4FHTA

Crystal structure of the pcav transcriptional regulator from streptomyces coelicolor in complex with its natural ligand
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
141
structure length
141
Chain Sequence
b'MAAVDLATHPGHLARRLQQAHYLLWNTMVSEETTSPQYAVLNALVAEPGLDQRTVGERVGLDRSTIAEVVSRLGRRGLLDKVRDPQDGRRSLLRLTDEGLRVHRRLGVRIARMNQVFLAPLAADEQAVFFDLIRRVADAAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PcaV transcriptional regulator
publication title Study of PcaV from Streptomyces coelicolor yields new insights into ligand-responsive MarR family transcription factors.
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Transcription
total genus 50
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13463 HTH_27 Winged helix DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4fhtA00
3RYRA 1HW5A 4HDVA 4FX4A 1QO0D 2ZCWA 2JRTA 2YSRA 3J81K 4AIJA 4HDUA 3KZZA 4P9UA 2JTVA 3NEUA 3F8NA 2IA0A 5BS6A 2ZMEB 3BDDA 5HDGA 4WX9A 1RUNA 3FM3A 1CF7B 3TO7A 1O7FA 5KK1A 4I2OA 2TDXA 1DPRA 1HSJA 2W84A 3T0YA 3RDIA 3IRQA 4MEYF 3L09A 3LWFA 3HHGA 4CHUA 2FE3A 3QRFF 4I7HA 3T1BA 5LEKA 1S29A 2J5PA 2K4JA 3WTTC 1K6OA 1RUOA 2LF7A 4KFCA 3ISPA 1P4WA 3HTSB 3ZN0A 2KIFA 1YG2A 2HDCA 3T8RA 4EJOA 1Z6TA 2BYVE 2GXBA 2AXLA 1MJ9A 4D0PA 2RQPA 1EH7A 4L9NA 2A07F 4XLPF 1FLIA 1UHWA 3WTVC 1KU3A 1R23A 3QPHA 4M9ZA 5LEJA 2GA2A 3I4PA 2CYYA 5HVQC 2STWA 3HRTA 4RB3C 4EGYA 3RKWA 3WTZA 2V6CA 1IN8A 3LQRA 1LDKB 2VN2A 4G6DA 4ETSA 3WE3A 1IXCA 3JSPA 2FU4A 2QVOA 3Q5FA 5HLHA 1F5TA 2HOEA 2L01A 4EVIA 3RPQA 1FYMA 3LSTA 2FSWA 3QP5A 4RAZA 2EK5A 1SMTA 2XGXA 5E8GA 1HKSA 1REPC 2EV6A 3VODA 5HLGA 1W7PD 1KU2A 3RTRA 1G3SA 3VOEA 1C0WA 2HFHA 1P4AA 4DNCA 2V79A 4A0XA 1Z7UA 4N0BA 1J75A 4YG2F 3IHUA 2LNBA 2GAUA 3SFZA 2K86A 5E20A 3K1PA 3QPTA 3SQNA 2W85A 2K27A 4KIGA 1F1ZA 5E8IA 3HRSA 3ECHA 3GEZA 4M71A 4XSZF 2Z99A 1XCVA 2QUFA 1ODDA 1D3YA 5LBQA 2QLZA 4JBAA 3C7JA 2HTJA 1IN7A 2PQ8A 4EM1A 2Z9OA 1B6AA 5L3CA 1U2WA 1IZ1A 2E1NA 1I1GA 1ULYA 4IPAA 3FHZA 4EJUA 1IXRC 1BI2A 3TOBA 5E1XA 5D4RA 2DI3A 5DCMB 3TOAA 4ENNA 1U6GA 1OYYA 4LFUA 1ZG3A 2HTSA 4OU0A 2VOPA 1LEAA 2JPCA 2K4BA 2CO5A 3WGIA 1U5TB 5CJ9A 3EYIA 2EFWA 4WCGA 4MQVA 4A6EA 3TO9A 4K2EA 1YS6A 2X4HA 4OIQF 4AIKA 4CDGA 2MA3A 1XSVA 1X3UA 3KEOA 5DDGA 3OV8A 1OYWA 3L2CA 1SD7A 3TQNA 4L5IA 1YQAA 2P6SA 2PEXA 1SFEA 4ZZDA 1I27A 2M87A 1T98A 1OKRA 2L4AA 5ICFA 3KEQA 4CICA 2CWEA 4N9IA 2EA2A 1HSTA 2E7XA 4CZZA 2XUBA 1FP1D 3C3WA 3WGGA 3DV8A 4KYWA 3RKXA 1FPQA 3F22A 1FZPB 1XGOA 5H20A 2DPUA 4OOIA 3N4MA 2FEZA 3F6OA 4LK0F 3E6MA 2HEOA 1ZRFA 3E5QA 3KCCA 3ZN1A 1J5YA 4BAYA 2R7FA 2W25A 3OOPA 3SHFA 2VBZA 1KU9A 2FNPA 2V1XA 1E2XA 3IWZA 3HSRA 2DFIA 3R0JA 2OQGA 4ENJA 1STZA 1TLHB 5FFZA 4OIPF 2Z33A 4ENKA 2VE9A 3EETA 1U5TA 1RI7A 1LDJA 5CYVA 3BROA 4Z2YA 1S8NA 5AIPA 2FRHA 4YFXF 1ZLKA 3H3ZA 4YFKF 2VC0A 3COAC 4EM0B 4ZYDA 3KLNA 2D45A 1D5VA 2CGPA 1GHCA 2RDPA 4A2UA 5FGMA 4Q47A 2DTRA 5H6RA 4I02A 2OZUA 5LLQA 2QENA 4Q48A 3E6DA 1SD6A 3L00A 1F9NA 2P8TA 3K0LA 4U0VA 3TGNA 5HS9A 1T2KA 1ZH5A 2L3DA 1R5GA 3KP3A 3L7WA 1W5SA 2FA5A 2XV4S 2BV6A 3DPLC 2PI0A 3WE2A 1P6RA 1FP2A 2BGCA 4CGZA 3I53A 3EQLF 1W4MA 1TW2A 3F8BA 2NS0A 1D8JA 5HOOA 5CVUA 2FBKA 4I0BA 1YLFA 3D5LA 4G6QA 4U7DA 1QGPA 4LD5A 1EH6A 5ILVA 1NHAA 3WU0A 3CUQA 2NRAC 5CLSA 2Q0OA 3ZMZA 1IN4A 1TNTA 3WTYC 1V3FA 1B4AA 1MZBA 2IP2A 3MZYA 4PZJA 4Q4ZF 2ZKZA 5L3EA 3P9CA 5DUKA 3HSEA 4A5MA 1U5TC 3F8FA 3V8LA 1GXQA 3BPVA 1RIOH 3WTXC 1LNWA 1J0RA 1YW8A 3ZMVA 2GIVA 4HZFA 2XKOA 2DW4A 1YS7A 4RGUA 4UVAA 1BI3A 3QOPA 3J7AO 1Y0UA 2FBIA 3B73A 3IKTA 4ESFA 3F72A 4YIIA 3TO6A 1YW7A 3LAJA 3G73A 4L0YB 3VEPA 1TW3A 1R36A 3QP6A 3I5UA 2VE8A 5BPIA 2NNNA 5CVVA 5D8LB 2XASA 3CJNA 2K7LA 2HWVA 4P5OA 4UUVA 1R7JA 3KP5A 3IKVA 3U1DA 1MJBA 1XSXA 1K78A 2PN6A 4TV7A 4AIHA 5E1WA 2XAFA 2G7HA 5CVRA 1IRFA 4ASNA 1R5HA 2A61A 2G9WA 1W5TA 4ESJA 2QWWA 3GXOA 3C1DA 4I0AA 1YYVA 4RB2C 5LRSA 2B0LA 5EEHA 1F4KA 4HW0A 2JZYA 2ADUA 3F21A 4L9JA 4EGZA 2HR3A 1G3WA 4KMUX 4YFNF 3F3XA 5F64A 4XSXF 1S7OA 2EV5A 1FYLA 1JHFA 2RC4A 4N9HA 1ZLJA 4MHGA 1R58A 3ZMDA 1R22A 4IHSA 3KP4A 2HYFA 3ZQ7A 1E17A 2ELHA 2V1DA 3E5XA 1O3RA 1MGTA 1FC3A 2H6CA 2UZKA 3DKWA 2XAHA 4UVBA 1J59A 4IVNA 3DXJF 5L3BA 3C18A 2Q2EA 1O3QA 2QQBA 3RYPA 2HYGD 3SZPA 5BQTA 4DQ2A 2RV8A 2V1UA 3MCZA 5BPDA 3V4GA 5FLXZ 2G7UA 4KDPA 5L3FA 3JTGA 2F2EA 1ZAOA 3P9IA 5JI6A 3E6BA 2FXAA 4U0WA 2HKOA 2CG4A 4HAMA 1AOYA 3JTHA 3R60A 1G6NA 1IF1A 2LSOA 4KUMA 4FHTA 3VFZA 2GZWA 2JPBA 4IF4A 4KN4X 5ICCA 4KIFA 3FXUA 4G7HF 3LA2A 1OR7A 3NRVA 1WKMA 3TDUC 2M1BA 5LGUA 2FMLA 1B9MA 2NNYA 3GVAA 1FY7A 2ZFWA 1ZREA 4O5VA 2FF4A 2H27A 5LHGA 2ZO4A 3K1MA 3M7GA 3FXQA 5D5XB 4KNYA 4L18B 5L3GA 1LVAA 2VODA 3DF8A 4M6XA 3VB2A 3BZ6A 1EV7A 1BC8C 2RKHA 2ZJ2A 1MDMA 2IW5A 1PP7U 2WV0A 4A5NA 4LMYA 5K1YA 1TQPA 1H0MA 5D8KB 2IA2A 3E6CC 3K1NA 3HRMA 1S7AA 1FOKA 3LA7A 2DQLA 3LA3A 5D5VB 1KQ9A 3KE2A 4PGGA 3W6KB 1WSUA 3H92A 1ZRDA 3T5XA 4WF2A 2P6TA 2JSCA 2LDUA 1T6SA 1K79A 1Z05A 4ZYHA 3FX3A 1ZG5A 3GZ6A 3WTSC 3SZTA 1J7KA 2DK5A 4S05A 2Z5UA 1SD4A 1XCBA 2GA1A 2QBYA 1Z91A 4OIOF 4Y17A 2UXNA 3GW2A 4M6YA 2LF8A 3GWZA 3WU1B 4KICA 2HKXA 3HUGA 1YO5C 1Z1DA 5E1ZB 4EMSA 1Z6RA 4HX7A 1UHMA 1W7PA 4ZZLA 1KA8A 2L4MA 2PLYA 3GO5A 2KKOA 4I98B 3M8FA 6PAXA 3CUOA 1QZYA 2XAJA 3QU6A 1WRJA 5FD6A 1BIAA 2MH2A 2E7WA 1TBXA 4PGHA 2IJLA 1J9IA 3HOTA 3HHHA 1CGPA 3JSOA 2X0LA 2RNJA 2FBHA 4R1HA 1FBSA 1ZYRF 2P4WA 1ON1A 3B02A 4L9TA 1JGSA 1SAXA 2IPQX 3BWGA 3GF2A 3CO6C 1EH8A 5AONA 1LB2A 1XGMA 3BY6A 4R8HA 3LQQA 2YU3A 3F8MA 5K5RA 4Y13A 3CUQB 2RVCA 1MKMA 2DLLA 2A3SA 3R61A 3U9GA 3FMSA 4S04A 4LGWA 1XB4A 5K5OA 2BBYA 1KU7A 2COMA 1USTA 2ISYA 2LKPA 1QPMA 1DPUA 5J6XA 2OAZA 1IAWA 2IA1A 1U3EM 3BJAA 4GYGA 3BP8A 4LG0B 3WTWC 1BBYA 2EFQA 3T8TA 2J5OA 4G7ZF 3ZMSA 3JW4A 3ZMTA 3HSFA 2IRFG 5LGNA 1TNSA 5HS7A 2O6GE 2VOOA 2KJCA 2XRNA 2ZBKA 3KP6A 3KP2A 2XAQA 3MEXA 5J8CA 3FZVA 3V8JA 3R0AA 2XHKA 4KIBA 2FOKA 4HX4A 4L9VA 4O3MA 3FWEA 3GLXA 1DDNA 2RN7A 2GWRA 4G8XA 1J2XA 5DD4A 3CO7C 2IT0A 4HA8A 1QNTA 2K02A 1H9GA 3RKYA 4RGXA 4HF2A 2ESNA 1SFXA 2DAOA 3M9AA 3MAJA 4MQ9F 1ZN2A 3LAPA 3P7NA 4LB5A 5FO5A 5ERIA 4HBLA 4UVCA 4YIFA 4UNOA 3ABUA 1K78B 4ZYGA 2ZXJA 5HDKA 2PJPA 2OU2A 4MTEA 4B8XA 4HQEA 1DP7P 1ZGAA 1FBUA 5DV5A 2A69F 3DQVC 4OMYA 3EYYA 4Y15A 1O3SA 3BJ6A 4RGSA 2H09A 2Q8KA 3M1EA 3CLOA 4KA4A 3ZPLA 4A12A 1QBJA 2QYOA 2GQQA 3BOQA 1KGSA 1YW9A 1PP8F 1HKQA 1XMKA 2EFOA 1IW7F 1XGSA 3I54A 4UV9A 4XLNF 4LG0A 2EFPA 2P7CB 3K9TA 2O0YA 1T0FA 2XKPA 3F8CA 4JK1X 3DP7A 1KQ0A 4LLGF 4BXUA 5E17F 1O7LA 4IJAA 1FBQA 3KLOA 1YFHA 5HDNA 3JAMK 2QQ9A 3HYIA 1USSA 1IN6A 4EQQA 3TKYA 1UB9A 4JQFA 2M45A 3MZHA 3O2PE 4LJZF 4P96A 2FQ3A 1IRGA 2QQAA 3R4KA 4QWQA 1SMYF 5LHHA 2KIMA 1FYKA 4G7OF 2VT2A 1UFMA 1YTYA 4ZYEA 1QZZA 2W57A 2CQKA 1O57A 3MWMA 4HV6A 1I1SA 1MJAA 5FFXA 4LB6B 1D8KA 2Y75A 5D4SA 4GXOA 5DEQA 1WWXA 2OA4A 3MQ0A 5FLXK 4E70A 2NAZA 3I59B 3CUQC 4LLLA 4EM2A 5LGTA 2O8XA 4ON0A 2Y0MA 3FM5A 3G3ZA 1XDSA 5IT9K 3PQJA 3RI4A 3JAMZ 1TQIA 2F5CA 1MDMB 1R1VA 1BIBA 1GVJA 2OZ6A 4UV8A 1A04A 2MD5A 3RPUA 4F7ZA 4RGRA 4BHPA 3K69A 3WGHA 2PBIA 3PQKA 2EFNA 5HLIA 5AIQA 1YIOA 4BH9A 2M5WA 2YR2A 5DD8A 2P5LC 4G94A 4IXAA 5A2QK 1L3LA 2RGVA 2CW0F 5ILSA 1ZG1A 5J8FA 4M72A 4IRHA 1LDDA 2XVCA 3BPXA 4CYDA 4HLYA 3DFGA 2EWNA 3CTAA 5D6EA 3ML6A 3GUDA 2R7DA 4IHTA 1IXSB 3J81Z 2DBBA 1ONVA 2O61A 2QBYB 4HX8A 3K2ZA 3O3KA 2QM3A 4P55A 3HOSA 3LFKA 3ABTA 1IUYA 3GYHX 4A6DA 1S3JA 5CVIA 5DUIA 3E5UA 5D5WB 5KVRA 4EJTA 4NHJA 3Q9SA 3I71A 3HIFA 4CO8A 4AD9A 5IT9Z 1W7PB 5D6FA 1B59A 1ZARA 3M8EA 1R00A 5L3DA 3E3VA 3I59A 2AS5F 1I5ZA 4M74A 1Q1HA 3ROUA 2MBFA 4RB0A 2ZMEA 1TQMA 4HLXA 2P5VA 4HQMA 2GXGA 1OPCA 4EV0A 1FX7A 2JT1A 4L0ZB 1ZHFA 1CF7A 1FSEA 3NQOA 3MFKA 4A0YA 5A2QZ 5ICGA 5F6FA 5JR3A 2UWMA 2EV0A 1HKTA 1RZ4A 4Q5SF 4H0EA 1KQ8A 1LJ9A 2M30A 3EUHA 4OIRF 4RB1A 1K7AA 2ESHA 1R1UA 4PDKA 1Z9CA 1B9NA 4HV5A 4KN7X 4NB5A 4NQWA 3GFIA 1BI0A 4RAYA 1AWCA 1ON2A 4G9YA 5ICEA 3L9FA 2VXZA 2M8EA 2O03A 5IT3A 5EEGA 1HBXG 2WTEA 2ZNZA 4GGGA 4HF0A 2H6BA 2YX7A 2ISZA 3CDHA 1HW1A 4UXNA 2YPRA 2DPDA 5DCFA 2P7VB 2D1HA 3GFJA 3H3UA 4I01A 2MLGA 4IRIA 3V8KA 2BEOA 2VBYA 1V4RA 3R6SA 3FF5A 4I09A 3F23A 3ULQB 3REOA 2CFXA 3I0TA 4ZH4F 2PFBA 1HW2A 1P2FA 1SD5A 3SXYA 1XMAA 2HGCA 3IWFA 1T39A 2H94A 4FX0A 4P9FA 1XN7A 2HZTA 1KYWA 4M9XA 3GZ5A 4IRGA 4MEXF 4AVPA 5BMZA 1LQ1A 1FNNA 1G3YA 4O6JA 4LK1F 1WQ2A 2L02A 4BHBA 4WXCA 2OQRA 1BJAA 3HTUA 3ECOA 1O3TA 1L0OC 2O3FA 3KZYA 2E1CA 1IN5A 2HS5A 4U88A 2HQRA 4BQAA 4KT5C 4L5JA 4RS8A 1FT9A 4EJVA 2VT3A 2UXXA 2OD5A 3BJOA 4M9SA 1LEBA 3FMQA 4MTDA 2KIUA 1BM9A 4HYEA 3S2WA 1PUEE 2NYXA 1B1BA 2L54A 4BHCA 1P92A 2V9VA 1KYZA 2EA4A 3WTUC 4AWXB 3WG9A 4GYIA 1WI9A 1BI1A 5LHIA 3ELKA 1XSDA 4U0YA 2A6HF 5DYMA 2DO7A 3QAHA 2KJBA 3O6BB 1JE8A 3J80K 1OYIA 4HOBA 2D1VA 4FT8A 1RNLA 4LLNA 2WWYA 4ESBA 4ENMA 1G4DA 5JFRA 5DCMA 1HQCA 1P4XA 4A0ZA 5H6QA 2IVMA 2R3SA 2QZ8A 2XROA 3V7SA 2W24A 1XDUA 2DQRA 4HF1A 3F6VA 4OMZA 1PDNC 2ACJA 2DK8A 2PG4A 3V7RA 4CXFA 3IRRA 5TRDA 4R79A 3PFIA 2P5KA 1JXSA 1U78A 3I64A 5K5QA 1R1TA 5ED4A 1G3TA 2F5FA 3I58A 2BE5F 4MNUA 2MH9A 3IL2A 1DUXC 3QU3A 1XGNA 3HRUA 4WK8F 5E18F 1FWZA 2ETHA 5LRRA 3V7CA 3WODF 4KMFA 3W6JB 3RJPA 3Q9VA 2XIGA 2A5YB 3N97A 2VBWA 3J80Z 3U2RA 1GXPA 1H9TA 2PMUA 2Z3YA 1JHHA 5F1RA 2DU9A 1UCRA 2FMYA 2MC3A 3GFMA 2D2WA 1QQIA 4U7BA 4XBFA 2HQNA 4BYYA 1ZGJA 4PCQA 2KRFA 3AAFA 2DT5A 3KP7A 2C6YA 3EDPA 2PMHA 5BOXA 1BC7C 3ZMUA 1BN5A 5ILUA 2F5DA 3FXRA 2Y48A 2XAGA 1ZRCA 1FSHA 4MGRA 1TTYA 3DPTA 4GCVA 3RIRA 5JHUA 4XRFA 5JVTA 3ZP5A 4B09A 5FB2A 2VC1A 4WXHA 4BNCA 2OBPA 3E97A 3KETA 2WC2A 5HS8A 2YX4A 1T38A 4EJWA 2A68F 3FMRA 4M73A 2A6EF 2MLKA 3KFWX 5TJJA 4QLCU 1XD7A 3IC7A 3P9KA 4WXDA 2STTA 2EJRA 2VBXA 1VTNC 2ZNYA 3GFLA 1U8RA 1I6XA 1HXDA 5D5UB 5CVJA 1SFUA 1BOAA 4OINF 1S6LA 3TDZC 2VONA 1OMIA 4WWCA 3DEUA 5FD5A 2EB7A 3D0SA 3GX4X 2FNAA 1MD0A 4GO1A 2CSOA 4UHTA 3ERED 2F5EA
chains in the Genus database with same CATH superfamily
1NG7A 3S1QJ 3PFYA 3RYRA 3OWTA 4E7JA 1HW5A 4HDVA 1IDZA 1V5EA 3CCRI 4XRSG 2LYCA 5HODA 1QO0D 3AG3H 2ZCWA 3BG3A 4FX4A 2JRTA 1FJLA 2YSRA 3O8GA 2ZB9A 4UB6C 1U9OA 2MG4A 3CQZJ 3J81K 4HDUA 4AIJA 2K9LA 3KZZA 2DOFA 2KLOA 5EJCA 5IOYA 3CJRB 4P9UA 2JTVA 3NEUA 3F8NA 2JA5J 3ABLH 3ZCOA 4M3EA 2IA0A 4BJ6C 5JLWA 1GV5A 5BS6A 3OYGA 1ZR4A 2ZMEB 2MC4A 3HXLA 2OTJI 3U21A 3BDDA 5HDGA 4WX9A 1RUNA 1Z77A 3FM3A 1CF7B 2CRGA 2DMNA 2VIXA 3TO7A 2QSHX 1O7FA 5KK1A 4I2OA 1Y0NA 2TDXA 3OOUA 5KAFC 1DPRA 2E1MC 2IGKA 1HSJA 2W84A 3E0JB 3T0YA 2V6EA 1MBFA 3RDIA 5J4YA 1RC9A 1GLNA 1SVOA 2XAUA 4AC0A 5FRNA 3BG6A 3IRQA 2HOSA 4HSRA 4MEYF 3L09A 3LWFA 2FOWA 3HHGA 5FRMA 4M3BA 3EUKL 4D5CA 2QEXI 4CHUA 2FE3A 3B6AA 4ABZA 3QRFF 4I7HA 4ZDPA 3T1BA 3WHBA 1XPXA 4KJZA 2MW8A 1FOWA 5LEKA 2XB0X 2LBFA 1T0FC 2JA8J 1S29A 2EIKH 2J5PA 1OCPA 1Z67A 2K4JA 3WTTC 1H89C 1K6OA 4FQGA 1RUOA 1OCZH 2LF7A 2XGDA 4NQWB 4KFCA 5E79C 3H0GJ 4BXFA 3ISPA 1ACIA 1P4WA 2DDBA 4IL6C 3HTSB 4E7IA 3ZN0A 2KIFA 1YG2A 2HDCA 3JRAA 1HC8A 3T8RA 4EJOA 1Z6TA 1TWFJ 2BYVE 1WGXA 4CSWA 2GXBA 2CW7A 3RQ4A 1OISA 2AXLA 1MJ9A 3BG9A 4D0PA 1VQOI 1WH7A 2RQPA 1EH7A 3IH2A 2QKMB 3TW6A 1MMAA 4L9NA 2IEKA 2A07F 4XLPF 5H2FC 1FLIA 1UHWA 3DTIA 3WTVC 2W48A 4RM2A 1KU3A 1R23A 3BR3A 3QPHA 1BA5A 4M9ZA 4CYCB 5LEJA 2GA2A 3I4PA 2CYYA 5FKKA 5HVQC 2STWA 4C3JJ 3HRTA 4RB3C 2R7XA 3BZCA 4EGYA 3RKWA 3D5RC 1A6IA 1Y8QB 3WTZA 2V6CA 1VQMI 1IN8A 3VYSB 1N78A 3LQRA 4Y4RA 1LDKB 2VN2A 4G6DA 3TBIA 3FHNA 4S0HB 2KL4A 2DFEA 3L2VA 5IOZA 3PNYA 1VI0A 3WE3A 4ETSA 1IXCA 3JSPA 2FU4A 2DJNA 5GTIC 5DM6F 2QVOA 2PJRA 3Q5FA 2DA7A 5FLVA 1ETQA 3AL0C 1D1CA 5HLHA 3DEEA 2HOEA 1F5TA 2R7ZJ 2L01A 2CMPA 2MYSA 3FK6A 3GMEA 4IHWA 4EVIA 3RPQA 4B48A 2ELJA 1FYMA 3NWSA 3LSTA 2FSWA 3QP5A 4RAZA 2EK5A 1SMTA 2XGXA 3TL4X 5E8GA 3I4NJ 2AO9A 1HKSA 1REPC 2EV6A 1HLVA 2BVLA 3VODA 5HLGA 1W7PD 1KU2A 3RTRA 3BR1A 1G3SA 1FOYA 2QQ8A 2K9NA 3VOEA 4F93B 4JX6A 1SAUA 1C0WA 2HFHA 2MSYA 1I3QJ 1P4AA 1EA3A 2V1NA 2V79A 4A0XA 4DNCA 3A01A 2YS9A 2CW8A 1WZ2A 1Z7UA 4L5EA 4N0BA 3GTKJ 1UJ8A 5EEAA 1J75A 3M3YJ 4YG2F 1SFKA 1KZHA 2N8GA 3IHUA 2LNBA 2GAUA 5C4XJ 3SFZA 2K86A 5E20A 2M4GA 4FASD 3K1PA 3QPTA 3SQNA 2W85A 1UHSA 2K27A 2BHZA 4KIGA 1YOVB 1F1ZA 5E8IA 1KONA 3HRSA 3ECHA 3GEZA 2HPIA 4M71A 4XSZF 2CUFA 5J47A 2Z16A 2Z99A 2HYJA 3CJQB 1XCVA 2QUFA 1ODDA 3ERMA 1D3YA 5LBQA 3M4OJ 2QLZA 4JBAA 1PJRA 3C7JA 1VQKI 2HTJA 1S9HA 3HOWJ 3DTEA 3QPLA 1IN7A 4IX7A 2DN0A 2PQ8A 2WY8Q 3MVPA 2Y0SN 1HDPA 1ITYA 1D0YA 4EM1A 3IAM2 2Z9OA 4IO9F 1SANA 1B6AA 5L3CA 3LNQA 3M8JA 5B66C 1U2WA 1IZ1A 1G2HA 2E1NA 1I1GA 1ULYA 1OJLA 4IPAA 2ZFUA 3FHZA 4EJUA 2BY3A 4LG3A 1JUPA 1IXRC 1VQ8I 4Y7NJ 5IP9J 1MSFC 4AM3A 1BI2A 1E3OC 3TOBA 5E1XA 4NNJA 1LFPA 3OYHA 3CCMI 4RAFA 5D4RA 1OCRH 2DI3A 5DCMB 4CYCA 3TOAA 4ENNA 1U6GA 1OYYA 4LFUA 1ZG3A 2HTSA 4OU0A 2VOPA 1LEAA 2JPCA 2K4BA 2CO5A 2B7EA 4PSWA 1R9TJ 3WGIA 1U5TB 5CJ9A 1GVDA 3EYIA 4BQNA 2ICWG 2EFWA 4WCGA 4MQVA 1MMDA 4A3BJ 2KDZA 3S3NA 4A6EA 3TO9A 2I10A 2R92J 4K2EA 1YS6A 2X4HA 4OIQF 4AIKA 4DIQA 4CDGA 4FE4A 4DOZA 2MA3A 1XSVA 1X3UA 2LKXA 4MIMA 3KEOA 4BGDA 5DDGA 3OV8A 2ZMEC 3PUFA 1P7JA 4BDZA 1OYWA 3L2CA 3HDDA 1SD7A 3TQNA 4L5IA 3CCSI 1ETWA 1YQAA 2P6SA 2PEXA 1SFEA 4F92B 1F43A 3M1CA 2WAFA 2A5WA 1ZELA 4ZZDA 5EGOB 3D5SC 1I27A 1IRZA 4RMNA 1ENHA 4IKFA 1Y8RB 5E3LA 2M87A 1K6YA 3L1PA 2DOAA 1T98A 1OKRA 3S17J 3U1KA 1Y6IA 2L4AA 1R4NB 3KEQA 5ICFA 1V5GA 4CICA 2CWEA 4N9IA 2EA2A 3OL4A 2R7RA 3OIPA 1HSTA 2E7XA 3OYIA 3EUHC 2VPLA 4E6KG 4CZZA 3S2DJ 2XUBA 1FP1D 2QA4I 3C3WA 3WGGA 3DU5A 3DV8A 4KYWA 3RKXA 3SYTA 2E2IJ 1FPQA 3F22A 1FZPB 3BTLA 1MIJA 3H3VK 1XGOA 1WVRA 5H20A 2DPUA 4OOIA 4HG2A 3OR1C 2K85A 3N4MA 3VWBA 2FEZA 3F6OA 4LK0F 3E6MA 2HEOA 1ZRFA 3E5QA 2MGQA 3KCCA 3ZN1A 4A69C 1J5YA 4HSTA 2JVHA 4BAYA 1D0ZA 3LSJA 4HPQA 2R7FA 4E7SA 2B63J 2W25A 3I4MJ 3OOPA 3SHFA 4XOTA 2VBZA 2L7FP 4AU7A 1KU9A 1XG1A 3JRDA 2FNPA 2V1XA 5GP9A 1E2XA 2IGMA 2ME0A 3IWZA 4RAGA 3HSRA 2DFIA 3K4MA 2L7KA 3R0JA 2OQGA 2CFOA 4ENJA 1STZA 4JP0A 5F08A 4AVZA 3H5RA 1BW5A 1YJNI 1TLHB 5FFZA 1ZK8A 4IQ4A 1S7EA 2HXIA 4OIPF 2Z33A 4ENKA 2E1OA 2OUMA 1QVTA 2VE9A 4XMYA 3EETA 5CQEA 1U5TA 1RI7A 1LDJA 5CYVA 3BROA 4Z2YA 1MW7A 2MABA 1S8NA 5KHDA 5AIPA 5B3SH 2FRHA 4YFXF 2VKEA 4XQFA 1ZLKA 3H3ZA 4YFKF 3OYEA 3CLQA 2VC0A 2XRLA 3HB9A 3COAC 4EM0B 3H1CA 4ZYDA 1WHUA 5F04A 3KLNA 3ZOBA 2D45A 1D5VA 2CGPA 1GHCA 2RDPA 4I76A 4A2UA 3A1YA 2NOGA 3PM1A 4XIDA 1YJWI 1GT0C 2HVSA 2H8WA 3CZ6A 3EPZA 3I3LA 5FGMA 4Q47A 2RNGA 4OWRB 2DTRA 3VYUB 1A31A 3CCVI 5H6RA 4I02A 2X85A 5FLMJ 2OZUA 4C3IJ 5LLQA 2QENA 3L00A 3E6DA 1SD6A 4Q48A 1F9NA 2XPVA 2P8TA 5EZGA 3K0LA 4U0VA 4AUXA 2KPMA 3TGNA 5HS9A 1T2KA 1ZH5A 2DA1A 2L3DA 5LD2C 4IHXA 1R5GA 3KP3A 3J7YJ 4ZDOA 3L7WA 1W5SA 2FA5A 2XV4S 4A3IJ 3BCAA 3WHCA 2BV6A 4FISA 3DPLC 1VQLI 2PI0A 3WE2A 1P6RA 5IY5H 1Q1VA 1RRJA 2IS1A 2DA4A 1BL0A 3CMAI 3PO3J 1Z3YA 1FP2A 2BGCA 4CGZA 3I53A 3HJEA 2HOAA 1WJAA 3EQLF 1W4MA 3QODA 1JUSA 1TW2A 2CUJA 3F8BA 2NS0A 1IV8A 5HOOA 1D8JA 5CVUA 2FBKA 4D7NA 4I0BA 1YLFA 3D5LA 4XN3A 4G6QA 1JT0A 4U7DA 1B72A 3OIOA 1QGPA 5TGTA 4LD5A 1EH6A 5ILVA 1NHAA 3SEZA 3WU0A 4NUBA 3ZQHA 3CUQA 1XS9A 4A3GJ 2NRAC 2V9PA 2DA6A 1XTAA 3J7AY 2KP6A 2Q0OA 5CLSA 1S72I 5KAIC 3ZMZA 1IN4A 2XC7A 1TNTA 1FMWA 3WTYC 4BE1A 1V3FA 1APLC 1B4AA 2JA6J 2E35A 1MZBA 3GTQJ 1TWGJ 5B1BH 1JKOC 2IP2A 3MZYA 3CP2A 3KYDB 2CS3A 2L7MP 2OCCH 4PZJA 1SFOJ 4Q4ZF 2ZKZA 3G1MA 2EZHA 3P9CA 5L3EA 3L2UA 5DUKA 2YUSA 2AHQA 3HSEA 4NC8A 2ZXHA 1UMQA 3W6VA 4A5MA 1U5TC 3F8FA 2CUEA 3AG1H 3V8LA 1GXQA 1R71A 4XKBA 3P5JA 3BG7A 3BPVA 1RIOH 3WTXC 1FTZA 1LNWA 1J0RA 3PUBA 3UR3C 1YW8A 3ZMVA 5M5XJ 5F1JA 2Y0SA 1SVLA 2GIVA 4HZFA 2XKOA 1LVKA 2M34A 1N25A 3BQZA 1UG2A 1IJWC 1X4OA 2R7QA 5DM7F 2F4OB 3KX2A 2DW4A 3G2BA 3EUAA 3JRFA 4B44A 3KYLA 1YS7A 4RGUA 5GPCA 2X9DA 4UVAA 4G6TB 1BI3A 3FIWA 3OYKA 3BC8A 3QOPA 1OLTA 3J7AO 3SJMA 3JRHA 2X6YA 3HGGA 1Y0UA 2FBIA 2BXYA 3B73A 3IKTA 4ESFA 2EQRA 3F72A 3HZJA 4YIIA 3OYNA 1TT0A 3BQYA 3TO6A 4NBQA 2ID6A 3S8PA 3ZQQA 3V42A 1YW7A 3LAJA 1UZCA 3G73A 4L0YB 3MN2A 5DS9A 3I55I 2NS7A 3MKYB 3VEPA 1TW3A 1A36A 1W5CC 4C2UA 2KHMA 3H35A 3B6CA 1R36A 3M07A 3QP6A 3I5UA 2VE8A 5BPIA 2NNNA 2RREA 5JHFA 5CVVA 4DGWB 5D8LB 2XASA 2XF7A 3CJNA 2JN6A 2K7LA 2HWVA 3HOXJ 1MBJA 3DPUA 3QWLA 4P5OA 2PJRB 5CPRB 1MMSA 4XM3A 4UUVA 3AKZA 1R7JA 3KP5A 4PSXA 1HDDC 4A3CJ 4QSHA 3PIPF 3IKVA 3U1DA 2H1KA 1MJBA 1XSXA 2RAEA 1K78A 2PN6A 4TV7A 1EF4A 1R5ID 2VJIA 4AIHA 5E1WA 2XAFA 2G7HA 5IYDJ 5CVRA 1IRFA 2GXAA 4ASNA 2Z1DA 1R5HA 2NVTJ 3NAUA 3K4NA 2LY9A 4CCLA 2HQAA 4C2MJ 2LR8A 1YX3A 2A61A 2DDAA 4XKCA 2G9WA 1W5TA 2WV1A 2QSGX 4ESJA 2QWWA 3C2BA 3C1DA 3GXOA 1P7IA 4I0AA 1YYVA 3A01B 3CCQI 1ZKGA 1VNDA 4RB2C 3DKYA 1UG0A 1X4PA 5LRSA 2CJJA 4LIUA 2B0LA 2JRMA 5EEHA 1Z7LA 1F4KA 4M6VA 2CV0A 3HOVJ 4HW0A 1WFXA 2JZYA 5TISC 2ADUA 3F21A 4L9JA 4EGZA 2OC6A 1X1PA 3CP8A 4PJNA 2HR3A 1G3WA 4KMUX 4YFNF 3F3XA 1QZEA 5F64A 4XSXF 1S7OA 4RDUA 2EV5A 1FYLA 1JHFA 2RC4A 4N9HA 1ZLJA 2Y30A 2L9VA 3JRCA 3KPHA 3L2QA 4MHGA 1R58A 4M3FA 2XB5A 2RQQA 4D5FA 4PJJA 3CDIA 3ZMDA 1R22A 4E4HA 3KP4A 3PNTA 4IHSA 2HYFA 2JQ7A 3ZQ7A 1E17A 2O7OA 2FQ4A 2ELHA 2V1DA 3E5XA 4J01A 4HNVA 1O3RA 1BW6A 3JR9A 1MGTA 1FC3A 2H6CA 2UZKA 3DKWA 2WAQN 2XAHA 4UVBA 1J59A 1V54H 2VL8A 4IVNA 3DXJF 2LMDA 5L3BA 3C18A 1YIJI 3ZQLA 3GTLJ 2Q2EA 5EDNA 3L2WA 1RKWA 1O3QA 3CCUI 2QQBA 2M7AA 3H36A 3RYPA 3IV5A 1I39A 2HYGD 3OMYA 2M0CA 3SZPA 3S1NJ 4QTRA 1U8BA 3ABMH 2ELKA 2NVUB 1VZ0A 5BQTA 4DQ2A 1T95A 4N4OB 1EJ9A 2RV8A 2DT7B 2V1UA 5J1UA 5J3LA 3MCZA 5BPDA 3ZQIA 4PJLA 2XF5A 3VSLA 3V4GA 2E36A 1JGGA 5FLXZ 2G7UA 4KDPA 5L3FA 3JTGA 2F2EA 1ZAOA 4BKXA 3P9IA 5JI6A 3E6BA 1ERDA 3UKGA 2FXAA 3K6GA 3CF5F 4U0WA 2DTZA 2HKOA 2CG4A 4V2FA 4HAMA 1AOYA 3JTHA 3R60A 4M3DA 2UUZA 2CH0A 1G6NA 1IF1A 4EEFG 2LSOA 2VJ5A 3Q3SA 2R5YA 2CUZA 4KUMA 4X0GA 1RR8C 4FHTA 2HVRA 3GTPJ 1PYVA 2KZVA 3VFZA 2GZWA 3HM5A 2JPBA 4IF4A 4KN4X 5ICCA 4KIFA 2BXZA 3FXUA 4IHYA 4G7HF 3LA2A 4BJ5C 1OR7A 4BQOA 3NRVA 2LD5A 1WKMA 3TDUC 1BR2A 2M1BA 2E60A 5LGUA 2FMLA 1B9MA 4BEHB 1VQ6I 2NNYA 3DLLF 3GVAA 1FY7A 2ZFWA 4PJ0C 4IEJA 1ZREA 4O5VA 2FF4A 4LITA 1ETKA 2M4KA 2H27A 5LHGA 2K3PA 2ZO4A 3K1MA 1JTXA 3TP0A 4CH7A 2W00A 2XPUA 2ZJQF 4JX5A 3M7GA 3FXQA 5D5XB 4E7HA 4KNYA 4L18B 3A2KA 5L3GA 1LVAA 3CESA 2VODA 3DF8A 3OYCA 4M6XA 3VB2A 3AFHA 2GLOA 3BZ6A 1EV7A 2WAEA 2ZSHB 1BC8C 2RKHA 2BW3B 2ZJ2A 4GRIA 4RM3A 4B47A 3Q0UA 1MDMA 1S5LC 2IW5A 2O8KA 1PP7U 2WV0A 3HPGA 4A5NA 4LMYA 3DLAA 5K1YA 1TQPA 5GAHJ 5D8KB 1H0MA 5B5EC 2IA2A 3E6CC 3K1NA 1ZTRA 4XORA 5FROA 1Y39A 4XL9A 3HRMA 1TT5B 4BBSJ 1S7AA 4RLQA 1FOKA 2X1DA 1K4SA 3KYCB 3LA7A 4DYQA 3GTOJ 2VKVA 2NVXJ 1X58A 1QHHD 2DQLA 1FTTA 3VPRA 3LA3A 5D5VB 2CQ7A 2F6CA 4D1QA 1KQ9A 1F36A 3KE2A 4PGGA 3W6KB 5JVGF 1WSUA 3H92A 1ZRDA 3T5XA 3UNGC 4WF2A 2P6TA 2JSCA 3RCOA 1M1EB 3L2RA 2LDUA 2DMTA 1IV6A 1T6SA 2FJ1A 1K79A 2FX0A 3JCUC 1Z05A 1QPIA 3E7LA 4ZYHA 3QOEA 2NXNB 3HKZN 3FX3A 1T33A 4PUSA 1ZG5A 4CUGA 1T8IA 3GZ6A 5M3MJ 1MH3A 1IC8A 3WTSC 3CC2I 1FIPA 3FXKA 3SZTA 3K4BA 1WCMJ 1J7KA 2EH3A 4PFOA 2FD5A 1POGA 2DK5A 4F52A 4S05A 2Z5UA 1SD4A 2V4JC 1XCBA 1NTCA 2GA1A 3OYJA 2JUGA 4XLFA 1Z91A 2QBYA 4OIOF 2HQ5A 1I3AA 4ITVA 4Y17A 4XR6A 4DZJA 2UXNA 3GW2A 4M6YA 2LF8A 3GWZA 3WU1B 4KICA 3DTKA 3LSGA 2HKXA 4D9JA 3HUGA 4FTHA 1YO5C 3CJTB 1Z1DA 5E1ZB 4EMSA 3S14J 2K3FA 1Z6RA 4HX7A 1LE8B 1UHMA 1W7PA 2CQXA 4ZZLA 4B1RA 1KA8A 3G6EI 2L4MA 2DJIA 2PLYA 3GO5A 5E3OA 1AA7A 2LLKA 3ZR8X 1CQTA 3F9KA 2KKOA 4I98B 2LRDA 3M8FA 3LMMA 6PAXA 3CUOA 1QZYA 3I9V2 4BEHA 2XAJA 3QU6A 5B1AH 3HPHA 3HGYA 1WRJA 5FD6A 1BIAA 2DCEA 3ZRGA 1AU7A 3OYDA 1JTYA 2MH2A 2E7WA 1TC3C 1TBXA 4PGHA 2IJLA 1JJ8C 1J9IA 3HOTA 1V55H 3HHHA 3JREA 1CGPA 5EG0B 3JSOA 1J09A 1D1AA 2X0LA 2RNJA 4XN0A 2FBHA 2BW3A 3A02A 2R7TA 4R1HA 2IXSA 1UELB 3ZXSA 1FBSA 1TWCJ 2VJ4A 1ZYRF 2M7BA 2K9SA 2R7OA 5J4VA 2P4WA 1ON1A 3B02A 4L9TA 1JGSA 2DMUA 1SAXA 3QYFA 1OCTC 2IPQX 3BWGA 3GF2A 3W2VA 3CO6C 1EH8A 5AONA 1LB2A 1B72B 1XGMA 1E3HA 4UY8I 3BY6A 1LFBA 1DP3A 1FEXA 2ECCA 3LQQA 2YU3A 3F8MA 4QPOA 4R8HA 4Y13A 5K5RA 4AIDA 2X1CA 1U9NA 2XGEA 3CUQB 3IUOA 4E7KA 2X6OA 1TZLA 2RVCA 4DYRA 1MKMA 2A6TA 2IGNA 2K5CA 2DLLA 2HNHA 4W1UA 3G71I 4XLEA 1ZQ3P 2A3SA 3KIOA 3R61A 4I99C 1W0UA 3U9GA 3FMSA 4A3MJ 2JA2A 4S04A 3AG4H 4LGWA 4YIRX 1XB4A 2Y2ZA 2W82A 5K5OA 4HRIA 4JOMA 2BBYA 1KU7A 2COMA 3CCLI 3K10A 1USTA 2ISYA 2LKPA 4XKVA 1QPMA 1QVUA 1DPUA 5J6XA 2OAZA 1IAWA 2IA1A 1U3EM 3BJAA 2CQQA 2AXTC 3GBGA 1MSEC 2Y69H 4GYGA 3K70D 1RKTA 3BP8A 1XX5A 2QCOA 3VYTB 2MD0A 3MZ8A 4LG0B 4BDYA 3WTWC 4RBOA 1HOMA 2DOEA 1BBYA 5CQGA 2EFQA 1R4MB 3T8TA 2J5OA 4G7ZF 3ZMSA 4A3DJ 3JW4A 3IH4A 3ZMTA 1YRNB 3SZGA 1K61A 2G0EA 1JJ6C 3GLLA 3HSFA 1XMXA 4EATA 1NK3P 1MMNA 2IRFG 5LGNA 1TNSA 2LREA 1LE8A 5HS7A 2P0WA 3Q0VA 1YJ9I 2WAQA 4PFPA 2O6GE 2VOOA 2KJCA 4UB8C 2M8GX 2V26A 2XRNA 2ZBKA 3CMEI 3DU6A 2LVSA 3KP6A 3KP2A 2XAQA 3BLYA 4JYKA 3MEXA 5J8CA 3FZVA 1ETYA 3V8JA 2R4GA 4CCOA 3R0AA 2XHKA 4KIBA 2FOKA 4HX4A 4E7ZA 4BE0A 3D1NI 4L9VA 2LFBA 1VQ7I 4O3MA 4YEJA 1Y56A 3FWEA 3GLXA 2HI3A 1DDNA 5IYBJ 4DYCA 3JRGA 2RN7A 2GWRA 4G8XA 1J2XA 3KEYA 5DD4A 1D1BA 5K7ZA 3LL7A 3CO7C 4UUSB 2WB1N 2IT0A 2O9LA 3GZNB 1HCRA 4HA8A 4XLCA 3RSNA 2YU9J 1QNTA 2K02A 5EG0A 1H9GA 1SVMA 4DJAA 1HF0A 2GIZA 3RKYA 4RGXA 4HF2A 1K83J 3BTIA 2ESNA 2LY2A 1SFXA 2DAOA 3H9QA 2WADA 3M9AA 2HDDA 4ZDLA 3MAJA 4MQ9F 3LSKA 5IPAA 2UV1A 1ZN2A 4QIWN 3LAPA 2HPMA 3S15J 3P7NA 4LB5A 5FO5A 1WH5A 4HBLA 5ERIA 4UVCA 2ZJPF 4YIFA 4UNOA 3ABUA 1K78B 2AQEA 4ZYGA 1RPWA 4KT6A 3RQIA 2ZXJA 3PL8A 5HDKA 2PJPA 2JSPA 2R93J 1HA8A 4DZPA 2OU2A 4MTEA 5FJ8J 3S93A 3AL0B 4B8XA 5EF6A 4BQQA 4HQEA 4FCYA 1DP7P 2LP0A 3DBHB 4RLFA 4A93J 1YI2I 1ZGAA 1FBUA 2X48A 3ZGKA 4XRMA 5DV5A 2A69F 3DQVC 2F5VA 4OMYA 3SEQA 3EYYA 4Y15A 2HDWA 3OY9A 4Z6YA 2B9SA 4V2GA 1O3SA 3BG5A 3A03A 1VQNI 1VFCA 2JVGA 3BJ6A 3A4CA 4RGSA 2H09A 2Q8KA 3BTJA 3M1EA 3CLOA 4KA4A 3ZPLA 1QRYA 4A12A 1QBJA 3CC4I 2QYOA 2GQQA 2I5UA 1KGSA 2CU7A 3BOQA 1PUFB 1WJEA 1YW9A 1PP8F 1HKQA 1XMKA 2EFOA 4DW6A 1IW7F 1XGSA 1V5FA 3I54A 2E71A 3DBLB 4LIVA 4UV9A 4XLNF 3CC7I 2E19A 4LG0A 2EFPA 1VQ5I 2P7CB 2HVQA 1G8XA 2VJJA 2R7WA 2VKHA 3K9TA 2JMWA 2O0YA 5E3NA 4FETA 1YRNA 1T0FA 2XKPA 4U87A 2DODA 4FE7A 5J40A 3F8CA 3ONQA 3DP7A 4JK1X 1K4TA 3WG7H 2XDVA 1KQ0A 5F27A 4LLGF 4BXUA 3MKLA 5E17F 2VB6A 1O7LA 4IJAA 1FBQA 3KLOA 4YELA 1YFHA 3H9GA 5FKLA 3C2HA 5HDNA 4GDFA 3S1RJ 3JAMK 2QQ9A 3DEWA 4LOCA 3HYIA 2Q2EB 2KIQA 4MFDA 5FKOA 1MMGA 1USSA 3IP4B 2E2HJ 1O4XA 3HKZA 4CZCA 3S16J 2I8DA 3LSIA 2DMQA 1IN6A 3ABKH 4EQQA 3TKYA 1PVEA 1UB9A 4JQFA 2M45A 3MZHA 3O2PE 2L5QA 4LJZF 4P96A 4UUSA 2VKDA 2FQ3A 4OAYA 3QQAA 4XRSA 2EZLA 4XK4A 5M3FJ 1IRGA 2QQAA 2OCEA 4OAZA 3R4KA 4QWQA 1SMYF 1JKQC 2E5ZA 3HOYJ 3FDYA 5LHHA 2X6XA 1IO2A 1NG6A 2KIMA 1FYKA 4G7OF 2VT2A 5M5YJ 3VDXA 3OYMA 3KZIC 1UFMA 2KRHA 4ZYEA 1YTYA 4B3XA 1QZZA 2W57A 3BR0A 3FKJA 2BVMA 2PMZN 2X6WA 1OCCH 2CQKA 1O57A 3MWMA 4HV6A 2DT6A 2LTPA 3LSMA 1I1SA 1I6HJ 1MJAA 2EINH 3E1SA 5FFXA 4LB6B 2R5YB 1TWHJ 1D8KA 4NDLA 2EZKA 3PJRA 2Y75A 1LPQA 2IGOA 2LK2A 5D4SA 1RESA 4M3GA 4GXOA 4CCKA 5DEQA 1WWXA 1MNEA 2DMPA 2KQRA 5C3EJ 2LC2A 2OA4A 3MQ0A 4KITB 5FLXK 1MNMC 2X51A 4E70A 2NAZA 2LG4A 3I59B 4BY7J 4BL0B 3K70C 5IP7J 1VQPI 3CUQC 4UUTA 4LLLA 1D5YA 2R7VA 1T08B 4C9YA 2L2OA 4EM2A 3FXOA 2P81A 5LGTA 9ANTA 4BY1J 3C2GA 1X1DA 3BT9A 2O8XA 2IS4A 4ON0A 2Y0MA 4BBRJ 3FM5A 3G3ZA 5IYCJ 1XDSA 4KISA 4J00A 4BJTA 5IT9K 2GM4A 3PQJA 4BACA 3RI4A 1QA6A 3OSFA 1PUFA 3JAMZ 4B43A 1TQIA 2F5CA 2WY7Q 1MDMB 1R1VA 2HZDA 3IAS2 1BIBA 1GVJA 1GV2A 2OZ6A 4UV8A 1GDTA 5GPAA 1A04A 2MD5A 3RPUA 4RGRA 1OFCX 4F7ZA 4BHPA 2ZXIA 3K69A 2ZJRF 3WGHA 3CCJI 2BY0A 3G1OA 4BS9A 3BCBA 2PBIA 3PQKA 2IS2A 2KMUA 2EFNA 5HLIA 1IRXA 2VQCA 4AYBN 2WBMA 5AIQA 2DFHA 2DXIA 1YIOA 3OS0A 3HL2A 4BH9A 2M5WA 2YR2A 3LOCA 5DD8A 3LSRA 1E3PA 2P5LC 4G94A 3TP3A 4IXAA 5A2QK 1L3LA 4MLOA 2RGVA 2KZGA 2CW0F 5ILSA 1ZG1A 5J8FA 4XNFA 1Z3XA 2JA7J 4IZZA 4M72A 2MFZA 3JRBA 4IRHA 1LDDA 2XVCA 3BPXA 4CYDA 4ZJZA 3OYAA 4HLYA 2R5ZB 3DFGA 2EWNA 3CTAA 5CKTA 2LOOA 5KNLA 1N75A 3A0BC 3RZDJ 5D6EA 3ML6A 1W36C 2DYSH 1EKEA 2O5RA 3GUDA 2DA2A 2R7DA 3LSPA 2R7SA 1AKHA 4IOAF 4IHTA 1IXSB 3O8HA 1VQ9I 3J81Z 4A3LJ 2KDOA 2DBBA 3OYBA 1ONVA 2O61A 2QBYB 5EZHA 4HX8A 3K2ZA 3K7AJ 3O3KA 2QM3A 4P55A 3HOSA 3LFKA 3ABTA 2M9HA 1IUYA 3GYHX 2M0MA 1UAAA 2E34A 4A6DA 1S3JA 5CVIA 2OV7A 4JX4A 5DUIA 4II3A 2VI6A 3E5UA 3HUGB 5D5WB 2NOJB 4I6ZA 2Y9ZA 5KVRA 4EJTA 4NHJA 3Q9SA 3I71A 3HIFA 2GOMA 4CO8A 4AD9A 2KISA 5DTDA 1W7PB 5D6FA 5IT9Z 1B59A 4MO7A 4F55A 1WPKA 1ZARA 1WJDA 3M8EA 1X3WB 3OSGA 4Y33A 1R00A 1B8IB 1R6RA 5GADJ 5L3DA 3E3VA 2L9NA 3IH3A 3I59A 2AS5F 1I5ZA 2QSFX 4M74A 1Q1HA 4NC7A 4GFBA 1YE9A 4XOPA 2OF7A 3ROUA 3HC7A 1DGRM 2MBFA 4RB0A 3SDBA 1IDYA 2ZMEA 1TQMA 2ECBA 4HLXA 1W0TA 2P5VA 4HQMA 2GXGA 1OPCA 4V19K 4EV0A 1FIAA 1TP4A 2WB1A 1FX7A 2JT1A 4L0ZB 1ZHFA 2EIJH 1CF7A 1FSEA 2L0KA 4HNUA 3NQOA 2EBIA 3MFKA 4A0YA 4DBRA 5A2QZ 5ICGA 1YHQI 4IHVA 5F6FA 5JR3A 3RZOJ 1RETA 3OS2A 2UWMA 2EV0A 1HKTA 4P1WA 1RZ4A 2KRCA 4H0EA 4Q5SF 3MKWB 4C3HJ 1KQ8A 4F91B 3GTJJ 1LJ9A 2M30A 2Z2SB 2NS8A 3QYBA 4A3FJ 3EUHA 2NVQJ 1P9QC 3CMMA 3I56I 4OIRF 4W97A 2COBA 4RB1A 1K7AA 2ESHA 1X2MA 1W1WE 2BY2A 1R1UA 5J1YA 4PDKA 1FOXA 4F3QA 1B9NA 1Z9CA 4HV5A 4KN7X 1IGNA 2VASA 3SDGA 2EZIA 5HLTA 4NB5A 4Y52J 4NQWA 3GFIA 1TL8A 3SFIA 1BI0A 2DYRH 1Z0XA 2JK3A 3TMOA 1G59A 2L9SA 4RAYA 1I50J 3NARA 1QU3A 4CCJA 1AWCA 2E5NA 3OL3A 2FUG2 2W1OA 1JI8A 3DBRB 1BR4A 1ON2A 4G9YA 5ICEA 3L9FA 2VXZA 2R5ZA 2VLAA 2M8EA 1MBEA 2O03A 5IT3A 5EEGA 1HBXG 2WTEA 3CMYA 2ZNZA 4E7LA 1X1BA 2LH9A 3W2AA 4GGGA 4HF0A 2H6BA 2YX7A 4IOCF 2ISZA 5E3MA 3CDHA 1HW1A 4UXNA 2YPRA 5HNFA 2DPDA 1MH4A 2P7VB 5DCFA 3FBIB 3ASOH 3OIQA 2D1HA 3GFJA 3H3UA 5J1RA 1Y1VJ 1VQ4I 1D0XA 4I01A 3PSFA 2MLGA 4XLHA 2EILH 4IRIA 1A35A 3V8KA 2BEOA 2VBYA 3CCYA 3QYEA 2D5VA 1V4RA 3R6SA 1YX5A 3FF5A 1LUJB 2VUMJ 2HXOA 4I09A 3F23A 3ULQB 2Y9YA 5LFAA 2V7FA 3REOA 2CFXA 3I0TA 4ZH4F 2PFBA 1HW2A 1P2FA 1GUUA 3GTGJ 2DA5A 5BNGA 4ZTJA 1SD5A 2ME6A 3SXYA 3PNVA 1XMAA 1A6QA 2L9RA 2HGCA 3IWFA 2AQFA 1B8IA 4C30A 1T39A 1TWAJ 1IG7A 2H94A 4FX0A 4P9FA 1XN7A 2HZTA 4CCMA 2VQLA 1KYWA 1OR7C 4A3KJ 2KT0A 4M9XA 2L7ZA 3LSHA 1MNDA 3HOUJ 3MD2A 3GZ5A 4IRGA 4MEXF 4AVPA 5BMZA 1LQ1A 3H5AA 1FNNA 3OR2C 1WJ5A 3DWLE 2ZC2A 1G3YA 3ASNH 4Y3OA 1X1AA 4O6JA 4RA2A 3CCEI 2CV2A 2CQNA 3FXMA 4LK1F 1BJZA 1WQ2A 2L02A 4BHBA 3HG9A 3G1LA 2JJ7A 4WXCA 2OQRA 2DA3A 1BJAA 1MBHA 3HTUA 3ECOA 1O3TA 1L0OC 2O3FA 2XPWA 3KZYA 2TRTA 4ZC3A 1BR1A 2PMZA 1VF9A 2E1CA 1IN5A 1NK2P 2HS5A 4U88A 1OQYA 2BZTA 2HQRA 3NWTA 2VXDA 4HEA2 4XKWA 1ETXA 4BQAA 2JUCA 4KT5C 4YRVA 4L5JA 2VQHA 1DGWY 4RS8A 1FT9A 4EJVA 4ZTFA 2VT3A 2F4IA 3VYRB 2UXXA 2WA0A 4H4KC 2OD5A 3BJOA 4M9SA 1LEBA 3FMQA 4MTDA 2KIUA 2PX9A 2QGUA 1BM9A 4HYEA 3W2WA 2H8RA 1Z21A 3K4CA 1RR7A 2BHYA 3S2WA 2W7NA 4CA0A 1PUEE 2NYXA 1T56A 1B1BA 2L54A 3OS1A 2R7UA 4BHCA 1P92A 2V9VA 3QPSA 1KYZA 4QPQA 4C2TA 3HOZJ 2EA4A 5HNHA 2ZXWH 4AWXB 3WG9A 4GYIA 2VQGA 3WTUC 2K40A 1WI9A 1ORKA 1LKXA 3H5NA 1WJCA 1JT6A 1BI1A 5GTHC 5LHIA 3ELKA 4B4CA 2E1MB 2QF7A 4HNTA 1XSDA 4B3AA 4U0YA 1AHDP 2A6HF 5DYMA 2DO7A 5C4JJ 3QAHA 3MKZA 2KJBA 3O6BB 1JUMA 1JE8A 3J80K 1OYIA 1LFUP 4HOBA 2D1VA 4FT8A 1RNLA 4LLNA 2WWYA 4ZYAA 2JWTA 2Q1ZB 3X2QH 4ESBA 1ZGWA 3H9JA 4ENMA 1G4DA 1JKRC 5JFRA 3OYFA 5DCMA 1HQCA 3JRIA 1P4XA 4A0ZA 2OPTA 3FXLA 1Y1WJ 5H6QA 1X2NA 2IVMA 2R3SA 2F4MB 2QZ8A 4XLAA 2XROA 3J7ZI 1MBGA 1XC5A 3V7SA 2W24A 4AYBA 5C44J 1XDUA 2DQRA 1WI3A 2BOLA 3ZQCA 2XF6A 4HF1A 2A05A 3BR2A 4G12A 5FKNA 3F6VA 2H1LA 4OMZA 4BU2A 1YITI 2ACJA 1PDNC 3LFUA 2DK8A 2PG4A 3A0HC 3V7RA 1SEUA 3FK7A 4CXFA 3IRRA 5TRDA 2XGCA 4R79A 3PFIA 2EPFA 5K7FA 1JKPC 4CCNA 1OCOH 2P5KA 1X3ZB 4II2A 3AG2H 1JXSA 5FKMA 1DU6A 4ANJA 3BTCA 1U78A 4PJMA 4X1EA 3I64A 5K5QA 3Q0WA 1BOBA 1R1TA 5ED4A 1X1CA 1G3TA 2F5FA 2VPRA 3I58A 2BE5F 2ZSIB 4MNUA 2MH9A 3IL2A 4X6AJ 1DUXC 5GAGJ 1MBKA 3QU3A 5F0HA 5EGOA 2OTLI 1XGNA 3FBNB 3HRUA 1ETOA 2K9MA 4WK8F 3BR5A 2HOTA 2EIMH 3K4LA 2IAIA 3BZKA 3OYLA 3HBLA 1A5JA 1ETVA 3ESWB 2K9QA 2F48A 5E18F 3S3MA 1W36D 1FWZA 2ETHA 3S1MJ 5LRRA 3V7CA 3WODF 3TW7A 4KMFA 3W6JB 3RJPA 3Q9VA 4A3EJ 2XIGA 5EYRA 2IBDA 2A5YB 3DKXA 2E2JJ 2IS6A 1DQUA 1IUFA 2BY1A 3F0CA 3ZQGA 2VBWA 3J80Z 3U2RA 3N97A 3MMYB 2OJED 2X1EA 2R0QC 5M5WJ 1GXPA 1SC7A 1E0EA 1H9TA 2PMUA 2Z3YA 3S32A 2LY1A 1JHHA 2XSJC 3HEFA 3GCMA 5F1RA 2DU9A 1UCRA 2XSDC 2FMYA 2MC3A 3GFMA 2KFDA 2D2WA 3BR6A 3S3OA 1QQIA 4NC6A 5F0CA 3FKIJ 4U7BA 1X19A 4XBFA 3G4SI 3CD6I 2HQNA 2M2EA 2HU9A 1N77A 4BYYA 1ZGJA 4PCQA 2KRFA 3AAFA 2DT5A 3S2HJ 3KP7A 5K7HA 2C6YA 3EDPA 2PMHA 5BOXA 1BC7C 2ID3A 3ZMUA 1BN5A 2CV1A 1U0JA 5ILUA 2F5DA 3FXRA 4J19A 1DU0A 2Y48A 2XAGA 5JLXA 1ZRCA 1FSHA 1WJBA 3K2AA 4MGRA 1TTYA 3DPTA 4GCVA 3K4KA 5F0FA 3VSKA 1H88C 3RIRA 3FXJA 5IP6A 1NH3A 2LBFB 5JHUA 4BUPA 4XRFA 3CDLA 5JVTA 2NVYJ 3ZP5A 4B09A 1H8AC 4N4NB 1WJFA 3RKQA 5GAEJ 5FB2A 2VC1A 4IQJA 4WXHA 4BNCA 2W4SA 3FISA 1R49A 2OBPA 1QHGA 3E97A 4D7MA 3KETA 2WC2A 5HS8A 2GOXB 3CF2A 4PK4A 2YX4A 1T38A 4EJWA 4A3JJ 2A68F 2V9KA 3FMRA 3PSIA 1ZR2A 4XICA 3RPUD 1FMVA 3GTMJ 2LKSA 4M73A 4BE2A 3TEDA 2A6EF 3N05A 3W3CA 2MLKA 2QKLB 3KFWX 5TJJA 4QLCU 1XD7A 3DCFA 3IC7A 3P9KA 4WXDA 2STTA 2EJRA 4BXXJ 2VBXA 2GBYA 1VTNC 2ZNYA 3GFLA 1AKHB 1U8RA 1I6XA 1HXDA 3WU2C 5D5UB 3K4JA 5CVJA 1SFUA 1BOAA 2DFFA 4OINF 1S6LA 3TDZC 3H0DA 3PIOF 2VONA 1OMIA 2TCTA 4WWCA 3DEUA 3PO2J 2Y31A 4DBQA 5KCMA 4MFEA 5FD5A 2EB7A 4XONA 3D0SA 2FNAA 1MD0A 3GX4X 4GO1A 2CSOA 4UHTA 3ZQFA 3ERED 2M3AA 2F5EA
chains in the Genus database with same CATH topology
3RYRA 1HW5A 4HDVA 4FX4A 1QO0D 2ZCWA 2JRTA 2YSRA 3J81K 4AIJA 4HDUA 3KZZA 4P9UA 2JTVA 3NEUA 3F8NA 2IA0A 5BS6A 2ZMEB 3BDDA 5HDGA 4WX9A 1RUNA 3FM3A 1CF7B 3TO7A 1O7FA 5KK1A 4I2OA 2TDXA 1DPRA 1HSJA 2W84A 3T0YA 3RDIA 3IRQA 4MEYF 3L09A 3LWFA 3HHGA 4CHUA 2FE3A 3QRFF 4I7HA 3T1BA 5LEKA 1S29A 2J5PA 2K4JA 3WTTC 1K6OA 1RUOA 2LF7A 4KFCA 3ISPA 1P4WA 3HTSB 3ZN0A 2KIFA 1YG2A 2HDCA 3T8RA 4EJOA 1Z6TA 2BYVE 2GXBA 2AXLA 1MJ9A 4D0PA 2RQPA 1EH7A 4L9NA 2A07F 4XLPF 1FLIA 1UHWA 3WTVC 1KU3A 1R23A 3QPHA 4M9ZA 5LEJA 2GA2A 3I4PA 2CYYA 5HVQC 2STWA 3HRTA 4RB3C 4EGYA 3RKWA 3WTZA 2V6CA 1IN8A 3LQRA 1LDKB 2VN2A 4G6DA 4ETSA 3WE3A 1IXCA 3JSPA 2FU4A 2QVOA 3Q5FA 5HLHA 1F5TA 2HOEA 2L01A 4EVIA 3RPQA 1FYMA 3LSTA 2FSWA 3QP5A 4RAZA 2EK5A 1SMTA 2XGXA 5E8GA 1HKSA 1REPC 2EV6A 3VODA 5HLGA 1W7PD 1KU2A 3RTRA 1G3SA 3VOEA 1C0WA 2HFHA 1P4AA 4DNCA 2V79A 4A0XA 1Z7UA 4N0BA 1J75A 4YG2F 3IHUA 2LNBA 2GAUA 3SFZA 2K86A 5E20A 3K1PA 3QPTA 3SQNA 2W85A 2K27A 4KIGA 1F1ZA 5E8IA 3HRSA 3ECHA 3GEZA 4M71A 4XSZF 2Z99A 1XCVA 2QUFA 1ODDA 1D3YA 5LBQA 2QLZA 4JBAA 3C7JA 2HTJA 1IN7A 2PQ8A 4EM1A 2Z9OA 1B6AA 5L3CA 1U2WA 1IZ1A 2E1NA 1I1GA 1ULYA 4IPAA 3FHZA 4EJUA 1IXRC 1BI2A 3TOBA 5E1XA 5D4RA 2DI3A 5DCMB 3TOAA 4ENNA 1U6GA 1OYYA 4LFUA 1ZG3A 2HTSA 4OU0A 2VOPA 1LEAA 2JPCA 2K4BA 2CO5A 3WGIA 1U5TB 5CJ9A 3EYIA 2EFWA 4WCGA 4MQVA 4A6EA 3TO9A 4K2EA 1YS6A 2X4HA 4OIQF 4AIKA 4CDGA 2MA3A 1XSVA 1X3UA 3KEOA 5DDGA 3OV8A 1OYWA 3L2CA 1SD7A 3TQNA 4L5IA 1YQAA 2P6SA 2PEXA 1SFEA 4ZZDA 1I27A 2M87A 1T98A 1OKRA 2L4AA 5ICFA 3KEQA 4CICA 2CWEA 4N9IA 2EA2A 1HSTA 2E7XA 4CZZA 2XUBA 1FP1D 3C3WA 3WGGA 3DV8A 4KYWA 3RKXA 1FPQA 3F22A 1FZPB 1XGOA 5H20A 2DPUA 4OOIA 3N4MA 2FEZA 3F6OA 4LK0F 3E6MA 2HEOA 1ZRFA 3E5QA 3KCCA 3ZN1A 1J5YA 4BAYA 2R7FA 2W25A 3OOPA 3SHFA 2VBZA 1KU9A 2FNPA 2V1XA 1E2XA 3IWZA 3HSRA 2DFIA 3R0JA 2OQGA 4ENJA 1STZA 1TLHB 5FFZA 4OIPF 2Z33A 4ENKA 2VE9A 3EETA 1U5TA 1RI7A 1LDJA 5CYVA 3BROA 4Z2YA 1S8NA 5AIPA 2FRHA 4YFXF 1ZLKA 3H3ZA 4YFKF 2VC0A 3COAC 4EM0B 4ZYDA 3KLNA 2D45A 1D5VA 2CGPA 1GHCA 2RDPA 4A2UA 5FGMA 4Q47A 2DTRA 5H6RA 4I02A 2OZUA 5LLQA 2QENA 4Q48A 3E6DA 1SD6A 3L00A 1F9NA 2P8TA 3K0LA 4U0VA 3TGNA 5HS9A 1T2KA 1ZH5A 2L3DA 1R5GA 3KP3A 3L7WA 1W5SA 2FA5A 2XV4S 2BV6A 3DPLC 2PI0A 3WE2A 1P6RA 1FP2A 2BGCA 4CGZA 3I53A 3EQLF 1W4MA 1TW2A 3F8BA 2NS0A 1D8JA 5HOOA 5CVUA 2FBKA 4I0BA 1YLFA 3D5LA 4G6QA 4U7DA 1QGPA 4LD5A 1EH6A 5ILVA 1NHAA 3WU0A 3CUQA 2NRAC 5CLSA 2Q0OA 3ZMZA 1IN4A 1TNTA 3WTYC 1V3FA 1B4AA 1MZBA 2IP2A 3MZYA 4PZJA 4Q4ZF 2ZKZA 5L3EA 3P9CA 5DUKA 3HSEA 4A5MA 1U5TC 3F8FA 3V8LA 1GXQA 3BPVA 1RIOH 3WTXC 1LNWA 1J0RA 1YW8A 3ZMVA 2GIVA 4HZFA 2XKOA 2DW4A 1YS7A 4RGUA 4UVAA 1BI3A 3QOPA 3J7AO 1Y0UA 2FBIA 3B73A 3IKTA 4ESFA 3F72A 4YIIA 3TO6A 1YW7A 3LAJA 3G73A 4L0YB 3VEPA 1TW3A 1R36A 3QP6A 3I5UA 2VE8A 5BPIA 2NNNA 5CVVA 5D8LB 2XASA 3CJNA 2K7LA 2HWVA 4P5OA 4UUVA 1R7JA 3KP5A 3IKVA 3U1DA 1MJBA 1XSXA 1K78A 2PN6A 4TV7A 4AIHA 5E1WA 2XAFA 2G7HA 5CVRA 1IRFA 4ASNA 1R5HA 2A61A 2G9WA 1W5TA 4ESJA 2QWWA 3GXOA 3C1DA 4I0AA 1YYVA 4RB2C 5LRSA 2B0LA 5EEHA 1F4KA 4HW0A 2JZYA 2ADUA 3F21A 4L9JA 4EGZA 2HR3A 1G3WA 4KMUX 4YFNF 3F3XA 5F64A 4XSXF 1S7OA 2EV5A 1FYLA 1JHFA 2RC4A 4N9HA 1ZLJA 4MHGA 1R58A 3ZMDA 1R22A 4IHSA 3KP4A 2HYFA 3ZQ7A 1E17A 2ELHA 2V1DA 3E5XA 1O3RA 1MGTA 1FC3A 2H6CA 2UZKA 3DKWA 2XAHA 4UVBA 1J59A 4IVNA 3DXJF 5L3BA 3C18A 2Q2EA 1O3QA 2QQBA 3RYPA 2HYGD 3SZPA 5BQTA 4DQ2A 2RV8A 2V1UA 3MCZA 5BPDA 3V4GA 5FLXZ 2G7UA 4KDPA 5L3FA 3JTGA 2F2EA 1ZAOA 3P9IA 5JI6A 3E6BA 2FXAA 4U0WA 2HKOA 2CG4A 4HAMA 1AOYA 3JTHA 3R60A 1G6NA 1IF1A 2LSOA 4KUMA 4FHTA 3VFZA 2GZWA 2JPBA 4IF4A 4KN4X 5ICCA 4KIFA 3FXUA 4G7HF 3LA2A 1OR7A 3NRVA 1WKMA 3TDUC 2M1BA 5LGUA 2FMLA 1B9MA 2NNYA 3GVAA 1FY7A 2ZFWA 1ZREA 4O5VA 2FF4A 2H27A 5LHGA 2ZO4A 3K1MA 3M7GA 3FXQA 5D5XB 4KNYA 4L18B 5L3GA 1LVAA 2VODA 3DF8A 4M6XA 3VB2A 3BZ6A 1EV7A 1BC8C 2RKHA 2ZJ2A 1MDMA 2IW5A 1PP7U 2WV0A 4A5NA 4LMYA 5K1YA 1TQPA 1H0MA 5D8KB 2IA2A 3E6CC 3K1NA 3HRMA 1S7AA 1FOKA 3LA7A 2DQLA 3LA3A 5D5VB 1KQ9A 3KE2A 4PGGA 3W6KB 1WSUA 3H92A 1ZRDA 3T5XA 4WF2A 2P6TA 2JSCA 2LDUA 1T6SA 1K79A 1Z05A 4ZYHA 3FX3A 1ZG5A 3GZ6A 3WTSC 3SZTA 1J7KA 2DK5A 4S05A 2Z5UA 1SD4A 1XCBA 2GA1A 2QBYA 1Z91A 4OIOF 4Y17A 2UXNA 3GW2A 4M6YA 2LF8A 3GWZA 3WU1B 4KICA 2HKXA 3HUGA 1YO5C 1Z1DA 5E1ZB 4EMSA 1Z6RA 4HX7A 1UHMA 1W7PA 4ZZLA 1KA8A 2L4MA 2PLYA 3GO5A 2KKOA 4I98B 3M8FA 6PAXA 3CUOA 1QZYA 2XAJA 3QU6A 1WRJA 5FD6A 1BIAA 2MH2A 2E7WA 1TBXA 4PGHA 2IJLA 1J9IA 3HOTA 3HHHA 1CGPA 3JSOA 2X0LA 2RNJA 2FBHA 4R1HA 1FBSA 1ZYRF 2P4WA 1ON1A 3B02A 4L9TA 1JGSA 1SAXA 2IPQX 3BWGA 3GF2A 3CO6C 1EH8A 5AONA 1LB2A 1XGMA 3BY6A 4R8HA 3LQQA 2YU3A 3F8MA 5K5RA 4Y13A 3CUQB 2RVCA 1MKMA 2DLLA 2A3SA 3R61A 3U9GA 3FMSA 4S04A 4LGWA 1XB4A 5K5OA 2BBYA 1KU7A 2COMA 1USTA 2ISYA 2LKPA 1QPMA 1DPUA 5J6XA 2OAZA 1IAWA 2IA1A 1U3EM 3BJAA 4GYGA 3BP8A 4LG0B 3WTWC 1BBYA 2EFQA 3T8TA 2J5OA 4G7ZF 3ZMSA 3JW4A 3ZMTA 3HSFA 2IRFG 5LGNA 1TNSA 5HS7A 2O6GE 2VOOA 2KJCA 2XRNA 2ZBKA 3KP6A 3KP2A 2XAQA 3MEXA 5J8CA 3FZVA 3V8JA 3R0AA 2XHKA 4KIBA 2FOKA 4HX4A 4L9VA 4O3MA 3FWEA 3GLXA 1DDNA 2RN7A 2GWRA 4G8XA 1J2XA 5DD4A 3CO7C 2IT0A 4HA8A 1QNTA 2K02A 1H9GA 3RKYA 4RGXA 4HF2A 2ESNA 1SFXA 2DAOA 3M9AA 3MAJA 4MQ9F 1ZN2A 3LAPA 3P7NA 4LB5A 5FO5A 5ERIA 4HBLA 4UVCA 4YIFA 4UNOA 3ABUA 1K78B 4ZYGA 2ZXJA 5HDKA 2PJPA 2OU2A 4MTEA 4B8XA 4HQEA 1DP7P 1ZGAA 1FBUA 5DV5A 2A69F 3DQVC 4OMYA 3EYYA 4Y15A 1O3SA 3BJ6A 4RGSA 2H09A 2Q8KA 3M1EA 3CLOA 4KA4A 3ZPLA 4A12A 1QBJA 2QYOA 2GQQA 3BOQA 1KGSA 1YW9A 1PP8F 1HKQA 1XMKA 2EFOA 1IW7F 1XGSA 3I54A 4UV9A 4XLNF 4LG0A 2EFPA 2P7CB 3K9TA 2O0YA 1T0FA 2XKPA 3F8CA 4JK1X 3DP7A 1KQ0A 4LLGF 4BXUA 5E17F 1O7LA 4IJAA 1FBQA 3KLOA 1YFHA 5HDNA 3JAMK 2QQ9A 3HYIA 1USSA 1IN6A 4EQQA 3TKYA 1UB9A 4JQFA 2M45A 3MZHA 3O2PE 4LJZF 4P96A 2FQ3A 1IRGA 2QQAA 3R4KA 4QWQA 1SMYF 5LHHA 2KIMA 1FYKA 4G7OF 2VT2A 1UFMA 1YTYA 4ZYEA 1QZZA 2W57A 2CQKA 1O57A 3MWMA 4HV6A 1I1SA 1MJAA 5FFXA 4LB6B 1D8KA 2Y75A 5D4SA 4GXOA 5DEQA 1WWXA 2OA4A 3MQ0A 5FLXK 4E70A 2NAZA 3I59B 3CUQC 4LLLA 4EM2A 5LGTA 2O8XA 4ON0A 2Y0MA 3FM5A 3G3ZA 1XDSA 5IT9K 3PQJA 3RI4A 3JAMZ 1TQIA 2F5CA 1MDMB 1R1VA 1BIBA 1GVJA 2OZ6A 4UV8A 1A04A 2MD5A 3RPUA 4F7ZA 4RGRA 4BHPA 3K69A 3WGHA 2PBIA 3PQKA 2EFNA 5HLIA 5AIQA 1YIOA 4BH9A 2M5WA 2YR2A 5DD8A 2P5LC 4G94A 4IXAA 5A2QK 1L3LA 2RGVA 2CW0F 5ILSA 1ZG1A 5J8FA 4M72A 4IRHA 1LDDA 2XVCA 3BPXA 4CYDA 4HLYA 3DFGA 2EWNA 3CTAA 5D6EA 3ML6A 3GUDA 2R7DA 4IHTA 1IXSB 3J81Z 2DBBA 1ONVA 2O61A 2QBYB 4HX8A 3K2ZA 3O3KA 2QM3A 4P55A 3HOSA 3LFKA 3ABTA 1IUYA 3GYHX 4A6DA 1S3JA 5CVIA 5DUIA 3E5UA 5D5WB 5KVRA 4EJTA 4NHJA 3Q9SA 3I71A 3HIFA 4CO8A 4AD9A 5IT9Z 1W7PB 5D6FA 1B59A 1ZARA 3M8EA 1R00A 5L3DA 3E3VA 3I59A 2AS5F 1I5ZA 4M74A 1Q1HA 3ROUA 2MBFA 4RB0A 2ZMEA 1TQMA 4HLXA 2P5VA 4HQMA 2GXGA 1OPCA 4EV0A 1FX7A 2JT1A 4L0ZB 1ZHFA 1CF7A 1FSEA 3NQOA 3MFKA 4A0YA 5A2QZ 5ICGA 5F6FA 5JR3A 2UWMA 2EV0A 1HKTA 1RZ4A 4Q5SF 4H0EA 1KQ8A 1LJ9A 2M30A 3EUHA 4OIRF 4RB1A 1K7AA 2ESHA 1R1UA 4PDKA 1Z9CA 1B9NA 4HV5A 4KN7X 4NB5A 4NQWA 3GFIA 1BI0A 4RAYA 1AWCA 1ON2A 4G9YA 5ICEA 3L9FA 2VXZA 2M8EA 2O03A 5IT3A 5EEGA 1HBXG 2WTEA 2ZNZA 4GGGA 4HF0A 2H6BA 2YX7A 2ISZA 3CDHA 1HW1A 4UXNA 2YPRA 2DPDA 5DCFA 2P7VB 2D1HA 3GFJA 3H3UA 4I01A 2MLGA 4IRIA 3V8KA 2BEOA 2VBYA 1V4RA 3R6SA 3FF5A 4I09A 3F23A 3ULQB 3REOA 2CFXA 3I0TA 4ZH4F 2PFBA 1HW2A 1P2FA 1SD5A 3SXYA 1XMAA 2HGCA 3IWFA 1T39A 2H94A 4FX0A 4P9FA 1XN7A 2HZTA 1KYWA 4M9XA 3GZ5A 4IRGA 4MEXF 4AVPA 5BMZA 1LQ1A 1FNNA 1G3YA 4O6JA 4LK1F 1WQ2A 2L02A 4BHBA 4WXCA 2OQRA 1BJAA 3HTUA 3ECOA 1O3TA 1L0OC 2O3FA 3KZYA 2E1CA 1IN5A 2HS5A 4U88A 2HQRA 4BQAA 4KT5C 4L5JA 4RS8A 1FT9A 4EJVA 2VT3A 2UXXA 2OD5A 3BJOA 4M9SA 1LEBA 3FMQA 4MTDA 2KIUA 1BM9A 4HYEA 3S2WA 1PUEE 2NYXA 1B1BA 2L54A 4BHCA 1P92A 2V9VA 1KYZA 2EA4A 3WTUC 4AWXB 3WG9A 4GYIA 1WI9A 1BI1A 5LHIA 3ELKA 1XSDA 4U0YA 2A6HF 5DYMA 2DO7A 3QAHA 2KJBA 3O6BB 1JE8A 3J80K 1OYIA 4HOBA 2D1VA 4FT8A 1RNLA 4LLNA 2WWYA 4ESBA 4ENMA 1G4DA 5JFRA 5DCMA 1HQCA 1P4XA 4A0ZA 5H6QA 2IVMA 2R3SA 2QZ8A 2XROA 3V7SA 2W24A 1XDUA 2DQRA 4HF1A 3F6VA 4OMZA 1PDNC 2ACJA 2DK8A 2PG4A 3V7RA 4CXFA 3IRRA 5TRDA 4R79A 3PFIA 2P5KA 1JXSA 1U78A 3I64A 5K5QA 1R1TA 5ED4A 1G3TA 2F5FA 3I58A 2BE5F 4MNUA 2MH9A 3IL2A 1DUXC 3QU3A 1XGNA 3HRUA 4WK8F 5E18F 1FWZA 2ETHA 5LRRA 3V7CA 3WODF 4KMFA 3W6JB 3RJPA 3Q9VA 2XIGA 2A5YB 3N97A 2VBWA 3J80Z 3U2RA 1GXPA 1H9TA 2PMUA 2Z3YA 1JHHA 5F1RA 2DU9A 1UCRA 2FMYA 2MC3A 3GFMA 2D2WA 1QQIA 4U7BA 4XBFA 2HQNA 4BYYA 1ZGJA 4PCQA 2KRFA 3AAFA 2DT5A 3KP7A 2C6YA 3EDPA 2PMHA 5BOXA 1BC7C 3ZMUA 1BN5A 5ILUA 2F5DA 3FXRA 2Y48A 2XAGA 1ZRCA 1FSHA 4MGRA 1TTYA 3DPTA 4GCVA 3RIRA 5JHUA 4XRFA 5JVTA 3ZP5A 4B09A 5FB2A 2VC1A 4WXHA 4BNCA 2OBPA 3E97A 3KETA 2WC2A 5HS8A 2YX4A 1T38A 4EJWA 2A68F 3FMRA 4M73A 2A6EF 2MLKA 3KFWX 5TJJA 4QLCU 1XD7A 3IC7A 3P9KA 4WXDA 2STTA 2EJRA 2VBXA 1VTNC 2ZNYA 3GFLA 1U8RA 1I6XA 1HXDA 5D5UB 5CVJA 1SFUA 1BOAA 4OINF 1S6LA 3TDZC 2VONA 1OMIA 4WWCA 3DEUA 5FD5A 2EB7A 3D0SA 3GX4X 2FNAA 1MD0A 4GO1A 2CSOA 4UHTA 3ERED 2F5EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RYR A;  1HW5 A;  4HDV A;  4FX4 A;  1QO0 D;  2ZCW A;  2JRT A;  2YSR A;  3J81 K;  4AIJ A;  4HDU A;  3KZZ A;  4P9U A;  2JTV A;  3NEU A;  3F8N A;  2IA0 A;  5BS6 A;  2ZME B;  3BDD A;  5HDG A;  4WX9 A;  1RUN A;  3FM3 A;  1CF7 B;  3TO7 A;  1O7F A;  5KK1 A;  4I2O A;  2TDX A;  1DPR A;  1HSJ A;  2W84 A;  3T0Y A;  3RDI A;  3IRQ A;  4MEY F;  3L09 A;  3LWF A;  3HHG A;  4CHU A;  2FE3 A;  3QRF F;  4I7H A;  3T1B A;  5LEK A;  1S29 A;  2J5P A;  2K4J A;  3WTT C;  1K6O A;  1RUO A;  2LF7 A;  4KFC A;  3ISP A;  1P4W A;  3HTS B;  3ZN0 A;  2KIF A;  1YG2 A;  2HDC A;  3T8R A;  4EJO A;  1Z6T A;  2BYV E;  2GXB A;  2AXL A;  1MJ9 A;  4D0P A;  2RQP A;  1EH7 A;  4L9N A;  2A07 F;  4XLP F;  1FLI A;  1UHW A;  3WTV C;  1KU3 A;  1R23 A;  3QPH A;  4M9Z A;  5LEJ A;  2GA2 A;  3I4P A;  2CYY A;  5HVQ C;  2STW A;  3HRT A;  4RB3 C;  4EGY A;  3RKW A;  3WTZ A;  2V6C A;  1IN8 A;  3LQR A;  1LDK B;  2VN2 A;  4G6D A;  4ETS A;  3WE3 A;  1IXC A;  3JSP A;  2FU4 A;  2QVO A;  3Q5F A;  5HLH A;  1F5T A;  2HOE A;  2L01 A;  4EVI A;  3RPQ A;  1FYM A;  3LST A;  2FSW A;  3QP5 A;  4RAZ A;  2EK5 A;  1SMT A;  2XGX A;  5E8G A;  1HKS A;  1REP C;  2EV6 A;  3VOD A;  5HLG A;  1W7P D;  1KU2 A;  3RTR A;  1G3S A;  3VOE A;  1C0W A;  2HFH A;  1P4A A;  4DNC A;  2V79 A;  4A0X A;  1Z7U A;  4N0B A;  1J75 A;  4YG2 F;  3IHU A;  2LNB A;  2GAU A;  3SFZ A;  2K86 A;  5E20 A;  3K1P A;  3QPT A;  3SQN A;  2W85 A;  2K27 A;  4KIG A;  1F1Z A;  5E8I A;  3HRS A;  3ECH A;  3GEZ A;  4M71 A;  4XSZ F;  2Z99 A;  1XCV A;  2QUF A;  1ODD A;  1D3Y A;  5LBQ A;  2QLZ A;  4JBA A;  3C7J A;  2HTJ A;  1IN7 A;  2PQ8 A;  4EM1 A;  2Z9O A;  1B6A A;  5L3C A;  1U2W A;  1IZ1 A;  2E1N A;  1I1G A;  1ULY A;  4IPA A;  3FHZ A;  4EJU A;  1IXR C;  1BI2 A;  3TOB A;  5E1X A;  5D4R A;  2DI3 A;  5DCM B;  3TOA A;  4ENN A;  1U6G A;  1OYY A;  4LFU A;  1ZG3 A;  2HTS A;  4OU0 A;  2VOP A;  1LEA A;  2JPC A;  2K4B A;  2CO5 A;  3WGI A;  1U5T B;  5CJ9 A;  3EYI A;  2EFW A;  4WCG A;  4MQV A;  4A6E A;  3TO9 A;  4K2E A;  1YS6 A;  2X4H A;  4OIQ F;  4AIK A;  4CDG A;  2MA3 A;  1XSV A;  1X3U A;  3KEO A;  5DDG A;  3OV8 A;  1OYW A;  3L2C A;  1SD7 A;  3TQN A;  4L5I A;  1YQA A;  2P6S A;  2PEX A;  1SFE A;  4ZZD A;  1I27 A;  2M87 A;  1T98 A;  1OKR A;  2L4A A;  5ICF A;  3KEQ A;  4CIC A;  2CWE A;  4N9I A;  2EA2 A;  1HST A;  2E7X A;  4CZZ A;  2XUB A;  1FP1 D;  3C3W A;  3WGG A;  3DV8 A;  4KYW A;  3RKX A;  1FPQ A;  3F22 A;  1FZP B;  1XGO A;  5H20 A;  2DPU A;  4OOI A;  3N4M A;  2FEZ A;  3F6O A;  4LK0 F;  3E6M A;  2HEO A;  1ZRF A;  3E5Q A;  3KCC A;  3ZN1 A;  1J5Y A;  4BAY A;  2R7F A;  2W25 A;  3OOP A;  3SHF A;  2VBZ A;  1KU9 A;  2FNP A;  2V1X A;  1E2X A;  3IWZ A;  3HSR A;  2DFI A;  3R0J A;  2OQG A;  4ENJ A;  1STZ A;  1TLH B;  5FFZ A;  4OIP F;  2Z33 A;  4ENK A;  2VE9 A;  3EET A;  1U5T A;  1RI7 A;  1LDJ A;  5CYV A;  3BRO A;  4Z2Y A;  1S8N A;  5AIP A;  2FRH A;  4YFX F;  1ZLK A;  3H3Z A;  4YFK F;  2VC0 A;  3COA C;  4EM0 B;  4ZYD A;  3KLN A;  2D45 A;  1D5V A;  2CGP A;  1GHC A;  2RDP A;  4A2U A;  5FGM A;  4Q47 A;  2DTR A;  5H6R A;  4I02 A;  2OZU A;  5LLQ A;  2QEN A;  4Q48 A;  3E6D A;  1SD6 A;  3L00 A;  1F9N A;  2P8T A;  3K0L A;  4U0V A;  3TGN A;  5HS9 A;  1T2K A;  1ZH5 A;  2L3D A;  1R5G A;  3KP3 A;  3L7W A;  1W5S A;  2FA5 A;  2XV4 S;  2BV6 A;  3DPL C;  2PI0 A;  3WE2 A;  1P6R A;  1FP2 A;  2BGC A;  4CGZ A;  3I53 A;  3EQL F;  1W4M A;  1TW2 A;  3F8B A;  2NS0 A;  1D8J A;  5HOO A;  5CVU A;  2FBK A;  4I0B A;  1YLF A;  3D5L A;  4G6Q A;  4U7D A;  1QGP A;  4LD5 A;  1EH6 A;  5ILV A;  1NHA A;  3WU0 A;  3CUQ A;  2NRA C;  5CLS A;  2Q0O A;  3ZMZ A;  1IN4 A;  1TNT A;  3WTY C;  1V3F A;  1B4A A;  1MZB A;  2IP2 A;  3MZY A;  4PZJ A;  4Q4Z F;  2ZKZ A;  5L3E A;  3P9C A;  5DUK A;  3HSE A;  4A5M A;  1U5T C;  3F8F A;  3V8L A;  1GXQ A;  3BPV A;  1RIO H;  3WTX C;  1LNW A;  1J0R A;  1YW8 A;  3ZMV A;  2GIV A;  4HZF A;  2XKO A;  2DW4 A;  1YS7 A;  4RGU A;  4UVA A;  1BI3 A;  3QOP A;  3J7A O;  1Y0U A;  2FBI A;  3B73 A;  3IKT A;  4ESF A;  3F72 A;  4YII A;  3TO6 A;  1YW7 A;  3LAJ A;  3G73 A;  4L0Y B;  3VEP A;  1TW3 A;  1R36 A;  3QP6 A;  3I5U A;  2VE8 A;  5BPI A;  2NNN A;  5CVV A;  5D8L B;  2XAS A;  3CJN A;  2K7L A;  2HWV A;  4P5O A;  4UUV A;  1R7J A;  3KP5 A;  3IKV A;  3U1D A;  1MJB A;  1XSX A;  1K78 A;  2PN6 A;  4TV7 A;  4AIH A;  5E1W A;  2XAF A;  2G7H A;  5CVR A;  1IRF A;  4ASN A;  1R5H A;  2A61 A;  2G9W A;  1W5T A;  4ESJ A;  2QWW A;  3GXO A;  3C1D A;  4I0A A;  1YYV A;  4RB2 C;  5LRS A;  2B0L A;  5EEH A;  1F4K A;  4HW0 A;  2JZY A;  2ADU A;  3F21 A;  4L9J A;  4EGZ A;  2HR3 A;  1G3W A;  4KMU X;  4YFN F;  3F3X A;  5F64 A;  4XSX F;  1S7O A;  2EV5 A;  1FYL A;  1JHF A;  2RC4 A;  4N9H A;  1ZLJ A;  4MHG A;  1R58 A;  3ZMD A;  1R22 A;  4IHS A;  3KP4 A;  2HYF A;  3ZQ7 A;  1E17 A;  2ELH A;  2V1D A;  3E5X A;  1O3R A;  1MGT A;  1FC3 A;  2H6C A;  2UZK A;  3DKW A;  2XAH A;  4UVB A;  1J59 A;  4IVN A;  3DXJ F;  5L3B A;  3C18 A;  2Q2E A;  1O3Q A;  2QQB A;  3RYP A;  2HYG D;  3SZP A;  5BQT A;  4DQ2 A;  2RV8 A;  2V1U A;  3MCZ A;  5BPD A;  3V4G A;  5FLX Z;  2G7U A;  4KDP A;  5L3F A;  3JTG A;  2F2E A;  1ZAO A;  3P9I A;  5JI6 A;  3E6B A;  2FXA A;  4U0W A;  2HKO A;  2CG4 A;  4HAM A;  1AOY A;  3JTH A;  3R60 A;  1G6N A;  1IF1 A;  2LSO A;  4KUM A;  4FHT A;  3VFZ A;  2GZW A;  2JPB A;  4IF4 A;  4KN4 X;  5ICC A;  4KIF A;  3FXU A;  4G7H F;  3LA2 A;  1OR7 A;  3NRV A;  1WKM A;  3TDU C;  2M1B A;  5LGU A;  2FML A;  1B9M A;  2NNY A;  3GVA A;  1FY7 A;  2ZFW A;  1ZRE A;  4O5V A;  2FF4 A;  2H27 A;  5LHG A;  2ZO4 A;  3K1M A;  3M7G A;  3FXQ A;  5D5X B;  4KNY A;  4L18 B;  5L3G A;  1LVA A;  2VOD A;  3DF8 A;  4M6X A;  3VB2 A;  3BZ6 A;  1EV7 A;  1BC8 C;  2RKH A;  2ZJ2 A;  1MDM A;  2IW5 A;  1PP7 U;  2WV0 A;  4A5N A;  4LMY A;  5K1Y A;  1TQP A;  1H0M A;  5D8K B;  2IA2 A;  3E6C C;  3K1N A;  3HRM A;  1S7A A;  1FOK A;  3LA7 A;  2DQL A;  3LA3 A;  5D5V B;  1KQ9 A;  3KE2 A;  4PGG A;  3W6K B;  1WSU A;  3H92 A;  1ZRD A;  3T5X A;  4WF2 A;  2P6T A;  2JSC A;  2LDU A;  1T6S A;  1K79 A;  1Z05 A;  4ZYH A;  3FX3 A;  1ZG5 A;  3GZ6 A;  3WTS C;  3SZT A;  1J7K A;  2DK5 A;  4S05 A;  2Z5U A;  1SD4 A;  1XCB A;  2GA1 A;  2QBY A;  1Z91 A;  4OIO F;  4Y17 A;  2UXN A;  3GW2 A;  4M6Y A;  2LF8 A;  3GWZ A;  3WU1 B;  4KIC A;  2HKX A;  3HUG A;  1YO5 C;  1Z1D A;  5E1Z B;  4EMS A;  1Z6R A;  4HX7 A;  1UHM A;  1W7P A;  4ZZL A;  1KA8 A;  2L4M A;  2PLY A;  3GO5 A;  2KKO A;  4I98 B;  3M8F A;  6PAX A;  3CUO A;  1QZY A;  2XAJ A;  3QU6 A;  1WRJ A;  5FD6 A;  1BIA A;  2MH2 A;  2E7W A;  1TBX A;  4PGH A;  2IJL A;  1J9I A;  3HOT A;  3HHH A;  1CGP A;  3JSO A;  2X0L A;  2RNJ A;  2FBH A;  4R1H A;  1FBS A;  1ZYR F;  2P4W A;  1ON1 A;  3B02 A;  4L9T A;  1JGS A;  1SAX A;  2IPQ X;  3BWG A;  3GF2 A;  3CO6 C;  1EH8 A;  5AON A;  1LB2 A;  1XGM A;  3BY6 A;  4R8H A;  3LQQ A;  2YU3 A;  3F8M A;  5K5R A;  4Y13 A;  3CUQ B;  2RVC A;  1MKM A;  2DLL A;  2A3S A;  3R61 A;  3U9G A;  3FMS A;  4S04 A;  4LGW A;  1XB4 A;  5K5O A;  2BBY A;  1KU7 A;  2COM A;  1UST A;  2ISY A;  2LKP A;  1QPM A;  1DPU A;  5J6X A;  2OAZ A;  1IAW A;  2IA1 A;  1U3E M;  3BJA A;  4GYG A;  3BP8 A;  4LG0 B;  3WTW C;  1BBY A;  2EFQ A;  3T8T A;  2J5O A;  4G7Z F;  3ZMS A;  3JW4 A;  3ZMT A;  3HSF A;  2IRF G;  5LGN A;  1TNS A;  5HS7 A;  2O6G E;  2VOO A;  2KJC A;  2XRN A;  2ZBK A;  3KP6 A;  3KP2 A;  2XAQ A;  3MEX A;  5J8C A;  3FZV A;  3V8J A;  3R0A A;  2XHK A;  4KIB A;  2FOK A;  4HX4 A;  4L9V A;  4O3M A;  3FWE A;  3GLX A;  1DDN A;  2RN7 A;  2GWR A;  4G8X A;  1J2X A;  5DD4 A;  3CO7 C;  2IT0 A;  4HA8 A;  1QNT A;  2K02 A;  1H9G A;  3RKY A;  4RGX A;  4HF2 A;  2ESN A;  1SFX A;  2DAO A;  3M9A A;  3MAJ A;  4MQ9 F;  1ZN2 A;  3LAP A;  3P7N A;  4LB5 A;  5FO5 A;  5ERI A;  4HBL A;  4UVC A;  4YIF A;  4UNO A;  3ABU A;  1K78 B;  4ZYG A;  2ZXJ A;  5HDK A;  2PJP A;  2OU2 A;  4MTE A;  4B8X A;  4HQE A;  1DP7 P;  1ZGA A;  1FBU A;  5DV5 A;  2A69 F;  3DQV C;  4OMY A;  3EYY A;  4Y15 A;  1O3S A;  3BJ6 A;  4RGS A;  2H09 A;  2Q8K A;  3M1E A;  3CLO A;  4KA4 A;  3ZPL A;  4A12 A;  1QBJ A;  2QYO A;  2GQQ A;  3BOQ A;  1KGS A;  1YW9 A;  1PP8 F;  1HKQ A;  1XMK A;  2EFO A;  1IW7 F;  1XGS A;  3I54 A;  4UV9 A;  4XLN F;  4LG0 A;  2EFP A;  2P7C B;  3K9T A;  2O0Y A;  1T0F A;  2XKP A;  3F8C A;  4JK1 X;  3DP7 A;  1KQ0 A;  4LLG F;  4BXU A;  5E17 F;  1O7L A;  4IJA A;  1FBQ A;  3KLO A;  1YFH A;  5HDN A;  3JAM K;  2QQ9 A;  3HYI A;  1USS A;  1IN6 A;  4EQQ A;  3TKY A;  1UB9 A;  4JQF A;  2M45 A;  3MZH A;  3O2P E;  4LJZ F;  4P96 A;  2FQ3 A;  1IRG A;  2QQA A;  3R4K A;  4QWQ A;  1SMY F;  5LHH A;  2KIM A;  1FYK A;  4G7O F;  2VT2 A;  1UFM A;  1YTY A;  4ZYE A;  1QZZ A;  2W57 A;  2CQK A;  1O57 A;  3MWM A;  4HV6 A;  1I1S A;  1MJA A;  5FFX A;  4LB6 B;  1D8K A;  2Y75 A;  5D4S A;  4GXO A;  5DEQ A;  1WWX A;  2OA4 A;  3MQ0 A;  5FLX K;  4E70 A;  2NAZ A;  3I59 B;  3CUQ C;  4LLL A;  4EM2 A;  5LGT A;  2O8X A;  4ON0 A;  2Y0M A;  3FM5 A;  3G3Z A;  1XDS A;  5IT9 K;  3PQJ A;  3RI4 A;  3JAM Z;  1TQI A;  2F5C A;  1MDM B;  1R1V A;  1BIB A;  1GVJ A;  2OZ6 A;  4UV8 A;  1A04 A;  2MD5 A;  3RPU A;  4F7Z A;  4RGR A;  4BHP A;  3K69 A;  3WGH A;  2PBI A;  3PQK A;  2EFN A;  5HLI A;  5AIQ A;  1YIO A;  4BH9 A;  2M5W A;  2YR2 A;  5DD8 A;  2P5L C;  4G94 A;  4IXA A;  5A2Q K;  1L3L A;  2RGV A;  2CW0 F;  5ILS A;  1ZG1 A;  5J8F A;  4M72 A;  4IRH A;  1LDD A;  2XVC A;  3BPX A;  4CYD A;  4HLY A;  3DFG A;  2EWN A;  3CTA A;  5D6E A;  3ML6 A;  3GUD A;  2R7D A;  4IHT A;  1IXS B;  3J81 Z;  2DBB A;  1ONV A;  2O61 A;  2QBY B;  4HX8 A;  3K2Z A;  3O3K A;  2QM3 A;  4P55 A;  3HOS A;  3LFK A;  3ABT A;  1IUY A;  3GYH X;  4A6D A;  1S3J A;  5CVI A;  5DUI A;  3E5U A;  5D5W B;  5KVR A;  4EJT A;  4NHJ A;  3Q9S A;  3I71 A;  3HIF A;  4CO8 A;  4AD9 A;  5IT9 Z;  1W7P B;  5D6F A;  1B59 A;  1ZAR A;  3M8E A;  1R00 A;  5L3D A;  3E3V A;  3I59 A;  2AS5 F;  1I5Z A;  4M74 A;  1Q1H A;  3ROU A;  2MBF A;  4RB0 A;  2ZME A;  1TQM A;  4HLX A;  2P5V A;  4HQM A;  2GXG A;  1OPC A;  4EV0 A;  1FX7 A;  2JT1 A;  4L0Z B;  1ZHF A;  1CF7 A;  1FSE A;  3NQO A;  3MFK A;  4A0Y A;  5A2Q Z;  5ICG A;  5F6F A;  5JR3 A;  2UWM A;  2EV0 A;  1HKT A;  1RZ4 A;  4Q5S F;  4H0E A;  1KQ8 A;  1LJ9 A;  2M30 A;  3EUH A;  4OIR F;  4RB1 A;  1K7A A;  2ESH A;  1R1U A;  4PDK A;  1Z9C A;  1B9N A;  4HV5 A;  4KN7 X;  4NB5 A;  4NQW A;  3GFI A;  1BI0 A;  4RAY A;  1AWC A;  1ON2 A;  4G9Y A;  5ICE A;  3L9F A;  2VXZ A;  2M8E A;  2O03 A;  5IT3 A;  5EEG A;  1HBX G;  2WTE A;  2ZNZ A;  4GGG A;  4HF0 A;  2H6B A;  2YX7 A;  2ISZ A;  3CDH A;  1HW1 A;  4UXN A;  2YPR A;  2DPD A;  5DCF A;  2P7V B;  2D1H A;  3GFJ A;  3H3U A;  4I01 A;  2MLG A;  4IRI A;  3V8K A;  2BEO A;  2VBY A;  1V4R A;  3R6S A;  3FF5 A;  4I09 A;  3F23 A;  3ULQ B;  3REO A;  2CFX A;  3I0T A;  4ZH4 F;  2PFB A;  1HW2 A;  1P2F A;  1SD5 A;  3SXY A;  1XMA A;  2HGC A;  3IWF A;  1T39 A;  2H94 A;  4FX0 A;  4P9F A;  1XN7 A;  2HZT A;  1KYW A;  4M9X A;  3GZ5 A;  4IRG A;  4MEX F;  4AVP A;  5BMZ A;  1LQ1 A;  1FNN A;  1G3Y A;  4O6J A;  4LK1 F;  1WQ2 A;  2L02 A;  4BHB A;  4WXC A;  2OQR A;  1BJA A;  3HTU A;  3ECO A;  1O3T A;  1L0O C;  2O3F A;  3KZY A;  2E1C A;  1IN5 A;  2HS5 A;  4U88 A;  2HQR A;  4BQA A;  4KT5 C;  4L5J A;  4RS8 A;  1FT9 A;  4EJV A;  2VT3 A;  2UXX A;  2OD5 A;  3BJO A;  4M9S A;  1LEB A;  3FMQ A;  4MTD A;  2KIU A;  1BM9 A;  4HYE A;  3S2W A;  1PUE E;  2NYX A;  1B1B A;  2L54 A;  4BHC A;  1P92 A;  2V9V A;  1KYZ A;  2EA4 A;  3WTU C;  4AWX B;  3WG9 A;  4GYI A;  1WI9 A;  1BI1 A;  5LHI A;  3ELK A;  1XSD A;  4U0Y A;  2A6H F;  5DYM A;  2DO7 A;  3QAH A;  2KJB A;  3O6B B;  1JE8 A;  3J80 K;  1OYI A;  4HOB A;  2D1V A;  4FT8 A;  1RNL A;  4LLN A;  2WWY A;  4ESB A;  4ENM A;  1G4D A;  5JFR A;  5DCM A;  1HQC A;  1P4X A;  4A0Z A;  5H6Q A;  2IVM A;  2R3S A;  2QZ8 A;  2XRO A;  3V7S A;  2W24 A;  1XDU A;  2DQR A;  4HF1 A;  3F6V A;  4OMZ A;  1PDN C;  2ACJ A;  2DK8 A;  2PG4 A;  3V7R A;  4CXF A;  3IRR A;  5TRD A;  4R79 A;  3PFI A;  2P5K A;  1JXS A;  1U78 A;  3I64 A;  5K5Q A;  1R1T A;  5ED4 A;  1G3T A;  2F5F A;  3I58 A;  2BE5 F;  4MNU A;  2MH9 A;  3IL2 A;  1DUX C;  3QU3 A;  1XGN A;  3HRU A;  4WK8 F;  5E18 F;  1FWZ A;  2ETH A;  5LRR A;  3V7C A;  3WOD F;  4KMF A;  3W6J B;  3RJP A;  3Q9V A;  2XIG A;  2A5Y B;  3N97 A;  2VBW A;  3J80 Z;  3U2R A;  1GXP A;  1H9T A;  2PMU A;  2Z3Y A;  1JHH A;  5F1R A;  2DU9 A;  1UCR A;  2FMY A;  2MC3 A;  3GFM A;  2D2W A;  1QQI A;  4U7B A;  4XBF A;  2HQN A;  4BYY A;  1ZGJ A;  4PCQ A;  2KRF A;  3AAF A;  2DT5 A;  3KP7 A;  2C6Y A;  3EDP A;  2PMH A;  5BOX A;  1BC7 C;  3ZMU A;  1BN5 A;  5ILU A;  2F5D A;  3FXR A;  2Y48 A;  2XAG A;  1ZRC A;  1FSH A;  4MGR A;  1TTY A;  3DPT A;  4GCV A;  3RIR A;  5JHU A;  4XRF A;  5JVT A;  3ZP5 A;  4B09 A;  5FB2 A;  2VC1 A;  4WXH A;  4BNC A;  2OBP A;  3E97 A;  3KET A;  2WC2 A;  5HS8 A;  2YX4 A;  1T38 A;  4EJW A;  2A68 F;  3FMR A;  4M73 A;  2A6E F;  2MLK A;  3KFW X;  5TJJ A;  4QLC U;  1XD7 A;  3IC7 A;  3P9K A;  4WXD A;  2STT A;  2EJR A;  2VBX A;  1VTN C;  2ZNY A;  3GFL A;  1U8R A;  1I6X A;  1HXD A;  5D5U B;  5CVJ A;  1SFU A;  1BOA A;  4OIN F;  1S6L A;  3TDZ C;  2VON A;  1OMI A;  4WWC A;  3DEU A;  5FD5 A;  2EB7 A;  3D0S A;  3GX4 X;  2FNA A;  1MD0 A;  4GO1 A;  2CSO A;  4UHT A;  3ERE D;  2F5E A; 
#chains in the Genus database with same CATH topology
 1NG7 A;  3S1Q J;  3PFY A;  3RYR A;  3OWT A;  4E7J A;  1HW5 A;  4HDV A;  1IDZ A;  1V5E A;  3CCR I;  4XRS G;  2LYC A;  5HOD A;  1QO0 D;  3AG3 H;  2ZCW A;  3BG3 A;  4FX4 A;  2JRT A;  1FJL A;  2YSR A;  3O8G A;  2ZB9 A;  4UB6 C;  1U9O A;  2MG4 A;  3CQZ J;  3J81 K;  4HDU A;  4AIJ A;  2K9L A;  3KZZ A;  2DOF A;  2KLO A;  5EJC A;  5IOY A;  3CJR B;  4P9U A;  2JTV A;  3NEU A;  3F8N A;  2JA5 J;  3ABL H;  3ZCO A;  4M3E A;  2IA0 A;  4BJ6 C;  5JLW A;  1GV5 A;  5BS6 A;  3OYG A;  1ZR4 A;  2ZME B;  2MC4 A;  3HXL A;  2OTJ I;  3U21 A;  3BDD A;  5HDG A;  4WX9 A;  1RUN A;  1Z77 A;  3FM3 A;  1CF7 B;  2CRG A;  2DMN A;  2VIX A;  3TO7 A;  2QSH X;  1O7F A;  5KK1 A;  4I2O A;  1Y0N A;  2TDX A;  3OOU A;  5KAF C;  1DPR A;  2E1M C;  2IGK A;  1HSJ A;  2W84 A;  3E0J B;  3T0Y A;  2V6E A;  1MBF A;  3RDI A;  5J4Y A;  1RC9 A;  1GLN A;  1SVO A;  2XAU A;  4AC0 A;  5FRN A;  3BG6 A;  3IRQ A;  2HOS A;  4HSR A;  4MEY F;  3L09 A;  3LWF A;  2FOW A;  3HHG A;  5FRM A;  4M3B A;  3EUK L;  4D5C A;  2QEX I;  4CHU A;  2FE3 A;  3B6A A;  4ABZ A;  3QRF F;  4I7H A;  4ZDP A;  3T1B A;  3WHB A;  1XPX A;  4KJZ A;  2MW8 A;  1FOW A;  5LEK A;  2XB0 X;  2LBF A;  1T0F C;  2JA8 J;  1S29 A;  2EIK H;  2J5P A;  1OCP A;  1Z67 A;  2K4J A;  3WTT C;  1H89 C;  1K6O A;  4FQG A;  1RUO A;  1OCZ H;  2LF7 A;  2XGD A;  4NQW B;  4KFC A;  5E79 C;  3H0G J;  4BXF A;  3ISP A;  1ACI A;  1P4W A;  2DDB A;  4IL6 C;  3HTS B;  4E7I A;  3ZN0 A;  2KIF A;  1YG2 A;  2HDC A;  3JRA A;  1HC8 A;  3T8R A;  4EJO A;  1Z6T A;  1TWF J;  2BYV E;  1WGX A;  4CSW A;  2GXB A;  2CW7 A;  3RQ4 A;  1OIS A;  2AXL A;  1MJ9 A;  3BG9 A;  4D0P A;  1VQO I;  1WH7 A;  2RQP A;  1EH7 A;  3IH2 A;  2QKM B;  3TW6 A;  1MMA A;  4L9N A;  2IEK A;  2A07 F;  4XLP F;  5H2F C;  1FLI A;  1UHW A;  3DTI A;  3WTV C;  2W48 A;  4RM2 A;  1KU3 A;  1R23 A;  3BR3 A;  3QPH A;  1BA5 A;  4M9Z A;  4CYC B;  5LEJ A;  2GA2 A;  3I4P A;  2CYY A;  5FKK A;  5HVQ C;  2STW A;  4C3J J;  3HRT A;  4RB3 C;  2R7X A;  3BZC A;  4EGY A;  3RKW A;  3D5R C;  1A6I A;  1Y8Q B;  3WTZ A;  2V6C A;  1VQM I;  1IN8 A;  3VYS B;  1N78 A;  3LQR A;  4Y4R A;  1LDK B;  2VN2 A;  4G6D A;  3TBI A;  3FHN A;  4S0H B;  2KL4 A;  2DFE A;  3L2V A;  5IOZ A;  3PNY A;  1VI0 A;  3WE3 A;  4ETS A;  1IXC A;  3JSP A;  2FU4 A;  2DJN A;  5GTI C;  5DM6 F;  2QVO A;  2PJR A;  3Q5F A;  2DA7 A;  5FLV A;  1ETQ A;  3AL0 C;  1D1C A;  5HLH A;  3DEE A;  2HOE A;  1F5T A;  2R7Z J;  2L01 A;  2CMP A;  2MYS A;  3FK6 A;  3GME A;  4IHW A;  4EVI A;  3RPQ A;  4B48 A;  2ELJ A;  1FYM A;  3NWS A;  3LST A;  2FSW A;  3QP5 A;  4RAZ A;  2EK5 A;  1SMT A;  2XGX A;  3TL4 X;  5E8G A;  3I4N J;  2AO9 A;  1HKS A;  1REP C;  2EV6 A;  1HLV A;  2BVL A;  3VOD A;  5HLG A;  1W7P D;  1KU2 A;  3RTR A;  3BR1 A;  1G3S A;  1FOY A;  2QQ8 A;  2K9N A;  3VOE A;  4F93 B;  4JX6 A;  1SAU A;  1C0W A;  2HFH A;  2MSY A;  1I3Q J;  1P4A A;  1EA3 A;  2V1N A;  2V79 A;  4A0X A;  4DNC A;  3A01 A;  2YS9 A;  2CW8 A;  1WZ2 A;  1Z7U A;  4L5E A;  4N0B A;  3GTK J;  1UJ8 A;  5EEA A;  1J75 A;  3M3Y J;  4YG2 F;  1SFK A;  1KZH A;  2N8G A;  3IHU A;  2LNB A;  2GAU A;  5C4X J;  3SFZ A;  2K86 A;  5E20 A;  2M4G A;  4FAS D;  3K1P A;  3QPT A;  3SQN A;  2W85 A;  1UHS A;  2K27 A;  2BHZ A;  4KIG A;  1YOV B;  1F1Z A;  5E8I A;  1KON A;  3HRS A;  3ECH A;  3GEZ A;  2HPI A;  4M71 A;  4XSZ F;  2CUF A;  5J47 A;  2Z16 A;  2Z99 A;  2HYJ A;  3CJQ B;  1XCV A;  2QUF A;  1ODD A;  3ERM A;  1D3Y A;  5LBQ A;  3M4O J;  2QLZ A;  4JBA A;  1PJR A;  3C7J A;  1VQK I;  2HTJ A;  1S9H A;  3HOW J;  3DTE A;  3QPL A;  1IN7 A;  4IX7 A;  2DN0 A;  2PQ8 A;  2WY8 Q;  3MVP A;  2Y0S N;  1HDP A;  1ITY A;  1D0Y A;  4EM1 A;  3IAM 2;  2Z9O A;  4IO9 F;  1SAN A;  1B6A A;  5L3C A;  3LNQ A;  3M8J A;  5B66 C;  1U2W A;  1IZ1 A;  1G2H A;  2E1N A;  1I1G A;  1ULY A;  1OJL A;  4IPA A;  2ZFU A;  3FHZ A;  4EJU A;  2BY3 A;  4LG3 A;  1JUP A;  1IXR C;  1VQ8 I;  4Y7N J;  5IP9 J;  1MSF C;  4AM3 A;  1BI2 A;  1E3O C;  3TOB A;  5E1X A;  4NNJ A;  1LFP A;  3OYH A;  3CCM I;  4RAF A;  5D4R A;  1OCR H;  2DI3 A;  5DCM B;  4CYC A;  3TOA A;  4ENN A;  1U6G A;  1OYY A;  4LFU A;  1ZG3 A;  2HTS A;  4OU0 A;  2VOP A;  1LEA A;  2JPC A;  2K4B A;  2CO5 A;  2B7E A;  4PSW A;  1R9T J;  3WGI A;  1U5T B;  5CJ9 A;  1GVD A;  3EYI A;  4BQN A;  2ICW G;  2EFW A;  4WCG A;  4MQV A;  1MMD A;  4A3B J;  2KDZ A;  3S3N A;  4A6E A;  3TO9 A;  2I10 A;  2R92 J;  4K2E A;  1YS6 A;  2X4H A;  4OIQ F;  4AIK A;  4DIQ A;  4CDG A;  4FE4 A;  4DOZ A;  2MA3 A;  1XSV A;  1X3U A;  2LKX A;  4MIM A;  3KEO A;  4BGD A;  5DDG A;  3OV8 A;  2ZME C;  3PUF A;  1P7J A;  4BDZ A;  1OYW A;  3L2C A;  3HDD A;  1SD7 A;  3TQN A;  4L5I A;  3CCS I;  1ETW A;  1YQA A;  2P6S A;  2PEX A;  1SFE A;  4F92 B;  1F43 A;  3M1C A;  2WAF A;  2A5W A;  1ZEL A;  4ZZD A;  5EGO B;  3D5S C;  1I27 A;  1IRZ A;  4RMN A;  1ENH A;  4IKF A;  1Y8R B;  5E3L A;  2M87 A;  1K6Y A;  3L1P A;  2DOA A;  1T98 A;  1OKR A;  3S17 J;  3U1K A;  1Y6I A;  2L4A A;  1R4N B;  3KEQ A;  5ICF A;  1V5G A;  4CIC A;  2CWE A;  4N9I A;  2EA2 A;  3OL4 A;  2R7R A;  3OIP A;  1HST A;  2E7X A;  3OYI A;  3EUH C;  2VPL A;  4E6K G;  4CZZ A;  3S2D J;  2XUB A;  1FP1 D;  2QA4 I;  3C3W A;  3WGG A;  3DU5 A;  3DV8 A;  4KYW A;  3RKX A;  3SYT A;  2E2I J;  1FPQ A;  3F22 A;  1FZP B;  3BTL A;  1MIJ A;  3H3V K;  1XGO A;  1WVR A;  5H20 A;  2DPU A;  4OOI A;  4HG2 A;  3OR1 C;  2K85 A;  3N4M A;  3VWB A;  2FEZ A;  3F6O A;  4LK0 F;  3E6M A;  2HEO A;  1ZRF A;  3E5Q A;  2MGQ A;  3KCC A;  3ZN1 A;  4A69 C;  1J5Y A;  4HST A;  2JVH A;  4BAY A;  1D0Z A;  3LSJ A;  4HPQ A;  2R7F A;  4E7S A;  2B63 J;  2W25 A;  3I4M J;  3OOP A;  3SHF A;  4XOT A;  2VBZ A;  2L7F P;  4AU7 A;  1KU9 A;  1XG1 A;  3JRD A;  2FNP A;  2V1X A;  5GP9 A;  1E2X A;  2IGM A;  2ME0 A;  3IWZ A;  4RAG A;  3HSR A;  2DFI A;  3K4M A;  2L7K A;  3R0J A;  2OQG A;  2CFO A;  4ENJ A;  1STZ A;  4JP0 A;  5F08 A;  4AVZ A;  3H5R A;  1BW5 A;  1YJN I;  1TLH B;  5FFZ A;  1ZK8 A;  4IQ4 A;  1S7E A;  2HXI A;  4OIP F;  2Z33 A;  4ENK A;  2E1O A;  2OUM A;  1QVT A;  2VE9 A;  4XMY A;  3EET A;  5CQE A;  1U5T A;  1RI7 A;  1LDJ A;  5CYV A;  3BRO A;  4Z2Y A;  1MW7 A;  2MAB A;  1S8N A;  5KHD A;  5AIP A;  5B3S H;  2FRH A;  4YFX F;  2VKE A;  4XQF A;  1ZLK A;  3H3Z A;  4YFK F;  3OYE A;  3CLQ A;  2VC0 A;  2XRL A;  3HB9 A;  3COA C;  4EM0 B;  3H1C A;  4ZYD A;  1WHU A;  5F04 A;  3KLN A;  3ZOB A;  2D45 A;  1D5V A;  2CGP A;  1GHC A;  2RDP A;  4I76 A;  4A2U A;  3A1Y A;  2NOG A;  3PM1 A;  4XID A;  1YJW I;  1GT0 C;  2HVS A;  2H8W A;  3CZ6 A;  3EPZ A;  3I3L A;  5FGM A;  4Q47 A;  2RNG A;  4OWR B;  2DTR A;  3VYU B;  1A31 A;  3CCV I;  5H6R A;  4I02 A;  2X85 A;  5FLM J;  2OZU A;  4C3I J;  5LLQ A;  2QEN A;  3L00 A;  3E6D A;  1SD6 A;  4Q48 A;  1F9N A;  2XPV A;  2P8T A;  5EZG A;  3K0L A;  4U0V A;  4AUX A;  2KPM A;  3TGN A;  5HS9 A;  1T2K A;  1ZH5 A;  2DA1 A;  2L3D A;  5LD2 C;  4IHX A;  1R5G A;  3KP3 A;  3J7Y J;  4ZDO A;  3L7W A;  1W5S A;  2FA5 A;  2XV4 S;  4A3I J;  3BCA A;  3WHC A;  2BV6 A;  4FIS A;  3DPL C;  1VQL I;  2PI0 A;  3WE2 A;  1P6R A;  5IY5 H;  1Q1V A;  1RRJ A;  2IS1 A;  2DA4 A;  1BL0 A;  3CMA I;  3PO3 J;  1Z3Y A;  1FP2 A;  2BGC A;  4CGZ A;  3I53 A;  3HJE A;  2HOA A;  1WJA A;  3EQL F;  1W4M A;  3QOD A;  1JUS A;  1TW2 A;  2CUJ A;  3F8B A;  2NS0 A;  1IV8 A;  5HOO A;  1D8J A;  5CVU A;  2FBK A;  4D7N A;  4I0B A;  1YLF A;  3D5L A;  4XN3 A;  4G6Q A;  1JT0 A;  4U7D A;  1B72 A;  3OIO A;  1QGP A;  5TGT A;  4LD5 A;  1EH6 A;  5ILV A;  1NHA A;  3SEZ A;  3WU0 A;  4NUB A;  3ZQH A;  3CUQ A;  1XS9 A;  4A3G J;  2NRA C;  2V9P A;  2DA6 A;  1XTA A;  3J7A Y;  2KP6 A;  2Q0O A;  5CLS A;  1S72 I;  5KAI C;  3ZMZ A;  1IN4 A;  2XC7 A;  1TNT A;  1FMW A;  3WTY C;  4BE1 A;  1V3F A;  1APL C;  1B4A A;  2JA6 J;  2E35 A;  1MZB A;  3GTQ J;  1TWG J;  5B1B H;  1JKO C;  2IP2 A;  3MZY A;  3CP2 A;  3KYD B;  2CS3 A;  2L7M P;  2OCC H;  4PZJ A;  1SFO J;  4Q4Z F;  2ZKZ A;  3G1M A;  2EZH A;  3P9C A;  5L3E A;  3L2U A;  5DUK A;  2YUS A;  2AHQ A;  3HSE A;  4NC8 A;  2ZXH A;  1UMQ A;  3W6V A;  4A5M A;  1U5T C;  3F8F A;  2CUE A;  3AG1 H;  3V8L A;  1GXQ A;  1R71 A;  4XKB A;  3P5J A;  3BG7 A;  3BPV A;  1RIO H;  3WTX C;  1FTZ A;  1LNW A;  1J0R A;  3PUB A;  3UR3 C;  1YW8 A;  3ZMV A;  5M5X J;  5F1J A;  2Y0S A;  1SVL A;  2GIV A;  4HZF A;  2XKO A;  1LVK A;  2M34 A;  1N25 A;  3BQZ A;  1UG2 A;  1IJW C;  1X4O A;  2R7Q A;  5DM7 F;  2F4O B;  3KX2 A;  2DW4 A;  3G2B A;  3EUA A;  3JRF A;  4B44 A;  3KYL A;  1YS7 A;  4RGU A;  5GPC A;  2X9D A;  4UVA A;  4G6T B;  1BI3 A;  3FIW A;  3OYK A;  3BC8 A;  3QOP A;  1OLT A;  3J7A O;  3SJM A;  3JRH A;  2X6Y A;  3HGG A;  1Y0U A;  2FBI A;  2BXY A;  3B73 A;  3IKT A;  4ESF A;  2EQR A;  3F72 A;  3HZJ A;  4YII A;  3OYN A;  1TT0 A;  3BQY A;  3TO6 A;  4NBQ A;  2ID6 A;  3S8P A;  3ZQQ A;  3V42 A;  1YW7 A;  3LAJ A;  1UZC A;  3G73 A;  4L0Y B;  3MN2 A;  5DS9 A;  3I55 I;  2NS7 A;  3MKY B;  3VEP A;  1TW3 A;  1A36 A;  1W5C C;  4C2U A;  2KHM A;  3H35 A;  3B6C A;  1R36 A;  3M07 A;  3QP6 A;  3I5U A;  2VE8 A;  5BPI A;  2NNN A;  2RRE A;  5JHF A;  5CVV A;  4DGW B;  5D8L B;  2XAS A;  2XF7 A;  3CJN A;  2JN6 A;  2K7L A;  2HWV A;  3HOX J;  1MBJ A;  3DPU A;  3QWL A;  4P5O A;  2PJR B;  5CPR B;  1MMS A;  4XM3 A;  4UUV A;  3AKZ A;  1R7J A;  3KP5 A;  4PSX A;  1HDD C;  4A3C J;  4QSH A;  3PIP F;  3IKV A;  3U1D A;  2H1K A;  1MJB A;  1XSX A;  2RAE A;  1K78 A;  2PN6 A;  4TV7 A;  1EF4 A;  1R5I D;  2VJI A;  4AIH A;  5E1W A;  2XAF A;  2G7H A;  5IYD J;  5CVR A;  1IRF A;  2GXA A;  4ASN A;  2Z1D A;  1R5H A;  2NVT J;  3NAU A;  3K4N A;  2LY9 A;  4CCL A;  2HQA A;  4C2M J;  2LR8 A;  1YX3 A;  2A61 A;  2DDA A;  4XKC A;  2G9W A;  1W5T A;  2WV1 A;  2QSG X;  4ESJ A;  2QWW A;  3C2B A;  3C1D A;  3GXO A;  1P7I A;  4I0A A;  1YYV A;  3A01 B;  3CCQ I;  1ZKG A;  1VND A;  4RB2 C;  3DKY A;  1UG0 A;  1X4P A;  5LRS A;  2CJJ A;  4LIU A;  2B0L A;  2JRM A;  5EEH A;  1Z7L A;  1F4K A;  4M6V A;  2CV0 A;  3HOV J;  4HW0 A;  1WFX A;  2JZY A;  5TIS C;  2ADU A;  3F21 A;  4L9J A;  4EGZ A;  2OC6 A;  1X1P A;  3CP8 A;  4PJN A;  2HR3 A;  1G3W A;  4KMU X;  4YFN F;  3F3X A;  1QZE A;  5F64 A;  4XSX F;  1S7O A;  4RDU A;  2EV5 A;  1FYL A;  1JHF A;  2RC4 A;  4N9H A;  1ZLJ A;  2Y30 A;  2L9V A;  3JRC A;  3KPH A;  3L2Q A;  4MHG A;  1R58 A;  4M3F A;  2XB5 A;  2RQQ A;  4D5F A;  4PJJ A;  3CDI A;  3ZMD A;  1R22 A;  4E4H A;  3KP4 A;  3PNT A;  4IHS A;  2HYF A;  2JQ7 A;  3ZQ7 A;  1E17 A;  2O7O A;  2FQ4 A;  2ELH A;  2V1D A;  3E5X A;  4J01 A;  4HNV A;  1O3R A;  1BW6 A;  3JR9 A;  1MGT A;  1FC3 A;  2H6C A;  2UZK A;  3DKW A;  2WAQ N;  2XAH A;  4UVB A;  1J59 A;  1V54 H;  2VL8 A;  4IVN A;  3DXJ F;  2LMD A;  5L3B A;  3C18 A;  1YIJ I;  3ZQL A;  3GTL J;  2Q2E A;  5EDN A;  3L2W A;  1RKW A;  1O3Q A;  3CCU I;  2QQB A;  2M7A A;  3H36 A;  3RYP A;  3IV5 A;  1I39 A;  2HYG D;  3OMY A;  2M0C A;  3SZP A;  3S1N J;  4QTR A;  1U8B A;  3ABM H;  2ELK A;  2NVU B;  1VZ0 A;  5BQT A;  4DQ2 A;  1T95 A;  4N4O B;  1EJ9 A;  2RV8 A;  2DT7 B;  2V1U A;  5J1U A;  5J3L A;  3MCZ A;  5BPD A;  3ZQI A;  4PJL A;  2XF5 A;  3VSL A;  3V4G A;  2E36 A;  1JGG A;  5FLX Z;  2G7U A;  4KDP A;  5L3F A;  3JTG A;  2F2E A;  1ZAO A;  4BKX A;  3P9I A;  5JI6 A;  3E6B A;  1ERD A;  3UKG A;  2FXA A;  3K6G A;  3CF5 F;  4U0W A;  2DTZ A;  2HKO A;  2CG4 A;  4V2F A;  4HAM A;  1AOY A;  3JTH A;  3R60 A;  4M3D A;  2UUZ A;  2CH0 A;  1G6N A;  1IF1 A;  4EEF G;  2LSO A;  2VJ5 A;  3Q3S A;  2R5Y A;  2CUZ A;  4KUM A;  4X0G A;  1RR8 C;  4FHT A;  2HVR A;  3GTP J;  1PYV A;  2KZV A;  3VFZ A;  2GZW A;  3HM5 A;  2JPB A;  4IF4 A;  4KN4 X;  5ICC A;  4KIF A;  2BXZ A;  3FXU A;  4IHY A;  4G7H F;  3LA2 A;  4BJ5 C;  1OR7 A;  4BQO A;  3NRV A;  2LD5 A;  1WKM A;  3TDU C;  1BR2 A;  2M1B A;  2E60 A;  5LGU A;  2FML A;  1B9M A;  4BEH B;  1VQ6 I;  2NNY A;  3DLL F;  3GVA A;  1FY7 A;  2ZFW A;  4PJ0 C;  4IEJ A;  1ZRE A;  4O5V A;  2FF4 A;  4LIT A;  1ETK A;  2M4K A;  2H27 A;  5LHG A;  2K3P A;  2ZO4 A;  3K1M A;  1JTX A;  3TP0 A;  4CH7 A;  2W00 A;  2XPU A;  2ZJQ F;  4JX5 A;  3M7G A;  3FXQ A;  5D5X B;  4E7H A;  4KNY A;  4L18 B;  3A2K A;  5L3G A;  1LVA A;  3CES A;  2VOD A;  3DF8 A;  3OYC A;  4M6X A;  3VB2 A;  3AFH A;  2GLO A;  3BZ6 A;  1EV7 A;  2WAE A;  2ZSH B;  1BC8 C;  2RKH A;  2BW3 B;  2ZJ2 A;  4GRI A;  4RM3 A;  4B47 A;  3Q0U A;  1MDM A;  1S5L C;  2IW5 A;  2O8K A;  1PP7 U;  2WV0 A;  3HPG A;  4A5N A;  4LMY A;  3DLA A;  5K1Y A;  1TQP A;  5GAH J;  5D8K B;  1H0M A;  5B5E C;  2IA2 A;  3E6C C;  3K1N A;  1ZTR A;  4XOR A;  5FRO A;  1Y39 A;  4XL9 A;  3HRM A;  1TT5 B;  4BBS J;  1S7A A;  4RLQ A;  1FOK A;  2X1D A;  1K4S A;  3KYC B;  3LA7 A;  4DYQ A;  3GTO J;  2VKV A;  2NVX J;  1X58 A;  1QHH D;  2DQL A;  1FTT A;  3VPR A;  3LA3 A;  5D5V B;  2CQ7 A;  2F6C A;  4D1Q A;  1KQ9 A;  1F36 A;  3KE2 A;  4PGG A;  3W6K B;  5JVG F;  1WSU A;  3H92 A;  1ZRD A;  3T5X A;  3UNG C;  4WF2 A;  2P6T A;  2JSC A;  3RCO A;  1M1E B;  3L2R A;  2LDU A;  2DMT A;  1IV6 A;  1T6S A;  2FJ1 A;  1K79 A;  2FX0 A;  3JCU C;  1Z05 A;  1QPI A;  3E7L A;  4ZYH A;  3QOE A;  2NXN B;  3HKZ N;  3FX3 A;  1T33 A;  4PUS A;  1ZG5 A;  4CUG A;  1T8I A;  3GZ6 A;  5M3M J;  1MH3 A;  1IC8 A;  3WTS C;  3CC2 I;  1FIP A;  3FXK A;  3SZT A;  3K4B A;  1WCM J;  1J7K A;  2EH3 A;  4PFO A;  2FD5 A;  1POG A;  2DK5 A;  4F52 A;  4S05 A;  2Z5U A;  1SD4 A;  2V4J C;  1XCB A;  1NTC A;  2GA1 A;  3OYJ A;  2JUG A;  4XLF A;  1Z91 A;  2QBY A;  4OIO F;  2HQ5 A;  1I3A A;  4ITV A;  4Y17 A;  4XR6 A;  4DZJ A;  2UXN A;  3GW2 A;  4M6Y A;  2LF8 A;  3GWZ A;  3WU1 B;  4KIC A;  3DTK A;  3LSG A;  2HKX A;  4D9J A;  3HUG A;  4FTH A;  1YO5 C;  3CJT B;  1Z1D A;  5E1Z B;  4EMS A;  3S14 J;  2K3F A;  1Z6R A;  4HX7 A;  1LE8 B;  1UHM A;  1W7P A;  2CQX A;  4ZZL A;  4B1R A;  1KA8 A;  3G6E I;  2L4M A;  2DJI A;  2PLY A;  3GO5 A;  5E3O A;  1AA7 A;  2LLK A;  3ZR8 X;  1CQT A;  3F9K A;  2KKO A;  4I98 B;  2LRD A;  3M8F A;  3LMM A;  6PAX A;  3CUO A;  1QZY A;  3I9V 2;  4BEH A;  2XAJ A;  3QU6 A;  5B1A H;  3HPH A;  3HGY A;  1WRJ A;  5FD6 A;  1BIA A;  2DCE A;  3ZRG A;  1AU7 A;  3OYD A;  1JTY A;  2MH2 A;  2E7W A;  1TC3 C;  1TBX A;  4PGH A;  2IJL A;  1JJ8 C;  1J9I A;  3HOT A;  1V55 H;  3HHH A;  3JRE A;  1CGP A;  5EG0 B;  3JSO A;  1J09 A;  1D1A A;  2X0L A;  2RNJ A;  4XN0 A;  2FBH A;  2BW3 A;  3A02 A;  2R7T A;  4R1H A;  2IXS A;  1UEL B;  3ZXS A;  1FBS A;  1TWC J;  2VJ4 A;  1ZYR F;  2M7B A;  2K9S A;  2R7O A;  5J4V A;  2P4W A;  1ON1 A;  3B02 A;  4L9T A;  1JGS A;  2DMU A;  1SAX A;  3QYF A;  1OCT C;  2IPQ X;  3BWG A;  3GF2 A;  3W2V A;  3CO6 C;  1EH8 A;  5AON A;  1LB2 A;  1B72 B;  1XGM A;  1E3H A;  4UY8 I;  3BY6 A;  1LFB A;  1DP3 A;  1FEX A;  2ECC A;  3LQQ A;  2YU3 A;  3F8M A;  4QPO A;  4R8H A;  4Y13 A;  5K5R A;  4AID A;  2X1C A;  1U9N A;  2XGE A;  3CUQ B;  3IUO A;  4E7K A;  2X6O A;  1TZL A;  2RVC A;  4DYR A;  1MKM A;  2A6T A;  2IGN A;  2K5C A;  2DLL A;  2HNH A;  4W1U A;  3G71 I;  4XLE A;  1ZQ3 P;  2A3S A;  3KIO A;  3R61 A;  4I99 C;  1W0U A;  3U9G A;  3FMS A;  4A3M J;  2JA2 A;  4S04 A;  3AG4 H;  4LGW A;  4YIR X;  1XB4 A;  2Y2Z A;  2W82 A;  5K5O A;  4HRI A;  4JOM A;  2BBY A;  1KU7 A;  2COM A;  3CCL I;  3K10 A;  1UST A;  2ISY A;  2LKP A;  4XKV A;  1QPM A;  1QVU A;  1DPU A;  5J6X A;  2OAZ A;  1IAW A;  2IA1 A;  1U3E M;  3BJA A;  2CQQ A;  2AXT C;  3GBG A;  1MSE C;  2Y69 H;  4GYG A;  3K70 D;  1RKT A;  3BP8 A;  1XX5 A;  2QCO A;  3VYT B;  2MD0 A;  3MZ8 A;  4LG0 B;  4BDY A;  3WTW C;  4RBO A;  1HOM A;  2DOE A;  1BBY A;  5CQG A;  2EFQ A;  1R4M B;  3T8T A;  2J5O A;  4G7Z F;  3ZMS A;  4A3D J;  3JW4 A;  3IH4 A;  3ZMT A;  1YRN B;  3SZG A;  1K61 A;  2G0E A;  1JJ6 C;  3GLL A;  3HSF A;  1XMX A;  4EAT A;  1NK3 P;  1MMN A;  2IRF G;  5LGN A;  1TNS A;  2LRE A;  1LE8 A;  5HS7 A;  2P0W A;  3Q0V A;  1YJ9 I;  2WAQ A;  4PFP A;  2O6G E;  2VOO A;  2KJC A;  4UB8 C;  2M8G X;  2V26 A;  2XRN A;  2ZBK A;  3CME I;  3DU6 A;  2LVS A;  3KP6 A;  3KP2 A;  2XAQ A;  3BLY A;  4JYK A;  3MEX A;  5J8C A;  3FZV A;  1ETY A;  3V8J A;  2R4G A;  4CCO A;  3R0A A;  2XHK A;  4KIB A;  2FOK A;  4HX4 A;  4E7Z A;  4BE0 A;  3D1N I;  4L9V A;  2LFB A;  1VQ7 I;  4O3M A;  4YEJ A;  1Y56 A;  3FWE A;  3GLX A;  2HI3 A;  1DDN A;  5IYB J;  4DYC A;  3JRG A;  2RN7 A;  2GWR A;  4G8X A;  1J2X A;  3KEY A;  5DD4 A;  1D1B A;  5K7Z A;  3LL7 A;  3CO7 C;  4UUS B;  2WB1 N;  2IT0 A;  2O9L A;  3GZN B;  1HCR A;  4HA8 A;  4XLC A;  3RSN A;  2YU9 J;  1QNT A;  2K02 A;  5EG0 A;  1H9G A;  1SVM A;  4DJA A;  1HF0 A;  2GIZ A;  3RKY A;  4RGX A;  4HF2 A;  1K83 J;  3BTI A;  2ESN A;  2LY2 A;  1SFX A;  2DAO A;  3H9Q A;  2WAD A;  3M9A A;  2HDD A;  4ZDL A;  3MAJ A;  4MQ9 F;  3LSK A;  5IPA A;  2UV1 A;  1ZN2 A;  4QIW N;  3LAP A;  2HPM A;  3S15 J;  3P7N A;  4LB5 A;  5FO5 A;  1WH5 A;  4HBL A;  5ERI A;  4UVC A;  2ZJP F;  4YIF A;  4UNO A;  3ABU A;  1K78 B;  2AQE A;  4ZYG A;  1RPW A;  4KT6 A;  3RQI A;  2ZXJ A;  3PL8 A;  5HDK A;  2PJP A;  2JSP A;  2R93 J;  1HA8 A;  4DZP A;  2OU2 A;  4MTE A;  5FJ8 J;  3S93 A;  3AL0 B;  4B8X A;  5EF6 A;  4BQQ A;  4HQE A;  4FCY A;  1DP7 P;  2LP0 A;  3DBH B;  4RLF A;  4A93 J;  1YI2 I;  1ZGA A;  1FBU A;  2X48 A;  3ZGK A;  4XRM A;  5DV5 A;  2A69 F;  3DQV C;  2F5V A;  4OMY A;  3SEQ A;  3EYY A;  4Y15 A;  2HDW A;  3OY9 A;  4Z6Y A;  2B9S A;  4V2G A;  1O3S A;  3BG5 A;  3A03 A;  1VQN I;  1VFC A;  2JVG A;  3BJ6 A;  3A4C A;  4RGS A;  2H09 A;  2Q8K A;  3BTJ A;  3M1E A;  3CLO A;  4KA4 A;  3ZPL A;  1QRY A;  4A12 A;  1QBJ A;  3CC4 I;  2QYO A;  2GQQ A;  2I5U A;  1KGS A;  2CU7 A;  3BOQ A;  1PUF B;  1WJE A;  1YW9 A;  1PP8 F;  1HKQ A;  1XMK A;  2EFO A;  4DW6 A;  1IW7 F;  1XGS A;  1V5F A;  3I54 A;  2E71 A;  3DBL B;  4LIV A;  4UV9 A;  4XLN F;  3CC7 I;  2E19 A;  4LG0 A;  2EFP A;  1VQ5 I;  2P7C B;  2HVQ A;  1G8X A;  2VJJ A;  2R7W A;  2VKH A;  3K9T A;  2JMW A;  2O0Y A;  5E3N A;  4FET A;  1YRN A;  1T0F A;  2XKP A;  4U87 A;  2DOD A;  4FE7 A;  5J40 A;  3F8C A;  3ONQ A;  3DP7 A;  4JK1 X;  1K4T A;  3WG7 H;  2XDV A;  1KQ0 A;  5F27 A;  4LLG F;  4BXU A;  3MKL A;  5E17 F;  2VB6 A;  1O7L A;  4IJA A;  1FBQ A;  3KLO A;  4YEL A;  1YFH A;  3H9G A;  5FKL A;  3C2H A;  5HDN A;  4GDF A;  3S1R J;  3JAM K;  2QQ9 A;  3DEW A;  4LOC A;  3HYI A;  2Q2E B;  2KIQ A;  4MFD A;  5FKO A;  1MMG A;  1USS A;  3IP4 B;  2E2H J;  1O4X A;  3HKZ A;  4CZC A;  3S16 J;  2I8D A;  3LSI A;  2DMQ A;  1IN6 A;  3ABK H;  4EQQ A;  3TKY A;  1PVE A;  1UB9 A;  4JQF A;  2M45 A;  3MZH A;  3O2P E;  2L5Q A;  4LJZ F;  4P96 A;  4UUS A;  2VKD A;  2FQ3 A;  4OAY A;  3QQA A;  4XRS A;  2EZL A;  4XK4 A;  5M3F J;  1IRG A;  2QQA A;  2OCE A;  4OAZ A;  3R4K A;  4QWQ A;  1SMY F;  1JKQ C;  2E5Z A;  3HOY J;  3FDY A;  5LHH A;  2X6X A;  1IO2 A;  1NG6 A;  2KIM A;  1FYK A;  4G7O F;  2VT2 A;  5M5Y J;  3VDX A;  3OYM A;  3KZI C;  1UFM A;  2KRH A;  4ZYE A;  1YTY A;  4B3X A;  1QZZ A;  2W57 A;  3BR0 A;  3FKJ A;  2BVM A;  2PMZ N;  2X6W A;  1OCC H;  2CQK A;  1O57 A;  3MWM A;  4HV6 A;  2DT6 A;  2LTP A;  3LSM A;  1I1S A;  1I6H J;  1MJA A;  2EIN H;  3E1S A;  5FFX A;  4LB6 B;  2R5Y B;  1TWH J;  1D8K A;  4NDL A;  2EZK A;  3PJR A;  2Y75 A;  1LPQ A;  2IGO A;  2LK2 A;  5D4S A;  1RES A;  4M3G A;  4GXO A;  4CCK A;  5DEQ A;  1WWX A;  1MNE A;  2DMP A;  2KQR A;  5C3E J;  2LC2 A;  2OA4 A;  3MQ0 A;  4KIT B;  5FLX K;  1MNM C;  2X51 A;  4E70 A;  2NAZ A;  2LG4 A;  3I59 B;  4BY7 J;  4BL0 B;  3K70 C;  5IP7 J;  1VQP I;  3CUQ C;  4UUT A;  4LLL A;  1D5Y A;  2R7V A;  1T08 B;  4C9Y A;  2L2O A;  4EM2 A;  3FXO A;  2P81 A;  5LGT A;  9ANT A;  4BY1 J;  3C2G A;  1X1D A;  3BT9 A;  2O8X A;  2IS4 A;  4ON0 A;  2Y0M A;  4BBR J;  3FM5 A;  3G3Z A;  5IYC J;  1XDS A;  4KIS A;  4J00 A;  4BJT A;  5IT9 K;  2GM4 A;  3PQJ A;  4BAC A;  3RI4 A;  1QA6 A;  3OSF A;  1PUF A;  3JAM Z;  4B43 A;  1TQI A;  2F5C A;  2WY7 Q;  1MDM B;  1R1V A;  2HZD A;  3IAS 2;  1BIB A;  1GVJ A;  1GV2 A;  2OZ6 A;  4UV8 A;  1GDT A;  5GPA A;  1A04 A;  2MD5 A;  3RPU A;  4RGR A;  1OFC X;  4F7Z A;  4BHP A;  2ZXI A;  3K69 A;  2ZJR F;  3WGH A;  3CCJ I;  2BY0 A;  3G1O A;  4BS9 A;  3BCB A;  2PBI A;  3PQK A;  2IS2 A;  2KMU A;  2EFN A;  5HLI A;  1IRX A;  2VQC A;  4AYB N;  2WBM A;  5AIQ A;  2DFH A;  2DXI A;  1YIO A;  3OS0 A;  3HL2 A;  4BH9 A;  2M5W A;  2YR2 A;  3LOC A;  5DD8 A;  3LSR A;  1E3P A;  2P5L C;  4G94 A;  3TP3 A;  4IXA A;  5A2Q K;  1L3L A;  4MLO A;  2RGV A;  2KZG A;  2CW0 F;  5ILS A;  1ZG1 A;  5J8F A;  4XNF A;  1Z3X A;  2JA7 J;  4IZZ A;  4M72 A;  2MFZ A;  3JRB A;  4IRH A;  1LDD A;  2XVC A;  3BPX A;  4CYD A;  4ZJZ A;  3OYA A;  4HLY A;  2R5Z B;  3DFG A;  2EWN A;  3CTA A;  5CKT A;  2LOO A;  5KNL A;  1N75 A;  3A0B C;  3RZD J;  5D6E A;  3ML6 A;  1W36 C;  2DYS H;  1EKE A;  2O5R A;  3GUD A;  2DA2 A;  2R7D A;  3LSP A;  2R7S A;  1AKH A;  4IOA F;  4IHT A;  1IXS B;  3O8H A;  1VQ9 I;  3J81 Z;  4A3L J;  2KDO A;  2DBB A;  3OYB A;  1ONV A;  2O61 A;  2QBY B;  5EZH A;  4HX8 A;  3K2Z A;  3K7A J;  3O3K A;  2QM3 A;  4P55 A;  3HOS A;  3LFK A;  3ABT A;  2M9H A;  1IUY A;  3GYH X;  2M0M A;  1UAA A;  2E34 A;  4A6D A;  1S3J A;  5CVI A;  2OV7 A;  4JX4 A;  5DUI A;  4II3 A;  2VI6 A;  3E5U A;  3HUG B;  5D5W B;  2NOJ B;  4I6Z A;  2Y9Z A;  5KVR A;  4EJT A;  4NHJ A;  3Q9S A;  3I71 A;  3HIF A;  2GOM A;  4CO8 A;  4AD9 A;  2KIS A;  5DTD A;  1W7P B;  5D6F A;  5IT9 Z;  1B59 A;  4MO7 A;  4F55 A;  1WPK A;  1ZAR A;  1WJD A;  3M8E A;  1X3W B;  3OSG A;  4Y33 A;  1R00 A;  1B8I B;  1R6R A;  5GAD J;  5L3D A;  3E3V A;  2L9N A;  3IH3 A;  3I59 A;  2AS5 F;  1I5Z A;  2QSF X;  4M74 A;  1Q1H A;  4NC7 A;  4GFB A;  1YE9 A;  4XOP A;  2OF7 A;  3ROU A;  3HC7 A;  1DGR M;  2MBF A;  4RB0 A;  3SDB A;  1IDY A;  2ZME A;  1TQM A;  2ECB A;  4HLX A;  1W0T A;  2P5V A;  4HQM A;  2GXG A;  1OPC A;  4V19 K;  4EV0 A;  1FIA A;  1TP4 A;  2WB1 A;  1FX7 A;  2JT1 A;  4L0Z B;  1ZHF A;  2EIJ H;  1CF7 A;  1FSE A;  2L0K A;  4HNU A;  3NQO A;  2EBI A;  3MFK A;  4A0Y A;  4DBR A;  5A2Q Z;  5ICG A;  1YHQ I;  4IHV A;  5F6F A;  5JR3 A;  3RZO J;  1RET A;  3OS2 A;  2UWM A;  2EV0 A;  1HKT A;  4P1W A;  1RZ4 A;  2KRC A;  4H0E A;  4Q5S F;  3MKW B;  4C3H J;  1KQ8 A;  4F91 B;  3GTJ J;  1LJ9 A;  2M30 A;  2Z2S B;  2NS8 A;  3QYB A;  4A3F J;  3EUH A;  2NVQ J;  1P9Q C;  3CMM A;  3I56 I;  4OIR F;  4W97 A;  2COB A;  4RB1 A;  1K7A A;  2ESH A;  1X2M A;  1W1W E;  2BY2 A;  1R1U A;  5J1Y A;  4PDK A;  1FOX A;  4F3Q A;  1B9N A;  1Z9C A;  4HV5 A;  4KN7 X;  1IGN A;  2VAS A;  3SDG A;  2EZI A;  5HLT A;  4NB5 A;  4Y52 J;  4NQW A;  3GFI A;  1TL8 A;  3SFI A;  1BI0 A;  2DYR H;  1Z0X A;  2JK3 A;  3TMO A;  1G59 A;  2L9S A;  4RAY A;  1I50 J;  3NAR A;  1QU3 A;  4CCJ A;  1AWC A;  2E5N A;  3OL3 A;  2FUG 2;  2W1O A;  1JI8 A;  3DBR B;  1BR4 A;  1ON2 A;  4G9Y A;  5ICE A;  3L9F A;  2VXZ A;  2R5Z A;  2VLA A;  2M8E A;  1MBE A;  2O03 A;  5IT3 A;  5EEG A;  1HBX G;  2WTE A;  3CMY A;  2ZNZ A;  4E7L A;  1X1B A;  2LH9 A;  3W2A A;  4GGG A;  4HF0 A;  2H6B A;  2YX7 A;  4IOC F;  2ISZ A;  5E3M A;  3CDH A;  1HW1 A;  4UXN A;  2YPR A;  5HNF A;  2DPD A;  1MH4 A;  2P7V B;  5DCF A;  3FBI B;  3ASO H;  3OIQ A;  2D1H A;  3GFJ A;  3H3U A;  5J1R A;  1Y1V J;  1VQ4 I;  1D0X A;  4I01 A;  3PSF A;  2MLG A;  4XLH A;  2EIL H;  4IRI A;  1A35 A;  3V8K A;  2BEO A;  2VBY A;  3CCY A;  3QYE A;  2D5V A;  1V4R A;  3R6S A;  1YX5 A;  3FF5 A;  1LUJ B;  2VUM J;  2HXO A;  4I09 A;  3F23 A;  3ULQ B;  2Y9Y A;  5LFA A;  2V7F A;  3REO A;  2CFX A;  3I0T A;  4ZH4 F;  2PFB A;  1HW2 A;  1P2F A;  1GUU A;  3GTG J;  2DA5 A;  5BNG A;  4ZTJ A;  1SD5 A;  2ME6 A;  3SXY A;  3PNV A;  1XMA A;  1A6Q A;  2L9R A;  2HGC A;  3IWF A;  2AQF A;  1B8I A;  4C30 A;  1T39 A;  1TWA J;  1IG7 A;  2H94 A;  4FX0 A;  4P9F A;  1XN7 A;  2HZT A;  4CCM A;  2VQL A;  1KYW A;  1OR7 C;  4A3K J;  2KT0 A;  4M9X A;  2L7Z A;  3LSH A;  1MND A;  3HOU J;  3MD2 A;  3GZ5 A;  4IRG A;  4MEX F;  4AVP A;  5BMZ A;  1LQ1 A;  3H5A A;  1FNN A;  3OR2 C;  1WJ5 A;  3DWL E;  2ZC2 A;  1G3Y A;  3ASN H;  4Y3O A;  1X1A A;  4O6J A;  4RA2 A;  3CCE I;  2CV2 A;  2CQN A;  3FXM A;  4LK1 F;  1BJZ A;  1WQ2 A;  2L02 A;  4BHB A;  3HG9 A;  3G1L A;  2JJ7 A;  4WXC A;  2OQR A;  2DA3 A;  1BJA A;  1MBH A;  3HTU A;  3ECO A;  1O3T A;  1L0O C;  2O3F A;  2XPW A;  3KZY A;  2TRT A;  4ZC3 A;  1BR1 A;  2PMZ A;  1VF9 A;  2E1C A;  1IN5 A;  1NK2 P;  2HS5 A;  4U88 A;  1OQY A;  2BZT A;  2HQR A;  3NWT A;  2VXD A;  4HEA 2;  4XKW A;  1ETX A;  4BQA A;  2JUC A;  4KT5 C;  4YRV A;  4L5J A;  2VQH A;  1DGW Y;  4RS8 A;  1FT9 A;  4EJV A;  4ZTF A;  2VT3 A;  2F4I A;  3VYR B;  2UXX A;  2WA0 A;  4H4K C;  2OD5 A;  3BJO A;  4M9S A;  1LEB A;  3FMQ A;  4MTD A;  2KIU A;  2PX9 A;  2QGU A;  1BM9 A;  4HYE A;  3W2W A;  2H8R A;  1Z21 A;  3K4C A;  1RR7 A;  2BHY A;  3S2W A;  2W7N A;  4CA0 A;  1PUE E;  2NYX A;  1T56 A;  1B1B A;  2L54 A;  3OS1 A;  2R7U A;  4BHC A;  1P92 A;  2V9V A;  3QPS A;  1KYZ A;  4QPQ A;  4C2T A;  3HOZ J;  2EA4 A;  5HNH A;  2ZXW H;  4AWX B;  3WG9 A;  4GYI A;  2VQG A;  3WTU C;  2K40 A;  1WI9 A;  1ORK A;  1LKX A;  3H5N A;  1WJC A;  1JT6 A;  1BI1 A;  5GTH C;  5LHI A;  3ELK A;  4B4C A;  2E1M B;  2QF7 A;  4HNT A;  1XSD A;  4B3A A;  4U0Y A;  1AHD P;  2A6H F;  5DYM A;  2DO7 A;  5C4J J;  3QAH A;  3MKZ A;  2KJB A;  3O6B B;  1JUM A;  1JE8 A;  3J80 K;  1OYI A;  1LFU P;  4HOB A;  2D1V A;  4FT8 A;  1RNL A;  4LLN A;  2WWY A;  4ZYA A;  2JWT A;  2Q1Z B;  3X2Q H;  4ESB A;  1ZGW A;  3H9J A;  4ENM A;  1G4D A;  1JKR C;  5JFR A;  3OYF A;  5DCM A;  1HQC A;  3JRI A;  1P4X A;  4A0Z A;  2OPT A;  3FXL A;  1Y1W J;  5H6Q A;  1X2N A;  2IVM A;  2R3S A;  2F4M B;  2QZ8 A;  4XLA A;  2XRO A;  3J7Z I;  1MBG A;  1XC5 A;  3V7S A;  2W24 A;  4AYB A;  5C44 J;  1XDU A;  2DQR A;  1WI3 A;  2BOL A;  3ZQC A;  2XF6 A;  4HF1 A;  2A05 A;  3BR2 A;  4G12 A;  5FKN A;  3F6V A;  2H1L A;  4OMZ A;  4BU2 A;  1YIT I;  2ACJ A;  1PDN C;  3LFU A;  2DK8 A;  2PG4 A;  3A0H C;  3V7R A;  1SEU A;  3FK7 A;  4CXF A;  3IRR A;  5TRD A;  2XGC A;  4R79 A;  3PFI A;  2EPF A;  5K7F A;  1JKP C;  4CCN A;  1OCO H;  2P5K A;  1X3Z B;  4II2 A;  3AG2 H;  1JXS A;  5FKM A;  1DU6 A;  4ANJ A;  3BTC A;  1U78 A;  4PJM A;  4X1E A;  3I64 A;  5K5Q A;  3Q0W A;  1BOB A;  1R1T A;  5ED4 A;  1X1C A;  1G3T A;  2F5F A;  2VPR A;  3I58 A;  2BE5 F;  2ZSI B;  4MNU A;  2MH9 A;  3IL2 A;  4X6A J;  1DUX C;  5GAG J;  1MBK A;  3QU3 A;  5F0H A;  5EGO A;  2OTL I;  1XGN A;  3FBN B;  3HRU A;  1ETO A;  2K9M A;  4WK8 F;  3BR5 A;  2HOT A;  2EIM H;  3K4L A;  2IAI A;  3BZK A;  3OYL A;  3HBL A;  1A5J A;  1ETV A;  3ESW B;  2K9Q A;  2F48 A;  5E18 F;  3S3M A;  1W36 D;  1FWZ A;  2ETH A;  3S1M J;  5LRR A;  3V7C A;  3WOD F;  3TW7 A;  4KMF A;  3W6J B;  3RJP A;  3Q9V A;  4A3E J;  2XIG A;  5EYR A;  2IBD A;  2A5Y B;  3DKX A;  2E2J J;  2IS6 A;  1DQU A;  1IUF A;  2BY1 A;  3F0C A;  3ZQG A;  2VBW A;  3J80 Z;  3U2R A;  3N97 A;  3MMY B;  2OJE D;  2X1E A;  2R0Q C;  5M5W J;  1GXP A;  1SC7 A;  1E0E A;  1H9T A;  2PMU A;  2Z3Y A;  3S32 A;  2LY1 A;  1JHH A;  2XSJ C;  3HEF A;  3GCM A;  5F1R A;  2DU9 A;  1UCR A;  2XSD C;  2FMY A;  2MC3 A;  3GFM A;  2KFD A;  2D2W A;  3BR6 A;  3S3O A;  1QQI A;  4NC6 A;  5F0C A;  3FKI J;  4U7B A;  1X19 A;  4XBF A;  3G4S I;  3CD6 I;  2HQN A;  2M2E A;  2HU9 A;  1N77 A;  4BYY A;  1ZGJ A;  4PCQ A;  2KRF A;  3AAF A;  2DT5 A;  3S2H J;  3KP7 A;  5K7H A;  2C6Y A;  3EDP A;  2PMH A;  5BOX A;  1BC7 C;  2ID3 A;  3ZMU A;  1BN5 A;  2CV1 A;  1U0J A;  5ILU A;  2F5D A;  3FXR A;  4J19 A;  1DU0 A;  2Y48 A;  2XAG A;  5JLX A;  1ZRC A;  1FSH A;  1WJB A;  3K2A A;  4MGR A;  1TTY A;  3DPT A;  4GCV A;  3K4K A;  5F0F A;  3VSK A;  1H88 C;  3RIR A;  3FXJ A;  5IP6 A;  1NH3 A;  2LBF B;  5JHU A;  4BUP A;  4XRF A;  3CDL A;  5JVT A;  2NVY J;  3ZP5 A;  4B09 A;  1H8A C;  4N4N B;  1WJF A;  3RKQ A;  5GAE J;  5FB2 A;  2VC1 A;  4IQJ A;  4WXH A;  4BNC A;  2W4S A;  3FIS A;  1R49 A;  2OBP A;  1QHG A;  3E97 A;  4D7M A;  3KET A;  2WC2 A;  5HS8 A;  2GOX B;  3CF2 A;  4PK4 A;  2YX4 A;  1T38 A;  4EJW A;  4A3J J;  2A68 F;  2V9K A;  3FMR A;  3PSI A;  1ZR2 A;  4XIC A;  3RPU D;  1FMV A;  3GTM J;  2LKS A;  4M73 A;  4BE2 A;  3TED A;  2A6E F;  3N05 A;  3W3C A;  2MLK A;  2QKL B;  3KFW X;  5TJJ A;  4QLC U;  1XD7 A;  3DCF A;  3IC7 A;  3P9K A;  4WXD A;  2STT A;  2EJR A;  4BXX J;  2VBX A;  2GBY A;  1VTN C;  2ZNY A;  3GFL A;  1AKH B;  1U8R A;  1I6X A;  1HXD A;  3WU2 C;  5D5U B;  3K4J A;  5CVJ A;  1SFU A;  1BOA A;  2DFF A;  4OIN F;  1S6L A;  3TDZ C;  3H0D A;  3PIO F;  2VON A;  1OMI A;  2TCT A;  4WWC A;  3DEU A;  3PO2 J;  2Y31 A;  4DBQ A;  5KCM A;  4MFE A;  5FD5 A;  2EB7 A;  4XON A;  3D0S A;  2FNA A;  1MD0 A;  3GX4 X;  4GO1 A;  2CSO A;  4UHT A;  3ZQF A;  3ERE D;  2M3A A;  2F5E A; 
#chains in the Genus database with same CATH homology
 3RYR A;  1HW5 A;  4HDV A;  4FX4 A;  1QO0 D;  2ZCW A;  2JRT A;  2YSR A;  3J81 K;  4AIJ A;  4HDU A;  3KZZ A;  4P9U A;  2JTV A;  3NEU A;  3F8N A;  2IA0 A;  5BS6 A;  2ZME B;  3BDD A;  5HDG A;  4WX9 A;  1RUN A;  3FM3 A;  1CF7 B;  3TO7 A;  1O7F A;  5KK1 A;  4I2O A;  2TDX A;  1DPR A;  1HSJ A;  2W84 A;  3T0Y A;  3RDI A;  3IRQ A;  4MEY F;  3L09 A;  3LWF A;  3HHG A;  4CHU A;  2FE3 A;  3QRF F;  4I7H A;  3T1B A;  5LEK A;  1S29 A;  2J5P A;  2K4J A;  3WTT C;  1K6O A;  1RUO A;  2LF7 A;  4KFC A;  3ISP A;  1P4W A;  3HTS B;  3ZN0 A;  2KIF A;  1YG2 A;  2HDC A;  3T8R A;  4EJO A;  1Z6T A;  2BYV E;  2GXB A;  2AXL A;  1MJ9 A;  4D0P A;  2RQP A;  1EH7 A;  4L9N A;  2A07 F;  4XLP F;  1FLI A;  1UHW A;  3WTV C;  1KU3 A;  1R23 A;  3QPH A;  4M9Z A;  5LEJ A;  2GA2 A;  3I4P A;  2CYY A;  5HVQ C;  2STW A;  3HRT A;  4RB3 C;  4EGY A;  3RKW A;  3WTZ A;  2V6C A;  1IN8 A;  3LQR A;  1LDK B;  2VN2 A;  4G6D A;  4ETS A;  3WE3 A;  1IXC A;  3JSP A;  2FU4 A;  2QVO A;  3Q5F A;  5HLH A;  1F5T A;  2HOE A;  2L01 A;  4EVI A;  3RPQ A;  1FYM A;  3LST A;  2FSW A;  3QP5 A;  4RAZ A;  2EK5 A;  1SMT A;  2XGX A;  5E8G A;  1HKS A;  1REP C;  2EV6 A;  3VOD A;  5HLG A;  1W7P D;  1KU2 A;  3RTR A;  1G3S A;  3VOE A;  1C0W A;  2HFH A;  1P4A A;  4DNC A;  2V79 A;  4A0X A;  1Z7U A;  4N0B A;  1J75 A;  4YG2 F;  3IHU A;  2LNB A;  2GAU A;  3SFZ A;  2K86 A;  5E20 A;  3K1P A;  3QPT A;  3SQN A;  2W85 A;  2K27 A;  4KIG A;  1F1Z A;  5E8I A;  3HRS A;  3ECH A;  3GEZ A;  4M71 A;  4XSZ F;  2Z99 A;  1XCV A;  2QUF A;  1ODD A;  1D3Y A;  5LBQ A;  2QLZ A;  4JBA A;  3C7J A;  2HTJ A;  1IN7 A;  2PQ8 A;  4EM1 A;  2Z9O A;  1B6A A;  5L3C A;  1U2W A;  1IZ1 A;  2E1N A;  1I1G A;  1ULY A;  4IPA A;  3FHZ A;  4EJU A;  1IXR C;  1BI2 A;  3TOB A;  5E1X A;  5D4R A;  2DI3 A;  5DCM B;  3TOA A;  4ENN A;  1U6G A;  1OYY A;  4LFU A;  1ZG3 A;  2HTS A;  4OU0 A;  2VOP A;  1LEA A;  2JPC A;  2K4B A;  2CO5 A;  3WGI A;  1U5T B;  5CJ9 A;  3EYI A;  2EFW A;  4WCG A;  4MQV A;  4A6E A;  3TO9 A;  4K2E A;  1YS6 A;  2X4H A;  4OIQ F;  4AIK A;  4CDG A;  2MA3 A;  1XSV A;  1X3U A;  3KEO A;  5DDG A;  3OV8 A;  1OYW A;  3L2C A;  1SD7 A;  3TQN A;  4L5I A;  1YQA A;  2P6S A;  2PEX A;  1SFE A;  4ZZD A;  1I27 A;  2M87 A;  1T98 A;  1OKR A;  2L4A A;  5ICF A;  3KEQ A;  4CIC A;  2CWE A;  4N9I A;  2EA2 A;  1HST A;  2E7X A;  4CZZ A;  2XUB A;  1FP1 D;  3C3W A;  3WGG A;  3DV8 A;  4KYW A;  3RKX A;  1FPQ A;  3F22 A;  1FZP B;  1XGO A;  5H20 A;  2DPU A;  4OOI A;  3N4M A;  2FEZ A;  3F6O A;  4LK0 F;  3E6M A;  2HEO A;  1ZRF A;  3E5Q A;  3KCC A;  3ZN1 A;  1J5Y A;  4BAY A;  2R7F A;  2W25 A;  3OOP A;  3SHF A;  2VBZ A;  1KU9 A;  2FNP A;  2V1X A;  1E2X A;  3IWZ A;  3HSR A;  2DFI A;  3R0J A;  2OQG A;  4ENJ A;  1STZ A;  1TLH B;  5FFZ A;  4OIP F;  2Z33 A;  4ENK A;  2VE9 A;  3EET A;  1U5T A;  1RI7 A;  1LDJ A;  5CYV A;  3BRO A;  4Z2Y A;  1S8N A;  5AIP A;  2FRH A;  4YFX F;  1ZLK A;  3H3Z A;  4YFK F;  2VC0 A;  3COA C;  4EM0 B;  4ZYD A;  3KLN A;  2D45 A;  1D5V A;  2CGP A;  1GHC A;  2RDP A;  4A2U A;  5FGM A;  4Q47 A;  2DTR A;  5H6R A;  4I02 A;  2OZU A;  5LLQ A;  2QEN A;  4Q48 A;  3E6D A;  1SD6 A;  3L00 A;  1F9N A;  2P8T A;  3K0L A;  4U0V A;  3TGN A;  5HS9 A;  1T2K A;  1ZH5 A;  2L3D A;  1R5G A;  3KP3 A;  3L7W A;  1W5S A;  2FA5 A;  2XV4 S;  2BV6 A;  3DPL C;  2PI0 A;  3WE2 A;  1P6R A;  1FP2 A;  2BGC A;  4CGZ A;  3I53 A;  3EQL F;  1W4M A;  1TW2 A;  3F8B A;  2NS0 A;  1D8J A;  5HOO A;  5CVU A;  2FBK A;  4I0B A;  1YLF A;  3D5L A;  4G6Q A;  4U7D A;  1QGP A;  4LD5 A;  1EH6 A;  5ILV A;  1NHA A;  3WU0 A;  3CUQ A;  2NRA C;  5CLS A;  2Q0O A;  3ZMZ A;  1IN4 A;  1TNT A;  3WTY C;  1V3F A;  1B4A A;  1MZB A;  2IP2 A;  3MZY A;  4PZJ A;  4Q4Z F;  2ZKZ A;  5L3E A;  3P9C A;  5DUK A;  3HSE A;  4A5M A;  1U5T C;  3F8F A;  3V8L A;  1GXQ A;  3BPV A;  1RIO H;  3WTX C;  1LNW A;  1J0R A;  1YW8 A;  3ZMV A;  2GIV A;  4HZF A;  2XKO A;  2DW4 A;  1YS7 A;  4RGU A;  4UVA A;  1BI3 A;  3QOP A;  3J7A O;  1Y0U A;  2FBI A;  3B73 A;  3IKT A;  4ESF A;  3F72 A;  4YII A;  3TO6 A;  1YW7 A;  3LAJ A;  3G73 A;  4L0Y B;  3VEP A;  1TW3 A;  1R36 A;  3QP6 A;  3I5U A;  2VE8 A;  5BPI A;  2NNN A;  5CVV A;  5D8L B;  2XAS A;  3CJN A;  2K7L A;  2HWV A;  4P5O A;  4UUV A;  1R7J A;  3KP5 A;  3IKV A;  3U1D A;  1MJB A;  1XSX A;  1K78 A;  2PN6 A;  4TV7 A;  4AIH A;  5E1W A;  2XAF A;  2G7H A;  5CVR A;  1IRF A;  4ASN A;  1R5H A;  2A61 A;  2G9W A;  1W5T A;  4ESJ A;  2QWW A;  3GXO A;  3C1D A;  4I0A A;  1YYV A;  4RB2 C;  5LRS A;  2B0L A;  5EEH A;  1F4K A;  4HW0 A;  2JZY A;  2ADU A;  3F21 A;  4L9J A;  4EGZ A;  2HR3 A;  1G3W A;  4KMU X;  4YFN F;  3F3X A;  5F64 A;  4XSX F;  1S7O A;  2EV5 A;  1FYL A;  1JHF A;  2RC4 A;  4N9H A;  1ZLJ A;  4MHG A;  1R58 A;  3ZMD A;  1R22 A;  4IHS A;  3KP4 A;  2HYF A;  3ZQ7 A;  1E17 A;  2ELH A;  2V1D A;  3E5X A;  1O3R A;  1MGT A;  1FC3 A;  2H6C A;  2UZK A;  3DKW A;  2XAH A;  4UVB A;  1J59 A;  4IVN A;  3DXJ F;  5L3B A;  3C18 A;  2Q2E A;  1O3Q A;  2QQB A;  3RYP A;  2HYG D;  3SZP A;  5BQT A;  4DQ2 A;  2RV8 A;  2V1U A;  3MCZ A;  5BPD A;  3V4G A;  5FLX Z;  2G7U A;  4KDP A;  5L3F A;  3JTG A;  2F2E A;  1ZAO A;  3P9I A;  5JI6 A;  3E6B A;  2FXA A;  4U0W A;  2HKO A;  2CG4 A;  4HAM A;  1AOY A;  3JTH A;  3R60 A;  1G6N A;  1IF1 A;  2LSO A;  4KUM A;  4FHT A;  3VFZ A;  2GZW A;  2JPB A;  4IF4 A;  4KN4 X;  5ICC A;  4KIF A;  3FXU A;  4G7H F;  3LA2 A;  1OR7 A;  3NRV A;  1WKM A;  3TDU C;  2M1B A;  5LGU A;  2FML A;  1B9M A;  2NNY A;  3GVA A;  1FY7 A;  2ZFW A;  1ZRE A;  4O5V A;  2FF4 A;  2H27 A;  5LHG A;  2ZO4 A;  3K1M A;  3M7G A;  3FXQ A;  5D5X B;  4KNY A;  4L18 B;  5L3G A;  1LVA A;  2VOD A;  3DF8 A;  4M6X A;  3VB2 A;  3BZ6 A;  1EV7 A;  1BC8 C;  2RKH A;  2ZJ2 A;  1MDM A;  2IW5 A;  1PP7 U;  2WV0 A;  4A5N A;  4LMY A;  5K1Y A;  1TQP A;  1H0M A;  5D8K B;  2IA2 A;  3E6C C;  3K1N A;  3HRM A;  1S7A A;  1FOK A;  3LA7 A;  2DQL A;  3LA3 A;  5D5V B;  1KQ9 A;  3KE2 A;  4PGG A;  3W6K B;  1WSU A;  3H92 A;  1ZRD A;  3T5X A;  4WF2 A;  2P6T A;  2JSC A;  2LDU A;  1T6S A;  1K79 A;  1Z05 A;  4ZYH A;  3FX3 A;  1ZG5 A;  3GZ6 A;  3WTS C;  3SZT A;  1J7K A;  2DK5 A;  4S05 A;  2Z5U A;  1SD4 A;  1XCB A;  2GA1 A;  2QBY A;  1Z91 A;  4OIO F;  4Y17 A;  2UXN A;  3GW2 A;  4M6Y A;  2LF8 A;  3GWZ A;  3WU1 B;  4KIC A;  2HKX A;  3HUG A;  1YO5 C;  1Z1D A;  5E1Z B;  4EMS A;  1Z6R A;  4HX7 A;  1UHM A;  1W7P A;  4ZZL A;  1KA8 A;  2L4M A;  2PLY A;  3GO5 A;  2KKO A;  4I98 B;  3M8F A;  6PAX A;  3CUO A;  1QZY A;  2XAJ A;  3QU6 A;  1WRJ A;  5FD6 A;  1BIA A;  2MH2 A;  2E7W A;  1TBX A;  4PGH A;  2IJL A;  1J9I A;  3HOT A;  3HHH A;  1CGP A;  3JSO A;  2X0L A;  2RNJ A;  2FBH A;  4R1H A;  1FBS A;  1ZYR F;  2P4W A;  1ON1 A;  3B02 A;  4L9T A;  1JGS A;  1SAX A;  2IPQ X;  3BWG A;  3GF2 A;  3CO6 C;  1EH8 A;  5AON A;  1LB2 A;  1XGM A;  3BY6 A;  4R8H A;  3LQQ A;  2YU3 A;  3F8M A;  5K5R A;  4Y13 A;  3CUQ B;  2RVC A;  1MKM A;  2DLL A;  2A3S A;  3R61 A;  3U9G A;  3FMS A;  4S04 A;  4LGW A;  1XB4 A;  5K5O A;  2BBY A;  1KU7 A;  2COM A;  1UST A;  2ISY A;  2LKP A;  1QPM A;  1DPU A;  5J6X A;  2OAZ A;  1IAW A;  2IA1 A;  1U3E M;  3BJA A;  4GYG A;  3BP8 A;  4LG0 B;  3WTW C;  1BBY A;  2EFQ A;  3T8T A;  2J5O A;  4G7Z F;  3ZMS A;  3JW4 A;  3ZMT A;  3HSF A;  2IRF G;  5LGN A;  1TNS A;  5HS7 A;  2O6G E;  2VOO A;  2KJC A;  2XRN A;  2ZBK A;  3KP6 A;  3KP2 A;  2XAQ A;  3MEX A;  5J8C A;  3FZV A;  3V8J A;  3R0A A;  2XHK A;  4KIB A;  2FOK A;  4HX4 A;  4L9V A;  4O3M A;  3FWE A;  3GLX A;  1DDN A;  2RN7 A;  2GWR A;  4G8X A;  1J2X A;  5DD4 A;  3CO7 C;  2IT0 A;  4HA8 A;  1QNT A;  2K02 A;  1H9G A;  3RKY A;  4RGX A;  4HF2 A;  2ESN A;  1SFX A;  2DAO A;  3M9A A;  3MAJ A;  4MQ9 F;  1ZN2 A;  3LAP A;  3P7N A;  4LB5 A;  5FO5 A;  5ERI A;  4HBL A;  4UVC A;  4YIF A;  4UNO A;  3ABU A;  1K78 B;  4ZYG A;  2ZXJ A;  5HDK A;  2PJP A;  2OU2 A;  4MTE A;  4B8X A;  4HQE A;  1DP7 P;  1ZGA A;  1FBU A;  5DV5 A;  2A69 F;  3DQV C;  4OMY A;  3EYY A;  4Y15 A;  1O3S A;  3BJ6 A;  4RGS A;  2H09 A;  2Q8K A;  3M1E A;  3CLO A;  4KA4 A;  3ZPL A;  4A12 A;  1QBJ A;  2QYO A;  2GQQ A;  3BOQ A;  1KGS A;  1YW9 A;  1PP8 F;  1HKQ A;  1XMK A;  2EFO A;  1IW7 F;  1XGS A;  3I54 A;  4UV9 A;  4XLN F;  4LG0 A;  2EFP A;  2P7C B;  3K9T A;  2O0Y A;  1T0F A;  2XKP A;  3F8C A;  4JK1 X;  3DP7 A;  1KQ0 A;  4LLG F;  4BXU A;  5E17 F;  1O7L A;  4IJA A;  1FBQ A;  3KLO A;  1YFH A;  5HDN A;  3JAM K;  2QQ9 A;  3HYI A;  1USS A;  1IN6 A;  4EQQ A;  3TKY A;  1UB9 A;  4JQF A;  2M45 A;  3MZH A;  3O2P E;  4LJZ F;  4P96 A;  2FQ3 A;  1IRG A;  2QQA A;  3R4K A;  4QWQ A;  1SMY F;  5LHH A;  2KIM A;  1FYK A;  4G7O F;  2VT2 A;  1UFM A;  1YTY A;  4ZYE A;  1QZZ A;  2W57 A;  2CQK A;  1O57 A;  3MWM A;  4HV6 A;  1I1S A;  1MJA A;  5FFX A;  4LB6 B;  1D8K A;  2Y75 A;  5D4S A;  4GXO A;  5DEQ A;  1WWX A;  2OA4 A;  3MQ0 A;  5FLX K;  4E70 A;  2NAZ A;  3I59 B;  3CUQ C;  4LLL A;  4EM2 A;  5LGT A;  2O8X A;  4ON0 A;  2Y0M A;  3FM5 A;  3G3Z A;  1XDS A;  5IT9 K;  3PQJ A;  3RI4 A;  3JAM Z;  1TQI A;  2F5C A;  1MDM B;  1R1V A;  1BIB A;  1GVJ A;  2OZ6 A;  4UV8 A;  1A04 A;  2MD5 A;  3RPU A;  4F7Z A;  4RGR A;  4BHP A;  3K69 A;  3WGH A;  2PBI A;  3PQK A;  2EFN A;  5HLI A;  5AIQ A;  1YIO A;  4BH9 A;  2M5W A;  2YR2 A;  5DD8 A;  2P5L C;  4G94 A;  4IXA A;  5A2Q K;  1L3L A;  2RGV A;  2CW0 F;  5ILS A;  1ZG1 A;  5J8F A;  4M72 A;  4IRH A;  1LDD A;  2XVC A;  3BPX A;  4CYD A;  4HLY A;  3DFG A;  2EWN A;  3CTA A;  5D6E A;  3ML6 A;  3GUD A;  2R7D A;  4IHT A;  1IXS B;  3J81 Z;  2DBB A;  1ONV A;  2O61 A;  2QBY B;  4HX8 A;  3K2Z A;  3O3K A;  2QM3 A;  4P55 A;  3HOS A;  3LFK A;  3ABT A;  1IUY A;  3GYH X;  4A6D A;  1S3J A;  5CVI A;  5DUI A;  3E5U A;  5D5W B;  5KVR A;  4EJT A;  4NHJ A;  3Q9S A;  3I71 A;  3HIF A;  4CO8 A;  4AD9 A;  5IT9 Z;  1W7P B;  5D6F A;  1B59 A;  1ZAR A;  3M8E A;  1R00 A;  5L3D A;  3E3V A;  3I59 A;  2AS5 F;  1I5Z A;  4M74 A;  1Q1H A;  3ROU A;  2MBF A;  4RB0 A;  2ZME A;  1TQM A;  4HLX A;  2P5V A;  4HQM A;  2GXG A;  1OPC A;  4EV0 A;  1FX7 A;  2JT1 A;  4L0Z B;  1ZHF A;  1CF7 A;  1FSE A;  3NQO A;  3MFK A;  4A0Y A;  5A2Q Z;  5ICG A;  5F6F A;  5JR3 A;  2UWM A;  2EV0 A;  1HKT A;  1RZ4 A;  4Q5S F;  4H0E A;  1KQ8 A;  1LJ9 A;  2M30 A;  3EUH A;  4OIR F;  4RB1 A;  1K7A A;  2ESH A;  1R1U A;  4PDK A;  1Z9C A;  1B9N A;  4HV5 A;  4KN7 X;  4NB5 A;  4NQW A;  3GFI A;  1BI0 A;  4RAY A;  1AWC A;  1ON2 A;  4G9Y A;  5ICE A;  3L9F A;  2VXZ A;  2M8E A;  2O03 A;  5IT3 A;  5EEG A;  1HBX G;  2WTE A;  2ZNZ A;  4GGG A;  4HF0 A;  2H6B A;  2YX7 A;  2ISZ A;  3CDH A;  1HW1 A;  4UXN A;  2YPR A;  2DPD A;  5DCF A;  2P7V B;  2D1H A;  3GFJ A;  3H3U A;  4I01 A;  2MLG A;  4IRI A;  3V8K A;  2BEO A;  2VBY A;  1V4R A;  3R6S A;  3FF5 A;  4I09 A;  3F23 A;  3ULQ B;  3REO A;  2CFX A;  3I0T A;  4ZH4 F;  2PFB A;  1HW2 A;  1P2F A;  1SD5 A;  3SXY A;  1XMA A;  2HGC A;  3IWF A;  1T39 A;  2H94 A;  4FX0 A;  4P9F A;  1XN7 A;  2HZT A;  1KYW A;  4M9X A;  3GZ5 A;  4IRG A;  4MEX F;  4AVP A;  5BMZ A;  1LQ1 A;  1FNN A;  1G3Y A;  4O6J A;  4LK1 F;  1WQ2 A;  2L02 A;  4BHB A;  4WXC A;  2OQR A;  1BJA A;  3HTU A;  3ECO A;  1O3T A;  1L0O C;  2O3F A;  3KZY A;  2E1C A;  1IN5 A;  2HS5 A;  4U88 A;  2HQR A;  4BQA A;  4KT5 C;  4L5J A;  4RS8 A;  1FT9 A;  4EJV A;  2VT3 A;  2UXX A;  2OD5 A;  3BJO A;  4M9S A;  1LEB A;  3FMQ A;  4MTD A;  2KIU A;  1BM9 A;  4HYE A;  3S2W A;  1PUE E;  2NYX A;  1B1B A;  2L54 A;  4BHC A;  1P92 A;  2V9V A;  1KYZ A;  2EA4 A;  3WTU C;  4AWX B;  3WG9 A;  4GYI A;  1WI9 A;  1BI1 A;  5LHI A;  3ELK A;  1XSD A;  4U0Y A;  2A6H F;  5DYM A;  2DO7 A;  3QAH A;  2KJB A;  3O6B B;  1JE8 A;  3J80 K;  1OYI A;  4HOB A;  2D1V A;  4FT8 A;  1RNL A;  4LLN A;  2WWY A;  4ESB A;  4ENM A;  1G4D A;  5JFR A;  5DCM A;  1HQC A;  1P4X A;  4A0Z A;  5H6Q A;  2IVM A;  2R3S A;  2QZ8 A;  2XRO A;  3V7S A;  2W24 A;  1XDU A;  2DQR A;  4HF1 A;  3F6V A;  4OMZ A;  1PDN C;  2ACJ A;  2DK8 A;  2PG4 A;  3V7R A;  4CXF A;  3IRR A;  5TRD A;  4R79 A;  3PFI A;  2P5K A;  1JXS A;  1U78 A;  3I64 A;  5K5Q A;  1R1T A;  5ED4 A;  1G3T A;  2F5F A;  3I58 A;  2BE5 F;  4MNU A;  2MH9 A;  3IL2 A;  1DUX C;  3QU3 A;  1XGN A;  3HRU A;  4WK8 F;  5E18 F;  1FWZ A;  2ETH A;  5LRR A;  3V7C A;  3WOD F;  4KMF A;  3W6J B;  3RJP A;  3Q9V A;  2XIG A;  2A5Y B;  3N97 A;  2VBW A;  3J80 Z;  3U2R A;  1GXP A;  1H9T A;  2PMU A;  2Z3Y A;  1JHH A;  5F1R A;  2DU9 A;  1UCR A;  2FMY A;  2MC3 A;  3GFM A;  2D2W A;  1QQI A;  4U7B A;  4XBF A;  2HQN A;  4BYY A;  1ZGJ A;  4PCQ A;  2KRF A;  3AAF A;  2DT5 A;  3KP7 A;  2C6Y A;  3EDP A;  2PMH A;  5BOX A;  1BC7 C;  3ZMU A;  1BN5 A;  5ILU A;  2F5D A;  3FXR A;  2Y48 A;  2XAG A;  1ZRC A;  1FSH A;  4MGR A;  1TTY A;  3DPT A;  4GCV A;  3RIR A;  5JHU A;  4XRF A;  5JVT A;  3ZP5 A;  4B09 A;  5FB2 A;  2VC1 A;  4WXH A;  4BNC A;  2OBP A;  3E97 A;  3KET A;  2WC2 A;  5HS8 A;  2YX4 A;  1T38 A;  4EJW A;  2A68 F;  3FMR A;  4M73 A;  2A6E F;  2MLK A;  3KFW X;  5TJJ A;  4QLC U;  1XD7 A;  3IC7 A;  3P9K A;  4WXD A;  2STT A;  2EJR A;  2VBX A;  1VTN C;  2ZNY A;  3GFL A;  1U8R A;  1I6X A;  1HXD A;  5D5U B;  5CVJ A;  1SFU A;  1BOA A;  4OIN F;  1S6L A;  3TDZ C;  2VON A;  1OMI A;  4WWC A;  3DEU A;  5FD5 A;  2EB7 A;  3D0S A;  3GX4 X;  2FNA A;  1MD0 A;  4GO1 A;  2CSO A;  4UHT A;  3ERE D;  2F5E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...