2HTSA

Crystal structure of the dna binding domain of the heat shock transcription factor
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
92
structure length
88
Chain Sequence
ARPAFVNKLWSMVNDKSNEKFIHWSTSGESIVVPNRERFVQEVLPKYFKHSNFASFVRQLNMYGWHKVQDVKSGSNDSRWEFENERHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the DNA binding domain of the heat shock transcription factor.
pubmed rcsb
source organism Kluyveromyces lactis
molecule tags Transcription factor
molecule keywords HEAT-SHOCK TRANSCRIPTION FACTOR
total genus 24
structure length 88
sequence length 92
ec nomenclature
pdb deposition date 1994-06-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2htsA00
5LEKA 4HYEA 4MQVA 2P5KA 3CUQA 5BOXA 2UXNA 3HOTA 3ELKA 4KMFA 1I5ZA 3TQNA 1R22A 5L3GA 2O0YA 2YU3A 3V7CA 3GF2A 3GLXA 1ZN2A 2ESNA 4FX0A 3WTWC 3RYRA 5BQTA 3F72A 4ON0A 2ZJ2A 2IVMA 2EFNA 3WTTC 5HDGA 3SFZA 2FQ3A 2EFWA 4F7ZA 5D6EA 3U2RA 5JI6A 2OQRA 3F8BA 2BV6A 5ICGA 4WX9A 2HKOA 3TGNA 4M71A 1T6SA 4MEYF 3IKVA 5K5QA 3E5XA 2BBYA 2IW5A 2XIGA 1S3JA 2PQ8A 1E17A 2DBBA 1XDSA 4UV8A 1HW2A 3QU3A 3F8MA 3ZMDA 2HOEA 4U0WA 2HYFA 2KJBA 2QQAA 3MEXA 3WG9A 3EUHA 4GO1A 1XGNA 2P6TA 3ERED 2QUFA 5D5UB 2V9VA 3B02A 2QENA 2V1XA 4L0YB 4A12A 1BBYA 1FYKA 2EV6A 5LHHA 1WSUA 1SD7A 1KYZA 1SFUA 2ISYA 2P7VB 3S2WA 3HUGA 1SD5A 4UUVA 4R8HA 2VBZA 5H6RA 3E6DA 4KIGA 2GA2A 2XHKA 1LQ1A 4BNCA 1B6AA 4LG0B 3QPTA 2OZUA 3V8KA 4HF1A 4AIJA 4LJZF 3WTUC 1ZH5A 3GVAA 3GZ5A 1KU3A 3LAPA 3RYPA 4Q4ZF 3ECOA 5D5XB 2CQKA 2DQLA 3VEPA 4Y13A 3CTAA 1O3TA 3FHZA 2QQ9A 2OQGA 3WTZA 1ZYRF 4IVNA 1UCRA 4MTDA 4RGUA 1VTNC 1ZRDA 1R1TA 3TO9A 2DPUA 4M6YA 3DP7A 1F4KA 5FLXK 1HW5A 1Z6TA 2ISZA 3DF8A 3R0AA 3P9KA 5KVRA 1HKQA 4KNYA 3GUDA 4DNCA 3H3UA 2MH9A 4S05A 2XKOA 2MD5A 5HVQC 4G8XA 1QO0D 1PP8F 2NNNA 5DYMA 2XROA 5HLIA 4ZYEA 1LDKB 2GWRA 3H92A 3ZMUA 1T39A 2DPDA 4NB5A 3SZPA 2PJPA 1WRJA 4G7ZF 1DP7P 2CSOA 1O3SA 1TQPA 2L01A 3F22A 3TO7A 3JSPA 3T8TA 2Q0OA 1EV7A 2BE5F 1YYVA 2E7XA 3E5QA 4YFKF 3U9GA 1OKRA 2CYYA 3ZMTA 4ENMA 3KCCA 4Z2YA 1CF7B 3WTXC 1HXDA 3Q5FA 2DT5A 1HSTA 1T2KA 4P55A 1H0MA 3MAJA 4A6DA 3AAFA 4DQ2A 3DFGA 3C1DA 3MQ0A 1SD6A 1UB9A 4ENNA 1HBXG 2FXAA 4N0BA 1R5GA 4RB1A 2HWVA 5D4RA 1O3RA 2LSOA 1IRGA 5LEJA 4G94A 2BYVE 1XSDA 2Q2EA 2EA2A 1U2WA 4L9NA 3F6OA 3QOPA 1RI7A 1R36A 2D1HA 2DTRA 3HIFA 3C7JA 1XN7A 1XSVA 2EFOA 1AOYA 2Y75A 2Z5UA 4G7HF 1BJAA 1TLHB 2XAJA 5E1XA 2K7LA 4U7BA 2L4MA 3FMQA 1HQCA 3F6VA 1KU7A 1DUXC 3VODA 2HDCA 4RGXA 1O7FA 4A5NA 1XMAA 1HSJA 4I09A 3DQVC 3CJNA 3O6BB 1ZG3A 1FP1D 2ZXJA 3DKWA 4A6EA 1HKTA 3C18A 2HR3A 3IC7A 5TJJA 4LK0F 4BHCA 1R23A 4HV6A 4TV7A 3T5XA 5DDGA 2K02A 2VE8A 2V1UA 1OMIA 3W6KB 3Q9SA 3MWMA 1HW1A 4IRGA 3FMSA 1AWCA 4ESBA 1Z9CA 5TRDA 5LGTA 1XGSA 5D8KB 2HQNA 3D0SA 3RKWA 1FBSA 3LA7A 2LDUA 1B4AA 5BPDA 4ETSA 4KIBA 3KFWX 2EB7A 4O5VA 5IT9K 4CHUA 4GGGA 2CG4A 3ABUA 5LBQA 1ZREA 1USSA 2K4BA 5DCFA 2FSWA 2QZ8A 4RS8A 3J81Z 1JE8A 2DK8A 2A6EF 4ENJA 5AIPA 2FU4A 4HBLA 2RN7A 2EV0A 3C3WA 2JRTA 3FXRA 3HHGA 3V7SA 5J6XA 1B1BA 2AS5F 1EH6A 3E6BA 4KIFA 1G3SA 4FHTA 4HQEA 4Q5SF 3RKXA 2V6CA 1S7OA 3RTRA 2ZNZA 2IRFG 1W5TA 1YW7A 2VBYA 3J7AO 1L3LA 3WTVC 5DD8A 5HLHA 3QP5A 2GXGA 1KYWA 4P96A 1D8KA 2PMHA 3GZ6A 1GHCA 3HHHA 5CVUA 2OZ6A 3BJAA 2A5YB 2UXXA 3U1DA 3LQQA 1Y0UA 1MDMB 1ZLKA 5CYVA 1F5TA 2WC2A 4XSXF 2STWA 1LJ9A 2EFQA 2GA1A 2P5LC 5CLSA 1MJBA 2M8EA 2L4AA 4M9SA 3N97A 1ZGAA 5AONA 2YX7A 3FZVA 3MZYA 1QGPA 2HYGD 3MZHA 2M30A 4UV9A 2H27A 5FD6A 4LK1F 3ULQB 1H9GA 5J8FA 1W7PA 4HF0A 4HDUA 5DD4A 2HEOA 4A0XA 4UXNA 2OAZA 3F8CA 2KIMA 5ILSA 1UFMA 3K1NA 2FA5A 2NYXA 3FMRA 4XRFA 1BIBA 3ZMVA 4MTEA 2VOOA 1J59A 5JFRA 1P6RA 3RI4A 2FBHA 3I71A 1XSXA 2F5EA 5JHUA 2ZNYA 2IPQX 4IHTA 2XAQA 2QWWA 4WXCA 2RNJA 1MKMA 5IT3A 3GFIA 4CO8A 2CWEA 2QYOA 2A68F 1ON1A 2D45A 2H09A 3ZMZA 1ONVA 3IHUA 3COAC 2O03A 2FMYA 4BYYA 4LMYA 1BIAA 4ZYGA 2P6SA 4LGWA 3LA2A 2KKOA 4L9JA 1G3WA 4IJAA 4HX8A 1C0WA 3FM3A 1MD0A 5L3BA 1ZHFA 3H3ZA 4L9VA 1FY7A 3ROUA 5HDNA 3QPHA 3LFKA 4AIKA 1RUNA 5D8LB 3CUOA 5ICEA 2OA4A 4EM1A 1K79A 2XV4S 2FMLA 2K27A 3DPTA 2MH2A 1WI9A 3GX4X 1YO5C 3E5UA 3REOA 1ZG5A 2RQPA 1J0RA 2MC3A 5F64A 4KUMA 1IUYA 1YLFA 4CDGA 1V3FA 3EDPA 1ZRCA 4CYDA 2IT0A 1P4AA 2X0LA 1S6LA 4Y17A 3JAMK 3GWZA 5H6QA 3TDZC 1FYLA 3LSTA 2C6YA 1JGSA 2HS5A 2IP2A 5LHIA 1W7PD 3FM5A 4YFNF 1K6OA 2R7DA 3IL2A 3FXQA 2JSCA 4OIRF 4QLCU 3KP7A 5FB2A 2DAOA 2B0LA 1LDDA 1IN5A 2JPCA 5HS8A 1D8JA 3GFMA 4BHPA 4OMYA 3L9FA 3JW4A 3CUQB 1UHMA 1K78A 1W7PB 1IXCA 3E6MA 4WK8F 5HS7A 3EETA 1J9IA 2O61A 3I64A 1Z6RA 1KGSA 4UVCA 3CUQC 1SFEA 3BDDA 2RV8A 2QBYA 1TBXA 1T98A 4ZZDA 4HDVA 1D5VA 2JT1A 3GFJA 5K5RA 4UVBA 2GQQA 4GXOA 5A2QZ 3V7RA 1XB4A 3WE3A 4EJWA 2BEOA 4O3MA 2EFPA 4Q47A 2KRFA 1MDMA 2XAFA 4L9TA 1GXQA 3L7WA 3JTGA 3HOSA 4A0ZA 1Z05A 3G3ZA 5JR3A 1QZYA 1SAXA 2O8XA 5BMZA 1FWZA 4UHTA 1G4DA 1E2XA 2ZO4A 3K2ZA 1ZARA 2OD5A 4IHSA 5E1ZB 3R4KA 4N9IA 2UZKA 2XASA 3E97A 5F1RA 3F8FA 5D5WB 2DLLA 1MZBA 3HTUA 1FYMA 1YW9A 3FWEA 5BPIA 4M74A 4CGZA 2D2WA 1XDUA 5E8IA 1ON2A 4OMZA 1R7JA 4EQQA 4K2EA 2ZFWA 3EQLF 3OOPA 2AXLA 1XGMA 3KZZA 3GO5A 2RDPA 4M9ZA 4ZZLA 1F1ZA 2XGXA 4LB6B 3LA3A 2IJLA 3ABTA 3GYHX 5CVRA 4UNOA 2H6CA 4BHBA 1RZ4A 3I0TA 3R6SA 5CVIA 2P8TA 2KIFA 1S8NA 2D1VA 4M9XA 3HRMA 2NAZA 2J5PA 3DEUA 4HV5A 4OIPF 2PFBA 1I1SA 2ELHA 2RC4A 1KA8A 4PCQA 4R1HA 4KN4X 1EH8A 1YG2A 2NNYA 1XGOA 3J80K 4H0EA 4U88A 1O57A 3PQKA 3BPVA 1TQIA 4S04A 5L3EA 2CW0F 2EA4A 2PEXA 3IWFA 1FBUA 2VXZA 4M6XA 5CVVA 3LQRA 4ZYDA 1JHHA 3BJOA 4MHGA 5LGUA 3JSOA 4XLNF 3BJ6A 2GZWA 1FSEA 1STZA 1OPCA 2P4WA 2WV0A 2LF7A 4BXUA 3J81K 2A69F 4IF4A 3NQOA 4I0AA 3I5UA 2PBIA 4HQMA 2A3SA 1U78A 1IN4A 4ESFA 4EM0B 3T0YA 3KP2A 5IT9Z 3GFLA 3ZPLA 2DQRA 5E1WA 5DV5A 1IAWA 1P4WA 2ZBKA 4IRIA 4G7OF 1LNWA 2MLKA 1R00A 2LF8A 2W57A 2IA2A 4L5JA 1PP7U 1FC3A 1XMKA 4RGSA 5FLXZ 3I59A 3WTSC 1IF1A 3P9IA 1XD7A 2FOKA 3BOQA 4OIQF 2VT2A 2FBKA 3RPQA 1QZZA 5E8GA 3HRSA 5K5OA 1CGPA 3IRRA 2XVCA 3W6JB 1R1VA 1D3YA 5FO5A 3T8RA 2L02A 1U6GA 1X3UA 4G6DA 2Y48A 1V4RA 2VN2A 4KN7X 1CF7A 4HLXA 4GCVA 4A2UA 3WE2A 5LHGA 4HW0A 2FBIA 4PDKA 5D6FA 2K4JA 2VONA 2R3SA 4HF2A 1P2FA 4I98B 3WGIA 2O3FA 3K1PA 4JQFA 3WGGA 1ZRFA 1RNLA 2A07F 3BP8A 3SZTA 3RIRA 1B59A 2O6GE 2QLZA 2EV5A 3VFZA 3K9TA 1FBQA 1BC8C 1G3YA 1ZGJA 3R61A 4HA8A 1RIOH 2F5FA 2FEZA 1ZLJA 3V4GA 1MJAA 2HTJA 2GIVA 1YTYA 4LLLA 3LAJA 1J7KA 4PGGA 2CO5A 4M72A 3DV8A 1U5TC 3L00A 3P9CA 4AVPA 5K1YA 2QQBA 2VT3A 4I01A 1DPRA 3E3VA 4KYWA 4GYIA 3IKTA 1QBJA 3KP3A 2OU2A 1L0OC 1T0FA 1JHFA 5J8CA 3FXUA 2V79A 4P5OA 3RKYA 4OOIA 2Z9OA 1TNSA 4ZYHA 5ILUA 4I7HA 3PFIA 4P9UA 2FF4A 3WTYC 2FRHA 1FNNA 1R5HA 1U3EM 1I27A 5EEGA 1P4XA 3F21A 1S29A 1QNTA 2E1NA 4XLPF 4YIFA 1XCBA 2H6BA 5CVJA 1ZAOA 2Z33A 3F8NA 2HGCA 3BPXA 1BI2A 2YSRA 4YG2F 5L3FA 5D5VB 1NHAA 1LVAA 5AIQA 3KP4A 2MBFA 5FFXA 3DPLC 2VOPA 2W84A 3TOBA 4WCGA 4EJUA 2E7WA 3GXOA 2RKHA 3P7NA 5E20A 2M1BA 3WU1B 3HTSB 3J80Z 1Z91A 2PMUA 1IRFA 4WF2A 1Z7UA 2VC1A 2LNBA 1A04A 4U0YA 4M73A 3M9AA 1GVJA 1IN6A 4FX4A 3QRFF 3RDIA 3G73A 1FZPB 1BC7C 1FSHA 3B73A 3HYIA 3NRVA 1W4MA 4OU0A 2CGPA 1O7LA 1Q1HA 3QAHA 2K86A 2X4HA 4EJVA 3V8JA 3WGHA 2UWMA 3ZN1A 3QP6A 5DUKA 4BH9A 3PQJA 1J2XA 1G6NA 1LEAA 4PGHA 5ICCA 4IXAA 3KLNA 5LRRA 3EYYA 2WTEA 4R79A 2DK5A 3GW2A 3M8EA 4MEXF 5ED4A 4JK1X 2M5WA 2F5CA 1H9TA 2ZCWA 4OIOF 3MFKA 2Q8KA 4WXHA 3MCZA 1MJ9A 5L3CA 2FNPA 3I4PA 2COMA 2DFIA 5A2QK 2JTVA 4LB5A 1TW2A 3R60A 3K1MA 1T38A 2IA1A 4G9YA 3ML6A 4QWQA 5ICFA 2MA3A 3V8LA 1PDNC 2QBYB 2PG4A 5DUIA 4EM2A 3N4MA 5DCMA 3F3XA 3L2CA 1IXRC 4U7DA 2A6HF 1K78B 2OBPA 2KIUA 3BROA 4ESJA 1DDNA 1BN5A 1BM9A 3D5LA 5D4SA 4RGRA 2DO7A 1FX7A 2V1DA 4AWXB 4MGRA 3DXJF 2JPBA 3KEOA 1RUOA 1SMTA 5CJ9A 1TTYA 3I53A 4E70A 4RB2C 3HSEA 3ISPA 4N9HA 4L18B 2A61A 1YS7A 3E6CC 3IRQA 4EJTA 1XCVA 3NEUA 5EEHA 1IZ1A 2FNAA 4Q48A 5HDKA 1B9NA 2H94A 2E1CA 2XKPA 2HZTA 1REPC 5FFZA 1I6XA 4I02A 1SD4A 2L3DA 5KK1A 3ZP5A 1FOKA 4ZH4F 3CDHA 3KP5A 4HOBA 4KMUX 1K7AA 4FT8A 1DPUA 2W25A 1O3QA 3VOEA 2HFHA 3ZQ7A 4MQ9F 1FT9A 4HX7A 1EH7A 3VB2A 3CO7C 1BOAA 5F6FA 3K0LA 1IXSB 4HZFA 2GAUA 5DEQA 1TW3A 2M45A 1B9MA 2XAHA 2BGCA 4HAMA 4EMSA 3EYIA 5E18F 1YFHA 1U5TA 1MGTA 4HX4A 2ETHA 4WWCA 2DU9A 4AD9A 1YW8A 4KICA 1LDJA 2F5DA 2R7FA 2YPRA 3HSFA 1FP2A 2PI0A 2G7HA 4EGYA 3L09A 1ZG1A 1JXSA 2Y0MA 2P7CB 4A0YA 2DW4A 3ZMSA 1ODDA 5DCMB 1G3TA 1OYWA 1YIOA 4HLYA 4EGZA 2NRAC 1BI1A 4LD5A 4OINF 4ENKA 4O6JA 2VBWA 4RAYA 2XRNA 3QU6A 4ASNA 1OYYA 4CICA 4KT5C 3KZYA 4B09A 2ZMEA 3KLOA 5HOOA 2LKPA 4LLNA 5E17F 4I2OA 3LWFA 2ADUA 4KA4A 2TDXA 2FE3A 4A5MA 5ERIA 3I59B 4NQWA 2EK5A 5BS6A 4GYGA 1IN8A 1IW7F 3TO6A 1LB2A 2RVCA 3IWZA 5H20A 5HS9A 1SMYF 5ILVA 3R0JA 2HQRA 3OV8A 1SFXA 4KDPA 2XUBA 1R58A 2L54A 3FF5A 2YX4A 2VODA 3RPUA 2W85A 2ESHA 3BWGA 4BAYA 4JBAA 4KFCA 2XAGA 5LLQA 1GXPA 1HKSA 1BI0A 1YQAA 5LGNA 2IA0A 3I54A 4XBFA 3ECHA 3FX3A 2J5OA 2EWNA 2WWYA 2M87A 3ZN0A 3KETA 2ZMEB 3KEQA 2RGVA 2G9WA 4EV0A 2VE9A 3T1BA 2ACJA 4L5IA 2Z3YA 1J5YA 4RB0A 2EJRA 2NS0A 5FGMA 5LRSA 6PAXA 4P9FA 4L0ZB 3SQNA 3M1EA 2VC0A 4EJOA 2QM3A 4IPAA 3BZ6A 3CLOA 1KU2A 4WXDA 4BQAA 4NHJA 3JTHA 4Y15A 1UHWA 4LFUA 5JVTA 1U8RA 1KQ8A 3GEZA 4CZZA 3CO6C 4LG0A 4CXFA 3TDUC 1KQ0A 1IN7A 1YS6A 4UVAA 5L3DA 4B8XA 4U0VA 2STTA 4RAZA 1U5TB 5HLGA 1I1GA 3WODF 1OYIA 3KP6A 2F2EA 2PLYA 1P92A 4IRHA 2PN6A 1F9NA 4PZJA 2MLGA 2ZKZA 1OR7A 2CFXA 3I58A 3JAMZ 1PUEE 1BI3A 3TKYA 1Z1DA 1S7AA 5FD5A 4RB3C 3M7GA 4YFXF 2VBXA 2KJCA 1USTA 2JZYA 3RJPA 3SXYA 4AIHA 2QVOA 1J75A 1WQ2A 2HKXA 1LEBA 3WU0A 1WKMA 2GXBA 3HRUA 3Q9VA 1FPQA 4XSZF 1R1UA 3HSRA 2W24A 1QQIA 2HTSA 2YR2A 3BY6A 3SHFA 3M8FA 4YIIA 3F23A 2Z99A 1W5SA 4G6QA 4I0BA 3TOAA 4MNUA 1QPMA 2P5VA 1ULYA 1KU9A 1FLIA 2DI3A 3K69A 1WWXA 3O2PE 3KE2A 3HRTA 1TQMA 4D0PA 4LLGF 4EVIA 1KQ9A 2G7UA 3O3KA 1TNTA
chains in the Genus database with same CATH superfamily
1T33A 5LEKA 4HYEA 4MQVA 1RR7A 1J09A 2P5KA 3CUQA 5BOXA 1V5GA 2M9HA 2UXNA 3M8JA 3HOTA 1B8IB 1LE8B 2K3PA 3ELKA 4QPOA 1QHHD 1I5ZA 4KMFA 2CQQA 3TQNA 1R22A 5L3GA 2O0YA 2YU3A 3RZDJ 3V7CA 1MSFC 3GF2A 3GLXA 1ZN2A 2ESNA 2HPMA 4FX0A 3WTWC 3RYRA 3N05A 2VLAA 5BQTA 3F72A 2CV1A 4ON0A 3G1MA 2ZJ2A 1EJ9A 2IVMA 2EFNA 2DFEA 1QU3A 3WTTC 5HDGA 3SFZA 2FQ3A 2EFWA 4F7ZA 4PK4A 3MMYB 3BLYA 5D6EA 3CESA 4BE0A 3C2GA 3CJQB 3S32A 4PJLA 3U2RA 1WJDA 3EUAA 4Y33A 3KPHA 3OIOA 5JI6A 2OQRA 3F8BA 3IAS2 2VB6A 4CCKA 2BV6A 1GV5A 2LVSA 4RM2A 5ICGA 3BR0A 4WX9A 2HKOA 3MKZA 3TGNA 3CDIA 4M71A 2R0QC 3ZR8X 1T6SA 2ZXIA 2HVRA 4MEYF 3QQAA 2VJ4A 2E2IJ 2ZJPF 2V6EA 2VKEA 3VYUB 3IKVA 1LVKA 5K5QA 2LP0A 1YRNA 3E5XA 2BBYA 1LPQA 2IW5A 2VQLA 2XIGA 5B3SH 4HNVA 1S3JA 2M7AA 2PQ8A 1E17A 2DBBA 5GAEJ 2HOSA 1JGGA 4KITB 1JUMA 2K9QA 1XDSA 4AUXA 2CUZA 4UV8A 1B72A 1HW2A 3A02A 3S1QJ 3DBLB 3CP8A 3DKYA 3QU3A 3F8MA 4XKWA 2CS3A 3PO3J 3ZMDA 2HOEA 4U0WA 2HYFA 3LSPA 1PJRA 2KJBA 2QQAA 3MEXA 3WG9A 1Z67A 3EUHA 4GO1A 5IPAA 3S3OA 3W2VA 1XGNA 3DBRB 2P6TA 5EZHA 3ERED 1SFKA 2QUFA 3PUBA 2V9VA 5D5UB 2KRCA 3I3LA 3CCUI 1GLNA 3B02A 2QENA 2V1XA 4FE7A 4L0YB 4A12A 1BBYA 3K4BA 4CCJA 2EV6A 1FYKA 3L2QA 3BCBA 5LHHA 1WSUA 1SD7A 3HGGA 4PJJA 1KYZA 1YE9A 1SFUA 2Y9ZA 3HM5A 2IGOA 2ISYA 3OR1C 4I76A 2LY9A 1AU7A 2BVMA 2P7VB 2IBDA 3S2WA 1N25A 3SFIA 3HUGA 1ETYA 2E35A 1SD5A 5FKLA 5FLVA 4UUVA 4R8HA 2VBZA 5IP6A 2MW8A 5H6RA 1SANA 2VJJA 3BQYA 3JRGA 2L7ZA 2NS8A 3E6DA 4KIGA 1W36D 4II2A 2GA2A 2XHKA 1LQ1A 3L1PA 4BNCA 2VKDA 1B6AA 4LG0B 2LK2A 3QPTA 2OZUA 3V8KA 4HF1A 2HXOA 2R5ZA 2DN0A 3ZQLA 4AIJA 3IH4A 4LJZF 1P9QC 3WTUC 3CC4I 2XSDC 1ZH5A 4BKXA 3NAUA 3GVAA 4PFPA 2H1LA 4XKBA 2NXNB 1UHSA 2EH3A 3GZ5A 1KU3A 2EQRA 2Y69H 3LAPA 3RYPA 4Q4ZF 2O8KA 2E71A 3ECOA 2CMPA 2CQKA 2DQLA 3RQIA 3VYSB 3VEPA 5D5XB 4Y13A 3RZOJ 3CTAA 1O3TA 3FHZA 3PUFA 2QQ9A 4XLEA 2OQGA 1ACIA 1ZR4A 3I4NJ 2OJED 3OYDA 4XONA 3RPUD 3S17J 1A36A 3OS0A 3WTZA 4V2FA 1ZYRF 4IVNA 1JT0A 3AG4H 1VZ0A 4C3JJ 2QF7A 1UCRA 1WJ5A 2K9MA 4B3XA 4MTDA 4RGUA 1VTNC 1XC5A 3J7AY 1ZRDA 1R1TA 1SFOJ 1ZKGA 1MW7A 3TO9A 2DPUA 4M6YA 3DP7A 3JCUC 1F4KA 1CQTA 1T0FC 5FLXK 1HW5A 1Z6TA 4XLFA 2ISZA 5EG0B 3WHBA 3DF8A 4X6AJ 2N8GA 3R0AA 4Y3OA 2X6WA 3P9KA 5KVRA 1HKQA 5J3LA 4KNYA 3GUDA 2DMPA 2RNGA 2JA6J 4DNCA 3H3UA 2MH9A 4S05A 2Y2ZA 2XKOA 2KP6A 2MD5A 1ZR2A 5HVQC 4G8XA 1QO0D 3ZOBA 1PP8F 2NNNA 1QVTA 3NWSA 5DYMA 3TP3A 2HYJA 2LKXA 2JQ7A 2XROA 2XF5A 5HLIA 5TISC 2EINH 4ZYEA 1LDKB 1H88C 2GWRA 2HXIA 1X2MA 1SVMA 4BGDA 2WY8Q 3H92A 2XC7A 3ZMUA 2JA5J 1T39A 2DPDA 4NB5A 2H8RA 2JSPA 1P7IA 5HNHA 2DOFA 3SZPA 1HOMA 3WHCA 2PJPA 5FLMJ 5J47A 2K40A 1WRJA 1TP4A 3MVPA 3H36A 2DA5A 4D1QA 4G7ZF 1DP7P 1ETVA 2DJNA 3S2HJ 2WY7Q 2JVHA 1NH3A 1OCPA 2CSOA 1O3SA 2DA2A 1FMWA 2K85A 2E19A 1TQPA 4OAZA 2L01A 2XF6A 3F22A 3TO7A 2VASA 3JSPA 3T8TA 2AQEA 2VQHA 4AYBN 2UUZA 4N4NB 2Q0OA 2QSHX 4UY8I 4CH7A 1EV7A 2BE5F 4PFOA 4BY1J 3IH2A 1YYVA 2E7XA 3E5QA 4NDLA 1IO2A 2KDOA 4YFKF 2WAQN 1JI8A 3U9GA 1OKRA 2CYYA 1IRXA 3ZMTA 2QSGX 4ENMA 3KCCA 2R5YA 4Z2YA 1CF7B 3HB9A 4NC8A 3WTXC 4IX7A 1HXDA 3A01A 3Q5FA 4Y7NJ 2HOTA 3LSKA 2DT5A 1HSTA 5K7HA 4PUSA 2P0WA 1T2KA 4P55A 3KEYA 1WZ2A 4RLQA 1MSEC 3OL4A 1B8IA 2LRDA 4C3HJ 4ZDPA 2KLOA 4J01A 1E3PA 1H0MA 3MAJA 4A6DA 1IC8A 3AAFA 3SJMA 4DQ2A 3DFGA 3C1DA 4MLOA 3VYRB 3MQ0A 1SD6A 1UB9A 4ENNA 1HBXG 2FXAA 3SEZA 4N0BA 4YRVA 2FJ1A 4EEFG 1TT0A 1R5GA 1A35A 2LKSA 4RB1A 5CQEA 3BTCA 4AM3A 2HWVA 5D4RA 1O3RA 1TWAJ 2LSOA 1IRGA 1GV2A 2M0CA 4KJZA 5LEJA 5B5EC 5M3FJ 4G94A 2BYVE 2DYRH 4ZJZA 1XSDA 2Q2EA 3P5JA 1AKHB 2EA2A 1U2WA 3JRIA 4L9NA 3JRHA 1XX5A 3BR5A 3F6OA 2V1NA 3QOPA 5FKNA 2XPVA 3G1LA 1RI7A 1R36A 2D1HA 3HBLA 4A3JJ 2DTRA 3DTEA 3HIFA 2JK3A 3C7JA 1XN7A 1XSVA 2EFOA 2K9LA 4D7NA 3HXLA 4D9JA 5F0CA 2LYCA 1AOYA 2WV1A 2Y0SN 2Y75A 2Z5UA 3CCYA 4G7HF 1BJAA 1TLHB 2XAJA 1Y8RB 2M4GA 5E1XA 1OLTA 2K7LA 2PMZA 4U7BA 2L4MA 3FMQA 1HQCA 2M8GX 3VPRA 2E2HJ 3F6VA 2R7SA 2DFFA 1KU7A 2NOGA 1GT0C 1DUXC 3VODA 2HDCA 4RGXA 1O7FA 3I4MJ 4XORA 4A5NA 4LIUA 1XMAA 1HSJA 2VQGA 1JKPC 1DU6A 4I09A 3DQVC 4F55A 3CJNA 1DP3A 4E7HA 2VI6A 2HVQA 1W0UA 1PVEA 3GTGJ 3O6BB 1ZK8A 2BY2A 1VQ6I 1ZG3A 1FP1D 2ZXJA 3DKWA 1W0TA 2LLKA 4A6EA 1HKTA 3C18A 2HR3A 1XPXA 2X9DA 3IC7A 3GTLJ 3K4CA 1K83J 2X1EA 5TJJA 5IY5H 4LK0F 4BHCA 1R23A 4HV6A 3DLLF 3OL3A 4XRSA 3JREA 1VQLI 2Y0SA 2K5CA 4TV7A 3T5XA 1JKRC 3LSRA 5DDGA 2K02A 1MMAA 2VE8A 2V1UA 1OMIA 3S8PA 3W6KB 2LOOA 3Q9SA 1ETKA 2BZTA 3MWMA 5FJ8J 2XSJC 5FRMA 3OSGA 1HW1A 4IRGA 2KL4A 3E1SA 3QPSA 4IHVA 2Q2EB 3FMSA 3H0GJ 1I3AA 1AWCA 4ESBA 4C2MJ 5EEAA 1Z9CA 3CJTB 5TRDA 1DGWY 5LGTA 2QQ8A 3DBHB 4XLHA 1XGSA 3BQZA 1RR8C 5D8KB 2HQNA 1Z3XA 2BXYA 3D0SA 2ME6A 3RKWA 2MABA 2LC2A 4HEA2 2W7NA 1RRJA 2HDDA 1FBSA 3LA7A 2M7BA 4BU2A 1E0EA 1ZQ3P 2LDUA 5KAIC 1B4AA 4ETSA 2X6YA 5BPDA 4KIBA 3KFWX 2EB7A 4O5VA 5IT9K 4CHUA 1MNDA 4GGGA 2P81A 3JRDA 2CG4A 3CF5F 1BW5A 3ABUA 5LBQA 1ZREA 1USSA 2E60A 3KYCB 3OYMA 2K4BA 2CV0A 2EIJH 5DCFA 3VDXA 2FSWA 2QZ8A 3CCVI 1HC8A 4RS8A 2O9LA 3J81Z 1BOBA 2R5YB 1JUPA 1JE8A 3K70D 2DK8A 2A6EF 4ENJA 5AIPA 2FU4A 2FUG2 2L7FP 4HBLA 2RN7A 2A5WA 3DEWA 3CDLA 2EV0A 3K4KA 3C3WA 2JRTA 2Z2SB 3FBNB 1YJNI 3H5NA 3FXRA 2BXZA 2F5VA 3HHGA 3V7SA 5E3MA 1OJLA 5J6XA 5J40A 4XOTA 1B1BA 2AS5F 3W2WA 5FRNA 2LH9A 1MMNA 1EH6A 3E6BA 4KIFA 3BTIA 5J1UA 1G3SA 4FHTA 4HQEA 4Q5SF 2E34A 3IH3A 3RKXA 2V6CA 3QPLA 1S7OA 4YEJA 1S9HA 3HGYA 3RTRA 2ZNZA 2IRFG 1W5TA 2H1KA 3H35A 1YW7A 2WADA 4XICA 2VBYA 3J7AO 1L3LA 5DM7F 3WTVC 4RBOA 5DD8A 5HLHA 1VI0A 2LBFA 3OYAA 3VSKA 3QP5A 2QEXI 3L2WA 2GXGA 5KCMA 2MG4A 5HODA 1KYWA 4P96A 1DQUA 1VQ8I 4D5FA 5J1RA 2XPWA 3OR2C 1D8KA 1IV8A 1MH3A 2GXAA 2PMHA 1TWGJ 4H4KC 3GZ6A 1GHCA 2F4OB 3BZKA 3HHHA 4GDFA 5CVUA 3FXJA 4V2GA 2OZ6A 4B44A 3BJAA 3OWTA 2GOXB 2A5YB 4JYKA 5IOYA 2HQAA 2UXXA 3CMMA 3LQQA 1YX5A 4UB6C 3U1DA 4DZJA 2EIKH 1DGRM 1Y0UA 3BR1A 1MDMB 4RMNA 3IV5A 3C2HA 3CC7I 3ABKH 1ZLKA 5CYVA 2DA1A 1F5TA 2WC2A 4XSXF 1HCRA 3OMYA 1LJ9A 2STWA 2EFQA 2GA1A 3K6GA 4LG3A 2P5LC 2M4KA 5CLSA 1G8XA 1MJBA 1E3OC 3SZGA 2M8EA 1TZLA 4CSWA 2L4AA 4M9SA 3N97A 1Y56A 2R7VA 2EIMH 1ETOA 1ZGAA 1WVRA 2X48A 5AONA 2YX7A 4CYCA 3FZVA 1ENHA 1WFXA 3MZYA 1QGPA 4IOCF 4E7SA 1VQ9I 2HYGD 1R9TJ 5BNGA 4GRIA 3MZHA 3E0JB 4BQQA 3FDYA 2M30A 1PYVA 4UV9A 2R7TA 2H27A 2YU9J 3CCRI 5FD6A 4LK1F 3ULQB 4ZYAA 4F91B 2R7ZJ 1H9GA 4BJ6C 3EPZA 2FD5A 5J8FA 1W7PA 5CKTA 4HF0A 4HDUA 5DD4A 2HEOA 2DT6A 4NC6A 2BOLA 1IV6A 4A0XA 4UXNA 2OAZA 3F8CA 1MBGA 2KIMA 5ILSA 1IJWC 1BJZA 2CRGA 1UFMA 3K1NA 2FA5A 2E2JJ 2NYXA 1IRZA 3AG2H 2GOMA 3FMRA 3A1YA 4XRFA 2LR8A 4LITA 1BIBA 1ETXA 3ZMVA 4MTEA 3BG6A 2VOOA 1J59A 5JFRA 3BG5A 2EBIA 3CCLI 2KZVA 4W1UA 4F52A 1P6RA 5EF6A 3OYCA 4D7MA 3RI4A 2FBHA 3I71A 1XSXA 2F5EA 5JHUA 1ITYA 2ZNYA 2IPQX 4IO9F 4IHTA 1ZTRA 4CCLA 2XAQA 2QWWA 5M5XJ 1EKEA 2RNJA 4WXCA 1MKMA 5IT3A 3GFIA 2DMNA 4CO8A 2CWEA 2QYOA 2A68F 3HZJA 1ON1A 2D45A 4UB8C 2H09A 2TRTA 2DA4A 2ECCA 3ZMZA 1ONVA 3IHUA 3WG7H 4M3GA 2DDBA 2WAQA 1EF4A 3COAC 2O03A 2FMYA 1HDPA 4BYYA 3F9KA 2ZJQF 3ZGKA 1TWFJ 2L2OA 2MSYA 4LMYA 1BIAA 1VFCA 4HRIA 4ZYGA 2P6SA 4LGWA 4QSHA 3LA2A 3HPHA 2KKOA 3B6CA 4L9JA 4Y52J 3CCSI 4BJ5C 3G2BA 1G3WA 4IJAA 4HX8A 1C0WA 3FM3A 1MD0A 5L3BA 1ZHFA 3H3ZA 1N75A 1PUFA 4L9VA 1FY7A 3AG1H 4J19A 3ROUA 3SYTA 5HDNA 3QPHA 3V42A 2I5UA 3LFKA 4AIKA 1NG6A 3LSMA 1RUNA 5D8LB 2KIQA 4AVZA 2YS9A 3CUOA 5ICEA 1VQ4I 2OA4A 4EM1A 1OCTC 4B1RA 1K79A 4BQNA 1MMDA 2XV4S 2FMLA 1YOVB 3Q3SA 1K4TA 2DOAA 2K27A 3DPTA 3HJEA 2MH2A 2ME0A 4CCNA 2GM4A 1WI9A 3GX4X 3FXMA 1I50J 5E3LA 3E5UA 1YO5C 2E5NA 3REOA 1ZG5A 2IGKA 1JJ8C 2RQPA 3FKIJ 3U1KA 3PSIA 1J0RA 1Y0NA 1QPIA 1VF9A 1YRNB 2MC3A 4FETA 1VQMI 5F64A 1S7EA 4KUMA 1W5CC 1IUYA 3S1NJ 1ETQA 1YLFA 3PIPF 4XIDA 3HOWJ 4CDGA 1V3FA 3EDPA 1ZRCA 3DU5A 4CYDA 2IT0A 1P4AA 2X0LA 1S6LA 4Y17A 2XB5A 3JAMK 4EATA 3GWZA 5H6QA 5F04A 1D0YA 3TDZC 1FYLA 3LSTA 2C6YA 1JGSA 2R7RA 2HS5A 3ERMA 2BY1A 4XK4A 4Y4RA 2IP2A 5LHIA 1Y8QB 4RAGA 1W7PD 3FM5A 2X85A 4YFNF 1K6OA 2R7DA 2WBMA 3IL2A 3FXQA 2JSCA 3KX2A 2JA8J 4G6TB 2OCCH 4U87A 2V7FA 3BTLA 3FXOA 4OIRF 4QLCU 5J4YA 3BR6A 2JUCA 3KP7A 2DAOA 5FB2A 2B0LA 1LDDA 2O5RA 4BDYA 2DMTA 3U21A 4IHYA 1IN5A 1POGA 2JPCA 5HS8A 1D8JA 3GFMA 4BHPA 4FQGA 4OMYA 3L9FA 1W36C 3MD2A 3JW4A 3QOEA 2XGCA 3CUQB 5EYRA 1UHMA 1K78A 1X1PA 2CW8A 1VQOI 2CJJA 1W7PB 1IXCA 3E6MA 3ZQFA 4WK8F 1FOXA 5HS7A 2L7MP 3EETA 1J9IA 2O61A 3I64A 1Z6RA 1KGSA 1WJEA 4UVCA 3CUQC 1SFEA 3BDDA 3K4LA 2RV8A 2ZJRF 2QBYA 2KMUA 3GLLA 1TBXA 1VQKI 1T98A 4ZZDA 4HDVA 2EZKA 1D5VA 2JT1A 1T08B 3GFJA 5K5RA 4UVBA 2GQQA 4GXOA 3BC8A 3W6VA 5A2QZ 2Z16A 1XB4A 4NC7A 3V7RA 3WE3A 4EJWA 1R71A 4E7IA 2BEOA 3Q0UA 4O3MA 2EFPA 3MZ8A 3H0DA 4A3BJ 1OCZH 4BL0B 4Q47A 1JTXA 2KRFA 1MDMA 2OV7A 3RSNA 2XAFA 4L9TA 1VQNI 1GXQA 3L7WA 3JTGA 4A3MJ 1SC7A 2ELJA 3HOSA 4A0ZA 3EUKL 3G3ZA 1Z05A 2X51A 5JR3A 1QZYA 4BUPA 1SAXA 2VXDA 1ERDA 1U9OA 1RKWA 1WPKA 2W00A 2X1DA 2NVXJ 3G71I 2O8XA 5BMZA 1FWZA 1NG7A 4UHTA 2VKHA 3OYKA 1G4DA 1E2XA 1OQYA 2ZO4A 3K2ZA 1ZARA 2V4JC 2OD5A 5FKOA 4IHSA 3EUHC 5E1ZB 2AHQA 3BG9A 3R4KA 4N9IA 2ECBA 2UZKA 4HSTA 4UUTA 2XASA 2D5VA 3E97A 5F1RA 3F8FA 5D5WB 3JRCA 2V9PA 5E3OA 3PFYA 1F36A 3D5RC 1MBKA 1ZELA 2DLLA 1MMSA 1MZBA 4D5CA 3H3VK 3HTUA 5LFAA 3K4JA 1Z0XA 1FYMA 1YW9A 3UR3C 3QWLA 2F48A 3FWEA 4IL6C 3OYJA 5BPIA 1R4NB 4M74A 4RM3A 2OCEA 2UV1A 4BY7J 4CGZA 4A3DJ 2D2WA 2PMZN 1ETWA 1XDUA 4DJAA 5E8IA 1ON2A 4OMZA 3DKXA 1R7JA 4EQQA 2JRMA 4K2EA 3EQLF 2ZFWA 3OOPA 2AXLA 1UJ8A 2KISA 1XGMA 2WA0A 3KZZA 3GO5A 3CD6I 3H5RA 3BR3A 2RDPA 3D5SC 1FOWA 4M9ZA 3ZXSA 4ZZLA 4AYBA 2HVSA 4C30A 1F1ZA 2XGXA 4LB6B 3LA3A 3J7ZI 2IJLA 3ABTA 3GYHX 5CVRA 4UNOA 2H6CA 5FKMA 2CUFA 4BHBA 1RZ4A 1WH7A 4L5EA 3PO2J 3I0TA 2W1OA 3OYFA 2CU7A 3R6SA 5CVIA 2DTZA 2P8TA 3KYDB 3LL7A 1YJ9I 2KIFA 2XGDA 4BE1A 2WAFA 1S8NA 2D1VA 2K9SA 2KQRA 3CCEI 4M9XA 2Y9YA 5EDNA 4XM3A 3HRMA 2NAZA 2F4MB 2J5PA 3DEUA 1RKTA 4HV5A 2IXSA 4RA2A 4OIPF 2PFBA 4KISA 1I1SA 1SAUA 4UUSB 2ELHA 3NARA 2RC4A 1KA8A 2KHMA 1U9NA 4HNTA 4PCQA 4R1HA 4KN4X 1EH8A 1K4SA 1YG2A 5IOZA 3VYTB 2NNYA 4DW6A 4IHXA 1XGOA 4FE4A 3ZQQA 2PJRB 2ZSIB 3ZQCA 3J80K 5IYBJ 1HDDC 1X3ZB 4H0EA 5DS9A 4U88A 1R6RA 1O57A 3PQKA 3FXLA 3BPVA 4X1EA 1X1DA 1TQIA 1LUJB 4S04A 3A03A 5L3EA 4XQFA 3OYGA 1APLC 2CQXA 2CW0F 2EA4A 2PEXA 3IWFA 3FIWA 1FBUA 3MKWB 2VXZA 3S15J 4M6XA 3LSIA 4A3EJ 4E7LA 2JN6A 5FROA 5CVVA 1GVDA 3G6EI 1AHDP 2PX9A 3DPUA 2EZIA 3LQRA 3H5AA 4ZYDA 1JHHA 3BJOA 4MHGA 5GAGJ 3AKZA 2F4IA 2KZGA 5C4JJ 5LGUA 3JSOA 4XLNF 3HOXJ 2CQNA 5IYDJ 4BDZA 5EGOB 1SVLA 3BJ6A 5EJCA 4BS9A 2GZWA 2LREA 1FSEA 1Y1WJ 3OOUA 1OFCX 1MBEA 1STZA 1OPCA 3DU6A 5KAFC 1G59A 2VJ5A 2P4WA 3LFUA 2JMWA 2WV0A 1WJBA 2LF7A 3CF2A 4NBQA 4BXUA 3J81K 2X1CA 2A69F 4IF4A 2IAIA 5HLTA 1BL0A 3NQOA 4I0AA 1BA5A 3I5UA 3CCQI 2PBIA 4HQMA 1MBFA 2A3SA 3OYEA 1U78A 2IS6A 1IN4A 4ESFA 4PSXA 4EM0B 3T0YA 4F3QA 3KP2A 4M3BA 4CZCA 5C44J 3TW7A 5IT9Z 1BR1A 2KRHA 5M5WJ 3LSGA 3GFLA 3ZPLA 2DQRA 1QHGA 1Z21A 2MYSA 5DV5A 5E1WA 1P4WA 1IAWA 3S2DJ 2ZBKA 4IRIA 4G7OF 1LNWA 1Y6IA 2MLKA 1R00A 2LF8A 2DA7A 2W57A 2IA2A 3A0BC 4L5JA 1FC3A 1PP7U 3BG7A 3OYHA 1XMKA 3OYLA 3RKQA 2JJ7A 3ASNH 4PJ0C 1JT6A 4RGSA 1OISA 2RREA 3IUOA 5FLXZ 2VJIA 3KZIC 3I59A 3SDBA 3H9JA 3WTSC 2Y31A 1IF1A 1Y39A 3P9IA 1XD7A 4BE2A 2FOKA 5GPCA 3BOQA 4OIQF 3H1CA 2VT2A 2FBKA 2OC6A 3RPQA 1QZZA 3OYBA 4FTHA 5E8GA 1T56A 3HC7A 2DA3A 3HRSA 5K5OA 1CGPA 3IRRA 3AL0B 4QTRA 2XVCA 3OIQA 3W6JB 1R1VA 1D3YA 4M3EA 5FO5A 3FK6A 3GTQJ 3T8RA 2L02A 1U6GA 4RDUA 1X3UA 4G6DA 3M4OJ 2Y48A 1V4RA 2VN2A 1OCRH 1T95A 5JLWA 4KN7X 2L0KA 4M3FA 4S0HB 4HLXA 3GZNB 1MBHA 4GCVA 1CF7A 4A2UA 1BR2A 3QYFA 4DYQA 2OTLI 2V26A 1QZEA 3AG3H 2IGNA 4E7KA 3WE2A 2R7XA 5LHGA 4HW0A 1X58A 2FBIA 3K2AA 4PDKA 5D6FA 2K4JA 5GTHC 2VONA 2E1MB 1WI3A 2R3SA 5F27A 1O4XA 4HF2A 3TP0A 1HF0A 1P2FA 2EPFA 4I98B 3WGIA 2O3FA 3K1PA 4JQFA 2IS4A 3WGGA 4DZPA 1ZRFA 1RNLA 4DYRA 3D1NI 2DA6A 2A07F 2LY2A 3BP8A 3DTIA 3SZTA 3RIRA 1B59A 5M3MJ 4XLCA 2O6GE 1U8BA 3K70C 2BY0A 3HDDA 2QLZA 5JHFA 1KZHA 2YUSA 2EV5A 3VFZA 3K9TA 1X2NA 3S14J 1FBQA 1RPWA 2M0MA 3ESWB 1BC8C 2EILH 3GCMA 2BW3A 4IOAF 1G3YA 2CUEA 1ZGJA 2W4SA 5CQGA 5EGOA 3R61A 3CMEI 4XL9A 4HA8A 2NVTJ 4YIRX 1RIOH 2E5ZA 2F5FA 2JA7J 2QCOA 2FEZA 1E3HA 1ZLJA 3V4GA 1MJAA 2HTJA 2FQ4A 2GIVA 3K4NA 4ABZA 1YTYA 2DODA 4IHWA 5K7ZA 1XG1A 4LLLA 3LAJA 1J7KA 5IP9J 4E7JA 2L9SA 2XB0X 2CO5A 4FISA 3LOCA 2W48A 3DV8A 4M72A 4PGGA 4HSRA 1U5TC 1S5LC 1DU0A 1PUFB 3L00A 2XPUA 1FMVA 3P9CA 1X1BA 4DGWB 3OYNA 4AVPA 1X1AA 5K1YA 1VQPI 2QQBA 2VT3A 4I01A 1DPRA 3E3VA 4KYWA 4GYIA 3IKTA 1FJLA 3KP3A 2OU2A 1L0OC 1T0FA 1BR4A 1QBJA 2PJRA 1JHFA 3HKZA 5J8CA 3FXUA 2V79A 3HEFA 4P5OA 5EG0A 3HPGA 3RKYA 4GFBA 4OOIA 2Z9OA 2LTPA 1TNSA 3DCFA 4ZYHA 5ILUA 2HPIA 4I7HA 2B9SA 1OR7C 2DT7B 2OTJI 3PFIA 2WB1N 4II3A 4P9UA 2FF4A 2M34A 2ICWG 3HG9A 4DBQA 3WTYC 1JJ6C 2FRHA 1FNNA 2L5QA 2MFZA 1R5HA 3KYLA 2ZFUA 2B63J 4A69C 1I27A 5EEGA 1U3EM 1N77A 1FIPA 4E4HA 1OCCH 1IDYA 1P4XA 3F21A 1S29A 1QNTA 2HOAA 2E1NA 4XLPF 3CP2A 4YIFA 2R4GA 1Q1VA 1XCBA 2H6BA 5CVJA 1ZAOA 3CMYA 4RLFA 2Z33A 3F8NA 4A3CJ 2HGCA 4BQOA 3L2UA 3BPXA 1I6HJ 1BI2A 3X2QH 2YSRA 4XKCA 2DYSH 4YG2F 3CMAI 5L3FA 2COBA 4V19K 2I8DA 4UUSA 3I55I 5D5VB 1NHAA 3M1CA 1LVAA 5AIQA 4JX6A 3KP4A 5JLXA 2MBFA 5M5YJ 3FISA 2MC4A 4IZZA 4IEJA 5FFXA 3OSFA 3DPLC 1G2HA 2VOPA 3TL4X 2W84A 1NK2P 2ZXHA 3TOBA 1WHUA 4WCGA 4EJUA 3JRFA 2NVQJ 2MGQA 3O8HA 4NUBA 2R5ZB 2E7WA 3GXOA 2RKHA 2FOWA 4E6KG 3P7NA 5E20A 2M1BA 3WU1B 2DOEA 3J80Z 5HNFA 3HTSB 1WJAA 1Z91A 2PMUA 4C2TA 1HA8A 3VWBA 1IRFA 4ZC3A 4M6VA 3M07A 4WF2A 1KONA 2LMDA 1Z7UA 2VC1A 1IGNA 2LNBA 1A04A 4B47A 1D0XA 3GBGA 4U0YA 4M73A 3M9AA 2TCTA 1GVJA 2GIZA 1IN6A 1Z3YA 3Q0VA 3LSJA 5GADJ 4FX4A 1FOYA 3FHNA 4JP0A 3QRFF 2QGUA 3HUGB 3RDIA 1V54H 3W2AA 2JUGA 2W82A 4DBRA 5GP9A 3G73A 1FZPB 1P7JA 1LKXA 4B48A 1BC7C 3H9QA 4RAFA 1FSHA 1EA3A 3B73A 3OY9A 2ZSHB 3HYIA 5F0FA 3HOUJ 3NRVA 1W4MA 4OU0A 2CGPA 1O7LA 1Q1HA 3QAHA 2K86A 1QA6A 5GTIC 2XRLA 2LY1A 2X4HA 4EJVA 2ZXWH 3V8JA 3WGHA 2UWMA 3ZN1A 3QP6A 5DUKA 4I99C 4BH9A 3PQJA 4OWRB 1J2XA 1G6NA 5DM6F 1UG0A 1TL8A 1LEAA 2NS7A 4PGHA 5ICCA 4IXAA 3KLNA 5LRRA 4CA0A 3EYYA 4ZTFA 1QVUA 1R4MB 2WTEA 4R79A 3ABMH 2DK5A 2FX0A 2IS1A 3GW2A 3M8EA 4MEXF 5ED4A 4JK1X 3GTMJ 2M5WA 2F5CA 2GBYA 1H9TA 2V9KA 3FKJA 2ZCWA 4C9YA 4NQWB 3MFKA 4OIOF 2Q8KA 2ELKA 3DTKA 4WXHA 3MCZA 1WJCA 1MJ9A 3FXKA 5L3CA 1SEUA 2VPLA 4BBSJ 2FNPA 2VUMJ 3I4PA 3LMMA 2COMA 2DFIA 3E7LA 1YI2I 5A2QK 3DLAA 2Q1ZB 3BTJA 2JTVA 4AC0A 3CC2I 3OYIA 4LB5A 2LFBA 1TW2A 3R60A 4MO7A 3K1MA 2E1OA 4M3DA 4BBRJ 1T38A 3JRBA 2IA1A 1D5YA 1V5FA 1VNDA 3PNTA 4XNFA 2DCEA 4G9YA 2JWTA 5J1YA 3ML6A 5E79C 4QWQA 3S3NA 1UG2A 2MA3A 2VQCA 5ICFA 3V8LA 1PDNC 2QBYB 4X0GA 2PG4A 5DUIA 1MBJA 4EM2A 3N4MA 2HZDA 5DCMA 3F3XA 3L2CA 1IXRC 4QPQA 4U7DA 2A6HF 4BXXJ 5IYCJ 4ANJA 4W97A 1K78B 2HNHA 2OBPA 2KIUA 3BROA 4ESJA 1DDNA 2K9NA 3PSFA 1W1WE 1BN5A 1HLVA 1BM9A 4KT6A 2A6TA 4JOMA 4AIDA 1TT5B 1WJFA 3ZCOA 3D5LA 1FEXA 2DMQA 2E36A 5D4SA 1ORKA 2XAUA 3ABLH 4XR6A 3TBIA 2NVUB 4RGRA 2DO7A 1FX7A 1NTCA 2OF7A 2V1DA 4AWXB 3HKZN 4MGRA 4FCYA 3DXJF 2JPBA 3KEOA 4BEHB 1RUOA 1SMTA 5CJ9A 4ZDLA 4LIVA 1TTYA 5LD2C 3I53A 4DIQA 4E70A 4YELA 3C2BA 4RB2C 1GDTA 3BR2A 4B43A 3HSEA 5C4XJ 3ISPA 4N9HA 4L18B 1V55H 3BG3A 4P1WA 2A61A 1YS7A 3E6CC 3IRQA 3S1MJ 3A2KA 2IS2A 4EJTA 1XCVA 3NEUA 5EEHA 1IZ1A 1TWHJ 2CW7A 2FNAA 4Q48A 1YIJI 5HDKA 1B9NA 2H94A 2E1CA 2XKPA 2HDWA 2HZTA 2DXIA 1REPC 4A3KJ 1AA7A 1I3QJ 1I6XA 5FFZA 4I02A 1SD4A 3W3CA 2L3DA 5KK1A 2B7EA 2Z1DA 3ZP5A 5F08A 1FOKA 4ZH4F 4IQ4A 1JUSA 3MKLA 3CDHA 3KP5A 4HOBA 1D1AA 4KMUX 1K7AA 4FT8A 1DPUA 2W25A 3ASOH 4HNUA 4XMYA 3A0HC 1O3QA 3VOEA 1FTTA 2HFHA 3RCOA 5FKKA 3AFHA 2KFDA 3LSHA 4MQ9F 1FT9A 4HX7A 3ZQ7A 5IP7J 4IQJA 1EH7A 2R7QA 3VB2A 3CO7C 1BOAA 5F6FA 3K0LA 4CUGA 2R7WA 1IXSB 4PJMA 4HZFA 3NWTA 2GAUA 4XKVA 5DEQA 1TW3A 1SVOA 2M45A 3HOYJ 2M3AA 1B9MA 3QODA 2XAHA 2BGCA 3IP4B 3BT9A 2L9RA 4HAMA 3CJRB 3PNYA 2DDAA 4DOZA 4EMSA 3HOVJ 1A5JA 1H89C 5B1BH 2DFHA 3EYIA 5CPRB 2ID6A 5E18F 3G1OA 1YFHA 2H8WA 1U5TA 3WU2C 3TEDA 1MGTA 5H2FC 4HX4A 4AU7A 3K10A 1H8AC 2BHYA 2ETHA 4WWCA 1VQ5I 4Z6YA 2DU9A 4AD9A 1MNEA 1YW8A 3BCAA 4KICA 1LDJA 2BHZA 2F5DA 3HSFA 2R7FA 2AXTC 2VPRA 2HI3A 1FP2A 2YPRA 5E3NA 2PI0A 2G7HA 4EGYA 3L09A 3HOZJ 1ZG1A 4HPQA 1I39A 2ZC2A 1JXSA 3CQZJ 2Y0MA 2X6XA 2P7CB 1X4PA 4A0YA 4A3FJ 4G12A 3OIPA 5J4VA 2DW4A 3ZMSA 3GTJJ 2KDZA 1ODDA 2IGMA 1TWCJ 4C2UA 5DCMB 1G3TA 3A01B 1OYWA 1A6IA 5F0HA 1YIOA 1YX3A 1ZGWA 4HLYA 1JKQC 4EGZA 2NRAC 1BI1A 1UELB 4LD5A 4OINF 3I9V2 4ENKA 3CLQA 4O6JA 2L9NA 2ZB9A 2VBWA 3ZRGA 2BVLA 2VKVA 3UNGC 2LG4A 4QIWN 4RAYA 2XRNA 3QU6A 3VSLA 1GUUA 4ASNA 3PM1A 2XF7A 3ONQA 1OYYA 4MIMA 3S16J 4MFEA 4CICA 2OUMA 2RQQA 4JX5A 4KT5C 3O8GA 1TC3C 3KZYA 4PJNA 5GPAA 4B09A 2ZMEA 3KLOA 5B1AH 5GAHJ 5HOOA 2LKPA 4LLNA 5E17F 3OS1A 3LWFA 4I2OA 3DEEA 2ADUA 4KA4A 2TDXA 2FE3A 1D1CA 4A5MA 1JTYA 3TMOA 5ERIA 3J7YJ 2G0EA 3I59B 4NQWA 2EK5A 1WCMJ 5BS6A 2CH0A 4GYGA 4CYCB 2M2EA 1IN8A 1B72B 1IW7F 1OCOH 3TO6A 1LB2A 1QRYA 2MD0A 1VQ7I 2RVCA 4XRSG 3CCMI 3IWZA 5H20A 5HS9A 1M1EB 4A3IJ 1SMYF 5ILVA 3R0JA 2HQRA 3A4CA 2QKMB 3OV8A 3IAM2 2AQFA 1SFXA 3CCJI 3SDGA 2L9VA 2XUBA 4KDPA 1R58A 2L54A 2O7OA 2YX4A 3FF5A 2VODA 2CQ7A 1Z77A 3RPUA 2W85A 2CV2A 2XGEA 2ESHA 3BWGA 4BAYA 1LFPA 1K6YA 4JBAA 4KFCA 3HL2A 2XAGA 3FBIB 5LLQA 4MFDA 1GXPA 2VL8A 4J00A 1X3WB 2GLOA 3ZQHA 1HKSA 1BI0A 1WGXA 2JA2A 1YQAA 5LGNA 2IA0A 3I54A 2LBFB 4XRMA 1JKOC 4IKFA 1N78A 4XBFA 4XOPA 3ECHA 3FX3A 2J5OA 5KNLA 3SEQA 2CFOA 5DTDA 2EWNA 2WWYA 2M87A 3ZN0A 3AL0C 3KETA 1Z7LA 2ZMEB 2DMUA 1YITI 3KEQA 2RGVA 2R92J 2G9WA 1R49A 4EV0A 2VE9A 3T1BA 1LE8A 2ACJA 4L5IA 2Z3YA 1D0ZA 1J5YA 2OPTA 4RB0A 4BXFA 5F1JA 2EJRA 2NS0A 1A6QA 3PNVA 5FGMA 3MKYB 1X19A 5LRSA 3L2RA 1U0JA 2IEKA 1UAAA 6PAXA 4P9FA 4L0ZB 3SQNA 3M1EA 2VC0A 4EJOA 2QM3A 4IPAA 4ITVA 4LOCA 4I6ZA 3BZ6A 2A05A 3K4MA 3G4SI 2HQ5A 3GMEA 3CLOA 1KU2A 4WXDA 4BQAA 3PL8A 4NHJA 2QSFX 3JTHA 4Y15A 1UHWA 4A93J 4LFUA 2WB1A 1NK3P 4FASD 5JVTA 3F0CA 5KHDA 4XN0A 2ID3A 4BACA 1U8RA 1KQ8A 3GEZA 4CZZA 1BW6A 4LG0A 5K7FA 3B6AA 4CXFA 4XN3A 3TDUC 3LNQA 3CO6C 4ZDOA 4JX4A 1K61A 1KQ0A 4XLAA 4ZTJA 3M3YJ 4OAYA 1YHQI 1IN7A 1YS6A 2QA4I 4UVAA 5L3DA 4B8XA 1MH4A 3DWLE 1S72I 1YJWI 4F92B 4U0VA 2STTA 4RAZA 1U5TB 2EZHA 5HLGA 1I1GA 1MMGA 3WODF 2DJIA 1OYIA 3KP6A 2F2EA 3Q0WA 2PLYA 1P92A 5B66C 4IRHA 2PN6A 2AO9A 1F9NA 2XDVA 4PZJA 2MLGA 2ZKZA 1OR7A 2CFXA 3GTOJ 3I58A 2KPMA 3JAMZ 1PUEE 4PSWA 3TW6A 1BI3A 1IG7A 1A31A 3TKYA 1XTAA 1Z1DA 2EZLA 5EZGA 3JRAA 2R7UA 3S93A 1S7AA 3S1RJ 3RQ4A 3FK7A 5FD5A 4RB3C 2R7OA 3M7GA 4YFXF 4BJTA 1Y1VJ 2WAEA 2VBXA 2KJCA 1UZCA 2CUJA 1WH5A 4F93B 1D1BA 3H9GA 3L2VA 5TGTA 3PJRA 2ZMEC 1USTA 2JZYA 1X1CA 2RAEA 1LFBA 3RJPA 4A3GJ 2I10A 3BZCA 1RESA 2LD5A 3SXYA 4AIHA 2JVGA 2QVOA 1J75A 1WQ2A 1FTZA 2HKXA 3OS2A 1LEBA 3WU0A 2BW3B 1WKMA 2K3FA 9ANTA 3CZ6A 3QYBA 4DYCA 3S3MA 3KIOA 2GXBA 3HRUA 3Q9VA 5C3EJ 1FPQA 2F6CA 2X6OA 1R1UA 1MIJA 4XSZF 1IDZA 1V5EA 3HSRA 3MN2A 3I56I 4CCMA 1T8IA 1R5ID 1X4OA 2R93J 2W24A 1QQIA 2E1MC 2HTSA 2VIXA 1UMQA 4NNJA 2KT0A 3UKGA 1XS9A 3K7AJ 4B4CA 2YR2A 3BY6A 3SHFA 3M8FA 4YIIA 3F23A 2Z99A 1W5SA 4G6QA 1IUFA 2L7KA 4I0BA 3TOAA 4MNUA 3ZQGA 1RETA 1AKHA 1F43A 3QYEA 1QPMA 2P5VA 1ULYA 2QKLB 4BEHA 1KU9A 5JVGF 1FIAA 1FLIA 2DI3A 3K69A 2HU9A 4B3AA 1WWXA 3O2PE 3JR9A 3KE2A 3HRTA 2Y30A 4E7ZA 2NOJB 1TQMA 4N4OB 4D0PA 4CCOA 4LLGF 2NVYJ 3GTPJ 4EVIA 4C3IJ 1KQ9A 1XMXA 1LFUP 4A3LJ 3ZQIA 2G7UA 1MNMC 2BY3A 4HG2A 3PIOF 3GTKJ 3O3KA 1TNTA 1RC9A
chains in the Genus database with same CATH topology
5LEKA 4HYEA 4MQVA 2P5KA 3CUQA 5BOXA 2UXNA 3HOTA 3ELKA 4KMFA 1I5ZA 3TQNA 1R22A 5L3GA 2O0YA 2YU3A 3V7CA 3GF2A 3GLXA 1ZN2A 2ESNA 4FX0A 3WTWC 3RYRA 5BQTA 3F72A 4ON0A 2ZJ2A 2IVMA 2EFNA 3WTTC 5HDGA 3SFZA 2FQ3A 2EFWA 4F7ZA 5D6EA 3U2RA 5JI6A 2OQRA 3F8BA 2BV6A 5ICGA 4WX9A 2HKOA 3TGNA 4M71A 1T6SA 4MEYF 3IKVA 5K5QA 3E5XA 2BBYA 2IW5A 2XIGA 1S3JA 2PQ8A 1E17A 2DBBA 1XDSA 4UV8A 1HW2A 3QU3A 3F8MA 3ZMDA 2HOEA 4U0WA 2HYFA 2KJBA 2QQAA 3MEXA 3WG9A 3EUHA 4GO1A 1XGNA 2P6TA 3ERED 2QUFA 5D5UB 2V9VA 3B02A 2QENA 2V1XA 4L0YB 4A12A 1BBYA 1FYKA 2EV6A 5LHHA 1WSUA 1SD7A 1KYZA 1SFUA 2ISYA 2P7VB 3S2WA 3HUGA 1SD5A 4UUVA 4R8HA 2VBZA 5H6RA 3E6DA 4KIGA 2GA2A 2XHKA 1LQ1A 4BNCA 1B6AA 4LG0B 3QPTA 2OZUA 3V8KA 4HF1A 4AIJA 4LJZF 3WTUC 1ZH5A 3GVAA 3GZ5A 1KU3A 3LAPA 3RYPA 4Q4ZF 3ECOA 5D5XB 2CQKA 2DQLA 3VEPA 4Y13A 3CTAA 1O3TA 3FHZA 2QQ9A 2OQGA 3WTZA 1ZYRF 4IVNA 1UCRA 4MTDA 4RGUA 1VTNC 1ZRDA 1R1TA 3TO9A 2DPUA 4M6YA 3DP7A 1F4KA 5FLXK 1HW5A 1Z6TA 2ISZA 3DF8A 3R0AA 3P9KA 5KVRA 1HKQA 4KNYA 3GUDA 4DNCA 3H3UA 2MH9A 4S05A 2XKOA 2MD5A 5HVQC 4G8XA 1QO0D 1PP8F 2NNNA 5DYMA 2XROA 5HLIA 4ZYEA 1LDKB 2GWRA 3H92A 3ZMUA 1T39A 2DPDA 4NB5A 3SZPA 2PJPA 1WRJA 4G7ZF 1DP7P 2CSOA 1O3SA 1TQPA 2L01A 3F22A 3TO7A 3JSPA 3T8TA 2Q0OA 1EV7A 2BE5F 1YYVA 2E7XA 3E5QA 4YFKF 3U9GA 1OKRA 2CYYA 3ZMTA 4ENMA 3KCCA 4Z2YA 1CF7B 3WTXC 1HXDA 3Q5FA 2DT5A 1HSTA 1T2KA 4P55A 1H0MA 3MAJA 4A6DA 3AAFA 4DQ2A 3DFGA 3C1DA 3MQ0A 1SD6A 1UB9A 4ENNA 1HBXG 2FXAA 4N0BA 1R5GA 4RB1A 2HWVA 5D4RA 1O3RA 2LSOA 1IRGA 5LEJA 4G94A 2BYVE 1XSDA 2Q2EA 2EA2A 1U2WA 4L9NA 3F6OA 3QOPA 1RI7A 1R36A 2D1HA 2DTRA 3HIFA 3C7JA 1XN7A 1XSVA 2EFOA 1AOYA 2Y75A 2Z5UA 4G7HF 1BJAA 1TLHB 2XAJA 5E1XA 2K7LA 4U7BA 2L4MA 3FMQA 1HQCA 3F6VA 1KU7A 1DUXC 3VODA 2HDCA 4RGXA 1O7FA 4A5NA 1XMAA 1HSJA 4I09A 3DQVC 3CJNA 3O6BB 1ZG3A 1FP1D 2ZXJA 3DKWA 4A6EA 1HKTA 3C18A 2HR3A 3IC7A 5TJJA 4LK0F 4BHCA 1R23A 4HV6A 4TV7A 3T5XA 5DDGA 2K02A 2VE8A 2V1UA 1OMIA 3W6KB 3Q9SA 3MWMA 1HW1A 4IRGA 3FMSA 1AWCA 4ESBA 1Z9CA 5TRDA 5LGTA 1XGSA 5D8KB 2HQNA 3D0SA 3RKWA 1FBSA 3LA7A 2LDUA 1B4AA 5BPDA 4ETSA 4KIBA 3KFWX 2EB7A 4O5VA 5IT9K 4CHUA 4GGGA 2CG4A 3ABUA 5LBQA 1ZREA 1USSA 2K4BA 5DCFA 2FSWA 2QZ8A 4RS8A 3J81Z 1JE8A 2DK8A 2A6EF 4ENJA 5AIPA 2FU4A 4HBLA 2RN7A 2EV0A 3C3WA 2JRTA 3FXRA 3HHGA 3V7SA 5J6XA 1B1BA 2AS5F 1EH6A 3E6BA 4KIFA 1G3SA 4FHTA 4HQEA 4Q5SF 3RKXA 2V6CA 1S7OA 3RTRA 2ZNZA 2IRFG 1W5TA 1YW7A 2VBYA 3J7AO 1L3LA 3WTVC 5DD8A 5HLHA 3QP5A 2GXGA 1KYWA 4P96A 1D8KA 2PMHA 3GZ6A 1GHCA 3HHHA 5CVUA 2OZ6A 3BJAA 2A5YB 2UXXA 3U1DA 3LQQA 1Y0UA 1MDMB 1ZLKA 5CYVA 1F5TA 2WC2A 4XSXF 2STWA 1LJ9A 2EFQA 2GA1A 2P5LC 5CLSA 1MJBA 2M8EA 2L4AA 4M9SA 3N97A 1ZGAA 5AONA 2YX7A 3FZVA 3MZYA 1QGPA 2HYGD 3MZHA 2M30A 4UV9A 2H27A 5FD6A 4LK1F 3ULQB 1H9GA 5J8FA 1W7PA 4HF0A 4HDUA 5DD4A 2HEOA 4A0XA 4UXNA 2OAZA 3F8CA 2KIMA 5ILSA 1UFMA 3K1NA 2FA5A 2NYXA 3FMRA 4XRFA 1BIBA 3ZMVA 4MTEA 2VOOA 1J59A 5JFRA 1P6RA 3RI4A 2FBHA 3I71A 1XSXA 2F5EA 5JHUA 2ZNYA 2IPQX 4IHTA 2XAQA 2QWWA 4WXCA 2RNJA 1MKMA 5IT3A 3GFIA 4CO8A 2CWEA 2QYOA 2A68F 1ON1A 2D45A 2H09A 3ZMZA 1ONVA 3IHUA 3COAC 2O03A 2FMYA 4BYYA 4LMYA 1BIAA 4ZYGA 2P6SA 4LGWA 3LA2A 2KKOA 4L9JA 1G3WA 4IJAA 4HX8A 1C0WA 3FM3A 1MD0A 5L3BA 1ZHFA 3H3ZA 4L9VA 1FY7A 3ROUA 5HDNA 3QPHA 3LFKA 4AIKA 1RUNA 5D8LB 3CUOA 5ICEA 2OA4A 4EM1A 1K79A 2XV4S 2FMLA 2K27A 3DPTA 2MH2A 1WI9A 3GX4X 1YO5C 3E5UA 3REOA 1ZG5A 2RQPA 1J0RA 2MC3A 5F64A 4KUMA 1IUYA 1YLFA 4CDGA 1V3FA 3EDPA 1ZRCA 4CYDA 2IT0A 1P4AA 2X0LA 1S6LA 4Y17A 3JAMK 3GWZA 5H6QA 3TDZC 1FYLA 3LSTA 2C6YA 1JGSA 2HS5A 2IP2A 5LHIA 1W7PD 3FM5A 4YFNF 1K6OA 2R7DA 3IL2A 3FXQA 2JSCA 4OIRF 4QLCU 3KP7A 5FB2A 2DAOA 2B0LA 1LDDA 1IN5A 2JPCA 5HS8A 1D8JA 3GFMA 4BHPA 4OMYA 3L9FA 3JW4A 3CUQB 1UHMA 1K78A 1W7PB 1IXCA 3E6MA 4WK8F 5HS7A 3EETA 1J9IA 2O61A 3I64A 1Z6RA 1KGSA 4UVCA 3CUQC 1SFEA 3BDDA 2RV8A 2QBYA 1TBXA 1T98A 4ZZDA 4HDVA 1D5VA 2JT1A 3GFJA 5K5RA 4UVBA 2GQQA 4GXOA 5A2QZ 3V7RA 1XB4A 3WE3A 4EJWA 2BEOA 4O3MA 2EFPA 4Q47A 2KRFA 1MDMA 2XAFA 4L9TA 1GXQA 3L7WA 3JTGA 3HOSA 4A0ZA 1Z05A 3G3ZA 5JR3A 1QZYA 1SAXA 2O8XA 5BMZA 1FWZA 4UHTA 1G4DA 1E2XA 2ZO4A 3K2ZA 1ZARA 2OD5A 4IHSA 5E1ZB 3R4KA 4N9IA 2UZKA 2XASA 3E97A 5F1RA 3F8FA 5D5WB 2DLLA 1MZBA 3HTUA 1FYMA 1YW9A 3FWEA 5BPIA 4M74A 4CGZA 2D2WA 1XDUA 5E8IA 1ON2A 4OMZA 1R7JA 4EQQA 4K2EA 2ZFWA 3EQLF 3OOPA 2AXLA 1XGMA 3KZZA 3GO5A 2RDPA 4M9ZA 4ZZLA 1F1ZA 2XGXA 4LB6B 3LA3A 2IJLA 3ABTA 3GYHX 5CVRA 4UNOA 2H6CA 4BHBA 1RZ4A 3I0TA 3R6SA 5CVIA 2P8TA 2KIFA 1S8NA 2D1VA 4M9XA 3HRMA 2NAZA 2J5PA 3DEUA 4HV5A 4OIPF 2PFBA 1I1SA 2ELHA 2RC4A 1KA8A 4PCQA 4R1HA 4KN4X 1EH8A 1YG2A 2NNYA 1XGOA 3J80K 4H0EA 4U88A 1O57A 3PQKA 3BPVA 1TQIA 4S04A 5L3EA 2CW0F 2EA4A 2PEXA 3IWFA 1FBUA 2VXZA 4M6XA 5CVVA 3LQRA 4ZYDA 1JHHA 3BJOA 4MHGA 5LGUA 3JSOA 4XLNF 3BJ6A 2GZWA 1FSEA 1STZA 1OPCA 2P4WA 2WV0A 2LF7A 4BXUA 3J81K 2A69F 4IF4A 3NQOA 4I0AA 3I5UA 2PBIA 4HQMA 2A3SA 1U78A 1IN4A 4ESFA 4EM0B 3T0YA 3KP2A 5IT9Z 3GFLA 3ZPLA 2DQRA 5E1WA 5DV5A 1IAWA 1P4WA 2ZBKA 4IRIA 4G7OF 1LNWA 2MLKA 1R00A 2LF8A 2W57A 2IA2A 4L5JA 1PP7U 1FC3A 1XMKA 4RGSA 5FLXZ 3I59A 3WTSC 1IF1A 3P9IA 1XD7A 2FOKA 3BOQA 4OIQF 2VT2A 2FBKA 3RPQA 1QZZA 5E8GA 3HRSA 5K5OA 1CGPA 3IRRA 2XVCA 3W6JB 1R1VA 1D3YA 5FO5A 3T8RA 2L02A 1U6GA 1X3UA 4G6DA 2Y48A 1V4RA 2VN2A 4KN7X 1CF7A 4HLXA 4GCVA 4A2UA 3WE2A 5LHGA 4HW0A 2FBIA 4PDKA 5D6FA 2K4JA 2VONA 2R3SA 4HF2A 1P2FA 4I98B 3WGIA 2O3FA 3K1PA 4JQFA 3WGGA 1ZRFA 1RNLA 2A07F 3BP8A 3SZTA 3RIRA 1B59A 2O6GE 2QLZA 2EV5A 3VFZA 3K9TA 1FBQA 1BC8C 1G3YA 1ZGJA 3R61A 4HA8A 1RIOH 2F5FA 2FEZA 1ZLJA 3V4GA 1MJAA 2HTJA 2GIVA 1YTYA 4LLLA 3LAJA 1J7KA 4PGGA 2CO5A 4M72A 3DV8A 1U5TC 3L00A 3P9CA 4AVPA 5K1YA 2QQBA 2VT3A 4I01A 1DPRA 3E3VA 4KYWA 4GYIA 3IKTA 1QBJA 3KP3A 2OU2A 1L0OC 1T0FA 1JHFA 5J8CA 3FXUA 2V79A 4P5OA 3RKYA 4OOIA 2Z9OA 1TNSA 4ZYHA 5ILUA 4I7HA 3PFIA 4P9UA 2FF4A 3WTYC 2FRHA 1FNNA 1R5HA 1U3EM 1I27A 5EEGA 1P4XA 3F21A 1S29A 1QNTA 2E1NA 4XLPF 4YIFA 1XCBA 2H6BA 5CVJA 1ZAOA 2Z33A 3F8NA 2HGCA 3BPXA 1BI2A 2YSRA 4YG2F 5L3FA 5D5VB 1NHAA 1LVAA 5AIQA 3KP4A 2MBFA 5FFXA 3DPLC 2VOPA 2W84A 3TOBA 4WCGA 4EJUA 2E7WA 3GXOA 2RKHA 3P7NA 5E20A 2M1BA 3WU1B 3HTSB 3J80Z 1Z91A 2PMUA 1IRFA 4WF2A 1Z7UA 2VC1A 2LNBA 1A04A 4U0YA 4M73A 3M9AA 1GVJA 1IN6A 4FX4A 3QRFF 3RDIA 3G73A 1FZPB 1BC7C 1FSHA 3B73A 3HYIA 3NRVA 1W4MA 4OU0A 2CGPA 1O7LA 1Q1HA 3QAHA 2K86A 2X4HA 4EJVA 3V8JA 3WGHA 2UWMA 3ZN1A 3QP6A 5DUKA 4BH9A 3PQJA 1J2XA 1G6NA 1LEAA 4PGHA 5ICCA 4IXAA 3KLNA 5LRRA 3EYYA 2WTEA 4R79A 2DK5A 3GW2A 3M8EA 4MEXF 5ED4A 4JK1X 2M5WA 2F5CA 1H9TA 2ZCWA 4OIOF 3MFKA 2Q8KA 4WXHA 3MCZA 1MJ9A 5L3CA 2FNPA 3I4PA 2COMA 2DFIA 5A2QK 2JTVA 4LB5A 1TW2A 3R60A 3K1MA 1T38A 2IA1A 4G9YA 3ML6A 4QWQA 5ICFA 2MA3A 3V8LA 1PDNC 2QBYB 2PG4A 5DUIA 4EM2A 3N4MA 5DCMA 3F3XA 3L2CA 1IXRC 4U7DA 2A6HF 1K78B 2OBPA 2KIUA 3BROA 4ESJA 1DDNA 1BN5A 1BM9A 3D5LA 5D4SA 4RGRA 2DO7A 1FX7A 2V1DA 4AWXB 4MGRA 3DXJF 2JPBA 3KEOA 1RUOA 1SMTA 5CJ9A 1TTYA 3I53A 4E70A 4RB2C 3HSEA 3ISPA 4N9HA 4L18B 2A61A 1YS7A 3E6CC 3IRQA 4EJTA 1XCVA 3NEUA 5EEHA 1IZ1A 2FNAA 4Q48A 5HDKA 1B9NA 2H94A 2E1CA 2XKPA 2HZTA 1REPC 5FFZA 1I6XA 4I02A 1SD4A 2L3DA 5KK1A 3ZP5A 1FOKA 4ZH4F 3CDHA 3KP5A 4HOBA 4KMUX 1K7AA 4FT8A 1DPUA 2W25A 1O3QA 3VOEA 2HFHA 3ZQ7A 4MQ9F 1FT9A 4HX7A 1EH7A 3VB2A 3CO7C 1BOAA 5F6FA 3K0LA 1IXSB 4HZFA 2GAUA 5DEQA 1TW3A 2M45A 1B9MA 2XAHA 2BGCA 4HAMA 4EMSA 3EYIA 5E18F 1YFHA 1U5TA 1MGTA 4HX4A 2ETHA 4WWCA 2DU9A 4AD9A 1YW8A 4KICA 1LDJA 2F5DA 2R7FA 2YPRA 3HSFA 1FP2A 2PI0A 2G7HA 4EGYA 3L09A 1ZG1A 1JXSA 2Y0MA 2P7CB 4A0YA 2DW4A 3ZMSA 1ODDA 5DCMB 1G3TA 1OYWA 1YIOA 4HLYA 4EGZA 2NRAC 1BI1A 4LD5A 4OINF 4ENKA 4O6JA 2VBWA 4RAYA 2XRNA 3QU6A 4ASNA 1OYYA 4CICA 4KT5C 3KZYA 4B09A 2ZMEA 3KLOA 5HOOA 2LKPA 4LLNA 5E17F 4I2OA 3LWFA 2ADUA 4KA4A 2TDXA 2FE3A 4A5MA 5ERIA 3I59B 4NQWA 2EK5A 5BS6A 4GYGA 1IN8A 1IW7F 3TO6A 1LB2A 2RVCA 3IWZA 5H20A 5HS9A 1SMYF 5ILVA 3R0JA 2HQRA 3OV8A 1SFXA 4KDPA 2XUBA 1R58A 2L54A 3FF5A 2YX4A 2VODA 3RPUA 2W85A 2ESHA 3BWGA 4BAYA 4JBAA 4KFCA 2XAGA 5LLQA 1GXPA 1HKSA 1BI0A 1YQAA 5LGNA 2IA0A 3I54A 4XBFA 3ECHA 3FX3A 2J5OA 2EWNA 2WWYA 2M87A 3ZN0A 3KETA 2ZMEB 3KEQA 2RGVA 2G9WA 4EV0A 2VE9A 3T1BA 2ACJA 4L5IA 2Z3YA 1J5YA 4RB0A 2EJRA 2NS0A 5FGMA 5LRSA 6PAXA 4P9FA 4L0ZB 3SQNA 3M1EA 2VC0A 4EJOA 2QM3A 4IPAA 3BZ6A 3CLOA 1KU2A 4WXDA 4BQAA 4NHJA 3JTHA 4Y15A 1UHWA 4LFUA 5JVTA 1U8RA 1KQ8A 3GEZA 4CZZA 3CO6C 4LG0A 4CXFA 3TDUC 1KQ0A 1IN7A 1YS6A 4UVAA 5L3DA 4B8XA 4U0VA 2STTA 4RAZA 1U5TB 5HLGA 1I1GA 3WODF 1OYIA 3KP6A 2F2EA 2PLYA 1P92A 4IRHA 2PN6A 1F9NA 4PZJA 2MLGA 2ZKZA 1OR7A 2CFXA 3I58A 3JAMZ 1PUEE 1BI3A 3TKYA 1Z1DA 1S7AA 5FD5A 4RB3C 3M7GA 4YFXF 2VBXA 2KJCA 1USTA 2JZYA 3RJPA 3SXYA 4AIHA 2QVOA 1J75A 1WQ2A 2HKXA 1LEBA 3WU0A 1WKMA 2GXBA 3HRUA 3Q9VA 1FPQA 4XSZF 1R1UA 3HSRA 2W24A 1QQIA 2HTSA 2YR2A 3BY6A 3SHFA 3M8FA 4YIIA 3F23A 2Z99A 1W5SA 4G6QA 4I0BA 3TOAA 4MNUA 1QPMA 2P5VA 1ULYA 1KU9A 1FLIA 2DI3A 3K69A 1WWXA 3O2PE 3KE2A 3HRTA 1TQMA 4D0PA 4LLGF 4EVIA 1KQ9A 2G7UA 3O3KA 1TNTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LEK A;  4HYE A;  4MQV A;  2P5K A;  3CUQ A;  5BOX A;  2UXN A;  3HOT A;  3ELK A;  4KMF A;  1I5Z A;  3TQN A;  1R22 A;  5L3G A;  2O0Y A;  2YU3 A;  3V7C A;  3GF2 A;  3GLX A;  1ZN2 A;  2ESN A;  4FX0 A;  3WTW C;  3RYR A;  5BQT A;  3F72 A;  4ON0 A;  2ZJ2 A;  2IVM A;  2EFN A;  3WTT C;  5HDG A;  3SFZ A;  2FQ3 A;  2EFW A;  4F7Z A;  5D6E A;  3U2R A;  5JI6 A;  2OQR A;  3F8B A;  2BV6 A;  5ICG A;  4WX9 A;  2HKO A;  3TGN A;  4M71 A;  1T6S A;  4MEY F;  3IKV A;  5K5Q A;  3E5X A;  2BBY A;  2IW5 A;  2XIG A;  1S3J A;  2PQ8 A;  1E17 A;  2DBB A;  1XDS A;  4UV8 A;  1HW2 A;  3QU3 A;  3F8M A;  3ZMD A;  2HOE A;  4U0W A;  2HYF A;  2KJB A;  2QQA A;  3MEX A;  3WG9 A;  3EUH A;  4GO1 A;  1XGN A;  2P6T A;  3ERE D;  2QUF A;  5D5U B;  2V9V A;  3B02 A;  2QEN A;  2V1X A;  4L0Y B;  4A12 A;  1BBY A;  1FYK A;  2EV6 A;  5LHH A;  1WSU A;  1SD7 A;  1KYZ A;  1SFU A;  2ISY A;  2P7V B;  3S2W A;  3HUG A;  1SD5 A;  4UUV A;  4R8H A;  2VBZ A;  5H6R A;  3E6D A;  4KIG A;  2GA2 A;  2XHK A;  1LQ1 A;  4BNC A;  1B6A A;  4LG0 B;  3QPT A;  2OZU A;  3V8K A;  4HF1 A;  4AIJ A;  4LJZ F;  3WTU C;  1ZH5 A;  3GVA A;  3GZ5 A;  1KU3 A;  3LAP A;  3RYP A;  4Q4Z F;  3ECO A;  5D5X B;  2CQK A;  2DQL A;  3VEP A;  4Y13 A;  3CTA A;  1O3T A;  3FHZ A;  2QQ9 A;  2OQG A;  3WTZ A;  1ZYR F;  4IVN A;  1UCR A;  4MTD A;  4RGU A;  1VTN C;  1ZRD A;  1R1T A;  3TO9 A;  2DPU A;  4M6Y A;  3DP7 A;  1F4K A;  5FLX K;  1HW5 A;  1Z6T A;  2ISZ A;  3DF8 A;  3R0A A;  3P9K A;  5KVR A;  1HKQ A;  4KNY A;  3GUD A;  4DNC A;  3H3U A;  2MH9 A;  4S05 A;  2XKO A;  2MD5 A;  5HVQ C;  4G8X A;  1QO0 D;  1PP8 F;  2NNN A;  5DYM A;  2XRO A;  5HLI A;  4ZYE A;  1LDK B;  2GWR A;  3H92 A;  3ZMU A;  1T39 A;  2DPD A;  4NB5 A;  3SZP A;  2PJP A;  1WRJ A;  4G7Z F;  1DP7 P;  2CSO A;  1O3S A;  1TQP A;  2L01 A;  3F22 A;  3TO7 A;  3JSP A;  3T8T A;  2Q0O A;  1EV7 A;  2BE5 F;  1YYV A;  2E7X A;  3E5Q A;  4YFK F;  3U9G A;  1OKR A;  2CYY A;  3ZMT A;  4ENM A;  3KCC A;  4Z2Y A;  1CF7 B;  3WTX C;  1HXD A;  3Q5F A;  2DT5 A;  1HST A;  1T2K A;  4P55 A;  1H0M A;  3MAJ A;  4A6D A;  3AAF A;  4DQ2 A;  3DFG A;  3C1D A;  3MQ0 A;  1SD6 A;  1UB9 A;  4ENN A;  1HBX G;  2FXA A;  4N0B A;  1R5G A;  4RB1 A;  2HWV A;  5D4R A;  1O3R A;  2LSO A;  1IRG A;  5LEJ A;  4G94 A;  2BYV E;  1XSD A;  2Q2E A;  2EA2 A;  1U2W A;  4L9N A;  3F6O A;  3QOP A;  1RI7 A;  1R36 A;  2D1H A;  2DTR A;  3HIF A;  3C7J A;  1XN7 A;  1XSV A;  2EFO A;  1AOY A;  2Y75 A;  2Z5U A;  4G7H F;  1BJA A;  1TLH B;  2XAJ A;  5E1X A;  2K7L A;  4U7B A;  2L4M A;  3FMQ A;  1HQC A;  3F6V A;  1KU7 A;  1DUX C;  3VOD A;  2HDC A;  4RGX A;  1O7F A;  4A5N A;  1XMA A;  1HSJ A;  4I09 A;  3DQV C;  3CJN A;  3O6B B;  1ZG3 A;  1FP1 D;  2ZXJ A;  3DKW A;  4A6E A;  1HKT A;  3C18 A;  2HR3 A;  3IC7 A;  5TJJ A;  4LK0 F;  4BHC A;  1R23 A;  4HV6 A;  4TV7 A;  3T5X A;  5DDG A;  2K02 A;  2VE8 A;  2V1U A;  1OMI A;  3W6K B;  3Q9S A;  3MWM A;  1HW1 A;  4IRG A;  3FMS A;  1AWC A;  4ESB A;  1Z9C A;  5TRD A;  5LGT A;  1XGS A;  5D8K B;  2HQN A;  3D0S A;  3RKW A;  1FBS A;  3LA7 A;  2LDU A;  1B4A A;  5BPD A;  4ETS A;  4KIB A;  3KFW X;  2EB7 A;  4O5V A;  5IT9 K;  4CHU A;  4GGG A;  2CG4 A;  3ABU A;  5LBQ A;  1ZRE A;  1USS A;  2K4B A;  5DCF A;  2FSW A;  2QZ8 A;  4RS8 A;  3J81 Z;  1JE8 A;  2DK8 A;  2A6E F;  4ENJ A;  5AIP A;  2FU4 A;  4HBL A;  2RN7 A;  2EV0 A;  3C3W A;  2JRT A;  3FXR A;  3HHG A;  3V7S A;  5J6X A;  1B1B A;  2AS5 F;  1EH6 A;  3E6B A;  4KIF A;  1G3S A;  4FHT A;  4HQE A;  4Q5S F;  3RKX A;  2V6C A;  1S7O A;  3RTR A;  2ZNZ A;  2IRF G;  1W5T A;  1YW7 A;  2VBY A;  3J7A O;  1L3L A;  3WTV C;  5DD8 A;  5HLH A;  3QP5 A;  2GXG A;  1KYW A;  4P96 A;  1D8K A;  2PMH A;  3GZ6 A;  1GHC A;  3HHH A;  5CVU A;  2OZ6 A;  3BJA A;  2A5Y B;  2UXX A;  3U1D A;  3LQQ A;  1Y0U A;  1MDM B;  1ZLK A;  5CYV A;  1F5T A;  2WC2 A;  4XSX F;  2STW A;  1LJ9 A;  2EFQ A;  2GA1 A;  2P5L C;  5CLS A;  1MJB A;  2M8E A;  2L4A A;  4M9S A;  3N97 A;  1ZGA A;  5AON A;  2YX7 A;  3FZV A;  3MZY A;  1QGP A;  2HYG D;  3MZH A;  2M30 A;  4UV9 A;  2H27 A;  5FD6 A;  4LK1 F;  3ULQ B;  1H9G A;  5J8F A;  1W7P A;  4HF0 A;  4HDU A;  5DD4 A;  2HEO A;  4A0X A;  4UXN A;  2OAZ A;  3F8C A;  2KIM A;  5ILS A;  1UFM A;  3K1N A;  2FA5 A;  2NYX A;  3FMR A;  4XRF A;  1BIB A;  3ZMV A;  4MTE A;  2VOO A;  1J59 A;  5JFR A;  1P6R A;  3RI4 A;  2FBH A;  3I71 A;  1XSX A;  2F5E A;  5JHU A;  2ZNY A;  2IPQ X;  4IHT A;  2XAQ A;  2QWW A;  4WXC A;  2RNJ A;  1MKM A;  5IT3 A;  3GFI A;  4CO8 A;  2CWE A;  2QYO A;  2A68 F;  1ON1 A;  2D45 A;  2H09 A;  3ZMZ A;  1ONV A;  3IHU A;  3COA C;  2O03 A;  2FMY A;  4BYY A;  4LMY A;  1BIA A;  4ZYG A;  2P6S A;  4LGW A;  3LA2 A;  2KKO A;  4L9J A;  1G3W A;  4IJA A;  4HX8 A;  1C0W A;  3FM3 A;  1MD0 A;  5L3B A;  1ZHF A;  3H3Z A;  4L9V A;  1FY7 A;  3ROU A;  5HDN A;  3QPH A;  3LFK A;  4AIK A;  1RUN A;  5D8L B;  3CUO A;  5ICE A;  2OA4 A;  4EM1 A;  1K79 A;  2XV4 S;  2FML A;  2K27 A;  3DPT A;  2MH2 A;  1WI9 A;  3GX4 X;  1YO5 C;  3E5U A;  3REO A;  1ZG5 A;  2RQP A;  1J0R A;  2MC3 A;  5F64 A;  4KUM A;  1IUY A;  1YLF A;  4CDG A;  1V3F A;  3EDP A;  1ZRC A;  4CYD A;  2IT0 A;  1P4A A;  2X0L A;  1S6L A;  4Y17 A;  3JAM K;  3GWZ A;  5H6Q A;  3TDZ C;  1FYL A;  3LST A;  2C6Y A;  1JGS A;  2HS5 A;  2IP2 A;  5LHI A;  1W7P D;  3FM5 A;  4YFN F;  1K6O A;  2R7D A;  3IL2 A;  3FXQ A;  2JSC A;  4OIR F;  4QLC U;  3KP7 A;  5FB2 A;  2DAO A;  2B0L A;  1LDD A;  1IN5 A;  2JPC A;  5HS8 A;  1D8J A;  3GFM A;  4BHP A;  4OMY A;  3L9F A;  3JW4 A;  3CUQ B;  1UHM A;  1K78 A;  1W7P B;  1IXC A;  3E6M A;  4WK8 F;  5HS7 A;  3EET A;  1J9I A;  2O61 A;  3I64 A;  1Z6R A;  1KGS A;  4UVC A;  3CUQ C;  1SFE A;  3BDD A;  2RV8 A;  2QBY A;  1TBX A;  1T98 A;  4ZZD A;  4HDV A;  1D5V A;  2JT1 A;  3GFJ A;  5K5R A;  4UVB A;  2GQQ A;  4GXO A;  5A2Q Z;  3V7R A;  1XB4 A;  3WE3 A;  4EJW A;  2BEO A;  4O3M A;  2EFP A;  4Q47 A;  2KRF A;  1MDM A;  2XAF A;  4L9T A;  1GXQ A;  3L7W A;  3JTG A;  3HOS A;  4A0Z A;  1Z05 A;  3G3Z A;  5JR3 A;  1QZY A;  1SAX A;  2O8X A;  5BMZ A;  1FWZ A;  4UHT A;  1G4D A;  1E2X A;  2ZO4 A;  3K2Z A;  1ZAR A;  2OD5 A;  4IHS A;  5E1Z B;  3R4K A;  4N9I A;  2UZK A;  2XAS A;  3E97 A;  5F1R A;  3F8F A;  5D5W B;  2DLL A;  1MZB A;  3HTU A;  1FYM A;  1YW9 A;  3FWE A;  5BPI A;  4M74 A;  4CGZ A;  2D2W A;  1XDU A;  5E8I A;  1ON2 A;  4OMZ A;  1R7J A;  4EQQ A;  4K2E A;  2ZFW A;  3EQL F;  3OOP A;  2AXL A;  1XGM A;  3KZZ A;  3GO5 A;  2RDP A;  4M9Z A;  4ZZL A;  1F1Z A;  2XGX A;  4LB6 B;  3LA3 A;  2IJL A;  3ABT A;  3GYH X;  5CVR A;  4UNO A;  2H6C A;  4BHB A;  1RZ4 A;  3I0T A;  3R6S A;  5CVI A;  2P8T A;  2KIF A;  1S8N A;  2D1V A;  4M9X A;  3HRM A;  2NAZ A;  2J5P A;  3DEU A;  4HV5 A;  4OIP F;  2PFB A;  1I1S A;  2ELH A;  2RC4 A;  1KA8 A;  4PCQ A;  4R1H A;  4KN4 X;  1EH8 A;  1YG2 A;  2NNY A;  1XGO A;  3J80 K;  4H0E A;  4U88 A;  1O57 A;  3PQK A;  3BPV A;  1TQI A;  4S04 A;  5L3E A;  2CW0 F;  2EA4 A;  2PEX A;  3IWF A;  1FBU A;  2VXZ A;  4M6X A;  5CVV A;  3LQR A;  4ZYD A;  1JHH A;  3BJO A;  4MHG A;  5LGU A;  3JSO A;  4XLN F;  3BJ6 A;  2GZW A;  1FSE A;  1STZ A;  1OPC A;  2P4W A;  2WV0 A;  2LF7 A;  4BXU A;  3J81 K;  2A69 F;  4IF4 A;  3NQO A;  4I0A A;  3I5U A;  2PBI A;  4HQM A;  2A3S A;  1U78 A;  1IN4 A;  4ESF A;  4EM0 B;  3T0Y A;  3KP2 A;  5IT9 Z;  3GFL A;  3ZPL A;  2DQR A;  5E1W A;  5DV5 A;  1IAW A;  1P4W A;  2ZBK A;  4IRI A;  4G7O F;  1LNW A;  2MLK A;  1R00 A;  2LF8 A;  2W57 A;  2IA2 A;  4L5J A;  1PP7 U;  1FC3 A;  1XMK A;  4RGS A;  5FLX Z;  3I59 A;  3WTS C;  1IF1 A;  3P9I A;  1XD7 A;  2FOK A;  3BOQ A;  4OIQ F;  2VT2 A;  2FBK A;  3RPQ A;  1QZZ A;  5E8G A;  3HRS A;  5K5O A;  1CGP A;  3IRR A;  2XVC A;  3W6J B;  1R1V A;  1D3Y A;  5FO5 A;  3T8R A;  2L02 A;  1U6G A;  1X3U A;  4G6D A;  2Y48 A;  1V4R A;  2VN2 A;  4KN7 X;  1CF7 A;  4HLX A;  4GCV A;  4A2U A;  3WE2 A;  5LHG A;  4HW0 A;  2FBI A;  4PDK A;  5D6F A;  2K4J A;  2VON A;  2R3S A;  4HF2 A;  1P2F A;  4I98 B;  3WGI A;  2O3F A;  3K1P A;  4JQF A;  3WGG A;  1ZRF A;  1RNL A;  2A07 F;  3BP8 A;  3SZT A;  3RIR A;  1B59 A;  2O6G E;  2QLZ A;  2EV5 A;  3VFZ A;  3K9T A;  1FBQ A;  1BC8 C;  1G3Y A;  1ZGJ A;  3R61 A;  4HA8 A;  1RIO H;  2F5F A;  2FEZ A;  1ZLJ A;  3V4G A;  1MJA A;  2HTJ A;  2GIV A;  1YTY A;  4LLL A;  3LAJ A;  1J7K A;  4PGG A;  2CO5 A;  4M72 A;  3DV8 A;  1U5T C;  3L00 A;  3P9C A;  4AVP A;  5K1Y A;  2QQB A;  2VT3 A;  4I01 A;  1DPR A;  3E3V A;  4KYW A;  4GYI A;  3IKT A;  1QBJ A;  3KP3 A;  2OU2 A;  1L0O C;  1T0F A;  1JHF A;  5J8C A;  3FXU A;  2V79 A;  4P5O A;  3RKY A;  4OOI A;  2Z9O A;  1TNS A;  4ZYH A;  5ILU A;  4I7H A;  3PFI A;  4P9U A;  2FF4 A;  3WTY C;  2FRH A;  1FNN A;  1R5H A;  1U3E M;  1I27 A;  5EEG A;  1P4X A;  3F21 A;  1S29 A;  1QNT A;  2E1N A;  4XLP F;  4YIF A;  1XCB A;  2H6B A;  5CVJ A;  1ZAO A;  2Z33 A;  3F8N A;  2HGC A;  3BPX A;  1BI2 A;  2YSR A;  4YG2 F;  5L3F A;  5D5V B;  1NHA A;  1LVA A;  5AIQ A;  3KP4 A;  2MBF A;  5FFX A;  3DPL C;  2VOP A;  2W84 A;  3TOB A;  4WCG A;  4EJU A;  2E7W A;  3GXO A;  2RKH A;  3P7N A;  5E20 A;  2M1B A;  3WU1 B;  3HTS B;  3J80 Z;  1Z91 A;  2PMU A;  1IRF A;  4WF2 A;  1Z7U A;  2VC1 A;  2LNB A;  1A04 A;  4U0Y A;  4M73 A;  3M9A A;  1GVJ A;  1IN6 A;  4FX4 A;  3QRF F;  3RDI A;  3G73 A;  1FZP B;  1BC7 C;  1FSH A;  3B73 A;  3HYI A;  3NRV A;  1W4M A;  4OU0 A;  2CGP A;  1O7L A;  1Q1H A;  3QAH A;  2K86 A;  2X4H A;  4EJV A;  3V8J A;  3WGH A;  2UWM A;  3ZN1 A;  3QP6 A;  5DUK A;  4BH9 A;  3PQJ A;  1J2X A;  1G6N A;  1LEA A;  4PGH A;  5ICC A;  4IXA A;  3KLN A;  5LRR A;  3EYY A;  2WTE A;  4R79 A;  2DK5 A;  3GW2 A;  3M8E A;  4MEX F;  5ED4 A;  4JK1 X;  2M5W A;  2F5C A;  1H9T A;  2ZCW A;  4OIO F;  3MFK A;  2Q8K A;  4WXH A;  3MCZ A;  1MJ9 A;  5L3C A;  2FNP A;  3I4P A;  2COM A;  2DFI A;  5A2Q K;  2JTV A;  4LB5 A;  1TW2 A;  3R60 A;  3K1M A;  1T38 A;  2IA1 A;  4G9Y A;  3ML6 A;  4QWQ A;  5ICF A;  2MA3 A;  3V8L A;  1PDN C;  2QBY B;  2PG4 A;  5DUI A;  4EM2 A;  3N4M A;  5DCM A;  3F3X A;  3L2C A;  1IXR C;  4U7D A;  2A6H F;  1K78 B;  2OBP A;  2KIU A;  3BRO A;  4ESJ A;  1DDN A;  1BN5 A;  1BM9 A;  3D5L A;  5D4S A;  4RGR A;  2DO7 A;  1FX7 A;  2V1D A;  4AWX B;  4MGR A;  3DXJ F;  2JPB A;  3KEO A;  1RUO A;  1SMT A;  5CJ9 A;  1TTY A;  3I53 A;  4E70 A;  4RB2 C;  3HSE A;  3ISP A;  4N9H A;  4L18 B;  2A61 A;  1YS7 A;  3E6C C;  3IRQ A;  4EJT A;  1XCV A;  3NEU A;  5EEH A;  1IZ1 A;  2FNA A;  4Q48 A;  5HDK A;  1B9N A;  2H94 A;  2E1C A;  2XKP A;  2HZT A;  1REP C;  5FFZ A;  1I6X A;  4I02 A;  1SD4 A;  2L3D A;  5KK1 A;  3ZP5 A;  1FOK A;  4ZH4 F;  3CDH A;  3KP5 A;  4HOB A;  4KMU X;  1K7A A;  4FT8 A;  1DPU A;  2W25 A;  1O3Q A;  3VOE A;  2HFH A;  3ZQ7 A;  4MQ9 F;  1FT9 A;  4HX7 A;  1EH7 A;  3VB2 A;  3CO7 C;  1BOA A;  5F6F A;  3K0L A;  1IXS B;  4HZF A;  2GAU A;  5DEQ A;  1TW3 A;  2M45 A;  1B9M A;  2XAH A;  2BGC A;  4HAM A;  4EMS A;  3EYI A;  5E18 F;  1YFH A;  1U5T A;  1MGT A;  4HX4 A;  2ETH A;  4WWC A;  2DU9 A;  4AD9 A;  1YW8 A;  4KIC A;  1LDJ A;  2F5D A;  2R7F A;  2YPR A;  3HSF A;  1FP2 A;  2PI0 A;  2G7H A;  4EGY A;  3L09 A;  1ZG1 A;  1JXS A;  2Y0M A;  2P7C B;  4A0Y A;  2DW4 A;  3ZMS A;  1ODD A;  5DCM B;  1G3T A;  1OYW A;  1YIO A;  4HLY A;  4EGZ A;  2NRA C;  1BI1 A;  4LD5 A;  4OIN F;  4ENK A;  4O6J A;  2VBW A;  4RAY A;  2XRN A;  3QU6 A;  4ASN A;  1OYY A;  4CIC A;  4KT5 C;  3KZY A;  4B09 A;  2ZME A;  3KLO A;  5HOO A;  2LKP A;  4LLN A;  5E17 F;  4I2O A;  3LWF A;  2ADU A;  4KA4 A;  2TDX A;  2FE3 A;  4A5M A;  5ERI A;  3I59 B;  4NQW A;  2EK5 A;  5BS6 A;  4GYG A;  1IN8 A;  1IW7 F;  3TO6 A;  1LB2 A;  2RVC A;  3IWZ A;  5H20 A;  5HS9 A;  1SMY F;  5ILV A;  3R0J A;  2HQR A;  3OV8 A;  1SFX A;  4KDP A;  2XUB A;  1R58 A;  2L54 A;  3FF5 A;  2YX4 A;  2VOD A;  3RPU A;  2W85 A;  2ESH A;  3BWG A;  4BAY A;  4JBA A;  4KFC A;  2XAG A;  5LLQ A;  1GXP A;  1HKS A;  1BI0 A;  1YQA A;  5LGN A;  2IA0 A;  3I54 A;  4XBF A;  3ECH A;  3FX3 A;  2J5O A;  2EWN A;  2WWY A;  2M87 A;  3ZN0 A;  3KET A;  2ZME B;  3KEQ A;  2RGV A;  2G9W A;  4EV0 A;  2VE9 A;  3T1B A;  2ACJ A;  4L5I A;  2Z3Y A;  1J5Y A;  4RB0 A;  2EJR A;  2NS0 A;  5FGM A;  5LRS A;  6PAX A;  4P9F A;  4L0Z B;  3SQN A;  3M1E A;  2VC0 A;  4EJO A;  2QM3 A;  4IPA A;  3BZ6 A;  3CLO A;  1KU2 A;  4WXD A;  4BQA A;  4NHJ A;  3JTH A;  4Y15 A;  1UHW A;  4LFU A;  5JVT A;  1U8R A;  1KQ8 A;  3GEZ A;  4CZZ A;  3CO6 C;  4LG0 A;  4CXF A;  3TDU C;  1KQ0 A;  1IN7 A;  1YS6 A;  4UVA A;  5L3D A;  4B8X A;  4U0V A;  2STT A;  4RAZ A;  1U5T B;  5HLG A;  1I1G A;  3WOD F;  1OYI A;  3KP6 A;  2F2E A;  2PLY A;  1P92 A;  4IRH A;  2PN6 A;  1F9N A;  4PZJ A;  2MLG A;  2ZKZ A;  1OR7 A;  2CFX A;  3I58 A;  3JAM Z;  1PUE E;  1BI3 A;  3TKY A;  1Z1D A;  1S7A A;  5FD5 A;  4RB3 C;  3M7G A;  4YFX F;  2VBX A;  2KJC A;  1UST A;  2JZY A;  3RJP A;  3SXY A;  4AIH A;  2QVO A;  1J75 A;  1WQ2 A;  2HKX A;  1LEB A;  3WU0 A;  1WKM A;  2GXB A;  3HRU A;  3Q9V A;  1FPQ A;  4XSZ F;  1R1U A;  3HSR A;  2W24 A;  1QQI A;  2HTS A;  2YR2 A;  3BY6 A;  3SHF A;  3M8F A;  4YII A;  3F23 A;  2Z99 A;  1W5S A;  4G6Q A;  4I0B A;  3TOA A;  4MNU A;  1QPM A;  2P5V A;  1ULY A;  1KU9 A;  1FLI A;  2DI3 A;  3K69 A;  1WWX A;  3O2P E;  3KE2 A;  3HRT A;  1TQM A;  4D0P A;  4LLG F;  4EVI A;  1KQ9 A;  2G7U A;  3O3K A;  1TNT A; 
#chains in the Genus database with same CATH topology
 1T33 A;  5LEK A;  4HYE A;  4MQV A;  1RR7 A;  1J09 A;  2P5K A;  3CUQ A;  5BOX A;  1V5G A;  2M9H A;  2UXN A;  3M8J A;  3HOT A;  1B8I B;  1LE8 B;  2K3P A;  3ELK A;  4QPO A;  1QHH D;  1I5Z A;  4KMF A;  2CQQ A;  3TQN A;  1R22 A;  5L3G A;  2O0Y A;  2YU3 A;  3RZD J;  3V7C A;  1MSF C;  3GF2 A;  3GLX A;  1ZN2 A;  2ESN A;  2HPM A;  4FX0 A;  3WTW C;  3RYR A;  3N05 A;  2VLA A;  5BQT A;  3F72 A;  2CV1 A;  4ON0 A;  3G1M A;  2ZJ2 A;  1EJ9 A;  2IVM A;  2EFN A;  2DFE A;  1QU3 A;  3WTT C;  5HDG A;  3SFZ A;  2FQ3 A;  2EFW A;  4F7Z A;  4PK4 A;  3MMY B;  3BLY A;  5D6E A;  3CES A;  4BE0 A;  3C2G A;  3CJQ B;  3S32 A;  4PJL A;  3U2R A;  1WJD A;  3EUA A;  4Y33 A;  3KPH A;  3OIO A;  5JI6 A;  2OQR A;  3F8B A;  3IAS 2;  2VB6 A;  4CCK A;  2BV6 A;  1GV5 A;  2LVS A;  4RM2 A;  5ICG A;  3BR0 A;  4WX9 A;  2HKO A;  3MKZ A;  3TGN A;  3CDI A;  4M71 A;  2R0Q C;  3ZR8 X;  1T6S A;  2ZXI A;  2HVR A;  4MEY F;  3QQA A;  2VJ4 A;  2E2I J;  2ZJP F;  2V6E A;  2VKE A;  3VYU B;  3IKV A;  1LVK A;  5K5Q A;  2LP0 A;  1YRN A;  3E5X A;  2BBY A;  1LPQ A;  2IW5 A;  2VQL A;  2XIG A;  5B3S H;  4HNV A;  1S3J A;  2M7A A;  2PQ8 A;  1E17 A;  2DBB A;  5GAE J;  2HOS A;  1JGG A;  4KIT B;  1JUM A;  2K9Q A;  1XDS A;  4AUX A;  2CUZ A;  4UV8 A;  1B72 A;  1HW2 A;  3A02 A;  3S1Q J;  3DBL B;  3CP8 A;  3DKY A;  3QU3 A;  3F8M A;  4XKW A;  2CS3 A;  3PO3 J;  3ZMD A;  2HOE A;  4U0W A;  2HYF A;  3LSP A;  1PJR A;  2KJB A;  2QQA A;  3MEX A;  3WG9 A;  1Z67 A;  3EUH A;  4GO1 A;  5IPA A;  3S3O A;  3W2V A;  1XGN A;  3DBR B;  2P6T A;  5EZH A;  3ERE D;  1SFK A;  2QUF A;  3PUB A;  2V9V A;  5D5U B;  2KRC A;  3I3L A;  3CCU I;  1GLN A;  3B02 A;  2QEN A;  2V1X A;  4FE7 A;  4L0Y B;  4A12 A;  1BBY A;  3K4B A;  4CCJ A;  2EV6 A;  1FYK A;  3L2Q A;  3BCB A;  5LHH A;  1WSU A;  1SD7 A;  3HGG A;  4PJJ A;  1KYZ A;  1YE9 A;  1SFU A;  2Y9Z A;  3HM5 A;  2IGO A;  2ISY A;  3OR1 C;  4I76 A;  2LY9 A;  1AU7 A;  2BVM A;  2P7V B;  2IBD A;  3S2W A;  1N25 A;  3SFI A;  3HUG A;  1ETY A;  2E35 A;  1SD5 A;  5FKL A;  5FLV A;  4UUV A;  4R8H A;  2VBZ A;  5IP6 A;  2MW8 A;  5H6R A;  1SAN A;  2VJJ A;  3BQY A;  3JRG A;  2L7Z A;  2NS8 A;  3E6D A;  4KIG A;  1W36 D;  4II2 A;  2GA2 A;  2XHK A;  1LQ1 A;  3L1P A;  4BNC A;  2VKD A;  1B6A A;  4LG0 B;  2LK2 A;  3QPT A;  2OZU A;  3V8K A;  4HF1 A;  2HXO A;  2R5Z A;  2DN0 A;  3ZQL A;  4AIJ A;  3IH4 A;  4LJZ F;  1P9Q C;  3WTU C;  3CC4 I;  2XSD C;  1ZH5 A;  4BKX A;  3NAU A;  3GVA A;  4PFP A;  2H1L A;  4XKB A;  2NXN B;  1UHS A;  2EH3 A;  3GZ5 A;  1KU3 A;  2EQR A;  2Y69 H;  3LAP A;  3RYP A;  4Q4Z F;  2O8K A;  2E71 A;  3ECO A;  2CMP A;  2CQK A;  2DQL A;  3RQI A;  3VYS B;  3VEP A;  5D5X B;  4Y13 A;  3RZO J;  3CTA A;  1O3T A;  3FHZ A;  3PUF A;  2QQ9 A;  4XLE A;  2OQG A;  1ACI A;  1ZR4 A;  3I4N J;  2OJE D;  3OYD A;  4XON A;  3RPU D;  3S17 J;  1A36 A;  3OS0 A;  3WTZ A;  4V2F A;  1ZYR F;  4IVN A;  1JT0 A;  3AG4 H;  1VZ0 A;  4C3J J;  2QF7 A;  1UCR A;  1WJ5 A;  2K9M A;  4B3X A;  4MTD A;  4RGU A;  1VTN C;  1XC5 A;  3J7A Y;  1ZRD A;  1R1T A;  1SFO J;  1ZKG A;  1MW7 A;  3TO9 A;  2DPU A;  4M6Y A;  3DP7 A;  3JCU C;  1F4K A;  1CQT A;  1T0F C;  5FLX K;  1HW5 A;  1Z6T A;  4XLF A;  2ISZ A;  5EG0 B;  3WHB A;  3DF8 A;  4X6A J;  2N8G A;  3R0A A;  4Y3O A;  2X6W A;  3P9K A;  5KVR A;  1HKQ A;  5J3L A;  4KNY A;  3GUD A;  2DMP A;  2RNG A;  2JA6 J;  4DNC A;  3H3U A;  2MH9 A;  4S05 A;  2Y2Z A;  2XKO A;  2KP6 A;  2MD5 A;  1ZR2 A;  5HVQ C;  4G8X A;  1QO0 D;  3ZOB A;  1PP8 F;  2NNN A;  1QVT A;  3NWS A;  5DYM A;  3TP3 A;  2HYJ A;  2LKX A;  2JQ7 A;  2XRO A;  2XF5 A;  5HLI A;  5TIS C;  2EIN H;  4ZYE A;  1LDK B;  1H88 C;  2GWR A;  2HXI A;  1X2M A;  1SVM A;  4BGD A;  2WY8 Q;  3H92 A;  2XC7 A;  3ZMU A;  2JA5 J;  1T39 A;  2DPD A;  4NB5 A;  2H8R A;  2JSP A;  1P7I A;  5HNH A;  2DOF A;  3SZP A;  1HOM A;  3WHC A;  2PJP A;  5FLM J;  5J47 A;  2K40 A;  1WRJ A;  1TP4 A;  3MVP A;  3H36 A;  2DA5 A;  4D1Q A;  4G7Z F;  1DP7 P;  1ETV A;  2DJN A;  3S2H J;  2WY7 Q;  2JVH A;  1NH3 A;  1OCP A;  2CSO A;  1O3S A;  2DA2 A;  1FMW A;  2K85 A;  2E19 A;  1TQP A;  4OAZ A;  2L01 A;  2XF6 A;  3F22 A;  3TO7 A;  2VAS A;  3JSP A;  3T8T A;  2AQE A;  2VQH A;  4AYB N;  2UUZ A;  4N4N B;  2Q0O A;  2QSH X;  4UY8 I;  4CH7 A;  1EV7 A;  2BE5 F;  4PFO A;  4BY1 J;  3IH2 A;  1YYV A;  2E7X A;  3E5Q A;  4NDL A;  1IO2 A;  2KDO A;  4YFK F;  2WAQ N;  1JI8 A;  3U9G A;  1OKR A;  2CYY A;  1IRX A;  3ZMT A;  2QSG X;  4ENM A;  3KCC A;  2R5Y A;  4Z2Y A;  1CF7 B;  3HB9 A;  4NC8 A;  3WTX C;  4IX7 A;  1HXD A;  3A01 A;  3Q5F A;  4Y7N J;  2HOT A;  3LSK A;  2DT5 A;  1HST A;  5K7H A;  4PUS A;  2P0W A;  1T2K A;  4P55 A;  3KEY A;  1WZ2 A;  4RLQ A;  1MSE C;  3OL4 A;  1B8I A;  2LRD A;  4C3H J;  4ZDP A;  2KLO A;  4J01 A;  1E3P A;  1H0M A;  3MAJ A;  4A6D A;  1IC8 A;  3AAF A;  3SJM A;  4DQ2 A;  3DFG A;  3C1D A;  4MLO A;  3VYR B;  3MQ0 A;  1SD6 A;  1UB9 A;  4ENN A;  1HBX G;  2FXA A;  3SEZ A;  4N0B A;  4YRV A;  2FJ1 A;  4EEF G;  1TT0 A;  1R5G A;  1A35 A;  2LKS A;  4RB1 A;  5CQE A;  3BTC A;  4AM3 A;  2HWV A;  5D4R A;  1O3R A;  1TWA J;  2LSO A;  1IRG A;  1GV2 A;  2M0C A;  4KJZ A;  5LEJ A;  5B5E C;  5M3F J;  4G94 A;  2BYV E;  2DYR H;  4ZJZ A;  1XSD A;  2Q2E A;  3P5J A;  1AKH B;  2EA2 A;  1U2W A;  3JRI A;  4L9N A;  3JRH A;  1XX5 A;  3BR5 A;  3F6O A;  2V1N A;  3QOP A;  5FKN A;  2XPV A;  3G1L A;  1RI7 A;  1R36 A;  2D1H A;  3HBL A;  4A3J J;  2DTR A;  3DTE A;  3HIF A;  2JK3 A;  3C7J A;  1XN7 A;  1XSV A;  2EFO A;  2K9L A;  4D7N A;  3HXL A;  4D9J A;  5F0C A;  2LYC A;  1AOY A;  2WV1 A;  2Y0S N;  2Y75 A;  2Z5U A;  3CCY A;  4G7H F;  1BJA A;  1TLH B;  2XAJ A;  1Y8R B;  2M4G A;  5E1X A;  1OLT A;  2K7L A;  2PMZ A;  4U7B A;  2L4M A;  3FMQ A;  1HQC A;  2M8G X;  3VPR A;  2E2H J;  3F6V A;  2R7S A;  2DFF A;  1KU7 A;  2NOG A;  1GT0 C;  1DUX C;  3VOD A;  2HDC A;  4RGX A;  1O7F A;  3I4M J;  4XOR A;  4A5N A;  4LIU A;  1XMA A;  1HSJ A;  2VQG A;  1JKP C;  1DU6 A;  4I09 A;  3DQV C;  4F55 A;  3CJN A;  1DP3 A;  4E7H A;  2VI6 A;  2HVQ A;  1W0U A;  1PVE A;  3GTG J;  3O6B B;  1ZK8 A;  2BY2 A;  1VQ6 I;  1ZG3 A;  1FP1 D;  2ZXJ A;  3DKW A;  1W0T A;  2LLK A;  4A6E A;  1HKT A;  3C18 A;  2HR3 A;  1XPX A;  2X9D A;  3IC7 A;  3GTL J;  3K4C A;  1K83 J;  2X1E A;  5TJJ A;  5IY5 H;  4LK0 F;  4BHC A;  1R23 A;  4HV6 A;  3DLL F;  3OL3 A;  4XRS A;  3JRE A;  1VQL I;  2Y0S A;  2K5C A;  4TV7 A;  3T5X A;  1JKR C;  3LSR A;  5DDG A;  2K02 A;  1MMA A;  2VE8 A;  2V1U A;  1OMI A;  3S8P A;  3W6K B;  2LOO A;  3Q9S A;  1ETK A;  2BZT A;  3MWM A;  5FJ8 J;  2XSJ C;  5FRM A;  3OSG A;  1HW1 A;  4IRG A;  2KL4 A;  3E1S A;  3QPS A;  4IHV A;  2Q2E B;  3FMS A;  3H0G J;  1I3A A;  1AWC A;  4ESB A;  4C2M J;  5EEA A;  1Z9C A;  3CJT B;  5TRD A;  1DGW Y;  5LGT A;  2QQ8 A;  3DBH B;  4XLH A;  1XGS A;  3BQZ A;  1RR8 C;  5D8K B;  2HQN A;  1Z3X A;  2BXY A;  3D0S A;  2ME6 A;  3RKW A;  2MAB A;  2LC2 A;  4HEA 2;  2W7N A;  1RRJ A;  2HDD A;  1FBS A;  3LA7 A;  2M7B A;  4BU2 A;  1E0E A;  1ZQ3 P;  2LDU A;  5KAI C;  1B4A A;  4ETS A;  2X6Y A;  5BPD A;  4KIB A;  3KFW X;  2EB7 A;  4O5V A;  5IT9 K;  4CHU A;  1MND A;  4GGG A;  2P81 A;  3JRD A;  2CG4 A;  3CF5 F;  1BW5 A;  3ABU A;  5LBQ A;  1ZRE A;  1USS A;  2E60 A;  3KYC B;  3OYM A;  2K4B A;  2CV0 A;  2EIJ H;  5DCF A;  3VDX A;  2FSW A;  2QZ8 A;  3CCV I;  1HC8 A;  4RS8 A;  2O9L A;  3J81 Z;  1BOB A;  2R5Y B;  1JUP A;  1JE8 A;  3K70 D;  2DK8 A;  2A6E F;  4ENJ A;  5AIP A;  2FU4 A;  2FUG 2;  2L7F P;  4HBL A;  2RN7 A;  2A5W A;  3DEW A;  3CDL A;  2EV0 A;  3K4K A;  3C3W A;  2JRT A;  2Z2S B;  3FBN B;  1YJN I;  3H5N A;  3FXR A;  2BXZ A;  2F5V A;  3HHG A;  3V7S A;  5E3M A;  1OJL A;  5J6X A;  5J40 A;  4XOT A;  1B1B A;  2AS5 F;  3W2W A;  5FRN A;  2LH9 A;  1MMN A;  1EH6 A;  3E6B A;  4KIF A;  3BTI A;  5J1U A;  1G3S A;  4FHT A;  4HQE A;  4Q5S F;  2E34 A;  3IH3 A;  3RKX A;  2V6C A;  3QPL A;  1S7O A;  4YEJ A;  1S9H A;  3HGY A;  3RTR A;  2ZNZ A;  2IRF G;  1W5T A;  2H1K A;  3H35 A;  1YW7 A;  2WAD A;  4XIC A;  2VBY A;  3J7A O;  1L3L A;  5DM7 F;  3WTV C;  4RBO A;  5DD8 A;  5HLH A;  1VI0 A;  2LBF A;  3OYA A;  3VSK A;  3QP5 A;  2QEX I;  3L2W A;  2GXG A;  5KCM A;  2MG4 A;  5HOD A;  1KYW A;  4P96 A;  1DQU A;  1VQ8 I;  4D5F A;  5J1R A;  2XPW A;  3OR2 C;  1D8K A;  1IV8 A;  1MH3 A;  2GXA A;  2PMH A;  1TWG J;  4H4K C;  3GZ6 A;  1GHC A;  2F4O B;  3BZK A;  3HHH A;  4GDF A;  5CVU A;  3FXJ A;  4V2G A;  2OZ6 A;  4B44 A;  3BJA A;  3OWT A;  2GOX B;  2A5Y B;  4JYK A;  5IOY A;  2HQA A;  2UXX A;  3CMM A;  3LQQ A;  1YX5 A;  4UB6 C;  3U1D A;  4DZJ A;  2EIK H;  1DGR M;  1Y0U A;  3BR1 A;  1MDM B;  4RMN A;  3IV5 A;  3C2H A;  3CC7 I;  3ABK H;  1ZLK A;  5CYV A;  2DA1 A;  1F5T A;  2WC2 A;  4XSX F;  1HCR A;  3OMY A;  1LJ9 A;  2STW A;  2EFQ A;  2GA1 A;  3K6G A;  4LG3 A;  2P5L C;  2M4K A;  5CLS A;  1G8X A;  1MJB A;  1E3O C;  3SZG A;  2M8E A;  1TZL A;  4CSW A;  2L4A A;  4M9S A;  3N97 A;  1Y56 A;  2R7V A;  2EIM H;  1ETO A;  1ZGA A;  1WVR A;  2X48 A;  5AON A;  2YX7 A;  4CYC A;  3FZV A;  1ENH A;  1WFX A;  3MZY A;  1QGP A;  4IOC F;  4E7S A;  1VQ9 I;  2HYG D;  1R9T J;  5BNG A;  4GRI A;  3MZH A;  3E0J B;  4BQQ A;  3FDY A;  2M30 A;  1PYV A;  4UV9 A;  2R7T A;  2H27 A;  2YU9 J;  3CCR I;  5FD6 A;  4LK1 F;  3ULQ B;  4ZYA A;  4F91 B;  2R7Z J;  1H9G A;  4BJ6 C;  3EPZ A;  2FD5 A;  5J8F A;  1W7P A;  5CKT A;  4HF0 A;  4HDU A;  5DD4 A;  2HEO A;  2DT6 A;  4NC6 A;  2BOL A;  1IV6 A;  4A0X A;  4UXN A;  2OAZ A;  3F8C A;  1MBG A;  2KIM A;  5ILS A;  1IJW C;  1BJZ A;  2CRG A;  1UFM A;  3K1N A;  2FA5 A;  2E2J J;  2NYX A;  1IRZ A;  3AG2 H;  2GOM A;  3FMR A;  3A1Y A;  4XRF A;  2LR8 A;  4LIT A;  1BIB A;  1ETX A;  3ZMV A;  4MTE A;  3BG6 A;  2VOO A;  1J59 A;  5JFR A;  3BG5 A;  2EBI A;  3CCL I;  2KZV A;  4W1U A;  4F52 A;  1P6R A;  5EF6 A;  3OYC A;  4D7M A;  3RI4 A;  2FBH A;  3I71 A;  1XSX A;  2F5E A;  5JHU A;  1ITY A;  2ZNY A;  2IPQ X;  4IO9 F;  4IHT A;  1ZTR A;  4CCL A;  2XAQ A;  2QWW A;  5M5X J;  1EKE A;  2RNJ A;  4WXC A;  1MKM A;  5IT3 A;  3GFI A;  2DMN A;  4CO8 A;  2CWE A;  2QYO A;  2A68 F;  3HZJ A;  1ON1 A;  2D45 A;  4UB8 C;  2H09 A;  2TRT A;  2DA4 A;  2ECC A;  3ZMZ A;  1ONV A;  3IHU A;  3WG7 H;  4M3G A;  2DDB A;  2WAQ A;  1EF4 A;  3COA C;  2O03 A;  2FMY A;  1HDP A;  4BYY A;  3F9K A;  2ZJQ F;  3ZGK A;  1TWF J;  2L2O A;  2MSY A;  4LMY A;  1BIA A;  1VFC A;  4HRI A;  4ZYG A;  2P6S A;  4LGW A;  4QSH A;  3LA2 A;  3HPH A;  2KKO A;  3B6C A;  4L9J A;  4Y52 J;  3CCS I;  4BJ5 C;  3G2B A;  1G3W A;  4IJA A;  4HX8 A;  1C0W A;  3FM3 A;  1MD0 A;  5L3B A;  1ZHF A;  3H3Z A;  1N75 A;  1PUF A;  4L9V A;  1FY7 A;  3AG1 H;  4J19 A;  3ROU A;  3SYT A;  5HDN A;  3QPH A;  3V42 A;  2I5U A;  3LFK A;  4AIK A;  1NG6 A;  3LSM A;  1RUN A;  5D8L B;  2KIQ A;  4AVZ A;  2YS9 A;  3CUO A;  5ICE A;  1VQ4 I;  2OA4 A;  4EM1 A;  1OCT C;  4B1R A;  1K79 A;  4BQN A;  1MMD A;  2XV4 S;  2FML A;  1YOV B;  3Q3S A;  1K4T A;  2DOA A;  2K27 A;  3DPT A;  3HJE A;  2MH2 A;  2ME0 A;  4CCN A;  2GM4 A;  1WI9 A;  3GX4 X;  3FXM A;  1I50 J;  5E3L A;  3E5U A;  1YO5 C;  2E5N A;  3REO A;  1ZG5 A;  2IGK A;  1JJ8 C;  2RQP A;  3FKI J;  3U1K A;  3PSI A;  1J0R A;  1Y0N A;  1QPI A;  1VF9 A;  1YRN B;  2MC3 A;  4FET A;  1VQM I;  5F64 A;  1S7E A;  4KUM A;  1W5C C;  1IUY A;  3S1N J;  1ETQ A;  1YLF A;  3PIP F;  4XID A;  3HOW J;  4CDG A;  1V3F A;  3EDP A;  1ZRC A;  3DU5 A;  4CYD A;  2IT0 A;  1P4A A;  2X0L A;  1S6L A;  4Y17 A;  2XB5 A;  3JAM K;  4EAT A;  3GWZ A;  5H6Q A;  5F04 A;  1D0Y A;  3TDZ C;  1FYL A;  3LST A;  2C6Y A;  1JGS A;  2R7R A;  2HS5 A;  3ERM A;  2BY1 A;  4XK4 A;  4Y4R A;  2IP2 A;  5LHI A;  1Y8Q B;  4RAG A;  1W7P D;  3FM5 A;  2X85 A;  4YFN F;  1K6O A;  2R7D A;  2WBM A;  3IL2 A;  3FXQ A;  2JSC A;  3KX2 A;  2JA8 J;  4G6T B;  2OCC H;  4U87 A;  2V7F A;  3BTL A;  3FXO A;  4OIR F;  4QLC U;  5J4Y A;  3BR6 A;  2JUC A;  3KP7 A;  2DAO A;  5FB2 A;  2B0L A;  1LDD A;  2O5R A;  4BDY A;  2DMT A;  3U21 A;  4IHY A;  1IN5 A;  1POG A;  2JPC A;  5HS8 A;  1D8J A;  3GFM A;  4BHP A;  4FQG A;  4OMY A;  3L9F A;  1W36 C;  3MD2 A;  3JW4 A;  3QOE A;  2XGC A;  3CUQ B;  5EYR A;  1UHM A;  1K78 A;  1X1P A;  2CW8 A;  1VQO I;  2CJJ A;  1W7P B;  1IXC A;  3E6M A;  3ZQF A;  4WK8 F;  1FOX A;  5HS7 A;  2L7M P;  3EET A;  1J9I A;  2O61 A;  3I64 A;  1Z6R A;  1KGS A;  1WJE A;  4UVC A;  3CUQ C;  1SFE A;  3BDD A;  3K4L A;  2RV8 A;  2ZJR F;  2QBY A;  2KMU A;  3GLL A;  1TBX A;  1VQK I;  1T98 A;  4ZZD A;  4HDV A;  2EZK A;  1D5V A;  2JT1 A;  1T08 B;  3GFJ A;  5K5R A;  4UVB A;  2GQQ A;  4GXO A;  3BC8 A;  3W6V A;  5A2Q Z;  2Z16 A;  1XB4 A;  4NC7 A;  3V7R A;  3WE3 A;  4EJW A;  1R71 A;  4E7I A;  2BEO A;  3Q0U A;  4O3M A;  2EFP A;  3MZ8 A;  3H0D A;  4A3B J;  1OCZ H;  4BL0 B;  4Q47 A;  1JTX A;  2KRF A;  1MDM A;  2OV7 A;  3RSN A;  2XAF A;  4L9T A;  1VQN I;  1GXQ A;  3L7W A;  3JTG A;  4A3M J;  1SC7 A;  2ELJ A;  3HOS A;  4A0Z A;  3EUK L;  3G3Z A;  1Z05 A;  2X51 A;  5JR3 A;  1QZY A;  4BUP A;  1SAX A;  2VXD A;  1ERD A;  1U9O A;  1RKW A;  1WPK A;  2W00 A;  2X1D A;  2NVX J;  3G71 I;  2O8X A;  5BMZ A;  1FWZ A;  1NG7 A;  4UHT A;  2VKH A;  3OYK A;  1G4D A;  1E2X A;  1OQY A;  2ZO4 A;  3K2Z A;  1ZAR A;  2V4J C;  2OD5 A;  5FKO A;  4IHS A;  3EUH C;  5E1Z B;  2AHQ A;  3BG9 A;  3R4K A;  4N9I A;  2ECB A;  2UZK A;  4HST A;  4UUT A;  2XAS A;  2D5V A;  3E97 A;  5F1R A;  3F8F A;  5D5W B;  3JRC A;  2V9P A;  5E3O A;  3PFY A;  1F36 A;  3D5R C;  1MBK A;  1ZEL A;  2DLL A;  1MMS A;  1MZB A;  4D5C A;  3H3V K;  3HTU A;  5LFA A;  3K4J A;  1Z0X A;  1FYM A;  1YW9 A;  3UR3 C;  3QWL A;  2F48 A;  3FWE A;  4IL6 C;  3OYJ A;  5BPI A;  1R4N B;  4M74 A;  4RM3 A;  2OCE A;  2UV1 A;  4BY7 J;  4CGZ A;  4A3D J;  2D2W A;  2PMZ N;  1ETW A;  1XDU A;  4DJA A;  5E8I A;  1ON2 A;  4OMZ A;  3DKX A;  1R7J A;  4EQQ A;  2JRM A;  4K2E A;  3EQL F;  2ZFW A;  3OOP A;  2AXL A;  1UJ8 A;  2KIS A;  1XGM A;  2WA0 A;  3KZZ A;  3GO5 A;  3CD6 I;  3H5R A;  3BR3 A;  2RDP A;  3D5S C;  1FOW A;  4M9Z A;  3ZXS A;  4ZZL A;  4AYB A;  2HVS A;  4C30 A;  1F1Z A;  2XGX A;  4LB6 B;  3LA3 A;  3J7Z I;  2IJL A;  3ABT A;  3GYH X;  5CVR A;  4UNO A;  2H6C A;  5FKM A;  2CUF A;  4BHB A;  1RZ4 A;  1WH7 A;  4L5E A;  3PO2 J;  3I0T A;  2W1O A;  3OYF A;  2CU7 A;  3R6S A;  5CVI A;  2DTZ A;  2P8T A;  3KYD B;  3LL7 A;  1YJ9 I;  2KIF A;  2XGD A;  4BE1 A;  2WAF A;  1S8N A;  2D1V A;  2K9S A;  2KQR A;  3CCE I;  4M9X A;  2Y9Y A;  5EDN A;  4XM3 A;  3HRM A;  2NAZ A;  2F4M B;  2J5P A;  3DEU A;  1RKT A;  4HV5 A;  2IXS A;  4RA2 A;  4OIP F;  2PFB A;  4KIS A;  1I1S A;  1SAU A;  4UUS B;  2ELH A;  3NAR A;  2RC4 A;  1KA8 A;  2KHM A;  1U9N A;  4HNT A;  4PCQ A;  4R1H A;  4KN4 X;  1EH8 A;  1K4S A;  1YG2 A;  5IOZ A;  3VYT B;  2NNY A;  4DW6 A;  4IHX A;  1XGO A;  4FE4 A;  3ZQQ A;  2PJR B;  2ZSI B;  3ZQC A;  3J80 K;  5IYB J;  1HDD C;  1X3Z B;  4H0E A;  5DS9 A;  4U88 A;  1R6R A;  1O57 A;  3PQK A;  3FXL A;  3BPV A;  4X1E A;  1X1D A;  1TQI A;  1LUJ B;  4S04 A;  3A03 A;  5L3E A;  4XQF A;  3OYG A;  1APL C;  2CQX A;  2CW0 F;  2EA4 A;  2PEX A;  3IWF A;  3FIW A;  1FBU A;  3MKW B;  2VXZ A;  3S15 J;  4M6X A;  3LSI A;  4A3E J;  4E7L A;  2JN6 A;  5FRO A;  5CVV A;  1GVD A;  3G6E I;  1AHD P;  2PX9 A;  3DPU A;  2EZI A;  3LQR A;  3H5A A;  4ZYD A;  1JHH A;  3BJO A;  4MHG A;  5GAG J;  3AKZ A;  2F4I A;  2KZG A;  5C4J J;  5LGU A;  3JSO A;  4XLN F;  3HOX J;  2CQN A;  5IYD J;  4BDZ A;  5EGO B;  1SVL A;  3BJ6 A;  5EJC A;  4BS9 A;  2GZW A;  2LRE A;  1FSE A;  1Y1W J;  3OOU A;  1OFC X;  1MBE A;  1STZ A;  1OPC A;  3DU6 A;  5KAF C;  1G59 A;  2VJ5 A;  2P4W A;  3LFU A;  2JMW A;  2WV0 A;  1WJB A;  2LF7 A;  3CF2 A;  4NBQ A;  4BXU A;  3J81 K;  2X1C A;  2A69 F;  4IF4 A;  2IAI A;  5HLT A;  1BL0 A;  3NQO A;  4I0A A;  1BA5 A;  3I5U A;  3CCQ I;  2PBI A;  4HQM A;  1MBF A;  2A3S A;  3OYE A;  1U78 A;  2IS6 A;  1IN4 A;  4ESF A;  4PSX A;  4EM0 B;  3T0Y A;  4F3Q A;  3KP2 A;  4M3B A;  4CZC A;  5C44 J;  3TW7 A;  5IT9 Z;  1BR1 A;  2KRH A;  5M5W J;  3LSG A;  3GFL A;  3ZPL A;  2DQR A;  1QHG A;  1Z21 A;  2MYS A;  5DV5 A;  5E1W A;  1P4W A;  1IAW A;  3S2D J;  2ZBK A;  4IRI A;  4G7O F;  1LNW A;  1Y6I A;  2MLK A;  1R00 A;  2LF8 A;  2DA7 A;  2W57 A;  2IA2 A;  3A0B C;  4L5J A;  1FC3 A;  1PP7 U;  3BG7 A;  3OYH A;  1XMK A;  3OYL A;  3RKQ A;  2JJ7 A;  3ASN H;  4PJ0 C;  1JT6 A;  4RGS A;  1OIS A;  2RRE A;  3IUO A;  5FLX Z;  2VJI A;  3KZI C;  3I59 A;  3SDB A;  3H9J A;  3WTS C;  2Y31 A;  1IF1 A;  1Y39 A;  3P9I A;  1XD7 A;  4BE2 A;  2FOK A;  5GPC A;  3BOQ A;  4OIQ F;  3H1C A;  2VT2 A;  2FBK A;  2OC6 A;  3RPQ A;  1QZZ A;  3OYB A;  4FTH A;  5E8G A;  1T56 A;  3HC7 A;  2DA3 A;  3HRS A;  5K5O A;  1CGP A;  3IRR A;  3AL0 B;  4QTR A;  2XVC A;  3OIQ A;  3W6J B;  1R1V A;  1D3Y A;  4M3E A;  5FO5 A;  3FK6 A;  3GTQ J;  3T8R A;  2L02 A;  1U6G A;  4RDU A;  1X3U A;  4G6D A;  3M4O J;  2Y48 A;  1V4R A;  2VN2 A;  1OCR H;  1T95 A;  5JLW A;  4KN7 X;  2L0K A;  4M3F A;  4S0H B;  4HLX A;  3GZN B;  1MBH A;  4GCV A;  1CF7 A;  4A2U A;  1BR2 A;  3QYF A;  4DYQ A;  2OTL I;  2V26 A;  1QZE A;  3AG3 H;  2IGN A;  4E7K A;  3WE2 A;  2R7X A;  5LHG A;  4HW0 A;  1X58 A;  2FBI A;  3K2A A;  4PDK A;  5D6F A;  2K4J A;  5GTH C;  2VON A;  2E1M B;  1WI3 A;  2R3S A;  5F27 A;  1O4X A;  4HF2 A;  3TP0 A;  1HF0 A;  1P2F A;  2EPF A;  4I98 B;  3WGI A;  2O3F A;  3K1P A;  4JQF A;  2IS4 A;  3WGG A;  4DZP A;  1ZRF A;  1RNL A;  4DYR A;  3D1N I;  2DA6 A;  2A07 F;  2LY2 A;  3BP8 A;  3DTI A;  3SZT A;  3RIR A;  1B59 A;  5M3M J;  4XLC A;  2O6G E;  1U8B A;  3K70 C;  2BY0 A;  3HDD A;  2QLZ A;  5JHF A;  1KZH A;  2YUS A;  2EV5 A;  3VFZ A;  3K9T A;  1X2N A;  3S14 J;  1FBQ A;  1RPW A;  2M0M A;  3ESW B;  1BC8 C;  2EIL H;  3GCM A;  2BW3 A;  4IOA F;  1G3Y A;  2CUE A;  1ZGJ A;  2W4S A;  5CQG A;  5EGO A;  3R61 A;  3CME I;  4XL9 A;  4HA8 A;  2NVT J;  4YIR X;  1RIO H;  2E5Z A;  2F5F A;  2JA7 J;  2QCO A;  2FEZ A;  1E3H A;  1ZLJ A;  3V4G A;  1MJA A;  2HTJ A;  2FQ4 A;  2GIV A;  3K4N A;  4ABZ A;  1YTY A;  2DOD A;  4IHW A;  5K7Z A;  1XG1 A;  4LLL A;  3LAJ A;  1J7K A;  5IP9 J;  4E7J A;  2L9S A;  2XB0 X;  2CO5 A;  4FIS A;  3LOC A;  2W48 A;  3DV8 A;  4M72 A;  4PGG A;  4HSR A;  1U5T C;  1S5L C;  1DU0 A;  1PUF B;  3L00 A;  2XPU A;  1FMV A;  3P9C A;  1X1B A;  4DGW B;  3OYN A;  4AVP A;  1X1A A;  5K1Y A;  1VQP I;  2QQB A;  2VT3 A;  4I01 A;  1DPR A;  3E3V A;  4KYW A;  4GYI A;  3IKT A;  1FJL A;  3KP3 A;  2OU2 A;  1L0O C;  1T0F A;  1BR4 A;  1QBJ A;  2PJR A;  1JHF A;  3HKZ A;  5J8C A;  3FXU A;  2V79 A;  3HEF A;  4P5O A;  5EG0 A;  3HPG A;  3RKY A;  4GFB A;  4OOI A;  2Z9O A;  2LTP A;  1TNS A;  3DCF A;  4ZYH A;  5ILU A;  2HPI A;  4I7H A;  2B9S A;  1OR7 C;  2DT7 B;  2OTJ I;  3PFI A;  2WB1 N;  4II3 A;  4P9U A;  2FF4 A;  2M34 A;  2ICW G;  3HG9 A;  4DBQ A;  3WTY C;  1JJ6 C;  2FRH A;  1FNN A;  2L5Q A;  2MFZ A;  1R5H A;  3KYL A;  2ZFU A;  2B63 J;  4A69 C;  1I27 A;  5EEG A;  1U3E M;  1N77 A;  1FIP A;  4E4H A;  1OCC H;  1IDY A;  1P4X A;  3F21 A;  1S29 A;  1QNT A;  2HOA A;  2E1N A;  4XLP F;  3CP2 A;  4YIF A;  2R4G A;  1Q1V A;  1XCB A;  2H6B A;  5CVJ A;  1ZAO A;  3CMY A;  4RLF A;  2Z33 A;  3F8N A;  4A3C J;  2HGC A;  4BQO A;  3L2U A;  3BPX A;  1I6H J;  1BI2 A;  3X2Q H;  2YSR A;  4XKC A;  2DYS H;  4YG2 F;  3CMA I;  5L3F A;  2COB A;  4V19 K;  2I8D A;  4UUS A;  3I55 I;  5D5V B;  1NHA A;  3M1C A;  1LVA A;  5AIQ A;  4JX6 A;  3KP4 A;  5JLX A;  2MBF A;  5M5Y J;  3FIS A;  2MC4 A;  4IZZ A;  4IEJ A;  5FFX A;  3OSF A;  3DPL C;  1G2H A;  2VOP A;  3TL4 X;  2W84 A;  1NK2 P;  2ZXH A;  3TOB A;  1WHU A;  4WCG A;  4EJU A;  3JRF A;  2NVQ J;  2MGQ A;  3O8H A;  4NUB A;  2R5Z B;  2E7W A;  3GXO A;  2RKH A;  2FOW A;  4E6K G;  3P7N A;  5E20 A;  2M1B A;  3WU1 B;  2DOE A;  3J80 Z;  5HNF A;  3HTS B;  1WJA A;  1Z91 A;  2PMU A;  4C2T A;  1HA8 A;  3VWB A;  1IRF A;  4ZC3 A;  4M6V A;  3M07 A;  4WF2 A;  1KON A;  2LMD A;  1Z7U A;  2VC1 A;  1IGN A;  2LNB A;  1A04 A;  4B47 A;  1D0X A;  3GBG A;  4U0Y A;  4M73 A;  3M9A A;  2TCT A;  1GVJ A;  2GIZ A;  1IN6 A;  1Z3Y A;  3Q0V A;  3LSJ A;  5GAD J;  4FX4 A;  1FOY A;  3FHN A;  4JP0 A;  3QRF F;  2QGU A;  3HUG B;  3RDI A;  1V54 H;  3W2A A;  2JUG A;  2W82 A;  4DBR A;  5GP9 A;  3G73 A;  1FZP B;  1P7J A;  1LKX A;  4B48 A;  1BC7 C;  3H9Q A;  4RAF A;  1FSH A;  1EA3 A;  3B73 A;  3OY9 A;  2ZSH B;  3HYI A;  5F0F A;  3HOU J;  3NRV A;  1W4M A;  4OU0 A;  2CGP A;  1O7L A;  1Q1H A;  3QAH A;  2K86 A;  1QA6 A;  5GTI C;  2XRL A;  2LY1 A;  2X4H A;  4EJV A;  2ZXW H;  3V8J A;  3WGH A;  2UWM A;  3ZN1 A;  3QP6 A;  5DUK A;  4I99 C;  4BH9 A;  3PQJ A;  4OWR B;  1J2X A;  1G6N A;  5DM6 F;  1UG0 A;  1TL8 A;  1LEA A;  2NS7 A;  4PGH A;  5ICC A;  4IXA A;  3KLN A;  5LRR A;  4CA0 A;  3EYY A;  4ZTF A;  1QVU A;  1R4M B;  2WTE A;  4R79 A;  3ABM H;  2DK5 A;  2FX0 A;  2IS1 A;  3GW2 A;  3M8E A;  4MEX F;  5ED4 A;  4JK1 X;  3GTM J;  2M5W A;  2F5C A;  2GBY A;  1H9T A;  2V9K A;  3FKJ A;  2ZCW A;  4C9Y A;  4NQW B;  3MFK A;  4OIO F;  2Q8K A;  2ELK A;  3DTK A;  4WXH A;  3MCZ A;  1WJC A;  1MJ9 A;  3FXK A;  5L3C A;  1SEU A;  2VPL A;  4BBS J;  2FNP A;  2VUM J;  3I4P A;  3LMM A;  2COM A;  2DFI A;  3E7L A;  1YI2 I;  5A2Q K;  3DLA A;  2Q1Z B;  3BTJ A;  2JTV A;  4AC0 A;  3CC2 I;  3OYI A;  4LB5 A;  2LFB A;  1TW2 A;  3R60 A;  4MO7 A;  3K1M A;  2E1O A;  4M3D A;  4BBR J;  1T38 A;  3JRB A;  2IA1 A;  1D5Y A;  1V5F A;  1VND A;  3PNT A;  4XNF A;  2DCE A;  4G9Y A;  2JWT A;  5J1Y A;  3ML6 A;  5E79 C;  4QWQ A;  3S3N A;  1UG2 A;  2MA3 A;  2VQC A;  5ICF A;  3V8L A;  1PDN C;  2QBY B;  4X0G A;  2PG4 A;  5DUI A;  1MBJ A;  4EM2 A;  3N4M A;  2HZD A;  5DCM A;  3F3X A;  3L2C A;  1IXR C;  4QPQ A;  4U7D A;  2A6H F;  4BXX J;  5IYC J;  4ANJ A;  4W97 A;  1K78 B;  2HNH A;  2OBP A;  2KIU A;  3BRO A;  4ESJ A;  1DDN A;  2K9N A;  3PSF A;  1W1W E;  1BN5 A;  1HLV A;  1BM9 A;  4KT6 A;  2A6T A;  4JOM A;  4AID A;  1TT5 B;  1WJF A;  3ZCO A;  3D5L A;  1FEX A;  2DMQ A;  2E36 A;  5D4S A;  1ORK A;  2XAU A;  3ABL H;  4XR6 A;  3TBI A;  2NVU B;  4RGR A;  2DO7 A;  1FX7 A;  1NTC A;  2OF7 A;  2V1D A;  4AWX B;  3HKZ N;  4MGR A;  4FCY A;  3DXJ F;  2JPB A;  3KEO A;  4BEH B;  1RUO A;  1SMT A;  5CJ9 A;  4ZDL A;  4LIV A;  1TTY A;  5LD2 C;  3I53 A;  4DIQ A;  4E70 A;  4YEL A;  3C2B A;  4RB2 C;  1GDT A;  3BR2 A;  4B43 A;  3HSE A;  5C4X J;  3ISP A;  4N9H A;  4L18 B;  1V55 H;  3BG3 A;  4P1W A;  2A61 A;  1YS7 A;  3E6C C;  3IRQ A;  3S1M J;  3A2K A;  2IS2 A;  4EJT A;  1XCV A;  3NEU A;  5EEH A;  1IZ1 A;  1TWH J;  2CW7 A;  2FNA A;  4Q48 A;  1YIJ I;  5HDK A;  1B9N A;  2H94 A;  2E1C A;  2XKP A;  2HDW A;  2HZT A;  2DXI A;  1REP C;  4A3K J;  1AA7 A;  1I3Q J;  1I6X A;  5FFZ A;  4I02 A;  1SD4 A;  3W3C A;  2L3D A;  5KK1 A;  2B7E A;  2Z1D A;  3ZP5 A;  5F08 A;  1FOK A;  4ZH4 F;  4IQ4 A;  1JUS A;  3MKL A;  3CDH A;  3KP5 A;  4HOB A;  1D1A A;  4KMU X;  1K7A A;  4FT8 A;  1DPU A;  2W25 A;  3ASO H;  4HNU A;  4XMY A;  3A0H C;  1O3Q A;  3VOE A;  1FTT A;  2HFH A;  3RCO A;  5FKK A;  3AFH A;  2KFD A;  3LSH A;  4MQ9 F;  1FT9 A;  4HX7 A;  3ZQ7 A;  5IP7 J;  4IQJ A;  1EH7 A;  2R7Q A;  3VB2 A;  3CO7 C;  1BOA A;  5F6F A;  3K0L A;  4CUG A;  2R7W A;  1IXS B;  4PJM A;  4HZF A;  3NWT A;  2GAU A;  4XKV A;  5DEQ A;  1TW3 A;  1SVO A;  2M45 A;  3HOY J;  2M3A A;  1B9M A;  3QOD A;  2XAH A;  2BGC A;  3IP4 B;  3BT9 A;  2L9R A;  4HAM A;  3CJR B;  3PNY A;  2DDA A;  4DOZ A;  4EMS A;  3HOV J;  1A5J A;  1H89 C;  5B1B H;  2DFH A;  3EYI A;  5CPR B;  2ID6 A;  5E18 F;  3G1O A;  1YFH A;  2H8W A;  1U5T A;  3WU2 C;  3TED A;  1MGT A;  5H2F C;  4HX4 A;  4AU7 A;  3K10 A;  1H8A C;  2BHY A;  2ETH A;  4WWC A;  1VQ5 I;  4Z6Y A;  2DU9 A;  4AD9 A;  1MNE A;  1YW8 A;  3BCA A;  4KIC A;  1LDJ A;  2BHZ A;  2F5D A;  3HSF A;  2R7F A;  2AXT C;  2VPR A;  2HI3 A;  1FP2 A;  2YPR A;  5E3N A;  2PI0 A;  2G7H A;  4EGY A;  3L09 A;  3HOZ J;  1ZG1 A;  4HPQ A;  1I39 A;  2ZC2 A;  1JXS A;  3CQZ J;  2Y0M A;  2X6X A;  2P7C B;  1X4P A;  4A0Y A;  4A3F J;  4G12 A;  3OIP A;  5J4V A;  2DW4 A;  3ZMS A;  3GTJ J;  2KDZ A;  1ODD A;  2IGM A;  1TWC J;  4C2U A;  5DCM B;  1G3T A;  3A01 B;  1OYW A;  1A6I A;  5F0H A;  1YIO A;  1YX3 A;  1ZGW A;  4HLY A;  1JKQ C;  4EGZ A;  2NRA C;  1BI1 A;  1UEL B;  4LD5 A;  4OIN F;  3I9V 2;  4ENK A;  3CLQ A;  4O6J A;  2L9N A;  2ZB9 A;  2VBW A;  3ZRG A;  2BVL A;  2VKV A;  3UNG C;  2LG4 A;  4QIW N;  4RAY A;  2XRN A;  3QU6 A;  3VSL A;  1GUU A;  4ASN A;  3PM1 A;  2XF7 A;  3ONQ A;  1OYY A;  4MIM A;  3S16 J;  4MFE A;  4CIC A;  2OUM A;  2RQQ A;  4JX5 A;  4KT5 C;  3O8G A;  1TC3 C;  3KZY A;  4PJN A;  5GPA A;  4B09 A;  2ZME A;  3KLO A;  5B1A H;  5GAH J;  5HOO A;  2LKP A;  4LLN A;  5E17 F;  3OS1 A;  3LWF A;  4I2O A;  3DEE A;  2ADU A;  4KA4 A;  2TDX A;  2FE3 A;  1D1C A;  4A5M A;  1JTY A;  3TMO A;  5ERI A;  3J7Y J;  2G0E A;  3I59 B;  4NQW A;  2EK5 A;  1WCM J;  5BS6 A;  2CH0 A;  4GYG A;  4CYC B;  2M2E A;  1IN8 A;  1B72 B;  1IW7 F;  1OCO H;  3TO6 A;  1LB2 A;  1QRY A;  2MD0 A;  1VQ7 I;  2RVC A;  4XRS G;  3CCM I;  3IWZ A;  5H20 A;  5HS9 A;  1M1E B;  4A3I J;  1SMY F;  5ILV A;  3R0J A;  2HQR A;  3A4C A;  2QKM B;  3OV8 A;  3IAM 2;  2AQF A;  1SFX A;  3CCJ I;  3SDG A;  2L9V A;  2XUB A;  4KDP A;  1R58 A;  2L54 A;  2O7O A;  2YX4 A;  3FF5 A;  2VOD A;  2CQ7 A;  1Z77 A;  3RPU A;  2W85 A;  2CV2 A;  2XGE A;  2ESH A;  3BWG A;  4BAY A;  1LFP A;  1K6Y A;  4JBA A;  4KFC A;  3HL2 A;  2XAG A;  3FBI B;  5LLQ A;  4MFD A;  1GXP A;  2VL8 A;  4J00 A;  1X3W B;  2GLO A;  3ZQH A;  1HKS A;  1BI0 A;  1WGX A;  2JA2 A;  1YQA A;  5LGN A;  2IA0 A;  3I54 A;  2LBF B;  4XRM A;  1JKO C;  4IKF A;  1N78 A;  4XBF A;  4XOP A;  3ECH A;  3FX3 A;  2J5O A;  5KNL A;  3SEQ A;  2CFO A;  5DTD A;  2EWN A;  2WWY A;  2M87 A;  3ZN0 A;  3AL0 C;  3KET A;  1Z7L A;  2ZME B;  2DMU A;  1YIT I;  3KEQ A;  2RGV A;  2R92 J;  2G9W A;  1R49 A;  4EV0 A;  2VE9 A;  3T1B A;  1LE8 A;  2ACJ A;  4L5I A;  2Z3Y A;  1D0Z A;  1J5Y A;  2OPT A;  4RB0 A;  4BXF A;  5F1J A;  2EJR A;  2NS0 A;  1A6Q A;  3PNV A;  5FGM A;  3MKY B;  1X19 A;  5LRS A;  3L2R A;  1U0J A;  2IEK A;  1UAA A;  6PAX A;  4P9F A;  4L0Z B;  3SQN A;  3M1E A;  2VC0 A;  4EJO A;  2QM3 A;  4IPA A;  4ITV A;  4LOC A;  4I6Z A;  3BZ6 A;  2A05 A;  3K4M A;  3G4S I;  2HQ5 A;  3GME A;  3CLO A;  1KU2 A;  4WXD A;  4BQA A;  3PL8 A;  4NHJ A;  2QSF X;  3JTH A;  4Y15 A;  1UHW A;  4A93 J;  4LFU A;  2WB1 A;  1NK3 P;  4FAS D;  5JVT A;  3F0C A;  5KHD A;  4XN0 A;  2ID3 A;  4BAC A;  1U8R A;  1KQ8 A;  3GEZ A;  4CZZ A;  1BW6 A;  4LG0 A;  5K7F A;  3B6A A;  4CXF A;  4XN3 A;  3TDU C;  3LNQ A;  3CO6 C;  4ZDO A;  4JX4 A;  1K61 A;  1KQ0 A;  4XLA A;  4ZTJ A;  3M3Y J;  4OAY A;  1YHQ I;  1IN7 A;  1YS6 A;  2QA4 I;  4UVA A;  5L3D A;  4B8X A;  1MH4 A;  3DWL E;  1S72 I;  1YJW I;  4F92 B;  4U0V A;  2STT A;  4RAZ A;  1U5T B;  2EZH A;  5HLG A;  1I1G A;  1MMG A;  3WOD F;  2DJI A;  1OYI A;  3KP6 A;  2F2E A;  3Q0W A;  2PLY A;  1P92 A;  5B66 C;  4IRH A;  2PN6 A;  2AO9 A;  1F9N A;  2XDV A;  4PZJ A;  2MLG A;  2ZKZ A;  1OR7 A;  2CFX A;  3GTO J;  3I58 A;  2KPM A;  3JAM Z;  1PUE E;  4PSW A;  3TW6 A;  1BI3 A;  1IG7 A;  1A31 A;  3TKY A;  1XTA A;  1Z1D A;  2EZL A;  5EZG A;  3JRA A;  2R7U A;  3S93 A;  1S7A A;  3S1R J;  3RQ4 A;  3FK7 A;  5FD5 A;  4RB3 C;  2R7O A;  3M7G A;  4YFX F;  4BJT A;  1Y1V J;  2WAE A;  2VBX A;  2KJC A;  1UZC A;  2CUJ A;  1WH5 A;  4F93 B;  1D1B A;  3H9G A;  3L2V A;  5TGT A;  3PJR A;  2ZME C;  1UST A;  2JZY A;  1X1C A;  2RAE A;  1LFB A;  3RJP A;  4A3G J;  2I10 A;  3BZC A;  1RES A;  2LD5 A;  3SXY A;  4AIH A;  2JVG A;  2QVO A;  1J75 A;  1WQ2 A;  1FTZ A;  2HKX A;  3OS2 A;  1LEB A;  3WU0 A;  2BW3 B;  1WKM A;  2K3F A;  9ANT A;  3CZ6 A;  3QYB A;  4DYC A;  3S3M A;  3KIO A;  2GXB A;  3HRU A;  3Q9V A;  5C3E J;  1FPQ A;  2F6C A;  2X6O A;  1R1U A;  1MIJ A;  4XSZ F;  1IDZ A;  1V5E A;  3HSR A;  3MN2 A;  3I56 I;  4CCM A;  1T8I A;  1R5I D;  1X4O A;  2R93 J;  2W24 A;  1QQI A;  2E1M C;  2HTS A;  2VIX A;  1UMQ A;  4NNJ A;  2KT0 A;  3UKG A;  1XS9 A;  3K7A J;  4B4C A;  2YR2 A;  3BY6 A;  3SHF A;  3M8F A;  4YII A;  3F23 A;  2Z99 A;  1W5S A;  4G6Q A;  1IUF A;  2L7K A;  4I0B A;  3TOA A;  4MNU A;  3ZQG A;  1RET A;  1AKH A;  1F43 A;  3QYE A;  1QPM A;  2P5V A;  1ULY A;  2QKL B;  4BEH A;  1KU9 A;  5JVG F;  1FIA A;  1FLI A;  2DI3 A;  3K69 A;  2HU9 A;  4B3A A;  1WWX A;  3O2P E;  3JR9 A;  3KE2 A;  3HRT A;  2Y30 A;  4E7Z A;  2NOJ B;  1TQM A;  4N4O B;  4D0P A;  4CCO A;  4LLG F;  2NVY J;  3GTP J;  4EVI A;  4C3I J;  1KQ9 A;  1XMX A;  1LFU P;  4A3L J;  3ZQI A;  2G7U A;  1MNM C;  2BY3 A;  4HG2 A;  3PIO F;  3GTK J;  3O3K A;  1TNT A;  1RC9 A; 
#chains in the Genus database with same CATH homology
 5LEK A;  4HYE A;  4MQV A;  2P5K A;  3CUQ A;  5BOX A;  2UXN A;  3HOT A;  3ELK A;  4KMF A;  1I5Z A;  3TQN A;  1R22 A;  5L3G A;  2O0Y A;  2YU3 A;  3V7C A;  3GF2 A;  3GLX A;  1ZN2 A;  2ESN A;  4FX0 A;  3WTW C;  3RYR A;  5BQT A;  3F72 A;  4ON0 A;  2ZJ2 A;  2IVM A;  2EFN A;  3WTT C;  5HDG A;  3SFZ A;  2FQ3 A;  2EFW A;  4F7Z A;  5D6E A;  3U2R A;  5JI6 A;  2OQR A;  3F8B A;  2BV6 A;  5ICG A;  4WX9 A;  2HKO A;  3TGN A;  4M71 A;  1T6S A;  4MEY F;  3IKV A;  5K5Q A;  3E5X A;  2BBY A;  2IW5 A;  2XIG A;  1S3J A;  2PQ8 A;  1E17 A;  2DBB A;  1XDS A;  4UV8 A;  1HW2 A;  3QU3 A;  3F8M A;  3ZMD A;  2HOE A;  4U0W A;  2HYF A;  2KJB A;  2QQA A;  3MEX A;  3WG9 A;  3EUH A;  4GO1 A;  1XGN A;  2P6T A;  3ERE D;  2QUF A;  5D5U B;  2V9V A;  3B02 A;  2QEN A;  2V1X A;  4L0Y B;  4A12 A;  1BBY A;  1FYK A;  2EV6 A;  5LHH A;  1WSU A;  1SD7 A;  1KYZ A;  1SFU A;  2ISY A;  2P7V B;  3S2W A;  3HUG A;  1SD5 A;  4UUV A;  4R8H A;  2VBZ A;  5H6R A;  3E6D A;  4KIG A;  2GA2 A;  2XHK A;  1LQ1 A;  4BNC A;  1B6A A;  4LG0 B;  3QPT A;  2OZU A;  3V8K A;  4HF1 A;  4AIJ A;  4LJZ F;  3WTU C;  1ZH5 A;  3GVA A;  3GZ5 A;  1KU3 A;  3LAP A;  3RYP A;  4Q4Z F;  3ECO A;  5D5X B;  2CQK A;  2DQL A;  3VEP A;  4Y13 A;  3CTA A;  1O3T A;  3FHZ A;  2QQ9 A;  2OQG A;  3WTZ A;  1ZYR F;  4IVN A;  1UCR A;  4MTD A;  4RGU A;  1VTN C;  1ZRD A;  1R1T A;  3TO9 A;  2DPU A;  4M6Y A;  3DP7 A;  1F4K A;  5FLX K;  1HW5 A;  1Z6T A;  2ISZ A;  3DF8 A;  3R0A A;  3P9K A;  5KVR A;  1HKQ A;  4KNY A;  3GUD A;  4DNC A;  3H3U A;  2MH9 A;  4S05 A;  2XKO A;  2MD5 A;  5HVQ C;  4G8X A;  1QO0 D;  1PP8 F;  2NNN A;  5DYM A;  2XRO A;  5HLI A;  4ZYE A;  1LDK B;  2GWR A;  3H92 A;  3ZMU A;  1T39 A;  2DPD A;  4NB5 A;  3SZP A;  2PJP A;  1WRJ A;  4G7Z F;  1DP7 P;  2CSO A;  1O3S A;  1TQP A;  2L01 A;  3F22 A;  3TO7 A;  3JSP A;  3T8T A;  2Q0O A;  1EV7 A;  2BE5 F;  1YYV A;  2E7X A;  3E5Q A;  4YFK F;  3U9G A;  1OKR A;  2CYY A;  3ZMT A;  4ENM A;  3KCC A;  4Z2Y A;  1CF7 B;  3WTX C;  1HXD A;  3Q5F A;  2DT5 A;  1HST A;  1T2K A;  4P55 A;  1H0M A;  3MAJ A;  4A6D A;  3AAF A;  4DQ2 A;  3DFG A;  3C1D A;  3MQ0 A;  1SD6 A;  1UB9 A;  4ENN A;  1HBX G;  2FXA A;  4N0B A;  1R5G A;  4RB1 A;  2HWV A;  5D4R A;  1O3R A;  2LSO A;  1IRG A;  5LEJ A;  4G94 A;  2BYV E;  1XSD A;  2Q2E A;  2EA2 A;  1U2W A;  4L9N A;  3F6O A;  3QOP A;  1RI7 A;  1R36 A;  2D1H A;  2DTR A;  3HIF A;  3C7J A;  1XN7 A;  1XSV A;  2EFO A;  1AOY A;  2Y75 A;  2Z5U A;  4G7H F;  1BJA A;  1TLH B;  2XAJ A;  5E1X A;  2K7L A;  4U7B A;  2L4M A;  3FMQ A;  1HQC A;  3F6V A;  1KU7 A;  1DUX C;  3VOD A;  2HDC A;  4RGX A;  1O7F A;  4A5N A;  1XMA A;  1HSJ A;  4I09 A;  3DQV C;  3CJN A;  3O6B B;  1ZG3 A;  1FP1 D;  2ZXJ A;  3DKW A;  4A6E A;  1HKT A;  3C18 A;  2HR3 A;  3IC7 A;  5TJJ A;  4LK0 F;  4BHC A;  1R23 A;  4HV6 A;  4TV7 A;  3T5X A;  5DDG A;  2K02 A;  2VE8 A;  2V1U A;  1OMI A;  3W6K B;  3Q9S A;  3MWM A;  1HW1 A;  4IRG A;  3FMS A;  1AWC A;  4ESB A;  1Z9C A;  5TRD A;  5LGT A;  1XGS A;  5D8K B;  2HQN A;  3D0S A;  3RKW A;  1FBS A;  3LA7 A;  2LDU A;  1B4A A;  5BPD A;  4ETS A;  4KIB A;  3KFW X;  2EB7 A;  4O5V A;  5IT9 K;  4CHU A;  4GGG A;  2CG4 A;  3ABU A;  5LBQ A;  1ZRE A;  1USS A;  2K4B A;  5DCF A;  2FSW A;  2QZ8 A;  4RS8 A;  3J81 Z;  1JE8 A;  2DK8 A;  2A6E F;  4ENJ A;  5AIP A;  2FU4 A;  4HBL A;  2RN7 A;  2EV0 A;  3C3W A;  2JRT A;  3FXR A;  3HHG A;  3V7S A;  5J6X A;  1B1B A;  2AS5 F;  1EH6 A;  3E6B A;  4KIF A;  1G3S A;  4FHT A;  4HQE A;  4Q5S F;  3RKX A;  2V6C A;  1S7O A;  3RTR A;  2ZNZ A;  2IRF G;  1W5T A;  1YW7 A;  2VBY A;  3J7A O;  1L3L A;  3WTV C;  5DD8 A;  5HLH A;  3QP5 A;  2GXG A;  1KYW A;  4P96 A;  1D8K A;  2PMH A;  3GZ6 A;  1GHC A;  3HHH A;  5CVU A;  2OZ6 A;  3BJA A;  2A5Y B;  2UXX A;  3U1D A;  3LQQ A;  1Y0U A;  1MDM B;  1ZLK A;  5CYV A;  1F5T A;  2WC2 A;  4XSX F;  2STW A;  1LJ9 A;  2EFQ A;  2GA1 A;  2P5L C;  5CLS A;  1MJB A;  2M8E A;  2L4A A;  4M9S A;  3N97 A;  1ZGA A;  5AON A;  2YX7 A;  3FZV A;  3MZY A;  1QGP A;  2HYG D;  3MZH A;  2M30 A;  4UV9 A;  2H27 A;  5FD6 A;  4LK1 F;  3ULQ B;  1H9G A;  5J8F A;  1W7P A;  4HF0 A;  4HDU A;  5DD4 A;  2HEO A;  4A0X A;  4UXN A;  2OAZ A;  3F8C A;  2KIM A;  5ILS A;  1UFM A;  3K1N A;  2FA5 A;  2NYX A;  3FMR A;  4XRF A;  1BIB A;  3ZMV A;  4MTE A;  2VOO A;  1J59 A;  5JFR A;  1P6R A;  3RI4 A;  2FBH A;  3I71 A;  1XSX A;  2F5E A;  5JHU A;  2ZNY A;  2IPQ X;  4IHT A;  2XAQ A;  2QWW A;  4WXC A;  2RNJ A;  1MKM A;  5IT3 A;  3GFI A;  4CO8 A;  2CWE A;  2QYO A;  2A68 F;  1ON1 A;  2D45 A;  2H09 A;  3ZMZ A;  1ONV A;  3IHU A;  3COA C;  2O03 A;  2FMY A;  4BYY A;  4LMY A;  1BIA A;  4ZYG A;  2P6S A;  4LGW A;  3LA2 A;  2KKO A;  4L9J A;  1G3W A;  4IJA A;  4HX8 A;  1C0W A;  3FM3 A;  1MD0 A;  5L3B A;  1ZHF A;  3H3Z A;  4L9V A;  1FY7 A;  3ROU A;  5HDN A;  3QPH A;  3LFK A;  4AIK A;  1RUN A;  5D8L B;  3CUO A;  5ICE A;  2OA4 A;  4EM1 A;  1K79 A;  2XV4 S;  2FML A;  2K27 A;  3DPT A;  2MH2 A;  1WI9 A;  3GX4 X;  1YO5 C;  3E5U A;  3REO A;  1ZG5 A;  2RQP A;  1J0R A;  2MC3 A;  5F64 A;  4KUM A;  1IUY A;  1YLF A;  4CDG A;  1V3F A;  3EDP A;  1ZRC A;  4CYD A;  2IT0 A;  1P4A A;  2X0L A;  1S6L A;  4Y17 A;  3JAM K;  3GWZ A;  5H6Q A;  3TDZ C;  1FYL A;  3LST A;  2C6Y A;  1JGS A;  2HS5 A;  2IP2 A;  5LHI A;  1W7P D;  3FM5 A;  4YFN F;  1K6O A;  2R7D A;  3IL2 A;  3FXQ A;  2JSC A;  4OIR F;  4QLC U;  3KP7 A;  5FB2 A;  2DAO A;  2B0L A;  1LDD A;  1IN5 A;  2JPC A;  5HS8 A;  1D8J A;  3GFM A;  4BHP A;  4OMY A;  3L9F A;  3JW4 A;  3CUQ B;  1UHM A;  1K78 A;  1W7P B;  1IXC A;  3E6M A;  4WK8 F;  5HS7 A;  3EET A;  1J9I A;  2O61 A;  3I64 A;  1Z6R A;  1KGS A;  4UVC A;  3CUQ C;  1SFE A;  3BDD A;  2RV8 A;  2QBY A;  1TBX A;  1T98 A;  4ZZD A;  4HDV A;  1D5V A;  2JT1 A;  3GFJ A;  5K5R A;  4UVB A;  2GQQ A;  4GXO A;  5A2Q Z;  3V7R A;  1XB4 A;  3WE3 A;  4EJW A;  2BEO A;  4O3M A;  2EFP A;  4Q47 A;  2KRF A;  1MDM A;  2XAF A;  4L9T A;  1GXQ A;  3L7W A;  3JTG A;  3HOS A;  4A0Z A;  1Z05 A;  3G3Z A;  5JR3 A;  1QZY A;  1SAX A;  2O8X A;  5BMZ A;  1FWZ A;  4UHT A;  1G4D A;  1E2X A;  2ZO4 A;  3K2Z A;  1ZAR A;  2OD5 A;  4IHS A;  5E1Z B;  3R4K A;  4N9I A;  2UZK A;  2XAS A;  3E97 A;  5F1R A;  3F8F A;  5D5W B;  2DLL A;  1MZB A;  3HTU A;  1FYM A;  1YW9 A;  3FWE A;  5BPI A;  4M74 A;  4CGZ A;  2D2W A;  1XDU A;  5E8I A;  1ON2 A;  4OMZ A;  1R7J A;  4EQQ A;  4K2E A;  2ZFW A;  3EQL F;  3OOP A;  2AXL A;  1XGM A;  3KZZ A;  3GO5 A;  2RDP A;  4M9Z A;  4ZZL A;  1F1Z A;  2XGX A;  4LB6 B;  3LA3 A;  2IJL A;  3ABT A;  3GYH X;  5CVR A;  4UNO A;  2H6C A;  4BHB A;  1RZ4 A;  3I0T A;  3R6S A;  5CVI A;  2P8T A;  2KIF A;  1S8N A;  2D1V A;  4M9X A;  3HRM A;  2NAZ A;  2J5P A;  3DEU A;  4HV5 A;  4OIP F;  2PFB A;  1I1S A;  2ELH A;  2RC4 A;  1KA8 A;  4PCQ A;  4R1H A;  4KN4 X;  1EH8 A;  1YG2 A;  2NNY A;  1XGO A;  3J80 K;  4H0E A;  4U88 A;  1O57 A;  3PQK A;  3BPV A;  1TQI A;  4S04 A;  5L3E A;  2CW0 F;  2EA4 A;  2PEX A;  3IWF A;  1FBU A;  2VXZ A;  4M6X A;  5CVV A;  3LQR A;  4ZYD A;  1JHH A;  3BJO A;  4MHG A;  5LGU A;  3JSO A;  4XLN F;  3BJ6 A;  2GZW A;  1FSE A;  1STZ A;  1OPC A;  2P4W A;  2WV0 A;  2LF7 A;  4BXU A;  3J81 K;  2A69 F;  4IF4 A;  3NQO A;  4I0A A;  3I5U A;  2PBI A;  4HQM A;  2A3S A;  1U78 A;  1IN4 A;  4ESF A;  4EM0 B;  3T0Y A;  3KP2 A;  5IT9 Z;  3GFL A;  3ZPL A;  2DQR A;  5E1W A;  5DV5 A;  1IAW A;  1P4W A;  2ZBK A;  4IRI A;  4G7O F;  1LNW A;  2MLK A;  1R00 A;  2LF8 A;  2W57 A;  2IA2 A;  4L5J A;  1PP7 U;  1FC3 A;  1XMK A;  4RGS A;  5FLX Z;  3I59 A;  3WTS C;  1IF1 A;  3P9I A;  1XD7 A;  2FOK A;  3BOQ A;  4OIQ F;  2VT2 A;  2FBK A;  3RPQ A;  1QZZ A;  5E8G A;  3HRS A;  5K5O A;  1CGP A;  3IRR A;  2XVC A;  3W6J B;  1R1V A;  1D3Y A;  5FO5 A;  3T8R A;  2L02 A;  1U6G A;  1X3U A;  4G6D A;  2Y48 A;  1V4R A;  2VN2 A;  4KN7 X;  1CF7 A;  4HLX A;  4GCV A;  4A2U A;  3WE2 A;  5LHG A;  4HW0 A;  2FBI A;  4PDK A;  5D6F A;  2K4J A;  2VON A;  2R3S A;  4HF2 A;  1P2F A;  4I98 B;  3WGI A;  2O3F A;  3K1P A;  4JQF A;  3WGG A;  1ZRF A;  1RNL A;  2A07 F;  3BP8 A;  3SZT A;  3RIR A;  1B59 A;  2O6G E;  2QLZ A;  2EV5 A;  3VFZ A;  3K9T A;  1FBQ A;  1BC8 C;  1G3Y A;  1ZGJ A;  3R61 A;  4HA8 A;  1RIO H;  2F5F A;  2FEZ A;  1ZLJ A;  3V4G A;  1MJA A;  2HTJ A;  2GIV A;  1YTY A;  4LLL A;  3LAJ A;  1J7K A;  4PGG A;  2CO5 A;  4M72 A;  3DV8 A;  1U5T C;  3L00 A;  3P9C A;  4AVP A;  5K1Y A;  2QQB A;  2VT3 A;  4I01 A;  1DPR A;  3E3V A;  4KYW A;  4GYI A;  3IKT A;  1QBJ A;  3KP3 A;  2OU2 A;  1L0O C;  1T0F A;  1JHF A;  5J8C A;  3FXU A;  2V79 A;  4P5O A;  3RKY A;  4OOI A;  2Z9O A;  1TNS A;  4ZYH A;  5ILU A;  4I7H A;  3PFI A;  4P9U A;  2FF4 A;  3WTY C;  2FRH A;  1FNN A;  1R5H A;  1U3E M;  1I27 A;  5EEG A;  1P4X A;  3F21 A;  1S29 A;  1QNT A;  2E1N A;  4XLP F;  4YIF A;  1XCB A;  2H6B A;  5CVJ A;  1ZAO A;  2Z33 A;  3F8N A;  2HGC A;  3BPX A;  1BI2 A;  2YSR A;  4YG2 F;  5L3F A;  5D5V B;  1NHA A;  1LVA A;  5AIQ A;  3KP4 A;  2MBF A;  5FFX A;  3DPL C;  2VOP A;  2W84 A;  3TOB A;  4WCG A;  4EJU A;  2E7W A;  3GXO A;  2RKH A;  3P7N A;  5E20 A;  2M1B A;  3WU1 B;  3HTS B;  3J80 Z;  1Z91 A;  2PMU A;  1IRF A;  4WF2 A;  1Z7U A;  2VC1 A;  2LNB A;  1A04 A;  4U0Y A;  4M73 A;  3M9A A;  1GVJ A;  1IN6 A;  4FX4 A;  3QRF F;  3RDI A;  3G73 A;  1FZP B;  1BC7 C;  1FSH A;  3B73 A;  3HYI A;  3NRV A;  1W4M A;  4OU0 A;  2CGP A;  1O7L A;  1Q1H A;  3QAH A;  2K86 A;  2X4H A;  4EJV A;  3V8J A;  3WGH A;  2UWM A;  3ZN1 A;  3QP6 A;  5DUK A;  4BH9 A;  3PQJ A;  1J2X A;  1G6N A;  1LEA A;  4PGH A;  5ICC A;  4IXA A;  3KLN A;  5LRR A;  3EYY A;  2WTE A;  4R79 A;  2DK5 A;  3GW2 A;  3M8E A;  4MEX F;  5ED4 A;  4JK1 X;  2M5W A;  2F5C A;  1H9T A;  2ZCW A;  4OIO F;  3MFK A;  2Q8K A;  4WXH A;  3MCZ A;  1MJ9 A;  5L3C A;  2FNP A;  3I4P A;  2COM A;  2DFI A;  5A2Q K;  2JTV A;  4LB5 A;  1TW2 A;  3R60 A;  3K1M A;  1T38 A;  2IA1 A;  4G9Y A;  3ML6 A;  4QWQ A;  5ICF A;  2MA3 A;  3V8L A;  1PDN C;  2QBY B;  2PG4 A;  5DUI A;  4EM2 A;  3N4M A;  5DCM A;  3F3X A;  3L2C A;  1IXR C;  4U7D A;  2A6H F;  1K78 B;  2OBP A;  2KIU A;  3BRO A;  4ESJ A;  1DDN A;  1BN5 A;  1BM9 A;  3D5L A;  5D4S A;  4RGR A;  2DO7 A;  1FX7 A;  2V1D A;  4AWX B;  4MGR A;  3DXJ F;  2JPB A;  3KEO A;  1RUO A;  1SMT A;  5CJ9 A;  1TTY A;  3I53 A;  4E70 A;  4RB2 C;  3HSE A;  3ISP A;  4N9H A;  4L18 B;  2A61 A;  1YS7 A;  3E6C C;  3IRQ A;  4EJT A;  1XCV A;  3NEU A;  5EEH A;  1IZ1 A;  2FNA A;  4Q48 A;  5HDK A;  1B9N A;  2H94 A;  2E1C A;  2XKP A;  2HZT A;  1REP C;  5FFZ A;  1I6X A;  4I02 A;  1SD4 A;  2L3D A;  5KK1 A;  3ZP5 A;  1FOK A;  4ZH4 F;  3CDH A;  3KP5 A;  4HOB A;  4KMU X;  1K7A A;  4FT8 A;  1DPU A;  2W25 A;  1O3Q A;  3VOE A;  2HFH A;  3ZQ7 A;  4MQ9 F;  1FT9 A;  4HX7 A;  1EH7 A;  3VB2 A;  3CO7 C;  1BOA A;  5F6F A;  3K0L A;  1IXS B;  4HZF A;  2GAU A;  5DEQ A;  1TW3 A;  2M45 A;  1B9M A;  2XAH A;  2BGC A;  4HAM A;  4EMS A;  3EYI A;  5E18 F;  1YFH A;  1U5T A;  1MGT A;  4HX4 A;  2ETH A;  4WWC A;  2DU9 A;  4AD9 A;  1YW8 A;  4KIC A;  1LDJ A;  2F5D A;  2R7F A;  2YPR A;  3HSF A;  1FP2 A;  2PI0 A;  2G7H A;  4EGY A;  3L09 A;  1ZG1 A;  1JXS A;  2Y0M A;  2P7C B;  4A0Y A;  2DW4 A;  3ZMS A;  1ODD A;  5DCM B;  1G3T A;  1OYW A;  1YIO A;  4HLY A;  4EGZ A;  2NRA C;  1BI1 A;  4LD5 A;  4OIN F;  4ENK A;  4O6J A;  2VBW A;  4RAY A;  2XRN A;  3QU6 A;  4ASN A;  1OYY A;  4CIC A;  4KT5 C;  3KZY A;  4B09 A;  2ZME A;  3KLO A;  5HOO A;  2LKP A;  4LLN A;  5E17 F;  4I2O A;  3LWF A;  2ADU A;  4KA4 A;  2TDX A;  2FE3 A;  4A5M A;  5ERI A;  3I59 B;  4NQW A;  2EK5 A;  5BS6 A;  4GYG A;  1IN8 A;  1IW7 F;  3TO6 A;  1LB2 A;  2RVC A;  3IWZ A;  5H20 A;  5HS9 A;  1SMY F;  5ILV A;  3R0J A;  2HQR A;  3OV8 A;  1SFX A;  4KDP A;  2XUB A;  1R58 A;  2L54 A;  3FF5 A;  2YX4 A;  2VOD A;  3RPU A;  2W85 A;  2ESH A;  3BWG A;  4BAY A;  4JBA A;  4KFC A;  2XAG A;  5LLQ A;  1GXP A;  1HKS A;  1BI0 A;  1YQA A;  5LGN A;  2IA0 A;  3I54 A;  4XBF A;  3ECH A;  3FX3 A;  2J5O A;  2EWN A;  2WWY A;  2M87 A;  3ZN0 A;  3KET A;  2ZME B;  3KEQ A;  2RGV A;  2G9W A;  4EV0 A;  2VE9 A;  3T1B A;  2ACJ A;  4L5I A;  2Z3Y A;  1J5Y A;  4RB0 A;  2EJR A;  2NS0 A;  5FGM A;  5LRS A;  6PAX A;  4P9F A;  4L0Z B;  3SQN A;  3M1E A;  2VC0 A;  4EJO A;  2QM3 A;  4IPA A;  3BZ6 A;  3CLO A;  1KU2 A;  4WXD A;  4BQA A;  4NHJ A;  3JTH A;  4Y15 A;  1UHW A;  4LFU A;  5JVT A;  1U8R A;  1KQ8 A;  3GEZ A;  4CZZ A;  3CO6 C;  4LG0 A;  4CXF A;  3TDU C;  1KQ0 A;  1IN7 A;  1YS6 A;  4UVA A;  5L3D A;  4B8X A;  4U0V A;  2STT A;  4RAZ A;  1U5T B;  5HLG A;  1I1G A;  3WOD F;  1OYI A;  3KP6 A;  2F2E A;  2PLY A;  1P92 A;  4IRH A;  2PN6 A;  1F9N A;  4PZJ A;  2MLG A;  2ZKZ A;  1OR7 A;  2CFX A;  3I58 A;  3JAM Z;  1PUE E;  1BI3 A;  3TKY A;  1Z1D A;  1S7A A;  5FD5 A;  4RB3 C;  3M7G A;  4YFX F;  2VBX A;  2KJC A;  1UST A;  2JZY A;  3RJP A;  3SXY A;  4AIH A;  2QVO A;  1J75 A;  1WQ2 A;  2HKX A;  1LEB A;  3WU0 A;  1WKM A;  2GXB A;  3HRU A;  3Q9V A;  1FPQ A;  4XSZ F;  1R1U A;  3HSR A;  2W24 A;  1QQI A;  2HTS A;  2YR2 A;  3BY6 A;  3SHF A;  3M8F A;  4YII A;  3F23 A;  2Z99 A;  1W5S A;  4G6Q A;  4I0B A;  3TOA A;  4MNU A;  1QPM A;  2P5V A;  1ULY A;  1KU9 A;  1FLI A;  2DI3 A;  3K69 A;  1WWX A;  3O2P E;  3KE2 A;  3HRT A;  1TQM A;  4D0P A;  4LLG F;  4EVI A;  1KQ9 A;  2G7U A;  3O3K A;  1TNT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...