1I1SA

Solution structure of the transcriptional activation domain of the bacteriophage t4 protein mota
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
96
structure length
96
Chain Sequence
MSKVTYIIKASNDVLNEKTATILITIAKKDFITAAEVREVHPDLGNAVVNSNIGVLIKKGLVEKSGDGLIITGEAQDIISNAATLYAQENAPELLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MOTA
publication title Solution structure of the transcriptional activation domain of the bacteriophage T4 protein, MotA.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Transcription
total genus 21
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2001-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09114 MotA_activ Transcription factor MotA, activation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1i1sA00
5D6EA 4I09A 2XAFA 1ZRFA 2VBXA 3I59B 4EJVA 1XSDA 1IW7F 1SFEA 4BHPA 1KQ0A 3KEQA 5HLHA 4FX0A 2K4JA 1B9NA 4HYEA 2Q2EA 4ZYHA 3RTRA 2RQPA 2EA2A 1XDSA 5E18F 3GVAA 4OIPF 2HKXA 4CGZA 1D8JA 1KU3A 1B4AA 4AIKA 3NQOA 1R1UA 2GZWA 4D0PA 3MEXA 3C18A 3FXUA 3LFKA 4HZFA 2W25A 4RGSA 4L0YB 4RS8A 3SZPA 4QWQA 4HAMA 2ACJA 3FWEA 2UXNA 1WRJA 1T2KA 5FLXK 1UFMA 2UZKA 2HYFA 1OPCA 1TQPA 1YTYA 3TGNA 3F6VA 2MH2A 2PN6A 4M6XA 2PEXA 5HOOA 3W6KB 1KA8A 2GWRA 5ICGA 2PG4A 4LFUA 2YU3A 1XSVA 1ZRCA 3LA2A 1OYWA 4PGGA 1IRFA 3IKVA 4RB1A 3HOSA 4OIOF 3J7AO 4UV9A 2X0LA 1SMYF 1QPMA 3JSOA 2Z3YA 5CVRA 3RI4A 2H6CA 1IUYA 4FHTA 4Q5SF 1IXRC 3ZMTA 2P5VA 2EFPA 3M9AA 3H3UA 5IT9Z 2QENA 1XD7A 4HA8A 2OZ6A 4HW0A 2A61A 4UHTA 1XGNA 4HF1A 1LDKB 1ZH5A 3DQVC 4OMYA 1LJ9A 4BYYA 1U5TA 1TQMA 4A6DA 1YW9A 2Y48A 4Y13A 5DUKA 1R36A 2O03A 5HDKA 5ILUA 1V3FA 3V7CA 1O57A 3F8NA 1MDMB 1FLIA 2PMHA 4L9NA 1Z05A 1F1ZA 3QOPA 4WX9A 3ULQB 3F6OA 4ZYGA 3F8BA 2GA2A 4G9YA 3ISPA 2KKOA 1PDNC 4A0XA 2PFBA 1YFHA 3ZN0A 2VN2A 2LKPA 2HQNA 3K1NA 5FFZA 5LEKA 3CJNA 3RYPA 3MAJA 5HVQC 1QO0D 2VBWA 1MGTA 4P96A 2IPQX 3D5LA 2VBZA 2O8XA 2WTEA 1T6SA 5CJ9A 1HBXG 1DPRA 2F5FA 2GIVA 2XAGA 2HZTA 2VOOA 5FLXZ 1XDUA 3MQ0A 4UUVA 4UNOA 3H92A 1G6NA 2FMLA 1T39A 3COAC 3G3ZA 4A12A 3HIFA 3BDDA 1KGSA 5JVTA 1BN5A 3GZ6A 2V1XA 5ICCA 4MNUA 2KRFA 1R7JA 3E5UA 4LK1F 2ZNYA 5E1ZB 2BBYA 2QBYB 3LQQA 3F3XA 4U7BA 2Z5UA 2H09A 3R60A 3LQRA 4BHBA 4NB5A 5ILVA 4HDUA 3DF8A 2DK5A 3F8MA 2Q8KA 2EK5A 4WCGA 3RKXA 4KICA 1E17A 2D45A 2O3FA 5ILSA 1Q1HA 2YPRA 5LGUA 2ZNZA 3F21A 4BHCA 2V79A 5LHGA 3GYHX 1YLFA 5DYMA 4CICA 4OIRF 3MWMA 3ABTA 3DPLC 1G3TA 1EH7A 3T5XA 3IHUA 4CHUA 5IT3A 4BXUA 2B0LA 2HWVA 2P4WA 3I71A 2JZYA 1R1TA 2HEOA 2VODA 3ERED 1ON2A 4U0WA 4GGGA 3BJOA 5LLQA 1RUOA 4YG2F 3BY6A 5HS7A 5DCMB 1XN7A 5D4RA 3HRMA 3EUHA 2H27A 4ENJA 2LF8A 1Z9CA 4LMYA 2PQ8A 3GF2A 3MCZA 2QYOA 4A5MA 3T8RA 1OYIA 5H6RA 2NNYA 2A6HF 5E20A 1HW1A 4IF4A 4O3MA 2Z9OA 4GXOA 4A0YA 1I27A 3IWZA 4UVAA 4MQVA 2V9VA 1Z6TA 3P9IA 1HSTA 2FRHA 4R8HA 3CUQB 3DEUA 4KIFA 3E3VA 2FXAA 2BGCA 2YX7A 4P5OA 3K2ZA 4OMZA 5CVUA 1H9GA 1LQ1A 2CFXA 1IAWA 5F1RA 3TKYA 1IN4A 2OQRA 3S2WA 1CF7A 4WXCA 2MC3A 5HS9A 1W5TA 4P55A 3L09A 4KIGA 4YFKF 1FYMA 2EA4A 2VT3A 5ICFA 5L3DA 4KYWA 3BOQA 2H6BA 1YIOA 1WSUA 2QM3A 2Z33A 3HSRA 1ZG3A 2M5WA 4G7ZF 2PLYA 5D5WB 3L9FA 1SD6A 1J5YA 2XKOA 4P9UA 3R4KA 2EFWA 3DXJF 1B9MA 3KZZA 3G73A 3WG9A 3ZP5A 2JRTA 1K78A 1LB2A 1U78A 1DPUA 3J81K 3B73A 1O3QA 3ZMVA 2W84A 5A2QZ 2IP2A 3QPTA 4KN4X 3ECHA 2IVMA 1FYKA 5L3GA 1B1BA 1S7AA 4L0ZB 2BE5F 3I5UA 2L54A 5BPDA 1NHAA 2M8EA 2K7LA 3RYRA 1ZARA 2QVOA 3R61A 2WV0A 1S8NA 4ZZDA 3V8LA 3MFKA 3K9TA 3GO5A 1P92A 3K69A 5BOXA 4M9SA 3V4GA 3H3ZA 2HQRA 2CW0F 3CO7C 3FMSA 3F23A 3CUQC 1AOYA 3GFLA 3NRVA 1IXSB 3DFGA 3WTYC 5L3FA 4MEXF 3TO6A 1XGMA 2VE8A 2R7FA 5JR3A 3IL2A 4Q47A 4CXFA 2RV8A 1RIOH 4XLNF 3HUGA 5HS8A 1WI9A 3VEPA 4BNCA 2ADUA 4M74A 4HLYA 3FMQA 5D4SA 2F2EA 3IKTA 4A6EA 3T0YA 2EV0A 4G7HF 2HFHA 5EEGA 5CLSA 4B8XA 3GX4X 3SQNA 3TQNA 4ESFA 3WU1B 2ZJ2A 3FHZA 3ZMSA 1G3SA 4M71A 3KE2A 2OQGA 1SFXA 2A07F 1W4MA 3E6BA 2FBKA 2D2WA 3WTTC 2IT0A 1IF1A 2NAZA 2DAOA 2Z99A 3PFIA 4N9HA 1G3WA 2DFIA 2ZO4A 1UHMA 5FGMA 4B09A 4GYGA 4QLCU 4XSXF 4HV6A 3BWGA 5F64A 4Z2YA 3VB2A 1F5TA 2L02A 1LVAA 4KUMA 2E7XA 2ZCWA 2RVCA 2PJPA 4WXDA 4LB5A 1IN7A 3WTVC 1IN6A 4MGRA 2YX4A 1IRGA 2XASA 4ENMA 1FPQA 3V8JA 4ZZLA 3HOTA 5LEJA 3J81Z 5E1XA 5TJJA 1YW8A 4OIQF 2UWMA 3KP3A 4IRHA 1PUEE 3WTUC 2XROA 2GXGA 2A69F 1XGSA 2ISYA 5HLIA 3RKWA 2OAZA 2JPCA 2P5KA 1FOKA 3MZYA 4Y15A 2EFOA 4IXAA 2HS5A 2XVCA 1R00A 1SFUA 2XHKA 2DO7A 2ZBKA 3WTWC 3WGIA 3Q9VA 4BH9A 5FD6A 1HSJA 1STZA 3C3WA 1S7OA 2HTSA 3GLXA 3O2PE 4JBAA 4LG0B 4MTEA 2VC0A 1HKSA 4H0EA 1GVJA 4RAZA 2FE3A 2DW4A 4ENKA 4I0AA 1RNLA 1D5VA 2XIGA 2L01A 1I6XA 5E8IA 1IXCA 3M8FA 3RIRA 2XAQA 1W7PA 4HF0A 2K27A 2FMYA 3HTSB 1SD4A 5TRDA 4IRGA 2O6GE 2O0YA 4BQAA 3HSEA 3DPTA 1DP7P 2G7HA 3ZMZA 2OA4A 3P9CA 3P7NA 4HX7A 3U9GA 1LNWA 1S6LA 1FX7A 3BJ6A 5LGNA 3HHGA 2E1NA 5DCFA 4RGRA 5F6FA 4KFCA 5E17F 2YSRA 4WXHA 5DD4A 2V1DA 4G6QA 3RDIA 1R23A 2ETHA 2ZMEA 1SD7A 1W5SA 2LDUA 5DDGA 2XUBA 3BJAA 5LBQA 4IHSA 3WODF 3BPVA 3V7SA 4UXNA 2KIFA 1R22A 3DP7A 2PBIA 4NHJA 1XB4A 4L9JA 4EJUA 3GWZA 1B6AA 1U3EM 2IW5A 3E97A 2OU2A 1YW7A 1V4RA 4ZYEA 2GQQA 3W6JB 1ULYA 1YG2A 1G3YA 2MD5A 3I0TA 1KQ8A 1MD0A 3M7GA 3QRFF 1FSHA 4G94A 3JSPA 4RGUA 4Q4ZF 3RJPA 3R6SA 4IPAA 1IN8A 1EV7A 3EQLF 5D8KB 1FZPB 2YR2A 5ERIA 4RB3C 1D8KA 2QUFA 5L3EA 2EFQA 3LAPA 4G6DA 2FA5A 2W57A 3U2RA 4IHTA 2A68F 4EJTA 3BP8A 3HRSA 2IJLA 3GW2A 2QLZA 1FBQA 3E5XA 1Z6RA 1XCVA 4PZJA 4A0ZA 5BMZA 5KVRA 4Q48A 3EYYA 2BEOA 5A2QK 1BI1A 3HSFA 2EWNA 2F5CA 1ZN2A 4KIBA 2DT5A 3ZQ7A 1YYVA 3ZMDA 3E6CC 1ODDA 5BS6A 5E8GA 1Z7UA 3MZHA 3JAMK 2HTJA 1TBXA 1L3LA 4EGZA 3GFJA 1W7PD 1YQAA 5JFRA 4XRFA 6PAXA 3U1DA 1A04A 3RPUA 1P4AA 2RGVA 3TOBA 1OR7A 1KQ9A 4EJWA 5DEQA 3I59A 1J7KA 1FSEA 2RKHA 4YIIA 2WWYA 4MEYF 1XSXA 3FXQA 5KK1A 3NEUA 2HYGD 3TO7A 5BQTA 2EV6A 4JK1X 2ISZA 1TNTA 1J2XA 1SMTA 2ZXJA 3WGHA 2CQKA 4HBLA 4FX4A 4M6YA 2MLGA 2VC1A 4HQEA 1BC7C 1R58A 1F9NA 4GYIA 4HV5A 1OYYA 1XCBA 5J6XA 2A6EF 1TNSA 3GUDA 3Q9SA 2XV4S 1J0RA 2ESHA 4HF2A 3HRUA 2DPDA 3IWFA 2NYXA 4KNYA 3OV8A 4L9VA 1U5TB 4M72A 1BJAA 5AIQA 3FF5A 4M73A 4AIJA 1TTYA 3WGGA 3I58A 2QQ9A 3B02A 1USTA 4WF2A 2IA1A 2BYVE 1B59A 4KMFA 3T8TA 4LLLA 3HRTA 3O6BB 4A5NA 4E70A 4KN7X 1F4KA 3OOPA 1T98A 2UXXA 2L4MA 1H0MA 2M1BA 1QGPA 4HDVA 1X3UA 1ZG5A 4IVNA 2W24A 3TDUC 2DK8A 4P9FA 5H6QA 5K1YA 1BIBA 2JTVA 2P8TA 1BI0A 3QU6A 1TQIA 4AWXB 3L7WA 4EQQA 1I1SA 2V6CA 2J5OA 4HLXA 4OOIA 1USSA 4S04A 1IZ1A 1P2FA 3O3KA 1Y0UA 1WWXA 3JAMZ 4ENNA 1ZRDA 1P4WA 4JQFA 1HW2A 3HYIA 1Z1DA 1REPC 3CDHA 3FXRA 2KJBA 3BROA 1E2XA 2CGPA 2OZUA 4ASNA 3C7JA 3TDZC 1O3SA 4LJZF 2EV5A 3CLOA 1ZREA 2IA2A 1J75A 4I2OA 2FF4A 1R5HA 3GEZA 3K1PA 2M45A 1MDMA 1K79A 2JPBA 1U5TC 4L9TA 1TW2A 3VODA 3C1DA 5ED4A 5CVVA 1ZLJA 4NQWA 1H9TA 1EH8A 4XBFA 1MZBA 1T0FA 2KIUA 3I54A 1VTNC 1T38A 4L18B 3N4MA 2TDXA 1J59A 4ZH4F 3KP5A 4UV8A 3KZYA 3HHHA 1BC8C 2XAHA 4CZZA 4ON0A 1IN5A 4KA4A 1PP8F 3CUOA 2AS5F 1GXPA 1MJBA 4LLGF 4HX4A 5AIPA 5FFXA 3AAFA 2DQLA 2E1CA 3KP6A 1PP7U 1FWZA 3KFWX 2VXZA 2ESNA 5JI6A 4ESBA 2MLKA 1UB9A 2WC2A 1WKMA 1QZYA 5HDNA 1XGOA 4ETSA 1MKMA 1ZGAA 2RC4A 3ZMUA 3KLNA 3JTHA 3LAJA 2D1HA 3D0SA 2QBYA 5CVJA 1O3RA 3I53A 3WTSC 1I1GA 5FO5A 5DD8A 1TLHB 2FBHA 3WE2A 3REOA 1YS7A 2PMUA 3I4PA 5J8CA 2G9WA 3WTZA 4N9IA 1KU7A 4EJOA 5AONA 3ROUA 3E6DA 5D5VB 2IA0A 3N97A 1K7AA 2G7UA 4DNCA 4RAYA 1BIAA 1FYLA 3GFMA 2DU9A 5LGTA 2VE9A 1P4XA 1GHCA 3VOEA 2STTA 3FZVA 1SD5A 2RNJA 3F8FA 4EM0B 3GFIA 1TW3A 3F22A 1CF7B 2DLLA 1QQIA 3ELKA 3V8KA 3QU3A 4M9ZA 5H20A 2QQAA 4O6JA 2C6YA 1ZLKA 5D5XB 2DPUA 1LDDA 2AXLA 2EB7A 4UVCA 3DV8A 2DQRA 1BM9A 5DCMA 2XKPA 2GXBA 1KYZA 4RB0A 4U0YA 2J5PA 4EM2A 4I01A 1BI2A 1U6GA 3L2CA 5CYVA 1K78B 1JXSA 3ZN1A 1Z91A 3CO6C 4XSZF 2OBPA 1QZZA 4GCVA 4R79A 1FY7A 2FNAA 2P7VB 2QZ8A 3IRQA 2XAJA 1XMAA 1R5GA 2NRAC 2XGXA 3QPHA 2ZKZA 3BZ6A 4IRIA 4RGXA 3CUQA 2R7DA 4F7ZA 4PDKA 3VFZA 1QNTA 2K86A 2BV6A 2ZFWA 3K1MA 1FP2A 1SAXA 4PCQA 2KJCA 5BPIA 3J80K 5LHIA 5LRSA 3LSTA 2KIMA 2GAUA 2JSCA 5D8LB 2R3SA 3SHFA 2CO5A 4U88A 4HX8A 1FBSA 3P9KA 4WK8F 2CWEA 3LA3A 2F5EA 4XLPF 1R1VA 1C0WA 5L3BA 4WWCA 2L4AA 2V1UA 3RKYA 1FT9A 5JHUA 3SFZA 1FBUA 1RZ4A 1ZHFA 2EFNA 2FNPA 2K4BA 1O7FA 3ZPLA 1AWCA 3FM5A 2FU4A 3JW4A 4EMSA 5LHHA 1MJAA 1FNNA 1KU2A 2FSWA 2MBFA 3SXYA 4G7OF 3FM3A 3PQKA 4BAYA 5DV5A 2Y0MA 4CDGA 1HW5A 2COMA 4GO1A 1FP1D 3LA7A 1GXQA 1P6RA 1JE8A 3GZ5A 3TO9A 1YS6A 2HOEA 3T1BA 3E5QA 3F8CA 2DI3A 2M87A 1OKRA 2OD5A 2Y75A 3EYIA 1QBJA 2RN7A 5HDGA 2A3SA 3F72A 2VBYA 4HQMA 5HLGA 3BPXA 2XRNA 2QWWA 4S05A 3FX3A 4U0VA 2IRFG 1CGPA 2Q0OA 4O5VA 1O3TA 1HKQA 1MJ9A 1XMKA 2STWA 1S3JA 4Y17A 4A2UA 4UVBA 2NS0A 1O7LA 2DBBA 4L5JA 1LEBA 2FBIA 3JTGA 4I7HA 4I98B 4CYDA 1K6OA 5FD5A 2CG4A 2L3DA 2ELHA 1EH6A 5D5UB 1ZGJA 3LWFA 2P5LC 1HKTA 4PGHA 4RB2C 2PI0A 2FEZA 4LD5A 4KMUX 3RPQA 4AD9A 4U7DA 4LK0F 4K2EA 2P7CB 2NNNA 1S29A 3GXOA 3IC7A 1ONVA 2K02A 1UCRA 2EJRA 2FQ3A 4AIHA 3J80Z 4KDPA 1JHFA 3HTUA 5K5QA 1RUNA 4L5IA 1J9IA 1OMIA 4CO8A 3KP4A 5LRRA 3FMRA 3KCCA 1I5ZA 3KLOA 3M1EA 3R0AA 3WE3A 3E6MA 2DTRA 3IRRA 2QQBA 1LDJA 5EEHA 1W7PB 4I02A 2HKOA 1LEAA 3SZTA 2HDCA 1ZYRF 4M9XA 2CSOA 4G8XA 1ON1A 1BBYA 3ABUA 4EGYA 3WTXC 3K0LA 1DUXC 1KYWA 2GA1A 2E7WA 1HQCA 1L0OC 4TV7A 4YFNF 2H94A 2JT1A 2M30A 1U2WA 2CYYA 2RDPA 2ZMEB 2P6TA 5FB2A 2VONA 2LSOA 4EVIA 3QP6A 5E1WA 4R1HA 2X4HA 3TOAA 4MTDA 4OU0A 2O61A 1D3YA 3PQJA 3ML6A 3M8EA 2FOKA 3EDPA 4LB6B 2W85A 2VOPA 4LG0A 4IJAA 4YIFA 3Q5FA 5J8FA 2P6SA 2VT2A 4FT8A 2MA3A 1U8RA 3DKWA 1BOAA 2LF7A 4I0BA 5K5RA 4YFXF 2HR3A 4DQ2A 3QP5A 1FC3A 3KEOA 1YO5C 1JGSA 2LNBA 1ZG1A 2A5YB 3V7RA 1HXDA 2F5DA 5L3CA 5ICEA 3KP2A 5CVIA 3KETA 3ECOA 4ZYDA 1ZAOA 4ESJA 3KP7A 1RI7A 2MH9A 1WQ2A 1UHWA 1KU9A 5D6FA 4OINF 4LLNA 4LGWA 3EETA 3WU0A 3QAHA 4EM1A 5DUIA 4MQ9F 4KT5C 5K5OA 1BI3A 4AVPA 2D1VA 5IT9K 4N0BA 4EV0A 1DDNA 3R0JA 1G4DA 3I64A 2HGCA 4MHGA 1JHHA 3CTAA 4HOBA 3L00A
chains in the Genus database with same CATH superfamily
5D6EA 1HDDC 4I09A 2XAFA 1ZRFA 1X1AA 2W7NA 2VBXA 3DU5A 4BUPA 1W0TA 2DJNA 3I59B 1FMWA 2JN6A 4EJVA 1XSDA 2O7OA 2X6WA 1IW7F 1YITI 5M5XJ 2RAEA 1SFEA 3B6AA 2DMUA 3MKZA 2FD5A 1J09A 1D1CA 1KQ0A 3KEQA 4BHPA 2NVUB 5HLHA 4FX0A 2K4JA 1B9NA 4HYEA 4B3AA 2Q2EA 3ASNH 3JRAA 3UKGA 4ZYHA 1NG7A 4MFEA 3RTRA 2RQPA 1TWGJ 2M2EA 2EA2A 2QSFX 4ABZA 4GDFA 1XDSA 5E18F 3GVAA 4OIPF 3CMMA 2LTPA 3H3VK 1VQ7I 3G71I 3AL0B 1NK2P 3MKWB 2HKXA 2B9SA 4CGZA 5FKOA 2NVXJ 5K7HA 2G0EA 2PJRA 1D8JA 1P7IA 2QQ8A 5EZGA 5HNHA 1KU3A 1B4AA 4AIKA 1HOMA 3NQOA 1R1UA 2GZWA 2OUMA 4F3QA 4D0PA 4Y7NJ 1VQOI 1VQPI 3BC8A 2X6OA 3MEXA 3IAS2 3M8JA 5FRMA 2L0KA 3C18A 3FXUA 3LFKA 3JRHA 4HZFA 4N4NB 5EGOA 2W25A 4RGSA 4L0YB 2CV1A 4RS8A 1SANA 3SZPA 4QWQA 3S32A 4HAMA 3HOYJ 2ACJA 3FWEA 2QA4I 1IRXA 2UXNA 1WRJA 2EIJH 1T2KA 1UFMA 1SFKA 5FLXK 3UNGC 2UZKA 4DBQA 2HVSA 2HYFA 1OPCA 2QF7A 1TQPA 2WAEA 1YTYA 2LFBA 5KNLA 1DGRM 4A3IJ 2B7EA 3TGNA 3F6VA 2MH2A 4AUXA 3HB9A 1XPXA 2PN6A 1YOVB 2H1KA 4M6XA 2PEXA 5HOOA 2MGQA 3W6KB 1KA8A 2GWRA 5ICGA 2LR8A 2PG4A 4LFUA 2IS1A 2YU3A 2QCOA 3DKYA 5EF6A 4CYCA 2L2OA 1FOYA 1XSVA 1ZRCA 4M3GA 3IUOA 3LA2A 1OYWA 2QKLB 4CCMA 4PGGA 4M6VA 2NVQJ 5B1AH 1IRFA 3IKVA 4RB1A 2JRMA 3HOSA 1MBGA 1ETVA 2L5QA 4OIOF 3J7AO 2HU9A 4UV9A 2X0LA 1MBEA 4D5FA 1MNEA 2BVMA 4RAGA 1SMYF 3FXOA 2F5VA 1QPMA 5M5WJ 1G8XA 2Y2ZA 1OR7C 3JSOA 2Z3YA 3LSIA 1YRNA 1JKOC 5CVRA 3GTJJ 3RI4A 2H6CA 4XICA 4XK4A 1IUYA 3CESA 4FHTA 4Q5SF 1IXRC 3I3LA 3ZMTA 2R7OA 2P5VA 2EFPA 3M9AA 1OLTA 1BR1A 3H3UA 5IT9Z 3OYIA 1B72A 2QENA 4M3EA 2DA4A 2DOEA 4PJNA 4F55A 3H36A 1XD7A 2M3AA 4HA8A 2DTZA 4KITB 2OZ6A 1QPIA 3FISA 1ZGWA 2W82A 4HW0A 2A61A 4UHTA 1XGNA 3AL0C 4IOAF 2WAQN 1WVRA 2KP6A 4MIMA 4HF1A 1LDKB 1ZH5A 3MZ8A 4C2UA 1I3AA 3DQVC 4OMYA 3S2DJ 1X3ZB 1LJ9A 1ZELA 1U5TA 4I76A 4BYYA 1Y1WJ 1TQMA 3KEYA 3AG4H 3H9GA 3VYTB 4A6DA 1YW9A 2Y48A 3A0BC 4Y13A 1IG7A 2ELJA 3BZCA 2OCCH 1IO2A 5DUKA 2WY8Q 1R36A 2CUZA 2O03A 2E1OA 5HDKA 5IOYA 5ILUA 1O4XA 3DU6A 1V3FA 3OMYA 3ZOBA 3V7CA 1V5FA 3S1MJ 1O57A 3F8NA 3OIPA 4BEHB 3S1RJ 2L9SA 1MDMB 5H2FC 1FLIA 5F08A 2PMHA 4L9NA 1X2MA 5GAHJ 1Z05A 1F1ZA 2IGOA 3QOPA 4WX9A 3ULQB 2DT7B 2ZXIA 3TL4X 3LSGA 3F6OA 4ZYGA 1YI2I 3F8BA 1GUUA 4IOCF 2GA2A 2BY2A 3SFIA 4B48A 4G9YA 4XNFA 3ISPA 2KKOA 3SEZA 2EILH 3LSPA 3HC7A 4C2TA 1PDNC 4AYBA 4NQWB 4A0XA 3DBRB 4AU7A 2PFBA 4YEJA 1YFHA 3ZN0A 2E71A 4CZCA 2VN2A 1OFCX 3C2GA 3HGGA 1PUFB 2LKPA 4LOCA 2L7ZA 3PUFA 1QVUA 2HQNA 4FE4A 3OYKA 3K1NA 5FFZA 5LEKA 4A3KJ 1EF4A 2PX9A 3CJNA 3RYPA 3MAJA 1AHDP 2XPWA 1R4NB 5HVQC 1QO0D 1T56A 2VBWA 3X2QH 1MGTA 3BQZA 4P96A 2LBFA 2IPQX 3D5LA 3CCRI 3IH2A 1Y8QB 1V5GA 1BR4A 1B8IA 2VBZA 2O8XA 4OAYA 2WTEA 2ECBA 1T6SA 2EZIA 5CJ9A 3HG9A 5CPRB 4IEJA 5EG0B 1HBXG 4OWRB 1DPRA 1I39A 2F5FA 2GIVA 1FIPA 4D1QA 2XAGA 2HZTA 2VOOA 5FLXZ 1XDUA 3MQ0A 4G12A 1FEXA 2XC7A 4ZTFA 4UUVA 4UNOA 3H92A 5J1RA 2WB1N 3GTMJ 1G6NA 2FMLA 1YE9A 1E3PA 1T39A 3COAC 3G3ZA 4HPQA 4A12A 2VKVA 3HIFA 3BDDA 3PUBA 4IO9F 3BR6A 1KGSA 3MD2A 2R7XA 3TW7A 4DIQA 1BN5A 4BGDA 5JVTA 3JRBA 2XGDA 3GZ6A 2F4MB 3QPSA 2GLOA 2V6EA 2V1XA 5ICCA 4MNUA 2HNHA 2KRFA 2MC4A 4XKVA 1R7JA 2K9LA 3E5UA 5J1YA 4LK1F 5JLWA 4GFBA 2ZNYA 5E1ZB 2BBYA 3ZR8X 2I5UA 2QBYB 3LQQA 2LMDA 1V54H 2LC2A 3F3XA 3GTGJ 2PMZN 3KYCB 4QSHA 3J7ZI 4U7BA 2Z5UA 2AQFA 2H09A 3HXLA 3R60A 4PK4A 5JLXA 3LQRA 2Y9YA 4BHBA 4NB5A 5ILVA 4HDUA 1JJ8C 3DF8A 2DK5A 3F8MA 3J7AY 2Q8KA 2EK5A 4WCGA 3RKXA 3DWLE 4KICA 1MMDA 1E17A 2D45A 1X4PA 3GLLA 2O3FA 5ILSA 5TISC 4A69C 1YHQI 1Q1HA 2YPRA 5LGUA 2ZNZA 3F21A 4BHCA 2V79A 5J47A 5LHGA 3GYHX 1RPWA 3LSHA 5E3OA 1YLFA 5DYMA 4CICA 3AG1H 4OIRF 3CJQB 3H5NA 3MWMA 2BXYA 1X1BA 3ABTA 4XRSA 3FDYA 4IHWA 1VQNI 3DPLC 1G3TA 3JRFA 1Z3XA 3JRIA 1JKPC 1EH7A 5KAFC 5E3MA 4BXFA 3T5XA 3W2VA 1T0FC 3IHUA 4J01A 5IT3A 4CHUA 3S2HJ 2JVGA 4BXUA 2B0LA 3DTKA 2DMNA 2HWVA 2P4WA 3H35A 1JJ6C 1WH7A 1TWCJ 3I71A 4XN3A 2JZYA 3HOVJ 1WI3A 1E3HA 1R49A 2ZXWH 2HVRA 2R5YA 1R1TA 2HEOA 2VODA 3ERED 3L2RA 1ON2A 4DJAA 3TBIA 1JTXA 2V1NA 2EQRA 4U0WA 2FJ1A 3UR3C 9ANTA 1JKRC 3RZOJ 4GGGA 3BJOA 5LLQA 1BA5A 1RUOA 4D7MA 4YG2F 3BY6A 5HS7A 5DCMB 1VQMI 1XN7A 5D4RA 5K7FA 2CU7A 3HRMA 2VKDA 3EUHA 2H27A 5HNFA 3BT9A 4ENJA 2R7VA 2LF8A 1U0JA 2M34A 1Z9CA 4CUGA 2IS4A 4LMYA 1Z3YA 2R7RA 1RR8C 2PQ8A 3GF2A 2BZTA 4B43A 3MCZA 2QYOA 3ZCOA 2DMTA 4A5MA 3T8RA 2CV2A 1OYIA 4BJ5C 2L7FP 5H6RA 2NNYA 3HKZA 4Z6YA 3SDGA 2A6HF 2MFZA 5E20A 5FLVA 2Q1ZB 3BTLA 1HW1A 2HPMA 4IF4A 5F1JA 2Z9OA 4BS9A 4O3MA 4GXOA 4A0YA 1HA8A 1I27A 4XORA 3IWZA 4UVAA 4MQVA 3BTIA 2V9VA 1Z6TA 4BBSJ 3D5SC 1HSTA 2FRHA 3P9IA 4R8HA 4F91B 1ZTRA 4N4OB 3CUQB 3DEUA 4KIFA 1ZKGA 1ENHA 3E3VA 2FXAA 2BGCA 2YX7A 1Q1VA 4P5OA 3OYCA 3K2ZA 4OMZA 2I10A 5CVUA 1H9GA 1F43A 3RKQA 1LQ1A 2CFXA 1IAWA 5F1RA 3L2UA 2JMWA 3BG9A 1W36D 1QU3A 3HOWJ 3TKYA 1IN4A 2OQRA 4FCYA 1EJ9A 3S2WA 4S0HB 1CF7A 4WXCA 2MC3A 5HS9A 1W5TA 4P55A 4FTHA 2ZJQF 1VQ5I 3L09A 3OYEA 3MVPA 2GIZA 4KIGA 4YFKF 1FYMA 3A2KA 3RZDJ 4PJ0C 2EA4A 2VT3A 3K70D 2IGMA 2VB6A 5ICFA 5L3DA 4KYWA 3BOQA 2H6BA 2M9HA 1YIOA 4NC6A 1WSUA 2R7QA 2QM3A 3C2HA 3ZQQA 2Z33A 3HSRA 5GTHC 1ZG3A 2M5WA 4G7ZF 2PLYA 3CCQI 5D5WB 3L9FA 1SD6A 2DJIA 1J5YA 2XKOA 4P9UA 3R4KA 2EFWA 2OV7A 2K9QA 3BR2A 2E34A 3VSLA 3DXJF 3OYBA 2VQGA 1B9MA 1YX3A 2LVSA 2VI6A 3A03A 3KZZA 3G73A 2E1MB 4XKBA 3WG9A 1MMGA 3ZP5A 2JRTA 4EEFG 3CF2A 1K78A 2E2JJ 1MSFC 1LB2A 1U78A 2BY1A 1DPUA 4NDLA 3J81K 3B73A 1O3QA 3ZMVA 2W84A 5A2QZ 2IP2A 1M1EB 3QPTA 4F93B 1ZQ3P 4KN4X 4EATA 3ECHA 2IVMA 4PJMA 2V7FA 1FYKA 2WADA 5L3GA 1B1BA 1S7AA 1UMQA 2BE5F 4L0ZB 3I5UA 1XC5A 2L54A 2VUMJ 5BPDA 2LK2A 2BXZA 1HCRA 2CJJA 1NHAA 2HPIA 3G1LA 2JVHA 4ITVA 3ABKH 4KJZA 1U8BA 2M8EA 1UG0A 1EA3A 3ABLH 5BNGA 2K7LA 2W1OA 3RYRA 3K4NA 4FASD 1ZARA 2QVOA 4DOZA 2M0CA 4DYCA 1SVMA 3R61A 2WV0A 1R9TJ 1S8NA 4ZZDA 1N77A 3V8LA 3MFKA 3K9TA 3GO5A 5F0HA 1TT0A 3CJTB 1P92A 2DDAA 2VKHA 3K69A 3A0HC 4IL6C 4IHYA 2VPRA 5BOXA 4M9SA 3V4GA 3BG3A 1UG2A 3H3ZA 2HQRA 3OR2C 1T08B 2CW0F 3KIOA 3CO7C 4BY1J 4XOTA 2VJIA 3FMSA 4XQFA 3F23A 3CUQC 5B1BH 3DEWA 3CCUI 1VQKI 2EPFA 1IRZA 2EBIA 2UV1A 1AOYA 3GFLA 3PIOF 3NRVA 2H1LA 1IXSB 3DFGA 5IYCJ 4XN0A 3BZKA 3F0CA 3TEDA 3K4KA 4HRIA 3WTYC 5L3FA 4MEXF 3TO6A 1XGMA 1Z21A 2JA5J 2VE8A 3FBIB 2R7FA 5JR3A 3IL2A 4D9JA 4Q47A 1RKTA 1OQYA 4CXFA 2RV8A 2VKEA 4C3HJ 1RIOH 4XLNF 4UUTA 3HUGA 1NK3P 5HS8A 1WI9A 3RQIA 1A35A 1ZR4A 3VEPA 3HL2A 4BNCA 2ADUA 4RLQA 1SVLA 4M74A 4HLYA 4E7ZA 1JUMA 3FMQA 1FTZA 1LE8B 4XMYA 5C3EJ 3CDIA 5D4SA 2F2EA 3IKTA 4A6EA 3T0YA 2EV0A 2QSHX 2VQHA 3L2VA 3LSJA 4A93J 3A01A 4A3BJ 1BW5A 4CCNA 4G7HF 1MH4A 3FKJA 2HFHA 1X1DA 1X2NA 5EEGA 5B3SH 2LY1A 2O8KA 4M3BA 5CLSA 4B8XA 2RNGA 3GX4X 1XMXA 3BR3A 3SQNA 3OYMA 3OYNA 1Y1VJ 1XTAA 3TQNA 4ESFA 2E1MC 3WU1B 2ZJ2A 2K9NA 3FHZA 3ZMSA 3PJRA 1I6HJ 1G3SA 4ZDOA 1WJ5A 4M71A 3KE2A 2OQGA 1LFPA 1X4OA 1SFXA 3I56I 2A07F 1W4MA 3E6BA 2FBKA 2D2WA 3WTTC 2IT0A 1IF1A 2XB0X 4QPQA 2NAZA 2KMUA 3MMYB 4AIDA 1A5JA 1D1AA 2DAOA 2Z99A 3PFIA 3S3OA 4N9HA 1G3WA 2DFIA 2ZO4A 1UHMA 5FGMA 4B09A 3Q3SA 4GYGA 1GLNA 4C3JJ 4QLCU 4XSXF 4HV6A 4LITA 2KZVA 3BWGA 5F64A 2LP0A 1LFBA 2LY9A 4Z2YA 3VB2A 1VQ6I 1F5TA 5C4XJ 2L02A 1W5CC 1LVAA 4KUMA 2E7XA 2ZCWA 2DOFA 2RVCA 2M4KA 4BQNA 4QPOA 2D5VA 3CC2I 2PJPA 4WXDA 4LB5A 1IN7A 3WTVC 1T8IA 1IN6A 2DMPA 4LIUA 4MGRA 2YX4A 1IRGA 4DGWB 4CCKA 2XASA 5IY5H 4ENMA 3HJEA 1FPQA 3V8JA 4ZZLA 2HDDA 4CCOA 3RQ4A 3QYBA 5LEJA 3HOTA 2GOMA 4DYQA 1V5EA 3J81Z 3F9KA 5E1XA 2JUCA 2X9DA 5TJJA 1YW8A 4OIQF 2UWMA 1RKWA 3BTCA 3KP3A 4IRHA 1PUEE 3E7LA 3WTUC 2KRHA 2LY2A 3FK6A 2HOAA 4E7LA 2XROA 2GXGA 3D5RC 2A69F 4B1RA 1XGSA 1R6RA 2VJJA 4II3A 2ISYA 4DBRA 5HLIA 2ZFUA 3RKWA 2OAZA 2JPCA 2UUZA 2P5KA 3OL4A 2EIKH 1FOKA 2KDOA 2MYSA 4YIRX 3MZYA 2OJED 3CP8A 4Y15A 2EFOA 2Y0SA 2HS5A 4IXAA 4CCLA 3GTKJ 2CW8A 2DYSH 2XVCA 3PFYA 1R00A 1SFUA 2XHKA 3WU2C 2KIQA 4CA0A 2DA5A 2DO7A 2ZBKA 2DFHA 3WTWC 3CMAI 3A02A 2DOAA 3DTEA 3WGIA 3Q9VA 4BH9A 5FD6A 1HSJA 3SZGA 5FJ8J 1EKEA 1STZA 3C3WA 1HDPA 4RLFA 1S7OA 2HTSA 3GLXA 3O2PE 4JBAA 2BHZA 4LG0B 4MTEA 2VC0A 1HKSA 4H0EA 1GVJA 4RAZA 2FE3A 2JQ7A 3CF5F 2DW4A 4ENKA 4I0AA 1RNLA 2NOGA 4BQOA 4RM2A 4XRMA 3OIOA 1D5VA 2XIGA 2L01A 3BTJA 1RETA 1GV5A 1I6XA 5E8IA 2FX0A 1IXCA 3M8FA 3RIRA 2XAQA 1OISA 1W7PA 2EIMH 2K27A 4HF0A 2FMYA 3HTSB 5EJCA 2O9LA 3LFUA 1SD4A 5TRDA 4IRGA 5DM6F 3O8GA 3CJRB 3HOXJ 2O6GE 2R7TA 3W2WA 2O0YA 1WJBA 2LREA 3HSEA 4RA2A 3DPTA 1SEUA 2G7HA 1DP7P 4BQAA 1G59A 2IAIA 3ZMZA 5GTIC 2EZLA 2OA4A 5M5YJ 1K4SA 3K4JA 1HF0A 2EINH 4D5CA 3PSIA 3P9CA 3P7NA 3W6VA 1MIJA 4HX7A 3U9GA 4NC7A 4XOPA 5GPAA 1LNWA 3EUKL 1S6LA 3OYLA 3OYGA 1QHHD 5J3LA 4XLFA 1FX7A 2HYJA 3BJ6A 5FLMJ 5LGNA 4BKXA 1FTTA 4LG3A 3HHGA 3TW6A 1AKHB 4XRSG 2E1NA 5DCFA 4RGRA 5F6FA 3ZQHA 4KFCA 5E17F 2YSRA 4WXHA 5DD4A 2V1DA 4G6QA 3RDIA 4HSRA 1R23A 2ETHA 2KISA 4U87A 2ZMEA 1SD7A 1W5SA 2LDUA 2R5ZB 5DDGA 2XUBA 3BJAA 1LKXA 3S3NA 2BW3A 2VXDA 5LBQA 1ERDA 2M0MA 1MNMC 2JUGA 3QOEA 4IHSA 3KZIC 3WODF 1I50J 3BPVA 3V7SA 4UXNA 4UUSA 5F04A 2CQ7A 2DCEA 2KIFA 3KX2A 2F4OB 2PMZA 1R22A 3TMOA 2R7WA 3GTLJ 3DP7A 3GMEA 5IP9J 2ZSHB 4BJTA 3CCMI 4A3LJ 1U9NA 2PBIA 1UZCA 4NHJA 1XB4A 4NC8A 2VJ5A 3HUGB 4L9JA 4X0GA 3BQYA 4Y3OA 1OCOH 4EJUA 3GWZA 3HOUJ 2CV0A 1B6AA 1U3EM 2IW5A 2Y69H 3E97A 4XLHA 1K4TA 2HQ5A 2OU2A 5J1UA 1YW7A 2DN0A 2O5RA 1V4RA 2FOWA 3BR1A 2CQNA 4ZYEA 2GQQA 3W6JB 1ULYA 3PSFA 4ZYAA 1YG2A 5IP6A 1G3YA 3GZNB 2CW7A 3ZQFA 2RQQA 5F0CA 2E2HJ 2MD5A 1MBFA 3I0TA 1KQ8A 1MD0A 3M7GA 3QRFF 1FSHA 2FQ4A 4G94A 2GBYA 1F36A 3BR5A 4XL9A 3JSPA 4RGUA 1W0UA 1H88C 4Q4ZF 4XIDA 4L5EA 1UJ8A 3RJPA 1X1CA 3R6SA 1QRYA 4IPAA 1IN8A 1EV7A 2XB5A 3EQLF 3S14J 2FUG2 2ID3A 4CSWA 5D8KB 2VLAA 1FZPB 2YR2A 2R4GA 5ERIA 4M3FA 2R7UA 4RB3C 2Q2EB 1D8KA 2QUFA 5L3EA 4FISA 2CRGA 2YS9A 1VQ8I 1ETKA 2EFQA 2F48A 2IEKA 3LAPA 4G6DA 1WJCA 4C30A 2FA5A 2W57A 1RRJA 3U2RA 2MW8A 3VWBA 1ETXA 1IUFA 4IHTA 2A68F 2AHQA 4EJTA 3BP8A 2PJRB 1QVTA 2IJLA 3HRSA 3GW2A 2QLZA 3B6CA 1FBQA 1X19A 2A5WA 3E5XA 1Z6RA 2OC6A 1XCVA 2KHMA 4C2MJ 4PZJA 4A0ZA 5BMZA 2KT0A 5KVRA 4Q48A 3EYYA 2BEOA 1YJ9I 5A2QK 1BI1A 2XSJC 3HSFA 3GTPJ 4E7JA 5IYBJ 2EWNA 2F5CA 1ZN2A 2DFFA 5EGOB 4KIBA 2DT5A 3ZQ7A 4UB8C 1YYVA 3ZMDA 3E6CC 1OCPA 5KCMA 1ODDA 2F4IA 4II2A 4XLCA 5BS6A 5E8GA 1Z7UA 3MZHA 3JAMK 2HTJA 3K4LA 1TBXA 1VF9A 1YJWI 5DM7F 2QEXI 1L3LA 4EGZA 3GFJA 2R93J 4PSXA 3PNTA 1IDZA 2L9VA 2ECCA 3Q0VA 1W7PD 1YQAA 1HC8A 1XG1A 2HDWA 3K2AA 5JFRA 1OJLA 3CZ6A 4XRFA 1S7EA 2IGNA 2L7MP 2LG4A 4MO7A 3U1DA 6PAXA 4CYCB 1A04A 3RPUA 3CP2A 1P4AA 2RGVA 3CMYA 2MD0A 3QWLA 3TOBA 2X51A 1OR7A 1KQ9A 5DEQA 4EJWA 3I59A 5IYDJ 5C4JJ 1J7KA 1FSEA 2RKHA 4YIIA 2WWYA 3DLAA 4MEYF 1TWAJ 1WJEA 1XSXA 1HLVA 3HDDA 3FXQA 3TP0A 1WFXA 5KK1A 3OS2A 3NEUA 2HYGD 4IQJA 3TO7A 1BL0A 1IC8A 4UB6C 5BQTA 2JWTA 2EV6A 4JK1X 4NUBA 2ISZA 1YRNB 2IS6A 1TNTA 4A3JJ 2ME0A 1J2XA 3FK7A 2LLKA 3G2BA 3SEQA 1GDTA 1SMTA 2ZXJA 3WGHA 4UY8I 2CQKA 4HBLA 4B4CA 4FX4A 1P7JA 4M6YA 1D1BA 3OYDA 3LNQA 2DA6A 5EDNA 2MLGA 2VC1A 4HQEA 3WG7H 1B72B 3QYEA 1BC7C 3LL7A 2IGKA 1R58A 2V9KA 1F9NA 3I55I 4GYIA 4HV5A 1OYYA 1XCBA 4A3GJ 5J6XA 2X1DA 2A6EF 1TNSA 1Y8RB 3GUDA 3Q9SA 2XV4S 1J0RA 2IS2A 2ESHA 4HF2A 3HRUA 1WGXA 2DPDA 3IWFA 4XR6A 2NYXA 3HEFA 4KNYA 3OV8A 4I99C 4L9VA 1U5TB 1OCCH 2W00A 4MFDA 4M72A 3GTQJ 2N8GA 1BJAA 1BJZA 4RAFA 3G6EI 5LD2C 5AIQA 2VIXA 3FF5A 4M73A 2YUSA 4AIJA 1WHUA 1TTYA 3ZQLA 3WGGA 2IXSA 2ZJRF 3I58A 2QQ9A 3B02A 3FXMA 3LSMA 1USTA 4WF2A 2IA1A 2BYVE 3E0JB 2TRTA 1W1WE 2E60A 5FKKA 1B59A 2EZHA 4KMFA 3DKXA 3T8TA 4LLLA 4DZJA 3H1CA 3OL3A 3MKYB 3HRTA 3O6BB 4KT6A 4A5NA 4E70A 2L9RA 4KN7X 2EH3A 2E19A 4IQ4A 3I4MJ 1JI8A 1F4KA 3OYAA 4JX4A 3OOPA 1LPQA 1T98A 2UXXA 2L4MA 1H0MA 4PFPA 1NTCA 1MMSA 2M1BA 1QGPA 4HDVA 1X3UA 2WA0A 1ZG5A 3IH3A 4IVNA 1FMVA 2W24A 3CDLA 3TDUC 3NAUA 5K7ZA 1JTYA 4BL0B 3U21A 4DZPA 2DK8A 3OWTA 4P9FA 5H6QA 4DYRA 2HXOA 5K1YA 2KQRA 3WHCA 3FHNA 2VQCA 2K5CA 1BIBA 4PJJA 2JTVA 2P8TA 3S3MA 1BOBA 1BI0A 3QU6A 2KLOA 1TQIA 4AWXB 3AG2H 1VI0A 3L7WA 3AKZA 4OAZA 4EQQA 3G1MA 4X1EA 2LBFB 1IV6A 1I1SA 2V6CA 3DCFA 2J5OA 1B8IB 4HLXA 2W4SA 4OOIA 1USSA 1UHSA 4S04A 1IZ1A 1IV8A 2CUJA 3IV5A 3K4MA 1P2FA 2HZDA 1JT6A 4BXXJ 1NG6A 2BY0A 3O3KA 1Y0UA 1KONA 1WWXA 3JAMZ 4ENNA 1WZ2A 1ZRDA 1P4WA 2I8DA 4JQFA 1HW2A 3ESWB 3HYIA 1Z1DA 1D0ZA 1REPC 3CDHA 3FXRA 2H8WA 2KJBA 3I9V2 3BROA 1SFOJ 1E2XA 1WJDA 2CGPA 1FIAA 2A6TA 2OZUA 2L9NA 4QIWN 4PJLA 4ASNA 3C7JA 3TDZC 1O3SA 3RPUD 4LJZF 2EV5A 3CLOA 1ZREA 3JREA 3LMMA 2IA2A 1J75A 1A6IA 4I2OA 2FF4A 4DW6A 3V42A 1WJAA 3E1SA 1R5HA 3GEZA 4BEHA 3ZQCA 1QA6A 3W2AA 3K1PA 2M45A 1MDMA 1K79A 4FETA 2JPBA 1E3OC 1U5TC 3FKIJ 1S72I 2WBMA 4L9TA 1TW2A 3VODA 1OCTC 4J00A 2BOLA 2DXIA 3C1DA 5FROA 2M7BA 1SAUA 5ED4A 5CVVA 2WAFA 2KL4A 1ZLJA 3HGYA 4RDUA 4BY7J 1XS9A 3W3CA 4NQWA 2MSYA 1BW6A 3QODA 4D7NA 2RREA 3CCEI 1H9TA 1EH8A 4XBFA 2NS8A 3OIQA 1PUFA 3H9JA 1MZBA 3K7AJ 1T0FA 2KIUA 3I54A 1VTNC 1T38A 4L18B 2LRDA 3N4MA 4B47A 3HM5A 3S17J 2TDXA 1DGWY 1J59A 4ZH4F 3O8HA 3KP5A 4UV8A 5CKTA 3KZYA 3HHHA 4CCJA 4ANJA 3ZXSA 3PNYA 5F27A 1BC8C 2XAHA 4CZZA 1SVOA 2XGCA 4ON0A 1RR7A 4G6TB 1IN5A 4KA4A 1PP8F 3CUOA 2B63J 3CCLI 2X6YA 2OTLI 4E4HA 2AS5F 4JOMA 5HLTA 1GXPA 1MJBA 3DPUA 4JX5A 4LLGF 5EG0A 2KZGA 3PM1A 4HX4A 1VQLI 3K10A 5DTDA 5AIPA 3CCSI 2HOTA 5GP9A 5FFXA 1UELB 2DA2A 3AAFA 2DQLA 2E1CA 2ZJPF 3KP6A 1K83J 4IX7A 3HPHA 1PP7U 2DMQA 2R5YB 3K6GA 1MSEC 2ZB9A 2R0QC 2W48A 2P81A 1FWZA 2XRLA 3KFWX 2ELKA 4HNUA 2VXZA 2ESNA 3M1CA 5JI6A 4ESBA 1MBKA 2MLKA 1UB9A 1R71A 2WC2A 1WKMA 1FOXA 3L1PA 2OPTA 3RSNA 1QZYA 3FXLA 5HDNA 1XGOA 2NXNB 4ETSA 1MKMA 1ZGAA 2RC4A 1W36C 3ZMUA 1Y6IA 1LVKA 3KLNA 3K4BA 3OOUA 4BU2A 3JTHA 3LAJA 2D1HA 3D0SA 2QBYA 4FQGA 2JSPA 5CVJA 2DODA 2LH9A 3HOZJ 3S1NJ 1O3RA 3I53A 1MMNA 3WTSC 1I1GA 5FO5A 5DD8A 3JR9A 1TLHB 2M4GA 2FBHA 3WE2A 2Z16A 3REOA 2HQAA 3K70C 5LFAA 3AFHA 1YS7A 4YRVA 2PMUA 3I4PA 3M4OJ 5J8CA 2G9WA 3CLQA 3WTZA 4N9IA 3CQZJ 2BHYA 1KU7A 4V19K 4EJOA 5AONA 3ROUA 1H8AC 1POGA 3BR0A 3BG5A 2WAQA 3KYDB 4ZTJA 2QSGX 3E6DA 5D5VB 2IA0A 4RM3A 3N97A 1K7AA 2COBA 2G7UA 4DNCA 4RAYA 1BIAA 1FYLA 1E0EA 1XX5A 3GFMA 3CCYA 2DU9A 5LGTA 2VE9A 1P4XA 1GHCA 2R7SA 3VOEA 2STTA 3M07A 3FZVA 1SD5A 2GOXB 2RNJA 4NBQA 4IZZA 3F8FA 4A3EJ 1RESA 3FXKA 1JUSA 4EM0B 3GFIA 1TW3A 3OYJA 3F22A 1ZR2A 3SJMA 1TC3C 1CF7B 2LYCA 2WY7Q 1R5ID 2DLLA 2NS7A 1QQIA 3A1YA 3ELKA 3V8KA 2CUEA 2CUFA 3QU3A 4M9ZA 2YU9J 3VDXA 5H20A 2QQAA 4O6JA 2A05A 1DU6A 2C6YA 1ZLKA 5D5XB 2DPUA 2VJ4A 1LDDA 3ABMH 1VFCA 2AXLA 5GAGJ 2EB7A 3LSKA 4UVCA 3DV8A 2DQRA 1BM9A 3S15J 3BLYA 1TT5B 2DYRH 5DCMA 2CQXA 1IGNA 1QZEA 2XKPA 2GXBA 1KYZA 1ETOA 4RBOA 4RB0A 2XF6A 3KPHA 1Z67A 2AXTC 4U0YA 2J5PA 1ETQA 5FKMA 4EM2A 3K4CA 4I01A 1BI2A 1U6GA 2KDZA 2QKMB 2VASA 2ICWG 4AM3A 3L2CA 1D0XA 5CYVA 1JKQC 1K78B 1JXSA 2XPUA 2V4JC 3ZN1A 3H9QA 1Z91A 2Y9ZA 3CO6C 4XSZF 3EUAA 2OCEA 1K61A 2OBPA 5HODA 1QZZA 3EUHC 4GCVA 4R79A 4AC0A 1FY7A 1TZLA 2FNAA 2P7VB 3D1NI 2QZ8A 3IRQA 2XAJA 1XMAA 1R5GA 2NRAC 2XGXA 3QPHA 2ZKZA 5EEAA 3BZ6A 1A31A 3G4SI 4IRIA 3VYUB 2WB1A 3IH4A 2HVQA 4RGXA 3CUQA 3LSRA 5J40A 2R7DA 4AVZA 4Y52J 1DP3A 4F7ZA 4PDKA 3VFZA 3QPLA 2AQEA 4E7HA 1QNTA 2K86A 3ONQA 2QGUA 4X6AJ 2BV6A 2LOOA 3S8PA 2ZFWA 5KAIC 2XPVA 2R7ZJ 1FOWA 3K1MA 1FP2A 3RCOA 5J4YA 4E7IA 1X58A 3DTIA 2V9PA 1SAXA 4PCQA 2KJCA 5BPIA 1GT0C 4BE0A 3J80K 5EYRA 1X3WB 5LHIA 5LRSA 3LSTA 2Y0SN 2KIMA 2GAUA 3AG3H 2JSCA 1TL8A 2Z1DA 5D8LB 2R3SA 1S5LC 3SHFA 2CO5A 3OYHA 4MLOA 4ZC3A 4U88A 4HX8A 1FBSA 3P9KA 2TCTA 2Y30A 4NNJA 2CWEA 3LA3A 4WK8F 2F5EA 2JA2A 4XLPF 1R1VA 1H89C 3TP3A 2NOJB 1PJRA 4H4KC 1C0WA 1OCZH 1ITYA 5L3BA 4Y33A 4ZDLA 1LUJB 1MBJA 4WWCA 2L4AA 4W1UA 2V1UA 3RKYA 2M7AA 1FT9A 2V26A 5JHUA 4BJ6C 3SFZA 1FBUA 3DEEA 1RZ4A 2ZC2A 4IHXA 1Z77A 1ZHFA 2EFNA 2X1EA 4BQQA 2FNPA 2K4BA 4F52A 1O7FA 4C9YA 3ZPLA 1V55H 1AWCA 3FM5A 1DQUA 3EPZA 2FU4A 4JYKA 1YIJI 3JW4A 4EMSA 1G2HA 5LHHA 1N78A 3BCBA 3A01B 2Z2SB 1MJAA 5E3NA 1YJNI 1FNNA 1KU2A 5JVGF 2FSWA 2MBFA 3SXYA 3GCMA 4HNTA 4G7OF 3FM3A 3PQKA 4BAYA 2ZSIB 5DV5A 2Y0MA 2X1CA 4CDGA 1HW5A 4GRIA 3HBLA 2COMA 4GO1A 1FP1D 2ZXHA 3LA7A 1GXQA 1P6RA 5FRNA 5E3LA 3OY9A 2DDBA 2K3PA 1Z0XA 1D0YA 1N25A 3H0GJ 3G1OA 1JE8A 2LD5A 1WPKA 3GZ5A 3TO9A 1YS6A 2K3FA 5CQEA 5FKNA 3S93A 1SC7A 3P5JA 2HOEA 3T1BA 5E79C 3PL8A 2XAUA 3E5QA 3F8CA 3SYTA 2DI3A 3N05A 2KFDA 4Y4RA 1CQTA 2M87A 1OKRA 2OD5A 2Y75A 3EYIA 3OYFA 5GPCA 1QBJA 3PO3J 2RN7A 2XF7A 4V2FA 5HDGA 3ZRGA 4AYBN 2A3SA 3PO2J 3MKLA 3F72A 2VQLA 2VBYA 2HOSA 4HQMA 2CQQA 5HLGA 3BPXA 3H5AA 2XRNA 4F92B 3JRCA 2KRCA 2QWWA 2X48A 4S05A 3FX3A 3OS1A 3L2QA 1NH3A 4U0VA 3NWTA 2IRFG 4I6ZA 1CGPA 1MH3A 2Q0OA 4O5VA 5KHDA 1O3TA 1HKQA 1P9QC 4A3FJ 1MJ9A 1XMKA 2STWA 1S3JA 4Y17A 4A2UA 4UVBA 2NS0A 1O7LA 2DBBA 1QHGA 4L5JA 4FE7A 4HNVA 4HSTA 1LEBA 2FBIA 3JTGA 3KYLA 4I7HA 4I98B 1K6YA 4CYDA 2OF7A 1K6OA 2X85A 5FD5A 1JT0A 1MMAA 3L2WA 2CFOA 4HEA2 2CG4A 2DA1A 2L3DA 3NWSA 4JP0A 1LE8A 2IBDA 2L7KA 2CH0A 2ELHA 2K85A 3H0DA 4BE1A 3PNVA 3FBNB 1EH6A 5D5UB 2EZKA 2JJ7A 1ACIA 2F6CA 3QQAA 4YELA 1ZGJA 3LWFA 4XKWA 1ETWA 3DBLB 2P5LC 1HKTA 3OR1C 1GVDA 3Q0WA 4PGHA 2VL8A 3IAM2 3CC4I 4RB2C 1WJFA 2PI0A 2FEZA 4LD5A 4KMUX 5M3MJ 3RPQA 2WV1A 3ZQGA 1PVEA 2HXIA 1VQ4I 4BBRJ 1OCRH 4AD9A 4KISA 2JA7J 1Y56A 4U7DA 4LK0F 4K2EA 5EZHA 2P7CB 2XF5A 3U1KA 5GADJ 2CMPA 1S29A 2NNNA 4BACA 1AU7A 4JX6A 2KPMA 5F0FA 3GXOA 1VQ9I 3VYSB 3IC7A 4PFOA 1ONVA 2K02A 1UCRA 5B5EC 2EJRA 2FQ3A 4AIHA 3J80Z 1VNDA 3OSFA 4KDPA 2Y31A 1JHFA 3LOCA 2H8RA 2BY3A 2GXAA 3HPGA 3CD6I 3FXJA 4XLAA 2XDVA 3HTUA 5K5QA 1RUNA 4L5IA 1Z7LA 1J9IA 2P0WA 1OMIA 1JGGA 3MN2A 4CO8A 3KP4A 3DBHB 5LRRA 2JA8J 3FMRA 3KCCA 1I5ZA 3KLOA 3OSGA 1WCMJ 3BCAA 3M1EA 5DS9A 3BG6A 3R0AA 3WE3A 3E6MA 2VPLA 2GM4A 1T95A 2DTRA 2K40A 3IRRA 2QQBA 3ASOH 2R92J 1LDJA 2ID6A 5EEHA 1W7PB 3CMEI 4I02A 2HKOA 1LEAA 1U9OA 1WH5A 3FIWA 1AA7A 2X6XA 3SZTA 1D5YA 4PSWA 4E7KA 3CCJI 2JA6J 3VYRB 2K9SA 2HDCA 4M3DA 5M3FJ 1ZYRF 3J7YJ 4M9XA 2CSOA 4G8XA 1ON1A 1BBYA 3ABUA 3JRDA 2E2IJ 4EGYA 3WTXC 4A3MJ 3S1QJ 3K0LA 1DUXC 1KYWA 2GA1A 2E7WA 1HQCA 1L0OC 1MBHA 2NVYJ 1UAAA 4TV7A 3JCUC 3CC7I 5C44J 1BR2A 4YFNF 2CS3A 2H94A 4P1WA 2JK3A 3PIPF 3CCVI 2JT1A 3ERMA 3QYFA 4XONA 2M30A 5FKLA 1U2WA 1A6QA 2LKXA 2CYYA 2RDPA 2ZMEB 2DA3A 2NVTJ 2P6TA 2M8GX 2MG4A 1ZK8A 2BW3B 3ZGKA 3DLLF 5FB2A 2XSDC 1IJWC 1R4MB 3IP4B 2VONA 1JUPA 1X1PA 2LSOA 5JHFA 4EVIA 3QP6A 4BDZA 4A3CJ 4UUSB 4LIVA 5E1WA 5IP7J 4BE2A 2DFEA 4R1HA 2X4HA 3I4NJ 1MW7A 3SDBA 3TOAA 4MTDA 4OU0A 1A36A 2O61A 1D3YA 3VSKA 3PQJA 3ML6A 3M8EA 2FOKA 1TP4A 3WHBA 2DT6A 1MNDA 3EDPA 1VZ0A 4LB6B 2AO9A 4B44A 2W85A 1KZHA 2VOPA 3HKZN 2DA7A 4LG0A 4IJAA 4YIFA 1I3QJ 4PUSA 3S16J 3ZQIA 3Q5FA 1APLC 5J8FA 1RC9A 2P6SA 1N75A 2VT2A 4FT8A 2MA3A 1TWHJ 1U8RA 4ZDPA 3DKWA 1BOAA 4ZJZA 2LF7A 1Y39A 4I0BA 2HI3A 1YX5A 5K5RA 4YFXF 2HR3A 4DQ2A 3QP5A 1FC3A 3KEOA 1YO5C 2K9MA 3VPRA 1JGSA 4BDYA 4IKFA 2LNBA 3OS0A 1ZG1A 4J19A 2A5YB 3V7RA 1HXDA 2F5DA 3NARA 5L3CA 5ICEA 1FJLA 4CH7A 2ME6A 3KP2A 5CVIA 3KETA 4XKCA 3ECOA 4ZYDA 4W97A 5IPAA 2MABA 1T33A 1ZAOA 1DU0A 4ESJA 3KP7A 4RMNA 1RI7A 2MH9A 4V2GA 1PYVA 1WQ2A 1UHWA 1AKHA 4A3DJ 3C2BA 1KU9A 3BG7A 4HG2A 5D6FA 4OINF 4LLNA 4LGWA 3EETA 3WU0A 2R5ZA 2E35A 5IOZA 3QAHA 4EM1A 2BVLA 5DUIA 4MQ9F 2OTJI 4KT5C 5GAEJ 5K5OA 1ORKA 4QTRA 5CQGA 1BI3A 1ETYA 4AVPA 2D1VA 5IT9K 3Q0UA 5J4VA 4IHVA 3GBGA 4N0BA 4EV0A 1DDNA 3R0JA 4C3IJ 5B66C 1G4DA 1IDYA 4E6KG 2ZMEC 3A4CA 2E5NA 3I64A 2HGCA 5TGTA 3GTOJ 4MHGA 1LFUP 1GV2A 1JHHA 4B3XA 1S9HA 3JRGA 2XGEA 1Y0NA 2LKSA 4XM3A 1TWFJ 3CTAA 3H5RA 4HOBA 4XLEA 2E36A 4E7SA 3HZJA 3L00A 3M3YJ 2E5ZA
chains in the Genus database with same CATH topology
5D6EA 4I09A 2XAFA 1ZRFA 2VBXA 3I59B 4EJVA 1XSDA 1IW7F 1SFEA 4BHPA 1KQ0A 3KEQA 5HLHA 4FX0A 2K4JA 1B9NA 4HYEA 2Q2EA 4ZYHA 3RTRA 2RQPA 2EA2A 1XDSA 5E18F 3GVAA 4OIPF 2HKXA 4CGZA 1D8JA 1KU3A 1B4AA 4AIKA 3NQOA 1R1UA 2GZWA 4D0PA 3MEXA 3C18A 3FXUA 3LFKA 4HZFA 2W25A 4RGSA 4L0YB 4RS8A 3SZPA 4QWQA 4HAMA 2ACJA 3FWEA 2UXNA 1WRJA 1T2KA 5FLXK 1UFMA 2UZKA 2HYFA 1OPCA 1TQPA 1YTYA 3TGNA 3F6VA 2MH2A 2PN6A 4M6XA 2PEXA 5HOOA 3W6KB 1KA8A 2GWRA 5ICGA 2PG4A 4LFUA 2YU3A 1XSVA 1ZRCA 3LA2A 1OYWA 4PGGA 1IRFA 3IKVA 4RB1A 3HOSA 4OIOF 3J7AO 4UV9A 2X0LA 1SMYF 1QPMA 3JSOA 2Z3YA 5CVRA 3RI4A 2H6CA 1IUYA 4FHTA 4Q5SF 1IXRC 3ZMTA 2P5VA 2EFPA 3M9AA 3H3UA 5IT9Z 2QENA 1XD7A 4HA8A 2OZ6A 4HW0A 2A61A 4UHTA 1XGNA 4HF1A 1LDKB 1ZH5A 3DQVC 4OMYA 1LJ9A 4BYYA 1U5TA 1TQMA 4A6DA 1YW9A 2Y48A 4Y13A 5DUKA 1R36A 2O03A 5HDKA 5ILUA 1V3FA 3V7CA 1O57A 3F8NA 1MDMB 1FLIA 2PMHA 4L9NA 1Z05A 1F1ZA 3QOPA 4WX9A 3ULQB 3F6OA 4ZYGA 3F8BA 2GA2A 4G9YA 3ISPA 2KKOA 1PDNC 4A0XA 2PFBA 1YFHA 3ZN0A 2VN2A 2LKPA 2HQNA 3K1NA 5FFZA 5LEKA 3CJNA 3RYPA 3MAJA 5HVQC 1QO0D 2VBWA 1MGTA 4P96A 2IPQX 3D5LA 2VBZA 2O8XA 2WTEA 1T6SA 5CJ9A 1HBXG 1DPRA 2F5FA 2GIVA 2XAGA 2HZTA 2VOOA 5FLXZ 1XDUA 3MQ0A 4UUVA 4UNOA 3H92A 1G6NA 2FMLA 1T39A 3COAC 3G3ZA 4A12A 3HIFA 3BDDA 1KGSA 5JVTA 1BN5A 3GZ6A 2V1XA 5ICCA 4MNUA 2KRFA 1R7JA 3E5UA 4LK1F 2ZNYA 5E1ZB 2BBYA 2QBYB 3LQQA 3F3XA 4U7BA 2Z5UA 2H09A 3R60A 3LQRA 4BHBA 4NB5A 5ILVA 4HDUA 3DF8A 2DK5A 3F8MA 2Q8KA 2EK5A 4WCGA 3RKXA 4KICA 1E17A 2D45A 2O3FA 5ILSA 1Q1HA 2YPRA 5LGUA 2ZNZA 3F21A 4BHCA 2V79A 5LHGA 3GYHX 1YLFA 5DYMA 4CICA 4OIRF 3MWMA 3ABTA 3DPLC 1G3TA 1EH7A 3T5XA 3IHUA 4CHUA 5IT3A 4BXUA 2B0LA 2HWVA 2P4WA 3I71A 2JZYA 1R1TA 2HEOA 2VODA 3ERED 1ON2A 4U0WA 4GGGA 3BJOA 5LLQA 1RUOA 4YG2F 3BY6A 5HS7A 5DCMB 1XN7A 5D4RA 3HRMA 3EUHA 2H27A 4ENJA 2LF8A 1Z9CA 4LMYA 2PQ8A 3GF2A 3MCZA 2QYOA 4A5MA 3T8RA 1OYIA 5H6RA 2NNYA 2A6HF 5E20A 1HW1A 4IF4A 4O3MA 2Z9OA 4GXOA 4A0YA 1I27A 3IWZA 4UVAA 4MQVA 2V9VA 1Z6TA 3P9IA 1HSTA 2FRHA 4R8HA 3CUQB 3DEUA 4KIFA 3E3VA 2FXAA 2BGCA 2YX7A 4P5OA 3K2ZA 4OMZA 5CVUA 1H9GA 1LQ1A 2CFXA 1IAWA 5F1RA 3TKYA 1IN4A 2OQRA 3S2WA 1CF7A 4WXCA 2MC3A 5HS9A 1W5TA 4P55A 3L09A 4KIGA 4YFKF 1FYMA 2EA4A 2VT3A 5ICFA 5L3DA 4KYWA 3BOQA 2H6BA 1YIOA 1WSUA 2QM3A 2Z33A 3HSRA 1ZG3A 2M5WA 4G7ZF 2PLYA 5D5WB 3L9FA 1SD6A 1J5YA 2XKOA 4P9UA 3R4KA 2EFWA 3DXJF 1B9MA 3KZZA 3G73A 3WG9A 3ZP5A 2JRTA 1K78A 1LB2A 1U78A 1DPUA 3J81K 3B73A 1O3QA 3ZMVA 2W84A 5A2QZ 2IP2A 3QPTA 4KN4X 3ECHA 2IVMA 1FYKA 5L3GA 1B1BA 1S7AA 4L0ZB 2BE5F 3I5UA 2L54A 5BPDA 1NHAA 2M8EA 2K7LA 3RYRA 1ZARA 2QVOA 3R61A 2WV0A 1S8NA 4ZZDA 3V8LA 3MFKA 3K9TA 3GO5A 1P92A 3K69A 5BOXA 4M9SA 3V4GA 3H3ZA 2HQRA 2CW0F 3CO7C 3FMSA 3F23A 3CUQC 1AOYA 3GFLA 3NRVA 1IXSB 3DFGA 3WTYC 5L3FA 4MEXF 3TO6A 1XGMA 2VE8A 2R7FA 5JR3A 3IL2A 4Q47A 4CXFA 2RV8A 1RIOH 4XLNF 3HUGA 5HS8A 1WI9A 3VEPA 4BNCA 2ADUA 4M74A 4HLYA 3FMQA 5D4SA 2F2EA 3IKTA 4A6EA 3T0YA 2EV0A 4G7HF 2HFHA 5EEGA 5CLSA 4B8XA 3GX4X 3SQNA 3TQNA 4ESFA 3WU1B 2ZJ2A 3FHZA 3ZMSA 1G3SA 4M71A 3KE2A 2OQGA 1SFXA 2A07F 1W4MA 3E6BA 2FBKA 2D2WA 3WTTC 2IT0A 1IF1A 2NAZA 2DAOA 2Z99A 3PFIA 4N9HA 1G3WA 2DFIA 2ZO4A 1UHMA 5FGMA 4B09A 4GYGA 4QLCU 4XSXF 4HV6A 3BWGA 5F64A 4Z2YA 3VB2A 1F5TA 2L02A 1LVAA 4KUMA 2E7XA 2ZCWA 2RVCA 2PJPA 4WXDA 4LB5A 1IN7A 3WTVC 1IN6A 4MGRA 2YX4A 1IRGA 2XASA 4ENMA 1FPQA 3V8JA 4ZZLA 3HOTA 5LEJA 3J81Z 5E1XA 5TJJA 1YW8A 4OIQF 2UWMA 3KP3A 4IRHA 1PUEE 3WTUC 2XROA 2GXGA 2A69F 1XGSA 2ISYA 5HLIA 3RKWA 2OAZA 2JPCA 2P5KA 1FOKA 3MZYA 4Y15A 2EFOA 4IXAA 2HS5A 2XVCA 1R00A 1SFUA 2XHKA 2DO7A 2ZBKA 3WTWC 3WGIA 3Q9VA 4BH9A 5FD6A 1HSJA 1STZA 3C3WA 1S7OA 2HTSA 3GLXA 3O2PE 4JBAA 4LG0B 4MTEA 2VC0A 1HKSA 4H0EA 1GVJA 4RAZA 2FE3A 2DW4A 4ENKA 4I0AA 1RNLA 1D5VA 2XIGA 2L01A 1I6XA 5E8IA 1IXCA 3M8FA 3RIRA 2XAQA 1W7PA 4HF0A 2K27A 2FMYA 3HTSB 1SD4A 5TRDA 4IRGA 2O6GE 2O0YA 4BQAA 3HSEA 3DPTA 1DP7P 2G7HA 3ZMZA 2OA4A 3P9CA 3P7NA 4HX7A 3U9GA 1LNWA 1S6LA 1FX7A 3BJ6A 5LGNA 3HHGA 2E1NA 5DCFA 4RGRA 5F6FA 4KFCA 5E17F 2YSRA 4WXHA 5DD4A 2V1DA 4G6QA 3RDIA 1R23A 2ETHA 2ZMEA 1SD7A 1W5SA 2LDUA 5DDGA 2XUBA 3BJAA 5LBQA 4IHSA 3WODF 3BPVA 3V7SA 4UXNA 2KIFA 1R22A 3DP7A 2PBIA 4NHJA 1XB4A 4L9JA 4EJUA 3GWZA 1B6AA 1U3EM 2IW5A 3E97A 2OU2A 1YW7A 1V4RA 4ZYEA 2GQQA 3W6JB 1ULYA 1YG2A 1G3YA 2MD5A 3I0TA 1KQ8A 1MD0A 3M7GA 3QRFF 1FSHA 4G94A 3JSPA 4RGUA 4Q4ZF 3RJPA 3R6SA 4IPAA 1IN8A 1EV7A 3EQLF 5D8KB 1FZPB 2YR2A 5ERIA 4RB3C 1D8KA 2QUFA 5L3EA 2EFQA 3LAPA 4G6DA 2FA5A 2W57A 3U2RA 4IHTA 2A68F 4EJTA 3BP8A 3HRSA 2IJLA 3GW2A 2QLZA 1FBQA 3E5XA 1Z6RA 1XCVA 4PZJA 4A0ZA 5BMZA 5KVRA 4Q48A 3EYYA 2BEOA 5A2QK 1BI1A 3HSFA 2EWNA 2F5CA 1ZN2A 4KIBA 2DT5A 3ZQ7A 1YYVA 3ZMDA 3E6CC 1ODDA 5BS6A 5E8GA 1Z7UA 3MZHA 3JAMK 2HTJA 1TBXA 1L3LA 4EGZA 3GFJA 1W7PD 1YQAA 5JFRA 4XRFA 6PAXA 3U1DA 1A04A 3RPUA 1P4AA 2RGVA 3TOBA 1OR7A 1KQ9A 4EJWA 5DEQA 3I59A 1J7KA 1FSEA 2RKHA 4YIIA 2WWYA 4MEYF 1XSXA 3FXQA 5KK1A 3NEUA 2HYGD 3TO7A 5BQTA 2EV6A 4JK1X 2ISZA 1TNTA 1J2XA 1SMTA 2ZXJA 3WGHA 2CQKA 4HBLA 4FX4A 4M6YA 2MLGA 2VC1A 4HQEA 1BC7C 1R58A 1F9NA 4GYIA 4HV5A 1OYYA 1XCBA 5J6XA 2A6EF 1TNSA 3GUDA 3Q9SA 2XV4S 1J0RA 2ESHA 4HF2A 3HRUA 2DPDA 3IWFA 2NYXA 4KNYA 3OV8A 4L9VA 1U5TB 4M72A 1BJAA 5AIQA 3FF5A 4M73A 4AIJA 1TTYA 3WGGA 3I58A 2QQ9A 3B02A 1USTA 4WF2A 2IA1A 2BYVE 1B59A 4KMFA 3T8TA 4LLLA 3HRTA 3O6BB 4A5NA 4E70A 4KN7X 1F4KA 3OOPA 1T98A 2UXXA 2L4MA 1H0MA 2M1BA 1QGPA 4HDVA 1X3UA 1ZG5A 4IVNA 2W24A 3TDUC 2DK8A 4P9FA 5H6QA 5K1YA 1BIBA 2JTVA 2P8TA 1BI0A 3QU6A 1TQIA 4AWXB 3L7WA 4EQQA 1I1SA 2V6CA 2J5OA 4HLXA 4OOIA 1USSA 4S04A 1IZ1A 1P2FA 3O3KA 1Y0UA 1WWXA 3JAMZ 4ENNA 1ZRDA 1P4WA 4JQFA 1HW2A 3HYIA 1Z1DA 1REPC 3CDHA 3FXRA 2KJBA 3BROA 1E2XA 2CGPA 2OZUA 4ASNA 3C7JA 3TDZC 1O3SA 4LJZF 2EV5A 3CLOA 1ZREA 2IA2A 1J75A 4I2OA 2FF4A 1R5HA 3GEZA 3K1PA 2M45A 1MDMA 1K79A 2JPBA 1U5TC 4L9TA 1TW2A 3VODA 3C1DA 5ED4A 5CVVA 1ZLJA 4NQWA 1H9TA 1EH8A 4XBFA 1MZBA 1T0FA 2KIUA 3I54A 1VTNC 1T38A 4L18B 3N4MA 2TDXA 1J59A 4ZH4F 3KP5A 4UV8A 3KZYA 3HHHA 1BC8C 2XAHA 4CZZA 4ON0A 1IN5A 4KA4A 1PP8F 3CUOA 2AS5F 1GXPA 1MJBA 4LLGF 4HX4A 5AIPA 5FFXA 3AAFA 2DQLA 2E1CA 3KP6A 1PP7U 1FWZA 3KFWX 2VXZA 2ESNA 5JI6A 4ESBA 2MLKA 1UB9A 2WC2A 1WKMA 1QZYA 5HDNA 1XGOA 4ETSA 1MKMA 1ZGAA 2RC4A 3ZMUA 3KLNA 3JTHA 3LAJA 2D1HA 3D0SA 2QBYA 5CVJA 1O3RA 3I53A 3WTSC 1I1GA 5FO5A 5DD8A 1TLHB 2FBHA 3WE2A 3REOA 1YS7A 2PMUA 3I4PA 5J8CA 2G9WA 3WTZA 4N9IA 1KU7A 4EJOA 5AONA 3ROUA 3E6DA 5D5VB 2IA0A 3N97A 1K7AA 2G7UA 4DNCA 4RAYA 1BIAA 1FYLA 3GFMA 2DU9A 5LGTA 2VE9A 1P4XA 1GHCA 3VOEA 2STTA 3FZVA 1SD5A 2RNJA 3F8FA 4EM0B 3GFIA 1TW3A 3F22A 1CF7B 2DLLA 1QQIA 3ELKA 3V8KA 3QU3A 4M9ZA 5H20A 2QQAA 4O6JA 2C6YA 1ZLKA 5D5XB 2DPUA 1LDDA 2AXLA 2EB7A 4UVCA 3DV8A 2DQRA 1BM9A 5DCMA 2XKPA 2GXBA 1KYZA 4RB0A 4U0YA 2J5PA 4EM2A 4I01A 1BI2A 1U6GA 3L2CA 5CYVA 1K78B 1JXSA 3ZN1A 1Z91A 3CO6C 4XSZF 2OBPA 1QZZA 4GCVA 4R79A 1FY7A 2FNAA 2P7VB 2QZ8A 3IRQA 2XAJA 1XMAA 1R5GA 2NRAC 2XGXA 3QPHA 2ZKZA 3BZ6A 4IRIA 4RGXA 3CUQA 2R7DA 4F7ZA 4PDKA 3VFZA 1QNTA 2K86A 2BV6A 2ZFWA 3K1MA 1FP2A 1SAXA 4PCQA 2KJCA 5BPIA 3J80K 5LHIA 5LRSA 3LSTA 2KIMA 2GAUA 2JSCA 5D8LB 2R3SA 3SHFA 2CO5A 4U88A 4HX8A 1FBSA 3P9KA 4WK8F 2CWEA 3LA3A 2F5EA 4XLPF 1R1VA 1C0WA 5L3BA 4WWCA 2L4AA 2V1UA 3RKYA 1FT9A 5JHUA 3SFZA 1FBUA 1RZ4A 1ZHFA 2EFNA 2FNPA 2K4BA 1O7FA 3ZPLA 1AWCA 3FM5A 2FU4A 3JW4A 4EMSA 5LHHA 1MJAA 1FNNA 1KU2A 2FSWA 2MBFA 3SXYA 4G7OF 3FM3A 3PQKA 4BAYA 5DV5A 2Y0MA 4CDGA 1HW5A 2COMA 4GO1A 1FP1D 3LA7A 1GXQA 1P6RA 1JE8A 3GZ5A 3TO9A 1YS6A 2HOEA 3T1BA 3E5QA 3F8CA 2DI3A 2M87A 1OKRA 2OD5A 2Y75A 3EYIA 1QBJA 2RN7A 5HDGA 2A3SA 3F72A 2VBYA 4HQMA 5HLGA 3BPXA 2XRNA 2QWWA 4S05A 3FX3A 4U0VA 2IRFG 1CGPA 2Q0OA 4O5VA 1O3TA 1HKQA 1MJ9A 1XMKA 2STWA 1S3JA 4Y17A 4A2UA 4UVBA 2NS0A 1O7LA 2DBBA 4L5JA 1LEBA 2FBIA 3JTGA 4I7HA 4I98B 4CYDA 1K6OA 5FD5A 2CG4A 2L3DA 2ELHA 1EH6A 5D5UB 1ZGJA 3LWFA 2P5LC 1HKTA 4PGHA 4RB2C 2PI0A 2FEZA 4LD5A 4KMUX 3RPQA 4AD9A 4U7DA 4LK0F 4K2EA 2P7CB 2NNNA 1S29A 3GXOA 3IC7A 1ONVA 2K02A 1UCRA 2EJRA 2FQ3A 4AIHA 3J80Z 4KDPA 1JHFA 3HTUA 5K5QA 1RUNA 4L5IA 1J9IA 1OMIA 4CO8A 3KP4A 5LRRA 3FMRA 3KCCA 1I5ZA 3KLOA 3M1EA 3R0AA 3WE3A 3E6MA 2DTRA 3IRRA 2QQBA 1LDJA 5EEHA 1W7PB 4I02A 2HKOA 1LEAA 3SZTA 2HDCA 1ZYRF 4M9XA 2CSOA 4G8XA 1ON1A 1BBYA 3ABUA 4EGYA 3WTXC 3K0LA 1DUXC 1KYWA 2GA1A 2E7WA 1HQCA 1L0OC 4TV7A 4YFNF 2H94A 2JT1A 2M30A 1U2WA 2CYYA 2RDPA 2ZMEB 2P6TA 5FB2A 2VONA 2LSOA 4EVIA 3QP6A 5E1WA 4R1HA 2X4HA 3TOAA 4MTDA 4OU0A 2O61A 1D3YA 3PQJA 3ML6A 3M8EA 2FOKA 3EDPA 4LB6B 2W85A 2VOPA 4LG0A 4IJAA 4YIFA 3Q5FA 5J8FA 2P6SA 2VT2A 4FT8A 2MA3A 1U8RA 3DKWA 1BOAA 2LF7A 4I0BA 5K5RA 4YFXF 2HR3A 4DQ2A 3QP5A 1FC3A 3KEOA 1YO5C 1JGSA 2LNBA 1ZG1A 2A5YB 3V7RA 1HXDA 2F5DA 5L3CA 5ICEA 3KP2A 5CVIA 3KETA 3ECOA 4ZYDA 1ZAOA 4ESJA 3KP7A 1RI7A 2MH9A 1WQ2A 1UHWA 1KU9A 5D6FA 4OINF 4LLNA 4LGWA 3EETA 3WU0A 3QAHA 4EM1A 5DUIA 4MQ9F 4KT5C 5K5OA 1BI3A 4AVPA 2D1VA 5IT9K 4N0BA 4EV0A 1DDNA 3R0JA 1G4DA 3I64A 2HGCA 4MHGA 1JHHA 3CTAA 4HOBA 3L00A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D6E A;  4I09 A;  2XAF A;  1ZRF A;  2VBX A;  3I59 B;  4EJV A;  1XSD A;  1IW7 F;  1SFE A;  4BHP A;  1KQ0 A;  3KEQ A;  5HLH A;  4FX0 A;  2K4J A;  1B9N A;  4HYE A;  2Q2E A;  4ZYH A;  3RTR A;  2RQP A;  2EA2 A;  1XDS A;  5E18 F;  3GVA A;  4OIP F;  2HKX A;  4CGZ A;  1D8J A;  1KU3 A;  1B4A A;  4AIK A;  3NQO A;  1R1U A;  2GZW A;  4D0P A;  3MEX A;  3C18 A;  3FXU A;  3LFK A;  4HZF A;  2W25 A;  4RGS A;  4L0Y B;  4RS8 A;  3SZP A;  4QWQ A;  4HAM A;  2ACJ A;  3FWE A;  2UXN A;  1WRJ A;  1T2K A;  5FLX K;  1UFM A;  2UZK A;  2HYF A;  1OPC A;  1TQP A;  1YTY A;  3TGN A;  3F6V A;  2MH2 A;  2PN6 A;  4M6X A;  2PEX A;  5HOO A;  3W6K B;  1KA8 A;  2GWR A;  5ICG A;  2PG4 A;  4LFU A;  2YU3 A;  1XSV A;  1ZRC A;  3LA2 A;  1OYW A;  4PGG A;  1IRF A;  3IKV A;  4RB1 A;  3HOS A;  4OIO F;  3J7A O;  4UV9 A;  2X0L A;  1SMY F;  1QPM A;  3JSO A;  2Z3Y A;  5CVR A;  3RI4 A;  2H6C A;  1IUY A;  4FHT A;  4Q5S F;  1IXR C;  3ZMT A;  2P5V A;  2EFP A;  3M9A A;  3H3U A;  5IT9 Z;  2QEN A;  1XD7 A;  4HA8 A;  2OZ6 A;  4HW0 A;  2A61 A;  4UHT A;  1XGN A;  4HF1 A;  1LDK B;  1ZH5 A;  3DQV C;  4OMY A;  1LJ9 A;  4BYY A;  1U5T A;  1TQM A;  4A6D A;  1YW9 A;  2Y48 A;  4Y13 A;  5DUK A;  1R36 A;  2O03 A;  5HDK A;  5ILU A;  1V3F A;  3V7C A;  1O57 A;  3F8N A;  1MDM B;  1FLI A;  2PMH A;  4L9N A;  1Z05 A;  1F1Z A;  3QOP A;  4WX9 A;  3ULQ B;  3F6O A;  4ZYG A;  3F8B A;  2GA2 A;  4G9Y A;  3ISP A;  2KKO A;  1PDN C;  4A0X A;  2PFB A;  1YFH A;  3ZN0 A;  2VN2 A;  2LKP A;  2HQN A;  3K1N A;  5FFZ A;  5LEK A;  3CJN A;  3RYP A;  3MAJ A;  5HVQ C;  1QO0 D;  2VBW A;  1MGT A;  4P96 A;  2IPQ X;  3D5L A;  2VBZ A;  2O8X A;  2WTE A;  1T6S A;  5CJ9 A;  1HBX G;  1DPR A;  2F5F A;  2GIV A;  2XAG A;  2HZT A;  2VOO A;  5FLX Z;  1XDU A;  3MQ0 A;  4UUV A;  4UNO A;  3H92 A;  1G6N A;  2FML A;  1T39 A;  3COA C;  3G3Z A;  4A12 A;  3HIF A;  3BDD A;  1KGS A;  5JVT A;  1BN5 A;  3GZ6 A;  2V1X A;  5ICC A;  4MNU A;  2KRF A;  1R7J A;  3E5U A;  4LK1 F;  2ZNY A;  5E1Z B;  2BBY A;  2QBY B;  3LQQ A;  3F3X A;  4U7B A;  2Z5U A;  2H09 A;  3R60 A;  3LQR A;  4BHB A;  4NB5 A;  5ILV A;  4HDU A;  3DF8 A;  2DK5 A;  3F8M A;  2Q8K A;  2EK5 A;  4WCG A;  3RKX A;  4KIC A;  1E17 A;  2D45 A;  2O3F A;  5ILS A;  1Q1H A;  2YPR A;  5LGU A;  2ZNZ A;  3F21 A;  4BHC A;  2V79 A;  5LHG A;  3GYH X;  1YLF A;  5DYM A;  4CIC A;  4OIR F;  3MWM A;  3ABT A;  3DPL C;  1G3T A;  1EH7 A;  3T5X A;  3IHU A;  4CHU A;  5IT3 A;  4BXU A;  2B0L A;  2HWV A;  2P4W A;  3I71 A;  2JZY A;  1R1T A;  2HEO A;  2VOD A;  3ERE D;  1ON2 A;  4U0W A;  4GGG A;  3BJO A;  5LLQ A;  1RUO A;  4YG2 F;  3BY6 A;  5HS7 A;  5DCM B;  1XN7 A;  5D4R A;  3HRM A;  3EUH A;  2H27 A;  4ENJ A;  2LF8 A;  1Z9C A;  4LMY A;  2PQ8 A;  3GF2 A;  3MCZ A;  2QYO A;  4A5M A;  3T8R A;  1OYI A;  5H6R A;  2NNY A;  2A6H F;  5E20 A;  1HW1 A;  4IF4 A;  4O3M A;  2Z9O A;  4GXO A;  4A0Y A;  1I27 A;  3IWZ A;  4UVA A;  4MQV A;  2V9V A;  1Z6T A;  3P9I A;  1HST A;  2FRH A;  4R8H A;  3CUQ B;  3DEU A;  4KIF A;  3E3V A;  2FXA A;  2BGC A;  2YX7 A;  4P5O A;  3K2Z A;  4OMZ A;  5CVU A;  1H9G A;  1LQ1 A;  2CFX A;  1IAW A;  5F1R A;  3TKY A;  1IN4 A;  2OQR A;  3S2W A;  1CF7 A;  4WXC A;  2MC3 A;  5HS9 A;  1W5T A;  4P55 A;  3L09 A;  4KIG A;  4YFK F;  1FYM A;  2EA4 A;  2VT3 A;  5ICF A;  5L3D A;  4KYW A;  3BOQ A;  2H6B A;  1YIO A;  1WSU A;  2QM3 A;  2Z33 A;  3HSR A;  1ZG3 A;  2M5W A;  4G7Z F;  2PLY A;  5D5W B;  3L9F A;  1SD6 A;  1J5Y A;  2XKO A;  4P9U A;  3R4K A;  2EFW A;  3DXJ F;  1B9M A;  3KZZ A;  3G73 A;  3WG9 A;  3ZP5 A;  2JRT A;  1K78 A;  1LB2 A;  1U78 A;  1DPU A;  3J81 K;  3B73 A;  1O3Q A;  3ZMV A;  2W84 A;  5A2Q Z;  2IP2 A;  3QPT A;  4KN4 X;  3ECH A;  2IVM A;  1FYK A;  5L3G A;  1B1B A;  1S7A A;  4L0Z B;  2BE5 F;  3I5U A;  2L54 A;  5BPD A;  1NHA A;  2M8E A;  2K7L A;  3RYR A;  1ZAR A;  2QVO A;  3R61 A;  2WV0 A;  1S8N A;  4ZZD A;  3V8L A;  3MFK A;  3K9T A;  3GO5 A;  1P92 A;  3K69 A;  5BOX A;  4M9S A;  3V4G A;  3H3Z A;  2HQR A;  2CW0 F;  3CO7 C;  3FMS A;  3F23 A;  3CUQ C;  1AOY A;  3GFL A;  3NRV A;  1IXS B;  3DFG A;  3WTY C;  5L3F A;  4MEX F;  3TO6 A;  1XGM A;  2VE8 A;  2R7F A;  5JR3 A;  3IL2 A;  4Q47 A;  4CXF A;  2RV8 A;  1RIO H;  4XLN F;  3HUG A;  5HS8 A;  1WI9 A;  3VEP A;  4BNC A;  2ADU A;  4M74 A;  4HLY A;  3FMQ A;  5D4S A;  2F2E A;  3IKT A;  4A6E A;  3T0Y A;  2EV0 A;  4G7H F;  2HFH A;  5EEG A;  5CLS A;  4B8X A;  3GX4 X;  3SQN A;  3TQN A;  4ESF A;  3WU1 B;  2ZJ2 A;  3FHZ A;  3ZMS A;  1G3S A;  4M71 A;  3KE2 A;  2OQG A;  1SFX A;  2A07 F;  1W4M A;  3E6B A;  2FBK A;  2D2W A;  3WTT C;  2IT0 A;  1IF1 A;  2NAZ A;  2DAO A;  2Z99 A;  3PFI A;  4N9H A;  1G3W A;  2DFI A;  2ZO4 A;  1UHM A;  5FGM A;  4B09 A;  4GYG A;  4QLC U;  4XSX F;  4HV6 A;  3BWG A;  5F64 A;  4Z2Y A;  3VB2 A;  1F5T A;  2L02 A;  1LVA A;  4KUM A;  2E7X A;  2ZCW A;  2RVC A;  2PJP A;  4WXD A;  4LB5 A;  1IN7 A;  3WTV C;  1IN6 A;  4MGR A;  2YX4 A;  1IRG A;  2XAS A;  4ENM A;  1FPQ A;  3V8J A;  4ZZL A;  3HOT A;  5LEJ A;  3J81 Z;  5E1X A;  5TJJ A;  1YW8 A;  4OIQ F;  2UWM A;  3KP3 A;  4IRH A;  1PUE E;  3WTU C;  2XRO A;  2GXG A;  2A69 F;  1XGS A;  2ISY A;  5HLI A;  3RKW A;  2OAZ A;  2JPC A;  2P5K A;  1FOK A;  3MZY A;  4Y15 A;  2EFO A;  4IXA A;  2HS5 A;  2XVC A;  1R00 A;  1SFU A;  2XHK A;  2DO7 A;  2ZBK A;  3WTW C;  3WGI A;  3Q9V A;  4BH9 A;  5FD6 A;  1HSJ A;  1STZ A;  3C3W A;  1S7O A;  2HTS A;  3GLX A;  3O2P E;  4JBA A;  4LG0 B;  4MTE A;  2VC0 A;  1HKS A;  4H0E A;  1GVJ A;  4RAZ A;  2FE3 A;  2DW4 A;  4ENK A;  4I0A A;  1RNL A;  1D5V A;  2XIG A;  2L01 A;  1I6X A;  5E8I A;  1IXC A;  3M8F A;  3RIR A;  2XAQ A;  1W7P A;  4HF0 A;  2K27 A;  2FMY A;  3HTS B;  1SD4 A;  5TRD A;  4IRG A;  2O6G E;  2O0Y A;  4BQA A;  3HSE A;  3DPT A;  1DP7 P;  2G7H A;  3ZMZ A;  2OA4 A;  3P9C A;  3P7N A;  4HX7 A;  3U9G A;  1LNW A;  1S6L A;  1FX7 A;  3BJ6 A;  5LGN A;  3HHG A;  2E1N A;  5DCF A;  4RGR A;  5F6F A;  4KFC A;  5E17 F;  2YSR A;  4WXH A;  5DD4 A;  2V1D A;  4G6Q A;  3RDI A;  1R23 A;  2ETH A;  2ZME A;  1SD7 A;  1W5S A;  2LDU A;  5DDG A;  2XUB A;  3BJA A;  5LBQ A;  4IHS A;  3WOD F;  3BPV A;  3V7S A;  4UXN A;  2KIF A;  1R22 A;  3DP7 A;  2PBI A;  4NHJ A;  1XB4 A;  4L9J A;  4EJU A;  3GWZ A;  1B6A A;  1U3E M;  2IW5 A;  3E97 A;  2OU2 A;  1YW7 A;  1V4R A;  4ZYE A;  2GQQ A;  3W6J B;  1ULY A;  1YG2 A;  1G3Y A;  2MD5 A;  3I0T A;  1KQ8 A;  1MD0 A;  3M7G A;  3QRF F;  1FSH A;  4G94 A;  3JSP A;  4RGU A;  4Q4Z F;  3RJP A;  3R6S A;  4IPA A;  1IN8 A;  1EV7 A;  3EQL F;  5D8K B;  1FZP B;  2YR2 A;  5ERI A;  4RB3 C;  1D8K A;  2QUF A;  5L3E A;  2EFQ A;  3LAP A;  4G6D A;  2FA5 A;  2W57 A;  3U2R A;  4IHT A;  2A68 F;  4EJT A;  3BP8 A;  3HRS A;  2IJL A;  3GW2 A;  2QLZ A;  1FBQ A;  3E5X A;  1Z6R A;  1XCV A;  4PZJ A;  4A0Z A;  5BMZ A;  5KVR A;  4Q48 A;  3EYY A;  2BEO A;  5A2Q K;  1BI1 A;  3HSF A;  2EWN A;  2F5C A;  1ZN2 A;  4KIB A;  2DT5 A;  3ZQ7 A;  1YYV A;  3ZMD A;  3E6C C;  1ODD A;  5BS6 A;  5E8G A;  1Z7U A;  3MZH A;  3JAM K;  2HTJ A;  1TBX A;  1L3L A;  4EGZ A;  3GFJ A;  1W7P D;  1YQA A;  5JFR A;  4XRF A;  6PAX A;  3U1D A;  1A04 A;  3RPU A;  1P4A A;  2RGV A;  3TOB A;  1OR7 A;  1KQ9 A;  4EJW A;  5DEQ A;  3I59 A;  1J7K A;  1FSE A;  2RKH A;  4YII A;  2WWY A;  4MEY F;  1XSX A;  3FXQ A;  5KK1 A;  3NEU A;  2HYG D;  3TO7 A;  5BQT A;  2EV6 A;  4JK1 X;  2ISZ A;  1TNT A;  1J2X A;  1SMT A;  2ZXJ A;  3WGH A;  2CQK A;  4HBL A;  4FX4 A;  4M6Y A;  2MLG A;  2VC1 A;  4HQE A;  1BC7 C;  1R58 A;  1F9N A;  4GYI A;  4HV5 A;  1OYY A;  1XCB A;  5J6X A;  2A6E F;  1TNS A;  3GUD A;  3Q9S A;  2XV4 S;  1J0R A;  2ESH A;  4HF2 A;  3HRU A;  2DPD A;  3IWF A;  2NYX A;  4KNY A;  3OV8 A;  4L9V A;  1U5T B;  4M72 A;  1BJA A;  5AIQ A;  3FF5 A;  4M73 A;  4AIJ A;  1TTY A;  3WGG A;  3I58 A;  2QQ9 A;  3B02 A;  1UST A;  4WF2 A;  2IA1 A;  2BYV E;  1B59 A;  4KMF A;  3T8T A;  4LLL A;  3HRT A;  3O6B B;  4A5N A;  4E70 A;  4KN7 X;  1F4K A;  3OOP A;  1T98 A;  2UXX A;  2L4M A;  1H0M A;  2M1B A;  1QGP A;  4HDV A;  1X3U A;  1ZG5 A;  4IVN A;  2W24 A;  3TDU C;  2DK8 A;  4P9F A;  5H6Q A;  5K1Y A;  1BIB A;  2JTV A;  2P8T A;  1BI0 A;  3QU6 A;  1TQI A;  4AWX B;  3L7W A;  4EQQ A;  1I1S A;  2V6C A;  2J5O A;  4HLX A;  4OOI A;  1USS A;  4S04 A;  1IZ1 A;  1P2F A;  3O3K A;  1Y0U A;  1WWX A;  3JAM Z;  4ENN A;  1ZRD A;  1P4W A;  4JQF A;  1HW2 A;  3HYI A;  1Z1D A;  1REP C;  3CDH A;  3FXR A;  2KJB A;  3BRO A;  1E2X A;  2CGP A;  2OZU A;  4ASN A;  3C7J A;  3TDZ C;  1O3S A;  4LJZ F;  2EV5 A;  3CLO A;  1ZRE A;  2IA2 A;  1J75 A;  4I2O A;  2FF4 A;  1R5H A;  3GEZ A;  3K1P A;  2M45 A;  1MDM A;  1K79 A;  2JPB A;  1U5T C;  4L9T A;  1TW2 A;  3VOD A;  3C1D A;  5ED4 A;  5CVV A;  1ZLJ A;  4NQW A;  1H9T A;  1EH8 A;  4XBF A;  1MZB A;  1T0F A;  2KIU A;  3I54 A;  1VTN C;  1T38 A;  4L18 B;  3N4M A;  2TDX A;  1J59 A;  4ZH4 F;  3KP5 A;  4UV8 A;  3KZY A;  3HHH A;  1BC8 C;  2XAH A;  4CZZ A;  4ON0 A;  1IN5 A;  4KA4 A;  1PP8 F;  3CUO A;  2AS5 F;  1GXP A;  1MJB A;  4LLG F;  4HX4 A;  5AIP A;  5FFX A;  3AAF A;  2DQL A;  2E1C A;  3KP6 A;  1PP7 U;  1FWZ A;  3KFW X;  2VXZ A;  2ESN A;  5JI6 A;  4ESB A;  2MLK A;  1UB9 A;  2WC2 A;  1WKM A;  1QZY A;  5HDN A;  1XGO A;  4ETS A;  1MKM A;  1ZGA A;  2RC4 A;  3ZMU A;  3KLN A;  3JTH A;  3LAJ A;  2D1H A;  3D0S A;  2QBY A;  5CVJ A;  1O3R A;  3I53 A;  3WTS C;  1I1G A;  5FO5 A;  5DD8 A;  1TLH B;  2FBH A;  3WE2 A;  3REO A;  1YS7 A;  2PMU A;  3I4P A;  5J8C A;  2G9W A;  3WTZ A;  4N9I A;  1KU7 A;  4EJO A;  5AON A;  3ROU A;  3E6D A;  5D5V B;  2IA0 A;  3N97 A;  1K7A A;  2G7U A;  4DNC A;  4RAY A;  1BIA A;  1FYL A;  3GFM A;  2DU9 A;  5LGT A;  2VE9 A;  1P4X A;  1GHC A;  3VOE A;  2STT A;  3FZV A;  1SD5 A;  2RNJ A;  3F8F A;  4EM0 B;  3GFI A;  1TW3 A;  3F22 A;  1CF7 B;  2DLL A;  1QQI A;  3ELK A;  3V8K A;  3QU3 A;  4M9Z A;  5H20 A;  2QQA A;  4O6J A;  2C6Y A;  1ZLK A;  5D5X B;  2DPU A;  1LDD A;  2AXL A;  2EB7 A;  4UVC A;  3DV8 A;  2DQR A;  1BM9 A;  5DCM A;  2XKP A;  2GXB A;  1KYZ A;  4RB0 A;  4U0Y A;  2J5P A;  4EM2 A;  4I01 A;  1BI2 A;  1U6G A;  3L2C A;  5CYV A;  1K78 B;  1JXS A;  3ZN1 A;  1Z91 A;  3CO6 C;  4XSZ F;  2OBP A;  1QZZ A;  4GCV A;  4R79 A;  1FY7 A;  2FNA A;  2P7V B;  2QZ8 A;  3IRQ A;  2XAJ A;  1XMA A;  1R5G A;  2NRA C;  2XGX A;  3QPH A;  2ZKZ A;  3BZ6 A;  4IRI A;  4RGX A;  3CUQ A;  2R7D A;  4F7Z A;  4PDK A;  3VFZ A;  1QNT A;  2K86 A;  2BV6 A;  2ZFW A;  3K1M A;  1FP2 A;  1SAX A;  4PCQ A;  2KJC A;  5BPI A;  3J80 K;  5LHI A;  5LRS A;  3LST A;  2KIM A;  2GAU A;  2JSC A;  5D8L B;  2R3S A;  3SHF A;  2CO5 A;  4U88 A;  4HX8 A;  1FBS A;  3P9K A;  4WK8 F;  2CWE A;  3LA3 A;  2F5E A;  4XLP F;  1R1V A;  1C0W A;  5L3B A;  4WWC A;  2L4A A;  2V1U A;  3RKY A;  1FT9 A;  5JHU A;  3SFZ A;  1FBU A;  1RZ4 A;  1ZHF A;  2EFN A;  2FNP A;  2K4B A;  1O7F A;  3ZPL A;  1AWC A;  3FM5 A;  2FU4 A;  3JW4 A;  4EMS A;  5LHH A;  1MJA A;  1FNN A;  1KU2 A;  2FSW A;  2MBF A;  3SXY A;  4G7O F;  3FM3 A;  3PQK A;  4BAY A;  5DV5 A;  2Y0M A;  4CDG A;  1HW5 A;  2COM A;  4GO1 A;  1FP1 D;  3LA7 A;  1GXQ A;  1P6R A;  1JE8 A;  3GZ5 A;  3TO9 A;  1YS6 A;  2HOE A;  3T1B A;  3E5Q A;  3F8C A;  2DI3 A;  2M87 A;  1OKR A;  2OD5 A;  2Y75 A;  3EYI A;  1QBJ A;  2RN7 A;  5HDG A;  2A3S A;  3F72 A;  2VBY A;  4HQM A;  5HLG A;  3BPX A;  2XRN A;  2QWW A;  4S05 A;  3FX3 A;  4U0V A;  2IRF G;  1CGP A;  2Q0O A;  4O5V A;  1O3T A;  1HKQ A;  1MJ9 A;  1XMK A;  2STW A;  1S3J A;  4Y17 A;  4A2U A;  4UVB A;  2NS0 A;  1O7L A;  2DBB A;  4L5J A;  1LEB A;  2FBI A;  3JTG A;  4I7H A;  4I98 B;  4CYD A;  1K6O A;  5FD5 A;  2CG4 A;  2L3D A;  2ELH A;  1EH6 A;  5D5U B;  1ZGJ A;  3LWF A;  2P5L C;  1HKT A;  4PGH A;  4RB2 C;  2PI0 A;  2FEZ A;  4LD5 A;  4KMU X;  3RPQ A;  4AD9 A;  4U7D A;  4LK0 F;  4K2E A;  2P7C B;  2NNN A;  1S29 A;  3GXO A;  3IC7 A;  1ONV A;  2K02 A;  1UCR A;  2EJR A;  2FQ3 A;  4AIH A;  3J80 Z;  4KDP A;  1JHF A;  3HTU A;  5K5Q A;  1RUN A;  4L5I A;  1J9I A;  1OMI A;  4CO8 A;  3KP4 A;  5LRR A;  3FMR A;  3KCC A;  1I5Z A;  3KLO A;  3M1E A;  3R0A A;  3WE3 A;  3E6M A;  2DTR A;  3IRR A;  2QQB A;  1LDJ A;  5EEH A;  1W7P B;  4I02 A;  2HKO A;  1LEA A;  3SZT A;  2HDC A;  1ZYR F;  4M9X A;  2CSO A;  4G8X A;  1ON1 A;  1BBY A;  3ABU A;  4EGY A;  3WTX C;  3K0L A;  1DUX C;  1KYW A;  2GA1 A;  2E7W A;  1HQC A;  1L0O C;  4TV7 A;  4YFN F;  2H94 A;  2JT1 A;  2M30 A;  1U2W A;  2CYY A;  2RDP A;  2ZME B;  2P6T A;  5FB2 A;  2VON A;  2LSO A;  4EVI A;  3QP6 A;  5E1W A;  4R1H A;  2X4H A;  3TOA A;  4MTD A;  4OU0 A;  2O61 A;  1D3Y A;  3PQJ A;  3ML6 A;  3M8E A;  2FOK A;  3EDP A;  4LB6 B;  2W85 A;  2VOP A;  4LG0 A;  4IJA A;  4YIF A;  3Q5F A;  5J8F A;  2P6S A;  2VT2 A;  4FT8 A;  2MA3 A;  1U8R A;  3DKW A;  1BOA A;  2LF7 A;  4I0B A;  5K5R A;  4YFX F;  2HR3 A;  4DQ2 A;  3QP5 A;  1FC3 A;  3KEO A;  1YO5 C;  1JGS A;  2LNB A;  1ZG1 A;  2A5Y B;  3V7R A;  1HXD A;  2F5D A;  5L3C A;  5ICE A;  3KP2 A;  5CVI A;  3KET A;  3ECO A;  4ZYD A;  1ZAO A;  4ESJ A;  3KP7 A;  1RI7 A;  2MH9 A;  1WQ2 A;  1UHW A;  1KU9 A;  5D6F A;  4OIN F;  4LLN A;  4LGW A;  3EET A;  3WU0 A;  3QAH A;  4EM1 A;  5DUI A;  4MQ9 F;  4KT5 C;  5K5O A;  1BI3 A;  4AVP A;  2D1V A;  5IT9 K;  4N0B A;  4EV0 A;  1DDN A;  3R0J A;  1G4D A;  3I64 A;  2HGC A;  4MHG A;  1JHH A;  3CTA A;  4HOB A;  3L00 A; 
#chains in the Genus database with same CATH topology
 5D6E A;  1HDD C;  4I09 A;  2XAF A;  1ZRF A;  1X1A A;  2W7N A;  2VBX A;  3DU5 A;  4BUP A;  1W0T A;  2DJN A;  3I59 B;  1FMW A;  2JN6 A;  4EJV A;  1XSD A;  2O7O A;  2X6W A;  1IW7 F;  1YIT I;  5M5X J;  2RAE A;  1SFE A;  3B6A A;  2DMU A;  3MKZ A;  2FD5 A;  1J09 A;  1D1C A;  1KQ0 A;  3KEQ A;  4BHP A;  2NVU B;  5HLH A;  4FX0 A;  2K4J A;  1B9N A;  4HYE A;  4B3A A;  2Q2E A;  3ASN H;  3JRA A;  3UKG A;  4ZYH A;  1NG7 A;  4MFE A;  3RTR A;  2RQP A;  1TWG J;  2M2E A;  2EA2 A;  2QSF X;  4ABZ A;  4GDF A;  1XDS A;  5E18 F;  3GVA A;  4OIP F;  3CMM A;  2LTP A;  3H3V K;  1VQ7 I;  3G71 I;  3AL0 B;  1NK2 P;  3MKW B;  2HKX A;  2B9S A;  4CGZ A;  5FKO A;  2NVX J;  5K7H A;  2G0E A;  2PJR A;  1D8J A;  1P7I A;  2QQ8 A;  5EZG A;  5HNH A;  1KU3 A;  1B4A A;  4AIK A;  1HOM A;  3NQO A;  1R1U A;  2GZW A;  2OUM A;  4F3Q A;  4D0P A;  4Y7N J;  1VQO I;  1VQP I;  3BC8 A;  2X6O A;  3MEX A;  3IAS 2;  3M8J A;  5FRM A;  2L0K A;  3C18 A;  3FXU A;  3LFK A;  3JRH A;  4HZF A;  4N4N B;  5EGO A;  2W25 A;  4RGS A;  4L0Y B;  2CV1 A;  4RS8 A;  1SAN A;  3SZP A;  4QWQ A;  3S32 A;  4HAM A;  3HOY J;  2ACJ A;  3FWE A;  2QA4 I;  1IRX A;  2UXN A;  1WRJ A;  2EIJ H;  1T2K A;  1UFM A;  1SFK A;  5FLX K;  3UNG C;  2UZK A;  4DBQ A;  2HVS A;  2HYF A;  1OPC A;  2QF7 A;  1TQP A;  2WAE A;  1YTY A;  2LFB A;  5KNL A;  1DGR M;  4A3I J;  2B7E A;  3TGN A;  3F6V A;  2MH2 A;  4AUX A;  3HB9 A;  1XPX A;  2PN6 A;  1YOV B;  2H1K A;  4M6X A;  2PEX A;  5HOO A;  2MGQ A;  3W6K B;  1KA8 A;  2GWR A;  5ICG A;  2LR8 A;  2PG4 A;  4LFU A;  2IS1 A;  2YU3 A;  2QCO A;  3DKY A;  5EF6 A;  4CYC A;  2L2O A;  1FOY A;  1XSV A;  1ZRC A;  4M3G A;  3IUO A;  3LA2 A;  1OYW A;  2QKL B;  4CCM A;  4PGG A;  4M6V A;  2NVQ J;  5B1A H;  1IRF A;  3IKV A;  4RB1 A;  2JRM A;  3HOS A;  1MBG A;  1ETV A;  2L5Q A;  4OIO F;  3J7A O;  2HU9 A;  4UV9 A;  2X0L A;  1MBE A;  4D5F A;  1MNE A;  2BVM A;  4RAG A;  1SMY F;  3FXO A;  2F5V A;  1QPM A;  5M5W J;  1G8X A;  2Y2Z A;  1OR7 C;  3JSO A;  2Z3Y A;  3LSI A;  1YRN A;  1JKO C;  5CVR A;  3GTJ J;  3RI4 A;  2H6C A;  4XIC A;  4XK4 A;  1IUY A;  3CES A;  4FHT A;  4Q5S F;  1IXR C;  3I3L A;  3ZMT A;  2R7O A;  2P5V A;  2EFP A;  3M9A A;  1OLT A;  1BR1 A;  3H3U A;  5IT9 Z;  3OYI A;  1B72 A;  2QEN A;  4M3E A;  2DA4 A;  2DOE A;  4PJN A;  4F55 A;  3H36 A;  1XD7 A;  2M3A A;  4HA8 A;  2DTZ A;  4KIT B;  2OZ6 A;  1QPI A;  3FIS A;  1ZGW A;  2W82 A;  4HW0 A;  2A61 A;  4UHT A;  1XGN A;  3AL0 C;  4IOA F;  2WAQ N;  1WVR A;  2KP6 A;  4MIM A;  4HF1 A;  1LDK B;  1ZH5 A;  3MZ8 A;  4C2U A;  1I3A A;  3DQV C;  4OMY A;  3S2D J;  1X3Z B;  1LJ9 A;  1ZEL A;  1U5T A;  4I76 A;  4BYY A;  1Y1W J;  1TQM A;  3KEY A;  3AG4 H;  3H9G A;  3VYT B;  4A6D A;  1YW9 A;  2Y48 A;  3A0B C;  4Y13 A;  1IG7 A;  2ELJ A;  3BZC A;  2OCC H;  1IO2 A;  5DUK A;  2WY8 Q;  1R36 A;  2CUZ A;  2O03 A;  2E1O A;  5HDK A;  5IOY A;  5ILU A;  1O4X A;  3DU6 A;  1V3F A;  3OMY A;  3ZOB A;  3V7C A;  1V5F A;  3S1M J;  1O57 A;  3F8N A;  3OIP A;  4BEH B;  3S1R J;  2L9S A;  1MDM B;  5H2F C;  1FLI A;  5F08 A;  2PMH A;  4L9N A;  1X2M A;  5GAH J;  1Z05 A;  1F1Z A;  2IGO A;  3QOP A;  4WX9 A;  3ULQ B;  2DT7 B;  2ZXI A;  3TL4 X;  3LSG A;  3F6O A;  4ZYG A;  1YI2 I;  3F8B A;  1GUU A;  4IOC F;  2GA2 A;  2BY2 A;  3SFI A;  4B48 A;  4G9Y A;  4XNF A;  3ISP A;  2KKO A;  3SEZ A;  2EIL H;  3LSP A;  3HC7 A;  4C2T A;  1PDN C;  4AYB A;  4NQW B;  4A0X A;  3DBR B;  4AU7 A;  2PFB A;  4YEJ A;  1YFH A;  3ZN0 A;  2E71 A;  4CZC A;  2VN2 A;  1OFC X;  3C2G A;  3HGG A;  1PUF B;  2LKP A;  4LOC A;  2L7Z A;  3PUF A;  1QVU A;  2HQN A;  4FE4 A;  3OYK A;  3K1N A;  5FFZ A;  5LEK A;  4A3K J;  1EF4 A;  2PX9 A;  3CJN A;  3RYP A;  3MAJ A;  1AHD P;  2XPW A;  1R4N B;  5HVQ C;  1QO0 D;  1T56 A;  2VBW A;  3X2Q H;  1MGT A;  3BQZ A;  4P96 A;  2LBF A;  2IPQ X;  3D5L A;  3CCR I;  3IH2 A;  1Y8Q B;  1V5G A;  1BR4 A;  1B8I A;  2VBZ A;  2O8X A;  4OAY A;  2WTE A;  2ECB A;  1T6S A;  2EZI A;  5CJ9 A;  3HG9 A;  5CPR B;  4IEJ A;  5EG0 B;  1HBX G;  4OWR B;  1DPR A;  1I39 A;  2F5F A;  2GIV A;  1FIP A;  4D1Q A;  2XAG A;  2HZT A;  2VOO A;  5FLX Z;  1XDU A;  3MQ0 A;  4G12 A;  1FEX A;  2XC7 A;  4ZTF A;  4UUV A;  4UNO A;  3H92 A;  5J1R A;  2WB1 N;  3GTM J;  1G6N A;  2FML A;  1YE9 A;  1E3P A;  1T39 A;  3COA C;  3G3Z A;  4HPQ A;  4A12 A;  2VKV A;  3HIF A;  3BDD A;  3PUB A;  4IO9 F;  3BR6 A;  1KGS A;  3MD2 A;  2R7X A;  3TW7 A;  4DIQ A;  1BN5 A;  4BGD A;  5JVT A;  3JRB A;  2XGD A;  3GZ6 A;  2F4M B;  3QPS A;  2GLO A;  2V6E A;  2V1X A;  5ICC A;  4MNU A;  2HNH A;  2KRF A;  2MC4 A;  4XKV A;  1R7J A;  2K9L A;  3E5U A;  5J1Y A;  4LK1 F;  5JLW A;  4GFB A;  2ZNY A;  5E1Z B;  2BBY A;  3ZR8 X;  2I5U A;  2QBY B;  3LQQ A;  2LMD A;  1V54 H;  2LC2 A;  3F3X A;  3GTG J;  2PMZ N;  3KYC B;  4QSH A;  3J7Z I;  4U7B A;  2Z5U A;  2AQF A;  2H09 A;  3HXL A;  3R60 A;  4PK4 A;  5JLX A;  3LQR A;  2Y9Y A;  4BHB A;  4NB5 A;  5ILV A;  4HDU A;  1JJ8 C;  3DF8 A;  2DK5 A;  3F8M A;  3J7A Y;  2Q8K A;  2EK5 A;  4WCG A;  3RKX A;  3DWL E;  4KIC A;  1MMD A;  1E17 A;  2D45 A;  1X4P A;  3GLL A;  2O3F A;  5ILS A;  5TIS C;  4A69 C;  1YHQ I;  1Q1H A;  2YPR A;  5LGU A;  2ZNZ A;  3F21 A;  4BHC A;  2V79 A;  5J47 A;  5LHG A;  3GYH X;  1RPW A;  3LSH A;  5E3O A;  1YLF A;  5DYM A;  4CIC A;  3AG1 H;  4OIR F;  3CJQ B;  3H5N A;  3MWM A;  2BXY A;  1X1B A;  3ABT A;  4XRS A;  3FDY A;  4IHW A;  1VQN I;  3DPL C;  1G3T A;  3JRF A;  1Z3X A;  3JRI A;  1JKP C;  1EH7 A;  5KAF C;  5E3M A;  4BXF A;  3T5X A;  3W2V A;  1T0F C;  3IHU A;  4J01 A;  5IT3 A;  4CHU A;  3S2H J;  2JVG A;  4BXU A;  2B0L A;  3DTK A;  2DMN A;  2HWV A;  2P4W A;  3H35 A;  1JJ6 C;  1WH7 A;  1TWC J;  3I71 A;  4XN3 A;  2JZY A;  3HOV J;  1WI3 A;  1E3H A;  1R49 A;  2ZXW H;  2HVR A;  2R5Y A;  1R1T A;  2HEO A;  2VOD A;  3ERE D;  3L2R A;  1ON2 A;  4DJA A;  3TBI A;  1JTX A;  2V1N A;  2EQR A;  4U0W A;  2FJ1 A;  3UR3 C;  9ANT A;  1JKR C;  3RZO J;  4GGG A;  3BJO A;  5LLQ A;  1BA5 A;  1RUO A;  4D7M A;  4YG2 F;  3BY6 A;  5HS7 A;  5DCM B;  1VQM I;  1XN7 A;  5D4R A;  5K7F A;  2CU7 A;  3HRM A;  2VKD A;  3EUH A;  2H27 A;  5HNF A;  3BT9 A;  4ENJ A;  2R7V A;  2LF8 A;  1U0J A;  2M34 A;  1Z9C A;  4CUG A;  2IS4 A;  4LMY A;  1Z3Y A;  2R7R A;  1RR8 C;  2PQ8 A;  3GF2 A;  2BZT A;  4B43 A;  3MCZ A;  2QYO A;  3ZCO A;  2DMT A;  4A5M A;  3T8R A;  2CV2 A;  1OYI A;  4BJ5 C;  2L7F P;  5H6R A;  2NNY A;  3HKZ A;  4Z6Y A;  3SDG A;  2A6H F;  2MFZ A;  5E20 A;  5FLV A;  2Q1Z B;  3BTL A;  1HW1 A;  2HPM A;  4IF4 A;  5F1J A;  2Z9O A;  4BS9 A;  4O3M A;  4GXO A;  4A0Y A;  1HA8 A;  1I27 A;  4XOR A;  3IWZ A;  4UVA A;  4MQV A;  3BTI A;  2V9V A;  1Z6T A;  4BBS J;  3D5S C;  1HST A;  2FRH A;  3P9I A;  4R8H A;  4F91 B;  1ZTR A;  4N4O B;  3CUQ B;  3DEU A;  4KIF A;  1ZKG A;  1ENH A;  3E3V A;  2FXA A;  2BGC A;  2YX7 A;  1Q1V A;  4P5O A;  3OYC A;  3K2Z A;  4OMZ A;  2I10 A;  5CVU A;  1H9G A;  1F43 A;  3RKQ A;  1LQ1 A;  2CFX A;  1IAW A;  5F1R A;  3L2U A;  2JMW A;  3BG9 A;  1W36 D;  1QU3 A;  3HOW J;  3TKY A;  1IN4 A;  2OQR A;  4FCY A;  1EJ9 A;  3S2W A;  4S0H B;  1CF7 A;  4WXC A;  2MC3 A;  5HS9 A;  1W5T A;  4P55 A;  4FTH A;  2ZJQ F;  1VQ5 I;  3L09 A;  3OYE A;  3MVP A;  2GIZ A;  4KIG A;  4YFK F;  1FYM A;  3A2K A;  3RZD J;  4PJ0 C;  2EA4 A;  2VT3 A;  3K70 D;  2IGM A;  2VB6 A;  5ICF A;  5L3D A;  4KYW A;  3BOQ A;  2H6B A;  2M9H A;  1YIO A;  4NC6 A;  1WSU A;  2R7Q A;  2QM3 A;  3C2H A;  3ZQQ A;  2Z33 A;  3HSR A;  5GTH C;  1ZG3 A;  2M5W A;  4G7Z F;  2PLY A;  3CCQ I;  5D5W B;  3L9F A;  1SD6 A;  2DJI A;  1J5Y A;  2XKO A;  4P9U A;  3R4K A;  2EFW A;  2OV7 A;  2K9Q A;  3BR2 A;  2E34 A;  3VSL A;  3DXJ F;  3OYB A;  2VQG A;  1B9M A;  1YX3 A;  2LVS A;  2VI6 A;  3A03 A;  3KZZ A;  3G73 A;  2E1M B;  4XKB A;  3WG9 A;  1MMG A;  3ZP5 A;  2JRT A;  4EEF G;  3CF2 A;  1K78 A;  2E2J J;  1MSF C;  1LB2 A;  1U78 A;  2BY1 A;  1DPU A;  4NDL A;  3J81 K;  3B73 A;  1O3Q A;  3ZMV A;  2W84 A;  5A2Q Z;  2IP2 A;  1M1E B;  3QPT A;  4F93 B;  1ZQ3 P;  4KN4 X;  4EAT A;  3ECH A;  2IVM A;  4PJM A;  2V7F A;  1FYK A;  2WAD A;  5L3G A;  1B1B A;  1S7A A;  1UMQ A;  2BE5 F;  4L0Z B;  3I5U A;  1XC5 A;  2L54 A;  2VUM J;  5BPD A;  2LK2 A;  2BXZ A;  1HCR A;  2CJJ A;  1NHA A;  2HPI A;  3G1L A;  2JVH A;  4ITV A;  3ABK H;  4KJZ A;  1U8B A;  2M8E A;  1UG0 A;  1EA3 A;  3ABL H;  5BNG A;  2K7L A;  2W1O A;  3RYR A;  3K4N A;  4FAS D;  1ZAR A;  2QVO A;  4DOZ A;  2M0C A;  4DYC A;  1SVM A;  3R61 A;  2WV0 A;  1R9T J;  1S8N A;  4ZZD A;  1N77 A;  3V8L A;  3MFK A;  3K9T A;  3GO5 A;  5F0H A;  1TT0 A;  3CJT B;  1P92 A;  2DDA A;  2VKH A;  3K69 A;  3A0H C;  4IL6 C;  4IHY A;  2VPR A;  5BOX A;  4M9S A;  3V4G A;  3BG3 A;  1UG2 A;  3H3Z A;  2HQR A;  3OR2 C;  1T08 B;  2CW0 F;  3KIO A;  3CO7 C;  4BY1 J;  4XOT A;  2VJI A;  3FMS A;  4XQF A;  3F23 A;  3CUQ C;  5B1B H;  3DEW A;  3CCU I;  1VQK I;  2EPF A;  1IRZ A;  2EBI A;  2UV1 A;  1AOY A;  3GFL A;  3PIO F;  3NRV A;  2H1L A;  1IXS B;  3DFG A;  5IYC J;  4XN0 A;  3BZK A;  3F0C A;  3TED A;  3K4K A;  4HRI A;  3WTY C;  5L3F A;  4MEX F;  3TO6 A;  1XGM A;  1Z21 A;  2JA5 J;  2VE8 A;  3FBI B;  2R7F A;  5JR3 A;  3IL2 A;  4D9J A;  4Q47 A;  1RKT A;  1OQY A;  4CXF A;  2RV8 A;  2VKE A;  4C3H J;  1RIO H;  4XLN F;  4UUT A;  3HUG A;  1NK3 P;  5HS8 A;  1WI9 A;  3RQI A;  1A35 A;  1ZR4 A;  3VEP A;  3HL2 A;  4BNC A;  2ADU A;  4RLQ A;  1SVL A;  4M74 A;  4HLY A;  4E7Z A;  1JUM A;  3FMQ A;  1FTZ A;  1LE8 B;  4XMY A;  5C3E J;  3CDI A;  5D4S A;  2F2E A;  3IKT A;  4A6E A;  3T0Y A;  2EV0 A;  2QSH X;  2VQH A;  3L2V A;  3LSJ A;  4A93 J;  3A01 A;  4A3B J;  1BW5 A;  4CCN A;  4G7H F;  1MH4 A;  3FKJ A;  2HFH A;  1X1D A;  1X2N A;  5EEG A;  5B3S H;  2LY1 A;  2O8K A;  4M3B A;  5CLS A;  4B8X A;  2RNG A;  3GX4 X;  1XMX A;  3BR3 A;  3SQN A;  3OYM A;  3OYN A;  1Y1V J;  1XTA A;  3TQN A;  4ESF A;  2E1M C;  3WU1 B;  2ZJ2 A;  2K9N A;  3FHZ A;  3ZMS A;  3PJR A;  1I6H J;  1G3S A;  4ZDO A;  1WJ5 A;  4M71 A;  3KE2 A;  2OQG A;  1LFP A;  1X4O A;  1SFX A;  3I56 I;  2A07 F;  1W4M A;  3E6B A;  2FBK A;  2D2W A;  3WTT C;  2IT0 A;  1IF1 A;  2XB0 X;  4QPQ A;  2NAZ A;  2KMU A;  3MMY B;  4AID A;  1A5J A;  1D1A A;  2DAO A;  2Z99 A;  3PFI A;  3S3O A;  4N9H A;  1G3W A;  2DFI A;  2ZO4 A;  1UHM A;  5FGM A;  4B09 A;  3Q3S A;  4GYG A;  1GLN A;  4C3J J;  4QLC U;  4XSX F;  4HV6 A;  4LIT A;  2KZV A;  3BWG A;  5F64 A;  2LP0 A;  1LFB A;  2LY9 A;  4Z2Y A;  3VB2 A;  1VQ6 I;  1F5T A;  5C4X J;  2L02 A;  1W5C C;  1LVA A;  4KUM A;  2E7X A;  2ZCW A;  2DOF A;  2RVC A;  2M4K A;  4BQN A;  4QPO A;  2D5V A;  3CC2 I;  2PJP A;  4WXD A;  4LB5 A;  1IN7 A;  3WTV C;  1T8I A;  1IN6 A;  2DMP A;  4LIU A;  4MGR A;  2YX4 A;  1IRG A;  4DGW B;  4CCK A;  2XAS A;  5IY5 H;  4ENM A;  3HJE A;  1FPQ A;  3V8J A;  4ZZL A;  2HDD A;  4CCO A;  3RQ4 A;  3QYB A;  5LEJ A;  3HOT A;  2GOM A;  4DYQ A;  1V5E A;  3J81 Z;  3F9K A;  5E1X A;  2JUC A;  2X9D A;  5TJJ A;  1YW8 A;  4OIQ F;  2UWM A;  1RKW A;  3BTC A;  3KP3 A;  4IRH A;  1PUE E;  3E7L A;  3WTU C;  2KRH A;  2LY2 A;  3FK6 A;  2HOA A;  4E7L A;  2XRO A;  2GXG A;  3D5R C;  2A69 F;  4B1R A;  1XGS A;  1R6R A;  2VJJ A;  4II3 A;  2ISY A;  4DBR A;  5HLI A;  2ZFU A;  3RKW A;  2OAZ A;  2JPC A;  2UUZ A;  2P5K A;  3OL4 A;  2EIK H;  1FOK A;  2KDO A;  2MYS A;  4YIR X;  3MZY A;  2OJE D;  3CP8 A;  4Y15 A;  2EFO A;  2Y0S A;  2HS5 A;  4IXA A;  4CCL A;  3GTK J;  2CW8 A;  2DYS H;  2XVC A;  3PFY A;  1R00 A;  1SFU A;  2XHK A;  3WU2 C;  2KIQ A;  4CA0 A;  2DA5 A;  2DO7 A;  2ZBK A;  2DFH A;  3WTW C;  3CMA I;  3A02 A;  2DOA A;  3DTE A;  3WGI A;  3Q9V A;  4BH9 A;  5FD6 A;  1HSJ A;  3SZG A;  5FJ8 J;  1EKE A;  1STZ A;  3C3W A;  1HDP A;  4RLF A;  1S7O A;  2HTS A;  3GLX A;  3O2P E;  4JBA A;  2BHZ A;  4LG0 B;  4MTE A;  2VC0 A;  1HKS A;  4H0E A;  1GVJ A;  4RAZ A;  2FE3 A;  2JQ7 A;  3CF5 F;  2DW4 A;  4ENK A;  4I0A A;  1RNL A;  2NOG A;  4BQO A;  4RM2 A;  4XRM A;  3OIO A;  1D5V A;  2XIG A;  2L01 A;  3BTJ A;  1RET A;  1GV5 A;  1I6X A;  5E8I A;  2FX0 A;  1IXC A;  3M8F A;  3RIR A;  2XAQ A;  1OIS A;  1W7P A;  2EIM H;  2K27 A;  4HF0 A;  2FMY A;  3HTS B;  5EJC A;  2O9L A;  3LFU A;  1SD4 A;  5TRD A;  4IRG A;  5DM6 F;  3O8G A;  3CJR B;  3HOX J;  2O6G E;  2R7T A;  3W2W A;  2O0Y A;  1WJB A;  2LRE A;  3HSE A;  4RA2 A;  3DPT A;  1SEU A;  2G7H A;  1DP7 P;  4BQA A;  1G59 A;  2IAI A;  3ZMZ A;  5GTI C;  2EZL A;  2OA4 A;  5M5Y J;  1K4S A;  3K4J A;  1HF0 A;  2EIN H;  4D5C A;  3PSI A;  3P9C A;  3P7N A;  3W6V A;  1MIJ A;  4HX7 A;  3U9G A;  4NC7 A;  4XOP A;  5GPA A;  1LNW A;  3EUK L;  1S6L A;  3OYL A;  3OYG A;  1QHH D;  5J3L A;  4XLF A;  1FX7 A;  2HYJ A;  3BJ6 A;  5FLM J;  5LGN A;  4BKX A;  1FTT A;  4LG3 A;  3HHG A;  3TW6 A;  1AKH B;  4XRS G;  2E1N A;  5DCF A;  4RGR A;  5F6F A;  3ZQH A;  4KFC A;  5E17 F;  2YSR A;  4WXH A;  5DD4 A;  2V1D A;  4G6Q A;  3RDI A;  4HSR A;  1R23 A;  2ETH A;  2KIS A;  4U87 A;  2ZME A;  1SD7 A;  1W5S A;  2LDU A;  2R5Z B;  5DDG A;  2XUB A;  3BJA A;  1LKX A;  3S3N A;  2BW3 A;  2VXD A;  5LBQ A;  1ERD A;  2M0M A;  1MNM C;  2JUG A;  3QOE A;  4IHS A;  3KZI C;  3WOD F;  1I50 J;  3BPV A;  3V7S A;  4UXN A;  4UUS A;  5F04 A;  2CQ7 A;  2DCE A;  2KIF A;  3KX2 A;  2F4O B;  2PMZ A;  1R22 A;  3TMO A;  2R7W A;  3GTL J;  3DP7 A;  3GME A;  5IP9 J;  2ZSH B;  4BJT A;  3CCM I;  4A3L J;  1U9N A;  2PBI A;  1UZC A;  4NHJ A;  1XB4 A;  4NC8 A;  2VJ5 A;  3HUG B;  4L9J A;  4X0G A;  3BQY A;  4Y3O A;  1OCO H;  4EJU A;  3GWZ A;  3HOU J;  2CV0 A;  1B6A A;  1U3E M;  2IW5 A;  2Y69 H;  3E97 A;  4XLH A;  1K4T A;  2HQ5 A;  2OU2 A;  5J1U A;  1YW7 A;  2DN0 A;  2O5R A;  1V4R A;  2FOW A;  3BR1 A;  2CQN A;  4ZYE A;  2GQQ A;  3W6J B;  1ULY A;  3PSF A;  4ZYA A;  1YG2 A;  5IP6 A;  1G3Y A;  3GZN B;  2CW7 A;  3ZQF A;  2RQQ A;  5F0C A;  2E2H J;  2MD5 A;  1MBF A;  3I0T A;  1KQ8 A;  1MD0 A;  3M7G A;  3QRF F;  1FSH A;  2FQ4 A;  4G94 A;  2GBY A;  1F36 A;  3BR5 A;  4XL9 A;  3JSP A;  4RGU A;  1W0U A;  1H88 C;  4Q4Z F;  4XID A;  4L5E A;  1UJ8 A;  3RJP A;  1X1C A;  3R6S A;  1QRY A;  4IPA A;  1IN8 A;  1EV7 A;  2XB5 A;  3EQL F;  3S14 J;  2FUG 2;  2ID3 A;  4CSW A;  5D8K B;  2VLA A;  1FZP B;  2YR2 A;  2R4G A;  5ERI A;  4M3F A;  2R7U A;  4RB3 C;  2Q2E B;  1D8K A;  2QUF A;  5L3E A;  4FIS A;  2CRG A;  2YS9 A;  1VQ8 I;  1ETK A;  2EFQ A;  2F48 A;  2IEK A;  3LAP A;  4G6D A;  1WJC A;  4C30 A;  2FA5 A;  2W57 A;  1RRJ A;  3U2R A;  2MW8 A;  3VWB A;  1ETX A;  1IUF A;  4IHT A;  2A68 F;  2AHQ A;  4EJT A;  3BP8 A;  2PJR B;  1QVT A;  2IJL A;  3HRS A;  3GW2 A;  2QLZ A;  3B6C A;  1FBQ A;  1X19 A;  2A5W A;  3E5X A;  1Z6R A;  2OC6 A;  1XCV A;  2KHM A;  4C2M J;  4PZJ A;  4A0Z A;  5BMZ A;  2KT0 A;  5KVR A;  4Q48 A;  3EYY A;  2BEO A;  1YJ9 I;  5A2Q K;  1BI1 A;  2XSJ C;  3HSF A;  3GTP J;  4E7J A;  5IYB J;  2EWN A;  2F5C A;  1ZN2 A;  2DFF A;  5EGO B;  4KIB A;  2DT5 A;  3ZQ7 A;  4UB8 C;  1YYV A;  3ZMD A;  3E6C C;  1OCP A;  5KCM A;  1ODD A;  2F4I A;  4II2 A;  4XLC A;  5BS6 A;  5E8G A;  1Z7U A;  3MZH A;  3JAM K;  2HTJ A;  3K4L A;  1TBX A;  1VF9 A;  1YJW I;  5DM7 F;  2QEX I;  1L3L A;  4EGZ A;  3GFJ A;  2R93 J;  4PSX A;  3PNT A;  1IDZ A;  2L9V A;  2ECC A;  3Q0V A;  1W7P D;  1YQA A;  1HC8 A;  1XG1 A;  2HDW A;  3K2A A;  5JFR A;  1OJL A;  3CZ6 A;  4XRF A;  1S7E A;  2IGN A;  2L7M P;  2LG4 A;  4MO7 A;  3U1D A;  6PAX A;  4CYC B;  1A04 A;  3RPU A;  3CP2 A;  1P4A A;  2RGV A;  3CMY A;  2MD0 A;  3QWL A;  3TOB A;  2X51 A;  1OR7 A;  1KQ9 A;  5DEQ A;  4EJW A;  3I59 A;  5IYD J;  5C4J J;  1J7K A;  1FSE A;  2RKH A;  4YII A;  2WWY A;  3DLA A;  4MEY F;  1TWA J;  1WJE A;  1XSX A;  1HLV A;  3HDD A;  3FXQ A;  3TP0 A;  1WFX A;  5KK1 A;  3OS2 A;  3NEU A;  2HYG D;  4IQJ A;  3TO7 A;  1BL0 A;  1IC8 A;  4UB6 C;  5BQT A;  2JWT A;  2EV6 A;  4JK1 X;  4NUB A;  2ISZ A;  1YRN B;  2IS6 A;  1TNT A;  4A3J J;  2ME0 A;  1J2X A;  3FK7 A;  2LLK A;  3G2B A;  3SEQ A;  1GDT A;  1SMT A;  2ZXJ A;  3WGH A;  4UY8 I;  2CQK A;  4HBL A;  4B4C A;  4FX4 A;  1P7J A;  4M6Y A;  1D1B A;  3OYD A;  3LNQ A;  2DA6 A;  5EDN A;  2MLG A;  2VC1 A;  4HQE A;  3WG7 H;  1B72 B;  3QYE A;  1BC7 C;  3LL7 A;  2IGK A;  1R58 A;  2V9K A;  1F9N A;  3I55 I;  4GYI A;  4HV5 A;  1OYY A;  1XCB A;  4A3G J;  5J6X A;  2X1D A;  2A6E F;  1TNS A;  1Y8R B;  3GUD A;  3Q9S A;  2XV4 S;  1J0R A;  2IS2 A;  2ESH A;  4HF2 A;  3HRU A;  1WGX A;  2DPD A;  3IWF A;  4XR6 A;  2NYX A;  3HEF A;  4KNY A;  3OV8 A;  4I99 C;  4L9V A;  1U5T B;  1OCC H;  2W00 A;  4MFD A;  4M72 A;  3GTQ J;  2N8G A;  1BJA A;  1BJZ A;  4RAF A;  3G6E I;  5LD2 C;  5AIQ A;  2VIX A;  3FF5 A;  4M73 A;  2YUS A;  4AIJ A;  1WHU A;  1TTY A;  3ZQL A;  3WGG A;  2IXS A;  2ZJR F;  3I58 A;  2QQ9 A;  3B02 A;  3FXM A;  3LSM A;  1UST A;  4WF2 A;  2IA1 A;  2BYV E;  3E0J B;  2TRT A;  1W1W E;  2E60 A;  5FKK A;  1B59 A;  2EZH A;  4KMF A;  3DKX A;  3T8T A;  4LLL A;  4DZJ A;  3H1C A;  3OL3 A;  3MKY B;  3HRT A;  3O6B B;  4KT6 A;  4A5N A;  4E70 A;  2L9R A;  4KN7 X;  2EH3 A;  2E19 A;  4IQ4 A;  3I4M J;  1JI8 A;  1F4K A;  3OYA A;  4JX4 A;  3OOP A;  1LPQ A;  1T98 A;  2UXX A;  2L4M A;  1H0M A;  4PFP A;  1NTC A;  1MMS A;  2M1B A;  1QGP A;  4HDV A;  1X3U A;  2WA0 A;  1ZG5 A;  3IH3 A;  4IVN A;  1FMV A;  2W24 A;  3CDL A;  3TDU C;  3NAU A;  5K7Z A;  1JTY A;  4BL0 B;  3U21 A;  4DZP A;  2DK8 A;  3OWT A;  4P9F A;  5H6Q A;  4DYR A;  2HXO A;  5K1Y A;  2KQR A;  3WHC A;  3FHN A;  2VQC A;  2K5C A;  1BIB A;  4PJJ A;  2JTV A;  2P8T A;  3S3M A;  1BOB A;  1BI0 A;  3QU6 A;  2KLO A;  1TQI A;  4AWX B;  3AG2 H;  1VI0 A;  3L7W A;  3AKZ A;  4OAZ A;  4EQQ A;  3G1M A;  4X1E A;  2LBF B;  1IV6 A;  1I1S A;  2V6C A;  3DCF A;  2J5O A;  1B8I B;  4HLX A;  2W4S A;  4OOI A;  1USS A;  1UHS A;  4S04 A;  1IZ1 A;  1IV8 A;  2CUJ A;  3IV5 A;  3K4M A;  1P2F A;  2HZD A;  1JT6 A;  4BXX J;  1NG6 A;  2BY0 A;  3O3K A;  1Y0U A;  1KON A;  1WWX A;  3JAM Z;  4ENN A;  1WZ2 A;  1ZRD A;  1P4W A;  2I8D A;  4JQF A;  1HW2 A;  3ESW B;  3HYI A;  1Z1D A;  1D0Z A;  1REP C;  3CDH A;  3FXR A;  2H8W A;  2KJB A;  3I9V 2;  3BRO A;  1SFO J;  1E2X A;  1WJD A;  2CGP A;  1FIA A;  2A6T A;  2OZU A;  2L9N A;  4QIW N;  4PJL A;  4ASN A;  3C7J A;  3TDZ C;  1O3S A;  3RPU D;  4LJZ F;  2EV5 A;  3CLO A;  1ZRE A;  3JRE A;  3LMM A;  2IA2 A;  1J75 A;  1A6I A;  4I2O A;  2FF4 A;  4DW6 A;  3V42 A;  1WJA A;  3E1S A;  1R5H A;  3GEZ A;  4BEH A;  3ZQC A;  1QA6 A;  3W2A A;  3K1P A;  2M45 A;  1MDM A;  1K79 A;  4FET A;  2JPB A;  1E3O C;  1U5T C;  3FKI J;  1S72 I;  2WBM A;  4L9T A;  1TW2 A;  3VOD A;  1OCT C;  4J00 A;  2BOL A;  2DXI A;  3C1D A;  5FRO A;  2M7B A;  1SAU A;  5ED4 A;  5CVV A;  2WAF A;  2KL4 A;  1ZLJ A;  3HGY A;  4RDU A;  4BY7 J;  1XS9 A;  3W3C A;  4NQW A;  2MSY A;  1BW6 A;  3QOD A;  4D7N A;  2RRE A;  3CCE I;  1H9T A;  1EH8 A;  4XBF A;  2NS8 A;  3OIQ A;  1PUF A;  3H9J A;  1MZB A;  3K7A J;  1T0F A;  2KIU A;  3I54 A;  1VTN C;  1T38 A;  4L18 B;  2LRD A;  3N4M A;  4B47 A;  3HM5 A;  3S17 J;  2TDX A;  1DGW Y;  1J59 A;  4ZH4 F;  3O8H A;  3KP5 A;  4UV8 A;  5CKT A;  3KZY A;  3HHH A;  4CCJ A;  4ANJ A;  3ZXS A;  3PNY A;  5F27 A;  1BC8 C;  2XAH A;  4CZZ A;  1SVO A;  2XGC A;  4ON0 A;  1RR7 A;  4G6T B;  1IN5 A;  4KA4 A;  1PP8 F;  3CUO A;  2B63 J;  3CCL I;  2X6Y A;  2OTL I;  4E4H A;  2AS5 F;  4JOM A;  5HLT A;  1GXP A;  1MJB A;  3DPU A;  4JX5 A;  4LLG F;  5EG0 A;  2KZG A;  3PM1 A;  4HX4 A;  1VQL I;  3K10 A;  5DTD A;  5AIP A;  3CCS I;  2HOT A;  5GP9 A;  5FFX A;  1UEL B;  2DA2 A;  3AAF A;  2DQL A;  2E1C A;  2ZJP F;  3KP6 A;  1K83 J;  4IX7 A;  3HPH A;  1PP7 U;  2DMQ A;  2R5Y B;  3K6G A;  1MSE C;  2ZB9 A;  2R0Q C;  2W48 A;  2P81 A;  1FWZ A;  2XRL A;  3KFW X;  2ELK A;  4HNU A;  2VXZ A;  2ESN A;  3M1C A;  5JI6 A;  4ESB A;  1MBK A;  2MLK A;  1UB9 A;  1R71 A;  2WC2 A;  1WKM A;  1FOX A;  3L1P A;  2OPT A;  3RSN A;  1QZY A;  3FXL A;  5HDN A;  1XGO A;  2NXN B;  4ETS A;  1MKM A;  1ZGA A;  2RC4 A;  1W36 C;  3ZMU A;  1Y6I A;  1LVK A;  3KLN A;  3K4B A;  3OOU A;  4BU2 A;  3JTH A;  3LAJ A;  2D1H A;  3D0S A;  2QBY A;  4FQG A;  2JSP A;  5CVJ A;  2DOD A;  2LH9 A;  3HOZ J;  3S1N J;  1O3R A;  3I53 A;  1MMN A;  3WTS C;  1I1G A;  5FO5 A;  5DD8 A;  3JR9 A;  1TLH B;  2M4G A;  2FBH A;  3WE2 A;  2Z16 A;  3REO A;  2HQA A;  3K70 C;  5LFA A;  3AFH A;  1YS7 A;  4YRV A;  2PMU A;  3I4P A;  3M4O J;  5J8C A;  2G9W A;  3CLQ A;  3WTZ A;  4N9I A;  3CQZ J;  2BHY A;  1KU7 A;  4V19 K;  4EJO A;  5AON A;  3ROU A;  1H8A C;  1POG A;  3BR0 A;  3BG5 A;  2WAQ A;  3KYD B;  4ZTJ A;  2QSG X;  3E6D A;  5D5V B;  2IA0 A;  4RM3 A;  3N97 A;  1K7A A;  2COB A;  2G7U A;  4DNC A;  4RAY A;  1BIA A;  1FYL A;  1E0E A;  1XX5 A;  3GFM A;  3CCY A;  2DU9 A;  5LGT A;  2VE9 A;  1P4X A;  1GHC A;  2R7S A;  3VOE A;  2STT A;  3M07 A;  3FZV A;  1SD5 A;  2GOX B;  2RNJ A;  4NBQ A;  4IZZ A;  3F8F A;  4A3E J;  1RES A;  3FXK A;  1JUS A;  4EM0 B;  3GFI A;  1TW3 A;  3OYJ A;  3F22 A;  1ZR2 A;  3SJM A;  1TC3 C;  1CF7 B;  2LYC A;  2WY7 Q;  1R5I D;  2DLL A;  2NS7 A;  1QQI A;  3A1Y A;  3ELK A;  3V8K A;  2CUE A;  2CUF A;  3QU3 A;  4M9Z A;  2YU9 J;  3VDX A;  5H20 A;  2QQA A;  4O6J A;  2A05 A;  1DU6 A;  2C6Y A;  1ZLK A;  5D5X B;  2DPU A;  2VJ4 A;  1LDD A;  3ABM H;  1VFC A;  2AXL A;  5GAG J;  2EB7 A;  3LSK A;  4UVC A;  3DV8 A;  2DQR A;  1BM9 A;  3S15 J;  3BLY A;  1TT5 B;  2DYR H;  5DCM A;  2CQX A;  1IGN A;  1QZE A;  2XKP A;  2GXB A;  1KYZ A;  1ETO A;  4RBO A;  4RB0 A;  2XF6 A;  3KPH A;  1Z67 A;  2AXT C;  4U0Y A;  2J5P A;  1ETQ A;  5FKM A;  4EM2 A;  3K4C A;  4I01 A;  1BI2 A;  1U6G A;  2KDZ A;  2QKM B;  2VAS A;  2ICW G;  4AM3 A;  3L2C A;  1D0X A;  5CYV A;  1JKQ C;  1K78 B;  1JXS A;  2XPU A;  2V4J C;  3ZN1 A;  3H9Q A;  1Z91 A;  2Y9Z A;  3CO6 C;  4XSZ F;  3EUA A;  2OCE A;  1K61 A;  2OBP A;  5HOD A;  1QZZ A;  3EUH C;  4GCV A;  4R79 A;  4AC0 A;  1FY7 A;  1TZL A;  2FNA A;  2P7V B;  3D1N I;  2QZ8 A;  3IRQ A;  2XAJ A;  1XMA A;  1R5G A;  2NRA C;  2XGX A;  3QPH A;  2ZKZ A;  5EEA A;  3BZ6 A;  1A31 A;  3G4S I;  4IRI A;  3VYU B;  2WB1 A;  3IH4 A;  2HVQ A;  4RGX A;  3CUQ A;  3LSR A;  5J40 A;  2R7D A;  4AVZ A;  4Y52 J;  1DP3 A;  4F7Z A;  4PDK A;  3VFZ A;  3QPL A;  2AQE A;  4E7H A;  1QNT A;  2K86 A;  3ONQ A;  2QGU A;  4X6A J;  2BV6 A;  2LOO A;  3S8P A;  2ZFW A;  5KAI C;  2XPV A;  2R7Z J;  1FOW A;  3K1M A;  1FP2 A;  3RCO A;  5J4Y A;  4E7I A;  1X58 A;  3DTI A;  2V9P A;  1SAX A;  4PCQ A;  2KJC A;  5BPI A;  1GT0 C;  4BE0 A;  3J80 K;  5EYR A;  1X3W B;  5LHI A;  5LRS A;  3LST A;  2Y0S N;  2KIM A;  2GAU A;  3AG3 H;  2JSC A;  1TL8 A;  2Z1D A;  5D8L B;  2R3S A;  1S5L C;  3SHF A;  2CO5 A;  3OYH A;  4MLO A;  4ZC3 A;  4U88 A;  4HX8 A;  1FBS A;  3P9K A;  2TCT A;  2Y30 A;  4NNJ A;  2CWE A;  3LA3 A;  4WK8 F;  2F5E A;  2JA2 A;  4XLP F;  1R1V A;  1H89 C;  3TP3 A;  2NOJ B;  1PJR A;  4H4K C;  1C0W A;  1OCZ H;  1ITY A;  5L3B A;  4Y33 A;  4ZDL A;  1LUJ B;  1MBJ A;  4WWC A;  2L4A A;  4W1U A;  2V1U A;  3RKY A;  2M7A A;  1FT9 A;  2V26 A;  5JHU A;  4BJ6 C;  3SFZ A;  1FBU A;  3DEE A;  1RZ4 A;  2ZC2 A;  4IHX A;  1Z77 A;  1ZHF A;  2EFN A;  2X1E A;  4BQQ A;  2FNP A;  2K4B A;  4F52 A;  1O7F A;  4C9Y A;  3ZPL A;  1V55 H;  1AWC A;  3FM5 A;  1DQU A;  3EPZ A;  2FU4 A;  4JYK A;  1YIJ I;  3JW4 A;  4EMS A;  1G2H A;  5LHH A;  1N78 A;  3BCB A;  3A01 B;  2Z2S B;  1MJA A;  5E3N A;  1YJN I;  1FNN A;  1KU2 A;  5JVG F;  2FSW A;  2MBF A;  3SXY A;  3GCM A;  4HNT A;  4G7O F;  3FM3 A;  3PQK A;  4BAY A;  2ZSI B;  5DV5 A;  2Y0M A;  2X1C A;  4CDG A;  1HW5 A;  4GRI A;  3HBL A;  2COM A;  4GO1 A;  1FP1 D;  2ZXH A;  3LA7 A;  1GXQ A;  1P6R A;  5FRN A;  5E3L A;  3OY9 A;  2DDB A;  2K3P A;  1Z0X A;  1D0Y A;  1N25 A;  3H0G J;  3G1O A;  1JE8 A;  2LD5 A;  1WPK A;  3GZ5 A;  3TO9 A;  1YS6 A;  2K3F A;  5CQE A;  5FKN A;  3S93 A;  1SC7 A;  3P5J A;  2HOE A;  3T1B A;  5E79 C;  3PL8 A;  2XAU A;  3E5Q A;  3F8C A;  3SYT A;  2DI3 A;  3N05 A;  2KFD A;  4Y4R A;  1CQT A;  2M87 A;  1OKR A;  2OD5 A;  2Y75 A;  3EYI A;  3OYF A;  5GPC A;  1QBJ A;  3PO3 J;  2RN7 A;  2XF7 A;  4V2F A;  5HDG A;  3ZRG A;  4AYB N;  2A3S A;  3PO2 J;  3MKL A;  3F72 A;  2VQL A;  2VBY A;  2HOS A;  4HQM A;  2CQQ A;  5HLG A;  3BPX A;  3H5A A;  2XRN A;  4F92 B;  3JRC A;  2KRC A;  2QWW A;  2X48 A;  4S05 A;  3FX3 A;  3OS1 A;  3L2Q A;  1NH3 A;  4U0V A;  3NWT A;  2IRF G;  4I6Z A;  1CGP A;  1MH3 A;  2Q0O A;  4O5V A;  5KHD A;  1O3T A;  1HKQ A;  1P9Q C;  4A3F J;  1MJ9 A;  1XMK A;  2STW A;  1S3J A;  4Y17 A;  4A2U A;  4UVB A;  2NS0 A;  1O7L A;  2DBB A;  1QHG A;  4L5J A;  4FE7 A;  4HNV A;  4HST A;  1LEB A;  2FBI A;  3JTG A;  3KYL A;  4I7H A;  4I98 B;  1K6Y A;  4CYD A;  2OF7 A;  1K6O A;  2X85 A;  5FD5 A;  1JT0 A;  1MMA A;  3L2W A;  2CFO A;  4HEA 2;  2CG4 A;  2DA1 A;  2L3D A;  3NWS A;  4JP0 A;  1LE8 A;  2IBD A;  2L7K A;  2CH0 A;  2ELH A;  2K85 A;  3H0D A;  4BE1 A;  3PNV A;  3FBN B;  1EH6 A;  5D5U B;  2EZK A;  2JJ7 A;  1ACI A;  2F6C A;  3QQA A;  4YEL A;  1ZGJ A;  3LWF A;  4XKW A;  1ETW A;  3DBL B;  2P5L C;  1HKT A;  3OR1 C;  1GVD A;  3Q0W A;  4PGH A;  2VL8 A;  3IAM 2;  3CC4 I;  4RB2 C;  1WJF A;  2PI0 A;  2FEZ A;  4LD5 A;  4KMU X;  5M3M J;  3RPQ A;  2WV1 A;  3ZQG A;  1PVE A;  2HXI A;  1VQ4 I;  4BBR J;  1OCR H;  4AD9 A;  4KIS A;  2JA7 J;  1Y56 A;  4U7D A;  4LK0 F;  4K2E A;  5EZH A;  2P7C B;  2XF5 A;  3U1K A;  5GAD J;  2CMP A;  1S29 A;  2NNN A;  4BAC A;  1AU7 A;  4JX6 A;  2KPM A;  5F0F A;  3GXO A;  1VQ9 I;  3VYS B;  3IC7 A;  4PFO A;  1ONV A;  2K02 A;  1UCR A;  5B5E C;  2EJR A;  2FQ3 A;  4AIH A;  3J80 Z;  1VND A;  3OSF A;  4KDP A;  2Y31 A;  1JHF A;  3LOC A;  2H8R A;  2BY3 A;  2GXA A;  3HPG A;  3CD6 I;  3FXJ A;  4XLA A;  2XDV A;  3HTU A;  5K5Q A;  1RUN A;  4L5I A;  1Z7L A;  1J9I A;  2P0W A;  1OMI A;  1JGG A;  3MN2 A;  4CO8 A;  3KP4 A;  3DBH B;  5LRR A;  2JA8 J;  3FMR A;  3KCC A;  1I5Z A;  3KLO A;  3OSG A;  1WCM J;  3BCA A;  3M1E A;  5DS9 A;  3BG6 A;  3R0A A;  3WE3 A;  3E6M A;  2VPL A;  2GM4 A;  1T95 A;  2DTR A;  2K40 A;  3IRR A;  2QQB A;  3ASO H;  2R92 J;  1LDJ A;  2ID6 A;  5EEH A;  1W7P B;  3CME I;  4I02 A;  2HKO A;  1LEA A;  1U9O A;  1WH5 A;  3FIW A;  1AA7 A;  2X6X A;  3SZT A;  1D5Y A;  4PSW A;  4E7K A;  3CCJ I;  2JA6 J;  3VYR B;  2K9S A;  2HDC A;  4M3D A;  5M3F J;  1ZYR F;  3J7Y J;  4M9X A;  2CSO A;  4G8X A;  1ON1 A;  1BBY A;  3ABU A;  3JRD A;  2E2I J;  4EGY A;  3WTX C;  4A3M J;  3S1Q J;  3K0L A;  1DUX C;  1KYW A;  2GA1 A;  2E7W A;  1HQC A;  1L0O C;  1MBH A;  2NVY J;  1UAA A;  4TV7 A;  3JCU C;  3CC7 I;  5C44 J;  1BR2 A;  4YFN F;  2CS3 A;  2H94 A;  4P1W A;  2JK3 A;  3PIP F;  3CCV I;  2JT1 A;  3ERM A;  3QYF A;  4XON A;  2M30 A;  5FKL A;  1U2W A;  1A6Q A;  2LKX A;  2CYY A;  2RDP A;  2ZME B;  2DA3 A;  2NVT J;  2P6T A;  2M8G X;  2MG4 A;  1ZK8 A;  2BW3 B;  3ZGK A;  3DLL F;  5FB2 A;  2XSD C;  1IJW C;  1R4M B;  3IP4 B;  2VON A;  1JUP A;  1X1P A;  2LSO A;  5JHF A;  4EVI A;  3QP6 A;  4BDZ A;  4A3C J;  4UUS B;  4LIV A;  5E1W A;  5IP7 J;  4BE2 A;  2DFE A;  4R1H A;  2X4H A;  3I4N J;  1MW7 A;  3SDB A;  3TOA A;  4MTD A;  4OU0 A;  1A36 A;  2O61 A;  1D3Y A;  3VSK A;  3PQJ A;  3ML6 A;  3M8E A;  2FOK A;  1TP4 A;  3WHB A;  2DT6 A;  1MND A;  3EDP A;  1VZ0 A;  4LB6 B;  2AO9 A;  4B44 A;  2W85 A;  1KZH A;  2VOP A;  3HKZ N;  2DA7 A;  4LG0 A;  4IJA A;  4YIF A;  1I3Q J;  4PUS A;  3S16 J;  3ZQI A;  3Q5F A;  1APL C;  5J8F A;  1RC9 A;  2P6S A;  1N75 A;  2VT2 A;  4FT8 A;  2MA3 A;  1TWH J;  1U8R A;  4ZDP A;  3DKW A;  1BOA A;  4ZJZ A;  2LF7 A;  1Y39 A;  4I0B A;  2HI3 A;  1YX5 A;  5K5R A;  4YFX F;  2HR3 A;  4DQ2 A;  3QP5 A;  1FC3 A;  3KEO A;  1YO5 C;  2K9M A;  3VPR A;  1JGS A;  4BDY A;  4IKF A;  2LNB A;  3OS0 A;  1ZG1 A;  4J19 A;  2A5Y B;  3V7R A;  1HXD A;  2F5D A;  3NAR A;  5L3C A;  5ICE A;  1FJL A;  4CH7 A;  2ME6 A;  3KP2 A;  5CVI A;  3KET A;  4XKC A;  3ECO A;  4ZYD A;  4W97 A;  5IPA A;  2MAB A;  1T33 A;  1ZAO A;  1DU0 A;  4ESJ A;  3KP7 A;  4RMN A;  1RI7 A;  2MH9 A;  4V2G A;  1PYV A;  1WQ2 A;  1UHW A;  1AKH A;  4A3D J;  3C2B A;  1KU9 A;  3BG7 A;  4HG2 A;  5D6F A;  4OIN F;  4LLN A;  4LGW A;  3EET A;  3WU0 A;  2R5Z A;  2E35 A;  5IOZ A;  3QAH A;  4EM1 A;  2BVL A;  5DUI A;  4MQ9 F;  2OTJ I;  4KT5 C;  5GAE J;  5K5O A;  1ORK A;  4QTR A;  5CQG A;  1BI3 A;  1ETY A;  4AVP A;  2D1V A;  5IT9 K;  3Q0U A;  5J4V A;  4IHV A;  3GBG A;  4N0B A;  4EV0 A;  1DDN A;  3R0J A;  4C3I J;  5B66 C;  1G4D A;  1IDY A;  4E6K G;  2ZME C;  3A4C A;  2E5N A;  3I64 A;  2HGC A;  5TGT A;  3GTO J;  4MHG A;  1LFU P;  1GV2 A;  1JHH A;  4B3X A;  1S9H A;  3JRG A;  2XGE A;  1Y0N A;  2LKS A;  4XM3 A;  1TWF J;  3CTA A;  3H5R A;  4HOB A;  4XLE A;  2E36 A;  4E7S A;  3HZJ A;  3L00 A;  3M3Y J;  2E5Z A; 
#chains in the Genus database with same CATH homology
 5D6E A;  4I09 A;  2XAF A;  1ZRF A;  2VBX A;  3I59 B;  4EJV A;  1XSD A;  1IW7 F;  1SFE A;  4BHP A;  1KQ0 A;  3KEQ A;  5HLH A;  4FX0 A;  2K4J A;  1B9N A;  4HYE A;  2Q2E A;  4ZYH A;  3RTR A;  2RQP A;  2EA2 A;  1XDS A;  5E18 F;  3GVA A;  4OIP F;  2HKX A;  4CGZ A;  1D8J A;  1KU3 A;  1B4A A;  4AIK A;  3NQO A;  1R1U A;  2GZW A;  4D0P A;  3MEX A;  3C18 A;  3FXU A;  3LFK A;  4HZF A;  2W25 A;  4RGS A;  4L0Y B;  4RS8 A;  3SZP A;  4QWQ A;  4HAM A;  2ACJ A;  3FWE A;  2UXN A;  1WRJ A;  1T2K A;  5FLX K;  1UFM A;  2UZK A;  2HYF A;  1OPC A;  1TQP A;  1YTY A;  3TGN A;  3F6V A;  2MH2 A;  2PN6 A;  4M6X A;  2PEX A;  5HOO A;  3W6K B;  1KA8 A;  2GWR A;  5ICG A;  2PG4 A;  4LFU A;  2YU3 A;  1XSV A;  1ZRC A;  3LA2 A;  1OYW A;  4PGG A;  1IRF A;  3IKV A;  4RB1 A;  3HOS A;  4OIO F;  3J7A O;  4UV9 A;  2X0L A;  1SMY F;  1QPM A;  3JSO A;  2Z3Y A;  5CVR A;  3RI4 A;  2H6C A;  1IUY A;  4FHT A;  4Q5S F;  1IXR C;  3ZMT A;  2P5V A;  2EFP A;  3M9A A;  3H3U A;  5IT9 Z;  2QEN A;  1XD7 A;  4HA8 A;  2OZ6 A;  4HW0 A;  2A61 A;  4UHT A;  1XGN A;  4HF1 A;  1LDK B;  1ZH5 A;  3DQV C;  4OMY A;  1LJ9 A;  4BYY A;  1U5T A;  1TQM A;  4A6D A;  1YW9 A;  2Y48 A;  4Y13 A;  5DUK A;  1R36 A;  2O03 A;  5HDK A;  5ILU A;  1V3F A;  3V7C A;  1O57 A;  3F8N A;  1MDM B;  1FLI A;  2PMH A;  4L9N A;  1Z05 A;  1F1Z A;  3QOP A;  4WX9 A;  3ULQ B;  3F6O A;  4ZYG A;  3F8B A;  2GA2 A;  4G9Y A;  3ISP A;  2KKO A;  1PDN C;  4A0X A;  2PFB A;  1YFH A;  3ZN0 A;  2VN2 A;  2LKP A;  2HQN A;  3K1N A;  5FFZ A;  5LEK A;  3CJN A;  3RYP A;  3MAJ A;  5HVQ C;  1QO0 D;  2VBW A;  1MGT A;  4P96 A;  2IPQ X;  3D5L A;  2VBZ A;  2O8X A;  2WTE A;  1T6S A;  5CJ9 A;  1HBX G;  1DPR A;  2F5F A;  2GIV A;  2XAG A;  2HZT A;  2VOO A;  5FLX Z;  1XDU A;  3MQ0 A;  4UUV A;  4UNO A;  3H92 A;  1G6N A;  2FML A;  1T39 A;  3COA C;  3G3Z A;  4A12 A;  3HIF A;  3BDD A;  1KGS A;  5JVT A;  1BN5 A;  3GZ6 A;  2V1X A;  5ICC A;  4MNU A;  2KRF A;  1R7J A;  3E5U A;  4LK1 F;  2ZNY A;  5E1Z B;  2BBY A;  2QBY B;  3LQQ A;  3F3X A;  4U7B A;  2Z5U A;  2H09 A;  3R60 A;  3LQR A;  4BHB A;  4NB5 A;  5ILV A;  4HDU A;  3DF8 A;  2DK5 A;  3F8M A;  2Q8K A;  2EK5 A;  4WCG A;  3RKX A;  4KIC A;  1E17 A;  2D45 A;  2O3F A;  5ILS A;  1Q1H A;  2YPR A;  5LGU A;  2ZNZ A;  3F21 A;  4BHC A;  2V79 A;  5LHG A;  3GYH X;  1YLF A;  5DYM A;  4CIC A;  4OIR F;  3MWM A;  3ABT A;  3DPL C;  1G3T A;  1EH7 A;  3T5X A;  3IHU A;  4CHU A;  5IT3 A;  4BXU A;  2B0L A;  2HWV A;  2P4W A;  3I71 A;  2JZY A;  1R1T A;  2HEO A;  2VOD A;  3ERE D;  1ON2 A;  4U0W A;  4GGG A;  3BJO A;  5LLQ A;  1RUO A;  4YG2 F;  3BY6 A;  5HS7 A;  5DCM B;  1XN7 A;  5D4R A;  3HRM A;  3EUH A;  2H27 A;  4ENJ A;  2LF8 A;  1Z9C A;  4LMY A;  2PQ8 A;  3GF2 A;  3MCZ A;  2QYO A;  4A5M A;  3T8R A;  1OYI A;  5H6R A;  2NNY A;  2A6H F;  5E20 A;  1HW1 A;  4IF4 A;  4O3M A;  2Z9O A;  4GXO A;  4A0Y A;  1I27 A;  3IWZ A;  4UVA A;  4MQV A;  2V9V A;  1Z6T A;  3P9I A;  1HST A;  2FRH A;  4R8H A;  3CUQ B;  3DEU A;  4KIF A;  3E3V A;  2FXA A;  2BGC A;  2YX7 A;  4P5O A;  3K2Z A;  4OMZ A;  5CVU A;  1H9G A;  1LQ1 A;  2CFX A;  1IAW A;  5F1R A;  3TKY A;  1IN4 A;  2OQR A;  3S2W A;  1CF7 A;  4WXC A;  2MC3 A;  5HS9 A;  1W5T A;  4P55 A;  3L09 A;  4KIG A;  4YFK F;  1FYM A;  2EA4 A;  2VT3 A;  5ICF A;  5L3D A;  4KYW A;  3BOQ A;  2H6B A;  1YIO A;  1WSU A;  2QM3 A;  2Z33 A;  3HSR A;  1ZG3 A;  2M5W A;  4G7Z F;  2PLY A;  5D5W B;  3L9F A;  1SD6 A;  1J5Y A;  2XKO A;  4P9U A;  3R4K A;  2EFW A;  3DXJ F;  1B9M A;  3KZZ A;  3G73 A;  3WG9 A;  3ZP5 A;  2JRT A;  1K78 A;  1LB2 A;  1U78 A;  1DPU A;  3J81 K;  3B73 A;  1O3Q A;  3ZMV A;  2W84 A;  5A2Q Z;  2IP2 A;  3QPT A;  4KN4 X;  3ECH A;  2IVM A;  1FYK A;  5L3G A;  1B1B A;  1S7A A;  4L0Z B;  2BE5 F;  3I5U A;  2L54 A;  5BPD A;  1NHA A;  2M8E A;  2K7L A;  3RYR A;  1ZAR A;  2QVO A;  3R61 A;  2WV0 A;  1S8N A;  4ZZD A;  3V8L A;  3MFK A;  3K9T A;  3GO5 A;  1P92 A;  3K69 A;  5BOX A;  4M9S A;  3V4G A;  3H3Z A;  2HQR A;  2CW0 F;  3CO7 C;  3FMS A;  3F23 A;  3CUQ C;  1AOY A;  3GFL A;  3NRV A;  1IXS B;  3DFG A;  3WTY C;  5L3F A;  4MEX F;  3TO6 A;  1XGM A;  2VE8 A;  2R7F A;  5JR3 A;  3IL2 A;  4Q47 A;  4CXF A;  2RV8 A;  1RIO H;  4XLN F;  3HUG A;  5HS8 A;  1WI9 A;  3VEP A;  4BNC A;  2ADU A;  4M74 A;  4HLY A;  3FMQ A;  5D4S A;  2F2E A;  3IKT A;  4A6E A;  3T0Y A;  2EV0 A;  4G7H F;  2HFH A;  5EEG A;  5CLS A;  4B8X A;  3GX4 X;  3SQN A;  3TQN A;  4ESF A;  3WU1 B;  2ZJ2 A;  3FHZ A;  3ZMS A;  1G3S A;  4M71 A;  3KE2 A;  2OQG A;  1SFX A;  2A07 F;  1W4M A;  3E6B A;  2FBK A;  2D2W A;  3WTT C;  2IT0 A;  1IF1 A;  2NAZ A;  2DAO A;  2Z99 A;  3PFI A;  4N9H A;  1G3W A;  2DFI A;  2ZO4 A;  1UHM A;  5FGM A;  4B09 A;  4GYG A;  4QLC U;  4XSX F;  4HV6 A;  3BWG A;  5F64 A;  4Z2Y A;  3VB2 A;  1F5T A;  2L02 A;  1LVA A;  4KUM A;  2E7X A;  2ZCW A;  2RVC A;  2PJP A;  4WXD A;  4LB5 A;  1IN7 A;  3WTV C;  1IN6 A;  4MGR A;  2YX4 A;  1IRG A;  2XAS A;  4ENM A;  1FPQ A;  3V8J A;  4ZZL A;  3HOT A;  5LEJ A;  3J81 Z;  5E1X A;  5TJJ A;  1YW8 A;  4OIQ F;  2UWM A;  3KP3 A;  4IRH A;  1PUE E;  3WTU C;  2XRO A;  2GXG A;  2A69 F;  1XGS A;  2ISY A;  5HLI A;  3RKW A;  2OAZ A;  2JPC A;  2P5K A;  1FOK A;  3MZY A;  4Y15 A;  2EFO A;  4IXA A;  2HS5 A;  2XVC A;  1R00 A;  1SFU A;  2XHK A;  2DO7 A;  2ZBK A;  3WTW C;  3WGI A;  3Q9V A;  4BH9 A;  5FD6 A;  1HSJ A;  1STZ A;  3C3W A;  1S7O A;  2HTS A;  3GLX A;  3O2P E;  4JBA A;  4LG0 B;  4MTE A;  2VC0 A;  1HKS A;  4H0E A;  1GVJ A;  4RAZ A;  2FE3 A;  2DW4 A;  4ENK A;  4I0A A;  1RNL A;  1D5V A;  2XIG A;  2L01 A;  1I6X A;  5E8I A;  1IXC A;  3M8F A;  3RIR A;  2XAQ A;  1W7P A;  4HF0 A;  2K27 A;  2FMY A;  3HTS B;  1SD4 A;  5TRD A;  4IRG A;  2O6G E;  2O0Y A;  4BQA A;  3HSE A;  3DPT A;  1DP7 P;  2G7H A;  3ZMZ A;  2OA4 A;  3P9C A;  3P7N A;  4HX7 A;  3U9G A;  1LNW A;  1S6L A;  1FX7 A;  3BJ6 A;  5LGN A;  3HHG A;  2E1N A;  5DCF A;  4RGR A;  5F6F A;  4KFC A;  5E17 F;  2YSR A;  4WXH A;  5DD4 A;  2V1D A;  4G6Q A;  3RDI A;  1R23 A;  2ETH A;  2ZME A;  1SD7 A;  1W5S A;  2LDU A;  5DDG A;  2XUB A;  3BJA A;  5LBQ A;  4IHS A;  3WOD F;  3BPV A;  3V7S A;  4UXN A;  2KIF A;  1R22 A;  3DP7 A;  2PBI A;  4NHJ A;  1XB4 A;  4L9J A;  4EJU A;  3GWZ A;  1B6A A;  1U3E M;  2IW5 A;  3E97 A;  2OU2 A;  1YW7 A;  1V4R A;  4ZYE A;  2GQQ A;  3W6J B;  1ULY A;  1YG2 A;  1G3Y A;  2MD5 A;  3I0T A;  1KQ8 A;  1MD0 A;  3M7G A;  3QRF F;  1FSH A;  4G94 A;  3JSP A;  4RGU A;  4Q4Z F;  3RJP A;  3R6S A;  4IPA A;  1IN8 A;  1EV7 A;  3EQL F;  5D8K B;  1FZP B;  2YR2 A;  5ERI A;  4RB3 C;  1D8K A;  2QUF A;  5L3E A;  2EFQ A;  3LAP A;  4G6D A;  2FA5 A;  2W57 A;  3U2R A;  4IHT A;  2A68 F;  4EJT A;  3BP8 A;  3HRS A;  2IJL A;  3GW2 A;  2QLZ A;  1FBQ A;  3E5X A;  1Z6R A;  1XCV A;  4PZJ A;  4A0Z A;  5BMZ A;  5KVR A;  4Q48 A;  3EYY A;  2BEO A;  5A2Q K;  1BI1 A;  3HSF A;  2EWN A;  2F5C A;  1ZN2 A;  4KIB A;  2DT5 A;  3ZQ7 A;  1YYV A;  3ZMD A;  3E6C C;  1ODD A;  5BS6 A;  5E8G A;  1Z7U A;  3MZH A;  3JAM K;  2HTJ A;  1TBX A;  1L3L A;  4EGZ A;  3GFJ A;  1W7P D;  1YQA A;  5JFR A;  4XRF A;  6PAX A;  3U1D A;  1A04 A;  3RPU A;  1P4A A;  2RGV A;  3TOB A;  1OR7 A;  1KQ9 A;  4EJW A;  5DEQ A;  3I59 A;  1J7K A;  1FSE A;  2RKH A;  4YII A;  2WWY A;  4MEY F;  1XSX A;  3FXQ A;  5KK1 A;  3NEU A;  2HYG D;  3TO7 A;  5BQT A;  2EV6 A;  4JK1 X;  2ISZ A;  1TNT A;  1J2X A;  1SMT A;  2ZXJ A;  3WGH A;  2CQK A;  4HBL A;  4FX4 A;  4M6Y A;  2MLG A;  2VC1 A;  4HQE A;  1BC7 C;  1R58 A;  1F9N A;  4GYI A;  4HV5 A;  1OYY A;  1XCB A;  5J6X A;  2A6E F;  1TNS A;  3GUD A;  3Q9S A;  2XV4 S;  1J0R A;  2ESH A;  4HF2 A;  3HRU A;  2DPD A;  3IWF A;  2NYX A;  4KNY A;  3OV8 A;  4L9V A;  1U5T B;  4M72 A;  1BJA A;  5AIQ A;  3FF5 A;  4M73 A;  4AIJ A;  1TTY A;  3WGG A;  3I58 A;  2QQ9 A;  3B02 A;  1UST A;  4WF2 A;  2IA1 A;  2BYV E;  1B59 A;  4KMF A;  3T8T A;  4LLL A;  3HRT A;  3O6B B;  4A5N A;  4E70 A;  4KN7 X;  1F4K A;  3OOP A;  1T98 A;  2UXX A;  2L4M A;  1H0M A;  2M1B A;  1QGP A;  4HDV A;  1X3U A;  1ZG5 A;  4IVN A;  2W24 A;  3TDU C;  2DK8 A;  4P9F A;  5H6Q A;  5K1Y A;  1BIB A;  2JTV A;  2P8T A;  1BI0 A;  3QU6 A;  1TQI A;  4AWX B;  3L7W A;  4EQQ A;  1I1S A;  2V6C A;  2J5O A;  4HLX A;  4OOI A;  1USS A;  4S04 A;  1IZ1 A;  1P2F A;  3O3K A;  1Y0U A;  1WWX A;  3JAM Z;  4ENN A;  1ZRD A;  1P4W A;  4JQF A;  1HW2 A;  3HYI A;  1Z1D A;  1REP C;  3CDH A;  3FXR A;  2KJB A;  3BRO A;  1E2X A;  2CGP A;  2OZU A;  4ASN A;  3C7J A;  3TDZ C;  1O3S A;  4LJZ F;  2EV5 A;  3CLO A;  1ZRE A;  2IA2 A;  1J75 A;  4I2O A;  2FF4 A;  1R5H A;  3GEZ A;  3K1P A;  2M45 A;  1MDM A;  1K79 A;  2JPB A;  1U5T C;  4L9T A;  1TW2 A;  3VOD A;  3C1D A;  5ED4 A;  5CVV A;  1ZLJ A;  4NQW A;  1H9T A;  1EH8 A;  4XBF A;  1MZB A;  1T0F A;  2KIU A;  3I54 A;  1VTN C;  1T38 A;  4L18 B;  3N4M A;  2TDX A;  1J59 A;  4ZH4 F;  3KP5 A;  4UV8 A;  3KZY A;  3HHH A;  1BC8 C;  2XAH A;  4CZZ A;  4ON0 A;  1IN5 A;  4KA4 A;  1PP8 F;  3CUO A;  2AS5 F;  1GXP A;  1MJB A;  4LLG F;  4HX4 A;  5AIP A;  5FFX A;  3AAF A;  2DQL A;  2E1C A;  3KP6 A;  1PP7 U;  1FWZ A;  3KFW X;  2VXZ A;  2ESN A;  5JI6 A;  4ESB A;  2MLK A;  1UB9 A;  2WC2 A;  1WKM A;  1QZY A;  5HDN A;  1XGO A;  4ETS A;  1MKM A;  1ZGA A;  2RC4 A;  3ZMU A;  3KLN A;  3JTH A;  3LAJ A;  2D1H A;  3D0S A;  2QBY A;  5CVJ A;  1O3R A;  3I53 A;  3WTS C;  1I1G A;  5FO5 A;  5DD8 A;  1TLH B;  2FBH A;  3WE2 A;  3REO A;  1YS7 A;  2PMU A;  3I4P A;  5J8C A;  2G9W A;  3WTZ A;  4N9I A;  1KU7 A;  4EJO A;  5AON A;  3ROU A;  3E6D A;  5D5V B;  2IA0 A;  3N97 A;  1K7A A;  2G7U A;  4DNC A;  4RAY A;  1BIA A;  1FYL A;  3GFM A;  2DU9 A;  5LGT A;  2VE9 A;  1P4X A;  1GHC A;  3VOE A;  2STT A;  3FZV A;  1SD5 A;  2RNJ A;  3F8F A;  4EM0 B;  3GFI A;  1TW3 A;  3F22 A;  1CF7 B;  2DLL A;  1QQI A;  3ELK A;  3V8K A;  3QU3 A;  4M9Z A;  5H20 A;  2QQA A;  4O6J A;  2C6Y A;  1ZLK A;  5D5X B;  2DPU A;  1LDD A;  2AXL A;  2EB7 A;  4UVC A;  3DV8 A;  2DQR A;  1BM9 A;  5DCM A;  2XKP A;  2GXB A;  1KYZ A;  4RB0 A;  4U0Y A;  2J5P A;  4EM2 A;  4I01 A;  1BI2 A;  1U6G A;  3L2C A;  5CYV A;  1K78 B;  1JXS A;  3ZN1 A;  1Z91 A;  3CO6 C;  4XSZ F;  2OBP A;  1QZZ A;  4GCV A;  4R79 A;  1FY7 A;  2FNA A;  2P7V B;  2QZ8 A;  3IRQ A;  2XAJ A;  1XMA A;  1R5G A;  2NRA C;  2XGX A;  3QPH A;  2ZKZ A;  3BZ6 A;  4IRI A;  4RGX A;  3CUQ A;  2R7D A;  4F7Z A;  4PDK A;  3VFZ A;  1QNT A;  2K86 A;  2BV6 A;  2ZFW A;  3K1M A;  1FP2 A;  1SAX A;  4PCQ A;  2KJC A;  5BPI A;  3J80 K;  5LHI A;  5LRS A;  3LST A;  2KIM A;  2GAU A;  2JSC A;  5D8L B;  2R3S A;  3SHF A;  2CO5 A;  4U88 A;  4HX8 A;  1FBS A;  3P9K A;  4WK8 F;  2CWE A;  3LA3 A;  2F5E A;  4XLP F;  1R1V A;  1C0W A;  5L3B A;  4WWC A;  2L4A A;  2V1U A;  3RKY A;  1FT9 A;  5JHU A;  3SFZ A;  1FBU A;  1RZ4 A;  1ZHF A;  2EFN A;  2FNP A;  2K4B A;  1O7F A;  3ZPL A;  1AWC A;  3FM5 A;  2FU4 A;  3JW4 A;  4EMS A;  5LHH A;  1MJA A;  1FNN A;  1KU2 A;  2FSW A;  2MBF A;  3SXY A;  4G7O F;  3FM3 A;  3PQK A;  4BAY A;  5DV5 A;  2Y0M A;  4CDG A;  1HW5 A;  2COM A;  4GO1 A;  1FP1 D;  3LA7 A;  1GXQ A;  1P6R A;  1JE8 A;  3GZ5 A;  3TO9 A;  1YS6 A;  2HOE A;  3T1B A;  3E5Q A;  3F8C A;  2DI3 A;  2M87 A;  1OKR A;  2OD5 A;  2Y75 A;  3EYI A;  1QBJ A;  2RN7 A;  5HDG A;  2A3S A;  3F72 A;  2VBY A;  4HQM A;  5HLG A;  3BPX A;  2XRN A;  2QWW A;  4S05 A;  3FX3 A;  4U0V A;  2IRF G;  1CGP A;  2Q0O A;  4O5V A;  1O3T A;  1HKQ A;  1MJ9 A;  1XMK A;  2STW A;  1S3J A;  4Y17 A;  4A2U A;  4UVB A;  2NS0 A;  1O7L A;  2DBB A;  4L5J A;  1LEB A;  2FBI A;  3JTG A;  4I7H A;  4I98 B;  4CYD A;  1K6O A;  5FD5 A;  2CG4 A;  2L3D A;  2ELH A;  1EH6 A;  5D5U B;  1ZGJ A;  3LWF A;  2P5L C;  1HKT A;  4PGH A;  4RB2 C;  2PI0 A;  2FEZ A;  4LD5 A;  4KMU X;  3RPQ A;  4AD9 A;  4U7D A;  4LK0 F;  4K2E A;  2P7C B;  2NNN A;  1S29 A;  3GXO A;  3IC7 A;  1ONV A;  2K02 A;  1UCR A;  2EJR A;  2FQ3 A;  4AIH A;  3J80 Z;  4KDP A;  1JHF A;  3HTU A;  5K5Q A;  1RUN A;  4L5I A;  1J9I A;  1OMI A;  4CO8 A;  3KP4 A;  5LRR A;  3FMR A;  3KCC A;  1I5Z A;  3KLO A;  3M1E A;  3R0A A;  3WE3 A;  3E6M A;  2DTR A;  3IRR A;  2QQB A;  1LDJ A;  5EEH A;  1W7P B;  4I02 A;  2HKO A;  1LEA A;  3SZT A;  2HDC A;  1ZYR F;  4M9X A;  2CSO A;  4G8X A;  1ON1 A;  1BBY A;  3ABU A;  4EGY A;  3WTX C;  3K0L A;  1DUX C;  1KYW A;  2GA1 A;  2E7W A;  1HQC A;  1L0O C;  4TV7 A;  4YFN F;  2H94 A;  2JT1 A;  2M30 A;  1U2W A;  2CYY A;  2RDP A;  2ZME B;  2P6T A;  5FB2 A;  2VON A;  2LSO A;  4EVI A;  3QP6 A;  5E1W A;  4R1H A;  2X4H A;  3TOA A;  4MTD A;  4OU0 A;  2O61 A;  1D3Y A;  3PQJ A;  3ML6 A;  3M8E A;  2FOK A;  3EDP A;  4LB6 B;  2W85 A;  2VOP A;  4LG0 A;  4IJA A;  4YIF A;  3Q5F A;  5J8F A;  2P6S A;  2VT2 A;  4FT8 A;  2MA3 A;  1U8R A;  3DKW A;  1BOA A;  2LF7 A;  4I0B A;  5K5R A;  4YFX F;  2HR3 A;  4DQ2 A;  3QP5 A;  1FC3 A;  3KEO A;  1YO5 C;  1JGS A;  2LNB A;  1ZG1 A;  2A5Y B;  3V7R A;  1HXD A;  2F5D A;  5L3C A;  5ICE A;  3KP2 A;  5CVI A;  3KET A;  3ECO A;  4ZYD A;  1ZAO A;  4ESJ A;  3KP7 A;  1RI7 A;  2MH9 A;  1WQ2 A;  1UHW A;  1KU9 A;  5D6F A;  4OIN F;  4LLN A;  4LGW A;  3EET A;  3WU0 A;  3QAH A;  4EM1 A;  5DUI A;  4MQ9 F;  4KT5 C;  5K5O A;  1BI3 A;  4AVP A;  2D1V A;  5IT9 K;  4N0B A;  4EV0 A;  1DDN A;  3R0J A;  1G4D A;  3I64 A;  2HGC A;  4MHG A;  1JHH A;  3CTA A;  4HOB A;  3L00 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...