2HTSA

Crystal structure of the dna binding domain of the heat shock transcription factor
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
92
structure length
88
Chain Sequence
ARPAFVNKLWSMVNDKSNEKFIHWSTSGESIVVPNRERFVQEVLPKYFKHSNFASFVRQLNMYGWHKVQDVKSGSNDSRWEFENERHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription factor
molecule keywords HEAT-SHOCK TRANSCRIPTION FACTOR
publication title Crystal structure of the DNA binding domain of the heat shock transcription factor.
pubmed rcsb
source organism Kluyveromyces lactis
total genus 24
structure length 88
sequence length 92
ec nomenclature
pdb deposition date 1994-06-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2htsA00
5HLGA 3C3WA 5BOXA 1IXSB 1XGSA 4I0AA 2XAGA 3DP7A 1MJAA 4RS8A 1DPRA 2DU9A 1U6GA 2JTVA 3GZ6A 3CUQC 1Z05A 2A3SA 1P4WA 4RGUA 5E8GA 3RKWA 1I6XA 2CQKA 5JI6A 1YLFA 4L9NA 1O7LA 2ISYA 2W84A 2QENA 2FMLA 2R7FA 4GXOA 3LA3A 4KN4X 2Z5UA 4YFNF 5HVQC 2KRFA 3H3ZA 4OMZA 2CO5A 5FFXA 3FM3A 3F23A 4I01A 3ROUA 3KP3A 3IL2A 4UNOA 1XN7A 4OIRF 2A68F 1W7PA 5EEHA 1NHAA 2COMA 3GFIA 4AWXB 2M87A 2HYFA 2XKOA 3LQRA 3D5LA 2L02A 2YSRA 1C0WA 2NS0A 2KJBA 3WTSC 5JFRA 1Q1HA 3ZP5A 1PP8F 2V6CA 4L5IA 2RGVA 3TO7A 3L00A 3WG9A 2PFBA 1FNNA 3VODA 3K0LA 3CO7C 4A2UA 5D8LB 3JAMZ 2UZKA 2WV0A 5L3GA 2QBYB 6PAXA 5CVVA 3Q9SA 5FLXZ 2ESNA 1KA8A 1IN6A 2OZ6A 4HYEA 4CICA 5AIQA 2A6EF 1VTNC 2PI0A 2YX7A 1U5TC 3MEXA 2J5OA 4B8XA 5BS6A 3T0YA 2HKXA 3U1DA 4LG0A 1D8KA 2AXLA 2BGCA 3DQVC 5HS7A 2DT5A 4YFXF 2G7UA 1WSUA 4BNCA 5D5WB 1R1UA 2E1NA 2IPQX 1J75A 4G6QA 4BQAA 2V1XA 5D6FA 2DQLA 1T38A 3F21A 4UHTA 4IRHA 3KLOA 1JHHA 5D6EA 2IA2A 4RGSA 2HWVA 4WCGA 5L3CA 3KCCA 3FHZA 5FFZA 1BC8C 2CG4A 1KU2A 2MBFA 4M72A 3R0JA 1RIOH 5ICCA 4L9TA 3L2CA 4KMFA 2JPBA 2Z3YA 4ENJA 1XGOA 2PMHA 3K9TA 3ECHA 4RAZA 2V79A 1FOKA 3GEZA 4BHPA 3HRTA 1QZZA 1ZG3A 4LJZF 3C1DA 2GQQA 3J81K 2P7CB 2VC0A 3F8FA 3HTUA 2FXAA 1W7PB 2O0YA 3GO5A 1D8JA 1T39A 1LDJA 5DD8A 2Y0MA 4KYWA 2MA3A 1R5HA 3GYHX 1HW2A 1R7JA 2DLLA 4EJTA 4HDUA 1UHMA 3LAJA 1FBUA 1DDNA 2UXNA 1JHFA 4QWQA 3F3XA 2M30A 1O7FA 3QU6A 4U0YA 3O2PE 2VBYA 3EDPA 3RDIA 2BBYA 4CGZA 2MLGA 2L54A 4LK0F 3KE2A 5IT3A 1AOYA 2RNJA 4F7ZA 1TNTA 4M71A 1I5ZA 3LQQA 3K69A 3R6SA 3LAPA 1U2WA 2XVCA 4LG0B 5AONA 1ZLKA 2JT1A 1REPC 2B0LA 4UVAA 3HSEA 3MQ0A 2UWMA 3P9IA 2ELHA 5DYMA 5HDNA 4CO8A 5D8KB 4AIJA 3RYRA 3TGNA 4K2EA 1W5TA 4ZZDA 1ZRDA 1MJ9A 3HHHA 1BBYA 3IRRA 3FZVA 1H0MA 5ICEA 3WE3A 1I27A 2RQPA 5CVRA 5HDKA 3FWEA 1ZN2A 2FU4A 4HF2A 3BDDA 2HYGD 4DNCA 4E70A 2EA2A 1SD7A 2FOKA 4WXHA 3FXUA 1W4MA 3E5XA 2FSWA 2W25A 4RGRA 4CZZA 3NEUA 1EH8A 3RTRA 1SMYF 1ZRFA 4FX4A 1T6SA 4N9HA 1MD0A 3Q5FA 1GHCA 5TRDA 2D45A 4RGXA 2OZUA 5E1WA 4U7DA 3K1MA 4EV0A 2GZWA 3REOA 2R7DA 4EVIA 3WTXC 2GXGA 3ZMSA 3CTAA 4XLNF 2EK5A 3SQNA 1J7KA 4PGGA 1YW8A 4BYYA 5F64A 2PQ8A 4Y15A 4KUMA 2Q0OA 1J59A 2ESHA 2TDXA 1LB2A 2QWWA 1FP2A 3E3VA 4HQMA 2BV6A 3B73A 3HOTA 3GW2A 1YW9A 3T1BA 3V7CA 2LNBA 3P7NA 3HSFA 2MH2A 2XROA 2EFNA 1TQPA 2O3FA 5D5XB 1KU7A 1T0FA 2F5CA 4G9YA 1G3WA 5CVIA 1BJAA 2F2EA 3MAJA 5DUKA 2W24A 1R1TA 4O6JA 4GCVA 4Q48A 2QQBA 2K7LA 1AWCA 4LD5A 3TOBA 3F8CA 2FBHA 1RNLA 5ILSA 2DBBA 2E7WA 2CFXA 3COAC 2ZXJA 3IWZA 4ZYDA 5ICFA 4I0BA 2O03A 5TJJA 4OIQF 2GXBA 3P9CA 3VFZA 1YTYA 1QNTA 3VEPA 2A07F 2XV4S 3U2RA 2CWEA 4XRFA 1MJBA 1KQ9A 1FX7A 1QQIA 4Q47A 3RKXA 1S8NA 1BI0A 1IW7F 1U8RA 4P55A 3IRQA 3DPTA 4HQEA 4LGWA 5H6QA 3BWGA 5E1XA 1HKQA 3KP6A 2QM3A 3TDZC 2RKHA 1ULYA 4I7HA 1ZLJA 1YIOA 3MFKA 4QLCU 1LDDA 4ENKA 3PQJA 4KN7X 2M1BA 1YYVA 4IPAA 2EB7A 4EMSA 3WODF 3E6DA 2CSOA 4IXAA 2K86A 3E6CC 1FC3A 2KJCA 1O57A 2G7HA 1KU9A 1RZ4A 5LRRA 1XDUA 2A61A 4AVPA 2G9WA 3WGHA 5K5OA 2NNYA 3V8KA 2ZMEA 2ZNYA 3V7RA 4KT5C 4B09A 4GO1A 1USSA 3KEOA 3LA2A 4ZYEA 1B59A 2M5WA 3ZN1A 5HLIA 4UV9A 3KEQA 2YX4A 3QP5A 4HLYA 1PDNC 1R36A 1IN8A 2IJLA 5BQTA 1BIBA 2ZJ2A 2LDUA 3F22A 3PFIA 3QPTA 4I98B 2FRHA 4RB3C 2NYXA 1MGTA 2W85A 1OYYA 1P2FA 2L3DA 1MZBA 2PEXA 3DV8A 2A69F 1LQ1A 4MNUA 4A6EA 1A04A 3RIRA 2HGCA 1J5YA 1FP1D 1J0RA 1S3JA 3JAMK 3EYYA 4MEXF 4AIHA 1KGSA 4KIBA 2MC3A 3WGIA 3ECOA 3CJNA 4KA4A 2R3SA 2XIGA 2DPUA 2KIMA 4L5JA 3WTVC 1WWXA 3JW4A 4R1HA 4ON0A 2L4AA 1BC7C 2P7VB 2ISZA 1G3YA 4OU0A 1XCVA 2D1VA 4HDVA 3QPHA 1SD6A 1KQ0A 2EA4A 3KETA 1TLHB 2GAUA 2LF8A 3HUGA 4I09A 5CJ9A 4KNYA 3W6KB 4U7BA 1G6NA 3HSRA 3W6JB 4R8HA 4EGYA 1ZARA 1KU3A 1XMKA 3V4GA 1F1ZA 3F6VA 4M9XA 4PZJA 1T98A 2ZMEB 1OR7A 2CW0F 4IF4A 3TQNA 2OA4A 1SFUA 4WXDA 1LVAA 2IT0A 1F5TA 1K78A 3SHFA 5A2QK 3SFZA 1F9NA 1ZREA 1O3QA 5HS8A 3I64A 4Y17A 1ZAOA 5CVJA 2ADUA 4FX0A 3LA7A 2PG4A 3EYIA 3KP2A 1DP7P 1QZYA 3JTHA 3I71A 2XHKA 2DTRA 1BI3A 3OV8A 2WC2A 4IRIA 2VC1A 3HOSA 4EGZA 4OOIA 1OYWA 2DI3A 3M9AA 4M6YA 1G4DA 4EM1A 3ML6A 4WWCA 1E17A 3HYIA 3AAFA 1R22A 2FMYA 3ABUA 5AIPA 1L0OC 2DW4A 1HW1A 3JTGA 3TO6A 2DFIA 3ZMVA 5E17F 3VB2A 2P4WA 1FLIA 2Q2EA 2LF7A 1G3SA 1FBSA 3KLNA 4A0ZA 4GYGA 3FM5A 3H92A 2HS5A 3WGGA 3FXRA 3MWMA 4G7HF 4CDGA 1STZA 2VBWA 2HDCA 4AIKA 3EETA 1D5VA 1YS6A 1XD7A 1ON1A 4PDKA 3LSTA 4P9FA 3I53A 2W57A 1P4XA 3CO6C 4NQWA 3ZQ7A 4LK1F 5DEQA 3M7GA 1GXPA 4IHTA 3OOPA 5KK1A 3R0AA 2QVOA 2RN7A 3J81Z 1IF1A 3K1NA 1K78B 2DQRA 2XAJA 2VT3A 4YIFA 1DPUA 3I0TA 2FBIA 3DEUA 5H20A 2EV0A 3V7SA 2Z9OA 3BJAA 4U88A 4WXCA 4YFKF 1CGPA 1IXCA 3I58A 2DK5A 1FYKA 2VBZA 1B9MA 2HZTA 3T8TA 2ZCWA 2PMUA 5BMZA 4UVCA 2YPRA 4RB2C 1PUEE 3R60A 4BHCA 5HOOA 2FF4A 2RV8A 5K1YA 3ZMTA 1ZHFA 2X0LA 3BPXA 4IHSA 5DV5A 4EJVA 3BOQA 4CHUA 1EH7A 2MLKA 2KIFA 4O5VA 1UHWA 2Z99A 4ZZLA 2P5LC 4XLPF 5LGUA 3C7JA 3JSPA 3E6MA 4HLXA 5CYVA 2GA2A 1XGMA 2A5YB 1OMIA 2IRFG 1FSEA 3C18A 3KFWX 4TV7A 4KIFA 4P96A 1XDSA 3TO9A 1D3YA 3DXJF 3WU1B 3F8MA 4BXUA 1P6RA 1DUXC 3SZPA 1L3LA 3ZMDA 5LEJA 3I5UA 2L01A 1HSJA 3F6OA 5LLQA 5E20A 4ZYHA 5LGNA 4NHJA 4MEYF 2KIUA 2RC4A 2QQ9A 3GVAA 5BPIA 4KDPA 1ZRCA 1LEBA 3RKYA 3L09A 3HRMA 2F5DA 1O3TA 1IAWA 1U3EM 1UFMA 1BIAA 3GZ5A 5D4RA 4UVBA 2HTJA 4P9UA 1J9IA 3SZTA 2VE8A 4A5NA 4WF2A 3DF8A 4HV6A 3J7AO 2DO7A 3F8NA 5J6XA 1LNWA 3D0SA 5HDGA 3ZMZA 1YS7A 1PP7U 4WX9A 3QU3A 5L3EA 1Z9CA 2P5VA 5HLHA 1HQCA 1S7AA 2ACJA 1B9NA 1YQAA 1SFEA 5D5VB 4U0VA 2A6HF 2EV6A 1BM9A 2YR2A 1ZG5A 1FPQA 1Z91A 2OD5A 3M1EA 1XCBA 5HS9A 1SFXA 2K4BA 2JZYA 1O3RA 1XGNA 1TW2A 4EM2A 2H09A 2LKPA 1XB4A 2V9VA 5ED4A 2VE9A 5E18F 4LLGF 4ENNA 2XASA 4ZH4F 2XUBA 1FBQA 1W7PD 1Z6TA 4EJOA 5ICGA 3N4MA 2E1CA 3M8FA 2O6GE 3R4KA 1JE8A 3RJPA 2OU2A 2V1DA 3WTYC 4R79A 5DCFA 1ONVA 4BH9A 3SXYA 2C6YA 4ESFA 3FMQA 4XBFA 1IZ1A 3GWZA 3CLOA 1WQ2A 2X4HA 1WRJA 4IRGA 2IP2A 2VT2A 4AD9A 4OIOF 2F5FA 4G7OF 4HV5A 2PN6A 5J8CA 4EQQA 2JRTA 2CGPA 5DUIA 3IC7A 2MD5A 3KZYA 3FMSA 2DAOA 4Z2YA 1K6OA 4A6DA 1FSHA 1O3SA 1QPMA 4MHGA 3QOPA 1K79A 1HSTA 5DD4A 1HKSA 4O3MA 3RYPA 5L3FA 2LSOA 3J80Z 4CXFA 2ZO4A 4GGGA 2VBXA 1T2KA 2HFHA 5FO5A 3EQLF 1Z6RA 2HTSA 1XSDA 2GIVA 2FNAA 1FZPB 2BE5F 3CUQA 1USTA 3U9GA 3G3ZA 3QAHA 1RI7A 1HKTA 3O6BB 2KKOA 1IN4A 4L9VA 1P4AA 5D4SA 4XSXF 4A0YA 3IKTA 2H6CA 5EEGA 3F8BA 1TTYA 5L3BA 3E5UA 5IT9Z 1KYWA 2HOEA 4LLNA 5FLXK 4OIPF 5F1RA 1WKMA 2H94A 1G3TA 4HX4A 2AS5F 4L0ZB 4HW0A 3ERED 2M8EA 5LRSA 1SD5A 4A12A 4HF1A 3QP6A 3L9FA 2NNNA 2H6BA 3E5QA 2UXXA 2V1UA 2K4JA 3K2ZA 2XAQA 1E2XA 3PQKA 2H27A 1BN5A 1XMAA 4MQ9F 3BY6A 4N9IA 4GYIA 2D1HA 2Y75A 5E8IA 2CYYA 3WE2A 3WTTC 2STWA 4YG2F 3P9KA 3ZN0A 1U5TA 2FQ3A 2QQAA 3DPLC 1IRGA 2EJRA 3RPQA 3MZYA 1R5GA 4A0XA 3K1PA 1QGPA 2QYOA 4G8XA 4M6XA 5LBQA 4ENMA 4L0YB 3MZHA 1OYIA 3WU0A 3BROA 4JBAA 5FD6A 1YFHA 4JK1X 2ZNZA 2BEOA 5LHIA 3N97A 4PCQA 5K5QA 3HRSA 2HQNA 2QLZA 4RB1A 2VN2A 5FGMA 2P6TA 4MTDA 1WI9A 4L9JA 3JSOA 4MGRA 3CUQB 3IWFA 1OKRA 2MH9A 3B02A 1Z7UA 3KP5A 4IVNA 4EJWA 1TQMA 3LFKA 3IHUA 1YO5C 3H3UA 2OQGA 2OAZA 4HF0A 1UCRA 5F6FA 4EJUA 2IVMA 3L7WA 1YG2A 4FT8A 4G6DA 2IA1A 1YW7A 5BPDA 5DDGA 3BPVA 2D2WA 3DKWA 1LEAA 4I02A 3T5XA 1FYLA 4M74A 2HKOA 4M73A 1GXQA 1MKMA 5K5RA 4YIIA 2O8XA 1BOAA 4OMYA 5A2QZ 2XAFA 4EM0B 2FEZA 3V8JA 2XAHA 1W5SA 3FMRA 1FYMA 1I1SA 2Z33A 2DPDA 1TW3A 5D5UB 3TDUC 2ZFWA 1RUOA 4LFUA 2XRNA 2RDPA 3DFGA 3RI4A 4G94A 1U5TB 1TQIA 4BAYA 2PBIA 2Q8KA 1MDMA 4LMYA 4LLLA 2K02A 3GFLA 2EFWA 1LDKB 2BYVE 1J2XA 1QBJA 5ILVA 2FA5A 2M45A 2EFOA 1H9GA 2XKPA 4HBLA 2OQRA 5H6RA 2VODA 1FT9A 4KIGA 1ZH5A 4WK8F 5LHHA 3NQOA 1IUYA 1TNSA 4UXNA 1EV7A 1B1BA 3BZ6A 1JGSA 1ON2A 5E1ZB 5FD5A 4M9SA 3G73A 1V4RA 4IJAA 4I2OA 3CUOA 5FB2A 4KICA 1BI2A 1KYZA 5KVRA 2JPCA 4MTEA 5ILUA 1ODDA 3FXQA 4HAMA 1R00A 3CDHA 1UB9A 1IXRC 1Z1DA 1EH6A 3ISPA 1KQ8A 3GFJA 2P6SA 4M9ZA 2FBKA 1V3FA 2ZBKA 3BP8A 1ZGJA 2EFQA 3M8EA 5LHGA 3RPUA 2VONA 3F72A 2E7XA 4S05A 2P5KA 1CF7A 2GA1A 4MQVA 2FE3A 3E6BA 3NRVA 3GX4X 2QZ8A 3E97A 4KMUX 2OBPA 2WTEA 1IN7A 2HR3A 3WTZA 2QUFA 1MDMB 1Y0UA 4JQFA 3GLXA 3LWFA 2L4MA 3I59A 2JSCA 4HX8A 4XSZF 1R1VA 5JHUA 3R61A 1U78A 3VOEA 1HW5A 3V8LA 4ETSA 5DCMA 4DQ2A 3Q9VA 2VXZA 3MCZA 2HQRA 4UV8A 4H0EA 4RAYA 3ELKA 3S2WA 1HBXG 2RVCA 3HTSB 2PLYA 5L3DA 2EV5A 3T8RA 1I1GA 1IN5A 2DK8A 4KFCA 3ULQB 4S04A 3FX3A 4D0PA 3HIFA 4FHTA 4HZFA 1S6LA 4HA8A 3FF5A 1FWZA 3GFMA 2F5EA 1FY7A 3HRUA 1SD4A 5JR3A 5JVTA 4PGHA 3GXOA 3KP7A 1S7OA 3TOAA 1K7AA 1R23A 2VOPA 2FNPA 1JXSA 4CYDA 4ZYGA 3BJ6A 4ESJA 5CVUA 2Y48A 3HHGA 4A5MA 4RB0A 2STTA 3IKVA 2WWYA 1XSVA 1P92A 4ESBA 4BHBA 1RUNA 5LGTA 2GWRA 5ERIA 1SAXA 1F4KA 1CF7B 3GUDA 4LB5A 3I4PA 3BJOA 4LB6B 4Q5SF 2HEOA 3ABTA 1XSXA 2ETHA 4N0BA 2YU3A 4U0WA 1B4AA 3I54A 2EFPA 1B6AA 1S29A 3WTWC 3WTUC 1ZG1A 1H9TA 1BI1A 3J80K 5J8FA 2NRAC 3I59B 3EUHA 2VOOA 4P5OA 1HXDA 4Q4ZF 4NB5A 1SMTA 5DCMB 1ZGAA 1LJ9A 3ZPLA 1ZYRF 4Y13A 2P8TA 2O61A 3O3KA 2QBYA 4HX7A 2EWNA 3TKYA 1R58A 2ZKZA 2XGXA 1QO0D 2PJPA 4L18B 3GF2A 2NAZA 5IT9K 2IW5A 2IA0A 2K27A 4UUVA 1OPCA 3ZMUA 4HOBA 3KP4A 5CLSA 3KZZA 1X3UA 2J5PA 4G7ZF 1GVJA 1IRFA 1TBXA 5LEKA 4ASNA 3QRFF 4OINF
chains in the Genus database with same CATH superfamily
4DOZA 5HLGA 1IGNA 3VSKA 3C3WA 4BE1A 4IHWA 2LLKA 3W3CA 5BOXA 1W36C 1IXSB 1XGSA 4CA0A 1WJFA 4HG2A 2X1DA 2XGCA 4HSTA 3A0BC 4I0AA 2EZHA 1JTXA 4DJAA 2XAGA 3DP7A 1MJAA 1BJZA 5KHDA 1ERDA 2JUCA 5GTHC 4RS8A 5EZHA 1DPRA 2DU9A 3I9V2 1I50J 4NBQA 4DBQA 2EINH 3L2QA 2AQEA 1U6GA 1OFCX 4JYKA 5FKMA 2JTVA 3GZ6A 3CUQC 1Z05A 2A3SA 1P4WA 4RGUA 5E8GA 1GUUA 4AYBA 3DU5A 3RKWA 1I6XA 4CZCA 1G2HA 1YIJI 2CQKA 5JI6A 3O8HA 1YLFA 3LNQA 4L9NA 3OYEA 2M4GA 2WV1A 1O7LA 2ISYA 2W84A 2QENA 2FMLA 4IL6C 1ZR2A 3JRGA 2R7FA 3ZQFA 2ZXIA 4GXOA 3LA3A 4KN4X 2Z5UA 3FXLA 1FMWA 2RREA 4YFNF 5HVQC 2KRFA 4EATA 3H3ZA 4OMZA 1V5GA 2CO5A 5FFXA 4IQJA 2DA3A 3FM3A 3F23A 4I01A 2DYRH 2M3AA 3KP3A 3ROUA 5DM6F 3IL2A 4UNOA 3RZOJ 3CCYA 2K40A 1XN7A 4ZDLA 4OIRF 1HLVA 4Z6YA 2DOFA 2E5NA 4Y3OA 1IDZA 2A68F 1W7PA 2IGMA 5EEHA 1NHAA 2COMA 3BR5A 4CCNA 1RPWA 3GFIA 2E71A 3IP4B 4AWXB 4LIUA 2PJRB 2M87A 2HYFA 2XKOA 3LQRA 3D5LA 2L02A 2YSRA 1LPQA 1C0WA 3OWTA 1VQPI 2CW8A 2LOOA 2NS0A 2KJBA 3WTSC 2KZVA 5JFRA 2MYSA 1Q1HA 3ZP5A 1PP8F 1VQ9I 2V6CA 2BVLA 2IEKA 4L5IA 2RGVA 3TO7A 3L00A 2DMTA 3OYLA 3RKQA 2OTJI 2DXIA 1UHSA 2Y9ZA 3WG9A 2PFBA 3TW6A 1R4MB 1FNNA 2IGKA 3VODA 1MBHA 1TZLA 1LE8B 2QCOA 2VKHA 3K0LA 4W97A 4A2UA 2BY3A 4AYBN 5D8LB 3CO7C 1YITI 3JAMZ 2UZKA 2IS1A 4B3XA 2WV0A 5L3GA 2QBYB 6PAXA 2VASA 5CVVA 2UUZA 3Q9SA 5IYCJ 3H9JA 5FLXZ 3I3LA 2ESNA 4FTHA 1KA8A 2GXAA 3CDLA 1IN6A 2OZ6A 2ZFUA 4HYEA 4CICA 2DN0A 5AIQA 2A6EF 1VTNC 1W0TA 2YX7A 1U5TC 2PI0A 2K9NA 2B63J 4BBSJ 2TRTA 3MEXA 4XICA 2J5OA 4B8XA 5BS6A 1YOVB 1XPXA 3T0YA 3PM1A 1WI3A 2HKXA 4IHVA 3MMYB 3U1DA 4LG0A 5GADJ 1D8KA 1P9QC 1FOWA 2AXLA 2Z2SB 2XF7A 2BGCA 3DQVC 3JR9A 5HS7A 2DT5A 4YFXF 2G7UA 1NK2P 1R71A 2WAQA 3U21A 1V5FA 1TWHJ 1WSUA 4BNCA 1RC9A 5D5WB 3QYFA 1R1UA 4RLQA 3AG1H 2E1NA 2IPQX 1ETOA 4YIRX 1J75A 4G6QA 4BQAA 5BNGA 2V1XA 4M3DA 5D6FA 1YX5A 2DQLA 1T38A 4XLAA 3F21A 3QPSA 4UHTA 4IO9F 1HDDC 4RA2A 4IRHA 3K70C 4BKXA 1HDPA 4UY8I 3KLOA 1JHHA 5D6EA 2E60A 3RSNA 2IA2A 4RGSA 1S9HA 2HWVA 4WCGA 2VI6A 5L3CA 3KCCA 2H8WA 4LIVA 3FHZA 2M0CA 4XNFA 5FFZA 2LR8A 1BC8C 3OSFA 2CG4A 4C3HJ 1R49A 1KU2A 3W2WA 2MBFA 4M72A 3R0JA 2MD0A 4FISA 3G6EI 3CJTB 1FTZA 1O4XA 1RIOH 5ICCA 4L9TA 3L2CA 1SEUA 1IV6A 2W1OA 4KMFA 2HOSA 2JPBA 4M3GA 2Z3YA 4ENJA 1XGOA 3A2KA 1SFKA 1Y6IA 2JK3A 2H1KA 2PMHA 3K9TA 2BHZA 3ECHA 4RAZA 2V79A 2BOLA 2DMPA 1FOKA 3CMEI 3GEZA 4BHPA 2W82A 3MKZA 3BZCA 4DW6A 2AO9A 3HRTA 1QZZA 1ZG3A 4LJZF 3C1DA 2GQQA 5F0HA 3K4MA 3G1OA 1BR4A 3J81K 2P7CB 2VC0A 3F8FA 3HTUA 2WAQN 2K9MA 2FXAA 1W7PB 2O0YA 1WVRA 3GO5A 1GLNA 1D8JA 4NUBA 1XG1A 5GPAA 3M1CA 1T39A 1LDJA 1XS9A 3LSRA 3IV5A 1VQ8I 5DD8A 3CC7I 3OYGA 2Y0MA 1TT5B 2CUFA 2LKSA 2MA3A 4KYWA 3BG5A 2MGQA 5J4VA 4LG3A 3HGGA 1YJWI 2JRMA 5J40A 1R5HA 3GYHX 2HDWA 3GTJJ 1FEXA 3ONQA 2XRLA 2ZXHA 1R7JA 1HW2A 2DLLA 4QPOA 3PO3J 1WHUA 4QIWN 4J01A 2HVRA 4MO7A 4E7KA 3H9QA 4V2FA 4EJTA 4HDUA 1UHMA 3LAJA 1FBUA 4BJ6C 1DDNA 2UXNA 1JHFA 4QWQA 3F3XA 2M30A 1O7FA 3QU6A 4U0YA 4A3KJ 3O2PE 2VBYA 3HPGA 3EDPA 3RDIA 2BBYA 1JT6A 4CGZA 1IG7A 3FXKA 3S3OA 2CQ7A 2MLGA 2L54A 3HC7A 5C3EJ 4CH7A 4LK0F 2Y69H 3KE2A 5IT3A 1AOYA 2RNJA 4F7ZA 1TNTA 2L7KA 4M71A 1I5ZA 4DYQA 3LQQA 3K69A 3R6SA 3LAPA 4C2TA 1D1BA 1U2WA 5FJ8J 4BGDA 3L2UA 2XVCA 3C2BA 4NC6A 4LG0B 4XR6A 5AONA 1ZLKA 1MW7A 2JT1A 1REPC 2B0LA 2VKEA 4UB6C 4UVAA 2R7SA 3HSEA 3MQ0A 2UWMA 3P9IA 2ELHA 5DYMA 5HDNA 3HL2A 2K9SA 4CO8A 5D8KB 2LY9A 1EA3A 4UB8C 4AIJA 3RYRA 2KDOA 3TGNA 4K2EA 1W5TA 3MN2A 4XOPA 4ZZDA 1ZRDA 2X48A 1MJ9A 3PUFA 3HHHA 1BBYA 3IRRA 4A3LJ 4PSWA 3UNGC 3FZVA 1H0MA 4XIDA 3DLAA 5ICEA 3WE3A 2R5ZA 1X1PA 3I4NJ 4XORA 1I27A 2RQPA 4LOCA 1X4PA 1DGRM 5CVRA 1ZKGA 4A3MJ 1X58A 5HDKA 2OUMA 3FWEA 4AIDA 1ZN2A 2FU4A 4HF2A 2Z1DA 1WJEA 3BDDA 3S3NA 3X2QH 1JUMA 2HYGD 4DNCA 4E7HA 4E70A 2CMPA 3DKYA 1QA6A 3H0DA 2EA2A 4OAYA 1SD7A 2FOKA 3TEDA 4WXHA 3PNYA 1MH4A 3OSGA 1G59A 3FXUA 1W4MA 3G71I 3E5XA 1UAAA 2XGEA 2FSWA 2W25A 4RGRA 4CZZA 2X1CA 2VJ5A 3NEUA 2XPWA 2KFDA 1EH8A 4M6VA 3RTRA 3WHBA 4AM3A 1SMYF 3S2HJ 4PJMA 3MD2A 1ZRFA 4F91B 1VI0A 2KIQA 3GBGA 4E7LA 3H5NA 1T6SA 4FX4A 4N9HA 1MD0A 3M4OJ 3Q5FA 3H5RA 1GHCA 4AU7A 5TRDA 2D45A 3H0GJ 2FJ1A 1BR1A 3N05A 2O8KA 4RGXA 2OZUA 5E1WA 4U7DA 2ME0A 2CRGA 1ZQ3P 2NOJB 1JI8A 3G2BA 3K1MA 4EV0A 2GZWA 3REOA 2R7DA 1TC3C 2EZIA 4FASD 4EVIA 3OYNA 4CCLA 1QZEA 2DA6A 2E34A 2VL8A 3WTXC 2JUGA 3EUKL 2GXGA 3ZMSA 1NTCA 4YRVA 3ASOH 3K10A 3CTAA 4XLNF 4B48A 2EK5A 3SQNA 1J7KA 4PGGA 1YW8A 4BYYA 1IDYA 5F64A 3K7AJ 3JRIA 2PQ8A 4Y15A 4KUMA 2Q0OA 4V19K 1J59A 3S93A 2ESHA 2TDXA 1LB2A 2QWWA 4E6KG 1FP2A 3E3VA 4HQMA 1VZ0A 2BV6A 1ZELA 4ZTFA 3B73A 4E4HA 3HOTA 3GW2A 3S16J 1YW9A 1DGWY 1IUFA 3T1BA 3V7CA 2AQFA 1JKPC 3NAUA 4XOTA 2V9KA 2LNBA 1KONA 1X1DA 3P7NA 5J1YA 1ACIA 2R7VA 3HSFA 1X3WB 2MH2A 2EFNA 1TQPA 2O3FA 5D5XB 2XROA 2VQGA 2JMWA 1KU7A 1T0FA 2F5CA 4BS9A 4G9YA 2R7RA 1G3WA 4XLHA 5CVIA 4A69C 2K9QA 1BJAA 2F2EA 3MAJA 5DUKA 2W24A 1YJ9I 2WY7Q 1R1TA 4O6JA 4A3GJ 1MMSA 4GCVA 4Q48A 1I3AA 2X6OA 2QQBA 3BQZA 1W36D 1N25A 2R5ZB 3PUBA 2K7LA 1AWCA 2ZC2A 4LD5A 3TOBA 1D5YA 3F8CA 1EJ9A 2QGUA 2FBHA 1RNLA 3PJRA 4JP0A 5ILSA 2R93J 4IHXA 2DBBA 2E7WA 2CFXA 3E7LA 2F4OB 5M3FJ 2JWTA 3COAC 2ZXJA 4RAGA 4BE2A 3OMYA 3IWZA 2KDZA 4ZYDA 5C4JJ 2X6WA 1T33A 3SDGA 5ICFA 1OLTA 1JKRC 4I0BA 9ANTA 2ECCA 1R6RA 2O03A 5TJJA 1U9NA 4OIQF 5F0CA 1POGA 1A35A 2GXBA 1IRZA 3K2AA 3ZOBA 3D1NI 1OQYA 3P9CA 3VFZA 1YTYA 3S32A 1QNTA 3VEPA 2A07F 4A3CJ 4MFDA 4IX7A 1BA5A 2XV4S 1E0EA 5J1RA 4KT6A 3U2RA 2CWEA 4XRFA 1V5EA 3IAS2 3MZ8A 1MJBA 3JRDA 1KQ9A 1FX7A 1QQIA 2K3PA 1Q1VA 2OF7A 4FETA 4Q47A 3RKXA 1S8NA 1YRNA 1BI0A 2JVGA 2IS2A 1IW7F 1U8RA 2BY1A 4EEFG 3JCUC 4P55A 3IRQA 4X1EA 4BQNA 3DPTA 3H36A 4D9JA 4HQEA 4LGWA 5H6QA 3BWGA 5E1XA 1HKQA 3KP6A 4F92B 3MKWB 2QM3A 5IP6A 4XL9A 4JX4A 3TDZC 3OYDA 1RR8C 4BE0A 4XN0A 2LREA 2RKHA 1ULYA 3KZIC 3ZRGA 4I7HA 1ZLJA 4RBOA 1YIOA 3MFKA 3BC8A 3HPHA 4QLCU 1LDDA 3K4BA 2V1NA 2X51A 3LFUA 2DFHA 5CQEA 4ENKA 3PQJA 4QTRA 2GOXB 4KN7X 2M1BA 2R4GA 1X3ZB 1YYVA 4IPAA 2Q1ZB 3LOCA 2EIMH 4I76A 4ZTJA 2EB7A 4EMSA 1ORKA 3HJEA 3WODF 3E6DA 1AA7A 5B3SH 1H8AC 2BVMA 2BY0A 2CSOA 2E35A 4IXAA 1N77A 2K86A 3E6CC 3I55I 1FC3A 4HRIA 5DS9A 2KJCA 1IC8A 1O57A 1Y0NA 1KU9A 2G7HA 2A5WA 2O7OA 3EUHC 1RZ4A 5LRRA 4ZDOA 1XDUA 2HVQA 2JA7J 2A61A 1X1BA 1ZTRA 2G9WA 3A03A 3WGHA 5FKNA 2CH0A 4AVPA 3L2WA 3IH4A 2JSPA 2LTPA 5EG0A 5K5OA 2NNYA 3V8KA 4F52A 2ZMEA 2ZNYA 3V7RA 3OYBA 3BTCA 3CMYA 3CCEI 4B44A 4KT5C 2E2JJ 2EZLA 4B09A 4GO1A 1USSA 3KEOA 3LA2A 4ZYEA 3C2GA 5IP9J 1PYVA 1B59A 3LSMA 2M5WA 3ZN1A 5HLIA 3PSIA 1ENHA 1D0ZA 2L2OA 4UV9A 3KEQA 1Y1VJ 1NG7A 2CS3A 2YX4A 1JGGA 3QP5A 4HLYA 1PDNC 2OV7A 5HODA 1R36A 1IN8A 2IJLA 2P0WA 5BQTA 3HKZN 1BIBA 2ZJ2A 1OCTC 4P1WA 2LDUA 3F22A 3S1RJ 3KPHA 1DQUA 3PFIA 3QPTA 3QWLA 2Y0SN 3FHNA 4XRMA 4I98B 2I8DA 3Q0WA 1ZR4A 1XC5A 2EIKH 2FRHA 3FXJA 4RB3C 2NYXA 3SJMA 1XX5A 1MGTA 2W85A 1QPIA 2WAEA 1OYYA 3ZQQA 3DTEA 1P2FA 1TWFJ 2XSJC 4A3DJ 2L3DA 3S15J 2DT7B 1AKHA 1MZBA 2E1OA 1N78A 3H1CA 2PEXA 3GZNB 2NVYJ 3DV8A 4B4CA 2A69F 4DYCA 3HB9A 1I39A 3J7ZI 1LQ1A 2LH9A 4MNUA 4A6EA 1YRNB 3U1KA 2M34A 1A04A 5FLMJ 3RIRA 2HGCA 1J5YA 1FP1D 3QYBA 1J0RA 2R7QA 4A3FJ 1S3JA 4BJTA 3EYYA 3JAMK 4MEXF 1B8IA 3FBIB 4AIHA 2R7WA 3KIOA 1KGSA 4KIBA 4A93J 4B3AA 3DBHB 3I4MJ 2MC3A 3WGIA 2CV1A 3ECOA 3CJNA 4KA4A 2R3SA 2BZTA 2XIGA 2DPUA 2KIMA 1X1CA 4L5JA 3AKZA 2XPVA 3WTVC 1WWXA 3DPUA 1HA8A 2L7FP 4Y52J 3JW4A 5F1JA 1V54H 2KZGA 4R1HA 4ON0A 2L4AA 4IOCF 3DEEA 1BC7C 2P7VB 2ISZA 1OCOH 1G3YA 4OU0A 1XCVA 2D1VA 5JLXA 4HDVA 1R4NB 3QPHA 2ME6A 2VJIA 2Y31A 3I56I 2KLOA 2KT0A 3G1MA 1SD6A 4BL0B 1KQ0A 1QRYA 4MFEA 1D0XA 1IRXA 2EA4A 4GRIA 5IYDJ 3KETA 2BW3A 2A05A 2CQXA 1TLHB 3OYJA 1VQMI 2GAUA 1MH3A 3TW7A 1X19A 2Z16A 3E1SA 2LF8A 3HUGA 2M2EA 4I09A 5CJ9A 3WG7H 4KNYA 3W6KB 3D5RC 1G6NA 4U7BA 3HSRA 1DP3A 3W6JB 4R8HA 4EGYA 1ZARA 2DTZA 1KU3A 1XMKA 4HPQA 5EG0B 3V4GA 2OTLI 1F1ZA 3F6VA 4PFPA 4IEJA 4M9XA 3OYAA 1T95A 1T98A 3CP2A 4PZJA 1PUFA 2ZMEB 1T08B 1OR7A 4KJZA 3S17J 2CW0F 5CQGA 4IF4A 1NH3A 4F55A 3OS0A 2HNHA 3TQNA 5LFAA 2OA4A 1SFUA 2VPRA 2F5VA 3VYSB 2Y2ZA 4WXDA 1LVAA 4AVZA 5J47A 1F5TA 2IT0A 4A3EJ 1WH5A 2XDVA 1K78A 3SHFA 2PMZN 2B9SA 2GOMA 1K83J 3ERMA 1OR7C 5A2QK 3SFZA 1F9NA 1ZREA 3PSFA 1O3QA 2DCEA 5HS8A 3I64A 2VIXA 4Y17A 3FKIJ 1ZAOA 1SVOA 2ADUA 3OL4A 5CVJA 4FX0A 4G6TB 3VYRB 2LY1A 3LA7A 2PG4A 5GAHJ 4LITA 3Q3SA 2K9LA 3EYIA 3CCMI 2RNGA 3KP2A 1DP7P 1QZYA 4PJJA 3JTHA 3I71A 2XHKA 2DTRA 2R7UA 1BI3A 1FMVA 2DYSH 3OV8A 1WPKA 2EZKA 2WC2A 4IRIA 2VC1A 1AKHB 3HOSA 3K4KA 4EGZA 4OOIA 2FX0A 3FXOA 1S5LC 1ETYA 5EDNA 1OYWA 1IO2A 2DI3A 3M9AA 2MFZA 4M6YA 1G4DA 4EM1A 3ML6A 4D7NA 4WWCA 3OYHA 3OS2A 4AC0A 3A01A 1E17A 3HYIA 1B8IB 2NVTJ 2JA6J 3AAFA 2KP6A 1ZGWA 1VQ6I 1RRJA 1R22A 2VUMJ 2IS6A 3RPUD 3RCOA 2FMYA 3ABUA 1K4TA 2QKMB 5AIPA 1L0OC 2DW4A 1HW1A 3JTGA 1X2NA 2L7MP 4XK4A 3TO6A 2DFIA 3ZMVA 5E17F 5F0FA 1TT0A 2XF5A 3VB2A 2P4WA 1FLIA 2DJIA 2LF7A 2Q2EA 3OR1C 1MNEA 1G3SA 1OCPA 1FBSA 3GCMA 3KLNA 4A0ZA 4GYGA 3FM5A 2Y9YA 2JQ7A 1VQLI 3UR3C 3H92A 2HS5A 3WGGA 3FXRA 2COBA 2VKDA 5F08A 3ZR8X 2BW3B 4XLEA 4JX5A 3MWMA 4G7HF 4CDGA 5CKTA 1STZA 3CF2A 1Z7LA 2ZB9A 3HUGB 4F93B 2LD5A 5EYRA 2VBWA 3S14J 2H8RA 2HDCA 4AIKA 3EETA 1D5VA 3ZQLA 5IY5H 1YS6A 2O5RA 1XD7A 2ZSHB 4N4OB 1ON1A 4PDKA 4X0GA 3BR2A 3LSTA 4P9FA 5B5EC 2LP0A 4BQOA 3I53A 2W57A 1SC7A 3Q0VA 1PUFB 1SANA 3ZGKA 3S1NJ 2YUSA 2XC7A 1P4XA 3CO6C 4NQWA 3ZQ7A 4LK1F 2EIJH 4II2A 5DEQA 3M7GA 2E1MB 4DIQA 4YELA 1GXPA 2AXTC 4IHTA 2MABA 5EGOA 3H9GA 3OOPA 2L9NA 2MSYA 2QVOA 2RN7A 3R0AA 5KK1A 2E19A 4CCJA 3J81Z 3K1NA 1IF1A 2ELKA 2DOEA 3ZQIA 3VWBA 1K78B 2DQRA 2D5VA 1Y8RB 2XAJA 2VT3A 4YIFA 1DPUA 3CLQA 2E36A 3I0TA 1YE9A 3HG9A 2FBIA 3DEUA 1B72A 5H20A 4BDZA 2EV0A 3V7SA 2F4IA 2Z9OA 4IHYA 1VNDA 3BJAA 1ETWA 2JVHA 1VQ5I 4U88A 4WXCA 4YFKF 1CGPA 1IXCA 1UMQA 3I58A 2DK5A 2HVSA 1TWAJ 4J00A 1FYKA 4XRSG 2VBZA 1B9MA 2HZTA 3T8TA 2ZCWA 3CC2I 1RKWA 2PMUA 5BMZA 4UVCA 3GTPJ 2YPRA 4RB2C 4M3BA 3R60A 3G4SI 1PUEE 1EF4A 3A1YA 2CW7A 3CMAI 4BHCA 5HOOA 3ZXSA 2FF4A 5E3NA 1YJNI 3D5SC 2RV8A 5K1YA 3ZMTA 4CSWA 2GM4A 1ZHFA 2X0LA 3BPXA 4RMNA 2DFFA 2M8GX 3KYDB 4IHSA 5DV5A 1YX3A 3A01B 5EZGA 1VF9A 4EJVA 3BOQA 4CHUA 1EH7A 1D1CA 2BXZA 2MLKA 5JHFA 2KIFA 4KITB 3QOEA 1HCRA 4OWRB 4O5VA 3GLLA 2M0MA 1UHWA 3PNTA 1X2MA 1Z3XA 2Z99A 4ZZLA 2P5LC 4XLPF 2R7TA 1Z67A 3C7JA 5LGUA 3JSPA 5E3OA 3E6MA 4HLXA 5CYVA 2GA2A 2HYJA 3BR0A 4PJLA 1XGMA 2CUEA 4BUPA 2A5YB 1OMIA 2IRFG 1FSEA 3C18A 2GIZA 3KFWX 4TV7A 1Z21A 3W2AA 2Q2EB 1IV8A 4KIFA 4RM3A 1HC8A 4P96A 2F6CA 1XDSA 3LSKA 3TO9A 2LK2A 3CP8A 1D3YA 3W2VA 1GDTA 2FD5A 3DXJF 2QA4I 3WU1B 3F8MA 4BXUA 3SEQA 1P6RA 3H3VK 4X6AJ 2VQLA 4E7ZA 5J1UA 1DUXC 3SZPA 2QSGX 1L3LA 3ZMDA 5LEJA 1EKEA 1DU0A 4XRSA 3I5UA 4J19A 3JRFA 5IYBJ 4MIMA 2L01A 1HSJA 3UKGA 1H88C 3PNVA 3VPRA 1W0UA 3F6OA 3OYMA 4E7IA 3FKJA 5LLQA 5E20A 2V6EA 3LSHA 1U9OA 3GTOJ 4CYCA 3BCAA 5M5WJ 2YS9A 5KAFC 4HNTA 4ZYHA 4ZDPA 4ZC3A 3VSLA 5LGNA 4NHJA 4MEYF 2KIUA 1GV5A 4NQWB 3HXLA 4XLFA 3RQIA 2CV2A 2RC4A 4H4KC 1MNMC 2QQ9A 3GVAA 5BPIA 1JUPA 5EGOB 2VLAA 4KDPA 4BY7J 2LKXA 4ZJZA 1ZRCA 1LEBA 3RKYA 5HLTA 1OISA 3L09A 1NK3P 4M3EA 3HRMA 1N75A 2F5DA 3HOWJ 2DA7A 1MNDA 1O3TA 1V55H 1GT0C 1B72B 1IAWA 1U3EM 5DM7F 1UFMA 1APLC 2A6TA 3BG3A 2VJJA 1BIAA 3GZ5A 5D4RA 4UVBA 2HTJA 2HQ5A 4P9UA 1J9IA 3SZGA 3SZTA 2VE8A 3DLLF 4A5NA 2OCEA 3P5JA 1BW5A 4WF2A 1FIAA 3CCUI 3DF8A 4HV6A 3J7AO 1ETVA 1T0FC 2DO7A 3S2DJ 3F8NA 5J6XA 1LNWA 3M07A 3HOYJ 3D0SA 3GTLJ 5HDGA 3ZMZA 1WJ5A 3OIPA 2WY8Q 1YS7A 1PP7U 4WX9A 3HEFA 4JOMA 4BXFA 5K7HA 3HGYA 3QU3A 2LMDA 5L3EA 1Z9CA 2P5VA 2L9SA 5HLHA 1HQCA 2KQRA 5JLWA 1Y56A 4BBRJ 2VB6A 1S7AA 2BXYA 2ACJA 1A5JA 1B9NA 1YQAA 1SFEA 1UG2A 3LSIA 5D5VB 2EBIA 4U0VA 2WAFA 5KNLA 1TWGJ 3Q0UA 1FJLA 2A6HF 5C44J 4E7SA 2EV6A 4B43A 1BM9A 2HPMA 2YR2A 1ZG5A 1FPQA 3FBNB 3M8JA 4AUXA 5TGTA 1Z91A 2OD5A 3M1EA 1XCBA 5HS9A 3OS1A 1SFXA 1H89C 2K4BA 4CCOA 2LBFA 1BW6A 2JZYA 1O3RA 1OCCH 1XGNA 5B1BH 1TW2A 3BT9A 4EM2A 2H09A 2LKPA 4C3JJ 3ZCOA 1XB4A 2V9VA 1ETXA 2DT6A 1F36A 5KCMA 1K6YA 1W1WE 5TISC 5ED4A 2VE9A 1GVDA 3KYCB 1SVMA 2QKLB 5E18F 2X1EA 1HOMA 4LLGF 4ENNA 2LC2A 5EEAA 2XASA 4ZH4F 2HXOA 5DTDA 2XUBA 1FBQA 1W7PD 1Z6TA 3IAM2 1S72I 3FK6A 3OYCA 3HKZA 4EJOA 5GTIC 3QPLA 5ICGA 3N4MA 2E1CA 4HEA2 3CESA 3ZQGA 3BTJA 3M8FA 2O6GE 3R4KA 2Y0SA 1JE8A 1WZ2A 4BJ5C 3RJPA 3F0CA 2OU2A 2V1DA 3WTYC 1NG6A 3A4CA 5GP9A 4R79A 1TWCJ 4CYCB 2V4JC 5DCFA 1ONVA 3BCBA 4BH9A 3SXYA 2C6YA 4ESFA 1VQ4I 3FMQA 3K6GA 2NVQJ 4XBFA 1IZ1A 3GWZA 2EH3A 5LD2C 3KX2A 3CLOA 1WQ2A 2X4HA 1WJAA 2FOWA 1WRJA 4IRGA 3S1MJ 2IP2A 2VT2A 4AD9A 4OIOF 2F5FA 4G7OF 4XLCA 4HV5A 1E3PA 2PN6A 3LL7A 5J8CA 1A31A 2QSHX 2P81A 4EQQA 2JRTA 3CCSI 2CGPA 3A0HC 5DUIA 3IC7A 4D5FA 4RDUA 2MD5A 4BDYA 3KZYA 3FMSA 2DAOA 2PX9A 3IH2A 1DU6A 4Z2YA 1K6OA 3K70D 4A6DA 1FSHA 1O3SA 4HSRA 1QPMA 3FK7A 4MHGA 2MW8A 3QOPA 1K79A 1HSTA 1RETA 3BG9A 5DD4A 1HKSA 2ZMEC 1JKQC 4O3MA 1JKOC 3K4NA 3RYPA 1VQ7I 5L3FA 2LSOA 3J80Z 1OCZH 4CXFA 3BQYA 2ZO4A 4GGGA 1BR2A 2VBXA 1T2KA 2N8GA 2HFHA 5FO5A 4C2MJ 3EQLF 1Z6RA 5J4YA 2B7EA 2E5ZA 1WJCA 2HTSA 1XSDA 2GIVA 2FNAA 4GDFA 1FZPB 3TL4X 1PVEA 2BE5F 1LVKA 3CUQA 1USTA 3U9GA 3G3ZA 3QAHA 1RI7A 5EF6A 1HKTA 3O6BB 2KKOA 1IN4A 4L9VA 5E3MA 1P4AA 5D4SA 4XSXF 2W4SA 1MBJA 3CJQB 4A0YA 1ZK8A 3IKTA 3S1QJ 2H6CA 5EEGA 3F8BA 1TTYA 1MBFA 2LBFB 5L3BA 3E5UA 4ANJA 5IT9Z 1KYWA 3FDYA 3JRHA 2LVSA 2HOEA 4LLNA 5FLXK 4UUTA 4OIPF 5F1RA 2ECBA 4XMYA 2DDAA 1WKMA 2OCCH 2H94A 1G3TA 1LFBA 2WADA 4HX4A 2V7FA 3ABKH 2AS5F 3OIQA 4L0ZB 2R7OA 4HW0A 1TP4A 1FOXA 3HZJA 3ERED 2M8EA 5LRSA 1SD5A 2K5CA 5FKKA 4A12A 3L2RA 2PMZA 1MMGA 4HF1A 3QP6A 3OYKA 3L9FA 2NNNA 2H6BA 4XKWA 3E5QA 2UXXA 4KISA 2DODA 3MKYB 1JTYA 4BACA 2V1UA 2K4JA 3ZQCA 2OJED 3DBLB 3K2ZA 3RZDJ 2XAQA 1E2XA 3BTIA 3PQKA 3PL8A 2NVUB 2H27A 2X6YA 4XKCA 2QEXI 1BN5A 1MMNA 3GTGJ 2E2HJ 1XMAA 1PJRA 2IAIA 4MQ9F 3BY6A 4N9IA 4GYIA 2JJ7A 4BEHA 2HQAA 2VQHA 2X85A 2D1HA 2VXDA 2Y75A 4Y7NJ 2NXNB 2M7BA 3DWLE 5E8IA 5IPAA 2CYYA 1WCMJ 3WE2A 3WTTC 2STWA 4YG2F 3P9KA 5HNFA 3J7AY 3ZN0A 2XGDA 2ID3A 1U5TA 2FQ3A 4Y4RA 2JN6A 2QQAA 4I6ZA 4DZPA 3DPLC 1IRGA 2EJRA 3RPQA 1P7JA 1R5GA 3MZYA 4A0XA 5IP7J 3K1PA 1QGPA 2QYOA 1MSEC 4IQ4A 4QSHA 4G8XA 4M6XA 5LBQA 3OYIA 1XMXA 4ENMA 4L0YB 3MZHA 1OYIA 2IS4A 4JX6A 2FUG2 2L9RA 3CZ6A 3SFIA 4HNVA 3WU0A 3BROA 4JBAA 2KRCA 3NWTA 5FD6A 3SYTA 1YFHA 2WB1A 4JK1X 2ZNZA 2EILH 2BEOA 3HOVJ 4C2UA 2WA0A 3ZQHA 4D5CA 5LHIA 3N97A 1WGXA 4PCQA 5K5QA 3HRSA 2HQNA 3KEYA 3SDBA 3GTMJ 2QLZA 4RB1A 3HM5A 1I3QJ 1WFXA 2E1MC 2VN2A 5FGMA 2P6TA 4MTDA 1WI9A 4XKVA 4L9JA 2KRHA 3JSOA 3K4JA 4MGRA 3CUQB 4FCYA 3IWFA 1VQOI 2DMQA 3OR2C 4GFBA 1OKRA 2MH9A 3B02A 1Z7UA 3KP5A 1OJLA 4IVNA 1FIPA 4EJWA 3K4CA 1TQMA 1UZCA 3LFKA 3CDIA 3PIOF 3IHUA 2AHQA 1ETQA 4U87A 1YO5C 3H3UA 2OQGA 2OAZA 1D0YA 4HF0A 4OAZA 1X1AA 1UCRA 4BXXJ 2FQ4A 3C2HA 4II3A 5F6FA 4EJUA 5JVGF 1QVUA 2CU7A 2IVMA 2LRDA 5EJCA 3L7WA 1UG0A 3IUOA 5FRNA 2DMNA 2OC6A 1YG2A 4FT8A 2VJ4A 4G6DA 2IA1A 1YW7A 5BPDA 5DDGA 1SAUA 3BPVA 4YEJA 3DU6A 2D2WA 3NARA 3DBRB 3DKWA 2TCTA 1ETKA 3DCFA 3JREA 1T56A 2WB1N 1TL8A 1LEAA 2ZXWH 2W48A 2EQRA 4I02A 3T5XA 3GTKJ 1Y8QB 3RQ4A 1FYLA 2CV0A 2ELJA 2M4KA 4M74A 4RLFA 2HKOA 4A3BJ 3QODA 4M73A 3B6CA 2HI3A 2R0QC 2ZJPF 1GXQA 1MKMA 5K5RA 1U0JA 3CF5F 4YIIA 2O8XA 1BOAA 4OMYA 2XPUA 1GV2A 5A2QZ 2XAFA 1JJ8C 3CMMA 4EM0B 2FEZA 2JA2A 4NC8A 3V8JA 2DJNA 2XAHA 4PJ0C 4BY1J 1RR7A 1W5SA 4DZJA 3FMRA 3LMMA 3OYFA 3EPZA 2H1LA 1FYMA 1I1SA 2Z33A 5FROA 3JRBA 4BEHB 2DPDA 2RQQA 3CC4I 1TW3A 5D5UB 3TDUC 5K7FA 2ZFWA 1LFUP 2V26A 4B47A 1RUOA 2K85A 2XRNA 2RDPA 4LFUA 3DFGA 3RI4A 1BL0A 3L2VA 4G94A 1MIJA 2LYCA 3QYEA 2L7ZA 2DA5A 5H2FC 1UJ8A 4BQQA 1U5TB 1TQIA 4BAYA 2PBIA 2Q8KA 3BR6A 2JA8J 1MDMA 4LMYA 4LLLA 4XM3A 2K02A 3GFLA 2EFWA 1LDKB 1MBGA 3HOZJ 2KISA 1YHQI 2BYVE 1J2XA 1QBJA 2HPIA 5ILVA 2FA5A 2M45A 2EFOA 2YU9J 2DFEA 4ABZA 1H9GA 2XKPA 3ASNH 4BU2A 4XKBA 2BY2A 4PFOA 2WBMA 2OQRA 4HBLA 2QQ8A 1K61A 5H6RA 2VODA 3O8GA 1FT9A 1Z3YA 4KIGA 3AG4H 2F48A 2KMUA 2NOGA 2R5YA 1ZH5A 4CCMA 3WHCA 2R7ZJ 4WK8F 5LHHA 3NQOA 2F4MB 1IUYA 1E3HA 1TNSA 4UXNA 5FKOA 1EV7A 1UELB 1Z0XA 4C3IJ 4ZYAA 2I10A 4V2GA 1B1BA 3BZ6A 3PIPF 3FISA 5M5YJ 3M3YJ 1JGSA 4DYRA 1Y1WJ 3ABLH 3TP0A 4XQFA 1ON2A 5E1ZB 5FD5A 4M9SA 3G73A 4RAFA 1LUJB 1V4RA 2K3FA 4IJAA 2W7NA 2JA5J 3CUOA 1Y39A 2ZSIB 1VFCA 4I2OA 2LFBA 5FB2A 4B1RA 3QQAA 4KICA 1BI2A 1KYZA 1MBEA 3FIWA 5KVRA 1M1EB 3K4LA 2R7XA 2JPCA 2XSDC 3LSJA 4MTEA 5ILUA 1ODDA 3FXQA 4HAMA 1R00A 4PSXA 3CDHA 2L5QA 1UB9A 1IXRC 2EPFA 5FRMA 1Z1DA 1EH6A 3ISPA 3HOXJ 4NNJA 1FOYA 4L5EA 1KQ8A 2ID6A 3GFJA 2P6SA 5FLVA 1JUSA 4G12A 3OY9A 3BR1A 4M9ZA 2FBKA 2IXSA 1V3FA 2MG4A 2ZBKA 2VPLA 2DDBA 3BZKA 3BP8A 3BLYA 1ZGJA 5IOZA 2EFQA 1WJDA 2R92J 4PUSA 3CCVI 1KZHA 3M8EA 5LHGA 3RPUA 2IBDA 2E2IJ 3DTIA 3L1PA 2VONA 3F72A 3TBIA 1HF0A 2E7XA 1SFOJ 4DGWB 4S05A 2ICWG 1S7EA 3CCQI 2P5KA 1SVLA 2HXIA 1CF7A 4E7JA 2GA1A 4MQVA 3VDXA 1BOBA 4IKFA 1QHHD 2FE3A 2HDDA 2IGOA 2DOAA 2L9VA 3E6BA 3NRVA 2KHMA 1A6IA 2QZ8A 3GX4X 3E97A 4A3JJ 4KMUX 4W1UA 2GBYA 1D1AA 3AG3H 2OBPA 2WTEA 1IN7A 4PK4A 2HR3A 3WTZA 2M9HA 4IZZA 5KAIC 3CQZJ 5J3LA 2QUFA 1I6HJ 3CCLI 1MDMB 1Y0UA 4JQFA 3GLXA 4ITVA 2CQNA 3LSGA 4PJNA 3LWFA 2L4MA 3I59A 2JSCA 3F9KA 4HX8A 2V9PA 4IOAF 4XSZF 1R1VA 5JHUA 1RESA 4D7MA 1G8XA 3R61A 1U78A 3VOEA 1HW5A 3V8LA 1K4SA 2DA2A 2XB5A 4C9YA 4ETSA 5DCMA 2KPMA 4DQ2A 4UUSA 1RKTA 5GAGJ 3Q9VA 2NVXJ 2VXZA 3MCZA 2HQRA 2R5YB 4UV8A 5HNHA 4H0EA 4MLOA 4XN3A 3G1LA 2UV1A 4RAYA 3ELKA 3SEZA 3S2WA 1HBXG 2RVCA 1JJ6C 3HTSB 2DA4A 2PLYA 5L3DA 2LG4A 2EV5A 3LSPA 3T8RA 1I1GA 1IN5A 2CFOA 3BG6A 2DK8A 1T8IA 1P7IA 4KFCA 3ULQB 3B6AA 4NDLA 4S04A 2MC4A 3FX3A 4D0PA 1MBKA 3J7YJ 3HIFA 3TP3A 2I5UA 5C4XJ 2XAUA 4FHTA 4HZFA 1S6LA 4HA8A 3WU2C 5GAEJ 1CQTA 2ZJRF 4F3QA 3AL0C 3FF5A 2L0KA 1R9TJ 4XONA 1FWZA 3GFMA 3S3MA 3DTKA 5IOYA 4S0HB 5B66C 2F5EA 1FY7A 4A3IJ 3HRUA 1QVTA 1SD4A 5JR3A 1XTAA 2G0EA 5JVTA 3KYLA 2XF6A 4PGHA 3MVPA 3V42A 3GXOA 3KP7A 4FE7A 1WJBA 1S7OA 2X6XA 3OOUA 1ITYA 2QSFX 3TOAA 1K7AA 1R23A 5K7ZA 2VOPA 3IH3A 2FNPA 1MSFC 4HNUA 1JXSA 4CYDA 4ZYGA 2LY2A 3JRAA 3BJ6A 5GPCA 4ESJA 3MKLA 1MMDA 5CVUA 2Y48A 3HHGA 4A5MA 3H35A 4RB0A 4RM2A 2STTA 3IKVA 2BHYA 2WWYA 1W5CC 2DMUA 1MMAA 1XSVA 1YI2I 3E0JB 4CUGA 3FXMA 3VYUB 4FQGA 1P92A 4ESBA 4BHBA 1RUNA 5LGTA 2GWRA 3HDDA 5ERIA 1SAXA 1F4KA 1CF7B 3BR3A 3HOUJ 1QU3A 3GUDA 4LB5A 3I4PA 4I99C 3BJOA 3GMEA 4N4NB 4LB6B 4Q5SF 2OPTA 1Z77A 2HEOA 3ABTA 2X9DA 2VQCA 2CUZA 3CCJI 1XSXA 5M5XJ 2ETHA 1AHDP 4N0BA 2RAEA 2YU3A 4U0WA 1B4AA 3OIOA 1F43A 4DBRA 1X4OA 4NC7A 3I54A 2EFPA 1B6AA 2DA1A 1S29A 2CJJA 2QF7A 3WTWC 3WTUC 4FE4A 3AG2H 1ZG1A 2CUJA 1H9TA 1BI1A 3BG7A 3AFHA 5M3MJ 5F27A 3J80K 5J8FA 2NRAC 3I59B 3OL3A 3EUHA 2PJRA 5E79C 3CD6I 3PFYA 3EUAA 4Y33A 2VOOA 1AU7A 5F04A 2GLOA 4P5OA 1VQKI 3S8PA 1HXDA 3A02A 4CCKA 4Q4ZF 2HOTA 3ABMH 4NB5A 1SMTA 1JT0A 5DCMB 1LFPA 1QHGA 1WH7A 1ZGAA 4M3FA 3H5AA 4UUSB 1LKXA 3CCRI 1LJ9A 2O9LA 1A36A 1LE8A 4QPQA 3ZPLA 1VQNI 1ZYRF 4Y13A 2P8TA 1A6QA 2O61A 3AL0B 2Y30A 2HOAA 3O3KA 2ZJQF 2HU9A 2QBYA 4HX7A 2EWNA 3TMOA 4C30A 3TKYA 1R58A 2ZKZA 2XGXA 1QO0D 2PJPA 2HZDA 2IGNA 3ESWB 4L18B 5FKLA 3HBLA 3GF2A 1OCRH 5CPRB 2NAZA 2XB0X 5IT9K 2IW5A 2IA0A 5B1AH 2CQQA 2VKVA 1U8BA 2K27A 1R5ID 4UUVA 3CJRB 3PO2J 1OPCA 2M7AA 3ZMUA 4HOBA 2W00A 1FTTA 3KP4A 3DKXA 3W6VA 5CLSA 3VYTB 3KZZA 1X3UA 3DEWA 2J5PA 3BTLA 4G7ZF 1GVJA 1E3OC 2NS8A 1IRFA 1J09A 1IJWC 2NS7A 3JRCA 2KL4A 1TBXA 5LEKA 3NWSA 3GTQJ 4D1QA 4ASNA 3QRFF 4OINF 5E3LA
chains in the Genus database with same CATH topology
5HLGA 3C3WA 5BOXA 1IXSB 1XGSA 4I0AA 2XAGA 3DP7A 1MJAA 4RS8A 1DPRA 2DU9A 1U6GA 2JTVA 3GZ6A 3CUQC 1Z05A 2A3SA 1P4WA 4RGUA 5E8GA 3RKWA 1I6XA 2CQKA 5JI6A 1YLFA 4L9NA 1O7LA 2ISYA 2W84A 2QENA 2FMLA 2R7FA 4GXOA 3LA3A 4KN4X 2Z5UA 4YFNF 5HVQC 2KRFA 3H3ZA 4OMZA 2CO5A 5FFXA 3FM3A 3F23A 4I01A 3ROUA 3KP3A 3IL2A 4UNOA 1XN7A 4OIRF 2A68F 1W7PA 5EEHA 1NHAA 2COMA 3GFIA 4AWXB 2M87A 2HYFA 2XKOA 3LQRA 3D5LA 2L02A 2YSRA 1C0WA 2NS0A 2KJBA 3WTSC 5JFRA 1Q1HA 3ZP5A 1PP8F 2V6CA 4L5IA 2RGVA 3TO7A 3L00A 3WG9A 2PFBA 1FNNA 3VODA 3K0LA 3CO7C 4A2UA 5D8LB 3JAMZ 2UZKA 2WV0A 5L3GA 2QBYB 6PAXA 5CVVA 3Q9SA 5FLXZ 2ESNA 1KA8A 1IN6A 2OZ6A 4HYEA 4CICA 5AIQA 2A6EF 1VTNC 2PI0A 2YX7A 1U5TC 3MEXA 2J5OA 4B8XA 5BS6A 3T0YA 2HKXA 3U1DA 4LG0A 1D8KA 2AXLA 2BGCA 3DQVC 5HS7A 2DT5A 4YFXF 2G7UA 1WSUA 4BNCA 5D5WB 1R1UA 2E1NA 2IPQX 1J75A 4G6QA 4BQAA 2V1XA 5D6FA 2DQLA 1T38A 3F21A 4UHTA 4IRHA 3KLOA 1JHHA 5D6EA 2IA2A 4RGSA 2HWVA 4WCGA 5L3CA 3KCCA 3FHZA 5FFZA 1BC8C 2CG4A 1KU2A 2MBFA 4M72A 3R0JA 1RIOH 5ICCA 4L9TA 3L2CA 4KMFA 2JPBA 2Z3YA 4ENJA 1XGOA 2PMHA 3K9TA 3ECHA 4RAZA 2V79A 1FOKA 3GEZA 4BHPA 3HRTA 1QZZA 1ZG3A 4LJZF 3C1DA 2GQQA 3J81K 2P7CB 2VC0A 3F8FA 3HTUA 2FXAA 1W7PB 2O0YA 3GO5A 1D8JA 1T39A 1LDJA 5DD8A 2Y0MA 4KYWA 2MA3A 1R5HA 3GYHX 1HW2A 1R7JA 2DLLA 4EJTA 4HDUA 1UHMA 3LAJA 1FBUA 1DDNA 2UXNA 1JHFA 4QWQA 3F3XA 2M30A 1O7FA 3QU6A 4U0YA 3O2PE 2VBYA 3EDPA 3RDIA 2BBYA 4CGZA 2MLGA 2L54A 4LK0F 3KE2A 5IT3A 1AOYA 2RNJA 4F7ZA 1TNTA 4M71A 1I5ZA 3LQQA 3K69A 3R6SA 3LAPA 1U2WA 2XVCA 4LG0B 5AONA 1ZLKA 2JT1A 1REPC 2B0LA 4UVAA 3HSEA 3MQ0A 2UWMA 3P9IA 2ELHA 5DYMA 5HDNA 4CO8A 5D8KB 4AIJA 3RYRA 3TGNA 4K2EA 1W5TA 4ZZDA 1ZRDA 1MJ9A 3HHHA 1BBYA 3IRRA 3FZVA 1H0MA 5ICEA 3WE3A 1I27A 2RQPA 5CVRA 5HDKA 3FWEA 1ZN2A 2FU4A 4HF2A 3BDDA 2HYGD 4DNCA 4E70A 2EA2A 1SD7A 2FOKA 4WXHA 3FXUA 1W4MA 3E5XA 2FSWA 2W25A 4RGRA 4CZZA 3NEUA 1EH8A 3RTRA 1SMYF 1ZRFA 4FX4A 1T6SA 4N9HA 1MD0A 3Q5FA 1GHCA 5TRDA 2D45A 4RGXA 2OZUA 5E1WA 4U7DA 3K1MA 4EV0A 2GZWA 3REOA 2R7DA 4EVIA 3WTXC 2GXGA 3ZMSA 3CTAA 4XLNF 2EK5A 3SQNA 1J7KA 4PGGA 1YW8A 4BYYA 5F64A 2PQ8A 4Y15A 4KUMA 2Q0OA 1J59A 2ESHA 2TDXA 1LB2A 2QWWA 1FP2A 3E3VA 4HQMA 2BV6A 3B73A 3HOTA 3GW2A 1YW9A 3T1BA 3V7CA 2LNBA 3P7NA 3HSFA 2MH2A 2XROA 2EFNA 1TQPA 2O3FA 5D5XB 1KU7A 1T0FA 2F5CA 4G9YA 1G3WA 5CVIA 1BJAA 2F2EA 3MAJA 5DUKA 2W24A 1R1TA 4O6JA 4GCVA 4Q48A 2QQBA 2K7LA 1AWCA 4LD5A 3TOBA 3F8CA 2FBHA 1RNLA 5ILSA 2DBBA 2E7WA 2CFXA 3COAC 2ZXJA 3IWZA 4ZYDA 5ICFA 4I0BA 2O03A 5TJJA 4OIQF 2GXBA 3P9CA 3VFZA 1YTYA 1QNTA 3VEPA 2A07F 2XV4S 3U2RA 2CWEA 4XRFA 1MJBA 1KQ9A 1FX7A 1QQIA 4Q47A 3RKXA 1S8NA 1BI0A 1IW7F 1U8RA 4P55A 3IRQA 3DPTA 4HQEA 4LGWA 5H6QA 3BWGA 5E1XA 1HKQA 3KP6A 2QM3A 3TDZC 2RKHA 1ULYA 4I7HA 1ZLJA 1YIOA 3MFKA 4QLCU 1LDDA 4ENKA 3PQJA 4KN7X 2M1BA 1YYVA 4IPAA 2EB7A 4EMSA 3WODF 3E6DA 2CSOA 4IXAA 2K86A 3E6CC 1FC3A 2KJCA 1O57A 2G7HA 1KU9A 1RZ4A 5LRRA 1XDUA 2A61A 4AVPA 2G9WA 3WGHA 5K5OA 2NNYA 3V8KA 2ZMEA 2ZNYA 3V7RA 4KT5C 4B09A 4GO1A 1USSA 3KEOA 3LA2A 4ZYEA 1B59A 2M5WA 3ZN1A 5HLIA 4UV9A 3KEQA 2YX4A 3QP5A 4HLYA 1PDNC 1R36A 1IN8A 2IJLA 5BQTA 1BIBA 2ZJ2A 2LDUA 3F22A 3PFIA 3QPTA 4I98B 2FRHA 4RB3C 2NYXA 1MGTA 2W85A 1OYYA 1P2FA 2L3DA 1MZBA 2PEXA 3DV8A 2A69F 1LQ1A 4MNUA 4A6EA 1A04A 3RIRA 2HGCA 1J5YA 1FP1D 1J0RA 1S3JA 3JAMK 3EYYA 4MEXF 4AIHA 1KGSA 4KIBA 2MC3A 3WGIA 3ECOA 3CJNA 4KA4A 2R3SA 2XIGA 2DPUA 2KIMA 4L5JA 3WTVC 1WWXA 3JW4A 4R1HA 4ON0A 2L4AA 1BC7C 2P7VB 2ISZA 1G3YA 4OU0A 1XCVA 2D1VA 4HDVA 3QPHA 1SD6A 1KQ0A 2EA4A 3KETA 1TLHB 2GAUA 2LF8A 3HUGA 4I09A 5CJ9A 4KNYA 3W6KB 4U7BA 1G6NA 3HSRA 3W6JB 4R8HA 4EGYA 1ZARA 1KU3A 1XMKA 3V4GA 1F1ZA 3F6VA 4M9XA 4PZJA 1T98A 2ZMEB 1OR7A 2CW0F 4IF4A 3TQNA 2OA4A 1SFUA 4WXDA 1LVAA 2IT0A 1F5TA 1K78A 3SHFA 5A2QK 3SFZA 1F9NA 1ZREA 1O3QA 5HS8A 3I64A 4Y17A 1ZAOA 5CVJA 2ADUA 4FX0A 3LA7A 2PG4A 3EYIA 3KP2A 1DP7P 1QZYA 3JTHA 3I71A 2XHKA 2DTRA 1BI3A 3OV8A 2WC2A 4IRIA 2VC1A 3HOSA 4EGZA 4OOIA 1OYWA 2DI3A 3M9AA 4M6YA 1G4DA 4EM1A 3ML6A 4WWCA 1E17A 3HYIA 3AAFA 1R22A 2FMYA 3ABUA 5AIPA 1L0OC 2DW4A 1HW1A 3JTGA 3TO6A 2DFIA 3ZMVA 5E17F 3VB2A 2P4WA 1FLIA 2Q2EA 2LF7A 1G3SA 1FBSA 3KLNA 4A0ZA 4GYGA 3FM5A 3H92A 2HS5A 3WGGA 3FXRA 3MWMA 4G7HF 4CDGA 1STZA 2VBWA 2HDCA 4AIKA 3EETA 1D5VA 1YS6A 1XD7A 1ON1A 4PDKA 3LSTA 4P9FA 3I53A 2W57A 1P4XA 3CO6C 4NQWA 3ZQ7A 4LK1F 5DEQA 3M7GA 1GXPA 4IHTA 3OOPA 5KK1A 3R0AA 2QVOA 2RN7A 3J81Z 1IF1A 3K1NA 1K78B 2DQRA 2XAJA 2VT3A 4YIFA 1DPUA 3I0TA 2FBIA 3DEUA 5H20A 2EV0A 3V7SA 2Z9OA 3BJAA 4U88A 4WXCA 4YFKF 1CGPA 1IXCA 3I58A 2DK5A 1FYKA 2VBZA 1B9MA 2HZTA 3T8TA 2ZCWA 2PMUA 5BMZA 4UVCA 2YPRA 4RB2C 1PUEE 3R60A 4BHCA 5HOOA 2FF4A 2RV8A 5K1YA 3ZMTA 1ZHFA 2X0LA 3BPXA 4IHSA 5DV5A 4EJVA 3BOQA 4CHUA 1EH7A 2MLKA 2KIFA 4O5VA 1UHWA 2Z99A 4ZZLA 2P5LC 4XLPF 5LGUA 3C7JA 3JSPA 3E6MA 4HLXA 5CYVA 2GA2A 1XGMA 2A5YB 1OMIA 2IRFG 1FSEA 3C18A 3KFWX 4TV7A 4KIFA 4P96A 1XDSA 3TO9A 1D3YA 3DXJF 3WU1B 3F8MA 4BXUA 1P6RA 1DUXC 3SZPA 1L3LA 3ZMDA 5LEJA 3I5UA 2L01A 1HSJA 3F6OA 5LLQA 5E20A 4ZYHA 5LGNA 4NHJA 4MEYF 2KIUA 2RC4A 2QQ9A 3GVAA 5BPIA 4KDPA 1ZRCA 1LEBA 3RKYA 3L09A 3HRMA 2F5DA 1O3TA 1IAWA 1U3EM 1UFMA 1BIAA 3GZ5A 5D4RA 4UVBA 2HTJA 4P9UA 1J9IA 3SZTA 2VE8A 4A5NA 4WF2A 3DF8A 4HV6A 3J7AO 2DO7A 3F8NA 5J6XA 1LNWA 3D0SA 5HDGA 3ZMZA 1YS7A 1PP7U 4WX9A 3QU3A 5L3EA 1Z9CA 2P5VA 5HLHA 1HQCA 1S7AA 2ACJA 1B9NA 1YQAA 1SFEA 5D5VB 4U0VA 2A6HF 2EV6A 1BM9A 2YR2A 1ZG5A 1FPQA 1Z91A 2OD5A 3M1EA 1XCBA 5HS9A 1SFXA 2K4BA 2JZYA 1O3RA 1XGNA 1TW2A 4EM2A 2H09A 2LKPA 1XB4A 2V9VA 5ED4A 2VE9A 5E18F 4LLGF 4ENNA 2XASA 4ZH4F 2XUBA 1FBQA 1W7PD 1Z6TA 4EJOA 5ICGA 3N4MA 2E1CA 3M8FA 2O6GE 3R4KA 1JE8A 3RJPA 2OU2A 2V1DA 3WTYC 4R79A 5DCFA 1ONVA 4BH9A 3SXYA 2C6YA 4ESFA 3FMQA 4XBFA 1IZ1A 3GWZA 3CLOA 1WQ2A 2X4HA 1WRJA 4IRGA 2IP2A 2VT2A 4AD9A 4OIOF 2F5FA 4G7OF 4HV5A 2PN6A 5J8CA 4EQQA 2JRTA 2CGPA 5DUIA 3IC7A 2MD5A 3KZYA 3FMSA 2DAOA 4Z2YA 1K6OA 4A6DA 1FSHA 1O3SA 1QPMA 4MHGA 3QOPA 1K79A 1HSTA 5DD4A 1HKSA 4O3MA 3RYPA 5L3FA 2LSOA 3J80Z 4CXFA 2ZO4A 4GGGA 2VBXA 1T2KA 2HFHA 5FO5A 3EQLF 1Z6RA 2HTSA 1XSDA 2GIVA 2FNAA 1FZPB 2BE5F 3CUQA 1USTA 3U9GA 3G3ZA 3QAHA 1RI7A 1HKTA 3O6BB 2KKOA 1IN4A 4L9VA 1P4AA 5D4SA 4XSXF 4A0YA 3IKTA 2H6CA 5EEGA 3F8BA 1TTYA 5L3BA 3E5UA 5IT9Z 1KYWA 2HOEA 4LLNA 5FLXK 4OIPF 5F1RA 1WKMA 2H94A 1G3TA 4HX4A 2AS5F 4L0ZB 4HW0A 3ERED 2M8EA 5LRSA 1SD5A 4A12A 4HF1A 3QP6A 3L9FA 2NNNA 2H6BA 3E5QA 2UXXA 2V1UA 2K4JA 3K2ZA 2XAQA 1E2XA 3PQKA 2H27A 1BN5A 1XMAA 4MQ9F 3BY6A 4N9IA 4GYIA 2D1HA 2Y75A 5E8IA 2CYYA 3WE2A 3WTTC 2STWA 4YG2F 3P9KA 3ZN0A 1U5TA 2FQ3A 2QQAA 3DPLC 1IRGA 2EJRA 3RPQA 3MZYA 1R5GA 4A0XA 3K1PA 1QGPA 2QYOA 4G8XA 4M6XA 5LBQA 4ENMA 4L0YB 3MZHA 1OYIA 3WU0A 3BROA 4JBAA 5FD6A 1YFHA 4JK1X 2ZNZA 2BEOA 5LHIA 3N97A 4PCQA 5K5QA 3HRSA 2HQNA 2QLZA 4RB1A 2VN2A 5FGMA 2P6TA 4MTDA 1WI9A 4L9JA 3JSOA 4MGRA 3CUQB 3IWFA 1OKRA 2MH9A 3B02A 1Z7UA 3KP5A 4IVNA 4EJWA 1TQMA 3LFKA 3IHUA 1YO5C 3H3UA 2OQGA 2OAZA 4HF0A 1UCRA 5F6FA 4EJUA 2IVMA 3L7WA 1YG2A 4FT8A 4G6DA 2IA1A 1YW7A 5BPDA 5DDGA 3BPVA 2D2WA 3DKWA 1LEAA 4I02A 3T5XA 1FYLA 4M74A 2HKOA 4M73A 1GXQA 1MKMA 5K5RA 4YIIA 2O8XA 1BOAA 4OMYA 5A2QZ 2XAFA 4EM0B 2FEZA 3V8JA 2XAHA 1W5SA 3FMRA 1FYMA 1I1SA 2Z33A 2DPDA 1TW3A 5D5UB 3TDUC 2ZFWA 1RUOA 4LFUA 2XRNA 2RDPA 3DFGA 3RI4A 4G94A 1U5TB 1TQIA 4BAYA 2PBIA 2Q8KA 1MDMA 4LMYA 4LLLA 2K02A 3GFLA 2EFWA 1LDKB 2BYVE 1J2XA 1QBJA 5ILVA 2FA5A 2M45A 2EFOA 1H9GA 2XKPA 4HBLA 2OQRA 5H6RA 2VODA 1FT9A 4KIGA 1ZH5A 4WK8F 5LHHA 3NQOA 1IUYA 1TNSA 4UXNA 1EV7A 1B1BA 3BZ6A 1JGSA 1ON2A 5E1ZB 5FD5A 4M9SA 3G73A 1V4RA 4IJAA 4I2OA 3CUOA 5FB2A 4KICA 1BI2A 1KYZA 5KVRA 2JPCA 4MTEA 5ILUA 1ODDA 3FXQA 4HAMA 1R00A 3CDHA 1UB9A 1IXRC 1Z1DA 1EH6A 3ISPA 1KQ8A 3GFJA 2P6SA 4M9ZA 2FBKA 1V3FA 2ZBKA 3BP8A 1ZGJA 2EFQA 3M8EA 5LHGA 3RPUA 2VONA 3F72A 2E7XA 4S05A 2P5KA 1CF7A 2GA1A 4MQVA 2FE3A 3E6BA 3NRVA 3GX4X 2QZ8A 3E97A 4KMUX 2OBPA 2WTEA 1IN7A 2HR3A 3WTZA 2QUFA 1MDMB 1Y0UA 4JQFA 3GLXA 3LWFA 2L4MA 3I59A 2JSCA 4HX8A 4XSZF 1R1VA 5JHUA 3R61A 1U78A 3VOEA 1HW5A 3V8LA 4ETSA 5DCMA 4DQ2A 3Q9VA 2VXZA 3MCZA 2HQRA 4UV8A 4H0EA 4RAYA 3ELKA 3S2WA 1HBXG 2RVCA 3HTSB 2PLYA 5L3DA 2EV5A 3T8RA 1I1GA 1IN5A 2DK8A 4KFCA 3ULQB 4S04A 3FX3A 4D0PA 3HIFA 4FHTA 4HZFA 1S6LA 4HA8A 3FF5A 1FWZA 3GFMA 2F5EA 1FY7A 3HRUA 1SD4A 5JR3A 5JVTA 4PGHA 3GXOA 3KP7A 1S7OA 3TOAA 1K7AA 1R23A 2VOPA 2FNPA 1JXSA 4CYDA 4ZYGA 3BJ6A 4ESJA 5CVUA 2Y48A 3HHGA 4A5MA 4RB0A 2STTA 3IKVA 2WWYA 1XSVA 1P92A 4ESBA 4BHBA 1RUNA 5LGTA 2GWRA 5ERIA 1SAXA 1F4KA 1CF7B 3GUDA 4LB5A 3I4PA 3BJOA 4LB6B 4Q5SF 2HEOA 3ABTA 1XSXA 2ETHA 4N0BA 2YU3A 4U0WA 1B4AA 3I54A 2EFPA 1B6AA 1S29A 3WTWC 3WTUC 1ZG1A 1H9TA 1BI1A 3J80K 5J8FA 2NRAC 3I59B 3EUHA 2VOOA 4P5OA 1HXDA 4Q4ZF 4NB5A 1SMTA 5DCMB 1ZGAA 1LJ9A 3ZPLA 1ZYRF 4Y13A 2P8TA 2O61A 3O3KA 2QBYA 4HX7A 2EWNA 3TKYA 1R58A 2ZKZA 2XGXA 1QO0D 2PJPA 4L18B 3GF2A 2NAZA 5IT9K 2IW5A 2IA0A 2K27A 4UUVA 1OPCA 3ZMUA 4HOBA 3KP4A 5CLSA 3KZZA 1X3UA 2J5PA 4G7ZF 1GVJA 1IRFA 1TBXA 5LEKA 4ASNA 3QRFF 4OINF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HLG A;  3C3W A;  5BOX A;  1IXS B;  1XGS A;  4I0A A;  2XAG A;  3DP7 A;  1MJA A;  4RS8 A;  1DPR A;  2DU9 A;  1U6G A;  2JTV A;  3GZ6 A;  3CUQ C;  1Z05 A;  2A3S A;  1P4W A;  4RGU A;  5E8G A;  3RKW A;  1I6X A;  2CQK A;  5JI6 A;  1YLF A;  4L9N A;  1O7L A;  2ISY A;  2W84 A;  2QEN A;  2FML A;  2R7F A;  4GXO A;  3LA3 A;  4KN4 X;  2Z5U A;  4YFN F;  5HVQ C;  2KRF A;  3H3Z A;  4OMZ A;  2CO5 A;  5FFX A;  3FM3 A;  3F23 A;  4I01 A;  3ROU A;  3KP3 A;  3IL2 A;  4UNO A;  1XN7 A;  4OIR F;  2A68 F;  1W7P A;  5EEH A;  1NHA A;  2COM A;  3GFI A;  4AWX B;  2M87 A;  2HYF A;  2XKO A;  3LQR A;  3D5L A;  2L02 A;  2YSR A;  1C0W A;  2NS0 A;  2KJB A;  3WTS C;  5JFR A;  1Q1H A;  3ZP5 A;  1PP8 F;  2V6C A;  4L5I A;  2RGV A;  3TO7 A;  3L00 A;  3WG9 A;  2PFB A;  1FNN A;  3VOD A;  3K0L A;  3CO7 C;  4A2U A;  5D8L B;  3JAM Z;  2UZK A;  2WV0 A;  5L3G A;  2QBY B;  6PAX A;  5CVV A;  3Q9S A;  5FLX Z;  2ESN A;  1KA8 A;  1IN6 A;  2OZ6 A;  4HYE A;  4CIC A;  5AIQ A;  2A6E F;  1VTN C;  2PI0 A;  2YX7 A;  1U5T C;  3MEX A;  2J5O A;  4B8X A;  5BS6 A;  3T0Y A;  2HKX A;  3U1D A;  4LG0 A;  1D8K A;  2AXL A;  2BGC A;  3DQV C;  5HS7 A;  2DT5 A;  4YFX F;  2G7U A;  1WSU A;  4BNC A;  5D5W B;  1R1U A;  2E1N A;  2IPQ X;  1J75 A;  4G6Q A;  4BQA A;  2V1X A;  5D6F A;  2DQL A;  1T38 A;  3F21 A;  4UHT A;  4IRH A;  3KLO A;  1JHH A;  5D6E A;  2IA2 A;  4RGS A;  2HWV A;  4WCG A;  5L3C A;  3KCC A;  3FHZ A;  5FFZ A;  1BC8 C;  2CG4 A;  1KU2 A;  2MBF A;  4M72 A;  3R0J A;  1RIO H;  5ICC A;  4L9T A;  3L2C A;  4KMF A;  2JPB A;  2Z3Y A;  4ENJ A;  1XGO A;  2PMH A;  3K9T A;  3ECH A;  4RAZ A;  2V79 A;  1FOK A;  3GEZ A;  4BHP A;  3HRT A;  1QZZ A;  1ZG3 A;  4LJZ F;  3C1D A;  2GQQ A;  3J81 K;  2P7C B;  2VC0 A;  3F8F A;  3HTU A;  2FXA A;  1W7P B;  2O0Y A;  3GO5 A;  1D8J A;  1T39 A;  1LDJ A;  5DD8 A;  2Y0M A;  4KYW A;  2MA3 A;  1R5H A;  3GYH X;  1HW2 A;  1R7J A;  2DLL A;  4EJT A;  4HDU A;  1UHM A;  3LAJ A;  1FBU A;  1DDN A;  2UXN A;  1JHF A;  4QWQ A;  3F3X A;  2M30 A;  1O7F A;  3QU6 A;  4U0Y A;  3O2P E;  2VBY A;  3EDP A;  3RDI A;  2BBY A;  4CGZ A;  2MLG A;  2L54 A;  4LK0 F;  3KE2 A;  5IT3 A;  1AOY A;  2RNJ A;  4F7Z A;  1TNT A;  4M71 A;  1I5Z A;  3LQQ A;  3K69 A;  3R6S A;  3LAP A;  1U2W A;  2XVC A;  4LG0 B;  5AON A;  1ZLK A;  2JT1 A;  1REP C;  2B0L A;  4UVA A;  3HSE A;  3MQ0 A;  2UWM A;  3P9I A;  2ELH A;  5DYM A;  5HDN A;  4CO8 A;  5D8K B;  4AIJ A;  3RYR A;  3TGN A;  4K2E A;  1W5T A;  4ZZD A;  1ZRD A;  1MJ9 A;  3HHH A;  1BBY A;  3IRR A;  3FZV A;  1H0M A;  5ICE A;  3WE3 A;  1I27 A;  2RQP A;  5CVR A;  5HDK A;  3FWE A;  1ZN2 A;  2FU4 A;  4HF2 A;  3BDD A;  2HYG D;  4DNC A;  4E70 A;  2EA2 A;  1SD7 A;  2FOK A;  4WXH A;  3FXU A;  1W4M A;  3E5X A;  2FSW A;  2W25 A;  4RGR A;  4CZZ A;  3NEU A;  1EH8 A;  3RTR A;  1SMY F;  1ZRF A;  4FX4 A;  1T6S A;  4N9H A;  1MD0 A;  3Q5F A;  1GHC A;  5TRD A;  2D45 A;  4RGX A;  2OZU A;  5E1W A;  4U7D A;  3K1M A;  4EV0 A;  2GZW A;  3REO A;  2R7D A;  4EVI A;  3WTX C;  2GXG A;  3ZMS A;  3CTA A;  4XLN F;  2EK5 A;  3SQN A;  1J7K A;  4PGG A;  1YW8 A;  4BYY A;  5F64 A;  2PQ8 A;  4Y15 A;  4KUM A;  2Q0O A;  1J59 A;  2ESH A;  2TDX A;  1LB2 A;  2QWW A;  1FP2 A;  3E3V A;  4HQM A;  2BV6 A;  3B73 A;  3HOT A;  3GW2 A;  1YW9 A;  3T1B A;  3V7C A;  2LNB A;  3P7N A;  3HSF A;  2MH2 A;  2XRO A;  2EFN A;  1TQP A;  2O3F A;  5D5X B;  1KU7 A;  1T0F A;  2F5C A;  4G9Y A;  1G3W A;  5CVI A;  1BJA A;  2F2E A;  3MAJ A;  5DUK A;  2W24 A;  1R1T A;  4O6J A;  4GCV A;  4Q48 A;  2QQB A;  2K7L A;  1AWC A;  4LD5 A;  3TOB A;  3F8C A;  2FBH A;  1RNL A;  5ILS A;  2DBB A;  2E7W A;  2CFX A;  3COA C;  2ZXJ A;  3IWZ A;  4ZYD A;  5ICF A;  4I0B A;  2O03 A;  5TJJ A;  4OIQ F;  2GXB A;  3P9C A;  3VFZ A;  1YTY A;  1QNT A;  3VEP A;  2A07 F;  2XV4 S;  3U2R A;  2CWE A;  4XRF A;  1MJB A;  1KQ9 A;  1FX7 A;  1QQI A;  4Q47 A;  3RKX A;  1S8N A;  1BI0 A;  1IW7 F;  1U8R A;  4P55 A;  3IRQ A;  3DPT A;  4HQE A;  4LGW A;  5H6Q A;  3BWG A;  5E1X A;  1HKQ A;  3KP6 A;  2QM3 A;  3TDZ C;  2RKH A;  1ULY A;  4I7H A;  1ZLJ A;  1YIO A;  3MFK A;  4QLC U;  1LDD A;  4ENK A;  3PQJ A;  4KN7 X;  2M1B A;  1YYV A;  4IPA A;  2EB7 A;  4EMS A;  3WOD F;  3E6D A;  2CSO A;  4IXA A;  2K86 A;  3E6C C;  1FC3 A;  2KJC A;  1O57 A;  2G7H A;  1KU9 A;  1RZ4 A;  5LRR A;  1XDU A;  2A61 A;  4AVP A;  2G9W A;  3WGH A;  5K5O A;  2NNY A;  3V8K A;  2ZME A;  2ZNY A;  3V7R A;  4KT5 C;  4B09 A;  4GO1 A;  1USS A;  3KEO A;  3LA2 A;  4ZYE A;  1B59 A;  2M5W A;  3ZN1 A;  5HLI A;  4UV9 A;  3KEQ A;  2YX4 A;  3QP5 A;  4HLY A;  1PDN C;  1R36 A;  1IN8 A;  2IJL A;  5BQT A;  1BIB A;  2ZJ2 A;  2LDU A;  3F22 A;  3PFI A;  3QPT A;  4I98 B;  2FRH A;  4RB3 C;  2NYX A;  1MGT A;  2W85 A;  1OYY A;  1P2F A;  2L3D A;  1MZB A;  2PEX A;  3DV8 A;  2A69 F;  1LQ1 A;  4MNU A;  4A6E A;  1A04 A;  3RIR A;  2HGC A;  1J5Y A;  1FP1 D;  1J0R A;  1S3J A;  3JAM K;  3EYY A;  4MEX F;  4AIH A;  1KGS A;  4KIB A;  2MC3 A;  3WGI A;  3ECO A;  3CJN A;  4KA4 A;  2R3S A;  2XIG A;  2DPU A;  2KIM A;  4L5J A;  3WTV C;  1WWX A;  3JW4 A;  4R1H A;  4ON0 A;  2L4A A;  1BC7 C;  2P7V B;  2ISZ A;  1G3Y A;  4OU0 A;  1XCV A;  2D1V A;  4HDV A;  3QPH A;  1SD6 A;  1KQ0 A;  2EA4 A;  3KET A;  1TLH B;  2GAU A;  2LF8 A;  3HUG A;  4I09 A;  5CJ9 A;  4KNY A;  3W6K B;  4U7B A;  1G6N A;  3HSR A;  3W6J B;  4R8H A;  4EGY A;  1ZAR A;  1KU3 A;  1XMK A;  3V4G A;  1F1Z A;  3F6V A;  4M9X A;  4PZJ A;  1T98 A;  2ZME B;  1OR7 A;  2CW0 F;  4IF4 A;  3TQN A;  2OA4 A;  1SFU A;  4WXD A;  1LVA A;  2IT0 A;  1F5T A;  1K78 A;  3SHF A;  5A2Q K;  3SFZ A;  1F9N A;  1ZRE A;  1O3Q A;  5HS8 A;  3I64 A;  4Y17 A;  1ZAO A;  5CVJ A;  2ADU A;  4FX0 A;  3LA7 A;  2PG4 A;  3EYI A;  3KP2 A;  1DP7 P;  1QZY A;  3JTH A;  3I71 A;  2XHK A;  2DTR A;  1BI3 A;  3OV8 A;  2WC2 A;  4IRI A;  2VC1 A;  3HOS A;  4EGZ A;  4OOI A;  1OYW A;  2DI3 A;  3M9A A;  4M6Y A;  1G4D A;  4EM1 A;  3ML6 A;  4WWC A;  1E17 A;  3HYI A;  3AAF A;  1R22 A;  2FMY A;  3ABU A;  5AIP A;  1L0O C;  2DW4 A;  1HW1 A;  3JTG A;  3TO6 A;  2DFI A;  3ZMV A;  5E17 F;  3VB2 A;  2P4W A;  1FLI A;  2Q2E A;  2LF7 A;  1G3S A;  1FBS A;  3KLN A;  4A0Z A;  4GYG A;  3FM5 A;  3H92 A;  2HS5 A;  3WGG A;  3FXR A;  3MWM A;  4G7H F;  4CDG A;  1STZ A;  2VBW A;  2HDC A;  4AIK A;  3EET A;  1D5V A;  1YS6 A;  1XD7 A;  1ON1 A;  4PDK A;  3LST A;  4P9F A;  3I53 A;  2W57 A;  1P4X A;  3CO6 C;  4NQW A;  3ZQ7 A;  4LK1 F;  5DEQ A;  3M7G A;  1GXP A;  4IHT A;  3OOP A;  5KK1 A;  3R0A A;  2QVO A;  2RN7 A;  3J81 Z;  1IF1 A;  3K1N A;  1K78 B;  2DQR A;  2XAJ A;  2VT3 A;  4YIF A;  1DPU A;  3I0T A;  2FBI A;  3DEU A;  5H20 A;  2EV0 A;  3V7S A;  2Z9O A;  3BJA A;  4U88 A;  4WXC A;  4YFK F;  1CGP A;  1IXC A;  3I58 A;  2DK5 A;  1FYK A;  2VBZ A;  1B9M A;  2HZT A;  3T8T A;  2ZCW A;  2PMU A;  5BMZ A;  4UVC A;  2YPR A;  4RB2 C;  1PUE E;  3R60 A;  4BHC A;  5HOO A;  2FF4 A;  2RV8 A;  5K1Y A;  3ZMT A;  1ZHF A;  2X0L A;  3BPX A;  4IHS A;  5DV5 A;  4EJV A;  3BOQ A;  4CHU A;  1EH7 A;  2MLK A;  2KIF A;  4O5V A;  1UHW A;  2Z99 A;  4ZZL A;  2P5L C;  4XLP F;  5LGU A;  3C7J A;  3JSP A;  3E6M A;  4HLX A;  5CYV A;  2GA2 A;  1XGM A;  2A5Y B;  1OMI A;  2IRF G;  1FSE A;  3C18 A;  3KFW X;  4TV7 A;  4KIF A;  4P96 A;  1XDS A;  3TO9 A;  1D3Y A;  3DXJ F;  3WU1 B;  3F8M A;  4BXU A;  1P6R A;  1DUX C;  3SZP A;  1L3L A;  3ZMD A;  5LEJ A;  3I5U A;  2L01 A;  1HSJ A;  3F6O A;  5LLQ A;  5E20 A;  4ZYH A;  5LGN A;  4NHJ A;  4MEY F;  2KIU A;  2RC4 A;  2QQ9 A;  3GVA A;  5BPI A;  4KDP A;  1ZRC A;  1LEB A;  3RKY A;  3L09 A;  3HRM A;  2F5D A;  1O3T A;  1IAW A;  1U3E M;  1UFM A;  1BIA A;  3GZ5 A;  5D4R A;  4UVB A;  2HTJ A;  4P9U A;  1J9I A;  3SZT A;  2VE8 A;  4A5N A;  4WF2 A;  3DF8 A;  4HV6 A;  3J7A O;  2DO7 A;  3F8N A;  5J6X A;  1LNW A;  3D0S A;  5HDG A;  3ZMZ A;  1YS7 A;  1PP7 U;  4WX9 A;  3QU3 A;  5L3E A;  1Z9C A;  2P5V A;  5HLH A;  1HQC A;  1S7A A;  2ACJ A;  1B9N A;  1YQA A;  1SFE A;  5D5V B;  4U0V A;  2A6H F;  2EV6 A;  1BM9 A;  2YR2 A;  1ZG5 A;  1FPQ A;  1Z91 A;  2OD5 A;  3M1E A;  1XCB A;  5HS9 A;  1SFX A;  2K4B A;  2JZY A;  1O3R A;  1XGN A;  1TW2 A;  4EM2 A;  2H09 A;  2LKP A;  1XB4 A;  2V9V A;  5ED4 A;  2VE9 A;  5E18 F;  4LLG F;  4ENN A;  2XAS A;  4ZH4 F;  2XUB A;  1FBQ A;  1W7P D;  1Z6T A;  4EJO A;  5ICG A;  3N4M A;  2E1C A;  3M8F A;  2O6G E;  3R4K A;  1JE8 A;  3RJP A;  2OU2 A;  2V1D A;  3WTY C;  4R79 A;  5DCF A;  1ONV A;  4BH9 A;  3SXY A;  2C6Y A;  4ESF A;  3FMQ A;  4XBF A;  1IZ1 A;  3GWZ A;  3CLO A;  1WQ2 A;  2X4H A;  1WRJ A;  4IRG A;  2IP2 A;  2VT2 A;  4AD9 A;  4OIO F;  2F5F A;  4G7O F;  4HV5 A;  2PN6 A;  5J8C A;  4EQQ A;  2JRT A;  2CGP A;  5DUI A;  3IC7 A;  2MD5 A;  3KZY A;  3FMS A;  2DAO A;  4Z2Y A;  1K6O A;  4A6D A;  1FSH A;  1O3S A;  1QPM A;  4MHG A;  3QOP A;  1K79 A;  1HST A;  5DD4 A;  1HKS A;  4O3M A;  3RYP A;  5L3F A;  2LSO A;  3J80 Z;  4CXF A;  2ZO4 A;  4GGG A;  2VBX A;  1T2K A;  2HFH A;  5FO5 A;  3EQL F;  1Z6R A;  2HTS A;  1XSD A;  2GIV A;  2FNA A;  1FZP B;  2BE5 F;  3CUQ A;  1UST A;  3U9G A;  3G3Z A;  3QAH A;  1RI7 A;  1HKT A;  3O6B B;  2KKO A;  1IN4 A;  4L9V A;  1P4A A;  5D4S A;  4XSX F;  4A0Y A;  3IKT A;  2H6C A;  5EEG A;  3F8B A;  1TTY A;  5L3B A;  3E5U A;  5IT9 Z;  1KYW A;  2HOE A;  4LLN A;  5FLX K;  4OIP F;  5F1R A;  1WKM A;  2H94 A;  1G3T A;  4HX4 A;  2AS5 F;  4L0Z B;  4HW0 A;  3ERE D;  2M8E A;  5LRS A;  1SD5 A;  4A12 A;  4HF1 A;  3QP6 A;  3L9F A;  2NNN A;  2H6B A;  3E5Q A;  2UXX A;  2V1U A;  2K4J A;  3K2Z A;  2XAQ A;  1E2X A;  3PQK A;  2H27 A;  1BN5 A;  1XMA A;  4MQ9 F;  3BY6 A;  4N9I A;  4GYI A;  2D1H A;  2Y75 A;  5E8I A;  2CYY A;  3WE2 A;  3WTT C;  2STW A;  4YG2 F;  3P9K A;  3ZN0 A;  1U5T A;  2FQ3 A;  2QQA A;  3DPL C;  1IRG A;  2EJR A;  3RPQ A;  3MZY A;  1R5G A;  4A0X A;  3K1P A;  1QGP A;  2QYO A;  4G8X A;  4M6X A;  5LBQ A;  4ENM A;  4L0Y B;  3MZH A;  1OYI A;  3WU0 A;  3BRO A;  4JBA A;  5FD6 A;  1YFH A;  4JK1 X;  2ZNZ A;  2BEO A;  5LHI A;  3N97 A;  4PCQ A;  5K5Q A;  3HRS A;  2HQN A;  2QLZ A;  4RB1 A;  2VN2 A;  5FGM A;  2P6T A;  4MTD A;  1WI9 A;  4L9J A;  3JSO A;  4MGR A;  3CUQ B;  3IWF A;  1OKR A;  2MH9 A;  3B02 A;  1Z7U A;  3KP5 A;  4IVN A;  4EJW A;  1TQM A;  3LFK A;  3IHU A;  1YO5 C;  3H3U A;  2OQG A;  2OAZ A;  4HF0 A;  1UCR A;  5F6F A;  4EJU A;  2IVM A;  3L7W A;  1YG2 A;  4FT8 A;  4G6D A;  2IA1 A;  1YW7 A;  5BPD A;  5DDG A;  3BPV A;  2D2W A;  3DKW A;  1LEA A;  4I02 A;  3T5X A;  1FYL A;  4M74 A;  2HKO A;  4M73 A;  1GXQ A;  1MKM A;  5K5R A;  4YII A;  2O8X A;  1BOA A;  4OMY A;  5A2Q Z;  2XAF A;  4EM0 B;  2FEZ A;  3V8J A;  2XAH A;  1W5S A;  3FMR A;  1FYM A;  1I1S A;  2Z33 A;  2DPD A;  1TW3 A;  5D5U B;  3TDU C;  2ZFW A;  1RUO A;  4LFU A;  2XRN A;  2RDP A;  3DFG A;  3RI4 A;  4G94 A;  1U5T B;  1TQI A;  4BAY A;  2PBI A;  2Q8K A;  1MDM A;  4LMY A;  4LLL A;  2K02 A;  3GFL A;  2EFW A;  1LDK B;  2BYV E;  1J2X A;  1QBJ A;  5ILV A;  2FA5 A;  2M45 A;  2EFO A;  1H9G A;  2XKP A;  4HBL A;  2OQR A;  5H6R A;  2VOD A;  1FT9 A;  4KIG A;  1ZH5 A;  4WK8 F;  5LHH A;  3NQO A;  1IUY A;  1TNS A;  4UXN A;  1EV7 A;  1B1B A;  3BZ6 A;  1JGS A;  1ON2 A;  5E1Z B;  5FD5 A;  4M9S A;  3G73 A;  1V4R A;  4IJA A;  4I2O A;  3CUO A;  5FB2 A;  4KIC A;  1BI2 A;  1KYZ A;  5KVR A;  2JPC A;  4MTE A;  5ILU A;  1ODD A;  3FXQ A;  4HAM A;  1R00 A;  3CDH A;  1UB9 A;  1IXR C;  1Z1D A;  1EH6 A;  3ISP A;  1KQ8 A;  3GFJ A;  2P6S A;  4M9Z A;  2FBK A;  1V3F A;  2ZBK A;  3BP8 A;  1ZGJ A;  2EFQ A;  3M8E A;  5LHG A;  3RPU A;  2VON A;  3F72 A;  2E7X A;  4S05 A;  2P5K A;  1CF7 A;  2GA1 A;  4MQV A;  2FE3 A;  3E6B A;  3NRV A;  3GX4 X;  2QZ8 A;  3E97 A;  4KMU X;  2OBP A;  2WTE A;  1IN7 A;  2HR3 A;  3WTZ A;  2QUF A;  1MDM B;  1Y0U A;  4JQF A;  3GLX A;  3LWF A;  2L4M A;  3I59 A;  2JSC A;  4HX8 A;  4XSZ F;  1R1V A;  5JHU A;  3R61 A;  1U78 A;  3VOE A;  1HW5 A;  3V8L A;  4ETS A;  5DCM A;  4DQ2 A;  3Q9V A;  2VXZ A;  3MCZ A;  2HQR A;  4UV8 A;  4H0E A;  4RAY A;  3ELK A;  3S2W A;  1HBX G;  2RVC A;  3HTS B;  2PLY A;  5L3D A;  2EV5 A;  3T8R A;  1I1G A;  1IN5 A;  2DK8 A;  4KFC A;  3ULQ B;  4S04 A;  3FX3 A;  4D0P A;  3HIF A;  4FHT A;  4HZF A;  1S6L A;  4HA8 A;  3FF5 A;  1FWZ A;  3GFM A;  2F5E A;  1FY7 A;  3HRU A;  1SD4 A;  5JR3 A;  5JVT A;  4PGH A;  3GXO A;  3KP7 A;  1S7O A;  3TOA A;  1K7A A;  1R23 A;  2VOP A;  2FNP A;  1JXS A;  4CYD A;  4ZYG A;  3BJ6 A;  4ESJ A;  5CVU A;  2Y48 A;  3HHG A;  4A5M A;  4RB0 A;  2STT A;  3IKV A;  2WWY A;  1XSV A;  1P92 A;  4ESB A;  4BHB A;  1RUN A;  5LGT A;  2GWR A;  5ERI A;  1SAX A;  1F4K A;  1CF7 B;  3GUD A;  4LB5 A;  3I4P A;  3BJO A;  4LB6 B;  4Q5S F;  2HEO A;  3ABT A;  1XSX A;  2ETH A;  4N0B A;  2YU3 A;  4U0W A;  1B4A A;  3I54 A;  2EFP A;  1B6A A;  1S29 A;  3WTW C;  3WTU C;  1ZG1 A;  1H9T A;  1BI1 A;  3J80 K;  5J8F A;  2NRA C;  3I59 B;  3EUH A;  2VOO A;  4P5O A;  1HXD A;  4Q4Z F;  4NB5 A;  1SMT A;  5DCM B;  1ZGA A;  1LJ9 A;  3ZPL A;  1ZYR F;  4Y13 A;  2P8T A;  2O61 A;  3O3K A;  2QBY A;  4HX7 A;  2EWN A;  3TKY A;  1R58 A;  2ZKZ A;  2XGX A;  1QO0 D;  2PJP A;  4L18 B;  3GF2 A;  2NAZ A;  5IT9 K;  2IW5 A;  2IA0 A;  2K27 A;  4UUV A;  1OPC A;  3ZMU A;  4HOB A;  3KP4 A;  5CLS A;  3KZZ A;  1X3U A;  2J5P A;  4G7Z F;  1GVJ A;  1IRF A;  1TBX A;  5LEK A;  4ASN A;  3QRF F;  4OIN F; 
#chains in the Genus database with same CATH topology
 4DOZ A;  5HLG A;  1IGN A;  3VSK A;  3C3W A;  4BE1 A;  4IHW A;  2LLK A;  3W3C A;  5BOX A;  1W36 C;  1IXS B;  1XGS A;  4CA0 A;  1WJF A;  4HG2 A;  2X1D A;  2XGC A;  4HST A;  3A0B C;  4I0A A;  2EZH A;  1JTX A;  4DJA A;  2XAG A;  3DP7 A;  1MJA A;  1BJZ A;  5KHD A;  1ERD A;  2JUC A;  5GTH C;  4RS8 A;  5EZH A;  1DPR A;  2DU9 A;  3I9V 2;  1I50 J;  4NBQ A;  4DBQ A;  2EIN H;  3L2Q A;  2AQE A;  1U6G A;  1OFC X;  4JYK A;  5FKM A;  2JTV A;  3GZ6 A;  3CUQ C;  1Z05 A;  2A3S A;  1P4W A;  4RGU A;  5E8G A;  1GUU A;  4AYB A;  3DU5 A;  3RKW A;  1I6X A;  4CZC A;  1G2H A;  1YIJ I;  2CQK A;  5JI6 A;  3O8H A;  1YLF A;  3LNQ A;  4L9N A;  3OYE A;  2M4G A;  2WV1 A;  1O7L A;  2ISY A;  2W84 A;  2QEN A;  2FML A;  4IL6 C;  1ZR2 A;  3JRG A;  2R7F A;  3ZQF A;  2ZXI A;  4GXO A;  3LA3 A;  4KN4 X;  2Z5U A;  3FXL A;  1FMW A;  2RRE A;  4YFN F;  5HVQ C;  2KRF A;  4EAT A;  3H3Z A;  4OMZ A;  1V5G A;  2CO5 A;  5FFX A;  4IQJ A;  2DA3 A;  3FM3 A;  3F23 A;  4I01 A;  2DYR H;  2M3A A;  3KP3 A;  3ROU A;  5DM6 F;  3IL2 A;  4UNO A;  3RZO J;  3CCY A;  2K40 A;  1XN7 A;  4ZDL A;  4OIR F;  1HLV A;  4Z6Y A;  2DOF A;  2E5N A;  4Y3O A;  1IDZ A;  2A68 F;  1W7P A;  2IGM A;  5EEH A;  1NHA A;  2COM A;  3BR5 A;  4CCN A;  1RPW A;  3GFI A;  2E71 A;  3IP4 B;  4AWX B;  4LIU A;  2PJR B;  2M87 A;  2HYF A;  2XKO A;  3LQR A;  3D5L A;  2L02 A;  2YSR A;  1LPQ A;  1C0W A;  3OWT A;  1VQP I;  2CW8 A;  2LOO A;  2NS0 A;  2KJB A;  3WTS C;  2KZV A;  5JFR A;  2MYS A;  1Q1H A;  3ZP5 A;  1PP8 F;  1VQ9 I;  2V6C A;  2BVL A;  2IEK A;  4L5I A;  2RGV A;  3TO7 A;  3L00 A;  2DMT A;  3OYL A;  3RKQ A;  2OTJ I;  2DXI A;  1UHS A;  2Y9Z A;  3WG9 A;  2PFB A;  3TW6 A;  1R4M B;  1FNN A;  2IGK A;  3VOD A;  1MBH A;  1TZL A;  1LE8 B;  2QCO A;  2VKH A;  3K0L A;  4W97 A;  4A2U A;  2BY3 A;  4AYB N;  5D8L B;  3CO7 C;  1YIT I;  3JAM Z;  2UZK A;  2IS1 A;  4B3X A;  2WV0 A;  5L3G A;  2QBY B;  6PAX A;  2VAS A;  5CVV A;  2UUZ A;  3Q9S A;  5IYC J;  3H9J A;  5FLX Z;  3I3L A;  2ESN A;  4FTH A;  1KA8 A;  2GXA A;  3CDL A;  1IN6 A;  2OZ6 A;  2ZFU A;  4HYE A;  4CIC A;  2DN0 A;  5AIQ A;  2A6E F;  1VTN C;  1W0T A;  2YX7 A;  1U5T C;  2PI0 A;  2K9N A;  2B63 J;  4BBS J;  2TRT A;  3MEX A;  4XIC A;  2J5O A;  4B8X A;  5BS6 A;  1YOV B;  1XPX A;  3T0Y A;  3PM1 A;  1WI3 A;  2HKX A;  4IHV A;  3MMY B;  3U1D A;  4LG0 A;  5GAD J;  1D8K A;  1P9Q C;  1FOW A;  2AXL A;  2Z2S B;  2XF7 A;  2BGC A;  3DQV C;  3JR9 A;  5HS7 A;  2DT5 A;  4YFX F;  2G7U A;  1NK2 P;  1R71 A;  2WAQ A;  3U21 A;  1V5F A;  1TWH J;  1WSU A;  4BNC A;  1RC9 A;  5D5W B;  3QYF A;  1R1U A;  4RLQ A;  3AG1 H;  2E1N A;  2IPQ X;  1ETO A;  4YIR X;  1J75 A;  4G6Q A;  4BQA A;  5BNG A;  2V1X A;  4M3D A;  5D6F A;  1YX5 A;  2DQL A;  1T38 A;  4XLA A;  3F21 A;  3QPS A;  4UHT A;  4IO9 F;  1HDD C;  4RA2 A;  4IRH A;  3K70 C;  4BKX A;  1HDP A;  4UY8 I;  3KLO A;  1JHH A;  5D6E A;  2E60 A;  3RSN A;  2IA2 A;  4RGS A;  1S9H A;  2HWV A;  4WCG A;  2VI6 A;  5L3C A;  3KCC A;  2H8W A;  4LIV A;  3FHZ A;  2M0C A;  4XNF A;  5FFZ A;  2LR8 A;  1BC8 C;  3OSF A;  2CG4 A;  4C3H J;  1R49 A;  1KU2 A;  3W2W A;  2MBF A;  4M72 A;  3R0J A;  2MD0 A;  4FIS A;  3G6E I;  3CJT B;  1FTZ A;  1O4X A;  1RIO H;  5ICC A;  4L9T A;  3L2C A;  1SEU A;  1IV6 A;  2W1O A;  4KMF A;  2HOS A;  2JPB A;  4M3G A;  2Z3Y A;  4ENJ A;  1XGO A;  3A2K A;  1SFK A;  1Y6I A;  2JK3 A;  2H1K A;  2PMH A;  3K9T A;  2BHZ A;  3ECH A;  4RAZ A;  2V79 A;  2BOL A;  2DMP A;  1FOK A;  3CME I;  3GEZ A;  4BHP A;  2W82 A;  3MKZ A;  3BZC A;  4DW6 A;  2AO9 A;  3HRT A;  1QZZ A;  1ZG3 A;  4LJZ F;  3C1D A;  2GQQ A;  5F0H A;  3K4M A;  3G1O A;  1BR4 A;  3J81 K;  2P7C B;  2VC0 A;  3F8F A;  3HTU A;  2WAQ N;  2K9M A;  2FXA A;  1W7P B;  2O0Y A;  1WVR A;  3GO5 A;  1GLN A;  1D8J A;  4NUB A;  1XG1 A;  5GPA A;  3M1C A;  1T39 A;  1LDJ A;  1XS9 A;  3LSR A;  3IV5 A;  1VQ8 I;  5DD8 A;  3CC7 I;  3OYG A;  2Y0M A;  1TT5 B;  2CUF A;  2LKS A;  2MA3 A;  4KYW A;  3BG5 A;  2MGQ A;  5J4V A;  4LG3 A;  3HGG A;  1YJW I;  2JRM A;  5J40 A;  1R5H A;  3GYH X;  2HDW A;  3GTJ J;  1FEX A;  3ONQ A;  2XRL A;  2ZXH A;  1R7J A;  1HW2 A;  2DLL A;  4QPO A;  3PO3 J;  1WHU A;  4QIW N;  4J01 A;  2HVR A;  4MO7 A;  4E7K A;  3H9Q A;  4V2F A;  4EJT A;  4HDU A;  1UHM A;  3LAJ A;  1FBU A;  4BJ6 C;  1DDN A;  2UXN A;  1JHF A;  4QWQ A;  3F3X A;  2M30 A;  1O7F A;  3QU6 A;  4U0Y A;  4A3K J;  3O2P E;  2VBY A;  3HPG A;  3EDP A;  3RDI A;  2BBY A;  1JT6 A;  4CGZ A;  1IG7 A;  3FXK A;  3S3O A;  2CQ7 A;  2MLG A;  2L54 A;  3HC7 A;  5C3E J;  4CH7 A;  4LK0 F;  2Y69 H;  3KE2 A;  5IT3 A;  1AOY A;  2RNJ A;  4F7Z A;  1TNT A;  2L7K A;  4M71 A;  1I5Z A;  4DYQ A;  3LQQ A;  3K69 A;  3R6S A;  3LAP A;  4C2T A;  1D1B A;  1U2W A;  5FJ8 J;  4BGD A;  3L2U A;  2XVC A;  3C2B A;  4NC6 A;  4LG0 B;  4XR6 A;  5AON A;  1ZLK A;  1MW7 A;  2JT1 A;  1REP C;  2B0L A;  2VKE A;  4UB6 C;  4UVA A;  2R7S A;  3HSE A;  3MQ0 A;  2UWM A;  3P9I A;  2ELH A;  5DYM A;  5HDN A;  3HL2 A;  2K9S A;  4CO8 A;  5D8K B;  2LY9 A;  1EA3 A;  4UB8 C;  4AIJ A;  3RYR A;  2KDO A;  3TGN A;  4K2E A;  1W5T A;  3MN2 A;  4XOP A;  4ZZD A;  1ZRD A;  2X48 A;  1MJ9 A;  3PUF A;  3HHH A;  1BBY A;  3IRR A;  4A3L J;  4PSW A;  3UNG C;  3FZV A;  1H0M A;  4XID A;  3DLA A;  5ICE A;  3WE3 A;  2R5Z A;  1X1P A;  3I4N J;  4XOR A;  1I27 A;  2RQP A;  4LOC A;  1X4P A;  1DGR M;  5CVR A;  1ZKG A;  4A3M J;  1X58 A;  5HDK A;  2OUM A;  3FWE A;  4AID A;  1ZN2 A;  2FU4 A;  4HF2 A;  2Z1D A;  1WJE A;  3BDD A;  3S3N A;  3X2Q H;  1JUM A;  2HYG D;  4DNC A;  4E7H A;  4E70 A;  2CMP A;  3DKY A;  1QA6 A;  3H0D A;  2EA2 A;  4OAY A;  1SD7 A;  2FOK A;  3TED A;  4WXH A;  3PNY A;  1MH4 A;  3OSG A;  1G59 A;  3FXU A;  1W4M A;  3G71 I;  3E5X A;  1UAA A;  2XGE A;  2FSW A;  2W25 A;  4RGR A;  4CZZ A;  2X1C A;  2VJ5 A;  3NEU A;  2XPW A;  2KFD A;  1EH8 A;  4M6V A;  3RTR A;  3WHB A;  4AM3 A;  1SMY F;  3S2H J;  4PJM A;  3MD2 A;  1ZRF A;  4F91 B;  1VI0 A;  2KIQ A;  3GBG A;  4E7L A;  3H5N A;  1T6S A;  4FX4 A;  4N9H A;  1MD0 A;  3M4O J;  3Q5F A;  3H5R A;  1GHC A;  4AU7 A;  5TRD A;  2D45 A;  3H0G J;  2FJ1 A;  1BR1 A;  3N05 A;  2O8K A;  4RGX A;  2OZU A;  5E1W A;  4U7D A;  2ME0 A;  2CRG A;  1ZQ3 P;  2NOJ B;  1JI8 A;  3G2B A;  3K1M A;  4EV0 A;  2GZW A;  3REO A;  2R7D A;  1TC3 C;  2EZI A;  4FAS D;  4EVI A;  3OYN A;  4CCL A;  1QZE A;  2DA6 A;  2E34 A;  2VL8 A;  3WTX C;  2JUG A;  3EUK L;  2GXG A;  3ZMS A;  1NTC A;  4YRV A;  3ASO H;  3K10 A;  3CTA A;  4XLN F;  4B48 A;  2EK5 A;  3SQN A;  1J7K A;  4PGG A;  1YW8 A;  4BYY A;  1IDY A;  5F64 A;  3K7A J;  3JRI A;  2PQ8 A;  4Y15 A;  4KUM A;  2Q0O A;  4V19 K;  1J59 A;  3S93 A;  2ESH A;  2TDX A;  1LB2 A;  2QWW A;  4E6K G;  1FP2 A;  3E3V A;  4HQM A;  1VZ0 A;  2BV6 A;  1ZEL A;  4ZTF A;  3B73 A;  4E4H A;  3HOT A;  3GW2 A;  3S16 J;  1YW9 A;  1DGW Y;  1IUF A;  3T1B A;  3V7C A;  2AQF A;  1JKP C;  3NAU A;  4XOT A;  2V9K A;  2LNB A;  1KON A;  1X1D A;  3P7N A;  5J1Y A;  1ACI A;  2R7V A;  3HSF A;  1X3W B;  2MH2 A;  2EFN A;  1TQP A;  2O3F A;  5D5X B;  2XRO A;  2VQG A;  2JMW A;  1KU7 A;  1T0F A;  2F5C A;  4BS9 A;  4G9Y A;  2R7R A;  1G3W A;  4XLH A;  5CVI A;  4A69 C;  2K9Q A;  1BJA A;  2F2E A;  3MAJ A;  5DUK A;  2W24 A;  1YJ9 I;  2WY7 Q;  1R1T A;  4O6J A;  4A3G J;  1MMS A;  4GCV A;  4Q48 A;  1I3A A;  2X6O A;  2QQB A;  3BQZ A;  1W36 D;  1N25 A;  2R5Z B;  3PUB A;  2K7L A;  1AWC A;  2ZC2 A;  4LD5 A;  3TOB A;  1D5Y A;  3F8C A;  1EJ9 A;  2QGU A;  2FBH A;  1RNL A;  3PJR A;  4JP0 A;  5ILS A;  2R93 J;  4IHX A;  2DBB A;  2E7W A;  2CFX A;  3E7L A;  2F4O B;  5M3F J;  2JWT A;  3COA C;  2ZXJ A;  4RAG A;  4BE2 A;  3OMY A;  3IWZ A;  2KDZ A;  4ZYD A;  5C4J J;  2X6W A;  1T33 A;  3SDG A;  5ICF A;  1OLT A;  1JKR C;  4I0B A;  9ANT A;  2ECC A;  1R6R A;  2O03 A;  5TJJ A;  1U9N A;  4OIQ F;  5F0C A;  1POG A;  1A35 A;  2GXB A;  1IRZ A;  3K2A A;  3ZOB A;  3D1N I;  1OQY A;  3P9C A;  3VFZ A;  1YTY A;  3S32 A;  1QNT A;  3VEP A;  2A07 F;  4A3C J;  4MFD A;  4IX7 A;  1BA5 A;  2XV4 S;  1E0E A;  5J1R A;  4KT6 A;  3U2R A;  2CWE A;  4XRF A;  1V5E A;  3IAS 2;  3MZ8 A;  1MJB A;  3JRD A;  1KQ9 A;  1FX7 A;  1QQI A;  2K3P A;  1Q1V A;  2OF7 A;  4FET A;  4Q47 A;  3RKX A;  1S8N A;  1YRN A;  1BI0 A;  2JVG A;  2IS2 A;  1IW7 F;  1U8R A;  2BY1 A;  4EEF G;  3JCU C;  4P55 A;  3IRQ A;  4X1E A;  4BQN A;  3DPT A;  3H36 A;  4D9J A;  4HQE A;  4LGW A;  5H6Q A;  3BWG A;  5E1X A;  1HKQ A;  3KP6 A;  4F92 B;  3MKW B;  2QM3 A;  5IP6 A;  4XL9 A;  4JX4 A;  3TDZ C;  3OYD A;  1RR8 C;  4BE0 A;  4XN0 A;  2LRE A;  2RKH A;  1ULY A;  3KZI C;  3ZRG A;  4I7H A;  1ZLJ A;  4RBO A;  1YIO A;  3MFK A;  3BC8 A;  3HPH A;  4QLC U;  1LDD A;  3K4B A;  2V1N A;  2X51 A;  3LFU A;  2DFH A;  5CQE A;  4ENK A;  3PQJ A;  4QTR A;  2GOX B;  4KN7 X;  2M1B A;  2R4G A;  1X3Z B;  1YYV A;  4IPA A;  2Q1Z B;  3LOC A;  2EIM H;  4I76 A;  4ZTJ A;  2EB7 A;  4EMS A;  1ORK A;  3HJE A;  3WOD F;  3E6D A;  1AA7 A;  5B3S H;  1H8A C;  2BVM A;  2BY0 A;  2CSO A;  2E35 A;  4IXA A;  1N77 A;  2K86 A;  3E6C C;  3I55 I;  1FC3 A;  4HRI A;  5DS9 A;  2KJC A;  1IC8 A;  1O57 A;  1Y0N A;  1KU9 A;  2G7H A;  2A5W A;  2O7O A;  3EUH C;  1RZ4 A;  5LRR A;  4ZDO A;  1XDU A;  2HVQ A;  2JA7 J;  2A61 A;  1X1B A;  1ZTR A;  2G9W A;  3A03 A;  3WGH A;  5FKN A;  2CH0 A;  4AVP A;  3L2W A;  3IH4 A;  2JSP A;  2LTP A;  5EG0 A;  5K5O A;  2NNY A;  3V8K A;  4F52 A;  2ZME A;  2ZNY A;  3V7R A;  3OYB A;  3BTC A;  3CMY A;  3CCE I;  4B44 A;  4KT5 C;  2E2J J;  2EZL A;  4B09 A;  4GO1 A;  1USS A;  3KEO A;  3LA2 A;  4ZYE A;  3C2G A;  5IP9 J;  1PYV A;  1B59 A;  3LSM A;  2M5W A;  3ZN1 A;  5HLI A;  3PSI A;  1ENH A;  1D0Z A;  2L2O A;  4UV9 A;  3KEQ A;  1Y1V J;  1NG7 A;  2CS3 A;  2YX4 A;  1JGG A;  3QP5 A;  4HLY A;  1PDN C;  2OV7 A;  5HOD A;  1R36 A;  1IN8 A;  2IJL A;  2P0W A;  5BQT A;  3HKZ N;  1BIB A;  2ZJ2 A;  1OCT C;  4P1W A;  2LDU A;  3F22 A;  3S1R J;  3KPH A;  1DQU A;  3PFI A;  3QPT A;  3QWL A;  2Y0S N;  3FHN A;  4XRM A;  4I98 B;  2I8D A;  3Q0W A;  1ZR4 A;  1XC5 A;  2EIK H;  2FRH A;  3FXJ A;  4RB3 C;  2NYX A;  3SJM A;  1XX5 A;  1MGT A;  2W85 A;  1QPI A;  2WAE A;  1OYY A;  3ZQQ A;  3DTE A;  1P2F A;  1TWF J;  2XSJ C;  4A3D J;  2L3D A;  3S15 J;  2DT7 B;  1AKH A;  1MZB A;  2E1O A;  1N78 A;  3H1C A;  2PEX A;  3GZN B;  2NVY J;  3DV8 A;  4B4C A;  2A69 F;  4DYC A;  3HB9 A;  1I39 A;  3J7Z I;  1LQ1 A;  2LH9 A;  4MNU A;  4A6E A;  1YRN B;  3U1K A;  2M34 A;  1A04 A;  5FLM J;  3RIR A;  2HGC A;  1J5Y A;  1FP1 D;  3QYB A;  1J0R A;  2R7Q A;  4A3F J;  1S3J A;  4BJT A;  3EYY A;  3JAM K;  4MEX F;  1B8I A;  3FBI B;  4AIH A;  2R7W A;  3KIO A;  1KGS A;  4KIB A;  4A93 J;  4B3A A;  3DBH B;  3I4M J;  2MC3 A;  3WGI A;  2CV1 A;  3ECO A;  3CJN A;  4KA4 A;  2R3S A;  2BZT A;  2XIG A;  2DPU A;  2KIM A;  1X1C A;  4L5J A;  3AKZ A;  2XPV A;  3WTV C;  1WWX A;  3DPU A;  1HA8 A;  2L7F P;  4Y52 J;  3JW4 A;  5F1J A;  1V54 H;  2KZG A;  4R1H A;  4ON0 A;  2L4A A;  4IOC F;  3DEE A;  1BC7 C;  2P7V B;  2ISZ A;  1OCO H;  1G3Y A;  4OU0 A;  1XCV A;  2D1V A;  5JLX A;  4HDV A;  1R4N B;  3QPH A;  2ME6 A;  2VJI A;  2Y31 A;  3I56 I;  2KLO A;  2KT0 A;  3G1M A;  1SD6 A;  4BL0 B;  1KQ0 A;  1QRY A;  4MFE A;  1D0X A;  1IRX A;  2EA4 A;  4GRI A;  5IYD J;  3KET A;  2BW3 A;  2A05 A;  2CQX A;  1TLH B;  3OYJ A;  1VQM I;  2GAU A;  1MH3 A;  3TW7 A;  1X19 A;  2Z16 A;  3E1S A;  2LF8 A;  3HUG A;  2M2E A;  4I09 A;  5CJ9 A;  3WG7 H;  4KNY A;  3W6K B;  3D5R C;  1G6N A;  4U7B A;  3HSR A;  1DP3 A;  3W6J B;  4R8H A;  4EGY A;  1ZAR A;  2DTZ A;  1KU3 A;  1XMK A;  4HPQ A;  5EG0 B;  3V4G A;  2OTL I;  1F1Z A;  3F6V A;  4PFP A;  4IEJ A;  4M9X A;  3OYA A;  1T95 A;  1T98 A;  3CP2 A;  4PZJ A;  1PUF A;  2ZME B;  1T08 B;  1OR7 A;  4KJZ A;  3S17 J;  2CW0 F;  5CQG A;  4IF4 A;  1NH3 A;  4F55 A;  3OS0 A;  2HNH A;  3TQN A;  5LFA A;  2OA4 A;  1SFU A;  2VPR A;  2F5V A;  3VYS B;  2Y2Z A;  4WXD A;  1LVA A;  4AVZ A;  5J47 A;  1F5T A;  2IT0 A;  4A3E J;  1WH5 A;  2XDV A;  1K78 A;  3SHF A;  2PMZ N;  2B9S A;  2GOM A;  1K83 J;  3ERM A;  1OR7 C;  5A2Q K;  3SFZ A;  1F9N A;  1ZRE A;  3PSF A;  1O3Q A;  2DCE A;  5HS8 A;  3I64 A;  2VIX A;  4Y17 A;  3FKI J;  1ZAO A;  1SVO A;  2ADU A;  3OL4 A;  5CVJ A;  4FX0 A;  4G6T B;  3VYR B;  2LY1 A;  3LA7 A;  2PG4 A;  5GAH J;  4LIT A;  3Q3S A;  2K9L A;  3EYI A;  3CCM I;  2RNG A;  3KP2 A;  1DP7 P;  1QZY A;  4PJJ A;  3JTH A;  3I71 A;  2XHK A;  2DTR A;  2R7U A;  1BI3 A;  1FMV A;  2DYS H;  3OV8 A;  1WPK A;  2EZK A;  2WC2 A;  4IRI A;  2VC1 A;  1AKH B;  3HOS A;  3K4K A;  4EGZ A;  4OOI A;  2FX0 A;  3FXO A;  1S5L C;  1ETY A;  5EDN A;  1OYW A;  1IO2 A;  2DI3 A;  3M9A A;  2MFZ A;  4M6Y A;  1G4D A;  4EM1 A;  3ML6 A;  4D7N A;  4WWC A;  3OYH A;  3OS2 A;  4AC0 A;  3A01 A;  1E17 A;  3HYI A;  1B8I B;  2NVT J;  2JA6 J;  3AAF A;  2KP6 A;  1ZGW A;  1VQ6 I;  1RRJ A;  1R22 A;  2VUM J;  2IS6 A;  3RPU D;  3RCO A;  2FMY A;  3ABU A;  1K4T A;  2QKM B;  5AIP A;  1L0O C;  2DW4 A;  1HW1 A;  3JTG A;  1X2N A;  2L7M P;  4XK4 A;  3TO6 A;  2DFI A;  3ZMV A;  5E17 F;  5F0F A;  1TT0 A;  2XF5 A;  3VB2 A;  2P4W A;  1FLI A;  2DJI A;  2LF7 A;  2Q2E A;  3OR1 C;  1MNE A;  1G3S A;  1OCP A;  1FBS A;  3GCM A;  3KLN A;  4A0Z A;  4GYG A;  3FM5 A;  2Y9Y A;  2JQ7 A;  1VQL I;  3UR3 C;  3H92 A;  2HS5 A;  3WGG A;  3FXR A;  2COB A;  2VKD A;  5F08 A;  3ZR8 X;  2BW3 B;  4XLE A;  4JX5 A;  3MWM A;  4G7H F;  4CDG A;  5CKT A;  1STZ A;  3CF2 A;  1Z7L A;  2ZB9 A;  3HUG B;  4F93 B;  2LD5 A;  5EYR A;  2VBW A;  3S14 J;  2H8R A;  2HDC A;  4AIK A;  3EET A;  1D5V A;  3ZQL A;  5IY5 H;  1YS6 A;  2O5R A;  1XD7 A;  2ZSH B;  4N4O B;  1ON1 A;  4PDK A;  4X0G A;  3BR2 A;  3LST A;  4P9F A;  5B5E C;  2LP0 A;  4BQO A;  3I53 A;  2W57 A;  1SC7 A;  3Q0V A;  1PUF B;  1SAN A;  3ZGK A;  3S1N J;  2YUS A;  2XC7 A;  1P4X A;  3CO6 C;  4NQW A;  3ZQ7 A;  4LK1 F;  2EIJ H;  4II2 A;  5DEQ A;  3M7G A;  2E1M B;  4DIQ A;  4YEL A;  1GXP A;  2AXT C;  4IHT A;  2MAB A;  5EGO A;  3H9G A;  3OOP A;  2L9N A;  2MSY A;  2QVO A;  2RN7 A;  3R0A A;  5KK1 A;  2E19 A;  4CCJ A;  3J81 Z;  3K1N A;  1IF1 A;  2ELK A;  2DOE A;  3ZQI A;  3VWB A;  1K78 B;  2DQR A;  2D5V A;  1Y8R B;  2XAJ A;  2VT3 A;  4YIF A;  1DPU A;  3CLQ A;  2E36 A;  3I0T A;  1YE9 A;  3HG9 A;  2FBI A;  3DEU A;  1B72 A;  5H20 A;  4BDZ A;  2EV0 A;  3V7S A;  2F4I A;  2Z9O A;  4IHY A;  1VND A;  3BJA A;  1ETW A;  2JVH A;  1VQ5 I;  4U88 A;  4WXC A;  4YFK F;  1CGP A;  1IXC A;  1UMQ A;  3I58 A;  2DK5 A;  2HVS A;  1TWA J;  4J00 A;  1FYK A;  4XRS G;  2VBZ A;  1B9M A;  2HZT A;  3T8T A;  2ZCW A;  3CC2 I;  1RKW A;  2PMU A;  5BMZ A;  4UVC A;  3GTP J;  2YPR A;  4RB2 C;  4M3B A;  3R60 A;  3G4S I;  1PUE E;  1EF4 A;  3A1Y A;  2CW7 A;  3CMA I;  4BHC A;  5HOO A;  3ZXS A;  2FF4 A;  5E3N A;  1YJN I;  3D5S C;  2RV8 A;  5K1Y A;  3ZMT A;  4CSW A;  2GM4 A;  1ZHF A;  2X0L A;  3BPX A;  4RMN A;  2DFF A;  2M8G X;  3KYD B;  4IHS A;  5DV5 A;  1YX3 A;  3A01 B;  5EZG A;  1VF9 A;  4EJV A;  3BOQ A;  4CHU A;  1EH7 A;  1D1C A;  2BXZ A;  2MLK A;  5JHF A;  2KIF A;  4KIT B;  3QOE A;  1HCR A;  4OWR B;  4O5V A;  3GLL A;  2M0M A;  1UHW A;  3PNT A;  1X2M A;  1Z3X A;  2Z99 A;  4ZZL A;  2P5L C;  4XLP F;  2R7T A;  1Z67 A;  3C7J A;  5LGU A;  3JSP A;  5E3O A;  3E6M A;  4HLX A;  5CYV A;  2GA2 A;  2HYJ A;  3BR0 A;  4PJL A;  1XGM A;  2CUE A;  4BUP A;  2A5Y B;  1OMI A;  2IRF G;  1FSE A;  3C18 A;  2GIZ A;  3KFW X;  4TV7 A;  1Z21 A;  3W2A A;  2Q2E B;  1IV8 A;  4KIF A;  4RM3 A;  1HC8 A;  4P96 A;  2F6C A;  1XDS A;  3LSK A;  3TO9 A;  2LK2 A;  3CP8 A;  1D3Y A;  3W2V A;  1GDT A;  2FD5 A;  3DXJ F;  2QA4 I;  3WU1 B;  3F8M A;  4BXU A;  3SEQ A;  1P6R A;  3H3V K;  4X6A J;  2VQL A;  4E7Z A;  5J1U A;  1DUX C;  3SZP A;  2QSG X;  1L3L A;  3ZMD A;  5LEJ A;  1EKE A;  1DU0 A;  4XRS A;  3I5U A;  4J19 A;  3JRF A;  5IYB J;  4MIM A;  2L01 A;  1HSJ A;  3UKG A;  1H88 C;  3PNV A;  3VPR A;  1W0U A;  3F6O A;  3OYM A;  4E7I A;  3FKJ A;  5LLQ A;  5E20 A;  2V6E A;  3LSH A;  1U9O A;  3GTO J;  4CYC A;  3BCA A;  5M5W J;  2YS9 A;  5KAF C;  4HNT A;  4ZYH A;  4ZDP A;  4ZC3 A;  3VSL A;  5LGN A;  4NHJ A;  4MEY F;  2KIU A;  1GV5 A;  4NQW B;  3HXL A;  4XLF A;  3RQI A;  2CV2 A;  2RC4 A;  4H4K C;  1MNM C;  2QQ9 A;  3GVA A;  5BPI A;  1JUP A;  5EGO B;  2VLA A;  4KDP A;  4BY7 J;  2LKX A;  4ZJZ A;  1ZRC A;  1LEB A;  3RKY A;  5HLT A;  1OIS A;  3L09 A;  1NK3 P;  4M3E A;  3HRM A;  1N75 A;  2F5D A;  3HOW J;  2DA7 A;  1MND A;  1O3T A;  1V55 H;  1GT0 C;  1B72 B;  1IAW A;  1U3E M;  5DM7 F;  1UFM A;  1APL C;  2A6T A;  3BG3 A;  2VJJ A;  1BIA A;  3GZ5 A;  5D4R A;  4UVB A;  2HTJ A;  2HQ5 A;  4P9U A;  1J9I A;  3SZG A;  3SZT A;  2VE8 A;  3DLL F;  4A5N A;  2OCE A;  3P5J A;  1BW5 A;  4WF2 A;  1FIA A;  3CCU I;  3DF8 A;  4HV6 A;  3J7A O;  1ETV A;  1T0F C;  2DO7 A;  3S2D J;  3F8N A;  5J6X A;  1LNW A;  3M07 A;  3HOY J;  3D0S A;  3GTL J;  5HDG A;  3ZMZ A;  1WJ5 A;  3OIP A;  2WY8 Q;  1YS7 A;  1PP7 U;  4WX9 A;  3HEF A;  4JOM A;  4BXF A;  5K7H A;  3HGY A;  3QU3 A;  2LMD A;  5L3E A;  1Z9C A;  2P5V A;  2L9S A;  5HLH A;  1HQC A;  2KQR A;  5JLW A;  1Y56 A;  4BBR J;  2VB6 A;  1S7A A;  2BXY A;  2ACJ A;  1A5J A;  1B9N A;  1YQA A;  1SFE A;  1UG2 A;  3LSI A;  5D5V B;  2EBI A;  4U0V A;  2WAF A;  5KNL A;  1TWG J;  3Q0U A;  1FJL A;  2A6H F;  5C44 J;  4E7S A;  2EV6 A;  4B43 A;  1BM9 A;  2HPM A;  2YR2 A;  1ZG5 A;  1FPQ A;  3FBN B;  3M8J A;  4AUX A;  5TGT A;  1Z91 A;  2OD5 A;  3M1E A;  1XCB A;  5HS9 A;  3OS1 A;  1SFX A;  1H89 C;  2K4B A;  4CCO A;  2LBF A;  1BW6 A;  2JZY A;  1O3R A;  1OCC H;  1XGN A;  5B1B H;  1TW2 A;  3BT9 A;  4EM2 A;  2H09 A;  2LKP A;  4C3J J;  3ZCO A;  1XB4 A;  2V9V A;  1ETX A;  2DT6 A;  1F36 A;  5KCM A;  1K6Y A;  1W1W E;  5TIS C;  5ED4 A;  2VE9 A;  1GVD A;  3KYC B;  1SVM A;  2QKL B;  5E18 F;  2X1E A;  1HOM A;  4LLG F;  4ENN A;  2LC2 A;  5EEA A;  2XAS A;  4ZH4 F;  2HXO A;  5DTD A;  2XUB A;  1FBQ A;  1W7P D;  1Z6T A;  3IAM 2;  1S72 I;  3FK6 A;  3OYC A;  3HKZ A;  4EJO A;  5GTI C;  3QPL A;  5ICG A;  3N4M A;  2E1C A;  4HEA 2;  3CES A;  3ZQG A;  3BTJ A;  3M8F A;  2O6G E;  3R4K A;  2Y0S A;  1JE8 A;  1WZ2 A;  4BJ5 C;  3RJP A;  3F0C A;  2OU2 A;  2V1D A;  3WTY C;  1NG6 A;  3A4C A;  5GP9 A;  4R79 A;  1TWC J;  4CYC B;  2V4J C;  5DCF A;  1ONV A;  3BCB A;  4BH9 A;  3SXY A;  2C6Y A;  4ESF A;  1VQ4 I;  3FMQ A;  3K6G A;  2NVQ J;  4XBF A;  1IZ1 A;  3GWZ A;  2EH3 A;  5LD2 C;  3KX2 A;  3CLO A;  1WQ2 A;  2X4H A;  1WJA A;  2FOW A;  1WRJ A;  4IRG A;  3S1M J;  2IP2 A;  2VT2 A;  4AD9 A;  4OIO F;  2F5F A;  4G7O F;  4XLC A;  4HV5 A;  1E3P A;  2PN6 A;  3LL7 A;  5J8C A;  1A31 A;  2QSH X;  2P81 A;  4EQQ A;  2JRT A;  3CCS I;  2CGP A;  3A0H C;  5DUI A;  3IC7 A;  4D5F A;  4RDU A;  2MD5 A;  4BDY A;  3KZY A;  3FMS A;  2DAO A;  2PX9 A;  3IH2 A;  1DU6 A;  4Z2Y A;  1K6O A;  3K70 D;  4A6D A;  1FSH A;  1O3S A;  4HSR A;  1QPM A;  3FK7 A;  4MHG A;  2MW8 A;  3QOP A;  1K79 A;  1HST A;  1RET A;  3BG9 A;  5DD4 A;  1HKS A;  2ZME C;  1JKQ C;  4O3M A;  1JKO C;  3K4N A;  3RYP A;  1VQ7 I;  5L3F A;  2LSO A;  3J80 Z;  1OCZ H;  4CXF A;  3BQY A;  2ZO4 A;  4GGG A;  1BR2 A;  2VBX A;  1T2K A;  2N8G A;  2HFH A;  5FO5 A;  4C2M J;  3EQL F;  1Z6R A;  5J4Y A;  2B7E A;  2E5Z A;  1WJC A;  2HTS A;  1XSD A;  2GIV A;  2FNA A;  4GDF A;  1FZP B;  3TL4 X;  1PVE A;  2BE5 F;  1LVK A;  3CUQ A;  1UST A;  3U9G A;  3G3Z A;  3QAH A;  1RI7 A;  5EF6 A;  1HKT A;  3O6B B;  2KKO A;  1IN4 A;  4L9V A;  5E3M A;  1P4A A;  5D4S A;  4XSX F;  2W4S A;  1MBJ A;  3CJQ B;  4A0Y A;  1ZK8 A;  3IKT A;  3S1Q J;  2H6C A;  5EEG A;  3F8B A;  1TTY A;  1MBF A;  2LBF B;  5L3B A;  3E5U A;  4ANJ A;  5IT9 Z;  1KYW A;  3FDY A;  3JRH A;  2LVS A;  2HOE A;  4LLN A;  5FLX K;  4UUT A;  4OIP F;  5F1R A;  2ECB A;  4XMY A;  2DDA A;  1WKM A;  2OCC H;  2H94 A;  1G3T A;  1LFB A;  2WAD A;  4HX4 A;  2V7F A;  3ABK H;  2AS5 F;  3OIQ A;  4L0Z B;  2R7O A;  4HW0 A;  1TP4 A;  1FOX A;  3HZJ A;  3ERE D;  2M8E A;  5LRS A;  1SD5 A;  2K5C A;  5FKK A;  4A12 A;  3L2R A;  2PMZ A;  1MMG A;  4HF1 A;  3QP6 A;  3OYK A;  3L9F A;  2NNN A;  2H6B A;  4XKW A;  3E5Q A;  2UXX A;  4KIS A;  2DOD A;  3MKY B;  1JTY A;  4BAC A;  2V1U A;  2K4J A;  3ZQC A;  2OJE D;  3DBL B;  3K2Z A;  3RZD J;  2XAQ A;  1E2X A;  3BTI A;  3PQK A;  3PL8 A;  2NVU B;  2H27 A;  2X6Y A;  4XKC A;  2QEX I;  1BN5 A;  1MMN A;  3GTG J;  2E2H J;  1XMA A;  1PJR A;  2IAI A;  4MQ9 F;  3BY6 A;  4N9I A;  4GYI A;  2JJ7 A;  4BEH A;  2HQA A;  2VQH A;  2X85 A;  2D1H A;  2VXD A;  2Y75 A;  4Y7N J;  2NXN B;  2M7B A;  3DWL E;  5E8I A;  5IPA A;  2CYY A;  1WCM J;  3WE2 A;  3WTT C;  2STW A;  4YG2 F;  3P9K A;  5HNF A;  3J7A Y;  3ZN0 A;  2XGD A;  2ID3 A;  1U5T A;  2FQ3 A;  4Y4R A;  2JN6 A;  2QQA A;  4I6Z A;  4DZP A;  3DPL C;  1IRG A;  2EJR A;  3RPQ A;  1P7J A;  1R5G A;  3MZY A;  4A0X A;  5IP7 J;  3K1P A;  1QGP A;  2QYO A;  1MSE C;  4IQ4 A;  4QSH A;  4G8X A;  4M6X A;  5LBQ A;  3OYI A;  1XMX A;  4ENM A;  4L0Y B;  3MZH A;  1OYI A;  2IS4 A;  4JX6 A;  2FUG 2;  2L9R A;  3CZ6 A;  3SFI A;  4HNV A;  3WU0 A;  3BRO A;  4JBA A;  2KRC A;  3NWT A;  5FD6 A;  3SYT A;  1YFH A;  2WB1 A;  4JK1 X;  2ZNZ A;  2EIL H;  2BEO A;  3HOV J;  4C2U A;  2WA0 A;  3ZQH A;  4D5C A;  5LHI A;  3N97 A;  1WGX A;  4PCQ A;  5K5Q A;  3HRS A;  2HQN A;  3KEY A;  3SDB A;  3GTM J;  2QLZ A;  4RB1 A;  3HM5 A;  1I3Q J;  1WFX A;  2E1M C;  2VN2 A;  5FGM A;  2P6T A;  4MTD A;  1WI9 A;  4XKV A;  4L9J A;  2KRH A;  3JSO A;  3K4J A;  4MGR A;  3CUQ B;  4FCY A;  3IWF A;  1VQO I;  2DMQ A;  3OR2 C;  4GFB A;  1OKR A;  2MH9 A;  3B02 A;  1Z7U A;  3KP5 A;  1OJL A;  4IVN A;  1FIP A;  4EJW A;  3K4C A;  1TQM A;  1UZC A;  3LFK A;  3CDI A;  3PIO F;  3IHU A;  2AHQ A;  1ETQ A;  4U87 A;  1YO5 C;  3H3U A;  2OQG A;  2OAZ A;  1D0Y A;  4HF0 A;  4OAZ A;  1X1A A;  1UCR A;  4BXX J;  2FQ4 A;  3C2H A;  4II3 A;  5F6F A;  4EJU A;  5JVG F;  1QVU A;  2CU7 A;  2IVM A;  2LRD A;  5EJC A;  3L7W A;  1UG0 A;  3IUO A;  5FRN A;  2DMN A;  2OC6 A;  1YG2 A;  4FT8 A;  2VJ4 A;  4G6D A;  2IA1 A;  1YW7 A;  5BPD A;  5DDG A;  1SAU A;  3BPV A;  4YEJ A;  3DU6 A;  2D2W A;  3NAR A;  3DBR B;  3DKW A;  2TCT A;  1ETK A;  3DCF A;  3JRE A;  1T56 A;  2WB1 N;  1TL8 A;  1LEA A;  2ZXW H;  2W48 A;  2EQR A;  4I02 A;  3T5X A;  3GTK J;  1Y8Q B;  3RQ4 A;  1FYL A;  2CV0 A;  2ELJ A;  2M4K A;  4M74 A;  4RLF A;  2HKO A;  4A3B J;  3QOD A;  4M73 A;  3B6C A;  2HI3 A;  2R0Q C;  2ZJP F;  1GXQ A;  1MKM A;  5K5R A;  1U0J A;  3CF5 F;  4YII A;  2O8X A;  1BOA A;  4OMY A;  2XPU A;  1GV2 A;  5A2Q Z;  2XAF A;  1JJ8 C;  3CMM A;  4EM0 B;  2FEZ A;  2JA2 A;  4NC8 A;  3V8J A;  2DJN A;  2XAH A;  4PJ0 C;  4BY1 J;  1RR7 A;  1W5S A;  4DZJ A;  3FMR A;  3LMM A;  3OYF A;  3EPZ A;  2H1L A;  1FYM A;  1I1S A;  2Z33 A;  5FRO A;  3JRB A;  4BEH B;  2DPD A;  2RQQ A;  3CC4 I;  1TW3 A;  5D5U B;  3TDU C;  5K7F A;  2ZFW A;  1LFU P;  2V26 A;  4B47 A;  1RUO A;  2K85 A;  2XRN A;  2RDP A;  4LFU A;  3DFG A;  3RI4 A;  1BL0 A;  3L2V A;  4G94 A;  1MIJ A;  2LYC A;  3QYE A;  2L7Z A;  2DA5 A;  5H2F C;  1UJ8 A;  4BQQ A;  1U5T B;  1TQI A;  4BAY A;  2PBI A;  2Q8K A;  3BR6 A;  2JA8 J;  1MDM A;  4LMY A;  4LLL A;  4XM3 A;  2K02 A;  3GFL A;  2EFW A;  1LDK B;  1MBG A;  3HOZ J;  2KIS A;  1YHQ I;  2BYV E;  1J2X A;  1QBJ A;  2HPI A;  5ILV A;  2FA5 A;  2M45 A;  2EFO A;  2YU9 J;  2DFE A;  4ABZ A;  1H9G A;  2XKP A;  3ASN H;  4BU2 A;  4XKB A;  2BY2 A;  4PFO A;  2WBM A;  2OQR A;  4HBL A;  2QQ8 A;  1K61 A;  5H6R A;  2VOD A;  3O8G A;  1FT9 A;  1Z3Y A;  4KIG A;  3AG4 H;  2F48 A;  2KMU A;  2NOG A;  2R5Y A;  1ZH5 A;  4CCM A;  3WHC A;  2R7Z J;  4WK8 F;  5LHH A;  3NQO A;  2F4M B;  1IUY A;  1E3H A;  1TNS A;  4UXN A;  5FKO A;  1EV7 A;  1UEL B;  1Z0X A;  4C3I J;  4ZYA A;  2I10 A;  4V2G A;  1B1B A;  3BZ6 A;  3PIP F;  3FIS A;  5M5Y J;  3M3Y J;  1JGS A;  4DYR A;  1Y1W J;  3ABL H;  3TP0 A;  4XQF A;  1ON2 A;  5E1Z B;  5FD5 A;  4M9S A;  3G73 A;  4RAF A;  1LUJ B;  1V4R A;  2K3F A;  4IJA A;  2W7N A;  2JA5 J;  3CUO A;  1Y39 A;  2ZSI B;  1VFC A;  4I2O A;  2LFB A;  5FB2 A;  4B1R A;  3QQA A;  4KIC A;  1BI2 A;  1KYZ A;  1MBE A;  3FIW A;  5KVR A;  1M1E B;  3K4L A;  2R7X A;  2JPC A;  2XSD C;  3LSJ A;  4MTE A;  5ILU A;  1ODD A;  3FXQ A;  4HAM A;  1R00 A;  4PSX A;  3CDH A;  2L5Q A;  1UB9 A;  1IXR C;  2EPF A;  5FRM A;  1Z1D A;  1EH6 A;  3ISP A;  3HOX J;  4NNJ A;  1FOY A;  4L5E A;  1KQ8 A;  2ID6 A;  3GFJ A;  2P6S A;  5FLV A;  1JUS A;  4G12 A;  3OY9 A;  3BR1 A;  4M9Z A;  2FBK A;  2IXS A;  1V3F A;  2MG4 A;  2ZBK A;  2VPL A;  2DDB A;  3BZK A;  3BP8 A;  3BLY A;  1ZGJ A;  5IOZ A;  2EFQ A;  1WJD A;  2R92 J;  4PUS A;  3CCV I;  1KZH A;  3M8E A;  5LHG A;  3RPU A;  2IBD A;  2E2I J;  3DTI A;  3L1P A;  2VON A;  3F72 A;  3TBI A;  1HF0 A;  2E7X A;  1SFO J;  4DGW B;  4S05 A;  2ICW G;  1S7E A;  3CCQ I;  2P5K A;  1SVL A;  2HXI A;  1CF7 A;  4E7J A;  2GA1 A;  4MQV A;  3VDX A;  1BOB A;  4IKF A;  1QHH D;  2FE3 A;  2HDD A;  2IGO A;  2DOA A;  2L9V A;  3E6B A;  3NRV A;  2KHM A;  1A6I A;  2QZ8 A;  3GX4 X;  3E97 A;  4A3J J;  4KMU X;  4W1U A;  2GBY A;  1D1A A;  3AG3 H;  2OBP A;  2WTE A;  1IN7 A;  4PK4 A;  2HR3 A;  3WTZ A;  2M9H A;  4IZZ A;  5KAI C;  3CQZ J;  5J3L A;  2QUF A;  1I6H J;  3CCL I;  1MDM B;  1Y0U A;  4JQF A;  3GLX A;  4ITV A;  2CQN A;  3LSG A;  4PJN A;  3LWF A;  2L4M A;  3I59 A;  2JSC A;  3F9K A;  4HX8 A;  2V9P A;  4IOA F;  4XSZ F;  1R1V A;  5JHU A;  1RES A;  4D7M A;  1G8X A;  3R61 A;  1U78 A;  3VOE A;  1HW5 A;  3V8L A;  1K4S A;  2DA2 A;  2XB5 A;  4C9Y A;  4ETS A;  5DCM A;  2KPM A;  4DQ2 A;  4UUS A;  1RKT A;  5GAG J;  3Q9V A;  2NVX J;  2VXZ A;  3MCZ A;  2HQR A;  2R5Y B;  4UV8 A;  5HNH A;  4H0E A;  4MLO A;  4XN3 A;  3G1L A;  2UV1 A;  4RAY A;  3ELK A;  3SEZ A;  3S2W A;  1HBX G;  2RVC A;  1JJ6 C;  3HTS B;  2DA4 A;  2PLY A;  5L3D A;  2LG4 A;  2EV5 A;  3LSP A;  3T8R A;  1I1G A;  1IN5 A;  2CFO A;  3BG6 A;  2DK8 A;  1T8I A;  1P7I A;  4KFC A;  3ULQ B;  3B6A A;  4NDL A;  4S04 A;  2MC4 A;  3FX3 A;  4D0P A;  1MBK A;  3J7Y J;  3HIF A;  3TP3 A;  2I5U A;  5C4X J;  2XAU A;  4FHT A;  4HZF A;  1S6L A;  4HA8 A;  3WU2 C;  5GAE J;  1CQT A;  2ZJR F;  4F3Q A;  3AL0 C;  3FF5 A;  2L0K A;  1R9T J;  4XON A;  1FWZ A;  3GFM A;  3S3M A;  3DTK A;  5IOY A;  4S0H B;  5B66 C;  2F5E A;  1FY7 A;  4A3I J;  3HRU A;  1QVT A;  1SD4 A;  5JR3 A;  1XTA A;  2G0E A;  5JVT A;  3KYL A;  2XF6 A;  4PGH A;  3MVP A;  3V42 A;  3GXO A;  3KP7 A;  4FE7 A;  1WJB A;  1S7O A;  2X6X A;  3OOU A;  1ITY A;  2QSF X;  3TOA A;  1K7A A;  1R23 A;  5K7Z A;  2VOP A;  3IH3 A;  2FNP A;  1MSF C;  4HNU A;  1JXS A;  4CYD A;  4ZYG A;  2LY2 A;  3JRA A;  3BJ6 A;  5GPC A;  4ESJ A;  3MKL A;  1MMD A;  5CVU A;  2Y48 A;  3HHG A;  4A5M A;  3H35 A;  4RB0 A;  4RM2 A;  2STT A;  3IKV A;  2BHY A;  2WWY A;  1W5C C;  2DMU A;  1MMA A;  1XSV A;  1YI2 I;  3E0J B;  4CUG A;  3FXM A;  3VYU B;  4FQG A;  1P92 A;  4ESB A;  4BHB A;  1RUN A;  5LGT A;  2GWR A;  3HDD A;  5ERI A;  1SAX A;  1F4K A;  1CF7 B;  3BR3 A;  3HOU J;  1QU3 A;  3GUD A;  4LB5 A;  3I4P A;  4I99 C;  3BJO A;  3GME A;  4N4N B;  4LB6 B;  4Q5S F;  2OPT A;  1Z77 A;  2HEO A;  3ABT A;  2X9D A;  2VQC A;  2CUZ A;  3CCJ I;  1XSX A;  5M5X J;  2ETH A;  1AHD P;  4N0B A;  2RAE A;  2YU3 A;  4U0W A;  1B4A A;  3OIO A;  1F43 A;  4DBR A;  1X4O A;  4NC7 A;  3I54 A;  2EFP A;  1B6A A;  2DA1 A;  1S29 A;  2CJJ A;  2QF7 A;  3WTW C;  3WTU C;  4FE4 A;  3AG2 H;  1ZG1 A;  2CUJ A;  1H9T A;  1BI1 A;  3BG7 A;  3AFH A;  5M3M J;  5F27 A;  3J80 K;  5J8F A;  2NRA C;  3I59 B;  3OL3 A;  3EUH A;  2PJR A;  5E79 C;  3CD6 I;  3PFY A;  3EUA A;  4Y33 A;  2VOO A;  1AU7 A;  5F04 A;  2GLO A;  4P5O A;  1VQK I;  3S8P A;  1HXD A;  3A02 A;  4CCK A;  4Q4Z F;  2HOT A;  3ABM H;  4NB5 A;  1SMT A;  1JT0 A;  5DCM B;  1LFP A;  1QHG A;  1WH7 A;  1ZGA A;  4M3F A;  3H5A A;  4UUS B;  1LKX A;  3CCR I;  1LJ9 A;  2O9L A;  1A36 A;  1LE8 A;  4QPQ A;  3ZPL A;  1VQN I;  1ZYR F;  4Y13 A;  2P8T A;  1A6Q A;  2O61 A;  3AL0 B;  2Y30 A;  2HOA A;  3O3K A;  2ZJQ F;  2HU9 A;  2QBY A;  4HX7 A;  2EWN A;  3TMO A;  4C30 A;  3TKY A;  1R58 A;  2ZKZ A;  2XGX A;  1QO0 D;  2PJP A;  2HZD A;  2IGN A;  3ESW B;  4L18 B;  5FKL A;  3HBL A;  3GF2 A;  1OCR H;  5CPR B;  2NAZ A;  2XB0 X;  5IT9 K;  2IW5 A;  2IA0 A;  5B1A H;  2CQQ A;  2VKV A;  1U8B A;  2K27 A;  1R5I D;  4UUV A;  3CJR B;  3PO2 J;  1OPC A;  2M7A A;  3ZMU A;  4HOB A;  2W00 A;  1FTT A;  3KP4 A;  3DKX A;  3W6V A;  5CLS A;  3VYT B;  3KZZ A;  1X3U A;  3DEW A;  2J5P A;  3BTL A;  4G7Z F;  1GVJ A;  1E3O C;  2NS8 A;  1IRF A;  1J09 A;  1IJW C;  2NS7 A;  3JRC A;  2KL4 A;  1TBX A;  5LEK A;  3NWS A;  3GTQ J;  4D1Q A;  4ASN A;  3QRF F;  4OIN F;  5E3L A; 
#chains in the Genus database with same CATH homology
 5HLG A;  3C3W A;  5BOX A;  1IXS B;  1XGS A;  4I0A A;  2XAG A;  3DP7 A;  1MJA A;  4RS8 A;  1DPR A;  2DU9 A;  1U6G A;  2JTV A;  3GZ6 A;  3CUQ C;  1Z05 A;  2A3S A;  1P4W A;  4RGU A;  5E8G A;  3RKW A;  1I6X A;  2CQK A;  5JI6 A;  1YLF A;  4L9N A;  1O7L A;  2ISY A;  2W84 A;  2QEN A;  2FML A;  2R7F A;  4GXO A;  3LA3 A;  4KN4 X;  2Z5U A;  4YFN F;  5HVQ C;  2KRF A;  3H3Z A;  4OMZ A;  2CO5 A;  5FFX A;  3FM3 A;  3F23 A;  4I01 A;  3ROU A;  3KP3 A;  3IL2 A;  4UNO A;  1XN7 A;  4OIR F;  2A68 F;  1W7P A;  5EEH A;  1NHA A;  2COM A;  3GFI A;  4AWX B;  2M87 A;  2HYF A;  2XKO A;  3LQR A;  3D5L A;  2L02 A;  2YSR A;  1C0W A;  2NS0 A;  2KJB A;  3WTS C;  5JFR A;  1Q1H A;  3ZP5 A;  1PP8 F;  2V6C A;  4L5I A;  2RGV A;  3TO7 A;  3L00 A;  3WG9 A;  2PFB A;  1FNN A;  3VOD A;  3K0L A;  3CO7 C;  4A2U A;  5D8L B;  3JAM Z;  2UZK A;  2WV0 A;  5L3G A;  2QBY B;  6PAX A;  5CVV A;  3Q9S A;  5FLX Z;  2ESN A;  1KA8 A;  1IN6 A;  2OZ6 A;  4HYE A;  4CIC A;  5AIQ A;  2A6E F;  1VTN C;  2PI0 A;  2YX7 A;  1U5T C;  3MEX A;  2J5O A;  4B8X A;  5BS6 A;  3T0Y A;  2HKX A;  3U1D A;  4LG0 A;  1D8K A;  2AXL A;  2BGC A;  3DQV C;  5HS7 A;  2DT5 A;  4YFX F;  2G7U A;  1WSU A;  4BNC A;  5D5W B;  1R1U A;  2E1N A;  2IPQ X;  1J75 A;  4G6Q A;  4BQA A;  2V1X A;  5D6F A;  2DQL A;  1T38 A;  3F21 A;  4UHT A;  4IRH A;  3KLO A;  1JHH A;  5D6E A;  2IA2 A;  4RGS A;  2HWV A;  4WCG A;  5L3C A;  3KCC A;  3FHZ A;  5FFZ A;  1BC8 C;  2CG4 A;  1KU2 A;  2MBF A;  4M72 A;  3R0J A;  1RIO H;  5ICC A;  4L9T A;  3L2C A;  4KMF A;  2JPB A;  2Z3Y A;  4ENJ A;  1XGO A;  2PMH A;  3K9T A;  3ECH A;  4RAZ A;  2V79 A;  1FOK A;  3GEZ A;  4BHP A;  3HRT A;  1QZZ A;  1ZG3 A;  4LJZ F;  3C1D A;  2GQQ A;  3J81 K;  2P7C B;  2VC0 A;  3F8F A;  3HTU A;  2FXA A;  1W7P B;  2O0Y A;  3GO5 A;  1D8J A;  1T39 A;  1LDJ A;  5DD8 A;  2Y0M A;  4KYW A;  2MA3 A;  1R5H A;  3GYH X;  1HW2 A;  1R7J A;  2DLL A;  4EJT A;  4HDU A;  1UHM A;  3LAJ A;  1FBU A;  1DDN A;  2UXN A;  1JHF A;  4QWQ A;  3F3X A;  2M30 A;  1O7F A;  3QU6 A;  4U0Y A;  3O2P E;  2VBY A;  3EDP A;  3RDI A;  2BBY A;  4CGZ A;  2MLG A;  2L54 A;  4LK0 F;  3KE2 A;  5IT3 A;  1AOY A;  2RNJ A;  4F7Z A;  1TNT A;  4M71 A;  1I5Z A;  3LQQ A;  3K69 A;  3R6S A;  3LAP A;  1U2W A;  2XVC A;  4LG0 B;  5AON A;  1ZLK A;  2JT1 A;  1REP C;  2B0L A;  4UVA A;  3HSE A;  3MQ0 A;  2UWM A;  3P9I A;  2ELH A;  5DYM A;  5HDN A;  4CO8 A;  5D8K B;  4AIJ A;  3RYR A;  3TGN A;  4K2E A;  1W5T A;  4ZZD A;  1ZRD A;  1MJ9 A;  3HHH A;  1BBY A;  3IRR A;  3FZV A;  1H0M A;  5ICE A;  3WE3 A;  1I27 A;  2RQP A;  5CVR A;  5HDK A;  3FWE A;  1ZN2 A;  2FU4 A;  4HF2 A;  3BDD A;  2HYG D;  4DNC A;  4E70 A;  2EA2 A;  1SD7 A;  2FOK A;  4WXH A;  3FXU A;  1W4M A;  3E5X A;  2FSW A;  2W25 A;  4RGR A;  4CZZ A;  3NEU A;  1EH8 A;  3RTR A;  1SMY F;  1ZRF A;  4FX4 A;  1T6S A;  4N9H A;  1MD0 A;  3Q5F A;  1GHC A;  5TRD A;  2D45 A;  4RGX A;  2OZU A;  5E1W A;  4U7D A;  3K1M A;  4EV0 A;  2GZW A;  3REO A;  2R7D A;  4EVI A;  3WTX C;  2GXG A;  3ZMS A;  3CTA A;  4XLN F;  2EK5 A;  3SQN A;  1J7K A;  4PGG A;  1YW8 A;  4BYY A;  5F64 A;  2PQ8 A;  4Y15 A;  4KUM A;  2Q0O A;  1J59 A;  2ESH A;  2TDX A;  1LB2 A;  2QWW A;  1FP2 A;  3E3V A;  4HQM A;  2BV6 A;  3B73 A;  3HOT A;  3GW2 A;  1YW9 A;  3T1B A;  3V7C A;  2LNB A;  3P7N A;  3HSF A;  2MH2 A;  2XRO A;  2EFN A;  1TQP A;  2O3F A;  5D5X B;  1KU7 A;  1T0F A;  2F5C A;  4G9Y A;  1G3W A;  5CVI A;  1BJA A;  2F2E A;  3MAJ A;  5DUK A;  2W24 A;  1R1T A;  4O6J A;  4GCV A;  4Q48 A;  2QQB A;  2K7L A;  1AWC A;  4LD5 A;  3TOB A;  3F8C A;  2FBH A;  1RNL A;  5ILS A;  2DBB A;  2E7W A;  2CFX A;  3COA C;  2ZXJ A;  3IWZ A;  4ZYD A;  5ICF A;  4I0B A;  2O03 A;  5TJJ A;  4OIQ F;  2GXB A;  3P9C A;  3VFZ A;  1YTY A;  1QNT A;  3VEP A;  2A07 F;  2XV4 S;  3U2R A;  2CWE A;  4XRF A;  1MJB A;  1KQ9 A;  1FX7 A;  1QQI A;  4Q47 A;  3RKX A;  1S8N A;  1BI0 A;  1IW7 F;  1U8R A;  4P55 A;  3IRQ A;  3DPT A;  4HQE A;  4LGW A;  5H6Q A;  3BWG A;  5E1X A;  1HKQ A;  3KP6 A;  2QM3 A;  3TDZ C;  2RKH A;  1ULY A;  4I7H A;  1ZLJ A;  1YIO A;  3MFK A;  4QLC U;  1LDD A;  4ENK A;  3PQJ A;  4KN7 X;  2M1B A;  1YYV A;  4IPA A;  2EB7 A;  4EMS A;  3WOD F;  3E6D A;  2CSO A;  4IXA A;  2K86 A;  3E6C C;  1FC3 A;  2KJC A;  1O57 A;  2G7H A;  1KU9 A;  1RZ4 A;  5LRR A;  1XDU A;  2A61 A;  4AVP A;  2G9W A;  3WGH A;  5K5O A;  2NNY A;  3V8K A;  2ZME A;  2ZNY A;  3V7R A;  4KT5 C;  4B09 A;  4GO1 A;  1USS A;  3KEO A;  3LA2 A;  4ZYE A;  1B59 A;  2M5W A;  3ZN1 A;  5HLI A;  4UV9 A;  3KEQ A;  2YX4 A;  3QP5 A;  4HLY A;  1PDN C;  1R36 A;  1IN8 A;  2IJL A;  5BQT A;  1BIB A;  2ZJ2 A;  2LDU A;  3F22 A;  3PFI A;  3QPT A;  4I98 B;  2FRH A;  4RB3 C;  2NYX A;  1MGT A;  2W85 A;  1OYY A;  1P2F A;  2L3D A;  1MZB A;  2PEX A;  3DV8 A;  2A69 F;  1LQ1 A;  4MNU A;  4A6E A;  1A04 A;  3RIR A;  2HGC A;  1J5Y A;  1FP1 D;  1J0R A;  1S3J A;  3JAM K;  3EYY A;  4MEX F;  4AIH A;  1KGS A;  4KIB A;  2MC3 A;  3WGI A;  3ECO A;  3CJN A;  4KA4 A;  2R3S A;  2XIG A;  2DPU A;  2KIM A;  4L5J A;  3WTV C;  1WWX A;  3JW4 A;  4R1H A;  4ON0 A;  2L4A A;  1BC7 C;  2P7V B;  2ISZ A;  1G3Y A;  4OU0 A;  1XCV A;  2D1V A;  4HDV A;  3QPH A;  1SD6 A;  1KQ0 A;  2EA4 A;  3KET A;  1TLH B;  2GAU A;  2LF8 A;  3HUG A;  4I09 A;  5CJ9 A;  4KNY A;  3W6K B;  4U7B A;  1G6N A;  3HSR A;  3W6J B;  4R8H A;  4EGY A;  1ZAR A;  1KU3 A;  1XMK A;  3V4G A;  1F1Z A;  3F6V A;  4M9X A;  4PZJ A;  1T98 A;  2ZME B;  1OR7 A;  2CW0 F;  4IF4 A;  3TQN A;  2OA4 A;  1SFU A;  4WXD A;  1LVA A;  2IT0 A;  1F5T A;  1K78 A;  3SHF A;  5A2Q K;  3SFZ A;  1F9N A;  1ZRE A;  1O3Q A;  5HS8 A;  3I64 A;  4Y17 A;  1ZAO A;  5CVJ A;  2ADU A;  4FX0 A;  3LA7 A;  2PG4 A;  3EYI A;  3KP2 A;  1DP7 P;  1QZY A;  3JTH A;  3I71 A;  2XHK A;  2DTR A;  1BI3 A;  3OV8 A;  2WC2 A;  4IRI A;  2VC1 A;  3HOS A;  4EGZ A;  4OOI A;  1OYW A;  2DI3 A;  3M9A A;  4M6Y A;  1G4D A;  4EM1 A;  3ML6 A;  4WWC A;  1E17 A;  3HYI A;  3AAF A;  1R22 A;  2FMY A;  3ABU A;  5AIP A;  1L0O C;  2DW4 A;  1HW1 A;  3JTG A;  3TO6 A;  2DFI A;  3ZMV A;  5E17 F;  3VB2 A;  2P4W A;  1FLI A;  2Q2E A;  2LF7 A;  1G3S A;  1FBS A;  3KLN A;  4A0Z A;  4GYG A;  3FM5 A;  3H92 A;  2HS5 A;  3WGG A;  3FXR A;  3MWM A;  4G7H F;  4CDG A;  1STZ A;  2VBW A;  2HDC A;  4AIK A;  3EET A;  1D5V A;  1YS6 A;  1XD7 A;  1ON1 A;  4PDK A;  3LST A;  4P9F A;  3I53 A;  2W57 A;  1P4X A;  3CO6 C;  4NQW A;  3ZQ7 A;  4LK1 F;  5DEQ A;  3M7G A;  1GXP A;  4IHT A;  3OOP A;  5KK1 A;  3R0A A;  2QVO A;  2RN7 A;  3J81 Z;  1IF1 A;  3K1N A;  1K78 B;  2DQR A;  2XAJ A;  2VT3 A;  4YIF A;  1DPU A;  3I0T A;  2FBI A;  3DEU A;  5H20 A;  2EV0 A;  3V7S A;  2Z9O A;  3BJA A;  4U88 A;  4WXC A;  4YFK F;  1CGP A;  1IXC A;  3I58 A;  2DK5 A;  1FYK A;  2VBZ A;  1B9M A;  2HZT A;  3T8T A;  2ZCW A;  2PMU A;  5BMZ A;  4UVC A;  2YPR A;  4RB2 C;  1PUE E;  3R60 A;  4BHC A;  5HOO A;  2FF4 A;  2RV8 A;  5K1Y A;  3ZMT A;  1ZHF A;  2X0L A;  3BPX A;  4IHS A;  5DV5 A;  4EJV A;  3BOQ A;  4CHU A;  1EH7 A;  2MLK A;  2KIF A;  4O5V A;  1UHW A;  2Z99 A;  4ZZL A;  2P5L C;  4XLP F;  5LGU A;  3C7J A;  3JSP A;  3E6M A;  4HLX A;  5CYV A;  2GA2 A;  1XGM A;  2A5Y B;  1OMI A;  2IRF G;  1FSE A;  3C18 A;  3KFW X;  4TV7 A;  4KIF A;  4P96 A;  1XDS A;  3TO9 A;  1D3Y A;  3DXJ F;  3WU1 B;  3F8M A;  4BXU A;  1P6R A;  1DUX C;  3SZP A;  1L3L A;  3ZMD A;  5LEJ A;  3I5U A;  2L01 A;  1HSJ A;  3F6O A;  5LLQ A;  5E20 A;  4ZYH A;  5LGN A;  4NHJ A;  4MEY F;  2KIU A;  2RC4 A;  2QQ9 A;  3GVA A;  5BPI A;  4KDP A;  1ZRC A;  1LEB A;  3RKY A;  3L09 A;  3HRM A;  2F5D A;  1O3T A;  1IAW A;  1U3E M;  1UFM A;  1BIA A;  3GZ5 A;  5D4R A;  4UVB A;  2HTJ A;  4P9U A;  1J9I A;  3SZT A;  2VE8 A;  4A5N A;  4WF2 A;  3DF8 A;  4HV6 A;  3J7A O;  2DO7 A;  3F8N A;  5J6X A;  1LNW A;  3D0S A;  5HDG A;  3ZMZ A;  1YS7 A;  1PP7 U;  4WX9 A;  3QU3 A;  5L3E A;  1Z9C A;  2P5V A;  5HLH A;  1HQC A;  1S7A A;  2ACJ A;  1B9N A;  1YQA A;  1SFE A;  5D5V B;  4U0V A;  2A6H F;  2EV6 A;  1BM9 A;  2YR2 A;  1ZG5 A;  1FPQ A;  1Z91 A;  2OD5 A;  3M1E A;  1XCB A;  5HS9 A;  1SFX A;  2K4B A;  2JZY A;  1O3R A;  1XGN A;  1TW2 A;  4EM2 A;  2H09 A;  2LKP A;  1XB4 A;  2V9V A;  5ED4 A;  2VE9 A;  5E18 F;  4LLG F;  4ENN A;  2XAS A;  4ZH4 F;  2XUB A;  1FBQ A;  1W7P D;  1Z6T A;  4EJO A;  5ICG A;  3N4M A;  2E1C A;  3M8F A;  2O6G E;  3R4K A;  1JE8 A;  3RJP A;  2OU2 A;  2V1D A;  3WTY C;  4R79 A;  5DCF A;  1ONV A;  4BH9 A;  3SXY A;  2C6Y A;  4ESF A;  3FMQ A;  4XBF A;  1IZ1 A;  3GWZ A;  3CLO A;  1WQ2 A;  2X4H A;  1WRJ A;  4IRG A;  2IP2 A;  2VT2 A;  4AD9 A;  4OIO F;  2F5F A;  4G7O F;  4HV5 A;  2PN6 A;  5J8C A;  4EQQ A;  2JRT A;  2CGP A;  5DUI A;  3IC7 A;  2MD5 A;  3KZY A;  3FMS A;  2DAO A;  4Z2Y A;  1K6O A;  4A6D A;  1FSH A;  1O3S A;  1QPM A;  4MHG A;  3QOP A;  1K79 A;  1HST A;  5DD4 A;  1HKS A;  4O3M A;  3RYP A;  5L3F A;  2LSO A;  3J80 Z;  4CXF A;  2ZO4 A;  4GGG A;  2VBX A;  1T2K A;  2HFH A;  5FO5 A;  3EQL F;  1Z6R A;  2HTS A;  1XSD A;  2GIV A;  2FNA A;  1FZP B;  2BE5 F;  3CUQ A;  1UST A;  3U9G A;  3G3Z A;  3QAH A;  1RI7 A;  1HKT A;  3O6B B;  2KKO A;  1IN4 A;  4L9V A;  1P4A A;  5D4S A;  4XSX F;  4A0Y A;  3IKT A;  2H6C A;  5EEG A;  3F8B A;  1TTY A;  5L3B A;  3E5U A;  5IT9 Z;  1KYW A;  2HOE A;  4LLN A;  5FLX K;  4OIP F;  5F1R A;  1WKM A;  2H94 A;  1G3T A;  4HX4 A;  2AS5 F;  4L0Z B;  4HW0 A;  3ERE D;  2M8E A;  5LRS A;  1SD5 A;  4A12 A;  4HF1 A;  3QP6 A;  3L9F A;  2NNN A;  2H6B A;  3E5Q A;  2UXX A;  2V1U A;  2K4J A;  3K2Z A;  2XAQ A;  1E2X A;  3PQK A;  2H27 A;  1BN5 A;  1XMA A;  4MQ9 F;  3BY6 A;  4N9I A;  4GYI A;  2D1H A;  2Y75 A;  5E8I A;  2CYY A;  3WE2 A;  3WTT C;  2STW A;  4YG2 F;  3P9K A;  3ZN0 A;  1U5T A;  2FQ3 A;  2QQA A;  3DPL C;  1IRG A;  2EJR A;  3RPQ A;  3MZY A;  1R5G A;  4A0X A;  3K1P A;  1QGP A;  2QYO A;  4G8X A;  4M6X A;  5LBQ A;  4ENM A;  4L0Y B;  3MZH A;  1OYI A;  3WU0 A;  3BRO A;  4JBA A;  5FD6 A;  1YFH A;  4JK1 X;  2ZNZ A;  2BEO A;  5LHI A;  3N97 A;  4PCQ A;  5K5Q A;  3HRS A;  2HQN A;  2QLZ A;  4RB1 A;  2VN2 A;  5FGM A;  2P6T A;  4MTD A;  1WI9 A;  4L9J A;  3JSO A;  4MGR A;  3CUQ B;  3IWF A;  1OKR A;  2MH9 A;  3B02 A;  1Z7U A;  3KP5 A;  4IVN A;  4EJW A;  1TQM A;  3LFK A;  3IHU A;  1YO5 C;  3H3U A;  2OQG A;  2OAZ A;  4HF0 A;  1UCR A;  5F6F A;  4EJU A;  2IVM A;  3L7W A;  1YG2 A;  4FT8 A;  4G6D A;  2IA1 A;  1YW7 A;  5BPD A;  5DDG A;  3BPV A;  2D2W A;  3DKW A;  1LEA A;  4I02 A;  3T5X A;  1FYL A;  4M74 A;  2HKO A;  4M73 A;  1GXQ A;  1MKM A;  5K5R A;  4YII A;  2O8X A;  1BOA A;  4OMY A;  5A2Q Z;  2XAF A;  4EM0 B;  2FEZ A;  3V8J A;  2XAH A;  1W5S A;  3FMR A;  1FYM A;  1I1S A;  2Z33 A;  2DPD A;  1TW3 A;  5D5U B;  3TDU C;  2ZFW A;  1RUO A;  4LFU A;  2XRN A;  2RDP A;  3DFG A;  3RI4 A;  4G94 A;  1U5T B;  1TQI A;  4BAY A;  2PBI A;  2Q8K A;  1MDM A;  4LMY A;  4LLL A;  2K02 A;  3GFL A;  2EFW A;  1LDK B;  2BYV E;  1J2X A;  1QBJ A;  5ILV A;  2FA5 A;  2M45 A;  2EFO A;  1H9G A;  2XKP A;  4HBL A;  2OQR A;  5H6R A;  2VOD A;  1FT9 A;  4KIG A;  1ZH5 A;  4WK8 F;  5LHH A;  3NQO A;  1IUY A;  1TNS A;  4UXN A;  1EV7 A;  1B1B A;  3BZ6 A;  1JGS A;  1ON2 A;  5E1Z B;  5FD5 A;  4M9S A;  3G73 A;  1V4R A;  4IJA A;  4I2O A;  3CUO A;  5FB2 A;  4KIC A;  1BI2 A;  1KYZ A;  5KVR A;  2JPC A;  4MTE A;  5ILU A;  1ODD A;  3FXQ A;  4HAM A;  1R00 A;  3CDH A;  1UB9 A;  1IXR C;  1Z1D A;  1EH6 A;  3ISP A;  1KQ8 A;  3GFJ A;  2P6S A;  4M9Z A;  2FBK A;  1V3F A;  2ZBK A;  3BP8 A;  1ZGJ A;  2EFQ A;  3M8E A;  5LHG A;  3RPU A;  2VON A;  3F72 A;  2E7X A;  4S05 A;  2P5K A;  1CF7 A;  2GA1 A;  4MQV A;  2FE3 A;  3E6B A;  3NRV A;  3GX4 X;  2QZ8 A;  3E97 A;  4KMU X;  2OBP A;  2WTE A;  1IN7 A;  2HR3 A;  3WTZ A;  2QUF A;  1MDM B;  1Y0U A;  4JQF A;  3GLX A;  3LWF A;  2L4M A;  3I59 A;  2JSC A;  4HX8 A;  4XSZ F;  1R1V A;  5JHU A;  3R61 A;  1U78 A;  3VOE A;  1HW5 A;  3V8L A;  4ETS A;  5DCM A;  4DQ2 A;  3Q9V A;  2VXZ A;  3MCZ A;  2HQR A;  4UV8 A;  4H0E A;  4RAY A;  3ELK A;  3S2W A;  1HBX G;  2RVC A;  3HTS B;  2PLY A;  5L3D A;  2EV5 A;  3T8R A;  1I1G A;  1IN5 A;  2DK8 A;  4KFC A;  3ULQ B;  4S04 A;  3FX3 A;  4D0P A;  3HIF A;  4FHT A;  4HZF A;  1S6L A;  4HA8 A;  3FF5 A;  1FWZ A;  3GFM A;  2F5E A;  1FY7 A;  3HRU A;  1SD4 A;  5JR3 A;  5JVT A;  4PGH A;  3GXO A;  3KP7 A;  1S7O A;  3TOA A;  1K7A A;  1R23 A;  2VOP A;  2FNP A;  1JXS A;  4CYD A;  4ZYG A;  3BJ6 A;  4ESJ A;  5CVU A;  2Y48 A;  3HHG A;  4A5M A;  4RB0 A;  2STT A;  3IKV A;  2WWY A;  1XSV A;  1P92 A;  4ESB A;  4BHB A;  1RUN A;  5LGT A;  2GWR A;  5ERI A;  1SAX A;  1F4K A;  1CF7 B;  3GUD A;  4LB5 A;  3I4P A;  3BJO A;  4LB6 B;  4Q5S F;  2HEO A;  3ABT A;  1XSX A;  2ETH A;  4N0B A;  2YU3 A;  4U0W A;  1B4A A;  3I54 A;  2EFP A;  1B6A A;  1S29 A;  3WTW C;  3WTU C;  1ZG1 A;  1H9T A;  1BI1 A;  3J80 K;  5J8F A;  2NRA C;  3I59 B;  3EUH A;  2VOO A;  4P5O A;  1HXD A;  4Q4Z F;  4NB5 A;  1SMT A;  5DCM B;  1ZGA A;  1LJ9 A;  3ZPL A;  1ZYR F;  4Y13 A;  2P8T A;  2O61 A;  3O3K A;  2QBY A;  4HX7 A;  2EWN A;  3TKY A;  1R58 A;  2ZKZ A;  2XGX A;  1QO0 D;  2PJP A;  4L18 B;  3GF2 A;  2NAZ A;  5IT9 K;  2IW5 A;  2IA0 A;  2K27 A;  4UUV A;  1OPC A;  3ZMU A;  4HOB A;  3KP4 A;  5CLS A;  3KZZ A;  1X3U A;  2J5P A;  4G7Z F;  1GVJ A;  1IRF A;  1TBX A;  5LEK A;  4ASN A;  3QRF F;  4OIN F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...