2OA4 A;  3GXO A;  3IKT A;  3DXJ F;  3PQJ A;  5HLG A;  5HS7 A;  3W6K B;  2DK8 A;  3JSO A;  1K79 A;  1CF7 A;  2YX4 A;  5FLX Z;  3E5U A;  1USS A;  3MEX A;  2RDP A;  2IJL A;  1IW7 F;  3CUO A;  1FBU A;  1H9T A;  2NYX A;  3FMS A;  4GXO A;  1BOA A;  2WWY A;  4HDU A;  4A12 A;  3GX4 X;  1NHA A;  4UHT A;  2QQB A;  2IVM A;  1G3T A;  2RGV A;  1HBX G;  5E17 F;  5DCM B;  1TQP A;  2H27 A;  3EYI A;  2A3S A;  3KP7 A;  3M8E A;  3HOS A;  4KIC A;  1IRG A;  3RJP A;  3ZMT A;  5ERI A;  4YFN F;  4WXC A;  2E1C A;  2IW5 A;  3CUQ A;  3JAM K;  5LHG A;  3SQN A;  1J59 A;  3TKY A;  2H09 A;  2PG4 A;  4K2E A;  5DUK A;  4I7H A;  1OPC A;  1HW5 A;  3QRF F;  1ZG1 A;  5JHU A;  2R3S A;  2CWE A;  2P4W A;  3WGH A;  4I01 A;  1IXC A;  1J2X A;  1XSD A;  3H3U A;  2KIM A;  5CVV A;  4G6D A;  1R1U A;  5CVJ A;  2G9W A;  5F6F A;  1YS6 A;  1BIA A;  3KP6 A;  1HKQ A;  3F6V A;  4ON0 A;  3WTV C;  2P5K A;  1MJB A;  1XMA A;  3P9I A;  5D4S A;  5DD4 A;  4KNY A;  2PMU A;  4UNO A;  4O3M A;  2QZ8 A;  1I1S A;  2OBP A;  1LDK B;  3BRO A;  4ESJ A;  4MTE A;  4NHJ A;  4LB5 A;  4ZYG A;  2R7F A;  1ZN2 A;  2CO5 A;  1T2K A;  2RV8 A;  2A69 F;  2CQK A;  3B73 A;  2AXL A;  2L4A A;  4RS8 A;  5A2Q K;  4H0E A;  4WXD A;  3ABU A;  2HDC A;  5IT9 K;  1MGT A;  4A0Y A;  1G4D A;  1SD4 A;  1R5G A;  2EFN A;  3FZV A;  2ELH A;  1YW8 A;  1Z1D A;  1EH7 A;  1IXR C;  5E1W A;  5K5R A;  4IVN A;  4O5V A;  3KEO A;  1BI1 A;  1S6L A;  1G3Y A;  1ZH5 A;  1KYW A;  2DT5 A;  5L3C A;  3C7J A;  4R79 A;  2XIG A;  1ZGA A;  3N97 A;  1KU9 A;  2W84 A;  1L3L A;  1XGM A;  5H20 A;  5LRS A;  1XCB A;  3M7G A;  2JPB A;  3M8F A;  3JW4 A;  1Z6R A;  3HRT A;  3PFI A;  2V1U A;  4LGW A;  4WWC A;  2MH9 A;  2IP2 A;  5L3G A;  3P7N A;  2EK5 A;  2OZU A;  5CVI A;  4U0W A;  3ROU A;  2MC3 A;  2XRO A;  2VBZ A;  1H9G A;  2DI3 A;  2XAF A;  1MJA A;  2Q8K A;  2EFQ A;  2XUB A;  2OAZ A;  5EEH A;  3GUD A;  1B4A A;  2EV0 A;  3IWF A;  3EDP A;  2VE9 A;  1V4R A;  1FC3 A;  5ILV A;  5J8F A;  3FMQ A;  2EV6 A;  2L3D A;  3KZZ A;  4N9H A;  3L7W A;  3ISP A;  1MD0 A;  2BBY A;  2ESH A;  1FBS A;  4M71 A;  5LBQ A;  2ESN A;  3HIF A;  1YLF A;  3ERE D;  2QLZ A;  2K02 A;  1EV7 A;  2KJC A;  3BY6 A;  3LA7 A;  1K78 B;  4B09 A;  3VFZ A;  2RVC A;  3V7R A;  3Q9S A;  3ZN1 A;  2HFH A;  3I54 A;  1U5T A;  1WWX A;  1DUX C;  2BEO A;  1B9M A;  5BMZ A;  5EEG A;  1R1T A;  4B8X A;  4ZYH A;  4I0B A;  5HOO A;  2M8E A;  3RPQ A;  3VEP A;  5CVU A;  5LHI A;  2GAU A;  4OIN F;  3RKX A;  1GXP A;  1IF1 A;  2FU4 A;  4RB2 C;  4FHT A;  1KQ0 A;  3LWF A;  2VOD A;  1WKM A;  4GGG A;  4FX4 A;  5L3F A;  5K5O A;  4G7O F;  3LA3 A;  3JTG A;  1F1Z A;  2HTJ A;  3I59 B;  4A6D A;  2L54 A;  4RAZ A;  4OIO F;  2EJR A;  1FP1 D;  1ZLK A;  4A0Z A;  3RPU A;  4KMF A;  1HW2 A;  1WRJ A;  3KP2 A;  2QM3 A;  5L3E A;  4L9J A;  1KQ8 A;  4G94 A;  4S04 A;  3WTW C;  4IJA A;  3MAJ A;  1KU2 A;  4AVP A;  4KIF A;  1LEA A;  3WU0 A;  2HOE A;  1JHH A;  5E1X A;  3ECO A;  3DPL C;  5HLI A;  2OQR A;  2GWR A;  5FD5 A;  4RAY A;  3C3W A;  2V6C A;  5DD8 A;  3D0S A;  2EA2 A;  1EH6 A;  1IZ1 A;  1F4K A;  2ZKZ A;  4CO8 A;  1IN5 A;  5FLX K;  2VC1 A;  5CVR A;  3F6O A;  4LD5 A;  3F72 A;  2RC4 A;  2O8X A;  2PEX A;  4CXF A;  3WE3 A;  3DF8 A;  1J5Y A;  2KRF A;  2VBW A;  3HTU A;  4ZYE A;  3ZN0 A;  2GXB A;  1D8K A;  1ZGJ A;  3GW2 A;  4RB3 C;  2KIF A;  1MZB A;  3TQN A;  4M72 A;  4JK1 X;  2P7C B;  5J6X A;  2ZFW A;  4EJV A;  1RI7 A;  4BHP A;  1DPU A;  4AIJ A;  5CLS A;  2L01 A;  4BQA A;  2O61 A;  4A2U A;  4Q47 A;  2YX7 A;  1GVJ A;  2CYY A;  3KLO A;  1O3T A;  1P92 A;  3T0Y A;  1FLI A;  1RZ4 A;  5HDG A;  2ZO4 A;  4HV5 A;  1D5V A;  4U88 A;  3VB2 A;  1Z05 A;  2MLK A;  2VT3 A;  4UVB A;  3QPT A;  1PP7 U;  3ZPL A;  1W7P B;  1YW7 A;  2HZT A;  3ABT A;  2GA1 A;  2JZY A;  1FY7 A;  3GLX A;  4UVA A;  4HF2 A;  2ZME B;  4MTD A;  4GO1 A;  3QAH A;  4AIK A;  4KIB A;  2PI0 A;  3RYR A;  4DQ2 A;  2E7X A;  1U8R A;  1LDJ A;  2K86 A;  4XSZ F;  3FXR A;  1YG2 A;  4P9U A;  1R5H A;  1XDU A;  3D5L A;  1I5Z A;  2FNP A;  1YYV A;  2FBI A;  4L9N A;  2YU3 A;  4PZJ A;  1LEB A;  1FYL A;  2LKP A;  2M45 A;  2K27 A;  5DUI A;  4YII A;  2QVO A;  5LGU A;  4L9T A;  1XGO A;  2HS5 A;  2YSR A;  3E97 A;  3F3X A;  4HLY A;  4KUM A;  2J5O A;  3SXY A;  2XAH A;  3R0J A;  3DQV C;  1D8J A;  2HWV A;  2M1B A;  3F21 A;  3ECH A;  4P96 A;  3H92 A;  3W6J B;  3GFI A;  1RIO H;  3J7A O;  3J80 K;  3KP3 A;  2GZW A;  3FM3 A;  3KLN A;  1G3S A;  2XKO A;  1HST A;  2EV5 A;  2X0L A;  2VBX A;  4XSX F;  1XD7 A;  2JTV A;  1JHF A;  5D5V B;  3ELK A;  2F5F A;  4HOB A;  3ML6 A;  4CZZ A;  2OQG A;  2ZNY A;  3RTR A;  4M74 A;  1OYI A;  5D6E A;  4KT5 C;  4GYG A;  3ZMU A;  4L18 B;  1ZRE A;  6PAX A;  1OKR A;  1KU3 A;  4FX0 A;  3JSP A;  1BI2 A;  1BC8 C;  2QQ9 A;  5HS8 A;  3T1B A;  4Z2Y A;  3PQK A;  4IRH A;  1IN8 A;  2AS5 F;  3DEU A;  2ZME A;  1GXQ A;  3QP5 A;  4XBF A;  2RKH A;  3MWM A;  2O03 A;  3JAM Z;  4AWX B;  2Z3Y A;  1KGS A;  4JQF A;  3M9A A;  3SHF A;  3E3V A;  3K1M A;  3MQ0 A;  1X3U A;  3TOA A;  2XHK A;  3WTU C;  4PDK A;  5LLQ A;  3C18 A;  2XVC A;  2B0L A;  4EGZ A;  4G6Q A;  1S7O A;  4EM0 B;  1P2F A;  3U9G A;  1ZAO A;  4GCV A;  2PJP A;  2QBY B;  2VBY A;  2HR3 A;  4AIH A;  1TNT A;  3HSF A;  1ZYR F;  2L02 A;  3KP5 A;  2H94 A;  2V1D A;  1YQA A;  4OU0 A;  3MFK A;  2P5L C;  1RUO A;  3VOE A;  1R58 A;  4L5I A;  1K6O A;  4OIR F;  3GF2 A;  1HKS A;  1J75 A;  1OYY A;  4ENN A;  1DP7 P;  1V3F A;  2Z9O A;  3R0A A;  2ZJ2 A;  2OU2 A;  3BZ6 A;  2KJB A;  5IT9 Z;  1HW1 A;  4XLN F;  4JBA A;  4HQE A;  4NQW A;  1T98 A;  3WTZ A;  1LQ1 A;  3LAP A;  1VTN C;  4LLG F;  1KA8 A;  1QZY A;  1ULY A;  3IRQ A;  2CW0 F;  2COM A;  3QP6 A;  2FBK A;  3HSR A;  2XAJ A;  3IWZ A;  2D1V A;  2YR2 A;  1XCV A;  5E8G A;  1SAX A;  4PCQ A;  3HOT A;  4IHT A;  4KYW A;  3MZY A;  4HF1 A;  4ASN A;  4N9I A;  1HSJ A;  1YS7 A;  1UB9 A;  3TGN A;  3G73 A;  1CF7 B;  3BPV A;  3LA2 A;  1FSH A;  4BH9 A;  5ICE A;  1ZRF A;  4XRF A;  3RDI A;  3V7C A;  2F5C A;  4F7Z A;  1DPR A;  4R8H A;  5CJ9 A;  1ZAR A;  1OR7 A;  2RNJ A;  1SMT A;  4U7D A;  2ADU A;  1P4X A;  4A0X A;  5HDN A;  4D0P A;  3R6S A;  5AON A;  1Y0U A;  3HYI A;  3SFZ A;  1B6A A;  1J9I A;  3CO7 C;  2DPD A;  3L09 A;  3GEZ A;  2RQP A;  3ZMS A;  2DK5 A;  2IT0 A;  4FT8 A;  3BJO A;  1FPQ A;  2FNA A;  4M9X A;  4LG0 B;  1IAW A;  1T38 A;  2ACJ A;  3K1P A;  1UHM A;  1IRF A;  1T39 A;  5E18 F;  2WTE A;  2MA3 A;  4MNU A;  2A6E F;  3F22 A;  1F9N A;  2V9V A;  1UST A;  2PN6 A;  4UVC A;  1SMY F;  2C6Y A;  4IPA A;  3T8R A;  4IF4 A;  1QBJ A;  3GZ5 A;  1R7J A;  4WK8 F;  5ICC A;  3E5X A;  3BOQ A;  3CLO A;  3VOD A;  5AIQ A;  2A61 A;  1IN4 A;  1TW3 A;  3SZT A;  1JE8 A;  1FYK A;  2A07 F;  1KYZ A;  4U0V A;  1I6X A;  1O3Q A;  3AAF A;  3TDZ C;  2Z33 A;  2XKP A;  3EUH A;  2F5D A;  2QQA A;  1T6S A;  2NNY A;  2XRN A;  2MLG A;  2W85 A;  3NRV A;  4LK1 F;  1P4A A;  5BQT A;  2V79 A;  2LSO A;  5CYV A;  2EA4 A;  1U5T C;  2GIV A;  3M1E A;  1TBX A;  3SZP A;  3COA C;  2HEO A;  1QPM A;  1BI0 A;  5BPI A;  4BYY A;  1W7P D;  2G7H A;  5LRR A;  1IN6 A;  2E7W A;  3K2Z A;  3RI4 A;  1W7P A;  3WOD F;  3EYY A;  1UFM A;  4L0Z B;  2WC2 A;  4QWQ A;  1TQM A;  3DP7 A;  4LK0 F;  1HQC A;  5HS9 A;  3FF5 A;  1W5S A;  3FWE A;  1J7K A;  3OOP A;  1BI3 A;  4L0Y B;  4HAM A;  1G3W A;  3BDD A;  3Q9V A;  3RKY A;  3IL2 A;  2FE3 A;  1FP2 A;  4E70 A;  5JVT A;  2VT2 A;  2J5P A;  3CDH A;  2F2E A;  5D8L B;  3G3Z A;  1TQI A;  2RN7 A;  2QBY A;  1ZHF A;  4I02 A;  4I98 B;  4Q4Z F;  4RB0 A;  2STW A;  2PMH A;  4KMU X;  3LQQ A;  3HTS B;  4HX4 A;  3CUQ C;  5KK1 A;  1ZLJ A;  3IC7 A;  4EM1 A;  4KIG A;  5TRD A;  3O2P E;  2VXZ A;  3FXU A;  1YO5 C;  2BGC A;  4ENK A;  2FA5 A;  5BPD A;  1Z91 A;  1T0F A;  3WTT C;  3MZH A;  1XSV A;  2EB7 A;  4RB1 A;  5DCM A;  3NQO A;  3WTS C;  2K7L A;  4M73 A;  1J0R A;  1IUY A;  2VC0 A;  4OOI A;  4CYD A;  2DQL A;  3L9F A;  2HQR A;  2K4B A;  1H0M A;  5ILS A;  4EJW A;  1YFH A;  3WGG A;  2DLL A;  1LJ9 A;  3K0L A;  3I5U A;  3NEU A;  3LQR A;  5J8C A;  4UV9 A;  1Z9C A;  2DW4 A;  2Y48 A;  4HDV A;  3JTH A;  2FSW A;  3F23 A;  2HYG D;  4U7B A;  2V1X A;  3T5X A;  1L0O C;  4NB5 A;  2P5V A;  2DBB A;  3FX3 A;  2DU9 A;  5F1R A;  3J81 K;  4RGR A;  1S8N A;  2UXX A;  2JSC A;  3R61 A;  1U5T B;  4UV8 A;  2PFB A;  3LST A;  2W57 A;  3F8C A;  3WE2 A;  3V8K A;  4KDP A;  3IHU A;  4MEY F;  3V8L A;  2QYO A;  1LVA A;  1W4M A;  4ZZL A;  2CFX A;  1F5T A;  4KN4 X;  3BJA A;  1YIO A;  2UXN A;  4OMZ A;  4EGY A;  5D8K B;  1U2W A;  1MDM A;  2MH2 A;  3QPH A;  3HUG A;  1P4W A;  4XLP F;  1FZP B;  3WTY C;  4TV7 A;  2KKO A;  1HXD A;  4M6Y A;  4LJZ F;  2FF4 A;  4BXU A;  4HV6 A;  1IN7 A;  1ZRD A;  2D2W A;  2IA0 A;  3L2C A;  2Z99 A;  2EFO A;  1IXS B;  4PGH A;  5LHH A;  5K5Q A;  2ZXJ A;  3IRR A;  3WTX C;  5FGM A;  3CO6 C;  3R60 A;  5ILU A;  2R7D A;  3FM5 A;  2ETH A;  1XMK A;  1R1V A;  2ZCW A;  4S05 A;  5LGN A;  1STZ A;  4IRI A;  1FSE A;  5DYM A;  4ESB A;  2L4M A;  1Z6T A;  1I1G A;  2H6C A;  2IRF G;  4BNC A;  3ZMV A;  5JI6 A;  3K1N A;  1Z7U A;  5D5U B;  2XV4 S;  4G7Z F;  4LB6 B;  3KET A;  2ISZ A;  1XN7 A;  3BWG A;  5LEK A;  2FRH A;  3C1D A;  2BV6 A;  2HQN A;  1K7A A;  3EET A;  4A6E A;  2HKO A;  1KU7 A;  4A5N A;  2JT1 A;  3R4K A;  3OV8 A;  2MD5 A;  3DPT A;  2JRT A;  5D6F A;  3LAJ A;  1MKM A;  2DO7 A;  4HA8 A;  4LFU A;  1SFX A;  5FO5 A;  1D3Y A;  4DNC A;  3HRS A;  4HF0 A;  2GA2 A;  2FMY A;  3QU6 A;  5IT3 A;  2ZBK A;  2FML A;  3L00 A;  5ED4 A;  5KVR A;  3V8J A;  2Z5U A;  2E1N A;  5BS6 A;  3CTA A;  1B9N A;  4I0A A;  1JXS A;  2QEN A;  3I58 A;  4HLX A;  2VOP A;  3GWZ A;  3HSE A;  4CGZ A;  1ONV A;  1FBQ A;  4EJO A;  1R00 A;  3FHZ A;  2O6G E;  1C0W A;  1MDM B;  2NNN A;  3TO6 A;  2K4J A;  3V4G A;  2OD5 A;  2WV0 A;  5FB2 A;  1YTY A;  3P9K A;  5A2Q Z;  4Y13 A;  2DTR A;  2G7U A;  4Q48 A;  1OYW A;  4MQV A;  2QUF A;  1BN5 A;  1TW2 A;  3KP4 A;  5K1Y A;  4RGS A;  3DV8 A;  1XSX A;  3REO A;  1S7A A;  1TNS A;  4M9S A;  4G9Y A;  4HX8 A;  3P9C A;  2W24 A;  1FYM A;  4LLN A;  3I59 A;  2XAQ A;  2UWM A;  3ZMD A;  4OIQ F;  5H6R A;  1HKT A;  2GQQ A;  4UUV A;  3F8M A;  3TO9 A;  2DFI A;  5HVQ C;  5BOX A;  3B02 A;  2IA1 A;  1BIB A;  1RNL A;  2FEZ A;  4IXA A;  2P7V B;  2XAG A;  1SD5 A;  3I64 A;  1QNT A;  2IPQ X;  2CG4 A;  1KQ9 A;  2Q0O A;  1SD6 A;  4OIP F;  4HYE A;  4I09 A;  1BJA A;  2VE8 A;  1LDD A;  1G6N A;  1U6G A;  2CGP A;  1FWZ A;  2NS0 A;  1BBY A;  4ZZD A;  4BHB A;  2XAS A;  4EV0 A;  1RUN A;  1YW9 A;  4LMY A;  4OMY A;  3RYP A;  4G8X A;  2X4H A;  4IHS A;  3S2W A;  3I4P A;  1ODD A;  1U3E M;  4YFK F;  3ZMZ A;  4KN7 X;  4KA4 A;  1R23 A;  5JFR A;  2D1H A;  1GHC A;  5D5X B;  3Q5F A;  4ENM A;  1FX7 A;  5JR3 A;  2HTS A;  3BPX A;  3GO5 A;  1FT9 A;  3J81 Z;  4M6X A;  4Y17 A;  3WU1 B;  2XGX A;  1I27 A;  4WF2 A;  1SD7 A;  2TDX A;  3WG9 A;  1AWC A;  3F8F A;  1QQI A;  3DFG A;  4YG2 F;  4QLC U;  2Q2E A;  2STT A;  1O3R A;  5DDG A;  2VN2 A;  3E6D A;  4WX9 A;  1O3S A;  4N0B A;  2PBI A;  4HZF A;  4CHU A;  4GYI A;  2GXG A;  1PDN C;  3F8N A;  1P6R A;  2W25 A;  3EQL F;  4ETS A;  2D45 A;  2P8T A;  1ZG5 A;  1AOY A;  3E5Q A;  4P5O A;  1XGN A;  2PLY A;  1MJ9 A;  3DKW A;  5F64 A;  1A04 A;  1BC7 C;  2Y0M A;  1ON1 A;  4U0Y A;  4Q5S F;  1BM9 A;  2NRA C;  1ON2 A;  1O57 A;  1TLH B;  2O0Y A;  4KFC A;  4M9Z A;  2Y75 A;  2EWN A;  5DEQ A;  3WGI A;  5HLH A;  4HQM A;  3GYH X;  3K69 A;  3E6B A;  4Y15 A;  3CUQ B;  2PQ8 A;  2LNB A;  1E2X A;  2P6T A;  5AIP A;  4HW0 A;  5LGT A;  2H6B A;  1R36 A;  4CDG A;  2VOO A;  5LEJ A;  3TO7 A;  1XGS A;  3J80 Z;  3GFL A;  1QO0 D;  1W5T A;  3K9T A;  3V7S A;  3TOB A;  2FBH A;  4MGR A;  4MQ9 F;  1S29 A;  3ZP5 A;  1FNN A;  4ESF A;  2HKX A;  5DV5 A;  3KZY A;  1SFU A;  3N4M A;  1WI9 A;  4MHG A;  2CSO A;  5HDK A;  1XDS A;  3IKV A;  3KEQ A;  2FXA A;  1WSU A;  1REP C;  1XB4 A;  2ZNZ A;  4MEX F;  3U1D A;  3GVA A;  3O3K A;  2OZ6 A;  3HRU A;  2YPR A;  1O7L A;  4EVI A;  4LG0 A;  3GFM A;  1O7F A;  1JGS A;  3H3Z A;  2BE5 F;  3TDU C;  3ULQ B;  5H6Q A;  1TTY A;  2M5W A;  2DPU A;  1LNW A;  3LFK A;  1ZG3 A;  4EM2 A;  5E1Z B;  2KIU A;  2O3F A;  2FQ3 A;  2VON A;  2P6S A;  1PP8 F;  5FD6 A;  5DCF A;  2A6H F;  4UXN A;  1U78 A;  5FFX A;  2HGC A;  4AD9 A;  1B59 A;  4YIF A;  1UCR A;  3QU3 A;  2A68 F;  2MBF A;  4I2O A;  1UHW A;  4HX7 A;  1DDN A;  3GZ6 A;  4CIC A;  3RKW A;  4O6J A;  3F8B A;  1R22 A;  5ICF A;  3KCC A;  4WXH A;  1CGP A;  1EH8 A;  1ZRC A;  4ENJ A;  1Q1H A;  2JPC A;  1SFE A;  5ICG A;  2UZK A;  1WQ2 A;  2LF8 A;  3BJ6 A;  1S3J A;  3I71 A;  2DQR A;  5L3B A;  2EFP A;  1PUE E;  2DAO A;  3E6C C;  1QZZ A;  4BAY A;  2M87 A;  4R1H A;  4ZH4 F;  1FOK A;  4EJT A;  3CJN A;  2NAZ A;  4L5J A;  3BP8 A;  4WCG A;  5D5W B;  3MCZ A;  4EMS A;  3E6M A;  3I0T A;  3O6B B;  5E20 A;  3HRM A;  1K78 A;  1LB2 A;  2IA2 A;  3ZQ7 A;  3QOP A;  3FMR A;  3KE2 A;  4EJU A;  4P9F A;  4YFX F;  4BHC A;  3HHH A;  3I53 A;  2A5Y B;  2QWW A;  2LDU A;  5L3D A;  4ZYD A;  3U2R A;  4EQQ A;  2ISY A;  2FOK A;  2HYF A;  3FXQ A;  5TJJ A;  3RIR A;  3KFW X;  2EFW A;  4P55 A;  5D4R A;  2BYV E;  2LF7 A;  4IRG A;  4L9V A;  4HBL A;  1E17 A;  3GFJ A;  1OMI A;  2F5E A;  4A5M A;  4PGG A;  3T8T A;  5E8I A; 
#chains in the Genus database with same CATH topology
 1QGP A;  4BJ6 C;  1H88 C;  3HHG A;  4G7H F;  3OSF A;  3BQY A;  1BJZ A;  3L2Q A;  2M30 A;  5IP9 J;  1IV6 A;  4BKX A;  4RGU A;  5FFZ A;  1VZ0 A;  4BJ5 C;  1B1B A;  3JRG A;  3IH4 A;  4LLL A;  3HB9 A;  1EJ9 A;  4PJL A;  4W97 A;  4RGX A;  3H0D A;  3CME I;  3O8G A;  1ETO A;  2OA4 A;  3GXO A;  1JUM A;  3IKT A;  3DXJ F;  2K9M A;  3PQJ A;  1HDP A;  2E19 A;  2K40 A;  5HLG A;  4ABZ A;  2L0K A;  2IGN A;  5HS7 A;  3W6K B;  2DK8 A;  3JSO A;  1K79 A;  1CF7 A;  2CQ7 A;  4LG3 A;  2YX4 A;  5FLX Z;  3E5U A;  3FXM A;  3HGG A;  1USS A;  3MEX A;  3A4C A;  4CCK A;  2EZI A;  2HI3 A;  1XS9 A;  2CU7 A;  1K4T A;  1MBF A;  1Z3X A;  1MMN A;  2RDP A;  5KHD A;  2QEX I;  2IJL A;  3QOE A;  3OYN A;  3VWB A;  1IW7 F;  3CUO A;  2VPR A;  4IL6 C;  3CCM I;  5IOZ A;  1MNM C;  1FBU A;  1X4O A;  4XKV A;  1H9T A;  2R0Q C;  3OYI A;  1VQ8 I;  1FOY A;  2NYX A;  3FMS A;  4GXO A;  4CUG A;  1F36 A;  1BOA A;  2WWY A;  4HDU A;  4A12 A;  3GX4 X;  1NHA A;  2JVG A;  4UHT A;  2QQB A;  4RLF A;  3OYG A;  5FLV A;  2DJI A;  2EIJ H;  2IVM A;  2RAE A;  1G3T A;  2RGV A;  1HBX G;  5E17 F;  1A5J A;  3BR0 A;  2M7A A;  5DCM B;  1TQP A;  2H27 A;  3EYI A;  2F4M B;  2VKE A;  1WI3 A;  2AXT C;  2VB6 A;  2ZC2 A;  2A3S A;  3ONQ A;  4W1U A;  3KP7 A;  3SDB A;  1R4N B;  2ZJQ F;  3CCQ I;  3FDY A;  2IS1 A;  3M8E A;  3HOS A;  4KIC A;  1IRG A;  1I3A A;  3I56 I;  3RJP A;  3ZMT A;  4I76 A;  5ERI A;  4YFN F;  2RNG A;  2LLK A;  4WXC A;  3HOV J;  2E1C A;  4BDY A;  2CV2 A;  2IW5 A;  3KYL A;  5EEA A;  3G1L A;  2CFO A;  3WG7 H;  3CUQ A;  4E4H A;  3Q0U A;  3JAM K;  5LHG A;  3SQN A;  4XQF A;  4M3B A;  1J59 A;  1G8X A;  3VYR B;  3TKY A;  1AKH B;  3S93 A;  2H09 A;  3K4K A;  2PG4 A;  1NTC A;  2OUM A;  4K2E A;  4XLC A;  2X6Y A;  5DUK A;  2R93 J;  4I7H A;  1OPC A;  2ECB A;  1HW5 A;  2HQ5 A;  4JX6 A;  4IOC F;  3QRF F;  1XG1 A;  1ZG1 A;  1FMV A;  4XN0 A;  5JHU A;  2OCE A;  5B5E C;  3A03 A;  2R3S A;  1YIT I;  1BR1 A;  2DFH A;  5IP6 A;  2CWE A;  2R5Y A;  2DA4 A;  2P4W A;  3WGH A;  2F5V A;  4I01 A;  5B1B H;  1IXC A;  1J2X A;  3CF5 F;  1XSD A;  3H3U A;  1FIA A;  2X9D A;  2KIM A;  5CVV A;  4A3C J;  4G6D A;  1JKQ C;  1R1U A;  2NS8 A;  4IQ4 A;  5CVJ A;  4BL0 B;  2G9W A;  1ZK8 A;  2BY2 A;  1D1C A;  2L5Q A;  3PM1 A;  2IGM A;  5DM7 F;  4D7M A;  3CF2 A;  4FE7 A;  5F6F A;  1YS6 A;  1BIA A;  3KP6 A;  3VPR A;  1HKQ A;  3D5R C;  2E2H J;  2EZK A;  3F6V A;  4ON0 A;  3OYM A;  2LY9 A;  3FBN B;  2E1M C;  3WTV C;  5EG0 B;  2P5K A;  1MJB A;  1XMA A;  3P9I A;  5D4S A;  4ZJZ A;  5DD4 A;  4KNY A;  2PMU A;  4UNO A;  4O3M A;  2W48 A;  2QZ8 A;  4IKF A;  3K70 D;  1I1S A;  2OBP A;  1LDK B;  3BRO A;  1HC8 A;  4XL9 A;  2F4O B;  3BTJ A;  4CH7 A;  4ESJ A;  4D7N A;  3PSI A;  2KIQ A;  4MTE A;  4A3M J;  1QA6 A;  4EAT A;  2MG4 A;  2HOA A;  1X1D A;  2JA8 J;  4NHJ A;  1MMA A;  4LB5 A;  4ZYG A;  2R7F A;  2OTJ I;  3BG7 A;  1ZN2 A;  2WV1 A;  2AO9 A;  2CO5 A;  2LP0 A;  4G12 A;  1TC3 C;  1T2K A;  3KEY A;  2RV8 A;  2LG4 A;  2A69 F;  2CQK A;  4IOA F;  3B73 A;  4PUS A;  2AXL A;  2L4A A;  4RS8 A;  2DT6 A;  5A2Q K;  4WXD A;  4H0E A;  4HST A;  4A3G J;  3ABU A;  2HDC A;  5JLX A;  5IT9 K;  3CCS I;  1AKH A;  1A6I A;  2DTZ A;  1MGT A;  1GLN A;  4A0Y A;  2O9L A;  1G4D A;  4A69 C;  4BDZ A;  3S16 J;  2AQF A;  1SD4 A;  1R5G A;  4F52 A;  1TL8 A;  2EFN A;  3FZV A;  2ELH A;  1PVE A;  1YIJ I;  1YW8 A;  1Z1D A;  2WAQ N;  1EH7 A;  4B1R A;  3OIQ A;  1IXR C;  5E1W A;  5K5R A;  4IVN A;  4O5V A;  4C30 A;  3KEO A;  3LSP A;  1BI1 A;  1S6L A;  1G3Y A;  2NVQ J;  1HLV A;  3LOC A;  1ZH5 A;  2WY8 Q;  1KYW A;  2LKX A;  5EZH A;  1IGN A;  1OCP A;  2MSY A;  2L7M P;  2DT5 A;  5L3C A;  3H35 A;  3GBG A;  1MNE A;  3C7J A;  4R79 A;  1X19 A;  4PSX A;  2AQE A;  4I99 C;  1ZR4 A;  2CW7 A;  1ZGA A;  2WA0 A;  2XIG A;  3N97 A;  3S8P A;  1B8I B;  3A01 B;  1KU9 A;  3FXL A;  2W84 A;  2YUS A;  5EGO A;  1L3L A;  1XC5 A;  1XGM A;  5H20 A;  5LRS A;  1H89 C;  2L9N A;  5DTD A;  2LY2 A;  1XCB A;  3M7G A;  3CCJ I;  4Y52 J;  2JPB A;  1OCR H;  3M8F A;  3JW4 A;  1Z6R A;  5EG0 A;  3HRT A;  3PFI A;  2V1U A;  4LGW A;  2FX0 A;  4WWC A;  1DGR M;  2MH9 A;  3DU5 A;  1W0T A;  2IP2 A;  2X1D A;  5L3G A;  5C3E J;  3P7N A;  3G1M A;  2EK5 A;  2OZU A;  2LH9 A;  5CVI A;  4KIT B;  4CCJ A;  4U0W A;  3ROU A;  2MC3 A;  2XRO A;  2VBZ A;  2KPM A;  1H9G A;  1RKT A;  3CCL I;  2DFE A;  2CQX A;  4DYQ A;  1LFB A;  2DI3 A;  2XAF A;  3TP3 A;  1MJA A;  2Q8K A;  3JRF A;  1U9N A;  2EFQ A;  2XUB A;  1OCO H;  2XPV A;  1AHD P;  2OAZ A;  4Y33 A;  1LE8 B;  1FJL A;  5EEH A;  4MFD A;  3GUD A;  1B4A A;  2EV0 A;  1QU3 A;  4Y4R A;  3SEQ A;  3IWF A;  3EDP A;  2VE9 A;  3CJR B;  1V4R A;  4NQW B;  1FC3 A;  2MD0 A;  5ILV A;  5J8F A;  2M4G A;  1P7J A;  1FOW A;  3FMQ A;  3HXL A;  1OQY A;  2EQR A;  2EV6 A;  2L3D A;  3KZZ A;  1N75 A;  4N9H A;  2A5W A;  3K7A J;  3L7W A;  4QPO A;  2O7O A;  3HUG B;  4E7K A;  3LSJ A;  1WH7 A;  3ISP A;  1MD0 A;  4XKB A;  2BBY A;  2ESH A;  1JI8 A;  1FBS A;  1R71 A;  1VQ4 I;  4KIS A;  4M71 A;  2E36 A;  5LBQ A;  2ESN A;  4E7H A;  3HIF A;  3EUH C;  2NVX J;  1OCC H;  1YLF A;  3ERE D;  2QLZ A;  2K02 A;  1EV7 A;  2KJC A;  3BY6 A;  3LA7 A;  1K78 B;  4B09 A;  3VFZ A;  2RVC A;  5LFA A;  3JCU C;  3V7R A;  3UNG C;  2M4K A;  4FET A;  3Q0V A;  3Q9S A;  4AC0 A;  3ZN1 A;  2HFH A;  3KYC B;  3I54 A;  1U5T A;  1WWX A;  1DUX C;  2QSG X;  5IY5 H;  2BEO A;  2OF7 A;  4XID A;  3DKX A;  3SDG A;  1B9M A;  2E71 A;  5BMZ A;  3ESW B;  1UG0 A;  2ZJP F;  5EEG A;  3VYU B;  1R1T A;  4B8X A;  4ZYH A;  4I0B A;  1G2H A;  5HOO A;  2M8E A;  3RPQ A;  3VEP A;  5CVU A;  5LHI A;  3OYE A;  2GAU A;  4OIN F;  3RKX A;  2BW3 B;  1SFK A;  3RPU D;  1GXP A;  2M3A A;  1IF1 A;  2FU4 A;  1WJE A;  4RB2 C;  4FHT A;  1KQ0 A;  3LWF A;  1X4P A;  2VOD A;  1WKM A;  4GGG A;  2DA7 A;  1Y0N A;  4FX4 A;  5L3F A;  1IRX A;  5K5O A;  1NG6 A;  4G7O F;  3LA3 A;  5CQE A;  3JTG A;  3MN2 A;  1F1Z A;  2LBF B;  2HTJ A;  3I59 B;  4A6D A;  2L54 A;  2R5Z B;  1MH3 A;  3FK7 A;  4RAZ A;  4B3X A;  1IG7 A;  3CQZ J;  4OIO F;  2EJR A;  1UJ8 A;  2IS4 A;  3VSL A;  1FP1 D;  1ZLK A;  4A0Z A;  3RPU A;  4KMF A;  2LRE A;  5J1Y A;  1HW2 A;  1WRJ A;  3KP2 A;  2QM3 A;  5L3E A;  4L9J A;  3PIP F;  1ORK A;  1KQ8 A;  1WJ5 A;  2V9P A;  4RM3 A;  3JRE A;  2Z2S B;  4GDF A;  4G94 A;  1JJ6 C;  2DMN A;  4S04 A;  3PIO F;  3HC7 A;  2WAQ A;  4IJA A;  3WTW C;  1IJW C;  3MAJ A;  2K9Q A;  1KU2 A;  3ASO H;  2KDZ A;  4AVP A;  2Q1Z B;  2QQ8 A;  4KIF A;  4PSW A;  3BC8 A;  3TED A;  3GTM J;  1LEA A;  3WU0 A;  3RZD J;  2HOE A;  3MVP A;  1JHH A;  5E1X A;  1SVL A;  4RAF A;  5M3M J;  3ECO A;  3DPL C;  5HLI A;  4HNV A;  3HL2 A;  2OQR A;  2XF7 A;  3JRH A;  2GWR A;  5FD5 A;  4RAY A;  3C3W A;  3JRC A;  2VQH A;  3OYD A;  2V6C A;  3B6C A;  5DD8 A;  3D0S A;  2EA2 A;  1VQ7 I;  4J01 A;  3G4S I;  2QGU A;  5HLT A;  1EH6 A;  1IZ1 A;  1F4K A;  4OWR B;  2ZKZ A;  4CO8 A;  4CYC B;  3S32 A;  1IN5 A;  1MBJ A;  1VQP I;  5FLX K;  4AUX A;  3M3Y J;  5J3L A;  2I8D A;  2VC1 A;  5CVR A;  4V19 K;  3F6O A;  4LD5 A;  3F72 A;  2RC4 A;  2O8X A;  4CCM A;  5EYR A;  2PEX A;  2GOM A;  4CXF A;  4H4K C;  3WE3 A;  2WAE A;  3DF8 A;  4B47 A;  3CLQ A;  1J5Y A;  2KLO A;  2KRF A;  2VBW A;  3HTU A;  4ZYE A;  3ZN0 A;  2GXB A;  3QQA A;  1D8K A;  2ELK A;  5GTI C;  1MSE C;  1ZGJ A;  3GW2 A;  3S3O A;  4RB3 C;  4IHY A;  2KIF A;  3HG9 A;  2M2E A;  1MZB A;  3TQN A;  1WJD A;  2QKL B;  1T0F C;  4FE4 A;  1Z21 A;  1I50 J;  3CMM A;  4GRI A;  2GOX B;  4M72 A;  4JK1 X;  1JJ8 C;  4BE0 A;  2CH0 A;  3RSN A;  5J40 A;  2P7C B;  3OIP A;  1ZR2 A;  5J6X A;  2ZFW A;  4EJV A;  1RI7 A;  3K10 A;  4BHP A;  1DPU A;  4AIJ A;  5CLS A;  2L01 A;  3SZG A;  5GP9 A;  4IZZ A;  4BQA A;  3DBH B;  2O61 A;  1MBK A;  3H9Q A;  3TP0 A;  2HPI A;  4A2U A;  4Q47 A;  2YX7 A;  4GFB A;  1GVJ A;  2CYY A;  1LVK A;  3KLO A;  4NNJ A;  1O3T A;  1JT0 A;  1P92 A;  3T0Y A;  3TL4 X;  3ZOB A;  1FLI A;  1RZ4 A;  1MBE A;  4XK4 A;  5HDG A;  2ZO4 A;  3FKI J;  2E5N A;  5GAH J;  3RKQ A;  4HV5 A;  1D5V A;  4U88 A;  3VB2 A;  5JHF A;  1Z05 A;  2O5R A;  2MLK A;  2VT3 A;  2CUJ A;  5HNH A;  3GME A;  4UVB A;  1MND A;  2ELJ A;  1D0X A;  3CCV I;  3QPT A;  4OAZ A;  1PP7 U;  3CC2 I;  3ZPL A;  2K3F A;  1BR2 A;  3QWL A;  2XDV A;  1W7P B;  1YW7 A;  2LTP A;  4M6V A;  2HZT A;  3ABT A;  3S3M A;  2H8W A;  3S14 J;  2DDA A;  5TGT A;  1B72 A;  3H9J A;  4HRI A;  2GA1 A;  4BY7 J;  2JZY A;  1FY7 A;  2XPU A;  3GLX A;  4XOT A;  4UVA A;  4HF2 A;  2MYS A;  3BG5 A;  4CCO A;  4A3I J;  2IEK A;  2ZME B;  4MTD A;  4GO1 A;  5GPC A;  4B44 A;  2M8G X;  1JKP C;  4RLQ A;  1TT5 B;  3QAH A;  4AIK A;  3PNV A;  2IS6 A;  2Y31 A;  3DEE A;  4KIB A;  3RYR A;  3WHB A;  4DQ2 A;  2E7X A;  1U8R A;  2PI0 A;  4XNF A;  1LDJ A;  1BOB A;  2K86 A;  3EPZ A;  4XSZ F;  3GTJ J;  3FXR A;  2X6O A;  2D5V A;  3GTG J;  4XOP A;  1YG2 A;  4P9U A;  1DQU A;  1R5H A;  1XDU A;  3D5L A;  1I5Z A;  3PSF A;  2CUE A;  2FNP A;  1YYV A;  3JR9 A;  2FBI A;  2KDO A;  4L9N A;  2YU3 A;  4PZJ A;  4AVZ A;  4QTR A;  3FIW A;  1LEB A;  1D5Y A;  1EF4 A;  1FYL A;  4A3B J;  3BR1 A;  2LKP A;  2M45 A;  3E1S A;  2K27 A;  4DBR A;  5DUI A;  4YII A;  1LE8 A;  2BOL A;  3SFI A;  1W1W E;  2QVO A;  3S17 J;  1S72 I;  2DYR H;  5FKL A;  5LGU A;  4L9T A;  3TW7 A;  3S1N J;  3K2A A;  1XGO A;  2HS5 A;  4QPQ A;  1QZE A;  3D5S C;  4NUB A;  2DA6 A;  2DT7 B;  1WHU A;  3E7L A;  2KRH A;  2YSR A;  3E97 A;  3F3X A;  1YJN I;  2R7X A;  4HLY A;  4KUM A;  2ZXW H;  1ZKG A;  3H5N A;  1KZH A;  4FAS D;  1P7I A;  2JSP A;  3MKL A;  2J5O A;  3LFU A;  1WCM J;  3LSM A;  3SXY A;  2XAH A;  3R0J A;  3DQV C;  1D8J A;  2Y0S N;  2HWV A;  5IYB J;  2M1B A;  1X1C A;  3F21 A;  3ECH A;  4P96 A;  3H92 A;  2EH3 A;  1QHH D;  3W6J B;  3GFI A;  1RIO H;  5K7H A;  1Y8Q B;  3CJT B;  3KP3 A;  3QPS A;  3J80 K;  2GZW A;  3J7A O;  1HA8 A;  2NOG A;  1RKW A;  3MD2 A;  3FM3 A;  3KLN A;  1H8A C;  1F43 A;  1XPX A;  1VI0 A;  1G3S A;  2XKO A;  1VFC A;  3K4C A;  1HST A;  4YEL A;  3TBI A;  2EV5 A;  3AKZ A;  2X0L A;  2CMP A;  2VBX A;  4XSX F;  3ZR8 X;  4BXX J;  1V5G A;  1XD7 A;  2HNH A;  2JTV A;  3PO3 J;  1JHF A;  1EKE A;  1X1B A;  2Y0S A;  3ELK A;  5D5V B;  4UY8 I;  3H3V K;  2F5F A;  2X6X A;  3IH3 A;  4HOB A;  3ML6 A;  3LNQ A;  3I4N J;  4CZZ A;  2NXN B;  2OQG A;  1Y56 A;  2ZNY A;  3RTR A;  4M74 A;  1OYI A;  3EUA A;  5D6E A;  2LMD A;  2R7S A;  3KX2 A;  3L2W A;  2OCC H;  4KT5 C;  1HDD C;  1TZL A;  4GYG A;  3J7Z I;  2XRL A;  3ZMU A;  4L18 B;  1GV2 A;  4E7J A;  1B72 B;  1ZRE A;  4DZP A;  2HDD A;  6PAX A;  3U21 A;  1OKR A;  2DCE A;  3HJE A;  1KU3 A;  3AG2 H;  4FX0 A;  3JSP A;  1BI2 A;  1E3P A;  2NS7 A;  1GDT A;  1WJA A;  1YE9 A;  1BC8 C;  2QQ9 A;  2KQR A;  4YIR X;  1FTZ A;  5HS8 A;  3T1B A;  4Z2Y A;  4BU2 A;  3W6V A;  3PQK A;  2R7O A;  4IRH A;  1IN8 A;  2VQG A;  3BCB A;  4FIS A;  2AS5 F;  1T95 A;  2WAD A;  2Y9Z A;  3DEU A;  2ZME A;  1DU6 A;  1GXQ A;  1V54 H;  3QP5 A;  1G59 A;  2EBI A;  1D1B A;  4XBF A;  4UUT A;  2RKH A;  3MWM A;  2O03 A;  3JAM Z;  5GAE J;  4AWX B;  2Z3Y A;  3KZI C;  1KGS A;  4JQF A;  3M9A A;  3SHF A;  3E3V A;  3K1M A;  3MQ0 A;  1X3U A;  3TOA A;  1UZC A;  2XHK A;  3ZRG A;  1QVU A;  3WTU C;  3C2G A;  4PDK A;  4AYB A;  4XLA A;  5J4Y A;  3LSR A;  1ACI A;  5LLQ A;  3C18 A;  2XVC A;  4XOR A;  5FRM A;  2B0L A;  2CJJ A;  2ZSI B;  3MMY B;  4EGZ A;  1Y8R B;  4G6Q A;  3LMM A;  1XMX A;  1S7O A;  3FXJ A;  3IP4 B;  1TP4 A;  4EM0 B;  1WJC A;  1P2F A;  3U9G A;  1ZAO A;  4A3D J;  2V9K A;  4GCV A;  1YX5 A;  2PJP A;  1XTA A;  3FHN A;  2QBY B;  2VBY A;  2HR3 A;  4XRS A;  2VLA A;  4AIH A;  2HOS A;  1I3Q J;  3F9K A;  1TNT A;  2JWT A;  3QYB A;  2L7K A;  3HSF A;  1ZYR F;  3AG4 H;  3ZGK A;  2HVS A;  5CQG A;  1SAU A;  4F55 A;  2IS2 A;  2L02 A;  2LKS A;  3KP5 A;  4PFO A;  1YRN B;  3PO2 J;  2W00 A;  2H94 A;  2KHM A;  2V1D A;  1YQA A;  3HBL A;  4OU0 A;  3MFK A;  3G6E I;  4NC8 A;  3ZQI A;  2RRE A;  4LOC A;  4JYK A;  2P5L C;  1RUO A;  2W1O A;  1ENH A;  5K7Z A;  1POG A;  1J09 A;  3VOE A;  1R58 A;  4IHW A;  3ABM H;  4L5I A;  2FOW A;  1K6O A;  1V5F A;  2KRC A;  4OIR F;  5F04 A;  3GF2 A;  1BW5 A;  3CCU I;  4X6A J;  1HKS A;  2JMW A;  1J75 A;  1OYY A;  4ENN A;  5F0H A;  1D1A A;  1DP7 P;  3GTK J;  5EZG A;  1V3F A;  2HXO A;  2ZXI A;  4FCY A;  4XKC A;  3QYE A;  1WJF A;  2Z9O A;  3R0A A;  2ZJ2 A;  2OU2 A;  1E3O C;  3BZ6 A;  2KJB A;  5E3M A;  5IT9 Z;  3RQI A;  3HOU J;  3AL0 B;  1HW1 A;  4XLN F;  4JBA A;  4KT6 A;  3L2U A;  4HQE A;  1VQL I;  4RA2 A;  4IEJ A;  4NQW A;  1NK2 P;  1T98 A;  1HOM A;  1TWF J;  3WTZ A;  9ANT A;  2OPT A;  1LQ1 A;  2PX9 A;  4C3J J;  3LAP A;  1BA5 A;  3FIS A;  2EZL A;  2W4S A;  2JA2 A;  5E3O A;  1BW6 A;  1X58 A;  4LLG F;  1KA8 A;  1QZY A;  1VTN C;  1W36 D;  3H5R A;  1T33 A;  1ULY A;  3IRQ A;  2R7Z J;  4M3G A;  2LY1 A;  2CW0 F;  2COM A;  3DKY A;  3OR2 C;  4FTH A;  2JRM A;  3O8H A;  3OSG A;  3QP6 A;  2FBK A;  2X51 A;  3HSR A;  2A6T A;  2XAJ A;  3MKY B;  5C44 J;  1MBH A;  3BTI A;  3IWZ A;  2HPM A;  2L9V A;  2D1V A;  1ERD A;  2YR2 A;  2IGO A;  2KMU A;  4BE1 A;  1NK3 P;  1XCV A;  5E8G A;  1SAX A;  2HXI A;  4PCQ A;  1LPQ A;  3HOT A;  4IHT A;  2QF7 A;  2LD5 A;  3MZY A;  4B48 A;  4KYW A;  1MSF C;  4HF1 A;  1MBG A;  2CQQ A;  2R4G A;  4ASN A;  4N9I A;  2IBD A;  3GZN B;  2GM4 A;  4C3H J;  1HSJ A;  3L2V A;  3HKZ N;  1RRJ A;  3OWT A;  2NVY J;  1DP3 A;  1YS7 A;  3CD6 I;  1UB9 A;  3TGN A;  3G73 A;  2DA2 A;  1KON A;  1CF7 B;  2V6E A;  3S3N A;  2DA5 A;  3BPV A;  1RR8 C;  3HDD A;  3LA2 A;  2CS3 A;  1X3Z B;  4XRS G;  3K4L A;  1FSH A;  4BH9 A;  5ICE A;  3HOW J;  2CUZ A;  1ZRF A;  3PNY A;  4XRF A;  3RDI A;  4F92 B;  1OIS A;  3PL8 A;  2F5C A;  3V7C A;  1DPR A;  4ZDP A;  4R8H A;  4F7Z A;  5CJ9 A;  4A3E J;  2K9L A;  1MIJ A;  1ZAR A;  1GUU A;  1OR7 A;  2BVM A;  5H2F C;  2BW3 A;  2RNJ A;  4Y7N J;  3W2W A;  1SMT A;  1WVR A;  5FLM J;  4U7D A;  2ADU A;  4MFE A;  3HOY J;  4BEH B;  1R5I D;  3S1Q J;  1P4X A;  4A0X A;  5HDN A;  4D0P A;  3H5A A;  3K4N A;  3OYL A;  4IHX A;  3R6S A;  5AON A;  1Y0U A;  3HYI A;  4XLF A;  3SFZ A;  1B6A A;  2DMT A;  1J9I A;  3DTI A;  2DOD A;  3CO7 C;  2LFB A;  4JOM A;  2DPD A;  3KIO A;  5F27 A;  3L09 A;  1X2M A;  3BTC A;  3GEZ A;  4CYC A;  2RQP A;  3ZMS A;  3L1P A;  2DK5 A;  1D0Y A;  3OR1 C;  4J19 A;  2IT0 A;  1R4M B;  4FT8 A;  1VQ5 I;  3BJO A;  1FPQ A;  2GXA A;  3CP2 A;  2FNA A;  4M9X A;  5GPA A;  1IC8 A;  4LG0 B;  1IAW A;  3BG3 A;  2VJJ A;  1T38 A;  3ABK H;  2ACJ A;  3K1P A;  1UHM A;  2M9H A;  1IRF A;  1T39 A;  2ZB9 A;  5E18 F;  3QPL A;  3DBL B;  3S2D J;  2WTE A;  2MA3 A;  3S15 J;  4BEH A;  2WB1 N;  4MNU A;  3S2H J;  3OYA A;  2A6E F;  5GAG J;  4BBR J;  1F9N A;  2V9V A;  3F22 A;  3CCE I;  1UST A;  2PN6 A;  4UVC A;  4JX4 A;  3S1R J;  1SMY F;  1LUJ B;  2C6Y A;  2ZSH B;  4IPA A;  3T8R A;  4IHV A;  4E7Z A;  4IF4 A;  1QBJ A;  3RZO J;  2WBM A;  3MKZ A;  2F4I A;  3GZ5 A;  1ETW A;  4X1E A;  3OS2 A;  1R7J A;  4WK8 F;  5ICC A;  3E5X A;  3BOQ A;  3CLO A;  1APL C;  5J1U A;  1S9H A;  2EIL H;  2ID6 A;  4S0H B;  3L2R A;  2R5Z A;  3VOD A;  5AIQ A;  2A61 A;  1IN4 A;  1W5C C;  3UR3 C;  4DYC A;  3M4O J;  2LBF A;  1TW3 A;  3SZT A;  2E35 A;  1R9T J;  1JE8 A;  4C9Y A;  1FYK A;  2A07 F;  1ETX A;  4QSH A;  1KYZ A;  4P1W A;  4U0V A;  1I6X A;  1O3Q A;  2R92 J;  3AAF A;  3TDZ C;  2Z33 A;  2XGC A;  2XKP A;  2MW8 A;  1OCZ H;  4DIQ A;  3OYF A;  3EUH A;  2F5D A;  4XR6 A;  4BQN A;  2QQA A;  3KPH A;  4D5C A;  3M8J A;  5FJ8 J;  1T6S A;  2W82 A;  2NNY A;  3BR3 A;  5M3F J;  2XRN A;  2MLG A;  2W85 A;  3MZ8 A;  3NRV A;  1FOX A;  4PJN A;  3GTP J;  4LK1 F;  2HDW A;  2MC4 A;  1P4A A;  4LIT A;  5BQT A;  1RET A;  1WZ2 A;  2V79 A;  3OYJ A;  2LSO A;  5CYV A;  2EA4 A;  2E1O A;  2JUG A;  2K5C A;  2CUF A;  3FKJ A;  5IP7 J;  4A3J J;  1U5T C;  2HVQ A;  4CCN A;  2GIV A;  5JVG F;  3M1E A;  4E7S A;  1UHS A;  1TBX A;  3SZP A;  3COA C;  2HEO A;  1IV8 A;  1QPM A;  1BI0 A;  2H1K A;  2JUC A;  5BPI A;  3SEZ A;  1N77 A;  2CRG A;  4BYY A;  1W7P D;  1AA7 A;  2VI6 A;  2G7H A;  1IRZ A;  3I9V 2;  5LRR A;  1IN6 A;  3BLY A;  1X1A A;  4BGD A;  2DMP A;  2E7W A;  3K2Z A;  3BG6 A;  3OS1 A;  3RI4 A;  3I4M J;  1OJL A;  3G1O A;  4HNT A;  5BNG A;  1W7P A;  5GAD J;  3WOD F;  2M0M A;  4CCL A;  3EYY A;  3CC7 I;  1ZTR A;  1UFM A;  2BXY A;  4L0Z B;  2WC2 A;  4QWQ A;  1TQM A;  5FRO A;  3DP7 A;  4LK0 F;  1HQC A;  3CCR I;  2HVR A;  5HS9 A;  1HF0 A;  3FF5 A;  4NDL A;  1W5S A;  3I55 I;  4A3L J;  1A6Q A;  3FWE A;  5HOD A;  1J7K A;  2HOT A;  1DU0 A;  3KYD B;  3J7A Y;  5E3L A;  3OOP A;  1BI3 A;  3U1K A;  4ZTF A;  5J1R A;  2BHY A;  4L0Y B;  4HAM A;  1G3W A;  2B9S A;  3BDD A;  3Q9V A;  1D0Z A;  2DMQ A;  3RKY A;  3IL2 A;  2FE3 A;  1FP2 A;  4E70 A;  5JVT A;  1MW7 A;  2VT2 A;  4E6K G;  2B7E A;  2J5P A;  3CDH A;  2GLO A;  2F2E A;  5D8L B;  1Y6I A;  3G3Z A;  2L9R A;  4Z6Y A;  1TQI A;  2RN7 A;  2QBY A;  3FK6 A;  1ZHF A;  4I02 A;  4I98 B;  4Q4Z F;  3JRA A;  4RB0 A;  2STW A;  5EF6 A;  2RQQ A;  2PMH A;  3BR5 A;  4XLE A;  4KMU X;  3D1N I;  1MH4 A;  2X1E A;  3BTL A;  3LQQ A;  3HTS B;  3PJR A;  4HX4 A;  3CUQ C;  1TWH J;  5KK1 A;  1JTY A;  1ZLJ A;  1PJR A;  3IC7 A;  4EM1 A;  2UV1 A;  4II2 A;  4KIG A;  5TRD A;  4D5F A;  3O2P E;  5JLW A;  2VXZ A;  3FXU A;  1YO5 C;  3JRD A;  4I6Z A;  1YHQ I;  4D1Q A;  2BGC A;  4ENK A;  2FA5 A;  5BPD A;  5F0C A;  4HEA 2;  4BE2 A;  5LD2 C;  2R5Y B;  1Z91 A;  1T56 A;  2L7Z A;  4BAC A;  3VYT B;  3ABL H;  2Y9Y A;  1T0F A;  3WTT C;  3W2A A;  2ZME C;  4C3I J;  2R7V A;  3MZH A;  1XSV A;  2EB7 A;  4RB1 A;  5DCM A;  3NQO A;  3WTS C;  2K7L A;  4M73 A;  2Y30 A;  1MMD A;  1J0R A;  4RBO A;  1K4S A;  2VC0 A;  1IUY A;  4OOI A;  3OY9 A;  4CYD A;  2DQL A;  3RCO A;  3L9F A;  4B3A A;  2HQR A;  2K4B A;  2LR8 A;  5M5X J;  1H0M A;  2Y69 H;  3WU2 C;  5ILS A;  4EJW A;  1VND A;  5B1A H;  3ZQC A;  1YFH A;  2VXD A;  3H1C A;  3WGG A;  2DLL A;  1T08 B;  2VJ4 A;  1OR7 C;  2E1M B;  2KL4 A;  1LJ9 A;  2Y2Z A;  3K0L A;  5E3N A;  4XKW A;  2KZV A;  3I5U A;  3NEU A;  2BXZ A;  3GTL J;  2VIX A;  3LQR A;  2QA4 I;  4EEF G;  5J8C A;  5HNF A;  4UV9 A;  2XC7 A;  1WPK A;  2KFD A;  2WB1 A;  4HSR A;  3LSK A;  1Z9C A;  2HZD A;  2XGD A;  1I39 A;  2BY3 A;  2DW4 A;  2Y48 A;  3H36 A;  2DA1 A;  2JJ7 A;  4MLO A;  4HDV A;  3FXK A;  5FKM A;  3JTH A;  2FSW A;  3F23 A;  2HYG D;  3HKZ A;  4U7B A;  2V1X A;  4DZJ A;  3T5X A;  2R7Q A;  1ETY A;  1L0O C;  1Z77 A;  4NB5 A;  4IX7 A;  3K6G A;  2P5V A;  1TWA J;  2DBB A;  3FX3 A;  3BG9 A;  2DU9 A;  5EJC A;  3A0B C;  2X1C A;  5F1R A;  3CZ6 A;  3H0G J;  4PJM A;  4CSW A;  1RPW A;  3J81 K;  4RGR A;  4F91 B;  4ANJ A;  3A02 A;  1S8N A;  3DU6 A;  2QCO A;  1U9O A;  3ZQG A;  1YJ9 I;  2UXX A;  2JSC A;  3R61 A;  1U5T B;  1VQO I;  1T8I A;  4UV8 A;  2PFB A;  3GTO J;  3LST A;  4HPQ A;  3PFY A;  2E5Z A;  2K9S A;  3DTK A;  2W57 A;  1IDY A;  3F8C A;  3DCF A;  3WHC A;  3WE2 A;  3V8K A;  4E7I A;  3DTE A;  4KDP A;  3IHU A;  2MGQ A;  4MEY F;  3V8L A;  2QYO A;  4ZDO A;  3DWL E;  1LVA A;  1W4M A;  2K85 A;  3LSG A;  3GCM A;  4ZZL A;  2CFX A;  1F5T A;  3N05 A;  1UMQ A;  4KN4 X;  1K83 J;  3BJA A;  1YIO A;  2UXN A;  1Z67 A;  4OMZ A;  4LIU A;  2LC2 A;  1WJB A;  4AU7 A;  4EGY A;  1PUF A;  5D8K B;  4BBS J;  1U2W A;  2QSH X;  1MDM A;  2CV0 A;  2MH2 A;  3QPH A;  3HUG A;  3M1C A;  1P4W A;  3I3L A;  1ETV A;  4XLP F;  1FZP B;  2XSJ C;  3HM5 A;  4V2F A;  3WTY C;  4TV7 A;  1JUS A;  2KKO A;  4PJJ A;  1PUF B;  1HXD A;  4M6Y A;  2JA7 J;  3MKW B;  4LJZ F;  2FF4 A;  4XMY A;  4BXU A;  4BQO A;  4HV6 A;  1IN7 A;  3DLA A;  4PJ0 C;  3RQ4 A;  1ZRD A;  2D2W A;  2IA0 A;  2V1N A;  3L2C A;  2Z99 A;  2EFO A;  1IXS B;  4PGH A;  5LHH A;  2HQA A;  5K5Q A;  3BCA A;  2ZXJ A;  3IRR A;  3OL4 A;  3WTX C;  3Q3S A;  5FGM A;  2DFF A;  3CO6 C;  3R60 A;  5ILU A;  4ZC3 A;  2R7D A;  4AYB N;  2I10 A;  3FM5 A;  2ZXH A;  2ETH A;  1XMK A;  1R1V A;  3K4B A;  3IH2 A;  2ZCW A;  4S05 A;  1LFU P;  5LGN A;  2ZJR F;  1STZ A;  4IRI A;  2E2I J;  1FSE A;  5DYM A;  4ESB A;  2L4M A;  1RR7 A;  1Z6T A;  2BHZ A;  1YI2 I;  3DLL F;  1I1G A;  2H6C A;  2IRF G;  3UKG A;  4BNC A;  3CMA I;  4E7L A;  3ZMV A;  5JI6 A;  1A35 A;  3K1N A;  3A2K A;  3GTQ J;  5KCM A;  1Z7U A;  2A05 A;  2XV4 S;  5D5U B;  3CCY A;  4G7Z F;  2JQ7 A;  2VPL A;  4LB6 B;  2DA3 A;  3KET A;  2ISZ A;  1XN7 A;  3BWG A;  3C1D A;  2FRH A;  5LEK A;  3ZCO A;  2M0C A;  1ITY A;  5KAI C;  2W7N A;  1U8B A;  2BV6 A;  2HQN A;  1FMW A;  2FUG 2;  1QPI A;  1K7A A;  3EET A;  4A6E A;  2HKO A;  1KU7 A;  4A5N A;  2JT1 A;  2M7B A;  3R4K A;  4AID A;  3OV8 A;  3TW6 A;  2YS9 A;  4XN3 A;  2MD5 A;  3DPT A;  3DPU A;  2IXS A;  2JRT A;  2K3P A;  5D6F A;  3LAJ A;  1Y1V J;  1MKM A;  2DO7 A;  4HA8 A;  4LFU A;  4YRV A;  4IO9 F;  1SFX A;  1M1E B;  5FO5 A;  1D3Y A;  2AHQ A;  4NC7 A;  4DNC A;  3HRS A;  4HF0 A;  2FMY A;  2EPF A;  2GA2 A;  1QVT A;  3QU6 A;  1RES A;  3QYF A;  1VQ9 I;  5IPA A;  5IT3 A;  2ZBK A;  2FML A;  3L00 A;  5ED4 A;  4C2T A;  5KVR A;  1Z0X A;  4V2G A;  2VJ5 A;  4U87 A;  3A1Y A;  1E0E A;  3V8J A;  2Z5U A;  2E1N A;  5BS6 A;  3BQZ A;  3CTA A;  3LL7 A;  1OCT C;  4A93 J;  4ZYA A;  4KJZ A;  4N4O B;  1B9N A;  4I0A A;  1JXS A;  2E34 A;  2DXI A;  1VQM I;  2QEN A;  1ZQ3 P;  2F48 A;  3I58 A;  4HLX A;  2VOP A;  3F0C A;  3GWZ A;  3HSE A;  4BQQ A;  3OS0 A;  2QKM B;  3PUB A;  2DOA A;  4CGZ A;  1ONV A;  1FBQ A;  3VYS B;  4EJO A;  1R00 A;  3FHZ A;  4ZTJ A;  1VQK I;  2COB A;  2O6G E;  2DJN A;  5C4J J;  2BVL A;  4MIM A;  2ZFU A;  1C0W A;  1MDM B;  2NNN A;  2OJE D;  3TO6 A;  2K4J A;  3V4G A;  2OD5 A;  1WGX A;  3IUO A;  2WV0 A;  5DS9 A;  1K61 A;  2YU9 J;  5C4X J;  2H1L A;  2KIS A;  5FB2 A;  1YTY A;  3P9K A;  2M34 A;  4BJT A;  5A2Q Z;  4Y13 A;  1JKO C;  2DTR A;  3SJM A;  1R6R A;  2G7U A;  3SYT A;  4Q48 A;  1UG2 A;  1JUP A;  1YX3 A;  2E60 A;  1OYW A;  4MQV A;  1GV5 A;  2QUF A;  1BN5 A;  1TW2 A;  2TCT A;  3X2Q H;  3IV5 A;  2PJR B;  1DGW Y;  3KP4 A;  5K1Y A;  4RGS A;  3DV8 A;  1XSX A;  1XX5 A;  3REO A;  4A3K J;  2FQ4 A;  1UEL B;  1S7A A;  1TNS A;  4IQJ A;  4M9S A;  4G9Y A;  4HX8 A;  3P9C A;  4JX5 A;  2W24 A;  5IYD J;  1B8I A;  2UUZ A;  1FYM A;  4LLN A;  2Q2E B;  2XF6 A;  3I59 A;  2XAQ A;  2UWM A;  3AG1 H;  3ZMD A;  1U0J A;  4OIQ F;  2ID3 A;  5H6R A;  1HKT A;  2GQQ A;  4UUV A;  3F8M A;  3TO9 A;  2ECC A;  2DFI A;  5HVQ C;  2Z16 A;  3ASN H;  5BOX A;  2MAB A;  3S1M J;  3FBI B;  2EZH A;  3B02 A;  2IA1 A;  1BIB A;  1RNL A;  2X48 A;  1V5E A;  2FEZ A;  4IXA A;  2P7V B;  3BZK A;  4M3E A;  2XAG A;  1SD5 A;  3I64 A;  1QNT A;  4ITV A;  4F3Q A;  3ZQL A;  2IPQ X;  2OTL I;  2CG4 A;  1CQT A;  1KQ9 A;  2Q0O A;  2VKD A;  1SD6 A;  4OIP F;  2PMZ N;  3ZXS A;  4HYE A;  4C2M J;  4I09 A;  3OYB A;  1BJA A;  2GIZ A;  2VE8 A;  1LDD A;  2KT0 A;  1G6N A;  1U6G A;  4PFP A;  2CGP A;  1FWZ A;  2NS0 A;  1BBY A;  5F1J A;  2G0E A;  3OOU A;  3CES A;  4ZZD A;  3E0J B;  4BHB A;  3HOX J;  2XAS A;  5FRN A;  2X85 A;  3G2B A;  2O8K A;  4EV0 A;  1RUN A;  1YW9 A;  1X2N A;  4D9J A;  4LMY A;  2EIN H;  2EIM H;  4OMY A;  1JGG A;  3RYP A;  4G8X A;  2X4H A;  4IHS A;  3S2W A;  5KAF C;  3I4P A;  3JRB A;  1ODD A;  1I6H J;  4RMN A;  1U3E M;  1SVO A;  4YFK F;  1SAN A;  3AFH A;  3ZMZ A;  2L7F P;  2PMZ A;  3BZC A;  4KN7 X;  3C2H A;  2NVU B;  1S5L C;  2XPW A;  4KA4 A;  2R7U A;  1R23 A;  3V42 A;  5JFR A;  2D1H A;  1GHC A;  1K6Y A;  5D5X B;  3Q5F A;  1TT0 A;  1TWC J;  3VSK A;  4ENM A;  1FX7 A;  3DBR B;  5JR3 A;  3LSI A;  4B4C A;  2HTS A;  3BPX A;  3GO5 A;  4HG2 A;  4PK4 A;  1FT9 A;  2BY1 A;  4RDU A;  2R7T A;  3J81 Z;  1W36 C;  4M6X A;  4Y17 A;  3WU1 B;  2XGX A;  1I27 A;  4WF2 A;  4UUS B;  2XSD C;  1O4X A;  2NOJ B;  1SD7 A;  2TDX A;  4M3D A;  5J4V A;  4DW6 A;  3J7Y J;  3WG9 A;  1WH5 A;  1Z7L A;  1AWC A;  4G6T B;  3F8F A;  1FTT A;  1W0U A;  2TRT A;  1QQI A;  4QIW N;  2DMU A;  3HPG A;  4BXF A;  3DFG A;  4YG2 F;  2CW8 A;  2FD5 A;  2CQN A;  4QLC U;  3NWS A;  2Q2E A;  5FKK A;  2STT A;  1O3R A;  4YEJ A;  4CZC A;  5DDG A;  2JN6 A;  1MMG A;  2VN2 A;  2WY7 Q;  3E6D A;  4WX9 A;  1O3S A;  4N0B A;  3FXO A;  2PBI A;  4HZF A;  2B63 J;  2VUM J;  2IGK A;  4CHU A;  2PJR A;  4GYI A;  1WFX A;  2GXG A;  1Z3Y A;  2V26 A;  3ZQF A;  1PDN C;  3F8N A;  3A0H C;  1P6R A;  1P9Q C;  4FQG A;  2W25 A;  3G71 I;  3EQL F;  2HU9 A;  3A01 A;  4ETS A;  2D45 A;  2KZG A;  2P8T A;  2H8R A;  1ZG5 A;  1JT6 A;  1AOY A;  2KP6 A;  3E5Q A;  4P5O A;  1XGN A;  2PLY A;  1MJ9 A;  3DKW A;  3H9G A;  5F64 A;  2IAI A;  2MFZ A;  3W3C A;  1A04 A;  1BC7 C;  2Y0M A;  1ON1 A;  4U0Y A;  4Q5S F;  4XIC A;  1BM9 A;  2QSF X;  1V55 H;  2Z1D A;  1IUF A;  4DOZ A;  2NRA C;  1ON2 A;  4XON A;  3HGY A;  1VQ6 I;  1ZGW A;  1O57 A;  1TLH B;  2O0Y A;  4KFC A;  1ETQ A;  4M9Z A;  2Y75 A;  5EDN A;  3GLL A;  1MMS A;  2EWN A;  5DEQ A;  2DYS H;  3BR6 A;  5HLH A;  3WGI A;  1OFC X;  4HQM A;  3GYH X;  3K69 A;  2ME0 A;  3E6B A;  4RAG A;  1BL0 A;  3DEW A;  3CUQ B;  4Y15 A;  2PQ8 A;  1HCR A;  2LNB A;  1E2X A;  2P6T A;  3CDI A;  5AIP A;  4HW0 A;  3W2V A;  4HNU A;  5LGT A;  2H6B A;  1JKR C;  3QOD A;  2V4J C;  2VKH A;  1R36 A;  4CDG A;  2VOO A;  5LEJ A;  3TO7 A;  1Y1W J;  1XGS A;  4NC6 A;  1GVD A;  5M5W J;  3J80 Z;  3ZQH A;  3GFL A;  1SFO J;  1UAA A;  1QO0 D;  3NAU A;  2P81 A;  3HOZ J;  1FEX A;  2F6C A;  1W5T A;  3K9T A;  5J47 A;  3IAM 2;  4M3F A;  3V7S A;  3TOB A;  2FBH A;  4F93 B;  2DDB A;  4MGR A;  4MQ9 F;  1S29 A;  4DJA A;  3ZP5 A;  2X6W A;  3PUF A;  2NVT J;  3ERM A;  2L2O A;  1FNN A;  4ESF A;  3BR2 A;  1EA3 A;  4UB6 C;  2HKX A;  3CDL A;  1A36 A;  4LIV A;  3AL0 C;  1ZEL A;  4BUP A;  2LVS A;  4II3 A;  5DV5 A;  1X3W B;  5FKN A;  1IO2 A;  3C2B A;  3KZY A;  1FIP A;  1SFU A;  3N4M A;  2XGE A;  2DOE A;  1WI9 A;  4MHG A;  2CSO A;  5HDK A;  4BS9 A;  1XDS A;  3OYK A;  3K4J A;  3IKV A;  1QRY A;  3KEQ A;  2FXA A;  1WSU A;  1REP C;  5B3S H;  4NBQ A;  2XB0 X;  1XB4 A;  3HEF A;  4OAY A;  2JK3 A;  2ZNZ A;  2LK2 A;  4MEX F;  3U1D A;  3GVA A;  3O3K A;  2OZ6 A;  3HRU A;  5FKO A;  2L9S A;  2YPR A;  3VDX A;  3CC4 I;  1O7L A;  4EVI A;  4LG0 A;  4L5E A;  3GFM A;  3LSH A;  1O7F A;  3OYC A;  1JGS A;  2N8G A;  3H3Z A;  4UUS A;  2BE5 F;  4JP0 A;  3TDU C;  3TMO A;  3ULQ B;  5H6Q A;  1TTY A;  4N4N B;  1SVM A;  4CA0 A;  3OMY A;  4X0G A;  2LOO A;  4XM3 A;  2JA5 J;  2M5W A;  2DPU A;  1LNW A;  4DYR A;  3LFK A;  1ZG3 A;  3K70 C;  4EM2 A;  5E1Z B;  2KIU A;  2O3F A;  2FQ3 A;  5B66 C;  2VON A;  2P6S A;  4AM3 A;  1PP8 F;  2BZT A;  4XLH A;  5FD6 A;  1Y39 A;  4UB8 C;  1VF9 A;  1SEU A;  3BT9 A;  4UXN A;  2A6H F;  2VQL A;  5DCF A;  1U78 A;  5FFX A;  2HGC A;  4AD9 A;  1B59 A;  4YIF A;  1UCR A;  3QU3 A;  3PNT A;  4ZDL A;  1N78 A;  2DOF A;  4RM2 A;  2A68 F;  2BY0 A;  2MBF A;  4I2O A;  1IDZ A;  2I5U A;  5DM6 F;  1UHW A;  4B43 A;  4HX7 A;  1DDN A;  4BY1 J;  1E3H A;  4Y3O A;  3GZ6 A;  1S7E A;  3B6A A;  4CIC A;  3RKW A;  2ICW G;  5F08 A;  4DBQ A;  4O6J A;  2K9N A;  5CKT A;  3F8B A;  1R22 A;  2JVH A;  1PYV A;  5ICF A;  2FJ1 A;  3KCC A;  4XRM A;  4WXH A;  1CGP A;  1EH8 A;  5IOY A;  2LRD A;  1ZRC A;  3JRI A;  4ENJ A;  1GT0 C;  1Q1H A;  2JPC A;  1SFE A;  5ICG A;  2UZK A;  1WQ2 A;  1BR4 A;  2LF8 A;  2VKV A;  3CP8 A;  2VAS A;  3M07 A;  3BJ6 A;  3P5J A;  1S3J A;  2DN0 A;  3I71 A;  2DQR A;  2XF5 A;  5L3B A;  2EFP A;  1JTX A;  1PUE E;  2DAO A;  3E6C C;  1QZZ A;  5EGO B;  3OYH A;  4BAY A;  2M87 A;  4R1H A;  4ZH4 F;  1FOK A;  4EJT A;  3CJN A;  1ETK A;  2NAZ A;  1VQN I;  3NWT A;  1OLT A;  4L5J A;  3EUK L;  3BP8 A;  5K7F A;  4J00 A;  3IAS 2;  4WCG A;  1N25 A;  4DGW B;  5D5W B;  3MCZ A;  4EMS A;  2OC6 A;  2R7W A;  1NH3 A;  5GTH C;  2OV7 A;  3E6M A;  3I0T A;  3K4M A;  3O6B B;  5E20 A;  5KNL A;  3HRM A;  5M5Y J;  1K78 A;  1A31 A;  5F0F A;  1NG7 A;  1Q1V A;  1LB2 A;  2R7R A;  2IA2 A;  3CJQ B;  3ZQ7 A;  5CPR B;  3QOP A;  3FMR A;  3KE2 A;  5TIS C;  4EJU A;  4P9F A;  1YJW I;  3OL3 A;  1SC7 A;  2XAU A;  4YFX F;  4BHC A;  1AU7 A;  2WAF A;  3HHH A;  3I53 A;  5IYC J;  2A5Y B;  2LYC A;  1R49 A;  3HZJ A;  2QWW A;  2LDU A;  5L3D A;  4ZYD A;  1LKX A;  3U2R A;  4MO7 A;  3Q0W A;  4EQQ A;  3NAR A;  4A3F J;  2ISY A;  2FOK A;  2HYF A;  3FXQ A;  2CV1 A;  5TJJ A;  1X1P A;  3RIR A;  4C2U A;  3OIO A;  3HPH A;  2HYJ A;  3KFW X;  2EFW A;  4P55 A;  5D4R A;  2BYV E;  2XB5 A;  1YOV B;  2EIK H;  2LF7 A;  2V7F A;  4IRG A;  2JA6 J;  4L9V A;  2E2J J;  2VJI A;  3ZQQ A;  1QHG A;  1LFP A;  3AG3 H;  1TWG J;  2GBY A;  4HBL A;  2VL8 A;  1E17 A;  3GFJ A;  1OMI A;  2F5E A;  4A5M A;  1RC9 A;  3CMY A;  5E79 C;  2P0W A;  1YRN A;  2VQC A;  2ME6 A;  4PGG A;  3T8T A;  5E8I A; 
#chains in the Genus database with same CATH homology
 1QGP A;  3HHG A;  4G7H F;  2M30 A;  4RGU A;  5FFZ A;  1B1B A;  4LLL A;  4RGX A;  2OA4 A;  3GXO A;  3IKT A;  3DXJ F;  3PQJ A;  5HLG A;  5HS7 A;  3W6K B;  2DK8 A;  3JSO A;  1K79 A;  1CF7 A;  2YX4 A;  5FLX Z;  3E5U A;  1USS A;  3MEX A;  2RDP A;  2IJL A;  1IW7 F;  3CUO A;  1FBU A;  1H9T A;  2NYX A;  3FMS A;  4GXO A;  1BOA A;  2WWY A;  4HDU A;  4A12 A;  3GX4 X;  1NHA A;  4UHT A;  2QQB A;  2IVM A;  1G3T A;  2RGV A;  1HBX G;  5E17 F;  5DCM B;  1TQP A;  2H27 A;  3EYI A;  2A3S A;  3KP7 A;  3M8E A;  3HOS A;  4KIC A;  1IRG A;  3RJP A;  3ZMT A;  5ERI A;  4YFN F;  4WXC A;  2E1C A;  2IW5 A;  3CUQ A;  3JAM K;  5LHG A;  3SQN A;  1J59 A;  3TKY A;  2H09 A;  2PG4 A;  4K2E A;  5DUK A;  4I7H A;  1OPC A;  1HW5 A;  3QRF F;  1ZG1 A;  5JHU A;  2R3S A;  2CWE A;  2P4W A;  3WGH A;  4I01 A;  1IXC A;  1J2X A;  1XSD A;  3H3U A;  2KIM A;  5CVV A;  4G6D A;  1R1U A;  5CVJ A;  2G9W A;  5F6F A;  1YS6 A;  1BIA A;  3KP6 A;  1HKQ A;  3F6V A;  4ON0 A;  3WTV C;  2P5K A;  1MJB A;  1XMA A;  3P9I A;  5D4S A;  5DD4 A;  4KNY A;  2PMU A;  4UNO A;  4O3M A;  2QZ8 A;  1I1S A;  2OBP A;  1LDK B;  3BRO A;  4ESJ A;  4MTE A;  4NHJ A;  4LB5 A;  4ZYG A;  2R7F A;  1ZN2 A;  2CO5 A;  1T2K A;  2RV8 A;  2A69 F;  2CQK A;  3B73 A;  2AXL A;  2L4A A;  4RS8 A;  5A2Q K;  4H0E A;  4WXD A;  3ABU A;  2HDC A;  5IT9 K;  1MGT A;  4A0Y A;  1G4D A;  1SD4 A;  1R5G A;  2EFN A;  3FZV A;  2ELH A;  1YW8 A;  1Z1D A;  1EH7 A;  1IXR C;  5E1W A;  5K5R A;  4IVN A;  4O5V A;  3KEO A;  1BI1 A;  1S6L A;  1G3Y A;  1ZH5 A;  1KYW A;  2DT5 A;  5L3C A;  3C7J A;  4R79 A;  2XIG A;  1ZGA A;  3N97 A;  1KU9 A;  2W84 A;  1L3L A;  1XGM A;  5H20 A;  5LRS A;  1XCB A;  3M7G A;  2JPB A;  3M8F A;  3JW4 A;  1Z6R A;  3HRT A;  3PFI A;  2V1U A;  4LGW A;  4WWC A;  2MH9 A;  2IP2 A;  5L3G A;  3P7N A;  2EK5 A;  2OZU A;  5CVI A;  4U0W A;  3ROU A;  2MC3 A;  2XRO A;  2VBZ A;  1H9G A;  2DI3 A;  2XAF A;  1MJA A;  2Q8K A;  2EFQ A;  2XUB A;  2OAZ A;  5EEH A;  3GUD A;  1B4A A;  2EV0 A;  3IWF A;  3EDP A;  2VE9 A;  1V4R A;  1FC3 A;  5ILV A;  5J8F A;  3FMQ A;  2EV6 A;  2L3D A;  3KZZ A;  4N9H A;  3L7W A;  3ISP A;  1MD0 A;  2BBY A;  2ESH A;  1FBS A;  4M71 A;  5LBQ A;  2ESN A;  3HIF A;  1YLF A;  3ERE D;  2QLZ A;  2K02 A;  1EV7 A;  2KJC A;  3BY6 A;  3LA7 A;  1K78 B;  4B09 A;  3VFZ A;  2RVC A;  3V7R A;  3Q9S A;  3ZN1 A;  2HFH A;  3I54 A;  1U5T A;  1WWX A;  1DUX C;  2BEO A;  1B9M A;  5BMZ A;  5EEG A;  1R1T A;  4B8X A;  4ZYH A;  4I0B A;  5HOO A;  2M8E A;  3RPQ A;  3VEP A;  5CVU A;  5LHI A;  2GAU A;  4OIN F;  3RKX A;  1GXP A;  1IF1 A;  2FU4 A;  4RB2 C;  4FHT A;  1KQ0 A;  3LWF A;  2VOD A;  1WKM A;  4GGG A;  4FX4 A;  5L3F A;  5K5O A;  4G7O F;  3LA3 A;  3JTG A;  1F1Z A;  2HTJ A;  3I59 B;  4A6D A;  2L54 A;  4RAZ A;  4OIO F;  2EJR A;  1FP1 D;  1ZLK A;  4A0Z A;  3RPU A;  4KMF A;  1HW2 A;  1WRJ A;  3KP2 A;  2QM3 A;  5L3E A;  4L9J A;  1KQ8 A;  4G94 A;  4S04 A;  3WTW C;  4IJA A;  3MAJ A;  1KU2 A;  4AVP A;  4KIF A;  1LEA A;  3WU0 A;  2HOE A;  1JHH A;  5E1X A;  3ECO A;  3DPL C;  5HLI A;  2OQR A;  2GWR A;  5FD5 A;  4RAY A;  3C3W A;  2V6C A;  5DD8 A;  3D0S A;  2EA2 A;  1EH6 A;  1IZ1 A;  1F4K A;  2ZKZ A;  4CO8 A;  1IN5 A;  5FLX K;  2VC1 A;  5CVR A;  3F6O A;  4LD5 A;  3F72 A;  2RC4 A;  2O8X A;  2PEX A;  4CXF A;  3WE3 A;  3DF8 A;  1J5Y A;  2KRF A;  2VBW A;  3HTU A;  4ZYE A;  3ZN0 A;  2GXB A;  1D8K A;  1ZGJ A;  3GW2 A;  4RB3 C;  2KIF A;  1MZB A;  3TQN A;  4M72 A;  4JK1 X;  2P7C B;  5J6X A;  2ZFW A;  4EJV A;  1RI7 A;  4BHP A;  1DPU A;  4AIJ A;  5CLS A;  2L01 A;  4BQA A;  2O61 A;  4A2U A;  4Q47 A;  2YX7 A;  1GVJ A;  2CYY A;  3KLO A;  1O3T A;  1P92 A;  3T0Y A;  1FLI A;  1RZ4 A;  5HDG A;  2ZO4 A;  4HV5 A;  1D5V A;  4U88 A;  3VB2 A;  1Z05 A;  2MLK A;  2VT3 A;  4UVB A;  3QPT A;  1PP7 U;  3ZPL A;  1W7P B;  1YW7 A;  2HZT A;  3ABT A;  2GA1 A;  2JZY A;  1FY7 A;  3GLX A;  4UVA A;  4HF2 A;  2ZME B;  4MTD A;  4GO1 A;  3QAH A;  4AIK A;  4KIB A;  2PI0 A;  3RYR A;  4DQ2 A;  2E7X A;  1U8R A;  1LDJ A;  2K86 A;  4XSZ F;  3FXR A;  1YG2 A;  4P9U A;  1R5H A;  1XDU A;  3D5L A;  1I5Z A;  2FNP A;  1YYV A;  2FBI A;  4L9N A;  2YU3 A;  4PZJ A;  1LEB A;  1FYL A;  2LKP A;  2M45 A;  2K27 A;  5DUI A;  4YII A;  2QVO A;  5LGU A;  4L9T A;  1XGO A;  2HS5 A;  2YSR A;  3E97 A;  3F3X A;  4HLY A;  4KUM A;  2J5O A;  3SXY A;  2XAH A;  3R0J A;  3DQV C;  1D8J A;  2HWV A;  2M1B A;  3F21 A;  3ECH A;  4P96 A;  3H92 A;  3W6J B;  3GFI A;  1RIO H;  3J7A O;  3J80 K;  3KP3 A;  2GZW A;  3FM3 A;  3KLN A;  1G3S A;  2XKO A;  1HST A;  2EV5 A;  2X0L A;  2VBX A;  4XSX F;  1XD7 A;  2JTV A;  1JHF A;  5D5V B;  3ELK A;  2F5F A;  4HOB A;  3ML6 A;  4CZZ A;  2OQG A;  2ZNY A;  3RTR A;  4M74 A;  1OYI A;  5D6E A;  4KT5 C;  4GYG A;  3ZMU A;  4L18 B;  1ZRE A;  6PAX A;  1OKR A;  1KU3 A;  4FX0 A;  3JSP A;  1BI2 A;  1BC8 C;  2QQ9 A;  5HS8 A;  3T1B A;  4Z2Y A;  3PQK A;  4IRH A;  1IN8 A;  2AS5 F;  3DEU A;  2ZME A;  1GXQ A;  3QP5 A;  4XBF A;  2RKH A;  3MWM A;  2O03 A;  3JAM Z;  4AWX B;  2Z3Y A;  1KGS A;  4JQF A;  3M9A A;  3SHF A;  3E3V A;  3K1M A;  3MQ0 A;  1X3U A;  3TOA A;  2XHK A;  3WTU C;  4PDK A;  5LLQ A;  3C18 A;  2XVC A;  2B0L A;  4EGZ A;  4G6Q A;  1S7O A;  4EM0 B;  1P2F A;  3U9G A;  1ZAO A;  4GCV A;  2PJP A;  2QBY B;  2VBY A;  2HR3 A;  4AIH A;  1TNT A;  3HSF A;  1ZYR F;  2L02 A;  3KP5 A;  2H94 A;  2V1D A;  1YQA A;  4OU0 A;  3MFK A;  2P5L C;  1RUO A;  3VOE A;  1R58 A;  4L5I A;  1K6O A;  4OIR F;  3GF2 A;  1HKS A;  1J75 A;  1OYY A;  4ENN A;  1DP7 P;  1V3F A;  2Z9O A;  3R0A A;  2ZJ2 A;  2OU2 A;  3BZ6 A;  2KJB A;  5IT9 Z;  1HW1 A;  4XLN F;  4JBA A;  4HQE A;  4NQW A;  1T98 A;  3WTZ A;  1LQ1 A;  3LAP A;  1VTN C;  4LLG F;  1KA8 A;  1QZY A;  1ULY A;  3IRQ A;  2CW0 F;  2COM A;  3QP6 A;  2FBK A;  3HSR A;  2XAJ A;  3IWZ A;  2D1V A;  2YR2 A;  1XCV A;  5E8G A;  1SAX A;  4PCQ A;  3HOT A;  4IHT A;  4KYW A;  3MZY A;  4HF1 A;  4ASN A;  4N9I A;  1HSJ A;  1YS7 A;  1UB9 A;  3TGN A;  3G73 A;  1CF7 B;  3BPV A;  3LA2 A;  1FSH A;  4BH9 A;  5ICE A;  1ZRF A;  4XRF A;  3RDI A;  3V7C A;  2F5C A;  4F7Z A;  1DPR A;  4R8H A;  5CJ9 A;  1ZAR A;  1OR7 A;  2RNJ A;  1SMT A;  4U7D A;  2ADU A;  1P4X A;  4A0X A;  5HDN A;  4D0P A;  3R6S A;  5AON A;  1Y0U A;  3HYI A;  3SFZ A;  1B6A A;  1J9I A;  3CO7 C;  2DPD A;  3L09 A;  3GEZ A;  2RQP A;  3ZMS A;  2DK5 A;  2IT0 A;  4FT8 A;  3BJO A;  1FPQ A;  2FNA A;  4M9X A;  4LG0 B;  1IAW A;  1T38 A;  2ACJ A;  3K1P A;  1UHM A;  1IRF A;  1T39 A;  5E18 F;  2WTE A;  2MA3 A;  4MNU A;  2A6E F;  3F22 A;  1F9N A;  2V9V A;  1UST A;  2PN6 A;  4UVC A;  1SMY F;  2C6Y A;  4IPA A;  3T8R A;  4IF4 A;  1QBJ A;  3GZ5 A;  1R7J A;  4WK8 F;  5ICC A;  3E5X A;  3BOQ A;  3CLO A;  3VOD A;  5AIQ A;  2A61 A;  1IN4 A;  1TW3 A;  3SZT A;  1JE8 A;  1FYK A;  2A07 F;  1KYZ A;  4U0V A;  1I6X A;  1O3Q A;  3AAF A;  3TDZ C;  2Z33 A;  2XKP A;  3EUH A;  2F5D A;  2QQA A;  1T6S A;  2NNY A;  2XRN A;  2MLG A;  2W85 A;  3NRV A;  4LK1 F;  1P4A A;  5BQT A;  2V79 A;  2LSO A;  5CYV A;  2EA4 A;  1U5T C;  2GIV A;  3M1E A;  1TBX A;  3SZP A;  3COA C;  2HEO A;  1QPM A;  1BI0 A;  5BPI A;  4BYY A;  1W7P D;  2G7H A;  5LRR A;  1IN6 A;  2E7W A;  3K2Z A;  3RI4 A;  1W7P A;  3WOD F;  3EYY A;  1UFM A;  4L0Z B;  2WC2 A;  4QWQ A;  1TQM A;  3DP7 A;  4LK0 F;  1HQC A;  5HS9 A;  3FF5 A;  1W5S A;  3FWE A;  1J7K A;  3OOP A;  1BI3 A;  4L0Y B;  4HAM A;  1G3W A;  3BDD A;  3Q9V A;  3RKY A;  3IL2 A;  2FE3 A;  1FP2 A;  4E70 A;  5JVT A;  2VT2 A;  2J5P A;  3CDH A;  2F2E A;  5D8L B;  3G3Z A;  1TQI A;  2RN7 A;  2QBY A;  1ZHF A;  4I02 A;  4I98 B;  4Q4Z F;  4RB0 A;  2STW A;  2PMH A;  4KMU X;  3LQQ A;  3HTS B;  4HX4 A;  3CUQ C;  5KK1 A;  1ZLJ A;  3IC7 A;  4EM1 A;  4KIG A;  5TRD A;  3O2P E;  2VXZ A;  3FXU A;  1YO5 C;  2BGC A;  4ENK A;  2FA5 A;  5BPD A;  1Z91 A;  1T0F A;  3WTT C;  3MZH A;  1XSV A;  2EB7 A;  4RB1 A;  5DCM A;  3NQO A;  3WTS C;  2K7L A;  4M73 A;  1J0R A;  1IUY A;  2VC0 A;  4OOI A;  4CYD A;  2DQL A;  3L9F A;  2HQR A;  2K4B A;  1H0M A;  5ILS A;  4EJW A;  1YFH A;  3WGG A;  2DLL A;  1LJ9 A;  3K0L A;  3I5U A;  3NEU A;  3LQR A;  5J8C A;  4UV9 A;  1Z9C A;  2DW4 A;  2Y48 A;  4HDV A;  3JTH A;  2FSW A;  3F23 A;  2HYG D;  4U7B A;  2V1X A;  3T5X A;  1L0O C;  4NB5 A;  2P5V A;  2DBB A;  3FX3 A;  2DU9 A;  5F1R A;  3J81 K;  4RGR A;  1S8N A;  2UXX A;  2JSC A;  3R61 A;  1U5T B;  4UV8 A;  2PFB A;  3LST A;  2W57 A;  3F8C A;  3WE2 A;  3V8K A;  4KDP A;  3IHU A;  4MEY F;  3V8L A;  2QYO A;  1LVA A;  1W4M A;  4ZZL A;  2CFX A;  1F5T A;  4KN4 X;  3BJA A;  1YIO A;  2UXN A;  4OMZ A;  4EGY A;  5D8K B;  1U2W A;  1MDM A;  2MH2 A;  3QPH A;  3HUG A;  1P4W A;  4XLP F;  1FZP B;  3WTY C;  4TV7 A;  2KKO A;  1HXD A;  4M6Y A;  4LJZ F;  2FF4 A;  4BXU A;  4HV6 A;  1IN7 A;  1ZRD A;  2D2W A;  2IA0 A;  3L2C A;  2Z99 A;  2EFO A;  1IXS B;  4PGH A;  5LHH A;  5K5Q A;  2ZXJ A;  3IRR A;  3WTX C;  5FGM A;  3CO6 C;  3R60 A;  5ILU A;  2R7D A;  3FM5 A;  2ETH A;  1XMK A;  1R1V A;  2ZCW A;  4S05 A;  5LGN A;  1STZ A;  4IRI A;  1FSE A;  5DYM A;  4ESB A;  2L4M A;  1Z6T A;  1I1G A;  2H6C A;  2IRF G;  4BNC A;  3ZMV A;  5JI6 A;  3K1N A;  1Z7U A;  5D5U B;  2XV4 S;  4G7Z F;  4LB6 B;  3KET A;  2ISZ A;  1XN7 A;  3BWG A;  5LEK A;  2FRH A;  3C1D A;  2BV6 A;  2HQN A;  1K7A A;  3EET A;  4A6E A;  2HKO A;  1KU7 A;  4A5N A;  2JT1 A;  3R4K A;  3OV8 A;  2MD5 A;  3DPT A;  2JRT A;  5D6F A;  3LAJ A;  1MKM A;  2DO7 A;  4HA8 A;  4LFU A;  1SFX A;  5FO5 A;  1D3Y A;  4DNC A;  3HRS A;  4HF0 A;  2GA2 A;  2FMY A;  3QU6 A;  5IT3 A;  2ZBK A;  2FML A;  3L00 A;  5ED4 A;  5KVR A;  3V8J A;  2Z5U A;  2E1N A;  5BS6 A;  3CTA A;  1B9N A;  4I0A A;  1JXS A;  2QEN A;  3I58 A;  4HLX A;  2VOP A;  3GWZ A;  3HSE A;  4CGZ A;  1ONV A;  1FBQ A;  4EJO A;  1R00 A;  3FHZ A;  2O6G E;  1C0W A;  1MDM B;  2NNN A;  3TO6 A;  2K4J A;  3V4G A;  2OD5 A;  2WV0 A;  5FB2 A;  1YTY A;  3P9K A;  5A2Q Z;  4Y13 A;  2DTR A;  2G7U A;  4Q48 A;  1OYW A;  4MQV A;  2QUF A;  1BN5 A;  1TW2 A;  3KP4 A;  5K1Y A;  4RGS A;  3DV8 A;  1XSX A;  3REO A;  1S7A A;  1TNS A;  4M9S A;  4G9Y A;  4HX8 A;  3P9C A;  2W24 A;  1FYM A;  4LLN A;  3I59 A;  2XAQ A;  2UWM A;  3ZMD A;  4OIQ F;  5H6R A;  1HKT A;  2GQQ A;  4UUV A;  3F8M A;  3TO9 A;  2DFI A;  5HVQ C;  5BOX A;  3B02 A;  2IA1 A;  1BIB A;  1RNL A;  2FEZ A;  4IXA A;  2P7V B;  2XAG A;  1SD5 A;  3I64 A;  1QNT A;  2IPQ X;  2CG4 A;  1KQ9 A;  2Q0O A;  1SD6 A;  4OIP F;  4HYE A;  4I09 A;  1BJA A;  2VE8 A;  1LDD A;  1G6N A;  1U6G A;  2CGP A;  1FWZ A;  2NS0 A;  1BBY A;  4ZZD A;  4BHB A;  2XAS A;  4EV0 A;  1RUN A;  1YW9 A;  4LMY A;  4OMY A;  3RYP A;  4G8X A;  2X4H A;  4IHS A;  3S2W A;  3I4P A;  1ODD A;  1U3E M;  4YFK F;  3ZMZ A;  4KN7 X;  4KA4 A;  1R23 A;  5JFR A;  2D1H A;  1GHC A;  5D5X B;  3Q5F A;  4ENM A;  1FX7 A;  5JR3 A;  2HTS A;  3BPX A;  3GO5 A;  1FT9 A;  3J81 Z;  4M6X A;  4Y17 A;  3WU1 B;  2XGX A;  1I27 A;  4WF2 A;  1SD7 A;  2TDX A;  3WG9 A;  1AWC A;  3F8F A;  1QQI A;  3DFG A;  4YG2 F;  4QLC U;  2Q2E A;  2STT A;  1O3R A;  5DDG A;  2VN2 A;  3E6D A;  4WX9 A;  1O3S A;  4N0B A;  2PBI A;  4HZF A;  4CHU A;  4GYI A;  2GXG A;  1PDN C;  3F8N A;  1P6R A;  2W25 A;  3EQL F;  4ETS A;  2D45 A;  2P8T A;  1ZG5 A;  1AOY A;  3E5Q A;  4P5O A;  1XGN A;  2PLY A;  1MJ9 A;  3DKW A;  5F64 A;  1A04 A;  1BC7 C;  2Y0M A;  1ON1 A;  4U0Y A;  4Q5S F;  1BM9 A;  2NRA C;  1ON2 A;  1O57 A;  1TLH B;  2O0Y A;  4KFC A;  4M9Z A;  2Y75 A;  2EWN A;  5DEQ A;  3WGI A;  5HLH A;  4HQM A;  3GYH X;  3K69 A;  3E6B A;  4Y15 A;  3CUQ B;  2PQ8 A;  2LNB A;  1E2X A;  2P6T A;  5AIP A;  4HW0 A;  5LGT A;  2H6B A;  1R36 A;  4CDG A;  2VOO A;  5LEJ A;  3TO7 A;  1XGS A;  3J80 Z;  3GFL A;  1QO0 D;  1W5T A;  3K9T A;  3V7S A;  3TOB A;  2FBH A;  4MGR A;  4MQ9 F;  1S29 A;  3ZP5 A;  1FNN A;  4ESF A;  2HKX A;  5DV5 A;  3KZY A;  1SFU A;  3N4M A;  1WI9 A;  4MHG A;  2CSO A;  5HDK A;  1XDS A;  3IKV A;  3KEQ A;  2FXA A;  1WSU A;  1REP C;  1XB4 A;  2ZNZ A;  4MEX F;  3U1D A;  3GVA A;  3O3K A;  2OZ6 A;  3HRU A;  2YPR A;  1O7L A;  4EVI A;  4LG0 A;  3GFM A;  1O7F A;  1JGS A;  3H3Z A;  2BE5 F;  3TDU C;  3ULQ B;  5H6Q A;  1TTY A;  2M5W A;  2DPU A;  1LNW A;  3LFK A;  1ZG3 A;  4EM2 A;  5E1Z B;  2KIU A;  2O3F A;  2FQ3 A;  2VON A;  2P6S A;  1PP8 F;  5FD6 A;  5DCF A;  2A6H F;  4UXN A;  1U78 A;  5FFX A;  2HGC A;  4AD9 A;  1B59 A;  4YIF A;  1UCR A;  3QU3 A;  2A68 F;  2MBF A;  4I2O A;  1UHW A;  4HX7 A;  1DDN A;  3GZ6 A;  4CIC A;  3RKW A;  4O6J A;  3F8B A;  1R22 A;  5ICF A;  3KCC A;  4WXH A;  1CGP A;  1EH8 A;  1ZRC A;  4ENJ A;  1Q1H A;  2JPC A;  1SFE A;  5ICG A;  2UZK A;  1WQ2 A;  2LF8 A;  3BJ6 A;  1S3J A;  3I71 A;  2DQR A;  5L3B A;  2EFP A;  1PUE E;  2DAO A;  3E6C C;  1QZZ A;  4BAY A;  2M87 A;  4R1H A;  4ZH4 F;  1FOK A;  4EJT A;  3CJN A;  2NAZ A;  4L5J A;  3BP8 A;  4WCG A;  5D5W B;  3MCZ A;  4EMS A;  3E6M A;  3I0T A;  3O6B B;  5E20 A;  3HRM A;  1K78 A;  1LB2 A;  2IA2 A;  3ZQ7 A;  3QOP A;  3FMR A;  3KE2 A;  4EJU A;  4P9F A;  4YFX F;  4BHC A;  3HHH A;  3I53 A;  2A5Y B;  2QWW A;  2LDU A;  5L3D A;  4ZYD A;  3U2R A;  4EQQ A;  2ISY A;  2FOK A;  2HYF A;  3FXQ A;  5TJJ A;  3RIR A;  3KFW X;  2EFW A;  4P55 A;  5D4R A;  2BYV E;  2LF7 A;  4IRG A;  4L9V A;  4HBL A;  1E17 A;  3GFJ A;  1OMI A;  2F5E A;  4A5M A;  4PGG A;  3T8T A;  5E8I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...