4XRSG

Heterodimeric complex of transcription factors meis1 and dlx3 on specific dna
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
56
structure length
56
Chain Sequence
KPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords DNA (5'-D(P*CP*AP*AP*TP*TP*AP*TP*CP*CP*TP*GP*TP*CP*AP*A)-3')
publication title DNA-dependent formation of transcription factor pairs alters their binding specificity.
pubmed doi rcsb
source organism Homo sapiens
total genus 7
structure length 56
sequence length 56
chains with identical sequence I
ec nomenclature
pdb deposition date 2015-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4xrsG00
5M5XJ 1ORKA 2DA2A 1VI0A 3WHCA 2HOSA 1RESA 4CYCB 1JKOC 4UUSB 4A3MJ 2I10A 3JR9A 2R92J 5EG0A 3NAUA 1CQTA 1TWGJ 2E2JJ 3OSFA 1Y1WJ 1JUMA 4DYQA 1IJWC 3BR1A 5GPCA 2AHQA 1JKQC 4BBRJ 1MBFA 2XGEA 1ZKGA 3A01B 3QQAA 2MG4A 1X2NA 2IEKA 2X48A 2XPUA 4FISA 3S15J 4A3LJ 3GTPJ 4C3HJ 1NK2P 3BG5A 3G1LA 5FKNA 3SJMA 3HOZJ 4FE4A 1TWAJ 4Y52J 5IYDJ 2HXIA 2ID6A 2HOTA 1U9OA 5M3MJ 1JT6A 2ME0A 2FD5A 1IGNA 3BTLA 4MFEA 4L5EA 5IOZA 4BY1J 4CYCA 3CCYA 1JUSA 2QF7A 4AUXA 4C3JJ 1I6HJ 1Q1VA 2DA4A 4NDLA 2K9SA 2Y9YA 4JX6A 3CDLA 5BNGA 3OOUA 3GTMJ 2DMQA 2CU7A 2IAIA 4XK4A 1DU0A 1VNDA 1B8IB 4XRSA 1AHDP 1O4XA 2JJ7A 2VPRA 2CQXA 4JP0A 1G2HA 1IV6A 3NARA 2O9LA 2K9QA 2M2EA 2OPTA 3HOWJ 1ETXA 3C2BA 1LE8B 2YUSA 2NVYJ 2W48A 2R7ZJ 4MO7A 3IV5A 5EZHA 2R0QC 5F1JA 2LD5A 2DMPA 5F0FA 4ABZA 1FIPA 1JKPC 1ZQ3P 3FKIJ 3JRDA 1JGGA 1K83J 2DA7A 3GTKJ 4Y7NJ 2XSDC 1JTYA 4M3DA 3S1RJ 2MW8A 2M9HA 1FTTA 1H89C 4D7MA 3HGGA 1OCTC 4XIDA 2EZKA 5F08A 4C3IJ 1MBHA 3JREA 5EG0B 2KT0A 2DJNA 2L0KA 3UKGA 2FJ1A 4GFBA 1RKTA 1DU6A 2NVXJ 3HOVJ 3JRCA 3FISA 3B6AA 2NS8A 3Q0WA 2CJJA 2RAEA 2WAQN 1BA5A 3BR6A 5FKKA 3WHBA 2FX0A 4IHYA 4M3EA 2NS7A 1D5YA 1SFOJ 2DMUA 4B3AA 3GTLJ 2JA8J 4S0HB 1OJLA 2IBDA 2LK2A 1JT0A 2TCTA 2DN0A 1ETQA 2OF7A 3LNQA 2CRGA 1TWHJ 5J3LA 1UMQA 1B72B 1ETKA 5HODA 3G1OA 4A3EJ 2DMNA 3S2HJ 2EZHA 5J1UA 1MBEA 3BR0A 1BL0A 3TW7A 3GTGJ 1FEXA 2EZLA 5E3NA 1X2MA 3ZQFA 3A03A 3FK6A 1IRZA 1GV2A 1QPIA 1SANA 3HBLA 4DYRA 3VPRA 1GVDA 5K7HA 1ETYA 3TW6A 1WI3A 4XRMA 1JJ8C 1R9TJ 2M34A 4BY7J 3TP3A 1NTCA 3BQZA 4LOCA 3HDDA 4B1RA 2DA5A 2B63J 2EZIA 5IP7J 2ECBA 3OSGA 4FTHA 1QVTA 5IOYA 1U9NA 5IYCJ 1W0UA 2FQ4A 1H88C 2X6OA 3BTIA 3SDGA 3HB9A 5M3FJ 3HOYJ 1NK3P 4EEFG 1JUPA 3GBGA 3RZDJ 2EQRA 1B72A 1XG1A 5EF6A 4BBSJ 5C3EJ 3BG9A 1Y1VJ 2ME6A 2TRTA 3HEFA 1WPKA 4A3BJ 4MFDA 3ZQHA 5K7FA 1IDZA 2VI6A 2Y30A 5GP9A 5E3LA 1HDDC 1HDPA 5GPAA 2GBYA 1MBGA 2LKXA 3HKZN 3I4NJ 1IG7A 3DEWA 3H0GJ 1U8BA 5FKLA 5DTDA 1MSFC 4BXXJ 1BW5A 2K40A 2XB0X 5FKMA 3S2DJ 4X1EA 2M8GX 5DS9A 2LR8A 4QTRA 1AKHA 1LFUP 2R5ZA 1MSEC 5IYBJ 1QRYA 1F43A 3JRFA 1FIAA 3G1MA 3RZOJ 4FCYA 2WV1A 5EGOA 2VKVA 2ELKA 3BT9A 4RDUA 4AYBN 1BJZA 4I6ZA 3S16J 2HI3A 2LLKA 3LSJA 1ZR4A 4A93J 1EF4A 3M3YJ 4M3GA 2JK3A 1OFCX 5F0CA 2L7MP 3BQYA 1MBKA 1PUFA 3QPLA 1JTXA 2H1KA 1ZTRA 1U78A 5JLXA 2NVTJ 1H8AC 2XB5A 4DZPA 4V2FA 3H3VK 2JMWA 4IEJA 3ZQIA 5F04A 3Q3SA 4A3IJ 2D5VA 4QSHA 2LFBA 2XRLA 3Q0VA 1FTZA 1WCMJ 3IH3A 3RKQA 3S17J 4MIMA 3MVPA 1P7IA 1RR7A 1GV5A 2XGCA 3ZOBA 2DA1A 5K7ZA 1W0TA 4JX4A 5JLWA 1FJLA 3I4MJ 4V2GA 5C4JJ 2CUEA 2X9DA 3S14J 4X6AJ 2Y31A 3GTQJ 3S1NJ 4W97A 3LOCA 3D1NI 2DA3A 1IDYA 4A3FJ 5C4XJ 2HQ5A 2JA7J 1GT0C 1I50J 2GM4A 2M0CA 1WGXA 4A69C 3ZQCA 1MH4A 2CUFA 5IP9J 1MNMC 3ZQGA 2CQQA 2LY9A 2HYJA 2LTPA 3QPSA 4XRSG 1APLC 3GTOJ 1HLVA 1Z77A 3PO2J 1AU7A 4A3DJ 2MSYA 2MGQA 3Q0UA 3GTJJ 2E1OA 1YRNA 1ETVA 5E3OA 2JA5J 1MBJA 2COBA 2ECCA 1P7JA 1ETWA 5F27A 1HF0A 2DTZA 2Y0SN 5C44J 2R93J 1T56A 3JRHA 1JJ6C 1AKHB 1ZGWA 2R5ZB 1T33A 1I3QJ 1UHSA 1A6IA 5EDNA 5FLVA 4QIWN 5E3MA 5EGOB 2HOAA 1GDTA 3BTJA 4FE7A 3FK7A 5M5YJ 2G0EA 1HCRA 3HOXJ 2GLOA 3E7LA 1POGA 3SFIA 1A5JA 2ID3A 1QVUA 1ETOA 4DZJA 5FJ8J 3CQZJ 3LSGA 4XICA 1PUFB 3BR5A 1ZK8A 2E2HJ 2YU9J 1X58A 1BW6A 4A3CJ 2LVSA 2N8GA 4D5FA 1TWFJ 1VF9A 3B6CA 1JKRC 4AC0A 4UUTA 3K2AA 5EEAA 4IHXA 2XPWA 4J19A 2HXOA 3RQIA 2H8RA 2QCOA 3TEDA 2R5YB 5FKOA 4IHWA 2JA6J 4D7NA 2ZB9A 2XPVA 5EZGA 3JRBA 3ZQLA 1F36A 1K61A 4M6VA 4I76A 4JYKA 2P81A 4UUSA 3PM1A 4IHVA 2HDDA 2E2IJ 2O8KA 4DYCA 4W1UA 4DW6A 2VUMJ 1Z0XA 4MLOA 2L9RA 3K7AJ 1MH3A 2EH3A 4M3FA 4HNVA 4B4CA 3HGYA 5J1YA 1E3OC 2E19A 5J1RA 3OIOA 1ITYA 3A01A 3BG3A 4A3GJ 3L1PA 2PMZN 3MN2A 2XGDA 3S1MJ 9ANTA 2JN6A 3IH2A 1ENHA 1IC8A 3FIWA 2LP0A 4G12A 3HM5A 3JRIA 4A3JJ 2R5YA 3DCFA 4C2MJ 4BKXA 2WB1N 1RETA 3BR2A 3F0CA 3MKLA 5FLMJ 1ZR2A 1YRNB 3LSRA 2KDZA 3JRAA 2O7OA 2NOGA 3PO3J 1WH5A 3A02A 1TC3C 1VFCA 2L7ZA 2DMTA 3S1QJ 3O8HA 2NVQJ 3LSPA 3W6VA 3IH4A 1B8IA 5M5WJ 2Y9ZA 1GUUA 4D5CA 1HOMA 1OCPA 3O8GA 5IP6A 2EBIA 4M3BA 1RPWA 2DA6A 1UG2A 1LE8A 3BR3A 4JX5A 3CMYA 2K9NA 2AO9A 3TP0A 1XS9A 1RKWA 4RBOA 1S7EA 1XC5A 2YS9A 2Y2ZA 5EYRA 1LFBA 2VKEA 2JWTA 3HOUJ 5F0HA 3M4OJ 3BTCA 1IUFA 1WH7A 2L7FP 3JRGA 5IPAA 4A3KJ 1TWCJ
chains in the Genus database with same CATH superfamily
2UXNA 3PFIA 3CMEI 1P4WA 5FRMA 3R0JA 4EJOA 1PP8F 2HOSA 3RI4A 2KZVA 2W25A 4UV8A 4UUSB 3RQ4A 3F22A 3EETA 4KN4X 4RAFA 3ZMDA 3HSFA 2DODA 2XRNA 3GFJA 5HLGA 2A6TA 3EUHC 1Y1WJ 1I39A 2FEZA 1BI1A 4KT6A 1WI9A 3JTHA 1JKQC 4BBRJ 1MBFA 4GXOA 3SHFA 1VQKI 2LOOA 1HXDA 3QQAA 1X2NA 4A2UA 2F5FA 1ZGJA 2IEKA 2X48A 3FF5A 3QP5A 1FX7A 3R4KA 4HZFA 4A3LJ 3OYFA 4C3HJ 3HUGA 5KK1A 3OWTA 2X6YA 3SJMA 3OY9A 2XKPA 4H0EA 1TWAJ 2DYRH 1WQ2A 4Q47A 5IYDJ 4QWQA 2HOTA 5CQGA 2X0LA 1IGNA 1ZRDA 4BJTA 4EMSA 4L5EA 4AUXA 3HOTA 2Y0MA 1V4RA 4JX6A 4JK1X 5BNGA 2WBMA 3I55I 4ZZDA 2CU7A 3LMMA 4XKBA 2LBFA 2JJ7A 2ZNYA 3AKZA 3LSHA 4XL9A 2L3DA 2RC4A 2CYYA 3BPVA 2KRHA 3FZVA 4M74A 4N4NB 4BXFA 1S5LC 1ZN2A 2M2EA 2XF7A 4M72A 2P6TA 2C6YA 1L3LA 4IRHA 4AIDA 3OYAA 1LE8B 1SVMA 1B1BA 3DQVC 1XSDA 1BI2A 1LPQA 2QENA 1OR7C 2DLLA 2K3PA 2FU4A 4GGGA 3BZCA 1FPQA 2JPBA 2LC2A 5EZHA 4EQQA 2DMPA 3H36A 4U0WA 4G9YA 2Z3YA 3GCMA 3P5JA 4JBAA 4Y7NJ 3LSKA 5FLXK 1OMIA 4M3DA 4XSXF 4LD5A 2VT3A 1FLIA 1IZ1A 2ETHA 4ZYHA 5FD6A 2KJCA 4A0ZA 4G94A 3OOPA 2W00A 2F5CA 2V9PA 2DT6A 1XCBA 2VOOA 3CUQB 2IGOA 1OCTC 2DFEA 2M4KA 5F08A 1D1CA 2DO7A 2K4JA 3MKYB 5EG0B 4BJ5C 3OYJA 2L0KA 3UKGA 2ZO4A 3DPUA 3V7RA 1OLTA 4J00A 1YO5C 3AG2H 3OYHA 4PSWA 4ZDLA 3T8RA 3JRCA 2CSOA 4UHTA 2W82A 3HOVJ 1R5HA 2A3SA 2TDXA 2VBWA 2X4HA 3K69A 2BXZA 3N97A 4CH7A 5KNLA 4I01A 4RMNA 3HC7A 4UXNA 4PZJA 3DTIA 1BN5A 2V6CA 4M3EA 3VOEA 4D1QA 1UJ8A 1EH6A 1X1CA 2EV0A 3OYIA 3BROA 4ZYDA 3ELKA 2LK2A 1X1DA 4EV0A 2TCTA 3LNQA 1ETQA 4HX4A 3RIRA 2P7CB 3BZKA 5J3LA 5LHHA 1MW7A 2DQLA 4XKVA 4A3EJ 3TKYA 2YX7A 2XV4S 1WJAA 5ICEA 2NVUB 3JAMZ 3HSRA 4BGDA 3BR0A 1T6SA 3IKTA 1FEXA 1XX5A 5E3NA 1X2MA 3CP2A 3KP4A 5CVVA 1X1BA 3ZQFA 5DM7F 2DDBA 1KU9A 2YPRA 1SANA 1KU3A 2H1LA 5LBQA 3HBLA 3BJOA 1DPRA 1WI3A 2VASA 1ZGAA 4M6XA 3LSTA 3VDXA 2BZTA 2XDVA 4FETA 3TP3A 3BQZA 4ZC3A 5BS6A 1T08B 1H9GA 2A69F 3JW4A 2XKOA 5H20A 3K70D 4KITB 3OSGA 1Z05A 2K3FA 1QVTA 2ZCWA 4ITVA 1H88C 2BE5F 4PUSA 4XR6A 3BTIA 3SDGA 4FASD 3OYLA 1F1ZA 5HLHA 1EJ9A 3KZZA 2EQRA 4ASNA 4WX9A 4I0AA 3NQOA 5EF6A 3IL2A 4GYGA 3H9GA 2OUMA 2JRTA 1Y1VJ 3BG9A 3IHUA 2A6EF 4A3BJ 3EQLF 4WXCA 2OQGA 2EFPA 3K2ZA 1RR8C 2HQRA 5K7FA 2WADA 3LFUA 2Y30A 4HF0A 5HS9A 2ZBKA 4B43A 4LK1F 2MD5A 4BQAA 3H0GJ 2P6SA 2HDCA 2RNJA 5J4VA 1TBXA 2K40A 5TRDA 1OYYA 3WTWC 2M8GX 3WTVC 5E1WA 1MSEC 1QRYA 1ZREA 2M1BA 5HDGA 3FXUA 3G1MA 2KHMA 3LA3A 4AYBA 4I99C 3S16J 3V7CA 3AAFA 2K27A 3BT9A 4AYBN 2Z16A 2M0MA 3B02A 1IXCA 3ZXSA 4PGHA 3PL8A 3QYBA 4XM3A 3L2WA 1KQ8A 1OFCX 1D0XA 1OQYA 4HV5A 3GWZA 5K1YA 2QKLB 1MKMA 1PUFA 5CLSA 1ZTRA 2HKOA 4XLNF 3RTRA 3CC4I 1O7LA 4BNCA 2NVTJ 1LUJB 4G6QA 1IN4A 3V8LA 5D5UB 5TGTA 3H3VK 4UB8C 4GCVA 4A3IJ 2Q2EB 1VQPI 1WCMJ 5CQEA 1KQ9A 3RKQA 2BHZA 5HLIA 3S17J 2DT5A 2K85A 4XRFA 3ZMTA 1GV5A 2GXAA 2DA1A 4BEHA 4N0BA 3E5XA 2OQRA 2HEOA 3REOA 2VODA 1RZ4A 2ESHA 3I54A 3U1KA 2CUEA 2FUG2 2Y31A 3GTQJ 4W97A 4X0GA 3LOCA 5LFAA 1UAAA 1RUNA 3QYFA 2MD0A 1O57A 4A3FJ 1I50J 2GM4A 1H9TA 1WGXA 3KFWX 3Q9SA 2R7WA 3ZQCA 1MH4A 5AONA 3CCSI 2HVSA 3HOSA 1EV7A 1YIOA 2RN7A 1A6QA 2HYJA 2Q0OA 3GTOJ 1HLVA 2L5QA 1MMGA 3PO2J 2WAEA 3F8CA 1WWXA 4A3DJ 2KDOA 2ZXJA 3IP4B 4CCJA 1JHFA 3PSFA 2XASA 3VFZA 1ETVA 2W57A 5KAIC 2KIUA 2COBA 1VQ6I 3DXJF 1W5SA 1EA3A 5F27A 1NG7A 2R93J 1Z67A 5LGNA 1XN7A 3JRHA 1JJ6C 3DPTA 1FYKA 4Y33A 3QRFF 1ZGWA 1AKHB 3LSIA 1Z6TA 3WGGA 2L4MA 1DQUA 5E3MA 5EGOB 1MDMA 4BHCA 4L0ZB 3KYLA 4TV7A 1S7OA 5M5YJ 4KT5C 1HCRA 3E7LA 5K5OA 1BR2A 2DDAA 2ID3A 3D5SC 2LNBA 4RB1A 4II2A 5FJ8J 2V4JC 2QVOA 4QPOA 1TT0A 5D5WB 1ZK8A 2YU9J 1BW6A 1X58A 2EIKH 1WJEA 2N8GA 4YFKF 2ZSHB 1VF9A 1XSVA 4EVIA 2EWNA 4J19A 2HXOA 3RQIA 4U7DA 2EINH 5FKOA 3LQQA 2Z5UA 1V54H 5B1BH 1UELB 2VN2A 2B9SA 3JRBA 2UUZA 5B66C 3QP6A 4UUSA 1LB2A 2IT0A 4MEYF 3F9KA 2WAFA 2CMPA 3DBHB 4W1UA 2UZKA 2STTA 4MLOA 2FOWA 3R61A 1E3OC 5L3BA 5A2QZ 2E19A 1R23A 4YELA 4Y13A 4ZYEA 3L1PA 1N77A 3ML6A 3MN2A 2XGDA 3S1MJ 3J81K 3K6GA 3VYSB 4IZZA 1SVLA 1SMTA 3FIWA 1FSHA 2LP0A 1SMYF 2K7LA 3BC8A 4NBQA 2G9WA 2EIJH 4RB3C 3JRIA 4WK8F 4C9YA 4A3JJ 4C2MJ 1T2KA 2ZJPF 4HNUA 3VSLA 2IS4A 4HX7A 1RETA 2DFHA 2H6BA 3TQNA 1YRNB 3LSRA 2KDZA 4IQ4A 5DUKA 2NOGA 1WH5A 3A02A 2YR2A 3R6SA 2L7ZA 2V6EA 2KIMA 3H1CA 3S1QJ 2AXTC 1YX3A 4LIUA 3PUFA 4MQVA 3E6BA 3W6VA 3IH4A 3ERMA 1DUXC 2L9NA 4Q5SF 3HJEA 4XMYA 3F6VA 2CS3A 2ZXHA 2HTSA 3K70C 1IN8A 4CA0A 1QGPA 1SFEA 3O8GA 4WCGA 5FFXA 3T1BA 3GEZA 3TDUC 2KKOA 3HYIA 1W5CC 3KP3A 3I4PA 3SXYA 2GXBA 1LE8A 4JX5A 1PJRA 2K9NA 3DU5A 3S8PA 3H0DA 1DGWY 4XQFA 2LY1A 1XS9A 3I58A 4CCNA 1XC5A 4EATA 2M4GA 1MMDA 2ZNZA 4BUPA 3CTAA 4BS9A 4HDVA 5KCMA 1LFBA 4A6DA 4LG0B 2VE8A 2VJJA 2JWTA 1R49A 4A12A 1UZCA 3QODA 1ACIA 5BMZA 3BTCA 3CMMA 4IPAA 3G71I 2EFWA 2DK5A 1T38A 2L7FP 4A3KJ 3C3WA 4I09A 4LK0F 3RKXA 3M3YJ 4RAGA 1OISA 1ORKA 2DA2A 3E97A 1QPMA 3WHCA 2RQPA 3K4NA 3DU6A 2CUZA 4E6KG 4G6DA 5L3CA 3CUQA 4NC8A 5CPRB 2I10A 3ECHA 4G8XA 4XLAA 1QA6A 1A35A 5EG0A 1YJ9I 3NAUA 1ZG3A 2KP6A 1TWGJ 3H3UA 1P2FA 3TOBA 3ZMSA 3OSFA 4AIHA 3P9CA 1FBQA 4DYQA 2DJIA 2EV6A 3KCCA 5GPCA 1ZKGA 2NOJB 1X4PA 3A01B 5ERIA 2FMYA 2MG4A 1K4TA 4ENNA 3S15J 1S29A 3FWEA 1Z21A 3OR2C 4KDPA 3BG5A 3J7AY 4UNOA 2XC7A 1Z6RA 3HOZJ 4OOIA 4BACA 4RGXA 2F4OB 2IGMA 4LG3A 2VQHA 1USSA 3KLNA 5J47A 2CG4A 2EJRA 4HLXA 1U3EM 3HTSB 1E2XA 1T95A 1RNLA 2G7HA 2FD5A 1B6AA 3BTLA 2LY2A 4OIPF 4HDUA 2IA2A 2R4GA 5DV5A 2PJPA 5IOZA 3SDBA 4CYCA 2MBFA 1JUSA 3S2WA 2E1CA 2DA4A 2M3AA 1X3WB 4DBQA 3CDLA 2V1UA 4XLPF 5HS7A 3H9JA 4U87A 3KP7A 3GLXA 4ESJA 2AQEA 1UHWA 3IAM2 4L18B 1G2HA 4DQ2A 4BDYA 2O9LA 2KPMA 2QSFX 4OMYA 1WKMA 5DCMB 3ZMZA 2O5RA 5B5EC 3LAPA 3LAJA 1Z7LA 1ETXA 3G3ZA 4RAZA 4WWCA 3MMYB 2R7ZJ 3A2KA 5ED4A 4JQFA 3IV5A 1FOYA 1GLNA 1V3FA 2R0QC 1QU3A 4KNYA 5E8GA 2IJLA 4A5MA 1ODDA 2VQCA 2IA0A 3HXLA 1YQAA 1U5TB 4P9UA 2XSDC 1JTYA 3I59A 3U2RA 2MW8A 4IKFA 3CCQI 1QNTA 4HQEA 3DTKA 2DBBA 4H4KC 2Z9OA 4V19K 2X1DA 2QSGX 5DDGA 4E70A 1LEAA 2V79A 3L09A 3WTXC 4D7MA 5ILVA 3ONQA 4XIDA 2VKHA 1U2WA 3M8EA 1BOAA 1MBHA 4C3IJ 2AXLA 2MYSA 1NG6A 4B44A 2DJNA 4UY8I 3OS2A 4BYYA 2CW7A 2NVXJ 4OINF 1QZYA 4I0BA 5CKTA 4ZTFA 4IOAF 3LQRA 2ELJA 3B6AA 3H5NA 5JHFA 2A5YB 2VXDA 3KP6A 1TTYA 2ZMEB 2UXXA 1XGSA 1YW8A 2FX0A 4CCMA 2F6CA 3G6EI 1LEBA 1D5YA 4GDFA 2VIXA 4KIGA 1SFOJ 3RKYA 3SZPA 4B3AA 4R79A 3GTLJ 1OPCA 2JA8J 4S0HB 1Y0UA 2OF7A 2ZXIA 5CYVA 1B72B 2DMNA 2EPFA 3KP5A 2W84A 3I9V2 1WJCA 2GOMA 1A31A 3GVAA 4B48A 4AU7A 2EZLA 3MZYA 3BWGA 1HW1A 2Q2EA 2V26A 5D4SA 4NQWB 1IRZA 1XMXA 4YIFA 4BE0A 2P0WA 1BBYA 3FM3A 2DOAA 1SD5A 2VXZA 3HZJA 4L0YB 2QBYB 3V4GA 4HNTA 3VPRA 5D4RA 1GVDA 3CCRI 1JJ8C 4XRMA 1R9TJ 1G8XA 4HW0A 1D8JA 2HQAA 3JSPA 2B63J 2BVLA 3LA2A 4F52A 2DQRA 1PYVA 2JTVA 4LITA 4FTHA 2K02A 2QSHX 4D0PA 5IYCJ 5K5QA 2RGVA 4CXFA 3J7ZI 4P9FA 3HB9A 4G7ZF 1NK3P 4EEFG 3GBGA 4OWRB 1WVRA 1KGSA 2CQ7A 3L7WA 2KIFA 4IQJA 5IT9Z 1YX5A 1XG1A 3HHGA 3ISPA 2BY3A 3I53A 4N9IA 1GXQA 2HGCA 3U21A 3K4CA 4MFDA 1D5VA 4E7IA 4BE2A 4E4HA 2IA1A 3ECOA 2JQ7A 3CCVI 5EEHA 3I56I 4L9NA 2OCEA 3OIPA 4YIRX 1HDDC 3ZR8X 3D0SA 2GBYA 3TL4X 4IL6C 1RIOH 3I4NJ 1MNEA 2V9VA 1U8BA 2QLZA 5LRRA 4RLFA 4L5JA 1BW5A 4NNJA 4LB6B 5DS9A 4CUGA 4OIQF 1AKHA 3ABKH 1LFUP 3PQKA 1RC9A 1B4AA 3ULQB 1FBUA 5LLQA 1F43A 3JRFA 3I5UA 1FIAA 1BM9A 1J75A 1MMNA 2WV1A 2VKVA 5EGOA 4BHBA 4I6ZA 1BC7C 2QUFA 5BOXA 2HI3A 1Y39A 4A93J 1EF4A 4WF2A 3P9KA 2HU9A 1XB4A 4M3GA 2HTJA 1G4DA 5F0CA 2L7MP 5DEQA 4RS8A 3BG7A 1MBKA 1ON1A 2LRDA 5L3GA 1IO2A 1R36A 1G59A 3DTEA 1MJ9A 1U78A 1WJDA 2H94A 3OR1C 4YEJA 5H6QA 1RRJA 4HF1A 1FP2A 1J0RA 3E6MA 3Q5FA 4RB2C 4V2FA 3OIQA 3T8TA 4HV6A 2PN6A 1VQLI 5F04A 2L4AA 2D5VA 5F64A 3CCMI 5HNFA 3MQ0A 2LFBA 4QSHA 2O0YA 2FSWA 2RREA 3IH3A 2A07F 1MZBA 4GO1A 1P7IA 4MIMA 5CJ9A 3DFGA 4HEA2 1YJNI 1FJLA 2DPDA 3AFHA 2IRFG 2V1XA 1G3WA 2XGXA 1K79A 1R58A 2NRAC 3G2BA 5C4JJ 4MEXF 1E3HA 1Q1HA 1K4SA 2MFZA 2YSRA 1QZEA 3MKWB 2DOEA 3D1NI 1ONVA 5FB2A 2DA3A 3KPHA 5C4XJ 4PDKA 4HG2A 2HDWA 2M0CA 2VBYA 3F6OA 5IP9J 2EA4A 1ZRCA 3WU0A 2OTJI 4U88A 3FXOA 4IO9F 2LTPA 3QPSA 1W7PD 1Z77A 5LEKA 1TNSA 2JVHA 3K1NA 2R7XA 1VZ0A 4P96A 3TO6A 2E36A 1BJAA 2MSYA 1P92A 1BR1A 2MGQA 1YOVB 2GA2A 2D1VA 3Q9VA 1KYZA 1YRNA 1YE9A 2DYSH 2VBXA 1REPC 5E3OA 2R7TA 3SFZA 3WE3A 3IC7A 1F4KA 3FDYA 4RGRA 1B59A 1P7JA 2ZJRF 2FQ3A 1PDNC 4BJ6C 2CUJA 2R5ZB 4FQGA 1I3QJ 2HKXA 1UHSA 1VQMI 2KLOA 1ERDA 4DBRA 4FX0A 2BGCA 2OJED 4Z6YA 3M7GA 2KL4A 2G0EA 2MLGA 3KIOA 3KEQA 3JTGA 1POGA 3OMYA 2MC3A 1I1SA 5DD8A 3JSOA 2Q1ZB 4LMYA 4ENMA 2B0LA 5CVJA 3K0LA 1IN7A 3WTZA 1MIJA 2LVSA 5L3DA 3DEUA 4IHXA 4UUTA 5EEAA 3OL3A 4EGYA 1FOXA 1LKXA 3HPGA 3DP7A 2QCOA 3S93A 3TEDA 1TNTA 2K86A 3H5AA 1BIAA 2XPVA 1K61A 1F36A 1TW3A 4JYKA 2BV6A 1FZPB 2ELHA 2IS6A 3WU1B 4IHVA 5KAFC 3B73A 1S72I 1OCRH 3ASNH 3H92A 2E2IJ 3ABTA 3K7AJ 1MH3A 2EH3A 4ESFA 1OYIA 2WC2A 3QAHA 4CYDA 3BLYA 4XN0A 5J1RA 3HRTA 3ABUA 2PMZA 3A01A 4A3GJ 3F21A 2PMZN 4E7KA 3L2UA 2EA2A 2R7VA 9ANTA 2JN6A 2HYGD 2WY8Q 5GTIC 5FGMA 3HM5A 4I02A 3CESA 1V5FA 2OZUA 2P8TA 1HSTA 1LNWA 4PJJA 1T39A 3C1DA 2FF4A 4HA8A 2VJ5A 2R5YA 3DCFA 1IRXA 3DLLF 1FY7A 2RV8A 2V1DA 4P55A 5FLMJ 3OYNA 1RI7A 1LVAA 2UV1A 1NH3A 2O7OA 5IY5H 2PJRB 3PO3J 2QKMB 3DKYA 4PFPA 5FO5A 2WTEA 1C0WA 5LGTA 1J2XA 1ZAOA 3K4JA 4QPQA 3LSPA 3LSMA 2A05A 2OU2A 4XOPA 2GZWA 5M5WJ 1FOKA 1X4OA 2E60A 4HBLA 1HOMA 1OCPA 1ZELA 1MJBA 2EBIA 5GAGJ 1W5TA 1KYWA 1FMWA 2X85A 5D5XB 5E20A 2I8DA 2HPMA 4A6EA 4FX4A 5J8FA 4LLNA 1RPWA 3C18A 2R3SA 5DCMA 1W7PA 3CUOA 5DM6F 1KZHA 1AOYA 4OMZA 2W85A 2EV5A 2CW0F 1S7EA 4BDZA 3F8BA 1HW2A 1E3PA 5EYRA 4HQMA 3HRMA 3P9IA 4UVBA 2P5VA 5F0HA 1U5TA 3M4OJ 4UB6C 3DBRB 3GZ6A 1IV8A 2VONA 3JRGA 2XAUA 2DAOA 5JVGF 3HRSA 4IRGA 1WSUA 5JFRA 5M5XJ 2K4BA 1VI0A 2JVGA 2IGKA 4YFNF 1ZRFA 1RESA 4EM0B 1IAWA 1EH7A 1JKOC 3AL0C 4A3MJ 3BCAA 3JR9A 2R92J 1TQPA 4AM3A 2O6GE 2E2JJ 3KYCB 1P9QC 2BW3A 2LBFB 3E3VA 2FE3A 3FXLA 1S6LA 2X51A 4DIQA 1N25A 5H2FC 2ICWG 2H6CA 4O6JA 3BJAA 2GWRA 4KFCA 1K7AA 2ZMEA 5TJJA 1MNDA 2LF7A 2XPUA 4FISA 2IS1A 2PQ8A 4MHGA 1VQ5I 3TGNA 3I3LA 4FE4A 2WWYA 1OCOH 4HX8A 4Y52J 4AIJA 3WG7H 2W7NA 3DKXA 1IF1A 4ANJA 3O6BB 4KISA 4G6TB 1U9OA 5M3MJ 1JT6A 3RSNA 3HL2A 2STWA 2BY2A 4MFEA 1V5EA 2IGNA 2OCCH 2CQNA 1D0YA 3E6CC 2KZGA 3CCYA 2QF7A 4C3JJ 1I6HJ 4NDLA 3IKVA 3MEXA 5KHDA 1VQOI 1XDSA 2ZFWA 5JHUA 3OOUA 1S9HA 2DMQA 1W36D 4NQWA 3GTMJ 2IAIA 2GXGA 4ZYAA 1AHDP 1Z1DA 1S8NA 3D5LA 2CQXA 1T8IA 2QBYA 3R60A 1IV6A 4ENJA 1F9NA 5J40A 2EB7A 2VE9A 2A61A 4CICA 2K9QA 1X3UA 3A1YA 1ZG5A 2OPTA 1VQ4I 3RYPA 4IX7A 2VJ4A 3GZ5A 3IWZA 4XN3A 3VSKA 1OYWA 4MQ9F 4B47A 3H9QA 2YUSA 1FOWA 1DPUA 2NVYJ 4B09A 3FKJA 3RPUA 4MO7A 1E17A 2H09A 2OAZA 3J7YJ 4FT8A 2R7OA 2LD5A 2FXAA 2OD5A 1FIPA 1JKPC 1SFXA 3DV8A 1QBJA 3FKIJ 4PJNA 3JRDA 2BXYA 3M9AA 2OZ6A 3W2WA 1K83J 2DA7A 3ZN0A 2CW8A 2VC1A 1LDKB 1KA8A 1YYVA 1ZLJA 3OL4A 1IXSB 5BPIA 4PCQA 1U0JA 1FTTA 1YW7A 1HKSA 3M1EA 2W4SA 3S3MA 2UWMA 1YITI 1XDUA 4E7ZA 2HR3A 3L2RA 2QGUA 4EM2A 5F1RA 2O61A 3RYRA 1J9IA 3HSEA 1R00A 4Y15A 4ZYGA 4DJAA 3KX2A 4CZCA 1NHAA 1YW9A 1BI3A 4HRIA 2KT0A 1Z3YA 5EJCA 1SFKA 1RKTA 3BP8A 3IRRA 4UV9A 5ICFA 3DKWA 4N9HA 5ILSA 3FISA 3ERED 1Z7UA 2CJJA 3ZQ7A 1N75A 2RAEA 1I5ZA 3WHBA 2QZ8A 4IHYA 2WA0A 3KETA 5LRSA 5FD5A 2XIGA 3DWLE 1XCVA 2LH9A 2M7BA 3L9FA 3CJRB 4M73A 2CH0A 2L01A 4J01A 4EJUA 4Y17A 2DN0A 1H0MA 5HLTA 2VQLA 1TWHJ 1FMVA 1UMQA 1ETKA 3SEZA 1SAUA 2H8WA 1WJBA 2OBPA 4L9JA 2MH2A 5J1UA 1WFXA 4OU0A 1MBEA 1ZG1A 3NRVA 1BL0A 3CMAI 3IAS2 3GTGJ 2V1NA 4UVAA 2HOEA 1XSXA 3A03A 3FK6A 2R7QA 2J5PA 3CJNA 3L00A 1P6RA 2IW5A 3MD2A 3ESWB 3PIPF 4ENKA 1D1AA 4DYRA 2VB6A 2IXSA 3TW6A 3HRUA 4BY7J 1NTCA 4LOCA 3BG6A 1JGSA 4B1RA 1WJ5A 2EZIA 1VQ8I 2RDPA 3CP8A 5IP7J 4WXDA 5IOYA 1U9NA 1AWCA 3RJPA 5BPDA 1W0UA 1I6XA 2O3FA 1QHGA 2L7KA 5M3FJ 4OIOF 1PP7U 3U1DA 3RZDJ 3OYMA 2R7SA 2WV0A 2VL8A 4O3MA 3KYDB 2VKDA 3RPQA 2F5EA 2BEOA 4L9VA 4NUBA 2W24A 5C3EJ 2FNAA 1R4NB 4RAYA 1WPKA 3VEPA 2V9KA 1CF7B 2KJBA 1Z3XA 1TW2A 1HBXG 5IT9K 1IDZA 2VI6A 5GP9A 2HNHA 2GAUA 3T0YA 3CJQB 2LKXA 3GW2A 2YX4A 3E1SA 4GRIA 1IG7A 2P5KA 3W2AA 3TO7A 5FKLA 4A0YA 2PEXA 3T5XA 1LFPA 2KISA 5DTDA 1MSFC 1MMSA 4XONA 2XB0X 5FKMA 3EUHA 3BOQA 2PMHA 4Q48A 3S2DJ 1ON2A 4X1EA 2LR8A 2PMUA 4RLQA 2R5ZA 2A6HF 2Z99A 5IYBJ 1YJWI 3K10A 2DT7B 3AG4H 1KQ0A 3M07A 3PNTA 4A0XA 4RDUA 1BJZA 2FMLA 1WRJA 3OYDA 3OYBA 1ZR4A 1VQNI 1FNNA 1JI8A 1FYMA 5L3EA 3KEYA 3BQYA 3W6JB 3S3OA 3ABLH 3QPLA 3VWBA 1ZLKA 1O7FA 1MGTA 3JCUC 1IRGA 3FX3A 2Y69H 2E1NA 2LREA 4DZPA 3CO7C 3GYHX 3E5QA 2CQKA 2QWWA 5DYMA 3M8JA 3BCBA 2VC0A 3QOEA 2JA2A 4OAYA 3FXKA 2FNPA 3FMSA 3MVPA 1DP3A 2EIMH 1RR7A 3CUQC 3G73A 2QQ8A 2LKSA 3ZOBA 1SEUA 1HKTA 3J7AO 1W0TA 4JX4A 3SEQA 3UR3C 2PFBA 5JLWA 1R71A 1BOBA 1VTNC 2VQGA 4V2GA 4RM3A 3CLOA 4CHUA 2X9DA 3S14J 4X6AJ 1X1AA 1T0FC 4OAZA 3WU2C 1IDYA 2CGPA 5E17F 1YLFA 2JA7J 1GT0C 4I2OA 1OR7A 3HPHA 2EFQA 4LFUA 2CUFA 2ZSIB 1MNMC 3ZQGA 4EGZA 3MKZA 2MA3A 2K9MA 1YI2I 4K2EA 2X1CA 2LY9A 1APLC 2KRFA 4XRSG 4CO8A 1I3AA 2RVCA 1R5ID 1X3ZB 4F91B 5D5VB 1UB9A 4HF2A 1O3TA 3CD6I 2ACJA 4NC6A 1AU7A 4NC7A 3G4SI 5GAHJ 3FHNA 3KLOA 2E1OA 5D8LB 4HSRA 2F48A 3ZN1A 4EJWA 3JAMK 3EUAA 2JA5J 3C2HA 1XGOA 4BQOA 2PJRA 2VJIA 1MBJA 4XKWA 3KEOA 2GIVA 3ROUA 1ETWA 2HS5A 2Y0SA 3SZTA 2DTZA 2Y0SN 4CCLA 5C44J 4MGRA 4CCKA 3DBLB 5J4YA 5ICCA 2XAQA 5JVTA 2X1EA 1A6IA 5FLVA 2OC6A 4QIWN 3H3ZA 4I98B 4U0YA 1V5GA 1IW7F 1GDTA 3BTJA 1OKRA 4FE7A 3MZHA 1YFHA 2GLOA 3HOXJ 1A5JA 2HYFA 2BOLA 2GOXB 1N78A 1ETOA 2V7FA 3K9TA 5LHGA 3K4MA 1J5YA 4DZJA 1XTAA 3CQZJ 3LSGA 4XICA 1XGNA 2BVMA 3M8FA 1D0ZA 2X6WA 2E2HJ 1JXSA 1A04A 2Z1DA 4AD9A 4NHJA 4P5OA 4A3CJ 4D5FA 3S3NA 3L2VA 3TMOA 3B6CA 4AC0A 3HHHA 2H8RA 3OYCA 2XAHA 4KMFA 3F8NA 2CFOA 2XSJC 2M87A 4D7NA 3DPLC 2ZB9A 3KE2A 4PK4A 3CO6C 3QU6A 5EZGA 4AVPA 4Y3OA 1BC8C 1K78B 5GAEJ 1ZH5A 3IRQA 3V7SA 4PJMA 4D9JA 3FMQA 5GADJ 3PM1A 3EYYA 5EEGA 2QA4I 2HDDA 4EM1A 4G7OF 4DYCA 4DW6A 2XF5A 1R1UA 3ZRGA 4B4CA 1M1EB 3CJTB 2O8XA 5DD4A 3HGYA 5J1YA 3I71A 2BYVE 2FBHA 3K1PA 3OIOA 4L9TA 1S3JA 4ZTJA 1XPXA 3BG3A 5E18F 1U8RA 2HZTA 2ESNA 3CCUI 5CVIA 3VYUB 1IC8A 2HVQA 4G12A 1KU2A 3EYIA 3S32A 1DP7P 1D8KA 1YIJI 1L0OC 2FBKA 3FMRA 1DDNA 4KJZA 3GZNB 4ON0A 2WB1A 2XF6A 3DF8A 2WB1N 1O3RA 3BR2A 3L2CA 3JRAA 3OYGA 3VYRB 3CF2A 3K4BA 1TC3C 2QYOA 4RA2A 3O8HA 1IXRC 1R1TA 4UUVA 1XMKA 3CC7I 1XD7A 2Y9ZA 2DFIA 2LDUA 3J80Z 5IP6A 2M7AA 2ISZA 1SC7A 4IHSA 4M3BA 3UNGC 1UG2A 3FHZA 1HW5A 4AWXB 1VQ7I 2E7WA 3BR3A 3OS1A 5D6EA 1RKWA 5IT3A 4RBOA 4R8HA 4PJ0C 5HNHA 2YS9A 1TT5B 4KN7X 3D5RC 3X2QH 3CC2I 3GMEA 1BR4A 2QEXI 6PAXA 2B7EA 4LJZF 4E7LA 1R22A 3GO5A 4LLGF 3HOUJ 2F2EA 4IXAA 3CDIA 4R1HA 1IUFA 3QPTA 3MCZA 3EUKL 4XLCA 1GVJA 2D1HA 4A5NA 1SD6A 4Y4RA 1I27A 3FXJA 3ASOH 1R7JA 1TWCJ 3FXMA 3P7NA 1G3SA 1R1VA 3PNVA 1QHHD 2F4MB 4BH9A 2P5LC 5E8IA 1LVKA 2M5WA 4G7HF 2JUCA 4I7HA 2L54A 4CYCB 3U9GA 5ILUA 1FP1D 4II3A 1R6RA 2E7XA 1CQTA 3N05A 1JUMA 2PX9A 3W2VA 2Z2SB 1IJWC 3BR1A 2AHQA 4DOZA 2XGEA 3WGIA 5FROA 1J09A 1MD0A 4IVNA 3WG9A 5BQTA 2R7RA 1LQ1A 1KU7A 2D45A 3MAJA 3HG9A 3GTPJ 2E35A 2K5CA 1NK2P 4XNFA 3TO9A 3G1LA 5L3FA 5FKNA 4LG0A 1SVOA 4ZJZA 4UVCA 3MZ8A 2HZDA 4AIKA 2BBYA 2CV1A 1JHHA 2HXIA 2ID6A 2H27A 2ME0A 3PFYA 2JUGA 3QYEA 4NB5A 4WXHA 3I59B 4S05A 2DTRA 4BY1J 2LF8A 1IRFA 1Q1VA 4RGSA 3F3XA 2DOFA 2FBIA 2K9SA 1EH8A 3N4MA 1P4AA 2Y9YA 3LWFA 2EK5A 3L2QA 1HSJA 2P4WA 4XK4A 4BQQA 4C2TA 1DU0A 1VNDA 1ZHFA 1B8IB 4XRSA 1BIBA 2X6XA 1O4XA 1A36A 2VPRA 4KUMA 2W1OA 4JP0A 3NARA 4XLEA 2RKHA 3PSIA 1SFUA 2F5DA 3HOWJ 2E5ZA 3TOAA 1HA8A 2DU9A 4IF4A 1FWZA 3IWFA 3C2BA 5LD2C 4KYWA 3O3KA 3F8FA 5FLXZ 1J7KA 1G3YA 2W48A 5A2QK 3C2GA 4OIRF 3FXRA 2XAJA 2OTLI 3LA7A 4RM2A 2XAFA 3NWSA 4KA4A 2QQ9A 5F1JA 5F0FA 4ABZA 3CCJI 2ZKZA 3RPUD 1ZQ3P 1K6YA 2JSCA 1JGGA 3GTKJ 1Y8RB 2VT2A 3E6DA 1G3TA 3E0JB 2E71A 4ETSA 1ZYRF 3VODA 3S1RJ 4KIFA 2M9HA 4KICA 1CF7A 1I1GA 1Y6IA 1FSEA 1CGPA 2L9VA 2O03A 1IN5A 4IOCF 3OV8A 3PQJA 1AA7A 1H89C 2FRHA 4CDGA 2MC4A 1WHUA 3HGGA 2NXNB 2GIZA 4ZZLA 3LFKA 2EZKA 1UG0A 3JREA 2FJ1A 4GFBA 3GFLA 5CVRA 3GF2A 2VBZA 1DU6A 4HPQA 2FA5A 2WY7Q 2GA1A 4XLFA 3IUOA 4HSTA 2NS8A 3Q0WA 1Z9CA 3FBIB 3VYTB 2WAQA 2L9SA 2ZJ2A 5K5RA 4C2UA 2WAQN 1BA5A 1OCZH 3BR6A 5FKKA 3TBIA 5HS8A 3AG1H 1WZ2A 2MH9A 2NS7A 3ZMVA 3QU3A 3HUGB 3PNYA 4HLYA 4F7ZA 2DMUA 3SYTA 1XMAA 3ZGKA 5J6XA 1LJ9A 1OJLA 2IBDA 1JT0A 2HWVA 4L5IA 3FM5A 2CRGA 3A0BC 2PLYA 4CCOA 2E1MC 2R7UA 1ZARA 3H5RA 5HODA 3W3CA 3CLQA 3G1OA 3S2HJ 2EZHA 3WTYC 2BHYA 5H6RA 2JPCA 1YHQI 2NAZA 3TW7A 1STZA 1E0EA 3BDDA 2CFXA 2MLKA 4PGGA 3BPXA 3OYEA 2XHKA 1GV2A 1QPIA 3EDPA 2BY0A 1R5GA 4EJVA 2DK8A 4E7JA 3DEEA 2QQAA 4M71A 1UFMA 5K7HA 1ETYA 2A5WA 2F4IA 3BY6A 5HDNA 3COAC 2M34A 1S7AA 2M8EA 3E5UA 2LKPA 2YU3A 3HDDA 3WGHA 3MFKA 2J5OA 2DA5A 3CZ6A 4CSWA 2ECBA 3FBNB 2EFNA 2FQ4A 3K1MA 2BY1A 2X6OA 3SQNA 2Z33A 2JZYA 3HOYJ 1YTYA 1JUPA 2XUBA 5LGUA 2KQRA 5CVUA 1B72A 2DXIA 4BQNA 4HYEA 4BBSJ 2ME6A 4U7BA 2TRTA 3HEFA 1R4MB 4IJAA 3I64A 3ZQHA 5JR3A 3F72A 2CV2A 2A68F 2IP2A 3I0TA 3PUBA 3K4LA 3PJRA 5E3LA 4HOBA 1TZLA 3CF5F 3HKZA 1HDPA 2D2WA 5GPAA 4BL0B 1MBGA 3HKZN 3GUDA 1Z91A 1LDDA 1X1PA 3DEWA 2QM3A 4BXXJ 3CCLI 4QTRA 1TL8A 2ZXWH 3RZOJ 3GFIA 2LMDA 4FCYA 2ELKA 2AS5F 2NYXA 2LLKA 3LSJA 2JK3A 3A4CA 4XOTA 5E1XA 1K6OA 4MTEA 3ZP5A 1EKEA 3RKWA 1W4MA 1JTXA 2H1KA 3GXOA 5JLXA 2RNGA 3V8KA 4BU2A 1QO0D 4MNUA 1U5TC 1H8AC 4BXUA 2XB5A 5TISC 4E7HA 1QQIA 4Z2YA 2JMWA 4IEJA 3ZQIA 2JRMA 5LHIA 3Q3SA 3V8JA 4M6YA 5GTHC 2XRLA 3Q0VA 2NNYA 1FTZA 2IPQX 2HQNA 2Y48A 4YRVA 1DGRM 4KMUX 2R7FA 5D6FA 2DCEA 2XGCA 1K78A 2K9LA 4JOMA 2DI3A 4M9SA 5K7ZA 4F3QA 1U6GA 4AVZA 1FT9A 4HAMA 1SD4A 3I4MJ 4KIBA 2RQQA 1YS6A 4Q4ZF 3CCEI 1VQ9I 2VOPA 2DFFA 3EPZA 3S1NJ 3BJ6A 2NNNA 1SAXA 1RUOA 4YIIA 2L2OA 2ZMEC 3CDHA 2ZC2A 2HQ5A 4B3XA 1XGMA 3WTTC 4M9XA 4A69C 4DNCA 4C30A 2CQQA 4U0VA 2P7VB 1MJAA 5J8CA 4PFOA 2HVRA 2VPLA 3OYKA 4LLLA 4ZDOA 1F5TA 2E1MB 5AIQA 1O3QA 3Q0UA 3GTJJ 4EJTA 4ZH4F 4XORA 2CWEA 1GHCA 1QZZA 3AL0B 5JI6A 1UCRA 2IVMA 3KZIC 3WTUC 3KP2A 4RGUA 2ECCA 4PSXA 1Y8QB 2XAGA 2PBIA 1D3YA 1SD7A 1HF0A 5DCFA 2Q8KA 1T56A 1HC8A 1T33A 3HIFA 1G6NA 1W1WE 1D1BA 1WJFA 3C7JA 5EDNA 4XLHA 3ZMUA 4F55A 5DUIA 4RB0A 2NS0A 4BHPA 2LSOA 4M9ZA 2HOAA 4N4OB 1HQCA 2GQQA 3QWLA 5HDKA 2HFHA 2PI0A 3NEUA 3FK7A 3AG3H 2ADUA 2KIQA 3SFIA 1V55H 4E7SA 1T0FA 1QVUA 3V42A 3ZCOA 3W6KB 1PUFB 1X19A 1TP4A 3BR5A 2CV0A 4P1WA 1FBSA 2KMUA 4F92B 2VLAA 1TWFJ 4CGZA 3M1CA 1JKRC 3K2AA 3ZQQA 2EILH 2XPWA 4PJLA 2MABA 3FXQA 4YFXF 4F93B 2F5VA 2R5YB 2R7DA 3HTUA 2QQBA 4IHWA 2JA6J 3WTSC 4GYIA 5ICGA 1FC3A 3ZQLA 1J59A 2LG4A 1Y56A 4M6VA 3A0HC 4I76A 5D8KB 4BEHB 2P81A 3TDZC 4YG2F 3OS0A 2KRCA 4XSZF 4IHTA 4FHTA 3KZYA 3VB2A 2DPUA 2XVCA 1OCCH 1YG2A 1B9NA 2CO5A 5B1AH 3O2PE 2O8KA 1KONA 3J81Z 2M30A 2VUMJ 1Z0XA 3WE2A 2L9RA 4M3FA 1BI0A 2OA4A 4HNVA 5AIPA 2ISYA 5E79C 1PUEE 4BAYA 1MMAA 5F6FA 1JE8A 1ITYA 2LYCA 5LEJA 1UHMA 5HVQC 3IH2A 1ENHA 1W7PB 2E34A 4S04A 4LGWA 5HOOA 4BE1A 1B9MA 5B3SH 1P4XA 3ZPLA 1LDJA 1YS7A 2E5NA 4XBFA 1ULYA 2EFOA 4LIVA 4BKXA 2XROA 3MKLA 3F0CA 5KVRA 1USTA 1ZR2A 5FFZA 4ESBA 3R0AA 3F23A 1O3SA 3RCOA 3QOPA 2I5UA 1VFCA 1IN6A 2DMTA 3H35A 2JSPA 3LL7A 4XKCA 2AQFA 3K4KA 2L02A 2ZJQF 2NVQJ 2KFDA 1PVEA 2M45A 2JT1A 1HKQA 1B8IA 2OV7A 4IRIA 1GUUA 4D5CA 2DW4A 4B8XA 1GXPA 3MWMA 2COMA 1MDMB 2HPIA 2BW3B 2PG4A 3NWTA 4QLCU 3DLAA 2DA6A 1FYLA 2G7UA 3CMYA 3QPHA 4MTDA 2AO9A 3WODF 5FRNA 1TQMA 3TP0A 3J80K 2ZFUA 3GLLA 3RDIA 3SZGA 2IS2A 4ZDPA 3PIOF 2Y2ZA 1Y0NA 1T98A 2VKEA 1IUYA 3ABMH 5E1ZB 2FOKA 1W36C 3F8MA 1TQIA 4LB5A 3BZ6A 1WH7A 4O5VA 4CZZA 4DGWB 1TLHB 2Y75A 5IPAA 3GFMA 3GX4X
chains in the Genus database with same CATH topology
5M5XJ 1ORKA 2DA2A 1VI0A 3WHCA 2HOSA 1RESA 4CYCB 1JKOC 4UUSB 4A3MJ 2I10A 3JR9A 2R92J 5EG0A 3NAUA 1CQTA 1TWGJ 2E2JJ 3OSFA 1Y1WJ 1JUMA 4DYQA 1IJWC 3BR1A 5GPCA 2AHQA 1JKQC 4BBRJ 1MBFA 2XGEA 1ZKGA 3A01B 3QQAA 2MG4A 1X2NA 2IEKA 2X48A 2XPUA 4FISA 3S15J 4A3LJ 3GTPJ 4C3HJ 1NK2P 3BG5A 3G1LA 5FKNA 3SJMA 3HOZJ 4FE4A 1TWAJ 4Y52J 5IYDJ 2HXIA 2ID6A 2HOTA 1U9OA 5M3MJ 1JT6A 2ME0A 2FD5A 1IGNA 3BTLA 4MFEA 4L5EA 5IOZA 4BY1J 4CYCA 3CCYA 1JUSA 2QF7A 4AUXA 4C3JJ 1I6HJ 1Q1VA 2DA4A 4NDLA 2K9SA 2Y9YA 4JX6A 3CDLA 5BNGA 3OOUA 3GTMJ 2DMQA 2CU7A 2IAIA 4XK4A 1DU0A 1VNDA 1B8IB 4XRSA 1AHDP 1O4XA 2JJ7A 2VPRA 2CQXA 4JP0A 1G2HA 1IV6A 3NARA 2O9LA 2K9QA 2M2EA 2OPTA 3HOWJ 1ETXA 3C2BA 1LE8B 2YUSA 2NVYJ 2W48A 2R7ZJ 4MO7A 3IV5A 5EZHA 2R0QC 5F1JA 2LD5A 2DMPA 5F0FA 4ABZA 1FIPA 1JKPC 1ZQ3P 3FKIJ 3JRDA 1JGGA 1K83J 2DA7A 3GTKJ 4Y7NJ 2XSDC 1JTYA 4M3DA 3S1RJ 2MW8A 2M9HA 1FTTA 1H89C 4D7MA 3HGGA 1OCTC 4XIDA 2EZKA 5F08A 4C3IJ 1MBHA 3JREA 5EG0B 2KT0A 2DJNA 2L0KA 3UKGA 2FJ1A 4GFBA 1RKTA 1DU6A 2NVXJ 3HOVJ 3JRCA 3FISA 3B6AA 2NS8A 3Q0WA 2CJJA 2RAEA 2WAQN 1BA5A 3BR6A 5FKKA 3WHBA 2FX0A 4IHYA 4M3EA 2NS7A 1D5YA 1SFOJ 2DMUA 4B3AA 3GTLJ 2JA8J 4S0HB 1OJLA 2IBDA 2LK2A 1JT0A 2TCTA 2DN0A 1ETQA 2OF7A 3LNQA 2CRGA 1TWHJ 5J3LA 1UMQA 1B72B 1ETKA 5HODA 3G1OA 4A3EJ 2DMNA 3S2HJ 2EZHA 5J1UA 1MBEA 3BR0A 1BL0A 3TW7A 3GTGJ 1FEXA 2EZLA 5E3NA 1X2MA 3ZQFA 3A03A 3FK6A 1IRZA 1GV2A 1QPIA 1SANA 3HBLA 4DYRA 3VPRA 1GVDA 5K7HA 1ETYA 3TW6A 1WI3A 4XRMA 1JJ8C 1R9TJ 2M34A 4BY7J 3TP3A 1NTCA 3BQZA 4LOCA 3HDDA 4B1RA 2DA5A 2B63J 2EZIA 5IP7J 2ECBA 3OSGA 4FTHA 1QVTA 5IOYA 1U9NA 5IYCJ 1W0UA 2FQ4A 1H88C 2X6OA 3BTIA 3SDGA 3HB9A 5M3FJ 3HOYJ 1NK3P 4EEFG 1JUPA 3GBGA 3RZDJ 2EQRA 1B72A 1XG1A 5EF6A 4BBSJ 5C3EJ 3BG9A 1Y1VJ 2ME6A 2TRTA 3HEFA 1WPKA 4A3BJ 4MFDA 3ZQHA 5K7FA 1IDZA 2VI6A 2Y30A 5GP9A 5E3LA 1HDDC 1HDPA 5GPAA 2GBYA 1MBGA 2LKXA 3HKZN 3I4NJ 1IG7A 3DEWA 3H0GJ 1U8BA 5FKLA 5DTDA 1MSFC 4BXXJ 1BW5A 2K40A 2XB0X 5FKMA 3S2DJ 4X1EA 2M8GX 5DS9A 2LR8A 4QTRA 1AKHA 1LFUP 2R5ZA 1MSEC 5IYBJ 1QRYA 1F43A 3JRFA 1FIAA 3G1MA 3RZOJ 4FCYA 2WV1A 5EGOA 2VKVA 2ELKA 3BT9A 4RDUA 4AYBN 1BJZA 4I6ZA 3S16J 2HI3A 2LLKA 3LSJA 1ZR4A 4A93J 1EF4A 3M3YJ 4M3GA 2JK3A 1OFCX 5F0CA 2L7MP 3BQYA 1MBKA 1PUFA 3QPLA 1JTXA 2H1KA 1ZTRA 1U78A 5JLXA 2NVTJ 1H8AC 2XB5A 4DZPA 4V2FA 3H3VK 2JMWA 4IEJA 3ZQIA 5F04A 3Q3SA 4A3IJ 2D5VA 4QSHA 2LFBA 2XRLA 3Q0VA 1FTZA 1WCMJ 3IH3A 3RKQA 3S17J 4MIMA 3MVPA 1P7IA 1RR7A 1GV5A 2XGCA 3ZOBA 2DA1A 5K7ZA 1W0TA 4JX4A 5JLWA 1FJLA 3I4MJ 4V2GA 5C4JJ 2CUEA 2X9DA 3S14J 4X6AJ 2Y31A 3GTQJ 3S1NJ 4W97A 3LOCA 3D1NI 2DA3A 1IDYA 4A3FJ 5C4XJ 2HQ5A 2JA7J 1GT0C 1I50J 2GM4A 2M0CA 1WGXA 4A69C 3ZQCA 1MH4A 2CUFA 5IP9J 1MNMC 3ZQGA 2CQQA 2LY9A 2HYJA 2LTPA 3QPSA 4XRSG 1APLC 3GTOJ 1HLVA 1Z77A 3PO2J 1AU7A 4A3DJ 2MSYA 2MGQA 3Q0UA 3GTJJ 2E1OA 1YRNA 1ETVA 5E3OA 2JA5J 1MBJA 2COBA 2ECCA 1P7JA 1ETWA 5F27A 1HF0A 2DTZA 2Y0SN 5C44J 2R93J 1T56A 3JRHA 1JJ6C 1AKHB 1ZGWA 2R5ZB 1T33A 1I3QJ 1UHSA 1A6IA 5EDNA 5FLVA 4QIWN 5E3MA 5EGOB 2HOAA 1GDTA 3BTJA 4FE7A 3FK7A 5M5YJ 2G0EA 1HCRA 3HOXJ 2GLOA 3E7LA 1POGA 3SFIA 1A5JA 2ID3A 1QVUA 1ETOA 4DZJA 5FJ8J 3CQZJ 3LSGA 4XICA 1PUFB 3BR5A 1ZK8A 2E2HJ 2YU9J 1X58A 1BW6A 4A3CJ 2LVSA 2N8GA 4D5FA 1TWFJ 1VF9A 3B6CA 1JKRC 4AC0A 4UUTA 3K2AA 5EEAA 4IHXA 2XPWA 4J19A 2HXOA 3RQIA 2H8RA 2QCOA 3TEDA 2R5YB 5FKOA 4IHWA 2JA6J 4D7NA 2ZB9A 2XPVA 5EZGA 3JRBA 3ZQLA 1F36A 1K61A 4M6VA 4I76A 4JYKA 2P81A 4UUSA 3PM1A 4IHVA 2HDDA 2E2IJ 2O8KA 4DYCA 4W1UA 4DW6A 2VUMJ 1Z0XA 4MLOA 2L9RA 3K7AJ 1MH3A 2EH3A 4M3FA 4HNVA 4B4CA 3HGYA 5J1YA 1E3OC 2E19A 5J1RA 3OIOA 1ITYA 3A01A 3BG3A 4A3GJ 3L1PA 2PMZN 3MN2A 2XGDA 3S1MJ 9ANTA 2JN6A 3IH2A 1ENHA 1IC8A 3FIWA 2LP0A 4G12A 3HM5A 3JRIA 4A3JJ 2R5YA 3DCFA 4C2MJ 4BKXA 2WB1N 1RETA 3BR2A 3F0CA 3MKLA 5FLMJ 1ZR2A 1YRNB 3LSRA 2KDZA 3JRAA 2O7OA 2NOGA 3PO3J 1WH5A 3A02A 1TC3C 1VFCA 2L7ZA 2DMTA 3S1QJ 3O8HA 2NVQJ 3LSPA 3W6VA 3IH4A 1B8IA 5M5WJ 2Y9ZA 1GUUA 4D5CA 1HOMA 1OCPA 3O8GA 5IP6A 2EBIA 4M3BA 1RPWA 2DA6A 1UG2A 1LE8A 3BR3A 4JX5A 3CMYA 2K9NA 2AO9A 3TP0A 1XS9A 1RKWA 4RBOA 1S7EA 1XC5A 2YS9A 2Y2ZA 5EYRA 1LFBA 2VKEA 2JWTA 3HOUJ 5F0HA 3M4OJ 3BTCA 1IUFA 1WH7A 2L7FP 3JRGA 5IPAA 4A3KJ 1TWCJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M5X J;  1ORK A;  2DA2 A;  1VI0 A;  3WHC A;  2HOS A;  1RES A;  4CYC B;  1JKO C;  4UUS B;  4A3M J;  2I10 A;  3JR9 A;  2R92 J;  5EG0 A;  3NAU A;  1CQT A;  1TWG J;  2E2J J;  3OSF A;  1Y1W J;  1JUM A;  4DYQ A;  1IJW C;  3BR1 A;  5GPC A;  2AHQ A;  1JKQ C;  4BBR J;  1MBF A;  2XGE A;  1ZKG A;  3A01 B;  3QQA A;  2MG4 A;  1X2N A;  2IEK A;  2X48 A;  2XPU A;  4FIS A;  3S15 J;  4A3L J;  3GTP J;  4C3H J;  1NK2 P;  3BG5 A;  3G1L A;  5FKN A;  3SJM A;  3HOZ J;  4FE4 A;  1TWA J;  4Y52 J;  5IYD J;  2HXI A;  2ID6 A;  2HOT A;  1U9O A;  5M3M J;  1JT6 A;  2ME0 A;  2FD5 A;  1IGN A;  3BTL A;  4MFE A;  4L5E A;  5IOZ A;  4BY1 J;  4CYC A;  3CCY A;  1JUS A;  2QF7 A;  4AUX A;  4C3J J;  1I6H J;  1Q1V A;  2DA4 A;  4NDL A;  2K9S A;  2Y9Y A;  4JX6 A;  3CDL A;  5BNG A;  3OOU A;  3GTM J;  2DMQ A;  2CU7 A;  2IAI A;  4XK4 A;  1DU0 A;  1VND A;  1B8I B;  4XRS A;  1AHD P;  1O4X A;  2JJ7 A;  2VPR A;  2CQX A;  4JP0 A;  1G2H A;  1IV6 A;  3NAR A;  2O9L A;  2K9Q A;  2M2E A;  2OPT A;  3HOW J;  1ETX A;  3C2B A;  1LE8 B;  2YUS A;  2NVY J;  2W48 A;  2R7Z J;  4MO7 A;  3IV5 A;  5EZH A;  2R0Q C;  5F1J A;  2LD5 A;  2DMP A;  5F0F A;  4ABZ A;  1FIP A;  1JKP C;  1ZQ3 P;  3FKI J;  3JRD A;  1JGG A;  1K83 J;  2DA7 A;  3GTK J;  4Y7N J;  2XSD C;  1JTY A;  4M3D A;  3S1R J;  2MW8 A;  2M9H A;  1FTT A;  1H89 C;  4D7M A;  3HGG A;  1OCT C;  4XID A;  2EZK A;  5F08 A;  4C3I J;  1MBH A;  3JRE A;  5EG0 B;  2KT0 A;  2DJN A;  2L0K A;  3UKG A;  2FJ1 A;  4GFB A;  1RKT A;  1DU6 A;  2NVX J;  3HOV J;  3JRC A;  3FIS A;  3B6A A;  2NS8 A;  3Q0W A;  2CJJ A;  2RAE A;  2WAQ N;  1BA5 A;  3BR6 A;  5FKK A;  3WHB A;  2FX0 A;  4IHY A;  4M3E A;  2NS7 A;  1D5Y A;  1SFO J;  2DMU A;  4B3A A;  3GTL J;  2JA8 J;  4S0H B;  1OJL A;  2IBD A;  2LK2 A;  1JT0 A;  2TCT A;  2DN0 A;  1ETQ A;  2OF7 A;  3LNQ A;  2CRG A;  1TWH J;  5J3L A;  1UMQ A;  1B72 B;  1ETK A;  5HOD A;  3G1O A;  4A3E J;  2DMN A;  3S2H J;  2EZH A;  5J1U A;  1MBE A;  3BR0 A;  1BL0 A;  3TW7 A;  3GTG J;  1FEX A;  2EZL A;  5E3N A;  1X2M A;  3ZQF A;  3A03 A;  3FK6 A;  1IRZ A;  1GV2 A;  1QPI A;  1SAN A;  3HBL A;  4DYR A;  3VPR A;  1GVD A;  5K7H A;  1ETY A;  3TW6 A;  1WI3 A;  4XRM A;  1JJ8 C;  1R9T J;  2M34 A;  4BY7 J;  3TP3 A;  1NTC A;  3BQZ A;  4LOC A;  3HDD A;  4B1R A;  2DA5 A;  2B63 J;  2EZI A;  5IP7 J;  2ECB A;  3OSG A;  4FTH A;  1QVT A;  5IOY A;  1U9N A;  5IYC J;  1W0U A;  2FQ4 A;  1H88 C;  2X6O A;  3BTI A;  3SDG A;  3HB9 A;  5M3F J;  3HOY J;  1NK3 P;  4EEF G;  1JUP A;  3GBG A;  3RZD J;  2EQR A;  1B72 A;  1XG1 A;  5EF6 A;  4BBS J;  5C3E J;  3BG9 A;  1Y1V J;  2ME6 A;  2TRT A;  3HEF A;  1WPK A;  4A3B J;  4MFD A;  3ZQH A;  5K7F A;  1IDZ A;  2VI6 A;  2Y30 A;  5GP9 A;  5E3L A;  1HDD C;  1HDP A;  5GPA A;  2GBY A;  1MBG A;  2LKX A;  3HKZ N;  3I4N J;  1IG7 A;  3DEW A;  3H0G J;  1U8B A;  5FKL A;  5DTD A;  1MSF C;  4BXX J;  1BW5 A;  2K40 A;  2XB0 X;  5FKM A;  3S2D J;  4X1E A;  2M8G X;  5DS9 A;  2LR8 A;  4QTR A;  1AKH A;  1LFU P;  2R5Z A;  1MSE C;  5IYB J;  1QRY A;  1F43 A;  3JRF A;  1FIA A;  3G1M A;  3RZO J;  4FCY A;  2WV1 A;  5EGO A;  2VKV A;  2ELK A;  3BT9 A;  4RDU A;  4AYB N;  1BJZ A;  4I6Z A;  3S16 J;  2HI3 A;  2LLK A;  3LSJ A;  1ZR4 A;  4A93 J;  1EF4 A;  3M3Y J;  4M3G A;  2JK3 A;  1OFC X;  5F0C A;  2L7M P;  3BQY A;  1MBK A;  1PUF A;  3QPL A;  1JTX A;  2H1K A;  1ZTR A;  1U78 A;  5JLX A;  2NVT J;  1H8A C;  2XB5 A;  4DZP A;  4V2F A;  3H3V K;  2JMW A;  4IEJ A;  3ZQI A;  5F04 A;  3Q3S A;  4A3I J;  2D5V A;  4QSH A;  2LFB A;  2XRL A;  3Q0V A;  1FTZ A;  1WCM J;  3IH3 A;  3RKQ A;  3S17 J;  4MIM A;  3MVP A;  1P7I A;  1RR7 A;  1GV5 A;  2XGC A;  3ZOB A;  2DA1 A;  5K7Z A;  1W0T A;  4JX4 A;  5JLW A;  1FJL A;  3I4M J;  4V2G A;  5C4J J;  2CUE A;  2X9D A;  3S14 J;  4X6A J;  2Y31 A;  3GTQ J;  3S1N J;  4W97 A;  3LOC A;  3D1N I;  2DA3 A;  1IDY A;  4A3F J;  5C4X J;  2HQ5 A;  2JA7 J;  1GT0 C;  1I50 J;  2GM4 A;  2M0C A;  1WGX A;  4A69 C;  3ZQC A;  1MH4 A;  2CUF A;  5IP9 J;  1MNM C;  3ZQG A;  2CQQ A;  2LY9 A;  2HYJ A;  2LTP A;  3QPS A;  4XRS G;  1APL C;  3GTO J;  1HLV A;  1Z77 A;  3PO2 J;  1AU7 A;  4A3D J;  2MSY A;  2MGQ A;  3Q0U A;  3GTJ J;  2E1O A;  1YRN A;  1ETV A;  5E3O A;  2JA5 J;  1MBJ A;  2COB A;  2ECC A;  1P7J A;  1ETW A;  5F27 A;  1HF0 A;  2DTZ A;  2Y0S N;  5C44 J;  2R93 J;  1T56 A;  3JRH A;  1JJ6 C;  1AKH B;  1ZGW A;  2R5Z B;  1T33 A;  1I3Q J;  1UHS A;  1A6I A;  5EDN A;  5FLV A;  4QIW N;  5E3M A;  5EGO B;  2HOA A;  1GDT A;  3BTJ A;  4FE7 A;  3FK7 A;  5M5Y J;  2G0E A;  1HCR A;  3HOX J;  2GLO A;  3E7L A;  1POG A;  3SFI A;  1A5J A;  2ID3 A;  1QVU A;  1ETO A;  4DZJ A;  5FJ8 J;  3CQZ J;  3LSG A;  4XIC A;  1PUF B;  3BR5 A;  1ZK8 A;  2E2H J;  2YU9 J;  1X58 A;  1BW6 A;  4A3C J;  2LVS A;  2N8G A;  4D5F A;  1TWF J;  1VF9 A;  3B6C A;  1JKR C;  4AC0 A;  4UUT A;  3K2A A;  5EEA A;  4IHX A;  2XPW A;  4J19 A;  2HXO A;  3RQI A;  2H8R A;  2QCO A;  3TED A;  2R5Y B;  5FKO A;  4IHW A;  2JA6 J;  4D7N A;  2ZB9 A;  2XPV A;  5EZG A;  3JRB A;  3ZQL A;  1F36 A;  1K61 A;  4M6V A;  4I76 A;  4JYK A;  2P81 A;  4UUS A;  3PM1 A;  4IHV A;  2HDD A;  2E2I J;  2O8K A;  4DYC A;  4W1U A;  4DW6 A;  2VUM J;  1Z0X A;  4MLO A;  2L9R A;  3K7A J;  1MH3 A;  2EH3 A;  4M3F A;  4HNV A;  4B4C A;  3HGY A;  5J1Y A;  1E3O C;  2E19 A;  5J1R A;  3OIO A;  1ITY A;  3A01 A;  3BG3 A;  4A3G J;  3L1P A;  2PMZ N;  3MN2 A;  2XGD A;  3S1M J;  9ANT A;  2JN6 A;  3IH2 A;  1ENH A;  1IC8 A;  3FIW A;  2LP0 A;  4G12 A;  3HM5 A;  3JRI A;  4A3J J;  2R5Y A;  3DCF A;  4C2M J;  4BKX A;  2WB1 N;  1RET A;  3BR2 A;  3F0C A;  3MKL A;  5FLM J;  1ZR2 A;  1YRN B;  3LSR A;  2KDZ A;  3JRA A;  2O7O A;  2NOG A;  3PO3 J;  1WH5 A;  3A02 A;  1TC3 C;  1VFC A;  2L7Z A;  2DMT A;  3S1Q J;  3O8H A;  2NVQ J;  3LSP A;  3W6V A;  3IH4 A;  1B8I A;  5M5W J;  2Y9Z A;  1GUU A;  4D5C A;  1HOM A;  1OCP A;  3O8G A;  5IP6 A;  2EBI A;  4M3B A;  1RPW A;  2DA6 A;  1UG2 A;  1LE8 A;  3BR3 A;  4JX5 A;  3CMY A;  2K9N A;  2AO9 A;  3TP0 A;  1XS9 A;  1RKW A;  4RBO A;  1S7E A;  1XC5 A;  2YS9 A;  2Y2Z A;  5EYR A;  1LFB A;  2VKE A;  2JWT A;  3HOU J;  5F0H A;  3M4O J;  3BTC A;  1IUF A;  1WH7 A;  2L7F P;  3JRG A;  5IPA A;  4A3K J;  1TWC J; 
#chains in the Genus database with same CATH topology
 2UXN A;  3PFI A;  3CME I;  1P4W A;  5FRM A;  3R0J A;  4EJO A;  1PP8 F;  2HOS A;  3RI4 A;  2KZV A;  2W25 A;  4UV8 A;  4UUS B;  3RQ4 A;  3F22 A;  3EET A;  4KN4 X;  4RAF A;  3ZMD A;  3HSF A;  2DOD A;  2XRN A;  3GFJ A;  5HLG A;  2A6T A;  3EUH C;  1Y1W J;  1I39 A;  2FEZ A;  1BI1 A;  4KT6 A;  1WI9 A;  3JTH A;  1JKQ C;  4BBR J;  1MBF A;  4GXO A;  3SHF A;  1VQK I;  2LOO A;  1HXD A;  3QQA A;  1X2N A;  4A2U A;  2F5F A;  1ZGJ A;  2IEK A;  2X48 A;  3FF5 A;  3QP5 A;  1FX7 A;  3R4K A;  4HZF A;  4A3L J;  3OYF A;  4C3H J;  3HUG A;  5KK1 A;  3OWT A;  2X6Y A;  3SJM A;  3OY9 A;  2XKP A;  4H0E A;  1TWA J;  2DYR H;  1WQ2 A;  4Q47 A;  5IYD J;  4QWQ A;  2HOT A;  5CQG A;  2X0L A;  1IGN A;  1ZRD A;  4BJT A;  4EMS A;  4L5E A;  4AUX A;  3HOT A;  2Y0M A;  1V4R A;  4JX6 A;  4JK1 X;  5BNG A;  2WBM A;  3I55 I;  4ZZD A;  2CU7 A;  3LMM A;  4XKB A;  2LBF A;  2JJ7 A;  2ZNY A;  3AKZ A;  3LSH A;  4XL9 A;  2L3D A;  2RC4 A;  2CYY A;  3BPV A;  2KRH A;  3FZV A;  4M74 A;  4N4N B;  4BXF A;  1S5L C;  1ZN2 A;  2M2E A;  2XF7 A;  4M72 A;  2P6T A;  2C6Y A;  1L3L A;  4IRH A;  4AID A;  3OYA A;  1LE8 B;  1SVM A;  1B1B A;  3DQV C;  1XSD A;  1BI2 A;  1LPQ A;  2QEN A;  1OR7 C;  2DLL A;  2K3P A;  2FU4 A;  4GGG A;  3BZC A;  1FPQ A;  2JPB A;  2LC2 A;  5EZH A;  4EQQ A;  2DMP A;  3H36 A;  4U0W A;  4G9Y A;  2Z3Y A;  3GCM A;  3P5J A;  4JBA A;  4Y7N J;  3LSK A;  5FLX K;  1OMI A;  4M3D A;  4XSX F;  4LD5 A;  2VT3 A;  1FLI A;  1IZ1 A;  2ETH A;  4ZYH A;  5FD6 A;  2KJC A;  4A0Z A;  4G94 A;  3OOP A;  2W00 A;  2F5C A;  2V9P A;  2DT6 A;  1XCB A;  2VOO A;  3CUQ B;  2IGO A;  1OCT C;  2DFE A;  2M4K A;  5F08 A;  1D1C A;  2DO7 A;  2K4J A;  3MKY B;  5EG0 B;  4BJ5 C;  3OYJ A;  2L0K A;  3UKG A;  2ZO4 A;  3DPU A;  3V7R A;  1OLT A;  4J00 A;  1YO5 C;  3AG2 H;  3OYH A;  4PSW A;  4ZDL A;  3T8R A;  3JRC A;  2CSO A;  4UHT A;  2W82 A;  3HOV J;  1R5H A;  2A3S A;  2TDX A;  2VBW A;  2X4H A;  3K69 A;  2BXZ A;  3N97 A;  4CH7 A;  5KNL A;  4I01 A;  4RMN A;  3HC7 A;  4UXN A;  4PZJ A;  3DTI A;  1BN5 A;  2V6C A;  4M3E A;  3VOE A;  4D1Q A;  1UJ8 A;  1EH6 A;  1X1C A;  2EV0 A;  3OYI A;  3BRO A;  4ZYD A;  3ELK A;  2LK2 A;  1X1D A;  4EV0 A;  2TCT A;  3LNQ A;  1ETQ A;  4HX4 A;  3RIR A;  2P7C B;  3BZK A;  5J3L A;  5LHH A;  1MW7 A;  2DQL A;  4XKV A;  4A3E J;  3TKY A;  2YX7 A;  2XV4 S;  1WJA A;  5ICE A;  2NVU B;  3JAM Z;  3HSR A;  4BGD A;  3BR0 A;  1T6S A;  3IKT A;  1FEX A;  1XX5 A;  5E3N A;  1X2M A;  3CP2 A;  3KP4 A;  5CVV A;  1X1B A;  3ZQF A;  5DM7 F;  2DDB A;  1KU9 A;  2YPR A;  1SAN A;  1KU3 A;  2H1L A;  5LBQ A;  3HBL A;  3BJO A;  1DPR A;  1WI3 A;  2VAS A;  1ZGA A;  4M6X A;  3LST A;  3VDX A;  2BZT A;  2XDV A;  4FET A;  3TP3 A;  3BQZ A;  4ZC3 A;  5BS6 A;  1T08 B;  1H9G A;  2A69 F;  3JW4 A;  2XKO A;  5H20 A;  3K70 D;  4KIT B;  3OSG A;  1Z05 A;  2K3F A;  1QVT A;  2ZCW A;  4ITV A;  1H88 C;  2BE5 F;  4PUS A;  4XR6 A;  3BTI A;  3SDG A;  4FAS D;  3OYL A;  1F1Z A;  5HLH A;  1EJ9 A;  3KZZ A;  2EQR A;  4ASN A;  4WX9 A;  4I0A A;  3NQO A;  5EF6 A;  3IL2 A;  4GYG A;  3H9G A;  2OUM A;  2JRT A;  1Y1V J;  3BG9 A;  3IHU A;  2A6E F;  4A3B J;  3EQL F;  4WXC A;  2OQG A;  2EFP A;  3K2Z A;  1RR8 C;  2HQR A;  5K7F A;  2WAD A;  3LFU A;  2Y30 A;  4HF0 A;  5HS9 A;  2ZBK A;  4B43 A;  4LK1 F;  2MD5 A;  4BQA A;  3H0G J;  2P6S A;  2HDC A;  2RNJ A;  5J4V A;  1TBX A;  2K40 A;  5TRD A;  1OYY A;  3WTW C;  2M8G X;  3WTV C;  5E1W A;  1MSE C;  1QRY A;  1ZRE A;  2M1B A;  5HDG A;  3FXU A;  3G1M A;  2KHM A;  3LA3 A;  4AYB A;  4I99 C;  3S16 J;  3V7C A;  3AAF A;  2K27 A;  3BT9 A;  4AYB N;  2Z16 A;  2M0M A;  3B02 A;  1IXC A;  3ZXS A;  4PGH A;  3PL8 A;  3QYB A;  4XM3 A;  3L2W A;  1KQ8 A;  1OFC X;  1D0X A;  1OQY A;  4HV5 A;  3GWZ A;  5K1Y A;  2QKL B;  1MKM A;  1PUF A;  5CLS A;  1ZTR A;  2HKO A;  4XLN F;  3RTR A;  3CC4 I;  1O7L A;  4BNC A;  2NVT J;  1LUJ B;  4G6Q A;  1IN4 A;  3V8L A;  5D5U B;  5TGT A;  3H3V K;  4UB8 C;  4GCV A;  4A3I J;  2Q2E B;  1VQP I;  1WCM J;  5CQE A;  1KQ9 A;  3RKQ A;  2BHZ A;  5HLI A;  3S17 J;  2DT5 A;  2K85 A;  4XRF A;  3ZMT A;  1GV5 A;  2GXA A;  2DA1 A;  4BEH A;  4N0B A;  3E5X A;  2OQR A;  2HEO A;  3REO A;  2VOD A;  1RZ4 A;  2ESH A;  3I54 A;  3U1K A;  2CUE A;  2FUG 2;  2Y31 A;  3GTQ J;  4W97 A;  4X0G A;  3LOC A;  5LFA A;  1UAA A;  1RUN A;  3QYF A;  2MD0 A;  1O57 A;  4A3F J;  1I50 J;  2GM4 A;  1H9T A;  1WGX A;  3KFW X;  3Q9S A;  2R7W A;  3ZQC A;  1MH4 A;  5AON A;  3CCS I;  2HVS A;  3HOS A;  1EV7 A;  1YIO A;  2RN7 A;  1A6Q A;  2HYJ A;  2Q0O A;  3GTO J;  1HLV A;  2L5Q A;  1MMG A;  3PO2 J;  2WAE A;  3F8C A;  1WWX A;  4A3D J;  2KDO A;  2ZXJ A;  3IP4 B;  4CCJ A;  1JHF A;  3PSF A;  2XAS A;  3VFZ A;  1ETV A;  2W57 A;  5KAI C;  2KIU A;  2COB A;  1VQ6 I;  3DXJ F;  1W5S A;  1EA3 A;  5F27 A;  1NG7 A;  2R93 J;  1Z67 A;  5LGN A;  1XN7 A;  3JRH A;  1JJ6 C;  3DPT A;  1FYK A;  4Y33 A;  3QRF F;  1ZGW A;  1AKH B;  3LSI A;  1Z6T A;  3WGG A;  2L4M A;  1DQU A;  5E3M A;  5EGO B;  1MDM A;  4BHC A;  4L0Z B;  3KYL A;  4TV7 A;  1S7O A;  5M5Y J;  4KT5 C;  1HCR A;  3E7L A;  5K5O A;  1BR2 A;  2DDA A;  2ID3 A;  3D5S C;  2LNB A;  4RB1 A;  4II2 A;  5FJ8 J;  2V4J C;  2QVO A;  4QPO A;  1TT0 A;  5D5W B;  1ZK8 A;  2YU9 J;  1BW6 A;  1X58 A;  2EIK H;  1WJE A;  2N8G A;  4YFK F;  2ZSH B;  1VF9 A;  1XSV A;  4EVI A;  2EWN A;  4J19 A;  2HXO A;  3RQI A;  4U7D A;  2EIN H;  5FKO A;  3LQQ A;  2Z5U A;  1V54 H;  5B1B H;  1UEL B;  2VN2 A;  2B9S A;  3JRB A;  2UUZ A;  5B66 C;  3QP6 A;  4UUS A;  1LB2 A;  2IT0 A;  4MEY F;  3F9K A;  2WAF A;  2CMP A;  3DBH B;  4W1U A;  2UZK A;  2STT A;  4MLO A;  2FOW A;  3R61 A;  1E3O C;  5L3B A;  5A2Q Z;  2E19 A;  1R23 A;  4YEL A;  4Y13 A;  4ZYE A;  3L1P A;  1N77 A;  3ML6 A;  3MN2 A;  2XGD A;  3S1M J;  3J81 K;  3K6G A;  3VYS B;  4IZZ A;  1SVL A;  1SMT A;  3FIW A;  1FSH A;  2LP0 A;  1SMY F;  2K7L A;  3BC8 A;  4NBQ A;  2G9W A;  2EIJ H;  4RB3 C;  3JRI A;  4WK8 F;  4C9Y A;  4A3J J;  4C2M J;  1T2K A;  2ZJP F;  4HNU A;  3VSL A;  2IS4 A;  4HX7 A;  1RET A;  2DFH A;  2H6B A;  3TQN A;  1YRN B;  3LSR A;  2KDZ A;  4IQ4 A;  5DUK A;  2NOG A;  1WH5 A;  3A02 A;  2YR2 A;  3R6S A;  2L7Z A;  2V6E A;  2KIM A;  3H1C A;  3S1Q J;  2AXT C;  1YX3 A;  4LIU A;  3PUF A;  4MQV A;  3E6B A;  3W6V A;  3IH4 A;  3ERM A;  1DUX C;  2L9N A;  4Q5S F;  3HJE A;  4XMY A;  3F6V A;  2CS3 A;  2ZXH A;  2HTS A;  3K70 C;  1IN8 A;  4CA0 A;  1QGP A;  1SFE A;  3O8G A;  4WCG A;  5FFX A;  3T1B A;  3GEZ A;  3TDU C;  2KKO A;  3HYI A;  1W5C C;  3KP3 A;  3I4P A;  3SXY A;  2GXB A;  1LE8 A;  4JX5 A;  1PJR A;  2K9N A;  3DU5 A;  3S8P A;  3H0D A;  1DGW Y;  4XQF A;  2LY1 A;  1XS9 A;  3I58 A;  4CCN A;  1XC5 A;  4EAT A;  2M4G A;  1MMD A;  2ZNZ A;  4BUP A;  3CTA A;  4BS9 A;  4HDV A;  5KCM A;  1LFB A;  4A6D A;  4LG0 B;  2VE8 A;  2VJJ A;  2JWT A;  1R49 A;  4A12 A;  1UZC A;  3QOD A;  1ACI A;  5BMZ A;  3BTC A;  3CMM A;  4IPA A;  3G71 I;  2EFW A;  2DK5 A;  1T38 A;  2L7F P;  4A3K J;  3C3W A;  4I09 A;  4LK0 F;  3RKX A;  3M3Y J;  4RAG A;  1OIS A;  1ORK A;  2DA2 A;  3E97 A;  1QPM A;  3WHC A;  2RQP A;  3K4N A;  3DU6 A;  2CUZ A;  4E6K G;  4G6D A;  5L3C A;  3CUQ A;  4NC8 A;  5CPR B;  2I10 A;  3ECH A;  4G8X A;  4XLA A;  1QA6 A;  1A35 A;  5EG0 A;  1YJ9 I;  3NAU A;  1ZG3 A;  2KP6 A;  1TWG J;  3H3U A;  1P2F A;  3TOB A;  3ZMS A;  3OSF A;  4AIH A;  3P9C A;  1FBQ A;  4DYQ A;  2DJI A;  2EV6 A;  3KCC A;  5GPC A;  1ZKG A;  2NOJ B;  1X4P A;  3A01 B;  5ERI A;  2FMY A;  2MG4 A;  1K4T A;  4ENN A;  3S15 J;  1S29 A;  3FWE A;  1Z21 A;  3OR2 C;  4KDP A;  3BG5 A;  3J7A Y;  4UNO A;  2XC7 A;  1Z6R A;  3HOZ J;  4OOI A;  4BAC A;  4RGX A;  2F4O B;  2IGM A;  4LG3 A;  2VQH A;  1USS A;  3KLN A;  5J47 A;  2CG4 A;  2EJR A;  4HLX A;  1U3E M;  3HTS B;  1E2X A;  1T95 A;  1RNL A;  2G7H A;  2FD5 A;  1B6A A;  3BTL A;  2LY2 A;  4OIP F;  4HDU A;  2IA2 A;  2R4G A;  5DV5 A;  2PJP A;  5IOZ A;  3SDB A;  4CYC A;  2MBF A;  1JUS A;  3S2W A;  2E1C A;  2DA4 A;  2M3A A;  1X3W B;  4DBQ A;  3CDL A;  2V1U A;  4XLP F;  5HS7 A;  3H9J A;  4U87 A;  3KP7 A;  3GLX A;  4ESJ A;  2AQE A;  1UHW A;  3IAM 2;  4L18 B;  1G2H A;  4DQ2 A;  4BDY A;  2O9L A;  2KPM A;  2QSF X;  4OMY A;  1WKM A;  5DCM B;  3ZMZ A;  2O5R A;  5B5E C;  3LAP A;  3LAJ A;  1Z7L A;  1ETX A;  3G3Z A;  4RAZ A;  4WWC A;  3MMY B;  2R7Z J;  3A2K A;  5ED4 A;  4JQF A;  3IV5 A;  1FOY A;  1GLN A;  1V3F A;  2R0Q C;  1QU3 A;  4KNY A;  5E8G A;  2IJL A;  4A5M A;  1ODD A;  2VQC A;  2IA0 A;  3HXL A;  1YQA A;  1U5T B;  4P9U A;  2XSD C;  1JTY A;  3I59 A;  3U2R A;  2MW8 A;  4IKF A;  3CCQ I;  1QNT A;  4HQE A;  3DTK A;  2DBB A;  4H4K C;  2Z9O A;  4V19 K;  2X1D A;  2QSG X;  5DDG A;  4E70 A;  1LEA A;  2V79 A;  3L09 A;  3WTX C;  4D7M A;  5ILV A;  3ONQ A;  4XID A;  2VKH A;  1U2W A;  3M8E A;  1BOA A;  1MBH A;  4C3I J;  2AXL A;  2MYS A;  1NG6 A;  4B44 A;  2DJN A;  4UY8 I;  3OS2 A;  4BYY A;  2CW7 A;  2NVX J;  4OIN F;  1QZY A;  4I0B A;  5CKT A;  4ZTF A;  4IOA F;  3LQR A;  2ELJ A;  3B6A A;  3H5N A;  5JHF A;  2A5Y B;  2VXD A;  3KP6 A;  1TTY A;  2ZME B;  2UXX A;  1XGS A;  1YW8 A;  2FX0 A;  4CCM A;  2F6C A;  3G6E I;  1LEB A;  1D5Y A;  4GDF A;  2VIX A;  4KIG A;  1SFO J;  3RKY A;  3SZP A;  4B3A A;  4R79 A;  3GTL J;  1OPC A;  2JA8 J;  4S0H B;  1Y0U A;  2OF7 A;  2ZXI A;  5CYV A;  1B72 B;  2DMN A;  2EPF A;  3KP5 A;  2W84 A;  3I9V 2;  1WJC A;  2GOM A;  1A31 A;  3GVA A;  4B48 A;  4AU7 A;  2EZL A;  3MZY A;  3BWG A;  1HW1 A;  2Q2E A;  2V26 A;  5D4S A;  4NQW B;  1IRZ A;  1XMX A;  4YIF A;  4BE0 A;  2P0W A;  1BBY A;  3FM3 A;  2DOA A;  1SD5 A;  2VXZ A;  3HZJ A;  4L0Y B;  2QBY B;  3V4G A;  4HNT A;  3VPR A;  5D4R A;  1GVD A;  3CCR I;  1JJ8 C;  4XRM A;  1R9T J;  1G8X A;  4HW0 A;  1D8J A;  2HQA A;  3JSP A;  2B63 J;  2BVL A;  3LA2 A;  4F52 A;  2DQR A;  1PYV A;  2JTV A;  4LIT A;  4FTH A;  2K02 A;  2QSH X;  4D0P A;  5IYC J;  5K5Q A;  2RGV A;  4CXF A;  3J7Z I;  4P9F A;  3HB9 A;  4G7Z F;  1NK3 P;  4EEF G;  3GBG A;  4OWR B;  1WVR A;  1KGS A;  2CQ7 A;  3L7W A;  2KIF A;  4IQJ A;  5IT9 Z;  1YX5 A;  1XG1 A;  3HHG A;  3ISP A;  2BY3 A;  3I53 A;  4N9I A;  1GXQ A;  2HGC A;  3U21 A;  3K4C A;  4MFD A;  1D5V A;  4E7I A;  4BE2 A;  4E4H A;  2IA1 A;  3ECO A;  2JQ7 A;  3CCV I;  5EEH A;  3I56 I;  4L9N A;  2OCE A;  3OIP A;  4YIR X;  1HDD C;  3ZR8 X;  3D0S A;  2GBY A;  3TL4 X;  4IL6 C;  1RIO H;  3I4N J;  1MNE A;  2V9V A;  1U8B A;  2QLZ A;  5LRR A;  4RLF A;  4L5J A;  1BW5 A;  4NNJ A;  4LB6 B;  5DS9 A;  4CUG A;  4OIQ F;  1AKH A;  3ABK H;  1LFU P;  3PQK A;  1RC9 A;  1B4A A;  3ULQ B;  1FBU A;  5LLQ A;  1F43 A;  3JRF A;  3I5U A;  1FIA A;  1BM9 A;  1J75 A;  1MMN A;  2WV1 A;  2VKV A;  5EGO A;  4BHB A;  4I6Z A;  1BC7 C;  2QUF A;  5BOX A;  2HI3 A;  1Y39 A;  4A93 J;  1EF4 A;  4WF2 A;  3P9K A;  2HU9 A;  1XB4 A;  4M3G A;  2HTJ A;  1G4D A;  5F0C A;  2L7M P;  5DEQ A;  4RS8 A;  3BG7 A;  1MBK A;  1ON1 A;  2LRD A;  5L3G A;  1IO2 A;  1R36 A;  1G59 A;  3DTE A;  1MJ9 A;  1U78 A;  1WJD A;  2H94 A;  3OR1 C;  4YEJ A;  5H6Q A;  1RRJ A;  4HF1 A;  1FP2 A;  1J0R A;  3E6M A;  3Q5F A;  4RB2 C;  4V2F A;  3OIQ A;  3T8T A;  4HV6 A;  2PN6 A;  1VQL I;  5F04 A;  2L4A A;  2D5V A;  5F64 A;  3CCM I;  5HNF A;  3MQ0 A;  2LFB A;  4QSH A;  2O0Y A;  2FSW A;  2RRE A;  3IH3 A;  2A07 F;  1MZB A;  4GO1 A;  1P7I A;  4MIM A;  5CJ9 A;  3DFG A;  4HEA 2;  1YJN I;  1FJL A;  2DPD A;  3AFH A;  2IRF G;  2V1X A;  1G3W A;  2XGX A;  1K79 A;  1R58 A;  2NRA C;  3G2B A;  5C4J J;  4MEX F;  1E3H A;  1Q1H A;  1K4S A;  2MFZ A;  2YSR A;  1QZE A;  3MKW B;  2DOE A;  3D1N I;  1ONV A;  5FB2 A;  2DA3 A;  3KPH A;  5C4X J;  4PDK A;  4HG2 A;  2HDW A;  2M0C A;  2VBY A;  3F6O A;  5IP9 J;  2EA4 A;  1ZRC A;  3WU0 A;  2OTJ I;  4U88 A;  3FXO A;  4IO9 F;  2LTP A;  3QPS A;  1W7P D;  1Z77 A;  5LEK A;  1TNS A;  2JVH A;  3K1N A;  2R7X A;  1VZ0 A;  4P96 A;  3TO6 A;  2E36 A;  1BJA A;  2MSY A;  1P92 A;  1BR1 A;  2MGQ A;  1YOV B;  2GA2 A;  2D1V A;  3Q9V A;  1KYZ A;  1YRN A;  1YE9 A;  2DYS H;  2VBX A;  1REP C;  5E3O A;  2R7T A;  3SFZ A;  3WE3 A;  3IC7 A;  1F4K A;  3FDY A;  4RGR A;  1B59 A;  1P7J A;  2ZJR F;  2FQ3 A;  1PDN C;  4BJ6 C;  2CUJ A;  2R5Z B;  4FQG A;  1I3Q J;  2HKX A;  1UHS A;  1VQM I;  2KLO A;  1ERD A;  4DBR A;  4FX0 A;  2BGC A;  2OJE D;  4Z6Y A;  3M7G A;  2KL4 A;  2G0E A;  2MLG A;  3KIO A;  3KEQ A;  3JTG A;  1POG A;  3OMY A;  2MC3 A;  1I1S A;  5DD8 A;  3JSO A;  2Q1Z B;  4LMY A;  4ENM A;  2B0L A;  5CVJ A;  3K0L A;  1IN7 A;  3WTZ A;  1MIJ A;  2LVS A;  5L3D A;  3DEU A;  4IHX A;  4UUT A;  5EEA A;  3OL3 A;  4EGY A;  1FOX A;  1LKX A;  3HPG A;  3DP7 A;  2QCO A;  3S93 A;  3TED A;  1TNT A;  2K86 A;  3H5A A;  1BIA A;  2XPV A;  1K61 A;  1F36 A;  1TW3 A;  4JYK A;  2BV6 A;  1FZP B;  2ELH A;  2IS6 A;  3WU1 B;  4IHV A;  5KAF C;  3B73 A;  1S72 I;  1OCR H;  3ASN H;  3H92 A;  2E2I J;  3ABT A;  3K7A J;  1MH3 A;  2EH3 A;  4ESF A;  1OYI A;  2WC2 A;  3QAH A;  4CYD A;  3BLY A;  4XN0 A;  5J1R A;  3HRT A;  3ABU A;  2PMZ A;  3A01 A;  4A3G J;  3F21 A;  2PMZ N;  4E7K A;  3L2U A;  2EA2 A;  2R7V A;  9ANT A;  2JN6 A;  2HYG D;  2WY8 Q;  5GTI C;  5FGM A;  3HM5 A;  4I02 A;  3CES A;  1V5F A;  2OZU A;  2P8T A;  1HST A;  1LNW A;  4PJJ A;  1T39 A;  3C1D A;  2FF4 A;  4HA8 A;  2VJ5 A;  2R5Y A;  3DCF A;  1IRX A;  3DLL F;  1FY7 A;  2RV8 A;  2V1D A;  4P55 A;  5FLM J;  3OYN A;  1RI7 A;  1LVA A;  2UV1 A;  1NH3 A;  2O7O A;  5IY5 H;  2PJR B;  3PO3 J;  2QKM B;  3DKY A;  4PFP A;  5FO5 A;  2WTE A;  1C0W A;  5LGT A;  1J2X A;  1ZAO A;  3K4J A;  4QPQ A;  3LSP A;  3LSM A;  2A05 A;  2OU2 A;  4XOP A;  2GZW A;  5M5W J;  1FOK A;  1X4O A;  2E60 A;  4HBL A;  1HOM A;  1OCP A;  1ZEL A;  1MJB A;  2EBI A;  5GAG J;  1W5T A;  1KYW A;  1FMW A;  2X85 A;  5D5X B;  5E20 A;  2I8D A;  2HPM A;  4A6E A;  4FX4 A;  5J8F A;  4LLN A;  1RPW A;  3C18 A;  2R3S A;  5DCM A;  1W7P A;  3CUO A;  5DM6 F;  1KZH A;  1AOY A;  4OMZ A;  2W85 A;  2EV5 A;  2CW0 F;  1S7E A;  4BDZ A;  3F8B A;  1HW2 A;  1E3P A;  5EYR A;  4HQM A;  3HRM A;  3P9I A;  4UVB A;  2P5V A;  5F0H A;  1U5T A;  3M4O J;  4UB6 C;  3DBR B;  3GZ6 A;  1IV8 A;  2VON A;  3JRG A;  2XAU A;  2DAO A;  5JVG F;  3HRS A;  4IRG A;  1WSU A;  5JFR A;  5M5X J;  2K4B A;  1VI0 A;  2JVG A;  2IGK A;  4YFN F;  1ZRF A;  1RES A;  4EM0 B;  1IAW A;  1EH7 A;  1JKO C;  3AL0 C;  4A3M J;  3BCA A;  3JR9 A;  2R92 J;  1TQP A;  4AM3 A;  2O6G E;  2E2J J;  3KYC B;  1P9Q C;  2BW3 A;  2LBF B;  3E3V A;  2FE3 A;  3FXL A;  1S6L A;  2X51 A;  4DIQ A;  1N25 A;  5H2F C;  2ICW G;  2H6C A;  4O6J A;  3BJA A;  2GWR A;  4KFC A;  1K7A A;  2ZME A;  5TJJ A;  1MND A;  2LF7 A;  2XPU A;  4FIS A;  2IS1 A;  2PQ8 A;  4MHG A;  1VQ5 I;  3TGN A;  3I3L A;  4FE4 A;  2WWY A;  1OCO H;  4HX8 A;  4Y52 J;  4AIJ A;  3WG7 H;  2W7N A;  3DKX A;  1IF1 A;  4ANJ A;  3O6B B;  4KIS A;  4G6T B;  1U9O A;  5M3M J;  1JT6 A;  3RSN A;  3HL2 A;  2STW A;  2BY2 A;  4MFE A;  1V5E A;  2IGN A;  2OCC H;  2CQN A;  1D0Y A;  3E6C C;  2KZG A;  3CCY A;  2QF7 A;  4C3J J;  1I6H J;  4NDL A;  3IKV A;  3MEX A;  5KHD A;  1VQO I;  1XDS A;  2ZFW A;  5JHU A;  3OOU A;  1S9H A;  2DMQ A;  1W36 D;  4NQW A;  3GTM J;  2IAI A;  2GXG A;  4ZYA A;  1AHD P;  1Z1D A;  1S8N A;  3D5L A;  2CQX A;  1T8I A;  2QBY A;  3R60 A;  1IV6 A;  4ENJ A;  1F9N A;  5J40 A;  2EB7 A;  2VE9 A;  2A61 A;  4CIC A;  2K9Q A;  1X3U A;  3A1Y A;  1ZG5 A;  2OPT A;  1VQ4 I;  3RYP A;  4IX7 A;  2VJ4 A;  3GZ5 A;  3IWZ A;  4XN3 A;  3VSK A;  1OYW A;  4MQ9 F;  4B47 A;  3H9Q A;  2YUS A;  1FOW A;  1DPU A;  2NVY J;  4B09 A;  3FKJ A;  3RPU A;  4MO7 A;  1E17 A;  2H09 A;  2OAZ A;  3J7Y J;  4FT8 A;  2R7O A;  2LD5 A;  2FXA A;  2OD5 A;  1FIP A;  1JKP C;  1SFX A;  3DV8 A;  1QBJ A;  3FKI J;  4PJN A;  3JRD A;  2BXY A;  3M9A A;  2OZ6 A;  3W2W A;  1K83 J;  2DA7 A;  3ZN0 A;  2CW8 A;  2VC1 A;  1LDK B;  1KA8 A;  1YYV A;  1ZLJ A;  3OL4 A;  1IXS B;  5BPI A;  4PCQ A;  1U0J A;  1FTT A;  1YW7 A;  1HKS A;  3M1E A;  2W4S A;  3S3M A;  2UWM A;  1YIT I;  1XDU A;  4E7Z A;  2HR3 A;  3L2R A;  2QGU A;  4EM2 A;  5F1R A;  2O61 A;  3RYR A;  1J9I A;  3HSE A;  1R00 A;  4Y15 A;  4ZYG A;  4DJA A;  3KX2 A;  4CZC A;  1NHA A;  1YW9 A;  1BI3 A;  4HRI A;  2KT0 A;  1Z3Y A;  5EJC A;  1SFK A;  1RKT A;  3BP8 A;  3IRR A;  4UV9 A;  5ICF A;  3DKW A;  4N9H A;  5ILS A;  3FIS A;  3ERE D;  1Z7U A;  2CJJ A;  3ZQ7 A;  1N75 A;  2RAE A;  1I5Z A;  3WHB A;  2QZ8 A;  4IHY A;  2WA0 A;  3KET A;  5LRS A;  5FD5 A;  2XIG A;  3DWL E;  1XCV A;  2LH9 A;  2M7B A;  3L9F A;  3CJR B;  4M73 A;  2CH0 A;  2L01 A;  4J01 A;  4EJU A;  4Y17 A;  2DN0 A;  1H0M A;  5HLT A;  2VQL A;  1TWH J;  1FMV A;  1UMQ A;  1ETK A;  3SEZ A;  1SAU A;  2H8W A;  1WJB A;  2OBP A;  4L9J A;  2MH2 A;  5J1U A;  1WFX A;  4OU0 A;  1MBE A;  1ZG1 A;  3NRV A;  1BL0 A;  3CMA I;  3IAS 2;  3GTG J;  2V1N A;  4UVA A;  2HOE A;  1XSX A;  3A03 A;  3FK6 A;  2R7Q A;  2J5P A;  3CJN A;  3L00 A;  1P6R A;  2IW5 A;  3MD2 A;  3ESW B;  3PIP F;  4ENK A;  1D1A A;  4DYR A;  2VB6 A;  2IXS A;  3TW6 A;  3HRU A;  4BY7 J;  1NTC A;  4LOC A;  3BG6 A;  1JGS A;  4B1R A;  1WJ5 A;  2EZI A;  1VQ8 I;  2RDP A;  3CP8 A;  5IP7 J;  4WXD A;  5IOY A;  1U9N A;  1AWC A;  3RJP A;  5BPD A;  1W0U A;  1I6X A;  2O3F A;  1QHG A;  2L7K A;  5M3F J;  4OIO F;  1PP7 U;  3U1D A;  3RZD J;  3OYM A;  2R7S A;  2WV0 A;  2VL8 A;  4O3M A;  3KYD B;  2VKD A;  3RPQ A;  2F5E A;  2BEO A;  4L9V A;  4NUB A;  2W24 A;  5C3E J;  2FNA A;  1R4N B;  4RAY A;  1WPK A;  3VEP A;  2V9K A;  1CF7 B;  2KJB A;  1Z3X A;  1TW2 A;  1HBX G;  5IT9 K;  1IDZ A;  2VI6 A;  5GP9 A;  2HNH A;  2GAU A;  3T0Y A;  3CJQ B;  2LKX A;  3GW2 A;  2YX4 A;  3E1S A;  4GRI A;  1IG7 A;  2P5K A;  3W2A A;  3TO7 A;  5FKL A;  4A0Y A;  2PEX A;  3T5X A;  1LFP A;  2KIS A;  5DTD A;  1MSF C;  1MMS A;  4XON A;  2XB0 X;  5FKM A;  3EUH A;  3BOQ A;  2PMH A;  4Q48 A;  3S2D J;  1ON2 A;  4X1E A;  2LR8 A;  2PMU A;  4RLQ A;  2R5Z A;  2A6H F;  2Z99 A;  5IYB J;  1YJW I;  3K10 A;  2DT7 B;  3AG4 H;  1KQ0 A;  3M07 A;  3PNT A;  4A0X A;  4RDU A;  1BJZ A;  2FML A;  1WRJ A;  3OYD A;  3OYB A;  1ZR4 A;  1VQN I;  1FNN A;  1JI8 A;  1FYM A;  5L3E A;  3KEY A;  3BQY A;  3W6J B;  3S3O A;  3ABL H;  3QPL A;  3VWB A;  1ZLK A;  1O7F A;  1MGT A;  3JCU C;  1IRG A;  3FX3 A;  2Y69 H;  2E1N A;  2LRE A;  4DZP A;  3CO7 C;  3GYH X;  3E5Q A;  2CQK A;  2QWW A;  5DYM A;  3M8J A;  3BCB A;  2VC0 A;  3QOE A;  2JA2 A;  4OAY A;  3FXK A;  2FNP A;  3FMS A;  3MVP A;  1DP3 A;  2EIM H;  1RR7 A;  3CUQ C;  3G73 A;  2QQ8 A;  2LKS A;  3ZOB A;  1SEU A;  1HKT A;  3J7A O;  1W0T A;  4JX4 A;  3SEQ A;  3UR3 C;  2PFB A;  5JLW A;  1R71 A;  1BOB A;  1VTN C;  2VQG A;  4V2G A;  4RM3 A;  3CLO A;  4CHU A;  2X9D A;  3S14 J;  4X6A J;  1X1A A;  1T0F C;  4OAZ A;  3WU2 C;  1IDY A;  2CGP A;  5E17 F;  1YLF A;  2JA7 J;  1GT0 C;  4I2O A;  1OR7 A;  3HPH A;  2EFQ A;  4LFU A;  2CUF A;  2ZSI B;  1MNM C;  3ZQG A;  4EGZ A;  3MKZ A;  2MA3 A;  2K9M A;  1YI2 I;  4K2E A;  2X1C A;  2LY9 A;  1APL C;  2KRF A;  4XRS G;  4CO8 A;  1I3A A;  2RVC A;  1R5I D;  1X3Z B;  4F91 B;  5D5V B;  1UB9 A;  4HF2 A;  1O3T A;  3CD6 I;  2ACJ A;  4NC6 A;  1AU7 A;  4NC7 A;  3G4S I;  5GAH J;  3FHN A;  3KLO A;  2E1O A;  5D8L B;  4HSR A;  2F48 A;  3ZN1 A;  4EJW A;  3JAM K;  3EUA A;  2JA5 J;  3C2H A;  1XGO A;  4BQO A;  2PJR A;  2VJI A;  1MBJ A;  4XKW A;  3KEO A;  2GIV A;  3ROU A;  1ETW A;  2HS5 A;  2Y0S A;  3SZT A;  2DTZ A;  2Y0S N;  4CCL A;  5C44 J;  4MGR A;  4CCK A;  3DBL B;  5J4Y A;  5ICC A;  2XAQ A;  5JVT A;  2X1E A;  1A6I A;  5FLV A;  2OC6 A;  4QIW N;  3H3Z A;  4I98 B;  4U0Y A;  1V5G A;  1IW7 F;  1GDT A;  3BTJ A;  1OKR A;  4FE7 A;  3MZH A;  1YFH A;  2GLO A;  3HOX J;  1A5J A;  2HYF A;  2BOL A;  2GOX B;  1N78 A;  1ETO A;  2V7F A;  3K9T A;  5LHG A;  3K4M A;  1J5Y A;  4DZJ A;  1XTA A;  3CQZ J;  3LSG A;  4XIC A;  1XGN A;  2BVM A;  3M8F A;  1D0Z A;  2X6W A;  2E2H J;  1JXS A;  1A04 A;  2Z1D A;  4AD9 A;  4NHJ A;  4P5O A;  4A3C J;  4D5F A;  3S3N A;  3L2V A;  3TMO A;  3B6C A;  4AC0 A;  3HHH A;  2H8R A;  3OYC A;  2XAH A;  4KMF A;  3F8N A;  2CFO A;  2XSJ C;  2M87 A;  4D7N A;  3DPL C;  2ZB9 A;  3KE2 A;  4PK4 A;  3CO6 C;  3QU6 A;  5EZG A;  4AVP A;  4Y3O A;  1BC8 C;  1K78 B;  5GAE J;  1ZH5 A;  3IRQ A;  3V7S A;  4PJM A;  4D9J A;  3FMQ A;  5GAD J;  3PM1 A;  3EYY A;  5EEG A;  2QA4 I;  2HDD A;  4EM1 A;  4G7O F;  4DYC A;  4DW6 A;  2XF5 A;  1R1U A;  3ZRG A;  4B4C A;  1M1E B;  3CJT B;  2O8X A;  5DD4 A;  3HGY A;  5J1Y A;  3I71 A;  2BYV E;  2FBH A;  3K1P A;  3OIO A;  4L9T A;  1S3J A;  4ZTJ A;  1XPX A;  3BG3 A;  5E18 F;  1U8R A;  2HZT A;  2ESN A;  3CCU I;  5CVI A;  3VYU B;  1IC8 A;  2HVQ A;  4G12 A;  1KU2 A;  3EYI A;  3S32 A;  1DP7 P;  1D8K A;  1YIJ I;  1L0O C;  2FBK A;  3FMR A;  1DDN A;  4KJZ A;  3GZN B;  4ON0 A;  2WB1 A;  2XF6 A;  3DF8 A;  2WB1 N;  1O3R A;  3BR2 A;  3L2C A;  3JRA A;  3OYG A;  3VYR B;  3CF2 A;  3K4B A;  1TC3 C;  2QYO A;  4RA2 A;  3O8H A;  1IXR C;  1R1T A;  4UUV A;  1XMK A;  3CC7 I;  1XD7 A;  2Y9Z A;  2DFI A;  2LDU A;  3J80 Z;  5IP6 A;  2M7A A;  2ISZ A;  1SC7 A;  4IHS A;  4M3B A;  3UNG C;  1UG2 A;  3FHZ A;  1HW5 A;  4AWX B;  1VQ7 I;  2E7W A;  3BR3 A;  3OS1 A;  5D6E A;  1RKW A;  5IT3 A;  4RBO A;  4R8H A;  4PJ0 C;  5HNH A;  2YS9 A;  1TT5 B;  4KN7 X;  3D5R C;  3X2Q H;  3CC2 I;  3GME A;  1BR4 A;  2QEX I;  6PAX A;  2B7E A;  4LJZ F;  4E7L A;  1R22 A;  3GO5 A;  4LLG F;  3HOU J;  2F2E A;  4IXA A;  3CDI A;  4R1H A;  1IUF A;  3QPT A;  3MCZ A;  3EUK L;  4XLC A;  1GVJ A;  2D1H A;  4A5N A;  1SD6 A;  4Y4R A;  1I27 A;  3FXJ A;  3ASO H;  1R7J A;  1TWC J;  3FXM A;  3P7N A;  1G3S A;  1R1V A;  3PNV A;  1QHH D;  2F4M B;  4BH9 A;  2P5L C;  5E8I A;  1LVK A;  2M5W A;  4G7H F;  2JUC A;  4I7H A;  2L54 A;  4CYC B;  3U9G A;  5ILU A;  1FP1 D;  4II3 A;  1R6R A;  2E7X A;  1CQT A;  3N05 A;  1JUM A;  2PX9 A;  3W2V A;  2Z2S B;  1IJW C;  3BR1 A;  2AHQ A;  4DOZ A;  2XGE A;  3WGI A;  5FRO A;  1J09 A;  1MD0 A;  4IVN A;  3WG9 A;  5BQT A;  2R7R A;  1LQ1 A;  1KU7 A;  2D45 A;  3MAJ A;  3HG9 A;  3GTP J;  2E35 A;  2K5C A;  1NK2 P;  4XNF A;  3TO9 A;  3G1L A;  5L3F A;  5FKN A;  4LG0 A;  1SVO A;  4ZJZ A;  4UVC A;  3MZ8 A;  2HZD A;  4AIK A;  2BBY A;  2CV1 A;  1JHH A;  2HXI A;  2ID6 A;  2H27 A;  2ME0 A;  3PFY A;  2JUG A;  3QYE A;  4NB5 A;  4WXH A;  3I59 B;  4S05 A;  2DTR A;  4BY1 J;  2LF8 A;  1IRF A;  1Q1V A;  4RGS A;  3F3X A;  2DOF A;  2FBI A;  2K9S A;  1EH8 A;  3N4M A;  1P4A A;  2Y9Y A;  3LWF A;  2EK5 A;  3L2Q A;  1HSJ A;  2P4W A;  4XK4 A;  4BQQ A;  4C2T A;  1DU0 A;  1VND A;  1ZHF A;  1B8I B;  4XRS A;  1BIB A;  2X6X A;  1O4X A;  1A36 A;  2VPR A;  4KUM A;  2W1O A;  4JP0 A;  3NAR A;  4XLE A;  2RKH A;  3PSI A;  1SFU A;  2F5D A;  3HOW J;  2E5Z A;  3TOA A;  1HA8 A;  2DU9 A;  4IF4 A;  1FWZ A;  3IWF A;  3C2B A;  5LD2 C;  4KYW A;  3O3K A;  3F8F A;  5FLX Z;  1J7K A;  1G3Y A;  2W48 A;  5A2Q K;  3C2G A;  4OIR F;  3FXR A;  2XAJ A;  2OTL I;  3LA7 A;  4RM2 A;  2XAF A;  3NWS A;  4KA4 A;  2QQ9 A;  5F1J A;  5F0F A;  4ABZ A;  3CCJ I;  2ZKZ A;  3RPU D;  1ZQ3 P;  1K6Y A;  2JSC A;  1JGG A;  3GTK J;  1Y8R B;  2VT2 A;  3E6D A;  1G3T A;  3E0J B;  2E71 A;  4ETS A;  1ZYR F;  3VOD A;  3S1R J;  4KIF A;  2M9H A;  4KIC A;  1CF7 A;  1I1G A;  1Y6I A;  1FSE A;  1CGP A;  2L9V A;  2O03 A;  1IN5 A;  4IOC F;  3OV8 A;  3PQJ A;  1AA7 A;  1H89 C;  2FRH A;  4CDG A;  2MC4 A;  1WHU A;  3HGG A;  2NXN B;  2GIZ A;  4ZZL A;  3LFK A;  2EZK A;  1UG0 A;  3JRE A;  2FJ1 A;  4GFB A;  3GFL A;  5CVR A;  3GF2 A;  2VBZ A;  1DU6 A;  4HPQ A;  2FA5 A;  2WY7 Q;  2GA1 A;  4XLF A;  3IUO A;  4HST A;  2NS8 A;  3Q0W A;  1Z9C A;  3FBI B;  3VYT B;  2WAQ A;  2L9S A;  2ZJ2 A;  5K5R A;  4C2U A;  2WAQ N;  1BA5 A;  1OCZ H;  3BR6 A;  5FKK A;  3TBI A;  5HS8 A;  3AG1 H;  1WZ2 A;  2MH9 A;  2NS7 A;  3ZMV A;  3QU3 A;  3HUG B;  3PNY A;  4HLY A;  4F7Z A;  2DMU A;  3SYT A;  1XMA A;  3ZGK A;  5J6X A;  1LJ9 A;  1OJL A;  2IBD A;  1JT0 A;  2HWV A;  4L5I A;  3FM5 A;  2CRG A;  3A0B C;  2PLY A;  4CCO A;  2E1M C;  2R7U A;  1ZAR A;  3H5R A;  5HOD A;  3W3C A;  3CLQ A;  3G1O A;  3S2H J;  2EZH A;  3WTY C;  2BHY A;  5H6R A;  2JPC A;  1YHQ I;  2NAZ A;  3TW7 A;  1STZ A;  1E0E A;  3BDD A;  2CFX A;  2MLK A;  4PGG A;  3BPX A;  3OYE A;  2XHK A;  1GV2 A;  1QPI A;  3EDP A;  2BY0 A;  1R5G A;  4EJV A;  2DK8 A;  4E7J A;  3DEE A;  2QQA A;  4M71 A;  1UFM A;  5K7H A;  1ETY A;  2A5W A;  2F4I A;  3BY6 A;  5HDN A;  3COA C;  2M34 A;  1S7A A;  2M8E A;  3E5U A;  2LKP A;  2YU3 A;  3HDD A;  3WGH A;  3MFK A;  2J5O A;  2DA5 A;  3CZ6 A;  4CSW A;  2ECB A;  3FBN B;  2EFN A;  2FQ4 A;  3K1M A;  2BY1 A;  2X6O A;  3SQN A;  2Z33 A;  2JZY A;  3HOY J;  1YTY A;  1JUP A;  2XUB A;  5LGU A;  2KQR A;  5CVU A;  1B72 A;  2DXI A;  4BQN A;  4HYE A;  4BBS J;  2ME6 A;  4U7B A;  2TRT A;  3HEF A;  1R4M B;  4IJA A;  3I64 A;  3ZQH A;  5JR3 A;  3F72 A;  2CV2 A;  2A68 F;  2IP2 A;  3I0T A;  3PUB A;  3K4L A;  3PJR A;  5E3L A;  4HOB A;  1TZL A;  3CF5 F;  3HKZ A;  1HDP A;  2D2W A;  5GPA A;  4BL0 B;  1MBG A;  3HKZ N;  3GUD A;  1Z91 A;  1LDD A;  1X1P A;  3DEW A;  2QM3 A;  4BXX J;  3CCL I;  4QTR A;  1TL8 A;  2ZXW H;  3RZO J;  3GFI A;  2LMD A;  4FCY A;  2ELK A;  2AS5 F;  2NYX A;  2LLK A;  3LSJ A;  2JK3 A;  3A4C A;  4XOT A;  5E1X A;  1K6O A;  4MTE A;  3ZP5 A;  1EKE A;  3RKW A;  1W4M A;  1JTX A;  2H1K A;  3GXO A;  5JLX A;  2RNG A;  3V8K A;  4BU2 A;  1QO0 D;  4MNU A;  1U5T C;  1H8A C;  4BXU A;  2XB5 A;  5TIS C;  4E7H A;  1QQI A;  4Z2Y A;  2JMW A;  4IEJ A;  3ZQI A;  2JRM A;  5LHI A;  3Q3S A;  3V8J A;  4M6Y A;  5GTH C;  2XRL A;  3Q0V A;  2NNY A;  1FTZ A;  2IPQ X;  2HQN A;  2Y48 A;  4YRV A;  1DGR M;  4KMU X;  2R7F A;  5D6F A;  2DCE A;  2XGC A;  1K78 A;  2K9L A;  4JOM A;  2DI3 A;  4M9S A;  5K7Z A;  4F3Q A;  1U6G A;  4AVZ A;  1FT9 A;  4HAM A;  1SD4 A;  3I4M J;  4KIB A;  2RQQ A;  1YS6 A;  4Q4Z F;  3CCE I;  1VQ9 I;  2VOP A;  2DFF A;  3EPZ A;  3S1N J;  3BJ6 A;  2NNN A;  1SAX A;  1RUO A;  4YII A;  2L2O A;  2ZME C;  3CDH A;  2ZC2 A;  2HQ5 A;  4B3X A;  1XGM A;  3WTT C;  4M9X A;  4A69 C;  4DNC A;  4C30 A;  2CQQ A;  4U0V A;  2P7V B;  1MJA A;  5J8C A;  4PFO A;  2HVR A;  2VPL A;  3OYK A;  4LLL A;  4ZDO A;  1F5T A;  2E1M B;  5AIQ A;  1O3Q A;  3Q0U A;  3GTJ J;  4EJT A;  4ZH4 F;  4XOR A;  2CWE A;  1GHC A;  1QZZ A;  3AL0 B;  5JI6 A;  1UCR A;  2IVM A;  3KZI C;  3WTU C;  3KP2 A;  4RGU A;  2ECC A;  4PSX A;  1Y8Q B;  2XAG A;  2PBI A;  1D3Y A;  1SD7 A;  1HF0 A;  5DCF A;  2Q8K A;  1T56 A;  1HC8 A;  1T33 A;  3HIF A;  1G6N A;  1W1W E;  1D1B A;  1WJF A;  3C7J A;  5EDN A;  4XLH A;  3ZMU A;  4F55 A;  5DUI A;  4RB0 A;  2NS0 A;  4BHP A;  2LSO A;  4M9Z A;  2HOA A;  4N4O B;  1HQC A;  2GQQ A;  3QWL A;  5HDK A;  2HFH A;  2PI0 A;  3NEU A;  3FK7 A;  3AG3 H;  2ADU A;  2KIQ A;  3SFI A;  1V55 H;  4E7S A;  1T0F A;  1QVU A;  3V42 A;  3ZCO A;  3W6K B;  1PUF B;  1X19 A;  1TP4 A;  3BR5 A;  2CV0 A;  4P1W A;  1FBS A;  2KMU A;  4F92 B;  2VLA A;  1TWF J;  4CGZ A;  3M1C A;  1JKR C;  3K2A A;  3ZQQ A;  2EIL H;  2XPW A;  4PJL A;  2MAB A;  3FXQ A;  4YFX F;  4F93 B;  2F5V A;  2R5Y B;  2R7D A;  3HTU A;  2QQB A;  4IHW A;  2JA6 J;  3WTS C;  4GYI A;  5ICG A;  1FC3 A;  3ZQL A;  1J59 A;  2LG4 A;  1Y56 A;  4M6V A;  3A0H C;  4I76 A;  5D8K B;  4BEH B;  2P81 A;  3TDZ C;  4YG2 F;  3OS0 A;  2KRC A;  4XSZ F;  4IHT A;  4FHT A;  3KZY A;  3VB2 A;  2DPU A;  2XVC A;  1OCC H;  1YG2 A;  1B9N A;  2CO5 A;  5B1A H;  3O2P E;  2O8K A;  1KON A;  3J81 Z;  2M30 A;  2VUM J;  1Z0X A;  3WE2 A;  2L9R A;  4M3F A;  1BI0 A;  2OA4 A;  4HNV A;  5AIP A;  2ISY A;  5E79 C;  1PUE E;  4BAY A;  1MMA A;  5F6F A;  1JE8 A;  1ITY A;  2LYC A;  5LEJ A;  1UHM A;  5HVQ C;  3IH2 A;  1ENH A;  1W7P B;  2E34 A;  4S04 A;  4LGW A;  5HOO A;  4BE1 A;  1B9M A;  5B3S H;  1P4X A;  3ZPL A;  1LDJ A;  1YS7 A;  2E5N A;  4XBF A;  1ULY A;  2EFO A;  4LIV A;  4BKX A;  2XRO A;  3MKL A;  3F0C A;  5KVR A;  1UST A;  1ZR2 A;  5FFZ A;  4ESB A;  3R0A A;  3F23 A;  1O3S A;  3RCO A;  3QOP A;  2I5U A;  1VFC A;  1IN6 A;  2DMT A;  3H35 A;  2JSP A;  3LL7 A;  4XKC A;  2AQF A;  3K4K A;  2L02 A;  2ZJQ F;  2NVQ J;  2KFD A;  1PVE A;  2M45 A;  2JT1 A;  1HKQ A;  1B8I A;  2OV7 A;  4IRI A;  1GUU A;  4D5C A;  2DW4 A;  4B8X A;  1GXP A;  3MWM A;  2COM A;  1MDM B;  2HPI A;  2BW3 B;  2PG4 A;  3NWT A;  4QLC U;  3DLA A;  2DA6 A;  1FYL A;  2G7U A;  3CMY A;  3QPH A;  4MTD A;  2AO9 A;  3WOD F;  5FRN A;  1TQM A;  3TP0 A;  3J80 K;  2ZFU A;  3GLL A;  3RDI A;  3SZG A;  2IS2 A;  4ZDP A;  3PIO F;  2Y2Z A;  1Y0N A;  1T98 A;  2VKE A;  1IUY A;  3ABM H;  5E1Z B;  2FOK A;  1W36 C;  3F8M A;  1TQI A;  4LB5 A;  3BZ6 A;  1WH7 A;  4O5V A;  4CZZ A;  4DGW B;  1TLH B;  2Y75 A;  5IPA A;  3GFM A;  3GX4 X; 
#chains in the Genus database with same CATH homology
 5M5X J;  1ORK A;  2DA2 A;  1VI0 A;  3WHC A;  2HOS A;  1RES A;  4CYC B;  1JKO C;  4UUS B;  4A3M J;  2I10 A;  3JR9 A;  2R92 J;  5EG0 A;  3NAU A;  1CQT A;  1TWG J;  2E2J J;  3OSF A;  1Y1W J;  1JUM A;  4DYQ A;  1IJW C;  3BR1 A;  5GPC A;  2AHQ A;  1JKQ C;  4BBR J;  1MBF A;  2XGE A;  1ZKG A;  3A01 B;  3QQA A;  2MG4 A;  1X2N A;  2IEK A;  2X48 A;  2XPU A;  4FIS A;  3S15 J;  4A3L J;  3GTP J;  4C3H J;  1NK2 P;  3BG5 A;  3G1L A;  5FKN A;  3SJM A;  3HOZ J;  4FE4 A;  1TWA J;  4Y52 J;  5IYD J;  2HXI A;  2ID6 A;  2HOT A;  1U9O A;  5M3M J;  1JT6 A;  2ME0 A;  2FD5 A;  1IGN A;  3BTL A;  4MFE A;  4L5E A;  5IOZ A;  4BY1 J;  4CYC A;  3CCY A;  1JUS A;  2QF7 A;  4AUX A;  4C3J J;  1I6H J;  1Q1V A;  2DA4 A;  4NDL A;  2K9S A;  2Y9Y A;  4JX6 A;  3CDL A;  5BNG A;  3OOU A;  3GTM J;  2DMQ A;  2CU7 A;  2IAI A;  4XK4 A;  1DU0 A;  1VND A;  1B8I B;  4XRS A;  1AHD P;  1O4X A;  2JJ7 A;  2VPR A;  2CQX A;  4JP0 A;  1G2H A;  1IV6 A;  3NAR A;  2O9L A;  2K9Q A;  2M2E A;  2OPT A;  3HOW J;  1ETX A;  3C2B A;  1LE8 B;  2YUS A;  2NVY J;  2W48 A;  2R7Z J;  4MO7 A;  3IV5 A;  5EZH A;  2R0Q C;  5F1J A;  2LD5 A;  2DMP A;  5F0F A;  4ABZ A;  1FIP A;  1JKP C;  1ZQ3 P;  3FKI J;  3JRD A;  1JGG A;  1K83 J;  2DA7 A;  3GTK J;  4Y7N J;  2XSD C;  1JTY A;  4M3D A;  3S1R J;  2MW8 A;  2M9H A;  1FTT A;  1H89 C;  4D7M A;  3HGG A;  1OCT C;  4XID A;  2EZK A;  5F08 A;  4C3I J;  1MBH A;  3JRE A;  5EG0 B;  2KT0 A;  2DJN A;  2L0K A;  3UKG A;  2FJ1 A;  4GFB A;  1RKT A;  1DU6 A;  2NVX J;  3HOV J;  3JRC A;  3FIS A;  3B6A A;  2NS8 A;  3Q0W A;  2CJJ A;  2RAE A;  2WAQ N;  1BA5 A;  3BR6 A;  5FKK A;  3WHB A;  2FX0 A;  4IHY A;  4M3E A;  2NS7 A;  1D5Y A;  1SFO J;  2DMU A;  4B3A A;  3GTL J;  2JA8 J;  4S0H B;  1OJL A;  2IBD A;  2LK2 A;  1JT0 A;  2TCT A;  2DN0 A;  1ETQ A;  2OF7 A;  3LNQ A;  2CRG A;  1TWH J;  5J3L A;  1UMQ A;  1B72 B;  1ETK A;  5HOD A;  3G1O A;  4A3E J;  2DMN A;  3S2H J;  2EZH A;  5J1U A;  1MBE A;  3BR0 A;  1BL0 A;  3TW7 A;  3GTG J;  1FEX A;  2EZL A;  5E3N A;  1X2M A;  3ZQF A;  3A03 A;  3FK6 A;  1IRZ A;  1GV2 A;  1QPI A;  1SAN A;  3HBL A;  4DYR A;  3VPR A;  1GVD A;  5K7H A;  1ETY A;  3TW6 A;  1WI3 A;  4XRM A;  1JJ8 C;  1R9T J;  2M34 A;  4BY7 J;  3TP3 A;  1NTC A;  3BQZ A;  4LOC A;  3HDD A;  4B1R A;  2DA5 A;  2B63 J;  2EZI A;  5IP7 J;  2ECB A;  3OSG A;  4FTH A;  1QVT A;  5IOY A;  1U9N A;  5IYC J;  1W0U A;  2FQ4 A;  1H88 C;  2X6O A;  3BTI A;  3SDG A;  3HB9 A;  5M3F J;  3HOY J;  1NK3 P;  4EEF G;  1JUP A;  3GBG A;  3RZD J;  2EQR A;  1B72 A;  1XG1 A;  5EF6 A;  4BBS J;  5C3E J;  3BG9 A;  1Y1V J;  2ME6 A;  2TRT A;  3HEF A;  1WPK A;  4A3B J;  4MFD A;  3ZQH A;  5K7F A;  1IDZ A;  2VI6 A;  2Y30 A;  5GP9 A;  5E3L A;  1HDD C;  1HDP A;  5GPA A;  2GBY A;  1MBG A;  2LKX A;  3HKZ N;  3I4N J;  1IG7 A;  3DEW A;  3H0G J;  1U8B A;  5FKL A;  5DTD A;  1MSF C;  4BXX J;  1BW5 A;  2K40 A;  2XB0 X;  5FKM A;  3S2D J;  4X1E A;  2M8G X;  5DS9 A;  2LR8 A;  4QTR A;  1AKH A;  1LFU P;  2R5Z A;  1MSE C;  5IYB J;  1QRY A;  1F43 A;  3JRF A;  1FIA A;  3G1M A;  3RZO J;  4FCY A;  2WV1 A;  5EGO A;  2VKV A;  2ELK A;  3BT9 A;  4RDU A;  4AYB N;  1BJZ A;  4I6Z A;  3S16 J;  2HI3 A;  2LLK A;  3LSJ A;  1ZR4 A;  4A93 J;  1EF4 A;  3M3Y J;  4M3G A;  2JK3 A;  1OFC X;  5F0C A;  2L7M P;  3BQY A;  1MBK A;  1PUF A;  3QPL A;  1JTX A;  2H1K A;  1ZTR A;  1U78 A;  5JLX A;  2NVT J;  1H8A C;  2XB5 A;  4DZP A;  4V2F A;  3H3V K;  2JMW A;  4IEJ A;  3ZQI A;  5F04 A;  3Q3S A;  4A3I J;  2D5V A;  4QSH A;  2LFB A;  2XRL A;  3Q0V A;  1FTZ A;  1WCM J;  3IH3 A;  3RKQ A;  3S17 J;  4MIM A;  3MVP A;  1P7I A;  1RR7 A;  1GV5 A;  2XGC A;  3ZOB A;  2DA1 A;  5K7Z A;  1W0T A;  4JX4 A;  5JLW A;  1FJL A;  3I4M J;  4V2G A;  5C4J J;  2CUE A;  2X9D A;  3S14 J;  4X6A J;  2Y31 A;  3GTQ J;  3S1N J;  4W97 A;  3LOC A;  3D1N I;  2DA3 A;  1IDY A;  4A3F J;  5C4X J;  2HQ5 A;  2JA7 J;  1GT0 C;  1I50 J;  2GM4 A;  2M0C A;  1WGX A;  4A69 C;  3ZQC A;  1MH4 A;  2CUF A;  5IP9 J;  1MNM C;  3ZQG A;  2CQQ A;  2LY9 A;  2HYJ A;  2LTP A;  3QPS A;  4XRS G;  1APL C;  3GTO J;  1HLV A;  1Z77 A;  3PO2 J;  1AU7 A;  4A3D J;  2MSY A;  2MGQ A;  3Q0U A;  3GTJ J;  2E1O A;  1YRN A;  1ETV A;  5E3O A;  2JA5 J;  1MBJ A;  2COB A;  2ECC A;  1P7J A;  1ETW A;  5F27 A;  1HF0 A;  2DTZ A;  2Y0S N;  5C44 J;  2R93 J;  1T56 A;  3JRH A;  1JJ6 C;  1AKH B;  1ZGW A;  2R5Z B;  1T33 A;  1I3Q J;  1UHS A;  1A6I A;  5EDN A;  5FLV A;  4QIW N;  5E3M A;  5EGO B;  2HOA A;  1GDT A;  3BTJ A;  4FE7 A;  3FK7 A;  5M5Y J;  2G0E A;  1HCR A;  3HOX J;  2GLO A;  3E7L A;  1POG A;  3SFI A;  1A5J A;  2ID3 A;  1QVU A;  1ETO A;  4DZJ A;  5FJ8 J;  3CQZ J;  3LSG A;  4XIC A;  1PUF B;  3BR5 A;  1ZK8 A;  2E2H J;  2YU9 J;  1X58 A;  1BW6 A;  4A3C J;  2LVS A;  2N8G A;  4D5F A;  1TWF J;  1VF9 A;  3B6C A;  1JKR C;  4AC0 A;  4UUT A;  3K2A A;  5EEA A;  4IHX A;  2XPW A;  4J19 A;  2HXO A;  3RQI A;  2H8R A;  2QCO A;  3TED A;  2R5Y B;  5FKO A;  4IHW A;  2JA6 J;  4D7N A;  2ZB9 A;  2XPV A;  5EZG A;  3JRB A;  3ZQL A;  1F36 A;  1K61 A;  4M6V A;  4I76 A;  4JYK A;  2P81 A;  4UUS A;  3PM1 A;  4IHV A;  2HDD A;  2E2I J;  2O8K A;  4DYC A;  4W1U A;  4DW6 A;  2VUM J;  1Z0X A;  4MLO A;  2L9R A;  3K7A J;  1MH3 A;  2EH3 A;  4M3F A;  4HNV A;  4B4C A;  3HGY A;  5J1Y A;  1E3O C;  2E19 A;  5J1R A;  3OIO A;  1ITY A;  3A01 A;  3BG3 A;  4A3G J;  3L1P A;  2PMZ N;  3MN2 A;  2XGD A;  3S1M J;  9ANT A;  2JN6 A;  3IH2 A;  1ENH A;  1IC8 A;  3FIW A;  2LP0 A;  4G12 A;  3HM5 A;  3JRI A;  4A3J J;  2R5Y A;  3DCF A;  4C2M J;  4BKX A;  2WB1 N;  1RET A;  3BR2 A;  3F0C A;  3MKL A;  5FLM J;  1ZR2 A;  1YRN B;  3LSR A;  2KDZ A;  3JRA A;  2O7O A;  2NOG A;  3PO3 J;  1WH5 A;  3A02 A;  1TC3 C;  1VFC A;  2L7Z A;  2DMT A;  3S1Q J;  3O8H A;  2NVQ J;  3LSP A;  3W6V A;  3IH4 A;  1B8I A;  5M5W J;  2Y9Z A;  1GUU A;  4D5C A;  1HOM A;  1OCP A;  3O8G A;  5IP6 A;  2EBI A;  4M3B A;  1RPW A;  2DA6 A;  1UG2 A;  1LE8 A;  3BR3 A;  4JX5 A;  3CMY A;  2K9N A;  2AO9 A;  3TP0 A;  1XS9 A;  1RKW A;  4RBO A;  1S7E A;  1XC5 A;  2YS9 A;  2Y2Z A;  5EYR A;  1LFB A;  2VKE A;  2JWT A;  3HOU J;  5F0H A;  3M4O J;  3BTC A;  1IUF A;  1WH7 A;  2L7F P;  3JRG A;  5IPA A;  4A3K J;  1TWC J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...