1I1SA

Solution structure of the transcriptional activation domain of the bacteriophage t4 protein mota
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
96
structure length
96
Chain Sequence
MSKVTYIIKASNDVLNEKTATILITIAKKDFITAAEVREVHPDLGNAVVNSNIGVLIKKGLVEKSGDGLIITGEAQDIISNAATLYAQENAPELLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords MOTA
publication title Solution structure of the transcriptional activation domain of the bacteriophage T4 protein, MotA.
pubmed doi rcsb
source organism Enterobacteria phage t4
total genus 21
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2001-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09114 MotA_activ Transcription factor MotA, activation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1i1sA00
3J80Z 5BPDA 2MLKA 2OU2A 4I0BA 2DK5A 3JAMK 4ZH4F 3WU0A 1FZPB 4L9TA 2CG4A 3DP7A 3ERED 2LSOA 1U5TB 1F1ZA 4XRFA 1WKMA 1S29A 4IF4A 1EV7A 2XGXA 1SD7A 3WTZA 1SFEA 4MGRA 3J81K 1W4MA 5F6FA 2NYXA 5K5QA 2M87A 3WTXC 5HVQC 4A6EA 4EGZA 1R7JA 2GIVA 1BI2A 5D4SA 4M72A 4ENNA 5ERIA 1O3RA 1I5ZA 2HDCA 4O5VA 2M5WA 4RS8A 4ASNA 1W7PA 5LRSA 2RGVA 2K86A 2DK8A 2KRFA 4M73A 2GXGA 4YG2F 1FBUA 5L3BA 1W5SA 3ZMSA 3BZ6A 1S7OA 1BC7C 5CLSA 3F8BA 2ADUA 1RZ4A 5DCMA 2YR2A 2FE3A 3U1DA 2IA2A 1O3QA 4OOIA 4LLGF 5LHHA 3WTWC 2EFNA 3PQKA 3SQNA 1MDMB 2Z99A 2JPBA 3C7JA 4Q47A 1XMKA 4N9IA 1FLIA 2F5CA 2KIUA 1J59A 5FGMA 5ICEA 4YFNF 3JTHA 2Y48A 1WQ2A 4BHCA 4A6DA 2QENA 2B0LA 1ZLKA 3LAJA 2JTVA 3E3VA 5CVRA 3DQVC 1D8KA 4EMSA 1MD0A 4RGUA 4ZYEA 4RB0A 3V8KA 2A5YB 3JW4A 4GO1A 1V4RA 5DV5A 5L3CA 4AIKA 1XB4A 5K1YA 4HQMA 4ZZLA 1IXCA 2A6HF 2PQ8A 2L4AA 1KU3A 2ZCWA 2Z3YA 4KIGA 3V7RA 1K78A 1XGNA 4PCQA 1RUNA 3GUDA 4LFUA 2FEZA 3IKVA 2P7VB 3EYIA 4JK1X 3CO6C 2XAGA 5FLXZ 3EUHA 2ZKZA 5E1XA 4G6QA 2FMLA 3ZMVA 1IUYA 1TQPA 1OMIA 1IRGA 2FNAA 3GVAA 3FMQA 1ODDA 2FA5A 2WC2A 2L4MA 2FRHA 2IA0A 3LA7A 4Y17A 1CF7A 4MQVA 4ETSA 3WGGA 2A3SA 3BWGA 4DNCA 1L0OC 1FC3A 4I0AA 3GZ6A 1LVAA 3CUQA 2HQRA 3FWEA 3F8NA 4OIPF 4KA4A 4G8XA 2VOOA 1T98A 5E17F 1LEBA 1IN8A 3Q9SA 4MQ9F 3SZTA 3DPTA 5HS9A 3FX3A 1J0RA 2XHKA 2HKXA 3G73A 2PLYA 3QU6A 3GWZA 3F3XA 2QUFA 3V4GA 4XBFA 3IKTA 4HBLA 4CDGA 1O7LA 3V7SA 3Q5FA 1HKTA 2VBYA 1AOYA 2RNJA 3HRSA 3VODA 3ABTA 2ZXJA 3T8RA 2ISYA 2GZWA 5E1WA 3QP5A 1KA8A 3W6JB 2E1CA 2X0LA 2D45A 5ILSA 4IHSA 2KIFA 4M9SA 3JSOA 1Q1HA 1HKSA 1O57A 2DW4A 2K27A 1R23A 1LQ1A 2D1VA 1XDUA 1Z9CA 3N97A 1WRJA 1ZARA 4EJWA 4WXHA 5D6FA 1S8NA 1TLHB 2OA4A 4EVIA 3SFZA 5L3FA 3H3ZA 1BI0A 2FBIA 3KCCA 2FNPA 1HW2A 2V79A 4EJUA 3ZMTA 5JVTA 1QQIA 5D6EA 1A04A 3KFWX 4AIHA 3WTVC 2KKOA 4MTEA 1XCVA 5IT9K 2EWNA 2FQ3A 3WGHA 2FU4A 3TKYA 3TGNA 1HBXG 1B9MA 4NHJA 5CVVA 2FMYA 4RAYA 3QP6A 2O61A 1LJ9A 4KN4X 1Z91A 3HRMA 3IWZA 2X4HA 3K69A 5K5RA 1WWXA 2R3SA 2CWEA 2G7HA 1O3TA 5JFRA 4AIJA 3J7AO 1Z6TA 3OV8A 1BN5A 5FD5A 3JSPA 2IP2A 2QQ9A 2W24A 3O2PE 4HF2A 2VODA 4P5OA 4IHTA 2IA1A 4I01A 1RUOA 4ENJA 2MD5A 1KU2A 1EH8A 1TQMA 4G7ZF 2QZ8A 4F7ZA 1V3FA 3I4PA 2YPRA 3I71A 3I0TA 2LF8A 2DPUA 4M9ZA 4XLPF 4BHPA 2DU9A 1Y0UA 1F9NA 3WTSC 4UVAA 3MAJA 3KZYA 3F6OA 4L5JA 1PUEE 3IC7A 1U6GA 4ZZDA 3R4KA 2RVCA 4ESBA 3TQNA 1DPUA 4I09A 2C6YA 4HDUA 3B73A 3TO9A 3ZPLA 2Z9OA 5DD4A 5HLHA 1YLFA 3PFIA 5DYMA 3F22A 1FP2A 2ZMEA 2ISZA 3CTAA 1RNLA 2DPDA 1R1VA 2VXZA 2CGPA 2DAOA 1YW9A 5FFXA 4LG0B 3CDHA 2WWYA 2H09A 3F21A 4CO8A 2XRNA 2OQRA 5F64A 1EH6A 1YW8A 2GA2A 3HYIA 4KICA 1BBYA 2LF7A 5IT3A 2NS0A 3WE3A 4WCGA 2L3DA 2NRAC 1D5VA 3F72A 3K1MA 4D0PA 1USTA 4LGWA 2XROA 1AWCA 2CQKA 5AIQA 3RTRA 4P96A 2O6GE 4ENKA 1R1TA 4E70A 3FM5A 2JRTA 4HF1A 2M30A 3D5LA 1YTYA 3TO6A 5F1RA 5CVIA 1H9GA 3MQ0A 1STZA 3L2CA 3IHUA 2V6CA 3HSFA 3WU1B 1JHFA 3ZMDA 3COAC 5D8KB 2A68F 1XSVA 3KE2A 1OYYA 4KFCA 1LDJA 1R5GA 2DFIA 3HSEA 2QBYA 1UFMA 3EDPA 2VT3A 5LGUA 1D3YA 4A0YA 1JHHA 4BH9A 6PAXA 1IRFA 1XGSA 5HDGA 4ZYHA 4UV9A 2IVMA 2DTRA 3K1PA 5ILVA 3E97A 3RPUA 2OZ6A 4EJOA 3J80K 5FO5A 1ONVA 1GXPA 1Z6RA 3GEZA 2STWA 2K7LA 4UV8A 4MEXF 3FMRA 1B9NA 2H94A 4HYEA 1BI3A 4CHUA 1P92A 3GO5A 3SZPA 2UZKA 4U7DA 1R36A 3RYPA 1QBJA 1ZG1A 1QO0D 3K2ZA 2MBFA 4R1HA 3U2RA 2PBIA 2DLLA 2O0YA 2W57A 1ZGAA 2HYGD 1IF1A 3R6SA 4JBAA 4XSXF 2VBZA 1I1SA 3VOEA 2M8EA 1QZYA 2Q0OA 2YU3A 4P9UA 4UUVA 2FXAA 4Q48A 4BNCA 2JSCA 5CJ9A 1XCBA 2CO5A 3KP3A 2VN2A 4U0WA 3HOTA 3BPVA 3ELKA 4HX8A 4YFKF 5ICFA 4PZJA 4KYWA 1BIBA 5DUKA 3GF2A 3E5QA 4LJZF 1YIOA 1XMAA 3GFMA 2PFBA 5DEQA 3BJOA 1YQAA 2EA2A 4B8XA 1YYVA 1ZRCA 1G3WA 4HLXA 1LB2A 1P6RA 3FXUA 1IN4A 4R79A 5E18F 5LHGA 1SD4A 3DEUA 3RDIA 3R61A 2HQNA 4AD9A 4L9NA 4RB1A 1OYWA 4HAMA 4LLLA 4M71A 2XIGA 5CYVA 4ZYGA 2A6EF 3V7CA 1KYWA 2OBPA 5J8CA 5DDGA 2WV0A 4S04A 3QPHA 1ZN2A 1OYIA 1R00A 4Y15A 1O7FA 2G9WA 3I53A 1U5TA 1BC8C 1FBSA 5H6QA 4HA8A 3FXQA 4AVPA 3PQJA 2W84A 4HW0A 3TDZC 4A12A 4H0EA 2R7DA 1HXDA 1FNNA 5LBQA 5HS8A 3HHHA 2HKOA 2GXBA 1ZRFA 1YW7A 3ECOA 5HDNA 1ULYA 3ABUA 4G7OF 3FXRA 1IXSB 1DPRA 4OMYA 2CSOA 1FSHA 1LDDA 4KT5C 3T0YA 3RIRA 4HLYA 3HSRA 2CW0F 1IN6A 4K2EA 3FF5A 2V1UA 2P5KA 3BROA 2PJPA 5FLXK 3E5UA 4MNUA 3LWFA 4IRGA 4PDKA 3T8TA 1S7AA 5FFZA 3Q9VA 1OR7A 2W85A 3V8JA 2RQPA 1S3JA 4EM1A 3RKXA 2VONA 1F4KA 3FMSA 4MEYF 1FX7A 3P9KA 4LD5A 5TRDA 1JGSA 2ZNZA 3F23A 1XSDA 5E20A 4WXCA 4UHTA 3L7WA 1LEAA 2WTEA 2EFPA 2EFQA 5E8IA 4GXOA 4MTDA 5D8LB 1G3TA 5LRRA 4BYYA 1ZYRF 2P8TA 4L9JA 3KP5A 4CXFA 3KEQA 1MJBA 2OD5A 4L0YB 2AS5F 5D5WB 3KETA 2F5DA 2QQBA 2ZBKA 3NRVA 2OQGA 1XD7A 2XASA 2H27A 1G4DA 2AXLA 4EM2A 2P6SA 4ENMA 4O6JA 1R5HA 4RAZA 2VBXA 4P9FA 3C18A 2BGCA 1OKRA 1T6SA 3C3WA 3FM3A 3OOPA 4GYIA 2E7WA 3I59A 3ZN0A 3KLOA 4RB2C 1PP8F 2PI0A 1QGPA 3M1EA 2FOKA 4A0XA 5A2QZ 1GVJA 1XSXA 3LA2A 4A5MA 3WTTC 2IW5A 3KP7A 3DFGA 2DQLA 2IPQX 3MWMA 5LLQA 3KP6A 4RGXA 3REOA 1T2KA 2Y0MA 5DCFA 4N0BA 3G3ZA 1MJAA 3NQOA 5LGNA 4KMUX 1Z05A 1L3LA 2HZTA 4KIFA 1WI9A 2K02A 3IRQA 3HRUA 3HUGA 3QPTA 2ETHA 3QRFF 3DF8A 2RC4A 4O3MA 3CUQC 1ZRDA 1P4WA 2YX7A 5D5VB 4U0VA 2GQQA 1IN7A 5LEKA 3ML6A 2EV6A 3FHZA 2HR3A 2M1BA 1B59A 4EV0A 1UCRA 1D8JA 1U2WA 4XLNF 2HS5A 1P4XA 2HFHA 2G7UA 3IRRA 1KQ9A 3P9CA 4EM0B 1KGSA 3VEPA 4L0ZB 4GYGA 2PMUA 1H0MA 4A0ZA 5KVRA 1DDNA 1UHMA 5BQTA 4KN7X 2IJLA 2HYFA 4HV5A 4MHGA 3H92A 1SAXA 1WSUA 1YS7A 1DUXC 5J8FA 2L02A 1S6LA 2TDXA 2M45A 3WGIA 2F2EA 3DPLC 1E2XA 3LQQA 3JTGA 4L18B 1LNWA 3E6CC 2VC1A 3K1NA 1IAWA 4LK1F 3BJ6A 2XKOA 4G94A 1W7PB 2E1NA 3CO7C 4KIBA 4U0YA 3GLXA 5CVJA 2GA1A 2H6BA 4LLNA 3H3UA 1IW7F 1BIAA 2MH9A 4UXNA 4CYDA 1TNSA 1YO5C 3LQRA 4QLCU 1R58A 1DP7P 3LAPA 5DCMB 1EH7A 1SD5A 4AWXB 3ROUA 3HHGA 2V1XA 2FBKA 2XAQA 3F8MA 3ZQ7A 1J75A 3M9AA 1BOAA 5ED4A 2RV8A 2DBBA 1YFHA 3HIFA 1QZZA 2D2WA 4OIRF 1ZH5A 4Q5SF 1NHAA 3TOAA 4ESFA 3WTYC 1G3SA 1GXQA 2P6TA 2BYVE 3HTUA 2QLZA 4PGGA 2QWWA 4L5IA 3JAMZ 4IRIA 2XAFA 2A69F 2QYOA 5CVUA 1FPQA 4WXDA 3F8CA 2CYYA 1SD6A 4WF2A 4RGRA 1TTYA 3J81Z 2V1DA 1YS6A 1I6XA 1J9IA 4LB5A 1T39A 1ZAOA 3TO7A 4WX9A 1J7KA 5AONA 5BMZA 2RDPA 5BS6A 2NAZA 1R1UA 2NNYA 4NQWA 4OINF 4TV7A 5EEHA 3GFIA 5L3GA 1K78B 3RKWA 1XN7A 4RGSA 5LGTA 4Z2YA 1W7PD 2BE5F 3RYRA 4UVBA 3DKWA 5HDKA 3FZVA 2VC0A 2FSWA 2F5EA 1JXSA 2VBWA 2VE9A 4I2OA 3ULQB 4JQFA 2MA3A 3QU3A 5JI6A 3IL2A 2OAZA 3QOPA 3NEUA 4R8HA 1PP7U 1FT9A 2DQRA 3DXJF 3L00A 2BEOA 1QNTA 4HZFA 4OIQF 4ON0A 5KK1A 1BI1A 1RI7A 1CF7B 3T5XA 1B4AA 1ZGJA 3E6BA 5ICCA 3B02A 3RJPA 4Y13A 3CUQB 4LMYA 2L01A 1FBQA 3D0SA 4WK8F 2J5PA 5D4RA 2ZFWA 3KZZA 4LG0A 2RN7A 2DO7A 4IRHA 1I1GA 1J2XA 4EQQA 4BAYA 1FSEA 3I5UA 3CUOA 4DQ2A 2UXXA 3KEOA 3N4MA 3LSTA 2EV5A 3I54A 1USSA 4LB6B 4M6XA 4FX0A 4S05A 3M8FA 4ZYDA 2K4BA 5D5XB 1HSJA 1FOKA 4A5NA 2ESNA 5EEGA 2EJRA 5TJJA 1YG2A 3KLNA 4OMZA 4XSZF 2HEOA 3GFJA 4EJVA 4EJTA 5FD6A 2YSRA 4IVNA 3P7NA 4L9VA 2XVCA 2ZNYA 3EYYA 1K6OA 1HSTA 3EQLF 1XDSA 4M9XA 3ZP5A 5DUIA 1Z7UA 1KQ8A 3WODF 2KJCA 3IWFA 3LA3A 4HOBA 2ACJA 2Q2EA 3CLOA 3F8FA 3CJNA 2K4JA 3I59B 4BQAA 2VOPA 1F5TA 1G6NA 1K79A 3M8EA 3T1BA 3ZMUA 3WE2A 4A2UA 3HRTA 1C0WA 2HWVA 1KU7A 4OU0A 3BPXA 1SMTA 3GZ5A 3BOQA 4UNOA 3V8LA 1X3UA 4IXAA 1MKMA 2ELHA 1U8RA 4OIOF 5K5OA 3RKYA 1TBXA 1T0FA 1MGTA 5FB2A 4G9YA 2XV4S 1HKQA 3I64A 2P5LC 2A61A 1B1BA 2LNBA 3BP8A 2FF4A 4HX4A 2OZUA 5AIPA 5HOOA 3KP2A 2EFOA 2R7FA 2NNNA 1FYKA 4P55A 3F6VA 1R22A 5LEJA 4Q4ZF 3EETA 4BHBA 2Z5UA 2UXNA 2PG4A 5H20A 2GAUA 2P4WA 2W25A 3E6DA 2A07F 2XAHA 1FYLA 5L3DA 1MDMA 1SFXA 2EK5A 2P5VA 4GCVA 1P4AA 4N9HA 4KUMA 1W5TA 4HDVA 3GX4X 3MCZA 3HTSB 2BV6A 4FHTA 4U88A 2PMHA 3TDUC 2EA4A 1E17A 4UVCA 2XKPA 3VFZA 2LDUA 1TQIA 2Z33A 4YIIA 4I02A 2COMA 1U3EM 4FT8A 1FWZA 2D1HA 4NB5A 4HX7A 5ILUA 1K7AA 3P9IA 3DV8A 3HOSA 4HF0A 3GFLA 3R0JA 2P7CB 5BPIA 3MZHA 4QWQA 1QPMA 1ON2A 1U5TC 2FBHA 2ZMEB 5IT9Z 1LDKB 4IJAA 3R0AA 5ICGA 2MH2A 3TOBA 3K9TA 2LKPA 1REPC 1GHCA 5LHIA 1IXRC 2JPCA 3WTUC 3GXOA 1Z1DA 1BJAA 1IZ1A 5E1ZB 2QVOA 4G6DA 2GWRA 2Y75A 3MZYA 2HTJA 1FYMA 2MLGA 1SMYF 3AAFA 1T38A 2QM3A 1FY7A 1TW3A 1ZLJA 2QQAA 1B6AA 3BJAA 5HLGA 5A2QK 2IT0A 2KJBA 2PN6A 1VTNC 4RB3C 1U78A 3K0LA 4IPAA 2JT1A 1O3SA 4CZZA 2UWMA 1ON1A 1KU9A 4KDPA 5D5UB 4CICA 1H9TA 2VT2A 2EB7A 2EV0A 4YIFA 1ZG5A 5JHUA 2YX4A 3SXYA 3KP4A 3S2WA 3ZN1A 2STTA 1ZG3A 2VE8A 4ESJA 1KQ0A 2O3FA 4EGYA 3MEXA 4KMFA 2O8XA 2DT5A 1RIOH 2QBYB 2CFXA 1ZREA 5J6XA 1OPCA 4YFXF 2PEXA 2JZYA 3GYHX 3U9GA 2KIMA 1MZBA 1SFUA 2O03A 1PDNC 1XGOA 1I27A 2ESHA 4U7BA 4M6YA 5HS7A 4GGGA 3ISPA 3GW2A 2DI3A 4M74A 2Q8KA 1J5YA 2MC3A 4I98B 1HW5A 3MFKA 5DD8A 2J5OA 3I58A 3LFKA 4KNYA 3O3KA 1MJ9A 2XAJA 1FP1D 1JE8A 3L09A 1XGMA 3W6KB 3ECHA 1IN5A 4WWCA 4CGZA 1TW2A 2L54A 4HV6A 5BOXA 1UB9A 3R60A 5H6RA 2RKHA 1ZHFA 4G7HF 3SHFA 4I7HA 1UHWA 2BBYA 4LK0F 4BXUA 1KYZA 3C1DA 2E7XA 2EFWA 2F5FA 4PGHA 3VB2A 2HGCA 1TNTA 3L9FA 3WG9A 5JR3A 2XUBA 3QAHA 2IRFG 3ZMZA 3BY6A 2HOEA 3RI4A 1CGPA 3E5XA 5E8GA 5HLIA 1HQCA 4FX4A 3O6BB 2V9VA 2ZO4A 4HQEA 5L3EA 4B09A 2H6CA 3E6MA 2HTSA 1P2FA 1G3YA 1BM9A 2ZJ2A 3RPQA 1HW1A 3M7GA 3BDDA
chains in the Genus database with same CATH superfamily
1I3QJ 3J80Z 5BPDA 2MLKA 2OU2A 4I0BA 4BGDA 2DK5A 3I3LA 4A93J 2JVHA 3JAMK 1Y8RB 2LVSA 4ZH4F 3WU0A 1FZPB 3BR5A 3ZQLA 2YUSA 4L9TA 2CG4A 4F93B 4A3EJ 1MMSA 3DP7A 3H5AA 3ERED 2LSOA 2RAEA 1U5TB 1F1ZA 3VPRA 1R71A 2ZB9A 3QYEA 4XRFA 4B47A 1WKMA 1S29A 1W0TA 1ETWA 1ETOA 4IF4A 4CYCA 1EV7A 2VPLA 2XGXA 1SD7A 3WTZA 2OUMA 1SFEA 4MGRA 3J81K 4FE4A 4NC8A 1UAAA 1W4MA 3L2RA 5F6FA 4ZDLA 2NYXA 2KRCA 5K5QA 4J19A 2M87A 3WTXC 5HVQC 2IBDA 4A6EA 3H9JA 1DGWY 4EGZA 1R7JA 2GIVA 1BI2A 5D4SA 4M72A 3S16J 1X4OA 2Y0SA 1X3WB 4ENNA 2V26A 4LG3A 1KONA 5ERIA 1O3RA 1QHGA 1I5ZA 3QODA 3LMMA 3RKQA 2HDCA 2DDBA 2HI3A 1GV2A 2ME6A 3BTIA 3OIOA 4O5VA 3FKIJ 2CJJA 2CQ7A 3VWBA 2M5WA 4RS8A 4ASNA 1K83J 4HG2A 1W7PA 4XONA 1BR2A 5LRSA 1H88C 1V5FA 2RGVA 2K86A 2DK8A 2KRFA 3LSPA 4M73A 2GXGA 4YG2F 5IP9J 1FBUA 5L3BA 1W5SA 2PMZN 2ELKA 4E7JA 1MIJA 3ZMSA 4A3DJ 3BZ6A 3L2WA 1NG7A 1S7OA 3PO2J 3QWLA 5J4YA 3W2WA 1BC7C 2EZKA 5J1RA 5CLSA 4YIRX 4ANJA 5IP7J 1OCTC 3F8BA 2ADUA 3HOUJ 1RZ4A 4FETA 5DCMA 2YR2A 1A6IA 4PSWA 2JA6J 2WAQA 3DEEA 2FE3A 4RMNA 3KEYA 4S0HB 3U1DA 3OIPA 4B1RA 2IA2A 1O3QA 5EF6A 3RQ4A 4OOIA 3D1NI 4LLGF 3WG7H 3IH4A 1BJZA 5LHHA 4YEJA 1VQ6I 1FTTA 3HDDA 1SVMA 2XC7A 2RREA 2CW8A 4NUBA 4MO7A 2VQLA 3WTWC 1OCCH 2EFNA 3PQKA 3SQNA 3OYBA 2CUEA 1MDMB 2XPWA 2Z99A 2JPBA 3C7JA 4F52A 2DA6A 1IDZA 4Q47A 1XMKA 2HQAA 4N9IA 1A36A 2Y2ZA 3K10A 3LSHA 1FLIA 5B3SH 2A6TA 2R7XA 1YJ9I 2F5CA 2KIUA 1J59A 5FGMA 5ICEA 3CMYA 4DBQA 3GTMJ 4YFNF 3FKJA 3JTHA 2R5YB 3FXJA 4AIDA 1MBEA 4QIWN 2X6WA 2Y48A 1WQ2A 1VQ7I 2KIQA 4BHCA 2E5ZA 3AKZA 4A6DA 2QENA 2PJRA 3KYDB 2B0LA 5EYRA 2EZLA 1ZLKA 3LAJA 2JTVA 3E3VA 5CVRA 3CQZJ 1JKRC 2DTZA 3DQVC 2XPUA 4KJZA 1D8KA 1ETVA 2X1DA 4NC7A 4EMSA 4C2UA 1MD0A 4IO9F 4RGUA 4D1QA 1X1CA 3HBLA 2B9SA 3CDLA 2JN6A 4ZYEA 2VI6A 4RB0A 1NK3P 3V8KA 3GCMA 1N78A 2A5YB 3JW4A 4C3IJ 2R92J 3EPZA 3VYSB 4GO1A 3H3VK 3CCEI 1V4RA 5DV5A 2DA5A 5L3CA 4AIKA 3AL0B 3LL7A 1XB4A 1QZEA 5K1YA 3DKXA 2WAEA 4DYCA 1ACIA 2WB1N 2Y31A 4HQMA 4ZZLA 2XGEA 2WA0A 1IXCA 1SEUA 2A6HF 3OSGA 2PQ8A 4XN3A 2R7TA 2L4AA 4B3XA 1KU3A 2ZCWA 5M5YJ 2Z3YA 3JRCA 3CC4I 2M8GX 4KIGA 3V7RA 4A3IJ 1K78A 1XGNA 1K61A 4PCQA 1RUNA 4FTHA 3GUDA 5F0HA 4JX4A 4BDZA 5TGTA 2LR8A 4LFUA 2FEZA 3IKVA 1KZHA 3GZNB 2P7VB 2F6CA 3IAM2 3EYIA 2DMTA 3OIQA 2EZIA 4JK1X 3CO6C 2KZVA 2XAGA 5FLXZ 2HDDA 3EUHA 4OAYA 1LFPA 2ZKZA 5E1XA 4G6QA 2K40A 2FMLA 4E7SA 3H0DA 2X6XA 2LLKA 3CC2I 3HPGA 3ZMVA 3W6VA 1UZCA 3CZ6A 3MZ8A 4IQJA 1IUYA 3CJQB 5GAGJ 1SAUA 1TQPA 4I76A 1OMIA 1IRGA 3BTLA 2FNAA 2QF7A 5B66C 3PFYA 3CCSI 2M3AA 1MW7A 3GVAA 3K2AA 3FMQA 2GBYA 1ODDA 2FA5A 4BXFA 2WC2A 4M3FA 2L4MA 3PNYA 2LY1A 2FRHA 2IA0A 3E7LA 3HUGB 2HVSA 1BW5A 3LA7A 1QHHD 4Y17A 1CF7A 3GTLJ 4UB8C 1VQ4I 4MQVA 4ETSA 3C2BA 2DXIA 3WGGA 2A3SA 1I6HJ 2L7MP 3BWGA 3IUOA 4DNCA 1L0OC 1FC3A 4I0AA 3GZ6A 3CDIA 1LVAA 3CUQA 2HQRA 2GOMA 3FWEA 1VQNI 1B72A 3F8NA 3BR1A 4OIPF 4KA4A 4G8XA 2VOOA 1T98A 5E17F 1LEBA 1IN8A 3Q9SA 2BHYA 4MQ9F 3SZTA 3DPTA 3OYLA 5HS9A 3VSLA 3MKWB 3FX3A 1J0RA 5GAHJ 1OQYA 2XHKA 2HKXA 2JMWA 3G73A 2PLYA 4XKVA 2EIKH 1WPKA 2EBIA 5EG0B 3QU6A 4PUSA 4D7MA 3SZGA 3GWZA 1ZR4A 3F9KA 3F3XA 5M3FJ 4UY8I 2QUFA 1WH7A 3D5SC 3V4GA 3TBIA 3CCMI 1JKPC 4RDUA 3B6CA 4XBFA 5C44J 3IKTA 4HBLA 4CDGA 3Q3SA 1O7LA 3V7SA 2DFHA 3W3CA 3Q5FA 3FBIB 1HKTA 2KL4A 2VBYA 2FX0A 1AOYA 2FUG2 2RNJA 2BHZA 3K4NA 2M7BA 3HRSA 5IP6A 3VODA 3ABTA 2ZXJA 3T8RA 2ISYA 2GZWA 3DLAA 5E1WA 4BE0A 4ZDOA 3QP5A 1X19A 2K9MA 1MH3A 4BY1J 1JI8A 5FRMA 3BR3A 1KA8A 3DBHB 3WHBA 3W6JB 2E1CA 2R7UA 1GT0C 4XLCA 2X1CA 1LFBA 1NG6A 2X0LA 2JUGA 3AFHA 3BZKA 2D45A 2NOJB 5ILSA 3S3MA 3L2VA 4IHSA 2KIFA 4M9SA 3JSOA 3OS2A 1DU0A 1Q1HA 1HKSA 1O57A 2DW4A 3LNQA 2K27A 1R23A 5HNHA 1WJEA 1ERDA 3OWTA 1LQ1A 1VFCA 4CH7A 2D1VA 1BR1A 1XDUA 5KAFC 4G12A 4XL9A 3H1CA 1Z9CA 3N97A 1QPIA 5IY5H 1WRJA 3S93A 3M8JA 1WZ2A 3B6AA 1ZARA 2I10A 2LMDA 2ECBA 3H36A 4EJWA 3ZRGA 4WXHA 1WJ5A 1S8NA 5D6FA 1TLHB 2OA4A 2XB0X 2KHMA 2I5UA 4EVIA 1RR7A 2DA3A 3H3ZA 1BI0A 3SFZA 5L3FA 4Y52J 2LREA 2FBIA 4M3EA 4A3BJ 2FQ4A 3KCCA 2FNPA 2CV2A 1HW2A 2V79A 2LBFB 4EJUA 1JGGA 2VXDA 3HZJA 1V5EA 3HOZJ 3ZMTA 2P81A 3BTJA 3EUHC 3AG4H 1VQMI 3PJRA 5JVTA 1QQIA 2WY8Q 5D6EA 4CUGA 1A04A 3KFWX 2VPRA 4AIHA 4IZZA 3WTVC 2KKOA 4MTEA 4E7IA 1XCVA 3ABMH 2EWNA 5IT9K 1POGA 2FQ3A 3WGHA 1T56A 2FU4A 3SEQA 3TKYA 3TGNA 4ZJZA 1T0FC 5JVGF 2QEXI 2DA7A 1HBXG 4QTRA 1B9MA 2KDOA 4NHJA 5CVVA 2FMYA 2D5VA 4RAYA 1G59A 3CMMA 2KISA 3QP6A 2O61A 3SFIA 3G6EI 1LJ9A 4KN4X 1Z91A 3IV5A 1S9HA 1V54H 3LSIA 2LK2A 3HRMA 3IWZA 1JUSA 2KT0A 2X4HA 3K69A 5K5RA 4DJAA 2VASA 4D7NA 1WWXA 2R3SA 2CWEA 2XF6A 1G2HA 2G7HA 1O3TA 5JFRA 4AIJA 3J7AO 1TT5B 1D5YA 1Z6TA 3OV8A 4XM3A 2R5ZB 1BN5A 4A69C 5FD5A 3JSPA 2IP2A 2QQ9A 4B3AA 2W24A 3O2PE 1TP4A 3G1MA 3RQIA 4HF2A 1GLNA 2VODA 4E7ZA 4P5OA 4IHTA 1WJDA 2IA1A 5IPAA 3OOUA 1WH5A 4I01A 1RUOA 2AQFA 3FDYA 3G71I 4BS9A 1MSEC 1F43A 3S17J 4NQWB 3AG3H 5F08A 2EZHA 4ENJA 2MD5A 1KU2A 1TWFJ 2DOFA 1EH8A 1TQMA 4G7ZF 1OFCX 2JSPA 2QZ8A 4F7ZA 1V3FA 3I4PA 2YPRA 3I71A 3I0TA 3CF2A 2LF8A 2DPUA 4M9ZA 2L0KA 4BL0B 4I99C 4XLPF 2W00A 4A3KJ 4BHPA 2DU9A 1Y0UA 4J01A 1F9NA 2OF7A 5K7FA 1MNEA 3WTSC 3QYFA 2XRLA 4UVAA 2W7NA 4LOCA 3MAJA 2QCOA 2Q1ZB 5FKOA 3KZYA 3ABLH 3F6OA 4L5JA 1PUEE 1X2MA 3IC7A 4RA2A 1U6GA 4ZZDA 2BOLA 1K4TA 4C30A 3R4KA 4FCYA 2RVCA 4ESBA 2VQCA 3TQNA 4FISA 4I09A 5J3LA 1DPUA 2C6YA 2DOEA 4HDUA 3GMEA 3B73A 3H5NA 4E7KA 5CQEA 4U87A 2CUFA 3TO9A 3ZPLA 2YU9J 4XOPA 1MNDA 2Z9OA 2YS9A 4XOTA 1Y0NA 3JRAA 3G4SI 5DD4A 3H9QA 3S2DJ 5HLHA 5CPRB 1YLFA 3OL4A 3PFIA 2E19A 5DYMA 5JLWA 3F22A 2BY1A 2HOSA 1FP2A 2MFZA 2ZMEA 1WFXA 2KMUA 2DJNA 5BNGA 3FXLA 2ISZA 3M1CA 1IV6A 3PNVA 2L5QA 1U8BA 3CTAA 1RNLA 3JRIA 1IC8A 5EGOA 1A31A 2B63J 4E7HA 2DPDA 1R1VA 2M9HA 2VXZA 2CGPA 2DAOA 2QQ8A 1YW9A 2JVGA 5HODA 5FFXA 5GTHC 1G8XA 3CDHA 4LG0B 1XMXA 2WWYA 3GTKJ 2H09A 3F21A 4CO8A 1HA8A 3GBGA 2R7RA 2MW8A 3DEWA 2XRNA 4PJ0C 3HJEA 2OQRA 3K70D 1FIPA 2LTPA 5F04A 4HPQA 5F64A 1EH6A 2E5NA 1YW8A 2GA2A 5EEAA 3HYIA 4KICA 1BBYA 3J7ZI 2LF7A 5E3NA 5IT3A 2NS0A 3WE3A 4WCGA 2L3DA 2NRAC 2LFBA 3BT9A 1RKTA 3HKZA 1JT6A 3F72A 1PVEA 3K1MA 4D0PA 2QA4I 9ANTA 2BW3A 1D5VA 1USTA 1WJAA 3G2BA 4LGWA 2K3FA 2XROA 3JRHA 1AWCA 2ICWG 2CQKA 5AIQA 1E0EA 2ID3A 3RTRA 4P96A 1LVKA 2O6GE 4ENKA 4BBSJ 4F92B 1ENHA 1R1TA 1PJRA 1IRXA 4E70A 3ERMA 3FM5A 2JRTA 1U9OA 4HF1A 2M30A 3D5LA 2HPIA 4I6ZA 1YTYA 3TO6A 5F1RA 5CVIA 1BOBA 3X2QH 3GTQJ 1NK2P 2WV1A 1H9GA 2DODA 3MQ0A 4HRIA 3H9GA 1STZA 3L2CA 2QKMB 4AU7A 3IHUA 3ZOBA 2V6CA 3HSFA 3WU1B 4A3LJ 1JHFA 3ZMDA 3COAC 1R5ID 2EH3A 1LE8A 5D8KB 2A68F 1SFKA 1VQOI 3MVPA 1JKOC 5EDNA 1XSVA 3O8HA 4Y7NJ 1W0UA 3KE2A 3S1QJ 1OYYA 3DPUA 2CV1A 2CW7A 4KFCA 1LDJA 2E36A 1YE9A 1R5GA 2DFIA 3HSEA 1Y56A 1MBHA 2Q2EB 1Z0XA 3RCOA 5K7ZA 2QBYA 1UFMA 3S1NJ 4DOZA 3EDPA 4HEA2 2VT3A 3HOXJ 1U9NA 5LGUA 1D3YA 3ZGKA 1JHHA 4A0YA 4BH9A 6PAXA 1IRFA 2NVYJ 1XGSA 5HDGA 4ZYHA 4UV9A 2IVMA 3OR1C 3HOWJ 2DTRA 3K1PA 5ILVA 2ZSHB 3E97A 1TC3C 4V2FA 5K7HA 3RPUA 2OZ6A 2DN0A 2P0WA 4EJOA 3J80K 3WHCA 5FO5A 1ONVA 1GXPA 1MMDA 1Z6RA 3GEZA 2STWA 2K7LA 4CSWA 4UV8A 3KYLA 2OTLI 2XB5A 4MEXF 1ZTRA 5F0CA 4B44A 3FMRA 3HOVJ 4X6AJ 1B9NA 1FOYA 3E1SA 2H94A 4HYEA 1BI3A 3DTEA 4CHUA 4F3QA 1P92A 2OJED 3GO5A 4KT6A 2ME0A 4XRSG 1R9TJ 5FJ8J 1ETYA 3SZPA 2UZKA 4U7DA 3HGGA 4DBRA 5FKMA 2BVLA 1R36A 4BUPA 3RYPA 3LSRA 2DCEA 4EEFG 1QBJA 1ZG1A 1QO0D 4W1UA 4LITA 3K2ZA 3I4MJ 2MBFA 2L9NA 4R1HA 2JA7J 1HCRA 4EATA 3U2RA 4XQFA 2PBIA 1CQTA 1V5GA 5GAEJ 2DLLA 4MFEA 1Y8QB 3N05A 2O0YA 2W57A 1ZGAA 2X1EA 4BQOA 5H2FC 4UUTA 2HYGD 1IF1A 3R6SA 4JBAA 4IHWA 2OTJI 2ZMEC 4MIMA 2VBZA 4XSXF 3JRDA 1I1SA 3VOEA 2M8EA 2V1NA 2QSGX 5C4XJ 1QZYA 2Q0OA 2YU3A 2CFOA 5FKNA 3PUBA 4P9UA 4UUVA 3S14J 2FXAA 4Q48A 4BNCA 2JSCA 3M3YJ 5CJ9A 1RR8C 1XCBA 3MKYB 2CO5A 4A3CJ 4BBRJ 2CQNA 3KP3A 2VN2A 4U0WA 3HOTA 3VDXA 2OPTA 3BPVA 3ELKA 4HX8A 4YFKF 4X0GA 1BR4A 5ICFA 4PZJA 4KYWA 1BIBA 5DUKA 3GF2A 3SEZA 4DIQA 3TW7A 1A5JA 3E5QA 4LJZF 1WCMJ 3WU2C 1YIOA 2OV7A 1WI3A 4XK4A 1XMAA 3GFMA 2PFBA 5DEQA 3BJOA 2JA8J 4AUXA 2G0EA 1N77A 1YQAA 1A35A 2OCEA 3CMAI 2EA2A 3I4NJ 4BXXJ 4B8XA 1YYVA 1RC9A 1ZRCA 1LUJB 3F0CA 1G3WA 4PSXA 2W48A 3MKLA 2BY3A 4HLXA 1LB2A 1QVTA 1Q1VA 1P6RA 3FXUA 1IN4A 4R79A 4II3A 1JKQC 5E18F 1WGXA 5LHGA 1SD4A 3DEUA 3RDIA 3ZR8X 3R61A 4AYBN 2HQNA 3DKYA 4BKXA 4AD9A 2IS1A 4L9NA 4M3BA 1TWAJ 2ELJA 2LRDA 3IAS2 1FMWA 4RB1A 3SDGA 2RQQA 1OYWA 1UG2A 4IOAF 1OLTA 1EA3A 3E0JB 4HAMA 5IYBJ 4LLLA 4M71A 2K85A 1DGRM 4GFBA 2XIGA 5CYVA 1W5CC 3K4CA 4ZYGA 5GTIC 3BG3A 5DM6F 2A6EF 3G1OA 1KYWA 3V7CA 2XPVA 4ABZA 3OMYA 2DA2A 2OBPA 5J8CA 5DDGA 2WV0A 1FMVA 3I56I 1XPXA 4S04A 4PFPA 2E2JJ 2ZSIB 2ZC2A 2E34A 3QPHA 1ZN2A 5GP9A 1OYIA 1R00A 4Y15A 3L2QA 1O7FA 3DTKA 2IS6A 2G9WA 5DTDA 4AM3A 3I53A 3Q0UA 1U5TA 2HOAA 1BC8C 1FBSA 1HDPA 3ZQCA 5H6QA 5J47A 1XG1A 4HA8A 1D0XA 3FXQA 4AVPA 1FIAA 1OCRH 2NS8A 4BEHB 3PQJA 2W84A 4HW0A 3TDZC 4H0EA 4A12A 2R7DA 1HXDA 4LIUA 4C9YA 4HNUA 4JP0A 4YELA 1FNNA 5LBQA 5HS8A 3HHHA 1W36C 2O8KA 2HKOA 2GXBA 1ZRFA 1QU3A 2Y0SN 1YW7A 1X1PA 3ECOA 5HDNA 1ULYA 2Y30A 3BC8A 3K4MA 1YITI 3ABUA 3I55I 4G7OF 3JR9A 3ABKH 3FXRA 1IXSB 3CP2A 1DPRA 4V2GA 4OMYA 2CSOA 5LD2C 1FSHA 1LDDA 4KT5C 3T0YA 4FQGA 3RIRA 1N75A 5E3MA 3G1LA 5JHFA 2R4GA 4HLYA 3HSRA 2JK3A 5C3EJ 3PIPF 1R4NB 1E3OC 2E60A 2CW0F 1IN6A 4K2EA 3DBRB 3A0HC 2H1KA 3FF5A 4D5FA 3BCBA 2V1UA 2P5KA 3BZCA 2DFEA 2O5RA 3BROA 4XRMA 3QYBA 2PJPA 5FLXK 3E5UA 4MNUA 3DU5A 3LWFA 2K9LA 2IS2A 1JTXA 4IRGA 3BG9A 4PDKA 3T8TA 1S7AA 1S72I 5FFZA 3Q9VA 1OR7A 1Y6IA 2W85A 2WAQN 3V8JA 1Z21A 2RQPA 3FXKA 1S3JA 4EM1A 3RKXA 2IGNA 2VONA 3VYRB 2IS4A 1EKEA 3Q0WA 3FMSA 3OYEA 1F4KA 4BQNA 1F36A 4MEYF 1FOXA 4L5EA 1FX7A 3M07A 5JLXA 3P9KA 5M5XJ 4LD5A 5TRDA 3SJMA 4KISA 3A01B 3P5JA 1JGSA 1JUPA 2ZNZA 3F23A 1XSDA 2NVTJ 5E20A 4LIVA 4QPOA 4WXCA 2CU7A 4UHTA 4DZPA 2KDZA 1P9QC 3L7WA 1LEAA 2WTEA 1J09A 4NC6A 2HVQA 2HXOA 2EFPA 2VJIA 2EFQA 2LH9A 5E8IA 4IX7A 3AG2H 3PM1A 4GXOA 4MTDA 2R0QC 1Z7LA 1G3TA 5D8LB 1H89C 2A05A 3V42A 5LRRA 2ECCA 1ZYRF 3HG9A 4BYYA 2R5YA 3ASNH 2P8TA 4L9JA 3KP5A 4XN0A 1ZKGA 4HSRA 2KZGA 4XR6A 3C2GA 4CXFA 1Z3XA 3LFUA 4XLEA 3A2KA 2DA4A 3KEQA 1MJBA 2OD5A 4L0YB 2LD5A 2AS5F 1Z3YA 5IOZA 2XSJC 5D5WB 3KETA 1HOMA 2F5DA 2UUZA 1BA5A 2MSYA 2QQBA 2ZBKA 1ZQ3P 3NRVA 2OQGA 4RBOA 1I39A 1XD7A 2MYSA 2XASA 2BXYA 2H27A 1G4DA 2AXLA 2VJ5A 1DP3A 2JA2A 4EM2A 1B8IB 2P6SA 4ENMA 2IAIA 4O6JA 1AU7A 1R5HA 4UUSB 1JJ6C 2ZXIA 3K4BA 4RAZA 2L2OA 2VBXA 4P9FA 3C18A 2BGCA 2VQGA 1OKRA 1T6SA 2O7OA 4IL6C 3C3WA 4E7LA 3FM3A 2XF7A 3OOPA 2E71A 4GYIA 2E7WA 3CJTB 3I59A 3CCQI 3ZN0A 2EIJH 3KLOA 4RB2C 1PP8F 2M7AA 1X4PA 2PI0A 3HPHA 1QGPA 2IEKA 2V7FA 2FOKA 3M1EA 2H1LA 4A0XA 5A2QZ 1T33A 1GVJA 4BY7J 1YRNB 2KP6A 2WAFA 3PO3J 1XSXA 3LA2A 4A5MA 3WTTC 1FEXA 2WY7Q 1TZLA 2CH0A 1WJFA 4E6KG 2IW5A 3KP7A 3DFGA 2DQLA 2IPQX 2ZJRF 2CQQA 3MWMA 5LLQA 3KP6A 3HC7A 2DJIA 4RGXA 3HXLA 3REOA 4QSHA 3LSKA 1T2KA 2Y0MA 1JJ8C 4BJ6C 5DCFA 4N0BA 3G3ZA 4UB6C 1MJAA 3NQOA 2CUJA 5LGNA 4KMUX 1Z05A 1E3HA 1L3LA 2HZTA 4KIFA 1WI9A 2K02A 3IRQA 1AKHB 2DYSH 4PJMA 3HRUA 3HUGA 3GTJJ 3QPTA 2ETHA 1GV5A 3QRFF 3DF8A 2RC4A 4O3MA 3CUQC 4AVZA 4IKFA 2X6OA 4XKWA 1ZRDA 1P4WA 2YX7A 5D5VB 1VQ9I 4J00A 4U0VA 1OJLA 5E3LA 1OR7C 2VL8A 2GQQA 1IN7A 2FOWA 5LEKA 4ZTJA 3CLQA 5IYDJ 3ML6A 1P7IA 2EV6A 3FHZA 1UMQA 2HR3A 2M1BA 2AQEA 3L2UA 1B59A 4EV0A 1UCRA 1D8JA 1U2WA 4XLNF 2NS7A 3FBNB 3FIWA 3EUAA 3CC7I 3J7YJ 2HS5A 2EPFA 1P4XA 1K6YA 2HFHA 2G7UA 4CCKA 2R7ZJ 1MMAA 1JTYA 2AHQA 3UKGA 3IRRA 5KAIC 1KQ9A 3CP8A 4C2MJ 3LSMA 3P9CA 4C3JJ 4EM0B 3SDBA 1KGSA 3S3NA 3CF5F 5EJCA 1YX3A 2NXNB 3VEPA 4CYCB 4D5CA 4IHVA 3JREA 4L0ZB 2V4JC 2BVMA 4GYGA 2PMUA 2XGCA 2F48A 1H0MA 4A0ZA 5KVRA 1DDNA 1D0YA 1UHMA 5BQTA 4OAZA 4KN7X 2IJLA 1HLVA 2HYFA 4HV5A 4MHGA 3H92A 3RZDJ 3DWLE 1X1BA 1SAXA 3QPLA 1A6QA 1WSUA 1YS7A 1DUXC 5J8FA 2L02A 3U1KA 1S6LA 3A4CA 2LP0A 2WADA 2TDXA 2M45A 3WGIA 1ETQA 2F2EA 3DPLC 1RKWA 1E2XA 1LKXA 1ZK8A 3LQQA 3JTGA 4L18B 4X1EA 1LNWA 3E6CC 2VC1A 4HNTA 4RLQA 3K1NA 1IAWA 4LK1F 3BJ6A 2XKOA 4G94A 4Y3OA 3TP0A 2ZXWH 3TL4X 1W7PB 2E1NA 3CO7C 2FJ1A 4KIBA 4U0YA 3QPSA 3GLXA 3NWTA 5CVJA 2X9DA 2GA1A 1SC7A 2H6BA 3BG7A 5B5EC 4LLNA 3H3UA 4BU2A 5B1AH 1IW7F 2HNHA 5FRNA 2L9VA 1BIAA 2PMZA 2K9QA 2MH9A 4UXNA 2MG4A 4PJJA 4CYDA 1TNSA 3UNGC 1YO5C 3LQRA 4QLCU 1R58A 1DP7P 3LAPA 5DCMB 3W2VA 1EH7A 2E2IJ 1SD5A 3LOCA 2ID6A 4AWXB 3ROUA 3HHGA 5FKKA 2V1XA 2FBKA 2XAQA 3F8MA 3ZQ7A 2K3PA 3FK6A 4RLFA 1OCOH 3VYUB 3BR6A 3DCFA 3M9AA 1J75A 2BZTA 3NAUA 5DS9A 2F4OB 1BOAA 2M2EA 4CA0A 2JUCA 5ED4A 2A5WA 2RV8A 2DBBA 2KQRA 4F91B 3OYMA 1YFHA 3HIFA 4PFOA 1QZZA 2D2WA 3ONQA 4OIRF 2NVUB 1ZH5A 2LY9A 1NHAA 3W2AA 4Q5SF 3TOAA 4ESFA 3WTYC 1ZGWA 1G3SA 1GXQA 2P6TA 1PUFA 2BYVE 3K4LA 4E4HA 3HTUA 2QLZA 5FROA 3J7AY 3BQYA 1YHQI 4PGGA 3S15J 4PK4A 2QWWA 1JT0A 4L5IA 3JAMZ 3BR0A 4IRIA 1MBKA 3CMEI 4AC0A 2PJRB 3C2HA 2XAFA 4XKBA 2A69F 4XLHA 5EZGA 2EIMH 2QYOA 5CVUA 1IG7A 2XAUA 1FPQA 2GIZA 3F8CA 4WXDA 2M4KA 3CCLI 2CYYA 1XC5A 1HC8A 1S7EA 2LYCA 1SD6A 4JX5A 3HM5A 4WF2A 4RGRA 1TTYA 2K9NA 4JOMA 3J81Z 2R5ZA 1FOWA 5F27A 4IEJA 2V1DA 1YS6A 1I6XA 1J9IA 4LB5A 2W82A 1T39A 1ZAOA 3JRBA 2KLOA 3TO7A 4WX9A 1J7KA 5AONA 5BMZA 2RDPA 3K6GA 4G6TB 5BS6A 1VNDA 2K9SA 2LG4A 4XKCA 4ZTFA 2NAZA 1R1UA 2BY0A 2NNYA 2DYRH 3CD6I 1R4MB 1HF0A 2E35A 2OC6A 2Z2SB 4NQWA 3OYKA 2WB1A 4OINF 4TV7A 5EEHA 2DT6A 3GFIA 2CRGA 5L3GA 1K78B 3K4JA 3RKWA 1XN7A 4RGSA 5LGTA 4Z2YA 2MD0A 1I3AA 1W7PD 2BE5F 2QKLB 5J1UA 3RYRA 2DDAA 5IOYA 4UVBA 3HB9A 4DYQA 3DKWA 5HDKA 1RRJA 3FZVA 2VC0A 4BE2A 2FSWA 2F5EA 1JXSA 2CS3A 2VBWA 2VE9A 4I2OA 4NBQA 3ULQB 1UHSA 4NNJA 3ZQGA 2AO9A 4JQFA 2DMNA 2MA3A 1V55H 3KIOA 3QU3A 2L7FP 5JI6A 3IL2A 2F4IA 1PYVA 1OISA 2OAZA 3QOPA 3NEUA 4R8HA 1PP7U 4BQQA 1FT9A 4C3HJ 5HLTA 2DQRA 2W4SA 3DXJF 3L00A 3OS1A 2BEOA 4A3GJ 4M3GA 1QNTA 4HZFA 4H4KC 4OIQF 2COBA 4ON0A 3OY9A 5KK1A 3MD2A 1BI1A 3NWSA 1RI7A 1UELB 2XGDA 1CF7B 3T5XA 4C2TA 1S5LC 1T08B 3FK7A 1B4AA 3PNTA 2Y9YA 1ZGJA 3E6BA 4N4OB 4XORA 1X1DA 4D9JA 5ICCA 3B02A 1YJWI 3RJPA 1TWHJ 4Y13A 2HOTA 3CUQB 3PUFA 1WHUA 1B72B 4LMYA 4IHYA 3CJRB 4HNVA 2L01A 2EINH 4XRSA 2VKVA 1FBQA 3D0SA 1FJLA 2AXTC 4WK8F 2DOAA 2J5PA 5D4RA 1DU6A 1TWCJ 2ZFWA 3KZZA 4LG0A 2ZJPF 2RN7A 4DW6A 5IYCJ 2DO7A 4IRHA 4BACA 1I1GA 1J2XA 4EQQA 1X58A 4BAYA 3BCAA 1BW6A 1X2NA 3S1RJ 4DYRA 1FSEA 3CCRI 3I5UA 3CUOA 1YJNI 4DQ2A 2UXXA 1TWGJ 5FKLA 2FD5A 1XTAA 2DFFA 2V9KA 3ZCOA 3HKZN 2HDWA 3KEOA 3N4MA 3LSTA 2EV5A 3I54A 2VQHA 1U0JA 1USSA 4LB6B 3ZQIA 4M6XA 1IGNA 5HNFA 4FX0A 4S05A 3M8FA 4ZYDA 5TISC 2CQXA 2K4BA 2XF5A 1GVDA 5D5XB 3IH3A 1RESA 1HSJA 1FOKA 3MKZA 4A5NA 2MGQA 2QSHX 5M5WJ 2BXZA 2ESNA 4ITVA 2M0MA 5EEGA 2EJRA 3K70C 2GXAA 3OL3A 5TJJA 2EQRA 1YG2A 2TCTA 3KLNA 4OMZA 4XSZF 4Z6YA 4BJTA 2HEOA 2JWTA 2N8GA 2R7SA 1W1WE 3QQAA 3GFJA 2LKSA 4QPQA 4EJVA 1EJ9A 4HSTA 1SFOJ 4CCJA 1MSFC 4EJTA 5FD6A 1VQLI 2YSRA 3OYDA 3BG6A 4IVNA 3P7NA 4L9VA 4ZC3A 2XVCA 3HGYA 2ZNYA 1AHDP 3BLYA 3EYYA 1K6OA 1IDYA 1SANA 1HSTA 3EQLF 4IOCF 1XDSA 3ESWB 3FISA 4M9XA 3ZP5A 3KX2A 5DUIA 1Z7UA 1KQ8A 3WODF 2KJCA 2WBMA 3IWFA 3LA3A 1D1BA 1Y39A 4HOBA 2ACJA 2Q2EA 1LPQA 3CLOA 3F8FA 4ZDPA 3OYCA 3CJNA 2K4JA 3I59B 3PIOF 4BQAA 1ETKA 3ZQQA 2IGOA 2H8RA 2VOPA 5CKTA 1F5TA 2ZFUA 1G6NA 2CV0A 1K79A 3M8EA 3CESA 3T1BA 3ZMUA 4F55A 1APLC 1MMGA 3WE2A 4A2UA 1M1EB 1NH3A 3HRTA 2M0CA 1XS9A 1C0WA 1ITYA 1SVLA 5GADJ 5E3OA 2E1MC 2HWVA 1KU7A 1D1AA 4OU0A 3BPXA 3JCUC 3LSGA 1SMTA 2B7EA 5CQGA 3D5RC 3GZ5A 3BOQA 4UNOA 3V8LA 1DQUA 1ETXA 1X3UA 3H35A 4IXAA 1MKMA 2ELHA 1GUUA 1U8RA 4OIOF 2IGKA 3S3OA 5K5OA 3RKYA 1TBXA 1BL0A 1T0FA 1MGTA 4NDLA 5J40A 5FB2A 4G9YA 4CZCA 1YIJI 2XV4S 1HKQA 2IXSA 3I64A 2VJJA 2KFDA 2P5LC 3OYJA 4JYKA 4GDFA 2A61A 1OCPA 1B1BA 2LNBA 3BP8A 2FF4A 4HX4A 2OZUA 5AIPA 5J4VA 5HOOA 3KP2A 4PJNA 4BDYA 2EFOA 2R7FA 1X3ZB 5F1JA 2VKHA 3CCYA 2NNNA 2O9LA 1Y1WJ 4M3DA 2K5CA 1FYKA 3A1YA 4A3MJ 4P55A 3F6VA 2LOOA 1R22A 5LEJA 1HDDC 4Q4ZF 1TL8A 1MBFA 3HOYJ 3RSNA 3EETA 4BHBA 2Z5UA 2X6YA 3ZQFA 3OYGA 2UXNA 2PG4A 1WJBA 3PSIA 5KCMA 5H20A 2GAUA 2P4WA 3SYTA 3S2HJ 2W25A 3E6DA 4IQ4A 2A07F 2XAHA 1FYLA 5L3DA 1MMNA 1MDMA 3BG5A 5DM7F 1X1AA 3QOEA 1SFXA 2GM4A 2EK5A 2V9PA 3CCJI 4JX6A 2P5VA 4GCVA 1D1CA 3S8PA 4PJLA 1P4AA 4N9HA 4KUMA 1W5TA 4XIDA 4HDVA 1IJWC 4CCMA 5E79C 3GX4X 3MCZA 1QA6A 3IH2A 3HTSB 2HU9A 2Z16A 2BV6A 3NARA 4CCNA 3TEDA 3VYTB 4FHTA 4U88A 2PMHA 3TDUC 3RZOJ 2JJ7A 2X51A 2EA4A 1T95A 1E17A 1IO2A 2JQ7A 3MN2A 1VQKI 1VQ8I 4UVCA 2XKPA 3VFZA 2LDUA 1TQIA 2F4MB 3OYFA 2Z33A 4YIIA 4I02A 1Y1VJ 2COMA 1O4XA 1YX5A 1U3EM 4FT8A 1FWZA 2W1OA 2Y69H 3FHNA 4B48A 3Q0VA 2D1HA 4NB5A 4HX7A 4W97A 5FLMJ 2VUMJ 5ILUA 2HQ5A 1K7AA 2DA1A 3P9IA 3GTOJ 3DV8A 3A03A 3HOSA 3CCUI 4HF0A 4KITB 1QVUA 4BJ5C 2H8WA 3UR3C 2DT7B 5EZHA 3GFLA 3R0JA 2P7CB 5BPIA 2R93J 3MZHA 4QWQA 2L7ZA 2VJ4A 1IRZA 1QPMA 5J1YA 2QSFX 4FE7A 1ON2A 1U5TC 2FBHA 1E3PA 2HXIA 3BTCA 4XICA 3PL8A 3O8GA 2R7VA 2ZMEB 5GPCA 4DGWB 5IT9Z 1LDKB 4IJAA 2GLOA 3R0AA 5ICGA 2IGMA 2MH2A 3K9TA 2L9RA 2LKPA 3TOBA 3OYHA 1REPC 2I8DA 1Z77A 4BEHA 5LHIA 5EGOB 1GHCA 1IXRC 1MBGA 2JPCA 4II2A 3WTUC 3GXOA 1Z1DA 1FTZA 1BJAA 1IZ1A 3FXOA 4BE1A 1ZELA 5E1ZB 4DZJA 2QVOA 3OS0A 4G6DA 3OYNA 2GWRA 3DBLB 1ZR2A 2Y75A 3H5RA 2UV1A 3MZYA 2HTJA 1FYMA 2MLGA 1SMYF 2JRMA 3ZXSA 3AAFA 1T38A 1K4SA 2JA5J 2PX9A 2X48A 2QM3A 4IHXA 4B4CA 4Y4RA 1VQPI 3S32A 1FY7A 4A3JJ 1TW3A 1ZLJA 3A02A 2BW3B 2QQAA 3H0GJ 2DMPA 1B6AA 2M34A 3DLLF 1PUFB 3L1PA 3BJAA 2LKXA 1RETA 3EUKL 5HLGA 5A2QK 3VSKA 2IT0A 2KJBA 1OCZH 4OWRB 3ZQHA 2PN6A 1GDTA 1VTNC 4RB3C 1U78A 3K0LA 4IPAA 2JT1A 2VB6A 3KPHA 4CCLA 1O3SA 1H8AC 4CZZA 2UWMA 1ON1A 3ASOH 3TW6A 1KU9A 4KDPA 5D5UB 4CICA 1H9TA 3K7AJ 2NVXJ 2L7KA 4M6VA 2VT2A 2EB7A 2CUZA 2EV0A 4YIFA 1ZG5A 5JHUA 2YX4A 1RPWA 3SXYA 3KP4A 3S2WA 2QGUA 3ZN1A 3JRGA 2ZXHA 2STTA 1ZG3A 1LE8B 2VE8A 5KHDA 2NVQJ 4ESJA 2MABA 5EG0A 4Y33A 1KQ0A 2DMQA 1UG0A 3DU6A 2O3FA 4EGYA 1VF9A 2M4GA 1MNMC 3MEXA 3TP3A 4KMFA 2O8XA 1NTCA 3A01A 3PSFA 1MBJA 1YOVB 3GTGJ 2DT5A 1RIOH 4RAFA 2QBYB 3LSJA 2CFXA 1IV8A 2CMPA 1ZREA 3OR2C 4RM3A 5J6XA 1OPCA 4YFXF 2PEXA 3M4OJ 2JZYA 2BY2A 2VIXA 3GYHX 3U9GA 1UJ8A 3OSFA 1T8IA 2KIMA 1R6RA 1MZBA 3JRFA 3AG1H 1SFUA 2O03A 5C4JJ 1PDNC 1XGOA 2EILH 1R49A 1I27A 2ESHA 4U7BA 4M6YA 1MH4A 5HS7A 2E1MB 4GGGA 3ISPA 1LFUP 3GW2A 1Z67A 4XLAA 4V19K 2DI3A 3BR2A 4M74A 5KNLA 2HPMA 2Q8KA 2XDVA 3KZIC 4XLFA 1J5YA 4CCOA 2MC3A 2OCCH 2KRHA 2L9SA 4I98B 1HW5A 3MMYB 4RM2A 3MFKA 1VQ5I 4P1WA 5DD8A 1B8IA 1WVRA 2J5OA 3I58A 3AL0C 3LFKA 4KNYA 1EF4A 2NOGA 3O3KA 4UUSA 2XAJA 1MJ9A 2MC4A 1FP1D 4MFDA 1VI0A 1JE8A 3L09A 1XGMA 2E2HJ 3W6KB 3ECHA 1IN5A 4FASD 4YRVA 2LY2A 2VKEA 4WWCA 4CGZA 2R7OA 2V6EA 1TW2A 2L54A 4HV6A 5BOXA 1ORKA 1UB9A 1AA7A 3R60A 4GRIA 4XNFA 5H6RA 3CCVI 2RKHA 4RAGA 1IUFA 1ZHFA 4G7HF 3SHFA 2X85A 4I7HA 3GTPJ 1UHWA 2F5VA 2VKDA 5B1BH 4A3FJ 3FXMA 1D0ZA 2BBYA 4LK0F 2E1OA 4BXUA 1KYZA 3C1DA 3BQZA 2E7XA 2LBFA 1P7JA 2EFWA 3OYIA 2F5FA 3DTIA 4PGHA 2Y9ZA 3VB2A 1YRNA 5M3MJ 3U21A 2HGCA 1TNTA 3L9FA 5GPAA 2VLAA 5LFAA 3WG9A 1QRYA 3HEFA 3IP4B 1VZ0A 4MLOA 5JR3A 4ZYAA 2XUBA 3QAHA 2IRFG 3ZMZA 3BY6A 3OYAA 2HVRA 2HOEA 1I50J 3RI4A 1CGPA 2KPMA 3E5XA 3S1MJ 2GOXB 5E8GA 5FLVA 3TMOA 5HLIA 1HQCA 4FX4A 5F0FA 4B43A 3O6BB 2ZJQF 2HZDA 3HL2A 1JUMA 2V9VA 1YI2I 3I9V2 2ZO4A 1AKHA 2TRTA 2LC2A 1WJCA 4HQEA 2HYJA 5L3EA 4B09A 2H6CA 3E6MA 1SVOA 2DMUA 2HTSA 4AYBA 3K4KA 1P2FA 1TT0A 1G3YA 1BM9A 2ZJ2A 2R7QA 2Z1DA 3RPQA 2XSDC 1XX5A 2RNGA 1HW1A 3A0BC 4N4NB 1N25A 1W36D 3M7GA 2R7WA 3BDDA 3KYCB 4XMYA 3GLLA 3RPUD
chains in the Genus database with same CATH topology
3J80Z 5BPDA 2MLKA 2OU2A 4I0BA 2DK5A 3JAMK 4ZH4F 3WU0A 1FZPB 4L9TA 2CG4A 3DP7A 3ERED 2LSOA 1U5TB 1F1ZA 4XRFA 1WKMA 1S29A 4IF4A 1EV7A 2XGXA 1SD7A 3WTZA 1SFEA 4MGRA 3J81K 1W4MA 5F6FA 2NYXA 5K5QA 2M87A 3WTXC 5HVQC 4A6EA 4EGZA 1R7JA 2GIVA 1BI2A 5D4SA 4M72A 4ENNA 5ERIA 1O3RA 1I5ZA 2HDCA 4O5VA 2M5WA 4RS8A 4ASNA 1W7PA 5LRSA 2RGVA 2K86A 2DK8A 2KRFA 4M73A 2GXGA 4YG2F 1FBUA 5L3BA 1W5SA 3ZMSA 3BZ6A 1S7OA 1BC7C 5CLSA 3F8BA 2ADUA 1RZ4A 5DCMA 2YR2A 2FE3A 3U1DA 2IA2A 1O3QA 4OOIA 4LLGF 5LHHA 3WTWC 2EFNA 3PQKA 3SQNA 1MDMB 2Z99A 2JPBA 3C7JA 4Q47A 1XMKA 4N9IA 1FLIA 2F5CA 2KIUA 1J59A 5FGMA 5ICEA 4YFNF 3JTHA 2Y48A 1WQ2A 4BHCA 4A6DA 2QENA 2B0LA 1ZLKA 3LAJA 2JTVA 3E3VA 5CVRA 3DQVC 1D8KA 4EMSA 1MD0A 4RGUA 4ZYEA 4RB0A 3V8KA 2A5YB 3JW4A 4GO1A 1V4RA 5DV5A 5L3CA 4AIKA 1XB4A 5K1YA 4HQMA 4ZZLA 1IXCA 2A6HF 2PQ8A 2L4AA 1KU3A 2ZCWA 2Z3YA 4KIGA 3V7RA 1K78A 1XGNA 4PCQA 1RUNA 3GUDA 4LFUA 2FEZA 3IKVA 2P7VB 3EYIA 4JK1X 3CO6C 2XAGA 5FLXZ 3EUHA 2ZKZA 5E1XA 4G6QA 2FMLA 3ZMVA 1IUYA 1TQPA 1OMIA 1IRGA 2FNAA 3GVAA 3FMQA 1ODDA 2FA5A 2WC2A 2L4MA 2FRHA 2IA0A 3LA7A 4Y17A 1CF7A 4MQVA 4ETSA 3WGGA 2A3SA 3BWGA 4DNCA 1L0OC 1FC3A 4I0AA 3GZ6A 1LVAA 3CUQA 2HQRA 3FWEA 3F8NA 4OIPF 4KA4A 4G8XA 2VOOA 1T98A 5E17F 1LEBA 1IN8A 3Q9SA 4MQ9F 3SZTA 3DPTA 5HS9A 3FX3A 1J0RA 2XHKA 2HKXA 3G73A 2PLYA 3QU6A 3GWZA 3F3XA 2QUFA 3V4GA 4XBFA 3IKTA 4HBLA 4CDGA 1O7LA 3V7SA 3Q5FA 1HKTA 2VBYA 1AOYA 2RNJA 3HRSA 3VODA 3ABTA 2ZXJA 3T8RA 2ISYA 2GZWA 5E1WA 3QP5A 1KA8A 3W6JB 2E1CA 2X0LA 2D45A 5ILSA 4IHSA 2KIFA 4M9SA 3JSOA 1Q1HA 1HKSA 1O57A 2DW4A 2K27A 1R23A 1LQ1A 2D1VA 1XDUA 1Z9CA 3N97A 1WRJA 1ZARA 4EJWA 4WXHA 5D6FA 1S8NA 1TLHB 2OA4A 4EVIA 3SFZA 5L3FA 3H3ZA 1BI0A 2FBIA 3KCCA 2FNPA 1HW2A 2V79A 4EJUA 3ZMTA 5JVTA 1QQIA 5D6EA 1A04A 3KFWX 4AIHA 3WTVC 2KKOA 4MTEA 1XCVA 5IT9K 2EWNA 2FQ3A 3WGHA 2FU4A 3TKYA 3TGNA 1HBXG 1B9MA 4NHJA 5CVVA 2FMYA 4RAYA 3QP6A 2O61A 1LJ9A 4KN4X 1Z91A 3HRMA 3IWZA 2X4HA 3K69A 5K5RA 1WWXA 2R3SA 2CWEA 2G7HA 1O3TA 5JFRA 4AIJA 3J7AO 1Z6TA 3OV8A 1BN5A 5FD5A 3JSPA 2IP2A 2QQ9A 2W24A 3O2PE 4HF2A 2VODA 4P5OA 4IHTA 2IA1A 4I01A 1RUOA 4ENJA 2MD5A 1KU2A 1EH8A 1TQMA 4G7ZF 2QZ8A 4F7ZA 1V3FA 3I4PA 2YPRA 3I71A 3I0TA 2LF8A 2DPUA 4M9ZA 4XLPF 4BHPA 2DU9A 1Y0UA 1F9NA 3WTSC 4UVAA 3MAJA 3KZYA 3F6OA 4L5JA 1PUEE 3IC7A 1U6GA 4ZZDA 3R4KA 2RVCA 4ESBA 3TQNA 1DPUA 4I09A 2C6YA 4HDUA 3B73A 3TO9A 3ZPLA 2Z9OA 5DD4A 5HLHA 1YLFA 3PFIA 5DYMA 3F22A 1FP2A 2ZMEA 2ISZA 3CTAA 1RNLA 2DPDA 1R1VA 2VXZA 2CGPA 2DAOA 1YW9A 5FFXA 4LG0B 3CDHA 2WWYA 2H09A 3F21A 4CO8A 2XRNA 2OQRA 5F64A 1EH6A 1YW8A 2GA2A 3HYIA 4KICA 1BBYA 2LF7A 5IT3A 2NS0A 3WE3A 4WCGA 2L3DA 2NRAC 1D5VA 3F72A 3K1MA 4D0PA 1USTA 4LGWA 2XROA 1AWCA 2CQKA 5AIQA 3RTRA 4P96A 2O6GE 4ENKA 1R1TA 4E70A 3FM5A 2JRTA 4HF1A 2M30A 3D5LA 1YTYA 3TO6A 5F1RA 5CVIA 1H9GA 3MQ0A 1STZA 3L2CA 3IHUA 2V6CA 3HSFA 3WU1B 1JHFA 3ZMDA 3COAC 5D8KB 2A68F 1XSVA 3KE2A 1OYYA 4KFCA 1LDJA 1R5GA 2DFIA 3HSEA 2QBYA 1UFMA 3EDPA 2VT3A 5LGUA 1D3YA 4A0YA 1JHHA 4BH9A 6PAXA 1IRFA 1XGSA 5HDGA 4ZYHA 4UV9A 2IVMA 2DTRA 3K1PA 5ILVA 3E97A 3RPUA 2OZ6A 4EJOA 3J80K 5FO5A 1ONVA 1GXPA 1Z6RA 3GEZA 2STWA 2K7LA 4UV8A 4MEXF 3FMRA 1B9NA 2H94A 4HYEA 1BI3A 4CHUA 1P92A 3GO5A 3SZPA 2UZKA 4U7DA 1R36A 3RYPA 1QBJA 1ZG1A 1QO0D 3K2ZA 2MBFA 4R1HA 3U2RA 2PBIA 2DLLA 2O0YA 2W57A 1ZGAA 2HYGD 1IF1A 3R6SA 4JBAA 4XSXF 2VBZA 1I1SA 3VOEA 2M8EA 1QZYA 2Q0OA 2YU3A 4P9UA 4UUVA 2FXAA 4Q48A 4BNCA 2JSCA 5CJ9A 1XCBA 2CO5A 3KP3A 2VN2A 4U0WA 3HOTA 3BPVA 3ELKA 4HX8A 4YFKF 5ICFA 4PZJA 4KYWA 1BIBA 5DUKA 3GF2A 3E5QA 4LJZF 1YIOA 1XMAA 3GFMA 2PFBA 5DEQA 3BJOA 1YQAA 2EA2A 4B8XA 1YYVA 1ZRCA 1G3WA 4HLXA 1LB2A 1P6RA 3FXUA 1IN4A 4R79A 5E18F 5LHGA 1SD4A 3DEUA 3RDIA 3R61A 2HQNA 4AD9A 4L9NA 4RB1A 1OYWA 4HAMA 4LLLA 4M71A 2XIGA 5CYVA 4ZYGA 2A6EF 3V7CA 1KYWA 2OBPA 5J8CA 5DDGA 2WV0A 4S04A 3QPHA 1ZN2A 1OYIA 1R00A 4Y15A 1O7FA 2G9WA 3I53A 1U5TA 1BC8C 1FBSA 5H6QA 4HA8A 3FXQA 4AVPA 3PQJA 2W84A 4HW0A 3TDZC 4A12A 4H0EA 2R7DA 1HXDA 1FNNA 5LBQA 5HS8A 3HHHA 2HKOA 2GXBA 1ZRFA 1YW7A 3ECOA 5HDNA 1ULYA 3ABUA 4G7OF 3FXRA 1IXSB 1DPRA 4OMYA 2CSOA 1FSHA 1LDDA 4KT5C 3T0YA 3RIRA 4HLYA 3HSRA 2CW0F 1IN6A 4K2EA 3FF5A 2V1UA 2P5KA 3BROA 2PJPA 5FLXK 3E5UA 4MNUA 3LWFA 4IRGA 4PDKA 3T8TA 1S7AA 5FFZA 3Q9VA 1OR7A 2W85A 3V8JA 2RQPA 1S3JA 4EM1A 3RKXA 2VONA 1F4KA 3FMSA 4MEYF 1FX7A 3P9KA 4LD5A 5TRDA 1JGSA 2ZNZA 3F23A 1XSDA 5E20A 4WXCA 4UHTA 3L7WA 1LEAA 2WTEA 2EFPA 2EFQA 5E8IA 4GXOA 4MTDA 5D8LB 1G3TA 5LRRA 4BYYA 1ZYRF 2P8TA 4L9JA 3KP5A 4CXFA 3KEQA 1MJBA 2OD5A 4L0YB 2AS5F 5D5WB 3KETA 2F5DA 2QQBA 2ZBKA 3NRVA 2OQGA 1XD7A 2XASA 2H27A 1G4DA 2AXLA 4EM2A 2P6SA 4ENMA 4O6JA 1R5HA 4RAZA 2VBXA 4P9FA 3C18A 2BGCA 1OKRA 1T6SA 3C3WA 3FM3A 3OOPA 4GYIA 2E7WA 3I59A 3ZN0A 3KLOA 4RB2C 1PP8F 2PI0A 1QGPA 3M1EA 2FOKA 4A0XA 5A2QZ 1GVJA 1XSXA 3LA2A 4A5MA 3WTTC 2IW5A 3KP7A 3DFGA 2DQLA 2IPQX 3MWMA 5LLQA 3KP6A 4RGXA 3REOA 1T2KA 2Y0MA 5DCFA 4N0BA 3G3ZA 1MJAA 3NQOA 5LGNA 4KMUX 1Z05A 1L3LA 2HZTA 4KIFA 1WI9A 2K02A 3IRQA 3HRUA 3HUGA 3QPTA 2ETHA 3QRFF 3DF8A 2RC4A 4O3MA 3CUQC 1ZRDA 1P4WA 2YX7A 5D5VB 4U0VA 2GQQA 1IN7A 5LEKA 3ML6A 2EV6A 3FHZA 2HR3A 2M1BA 1B59A 4EV0A 1UCRA 1D8JA 1U2WA 4XLNF 2HS5A 1P4XA 2HFHA 2G7UA 3IRRA 1KQ9A 3P9CA 4EM0B 1KGSA 3VEPA 4L0ZB 4GYGA 2PMUA 1H0MA 4A0ZA 5KVRA 1DDNA 1UHMA 5BQTA 4KN7X 2IJLA 2HYFA 4HV5A 4MHGA 3H92A 1SAXA 1WSUA 1YS7A 1DUXC 5J8FA 2L02A 1S6LA 2TDXA 2M45A 3WGIA 2F2EA 3DPLC 1E2XA 3LQQA 3JTGA 4L18B 1LNWA 3E6CC 2VC1A 3K1NA 1IAWA 4LK1F 3BJ6A 2XKOA 4G94A 1W7PB 2E1NA 3CO7C 4KIBA 4U0YA 3GLXA 5CVJA 2GA1A 2H6BA 4LLNA 3H3UA 1IW7F 1BIAA 2MH9A 4UXNA 4CYDA 1TNSA 1YO5C 3LQRA 4QLCU 1R58A 1DP7P 3LAPA 5DCMB 1EH7A 1SD5A 4AWXB 3ROUA 3HHGA 2V1XA 2FBKA 2XAQA 3F8MA 3ZQ7A 1J75A 3M9AA 1BOAA 5ED4A 2RV8A 2DBBA 1YFHA 3HIFA 1QZZA 2D2WA 4OIRF 1ZH5A 4Q5SF 1NHAA 3TOAA 4ESFA 3WTYC 1G3SA 1GXQA 2P6TA 2BYVE 3HTUA 2QLZA 4PGGA 2QWWA 4L5IA 3JAMZ 4IRIA 2XAFA 2A69F 2QYOA 5CVUA 1FPQA 4WXDA 3F8CA 2CYYA 1SD6A 4WF2A 4RGRA 1TTYA 3J81Z 2V1DA 1YS6A 1I6XA 1J9IA 4LB5A 1T39A 1ZAOA 3TO7A 4WX9A 1J7KA 5AONA 5BMZA 2RDPA 5BS6A 2NAZA 1R1UA 2NNYA 4NQWA 4OINF 4TV7A 5EEHA 3GFIA 5L3GA 1K78B 3RKWA 1XN7A 4RGSA 5LGTA 4Z2YA 1W7PD 2BE5F 3RYRA 4UVBA 3DKWA 5HDKA 3FZVA 2VC0A 2FSWA 2F5EA 1JXSA 2VBWA 2VE9A 4I2OA 3ULQB 4JQFA 2MA3A 3QU3A 5JI6A 3IL2A 2OAZA 3QOPA 3NEUA 4R8HA 1PP7U 1FT9A 2DQRA 3DXJF 3L00A 2BEOA 1QNTA 4HZFA 4OIQF 4ON0A 5KK1A 1BI1A 1RI7A 1CF7B 3T5XA 1B4AA 1ZGJA 3E6BA 5ICCA 3B02A 3RJPA 4Y13A 3CUQB 4LMYA 2L01A 1FBQA 3D0SA 4WK8F 2J5PA 5D4RA 2ZFWA 3KZZA 4LG0A 2RN7A 2DO7A 4IRHA 1I1GA 1J2XA 4EQQA 4BAYA 1FSEA 3I5UA 3CUOA 4DQ2A 2UXXA 3KEOA 3N4MA 3LSTA 2EV5A 3I54A 1USSA 4LB6B 4M6XA 4FX0A 4S05A 3M8FA 4ZYDA 2K4BA 5D5XB 1HSJA 1FOKA 4A5NA 2ESNA 5EEGA 2EJRA 5TJJA 1YG2A 3KLNA 4OMZA 4XSZF 2HEOA 3GFJA 4EJVA 4EJTA 5FD6A 2YSRA 4IVNA 3P7NA 4L9VA 2XVCA 2ZNYA 3EYYA 1K6OA 1HSTA 3EQLF 1XDSA 4M9XA 3ZP5A 5DUIA 1Z7UA 1KQ8A 3WODF 2KJCA 3IWFA 3LA3A 4HOBA 2ACJA 2Q2EA 3CLOA 3F8FA 3CJNA 2K4JA 3I59B 4BQAA 2VOPA 1F5TA 1G6NA 1K79A 3M8EA 3T1BA 3ZMUA 3WE2A 4A2UA 3HRTA 1C0WA 2HWVA 1KU7A 4OU0A 3BPXA 1SMTA 3GZ5A 3BOQA 4UNOA 3V8LA 1X3UA 4IXAA 1MKMA 2ELHA 1U8RA 4OIOF 5K5OA 3RKYA 1TBXA 1T0FA 1MGTA 5FB2A 4G9YA 2XV4S 1HKQA 3I64A 2P5LC 2A61A 1B1BA 2LNBA 3BP8A 2FF4A 4HX4A 2OZUA 5AIPA 5HOOA 3KP2A 2EFOA 2R7FA 2NNNA 1FYKA 4P55A 3F6VA 1R22A 5LEJA 4Q4ZF 3EETA 4BHBA 2Z5UA 2UXNA 2PG4A 5H20A 2GAUA 2P4WA 2W25A 3E6DA 2A07F 2XAHA 1FYLA 5L3DA 1MDMA 1SFXA 2EK5A 2P5VA 4GCVA 1P4AA 4N9HA 4KUMA 1W5TA 4HDVA 3GX4X 3MCZA 3HTSB 2BV6A 4FHTA 4U88A 2PMHA 3TDUC 2EA4A 1E17A 4UVCA 2XKPA 3VFZA 2LDUA 1TQIA 2Z33A 4YIIA 4I02A 2COMA 1U3EM 4FT8A 1FWZA 2D1HA 4NB5A 4HX7A 5ILUA 1K7AA 3P9IA 3DV8A 3HOSA 4HF0A 3GFLA 3R0JA 2P7CB 5BPIA 3MZHA 4QWQA 1QPMA 1ON2A 1U5TC 2FBHA 2ZMEB 5IT9Z 1LDKB 4IJAA 3R0AA 5ICGA 2MH2A 3TOBA 3K9TA 2LKPA 1REPC 1GHCA 5LHIA 1IXRC 2JPCA 3WTUC 3GXOA 1Z1DA 1BJAA 1IZ1A 5E1ZB 2QVOA 4G6DA 2GWRA 2Y75A 3MZYA 2HTJA 1FYMA 2MLGA 1SMYF 3AAFA 1T38A 2QM3A 1FY7A 1TW3A 1ZLJA 2QQAA 1B6AA 3BJAA 5HLGA 5A2QK 2IT0A 2KJBA 2PN6A 1VTNC 4RB3C 1U78A 3K0LA 4IPAA 2JT1A 1O3SA 4CZZA 2UWMA 1ON1A 1KU9A 4KDPA 5D5UB 4CICA 1H9TA 2VT2A 2EB7A 2EV0A 4YIFA 1ZG5A 5JHUA 2YX4A 3SXYA 3KP4A 3S2WA 3ZN1A 2STTA 1ZG3A 2VE8A 4ESJA 1KQ0A 2O3FA 4EGYA 3MEXA 4KMFA 2O8XA 2DT5A 1RIOH 2QBYB 2CFXA 1ZREA 5J6XA 1OPCA 4YFXF 2PEXA 2JZYA 3GYHX 3U9GA 2KIMA 1MZBA 1SFUA 2O03A 1PDNC 1XGOA 1I27A 2ESHA 4U7BA 4M6YA 5HS7A 4GGGA 3ISPA 3GW2A 2DI3A 4M74A 2Q8KA 1J5YA 2MC3A 4I98B 1HW5A 3MFKA 5DD8A 2J5OA 3I58A 3LFKA 4KNYA 3O3KA 1MJ9A 2XAJA 1FP1D 1JE8A 3L09A 1XGMA 3W6KB 3ECHA 1IN5A 4WWCA 4CGZA 1TW2A 2L54A 4HV6A 5BOXA 1UB9A 3R60A 5H6RA 2RKHA 1ZHFA 4G7HF 3SHFA 4I7HA 1UHWA 2BBYA 4LK0F 4BXUA 1KYZA 3C1DA 2E7XA 2EFWA 2F5FA 4PGHA 3VB2A 2HGCA 1TNTA 3L9FA 3WG9A 5JR3A 2XUBA 3QAHA 2IRFG 3ZMZA 3BY6A 2HOEA 3RI4A 1CGPA 3E5XA 5E8GA 5HLIA 1HQCA 4FX4A 3O6BB 2V9VA 2ZO4A 4HQEA 5L3EA 4B09A 2H6CA 3E6MA 2HTSA 1P2FA 1G3YA 1BM9A 2ZJ2A 3RPQA 1HW1A 3M7GA 3BDDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J80 Z;  5BPD A;  2MLK A;  2OU2 A;  4I0B A;  2DK5 A;  3JAM K;  4ZH4 F;  3WU0 A;  1FZP B;  4L9T A;  2CG4 A;  3DP7 A;  3ERE D;  2LSO A;  1U5T B;  1F1Z A;  4XRF A;  1WKM A;  1S29 A;  4IF4 A;  1EV7 A;  2XGX A;  1SD7 A;  3WTZ A;  1SFE A;  4MGR A;  3J81 K;  1W4M A;  5F6F A;  2NYX A;  5K5Q A;  2M87 A;  3WTX C;  5HVQ C;  4A6E A;  4EGZ A;  1R7J A;  2GIV A;  1BI2 A;  5D4S A;  4M72 A;  4ENN A;  5ERI A;  1O3R A;  1I5Z A;  2HDC A;  4O5V A;  2M5W A;  4RS8 A;  4ASN A;  1W7P A;  5LRS A;  2RGV A;  2K86 A;  2DK8 A;  2KRF A;  4M73 A;  2GXG A;  4YG2 F;  1FBU A;  5L3B A;  1W5S A;  3ZMS A;  3BZ6 A;  1S7O A;  1BC7 C;  5CLS A;  3F8B A;  2ADU A;  1RZ4 A;  5DCM A;  2YR2 A;  2FE3 A;  3U1D A;  2IA2 A;  1O3Q A;  4OOI A;  4LLG F;  5LHH A;  3WTW C;  2EFN A;  3PQK A;  3SQN A;  1MDM B;  2Z99 A;  2JPB A;  3C7J A;  4Q47 A;  1XMK A;  4N9I A;  1FLI A;  2F5C A;  2KIU A;  1J59 A;  5FGM A;  5ICE A;  4YFN F;  3JTH A;  2Y48 A;  1WQ2 A;  4BHC A;  4A6D A;  2QEN A;  2B0L A;  1ZLK A;  3LAJ A;  2JTV A;  3E3V A;  5CVR A;  3DQV C;  1D8K A;  4EMS A;  1MD0 A;  4RGU A;  4ZYE A;  4RB0 A;  3V8K A;  2A5Y B;  3JW4 A;  4GO1 A;  1V4R A;  5DV5 A;  5L3C A;  4AIK A;  1XB4 A;  5K1Y A;  4HQM A;  4ZZL A;  1IXC A;  2A6H F;  2PQ8 A;  2L4A A;  1KU3 A;  2ZCW A;  2Z3Y A;  4KIG A;  3V7R A;  1K78 A;  1XGN A;  4PCQ A;  1RUN A;  3GUD A;  4LFU A;  2FEZ A;  3IKV A;  2P7V B;  3EYI A;  4JK1 X;  3CO6 C;  2XAG A;  5FLX Z;  3EUH A;  2ZKZ A;  5E1X A;  4G6Q A;  2FML A;  3ZMV A;  1IUY A;  1TQP A;  1OMI A;  1IRG A;  2FNA A;  3GVA A;  3FMQ A;  1ODD A;  2FA5 A;  2WC2 A;  2L4M A;  2FRH A;  2IA0 A;  3LA7 A;  4Y17 A;  1CF7 A;  4MQV A;  4ETS A;  3WGG A;  2A3S A;  3BWG A;  4DNC A;  1L0O C;  1FC3 A;  4I0A A;  3GZ6 A;  1LVA A;  3CUQ A;  2HQR A;  3FWE A;  3F8N A;  4OIP F;  4KA4 A;  4G8X A;  2VOO A;  1T98 A;  5E17 F;  1LEB A;  1IN8 A;  3Q9S A;  4MQ9 F;  3SZT A;  3DPT A;  5HS9 A;  3FX3 A;  1J0R A;  2XHK A;  2HKX A;  3G73 A;  2PLY A;  3QU6 A;  3GWZ A;  3F3X A;  2QUF A;  3V4G A;  4XBF A;  3IKT A;  4HBL A;  4CDG A;  1O7L A;  3V7S A;  3Q5F A;  1HKT A;  2VBY A;  1AOY A;  2RNJ A;  3HRS A;  3VOD A;  3ABT A;  2ZXJ A;  3T8R A;  2ISY A;  2GZW A;  5E1W A;  3QP5 A;  1KA8 A;  3W6J B;  2E1C A;  2X0L A;  2D45 A;  5ILS A;  4IHS A;  2KIF A;  4M9S A;  3JSO A;  1Q1H A;  1HKS A;  1O57 A;  2DW4 A;  2K27 A;  1R23 A;  1LQ1 A;  2D1V A;  1XDU A;  1Z9C A;  3N97 A;  1WRJ A;  1ZAR A;  4EJW A;  4WXH A;  5D6F A;  1S8N A;  1TLH B;  2OA4 A;  4EVI A;  3SFZ A;  5L3F A;  3H3Z A;  1BI0 A;  2FBI A;  3KCC A;  2FNP A;  1HW2 A;  2V79 A;  4EJU A;  3ZMT A;  5JVT A;  1QQI A;  5D6E A;  1A04 A;  3KFW X;  4AIH A;  3WTV C;  2KKO A;  4MTE A;  1XCV A;  5IT9 K;  2EWN A;  2FQ3 A;  3WGH A;  2FU4 A;  3TKY A;  3TGN A;  1HBX G;  1B9M A;  4NHJ A;  5CVV A;  2FMY A;  4RAY A;  3QP6 A;  2O61 A;  1LJ9 A;  4KN4 X;  1Z91 A;  3HRM A;  3IWZ A;  2X4H A;  3K69 A;  5K5R A;  1WWX A;  2R3S A;  2CWE A;  2G7H A;  1O3T A;  5JFR A;  4AIJ A;  3J7A O;  1Z6T A;  3OV8 A;  1BN5 A;  5FD5 A;  3JSP A;  2IP2 A;  2QQ9 A;  2W24 A;  3O2P E;  4HF2 A;  2VOD A;  4P5O A;  4IHT A;  2IA1 A;  4I01 A;  1RUO A;  4ENJ A;  2MD5 A;  1KU2 A;  1EH8 A;  1TQM A;  4G7Z F;  2QZ8 A;  4F7Z A;  1V3F A;  3I4P A;  2YPR A;  3I71 A;  3I0T A;  2LF8 A;  2DPU A;  4M9Z A;  4XLP F;  4BHP A;  2DU9 A;  1Y0U A;  1F9N A;  3WTS C;  4UVA A;  3MAJ A;  3KZY A;  3F6O A;  4L5J A;  1PUE E;  3IC7 A;  1U6G A;  4ZZD A;  3R4K A;  2RVC A;  4ESB A;  3TQN A;  1DPU A;  4I09 A;  2C6Y A;  4HDU A;  3B73 A;  3TO9 A;  3ZPL A;  2Z9O A;  5DD4 A;  5HLH A;  1YLF A;  3PFI A;  5DYM A;  3F22 A;  1FP2 A;  2ZME A;  2ISZ A;  3CTA A;  1RNL A;  2DPD A;  1R1V A;  2VXZ A;  2CGP A;  2DAO A;  1YW9 A;  5FFX A;  4LG0 B;  3CDH A;  2WWY A;  2H09 A;  3F21 A;  4CO8 A;  2XRN A;  2OQR A;  5F64 A;  1EH6 A;  1YW8 A;  2GA2 A;  3HYI A;  4KIC A;  1BBY A;  2LF7 A;  5IT3 A;  2NS0 A;  3WE3 A;  4WCG A;  2L3D A;  2NRA C;  1D5V A;  3F72 A;  3K1M A;  4D0P A;  1UST A;  4LGW A;  2XRO A;  1AWC A;  2CQK A;  5AIQ A;  3RTR A;  4P96 A;  2O6G E;  4ENK A;  1R1T A;  4E70 A;  3FM5 A;  2JRT A;  4HF1 A;  2M30 A;  3D5L A;  1YTY A;  3TO6 A;  5F1R A;  5CVI A;  1H9G A;  3MQ0 A;  1STZ A;  3L2C A;  3IHU A;  2V6C A;  3HSF A;  3WU1 B;  1JHF A;  3ZMD A;  3COA C;  5D8K B;  2A68 F;  1XSV A;  3KE2 A;  1OYY A;  4KFC A;  1LDJ A;  1R5G A;  2DFI A;  3HSE A;  2QBY A;  1UFM A;  3EDP A;  2VT3 A;  5LGU A;  1D3Y A;  4A0Y A;  1JHH A;  4BH9 A;  6PAX A;  1IRF A;  1XGS A;  5HDG A;  4ZYH A;  4UV9 A;  2IVM A;  2DTR A;  3K1P A;  5ILV A;  3E97 A;  3RPU A;  2OZ6 A;  4EJO A;  3J80 K;  5FO5 A;  1ONV A;  1GXP A;  1Z6R A;  3GEZ A;  2STW A;  2K7L A;  4UV8 A;  4MEX F;  3FMR A;  1B9N A;  2H94 A;  4HYE A;  1BI3 A;  4CHU A;  1P92 A;  3GO5 A;  3SZP A;  2UZK A;  4U7D A;  1R36 A;  3RYP A;  1QBJ A;  1ZG1 A;  1QO0 D;  3K2Z A;  2MBF A;  4R1H A;  3U2R A;  2PBI A;  2DLL A;  2O0Y A;  2W57 A;  1ZGA A;  2HYG D;  1IF1 A;  3R6S A;  4JBA A;  4XSX F;  2VBZ A;  1I1S A;  3VOE A;  2M8E A;  1QZY A;  2Q0O A;  2YU3 A;  4P9U A;  4UUV A;  2FXA A;  4Q48 A;  4BNC A;  2JSC A;  5CJ9 A;  1XCB A;  2CO5 A;  3KP3 A;  2VN2 A;  4U0W A;  3HOT A;  3BPV A;  3ELK A;  4HX8 A;  4YFK F;  5ICF A;  4PZJ A;  4KYW A;  1BIB A;  5DUK A;  3GF2 A;  3E5Q A;  4LJZ F;  1YIO A;  1XMA A;  3GFM A;  2PFB A;  5DEQ A;  3BJO A;  1YQA A;  2EA2 A;  4B8X A;  1YYV A;  1ZRC A;  1G3W A;  4HLX A;  1LB2 A;  1P6R A;  3FXU A;  1IN4 A;  4R79 A;  5E18 F;  5LHG A;  1SD4 A;  3DEU A;  3RDI A;  3R61 A;  2HQN A;  4AD9 A;  4L9N A;  4RB1 A;  1OYW A;  4HAM A;  4LLL A;  4M71 A;  2XIG A;  5CYV A;  4ZYG A;  2A6E F;  3V7C A;  1KYW A;  2OBP A;  5J8C A;  5DDG A;  2WV0 A;  4S04 A;  3QPH A;  1ZN2 A;  1OYI A;  1R00 A;  4Y15 A;  1O7F A;  2G9W A;  3I53 A;  1U5T A;  1BC8 C;  1FBS A;  5H6Q A;  4HA8 A;  3FXQ A;  4AVP A;  3PQJ A;  2W84 A;  4HW0 A;  3TDZ C;  4A12 A;  4H0E A;  2R7D A;  1HXD A;  1FNN A;  5LBQ A;  5HS8 A;  3HHH A;  2HKO A;  2GXB A;  1ZRF A;  1YW7 A;  3ECO A;  5HDN A;  1ULY A;  3ABU A;  4G7O F;  3FXR A;  1IXS B;  1DPR A;  4OMY A;  2CSO A;  1FSH A;  1LDD A;  4KT5 C;  3T0Y A;  3RIR A;  4HLY A;  3HSR A;  2CW0 F;  1IN6 A;  4K2E A;  3FF5 A;  2V1U A;  2P5K A;  3BRO A;  2PJP A;  5FLX K;  3E5U A;  4MNU A;  3LWF A;  4IRG A;  4PDK A;  3T8T A;  1S7A A;  5FFZ A;  3Q9V A;  1OR7 A;  2W85 A;  3V8J A;  2RQP A;  1S3J A;  4EM1 A;  3RKX A;  2VON A;  1F4K A;  3FMS A;  4MEY F;  1FX7 A;  3P9K A;  4LD5 A;  5TRD A;  1JGS A;  2ZNZ A;  3F23 A;  1XSD A;  5E20 A;  4WXC A;  4UHT A;  3L7W A;  1LEA A;  2WTE A;  2EFP A;  2EFQ A;  5E8I A;  4GXO A;  4MTD A;  5D8L B;  1G3T A;  5LRR A;  4BYY A;  1ZYR F;  2P8T A;  4L9J A;  3KP5 A;  4CXF A;  3KEQ A;  1MJB A;  2OD5 A;  4L0Y B;  2AS5 F;  5D5W B;  3KET A;  2F5D A;  2QQB A;  2ZBK A;  3NRV A;  2OQG A;  1XD7 A;  2XAS A;  2H27 A;  1G4D A;  2AXL A;  4EM2 A;  2P6S A;  4ENM A;  4O6J A;  1R5H A;  4RAZ A;  2VBX A;  4P9F A;  3C18 A;  2BGC A;  1OKR A;  1T6S A;  3C3W A;  3FM3 A;  3OOP A;  4GYI A;  2E7W A;  3I59 A;  3ZN0 A;  3KLO A;  4RB2 C;  1PP8 F;  2PI0 A;  1QGP A;  3M1E A;  2FOK A;  4A0X A;  5A2Q Z;  1GVJ A;  1XSX A;  3LA2 A;  4A5M A;  3WTT C;  2IW5 A;  3KP7 A;  3DFG A;  2DQL A;  2IPQ X;  3MWM A;  5LLQ A;  3KP6 A;  4RGX A;  3REO A;  1T2K A;  2Y0M A;  5DCF A;  4N0B A;  3G3Z A;  1MJA A;  3NQO A;  5LGN A;  4KMU X;  1Z05 A;  1L3L A;  2HZT A;  4KIF A;  1WI9 A;  2K02 A;  3IRQ A;  3HRU A;  3HUG A;  3QPT A;  2ETH A;  3QRF F;  3DF8 A;  2RC4 A;  4O3M A;  3CUQ C;  1ZRD A;  1P4W A;  2YX7 A;  5D5V B;  4U0V A;  2GQQ A;  1IN7 A;  5LEK A;  3ML6 A;  2EV6 A;  3FHZ A;  2HR3 A;  2M1B A;  1B59 A;  4EV0 A;  1UCR A;  1D8J A;  1U2W A;  4XLN F;  2HS5 A;  1P4X A;  2HFH A;  2G7U A;  3IRR A;  1KQ9 A;  3P9C A;  4EM0 B;  1KGS A;  3VEP A;  4L0Z B;  4GYG A;  2PMU A;  1H0M A;  4A0Z A;  5KVR A;  1DDN A;  1UHM A;  5BQT A;  4KN7 X;  2IJL A;  2HYF A;  4HV5 A;  4MHG A;  3H92 A;  1SAX A;  1WSU A;  1YS7 A;  1DUX C;  5J8F A;  2L02 A;  1S6L A;  2TDX A;  2M45 A;  3WGI A;  2F2E A;  3DPL C;  1E2X A;  3LQQ A;  3JTG A;  4L18 B;  1LNW A;  3E6C C;  2VC1 A;  3K1N A;  1IAW A;  4LK1 F;  3BJ6 A;  2XKO A;  4G94 A;  1W7P B;  2E1N A;  3CO7 C;  4KIB A;  4U0Y A;  3GLX A;  5CVJ A;  2GA1 A;  2H6B A;  4LLN A;  3H3U A;  1IW7 F;  1BIA A;  2MH9 A;  4UXN A;  4CYD A;  1TNS A;  1YO5 C;  3LQR A;  4QLC U;  1R58 A;  1DP7 P;  3LAP A;  5DCM B;  1EH7 A;  1SD5 A;  4AWX B;  3ROU A;  3HHG A;  2V1X A;  2FBK A;  2XAQ A;  3F8M A;  3ZQ7 A;  1J75 A;  3M9A A;  1BOA A;  5ED4 A;  2RV8 A;  2DBB A;  1YFH A;  3HIF A;  1QZZ A;  2D2W A;  4OIR F;  1ZH5 A;  4Q5S F;  1NHA A;  3TOA A;  4ESF A;  3WTY C;  1G3S A;  1GXQ A;  2P6T A;  2BYV E;  3HTU A;  2QLZ A;  4PGG A;  2QWW A;  4L5I A;  3JAM Z;  4IRI A;  2XAF A;  2A69 F;  2QYO A;  5CVU A;  1FPQ A;  4WXD A;  3F8C A;  2CYY A;  1SD6 A;  4WF2 A;  4RGR A;  1TTY A;  3J81 Z;  2V1D A;  1YS6 A;  1I6X A;  1J9I A;  4LB5 A;  1T39 A;  1ZAO A;  3TO7 A;  4WX9 A;  1J7K A;  5AON A;  5BMZ A;  2RDP A;  5BS6 A;  2NAZ A;  1R1U A;  2NNY A;  4NQW A;  4OIN F;  4TV7 A;  5EEH A;  3GFI A;  5L3G A;  1K78 B;  3RKW A;  1XN7 A;  4RGS A;  5LGT A;  4Z2Y A;  1W7P D;  2BE5 F;  3RYR A;  4UVB A;  3DKW A;  5HDK A;  3FZV A;  2VC0 A;  2FSW A;  2F5E A;  1JXS A;  2VBW A;  2VE9 A;  4I2O A;  3ULQ B;  4JQF A;  2MA3 A;  3QU3 A;  5JI6 A;  3IL2 A;  2OAZ A;  3QOP A;  3NEU A;  4R8H A;  1PP7 U;  1FT9 A;  2DQR A;  3DXJ F;  3L00 A;  2BEO A;  1QNT A;  4HZF A;  4OIQ F;  4ON0 A;  5KK1 A;  1BI1 A;  1RI7 A;  1CF7 B;  3T5X A;  1B4A A;  1ZGJ A;  3E6B A;  5ICC A;  3B02 A;  3RJP A;  4Y13 A;  3CUQ B;  4LMY A;  2L01 A;  1FBQ A;  3D0S A;  4WK8 F;  2J5P A;  5D4R A;  2ZFW A;  3KZZ A;  4LG0 A;  2RN7 A;  2DO7 A;  4IRH A;  1I1G A;  1J2X A;  4EQQ A;  4BAY A;  1FSE A;  3I5U A;  3CUO A;  4DQ2 A;  2UXX A;  3KEO A;  3N4M A;  3LST A;  2EV5 A;  3I54 A;  1USS A;  4LB6 B;  4M6X A;  4FX0 A;  4S05 A;  3M8F A;  4ZYD A;  2K4B A;  5D5X B;  1HSJ A;  1FOK A;  4A5N A;  2ESN A;  5EEG A;  2EJR A;  5TJJ A;  1YG2 A;  3KLN A;  4OMZ A;  4XSZ F;  2HEO A;  3GFJ A;  4EJV A;  4EJT A;  5FD6 A;  2YSR A;  4IVN A;  3P7N A;  4L9V A;  2XVC A;  2ZNY A;  3EYY A;  1K6O A;  1HST A;  3EQL F;  1XDS A;  4M9X A;  3ZP5 A;  5DUI A;  1Z7U A;  1KQ8 A;  3WOD F;  2KJC A;  3IWF A;  3LA3 A;  4HOB A;  2ACJ A;  2Q2E A;  3CLO A;  3F8F A;  3CJN A;  2K4J A;  3I59 B;  4BQA A;  2VOP A;  1F5T A;  1G6N A;  1K79 A;  3M8E A;  3T1B A;  3ZMU A;  3WE2 A;  4A2U A;  3HRT A;  1C0W A;  2HWV A;  1KU7 A;  4OU0 A;  3BPX A;  1SMT A;  3GZ5 A;  3BOQ A;  4UNO A;  3V8L A;  1X3U A;  4IXA A;  1MKM A;  2ELH A;  1U8R A;  4OIO F;  5K5O A;  3RKY A;  1TBX A;  1T0F A;  1MGT A;  5FB2 A;  4G9Y A;  2XV4 S;  1HKQ A;  3I64 A;  2P5L C;  2A61 A;  1B1B A;  2LNB A;  3BP8 A;  2FF4 A;  4HX4 A;  2OZU A;  5AIP A;  5HOO A;  3KP2 A;  2EFO A;  2R7F A;  2NNN A;  1FYK A;  4P55 A;  3F6V A;  1R22 A;  5LEJ A;  4Q4Z F;  3EET A;  4BHB A;  2Z5U A;  2UXN A;  2PG4 A;  5H20 A;  2GAU A;  2P4W A;  2W25 A;  3E6D A;  2A07 F;  2XAH A;  1FYL A;  5L3D A;  1MDM A;  1SFX A;  2EK5 A;  2P5V A;  4GCV A;  1P4A A;  4N9H A;  4KUM A;  1W5T A;  4HDV A;  3GX4 X;  3MCZ A;  3HTS B;  2BV6 A;  4FHT A;  4U88 A;  2PMH A;  3TDU C;  2EA4 A;  1E17 A;  4UVC A;  2XKP A;  3VFZ A;  2LDU A;  1TQI A;  2Z33 A;  4YII A;  4I02 A;  2COM A;  1U3E M;  4FT8 A;  1FWZ A;  2D1H A;  4NB5 A;  4HX7 A;  5ILU A;  1K7A A;  3P9I A;  3DV8 A;  3HOS A;  4HF0 A;  3GFL A;  3R0J A;  2P7C B;  5BPI A;  3MZH A;  4QWQ A;  1QPM A;  1ON2 A;  1U5T C;  2FBH A;  2ZME B;  5IT9 Z;  1LDK B;  4IJA A;  3R0A A;  5ICG A;  2MH2 A;  3TOB A;  3K9T A;  2LKP A;  1REP C;  1GHC A;  5LHI A;  1IXR C;  2JPC A;  3WTU C;  3GXO A;  1Z1D A;  1BJA A;  1IZ1 A;  5E1Z B;  2QVO A;  4G6D A;  2GWR A;  2Y75 A;  3MZY A;  2HTJ A;  1FYM A;  2MLG A;  1SMY F;  3AAF A;  1T38 A;  2QM3 A;  1FY7 A;  1TW3 A;  1ZLJ A;  2QQA A;  1B6A A;  3BJA A;  5HLG A;  5A2Q K;  2IT0 A;  2KJB A;  2PN6 A;  1VTN C;  4RB3 C;  1U78 A;  3K0L A;  4IPA A;  2JT1 A;  1O3S A;  4CZZ A;  2UWM A;  1ON1 A;  1KU9 A;  4KDP A;  5D5U B;  4CIC A;  1H9T A;  2VT2 A;  2EB7 A;  2EV0 A;  4YIF A;  1ZG5 A;  5JHU A;  2YX4 A;  3SXY A;  3KP4 A;  3S2W A;  3ZN1 A;  2STT A;  1ZG3 A;  2VE8 A;  4ESJ A;  1KQ0 A;  2O3F A;  4EGY A;  3MEX A;  4KMF A;  2O8X A;  2DT5 A;  1RIO H;  2QBY B;  2CFX A;  1ZRE A;  5J6X A;  1OPC A;  4YFX F;  2PEX A;  2JZY A;  3GYH X;  3U9G A;  2KIM A;  1MZB A;  1SFU A;  2O03 A;  1PDN C;  1XGO A;  1I27 A;  2ESH A;  4U7B A;  4M6Y A;  5HS7 A;  4GGG A;  3ISP A;  3GW2 A;  2DI3 A;  4M74 A;  2Q8K A;  1J5Y A;  2MC3 A;  4I98 B;  1HW5 A;  3MFK A;  5DD8 A;  2J5O A;  3I58 A;  3LFK A;  4KNY A;  3O3K A;  1MJ9 A;  2XAJ A;  1FP1 D;  1JE8 A;  3L09 A;  1XGM A;  3W6K B;  3ECH A;  1IN5 A;  4WWC A;  4CGZ A;  1TW2 A;  2L54 A;  4HV6 A;  5BOX A;  1UB9 A;  3R60 A;  5H6R A;  2RKH A;  1ZHF A;  4G7H F;  3SHF A;  4I7H A;  1UHW A;  2BBY A;  4LK0 F;  4BXU A;  1KYZ A;  3C1D A;  2E7X A;  2EFW A;  2F5F A;  4PGH A;  3VB2 A;  2HGC A;  1TNT A;  3L9F A;  3WG9 A;  5JR3 A;  2XUB A;  3QAH A;  2IRF G;  3ZMZ A;  3BY6 A;  2HOE A;  3RI4 A;  1CGP A;  3E5X A;  5E8G A;  5HLI A;  1HQC A;  4FX4 A;  3O6B B;  2V9V A;  2ZO4 A;  4HQE A;  5L3E A;  4B09 A;  2H6C A;  3E6M A;  2HTS A;  1P2F A;  1G3Y A;  1BM9 A;  2ZJ2 A;  3RPQ A;  1HW1 A;  3M7G A;  3BDD A; 
#chains in the Genus database with same CATH topology
 1I3Q J;  3J80 Z;  5BPD A;  2MLK A;  2OU2 A;  4I0B A;  4BGD A;  2DK5 A;  3I3L A;  4A93 J;  2JVH A;  3JAM K;  1Y8R B;  2LVS A;  4ZH4 F;  3WU0 A;  1FZP B;  3BR5 A;  3ZQL A;  2YUS A;  4L9T A;  2CG4 A;  4F93 B;  4A3E J;  1MMS A;  3DP7 A;  3H5A A;  3ERE D;  2LSO A;  2RAE A;  1U5T B;  1F1Z A;  3VPR A;  1R71 A;  2ZB9 A;  3QYE A;  4XRF A;  4B47 A;  1WKM A;  1S29 A;  1W0T A;  1ETW A;  1ETO A;  4IF4 A;  4CYC A;  1EV7 A;  2VPL A;  2XGX A;  1SD7 A;  3WTZ A;  2OUM A;  1SFE A;  4MGR A;  3J81 K;  4FE4 A;  4NC8 A;  1UAA A;  1W4M A;  3L2R A;  5F6F A;  4ZDL A;  2NYX A;  2KRC A;  5K5Q A;  4J19 A;  2M87 A;  3WTX C;  5HVQ C;  2IBD A;  4A6E A;  3H9J A;  1DGW Y;  4EGZ A;  1R7J A;  2GIV A;  1BI2 A;  5D4S A;  4M72 A;  3S16 J;  1X4O A;  2Y0S A;  1X3W B;  4ENN A;  2V26 A;  4LG3 A;  1KON A;  5ERI A;  1O3R A;  1QHG A;  1I5Z A;  3QOD A;  3LMM A;  3RKQ A;  2HDC A;  2DDB A;  2HI3 A;  1GV2 A;  2ME6 A;  3BTI A;  3OIO A;  4O5V A;  3FKI J;  2CJJ A;  2CQ7 A;  3VWB A;  2M5W A;  4RS8 A;  4ASN A;  1K83 J;  4HG2 A;  1W7P A;  4XON A;  1BR2 A;  5LRS A;  1H88 C;  1V5F A;  2RGV A;  2K86 A;  2DK8 A;  2KRF A;  3LSP A;  4M73 A;  2GXG A;  4YG2 F;  5IP9 J;  1FBU A;  5L3B A;  1W5S A;  2PMZ N;  2ELK A;  4E7J A;  1MIJ A;  3ZMS A;  4A3D J;  3BZ6 A;  3L2W A;  1NG7 A;  1S7O A;  3PO2 J;  3QWL A;  5J4Y A;  3W2W A;  1BC7 C;  2EZK A;  5J1R A;  5CLS A;  4YIR X;  4ANJ A;  5IP7 J;  1OCT C;  3F8B A;  2ADU A;  3HOU J;  1RZ4 A;  4FET A;  5DCM A;  2YR2 A;  1A6I A;  4PSW A;  2JA6 J;  2WAQ A;  3DEE A;  2FE3 A;  4RMN A;  3KEY A;  4S0H B;  3U1D A;  3OIP A;  4B1R A;  2IA2 A;  1O3Q A;  5EF6 A;  3RQ4 A;  4OOI A;  3D1N I;  4LLG F;  3WG7 H;  3IH4 A;  1BJZ A;  5LHH A;  4YEJ A;  1VQ6 I;  1FTT A;  3HDD A;  1SVM A;  2XC7 A;  2RRE A;  2CW8 A;  4NUB A;  4MO7 A;  2VQL A;  3WTW C;  1OCC H;  2EFN A;  3PQK A;  3SQN A;  3OYB A;  2CUE A;  1MDM B;  2XPW A;  2Z99 A;  2JPB A;  3C7J A;  4F52 A;  2DA6 A;  1IDZ A;  4Q47 A;  1XMK A;  2HQA A;  4N9I A;  1A36 A;  2Y2Z A;  3K10 A;  3LSH A;  1FLI A;  5B3S H;  2A6T A;  2R7X A;  1YJ9 I;  2F5C A;  2KIU A;  1J59 A;  5FGM A;  5ICE A;  3CMY A;  4DBQ A;  3GTM J;  4YFN F;  3FKJ A;  3JTH A;  2R5Y B;  3FXJ A;  4AID A;  1MBE A;  4QIW N;  2X6W A;  2Y48 A;  1WQ2 A;  1VQ7 I;  2KIQ A;  4BHC A;  2E5Z A;  3AKZ A;  4A6D A;  2QEN A;  2PJR A;  3KYD B;  2B0L A;  5EYR A;  2EZL A;  1ZLK A;  3LAJ A;  2JTV A;  3E3V A;  5CVR A;  3CQZ J;  1JKR C;  2DTZ A;  3DQV C;  2XPU A;  4KJZ A;  1D8K A;  1ETV A;  2X1D A;  4NC7 A;  4EMS A;  4C2U A;  1MD0 A;  4IO9 F;  4RGU A;  4D1Q A;  1X1C A;  3HBL A;  2B9S A;  3CDL A;  2JN6 A;  4ZYE A;  2VI6 A;  4RB0 A;  1NK3 P;  3V8K A;  3GCM A;  1N78 A;  2A5Y B;  3JW4 A;  4C3I J;  2R92 J;  3EPZ A;  3VYS B;  4GO1 A;  3H3V K;  3CCE I;  1V4R A;  5DV5 A;  2DA5 A;  5L3C A;  4AIK A;  3AL0 B;  3LL7 A;  1XB4 A;  1QZE A;  5K1Y A;  3DKX A;  2WAE A;  4DYC A;  1ACI A;  2WB1 N;  2Y31 A;  4HQM A;  4ZZL A;  2XGE A;  2WA0 A;  1IXC A;  1SEU A;  2A6H F;  3OSG A;  2PQ8 A;  4XN3 A;  2R7T A;  2L4A A;  4B3X A;  1KU3 A;  2ZCW A;  5M5Y J;  2Z3Y A;  3JRC A;  3CC4 I;  2M8G X;  4KIG A;  3V7R A;  4A3I J;  1K78 A;  1XGN A;  1K61 A;  4PCQ A;  1RUN A;  4FTH A;  3GUD A;  5F0H A;  4JX4 A;  4BDZ A;  5TGT A;  2LR8 A;  4LFU A;  2FEZ A;  3IKV A;  1KZH A;  3GZN B;  2P7V B;  2F6C A;  3IAM 2;  3EYI A;  2DMT A;  3OIQ A;  2EZI A;  4JK1 X;  3CO6 C;  2KZV A;  2XAG A;  5FLX Z;  2HDD A;  3EUH A;  4OAY A;  1LFP A;  2ZKZ A;  5E1X A;  4G6Q A;  2K40 A;  2FML A;  4E7S A;  3H0D A;  2X6X A;  2LLK A;  3CC2 I;  3HPG A;  3ZMV A;  3W6V A;  1UZC A;  3CZ6 A;  3MZ8 A;  4IQJ A;  1IUY A;  3CJQ B;  5GAG J;  1SAU A;  1TQP A;  4I76 A;  1OMI A;  1IRG A;  3BTL A;  2FNA A;  2QF7 A;  5B66 C;  3PFY A;  3CCS I;  2M3A A;  1MW7 A;  3GVA A;  3K2A A;  3FMQ A;  2GBY A;  1ODD A;  2FA5 A;  4BXF A;  2WC2 A;  4M3F A;  2L4M A;  3PNY A;  2LY1 A;  2FRH A;  2IA0 A;  3E7L A;  3HUG B;  2HVS A;  1BW5 A;  3LA7 A;  1QHH D;  4Y17 A;  1CF7 A;  3GTL J;  4UB8 C;  1VQ4 I;  4MQV A;  4ETS A;  3C2B A;  2DXI A;  3WGG A;  2A3S A;  1I6H J;  2L7M P;  3BWG A;  3IUO A;  4DNC A;  1L0O C;  1FC3 A;  4I0A A;  3GZ6 A;  3CDI A;  1LVA A;  3CUQ A;  2HQR A;  2GOM A;  3FWE A;  1VQN I;  1B72 A;  3F8N A;  3BR1 A;  4OIP F;  4KA4 A;  4G8X A;  2VOO A;  1T98 A;  5E17 F;  1LEB A;  1IN8 A;  3Q9S A;  2BHY A;  4MQ9 F;  3SZT A;  3DPT A;  3OYL A;  5HS9 A;  3VSL A;  3MKW B;  3FX3 A;  1J0R A;  5GAH J;  1OQY A;  2XHK A;  2HKX A;  2JMW A;  3G73 A;  2PLY A;  4XKV A;  2EIK H;  1WPK A;  2EBI A;  5EG0 B;  3QU6 A;  4PUS A;  4D7M A;  3SZG A;  3GWZ A;  1ZR4 A;  3F9K A;  3F3X A;  5M3F J;  4UY8 I;  2QUF A;  1WH7 A;  3D5S C;  3V4G A;  3TBI A;  3CCM I;  1JKP C;  4RDU A;  3B6C A;  4XBF A;  5C44 J;  3IKT A;  4HBL A;  4CDG A;  3Q3S A;  1O7L A;  3V7S A;  2DFH A;  3W3C A;  3Q5F A;  3FBI B;  1HKT A;  2KL4 A;  2VBY A;  2FX0 A;  1AOY A;  2FUG 2;  2RNJ A;  2BHZ A;  3K4N A;  2M7B A;  3HRS A;  5IP6 A;  3VOD A;  3ABT A;  2ZXJ A;  3T8R A;  2ISY A;  2GZW A;  3DLA A;  5E1W A;  4BE0 A;  4ZDO A;  3QP5 A;  1X19 A;  2K9M A;  1MH3 A;  4BY1 J;  1JI8 A;  5FRM A;  3BR3 A;  1KA8 A;  3DBH B;  3WHB A;  3W6J B;  2E1C A;  2R7U A;  1GT0 C;  4XLC A;  2X1C A;  1LFB A;  1NG6 A;  2X0L A;  2JUG A;  3AFH A;  3BZK A;  2D45 A;  2NOJ B;  5ILS A;  3S3M A;  3L2V A;  4IHS A;  2KIF A;  4M9S A;  3JSO A;  3OS2 A;  1DU0 A;  1Q1H A;  1HKS A;  1O57 A;  2DW4 A;  3LNQ A;  2K27 A;  1R23 A;  5HNH A;  1WJE A;  1ERD A;  3OWT A;  1LQ1 A;  1VFC A;  4CH7 A;  2D1V A;  1BR1 A;  1XDU A;  5KAF C;  4G12 A;  4XL9 A;  3H1C A;  1Z9C A;  3N97 A;  1QPI A;  5IY5 H;  1WRJ A;  3S93 A;  3M8J A;  1WZ2 A;  3B6A A;  1ZAR A;  2I10 A;  2LMD A;  2ECB A;  3H36 A;  4EJW A;  3ZRG A;  4WXH A;  1WJ5 A;  1S8N A;  5D6F A;  1TLH B;  2OA4 A;  2XB0 X;  2KHM A;  2I5U A;  4EVI A;  1RR7 A;  2DA3 A;  3H3Z A;  1BI0 A;  3SFZ A;  5L3F A;  4Y52 J;  2LRE A;  2FBI A;  4M3E A;  4A3B J;  2FQ4 A;  3KCC A;  2FNP A;  2CV2 A;  1HW2 A;  2V79 A;  2LBF B;  4EJU A;  1JGG A;  2VXD A;  3HZJ A;  1V5E A;  3HOZ J;  3ZMT A;  2P81 A;  3BTJ A;  3EUH C;  3AG4 H;  1VQM I;  3PJR A;  5JVT A;  1QQI A;  2WY8 Q;  5D6E A;  4CUG A;  1A04 A;  3KFW X;  2VPR A;  4AIH A;  4IZZ A;  3WTV C;  2KKO A;  4MTE A;  4E7I A;  1XCV A;  3ABM H;  2EWN A;  5IT9 K;  1POG A;  2FQ3 A;  3WGH A;  1T56 A;  2FU4 A;  3SEQ A;  3TKY A;  3TGN A;  4ZJZ A;  1T0F C;  5JVG F;  2QEX I;  2DA7 A;  1HBX G;  4QTR A;  1B9M A;  2KDO A;  4NHJ A;  5CVV A;  2FMY A;  2D5V A;  4RAY A;  1G59 A;  3CMM A;  2KIS A;  3QP6 A;  2O61 A;  3SFI A;  3G6E I;  1LJ9 A;  4KN4 X;  1Z91 A;  3IV5 A;  1S9H A;  1V54 H;  3LSI A;  2LK2 A;  3HRM A;  3IWZ A;  1JUS A;  2KT0 A;  2X4H A;  3K69 A;  5K5R A;  4DJA A;  2VAS A;  4D7N A;  1WWX A;  2R3S A;  2CWE A;  2XF6 A;  1G2H A;  2G7H A;  1O3T A;  5JFR A;  4AIJ A;  3J7A O;  1TT5 B;  1D5Y A;  1Z6T A;  3OV8 A;  4XM3 A;  2R5Z B;  1BN5 A;  4A69 C;  5FD5 A;  3JSP A;  2IP2 A;  2QQ9 A;  4B3A A;  2W24 A;  3O2P E;  1TP4 A;  3G1M A;  3RQI A;  4HF2 A;  1GLN A;  2VOD A;  4E7Z A;  4P5O A;  4IHT A;  1WJD A;  2IA1 A;  5IPA A;  3OOU A;  1WH5 A;  4I01 A;  1RUO A;  2AQF A;  3FDY A;  3G71 I;  4BS9 A;  1MSE C;  1F43 A;  3S17 J;  4NQW B;  3AG3 H;  5F08 A;  2EZH A;  4ENJ A;  2MD5 A;  1KU2 A;  1TWF J;  2DOF A;  1EH8 A;  1TQM A;  4G7Z F;  1OFC X;  2JSP A;  2QZ8 A;  4F7Z A;  1V3F A;  3I4P A;  2YPR A;  3I71 A;  3I0T A;  3CF2 A;  2LF8 A;  2DPU A;  4M9Z A;  2L0K A;  4BL0 B;  4I99 C;  4XLP F;  2W00 A;  4A3K J;  4BHP A;  2DU9 A;  1Y0U A;  4J01 A;  1F9N A;  2OF7 A;  5K7F A;  1MNE A;  3WTS C;  3QYF A;  2XRL A;  4UVA A;  2W7N A;  4LOC A;  3MAJ A;  2QCO A;  2Q1Z B;  5FKO A;  3KZY A;  3ABL H;  3F6O A;  4L5J A;  1PUE E;  1X2M A;  3IC7 A;  4RA2 A;  1U6G A;  4ZZD A;  2BOL A;  1K4T A;  4C30 A;  3R4K A;  4FCY A;  2RVC A;  4ESB A;  2VQC A;  3TQN A;  4FIS A;  4I09 A;  5J3L A;  1DPU A;  2C6Y A;  2DOE A;  4HDU A;  3GME A;  3B73 A;  3H5N A;  4E7K A;  5CQE A;  4U87 A;  2CUF A;  3TO9 A;  3ZPL A;  2YU9 J;  4XOP A;  1MND A;  2Z9O A;  2YS9 A;  4XOT A;  1Y0N A;  3JRA A;  3G4S I;  5DD4 A;  3H9Q A;  3S2D J;  5HLH A;  5CPR B;  1YLF A;  3OL4 A;  3PFI A;  2E19 A;  5DYM A;  5JLW A;  3F22 A;  2BY1 A;  2HOS A;  1FP2 A;  2MFZ A;  2ZME A;  1WFX A;  2KMU A;  2DJN A;  5BNG A;  3FXL A;  2ISZ A;  3M1C A;  1IV6 A;  3PNV A;  2L5Q A;  1U8B A;  3CTA A;  1RNL A;  3JRI A;  1IC8 A;  5EGO A;  1A31 A;  2B63 J;  4E7H A;  2DPD A;  1R1V A;  2M9H A;  2VXZ A;  2CGP A;  2DAO A;  2QQ8 A;  1YW9 A;  2JVG A;  5HOD A;  5FFX A;  5GTH C;  1G8X A;  3CDH A;  4LG0 B;  1XMX A;  2WWY A;  3GTK J;  2H09 A;  3F21 A;  4CO8 A;  1HA8 A;  3GBG A;  2R7R A;  2MW8 A;  3DEW A;  2XRN A;  4PJ0 C;  3HJE A;  2OQR A;  3K70 D;  1FIP A;  2LTP A;  5F04 A;  4HPQ A;  5F64 A;  1EH6 A;  2E5N A;  1YW8 A;  2GA2 A;  5EEA A;  3HYI A;  4KIC A;  1BBY A;  3J7Z I;  2LF7 A;  5E3N A;  5IT3 A;  2NS0 A;  3WE3 A;  4WCG A;  2L3D A;  2NRA C;  2LFB A;  3BT9 A;  1RKT A;  3HKZ A;  1JT6 A;  3F72 A;  1PVE A;  3K1M A;  4D0P A;  2QA4 I;  9ANT A;  2BW3 A;  1D5V A;  1UST A;  1WJA A;  3G2B A;  4LGW A;  2K3F A;  2XRO A;  3JRH A;  1AWC A;  2ICW G;  2CQK A;  5AIQ A;  1E0E A;  2ID3 A;  3RTR A;  4P96 A;  1LVK A;  2O6G E;  4ENK A;  4BBS J;  4F92 B;  1ENH A;  1R1T A;  1PJR A;  1IRX A;  4E70 A;  3ERM A;  3FM5 A;  2JRT A;  1U9O A;  4HF1 A;  2M30 A;  3D5L A;  2HPI A;  4I6Z A;  1YTY A;  3TO6 A;  5F1R A;  5CVI A;  1BOB A;  3X2Q H;  3GTQ J;  1NK2 P;  2WV1 A;  1H9G A;  2DOD A;  3MQ0 A;  4HRI A;  3H9G A;  1STZ A;  3L2C A;  2QKM B;  4AU7 A;  3IHU A;  3ZOB A;  2V6C A;  3HSF A;  3WU1 B;  4A3L J;  1JHF A;  3ZMD A;  3COA C;  1R5I D;  2EH3 A;  1LE8 A;  5D8K B;  2A68 F;  1SFK A;  1VQO I;  3MVP A;  1JKO C;  5EDN A;  1XSV A;  3O8H A;  4Y7N J;  1W0U A;  3KE2 A;  3S1Q J;  1OYY A;  3DPU A;  2CV1 A;  2CW7 A;  4KFC A;  1LDJ A;  2E36 A;  1YE9 A;  1R5G A;  2DFI A;  3HSE A;  1Y56 A;  1MBH A;  2Q2E B;  1Z0X A;  3RCO A;  5K7Z A;  2QBY A;  1UFM A;  3S1N J;  4DOZ A;  3EDP A;  4HEA 2;  2VT3 A;  3HOX J;  1U9N A;  5LGU A;  1D3Y A;  3ZGK A;  1JHH A;  4A0Y A;  4BH9 A;  6PAX A;  1IRF A;  2NVY J;  1XGS A;  5HDG A;  4ZYH A;  4UV9 A;  2IVM A;  3OR1 C;  3HOW J;  2DTR A;  3K1P A;  5ILV A;  2ZSH B;  3E97 A;  1TC3 C;  4V2F A;  5K7H A;  3RPU A;  2OZ6 A;  2DN0 A;  2P0W A;  4EJO A;  3J80 K;  3WHC A;  5FO5 A;  1ONV A;  1GXP A;  1MMD A;  1Z6R A;  3GEZ A;  2STW A;  2K7L A;  4CSW A;  4UV8 A;  3KYL A;  2OTL I;  2XB5 A;  4MEX F;  1ZTR A;  5F0C A;  4B44 A;  3FMR A;  3HOV J;  4X6A J;  1B9N A;  1FOY A;  3E1S A;  2H94 A;  4HYE A;  1BI3 A;  3DTE A;  4CHU A;  4F3Q A;  1P92 A;  2OJE D;  3GO5 A;  4KT6 A;  2ME0 A;  4XRS G;  1R9T J;  5FJ8 J;  1ETY A;  3SZP A;  2UZK A;  4U7D A;  3HGG A;  4DBR A;  5FKM A;  2BVL A;  1R36 A;  4BUP A;  3RYP A;  3LSR A;  2DCE A;  4EEF G;  1QBJ A;  1ZG1 A;  1QO0 D;  4W1U A;  4LIT A;  3K2Z A;  3I4M J;  2MBF A;  2L9N A;  4R1H A;  2JA7 J;  1HCR A;  4EAT A;  3U2R A;  4XQF A;  2PBI A;  1CQT A;  1V5G A;  5GAE J;  2DLL A;  4MFE A;  1Y8Q B;  3N05 A;  2O0Y A;  2W57 A;  1ZGA A;  2X1E A;  4BQO A;  5H2F C;  4UUT A;  2HYG D;  1IF1 A;  3R6S A;  4JBA A;  4IHW A;  2OTJ I;  2ZME C;  4MIM A;  2VBZ A;  4XSX F;  3JRD A;  1I1S A;  3VOE A;  2M8E A;  2V1N A;  2QSG X;  5C4X J;  1QZY A;  2Q0O A;  2YU3 A;  2CFO A;  5FKN A;  3PUB A;  4P9U A;  4UUV A;  3S14 J;  2FXA A;  4Q48 A;  4BNC A;  2JSC A;  3M3Y J;  5CJ9 A;  1RR8 C;  1XCB A;  3MKY B;  2CO5 A;  4A3C J;  4BBR J;  2CQN A;  3KP3 A;  2VN2 A;  4U0W A;  3HOT A;  3VDX A;  2OPT A;  3BPV A;  3ELK A;  4HX8 A;  4YFK F;  4X0G A;  1BR4 A;  5ICF A;  4PZJ A;  4KYW A;  1BIB A;  5DUK A;  3GF2 A;  3SEZ A;  4DIQ A;  3TW7 A;  1A5J A;  3E5Q A;  4LJZ F;  1WCM J;  3WU2 C;  1YIO A;  2OV7 A;  1WI3 A;  4XK4 A;  1XMA A;  3GFM A;  2PFB A;  5DEQ A;  3BJO A;  2JA8 J;  4AUX A;  2G0E A;  1N77 A;  1YQA A;  1A35 A;  2OCE A;  3CMA I;  2EA2 A;  3I4N J;  4BXX J;  4B8X A;  1YYV A;  1RC9 A;  1ZRC A;  1LUJ B;  3F0C A;  1G3W A;  4PSX A;  2W48 A;  3MKL A;  2BY3 A;  4HLX A;  1LB2 A;  1QVT A;  1Q1V A;  1P6R A;  3FXU A;  1IN4 A;  4R79 A;  4II3 A;  1JKQ C;  5E18 F;  1WGX A;  5LHG A;  1SD4 A;  3DEU A;  3RDI A;  3ZR8 X;  3R61 A;  4AYB N;  2HQN A;  3DKY A;  4BKX A;  4AD9 A;  2IS1 A;  4L9N A;  4M3B A;  1TWA J;  2ELJ A;  2LRD A;  3IAS 2;  1FMW A;  4RB1 A;  3SDG A;  2RQQ A;  1OYW A;  1UG2 A;  4IOA F;  1OLT A;  1EA3 A;  3E0J B;  4HAM A;  5IYB J;  4LLL A;  4M71 A;  2K85 A;  1DGR M;  4GFB A;  2XIG A;  5CYV A;  1W5C C;  3K4C A;  4ZYG A;  5GTI C;  3BG3 A;  5DM6 F;  2A6E F;  3G1O A;  1KYW A;  3V7C A;  2XPV A;  4ABZ A;  3OMY A;  2DA2 A;  2OBP A;  5J8C A;  5DDG A;  2WV0 A;  1FMV A;  3I56 I;  1XPX A;  4S04 A;  4PFP A;  2E2J J;  2ZSI B;  2ZC2 A;  2E34 A;  3QPH A;  1ZN2 A;  5GP9 A;  1OYI A;  1R00 A;  4Y15 A;  3L2Q A;  1O7F A;  3DTK A;  2IS6 A;  2G9W A;  5DTD A;  4AM3 A;  3I53 A;  3Q0U A;  1U5T A;  2HOA A;  1BC8 C;  1FBS A;  1HDP A;  3ZQC A;  5H6Q A;  5J47 A;  1XG1 A;  4HA8 A;  1D0X A;  3FXQ A;  4AVP A;  1FIA A;  1OCR H;  2NS8 A;  4BEH B;  3PQJ A;  2W84 A;  4HW0 A;  3TDZ C;  4H0E A;  4A12 A;  2R7D A;  1HXD A;  4LIU A;  4C9Y A;  4HNU A;  4JP0 A;  4YEL A;  1FNN A;  5LBQ A;  5HS8 A;  3HHH A;  1W36 C;  2O8K A;  2HKO A;  2GXB A;  1ZRF A;  1QU3 A;  2Y0S N;  1YW7 A;  1X1P A;  3ECO A;  5HDN A;  1ULY A;  2Y30 A;  3BC8 A;  3K4M A;  1YIT I;  3ABU A;  3I55 I;  4G7O F;  3JR9 A;  3ABK H;  3FXR A;  1IXS B;  3CP2 A;  1DPR A;  4V2G A;  4OMY A;  2CSO A;  5LD2 C;  1FSH A;  1LDD A;  4KT5 C;  3T0Y A;  4FQG A;  3RIR A;  1N75 A;  5E3M A;  3G1L A;  5JHF A;  2R4G A;  4HLY A;  3HSR A;  2JK3 A;  5C3E J;  3PIP F;  1R4N B;  1E3O C;  2E60 A;  2CW0 F;  1IN6 A;  4K2E A;  3DBR B;  3A0H C;  2H1K A;  3FF5 A;  4D5F A;  3BCB A;  2V1U A;  2P5K A;  3BZC A;  2DFE A;  2O5R A;  3BRO A;  4XRM A;  3QYB A;  2PJP A;  5FLX K;  3E5U A;  4MNU A;  3DU5 A;  3LWF A;  2K9L A;  2IS2 A;  1JTX A;  4IRG A;  3BG9 A;  4PDK A;  3T8T A;  1S7A A;  1S72 I;  5FFZ A;  3Q9V A;  1OR7 A;  1Y6I A;  2W85 A;  2WAQ N;  3V8J A;  1Z21 A;  2RQP A;  3FXK A;  1S3J A;  4EM1 A;  3RKX A;  2IGN A;  2VON A;  3VYR B;  2IS4 A;  1EKE A;  3Q0W A;  3FMS A;  3OYE A;  1F4K A;  4BQN A;  1F36 A;  4MEY F;  1FOX A;  4L5E A;  1FX7 A;  3M07 A;  5JLX A;  3P9K A;  5M5X J;  4LD5 A;  5TRD A;  3SJM A;  4KIS A;  3A01 B;  3P5J A;  1JGS A;  1JUP A;  2ZNZ A;  3F23 A;  1XSD A;  2NVT J;  5E20 A;  4LIV A;  4QPO A;  4WXC A;  2CU7 A;  4UHT A;  4DZP A;  2KDZ A;  1P9Q C;  3L7W A;  1LEA A;  2WTE A;  1J09 A;  4NC6 A;  2HVQ A;  2HXO A;  2EFP A;  2VJI A;  2EFQ A;  2LH9 A;  5E8I A;  4IX7 A;  3AG2 H;  3PM1 A;  4GXO A;  4MTD A;  2R0Q C;  1Z7L A;  1G3T A;  5D8L B;  1H89 C;  2A05 A;  3V42 A;  5LRR A;  2ECC A;  1ZYR F;  3HG9 A;  4BYY A;  2R5Y A;  3ASN H;  2P8T A;  4L9J A;  3KP5 A;  4XN0 A;  1ZKG A;  4HSR A;  2KZG A;  4XR6 A;  3C2G A;  4CXF A;  1Z3X A;  3LFU A;  4XLE A;  3A2K A;  2DA4 A;  3KEQ A;  1MJB A;  2OD5 A;  4L0Y B;  2LD5 A;  2AS5 F;  1Z3Y A;  5IOZ A;  2XSJ C;  5D5W B;  3KET A;  1HOM A;  2F5D A;  2UUZ A;  1BA5 A;  2MSY A;  2QQB A;  2ZBK A;  1ZQ3 P;  3NRV A;  2OQG A;  4RBO A;  1I39 A;  1XD7 A;  2MYS A;  2XAS A;  2BXY A;  2H27 A;  1G4D A;  2AXL A;  2VJ5 A;  1DP3 A;  2JA2 A;  4EM2 A;  1B8I B;  2P6S A;  4ENM A;  2IAI A;  4O6J A;  1AU7 A;  1R5H A;  4UUS B;  1JJ6 C;  2ZXI A;  3K4B A;  4RAZ A;  2L2O A;  2VBX A;  4P9F A;  3C18 A;  2BGC A;  2VQG A;  1OKR A;  1T6S A;  2O7O A;  4IL6 C;  3C3W A;  4E7L A;  3FM3 A;  2XF7 A;  3OOP A;  2E71 A;  4GYI A;  2E7W A;  3CJT B;  3I59 A;  3CCQ I;  3ZN0 A;  2EIJ H;  3KLO A;  4RB2 C;  1PP8 F;  2M7A A;  1X4P A;  2PI0 A;  3HPH A;  1QGP A;  2IEK A;  2V7F A;  2FOK A;  3M1E A;  2H1L A;  4A0X A;  5A2Q Z;  1T33 A;  1GVJ A;  4BY7 J;  1YRN B;  2KP6 A;  2WAF A;  3PO3 J;  1XSX A;  3LA2 A;  4A5M A;  3WTT C;  1FEX A;  2WY7 Q;  1TZL A;  2CH0 A;  1WJF A;  4E6K G;  2IW5 A;  3KP7 A;  3DFG A;  2DQL A;  2IPQ X;  2ZJR F;  2CQQ A;  3MWM A;  5LLQ A;  3KP6 A;  3HC7 A;  2DJI A;  4RGX A;  3HXL A;  3REO A;  4QSH A;  3LSK A;  1T2K A;  2Y0M A;  1JJ8 C;  4BJ6 C;  5DCF A;  4N0B A;  3G3Z A;  4UB6 C;  1MJA A;  3NQO A;  2CUJ A;  5LGN A;  4KMU X;  1Z05 A;  1E3H A;  1L3L A;  2HZT A;  4KIF A;  1WI9 A;  2K02 A;  3IRQ A;  1AKH B;  2DYS H;  4PJM A;  3HRU A;  3HUG A;  3GTJ J;  3QPT A;  2ETH A;  1GV5 A;  3QRF F;  3DF8 A;  2RC4 A;  4O3M A;  3CUQ C;  4AVZ A;  4IKF A;  2X6O A;  4XKW A;  1ZRD A;  1P4W A;  2YX7 A;  5D5V B;  1VQ9 I;  4J00 A;  4U0V A;  1OJL A;  5E3L A;  1OR7 C;  2VL8 A;  2GQQ A;  1IN7 A;  2FOW A;  5LEK A;  4ZTJ A;  3CLQ A;  5IYD J;  3ML6 A;  1P7I A;  2EV6 A;  3FHZ A;  1UMQ A;  2HR3 A;  2M1B A;  2AQE A;  3L2U A;  1B59 A;  4EV0 A;  1UCR A;  1D8J A;  1U2W A;  4XLN F;  2NS7 A;  3FBN B;  3FIW A;  3EUA A;  3CC7 I;  3J7Y J;  2HS5 A;  2EPF A;  1P4X A;  1K6Y A;  2HFH A;  2G7U A;  4CCK A;  2R7Z J;  1MMA A;  1JTY A;  2AHQ A;  3UKG A;  3IRR A;  5KAI C;  1KQ9 A;  3CP8 A;  4C2M J;  3LSM A;  3P9C A;  4C3J J;  4EM0 B;  3SDB A;  1KGS A;  3S3N A;  3CF5 F;  5EJC A;  1YX3 A;  2NXN B;  3VEP A;  4CYC B;  4D5C A;  4IHV A;  3JRE A;  4L0Z B;  2V4J C;  2BVM A;  4GYG A;  2PMU A;  2XGC A;  2F48 A;  1H0M A;  4A0Z A;  5KVR A;  1DDN A;  1D0Y A;  1UHM A;  5BQT A;  4OAZ A;  4KN7 X;  2IJL A;  1HLV A;  2HYF A;  4HV5 A;  4MHG A;  3H92 A;  3RZD J;  3DWL E;  1X1B A;  1SAX A;  3QPL A;  1A6Q A;  1WSU A;  1YS7 A;  1DUX C;  5J8F A;  2L02 A;  3U1K A;  1S6L A;  3A4C A;  2LP0 A;  2WAD A;  2TDX A;  2M45 A;  3WGI A;  1ETQ A;  2F2E A;  3DPL C;  1RKW A;  1E2X A;  1LKX A;  1ZK8 A;  3LQQ A;  3JTG A;  4L18 B;  4X1E A;  1LNW A;  3E6C C;  2VC1 A;  4HNT A;  4RLQ A;  3K1N A;  1IAW A;  4LK1 F;  3BJ6 A;  2XKO A;  4G94 A;  4Y3O A;  3TP0 A;  2ZXW H;  3TL4 X;  1W7P B;  2E1N A;  3CO7 C;  2FJ1 A;  4KIB A;  4U0Y A;  3QPS A;  3GLX A;  3NWT A;  5CVJ A;  2X9D A;  2GA1 A;  1SC7 A;  2H6B A;  3BG7 A;  5B5E C;  4LLN A;  3H3U A;  4BU2 A;  5B1A H;  1IW7 F;  2HNH A;  5FRN A;  2L9V A;  1BIA A;  2PMZ A;  2K9Q A;  2MH9 A;  4UXN A;  2MG4 A;  4PJJ A;  4CYD A;  1TNS A;  3UNG C;  1YO5 C;  3LQR A;  4QLC U;  1R58 A;  1DP7 P;  3LAP A;  5DCM B;  3W2V A;  1EH7 A;  2E2I J;  1SD5 A;  3LOC A;  2ID6 A;  4AWX B;  3ROU A;  3HHG A;  5FKK A;  2V1X A;  2FBK A;  2XAQ A;  3F8M A;  3ZQ7 A;  2K3P A;  3FK6 A;  4RLF A;  1OCO H;  3VYU B;  3BR6 A;  3DCF A;  3M9A A;  1J75 A;  2BZT A;  3NAU A;  5DS9 A;  2F4O B;  1BOA A;  2M2E A;  4CA0 A;  2JUC A;  5ED4 A;  2A5W A;  2RV8 A;  2DBB A;  2KQR A;  4F91 B;  3OYM A;  1YFH A;  3HIF A;  4PFO A;  1QZZ A;  2D2W A;  3ONQ A;  4OIR F;  2NVU B;  1ZH5 A;  2LY9 A;  1NHA A;  3W2A A;  4Q5S F;  3TOA A;  4ESF A;  3WTY C;  1ZGW A;  1G3S A;  1GXQ A;  2P6T A;  1PUF A;  2BYV E;  3K4L A;  4E4H A;  3HTU A;  2QLZ A;  5FRO A;  3J7A Y;  3BQY A;  1YHQ I;  4PGG A;  3S15 J;  4PK4 A;  2QWW A;  1JT0 A;  4L5I A;  3JAM Z;  3BR0 A;  4IRI A;  1MBK A;  3CME I;  4AC0 A;  2PJR B;  3C2H A;  2XAF A;  4XKB A;  2A69 F;  4XLH A;  5EZG A;  2EIM H;  2QYO A;  5CVU A;  1IG7 A;  2XAU A;  1FPQ A;  2GIZ A;  3F8C A;  4WXD A;  2M4K A;  3CCL I;  2CYY A;  1XC5 A;  1HC8 A;  1S7E A;  2LYC A;  1SD6 A;  4JX5 A;  3HM5 A;  4WF2 A;  4RGR A;  1TTY A;  2K9N A;  4JOM A;  3J81 Z;  2R5Z A;  1FOW A;  5F27 A;  4IEJ A;  2V1D A;  1YS6 A;  1I6X A;  1J9I A;  4LB5 A;  2W82 A;  1T39 A;  1ZAO A;  3JRB A;  2KLO A;  3TO7 A;  4WX9 A;  1J7K A;  5AON A;  5BMZ A;  2RDP A;  3K6G A;  4G6T B;  5BS6 A;  1VND A;  2K9S A;  2LG4 A;  4XKC A;  4ZTF A;  2NAZ A;  1R1U A;  2BY0 A;  2NNY A;  2DYR H;  3CD6 I;  1R4M B;  1HF0 A;  2E35 A;  2OC6 A;  2Z2S B;  4NQW A;  3OYK A;  2WB1 A;  4OIN F;  4TV7 A;  5EEH A;  2DT6 A;  3GFI A;  2CRG A;  5L3G A;  1K78 B;  3K4J A;  3RKW A;  1XN7 A;  4RGS A;  5LGT A;  4Z2Y A;  2MD0 A;  1I3A A;  1W7P D;  2BE5 F;  2QKL B;  5J1U A;  3RYR A;  2DDA A;  5IOY A;  4UVB A;  3HB9 A;  4DYQ A;  3DKW A;  5HDK A;  1RRJ A;  3FZV A;  2VC0 A;  4BE2 A;  2FSW A;  2F5E A;  1JXS A;  2CS3 A;  2VBW A;  2VE9 A;  4I2O A;  4NBQ A;  3ULQ B;  1UHS A;  4NNJ A;  3ZQG A;  2AO9 A;  4JQF A;  2DMN A;  2MA3 A;  1V55 H;  3KIO A;  3QU3 A;  2L7F P;  5JI6 A;  3IL2 A;  2F4I A;  1PYV A;  1OIS A;  2OAZ A;  3QOP A;  3NEU A;  4R8H A;  1PP7 U;  4BQQ A;  1FT9 A;  4C3H J;  5HLT A;  2DQR A;  2W4S A;  3DXJ F;  3L00 A;  3OS1 A;  2BEO A;  4A3G J;  4M3G A;  1QNT A;  4HZF A;  4H4K C;  4OIQ F;  2COB A;  4ON0 A;  3OY9 A;  5KK1 A;  3MD2 A;  1BI1 A;  3NWS A;  1RI7 A;  1UEL B;  2XGD A;  1CF7 B;  3T5X A;  4C2T A;  1S5L C;  1T08 B;  3FK7 A;  1B4A A;  3PNT A;  2Y9Y A;  1ZGJ A;  3E6B A;  4N4O B;  4XOR A;  1X1D A;  4D9J A;  5ICC A;  3B02 A;  1YJW I;  3RJP A;  1TWH J;  4Y13 A;  2HOT A;  3CUQ B;  3PUF A;  1WHU A;  1B72 B;  4LMY A;  4IHY A;  3CJR B;  4HNV A;  2L01 A;  2EIN H;  4XRS A;  2VKV A;  1FBQ A;  3D0S A;  1FJL A;  2AXT C;  4WK8 F;  2DOA A;  2J5P A;  5D4R A;  1DU6 A;  1TWC J;  2ZFW A;  3KZZ A;  4LG0 A;  2ZJP F;  2RN7 A;  4DW6 A;  5IYC J;  2DO7 A;  4IRH A;  4BAC A;  1I1G A;  1J2X A;  4EQQ A;  1X58 A;  4BAY A;  3BCA A;  1BW6 A;  1X2N A;  3S1R J;  4DYR A;  1FSE A;  3CCR I;  3I5U A;  3CUO A;  1YJN I;  4DQ2 A;  2UXX A;  1TWG J;  5FKL A;  2FD5 A;  1XTA A;  2DFF A;  2V9K A;  3ZCO A;  3HKZ N;  2HDW A;  3KEO A;  3N4M A;  3LST A;  2EV5 A;  3I54 A;  2VQH A;  1U0J A;  1USS A;  4LB6 B;  3ZQI A;  4M6X A;  1IGN A;  5HNF A;  4FX0 A;  4S05 A;  3M8F A;  4ZYD A;  5TIS C;  2CQX A;  2K4B A;  2XF5 A;  1GVD A;  5D5X B;  3IH3 A;  1RES A;  1HSJ A;  1FOK A;  3MKZ A;  4A5N A;  2MGQ A;  2QSH X;  5M5W J;  2BXZ A;  2ESN A;  4ITV A;  2M0M A;  5EEG A;  2EJR A;  3K70 C;  2GXA A;  3OL3 A;  5TJJ A;  2EQR A;  1YG2 A;  2TCT A;  3KLN A;  4OMZ A;  4XSZ F;  4Z6Y A;  4BJT A;  2HEO A;  2JWT A;  2N8G A;  2R7S A;  1W1W E;  3QQA A;  3GFJ A;  2LKS A;  4QPQ A;  4EJV A;  1EJ9 A;  4HST A;  1SFO J;  4CCJ A;  1MSF C;  4EJT A;  5FD6 A;  1VQL I;  2YSR A;  3OYD A;  3BG6 A;  4IVN A;  3P7N A;  4L9V A;  4ZC3 A;  2XVC A;  3HGY A;  2ZNY A;  1AHD P;  3BLY A;  3EYY A;  1K6O A;  1IDY A;  1SAN A;  1HST A;  3EQL F;  4IOC F;  1XDS A;  3ESW B;  3FIS A;  4M9X A;  3ZP5 A;  3KX2 A;  5DUI A;  1Z7U A;  1KQ8 A;  3WOD F;  2KJC A;  2WBM A;  3IWF A;  3LA3 A;  1D1B A;  1Y39 A;  4HOB A;  2ACJ A;  2Q2E A;  1LPQ A;  3CLO A;  3F8F A;  4ZDP A;  3OYC A;  3CJN A;  2K4J A;  3I59 B;  3PIO F;  4BQA A;  1ETK A;  3ZQQ A;  2IGO A;  2H8R A;  2VOP A;  5CKT A;  1F5T A;  2ZFU A;  1G6N A;  2CV0 A;  1K79 A;  3M8E A;  3CES A;  3T1B A;  3ZMU A;  4F55 A;  1APL C;  1MMG A;  3WE2 A;  4A2U A;  1M1E B;  1NH3 A;  3HRT A;  2M0C A;  1XS9 A;  1C0W A;  1ITY A;  1SVL A;  5GAD J;  5E3O A;  2E1M C;  2HWV A;  1KU7 A;  1D1A A;  4OU0 A;  3BPX A;  3JCU C;  3LSG A;  1SMT A;  2B7E A;  5CQG A;  3D5R C;  3GZ5 A;  3BOQ A;  4UNO A;  3V8L A;  1DQU A;  1ETX A;  1X3U A;  3H35 A;  4IXA A;  1MKM A;  2ELH A;  1GUU A;  1U8R A;  4OIO F;  2IGK A;  3S3O A;  5K5O A;  3RKY A;  1TBX A;  1BL0 A;  1T0F A;  1MGT A;  4NDL A;  5J40 A;  5FB2 A;  4G9Y A;  4CZC A;  1YIJ I;  2XV4 S;  1HKQ A;  2IXS A;  3I64 A;  2VJJ A;  2KFD A;  2P5L C;  3OYJ A;  4JYK A;  4GDF A;  2A61 A;  1OCP A;  1B1B A;  2LNB A;  3BP8 A;  2FF4 A;  4HX4 A;  2OZU A;  5AIP A;  5J4V A;  5HOO A;  3KP2 A;  4PJN A;  4BDY A;  2EFO A;  2R7F A;  1X3Z B;  5F1J A;  2VKH A;  3CCY A;  2NNN A;  2O9L A;  1Y1W J;  4M3D A;  2K5C A;  1FYK A;  3A1Y A;  4A3M J;  4P55 A;  3F6V A;  2LOO A;  1R22 A;  5LEJ A;  1HDD C;  4Q4Z F;  1TL8 A;  1MBF A;  3HOY J;  3RSN A;  3EET A;  4BHB A;  2Z5U A;  2X6Y A;  3ZQF A;  3OYG A;  2UXN A;  2PG4 A;  1WJB A;  3PSI A;  5KCM A;  5H20 A;  2GAU A;  2P4W A;  3SYT A;  3S2H J;  2W25 A;  3E6D A;  4IQ4 A;  2A07 F;  2XAH A;  1FYL A;  5L3D A;  1MMN A;  1MDM A;  3BG5 A;  5DM7 F;  1X1A A;  3QOE A;  1SFX A;  2GM4 A;  2EK5 A;  2V9P A;  3CCJ I;  4JX6 A;  2P5V A;  4GCV A;  1D1C A;  3S8P A;  4PJL A;  1P4A A;  4N9H A;  4KUM A;  1W5T A;  4XID A;  4HDV A;  1IJW C;  4CCM A;  5E79 C;  3GX4 X;  3MCZ A;  1QA6 A;  3IH2 A;  3HTS B;  2HU9 A;  2Z16 A;  2BV6 A;  3NAR A;  4CCN A;  3TED A;  3VYT B;  4FHT A;  4U88 A;  2PMH A;  3TDU C;  3RZO J;  2JJ7 A;  2X51 A;  2EA4 A;  1T95 A;  1E17 A;  1IO2 A;  2JQ7 A;  3MN2 A;  1VQK I;  1VQ8 I;  4UVC A;  2XKP A;  3VFZ A;  2LDU A;  1TQI A;  2F4M B;  3OYF A;  2Z33 A;  4YII A;  4I02 A;  1Y1V J;  2COM A;  1O4X A;  1YX5 A;  1U3E M;  4FT8 A;  1FWZ A;  2W1O A;  2Y69 H;  3FHN A;  4B48 A;  3Q0V A;  2D1H A;  4NB5 A;  4HX7 A;  4W97 A;  5FLM J;  2VUM J;  5ILU A;  2HQ5 A;  1K7A A;  2DA1 A;  3P9I A;  3GTO J;  3DV8 A;  3A03 A;  3HOS A;  3CCU I;  4HF0 A;  4KIT B;  1QVU A;  4BJ5 C;  2H8W A;  3UR3 C;  2DT7 B;  5EZH A;  3GFL A;  3R0J A;  2P7C B;  5BPI A;  2R93 J;  3MZH A;  4QWQ A;  2L7Z A;  2VJ4 A;  1IRZ A;  1QPM A;  5J1Y A;  2QSF X;  4FE7 A;  1ON2 A;  1U5T C;  2FBH A;  1E3P A;  2HXI A;  3BTC A;  4XIC A;  3PL8 A;  3O8G A;  2R7V A;  2ZME B;  5GPC A;  4DGW B;  5IT9 Z;  1LDK B;  4IJA A;  2GLO A;  3R0A A;  5ICG A;  2IGM A;  2MH2 A;  3K9T A;  2L9R A;  2LKP A;  3TOB A;  3OYH A;  1REP C;  2I8D A;  1Z77 A;  4BEH A;  5LHI A;  5EGO B;  1GHC A;  1IXR C;  1MBG A;  2JPC A;  4II2 A;  3WTU C;  3GXO A;  1Z1D A;  1FTZ A;  1BJA A;  1IZ1 A;  3FXO A;  4BE1 A;  1ZEL A;  5E1Z B;  4DZJ A;  2QVO A;  3OS0 A;  4G6D A;  3OYN A;  2GWR A;  3DBL B;  1ZR2 A;  2Y75 A;  3H5R A;  2UV1 A;  3MZY A;  2HTJ A;  1FYM A;  2MLG A;  1SMY F;  2JRM A;  3ZXS A;  3AAF A;  1T38 A;  1K4S A;  2JA5 J;  2PX9 A;  2X48 A;  2QM3 A;  4IHX A;  4B4C A;  4Y4R A;  1VQP I;  3S32 A;  1FY7 A;  4A3J J;  1TW3 A;  1ZLJ A;  3A02 A;  2BW3 B;  2QQA A;  3H0G J;  2DMP A;  1B6A A;  2M34 A;  3DLL F;  1PUF B;  3L1P A;  3BJA A;  2LKX A;  1RET A;  3EUK L;  5HLG A;  5A2Q K;  3VSK A;  2IT0 A;  2KJB A;  1OCZ H;  4OWR B;  3ZQH A;  2PN6 A;  1GDT A;  1VTN C;  4RB3 C;  1U78 A;  3K0L A;  4IPA A;  2JT1 A;  2VB6 A;  3KPH A;  4CCL A;  1O3S A;  1H8A C;  4CZZ A;  2UWM A;  1ON1 A;  3ASO H;  3TW6 A;  1KU9 A;  4KDP A;  5D5U B;  4CIC A;  1H9T A;  3K7A J;  2NVX J;  2L7K A;  4M6V A;  2VT2 A;  2EB7 A;  2CUZ A;  2EV0 A;  4YIF A;  1ZG5 A;  5JHU A;  2YX4 A;  1RPW A;  3SXY A;  3KP4 A;  3S2W A;  2QGU A;  3ZN1 A;  3JRG A;  2ZXH A;  2STT A;  1ZG3 A;  1LE8 B;  2VE8 A;  5KHD A;  2NVQ J;  4ESJ A;  2MAB A;  5EG0 A;  4Y33 A;  1KQ0 A;  2DMQ A;  1UG0 A;  3DU6 A;  2O3F A;  4EGY A;  1VF9 A;  2M4G A;  1MNM C;  3MEX A;  3TP3 A;  4KMF A;  2O8X A;  1NTC A;  3A01 A;  3PSF A;  1MBJ A;  1YOV B;  3GTG J;  2DT5 A;  1RIO H;  4RAF A;  2QBY B;  3LSJ A;  2CFX A;  1IV8 A;  2CMP A;  1ZRE A;  3OR2 C;  4RM3 A;  5J6X A;  1OPC A;  4YFX F;  2PEX A;  3M4O J;  2JZY A;  2BY2 A;  2VIX A;  3GYH X;  3U9G A;  1UJ8 A;  3OSF A;  1T8I A;  2KIM A;  1R6R A;  1MZB A;  3JRF A;  3AG1 H;  1SFU A;  2O03 A;  5C4J J;  1PDN C;  1XGO A;  2EIL H;  1R49 A;  1I27 A;  2ESH A;  4U7B A;  4M6Y A;  1MH4 A;  5HS7 A;  2E1M B;  4GGG A;  3ISP A;  1LFU P;  3GW2 A;  1Z67 A;  4XLA A;  4V19 K;  2DI3 A;  3BR2 A;  4M74 A;  5KNL A;  2HPM A;  2Q8K A;  2XDV A;  3KZI C;  4XLF A;  1J5Y A;  4CCO A;  2MC3 A;  2OCC H;  2KRH A;  2L9S A;  4I98 B;  1HW5 A;  3MMY B;  4RM2 A;  3MFK A;  1VQ5 I;  4P1W A;  5DD8 A;  1B8I A;  1WVR A;  2J5O A;  3I58 A;  3AL0 C;  3LFK A;  4KNY A;  1EF4 A;  2NOG A;  3O3K A;  4UUS A;  2XAJ A;  1MJ9 A;  2MC4 A;  1FP1 D;  4MFD A;  1VI0 A;  1JE8 A;  3L09 A;  1XGM A;  2E2H J;  3W6K B;  3ECH A;  1IN5 A;  4FAS D;  4YRV A;  2LY2 A;  2VKE A;  4WWC A;  4CGZ A;  2R7O A;  2V6E A;  1TW2 A;  2L54 A;  4HV6 A;  5BOX A;  1ORK A;  1UB9 A;  1AA7 A;  3R60 A;  4GRI A;  4XNF A;  5H6R A;  3CCV I;  2RKH A;  4RAG A;  1IUF A;  1ZHF A;  4G7H F;  3SHF A;  2X85 A;  4I7H A;  3GTP J;  1UHW A;  2F5V A;  2VKD A;  5B1B H;  4A3F J;  3FXM A;  1D0Z A;  2BBY A;  4LK0 F;  2E1O A;  4BXU A;  1KYZ A;  3C1D A;  3BQZ A;  2E7X A;  2LBF A;  1P7J A;  2EFW A;  3OYI A;  2F5F A;  3DTI A;  4PGH A;  2Y9Z A;  3VB2 A;  1YRN A;  5M3M J;  3U21 A;  2HGC A;  1TNT A;  3L9F A;  5GPA A;  2VLA A;  5LFA A;  3WG9 A;  1QRY A;  3HEF A;  3IP4 B;  1VZ0 A;  4MLO A;  5JR3 A;  4ZYA A;  2XUB A;  3QAH A;  2IRF G;  3ZMZ A;  3BY6 A;  3OYA A;  2HVR A;  2HOE A;  1I50 J;  3RI4 A;  1CGP A;  2KPM A;  3E5X A;  3S1M J;  2GOX B;  5E8G A;  5FLV A;  3TMO A;  5HLI A;  1HQC A;  4FX4 A;  5F0F A;  4B43 A;  3O6B B;  2ZJQ F;  2HZD A;  3HL2 A;  1JUM A;  2V9V A;  1YI2 I;  3I9V 2;  2ZO4 A;  1AKH A;  2TRT A;  2LC2 A;  1WJC A;  4HQE A;  2HYJ A;  5L3E A;  4B09 A;  2H6C A;  3E6M A;  1SVO A;  2DMU A;  2HTS A;  4AYB A;  3K4K A;  1P2F A;  1TT0 A;  1G3Y A;  1BM9 A;  2ZJ2 A;  2R7Q A;  2Z1D A;  3RPQ A;  2XSD C;  1XX5 A;  2RNG A;  1HW1 A;  3A0B C;  4N4N B;  1N25 A;  1W36 D;  3M7G A;  2R7W A;  3BDD A;  3KYC B;  4XMY A;  3GLL A;  3RPU D; 
#chains in the Genus database with same CATH homology
 3J80 Z;  5BPD A;  2MLK A;  2OU2 A;  4I0B A;  2DK5 A;  3JAM K;  4ZH4 F;  3WU0 A;  1FZP B;  4L9T A;  2CG4 A;  3DP7 A;  3ERE D;  2LSO A;  1U5T B;  1F1Z A;  4XRF A;  1WKM A;  1S29 A;  4IF4 A;  1EV7 A;  2XGX A;  1SD7 A;  3WTZ A;  1SFE A;  4MGR A;  3J81 K;  1W4M A;  5F6F A;  2NYX A;  5K5Q A;  2M87 A;  3WTX C;  5HVQ C;  4A6E A;  4EGZ A;  1R7J A;  2GIV A;  1BI2 A;  5D4S A;  4M72 A;  4ENN A;  5ERI A;  1O3R A;  1I5Z A;  2HDC A;  4O5V A;  2M5W A;  4RS8 A;  4ASN A;  1W7P A;  5LRS A;  2RGV A;  2K86 A;  2DK8 A;  2KRF A;  4M73 A;  2GXG A;  4YG2 F;  1FBU A;  5L3B A;  1W5S A;  3ZMS A;  3BZ6 A;  1S7O A;  1BC7 C;  5CLS A;  3F8B A;  2ADU A;  1RZ4 A;  5DCM A;  2YR2 A;  2FE3 A;  3U1D A;  2IA2 A;  1O3Q A;  4OOI A;  4LLG F;  5LHH A;  3WTW C;  2EFN A;  3PQK A;  3SQN A;  1MDM B;  2Z99 A;  2JPB A;  3C7J A;  4Q47 A;  1XMK A;  4N9I A;  1FLI A;  2F5C A;  2KIU A;  1J59 A;  5FGM A;  5ICE A;  4YFN F;  3JTH A;  2Y48 A;  1WQ2 A;  4BHC A;  4A6D A;  2QEN A;  2B0L A;  1ZLK A;  3LAJ A;  2JTV A;  3E3V A;  5CVR A;  3DQV C;  1D8K A;  4EMS A;  1MD0 A;  4RGU A;  4ZYE A;  4RB0 A;  3V8K A;  2A5Y B;  3JW4 A;  4GO1 A;  1V4R A;  5DV5 A;  5L3C A;  4AIK A;  1XB4 A;  5K1Y A;  4HQM A;  4ZZL A;  1IXC A;  2A6H F;  2PQ8 A;  2L4A A;  1KU3 A;  2ZCW A;  2Z3Y A;  4KIG A;  3V7R A;  1K78 A;  1XGN A;  4PCQ A;  1RUN A;  3GUD A;  4LFU A;  2FEZ A;  3IKV A;  2P7V B;  3EYI A;  4JK1 X;  3CO6 C;  2XAG A;  5FLX Z;  3EUH A;  2ZKZ A;  5E1X A;  4G6Q A;  2FML A;  3ZMV A;  1IUY A;  1TQP A;  1OMI A;  1IRG A;  2FNA A;  3GVA A;  3FMQ A;  1ODD A;  2FA5 A;  2WC2 A;  2L4M A;  2FRH A;  2IA0 A;  3LA7 A;  4Y17 A;  1CF7 A;  4MQV A;  4ETS A;  3WGG A;  2A3S A;  3BWG A;  4DNC A;  1L0O C;  1FC3 A;  4I0A A;  3GZ6 A;  1LVA A;  3CUQ A;  2HQR A;  3FWE A;  3F8N A;  4OIP F;  4KA4 A;  4G8X A;  2VOO A;  1T98 A;  5E17 F;  1LEB A;  1IN8 A;  3Q9S A;  4MQ9 F;  3SZT A;  3DPT A;  5HS9 A;  3FX3 A;  1J0R A;  2XHK A;  2HKX A;  3G73 A;  2PLY A;  3QU6 A;  3GWZ A;  3F3X A;  2QUF A;  3V4G A;  4XBF A;  3IKT A;  4HBL A;  4CDG A;  1O7L A;  3V7S A;  3Q5F A;  1HKT A;  2VBY A;  1AOY A;  2RNJ A;  3HRS A;  3VOD A;  3ABT A;  2ZXJ A;  3T8R A;  2ISY A;  2GZW A;  5E1W A;  3QP5 A;  1KA8 A;  3W6J B;  2E1C A;  2X0L A;  2D45 A;  5ILS A;  4IHS A;  2KIF A;  4M9S A;  3JSO A;  1Q1H A;  1HKS A;  1O57 A;  2DW4 A;  2K27 A;  1R23 A;  1LQ1 A;  2D1V A;  1XDU A;  1Z9C A;  3N97 A;  1WRJ A;  1ZAR A;  4EJW A;  4WXH A;  5D6F A;  1S8N A;  1TLH B;  2OA4 A;  4EVI A;  3SFZ A;  5L3F A;  3H3Z A;  1BI0 A;  2FBI A;  3KCC A;  2FNP A;  1HW2 A;  2V79 A;  4EJU A;  3ZMT A;  5JVT A;  1QQI A;  5D6E A;  1A04 A;  3KFW X;  4AIH A;  3WTV C;  2KKO A;  4MTE A;  1XCV A;  5IT9 K;  2EWN A;  2FQ3 A;  3WGH A;  2FU4 A;  3TKY A;  3TGN A;  1HBX G;  1B9M A;  4NHJ A;  5CVV A;  2FMY A;  4RAY A;  3QP6 A;  2O61 A;  1LJ9 A;  4KN4 X;  1Z91 A;  3HRM A;  3IWZ A;  2X4H A;  3K69 A;  5K5R A;  1WWX A;  2R3S A;  2CWE A;  2G7H A;  1O3T A;  5JFR A;  4AIJ A;  3J7A O;  1Z6T A;  3OV8 A;  1BN5 A;  5FD5 A;  3JSP A;  2IP2 A;  2QQ9 A;  2W24 A;  3O2P E;  4HF2 A;  2VOD A;  4P5O A;  4IHT A;  2IA1 A;  4I01 A;  1RUO A;  4ENJ A;  2MD5 A;  1KU2 A;  1EH8 A;  1TQM A;  4G7Z F;  2QZ8 A;  4F7Z A;  1V3F A;  3I4P A;  2YPR A;  3I71 A;  3I0T A;  2LF8 A;  2DPU A;  4M9Z A;  4XLP F;  4BHP A;  2DU9 A;  1Y0U A;  1F9N A;  3WTS C;  4UVA A;  3MAJ A;  3KZY A;  3F6O A;  4L5J A;  1PUE E;  3IC7 A;  1U6G A;  4ZZD A;  3R4K A;  2RVC A;  4ESB A;  3TQN A;  1DPU A;  4I09 A;  2C6Y A;  4HDU A;  3B73 A;  3TO9 A;  3ZPL A;  2Z9O A;  5DD4 A;  5HLH A;  1YLF A;  3PFI A;  5DYM A;  3F22 A;  1FP2 A;  2ZME A;  2ISZ A;  3CTA A;  1RNL A;  2DPD A;  1R1V A;  2VXZ A;  2CGP A;  2DAO A;  1YW9 A;  5FFX A;  4LG0 B;  3CDH A;  2WWY A;  2H09 A;  3F21 A;  4CO8 A;  2XRN A;  2OQR A;  5F64 A;  1EH6 A;  1YW8 A;  2GA2 A;  3HYI A;  4KIC A;  1BBY A;  2LF7 A;  5IT3 A;  2NS0 A;  3WE3 A;  4WCG A;  2L3D A;  2NRA C;  1D5V A;  3F72 A;  3K1M A;  4D0P A;  1UST A;  4LGW A;  2XRO A;  1AWC A;  2CQK A;  5AIQ A;  3RTR A;  4P96 A;  2O6G E;  4ENK A;  1R1T A;  4E70 A;  3FM5 A;  2JRT A;  4HF1 A;  2M30 A;  3D5L A;  1YTY A;  3TO6 A;  5F1R A;  5CVI A;  1H9G A;  3MQ0 A;  1STZ A;  3L2C A;  3IHU A;  2V6C A;  3HSF A;  3WU1 B;  1JHF A;  3ZMD A;  3COA C;  5D8K B;  2A68 F;  1XSV A;  3KE2 A;  1OYY A;  4KFC A;  1LDJ A;  1R5G A;  2DFI A;  3HSE A;  2QBY A;  1UFM A;  3EDP A;  2VT3 A;  5LGU A;  1D3Y A;  4A0Y A;  1JHH A;  4BH9 A;  6PAX A;  1IRF A;  1XGS A;  5HDG A;  4ZYH A;  4UV9 A;  2IVM A;  2DTR A;  3K1P A;  5ILV A;  3E97 A;  3RPU A;  2OZ6 A;  4EJO A;  3J80 K;  5FO5 A;  1ONV A;  1GXP A;  1Z6R A;  3GEZ A;  2STW A;  2K7L A;  4UV8 A;  4MEX F;  3FMR A;  1B9N A;  2H94 A;  4HYE A;  1BI3 A;  4CHU A;  1P92 A;  3GO5 A;  3SZP A;  2UZK A;  4U7D A;  1R36 A;  3RYP A;  1QBJ A;  1ZG1 A;  1QO0 D;  3K2Z A;  2MBF A;  4R1H A;  3U2R A;  2PBI A;  2DLL A;  2O0Y A;  2W57 A;  1ZGA A;  2HYG D;  1IF1 A;  3R6S A;  4JBA A;  4XSX F;  2VBZ A;  1I1S A;  3VOE A;  2M8E A;  1QZY A;  2Q0O A;  2YU3 A;  4P9U A;  4UUV A;  2FXA A;  4Q48 A;  4BNC A;  2JSC A;  5CJ9 A;  1XCB A;  2CO5 A;  3KP3 A;  2VN2 A;  4U0W A;  3HOT A;  3BPV A;  3ELK A;  4HX8 A;  4YFK F;  5ICF A;  4PZJ A;  4KYW A;  1BIB A;  5DUK A;  3GF2 A;  3E5Q A;  4LJZ F;  1YIO A;  1XMA A;  3GFM A;  2PFB A;  5DEQ A;  3BJO A;  1YQA A;  2EA2 A;  4B8X A;  1YYV A;  1ZRC A;  1G3W A;  4HLX A;  1LB2 A;  1P6R A;  3FXU A;  1IN4 A;  4R79 A;  5E18 F;  5LHG A;  1SD4 A;  3DEU A;  3RDI A;  3R61 A;  2HQN A;  4AD9 A;  4L9N A;  4RB1 A;  1OYW A;  4HAM A;  4LLL A;  4M71 A;  2XIG A;  5CYV A;  4ZYG A;  2A6E F;  3V7C A;  1KYW A;  2OBP A;  5J8C A;  5DDG A;  2WV0 A;  4S04 A;  3QPH A;  1ZN2 A;  1OYI A;  1R00 A;  4Y15 A;  1O7F A;  2G9W A;  3I53 A;  1U5T A;  1BC8 C;  1FBS A;  5H6Q A;  4HA8 A;  3FXQ A;  4AVP A;  3PQJ A;  2W84 A;  4HW0 A;  3TDZ C;  4A12 A;  4H0E A;  2R7D A;  1HXD A;  1FNN A;  5LBQ A;  5HS8 A;  3HHH A;  2HKO A;  2GXB A;  1ZRF A;  1YW7 A;  3ECO A;  5HDN A;  1ULY A;  3ABU A;  4G7O F;  3FXR A;  1IXS B;  1DPR A;  4OMY A;  2CSO A;  1FSH A;  1LDD A;  4KT5 C;  3T0Y A;  3RIR A;  4HLY A;  3HSR A;  2CW0 F;  1IN6 A;  4K2E A;  3FF5 A;  2V1U A;  2P5K A;  3BRO A;  2PJP A;  5FLX K;  3E5U A;  4MNU A;  3LWF A;  4IRG A;  4PDK A;  3T8T A;  1S7A A;  5FFZ A;  3Q9V A;  1OR7 A;  2W85 A;  3V8J A;  2RQP A;  1S3J A;  4EM1 A;  3RKX A;  2VON A;  1F4K A;  3FMS A;  4MEY F;  1FX7 A;  3P9K A;  4LD5 A;  5TRD A;  1JGS A;  2ZNZ A;  3F23 A;  1XSD A;  5E20 A;  4WXC A;  4UHT A;  3L7W A;  1LEA A;  2WTE A;  2EFP A;  2EFQ A;  5E8I A;  4GXO A;  4MTD A;  5D8L B;  1G3T A;  5LRR A;  4BYY A;  1ZYR F;  2P8T A;  4L9J A;  3KP5 A;  4CXF A;  3KEQ A;  1MJB A;  2OD5 A;  4L0Y B;  2AS5 F;  5D5W B;  3KET A;  2F5D A;  2QQB A;  2ZBK A;  3NRV A;  2OQG A;  1XD7 A;  2XAS A;  2H27 A;  1G4D A;  2AXL A;  4EM2 A;  2P6S A;  4ENM A;  4O6J A;  1R5H A;  4RAZ A;  2VBX A;  4P9F A;  3C18 A;  2BGC A;  1OKR A;  1T6S A;  3C3W A;  3FM3 A;  3OOP A;  4GYI A;  2E7W A;  3I59 A;  3ZN0 A;  3KLO A;  4RB2 C;  1PP8 F;  2PI0 A;  1QGP A;  3M1E A;  2FOK A;  4A0X A;  5A2Q Z;  1GVJ A;  1XSX A;  3LA2 A;  4A5M A;  3WTT C;  2IW5 A;  3KP7 A;  3DFG A;  2DQL A;  2IPQ X;  3MWM A;  5LLQ A;  3KP6 A;  4RGX A;  3REO A;  1T2K A;  2Y0M A;  5DCF A;  4N0B A;  3G3Z A;  1MJA A;  3NQO A;  5LGN A;  4KMU X;  1Z05 A;  1L3L A;  2HZT A;  4KIF A;  1WI9 A;  2K02 A;  3IRQ A;  3HRU A;  3HUG A;  3QPT A;  2ETH A;  3QRF F;  3DF8 A;  2RC4 A;  4O3M A;  3CUQ C;  1ZRD A;  1P4W A;  2YX7 A;  5D5V B;  4U0V A;  2GQQ A;  1IN7 A;  5LEK A;  3ML6 A;  2EV6 A;  3FHZ A;  2HR3 A;  2M1B A;  1B59 A;  4EV0 A;  1UCR A;  1D8J A;  1U2W A;  4XLN F;  2HS5 A;  1P4X A;  2HFH A;  2G7U A;  3IRR A;  1KQ9 A;  3P9C A;  4EM0 B;  1KGS A;  3VEP A;  4L0Z B;  4GYG A;  2PMU A;  1H0M A;  4A0Z A;  5KVR A;  1DDN A;  1UHM A;  5BQT A;  4KN7 X;  2IJL A;  2HYF A;  4HV5 A;  4MHG A;  3H92 A;  1SAX A;  1WSU A;  1YS7 A;  1DUX C;  5J8F A;  2L02 A;  1S6L A;  2TDX A;  2M45 A;  3WGI A;  2F2E A;  3DPL C;  1E2X A;  3LQQ A;  3JTG A;  4L18 B;  1LNW A;  3E6C C;  2VC1 A;  3K1N A;  1IAW A;  4LK1 F;  3BJ6 A;  2XKO A;  4G94 A;  1W7P B;  2E1N A;  3CO7 C;  4KIB A;  4U0Y A;  3GLX A;  5CVJ A;  2GA1 A;  2H6B A;  4LLN A;  3H3U A;  1IW7 F;  1BIA A;  2MH9 A;  4UXN A;  4CYD A;  1TNS A;  1YO5 C;  3LQR A;  4QLC U;  1R58 A;  1DP7 P;  3LAP A;  5DCM B;  1EH7 A;  1SD5 A;  4AWX B;  3ROU A;  3HHG A;  2V1X A;  2FBK A;  2XAQ A;  3F8M A;  3ZQ7 A;  1J75 A;  3M9A A;  1BOA A;  5ED4 A;  2RV8 A;  2DBB A;  1YFH A;  3HIF A;  1QZZ A;  2D2W A;  4OIR F;  1ZH5 A;  4Q5S F;  1NHA A;  3TOA A;  4ESF A;  3WTY C;  1G3S A;  1GXQ A;  2P6T A;  2BYV E;  3HTU A;  2QLZ A;  4PGG A;  2QWW A;  4L5I A;  3JAM Z;  4IRI A;  2XAF A;  2A69 F;  2QYO A;  5CVU A;  1FPQ A;  4WXD A;  3F8C A;  2CYY A;  1SD6 A;  4WF2 A;  4RGR A;  1TTY A;  3J81 Z;  2V1D A;  1YS6 A;  1I6X A;  1J9I A;  4LB5 A;  1T39 A;  1ZAO A;  3TO7 A;  4WX9 A;  1J7K A;  5AON A;  5BMZ A;  2RDP A;  5BS6 A;  2NAZ A;  1R1U A;  2NNY A;  4NQW A;  4OIN F;  4TV7 A;  5EEH A;  3GFI A;  5L3G A;  1K78 B;  3RKW A;  1XN7 A;  4RGS A;  5LGT A;  4Z2Y A;  1W7P D;  2BE5 F;  3RYR A;  4UVB A;  3DKW A;  5HDK A;  3FZV A;  2VC0 A;  2FSW A;  2F5E A;  1JXS A;  2VBW A;  2VE9 A;  4I2O A;  3ULQ B;  4JQF A;  2MA3 A;  3QU3 A;  5JI6 A;  3IL2 A;  2OAZ A;  3QOP A;  3NEU A;  4R8H A;  1PP7 U;  1FT9 A;  2DQR A;  3DXJ F;  3L00 A;  2BEO A;  1QNT A;  4HZF A;  4OIQ F;  4ON0 A;  5KK1 A;  1BI1 A;  1RI7 A;  1CF7 B;  3T5X A;  1B4A A;  1ZGJ A;  3E6B A;  5ICC A;  3B02 A;  3RJP A;  4Y13 A;  3CUQ B;  4LMY A;  2L01 A;  1FBQ A;  3D0S A;  4WK8 F;  2J5P A;  5D4R A;  2ZFW A;  3KZZ A;  4LG0 A;  2RN7 A;  2DO7 A;  4IRH A;  1I1G A;  1J2X A;  4EQQ A;  4BAY A;  1FSE A;  3I5U A;  3CUO A;  4DQ2 A;  2UXX A;  3KEO A;  3N4M A;  3LST A;  2EV5 A;  3I54 A;  1USS A;  4LB6 B;  4M6X A;  4FX0 A;  4S05 A;  3M8F A;  4ZYD A;  2K4B A;  5D5X B;  1HSJ A;  1FOK A;  4A5N A;  2ESN A;  5EEG A;  2EJR A;  5TJJ A;  1YG2 A;  3KLN A;  4OMZ A;  4XSZ F;  2HEO A;  3GFJ A;  4EJV A;  4EJT A;  5FD6 A;  2YSR A;  4IVN A;  3P7N A;  4L9V A;  2XVC A;  2ZNY A;  3EYY A;  1K6O A;  1HST A;  3EQL F;  1XDS A;  4M9X A;  3ZP5 A;  5DUI A;  1Z7U A;  1KQ8 A;  3WOD F;  2KJC A;  3IWF A;  3LA3 A;  4HOB A;  2ACJ A;  2Q2E A;  3CLO A;  3F8F A;  3CJN A;  2K4J A;  3I59 B;  4BQA A;  2VOP A;  1F5T A;  1G6N A;  1K79 A;  3M8E A;  3T1B A;  3ZMU A;  3WE2 A;  4A2U A;  3HRT A;  1C0W A;  2HWV A;  1KU7 A;  4OU0 A;  3BPX A;  1SMT A;  3GZ5 A;  3BOQ A;  4UNO A;  3V8L A;  1X3U A;  4IXA A;  1MKM A;  2ELH A;  1U8R A;  4OIO F;  5K5O A;  3RKY A;  1TBX A;  1T0F A;  1MGT A;  5FB2 A;  4G9Y A;  2XV4 S;  1HKQ A;  3I64 A;  2P5L C;  2A61 A;  1B1B A;  2LNB A;  3BP8 A;  2FF4 A;  4HX4 A;  2OZU A;  5AIP A;  5HOO A;  3KP2 A;  2EFO A;  2R7F A;  2NNN A;  1FYK A;  4P55 A;  3F6V A;  1R22 A;  5LEJ A;  4Q4Z F;  3EET A;  4BHB A;  2Z5U A;  2UXN A;  2PG4 A;  5H20 A;  2GAU A;  2P4W A;  2W25 A;  3E6D A;  2A07 F;  2XAH A;  1FYL A;  5L3D A;  1MDM A;  1SFX A;  2EK5 A;  2P5V A;  4GCV A;  1P4A A;  4N9H A;  4KUM A;  1W5T A;  4HDV A;  3GX4 X;  3MCZ A;  3HTS B;  2BV6 A;  4FHT A;  4U88 A;  2PMH A;  3TDU C;  2EA4 A;  1E17 A;  4UVC A;  2XKP A;  3VFZ A;  2LDU A;  1TQI A;  2Z33 A;  4YII A;  4I02 A;  2COM A;  1U3E M;  4FT8 A;  1FWZ A;  2D1H A;  4NB5 A;  4HX7 A;  5ILU A;  1K7A A;  3P9I A;  3DV8 A;  3HOS A;  4HF0 A;  3GFL A;  3R0J A;  2P7C B;  5BPI A;  3MZH A;  4QWQ A;  1QPM A;  1ON2 A;  1U5T C;  2FBH A;  2ZME B;  5IT9 Z;  1LDK B;  4IJA A;  3R0A A;  5ICG A;  2MH2 A;  3TOB A;  3K9T A;  2LKP A;  1REP C;  1GHC A;  5LHI A;  1IXR C;  2JPC A;  3WTU C;  3GXO A;  1Z1D A;  1BJA A;  1IZ1 A;  5E1Z B;  2QVO A;  4G6D A;  2GWR A;  2Y75 A;  3MZY A;  2HTJ A;  1FYM A;  2MLG A;  1SMY F;  3AAF A;  1T38 A;  2QM3 A;  1FY7 A;  1TW3 A;  1ZLJ A;  2QQA A;  1B6A A;  3BJA A;  5HLG A;  5A2Q K;  2IT0 A;  2KJB A;  2PN6 A;  1VTN C;  4RB3 C;  1U78 A;  3K0L A;  4IPA A;  2JT1 A;  1O3S A;  4CZZ A;  2UWM A;  1ON1 A;  1KU9 A;  4KDP A;  5D5U B;  4CIC A;  1H9T A;  2VT2 A;  2EB7 A;  2EV0 A;  4YIF A;  1ZG5 A;  5JHU A;  2YX4 A;  3SXY A;  3KP4 A;  3S2W A;  3ZN1 A;  2STT A;  1ZG3 A;  2VE8 A;  4ESJ A;  1KQ0 A;  2O3F A;  4EGY A;  3MEX A;  4KMF A;  2O8X A;  2DT5 A;  1RIO H;  2QBY B;  2CFX A;  1ZRE A;  5J6X A;  1OPC A;  4YFX F;  2PEX A;  2JZY A;  3GYH X;  3U9G A;  2KIM A;  1MZB A;  1SFU A;  2O03 A;  1PDN C;  1XGO A;  1I27 A;  2ESH A;  4U7B A;  4M6Y A;  5HS7 A;  4GGG A;  3ISP A;  3GW2 A;  2DI3 A;  4M74 A;  2Q8K A;  1J5Y A;  2MC3 A;  4I98 B;  1HW5 A;  3MFK A;  5DD8 A;  2J5O A;  3I58 A;  3LFK A;  4KNY A;  3O3K A;  1MJ9 A;  2XAJ A;  1FP1 D;  1JE8 A;  3L09 A;  1XGM A;  3W6K B;  3ECH A;  1IN5 A;  4WWC A;  4CGZ A;  1TW2 A;  2L54 A;  4HV6 A;  5BOX A;  1UB9 A;  3R60 A;  5H6R A;  2RKH A;  1ZHF A;  4G7H F;  3SHF A;  4I7H A;  1UHW A;  2BBY A;  4LK0 F;  4BXU A;  1KYZ A;  3C1D A;  2E7X A;  2EFW A;  2F5F A;  4PGH A;  3VB2 A;  2HGC A;  1TNT A;  3L9F A;  3WG9 A;  5JR3 A;  2XUB A;  3QAH A;  2IRF G;  3ZMZ A;  3BY6 A;  2HOE A;  3RI4 A;  1CGP A;  3E5X A;  5E8G A;  5HLI A;  1HQC A;  4FX4 A;  3O6B B;  2V9V A;  2ZO4 A;  4HQE A;  5L3E A;  4B09 A;  2H6C A;  3E6M A;  2HTS A;  1P2F A;  1G3Y A;  1BM9 A;  2ZJ2 A;  3RPQ A;  1HW1 A;  3M7G A;  3BDD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...