1I1SA

Solution structure of the transcriptional activation domain of the bacteriophage t4 protein mota
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
96
structure length
96
Chain Sequence
b'MSKVTYIIKASNDVLNEKTATILITIAKKDFITAAEVREVHPDLGNAVVNSNIGVLIKKGLVEKSGDGLIITGEAQDIISNAATLYAQENAPELLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MOTA
publication title Solution structure of the transcriptional activation domain of the bacteriophage T4 protein, MotA.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Transcription
total genus 21
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2001-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09114 MotA_activ Transcription factor MotA, activation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1i1sA00
1HKSA 2A6HF 2V1XA 1AOYA 3BY6A 3V8JA 2M8EA 3M8FA 2QYOA 5K5OA 5FGMA 3HOSA 1MZBA 1RZ4A 1ZRFA 2GZWA 1W5SA 3H3UA 1YW9A 2CGPA 2Q2EA 3FM5A 1FYLA 2UXXA 3WU1B 1J7KA 4L5JA 1CF7B 5HLHA 2FBKA 5K5QA 2DU9A 2KJBA 1OMIA 1FPQA 1WI9A 2EK5A 4B09A 1X3UA 1XGNA 2VODA 1XDUA 1IXRC 2JTVA 4HV6A 1CF7A 4PCQA 4RGXA 3F21A 3RJPA 3Q9VA 3ROUA 1QZYA 2ZBKA 3RDIA 3ZMTA 4S04A 1SFEA 1R00A 3VOEA 1FWZA 3E6BA 1KQ0A 4P96A 3IRRA 2A69F 1K78B 4GXOA 2XV4S 3FMQA 2HZTA 2IW5A 2V9VA 3FMSA 3ABTA 3ULQB 1XCVA 1DPRA 4GYIA 1K78A 5D5WB 3WTXC 4QWQA 5F64A 5FO5A 4WK8F 1JGSA 1XGOA 3WE3A 4G7OF 3TDUC 2ACJA 4OMZA 4L9NA 1QZZA 1BI2A 2BBYA 2A68F 1IRFA 3FF5A 3IWFA 1FSHA 3TO6A 1MDMB 4UVBA 5FB2A 3DKWA 4MGRA 3FHZA 3PQJA 1HBXG 1IN5A 1UCRA 3U9GA 1XGSA 4FX4A 1KQ9A 5JFRA 2RKHA 1QQIA 2EB7A 3JSPA 2HQRA 2VOPA 3WTYC 2VE9A 3FM3A 3DF8A 2IPQX 3QU6A 1Z9CA 3GW2A 3WU0A 1GXPA 2HR3A 1IF1A 1G3YA 2K86A 2DPDA 2BE5F 3T8TA 2HWVA 1XSVA 3GFLA 4OINF 1ZG5A 4Q48A 3R6SA 4CZZA 2LNBA 2ZNYA 4K2EA 1DP7P 2JPBA 4IRHA 1HW2A 2GA2A 5ERIA 2EWNA 5D5XB 1SAXA 4ZZDA 3RYRA 2QQ9A 3ECHA 3LA2A 3JAMZ 3DV8A 4XBFA 1ZREA 2NRAC 4LLLA 3MWMA 2FNPA 1S7AA 4ZYHA 4WX9A 2FNAA 3K69A 3M7GA 3KLOA 1FLIA 2HFHA 2EFWA 4ENMA 4RS8A 4OMYA 4KMFA 1OYYA 3ZN1A 1E2XA 2ZMEB 1HW1A 2GAUA 2HGCA 1ZARA 3DP7A 3L00A 4KNYA 1BC7C 4LB5A 5E20A 2W84A 4O6JA 5BQTA 4WCGA 4G7HF 1YTYA 2F5FA 2W57A 1STZA 1ULYA 2ZMEA 1HKQA 3HHGA 2OD5A 4L9TA 5D4SA 1U5TB 2DQLA 4YFNF 5JHUA 1H9TA 2XROA 4DNCA 3L7WA 1IAWA 1LEBA 2ZKZA 2FXAA 2BYVE 2H6CA 3I0TA 2YU3A 1ZLJA 3V4GA 1F4KA 1U5TA 1USSA 4JK1X 2O8XA 3ABUA 1J59A 4IXAA 1S8NA 2CW0F 3CO7C 2P7VB 2E7XA 3W6JB 1LNWA 2EFOA 1R1TA 1O3TA 1XMAA 5HS7A 4HQMA 1OR7A 3LSTA 3BPXA 2MH9A 4A2UA 1T98A 3ZPLA 4EGYA 2G7HA 1D8JA 5CVIA 5DCFA 4Z2YA 3D0SA 2Z99A 1XSXA 2KRFA 3K9TA 3O6BB 1ON2A 3AAFA 4IRGA 4U0YA 3WTUC 3M1EA 1ZN2A 5CVUA 4AVPA 3FX3A 3GZ5A 2EFQA 3TO7A 4KIBA 1T2KA 5CLSA 3U1DA 4LK0F 2NNNA 2JZYA 4YIIA 1HW5A 3TOAA 3P9KA 2LKPA 4KMUX 1AWCA 1OPCA 1PP8F 1ZH5A 3IKVA 5ICCA 1REPC 3OOPA 4CHUA 2AXLA 4WXHA 2QZ8A 2HOEA 3DFGA 2C6YA 2QWWA 4PDKA 4OIOF 3KEQA 3F8NA 2M1BA 3GVAA 3K1MA 4UVAA 1SFXA 3IL2A 1ZG3A 3E6MA 1FBSA 4BXUA 2WC2A 2XIGA 1LB2A 5ICGA 4M9SA 5DDGA 1SD5A 4ESJA 2VT3A 2IP2A 2Y0MA 1MD0A 3J81Z 5E1XA 2A6EF 3RPQA 3V8LA 2L54A 4HZFA 3F22A 3Q5FA 3K2ZA 3MEXA 2OZ6A 5CVVA 5K1YA 3M8EA 1BIBA 3RKYA 1XDSA 3HRTA 4N9IA 4O3MA 1R1VA 1GVJA 2H94A 3CDHA 2HKXA 3R0JA 1B59A 2VT2A 4M71A 4EVIA 5L3DA 4CXFA 1S7OA 1A04A 1P4WA 1B1BA 4N0BA 3ECOA 1RUNA 4A6DA 4ENNA 1VTNC 3ISPA 2IA0A 1IXSB 1PUEE 3WGIA 4ZYDA 5F6FA 4EM0B 2YX4A 5HLIA 2CO5A 2K4BA 4Q47A 5ILVA 4R8HA 4CYDA 5A2QK 4A0ZA 1WQ2A 1SD7A 4WF2A 1BI1A 5E1WA 1G6NA 2ELHA 1JHHA 3PQKA 2R7DA 2IJLA 1Y0UA 3KP4A 2XAJA 4I0BA 4FX0A 3JW4A 1RI7A 4GGGA 5CVRA 5IT3A 3HRMA 4LJZF 2XAFA 4A12A 1KU9A 3M9AA 3TDZC 4QLCU 3NRVA 4AIKA 1TQIA 2D1VA 1SD6A 3I58A 3N97A 1LJ9A 3F6OA 4BHCA 4ON0A 1IRGA 1KU2A 2PQ8A 1R5GA 4S05A 4KICA 4LLGF 2H27A 1BIAA 3Q9SA 3BP8A 2FF4A 2H09A 1J0RA 4OU0A 3KETA 4HYEA 4GCVA 3VEPA 3ZP5A 4NHJA 2XASA 4R1HA 1QNTA 4IPAA 5ICEA 1F1ZA 5IT9Z 4M74A 2P6SA 1QGPA 1B6AA 3P7NA 2PI0A 3CUQC 5FD5A 4ETSA 1FSEA 2HTJA 4HX7A 4LGWA 1PP7U 3DPLC 4IJAA 5DYMA 2AS5F 1KU3A 5J8FA 2Q0OA 4U88A 4ESBA 4EJVA 2KIFA 4U0WA 2FBIA 2DT5A 3I5UA 3MZHA 3E5QA 5CJ9A 2RGVA 3QP5A 3B02A 2FMLA 3GXOA 1FT9A 1GXQA 5E8GA 5LGUA 3SHFA 3F8MA 2PFBA 3V7RA 3DXJF 5D6FA 1OKRA 2M87A 1IXCA 1XN7A 3R0AA 2IVMA 1ODDA 4BH9A 2OAZA 3GX4X 5AIQA 2DAOA 2FEZA 5KVRA 2ISZA 4HV5A 3O2PE 3KEOA 3KP6A 4BHBA 3H3ZA 5E1ZB 1YO5C 5LGTA 5TRDA 2O6GE 1E17A 1T0FA 1KGSA 4HF2A 3TO9A 4LG0B 5LHGA 4P9UA 3LAPA 1FBQA 2QLZA 2RC4A 3BZ6A 4A0XA 3F3XA 3ZMZA 2VC0A 1MGTA 4I09A 2X4HA 5HLGA 1D8KA 4EJOA 2EFPA 2JSCA 4LG0A 1NHAA 3I64A 2DI3A 1T38A 4A5NA 4M6XA 1T39A 1K7AA 3SZPA 4XSXF 5HS9A 3IC7A 4HA8A 1MJBA 3L2CA 1TW2A 1I6XA 5JR3A 4YIFA 1OYWA 3ELKA 1KU7A 2DO7A 5L3GA 5A2QZ 3W6KB 3RPUA 5HDKA 2NYXA 1V3FA 3IWZA 1J5YA 4KIGA 1WSUA 4RB3C 5LBQA 3HTSB 4MTDA 5ILSA 4ENJA 2L02A 4HBLA 2J5OA 3J80K 1TQPA 4L9JA 2CSOA 4KFCA 3RIRA 1OYIA 3BPVA 1W7PA 1ZHFA 3GFMA 1U78A 3COAC 1R22A 4HAMA 1HQCA 2IT0A 3BJAA 2WV0A 5K5RA 2F5DA 2YSRA 2OQGA 1FZPB 2STTA 2VBZA 1EV7A 2KIMA 2P8TA 4Y17A 4JQFA 1IN6A 1TLHB 4ZZLA 2OU2A 3EDPA 3PFIA 4BQAA 2Y75A 4G94A 3K1NA 4BAYA 3JTGA 2ZNZA 2L3DA 1EH6A 3HOTA 1YYVA 5F1RA 4CICA 3HRUA 1J2XA 3IHUA 1YIOA 4HX8A 4A0YA 4LFUA 2E7WA 4FHTA 5LEJA 4YG2F 1LQ1A 4RB1A 1UHWA 1MJ9A 4A5MA 5BMZA 4CO8A 2JT1A 3IKTA 1B9NA 2KKOA 2QM3A 5L3BA 1MKMA 2EV5A 3SQNA 5DD4A 3MAJA 4I2OA 1Z1DA 2CYYA 5ICFA 2QQAA 2MLKA 3LFKA 2ZO4A 3GWZA 3RKWA 2A5YB 2LF7A 2K7LA 4KYWA 2MBFA 1ZGAA 4UUVA 1YS7A 5FLXK 2K4JA 2V1DA 2O3FA 4G6QA 3GFJA 4HLYA 1LDDA 3HSRA 3ZMDA 1RNLA 3GEZA 4P5OA 4G8XA 4RB2C 2QQBA 1S29A 4B8XA 1Z05A 3RYPA 5LRSA 3MQ0A 4KT5C 3CUQA 2WWYA 2OZUA 4RB0A 4R79A 2O0YA 3TKYA 2RQPA 3I53A 3RTRA 2VOOA 1EH8A 2FRHA 1FOKA 4I02A 1IUYA 2IRFG 4EJUA 4DQ2A 3KCCA 1KA8A 3C3WA 2HDCA 6PAXA 3C1DA 3KP3A 2W25A 1FYKA 5KK1A 5HS8A 2E1CA 1ZLKA 5DUKA 3E3VA 2ESHA 3G3ZA 1B4AA 4UVCA 1BC8C 5CVJA 1KQ8A 4NB5A 3LWFA 1I1SA 4KDPA 3P9CA 3RI4A 3ERED 3FXRA 3HIFA 2D45A 3FZVA 4MEXF 4EJTA 1W4MA 3E5UA 3CTAA 2EV6A 2EV0A 1TNSA 1BN5A 4AD9A 1D5VA 3T1BA 1QPMA 2MC3A 1LVAA 2VBWA 1HSJA 3TGNA 2STWA 3WTVC 4ESFA 3WTWC 1ZGJA 1Z6TA 2GQQA 2PN6A 1WKMA 1FNNA 2P5VA 3HSEA 2UXNA 2RDPA 2M30A 5LHHA 3HSFA 4XLNF 4P55A 1CGPA 2XAGA 3BWGA 3CLOA 4HLXA 5DD8A 1FP2A 4OIRF 3V7SA 2ESNA 3DEUA 2FSWA 4I01A 4HW0A 3LA3A 2BV6A 5LGNA 4EGZA 1XB4A 3BOQA 1O7LA 1HXDA 4MTEA 1O7FA 4O5VA 1TTYA 4M6YA 4KIFA 5FFXA 4CDGA 4XRFA 2O61A 4IRIA 2EA2A 5J6XA 1ZRDA 3CJNA 5DEQA 2IA2A 2QBYB 2Z3YA 2Z9OA 2XRNA 1XGMA 2YPRA 1C0WA 4U7BA 3WTTC 1DDNA 1FYMA 5D4RA 2E1NA 3KLNA 4MQVA 2PMHA 2QBYA 5DV5A 1L3LA 2OQRA 1U2WA 3FMRA 4HDVA 4LD5A 3JTHA 5H6QA 2MA3A 2F5CA 2A07F 3VB2A 5DCMB 1FY7A 2L01A 1F9NA 4L0YB 1R36A 2IA1A 4OIPF 3FXQA 4BYYA 3DQVC 3KZZA 1O57A 2GWRA 1LDKB 5EEHA 3JAMK 5DCMA 4ZH4F 3EUHA 2XKOA 1P4AA 3ZMVA 4CGZA 4IVNA 3HTUA 3E97A 2XGXA 2VE8A 4EQQA 1Z91A 3R4KA 2XAQA 3F23A 1R7JA 3C18A 2CFXA 4KN4X 1IN8A 2F2EA 1FC3A 1T6SA 4MEYF 2CG4A 1BI3A 3BROA 2UZKA 1BOAA 1U3EM 1YFHA 3WGGA 2FBHA 5BPIA 4WXDA 3I59B 2ADUA 3F8FA 2O03A 4XLPF 2Y48A 1U5TC 4Y15A 2MD5A 1ZRCA 4M72A 1P4XA 1F5TA 1YLFA 3KFWX 3H92A 3I59A 1YS6A 5HVQC 5D5VB 2COMA 1P6RA 2ETHA 2NS0A 1XD7A 1YG2A 1W5TA 3L9FA 1D3YA 5TJJA 5E8IA 4HQEA 1FX7A 2L4AA 4YFXF 4LMYA 2V79A 1FBUA 1U6GA 2JPCA 1MJAA 3WE2A 4EV0A 4E70A 4UV9A 5L3EA 4IF4A 5J8CA 4EJWA 2V1UA 2CWEA 3BJ6A 4AIHA 2OA4A 4RGUA 1O3SA 5LLQA 1ONVA 1G4DA 1I27A 2JRTA 3KZYA 1BBYA 5ILUA 2HQNA 3U2RA 3QPHA 4UV8A 4A6EA 5EEGA 5ED4A 2X0LA 4BHPA 1GHCA 3SZTA 3WGHA 2PJPA 3T8RA 4ZYGA 4D0PA 1P92A 2M5WA 1O3RA 3GUDA 4G6DA 2OBPA 2WTEA 1YW8A 5BPDA 4HX4A 3VFZA 3F8BA 5FD6A 4LLNA 3J7AO 1TBXA 3VODA 4OOIA 1EH7A 4IHSA 2M45A 3QRFF 4M73A 4H0EA 1LDJA 2L4MA 1RUOA 2ZCWA 3S2WA 2F5EA 2XHKA 3I71A 3I54A 4KUMA 2ZJ2A 2ISYA 2DBBA 2R3SA 3EYIA 4LB6B 3BDDA 4AIJA 4NQWA 1R5HA 4PGGA 4P9FA 2EJRA 5JI6A 1MDMA 3NEUA 4XSZF 3K1PA 4U0VA 4HF1A 1FP1D 1SMYF 2BEOA 2RN7A 1V4RA 2XAHA 4HOBA 4EMSA 4WWCA 3WG9A 3GLXA 5BS6A 1P2FA 1W7PB 2DW4A 1I1GA 5D8LB 2ZXJA 1UB9A 2W24A 1ZYRF 1PDNC 2PLYA 5LHIA 3KP2A 3J81K 3F72A 3R61A 2PEXA 3V7CA 2LDUA 5D6EA 1IN7A 3TQNA 1K79A 1G3TA 1J9IA 3BJOA 3EQLF 2MH2A 3GFIA 2ZFWA 4KA4A 2RV8A 5LRRA 4MHGA 3MZYA 1USTA 5E18F 1H9GA 3JSOA 1Q1HA 2W85A 2D1HA 1Z6RA 5E17F 1I5ZA 5L3CA 4F7ZA 2K02A 1WRJA 3HHHA 5CYVA 3T0YA 1BM9A 3B73A 4HDUA 3EYYA 1QBJA 1H0MA 3SFZA 3LQQA 2RVCA 2GIVA 2PBIA 4HF0A 4FT8A 2V6CA 4JBAA 2QVOA 3F8CA 1L0OC 2HYGD 3ML6A 3R60A 1XSDA 2K27A 2XUBA 2P4WA 2A61A 5D5UB 2DQRA 3GF2A 5AONA 1TQMA 3MFKA 1ON1A 1ZAOA 1B9MA 2G9WA 4ZYEA 2VXZA 4RGSA 3CUQB 2RNJA 4AWXB 3QAHA 4N9HA 3V8KA 3ZMUA 3D5LA 4KN7X 3GZ6A 2GXGA 4PGHA 5HOOA 1SMTA 5JVTA 1ZG1A 3P9IA 1S3JA 1R58A 1TW3A 1SD4A 2G7UA 3N4MA 4RGRA 2HKOA 1QO0D 5L3FA 2LF8A 2EA4A 2EFNA 1HKTA 2FA5A 2MLGA 3T5XA 3QPTA 2DLLA 2NAZA 2DK8A 2J5PA 2UWMA 3LA7A 4M9ZA 2Z5UA 5LEKA 2XKPA 2YR2A 5HDGA 2P6TA 3FWEA 3OV8A 3WODF 3QP6A 4MQ9F 5FFZA 4I98B 5IT9K 1YQAA 3RKXA 3KE2A 4ENKA 3WTSC 5BOXA 5D8KB 2P5LC 1JXSA 1W7PD 3E6DA 2HS5A 2Z33A 2FE3A 1G3WA 5HDNA 2DFIA 4RAZA 4IHTA 4EM1A 2A3SA 3KP7A 4OIQF 4UHTA 1U8RA 2CQKA 4EM2A 2D2WA 4TV7A 4L0ZB 1BI0A 3QU3A 1UFMA 1R23A 1UHMA 2XVCA 2B0LA 3ZQ7A 1G3SA 1DUXC 2TDXA 4MNUA 2H6BA 4M9XA 3SXYA 3QOPA 3FXUA 3EETA 2P7CB 1LEAA 2YX7A 1DPUA 4Q5SF 3F6VA 4Q4ZF 3REOA 2QENA 4LK1F 4RAYA 2DTRA 3MCZA 1KYZA 2P5KA 4G7ZF 3IRQA 2NNYA 2HEOA 1R1UA 3I4PA 2R7FA 2FU4A 3NQOA 1K6OA 4UXNA 2FOKA 3GYHX 1WWXA 3G73A 1XCBA 2BGCA 3KP5A 2Q8KA 1HSTA 3J80Z 3HRSA 2VBYA 2HYFA 3CUOA 3ZN0A 4G9YA 2PMUA 4GYGA 4GO1A 2VBXA 4U7DA 2VN2A 3GO5A 4I0AA 2DK5A 2GA1A 4YFKF 2LSOA 3C7JA 1S6LA 4UNOA 3CO6C 3TOBA 3DPTA 4Y13A 2KIUA 5H20A 2QUFA 1Z7UA 2KJCA 1RIOH 5AIPA 4WXCA 2FMYA 3LAJA 2PG4A 2VONA 2DPUA 1SFUA 4I7HA 1IN4A 3K0LA 3HUGA 3L09A 1IZ1A 3WTZA 1IW7F 5H6RA 3O3KA 4L9VA 2VC1A 4ASNA 1J75A 2FQ3A 3ZMSA 1KYWA 4L5IA 3HYIA 1O3QA 5DUIA 4BNCA 3E5XA 2HTSA 2GXBA 4PZJA 1XMKA 1YW7A 5FLXZ 1BJAA 1JHFA 3E6CC 4L18B 1TNTA 1JE8A 3LQRA
chains in the Genus database with same CATH superfamily
1HKSA 4M3EA 2A6HF 2V1XA 4CUGA 1AOYA 3BY6A 3V8JA 3BTLA 2M8EA 2Q2EB 3FXMA 3M8FA 1T08B 3LSGA 3CDIA 4LOCA 2VQHA 4LIVA 2QYOA 5K5OA 5FGMA 4FQGA 3HOSA 3BCAA 1MZBA 1RZ4A 2E35A 1ZRFA 3B6CA 2NVTJ 2GZWA 4XMYA 2O7OA 4ZYAA 1PJRA 5KAIC 1W5SA 4RM3A 2R5YB 2Y0SA 2CU7A 3H3UA 2X51A 2BOLA 4GDFA 1X2NA 5JHFA 3E0JB 1YW9A 1WPKA 2CGPA 4OAZA 3ZQIA 2Q2EA 2VJ5A 1X1AA 3K70C 2XDVA 1TWFJ 3FM5A 5M3MJ 3Q0UA 3IH3A 1LE8A 2MSYA 1FYLA 4HNVA 2UXXA 2KFDA 3WU1B 1J7KA 3CCMI 4L5JA 5LD2C 1CF7B 1QU3A 3LSRA 1ZR2A 3A2KA 4OAYA 5HLHA 2FBKA 5K5QA 2DU9A 5DM6F 2KJBA 1W0UA 2CQQA 2R7UA 1TWAJ 2LLKA 1UZCA 1OMIA 1FPQA 2W48A 1WI9A 2EK5A 1J09A 3VPRA 4BY7J 1X3UA 2ELJA 4B09A 1XGNA 2E5NA 2VODA 1ENHA 1XDUA 1IXRC 2JTVA 1VZ0A 2K9NA 3S1NJ 2DN0A 2DYSH 2W4SA 4HV6A 1CF7A 4BU2A 4PCQA 2EILH 2R7RA 5F0HA 4RGXA 3F21A 3S16J 5M5WJ 3RJPA 3H9JA 3Q9VA 3ROUA 1QZYA 1S7EA 2ZBKA 3RDIA 3ZMTA 2B7EA 3A4CA 2CUFA 4S04A 3H9QA 1SFEA 1PYVA 1E3OC 1IDYA 2BXZA 2HOAA 3RKQA 2R0QC 1R00A 3VOEA 2HU9A 2NXNB 4XORA 1FWZA 4A3LJ 2DDAA 2P0WA 3E6BA 2KHMA 4XLAA 2EIJH 1KQ0A 3CP2A 1E0EA 2DA2A 2A6TA 4P96A 2JWTA 2V4JC 4AU7A 3IRRA 1MBHA 2A69F 3LNQA 1MMNA 1K78B 4GXOA 3BG6A 3OIPA 1YI2I 1P9QC 2QF7A 1WJAA 3DCFA 3TL4X 2XV4S 2O9LA 3PL8A 4M3FA 5HNFA 1AKHB 3H0DA 4PJJA 1UHSA 3C2GA 2HZTA 3FMQA 4PJLA 5IP9J 2IW5A 2V9VA 1UG0A 4HPQA 2K3FA 2KISA 2RNGA 3C2BA 3FMSA 3ABTA 3ULQB 3CJQB 4D1QA 1XCVA 4Z6YA 2M7AA 1DPRA 4GYIA 1K78A 5J40A 2KLOA 5D5WB 2WY8Q 3WTXC 4QWQA 5J1YA 1W0TA 4IQJA 5F64A 3S17J 3K4NA 2X6XA 5FJ8J 1XMXA 2DDBA 1AKHA 4BS9A 5FO5A 4BUPA 4WK8F 1JGSA 3LSIA 2A05A 4C2MJ 4BE1A 5JLWA 1W36D 1XGOA 3WE3A 4G7OF 3TDUC 2ACJA 4ZDPA 1LKXA 4OMZA 4L9NA 4G12A 1YOVB 5J47A 1QZZA 1BI2A 2BBYA 2MG4A 3PJRA 1POGA 2A68F 1IRFA 2IBDA 3FF5A 3IWFA 1KONA 4NQWB 1FSHA 3TO6A 2K9MA 4CH7A 1W5CC 1MDMB 4UVBA 1FMWA 5KAFC 3DKWA 5FB2A 1BW5A 2XPUA 4RLQA 4MGRA 2WBMA 3EUKL 2Y2ZA 3PQJA 3FHZA 1HBXG 1IN5A 5TISC 2KDOA 2QKMB 1K83J 1UCRA 4CCJA 2R92J 3U9GA 1XGSA 2DMPA 3ERMA 4FX4A 1MMAA 1KQ9A 4D7NA 5JFRA 1IUFA 4XONA 2RKHA 1QQIA 1ZR4A 2ZSIB 3L2WA 2EB7A 3JSPA 2HQRA 2VOPA 2FUG2 1BW6A 1WJBA 4B4CA 3WTYC 1UELB 2VE9A 3HOYJ 3FM3A 3DF8A 3OY9A 3W2WA 2HNHA 2MABA 2IPQX 3QU6A 1Z9CA 3GW2A 1CQTA 2VQLA 4II2A 3WU0A 2ZC2A 1QVTA 5IY5H 1GXPA 2WA0A 2HR3A 1VQOI 1IF1A 1G3YA 2RAEA 1JGGA 2K86A 1DGWY 2UUZA 2M7BA 2R7WA 2DPDA 2BE5F 1R49A 2L0KA 3T8TA 3A03A 2DXIA 3QPLA 5EYRA 2M8GX 2GM4A 2HWVA 1ETOA 1X2MA 1XSVA 3GFLA 3I3LA 2BY3A 4A3MJ 4OINF 1ZG5A 4Q48A 3R6SA 4CZZA 2JA6J 3CLQA 2MGQA 2LNBA 2ZNYA 5JVGF 2EZHA 4K2EA 5F04A 1GLNA 1H8AC 1DP7P 2JPBA 4IRHA 4XRMA 4BACA 1HW2A 2GA2A 5ERIA 3BG3A 2EWNA 1ERDA 5D5XB 4A3EJ 1SAXA 4ZZDA 2VJIA 2V7FA 1DU0A 3RYRA 2QQ9A 2LVSA 3ECHA 3LA2A 3JAMZ 3DV8A 3TEDA 4XBFA 2LH9A 2M2EA 1TP4A 1ZREA 2NRAC 4LLLA 2KMUA 3HOUJ 3CZ6A 3MWMA 2WY7Q 2FNPA 1VQ4I 4EATA 5IYDJ 2VIXA 2E36A 1PVEA 3S8PA 3L2VA 1S7AA 4ZYHA 4WX9A 3E1SA 1NK2P 2FNAA 3K69A 4QPQA 3CC4I 3M7GA 3KLOA 2M9HA 2PJRB 1FLIA 3ZQCA 3BR2A 2HFHA 3KYDB 3S32A 2EFWA 4ENMA 4RS8A 4OMYA 4KMFA 1OYYA 3ZN1A 3S2HJ 2JRMA 3C2HA 1E2XA 2R7XA 4HSTA 2ZMEB 3TW7A 4DW6A 2ID3A 3HL2A 1HW1A 2GAUA 2HGCA 1ZARA 2CS3A 2OUMA 3DP7A 3HM5A 3L00A 5M5YJ 4KNYA 2DA4A 2E1MC 1EA3A 4BL0B 1BC7C 2PJRA 4LB5A 4PSWA 5E20A 2W84A 4O6JA 4QIWN 4XQFA 1WCMJ 5BQTA 3EUHC 4KT6A 4WCGA 4G7HF 1YTYA 1LUJB 1VQ6I 2F5FA 2W57A 1STZA 1ULYA 2ZMEA 2F4MB 5E79C 3DBRB 1HKQA 4NDLA 3HHGA 3K7AJ 4X1EA 2OD5A 4L9TA 5D4SA 1U5TB 1SAUA 2DQLA 4YFNF 5JHUA 1WJDA 1H9TA 2AXTC 2LG4A 2XROA 3TBIA 4DNCA 4IHWA 2L2OA 3L7WA 5FKOA 3HKZA 4DZPA 1IAWA 1HC8A 2XGEA 1WI3A 1LEBA 5E3OA 2ZKZA 2FXAA 1D1AA 2BZTA 2BYVE 1I6HJ 2H6CA 3K4JA 1WZ2A 4RA2A 3I0TA 1EF4A 1X1BA 2YU3A 1ZLJA 3V4GA 1F4KA 3G1MA 3ZQLA 1U5TA 4NC8A 3A1YA 3PSFA 5F08A 4IZZA 1USSA 4JK1X 2O8XA 3ABUA 1J59A 4IXAA 2FD5A 2ME0A 4XOPA 1HCRA 4CCMA 1S8NA 3LOCA 3FKIJ 3I4NJ 2CW0F 3K4BA 3CO7C 2EBIA 2P7VB 5BNGA 1Y56A 2JMWA 2E7XA 2DJNA 3W6JB 1LNWA 3G2BA 2EFOA 2Z16A 1R1TA 1O3TA 1MSEC 1XMAA 2KL4A 5HS7A 2NOJB 2E1OA 4HQMA 1OCRH 2CV1A 1OR7A 2F6CA 2F48A 4M3DA 3IUOA 4P1WA 3LSTA 3BPXA 2MH9A 3N05A 4BDZA 2ZB9A 3RSNA 1ETXA 1BR2A 2XRLA 4A2UA 1T98A 3ZPLA 4EGYA 2G7HA 1D8JA 5CVIA 5DCFA 1OFCX 5DTDA 2VKDA 1Y8RB 2JUGA 3D0SA 4Z2YA 5TGTA 2Z99A 4W1UA 2PMZN 2JN6A 1XSXA 2EZKA 2KRFA 3K9TA 3O6BB 1ON2A 4IRGA 3AAFA 1B72B 1JKRC 4U0YA 3WTUC 3M1EA 1ZN2A 1BR1A 3KIOA 5CVUA 4RAGA 4AVPA 4V2FA 1IG7A 3FX3A 3GZ5A 1QA6A 2EFQA 3TO7A 2KDZA 3RQIA 1HLVA 4XN0A 4KIBA 5GAHJ 3WU2C 5CLSA 1T2KA 3U1DA 4LK0F 2NNNA 2JZYA 3D5RC 1Z7LA 2K9SA 4YIIA 4HEA2 1HW5A 3H5AA 1TT0A 1OISA 2ZJRF 3TOAA 1ETWA 3P9KA 2LKPA 4KMUX 2COBA 1AWCA 5C44J 1OPCA 4D9JA 2VJ4A 1PP8F 1ZH5A 3IAS2 1AU7A 3IKVA 5ICCA 1REPC 3OOPA 3OR2C 1IJWC 4XICA 4DBRA 4CHUA 2AXLA 4WXHA 3M3YJ 2QZ8A 2HOEA 3DFGA 2C6YA 2QWWA 4CYCA 3V42A 3CCYA 2KRHA 4PDKA 4OIOF 3UNGC 2EZIA 3KEQA 3F8NA 2M1BA 3GVAA 2VLAA 3FDYA 2LRDA 2W1OA 3K1MA 4UVAA 4X0GA 2R7ZJ 2YS9A 4FE7A 4B47A 4RBOA 1VQ8I 1SFXA 3K4KA 5HNHA 3H5RA 1N78A 3IL2A 1ZG3A 3E6MA 2HQAA 3BZCA 5H2FC 1FBSA 3VDXA 4BXUA 1X4OA 2WC2A 2XIGA 4XM3A 1LB2A 5ICGA 2L7MP 1WGXA 4M9SA 5DDGA 1SD5A 3VSKA 4ESJA 1MNEA 2GOXB 2H1KA 2VT3A 2IP2A 2Y0MA 1MD0A 3J81Z 1UG2A 5E1XA 3GTJJ 2A6EF 3RPQA 3V8LA 1E3PA 2L54A 1QVUA 1FIAA 4HZFA 3F22A 1PUFB 3Q5FA 3K2ZA 3MEXA 4BGDA 2OZ6A 1FTZA 5CVVA 5K1YA 1TWCJ 3M8EA 2GOMA 4EEFG 3A01B 1RKTA 3BG7A 1BIBA 3RKYA 1B8IA 3L1PA 1XDSA 3PO2J 3JRIA 1ZKGA 2KT0A 2B9SA 3BTCA 2L7FP 3HRTA 5IYBJ 4N9IA 4O3MA 4LITA 4ZDLA 2DA1A 2JVHA 1R1VA 1GVJA 2OF7A 1PUFA 2ECCA 2H94A 3CDHA 4W97A 2K9QA 2CUJA 5CKTA 3BR6A 2HKXA 3HUGB 1SFKA 3R0JA 3A01A 1B59A 1IV8A 2VT2A 5C4XJ 4M71A 2CW7A 4EVIA 5GP9A 3F0CA 2ECBA 3OYIA 5L3DA 2L9NA 1UAAA 1BJZA 4CXFA 1S7OA 2GXAA 1A04A 1P4WA 1B1BA 4N0BA 3ECOA 1IRXA 1RUNA 5DS9A 4ZTJA 4A6DA 5C3EJ 4ENNA 1VTNC 2R7SA 3ISPA 2NVXJ 4XKBA 3CMEI 2X9DA 3JRHA 1X1PA 2IA0A 1IXSB 1KZHA 3OYDA 3JRGA 1PUEE 3WGIA 4ZYDA 4JYKA 5F6FA 4EM0B 2YX4A 1SC7A 4NBQA 3OSFA 5HLIA 2CO5A 1MH4A 1DQUA 2K4BA 2HXIA 4Q47A 1ETKA 4JX6A 3BC8A 5ILVA 4FCYA 4J19A 2LP0A 4R8HA 4CYDA 4BE2A 5A2QK 4A0ZA 2HVSA 2GIZA 4NNJA 1WQ2A 1SD7A 1MSFC 2VKEA 2M4KA 2VL8A 2MYSA 4WF2A 1BI1A 5E1WA 2ME6A 1G6NA 2ELHA 2QGUA 1JHHA 3PQKA 3PSIA 3VYSB 2I10A 2R7DA 2IJLA 1V55H 3OIQA 1Y0UA 3MKZA 3KP4A 2XAJA 4I0BA 3CF5F 2CH0A 4FX0A 3JW4A 1RI7A 2RREA 4U87A 2PX9A 4GGGA 1K4TA 5CVRA 1MW7A 1OCPA 2EH3A 3FHNA 5IT3A 3HRMA 4CA0A 4DYCA 4LJZF 2CV0A 1NH3A 3G1LA 2XAFA 1LE8B 4A12A 1KU9A 3M9AA 4I99C 4CCKA 3LSPA 3MKYB 3TDZC 4QLCU 1YJNI 3NRVA 4AIKA 1TQIA 2K9LA 3CDLA 2D1VA 4A3KJ 1SD6A 3I58A 1G8XA 1VQNI 3N97A 1LJ9A 2EQRA 3F6OA 2IXSA 3HDDA 4BHCA 4ON0A 2VJJA 3FISA 5C4JJ 3GBGA 1IRGA 1KU2A 4AM3A 2PQ8A 2R7TA 2OTJI 1OCZH 1R5GA 4BQOA 4CCOA 4S05A 4KICA 2JJ7A 5EG0B 3PNYA 4B43A 4LLGF 4AYBA 2H27A 1BIAA 3CC7I 3Q9SA 4FETA 3HC7A 1HF0A 3BP8A 3LSKA 5M5XJ 3HOWJ 2FF4A 1SVLA 2OV7A 2H09A 1J0RA 3GTPJ 5KHDA 1Z0XA 4C9YA 4OU0A 5GADJ 3KETA 3OYJA 4HYEA 4GCVA 3D1NI 3VEPA 3ZP5A 4NHJA 2XASA 4R1HA 1QNTA 3FXLA 4BBRJ 3ZOBA 1Y1WJ 4IPAA 5ICEA 1F1ZA 1A6QA 1N75A 2X1CA 5EG0A 5IT9Z 4M74A 2QSHX 2P6SA 1QGPA 1XX5A 1B6AA 3P7NA 2PI0A 2R93J 3CUQC 5FD5A 3VYUB 2R7VA 3AG3H 1RRJA 4ETSA 1FSEA 2Q1ZB 2HTJA 4HX7A 2OTLI 3FK7A 4HG2A 4LGWA 1PP7U 3DPLC 3HG9A 4IJAA 3K2AA 5DYMA 2AS5F 3RCOA 3K4CA 1FOXA 4PUSA 1KU3A 1V5FA 1G59A 2O5RA 2JA2A 5FKNA 5J8FA 3RQ4A 3NAUA 2Q0OA 1ZGWA 4U88A 3CCVI 4ESBA 4EJVA 2KIFA 2IGOA 2FBIA 2M34A 2DT5A 2UV1A 3I5UA 4U0WA 3SYTA 3MZHA 1S9HA 3E5QA 2JSPA 5CJ9A 3OYHA 3AL0B 4IOCF 2RGVA 3H35A 5GAEJ 3J7AY 3BTJA 4BXFA 3QP5A 3B02A 2FMLA 3GXOA 1FT9A 1GXQA 5E8GA 5LGUA 3SHFA 4AIDA 3F8MA 2PFBA 5HLTA 3V7RA 3QYBA 1IRZA 3DXJF 3M4OJ 4H4KC 5D6FA 3H36A 2H8RA 4Y52J 1OKRA 2M87A 4A3JJ 1IXCA 2DMUA 2X1DA 2X48A 5K7HA 4M3BA 1XN7A 3R0AA 3CCUI 3BQZA 3KEYA 2IVMA 3DLAA 1ODDA 1LFPA 2LY2A 4YRVA 4BH9A 1QHHD 1UJ8A 4C3IJ 4V19K 1LPQA 3S1RJ 2OAZA 3GX4X 1MMGA 5AIQA 2DAOA 5IOZA 2FEZA 5KVRA 2ISZA 3DTIA 4HV5A 4E7IA 4IKFA 3O2PE 1JT6A 2NS8A 3DU5A 3KEOA 3KP6A 1D0ZA 3H5NA 3M8JA 4BHBA 4F91B 3H3ZA 4F93B 5E1ZB 1YO5C 1APLC 5LGTA 5TRDA 3W2VA 2O6GE 1E17A 3GLLA 1T0FA 1KGSA 1TWGJ 2HVRA 4HF2A 2XSJC 4FASD 3TO9A 4LG0B 5LHGA 3O8GA 3M07A 4P9UA 4B44A 3LAPA 2VPRA 3S3OA 1FBQA 2NVUB 2QLZA 2DT7B 2RC4A 4A3CJ 1JT0A 1Z21A 2NVYJ 2DFFA 2W00A 3BZ6A 3WHBA 3F3XA 4A0XA 4C3HJ 3ZMZA 4A3IJ 2JQ7A 2VC0A 1MGTA 3MVPA 4I09A 1IV6A 1HDDC 2X4HA 3GZNB 5HLGA 4M6VA 1D8KA 3ZQHA 2OCEA 4EJOA 5IP6A 4ZTFA 1G2HA 4E7KA 2EFPA 2JSCA 4XL9A 1NHAA 1V5GA 3I64A 4LG0A 2DI3A 3MN2A 1T38A 4A5NA 2H1LA 4M6XA 3ZXSA 2VQGA 1T39A 4N4OB 2L9RA 3PO3J 2XGDA 2BHZA 1K7AA 3S1MJ 1IO2A 2E71A 3M1CA 5EJCA 4FISA 3SZGA 2E5ZA 3SZPA 2R7QA 2NOGA 4XSXF 5F1JA 1JKQC 4V2GA 5HS9A 2Y9YA 4IEJA 3IC7A 4HA8A 1MJBA 4F55A 3L2CA 1TW2A 1I6XA 5JR3A 2CJJA 4YIFA 2DMQA 3QOEA 1OYWA 1Y1VJ 1TWHJ 3ELKA 4C2TA 1MBEA 1KU7A 2DO7A 3QWLA 1FOWA 2PMZA 5L3GA 1U8BA 1WH7A 5A2QZ 4XKVA 3W6KB 2CUZA 1JJ8C 3RPUA 1RESA 5HDKA 2Y9ZA 1SEUA 2NYXA 3H0GJ 1SANA 1V3FA 2DYRH 1J5YA 3IWZA 4KIGA 1WSUA 4A3DJ 2CQNA 4RB3C 5LBQA 3ASOH 3HTSB 1R4NB 4MTDA 4BJ6C 5ILSA 4ENJA 1U9NA 2L02A 4HBLA 5CPRB 1WJ5A 1A5JA 2J5OA 3J80K 1TQPA 2TRTA 4L9JA 2CSOA 5FLMJ 5E3LA 4KFCA 2V9KA 3RIRA 4YEJA 1NG7A 1OYIA 3OYFA 2L9VA 3BR1A 3BPVA 1W7PA 3MZ8A 1ZHFA 2DA7A 3EPZA 2LOOA 2ELKA 3GFMA 1U78A 3COAC 4PSXA 2IS1A 1R22A 4HAMA 1HQCA 2VI6A 2IT0A 2QEXI 2EZLA 1VQLI 3BJAA 2WV0A 5K5RA 2DCEA 2F5DA 2YSRA 1TC3C 2OQGA 1FZPB 2STTA 2VBZA 3W6VA 5EZHA 1EV7A 2KIMA 1VQ7I 2G0EA 2P8TA 4Y17A 1GV2A 4JQFA 3KYLA 1Q1VA 1IN6A 3ZQGA 4XNFA 1TLHB 2CQXA 1YRNB 4ZZLA 2OU2A 2NVQJ 2HDDA 3EDPA 2HI3A 2FQ4A 2LREA 3PFIA 4BQAA 2Y75A 4G94A 4N4NB 3K1NA 3TP0A 2BXYA 4BAYA 1W36C 3JTGA 1K61A 1FJLA 2ZNZA 1HDPA 5KNLA 2L3DA 5EGOB 3JCUC 1YHQI 1EH6A 3HOTA 1YYVA 5F1RA 4CICA 3HRUA 1J2XA 1D0YA 3IHUA 2Z2SB 1YRNA 1BA5A 1YIOA 4HX8A 3E7LA 4A0YA 4LFUA 2E7WA 4FHTA 5LEJA 3S93A 4YG2F 3LSJA 1LQ1A 4RB1A 3GTOJ 1UHWA 1MJ9A 4A5MA 5BMZA 1RR7A 4CO8A 1D0XA 1ETVA 2JT1A 3IKTA 1B9NA 3CF2A 1ACIA 1R5ID 2XC7A 5EGOA 2KKOA 2QM3A 5L3BA 1MKMA 4FTHA 5FKKA 1VF9A 2EV5A 3PFYA 3SQNA 5DD4A 4E7HA 4BE0A 3MAJA 3JREA 4I2OA 1Z1DA 2CYYA 4XLEA 5ICFA 1SFOJ 2QQAA 1RPWA 3CQZJ 2MLKA 5EEAA 3LFKA 2ZO4A 3GWZA 3PIPF 3RKWA 1XC5A 2A5YB 2K7LA 2LF7A 4KYWA 3OL4A 2MBFA 1ZGAA 2DFEA 2XF5A 1YS7A 1XG1A 4UUVA 2K4JA 5FLXK 2AHQA 2XF7A 4L5EA 3O8HA 4E6KG 2MW8A 2V1DA 3OS2A 2O3FA 4G6QA 3GFJA 3DEWA 4HLYA 4DYRA 2HPMA 1LDDA 3GMEA 3HSRA 3DEEA 5F0CA 3ZMDA 1RNLA 3H3VK 3GEZA 3G6EI 2W7NA 4P5OA 3HOVJ 4G8XA 2BVLA 2DJIA 2QQBA 1S29A 4RB2C 4B8XA 1Z05A 2K5CA 3RYPA 5LRSA 3SFIA 3ONQA 4XR6A 3MQ0A 4KT5C 2CMPA 4D7MA 2XGCA 3CUQA 2WWYA 3S1QJ 2OZUA 4RB0A 4R79A 1QZEA 2O0YA 2W82A 3HPGA 4BDYA 3TKYA 3IP4B 2RQPA 3I53A 3CJRB 1MH3A 1ETYA 3QPSA 3RTRA 2VOOA 3KPHA 1EH8A 2VQCA 2FRHA 1FOKA 4I02A 1IUYA 1YIJI 2IRFG 4EJUA 4DQ2A 3KCCA 2LY9A 4XLFA 1H89C 1KA8A 1OCTC 3C3WA 5FKMA 4AC0A 2HDCA 6PAXA 1ZTRA 1A31A 3A0BC 3C1DA 1GT0C 2HDWA 4PJ0C 3KP3A 2W25A 1FYKA 3RPUD 4PFPA 5KK1A 5B3SH 1U9OA 5HS8A 3S2DJ 4C2UA 4IHYA 2E1CA 1ZLKA 1NG6A 4BY1J 2LTPA 3FXOA 1LFUP 4CYCB 5DUKA 2LBFA 3IAM2 1TT5B 3E3VA 2ESHA 2LYCA 4XK4A 5IYCJ 3G3ZA 1B4AA 3MD2A 1AHDP 4LIUA 4UB6C 4D5FA 3B6AA 2WAQN 4UVCA 1VI0A 2DA3A 3NARA 1BC8C 5CVJA 3ZQQA 1KQ8A 4IL6C 1P7IA 4NB5A 3LWFA 4MO7A 3WHCA 1I1SA 4DGWB 2K85A 3DKYA 3P9CA 4KDPA 3RI4A 3ERED 3FXRA 3HIFA 3VWBA 2D45A 4DIQA 3FZVA 2BW3B 2E19A 4MEXF 1W4MA 3E5UA 4EJTA 3CTAA 3OYMA 2EV6A 2M0MA 2EV0A 1TNSA 4G6TB 3Q3SA 1BN5A 3HPHA 4AD9A 2ZFUA 1D5VA 3I56I 3T1BA 1D1BA 2KZGA 1A6IA 1QPMA 1S5LC 2MC3A 2HXOA 1LVAA 2VBWA 2ZXHA 1HSJA 3LL7A 3TGNA 2R5ZA 4JX5A 1N77A 3WTVC 2STWA 4ESFA 3FIWA 3WTWC 1P7JA 4ABZA 1ZGJA 1Z6TA 2BW3A 2GQQA 2PN6A 5FRNA 1WKMA 2WADA 2DODA 4ITVA 1BR4A 1FNNA 2XPWA 2P5VA 3HSEA 2UXNA 2YUSA 1B8IB 2RDPA 2M30A 5LHHA 3HJEA 1T56A 3HSFA 4XLNF 3S15J 3H1CA 4P55A 4RAFA 1CGPA 2XAGA 4PK4A 3BWGA 2ICWG 3BTIA 3CLOA 4HLXA 1FP2A 5DD8A 3H9GA 4OIRF 3V7SA 1YITI 3DLLF 3K10A 2ESNA 3DEUA 5GAGJ 2FSWA 4I01A 4HW0A 3LA3A 2BV6A 4I6ZA 1S72I 3FBNB 5LGNA 3J7ZI 4EGZA 1XB4A 3RZDJ 2TCTA 3BOQA 1O7LA 2WAFA 1HXDA 4MTEA 3HKZN 1O7FA 3KYCB 3K70D 2CUEA 1TTYA 4O5VA 4QTRA 1VQKI 2V6EA 4M6YA 2Z1DA 4KIFA 5FFXA 2X85A 4CDGA 2AQEA 4XRFA 2O61A 4IRIA 2EA2A 3OYBA 2QCOA 5J6XA 5IPAA 2WAEA 4E7ZA 1ZRDA 2DTZA 4RLFA 3CJNA 5DEQA 2BY1A 4F92B 2IA2A 1OLTA 3OYNA 2QBYB 4DJAA 2IGNA 1FTTA 2Z3YA 2Z9OA 5J1UA 3U21A 2XRNA 1XGMA 2YPRA 1C0WA 4U7BA 3WTTC 3LFUA 1DDNA 1FYMA 5D4RA 2E1NA 4QPOA 4XKCA 3FKJA 3KLNA 1X1CA 3CCQI 2IGMA 4E7JA 2X6YA 4MQVA 4NC7A 2PMHA 2QBYA 5DV5A 1L3LA 3IV5A 1SVOA 2OQRA 3QYFA 4XN3A 1MNDA 1U2WA 1OJLA 2E1MB 2XF6A 3OOUA 4Y4RA 3FMRA 4HDVA 4A3GJ 2HPIA 3JTHA 4LD5A 5H6QA 4NC6A 2MA3A 2F5CA 2A07F 3VB2A 2XAUA 3JRDA 3VYTB 1VQ5I 5DCMB 1FY7A 2L01A 1OCOH 1EKEA 1F9NA 4BJ5C 2KRCA 4IQ4A 1R4MB 4L0YB 1R36A 2IA1A 2LK2A 3VYRB 4OIPF 4X6AJ 3FXQA 4BYYA 2A5WA 1E3HA 4S0HB 4B3XA 3DQVC 3KZZA 3W3CA 3FBIB 1O57A 2GWRA 1LDKB 3OL3A 5IP7J 5EEHA 2M3AA 3JAMK 3OYKA 4Y7NJ 1V54H 5DCMA 4ZH4F 3EUHA 2I5UA 2XKOA 1P4AA 5FROA 2IS2A 3ZMVA 4CGZA 4M3GA 4IVNA 3HTUA 3E97A 2XGXA 2VE8A 4EQQA 1Z91A 3R4KA 2WB1N 3X2QH 1R71A 3ZCOA 3AG2H 2XAQA 3F23A 1T95A 1R7JA 3C18A 2CFXA 3GTMJ 2ZMEC 4KN4X 1IN8A 2KQRA 2F2EA 1FC3A 1HA8A 2CV2A 1T6SA 3EUAA 2FJ1A 4JOMA 1ZQ3P 2CRGA 3BT9A 1WHUA 4MEYF 1MBKA 3BZKA 5GPAA 2CG4A 3DBLB 4C3JJ 1BI3A 3BROA 1Z3XA 1BOAA 3HGYA 5B66C 2UZKA 1U3EM 2HOSA 1YFHA 3WGGA 2FBHA 4DOZA 5BPIA 4BQQA 1TL8A 2VPLA 4WXDA 1UMQA 1D1CA 5EDNA 3I59B 1SVMA 2ADUA 3F8FA 4DYQA 1NTCA 2O03A 1K4SA 4BQNA 4XLPF 1QPIA 2Y48A 1U5TC 4Y15A 2MD5A 4F52A 3OSGA 1ZRCA 5B1AH 2IGKA 1QRYA 3JR9A 2R4GA 2XPVA 4M72A 1P4XA 1ORKA 2Y69H 1F5TA 1YLFA 5EZGA 3OYGA 2R5YA 3KFWX 3H92A 3SEQA 3I59A 1MMDA 1YS6A 5HVQC 5D5VB 2COMA 1XS9A 5J3LA 4Y3OA 1P6RA 4XRSA 2ETHA 2NS0A 1WFXA 1XD7A 5FLVA 1RKWA 1OR7C 1JTXA 3CCJI 1YG2A 1W5TA 1YJWI 2BY0A 2OPTA 3L9FA 1D3YA 2AQFA 5TJJA 5E8IA 1BOBA 4HQEA 1FX7A 2L4AA 1JUMA 4YFXF 4LMYA 2V79A 1FBUA 4CZCA 2LY1A 1U6GA 2VKHA 2JPCA 1MJAA 3TP3A 5K7FA 4RMNA 3BLYA 3WE2A 1RC9A 4EV0A 4E70A 4BEHB 4UV9A 2ID6A 5L3EA 2EINH 2JUCA 5F27A 2F5VA 3QODA 4IF4A 5J8CA 3UR3C 4EJWA 2V1UA 2CWEA 2LD5A 3HZJA 3CMMA 2B63J 4E7LA 1FMVA 2LR8A 3QYEA 4IHXA 2H8WA 3BG9A 3BJ6A 4AIHA 2OA4A 3CC2I 4RGUA 5CQEA 1O3SA 3S3MA 3KX2A 3AG1H 5LLQA 2E2IJ 1ONVA 9ANTA 3AFHA 1G4DA 1I27A 1F43A 1X1DA 2JRTA 1X19A 4B3AA 4BEHA 3KZYA 1OCCH 2E34A 1ZK8A 3QQAA 1BBYA 4UB8C 3GTQJ 5ILUA 1U0JA 2HQNA 3U2RA 3QPHA 4UV8A 4A6EA 3F9KA 3ESWB 2EIKH 5EEGA 5ED4A 2X0LA 1JI8A 2VXDA 4BKXA 4BHPA 1GHCA 3SZTA 3WGHA 3MKLA 2OC6A 2PJPA 3T8RA 4ZYGA 4D0PA 1P92A 2M5WA 1O3RA 3GUDA 3G4SI 4KITB 1FEXA 3HB9A 4G6DA 2AO9A 2QA4I 2LC2A 2OBPA 2MC4A 3ZR8X 2WTEA 3J7YJ 1YW8A 5BPDA 3L2RA 4HX4A 3VFZA 3F8BA 1VFCA 4AVZA 5FD6A 4LLNA 3J7AO 1TBXA 5CQGA 3VODA 4OOIA 1I39A 3OS0A 1EH7A 3OYAA 4IHSA 1F36A 2M45A 2RQQA 3QRFF 4M73A 4H0EA 2CW8A 3LMMA 1LDJA 2L4MA 2ZJPF 5GPCA 2F4IA 1RUOA 3CCEI 1LVKA 2ZCWA 3S2WA 2F5EA 2JA7J 4UY8I 1FOYA 2VUMJ 2XHKA 3I71A 3I54A 2HOTA 4KUMA 2ZJ2A 2ISYA 3SJMA 3ABKH 5J1RA 3S14J 2DBBA 2R3SA 3EYIA 1MBFA 2Y0SN 4LB6B 3BDDA 3JRAA 5KCMA 4AIJA 2ZJQF 4NQWA 3JRBA 1R5HA 4PGGA 2I8DA 4P9FA 2EJRA 5JI6A 1MDMA 4AYBN 3NEUA 4XSZF 3K1PA 1AA7A 4U0VA 3BCBA 4HF1A 2DFHA 4IOAF 1FP1D 1SMYF 2BEOA 2RN7A 3AKZA 1V4RA 2XAHA 4HOBA 2KP6A 2MD0A 1LFBA 4EMSA 5FKLA 4DZJA 4WWCA 4ZDOA 4UUSB 4UUTA 3WG9A 4A93J 3GLXA 5BS6A 2BVMA 3OIOA 1P2FA 1W7PB 1X3ZB 2DW4A 2E2HJ 1I1GA 5D8LB 3DTEA 2DOAA 2ZXJA 1Y6IA 3AG4H 1UB9A 2W24A 1ZYRF 4OWRB 1PDNC 2PLYA 3CJTB 1XTAA 2YU9J 3I55I 5LHIA 3CESA 3KP2A 1ITYA 3J81K 3F72A 3HGGA 3R61A 2PEXA 3V7CA 2LDUA 4CCLA 4XLHA 3HOXJ 5D6EA 1IN7A 5K7ZA 3TQNA 2QSFX 2GBYA 3WG7H 1K79A 4UUSA 1G3TA 1WJFA 2WAQA 3PM1A 1T33A 3OYLA 3MKWB 1J9IA 3W2AA 3BJOA 1Y39A 3EQLF 2DA5A 1X4PA 2MH2A 3PUBA 3ZQFA 4YELA 3GFIA 2ZFWA 3GTLJ 3P5JA 4KA4A 1GUUA 2RV8A 5LRRA 1BL0A 1MBGA 4MHGA 1O4XA 3MZYA 1USTA 3PNTA 5E18F 1H9GA 3JSOA 1YX3A 1A36A 3OR1C 1Q1HA 2DA6A 1R9TJ 4QSHA 2W85A 2L7ZA 2LFBA 3ABLH 1RR8C 2MFZA 2D1HA 1Z6RA 5E17F 1I5ZA 5L3CA 4HNTA 4F7ZA 5E3NA 2K02A 1WRJA 3KZIC 2M0CA 3HHHA 5J4YA 5CYVA 3T0YA 2O8KA 3BR0A 1W1WE 1BM9A 1Y0NA 3FXKA 3B73A 2JA8J 4HDUA 3EYYA 1QBJA 1H0MA 2ZSHB 2X1EA 3SFZA 3LQQA 2RVCA 2GIVA 3I4MJ 2PBIA 3JRFA 2K3PA 5B5EC 4HF0A 4FT8A 2V6CA 4JBAA 2QVOA 3F8CA 1L0OC 2HYGD 3OMYA 1MBJA 2DMTA 3ML6A 2WV1A 3R60A 1XSDA 2K27A 2VASA 2XUBA 2P4WA 2FX0A 5EF6A 1GVDA 1EJ9A 2L7KA 3MMYB 3CD6I 2A61A 2BHYA 5D5UB 2DQRA 3GF2A 5AONA 2LKSA 3K4LA 1TQMA 3MFKA 2HVQA 1ON1A 1B9MA 1ZAOA 4PJMA 2GLOA 2G9WA 3OYCA 3DWLE 4ZYEA 2VXZA 4XLCA 4RGSA 3CUQB 1Z77A 2RNJA 4AWXB 3QAHA 4D5CA 1YJ9I 4N9HA 4PJNA 4Y33A 3ABMH 2DMNA 3V8KA 4IO9F 3ZMUA 3JRCA 1GDTA 3D5LA 4A69C 4KN7X 1JJ6C 3GZ6A 3ASNH 1K6YA 2GXGA 3IH4A 4PGHA 5HOOA 3FXJA 4F3QA 1SMTA 4XKWA 5JVTA 1ZG1A 3P9IA 1S3JA 1R58A 1TW3A 1JKOC 1WVRA 1SD4A 2Y30A 5B1BH 2G7UA 3N4MA 4RGRA 2HKOA 1QO0D 2EPFA 3VSLA 1D5YA 5L3FA 2LF8A 4MFDA 4KISA 4IX7A 2EA4A 2X6WA 2EFNA 1HKTA 1DP3A 2FA5A 2LMDA 2MLGA 3T5XA 1JUSA 2CQ7A 3QPTA 2K40A 3D5SC 2DLLA 2NAZA 1MMSA 3CCLI 4J01A 1X58A 5LFAA 2LBFB 4HSRA 2IS4A 2DK8A 1JUPA 2J5PA 2UWMA 3GTKJ 3LA7A 3I9V2 2E2JJ 4M9ZA 2R7OA 1MNMC 2Z5UA 2VB6A 3DU6A 3SDBA 4BJTA 3CMYA 5LEKA 2XSDC 1A35A 4E4HA 2XKPA 2YR2A 5HDGA 1N25A 2XB0X 2P6TA 3FWEA 4B48A 2L9SA 1RETA 2X6OA 5GTIC 5JLXA 2EIMH 3OV8A 3RZOJ 4XRSG 3GTGJ 1I3AA 2LKXA 1VQPI 3WODF 3QP6A 4MQ9F 5FFZA 1YX5A 4I98B 5IT9K 1YQAA 4A3BJ 3RKXA 3PNVA 1I50J 2JA5J 1JTYA 3KE2A 2QQ8A 4ENKA 3WTSC 5BOXA 4HNUA 2CFOA 5D8KB 1V5EA 2P5LC 2R5ZB 1JXSA 3LSHA 1W7PD 2ZXWH 2M4GA 3E6DA 2HS5A 2Z33A 2FE3A 3AL0C 1G3WA 5HDNA 3G71I 4FE4A 1WJEA 3CMAI 2DFIA 4RAZA 4IHTA 4EM1A 2A3SA 3KP7A 4OIQF 4UHTA 1OQYA 2CQKA 1U8RA 4EM2A 3A02A 1B72A 1ZELA 4JX4A 3SDGA 2D2WA 4GFBA 4TV7A 5J4VA 2WB1A 1BI0A 3QU3A 4CSWA 1I3QJ 4L0ZB 1UFMA 3DBHB 2DOEA 2DOFA 1R23A 1UHMA 2IEKA 1VQ9I 1X3WB 2XVCA 2B0LA 5IOYA 1TZLA 1NK3P 4MLOA 1WH5A 3ZQ7A 2HZDA 1G3SA 2KZVA 1DUXC 1DU6A 1T8IA 2TDXA 3CCSI 3NWSA 4MNUA 1JKPC 4XIDA 2H6BA 2FOWA 3HEFA 4M9XA 3QOPA 3SXYA 2VKVA 1T0FC 2Y31A 3FXUA 3EETA 4ZC3A 2P7CB 4AUXA 1LEAA 2YX7A 5FRMA 1DPUA 3CCRI 4Q5SF 4LG3A 3F6VA 3ZGKA 4Q4ZF 3LSMA 3REOA 1M1EB 2HYJA 2QENA 3BQYA 4JP0A 4LK1F 4RAYA 2DTRA 3MCZA 1KYZA 2P5KA 4IHVA 4G7ZF 4ANJA 3PUFA 3IRQA 2NNYA 3BR3A 3Q0VA 2HEOA 1R1UA 3I4PA 4E7SA 5M3FJ 2R7FA 2FU4A 2V1NA 3NQOA 1K6OA 2IAIA 4UXNA 2OCCH 2FOKA 3GYHX 2HQ5A 1WWXA 3G73A 3SEZA 1XCBA 3BR5A 4BBSJ 2BGCA 2XB5A 3KP5A 2Q8KA 1HSTA 5HODA 2NS7A 3J80Z 3K6GA 3A0HC 3HRSA 2VBYA 4KJZA 3HXLA 1IGNA 2HYFA 3DTKA 3G1OA 1ETQA 3CUOA 2JK3A 4BXXJ 3ZN0A 4G9YA 2QSGX 4I76A 3HOZJ 2KIQA 3BG5A 4ZJZA 1IDZA 4YIRX 2PMUA 4GYGA 3TW6A 4GO1A 2VBXA 3OYEA 1H88C 4U7DA 4DBQA 3PIOF 3NWTA 5F0FA 2VN2A 1Z3YA 2V9PA 4HRIA 3GO5A 4I0AA 2DK5A 2GA1A 4YFKF 1GV5A 2JVGA 2P81A 2DT6A 2LSOA 3C7JA 1S6LA 3IH2A 4UNOA 5E3MA 2N8GA 3CO6C 3DKXA 1QHGA 4RM2A 3TOBA 4CCNA 3DPTA 4Y13A 3Q0WA 1MIJA 2KIUA 1YE9A 2D5VA 5H20A 1VQMI 2QUFA 1Z7UA 2KJCA 1RIOH 5AIPA 4XOTA 4WXCA 1HOMA 3FK6A 3L2UA 2FMYA 3LAJA 2PG4A 2VONA 2DPUA 1Y8QB 3HBLA 3ZRGA 3GCMA 1SFUA 4I7HA 3OWTA 3UKGA 1IN4A 3DPUA 1R6RA 1WJCA 2L5QA 3HUGA 2QKLB 3K0LA 3L09A 1IZ1A 3WTZA 4II3A 1IW7F 5H6RA 2BY2A 2KPMA 3O3KA 4L9VA 3U1KA 2VC1A 2V26A 4J00A 4ASNA 1J75A 2FQ3A 3ZMSA 2E60A 4MIMA 1KYWA 4L5IA 4B1RA 1DGRM 3HYIA 4NUBA 3S3NA 4A3FJ 3L2QA 1VNDA 1O3QA 5DUIA 4BNCA 3E5XA 2HTSA 2OJED 4PFOA 3K4MA 5DM7F 4MFEA 1IC8A 2GXBA 2IS6A 4RDUA 4PZJA 3OS1A 1XMKA 4GRIA 2ZXIA 4C30A 3TMOA 1XPXA 1YW7A 5FLXZ 1Z67A 1BJAA 2F4OB 1FIPA 1JHFA 3CP8A 5GTHC 3E6CC 4L18B 1TNTA 1JE8A 3LQRA
chains in the Genus database with same CATH topology
1HKSA 2A6HF 2V1XA 1AOYA 3BY6A 3V8JA 2M8EA 3M8FA 2QYOA 5K5OA 5FGMA 3HOSA 1MZBA 1RZ4A 1ZRFA 2GZWA 1W5SA 3H3UA 1YW9A 2CGPA 2Q2EA 3FM5A 1FYLA 2UXXA 3WU1B 1J7KA 4L5JA 1CF7B 5HLHA 2FBKA 5K5QA 2DU9A 2KJBA 1OMIA 1FPQA 1WI9A 2EK5A 4B09A 1X3UA 1XGNA 2VODA 1XDUA 1IXRC 2JTVA 4HV6A 1CF7A 4PCQA 4RGXA 3F21A 3RJPA 3Q9VA 3ROUA 1QZYA 2ZBKA 3RDIA 3ZMTA 4S04A 1SFEA 1R00A 3VOEA 1FWZA 3E6BA 1KQ0A 4P96A 3IRRA 2A69F 1K78B 4GXOA 2XV4S 3FMQA 2HZTA 2IW5A 2V9VA 3FMSA 3ABTA 3ULQB 1XCVA 1DPRA 4GYIA 1K78A 5D5WB 3WTXC 4QWQA 5F64A 5FO5A 4WK8F 1JGSA 1XGOA 3WE3A 4G7OF 3TDUC 2ACJA 4OMZA 4L9NA 1QZZA 1BI2A 2BBYA 2A68F 1IRFA 3FF5A 3IWFA 1FSHA 3TO6A 1MDMB 4UVBA 5FB2A 3DKWA 4MGRA 3FHZA 3PQJA 1HBXG 1IN5A 1UCRA 3U9GA 1XGSA 4FX4A 1KQ9A 5JFRA 2RKHA 1QQIA 2EB7A 3JSPA 2HQRA 2VOPA 3WTYC 2VE9A 3FM3A 3DF8A 2IPQX 3QU6A 1Z9CA 3GW2A 3WU0A 1GXPA 2HR3A 1IF1A 1G3YA 2K86A 2DPDA 2BE5F 3T8TA 2HWVA 1XSVA 3GFLA 4OINF 1ZG5A 4Q48A 3R6SA 4CZZA 2LNBA 2ZNYA 4K2EA 1DP7P 2JPBA 4IRHA 1HW2A 2GA2A 5ERIA 2EWNA 5D5XB 1SAXA 4ZZDA 3RYRA 2QQ9A 3ECHA 3LA2A 3JAMZ 3DV8A 4XBFA 1ZREA 2NRAC 4LLLA 3MWMA 2FNPA 1S7AA 4ZYHA 4WX9A 2FNAA 3K69A 3M7GA 3KLOA 1FLIA 2HFHA 2EFWA 4ENMA 4RS8A 4OMYA 4KMFA 1OYYA 3ZN1A 1E2XA 2ZMEB 1HW1A 2GAUA 2HGCA 1ZARA 3DP7A 3L00A 4KNYA 1BC7C 4LB5A 5E20A 2W84A 4O6JA 5BQTA 4WCGA 4G7HF 1YTYA 2F5FA 2W57A 1STZA 1ULYA 2ZMEA 1HKQA 3HHGA 2OD5A 4L9TA 5D4SA 1U5TB 2DQLA 4YFNF 5JHUA 1H9TA 2XROA 4DNCA 3L7WA 1IAWA 1LEBA 2ZKZA 2FXAA 2BYVE 2H6CA 3I0TA 2YU3A 1ZLJA 3V4GA 1F4KA 1U5TA 1USSA 4JK1X 2O8XA 3ABUA 1J59A 4IXAA 1S8NA 2CW0F 3CO7C 2P7VB 2E7XA 3W6JB 1LNWA 2EFOA 1R1TA 1O3TA 1XMAA 5HS7A 4HQMA 1OR7A 3LSTA 3BPXA 2MH9A 4A2UA 1T98A 3ZPLA 4EGYA 2G7HA 1D8JA 5CVIA 5DCFA 4Z2YA 3D0SA 2Z99A 1XSXA 2KRFA 3K9TA 3O6BB 1ON2A 3AAFA 4IRGA 4U0YA 3WTUC 3M1EA 1ZN2A 5CVUA 4AVPA 3FX3A 3GZ5A 2EFQA 3TO7A 4KIBA 1T2KA 5CLSA 3U1DA 4LK0F 2NNNA 2JZYA 4YIIA 1HW5A 3TOAA 3P9KA 2LKPA 4KMUX 1AWCA 1OPCA 1PP8F 1ZH5A 3IKVA 5ICCA 1REPC 3OOPA 4CHUA 2AXLA 4WXHA 2QZ8A 2HOEA 3DFGA 2C6YA 2QWWA 4PDKA 4OIOF 3KEQA 3F8NA 2M1BA 3GVAA 3K1MA 4UVAA 1SFXA 3IL2A 1ZG3A 3E6MA 1FBSA 4BXUA 2WC2A 2XIGA 1LB2A 5ICGA 4M9SA 5DDGA 1SD5A 4ESJA 2VT3A 2IP2A 2Y0MA 1MD0A 3J81Z 5E1XA 2A6EF 3RPQA 3V8LA 2L54A 4HZFA 3F22A 3Q5FA 3K2ZA 3MEXA 2OZ6A 5CVVA 5K1YA 3M8EA 1BIBA 3RKYA 1XDSA 3HRTA 4N9IA 4O3MA 1R1VA 1GVJA 2H94A 3CDHA 2HKXA 3R0JA 1B59A 2VT2A 4M71A 4EVIA 5L3DA 4CXFA 1S7OA 1A04A 1P4WA 1B1BA 4N0BA 3ECOA 1RUNA 4A6DA 4ENNA 1VTNC 3ISPA 2IA0A 1IXSB 1PUEE 3WGIA 4ZYDA 5F6FA 4EM0B 2YX4A 5HLIA 2CO5A 2K4BA 4Q47A 5ILVA 4R8HA 4CYDA 5A2QK 4A0ZA 1WQ2A 1SD7A 4WF2A 1BI1A 5E1WA 1G6NA 2ELHA 1JHHA 3PQKA 2R7DA 2IJLA 1Y0UA 3KP4A 2XAJA 4I0BA 4FX0A 3JW4A 1RI7A 4GGGA 5CVRA 5IT3A 3HRMA 4LJZF 2XAFA 4A12A 1KU9A 3M9AA 3TDZC 4QLCU 3NRVA 4AIKA 1TQIA 2D1VA 1SD6A 3I58A 3N97A 1LJ9A 3F6OA 4BHCA 4ON0A 1IRGA 1KU2A 2PQ8A 1R5GA 4S05A 4KICA 4LLGF 2H27A 1BIAA 3Q9SA 3BP8A 2FF4A 2H09A 1J0RA 4OU0A 3KETA 4HYEA 4GCVA 3VEPA 3ZP5A 4NHJA 2XASA 4R1HA 1QNTA 4IPAA 5ICEA 1F1ZA 5IT9Z 4M74A 2P6SA 1QGPA 1B6AA 3P7NA 2PI0A 3CUQC 5FD5A 4ETSA 1FSEA 2HTJA 4HX7A 4LGWA 1PP7U 3DPLC 4IJAA 5DYMA 2AS5F 1KU3A 5J8FA 2Q0OA 4U88A 4ESBA 4EJVA 2KIFA 4U0WA 2FBIA 2DT5A 3I5UA 3MZHA 3E5QA 5CJ9A 2RGVA 3QP5A 3B02A 2FMLA 3GXOA 1FT9A 1GXQA 5E8GA 5LGUA 3SHFA 3F8MA 2PFBA 3V7RA 3DXJF 5D6FA 1OKRA 2M87A 1IXCA 1XN7A 3R0AA 2IVMA 1ODDA 4BH9A 2OAZA 3GX4X 5AIQA 2DAOA 2FEZA 5KVRA 2ISZA 4HV5A 3O2PE 3KEOA 3KP6A 4BHBA 3H3ZA 5E1ZB 1YO5C 5LGTA 5TRDA 2O6GE 1E17A 1T0FA 1KGSA 4HF2A 3TO9A 4LG0B 5LHGA 4P9UA 3LAPA 1FBQA 2QLZA 2RC4A 3BZ6A 4A0XA 3F3XA 3ZMZA 2VC0A 1MGTA 4I09A 2X4HA 5HLGA 1D8KA 4EJOA 2EFPA 2JSCA 4LG0A 1NHAA 3I64A 2DI3A 1T38A 4A5NA 4M6XA 1T39A 1K7AA 3SZPA 4XSXF 5HS9A 3IC7A 4HA8A 1MJBA 3L2CA 1TW2A 1I6XA 5JR3A 4YIFA 1OYWA 3ELKA 1KU7A 2DO7A 5L3GA 5A2QZ 3W6KB 3RPUA 5HDKA 2NYXA 1V3FA 3IWZA 1J5YA 4KIGA 1WSUA 4RB3C 5LBQA 3HTSB 4MTDA 5ILSA 4ENJA 2L02A 4HBLA 2J5OA 3J80K 1TQPA 4L9JA 2CSOA 4KFCA 3RIRA 1OYIA 3BPVA 1W7PA 1ZHFA 3GFMA 1U78A 3COAC 1R22A 4HAMA 1HQCA 2IT0A 3BJAA 2WV0A 5K5RA 2F5DA 2YSRA 2OQGA 1FZPB 2STTA 2VBZA 1EV7A 2KIMA 2P8TA 4Y17A 4JQFA 1IN6A 1TLHB 4ZZLA 2OU2A 3EDPA 3PFIA 4BQAA 2Y75A 4G94A 3K1NA 4BAYA 3JTGA 2ZNZA 2L3DA 1EH6A 3HOTA 1YYVA 5F1RA 4CICA 3HRUA 1J2XA 3IHUA 1YIOA 4HX8A 4A0YA 4LFUA 2E7WA 4FHTA 5LEJA 4YG2F 1LQ1A 4RB1A 1UHWA 1MJ9A 4A5MA 5BMZA 4CO8A 2JT1A 3IKTA 1B9NA 2KKOA 2QM3A 5L3BA 1MKMA 2EV5A 3SQNA 5DD4A 3MAJA 4I2OA 1Z1DA 2CYYA 5ICFA 2QQAA 2MLKA 3LFKA 2ZO4A 3GWZA 3RKWA 2A5YB 2LF7A 2K7LA 4KYWA 2MBFA 1ZGAA 4UUVA 1YS7A 5FLXK 2K4JA 2V1DA 2O3FA 4G6QA 3GFJA 4HLYA 1LDDA 3HSRA 3ZMDA 1RNLA 3GEZA 4P5OA 4G8XA 4RB2C 2QQBA 1S29A 4B8XA 1Z05A 3RYPA 5LRSA 3MQ0A 4KT5C 3CUQA 2WWYA 2OZUA 4RB0A 4R79A 2O0YA 3TKYA 2RQPA 3I53A 3RTRA 2VOOA 1EH8A 2FRHA 1FOKA 4I02A 1IUYA 2IRFG 4EJUA 4DQ2A 3KCCA 1KA8A 3C3WA 2HDCA 6PAXA 3C1DA 3KP3A 2W25A 1FYKA 5KK1A 5HS8A 2E1CA 1ZLKA 5DUKA 3E3VA 2ESHA 3G3ZA 1B4AA 4UVCA 1BC8C 5CVJA 1KQ8A 4NB5A 3LWFA 1I1SA 4KDPA 3P9CA 3RI4A 3ERED 3FXRA 3HIFA 2D45A 3FZVA 4MEXF 4EJTA 1W4MA 3E5UA 3CTAA 2EV6A 2EV0A 1TNSA 1BN5A 4AD9A 1D5VA 3T1BA 1QPMA 2MC3A 1LVAA 2VBWA 1HSJA 3TGNA 2STWA 3WTVC 4ESFA 3WTWC 1ZGJA 1Z6TA 2GQQA 2PN6A 1WKMA 1FNNA 2P5VA 3HSEA 2UXNA 2RDPA 2M30A 5LHHA 3HSFA 4XLNF 4P55A 1CGPA 2XAGA 3BWGA 3CLOA 4HLXA 5DD8A 1FP2A 4OIRF 3V7SA 2ESNA 3DEUA 2FSWA 4I01A 4HW0A 3LA3A 2BV6A 5LGNA 4EGZA 1XB4A 3BOQA 1O7LA 1HXDA 4MTEA 1O7FA 4O5VA 1TTYA 4M6YA 4KIFA 5FFXA 4CDGA 4XRFA 2O61A 4IRIA 2EA2A 5J6XA 1ZRDA 3CJNA 5DEQA 2IA2A 2QBYB 2Z3YA 2Z9OA 2XRNA 1XGMA 2YPRA 1C0WA 4U7BA 3WTTC 1DDNA 1FYMA 5D4RA 2E1NA 3KLNA 4MQVA 2PMHA 2QBYA 5DV5A 1L3LA 2OQRA 1U2WA 3FMRA 4HDVA 4LD5A 3JTHA 5H6QA 2MA3A 2F5CA 2A07F 3VB2A 5DCMB 1FY7A 2L01A 1F9NA 4L0YB 1R36A 2IA1A 4OIPF 3FXQA 4BYYA 3DQVC 3KZZA 1O57A 2GWRA 1LDKB 5EEHA 3JAMK 5DCMA 4ZH4F 3EUHA 2XKOA 1P4AA 3ZMVA 4CGZA 4IVNA 3HTUA 3E97A 2XGXA 2VE8A 4EQQA 1Z91A 3R4KA 2XAQA 3F23A 1R7JA 3C18A 2CFXA 4KN4X 1IN8A 2F2EA 1FC3A 1T6SA 4MEYF 2CG4A 1BI3A 3BROA 2UZKA 1BOAA 1U3EM 1YFHA 3WGGA 2FBHA 5BPIA 4WXDA 3I59B 2ADUA 3F8FA 2O03A 4XLPF 2Y48A 1U5TC 4Y15A 2MD5A 1ZRCA 4M72A 1P4XA 1F5TA 1YLFA 3KFWX 3H92A 3I59A 1YS6A 5HVQC 5D5VB 2COMA 1P6RA 2ETHA 2NS0A 1XD7A 1YG2A 1W5TA 3L9FA 1D3YA 5TJJA 5E8IA 4HQEA 1FX7A 2L4AA 4YFXF 4LMYA 2V79A 1FBUA 1U6GA 2JPCA 1MJAA 3WE2A 4EV0A 4E70A 4UV9A 5L3EA 4IF4A 5J8CA 4EJWA 2V1UA 2CWEA 3BJ6A 4AIHA 2OA4A 4RGUA 1O3SA 5LLQA 1ONVA 1G4DA 1I27A 2JRTA 3KZYA 1BBYA 5ILUA 2HQNA 3U2RA 3QPHA 4UV8A 4A6EA 5EEGA 5ED4A 2X0LA 4BHPA 1GHCA 3SZTA 3WGHA 2PJPA 3T8RA 4ZYGA 4D0PA 1P92A 2M5WA 1O3RA 3GUDA 4G6DA 2OBPA 2WTEA 1YW8A 5BPDA 4HX4A 3VFZA 3F8BA 5FD6A 4LLNA 3J7AO 1TBXA 3VODA 4OOIA 1EH7A 4IHSA 2M45A 3QRFF 4M73A 4H0EA 1LDJA 2L4MA 1RUOA 2ZCWA 3S2WA 2F5EA 2XHKA 3I71A 3I54A 4KUMA 2ZJ2A 2ISYA 2DBBA 2R3SA 3EYIA 4LB6B 3BDDA 4AIJA 4NQWA 1R5HA 4PGGA 4P9FA 2EJRA 5JI6A 1MDMA 3NEUA 4XSZF 3K1PA 4U0VA 4HF1A 1FP1D 1SMYF 2BEOA 2RN7A 1V4RA 2XAHA 4HOBA 4EMSA 4WWCA 3WG9A 3GLXA 5BS6A 1P2FA 1W7PB 2DW4A 1I1GA 5D8LB 2ZXJA 1UB9A 2W24A 1ZYRF 1PDNC 2PLYA 5LHIA 3KP2A 3J81K 3F72A 3R61A 2PEXA 3V7CA 2LDUA 5D6EA 1IN7A 3TQNA 1K79A 1G3TA 1J9IA 3BJOA 3EQLF 2MH2A 3GFIA 2ZFWA 4KA4A 2RV8A 5LRRA 4MHGA 3MZYA 1USTA 5E18F 1H9GA 3JSOA 1Q1HA 2W85A 2D1HA 1Z6RA 5E17F 1I5ZA 5L3CA 4F7ZA 2K02A 1WRJA 3HHHA 5CYVA 3T0YA 1BM9A 3B73A 4HDUA 3EYYA 1QBJA 1H0MA 3SFZA 3LQQA 2RVCA 2GIVA 2PBIA 4HF0A 4FT8A 2V6CA 4JBAA 2QVOA 3F8CA 1L0OC 2HYGD 3ML6A 3R60A 1XSDA 2K27A 2XUBA 2P4WA 2A61A 5D5UB 2DQRA 3GF2A 5AONA 1TQMA 3MFKA 1ON1A 1ZAOA 1B9MA 2G9WA 4ZYEA 2VXZA 4RGSA 3CUQB 2RNJA 4AWXB 3QAHA 4N9HA 3V8KA 3ZMUA 3D5LA 4KN7X 3GZ6A 2GXGA 4PGHA 5HOOA 1SMTA 5JVTA 1ZG1A 3P9IA 1S3JA 1R58A 1TW3A 1SD4A 2G7UA 3N4MA 4RGRA 2HKOA 1QO0D 5L3FA 2LF8A 2EA4A 2EFNA 1HKTA 2FA5A 2MLGA 3T5XA 3QPTA 2DLLA 2NAZA 2DK8A 2J5PA 2UWMA 3LA7A 4M9ZA 2Z5UA 5LEKA 2XKPA 2YR2A 5HDGA 2P6TA 3FWEA 3OV8A 3WODF 3QP6A 4MQ9F 5FFZA 4I98B 5IT9K 1YQAA 3RKXA 3KE2A 4ENKA 3WTSC 5BOXA 5D8KB 2P5LC 1JXSA 1W7PD 3E6DA 2HS5A 2Z33A 2FE3A 1G3WA 5HDNA 2DFIA 4RAZA 4IHTA 4EM1A 2A3SA 3KP7A 4OIQF 4UHTA 1U8RA 2CQKA 4EM2A 2D2WA 4TV7A 4L0ZB 1BI0A 3QU3A 1UFMA 1R23A 1UHMA 2XVCA 2B0LA 3ZQ7A 1G3SA 1DUXC 2TDXA 4MNUA 2H6BA 4M9XA 3SXYA 3QOPA 3FXUA 3EETA 2P7CB 1LEAA 2YX7A 1DPUA 4Q5SF 3F6VA 4Q4ZF 3REOA 2QENA 4LK1F 4RAYA 2DTRA 3MCZA 1KYZA 2P5KA 4G7ZF 3IRQA 2NNYA 2HEOA 1R1UA 3I4PA 2R7FA 2FU4A 3NQOA 1K6OA 4UXNA 2FOKA 3GYHX 1WWXA 3G73A 1XCBA 2BGCA 3KP5A 2Q8KA 1HSTA 3J80Z 3HRSA 2VBYA 2HYFA 3CUOA 3ZN0A 4G9YA 2PMUA 4GYGA 4GO1A 2VBXA 4U7DA 2VN2A 3GO5A 4I0AA 2DK5A 2GA1A 4YFKF 2LSOA 3C7JA 1S6LA 4UNOA 3CO6C 3TOBA 3DPTA 4Y13A 2KIUA 5H20A 2QUFA 1Z7UA 2KJCA 1RIOH 5AIPA 4WXCA 2FMYA 3LAJA 2PG4A 2VONA 2DPUA 1SFUA 4I7HA 1IN4A 3K0LA 3HUGA 3L09A 1IZ1A 3WTZA 1IW7F 5H6RA 3O3KA 4L9VA 2VC1A 4ASNA 1J75A 2FQ3A 3ZMSA 1KYWA 4L5IA 3HYIA 1O3QA 5DUIA 4BNCA 3E5XA 2HTSA 2GXBA 4PZJA 1XMKA 1YW7A 5FLXZ 1BJAA 1JHFA 3E6CC 4L18B 1TNTA 1JE8A 3LQRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HKS A;  2A6H F;  2V1X A;  1AOY A;  3BY6 A;  3V8J A;  2M8E A;  3M8F A;  2QYO A;  5K5O A;  5FGM A;  3HOS A;  1MZB A;  1RZ4 A;  1ZRF A;  2GZW A;  1W5S A;  3H3U A;  1YW9 A;  2CGP A;  2Q2E A;  3FM5 A;  1FYL A;  2UXX A;  3WU1 B;  1J7K A;  4L5J A;  1CF7 B;  5HLH A;  2FBK A;  5K5Q A;  2DU9 A;  2KJB A;  1OMI A;  1FPQ A;  1WI9 A;  2EK5 A;  4B09 A;  1X3U A;  1XGN A;  2VOD A;  1XDU A;  1IXR C;  2JTV A;  4HV6 A;  1CF7 A;  4PCQ A;  4RGX A;  3F21 A;  3RJP A;  3Q9V A;  3ROU A;  1QZY A;  2ZBK A;  3RDI A;  3ZMT A;  4S04 A;  1SFE A;  1R00 A;  3VOE A;  1FWZ A;  3E6B A;  1KQ0 A;  4P96 A;  3IRR A;  2A69 F;  1K78 B;  4GXO A;  2XV4 S;  3FMQ A;  2HZT A;  2IW5 A;  2V9V A;  3FMS A;  3ABT A;  3ULQ B;  1XCV A;  1DPR A;  4GYI A;  1K78 A;  5D5W B;  3WTX C;  4QWQ A;  5F64 A;  5FO5 A;  4WK8 F;  1JGS A;  1XGO A;  3WE3 A;  4G7O F;  3TDU C;  2ACJ A;  4OMZ A;  4L9N A;  1QZZ A;  1BI2 A;  2BBY A;  2A68 F;  1IRF A;  3FF5 A;  3IWF A;  1FSH A;  3TO6 A;  1MDM B;  4UVB A;  5FB2 A;  3DKW A;  4MGR A;  3FHZ A;  3PQJ A;  1HBX G;  1IN5 A;  1UCR A;  3U9G A;  1XGS A;  4FX4 A;  1KQ9 A;  5JFR A;  2RKH A;  1QQI A;  2EB7 A;  3JSP A;  2HQR A;  2VOP A;  3WTY C;  2VE9 A;  3FM3 A;  3DF8 A;  2IPQ X;  3QU6 A;  1Z9C A;  3GW2 A;  3WU0 A;  1GXP A;  2HR3 A;  1IF1 A;  1G3Y A;  2K86 A;  2DPD A;  2BE5 F;  3T8T A;  2HWV A;  1XSV A;  3GFL A;  4OIN F;  1ZG5 A;  4Q48 A;  3R6S A;  4CZZ A;  2LNB A;  2ZNY A;  4K2E A;  1DP7 P;  2JPB A;  4IRH A;  1HW2 A;  2GA2 A;  5ERI A;  2EWN A;  5D5X B;  1SAX A;  4ZZD A;  3RYR A;  2QQ9 A;  3ECH A;  3LA2 A;  3JAM Z;  3DV8 A;  4XBF A;  1ZRE A;  2NRA C;  4LLL A;  3MWM A;  2FNP A;  1S7A A;  4ZYH A;  4WX9 A;  2FNA A;  3K69 A;  3M7G A;  3KLO A;  1FLI A;  2HFH A;  2EFW A;  4ENM A;  4RS8 A;  4OMY A;  4KMF A;  1OYY A;  3ZN1 A;  1E2X A;  2ZME B;  1HW1 A;  2GAU A;  2HGC A;  1ZAR A;  3DP7 A;  3L00 A;  4KNY A;  1BC7 C;  4LB5 A;  5E20 A;  2W84 A;  4O6J A;  5BQT A;  4WCG A;  4G7H F;  1YTY A;  2F5F A;  2W57 A;  1STZ A;  1ULY A;  2ZME A;  1HKQ A;  3HHG A;  2OD5 A;  4L9T A;  5D4S A;  1U5T B;  2DQL A;  4YFN F;  5JHU A;  1H9T A;  2XRO A;  4DNC A;  3L7W A;  1IAW A;  1LEB A;  2ZKZ A;  2FXA A;  2BYV E;  2H6C A;  3I0T A;  2YU3 A;  1ZLJ A;  3V4G A;  1F4K A;  1U5T A;  1USS A;  4JK1 X;  2O8X A;  3ABU A;  1J59 A;  4IXA A;  1S8N A;  2CW0 F;  3CO7 C;  2P7V B;  2E7X A;  3W6J B;  1LNW A;  2EFO A;  1R1T A;  1O3T A;  1XMA A;  5HS7 A;  4HQM A;  1OR7 A;  3LST A;  3BPX A;  2MH9 A;  4A2U A;  1T98 A;  3ZPL A;  4EGY A;  2G7H A;  1D8J A;  5CVI A;  5DCF A;  4Z2Y A;  3D0S A;  2Z99 A;  1XSX A;  2KRF A;  3K9T A;  3O6B B;  1ON2 A;  3AAF A;  4IRG A;  4U0Y A;  3WTU C;  3M1E A;  1ZN2 A;  5CVU A;  4AVP A;  3FX3 A;  3GZ5 A;  2EFQ A;  3TO7 A;  4KIB A;  1T2K A;  5CLS A;  3U1D A;  4LK0 F;  2NNN A;  2JZY A;  4YII A;  1HW5 A;  3TOA A;  3P9K A;  2LKP A;  4KMU X;  1AWC A;  1OPC A;  1PP8 F;  1ZH5 A;  3IKV A;  5ICC A;  1REP C;  3OOP A;  4CHU A;  2AXL A;  4WXH A;  2QZ8 A;  2HOE A;  3DFG A;  2C6Y A;  2QWW A;  4PDK A;  4OIO F;  3KEQ A;  3F8N A;  2M1B A;  3GVA A;  3K1M A;  4UVA A;  1SFX A;  3IL2 A;  1ZG3 A;  3E6M A;  1FBS A;  4BXU A;  2WC2 A;  2XIG A;  1LB2 A;  5ICG A;  4M9S A;  5DDG A;  1SD5 A;  4ESJ A;  2VT3 A;  2IP2 A;  2Y0M A;  1MD0 A;  3J81 Z;  5E1X A;  2A6E F;  3RPQ A;  3V8L A;  2L54 A;  4HZF A;  3F22 A;  3Q5F A;  3K2Z A;  3MEX A;  2OZ6 A;  5CVV A;  5K1Y A;  3M8E A;  1BIB A;  3RKY A;  1XDS A;  3HRT A;  4N9I A;  4O3M A;  1R1V A;  1GVJ A;  2H94 A;  3CDH A;  2HKX A;  3R0J A;  1B59 A;  2VT2 A;  4M71 A;  4EVI A;  5L3D A;  4CXF A;  1S7O A;  1A04 A;  1P4W A;  1B1B A;  4N0B A;  3ECO A;  1RUN A;  4A6D A;  4ENN A;  1VTN C;  3ISP A;  2IA0 A;  1IXS B;  1PUE E;  3WGI A;  4ZYD A;  5F6F A;  4EM0 B;  2YX4 A;  5HLI A;  2CO5 A;  2K4B A;  4Q47 A;  5ILV A;  4R8H A;  4CYD A;  5A2Q K;  4A0Z A;  1WQ2 A;  1SD7 A;  4WF2 A;  1BI1 A;  5E1W A;  1G6N A;  2ELH A;  1JHH A;  3PQK A;  2R7D A;  2IJL A;  1Y0U A;  3KP4 A;  2XAJ A;  4I0B A;  4FX0 A;  3JW4 A;  1RI7 A;  4GGG A;  5CVR A;  5IT3 A;  3HRM A;  4LJZ F;  2XAF A;  4A12 A;  1KU9 A;  3M9A A;  3TDZ C;  4QLC U;  3NRV A;  4AIK A;  1TQI A;  2D1V A;  1SD6 A;  3I58 A;  3N97 A;  1LJ9 A;  3F6O A;  4BHC A;  4ON0 A;  1IRG A;  1KU2 A;  2PQ8 A;  1R5G A;  4S05 A;  4KIC A;  4LLG F;  2H27 A;  1BIA A;  3Q9S A;  3BP8 A;  2FF4 A;  2H09 A;  1J0R A;  4OU0 A;  3KET A;  4HYE A;  4GCV A;  3VEP A;  3ZP5 A;  4NHJ A;  2XAS A;  4R1H A;  1QNT A;  4IPA A;  5ICE A;  1F1Z A;  5IT9 Z;  4M74 A;  2P6S A;  1QGP A;  1B6A A;  3P7N A;  2PI0 A;  3CUQ C;  5FD5 A;  4ETS A;  1FSE A;  2HTJ A;  4HX7 A;  4LGW A;  1PP7 U;  3DPL C;  4IJA A;  5DYM A;  2AS5 F;  1KU3 A;  5J8F A;  2Q0O A;  4U88 A;  4ESB A;  4EJV A;  2KIF A;  4U0W A;  2FBI A;  2DT5 A;  3I5U A;  3MZH A;  3E5Q A;  5CJ9 A;  2RGV A;  3QP5 A;  3B02 A;  2FML A;  3GXO A;  1FT9 A;  1GXQ A;  5E8G A;  5LGU A;  3SHF A;  3F8M A;  2PFB A;  3V7R A;  3DXJ F;  5D6F A;  1OKR A;  2M87 A;  1IXC A;  1XN7 A;  3R0A A;  2IVM A;  1ODD A;  4BH9 A;  2OAZ A;  3GX4 X;  5AIQ A;  2DAO A;  2FEZ A;  5KVR A;  2ISZ A;  4HV5 A;  3O2P E;  3KEO A;  3KP6 A;  4BHB A;  3H3Z A;  5E1Z B;  1YO5 C;  5LGT A;  5TRD A;  2O6G E;  1E17 A;  1T0F A;  1KGS A;  4HF2 A;  3TO9 A;  4LG0 B;  5LHG A;  4P9U A;  3LAP A;  1FBQ A;  2QLZ A;  2RC4 A;  3BZ6 A;  4A0X A;  3F3X A;  3ZMZ A;  2VC0 A;  1MGT A;  4I09 A;  2X4H A;  5HLG A;  1D8K A;  4EJO A;  2EFP A;  2JSC A;  4LG0 A;  1NHA A;  3I64 A;  2DI3 A;  1T38 A;  4A5N A;  4M6X A;  1T39 A;  1K7A A;  3SZP A;  4XSX F;  5HS9 A;  3IC7 A;  4HA8 A;  1MJB A;  3L2C A;  1TW2 A;  1I6X A;  5JR3 A;  4YIF A;  1OYW A;  3ELK A;  1KU7 A;  2DO7 A;  5L3G A;  5A2Q Z;  3W6K B;  3RPU A;  5HDK A;  2NYX A;  1V3F A;  3IWZ A;  1J5Y A;  4KIG A;  1WSU A;  4RB3 C;  5LBQ A;  3HTS B;  4MTD A;  5ILS A;  4ENJ A;  2L02 A;  4HBL A;  2J5O A;  3J80 K;  1TQP A;  4L9J A;  2CSO A;  4KFC A;  3RIR A;  1OYI A;  3BPV A;  1W7P A;  1ZHF A;  3GFM A;  1U78 A;  3COA C;  1R22 A;  4HAM A;  1HQC A;  2IT0 A;  3BJA A;  2WV0 A;  5K5R A;  2F5D A;  2YSR A;  2OQG A;  1FZP B;  2STT A;  2VBZ A;  1EV7 A;  2KIM A;  2P8T A;  4Y17 A;  4JQF A;  1IN6 A;  1TLH B;  4ZZL A;  2OU2 A;  3EDP A;  3PFI A;  4BQA A;  2Y75 A;  4G94 A;  3K1N A;  4BAY A;  3JTG A;  2ZNZ A;  2L3D A;  1EH6 A;  3HOT A;  1YYV A;  5F1R A;  4CIC A;  3HRU A;  1J2X A;  3IHU A;  1YIO A;  4HX8 A;  4A0Y A;  4LFU A;  2E7W A;  4FHT A;  5LEJ A;  4YG2 F;  1LQ1 A;  4RB1 A;  1UHW A;  1MJ9 A;  4A5M A;  5BMZ A;  4CO8 A;  2JT1 A;  3IKT A;  1B9N A;  2KKO A;  2QM3 A;  5L3B A;  1MKM A;  2EV5 A;  3SQN A;  5DD4 A;  3MAJ A;  4I2O A;  1Z1D A;  2CYY A;  5ICF A;  2QQA A;  2MLK A;  3LFK A;  2ZO4 A;  3GWZ A;  3RKW A;  2A5Y B;  2LF7 A;  2K7L A;  4KYW A;  2MBF A;  1ZGA A;  4UUV A;  1YS7 A;  5FLX K;  2K4J A;  2V1D A;  2O3F A;  4G6Q A;  3GFJ A;  4HLY A;  1LDD A;  3HSR A;  3ZMD A;  1RNL A;  3GEZ A;  4P5O A;  4G8X A;  4RB2 C;  2QQB A;  1S29 A;  4B8X A;  1Z05 A;  3RYP A;  5LRS A;  3MQ0 A;  4KT5 C;  3CUQ A;  2WWY A;  2OZU A;  4RB0 A;  4R79 A;  2O0Y A;  3TKY A;  2RQP A;  3I53 A;  3RTR A;  2VOO A;  1EH8 A;  2FRH A;  1FOK A;  4I02 A;  1IUY A;  2IRF G;  4EJU A;  4DQ2 A;  3KCC A;  1KA8 A;  3C3W A;  2HDC A;  6PAX A;  3C1D A;  3KP3 A;  2W25 A;  1FYK A;  5KK1 A;  5HS8 A;  2E1C A;  1ZLK A;  5DUK A;  3E3V A;  2ESH A;  3G3Z A;  1B4A A;  4UVC A;  1BC8 C;  5CVJ A;  1KQ8 A;  4NB5 A;  3LWF A;  1I1S A;  4KDP A;  3P9C A;  3RI4 A;  3ERE D;  3FXR A;  3HIF A;  2D45 A;  3FZV A;  4MEX F;  4EJT A;  1W4M A;  3E5U A;  3CTA A;  2EV6 A;  2EV0 A;  1TNS A;  1BN5 A;  4AD9 A;  1D5V A;  3T1B A;  1QPM A;  2MC3 A;  1LVA A;  2VBW A;  1HSJ A;  3TGN A;  2STW A;  3WTV C;  4ESF A;  3WTW C;  1ZGJ A;  1Z6T A;  2GQQ A;  2PN6 A;  1WKM A;  1FNN A;  2P5V A;  3HSE A;  2UXN A;  2RDP A;  2M30 A;  5LHH A;  3HSF A;  4XLN F;  4P55 A;  1CGP A;  2XAG A;  3BWG A;  3CLO A;  4HLX A;  5DD8 A;  1FP2 A;  4OIR F;  3V7S A;  2ESN A;  3DEU A;  2FSW A;  4I01 A;  4HW0 A;  3LA3 A;  2BV6 A;  5LGN A;  4EGZ A;  1XB4 A;  3BOQ A;  1O7L A;  1HXD A;  4MTE A;  1O7F A;  4O5V A;  1TTY A;  4M6Y A;  4KIF A;  5FFX A;  4CDG A;  4XRF A;  2O61 A;  4IRI A;  2EA2 A;  5J6X A;  1ZRD A;  3CJN A;  5DEQ A;  2IA2 A;  2QBY B;  2Z3Y A;  2Z9O A;  2XRN A;  1XGM A;  2YPR A;  1C0W A;  4U7B A;  3WTT C;  1DDN A;  1FYM A;  5D4R A;  2E1N A;  3KLN A;  4MQV A;  2PMH A;  2QBY A;  5DV5 A;  1L3L A;  2OQR A;  1U2W A;  3FMR A;  4HDV A;  4LD5 A;  3JTH A;  5H6Q A;  2MA3 A;  2F5C A;  2A07 F;  3VB2 A;  5DCM B;  1FY7 A;  2L01 A;  1F9N A;  4L0Y B;  1R36 A;  2IA1 A;  4OIP F;  3FXQ A;  4BYY A;  3DQV C;  3KZZ A;  1O57 A;  2GWR A;  1LDK B;  5EEH A;  3JAM K;  5DCM A;  4ZH4 F;  3EUH A;  2XKO A;  1P4A A;  3ZMV A;  4CGZ A;  4IVN A;  3HTU A;  3E97 A;  2XGX A;  2VE8 A;  4EQQ A;  1Z91 A;  3R4K A;  2XAQ A;  3F23 A;  1R7J A;  3C18 A;  2CFX A;  4KN4 X;  1IN8 A;  2F2E A;  1FC3 A;  1T6S A;  4MEY F;  2CG4 A;  1BI3 A;  3BRO A;  2UZK A;  1BOA A;  1U3E M;  1YFH A;  3WGG A;  2FBH A;  5BPI A;  4WXD A;  3I59 B;  2ADU A;  3F8F A;  2O03 A;  4XLP F;  2Y48 A;  1U5T C;  4Y15 A;  2MD5 A;  1ZRC A;  4M72 A;  1P4X A;  1F5T A;  1YLF A;  3KFW X;  3H92 A;  3I59 A;  1YS6 A;  5HVQ C;  5D5V B;  2COM A;  1P6R A;  2ETH A;  2NS0 A;  1XD7 A;  1YG2 A;  1W5T A;  3L9F A;  1D3Y A;  5TJJ A;  5E8I A;  4HQE A;  1FX7 A;  2L4A A;  4YFX F;  4LMY A;  2V79 A;  1FBU A;  1U6G A;  2JPC A;  1MJA A;  3WE2 A;  4EV0 A;  4E70 A;  4UV9 A;  5L3E A;  4IF4 A;  5J8C A;  4EJW A;  2V1U A;  2CWE A;  3BJ6 A;  4AIH A;  2OA4 A;  4RGU A;  1O3S A;  5LLQ A;  1ONV A;  1G4D A;  1I27 A;  2JRT A;  3KZY A;  1BBY A;  5ILU A;  2HQN A;  3U2R A;  3QPH A;  4UV8 A;  4A6E A;  5EEG A;  5ED4 A;  2X0L A;  4BHP A;  1GHC A;  3SZT A;  3WGH A;  2PJP A;  3T8R A;  4ZYG A;  4D0P A;  1P92 A;  2M5W A;  1O3R A;  3GUD A;  4G6D A;  2OBP A;  2WTE A;  1YW8 A;  5BPD A;  4HX4 A;  3VFZ A;  3F8B A;  5FD6 A;  4LLN A;  3J7A O;  1TBX A;  3VOD A;  4OOI A;  1EH7 A;  4IHS A;  2M45 A;  3QRF F;  4M73 A;  4H0E A;  1LDJ A;  2L4M A;  1RUO A;  2ZCW A;  3S2W A;  2F5E A;  2XHK A;  3I71 A;  3I54 A;  4KUM A;  2ZJ2 A;  2ISY A;  2DBB A;  2R3S A;  3EYI A;  4LB6 B;  3BDD A;  4AIJ A;  4NQW A;  1R5H A;  4PGG A;  4P9F A;  2EJR A;  5JI6 A;  1MDM A;  3NEU A;  4XSZ F;  3K1P A;  4U0V A;  4HF1 A;  1FP1 D;  1SMY F;  2BEO A;  2RN7 A;  1V4R A;  2XAH A;  4HOB A;  4EMS A;  4WWC A;  3WG9 A;  3GLX A;  5BS6 A;  1P2F A;  1W7P B;  2DW4 A;  1I1G A;  5D8L B;  2ZXJ A;  1UB9 A;  2W24 A;  1ZYR F;  1PDN C;  2PLY A;  5LHI A;  3KP2 A;  3J81 K;  3F72 A;  3R61 A;  2PEX A;  3V7C A;  2LDU A;  5D6E A;  1IN7 A;  3TQN A;  1K79 A;  1G3T A;  1J9I A;  3BJO A;  3EQL F;  2MH2 A;  3GFI A;  2ZFW A;  4KA4 A;  2RV8 A;  5LRR A;  4MHG A;  3MZY A;  1UST A;  5E18 F;  1H9G A;  3JSO A;  1Q1H A;  2W85 A;  2D1H A;  1Z6R A;  5E17 F;  1I5Z A;  5L3C A;  4F7Z A;  2K02 A;  1WRJ A;  3HHH A;  5CYV A;  3T0Y A;  1BM9 A;  3B73 A;  4HDU A;  3EYY A;  1QBJ A;  1H0M A;  3SFZ A;  3LQQ A;  2RVC A;  2GIV A;  2PBI A;  4HF0 A;  4FT8 A;  2V6C A;  4JBA A;  2QVO A;  3F8C A;  1L0O C;  2HYG D;  3ML6 A;  3R60 A;  1XSD A;  2K27 A;  2XUB A;  2P4W A;  2A61 A;  5D5U B;  2DQR A;  3GF2 A;  5AON A;  1TQM A;  3MFK A;  1ON1 A;  1ZAO A;  1B9M A;  2G9W A;  4ZYE A;  2VXZ A;  4RGS A;  3CUQ B;  2RNJ A;  4AWX B;  3QAH A;  4N9H A;  3V8K A;  3ZMU A;  3D5L A;  4KN7 X;  3GZ6 A;  2GXG A;  4PGH A;  5HOO A;  1SMT A;  5JVT A;  1ZG1 A;  3P9I A;  1S3J A;  1R58 A;  1TW3 A;  1SD4 A;  2G7U A;  3N4M A;  4RGR A;  2HKO A;  1QO0 D;  5L3F A;  2LF8 A;  2EA4 A;  2EFN A;  1HKT A;  2FA5 A;  2MLG A;  3T5X A;  3QPT A;  2DLL A;  2NAZ A;  2DK8 A;  2J5P A;  2UWM A;  3LA7 A;  4M9Z A;  2Z5U A;  5LEK A;  2XKP A;  2YR2 A;  5HDG A;  2P6T A;  3FWE A;  3OV8 A;  3WOD F;  3QP6 A;  4MQ9 F;  5FFZ A;  4I98 B;  5IT9 K;  1YQA A;  3RKX A;  3KE2 A;  4ENK A;  3WTS C;  5BOX A;  5D8K B;  2P5L C;  1JXS A;  1W7P D;  3E6D A;  2HS5 A;  2Z33 A;  2FE3 A;  1G3W A;  5HDN A;  2DFI A;  4RAZ A;  4IHT A;  4EM1 A;  2A3S A;  3KP7 A;  4OIQ F;  4UHT A;  1U8R A;  2CQK A;  4EM2 A;  2D2W A;  4TV7 A;  4L0Z B;  1BI0 A;  3QU3 A;  1UFM A;  1R23 A;  1UHM A;  2XVC A;  2B0L A;  3ZQ7 A;  1G3S A;  1DUX C;  2TDX A;  4MNU A;  2H6B A;  4M9X A;  3SXY A;  3QOP A;  3FXU A;  3EET A;  2P7C B;  1LEA A;  2YX7 A;  1DPU A;  4Q5S F;  3F6V A;  4Q4Z F;  3REO A;  2QEN A;  4LK1 F;  4RAY A;  2DTR A;  3MCZ A;  1KYZ A;  2P5K A;  4G7Z F;  3IRQ A;  2NNY A;  2HEO A;  1R1U A;  3I4P A;  2R7F A;  2FU4 A;  3NQO A;  1K6O A;  4UXN A;  2FOK A;  3GYH X;  1WWX A;  3G73 A;  1XCB A;  2BGC A;  3KP5 A;  2Q8K A;  1HST A;  3J80 Z;  3HRS A;  2VBY A;  2HYF A;  3CUO A;  3ZN0 A;  4G9Y A;  2PMU A;  4GYG A;  4GO1 A;  2VBX A;  4U7D A;  2VN2 A;  3GO5 A;  4I0A A;  2DK5 A;  2GA1 A;  4YFK F;  2LSO A;  3C7J A;  1S6L A;  4UNO A;  3CO6 C;  3TOB A;  3DPT A;  4Y13 A;  2KIU A;  5H20 A;  2QUF A;  1Z7U A;  2KJC A;  1RIO H;  5AIP A;  4WXC A;  2FMY A;  3LAJ A;  2PG4 A;  2VON A;  2DPU A;  1SFU A;  4I7H A;  1IN4 A;  3K0L A;  3HUG A;  3L09 A;  1IZ1 A;  3WTZ A;  1IW7 F;  5H6R A;  3O3K A;  4L9V A;  2VC1 A;  4ASN A;  1J75 A;  2FQ3 A;  3ZMS A;  1KYW A;  4L5I A;  3HYI A;  1O3Q A;  5DUI A;  4BNC A;  3E5X A;  2HTS A;  2GXB A;  4PZJ A;  1XMK A;  1YW7 A;  5FLX Z;  1BJA A;  1JHF A;  3E6C C;  4L18 B;  1TNT A;  1JE8 A;  3LQR A; 
#chains in the Genus database with same CATH topology
 1HKS A;  4M3E A;  2A6H F;  2V1X A;  4CUG A;  1AOY A;  3BY6 A;  3V8J A;  3BTL A;  2M8E A;  2Q2E B;  3FXM A;  3M8F A;  1T08 B;  3LSG A;  3CDI A;  4LOC A;  2VQH A;  4LIV A;  2QYO A;  5K5O A;  5FGM A;  4FQG A;  3HOS A;  3BCA A;  1MZB A;  1RZ4 A;  2E35 A;  1ZRF A;  3B6C A;  2NVT J;  2GZW A;  4XMY A;  2O7O A;  4ZYA A;  1PJR A;  5KAI C;  1W5S A;  4RM3 A;  2R5Y B;  2Y0S A;  2CU7 A;  3H3U A;  2X51 A;  2BOL A;  4GDF A;  1X2N A;  5JHF A;  3E0J B;  1YW9 A;  1WPK A;  2CGP A;  4OAZ A;  3ZQI A;  2Q2E A;  2VJ5 A;  1X1A A;  3K70 C;  2XDV A;  1TWF J;  3FM5 A;  5M3M J;  3Q0U A;  3IH3 A;  1LE8 A;  2MSY A;  1FYL A;  4HNV A;  2UXX A;  2KFD A;  3WU1 B;  1J7K A;  3CCM I;  4L5J A;  5LD2 C;  1CF7 B;  1QU3 A;  3LSR A;  1ZR2 A;  3A2K A;  4OAY A;  5HLH A;  2FBK A;  5K5Q A;  2DU9 A;  5DM6 F;  2KJB A;  1W0U A;  2CQQ A;  2R7U A;  1TWA J;  2LLK A;  1UZC A;  1OMI A;  1FPQ A;  2W48 A;  1WI9 A;  2EK5 A;  1J09 A;  3VPR A;  4BY7 J;  1X3U A;  2ELJ A;  4B09 A;  1XGN A;  2E5N A;  2VOD A;  1ENH A;  1XDU A;  1IXR C;  2JTV A;  1VZ0 A;  2K9N A;  3S1N J;  2DN0 A;  2DYS H;  2W4S A;  4HV6 A;  1CF7 A;  4BU2 A;  4PCQ A;  2EIL H;  2R7R A;  5F0H A;  4RGX A;  3F21 A;  3S16 J;  5M5W J;  3RJP A;  3H9J A;  3Q9V A;  3ROU A;  1QZY A;  1S7E A;  2ZBK A;  3RDI A;  3ZMT A;  2B7E A;  3A4C A;  2CUF A;  4S04 A;  3H9Q A;  1SFE A;  1PYV A;  1E3O C;  1IDY A;  2BXZ A;  2HOA A;  3RKQ A;  2R0Q C;  1R00 A;  3VOE A;  2HU9 A;  2NXN B;  4XOR A;  1FWZ A;  4A3L J;  2DDA A;  2P0W A;  3E6B A;  2KHM A;  4XLA A;  2EIJ H;  1KQ0 A;  3CP2 A;  1E0E A;  2DA2 A;  2A6T A;  4P96 A;  2JWT A;  2V4J C;  4AU7 A;  3IRR A;  1MBH A;  2A69 F;  3LNQ A;  1MMN A;  1K78 B;  4GXO A;  3BG6 A;  3OIP A;  1YI2 I;  1P9Q C;  2QF7 A;  1WJA A;  3DCF A;  3TL4 X;  2XV4 S;  2O9L A;  3PL8 A;  4M3F A;  5HNF A;  1AKH B;  3H0D A;  4PJJ A;  1UHS A;  3C2G A;  2HZT A;  3FMQ A;  4PJL A;  5IP9 J;  2IW5 A;  2V9V A;  1UG0 A;  4HPQ A;  2K3F A;  2KIS A;  2RNG A;  3C2B A;  3FMS A;  3ABT A;  3ULQ B;  3CJQ B;  4D1Q A;  1XCV A;  4Z6Y A;  2M7A A;  1DPR A;  4GYI A;  1K78 A;  5J40 A;  2KLO A;  5D5W B;  2WY8 Q;  3WTX C;  4QWQ A;  5J1Y A;  1W0T A;  4IQJ A;  5F64 A;  3S17 J;  3K4N A;  2X6X A;  5FJ8 J;  1XMX A;  2DDB A;  1AKH A;  4BS9 A;  5FO5 A;  4BUP A;  4WK8 F;  1JGS A;  3LSI A;  2A05 A;  4C2M J;  4BE1 A;  5JLW A;  1W36 D;  1XGO A;  3WE3 A;  4G7O F;  3TDU C;  2ACJ A;  4ZDP A;  1LKX A;  4OMZ A;  4L9N A;  4G12 A;  1YOV B;  5J47 A;  1QZZ A;  1BI2 A;  2BBY A;  2MG4 A;  3PJR A;  1POG A;  2A68 F;  1IRF A;  2IBD A;  3FF5 A;  3IWF A;  1KON A;  4NQW B;  1FSH A;  3TO6 A;  2K9M A;  4CH7 A;  1W5C C;  1MDM B;  4UVB A;  1FMW A;  5KAF C;  3DKW A;  5FB2 A;  1BW5 A;  2XPU A;  4RLQ A;  4MGR A;  2WBM A;  3EUK L;  2Y2Z A;  3PQJ A;  3FHZ A;  1HBX G;  1IN5 A;  5TIS C;  2KDO A;  2QKM B;  1K83 J;  1UCR A;  4CCJ A;  2R92 J;  3U9G A;  1XGS A;  2DMP A;  3ERM A;  4FX4 A;  1MMA A;  1KQ9 A;  4D7N A;  5JFR A;  1IUF A;  4XON A;  2RKH A;  1QQI A;  1ZR4 A;  2ZSI B;  3L2W A;  2EB7 A;  3JSP A;  2HQR A;  2VOP A;  2FUG 2;  1BW6 A;  1WJB A;  4B4C A;  3WTY C;  1UEL B;  2VE9 A;  3HOY J;  3FM3 A;  3DF8 A;  3OY9 A;  3W2W A;  2HNH A;  2MAB A;  2IPQ X;  3QU6 A;  1Z9C A;  3GW2 A;  1CQT A;  2VQL A;  4II2 A;  3WU0 A;  2ZC2 A;  1QVT A;  5IY5 H;  1GXP A;  2WA0 A;  2HR3 A;  1VQO I;  1IF1 A;  1G3Y A;  2RAE A;  1JGG A;  2K86 A;  1DGW Y;  2UUZ A;  2M7B A;  2R7W A;  2DPD A;  2BE5 F;  1R49 A;  2L0K A;  3T8T A;  3A03 A;  2DXI A;  3QPL A;  5EYR A;  2M8G X;  2GM4 A;  2HWV A;  1ETO A;  1X2M A;  1XSV A;  3GFL A;  3I3L A;  2BY3 A;  4A3M J;  4OIN F;  1ZG5 A;  4Q48 A;  3R6S A;  4CZZ A;  2JA6 J;  3CLQ A;  2MGQ A;  2LNB A;  2ZNY A;  5JVG F;  2EZH A;  4K2E A;  5F04 A;  1GLN A;  1H8A C;  1DP7 P;  2JPB A;  4IRH A;  4XRM A;  4BAC A;  1HW2 A;  2GA2 A;  5ERI A;  3BG3 A;  2EWN A;  1ERD A;  5D5X B;  4A3E J;  1SAX A;  4ZZD A;  2VJI A;  2V7F A;  1DU0 A;  3RYR A;  2QQ9 A;  2LVS A;  3ECH A;  3LA2 A;  3JAM Z;  3DV8 A;  3TED A;  4XBF A;  2LH9 A;  2M2E A;  1TP4 A;  1ZRE A;  2NRA C;  4LLL A;  2KMU A;  3HOU J;  3CZ6 A;  3MWM A;  2WY7 Q;  2FNP A;  1VQ4 I;  4EAT A;  5IYD J;  2VIX A;  2E36 A;  1PVE A;  3S8P A;  3L2V A;  1S7A A;  4ZYH A;  4WX9 A;  3E1S A;  1NK2 P;  2FNA A;  3K69 A;  4QPQ A;  3CC4 I;  3M7G A;  3KLO A;  2M9H A;  2PJR B;  1FLI A;  3ZQC A;  3BR2 A;  2HFH A;  3KYD B;  3S32 A;  2EFW A;  4ENM A;  4RS8 A;  4OMY A;  4KMF A;  1OYY A;  3ZN1 A;  3S2H J;  2JRM A;  3C2H A;  1E2X A;  2R7X A;  4HST A;  2ZME B;  3TW7 A;  4DW6 A;  2ID3 A;  3HL2 A;  1HW1 A;  2GAU A;  2HGC A;  1ZAR A;  2CS3 A;  2OUM A;  3DP7 A;  3HM5 A;  3L00 A;  5M5Y J;  4KNY A;  2DA4 A;  2E1M C;  1EA3 A;  4BL0 B;  1BC7 C;  2PJR A;  4LB5 A;  4PSW A;  5E20 A;  2W84 A;  4O6J A;  4QIW N;  4XQF A;  1WCM J;  5BQT A;  3EUH C;  4KT6 A;  4WCG A;  4G7H F;  1YTY A;  1LUJ B;  1VQ6 I;  2F5F A;  2W57 A;  1STZ A;  1ULY A;  2ZME A;  2F4M B;  5E79 C;  3DBR B;  1HKQ A;  4NDL A;  3HHG A;  3K7A J;  4X1E A;  2OD5 A;  4L9T A;  5D4S A;  1U5T B;  1SAU A;  2DQL A;  4YFN F;  5JHU A;  1WJD A;  1H9T A;  2AXT C;  2LG4 A;  2XRO A;  3TBI A;  4DNC A;  4IHW A;  2L2O A;  3L7W A;  5FKO A;  3HKZ A;  4DZP A;  1IAW A;  1HC8 A;  2XGE A;  1WI3 A;  1LEB A;  5E3O A;  2ZKZ A;  2FXA A;  1D1A A;  2BZT A;  2BYV E;  1I6H J;  2H6C A;  3K4J A;  1WZ2 A;  4RA2 A;  3I0T A;  1EF4 A;  1X1B A;  2YU3 A;  1ZLJ A;  3V4G A;  1F4K A;  3G1M A;  3ZQL A;  1U5T A;  4NC8 A;  3A1Y A;  3PSF A;  5F08 A;  4IZZ A;  1USS A;  4JK1 X;  2O8X A;  3ABU A;  1J59 A;  4IXA A;  2FD5 A;  2ME0 A;  4XOP A;  1HCR A;  4CCM A;  1S8N A;  3LOC A;  3FKI J;  3I4N J;  2CW0 F;  3K4B A;  3CO7 C;  2EBI A;  2P7V B;  5BNG A;  1Y56 A;  2JMW A;  2E7X A;  2DJN A;  3W6J B;  1LNW A;  3G2B A;  2EFO A;  2Z16 A;  1R1T A;  1O3T A;  1MSE C;  1XMA A;  2KL4 A;  5HS7 A;  2NOJ B;  2E1O A;  4HQM A;  1OCR H;  2CV1 A;  1OR7 A;  2F6C A;  2F48 A;  4M3D A;  3IUO A;  4P1W A;  3LST A;  3BPX A;  2MH9 A;  3N05 A;  4BDZ A;  2ZB9 A;  3RSN A;  1ETX A;  1BR2 A;  2XRL A;  4A2U A;  1T98 A;  3ZPL A;  4EGY A;  2G7H A;  1D8J A;  5CVI A;  5DCF A;  1OFC X;  5DTD A;  2VKD A;  1Y8R B;  2JUG A;  3D0S A;  4Z2Y A;  5TGT A;  2Z99 A;  4W1U A;  2PMZ N;  2JN6 A;  1XSX A;  2EZK A;  2KRF A;  3K9T A;  3O6B B;  1ON2 A;  4IRG A;  3AAF A;  1B72 B;  1JKR C;  4U0Y A;  3WTU C;  3M1E A;  1ZN2 A;  1BR1 A;  3KIO A;  5CVU A;  4RAG A;  4AVP A;  4V2F A;  1IG7 A;  3FX3 A;  3GZ5 A;  1QA6 A;  2EFQ A;  3TO7 A;  2KDZ A;  3RQI A;  1HLV A;  4XN0 A;  4KIB A;  5GAH J;  3WU2 C;  5CLS A;  1T2K A;  3U1D A;  4LK0 F;  2NNN A;  2JZY A;  3D5R C;  1Z7L A;  2K9S A;  4YII A;  4HEA 2;  1HW5 A;  3H5A A;  1TT0 A;  1OIS A;  2ZJR F;  3TOA A;  1ETW A;  3P9K A;  2LKP A;  4KMU X;  2COB A;  1AWC A;  5C44 J;  1OPC A;  4D9J A;  2VJ4 A;  1PP8 F;  1ZH5 A;  3IAS 2;  1AU7 A;  3IKV A;  5ICC A;  1REP C;  3OOP A;  3OR2 C;  1IJW C;  4XIC A;  4DBR A;  4CHU A;  2AXL A;  4WXH A;  3M3Y J;  2QZ8 A;  2HOE A;  3DFG A;  2C6Y A;  2QWW A;  4CYC A;  3V42 A;  3CCY A;  2KRH A;  4PDK A;  4OIO F;  3UNG C;  2EZI A;  3KEQ A;  3F8N A;  2M1B A;  3GVA A;  2VLA A;  3FDY A;  2LRD A;  2W1O A;  3K1M A;  4UVA A;  4X0G A;  2R7Z J;  2YS9 A;  4FE7 A;  4B47 A;  4RBO A;  1VQ8 I;  1SFX A;  3K4K A;  5HNH A;  3H5R A;  1N78 A;  3IL2 A;  1ZG3 A;  3E6M A;  2HQA A;  3BZC A;  5H2F C;  1FBS A;  3VDX A;  4BXU A;  1X4O A;  2WC2 A;  2XIG A;  4XM3 A;  1LB2 A;  5ICG A;  2L7M P;  1WGX A;  4M9S A;  5DDG A;  1SD5 A;  3VSK A;  4ESJ A;  1MNE A;  2GOX B;  2H1K A;  2VT3 A;  2IP2 A;  2Y0M A;  1MD0 A;  3J81 Z;  1UG2 A;  5E1X A;  3GTJ J;  2A6E F;  3RPQ A;  3V8L A;  1E3P A;  2L54 A;  1QVU A;  1FIA A;  4HZF A;  3F22 A;  1PUF B;  3Q5F A;  3K2Z A;  3MEX A;  4BGD A;  2OZ6 A;  1FTZ A;  5CVV A;  5K1Y A;  1TWC J;  3M8E A;  2GOM A;  4EEF G;  3A01 B;  1RKT A;  3BG7 A;  1BIB A;  3RKY A;  1B8I A;  3L1P A;  1XDS A;  3PO2 J;  3JRI A;  1ZKG A;  2KT0 A;  2B9S A;  3BTC A;  2L7F P;  3HRT A;  5IYB J;  4N9I A;  4O3M A;  4LIT A;  4ZDL A;  2DA1 A;  2JVH A;  1R1V A;  1GVJ A;  2OF7 A;  1PUF A;  2ECC A;  2H94 A;  3CDH A;  4W97 A;  2K9Q A;  2CUJ A;  5CKT A;  3BR6 A;  2HKX A;  3HUG B;  1SFK A;  3R0J A;  3A01 A;  1B59 A;  1IV8 A;  2VT2 A;  5C4X J;  4M71 A;  2CW7 A;  4EVI A;  5GP9 A;  3F0C A;  2ECB A;  3OYI A;  5L3D A;  2L9N A;  1UAA A;  1BJZ A;  4CXF A;  1S7O A;  2GXA A;  1A04 A;  1P4W A;  1B1B A;  4N0B A;  3ECO A;  1IRX A;  1RUN A;  5DS9 A;  4ZTJ A;  4A6D A;  5C3E J;  4ENN A;  1VTN C;  2R7S A;  3ISP A;  2NVX J;  4XKB A;  3CME I;  2X9D A;  3JRH A;  1X1P A;  2IA0 A;  1IXS B;  1KZH A;  3OYD A;  3JRG A;  1PUE E;  3WGI A;  4ZYD A;  4JYK A;  5F6F A;  4EM0 B;  2YX4 A;  1SC7 A;  4NBQ A;  3OSF A;  5HLI A;  2CO5 A;  1MH4 A;  1DQU A;  2K4B A;  2HXI A;  4Q47 A;  1ETK A;  4JX6 A;  3BC8 A;  5ILV A;  4FCY A;  4J19 A;  2LP0 A;  4R8H A;  4CYD A;  4BE2 A;  5A2Q K;  4A0Z A;  2HVS A;  2GIZ A;  4NNJ A;  1WQ2 A;  1SD7 A;  1MSF C;  2VKE A;  2M4K A;  2VL8 A;  2MYS A;  4WF2 A;  1BI1 A;  5E1W A;  2ME6 A;  1G6N A;  2ELH A;  2QGU A;  1JHH A;  3PQK A;  3PSI A;  3VYS B;  2I10 A;  2R7D A;  2IJL A;  1V55 H;  3OIQ A;  1Y0U A;  3MKZ A;  3KP4 A;  2XAJ A;  4I0B A;  3CF5 F;  2CH0 A;  4FX0 A;  3JW4 A;  1RI7 A;  2RRE A;  4U87 A;  2PX9 A;  4GGG A;  1K4T A;  5CVR A;  1MW7 A;  1OCP A;  2EH3 A;  3FHN A;  5IT3 A;  3HRM A;  4CA0 A;  4DYC A;  4LJZ F;  2CV0 A;  1NH3 A;  3G1L A;  2XAF A;  1LE8 B;  4A12 A;  1KU9 A;  3M9A A;  4I99 C;  4CCK A;  3LSP A;  3MKY B;  3TDZ C;  4QLC U;  1YJN I;  3NRV A;  4AIK A;  1TQI A;  2K9L A;  3CDL A;  2D1V A;  4A3K J;  1SD6 A;  3I58 A;  1G8X A;  1VQN I;  3N97 A;  1LJ9 A;  2EQR A;  3F6O A;  2IXS A;  3HDD A;  4BHC A;  4ON0 A;  2VJJ A;  3FIS A;  5C4J J;  3GBG A;  1IRG A;  1KU2 A;  4AM3 A;  2PQ8 A;  2R7T A;  2OTJ I;  1OCZ H;  1R5G A;  4BQO A;  4CCO A;  4S05 A;  4KIC A;  2JJ7 A;  5EG0 B;  3PNY A;  4B43 A;  4LLG F;  4AYB A;  2H27 A;  1BIA A;  3CC7 I;  3Q9S A;  4FET A;  3HC7 A;  1HF0 A;  3BP8 A;  3LSK A;  5M5X J;  3HOW J;  2FF4 A;  1SVL A;  2OV7 A;  2H09 A;  1J0R A;  3GTP J;  5KHD A;  1Z0X A;  4C9Y A;  4OU0 A;  5GAD J;  3KET A;  3OYJ A;  4HYE A;  4GCV A;  3D1N I;  3VEP A;  3ZP5 A;  4NHJ A;  2XAS A;  4R1H A;  1QNT A;  3FXL A;  4BBR J;  3ZOB A;  1Y1W J;  4IPA A;  5ICE A;  1F1Z A;  1A6Q A;  1N75 A;  2X1C A;  5EG0 A;  5IT9 Z;  4M74 A;  2QSH X;  2P6S A;  1QGP A;  1XX5 A;  1B6A A;  3P7N A;  2PI0 A;  2R93 J;  3CUQ C;  5FD5 A;  3VYU B;  2R7V A;  3AG3 H;  1RRJ A;  4ETS A;  1FSE A;  2Q1Z B;  2HTJ A;  4HX7 A;  2OTL I;  3FK7 A;  4HG2 A;  4LGW A;  1PP7 U;  3DPL C;  3HG9 A;  4IJA A;  3K2A A;  5DYM A;  2AS5 F;  3RCO A;  3K4C A;  1FOX A;  4PUS A;  1KU3 A;  1V5F A;  1G59 A;  2O5R A;  2JA2 A;  5FKN A;  5J8F A;  3RQ4 A;  3NAU A;  2Q0O A;  1ZGW A;  4U88 A;  3CCV I;  4ESB A;  4EJV A;  2KIF A;  2IGO A;  2FBI A;  2M34 A;  2DT5 A;  2UV1 A;  3I5U A;  4U0W A;  3SYT A;  3MZH A;  1S9H A;  3E5Q A;  2JSP A;  5CJ9 A;  3OYH A;  3AL0 B;  4IOC F;  2RGV A;  3H35 A;  5GAE J;  3J7A Y;  3BTJ A;  4BXF A;  3QP5 A;  3B02 A;  2FML A;  3GXO A;  1FT9 A;  1GXQ A;  5E8G A;  5LGU A;  3SHF A;  4AID A;  3F8M A;  2PFB A;  5HLT A;  3V7R A;  3QYB A;  1IRZ A;  3DXJ F;  3M4O J;  4H4K C;  5D6F A;  3H36 A;  2H8R A;  4Y52 J;  1OKR A;  2M87 A;  4A3J J;  1IXC A;  2DMU A;  2X1D A;  2X48 A;  5K7H A;  4M3B A;  1XN7 A;  3R0A A;  3CCU I;  3BQZ A;  3KEY A;  2IVM A;  3DLA A;  1ODD A;  1LFP A;  2LY2 A;  4YRV A;  4BH9 A;  1QHH D;  1UJ8 A;  4C3I J;  4V19 K;  1LPQ A;  3S1R J;  2OAZ A;  3GX4 X;  1MMG A;  5AIQ A;  2DAO A;  5IOZ A;  2FEZ A;  5KVR A;  2ISZ A;  3DTI A;  4HV5 A;  4E7I A;  4IKF A;  3O2P E;  1JT6 A;  2NS8 A;  3DU5 A;  3KEO A;  3KP6 A;  1D0Z A;  3H5N A;  3M8J A;  4BHB A;  4F91 B;  3H3Z A;  4F93 B;  5E1Z B;  1YO5 C;  1APL C;  5LGT A;  5TRD A;  3W2V A;  2O6G E;  1E17 A;  3GLL A;  1T0F A;  1KGS A;  1TWG J;  2HVR A;  4HF2 A;  2XSJ C;  4FAS D;  3TO9 A;  4LG0 B;  5LHG A;  3O8G A;  3M07 A;  4P9U A;  4B44 A;  3LAP A;  2VPR A;  3S3O A;  1FBQ A;  2NVU B;  2QLZ A;  2DT7 B;  2RC4 A;  4A3C J;  1JT0 A;  1Z21 A;  2NVY J;  2DFF A;  2W00 A;  3BZ6 A;  3WHB A;  3F3X A;  4A0X A;  4C3H J;  3ZMZ A;  4A3I J;  2JQ7 A;  2VC0 A;  1MGT A;  3MVP A;  4I09 A;  1IV6 A;  1HDD C;  2X4H A;  3GZN B;  5HLG A;  4M6V A;  1D8K A;  3ZQH A;  2OCE A;  4EJO A;  5IP6 A;  4ZTF A;  1G2H A;  4E7K A;  2EFP A;  2JSC A;  4XL9 A;  1NHA A;  1V5G A;  3I64 A;  4LG0 A;  2DI3 A;  3MN2 A;  1T38 A;  4A5N A;  2H1L A;  4M6X A;  3ZXS A;  2VQG A;  1T39 A;  4N4O B;  2L9R A;  3PO3 J;  2XGD A;  2BHZ A;  1K7A A;  3S1M J;  1IO2 A;  2E71 A;  3M1C A;  5EJC A;  4FIS A;  3SZG A;  2E5Z A;  3SZP A;  2R7Q A;  2NOG A;  4XSX F;  5F1J A;  1JKQ C;  4V2G A;  5HS9 A;  2Y9Y A;  4IEJ A;  3IC7 A;  4HA8 A;  1MJB A;  4F55 A;  3L2C A;  1TW2 A;  1I6X A;  5JR3 A;  2CJJ A;  4YIF A;  2DMQ A;  3QOE A;  1OYW A;  1Y1V J;  1TWH J;  3ELK A;  4C2T A;  1MBE A;  1KU7 A;  2DO7 A;  3QWL A;  1FOW A;  2PMZ A;  5L3G A;  1U8B A;  1WH7 A;  5A2Q Z;  4XKV A;  3W6K B;  2CUZ A;  1JJ8 C;  3RPU A;  1RES A;  5HDK A;  2Y9Z A;  1SEU A;  2NYX A;  3H0G J;  1SAN A;  1V3F A;  2DYR H;  1J5Y A;  3IWZ A;  4KIG A;  1WSU A;  4A3D J;  2CQN A;  4RB3 C;  5LBQ A;  3ASO H;  3HTS B;  1R4N B;  4MTD A;  4BJ6 C;  5ILS A;  4ENJ A;  1U9N A;  2L02 A;  4HBL A;  5CPR B;  1WJ5 A;  1A5J A;  2J5O A;  3J80 K;  1TQP A;  2TRT A;  4L9J A;  2CSO A;  5FLM J;  5E3L A;  4KFC A;  2V9K A;  3RIR A;  4YEJ A;  1NG7 A;  1OYI A;  3OYF A;  2L9V A;  3BR1 A;  3BPV A;  1W7P A;  3MZ8 A;  1ZHF A;  2DA7 A;  3EPZ A;  2LOO A;  2ELK A;  3GFM A;  1U78 A;  3COA C;  4PSX A;  2IS1 A;  1R22 A;  4HAM A;  1HQC A;  2VI6 A;  2IT0 A;  2QEX I;  2EZL A;  1VQL I;  3BJA A;  2WV0 A;  5K5R A;  2DCE A;  2F5D A;  2YSR A;  1TC3 C;  2OQG A;  1FZP B;  2STT A;  2VBZ A;  3W6V A;  5EZH A;  1EV7 A;  2KIM A;  1VQ7 I;  2G0E A;  2P8T A;  4Y17 A;  1GV2 A;  4JQF A;  3KYL A;  1Q1V A;  1IN6 A;  3ZQG A;  4XNF A;  1TLH B;  2CQX A;  1YRN B;  4ZZL A;  2OU2 A;  2NVQ J;  2HDD A;  3EDP A;  2HI3 A;  2FQ4 A;  2LRE A;  3PFI A;  4BQA A;  2Y75 A;  4G94 A;  4N4N B;  3K1N A;  3TP0 A;  2BXY A;  4BAY A;  1W36 C;  3JTG A;  1K61 A;  1FJL A;  2ZNZ A;  1HDP A;  5KNL A;  2L3D A;  5EGO B;  3JCU C;  1YHQ I;  1EH6 A;  3HOT A;  1YYV A;  5F1R A;  4CIC A;  3HRU A;  1J2X A;  1D0Y A;  3IHU A;  2Z2S B;  1YRN A;  1BA5 A;  1YIO A;  4HX8 A;  3E7L A;  4A0Y A;  4LFU A;  2E7W A;  4FHT A;  5LEJ A;  3S93 A;  4YG2 F;  3LSJ A;  1LQ1 A;  4RB1 A;  3GTO J;  1UHW A;  1MJ9 A;  4A5M A;  5BMZ A;  1RR7 A;  4CO8 A;  1D0X A;  1ETV A;  2JT1 A;  3IKT A;  1B9N A;  3CF2 A;  1ACI A;  1R5I D;  2XC7 A;  5EGO A;  2KKO A;  2QM3 A;  5L3B A;  1MKM A;  4FTH A;  5FKK A;  1VF9 A;  2EV5 A;  3PFY A;  3SQN A;  5DD4 A;  4E7H A;  4BE0 A;  3MAJ A;  3JRE A;  4I2O A;  1Z1D A;  2CYY A;  4XLE A;  5ICF A;  1SFO J;  2QQA A;  1RPW A;  3CQZ J;  2MLK A;  5EEA A;  3LFK A;  2ZO4 A;  3GWZ A;  3PIP F;  3RKW A;  1XC5 A;  2A5Y B;  2K7L A;  2LF7 A;  4KYW A;  3OL4 A;  2MBF A;  1ZGA A;  2DFE A;  2XF5 A;  1YS7 A;  1XG1 A;  4UUV A;  2K4J A;  5FLX K;  2AHQ A;  2XF7 A;  4L5E A;  3O8H A;  4E6K G;  2MW8 A;  2V1D A;  3OS2 A;  2O3F A;  4G6Q A;  3GFJ A;  3DEW A;  4HLY A;  4DYR A;  2HPM A;  1LDD A;  3GME A;  3HSR A;  3DEE A;  5F0C A;  3ZMD A;  1RNL A;  3H3V K;  3GEZ A;  3G6E I;  2W7N A;  4P5O A;  3HOV J;  4G8X A;  2BVL A;  2DJI A;  2QQB A;  1S29 A;  4RB2 C;  4B8X A;  1Z05 A;  2K5C A;  3RYP A;  5LRS A;  3SFI A;  3ONQ A;  4XR6 A;  3MQ0 A;  4KT5 C;  2CMP A;  4D7M A;  2XGC A;  3CUQ A;  2WWY A;  3S1Q J;  2OZU A;  4RB0 A;  4R79 A;  1QZE A;  2O0Y A;  2W82 A;  3HPG A;  4BDY A;  3TKY A;  3IP4 B;  2RQP A;  3I53 A;  3CJR B;  1MH3 A;  1ETY A;  3QPS A;  3RTR A;  2VOO A;  3KPH A;  1EH8 A;  2VQC A;  2FRH A;  1FOK A;  4I02 A;  1IUY A;  1YIJ I;  2IRF G;  4EJU A;  4DQ2 A;  3KCC A;  2LY9 A;  4XLF A;  1H89 C;  1KA8 A;  1OCT C;  3C3W A;  5FKM A;  4AC0 A;  2HDC A;  6PAX A;  1ZTR A;  1A31 A;  3A0B C;  3C1D A;  1GT0 C;  2HDW A;  4PJ0 C;  3KP3 A;  2W25 A;  1FYK A;  3RPU D;  4PFP A;  5KK1 A;  5B3S H;  1U9O A;  5HS8 A;  3S2D J;  4C2U A;  4IHY A;  2E1C A;  1ZLK A;  1NG6 A;  4BY1 J;  2LTP A;  3FXO A;  1LFU P;  4CYC B;  5DUK A;  2LBF A;  3IAM 2;  1TT5 B;  3E3V A;  2ESH A;  2LYC A;  4XK4 A;  5IYC J;  3G3Z A;  1B4A A;  3MD2 A;  1AHD P;  4LIU A;  4UB6 C;  4D5F A;  3B6A A;  2WAQ N;  4UVC A;  1VI0 A;  2DA3 A;  3NAR A;  1BC8 C;  5CVJ A;  3ZQQ A;  1KQ8 A;  4IL6 C;  1P7I A;  4NB5 A;  3LWF A;  4MO7 A;  3WHC A;  1I1S A;  4DGW B;  2K85 A;  3DKY A;  3P9C A;  4KDP A;  3RI4 A;  3ERE D;  3FXR A;  3HIF A;  3VWB A;  2D45 A;  4DIQ A;  3FZV A;  2BW3 B;  2E19 A;  4MEX F;  1W4M A;  3E5U A;  4EJT A;  3CTA A;  3OYM A;  2EV6 A;  2M0M A;  2EV0 A;  1TNS A;  4G6T B;  3Q3S A;  1BN5 A;  3HPH A;  4AD9 A;  2ZFU A;  1D5V A;  3I56 I;  3T1B A;  1D1B A;  2KZG A;  1A6I A;  1QPM A;  1S5L C;  2MC3 A;  2HXO A;  1LVA A;  2VBW A;  2ZXH A;  1HSJ A;  3LL7 A;  3TGN A;  2R5Z A;  4JX5 A;  1N77 A;  3WTV C;  2STW A;  4ESF A;  3FIW A;  3WTW C;  1P7J A;  4ABZ A;  1ZGJ A;  1Z6T A;  2BW3 A;  2GQQ A;  2PN6 A;  5FRN A;  1WKM A;  2WAD A;  2DOD A;  4ITV A;  1BR4 A;  1FNN A;  2XPW A;  2P5V A;  3HSE A;  2UXN A;  2YUS A;  1B8I B;  2RDP A;  2M30 A;  5LHH A;  3HJE A;  1T56 A;  3HSF A;  4XLN F;  3S15 J;  3H1C A;  4P55 A;  4RAF A;  1CGP A;  2XAG A;  4PK4 A;  3BWG A;  2ICW G;  3BTI A;  3CLO A;  4HLX A;  1FP2 A;  5DD8 A;  3H9G A;  4OIR F;  3V7S A;  1YIT I;  3DLL F;  3K10 A;  2ESN A;  3DEU A;  5GAG J;  2FSW A;  4I01 A;  4HW0 A;  3LA3 A;  2BV6 A;  4I6Z A;  1S72 I;  3FBN B;  5LGN A;  3J7Z I;  4EGZ A;  1XB4 A;  3RZD J;  2TCT A;  3BOQ A;  1O7L A;  2WAF A;  1HXD A;  4MTE A;  3HKZ N;  1O7F A;  3KYC B;  3K70 D;  2CUE A;  1TTY A;  4O5V A;  4QTR A;  1VQK I;  2V6E A;  4M6Y A;  2Z1D A;  4KIF A;  5FFX A;  2X85 A;  4CDG A;  2AQE A;  4XRF A;  2O61 A;  4IRI A;  2EA2 A;  3OYB A;  2QCO A;  5J6X A;  5IPA A;  2WAE A;  4E7Z A;  1ZRD A;  2DTZ A;  4RLF A;  3CJN A;  5DEQ A;  2BY1 A;  4F92 B;  2IA2 A;  1OLT A;  3OYN A;  2QBY B;  4DJA A;  2IGN A;  1FTT A;  2Z3Y A;  2Z9O A;  5J1U A;  3U21 A;  2XRN A;  1XGM A;  2YPR A;  1C0W A;  4U7B A;  3WTT C;  3LFU A;  1DDN A;  1FYM A;  5D4R A;  2E1N A;  4QPO A;  4XKC A;  3FKJ A;  3KLN A;  1X1C A;  3CCQ I;  2IGM A;  4E7J A;  2X6Y A;  4MQV A;  4NC7 A;  2PMH A;  2QBY A;  5DV5 A;  1L3L A;  3IV5 A;  1SVO A;  2OQR A;  3QYF A;  4XN3 A;  1MND A;  1U2W A;  1OJL A;  2E1M B;  2XF6 A;  3OOU A;  4Y4R A;  3FMR A;  4HDV A;  4A3G J;  2HPI A;  3JTH A;  4LD5 A;  5H6Q A;  4NC6 A;  2MA3 A;  2F5C A;  2A07 F;  3VB2 A;  2XAU A;  3JRD A;  3VYT B;  1VQ5 I;  5DCM B;  1FY7 A;  2L01 A;  1OCO H;  1EKE A;  1F9N A;  4BJ5 C;  2KRC A;  4IQ4 A;  1R4M B;  4L0Y B;  1R36 A;  2IA1 A;  2LK2 A;  3VYR B;  4OIP F;  4X6A J;  3FXQ A;  4BYY A;  2A5W A;  1E3H A;  4S0H B;  4B3X A;  3DQV C;  3KZZ A;  3W3C A;  3FBI B;  1O57 A;  2GWR A;  1LDK B;  3OL3 A;  5IP7 J;  5EEH A;  2M3A A;  3JAM K;  3OYK A;  4Y7N J;  1V54 H;  5DCM A;  4ZH4 F;  3EUH A;  2I5U A;  2XKO A;  1P4A A;  5FRO A;  2IS2 A;  3ZMV A;  4CGZ A;  4M3G A;  4IVN A;  3HTU A;  3E97 A;  2XGX A;  2VE8 A;  4EQQ A;  1Z91 A;  3R4K A;  2WB1 N;  3X2Q H;  1R71 A;  3ZCO A;  3AG2 H;  2XAQ A;  3F23 A;  1T95 A;  1R7J A;  3C18 A;  2CFX A;  3GTM J;  2ZME C;  4KN4 X;  1IN8 A;  2KQR A;  2F2E A;  1FC3 A;  1HA8 A;  2CV2 A;  1T6S A;  3EUA A;  2FJ1 A;  4JOM A;  1ZQ3 P;  2CRG A;  3BT9 A;  1WHU A;  4MEY F;  1MBK A;  3BZK A;  5GPA A;  2CG4 A;  3DBL B;  4C3J J;  1BI3 A;  3BRO A;  1Z3X A;  1BOA A;  3HGY A;  5B66 C;  2UZK A;  1U3E M;  2HOS A;  1YFH A;  3WGG A;  2FBH A;  4DOZ A;  5BPI A;  4BQQ A;  1TL8 A;  2VPL A;  4WXD A;  1UMQ A;  1D1C A;  5EDN A;  3I59 B;  1SVM A;  2ADU A;  3F8F A;  4DYQ A;  1NTC A;  2O03 A;  1K4S A;  4BQN A;  4XLP F;  1QPI A;  2Y48 A;  1U5T C;  4Y15 A;  2MD5 A;  4F52 A;  3OSG A;  1ZRC A;  5B1A H;  2IGK A;  1QRY A;  3JR9 A;  2R4G A;  2XPV A;  4M72 A;  1P4X A;  1ORK A;  2Y69 H;  1F5T A;  1YLF A;  5EZG A;  3OYG A;  2R5Y A;  3KFW X;  3H92 A;  3SEQ A;  3I59 A;  1MMD A;  1YS6 A;  5HVQ C;  5D5V B;  2COM A;  1XS9 A;  5J3L A;  4Y3O A;  1P6R A;  4XRS A;  2ETH A;  2NS0 A;  1WFX A;  1XD7 A;  5FLV A;  1RKW A;  1OR7 C;  1JTX A;  3CCJ I;  1YG2 A;  1W5T A;  1YJW I;  2BY0 A;  2OPT A;  3L9F A;  1D3Y A;  2AQF A;  5TJJ A;  5E8I A;  1BOB A;  4HQE A;  1FX7 A;  2L4A A;  1JUM A;  4YFX F;  4LMY A;  2V79 A;  1FBU A;  4CZC A;  2LY1 A;  1U6G A;  2VKH A;  2JPC A;  1MJA A;  3TP3 A;  5K7F A;  4RMN A;  3BLY A;  3WE2 A;  1RC9 A;  4EV0 A;  4E70 A;  4BEH B;  4UV9 A;  2ID6 A;  5L3E A;  2EIN H;  2JUC A;  5F27 A;  2F5V A;  3QOD A;  4IF4 A;  5J8C A;  3UR3 C;  4EJW A;  2V1U A;  2CWE A;  2LD5 A;  3HZJ A;  3CMM A;  2B63 J;  4E7L A;  1FMV A;  2LR8 A;  3QYE A;  4IHX A;  2H8W A;  3BG9 A;  3BJ6 A;  4AIH A;  2OA4 A;  3CC2 I;  4RGU A;  5CQE A;  1O3S A;  3S3M A;  3KX2 A;  3AG1 H;  5LLQ A;  2E2I J;  1ONV A;  9ANT A;  3AFH A;  1G4D A;  1I27 A;  1F43 A;  1X1D A;  2JRT A;  1X19 A;  4B3A A;  4BEH A;  3KZY A;  1OCC H;  2E34 A;  1ZK8 A;  3QQA A;  1BBY A;  4UB8 C;  3GTQ J;  5ILU A;  1U0J A;  2HQN A;  3U2R A;  3QPH A;  4UV8 A;  4A6E A;  3F9K A;  3ESW B;  2EIK H;  5EEG A;  5ED4 A;  2X0L A;  1JI8 A;  2VXD A;  4BKX A;  4BHP A;  1GHC A;  3SZT A;  3WGH A;  3MKL A;  2OC6 A;  2PJP A;  3T8R A;  4ZYG A;  4D0P A;  1P92 A;  2M5W A;  1O3R A;  3GUD A;  3G4S I;  4KIT B;  1FEX A;  3HB9 A;  4G6D A;  2AO9 A;  2QA4 I;  2LC2 A;  2OBP A;  2MC4 A;  3ZR8 X;  2WTE A;  3J7Y J;  1YW8 A;  5BPD A;  3L2R A;  4HX4 A;  3VFZ A;  3F8B A;  1VFC A;  4AVZ A;  5FD6 A;  4LLN A;  3J7A O;  1TBX A;  5CQG A;  3VOD A;  4OOI A;  1I39 A;  3OS0 A;  1EH7 A;  3OYA A;  4IHS A;  1F36 A;  2M45 A;  2RQQ A;  3QRF F;  4M73 A;  4H0E A;  2CW8 A;  3LMM A;  1LDJ A;  2L4M A;  2ZJP F;  5GPC A;  2F4I A;  1RUO A;  3CCE I;  1LVK A;  2ZCW A;  3S2W A;  2F5E A;  2JA7 J;  4UY8 I;  1FOY A;  2VUM J;  2XHK A;  3I71 A;  3I54 A;  2HOT A;  4KUM A;  2ZJ2 A;  2ISY A;  3SJM A;  3ABK H;  5J1R A;  3S14 J;  2DBB A;  2R3S A;  3EYI A;  1MBF A;  2Y0S N;  4LB6 B;  3BDD A;  3JRA A;  5KCM A;  4AIJ A;  2ZJQ F;  4NQW A;  3JRB A;  1R5H A;  4PGG A;  2I8D A;  4P9F A;  2EJR A;  5JI6 A;  1MDM A;  4AYB N;  3NEU A;  4XSZ F;  3K1P A;  1AA7 A;  4U0V A;  3BCB A;  4HF1 A;  2DFH A;  4IOA F;  1FP1 D;  1SMY F;  2BEO A;  2RN7 A;  3AKZ A;  1V4R A;  2XAH A;  4HOB A;  2KP6 A;  2MD0 A;  1LFB A;  4EMS A;  5FKL A;  4DZJ A;  4WWC A;  4ZDO A;  4UUS B;  4UUT A;  3WG9 A;  4A93 J;  3GLX A;  5BS6 A;  2BVM A;  3OIO A;  1P2F A;  1W7P B;  1X3Z B;  2DW4 A;  2E2H J;  1I1G A;  5D8L B;  3DTE A;  2DOA A;  2ZXJ A;  1Y6I A;  3AG4 H;  1UB9 A;  2W24 A;  1ZYR F;  4OWR B;  1PDN C;  2PLY A;  3CJT B;  1XTA A;  2YU9 J;  3I55 I;  5LHI A;  3CES A;  3KP2 A;  1ITY A;  3J81 K;  3F72 A;  3HGG A;  3R61 A;  2PEX A;  3V7C A;  2LDU A;  4CCL A;  4XLH A;  3HOX J;  5D6E A;  1IN7 A;  5K7Z A;  3TQN A;  2QSF X;  2GBY A;  3WG7 H;  1K79 A;  4UUS A;  1G3T A;  1WJF A;  2WAQ A;  3PM1 A;  1T33 A;  3OYL A;  3MKW B;  1J9I A;  3W2A A;  3BJO A;  1Y39 A;  3EQL F;  2DA5 A;  1X4P A;  2MH2 A;  3PUB A;  3ZQF A;  4YEL A;  3GFI A;  2ZFW A;  3GTL J;  3P5J A;  4KA4 A;  1GUU A;  2RV8 A;  5LRR A;  1BL0 A;  1MBG A;  4MHG A;  1O4X A;  3MZY A;  1UST A;  3PNT A;  5E18 F;  1H9G A;  3JSO A;  1YX3 A;  1A36 A;  3OR1 C;  1Q1H A;  2DA6 A;  1R9T J;  4QSH A;  2W85 A;  2L7Z A;  2LFB A;  3ABL H;  1RR8 C;  2MFZ A;  2D1H A;  1Z6R A;  5E17 F;  1I5Z A;  5L3C A;  4HNT A;  4F7Z A;  5E3N A;  2K02 A;  1WRJ A;  3KZI C;  2M0C A;  3HHH A;  5J4Y A;  5CYV A;  3T0Y A;  2O8K A;  3BR0 A;  1W1W E;  1BM9 A;  1Y0N A;  3FXK A;  3B73 A;  2JA8 J;  4HDU A;  3EYY A;  1QBJ A;  1H0M A;  2ZSH B;  2X1E A;  3SFZ A;  3LQQ A;  2RVC A;  2GIV A;  3I4M J;  2PBI A;  3JRF A;  2K3P A;  5B5E C;  4HF0 A;  4FT8 A;  2V6C A;  4JBA A;  2QVO A;  3F8C A;  1L0O C;  2HYG D;  3OMY A;  1MBJ A;  2DMT A;  3ML6 A;  2WV1 A;  3R60 A;  1XSD A;  2K27 A;  2VAS A;  2XUB A;  2P4W A;  2FX0 A;  5EF6 A;  1GVD A;  1EJ9 A;  2L7K A;  3MMY B;  3CD6 I;  2A61 A;  2BHY A;  5D5U B;  2DQR A;  3GF2 A;  5AON A;  2LKS A;  3K4L A;  1TQM A;  3MFK A;  2HVQ A;  1ON1 A;  1B9M A;  1ZAO A;  4PJM A;  2GLO A;  2G9W A;  3OYC A;  3DWL E;  4ZYE A;  2VXZ A;  4XLC A;  4RGS A;  3CUQ B;  1Z77 A;  2RNJ A;  4AWX B;  3QAH A;  4D5C A;  1YJ9 I;  4N9H A;  4PJN A;  4Y33 A;  3ABM H;  2DMN A;  3V8K A;  4IO9 F;  3ZMU A;  3JRC A;  1GDT A;  3D5L A;  4A69 C;  4KN7 X;  1JJ6 C;  3GZ6 A;  3ASN H;  1K6Y A;  2GXG A;  3IH4 A;  4PGH A;  5HOO A;  3FXJ A;  4F3Q A;  1SMT A;  4XKW A;  5JVT A;  1ZG1 A;  3P9I A;  1S3J A;  1R58 A;  1TW3 A;  1JKO C;  1WVR A;  1SD4 A;  2Y30 A;  5B1B H;  2G7U A;  3N4M A;  4RGR A;  2HKO A;  1QO0 D;  2EPF A;  3VSL A;  1D5Y A;  5L3F A;  2LF8 A;  4MFD A;  4KIS A;  4IX7 A;  2EA4 A;  2X6W A;  2EFN A;  1HKT A;  1DP3 A;  2FA5 A;  2LMD A;  2MLG A;  3T5X A;  1JUS A;  2CQ7 A;  3QPT A;  2K40 A;  3D5S C;  2DLL A;  2NAZ A;  1MMS A;  3CCL I;  4J01 A;  1X58 A;  5LFA A;  2LBF B;  4HSR A;  2IS4 A;  2DK8 A;  1JUP A;  2J5P A;  2UWM A;  3GTK J;  3LA7 A;  3I9V 2;  2E2J J;  4M9Z A;  2R7O A;  1MNM C;  2Z5U A;  2VB6 A;  3DU6 A;  3SDB A;  4BJT A;  3CMY A;  5LEK A;  2XSD C;  1A35 A;  4E4H A;  2XKP A;  2YR2 A;  5HDG A;  1N25 A;  2XB0 X;  2P6T A;  3FWE A;  4B48 A;  2L9S A;  1RET A;  2X6O A;  5GTI C;  5JLX A;  2EIM H;  3OV8 A;  3RZO J;  4XRS G;  3GTG J;  1I3A A;  2LKX A;  1VQP I;  3WOD F;  3QP6 A;  4MQ9 F;  5FFZ A;  1YX5 A;  4I98 B;  5IT9 K;  1YQA A;  4A3B J;  3RKX A;  3PNV A;  1I50 J;  2JA5 J;  1JTY A;  3KE2 A;  2QQ8 A;  4ENK A;  3WTS C;  5BOX A;  4HNU A;  2CFO A;  5D8K B;  1V5E A;  2P5L C;  2R5Z B;  1JXS A;  3LSH A;  1W7P D;  2ZXW H;  2M4G A;  3E6D A;  2HS5 A;  2Z33 A;  2FE3 A;  3AL0 C;  1G3W A;  5HDN A;  3G71 I;  4FE4 A;  1WJE A;  3CMA I;  2DFI A;  4RAZ A;  4IHT A;  4EM1 A;  2A3S A;  3KP7 A;  4OIQ F;  4UHT A;  1OQY A;  2CQK A;  1U8R A;  4EM2 A;  3A02 A;  1B72 A;  1ZEL A;  4JX4 A;  3SDG A;  2D2W A;  4GFB A;  4TV7 A;  5J4V A;  2WB1 A;  1BI0 A;  3QU3 A;  4CSW A;  1I3Q J;  4L0Z B;  1UFM A;  3DBH B;  2DOE A;  2DOF A;  1R23 A;  1UHM A;  2IEK A;  1VQ9 I;  1X3W B;  2XVC A;  2B0L A;  5IOY A;  1TZL A;  1NK3 P;  4MLO A;  1WH5 A;  3ZQ7 A;  2HZD A;  1G3S A;  2KZV A;  1DUX C;  1DU6 A;  1T8I A;  2TDX A;  3CCS I;  3NWS A;  4MNU A;  1JKP C;  4XID A;  2H6B A;  2FOW A;  3HEF A;  4M9X A;  3QOP A;  3SXY A;  2VKV A;  1T0F C;  2Y31 A;  3FXU A;  3EET A;  4ZC3 A;  2P7C B;  4AUX A;  1LEA A;  2YX7 A;  5FRM A;  1DPU A;  3CCR I;  4Q5S F;  4LG3 A;  3F6V A;  3ZGK A;  4Q4Z F;  3LSM A;  3REO A;  1M1E B;  2HYJ A;  2QEN A;  3BQY A;  4JP0 A;  4LK1 F;  4RAY A;  2DTR A;  3MCZ A;  1KYZ A;  2P5K A;  4IHV A;  4G7Z F;  4ANJ A;  3PUF A;  3IRQ A;  2NNY A;  3BR3 A;  3Q0V A;  2HEO A;  1R1U A;  3I4P A;  4E7S A;  5M3F J;  2R7F A;  2FU4 A;  2V1N A;  3NQO A;  1K6O A;  2IAI A;  4UXN A;  2OCC H;  2FOK A;  3GYH X;  2HQ5 A;  1WWX A;  3G73 A;  3SEZ A;  1XCB A;  3BR5 A;  4BBS J;  2BGC A;  2XB5 A;  3KP5 A;  2Q8K A;  1HST A;  5HOD A;  2NS7 A;  3J80 Z;  3K6G A;  3A0H C;  3HRS A;  2VBY A;  4KJZ A;  3HXL A;  1IGN A;  2HYF A;  3DTK A;  3G1O A;  1ETQ A;  3CUO A;  2JK3 A;  4BXX J;  3ZN0 A;  4G9Y A;  2QSG X;  4I76 A;  3HOZ J;  2KIQ A;  3BG5 A;  4ZJZ A;  1IDZ A;  4YIR X;  2PMU A;  4GYG A;  3TW6 A;  4GO1 A;  2VBX A;  3OYE A;  1H88 C;  4U7D A;  4DBQ A;  3PIO F;  3NWT A;  5F0F A;  2VN2 A;  1Z3Y A;  2V9P A;  4HRI A;  3GO5 A;  4I0A A;  2DK5 A;  2GA1 A;  4YFK F;  1GV5 A;  2JVG A;  2P81 A;  2DT6 A;  2LSO A;  3C7J A;  1S6L A;  3IH2 A;  4UNO A;  5E3M A;  2N8G A;  3CO6 C;  3DKX A;  1QHG A;  4RM2 A;  3TOB A;  4CCN A;  3DPT A;  4Y13 A;  3Q0W A;  1MIJ A;  2KIU A;  1YE9 A;  2D5V A;  5H20 A;  1VQM I;  2QUF A;  1Z7U A;  2KJC A;  1RIO H;  5AIP A;  4XOT A;  4WXC A;  1HOM A;  3FK6 A;  3L2U A;  2FMY A;  3LAJ A;  2PG4 A;  2VON A;  2DPU A;  1Y8Q B;  3HBL A;  3ZRG A;  3GCM A;  1SFU A;  4I7H A;  3OWT A;  3UKG A;  1IN4 A;  3DPU A;  1R6R A;  1WJC A;  2L5Q A;  3HUG A;  2QKL B;  3K0L A;  3L09 A;  1IZ1 A;  3WTZ A;  4II3 A;  1IW7 F;  5H6R A;  2BY2 A;  2KPM A;  3O3K A;  4L9V A;  3U1K A;  2VC1 A;  2V26 A;  4J00 A;  4ASN A;  1J75 A;  2FQ3 A;  3ZMS A;  2E60 A;  4MIM A;  1KYW A;  4L5I A;  4B1R A;  1DGR M;  3HYI A;  4NUB A;  3S3N A;  4A3F J;  3L2Q A;  1VND A;  1O3Q A;  5DUI A;  4BNC A;  3E5X A;  2HTS A;  2OJE D;  4PFO A;  3K4M A;  5DM7 F;  4MFE A;  1IC8 A;  2GXB A;  2IS6 A;  4RDU A;  4PZJ A;  3OS1 A;  1XMK A;  4GRI A;  2ZXI A;  4C30 A;  3TMO A;  1XPX A;  1YW7 A;  5FLX Z;  1Z67 A;  1BJA A;  2F4O B;  1FIP A;  1JHF A;  3CP8 A;  5GTH C;  3E6C C;  4L18 B;  1TNT A;  1JE8 A;  3LQR A; 
#chains in the Genus database with same CATH homology
 1HKS A;  2A6H F;  2V1X A;  1AOY A;  3BY6 A;  3V8J A;  2M8E A;  3M8F A;  2QYO A;  5K5O A;  5FGM A;  3HOS A;  1MZB A;  1RZ4 A;  1ZRF A;  2GZW A;  1W5S A;  3H3U A;  1YW9 A;  2CGP A;  2Q2E A;  3FM5 A;  1FYL A;  2UXX A;  3WU1 B;  1J7K A;  4L5J A;  1CF7 B;  5HLH A;  2FBK A;  5K5Q A;  2DU9 A;  2KJB A;  1OMI A;  1FPQ A;  1WI9 A;  2EK5 A;  4B09 A;  1X3U A;  1XGN A;  2VOD A;  1XDU A;  1IXR C;  2JTV A;  4HV6 A;  1CF7 A;  4PCQ A;  4RGX A;  3F21 A;  3RJP A;  3Q9V A;  3ROU A;  1QZY A;  2ZBK A;  3RDI A;  3ZMT A;  4S04 A;  1SFE A;  1R00 A;  3VOE A;  1FWZ A;  3E6B A;  1KQ0 A;  4P96 A;  3IRR A;  2A69 F;  1K78 B;  4GXO A;  2XV4 S;  3FMQ A;  2HZT A;  2IW5 A;  2V9V A;  3FMS A;  3ABT A;  3ULQ B;  1XCV A;  1DPR A;  4GYI A;  1K78 A;  5D5W B;  3WTX C;  4QWQ A;  5F64 A;  5FO5 A;  4WK8 F;  1JGS A;  1XGO A;  3WE3 A;  4G7O F;  3TDU C;  2ACJ A;  4OMZ A;  4L9N A;  1QZZ A;  1BI2 A;  2BBY A;  2A68 F;  1IRF A;  3FF5 A;  3IWF A;  1FSH A;  3TO6 A;  1MDM B;  4UVB A;  5FB2 A;  3DKW A;  4MGR A;  3FHZ A;  3PQJ A;  1HBX G;  1IN5 A;  1UCR A;  3U9G A;  1XGS A;  4FX4 A;  1KQ9 A;  5JFR A;  2RKH A;  1QQI A;  2EB7 A;  3JSP A;  2HQR A;  2VOP A;  3WTY C;  2VE9 A;  3FM3 A;  3DF8 A;  2IPQ X;  3QU6 A;  1Z9C A;  3GW2 A;  3WU0 A;  1GXP A;  2HR3 A;  1IF1 A;  1G3Y A;  2K86 A;  2DPD A;  2BE5 F;  3T8T A;  2HWV A;  1XSV A;  3GFL A;  4OIN F;  1ZG5 A;  4Q48 A;  3R6S A;  4CZZ A;  2LNB A;  2ZNY A;  4K2E A;  1DP7 P;  2JPB A;  4IRH A;  1HW2 A;  2GA2 A;  5ERI A;  2EWN A;  5D5X B;  1SAX A;  4ZZD A;  3RYR A;  2QQ9 A;  3ECH A;  3LA2 A;  3JAM Z;  3DV8 A;  4XBF A;  1ZRE A;  2NRA C;  4LLL A;  3MWM A;  2FNP A;  1S7A A;  4ZYH A;  4WX9 A;  2FNA A;  3K69 A;  3M7G A;  3KLO A;  1FLI A;  2HFH A;  2EFW A;  4ENM A;  4RS8 A;  4OMY A;  4KMF A;  1OYY A;  3ZN1 A;  1E2X A;  2ZME B;  1HW1 A;  2GAU A;  2HGC A;  1ZAR A;  3DP7 A;  3L00 A;  4KNY A;  1BC7 C;  4LB5 A;  5E20 A;  2W84 A;  4O6J A;  5BQT A;  4WCG A;  4G7H F;  1YTY A;  2F5F A;  2W57 A;  1STZ A;  1ULY A;  2ZME A;  1HKQ A;  3HHG A;  2OD5 A;  4L9T A;  5D4S A;  1U5T B;  2DQL A;  4YFN F;  5JHU A;  1H9T A;  2XRO A;  4DNC A;  3L7W A;  1IAW A;  1LEB A;  2ZKZ A;  2FXA A;  2BYV E;  2H6C A;  3I0T A;  2YU3 A;  1ZLJ A;  3V4G A;  1F4K A;  1U5T A;  1USS A;  4JK1 X;  2O8X A;  3ABU A;  1J59 A;  4IXA A;  1S8N A;  2CW0 F;  3CO7 C;  2P7V B;  2E7X A;  3W6J B;  1LNW A;  2EFO A;  1R1T A;  1O3T A;  1XMA A;  5HS7 A;  4HQM A;  1OR7 A;  3LST A;  3BPX A;  2MH9 A;  4A2U A;  1T98 A;  3ZPL A;  4EGY A;  2G7H A;  1D8J A;  5CVI A;  5DCF A;  4Z2Y A;  3D0S A;  2Z99 A;  1XSX A;  2KRF A;  3K9T A;  3O6B B;  1ON2 A;  3AAF A;  4IRG A;  4U0Y A;  3WTU C;  3M1E A;  1ZN2 A;  5CVU A;  4AVP A;  3FX3 A;  3GZ5 A;  2EFQ A;  3TO7 A;  4KIB A;  1T2K A;  5CLS A;  3U1D A;  4LK0 F;  2NNN A;  2JZY A;  4YII A;  1HW5 A;  3TOA A;  3P9K A;  2LKP A;  4KMU X;  1AWC A;  1OPC A;  1PP8 F;  1ZH5 A;  3IKV A;  5ICC A;  1REP C;  3OOP A;  4CHU A;  2AXL A;  4WXH A;  2QZ8 A;  2HOE A;  3DFG A;  2C6Y A;  2QWW A;  4PDK A;  4OIO F;  3KEQ A;  3F8N A;  2M1B A;  3GVA A;  3K1M A;  4UVA A;  1SFX A;  3IL2 A;  1ZG3 A;  3E6M A;  1FBS A;  4BXU A;  2WC2 A;  2XIG A;  1LB2 A;  5ICG A;  4M9S A;  5DDG A;  1SD5 A;  4ESJ A;  2VT3 A;  2IP2 A;  2Y0M A;  1MD0 A;  3J81 Z;  5E1X A;  2A6E F;  3RPQ A;  3V8L A;  2L54 A;  4HZF A;  3F22 A;  3Q5F A;  3K2Z A;  3MEX A;  2OZ6 A;  5CVV A;  5K1Y A;  3M8E A;  1BIB A;  3RKY A;  1XDS A;  3HRT A;  4N9I A;  4O3M A;  1R1V A;  1GVJ A;  2H94 A;  3CDH A;  2HKX A;  3R0J A;  1B59 A;  2VT2 A;  4M71 A;  4EVI A;  5L3D A;  4CXF A;  1S7O A;  1A04 A;  1P4W A;  1B1B A;  4N0B A;  3ECO A;  1RUN A;  4A6D A;  4ENN A;  1VTN C;  3ISP A;  2IA0 A;  1IXS B;  1PUE E;  3WGI A;  4ZYD A;  5F6F A;  4EM0 B;  2YX4 A;  5HLI A;  2CO5 A;  2K4B A;  4Q47 A;  5ILV A;  4R8H A;  4CYD A;  5A2Q K;  4A0Z A;  1WQ2 A;  1SD7 A;  4WF2 A;  1BI1 A;  5E1W A;  1G6N A;  2ELH A;  1JHH A;  3PQK A;  2R7D A;  2IJL A;  1Y0U A;  3KP4 A;  2XAJ A;  4I0B A;  4FX0 A;  3JW4 A;  1RI7 A;  4GGG A;  5CVR A;  5IT3 A;  3HRM A;  4LJZ F;  2XAF A;  4A12 A;  1KU9 A;  3M9A A;  3TDZ C;  4QLC U;  3NRV A;  4AIK A;  1TQI A;  2D1V A;  1SD6 A;  3I58 A;  3N97 A;  1LJ9 A;  3F6O A;  4BHC A;  4ON0 A;  1IRG A;  1KU2 A;  2PQ8 A;  1R5G A;  4S05 A;  4KIC A;  4LLG F;  2H27 A;  1BIA A;  3Q9S A;  3BP8 A;  2FF4 A;  2H09 A;  1J0R A;  4OU0 A;  3KET A;  4HYE A;  4GCV A;  3VEP A;  3ZP5 A;  4NHJ A;  2XAS A;  4R1H A;  1QNT A;  4IPA A;  5ICE A;  1F1Z A;  5IT9 Z;  4M74 A;  2P6S A;  1QGP A;  1B6A A;  3P7N A;  2PI0 A;  3CUQ C;  5FD5 A;  4ETS A;  1FSE A;  2HTJ A;  4HX7 A;  4LGW A;  1PP7 U;  3DPL C;  4IJA A;  5DYM A;  2AS5 F;  1KU3 A;  5J8F A;  2Q0O A;  4U88 A;  4ESB A;  4EJV A;  2KIF A;  4U0W A;  2FBI A;  2DT5 A;  3I5U A;  3MZH A;  3E5Q A;  5CJ9 A;  2RGV A;  3QP5 A;  3B02 A;  2FML A;  3GXO A;  1FT9 A;  1GXQ A;  5E8G A;  5LGU A;  3SHF A;  3F8M A;  2PFB A;  3V7R A;  3DXJ F;  5D6F A;  1OKR A;  2M87 A;  1IXC A;  1XN7 A;  3R0A A;  2IVM A;  1ODD A;  4BH9 A;  2OAZ A;  3GX4 X;  5AIQ A;  2DAO A;  2FEZ A;  5KVR A;  2ISZ A;  4HV5 A;  3O2P E;  3KEO A;  3KP6 A;  4BHB A;  3H3Z A;  5E1Z B;  1YO5 C;  5LGT A;  5TRD A;  2O6G E;  1E17 A;  1T0F A;  1KGS A;  4HF2 A;  3TO9 A;  4LG0 B;  5LHG A;  4P9U A;  3LAP A;  1FBQ A;  2QLZ A;  2RC4 A;  3BZ6 A;  4A0X A;  3F3X A;  3ZMZ A;  2VC0 A;  1MGT A;  4I09 A;  2X4H A;  5HLG A;  1D8K A;  4EJO A;  2EFP A;  2JSC A;  4LG0 A;  1NHA A;  3I64 A;  2DI3 A;  1T38 A;  4A5N A;  4M6X A;  1T39 A;  1K7A A;  3SZP A;  4XSX F;  5HS9 A;  3IC7 A;  4HA8 A;  1MJB A;  3L2C A;  1TW2 A;  1I6X A;  5JR3 A;  4YIF A;  1OYW A;  3ELK A;  1KU7 A;  2DO7 A;  5L3G A;  5A2Q Z;  3W6K B;  3RPU A;  5HDK A;  2NYX A;  1V3F A;  3IWZ A;  1J5Y A;  4KIG A;  1WSU A;  4RB3 C;  5LBQ A;  3HTS B;  4MTD A;  5ILS A;  4ENJ A;  2L02 A;  4HBL A;  2J5O A;  3J80 K;  1TQP A;  4L9J A;  2CSO A;  4KFC A;  3RIR A;  1OYI A;  3BPV A;  1W7P A;  1ZHF A;  3GFM A;  1U78 A;  3COA C;  1R22 A;  4HAM A;  1HQC A;  2IT0 A;  3BJA A;  2WV0 A;  5K5R A;  2F5D A;  2YSR A;  2OQG A;  1FZP B;  2STT A;  2VBZ A;  1EV7 A;  2KIM A;  2P8T A;  4Y17 A;  4JQF A;  1IN6 A;  1TLH B;  4ZZL A;  2OU2 A;  3EDP A;  3PFI A;  4BQA A;  2Y75 A;  4G94 A;  3K1N A;  4BAY A;  3JTG A;  2ZNZ A;  2L3D A;  1EH6 A;  3HOT A;  1YYV A;  5F1R A;  4CIC A;  3HRU A;  1J2X A;  3IHU A;  1YIO A;  4HX8 A;  4A0Y A;  4LFU A;  2E7W A;  4FHT A;  5LEJ A;  4YG2 F;  1LQ1 A;  4RB1 A;  1UHW A;  1MJ9 A;  4A5M A;  5BMZ A;  4CO8 A;  2JT1 A;  3IKT A;  1B9N A;  2KKO A;  2QM3 A;  5L3B A;  1MKM A;  2EV5 A;  3SQN A;  5DD4 A;  3MAJ A;  4I2O A;  1Z1D A;  2CYY A;  5ICF A;  2QQA A;  2MLK A;  3LFK A;  2ZO4 A;  3GWZ A;  3RKW A;  2A5Y B;  2LF7 A;  2K7L A;  4KYW A;  2MBF A;  1ZGA A;  4UUV A;  1YS7 A;  5FLX K;  2K4J A;  2V1D A;  2O3F A;  4G6Q A;  3GFJ A;  4HLY A;  1LDD A;  3HSR A;  3ZMD A;  1RNL A;  3GEZ A;  4P5O A;  4G8X A;  4RB2 C;  2QQB A;  1S29 A;  4B8X A;  1Z05 A;  3RYP A;  5LRS A;  3MQ0 A;  4KT5 C;  3CUQ A;  2WWY A;  2OZU A;  4RB0 A;  4R79 A;  2O0Y A;  3TKY A;  2RQP A;  3I53 A;  3RTR A;  2VOO A;  1EH8 A;  2FRH A;  1FOK A;  4I02 A;  1IUY A;  2IRF G;  4EJU A;  4DQ2 A;  3KCC A;  1KA8 A;  3C3W A;  2HDC A;  6PAX A;  3C1D A;  3KP3 A;  2W25 A;  1FYK A;  5KK1 A;  5HS8 A;  2E1C A;  1ZLK A;  5DUK A;  3E3V A;  2ESH A;  3G3Z A;  1B4A A;  4UVC A;  1BC8 C;  5CVJ A;  1KQ8 A;  4NB5 A;  3LWF A;  1I1S A;  4KDP A;  3P9C A;  3RI4 A;  3ERE D;  3FXR A;  3HIF A;  2D45 A;  3FZV A;  4MEX F;  4EJT A;  1W4M A;  3E5U A;  3CTA A;  2EV6 A;  2EV0 A;  1TNS A;  1BN5 A;  4AD9 A;  1D5V A;  3T1B A;  1QPM A;  2MC3 A;  1LVA A;  2VBW A;  1HSJ A;  3TGN A;  2STW A;  3WTV C;  4ESF A;  3WTW C;  1ZGJ A;  1Z6T A;  2GQQ A;  2PN6 A;  1WKM A;  1FNN A;  2P5V A;  3HSE A;  2UXN A;  2RDP A;  2M30 A;  5LHH A;  3HSF A;  4XLN F;  4P55 A;  1CGP A;  2XAG A;  3BWG A;  3CLO A;  4HLX A;  5DD8 A;  1FP2 A;  4OIR F;  3V7S A;  2ESN A;  3DEU A;  2FSW A;  4I01 A;  4HW0 A;  3LA3 A;  2BV6 A;  5LGN A;  4EGZ A;  1XB4 A;  3BOQ A;  1O7L A;  1HXD A;  4MTE A;  1O7F A;  4O5V A;  1TTY A;  4M6Y A;  4KIF A;  5FFX A;  4CDG A;  4XRF A;  2O61 A;  4IRI A;  2EA2 A;  5J6X A;  1ZRD A;  3CJN A;  5DEQ A;  2IA2 A;  2QBY B;  2Z3Y A;  2Z9O A;  2XRN A;  1XGM A;  2YPR A;  1C0W A;  4U7B A;  3WTT C;  1DDN A;  1FYM A;  5D4R A;  2E1N A;  3KLN A;  4MQV A;  2PMH A;  2QBY A;  5DV5 A;  1L3L A;  2OQR A;  1U2W A;  3FMR A;  4HDV A;  4LD5 A;  3JTH A;  5H6Q A;  2MA3 A;  2F5C A;  2A07 F;  3VB2 A;  5DCM B;  1FY7 A;  2L01 A;  1F9N A;  4L0Y B;  1R36 A;  2IA1 A;  4OIP F;  3FXQ A;  4BYY A;  3DQV C;  3KZZ A;  1O57 A;  2GWR A;  1LDK B;  5EEH A;  3JAM K;  5DCM A;  4ZH4 F;  3EUH A;  2XKO A;  1P4A A;  3ZMV A;  4CGZ A;  4IVN A;  3HTU A;  3E97 A;  2XGX A;  2VE8 A;  4EQQ A;  1Z91 A;  3R4K A;  2XAQ A;  3F23 A;  1R7J A;  3C18 A;  2CFX A;  4KN4 X;  1IN8 A;  2F2E A;  1FC3 A;  1T6S A;  4MEY F;  2CG4 A;  1BI3 A;  3BRO A;  2UZK A;  1BOA A;  1U3E M;  1YFH A;  3WGG A;  2FBH A;  5BPI A;  4WXD A;  3I59 B;  2ADU A;  3F8F A;  2O03 A;  4XLP F;  2Y48 A;  1U5T C;  4Y15 A;  2MD5 A;  1ZRC A;  4M72 A;  1P4X A;  1F5T A;  1YLF A;  3KFW X;  3H92 A;  3I59 A;  1YS6 A;  5HVQ C;  5D5V B;  2COM A;  1P6R A;  2ETH A;  2NS0 A;  1XD7 A;  1YG2 A;  1W5T A;  3L9F A;  1D3Y A;  5TJJ A;  5E8I A;  4HQE A;  1FX7 A;  2L4A A;  4YFX F;  4LMY A;  2V79 A;  1FBU A;  1U6G A;  2JPC A;  1MJA A;  3WE2 A;  4EV0 A;  4E70 A;  4UV9 A;  5L3E A;  4IF4 A;  5J8C A;  4EJW A;  2V1U A;  2CWE A;  3BJ6 A;  4AIH A;  2OA4 A;  4RGU A;  1O3S A;  5LLQ A;  1ONV A;  1G4D A;  1I27 A;  2JRT A;  3KZY A;  1BBY A;  5ILU A;  2HQN A;  3U2R A;  3QPH A;  4UV8 A;  4A6E A;  5EEG A;  5ED4 A;  2X0L A;  4BHP A;  1GHC A;  3SZT A;  3WGH A;  2PJP A;  3T8R A;  4ZYG A;  4D0P A;  1P92 A;  2M5W A;  1O3R A;  3GUD A;  4G6D A;  2OBP A;  2WTE A;  1YW8 A;  5BPD A;  4HX4 A;  3VFZ A;  3F8B A;  5FD6 A;  4LLN A;  3J7A O;  1TBX A;  3VOD A;  4OOI A;  1EH7 A;  4IHS A;  2M45 A;  3QRF F;  4M73 A;  4H0E A;  1LDJ A;  2L4M A;  1RUO A;  2ZCW A;  3S2W A;  2F5E A;  2XHK A;  3I71 A;  3I54 A;  4KUM A;  2ZJ2 A;  2ISY A;  2DBB A;  2R3S A;  3EYI A;  4LB6 B;  3BDD A;  4AIJ A;  4NQW A;  1R5H A;  4PGG A;  4P9F A;  2EJR A;  5JI6 A;  1MDM A;  3NEU A;  4XSZ F;  3K1P A;  4U0V A;  4HF1 A;  1FP1 D;  1SMY F;  2BEO A;  2RN7 A;  1V4R A;  2XAH A;  4HOB A;  4EMS A;  4WWC A;  3WG9 A;  3GLX A;  5BS6 A;  1P2F A;  1W7P B;  2DW4 A;  1I1G A;  5D8L B;  2ZXJ A;  1UB9 A;  2W24 A;  1ZYR F;  1PDN C;  2PLY A;  5LHI A;  3KP2 A;  3J81 K;  3F72 A;  3R61 A;  2PEX A;  3V7C A;  2LDU A;  5D6E A;  1IN7 A;  3TQN A;  1K79 A;  1G3T A;  1J9I A;  3BJO A;  3EQL F;  2MH2 A;  3GFI A;  2ZFW A;  4KA4 A;  2RV8 A;  5LRR A;  4MHG A;  3MZY A;  1UST A;  5E18 F;  1H9G A;  3JSO A;  1Q1H A;  2W85 A;  2D1H A;  1Z6R A;  5E17 F;  1I5Z A;  5L3C A;  4F7Z A;  2K02 A;  1WRJ A;  3HHH A;  5CYV A;  3T0Y A;  1BM9 A;  3B73 A;  4HDU A;  3EYY A;  1QBJ A;  1H0M A;  3SFZ A;  3LQQ A;  2RVC A;  2GIV A;  2PBI A;  4HF0 A;  4FT8 A;  2V6C A;  4JBA A;  2QVO A;  3F8C A;  1L0O C;  2HYG D;  3ML6 A;  3R60 A;  1XSD A;  2K27 A;  2XUB A;  2P4W A;  2A61 A;  5D5U B;  2DQR A;  3GF2 A;  5AON A;  1TQM A;  3MFK A;  1ON1 A;  1ZAO A;  1B9M A;  2G9W A;  4ZYE A;  2VXZ A;  4RGS A;  3CUQ B;  2RNJ A;  4AWX B;  3QAH A;  4N9H A;  3V8K A;  3ZMU A;  3D5L A;  4KN7 X;  3GZ6 A;  2GXG A;  4PGH A;  5HOO A;  1SMT A;  5JVT A;  1ZG1 A;  3P9I A;  1S3J A;  1R58 A;  1TW3 A;  1SD4 A;  2G7U A;  3N4M A;  4RGR A;  2HKO A;  1QO0 D;  5L3F A;  2LF8 A;  2EA4 A;  2EFN A;  1HKT A;  2FA5 A;  2MLG A;  3T5X A;  3QPT A;  2DLL A;  2NAZ A;  2DK8 A;  2J5P A;  2UWM A;  3LA7 A;  4M9Z A;  2Z5U A;  5LEK A;  2XKP A;  2YR2 A;  5HDG A;  2P6T A;  3FWE A;  3OV8 A;  3WOD F;  3QP6 A;  4MQ9 F;  5FFZ A;  4I98 B;  5IT9 K;  1YQA A;  3RKX A;  3KE2 A;  4ENK A;  3WTS C;  5BOX A;  5D8K B;  2P5L C;  1JXS A;  1W7P D;  3E6D A;  2HS5 A;  2Z33 A;  2FE3 A;  1G3W A;  5HDN A;  2DFI A;  4RAZ A;  4IHT A;  4EM1 A;  2A3S A;  3KP7 A;  4OIQ F;  4UHT A;  1U8R A;  2CQK A;  4EM2 A;  2D2W A;  4TV7 A;  4L0Z B;  1BI0 A;  3QU3 A;  1UFM A;  1R23 A;  1UHM A;  2XVC A;  2B0L A;  3ZQ7 A;  1G3S A;  1DUX C;  2TDX A;  4MNU A;  2H6B A;  4M9X A;  3SXY A;  3QOP A;  3FXU A;  3EET A;  2P7C B;  1LEA A;  2YX7 A;  1DPU A;  4Q5S F;  3F6V A;  4Q4Z F;  3REO A;  2QEN A;  4LK1 F;  4RAY A;  2DTR A;  3MCZ A;  1KYZ A;  2P5K A;  4G7Z F;  3IRQ A;  2NNY A;  2HEO A;  1R1U A;  3I4P A;  2R7F A;  2FU4 A;  3NQO A;  1K6O A;  4UXN A;  2FOK A;  3GYH X;  1WWX A;  3G73 A;  1XCB A;  2BGC A;  3KP5 A;  2Q8K A;  1HST A;  3J80 Z;  3HRS A;  2VBY A;  2HYF A;  3CUO A;  3ZN0 A;  4G9Y A;  2PMU A;  4GYG A;  4GO1 A;  2VBX A;  4U7D A;  2VN2 A;  3GO5 A;  4I0A A;  2DK5 A;  2GA1 A;  4YFK F;  2LSO A;  3C7J A;  1S6L A;  4UNO A;  3CO6 C;  3TOB A;  3DPT A;  4Y13 A;  2KIU A;  5H20 A;  2QUF A;  1Z7U A;  2KJC A;  1RIO H;  5AIP A;  4WXC A;  2FMY A;  3LAJ A;  2PG4 A;  2VON A;  2DPU A;  1SFU A;  4I7H A;  1IN4 A;  3K0L A;  3HUG A;  3L09 A;  1IZ1 A;  3WTZ A;  1IW7 F;  5H6R A;  3O3K A;  4L9V A;  2VC1 A;  4ASN A;  1J75 A;  2FQ3 A;  3ZMS A;  1KYW A;  4L5I A;  3HYI A;  1O3Q A;  5DUI A;  4BNC A;  3E5X A;  2HTS A;  2GXB A;  4PZJ A;  1XMK A;  1YW7 A;  5FLX Z;  1BJA A;  1JHF A;  3E6C C;  4L18 B;  1TNT A;  1JE8 A;  3LQR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...