4XRSG

Heterodimeric complex of transcription factors meis1 and dlx3 on specific dna
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
56
structure length
56
Chain Sequence
KPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(P*CP*AP*AP*TP*TP*AP*TP*CP*CP*TP*GP*TP*CP*AP*A)-3')
publication title DNA-dependent formation of transcription factor pairs alters their binding specificity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 7
structure length 56
sequence length 56
chains with identical sequence I
ec nomenclature
pdb deposition date 2015-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4xrsG00
3BQYA 3ZQGA 2NS8A 5EZHA 2NS7A 1DU6A 2JN6A 3IH4A 4A69C 1MSFC 4JX5A 1H88C 1X2MA 2CU7A 1JUMA 1PUFA 4IHXA 3L1PA 5J1RA 5EGOA 4S0HB 4AC0A 2H8RA 4FISA 1HCRA 1MH4A 3HOZJ 1WI3A 1B72B 4FE4A 1P7IA 2COBA 1QRYA 3UKGA 1S7EA 2DA7A 3RZOJ 2MG4A 4QSHA 2DA3A 5FKMA 4XICA 1MBEA 1WPKA 3G1OA 3QQAA 1H89C 5FJ8J 3CQZJ 3SFIA 2JK3A 5C4XJ 3OOUA 3GTJJ 3Q0UA 1HDDC 1X58A 3BG9A 1CQTA 5F0FA 3ZQHA 2ID6A 1PUFB 3HBLA 2HYJA 3Q3SA 1AU7A 1FTTA 5EGOB 3LSPA 4A3EJ 2K9SA 4I76A 4BBRJ 4DZJA 3TW7A 2IEKA 4XRSA 2NVQJ 3K2AA 1IJWC 1K83J 1Z77A 1GT0C 2DA2A 3LOCA 5BNGA 2XGEA 5IP6A 4XIDA 4M3BA 3A02A 1OFCX 4RBOA 2R5ZA 1YRNA 2EZKA 2DN0A 4DYRA 4M3DA 2QF7A 2DMUA 2QCOA 3JRHA 1ETOA 2VUMJ 5F27A 3M4OJ 5K7ZA 2FX0A 2K9QA 5EYRA 3FIWA 3JRAA 2JJ7A 3HOYJ 1GVDA 2MW8A 5K7HA 4JX4A 3GTLJ 1WCMJ 1ETKA 4NDLA 4D5CA 1OJLA 1FEXA 1JKQC 5IP9J 2CUFA 5FKNA 4D7MA 2FQ4A 5M5XJ 5EZGA 2R5ZB 1JT6A 1U9NA 4A93J 3JRFA 1VF9A 3BTLA 4M3FA 3H0GJ 5FKOA 2LFBA 1IDYA 4A3JJ 1EF4A 4AYBN 4DYCA 3BQZA 3E7LA 1IC8A 2YS9A 4B1RA 1RETA 1AHDP 4I6ZA 2O7OA 2JMWA 2R93J 1A5JA 4CYCB 1DU0A 1GUUA 5EG0B 1GDTA 1ETXA 4JYKA 1A6IA 1MBFA 5FKKA 5J1YA 2DA5A 5GP9A 4A3FJ 1IGNA 4FE7A 1B8IA 2HXIA 2VI6A 3HDDA 2HI3A 3ZQIA 3B6AA 1TWHJ 3PM1A 3WHCA 1MH3A 1Q1VA 2XGCA 3JRCA 4V2GA 3LSGA 1LFUP 1IRZA 1TWCJ 2K40A 2M9HA 5IP7J 4BY1J 2DMNA 3OSGA 2EH3A 2DMQA 2JWTA 2OPTA 4MFDA 1HF0A 1NTCA 1Y1VJ 4MO7A 3LSJA 3HGGA 3ZQLA 2D5VA 1BL0A 1VFCA 5DS9A 1B8IB 3RQIA 4ABZA 1RKTA 2JA6J 3OSFA 3S16J 5F04A 3NAUA 3TEDA 4A3DJ 2VKEA 2ME6A 1FTZA 2EZIA 2R92J 5IYCJ 3FISA 4FCYA 2JA7J 2CJJA 3Q0VA 4V2FA 1I50J 4DYQA 2TCTA 1ZKGA 5F0CA 1G2HA 3IH2A 1SANA 4J19A 3BTCA 2XB0X 5M5YJ 3O8GA 3FK7A 3SJMA 4W1UA 4BY7J 4A3MJ 2EZHA 5EDNA 3CMYA 3ZQCA 2E1OA 1VNDA 4UUSA 3BG5A 1LE8A 2B63J 3GTPJ 1BW6A 1JJ6C 2H1KA 2CQXA 2L7FP 3HOUJ 4RDUA 1JGGA 1NK3P 2AO9A 2P81A 2E2HJ 2YU9J 1WH5A 2WV1A 1XG1A 2M34A 1JKPC 1R9TJ 2LVSA 1U9OA 2VPRA 1E3OC 1T56A 2XPWA 3C2BA 3BR2A 5IYDJ 3MKLA 3HOXJ 4XRMA 3HKZN 3BR3A 3JRDA 4A3GJ 2Y30A 3JRBA 1RESA 2Y0SN 1ETWA 1JTXA 4IHYA 5GPCA 1ZGWA 3A03A 1LE8B 4UUSB 3BG3A 5FKLA 4A3BJ 1RR7A 3BT9A 1HOMA 1ETVA 4JX6A 5E3OA 1GV5A 5C44J 3S2DJ 1QVTA 1MBGA 4Y7NJ 4L5EA 2L7MP 3NARA 3OIOA 4FTHA 1U8BA 1ZR4A 5E3LA 1LFBA 1MBJA 3O8HA 1F36A 3BR1A 2M2EA 1YRNB 1MBKA 3PO3J 2OF7A 1QVUA 2Y31A 2IAIA 2L7ZA 4QTRA 4C3JJ 2I10A 3S1MJ 3F0CA 5J3LA 4D5FA 2HDDA 4D7NA 2E2JJ 2HOTA 4UUTA 1Y1WJ 3LSRA 3HM5A 1HDPA 4A3IJ 3MN2A 5F1JA 5EEAA 1IV6A 3JR9A 2G0EA 1OCTC 4A3KJ 5EF6A 1XC5A 5IPAA 4A3CJ 2N8GA 1K61A 9ANTA 1ZTRA 2LTPA 3I4MJ 3B6CA 2LD5A 5C3EJ 3G1MA 2LR8A 2NVTJ 2Y9YA 1HLVA 5DTDA 2NVXJ 4DZPA 2FD5A 5M5WJ 3S1RJ 2HXOA 3K7AJ 4MIMA 3LNQA 1RKWA 1W0UA 2IBDA 1RPWA 3CCYA 1BA5A 2CUEA 2AHQA 3GBGA 2M8GX 1ZQ3P 2XGDA 1T33A 1TWGJ 1ZR2A 2K9NA 3GTMJ 5E3MA 4XK4A 5F08A 2ECCA 3D1NI 1MNMC 3GTQJ 3H3VK 2CQQA 3S14J 3W6VA 2Y9ZA 2R0QC 2YUSA 5JLXA 3RZDJ 3HEFA 3JRGA 1BJZA 1P7JA 3HOVJ 4C2MJ 3DEWA 4MFEA 1IUFA 3DCFA 3MVPA 3IV5A 2ZB9A 4B4CA 1Z0XA 2CRGA 4XRSG 1D5YA 1JT0A 2LP0A 2ME0A 3GTOJ 2WB1N 2DMTA 4W97A 4IEJA 4QIWN 1MBHA 2LLKA 2KDZA 3PO2J 1TWAJ 2EBIA 4M3EA 4LOCA 2XB5A 5IOYA 3FK6A 4AUXA 4IHVA 5C4JJ 5J1UA 2X6OA 1MSEC 4GFBA 1I3QJ 1JJ8C 2JA8J 2DJNA 2DA1A 3CDLA 2E19A 2DA4A 5K7FA 5M3MJ 4Y52J 1JKRC 2HQ5A 2LKXA 2L0KA 1JUPA 3JRIA 2M0CA 3SDGA 3GTKJ 3FKIJ 3TP0A 1NK2P 2HOAA 2KT0A 4M3GA 2PMZN 4EEFG 5IYBJ 3ZOBA 5IOZA 3HOWJ 4X6AJ 5F0HA 1JKOC 1ETQA 2GBYA 1IDZA 2EZLA 4IHWA 1FIAA 3G1LA 3BR5A 2NVYJ 2ELKA 1OCPA 2DTZA 3BR6A 1QPIA 1ENHA 5E3NA 1W0TA 4C3IJ 1IG7A 1UMQA 2WAQN 1I6HJ 2HOSA 5GPAA 1WGXA 3VPRA 3Q0WA 2GLOA 2X48A 3A01A 1VI0A 4CYCA 1TC3C 2EQRA 2NOGA 5EG0A 1F43A 3HB9A 2ECBA 1APLC 3QPLA 2W48A 2LY9A 4X1EA 5FLMJ 1ETYA 5HODA 3QPSA 2JA5J 3BR0A 1U78A 5FLVA 4B3AA 4HNVA 2XSDC 3GTGJ 3S17J 5M3FJ 2O8KA 1POGA 2MSYA 3S2HJ 5JLWA 2XPVA 1JTYA 3TW6A 3JREA 1XS9A 1X2NA 2ID3A 1ITYA 1GV2A 3TP3A 3IH3A 3A01B 2X9DA 2R5YA 2MGQA 1AKHA 3S1QJ 3S1NJ 1TWFJ 3WHBA 4C3HJ 4DW6A 2GM4A 2DA6A 4JP0A 2XRLA 4BXXJ 1ZK8A 2XPUA 2TRTA 1H8AC 3M3YJ 3BTIA 4G12A 2DMPA 1BW5A 1UG2A 4MLOA 3BTJA 2RAEA 4BKXA 2R7ZJ 4A3LJ 2Y2ZA 2L9RA 4M6VA 3HGYA 1SFOJ 1JUSA 2VKVA 3ZQFA 1O4XA 1WH7A 1FJLA 3RKQA 1B72A 2E2IJ 2O9LA 2R5YB 3I4NJ 1UHSA 2LK2A 1AKHB 4BBSJ 1ORKA 3S15J 2FJ1A 1FIPA
chains in the Genus database with same CATH superfamily
4WK8F 2DTRA 2HZTA 5EZHA 5DYMA 3T5XA 4IXAA 1X2MA 2H1LA 3IC7A 5J1RA 1FPQA 4UXNA 4P9UA 1GLNA 3HZJA 2V9VA 5D5XB 4LJZF 3VYTB 1R4NB 4ESBA 3MZ8A 4I02A 2V6EA 1B72B 1O7LA 1ONVA 1XMXA 2X6WA 5ICFA 5FKMA 3KIOA 4EJWA 2E34A 1QNTA 3QQAA 4KIBA 2ZC2A 2JVHA 5C4XJ 1E2XA 2Z16A 3BG9A 3DXJF 5L3BA 3HBLA 2FEZA 5F6FA 1DQUA 2PX9A 2K9LA 3IKTA 4DZJA 1BI0A 4HX7A 4O5VA 1F4KA 1MZBA 1QZZA 1X1AA 2UXNA 2K9SA 1N75A 2KMUA 2IEKA 4BBRJ 4BS9A 4XRSA 2M0MA 2OUMA 3CUOA 2KHMA 3K2AA 4PSXA 1GT0C 5BNGA 1EJ9A 1T8IA 3A02A 1E3PA 5HLGA 4XOPA 3EUAA 5DM7F 4RBOA 3CP8A 3DEEA 3RPUD 5BMZA 4LG0A 2HDWA 2QCOA 2E71A 1ETOA 1Y39A 4ZDLA 1E3HA 5HOOA 1A35A 3CUQA 4HX4A 4AYBA 5K7ZA 2FX0A 3OWTA 3ZMSA 4BGDA 1SAXA 1UCRA 3KEYA 1WJ5A 3OYGA 4CDGA 2RGVA 4HOBA 2LBFB 2VJJA 5D5VB 2JJ7A 5H2FC 4LLLA 4X0GA 3HRUA 1R58A 4JX4A 4U87A 1ETKA 2RC4A 1WHUA 5J4VA 1OJLA 1FEXA 1JKQC 1BI2A 3OIQA 1Y6IA 5M5XJ 1MGTA 1X1DA 3L00A 2DOEA 1YIJI 3SXYA 3BTLA 1VQ5I 3SZTA 3H0GJ 2ACJA 2F4OB 4R1HA 2LFBA 2Z1DA 1IDYA 1S9HA 4A3JJ 4XLPF 4WF2A 2O61A 4KMUX 5B1AH 2VJIA 2VASA 3OYIA 4CCNA 2VJ4A 2QUFA 2FSWA 3IHUA 4HLYA 2QLZA 2XAGA 1G3WA 1IO2A 2VN2A 1W5CC 1EV7A 1GDTA 3MZHA 1U6GA 5F1RA 1YS7A 4MEXF 4C2TA 4JYKA 3DTEA 3CF2A 1X1PA 2DA5A 4A3FJ 2BZTA 1N25A 3OYFA 1B8IA 2IPQX 3MKZA 3ELKA 3HDDA 1UHWA 3FBIB 3WU1B 1A31A 4L0ZB 3M1CA 1OISA 3J7YJ 3S3MA 2IVMA 3ZXSA 4V2GA 2ZMEA 4IHSA 2DCEA 1B59A 1B6AA 2X1CA 2UV1A 1WKMA 2DMNA 3OSGA 2PFBA 3ISPA 2L3DA 2MBFA 2EH3A 3RCOA 4F7ZA 2QVOA 4EM2A 2XAHA 2A6EF 2GIVA 2RDPA 3MWMA 2BHZA 2KFDA 2ZSIB 3HGGA 4XSZF 3HJEA 4RAZA 5LLQA 4NC7A 2HPIA 3ZQLA 1YJ9I 2IT0A 3NEUA 1B8IB 2R7OA 4F52A 4IRIA 4V19K 1RKTA 4N9HA 1J9IA 3BJ6A 3HPHA 5F04A 3NAUA 4A3DJ 1I5ZA 2QQ8A 5LHGA 1QQIA 4ENJA 3R61A 4RAYA 2COMA 2HPMA 3W6JB 4ON0A 5IYCJ 5HS8A 3SZGA 1W36D 2OD5A 1YOVB 4XORA 4FCYA 3REOA 2P5VA 1HC8A 1G2HA 1SANA 5IT3A 4J19A 2R3SA 4XLCA 4KT5C 2DOFA 3O8GA 3H0DA 2V9PA 3SJMA 2V1NA 3U1KA 3UNGC 3CMYA 4YFXF 2WY7Q 2E1OA 4UUSA 1T38A 1KU2A 2R7UA 3D5LA 5DUIA 3QU3A 2LF7A 1ZGJA 3IRRA 2L7FP 5D8LB 2DODA 3TKYA 5H6RA 4ZDOA 3PQJA 1ZRDA 2F4MB 2E2HJ 1XGOA 3ZRGA 1XG1A 2LVSA 1PUEE 2XGXA 2VBWA 1VZ0A 3QU6A 4RM2A 2W25A 4M9SA 1WFXA 3BR2A 2E1MC 1Z7UA 3PSIA 5FRMA 3HOXJ 4L9VA 2BE5F 4DJAA 5B3SH 3MQ0A 4ANJA 1U2WA 3BR3A 1O57A 3WG9A 2VONA 4A3GJ 4AVZA 3RJPA 2XIGA 1ETWA 1ZGWA 1VQLI 4UUSB 2QSGX 2LY1A 3ZN0A 3FXLA 2QQBA 2V1UA 3BT9A 4A0ZA 4JK1X 1NG7A 1HW2A 4PGHA 4Y7NJ 2FBHA 2GQQA 2L7MP 2H94A 1DP3A 2DO7A 2RN7A 2BVMA 3HUGA 4LITA 6PAXA 4BHPA 1BOAA 1MJ9A 1YRNB 5JR3A 3ASOH 4IO9F 3C7JA 3CLQA 2A07F 1SFXA 4E7HA 3I71A 1ZH5A 2WA0A 1H9TA 2HDDA 1XGMA 4D7NA 1J09A 1Y8QB 4R8HA 4HPQA 3RYPA 4UUTA 3HM5A 4LMYA 2EFPA 1ZHFA 1IV6A 2EV6A 2G0EA 3I53A 1OCTC 2QA4I 2PLYA 3QAHA 3HHGA 1KU9A 1IW7F 1XC5A 3EYIA 3HUGB 3ABTA 3FWEA 1P4XA 4A3CJ 1QU3A 2FUG2 5CYVA 2L01A 2E35A 1FBQA 4BACA 3L2QA 2R7RA 1YW9A 4L5IA 5FRNA 3GCMA 2XC7A 2BXZA 2EILH 5J47A 2WADA 3BCAA 5C3EJ 1J0RA 3G1MA 2LR8A 1FBUA 2Y9YA 3CLOA 5D4RA 2EFWA 3L9FA 4RB1A 3J7AY 3K4BA 3U2RA 2FMYA 3T8RA 4XOTA 5K1YA 3CCQI 3ERED 2Y0MA 2L4AA 3C2GA 2JUGA 3H1CA 3KE2A 4JQFA 4Y4RA 1W0UA 1RPWA 4CCMA 3JAMK 1ZQ3P 3F8BA 1OCZH 2Z2SB 1ZR2A 4NUBA 4XK4A 3G2BA 3D1NI 3W6KB 1MNMC 1VQ4I 3M1EA 3WE2A 3S14J 3M07A 2R7VA 3IWZA 4HNUA 2YUSA 3RZDJ 1P7JA 4C2MJ 3DBRB 3DEWA 4BE0A 5AIPA 3GEZA 4G6QA 3RKYA 3AAFA 3DCFA 3GO5A 4IHTA 2YR2A 3TO6A 1ZG1A 2RNGA 4XRSG 1UFMA 1D5YA 1GHCA 1QZYA 4ENNA 2ZXHA 1IN4A 1DGWY 3H3UA 2WB1N 2DMTA 4YELA 3ZMUA 4ENMA 2L2OA 3J81Z 5J6XA 2DAOA 3H5AA 1SVLA 1GVJA 2W00A 2HZDA 1IRGA 2E7XA 2XB5A 1HSJA 1IRFA 5IOYA 3L2VA 4Q5SF 4IHVA 2VBYA 4E7JA 4XLFA 3BZCA 3IL2A 3S2WA 1T2KA 1Z05A 2E19A 2Z99A 2DA4A 1FT9A 5M3MJ 2M1BA 4LG3A 2ZJ2A 2CQ7A 1KU7A 1IF1A 3PNVA 3QYBA 4RLQA 4EJTA 3CP2A 1OYWA 3S3OA 1ZN2A 2L9VA 3HSFA 3ABLH 3FKIJ 4LLNA 3TP0A 2VQGA 3H5RA 3F3XA 4KN7X 1F5TA 3OYLA 4G9YA 2IW5A 2L7KA 2H09A 4RGSA 4F91B 3K4NA 5IOZA 3KP5A 4Y3OA 4BEHA 3W2VA 2IS4A 2GBYA 3T0YA 1OQYA 1P2FA 5E8GA 4YEJA 4IHWA 3I0TA 4IOAF 3G1LA 1SD5A 3E5UA 3VFZA 5K5OA 2CWEA 4OWRB 1OCPA 5HS7A 4A12A 4GDFA 1D3YA 2UXXA 1LVAA 3GUDA 1P92A 1DPRA 2XAQA 1Z9CA 1I6HJ 2DT7B 2HOSA 4HW0A 3CCEI 4NHJA 1G6NA 1X1BA 4IF4A 3WTXC 3V7RA 4M71A 3HRSA 2EA2A 2K3PA 1YS6A 3VPRA 5HDKA 3A01A 1XPXA 3SEQA 2DYSH 1VI0A 1KZHA 2M45A 4XRFA 3BG6A 1FSHA 2FNAA 3HB9A 2ECBA 2W4SA 2CS3A 1YITI 1JHHA 3QPLA 2LY9A 4X1EA 1HW1A 4UB6C 2A3SA 5FLMJ 1NG6A 4WX9A 3K6GA 2HYFA 4HNVA 2XSDC 3S17J 2IGNA 4S05A 2JRTA 2O8KA 1POGA 1N77A 2MSYA 3S2HJ 3E3VA 3GW2A 3JREA 5DM6F 2M7BA 3P7NA 3MFKA 2CG4A 2PI0A 1ITYA 1BC8C 3A01B 4LB6B 3DBHB 3PL8A 4IX7A 1G3TA 3DF8A 3G3ZA 2MGQA 1TWFJ 4C3HJ 2R7DA 5CJ9A 4DW6A 4RLFA 4KA4A 3OV8A 4JP0A 1PP8F 3OIPA 2CQKA 3L09A 1XDUA 2EINH 1LNWA 3M3YJ 1D1AA 1MNEA 4BDYA 1YE9A 4P96A 3PJRA 2DMPA 3V7CA 1BW5A 1ZLJA 1V5GA 2RAEA 4II3A 4XBFA 4BKXA 3CCSI 4A3LJ 1R1TA 1LVKA 2L9RA 3E5QA 3Q9VA 4M6VA 4L9TA 1RRJA 1LB2A 1ZLKA 1MW7A 3HTUA 3OL3A 2L9NA 1PVEA 1J59A 1WH7A 3KCCA 3I4NJ 3HOTA 2LK2A 5B1BH 5ICGA 3BG7A 3O2PE 2PBIA 2KJCA 4PFPA 1W5TA 1JI8A 3CDHA 1FIPA 3VEPA 4L5JA 4XLAA 2HQNA 4HF2A 3ZQGA 2NS8A 3AG1H 2O8XA 1E0EA 4XR6A 5LGTA 3LWFA 5FO5A 3DPTA 3IH4A 3ZMDA 3HXLA 2CU7A 3I56I 4RMNA 4EQQA 3F6VA 3L1PA 1I3AA 4IHXA 1MMSA 1FP2A 2FOKA 4XKBA 5EGOA 1HCRA 3I58A 3N97A 1VQOI 3IP4B 1H0MA 2C6YA 1S7EA 2DA7A 3RZOJ 2W82A 2DA3A 3I64A 1IXRC 5BPDA 1RUOA 3UR3C 1WPKA 2M87A 3DKXA 1H89C 3SFIA 2JK3A 2R7TA 4H0EA 1Y56A 1HDDC 2QENA 2ZNYA 4RB0A 1PYVA 5LGNA 2Q1ZB 2IP2A 3GZNB 5F0FA 1CQTA 3ZQHA 4CXFA 2ID6A 1J5YA 2CSOA 5LEKA 1FTTA 5EGOB 4A3EJ 4I76A 1BN5A 3TW7A 3NWTA 1X3ZB 4BQQA 1LDDA 1Z77A 2VKDA 4LD5A 4M6YA 3PUBA 2IS2A 1SVOA 5HDNA 4M3BA 3ML6A 3KYLA 4ZYEA 4DYRA 4M3DA 2XROA 2QF7A 3JRHA 1WI9A 2CH0A 4LK0F 2VUMJ 3EYYA 2V7FA 2A6TA 3ABMH 1W36C 2D1VA 3RTRA 2ZJPF 2IGOA 1R00A 4PJNA 1ZYRF 3HRTA 4HA8A 2K9QA 2F5FA 3DKYA 5HNFA 5ILUA 1DP7P 3FIWA 2R7QA 3HOYJ 4QWQA 1GVDA 1IV8A 3I3LA 3GTLJ 3BC8A 3AL0B 4D7MA 2FQ4A 1FP1D 5EZGA 4RAGA 1YG2A 1O3RA 3KYDB 3GFLA 2LY2A 4M3FA 4ZYDA 2KKOA 3CJNA 1JGSA 3M7GA 2O3FA 1V5EA 2LSOA 3X2QH 4DYCA 3VYRB 5LD2C 3SZPA 4KJZA 2YS9A 1RETA 2B9SA 2JMWA 2R93J 4BYYA 1RNLA 3OYCA 1R49A 1FSEA 4CYCB 1DU0A 1GUUA 2NVUB 5EG0B 1D1CA 2LRDA 1MJAA 5FKKA 4CICA 2NNYA 1ZG5A 2JTVA 2ZXJA 3K0LA 1IGNA 1TW3A 2HI3A 1WVRA 1K4TA 4Z6YA 1P4WA 1TWHJ 5J4YA 1X4PA 4AIDA 4IOCF 3OYDA 1Q1VA 3CC2I 5HLIA 2CFOA 2AQFA 4AVPA 3OYNA 2LMDA 2OCEA 3H5NA 5D6FA 1LFUP 2QSFX 3E6CC 1YYVA 1QGPA 4NBQA 1TWCJ 2K40A 2M9HA 2BGCA 5IP7J 3MEXA 4WXDA 2DDBA 2NAZA 3K1MA 1T0FC 5LHHA 4FQGA 1WRJA 5CVRA 1Y1VJ 5HVQC 2DW4A 4MO7A 3LSJA 2G7HA 2VL8A 2D5VA 1KGSA 1VFCA 1BIBA 5JHUA 4DQ2A 1M1EB 1NHAA 1A6QA 2DLLA 2JA6J 4LLGF 3OSFA 2M4KA 3TEDA 5DEQA 3G71I 2GXGA 2EZIA 1T08B 3I59A 4ZJZA 4OINF 3CJRB 2Q2EA 3CCMI 4BJ6C 3V42A 3W3CA 2EA4A 2CJJA 3M8EA 3CCUI 4NC8A 1A36A 1S3JA 3EPZA 2LF8A 4KISA 2FQ3A 1Z3XA 2MA3A 4BHCA 4G7ZF 2PN6A 3FK7A 3C2HA 5CKTA 3ZPLA 1KA8A 3RSNA 2EZHA 5B5EC 4HQEA 4XKVA 2OTLI 5IT9Z 5B66C 3GTPJ 3N4MA 3ERMA 3FXKA 2UZKA 3HOUJ 3I59B 1EH6A 4HBLA 1NK3P 2AO9A 2IA1A 2Q2EB 2HTJA 3QOEA 2P81A 1HW5A 3ULQB 2YU9J 2M34A 3AG3H 1JKPC 2FE3A 4LFUA 1R9TJ 1B1BA 2XKPA 1U9OA 2H27A 4NC6A 1T56A 3C2BA 1VQKI 3CO7C 2A69F 1TQPA 2MYSA 3HKZN 3JTGA 1T6SA 3ZQQA 1RESA 3JRBA 3CCRI 2Y0SN 4IHYA 1G8XA 5GAHJ 2WAQA 3A03A 3A0HC 3AG2H 1VQNI 3FM5A 2P4WA 1SC7A 2ICWG 1ODDA 1Z1DA 1D5VA 4IVNA 4FETA 5CQGA 1ETVA 1HOMA 1GV5A 3D5SC 5C44J 2JRMA 2VT2A 4EGYA 3KEOA 1ZR4A 3S3NA 2XVCA 1LPQA 1FOWA 4HLXA 3GMEA 2NNNA 3WU2C 3HYIA 4CHUA 1N78A 4LG0B 2DJIA 4C3JJ 3DU6A 3KLNA 3H92A 1KQ8A 3S1MJ 1YJWI 3CUQB 4EV0A 4GGGA 2KISA 4D5FA 4MTDA 2VQLA 2E2JJ 2QWWA 4KT6A 2EPFA 5K5RA 1HDPA 1UZCA 2ZFUA 4HF0A 2A68F 5EF6A 1V5FA 5BOXA 3M8FA 2N8GA 2VBZA 2GXAA 2E36A 3CESA 3DKWA 1STZA 4NNJA 1WJEA 1ZTRA 3GLXA 3K4LA 3I4MJ 3B6CA 2LD5A 3FMRA 5CVUA 4PGGA 3LSHA 3FDYA 4B3XA 4PZJA 4DZPA 2FD5A 2K4BA 2Z3YA 3T1BA 2K7LA 5M5WJ 5JHFA 3S1RJ 1VQ7I 1OCOH 3WTUC 4PSWA 4MTEA 4II2A 3TO9A 4H4KC 2ETHA 4HQMA 3LNQA 2FA5A 4HYEA 2R7SA 1ULYA 2OQGA 1BA5A 1QHHD 1ZG3A 3DV8A 2P5KA 2RQPA 4BUPA 2AHQA 1W1WE 3I54A 2WB1A 2XGDA 2KIUA 3ZN1A 3WGIA 1YIOA 5E3MA 5E20A 1OKRA 4A5NA 2KP6A 3E6BA 2F2EA 4HSRA 2XRNA 2ZMEB 3GFMA 3GTQJ 3F8FA 4RM3A 3W6VA 2Y9ZA 2R0QC 3TBIA 5JLXA 1FY7A 3HEFA 4AD9A 1BJZA 4EM0B 3HOVJ 5J8CA 2FRHA 1KONA 1SAUA 1YQAA 2NXNB 1SFKA 5EJCA 2FF4A 2CRGA 4LIUA 2ISZA 1JT0A 2ZXWH 3D5RC 3OYJA 1HKQA 2NRAC 3C1DA 4QIWN 1MMDA 1MBHA 4P55A 4UY8I 3CTAA 2LLKA 4CCOA 1TWAJ 1R7JA 2ZKZA 3E1SA 2AQEA 2EBIA 4EMSA 4LOCA 2ESHA 1D0ZA 4RS8A 2CW0F 2X6OA 4GFBA 1XD7A 1I3QJ 4A0XA 4DOZA 1JJ8C 2JA2A 2JA8J 4RGRA 3CDLA 2KPMA 1WJBA 2PJRA 1JKRC 4HZFA 1FX7A 2E7WA 4DIQA 2QBYA 3I4PA 2LKXA 3LSTA 2EIMH 1G4DA 2A6HF 3JRIA 3QP5A 4HF1A 3JSOA 2Y48A 3V8LA 2A05A 3HSRA 1NK2P 1FOKA 4XKWA 5AIQA 2HQAA 4KICA 1IRXA 4EEFG 3HOWJ 4U7BA 1I6XA 1IZ1A 5L3FA 4HDVA 4XKCA 2PMHA 4X6AJ 1ETQA 1QZEA 2BOLA 4KYWA 1IDZA 4OIQF 4BL0B 4ZZLA 1S7AA 2F5VA 2NVYJ 3KFWX 3NRVA 2DDAA 2PJRB 2ELKA 5KK1A 4RA2A 4U0VA 2QBYB 1QPIA 2STTA 1RR8C 4KIFA 2KQRA 2V26A 3H35A 1OR7C 4P5OA 2HKOA 2HEOA 1K7AA 2WAQN 3QYEA 2DI3A 4XN0A 4MEYF 5GPAA 4A2UA 4BJ5C 1WGXA 3K4CA 3DTIA 4P1WA 2LC2A 4XLEA 1IXCA 3LSKA 3Q0WA 2X48A 3ZP5A 2GLOA 5LBQA 3D0SA 2WWYA 3HHHA 1ZRFA 5L3EA 4Q47A 2DQLA 2D2WA 2HTSA 2X6XA 2EB7A 3EUHC 2JA5J 1QPMA 3P9CA 3BR0A 2ZBKA 3R0JA 1CGPA 5FLVA 4B3AA 2CMPA 3C18A 2FBKA 4UV8A 2OV7A 1BI1A 3P9KA 1LEAA 3EDPA 5JLWA 2XPVA 1JTYA 3I55I 3TW6A 4XQFA 2UWMA 3H9GA 3CMEI 3LFKA 3HOSA 3HL2A 3TP3A 3S32A 1FYKA 3ONQA 3WHBA 3TDUC 4BE2A 4F55A 2DA6A 3SFZA 3KZYA 5LRSA 2XRLA 3DLLF 2KIFA 1AOYA 3L2CA 2WTEA 2VOPA 2K4JA 4N9IA 4BXUA 4BXFA 4CO8A 4G8XA 3FXRA 3BTJA 2R7ZJ 3LA3A 3PQKA 3VYSB 2CYYA 2XUBA 2PEXA 3ECHA 3ZQFA 2BHYA 3RKQA 1P6RA 2ZNZA 1TW2A 5LEJA 3QP6A 1TZLA 3OS0A 1SFUA 2Y75A 4Y33A 2P8TA 2JZYA 2V1DA 3QWLA 4YFKF 2V1XA 1T95A 1O7FA 1SD4A 3FMSA 5FGMA 1DU6A 1HKTA 1MSFC 4JX5A 1JUMA 3SYTA 2M8EA 3ZQ7A 1LEBA 3BROA 2GWRA 2E5NA 3A4CA 4S0HB 4AC0A 3OR1C 2RREA 4KDPA 2YU3A 2A61A 2BY0A 4OAYA 4OIRF 2OU2A 1MJBA 1P7IA 1ZARA 2AXTC 3BP8A 2W85A 4FE4A 4UVCA 3JAMZ 2UUZA 4QLCU 1RUNA 3TL4X 4QSHA 2BY2A 2O0YA 2PMUA 5EEHA 5J40A 4XICA 1MBEA 5FJ8J 2A5WA 2ZO4A 5FB2A 1IUYA 3OOUA 3GTJJ 5EEGA 4AM3A 3PFYA 5H6QA 1OYYA 2P6SA 4RAFA 3CCLI 3QPHA 3LSPA 2VQCA 3F6OA 2QEXI 1XSXA 2EV5A 5ILSA 1LJ9A 2H6CA 3BWGA 2NVQJ 5GTHC 2F5CA 2X1EA 1S6LA 5BS6A 2HWVA 3E0JB 3BOQA 3CMAI 3ABKH 3CJQB 1UB9A 3LOCA 4J00A 3SQNA 4NQWA 3TDZC 2XGEA 1IN6A 5IP6A 4XIDA 2IRFG 1OFCX 4DNCA 2DN0A 1UHMA 4CCKA 1YTYA 1KYWA 5L3DA 2RNJA 2W57A 5F27A 3L2RA 5FFZA 2WAFA 1XN7A 1XSVA 1Z6RA 1IN5A 1ON2A 3PIPF 1X3UA 3LAJA 5LFAA 3VB2A 4UVBA 2HS5A 4M9XA 3ZCOA 4EJOA 3TOAA 2BVLA 1WCMJ 4BEHB 5TJJA 1ZREA 4NDLA 4D5CA 4NQWB 1Y0UA 2CUFA 3KZZA 1JT6A 1VF9A 2XAFA 3HIFA 4OMYA 5FKOA 2OZUA 5KHDA 2STWA 3CUQC 3IAM2 4J01A 3BQZA 3E7LA 3MD2A 1MMGA 3DQVC 2VE8A 3VOEA 4B1RA 1AHDP 1RZ4A 2O7OA 2CW8A 3K4KA 2R7FA 1X3WB 1A5JA 1C0WA 3BPXA 4L9NA 3E6MA 3ZR8X 3VDXA 4YG2F 3H36A 4CGZA 1A6IA 1MBFA 5J1YA 1GXQA 3KP3A 1B9NA 5ICCA 2QGUA 3ZQIA 3DLAA 1TQMA 3WHCA 1TQIA 2XGCA 4GO1A 1XB4A 3MKYB 3JRCA 1VQ9I 1Q1HA 1YI2I 1AWCA 4I98B 2WAEA 2XSJC 5CVJA 4CCJA 3T8TA 1IRZA 2HDCA 2KIMA 1IAWA 4AIHA 2JWTA 5A2QK 2J5PA 2R4GA 2RV8A 1HF0A 3G6EI 2XDVA 2E60A 5LGUA 3OL4A 5KVRA 1VQ8I 1BL0A 3GZ6A 1VQMI 1XMAA 1T98A 2LG4A 2TDXA 4WXCA 2DYRH 5ERIA 2QYOA 4ABZA 4XLHA 4IQJA 3LA2A 2WBMA 2ZMEC 1MMNA 2HVQA 2R92J 3WTYC 4BQNA 2DFEA 1UG0A 1BBYA 3LMMA 4B43A 3K70D 2DQRA 2GOXB 1A04A 1BR1A 3FISA 1P9QC 2Z33A 2JA7J 4V2FA 1I50J 3K4MA 2HOEA 4FASD 3WTZA 1ZKGA 1D0XA 5F0CA 4BJTA 5FROA 1WJDA 2XB0X 3RKWA 3HKZA 2GA2A 1U5TA 4W1UA 1WSUA 1Z67A 4BY7J 2Y0SA 1EH8A 4A5MA 3DP7A 5A2QZ 2B63J 2MABA 1BW6A 5JVTA 2FOWA 1TNSA 3OR2C 2MLKA 2QQ9A 4RDUA 5D5UB 4AU7A 1MDMA 1WH5A 2P6TA 1YW8A 2WV1A 3CC7I 3K9TA 3FHZA 2VPRA 4XN3A 2XPWA 5IYDJ 3MKLA 4PUSA 2LREA 3BY6A 3CZ6A 4XRMA 2MH2A 4CZCA 2LKSA 3JCUC 3JRDA 1WWXA 2R7XA 4CH7A 1U5TB 2X85A 4CYDA 5GPCA 5ICEA 4E7ZA 5E1WA 3V7SA 2MC4A 4CSWA 1VQPI 3CMMA 2CV1A 3IUOA 5FKLA 1ZAOA 4PJJA 4A3BJ 2DT5A 3GLLA 3K1NA 1F9NA 2A5YB 2IGMA 1QVTA 1FYMA 3F9KA 4IJAA 2G7UA 2L9SA 2LNBA 1MDMB 3W2AA 4L5EA 3KLOA 3M9AA 3OIOA 4N4NB 4UNOA 5E3LA 1LFBA 3K2ZA 1MBJA 1F36A 3BR1A 1NH3A 2M2EA 3HC7A 4LGWA 3HSEA 5DV5A 2IAIA 2L7ZA 3GXOA 1YHQI 4BAYA 1R6RA 2MLGA 1K6OA 3KP7A 2I10A 1R1UA 3F0CA 1T39A 1SD7A 4U0WA 1HXDA 4I01A 2HOTA 2M7AA 1IXSB 2DXIA 1Y1WJ 4PJMA 3LSRA 3BCBA 1BR4A 5GAGJ 5F1JA 2JQ7A 3JR9A 4A3KJ 5CVVA 1X4OA 5IPAA 2IA2A 4EM1A 2DFIA 4N4OB 3U21A 2HNHA 2RKHA 9ANTA 4KIGA 1D1BA 3IWFA 3ZMVA 2GIZA 2ELJA 2LTPA 2X6YA 3I5UA 3FZVA 5DCFA 3CCVI 3KETA 2NVTJ 4I0BA 3R60A 3PNYA 4RGUA 1TT0A 4PFOA 1IN7A 1D8KA 3IKVA 4EJUA 2VB6A 1K78A 3K7AJ 3LL7A 1FLIA 2CV0A 4MIMA 5FLXK 4L9JA 4M9ZA 1R5ID 1RKWA 4LB5A 4F93B 2IBDA 3CCYA 1XGSA 3GYHX 3KPHA 4HG2A 1LFPA 3I9V2 4U88A 2AS5F 1B9MA 3GBGA 3SEZA 1TWGJ 2K9NA 3GTMJ 2GZWA 3B02A 5F08A 5K5QA 2ECCA 1U0JA 2KL4A 2RQQA 4ZDPA 3MCZA 2KDOA 3H3VK 4EJVA 1Z21A 1XGNA 2L5QA 4L0YB 5E1ZB 2PQ8A 3S93A 1SEUA 2J5OA 4CUGA 2OQRA 3JRGA 5HS9A 3DBLB 1YO5C 1ON1A 1S29A 2MH9A 4MFEA 4BU2A 3MVPA 4JOMA 3Q9SA 2BY1A 3TOBA 2NOJB 2XF7A 1XMKA 4B4CA 5ILVA 2LOOA 3IV5A 4I0AA 3WE3A 4FX4A 2B7EA 2MD0A 4E70A 2VIXA 3MZYA 4I99C 3GTOJ 1RC9A 2VXDA 1MD0A 4GYGA 4IEJA 5FLXZ 4PJLA 1PJRA 2WC2A 3PO2J 2Y69H 1D8JA 4YRVA 1X1CA 3GWZA 3TO7A 2W1OA 2DFHA 3FK6A 4AUXA 5J1UA 1MSEC 4XONA 4TV7A 2O5RA 1OCRH 4D0PA 2DA1A 2Q8KA 4DBRA 4FHTA 3FX3A 3KYCB 4E7SA 1TTYA 4PK4A 3W2WA 1V3FA 2OTJI 2CV2A 1QHGA 4Y13A 3JTHA 2M0CA 3GTKJ 3FBNB 4C2UA 1R5GA 5HNHA 1KU3A 4ESJA 4ZC3A 4M3GA 3F21A 2LBFA 1O3TA 2X51A 4MHGA 4AWXB 2ADUA 2F5EA 2E5ZA 4GXOA 5F0HA 1JKOC 3ZMZA 2LKPA 5L3CA 2EZLA 4C9YA 3F8CA 1I1GA 1FIAA 2VBXA 3FXQA 2LDUA 1FMWA 1EH7A 4DBQA 3BR5A 2AXLA 1ERDA 3WODF 1JE8A 3BR6A 2V6CA 1DPUA 1F1ZA 2HQRA 2QQAA 2VT3A 1ENHA 1WZ2A 3IAS2 3WGGA 1W0TA 4C3IJ 1IG7A 2EK5A 4AIJA 2P0WA 3FXUA 1XX5A 3AKZA 1GXPA 1OMIA 4MQVA 3RPUA 2VOOA 4XL9A 2NOGA 1TLHB 1F43A 4F3QA 5GADJ 1APLC 1R5HA 3V4GA 3SHFA 3J80K 4B44A 2HKXA 1OCCH 1SFEA 4MQ9F 3VYUB 4YFNF 3FKJA 1U78A 5ED4A 2CQNA 1B4AA 3RQ4A 3J7AO 5CVIA 3R6SA 2WY8Q 3OS2A 4ZYGA 4XMYA 4IRHA 2MD5A 3AFHA 2EJRA 2R7WA 3RI4A 5KNLA 3Q5FA 1L3LA 1X2NA 2ID3A 4OMZA 4BDZA 3ZMTA 1GV2A 2K9MA 4L18B 3IH3A 4KNYA 3JW4A 2K3FA 4PCQA 1KYZA 1R1VA 2CFXA 4ZH4F 3S1NJ 3S1QJ 3K4JA 2GM4A 1XCVA 2M3AA 4IPAA 1UJ8A 1LDJA 1KQ9A 2TRTA 5DD4A 5LHIA 1YX5A 2QKLB 4G12A 2OCCH 5J8FA 1BM9A 4I7HA 2BEOA 3O3KA 1V54H 2VJ5A 2K5CA 3J80Z 1SFOJ 2JUCA 1JUSA 2VKVA 4E7KA 5CPRB 4C30A 4G7HF 5DCMA 1FJLA 1OPCA 2JPBA 2EFOA 3OYMA 2D45A 2O9LA 2ZJQF 2EIJH 3H9JA 2Z5UA 4M72A 2NYXA 1J75A 4BBSJ 1ORKA 2GXBA 3QYFA 1QBJA 4HDUA 2XKOA 1R71A 5E18F 1P4AA 3FM3A 2ELHA 3BQYA 3QODA 4EVIA 2NS7A 2JN6A 2GAUA 4A69C 1H88C 1PUFA 4RGXA 2VLAA 2HR3A 4HAMA 1PDNC 2H8RA 4FISA 5E79C 5DCMB 4YIFA 1MH4A 3L2WA 5D8KB 4OIOF 4CA0A 1YX3A 5CQEA 1HSTA 3OS1A 3HOZJ 1WI3A 2COBA 1QRYA 3VSLA 3UKGA 4G6TB 2MG4A 2OJED 1CF7A 1LDKB 3KEQA 3PNTA 5TRDA 3G1OA 3CQZJ 3GFJA 3MAJA 2BBYA 1YLFA 4Z2YA 1I39A 2QKMB 3Q0UA 4MGRA 5D6EA 3LFUA 1X58A 2ZSHB 3VWBA 2VC0A 2O6GE 1PUFB 3Q3SA 2HYJA 2K27A 4R79A 1Z6TA 1AU7A 3BJAA 4ZTFA 3FXMA 2VXZA 1IN8A 1TBXA 5E1XA 3LSIA 1IJWC 3BPVA 1K83J 2E1CA 2DA2A 1CF7B 1G59A 4IZZA 1S7OA 2R5ZA 4BQOA 1YRNA 1OYIA 2DK5A 2EZKA 4ENKA 4O3MA 2JSPA 2HVRA 4GRIA 1U5TC 2DMUA 2DOAA 5FFXA 4AIKA 2B0LA 3K70C 2X0LA 1MKMA 2G9WA 4IKFA 3M4OJ 1BIAA 1EKEA 3KX2A 4JBAA 2IGKA 1Z3YA 2FMLA 5EYRA 1R23A 2ZFWA 3JRAA 2KRHA 3GX4X 4DGWB 2MW8A 1ZRCA 3PFIA 5K7HA 1KQ0A 2CUZA 2OBPA 2ZCWA 2VC1A 1YJNI 3CO6C 1O3QA 5IP9J 3RKXA 4KITB 3AL0C 5FKNA 1LQ1A 3S8PA 2R5ZB 3A1YA 1U9NA 4HRIA 4A93J 3JRFA 2KLOA 2LYCA 3GVAA 3QRFF 3NWSA 3OYEA 2DK8A 4GCVA 1EF4A 3FMQA 4OU0A 3H3ZA 4AYBN 1XSDA 4LIVA 3R0AA 5GAEJ 3KP2A 4I09A 1J7KA 1IC8A 1I27A 2O03A 1R22A 4I6ZA 1K4SA 3WG7H 3DFGA 2HFHA 2MFZA 4ETSA 2XV4S 1T0FA 1Y8RB 2EWNA 3A2KA 1R36A 1ETXA 3B73A 1LKXA 1R4MB 1E17A 5GP9A 4FE7A 2DBBA 4A0YA 3F8NA 2HXIA 2VI6A 1RI7A 3AG4H 3B6AA 3PM1A 1UAAA 1MH3A 3ECOA 5DD8A 1FOXA 3FXOA 3LSGA 2VODA 1XDSA 4OOIA 2V4JC 3U9GA 1FWZA 4BY1J 2H6BA 3COAC 4IRGA 1HA8A 5DDGA 3J81K 2DMQA 3KZIC 2OPTA 3PIOF 1ACIA 4MFDA 3CD6I 1NTCA 2I5UA 4QPQA 4KMFA 4K2EA 2DT6A 4FT8A 5DS9A 4P9FA 3RQIA 5DUKA 2W84A 3A0BC 3IRQA 4ZZDA 3L2UA 1DGRM 2QM3A 3S16J 1TP4A 3V8JA 2VKEA 2ME6A 1FTZA 2ISYA 2I8DA 3DPUA 2ESNA 2BY3A 4U0YA 3Q0VA 4DYQA 3N05A 2TCTA 3OMYA 2PJPA 3EETA 4IQ4A 4BQAA 3JSPA 2HU9A 3IH2A 3DTKA 3BTCA 1W7PD 2KRFA 4Y15A 5M5YJ 4O6JA 4N0BA 1QA6A 3TGNA 4BE1A 1DUXC 4A3MJ 2Q0OA 3HPGA 5EDNA 3ZQCA 3E97A 4HNTA 5AONA 1VNDA 1LE8A 3BG5A 3H9QA 1XTAA 4E7LA 2BV6A 3KP4A 1JJ6C 2H1KA 2PMZA 4LK1F 1MIJA 2CQXA 1W7PA 2K02A 2F48A 3F8MA 1JGGA 2E1NA 5TGTA 1G3YA 3C3WA 4I2OA 1E3OC 5H20A 4UHTA 4CCLA 4ZYAA 3GFIA 2X1DA 5GTIC 2Y30A 1UELB 3WU0A 1JTXA 5D5WB 4U7DA 1LE8B 3BG3A 2EIKH 4D9JA 3O6BB 2HVSA 4Q48A 5KCMA 2M30A 3E6DA 1RR7A 2XHKA 4G7OF 4JX6A 5E3OA 1W7PB 2OAZA 3OYKA 3S2DJ 1MBGA 1QO0D 1USTA 1ZELA 4FTHA 3NARA 1U8BA 1U8RA 4WWCA 3O8HA 1VQ6I 2DPDA 2DU9A 4XNFA 3LQQA 1VTNC 1SD6A 1SMTA 1BJAA 1HQCA 1MBKA 2GA1A 2BYVE 2OF7A 1DDNA 3PO3J 2IS6A 1QVUA 2Y31A 2XAJA 3L7WA 2JSCA 4QTRA 1BR2A 5L3GA 4ESFA 1X19A 1FYLA 1V4RA 4UB8C 4Y17A 1O3SA 5J3LA 2M5WA 3HRMA 4B09A 1FOYA 4Q4ZF 2VPLA 3KP6A 4A3IJ 4HX8A 3MN2A 5EEAA 4HV5A 4MNUA 2HGCA 5IY5H 1MNDA 4E6KG 1BOBA 2H8WA 2KJBA 4NB5A 4BHBA 2DPUA 4M74A 1K61A 1WJAA 2JT1A 3BZKA 5D4SA 5KAFC 2CO5A 2ZXIA 4KN4X 3ZGKA 1FNNA 1FC3A 3DWLE 5BQTA 5HLTA 2FXAA 3P9IA 1HLVA 2K85A 5DTDA 4ZYHA 3QOPA 3ROUA 4A6DA 2NVXJ 3R4KA 4FX0A 3OYBA 4M6XA 2JVGA 1G3SA 2HXOA 2CUJA 3GZ5A 4D1QA 2KIQA 3P5JA 4G94A 4EGZA 3VODA 1REPC 1Z91A 1BI3A 4B8XA 1YFHA 5E17F 3DU5A 3J7ZI 4UUVA 2F5DA 2VQHA 1EA3A 4IL6C 5FD5A 3E5XA 2CUEA 5HDGA 3WTTC 2IXSA 2M8GX 4KFCA 2YSRA 1T33A 1HBXG 3QPTA 5E8IA 3OYHA 2P7CB 3FXJA 2VE9A 2CQQA 4EATA 2XF6A 3EUKL 3TQNA 1PP7U 4UV9A 2KZVA 2BXYA 1FMVA 3TMOA 2L54A 3MMYB 2GOMA 1IUFA 2FBIA 2BW3A 2ZB9A 4F92B 2IS1A 1Z0XA 4B48A 1K79A 3OOPA 2LP0A 2IA0A 2ME0A 4XLNF 3CCJI 4KUMA 3GF2A 4W97A 5JFRA 1H9GA 1ZGAA 4XM3A 2ZJRF 1TL8A 2CGPA 2KDZA 3DPLC 4GYIA 4WCGA 3ABUA 2KRCA 1K6YA 4M3EA 1FBSA 4B47A 3HG9A 3BDDA 4BH9A 2QZ8A 4ZTJA 1V55H 3LQRA 2NS0A 5C4JJ 3BJOA 2EFNA 3SDBA 1RIOH 3LAPA 2F4IA 2QSHX 3FHNA 2DJNA 3CF5F 1J2XA 4G6DA 3VSKA 5K7FA 3CDIA 4OAZA 3CC4I 4Y52J 1HKSA 2E1MB 2BW3B 2HQ5A 1L0OC 2X4HA 3RYRA 2L0KA 1JUPA 2L02A 3LA7A 1OR7A 3SDGA 3WTSC 4S04A 1D0YA 1BC7C 4CZZA 2OC6A 5CLSA 2M4GA 4BNCA 1WJCA 1S5LC 2HOAA 2KT0A 2V79A 3WTVC 4HEA2 1SVMA 5JI6A 1YW7A 2PMZN 4RB3C 4RB2C 5TISC 5IYBJ 1MMAA 3ZOBA 5KAIC 2PG4A 2IJLA 2P7VB 3G4SI 1FZPB 2XASA 3U1DA 3EUHA 3K69A 2VKHA 3K1PA 2DTZA 3M8JA 2WV0A 5FD6A 2HYGD 2K86A 5E3NA 4OIPF 1UMQA 2DFFA 4PJ0C 4XSXF 3PSFA 3F23A 1W5SA 3OYAA 3PUFA 3OY9A 4CYCA 3DEUA 2MC3A 1TC3C 2EQRA 2OA4A 3F22A 2EV0A 5EG0A 2W7NA 2W48A 1AA7A 2YPRA 3ESWB 1ETYA 5HODA 2F6CA 3QPSA 3EQLF 3CJTB 3V8KA 3F72A 2EFQA 4E4HA 3GTGJ 1USSA 5M3FJ 1WJFA 1JHFA 4A6EA 4HV6A 5F64A 1XS9A 1JXSA 4QPOA 2FU4A 2V9KA 3WGHA 2X9DA 1U3EM 1SMYF 3RPQA 2R5YA 2LH9A 4ASNA 1AKHA 3BZ6A 1Y0NA 3ASNH 5BPIA 3HTSB 1W4MA 3FF5A 4M73A 5HLHA 3K10A 4BXXJ 1ZK8A 2XPUA 1S72I 3G73A 1H8AC 2FNPA 2XAUA 3BTIA 1UG2A 4MLOA 3BLYA 1Z7LA 4WXHA 4E7IA 3RIRA 4HSTA 2Y2ZA 1OLTA 4PDKA 3HGYA 2D1HA 1I1SA 1XCBA 1O4XA 3MKWB 2KZGA 2RVCA 2L4MA 2YX4A 1WQ2A 4YIRX 2OZ6A 2YX7A 1B72A 2E2IJ 2R5YB 5JVGF 1UHSA 3NQOA 2XF5A 2P5LC 4UVAA 1AKHB 5IT9K 2CW7A 1K78B 2W24A 2JPCA 2Z9OA 4YIIA 1TNTA 3S15J 3LSMA 2FJ1A 1LUJB 3RDIA 3WTWC 1S8NA 4ITVA 5LRRA 1TT5B
chains in the Genus database with same CATH topology
3BQYA 3ZQGA 2NS8A 5EZHA 2NS7A 1DU6A 2JN6A 3IH4A 4A69C 1MSFC 4JX5A 1H88C 1X2MA 2CU7A 1JUMA 1PUFA 4IHXA 3L1PA 5J1RA 5EGOA 4S0HB 4AC0A 2H8RA 4FISA 1HCRA 1MH4A 3HOZJ 1WI3A 1B72B 4FE4A 1P7IA 2COBA 1QRYA 3UKGA 1S7EA 2DA7A 3RZOJ 2MG4A 4QSHA 2DA3A 5FKMA 4XICA 1MBEA 1WPKA 3G1OA 3QQAA 1H89C 5FJ8J 3CQZJ 3SFIA 2JK3A 5C4XJ 3OOUA 3GTJJ 3Q0UA 1HDDC 1X58A 3BG9A 1CQTA 5F0FA 3ZQHA 2ID6A 1PUFB 3HBLA 2HYJA 3Q3SA 1AU7A 1FTTA 5EGOB 3LSPA 4A3EJ 2K9SA 4I76A 4BBRJ 4DZJA 3TW7A 2IEKA 4XRSA 2NVQJ 3K2AA 1IJWC 1K83J 1Z77A 1GT0C 2DA2A 3LOCA 5BNGA 2XGEA 5IP6A 4XIDA 4M3BA 3A02A 1OFCX 4RBOA 2R5ZA 1YRNA 2EZKA 2DN0A 4DYRA 4M3DA 2QF7A 2DMUA 2QCOA 3JRHA 1ETOA 2VUMJ 5F27A 3M4OJ 5K7ZA 2FX0A 2K9QA 5EYRA 3FIWA 3JRAA 2JJ7A 3HOYJ 1GVDA 2MW8A 5K7HA 4JX4A 3GTLJ 1WCMJ 1ETKA 4NDLA 4D5CA 1OJLA 1FEXA 1JKQC 5IP9J 2CUFA 5FKNA 4D7MA 2FQ4A 5M5XJ 5EZGA 2R5ZB 1JT6A 1U9NA 4A93J 3JRFA 1VF9A 3BTLA 4M3FA 3H0GJ 5FKOA 2LFBA 1IDYA 4A3JJ 1EF4A 4AYBN 4DYCA 3BQZA 3E7LA 1IC8A 2YS9A 4B1RA 1RETA 1AHDP 4I6ZA 2O7OA 2JMWA 2R93J 1A5JA 4CYCB 1DU0A 1GUUA 5EG0B 1GDTA 1ETXA 4JYKA 1A6IA 1MBFA 5FKKA 5J1YA 2DA5A 5GP9A 4A3FJ 1IGNA 4FE7A 1B8IA 2HXIA 2VI6A 3HDDA 2HI3A 3ZQIA 3B6AA 1TWHJ 3PM1A 3WHCA 1MH3A 1Q1VA 2XGCA 3JRCA 4V2GA 3LSGA 1LFUP 1IRZA 1TWCJ 2K40A 2M9HA 5IP7J 4BY1J 2DMNA 3OSGA 2EH3A 2DMQA 2JWTA 2OPTA 4MFDA 1HF0A 1NTCA 1Y1VJ 4MO7A 3LSJA 3HGGA 3ZQLA 2D5VA 1BL0A 1VFCA 5DS9A 1B8IB 3RQIA 4ABZA 1RKTA 2JA6J 3OSFA 3S16J 5F04A 3NAUA 3TEDA 4A3DJ 2VKEA 2ME6A 1FTZA 2EZIA 2R92J 5IYCJ 3FISA 4FCYA 2JA7J 2CJJA 3Q0VA 4V2FA 1I50J 4DYQA 2TCTA 1ZKGA 5F0CA 1G2HA 3IH2A 1SANA 4J19A 3BTCA 2XB0X 5M5YJ 3O8GA 3FK7A 3SJMA 4W1UA 4BY7J 4A3MJ 2EZHA 5EDNA 3CMYA 3ZQCA 2E1OA 1VNDA 4UUSA 3BG5A 1LE8A 2B63J 3GTPJ 1BW6A 1JJ6C 2H1KA 2CQXA 2L7FP 3HOUJ 4RDUA 1JGGA 1NK3P 2AO9A 2P81A 2E2HJ 2YU9J 1WH5A 2WV1A 1XG1A 2M34A 1JKPC 1R9TJ 2LVSA 1U9OA 2VPRA 1E3OC 1T56A 2XPWA 3C2BA 3BR2A 5IYDJ 3MKLA 3HOXJ 4XRMA 3HKZN 3BR3A 3JRDA 4A3GJ 2Y30A 3JRBA 1RESA 2Y0SN 1ETWA 1JTXA 4IHYA 5GPCA 1ZGWA 3A03A 1LE8B 4UUSB 3BG3A 5FKLA 4A3BJ 1RR7A 3BT9A 1HOMA 1ETVA 4JX6A 5E3OA 1GV5A 5C44J 3S2DJ 1QVTA 1MBGA 4Y7NJ 4L5EA 2L7MP 3NARA 3OIOA 4FTHA 1U8BA 1ZR4A 5E3LA 1LFBA 1MBJA 3O8HA 1F36A 3BR1A 2M2EA 1YRNB 1MBKA 3PO3J 2OF7A 1QVUA 2Y31A 2IAIA 2L7ZA 4QTRA 4C3JJ 2I10A 3S1MJ 3F0CA 5J3LA 4D5FA 2HDDA 4D7NA 2E2JJ 2HOTA 4UUTA 1Y1WJ 3LSRA 3HM5A 1HDPA 4A3IJ 3MN2A 5F1JA 5EEAA 1IV6A 3JR9A 2G0EA 1OCTC 4A3KJ 5EF6A 1XC5A 5IPAA 4A3CJ 2N8GA 1K61A 9ANTA 1ZTRA 2LTPA 3I4MJ 3B6CA 2LD5A 5C3EJ 3G1MA 2LR8A 2NVTJ 2Y9YA 1HLVA 5DTDA 2NVXJ 4DZPA 2FD5A 5M5WJ 3S1RJ 2HXOA 3K7AJ 4MIMA 3LNQA 1RKWA 1W0UA 2IBDA 1RPWA 3CCYA 1BA5A 2CUEA 2AHQA 3GBGA 2M8GX 1ZQ3P 2XGDA 1T33A 1TWGJ 1ZR2A 2K9NA 3GTMJ 5E3MA 4XK4A 5F08A 2ECCA 3D1NI 1MNMC 3GTQJ 3H3VK 2CQQA 3S14J 3W6VA 2Y9ZA 2R0QC 2YUSA 5JLXA 3RZDJ 3HEFA 3JRGA 1BJZA 1P7JA 3HOVJ 4C2MJ 3DEWA 4MFEA 1IUFA 3DCFA 3MVPA 3IV5A 2ZB9A 4B4CA 1Z0XA 2CRGA 4XRSG 1D5YA 1JT0A 2LP0A 2ME0A 3GTOJ 2WB1N 2DMTA 4W97A 4IEJA 4QIWN 1MBHA 2LLKA 2KDZA 3PO2J 1TWAJ 2EBIA 4M3EA 4LOCA 2XB5A 5IOYA 3FK6A 4AUXA 4IHVA 5C4JJ 5J1UA 2X6OA 1MSEC 4GFBA 1I3QJ 1JJ8C 2JA8J 2DJNA 2DA1A 3CDLA 2E19A 2DA4A 5K7FA 5M3MJ 4Y52J 1JKRC 2HQ5A 2LKXA 2L0KA 1JUPA 3JRIA 2M0CA 3SDGA 3GTKJ 3FKIJ 3TP0A 1NK2P 2HOAA 2KT0A 4M3GA 2PMZN 4EEFG 5IYBJ 3ZOBA 5IOZA 3HOWJ 4X6AJ 5F0HA 1JKOC 1ETQA 2GBYA 1IDZA 2EZLA 4IHWA 1FIAA 3G1LA 3BR5A 2NVYJ 2ELKA 1OCPA 2DTZA 3BR6A 1QPIA 1ENHA 5E3NA 1W0TA 4C3IJ 1IG7A 1UMQA 2WAQN 1I6HJ 2HOSA 5GPAA 1WGXA 3VPRA 3Q0WA 2GLOA 2X48A 3A01A 1VI0A 4CYCA 1TC3C 2EQRA 2NOGA 5EG0A 1F43A 3HB9A 2ECBA 1APLC 3QPLA 2W48A 2LY9A 4X1EA 5FLMJ 1ETYA 5HODA 3QPSA 2JA5J 3BR0A 1U78A 5FLVA 4B3AA 4HNVA 2XSDC 3GTGJ 3S17J 5M3FJ 2O8KA 1POGA 2MSYA 3S2HJ 5JLWA 2XPVA 1JTYA 3TW6A 3JREA 1XS9A 1X2NA 2ID3A 1ITYA 1GV2A 3TP3A 3IH3A 3A01B 2X9DA 2R5YA 2MGQA 1AKHA 3S1QJ 3S1NJ 1TWFJ 3WHBA 4C3HJ 4DW6A 2GM4A 2DA6A 4JP0A 2XRLA 4BXXJ 1ZK8A 2XPUA 2TRTA 1H8AC 3M3YJ 3BTIA 4G12A 2DMPA 1BW5A 1UG2A 4MLOA 3BTJA 2RAEA 4BKXA 2R7ZJ 4A3LJ 2Y2ZA 2L9RA 4M6VA 3HGYA 1SFOJ 1JUSA 2VKVA 3ZQFA 1O4XA 1WH7A 1FJLA 3RKQA 1B72A 2E2IJ 2O9LA 2R5YB 3I4NJ 1UHSA 2LK2A 1AKHB 4BBSJ 1ORKA 3S15J 2FJ1A 1FIPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BQY A;  3ZQG A;  2NS8 A;  5EZH A;  2NS7 A;  1DU6 A;  2JN6 A;  3IH4 A;  4A69 C;  1MSF C;  4JX5 A;  1H88 C;  1X2M A;  2CU7 A;  1JUM A;  1PUF A;  4IHX A;  3L1P A;  5J1R A;  5EGO A;  4S0H B;  4AC0 A;  2H8R A;  4FIS A;  1HCR A;  1MH4 A;  3HOZ J;  1WI3 A;  1B72 B;  4FE4 A;  1P7I A;  2COB A;  1QRY A;  3UKG A;  1S7E A;  2DA7 A;  3RZO J;  2MG4 A;  4QSH A;  2DA3 A;  5FKM A;  4XIC A;  1MBE A;  1WPK A;  3G1O A;  3QQA A;  1H89 C;  5FJ8 J;  3CQZ J;  3SFI A;  2JK3 A;  5C4X J;  3OOU A;  3GTJ J;  3Q0U A;  1HDD C;  1X58 A;  3BG9 A;  1CQT A;  5F0F A;  3ZQH A;  2ID6 A;  1PUF B;  3HBL A;  2HYJ A;  3Q3S A;  1AU7 A;  1FTT A;  5EGO B;  3LSP A;  4A3E J;  2K9S A;  4I76 A;  4BBR J;  4DZJ A;  3TW7 A;  2IEK A;  4XRS A;  2NVQ J;  3K2A A;  1IJW C;  1K83 J;  1Z77 A;  1GT0 C;  2DA2 A;  3LOC A;  5BNG A;  2XGE A;  5IP6 A;  4XID A;  4M3B A;  3A02 A;  1OFC X;  4RBO A;  2R5Z A;  1YRN A;  2EZK A;  2DN0 A;  4DYR A;  4M3D A;  2QF7 A;  2DMU A;  2QCO A;  3JRH A;  1ETO A;  2VUM J;  5F27 A;  3M4O J;  5K7Z A;  2FX0 A;  2K9Q A;  5EYR A;  3FIW A;  3JRA A;  2JJ7 A;  3HOY J;  1GVD A;  2MW8 A;  5K7H A;  4JX4 A;  3GTL J;  1WCM J;  1ETK A;  4NDL A;  4D5C A;  1OJL A;  1FEX A;  1JKQ C;  5IP9 J;  2CUF A;  5FKN A;  4D7M A;  2FQ4 A;  5M5X J;  5EZG A;  2R5Z B;  1JT6 A;  1U9N A;  4A93 J;  3JRF A;  1VF9 A;  3BTL A;  4M3F A;  3H0G J;  5FKO A;  2LFB A;  1IDY A;  4A3J J;  1EF4 A;  4AYB N;  4DYC A;  3BQZ A;  3E7L A;  1IC8 A;  2YS9 A;  4B1R A;  1RET A;  1AHD P;  4I6Z A;  2O7O A;  2JMW A;  2R93 J;  1A5J A;  4CYC B;  1DU0 A;  1GUU A;  5EG0 B;  1GDT A;  1ETX A;  4JYK A;  1A6I A;  1MBF A;  5FKK A;  5J1Y A;  2DA5 A;  5GP9 A;  4A3F J;  1IGN A;  4FE7 A;  1B8I A;  2HXI A;  2VI6 A;  3HDD A;  2HI3 A;  3ZQI A;  3B6A A;  1TWH J;  3PM1 A;  3WHC A;  1MH3 A;  1Q1V A;  2XGC A;  3JRC A;  4V2G A;  3LSG A;  1LFU P;  1IRZ A;  1TWC J;  2K40 A;  2M9H A;  5IP7 J;  4BY1 J;  2DMN A;  3OSG A;  2EH3 A;  2DMQ A;  2JWT A;  2OPT A;  4MFD A;  1HF0 A;  1NTC A;  1Y1V J;  4MO7 A;  3LSJ A;  3HGG A;  3ZQL A;  2D5V A;  1BL0 A;  1VFC A;  5DS9 A;  1B8I B;  3RQI A;  4ABZ A;  1RKT A;  2JA6 J;  3OSF A;  3S16 J;  5F04 A;  3NAU A;  3TED A;  4A3D J;  2VKE A;  2ME6 A;  1FTZ A;  2EZI A;  2R92 J;  5IYC J;  3FIS A;  4FCY A;  2JA7 J;  2CJJ A;  3Q0V A;  4V2F A;  1I50 J;  4DYQ A;  2TCT A;  1ZKG A;  5F0C A;  1G2H A;  3IH2 A;  1SAN A;  4J19 A;  3BTC A;  2XB0 X;  5M5Y J;  3O8G A;  3FK7 A;  3SJM A;  4W1U A;  4BY7 J;  4A3M J;  2EZH A;  5EDN A;  3CMY A;  3ZQC A;  2E1O A;  1VND A;  4UUS A;  3BG5 A;  1LE8 A;  2B63 J;  3GTP J;  1BW6 A;  1JJ6 C;  2H1K A;  2CQX A;  2L7F P;  3HOU J;  4RDU A;  1JGG A;  1NK3 P;  2AO9 A;  2P81 A;  2E2H J;  2YU9 J;  1WH5 A;  2WV1 A;  1XG1 A;  2M34 A;  1JKP C;  1R9T J;  2LVS A;  1U9O A;  2VPR A;  1E3O C;  1T56 A;  2XPW A;  3C2B A;  3BR2 A;  5IYD J;  3MKL A;  3HOX J;  4XRM A;  3HKZ N;  3BR3 A;  3JRD A;  4A3G J;  2Y30 A;  3JRB A;  1RES A;  2Y0S N;  1ETW A;  1JTX A;  4IHY A;  5GPC A;  1ZGW A;  3A03 A;  1LE8 B;  4UUS B;  3BG3 A;  5FKL A;  4A3B J;  1RR7 A;  3BT9 A;  1HOM A;  1ETV A;  4JX6 A;  5E3O A;  1GV5 A;  5C44 J;  3S2D J;  1QVT A;  1MBG A;  4Y7N J;  4L5E A;  2L7M P;  3NAR A;  3OIO A;  4FTH A;  1U8B A;  1ZR4 A;  5E3L A;  1LFB A;  1MBJ A;  3O8H A;  1F36 A;  3BR1 A;  2M2E A;  1YRN B;  1MBK A;  3PO3 J;  2OF7 A;  1QVU A;  2Y31 A;  2IAI A;  2L7Z A;  4QTR A;  4C3J J;  2I10 A;  3S1M J;  3F0C A;  5J3L A;  4D5F A;  2HDD A;  4D7N A;  2E2J J;  2HOT A;  4UUT A;  1Y1W J;  3LSR A;  3HM5 A;  1HDP A;  4A3I J;  3MN2 A;  5F1J A;  5EEA A;  1IV6 A;  3JR9 A;  2G0E A;  1OCT C;  4A3K J;  5EF6 A;  1XC5 A;  5IPA A;  4A3C J;  2N8G A;  1K61 A;  9ANT A;  1ZTR A;  2LTP A;  3I4M J;  3B6C A;  2LD5 A;  5C3E J;  3G1M A;  2LR8 A;  2NVT J;  2Y9Y A;  1HLV A;  5DTD A;  2NVX J;  4DZP A;  2FD5 A;  5M5W J;  3S1R J;  2HXO A;  3K7A J;  4MIM A;  3LNQ A;  1RKW A;  1W0U A;  2IBD A;  1RPW A;  3CCY A;  1BA5 A;  2CUE A;  2AHQ A;  3GBG A;  2M8G X;  1ZQ3 P;  2XGD A;  1T33 A;  1TWG J;  1ZR2 A;  2K9N A;  3GTM J;  5E3M A;  4XK4 A;  5F08 A;  2ECC A;  3D1N I;  1MNM C;  3GTQ J;  3H3V K;  2CQQ A;  3S14 J;  3W6V A;  2Y9Z A;  2R0Q C;  2YUS A;  5JLX A;  3RZD J;  3HEF A;  3JRG A;  1BJZ A;  1P7J A;  3HOV J;  4C2M J;  3DEW A;  4MFE A;  1IUF A;  3DCF A;  3MVP A;  3IV5 A;  2ZB9 A;  4B4C A;  1Z0X A;  2CRG A;  4XRS G;  1D5Y A;  1JT0 A;  2LP0 A;  2ME0 A;  3GTO J;  2WB1 N;  2DMT A;  4W97 A;  4IEJ A;  4QIW N;  1MBH A;  2LLK A;  2KDZ A;  3PO2 J;  1TWA J;  2EBI A;  4M3E A;  4LOC A;  2XB5 A;  5IOY A;  3FK6 A;  4AUX A;  4IHV A;  5C4J J;  5J1U A;  2X6O A;  1MSE C;  4GFB A;  1I3Q J;  1JJ8 C;  2JA8 J;  2DJN A;  2DA1 A;  3CDL A;  2E19 A;  2DA4 A;  5K7F A;  5M3M J;  4Y52 J;  1JKR C;  2HQ5 A;  2LKX A;  2L0K A;  1JUP A;  3JRI A;  2M0C A;  3SDG A;  3GTK J;  3FKI J;  3TP0 A;  1NK2 P;  2HOA A;  2KT0 A;  4M3G A;  2PMZ N;  4EEF G;  5IYB J;  3ZOB A;  5IOZ A;  3HOW J;  4X6A J;  5F0H A;  1JKO C;  1ETQ A;  2GBY A;  1IDZ A;  2EZL A;  4IHW A;  1FIA A;  3G1L A;  3BR5 A;  2NVY J;  2ELK A;  1OCP A;  2DTZ A;  3BR6 A;  1QPI A;  1ENH A;  5E3N A;  1W0T A;  4C3I J;  1IG7 A;  1UMQ A;  2WAQ N;  1I6H J;  2HOS A;  5GPA A;  1WGX A;  3VPR A;  3Q0W A;  2GLO A;  2X48 A;  3A01 A;  1VI0 A;  4CYC A;  1TC3 C;  2EQR A;  2NOG A;  5EG0 A;  1F43 A;  3HB9 A;  2ECB A;  1APL C;  3QPL A;  2W48 A;  2LY9 A;  4X1E A;  5FLM J;  1ETY A;  5HOD A;  3QPS A;  2JA5 J;  3BR0 A;  1U78 A;  5FLV A;  4B3A A;  4HNV A;  2XSD C;  3GTG J;  3S17 J;  5M3F J;  2O8K A;  1POG A;  2MSY A;  3S2H J;  5JLW A;  2XPV A;  1JTY A;  3TW6 A;  3JRE A;  1XS9 A;  1X2N A;  2ID3 A;  1ITY A;  1GV2 A;  3TP3 A;  3IH3 A;  3A01 B;  2X9D A;  2R5Y A;  2MGQ A;  1AKH A;  3S1Q J;  3S1N J;  1TWF J;  3WHB A;  4C3H J;  4DW6 A;  2GM4 A;  2DA6 A;  4JP0 A;  2XRL A;  4BXX J;  1ZK8 A;  2XPU A;  2TRT A;  1H8A C;  3M3Y J;  3BTI A;  4G12 A;  2DMP A;  1BW5 A;  1UG2 A;  4MLO A;  3BTJ A;  2RAE A;  4BKX A;  2R7Z J;  4A3L J;  2Y2Z A;  2L9R A;  4M6V A;  3HGY A;  1SFO J;  1JUS A;  2VKV A;  3ZQF A;  1O4X A;  1WH7 A;  1FJL A;  3RKQ A;  1B72 A;  2E2I J;  2O9L A;  2R5Y B;  3I4N J;  1UHS A;  2LK2 A;  1AKH B;  4BBS J;  1ORK A;  3S15 J;  2FJ1 A;  1FIP A; 
#chains in the Genus database with same CATH topology
 4WK8 F;  2DTR A;  2HZT A;  5EZH A;  5DYM A;  3T5X A;  4IXA A;  1X2M A;  2H1L A;  3IC7 A;  5J1R A;  1FPQ A;  4UXN A;  4P9U A;  1GLN A;  3HZJ A;  2V9V A;  5D5X B;  4LJZ F;  3VYT B;  1R4N B;  4ESB A;  3MZ8 A;  4I02 A;  2V6E A;  1B72 B;  1O7L A;  1ONV A;  1XMX A;  2X6W A;  5ICF A;  5FKM A;  3KIO A;  4EJW A;  2E34 A;  1QNT A;  3QQA A;  4KIB A;  2ZC2 A;  2JVH A;  5C4X J;  1E2X A;  2Z16 A;  3BG9 A;  3DXJ F;  5L3B A;  3HBL A;  2FEZ A;  5F6F A;  1DQU A;  2PX9 A;  2K9L A;  3IKT A;  4DZJ A;  1BI0 A;  4HX7 A;  4O5V A;  1F4K A;  1MZB A;  1QZZ A;  1X1A A;  2UXN A;  2K9S A;  1N75 A;  2KMU A;  2IEK A;  4BBR J;  4BS9 A;  4XRS A;  2M0M A;  2OUM A;  3CUO A;  2KHM A;  3K2A A;  4PSX A;  1GT0 C;  5BNG A;  1EJ9 A;  1T8I A;  3A02 A;  1E3P A;  5HLG A;  4XOP A;  3EUA A;  5DM7 F;  4RBO A;  3CP8 A;  3DEE A;  3RPU D;  5BMZ A;  4LG0 A;  2HDW A;  2QCO A;  2E71 A;  1ETO A;  1Y39 A;  4ZDL A;  1E3H A;  5HOO A;  1A35 A;  3CUQ A;  4HX4 A;  4AYB A;  5K7Z A;  2FX0 A;  3OWT A;  3ZMS A;  4BGD A;  1SAX A;  1UCR A;  3KEY A;  1WJ5 A;  3OYG A;  4CDG A;  2RGV A;  4HOB A;  2LBF B;  2VJJ A;  5D5V B;  2JJ7 A;  5H2F C;  4LLL A;  4X0G A;  3HRU A;  1R58 A;  4JX4 A;  4U87 A;  1ETK A;  2RC4 A;  1WHU A;  5J4V A;  1OJL A;  1FEX A;  1JKQ C;  1BI2 A;  3OIQ A;  1Y6I A;  5M5X J;  1MGT A;  1X1D A;  3L00 A;  2DOE A;  1YIJ I;  3SXY A;  3BTL A;  1VQ5 I;  3SZT A;  3H0G J;  2ACJ A;  2F4O B;  4R1H A;  2LFB A;  2Z1D A;  1IDY A;  1S9H A;  4A3J J;  4XLP F;  4WF2 A;  2O61 A;  4KMU X;  5B1A H;  2VJI A;  2VAS A;  3OYI A;  4CCN A;  2VJ4 A;  2QUF A;  2FSW A;  3IHU A;  4HLY A;  2QLZ A;  2XAG A;  1G3W A;  1IO2 A;  2VN2 A;  1W5C C;  1EV7 A;  1GDT A;  3MZH A;  1U6G A;  5F1R A;  1YS7 A;  4MEX F;  4C2T A;  4JYK A;  3DTE A;  3CF2 A;  1X1P A;  2DA5 A;  4A3F J;  2BZT A;  1N25 A;  3OYF A;  1B8I A;  2IPQ X;  3MKZ A;  3ELK A;  3HDD A;  1UHW A;  3FBI B;  3WU1 B;  1A31 A;  4L0Z B;  3M1C A;  1OIS A;  3J7Y J;  3S3M A;  2IVM A;  3ZXS A;  4V2G A;  2ZME A;  4IHS A;  2DCE A;  1B59 A;  1B6A A;  2X1C A;  2UV1 A;  1WKM A;  2DMN A;  3OSG A;  2PFB A;  3ISP A;  2L3D A;  2MBF A;  2EH3 A;  3RCO A;  4F7Z A;  2QVO A;  4EM2 A;  2XAH A;  2A6E F;  2GIV A;  2RDP A;  3MWM A;  2BHZ A;  2KFD A;  2ZSI B;  3HGG A;  4XSZ F;  3HJE A;  4RAZ A;  5LLQ A;  4NC7 A;  2HPI A;  3ZQL A;  1YJ9 I;  2IT0 A;  3NEU A;  1B8I B;  2R7O A;  4F52 A;  4IRI A;  4V19 K;  1RKT A;  4N9H A;  1J9I A;  3BJ6 A;  3HPH A;  5F04 A;  3NAU A;  4A3D J;  1I5Z A;  2QQ8 A;  5LHG A;  1QQI A;  4ENJ A;  3R61 A;  4RAY A;  2COM A;  2HPM A;  3W6J B;  4ON0 A;  5IYC J;  5HS8 A;  3SZG A;  1W36 D;  2OD5 A;  1YOV B;  4XOR A;  4FCY A;  3REO A;  2P5V A;  1HC8 A;  1G2H A;  1SAN A;  5IT3 A;  4J19 A;  2R3S A;  4XLC A;  4KT5 C;  2DOF A;  3O8G A;  3H0D A;  2V9P A;  3SJM A;  2V1N A;  3U1K A;  3UNG C;  3CMY A;  4YFX F;  2WY7 Q;  2E1O A;  4UUS A;  1T38 A;  1KU2 A;  2R7U A;  3D5L A;  5DUI A;  3QU3 A;  2LF7 A;  1ZGJ A;  3IRR A;  2L7F P;  5D8L B;  2DOD A;  3TKY A;  5H6R A;  4ZDO A;  3PQJ A;  1ZRD A;  2F4M B;  2E2H J;  1XGO A;  3ZRG A;  1XG1 A;  2LVS A;  1PUE E;  2XGX A;  2VBW A;  1VZ0 A;  3QU6 A;  4RM2 A;  2W25 A;  4M9S A;  1WFX A;  3BR2 A;  2E1M C;  1Z7U A;  3PSI A;  5FRM A;  3HOX J;  4L9V A;  2BE5 F;  4DJA A;  5B3S H;  3MQ0 A;  4ANJ A;  1U2W A;  3BR3 A;  1O57 A;  3WG9 A;  2VON A;  4A3G J;  4AVZ A;  3RJP A;  2XIG A;  1ETW A;  1ZGW A;  1VQL I;  4UUS B;  2QSG X;  2LY1 A;  3ZN0 A;  3FXL A;  2QQB A;  2V1U A;  3BT9 A;  4A0Z A;  4JK1 X;  1NG7 A;  1HW2 A;  4PGH A;  4Y7N J;  2FBH A;  2GQQ A;  2L7M P;  2H94 A;  1DP3 A;  2DO7 A;  2RN7 A;  2BVM A;  3HUG A;  4LIT A;  6PAX A;  4BHP A;  1BOA A;  1MJ9 A;  1YRN B;  5JR3 A;  3ASO H;  4IO9 F;  3C7J A;  3CLQ A;  2A07 F;  1SFX A;  4E7H A;  3I71 A;  1ZH5 A;  2WA0 A;  1H9T A;  2HDD A;  1XGM A;  4D7N A;  1J09 A;  1Y8Q B;  4R8H A;  4HPQ A;  3RYP A;  4UUT A;  3HM5 A;  4LMY A;  2EFP A;  1ZHF A;  1IV6 A;  2EV6 A;  2G0E A;  3I53 A;  1OCT C;  2QA4 I;  2PLY A;  3QAH A;  3HHG A;  1KU9 A;  1IW7 F;  1XC5 A;  3EYI A;  3HUG B;  3ABT A;  3FWE A;  1P4X A;  4A3C J;  1QU3 A;  2FUG 2;  5CYV A;  2L01 A;  2E35 A;  1FBQ A;  4BAC A;  3L2Q A;  2R7R A;  1YW9 A;  4L5I A;  5FRN A;  3GCM A;  2XC7 A;  2BXZ A;  2EIL H;  5J47 A;  2WAD A;  3BCA A;  5C3E J;  1J0R A;  3G1M A;  2LR8 A;  1FBU A;  2Y9Y A;  3CLO A;  5D4R A;  2EFW A;  3L9F A;  4RB1 A;  3J7A Y;  3K4B A;  3U2R A;  2FMY A;  3T8R A;  4XOT A;  5K1Y A;  3CCQ I;  3ERE D;  2Y0M A;  2L4A A;  3C2G A;  2JUG A;  3H1C A;  3KE2 A;  4JQF A;  4Y4R A;  1W0U A;  1RPW A;  4CCM A;  3JAM K;  1ZQ3 P;  3F8B A;  1OCZ H;  2Z2S B;  1ZR2 A;  4NUB A;  4XK4 A;  3G2B A;  3D1N I;  3W6K B;  1MNM C;  1VQ4 I;  3M1E A;  3WE2 A;  3S14 J;  3M07 A;  2R7V A;  3IWZ A;  4HNU A;  2YUS A;  3RZD J;  1P7J A;  4C2M J;  3DBR B;  3DEW A;  4BE0 A;  5AIP A;  3GEZ A;  4G6Q A;  3RKY A;  3AAF A;  3DCF A;  3GO5 A;  4IHT A;  2YR2 A;  3TO6 A;  1ZG1 A;  2RNG A;  4XRS G;  1UFM A;  1D5Y A;  1GHC A;  1QZY A;  4ENN A;  2ZXH A;  1IN4 A;  1DGW Y;  3H3U A;  2WB1 N;  2DMT A;  4YEL A;  3ZMU A;  4ENM A;  2L2O A;  3J81 Z;  5J6X A;  2DAO A;  3H5A A;  1SVL A;  1GVJ A;  2W00 A;  2HZD A;  1IRG A;  2E7X A;  2XB5 A;  1HSJ A;  1IRF A;  5IOY A;  3L2V A;  4Q5S F;  4IHV A;  2VBY A;  4E7J A;  4XLF A;  3BZC A;  3IL2 A;  3S2W A;  1T2K A;  1Z05 A;  2E19 A;  2Z99 A;  2DA4 A;  1FT9 A;  5M3M J;  2M1B A;  4LG3 A;  2ZJ2 A;  2CQ7 A;  1KU7 A;  1IF1 A;  3PNV A;  3QYB A;  4RLQ A;  4EJT A;  3CP2 A;  1OYW A;  3S3O A;  1ZN2 A;  2L9V A;  3HSF A;  3ABL H;  3FKI J;  4LLN A;  3TP0 A;  2VQG A;  3H5R A;  3F3X A;  4KN7 X;  1F5T A;  3OYL A;  4G9Y A;  2IW5 A;  2L7K A;  2H09 A;  4RGS A;  4F91 B;  3K4N A;  5IOZ A;  3KP5 A;  4Y3O A;  4BEH A;  3W2V A;  2IS4 A;  2GBY A;  3T0Y A;  1OQY A;  1P2F A;  5E8G A;  4YEJ A;  4IHW A;  3I0T A;  4IOA F;  3G1L A;  1SD5 A;  3E5U A;  3VFZ A;  5K5O A;  2CWE A;  4OWR B;  1OCP A;  5HS7 A;  4A12 A;  4GDF A;  1D3Y A;  2UXX A;  1LVA A;  3GUD A;  1P92 A;  1DPR A;  2XAQ A;  1Z9C A;  1I6H J;  2DT7 B;  2HOS A;  4HW0 A;  3CCE I;  4NHJ A;  1G6N A;  1X1B A;  4IF4 A;  3WTX C;  3V7R A;  4M71 A;  3HRS A;  2EA2 A;  2K3P A;  1YS6 A;  3VPR A;  5HDK A;  3A01 A;  1XPX A;  3SEQ A;  2DYS H;  1VI0 A;  1KZH A;  2M45 A;  4XRF A;  3BG6 A;  1FSH A;  2FNA A;  3HB9 A;  2ECB A;  2W4S A;  2CS3 A;  1YIT I;  1JHH A;  3QPL A;  2LY9 A;  4X1E A;  1HW1 A;  4UB6 C;  2A3S A;  5FLM J;  1NG6 A;  4WX9 A;  3K6G A;  2HYF A;  4HNV A;  2XSD C;  3S17 J;  2IGN A;  4S05 A;  2JRT A;  2O8K A;  1POG A;  1N77 A;  2MSY A;  3S2H J;  3E3V A;  3GW2 A;  3JRE A;  5DM6 F;  2M7B A;  3P7N A;  3MFK A;  2CG4 A;  2PI0 A;  1ITY A;  1BC8 C;  3A01 B;  4LB6 B;  3DBH B;  3PL8 A;  4IX7 A;  1G3T A;  3DF8 A;  3G3Z A;  2MGQ A;  1TWF J;  4C3H J;  2R7D A;  5CJ9 A;  4DW6 A;  4RLF A;  4KA4 A;  3OV8 A;  4JP0 A;  1PP8 F;  3OIP A;  2CQK A;  3L09 A;  1XDU A;  2EIN H;  1LNW A;  3M3Y J;  1D1A A;  1MNE A;  4BDY A;  1YE9 A;  4P96 A;  3PJR A;  2DMP A;  3V7C A;  1BW5 A;  1ZLJ A;  1V5G A;  2RAE A;  4II3 A;  4XBF A;  4BKX A;  3CCS I;  4A3L J;  1R1T A;  1LVK A;  2L9R A;  3E5Q A;  3Q9V A;  4M6V A;  4L9T A;  1RRJ A;  1LB2 A;  1ZLK A;  1MW7 A;  3HTU A;  3OL3 A;  2L9N A;  1PVE A;  1J59 A;  1WH7 A;  3KCC A;  3I4N J;  3HOT A;  2LK2 A;  5B1B H;  5ICG A;  3BG7 A;  3O2P E;  2PBI A;  2KJC A;  4PFP A;  1W5T A;  1JI8 A;  3CDH A;  1FIP A;  3VEP A;  4L5J A;  4XLA A;  2HQN A;  4HF2 A;  3ZQG A;  2NS8 A;  3AG1 H;  2O8X A;  1E0E A;  4XR6 A;  5LGT A;  3LWF A;  5FO5 A;  3DPT A;  3IH4 A;  3ZMD A;  3HXL A;  2CU7 A;  3I56 I;  4RMN A;  4EQQ A;  3F6V A;  3L1P A;  1I3A A;  4IHX A;  1MMS A;  1FP2 A;  2FOK A;  4XKB A;  5EGO A;  1HCR A;  3I58 A;  3N97 A;  1VQO I;  3IP4 B;  1H0M A;  2C6Y A;  1S7E A;  2DA7 A;  3RZO J;  2W82 A;  2DA3 A;  3I64 A;  1IXR C;  5BPD A;  1RUO A;  3UR3 C;  1WPK A;  2M87 A;  3DKX A;  1H89 C;  3SFI A;  2JK3 A;  2R7T A;  4H0E A;  1Y56 A;  1HDD C;  2QEN A;  2ZNY A;  4RB0 A;  1PYV A;  5LGN A;  2Q1Z B;  2IP2 A;  3GZN B;  5F0F A;  1CQT A;  3ZQH A;  4CXF A;  2ID6 A;  1J5Y A;  2CSO A;  5LEK A;  1FTT A;  5EGO B;  4A3E J;  4I76 A;  1BN5 A;  3TW7 A;  3NWT A;  1X3Z B;  4BQQ A;  1LDD A;  1Z77 A;  2VKD A;  4LD5 A;  4M6Y A;  3PUB A;  2IS2 A;  1SVO A;  5HDN A;  4M3B A;  3ML6 A;  3KYL A;  4ZYE A;  4DYR A;  4M3D A;  2XRO A;  2QF7 A;  3JRH A;  1WI9 A;  2CH0 A;  4LK0 F;  2VUM J;  3EYY A;  2V7F A;  2A6T A;  3ABM H;  1W36 C;  2D1V A;  3RTR A;  2ZJP F;  2IGO A;  1R00 A;  4PJN A;  1ZYR F;  3HRT A;  4HA8 A;  2K9Q A;  2F5F A;  3DKY A;  5HNF A;  5ILU A;  1DP7 P;  3FIW A;  2R7Q A;  3HOY J;  4QWQ A;  1GVD A;  1IV8 A;  3I3L A;  3GTL J;  3BC8 A;  3AL0 B;  4D7M A;  2FQ4 A;  1FP1 D;  5EZG A;  4RAG A;  1YG2 A;  1O3R A;  3KYD B;  3GFL A;  2LY2 A;  4M3F A;  4ZYD A;  2KKO A;  3CJN A;  1JGS A;  3M7G A;  2O3F A;  1V5E A;  2LSO A;  3X2Q H;  4DYC A;  3VYR B;  5LD2 C;  3SZP A;  4KJZ A;  2YS9 A;  1RET A;  2B9S A;  2JMW A;  2R93 J;  4BYY A;  1RNL A;  3OYC A;  1R49 A;  1FSE A;  4CYC B;  1DU0 A;  1GUU A;  2NVU B;  5EG0 B;  1D1C A;  2LRD A;  1MJA A;  5FKK A;  4CIC A;  2NNY A;  1ZG5 A;  2JTV A;  2ZXJ A;  3K0L A;  1IGN A;  1TW3 A;  2HI3 A;  1WVR A;  1K4T A;  4Z6Y A;  1P4W A;  1TWH J;  5J4Y A;  1X4P A;  4AID A;  4IOC F;  3OYD A;  1Q1V A;  3CC2 I;  5HLI A;  2CFO A;  2AQF A;  4AVP A;  3OYN A;  2LMD A;  2OCE A;  3H5N A;  5D6F A;  1LFU P;  2QSF X;  3E6C C;  1YYV A;  1QGP A;  4NBQ A;  1TWC J;  2K40 A;  2M9H A;  2BGC A;  5IP7 J;  3MEX A;  4WXD A;  2DDB A;  2NAZ A;  3K1M A;  1T0F C;  5LHH A;  4FQG A;  1WRJ A;  5CVR A;  1Y1V J;  5HVQ C;  2DW4 A;  4MO7 A;  3LSJ A;  2G7H A;  2VL8 A;  2D5V A;  1KGS A;  1VFC A;  1BIB A;  5JHU A;  4DQ2 A;  1M1E B;  1NHA A;  1A6Q A;  2DLL A;  2JA6 J;  4LLG F;  3OSF A;  2M4K A;  3TED A;  5DEQ A;  3G71 I;  2GXG A;  2EZI A;  1T08 B;  3I59 A;  4ZJZ A;  4OIN F;  3CJR B;  2Q2E A;  3CCM I;  4BJ6 C;  3V42 A;  3W3C A;  2EA4 A;  2CJJ A;  3M8E A;  3CCU I;  4NC8 A;  1A36 A;  1S3J A;  3EPZ A;  2LF8 A;  4KIS A;  2FQ3 A;  1Z3X A;  2MA3 A;  4BHC A;  4G7Z F;  2PN6 A;  3FK7 A;  3C2H A;  5CKT A;  3ZPL A;  1KA8 A;  3RSN A;  2EZH A;  5B5E C;  4HQE A;  4XKV A;  2OTL I;  5IT9 Z;  5B66 C;  3GTP J;  3N4M A;  3ERM A;  3FXK A;  2UZK A;  3HOU J;  3I59 B;  1EH6 A;  4HBL A;  1NK3 P;  2AO9 A;  2IA1 A;  2Q2E B;  2HTJ A;  3QOE A;  2P81 A;  1HW5 A;  3ULQ B;  2YU9 J;  2M34 A;  3AG3 H;  1JKP C;  2FE3 A;  4LFU A;  1R9T J;  1B1B A;  2XKP A;  1U9O A;  2H27 A;  4NC6 A;  1T56 A;  3C2B A;  1VQK I;  3CO7 C;  2A69 F;  1TQP A;  2MYS A;  3HKZ N;  3JTG A;  1T6S A;  3ZQQ A;  1RES A;  3JRB A;  3CCR I;  2Y0S N;  4IHY A;  1G8X A;  5GAH J;  2WAQ A;  3A03 A;  3A0H C;  3AG2 H;  1VQN I;  3FM5 A;  2P4W A;  1SC7 A;  2ICW G;  1ODD A;  1Z1D A;  1D5V A;  4IVN A;  4FET A;  5CQG A;  1ETV A;  1HOM A;  1GV5 A;  3D5S C;  5C44 J;  2JRM A;  2VT2 A;  4EGY A;  3KEO A;  1ZR4 A;  3S3N A;  2XVC A;  1LPQ A;  1FOW A;  4HLX A;  3GME A;  2NNN A;  3WU2 C;  3HYI A;  4CHU A;  1N78 A;  4LG0 B;  2DJI A;  4C3J J;  3DU6 A;  3KLN A;  3H92 A;  1KQ8 A;  3S1M J;  1YJW I;  3CUQ B;  4EV0 A;  4GGG A;  2KIS A;  4D5F A;  4MTD A;  2VQL A;  2E2J J;  2QWW A;  4KT6 A;  2EPF A;  5K5R A;  1HDP A;  1UZC A;  2ZFU A;  4HF0 A;  2A68 F;  5EF6 A;  1V5F A;  5BOX A;  3M8F A;  2N8G A;  2VBZ A;  2GXA A;  2E36 A;  3CES A;  3DKW A;  1STZ A;  4NNJ A;  1WJE A;  1ZTR A;  3GLX A;  3K4L A;  3I4M J;  3B6C A;  2LD5 A;  3FMR A;  5CVU A;  4PGG A;  3LSH A;  3FDY A;  4B3X A;  4PZJ A;  4DZP A;  2FD5 A;  2K4B A;  2Z3Y A;  3T1B A;  2K7L A;  5M5W J;  5JHF A;  3S1R J;  1VQ7 I;  1OCO H;  3WTU C;  4PSW A;  4MTE A;  4II2 A;  3TO9 A;  4H4K C;  2ETH A;  4HQM A;  3LNQ A;  2FA5 A;  4HYE A;  2R7S A;  1ULY A;  2OQG A;  1BA5 A;  1QHH D;  1ZG3 A;  3DV8 A;  2P5K A;  2RQP A;  4BUP A;  2AHQ A;  1W1W E;  3I54 A;  2WB1 A;  2XGD A;  2KIU A;  3ZN1 A;  3WGI A;  1YIO A;  5E3M A;  5E20 A;  1OKR A;  4A5N A;  2KP6 A;  3E6B A;  2F2E A;  4HSR A;  2XRN A;  2ZME B;  3GFM A;  3GTQ J;  3F8F A;  4RM3 A;  3W6V A;  2Y9Z A;  2R0Q C;  3TBI A;  5JLX A;  1FY7 A;  3HEF A;  4AD9 A;  1BJZ A;  4EM0 B;  3HOV J;  5J8C A;  2FRH A;  1KON A;  1SAU A;  1YQA A;  2NXN B;  1SFK A;  5EJC A;  2FF4 A;  2CRG A;  4LIU A;  2ISZ A;  1JT0 A;  2ZXW H;  3D5R C;  3OYJ A;  1HKQ A;  2NRA C;  3C1D A;  4QIW N;  1MMD A;  1MBH A;  4P55 A;  4UY8 I;  3CTA A;  2LLK A;  4CCO A;  1TWA J;  1R7J A;  2ZKZ A;  3E1S A;  2AQE A;  2EBI A;  4EMS A;  4LOC A;  2ESH A;  1D0Z A;  4RS8 A;  2CW0 F;  2X6O A;  4GFB A;  1XD7 A;  1I3Q J;  4A0X A;  4DOZ A;  1JJ8 C;  2JA2 A;  2JA8 J;  4RGR A;  3CDL A;  2KPM A;  1WJB A;  2PJR A;  1JKR C;  4HZF A;  1FX7 A;  2E7W A;  4DIQ A;  2QBY A;  3I4P A;  2LKX A;  3LST A;  2EIM H;  1G4D A;  2A6H F;  3JRI A;  3QP5 A;  4HF1 A;  3JSO A;  2Y48 A;  3V8L A;  2A05 A;  3HSR A;  1NK2 P;  1FOK A;  4XKW A;  5AIQ A;  2HQA A;  4KIC A;  1IRX A;  4EEF G;  3HOW J;  4U7B A;  1I6X A;  1IZ1 A;  5L3F A;  4HDV A;  4XKC A;  2PMH A;  4X6A J;  1ETQ A;  1QZE A;  2BOL A;  4KYW A;  1IDZ A;  4OIQ F;  4BL0 B;  4ZZL A;  1S7A A;  2F5V A;  2NVY J;  3KFW X;  3NRV A;  2DDA A;  2PJR B;  2ELK A;  5KK1 A;  4RA2 A;  4U0V A;  2QBY B;  1QPI A;  2STT A;  1RR8 C;  4KIF A;  2KQR A;  2V26 A;  3H35 A;  1OR7 C;  4P5O A;  2HKO A;  2HEO A;  1K7A A;  2WAQ N;  3QYE A;  2DI3 A;  4XN0 A;  4MEY F;  5GPA A;  4A2U A;  4BJ5 C;  1WGX A;  3K4C A;  3DTI A;  4P1W A;  2LC2 A;  4XLE A;  1IXC A;  3LSK A;  3Q0W A;  2X48 A;  3ZP5 A;  2GLO A;  5LBQ A;  3D0S A;  2WWY A;  3HHH A;  1ZRF A;  5L3E A;  4Q47 A;  2DQL A;  2D2W A;  2HTS A;  2X6X A;  2EB7 A;  3EUH C;  2JA5 J;  1QPM A;  3P9C A;  3BR0 A;  2ZBK A;  3R0J A;  1CGP A;  5FLV A;  4B3A A;  2CMP A;  3C18 A;  2FBK A;  4UV8 A;  2OV7 A;  1BI1 A;  3P9K A;  1LEA A;  3EDP A;  5JLW A;  2XPV A;  1JTY A;  3I55 I;  3TW6 A;  4XQF A;  2UWM A;  3H9G A;  3CME I;  3LFK A;  3HOS A;  3HL2 A;  3TP3 A;  3S32 A;  1FYK A;  3ONQ A;  3WHB A;  3TDU C;  4BE2 A;  4F55 A;  2DA6 A;  3SFZ A;  3KZY A;  5LRS A;  2XRL A;  3DLL F;  2KIF A;  1AOY A;  3L2C A;  2WTE A;  2VOP A;  2K4J A;  4N9I A;  4BXU A;  4BXF A;  4CO8 A;  4G8X A;  3FXR A;  3BTJ A;  2R7Z J;  3LA3 A;  3PQK A;  3VYS B;  2CYY A;  2XUB A;  2PEX A;  3ECH A;  3ZQF A;  2BHY A;  3RKQ A;  1P6R A;  2ZNZ A;  1TW2 A;  5LEJ A;  3QP6 A;  1TZL A;  3OS0 A;  1SFU A;  2Y75 A;  4Y33 A;  2P8T A;  2JZY A;  2V1D A;  3QWL A;  4YFK F;  2V1X A;  1T95 A;  1O7F A;  1SD4 A;  3FMS A;  5FGM A;  1DU6 A;  1HKT A;  1MSF C;  4JX5 A;  1JUM A;  3SYT A;  2M8E A;  3ZQ7 A;  1LEB A;  3BRO A;  2GWR A;  2E5N A;  3A4C A;  4S0H B;  4AC0 A;  3OR1 C;  2RRE A;  4KDP A;  2YU3 A;  2A61 A;  2BY0 A;  4OAY A;  4OIR F;  2OU2 A;  1MJB A;  1P7I A;  1ZAR A;  2AXT C;  3BP8 A;  2W85 A;  4FE4 A;  4UVC A;  3JAM Z;  2UUZ A;  4QLC U;  1RUN A;  3TL4 X;  4QSH A;  2BY2 A;  2O0Y A;  2PMU A;  5EEH A;  5J40 A;  4XIC A;  1MBE A;  5FJ8 J;  2A5W A;  2ZO4 A;  5FB2 A;  1IUY A;  3OOU A;  3GTJ J;  5EEG A;  4AM3 A;  3PFY A;  5H6Q A;  1OYY A;  2P6S A;  4RAF A;  3CCL I;  3QPH A;  3LSP A;  2VQC A;  3F6O A;  2QEX I;  1XSX A;  2EV5 A;  5ILS A;  1LJ9 A;  2H6C A;  3BWG A;  2NVQ J;  5GTH C;  2F5C A;  2X1E A;  1S6L A;  5BS6 A;  2HWV A;  3E0J B;  3BOQ A;  3CMA I;  3ABK H;  3CJQ B;  1UB9 A;  3LOC A;  4J00 A;  3SQN A;  4NQW A;  3TDZ C;  2XGE A;  1IN6 A;  5IP6 A;  4XID A;  2IRF G;  1OFC X;  4DNC A;  2DN0 A;  1UHM A;  4CCK A;  1YTY A;  1KYW A;  5L3D A;  2RNJ A;  2W57 A;  5F27 A;  3L2R A;  5FFZ A;  2WAF A;  1XN7 A;  1XSV A;  1Z6R A;  1IN5 A;  1ON2 A;  3PIP F;  1X3U A;  3LAJ A;  5LFA A;  3VB2 A;  4UVB A;  2HS5 A;  4M9X A;  3ZCO A;  4EJO A;  3TOA A;  2BVL A;  1WCM J;  4BEH B;  5TJJ A;  1ZRE A;  4NDL A;  4D5C A;  4NQW B;  1Y0U A;  2CUF A;  3KZZ A;  1JT6 A;  1VF9 A;  2XAF A;  3HIF A;  4OMY A;  5FKO A;  2OZU A;  5KHD A;  2STW A;  3CUQ C;  3IAM 2;  4J01 A;  3BQZ A;  3E7L A;  3MD2 A;  1MMG A;  3DQV C;  2VE8 A;  3VOE A;  4B1R A;  1AHD P;  1RZ4 A;  2O7O A;  2CW8 A;  3K4K A;  2R7F A;  1X3W B;  1A5J A;  1C0W A;  3BPX A;  4L9N A;  3E6M A;  3ZR8 X;  3VDX A;  4YG2 F;  3H36 A;  4CGZ A;  1A6I A;  1MBF A;  5J1Y A;  1GXQ A;  3KP3 A;  1B9N A;  5ICC A;  2QGU A;  3ZQI A;  3DLA A;  1TQM A;  3WHC A;  1TQI A;  2XGC A;  4GO1 A;  1XB4 A;  3MKY B;  3JRC A;  1VQ9 I;  1Q1H A;  1YI2 I;  1AWC A;  4I98 B;  2WAE A;  2XSJ C;  5CVJ A;  4CCJ A;  3T8T A;  1IRZ A;  2HDC A;  2KIM A;  1IAW A;  4AIH A;  2JWT A;  5A2Q K;  2J5P A;  2R4G A;  2RV8 A;  1HF0 A;  3G6E I;  2XDV A;  2E60 A;  5LGU A;  3OL4 A;  5KVR A;  1VQ8 I;  1BL0 A;  3GZ6 A;  1VQM I;  1XMA A;  1T98 A;  2LG4 A;  2TDX A;  4WXC A;  2DYR H;  5ERI A;  2QYO A;  4ABZ A;  4XLH A;  4IQJ A;  3LA2 A;  2WBM A;  2ZME C;  1MMN A;  2HVQ A;  2R92 J;  3WTY C;  4BQN A;  2DFE A;  1UG0 A;  1BBY A;  3LMM A;  4B43 A;  3K70 D;  2DQR A;  2GOX B;  1A04 A;  1BR1 A;  3FIS A;  1P9Q C;  2Z33 A;  2JA7 J;  4V2F A;  1I50 J;  3K4M A;  2HOE A;  4FAS D;  3WTZ A;  1ZKG A;  1D0X A;  5F0C A;  4BJT A;  5FRO A;  1WJD A;  2XB0 X;  3RKW A;  3HKZ A;  2GA2 A;  1U5T A;  4W1U A;  1WSU A;  1Z67 A;  4BY7 J;  2Y0S A;  1EH8 A;  4A5M A;  3DP7 A;  5A2Q Z;  2B63 J;  2MAB A;  1BW6 A;  5JVT A;  2FOW A;  1TNS A;  3OR2 C;  2MLK A;  2QQ9 A;  4RDU A;  5D5U B;  4AU7 A;  1MDM A;  1WH5 A;  2P6T A;  1YW8 A;  2WV1 A;  3CC7 I;  3K9T A;  3FHZ A;  2VPR A;  4XN3 A;  2XPW A;  5IYD J;  3MKL A;  4PUS A;  2LRE A;  3BY6 A;  3CZ6 A;  4XRM A;  2MH2 A;  4CZC A;  2LKS A;  3JCU C;  3JRD A;  1WWX A;  2R7X A;  4CH7 A;  1U5T B;  2X85 A;  4CYD A;  5GPC A;  5ICE A;  4E7Z A;  5E1W A;  3V7S A;  2MC4 A;  4CSW A;  1VQP I;  3CMM A;  2CV1 A;  3IUO A;  5FKL A;  1ZAO A;  4PJJ A;  4A3B J;  2DT5 A;  3GLL A;  3K1N A;  1F9N A;  2A5Y B;  2IGM A;  1QVT A;  1FYM A;  3F9K A;  4IJA A;  2G7U A;  2L9S A;  2LNB A;  1MDM B;  3W2A A;  4L5E A;  3KLO A;  3M9A A;  3OIO A;  4N4N B;  4UNO A;  5E3L A;  1LFB A;  3K2Z A;  1MBJ A;  1F36 A;  3BR1 A;  1NH3 A;  2M2E A;  3HC7 A;  4LGW A;  3HSE A;  5DV5 A;  2IAI A;  2L7Z A;  3GXO A;  1YHQ I;  4BAY A;  1R6R A;  2MLG A;  1K6O A;  3KP7 A;  2I10 A;  1R1U A;  3F0C A;  1T39 A;  1SD7 A;  4U0W A;  1HXD A;  4I01 A;  2HOT A;  2M7A A;  1IXS B;  2DXI A;  1Y1W J;  4PJM A;  3LSR A;  3BCB A;  1BR4 A;  5GAG J;  5F1J A;  2JQ7 A;  3JR9 A;  4A3K J;  5CVV A;  1X4O A;  5IPA A;  2IA2 A;  4EM1 A;  2DFI A;  4N4O B;  3U21 A;  2HNH A;  2RKH A;  9ANT A;  4KIG A;  1D1B A;  3IWF A;  3ZMV A;  2GIZ A;  2ELJ A;  2LTP A;  2X6Y A;  3I5U A;  3FZV A;  5DCF A;  3CCV I;  3KET A;  2NVT J;  4I0B A;  3R60 A;  3PNY A;  4RGU A;  1TT0 A;  4PFO A;  1IN7 A;  1D8K A;  3IKV A;  4EJU A;  2VB6 A;  1K78 A;  3K7A J;  3LL7 A;  1FLI A;  2CV0 A;  4MIM A;  5FLX K;  4L9J A;  4M9Z A;  1R5I D;  1RKW A;  4LB5 A;  4F93 B;  2IBD A;  3CCY A;  1XGS A;  3GYH X;  3KPH A;  4HG2 A;  1LFP A;  3I9V 2;  4U88 A;  2AS5 F;  1B9M A;  3GBG A;  3SEZ A;  1TWG J;  2K9N A;  3GTM J;  2GZW A;  3B02 A;  5F08 A;  5K5Q A;  2ECC A;  1U0J A;  2KL4 A;  2RQQ A;  4ZDP A;  3MCZ A;  2KDO A;  3H3V K;  4EJV A;  1Z21 A;  1XGN A;  2L5Q A;  4L0Y B;  5E1Z B;  2PQ8 A;  3S93 A;  1SEU A;  2J5O A;  4CUG A;  2OQR A;  3JRG A;  5HS9 A;  3DBL B;  1YO5 C;  1ON1 A;  1S29 A;  2MH9 A;  4MFE A;  4BU2 A;  3MVP A;  4JOM A;  3Q9S A;  2BY1 A;  3TOB A;  2NOJ B;  2XF7 A;  1XMK A;  4B4C A;  5ILV A;  2LOO A;  3IV5 A;  4I0A A;  3WE3 A;  4FX4 A;  2B7E A;  2MD0 A;  4E70 A;  2VIX A;  3MZY A;  4I99 C;  3GTO J;  1RC9 A;  2VXD A;  1MD0 A;  4GYG A;  4IEJ A;  5FLX Z;  4PJL A;  1PJR A;  2WC2 A;  3PO2 J;  2Y69 H;  1D8J A;  4YRV A;  1X1C A;  3GWZ A;  3TO7 A;  2W1O A;  2DFH A;  3FK6 A;  4AUX A;  5J1U A;  1MSE C;  4XON A;  4TV7 A;  2O5R A;  1OCR H;  4D0P A;  2DA1 A;  2Q8K A;  4DBR A;  4FHT A;  3FX3 A;  3KYC B;  4E7S A;  1TTY A;  4PK4 A;  3W2W A;  1V3F A;  2OTJ I;  2CV2 A;  1QHG A;  4Y13 A;  3JTH A;  2M0C A;  3GTK J;  3FBN B;  4C2U A;  1R5G A;  5HNH A;  1KU3 A;  4ESJ A;  4ZC3 A;  4M3G A;  3F21 A;  2LBF A;  1O3T A;  2X51 A;  4MHG A;  4AWX B;  2ADU A;  2F5E A;  2E5Z A;  4GXO A;  5F0H A;  1JKO C;  3ZMZ A;  2LKP A;  5L3C A;  2EZL A;  4C9Y A;  3F8C A;  1I1G A;  1FIA A;  2VBX A;  3FXQ A;  2LDU A;  1FMW A;  1EH7 A;  4DBQ A;  3BR5 A;  2AXL A;  1ERD A;  3WOD F;  1JE8 A;  3BR6 A;  2V6C A;  1DPU A;  1F1Z A;  2HQR A;  2QQA A;  2VT3 A;  1ENH A;  1WZ2 A;  3IAS 2;  3WGG A;  1W0T A;  4C3I J;  1IG7 A;  2EK5 A;  4AIJ A;  2P0W A;  3FXU A;  1XX5 A;  3AKZ A;  1GXP A;  1OMI A;  4MQV A;  3RPU A;  2VOO A;  4XL9 A;  2NOG A;  1TLH B;  1F43 A;  4F3Q A;  5GAD J;  1APL C;  1R5H A;  3V4G A;  3SHF A;  3J80 K;  4B44 A;  2HKX A;  1OCC H;  1SFE A;  4MQ9 F;  3VYU B;  4YFN F;  3FKJ A;  1U78 A;  5ED4 A;  2CQN A;  1B4A A;  3RQ4 A;  3J7A O;  5CVI A;  3R6S A;  2WY8 Q;  3OS2 A;  4ZYG A;  4XMY A;  4IRH A;  2MD5 A;  3AFH A;  2EJR A;  2R7W A;  3RI4 A;  5KNL A;  3Q5F A;  1L3L A;  1X2N A;  2ID3 A;  4OMZ A;  4BDZ A;  3ZMT A;  1GV2 A;  2K9M A;  4L18 B;  3IH3 A;  4KNY A;  3JW4 A;  2K3F A;  4PCQ A;  1KYZ A;  1R1V A;  2CFX A;  4ZH4 F;  3S1N J;  3S1Q J;  3K4J A;  2GM4 A;  1XCV A;  2M3A A;  4IPA A;  1UJ8 A;  1LDJ A;  1KQ9 A;  2TRT A;  5DD4 A;  5LHI A;  1YX5 A;  2QKL B;  4G12 A;  2OCC H;  5J8F A;  1BM9 A;  4I7H A;  2BEO A;  3O3K A;  1V54 H;  2VJ5 A;  2K5C A;  3J80 Z;  1SFO J;  2JUC A;  1JUS A;  2VKV A;  4E7K A;  5CPR B;  4C30 A;  4G7H F;  5DCM A;  1FJL A;  1OPC A;  2JPB A;  2EFO A;  3OYM A;  2D45 A;  2O9L A;  2ZJQ F;  2EIJ H;  3H9J A;  2Z5U A;  4M72 A;  2NYX A;  1J75 A;  4BBS J;  1ORK A;  2GXB A;  3QYF A;  1QBJ A;  4HDU A;  2XKO A;  1R71 A;  5E18 F;  1P4A A;  3FM3 A;  2ELH A;  3BQY A;  3QOD A;  4EVI A;  2NS7 A;  2JN6 A;  2GAU A;  4A69 C;  1H88 C;  1PUF A;  4RGX A;  2VLA A;  2HR3 A;  4HAM A;  1PDN C;  2H8R A;  4FIS A;  5E79 C;  5DCM B;  4YIF A;  1MH4 A;  3L2W A;  5D8K B;  4OIO F;  4CA0 A;  1YX3 A;  5CQE A;  1HST A;  3OS1 A;  3HOZ J;  1WI3 A;  2COB A;  1QRY A;  3VSL A;  3UKG A;  4G6T B;  2MG4 A;  2OJE D;  1CF7 A;  1LDK B;  3KEQ A;  3PNT A;  5TRD A;  3G1O A;  3CQZ J;  3GFJ A;  3MAJ A;  2BBY A;  1YLF A;  4Z2Y A;  1I39 A;  2QKM B;  3Q0U A;  4MGR A;  5D6E A;  3LFU A;  1X58 A;  2ZSH B;  3VWB A;  2VC0 A;  2O6G E;  1PUF B;  3Q3S A;  2HYJ A;  2K27 A;  4R79 A;  1Z6T A;  1AU7 A;  3BJA A;  4ZTF A;  3FXM A;  2VXZ A;  1IN8 A;  1TBX A;  5E1X A;  3LSI A;  1IJW C;  3BPV A;  1K83 J;  2E1C A;  2DA2 A;  1CF7 B;  1G59 A;  4IZZ A;  1S7O A;  2R5Z A;  4BQO A;  1YRN A;  1OYI A;  2DK5 A;  2EZK A;  4ENK A;  4O3M A;  2JSP A;  2HVR A;  4GRI A;  1U5T C;  2DMU A;  2DOA A;  5FFX A;  4AIK A;  2B0L A;  3K70 C;  2X0L A;  1MKM A;  2G9W A;  4IKF A;  3M4O J;  1BIA A;  1EKE A;  3KX2 A;  4JBA A;  2IGK A;  1Z3Y A;  2FML A;  5EYR A;  1R23 A;  2ZFW A;  3JRA A;  2KRH A;  3GX4 X;  4DGW B;  2MW8 A;  1ZRC A;  3PFI A;  5K7H A;  1KQ0 A;  2CUZ A;  2OBP A;  2ZCW A;  2VC1 A;  1YJN I;  3CO6 C;  1O3Q A;  5IP9 J;  3RKX A;  4KIT B;  3AL0 C;  5FKN A;  1LQ1 A;  3S8P A;  2R5Z B;  3A1Y A;  1U9N A;  4HRI A;  4A93 J;  3JRF A;  2KLO A;  2LYC A;  3GVA A;  3QRF F;  3NWS A;  3OYE A;  2DK8 A;  4GCV A;  1EF4 A;  3FMQ A;  4OU0 A;  3H3Z A;  4AYB N;  1XSD A;  4LIV A;  3R0A A;  5GAE J;  3KP2 A;  4I09 A;  1J7K A;  1IC8 A;  1I27 A;  2O03 A;  1R22 A;  4I6Z A;  1K4S A;  3WG7 H;  3DFG A;  2HFH A;  2MFZ A;  4ETS A;  2XV4 S;  1T0F A;  1Y8R B;  2EWN A;  3A2K A;  1R36 A;  1ETX A;  3B73 A;  1LKX A;  1R4M B;  1E17 A;  5GP9 A;  4FE7 A;  2DBB A;  4A0Y A;  3F8N A;  2HXI A;  2VI6 A;  1RI7 A;  3AG4 H;  3B6A A;  3PM1 A;  1UAA A;  1MH3 A;  3ECO A;  5DD8 A;  1FOX A;  3FXO A;  3LSG A;  2VOD A;  1XDS A;  4OOI A;  2V4J C;  3U9G A;  1FWZ A;  4BY1 J;  2H6B A;  3COA C;  4IRG A;  1HA8 A;  5DDG A;  3J81 K;  2DMQ A;  3KZI C;  2OPT A;  3PIO F;  1ACI A;  4MFD A;  3CD6 I;  1NTC A;  2I5U A;  4QPQ A;  4KMF A;  4K2E A;  2DT6 A;  4FT8 A;  5DS9 A;  4P9F A;  3RQI A;  5DUK A;  2W84 A;  3A0B C;  3IRQ A;  4ZZD A;  3L2U A;  1DGR M;  2QM3 A;  3S16 J;  1TP4 A;  3V8J A;  2VKE A;  2ME6 A;  1FTZ A;  2ISY A;  2I8D A;  3DPU A;  2ESN A;  2BY3 A;  4U0Y A;  3Q0V A;  4DYQ A;  3N05 A;  2TCT A;  3OMY A;  2PJP A;  3EET A;  4IQ4 A;  4BQA A;  3JSP A;  2HU9 A;  3IH2 A;  3DTK A;  3BTC A;  1W7P D;  2KRF A;  4Y15 A;  5M5Y J;  4O6J A;  4N0B A;  1QA6 A;  3TGN A;  4BE1 A;  1DUX C;  4A3M J;  2Q0O A;  3HPG A;  5EDN A;  3ZQC A;  3E97 A;  4HNT A;  5AON A;  1VND A;  1LE8 A;  3BG5 A;  3H9Q A;  1XTA A;  4E7L A;  2BV6 A;  3KP4 A;  1JJ6 C;  2H1K A;  2PMZ A;  4LK1 F;  1MIJ A;  2CQX A;  1W7P A;  2K02 A;  2F48 A;  3F8M A;  1JGG A;  2E1N A;  5TGT A;  1G3Y A;  3C3W A;  4I2O A;  1E3O C;  5H20 A;  4UHT A;  4CCL A;  4ZYA A;  3GFI A;  2X1D A;  5GTI C;  2Y30 A;  1UEL B;  3WU0 A;  1JTX A;  5D5W B;  4U7D A;  1LE8 B;  3BG3 A;  2EIK H;  4D9J A;  3O6B B;  2HVS A;  4Q48 A;  5KCM A;  2M30 A;  3E6D A;  1RR7 A;  2XHK A;  4G7O F;  4JX6 A;  5E3O A;  1W7P B;  2OAZ A;  3OYK A;  3S2D J;  1MBG A;  1QO0 D;  1UST A;  1ZEL A;  4FTH A;  3NAR A;  1U8B A;  1U8R A;  4WWC A;  3O8H A;  1VQ6 I;  2DPD A;  2DU9 A;  4XNF A;  3LQQ A;  1VTN C;  1SD6 A;  1SMT A;  1BJA A;  1HQC A;  1MBK A;  2GA1 A;  2BYV E;  2OF7 A;  1DDN A;  3PO3 J;  2IS6 A;  1QVU A;  2Y31 A;  2XAJ A;  3L7W A;  2JSC A;  4QTR A;  1BR2 A;  5L3G A;  4ESF A;  1X19 A;  1FYL A;  1V4R A;  4UB8 C;  4Y17 A;  1O3S A;  5J3L A;  2M5W A;  3HRM A;  4B09 A;  1FOY A;  4Q4Z F;  2VPL A;  3KP6 A;  4A3I J;  4HX8 A;  3MN2 A;  5EEA A;  4HV5 A;  4MNU A;  2HGC A;  5IY5 H;  1MND A;  4E6K G;  1BOB A;  2H8W A;  2KJB A;  4NB5 A;  4BHB A;  2DPU A;  4M74 A;  1K61 A;  1WJA A;  2JT1 A;  3BZK A;  5D4S A;  5KAF C;  2CO5 A;  2ZXI A;  4KN4 X;  3ZGK A;  1FNN A;  1FC3 A;  3DWL E;  5BQT A;  5HLT A;  2FXA A;  3P9I A;  1HLV A;  2K85 A;  5DTD A;  4ZYH A;  3QOP A;  3ROU A;  4A6D A;  2NVX J;  3R4K A;  4FX0 A;  3OYB A;  4M6X A;  2JVG A;  1G3S A;  2HXO A;  2CUJ A;  3GZ5 A;  4D1Q A;  2KIQ A;  3P5J A;  4G94 A;  4EGZ A;  3VOD A;  1REP C;  1Z91 A;  1BI3 A;  4B8X A;  1YFH A;  5E17 F;  3DU5 A;  3J7Z I;  4UUV A;  2F5D A;  2VQH A;  1EA3 A;  4IL6 C;  5FD5 A;  3E5X A;  2CUE A;  5HDG A;  3WTT C;  2IXS A;  2M8G X;  4KFC A;  2YSR A;  1T33 A;  1HBX G;  3QPT A;  5E8I A;  3OYH A;  2P7C B;  3FXJ A;  2VE9 A;  2CQQ A;  4EAT A;  2XF6 A;  3EUK L;  3TQN A;  1PP7 U;  4UV9 A;  2KZV A;  2BXY A;  1FMV A;  3TMO A;  2L54 A;  3MMY B;  2GOM A;  1IUF A;  2FBI A;  2BW3 A;  2ZB9 A;  4F92 B;  2IS1 A;  1Z0X A;  4B48 A;  1K79 A;  3OOP A;  2LP0 A;  2IA0 A;  2ME0 A;  4XLN F;  3CCJ I;  4KUM A;  3GF2 A;  4W97 A;  5JFR A;  1H9G A;  1ZGA A;  4XM3 A;  2ZJR F;  1TL8 A;  2CGP A;  2KDZ A;  3DPL C;  4GYI A;  4WCG A;  3ABU A;  2KRC A;  1K6Y A;  4M3E A;  1FBS A;  4B47 A;  3HG9 A;  3BDD A;  4BH9 A;  2QZ8 A;  4ZTJ A;  1V55 H;  3LQR A;  2NS0 A;  5C4J J;  3BJO A;  2EFN A;  3SDB A;  1RIO H;  3LAP A;  2F4I A;  2QSH X;  3FHN A;  2DJN A;  3CF5 F;  1J2X A;  4G6D A;  3VSK A;  5K7F A;  3CDI A;  4OAZ A;  3CC4 I;  4Y52 J;  1HKS A;  2E1M B;  2BW3 B;  2HQ5 A;  1L0O C;  2X4H A;  3RYR A;  2L0K A;  1JUP A;  2L02 A;  3LA7 A;  1OR7 A;  3SDG A;  3WTS C;  4S04 A;  1D0Y A;  1BC7 C;  4CZZ A;  2OC6 A;  5CLS A;  2M4G A;  4BNC A;  1WJC A;  1S5L C;  2HOA A;  2KT0 A;  2V79 A;  3WTV C;  4HEA 2;  1SVM A;  5JI6 A;  1YW7 A;  2PMZ N;  4RB3 C;  4RB2 C;  5TIS C;  5IYB J;  1MMA A;  3ZOB A;  5KAI C;  2PG4 A;  2IJL A;  2P7V B;  3G4S I;  1FZP B;  2XAS A;  3U1D A;  3EUH A;  3K69 A;  2VKH A;  3K1P A;  2DTZ A;  3M8J A;  2WV0 A;  5FD6 A;  2HYG D;  2K86 A;  5E3N A;  4OIP F;  1UMQ A;  2DFF A;  4PJ0 C;  4XSX F;  3PSF A;  3F23 A;  1W5S A;  3OYA A;  3PUF A;  3OY9 A;  4CYC A;  3DEU A;  2MC3 A;  1TC3 C;  2EQR A;  2OA4 A;  3F22 A;  2EV0 A;  5EG0 A;  2W7N A;  2W48 A;  1AA7 A;  2YPR A;  3ESW B;  1ETY A;  5HOD A;  2F6C A;  3QPS A;  3EQL F;  3CJT B;  3V8K A;  3F72 A;  2EFQ A;  4E4H A;  3GTG J;  1USS A;  5M3F J;  1WJF A;  1JHF A;  4A6E A;  4HV6 A;  5F64 A;  1XS9 A;  1JXS A;  4QPO A;  2FU4 A;  2V9K A;  3WGH A;  2X9D A;  1U3E M;  1SMY F;  3RPQ A;  2R5Y A;  2LH9 A;  4ASN A;  1AKH A;  3BZ6 A;  1Y0N A;  3ASN H;  5BPI A;  3HTS B;  1W4M A;  3FF5 A;  4M73 A;  5HLH A;  3K10 A;  4BXX J;  1ZK8 A;  2XPU A;  1S72 I;  3G73 A;  1H8A C;  2FNP A;  2XAU A;  3BTI A;  1UG2 A;  4MLO A;  3BLY A;  1Z7L A;  4WXH A;  4E7I A;  3RIR A;  4HST A;  2Y2Z A;  1OLT A;  4PDK A;  3HGY A;  2D1H A;  1I1S A;  1XCB A;  1O4X A;  3MKW B;  2KZG A;  2RVC A;  2L4M A;  2YX4 A;  1WQ2 A;  4YIR X;  2OZ6 A;  2YX7 A;  1B72 A;  2E2I J;  2R5Y B;  5JVG F;  1UHS A;  3NQO A;  2XF5 A;  2P5L C;  4UVA A;  1AKH B;  5IT9 K;  2CW7 A;  1K78 B;  2W24 A;  2JPC A;  2Z9O A;  4YII A;  1TNT A;  3S15 J;  3LSM A;  2FJ1 A;  1LUJ B;  3RDI A;  3WTW C;  1S8N A;  4ITV A;  5LRR A;  1TT5 B; 
#chains in the Genus database with same CATH homology
 3BQY A;  3ZQG A;  2NS8 A;  5EZH A;  2NS7 A;  1DU6 A;  2JN6 A;  3IH4 A;  4A69 C;  1MSF C;  4JX5 A;  1H88 C;  1X2M A;  2CU7 A;  1JUM A;  1PUF A;  4IHX A;  3L1P A;  5J1R A;  5EGO A;  4S0H B;  4AC0 A;  2H8R A;  4FIS A;  1HCR A;  1MH4 A;  3HOZ J;  1WI3 A;  1B72 B;  4FE4 A;  1P7I A;  2COB A;  1QRY A;  3UKG A;  1S7E A;  2DA7 A;  3RZO J;  2MG4 A;  4QSH A;  2DA3 A;  5FKM A;  4XIC A;  1MBE A;  1WPK A;  3G1O A;  3QQA A;  1H89 C;  5FJ8 J;  3CQZ J;  3SFI A;  2JK3 A;  5C4X J;  3OOU A;  3GTJ J;  3Q0U A;  1HDD C;  1X58 A;  3BG9 A;  1CQT A;  5F0F A;  3ZQH A;  2ID6 A;  1PUF B;  3HBL A;  2HYJ A;  3Q3S A;  1AU7 A;  1FTT A;  5EGO B;  3LSP A;  4A3E J;  2K9S A;  4I76 A;  4BBR J;  4DZJ A;  3TW7 A;  2IEK A;  4XRS A;  2NVQ J;  3K2A A;  1IJW C;  1K83 J;  1Z77 A;  1GT0 C;  2DA2 A;  3LOC A;  5BNG A;  2XGE A;  5IP6 A;  4XID A;  4M3B A;  3A02 A;  1OFC X;  4RBO A;  2R5Z A;  1YRN A;  2EZK A;  2DN0 A;  4DYR A;  4M3D A;  2QF7 A;  2DMU A;  2QCO A;  3JRH A;  1ETO A;  2VUM J;  5F27 A;  3M4O J;  5K7Z A;  2FX0 A;  2K9Q A;  5EYR A;  3FIW A;  3JRA A;  2JJ7 A;  3HOY J;  1GVD A;  2MW8 A;  5K7H A;  4JX4 A;  3GTL J;  1WCM J;  1ETK A;  4NDL A;  4D5C A;  1OJL A;  1FEX A;  1JKQ C;  5IP9 J;  2CUF A;  5FKN A;  4D7M A;  2FQ4 A;  5M5X J;  5EZG A;  2R5Z B;  1JT6 A;  1U9N A;  4A93 J;  3JRF A;  1VF9 A;  3BTL A;  4M3F A;  3H0G J;  5FKO A;  2LFB A;  1IDY A;  4A3J J;  1EF4 A;  4AYB N;  4DYC A;  3BQZ A;  3E7L A;  1IC8 A;  2YS9 A;  4B1R A;  1RET A;  1AHD P;  4I6Z A;  2O7O A;  2JMW A;  2R93 J;  1A5J A;  4CYC B;  1DU0 A;  1GUU A;  5EG0 B;  1GDT A;  1ETX A;  4JYK A;  1A6I A;  1MBF A;  5FKK A;  5J1Y A;  2DA5 A;  5GP9 A;  4A3F J;  1IGN A;  4FE7 A;  1B8I A;  2HXI A;  2VI6 A;  3HDD A;  2HI3 A;  3ZQI A;  3B6A A;  1TWH J;  3PM1 A;  3WHC A;  1MH3 A;  1Q1V A;  2XGC A;  3JRC A;  4V2G A;  3LSG A;  1LFU P;  1IRZ A;  1TWC J;  2K40 A;  2M9H A;  5IP7 J;  4BY1 J;  2DMN A;  3OSG A;  2EH3 A;  2DMQ A;  2JWT A;  2OPT A;  4MFD A;  1HF0 A;  1NTC A;  1Y1V J;  4MO7 A;  3LSJ A;  3HGG A;  3ZQL A;  2D5V A;  1BL0 A;  1VFC A;  5DS9 A;  1B8I B;  3RQI A;  4ABZ A;  1RKT A;  2JA6 J;  3OSF A;  3S16 J;  5F04 A;  3NAU A;  3TED A;  4A3D J;  2VKE A;  2ME6 A;  1FTZ A;  2EZI A;  2R92 J;  5IYC J;  3FIS A;  4FCY A;  2JA7 J;  2CJJ A;  3Q0V A;  4V2F A;  1I50 J;  4DYQ A;  2TCT A;  1ZKG A;  5F0C A;  1G2H A;  3IH2 A;  1SAN A;  4J19 A;  3BTC A;  2XB0 X;  5M5Y J;  3O8G A;  3FK7 A;  3SJM A;  4W1U A;  4BY7 J;  4A3M J;  2EZH A;  5EDN A;  3CMY A;  3ZQC A;  2E1O A;  1VND A;  4UUS A;  3BG5 A;  1LE8 A;  2B63 J;  3GTP J;  1BW6 A;  1JJ6 C;  2H1K A;  2CQX A;  2L7F P;  3HOU J;  4RDU A;  1JGG A;  1NK3 P;  2AO9 A;  2P81 A;  2E2H J;  2YU9 J;  1WH5 A;  2WV1 A;  1XG1 A;  2M34 A;  1JKP C;  1R9T J;  2LVS A;  1U9O A;  2VPR A;  1E3O C;  1T56 A;  2XPW A;  3C2B A;  3BR2 A;  5IYD J;  3MKL A;  3HOX J;  4XRM A;  3HKZ N;  3BR3 A;  3JRD A;  4A3G J;  2Y30 A;  3JRB A;  1RES A;  2Y0S N;  1ETW A;  1JTX A;  4IHY A;  5GPC A;  1ZGW A;  3A03 A;  1LE8 B;  4UUS B;  3BG3 A;  5FKL A;  4A3B J;  1RR7 A;  3BT9 A;  1HOM A;  1ETV A;  4JX6 A;  5E3O A;  1GV5 A;  5C44 J;  3S2D J;  1QVT A;  1MBG A;  4Y7N J;  4L5E A;  2L7M P;  3NAR A;  3OIO A;  4FTH A;  1U8B A;  1ZR4 A;  5E3L A;  1LFB A;  1MBJ A;  3O8H A;  1F36 A;  3BR1 A;  2M2E A;  1YRN B;  1MBK A;  3PO3 J;  2OF7 A;  1QVU A;  2Y31 A;  2IAI A;  2L7Z A;  4QTR A;  4C3J J;  2I10 A;  3S1M J;  3F0C A;  5J3L A;  4D5F A;  2HDD A;  4D7N A;  2E2J J;  2HOT A;  4UUT A;  1Y1W J;  3LSR A;  3HM5 A;  1HDP A;  4A3I J;  3MN2 A;  5F1J A;  5EEA A;  1IV6 A;  3JR9 A;  2G0E A;  1OCT C;  4A3K J;  5EF6 A;  1XC5 A;  5IPA A;  4A3C J;  2N8G A;  1K61 A;  9ANT A;  1ZTR A;  2LTP A;  3I4M J;  3B6C A;  2LD5 A;  5C3E J;  3G1M A;  2LR8 A;  2NVT J;  2Y9Y A;  1HLV A;  5DTD A;  2NVX J;  4DZP A;  2FD5 A;  5M5W J;  3S1R J;  2HXO A;  3K7A J;  4MIM A;  3LNQ A;  1RKW A;  1W0U A;  2IBD A;  1RPW A;  3CCY A;  1BA5 A;  2CUE A;  2AHQ A;  3GBG A;  2M8G X;  1ZQ3 P;  2XGD A;  1T33 A;  1TWG J;  1ZR2 A;  2K9N A;  3GTM J;  5E3M A;  4XK4 A;  5F08 A;  2ECC A;  3D1N I;  1MNM C;  3GTQ J;  3H3V K;  2CQQ A;  3S14 J;  3W6V A;  2Y9Z A;  2R0Q C;  2YUS A;  5JLX A;  3RZD J;  3HEF A;  3JRG A;  1BJZ A;  1P7J A;  3HOV J;  4C2M J;  3DEW A;  4MFE A;  1IUF A;  3DCF A;  3MVP A;  3IV5 A;  2ZB9 A;  4B4C A;  1Z0X A;  2CRG A;  4XRS G;  1D5Y A;  1JT0 A;  2LP0 A;  2ME0 A;  3GTO J;  2WB1 N;  2DMT A;  4W97 A;  4IEJ A;  4QIW N;  1MBH A;  2LLK A;  2KDZ A;  3PO2 J;  1TWA J;  2EBI A;  4M3E A;  4LOC A;  2XB5 A;  5IOY A;  3FK6 A;  4AUX A;  4IHV A;  5C4J J;  5J1U A;  2X6O A;  1MSE C;  4GFB A;  1I3Q J;  1JJ8 C;  2JA8 J;  2DJN A;  2DA1 A;  3CDL A;  2E19 A;  2DA4 A;  5K7F A;  5M3M J;  4Y52 J;  1JKR C;  2HQ5 A;  2LKX A;  2L0K A;  1JUP A;  3JRI A;  2M0C A;  3SDG A;  3GTK J;  3FKI J;  3TP0 A;  1NK2 P;  2HOA A;  2KT0 A;  4M3G A;  2PMZ N;  4EEF G;  5IYB J;  3ZOB A;  5IOZ A;  3HOW J;  4X6A J;  5F0H A;  1JKO C;  1ETQ A;  2GBY A;  1IDZ A;  2EZL A;  4IHW A;  1FIA A;  3G1L A;  3BR5 A;  2NVY J;  2ELK A;  1OCP A;  2DTZ A;  3BR6 A;  1QPI A;  1ENH A;  5E3N A;  1W0T A;  4C3I J;  1IG7 A;  1UMQ A;  2WAQ N;  1I6H J;  2HOS A;  5GPA A;  1WGX A;  3VPR A;  3Q0W A;  2GLO A;  2X48 A;  3A01 A;  1VI0 A;  4CYC A;  1TC3 C;  2EQR A;  2NOG A;  5EG0 A;  1F43 A;  3HB9 A;  2ECB A;  1APL C;  3QPL A;  2W48 A;  2LY9 A;  4X1E A;  5FLM J;  1ETY A;  5HOD A;  3QPS A;  2JA5 J;  3BR0 A;  1U78 A;  5FLV A;  4B3A A;  4HNV A;  2XSD C;  3GTG J;  3S17 J;  5M3F J;  2O8K A;  1POG A;  2MSY A;  3S2H J;  5JLW A;  2XPV A;  1JTY A;  3TW6 A;  3JRE A;  1XS9 A;  1X2N A;  2ID3 A;  1ITY A;  1GV2 A;  3TP3 A;  3IH3 A;  3A01 B;  2X9D A;  2R5Y A;  2MGQ A;  1AKH A;  3S1Q J;  3S1N J;  1TWF J;  3WHB A;  4C3H J;  4DW6 A;  2GM4 A;  2DA6 A;  4JP0 A;  2XRL A;  4BXX J;  1ZK8 A;  2XPU A;  2TRT A;  1H8A C;  3M3Y J;  3BTI A;  4G12 A;  2DMP A;  1BW5 A;  1UG2 A;  4MLO A;  3BTJ A;  2RAE A;  4BKX A;  2R7Z J;  4A3L J;  2Y2Z A;  2L9R A;  4M6V A;  3HGY A;  1SFO J;  1JUS A;  2VKV A;  3ZQF A;  1O4X A;  1WH7 A;  1FJL A;  3RKQ A;  1B72 A;  2E2I J;  2O9L A;  2R5Y B;  3I4N J;  1UHS A;  2LK2 A;  1AKH B;  4BBS J;  1ORK A;  3S15 J;  2FJ1 A;  1FIP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...