1I1SA

Solution structure of the transcriptional activation domain of the bacteriophage t4 protein mota
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
96
structure length
96
Chain Sequence
MSKVTYIIKASNDVLNEKTATILITIAKKDFITAAEVREVHPDLGNAVVNSNIGVLIKKGLVEKSGDGLIITGEAQDIISNAATLYAQENAPELLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the transcriptional activation domain of the bacteriophage T4 protein, MotA.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Transcription
molecule keywords MOTA
total genus 21
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2001-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09114 MotA_activ Transcription factor MotA, activation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1i1sA00
1ZRCA 1F9NA 1MGTA 2COMA 3KP6A 3ECOA 3I0TA 3WGHA 1ON2A 3J80K 3T8RA 3KZZA 2XAQA 5LHIA 2VC0A 2G7UA 3T5XA 4AVPA 1FPQA 2XIGA 3BPVA 1HW5A 4MTEA 4CXFA 2MH9A 1D3YA 4EGYA 1J59A 1Z1DA 4MEYF 5K5QA 4HF0A 2ZMEA 2BE5F 2HKXA 1ZRDA 2CG4A 4ENNA 5FFXA 3FXQA 2IRFG 1FX7A 3QRFF 1DDNA 4HQMA 1ZYRF 3DXJF 4UVAA 4BH9A 1U5TC 5HLGA 4WWCA 4ESFA 1IXRC 4EJWA 1JHHA 4EM1A 1TNTA 5HDKA 5D8KB 1O7LA 3H92A 3KP2A 1P4AA 1AOYA 1ZG5A 1MD0A 4BQAA 1MKMA 3R4KA 4OIOF 2V1UA 3KEQA 3ZN1A 1KU2A 4IPAA 1TW2A 2ELHA 3BROA 3L2CA 2GWRA 2FRHA 4P55A 1YLFA 2J5OA 1XGOA 5A2QZ 2PMUA 2ISZA 2QZ8A 4JBAA 1T38A 2Z33A 1FSHA 2Z99A 2HTJA 3B02A 4MNUA 1IZ1A 3V7SA 2STWA 1WRJA 4ENJA 4L9JA 3E97A 4HDVA 3IWZA 4UVBA 3TDUC 1BI3A 2QBYB 1TW3A 3U1DA 4LD5A 2HZTA 5LEJA 4IXAA 4IHTA 4ENMA 5CLSA 1XGNA 2DT5A 1D8JA 5L3GA 2HEOA 4WCGA 2VOOA 3WTZA 5H6QA 3RYPA 3M8EA 4R8HA 2XAGA 4P5OA 3P9KA 1B6AA 2DK5A 4RB0A 2ZBKA 5F1RA 1W7PB 5JI6A 3V7CA 4MHGA 2RV8A 5CVRA 1REPC 1JXSA 2XKPA 2OAZA 2G9WA 2KJCA 1WI9A 4HOBA 4LFUA 4Q48A 3RKXA 3O6BB 4A0YA 2VONA 4M9XA 3F6OA 2JZYA 4LLLA 3T8TA 2O0YA 3MAJA 3C3WA 4CZZA 4I7HA 1RIOH 5CVJA 5ERIA 5DDGA 5K5RA 2W24A 3JTGA 4GXOA 4A2UA 1KQ8A 1W7PD 3O3KA 2LDUA 1R58A 4MTDA 3HOTA 3CJNA 4M9ZA 2LSOA 3R0AA 4Q47A 2MLKA 2YR2A 2KIUA 4L9VA 2NNYA 2F5DA 1T39A 4ESBA 2J5PA 4WXCA 1FBSA 4ZYGA 2L02A 4LK1F 1HQCA 3HSEA 4HV6A 1GHCA 2EV0A 4L9NA 1XSDA 1YS7A 2R7FA 5DCMB 4HF2A 3JTHA 4UV9A 2RKHA 2RVCA 2OBPA 3IRQA 5DD8A 4D0PA 4ZH4F 3R61A 2FEZA 4RS8A 3F21A 1ZARA 1ODDA 5IT9K 3TO7A 2E1NA 2VBWA 4OIQF 3TO6A 5E20A 5JHUA 3T0YA 4YFNF 2JRTA 1STZA 2PFBA 1XGSA 3FMQA 5J8CA 4UNOA 1YFHA 2XAFA 4L5JA 5LHGA 3I4PA 2IA2A 4MQVA 2FMYA 4N9HA 4QWQA 3LWFA 1O3TA 4E70A 3BP8A 4MQ9F 5ILSA 3HRTA 5IT9Z 2D45A 4KMUX 3RYRA 2YU3A 3ERED 2YSRA 2KJBA 3SZTA 2PI0A 3HSRA 4FT8A 1JE8A 1IXCA 2H27A 2R3SA 3NRVA 1TLHB 4ENKA 2LF8A 2VT3A 3JW4A 2F5FA 1P2FA 3R0JA 1O3RA 2LF7A 3WTVC 3Q9SA 1OR7A 1O57A 1R22A 3E3VA 3TOAA 4YFXF 3U2RA 5LBQA 4EJTA 3K0LA 3DFGA 2PG4A 1T98A 2Q8KA 3CUOA 2DAOA 3QOPA 2EV5A 2JTVA 1KGSA 4L9TA 2MLGA 3V8JA 5KVRA 4ZYHA 2L3DA 1IF1A 4KYWA 5DCFA 2P7CB 4RGRA 3CO7C 3H3ZA 2RDPA 1S8NA 1G4DA 3RKYA 2D1VA 3DPTA 1S6LA 2EJRA 2UXXA 2MD5A 1FC3A 3V8LA 1B1BA 3TO9A 1S7OA 4CGZA 3ABUA 2A69F 1UHMA 4KIFA 2P4WA 2FBKA 2RNJA 1BIBA 1LB2A 1FP1D 3T1BA 4G7ZF 4KN4X 3ISPA 2V9VA 5L3BA 5D4RA 2HFHA 1OPCA 3ELKA 3G3ZA 1DPRA 1W5TA 3B73A 4UV8A 1LNWA 2K27A 4JK1X 3GFMA 3CTAA 1VTNC 1R23A 2O8XA 4LLNA 1KU7A 4RB2C 1YTYA 2ZCWA 1LDJA 2BYVE 1SMYF 4RGUA 2OQRA 5HDGA 4S04A 2DPUA 2STTA 2ZNZA 1QGPA 2PEXA 3WE2A 4RGXA 1IRGA 2ZO4A 4RGSA 2WC2A 5ICGA 1F5TA 3FM3A 1G3TA 3QAHA 2KIMA 1P4XA 4BYYA 2JPCA 2CQKA 3IKVA 1CGPA 2YX4A 2PN6A 4ASNA 1YW7A 4LB6B 4GCVA 1HKSA 5BOXA 5D5WB 3DQVC 2EK5A 3GF2A 4HW0A 1JGSA 2QYOA 2Q0OA 3J80Z 2BGCA 2M87A 4PGGA 2XVCA 3K1PA 4HDUA 5D5UB 1S7AA 3DP7A 3FMSA 4K2EA 3NEUA 2VE9A 2M45A 1SAXA 3KCCA 3FMRA 2FBIA 5HS8A 2GXGA 1FYKA 2VBYA 2R7DA 5D8LB 4A6EA 1RZ4A 4IRIA 4L5IA 1SFUA 1K6OA 2O61A 2H6CA 1LEAA 3FM5A 3P9CA 5E1ZB 2GIVA 2CSOA 3WGGA 3IKTA 4I01A 3OV8A 1BC7C 2MH2A 4PDKA 2E7XA 2ETHA 5H20A 3RI4A 2NNNA 2AXLA 1WQ2A 2ESHA 2FU4A 1IW7F 1FP2A 1BOAA 2G7HA 1WKMA 3FX3A 3QPHA 1KU3A 3EYYA 1BN5A 2A07F 1Z9CA 5J6XA 3I5UA 4KFCA 5CVVA 3MZYA 4PGHA 2NRAC 1HKQA 3L09A 1KA8A 4A6DA 2XGXA 4R1HA 2IP2A 2QBYA 2M1BA 1J2XA 1PP8F 2UWMA 3VB2A 3VODA 4IRHA 4EM0B 1E17A 5HDNA 4EJUA 3VOEA 4HYEA 1BC8C 1KU9A 3DF8A 4EV0A 2MBFA 3RTRA 3JSPA 4LMYA 1J7KA 4CICA 2QVOA 1XGMA 5BPDA 2CYYA 4RB1A 3LA7A 4CDGA 1O7FA 3KP7A 3HYIA 4HF1A 5ED4A 1MZBA 1MDMB 3N4MA 1Q1HA 2MC3A 1V3FA 3DV8A 4XBFA 2CWEA 5E8GA 4IJAA 1XD7A 4O3MA 1TQPA 2AS5F 5H6RA 2WTEA 4FHTA 4HZFA 5DCMA 4DNCA 4F7ZA 3I54A 2PBIA 4BHCA 5FB2A 4OMZA 6PAXA 3GYHX 3BJ6A 3KEOA 5ICEA 1KQ0A 4CO8A 4KA4A 4LJZF 2B0LA 4L18B 1LDKB 3IWFA 3HTSB 1BI0A 1ZAOA 3M1EA 3F8NA 4FX0A 4UHTA 3G73A 3HRSA 1YG2A 1D5VA 3WODF 2C6YA 2K4JA 3I64A 4P96A 2P6SA 2GA1A 3PQKA 3GFLA 2XASA 3IRRA 5FLXZ 4IVNA 1MDMA 1K79A 4YIFA 1B59A 1R1UA 1SD7A 3PFIA 2O6GE 4U0YA 2W84A 2A5YB 1ZG3A 5K5OA 1F1ZA 2EA4A 5LGUA 1LVAA 4L0ZB 2QLZA 2DQLA 2FE3A 3M8FA 1R1VA 5FLXK 3LQQA 3E5XA 1A04A 4KIGA 3BJOA 3RJPA 3J81K 5FFZA 3P7NA 2M5WA 4M73A 4Z2YA 1EH6A 3LA3A 3U9GA 1G3SA 2OZ6A 1BI2A 3GLXA 1SD5A 1BBYA 1TBXA 4HV5A 4AIJA 4FX4A 2HGCA 2D2WA 3GO5A 1K7AA 1H9GA 1H0MA 1FOKA 5HVQC 2JPBA 2W85A 3BDDA 1YQAA 3ZMZA 1PP7U 4EGZA 3F6VA 2RN7A 3GFIA 1RI7A 4LLGF 1DUXC 3ULQB 1B9NA 2EFQA 1EV7A 4IRGA 1J0RA 4XSZF 1QZZA 4A12A 5CJ9A 2E1CA 3I58A 2XHKA 4ZZDA 3F8MA 5LGNA 3C7JA 4U7BA 2HDCA 3WE3A 2WWYA 3DEUA 4WF2A 3F23A 3ZN0A 2V79A 3F22A 1LEBA 1OMIA 3WGIA 2KKOA 3K2ZA 2LKPA 4OMYA 3FXUA 2EFPA 1FT9A 3SQNA 2CFXA 1BI1A 2W25A 3P9IA 2H94A 3PQJA 3V4GA 4GGGA 2HQRA 4DQ2A 3JSOA 2XAJA 3EUHA 4I98B 3R60A 1FBUA 2PJPA 2O3FA 1Y0UA 2IA0A 2VODA 4LB5A 3IL2A 2P7VB 3M9AA 1YYVA 5DD4A 1FYLA 1XN7A 3WU0A 2QQAA 1HKTA 1UB9A 3JAMZ 2CW0F 2XV4S 3HRUA 5AIPA 5L3EA 4CYDA 3E6MA 3FHZA 2HR3A 4PZJA 3CO6C 4U7DA 1XDUA 3WTYC 3GWZA 1BM9A 2NAZA 4UUVA 3ZMUA 4ESJA 2CO5A 1FZPB 3DKWA 3ZMDA 3LAPA 5FGMA 2GXBA 1HSTA 2FMLA 4XRFA 5HS7A 3FZVA 2DBBA 3I53A 4UXNA 3QU3A 4KT5C 1CF7B 1UCRA 5BQTA 3NQOA 1QBJA 2A61A 4WK8F 4HX4A 3OOPA 4G9YA 3RIRA 5E1WA 1TQMA 2VC1A 5D6FA 3GX4X 5CVIA 2E7WA 2DPDA 3E6DA 1H9TA 5BS6A 5IT3A 4EQQA 1K78A 1AWCA 1IN5A 4Q5SF 2XUBA 5D4SA 2A6EF 3KE2A 3WTUC 1MJBA 4HAMA 1I5ZA 4ZYDA 5CYVA 1L0OC 4OIRF 1OKRA 5LLQA 4M6XA 1FBQA 1FY7A 2HYGD 5ICCA 1P92A 4ZYEA 2X4HA 4BHBA 1R36A 1Z7UA 3RDIA 2P5KA 3O2PE 1E2XA 1OYWA 2JSCA 1R00A 3KETA 2IPQX 1L3LA 1FYMA 4EJOA 1QO0D 1LQ1A 2A68F 4AIHA 2VBZA 1QNTA 1XSVA 2RGVA 1ULYA 3MFKA 2HTSA 2FQ3A 2KRFA 2MA3A 1ZREA 3H3UA 4N9IA 3TQNA 1V4RA 4A5MA 1R7JA 3GEZA 1ONVA 4ETSA 3GVAA 1QZYA 3F72A 2FXAA 3JAMK 3S2WA 1HW1A 5AONA 1ON1A 4O6JA 1PUEE 2K7LA 5DUKA 2Y48A 4BNCA 3CUQA 4AWXB 3SZPA 2FF4A 1W4MA 4WXHA 2VBXA 4Y15A 5FO5A 1B4AA 2QQBA 3EQLF 4A0XA 2L4AA 4MGRA 2GQQA 1U78A 1J75A 1MJAA 5DEQA 5JR3A 4HA8A 2OQGA 1HW2A 4BAYA 1LDDA 1BIAA 3IC7A 1I6XA 4G6DA 3MQ0A 5A2QK 3WG9A 3ZMTA 2Y75A 3D5LA 1Z6RA 5AIQA 3M7GA 4Y13A 4XSXF 1U3EM 1T2KA 3KP4A 1O3QA 3WTSC 5E17F 1SFEA 3QPTA 2ADUA 2O03A 4M9SA 3L00A 5BPIA 3ZPLA 4HBLA 3HIFA 1USTA 3CUQB 5E18F 4NB5A 4KUMA 2OA4A 1I1SA 4I02A 3HUGA 4N0BA 1XB4A 1I27A 3QU6A 3COAC 2Q2EA 2HS5A 5E1XA 5LRRA 3L7WA 3TGNA 1YW8A 5BMZA 2FSWA 3EYIA 5L3DA 2BEOA 1IN4A 1Z6TA 4RAZA 5TRDA 3BPXA 3I59A 4U88A 3HOSA 4Y17A 2H09A 2LNBA 2QUFA 1LJ9A 3SXYA 5JFRA 2WV0A 1X3UA 1U5TA 5HOOA 3K69A 3KP3A 1GXPA 4YIIA 1RUNA 1YS6A 1KYZA 1UHWA 3GFJA 4NHJA 1DP7P 3TDZC 2UZKA 2ZXJA 3V8KA 3Q5FA 5DUIA 1FWZA 4LG0B 5FD5A 3QP6A 5HS9A 2K02A 4OU0A 4P9UA 2QM3A 2BV6A 3GUDA 1GVJA 4IHSA 2VE8A 3E5UA 1K78B 3REOA 2DU9A 4EMSA 2K86A 4KNYA 4LG0A 1U5TB 4U0WA 1HSJA 2DK8A 5D5VB 5TJJA 4WXDA 4P9FA 1RUOA 1IN8A 2IW5A 3CDHA 3I59B 2TDXA 2A3SA 2Z5UA 4PCQA 5HLIA 3ML6A 3WU1B 1CF7A 2YX7A 2GA2A 3LQRA 2XRNA 2M30A 3E5QA 1F4KA 1GXQA 1SD6A 3K9TA 4AD9A 3KZYA 5HLHA 3FF5A 1ZLKA 3IHUA 3RPQA 4M71A 4UVCA 1OYIA 1IAWA 3AAFA 4A5NA 2VT2A 4M74A 2ZFWA 3F3XA 1YW9A 2EFOA 2CGPA 3I71A 3TOBA 2NYXA 1R5HA 2ACJA 2F5EA 4G6QA 4IF4A 2XAHA 2DI3A 1ZHFA 4LGWA 1JHFA 1TQIA 3GW2A 1C0WA 1I1GA 4B8XA 2EA2A 2Z3YA 2ZMEB 1G3WA 2P8TA 2ESNA 1D8KA 2XROA 2OU2A 4OOIA 5EEHA 3K1NA 3VFZA 1USSA 1BJAA 1YO5C 3GXOA 1T6SA 3KLNA 3KLOA 3GZ6A 2DO7A 1ZRFA 1QPMA 3HHGA 1MJ9A 3ZMSA 2F5CA 2P5VA 2FNAA 3WTWC 4BHPA 4GO1A 5LEKA 2D1HA 4U0VA 1IN6A 2UXNA 2W57A 1YIOA 4BXUA 2VN2A 2H6BA 1WWXA 3C1DA 2L4MA 3CLOA 2FA5A 2FNPA 5DYMA 3ZMVA 5D5XB 5J8FA 4S05A 1OYYA 1P6RA 2P6TA 3SFZA 4YFKF 1XMKA 4A0ZA 1U8RA 3E6CC 3MZHA 1R5GA 3FWEA 2NS0A 1KQ9A 2FBHA 2IT0A 4QLCU 2HQNA 1W7PA 3MWMA 1XCBA 3MEXA 4AIKA 3V7RA 1ZGJA 1SD4A 4M6YA 4TV7A 3CUQC 4EJVA 1DPUA 2L01A 1TNSA 4OIPF 1EH7A 1RNLA 1HBXG 3R6SA 2JT1A 2QWWA 4ON0A 2EWNA 5KK1A 1IN7A 2EB7A 1HXDA 1XCVA 3ZQ7A 4EM2A 2PMHA 2ZNYA 3HRMA 4I09A 2GAUA 4I0BA 3BOQA 3ZP5A 1XMAA 2P5LC 2HOEA 1G3YA 2Z9OA 3J81Z 4G7OF 3RPUA 2IA1A 1Z05A 2VXZA 3KFWX 3LA2A 4I2OA 2EFNA 4KMFA 1IRFA 3N97A 3BY6A 4G8XA 3E6BA 1PDNC 5L3FA 2ZKZA 1QQIA 3ABTA 3WTXC 3W6JB 3C18A 4O5VA 3W6KB 2Y0MA 5FD6A 5JVTA 4G94A 1P4WA 4WX9A 4L0YB 2OD5A 1ZLJA 3FXRA 1B9MA 5ILUA 5EEGA 2VOPA 1S29A 2BBYA 4KN7X 2A6HF 4HLYA 5ILVA 3MCZA 4HX8A 1O3SA 2V1DA 4XLNF 1Z91A 4KICA 1ZH5A 2YPRA 2DW4A 2EV6A 5L3CA 1R1TA 5ICFA 1FSEA 5F6FA 1G6NA 2DQRA 3SHFA 1TTYA 1S3JA 1FLIA 2IVMA 2FOKA 3RKWA 2HWVA 2M8EA 3KP5A 3LSTA 3GZ5A 3QP5A 4HLXA 2EFWA 4CHUA 1WSUA 1W5SA 1ZG1A 2DTRA 2L54A 4HQEA 2HKOA 2V6CA 3EETA 1IXSB 1FNNA 4MEXF 2HYFA 2KIFA 5DV5A 3F8FA 5LRSA 3TKYA 4YG2F 2RC4A 3F8CA 1KYWA 4HX7A 4Q4ZF 1SFXA 4G7HF 2K4BA 3VEPA 2DFIA 1ZN2A 4GYIA 2PQ8A 5K1YA 3Q9VA 5D6EA 4JQFA 5LGTA 3WTTC 3BJAA 1EH8A 4R79A 3LFKA 5E8IA 4H0EA 5LHHA 1UFMA 1J9IA 3HHHA 5F64A 3F8BA 5CVUA 4GYGA 4KIBA 4EVIA 2PLYA 4B09A 3ECHA 1ZGAA 1SMTA 4OINF 2IJLA 4I0AA 1U2WA 4ZZLA 2ISYA 4NQWA 3J7AO 2QENA 4RB3C 3D0SA 1NHAA 2DLLA 3BZ6A 2F2EA 1XSXA 2GZWA 1IUYA 1XDSA 2QQ9A 4XLPF 4RAYA 3L9FA 2V1XA 3HSFA 2X0LA 3BWGA 3DPLC 4M72A 2XKOA 2OZUA 4LK0F 1T0FA 1J5YA 3K1MA 2RQPA 3EDPA 1U6GA 2ZJ2A 3HTUA 4KDPA 3LAJA 3ROUA
chains in the Genus database with same CATH superfamily
2LMDA 2KFDA 1F9NA 5B1AH 2CQNA 1ZRCA 2CV1A 3PNVA 1MGTA 2COMA 4E4HA 1WHUA 1R4NB 3KP6A 3ECOA 3I0TA 1V5EA 3WGHA 3BR0A 5IP6A 1ON2A 2DMUA 1IV8A 3BG7A 5E3OA 1R49A 3J80K 3T8RA 3KZZA 2XAQA 2KZVA 5LHIA 2VC0A 2G7UA 3T5XA 4AVPA 3VSLA 3C2BA 3CCRI 1FPQA 2XIGA 3BPVA 2LR8A 4RM3A 1HW5A 4D9JA 4MTEA 2LD5A 5F27A 4CXFA 2MH9A 1DQUA 1D3YA 4EGYA 1J59A 3CD6I 5K7FA 1Z1DA 3BLYA 2E19A 4MEYF 4IHVA 5LD2C 5K5QA 2CV0A 4V2GA 4HF0A 2EIKH 2VKDA 4V19K 2ZMEA 2KDZA 2BE5F 2DMTA 2HKXA 1ZRDA 4Z6YA 2CG4A 3E7LA 4ENNA 1WVRA 5EZGA 2IS6A 5FFXA 3FXQA 2Y31A 2ICWG 2LRDA 3S16J 4V2FA 2IRFG 1XX5A 1FX7A 3QRFF 3NAUA 3CJQB 1DDNA 4HQMA 2CUZA 1IGNA 1ZYRF 2E1MC 3ZQCA 2OTLI 3DXJF 4UVAA 4DGWB 4BH9A 1U5TC 5F0HA 5HLGA 3M3YJ 4WWCA 4ESFA 1IXRC 4A3DJ 2EIMH 3UR3C 1RR8C 4EJWA 2IS4A 1JHHA 3WG7H 4EM1A 1I39A 1TNTA 1YITI 3IH3A 5HDKA 2R7SA 3ZRGA 5D8KB 2EINH 4XLAA 4B3AA 1O7LA 1JUPA 3H92A 3KP2A 1P4AA 1AOYA 1ZG5A 1MD0A 4BQAA 1MKMA 3R4KA 2V1UA 4W97A 1BR1A 4OIOF 3KEQA 3ZN1A 3S1RJ 2NXNB 1BA5A 3EUKL 4B47A 1KU2A 2CV2A 3CMMA 4IPAA 2IAIA 4NUBA 1APLC 3VYTB 1TW2A 2ELHA 3F0CA 4D1QA 3BROA 5GAGJ 3L2CA 4F91B 1I6HJ 3C2GA 2GWRA 4CCJA 2QKLB 4CYCB 2FRHA 1TL8A 4P55A 1YLFA 2J5OA 3HJEA 1QVTA 1XGOA 5A2QZ 1X2NA 2OTJI 2M8GX 2DA4A 2PMUA 2OF7A 2WAQN 2ISZA 5J47A 3MN2A 2QZ8A 2VIXA 3K4KA 4M3FA 3H0DA 1JKOC 2R5ZA 4JBAA 1T38A 2Z33A 1FSHA 1RC9A 2Z99A 3OMYA 2HTJA 4NNJA 2DOAA 2JA2A 3B02A 4MNUA 1IZ1A 2R7UA 3V7SA 4NQWB 1WRJA 4BXFA 4ENJA 2STWA 5EJCA 2LK2A 3E97A 1NG6A 4L9JA 1YRNA 4HDVA 3IWZA 1GDTA 1VQNI 1R71A 4NC6A 4UVBA 5LFAA 3TDUC 1BI3A 2MFZA 2QBYB 1TW3A 3U1DA 4LD5A 2HZTA 5LEJA 1LPQA 2ZC2A 3JRHA 4IXAA 1A5JA 3TMOA 4IHTA 4ENMA 5CLSA 1XGNA 2DT5A 4RLQA 1D8JA 1R4MB 5L3GA 2NVUB 3JRIA 2HEOA 3HL2A 2R7TA 4WCGA 4BQNA 2F4IA 1HLVA 1QA6A 4PUSA 2VOOA 3WTZA 3GBGA 2NVYJ 3S14J 2R7VA 4D5CA 1ETYA 5CQGA 3M4OJ 5H6QA 2XGDA 3RYPA 3M8EA 4R8HA 2XAGA 4P5OA 3ZQLA 1JT0A 3P9KA 1B6AA 2DK5A 3RZOJ 2JN6A 1OCCH 4RB0A 2ZBKA 5F1RA 1W7PB 3H5AA 2E1MB 5JI6A 3V7CA 3BTLA 2WY7Q 4XK4A 2VQGA 2RV8A 5CVRA 4MHGA 1REPC 3GTMJ 1JXSA 2XKPA 2OAZA 2G9WA 1GUUA 2HNHA 2KJCA 2L7KA 1WI9A 4FQGA 4HOBA 4LFUA 4Q48A 3RKXA 4LG3A 3O6BB 2DT6A 5FJ8J 4A0YA 2P0WA 3ASOH 2K3PA 4M9XA 1LFUP 2VONA 3F6OA 1N78A 2JZYA 2DCEA 3ZQGA 1WH7A 5J1UA 1JJ8C 4LLLA 3T8TA 3OYKA 4RLFA 2O0YA 3ESWB 2MYSA 1SVOA 3MAJA 2LKSA 2JA5J 3C3WA 2OUMA 4CZZA 4I7HA 1RIOH 3TW7A 3LNQA 1VQ9I 5CVJA 5ERIA 2K40A 2LLKA 1OCOH 5DDGA 2JVHA 5K5RA 2W24A 3JTGA 4GXOA 5GPCA 4PSXA 4A2UA 1KQ8A 1OISA 1W7PD 3O3KA 2AO9A 1F36A 2LDUA 1R58A 3HZJA 4MTDA 3HOTA 3CJNA 4M9ZA 2LSOA 4AU7A 3R0AA 4Q47A 2MLKA 1U8BA 2YR2A 2KIUA 2MABA 4L9VA 2NNYA 3A4CA 2F5DA 1T39A 4ESBA 3OIQA 2J5PA 2IS1A 4I6ZA 4IHXA 2X6OA 4WXCA 3PJRA 3HG9A 1FBSA 2G0EA 4ZYGA 4DBRA 3CMAI 1JI8A 2L02A 4LK1F 2HDWA 1HQCA 2O8KA 3HSEA 1GLNA 5F04A 3OIOA 4BACA 2NS8A 5FKOA 4HV6A 3GTLJ 1G59A 1GHCA 2EV0A 3LSMA 4L9NA 3BZKA 3CCSI 1XSDA 2LREA 1YS7A 2R7FA 5DCMB 4HF2A 2LBFB 3JTHA 4UV9A 2RKHA 2RVCA 2K9NA 3CC4I 2OBPA 4G12A 2L5QA 2CFOA 4BU2A 3DEEA 3IRQA 5DD8A 4D0PA 1ZGWA 2K85A 3KX2A 4PJLA 4ZH4F 3R61A 4GDFA 2FEZA 2HVQA 4RS8A 1X1PA 1ZARA 3F21A 4BY7J 1ODDA 1G2HA 1ZKGA 3ZCOA 5IT9K 3TO7A 5JVGF 1N77A 2E1NA 2DA2A 3LSKA 2LY9A 2VBWA 4OIQF 3A02A 2EH3A 3MKWB 2JUGA 5DM7F 3TO6A 4X6AJ 3H1CA 5E20A 1B8IA 5JHUA 3T0YA 3DBRB 5F1JA 4YFNF 4J19A 1YIJI 2JRTA 1STZA 2PFBA 5J4VA 2VASA 1XGSA 3FMQA 2ID6A 2ZXWH 5GP9A 5J8CA 5EDNA 1YFHA 4UNOA 2JA7J 2XAFA 4L5JA 4XKCA 5LHGA 3I4PA 4BJ6C 3OYDA 5C4XJ 2IA2A 3LMMA 3RQ4A 2XRLA 4MQVA 2YUSA 2FMYA 4N9HA 4QWQA 3JRGA 3LWFA 3CCUI 4PJNA 2F4OB 4XRSA 1S72I 3GMEA 1JT6A 3Q0UA 3BP8A 4MQ9F 4E70A 5ILSA 1O3TA 1IUFA 3HRTA 5IT9Z 2D45A 4KMUX 3RYRA 3KEYA 2YU3A 1UMQA 3ZQHA 3ERED 3L2WA 2YSRA 2KJBA 3SZTA 1FTZA 2PI0A 3ZXSA 3HSRA 3M8JA 5IYBJ 4Y3OA 2L0KA 4FT8A 1JE8A 1IXCA 2H27A 2XAUA 3JRAA 5KCMA 2R3SA 3NRVA 1TLHB 2ZJRF 4F92B 1RESA 4ENKA 1WJCA 1HOMA 3OIPA 3ONQA 3I9V2 2LF8A 5FRMA 1DGRM 3AL0B 2VT3A 3JW4A 3QODA 2F5FA 2K9MA 1P2FA 3R0JA 4A3KJ 1O3RA 2LF7A 3U21A 3WTVC 3KYDB 1OR7A 1O57A 1R22A 3E3VA 3Q9SA 3TOAA 3U2RA 4YFXF 1IJWC 5LBQA 4IHWA 3TP3A 3S17J 4EJTA 3K0LA 1MNDA 1SVMA 3E0JB 3DFGA 2PG4A 1TWHJ 1T98A 2ZB9A 3S1QJ 1FOWA 3H9QA 2IEKA 1X3ZB 2NOGA 2EIJH 2Q8KA 5M5WJ 3CUOA 2DAOA 3I56I 1K6YA 3QOPA 2JJ7A 2EV5A 2HVRA 4C2MJ 1TZLA 2JTVA 1KGSA 4L9TA 1JJ6C 2I8DA 2MLGA 4C9YA 3V8JA 5KVRA 4BEHB 4ZYHA 2L3DA 1IF1A 4KYWA 5DCFA 2P7CB 4RGRA 1S9HA 4XL9A 3CO7C 3H3ZA 2RDPA 3JRCA 1S8NA 1TP4A 1G4DA 1DU6A 3RKYA 2D1VA 3DPTA 1S6LA 2EJRA 2UXXA 3K70C 2M34A 2LY1A 3FKJA 2MD5A 2FJ1A 5FKNA 3LSHA 1FC3A 1T95A 1QRYA 3CLQA 2TCTA 4CZCA 1U9OA 1B1BA 3V8LA 3TO9A 5F08A 5M3MJ 1A6IA 1S7OA 5E3MA 4CGZA 5FKKA 3ABUA 2A69F 1UHMA 2JA6J 4KIFA 2P4WA 3MD2A 2FBKA 1U9NA 3K10A 2RNJA 1I3QJ 4B43A 1BIBA 1PYVA 2O7OA 3HEFA 3A1YA 4M3EA 3A03A 4XORA 5J4YA 5DM6F 1LB2A 1FP1D 2X1CA 1MBJA 3T1BA 4G7ZF 4LOCA 4KN4X 2W00A 3ISPA 1MMNA 2V9VA 5L3BA 4XICA 5D4RA 2EPFA 1KZHA 2PJRA 2HFHA 2GOXB 2RAEA 1OPCA 1X1CA 1VQPI 1RETA 3ELKA 2HOTA 3G3ZA 1DPRA 1W5TA 5EZHA 3OYAA 3B73A 4UV8A 1VZ0A 1LNWA 2K27A 4JK1X 1GVDA 2V9PA 3HPHA 3GFMA 3CTAA 1VTNC 1R23A 3G4SI 4YEJA 2O8XA 5M3FJ 4LLNA 1JGGA 2DA5A 1KU7A 2W1OA 1B72A 3MZ8A 3PIOF 3OY9A 3OYFA 4RB2C 1YJNI 1UG0A 1YTYA 2ZCWA 2PMZA 1LDJA 2BYVE 1Z67A 1SMYF 4RGUA 2OQRA 3KPHA 2DDBA 4HG2A 3KYCB 3HC7A 1W36C 3IAM2 3DLAA 4XMYA 5HDGA 4S04A 2DPUA 2STTA 1MNEA 2KZGA 2WAFA 2ZNZA 3K4MA 2GLOA 1QGPA 2M9HA 2PEXA 3WE2A 3BZCA 2CS3A 4RGXA 3K4NA 3SEZA 2QF7A 1T08B 1IRGA 2ZO4A 1IG7A 4RGSA 4E7JA 1MBGA 2WC2A 4HNTA 2Y69H 3CCLI 2M7AA 4XKVA 5ICGA 1F5TA 3FM3A 1G3TA 1IRXA 3AG4H 2XGEA 3QAHA 1SAUA 2KIMA 1P4XA 2XC7A 4BYYA 3K70D 1OR7C 2JPCA 1Z3XA 2BW3A 2CQKA 3CF2A 3IKVA 2QQ8A 4HPQA 3AKZA 2HYJA 1X1BA 1X4PA 2YX4A 1CGPA 2E35A 4F93B 2PN6A 4ASNA 1YW7A 3VPRA 4LB6B 2LP0A 4GCVA 1AA7A 5TGTA 1JUMA 1HKSA 2JVGA 5BOXA 5D5WB 1YOVB 3DQVC 1IO2A 2EK5A 3GF2A 1JGSA 4HW0A 3DKYA 3OYMA 2QYOA 2Q0OA 3J80Z 2BGCA 2M87A 2OC6A 3OS1A 4MLOA 1I50J 4PGGA 2XVCA 3K1PA 3VDXA 1P7IA 4HDUA 2JUCA 1X2MA 3L2QA 5D5UB 1S7AA 3DP7A 3FMSA 2ECCA 5B5EC 4K2EA 3NEUA 2VE9A 3QYEA 2M45A 1SAXA 1RR7A 3KCCA 3FMRA 2FBIA 5HS8A 2GXGA 1FYKA 2VBYA 4ITVA 3A0HC 2B7EA 2R7DA 4IZZA 1VI0A 3G1MA 5D8LB 5J1RA 3OR2C 3PSIA 1HCRA 4A6EA 1FIAA 1RZ4A 4IRIA 4L5IA 1SFUA 1K6OA 2O61A 2H6CA 1LEAA 3FM5A 3P9CA 5E1ZB 1H88C 2Z16A 4IKFA 2GIVA 2CSOA 1UZCA 3WGGA 3IKTA 1MMGA 3HGGA 3N05A 4I01A 2VLAA 4BEHA 3OV8A 5JLXA 1BC7C 2MH2A 4PDKA 1NK2P 1JKPC 2E7XA 2Y0SN 4PFOA 2ETHA 2KQRA 5H20A 4H4KC 2CUJA 3RI4A 1FJLA 4KISA 2BZTA 1S7EA 2NNNA 2AXLA 2HXIA 4QIWN 1WQ2A 3JCUC 4NDLA 1FTTA 2ESHA 1D1BA 1D5YA 3H35A 2FU4A 2HI3A 1IW7F 1FP2A 1BOAA 2G7HA 1WKMA 2HOSA 3OL3A 3FX3A 1V5GA 3QPHA 3FIWA 1TWFJ 3HM5A 1KU3A 2DJNA 3EYYA 1LE8B 1BN5A 1PJRA 2A07F 1Z9CA 5J6XA 5JHFA 2R4GA 3MMYB 3I5UA 2Y9YA 1O4XA 4KFCA 5CVVA 2AQFA 2X1DA 3MZYA 4PGHA 2NRAC 1HKQA 2OCCH 3ABKH 3L09A 1KA8A 4A6DA 4U87A 1ORKA 2XGXA 4R1HA 2IP2A 2QBYA 3WU2C 2V6EA 2M1BA 1J2XA 2M4GA 1PP8F 2UWMA 3VB2A 3VODA 4IRHA 4EM0B 1E17A 3S1MJ 4CCOA 5HDNA 2VL8A 2LG4A 3M07A 4EJUA 3VOEA 3S2HJ 4HYEA 1AKHA 1BC8C 2R7XA 1KU9A 3DF8A 4X0GA 3H9GA 4EV0A 1HC8A 2MBFA 4ANJA 2WV1A 1F43A 3RTRA 1IRZA 1W1WE 2BHYA 3JSPA 4LMYA 1FEXA 2W7NA 1J7KA 4CICA 2QVOA 3WHCA 1XGMA 4RAGA 2PX9A 4M6VA 5BPDA 2CYYA 2ZSHB 4RB1A 4JYKA 2HVSA 3LA7A 4CDGA 3L2RA 1O7FA 3S3OA 3KP7A 2NVQJ 2X85A 3HYIA 1YJWI 3DCFA 4HF1A 5ED4A 1OCRH 3SEQA 1MZBA 1MDMB 3N4MA 1Q1HA 2MC3A 1V3FA 4RM2A 2KDOA 3DV8A 1DGWY 4XBFA 3BTJA 2R5YA 4ZTFA 2BVMA 5KAIC 2JWTA 2XB0X 2B9SA 2CWEA 1ETXA 5E8GA 3LSJA 4IQ4A 3DWLE 4IJAA 2XPVA 5IPAA 3QPSA 4BL0B 2DYRH 1XD7A 4O3MA 5IOZA 3PL8A 1VQ7I 1TQPA 1ZK8A 5EGOB 2AS5F 5H6RA 2WTEA 3IH2A 1WFXA 5HLTA 3OSFA 2Y2ZA 4FHTA 3S8PA 4DOZA 2E5NA 4HZFA 4HNUA 3CCYA 4E7KA 3CP2A 5DCMA 2WAQA 4DNCA 2QKMB 3IV5A 4F7ZA 3I54A 3BQZA 2HOAA 2PBIA 4BHCA 5FB2A 4NBQA 4OMZA 5EG0B 6PAXA 4HSRA 3GYHX 3ERMA 1T0FC 2L9NA 3BJ6A 2DDAA 3KEOA 5ICEA 1KQ0A 3PO3J 4CO8A 1HF0A 2LKXA 4KA4A 1GV5A 4LJZF 2B0LA 4L18B 1LDKB 3IWFA 1WJBA 3BR2A 3HTSB 1BI0A 2M7BA 1ZAOA 2E1OA 3M1EA 3F8NA 4FX0A 4UHTA 2X6XA 3RPUD 3G73A 3HRSA 1XPXA 2L9VA 1YG2A 5B3SH 4UB6C 2DA1A 1D5VA 3WODF 4LIUA 3DBHB 2C6YA 5F0FA 2K4JA 3I64A 4P96A 1WJEA 4II2A 2P6SA 3G6EI 3OS0A 3DTEA 1ETVA 3Q0WA 3JR9A 2CUEA 2GA1A 1JKQC 2ELKA 3PQKA 1T56A 3GTGJ 3GFLA 2XASA 3IRRA 2BXYA 1ETKA 2V7FA 5BNGA 5FLXZ 2V4JC 2R5YB 1SEUA 2VJJA 4IVNA 3NWSA 4F52A 4BUPA 2VQHA 4E7IA 4UUSB 1MDMA 4BBSJ 2DYSH 4OAYA 1Z21A 1K79A 3PNTA 4XLCA 4YIFA 5C3EJ 1B59A 1Y1VJ 4DYRA 4G6TB 1R1UA 5FKMA 1SD7A 1ZTRA 3PFIA 2O6GE 4U0YA 4CH7A 4CA0A 1K83J 2W84A 2A5YB 2F4MB 4XOPA 2AHQA 3EUAA 1ZG3A 1W0TA 5K5OA 1F1ZA 2EA4A 2L9RA 5LGUA 1NK3P 1LVAA 4Y4RA 2VUMJ 1WGXA 4L0ZB 2L9SA 2QLZA 2DQLA 2FE3A 2EZIA 3M8FA 1SFOJ 1R1VA 3OYHA 3LQQA 3A01A 5FLXK 2VKVA 3FK7A 3E5XA 3W3CA 2PMZN 1A04A 4KIGA 3PUBA 4P1WA 5M5YJ 3BJOA 3PM1A 1Y0NA 2BY2A 2DTZA 4RMNA 3RJPA 3J81K 5FFZA 1OCZH 2X51A 2EZLA 5FKLA 3U1KA 3P7NA 4QTRA 1MBKA 3CF5F 2M5WA 4M73A 1D0ZA 4DYQA 2W4SA 2LY2A 4Z2YA 1EH6A 4RA2A 3LA3A 1K4TA 3U9GA 1G3SA 2OZ6A 4M3DA 1BR2A 3W2AA 1BI2A 3GLXA 4XKWA 3MVPA 1R9TJ 2CQXA 2KHMA 3PUFA 1SD5A 4PJ0C 1BBYA 1TBXA 2WB1A 4HV5A 4AIJA 4FX4A 2HGCA 5E3NA 2D2WA 4BGDA 3GO5A 1K7AA 3QYBA 1BL0A 1H9GA 1H0MA 1FOKA 5HVQC 2JPBA 2W85A 3BDDA 3AL0C 1YQAA 3ZMZA 2K5CA 2DA7A 5K7ZA 1PP7U 4EGZA 3F6VA 2RN7A 3GFIA 4FE4A 4HSTA 1RI7A 1Z77A 2XF7A 4LLGF 1DUXC 3ULQB 1B9NA 2JK3A 2EFQA 1EV7A 1NTCA 4IRGA 2E2HJ 3S15J 3KYLA 2XGCA 1J0RA 1G8XA 4XSZF 5HNFA 4XONA 2M0MA 4A3FJ 1QZZA 4A12A 5CJ9A 1PVEA 4BQQA 2E1CA 4CCKA 1MW7A 3I58A 2A5WA 3OR1C 1DU0A 2E2IJ 2XHKA 4XRSG 4ZZDA 2VXDA 2OPTA 3F8MA 3FXMA 5LGNA 1JUSA 2DMQA 3C7JA 4U7BA 2HDCA 1YE9A 5JLWA 1Y8RB 3WE3A 2WWYA 3DEUA 1OJLA 3FBIB 4WF2A 3PIPF 3S2DJ 3V42A 3F23A 1ETWA 3ZN0A 2V79A 3F22A 4X1EA 4IHYA 1UHSA 4D5FA 3DPUA 4HNVA 1LEBA 3H3VK 3ABLH 2VJ5A 1OMIA 3WGIA 2KKOA 3K2ZA 2RNGA 1RKTA 1LFPA 2LKPA 2VJ4A 1E0EA 4OMYA 2DFFA 3CCJI 3FXUA 2EFPA 1MNMC 2VKEA 2VPLA 1FT9A 3SQNA 4E6KG 3W6VA 2CFXA 1BI1A 3J7AY 4XLHA 2JMWA 2Y30A 4DIQA 3SYTA 2W25A 3P9IA 1MMAA 2H94A 3PQJA 3V4GA 4L5EA 1MBHA 5FLVA 2O5RA 4E7HA 2V26A 4GGGA 4DW6A 1RRJA 1NH3A 2HQRA 4DQ2A 2A6TA 3WHBA 2GBYA 2HPIA 4JX6A 2NS7A 5EG0A 2XAJA 3JSOA 3EUHA 4OAZA 3CQZJ 4I98B 1LFBA 3R60A 1FBUA 2PJPA 2O3FA 1Y0UA 2DFEA 4PJJA 5GTIC 4BBRJ 2F6CA 3FHNA 2IA0A 3O8GA 1IDYA 2Q1ZB 2XSJC 1V55H 2VODA 4AVZA 1GV2A 4LB5A 3IL2A 4IO9F 2P7VB 3M9AA 1YYVA 5DD4A 1FYLA 5EGOA 1XN7A 3WU0A 1QHGA 3VYSB 3CCVI 1DP3A 2R93J 1LUJB 2QQAA 1HKTA 4E7SA 1UB9A 3JAMZ 2CW0F 2XV4S 2D5VA 3HRUA 5AIPA 5L3EA 1Y56A 3TL4X 2JSPA 4KITB 3J7YJ 4CYDA 2DT7B 5B66C 3E6MA 3FHZA 2HR3A 2K9SA 4PZJA 1ACIA 3TEDA 3CO6C 3O8HA 2V9KA 4U7DA 1XDUA 1XS9A 1ZELA 1B72B 3HDDA 2I5UA 3WTYC 3OS2A 1VQMI 3GWZA 1IC8A 1BM9A 1PUFB 3OYNA 2NAZA 3HOXJ 4AYBN 4UUVA 3ZMUA 4ESJA 2CO5A 1FZPB 2MGQA 4J00A 3DKWA 4DZJA 4A3LJ 2Z2SB 3ZMDA 2B63J 1BW6A 3LAPA 5FGMA 4I76A 2GXBA 3ZQFA 1HSTA 2FMLA 2KP6A 4XRFA 5HS7A 2R92J 4ZJZA 3FZVA 4EATA 2KT0A 3CP8A 4DJAA 3OYEA 3OWTA 2DBBA 3I53A 4UXNA 3OSGA 3QU3A 2ME6A 3ZQIA 4KT5C 2QSGX 1CF7B 1UCRA 2DMPA 1AKHB 3S3MA 2HDDA 5BQTA 3JRFA 3PFYA 1Q1VA 3NQOA 3CDLA 2A61A 1QBJA 4FASD 3CCQI 4WK8F 3BR6A 4HX4A 3GLLA 1Y39A 1A35A 1IDZA 1MBEA 3OOPA 4G9YA 3RIRA 4CUGA 1WZ2A 1TT0A 2W82A 5E1WA 1TQMA 2VC1A 4YELA 5D6FA 4QSHA 5GAHJ 3A0BC 3GX4X 5CVIA 3ZR8X 1E3OC 2E7WA 2DPDA 3E6DA 1LKXA 3SJMA 1H9TA 2FD5A 5BS6A 5IT3A 4EQQA 1K78A 3OYIA 1AWCA 1IN5A 2BHZA 4Q5SF 2XUBA 5D4SA 1E3HA 3GTKJ 2A6EF 3KE2A 3WTUC 1MJBA 4HAMA 1I5ZA 3KZIC 1OFCX 5CYVA 1L0OC 4ZYDA 4OIRF 1OKRA 2M4KA 3VSKA 5LLQA 2HU9A 4M6XA 2XSDC 1FBQA 1FY7A 3CESA 4XRMA 1WJAA 2HYGD 4A3EJ 5ICCA 1P92A 4ZYEA 1ERDA 1CQTA 4FETA 4ZDPA 2QCOA 3VWBA 2X4HA 1XC5A 4BHBA 3AFHA 1R36A 1EKEA 1VQOI 1Z7UA 3IUOA 3FXKA 3RDIA 2P5KA 3FXOA 3W2VA 3D1NI 1WJFA 3O2PE 2K3FA 1E2XA 1OYWA 2JSCA 1R00A 2L7MP 3TW6A 2VQCA 2BY1A 2IPQX 3KETA 2CU7A 2ECBA 3CZ6A 1L3LA 1FYMA 4EJOA 2Z1DA 4CCNA 1QO0D 2WAEA 1LQ1A 2XPUA 2A68F 2I10A 1R5ID 3BT9A 4AIHA 2VBZA 2E5ZA 1QNTA 1X3WB 1XSVA 2RGVA 1ULYA 3MFKA 2QA4I 2IGOA 2EZKA 2HTSA 2FQ3A 2KRFA 3CJRB 2MA3A 1ZREA 4F3QA 2DA6A 4Y52J 3H3UA 2L7FP 1W0UA 4N9IA 1X1DA 3TQNA 3CC7I 1V4RA 4A5MA 1R7JA 1R6RA 3GEZA 3TBIA 2NOJB 1ONVA 4ETSA 1H8AC 3GVAA 1QZYA 3F72A 2FXAA 3JAMK 3OYLA 3S2WA 4MFDA 1HW1A 4A3CJ 4OWRB 3HB9A 5AONA 3HOWJ 1ON1A 1X58A 4O6JA 3M1CA 1PUEE 2K7LA 5DUKA 2Y48A 4BNCA 3CUQA 4AWXB 3SZPA 5H2FC 2N8GA 2FF4A 1W4MA 4WXHA 2X6YA 2VBXA 3IP4B 4Y15A 5FO5A 1B4AA 2CJJA 2QQBA 3LFUA 4IEJA 4C2TA 2WB1N 1HA8A 3LSGA 3EQLF 1Y6IA 4A0XA 2L4AA 4MGRA 2GQQA 2MC4A 1U78A 1J75A 3AG3H 1MJAA 2YU9J 3W2WA 5DEQA 3L1PA 4DYCA 5JR3A 4HA8A 5IP9J 1K4SA 2OQGA 2WADA 1HW2A 2CH0A 4IOAF 2UUZA 1VFCA 4M3GA 4BAYA 3CDIA 1LDDA 1BIAA 3IC7A 1I6XA 4G6DA 3MQ0A 5A2QK 2EBIA 3WG9A 4XNFA 1OCTC 3ZMTA 2Y75A 3D5LA 1Z6RA 5AIQA 5K7HA 2LBFA 3M7GA 4BJ5C 4Y13A 4XSXF 1V5FA 1WJDA 1HDDC 4UB8C 1U3EM 2UV1A 1T2KA 3KP4A 1O3QA 3WTSC 4BE2A 2FOWA 1SFEA 3QPTA 4BDZA 5E17F 5F0CA 4BXXJ 2ADUA 2O03A 4M9SA 2LTPA 1YHQI 3L00A 5BPIA 9ANTA 3HOUJ 2R7OA 4ZTJA 4GRIA 4HBLA 3ZPLA 3HIFA 1EF4A 1USTA 2AQEA 2IXSA 3C2HA 3CUQB 5E18F 4NB5A 4IOCF 4KUMA 2OA4A 4M3BA 4I99C 1I1SA 4I02A 3HUGA 4N0BA 1JTXA 3SDGA 1XB4A 1I27A 1ETQA 3QU6A 5EEAA 3GTOJ 3COAC 2GM4A 3MKLA 1AU7A 1FIPA 3I4NJ 5HODA 2Q2EA 4AIDA 2HS5A 5E1XA 5LRRA 3E1SA 3L7WA 4BJTA 3TGNA 1YW8A 5IP7J 5BMZA 2FSWA 3EYIA 5L3DA 3QYFA 2BEOA 2DXIA 1IN4A 4XOTA 1Z3YA 1FMVA 1Z6TA 4FTHA 4RAZA 2V1NA 5TRDA 2PJRB 3DLLF 3BPXA 5EF6A 1H89C 1W5CC 3I59A 4U88A 3RSNA 3MKYB 3HOSA 4NC8A 4Y17A 1WCMJ 2H09A 2LNBA 2QUFA 2K9QA 1VQ4I 1LJ9A 3SXYA 3D5SC 5JFRA 4A93J 2W48A 2WV0A 1J09A 1X3UA 1U5TA 5GADJ 5HOOA 3HOVJ 3K69A 3KP3A 1GXPA 4YIIA 1RUNA 3HXLA 1YS6A 3K4BA 1OCPA 1MSFC 4CCLA 1VQ5I 1KYZA 1UHWA 3GTQJ 2DA3A 2XDVA 1TWCJ 1S5LC 5J3LA 3GFJA 2HQ5A 3DKXA 4NHJA 1DP7P 3TDZC 4EEFG 2UZKA 2QGUA 2ZXJA 1LE8A 1A6QA 1OLTA 2KRCA 3BR5A 3V8KA 3Q5FA 3HKZA 2KLOA 5KHDA 1BJZA 3BCBA 4Y7NJ 5DUIA 1FWZA 4LIVA 5FD5A 4A3MJ 4LG0B 3QP6A 3LOCA 5IYCJ 3QQAA 5HS9A 2K02A 4OU0A 1T33A 4P9UA 2QSFX 4BS9A 2QM3A 3OL4A 3OYBA 2BV6A 2CQ7A 3GUDA 5IY5H 4JOMA 1GVJA 1TWAJ 1VQ8I 4IHSA 3H5RA 3OYJA 5FRNA 2VE8A 1D0XA 3E5UA 1K78B 3REOA 3KIOA 1M1EB 2DU9A 4EMSA 4Y33A 1YX3A 2K86A 4XLFA 2RQQA 3CCEI 1Y1WJ 4KNYA 2MW8A 2HQAA 1TT5B 4LG0A 1U5TB 2GIZA 3I55I 4U0WA 1HSJA 5FLMJ 3QPLA 4B1RA 2EILH 2DK8A 5D5VB 2E2JJ 1IV6A 2O9LA 5TJJA 4WXDA 4BKXA 1EJ9A 2AXTC 4P9FA 3F9KA 1RUOA 1IN8A 2IW5A 3CC2I 2IGNA 2KL4A 3CDHA 1UG2A 1VNDA 5KNLA 2ZXHA 1SVLA 3I59B 2TDXA 3K4CA 3SDBA 2A3SA 2Z5UA 3HPGA 4PCQA 4PJMA 5HLIA 3ML6A 4W1UA 1T8IA 4AYBA 3WU1B 5DS9A 1CF7A 2YX7A 2GA2A 4C3JJ 3G71I 3LQRA 4N4OB 2XRNA 2E60A 2M30A 3E5QA 1F4KA 1P7JA 1GXQA 3FDYA 1FOYA 1SD6A 2Q2EB 1TWGJ 2FUG2 3BR1A 3ZGKA 5CPRB 3K9TA 4J01A 4AD9A 3KZYA 5HLHA 5KAFC 3FF5A 1ZLKA 3IHUA 3RPQA 2ZJQF 4M71A 4UVCA 1OYIA 1KONA 1IAWA 2IS2A 3AAFA 4A5NA 1D0YA 1EA3A 2VT2A 4E7LA 4BY1J 2M2EA 2H1LA 2LOOA 1D1AA 1WI3A 2BW3B 2ZFWA 3F3XA 4M74A 1YW9A 2EFOA 2KMUA 2R7QA 2ELJA 3LSRA 3K6GA 3I71A 3RCOA 2CGPA 2VB6A 3TOBA 2NYXA 5GTHC 3HUGB 4C2UA 3BC8A 3GTJJ 1R5HA 4C3HJ 1Z7LA 2ACJA 3LSIA 1A31A 1BOBA 4C30A 4AM3A 2F5EA 4G6QA 3BG9A 4IF4A 3B6CA 2XAHA 3K2AA 2DI3A 1ZHFA 4LGWA 1WPKA 3A2KA 1JHFA 3NARA 2NVXJ 1ITYA 1TQIA 3GW2A 5GPAA 4RBOA 3RZDJ 1C0WA 1I1GA 4B8XA 2EA2A 2Z3YA 1ZR4A 2ZMEB 2RREA 4JX5A 4IL6C 1G3WA 1WJ5A 1VF9A 2P8TA 3DTIA 4A69C 2ESNA 1D8KA 2QEXI 4UUTA 2XROA 2OU2A 4PK4A 5DTDA 4RDUA 1POGA 4OOIA 5EEHA 3K1NA 3DU5A 3BTIA 2GXAA 4XIDA 3VFZA 3K7AJ 3J7ZI 3G2BA 1USSA 1BJAA 1YO5C 2VKHA 3ZQQA 3GXOA 2GOMA 1T6SA 1N25A 2CQQA 2CRGA 3KLNA 4B4CA 2CW8A 2LFBA 3KLOA 2L7ZA 3QWLA 3D5RC 3GZ6A 3HOYJ 1ETOA 2DO7A 1QPMA 1ZRFA 3VYUB 3HHGA 1MJ9A 4UY8I 3ZMSA 4BQOA 4FCYA 2COBA 2F5CA 2P5VA 2FNAA 1A36A 2VI6A 4B48A 4AUXA 1U0JA 3WTWC 2LVSA 4BHPA 4GO1A 5LEKA 2R7ZJ 2D1HA 3VYRB 3BG5A 2EZHA 1IN6A 2MD0A 4U0VA 1N75A 2UXNA 2W57A 2ZXIA 1OQYA 1YIOA 2HXOA 3HGYA 2LC2A 4BXUA 4NC7A 2VN2A 3CCMI 4MO7A 2H6BA 2E71A 1WWXA 1LVKA 1MIJA 3C1DA 2ME0A 2L4MA 3AG1H 3CLOA 2FA5A 2FNPA 5DYMA 3ZMVA 4ZDLA 5D5XB 5J8FA 2HPMA 4S05A 5E3LA 1OYYA 1P6RA 2P6TA 3SFZA 4YFKF 3FXLA 4CSWA 1XMKA 4A0ZA 4JX4A 1U8RA 3E6CC 2R0QC 3MZHA 1WH5A 1R5GA 4II3A 3FWEA 2NS0A 2E34A 1QU3A 3ASNH 1KQ9A 2DOFA 2FBHA 3GCMA 4D7MA 2IT0A 1V54H 2VQLA 4QLCU 2HQNA 1W7PA 3DTKA 3MWMA 1XCBA 3SFIA 3MEXA 2EQRA 4AIKA 4A3GJ 2HZDA 1MMSA 3I3LA 4YIRX 3V7RA 4ABZA 2IGKA 1ZGJA 4XM3A 4E7ZA 1SD4A 4M6YA 1RKWA 4TV7A 3CUQC 1K61A 2YS9A 4EJVA 2JQ7A 1DPUA 3SZGA 2L01A 2L2OA 1TNSA 3K4LA 4OIPF 1EH7A 2K9LA 2BVLA 1RNLA 1HBXG 3R6SA 2JT1A 2QWWA 1FMWA 2ZSIB 4ON0A 2F5VA 2EWNA 5KK1A 2FQ4A 1IN7A 1HXDA 2EB7A 1XCVA 2KIQA 3ZQ7A 4EM2A 3LSPA 4C3IJ 4BDYA 2OJED 4DBQA 4FISA 2PMHA 2ZNYA 3L2UA 2NVTJ 1JTYA 3HRMA 5CKTA 4I09A 2GAUA 2WBMA 4I0BA 2R5ZB 3BOQA 3ZP5A 1XMAA 2P5LC 1SC7A 4ZDOA 3PSFA 2HOEA 1G3YA 2Z9OA 2X6WA 3J81Z 1UJ8A 4CCMA 2FX0A 1VQKI 1UELB 3CJTB 4S0HB 4JP0A 1MBFA 4CYCA 4G7OF 3RPUA 3FISA 4DZPA 3BR3A 3MKZA 2IA1A 2BY0A 1Z05A 2VXZA 3JRBA 1JKRC 4XLEA 3KFWX 4B44A 1VQLI 3Q0VA 2OCEA 3LA2A 4I2OA 2EFNA 3OOUA 4RAFA 4KMFA 1IRFA 2E36A 4UUSA 3NWTA 3N97A 3BY6A 2XF6A 2ZFUA 4XN3A 2ZMEC 4XN0A 1B8IB 1ENHA 4G8XA 3E6BA 2KPMA 1PDNC 5L3FA 4A3JJ 2ZKZA 5C4JJ 1QQIA 3ABTA 3QOEA 3DEWA 3WTXC 3W6JB 3C18A 1I3AA 3HOZJ 4O5VA 3W6KB 2Y0MA 5FD6A 1MMDA 2WY8Q 5JVTA 1QVUA 4G94A 1P4WA 4WX9A 3HKZN 3PNYA 2X48A 1NG7A 4L0YB 3CMYA 3Q3SA 4QPQA 2OD5A 2P81A 3CMEI 4YRVA 1X4OA 5E79C 1VQ6I 1ZLJA 1YX5A 3FXRA 2QSHX 3H5NA 3IH4A 3L2VA 1B9MA 1FOXA 5ILUA 5EEGA 2VOPA 3G1LA 1S29A 2BBYA 2KISA 4KN7X 1W36D 2CUFA 2A6HF 2BXZA 2Y9ZA 4HLYA 5ILVA 3EPZA 3MCZA 3K4JA 4HX8A 1RPWA 2DJIA 1O3SA 2V1DA 4XLNF 4KT6A 1X1AA 4XKBA 1Z91A 4KICA 1MH3A 1ZH5A 2DODA 2YPRA 2DW4A 2EV6A 5L3CA 1R1TA 2OV7A 5ICFA 1FSEA 5F6FA 5B1BH 1HDPA 1G6NA 2DQRA 3SHFA 4XQFA 1TTYA 4PFPA 3FBNB 1S3JA 1FLIA 2IVMA 5GAEJ 2FOKA 1UAAA 3RKWA 2M0CA 2XPWA 2HWVA 3I4MJ 4A3BJ 2M8EA 3KP5A 2X1EA 3LSTA 4D7NA 3GZ5A 3IAS2 3QP5A 5M5XJ 3G1OA 4HLXA 1XTAA 4KJZA 2EFWA 4CHUA 5EYRA 1WSUA 3JREA 3H36A 1W5SA 4A3IJ 3EUHC 1ZG1A 2DTRA 2L54A 3GZNB 4BE0A 2CMPA 2A05A 5CQEA 3S93A 4HQEA 2LH9A 1XG1A 2HKOA 2V6CA 3EETA 3BG6A 1IXSB 1FNNA 4MEXF 2HYFA 2KIFA 5DV5A 1MH4A 3F8FA 5LRSA 3TKYA 4YG2F 1MSEC 2RC4A 3F8CA 3S32A 1KYWA 2DMNA 4GFBA 4HX7A 4Q4ZF 1SFXA 2VJIA 4G7HF 2K4BA 3VEPA 2H8WA 2DFIA 1ZN2A 2MG4A 1BW5A 3UNGC 4XR6A 4GYIA 2H1KA 2PQ8A 5K1YA 3Q9VA 5J40A 3H9JA 4ZC3A 5D6EA 2MSYA 4JQFA 5LGTA 3WTTC 4LITA 3RKQA 1ZQ3P 3BJAA 1EH8A 2VPRA 2H8RA 3DU6A 4R79A 3LFKA 5E8IA 4H0EA 5LHHA 2XF5A 1QHHD 1UFMA 1J9IA 3TP0A 3HHHA 5FROA 1AHDP 3UKGA 5F64A 2TRTA 1D1CA 3BCAA 2LYCA 3F8BA 4F55A 1XMXA 5CVUA 4GYGA 4KIBA 4EVIA 1X19A 2PLYA 4B09A 2M3AA 3BQYA 4N4NB 3ECHA 1ZGAA 1SMTA 4OINF 3ZOBA 1TC3C 1BR4A 1Y8QB 1Z0XA 4MFEA 3S1NJ 2IJLA 4I0AA 4PSWA 2JA8J 1U2WA 4ZZLA 2ISYA 4AC0A 1YJ9I 3AG2H 3JRDA 1YRNB 1P9QC 4NQWA 3J7AO 3FK6A 3OYGA 1ZR2A 3GTPJ 4MIMA 2QENA 1E3PA 4RB3C 3D0SA 1NHAA 2DLLA 2KRHA 5IOYA 2X9DA 3BZ6A 1QZEA 2R7WA 3BTCA 2F2EA 1YI2I 2F48A 2IGMA 4IX7A 3PO2J 1XSXA 4HEA2 2GZWA 1IUYA 1XDSA 2QQ9A 4XLPF 4RAYA 3ABMH 3L9FA 2V1XA 3HBLA 2BY3A 2JRMA 3HSFA 3A01B 2X0LA 3BWGA 3DPLC 4M72A 2R7RA 2XKOA 5HNHA 2OZUA 1SANA 2WA0A 4LK0F 3FXJA 1SFKA 4QPOA 1QPIA 1T0FA 4IQJA 2DOEA 2Y0SA 1J5YA 3P5JA 4B3XA 3K1MA 3S3NA 1PUFA 2XB5A 2CW7A 2RQPA 4ZYAA 2IBDA 2DN0A 3BG3A 3RQIA 3EDPA 2ZJPF 3H0GJ 2ID3A 1U6GA 3LL7A 2ZJ2A 3HTUA 3X2QH 3FKIJ 2DFHA 4KDPA 3OYCA 5TISC 5IYDJ 5J1YA 5C44J 1GT0C 3LAJA 3B6AA 2BOLA 3ROUA 4FE7A 4BE1A 3DBLB 4HRIA
chains in the Genus database with same CATH topology
1ZRCA 1F9NA 1MGTA 2COMA 3KP6A 3ECOA 3I0TA 3WGHA 1ON2A 3J80K 3T8RA 3KZZA 2XAQA 5LHIA 2VC0A 2G7UA 3T5XA 4AVPA 1FPQA 2XIGA 3BPVA 1HW5A 4MTEA 4CXFA 2MH9A 1D3YA 4EGYA 1J59A 1Z1DA 4MEYF 5K5QA 4HF0A 2ZMEA 2BE5F 2HKXA 1ZRDA 2CG4A 4ENNA 5FFXA 3FXQA 2IRFG 1FX7A 3QRFF 1DDNA 4HQMA 1ZYRF 3DXJF 4UVAA 4BH9A 1U5TC 5HLGA 4WWCA 4ESFA 1IXRC 4EJWA 1JHHA 4EM1A 1TNTA 5HDKA 5D8KB 1O7LA 3H92A 3KP2A 1P4AA 1AOYA 1ZG5A 1MD0A 4BQAA 1MKMA 3R4KA 4OIOF 2V1UA 3KEQA 3ZN1A 1KU2A 4IPAA 1TW2A 2ELHA 3BROA 3L2CA 2GWRA 2FRHA 4P55A 1YLFA 2J5OA 1XGOA 5A2QZ 2PMUA 2ISZA 2QZ8A 4JBAA 1T38A 2Z33A 1FSHA 2Z99A 2HTJA 3B02A 4MNUA 1IZ1A 3V7SA 2STWA 1WRJA 4ENJA 4L9JA 3E97A 4HDVA 3IWZA 4UVBA 3TDUC 1BI3A 2QBYB 1TW3A 3U1DA 4LD5A 2HZTA 5LEJA 4IXAA 4IHTA 4ENMA 5CLSA 1XGNA 2DT5A 1D8JA 5L3GA 2HEOA 4WCGA 2VOOA 3WTZA 5H6QA 3RYPA 3M8EA 4R8HA 2XAGA 4P5OA 3P9KA 1B6AA 2DK5A 4RB0A 2ZBKA 5F1RA 1W7PB 5JI6A 3V7CA 4MHGA 2RV8A 5CVRA 1REPC 1JXSA 2XKPA 2OAZA 2G9WA 2KJCA 1WI9A 4HOBA 4LFUA 4Q48A 3RKXA 3O6BB 4A0YA 2VONA 4M9XA 3F6OA 2JZYA 4LLLA 3T8TA 2O0YA 3MAJA 3C3WA 4CZZA 4I7HA 1RIOH 5CVJA 5ERIA 5DDGA 5K5RA 2W24A 3JTGA 4GXOA 4A2UA 1KQ8A 1W7PD 3O3KA 2LDUA 1R58A 4MTDA 3HOTA 3CJNA 4M9ZA 2LSOA 3R0AA 4Q47A 2MLKA 2YR2A 2KIUA 4L9VA 2NNYA 2F5DA 1T39A 4ESBA 2J5PA 4WXCA 1FBSA 4ZYGA 2L02A 4LK1F 1HQCA 3HSEA 4HV6A 1GHCA 2EV0A 4L9NA 1XSDA 1YS7A 2R7FA 5DCMB 4HF2A 3JTHA 4UV9A 2RKHA 2RVCA 2OBPA 3IRQA 5DD8A 4D0PA 4ZH4F 3R61A 2FEZA 4RS8A 3F21A 1ZARA 1ODDA 5IT9K 3TO7A 2E1NA 2VBWA 4OIQF 3TO6A 5E20A 5JHUA 3T0YA 4YFNF 2JRTA 1STZA 2PFBA 1XGSA 3FMQA 5J8CA 4UNOA 1YFHA 2XAFA 4L5JA 5LHGA 3I4PA 2IA2A 4MQVA 2FMYA 4N9HA 4QWQA 3LWFA 1O3TA 4E70A 3BP8A 4MQ9F 5ILSA 3HRTA 5IT9Z 2D45A 4KMUX 3RYRA 2YU3A 3ERED 2YSRA 2KJBA 3SZTA 2PI0A 3HSRA 4FT8A 1JE8A 1IXCA 2H27A 2R3SA 3NRVA 1TLHB 4ENKA 2LF8A 2VT3A 3JW4A 2F5FA 1P2FA 3R0JA 1O3RA 2LF7A 3WTVC 3Q9SA 1OR7A 1O57A 1R22A 3E3VA 3TOAA 4YFXF 3U2RA 5LBQA 4EJTA 3K0LA 3DFGA 2PG4A 1T98A 2Q8KA 3CUOA 2DAOA 3QOPA 2EV5A 2JTVA 1KGSA 4L9TA 2MLGA 3V8JA 5KVRA 4ZYHA 2L3DA 1IF1A 4KYWA 5DCFA 2P7CB 4RGRA 3CO7C 3H3ZA 2RDPA 1S8NA 1G4DA 3RKYA 2D1VA 3DPTA 1S6LA 2EJRA 2UXXA 2MD5A 1FC3A 3V8LA 1B1BA 3TO9A 1S7OA 4CGZA 3ABUA 2A69F 1UHMA 4KIFA 2P4WA 2FBKA 2RNJA 1BIBA 1LB2A 1FP1D 3T1BA 4G7ZF 4KN4X 3ISPA 2V9VA 5L3BA 5D4RA 2HFHA 1OPCA 3ELKA 3G3ZA 1DPRA 1W5TA 3B73A 4UV8A 1LNWA 2K27A 4JK1X 3GFMA 3CTAA 1VTNC 1R23A 2O8XA 4LLNA 1KU7A 4RB2C 1YTYA 2ZCWA 1LDJA 2BYVE 1SMYF 4RGUA 2OQRA 5HDGA 4S04A 2DPUA 2STTA 2ZNZA 1QGPA 2PEXA 3WE2A 4RGXA 1IRGA 2ZO4A 4RGSA 2WC2A 5ICGA 1F5TA 3FM3A 1G3TA 3QAHA 2KIMA 1P4XA 4BYYA 2JPCA 2CQKA 3IKVA 1CGPA 2YX4A 2PN6A 4ASNA 1YW7A 4LB6B 4GCVA 1HKSA 5BOXA 5D5WB 3DQVC 2EK5A 3GF2A 4HW0A 1JGSA 2QYOA 2Q0OA 3J80Z 2BGCA 2M87A 4PGGA 2XVCA 3K1PA 4HDUA 5D5UB 1S7AA 3DP7A 3FMSA 4K2EA 3NEUA 2VE9A 2M45A 1SAXA 3KCCA 3FMRA 2FBIA 5HS8A 2GXGA 1FYKA 2VBYA 2R7DA 5D8LB 4A6EA 1RZ4A 4IRIA 4L5IA 1SFUA 1K6OA 2O61A 2H6CA 1LEAA 3FM5A 3P9CA 5E1ZB 2GIVA 2CSOA 3WGGA 3IKTA 4I01A 3OV8A 1BC7C 2MH2A 4PDKA 2E7XA 2ETHA 5H20A 3RI4A 2NNNA 2AXLA 1WQ2A 2ESHA 2FU4A 1IW7F 1FP2A 1BOAA 2G7HA 1WKMA 3FX3A 3QPHA 1KU3A 3EYYA 1BN5A 2A07F 1Z9CA 5J6XA 3I5UA 4KFCA 5CVVA 3MZYA 4PGHA 2NRAC 1HKQA 3L09A 1KA8A 4A6DA 2XGXA 4R1HA 2IP2A 2QBYA 2M1BA 1J2XA 1PP8F 2UWMA 3VB2A 3VODA 4IRHA 4EM0B 1E17A 5HDNA 4EJUA 3VOEA 4HYEA 1BC8C 1KU9A 3DF8A 4EV0A 2MBFA 3RTRA 3JSPA 4LMYA 1J7KA 4CICA 2QVOA 1XGMA 5BPDA 2CYYA 4RB1A 3LA7A 4CDGA 1O7FA 3KP7A 3HYIA 4HF1A 5ED4A 1MZBA 1MDMB 3N4MA 1Q1HA 2MC3A 1V3FA 3DV8A 4XBFA 2CWEA 5E8GA 4IJAA 1XD7A 4O3MA 1TQPA 2AS5F 5H6RA 2WTEA 4FHTA 4HZFA 5DCMA 4DNCA 4F7ZA 3I54A 2PBIA 4BHCA 5FB2A 4OMZA 6PAXA 3GYHX 3BJ6A 3KEOA 5ICEA 1KQ0A 4CO8A 4KA4A 4LJZF 2B0LA 4L18B 1LDKB 3IWFA 3HTSB 1BI0A 1ZAOA 3M1EA 3F8NA 4FX0A 4UHTA 3G73A 3HRSA 1YG2A 1D5VA 3WODF 2C6YA 2K4JA 3I64A 4P96A 2P6SA 2GA1A 3PQKA 3GFLA 2XASA 3IRRA 5FLXZ 4IVNA 1MDMA 1K79A 4YIFA 1B59A 1R1UA 1SD7A 3PFIA 2O6GE 4U0YA 2W84A 2A5YB 1ZG3A 5K5OA 1F1ZA 2EA4A 5LGUA 1LVAA 4L0ZB 2QLZA 2DQLA 2FE3A 3M8FA 1R1VA 5FLXK 3LQQA 3E5XA 1A04A 4KIGA 3BJOA 3RJPA 3J81K 5FFZA 3P7NA 2M5WA 4M73A 4Z2YA 1EH6A 3LA3A 3U9GA 1G3SA 2OZ6A 1BI2A 3GLXA 1SD5A 1BBYA 1TBXA 4HV5A 4AIJA 4FX4A 2HGCA 2D2WA 3GO5A 1K7AA 1H9GA 1H0MA 1FOKA 5HVQC 2JPBA 2W85A 3BDDA 1YQAA 3ZMZA 1PP7U 4EGZA 3F6VA 2RN7A 3GFIA 1RI7A 4LLGF 1DUXC 3ULQB 1B9NA 2EFQA 1EV7A 4IRGA 1J0RA 4XSZF 1QZZA 4A12A 5CJ9A 2E1CA 3I58A 2XHKA 4ZZDA 3F8MA 5LGNA 3C7JA 4U7BA 2HDCA 3WE3A 2WWYA 3DEUA 4WF2A 3F23A 3ZN0A 2V79A 3F22A 1LEBA 1OMIA 3WGIA 2KKOA 3K2ZA 2LKPA 4OMYA 3FXUA 2EFPA 1FT9A 3SQNA 2CFXA 1BI1A 2W25A 3P9IA 2H94A 3PQJA 3V4GA 4GGGA 2HQRA 4DQ2A 3JSOA 2XAJA 3EUHA 4I98B 3R60A 1FBUA 2PJPA 2O3FA 1Y0UA 2IA0A 2VODA 4LB5A 3IL2A 2P7VB 3M9AA 1YYVA 5DD4A 1FYLA 1XN7A 3WU0A 2QQAA 1HKTA 1UB9A 3JAMZ 2CW0F 2XV4S 3HRUA 5AIPA 5L3EA 4CYDA 3E6MA 3FHZA 2HR3A 4PZJA 3CO6C 4U7DA 1XDUA 3WTYC 3GWZA 1BM9A 2NAZA 4UUVA 3ZMUA 4ESJA 2CO5A 1FZPB 3DKWA 3ZMDA 3LAPA 5FGMA 2GXBA 1HSTA 2FMLA 4XRFA 5HS7A 3FZVA 2DBBA 3I53A 4UXNA 3QU3A 4KT5C 1CF7B 1UCRA 5BQTA 3NQOA 1QBJA 2A61A 4WK8F 4HX4A 3OOPA 4G9YA 3RIRA 5E1WA 1TQMA 2VC1A 5D6FA 3GX4X 5CVIA 2E7WA 2DPDA 3E6DA 1H9TA 5BS6A 5IT3A 4EQQA 1K78A 1AWCA 1IN5A 4Q5SF 2XUBA 5D4SA 2A6EF 3KE2A 3WTUC 1MJBA 4HAMA 1I5ZA 4ZYDA 5CYVA 1L0OC 4OIRF 1OKRA 5LLQA 4M6XA 1FBQA 1FY7A 2HYGD 5ICCA 1P92A 4ZYEA 2X4HA 4BHBA 1R36A 1Z7UA 3RDIA 2P5KA 3O2PE 1E2XA 1OYWA 2JSCA 1R00A 3KETA 2IPQX 1L3LA 1FYMA 4EJOA 1QO0D 1LQ1A 2A68F 4AIHA 2VBZA 1QNTA 1XSVA 2RGVA 1ULYA 3MFKA 2HTSA 2FQ3A 2KRFA 2MA3A 1ZREA 3H3UA 4N9IA 3TQNA 1V4RA 4A5MA 1R7JA 3GEZA 1ONVA 4ETSA 3GVAA 1QZYA 3F72A 2FXAA 3JAMK 3S2WA 1HW1A 5AONA 1ON1A 4O6JA 1PUEE 2K7LA 5DUKA 2Y48A 4BNCA 3CUQA 4AWXB 3SZPA 2FF4A 1W4MA 4WXHA 2VBXA 4Y15A 5FO5A 1B4AA 2QQBA 3EQLF 4A0XA 2L4AA 4MGRA 2GQQA 1U78A 1J75A 1MJAA 5DEQA 5JR3A 4HA8A 2OQGA 1HW2A 4BAYA 1LDDA 1BIAA 3IC7A 1I6XA 4G6DA 3MQ0A 5A2QK 3WG9A 3ZMTA 2Y75A 3D5LA 1Z6RA 5AIQA 3M7GA 4Y13A 4XSXF 1U3EM 1T2KA 3KP4A 1O3QA 3WTSC 5E17F 1SFEA 3QPTA 2ADUA 2O03A 4M9SA 3L00A 5BPIA 3ZPLA 4HBLA 3HIFA 1USTA 3CUQB 5E18F 4NB5A 4KUMA 2OA4A 1I1SA 4I02A 3HUGA 4N0BA 1XB4A 1I27A 3QU6A 3COAC 2Q2EA 2HS5A 5E1XA 5LRRA 3L7WA 3TGNA 1YW8A 5BMZA 2FSWA 3EYIA 5L3DA 2BEOA 1IN4A 1Z6TA 4RAZA 5TRDA 3BPXA 3I59A 4U88A 3HOSA 4Y17A 2H09A 2LNBA 2QUFA 1LJ9A 3SXYA 5JFRA 2WV0A 1X3UA 1U5TA 5HOOA 3K69A 3KP3A 1GXPA 4YIIA 1RUNA 1YS6A 1KYZA 1UHWA 3GFJA 4NHJA 1DP7P 3TDZC 2UZKA 2ZXJA 3V8KA 3Q5FA 5DUIA 1FWZA 4LG0B 5FD5A 3QP6A 5HS9A 2K02A 4OU0A 4P9UA 2QM3A 2BV6A 3GUDA 1GVJA 4IHSA 2VE8A 3E5UA 1K78B 3REOA 2DU9A 4EMSA 2K86A 4KNYA 4LG0A 1U5TB 4U0WA 1HSJA 2DK8A 5D5VB 5TJJA 4WXDA 4P9FA 1RUOA 1IN8A 2IW5A 3CDHA 3I59B 2TDXA 2A3SA 2Z5UA 4PCQA 5HLIA 3ML6A 3WU1B 1CF7A 2YX7A 2GA2A 3LQRA 2XRNA 2M30A 3E5QA 1F4KA 1GXQA 1SD6A 3K9TA 4AD9A 3KZYA 5HLHA 3FF5A 1ZLKA 3IHUA 3RPQA 4M71A 4UVCA 1OYIA 1IAWA 3AAFA 4A5NA 2VT2A 4M74A 2ZFWA 3F3XA 1YW9A 2EFOA 2CGPA 3I71A 3TOBA 2NYXA 1R5HA 2ACJA 2F5EA 4G6QA 4IF4A 2XAHA 2DI3A 1ZHFA 4LGWA 1JHFA 1TQIA 3GW2A 1C0WA 1I1GA 4B8XA 2EA2A 2Z3YA 2ZMEB 1G3WA 2P8TA 2ESNA 1D8KA 2XROA 2OU2A 4OOIA 5EEHA 3K1NA 3VFZA 1USSA 1BJAA 1YO5C 3GXOA 1T6SA 3KLNA 3KLOA 3GZ6A 2DO7A 1ZRFA 1QPMA 3HHGA 1MJ9A 3ZMSA 2F5CA 2P5VA 2FNAA 3WTWC 4BHPA 4GO1A 5LEKA 2D1HA 4U0VA 1IN6A 2UXNA 2W57A 1YIOA 4BXUA 2VN2A 2H6BA 1WWXA 3C1DA 2L4MA 3CLOA 2FA5A 2FNPA 5DYMA 3ZMVA 5D5XB 5J8FA 4S05A 1OYYA 1P6RA 2P6TA 3SFZA 4YFKF 1XMKA 4A0ZA 1U8RA 3E6CC 3MZHA 1R5GA 3FWEA 2NS0A 1KQ9A 2FBHA 2IT0A 4QLCU 2HQNA 1W7PA 3MWMA 1XCBA 3MEXA 4AIKA 3V7RA 1ZGJA 1SD4A 4M6YA 4TV7A 3CUQC 4EJVA 1DPUA 2L01A 1TNSA 4OIPF 1EH7A 1RNLA 1HBXG 3R6SA 2JT1A 2QWWA 4ON0A 2EWNA 5KK1A 1IN7A 2EB7A 1HXDA 1XCVA 3ZQ7A 4EM2A 2PMHA 2ZNYA 3HRMA 4I09A 2GAUA 4I0BA 3BOQA 3ZP5A 1XMAA 2P5LC 2HOEA 1G3YA 2Z9OA 3J81Z 4G7OF 3RPUA 2IA1A 1Z05A 2VXZA 3KFWX 3LA2A 4I2OA 2EFNA 4KMFA 1IRFA 3N97A 3BY6A 4G8XA 3E6BA 1PDNC 5L3FA 2ZKZA 1QQIA 3ABTA 3WTXC 3W6JB 3C18A 4O5VA 3W6KB 2Y0MA 5FD6A 5JVTA 4G94A 1P4WA 4WX9A 4L0YB 2OD5A 1ZLJA 3FXRA 1B9MA 5ILUA 5EEGA 2VOPA 1S29A 2BBYA 4KN7X 2A6HF 4HLYA 5ILVA 3MCZA 4HX8A 1O3SA 2V1DA 4XLNF 1Z91A 4KICA 1ZH5A 2YPRA 2DW4A 2EV6A 5L3CA 1R1TA 5ICFA 1FSEA 5F6FA 1G6NA 2DQRA 3SHFA 1TTYA 1S3JA 1FLIA 2IVMA 2FOKA 3RKWA 2HWVA 2M8EA 3KP5A 3LSTA 3GZ5A 3QP5A 4HLXA 2EFWA 4CHUA 1WSUA 1W5SA 1ZG1A 2DTRA 2L54A 4HQEA 2HKOA 2V6CA 3EETA 1IXSB 1FNNA 4MEXF 2HYFA 2KIFA 5DV5A 3F8FA 5LRSA 3TKYA 4YG2F 2RC4A 3F8CA 1KYWA 4HX7A 4Q4ZF 1SFXA 4G7HF 2K4BA 3VEPA 2DFIA 1ZN2A 4GYIA 2PQ8A 5K1YA 3Q9VA 5D6EA 4JQFA 5LGTA 3WTTC 3BJAA 1EH8A 4R79A 3LFKA 5E8IA 4H0EA 5LHHA 1UFMA 1J9IA 3HHHA 5F64A 3F8BA 5CVUA 4GYGA 4KIBA 4EVIA 2PLYA 4B09A 3ECHA 1ZGAA 1SMTA 4OINF 2IJLA 4I0AA 1U2WA 4ZZLA 2ISYA 4NQWA 3J7AO 2QENA 4RB3C 3D0SA 1NHAA 2DLLA 3BZ6A 2F2EA 1XSXA 2GZWA 1IUYA 1XDSA 2QQ9A 4XLPF 4RAYA 3L9FA 2V1XA 3HSFA 2X0LA 3BWGA 3DPLC 4M72A 2XKOA 2OZUA 4LK0F 1T0FA 1J5YA 3K1MA 2RQPA 3EDPA 1U6GA 2ZJ2A 3HTUA 4KDPA 3LAJA 3ROUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZRC A;  1F9N A;  1MGT A;  2COM A;  3KP6 A;  3ECO A;  3I0T A;  3WGH A;  1ON2 A;  3J80 K;  3T8R A;  3KZZ A;  2XAQ A;  5LHI A;  2VC0 A;  2G7U A;  3T5X A;  4AVP A;  1FPQ A;  2XIG A;  3BPV A;  1HW5 A;  4MTE A;  4CXF A;  2MH9 A;  1D3Y A;  4EGY A;  1J59 A;  1Z1D A;  4MEY F;  5K5Q A;  4HF0 A;  2ZME A;  2BE5 F;  2HKX A;  1ZRD A;  2CG4 A;  4ENN A;  5FFX A;  3FXQ A;  2IRF G;  1FX7 A;  3QRF F;  1DDN A;  4HQM A;  1ZYR F;  3DXJ F;  4UVA A;  4BH9 A;  1U5T C;  5HLG A;  4WWC A;  4ESF A;  1IXR C;  4EJW A;  1JHH A;  4EM1 A;  1TNT A;  5HDK A;  5D8K B;  1O7L A;  3H92 A;  3KP2 A;  1P4A A;  1AOY A;  1ZG5 A;  1MD0 A;  4BQA A;  1MKM A;  3R4K A;  4OIO F;  2V1U A;  3KEQ A;  3ZN1 A;  1KU2 A;  4IPA A;  1TW2 A;  2ELH A;  3BRO A;  3L2C A;  2GWR A;  2FRH A;  4P55 A;  1YLF A;  2J5O A;  1XGO A;  5A2Q Z;  2PMU A;  2ISZ A;  2QZ8 A;  4JBA A;  1T38 A;  2Z33 A;  1FSH A;  2Z99 A;  2HTJ A;  3B02 A;  4MNU A;  1IZ1 A;  3V7S A;  2STW A;  1WRJ A;  4ENJ A;  4L9J A;  3E97 A;  4HDV A;  3IWZ A;  4UVB A;  3TDU C;  1BI3 A;  2QBY B;  1TW3 A;  3U1D A;  4LD5 A;  2HZT A;  5LEJ A;  4IXA A;  4IHT A;  4ENM A;  5CLS A;  1XGN A;  2DT5 A;  1D8J A;  5L3G A;  2HEO A;  4WCG A;  2VOO A;  3WTZ A;  5H6Q A;  3RYP A;  3M8E A;  4R8H A;  2XAG A;  4P5O A;  3P9K A;  1B6A A;  2DK5 A;  4RB0 A;  2ZBK A;  5F1R A;  1W7P B;  5JI6 A;  3V7C A;  4MHG A;  2RV8 A;  5CVR A;  1REP C;  1JXS A;  2XKP A;  2OAZ A;  2G9W A;  2KJC A;  1WI9 A;  4HOB A;  4LFU A;  4Q48 A;  3RKX A;  3O6B B;  4A0Y A;  2VON A;  4M9X A;  3F6O A;  2JZY A;  4LLL A;  3T8T A;  2O0Y A;  3MAJ A;  3C3W A;  4CZZ A;  4I7H A;  1RIO H;  5CVJ A;  5ERI A;  5DDG A;  5K5R A;  2W24 A;  3JTG A;  4GXO A;  4A2U A;  1KQ8 A;  1W7P D;  3O3K A;  2LDU A;  1R58 A;  4MTD A;  3HOT A;  3CJN A;  4M9Z A;  2LSO A;  3R0A A;  4Q47 A;  2MLK A;  2YR2 A;  2KIU A;  4L9V A;  2NNY A;  2F5D A;  1T39 A;  4ESB A;  2J5P A;  4WXC A;  1FBS A;  4ZYG A;  2L02 A;  4LK1 F;  1HQC A;  3HSE A;  4HV6 A;  1GHC A;  2EV0 A;  4L9N A;  1XSD A;  1YS7 A;  2R7F A;  5DCM B;  4HF2 A;  3JTH A;  4UV9 A;  2RKH A;  2RVC A;  2OBP A;  3IRQ A;  5DD8 A;  4D0P A;  4ZH4 F;  3R61 A;  2FEZ A;  4RS8 A;  3F21 A;  1ZAR A;  1ODD A;  5IT9 K;  3TO7 A;  2E1N A;  2VBW A;  4OIQ F;  3TO6 A;  5E20 A;  5JHU A;  3T0Y A;  4YFN F;  2JRT A;  1STZ A;  2PFB A;  1XGS A;  3FMQ A;  5J8C A;  4UNO A;  1YFH A;  2XAF A;  4L5J A;  5LHG A;  3I4P A;  2IA2 A;  4MQV A;  2FMY A;  4N9H A;  4QWQ A;  3LWF A;  1O3T A;  4E70 A;  3BP8 A;  4MQ9 F;  5ILS A;  3HRT A;  5IT9 Z;  2D45 A;  4KMU X;  3RYR A;  2YU3 A;  3ERE D;  2YSR A;  2KJB A;  3SZT A;  2PI0 A;  3HSR A;  4FT8 A;  1JE8 A;  1IXC A;  2H27 A;  2R3S A;  3NRV A;  1TLH B;  4ENK A;  2LF8 A;  2VT3 A;  3JW4 A;  2F5F A;  1P2F A;  3R0J A;  1O3R A;  2LF7 A;  3WTV C;  3Q9S A;  1OR7 A;  1O57 A;  1R22 A;  3E3V A;  3TOA A;  4YFX F;  3U2R A;  5LBQ A;  4EJT A;  3K0L A;  3DFG A;  2PG4 A;  1T98 A;  2Q8K A;  3CUO A;  2DAO A;  3QOP A;  2EV5 A;  2JTV A;  1KGS A;  4L9T A;  2MLG A;  3V8J A;  5KVR A;  4ZYH A;  2L3D A;  1IF1 A;  4KYW A;  5DCF A;  2P7C B;  4RGR A;  3CO7 C;  3H3Z A;  2RDP A;  1S8N A;  1G4D A;  3RKY A;  2D1V A;  3DPT A;  1S6L A;  2EJR A;  2UXX A;  2MD5 A;  1FC3 A;  3V8L A;  1B1B A;  3TO9 A;  1S7O A;  4CGZ A;  3ABU A;  2A69 F;  1UHM A;  4KIF A;  2P4W A;  2FBK A;  2RNJ A;  1BIB A;  1LB2 A;  1FP1 D;  3T1B A;  4G7Z F;  4KN4 X;  3ISP A;  2V9V A;  5L3B A;  5D4R A;  2HFH A;  1OPC A;  3ELK A;  3G3Z A;  1DPR A;  1W5T A;  3B73 A;  4UV8 A;  1LNW A;  2K27 A;  4JK1 X;  3GFM A;  3CTA A;  1VTN C;  1R23 A;  2O8X A;  4LLN A;  1KU7 A;  4RB2 C;  1YTY A;  2ZCW A;  1LDJ A;  2BYV E;  1SMY F;  4RGU A;  2OQR A;  5HDG A;  4S04 A;  2DPU A;  2STT A;  2ZNZ A;  1QGP A;  2PEX A;  3WE2 A;  4RGX A;  1IRG A;  2ZO4 A;  4RGS A;  2WC2 A;  5ICG A;  1F5T A;  3FM3 A;  1G3T A;  3QAH A;  2KIM A;  1P4X A;  4BYY A;  2JPC A;  2CQK A;  3IKV A;  1CGP A;  2YX4 A;  2PN6 A;  4ASN A;  1YW7 A;  4LB6 B;  4GCV A;  1HKS A;  5BOX A;  5D5W B;  3DQV C;  2EK5 A;  3GF2 A;  4HW0 A;  1JGS A;  2QYO A;  2Q0O A;  3J80 Z;  2BGC A;  2M87 A;  4PGG A;  2XVC A;  3K1P A;  4HDU A;  5D5U B;  1S7A A;  3DP7 A;  3FMS A;  4K2E A;  3NEU A;  2VE9 A;  2M45 A;  1SAX A;  3KCC A;  3FMR A;  2FBI A;  5HS8 A;  2GXG A;  1FYK A;  2VBY A;  2R7D A;  5D8L B;  4A6E A;  1RZ4 A;  4IRI A;  4L5I A;  1SFU A;  1K6O A;  2O61 A;  2H6C A;  1LEA A;  3FM5 A;  3P9C A;  5E1Z B;  2GIV A;  2CSO A;  3WGG A;  3IKT A;  4I01 A;  3OV8 A;  1BC7 C;  2MH2 A;  4PDK A;  2E7X A;  2ETH A;  5H20 A;  3RI4 A;  2NNN A;  2AXL A;  1WQ2 A;  2ESH A;  2FU4 A;  1IW7 F;  1FP2 A;  1BOA A;  2G7H A;  1WKM A;  3FX3 A;  3QPH A;  1KU3 A;  3EYY A;  1BN5 A;  2A07 F;  1Z9C A;  5J6X A;  3I5U A;  4KFC A;  5CVV A;  3MZY A;  4PGH A;  2NRA C;  1HKQ A;  3L09 A;  1KA8 A;  4A6D A;  2XGX A;  4R1H A;  2IP2 A;  2QBY A;  2M1B A;  1J2X A;  1PP8 F;  2UWM A;  3VB2 A;  3VOD A;  4IRH A;  4EM0 B;  1E17 A;  5HDN A;  4EJU A;  3VOE A;  4HYE A;  1BC8 C;  1KU9 A;  3DF8 A;  4EV0 A;  2MBF A;  3RTR A;  3JSP A;  4LMY A;  1J7K A;  4CIC A;  2QVO A;  1XGM A;  5BPD A;  2CYY A;  4RB1 A;  3LA7 A;  4CDG A;  1O7F A;  3KP7 A;  3HYI A;  4HF1 A;  5ED4 A;  1MZB A;  1MDM B;  3N4M A;  1Q1H A;  2MC3 A;  1V3F A;  3DV8 A;  4XBF A;  2CWE A;  5E8G A;  4IJA A;  1XD7 A;  4O3M A;  1TQP A;  2AS5 F;  5H6R A;  2WTE A;  4FHT A;  4HZF A;  5DCM A;  4DNC A;  4F7Z A;  3I54 A;  2PBI A;  4BHC A;  5FB2 A;  4OMZ A;  6PAX A;  3GYH X;  3BJ6 A;  3KEO A;  5ICE A;  1KQ0 A;  4CO8 A;  4KA4 A;  4LJZ F;  2B0L A;  4L18 B;  1LDK B;  3IWF A;  3HTS B;  1BI0 A;  1ZAO A;  3M1E A;  3F8N A;  4FX0 A;  4UHT A;  3G73 A;  3HRS A;  1YG2 A;  1D5V A;  3WOD F;  2C6Y A;  2K4J A;  3I64 A;  4P96 A;  2P6S A;  2GA1 A;  3PQK A;  3GFL A;  2XAS A;  3IRR A;  5FLX Z;  4IVN A;  1MDM A;  1K79 A;  4YIF A;  1B59 A;  1R1U A;  1SD7 A;  3PFI A;  2O6G E;  4U0Y A;  2W84 A;  2A5Y B;  1ZG3 A;  5K5O A;  1F1Z A;  2EA4 A;  5LGU A;  1LVA A;  4L0Z B;  2QLZ A;  2DQL A;  2FE3 A;  3M8F A;  1R1V A;  5FLX K;  3LQQ A;  3E5X A;  1A04 A;  4KIG A;  3BJO A;  3RJP A;  3J81 K;  5FFZ A;  3P7N A;  2M5W A;  4M73 A;  4Z2Y A;  1EH6 A;  3LA3 A;  3U9G A;  1G3S A;  2OZ6 A;  1BI2 A;  3GLX A;  1SD5 A;  1BBY A;  1TBX A;  4HV5 A;  4AIJ A;  4FX4 A;  2HGC A;  2D2W A;  3GO5 A;  1K7A A;  1H9G A;  1H0M A;  1FOK A;  5HVQ C;  2JPB A;  2W85 A;  3BDD A;  1YQA A;  3ZMZ A;  1PP7 U;  4EGZ A;  3F6V A;  2RN7 A;  3GFI A;  1RI7 A;  4LLG F;  1DUX C;  3ULQ B;  1B9N A;  2EFQ A;  1EV7 A;  4IRG A;  1J0R A;  4XSZ F;  1QZZ A;  4A12 A;  5CJ9 A;  2E1C A;  3I58 A;  2XHK A;  4ZZD A;  3F8M A;  5LGN A;  3C7J A;  4U7B A;  2HDC A;  3WE3 A;  2WWY A;  3DEU A;  4WF2 A;  3F23 A;  3ZN0 A;  2V79 A;  3F22 A;  1LEB A;  1OMI A;  3WGI A;  2KKO A;  3K2Z A;  2LKP A;  4OMY A;  3FXU A;  2EFP A;  1FT9 A;  3SQN A;  2CFX A;  1BI1 A;  2W25 A;  3P9I A;  2H94 A;  3PQJ A;  3V4G A;  4GGG A;  2HQR A;  4DQ2 A;  3JSO A;  2XAJ A;  3EUH A;  4I98 B;  3R60 A;  1FBU A;  2PJP A;  2O3F A;  1Y0U A;  2IA0 A;  2VOD A;  4LB5 A;  3IL2 A;  2P7V B;  3M9A A;  1YYV A;  5DD4 A;  1FYL A;  1XN7 A;  3WU0 A;  2QQA A;  1HKT A;  1UB9 A;  3JAM Z;  2CW0 F;  2XV4 S;  3HRU A;  5AIP A;  5L3E A;  4CYD A;  3E6M A;  3FHZ A;  2HR3 A;  4PZJ A;  3CO6 C;  4U7D A;  1XDU A;  3WTY C;  3GWZ A;  1BM9 A;  2NAZ A;  4UUV A;  3ZMU A;  4ESJ A;  2CO5 A;  1FZP B;  3DKW A;  3ZMD A;  3LAP A;  5FGM A;  2GXB A;  1HST A;  2FML A;  4XRF A;  5HS7 A;  3FZV A;  2DBB A;  3I53 A;  4UXN A;  3QU3 A;  4KT5 C;  1CF7 B;  1UCR A;  5BQT A;  3NQO A;  1QBJ A;  2A61 A;  4WK8 F;  4HX4 A;  3OOP A;  4G9Y A;  3RIR A;  5E1W A;  1TQM A;  2VC1 A;  5D6F A;  3GX4 X;  5CVI A;  2E7W A;  2DPD A;  3E6D A;  1H9T A;  5BS6 A;  5IT3 A;  4EQQ A;  1K78 A;  1AWC A;  1IN5 A;  4Q5S F;  2XUB A;  5D4S A;  2A6E F;  3KE2 A;  3WTU C;  1MJB A;  4HAM A;  1I5Z A;  4ZYD A;  5CYV A;  1L0O C;  4OIR F;  1OKR A;  5LLQ A;  4M6X A;  1FBQ A;  1FY7 A;  2HYG D;  5ICC A;  1P92 A;  4ZYE A;  2X4H A;  4BHB A;  1R36 A;  1Z7U A;  3RDI A;  2P5K A;  3O2P E;  1E2X A;  1OYW A;  2JSC A;  1R00 A;  3KET A;  2IPQ X;  1L3L A;  1FYM A;  4EJO A;  1QO0 D;  1LQ1 A;  2A68 F;  4AIH A;  2VBZ A;  1QNT A;  1XSV A;  2RGV A;  1ULY A;  3MFK A;  2HTS A;  2FQ3 A;  2KRF A;  2MA3 A;  1ZRE A;  3H3U A;  4N9I A;  3TQN A;  1V4R A;  4A5M A;  1R7J A;  3GEZ A;  1ONV A;  4ETS A;  3GVA A;  1QZY A;  3F72 A;  2FXA A;  3JAM K;  3S2W A;  1HW1 A;  5AON A;  1ON1 A;  4O6J A;  1PUE E;  2K7L A;  5DUK A;  2Y48 A;  4BNC A;  3CUQ A;  4AWX B;  3SZP A;  2FF4 A;  1W4M A;  4WXH A;  2VBX A;  4Y15 A;  5FO5 A;  1B4A A;  2QQB A;  3EQL F;  4A0X A;  2L4A A;  4MGR A;  2GQQ A;  1U78 A;  1J75 A;  1MJA A;  5DEQ A;  5JR3 A;  4HA8 A;  2OQG A;  1HW2 A;  4BAY A;  1LDD A;  1BIA A;  3IC7 A;  1I6X A;  4G6D A;  3MQ0 A;  5A2Q K;  3WG9 A;  3ZMT A;  2Y75 A;  3D5L A;  1Z6R A;  5AIQ A;  3M7G A;  4Y13 A;  4XSX F;  1U3E M;  1T2K A;  3KP4 A;  1O3Q A;  3WTS C;  5E17 F;  1SFE A;  3QPT A;  2ADU A;  2O03 A;  4M9S A;  3L00 A;  5BPI A;  3ZPL A;  4HBL A;  3HIF A;  1UST A;  3CUQ B;  5E18 F;  4NB5 A;  4KUM A;  2OA4 A;  1I1S A;  4I02 A;  3HUG A;  4N0B A;  1XB4 A;  1I27 A;  3QU6 A;  3COA C;  2Q2E A;  2HS5 A;  5E1X A;  5LRR A;  3L7W A;  3TGN A;  1YW8 A;  5BMZ A;  2FSW A;  3EYI A;  5L3D A;  2BEO A;  1IN4 A;  1Z6T A;  4RAZ A;  5TRD A;  3BPX A;  3I59 A;  4U88 A;  3HOS A;  4Y17 A;  2H09 A;  2LNB A;  2QUF A;  1LJ9 A;  3SXY A;  5JFR A;  2WV0 A;  1X3U A;  1U5T A;  5HOO A;  3K69 A;  3KP3 A;  1GXP A;  4YII A;  1RUN A;  1YS6 A;  1KYZ A;  1UHW A;  3GFJ A;  4NHJ A;  1DP7 P;  3TDZ C;  2UZK A;  2ZXJ A;  3V8K A;  3Q5F A;  5DUI A;  1FWZ A;  4LG0 B;  5FD5 A;  3QP6 A;  5HS9 A;  2K02 A;  4OU0 A;  4P9U A;  2QM3 A;  2BV6 A;  3GUD A;  1GVJ A;  4IHS A;  2VE8 A;  3E5U A;  1K78 B;  3REO A;  2DU9 A;  4EMS A;  2K86 A;  4KNY A;  4LG0 A;  1U5T B;  4U0W A;  1HSJ A;  2DK8 A;  5D5V B;  5TJJ A;  4WXD A;  4P9F A;  1RUO A;  1IN8 A;  2IW5 A;  3CDH A;  3I59 B;  2TDX A;  2A3S A;  2Z5U A;  4PCQ A;  5HLI A;  3ML6 A;  3WU1 B;  1CF7 A;  2YX7 A;  2GA2 A;  3LQR A;  2XRN A;  2M30 A;  3E5Q A;  1F4K A;  1GXQ A;  1SD6 A;  3K9T A;  4AD9 A;  3KZY A;  5HLH A;  3FF5 A;  1ZLK A;  3IHU A;  3RPQ A;  4M71 A;  4UVC A;  1OYI A;  1IAW A;  3AAF A;  4A5N A;  2VT2 A;  4M74 A;  2ZFW A;  3F3X A;  1YW9 A;  2EFO A;  2CGP A;  3I71 A;  3TOB A;  2NYX A;  1R5H A;  2ACJ A;  2F5E A;  4G6Q A;  4IF4 A;  2XAH A;  2DI3 A;  1ZHF A;  4LGW A;  1JHF A;  1TQI A;  3GW2 A;  1C0W A;  1I1G A;  4B8X A;  2EA2 A;  2Z3Y A;  2ZME B;  1G3W A;  2P8T A;  2ESN A;  1D8K A;  2XRO A;  2OU2 A;  4OOI A;  5EEH A;  3K1N A;  3VFZ A;  1USS A;  1BJA A;  1YO5 C;  3GXO A;  1T6S A;  3KLN A;  3KLO A;  3GZ6 A;  2DO7 A;  1ZRF A;  1QPM A;  3HHG A;  1MJ9 A;  3ZMS A;  2F5C A;  2P5V A;  2FNA A;  3WTW C;  4BHP A;  4GO1 A;  5LEK A;  2D1H A;  4U0V A;  1IN6 A;  2UXN A;  2W57 A;  1YIO A;  4BXU A;  2VN2 A;  2H6B A;  1WWX A;  3C1D A;  2L4M A;  3CLO A;  2FA5 A;  2FNP A;  5DYM A;  3ZMV A;  5D5X B;  5J8F A;  4S05 A;  1OYY A;  1P6R A;  2P6T A;  3SFZ A;  4YFK F;  1XMK A;  4A0Z A;  1U8R A;  3E6C C;  3MZH A;  1R5G A;  3FWE A;  2NS0 A;  1KQ9 A;  2FBH A;  2IT0 A;  4QLC U;  2HQN A;  1W7P A;  3MWM A;  1XCB A;  3MEX A;  4AIK A;  3V7R A;  1ZGJ A;  1SD4 A;  4M6Y A;  4TV7 A;  3CUQ C;  4EJV A;  1DPU A;  2L01 A;  1TNS A;  4OIP F;  1EH7 A;  1RNL A;  1HBX G;  3R6S A;  2JT1 A;  2QWW A;  4ON0 A;  2EWN A;  5KK1 A;  1IN7 A;  2EB7 A;  1HXD A;  1XCV A;  3ZQ7 A;  4EM2 A;  2PMH A;  2ZNY A;  3HRM A;  4I09 A;  2GAU A;  4I0B A;  3BOQ A;  3ZP5 A;  1XMA A;  2P5L C;  2HOE A;  1G3Y A;  2Z9O A;  3J81 Z;  4G7O F;  3RPU A;  2IA1 A;  1Z05 A;  2VXZ A;  3KFW X;  3LA2 A;  4I2O A;  2EFN A;  4KMF A;  1IRF A;  3N97 A;  3BY6 A;  4G8X A;  3E6B A;  1PDN C;  5L3F A;  2ZKZ A;  1QQI A;  3ABT A;  3WTX C;  3W6J B;  3C18 A;  4O5V A;  3W6K B;  2Y0M A;  5FD6 A;  5JVT A;  4G94 A;  1P4W A;  4WX9 A;  4L0Y B;  2OD5 A;  1ZLJ A;  3FXR A;  1B9M A;  5ILU A;  5EEG A;  2VOP A;  1S29 A;  2BBY A;  4KN7 X;  2A6H F;  4HLY A;  5ILV A;  3MCZ A;  4HX8 A;  1O3S A;  2V1D A;  4XLN F;  1Z91 A;  4KIC A;  1ZH5 A;  2YPR A;  2DW4 A;  2EV6 A;  5L3C A;  1R1T A;  5ICF A;  1FSE A;  5F6F A;  1G6N A;  2DQR A;  3SHF A;  1TTY A;  1S3J A;  1FLI A;  2IVM A;  2FOK A;  3RKW A;  2HWV A;  2M8E A;  3KP5 A;  3LST A;  3GZ5 A;  3QP5 A;  4HLX A;  2EFW A;  4CHU A;  1WSU A;  1W5S A;  1ZG1 A;  2DTR A;  2L54 A;  4HQE A;  2HKO A;  2V6C A;  3EET A;  1IXS B;  1FNN A;  4MEX F;  2HYF A;  2KIF A;  5DV5 A;  3F8F A;  5LRS A;  3TKY A;  4YG2 F;  2RC4 A;  3F8C A;  1KYW A;  4HX7 A;  4Q4Z F;  1SFX A;  4G7H F;  2K4B A;  3VEP A;  2DFI A;  1ZN2 A;  4GYI A;  2PQ8 A;  5K1Y A;  3Q9V A;  5D6E A;  4JQF A;  5LGT A;  3WTT C;  3BJA A;  1EH8 A;  4R79 A;  3LFK A;  5E8I A;  4H0E A;  5LHH A;  1UFM A;  1J9I A;  3HHH A;  5F64 A;  3F8B A;  5CVU A;  4GYG A;  4KIB A;  4EVI A;  2PLY A;  4B09 A;  3ECH A;  1ZGA A;  1SMT A;  4OIN F;  2IJL A;  4I0A A;  1U2W A;  4ZZL A;  2ISY A;  4NQW A;  3J7A O;  2QEN A;  4RB3 C;  3D0S A;  1NHA A;  2DLL A;  3BZ6 A;  2F2E A;  1XSX A;  2GZW A;  1IUY A;  1XDS A;  2QQ9 A;  4XLP F;  4RAY A;  3L9F A;  2V1X A;  3HSF A;  2X0L A;  3BWG A;  3DPL C;  4M72 A;  2XKO A;  2OZU A;  4LK0 F;  1T0F A;  1J5Y A;  3K1M A;  2RQP A;  3EDP A;  1U6G A;  2ZJ2 A;  3HTU A;  4KDP A;  3LAJ A;  3ROU A; 
#chains in the Genus database with same CATH topology
 2LMD A;  2KFD A;  1F9N A;  5B1A H;  2CQN A;  1ZRC A;  2CV1 A;  3PNV A;  1MGT A;  2COM A;  4E4H A;  1WHU A;  1R4N B;  3KP6 A;  3ECO A;  3I0T A;  1V5E A;  3WGH A;  3BR0 A;  5IP6 A;  1ON2 A;  2DMU A;  1IV8 A;  3BG7 A;  5E3O A;  1R49 A;  3J80 K;  3T8R A;  3KZZ A;  2XAQ A;  2KZV A;  5LHI A;  2VC0 A;  2G7U A;  3T5X A;  4AVP A;  3VSL A;  3C2B A;  3CCR I;  1FPQ A;  2XIG A;  3BPV A;  2LR8 A;  4RM3 A;  1HW5 A;  4D9J A;  4MTE A;  2LD5 A;  5F27 A;  4CXF A;  2MH9 A;  1DQU A;  1D3Y A;  4EGY A;  1J59 A;  3CD6 I;  5K7F A;  1Z1D A;  3BLY A;  2E19 A;  4MEY F;  4IHV A;  5LD2 C;  5K5Q A;  2CV0 A;  4V2G A;  4HF0 A;  2EIK H;  2VKD A;  4V19 K;  2ZME A;  2KDZ A;  2BE5 F;  2DMT A;  2HKX A;  1ZRD A;  4Z6Y A;  2CG4 A;  3E7L A;  4ENN A;  1WVR A;  5EZG A;  2IS6 A;  5FFX A;  3FXQ A;  2Y31 A;  2ICW G;  2LRD A;  3S16 J;  4V2F A;  2IRF G;  1XX5 A;  1FX7 A;  3QRF F;  3NAU A;  3CJQ B;  1DDN A;  4HQM A;  2CUZ A;  1IGN A;  1ZYR F;  2E1M C;  3ZQC A;  2OTL I;  3DXJ F;  4UVA A;  4DGW B;  4BH9 A;  1U5T C;  5F0H A;  5HLG A;  3M3Y J;  4WWC A;  4ESF A;  1IXR C;  4A3D J;  2EIM H;  3UR3 C;  1RR8 C;  4EJW A;  2IS4 A;  1JHH A;  3WG7 H;  4EM1 A;  1I39 A;  1TNT A;  1YIT I;  3IH3 A;  5HDK A;  2R7S A;  3ZRG A;  5D8K B;  2EIN H;  4XLA A;  4B3A A;  1O7L A;  1JUP A;  3H92 A;  3KP2 A;  1P4A A;  1AOY A;  1ZG5 A;  1MD0 A;  4BQA A;  1MKM A;  3R4K A;  2V1U A;  4W97 A;  1BR1 A;  4OIO F;  3KEQ A;  3ZN1 A;  3S1R J;  2NXN B;  1BA5 A;  3EUK L;  4B47 A;  1KU2 A;  2CV2 A;  3CMM A;  4IPA A;  2IAI A;  4NUB A;  1APL C;  3VYT B;  1TW2 A;  2ELH A;  3F0C A;  4D1Q A;  3BRO A;  5GAG J;  3L2C A;  4F91 B;  1I6H J;  3C2G A;  2GWR A;  4CCJ A;  2QKL B;  4CYC B;  2FRH A;  1TL8 A;  4P55 A;  1YLF A;  2J5O A;  3HJE A;  1QVT A;  1XGO A;  5A2Q Z;  1X2N A;  2OTJ I;  2M8G X;  2DA4 A;  2PMU A;  2OF7 A;  2WAQ N;  2ISZ A;  5J47 A;  3MN2 A;  2QZ8 A;  2VIX A;  3K4K A;  4M3F A;  3H0D A;  1JKO C;  2R5Z A;  4JBA A;  1T38 A;  2Z33 A;  1FSH A;  1RC9 A;  2Z99 A;  3OMY A;  2HTJ A;  4NNJ A;  2DOA A;  2JA2 A;  3B02 A;  4MNU A;  1IZ1 A;  2R7U A;  3V7S A;  4NQW B;  1WRJ A;  4BXF A;  4ENJ A;  2STW A;  5EJC A;  2LK2 A;  3E97 A;  1NG6 A;  4L9J A;  1YRN A;  4HDV A;  3IWZ A;  1GDT A;  1VQN I;  1R71 A;  4NC6 A;  4UVB A;  5LFA A;  3TDU C;  1BI3 A;  2MFZ A;  2QBY B;  1TW3 A;  3U1D A;  4LD5 A;  2HZT A;  5LEJ A;  1LPQ A;  2ZC2 A;  3JRH A;  4IXA A;  1A5J A;  3TMO A;  4IHT A;  4ENM A;  5CLS A;  1XGN A;  2DT5 A;  4RLQ A;  1D8J A;  1R4M B;  5L3G A;  2NVU B;  3JRI A;  2HEO A;  3HL2 A;  2R7T A;  4WCG A;  4BQN A;  2F4I A;  1HLV A;  1QA6 A;  4PUS A;  2VOO A;  3WTZ A;  3GBG A;  2NVY J;  3S14 J;  2R7V A;  4D5C A;  1ETY A;  5CQG A;  3M4O J;  5H6Q A;  2XGD A;  3RYP A;  3M8E A;  4R8H A;  2XAG A;  4P5O A;  3ZQL A;  1JT0 A;  3P9K A;  1B6A A;  2DK5 A;  3RZO J;  2JN6 A;  1OCC H;  4RB0 A;  2ZBK A;  5F1R A;  1W7P B;  3H5A A;  2E1M B;  5JI6 A;  3V7C A;  3BTL A;  2WY7 Q;  4XK4 A;  2VQG A;  2RV8 A;  5CVR A;  4MHG A;  1REP C;  3GTM J;  1JXS A;  2XKP A;  2OAZ A;  2G9W A;  1GUU A;  2HNH A;  2KJC A;  2L7K A;  1WI9 A;  4FQG A;  4HOB A;  4LFU A;  4Q48 A;  3RKX A;  4LG3 A;  3O6B B;  2DT6 A;  5FJ8 J;  4A0Y A;  2P0W A;  3ASO H;  2K3P A;  4M9X A;  1LFU P;  2VON A;  3F6O A;  1N78 A;  2JZY A;  2DCE A;  3ZQG A;  1WH7 A;  5J1U A;  1JJ8 C;  4LLL A;  3T8T A;  3OYK A;  4RLF A;  2O0Y A;  3ESW B;  2MYS A;  1SVO A;  3MAJ A;  2LKS A;  2JA5 J;  3C3W A;  2OUM A;  4CZZ A;  4I7H A;  1RIO H;  3TW7 A;  3LNQ A;  1VQ9 I;  5CVJ A;  5ERI A;  2K40 A;  2LLK A;  1OCO H;  5DDG A;  2JVH A;  5K5R A;  2W24 A;  3JTG A;  4GXO A;  5GPC A;  4PSX A;  4A2U A;  1KQ8 A;  1OIS A;  1W7P D;  3O3K A;  2AO9 A;  1F36 A;  2LDU A;  1R58 A;  3HZJ A;  4MTD A;  3HOT A;  3CJN A;  4M9Z A;  2LSO A;  4AU7 A;  3R0A A;  4Q47 A;  2MLK A;  1U8B A;  2YR2 A;  2KIU A;  2MAB A;  4L9V A;  2NNY A;  3A4C A;  2F5D A;  1T39 A;  4ESB A;  3OIQ A;  2J5P A;  2IS1 A;  4I6Z A;  4IHX A;  2X6O A;  4WXC A;  3PJR A;  3HG9 A;  1FBS A;  2G0E A;  4ZYG A;  4DBR A;  3CMA I;  1JI8 A;  2L02 A;  4LK1 F;  2HDW A;  1HQC A;  2O8K A;  3HSE A;  1GLN A;  5F04 A;  3OIO A;  4BAC A;  2NS8 A;  5FKO A;  4HV6 A;  3GTL J;  1G59 A;  1GHC A;  2EV0 A;  3LSM A;  4L9N A;  3BZK A;  3CCS I;  1XSD A;  2LRE A;  1YS7 A;  2R7F A;  5DCM B;  4HF2 A;  2LBF B;  3JTH A;  4UV9 A;  2RKH A;  2RVC A;  2K9N A;  3CC4 I;  2OBP A;  4G12 A;  2L5Q A;  2CFO A;  4BU2 A;  3DEE A;  3IRQ A;  5DD8 A;  4D0P A;  1ZGW A;  2K85 A;  3KX2 A;  4PJL A;  4ZH4 F;  3R61 A;  4GDF A;  2FEZ A;  2HVQ A;  4RS8 A;  1X1P A;  1ZAR A;  3F21 A;  4BY7 J;  1ODD A;  1G2H A;  1ZKG A;  3ZCO A;  5IT9 K;  3TO7 A;  5JVG F;  1N77 A;  2E1N A;  2DA2 A;  3LSK A;  2LY9 A;  2VBW A;  4OIQ F;  3A02 A;  2EH3 A;  3MKW B;  2JUG A;  5DM7 F;  3TO6 A;  4X6A J;  3H1C A;  5E20 A;  1B8I A;  5JHU A;  3T0Y A;  3DBR B;  5F1J A;  4YFN F;  4J19 A;  1YIJ I;  2JRT A;  1STZ A;  2PFB A;  5J4V A;  2VAS A;  1XGS A;  3FMQ A;  2ID6 A;  2ZXW H;  5GP9 A;  5J8C A;  5EDN A;  1YFH A;  4UNO A;  2JA7 J;  2XAF A;  4L5J A;  4XKC A;  5LHG A;  3I4P A;  4BJ6 C;  3OYD A;  5C4X J;  2IA2 A;  3LMM A;  3RQ4 A;  2XRL A;  4MQV A;  2YUS A;  2FMY A;  4N9H A;  4QWQ A;  3JRG A;  3LWF A;  3CCU I;  4PJN A;  2F4O B;  4XRS A;  1S72 I;  3GME A;  1JT6 A;  3Q0U A;  3BP8 A;  4MQ9 F;  4E70 A;  5ILS A;  1O3T A;  1IUF A;  3HRT A;  5IT9 Z;  2D45 A;  4KMU X;  3RYR A;  3KEY A;  2YU3 A;  1UMQ A;  3ZQH A;  3ERE D;  3L2W A;  2YSR A;  2KJB A;  3SZT A;  1FTZ A;  2PI0 A;  3ZXS A;  3HSR A;  3M8J A;  5IYB J;  4Y3O A;  2L0K A;  4FT8 A;  1JE8 A;  1IXC A;  2H27 A;  2XAU A;  3JRA A;  5KCM A;  2R3S A;  3NRV A;  1TLH B;  2ZJR F;  4F92 B;  1RES A;  4ENK A;  1WJC A;  1HOM A;  3OIP A;  3ONQ A;  3I9V 2;  2LF8 A;  5FRM A;  1DGR M;  3AL0 B;  2VT3 A;  3JW4 A;  3QOD A;  2F5F A;  2K9M A;  1P2F A;  3R0J A;  4A3K J;  1O3R A;  2LF7 A;  3U21 A;  3WTV C;  3KYD B;  1OR7 A;  1O57 A;  1R22 A;  3E3V A;  3Q9S A;  3TOA A;  3U2R A;  4YFX F;  1IJW C;  5LBQ A;  4IHW A;  3TP3 A;  3S17 J;  4EJT A;  3K0L A;  1MND A;  1SVM A;  3E0J B;  3DFG A;  2PG4 A;  1TWH J;  1T98 A;  2ZB9 A;  3S1Q J;  1FOW A;  3H9Q A;  2IEK A;  1X3Z B;  2NOG A;  2EIJ H;  2Q8K A;  5M5W J;  3CUO A;  2DAO A;  3I56 I;  1K6Y A;  3QOP A;  2JJ7 A;  2EV5 A;  2HVR A;  4C2M J;  1TZL A;  2JTV A;  1KGS A;  4L9T A;  1JJ6 C;  2I8D A;  2MLG A;  4C9Y A;  3V8J A;  5KVR A;  4BEH B;  4ZYH A;  2L3D A;  1IF1 A;  4KYW A;  5DCF A;  2P7C B;  4RGR A;  1S9H A;  4XL9 A;  3CO7 C;  3H3Z A;  2RDP A;  3JRC A;  1S8N A;  1TP4 A;  1G4D A;  1DU6 A;  3RKY A;  2D1V A;  3DPT A;  1S6L A;  2EJR A;  2UXX A;  3K70 C;  2M34 A;  2LY1 A;  3FKJ A;  2MD5 A;  2FJ1 A;  5FKN A;  3LSH A;  1FC3 A;  1T95 A;  1QRY A;  3CLQ A;  2TCT A;  4CZC A;  1U9O A;  1B1B A;  3V8L A;  3TO9 A;  5F08 A;  5M3M J;  1A6I A;  1S7O A;  5E3M A;  4CGZ A;  5FKK A;  3ABU A;  2A69 F;  1UHM A;  2JA6 J;  4KIF A;  2P4W A;  3MD2 A;  2FBK A;  1U9N A;  3K10 A;  2RNJ A;  1I3Q J;  4B43 A;  1BIB A;  1PYV A;  2O7O A;  3HEF A;  3A1Y A;  4M3E A;  3A03 A;  4XOR A;  5J4Y A;  5DM6 F;  1LB2 A;  1FP1 D;  2X1C A;  1MBJ A;  3T1B A;  4G7Z F;  4LOC A;  4KN4 X;  2W00 A;  3ISP A;  1MMN A;  2V9V A;  5L3B A;  4XIC A;  5D4R A;  2EPF A;  1KZH A;  2PJR A;  2HFH A;  2GOX B;  2RAE A;  1OPC A;  1X1C A;  1VQP I;  1RET A;  3ELK A;  2HOT A;  3G3Z A;  1DPR A;  1W5T A;  5EZH A;  3OYA A;  3B73 A;  4UV8 A;  1VZ0 A;  1LNW A;  2K27 A;  4JK1 X;  1GVD A;  2V9P A;  3HPH A;  3GFM A;  3CTA A;  1VTN C;  1R23 A;  3G4S I;  4YEJ A;  2O8X A;  5M3F J;  4LLN A;  1JGG A;  2DA5 A;  1KU7 A;  2W1O A;  1B72 A;  3MZ8 A;  3PIO F;  3OY9 A;  3OYF A;  4RB2 C;  1YJN I;  1UG0 A;  1YTY A;  2ZCW A;  2PMZ A;  1LDJ A;  2BYV E;  1Z67 A;  1SMY F;  4RGU A;  2OQR A;  3KPH A;  2DDB A;  4HG2 A;  3KYC B;  3HC7 A;  1W36 C;  3IAM 2;  3DLA A;  4XMY A;  5HDG A;  4S04 A;  2DPU A;  2STT A;  1MNE A;  2KZG A;  2WAF A;  2ZNZ A;  3K4M A;  2GLO A;  1QGP A;  2M9H A;  2PEX A;  3WE2 A;  3BZC A;  2CS3 A;  4RGX A;  3K4N A;  3SEZ A;  2QF7 A;  1T08 B;  1IRG A;  2ZO4 A;  1IG7 A;  4RGS A;  4E7J A;  1MBG A;  2WC2 A;  4HNT A;  2Y69 H;  3CCL I;  2M7A A;  4XKV A;  5ICG A;  1F5T A;  3FM3 A;  1G3T A;  1IRX A;  3AG4 H;  2XGE A;  3QAH A;  1SAU A;  2KIM A;  1P4X A;  2XC7 A;  4BYY A;  3K70 D;  1OR7 C;  2JPC A;  1Z3X A;  2BW3 A;  2CQK A;  3CF2 A;  3IKV A;  2QQ8 A;  4HPQ A;  3AKZ A;  2HYJ A;  1X1B A;  1X4P A;  2YX4 A;  1CGP A;  2E35 A;  4F93 B;  2PN6 A;  4ASN A;  1YW7 A;  3VPR A;  4LB6 B;  2LP0 A;  4GCV A;  1AA7 A;  5TGT A;  1JUM A;  1HKS A;  2JVG A;  5BOX A;  5D5W B;  1YOV B;  3DQV C;  1IO2 A;  2EK5 A;  3GF2 A;  1JGS A;  4HW0 A;  3DKY A;  3OYM A;  2QYO A;  2Q0O A;  3J80 Z;  2BGC A;  2M87 A;  2OC6 A;  3OS1 A;  4MLO A;  1I50 J;  4PGG A;  2XVC A;  3K1P A;  3VDX A;  1P7I A;  4HDU A;  2JUC A;  1X2M A;  3L2Q A;  5D5U B;  1S7A A;  3DP7 A;  3FMS A;  2ECC A;  5B5E C;  4K2E A;  3NEU A;  2VE9 A;  3QYE A;  2M45 A;  1SAX A;  1RR7 A;  3KCC A;  3FMR A;  2FBI A;  5HS8 A;  2GXG A;  1FYK A;  2VBY A;  4ITV A;  3A0H C;  2B7E A;  2R7D A;  4IZZ A;  1VI0 A;  3G1M A;  5D8L B;  5J1R A;  3OR2 C;  3PSI A;  1HCR A;  4A6E A;  1FIA A;  1RZ4 A;  4IRI A;  4L5I A;  1SFU A;  1K6O A;  2O61 A;  2H6C A;  1LEA A;  3FM5 A;  3P9C A;  5E1Z B;  1H88 C;  2Z16 A;  4IKF A;  2GIV A;  2CSO A;  1UZC A;  3WGG A;  3IKT A;  1MMG A;  3HGG A;  3N05 A;  4I01 A;  2VLA A;  4BEH A;  3OV8 A;  5JLX A;  1BC7 C;  2MH2 A;  4PDK A;  1NK2 P;  1JKP C;  2E7X A;  2Y0S N;  4PFO A;  2ETH A;  2KQR A;  5H20 A;  4H4K C;  2CUJ A;  3RI4 A;  1FJL A;  4KIS A;  2BZT A;  1S7E A;  2NNN A;  2AXL A;  2HXI A;  4QIW N;  1WQ2 A;  3JCU C;  4NDL A;  1FTT A;  2ESH A;  1D1B A;  1D5Y A;  3H35 A;  2FU4 A;  2HI3 A;  1IW7 F;  1FP2 A;  1BOA A;  2G7H A;  1WKM A;  2HOS A;  3OL3 A;  3FX3 A;  1V5G A;  3QPH A;  3FIW A;  1TWF J;  3HM5 A;  1KU3 A;  2DJN A;  3EYY A;  1LE8 B;  1BN5 A;  1PJR A;  2A07 F;  1Z9C A;  5J6X A;  5JHF A;  2R4G A;  3MMY B;  3I5U A;  2Y9Y A;  1O4X A;  4KFC A;  5CVV A;  2AQF A;  2X1D A;  3MZY A;  4PGH A;  2NRA C;  1HKQ A;  2OCC H;  3ABK H;  3L09 A;  1KA8 A;  4A6D A;  4U87 A;  1ORK A;  2XGX A;  4R1H A;  2IP2 A;  2QBY A;  3WU2 C;  2V6E A;  2M1B A;  1J2X A;  2M4G A;  1PP8 F;  2UWM A;  3VB2 A;  3VOD A;  4IRH A;  4EM0 B;  1E17 A;  3S1M J;  4CCO A;  5HDN A;  2VL8 A;  2LG4 A;  3M07 A;  4EJU A;  3VOE A;  3S2H J;  4HYE A;  1AKH A;  1BC8 C;  2R7X A;  1KU9 A;  3DF8 A;  4X0G A;  3H9G A;  4EV0 A;  1HC8 A;  2MBF A;  4ANJ A;  2WV1 A;  1F43 A;  3RTR A;  1IRZ A;  1W1W E;  2BHY A;  3JSP A;  4LMY A;  1FEX A;  2W7N A;  1J7K A;  4CIC A;  2QVO A;  3WHC A;  1XGM A;  4RAG A;  2PX9 A;  4M6V A;  5BPD A;  2CYY A;  2ZSH B;  4RB1 A;  4JYK A;  2HVS A;  3LA7 A;  4CDG A;  3L2R A;  1O7F A;  3S3O A;  3KP7 A;  2NVQ J;  2X85 A;  3HYI A;  1YJW I;  3DCF A;  4HF1 A;  5ED4 A;  1OCR H;  3SEQ A;  1MZB A;  1MDM B;  3N4M A;  1Q1H A;  2MC3 A;  1V3F A;  4RM2 A;  2KDO A;  3DV8 A;  1DGW Y;  4XBF A;  3BTJ A;  2R5Y A;  4ZTF A;  2BVM A;  5KAI C;  2JWT A;  2XB0 X;  2B9S A;  2CWE A;  1ETX A;  5E8G A;  3LSJ A;  4IQ4 A;  3DWL E;  4IJA A;  2XPV A;  5IPA A;  3QPS A;  4BL0 B;  2DYR H;  1XD7 A;  4O3M A;  5IOZ A;  3PL8 A;  1VQ7 I;  1TQP A;  1ZK8 A;  5EGO B;  2AS5 F;  5H6R A;  2WTE A;  3IH2 A;  1WFX A;  5HLT A;  3OSF A;  2Y2Z A;  4FHT A;  3S8P A;  4DOZ A;  2E5N A;  4HZF A;  4HNU A;  3CCY A;  4E7K A;  3CP2 A;  5DCM A;  2WAQ A;  4DNC A;  2QKM B;  3IV5 A;  4F7Z A;  3I54 A;  3BQZ A;  2HOA A;  2PBI A;  4BHC A;  5FB2 A;  4NBQ A;  4OMZ A;  5EG0 B;  6PAX A;  4HSR A;  3GYH X;  3ERM A;  1T0F C;  2L9N A;  3BJ6 A;  2DDA A;  3KEO A;  5ICE A;  1KQ0 A;  3PO3 J;  4CO8 A;  1HF0 A;  2LKX A;  4KA4 A;  1GV5 A;  4LJZ F;  2B0L A;  4L18 B;  1LDK B;  3IWF A;  1WJB A;  3BR2 A;  3HTS B;  1BI0 A;  2M7B A;  1ZAO A;  2E1O A;  3M1E A;  3F8N A;  4FX0 A;  4UHT A;  2X6X A;  3RPU D;  3G73 A;  3HRS A;  1XPX A;  2L9V A;  1YG2 A;  5B3S H;  4UB6 C;  2DA1 A;  1D5V A;  3WOD F;  4LIU A;  3DBH B;  2C6Y A;  5F0F A;  2K4J A;  3I64 A;  4P96 A;  1WJE A;  4II2 A;  2P6S A;  3G6E I;  3OS0 A;  3DTE A;  1ETV A;  3Q0W A;  3JR9 A;  2CUE A;  2GA1 A;  1JKQ C;  2ELK A;  3PQK A;  1T56 A;  3GTG J;  3GFL A;  2XAS A;  3IRR A;  2BXY A;  1ETK A;  2V7F A;  5BNG A;  5FLX Z;  2V4J C;  2R5Y B;  1SEU A;  2VJJ A;  4IVN A;  3NWS A;  4F52 A;  4BUP A;  2VQH A;  4E7I A;  4UUS B;  1MDM A;  4BBS J;  2DYS H;  4OAY A;  1Z21 A;  1K79 A;  3PNT A;  4XLC A;  4YIF A;  5C3E J;  1B59 A;  1Y1V J;  4DYR A;  4G6T B;  1R1U A;  5FKM A;  1SD7 A;  1ZTR A;  3PFI A;  2O6G E;  4U0Y A;  4CH7 A;  4CA0 A;  1K83 J;  2W84 A;  2A5Y B;  2F4M B;  4XOP A;  2AHQ A;  3EUA A;  1ZG3 A;  1W0T A;  5K5O A;  1F1Z A;  2EA4 A;  2L9R A;  5LGU A;  1NK3 P;  1LVA A;  4Y4R A;  2VUM J;  1WGX A;  4L0Z B;  2L9S A;  2QLZ A;  2DQL A;  2FE3 A;  2EZI A;  3M8F A;  1SFO J;  1R1V A;  3OYH A;  3LQQ A;  3A01 A;  5FLX K;  2VKV A;  3FK7 A;  3E5X A;  3W3C A;  2PMZ N;  1A04 A;  4KIG A;  3PUB A;  4P1W A;  5M5Y J;  3BJO A;  3PM1 A;  1Y0N A;  2BY2 A;  2DTZ A;  4RMN A;  3RJP A;  3J81 K;  5FFZ A;  1OCZ H;  2X51 A;  2EZL A;  5FKL A;  3U1K A;  3P7N A;  4QTR A;  1MBK A;  3CF5 F;  2M5W A;  4M73 A;  1D0Z A;  4DYQ A;  2W4S A;  2LY2 A;  4Z2Y A;  1EH6 A;  4RA2 A;  3LA3 A;  1K4T A;  3U9G A;  1G3S A;  2OZ6 A;  4M3D A;  1BR2 A;  3W2A A;  1BI2 A;  3GLX A;  4XKW A;  3MVP A;  1R9T J;  2CQX A;  2KHM A;  3PUF A;  1SD5 A;  4PJ0 C;  1BBY A;  1TBX A;  2WB1 A;  4HV5 A;  4AIJ A;  4FX4 A;  2HGC A;  5E3N A;  2D2W A;  4BGD A;  3GO5 A;  1K7A A;  3QYB A;  1BL0 A;  1H9G A;  1H0M A;  1FOK A;  5HVQ C;  2JPB A;  2W85 A;  3BDD A;  3AL0 C;  1YQA A;  3ZMZ A;  2K5C A;  2DA7 A;  5K7Z A;  1PP7 U;  4EGZ A;  3F6V A;  2RN7 A;  3GFI A;  4FE4 A;  4HST A;  1RI7 A;  1Z77 A;  2XF7 A;  4LLG F;  1DUX C;  3ULQ B;  1B9N A;  2JK3 A;  2EFQ A;  1EV7 A;  1NTC A;  4IRG A;  2E2H J;  3S15 J;  3KYL A;  2XGC A;  1J0R A;  1G8X A;  4XSZ F;  5HNF A;  4XON A;  2M0M A;  4A3F J;  1QZZ A;  4A12 A;  5CJ9 A;  1PVE A;  4BQQ A;  2E1C A;  4CCK A;  1MW7 A;  3I58 A;  2A5W A;  3OR1 C;  1DU0 A;  2E2I J;  2XHK A;  4XRS G;  4ZZD A;  2VXD A;  2OPT A;  3F8M A;  3FXM A;  5LGN A;  1JUS A;  2DMQ A;  3C7J A;  4U7B A;  2HDC A;  1YE9 A;  5JLW A;  1Y8R B;  3WE3 A;  2WWY A;  3DEU A;  1OJL A;  3FBI B;  4WF2 A;  3PIP F;  3S2D J;  3V42 A;  3F23 A;  1ETW A;  3ZN0 A;  2V79 A;  3F22 A;  4X1E A;  4IHY A;  1UHS A;  4D5F A;  3DPU A;  4HNV A;  1LEB A;  3H3V K;  3ABL H;  2VJ5 A;  1OMI A;  3WGI A;  2KKO A;  3K2Z A;  2RNG A;  1RKT A;  1LFP A;  2LKP A;  2VJ4 A;  1E0E A;  4OMY A;  2DFF A;  3CCJ I;  3FXU A;  2EFP A;  1MNM C;  2VKE A;  2VPL A;  1FT9 A;  3SQN A;  4E6K G;  3W6V A;  2CFX A;  1BI1 A;  3J7A Y;  4XLH A;  2JMW A;  2Y30 A;  4DIQ A;  3SYT A;  2W25 A;  3P9I A;  1MMA A;  2H94 A;  3PQJ A;  3V4G A;  4L5E A;  1MBH A;  5FLV A;  2O5R A;  4E7H A;  2V26 A;  4GGG A;  4DW6 A;  1RRJ A;  1NH3 A;  2HQR A;  4DQ2 A;  2A6T A;  3WHB A;  2GBY A;  2HPI A;  4JX6 A;  2NS7 A;  5EG0 A;  2XAJ A;  3JSO A;  3EUH A;  4OAZ A;  3CQZ J;  4I98 B;  1LFB A;  3R60 A;  1FBU A;  2PJP A;  2O3F A;  1Y0U A;  2DFE A;  4PJJ A;  5GTI C;  4BBR J;  2F6C A;  3FHN A;  2IA0 A;  3O8G A;  1IDY A;  2Q1Z B;  2XSJ C;  1V55 H;  2VOD A;  4AVZ A;  1GV2 A;  4LB5 A;  3IL2 A;  4IO9 F;  2P7V B;  3M9A A;  1YYV A;  5DD4 A;  1FYL A;  5EGO A;  1XN7 A;  3WU0 A;  1QHG A;  3VYS B;  3CCV I;  1DP3 A;  2R93 J;  1LUJ B;  2QQA A;  1HKT A;  4E7S A;  1UB9 A;  3JAM Z;  2CW0 F;  2XV4 S;  2D5V A;  3HRU A;  5AIP A;  5L3E A;  1Y56 A;  3TL4 X;  2JSP A;  4KIT B;  3J7Y J;  4CYD A;  2DT7 B;  5B66 C;  3E6M A;  3FHZ A;  2HR3 A;  2K9S A;  4PZJ A;  1ACI A;  3TED A;  3CO6 C;  3O8H A;  2V9K A;  4U7D A;  1XDU A;  1XS9 A;  1ZEL A;  1B72 B;  3HDD A;  2I5U A;  3WTY C;  3OS2 A;  1VQM I;  3GWZ A;  1IC8 A;  1BM9 A;  1PUF B;  3OYN A;  2NAZ A;  3HOX J;  4AYB N;  4UUV A;  3ZMU A;  4ESJ A;  2CO5 A;  1FZP B;  2MGQ A;  4J00 A;  3DKW A;  4DZJ A;  4A3L J;  2Z2S B;  3ZMD A;  2B63 J;  1BW6 A;  3LAP A;  5FGM A;  4I76 A;  2GXB A;  3ZQF A;  1HST A;  2FML A;  2KP6 A;  4XRF A;  5HS7 A;  2R92 J;  4ZJZ A;  3FZV A;  4EAT A;  2KT0 A;  3CP8 A;  4DJA A;  3OYE A;  3OWT A;  2DBB A;  3I53 A;  4UXN A;  3OSG A;  3QU3 A;  2ME6 A;  3ZQI A;  4KT5 C;  2QSG X;  1CF7 B;  1UCR A;  2DMP A;  1AKH B;  3S3M A;  2HDD A;  5BQT A;  3JRF A;  3PFY A;  1Q1V A;  3NQO A;  3CDL A;  2A61 A;  1QBJ A;  4FAS D;  3CCQ I;  4WK8 F;  3BR6 A;  4HX4 A;  3GLL A;  1Y39 A;  1A35 A;  1IDZ A;  1MBE A;  3OOP A;  4G9Y A;  3RIR A;  4CUG A;  1WZ2 A;  1TT0 A;  2W82 A;  5E1W A;  1TQM A;  2VC1 A;  4YEL A;  5D6F A;  4QSH A;  5GAH J;  3A0B C;  3GX4 X;  5CVI A;  3ZR8 X;  1E3O C;  2E7W A;  2DPD A;  3E6D A;  1LKX A;  3SJM A;  1H9T A;  2FD5 A;  5BS6 A;  5IT3 A;  4EQQ A;  1K78 A;  3OYI A;  1AWC A;  1IN5 A;  2BHZ A;  4Q5S F;  2XUB A;  5D4S A;  1E3H A;  3GTK J;  2A6E F;  3KE2 A;  3WTU C;  1MJB A;  4HAM A;  1I5Z A;  3KZI C;  1OFC X;  5CYV A;  1L0O C;  4ZYD A;  4OIR F;  1OKR A;  2M4K A;  3VSK A;  5LLQ A;  2HU9 A;  4M6X A;  2XSD C;  1FBQ A;  1FY7 A;  3CES A;  4XRM A;  1WJA A;  2HYG D;  4A3E J;  5ICC A;  1P92 A;  4ZYE A;  1ERD A;  1CQT A;  4FET A;  4ZDP A;  2QCO A;  3VWB A;  2X4H A;  1XC5 A;  4BHB A;  3AFH A;  1R36 A;  1EKE A;  1VQO I;  1Z7U A;  3IUO A;  3FXK A;  3RDI A;  2P5K A;  3FXO A;  3W2V A;  3D1N I;  1WJF A;  3O2P E;  2K3F A;  1E2X A;  1OYW A;  2JSC A;  1R00 A;  2L7M P;  3TW6 A;  2VQC A;  2BY1 A;  2IPQ X;  3KET A;  2CU7 A;  2ECB A;  3CZ6 A;  1L3L A;  1FYM A;  4EJO A;  2Z1D A;  4CCN A;  1QO0 D;  2WAE A;  1LQ1 A;  2XPU A;  2A68 F;  2I10 A;  1R5I D;  3BT9 A;  4AIH A;  2VBZ A;  2E5Z A;  1QNT A;  1X3W B;  1XSV A;  2RGV A;  1ULY A;  3MFK A;  2QA4 I;  2IGO A;  2EZK A;  2HTS A;  2FQ3 A;  2KRF A;  3CJR B;  2MA3 A;  1ZRE A;  4F3Q A;  2DA6 A;  4Y52 J;  3H3U A;  2L7F P;  1W0U A;  4N9I A;  1X1D A;  3TQN A;  3CC7 I;  1V4R A;  4A5M A;  1R7J A;  1R6R A;  3GEZ A;  3TBI A;  2NOJ B;  1ONV A;  4ETS A;  1H8A C;  3GVA A;  1QZY A;  3F72 A;  2FXA A;  3JAM K;  3OYL A;  3S2W A;  4MFD A;  1HW1 A;  4A3C J;  4OWR B;  3HB9 A;  5AON A;  3HOW J;  1ON1 A;  1X58 A;  4O6J A;  3M1C A;  1PUE E;  2K7L A;  5DUK A;  2Y48 A;  4BNC A;  3CUQ A;  4AWX B;  3SZP A;  5H2F C;  2N8G A;  2FF4 A;  1W4M A;  4WXH A;  2X6Y A;  2VBX A;  3IP4 B;  4Y15 A;  5FO5 A;  1B4A A;  2CJJ A;  2QQB A;  3LFU A;  4IEJ A;  4C2T A;  2WB1 N;  1HA8 A;  3LSG A;  3EQL F;  1Y6I A;  4A0X A;  2L4A A;  4MGR A;  2GQQ A;  2MC4 A;  1U78 A;  1J75 A;  3AG3 H;  1MJA A;  2YU9 J;  3W2W A;  5DEQ A;  3L1P A;  4DYC A;  5JR3 A;  4HA8 A;  5IP9 J;  1K4S A;  2OQG A;  2WAD A;  1HW2 A;  2CH0 A;  4IOA F;  2UUZ A;  1VFC A;  4M3G A;  4BAY A;  3CDI A;  1LDD A;  1BIA A;  3IC7 A;  1I6X A;  4G6D A;  3MQ0 A;  5A2Q K;  2EBI A;  3WG9 A;  4XNF A;  1OCT C;  3ZMT A;  2Y75 A;  3D5L A;  1Z6R A;  5AIQ A;  5K7H A;  2LBF A;  3M7G A;  4BJ5 C;  4Y13 A;  4XSX F;  1V5F A;  1WJD A;  1HDD C;  4UB8 C;  1U3E M;  2UV1 A;  1T2K A;  3KP4 A;  1O3Q A;  3WTS C;  4BE2 A;  2FOW A;  1SFE A;  3QPT A;  4BDZ A;  5E17 F;  5F0C A;  4BXX J;  2ADU A;  2O03 A;  4M9S A;  2LTP A;  1YHQ I;  3L00 A;  5BPI A;  9ANT A;  3HOU J;  2R7O A;  4ZTJ A;  4GRI A;  4HBL A;  3ZPL A;  3HIF A;  1EF4 A;  1UST A;  2AQE A;  2IXS A;  3C2H A;  3CUQ B;  5E18 F;  4NB5 A;  4IOC F;  4KUM A;  2OA4 A;  4M3B A;  4I99 C;  1I1S A;  4I02 A;  3HUG A;  4N0B A;  1JTX A;  3SDG A;  1XB4 A;  1I27 A;  1ETQ A;  3QU6 A;  5EEA A;  3GTO J;  3COA C;  2GM4 A;  3MKL A;  1AU7 A;  1FIP A;  3I4N J;  5HOD A;  2Q2E A;  4AID A;  2HS5 A;  5E1X A;  5LRR A;  3E1S A;  3L7W A;  4BJT A;  3TGN A;  1YW8 A;  5IP7 J;  5BMZ A;  2FSW A;  3EYI A;  5L3D A;  3QYF A;  2BEO A;  2DXI A;  1IN4 A;  4XOT A;  1Z3Y A;  1FMV A;  1Z6T A;  4FTH A;  4RAZ A;  2V1N A;  5TRD A;  2PJR B;  3DLL F;  3BPX A;  5EF6 A;  1H89 C;  1W5C C;  3I59 A;  4U88 A;  3RSN A;  3MKY B;  3HOS A;  4NC8 A;  4Y17 A;  1WCM J;  2H09 A;  2LNB A;  2QUF A;  2K9Q A;  1VQ4 I;  1LJ9 A;  3SXY A;  3D5S C;  5JFR A;  4A93 J;  2W48 A;  2WV0 A;  1J09 A;  1X3U A;  1U5T A;  5GAD J;  5HOO A;  3HOV J;  3K69 A;  3KP3 A;  1GXP A;  4YII A;  1RUN A;  3HXL A;  1YS6 A;  3K4B A;  1OCP A;  1MSF C;  4CCL A;  1VQ5 I;  1KYZ A;  1UHW A;  3GTQ J;  2DA3 A;  2XDV A;  1TWC J;  1S5L C;  5J3L A;  3GFJ A;  2HQ5 A;  3DKX A;  4NHJ A;  1DP7 P;  3TDZ C;  4EEF G;  2UZK A;  2QGU A;  2ZXJ A;  1LE8 A;  1A6Q A;  1OLT A;  2KRC A;  3BR5 A;  3V8K A;  3Q5F A;  3HKZ A;  2KLO A;  5KHD A;  1BJZ A;  3BCB A;  4Y7N J;  5DUI A;  1FWZ A;  4LIV A;  5FD5 A;  4A3M J;  4LG0 B;  3QP6 A;  3LOC A;  5IYC J;  3QQA A;  5HS9 A;  2K02 A;  4OU0 A;  1T33 A;  4P9U A;  2QSF X;  4BS9 A;  2QM3 A;  3OL4 A;  3OYB A;  2BV6 A;  2CQ7 A;  3GUD A;  5IY5 H;  4JOM A;  1GVJ A;  1TWA J;  1VQ8 I;  4IHS A;  3H5R A;  3OYJ A;  5FRN A;  2VE8 A;  1D0X A;  3E5U A;  1K78 B;  3REO A;  3KIO A;  1M1E B;  2DU9 A;  4EMS A;  4Y33 A;  1YX3 A;  2K86 A;  4XLF A;  2RQQ A;  3CCE I;  1Y1W J;  4KNY A;  2MW8 A;  2HQA A;  1TT5 B;  4LG0 A;  1U5T B;  2GIZ A;  3I55 I;  4U0W A;  1HSJ A;  5FLM J;  3QPL A;  4B1R A;  2EIL H;  2DK8 A;  5D5V B;  2E2J J;  1IV6 A;  2O9L A;  5TJJ A;  4WXD A;  4BKX A;  1EJ9 A;  2AXT C;  4P9F A;  3F9K A;  1RUO A;  1IN8 A;  2IW5 A;  3CC2 I;  2IGN A;  2KL4 A;  3CDH A;  1UG2 A;  1VND A;  5KNL A;  2ZXH A;  1SVL A;  3I59 B;  2TDX A;  3K4C A;  3SDB A;  2A3S A;  2Z5U A;  3HPG A;  4PCQ A;  4PJM A;  5HLI A;  3ML6 A;  4W1U A;  1T8I A;  4AYB A;  3WU1 B;  5DS9 A;  1CF7 A;  2YX7 A;  2GA2 A;  4C3J J;  3G71 I;  3LQR A;  4N4O B;  2XRN A;  2E60 A;  2M30 A;  3E5Q A;  1F4K A;  1P7J A;  1GXQ A;  3FDY A;  1FOY A;  1SD6 A;  2Q2E B;  1TWG J;  2FUG 2;  3BR1 A;  3ZGK A;  5CPR B;  3K9T A;  4J01 A;  4AD9 A;  3KZY A;  5HLH A;  5KAF C;  3FF5 A;  1ZLK A;  3IHU A;  3RPQ A;  2ZJQ F;  4M71 A;  4UVC A;  1OYI A;  1KON A;  1IAW A;  2IS2 A;  3AAF A;  4A5N A;  1D0Y A;  1EA3 A;  2VT2 A;  4E7L A;  4BY1 J;  2M2E A;  2H1L A;  2LOO A;  1D1A A;  1WI3 A;  2BW3 B;  2ZFW A;  3F3X A;  4M74 A;  1YW9 A;  2EFO A;  2KMU A;  2R7Q A;  2ELJ A;  3LSR A;  3K6G A;  3I71 A;  3RCO A;  2CGP A;  2VB6 A;  3TOB A;  2NYX A;  5GTH C;  3HUG B;  4C2U A;  3BC8 A;  3GTJ J;  1R5H A;  4C3H J;  1Z7L A;  2ACJ A;  3LSI A;  1A31 A;  1BOB A;  4C30 A;  4AM3 A;  2F5E A;  4G6Q A;  3BG9 A;  4IF4 A;  3B6C A;  2XAH A;  3K2A A;  2DI3 A;  1ZHF A;  4LGW A;  1WPK A;  3A2K A;  1JHF A;  3NAR A;  2NVX J;  1ITY A;  1TQI A;  3GW2 A;  5GPA A;  4RBO A;  3RZD J;  1C0W A;  1I1G A;  4B8X A;  2EA2 A;  2Z3Y A;  1ZR4 A;  2ZME B;  2RRE A;  4JX5 A;  4IL6 C;  1G3W A;  1WJ5 A;  1VF9 A;  2P8T A;  3DTI A;  4A69 C;  2ESN A;  1D8K A;  2QEX I;  4UUT A;  2XRO A;  2OU2 A;  4PK4 A;  5DTD A;  4RDU A;  1POG A;  4OOI A;  5EEH A;  3K1N A;  3DU5 A;  3BTI A;  2GXA A;  4XID A;  3VFZ A;  3K7A J;  3J7Z I;  3G2B A;  1USS A;  1BJA A;  1YO5 C;  2VKH A;  3ZQQ A;  3GXO A;  2GOM A;  1T6S A;  1N25 A;  2CQQ A;  2CRG A;  3KLN A;  4B4C A;  2CW8 A;  2LFB A;  3KLO A;  2L7Z A;  3QWL A;  3D5R C;  3GZ6 A;  3HOY J;  1ETO A;  2DO7 A;  1QPM A;  1ZRF A;  3VYU B;  3HHG A;  1MJ9 A;  4UY8 I;  3ZMS A;  4BQO A;  4FCY A;  2COB A;  2F5C A;  2P5V A;  2FNA A;  1A36 A;  2VI6 A;  4B48 A;  4AUX A;  1U0J A;  3WTW C;  2LVS A;  4BHP A;  4GO1 A;  5LEK A;  2R7Z J;  2D1H A;  3VYR B;  3BG5 A;  2EZH A;  1IN6 A;  2MD0 A;  4U0V A;  1N75 A;  2UXN A;  2W57 A;  2ZXI A;  1OQY A;  1YIO A;  2HXO A;  3HGY A;  2LC2 A;  4BXU A;  4NC7 A;  2VN2 A;  3CCM I;  4MO7 A;  2H6B A;  2E71 A;  1WWX A;  1LVK A;  1MIJ A;  3C1D A;  2ME0 A;  2L4M A;  3AG1 H;  3CLO A;  2FA5 A;  2FNP A;  5DYM A;  3ZMV A;  4ZDL A;  5D5X B;  5J8F A;  2HPM A;  4S05 A;  5E3L A;  1OYY A;  1P6R A;  2P6T A;  3SFZ A;  4YFK F;  3FXL A;  4CSW A;  1XMK A;  4A0Z A;  4JX4 A;  1U8R A;  3E6C C;  2R0Q C;  3MZH A;  1WH5 A;  1R5G A;  4II3 A;  3FWE A;  2NS0 A;  2E34 A;  1QU3 A;  3ASN H;  1KQ9 A;  2DOF A;  2FBH A;  3GCM A;  4D7M A;  2IT0 A;  1V54 H;  2VQL A;  4QLC U;  2HQN A;  1W7P A;  3DTK A;  3MWM A;  1XCB A;  3SFI A;  3MEX A;  2EQR A;  4AIK A;  4A3G J;  2HZD A;  1MMS A;  3I3L A;  4YIR X;  3V7R A;  4ABZ A;  2IGK A;  1ZGJ A;  4XM3 A;  4E7Z A;  1SD4 A;  4M6Y A;  1RKW A;  4TV7 A;  3CUQ C;  1K61 A;  2YS9 A;  4EJV A;  2JQ7 A;  1DPU A;  3SZG A;  2L01 A;  2L2O A;  1TNS A;  3K4L A;  4OIP F;  1EH7 A;  2K9L A;  2BVL A;  1RNL A;  1HBX G;  3R6S A;  2JT1 A;  2QWW A;  1FMW A;  2ZSI B;  4ON0 A;  2F5V A;  2EWN A;  5KK1 A;  2FQ4 A;  1IN7 A;  1HXD A;  2EB7 A;  1XCV A;  2KIQ A;  3ZQ7 A;  4EM2 A;  3LSP A;  4C3I J;  4BDY A;  2OJE D;  4DBQ A;  4FIS A;  2PMH A;  2ZNY A;  3L2U A;  2NVT J;  1JTY A;  3HRM A;  5CKT A;  4I09 A;  2GAU A;  2WBM A;  4I0B A;  2R5Z B;  3BOQ A;  3ZP5 A;  1XMA A;  2P5L C;  1SC7 A;  4ZDO A;  3PSF A;  2HOE A;  1G3Y A;  2Z9O A;  2X6W A;  3J81 Z;  1UJ8 A;  4CCM A;  2FX0 A;  1VQK I;  1UEL B;  3CJT B;  4S0H B;  4JP0 A;  1MBF A;  4CYC A;  4G7O F;  3RPU A;  3FIS A;  4DZP A;  3BR3 A;  3MKZ A;  2IA1 A;  2BY0 A;  1Z05 A;  2VXZ A;  3JRB A;  1JKR C;  4XLE A;  3KFW X;  4B44 A;  1VQL I;  3Q0V A;  2OCE A;  3LA2 A;  4I2O A;  2EFN A;  3OOU A;  4RAF A;  4KMF A;  1IRF A;  2E36 A;  4UUS A;  3NWT A;  3N97 A;  3BY6 A;  2XF6 A;  2ZFU A;  4XN3 A;  2ZME C;  4XN0 A;  1B8I B;  1ENH A;  4G8X A;  3E6B A;  2KPM A;  1PDN C;  5L3F A;  4A3J J;  2ZKZ A;  5C4J J;  1QQI A;  3ABT A;  3QOE A;  3DEW A;  3WTX C;  3W6J B;  3C18 A;  1I3A A;  3HOZ J;  4O5V A;  3W6K B;  2Y0M A;  5FD6 A;  1MMD A;  2WY8 Q;  5JVT A;  1QVU A;  4G94 A;  1P4W A;  4WX9 A;  3HKZ N;  3PNY A;  2X48 A;  1NG7 A;  4L0Y B;  3CMY A;  3Q3S A;  4QPQ A;  2OD5 A;  2P81 A;  3CME I;  4YRV A;  1X4O A;  5E79 C;  1VQ6 I;  1ZLJ A;  1YX5 A;  3FXR A;  2QSH X;  3H5N A;  3IH4 A;  3L2V A;  1B9M A;  1FOX A;  5ILU A;  5EEG A;  2VOP A;  3G1L A;  1S29 A;  2BBY A;  2KIS A;  4KN7 X;  1W36 D;  2CUF A;  2A6H F;  2BXZ A;  2Y9Z A;  4HLY A;  5ILV A;  3EPZ A;  3MCZ A;  3K4J A;  4HX8 A;  1RPW A;  2DJI A;  1O3S A;  2V1D A;  4XLN F;  4KT6 A;  1X1A A;  4XKB A;  1Z91 A;  4KIC A;  1MH3 A;  1ZH5 A;  2DOD A;  2YPR A;  2DW4 A;  2EV6 A;  5L3C A;  1R1T A;  2OV7 A;  5ICF A;  1FSE A;  5F6F A;  5B1B H;  1HDP A;  1G6N A;  2DQR A;  3SHF A;  4XQF A;  1TTY A;  4PFP A;  3FBN B;  1S3J A;  1FLI A;  2IVM A;  5GAE J;  2FOK A;  1UAA A;  3RKW A;  2M0C A;  2XPW A;  2HWV A;  3I4M J;  4A3B J;  2M8E A;  3KP5 A;  2X1E A;  3LST A;  4D7N A;  3GZ5 A;  3IAS 2;  3QP5 A;  5M5X J;  3G1O A;  4HLX A;  1XTA A;  4KJZ A;  2EFW A;  4CHU A;  5EYR A;  1WSU A;  3JRE A;  3H36 A;  1W5S A;  4A3I J;  3EUH C;  1ZG1 A;  2DTR A;  2L54 A;  3GZN B;  4BE0 A;  2CMP A;  2A05 A;  5CQE A;  3S93 A;  4HQE A;  2LH9 A;  1XG1 A;  2HKO A;  2V6C A;  3EET A;  3BG6 A;  1IXS B;  1FNN A;  4MEX F;  2HYF A;  2KIF A;  5DV5 A;  1MH4 A;  3F8F A;  5LRS A;  3TKY A;  4YG2 F;  1MSE C;  2RC4 A;  3F8C A;  3S32 A;  1KYW A;  2DMN A;  4GFB A;  4HX7 A;  4Q4Z F;  1SFX A;  2VJI A;  4G7H F;  2K4B A;  3VEP A;  2H8W A;  2DFI A;  1ZN2 A;  2MG4 A;  1BW5 A;  3UNG C;  4XR6 A;  4GYI A;  2H1K A;  2PQ8 A;  5K1Y A;  3Q9V A;  5J40 A;  3H9J A;  4ZC3 A;  5D6E A;  2MSY A;  4JQF A;  5LGT A;  3WTT C;  4LIT A;  3RKQ A;  1ZQ3 P;  3BJA A;  1EH8 A;  2VPR A;  2H8R A;  3DU6 A;  4R79 A;  3LFK A;  5E8I A;  4H0E A;  5LHH A;  2XF5 A;  1QHH D;  1UFM A;  1J9I A;  3TP0 A;  3HHH A;  5FRO A;  1AHD P;  3UKG A;  5F64 A;  2TRT A;  1D1C A;  3BCA A;  2LYC A;  3F8B A;  4F55 A;  1XMX A;  5CVU A;  4GYG A;  4KIB A;  4EVI A;  1X19 A;  2PLY A;  4B09 A;  2M3A A;  3BQY A;  4N4N B;  3ECH A;  1ZGA A;  1SMT A;  4OIN F;  3ZOB A;  1TC3 C;  1BR4 A;  1Y8Q B;  1Z0X A;  4MFE A;  3S1N J;  2IJL A;  4I0A A;  4PSW A;  2JA8 J;  1U2W A;  4ZZL A;  2ISY A;  4AC0 A;  1YJ9 I;  3AG2 H;  3JRD A;  1YRN B;  1P9Q C;  4NQW A;  3J7A O;  3FK6 A;  3OYG A;  1ZR2 A;  3GTP J;  4MIM A;  2QEN A;  1E3P A;  4RB3 C;  3D0S A;  1NHA A;  2DLL A;  2KRH A;  5IOY A;  2X9D A;  3BZ6 A;  1QZE A;  2R7W A;  3BTC A;  2F2E A;  1YI2 I;  2F48 A;  2IGM A;  4IX7 A;  3PO2 J;  1XSX A;  4HEA 2;  2GZW A;  1IUY A;  1XDS A;  2QQ9 A;  4XLP F;  4RAY A;  3ABM H;  3L9F A;  2V1X A;  3HBL A;  2BY3 A;  2JRM A;  3HSF A;  3A01 B;  2X0L A;  3BWG A;  3DPL C;  4M72 A;  2R7R A;  2XKO A;  5HNH A;  2OZU A;  1SAN A;  2WA0 A;  4LK0 F;  3FXJ A;  1SFK A;  4QPO A;  1QPI A;  1T0F A;  4IQJ A;  2DOE A;  2Y0S A;  1J5Y A;  3P5J A;  4B3X A;  3K1M A;  3S3N A;  1PUF A;  2XB5 A;  2CW7 A;  2RQP A;  4ZYA A;  2IBD A;  2DN0 A;  3BG3 A;  3RQI A;  3EDP A;  2ZJP F;  3H0G J;  2ID3 A;  1U6G A;  3LL7 A;  2ZJ2 A;  3HTU A;  3X2Q H;  3FKI J;  2DFH A;  4KDP A;  3OYC A;  5TIS C;  5IYD J;  5J1Y A;  5C44 J;  1GT0 C;  3LAJ A;  3B6A A;  2BOL A;  3ROU A;  4FE7 A;  4BE1 A;  3DBL B;  4HRI A; 
#chains in the Genus database with same CATH homology
 1ZRC A;  1F9N A;  1MGT A;  2COM A;  3KP6 A;  3ECO A;  3I0T A;  3WGH A;  1ON2 A;  3J80 K;  3T8R A;  3KZZ A;  2XAQ A;  5LHI A;  2VC0 A;  2G7U A;  3T5X A;  4AVP A;  1FPQ A;  2XIG A;  3BPV A;  1HW5 A;  4MTE A;  4CXF A;  2MH9 A;  1D3Y A;  4EGY A;  1J59 A;  1Z1D A;  4MEY F;  5K5Q A;  4HF0 A;  2ZME A;  2BE5 F;  2HKX A;  1ZRD A;  2CG4 A;  4ENN A;  5FFX A;  3FXQ A;  2IRF G;  1FX7 A;  3QRF F;  1DDN A;  4HQM A;  1ZYR F;  3DXJ F;  4UVA A;  4BH9 A;  1U5T C;  5HLG A;  4WWC A;  4ESF A;  1IXR C;  4EJW A;  1JHH A;  4EM1 A;  1TNT A;  5HDK A;  5D8K B;  1O7L A;  3H92 A;  3KP2 A;  1P4A A;  1AOY A;  1ZG5 A;  1MD0 A;  4BQA A;  1MKM A;  3R4K A;  4OIO F;  2V1U A;  3KEQ A;  3ZN1 A;  1KU2 A;  4IPA A;  1TW2 A;  2ELH A;  3BRO A;  3L2C A;  2GWR A;  2FRH A;  4P55 A;  1YLF A;  2J5O A;  1XGO A;  5A2Q Z;  2PMU A;  2ISZ A;  2QZ8 A;  4JBA A;  1T38 A;  2Z33 A;  1FSH A;  2Z99 A;  2HTJ A;  3B02 A;  4MNU A;  1IZ1 A;  3V7S A;  2STW A;  1WRJ A;  4ENJ A;  4L9J A;  3E97 A;  4HDV A;  3IWZ A;  4UVB A;  3TDU C;  1BI3 A;  2QBY B;  1TW3 A;  3U1D A;  4LD5 A;  2HZT A;  5LEJ A;  4IXA A;  4IHT A;  4ENM A;  5CLS A;  1XGN A;  2DT5 A;  1D8J A;  5L3G A;  2HEO A;  4WCG A;  2VOO A;  3WTZ A;  5H6Q A;  3RYP A;  3M8E A;  4R8H A;  2XAG A;  4P5O A;  3P9K A;  1B6A A;  2DK5 A;  4RB0 A;  2ZBK A;  5F1R A;  1W7P B;  5JI6 A;  3V7C A;  4MHG A;  2RV8 A;  5CVR A;  1REP C;  1JXS A;  2XKP A;  2OAZ A;  2G9W A;  2KJC A;  1WI9 A;  4HOB A;  4LFU A;  4Q48 A;  3RKX A;  3O6B B;  4A0Y A;  2VON A;  4M9X A;  3F6O A;  2JZY A;  4LLL A;  3T8T A;  2O0Y A;  3MAJ A;  3C3W A;  4CZZ A;  4I7H A;  1RIO H;  5CVJ A;  5ERI A;  5DDG A;  5K5R A;  2W24 A;  3JTG A;  4GXO A;  4A2U A;  1KQ8 A;  1W7P D;  3O3K A;  2LDU A;  1R58 A;  4MTD A;  3HOT A;  3CJN A;  4M9Z A;  2LSO A;  3R0A A;  4Q47 A;  2MLK A;  2YR2 A;  2KIU A;  4L9V A;  2NNY A;  2F5D A;  1T39 A;  4ESB A;  2J5P A;  4WXC A;  1FBS A;  4ZYG A;  2L02 A;  4LK1 F;  1HQC A;  3HSE A;  4HV6 A;  1GHC A;  2EV0 A;  4L9N A;  1XSD A;  1YS7 A;  2R7F A;  5DCM B;  4HF2 A;  3JTH A;  4UV9 A;  2RKH A;  2RVC A;  2OBP A;  3IRQ A;  5DD8 A;  4D0P A;  4ZH4 F;  3R61 A;  2FEZ A;  4RS8 A;  3F21 A;  1ZAR A;  1ODD A;  5IT9 K;  3TO7 A;  2E1N A;  2VBW A;  4OIQ F;  3TO6 A;  5E20 A;  5JHU A;  3T0Y A;  4YFN F;  2JRT A;  1STZ A;  2PFB A;  1XGS A;  3FMQ A;  5J8C A;  4UNO A;  1YFH A;  2XAF A;  4L5J A;  5LHG A;  3I4P A;  2IA2 A;  4MQV A;  2FMY A;  4N9H A;  4QWQ A;  3LWF A;  1O3T A;  4E70 A;  3BP8 A;  4MQ9 F;  5ILS A;  3HRT A;  5IT9 Z;  2D45 A;  4KMU X;  3RYR A;  2YU3 A;  3ERE D;  2YSR A;  2KJB A;  3SZT A;  2PI0 A;  3HSR A;  4FT8 A;  1JE8 A;  1IXC A;  2H27 A;  2R3S A;  3NRV A;  1TLH B;  4ENK A;  2LF8 A;  2VT3 A;  3JW4 A;  2F5F A;  1P2F A;  3R0J A;  1O3R A;  2LF7 A;  3WTV C;  3Q9S A;  1OR7 A;  1O57 A;  1R22 A;  3E3V A;  3TOA A;  4YFX F;  3U2R A;  5LBQ A;  4EJT A;  3K0L A;  3DFG A;  2PG4 A;  1T98 A;  2Q8K A;  3CUO A;  2DAO A;  3QOP A;  2EV5 A;  2JTV A;  1KGS A;  4L9T A;  2MLG A;  3V8J A;  5KVR A;  4ZYH A;  2L3D A;  1IF1 A;  4KYW A;  5DCF A;  2P7C B;  4RGR A;  3CO7 C;  3H3Z A;  2RDP A;  1S8N A;  1G4D A;  3RKY A;  2D1V A;  3DPT A;  1S6L A;  2EJR A;  2UXX A;  2MD5 A;  1FC3 A;  3V8L A;  1B1B A;  3TO9 A;  1S7O A;  4CGZ A;  3ABU A;  2A69 F;  1UHM A;  4KIF A;  2P4W A;  2FBK A;  2RNJ A;  1BIB A;  1LB2 A;  1FP1 D;  3T1B A;  4G7Z F;  4KN4 X;  3ISP A;  2V9V A;  5L3B A;  5D4R A;  2HFH A;  1OPC A;  3ELK A;  3G3Z A;  1DPR A;  1W5T A;  3B73 A;  4UV8 A;  1LNW A;  2K27 A;  4JK1 X;  3GFM A;  3CTA A;  1VTN C;  1R23 A;  2O8X A;  4LLN A;  1KU7 A;  4RB2 C;  1YTY A;  2ZCW A;  1LDJ A;  2BYV E;  1SMY F;  4RGU A;  2OQR A;  5HDG A;  4S04 A;  2DPU A;  2STT A;  2ZNZ A;  1QGP A;  2PEX A;  3WE2 A;  4RGX A;  1IRG A;  2ZO4 A;  4RGS A;  2WC2 A;  5ICG A;  1F5T A;  3FM3 A;  1G3T A;  3QAH A;  2KIM A;  1P4X A;  4BYY A;  2JPC A;  2CQK A;  3IKV A;  1CGP A;  2YX4 A;  2PN6 A;  4ASN A;  1YW7 A;  4LB6 B;  4GCV A;  1HKS A;  5BOX A;  5D5W B;  3DQV C;  2EK5 A;  3GF2 A;  4HW0 A;  1JGS A;  2QYO A;  2Q0O A;  3J80 Z;  2BGC A;  2M87 A;  4PGG A;  2XVC A;  3K1P A;  4HDU A;  5D5U B;  1S7A A;  3DP7 A;  3FMS A;  4K2E A;  3NEU A;  2VE9 A;  2M45 A;  1SAX A;  3KCC A;  3FMR A;  2FBI A;  5HS8 A;  2GXG A;  1FYK A;  2VBY A;  2R7D A;  5D8L B;  4A6E A;  1RZ4 A;  4IRI A;  4L5I A;  1SFU A;  1K6O A;  2O61 A;  2H6C A;  1LEA A;  3FM5 A;  3P9C A;  5E1Z B;  2GIV A;  2CSO A;  3WGG A;  3IKT A;  4I01 A;  3OV8 A;  1BC7 C;  2MH2 A;  4PDK A;  2E7X A;  2ETH A;  5H20 A;  3RI4 A;  2NNN A;  2AXL A;  1WQ2 A;  2ESH A;  2FU4 A;  1IW7 F;  1FP2 A;  1BOA A;  2G7H A;  1WKM A;  3FX3 A;  3QPH A;  1KU3 A;  3EYY A;  1BN5 A;  2A07 F;  1Z9C A;  5J6X A;  3I5U A;  4KFC A;  5CVV A;  3MZY A;  4PGH A;  2NRA C;  1HKQ A;  3L09 A;  1KA8 A;  4A6D A;  2XGX A;  4R1H A;  2IP2 A;  2QBY A;  2M1B A;  1J2X A;  1PP8 F;  2UWM A;  3VB2 A;  3VOD A;  4IRH A;  4EM0 B;  1E17 A;  5HDN A;  4EJU A;  3VOE A;  4HYE A;  1BC8 C;  1KU9 A;  3DF8 A;  4EV0 A;  2MBF A;  3RTR A;  3JSP A;  4LMY A;  1J7K A;  4CIC A;  2QVO A;  1XGM A;  5BPD A;  2CYY A;  4RB1 A;  3LA7 A;  4CDG A;  1O7F A;  3KP7 A;  3HYI A;  4HF1 A;  5ED4 A;  1MZB A;  1MDM B;  3N4M A;  1Q1H A;  2MC3 A;  1V3F A;  3DV8 A;  4XBF A;  2CWE A;  5E8G A;  4IJA A;  1XD7 A;  4O3M A;  1TQP A;  2AS5 F;  5H6R A;  2WTE A;  4FHT A;  4HZF A;  5DCM A;  4DNC A;  4F7Z A;  3I54 A;  2PBI A;  4BHC A;  5FB2 A;  4OMZ A;  6PAX A;  3GYH X;  3BJ6 A;  3KEO A;  5ICE A;  1KQ0 A;  4CO8 A;  4KA4 A;  4LJZ F;  2B0L A;  4L18 B;  1LDK B;  3IWF A;  3HTS B;  1BI0 A;  1ZAO A;  3M1E A;  3F8N A;  4FX0 A;  4UHT A;  3G73 A;  3HRS A;  1YG2 A;  1D5V A;  3WOD F;  2C6Y A;  2K4J A;  3I64 A;  4P96 A;  2P6S A;  2GA1 A;  3PQK A;  3GFL A;  2XAS A;  3IRR A;  5FLX Z;  4IVN A;  1MDM A;  1K79 A;  4YIF A;  1B59 A;  1R1U A;  1SD7 A;  3PFI A;  2O6G E;  4U0Y A;  2W84 A;  2A5Y B;  1ZG3 A;  5K5O A;  1F1Z A;  2EA4 A;  5LGU A;  1LVA A;  4L0Z B;  2QLZ A;  2DQL A;  2FE3 A;  3M8F A;  1R1V A;  5FLX K;  3LQQ A;  3E5X A;  1A04 A;  4KIG A;  3BJO A;  3RJP A;  3J81 K;  5FFZ A;  3P7N A;  2M5W A;  4M73 A;  4Z2Y A;  1EH6 A;  3LA3 A;  3U9G A;  1G3S A;  2OZ6 A;  1BI2 A;  3GLX A;  1SD5 A;  1BBY A;  1TBX A;  4HV5 A;  4AIJ A;  4FX4 A;  2HGC A;  2D2W A;  3GO5 A;  1K7A A;  1H9G A;  1H0M A;  1FOK A;  5HVQ C;  2JPB A;  2W85 A;  3BDD A;  1YQA A;  3ZMZ A;  1PP7 U;  4EGZ A;  3F6V A;  2RN7 A;  3GFI A;  1RI7 A;  4LLG F;  1DUX C;  3ULQ B;  1B9N A;  2EFQ A;  1EV7 A;  4IRG A;  1J0R A;  4XSZ F;  1QZZ A;  4A12 A;  5CJ9 A;  2E1C A;  3I58 A;  2XHK A;  4ZZD A;  3F8M A;  5LGN A;  3C7J A;  4U7B A;  2HDC A;  3WE3 A;  2WWY A;  3DEU A;  4WF2 A;  3F23 A;  3ZN0 A;  2V79 A;  3F22 A;  1LEB A;  1OMI A;  3WGI A;  2KKO A;  3K2Z A;  2LKP A;  4OMY A;  3FXU A;  2EFP A;  1FT9 A;  3SQN A;  2CFX A;  1BI1 A;  2W25 A;  3P9I A;  2H94 A;  3PQJ A;  3V4G A;  4GGG A;  2HQR A;  4DQ2 A;  3JSO A;  2XAJ A;  3EUH A;  4I98 B;  3R60 A;  1FBU A;  2PJP A;  2O3F A;  1Y0U A;  2IA0 A;  2VOD A;  4LB5 A;  3IL2 A;  2P7V B;  3M9A A;  1YYV A;  5DD4 A;  1FYL A;  1XN7 A;  3WU0 A;  2QQA A;  1HKT A;  1UB9 A;  3JAM Z;  2CW0 F;  2XV4 S;  3HRU A;  5AIP A;  5L3E A;  4CYD A;  3E6M A;  3FHZ A;  2HR3 A;  4PZJ A;  3CO6 C;  4U7D A;  1XDU A;  3WTY C;  3GWZ A;  1BM9 A;  2NAZ A;  4UUV A;  3ZMU A;  4ESJ A;  2CO5 A;  1FZP B;  3DKW A;  3ZMD A;  3LAP A;  5FGM A;  2GXB A;  1HST A;  2FML A;  4XRF A;  5HS7 A;  3FZV A;  2DBB A;  3I53 A;  4UXN A;  3QU3 A;  4KT5 C;  1CF7 B;  1UCR A;  5BQT A;  3NQO A;  1QBJ A;  2A61 A;  4WK8 F;  4HX4 A;  3OOP A;  4G9Y A;  3RIR A;  5E1W A;  1TQM A;  2VC1 A;  5D6F A;  3GX4 X;  5CVI A;  2E7W A;  2DPD A;  3E6D A;  1H9T A;  5BS6 A;  5IT3 A;  4EQQ A;  1K78 A;  1AWC A;  1IN5 A;  4Q5S F;  2XUB A;  5D4S A;  2A6E F;  3KE2 A;  3WTU C;  1MJB A;  4HAM A;  1I5Z A;  4ZYD A;  5CYV A;  1L0O C;  4OIR F;  1OKR A;  5LLQ A;  4M6X A;  1FBQ A;  1FY7 A;  2HYG D;  5ICC A;  1P92 A;  4ZYE A;  2X4H A;  4BHB A;  1R36 A;  1Z7U A;  3RDI A;  2P5K A;  3O2P E;  1E2X A;  1OYW A;  2JSC A;  1R00 A;  3KET A;  2IPQ X;  1L3L A;  1FYM A;  4EJO A;  1QO0 D;  1LQ1 A;  2A68 F;  4AIH A;  2VBZ A;  1QNT A;  1XSV A;  2RGV A;  1ULY A;  3MFK A;  2HTS A;  2FQ3 A;  2KRF A;  2MA3 A;  1ZRE A;  3H3U A;  4N9I A;  3TQN A;  1V4R A;  4A5M A;  1R7J A;  3GEZ A;  1ONV A;  4ETS A;  3GVA A;  1QZY A;  3F72 A;  2FXA A;  3JAM K;  3S2W A;  1HW1 A;  5AON A;  1ON1 A;  4O6J A;  1PUE E;  2K7L A;  5DUK A;  2Y48 A;  4BNC A;  3CUQ A;  4AWX B;  3SZP A;  2FF4 A;  1W4M A;  4WXH A;  2VBX A;  4Y15 A;  5FO5 A;  1B4A A;  2QQB A;  3EQL F;  4A0X A;  2L4A A;  4MGR A;  2GQQ A;  1U78 A;  1J75 A;  1MJA A;  5DEQ A;  5JR3 A;  4HA8 A;  2OQG A;  1HW2 A;  4BAY A;  1LDD A;  1BIA A;  3IC7 A;  1I6X A;  4G6D A;  3MQ0 A;  5A2Q K;  3WG9 A;  3ZMT A;  2Y75 A;  3D5L A;  1Z6R A;  5AIQ A;  3M7G A;  4Y13 A;  4XSX F;  1U3E M;  1T2K A;  3KP4 A;  1O3Q A;  3WTS C;  5E17 F;  1SFE A;  3QPT A;  2ADU A;  2O03 A;  4M9S A;  3L00 A;  5BPI A;  3ZPL A;  4HBL A;  3HIF A;  1UST A;  3CUQ B;  5E18 F;  4NB5 A;  4KUM A;  2OA4 A;  1I1S A;  4I02 A;  3HUG A;  4N0B A;  1XB4 A;  1I27 A;  3QU6 A;  3COA C;  2Q2E A;  2HS5 A;  5E1X A;  5LRR A;  3L7W A;  3TGN A;  1YW8 A;  5BMZ A;  2FSW A;  3EYI A;  5L3D A;  2BEO A;  1IN4 A;  1Z6T A;  4RAZ A;  5TRD A;  3BPX A;  3I59 A;  4U88 A;  3HOS A;  4Y17 A;  2H09 A;  2LNB A;  2QUF A;  1LJ9 A;  3SXY A;  5JFR A;  2WV0 A;  1X3U A;  1U5T A;  5HOO A;  3K69 A;  3KP3 A;  1GXP A;  4YII A;  1RUN A;  1YS6 A;  1KYZ A;  1UHW A;  3GFJ A;  4NHJ A;  1DP7 P;  3TDZ C;  2UZK A;  2ZXJ A;  3V8K A;  3Q5F A;  5DUI A;  1FWZ A;  4LG0 B;  5FD5 A;  3QP6 A;  5HS9 A;  2K02 A;  4OU0 A;  4P9U A;  2QM3 A;  2BV6 A;  3GUD A;  1GVJ A;  4IHS A;  2VE8 A;  3E5U A;  1K78 B;  3REO A;  2DU9 A;  4EMS A;  2K86 A;  4KNY A;  4LG0 A;  1U5T B;  4U0W A;  1HSJ A;  2DK8 A;  5D5V B;  5TJJ A;  4WXD A;  4P9F A;  1RUO A;  1IN8 A;  2IW5 A;  3CDH A;  3I59 B;  2TDX A;  2A3S A;  2Z5U A;  4PCQ A;  5HLI A;  3ML6 A;  3WU1 B;  1CF7 A;  2YX7 A;  2GA2 A;  3LQR A;  2XRN A;  2M30 A;  3E5Q A;  1F4K A;  1GXQ A;  1SD6 A;  3K9T A;  4AD9 A;  3KZY A;  5HLH A;  3FF5 A;  1ZLK A;  3IHU A;  3RPQ A;  4M71 A;  4UVC A;  1OYI A;  1IAW A;  3AAF A;  4A5N A;  2VT2 A;  4M74 A;  2ZFW A;  3F3X A;  1YW9 A;  2EFO A;  2CGP A;  3I71 A;  3TOB A;  2NYX A;  1R5H A;  2ACJ A;  2F5E A;  4G6Q A;  4IF4 A;  2XAH A;  2DI3 A;  1ZHF A;  4LGW A;  1JHF A;  1TQI A;  3GW2 A;  1C0W A;  1I1G A;  4B8X A;  2EA2 A;  2Z3Y A;  2ZME B;  1G3W A;  2P8T A;  2ESN A;  1D8K A;  2XRO A;  2OU2 A;  4OOI A;  5EEH A;  3K1N A;  3VFZ A;  1USS A;  1BJA A;  1YO5 C;  3GXO A;  1T6S A;  3KLN A;  3KLO A;  3GZ6 A;  2DO7 A;  1ZRF A;  1QPM A;  3HHG A;  1MJ9 A;  3ZMS A;  2F5C A;  2P5V A;  2FNA A;  3WTW C;  4BHP A;  4GO1 A;  5LEK A;  2D1H A;  4U0V A;  1IN6 A;  2UXN A;  2W57 A;  1YIO A;  4BXU A;  2VN2 A;  2H6B A;  1WWX A;  3C1D A;  2L4M A;  3CLO A;  2FA5 A;  2FNP A;  5DYM A;  3ZMV A;  5D5X B;  5J8F A;  4S05 A;  1OYY A;  1P6R A;  2P6T A;  3SFZ A;  4YFK F;  1XMK A;  4A0Z A;  1U8R A;  3E6C C;  3MZH A;  1R5G A;  3FWE A;  2NS0 A;  1KQ9 A;  2FBH A;  2IT0 A;  4QLC U;  2HQN A;  1W7P A;  3MWM A;  1XCB A;  3MEX A;  4AIK A;  3V7R A;  1ZGJ A;  1SD4 A;  4M6Y A;  4TV7 A;  3CUQ C;  4EJV A;  1DPU A;  2L01 A;  1TNS A;  4OIP F;  1EH7 A;  1RNL A;  1HBX G;  3R6S A;  2JT1 A;  2QWW A;  4ON0 A;  2EWN A;  5KK1 A;  1IN7 A;  2EB7 A;  1HXD A;  1XCV A;  3ZQ7 A;  4EM2 A;  2PMH A;  2ZNY A;  3HRM A;  4I09 A;  2GAU A;  4I0B A;  3BOQ A;  3ZP5 A;  1XMA A;  2P5L C;  2HOE A;  1G3Y A;  2Z9O A;  3J81 Z;  4G7O F;  3RPU A;  2IA1 A;  1Z05 A;  2VXZ A;  3KFW X;  3LA2 A;  4I2O A;  2EFN A;  4KMF A;  1IRF A;  3N97 A;  3BY6 A;  4G8X A;  3E6B A;  1PDN C;  5L3F A;  2ZKZ A;  1QQI A;  3ABT A;  3WTX C;  3W6J B;  3C18 A;  4O5V A;  3W6K B;  2Y0M A;  5FD6 A;  5JVT A;  4G94 A;  1P4W A;  4WX9 A;  4L0Y B;  2OD5 A;  1ZLJ A;  3FXR A;  1B9M A;  5ILU A;  5EEG A;  2VOP A;  1S29 A;  2BBY A;  4KN7 X;  2A6H F;  4HLY A;  5ILV A;  3MCZ A;  4HX8 A;  1O3S A;  2V1D A;  4XLN F;  1Z91 A;  4KIC A;  1ZH5 A;  2YPR A;  2DW4 A;  2EV6 A;  5L3C A;  1R1T A;  5ICF A;  1FSE A;  5F6F A;  1G6N A;  2DQR A;  3SHF A;  1TTY A;  1S3J A;  1FLI A;  2IVM A;  2FOK A;  3RKW A;  2HWV A;  2M8E A;  3KP5 A;  3LST A;  3GZ5 A;  3QP5 A;  4HLX A;  2EFW A;  4CHU A;  1WSU A;  1W5S A;  1ZG1 A;  2DTR A;  2L54 A;  4HQE A;  2HKO A;  2V6C A;  3EET A;  1IXS B;  1FNN A;  4MEX F;  2HYF A;  2KIF A;  5DV5 A;  3F8F A;  5LRS A;  3TKY A;  4YG2 F;  2RC4 A;  3F8C A;  1KYW A;  4HX7 A;  4Q4Z F;  1SFX A;  4G7H F;  2K4B A;  3VEP A;  2DFI A;  1ZN2 A;  4GYI A;  2PQ8 A;  5K1Y A;  3Q9V A;  5D6E A;  4JQF A;  5LGT A;  3WTT C;  3BJA A;  1EH8 A;  4R79 A;  3LFK A;  5E8I A;  4H0E A;  5LHH A;  1UFM A;  1J9I A;  3HHH A;  5F64 A;  3F8B A;  5CVU A;  4GYG A;  4KIB A;  4EVI A;  2PLY A;  4B09 A;  3ECH A;  1ZGA A;  1SMT A;  4OIN F;  2IJL A;  4I0A A;  1U2W A;  4ZZL A;  2ISY A;  4NQW A;  3J7A O;  2QEN A;  4RB3 C;  3D0S A;  1NHA A;  2DLL A;  3BZ6 A;  2F2E A;  1XSX A;  2GZW A;  1IUY A;  1XDS A;  2QQ9 A;  4XLP F;  4RAY A;  3L9F A;  2V1X A;  3HSF A;  2X0L A;  3BWG A;  3DPL C;  4M72 A;  2XKO A;  2OZU A;  4LK0 F;  1T0F A;  1J5Y A;  3K1M A;  2RQP A;  3EDP A;  1U6G A;  2ZJ2 A;  3HTU A;  4KDP A;  3LAJ A;  3ROU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...