4FHTA

Crystal structure of the pcav transcriptional regulator from streptomyces coelicolor in complex with its natural ligand
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
141
structure length
141
Chain Sequence
MAAVDLATHPGHLARRLQQAHYLLWNTMVSEETTSPQYAVLNALVAEPGLDQRTVGERVGLDRSTIAEVVSRLGRRGLLDKVRDPQDGRRSLLRLTDEGLRVHRRLGVRIARMNQVFLAPLAADEQAVFFDLIRRVADAAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PcaV transcriptional regulator
publication title Study of PcaV from Streptomyces coelicolor yields new insights into ligand-responsive MarR family transcription factors.
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Transcription
total genus 50
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13463 HTH_27 Winged helix DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4fhtA00
4A0XA 1GXQA 5ICFA 3JAMZ 4I0AA 4I7HA 4Q5SF 2OQRA 2BBYA 3HRUA 5LRRA 2ZCWA 3KCCA 2KIUA 2Q2EA 2OU2A 3H3UA 2P6TA 3ULQB 1MGTA 1BI0A 4HA8A 3VOEA 1XSDA 2FBHA 5ICEA 1SD5A 2AXLA 4GO1A 5H20A 1IW7F 3DQVC 1SMTA 3T8TA 3K1PA 1AOYA 4IJAA 2EV6A 1GXPA 3GO5A 1EH7A 4UVAA 1R5HA 2XIGA 2P5LC 2ISZA 5HLGA 2ZMEB 3KP7A 2HQRA 2E7XA 5F6FA 4HW0A 5AIQA 5F64A 3E97A 1LDJA 2CGPA 2CFXA 5L3CA 4HYEA 4M6XA 3J81K 3B02A 3GF2A 4HZFA 2V1DA 4HQEA 4WF2A 1FSHA 1MJBA 3TQNA 5FFZA 2HR3A 3EDPA 1DPRA 1G3WA 2QUFA 2R3SA 2YSRA 4KIBA 2DI3A 4LLLA 4KUMA 4TV7A 1TLHB 2XAQA 4I2OA 3L00A 5DD8A 2H6CA 1WI9A 4UV9A 1FY7A 2W24A 3BJAA 4LFUA 1FYLA 3R60A 4N9HA 3E6BA 1HW1A 1IN7A 1TNSA 1TW3A 2A5YB 1I1SA 3LAPA 2X0LA 1HKQA 3KZYA 1T6SA 5HS9A 3HTSB 1XGNA 4NHJA 2EA2A 3GZ5A 2FMLA 3L09A 1W5SA 3K69A 2YX4A 3GFIA 6PAXA 2EFNA 5E17F 1QGPA 4LGWA 3H3ZA 3KEQA 4A6DA 1STZA 4EGYA 1K78A 4R8HA 3Q5FA 3BJOA 2EFPA 4UHTA 2L54A 2EFQA 1ZRCA 5KVRA 1BC8C 2VN2A 2DAOA 1F9NA 4M9ZA 2XROA 2GZWA 3BPVA 1KU7A 2STTA 1NHAA 3MCZA 4L0YB 4R79A 2F5FA 5CYVA 1KU3A 3SZPA 3CTAA 5D5UB 5EEGA 4EVIA 4Q4ZF 2FRHA 3HRSA 3RTRA 2H6BA 1TQPA 3WGHA 3K2ZA 4RS8A 4G7HF 2NAZA 3P9IA 3CJNA 3KP6A 1HKSA 5J8CA 3W6JB 3CO7C 2GAUA 2FEZA 1D5VA 3F23A 4ZYHA 2MA3A 4CZZA 3WTUC 1S7OA 4G94A 2H09A 1YW7A 3E3VA 2PFBA 5H6QA 2DLLA 2M1BA 3HHHA 3COAC 2QBYB 2ZFWA 1J0RA 3BJ6A 3C1DA 2HEOA 3F21A 4UXNA 2QM3A 5DCMA 3GVAA 4OINF 4CDGA 2QLZA 5FD6A 2Y75A 3N4MA 5D4RA 1ON2A 1LEAA 3WTVC 4L9VA 1A04A 4EJVA 3GX4X 4LG0B 3TOAA 3JSPA 2HGCA 2OD5A 2DK5A 3F6VA 2RKHA 3ZMDA 2XAGA 3RDIA 1B4AA 4U0VA 1YLFA 3H92A 2LSOA 3RKWA 2XVCA 1YYVA 1F4KA 5DDGA 3G73A 1Z1DA 1Y0UA 2IW5A 2OQGA 3WU1B 5BS6A 3PFIA 1FNNA 4KDPA 5L3EA 1WWXA 4CGZA 3HRTA 1T38A 2EFOA 1O57A 2YU3A 2LDUA 1HSTA 1YIOA 1O3TA 3T0YA 4IRGA 4JQFA 1Z91A 2O3FA 3D5LA 4P9UA 1OYWA 1TQMA 2MLKA 3ERED 4KNYA 4HDVA 1KA8A 2DU9A 1S6LA 1U3EM 3E5XA 3CUQC 4OIQF 1ZGAA 3KEOA 4AWXB 2QWWA 3OV8A 2EFWA 1G3YA 4P55A 2XKOA 4L9JA 4UUVA 1ZYRF 1MKMA 3TO9A 4I98B 2K4JA 4KYWA 1E2XA 2K4BA 2BE5F 4GXOA 1OPCA 4XSZF 1PUEE 2D1HA 2VONA 4YIIA 3CDHA 3KFWX 3J80Z 5JHUA 4YFKF 4G8XA 1YTYA 2LF7A 3BPXA 4FX0A 3O6BB 4RGSA 3FX3A 3NEUA 5LGTA 2EB7A 5HVQC 5ILUA 3N97A 1W7PA 4G6DA 3F6OA 3JAMK 4IVNA 3LQQA 2F5CA 3KP5A 3E6MA 3LAJA 2MC3A 4JBAA 4KMFA 2M8EA 2FOKA 2O03A 3KETA 4LB5A 2ETHA 2G9WA 5DUKA 1UHWA 1Z9CA 1REPC 2CWEA 2A07F 1S7AA 2E7WA 4G6QA 2L4MA 5HS7A 3D0SA 3ECHA 5LHIA 1ZAOA 3HYIA 5D8LB 3TDZC 1TW2A 1J75A 2Z33A 1O3SA 2UXNA 2DPDA 1MDMA 4HF0A 2VE8A 3TO6A 4BQAA 3E5QA 2XKPA 2K86A 2J5OA 4MTDA 1O3QA 4BHBA 1BBYA 5JVTA 5L3FA 5HOOA 3V4GA 1U5TA 1XCVA 1J5YA 1I5ZA 3FF5A 2OZ6A 4LK0F 5CLSA 1BIBA 3NRVA 1FSEA 4NQWA 5TRDA 1GVJA 3I54A 2Q8KA 5FB2A 1BOAA 1USTA 1K78B 5FLXK 4HLXA 2QQBA 1SD7A 3DP7A 1KU9A 3I59A 2C6YA 3GW2A 4OMZA 2A69F 3KP4A 3ML6A 3QRFF 4L5JA 1FBUA 2VBWA 4BXUA 3L9FA 1IN8A 2NRAC 3I53A 5K5OA 2QQ9A 4RGRA 5E1XA 2PQ8A 3DPTA 4I01A 5E18F 1EH6A 1FP1D 2F5DA 5JFRA 4MHGA 2IP2A 3EQLF 3LFKA 2GA2A 1YFHA 1OYIA 2DO7A 1UCRA 2EA4A 1TTYA 4OIRF 3SQNA 4R1HA 1P4WA 3DKWA 1I27A 2E1NA 3ZMVA 2P5VA 4O3MA 3P9CA 4EQQA 5LGNA 1BC7C 3NQOA 4Y15A 4HOBA 1ZG5A 1USSA 1RNLA 1P6RA 2FNAA 3GFLA 3EUHA 2HTSA 3BWGA 1XDSA 2YPRA 4BHPA 2VBZA 1JHFA 3RPQA 3C3WA 1LDDA 3Q9SA 2Z3YA 5ICGA 3M9AA 5DCMB 5E8GA 1W5TA 2XASA 3LA7A 3WE3A 5IT9Z 3I0TA 4MNUA 3B73A 3ZMTA 1MD0A 2QENA 3IKVA 1OMIA 5LBQA 3QU6A 2CQKA 1IRFA 4IRHA 1MJ9A 2QQAA 2HZTA 1H9TA 2V6CA 3IC7A 3RJPA 3TGNA 3EETA 4ESJA 4IF4A 4XRFA 2FMYA 3CO6C 4O6JA 3GLXA 4UVBA 4XLPF 5DV5A 2P5KA 3RPUA 1SFUA 1O3RA 2PJPA 1FWZA 2DPUA 4AIHA 2M87A 3WGIA 1PP8F 2RGVA 1FYMA 1XMAA 4CHUA 3U9GA 3I71A 2A68F 4Q48A 2FE3A 3OOPA 1J59A 3ABTA 2XV4S 3BP8A 4M9XA 1Z7UA 1HW5A 2CW0F 4ESFA 1R58A 2PN6A 1JHHA 3V7CA 3MZYA 4A12A 1ODDA 1YW9A 2ZKZA 3CUQB 4L9TA 5E8IA 3ZQ7A 3T8RA 3K1NA 3ISPA 5FO5A 4RAYA 4M9SA 1IAWA 3E6DA 5CVVA 1D8KA 5L3DA 4P5OA 2PLYA 2ZNZA 3IHUA 4DNCA 2EV5A 3IRRA 4ASNA 5HLHA 2KIMA 1F1ZA 3QPHA 2CSOA 1V4RA 5A2QK 3VEPA 4PDKA 3P7NA 3KP3A 4QWQA 1YW8A 4P9FA 2M5WA 3LA3A 2B0LA 3KE2A 1W7PB 2IVMA 2V9VA 1XGOA 1XDUA 1ZRFA 1JE8A 5D6EA 4UNOA 1W4MA 4F7ZA 4S05A 1QZZA 3K1MA 2FBIA 2ZO4A 4AVPA 5CJ9A 1I1GA 2VT2A 1FPQA 3FXUA 5DD4A 4PZJA 4LK1F 2L01A 2W84A 2E1CA 4Z2YA 3BY6A 1KQ0A 1T98A 5CVIA 3FMQA 2VOOA 5FD5A 3SHFA 2CO5A 4BYYA 2D1VA 1IXCA 1R5GA 2Z9OA 2K7LA 4ZYDA 2Y0MA 3C18A 3GFJA 4B09A 2VBXA 4E70A 3GXOA 1FC3A 1ZREA 4BHCA 4KA4A 2DQRA 2EWNA 3PQKA 2ZJ2A 2JPCA 3V7SA 3I5UA 2DQLA 1MDMB 2HYGD 3HIFA 2WWYA 4A2UA 3WG9A 4BH9A 1F5TA 3SFZA 3BOQA 1OKRA 3RIRA 1U5TB 1Z6RA 1X3UA 4K2EA 2BV6A 3MQ0A 2W25A 4M74A 1BIAA 4CYDA 4KN4X 4OIPF 4AIJA 1KYWA 4L0ZB 4OIOF 4I0BA 4RB0A 2BGCA 1R23A 1FBQA 3WGGA 4RB3C 4FT8A 3TO7A 4HLYA 2GWRA 1R1TA 2G7UA 3I59B 2MH2A 2NS0A 3C7JA 1Z6TA 4KICA 2QYOA 1BJAA 4NB5A 1IRGA 2HKXA 4IXAA 1ZN2A 5L3BA 4A5MA 2Y48A 3HOSA 2V1XA 1JGSA 3LSTA 4OOIA 2V79A 1ON1A 2XAFA 3M1EA 1XCBA 2HWVA 4HX4A 4LLNA 1S8NA 2K02A 5D8KB 1UB9A 1AWCA 4M71A 1WSUA 1G3TA 2PBIA 3F8FA 2LKPA 5F1RA 4UVCA 1TBXA 5E1ZB 4A5NA 2X4HA 3WTWC 3GYHX 4N0BA 2GA1A 3WTYC 1V3FA 5AONA 5KK1A 5ICCA 3JW4A 1U2WA 3QPTA 2KJBA 3F72A 1O7LA 1R00A 1CF7A 4ENJA 1QQIA 1RIOH 2M45A 2KJCA 1P2FA 5HLIA 1IZ1A 2ZNYA 4Q47A 5JI6A 2GXBA 1DP7P 5K5QA 3WTSC 4IRIA 5BQTA 2V1UA 2UZKA 4HX7A 4YG2F 3KZZA 5HDGA 1SFXA 1SAXA 4G7OF 1PDNC 1B9MA 5HDKA 4GGGA 5LGUA 3V8LA 3WTXC 1QO0D 2DK8A 2P7VB 2M30A 1LNWA 1FX7A 1MJAA 2QVOA 1XD7A 3DPLC 1R22A 3R6SA 5EEHA 1FBSA 4LD5A 4RGUA 2RQPA 1VTNC 2PI0A 5HS8A 1K79A 1FYKA 3ECOA 2A3SA 2WV0A 1U6GA 3ZMZA 5D5XB 1YG2A 2HDCA 4D0PA 1TQIA 2L02A 3JSOA 2FF4A 4GYIA 4LJZF 4ZZLA 1P92A 1YO5C 3K9TA 4XLNF 1U5TC 5J8FA 2FQ3A 3DXJF 1KYZA 1XB4A 2O8XA 2PMUA 2FA5A 5IT3A 4RAZA 3LA2A 1IN4A 1JXSA 3WODF 1KQ9A 2VT3A 4M72A 3U2RA 2ZXJA 2WC2A 2ISYA 1G6NA 4OMYA 3V7RA 4HDUA 2ADUA 3RI4A 1IN6A 5BMZA 3F8CA 3ZMSA 4LB6B 3GEZA 1B6AA 1O7FA 2HYFA 3EYIA 1ZARA 3R4KA 3I64A 4KT5C 5BPDA 1QPMA 1QZYA 3F8NA 1RUOA 3FHZA 4ENNA 3ZPLA 4XBFA 1SD4A 1WQ2A 3GFMA 1XN7A 2KIFA 5AIPA 1R7JA 4UV8A 3VFZA 2FXAA 4HV6A 2EK5A 2D2WA 2MLGA 2IA0A 2PG4A 2FU4A 1BN5A 3AAFA 1WRJA 3RKXA 3GZ6A 4EJWA 2DFIA 2R7FA 3KP2A 3Q9VA 2JPBA 3SZTA 5D4SA 3J7AO 4HF1A 4B8XA 1G4DA 1L0OC 5ILVA 2JT1A 2K27A 5J6XA 3R61A 5K1YA 3CLOA 2STWA 4KN7X 4MQVA 3FXRA 3ZMUA 1Z05A 1GHCA 4U0YA 3LQRA 3SXYA 2NYXA 2VOPA 5CVJA 2HOEA 2ZBKA 3DV8A 2VODA 2IRFG 3W6KB 2AS5F 1YS7A 3QP6A 3R0JA 4FX4A 3MZHA 1XSXA 2Q0OA 1FZPB 3ZN0A 1D3YA 1BI1A 4OU0A 1ZH5A 4MQ9F 2XRNA 4ZYEA 1R36A 4M73A 3BZ6A 1K7AA 2A6HF 3F8MA 4GCVA 1HKTA 5DYMA 2CG4A 2XAHA 3HSEA 1LB2A 2VBYA 4HX8A 4EJUA 2OA4A 5FLXZ 1RZ4A 3FZVA 5BOXA 4WXDA 1HBXG 5ERIA 1B1BA 1LDKB 1G3SA 2GQQA 4ENMA 3L7WA 4I09A 1ULYA 2O61A 2J5PA 2XHKA 3QOPA 1L3LA 3T1BA 4WK8F 3FWEA 3S2WA 3ELKA 2RC4A 4YFNF 4H0EA 2F5EA 4U0WA 4MEXF 1E17A 1OYYA 2HQNA 3CUOA 4WWCA 4A0ZA 1IXSB 3QP5A 3MEXA 2ACJA 1IXRC 2PMHA 2W85A 1XGSA 1K6OA 1KU2A 1HXDA 5LHHA 3HUGA 4XSXF 3F8BA 5DCFA 4JK1X 3M8EA 2OAZA 2EJRA 4O5VA 5LLQA 1RI7A 4EJOA 3VB2A 2ELHA 4RB1A 4AIKA 1UHMA 1FT9A 4KIFA 1YS6A 2P8TA 2PEXA 1ZG1A 4YIFA 3IRQA 3WU0A 5DEQA 2IT0A 2IA2A 4PGHA 2NNNA 3RYPA 3J80K 2Z5UA 1CF7B 1ZGJA 2HS5A 3TKYA 3L2CA 1YQAA 1S3JA 1XGMA 4DQ2A 1C0WA 3ABUA 5LHGA 3FM3A 5D5WB 2GXGA 5E1WA 4EMSA 2CYYA 1QBJA 1T2KA 1KGSA 2YR2A 3O2PE 4AD9A 4EV0A 2JTVA 3HSRA 4P96A 3E6CC 2RVCA 4YFXF 4EJTA 2VC0A 3J81Z 1B59A 4U88A 3BDDA 1J2XA 2RDPA 5LEKA 3DEUA 4IHSA 3JTGA 2HTJA 1J9IA 4MEYF 2VXZA 2ZMEA 4HF2A 1OR7A 2OZUA 4ESBA 1D8JA 1DDNA 1DUXC 4IHTA 1U78A 1Q1HA 2QZ8A 3EYYA 1IUYA 1LEBA 1SD6A 3HSFA 3QAHA 2XAJA 3ROUA 2VC1A 3F22A 4ZYGA 1ZLKA 4M6YA 4RB2C 1ZRDA 4ZZDA 1J7KA 2HFHA 2VE9A 2IPQX 3ZN1A 4Y13A 3M7GA 5FFXA 3REOA 2TDXA 4ETSA 2Z99A 4WCGA 3CUQA 3GUDA 2EV0A 4EM0B 2JSCA 4MTEA 2W57A 2F2EA 4HV5A 4S04A 3IWFA 3BROA 2MH9A 3V8KA 2JRTA 2UXXA 3RKYA 3HOTA 4ENKA 4HBLA 1LQ1A 2YX7A 5A2QZ 1S29A 5H6RA 3FMSA 2OBPA 4A0YA 1CGPA 2O6GE 2R7DA 3MWMA 4I02A 2KKOA 3WTZA 5ED4A 5D5VB 2MBFA 3I4PA 2O0YA 4WXCA 3TOBA 1I6XA 2UWMA 3IWZA 3FXQA 4GYGA 4IPAA 4L5IA 4EGZA 1B9NA 3HHGA 1PP7U 1WKMA 3PQJA 3FMRA 1W7PD 1SMYF 5HDNA 1FOKA 2P4WA 4U7BA 4WXHA 4N9IA 4WX9A 2DBBA 1IN5A 3ZP5A 2H27A 1TNTA 4PCQA 1FLIA 1HQCA 4Y17A 3F3XA 2IJLA 3M8FA 2DT5A 2LF8A 5ILSA 3P9KA 2G7HA 4ON0A 4PGGA 2DTRA 5IT9K 2H94A 4U7DA 3T5XA 2MD5A 1QNTA 5FGMA 4CICA 4L18B 1HW2A 4G9YA 1FP2A 5K5RA 3IL2A 1T0FA 1MZBA 5BPIA 1XMKA 1R1VA 4LLGF 5DUIA 4A6EA 4LMYA 2QBYA 3O3KA 3TDUC 5E20A 1RUNA 2HKOA 1XSVA 2IA1A 4FHTA 1EV7A 5CVUA 1UFMA 1H9GA 2JZYA 3VODA 3QU3A 1SFEA 3RYRA 3HTUA 2GIVA 3FM5A 3KLNA 3HRMA 1ZHFA 2RNJA 3I58A 4HAMA 1BI2A 3DF8A 4QLCU 4LG0A 2NNYA 2A6EF 3JTHA 3E5UA 1P4XA 2L3DA 5D6FA 1DPUA 4HQMA 4KFCA 5JR3A 1P4AA 2XUBA 4RGXA 3R0AA 4CO8A 4KIGA 2LNBA 3WE2A 1H0MA 3WTTC 1LJ9A 1T39A 1IF1A 1BI3A 1ZLJA 4MGRA 2D45A 5LEJA 2RV8A 2P7CB 5CVRA 5LRSA 4EM1A 4CXFA 3LWFA 1ONVA 2DW4A 5L3GA 2FBKA 1U8RA 3MFKA 2FNPA 1HSJA 2L4AA 4EM2A 3K0LA 2BYVE 3IKTA 3U1DA 3DFGA 4BNCA 4ZH4F 1KQ8A 5TJJA 4L9NA 1ZG3A 2FSWA 3GWZA 3V8JA 2A61A 2WTEA 3MAJA 4BAYA 4G7ZF 3KLOA 2ESNA 3G3ZA 2P6SA 2COMA 1EH8A 1R1UA 1BM9A 2RN7A 2KRFA 4KMUX 2XGXA 2ESHA 1LVAA 2BEOA
chains in the Genus database with same CATH superfamily
4E7SA 4A0XA 1GXQA 5ICFA 3JAMZ 3OIOA 4I0AA 4I7HA 5FRNA 4Q5SF 2OQRA 2BBYA 3HRUA 5LRRA 3BG6A 2ZCWA 3KCCA 2KIUA 2ZXWH 2Q2EA 2OU2A 1APLC 2JQ7A 2MABA 3H3UA 5F0FA 2P6TA 1RR7A 3ULQB 3KIOA 1MGTA 5EYRA 1BI0A 4HA8A 1AU7A 3GTPJ 2KZVA 4S0HB 3ABKH 3TP0A 3VOEA 3CC7I 1XSDA 2DDBA 2MFZA 2FBHA 2IXSA 2F48A 3VYSB 1SD5A 2AXLA 4GO1A 5H20A 5ICEA 2HVRA 1IW7F 2ZSHB 3EUAA 2EZKA 3OL4A 3DQVC 1SMTA 5EJCA 4AYBN 1A36A 4XOPA 1N77A 3IAM2 3T8TA 1YITI 3GTMJ 3K1PA 1X4PA 1AOYA 4IJAA 2EV6A 1GXPA 4D5CA 3K10A 1HLVA 3GO5A 1EH7A 4UVAA 1R5HA 2XIGA 4C2UA 1DGWY 2P5LC 2ISZA 5HLGA 5EG0A 3PIOF 2ZMEB 3KP7A 2HQRA 2NOGA 2E7XA 5F6FA 3QPSA 4HW0A 5C4XJ 5AIQA 5F64A 3VWBA 3E97A 3CLQA 3RPUD 1H88C 4XKVA 1LDJA 4PJJA 1X1DA 1I3AA 2CGPA 1V5GA 4ZDPA 2CFXA 5LD2C 5L3CA 4HYEA 3G71I 4M6XA 3J81K 3B02A 2X6WA 1Y1VJ 3GF2A 4HZFA 2V1DA 4HQEA 5GPAA 4WF2A 1FSHA 1ENHA 2V26A 1W0TA 1MJBA 3IH3A 3TQNA 3C2BA 3PUFA 3DBLB 2BW3A 5FFZA 4ZTFA 2HR3A 1WJ5A 3EDPA 4X0GA 3AL0B 1DPRA 1G3WA 2QUFA 2R3SA 2KRHA 2YSRA 4KIBA 2DI3A 2DYSH 4LLLA 4KUMA 3CCRI 4TV7A 4A69C 5HODA 3DCFA 1R71A 2GOXB 1TLHB 2XAQA 1WJEA 3LSGA 4MIMA 4I2OA 3DKXA 4XLCA 3L00A 2VPRA 2CUEA 1KONA 3HKZN 5DD8A 4B44A 2H6CA 3HOXJ 5KAFC 2GOMA 1WI9A 4UV9A 4XM3A 1FY7A 2W24A 3BJAA 3FXOA 4LFUA 5GP9A 3ZOBA 1FYLA 2CFOA 1LUJB 3R60A 4N9HA 2GBYA 1D5YA 3E6BA 1HW1A 4DBQA 1XMXA 1IN7A 1TNSA 1TW3A 2A5YB 1ETQA 2W1OA 1MMSA 1G2HA 3K7AJ 2X1CA 1I1SA 3LAPA 2X0LA 1HKQA 4PSXA 3KZYA 1T6SA 5HS9A 1GVDA 3Q0WA 3HTSB 1XGNA 2DOAA 4NHJA 3NAUA 2EA2A 3GZ5A 1P9QC 2FMLA 3VYRB 1WGXA 2DMQA 3L09A 1W5SA 2LTPA 3K69A 1Y6IA 2CU7A 2YX4A 3GFIA 4HG2A 6PAXA 5J3LA 2EFNA 5E17F 3BG5A 1QGPA 2R7OA 4LGWA 2CRGA 3H3ZA 1S72I 2IS6A 5B1BH 2PMZA 3KEQA 4A6DA 1STZA 4UB6C 3OYGA 4EGYA 2JJ7A 1K78A 2V9PA 4R8HA 3ZR8X 4D1QA 2ELJA 5KCMA 3Q5FA 3BJOA 2EFPA 3DPUA 4UHTA 2L54A 2PX9A 2EFQA 1VQPI 3QYEA 2DJIA 1ZRCA 4FETA 1IG7A 3K4BA 3MZ8A 5KVRA 1BC8C 2VN2A 2DAOA 3S2HJ 4XOTA 1F9NA 4XR6A 4BGDA 3OY9A 4M9ZA 4DZJA 2KDOA 2XROA 2GZWA 3BPVA 4QSHA 1KU7A 2STTA 3CJTB 3FXLA 1NHAA 3MCZA 4L0YB 1MH3A 2W4SA 2F5FA 4R79A 5CYVA 1KU3A 3SZPA 2M9HA 1GUUA 3CTAA 3FKIJ 1XC5A 5D5UB 2WB1N 5EEGA 4EVIA 4Q4ZF 1D1AA 2FRHA 5FKMA 3IH4A 3HRSA 4C3HJ 3FIWA 2IAIA 2VKVA 5IOYA 5IOZA 2R7WA 4FTHA 3RTRA 2HQ5A 3I9V2 2H6BA 3G1MA 1T56A 1TQPA 3WGHA 3K2ZA 2UV1A 3HOWJ 4RS8A 3BC8A 4G7HF 2NAZA 3P9IA 3CJNA 3KP6A 5C44J 2RAEA 1MIJA 4A3KJ 1HKSA 5J8CA 3W6JB 2EIKH 3CO7C 1MH4A 3FK6A 4HNTA 2GAUA 1MBFA 2FEZA 1HDPA 1D5VA 3VSKA 3F23A 1WZ2A 4ZYHA 2DMNA 5GAGJ 2M3AA 2MA3A 4CZZA 3TP3A 4XKCA 3WTUC 5J47A 2KL4A 3HOZJ 5EZGA 1S7OA 4G94A 2H09A 4M3GA 1YW7A 3OSFA 3E3VA 1UAAA 2CV1A 2PFBA 3BR2A 5H6QA 2DLLA 3K6GA 1JI8A 2M1BA 3HHHA 4UUSA 3COAC 4BS9A 1A31A 2QBYB 2ZFWA 4J00A 3VYUB 1J0RA 3BJ6A 3C1DA 3GBGA 2HEOA 3F21A 4UXNA 3JRHA 3ZGKA 3ZQCA 1TT0A 1IV8A 2QM3A 3F9KA 5DCMA 3GVAA 4OINF 2JMWA 4BY1J 1JT0A 4CDGA 2QLZA 1BR1A 5FD6A 2Y75A 3N4MA 2WAFA 3IP4B 1VQ9I 1X1PA 3GTGJ 5D4RA 3BTIA 1ON2A 1Y56A 1LEAA 2IGOA 3K4MA 1G8XA 3WTVC 5GAEJ 4M3EA 4IEJA 4L9VA 3VDXA 2JA2A 5EGOA 1A04A 4EJVA 3GX4X 4LG0B 3TOAA 3BG9A 2WBMA 3JSPA 2IEKA 2ME6A 2HGCA 2OD5A 2DK5A 5B3SH 1FMVA 2ZMEC 3F6VA 2XPVA 3HGGA 3CCEI 2K9MA 2RKHA 2YS9A 1OR7C 3ZMDA 2XAGA 3RDIA 4XRSG 2NS7A 3D5RC 2M7BA 1B4AA 4HSTA 2W82A 4U0VA 1YLFA 3H92A 2LSOA 3RKWA 2XVCA 1YYVA 1F4KA 5DDGA 3OIPA 3CQZJ 3H9JA 1Z1DA 1Y0UA 2IW5A 2OQGA 3G73A 1WH7A 3WU1B 5BS6A 2ZB9A 4F55A 3CMEI 3PFIA 1FNNA 4RM3A 2NVXJ 4HPQA 3PNTA 3MMYB 4KDPA 3HJEA 5L3EA 1WWXA 3E7LA 4IHYA 2JA8J 4CGZA 3AL0C 3HRTA 1T38A 5F0CA 3OSGA 2EFOA 5M5YJ 4HEA2 2B7EA 1O57A 2YU3A 2HVQA 2LDUA 4RDUA 1HSTA 1YIOA 4FASD 3IH2A 3GTJJ 1O3TA 3T0YA 4IRGA 2DFHA 5DM6F 4JQFA 2P81A 1Z91A 2O3FA 3D5LA 3KPHA 1MBEA 1X1BA 4II3A 4P9UA 4E6KG 1OYWA 4XLFA 4CCNA 1TQMA 2MLKA 2MD0A 4MLOA 3ERED 5FKKA 4KNYA 2AO9A 4BDZA 1ZQ3P 1LFPA 4HDVA 1KA8A 4BE1A 2DU9A 4UB8C 2QKMB 5HNFA 1S6LA 1U3EM 2ID6A 3FXJA 1V5EA 2M2EA 4CCOA 2BY3A 3E5XA 3CUQC 4OIQF 4FE7A 5CKTA 1ZGAA 3KEOA 4AUXA 4AWXB 1DGRM 1X19A 3BR6A 2QWWA 3OV8A 2EFWA 1SANA 1G3YA 2DOEA 2XKOA 4L9JA 4P55A 4ZTJA 4A3CJ 4UUVA 4JX6A 1MNDA 1ZYRF 2XDVA 3A02A 2R7XA 2X9DA 4C30A 1MKMA 1S7EA 3A0HC 3TO9A 3H5AA 4IHVA 4I98B 4A93J 2K4JA 4KYWA 4Y3OA 1E2XA 2K4BA 3ZQFA 1YX3A 3SZGA 2XPWA 2LRDA 2BE5F 1EA3A 1OPCA 3NWSA 4GXOA 4XSZF 2D1HA 5GPCA 3K70D 4E7KA 1PUEE 2VONA 4YIIA 3CDHA 5FJ8J 3KFWX 1IDZA 3KX2A 5E3MA 2XC7A 1Y39A 3J80Z 1I50J 2NVUB 3BR3A 2X85A 5JHUA 2DODA 4YFKF 4G8XA 1YTYA 2LF7A 4C3JJ 3OS1A 3BPXA 1JKRC 3CF2A 4FX0A 1N75A 3K70C 2BY0A 3NWTA 3O6BB 2DA1A 4RGSA 1W36D 3FX3A 3NEUA 5LGTA 2EB7A 4AC0A 5HVQC 5ILUA 3N97A 1W7PA 5M3FJ 4G6DA 3F6OA 4B43A 4IVNA 3JAMK 3LQQA 1OCZH 2F5CA 4C9YA 3CC4I 3KP5A 3E6MA 4U87A 1VZ0A 3LAJA 1FEXA 3JRFA 2MC3A 4JBAA 4KMFA 4IOCF 5BNGA 1JKOC 3S15J 1JJ6C 2H1LA 2M8EA 3ZRGA 2FOKA 1W36C 2O03A 3KETA 4XLEA 5EG0B 2QA4I 3S93A 2DN0A 4LB5A 3RZOJ 1BW6A 4FE4A 4GFBA 4LITA 2ETHA 2R7UA 3G2BA 2G9WA 5DUKA 1UHWA 1Z9CA 5F04A 5E3NA 1IO2A 3JREA 1REPC 3A2KA 4RA2A 3DWLE 3ZXSA 2LREA 2CWEA 2A07F 2LKXA 1S7AA 1OFCX 2EINH 4IX7A 2E7WA 4G6QA 1F43A 3CCSI 2XGDA 4PJ0C 2L4MA 5TISC 5HS7A 2BW3B 3KYDB 3D0SA 4A3BJ 3OYCA 1WVRA 1T0FC 2DMTA 4DGWB 3H1CA 2VXDA 3WHCA 3ECHA 4D5FA 5GAHJ 5LHIA 1ZAOA 3BG7A 3HYIA 5D8LB 3CMMA 3TDZC 1TW2A 2MYSA 1J75A 4IZZA 2QEXI 2MSYA 2Z33A 1O3SA 2UXNA 1DU0A 2DPDA 3QODA 1SC7A 1MDMA 4HF0A 2VE8A 3TO6A 4BQAA 4CCLA 1MSEC 5CQGA 4A3JJ 3QQAA 1QRYA 2ICWG 3E5QA 2XKPA 2K86A 2J5OA 1B8IA 3BR1A 4MTDA 2PJRA 1O3QA 4BHBA 3KYLA 2L2OA 4DZPA 1BBYA 1K61A 3L2WA 4BL0B 1WJCA 3SDGA 5JVTA 5L3FA 3CCUI 5HOOA 5EF6A 3V4GA 1RKTA 1U5TA 2DA4A 2YU9J 1E0EA 1XCVA 1J5YA 3FDYA 4E7ZA 1I5ZA 4D7MA 1OCPA 3FF5A 2OZ6A 1ZK8A 1GDTA 4LK0F 5CLSA 2L5QA 1BIBA 3NRVA 3G6EI 2KPMA 1W0UA 1FSEA 5IY5H 1YI2I 2K9NA 4E7HA 4NQWA 5TRDA 2A05A 1GVJA 3S14J 3L2RA 3I54A 3LSMA 4NC8A 2Q8KA 5FB2A 1BOAA 3S1MJ 4QIWN 1USTA 2VJIA 1K78B 5FLXK 4HLXA 3S1RJ 4M3BA 5B1AH 2QQBA 2FUG2 1SD7A 2DXIA 3OYJA 2M0CA 3DP7A 1HDDC 1KU9A 3I59A 2C6YA 3GW2A 4OMZA 4P1WA 1VQ4I 5KAIC 1PVEA 2A69F 3KP4A 3ML6A 3H0GJ 3QRFF 4L5JA 1FBUA 4XN0A 4IOAF 2DDAA 2VBWA 2H8RA 4BXUA 4Y33A 3L9FA 3PUBA 1IN8A 3MKWB 4KITB 2NRAC 3M4OJ 3I53A 3CZ6A 2KISA 2Q1ZB 5K5OA 3OOUA 2QQ9A 4BJ6C 4RGRA 5E1XA 2RNGA 2E2IJ 1W1WE 2CS3A 2CQXA 2PQ8A 3O8HA 3DPTA 4I01A 5E18F 1EH6A 1FP1D 2DA2A 3BT9A 2F5DA 2L9RA 2B9SA 5JFRA 4MHGA 2IP2A 3EQLF 3EPZA 2LFBA 3LFKA 1GV5A 2GA2A 1YFHA 1EKEA 1OYIA 2FD5A 2O9LA 1K4TA 2DO7A 1UCRA 1SVOA 2EH3A 2EA4A 1TTYA 4OIRF 4G6TB 3SQNA 1NK3P 4R1HA 4QTRA 1P4WA 2HOTA 3DKWA 5IYCJ 1I27A 2E1NA 2X1EA 2KHMA 1IV6A 3ZMVA 3S3NA 3DEWA 2N8GA 2P5VA 4O3MA 3P9CA 1NH3A 4EQQA 3JR9A 5LGNA 1BC7C 3OYBA 3NQOA 4Y15A 1VQ6I 3OR2C 4HOBA 4H0EA 1ZG5A 1USSA 1RNLA 1P6RA 2CQNA 2FNAA 3GFLA 4A3DJ 3EUHA 2E2JJ 2HTSA 1OQYA 3CD6I 3BWGA 1XDSA 3MD2A 2YPRA 4W1UA 4DIQA 1DU6A 2BZTA 2HZDA 4BHPA 2VBZA 4UUSB 1JHFA 3RPQA 2E2HJ 3C3WA 1LDDA 3Q9SA 2Z3YA 5ICGA 3M9AA 5DCMB 5E8GA 1W5TA 2XASA 3LA7A 3WE3A 5IT9Z 2E71A 3I0TA 4ANJA 4BQOA 4MNUA 3B73A 2UUZA 3ZMTA 2VKHA 3BG3A 3SEZA 3H0DA 1JT6A 1WJBA 3JRBA 1ETVA 2ECCA 1MD0A 2QENA 3IKVA 1OMIA 4XNFA 1D0YA 5LBQA 4E7JA 3QU6A 1I39A 2CQKA 2DJNA 1IRFA 3HL2A 3H3VK 3CCYA 4IRHA 1MJ9A 1JKPC 3GTLJ 2QQAA 2HZTA 3OYFA 2X51A 1H9TA 1ZTRA 2V6CA 3IC7A 3RJPA 3HC7A 3EETA 3TGNA 5F1JA 1D1CA 4ESJA 1WPKA 1P7IA 1HF0A 4IF4A 4XRFA 2F5VA 2FMYA 3CO6C 3AG1H 4O6JA 1B72A 1Y0NA 3ZQQA 2WY7Q 3GLXA 4UVBA 1ORKA 4XLPF 5DV5A 1H89C 2HQAA 2P5KA 2XF7A 1VQ5I 2DFFA 3RPUA 1SFUA 1YJWI 1O3RA 1TWFJ 4ZJZA 2PJPA 1FWZA 4BEHA 4Y4RA 3LSKA 2DPUA 4AIHA 3OYNA 2M87A 3WGIA 2G0EA 1PP8F 2RGVA 1ZGWA 1FYMA 1XMAA 4KJZA 1VQKI 4XLAA 4CHUA 2JA7J 3U9GA 1YRNA 1I3QJ 4F3QA 3I71A 2A68F 4Q48A 1Z3YA 2FE3A 2K5CA 3OOPA 1J59A 2GLOA 1RKWA 3ABTA 2XV4S 1WCMJ 3L1PA 1WHUA 3K4CA 3BP8A 3OS2A 4M9XA 1Z7UA 3J7AY 2Y0SA 1HW5A 2CW0F 4ESFA 1I6HJ 9ANTA 1R58A 1X3WB 1JHHA 2PN6A 2ZFUA 3V7CA 1D0XA 3MZYA 1HCRA 3BCBA 3G1OA 4A12A 2LG4A 3W6VA 1ODDA 1JUSA 1MW7A 3BCAA 4W97A 1X1AA 1YW9A 3GTKJ 3CCMI 2ZKZA 3CUQB 4B4CA 4L9TA 2LKSA 2JA6J 5E8IA 3ZQ7A 3T8RA 3FK7A 3K1NA 2AQEA 2ELKA 3ISPA 5FO5A 2GXAA 1J09A 2L7KA 4RAYA 4M9SA 1IAWA 2BXYA 3E6DA 5CVVA 1D8KA 2QSFX 2XSDC 5FRMA 5L3DA 1ETXA 2WV1A 3BTCA 4P5OA 3JRGA 2PLYA 3PO3J 1FOYA 2K9QA 5CQEA 3DTKA 2ZNZA 3IHUA 3ONQA 4DNCA 3VPRA 3K4NA 4RBOA 4HRIA 2EV5A 2V7FA 1Z21A 3IRRA 2ZSIB 1WJFA 4ASNA 1IJWC 5HLHA 2KIMA 1ETWA 1F1ZA 3DU6A 2OF7A 2Y2ZA 4ITVA 5GTIC 2M4KA 2VQLA 2JK3A 2DOFA 4AU7A 3QPHA 2CSOA 4NDLA 3MN2A 3JRIA 4ZYAA 1V4RA 5A2QK 3VEPA 5EZHA 4PDKA 2XGEA 3KP3A 3P7NA 4QWQA 4YIRX 1ACIA 4I99C 1YW8A 4P9FA 2IS1A 3P5JA 2M5WA 2X1DA 1HC8A 2Y0SN 2RQQA 5KNLA 3LA3A 4PFPA 2EIJH 2B0LA 3KE2A 2I5UA 5EDNA 1W7PB 2IVMA 2V9VA 1XGOA 3VYTB 5JHFA 2NVTJ 3CC2I 1XDUA 3UKGA 4E4HA 1ZRFA 1JE8A 1HOMA 5D6EA 4UNOA 1W4MA 4F7ZA 4S05A 2A6TA 1QZZA 2NOJB 3K1MA 2FBIA 4LIUA 2ZO4A 2LMDA 1VNDA 4AVPA 2WADA 4V2GA 4E7IA 4KT6A 5CJ9A 1Z67A 2QGUA 1I1GA 2VT2A 1FPQA 3A03A 3FXUA 3S32A 5DD4A 4PZJA 4LK1F 4IHXA 2L01A 3OYEA 2W84A 4OAYA 3CMYA 1FJLA 1TT5B 2E1CA 4Z2YA 3BY6A 4NC7A 2PMZN 2X6YA 1KQ0A 1T98A 2KRCA 5FROA 5CVIA 2QCOA 2EIMH 3FMQA 2VOOA 2VASA 2LK2A 5FD5A 2XF6A 3SHFA 1VQNI 1SVMA 2CO5A 4BYYA 2D1VA 5IP9J 1IXCA 1R5GA 1ETKA 1JKQC 3PJRA 1JUPA 2Z9OA 2LYCA 4B47A 2K7LA 4ZYDA 3HEFA 2Y0MA 2DA6A 2Y31A 3C18A 3GFJA 1SVLA 1YJNI 2XB5A 4B09A 1LE8A 2VBXA 4E70A 3GXOA 3H35A 1BJZA 4J19A 1FC3A 4ZDLA 2F4OB 1ZREA 4BHCA 4OWRB 3RQ4A 4KA4A 2DQRA 1LPQA 2EWNA 4F93B 1VQMI 3PQKA 4PK4A 2ZJ2A 2JPCA 4OAZA 4PJMA 3V7SA 3I5UA 1JJ8C 1X2MA 2DQLA 3CDLA 3K4KA 1MDMB 3H5NA 2HYGD 3HIFA 4CYCA 2WWYA 3HOUJ 4A2UA 3WG9A 4BH9A 1F5TA 2PJRB 3SFZA 3A01B 3BOQA 1OKRA 3QYFA 1XPXA 1WI3A 2Y30A 4H4KC 3RIRA 2VLAA 1D0ZA 3CCQI 2QSGX 4HSRA 1Z77A 1U5TB 1Z6RA 1X3UA 4K2EA 1SFOJ 2BV6A 3MQ0A 1Z7LA 2W25A 3Q3SA 4M74A 5JVGF 3Q0UA 1TP4A 1BIAA 4CYDA 4KN4X 4OIPF 4AIJA 4CH7A 1BOBA 4NQWB 1KYWA 4L0ZB 4OIOF 2DFEA 2WAQA 4I0BA 4RB0A 2BGCA 4RLQA 1R23A 1FBQA 3WGGA 1M1EB 2TRTA 4RB3C 2JN6A 4FT8A 3BTLA 3TO7A 2OUMA 4HLYA 2GWRA 2VI6A 1R1TA 2G7UA 3I59B 3N05A 4RLFA 4BBRJ 2MH2A 2HYJA 4IO9F 2NS0A 1MBKA 3C7JA 2RREA 4XIDA 3WHBA 3ZQIA 1Z6TA 3J7YJ 3PSFA 4KICA 4DYRA 2QYOA 2LH9A 2BY2A 4LG3A 1BJAA 2H8WA 2XF5A 2R5ZA 2DCEA 4MFDA 3OMYA 4NB5A 1IRGA 2HKXA 4IXAA 1ZN2A 3B6CA 5L3BA 4A5MA 3K4JA 2Y48A 3HOSA 3ZQGA 3I4MJ 1YE9A 2Z16A 2V1XA 5LFAA 1JGSA 2NXNB 3LSTA 4OOIA 2V79A 4D9JA 2ID3A 1RR8C 1ON1A 4XONA 5K7HA 3VSLA 2DA3A 2GM4A 2XAFA 3M1EA 2O8KA 3JCUC 2COBA 1UMQA 1XCBA 2HWVA 4HX4A 4PJNA 4LLNA 4B48A 4LIVA 4QPOA 1S8NA 2K02A 3FISA 4A3GJ 2Q2EB 5D8KB 2AQFA 1UB9A 5FLVA 1AWCA 4E7LA 4M71A 1WSUA 2L0KA 1G3TA 2PBIA 3F8FA 2LKPA 5F1RA 4UVCA 2IGKA 1N25A 3PO2J 1TWHJ 1K83J 1TBXA 5E1ZB 4A5NA 1A6QA 2X4HA 4JX5A 3PSIA 2M0MA 5E3LA 3WTWC 3GYHX 2LBFA 2L9SA 3MVPA 4N0BA 3CCJI 2EZIA 2GA1A 3WTYC 1SEUA 1O4XA 3AKZA 1V3FA 5AONA 3M8JA 4BBSJ 4NNJA 5KK1A 5ICCA 3OYLA 5J1RA 3JW4A 4XORA 1U9OA 1VI0A 1U2WA 3QPTA 4IHWA 2HPMA 1BR4A 2KJBA 2IS4A 3F72A 1O7LA 1FOWA 1R00A 4BKXA 2X6OA 1CF7A 4ENJA 1OCOH 1T95A 1QQIA 3OS0A 1RIOH 3QYBA 2ZXIA 2M45A 4XMYA 4ZDOA 1Y8RB 5GTHC 2JUGA 2KJCA 1P2FA 1R6RA 5HLIA 4X1EA 2B63J 3GZNB 1IZ1A 2XPUA 1B72B 5FKNA 2ZNYA 4Q47A 5JI6A 4IQJA 4PJLA 1MMGA 2LC2A 5J4YA 5M5XJ 2GXBA 1SAUA 1DP7P 5K5QA 3WTSC 4NUBA 4IRIA 3SEQA 5BQTA 2V1UA 2UZKA 1V55H 3HB9A 3CCLI 4HX7A 4YG2F 3KZZA 5HDGA 4BEHB 1SFXA 5DTDA 3DLLF 1SAXA 2VJ5A 1IDYA 1XTAA 4G7OF 1PDNC 1B9MA 2HDWA 5HDKA 4GGGA 2KZGA 2K40A 3V8LA 4CZCA 5LGUA 3WTXC 1QO0D 2DK8A 2P7VB 3LSJA 5J1YA 1U0JA 2M30A 1LNWA 1YRNB 1FX7A 3EUKL 2BVLA 1VQLI 1MJAA 1F36A 5C4JJ 4BACA 2CQQA 3KEYA 2OV7A 1ETYA 1S9HA 2QVOA 1XD7A 3RKQA 1YIJI 3DPLC 2I10A 1R22A 3R6SA 5EEHA 1FBSA 4LD5A 4RGUA 2RQPA 1VTNC 1KZHA 2HOAA 4BQNA 2VQGA 3HDDA 2PI0A 5HS8A 5J40A 1K79A 1FYKA 3H5RA 3BQZA 1WFXA 3ECOA 2QSHX 1YOVB 4A3LJ 2A3SA 2WV0A 1U6GA 4FISA 4CSWA 1V54H 1E3OC 3ZMZA 5D5XB 1YG2A 2HDCA 4D0PA 3ZQLA 1WJAA 1TQIA 2CH0A 2D5VA 2L02A 1OCTC 4MO7A 3JSOA 3PNVA 3GCMA 2FF4A 4GYIA 4LJZF 3OYHA 4ZZLA 1HA8A 1P92A 2DA5A 3K9TA 4NBQA 1YO5C 4XLNF 1U5TC 5J8FA 3S8PA 2FQ3A 4F52A 1NG7A 3DXJF 1KYZA 1XB4A 2O8XA 3TMOA 2PMUA 4C2MJ 2EZLA 4IL6C 2E1MB 2XAUA 1R4MB 2FA5A 5IT3A 4Y52J 2YUSA 4RAZA 2O7OA 3OYMA 3GMEA 3BTJA 3LA2A 4NC6A 1IN4A 4A3EJ 3S3MA 2VQHA 3WODF 1VQ8I 1JXSA 1KQ9A 2BOLA 2VT3A 1OCRH 5IYBJ 4M72A 3U2RA 2ME0A 2ZXJA 1ZELA 2WC2A 2ISYA 2WY8Q 4DJAA 3TW7A 1G6NA 1A5JA 4OMYA 2H1KA 4AYBA 3V7RA 1IRXA 4HDUA 2ADUA 5E79C 3ZQHA 1R4NB 4BE2A 3RI4A 5M5WJ 2V6EA 1IN6A 2K85A 5BMZA 3F8CA 4Z6YA 3ZMSA 1EJ9A 3LSHA 4LB6B 2Y69H 4KISA 3GEZA 1EF4A 1B6AA 5IP6A 1O7FA 3OR1C 2HYFA 3L2UA 3EYIA 1ZARA 3R4KA 1Z3XA 3I64A 4V19K 4KT5C 5BPDA 4XQFA 1QPMA 1QZYA 2KP6A 3F8NA 3FKJA 3PM1A 1H8AC 2OJED 3S1QJ 4XLHA 2M7AA 1RUOA 4MFEA 2L9NA 3L2QA 3FHZA 4ENNA 1VQOI 4PSWA 3ZPLA 4XBFA 3LSPA 1SD4A 3MKZA 1WQ2A 3GFMA 3E1SA 1XN7A 2KIFA 3AG2H 5AIPA 3KZIC 1R7JA 4UV8A 3VFZA 4M3FA 3CJQB 3NARA 2IGNA 3SFIA 2M34A 2FXAA 4HV6A 2EK5A 2D2WA 2MLGA 3A0BC 4CUGA 2IA0A 2PG4A 2V1NA 1MBJA 2FU4A 1BN5A 1OLTA 3AAFA 1WRJA 3RKXA 3GZ6A 3C2GA 3HKZA 3EUHC 4RM2A 4JYKA 3BZKA 2BHYA 4EJWA 2DFIA 2KQRA 3D1NI 1BW5A 2R7FA 3KP2A 3Q9VA 1LE8B 2VUMJ 2JPBA 3SZTA 2AXTC 1ETOA 2BY1A 2CW7A 5D4SA 3OYKA 5F08A 3J7AO 1XX5A 5EGOB 4AM3A 2F4MB 5K7FA 4XRSA 2CUFA 4HF1A 1DP3A 4B8XA 3G4SI 4ZC3A 2L7MP 1AHDP 1G4DA 1L0OC 5ILVA 4V2FA 1W5CC 2HXIA 2M4GA 4M6VA 4CYCB 3S3OA 2JT1A 3ABLH 2K27A 5J6XA 3R61A 2OCEA 4DYQA 3RSNA 5K1YA 4A3FJ 3GTOJ 3CLOA 3DTIA 1IC8A 2DTZA 2K3FA 1MNMC 1D1BA 4KN7X 2STWA 1FTZA 4MQVA 2KMUA 3FXRA 3ZMUA 1Z05A 2MG4A 2FX0A 1GHCA 4U0YA 3LQRA 3SXYA 2NYXA 4G12A 2VOPA 5CVJA 3LMMA 2HOEA 2ZBKA 1RETA 1Y1WJ 1UG2A 3DV8A 2VODA 4M3DA 2IRFG 3W6KB 2HI3A 2AS5F 3LL7A 1YS7A 3QP6A 3R0JA 4FX4A 3MZHA 3H36A 1XSXA 2Q0OA 1POGA 3HGYA 1FZPB 3ZN0A 1D3YA 1BI1A 2FJ1A 2W7NA 4OU0A 2X6XA 1QVUA 1ZH5A 4MQ9F 2LY2A 2XRNA 4ZYEA 1R36A 4M73A 3K4LA 3BZ6A 4YRVA 5JLXA 1OISA 2A6HF 1K7AA 3DU5A 2WB1A 2VL8A 3F8MA 4GCVA 4BDYA 3AG4H 1HKTA 2JSPA 5DYMA 2CG4A 2JRMA 3QPLA 1YHQI 2XAHA 3HSEA 1LB2A 2K3PA 2VBYA 2F6CA 4HX8A 4D7NA 4EJUA 3BR5A 2OA4A 1LFUP 2Z2SB 5FLXZ 1RZ4A 2L9VA 3FZVA 5BOXA 4WXDA 3RCOA 2KDZA 3CP2A 5ERIA 3UR3C 2R5ZB 1HBXG 1B1BA 4BUPA 1LDKB 3I55I 1ERDA 1Z0XA 1G3SA 2WA0A 1FIPA 2GQQA 2CV0A 4ENMA 1AA7A 3L7WA 3FBIB 4I09A 3GLLA 2XB0X 1ULYA 3BR0A 2J5PA 2XHKA 2O61A 3QOPA 1L3LA 3T1BA 1OCCH 4WK8F 5JLWA 3FWEA 3M07A 2P0WA 3S2WA 2CQ7A 2OC6A 1QHGA 2RC4A 3ELKA 4YFNF 3ASNH 2R7RA 2R7QA 2F5EA 4U0WA 4MEXF 1E17A 2R5YA 1OYYA 1AKHA 2HQNA 3CUOA 1IUFA 4WWCA 4A0ZA 1IRZA 2DMUA 1PUFA 1IXSB 1RPWA 1T33A 2JVHA 3MEXA 3QP5A 2E1MC 4BQQA 1GLNA 4HNVA 1TZLA 1IXRC 2BXZA 2NVYJ 2ACJA 4FQGA 2DMPA 2PMHA 2W85A 1XGSA 1K6OA 1KU2A 1X1CA 1HXDA 5LHHA 4XN3A 4DYCA 2NVQJ 3HUGA 3DEEA 1XG1A 4XSXF 2DYRH 1YJ9I 3F8BA 1ZR2A 5DCFA 4JK1X 3M8EA 3HBLA 2OAZA 2EJRA 1UELB 1LFBA 2JA5J 4O5VA 5LLQA 1RI7A 4I76A 4EJOA 2LY1A 2LBFB 3VB2A 3OYDA 2ELHA 2CUZA 2X48A 4RB1A 2LP0A 4AIKA 1UHMA 4CCMA 1FT9A 2JWTA 4KIFA 3HM5A 3PIPF 1WJDA 1YS6A 2P8TA 2PEXA 3OYIA 1QA6A 2IGMA 2QKLB 4PFOA 1ZG1A 2VIXA 4YIFA 4DOZA 3DBRB 2XGCA 3IRQA 3WU0A 1A6IA 5DEQA 1TWCJ 2IT0A 2IA2A 4PGHA 2NNNA 3RYPA 4BJTA 3J80K 2Z5UA 1CF7B 3M1CA 1BR2A 3ABMH 1ZGJA 2HVSA 2HS5A 2KIQA 2EILH 2LR8A 3TKYA 3L2CA 3AFHA 3OIQA 5C3EJ 1YQAA 1ZR4A 1S3JA 2XRLA 5EEAA 4C2TA 5M3MJ 2BHZA 4RAGA 1XGMA 4DQ2A 1C0WA 3RQIA 3M3YJ 3ABUA 5LHGA 2OPTA 4UY8I 3FM3A 5E3OA 5IP7J 2EBIA 4ABZA 5D5WB 2GXGA 2E60A 5E1WA 4HNUA 3B6AA 4EMSA 2CYYA 3FBNB 3WU2C 1QBJA 1RC9A 3JRCA 1T2KA 1E3HA 1KGSA 2GIZA 2JUCA 2YR2A 3O2PE 4AD9A 3IUOA 2JTVA 4EV0A 3HSRA 4GDFA 4P96A 3SJMA 3E6CC 1CQTA 2TCTA 3CDIA 4I6ZA 2KLOA 4IKFA 2RVCA 4YFXF 4EJTA 2AHQA 4YELA 3D5SC 2HNHA 1OJLA 2VC0A 3J81Z 4J01A 3ZCOA 1B59A 1TL8A 2LVSA 1UHSA 4U88A 3BDDA 1J2XA 2RDPA 2VQCA 5LEKA 1RRJA 3TW6A 3CJRB 5FLMJ 2R7TA 1UZCA 2W00A 3DEUA 3HG9A 1N78A 4IHSA 1R49A 2W48A 1YX5A 3JTGA 1B8IB 5KHDA 2LOOA 2HTJA 3G1LA 1J9IA 4MEYF 2VXZA 2ZMEA 5F27A 4HF2A 3S2DJ 1OR7A 2K9SA 2OZUA 1FIAA 4ESBA 1D8JA 1DDNA 1GT0C 2JVGA 3X2QH 2EPFA 3TBIA 4BXXJ 2VB6A 1DUXC 2MGQA 4FCYA 3ASOH 4IHTA 1U78A 1Q1HA 2QZ8A 2Z1DA 3OL3A 1DQUA 3EYYA 2V9KA 3I3LA 1IUYA 1VF9A 1LEBA 1Q1VA 2V4JC 2Y9ZA 1SD6A 3HSFA 3QAHA 4JOMA 2VKEA 4DW6A 2R0QC 4YEJA 2XAJA 2HOSA 3ROUA 1ZKGA 2VC1A 2E5ZA 3F22A 4BY7J 3U21A 4ZYGA 3MKLA 1ZLKA 3CESA 3CCVI 5GADJ 3O8GA 2HU9A 3BZCA 4M6YA 3DLAA 3KYCB 4EATA 2MC4A 3FXMA 2CUJA 2KFDA 4RB2C 3V42A 3ERMA 1ZRDA 4ZZDA 1J7KA 2HFHA 4N4NB 5HNHA 5B66C 5FKLA 3CP8A 3PFYA 1QPIA 2VE9A 2IPQX 2VJ4A 1Y8QB 3ZN1A 2DT7B 4RAFA 4Y13A 5TGTA 3M7GA 1JTXA 5FFXA 1MMAA 3LSIA 3REOA 2TDXA 1TWGJ 3PL8A 4ETSA 4XKWA 4CCKA 2Z99A 3FHNA 4WCGA 3CUQA 3H9GA 3GUDA 2EV0A 4EM0B 3S16J 3W2AA 2ZXHA 1JUMA 2JSCA 4MTEA 2W57A 2F2EA 4HV5A 4S04A 2CJJA 3IWFA 2VJJA 1X2NA 2MH9A 2E36A 3BROA 3V8KA 3TEDA 2JRTA 2UXXA 3RKYA 3IV5A 3LFUA 3HOTA 3HXLA 4ENKA 4X6AJ 3BLYA 1PJRA 2KT0A 3F0CA 3K2AA 4B1RA 3JRDA 4HBLA 1TWAJ 1LQ1A 1ITYA 2YX7A 3DKYA 5A2QZ 1S29A 5H6RA 4BE0A 3HZJA 3FMSA 2OBPA 4RMNA 4A0YA 1CGPA 2R7DA 3MWMA 4I02A 3OYAA 2O6GE 2KKOA 1FTTA 3SDBA 2L7FP 3U1KA 3WTZA 5ED4A 5D5VB 2MBFA 2CW8A 3MKYB 1G59A 3I4PA 2OTJI 4BU2A 2HDDA 2WAQN 2O0YA 4WXCA 3TOBA 1I6XA 2UWMA 3IWZA 3FXQA 4GYGA 4IPAA 4L5IA 4EGZA 1B9NA 2OCCH 3HHGA 2IS2A 4LOCA 1PP7U 1QZEA 4CCJA 1T08B 1WKMA 2HXOA 3PQJA 3I4NJ 3WG7H 3FMRA 2FOWA 1VQ7I 1W7PD 2ZJPF 1SMYF 1V5FA 3FXKA 5HDNA 2R7SA 4AIDA 1FOKA 1WH5A 2P4WA 3UNGC 4F91B 4UUTA 2CMPA 4U7BA 1XS9A 4WXHA 4N9IA 3QWLA 2DA7A 4WX9A 2DBBA 4B3AA 1MMDA 2BVMA 1IN5A 3ZP5A 3CMAI 2H27A 3W2VA 1TC3C 1TNTA 4PCQA 2E5NA 3SYTA 1MBHA 1UJ8A 1UG0A 2K9LA 2R4GA 1BL0A 1FLIA 4N4OB 3J7ZI 3RZDJ 4BXFA 1HQCA 2R93J 4DBRA 3JRAA 4Y17A 3Q0VA 2R92J 2HPIA 2IJLA 3F3XA 2M8GX 3M8FA 2DT5A 3HPGA 2LF8A 3LOCA 5ILSA 3P9KA 2EZHA 2G7HA 4ON0A 2LD5A 4F92B 2Y9YA 4PGGA 3A4CA 2E1OA 2DTRA 1NG6A 5HLTA 5IT9K 2H94A 4C3IJ 2R7ZJ 4II2A 4EEFG 4XL9A 4U7DA 2VPLA 3T5XA 3QOEA 4A3IJ 2MD5A 1QNTA 5FGMA 4CICA 4L18B 1T8IA 1HW2A 4G9YA 1K4SA 4JP0A 1S5LC 1FP2A 1LKXA 5K5RA 3IL2A 1T0FA 1GV2A 3DTEA 5J1UA 1MZBA 5BPIA 1XMKA 4XICA 2A5WA 1R1VA 4LLGF 5DUIA 3W2WA 4A6EA 4LMYA 2QBYA 3AG3H 3O3KA 3TDUC 5E20A 1RUNA 2HKOA 1XSVA 3GTQJ 3TL4X 4JX4A 2IA1A 4FHTA 2DT6A 1MSFC 1EV7A 5CVUA 2OTLI 1UFMA 3HPHA 4IQ4A 1H9GA 2JZYA 3VODA 3QU3A 1SFEA 2L7ZA 3RYRA 3HTUA 2GIVA 3FM5A 5F0HA 1FMWA 1IGNA 2ZC2A 3KLNA 3HRMA 1ZHFA 5CPRB 2RNJA 3I58A 4HAMA 1BI2A 3DF8A 4QLCU 3L2VA 4QPQA 1U8BA 2F4IA 1R9TJ 4LG0A 2NNYA 2A6EF 3JTHA 5FKOA 5K7ZA 3A1YA 3E5UA 1P4XA 2L3DA 1X3ZB 5D6FA 2QQ8A 2XSJC 2E19A 1DPUA 4HQMA 4KFCA 5JR3A 3A01A 1P4AA 2LLKA 2XUBA 4RGXA 5DS9A 3R0AA 2VKDA 4CO8A 5H2FC 4KIGA 5B5EC 2NS8A 1MBGA 2LNBA 3LNQA 3WE2A 1FOXA 5DM7F 3W3CA 1NTCA 1H0MA 3WTTC 1LJ9A 1T39A 1IF1A 1LVKA 1BI3A 1X4OA 2QF7A 1ZLJA 4MGRA 4B3XA 2D45A 5LEJA 2RV8A 3ESWB 3I56I 2P7CB 4AVZA 4XKBA 5CVRA 2ECBA 4EM1A 5LRSA 2R5YB 2CV2A 1AKHB 4A3MJ 2R7VA 1MNEA 4CXFA 3LWFA 5J4VA 1ONVA 2DW4A 5L3GA 2FBKA 4XK4A 4Y7NJ 1U8RA 3MFKA 1X58A 1PUFB 1K6YA 3IAS2 1A35A 2FNPA 1E3PA 3PNYA 2EQRA 1BA5A 1HSJA 2L4AA 1NK2P 4EM2A 2LY9A 3H9QA 3K0LA 4GRIA 2BYVE 3HOYJ 3IKTA 1R5ID 3E0JB 3HUGB 3U1DA 3DBHB 3DFGA 4BNCA 4ZH4F 1JGGA 2E35A 1KQ8A 5TJJA 4L9NA 2O5RA 1ZG3A 2FSWA 3GWZA 4L5EA 3V8JA 1PYVA 1QU3A 2ZJRF 2A61A 5IPAA 1P7JA 2WTEA 3LSRA 2FQ4A 3MAJA 2I8DA 4BJ5C 4BAYA 4G7ZF 3BQYA 3KLOA 3CF5F 2ESNA 3G3ZA 2P6SA 1MMNA 2COMA 3S17J 2E34A 1EH8A 5IYDJ 1R1UA 1U9NA 1BM9A 2RN7A 4XRMA 1VFCA 2IBDA 1QVTA 3HOVJ 1JTYA 2WAEA 2KRFA 3OWTA 3C2HA 2ZJQF 4KMUX 1SFKA 2XGXA 4CA0A 4PUSA 2ESHA 1QHHD 3S1NJ 1LVAA 2MW8A 1RESA 2BEOA
chains in the Genus database with same CATH topology
4A0XA 1GXQA 5ICFA 3JAMZ 4I0AA 4I7HA 4Q5SF 2OQRA 2BBYA 3HRUA 5LRRA 2ZCWA 3KCCA 2KIUA 2Q2EA 2OU2A 3H3UA 2P6TA 3ULQB 1MGTA 1BI0A 4HA8A 3VOEA 1XSDA 2FBHA 5ICEA 1SD5A 2AXLA 4GO1A 5H20A 1IW7F 3DQVC 1SMTA 3T8TA 3K1PA 1AOYA 4IJAA 2EV6A 1GXPA 3GO5A 1EH7A 4UVAA 1R5HA 2XIGA 2P5LC 2ISZA 5HLGA 2ZMEB 3KP7A 2HQRA 2E7XA 5F6FA 4HW0A 5AIQA 5F64A 3E97A 1LDJA 2CGPA 2CFXA 5L3CA 4HYEA 4M6XA 3J81K 3B02A 3GF2A 4HZFA 2V1DA 4HQEA 4WF2A 1FSHA 1MJBA 3TQNA 5FFZA 2HR3A 3EDPA 1DPRA 1G3WA 2QUFA 2R3SA 2YSRA 4KIBA 2DI3A 4LLLA 4KUMA 4TV7A 1TLHB 2XAQA 4I2OA 3L00A 5DD8A 2H6CA 1WI9A 4UV9A 1FY7A 2W24A 3BJAA 4LFUA 1FYLA 3R60A 4N9HA 3E6BA 1HW1A 1IN7A 1TNSA 1TW3A 2A5YB 1I1SA 3LAPA 2X0LA 1HKQA 3KZYA 1T6SA 5HS9A 3HTSB 1XGNA 4NHJA 2EA2A 3GZ5A 2FMLA 3L09A 1W5SA 3K69A 2YX4A 3GFIA 6PAXA 2EFNA 5E17F 1QGPA 4LGWA 3H3ZA 3KEQA 4A6DA 1STZA 4EGYA 1K78A 4R8HA 3Q5FA 3BJOA 2EFPA 4UHTA 2L54A 2EFQA 1ZRCA 5KVRA 1BC8C 2VN2A 2DAOA 1F9NA 4M9ZA 2XROA 2GZWA 3BPVA 1KU7A 2STTA 1NHAA 3MCZA 4L0YB 4R79A 2F5FA 5CYVA 1KU3A 3SZPA 3CTAA 5D5UB 5EEGA 4EVIA 4Q4ZF 2FRHA 3HRSA 3RTRA 2H6BA 1TQPA 3WGHA 3K2ZA 4RS8A 4G7HF 2NAZA 3P9IA 3CJNA 3KP6A 1HKSA 5J8CA 3W6JB 3CO7C 2GAUA 2FEZA 1D5VA 3F23A 4ZYHA 2MA3A 4CZZA 3WTUC 1S7OA 4G94A 2H09A 1YW7A 3E3VA 2PFBA 5H6QA 2DLLA 2M1BA 3HHHA 3COAC 2QBYB 2ZFWA 1J0RA 3BJ6A 3C1DA 2HEOA 3F21A 4UXNA 2QM3A 5DCMA 3GVAA 4OINF 4CDGA 2QLZA 5FD6A 2Y75A 3N4MA 5D4RA 1ON2A 1LEAA 3WTVC 4L9VA 1A04A 4EJVA 3GX4X 4LG0B 3TOAA 3JSPA 2HGCA 2OD5A 2DK5A 3F6VA 2RKHA 3ZMDA 2XAGA 3RDIA 1B4AA 4U0VA 1YLFA 3H92A 2LSOA 3RKWA 2XVCA 1YYVA 1F4KA 5DDGA 3G73A 1Z1DA 1Y0UA 2IW5A 2OQGA 3WU1B 5BS6A 3PFIA 1FNNA 4KDPA 5L3EA 1WWXA 4CGZA 3HRTA 1T38A 2EFOA 1O57A 2YU3A 2LDUA 1HSTA 1YIOA 1O3TA 3T0YA 4IRGA 4JQFA 1Z91A 2O3FA 3D5LA 4P9UA 1OYWA 1TQMA 2MLKA 3ERED 4KNYA 4HDVA 1KA8A 2DU9A 1S6LA 1U3EM 3E5XA 3CUQC 4OIQF 1ZGAA 3KEOA 4AWXB 2QWWA 3OV8A 2EFWA 1G3YA 4P55A 2XKOA 4L9JA 4UUVA 1ZYRF 1MKMA 3TO9A 4I98B 2K4JA 4KYWA 1E2XA 2K4BA 2BE5F 4GXOA 1OPCA 4XSZF 1PUEE 2D1HA 2VONA 4YIIA 3CDHA 3KFWX 3J80Z 5JHUA 4YFKF 4G8XA 1YTYA 2LF7A 3BPXA 4FX0A 3O6BB 4RGSA 3FX3A 3NEUA 5LGTA 2EB7A 5HVQC 5ILUA 3N97A 1W7PA 4G6DA 3F6OA 3JAMK 4IVNA 3LQQA 2F5CA 3KP5A 3E6MA 3LAJA 2MC3A 4JBAA 4KMFA 2M8EA 2FOKA 2O03A 3KETA 4LB5A 2ETHA 2G9WA 5DUKA 1UHWA 1Z9CA 1REPC 2CWEA 2A07F 1S7AA 2E7WA 4G6QA 2L4MA 5HS7A 3D0SA 3ECHA 5LHIA 1ZAOA 3HYIA 5D8LB 3TDZC 1TW2A 1J75A 2Z33A 1O3SA 2UXNA 2DPDA 1MDMA 4HF0A 2VE8A 3TO6A 4BQAA 3E5QA 2XKPA 2K86A 2J5OA 4MTDA 1O3QA 4BHBA 1BBYA 5JVTA 5L3FA 5HOOA 3V4GA 1U5TA 1XCVA 1J5YA 1I5ZA 3FF5A 2OZ6A 4LK0F 5CLSA 1BIBA 3NRVA 1FSEA 4NQWA 5TRDA 1GVJA 3I54A 2Q8KA 5FB2A 1BOAA 1USTA 1K78B 5FLXK 4HLXA 2QQBA 1SD7A 3DP7A 1KU9A 3I59A 2C6YA 3GW2A 4OMZA 2A69F 3KP4A 3ML6A 3QRFF 4L5JA 1FBUA 2VBWA 4BXUA 3L9FA 1IN8A 2NRAC 3I53A 5K5OA 2QQ9A 4RGRA 5E1XA 2PQ8A 3DPTA 4I01A 5E18F 1EH6A 1FP1D 2F5DA 5JFRA 4MHGA 2IP2A 3EQLF 3LFKA 2GA2A 1YFHA 1OYIA 2DO7A 1UCRA 2EA4A 1TTYA 4OIRF 3SQNA 4R1HA 1P4WA 3DKWA 1I27A 2E1NA 3ZMVA 2P5VA 4O3MA 3P9CA 4EQQA 5LGNA 1BC7C 3NQOA 4Y15A 4HOBA 1ZG5A 1USSA 1RNLA 1P6RA 2FNAA 3GFLA 3EUHA 2HTSA 3BWGA 1XDSA 2YPRA 4BHPA 2VBZA 1JHFA 3RPQA 3C3WA 1LDDA 3Q9SA 2Z3YA 5ICGA 3M9AA 5DCMB 5E8GA 1W5TA 2XASA 3LA7A 3WE3A 5IT9Z 3I0TA 4MNUA 3B73A 3ZMTA 1MD0A 2QENA 3IKVA 1OMIA 5LBQA 3QU6A 2CQKA 1IRFA 4IRHA 1MJ9A 2QQAA 2HZTA 1H9TA 2V6CA 3IC7A 3RJPA 3TGNA 3EETA 4ESJA 4IF4A 4XRFA 2FMYA 3CO6C 4O6JA 3GLXA 4UVBA 4XLPF 5DV5A 2P5KA 3RPUA 1SFUA 1O3RA 2PJPA 1FWZA 2DPUA 4AIHA 2M87A 3WGIA 1PP8F 2RGVA 1FYMA 1XMAA 4CHUA 3U9GA 3I71A 2A68F 4Q48A 2FE3A 3OOPA 1J59A 3ABTA 2XV4S 3BP8A 4M9XA 1Z7UA 1HW5A 2CW0F 4ESFA 1R58A 2PN6A 1JHHA 3V7CA 3MZYA 4A12A 1ODDA 1YW9A 2ZKZA 3CUQB 4L9TA 5E8IA 3ZQ7A 3T8RA 3K1NA 3ISPA 5FO5A 4RAYA 4M9SA 1IAWA 3E6DA 5CVVA 1D8KA 5L3DA 4P5OA 2PLYA 2ZNZA 3IHUA 4DNCA 2EV5A 3IRRA 4ASNA 5HLHA 2KIMA 1F1ZA 3QPHA 2CSOA 1V4RA 5A2QK 3VEPA 4PDKA 3P7NA 3KP3A 4QWQA 1YW8A 4P9FA 2M5WA 3LA3A 2B0LA 3KE2A 1W7PB 2IVMA 2V9VA 1XGOA 1XDUA 1ZRFA 1JE8A 5D6EA 4UNOA 1W4MA 4F7ZA 4S05A 1QZZA 3K1MA 2FBIA 2ZO4A 4AVPA 5CJ9A 1I1GA 2VT2A 1FPQA 3FXUA 5DD4A 4PZJA 4LK1F 2L01A 2W84A 2E1CA 4Z2YA 3BY6A 1KQ0A 1T98A 5CVIA 3FMQA 2VOOA 5FD5A 3SHFA 2CO5A 4BYYA 2D1VA 1IXCA 1R5GA 2Z9OA 2K7LA 4ZYDA 2Y0MA 3C18A 3GFJA 4B09A 2VBXA 4E70A 3GXOA 1FC3A 1ZREA 4BHCA 4KA4A 2DQRA 2EWNA 3PQKA 2ZJ2A 2JPCA 3V7SA 3I5UA 2DQLA 1MDMB 2HYGD 3HIFA 2WWYA 4A2UA 3WG9A 4BH9A 1F5TA 3SFZA 3BOQA 1OKRA 3RIRA 1U5TB 1Z6RA 1X3UA 4K2EA 2BV6A 3MQ0A 2W25A 4M74A 1BIAA 4CYDA 4KN4X 4OIPF 4AIJA 1KYWA 4L0ZB 4OIOF 4I0BA 4RB0A 2BGCA 1R23A 1FBQA 3WGGA 4RB3C 4FT8A 3TO7A 4HLYA 2GWRA 1R1TA 2G7UA 3I59B 2MH2A 2NS0A 3C7JA 1Z6TA 4KICA 2QYOA 1BJAA 4NB5A 1IRGA 2HKXA 4IXAA 1ZN2A 5L3BA 4A5MA 2Y48A 3HOSA 2V1XA 1JGSA 3LSTA 4OOIA 2V79A 1ON1A 2XAFA 3M1EA 1XCBA 2HWVA 4HX4A 4LLNA 1S8NA 2K02A 5D8KB 1UB9A 1AWCA 4M71A 1WSUA 1G3TA 2PBIA 3F8FA 2LKPA 5F1RA 4UVCA 1TBXA 5E1ZB 4A5NA 2X4HA 3WTWC 3GYHX 4N0BA 2GA1A 3WTYC 1V3FA 5AONA 5KK1A 5ICCA 3JW4A 1U2WA 3QPTA 2KJBA 3F72A 1O7LA 1R00A 1CF7A 4ENJA 1QQIA 1RIOH 2M45A 2KJCA 1P2FA 5HLIA 1IZ1A 2ZNYA 4Q47A 5JI6A 2GXBA 1DP7P 5K5QA 3WTSC 4IRIA 5BQTA 2V1UA 2UZKA 4HX7A 4YG2F 3KZZA 5HDGA 1SFXA 1SAXA 4G7OF 1PDNC 1B9MA 5HDKA 4GGGA 5LGUA 3V8LA 3WTXC 1QO0D 2DK8A 2P7VB 2M30A 1LNWA 1FX7A 1MJAA 2QVOA 1XD7A 3DPLC 1R22A 3R6SA 5EEHA 1FBSA 4LD5A 4RGUA 2RQPA 1VTNC 2PI0A 5HS8A 1K79A 1FYKA 3ECOA 2A3SA 2WV0A 1U6GA 3ZMZA 5D5XB 1YG2A 2HDCA 4D0PA 1TQIA 2L02A 3JSOA 2FF4A 4GYIA 4LJZF 4ZZLA 1P92A 1YO5C 3K9TA 4XLNF 1U5TC 5J8FA 2FQ3A 3DXJF 1KYZA 1XB4A 2O8XA 2PMUA 2FA5A 5IT3A 4RAZA 3LA2A 1IN4A 1JXSA 3WODF 1KQ9A 2VT3A 4M72A 3U2RA 2ZXJA 2WC2A 2ISYA 1G6NA 4OMYA 3V7RA 4HDUA 2ADUA 3RI4A 1IN6A 5BMZA 3F8CA 3ZMSA 4LB6B 3GEZA 1B6AA 1O7FA 2HYFA 3EYIA 1ZARA 3R4KA 3I64A 4KT5C 5BPDA 1QPMA 1QZYA 3F8NA 1RUOA 3FHZA 4ENNA 3ZPLA 4XBFA 1SD4A 1WQ2A 3GFMA 1XN7A 2KIFA 5AIPA 1R7JA 4UV8A 3VFZA 2FXAA 4HV6A 2EK5A 2D2WA 2MLGA 2IA0A 2PG4A 2FU4A 1BN5A 3AAFA 1WRJA 3RKXA 3GZ6A 4EJWA 2DFIA 2R7FA 3KP2A 3Q9VA 2JPBA 3SZTA 5D4SA 3J7AO 4HF1A 4B8XA 1G4DA 1L0OC 5ILVA 2JT1A 2K27A 5J6XA 3R61A 5K1YA 3CLOA 2STWA 4KN7X 4MQVA 3FXRA 3ZMUA 1Z05A 1GHCA 4U0YA 3LQRA 3SXYA 2NYXA 2VOPA 5CVJA 2HOEA 2ZBKA 3DV8A 2VODA 2IRFG 3W6KB 2AS5F 1YS7A 3QP6A 3R0JA 4FX4A 3MZHA 1XSXA 2Q0OA 1FZPB 3ZN0A 1D3YA 1BI1A 4OU0A 1ZH5A 4MQ9F 2XRNA 4ZYEA 1R36A 4M73A 3BZ6A 1K7AA 2A6HF 3F8MA 4GCVA 1HKTA 5DYMA 2CG4A 2XAHA 3HSEA 1LB2A 2VBYA 4HX8A 4EJUA 2OA4A 5FLXZ 1RZ4A 3FZVA 5BOXA 4WXDA 1HBXG 5ERIA 1B1BA 1LDKB 1G3SA 2GQQA 4ENMA 3L7WA 4I09A 1ULYA 2O61A 2J5PA 2XHKA 3QOPA 1L3LA 3T1BA 4WK8F 3FWEA 3S2WA 3ELKA 2RC4A 4YFNF 4H0EA 2F5EA 4U0WA 4MEXF 1E17A 1OYYA 2HQNA 3CUOA 4WWCA 4A0ZA 1IXSB 3QP5A 3MEXA 2ACJA 1IXRC 2PMHA 2W85A 1XGSA 1K6OA 1KU2A 1HXDA 5LHHA 3HUGA 4XSXF 3F8BA 5DCFA 4JK1X 3M8EA 2OAZA 2EJRA 4O5VA 5LLQA 1RI7A 4EJOA 3VB2A 2ELHA 4RB1A 4AIKA 1UHMA 1FT9A 4KIFA 1YS6A 2P8TA 2PEXA 1ZG1A 4YIFA 3IRQA 3WU0A 5DEQA 2IT0A 2IA2A 4PGHA 2NNNA 3RYPA 3J80K 2Z5UA 1CF7B 1ZGJA 2HS5A 3TKYA 3L2CA 1YQAA 1S3JA 1XGMA 4DQ2A 1C0WA 3ABUA 5LHGA 3FM3A 5D5WB 2GXGA 5E1WA 4EMSA 2CYYA 1QBJA 1T2KA 1KGSA 2YR2A 3O2PE 4AD9A 4EV0A 2JTVA 3HSRA 4P96A 3E6CC 2RVCA 4YFXF 4EJTA 2VC0A 3J81Z 1B59A 4U88A 3BDDA 1J2XA 2RDPA 5LEKA 3DEUA 4IHSA 3JTGA 2HTJA 1J9IA 4MEYF 2VXZA 2ZMEA 4HF2A 1OR7A 2OZUA 4ESBA 1D8JA 1DDNA 1DUXC 4IHTA 1U78A 1Q1HA 2QZ8A 3EYYA 1IUYA 1LEBA 1SD6A 3HSFA 3QAHA 2XAJA 3ROUA 2VC1A 3F22A 4ZYGA 1ZLKA 4M6YA 4RB2C 1ZRDA 4ZZDA 1J7KA 2HFHA 2VE9A 2IPQX 3ZN1A 4Y13A 3M7GA 5FFXA 3REOA 2TDXA 4ETSA 2Z99A 4WCGA 3CUQA 3GUDA 2EV0A 4EM0B 2JSCA 4MTEA 2W57A 2F2EA 4HV5A 4S04A 3IWFA 3BROA 2MH9A 3V8KA 2JRTA 2UXXA 3RKYA 3HOTA 4ENKA 4HBLA 1LQ1A 2YX7A 5A2QZ 1S29A 5H6RA 3FMSA 2OBPA 4A0YA 1CGPA 2O6GE 2R7DA 3MWMA 4I02A 2KKOA 3WTZA 5ED4A 5D5VB 2MBFA 3I4PA 2O0YA 4WXCA 3TOBA 1I6XA 2UWMA 3IWZA 3FXQA 4GYGA 4IPAA 4L5IA 4EGZA 1B9NA 3HHGA 1PP7U 1WKMA 3PQJA 3FMRA 1W7PD 1SMYF 5HDNA 1FOKA 2P4WA 4U7BA 4WXHA 4N9IA 4WX9A 2DBBA 1IN5A 3ZP5A 2H27A 1TNTA 4PCQA 1FLIA 1HQCA 4Y17A 3F3XA 2IJLA 3M8FA 2DT5A 2LF8A 5ILSA 3P9KA 2G7HA 4ON0A 4PGGA 2DTRA 5IT9K 2H94A 4U7DA 3T5XA 2MD5A 1QNTA 5FGMA 4CICA 4L18B 1HW2A 4G9YA 1FP2A 5K5RA 3IL2A 1T0FA 1MZBA 5BPIA 1XMKA 1R1VA 4LLGF 5DUIA 4A6EA 4LMYA 2QBYA 3O3KA 3TDUC 5E20A 1RUNA 2HKOA 1XSVA 2IA1A 4FHTA 1EV7A 5CVUA 1UFMA 1H9GA 2JZYA 3VODA 3QU3A 1SFEA 3RYRA 3HTUA 2GIVA 3FM5A 3KLNA 3HRMA 1ZHFA 2RNJA 3I58A 4HAMA 1BI2A 3DF8A 4QLCU 4LG0A 2NNYA 2A6EF 3JTHA 3E5UA 1P4XA 2L3DA 5D6FA 1DPUA 4HQMA 4KFCA 5JR3A 1P4AA 2XUBA 4RGXA 3R0AA 4CO8A 4KIGA 2LNBA 3WE2A 1H0MA 3WTTC 1LJ9A 1T39A 1IF1A 1BI3A 1ZLJA 4MGRA 2D45A 5LEJA 2RV8A 2P7CB 5CVRA 5LRSA 4EM1A 4CXFA 3LWFA 1ONVA 2DW4A 5L3GA 2FBKA 1U8RA 3MFKA 2FNPA 1HSJA 2L4AA 4EM2A 3K0LA 2BYVE 3IKTA 3U1DA 3DFGA 4BNCA 4ZH4F 1KQ8A 5TJJA 4L9NA 1ZG3A 2FSWA 3GWZA 3V8JA 2A61A 2WTEA 3MAJA 4BAYA 4G7ZF 3KLOA 2ESNA 3G3ZA 2P6SA 2COMA 1EH8A 1R1UA 1BM9A 2RN7A 2KRFA 4KMUX 2XGXA 2ESHA 1LVAA 2BEOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A0X A;  1GXQ A;  5ICF A;  3JAM Z;  4I0A A;  4I7H A;  4Q5S F;  2OQR A;  2BBY A;  3HRU A;  5LRR A;  2ZCW A;  3KCC A;  2KIU A;  2Q2E A;  2OU2 A;  3H3U A;  2P6T A;  3ULQ B;  1MGT A;  1BI0 A;  4HA8 A;  3VOE A;  1XSD A;  2FBH A;  5ICE A;  1SD5 A;  2AXL A;  4GO1 A;  5H20 A;  1IW7 F;  3DQV C;  1SMT A;  3T8T A;  3K1P A;  1AOY A;  4IJA A;  2EV6 A;  1GXP A;  3GO5 A;  1EH7 A;  4UVA A;  1R5H A;  2XIG A;  2P5L C;  2ISZ A;  5HLG A;  2ZME B;  3KP7 A;  2HQR A;  2E7X A;  5F6F A;  4HW0 A;  5AIQ A;  5F64 A;  3E97 A;  1LDJ A;  2CGP A;  2CFX A;  5L3C A;  4HYE A;  4M6X A;  3J81 K;  3B02 A;  3GF2 A;  4HZF A;  2V1D A;  4HQE A;  4WF2 A;  1FSH A;  1MJB A;  3TQN A;  5FFZ A;  2HR3 A;  3EDP A;  1DPR A;  1G3W A;  2QUF A;  2R3S A;  2YSR A;  4KIB A;  2DI3 A;  4LLL A;  4KUM A;  4TV7 A;  1TLH B;  2XAQ A;  4I2O A;  3L00 A;  5DD8 A;  2H6C A;  1WI9 A;  4UV9 A;  1FY7 A;  2W24 A;  3BJA A;  4LFU A;  1FYL A;  3R60 A;  4N9H A;  3E6B A;  1HW1 A;  1IN7 A;  1TNS A;  1TW3 A;  2A5Y B;  1I1S A;  3LAP A;  2X0L A;  1HKQ A;  3KZY A;  1T6S A;  5HS9 A;  3HTS B;  1XGN A;  4NHJ A;  2EA2 A;  3GZ5 A;  2FML A;  3L09 A;  1W5S A;  3K69 A;  2YX4 A;  3GFI A;  6PAX A;  2EFN A;  5E17 F;  1QGP A;  4LGW A;  3H3Z A;  3KEQ A;  4A6D A;  1STZ A;  4EGY A;  1K78 A;  4R8H A;  3Q5F A;  3BJO A;  2EFP A;  4UHT A;  2L54 A;  2EFQ A;  1ZRC A;  5KVR A;  1BC8 C;  2VN2 A;  2DAO A;  1F9N A;  4M9Z A;  2XRO A;  2GZW A;  3BPV A;  1KU7 A;  2STT A;  1NHA A;  3MCZ A;  4L0Y B;  4R79 A;  2F5F A;  5CYV A;  1KU3 A;  3SZP A;  3CTA A;  5D5U B;  5EEG A;  4EVI A;  4Q4Z F;  2FRH A;  3HRS A;  3RTR A;  2H6B A;  1TQP A;  3WGH A;  3K2Z A;  4RS8 A;  4G7H F;  2NAZ A;  3P9I A;  3CJN A;  3KP6 A;  1HKS A;  5J8C A;  3W6J B;  3CO7 C;  2GAU A;  2FEZ A;  1D5V A;  3F23 A;  4ZYH A;  2MA3 A;  4CZZ A;  3WTU C;  1S7O A;  4G94 A;  2H09 A;  1YW7 A;  3E3V A;  2PFB A;  5H6Q A;  2DLL A;  2M1B A;  3HHH A;  3COA C;  2QBY B;  2ZFW A;  1J0R A;  3BJ6 A;  3C1D A;  2HEO A;  3F21 A;  4UXN A;  2QM3 A;  5DCM A;  3GVA A;  4OIN F;  4CDG A;  2QLZ A;  5FD6 A;  2Y75 A;  3N4M A;  5D4R A;  1ON2 A;  1LEA A;  3WTV C;  4L9V A;  1A04 A;  4EJV A;  3GX4 X;  4LG0 B;  3TOA A;  3JSP A;  2HGC A;  2OD5 A;  2DK5 A;  3F6V A;  2RKH A;  3ZMD A;  2XAG A;  3RDI A;  1B4A A;  4U0V A;  1YLF A;  3H92 A;  2LSO A;  3RKW A;  2XVC A;  1YYV A;  1F4K A;  5DDG A;  3G73 A;  1Z1D A;  1Y0U A;  2IW5 A;  2OQG A;  3WU1 B;  5BS6 A;  3PFI A;  1FNN A;  4KDP A;  5L3E A;  1WWX A;  4CGZ A;  3HRT A;  1T38 A;  2EFO A;  1O57 A;  2YU3 A;  2LDU A;  1HST A;  1YIO A;  1O3T A;  3T0Y A;  4IRG A;  4JQF A;  1Z91 A;  2O3F A;  3D5L A;  4P9U A;  1OYW A;  1TQM A;  2MLK A;  3ERE D;  4KNY A;  4HDV A;  1KA8 A;  2DU9 A;  1S6L A;  1U3E M;  3E5X A;  3CUQ C;  4OIQ F;  1ZGA A;  3KEO A;  4AWX B;  2QWW A;  3OV8 A;  2EFW A;  1G3Y A;  4P55 A;  2XKO A;  4L9J A;  4UUV A;  1ZYR F;  1MKM A;  3TO9 A;  4I98 B;  2K4J A;  4KYW A;  1E2X A;  2K4B A;  2BE5 F;  4GXO A;  1OPC A;  4XSZ F;  1PUE E;  2D1H A;  2VON A;  4YII A;  3CDH A;  3KFW X;  3J80 Z;  5JHU A;  4YFK F;  4G8X A;  1YTY A;  2LF7 A;  3BPX A;  4FX0 A;  3O6B B;  4RGS A;  3FX3 A;  3NEU A;  5LGT A;  2EB7 A;  5HVQ C;  5ILU A;  3N97 A;  1W7P A;  4G6D A;  3F6O A;  3JAM K;  4IVN A;  3LQQ A;  2F5C A;  3KP5 A;  3E6M A;  3LAJ A;  2MC3 A;  4JBA A;  4KMF A;  2M8E A;  2FOK A;  2O03 A;  3KET A;  4LB5 A;  2ETH A;  2G9W A;  5DUK A;  1UHW A;  1Z9C A;  1REP C;  2CWE A;  2A07 F;  1S7A A;  2E7W A;  4G6Q A;  2L4M A;  5HS7 A;  3D0S A;  3ECH A;  5LHI A;  1ZAO A;  3HYI A;  5D8L B;  3TDZ C;  1TW2 A;  1J75 A;  2Z33 A;  1O3S A;  2UXN A;  2DPD A;  1MDM A;  4HF0 A;  2VE8 A;  3TO6 A;  4BQA A;  3E5Q A;  2XKP A;  2K86 A;  2J5O A;  4MTD A;  1O3Q A;  4BHB A;  1BBY A;  5JVT A;  5L3F A;  5HOO A;  3V4G A;  1U5T A;  1XCV A;  1J5Y A;  1I5Z A;  3FF5 A;  2OZ6 A;  4LK0 F;  5CLS A;  1BIB A;  3NRV A;  1FSE A;  4NQW A;  5TRD A;  1GVJ A;  3I54 A;  2Q8K A;  5FB2 A;  1BOA A;  1UST A;  1K78 B;  5FLX K;  4HLX A;  2QQB A;  1SD7 A;  3DP7 A;  1KU9 A;  3I59 A;  2C6Y A;  3GW2 A;  4OMZ A;  2A69 F;  3KP4 A;  3ML6 A;  3QRF F;  4L5J A;  1FBU A;  2VBW A;  4BXU A;  3L9F A;  1IN8 A;  2NRA C;  3I53 A;  5K5O A;  2QQ9 A;  4RGR A;  5E1X A;  2PQ8 A;  3DPT A;  4I01 A;  5E18 F;  1EH6 A;  1FP1 D;  2F5D A;  5JFR A;  4MHG A;  2IP2 A;  3EQL F;  3LFK A;  2GA2 A;  1YFH A;  1OYI A;  2DO7 A;  1UCR A;  2EA4 A;  1TTY A;  4OIR F;  3SQN A;  4R1H A;  1P4W A;  3DKW A;  1I27 A;  2E1N A;  3ZMV A;  2P5V A;  4O3M A;  3P9C A;  4EQQ A;  5LGN A;  1BC7 C;  3NQO A;  4Y15 A;  4HOB A;  1ZG5 A;  1USS A;  1RNL A;  1P6R A;  2FNA A;  3GFL A;  3EUH A;  2HTS A;  3BWG A;  1XDS A;  2YPR A;  4BHP A;  2VBZ A;  1JHF A;  3RPQ A;  3C3W A;  1LDD A;  3Q9S A;  2Z3Y A;  5ICG A;  3M9A A;  5DCM B;  5E8G A;  1W5T A;  2XAS A;  3LA7 A;  3WE3 A;  5IT9 Z;  3I0T A;  4MNU A;  3B73 A;  3ZMT A;  1MD0 A;  2QEN A;  3IKV A;  1OMI A;  5LBQ A;  3QU6 A;  2CQK A;  1IRF A;  4IRH A;  1MJ9 A;  2QQA A;  2HZT A;  1H9T A;  2V6C A;  3IC7 A;  3RJP A;  3TGN A;  3EET A;  4ESJ A;  4IF4 A;  4XRF A;  2FMY A;  3CO6 C;  4O6J A;  3GLX A;  4UVB A;  4XLP F;  5DV5 A;  2P5K A;  3RPU A;  1SFU A;  1O3R A;  2PJP A;  1FWZ A;  2DPU A;  4AIH A;  2M87 A;  3WGI A;  1PP8 F;  2RGV A;  1FYM A;  1XMA A;  4CHU A;  3U9G A;  3I71 A;  2A68 F;  4Q48 A;  2FE3 A;  3OOP A;  1J59 A;  3ABT A;  2XV4 S;  3BP8 A;  4M9X A;  1Z7U A;  1HW5 A;  2CW0 F;  4ESF A;  1R58 A;  2PN6 A;  1JHH A;  3V7C A;  3MZY A;  4A12 A;  1ODD A;  1YW9 A;  2ZKZ A;  3CUQ B;  4L9T A;  5E8I A;  3ZQ7 A;  3T8R A;  3K1N A;  3ISP A;  5FO5 A;  4RAY A;  4M9S A;  1IAW A;  3E6D A;  5CVV A;  1D8K A;  5L3D A;  4P5O A;  2PLY A;  2ZNZ A;  3IHU A;  4DNC A;  2EV5 A;  3IRR A;  4ASN A;  5HLH A;  2KIM A;  1F1Z A;  3QPH A;  2CSO A;  1V4R A;  5A2Q K;  3VEP A;  4PDK A;  3P7N A;  3KP3 A;  4QWQ A;  1YW8 A;  4P9F A;  2M5W A;  3LA3 A;  2B0L A;  3KE2 A;  1W7P B;  2IVM A;  2V9V A;  1XGO A;  1XDU A;  1ZRF A;  1JE8 A;  5D6E A;  4UNO A;  1W4M A;  4F7Z A;  4S05 A;  1QZZ A;  3K1M A;  2FBI A;  2ZO4 A;  4AVP A;  5CJ9 A;  1I1G A;  2VT2 A;  1FPQ A;  3FXU A;  5DD4 A;  4PZJ A;  4LK1 F;  2L01 A;  2W84 A;  2E1C A;  4Z2Y A;  3BY6 A;  1KQ0 A;  1T98 A;  5CVI A;  3FMQ A;  2VOO A;  5FD5 A;  3SHF A;  2CO5 A;  4BYY A;  2D1V A;  1IXC A;  1R5G A;  2Z9O A;  2K7L A;  4ZYD A;  2Y0M A;  3C18 A;  3GFJ A;  4B09 A;  2VBX A;  4E70 A;  3GXO A;  1FC3 A;  1ZRE A;  4BHC A;  4KA4 A;  2DQR A;  2EWN A;  3PQK A;  2ZJ2 A;  2JPC A;  3V7S A;  3I5U A;  2DQL A;  1MDM B;  2HYG D;  3HIF A;  2WWY A;  4A2U A;  3WG9 A;  4BH9 A;  1F5T A;  3SFZ A;  3BOQ A;  1OKR A;  3RIR A;  1U5T B;  1Z6R A;  1X3U A;  4K2E A;  2BV6 A;  3MQ0 A;  2W25 A;  4M74 A;  1BIA A;  4CYD A;  4KN4 X;  4OIP F;  4AIJ A;  1KYW A;  4L0Z B;  4OIO F;  4I0B A;  4RB0 A;  2BGC A;  1R23 A;  1FBQ A;  3WGG A;  4RB3 C;  4FT8 A;  3TO7 A;  4HLY A;  2GWR A;  1R1T A;  2G7U A;  3I59 B;  2MH2 A;  2NS0 A;  3C7J A;  1Z6T A;  4KIC A;  2QYO A;  1BJA A;  4NB5 A;  1IRG A;  2HKX A;  4IXA A;  1ZN2 A;  5L3B A;  4A5M A;  2Y48 A;  3HOS A;  2V1X A;  1JGS A;  3LST A;  4OOI A;  2V79 A;  1ON1 A;  2XAF A;  3M1E A;  1XCB A;  2HWV A;  4HX4 A;  4LLN A;  1S8N A;  2K02 A;  5D8K B;  1UB9 A;  1AWC A;  4M71 A;  1WSU A;  1G3T A;  2PBI A;  3F8F A;  2LKP A;  5F1R A;  4UVC A;  1TBX A;  5E1Z B;  4A5N A;  2X4H A;  3WTW C;  3GYH X;  4N0B A;  2GA1 A;  3WTY C;  1V3F A;  5AON A;  5KK1 A;  5ICC A;  3JW4 A;  1U2W A;  3QPT A;  2KJB A;  3F72 A;  1O7L A;  1R00 A;  1CF7 A;  4ENJ A;  1QQI A;  1RIO H;  2M45 A;  2KJC A;  1P2F A;  5HLI A;  1IZ1 A;  2ZNY A;  4Q47 A;  5JI6 A;  2GXB A;  1DP7 P;  5K5Q A;  3WTS C;  4IRI A;  5BQT A;  2V1U A;  2UZK A;  4HX7 A;  4YG2 F;  3KZZ A;  5HDG A;  1SFX A;  1SAX A;  4G7O F;  1PDN C;  1B9M A;  5HDK A;  4GGG A;  5LGU A;  3V8L A;  3WTX C;  1QO0 D;  2DK8 A;  2P7V B;  2M30 A;  1LNW A;  1FX7 A;  1MJA A;  2QVO A;  1XD7 A;  3DPL C;  1R22 A;  3R6S A;  5EEH A;  1FBS A;  4LD5 A;  4RGU A;  2RQP A;  1VTN C;  2PI0 A;  5HS8 A;  1K79 A;  1FYK A;  3ECO A;  2A3S A;  2WV0 A;  1U6G A;  3ZMZ A;  5D5X B;  1YG2 A;  2HDC A;  4D0P A;  1TQI A;  2L02 A;  3JSO A;  2FF4 A;  4GYI A;  4LJZ F;  4ZZL A;  1P92 A;  1YO5 C;  3K9T A;  4XLN F;  1U5T C;  5J8F A;  2FQ3 A;  3DXJ F;  1KYZ A;  1XB4 A;  2O8X A;  2PMU A;  2FA5 A;  5IT3 A;  4RAZ A;  3LA2 A;  1IN4 A;  1JXS A;  3WOD F;  1KQ9 A;  2VT3 A;  4M72 A;  3U2R A;  2ZXJ A;  2WC2 A;  2ISY A;  1G6N A;  4OMY A;  3V7R A;  4HDU A;  2ADU A;  3RI4 A;  1IN6 A;  5BMZ A;  3F8C A;  3ZMS A;  4LB6 B;  3GEZ A;  1B6A A;  1O7F A;  2HYF A;  3EYI A;  1ZAR A;  3R4K A;  3I64 A;  4KT5 C;  5BPD A;  1QPM A;  1QZY A;  3F8N A;  1RUO A;  3FHZ A;  4ENN A;  3ZPL A;  4XBF A;  1SD4 A;  1WQ2 A;  3GFM A;  1XN7 A;  2KIF A;  5AIP A;  1R7J A;  4UV8 A;  3VFZ A;  2FXA A;  4HV6 A;  2EK5 A;  2D2W A;  2MLG A;  2IA0 A;  2PG4 A;  2FU4 A;  1BN5 A;  3AAF A;  1WRJ A;  3RKX A;  3GZ6 A;  4EJW A;  2DFI A;  2R7F A;  3KP2 A;  3Q9V A;  2JPB A;  3SZT A;  5D4S A;  3J7A O;  4HF1 A;  4B8X A;  1G4D A;  1L0O C;  5ILV A;  2JT1 A;  2K27 A;  5J6X A;  3R61 A;  5K1Y A;  3CLO A;  2STW A;  4KN7 X;  4MQV A;  3FXR A;  3ZMU A;  1Z05 A;  1GHC A;  4U0Y A;  3LQR A;  3SXY A;  2NYX A;  2VOP A;  5CVJ A;  2HOE A;  2ZBK A;  3DV8 A;  2VOD A;  2IRF G;  3W6K B;  2AS5 F;  1YS7 A;  3QP6 A;  3R0J A;  4FX4 A;  3MZH A;  1XSX A;  2Q0O A;  1FZP B;  3ZN0 A;  1D3Y A;  1BI1 A;  4OU0 A;  1ZH5 A;  4MQ9 F;  2XRN A;  4ZYE A;  1R36 A;  4M73 A;  3BZ6 A;  1K7A A;  2A6H F;  3F8M A;  4GCV A;  1HKT A;  5DYM A;  2CG4 A;  2XAH A;  3HSE A;  1LB2 A;  2VBY A;  4HX8 A;  4EJU A;  2OA4 A;  5FLX Z;  1RZ4 A;  3FZV A;  5BOX A;  4WXD A;  1HBX G;  5ERI A;  1B1B A;  1LDK B;  1G3S A;  2GQQ A;  4ENM A;  3L7W A;  4I09 A;  1ULY A;  2O61 A;  2J5P A;  2XHK A;  3QOP A;  1L3L A;  3T1B A;  4WK8 F;  3FWE A;  3S2W A;  3ELK A;  2RC4 A;  4YFN F;  4H0E A;  2F5E A;  4U0W A;  4MEX F;  1E17 A;  1OYY A;  2HQN A;  3CUO A;  4WWC A;  4A0Z A;  1IXS B;  3QP5 A;  3MEX A;  2ACJ A;  1IXR C;  2PMH A;  2W85 A;  1XGS A;  1K6O A;  1KU2 A;  1HXD A;  5LHH A;  3HUG A;  4XSX F;  3F8B A;  5DCF A;  4JK1 X;  3M8E A;  2OAZ A;  2EJR A;  4O5V A;  5LLQ A;  1RI7 A;  4EJO A;  3VB2 A;  2ELH A;  4RB1 A;  4AIK A;  1UHM A;  1FT9 A;  4KIF A;  1YS6 A;  2P8T A;  2PEX A;  1ZG1 A;  4YIF A;  3IRQ A;  3WU0 A;  5DEQ A;  2IT0 A;  2IA2 A;  4PGH A;  2NNN A;  3RYP A;  3J80 K;  2Z5U A;  1CF7 B;  1ZGJ A;  2HS5 A;  3TKY A;  3L2C A;  1YQA A;  1S3J A;  1XGM A;  4DQ2 A;  1C0W A;  3ABU A;  5LHG A;  3FM3 A;  5D5W B;  2GXG A;  5E1W A;  4EMS A;  2CYY A;  1QBJ A;  1T2K A;  1KGS A;  2YR2 A;  3O2P E;  4AD9 A;  4EV0 A;  2JTV A;  3HSR A;  4P96 A;  3E6C C;  2RVC A;  4YFX F;  4EJT A;  2VC0 A;  3J81 Z;  1B59 A;  4U88 A;  3BDD A;  1J2X A;  2RDP A;  5LEK A;  3DEU A;  4IHS A;  3JTG A;  2HTJ A;  1J9I A;  4MEY F;  2VXZ A;  2ZME A;  4HF2 A;  1OR7 A;  2OZU A;  4ESB A;  1D8J A;  1DDN A;  1DUX C;  4IHT A;  1U78 A;  1Q1H A;  2QZ8 A;  3EYY A;  1IUY A;  1LEB A;  1SD6 A;  3HSF A;  3QAH A;  2XAJ A;  3ROU A;  2VC1 A;  3F22 A;  4ZYG A;  1ZLK A;  4M6Y A;  4RB2 C;  1ZRD A;  4ZZD A;  1J7K A;  2HFH A;  2VE9 A;  2IPQ X;  3ZN1 A;  4Y13 A;  3M7G A;  5FFX A;  3REO A;  2TDX A;  4ETS A;  2Z99 A;  4WCG A;  3CUQ A;  3GUD A;  2EV0 A;  4EM0 B;  2JSC A;  4MTE A;  2W57 A;  2F2E A;  4HV5 A;  4S04 A;  3IWF A;  3BRO A;  2MH9 A;  3V8K A;  2JRT A;  2UXX A;  3RKY A;  3HOT A;  4ENK A;  4HBL A;  1LQ1 A;  2YX7 A;  5A2Q Z;  1S29 A;  5H6R A;  3FMS A;  2OBP A;  4A0Y A;  1CGP A;  2O6G E;  2R7D A;  3MWM A;  4I02 A;  2KKO A;  3WTZ A;  5ED4 A;  5D5V B;  2MBF A;  3I4P A;  2O0Y A;  4WXC A;  3TOB A;  1I6X A;  2UWM A;  3IWZ A;  3FXQ A;  4GYG A;  4IPA A;  4L5I A;  4EGZ A;  1B9N A;  3HHG A;  1PP7 U;  1WKM A;  3PQJ A;  3FMR A;  1W7P D;  1SMY F;  5HDN A;  1FOK A;  2P4W A;  4U7B A;  4WXH A;  4N9I A;  4WX9 A;  2DBB A;  1IN5 A;  3ZP5 A;  2H27 A;  1TNT A;  4PCQ A;  1FLI A;  1HQC A;  4Y17 A;  3F3X A;  2IJL A;  3M8F A;  2DT5 A;  2LF8 A;  5ILS A;  3P9K A;  2G7H A;  4ON0 A;  4PGG A;  2DTR A;  5IT9 K;  2H94 A;  4U7D A;  3T5X A;  2MD5 A;  1QNT A;  5FGM A;  4CIC A;  4L18 B;  1HW2 A;  4G9Y A;  1FP2 A;  5K5R A;  3IL2 A;  1T0F A;  1MZB A;  5BPI A;  1XMK A;  1R1V A;  4LLG F;  5DUI A;  4A6E A;  4LMY A;  2QBY A;  3O3K A;  3TDU C;  5E20 A;  1RUN A;  2HKO A;  1XSV A;  2IA1 A;  4FHT A;  1EV7 A;  5CVU A;  1UFM A;  1H9G A;  2JZY A;  3VOD A;  3QU3 A;  1SFE A;  3RYR A;  3HTU A;  2GIV A;  3FM5 A;  3KLN A;  3HRM A;  1ZHF A;  2RNJ A;  3I58 A;  4HAM A;  1BI2 A;  3DF8 A;  4QLC U;  4LG0 A;  2NNY A;  2A6E F;  3JTH A;  3E5U A;  1P4X A;  2L3D A;  5D6F A;  1DPU A;  4HQM A;  4KFC A;  5JR3 A;  1P4A A;  2XUB A;  4RGX A;  3R0A A;  4CO8 A;  4KIG A;  2LNB A;  3WE2 A;  1H0M A;  3WTT C;  1LJ9 A;  1T39 A;  1IF1 A;  1BI3 A;  1ZLJ A;  4MGR A;  2D45 A;  5LEJ A;  2RV8 A;  2P7C B;  5CVR A;  5LRS A;  4EM1 A;  4CXF A;  3LWF A;  1ONV A;  2DW4 A;  5L3G A;  2FBK A;  1U8R A;  3MFK A;  2FNP A;  1HSJ A;  2L4A A;  4EM2 A;  3K0L A;  2BYV E;  3IKT A;  3U1D A;  3DFG A;  4BNC A;  4ZH4 F;  1KQ8 A;  5TJJ A;  4L9N A;  1ZG3 A;  2FSW A;  3GWZ A;  3V8J A;  2A61 A;  2WTE A;  3MAJ A;  4BAY A;  4G7Z F;  3KLO A;  2ESN A;  3G3Z A;  2P6S A;  2COM A;  1EH8 A;  1R1U A;  1BM9 A;  2RN7 A;  2KRF A;  4KMU X;  2XGX A;  2ESH A;  1LVA A;  2BEO A; 
#chains in the Genus database with same CATH topology
 4E7S A;  4A0X A;  1GXQ A;  5ICF A;  3JAM Z;  3OIO A;  4I0A A;  4I7H A;  5FRN A;  4Q5S F;  2OQR A;  2BBY A;  3HRU A;  5LRR A;  3BG6 A;  2ZCW A;  3KCC A;  2KIU A;  2ZXW H;  2Q2E A;  2OU2 A;  1APL C;  2JQ7 A;  2MAB A;  3H3U A;  5F0F A;  2P6T A;  1RR7 A;  3ULQ B;  3KIO A;  1MGT A;  5EYR A;  1BI0 A;  4HA8 A;  1AU7 A;  3GTP J;  2KZV A;  4S0H B;  3ABK H;  3TP0 A;  3VOE A;  3CC7 I;  1XSD A;  2DDB A;  2MFZ A;  2FBH A;  2IXS A;  2F48 A;  3VYS B;  1SD5 A;  2AXL A;  4GO1 A;  5H20 A;  5ICE A;  2HVR A;  1IW7 F;  2ZSH B;  3EUA A;  2EZK A;  3OL4 A;  3DQV C;  1SMT A;  5EJC A;  4AYB N;  1A36 A;  4XOP A;  1N77 A;  3IAM 2;  3T8T A;  1YIT I;  3GTM J;  3K1P A;  1X4P A;  1AOY A;  4IJA A;  2EV6 A;  1GXP A;  4D5C A;  3K10 A;  1HLV A;  3GO5 A;  1EH7 A;  4UVA A;  1R5H A;  2XIG A;  4C2U A;  1DGW Y;  2P5L C;  2ISZ A;  5HLG A;  5EG0 A;  3PIO F;  2ZME B;  3KP7 A;  2HQR A;  2NOG A;  2E7X A;  5F6F A;  3QPS A;  4HW0 A;  5C4X J;  5AIQ A;  5F64 A;  3VWB A;  3E97 A;  3CLQ A;  3RPU D;  1H88 C;  4XKV A;  1LDJ A;  4PJJ A;  1X1D A;  1I3A A;  2CGP A;  1V5G A;  4ZDP A;  2CFX A;  5LD2 C;  5L3C A;  4HYE A;  3G71 I;  4M6X A;  3J81 K;  3B02 A;  2X6W A;  1Y1V J;  3GF2 A;  4HZF A;  2V1D A;  4HQE A;  5GPA A;  4WF2 A;  1FSH A;  1ENH A;  2V26 A;  1W0T A;  1MJB A;  3IH3 A;  3TQN A;  3C2B A;  3PUF A;  3DBL B;  2BW3 A;  5FFZ A;  4ZTF A;  2HR3 A;  1WJ5 A;  3EDP A;  4X0G A;  3AL0 B;  1DPR A;  1G3W A;  2QUF A;  2R3S A;  2KRH A;  2YSR A;  4KIB A;  2DI3 A;  2DYS H;  4LLL A;  4KUM A;  3CCR I;  4TV7 A;  4A69 C;  5HOD A;  3DCF A;  1R71 A;  2GOX B;  1TLH B;  2XAQ A;  1WJE A;  3LSG A;  4MIM A;  4I2O A;  3DKX A;  4XLC A;  3L00 A;  2VPR A;  2CUE A;  1KON A;  3HKZ N;  5DD8 A;  4B44 A;  2H6C A;  3HOX J;  5KAF C;  2GOM A;  1WI9 A;  4UV9 A;  4XM3 A;  1FY7 A;  2W24 A;  3BJA A;  3FXO A;  4LFU A;  5GP9 A;  3ZOB A;  1FYL A;  2CFO A;  1LUJ B;  3R60 A;  4N9H A;  2GBY A;  1D5Y A;  3E6B A;  1HW1 A;  4DBQ A;  1XMX A;  1IN7 A;  1TNS A;  1TW3 A;  2A5Y B;  1ETQ A;  2W1O A;  1MMS A;  1G2H A;  3K7A J;  2X1C A;  1I1S A;  3LAP A;  2X0L A;  1HKQ A;  4PSX A;  3KZY A;  1T6S A;  5HS9 A;  1GVD A;  3Q0W A;  3HTS B;  1XGN A;  2DOA A;  4NHJ A;  3NAU A;  2EA2 A;  3GZ5 A;  1P9Q C;  2FML A;  3VYR B;  1WGX A;  2DMQ A;  3L09 A;  1W5S A;  2LTP A;  3K69 A;  1Y6I A;  2CU7 A;  2YX4 A;  3GFI A;  4HG2 A;  6PAX A;  5J3L A;  2EFN A;  5E17 F;  3BG5 A;  1QGP A;  2R7O A;  4LGW A;  2CRG A;  3H3Z A;  1S72 I;  2IS6 A;  5B1B H;  2PMZ A;  3KEQ A;  4A6D A;  1STZ A;  4UB6 C;  3OYG A;  4EGY A;  2JJ7 A;  1K78 A;  2V9P A;  4R8H A;  3ZR8 X;  4D1Q A;  2ELJ A;  5KCM A;  3Q5F A;  3BJO A;  2EFP A;  3DPU A;  4UHT A;  2L54 A;  2PX9 A;  2EFQ A;  1VQP I;  3QYE A;  2DJI A;  1ZRC A;  4FET A;  1IG7 A;  3K4B A;  3MZ8 A;  5KVR A;  1BC8 C;  2VN2 A;  2DAO A;  3S2H J;  4XOT A;  1F9N A;  4XR6 A;  4BGD A;  3OY9 A;  4M9Z A;  4DZJ A;  2KDO A;  2XRO A;  2GZW A;  3BPV A;  4QSH A;  1KU7 A;  2STT A;  3CJT B;  3FXL A;  1NHA A;  3MCZ A;  4L0Y B;  1MH3 A;  2W4S A;  2F5F A;  4R79 A;  5CYV A;  1KU3 A;  3SZP A;  2M9H A;  1GUU A;  3CTA A;  3FKI J;  1XC5 A;  5D5U B;  2WB1 N;  5EEG A;  4EVI A;  4Q4Z F;  1D1A A;  2FRH A;  5FKM A;  3IH4 A;  3HRS A;  4C3H J;  3FIW A;  2IAI A;  2VKV A;  5IOY A;  5IOZ A;  2R7W A;  4FTH A;  3RTR A;  2HQ5 A;  3I9V 2;  2H6B A;  3G1M A;  1T56 A;  1TQP A;  3WGH A;  3K2Z A;  2UV1 A;  3HOW J;  4RS8 A;  3BC8 A;  4G7H F;  2NAZ A;  3P9I A;  3CJN A;  3KP6 A;  5C44 J;  2RAE A;  1MIJ A;  4A3K J;  1HKS A;  5J8C A;  3W6J B;  2EIK H;  3CO7 C;  1MH4 A;  3FK6 A;  4HNT A;  2GAU A;  1MBF A;  2FEZ A;  1HDP A;  1D5V A;  3VSK A;  3F23 A;  1WZ2 A;  4ZYH A;  2DMN A;  5GAG J;  2M3A A;  2MA3 A;  4CZZ A;  3TP3 A;  4XKC A;  3WTU C;  5J47 A;  2KL4 A;  3HOZ J;  5EZG A;  1S7O A;  4G94 A;  2H09 A;  4M3G A;  1YW7 A;  3OSF A;  3E3V A;  1UAA A;  2CV1 A;  2PFB A;  3BR2 A;  5H6Q A;  2DLL A;  3K6G A;  1JI8 A;  2M1B A;  3HHH A;  4UUS A;  3COA C;  4BS9 A;  1A31 A;  2QBY B;  2ZFW A;  4J00 A;  3VYU B;  1J0R A;  3BJ6 A;  3C1D A;  3GBG A;  2HEO A;  3F21 A;  4UXN A;  3JRH A;  3ZGK A;  3ZQC A;  1TT0 A;  1IV8 A;  2QM3 A;  3F9K A;  5DCM A;  3GVA A;  4OIN F;  2JMW A;  4BY1 J;  1JT0 A;  4CDG A;  2QLZ A;  1BR1 A;  5FD6 A;  2Y75 A;  3N4M A;  2WAF A;  3IP4 B;  1VQ9 I;  1X1P A;  3GTG J;  5D4R A;  3BTI A;  1ON2 A;  1Y56 A;  1LEA A;  2IGO A;  3K4M A;  1G8X A;  3WTV C;  5GAE J;  4M3E A;  4IEJ A;  4L9V A;  3VDX A;  2JA2 A;  5EGO A;  1A04 A;  4EJV A;  3GX4 X;  4LG0 B;  3TOA A;  3BG9 A;  2WBM A;  3JSP A;  2IEK A;  2ME6 A;  2HGC A;  2OD5 A;  2DK5 A;  5B3S H;  1FMV A;  2ZME C;  3F6V A;  2XPV A;  3HGG A;  3CCE I;  2K9M A;  2RKH A;  2YS9 A;  1OR7 C;  3ZMD A;  2XAG A;  3RDI A;  4XRS G;  2NS7 A;  3D5R C;  2M7B A;  1B4A A;  4HST A;  2W82 A;  4U0V A;  1YLF A;  3H92 A;  2LSO A;  3RKW A;  2XVC A;  1YYV A;  1F4K A;  5DDG A;  3OIP A;  3CQZ J;  3H9J A;  1Z1D A;  1Y0U A;  2IW5 A;  2OQG A;  3G73 A;  1WH7 A;  3WU1 B;  5BS6 A;  2ZB9 A;  4F55 A;  3CME I;  3PFI A;  1FNN A;  4RM3 A;  2NVX J;  4HPQ A;  3PNT A;  3MMY B;  4KDP A;  3HJE A;  5L3E A;  1WWX A;  3E7L A;  4IHY A;  2JA8 J;  4CGZ A;  3AL0 C;  3HRT A;  1T38 A;  5F0C A;  3OSG A;  2EFO A;  5M5Y J;  4HEA 2;  2B7E A;  1O57 A;  2YU3 A;  2HVQ A;  2LDU A;  4RDU A;  1HST A;  1YIO A;  4FAS D;  3IH2 A;  3GTJ J;  1O3T A;  3T0Y A;  4IRG A;  2DFH A;  5DM6 F;  4JQF A;  2P81 A;  1Z91 A;  2O3F A;  3D5L A;  3KPH A;  1MBE A;  1X1B A;  4II3 A;  4P9U A;  4E6K G;  1OYW A;  4XLF A;  4CCN A;  1TQM A;  2MLK A;  2MD0 A;  4MLO A;  3ERE D;  5FKK A;  4KNY A;  2AO9 A;  4BDZ A;  1ZQ3 P;  1LFP A;  4HDV A;  1KA8 A;  4BE1 A;  2DU9 A;  4UB8 C;  2QKM B;  5HNF A;  1S6L A;  1U3E M;  2ID6 A;  3FXJ A;  1V5E A;  2M2E A;  4CCO A;  2BY3 A;  3E5X A;  3CUQ C;  4OIQ F;  4FE7 A;  5CKT A;  1ZGA A;  3KEO A;  4AUX A;  4AWX B;  1DGR M;  1X19 A;  3BR6 A;  2QWW A;  3OV8 A;  2EFW A;  1SAN A;  1G3Y A;  2DOE A;  2XKO A;  4L9J A;  4P55 A;  4ZTJ A;  4A3C J;  4UUV A;  4JX6 A;  1MND A;  1ZYR F;  2XDV A;  3A02 A;  2R7X A;  2X9D A;  4C30 A;  1MKM A;  1S7E A;  3A0H C;  3TO9 A;  3H5A A;  4IHV A;  4I98 B;  4A93 J;  2K4J A;  4KYW A;  4Y3O A;  1E2X A;  2K4B A;  3ZQF A;  1YX3 A;  3SZG A;  2XPW A;  2LRD A;  2BE5 F;  1EA3 A;  1OPC A;  3NWS A;  4GXO A;  4XSZ F;  2D1H A;  5GPC A;  3K70 D;  4E7K A;  1PUE E;  2VON A;  4YII A;  3CDH A;  5FJ8 J;  3KFW X;  1IDZ A;  3KX2 A;  5E3M A;  2XC7 A;  1Y39 A;  3J80 Z;  1I50 J;  2NVU B;  3BR3 A;  2X85 A;  5JHU A;  2DOD A;  4YFK F;  4G8X A;  1YTY A;  2LF7 A;  4C3J J;  3OS1 A;  3BPX A;  1JKR C;  3CF2 A;  4FX0 A;  1N75 A;  3K70 C;  2BY0 A;  3NWT A;  3O6B B;  2DA1 A;  4RGS A;  1W36 D;  3FX3 A;  3NEU A;  5LGT A;  2EB7 A;  4AC0 A;  5HVQ C;  5ILU A;  3N97 A;  1W7P A;  5M3F J;  4G6D A;  3F6O A;  4B43 A;  4IVN A;  3JAM K;  3LQQ A;  1OCZ H;  2F5C A;  4C9Y A;  3CC4 I;  3KP5 A;  3E6M A;  4U87 A;  1VZ0 A;  3LAJ A;  1FEX A;  3JRF A;  2MC3 A;  4JBA A;  4KMF A;  4IOC F;  5BNG A;  1JKO C;  3S15 J;  1JJ6 C;  2H1L A;  2M8E A;  3ZRG A;  2FOK A;  1W36 C;  2O03 A;  3KET A;  4XLE A;  5EG0 B;  2QA4 I;  3S93 A;  2DN0 A;  4LB5 A;  3RZO J;  1BW6 A;  4FE4 A;  4GFB A;  4LIT A;  2ETH A;  2R7U A;  3G2B A;  2G9W A;  5DUK A;  1UHW A;  1Z9C A;  5F04 A;  5E3N A;  1IO2 A;  3JRE A;  1REP C;  3A2K A;  4RA2 A;  3DWL E;  3ZXS A;  2LRE A;  2CWE A;  2A07 F;  2LKX A;  1S7A A;  1OFC X;  2EIN H;  4IX7 A;  2E7W A;  4G6Q A;  1F43 A;  3CCS I;  2XGD A;  4PJ0 C;  2L4M A;  5TIS C;  5HS7 A;  2BW3 B;  3KYD B;  3D0S A;  4A3B J;  3OYC A;  1WVR A;  1T0F C;  2DMT A;  4DGW B;  3H1C A;  2VXD A;  3WHC A;  3ECH A;  4D5F A;  5GAH J;  5LHI A;  1ZAO A;  3BG7 A;  3HYI A;  5D8L B;  3CMM A;  3TDZ C;  1TW2 A;  2MYS A;  1J75 A;  4IZZ A;  2QEX I;  2MSY A;  2Z33 A;  1O3S A;  2UXN A;  1DU0 A;  2DPD A;  3QOD A;  1SC7 A;  1MDM A;  4HF0 A;  2VE8 A;  3TO6 A;  4BQA A;  4CCL A;  1MSE C;  5CQG A;  4A3J J;  3QQA A;  1QRY A;  2ICW G;  3E5Q A;  2XKP A;  2K86 A;  2J5O A;  1B8I A;  3BR1 A;  4MTD A;  2PJR A;  1O3Q A;  4BHB A;  3KYL A;  2L2O A;  4DZP A;  1BBY A;  1K61 A;  3L2W A;  4BL0 B;  1WJC A;  3SDG A;  5JVT A;  5L3F A;  3CCU I;  5HOO A;  5EF6 A;  3V4G A;  1RKT A;  1U5T A;  2DA4 A;  2YU9 J;  1E0E A;  1XCV A;  1J5Y A;  3FDY A;  4E7Z A;  1I5Z A;  4D7M A;  1OCP A;  3FF5 A;  2OZ6 A;  1ZK8 A;  1GDT A;  4LK0 F;  5CLS A;  2L5Q A;  1BIB A;  3NRV A;  3G6E I;  2KPM A;  1W0U A;  1FSE A;  5IY5 H;  1YI2 I;  2K9N A;  4E7H A;  4NQW A;  5TRD A;  2A05 A;  1GVJ A;  3S14 J;  3L2R A;  3I54 A;  3LSM A;  4NC8 A;  2Q8K A;  5FB2 A;  1BOA A;  3S1M J;  4QIW N;  1UST A;  2VJI A;  1K78 B;  5FLX K;  4HLX A;  3S1R J;  4M3B A;  5B1A H;  2QQB A;  2FUG 2;  1SD7 A;  2DXI A;  3OYJ A;  2M0C A;  3DP7 A;  1HDD C;  1KU9 A;  3I59 A;  2C6Y A;  3GW2 A;  4OMZ A;  4P1W A;  1VQ4 I;  5KAI C;  1PVE A;  2A69 F;  3KP4 A;  3ML6 A;  3H0G J;  3QRF F;  4L5J A;  1FBU A;  4XN0 A;  4IOA F;  2DDA A;  2VBW A;  2H8R A;  4BXU A;  4Y33 A;  3L9F A;  3PUB A;  1IN8 A;  3MKW B;  4KIT B;  2NRA C;  3M4O J;  3I53 A;  3CZ6 A;  2KIS A;  2Q1Z B;  5K5O A;  3OOU A;  2QQ9 A;  4BJ6 C;  4RGR A;  5E1X A;  2RNG A;  2E2I J;  1W1W E;  2CS3 A;  2CQX A;  2PQ8 A;  3O8H A;  3DPT A;  4I01 A;  5E18 F;  1EH6 A;  1FP1 D;  2DA2 A;  3BT9 A;  2F5D A;  2L9R A;  2B9S A;  5JFR A;  4MHG A;  2IP2 A;  3EQL F;  3EPZ A;  2LFB A;  3LFK A;  1GV5 A;  2GA2 A;  1YFH A;  1EKE A;  1OYI A;  2FD5 A;  2O9L A;  1K4T A;  2DO7 A;  1UCR A;  1SVO A;  2EH3 A;  2EA4 A;  1TTY A;  4OIR F;  4G6T B;  3SQN A;  1NK3 P;  4R1H A;  4QTR A;  1P4W A;  2HOT A;  3DKW A;  5IYC J;  1I27 A;  2E1N A;  2X1E A;  2KHM A;  1IV6 A;  3ZMV A;  3S3N A;  3DEW A;  2N8G A;  2P5V A;  4O3M A;  3P9C A;  1NH3 A;  4EQQ A;  3JR9 A;  5LGN A;  1BC7 C;  3OYB A;  3NQO A;  4Y15 A;  1VQ6 I;  3OR2 C;  4HOB A;  4H0E A;  1ZG5 A;  1USS A;  1RNL A;  1P6R A;  2CQN A;  2FNA A;  3GFL A;  4A3D J;  3EUH A;  2E2J J;  2HTS A;  1OQY A;  3CD6 I;  3BWG A;  1XDS A;  3MD2 A;  2YPR A;  4W1U A;  4DIQ A;  1DU6 A;  2BZT A;  2HZD A;  4BHP A;  2VBZ A;  4UUS B;  1JHF A;  3RPQ A;  2E2H J;  3C3W A;  1LDD A;  3Q9S A;  2Z3Y A;  5ICG A;  3M9A A;  5DCM B;  5E8G A;  1W5T A;  2XAS A;  3LA7 A;  3WE3 A;  5IT9 Z;  2E71 A;  3I0T A;  4ANJ A;  4BQO A;  4MNU A;  3B73 A;  2UUZ A;  3ZMT A;  2VKH A;  3BG3 A;  3SEZ A;  3H0D A;  1JT6 A;  1WJB A;  3JRB A;  1ETV A;  2ECC A;  1MD0 A;  2QEN A;  3IKV A;  1OMI A;  4XNF A;  1D0Y A;  5LBQ A;  4E7J A;  3QU6 A;  1I39 A;  2CQK A;  2DJN A;  1IRF A;  3HL2 A;  3H3V K;  3CCY A;  4IRH A;  1MJ9 A;  1JKP C;  3GTL J;  2QQA A;  2HZT A;  3OYF A;  2X51 A;  1H9T A;  1ZTR A;  2V6C A;  3IC7 A;  3RJP A;  3HC7 A;  3EET A;  3TGN A;  5F1J A;  1D1C A;  4ESJ A;  1WPK A;  1P7I A;  1HF0 A;  4IF4 A;  4XRF A;  2F5V A;  2FMY A;  3CO6 C;  3AG1 H;  4O6J A;  1B72 A;  1Y0N A;  3ZQQ A;  2WY7 Q;  3GLX A;  4UVB A;  1ORK A;  4XLP F;  5DV5 A;  1H89 C;  2HQA A;  2P5K A;  2XF7 A;  1VQ5 I;  2DFF A;  3RPU A;  1SFU A;  1YJW I;  1O3R A;  1TWF J;  4ZJZ A;  2PJP A;  1FWZ A;  4BEH A;  4Y4R A;  3LSK A;  2DPU A;  4AIH A;  3OYN A;  2M87 A;  3WGI A;  2G0E A;  1PP8 F;  2RGV A;  1ZGW A;  1FYM A;  1XMA A;  4KJZ A;  1VQK I;  4XLA A;  4CHU A;  2JA7 J;  3U9G A;  1YRN A;  1I3Q J;  4F3Q A;  3I71 A;  2A68 F;  4Q48 A;  1Z3Y A;  2FE3 A;  2K5C A;  3OOP A;  1J59 A;  2GLO A;  1RKW A;  3ABT A;  2XV4 S;  1WCM J;  3L1P A;  1WHU A;  3K4C A;  3BP8 A;  3OS2 A;  4M9X A;  1Z7U A;  3J7A Y;  2Y0S A;  1HW5 A;  2CW0 F;  4ESF A;  1I6H J;  9ANT A;  1R58 A;  1X3W B;  1JHH A;  2PN6 A;  2ZFU A;  3V7C A;  1D0X A;  3MZY A;  1HCR A;  3BCB A;  3G1O A;  4A12 A;  2LG4 A;  3W6V A;  1ODD A;  1JUS A;  1MW7 A;  3BCA A;  4W97 A;  1X1A A;  1YW9 A;  3GTK J;  3CCM I;  2ZKZ A;  3CUQ B;  4B4C A;  4L9T A;  2LKS A;  2JA6 J;  5E8I A;  3ZQ7 A;  3T8R A;  3FK7 A;  3K1N A;  2AQE A;  2ELK A;  3ISP A;  5FO5 A;  2GXA A;  1J09 A;  2L7K A;  4RAY A;  4M9S A;  1IAW A;  2BXY A;  3E6D A;  5CVV A;  1D8K A;  2QSF X;  2XSD C;  5FRM A;  5L3D A;  1ETX A;  2WV1 A;  3BTC A;  4P5O A;  3JRG A;  2PLY A;  3PO3 J;  1FOY A;  2K9Q A;  5CQE A;  3DTK A;  2ZNZ A;  3IHU A;  3ONQ A;  4DNC A;  3VPR A;  3K4N A;  4RBO A;  4HRI A;  2EV5 A;  2V7F A;  1Z21 A;  3IRR A;  2ZSI B;  1WJF A;  4ASN A;  1IJW C;  5HLH A;  2KIM A;  1ETW A;  1F1Z A;  3DU6 A;  2OF7 A;  2Y2Z A;  4ITV A;  5GTI C;  2M4K A;  2VQL A;  2JK3 A;  2DOF A;  4AU7 A;  3QPH A;  2CSO A;  4NDL A;  3MN2 A;  3JRI A;  4ZYA A;  1V4R A;  5A2Q K;  3VEP A;  5EZH A;  4PDK A;  2XGE A;  3KP3 A;  3P7N A;  4QWQ A;  4YIR X;  1ACI A;  4I99 C;  1YW8 A;  4P9F A;  2IS1 A;  3P5J A;  2M5W A;  2X1D A;  1HC8 A;  2Y0S N;  2RQQ A;  5KNL A;  3LA3 A;  4PFP A;  2EIJ H;  2B0L A;  3KE2 A;  2I5U A;  5EDN A;  1W7P B;  2IVM A;  2V9V A;  1XGO A;  3VYT B;  5JHF A;  2NVT J;  3CC2 I;  1XDU A;  3UKG A;  4E4H A;  1ZRF A;  1JE8 A;  1HOM A;  5D6E A;  4UNO A;  1W4M A;  4F7Z A;  4S05 A;  2A6T A;  1QZZ A;  2NOJ B;  3K1M A;  2FBI A;  4LIU A;  2ZO4 A;  2LMD A;  1VND A;  4AVP A;  2WAD A;  4V2G A;  4E7I A;  4KT6 A;  5CJ9 A;  1Z67 A;  2QGU A;  1I1G A;  2VT2 A;  1FPQ A;  3A03 A;  3FXU A;  3S32 A;  5DD4 A;  4PZJ A;  4LK1 F;  4IHX A;  2L01 A;  3OYE A;  2W84 A;  4OAY A;  3CMY A;  1FJL A;  1TT5 B;  2E1C A;  4Z2Y A;  3BY6 A;  4NC7 A;  2PMZ N;  2X6Y A;  1KQ0 A;  1T98 A;  2KRC A;  5FRO A;  5CVI A;  2QCO A;  2EIM H;  3FMQ A;  2VOO A;  2VAS A;  2LK2 A;  5FD5 A;  2XF6 A;  3SHF A;  1VQN I;  1SVM A;  2CO5 A;  4BYY A;  2D1V A;  5IP9 J;  1IXC A;  1R5G A;  1ETK A;  1JKQ C;  3PJR A;  1JUP A;  2Z9O A;  2LYC A;  4B47 A;  2K7L A;  4ZYD A;  3HEF A;  2Y0M A;  2DA6 A;  2Y31 A;  3C18 A;  3GFJ A;  1SVL A;  1YJN I;  2XB5 A;  4B09 A;  1LE8 A;  2VBX A;  4E70 A;  3GXO A;  3H35 A;  1BJZ A;  4J19 A;  1FC3 A;  4ZDL A;  2F4O B;  1ZRE A;  4BHC A;  4OWR B;  3RQ4 A;  4KA4 A;  2DQR A;  1LPQ A;  2EWN A;  4F93 B;  1VQM I;  3PQK A;  4PK4 A;  2ZJ2 A;  2JPC A;  4OAZ A;  4PJM A;  3V7S A;  3I5U A;  1JJ8 C;  1X2M A;  2DQL A;  3CDL A;  3K4K A;  1MDM B;  3H5N A;  2HYG D;  3HIF A;  4CYC A;  2WWY A;  3HOU J;  4A2U A;  3WG9 A;  4BH9 A;  1F5T A;  2PJR B;  3SFZ A;  3A01 B;  3BOQ A;  1OKR A;  3QYF A;  1XPX A;  1WI3 A;  2Y30 A;  4H4K C;  3RIR A;  2VLA A;  1D0Z A;  3CCQ I;  2QSG X;  4HSR A;  1Z77 A;  1U5T B;  1Z6R A;  1X3U A;  4K2E A;  1SFO J;  2BV6 A;  3MQ0 A;  1Z7L A;  2W25 A;  3Q3S A;  4M74 A;  5JVG F;  3Q0U A;  1TP4 A;  1BIA A;  4CYD A;  4KN4 X;  4OIP F;  4AIJ A;  4CH7 A;  1BOB A;  4NQW B;  1KYW A;  4L0Z B;  4OIO F;  2DFE A;  2WAQ A;  4I0B A;  4RB0 A;  2BGC A;  4RLQ A;  1R23 A;  1FBQ A;  3WGG A;  1M1E B;  2TRT A;  4RB3 C;  2JN6 A;  4FT8 A;  3BTL A;  3TO7 A;  2OUM A;  4HLY A;  2GWR A;  2VI6 A;  1R1T A;  2G7U A;  3I59 B;  3N05 A;  4RLF A;  4BBR J;  2MH2 A;  2HYJ A;  4IO9 F;  2NS0 A;  1MBK A;  3C7J A;  2RRE A;  4XID A;  3WHB A;  3ZQI A;  1Z6T A;  3J7Y J;  3PSF A;  4KIC A;  4DYR A;  2QYO A;  2LH9 A;  2BY2 A;  4LG3 A;  1BJA A;  2H8W A;  2XF5 A;  2R5Z A;  2DCE A;  4MFD A;  3OMY A;  4NB5 A;  1IRG A;  2HKX A;  4IXA A;  1ZN2 A;  3B6C A;  5L3B A;  4A5M A;  3K4J A;  2Y48 A;  3HOS A;  3ZQG A;  3I4M J;  1YE9 A;  2Z16 A;  2V1X A;  5LFA A;  1JGS A;  2NXN B;  3LST A;  4OOI A;  2V79 A;  4D9J A;  2ID3 A;  1RR8 C;  1ON1 A;  4XON A;  5K7H A;  3VSL A;  2DA3 A;  2GM4 A;  2XAF A;  3M1E A;  2O8K A;  3JCU C;  2COB A;  1UMQ A;  1XCB A;  2HWV A;  4HX4 A;  4PJN A;  4LLN A;  4B48 A;  4LIV A;  4QPO A;  1S8N A;  2K02 A;  3FIS A;  4A3G J;  2Q2E B;  5D8K B;  2AQF A;  1UB9 A;  5FLV A;  1AWC A;  4E7L A;  4M71 A;  1WSU A;  2L0K A;  1G3T A;  2PBI A;  3F8F A;  2LKP A;  5F1R A;  4UVC A;  2IGK A;  1N25 A;  3PO2 J;  1TWH J;  1K83 J;  1TBX A;  5E1Z B;  4A5N A;  1A6Q A;  2X4H A;  4JX5 A;  3PSI A;  2M0M A;  5E3L A;  3WTW C;  3GYH X;  2LBF A;  2L9S A;  3MVP A;  4N0B A;  3CCJ I;  2EZI A;  2GA1 A;  3WTY C;  1SEU A;  1O4X A;  3AKZ A;  1V3F A;  5AON A;  3M8J A;  4BBS J;  4NNJ A;  5KK1 A;  5ICC A;  3OYL A;  5J1R A;  3JW4 A;  4XOR A;  1U9O A;  1VI0 A;  1U2W A;  3QPT A;  4IHW A;  2HPM A;  1BR4 A;  2KJB A;  2IS4 A;  3F72 A;  1O7L A;  1FOW A;  1R00 A;  4BKX A;  2X6O A;  1CF7 A;  4ENJ A;  1OCO H;  1T95 A;  1QQI A;  3OS0 A;  1RIO H;  3QYB A;  2ZXI A;  2M45 A;  4XMY A;  4ZDO A;  1Y8R B;  5GTH C;  2JUG A;  2KJC A;  1P2F A;  1R6R A;  5HLI A;  4X1E A;  2B63 J;  3GZN B;  1IZ1 A;  2XPU A;  1B72 B;  5FKN A;  2ZNY A;  4Q47 A;  5JI6 A;  4IQJ A;  4PJL A;  1MMG A;  2LC2 A;  5J4Y A;  5M5X J;  2GXB A;  1SAU A;  1DP7 P;  5K5Q A;  3WTS C;  4NUB A;  4IRI A;  3SEQ A;  5BQT A;  2V1U A;  2UZK A;  1V55 H;  3HB9 A;  3CCL I;  4HX7 A;  4YG2 F;  3KZZ A;  5HDG A;  4BEH B;  1SFX A;  5DTD A;  3DLL F;  1SAX A;  2VJ5 A;  1IDY A;  1XTA A;  4G7O F;  1PDN C;  1B9M A;  2HDW A;  5HDK A;  4GGG A;  2KZG A;  2K40 A;  3V8L A;  4CZC A;  5LGU A;  3WTX C;  1QO0 D;  2DK8 A;  2P7V B;  3LSJ A;  5J1Y A;  1U0J A;  2M30 A;  1LNW A;  1YRN B;  1FX7 A;  3EUK L;  2BVL A;  1VQL I;  1MJA A;  1F36 A;  5C4J J;  4BAC A;  2CQQ A;  3KEY A;  2OV7 A;  1ETY A;  1S9H A;  2QVO A;  1XD7 A;  3RKQ A;  1YIJ I;  3DPL C;  2I10 A;  1R22 A;  3R6S A;  5EEH A;  1FBS A;  4LD5 A;  4RGU A;  2RQP A;  1VTN C;  1KZH A;  2HOA A;  4BQN A;  2VQG A;  3HDD A;  2PI0 A;  5HS8 A;  5J40 A;  1K79 A;  1FYK A;  3H5R A;  3BQZ A;  1WFX A;  3ECO A;  2QSH X;  1YOV B;  4A3L J;  2A3S A;  2WV0 A;  1U6G A;  4FIS A;  4CSW A;  1V54 H;  1E3O C;  3ZMZ A;  5D5X B;  1YG2 A;  2HDC A;  4D0P A;  3ZQL A;  1WJA A;  1TQI A;  2CH0 A;  2D5V A;  2L02 A;  1OCT C;  4MO7 A;  3JSO A;  3PNV A;  3GCM A;  2FF4 A;  4GYI A;  4LJZ F;  3OYH A;  4ZZL A;  1HA8 A;  1P92 A;  2DA5 A;  3K9T A;  4NBQ A;  1YO5 C;  4XLN F;  1U5T C;  5J8F A;  3S8P A;  2FQ3 A;  4F52 A;  1NG7 A;  3DXJ F;  1KYZ A;  1XB4 A;  2O8X A;  3TMO A;  2PMU A;  4C2M J;  2EZL A;  4IL6 C;  2E1M B;  2XAU A;  1R4M B;  2FA5 A;  5IT3 A;  4Y52 J;  2YUS A;  4RAZ A;  2O7O A;  3OYM A;  3GME A;  3BTJ A;  3LA2 A;  4NC6 A;  1IN4 A;  4A3E J;  3S3M A;  2VQH A;  3WOD F;  1VQ8 I;  1JXS A;  1KQ9 A;  2BOL A;  2VT3 A;  1OCR H;  5IYB J;  4M72 A;  3U2R A;  2ME0 A;  2ZXJ A;  1ZEL A;  2WC2 A;  2ISY A;  2WY8 Q;  4DJA A;  3TW7 A;  1G6N A;  1A5J A;  4OMY A;  2H1K A;  4AYB A;  3V7R A;  1IRX A;  4HDU A;  2ADU A;  5E79 C;  3ZQH A;  1R4N B;  4BE2 A;  3RI4 A;  5M5W J;  2V6E A;  1IN6 A;  2K85 A;  5BMZ A;  3F8C A;  4Z6Y A;  3ZMS A;  1EJ9 A;  3LSH A;  4LB6 B;  2Y69 H;  4KIS A;  3GEZ A;  1EF4 A;  1B6A A;  5IP6 A;  1O7F A;  3OR1 C;  2HYF A;  3L2U A;  3EYI A;  1ZAR A;  3R4K A;  1Z3X A;  3I64 A;  4V19 K;  4KT5 C;  5BPD A;  4XQF A;  1QPM A;  1QZY A;  2KP6 A;  3F8N A;  3FKJ A;  3PM1 A;  1H8A C;  2OJE D;  3S1Q J;  4XLH A;  2M7A A;  1RUO A;  4MFE A;  2L9N A;  3L2Q A;  3FHZ A;  4ENN A;  1VQO I;  4PSW A;  3ZPL A;  4XBF A;  3LSP A;  1SD4 A;  3MKZ A;  1WQ2 A;  3GFM A;  3E1S A;  1XN7 A;  2KIF A;  3AG2 H;  5AIP A;  3KZI C;  1R7J A;  4UV8 A;  3VFZ A;  4M3F A;  3CJQ B;  3NAR A;  2IGN A;  3SFI A;  2M34 A;  2FXA A;  4HV6 A;  2EK5 A;  2D2W A;  2MLG A;  3A0B C;  4CUG A;  2IA0 A;  2PG4 A;  2V1N A;  1MBJ A;  2FU4 A;  1BN5 A;  1OLT A;  3AAF A;  1WRJ A;  3RKX A;  3GZ6 A;  3C2G A;  3HKZ A;  3EUH C;  4RM2 A;  4JYK A;  3BZK A;  2BHY A;  4EJW A;  2DFI A;  2KQR A;  3D1N I;  1BW5 A;  2R7F A;  3KP2 A;  3Q9V A;  1LE8 B;  2VUM J;  2JPB A;  3SZT A;  2AXT C;  1ETO A;  2BY1 A;  2CW7 A;  5D4S A;  3OYK A;  5F08 A;  3J7A O;  1XX5 A;  5EGO B;  4AM3 A;  2F4M B;  5K7F A;  4XRS A;  2CUF A;  4HF1 A;  1DP3 A;  4B8X A;  3G4S I;  4ZC3 A;  2L7M P;  1AHD P;  1G4D A;  1L0O C;  5ILV A;  4V2F A;  1W5C C;  2HXI A;  2M4G A;  4M6V A;  4CYC B;  3S3O A;  2JT1 A;  3ABL H;  2K27 A;  5J6X A;  3R61 A;  2OCE A;  4DYQ A;  3RSN A;  5K1Y A;  4A3F J;  3GTO J;  3CLO A;  3DTI A;  1IC8 A;  2DTZ A;  2K3F A;  1MNM C;  1D1B A;  4KN7 X;  2STW A;  1FTZ A;  4MQV A;  2KMU A;  3FXR A;  3ZMU A;  1Z05 A;  2MG4 A;  2FX0 A;  1GHC A;  4U0Y A;  3LQR A;  3SXY A;  2NYX A;  4G12 A;  2VOP A;  5CVJ A;  3LMM A;  2HOE A;  2ZBK A;  1RET A;  1Y1W J;  1UG2 A;  3DV8 A;  2VOD A;  4M3D A;  2IRF G;  3W6K B;  2HI3 A;  2AS5 F;  3LL7 A;  1YS7 A;  3QP6 A;  3R0J A;  4FX4 A;  3MZH A;  3H36 A;  1XSX A;  2Q0O A;  1POG A;  3HGY A;  1FZP B;  3ZN0 A;  1D3Y A;  1BI1 A;  2FJ1 A;  2W7N A;  4OU0 A;  2X6X A;  1QVU A;  1ZH5 A;  4MQ9 F;  2LY2 A;  2XRN A;  4ZYE A;  1R36 A;  4M73 A;  3K4L A;  3BZ6 A;  4YRV A;  5JLX A;  1OIS A;  2A6H F;  1K7A A;  3DU5 A;  2WB1 A;  2VL8 A;  3F8M A;  4GCV A;  4BDY A;  3AG4 H;  1HKT A;  2JSP A;  5DYM A;  2CG4 A;  2JRM A;  3QPL A;  1YHQ I;  2XAH A;  3HSE A;  1LB2 A;  2K3P A;  2VBY A;  2F6C A;  4HX8 A;  4D7N A;  4EJU A;  3BR5 A;  2OA4 A;  1LFU P;  2Z2S B;  5FLX Z;  1RZ4 A;  2L9V A;  3FZV A;  5BOX A;  4WXD A;  3RCO A;  2KDZ A;  3CP2 A;  5ERI A;  3UR3 C;  2R5Z B;  1HBX G;  1B1B A;  4BUP A;  1LDK B;  3I55 I;  1ERD A;  1Z0X A;  1G3S A;  2WA0 A;  1FIP A;  2GQQ A;  2CV0 A;  4ENM A;  1AA7 A;  3L7W A;  3FBI B;  4I09 A;  3GLL A;  2XB0 X;  1ULY A;  3BR0 A;  2J5P A;  2XHK A;  2O61 A;  3QOP A;  1L3L A;  3T1B A;  1OCC H;  4WK8 F;  5JLW A;  3FWE A;  3M07 A;  2P0W A;  3S2W A;  2CQ7 A;  2OC6 A;  1QHG A;  2RC4 A;  3ELK A;  4YFN F;  3ASN H;  2R7R A;  2R7Q A;  2F5E A;  4U0W A;  4MEX F;  1E17 A;  2R5Y A;  1OYY A;  1AKH A;  2HQN A;  3CUO A;  1IUF A;  4WWC A;  4A0Z A;  1IRZ A;  2DMU A;  1PUF A;  1IXS B;  1RPW A;  1T33 A;  2JVH A;  3MEX A;  3QP5 A;  2E1M C;  4BQQ A;  1GLN A;  4HNV A;  1TZL A;  1IXR C;  2BXZ A;  2NVY J;  2ACJ A;  4FQG A;  2DMP A;  2PMH A;  2W85 A;  1XGS A;  1K6O A;  1KU2 A;  1X1C A;  1HXD A;  5LHH A;  4XN3 A;  4DYC A;  2NVQ J;  3HUG A;  3DEE A;  1XG1 A;  4XSX F;  2DYR H;  1YJ9 I;  3F8B A;  1ZR2 A;  5DCF A;  4JK1 X;  3M8E A;  3HBL A;  2OAZ A;  2EJR A;  1UEL B;  1LFB A;  2JA5 J;  4O5V A;  5LLQ A;  1RI7 A;  4I76 A;  4EJO A;  2LY1 A;  2LBF B;  3VB2 A;  3OYD A;  2ELH A;  2CUZ A;  2X48 A;  4RB1 A;  2LP0 A;  4AIK A;  1UHM A;  4CCM A;  1FT9 A;  2JWT A;  4KIF A;  3HM5 A;  3PIP F;  1WJD A;  1YS6 A;  2P8T A;  2PEX A;  3OYI A;  1QA6 A;  2IGM A;  2QKL B;  4PFO A;  1ZG1 A;  2VIX A;  4YIF A;  4DOZ A;  3DBR B;  2XGC A;  3IRQ A;  3WU0 A;  1A6I A;  5DEQ A;  1TWC J;  2IT0 A;  2IA2 A;  4PGH A;  2NNN A;  3RYP A;  4BJT A;  3J80 K;  2Z5U A;  1CF7 B;  3M1C A;  1BR2 A;  3ABM H;  1ZGJ A;  2HVS A;  2HS5 A;  2KIQ A;  2EIL H;  2LR8 A;  3TKY A;  3L2C A;  3AFH A;  3OIQ A;  5C3E J;  1YQA A;  1ZR4 A;  1S3J A;  2XRL A;  5EEA A;  4C2T A;  5M3M J;  2BHZ A;  4RAG A;  1XGM A;  4DQ2 A;  1C0W A;  3RQI A;  3M3Y J;  3ABU A;  5LHG A;  2OPT A;  4UY8 I;  3FM3 A;  5E3O A;  5IP7 J;  2EBI A;  4ABZ A;  5D5W B;  2GXG A;  2E60 A;  5E1W A;  4HNU A;  3B6A A;  4EMS A;  2CYY A;  3FBN B;  3WU2 C;  1QBJ A;  1RC9 A;  3JRC A;  1T2K A;  1E3H A;  1KGS A;  2GIZ A;  2JUC A;  2YR2 A;  3O2P E;  4AD9 A;  3IUO A;  2JTV A;  4EV0 A;  3HSR A;  4GDF A;  4P96 A;  3SJM A;  3E6C C;  1CQT A;  2TCT A;  3CDI A;  4I6Z A;  2KLO A;  4IKF A;  2RVC A;  4YFX F;  4EJT A;  2AHQ A;  4YEL A;  3D5S C;  2HNH A;  1OJL A;  2VC0 A;  3J81 Z;  4J01 A;  3ZCO A;  1B59 A;  1TL8 A;  2LVS A;  1UHS A;  4U88 A;  3BDD A;  1J2X A;  2RDP A;  2VQC A;  5LEK A;  1RRJ A;  3TW6 A;  3CJR B;  5FLM J;  2R7T A;  1UZC A;  2W00 A;  3DEU A;  3HG9 A;  1N78 A;  4IHS A;  1R49 A;  2W48 A;  1YX5 A;  3JTG A;  1B8I B;  5KHD A;  2LOO A;  2HTJ A;  3G1L A;  1J9I A;  4MEY F;  2VXZ A;  2ZME A;  5F27 A;  4HF2 A;  3S2D J;  1OR7 A;  2K9S A;  2OZU A;  1FIA A;  4ESB A;  1D8J A;  1DDN A;  1GT0 C;  2JVG A;  3X2Q H;  2EPF A;  3TBI A;  4BXX J;  2VB6 A;  1DUX C;  2MGQ A;  4FCY A;  3ASO H;  4IHT A;  1U78 A;  1Q1H A;  2QZ8 A;  2Z1D A;  3OL3 A;  1DQU A;  3EYY A;  2V9K A;  3I3L A;  1IUY A;  1VF9 A;  1LEB A;  1Q1V A;  2V4J C;  2Y9Z A;  1SD6 A;  3HSF A;  3QAH A;  4JOM A;  2VKE A;  4DW6 A;  2R0Q C;  4YEJ A;  2XAJ A;  2HOS A;  3ROU A;  1ZKG A;  2VC1 A;  2E5Z A;  3F22 A;  4BY7 J;  3U21 A;  4ZYG A;  3MKL A;  1ZLK A;  3CES A;  3CCV I;  5GAD J;  3O8G A;  2HU9 A;  3BZC A;  4M6Y A;  3DLA A;  3KYC B;  4EAT A;  2MC4 A;  3FXM A;  2CUJ A;  2KFD A;  4RB2 C;  3V42 A;  3ERM A;  1ZRD A;  4ZZD A;  1J7K A;  2HFH A;  4N4N B;  5HNH A;  5B66 C;  5FKL A;  3CP8 A;  3PFY A;  1QPI A;  2VE9 A;  2IPQ X;  2VJ4 A;  1Y8Q B;  3ZN1 A;  2DT7 B;  4RAF A;  4Y13 A;  5TGT A;  3M7G A;  1JTX A;  5FFX A;  1MMA A;  3LSI A;  3REO A;  2TDX A;  1TWG J;  3PL8 A;  4ETS A;  4XKW A;  4CCK A;  2Z99 A;  3FHN A;  4WCG A;  3CUQ A;  3H9G A;  3GUD A;  2EV0 A;  4EM0 B;  3S16 J;  3W2A A;  2ZXH A;  1JUM A;  2JSC A;  4MTE A;  2W57 A;  2F2E A;  4HV5 A;  4S04 A;  2CJJ A;  3IWF A;  2VJJ A;  1X2N A;  2MH9 A;  2E36 A;  3BRO A;  3V8K A;  3TED A;  2JRT A;  2UXX A;  3RKY A;  3IV5 A;  3LFU A;  3HOT A;  3HXL A;  4ENK A;  4X6A J;  3BLY A;  1PJR A;  2KT0 A;  3F0C A;  3K2A A;  4B1R A;  3JRD A;  4HBL A;  1TWA J;  1LQ1 A;  1ITY A;  2YX7 A;  3DKY A;  5A2Q Z;  1S29 A;  5H6R A;  4BE0 A;  3HZJ A;  3FMS A;  2OBP A;  4RMN A;  4A0Y A;  1CGP A;  2R7D A;  3MWM A;  4I02 A;  3OYA A;  2O6G E;  2KKO A;  1FTT A;  3SDB A;  2L7F P;  3U1K A;  3WTZ A;  5ED4 A;  5D5V B;  2MBF A;  2CW8 A;  3MKY B;  1G59 A;  3I4P A;  2OTJ I;  4BU2 A;  2HDD A;  2WAQ N;  2O0Y A;  4WXC A;  3TOB A;  1I6X A;  2UWM A;  3IWZ A;  3FXQ A;  4GYG A;  4IPA A;  4L5I A;  4EGZ A;  1B9N A;  2OCC H;  3HHG A;  2IS2 A;  4LOC A;  1PP7 U;  1QZE A;  4CCJ A;  1T08 B;  1WKM A;  2HXO A;  3PQJ A;  3I4N J;  3WG7 H;  3FMR A;  2FOW A;  1VQ7 I;  1W7P D;  2ZJP F;  1SMY F;  1V5F A;  3FXK A;  5HDN A;  2R7S A;  4AID A;  1FOK A;  1WH5 A;  2P4W A;  3UNG C;  4F91 B;  4UUT A;  2CMP A;  4U7B A;  1XS9 A;  4WXH A;  4N9I A;  3QWL A;  2DA7 A;  4WX9 A;  2DBB A;  4B3A A;  1MMD A;  2BVM A;  1IN5 A;  3ZP5 A;  3CMA I;  2H27 A;  3W2V A;  1TC3 C;  1TNT A;  4PCQ A;  2E5N A;  3SYT A;  1MBH A;  1UJ8 A;  1UG0 A;  2K9L A;  2R4G A;  1BL0 A;  1FLI A;  4N4O B;  3J7Z I;  3RZD J;  4BXF A;  1HQC A;  2R93 J;  4DBR A;  3JRA A;  4Y17 A;  3Q0V A;  2R92 J;  2HPI A;  2IJL A;  3F3X A;  2M8G X;  3M8F A;  2DT5 A;  3HPG A;  2LF8 A;  3LOC A;  5ILS A;  3P9K A;  2EZH A;  2G7H A;  4ON0 A;  2LD5 A;  4F92 B;  2Y9Y A;  4PGG A;  3A4C A;  2E1O A;  2DTR A;  1NG6 A;  5HLT A;  5IT9 K;  2H94 A;  4C3I J;  2R7Z J;  4II2 A;  4EEF G;  4XL9 A;  4U7D A;  2VPL A;  3T5X A;  3QOE A;  4A3I J;  2MD5 A;  1QNT A;  5FGM A;  4CIC A;  4L18 B;  1T8I A;  1HW2 A;  4G9Y A;  1K4S A;  4JP0 A;  1S5L C;  1FP2 A;  1LKX A;  5K5R A;  3IL2 A;  1T0F A;  1GV2 A;  3DTE A;  5J1U A;  1MZB A;  5BPI A;  1XMK A;  4XIC A;  2A5W A;  1R1V A;  4LLG F;  5DUI A;  3W2W A;  4A6E A;  4LMY A;  2QBY A;  3AG3 H;  3O3K A;  3TDU C;  5E20 A;  1RUN A;  2HKO A;  1XSV A;  3GTQ J;  3TL4 X;  4JX4 A;  2IA1 A;  4FHT A;  2DT6 A;  1MSF C;  1EV7 A;  5CVU A;  2OTL I;  1UFM A;  3HPH A;  4IQ4 A;  1H9G A;  2JZY A;  3VOD A;  3QU3 A;  1SFE A;  2L7Z A;  3RYR A;  3HTU A;  2GIV A;  3FM5 A;  5F0H A;  1FMW A;  1IGN A;  2ZC2 A;  3KLN A;  3HRM A;  1ZHF A;  5CPR B;  2RNJ A;  3I58 A;  4HAM A;  1BI2 A;  3DF8 A;  4QLC U;  3L2V A;  4QPQ A;  1U8B A;  2F4I A;  1R9T J;  4LG0 A;  2NNY A;  2A6E F;  3JTH A;  5FKO A;  5K7Z A;  3A1Y A;  3E5U A;  1P4X A;  2L3D A;  1X3Z B;  5D6F A;  2QQ8 A;  2XSJ C;  2E19 A;  1DPU A;  4HQM A;  4KFC A;  5JR3 A;  3A01 A;  1P4A A;  2LLK A;  2XUB A;  4RGX A;  5DS9 A;  3R0A A;  2VKD A;  4CO8 A;  5H2F C;  4KIG A;  5B5E C;  2NS8 A;  1MBG A;  2LNB A;  3LNQ A;  3WE2 A;  1FOX A;  5DM7 F;  3W3C A;  1NTC A;  1H0M A;  3WTT C;  1LJ9 A;  1T39 A;  1IF1 A;  1LVK A;  1BI3 A;  1X4O A;  2QF7 A;  1ZLJ A;  4MGR A;  4B3X A;  2D45 A;  5LEJ A;  2RV8 A;  3ESW B;  3I56 I;  2P7C B;  4AVZ A;  4XKB A;  5CVR A;  2ECB A;  4EM1 A;  5LRS A;  2R5Y B;  2CV2 A;  1AKH B;  4A3M J;  2R7V A;  1MNE A;  4CXF A;  3LWF A;  5J4V A;  1ONV A;  2DW4 A;  5L3G A;  2FBK A;  4XK4 A;  4Y7N J;  1U8R A;  3MFK A;  1X58 A;  1PUF B;  1K6Y A;  3IAS 2;  1A35 A;  2FNP A;  1E3P A;  3PNY A;  2EQR A;  1BA5 A;  1HSJ A;  2L4A A;  1NK2 P;  4EM2 A;  2LY9 A;  3H9Q A;  3K0L A;  4GRI A;  2BYV E;  3HOY J;  3IKT A;  1R5I D;  3E0J B;  3HUG B;  3U1D A;  3DBH B;  3DFG A;  4BNC A;  4ZH4 F;  1JGG A;  2E35 A;  1KQ8 A;  5TJJ A;  4L9N A;  2O5R A;  1ZG3 A;  2FSW A;  3GWZ A;  4L5E A;  3V8J A;  1PYV A;  1QU3 A;  2ZJR F;  2A61 A;  5IPA A;  1P7J A;  2WTE A;  3LSR A;  2FQ4 A;  3MAJ A;  2I8D A;  4BJ5 C;  4BAY A;  4G7Z F;  3BQY A;  3KLO A;  3CF5 F;  2ESN A;  3G3Z A;  2P6S A;  1MMN A;  2COM A;  3S17 J;  2E34 A;  1EH8 A;  5IYD J;  1R1U A;  1U9N A;  1BM9 A;  2RN7 A;  4XRM A;  1VFC A;  2IBD A;  1QVT A;  3HOV J;  1JTY A;  2WAE A;  2KRF A;  3OWT A;  3C2H A;  2ZJQ F;  4KMU X;  1SFK A;  2XGX A;  4CA0 A;  4PUS A;  2ESH A;  1QHH D;  3S1N J;  1LVA A;  2MW8 A;  1RES A;  2BEO A; 
#chains in the Genus database with same CATH homology
 4A0X A;  1GXQ A;  5ICF A;  3JAM Z;  4I0A A;  4I7H A;  4Q5S F;  2OQR A;  2BBY A;  3HRU A;  5LRR A;  2ZCW A;  3KCC A;  2KIU A;  2Q2E A;  2OU2 A;  3H3U A;  2P6T A;  3ULQ B;  1MGT A;  1BI0 A;  4HA8 A;  3VOE A;  1XSD A;  2FBH A;  5ICE A;  1SD5 A;  2AXL A;  4GO1 A;  5H20 A;  1IW7 F;  3DQV C;  1SMT A;  3T8T A;  3K1P A;  1AOY A;  4IJA A;  2EV6 A;  1GXP A;  3GO5 A;  1EH7 A;  4UVA A;  1R5H A;  2XIG A;  2P5L C;  2ISZ A;  5HLG A;  2ZME B;  3KP7 A;  2HQR A;  2E7X A;  5F6F A;  4HW0 A;  5AIQ A;  5F64 A;  3E97 A;  1LDJ A;  2CGP A;  2CFX A;  5L3C A;  4HYE A;  4M6X A;  3J81 K;  3B02 A;  3GF2 A;  4HZF A;  2V1D A;  4HQE A;  4WF2 A;  1FSH A;  1MJB A;  3TQN A;  5FFZ A;  2HR3 A;  3EDP A;  1DPR A;  1G3W A;  2QUF A;  2R3S A;  2YSR A;  4KIB A;  2DI3 A;  4LLL A;  4KUM A;  4TV7 A;  1TLH B;  2XAQ A;  4I2O A;  3L00 A;  5DD8 A;  2H6C A;  1WI9 A;  4UV9 A;  1FY7 A;  2W24 A;  3BJA A;  4LFU A;  1FYL A;  3R60 A;  4N9H A;  3E6B A;  1HW1 A;  1IN7 A;  1TNS A;  1TW3 A;  2A5Y B;  1I1S A;  3LAP A;  2X0L A;  1HKQ A;  3KZY A;  1T6S A;  5HS9 A;  3HTS B;  1XGN A;  4NHJ A;  2EA2 A;  3GZ5 A;  2FML A;  3L09 A;  1W5S A;  3K69 A;  2YX4 A;  3GFI A;  6PAX A;  2EFN A;  5E17 F;  1QGP A;  4LGW A;  3H3Z A;  3KEQ A;  4A6D A;  1STZ A;  4EGY A;  1K78 A;  4R8H A;  3Q5F A;  3BJO A;  2EFP A;  4UHT A;  2L54 A;  2EFQ A;  1ZRC A;  5KVR A;  1BC8 C;  2VN2 A;  2DAO A;  1F9N A;  4M9Z A;  2XRO A;  2GZW A;  3BPV A;  1KU7 A;  2STT A;  1NHA A;  3MCZ A;  4L0Y B;  4R79 A;  2F5F A;  5CYV A;  1KU3 A;  3SZP A;  3CTA A;  5D5U B;  5EEG A;  4EVI A;  4Q4Z F;  2FRH A;  3HRS A;  3RTR A;  2H6B A;  1TQP A;  3WGH A;  3K2Z A;  4RS8 A;  4G7H F;  2NAZ A;  3P9I A;  3CJN A;  3KP6 A;  1HKS A;  5J8C A;  3W6J B;  3CO7 C;  2GAU A;  2FEZ A;  1D5V A;  3F23 A;  4ZYH A;  2MA3 A;  4CZZ A;  3WTU C;  1S7O A;  4G94 A;  2H09 A;  1YW7 A;  3E3V A;  2PFB A;  5H6Q A;  2DLL A;  2M1B A;  3HHH A;  3COA C;  2QBY B;  2ZFW A;  1J0R A;  3BJ6 A;  3C1D A;  2HEO A;  3F21 A;  4UXN A;  2QM3 A;  5DCM A;  3GVA A;  4OIN F;  4CDG A;  2QLZ A;  5FD6 A;  2Y75 A;  3N4M A;  5D4R A;  1ON2 A;  1LEA A;  3WTV C;  4L9V A;  1A04 A;  4EJV A;  3GX4 X;  4LG0 B;  3TOA A;  3JSP A;  2HGC A;  2OD5 A;  2DK5 A;  3F6V A;  2RKH A;  3ZMD A;  2XAG A;  3RDI A;  1B4A A;  4U0V A;  1YLF A;  3H92 A;  2LSO A;  3RKW A;  2XVC A;  1YYV A;  1F4K A;  5DDG A;  3G73 A;  1Z1D A;  1Y0U A;  2IW5 A;  2OQG A;  3WU1 B;  5BS6 A;  3PFI A;  1FNN A;  4KDP A;  5L3E A;  1WWX A;  4CGZ A;  3HRT A;  1T38 A;  2EFO A;  1O57 A;  2YU3 A;  2LDU A;  1HST A;  1YIO A;  1O3T A;  3T0Y A;  4IRG A;  4JQF A;  1Z91 A;  2O3F A;  3D5L A;  4P9U A;  1OYW A;  1TQM A;  2MLK A;  3ERE D;  4KNY A;  4HDV A;  1KA8 A;  2DU9 A;  1S6L A;  1U3E M;  3E5X A;  3CUQ C;  4OIQ F;  1ZGA A;  3KEO A;  4AWX B;  2QWW A;  3OV8 A;  2EFW A;  1G3Y A;  4P55 A;  2XKO A;  4L9J A;  4UUV A;  1ZYR F;  1MKM A;  3TO9 A;  4I98 B;  2K4J A;  4KYW A;  1E2X A;  2K4B A;  2BE5 F;  4GXO A;  1OPC A;  4XSZ F;  1PUE E;  2D1H A;  2VON A;  4YII A;  3CDH A;  3KFW X;  3J80 Z;  5JHU A;  4YFK F;  4G8X A;  1YTY A;  2LF7 A;  3BPX A;  4FX0 A;  3O6B B;  4RGS A;  3FX3 A;  3NEU A;  5LGT A;  2EB7 A;  5HVQ C;  5ILU A;  3N97 A;  1W7P A;  4G6D A;  3F6O A;  3JAM K;  4IVN A;  3LQQ A;  2F5C A;  3KP5 A;  3E6M A;  3LAJ A;  2MC3 A;  4JBA A;  4KMF A;  2M8E A;  2FOK A;  2O03 A;  3KET A;  4LB5 A;  2ETH A;  2G9W A;  5DUK A;  1UHW A;  1Z9C A;  1REP C;  2CWE A;  2A07 F;  1S7A A;  2E7W A;  4G6Q A;  2L4M A;  5HS7 A;  3D0S A;  3ECH A;  5LHI A;  1ZAO A;  3HYI A;  5D8L B;  3TDZ C;  1TW2 A;  1J75 A;  2Z33 A;  1O3S A;  2UXN A;  2DPD A;  1MDM A;  4HF0 A;  2VE8 A;  3TO6 A;  4BQA A;  3E5Q A;  2XKP A;  2K86 A;  2J5O A;  4MTD A;  1O3Q A;  4BHB A;  1BBY A;  5JVT A;  5L3F A;  5HOO A;  3V4G A;  1U5T A;  1XCV A;  1J5Y A;  1I5Z A;  3FF5 A;  2OZ6 A;  4LK0 F;  5CLS A;  1BIB A;  3NRV A;  1FSE A;  4NQW A;  5TRD A;  1GVJ A;  3I54 A;  2Q8K A;  5FB2 A;  1BOA A;  1UST A;  1K78 B;  5FLX K;  4HLX A;  2QQB A;  1SD7 A;  3DP7 A;  1KU9 A;  3I59 A;  2C6Y A;  3GW2 A;  4OMZ A;  2A69 F;  3KP4 A;  3ML6 A;  3QRF F;  4L5J A;  1FBU A;  2VBW A;  4BXU A;  3L9F A;  1IN8 A;  2NRA C;  3I53 A;  5K5O A;  2QQ9 A;  4RGR A;  5E1X A;  2PQ8 A;  3DPT A;  4I01 A;  5E18 F;  1EH6 A;  1FP1 D;  2F5D A;  5JFR A;  4MHG A;  2IP2 A;  3EQL F;  3LFK A;  2GA2 A;  1YFH A;  1OYI A;  2DO7 A;  1UCR A;  2EA4 A;  1TTY A;  4OIR F;  3SQN A;  4R1H A;  1P4W A;  3DKW A;  1I27 A;  2E1N A;  3ZMV A;  2P5V A;  4O3M A;  3P9C A;  4EQQ A;  5LGN A;  1BC7 C;  3NQO A;  4Y15 A;  4HOB A;  1ZG5 A;  1USS A;  1RNL A;  1P6R A;  2FNA A;  3GFL A;  3EUH A;  2HTS A;  3BWG A;  1XDS A;  2YPR A;  4BHP A;  2VBZ A;  1JHF A;  3RPQ A;  3C3W A;  1LDD A;  3Q9S A;  2Z3Y A;  5ICG A;  3M9A A;  5DCM B;  5E8G A;  1W5T A;  2XAS A;  3LA7 A;  3WE3 A;  5IT9 Z;  3I0T A;  4MNU A;  3B73 A;  3ZMT A;  1MD0 A;  2QEN A;  3IKV A;  1OMI A;  5LBQ A;  3QU6 A;  2CQK A;  1IRF A;  4IRH A;  1MJ9 A;  2QQA A;  2HZT A;  1H9T A;  2V6C A;  3IC7 A;  3RJP A;  3TGN A;  3EET A;  4ESJ A;  4IF4 A;  4XRF A;  2FMY A;  3CO6 C;  4O6J A;  3GLX A;  4UVB A;  4XLP F;  5DV5 A;  2P5K A;  3RPU A;  1SFU A;  1O3R A;  2PJP A;  1FWZ A;  2DPU A;  4AIH A;  2M87 A;  3WGI A;  1PP8 F;  2RGV A;  1FYM A;  1XMA A;  4CHU A;  3U9G A;  3I71 A;  2A68 F;  4Q48 A;  2FE3 A;  3OOP A;  1J59 A;  3ABT A;  2XV4 S;  3BP8 A;  4M9X A;  1Z7U A;  1HW5 A;  2CW0 F;  4ESF A;  1R58 A;  2PN6 A;  1JHH A;  3V7C A;  3MZY A;  4A12 A;  1ODD A;  1YW9 A;  2ZKZ A;  3CUQ B;  4L9T A;  5E8I A;  3ZQ7 A;  3T8R A;  3K1N A;  3ISP A;  5FO5 A;  4RAY A;  4M9S A;  1IAW A;  3E6D A;  5CVV A;  1D8K A;  5L3D A;  4P5O A;  2PLY A;  2ZNZ A;  3IHU A;  4DNC A;  2EV5 A;  3IRR A;  4ASN A;  5HLH A;  2KIM A;  1F1Z A;  3QPH A;  2CSO A;  1V4R A;  5A2Q K;  3VEP A;  4PDK A;  3P7N A;  3KP3 A;  4QWQ A;  1YW8 A;  4P9F A;  2M5W A;  3LA3 A;  2B0L A;  3KE2 A;  1W7P B;  2IVM A;  2V9V A;  1XGO A;  1XDU A;  1ZRF A;  1JE8 A;  5D6E A;  4UNO A;  1W4M A;  4F7Z A;  4S05 A;  1QZZ A;  3K1M A;  2FBI A;  2ZO4 A;  4AVP A;  5CJ9 A;  1I1G A;  2VT2 A;  1FPQ A;  3FXU A;  5DD4 A;  4PZJ A;  4LK1 F;  2L01 A;  2W84 A;  2E1C A;  4Z2Y A;  3BY6 A;  1KQ0 A;  1T98 A;  5CVI A;  3FMQ A;  2VOO A;  5FD5 A;  3SHF A;  2CO5 A;  4BYY A;  2D1V A;  1IXC A;  1R5G A;  2Z9O A;  2K7L A;  4ZYD A;  2Y0M A;  3C18 A;  3GFJ A;  4B09 A;  2VBX A;  4E70 A;  3GXO A;  1FC3 A;  1ZRE A;  4BHC A;  4KA4 A;  2DQR A;  2EWN A;  3PQK A;  2ZJ2 A;  2JPC A;  3V7S A;  3I5U A;  2DQL A;  1MDM B;  2HYG D;  3HIF A;  2WWY A;  4A2U A;  3WG9 A;  4BH9 A;  1F5T A;  3SFZ A;  3BOQ A;  1OKR A;  3RIR A;  1U5T B;  1Z6R A;  1X3U A;  4K2E A;  2BV6 A;  3MQ0 A;  2W25 A;  4M74 A;  1BIA A;  4CYD A;  4KN4 X;  4OIP F;  4AIJ A;  1KYW A;  4L0Z B;  4OIO F;  4I0B A;  4RB0 A;  2BGC A;  1R23 A;  1FBQ A;  3WGG A;  4RB3 C;  4FT8 A;  3TO7 A;  4HLY A;  2GWR A;  1R1T A;  2G7U A;  3I59 B;  2MH2 A;  2NS0 A;  3C7J A;  1Z6T A;  4KIC A;  2QYO A;  1BJA A;  4NB5 A;  1IRG A;  2HKX A;  4IXA A;  1ZN2 A;  5L3B A;  4A5M A;  2Y48 A;  3HOS A;  2V1X A;  1JGS A;  3LST A;  4OOI A;  2V79 A;  1ON1 A;  2XAF A;  3M1E A;  1XCB A;  2HWV A;  4HX4 A;  4LLN A;  1S8N A;  2K02 A;  5D8K B;  1UB9 A;  1AWC A;  4M71 A;  1WSU A;  1G3T A;  2PBI A;  3F8F A;  2LKP A;  5F1R A;  4UVC A;  1TBX A;  5E1Z B;  4A5N A;  2X4H A;  3WTW C;  3GYH X;  4N0B A;  2GA1 A;  3WTY C;  1V3F A;  5AON A;  5KK1 A;  5ICC A;  3JW4 A;  1U2W A;  3QPT A;  2KJB A;  3F72 A;  1O7L A;  1R00 A;  1CF7 A;  4ENJ A;  1QQI A;  1RIO H;  2M45 A;  2KJC A;  1P2F A;  5HLI A;  1IZ1 A;  2ZNY A;  4Q47 A;  5JI6 A;  2GXB A;  1DP7 P;  5K5Q A;  3WTS C;  4IRI A;  5BQT A;  2V1U A;  2UZK A;  4HX7 A;  4YG2 F;  3KZZ A;  5HDG A;  1SFX A;  1SAX A;  4G7O F;  1PDN C;  1B9M A;  5HDK A;  4GGG A;  5LGU A;  3V8L A;  3WTX C;  1QO0 D;  2DK8 A;  2P7V B;  2M30 A;  1LNW A;  1FX7 A;  1MJA A;  2QVO A;  1XD7 A;  3DPL C;  1R22 A;  3R6S A;  5EEH A;  1FBS A;  4LD5 A;  4RGU A;  2RQP A;  1VTN C;  2PI0 A;  5HS8 A;  1K79 A;  1FYK A;  3ECO A;  2A3S A;  2WV0 A;  1U6G A;  3ZMZ A;  5D5X B;  1YG2 A;  2HDC A;  4D0P A;  1TQI A;  2L02 A;  3JSO A;  2FF4 A;  4GYI A;  4LJZ F;  4ZZL A;  1P92 A;  1YO5 C;  3K9T A;  4XLN F;  1U5T C;  5J8F A;  2FQ3 A;  3DXJ F;  1KYZ A;  1XB4 A;  2O8X A;  2PMU A;  2FA5 A;  5IT3 A;  4RAZ A;  3LA2 A;  1IN4 A;  1JXS A;  3WOD F;  1KQ9 A;  2VT3 A;  4M72 A;  3U2R A;  2ZXJ A;  2WC2 A;  2ISY A;  1G6N A;  4OMY A;  3V7R A;  4HDU A;  2ADU A;  3RI4 A;  1IN6 A;  5BMZ A;  3F8C A;  3ZMS A;  4LB6 B;  3GEZ A;  1B6A A;  1O7F A;  2HYF A;  3EYI A;  1ZAR A;  3R4K A;  3I64 A;  4KT5 C;  5BPD A;  1QPM A;  1QZY A;  3F8N A;  1RUO A;  3FHZ A;  4ENN A;  3ZPL A;  4XBF A;  1SD4 A;  1WQ2 A;  3GFM A;  1XN7 A;  2KIF A;  5AIP A;  1R7J A;  4UV8 A;  3VFZ A;  2FXA A;  4HV6 A;  2EK5 A;  2D2W A;  2MLG A;  2IA0 A;  2PG4 A;  2FU4 A;  1BN5 A;  3AAF A;  1WRJ A;  3RKX A;  3GZ6 A;  4EJW A;  2DFI A;  2R7F A;  3KP2 A;  3Q9V A;  2JPB A;  3SZT A;  5D4S A;  3J7A O;  4HF1 A;  4B8X A;  1G4D A;  1L0O C;  5ILV A;  2JT1 A;  2K27 A;  5J6X A;  3R61 A;  5K1Y A;  3CLO A;  2STW A;  4KN7 X;  4MQV A;  3FXR A;  3ZMU A;  1Z05 A;  1GHC A;  4U0Y A;  3LQR A;  3SXY A;  2NYX A;  2VOP A;  5CVJ A;  2HOE A;  2ZBK A;  3DV8 A;  2VOD A;  2IRF G;  3W6K B;  2AS5 F;  1YS7 A;  3QP6 A;  3R0J A;  4FX4 A;  3MZH A;  1XSX A;  2Q0O A;  1FZP B;  3ZN0 A;  1D3Y A;  1BI1 A;  4OU0 A;  1ZH5 A;  4MQ9 F;  2XRN A;  4ZYE A;  1R36 A;  4M73 A;  3BZ6 A;  1K7A A;  2A6H F;  3F8M A;  4GCV A;  1HKT A;  5DYM A;  2CG4 A;  2XAH A;  3HSE A;  1LB2 A;  2VBY A;  4HX8 A;  4EJU A;  2OA4 A;  5FLX Z;  1RZ4 A;  3FZV A;  5BOX A;  4WXD A;  1HBX G;  5ERI A;  1B1B A;  1LDK B;  1G3S A;  2GQQ A;  4ENM A;  3L7W A;  4I09 A;  1ULY A;  2O61 A;  2J5P A;  2XHK A;  3QOP A;  1L3L A;  3T1B A;  4WK8 F;  3FWE A;  3S2W A;  3ELK A;  2RC4 A;  4YFN F;  4H0E A;  2F5E A;  4U0W A;  4MEX F;  1E17 A;  1OYY A;  2HQN A;  3CUO A;  4WWC A;  4A0Z A;  1IXS B;  3QP5 A;  3MEX A;  2ACJ A;  1IXR C;  2PMH A;  2W85 A;  1XGS A;  1K6O A;  1KU2 A;  1HXD A;  5LHH A;  3HUG A;  4XSX F;  3F8B A;  5DCF A;  4JK1 X;  3M8E A;  2OAZ A;  2EJR A;  4O5V A;  5LLQ A;  1RI7 A;  4EJO A;  3VB2 A;  2ELH A;  4RB1 A;  4AIK A;  1UHM A;  1FT9 A;  4KIF A;  1YS6 A;  2P8T A;  2PEX A;  1ZG1 A;  4YIF A;  3IRQ A;  3WU0 A;  5DEQ A;  2IT0 A;  2IA2 A;  4PGH A;  2NNN A;  3RYP A;  3J80 K;  2Z5U A;  1CF7 B;  1ZGJ A;  2HS5 A;  3TKY A;  3L2C A;  1YQA A;  1S3J A;  1XGM A;  4DQ2 A;  1C0W A;  3ABU A;  5LHG A;  3FM3 A;  5D5W B;  2GXG A;  5E1W A;  4EMS A;  2CYY A;  1QBJ A;  1T2K A;  1KGS A;  2YR2 A;  3O2P E;  4AD9 A;  4EV0 A;  2JTV A;  3HSR A;  4P96 A;  3E6C C;  2RVC A;  4YFX F;  4EJT A;  2VC0 A;  3J81 Z;  1B59 A;  4U88 A;  3BDD A;  1J2X A;  2RDP A;  5LEK A;  3DEU A;  4IHS A;  3JTG A;  2HTJ A;  1J9I A;  4MEY F;  2VXZ A;  2ZME A;  4HF2 A;  1OR7 A;  2OZU A;  4ESB A;  1D8J A;  1DDN A;  1DUX C;  4IHT A;  1U78 A;  1Q1H A;  2QZ8 A;  3EYY A;  1IUY A;  1LEB A;  1SD6 A;  3HSF A;  3QAH A;  2XAJ A;  3ROU A;  2VC1 A;  3F22 A;  4ZYG A;  1ZLK A;  4M6Y A;  4RB2 C;  1ZRD A;  4ZZD A;  1J7K A;  2HFH A;  2VE9 A;  2IPQ X;  3ZN1 A;  4Y13 A;  3M7G A;  5FFX A;  3REO A;  2TDX A;  4ETS A;  2Z99 A;  4WCG A;  3CUQ A;  3GUD A;  2EV0 A;  4EM0 B;  2JSC A;  4MTE A;  2W57 A;  2F2E A;  4HV5 A;  4S04 A;  3IWF A;  3BRO A;  2MH9 A;  3V8K A;  2JRT A;  2UXX A;  3RKY A;  3HOT A;  4ENK A;  4HBL A;  1LQ1 A;  2YX7 A;  5A2Q Z;  1S29 A;  5H6R A;  3FMS A;  2OBP A;  4A0Y A;  1CGP A;  2O6G E;  2R7D A;  3MWM A;  4I02 A;  2KKO A;  3WTZ A;  5ED4 A;  5D5V B;  2MBF A;  3I4P A;  2O0Y A;  4WXC A;  3TOB A;  1I6X A;  2UWM A;  3IWZ A;  3FXQ A;  4GYG A;  4IPA A;  4L5I A;  4EGZ A;  1B9N A;  3HHG A;  1PP7 U;  1WKM A;  3PQJ A;  3FMR A;  1W7P D;  1SMY F;  5HDN A;  1FOK A;  2P4W A;  4U7B A;  4WXH A;  4N9I A;  4WX9 A;  2DBB A;  1IN5 A;  3ZP5 A;  2H27 A;  1TNT A;  4PCQ A;  1FLI A;  1HQC A;  4Y17 A;  3F3X A;  2IJL A;  3M8F A;  2DT5 A;  2LF8 A;  5ILS A;  3P9K A;  2G7H A;  4ON0 A;  4PGG A;  2DTR A;  5IT9 K;  2H94 A;  4U7D A;  3T5X A;  2MD5 A;  1QNT A;  5FGM A;  4CIC A;  4L18 B;  1HW2 A;  4G9Y A;  1FP2 A;  5K5R A;  3IL2 A;  1T0F A;  1MZB A;  5BPI A;  1XMK A;  1R1V A;  4LLG F;  5DUI A;  4A6E A;  4LMY A;  2QBY A;  3O3K A;  3TDU C;  5E20 A;  1RUN A;  2HKO A;  1XSV A;  2IA1 A;  4FHT A;  1EV7 A;  5CVU A;  1UFM A;  1H9G A;  2JZY A;  3VOD A;  3QU3 A;  1SFE A;  3RYR A;  3HTU A;  2GIV A;  3FM5 A;  3KLN A;  3HRM A;  1ZHF A;  2RNJ A;  3I58 A;  4HAM A;  1BI2 A;  3DF8 A;  4QLC U;  4LG0 A;  2NNY A;  2A6E F;  3JTH A;  3E5U A;  1P4X A;  2L3D A;  5D6F A;  1DPU A;  4HQM A;  4KFC A;  5JR3 A;  1P4A A;  2XUB A;  4RGX A;  3R0A A;  4CO8 A;  4KIG A;  2LNB A;  3WE2 A;  1H0M A;  3WTT C;  1LJ9 A;  1T39 A;  1IF1 A;  1BI3 A;  1ZLJ A;  4MGR A;  2D45 A;  5LEJ A;  2RV8 A;  2P7C B;  5CVR A;  5LRS A;  4EM1 A;  4CXF A;  3LWF A;  1ONV A;  2DW4 A;  5L3G A;  2FBK A;  1U8R A;  3MFK A;  2FNP A;  1HSJ A;  2L4A A;  4EM2 A;  3K0L A;  2BYV E;  3IKT A;  3U1D A;  3DFG A;  4BNC A;  4ZH4 F;  1KQ8 A;  5TJJ A;  4L9N A;  1ZG3 A;  2FSW A;  3GWZ A;  3V8J A;  2A61 A;  2WTE A;  3MAJ A;  4BAY A;  4G7Z F;  3KLO A;  2ESN A;  3G3Z A;  2P6S A;  2COM A;  1EH8 A;  1R1U A;  1BM9 A;  2RN7 A;  2KRF A;  4KMU X;  2XGX A;  2ESH A;  1LVA A;  2BEO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...