5KK1A

Structure of pnob8 aspa-dna complex.
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
88
structure length
88
Chain Sequence
STDKYIFLTPRAYIIVHLLKVGKAKASEISENTQIPYQTVIQNIRWLLAEGYVVKEQKGEEIYYKLTDKGKQLATAELEKIRKLVEVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords AspA
publication title to be published
rcsb
source organism Sulfolobus sp. nob8h2
total genus 26
structure length 88
sequence length 88
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2016-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13463 HTH_27 Winged helix DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5kk1A00
3CO6C 3K1NA 2IRFG 5CVJA 4IRIA 3WTXC 3HSEA 4M9ZA 1I6XA 2VONA 2QQ9A 3HYIA 5H6QA 3EUHA 5HDGA 3QP6A 2K7LA 4MEXF 4EJVA 2R7DA 2Z9OA 2ZFWA 4M6YA 2AS5F 1XSVA 2F5CA 2HOEA 3HRUA 2MD5A 5D5XB 1HW2A 1ON1A 5HS8A 3DP7A 3IWFA 2V1UA 4O5VA 3BY6A 1JE8A 4MQVA 2DFIA 4EGZA 2ZMEA 5CVRA 5FD6A 2C6YA 2L3DA 4Q4ZF 2XAJA 2FE3A 2A5YB 2JTVA 3V8KA 2DQLA 5LHHA 2L4AA 4A5NA 1HW5A 3WODF 4CYDA 2A6EF 4EGYA 4PGHA 2DI3A 1XGSA 1R58A 3MAJA 5FO5A 2VBWA 4Y13A 4RGXA 2DO7A 4HX7A 1QO0D 2KIFA 5ICFA 1HQCA 1B59A 2RNJA 2CFXA 4G7OF 1QGPA 3TO9A 2XKPA 3IWZA 4EM1A 3T0YA 4OIPF 1UB9A 3E3VA 4ENNA 4RGUA 2GQQA 2E7XA 1O7FA 1KQ9A 5D5VB 3GX4X 2VXZA 5LEKA 3F8MA 1FX7A 2QUFA 2VE9A 4G8XA 1U8RA 3LAPA 2VOOA 5LHIA 3TOAA 2WV0A 3RPQA 3IC7A 2J5OA 4A0YA 4PCQA 4A5MA 3I0TA 1IN5A 4CDGA 4WCGA 4OU0A 1U5TB 4ASNA 2P5LC 1I1SA 1T2KA 1O57A 3AAFA 3L09A 3GFLA 1EV7A 2P7VB 2OAZA 2E1NA 5D8LB 3R60A 4NQWA 5CVIA 2IPQX 4Q47A 4HLXA 3V8LA 4OMYA 4UVBA 2FNAA 1BC7C 4XBFA 5TJJA 2EFQA 2K86A 1LEBA 1QPMA 4HA8A 1SD7A 2LF8A 3L2CA 4L5IA 3I71A 4BHBA 1R1UA 2DBBA 4BYYA 3KZYA 2Z33A 3RKYA 5D4SA 2M5WA 4GCVA 2ZXJA 1Z7UA 5DCFA 2QBYA 5L3GA 2O61A 1T39A 3E5XA 5ICGA 1STZA 2Y75A 3RYPA 4NB5A 3BP8A 2D45A 3RYRA 3EYIA 2XAHA 5JHUA 2FNPA 4RAZA 2HEOA 4Y15A 3RKWA 1ZYRF 4MEYF 2JZYA 3CDHA 5H20A 3VODA 3ULQB 3QRFF 1K78A 2O03A 5L3DA 4F7ZA 2K02A 1J75A 1KU7A 2K4BA 3SHFA 3BJ6A 3WU1B 1G4DA 3CTAA 3J7AO 2PBIA 2XRNA 3RTRA 1F4KA 5D5WB 1IUYA 5DCMA 5AONA 3E6MA 1Z6RA 1ONVA 3R6SA 5LGUA 4PZJA 3BPXA 3JTGA 3F8FA 4RAYA 1BI1A 3E5QA 2AXLA 5J8CA 4MGRA 4ZH4F 1S7OA 2LDUA 2P6SA 1YTYA 3CUQB 2ZBKA 3K69A 3ELKA 4I09A 4WK8F 4UVCA 5BMZA 3KE2A 1GVJA 5DD8A 1IAWA 1XN7A 2L02A 5J8FA 1P4WA 3GFMA 3ZMSA 1XSXA 2DT5A 4JK1X 5HS9A 2TDXA 2RGVA 1L3LA 5BQTA 1YS7A 4LB5A 4UHTA 1O7LA 3DV8A 4HX8A 4CICA 4XLNF 1O3QA 1JHFA 6PAXA 3IRQA 3EETA 3QU3A 4UXNA 3I53A 3GXOA 2OQGA 2STTA 1JGSA 5IT9Z 4KFCA 3HRTA 1VTNC 1TQIA 2FMYA 2PMHA 1P6RA 3ROUA 5E20A 4UNOA 2IP2A 1YFHA 3ABUA 4LLGF 2HYFA 5LGTA 1R5HA 1LDJA 3E6DA 1BOAA 2E7WA 5BOXA 2L4MA 2COMA 1TLHB 4EM0B 3WG9A 3DQVC 4IHSA 3R0AA 2G7UA 5E8IA 3WTZA 2GA1A 2YR2A 3LSTA 4P9UA 4QLCU 3WTTC 1WI9A 5HLIA 4YFKF 4PGGA 4AIHA 1IW7F 3C3WA 1KGSA 4N0BA 2VT2A 3RI4A 5IT9K 1U5TC 2ZNYA 1Z05A 2DPUA 3J80Z 1FYLA 1XDSA 4CZZA 2EJRA 4YIIA 2O6GE 1J5YA 1S29A 4RGRA 2FOKA 1BN5A 4AIJA 2KIUA 1Q1HA 3BZ6A 5HLGA 1FBUA 2BBYA 3GUDA 1U5TA 4ETSA 2HS5A 2OD5A 3FX3A 4IXAA 2H6BA 4HYEA 4XLPF 3GW2A 2CQKA 2DU9A 2NNNA 1T6SA 5JI6A 4BNCA 4EM2A 3V7CA 3J80K 1SFEA 2ESNA 3G3ZA 3GO5A 1IN6A 3DPLC 5K5RA 2EFWA 2MC3A 2FQ3A 3QOPA 1L0OC 4ZZDA 2L54A 4G6DA 1S3JA 4M74A 5CLSA 3G73A 3N4MA 3U9GA 1DUXC 1XCBA 4UUVA 5DUKA 3RKXA 1WSUA 4KNYA 3BROA 1IXCA 2OZ6A 5FFZA 4U88A 1IN4A 4LG0A 2KRFA 1HKTA 3U1DA 3GEZA 3U2RA 1XCVA 2ZO4A 1ZREA 4ENJA 4DNCA 4M6XA 4HW0A 4ENKA 1QQIA 2O0YA 3KCCA 2RKHA 2F2EA 4YFNF 2DK5A 2F5DA 1YW8A 3HSRA 3ZPLA 3FZVA 1R22A 2RVCA 2D2WA 2GIVA 3P9IA 1F5TA 1KU3A 2FBIA 2ZNZA 1B4AA 5HDNA 1LNWA 2GWRA 5D8KB 3ECOA 3M7GA 4AVPA 2VOPA 1NHAA 3ABTA 3TGNA 4GXOA 1E17A 5K5QA 3ISPA 3SQNA 3L9FA 1Z6TA 1RUNA 1SFUA 4LK1F 3ERED 4HV6A 1V4RA 2KKOA 5D6FA 3MZHA 1QBJA 5FB2A 5HVQC 1ZRDA 1KU9A 3E6BA 1BJAA 4LB6B 2W85A 1FPQA 3CUQA 3WTSC 2QVOA 1OKRA 2DQRA 1FSEA 5F1RA 1LDKB 5EEGA 3JSOA 2G9WA 2F5FA 4S04A 3GZ6A 1YG2A 4HBLA 3KEQA 2RN7A 3C7JA 4WF2A 2ZKZA 1IRGA 4KIFA 1YO5C 3PQKA 2Q8KA 3HRSA 1XB4A 4KN4X 5FLXZ 1R1TA 3FHZA 2P7CB 4L0ZB 3N97A 5JVTA 4CO8A 1TBXA 1FYMA 1HSJA 3ZN1A 2IVMA 4KIBA 3JTHA 1W4MA 2ZCWA 3HSFA 2YX7A 2UXNA 3F8CA 3IRRA 2BV6A 4P96A 2MLGA 5DEQA 4HDVA 2W57A 2EB7A 2XIGA 3HHGA 5J6XA 1IN8A 3ZMVA 4B8XA 3JW4A 3O3KA 2UZKA 4A0ZA 1BM9A 3HOSA 3C18A 1EH6A 3KZZA 4CXFA 1G3SA 5LHGA 5HLHA 3O2PE 5L3BA 1REPC 1FC3A 5FLXK 2OU2A 1P2FA 2EV6A 4BXUA 4R8HA 3TQNA 4EQQA 1A04A 3TOBA 4HLYA 4HOBA 1UHMA 3FXUA 5DD4A 4FX4A 2UXXA 1TTYA 2EA2A 3WGHA 5H6RA 1LEAA 1FY7A 4EJWA 5DDGA 5FGMA 2R7FA 2A68F 2XUBA 4DQ2A 2YX4A 3FM3A 1ZGAA 3T5XA 4UV8A 4RS8A 4PDKA 5D6EA 3HTSB 4HZFA 1ZLKA 1FYKA 1V3FA 2VN2A 4ENMA 1MDMB 3WTWC 3CJNA 4I98B 3EYYA 1HKSA 3HIFA 2EWNA 4JQFA 2HWVA 1Z9CA 4Q5SF 1W7PB 2HKXA 2O3FA 1J2XA 2K4JA 2JRTA 1IRFA 5LGNA 1ON2A 1IN7A 4XSZF 3KP6A 5L3EA 3K9TA 3I64A 3HTUA 3DF8A 2PLYA 2CYYA 4L5JA 4HF2A 3MFKA 1B9MA 4ZZLA 3RIRA 2ETHA 1TNSA 4ZYEA 3I5UA 3HRMA 1R36A 1Z91A 3F6OA 3D5LA 4RB2C 3GZ5A 4IHTA 1PDNC 2ADUA 3B73A 4OIOF 4HX4A 3F22A 2XVCA 2VC1A 4EMSA 1KYWA 2JSCA 3IL2A 4EJOA 2OBPA 1H9GA 2FBHA 5HS7A 3QPTA 3M9AA 4LMYA 4D0PA 2W25A 3KLNA 3T1BA 5E1ZB 1G6NA 3BJAA 2UWMA 3P7NA 2OA4A 1CF7B 1KQ8A 4HF1A 4GYGA 1ZARA 1FNNA 2DTRA 2ISZA 1XGMA 1S6LA 3TDZC 4BAYA 2ACJA 1T0FA 1BC8C 3ZP5A 3M8EA 3NEUA 5TRDA 1D8KA 2NNYA 1KQ0A 1DPUA 3REOA 1FT9A 5E18F 1O3RA 3RJPA 1XGOA 3E5UA 1QZZA 2DAOA 2VC0A 5EEHA 5K5OA 2PJPA 3KP7A 3GLXA 2CSOA 2LKPA 2XV4S 1MJBA 5CVVA 4KN7X 5LRRA 3MQ0A 1BIAA 2VE8A 1I5ZA 3GWZA 1YQAA 5ERIA 2ZMEB 2MH9A 4Z2YA 4L18B 1D5VA 4CGZA 5ILVA 3HHHA 1CGPA 1FBQA 2FF4A 1W5SA 1B6AA 4OIRF 1D3YA 3K2ZA 3Q9SA 3IKTA 2V79A 4BH9A 2VT3A 4U0YA 2XAQA 4ZYGA 3COAC 2XGXA 1ULYA 3DPTA 2PG4A 4G7HF 1XGNA 4IF4A 4KMFA 2GXGA 4Y17A 3GVAA 1ZH5A 2X4HA 5CYVA 3QAHA 3JAMZ 5LEJA 4I02A 4IRGA 2GXBA 3V7SA 3QPHA 3GF2A 4I2OA 3P9KA 1DPRA 1HBXG 2OZUA 3FMRA 1W5TA 2P5VA 4KIGA 3VOEA 4KDPA 3LQRA 2RDPA 1SD4A 4EVIA 2H6CA 2CG4A 3TO6A 2YU3A 1Z1DA 4IVNA 2EFOA 3DEUA 3WTYC 3F8BA 5DUIA 3ECHA 1USSA 3EDPA 5HDKA 2XAFA 3NRVA 3FMSA 3JAMK 2XHKA 4M72A 2EK5A 4N9IA 5FFXA 4WWCA 4EJTA 1O3SA 1PP8F 2ZJ2A 4S05A 5KK1A 3NQOA 3F3XA 3KP5A 1LJ9A 1T98A 1J7KA 2G7HA 4LFUA 2FRHA 1SD6A 2X0LA 4FHTA 3B02A 5AIQA 4KYWA 2VBXA 2Y48A 1F1ZA 1R7JA 4L0YB 4OINF 3V7RA 2DPDA 3SZPA 2PEXA 3R0JA 1RZ4A 3KP4A 4LLNA 4LJZF 1DDNA 2V6CA 2M30A 1GXQA 1QZYA 4GGGA 5K1YA 2D1HA 2K27A 2QENA 4ESBA 2EV5A 4L9VA 2VBZA 3E6CC 1OPCA 5L3CA 2A61A 3F23A 2WTEA 4HAMA 2FMLA 4IRHA 2DK8A 4I7HA 4ON0A 4RB1A 1I1GA 2RV8A 5LBQA 2PQ8A 3BPVA 3GFIA 3Q9VA 1UCRA 5DCMB 1LQ1A 2PFBA 3WTVC 3WU0A 3CUQC 5JR3A 1SD5A 4HDUA 2O8XA 1XMAA 1W7PD 1YIOA 2HQNA 2M8EA 2Z3YA 2OQRA 2HGCA 4ESFA 2Q0OA 4O3MA 4NHJA 5IT3A 3WE2A 2MA3A 1CF7A 3VB2A 4U0WA 1RI7A 2CGPA 1TQPA 2KIMA 2MLKA 4BHPA 3BDDA 3ZMTA 5ICCA 1P4XA 3LFKA 1MKMA 4FT8A 2KJBA 2KJCA 3E97A 3BOQA 4MTEA 4CHUA 3F8NA 1B1BA 3H3ZA 3I59B 3DFGA 3FF5A 2R3SA 4YIFA 3W6KB 2GZWA 2GA2A 1ZRCA 1FP2A 2QQBA 2HKOA 4M73A 2CO5A 3W6JB 1G3YA 3C1DA 3QU6A 4WXCA 3ZMDA 3Q5FA 2Z5UA 3T8TA 2L01A 3SXYA 2HYGD 1XMKA 1FZPB 3TKYA 1ZHFA 2FXAA 4P55A 1C0WA 4MTDA 3F21A 2M87A 3WGGA 4G94A 1XDUA 4HV5A 3MWMA 1MJAA 1YLFA 2WWYA 4UV9A 3ML6A 3J81Z 4LD5A 2HQRA 4GYIA 1JHHA 4MNUA 3KLOA 1FWZA 4WXDA 2GAUA 3FXRA 2HTSA 2PI0A 2EA4A 2XROA 4KT5C 1EH7A 4YG2F 3WGIA 2P6TA 1MZBA 5L3FA 4A6DA 4HQEA 1AOYA 1BI0A 1TNTA 2QLZA 3TDUC 4BQAA 3ZQ7A 1S8NA 2PMUA 4KUMA 3J81K 3M8FA 3DXJF 4EJUA 1T38A 4K2EA 2F5EA 3CO7C 3IKVA 1ZG5A 2A07F 1S7AA 3ZMUA 2P4WA 1H9TA 1RUOA 4LLLA 4WX9A 4M9XA 3KETA 1SMYF 4R79A 2EFNA 4MQ9F 1ZAOA 2VBYA 3VFZA 1USTA 1PUEE 2FSWA 4N9HA 4OOIA 1IXSB 2W24A 3QP5A 2HR3A 2BYVE 2V9VA 2BGCA 2DW4A 3KP3A 4BHCA 2HTJA 2XAGA 5DV5A 1FOKA 2P5KA 3I54A 2QQAA 4OMZA 3I4PA 1HXDA 4U7DA 3BWGA 1MJ9A 3MEXA 4ZYHA 4A6EA 3SZTA 4KMUX 3K1MA 1XD7A 5BPDA 4LG0B 1OYWA 5AIPA 2DLLA 3OOPA 4EV0A 3MZYA 4H0EA 3M1EA 5CJ9A 2ESHA 3CUOA 3FWEA 5D4RA 4AIKA 2V1XA 1EH8A 4KA4A 3LA3A 1G3TA 4M71A 5E17F 2IA1A 5E1XA 1R1VA 4L9JA 2QM3A 5LRSA 2MH2A 1HKQA 1ZRFA 2EFPA 2H94A 1BI3A 3H92A 2JT1A 2QZ8A 3OV8A 1WWXA 4XRFA 1BI2A 4I0BA 3WTUC 3ZN0A 2LF7A 1FLIA 1AWCA 3R4KA 4ESJA 5KVRA 2HDCA 2IT0A 2P8TA 3K1PA 1JXSA 5ILSA 1SAXA 3LA2A 1ZGJA 4GO1A 1R23A 5ILUA 2XKOA 3FM5A 2H27A 4HF0A 4LGWA 4HQMA 1K7AA 4AWXB 4U7BA 2M1BA 2ISYA 5D5UB 2A6HF 2FA5A 3WE3A 1B9NA 4G7ZF 5BS6A 5JFRA 2NS0A 3P9CA 1LDDA 4G6QA 1OYYA 2MBFA 5E8GA 1K79A 4R1HA 3I59A 4IJAA 2ELHA 1UFMA 3L00A 1FBSA 1OR7A 3T8RA 2FEZA 1YYVA 1HSTA 3GYHX 2H09A 2CWEA 2YSRA 2IJLA 1TQMA 4UVAA 1J0RA 4OIQF 4AD9A 1GHCA 2JPCA 1GXPA 2BEOA 1BBYA 2Y0MA 1FSHA 3LQQA 4A2UA 1J59A 5CVUA 2A3SA 4MHGA 1TW3A 4RB0A 1KYZA 3GFJA 3S2WA 4E70A 3VEPA 3R61A 2D1VA 2BE5F 1RNLA 4G9YA 1P92A 5DYMA 4A12A 5A2QZ 5BPIA 2JPBA 1MD0A 2STWA 1BIBA 2NYXA 4I01A 1YW7A 1WQ2A 2CW0F 4L9NA 3BJOA 1O3TA 2FBKA 3HUGA 1X3UA 5HOOA 1FP1D 4Q48A 2VODA 3CLOA 1U78A 2Z99A 4ZYDA 3O6BB 2J5PA 4RB3C 5E1WA 2W84A 2IA2A 4XSXF 3D0SA 3MCZA 2IW5A 1Y0UA 1HW1A 5LLQA 1J9IA 1U6GA 4U0VA 1ZG1A 1R5GA 1MDMA 2V1DA 2HFHA 3KEOA 2QWWA 1UHWA 3V8JA 2PN6A 1H0MA 5A2QK 1OMIA 5ED4A 2EV0A 2IA0A 2NRAC 2QBYB 1YW9A 2NAZA 3IHUA 2A69F 2LSOA 2QYOA 3K0LA 1W7PA 1ZG3A 3RPUA 2LNBA 3EQLF 3L7WA 4M9SA 3V4GA 4P9FA 4I0AA 1D8JA 1ODDA 3DKWA 4L9TA 3ZMZA 2B0LA 5FD5A 4A0XA 1F9NA 3I58A 5F6FA 1LVAA 1SFXA 5F64A 1YS6A 1K78B 3TO7A 3RDIA 4JBAA 4TV7A 3LAJA 4LK0F 4YFXF 1SMTA 1QNTA 1DP7P 3F6VA 2RC4A 4B09A 1PP7U 1IZ1A 1K6OA 2YPRA 1I27A 3PFIA 4WXHA 1RIOH 1IXRC 1E2XA 1R00A 1KU2A 1ZN2A 4QWQA 5ICEA 2FU4A 3F72A 3KFWX 2Q2EA 4KICA 1OYIA 1P4AA 1MGTA 3H3UA 3FXQA 2M45A 3FMQA 3LA7A 4P5OA 1U2WA 1IF1A 2RQPA 1TW2A 1G3WA 2XASA 1WKMA 1ZLJA 3LWFA 2HZTA 3KP2A 2WC2A 3SFZA 1WRJA 3PQJA 4O6JA 4RGSA 2E1CA 4FX0A 1LB2A 3HOTA 1U3EM 4IPAA 1XSDA 1KA8A 3JSPA
chains in the Genus database with same CATH superfamily
3FBIB 3H9QA 3K1NA 4M3DA 4PJJA 3CO6C 2IRFG 5EG0B 1D1AA 5CVJA 4IRIA 3WTXC 3HSEA 2DA4A 4M9ZA 2VJJA 1I6XA 2VONA 2QQ9A 3HYIA 3DU5A 2DDBA 2LC2A 5H6QA 3KYCB 4XLHA 3EUHA 2JVHA 2HOAA 3IH4A 3QP6A 5HDGA 3S3NA 2K7LA 4MEXF 2EIKH 3GBGA 4EJVA 3H1CA 4BXFA 2R7DA 2Z9OA 2OCEA 4IQ4A 1YOVB 2ZFWA 4M6YA 2AS5F 2L7FP 1XSVA 2F5CA 2HOEA 1WZ2A 1S9HA 3ZCOA 1A31A 3HRUA 2MD5A 1UHSA 5D5XB 1HW2A 1ON1A 5HS8A 3DP7A 4QPQA 3IWFA 1G8XA 2V1UA 2W48A 3TW6A 4O5VA 3BY6A 1TL8A 1JE8A 2DMNA 3LSJA 4MQVA 3CESA 4AUXA 2DFIA 4EGZA 2ZMEA 3ABMH 1JTYA 5CVRA 5FD6A 2C6YA 2L3DA 1UAAA 2OTJI 4Q4ZF 2XAJA 3CCEI 2B63J 2FE3A 2JRMA 2A5YB 2JTVA 3V8KA 1BR1A 4ZYAA 3I4NJ 2M9HA 2DQLA 2NOJB 1ZGWA 2YUSA 3D1NI 5DM7F 2FX0A 5LHHA 2L4AA 4A5NA 3S1MJ 1HW5A 3WODF 4CYDA 2A6EF 4EGYA 4PGHA 3CC7I 2DI3A 1XGSA 1R58A 4QTRA 2R0QC 5HLTA 4NBQA 3MAJA 5FO5A 4ZTJA 2M4KA 2VBWA 4Y13A 4RGXA 5H2FC 2DO7A 4HX7A 1QO0D 2KIFA 5ICFA 1HQCA 1AKHA 1B59A 2RNJA 2CFXA 4G7OF 1QGPA 3TO9A 3WHCA 1VQ4I 3BTJA 2XKPA 1X4PA 3IWZA 4EM1A 1UZCA 3T0YA 1X3WB 4OIPF 1OISA 1UB9A 5IP6A 5JLWA 3E3VA 3MZ8A 3CMEI 4ENNA 3QODA 4RGUA 1MBFA 1OCCH 2GQQA 2KLOA 2E7XA 3M8JA 4FISA 3IAS2 1O7FA 3CCVI 1KQ9A 5D5VB 2L2OA 3GX4X 4DYRA 4UUSA 2V6EA 1Y1VJ 5FKMA 2VXZA 3NARA 3F8MA 5LEKA 1QU3A 5EZHA 1FX7A 3GTKJ 1OLTA 3S3OA 2QUFA 1SFOJ 4XLEA 3K4JA 3F0CA 4PUSA 2VE9A 4G8XA 2N8GA 1U8RA 1SVMA 3ERMA 3LAPA 1ZR4A 1GT0C 2VOOA 5LHIA 3TOAA 2WV0A 2EIJH 3RPQA 3IC7A 2Y2ZA 2J5OA 4A0YA 2LOOA 2ELJA 4PCQA 2KDOA 4A5MA 3I0TA 2XSDC 2R7RA 1IN5A 4CDGA 3ZQIA 4OU0A 4C9YA 4WCGA 3MKYB 3S2DJ 1U5TB 3ZR8X 4ASNA 3JRHA 2P5LC 1LPQA 4JX6A 1I1SA 1T2KA 1Y8RB 2BY0A 1O57A 1R71A 1J09A 3CCJI 3FKIJ 3AAFA 5FKNA 3L09A 1TWFJ 1QHGA 3GFLA 1EV7A 2P7VB 3CCLI 3O8HA 2BHYA 2OAZA 2E1NA 3BLYA 4HPQA 5D8LB 1X58A 3CC2I 3I4MJ 3R60A 4NQWA 3SYTA 5FLMJ 3K70C 5CVIA 2IPQX 4Q47A 4CZCA 4HLXA 3V8LA 4OMYA 4UVBA 2FNAA 1BC7C 2E5NA 2DA1A 4XBFA 5TJJA 2EFQA 2K86A 2VASA 5FRNA 1QPMA 1LEBA 4HA8A 1SD7A 2LF8A 1QVTA 4XKWA 3L2CA 1UG2A 4L5IA 2L5QA 3I71A 3LMMA 4IOAF 1YJWI 4BHBA 4CCOA 4FTHA 4FETA 1R1UA 2DBBA 1G2HA 4BYYA 2EZIA 3KZYA 2Z33A 3A0HC 2I8DA 3RKYA 3S2HJ 5D4SA 3H35A 2M5WA 2QSGX 4GCVA 5J4YA 4C3HJ 2ZXJA 2M34A 4PFPA 1Z7UA 2R92J 5DCFA 4I6ZA 2QBYA 5L3GA 1TZLA 2O61A 5IY5H 2WY8Q 3E5XA 1T39A 5ICGA 1STZA 4HNVA 1RRJA 2Y75A 1QVUA 3RYPA 4NB5A 1JUMA 2AXTC 1A36A 2CV2A 3BP8A 2LKXA 2D45A 2NVXJ 3RYRA 3EYIA 2XAHA 2CW7A 4PJNA 5JHUA 4ZTFA 4FCYA 4AYBA 3HOUJ 2FNPA 3B6AA 4RAZA 2QF7A 2HEOA 4Y15A 2FOWA 2P81A 5K7ZA 2E2HJ 3RKWA 3G2BA 4BGDA 1ZYRF 4MEYF 2JZYA 3CDHA 5H20A 2KIQA 3VODA 1ZTRA 2VI6A 3ULQB 3QRFF 2WAQN 1K78A 2O03A 5L3DA 2E5ZA 3G1LA 4F7ZA 2K02A 2JA7J 3GTQJ 1J75A 1N25A 1KU7A 2K4BA 3SHFA 2V1NA 2XPVA 3BJ6A 4QSHA 3WU1B 1ETVA 3CTAA 1G4DA 3J7AO 2PBIA 5JLXA 2DYRH 2XRNA 3PNVA 3RTRA 1F4KA 5D5WB 2VPRA 4A3LJ 1WJCA 3HOVJ 1IUYA 1OCZH 5DCMA 3FXLA 5AONA 1NK3P 2PMZN 3E6MA 1Z6RA 2K40A 3ZXSA 1V5EA 1ONVA 3SEQA 3R6SA 3JRCA 2V9KA 5LGUA 4PZJA 4Y7NJ 2CJJA 3BT9A 5CQEA 3BPXA 1GUUA 2NS7A 3JTGA 3F8FA 1ITYA 2LD5A 4RAYA 1BI1A 3E5QA 1A35A 2AXLA 3C2BA 5J8CA 3K70D 4MGRA 2CV1A 4ZH4F 1S7OA 4A3GJ 1A6QA 1RETA 2ZXWH 4G6TB 2LDUA 2P6SA 4X1EA 1YTYA 3CUQB 4DYCA 2ZBKA 3K69A 3SDGA 3DTKA 4BE2A 3ELKA 1RR8C 4I09A 4WK8F 1VQOI 4UVCA 5BMZA 3KE2A 3OR2C 1GVJA 5DD8A 1IAWA 2X48A 4JYKA 1XN7A 2VIXA 2L02A 3D5RC 3HB9A 1T56A 4XLFA 5J8FA 1P4WA 2QKMB 3CMAI 3DEEA 3TEDA 2WADA 3GFMA 3ZMSA 1XSXA 3H3VK 2DT5A 4JK1X 3DKYA 5HS9A 2TDXA 1I3AA 4J01A 2RGVA 4XL9A 1PVEA 1V54H 1L3LA 1YX5A 2ZB9A 2ZSHB 1FIAA 4B4CA 4EATA 5BQTA 1YS7A 3VYTB 3ZQGA 4RMNA 5FKOA 4LB5A 4UHTA 1W5CC 2CMPA 3QYBA 1O7LA 4E7SA 2IGOA 1K61A 3DV8A 4HX8A 2HU9A 4CICA 3S1QJ 4XLNF 1O3QA 1JHFA 2DA7A 2XPWA 3PIPF 3IRQA 5M5WJ 6PAXA 3BG7A 3EETA 4E7HA 3QU3A 4UXNA 4KISA 3OYHA 3I53A 3GXOA 2IBDA 5IOYA 1OQYA 2OQGA 2LRDA 4DBQA 2STTA 2A5WA 2DOAA 3H0DA 1JGSA 5IT9Z 2XGCA 4KFCA 4A93J 2KRCA 3HRTA 1TQIA 4UUTA 1VTNC 3AL0B 1WJBA 2FMYA 2PMHA 1FOXA 1P6RA 3ROUA 2LTPA 5E20A 4UNOA 2IP2A 4C2MJ 3OL4A 1YFHA 3A02A 3ABUA 3DTIA 3RQIA 3CCSI 3QYFA 5FKLA 4LLGF 2HYFA 1D0XA 1R5HA 1TWCJ 1LDJA 5LGTA 2KFDA 1XC5A 3VWBA 4KJZA 5M5XJ 2AQFA 3E6DA 1BOAA 3DKXA 2E7WA 2R7QA 4F3QA 5BOXA 2L4MA 2E1MB 1NG7A 4E7IA 2COMA 1TLHB 4EM0B 3WG9A 5B66C 3DQVC 4IHSA 4L5EA 1BL0A 3R0AA 1E0EA 2G7UA 2BVLA 2R7ZJ 5E8IA 3WTZA 2GA1A 2YR2A 1WFXA 3LSTA 2MYSA 4P9UA 1HOMA 2H8RA 2Y9YA 4QLCU 3GTGJ 3WTTC 5GTIC 3H9GA 1WI9A 3I9V2 3QQAA 3PO2J 4E7KA 1WI3A 5HLIA 4YFKF 3BR3A 1CQTA 2LY9A 4PGGA 4BACA 2R5YB 4AIHA 4GDFA 2X1EA 1IW7F 2VKEA 1RR7A 2D5VA 3C3WA 1KGSA 3I3LA 4N0BA 2JA8J 2BVMA 2VT2A 3RI4A 5IT9K 1FTTA 1U5TC 2ZNYA 1ENHA 3G1MA 1JJ6C 1Z05A 1JUPA 2DFFA 1X3ZB 1JT6A 3JCUC 2DPUA 5J1YA 3J80Z 1FYLA 1XDSA 2DMTA 3QWLA 4IHWA 4CZZA 2EJRA 4YIIA 2HXOA 1YJNI 2E2IJ 1R9TJ 2KISA 1R4MB 2O6GE 1J5YA 4W1UA 2JA6J 1TT0A 1XS9A 1S29A 4LG3A 4RGRA 2FOKA 5E3NA 4GRIA 1W36D 1BN5A 4AIJA 2KIUA 2CQXA 4XKBA 1FOWA 4E7JA 3FDYA 4PJ0C 2PMZA 2E1OA 4LITA 1Q1HA 3BZ6A 2ZC2A 4CUGA 5HLGA 1FBUA 4PSWA 2BBYA 1W1WE 2LBFB 3EUAA 5IPAA 3GUDA 1VFCA 1U5TA 4ETSA 2HS5A 2OD5A 3FX3A 4IXAA 3ZQCA 1BW5A 3IUOA 2H6BA 4HYEA 4XLPF 3GW2A 4CCKA 2CQKA 2DU9A 1R49A 2NNNA 1T6SA 5JI6A 4BNCA 4EM2A 3GTMJ 2Y31A 3V7CA 3J80K 2CS3A 5E3OA 5FLVA 4DW6A 1ETOA 5E3MA 1SFEA 2ESNA 3TMOA 3G3ZA 3GO5A 1IN6A 1U9NA 3DPLC 5K5RA 4JOMA 2EFWA 2MC3A 2W82A 2FQ3A 2AQEA 3QOPA 1IDZA 2JA5J 4A3CJ 1L0OC 5J3LA 3K4CA 1U9OA 4ZZDA 2FUG2 2L54A 4BE1A 4G6DA 2K3PA 1S3JA 4M74A 4D9JA 5CLSA 4BQOA 3G73A 3N4MA 2R7OA 3U9GA 1DUXC 1XCBA 4UUVA 5DUKA 5B1BH 2M3AA 3RKXA 1WSUA 2PJRB 1BOBA 4KNYA 3QOEA 4BJTA 3BROA 1IXCA 2K9QA 3BR6A 2OZ6A 2DTZA 5FFZA 3M1CA 1DU0A 4U88A 1YI2I 1IN4A 4LG0A 2KRFA 1HKTA 3U1DA 4W97A 3GEZA 3U2RA 2CU7A 1APLC 5DS9A 1XCVA 3ZOBA 3HG9A 3VYSB 2ZO4A 2ID3A 1BA5A 3M07A 1ZREA 4ENJA 1GDTA 4DNCA 4M6XA 4HW0A 4ENKA 2XF7A 1QQIA 3LSPA 2F6CA 2O0YA 3KCCA 2WB1N 2RKHA 3ASNH 2F2EA 4CYCB 2XPUA 4B48A 4RM3A 4YFNF 2XGEA 1JKRC 2DK5A 2F5DA 1YW8A 1EKEA 3HSRA 3TP3A 1PUFA 3BZCA 3ZPLA 3FZVA 1R22A 2RVCA 5J47A 2LG4A 2D2WA 2GIVA 2E2JJ 3P9IA 1F5TA 2M2EA 1KU3A 2HOSA 2FBIA 3EUHC 2ZNZA 4Y33A 1B4AA 1NTCA 5HDNA 1LNWA 2GWRA 5D8KB 3ZQHA 3CCYA 3ECOA 1IRZA 3M7GA 4AVPA 3JR9A 2DA5A 4LIUA 2VOPA 1AU7A 1Y56A 1NHAA 1R5ID 2BW3A 3BR2A 3NAUA 3ABTA 3S17J 3TGNA 4GXOA 1E17A 5K5QA 2R5ZB 3ISPA 2RREA 3SQNA 1T95A 3L9FA 5C3EJ 4C3JJ 1Z6TA 1RUNA 1SFUA 4LK1F 3ERED 3OYJA 4HV6A 2JJ7A 1V4RA 2KKOA 2Z1DA 5D6FA 3BG5A 3MZHA 4II2A 2RNGA 4RBOA 1QBJA 3P5JA 5FB2A 2UUZA 5HVQC 2DMUA 3JREA 3FIWA 4RLQA 2OPTA 1ZRDA 2DJNA 2QCOA 1KU9A 3E6BA 1BJAA 1N75A 1NG6A 4RAGA 3KX2A 1N78A 4FE7A 4LB6B 2W85A 1B72B 4DIQA 3W2VA 1FPQA 3CUQA 3WTSC 3OYFA 2QVOA 1OKRA 2DQRA 2EIMH 1FSEA 5F1RA 1LDKB 1Y39A 1WJFA 5EEGA 3JSOA 2G9WA 2F5FA 4S04A 3GZ6A 4BY1J 1T8IA 3E0JB 1YG2A 1LE8B 1T33A 4HBLA 3KEQA 2XSJC 2RN7A 5FROA 1KONA 3C7JA 4RLFA 1X2NA 4WF2A 2ZKZA 1IRGA 4KIFA 4NC8A 3OIPA 1YO5C 3O8GA 3PQKA 2WA0A 1LFUP 2GOMA 2W4SA 1POGA 4ABZA 3ZRGA 4FE4A 2Q8KA 2WV1A 3AFHA 3HRSA 1XB4A 3A0BC 4KN4X 5FLXZ 1R1TA 3FHZA 2E1MC 2X6YA 1IV6A 2P7CB 4C2TA 3A1YA 4L0ZB 3N97A 2MABA 5JVTA 4CO8A 1TBXA 1FYMA 4DOZA 1HSJA 3ZN1A 4II3A 2EPFA 2IVMA 5JHFA 3OIOA 3S1RJ 4KIBA 3JRAA 4J00A 3JTHA 1W4MA 2ZCWA 2CUEA 3HSFA 1VQLI 2YX7A 1RKTA 2UXNA 3FK7A 1IV8A 4KT6A 3F8CA 3IRRA 2BV6A 4P96A 2MLGA 3A4CA 5DEQA 1K4TA 1FTZA 4HDVA 4XR6A 2W57A 2EB7A 3CD6I 2XIGA 3HHGA 3OIQA 2B9SA 2CH0A 1IN8A 2K9NA 5J6XA 1TP4A 3DPUA 3ZMVA 4B8XA 2JN6A 3JW4A 3O3KA 2IGNA 4CA0A 1WVRA 2UZKA 4PK4A 3BG9A 1VQ7I 4A0ZA 2G0EA 1BM9A 2FJ1A 4CCNA 3HOSA 3C18A 1WHUA 1HLVA 2E35A 1SFKA 2VLAA 3OYNA 1F36A 1EH6A 3KZZA 1Z3YA 4CXFA 2LVSA 5B5EC 1G3SA 2HVQA 3SDBA 2X1CA 5LHGA 5HLHA 3O2PE 5L3BA 4BXXJ 1REPC 2EQRA 1FC3A 5K7FA 5FLXK 1UJ8A 2CRGA 2OU2A 3LFUA 5IP7J 1P2FA 2EV6A 2W1OA 3S1NJ 3BCBA 4BXUA 4R8HA 3TQNA 2ME6A 4EQQA 1A04A 5IYBJ 3ASOH 3TOBA 2CW8A 1JKOC 4HLYA 4HOBA 3S16J 1UHMA 1LKXA 1EJ9A 2ZSIB 1V55H 1EF4A 3BG3A 3FXUA 3MD2A 5DD4A 4FX4A 2AO9A 3MMYB 2UXXA 2WB1A 1TTYA 3C2HA 1DGWY 2VJ5A 4IZZA 2EA2A 4XLCA 3WGHA 4CCLA 2QEXI 2ZJQF 5H6RA 1LEAA 1FY7A 4EJWA 4DBRA 4QIWN 1B8IA 4BS9A 5DDGA 5FGMA 2R7FA 2WAFA 2A68F 2XUBA 4DQ2A 2YX4A 4E6KG 5J40A 1K6YA 4D7NA 3FM3A 1ZGAA 3T5XA 4UV8A 1UMQA 3CJTB 2XDVA 4RS8A 4PDKA 3OYKA 2VQGA 4AU7A 3BR5A 5D6EA 3N05A 3HTSB 4HZFA 1ZLKA 1VQ9I 2R7VA 1FYKA 1V3FA 2L0KA 2TCTA 1VI0A 2VN2A 4ENMA 1MDMB 3WTWC 3CJNA 3HEFA 1M1EB 2H1KA 2BHZA 4I98B 3A2KA 3EYYA 1HKSA 3J7AY 3HIFA 3UNGC 2EWNA 4JQFA 2AHQA 3SFIA 2RQQA 4NUBA 2HWVA 1Z9CA 3HPGA 4Q5SF 2VKHA 1W7PB 2HKXA 2QSFX 2O3FA 1J2XA 1RESA 2K9LA 3TW7A 2K4JA 2JRTA 1IRFA 2OC6A 3K6GA 1ON2A 5LGNA 1IN7A 1DU6A 3DBLB 4XSZF 2IS6A 3G6EI 3KP6A 3L1PA 5L3EA 3K9TA 1E3HA 2DT7B 3I64A 3HTUA 3ZQFA 5BNGA 5F0HA 3DF8A 2JK3A 5J4VA 5C44J 3J7ZI 5JVGF 3IV5A 2PLYA 5EDNA 4B1RA 4HNUA 2CYYA 3CF2A 2X1DA 4L5JA 1IC8A 4HF2A 3MFKA 1B9MA 4M3FA 1YJ9I 4IHVA 3HBLA 4ZZLA 3RIRA 2ETHA 1BW6A 2CFOA 1TNSA 1HDPA 3G4SI 4ZYEA 2K85A 3I5UA 2MC4A 1JGGA 3HRMA 1Y6IA 4CCJA 2DMQA 3BG6A 1R36A 2K9MA 1Z91A 3F6OA 3D5LA 1V5GA 3Q0WA 4RB2C 4XRMA 3GZ5A 3IAM2 2L9SA 3OYAA 1JKQC 4IHTA 1PDNC 3FXKA 3LL7A 2ADUA 2PJRA 3BQYA 3B73A 4OIOF 3JRGA 4HX4A 3S3MA 3F22A 3ZQLA 4BDZA 1T0FC 4Z6YA 2XVCA 3OYDA 2VC1A 4EMSA 1KYWA 1ZK8A 2JSCA 3IL2A 1X1DA 3OMYA 2OBPA 4EJOA 3K4KA 1H9GA 2M7AA 3S32A 2FBHA 5HS7A 3QPTA 3M9AA 4LMYA 4D0PA 2W25A 1I39A 3KLNA 3Q3SA 2Q2EB 3MKWB 3T1BA 2BXYA 1FMVA 5E1ZB 1G6NA 2JUGA 3BJAA 4CYCA 2UWMA 3P7NA 1Y1WJ 5IYDJ 5DTDA 2OA4A 2O9LA 1O4XA 1CF7B 1KQ8A 4HF1A 4GYGA 2R93J 4UB8C 1DQUA 1ZARA 2DOEA 2EZHA 1FNNA 3DLLF 2DTRA 2ISZA 3L2RA 2ECBA 1XGMA 3MKLA 1IJWC 4V2GA 2DN0A 2ZJRF 1X1PA 4FQGA 1S6LA 3TDZC 4BAYA 2ACJA 1T0FA 1BC8C 5TGTA 1GV5A 2I10A 3RSNA 3M8EA 3ZP5A 3NEUA 5TRDA 2TRTA 1D8KA 2NNYA 1KQ0A 2F4OB 1D1CA 2R5ZA 1DPUA 4J19A 3REOA 1FT9A 1IRXA 5E18F 1O3RA 2NS8A 2PX9A 3RJPA 3H5RA 4IO9F 1XGOA 3E5UA 3NWTA 2E60A 2ELKA 2QKLB 1P7IA 3OS0A 4OWRB 3CQZJ 1QZZA 2DAOA 1VQPI 2VC0A 4XLAA 2GOXB 5EEHA 5K5OA 1MSEC 2PJPA 5KNLA 3OYEA 3KP7A 3S8PA 1SVOA 3GLXA 5EG0A 2CSOA 3GTJJ 2LKPA 4F93B 1W36C 1WJAA 2XV4S 1MJBA 5CVVA 4KN7X 5LRRA 2DFHA 3MQ0A 1BIAA 2CQNA 2VUMJ 2VE8A 4XICA 2E71A 1I5ZA 4CSWA 5GTHC 3OYLA 3GWZA 1YQAA 2W00A 3K10A 3FXMA 5ERIA 2XB0X 4E7ZA 1MIJA 4M3BA 4XRSA 2ZMEB 2MH9A 1MH4A 4Z2YA 4L18B 1D5VA 3FK6A 4CGZA 5ILVA 1Y0NA 2CUJA 1WH7A 2H1LA 2LP0A 3HHHA 1CGPA 4A69C 1Y8QB 1FBQA 4OAZA 3QYEA 2FF4A 2KHMA 1Z7LA 1W5SA 5CKTA 1B6AA 4KITB 3A01B 4OIRF 1D3YA 2GBYA 3K2ZA 3Q9SA 2L9NA 2OUMA 1ACIA 3IKTA 2V79A 4BH9A 1WPKA 2VT3A 1T08B 2XAQA 4U0YA 1HCRA 2LK2A 4ZYGA 4RM2A 4F55A 3COAC 5EGOB 3BC8A 2LFBA 5GAHJ 3GTOJ 2XGXA 3OOUA 2B7EA 2F4MB 3PJRA 1AKHB 3DLAA 1ULYA 2IEKA 4A3EJ 3DPTA 2PG4A 4S0HB 1LUJB 4G7HF 4ZJZA 1XGNA 3LOCA 2DFEA 4IF4A 2JA2A 4KMFA 2GXGA 3LSGA 4PJLA 5KAFC 4Y17A 5HNFA 3GVAA 1ZH5A 2X4HA 5CYVA 5B3SH 1ZKGA 3QAHA 3JAMZ 5LEJA 4I02A 4IRGA 2VPLA 2GXBA 3V7SA 3X2QH 3QPSA 3QPHA 3GF2A 3ESWB 2VQHA 4B3XA 3PM1A 4I2OA 2KMUA 4HSTA 3P9KA 1DPRA 1HBXG 2KT0A 2OZUA 2F4IA 1W5TA 2P5VA 3FMRA 4KIGA 3VOEA 4KDPA 1PYVA 1FMWA 3LQRA 2RDPA 3W3CA 2WAQA 2LR8A 2HPIA 2XF6A 1SD4A 2EZKA 4EVIA 2ID6A 2H6CA 2CG4A 3TO6A 3HOWJ 1D0YA 2YU3A 4D1QA 1Z1DA 3DU6A 4IVNA 2EFOA 3DEUA 3WTYC 3F8BA 1YRNB 1Z0XA 3GMEA 5DUIA 2RAEA 3ABLH 2HZDA 3KYLA 3ECHA 4IL6C 1USSA 3EDPA 5HDKA 1MSFC 2XAFA 1VNDA 3NRVA 2HVSA 3FMSA 3KPHA 1Z3XA 2R4GA 3JAMK 1AHDP 1K4SA 4NQWB 2XHKA 4IOCF 4M72A 1LVKA 2EK5A 4N9IA 4YELA 5FFXA 4WWCA 4EJTA 1MMGA 3OSFA 1O3SA 1PP8F 2ZJ2A 3FXOA 4S05A 5KK1A 3NQOA 3HKZN 3F3XA 3KP5A 2X85A 1LJ9A 2KDZA 1T98A 1X1AA 1Z21A 1J7KA 1VQ5I 3CCUI 2HQAA 4B44A 2G7HA 4LFUA 3OYIA 1OCRH 1IUFA 3B6CA 2FRHA 1SD6A 2X0LA 3SZGA 3M4OJ 1ERDA 4BE0A 4FHTA 2OTLI 3B02A 5AIQA 4KYWA 9ANTA 5F04A 2VBXA 3OS2A 1WJEA 1D1BA 2Y48A 1JJ8C 2KZVA 1F1ZA 1R7JA 2DODA 4XONA 2CUZA 4YRVA 4L0YB 3H5AA 4OINF 2Y30A 3V7RA 3CMMA 2DPDA 1HA8A 1MMNA 1YX3A 2DYSH 2PEXA 3R0JA 3SZPA 3HOZJ 4BKXA 1RZ4A 3KP4A 3CMYA 4LLNA 4DJAA 4LJZF 2YU9J 5LFAA 4NC6A 4PFOA 1DDNA 3H9JA 2V6CA 1MBGA 2M30A 2YS9A 1GXQA 1QZYA 4GGGA 3CF5F 2E36A 1MBEA 2D1HA 5K1YA 2K27A 2QENA 4ESBA 1OJLA 2FD5A 4A3KJ 2KPMA 1WH5A 2EV5A 4Y52J 4L9VA 2VBZA 3E6CC 4A3IJ 4I76A 1OPCA 1TC3C 5L3CA 3HL2A 1SANA 4E4HA 2ICWG 2X51A 2A61A 5EJCA 3F23A 2WTEA 1BR4A 4HAMA 3FHNA 2FMLA 4PSXA 3HJEA 4JX4A 3WG7H 1HC8A 2V4JC 4IRHA 3JRFA 2DK8A 4XM3A 4NNJA 1OFCX 4I7HA 3L2QA 4ON0A 2GXAA 4RB1A 1I1GA 5CQGA 2RV8A 5KHDA 1A6IA 4RAFA 3FBNB 5LBQA 2PQ8A 3BPVA 1W0UA 2Y0SN 3GFIA 3Q9VA 1UCRA 5DCMB 1LQ1A 2PFBA 2JMWA 1U0JA 3WTVC 3W2AA 3WU0A 3CUQC 2KQRA 5JR3A 1SD5A 1Z67A 4HDUA 2O8XA 1XMAA 2V9PA 3K7AJ 1W7PD 3RPUD 3JRDA 1YIOA 3GZNB 2HQNA 2M8EA 2Z3YA 2OCCH 2OQRA 2DMPA 2LY1A 5GAEJ 1K83J 2OV7A 2DT6A 5GPAA 2X6OA 4AC0A 2EZLA 2HGCA 3PUBA 2DXIA 3K4LA 4ESFA 1YIJI 1OCOH 3LSMA 2Q0OA 4AVZA 4O3MA 3PNYA 2V7FA 3LSHA 3OYGA 2BY3A 4NHJA 4LOCA 2HVRA 2BXZA 1Q1VA 5IT3A 1WJ5A 3WE2A 3V42A 5K7HA 2R7TA 3ZQQA 2QGUA 2MA3A 4NDLA 3VB2A 5IOZA 1CF7A 2K3FA 5IP9J 4U0WA 4BY7J 1UG0A 1RI7A 2CGPA 3CP2A 1TQPA 2UV1A 5CPRB 2ME0A 2KIMA 2MLKA 4BHPA 5F1JA 2R7WA 5C4XJ 1X2MA 1Z77A 3BDDA 3W6VA 3ZMTA 5ICCA 2K5CA 1TWHJ 1P4XA 3LFKA 4PJMA 3OYCA 1MKMA 2DJIA 2HQ5A 4FT8A 4RDUA 2KJBA 3AL0C 3KZIC 2KJCA 3E97A 4A3MJ 2NOGA 1QHHD 2LYCA 2ZXHA 3BOQA 4MTEA 4CHUA 3F8NA 2CQ7A 3GTPJ 1B1BA 1WJDA 3H3ZA 1DP3A 3I59B 3DFGA 3FF5A 3G71I 2QA4I 1RKWA 2R3SA 4YIFA 2GM4A 3CLQA 3D5SC 3W6KB 4UY8I 2GZWA 2GA2A 1SEUA 2WBMA 1NH3A 1FP2A 3UKGA 1ZRCA 4AYBN 2QQBA 2HKOA 4M73A 2CO5A 3MN2A 3W6JB 3BQZA 1GLNA 5FKKA 1G3YA 1S7EA 3C1DA 3QU6A 3RZDJ 4WXCA 1PJRA 2VKDA 3CDIA 3ZMDA 5J1UA 3HKZA 3Q5FA 2Z5UA 4F91B 4BQNA 3T8TA 1P9QC 2L01A 3IH2A 3SXYA 2HYGD 1HF0A 1XMKA 1FZPB 1TWGJ 3TKYA 2DCEA 3E1SA 1ZHFA 2FXAA 4P55A 1JT0A 1C0WA 2JSPA 3S15J 2VQLA 4MTDA 3F21A 4X0GA 2M87A 5FRMA 1UELB 5F08A 3WGGA 4G94A 3A01A 4A3DJ 4M6VA 1XDUA 3GLLA 5KCMA 4HV5A 1MNDA 1OCPA 2OJED 3MWMA 3U1KA 3UR3C 4ZDPA 1MJAA 1YLFA 3G1OA 4M3EA 3HC7A 2WWYA 2EILH 4UV9A 3ML6A 3J81Z 2KP6A 5EGOA 4G12A 4LD5A 3PL8A 2HQRA 4GYIA 3TBIA 1JHHA 2DA6A 4MNUA 2ZXIA 4OAYA 1V5FA 4U87A 3KLOA 1FWZA 3K4MA 4WXDA 2GAUA 3FXRA 2X6XA 2HNHA 2HTSA 2L9RA 3BR0A 2PI0A 1EA3A 3VSKA 2EA4A 1ETXA 1ZELA 1QA6A 4BBSJ 1ETKA 4FASD 4IQJA 2XROA 4KT5C 3ZGKA 1EH7A 4YG2F 5HNHA 2P6TA 3WGIA 1MZBA 5GADJ 4DZJA 2R5YA 4IX7A 3AG1H 2R7UA 5L3FA 5EEAA 4A6DA 3HUGB 4ITVA 4HQEA 1AOYA 3OS1A 2GIZA 1ZQ3P 1BI0A 4IEJA 1TNTA 3CC4I 1D5YA 2GLOA 2QLZA 3TDUC 3TP0A 2MFZA 4BL0B 3OSGA 4BQAA 2Y0SA 2VJIA 5C4JJ 1QRYA 5M3MJ 3ZQ7A 5E79C 1S8NA 1H89C 2PMUA 1X1BA 4KUMA 2W7NA 3MVPA 4CH7A 3OWTA 4BBRJ 3J81K 2HI3A 3DXJF 3M8FA 4EJUA 2Y9ZA 1T38A 4K2EA 2F5EA 4C2UA 1SVLA 1BR2A 3CO7C 3IKVA 1ZG5A 2A07F 1S7AA 1IG7A 2EBIA 2QSHX 3ZMUA 1YRNA 2P4WA 1H9TA 1RUOA 3Q0UA 4F52A 4LLLA 4WX9A 4M9XA 3CJRB 1VQ6I 3KETA 1SMYF 4R79A 2EFNA 4MQ9F 1ZAOA 2VBYA 3VFZA 2NXNB 1USTA 1PUEE 2FSWA 2LBFA 3PFYA 4MIMA 4XRSG 4N9HA 4OOIA 5TISC 1A5JA 1XMXA 1IXSB 2W24A 3QP5A 2HR3A 3BTCA 3CP8A 2A05A 2L7ZA 3RZOJ 2BYVE 1MNMC 3LSIA 4D7MA 2XGDA 4P1WA 2Q1ZB 4BJ5C 2V9VA 2BGCA 2DW4A 4V2FA 3KP3A 4BHCA 3BTIA 2HTJA 2XAGA 5DV5A 1FOKA 3HZJA 2P5KA 2KRHA 3I54A 3KIOA 2CV0A 3SEZA 2QQAA 1VF9A 4OMZA 3I4PA 2EH3A 1ETWA 1HXDA 4B47A 3BWGA 2DA2A 5DM6F 4U7DA 1MJ9A 3DBHB 4DZPA 3K4NA 3MEXA 4ZYHA 4A6EA 3SZTA 1H8AC 4GFBA 4KMUX 4DGWB 4XKCA 2ZFUA 3K1MA 1XD7A 5BPDA 1X1CA 2F48A 4LG0B 3AG4H 1OYWA 4XN0A 5AIPA 2DLLA 3OOPA 2JWTA 4EV0A 2IGKA 1JI8A 3AG3H 2VKVA 3MZYA 4BEHB 2I5UA 4H0EA 1VQNI 2LREA 2DDAA 3M3YJ 2FQ4A 4X6AJ 3M1EA 3EPZA 5CJ9A 4CCMA 4QPOA 1I6HJ 2ESHA 3CUOA 4BUPA 3VPRA 3FWEA 5D4RA 1IGNA 4IKFA 4AIKA 4IHYA 2QQ8A 2V1XA 3S14J 1EH8A 3LNQA 1PUFB 2A6TA 4KA4A 3OYBA 4YIRX 3LA3A 1G3TA 1JUSA 4LIVA 4M3GA 4M71A 3I55I 1OCTC 2IA1A 5E17F 2BY1A 5E1XA 1R1VA 2IGMA 4L9JA 2QM3A 5LRSA 2MH2A 1HKQA 1ZRFA 2EFPA 3HOYJ 3IH3A 1U8BA 2LKSA 2H94A 1BI3A 3H92A 2JT1A 2QZ8A 3OV8A 2VXDA 1WWXA 2BW3B 3PUFA 4XRFA 3J7YJ 1BI2A 3PSIA 4I0BA 5EZGA 3WTUC 1P7JA 3ZN0A 5GAGJ 2HDWA 2LF7A 1FLIA 1YE9A 2WAEA 1AWCA 2E34A 3R4KA 2E19A 3BR1A 4B43A 4ESJA 5KVRA 1NK2P 2HDCA 2IT0A 2BOLA 2P8TA 1E3PA 3K1PA 4UB6C 1JXSA 1MMAA 2L9VA 5ILSA 1SAXA 1I3QJ 1MMDA 3LA2A 1ZGJA 4GO1A 4N4NB 3HXLA 1XG1A 4MO7A 2CQQA 3ABKH 3S93A 1R23A 5ILUA 5E3LA 1LFBA 2XKOA 5F0CA 3FM5A 3VYRB 2H27A 1OR7C 4HF0A 4LGWA 2M0MA 3OL3A 4HQMA 2V26A 1K7AA 1RPWA 2MGQA 3HPHA 3CCRI 4AWXB 4U7BA 1FJLA 2VQCA 2M1BA 1QZEA 1JTXA 2ISYA 5D5UB 2A6HF 3L2VA 3CJQB 3L2UA 1B72A 3QPLA 2FA5A 3F9KA 3TL4X 3WE3A 1B9NA 1HDDC 4G7ZF 4Y3OA 2K9SA 5BS6A 2IS4A 5JFRA 4IHXA 1S72I 2NS0A 4XQFA 2IXSA 1LE8A 5M5YJ 2X9DA 3P9CA 1LDDA 1ORKA 1TWAJ 2COBA 4B3AA 4RA2A 4G6QA 1OYYA 2IAIA 2MBFA 1ETQA 3JRIA 1R6RA 5E8GA 1K79A 4R1HA 3I59A 4IJAA 2ELHA 5J1RA 4Y4RA 3CDLA 1UFMA 4V19K 2HDDA 3L00A 1FBSA 1OR7A 1FOYA 1S5LC 3T8RA 2FEZA 1YYVA 3DCFA 1HSTA 4AIDA 3GYHX 2MG4A 2H09A 5EF6A 2CWEA 2YSRA 2IJLA 4XIDA 1TQMA 4UVAA 4MFDA 3CCMI 1ZR2A 4D5FA 1J0RA 1MBKA 4OIQF 1SC7A 1FIPA 2LH9A 4C30A 4AD9A 3H0GJ 3PNTA 1XPXA 1GHCA 1MMSA 2JPCA 1GXPA 2BEOA 5LD2C 1YITI 3OR1C 1BBYA 1GV2A 4H4KC 2Y0MA 3IP4B 1FSHA 3JRBA 3OYMA 2Z2SB 3LQQA 4A2UA 3Q0VA 2VL8A 2IS1A 1J59A 2M8GX 5CVUA 1MBHA 2JUCA 2A3SA 4XKVA 4NC7A 2MW8A 1VQ8I 1AA7A 4MHGA 2HPMA 4E7LA 4F92B 3DBRB 2R7SA 1XX5A 2WY7Q 4XNFA 1X4OA 4UUSB 1TW3A 4RB0A 2BY2A 2KZGA 3WHBA 2JQ7A 3RCOA 4XOTA 1W0TA 4ZC3A 3AG2H 1KYZA 4ANJA 2JVGA 4JX5A 3ONQA 3GFJA 3S2WA 4E70A 2HYJA 3VEPA 3R61A 2D1VA 3A03A 1MNEA 2BE5F 1RNLA 4G9YA 1P92A 3MKZA 5DYMA 4A12A 5A2QZ 5BPIA 3HDDA 2JPBA 1MD0A 2STWA 1BIBA 2M0CA 1LFPA 4YEJA 2VB6A 1B8IB 2NYXA 4I01A 1FEXA 4A3FJ 2O8KA 1YW7A 1WQ2A 2DA3A 2LMDA 2MSYA 2CW0F 3HGGA 4L9NA 3K2AA 3BJOA 1O3TA 2L7MP 2FBKA 3HUGA 1X3UA 2O7OA 5HOOA 2M4GA 2IS2A 2EINH 1FP1D 1I50J 4Q48A 1G59A 2VODA 3AKZA 4JP0A 4ZDOA 3CLOA 5KAIC 1U78A 2Z99A 2F5VA 2HXIA 4ZYDA 3O6BB 2J5PA 1MW7A 5E1WA 4RB3C 2W84A 2IA2A 4XSXF 1DGRM 3D0SA 1JKPC 3BCAA 2IW5A 3MCZA 3K4BA 1Y0UA 4HNTA 1ETYA 3VDXA 1HW1A 5F27A 1QPIA 4AM3A 5LLQA 2ECCA 3DWLE 2XRLA 1J9IA 1U6GA 2Y69H 4U0VA 1ZG1A 2R7XA 1R5GA 2MD0A 1MDMA 2V1DA 2HFHA 1E3OC 3NWSA 3C2GA 3KEOA 2QWWA 4BDYA 1UHWA 3V8JA 2PN6A 4EEFG 1H0MA 4ZDLA 5A2QK 2M7BA 1R4NB 1OMIA 3BTLA 5ED4A 2EV0A 3H5NA 4BJ6C 2NVTJ 3FISA 4A3JJ 2IA0A 5HODA 2NRAC 2BZTA 2QBYB 1WCMJ 2NVUB 1YW9A 2NAZA 1D0ZA 3GCMA 3IHUA 5M3FJ 4BU2A 2A69F 4XN3A 3WU2C 3HOXJ 2LSOA 2DOFA 2QYOA 1VQKI 3K0LA 2Z16A 1W7PA 3SJMA 1ZG3A 4I99C 3RPUA 2LNBA 3EQLF 4MFEA 3L7WA 1YHQI 4M9SA 3V4GA 4P9FA 4I0AA 5F0FA 1WGXA 1D8JA 1IDYA 1ODDA 3DKWA 4L9TA 5GPCA 3ZMZA 2ZJPF 2B0LA 3H36A 5FD5A 2OF7A 3LSKA 1IO2A 4A0XA 1F9NA 4HRIA 3I58A 3U21A 5F6FA 1LVAA 1SFXA 5F64A 1TT5B 1YS6A 1K78B 1GVDA 1H88C 1N77A 3TO7A 2HOTA 1MBJA 3DTEA 4N4OB 3RDIA 4JBAA 4TV7A 2KL4A 5GP9A 4MLOA 4HEA2 5IYCJ 2H8WA 4A3BJ 4DYQA 3LAJA 3PSFA 4LK0F 4C3IJ 2XF5A 4YFXF 1SMTA 1QNTA 1DP7P 3F6VA 2CUFA 4XOPA 2RC4A 3RQ4A 4B09A 4BEHA 3DEWA 1PP7U 1IZ1A 1K6OA 5FJ8J 2YPRA 1I27A 3PFIA 2XB5A 1KZHA 3LSRA 3CZ6A 1F43A 2LLKA 2NVQJ 4WXHA 4XMYA 1RIOH 1IXRC 1E2XA 1R00A 1KU2A 3EUKL 1SAUA 1ZN2A 3L2WA 1MH3A 2XC7A 4QWQA 1XTAA 5B1AH 4HSRA 3VSLA 2VJ4A 2FU4A 3F72A 5ICEA 3KFWX 3HGYA 3E7LA 2Q2EA 1X19A 3HM5A 1OYIA 1VZ0A 4KICA 4D5CA 1P4AA 4XORA 1MGTA 1VQMI 3H3UA 3FXQA 2M45A 3FMQA 3LA7A 2X6WA 4P5OA 3W2WA 1U2WA 3FXJA 1IF1A 3KEYA 2RQPA 3KYDB 3VYUB 3GTLJ 1TW2A 1G3WA 4BQQA 2XASA 1WKMA 1ZLJA 3LWFA 3RKQA 2XAUA 3OY9A 2O5RA 5EYRA 3BZKA 2HZTA 3CCQI 1BJZA 3KP2A 2L7KA 4XK4A 2WC2A 3PIOF 2ZMEC 3SFZA 4HG2A 1WRJA 3PQJA 4O6JA 4RGSA 3I56I 3FKJA 4FX0A 2E1CA 3PO3J 1LB2A 2NVYJ 2P0WA 3HOTA 2LY2A 1U3EM 4IPAA 1XSDA 1KA8A 3JSPA 1RC9A
chains in the Genus database with same CATH topology
3CO6C 3K1NA 2IRFG 5CVJA 4IRIA 3WTXC 3HSEA 4M9ZA 1I6XA 2VONA 2QQ9A 3HYIA 5H6QA 3EUHA 5HDGA 3QP6A 2K7LA 4MEXF 4EJVA 2R7DA 2Z9OA 2ZFWA 4M6YA 2AS5F 1XSVA 2F5CA 2HOEA 3HRUA 2MD5A 5D5XB 1HW2A 1ON1A 5HS8A 3DP7A 3IWFA 2V1UA 4O5VA 3BY6A 1JE8A 4MQVA 2DFIA 4EGZA 2ZMEA 5CVRA 5FD6A 2C6YA 2L3DA 4Q4ZF 2XAJA 2FE3A 2A5YB 2JTVA 3V8KA 2DQLA 5LHHA 2L4AA 4A5NA 1HW5A 3WODF 4CYDA 2A6EF 4EGYA 4PGHA 2DI3A 1XGSA 1R58A 3MAJA 5FO5A 2VBWA 4Y13A 4RGXA 2DO7A 4HX7A 1QO0D 2KIFA 5ICFA 1HQCA 1B59A 2RNJA 2CFXA 4G7OF 1QGPA 3TO9A 2XKPA 3IWZA 4EM1A 3T0YA 4OIPF 1UB9A 3E3VA 4ENNA 4RGUA 2GQQA 2E7XA 1O7FA 1KQ9A 5D5VB 3GX4X 2VXZA 5LEKA 3F8MA 1FX7A 2QUFA 2VE9A 4G8XA 1U8RA 3LAPA 2VOOA 5LHIA 3TOAA 2WV0A 3RPQA 3IC7A 2J5OA 4A0YA 4PCQA 4A5MA 3I0TA 1IN5A 4CDGA 4WCGA 4OU0A 1U5TB 4ASNA 2P5LC 1I1SA 1T2KA 1O57A 3AAFA 3L09A 3GFLA 1EV7A 2P7VB 2OAZA 2E1NA 5D8LB 3R60A 4NQWA 5CVIA 2IPQX 4Q47A 4HLXA 3V8LA 4OMYA 4UVBA 2FNAA 1BC7C 4XBFA 5TJJA 2EFQA 2K86A 1LEBA 1QPMA 4HA8A 1SD7A 2LF8A 3L2CA 4L5IA 3I71A 4BHBA 1R1UA 2DBBA 4BYYA 3KZYA 2Z33A 3RKYA 5D4SA 2M5WA 4GCVA 2ZXJA 1Z7UA 5DCFA 2QBYA 5L3GA 2O61A 1T39A 3E5XA 5ICGA 1STZA 2Y75A 3RYPA 4NB5A 3BP8A 2D45A 3RYRA 3EYIA 2XAHA 5JHUA 2FNPA 4RAZA 2HEOA 4Y15A 3RKWA 1ZYRF 4MEYF 2JZYA 3CDHA 5H20A 3VODA 3ULQB 3QRFF 1K78A 2O03A 5L3DA 4F7ZA 2K02A 1J75A 1KU7A 2K4BA 3SHFA 3BJ6A 3WU1B 1G4DA 3CTAA 3J7AO 2PBIA 2XRNA 3RTRA 1F4KA 5D5WB 1IUYA 5DCMA 5AONA 3E6MA 1Z6RA 1ONVA 3R6SA 5LGUA 4PZJA 3BPXA 3JTGA 3F8FA 4RAYA 1BI1A 3E5QA 2AXLA 5J8CA 4MGRA 4ZH4F 1S7OA 2LDUA 2P6SA 1YTYA 3CUQB 2ZBKA 3K69A 3ELKA 4I09A 4WK8F 4UVCA 5BMZA 3KE2A 1GVJA 5DD8A 1IAWA 1XN7A 2L02A 5J8FA 1P4WA 3GFMA 3ZMSA 1XSXA 2DT5A 4JK1X 5HS9A 2TDXA 2RGVA 1L3LA 5BQTA 1YS7A 4LB5A 4UHTA 1O7LA 3DV8A 4HX8A 4CICA 4XLNF 1O3QA 1JHFA 6PAXA 3IRQA 3EETA 3QU3A 4UXNA 3I53A 3GXOA 2OQGA 2STTA 1JGSA 5IT9Z 4KFCA 3HRTA 1VTNC 1TQIA 2FMYA 2PMHA 1P6RA 3ROUA 5E20A 4UNOA 2IP2A 1YFHA 3ABUA 4LLGF 2HYFA 5LGTA 1R5HA 1LDJA 3E6DA 1BOAA 2E7WA 5BOXA 2L4MA 2COMA 1TLHB 4EM0B 3WG9A 3DQVC 4IHSA 3R0AA 2G7UA 5E8IA 3WTZA 2GA1A 2YR2A 3LSTA 4P9UA 4QLCU 3WTTC 1WI9A 5HLIA 4YFKF 4PGGA 4AIHA 1IW7F 3C3WA 1KGSA 4N0BA 2VT2A 3RI4A 5IT9K 1U5TC 2ZNYA 1Z05A 2DPUA 3J80Z 1FYLA 1XDSA 4CZZA 2EJRA 4YIIA 2O6GE 1J5YA 1S29A 4RGRA 2FOKA 1BN5A 4AIJA 2KIUA 1Q1HA 3BZ6A 5HLGA 1FBUA 2BBYA 3GUDA 1U5TA 4ETSA 2HS5A 2OD5A 3FX3A 4IXAA 2H6BA 4HYEA 4XLPF 3GW2A 2CQKA 2DU9A 2NNNA 1T6SA 5JI6A 4BNCA 4EM2A 3V7CA 3J80K 1SFEA 2ESNA 3G3ZA 3GO5A 1IN6A 3DPLC 5K5RA 2EFWA 2MC3A 2FQ3A 3QOPA 1L0OC 4ZZDA 2L54A 4G6DA 1S3JA 4M74A 5CLSA 3G73A 3N4MA 3U9GA 1DUXC 1XCBA 4UUVA 5DUKA 3RKXA 1WSUA 4KNYA 3BROA 1IXCA 2OZ6A 5FFZA 4U88A 1IN4A 4LG0A 2KRFA 1HKTA 3U1DA 3GEZA 3U2RA 1XCVA 2ZO4A 1ZREA 4ENJA 4DNCA 4M6XA 4HW0A 4ENKA 1QQIA 2O0YA 3KCCA 2RKHA 2F2EA 4YFNF 2DK5A 2F5DA 1YW8A 3HSRA 3ZPLA 3FZVA 1R22A 2RVCA 2D2WA 2GIVA 3P9IA 1F5TA 1KU3A 2FBIA 2ZNZA 1B4AA 5HDNA 1LNWA 2GWRA 5D8KB 3ECOA 3M7GA 4AVPA 2VOPA 1NHAA 3ABTA 3TGNA 4GXOA 1E17A 5K5QA 3ISPA 3SQNA 3L9FA 1Z6TA 1RUNA 1SFUA 4LK1F 3ERED 4HV6A 1V4RA 2KKOA 5D6FA 3MZHA 1QBJA 5FB2A 5HVQC 1ZRDA 1KU9A 3E6BA 1BJAA 4LB6B 2W85A 1FPQA 3CUQA 3WTSC 2QVOA 1OKRA 2DQRA 1FSEA 5F1RA 1LDKB 5EEGA 3JSOA 2G9WA 2F5FA 4S04A 3GZ6A 1YG2A 4HBLA 3KEQA 2RN7A 3C7JA 4WF2A 2ZKZA 1IRGA 4KIFA 1YO5C 3PQKA 2Q8KA 3HRSA 1XB4A 4KN4X 5FLXZ 1R1TA 3FHZA 2P7CB 4L0ZB 3N97A 5JVTA 4CO8A 1TBXA 1FYMA 1HSJA 3ZN1A 2IVMA 4KIBA 3JTHA 1W4MA 2ZCWA 3HSFA 2YX7A 2UXNA 3F8CA 3IRRA 2BV6A 4P96A 2MLGA 5DEQA 4HDVA 2W57A 2EB7A 2XIGA 3HHGA 5J6XA 1IN8A 3ZMVA 4B8XA 3JW4A 3O3KA 2UZKA 4A0ZA 1BM9A 3HOSA 3C18A 1EH6A 3KZZA 4CXFA 1G3SA 5LHGA 5HLHA 3O2PE 5L3BA 1REPC 1FC3A 5FLXK 2OU2A 1P2FA 2EV6A 4BXUA 4R8HA 3TQNA 4EQQA 1A04A 3TOBA 4HLYA 4HOBA 1UHMA 3FXUA 5DD4A 4FX4A 2UXXA 1TTYA 2EA2A 3WGHA 5H6RA 1LEAA 1FY7A 4EJWA 5DDGA 5FGMA 2R7FA 2A68F 2XUBA 4DQ2A 2YX4A 3FM3A 1ZGAA 3T5XA 4UV8A 4RS8A 4PDKA 5D6EA 3HTSB 4HZFA 1ZLKA 1FYKA 1V3FA 2VN2A 4ENMA 1MDMB 3WTWC 3CJNA 4I98B 3EYYA 1HKSA 3HIFA 2EWNA 4JQFA 2HWVA 1Z9CA 4Q5SF 1W7PB 2HKXA 2O3FA 1J2XA 2K4JA 2JRTA 1IRFA 5LGNA 1ON2A 1IN7A 4XSZF 3KP6A 5L3EA 3K9TA 3I64A 3HTUA 3DF8A 2PLYA 2CYYA 4L5JA 4HF2A 3MFKA 1B9MA 4ZZLA 3RIRA 2ETHA 1TNSA 4ZYEA 3I5UA 3HRMA 1R36A 1Z91A 3F6OA 3D5LA 4RB2C 3GZ5A 4IHTA 1PDNC 2ADUA 3B73A 4OIOF 4HX4A 3F22A 2XVCA 2VC1A 4EMSA 1KYWA 2JSCA 3IL2A 4EJOA 2OBPA 1H9GA 2FBHA 5HS7A 3QPTA 3M9AA 4LMYA 4D0PA 2W25A 3KLNA 3T1BA 5E1ZB 1G6NA 3BJAA 2UWMA 3P7NA 2OA4A 1CF7B 1KQ8A 4HF1A 4GYGA 1ZARA 1FNNA 2DTRA 2ISZA 1XGMA 1S6LA 3TDZC 4BAYA 2ACJA 1T0FA 1BC8C 3ZP5A 3M8EA 3NEUA 5TRDA 1D8KA 2NNYA 1KQ0A 1DPUA 3REOA 1FT9A 5E18F 1O3RA 3RJPA 1XGOA 3E5UA 1QZZA 2DAOA 2VC0A 5EEHA 5K5OA 2PJPA 3KP7A 3GLXA 2CSOA 2LKPA 2XV4S 1MJBA 5CVVA 4KN7X 5LRRA 3MQ0A 1BIAA 2VE8A 1I5ZA 3GWZA 1YQAA 5ERIA 2ZMEB 2MH9A 4Z2YA 4L18B 1D5VA 4CGZA 5ILVA 3HHHA 1CGPA 1FBQA 2FF4A 1W5SA 1B6AA 4OIRF 1D3YA 3K2ZA 3Q9SA 3IKTA 2V79A 4BH9A 2VT3A 4U0YA 2XAQA 4ZYGA 3COAC 2XGXA 1ULYA 3DPTA 2PG4A 4G7HF 1XGNA 4IF4A 4KMFA 2GXGA 4Y17A 3GVAA 1ZH5A 2X4HA 5CYVA 3QAHA 3JAMZ 5LEJA 4I02A 4IRGA 2GXBA 3V7SA 3QPHA 3GF2A 4I2OA 3P9KA 1DPRA 1HBXG 2OZUA 3FMRA 1W5TA 2P5VA 4KIGA 3VOEA 4KDPA 3LQRA 2RDPA 1SD4A 4EVIA 2H6CA 2CG4A 3TO6A 2YU3A 1Z1DA 4IVNA 2EFOA 3DEUA 3WTYC 3F8BA 5DUIA 3ECHA 1USSA 3EDPA 5HDKA 2XAFA 3NRVA 3FMSA 3JAMK 2XHKA 4M72A 2EK5A 4N9IA 5FFXA 4WWCA 4EJTA 1O3SA 1PP8F 2ZJ2A 4S05A 5KK1A 3NQOA 3F3XA 3KP5A 1LJ9A 1T98A 1J7KA 2G7HA 4LFUA 2FRHA 1SD6A 2X0LA 4FHTA 3B02A 5AIQA 4KYWA 2VBXA 2Y48A 1F1ZA 1R7JA 4L0YB 4OINF 3V7RA 2DPDA 3SZPA 2PEXA 3R0JA 1RZ4A 3KP4A 4LLNA 4LJZF 1DDNA 2V6CA 2M30A 1GXQA 1QZYA 4GGGA 5K1YA 2D1HA 2K27A 2QENA 4ESBA 2EV5A 4L9VA 2VBZA 3E6CC 1OPCA 5L3CA 2A61A 3F23A 2WTEA 4HAMA 2FMLA 4IRHA 2DK8A 4I7HA 4ON0A 4RB1A 1I1GA 2RV8A 5LBQA 2PQ8A 3BPVA 3GFIA 3Q9VA 1UCRA 5DCMB 1LQ1A 2PFBA 3WTVC 3WU0A 3CUQC 5JR3A 1SD5A 4HDUA 2O8XA 1XMAA 1W7PD 1YIOA 2HQNA 2M8EA 2Z3YA 2OQRA 2HGCA 4ESFA 2Q0OA 4O3MA 4NHJA 5IT3A 3WE2A 2MA3A 1CF7A 3VB2A 4U0WA 1RI7A 2CGPA 1TQPA 2KIMA 2MLKA 4BHPA 3BDDA 3ZMTA 5ICCA 1P4XA 3LFKA 1MKMA 4FT8A 2KJBA 2KJCA 3E97A 3BOQA 4MTEA 4CHUA 3F8NA 1B1BA 3H3ZA 3I59B 3DFGA 3FF5A 2R3SA 4YIFA 3W6KB 2GZWA 2GA2A 1ZRCA 1FP2A 2QQBA 2HKOA 4M73A 2CO5A 3W6JB 1G3YA 3C1DA 3QU6A 4WXCA 3ZMDA 3Q5FA 2Z5UA 3T8TA 2L01A 3SXYA 2HYGD 1XMKA 1FZPB 3TKYA 1ZHFA 2FXAA 4P55A 1C0WA 4MTDA 3F21A 2M87A 3WGGA 4G94A 1XDUA 4HV5A 3MWMA 1MJAA 1YLFA 2WWYA 4UV9A 3ML6A 3J81Z 4LD5A 2HQRA 4GYIA 1JHHA 4MNUA 3KLOA 1FWZA 4WXDA 2GAUA 3FXRA 2HTSA 2PI0A 2EA4A 2XROA 4KT5C 1EH7A 4YG2F 3WGIA 2P6TA 1MZBA 5L3FA 4A6DA 4HQEA 1AOYA 1BI0A 1TNTA 2QLZA 3TDUC 4BQAA 3ZQ7A 1S8NA 2PMUA 4KUMA 3J81K 3M8FA 3DXJF 4EJUA 1T38A 4K2EA 2F5EA 3CO7C 3IKVA 1ZG5A 2A07F 1S7AA 3ZMUA 2P4WA 1H9TA 1RUOA 4LLLA 4WX9A 4M9XA 3KETA 1SMYF 4R79A 2EFNA 4MQ9F 1ZAOA 2VBYA 3VFZA 1USTA 1PUEE 2FSWA 4N9HA 4OOIA 1IXSB 2W24A 3QP5A 2HR3A 2BYVE 2V9VA 2BGCA 2DW4A 3KP3A 4BHCA 2HTJA 2XAGA 5DV5A 1FOKA 2P5KA 3I54A 2QQAA 4OMZA 3I4PA 1HXDA 4U7DA 3BWGA 1MJ9A 3MEXA 4ZYHA 4A6EA 3SZTA 4KMUX 3K1MA 1XD7A 5BPDA 4LG0B 1OYWA 5AIPA 2DLLA 3OOPA 4EV0A 3MZYA 4H0EA 3M1EA 5CJ9A 2ESHA 3CUOA 3FWEA 5D4RA 4AIKA 2V1XA 1EH8A 4KA4A 3LA3A 1G3TA 4M71A 5E17F 2IA1A 5E1XA 1R1VA 4L9JA 2QM3A 5LRSA 2MH2A 1HKQA 1ZRFA 2EFPA 2H94A 1BI3A 3H92A 2JT1A 2QZ8A 3OV8A 1WWXA 4XRFA 1BI2A 4I0BA 3WTUC 3ZN0A 2LF7A 1FLIA 1AWCA 3R4KA 4ESJA 5KVRA 2HDCA 2IT0A 2P8TA 3K1PA 1JXSA 5ILSA 1SAXA 3LA2A 1ZGJA 4GO1A 1R23A 5ILUA 2XKOA 3FM5A 2H27A 4HF0A 4LGWA 4HQMA 1K7AA 4AWXB 4U7BA 2M1BA 2ISYA 5D5UB 2A6HF 2FA5A 3WE3A 1B9NA 4G7ZF 5BS6A 5JFRA 2NS0A 3P9CA 1LDDA 4G6QA 1OYYA 2MBFA 5E8GA 1K79A 4R1HA 3I59A 4IJAA 2ELHA 1UFMA 3L00A 1FBSA 1OR7A 3T8RA 2FEZA 1YYVA 1HSTA 3GYHX 2H09A 2CWEA 2YSRA 2IJLA 1TQMA 4UVAA 1J0RA 4OIQF 4AD9A 1GHCA 2JPCA 1GXPA 2BEOA 1BBYA 2Y0MA 1FSHA 3LQQA 4A2UA 1J59A 5CVUA 2A3SA 4MHGA 1TW3A 4RB0A 1KYZA 3GFJA 3S2WA 4E70A 3VEPA 3R61A 2D1VA 2BE5F 1RNLA 4G9YA 1P92A 5DYMA 4A12A 5A2QZ 5BPIA 2JPBA 1MD0A 2STWA 1BIBA 2NYXA 4I01A 1YW7A 1WQ2A 2CW0F 4L9NA 3BJOA 1O3TA 2FBKA 3HUGA 1X3UA 5HOOA 1FP1D 4Q48A 2VODA 3CLOA 1U78A 2Z99A 4ZYDA 3O6BB 2J5PA 4RB3C 5E1WA 2W84A 2IA2A 4XSXF 3D0SA 3MCZA 2IW5A 1Y0UA 1HW1A 5LLQA 1J9IA 1U6GA 4U0VA 1ZG1A 1R5GA 1MDMA 2V1DA 2HFHA 3KEOA 2QWWA 1UHWA 3V8JA 2PN6A 1H0MA 5A2QK 1OMIA 5ED4A 2EV0A 2IA0A 2NRAC 2QBYB 1YW9A 2NAZA 3IHUA 2A69F 2LSOA 2QYOA 3K0LA 1W7PA 1ZG3A 3RPUA 2LNBA 3EQLF 3L7WA 4M9SA 3V4GA 4P9FA 4I0AA 1D8JA 1ODDA 3DKWA 4L9TA 3ZMZA 2B0LA 5FD5A 4A0XA 1F9NA 3I58A 5F6FA 1LVAA 1SFXA 5F64A 1YS6A 1K78B 3TO7A 3RDIA 4JBAA 4TV7A 3LAJA 4LK0F 4YFXF 1SMTA 1QNTA 1DP7P 3F6VA 2RC4A 4B09A 1PP7U 1IZ1A 1K6OA 2YPRA 1I27A 3PFIA 4WXHA 1RIOH 1IXRC 1E2XA 1R00A 1KU2A 1ZN2A 4QWQA 5ICEA 2FU4A 3F72A 3KFWX 2Q2EA 4KICA 1OYIA 1P4AA 1MGTA 3H3UA 3FXQA 2M45A 3FMQA 3LA7A 4P5OA 1U2WA 1IF1A 2RQPA 1TW2A 1G3WA 2XASA 1WKMA 1ZLJA 3LWFA 2HZTA 3KP2A 2WC2A 3SFZA 1WRJA 3PQJA 4O6JA 4RGSA 2E1CA 4FX0A 1LB2A 3HOTA 1U3EM 4IPAA 1XSDA 1KA8A 3JSPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CO6 C;  3K1N A;  2IRF G;  5CVJ A;  4IRI A;  3WTX C;  3HSE A;  4M9Z A;  1I6X A;  2VON A;  2QQ9 A;  3HYI A;  5H6Q A;  3EUH A;  5HDG A;  3QP6 A;  2K7L A;  4MEX F;  4EJV A;  2R7D A;  2Z9O A;  2ZFW A;  4M6Y A;  2AS5 F;  1XSV A;  2F5C A;  2HOE A;  3HRU A;  2MD5 A;  5D5X B;  1HW2 A;  1ON1 A;  5HS8 A;  3DP7 A;  3IWF A;  2V1U A;  4O5V A;  3BY6 A;  1JE8 A;  4MQV A;  2DFI A;  4EGZ A;  2ZME A;  5CVR A;  5FD6 A;  2C6Y A;  2L3D A;  4Q4Z F;  2XAJ A;  2FE3 A;  2A5Y B;  2JTV A;  3V8K A;  2DQL A;  5LHH A;  2L4A A;  4A5N A;  1HW5 A;  3WOD F;  4CYD A;  2A6E F;  4EGY A;  4PGH A;  2DI3 A;  1XGS A;  1R58 A;  3MAJ A;  5FO5 A;  2VBW A;  4Y13 A;  4RGX A;  2DO7 A;  4HX7 A;  1QO0 D;  2KIF A;  5ICF A;  1HQC A;  1B59 A;  2RNJ A;  2CFX A;  4G7O F;  1QGP A;  3TO9 A;  2XKP A;  3IWZ A;  4EM1 A;  3T0Y A;  4OIP F;  1UB9 A;  3E3V A;  4ENN A;  4RGU A;  2GQQ A;  2E7X A;  1O7F A;  1KQ9 A;  5D5V B;  3GX4 X;  2VXZ A;  5LEK A;  3F8M A;  1FX7 A;  2QUF A;  2VE9 A;  4G8X A;  1U8R A;  3LAP A;  2VOO A;  5LHI A;  3TOA A;  2WV0 A;  3RPQ A;  3IC7 A;  2J5O A;  4A0Y A;  4PCQ A;  4A5M A;  3I0T A;  1IN5 A;  4CDG A;  4WCG A;  4OU0 A;  1U5T B;  4ASN A;  2P5L C;  1I1S A;  1T2K A;  1O57 A;  3AAF A;  3L09 A;  3GFL A;  1EV7 A;  2P7V B;  2OAZ A;  2E1N A;  5D8L B;  3R60 A;  4NQW A;  5CVI A;  2IPQ X;  4Q47 A;  4HLX A;  3V8L A;  4OMY A;  4UVB A;  2FNA A;  1BC7 C;  4XBF A;  5TJJ A;  2EFQ A;  2K86 A;  1LEB A;  1QPM A;  4HA8 A;  1SD7 A;  2LF8 A;  3L2C A;  4L5I A;  3I71 A;  4BHB A;  1R1U A;  2DBB A;  4BYY A;  3KZY A;  2Z33 A;  3RKY A;  5D4S A;  2M5W A;  4GCV A;  2ZXJ A;  1Z7U A;  5DCF A;  2QBY A;  5L3G A;  2O61 A;  1T39 A;  3E5X A;  5ICG A;  1STZ A;  2Y75 A;  3RYP A;  4NB5 A;  3BP8 A;  2D45 A;  3RYR A;  3EYI A;  2XAH A;  5JHU A;  2FNP A;  4RAZ A;  2HEO A;  4Y15 A;  3RKW A;  1ZYR F;  4MEY F;  2JZY A;  3CDH A;  5H20 A;  3VOD A;  3ULQ B;  3QRF F;  1K78 A;  2O03 A;  5L3D A;  4F7Z A;  2K02 A;  1J75 A;  1KU7 A;  2K4B A;  3SHF A;  3BJ6 A;  3WU1 B;  1G4D A;  3CTA A;  3J7A O;  2PBI A;  2XRN A;  3RTR A;  1F4K A;  5D5W B;  1IUY A;  5DCM A;  5AON A;  3E6M A;  1Z6R A;  1ONV A;  3R6S A;  5LGU A;  4PZJ A;  3BPX A;  3JTG A;  3F8F A;  4RAY A;  1BI1 A;  3E5Q A;  2AXL A;  5J8C A;  4MGR A;  4ZH4 F;  1S7O A;  2LDU A;  2P6S A;  1YTY A;  3CUQ B;  2ZBK A;  3K69 A;  3ELK A;  4I09 A;  4WK8 F;  4UVC A;  5BMZ A;  3KE2 A;  1GVJ A;  5DD8 A;  1IAW A;  1XN7 A;  2L02 A;  5J8F A;  1P4W A;  3GFM A;  3ZMS A;  1XSX A;  2DT5 A;  4JK1 X;  5HS9 A;  2TDX A;  2RGV A;  1L3L A;  5BQT A;  1YS7 A;  4LB5 A;  4UHT A;  1O7L A;  3DV8 A;  4HX8 A;  4CIC A;  4XLN F;  1O3Q A;  1JHF A;  6PAX A;  3IRQ A;  3EET A;  3QU3 A;  4UXN A;  3I53 A;  3GXO A;  2OQG A;  2STT A;  1JGS A;  5IT9 Z;  4KFC A;  3HRT A;  1VTN C;  1TQI A;  2FMY A;  2PMH A;  1P6R A;  3ROU A;  5E20 A;  4UNO A;  2IP2 A;  1YFH A;  3ABU A;  4LLG F;  2HYF A;  5LGT A;  1R5H A;  1LDJ A;  3E6D A;  1BOA A;  2E7W A;  5BOX A;  2L4M A;  2COM A;  1TLH B;  4EM0 B;  3WG9 A;  3DQV C;  4IHS A;  3R0A A;  2G7U A;  5E8I A;  3WTZ A;  2GA1 A;  2YR2 A;  3LST A;  4P9U A;  4QLC U;  3WTT C;  1WI9 A;  5HLI A;  4YFK F;  4PGG A;  4AIH A;  1IW7 F;  3C3W A;  1KGS A;  4N0B A;  2VT2 A;  3RI4 A;  5IT9 K;  1U5T C;  2ZNY A;  1Z05 A;  2DPU A;  3J80 Z;  1FYL A;  1XDS A;  4CZZ A;  2EJR A;  4YII A;  2O6G E;  1J5Y A;  1S29 A;  4RGR A;  2FOK A;  1BN5 A;  4AIJ A;  2KIU A;  1Q1H A;  3BZ6 A;  5HLG A;  1FBU A;  2BBY A;  3GUD A;  1U5T A;  4ETS A;  2HS5 A;  2OD5 A;  3FX3 A;  4IXA A;  2H6B A;  4HYE A;  4XLP F;  3GW2 A;  2CQK A;  2DU9 A;  2NNN A;  1T6S A;  5JI6 A;  4BNC A;  4EM2 A;  3V7C A;  3J80 K;  1SFE A;  2ESN A;  3G3Z A;  3GO5 A;  1IN6 A;  3DPL C;  5K5R A;  2EFW A;  2MC3 A;  2FQ3 A;  3QOP A;  1L0O C;  4ZZD A;  2L54 A;  4G6D A;  1S3J A;  4M74 A;  5CLS A;  3G73 A;  3N4M A;  3U9G A;  1DUX C;  1XCB A;  4UUV A;  5DUK A;  3RKX A;  1WSU A;  4KNY A;  3BRO A;  1IXC A;  2OZ6 A;  5FFZ A;  4U88 A;  1IN4 A;  4LG0 A;  2KRF A;  1HKT A;  3U1D A;  3GEZ A;  3U2R A;  1XCV A;  2ZO4 A;  1ZRE A;  4ENJ A;  4DNC A;  4M6X A;  4HW0 A;  4ENK A;  1QQI A;  2O0Y A;  3KCC A;  2RKH A;  2F2E A;  4YFN F;  2DK5 A;  2F5D A;  1YW8 A;  3HSR A;  3ZPL A;  3FZV A;  1R22 A;  2RVC A;  2D2W A;  2GIV A;  3P9I A;  1F5T A;  1KU3 A;  2FBI A;  2ZNZ A;  1B4A A;  5HDN A;  1LNW A;  2GWR A;  5D8K B;  3ECO A;  3M7G A;  4AVP A;  2VOP A;  1NHA A;  3ABT A;  3TGN A;  4GXO A;  1E17 A;  5K5Q A;  3ISP A;  3SQN A;  3L9F A;  1Z6T A;  1RUN A;  1SFU A;  4LK1 F;  3ERE D;  4HV6 A;  1V4R A;  2KKO A;  5D6F A;  3MZH A;  1QBJ A;  5FB2 A;  5HVQ C;  1ZRD A;  1KU9 A;  3E6B A;  1BJA A;  4LB6 B;  2W85 A;  1FPQ A;  3CUQ A;  3WTS C;  2QVO A;  1OKR A;  2DQR A;  1FSE A;  5F1R A;  1LDK B;  5EEG A;  3JSO A;  2G9W A;  2F5F A;  4S04 A;  3GZ6 A;  1YG2 A;  4HBL A;  3KEQ A;  2RN7 A;  3C7J A;  4WF2 A;  2ZKZ A;  1IRG A;  4KIF A;  1YO5 C;  3PQK A;  2Q8K A;  3HRS A;  1XB4 A;  4KN4 X;  5FLX Z;  1R1T A;  3FHZ A;  2P7C B;  4L0Z B;  3N97 A;  5JVT A;  4CO8 A;  1TBX A;  1FYM A;  1HSJ A;  3ZN1 A;  2IVM A;  4KIB A;  3JTH A;  1W4M A;  2ZCW A;  3HSF A;  2YX7 A;  2UXN A;  3F8C A;  3IRR A;  2BV6 A;  4P96 A;  2MLG A;  5DEQ A;  4HDV A;  2W57 A;  2EB7 A;  2XIG A;  3HHG A;  5J6X A;  1IN8 A;  3ZMV A;  4B8X A;  3JW4 A;  3O3K A;  2UZK A;  4A0Z A;  1BM9 A;  3HOS A;  3C18 A;  1EH6 A;  3KZZ A;  4CXF A;  1G3S A;  5LHG A;  5HLH A;  3O2P E;  5L3B A;  1REP C;  1FC3 A;  5FLX K;  2OU2 A;  1P2F A;  2EV6 A;  4BXU A;  4R8H A;  3TQN A;  4EQQ A;  1A04 A;  3TOB A;  4HLY A;  4HOB A;  1UHM A;  3FXU A;  5DD4 A;  4FX4 A;  2UXX A;  1TTY A;  2EA2 A;  3WGH A;  5H6R A;  1LEA A;  1FY7 A;  4EJW A;  5DDG A;  5FGM A;  2R7F A;  2A68 F;  2XUB A;  4DQ2 A;  2YX4 A;  3FM3 A;  1ZGA A;  3T5X A;  4UV8 A;  4RS8 A;  4PDK A;  5D6E A;  3HTS B;  4HZF A;  1ZLK A;  1FYK A;  1V3F A;  2VN2 A;  4ENM A;  1MDM B;  3WTW C;  3CJN A;  4I98 B;  3EYY A;  1HKS A;  3HIF A;  2EWN A;  4JQF A;  2HWV A;  1Z9C A;  4Q5S F;  1W7P B;  2HKX A;  2O3F A;  1J2X A;  2K4J A;  2JRT A;  1IRF A;  5LGN A;  1ON2 A;  1IN7 A;  4XSZ F;  3KP6 A;  5L3E A;  3K9T A;  3I64 A;  3HTU A;  3DF8 A;  2PLY A;  2CYY A;  4L5J A;  4HF2 A;  3MFK A;  1B9M A;  4ZZL A;  3RIR A;  2ETH A;  1TNS A;  4ZYE A;  3I5U A;  3HRM A;  1R36 A;  1Z91 A;  3F6O A;  3D5L A;  4RB2 C;  3GZ5 A;  4IHT A;  1PDN C;  2ADU A;  3B73 A;  4OIO F;  4HX4 A;  3F22 A;  2XVC A;  2VC1 A;  4EMS A;  1KYW A;  2JSC A;  3IL2 A;  4EJO A;  2OBP A;  1H9G A;  2FBH A;  5HS7 A;  3QPT A;  3M9A A;  4LMY A;  4D0P A;  2W25 A;  3KLN A;  3T1B A;  5E1Z B;  1G6N A;  3BJA A;  2UWM A;  3P7N A;  2OA4 A;  1CF7 B;  1KQ8 A;  4HF1 A;  4GYG A;  1ZAR A;  1FNN A;  2DTR A;  2ISZ A;  1XGM A;  1S6L A;  3TDZ C;  4BAY A;  2ACJ A;  1T0F A;  1BC8 C;  3ZP5 A;  3M8E A;  3NEU A;  5TRD A;  1D8K A;  2NNY A;  1KQ0 A;  1DPU A;  3REO A;  1FT9 A;  5E18 F;  1O3R A;  3RJP A;  1XGO A;  3E5U A;  1QZZ A;  2DAO A;  2VC0 A;  5EEH A;  5K5O A;  2PJP A;  3KP7 A;  3GLX A;  2CSO A;  2LKP A;  2XV4 S;  1MJB A;  5CVV A;  4KN7 X;  5LRR A;  3MQ0 A;  1BIA A;  2VE8 A;  1I5Z A;  3GWZ A;  1YQA A;  5ERI A;  2ZME B;  2MH9 A;  4Z2Y A;  4L18 B;  1D5V A;  4CGZ A;  5ILV A;  3HHH A;  1CGP A;  1FBQ A;  2FF4 A;  1W5S A;  1B6A A;  4OIR F;  1D3Y A;  3K2Z A;  3Q9S A;  3IKT A;  2V79 A;  4BH9 A;  2VT3 A;  4U0Y A;  2XAQ A;  4ZYG A;  3COA C;  2XGX A;  1ULY A;  3DPT A;  2PG4 A;  4G7H F;  1XGN A;  4IF4 A;  4KMF A;  2GXG A;  4Y17 A;  3GVA A;  1ZH5 A;  2X4H A;  5CYV A;  3QAH A;  3JAM Z;  5LEJ A;  4I02 A;  4IRG A;  2GXB A;  3V7S A;  3QPH A;  3GF2 A;  4I2O A;  3P9K A;  1DPR A;  1HBX G;  2OZU A;  3FMR A;  1W5T A;  2P5V A;  4KIG A;  3VOE A;  4KDP A;  3LQR A;  2RDP A;  1SD4 A;  4EVI A;  2H6C A;  2CG4 A;  3TO6 A;  2YU3 A;  1Z1D A;  4IVN A;  2EFO A;  3DEU A;  3WTY C;  3F8B A;  5DUI A;  3ECH A;  1USS A;  3EDP A;  5HDK A;  2XAF A;  3NRV A;  3FMS A;  3JAM K;  2XHK A;  4M72 A;  2EK5 A;  4N9I A;  5FFX A;  4WWC A;  4EJT A;  1O3S A;  1PP8 F;  2ZJ2 A;  4S05 A;  5KK1 A;  3NQO A;  3F3X A;  3KP5 A;  1LJ9 A;  1T98 A;  1J7K A;  2G7H A;  4LFU A;  2FRH A;  1SD6 A;  2X0L A;  4FHT A;  3B02 A;  5AIQ A;  4KYW A;  2VBX A;  2Y48 A;  1F1Z A;  1R7J A;  4L0Y B;  4OIN F;  3V7R A;  2DPD A;  3SZP A;  2PEX A;  3R0J A;  1RZ4 A;  3KP4 A;  4LLN A;  4LJZ F;  1DDN A;  2V6C A;  2M30 A;  1GXQ A;  1QZY A;  4GGG A;  5K1Y A;  2D1H A;  2K27 A;  2QEN A;  4ESB A;  2EV5 A;  4L9V A;  2VBZ A;  3E6C C;  1OPC A;  5L3C A;  2A61 A;  3F23 A;  2WTE A;  4HAM A;  2FML A;  4IRH A;  2DK8 A;  4I7H A;  4ON0 A;  4RB1 A;  1I1G A;  2RV8 A;  5LBQ A;  2PQ8 A;  3BPV A;  3GFI A;  3Q9V A;  1UCR A;  5DCM B;  1LQ1 A;  2PFB A;  3WTV C;  3WU0 A;  3CUQ C;  5JR3 A;  1SD5 A;  4HDU A;  2O8X A;  1XMA A;  1W7P D;  1YIO A;  2HQN A;  2M8E A;  2Z3Y A;  2OQR A;  2HGC A;  4ESF A;  2Q0O A;  4O3M A;  4NHJ A;  5IT3 A;  3WE2 A;  2MA3 A;  1CF7 A;  3VB2 A;  4U0W A;  1RI7 A;  2CGP A;  1TQP A;  2KIM A;  2MLK A;  4BHP A;  3BDD A;  3ZMT A;  5ICC A;  1P4X A;  3LFK A;  1MKM A;  4FT8 A;  2KJB A;  2KJC A;  3E97 A;  3BOQ A;  4MTE A;  4CHU A;  3F8N A;  1B1B A;  3H3Z A;  3I59 B;  3DFG A;  3FF5 A;  2R3S A;  4YIF A;  3W6K B;  2GZW A;  2GA2 A;  1ZRC A;  1FP2 A;  2QQB A;  2HKO A;  4M73 A;  2CO5 A;  3W6J B;  1G3Y A;  3C1D A;  3QU6 A;  4WXC A;  3ZMD A;  3Q5F A;  2Z5U A;  3T8T A;  2L01 A;  3SXY A;  2HYG D;  1XMK A;  1FZP B;  3TKY A;  1ZHF A;  2FXA A;  4P55 A;  1C0W A;  4MTD A;  3F21 A;  2M87 A;  3WGG A;  4G94 A;  1XDU A;  4HV5 A;  3MWM A;  1MJA A;  1YLF A;  2WWY A;  4UV9 A;  3ML6 A;  3J81 Z;  4LD5 A;  2HQR A;  4GYI A;  1JHH A;  4MNU A;  3KLO A;  1FWZ A;  4WXD A;  2GAU A;  3FXR A;  2HTS A;  2PI0 A;  2EA4 A;  2XRO A;  4KT5 C;  1EH7 A;  4YG2 F;  3WGI A;  2P6T A;  1MZB A;  5L3F A;  4A6D A;  4HQE A;  1AOY A;  1BI0 A;  1TNT A;  2QLZ A;  3TDU C;  4BQA A;  3ZQ7 A;  1S8N A;  2PMU A;  4KUM A;  3J81 K;  3M8F A;  3DXJ F;  4EJU A;  1T38 A;  4K2E A;  2F5E A;  3CO7 C;  3IKV A;  1ZG5 A;  2A07 F;  1S7A A;  3ZMU A;  2P4W A;  1H9T A;  1RUO A;  4LLL A;  4WX9 A;  4M9X A;  3KET A;  1SMY F;  4R79 A;  2EFN A;  4MQ9 F;  1ZAO A;  2VBY A;  3VFZ A;  1UST A;  1PUE E;  2FSW A;  4N9H A;  4OOI A;  1IXS B;  2W24 A;  3QP5 A;  2HR3 A;  2BYV E;  2V9V A;  2BGC A;  2DW4 A;  3KP3 A;  4BHC A;  2HTJ A;  2XAG A;  5DV5 A;  1FOK A;  2P5K A;  3I54 A;  2QQA A;  4OMZ A;  3I4P A;  1HXD A;  4U7D A;  3BWG A;  1MJ9 A;  3MEX A;  4ZYH A;  4A6E A;  3SZT A;  4KMU X;  3K1M A;  1XD7 A;  5BPD A;  4LG0 B;  1OYW A;  5AIP A;  2DLL A;  3OOP A;  4EV0 A;  3MZY A;  4H0E A;  3M1E A;  5CJ9 A;  2ESH A;  3CUO A;  3FWE A;  5D4R A;  4AIK A;  2V1X A;  1EH8 A;  4KA4 A;  3LA3 A;  1G3T A;  4M71 A;  5E17 F;  2IA1 A;  5E1X A;  1R1V A;  4L9J A;  2QM3 A;  5LRS A;  2MH2 A;  1HKQ A;  1ZRF A;  2EFP A;  2H94 A;  1BI3 A;  3H92 A;  2JT1 A;  2QZ8 A;  3OV8 A;  1WWX A;  4XRF A;  1BI2 A;  4I0B A;  3WTU C;  3ZN0 A;  2LF7 A;  1FLI A;  1AWC A;  3R4K A;  4ESJ A;  5KVR A;  2HDC A;  2IT0 A;  2P8T A;  3K1P A;  1JXS A;  5ILS A;  1SAX A;  3LA2 A;  1ZGJ A;  4GO1 A;  1R23 A;  5ILU A;  2XKO A;  3FM5 A;  2H27 A;  4HF0 A;  4LGW A;  4HQM A;  1K7A A;  4AWX B;  4U7B A;  2M1B A;  2ISY A;  5D5U B;  2A6H F;  2FA5 A;  3WE3 A;  1B9N A;  4G7Z F;  5BS6 A;  5JFR A;  2NS0 A;  3P9C A;  1LDD A;  4G6Q A;  1OYY A;  2MBF A;  5E8G A;  1K79 A;  4R1H A;  3I59 A;  4IJA A;  2ELH A;  1UFM A;  3L00 A;  1FBS A;  1OR7 A;  3T8R A;  2FEZ A;  1YYV A;  1HST A;  3GYH X;  2H09 A;  2CWE A;  2YSR A;  2IJL A;  1TQM A;  4UVA A;  1J0R A;  4OIQ F;  4AD9 A;  1GHC A;  2JPC A;  1GXP A;  2BEO A;  1BBY A;  2Y0M A;  1FSH A;  3LQQ A;  4A2U A;  1J59 A;  5CVU A;  2A3S A;  4MHG A;  1TW3 A;  4RB0 A;  1KYZ A;  3GFJ A;  3S2W A;  4E70 A;  3VEP A;  3R61 A;  2D1V A;  2BE5 F;  1RNL A;  4G9Y A;  1P92 A;  5DYM A;  4A12 A;  5A2Q Z;  5BPI A;  2JPB A;  1MD0 A;  2STW A;  1BIB A;  2NYX A;  4I01 A;  1YW7 A;  1WQ2 A;  2CW0 F;  4L9N A;  3BJO A;  1O3T A;  2FBK A;  3HUG A;  1X3U A;  5HOO A;  1FP1 D;  4Q48 A;  2VOD A;  3CLO A;  1U78 A;  2Z99 A;  4ZYD A;  3O6B B;  2J5P A;  4RB3 C;  5E1W A;  2W84 A;  2IA2 A;  4XSX F;  3D0S A;  3MCZ A;  2IW5 A;  1Y0U A;  1HW1 A;  5LLQ A;  1J9I A;  1U6G A;  4U0V A;  1ZG1 A;  1R5G A;  1MDM A;  2V1D A;  2HFH A;  3KEO A;  2QWW A;  1UHW A;  3V8J A;  2PN6 A;  1H0M A;  5A2Q K;  1OMI A;  5ED4 A;  2EV0 A;  2IA0 A;  2NRA C;  2QBY B;  1YW9 A;  2NAZ A;  3IHU A;  2A69 F;  2LSO A;  2QYO A;  3K0L A;  1W7P A;  1ZG3 A;  3RPU A;  2LNB A;  3EQL F;  3L7W A;  4M9S A;  3V4G A;  4P9F A;  4I0A A;  1D8J A;  1ODD A;  3DKW A;  4L9T A;  3ZMZ A;  2B0L A;  5FD5 A;  4A0X A;  1F9N A;  3I58 A;  5F6F A;  1LVA A;  1SFX A;  5F64 A;  1YS6 A;  1K78 B;  3TO7 A;  3RDI A;  4JBA A;  4TV7 A;  3LAJ A;  4LK0 F;  4YFX F;  1SMT A;  1QNT A;  1DP7 P;  3F6V A;  2RC4 A;  4B09 A;  1PP7 U;  1IZ1 A;  1K6O A;  2YPR A;  1I27 A;  3PFI A;  4WXH A;  1RIO H;  1IXR C;  1E2X A;  1R00 A;  1KU2 A;  1ZN2 A;  4QWQ A;  5ICE A;  2FU4 A;  3F72 A;  3KFW X;  2Q2E A;  4KIC A;  1OYI A;  1P4A A;  1MGT A;  3H3U A;  3FXQ A;  2M45 A;  3FMQ A;  3LA7 A;  4P5O A;  1U2W A;  1IF1 A;  2RQP A;  1TW2 A;  1G3W A;  2XAS A;  1WKM A;  1ZLJ A;  3LWF A;  2HZT A;  3KP2 A;  2WC2 A;  3SFZ A;  1WRJ A;  3PQJ A;  4O6J A;  4RGS A;  2E1C A;  4FX0 A;  1LB2 A;  3HOT A;  1U3E M;  4IPA A;  1XSD A;  1KA8 A;  3JSP A; 
#chains in the Genus database with same CATH topology
 3FBI B;  3H9Q A;  3K1N A;  4M3D A;  4PJJ A;  3CO6 C;  2IRF G;  5EG0 B;  1D1A A;  5CVJ A;  4IRI A;  3WTX C;  3HSE A;  2DA4 A;  4M9Z A;  2VJJ A;  1I6X A;  2VON A;  2QQ9 A;  3HYI A;  3DU5 A;  2DDB A;  2LC2 A;  5H6Q A;  3KYC B;  4XLH A;  3EUH A;  2JVH A;  2HOA A;  3IH4 A;  3QP6 A;  5HDG A;  3S3N A;  2K7L A;  4MEX F;  2EIK H;  3GBG A;  4EJV A;  3H1C A;  4BXF A;  2R7D A;  2Z9O A;  2OCE A;  4IQ4 A;  1YOV B;  2ZFW A;  4M6Y A;  2AS5 F;  2L7F P;  1XSV A;  2F5C A;  2HOE A;  1WZ2 A;  1S9H A;  3ZCO A;  1A31 A;  3HRU A;  2MD5 A;  1UHS A;  5D5X B;  1HW2 A;  1ON1 A;  5HS8 A;  3DP7 A;  4QPQ A;  3IWF A;  1G8X A;  2V1U A;  2W48 A;  3TW6 A;  4O5V A;  3BY6 A;  1TL8 A;  1JE8 A;  2DMN A;  3LSJ A;  4MQV A;  3CES A;  4AUX A;  2DFI A;  4EGZ A;  2ZME A;  3ABM H;  1JTY A;  5CVR A;  5FD6 A;  2C6Y A;  2L3D A;  1UAA A;  2OTJ I;  4Q4Z F;  2XAJ A;  3CCE I;  2B63 J;  2FE3 A;  2JRM A;  2A5Y B;  2JTV A;  3V8K A;  1BR1 A;  4ZYA A;  3I4N J;  2M9H A;  2DQL A;  2NOJ B;  1ZGW A;  2YUS A;  3D1N I;  5DM7 F;  2FX0 A;  5LHH A;  2L4A A;  4A5N A;  3S1M J;  1HW5 A;  3WOD F;  4CYD A;  2A6E F;  4EGY A;  4PGH A;  3CC7 I;  2DI3 A;  1XGS A;  1R58 A;  4QTR A;  2R0Q C;  5HLT A;  4NBQ A;  3MAJ A;  5FO5 A;  4ZTJ A;  2M4K A;  2VBW A;  4Y13 A;  4RGX A;  5H2F C;  2DO7 A;  4HX7 A;  1QO0 D;  2KIF A;  5ICF A;  1HQC A;  1AKH A;  1B59 A;  2RNJ A;  2CFX A;  4G7O F;  1QGP A;  3TO9 A;  3WHC A;  1VQ4 I;  3BTJ A;  2XKP A;  1X4P A;  3IWZ A;  4EM1 A;  1UZC A;  3T0Y A;  1X3W B;  4OIP F;  1OIS A;  1UB9 A;  5IP6 A;  5JLW A;  3E3V A;  3MZ8 A;  3CME I;  4ENN A;  3QOD A;  4RGU A;  1MBF A;  1OCC H;  2GQQ A;  2KLO A;  2E7X A;  3M8J A;  4FIS A;  3IAS 2;  1O7F A;  3CCV I;  1KQ9 A;  5D5V B;  2L2O A;  3GX4 X;  4DYR A;  4UUS A;  2V6E A;  1Y1V J;  5FKM A;  2VXZ A;  3NAR A;  3F8M A;  5LEK A;  1QU3 A;  5EZH A;  1FX7 A;  3GTK J;  1OLT A;  3S3O A;  2QUF A;  1SFO J;  4XLE A;  3K4J A;  3F0C A;  4PUS A;  2VE9 A;  4G8X A;  2N8G A;  1U8R A;  1SVM A;  3ERM A;  3LAP A;  1ZR4 A;  1GT0 C;  2VOO A;  5LHI A;  3TOA A;  2WV0 A;  2EIJ H;  3RPQ A;  3IC7 A;  2Y2Z A;  2J5O A;  4A0Y A;  2LOO A;  2ELJ A;  4PCQ A;  2KDO A;  4A5M A;  3I0T A;  2XSD C;  2R7R A;  1IN5 A;  4CDG A;  3ZQI A;  4OU0 A;  4C9Y A;  4WCG A;  3MKY B;  3S2D J;  1U5T B;  3ZR8 X;  4ASN A;  3JRH A;  2P5L C;  1LPQ A;  4JX6 A;  1I1S A;  1T2K A;  1Y8R B;  2BY0 A;  1O57 A;  1R71 A;  1J09 A;  3CCJ I;  3FKI J;  3AAF A;  5FKN A;  3L09 A;  1TWF J;  1QHG A;  3GFL A;  1EV7 A;  2P7V B;  3CCL I;  3O8H A;  2BHY A;  2OAZ A;  2E1N A;  3BLY A;  4HPQ A;  5D8L B;  1X58 A;  3CC2 I;  3I4M J;  3R60 A;  4NQW A;  3SYT A;  5FLM J;  3K70 C;  5CVI A;  2IPQ X;  4Q47 A;  4CZC A;  4HLX A;  3V8L A;  4OMY A;  4UVB A;  2FNA A;  1BC7 C;  2E5N A;  2DA1 A;  4XBF A;  5TJJ A;  2EFQ A;  2K86 A;  2VAS A;  5FRN A;  1QPM A;  1LEB A;  4HA8 A;  1SD7 A;  2LF8 A;  1QVT A;  4XKW A;  3L2C A;  1UG2 A;  4L5I A;  2L5Q A;  3I71 A;  3LMM A;  4IOA F;  1YJW I;  4BHB A;  4CCO A;  4FTH A;  4FET A;  1R1U A;  2DBB A;  1G2H A;  4BYY A;  2EZI A;  3KZY A;  2Z33 A;  3A0H C;  2I8D A;  3RKY A;  3S2H J;  5D4S A;  3H35 A;  2M5W A;  2QSG X;  4GCV A;  5J4Y A;  4C3H J;  2ZXJ A;  2M34 A;  4PFP A;  1Z7U A;  2R92 J;  5DCF A;  4I6Z A;  2QBY A;  5L3G A;  1TZL A;  2O61 A;  5IY5 H;  2WY8 Q;  3E5X A;  1T39 A;  5ICG A;  1STZ A;  4HNV A;  1RRJ A;  2Y75 A;  1QVU A;  3RYP A;  4NB5 A;  1JUM A;  2AXT C;  1A36 A;  2CV2 A;  3BP8 A;  2LKX A;  2D45 A;  2NVX J;  3RYR A;  3EYI A;  2XAH A;  2CW7 A;  4PJN A;  5JHU A;  4ZTF A;  4FCY A;  4AYB A;  3HOU J;  2FNP A;  3B6A A;  4RAZ A;  2QF7 A;  2HEO A;  4Y15 A;  2FOW A;  2P81 A;  5K7Z A;  2E2H J;  3RKW A;  3G2B A;  4BGD A;  1ZYR F;  4MEY F;  2JZY A;  3CDH A;  5H20 A;  2KIQ A;  3VOD A;  1ZTR A;  2VI6 A;  3ULQ B;  3QRF F;  2WAQ N;  1K78 A;  2O03 A;  5L3D A;  2E5Z A;  3G1L A;  4F7Z A;  2K02 A;  2JA7 J;  3GTQ J;  1J75 A;  1N25 A;  1KU7 A;  2K4B A;  3SHF A;  2V1N A;  2XPV A;  3BJ6 A;  4QSH A;  3WU1 B;  1ETV A;  3CTA A;  1G4D A;  3J7A O;  2PBI A;  5JLX A;  2DYR H;  2XRN A;  3PNV A;  3RTR A;  1F4K A;  5D5W B;  2VPR A;  4A3L J;  1WJC A;  3HOV J;  1IUY A;  1OCZ H;  5DCM A;  3FXL A;  5AON A;  1NK3 P;  2PMZ N;  3E6M A;  1Z6R A;  2K40 A;  3ZXS A;  1V5E A;  1ONV A;  3SEQ A;  3R6S A;  3JRC A;  2V9K A;  5LGU A;  4PZJ A;  4Y7N J;  2CJJ A;  3BT9 A;  5CQE A;  3BPX A;  1GUU A;  2NS7 A;  3JTG A;  3F8F A;  1ITY A;  2LD5 A;  4RAY A;  1BI1 A;  3E5Q A;  1A35 A;  2AXL A;  3C2B A;  5J8C A;  3K70 D;  4MGR A;  2CV1 A;  4ZH4 F;  1S7O A;  4A3G J;  1A6Q A;  1RET A;  2ZXW H;  4G6T B;  2LDU A;  2P6S A;  4X1E A;  1YTY A;  3CUQ B;  4DYC A;  2ZBK A;  3K69 A;  3SDG A;  3DTK A;  4BE2 A;  3ELK A;  1RR8 C;  4I09 A;  4WK8 F;  1VQO I;  4UVC A;  5BMZ A;  3KE2 A;  3OR2 C;  1GVJ A;  5DD8 A;  1IAW A;  2X48 A;  4JYK A;  1XN7 A;  2VIX A;  2L02 A;  3D5R C;  3HB9 A;  1T56 A;  4XLF A;  5J8F A;  1P4W A;  2QKM B;  3CMA I;  3DEE A;  3TED A;  2WAD A;  3GFM A;  3ZMS A;  1XSX A;  3H3V K;  2DT5 A;  4JK1 X;  3DKY A;  5HS9 A;  2TDX A;  1I3A A;  4J01 A;  2RGV A;  4XL9 A;  1PVE A;  1V54 H;  1L3L A;  1YX5 A;  2ZB9 A;  2ZSH B;  1FIA A;  4B4C A;  4EAT A;  5BQT A;  1YS7 A;  3VYT B;  3ZQG A;  4RMN A;  5FKO A;  4LB5 A;  4UHT A;  1W5C C;  2CMP A;  3QYB A;  1O7L A;  4E7S A;  2IGO A;  1K61 A;  3DV8 A;  4HX8 A;  2HU9 A;  4CIC A;  3S1Q J;  4XLN F;  1O3Q A;  1JHF A;  2DA7 A;  2XPW A;  3PIP F;  3IRQ A;  5M5W J;  6PAX A;  3BG7 A;  3EET A;  4E7H A;  3QU3 A;  4UXN A;  4KIS A;  3OYH A;  3I53 A;  3GXO A;  2IBD A;  5IOY A;  1OQY A;  2OQG A;  2LRD A;  4DBQ A;  2STT A;  2A5W A;  2DOA A;  3H0D A;  1JGS A;  5IT9 Z;  2XGC A;  4KFC A;  4A93 J;  2KRC A;  3HRT A;  1TQI A;  4UUT A;  1VTN C;  3AL0 B;  1WJB A;  2FMY A;  2PMH A;  1FOX A;  1P6R A;  3ROU A;  2LTP A;  5E20 A;  4UNO A;  2IP2 A;  4C2M J;  3OL4 A;  1YFH A;  3A02 A;  3ABU A;  3DTI A;  3RQI A;  3CCS I;  3QYF A;  5FKL A;  4LLG F;  2HYF A;  1D0X A;  1R5H A;  1TWC J;  1LDJ A;  5LGT A;  2KFD A;  1XC5 A;  3VWB A;  4KJZ A;  5M5X J;  2AQF A;  3E6D A;  1BOA A;  3DKX A;  2E7W A;  2R7Q A;  4F3Q A;  5BOX A;  2L4M A;  2E1M B;  1NG7 A;  4E7I A;  2COM A;  1TLH B;  4EM0 B;  3WG9 A;  5B66 C;  3DQV C;  4IHS A;  4L5E A;  1BL0 A;  3R0A A;  1E0E A;  2G7U A;  2BVL A;  2R7Z J;  5E8I A;  3WTZ A;  2GA1 A;  2YR2 A;  1WFX A;  3LST A;  2MYS A;  4P9U A;  1HOM A;  2H8R A;  2Y9Y A;  4QLC U;  3GTG J;  3WTT C;  5GTI C;  3H9G A;  1WI9 A;  3I9V 2;  3QQA A;  3PO2 J;  4E7K A;  1WI3 A;  5HLI A;  4YFK F;  3BR3 A;  1CQT A;  2LY9 A;  4PGG A;  4BAC A;  2R5Y B;  4AIH A;  4GDF A;  2X1E A;  1IW7 F;  2VKE A;  1RR7 A;  2D5V A;  3C3W A;  1KGS A;  3I3L A;  4N0B A;  2JA8 J;  2BVM A;  2VT2 A;  3RI4 A;  5IT9 K;  1FTT A;  1U5T C;  2ZNY A;  1ENH A;  3G1M A;  1JJ6 C;  1Z05 A;  1JUP A;  2DFF A;  1X3Z B;  1JT6 A;  3JCU C;  2DPU A;  5J1Y A;  3J80 Z;  1FYL A;  1XDS A;  2DMT A;  3QWL A;  4IHW A;  4CZZ A;  2EJR A;  4YII A;  2HXO A;  1YJN I;  2E2I J;  1R9T J;  2KIS A;  1R4M B;  2O6G E;  1J5Y A;  4W1U A;  2JA6 J;  1TT0 A;  1XS9 A;  1S29 A;  4LG3 A;  4RGR A;  2FOK A;  5E3N A;  4GRI A;  1W36 D;  1BN5 A;  4AIJ A;  2KIU A;  2CQX A;  4XKB A;  1FOW A;  4E7J A;  3FDY A;  4PJ0 C;  2PMZ A;  2E1O A;  4LIT A;  1Q1H A;  3BZ6 A;  2ZC2 A;  4CUG A;  5HLG A;  1FBU A;  4PSW A;  2BBY A;  1W1W E;  2LBF B;  3EUA A;  5IPA A;  3GUD A;  1VFC A;  1U5T A;  4ETS A;  2HS5 A;  2OD5 A;  3FX3 A;  4IXA A;  3ZQC A;  1BW5 A;  3IUO A;  2H6B A;  4HYE A;  4XLP F;  3GW2 A;  4CCK A;  2CQK A;  2DU9 A;  1R49 A;  2NNN A;  1T6S A;  5JI6 A;  4BNC A;  4EM2 A;  3GTM J;  2Y31 A;  3V7C A;  3J80 K;  2CS3 A;  5E3O A;  5FLV A;  4DW6 A;  1ETO A;  5E3M A;  1SFE A;  2ESN A;  3TMO A;  3G3Z A;  3GO5 A;  1IN6 A;  1U9N A;  3DPL C;  5K5R A;  4JOM A;  2EFW A;  2MC3 A;  2W82 A;  2FQ3 A;  2AQE A;  3QOP A;  1IDZ A;  2JA5 J;  4A3C J;  1L0O C;  5J3L A;  3K4C A;  1U9O A;  4ZZD A;  2FUG 2;  2L54 A;  4BE1 A;  4G6D A;  2K3P A;  1S3J A;  4M74 A;  4D9J A;  5CLS A;  4BQO A;  3G73 A;  3N4M A;  2R7O A;  3U9G A;  1DUX C;  1XCB A;  4UUV A;  5DUK A;  5B1B H;  2M3A A;  3RKX A;  1WSU A;  2PJR B;  1BOB A;  4KNY A;  3QOE A;  4BJT A;  3BRO A;  1IXC A;  2K9Q A;  3BR6 A;  2OZ6 A;  2DTZ A;  5FFZ A;  3M1C A;  1DU0 A;  4U88 A;  1YI2 I;  1IN4 A;  4LG0 A;  2KRF A;  1HKT A;  3U1D A;  4W97 A;  3GEZ A;  3U2R A;  2CU7 A;  1APL C;  5DS9 A;  1XCV A;  3ZOB A;  3HG9 A;  3VYS B;  2ZO4 A;  2ID3 A;  1BA5 A;  3M07 A;  1ZRE A;  4ENJ A;  1GDT A;  4DNC A;  4M6X A;  4HW0 A;  4ENK A;  2XF7 A;  1QQI A;  3LSP A;  2F6C A;  2O0Y A;  3KCC A;  2WB1 N;  2RKH A;  3ASN H;  2F2E A;  4CYC B;  2XPU A;  4B48 A;  4RM3 A;  4YFN F;  2XGE A;  1JKR C;  2DK5 A;  2F5D A;  1YW8 A;  1EKE A;  3HSR A;  3TP3 A;  1PUF A;  3BZC A;  3ZPL A;  3FZV A;  1R22 A;  2RVC A;  5J47 A;  2LG4 A;  2D2W A;  2GIV A;  2E2J J;  3P9I A;  1F5T A;  2M2E A;  1KU3 A;  2HOS A;  2FBI A;  3EUH C;  2ZNZ A;  4Y33 A;  1B4A A;  1NTC A;  5HDN A;  1LNW A;  2GWR A;  5D8K B;  3ZQH A;  3CCY A;  3ECO A;  1IRZ A;  3M7G A;  4AVP A;  3JR9 A;  2DA5 A;  4LIU A;  2VOP A;  1AU7 A;  1Y56 A;  1NHA A;  1R5I D;  2BW3 A;  3BR2 A;  3NAU A;  3ABT A;  3S17 J;  3TGN A;  4GXO A;  1E17 A;  5K5Q A;  2R5Z B;  3ISP A;  2RRE A;  3SQN A;  1T95 A;  3L9F A;  5C3E J;  4C3J J;  1Z6T A;  1RUN A;  1SFU A;  4LK1 F;  3ERE D;  3OYJ A;  4HV6 A;  2JJ7 A;  1V4R A;  2KKO A;  2Z1D A;  5D6F A;  3BG5 A;  3MZH A;  4II2 A;  2RNG A;  4RBO A;  1QBJ A;  3P5J A;  5FB2 A;  2UUZ A;  5HVQ C;  2DMU A;  3JRE A;  3FIW A;  4RLQ A;  2OPT A;  1ZRD A;  2DJN A;  2QCO A;  1KU9 A;  3E6B A;  1BJA A;  1N75 A;  1NG6 A;  4RAG A;  3KX2 A;  1N78 A;  4FE7 A;  4LB6 B;  2W85 A;  1B72 B;  4DIQ A;  3W2V A;  1FPQ A;  3CUQ A;  3WTS C;  3OYF A;  2QVO A;  1OKR A;  2DQR A;  2EIM H;  1FSE A;  5F1R A;  1LDK B;  1Y39 A;  1WJF A;  5EEG A;  3JSO A;  2G9W A;  2F5F A;  4S04 A;  3GZ6 A;  4BY1 J;  1T8I A;  3E0J B;  1YG2 A;  1LE8 B;  1T33 A;  4HBL A;  3KEQ A;  2XSJ C;  2RN7 A;  5FRO A;  1KON A;  3C7J A;  4RLF A;  1X2N A;  4WF2 A;  2ZKZ A;  1IRG A;  4KIF A;  4NC8 A;  3OIP A;  1YO5 C;  3O8G A;  3PQK A;  2WA0 A;  1LFU P;  2GOM A;  2W4S A;  1POG A;  4ABZ A;  3ZRG A;  4FE4 A;  2Q8K A;  2WV1 A;  3AFH A;  3HRS A;  1XB4 A;  3A0B C;  4KN4 X;  5FLX Z;  1R1T A;  3FHZ A;  2E1M C;  2X6Y A;  1IV6 A;  2P7C B;  4C2T A;  3A1Y A;  4L0Z B;  3N97 A;  2MAB A;  5JVT A;  4CO8 A;  1TBX A;  1FYM A;  4DOZ A;  1HSJ A;  3ZN1 A;  4II3 A;  2EPF A;  2IVM A;  5JHF A;  3OIO A;  3S1R J;  4KIB A;  3JRA A;  4J00 A;  3JTH A;  1W4M A;  2ZCW A;  2CUE A;  3HSF A;  1VQL I;  2YX7 A;  1RKT A;  2UXN A;  3FK7 A;  1IV8 A;  4KT6 A;  3F8C A;  3IRR A;  2BV6 A;  4P96 A;  2MLG A;  3A4C A;  5DEQ A;  1K4T A;  1FTZ A;  4HDV A;  4XR6 A;  2W57 A;  2EB7 A;  3CD6 I;  2XIG A;  3HHG A;  3OIQ A;  2B9S A;  2CH0 A;  1IN8 A;  2K9N A;  5J6X A;  1TP4 A;  3DPU A;  3ZMV A;  4B8X A;  2JN6 A;  3JW4 A;  3O3K A;  2IGN A;  4CA0 A;  1WVR A;  2UZK A;  4PK4 A;  3BG9 A;  1VQ7 I;  4A0Z A;  2G0E A;  1BM9 A;  2FJ1 A;  4CCN A;  3HOS A;  3C18 A;  1WHU A;  1HLV A;  2E35 A;  1SFK A;  2VLA A;  3OYN A;  1F36 A;  1EH6 A;  3KZZ A;  1Z3Y A;  4CXF A;  2LVS A;  5B5E C;  1G3S A;  2HVQ A;  3SDB A;  2X1C A;  5LHG A;  5HLH A;  3O2P E;  5L3B A;  4BXX J;  1REP C;  2EQR A;  1FC3 A;  5K7F A;  5FLX K;  1UJ8 A;  2CRG A;  2OU2 A;  3LFU A;  5IP7 J;  1P2F A;  2EV6 A;  2W1O A;  3S1N J;  3BCB A;  4BXU A;  4R8H A;  3TQN A;  2ME6 A;  4EQQ A;  1A04 A;  5IYB J;  3ASO H;  3TOB A;  2CW8 A;  1JKO C;  4HLY A;  4HOB A;  3S16 J;  1UHM A;  1LKX A;  1EJ9 A;  2ZSI B;  1V55 H;  1EF4 A;  3BG3 A;  3FXU A;  3MD2 A;  5DD4 A;  4FX4 A;  2AO9 A;  3MMY B;  2UXX A;  2WB1 A;  1TTY A;  3C2H A;  1DGW Y;  2VJ5 A;  4IZZ A;  2EA2 A;  4XLC A;  3WGH A;  4CCL A;  2QEX I;  2ZJQ F;  5H6R A;  1LEA A;  1FY7 A;  4EJW A;  4DBR A;  4QIW N;  1B8I A;  4BS9 A;  5DDG A;  5FGM A;  2R7F A;  2WAF A;  2A68 F;  2XUB A;  4DQ2 A;  2YX4 A;  4E6K G;  5J40 A;  1K6Y A;  4D7N A;  3FM3 A;  1ZGA A;  3T5X A;  4UV8 A;  1UMQ A;  3CJT B;  2XDV A;  4RS8 A;  4PDK A;  3OYK A;  2VQG A;  4AU7 A;  3BR5 A;  5D6E A;  3N05 A;  3HTS B;  4HZF A;  1ZLK A;  1VQ9 I;  2R7V A;  1FYK A;  1V3F A;  2L0K A;  2TCT A;  1VI0 A;  2VN2 A;  4ENM A;  1MDM B;  3WTW C;  3CJN A;  3HEF A;  1M1E B;  2H1K A;  2BHZ A;  4I98 B;  3A2K A;  3EYY A;  1HKS A;  3J7A Y;  3HIF A;  3UNG C;  2EWN A;  4JQF A;  2AHQ A;  3SFI A;  2RQQ A;  4NUB A;  2HWV A;  1Z9C A;  3HPG A;  4Q5S F;  2VKH A;  1W7P B;  2HKX A;  2QSF X;  2O3F A;  1J2X A;  1RES A;  2K9L A;  3TW7 A;  2K4J A;  2JRT A;  1IRF A;  2OC6 A;  3K6G A;  1ON2 A;  5LGN A;  1IN7 A;  1DU6 A;  3DBL B;  4XSZ F;  2IS6 A;  3G6E I;  3KP6 A;  3L1P A;  5L3E A;  3K9T A;  1E3H A;  2DT7 B;  3I64 A;  3HTU A;  3ZQF A;  5BNG A;  5F0H A;  3DF8 A;  2JK3 A;  5J4V A;  5C44 J;  3J7Z I;  5JVG F;  3IV5 A;  2PLY A;  5EDN A;  4B1R A;  4HNU A;  2CYY A;  3CF2 A;  2X1D A;  4L5J A;  1IC8 A;  4HF2 A;  3MFK A;  1B9M A;  4M3F A;  1YJ9 I;  4IHV A;  3HBL A;  4ZZL A;  3RIR A;  2ETH A;  1BW6 A;  2CFO A;  1TNS A;  1HDP A;  3G4S I;  4ZYE A;  2K85 A;  3I5U A;  2MC4 A;  1JGG A;  3HRM A;  1Y6I A;  4CCJ A;  2DMQ A;  3BG6 A;  1R36 A;  2K9M A;  1Z91 A;  3F6O A;  3D5L A;  1V5G A;  3Q0W A;  4RB2 C;  4XRM A;  3GZ5 A;  3IAM 2;  2L9S A;  3OYA A;  1JKQ C;  4IHT A;  1PDN C;  3FXK A;  3LL7 A;  2ADU A;  2PJR A;  3BQY A;  3B73 A;  4OIO F;  3JRG A;  4HX4 A;  3S3M A;  3F22 A;  3ZQL A;  4BDZ A;  1T0F C;  4Z6Y A;  2XVC A;  3OYD A;  2VC1 A;  4EMS A;  1KYW A;  1ZK8 A;  2JSC A;  3IL2 A;  1X1D A;  3OMY A;  2OBP A;  4EJO A;  3K4K A;  1H9G A;  2M7A A;  3S32 A;  2FBH A;  5HS7 A;  3QPT A;  3M9A A;  4LMY A;  4D0P A;  2W25 A;  1I39 A;  3KLN A;  3Q3S A;  2Q2E B;  3MKW B;  3T1B A;  2BXY A;  1FMV A;  5E1Z B;  1G6N A;  2JUG A;  3BJA A;  4CYC A;  2UWM A;  3P7N A;  1Y1W J;  5IYD J;  5DTD A;  2OA4 A;  2O9L A;  1O4X A;  1CF7 B;  1KQ8 A;  4HF1 A;  4GYG A;  2R93 J;  4UB8 C;  1DQU A;  1ZAR A;  2DOE A;  2EZH A;  1FNN A;  3DLL F;  2DTR A;  2ISZ A;  3L2R A;  2ECB A;  1XGM A;  3MKL A;  1IJW C;  4V2G A;  2DN0 A;  2ZJR F;  1X1P A;  4FQG A;  1S6L A;  3TDZ C;  4BAY A;  2ACJ A;  1T0F A;  1BC8 C;  5TGT A;  1GV5 A;  2I10 A;  3RSN A;  3M8E A;  3ZP5 A;  3NEU A;  5TRD A;  2TRT A;  1D8K A;  2NNY A;  1KQ0 A;  2F4O B;  1D1C A;  2R5Z A;  1DPU A;  4J19 A;  3REO A;  1FT9 A;  1IRX A;  5E18 F;  1O3R A;  2NS8 A;  2PX9 A;  3RJP A;  3H5R A;  4IO9 F;  1XGO A;  3E5U A;  3NWT A;  2E60 A;  2ELK A;  2QKL B;  1P7I A;  3OS0 A;  4OWR B;  3CQZ J;  1QZZ A;  2DAO A;  1VQP I;  2VC0 A;  4XLA A;  2GOX B;  5EEH A;  5K5O A;  1MSE C;  2PJP A;  5KNL A;  3OYE A;  3KP7 A;  3S8P A;  1SVO A;  3GLX A;  5EG0 A;  2CSO A;  3GTJ J;  2LKP A;  4F93 B;  1W36 C;  1WJA A;  2XV4 S;  1MJB A;  5CVV A;  4KN7 X;  5LRR A;  2DFH A;  3MQ0 A;  1BIA A;  2CQN A;  2VUM J;  2VE8 A;  4XIC A;  2E71 A;  1I5Z A;  4CSW A;  5GTH C;  3OYL A;  3GWZ A;  1YQA A;  2W00 A;  3K10 A;  3FXM A;  5ERI A;  2XB0 X;  4E7Z A;  1MIJ A;  4M3B A;  4XRS A;  2ZME B;  2MH9 A;  1MH4 A;  4Z2Y A;  4L18 B;  1D5V A;  3FK6 A;  4CGZ A;  5ILV A;  1Y0N A;  2CUJ A;  1WH7 A;  2H1L A;  2LP0 A;  3HHH A;  1CGP A;  4A69 C;  1Y8Q B;  1FBQ A;  4OAZ A;  3QYE A;  2FF4 A;  2KHM A;  1Z7L A;  1W5S A;  5CKT A;  1B6A A;  4KIT B;  3A01 B;  4OIR F;  1D3Y A;  2GBY A;  3K2Z A;  3Q9S A;  2L9N A;  2OUM A;  1ACI A;  3IKT A;  2V79 A;  4BH9 A;  1WPK A;  2VT3 A;  1T08 B;  2XAQ A;  4U0Y A;  1HCR A;  2LK2 A;  4ZYG A;  4RM2 A;  4F55 A;  3COA C;  5EGO B;  3BC8 A;  2LFB A;  5GAH J;  3GTO J;  2XGX A;  3OOU A;  2B7E A;  2F4M B;  3PJR A;  1AKH B;  3DLA A;  1ULY A;  2IEK A;  4A3E J;  3DPT A;  2PG4 A;  4S0H B;  1LUJ B;  4G7H F;  4ZJZ A;  1XGN A;  3LOC A;  2DFE A;  4IF4 A;  2JA2 A;  4KMF A;  2GXG A;  3LSG A;  4PJL A;  5KAF C;  4Y17 A;  5HNF A;  3GVA A;  1ZH5 A;  2X4H A;  5CYV A;  5B3S H;  1ZKG A;  3QAH A;  3JAM Z;  5LEJ A;  4I02 A;  4IRG A;  2VPL A;  2GXB A;  3V7S A;  3X2Q H;  3QPS A;  3QPH A;  3GF2 A;  3ESW B;  2VQH A;  4B3X A;  3PM1 A;  4I2O A;  2KMU A;  4HST A;  3P9K A;  1DPR A;  1HBX G;  2KT0 A;  2OZU A;  2F4I A;  1W5T A;  2P5V A;  3FMR A;  4KIG A;  3VOE A;  4KDP A;  1PYV A;  1FMW A;  3LQR A;  2RDP A;  3W3C A;  2WAQ A;  2LR8 A;  2HPI A;  2XF6 A;  1SD4 A;  2EZK A;  4EVI A;  2ID6 A;  2H6C A;  2CG4 A;  3TO6 A;  3HOW J;  1D0Y A;  2YU3 A;  4D1Q A;  1Z1D A;  3DU6 A;  4IVN A;  2EFO A;  3DEU A;  3WTY C;  3F8B A;  1YRN B;  1Z0X A;  3GME A;  5DUI A;  2RAE A;  3ABL H;  2HZD A;  3KYL A;  3ECH A;  4IL6 C;  1USS A;  3EDP A;  5HDK A;  1MSF C;  2XAF A;  1VND A;  3NRV A;  2HVS A;  3FMS A;  3KPH A;  1Z3X A;  2R4G A;  3JAM K;  1AHD P;  1K4S A;  4NQW B;  2XHK A;  4IOC F;  4M72 A;  1LVK A;  2EK5 A;  4N9I A;  4YEL A;  5FFX A;  4WWC A;  4EJT A;  1MMG A;  3OSF A;  1O3S A;  1PP8 F;  2ZJ2 A;  3FXO A;  4S05 A;  5KK1 A;  3NQO A;  3HKZ N;  3F3X A;  3KP5 A;  2X85 A;  1LJ9 A;  2KDZ A;  1T98 A;  1X1A A;  1Z21 A;  1J7K A;  1VQ5 I;  3CCU I;  2HQA A;  4B44 A;  2G7H A;  4LFU A;  3OYI A;  1OCR H;  1IUF A;  3B6C A;  2FRH A;  1SD6 A;  2X0L A;  3SZG A;  3M4O J;  1ERD A;  4BE0 A;  4FHT A;  2OTL I;  3B02 A;  5AIQ A;  4KYW A;  9ANT A;  5F04 A;  2VBX A;  3OS2 A;  1WJE A;  1D1B A;  2Y48 A;  1JJ8 C;  2KZV A;  1F1Z A;  1R7J A;  2DOD A;  4XON A;  2CUZ A;  4YRV A;  4L0Y B;  3H5A A;  4OIN F;  2Y30 A;  3V7R A;  3CMM A;  2DPD A;  1HA8 A;  1MMN A;  1YX3 A;  2DYS H;  2PEX A;  3R0J A;  3SZP A;  3HOZ J;  4BKX A;  1RZ4 A;  3KP4 A;  3CMY A;  4LLN A;  4DJA A;  4LJZ F;  2YU9 J;  5LFA A;  4NC6 A;  4PFO A;  1DDN A;  3H9J A;  2V6C A;  1MBG A;  2M30 A;  2YS9 A;  1GXQ A;  1QZY A;  4GGG A;  3CF5 F;  2E36 A;  1MBE A;  2D1H A;  5K1Y A;  2K27 A;  2QEN A;  4ESB A;  1OJL A;  2FD5 A;  4A3K J;  2KPM A;  1WH5 A;  2EV5 A;  4Y52 J;  4L9V A;  2VBZ A;  3E6C C;  4A3I J;  4I76 A;  1OPC A;  1TC3 C;  5L3C A;  3HL2 A;  1SAN A;  4E4H A;  2ICW G;  2X51 A;  2A61 A;  5EJC A;  3F23 A;  2WTE A;  1BR4 A;  4HAM A;  3FHN A;  2FML A;  4PSX A;  3HJE A;  4JX4 A;  3WG7 H;  1HC8 A;  2V4J C;  4IRH A;  3JRF A;  2DK8 A;  4XM3 A;  4NNJ A;  1OFC X;  4I7H A;  3L2Q A;  4ON0 A;  2GXA A;  4RB1 A;  1I1G A;  5CQG A;  2RV8 A;  5KHD A;  1A6I A;  4RAF A;  3FBN B;  5LBQ A;  2PQ8 A;  3BPV A;  1W0U A;  2Y0S N;  3GFI A;  3Q9V A;  1UCR A;  5DCM B;  1LQ1 A;  2PFB A;  2JMW A;  1U0J A;  3WTV C;  3W2A A;  3WU0 A;  3CUQ C;  2KQR A;  5JR3 A;  1SD5 A;  1Z67 A;  4HDU A;  2O8X A;  1XMA A;  2V9P A;  3K7A J;  1W7P D;  3RPU D;  3JRD A;  1YIO A;  3GZN B;  2HQN A;  2M8E A;  2Z3Y A;  2OCC H;  2OQR A;  2DMP A;  2LY1 A;  5GAE J;  1K83 J;  2OV7 A;  2DT6 A;  5GPA A;  2X6O A;  4AC0 A;  2EZL A;  2HGC A;  3PUB A;  2DXI A;  3K4L A;  4ESF A;  1YIJ I;  1OCO H;  3LSM A;  2Q0O A;  4AVZ A;  4O3M A;  3PNY A;  2V7F A;  3LSH A;  3OYG A;  2BY3 A;  4NHJ A;  4LOC A;  2HVR A;  2BXZ A;  1Q1V A;  5IT3 A;  1WJ5 A;  3WE2 A;  3V42 A;  5K7H A;  2R7T A;  3ZQQ A;  2QGU A;  2MA3 A;  4NDL A;  3VB2 A;  5IOZ A;  1CF7 A;  2K3F A;  5IP9 J;  4U0W A;  4BY7 J;  1UG0 A;  1RI7 A;  2CGP A;  3CP2 A;  1TQP A;  2UV1 A;  5CPR B;  2ME0 A;  2KIM A;  2MLK A;  4BHP A;  5F1J A;  2R7W A;  5C4X J;  1X2M A;  1Z77 A;  3BDD A;  3W6V A;  3ZMT A;  5ICC A;  2K5C A;  1TWH J;  1P4X A;  3LFK A;  4PJM A;  3OYC A;  1MKM A;  2DJI A;  2HQ5 A;  4FT8 A;  4RDU A;  2KJB A;  3AL0 C;  3KZI C;  2KJC A;  3E97 A;  4A3M J;  2NOG A;  1QHH D;  2LYC A;  2ZXH A;  3BOQ A;  4MTE A;  4CHU A;  3F8N A;  2CQ7 A;  3GTP J;  1B1B A;  1WJD A;  3H3Z A;  1DP3 A;  3I59 B;  3DFG A;  3FF5 A;  3G71 I;  2QA4 I;  1RKW A;  2R3S A;  4YIF A;  2GM4 A;  3CLQ A;  3D5S C;  3W6K B;  4UY8 I;  2GZW A;  2GA2 A;  1SEU A;  2WBM A;  1NH3 A;  1FP2 A;  3UKG A;  1ZRC A;  4AYB N;  2QQB A;  2HKO A;  4M73 A;  2CO5 A;  3MN2 A;  3W6J B;  3BQZ A;  1GLN A;  5FKK A;  1G3Y A;  1S7E A;  3C1D A;  3QU6 A;  3RZD J;  4WXC A;  1PJR A;  2VKD A;  3CDI A;  3ZMD A;  5J1U A;  3HKZ A;  3Q5F A;  2Z5U A;  4F91 B;  4BQN A;  3T8T A;  1P9Q C;  2L01 A;  3IH2 A;  3SXY A;  2HYG D;  1HF0 A;  1XMK A;  1FZP B;  1TWG J;  3TKY A;  2DCE A;  3E1S A;  1ZHF A;  2FXA A;  4P55 A;  1JT0 A;  1C0W A;  2JSP A;  3S15 J;  2VQL A;  4MTD A;  3F21 A;  4X0G A;  2M87 A;  5FRM A;  1UEL B;  5F08 A;  3WGG A;  4G94 A;  3A01 A;  4A3D J;  4M6V A;  1XDU A;  3GLL A;  5KCM A;  4HV5 A;  1MND A;  1OCP A;  2OJE D;  3MWM A;  3U1K A;  3UR3 C;  4ZDP A;  1MJA A;  1YLF A;  3G1O A;  4M3E A;  3HC7 A;  2WWY A;  2EIL H;  4UV9 A;  3ML6 A;  3J81 Z;  2KP6 A;  5EGO A;  4G12 A;  4LD5 A;  3PL8 A;  2HQR A;  4GYI A;  3TBI A;  1JHH A;  2DA6 A;  4MNU A;  2ZXI A;  4OAY A;  1V5F A;  4U87 A;  3KLO A;  1FWZ A;  3K4M A;  4WXD A;  2GAU A;  3FXR A;  2X6X A;  2HNH A;  2HTS A;  2L9R A;  3BR0 A;  2PI0 A;  1EA3 A;  3VSK A;  2EA4 A;  1ETX A;  1ZEL A;  1QA6 A;  4BBS J;  1ETK A;  4FAS D;  4IQJ A;  2XRO A;  4KT5 C;  3ZGK A;  1EH7 A;  4YG2 F;  5HNH A;  2P6T A;  3WGI A;  1MZB A;  5GAD J;  4DZJ A;  2R5Y A;  4IX7 A;  3AG1 H;  2R7U A;  5L3F A;  5EEA A;  4A6D A;  3HUG B;  4ITV A;  4HQE A;  1AOY A;  3OS1 A;  2GIZ A;  1ZQ3 P;  1BI0 A;  4IEJ A;  1TNT A;  3CC4 I;  1D5Y A;  2GLO A;  2QLZ A;  3TDU C;  3TP0 A;  2MFZ A;  4BL0 B;  3OSG A;  4BQA A;  2Y0S A;  2VJI A;  5C4J J;  1QRY A;  5M3M J;  3ZQ7 A;  5E79 C;  1S8N A;  1H89 C;  2PMU A;  1X1B A;  4KUM A;  2W7N A;  3MVP A;  4CH7 A;  3OWT A;  4BBR J;  3J81 K;  2HI3 A;  3DXJ F;  3M8F A;  4EJU A;  2Y9Z A;  1T38 A;  4K2E A;  2F5E A;  4C2U A;  1SVL A;  1BR2 A;  3CO7 C;  3IKV A;  1ZG5 A;  2A07 F;  1S7A A;  1IG7 A;  2EBI A;  2QSH X;  3ZMU A;  1YRN A;  2P4W A;  1H9T A;  1RUO A;  3Q0U A;  4F52 A;  4LLL A;  4WX9 A;  4M9X A;  3CJR B;  1VQ6 I;  3KET A;  1SMY F;  4R79 A;  2EFN A;  4MQ9 F;  1ZAO A;  2VBY A;  3VFZ A;  2NXN B;  1UST A;  1PUE E;  2FSW A;  2LBF A;  3PFY A;  4MIM A;  4XRS G;  4N9H A;  4OOI A;  5TIS C;  1A5J A;  1XMX A;  1IXS B;  2W24 A;  3QP5 A;  2HR3 A;  3BTC A;  3CP8 A;  2A05 A;  2L7Z A;  3RZO J;  2BYV E;  1MNM C;  3LSI A;  4D7M A;  2XGD A;  4P1W A;  2Q1Z B;  4BJ5 C;  2V9V A;  2BGC A;  2DW4 A;  4V2F A;  3KP3 A;  4BHC A;  3BTI A;  2HTJ A;  2XAG A;  5DV5 A;  1FOK A;  3HZJ A;  2P5K A;  2KRH A;  3I54 A;  3KIO A;  2CV0 A;  3SEZ A;  2QQA A;  1VF9 A;  4OMZ A;  3I4P A;  2EH3 A;  1ETW A;  1HXD A;  4B47 A;  3BWG A;  2DA2 A;  5DM6 F;  4U7D A;  1MJ9 A;  3DBH B;  4DZP A;  3K4N A;  3MEX A;  4ZYH A;  4A6E A;  3SZT A;  1H8A C;  4GFB A;  4KMU X;  4DGW B;  4XKC A;  2ZFU A;  3K1M A;  1XD7 A;  5BPD A;  1X1C A;  2F48 A;  4LG0 B;  3AG4 H;  1OYW A;  4XN0 A;  5AIP A;  2DLL A;  3OOP A;  2JWT A;  4EV0 A;  2IGK A;  1JI8 A;  3AG3 H;  2VKV A;  3MZY A;  4BEH B;  2I5U A;  4H0E A;  1VQN I;  2LRE A;  2DDA A;  3M3Y J;  2FQ4 A;  4X6A J;  3M1E A;  3EPZ A;  5CJ9 A;  4CCM A;  4QPO A;  1I6H J;  2ESH A;  3CUO A;  4BUP A;  3VPR A;  3FWE A;  5D4R A;  1IGN A;  4IKF A;  4AIK A;  4IHY A;  2QQ8 A;  2V1X A;  3S14 J;  1EH8 A;  3LNQ A;  1PUF B;  2A6T A;  4KA4 A;  3OYB A;  4YIR X;  3LA3 A;  1G3T A;  1JUS A;  4LIV A;  4M3G A;  4M71 A;  3I55 I;  1OCT C;  2IA1 A;  5E17 F;  2BY1 A;  5E1X A;  1R1V A;  2IGM A;  4L9J A;  2QM3 A;  5LRS A;  2MH2 A;  1HKQ A;  1ZRF A;  2EFP A;  3HOY J;  3IH3 A;  1U8B A;  2LKS A;  2H94 A;  1BI3 A;  3H92 A;  2JT1 A;  2QZ8 A;  3OV8 A;  2VXD A;  1WWX A;  2BW3 B;  3PUF A;  4XRF A;  3J7Y J;  1BI2 A;  3PSI A;  4I0B A;  5EZG A;  3WTU C;  1P7J A;  3ZN0 A;  5GAG J;  2HDW A;  2LF7 A;  1FLI A;  1YE9 A;  2WAE A;  1AWC A;  2E34 A;  3R4K A;  2E19 A;  3BR1 A;  4B43 A;  4ESJ A;  5KVR A;  1NK2 P;  2HDC A;  2IT0 A;  2BOL A;  2P8T A;  1E3P A;  3K1P A;  4UB6 C;  1JXS A;  1MMA A;  2L9V A;  5ILS A;  1SAX A;  1I3Q J;  1MMD A;  3LA2 A;  1ZGJ A;  4GO1 A;  4N4N B;  3HXL A;  1XG1 A;  4MO7 A;  2CQQ A;  3ABK H;  3S93 A;  1R23 A;  5ILU A;  5E3L A;  1LFB A;  2XKO A;  5F0C A;  3FM5 A;  3VYR B;  2H27 A;  1OR7 C;  4HF0 A;  4LGW A;  2M0M A;  3OL3 A;  4HQM A;  2V26 A;  1K7A A;  1RPW A;  2MGQ A;  3HPH A;  3CCR I;  4AWX B;  4U7B A;  1FJL A;  2VQC A;  2M1B A;  1QZE A;  1JTX A;  2ISY A;  5D5U B;  2A6H F;  3L2V A;  3CJQ B;  3L2U A;  1B72 A;  3QPL A;  2FA5 A;  3F9K A;  3TL4 X;  3WE3 A;  1B9N A;  1HDD C;  4G7Z F;  4Y3O A;  2K9S A;  5BS6 A;  2IS4 A;  5JFR A;  4IHX A;  1S72 I;  2NS0 A;  4XQF A;  2IXS A;  1LE8 A;  5M5Y J;  2X9D A;  3P9C A;  1LDD A;  1ORK A;  1TWA J;  2COB A;  4B3A A;  4RA2 A;  4G6Q A;  1OYY A;  2IAI A;  2MBF A;  1ETQ A;  3JRI A;  1R6R A;  5E8G A;  1K79 A;  4R1H A;  3I59 A;  4IJA A;  2ELH A;  5J1R A;  4Y4R A;  3CDL A;  1UFM A;  4V19 K;  2HDD A;  3L00 A;  1FBS A;  1OR7 A;  1FOY A;  1S5L C;  3T8R A;  2FEZ A;  1YYV A;  3DCF A;  1HST A;  4AID A;  3GYH X;  2MG4 A;  2H09 A;  5EF6 A;  2CWE A;  2YSR A;  2IJL A;  4XID A;  1TQM A;  4UVA A;  4MFD A;  3CCM I;  1ZR2 A;  4D5F A;  1J0R A;  1MBK A;  4OIQ F;  1SC7 A;  1FIP A;  2LH9 A;  4C30 A;  4AD9 A;  3H0G J;  3PNT A;  1XPX A;  1GHC A;  1MMS A;  2JPC A;  1GXP A;  2BEO A;  5LD2 C;  1YIT I;  3OR1 C;  1BBY A;  1GV2 A;  4H4K C;  2Y0M A;  3IP4 B;  1FSH A;  3JRB A;  3OYM A;  2Z2S B;  3LQQ A;  4A2U A;  3Q0V A;  2VL8 A;  2IS1 A;  1J59 A;  2M8G X;  5CVU A;  1MBH A;  2JUC A;  2A3S A;  4XKV A;  4NC7 A;  2MW8 A;  1VQ8 I;  1AA7 A;  4MHG A;  2HPM A;  4E7L A;  4F92 B;  3DBR B;  2R7S A;  1XX5 A;  2WY7 Q;  4XNF A;  1X4O A;  4UUS B;  1TW3 A;  4RB0 A;  2BY2 A;  2KZG A;  3WHB A;  2JQ7 A;  3RCO A;  4XOT A;  1W0T A;  4ZC3 A;  3AG2 H;  1KYZ A;  4ANJ A;  2JVG A;  4JX5 A;  3ONQ A;  3GFJ A;  3S2W A;  4E70 A;  2HYJ A;  3VEP A;  3R61 A;  2D1V A;  3A03 A;  1MNE A;  2BE5 F;  1RNL A;  4G9Y A;  1P92 A;  3MKZ A;  5DYM A;  4A12 A;  5A2Q Z;  5BPI A;  3HDD A;  2JPB A;  1MD0 A;  2STW A;  1BIB A;  2M0C A;  1LFP A;  4YEJ A;  2VB6 A;  1B8I B;  2NYX A;  4I01 A;  1FEX A;  4A3F J;  2O8K A;  1YW7 A;  1WQ2 A;  2DA3 A;  2LMD A;  2MSY A;  2CW0 F;  3HGG A;  4L9N A;  3K2A A;  3BJO A;  1O3T A;  2L7M P;  2FBK A;  3HUG A;  1X3U A;  2O7O A;  5HOO A;  2M4G A;  2IS2 A;  2EIN H;  1FP1 D;  1I50 J;  4Q48 A;  1G59 A;  2VOD A;  3AKZ A;  4JP0 A;  4ZDO A;  3CLO A;  5KAI C;  1U78 A;  2Z99 A;  2F5V A;  2HXI A;  4ZYD A;  3O6B B;  2J5P A;  1MW7 A;  5E1W A;  4RB3 C;  2W84 A;  2IA2 A;  4XSX F;  1DGR M;  3D0S A;  1JKP C;  3BCA A;  2IW5 A;  3MCZ A;  3K4B A;  1Y0U A;  4HNT A;  1ETY A;  3VDX A;  1HW1 A;  5F27 A;  1QPI A;  4AM3 A;  5LLQ A;  2ECC A;  3DWL E;  2XRL A;  1J9I A;  1U6G A;  2Y69 H;  4U0V A;  1ZG1 A;  2R7X A;  1R5G A;  2MD0 A;  1MDM A;  2V1D A;  2HFH A;  1E3O C;  3NWS A;  3C2G A;  3KEO A;  2QWW A;  4BDY A;  1UHW A;  3V8J A;  2PN6 A;  4EEF G;  1H0M A;  4ZDL A;  5A2Q K;  2M7B A;  1R4N B;  1OMI A;  3BTL A;  5ED4 A;  2EV0 A;  3H5N A;  4BJ6 C;  2NVT J;  3FIS A;  4A3J J;  2IA0 A;  5HOD A;  2NRA C;  2BZT A;  2QBY B;  1WCM J;  2NVU B;  1YW9 A;  2NAZ A;  1D0Z A;  3GCM A;  3IHU A;  5M3F J;  4BU2 A;  2A69 F;  4XN3 A;  3WU2 C;  3HOX J;  2LSO A;  2DOF A;  2QYO A;  1VQK I;  3K0L A;  2Z16 A;  1W7P A;  3SJM A;  1ZG3 A;  4I99 C;  3RPU A;  2LNB A;  3EQL F;  4MFE A;  3L7W A;  1YHQ I;  4M9S A;  3V4G A;  4P9F A;  4I0A A;  5F0F A;  1WGX A;  1D8J A;  1IDY A;  1ODD A;  3DKW A;  4L9T A;  5GPC A;  3ZMZ A;  2ZJP F;  2B0L A;  3H36 A;  5FD5 A;  2OF7 A;  3LSK A;  1IO2 A;  4A0X A;  1F9N A;  4HRI A;  3I58 A;  3U21 A;  5F6F A;  1LVA A;  1SFX A;  5F64 A;  1TT5 B;  1YS6 A;  1K78 B;  1GVD A;  1H88 C;  1N77 A;  3TO7 A;  2HOT A;  1MBJ A;  3DTE A;  4N4O B;  3RDI A;  4JBA A;  4TV7 A;  2KL4 A;  5GP9 A;  4MLO A;  4HEA 2;  5IYC J;  2H8W A;  4A3B J;  4DYQ A;  3LAJ A;  3PSF A;  4LK0 F;  4C3I J;  2XF5 A;  4YFX F;  1SMT A;  1QNT A;  1DP7 P;  3F6V A;  2CUF A;  4XOP A;  2RC4 A;  3RQ4 A;  4B09 A;  4BEH A;  3DEW A;  1PP7 U;  1IZ1 A;  1K6O A;  5FJ8 J;  2YPR A;  1I27 A;  3PFI A;  2XB5 A;  1KZH A;  3LSR A;  3CZ6 A;  1F43 A;  2LLK A;  2NVQ J;  4WXH A;  4XMY A;  1RIO H;  1IXR C;  1E2X A;  1R00 A;  1KU2 A;  3EUK L;  1SAU A;  1ZN2 A;  3L2W A;  1MH3 A;  2XC7 A;  4QWQ A;  1XTA A;  5B1A H;  4HSR A;  3VSL A;  2VJ4 A;  2FU4 A;  3F72 A;  5ICE A;  3KFW X;  3HGY A;  3E7L A;  2Q2E A;  1X19 A;  3HM5 A;  1OYI A;  1VZ0 A;  4KIC A;  4D5C A;  1P4A A;  4XOR A;  1MGT A;  1VQM I;  3H3U A;  3FXQ A;  2M45 A;  3FMQ A;  3LA7 A;  2X6W A;  4P5O A;  3W2W A;  1U2W A;  3FXJ A;  1IF1 A;  3KEY A;  2RQP A;  3KYD B;  3VYU B;  3GTL J;  1TW2 A;  1G3W A;  4BQQ A;  2XAS A;  1WKM A;  1ZLJ A;  3LWF A;  3RKQ A;  2XAU A;  3OY9 A;  2O5R A;  5EYR A;  3BZK A;  2HZT A;  3CCQ I;  1BJZ A;  3KP2 A;  2L7K A;  4XK4 A;  2WC2 A;  3PIO F;  2ZME C;  3SFZ A;  4HG2 A;  1WRJ A;  3PQJ A;  4O6J A;  4RGS A;  3I56 I;  3FKJ A;  4FX0 A;  2E1C A;  3PO3 J;  1LB2 A;  2NVY J;  2P0W A;  3HOT A;  2LY2 A;  1U3E M;  4IPA A;  1XSD A;  1KA8 A;  3JSP A;  1RC9 A; 
#chains in the Genus database with same CATH homology
 3CO6 C;  3K1N A;  2IRF G;  5CVJ A;  4IRI A;  3WTX C;  3HSE A;  4M9Z A;  1I6X A;  2VON A;  2QQ9 A;  3HYI A;  5H6Q A;  3EUH A;  5HDG A;  3QP6 A;  2K7L A;  4MEX F;  4EJV A;  2R7D A;  2Z9O A;  2ZFW A;  4M6Y A;  2AS5 F;  1XSV A;  2F5C A;  2HOE A;  3HRU A;  2MD5 A;  5D5X B;  1HW2 A;  1ON1 A;  5HS8 A;  3DP7 A;  3IWF A;  2V1U A;  4O5V A;  3BY6 A;  1JE8 A;  4MQV A;  2DFI A;  4EGZ A;  2ZME A;  5CVR A;  5FD6 A;  2C6Y A;  2L3D A;  4Q4Z F;  2XAJ A;  2FE3 A;  2A5Y B;  2JTV A;  3V8K A;  2DQL A;  5LHH A;  2L4A A;  4A5N A;  1HW5 A;  3WOD F;  4CYD A;  2A6E F;  4EGY A;  4PGH A;  2DI3 A;  1XGS A;  1R58 A;  3MAJ A;  5FO5 A;  2VBW A;  4Y13 A;  4RGX A;  2DO7 A;  4HX7 A;  1QO0 D;  2KIF A;  5ICF A;  1HQC A;  1B59 A;  2RNJ A;  2CFX A;  4G7O F;  1QGP A;  3TO9 A;  2XKP A;  3IWZ A;  4EM1 A;  3T0Y A;  4OIP F;  1UB9 A;  3E3V A;  4ENN A;  4RGU A;  2GQQ A;  2E7X A;  1O7F A;  1KQ9 A;  5D5V B;  3GX4 X;  2VXZ A;  5LEK A;  3F8M A;  1FX7 A;  2QUF A;  2VE9 A;  4G8X A;  1U8R A;  3LAP A;  2VOO A;  5LHI A;  3TOA A;  2WV0 A;  3RPQ A;  3IC7 A;  2J5O A;  4A0Y A;  4PCQ A;  4A5M A;  3I0T A;  1IN5 A;  4CDG A;  4WCG A;  4OU0 A;  1U5T B;  4ASN A;  2P5L C;  1I1S A;  1T2K A;  1O57 A;  3AAF A;  3L09 A;  3GFL A;  1EV7 A;  2P7V B;  2OAZ A;  2E1N A;  5D8L B;  3R60 A;  4NQW A;  5CVI A;  2IPQ X;  4Q47 A;  4HLX A;  3V8L A;  4OMY A;  4UVB A;  2FNA A;  1BC7 C;  4XBF A;  5TJJ A;  2EFQ A;  2K86 A;  1LEB A;  1QPM A;  4HA8 A;  1SD7 A;  2LF8 A;  3L2C A;  4L5I A;  3I71 A;  4BHB A;  1R1U A;  2DBB A;  4BYY A;  3KZY A;  2Z33 A;  3RKY A;  5D4S A;  2M5W A;  4GCV A;  2ZXJ A;  1Z7U A;  5DCF A;  2QBY A;  5L3G A;  2O61 A;  1T39 A;  3E5X A;  5ICG A;  1STZ A;  2Y75 A;  3RYP A;  4NB5 A;  3BP8 A;  2D45 A;  3RYR A;  3EYI A;  2XAH A;  5JHU A;  2FNP A;  4RAZ A;  2HEO A;  4Y15 A;  3RKW A;  1ZYR F;  4MEY F;  2JZY A;  3CDH A;  5H20 A;  3VOD A;  3ULQ B;  3QRF F;  1K78 A;  2O03 A;  5L3D A;  4F7Z A;  2K02 A;  1J75 A;  1KU7 A;  2K4B A;  3SHF A;  3BJ6 A;  3WU1 B;  1G4D A;  3CTA A;  3J7A O;  2PBI A;  2XRN A;  3RTR A;  1F4K A;  5D5W B;  1IUY A;  5DCM A;  5AON A;  3E6M A;  1Z6R A;  1ONV A;  3R6S A;  5LGU A;  4PZJ A;  3BPX A;  3JTG A;  3F8F A;  4RAY A;  1BI1 A;  3E5Q A;  2AXL A;  5J8C A;  4MGR A;  4ZH4 F;  1S7O A;  2LDU A;  2P6S A;  1YTY A;  3CUQ B;  2ZBK A;  3K69 A;  3ELK A;  4I09 A;  4WK8 F;  4UVC A;  5BMZ A;  3KE2 A;  1GVJ A;  5DD8 A;  1IAW A;  1XN7 A;  2L02 A;  5J8F A;  1P4W A;  3GFM A;  3ZMS A;  1XSX A;  2DT5 A;  4JK1 X;  5HS9 A;  2TDX A;  2RGV A;  1L3L A;  5BQT A;  1YS7 A;  4LB5 A;  4UHT A;  1O7L A;  3DV8 A;  4HX8 A;  4CIC A;  4XLN F;  1O3Q A;  1JHF A;  6PAX A;  3IRQ A;  3EET A;  3QU3 A;  4UXN A;  3I53 A;  3GXO A;  2OQG A;  2STT A;  1JGS A;  5IT9 Z;  4KFC A;  3HRT A;  1VTN C;  1TQI A;  2FMY A;  2PMH A;  1P6R A;  3ROU A;  5E20 A;  4UNO A;  2IP2 A;  1YFH A;  3ABU A;  4LLG F;  2HYF A;  5LGT A;  1R5H A;  1LDJ A;  3E6D A;  1BOA A;  2E7W A;  5BOX A;  2L4M A;  2COM A;  1TLH B;  4EM0 B;  3WG9 A;  3DQV C;  4IHS A;  3R0A A;  2G7U A;  5E8I A;  3WTZ A;  2GA1 A;  2YR2 A;  3LST A;  4P9U A;  4QLC U;  3WTT C;  1WI9 A;  5HLI A;  4YFK F;  4PGG A;  4AIH A;  1IW7 F;  3C3W A;  1KGS A;  4N0B A;  2VT2 A;  3RI4 A;  5IT9 K;  1U5T C;  2ZNY A;  1Z05 A;  2DPU A;  3J80 Z;  1FYL A;  1XDS A;  4CZZ A;  2EJR A;  4YII A;  2O6G E;  1J5Y A;  1S29 A;  4RGR A;  2FOK A;  1BN5 A;  4AIJ A;  2KIU A;  1Q1H A;  3BZ6 A;  5HLG A;  1FBU A;  2BBY A;  3GUD A;  1U5T A;  4ETS A;  2HS5 A;  2OD5 A;  3FX3 A;  4IXA A;  2H6B A;  4HYE A;  4XLP F;  3GW2 A;  2CQK A;  2DU9 A;  2NNN A;  1T6S A;  5JI6 A;  4BNC A;  4EM2 A;  3V7C A;  3J80 K;  1SFE A;  2ESN A;  3G3Z A;  3GO5 A;  1IN6 A;  3DPL C;  5K5R A;  2EFW A;  2MC3 A;  2FQ3 A;  3QOP A;  1L0O C;  4ZZD A;  2L54 A;  4G6D A;  1S3J A;  4M74 A;  5CLS A;  3G73 A;  3N4M A;  3U9G A;  1DUX C;  1XCB A;  4UUV A;  5DUK A;  3RKX A;  1WSU A;  4KNY A;  3BRO A;  1IXC A;  2OZ6 A;  5FFZ A;  4U88 A;  1IN4 A;  4LG0 A;  2KRF A;  1HKT A;  3U1D A;  3GEZ A;  3U2R A;  1XCV A;  2ZO4 A;  1ZRE A;  4ENJ A;  4DNC A;  4M6X A;  4HW0 A;  4ENK A;  1QQI A;  2O0Y A;  3KCC A;  2RKH A;  2F2E A;  4YFN F;  2DK5 A;  2F5D A;  1YW8 A;  3HSR A;  3ZPL A;  3FZV A;  1R22 A;  2RVC A;  2D2W A;  2GIV A;  3P9I A;  1F5T A;  1KU3 A;  2FBI A;  2ZNZ A;  1B4A A;  5HDN A;  1LNW A;  2GWR A;  5D8K B;  3ECO A;  3M7G A;  4AVP A;  2VOP A;  1NHA A;  3ABT A;  3TGN A;  4GXO A;  1E17 A;  5K5Q A;  3ISP A;  3SQN A;  3L9F A;  1Z6T A;  1RUN A;  1SFU A;  4LK1 F;  3ERE D;  4HV6 A;  1V4R A;  2KKO A;  5D6F A;  3MZH A;  1QBJ A;  5FB2 A;  5HVQ C;  1ZRD A;  1KU9 A;  3E6B A;  1BJA A;  4LB6 B;  2W85 A;  1FPQ A;  3CUQ A;  3WTS C;  2QVO A;  1OKR A;  2DQR A;  1FSE A;  5F1R A;  1LDK B;  5EEG A;  3JSO A;  2G9W A;  2F5F A;  4S04 A;  3GZ6 A;  1YG2 A;  4HBL A;  3KEQ A;  2RN7 A;  3C7J A;  4WF2 A;  2ZKZ A;  1IRG A;  4KIF A;  1YO5 C;  3PQK A;  2Q8K A;  3HRS A;  1XB4 A;  4KN4 X;  5FLX Z;  1R1T A;  3FHZ A;  2P7C B;  4L0Z B;  3N97 A;  5JVT A;  4CO8 A;  1TBX A;  1FYM A;  1HSJ A;  3ZN1 A;  2IVM A;  4KIB A;  3JTH A;  1W4M A;  2ZCW A;  3HSF A;  2YX7 A;  2UXN A;  3F8C A;  3IRR A;  2BV6 A;  4P96 A;  2MLG A;  5DEQ A;  4HDV A;  2W57 A;  2EB7 A;  2XIG A;  3HHG A;  5J6X A;  1IN8 A;  3ZMV A;  4B8X A;  3JW4 A;  3O3K A;  2UZK A;  4A0Z A;  1BM9 A;  3HOS A;  3C18 A;  1EH6 A;  3KZZ A;  4CXF A;  1G3S A;  5LHG A;  5HLH A;  3O2P E;  5L3B A;  1REP C;  1FC3 A;  5FLX K;  2OU2 A;  1P2F A;  2EV6 A;  4BXU A;  4R8H A;  3TQN A;  4EQQ A;  1A04 A;  3TOB A;  4HLY A;  4HOB A;  1UHM A;  3FXU A;  5DD4 A;  4FX4 A;  2UXX A;  1TTY A;  2EA2 A;  3WGH A;  5H6R A;  1LEA A;  1FY7 A;  4EJW A;  5DDG A;  5FGM A;  2R7F A;  2A68 F;  2XUB A;  4DQ2 A;  2YX4 A;  3FM3 A;  1ZGA A;  3T5X A;  4UV8 A;  4RS8 A;  4PDK A;  5D6E A;  3HTS B;  4HZF A;  1ZLK A;  1FYK A;  1V3F A;  2VN2 A;  4ENM A;  1MDM B;  3WTW C;  3CJN A;  4I98 B;  3EYY A;  1HKS A;  3HIF A;  2EWN A;  4JQF A;  2HWV A;  1Z9C A;  4Q5S F;  1W7P B;  2HKX A;  2O3F A;  1J2X A;  2K4J A;  2JRT A;  1IRF A;  5LGN A;  1ON2 A;  1IN7 A;  4XSZ F;  3KP6 A;  5L3E A;  3K9T A;  3I64 A;  3HTU A;  3DF8 A;  2PLY A;  2CYY A;  4L5J A;  4HF2 A;  3MFK A;  1B9M A;  4ZZL A;  3RIR A;  2ETH A;  1TNS A;  4ZYE A;  3I5U A;  3HRM A;  1R36 A;  1Z91 A;  3F6O A;  3D5L A;  4RB2 C;  3GZ5 A;  4IHT A;  1PDN C;  2ADU A;  3B73 A;  4OIO F;  4HX4 A;  3F22 A;  2XVC A;  2VC1 A;  4EMS A;  1KYW A;  2JSC A;  3IL2 A;  4EJO A;  2OBP A;  1H9G A;  2FBH A;  5HS7 A;  3QPT A;  3M9A A;  4LMY A;  4D0P A;  2W25 A;  3KLN A;  3T1B A;  5E1Z B;  1G6N A;  3BJA A;  2UWM A;  3P7N A;  2OA4 A;  1CF7 B;  1KQ8 A;  4HF1 A;  4GYG A;  1ZAR A;  1FNN A;  2DTR A;  2ISZ A;  1XGM A;  1S6L A;  3TDZ C;  4BAY A;  2ACJ A;  1T0F A;  1BC8 C;  3ZP5 A;  3M8E A;  3NEU A;  5TRD A;  1D8K A;  2NNY A;  1KQ0 A;  1DPU A;  3REO A;  1FT9 A;  5E18 F;  1O3R A;  3RJP A;  1XGO A;  3E5U A;  1QZZ A;  2DAO A;  2VC0 A;  5EEH A;  5K5O A;  2PJP A;  3KP7 A;  3GLX A;  2CSO A;  2LKP A;  2XV4 S;  1MJB A;  5CVV A;  4KN7 X;  5LRR A;  3MQ0 A;  1BIA A;  2VE8 A;  1I5Z A;  3GWZ A;  1YQA A;  5ERI A;  2ZME B;  2MH9 A;  4Z2Y A;  4L18 B;  1D5V A;  4CGZ A;  5ILV A;  3HHH A;  1CGP A;  1FBQ A;  2FF4 A;  1W5S A;  1B6A A;  4OIR F;  1D3Y A;  3K2Z A;  3Q9S A;  3IKT A;  2V79 A;  4BH9 A;  2VT3 A;  4U0Y A;  2XAQ A;  4ZYG A;  3COA C;  2XGX A;  1ULY A;  3DPT A;  2PG4 A;  4G7H F;  1XGN A;  4IF4 A;  4KMF A;  2GXG A;  4Y17 A;  3GVA A;  1ZH5 A;  2X4H A;  5CYV A;  3QAH A;  3JAM Z;  5LEJ A;  4I02 A;  4IRG A;  2GXB A;  3V7S A;  3QPH A;  3GF2 A;  4I2O A;  3P9K A;  1DPR A;  1HBX G;  2OZU A;  3FMR A;  1W5T A;  2P5V A;  4KIG A;  3VOE A;  4KDP A;  3LQR A;  2RDP A;  1SD4 A;  4EVI A;  2H6C A;  2CG4 A;  3TO6 A;  2YU3 A;  1Z1D A;  4IVN A;  2EFO A;  3DEU A;  3WTY C;  3F8B A;  5DUI A;  3ECH A;  1USS A;  3EDP A;  5HDK A;  2XAF A;  3NRV A;  3FMS A;  3JAM K;  2XHK A;  4M72 A;  2EK5 A;  4N9I A;  5FFX A;  4WWC A;  4EJT A;  1O3S A;  1PP8 F;  2ZJ2 A;  4S05 A;  5KK1 A;  3NQO A;  3F3X A;  3KP5 A;  1LJ9 A;  1T98 A;  1J7K A;  2G7H A;  4LFU A;  2FRH A;  1SD6 A;  2X0L A;  4FHT A;  3B02 A;  5AIQ A;  4KYW A;  2VBX A;  2Y48 A;  1F1Z A;  1R7J A;  4L0Y B;  4OIN F;  3V7R A;  2DPD A;  3SZP A;  2PEX A;  3R0J A;  1RZ4 A;  3KP4 A;  4LLN A;  4LJZ F;  1DDN A;  2V6C A;  2M30 A;  1GXQ A;  1QZY A;  4GGG A;  5K1Y A;  2D1H A;  2K27 A;  2QEN A;  4ESB A;  2EV5 A;  4L9V A;  2VBZ A;  3E6C C;  1OPC A;  5L3C A;  2A61 A;  3F23 A;  2WTE A;  4HAM A;  2FML A;  4IRH A;  2DK8 A;  4I7H A;  4ON0 A;  4RB1 A;  1I1G A;  2RV8 A;  5LBQ A;  2PQ8 A;  3BPV A;  3GFI A;  3Q9V A;  1UCR A;  5DCM B;  1LQ1 A;  2PFB A;  3WTV C;  3WU0 A;  3CUQ C;  5JR3 A;  1SD5 A;  4HDU A;  2O8X A;  1XMA A;  1W7P D;  1YIO A;  2HQN A;  2M8E A;  2Z3Y A;  2OQR A;  2HGC A;  4ESF A;  2Q0O A;  4O3M A;  4NHJ A;  5IT3 A;  3WE2 A;  2MA3 A;  1CF7 A;  3VB2 A;  4U0W A;  1RI7 A;  2CGP A;  1TQP A;  2KIM A;  2MLK A;  4BHP A;  3BDD A;  3ZMT A;  5ICC A;  1P4X A;  3LFK A;  1MKM A;  4FT8 A;  2KJB A;  2KJC A;  3E97 A;  3BOQ A;  4MTE A;  4CHU A;  3F8N A;  1B1B A;  3H3Z A;  3I59 B;  3DFG A;  3FF5 A;  2R3S A;  4YIF A;  3W6K B;  2GZW A;  2GA2 A;  1ZRC A;  1FP2 A;  2QQB A;  2HKO A;  4M73 A;  2CO5 A;  3W6J B;  1G3Y A;  3C1D A;  3QU6 A;  4WXC A;  3ZMD A;  3Q5F A;  2Z5U A;  3T8T A;  2L01 A;  3SXY A;  2HYG D;  1XMK A;  1FZP B;  3TKY A;  1ZHF A;  2FXA A;  4P55 A;  1C0W A;  4MTD A;  3F21 A;  2M87 A;  3WGG A;  4G94 A;  1XDU A;  4HV5 A;  3MWM A;  1MJA A;  1YLF A;  2WWY A;  4UV9 A;  3ML6 A;  3J81 Z;  4LD5 A;  2HQR A;  4GYI A;  1JHH A;  4MNU A;  3KLO A;  1FWZ A;  4WXD A;  2GAU A;  3FXR A;  2HTS A;  2PI0 A;  2EA4 A;  2XRO A;  4KT5 C;  1EH7 A;  4YG2 F;  3WGI A;  2P6T A;  1MZB A;  5L3F A;  4A6D A;  4HQE A;  1AOY A;  1BI0 A;  1TNT A;  2QLZ A;  3TDU C;  4BQA A;  3ZQ7 A;  1S8N A;  2PMU A;  4KUM A;  3J81 K;  3M8F A;  3DXJ F;  4EJU A;  1T38 A;  4K2E A;  2F5E A;  3CO7 C;  3IKV A;  1ZG5 A;  2A07 F;  1S7A A;  3ZMU A;  2P4W A;  1H9T A;  1RUO A;  4LLL A;  4WX9 A;  4M9X A;  3KET A;  1SMY F;  4R79 A;  2EFN A;  4MQ9 F;  1ZAO A;  2VBY A;  3VFZ A;  1UST A;  1PUE E;  2FSW A;  4N9H A;  4OOI A;  1IXS B;  2W24 A;  3QP5 A;  2HR3 A;  2BYV E;  2V9V A;  2BGC A;  2DW4 A;  3KP3 A;  4BHC A;  2HTJ A;  2XAG A;  5DV5 A;  1FOK A;  2P5K A;  3I54 A;  2QQA A;  4OMZ A;  3I4P A;  1HXD A;  4U7D A;  3BWG A;  1MJ9 A;  3MEX A;  4ZYH A;  4A6E A;  3SZT A;  4KMU X;  3K1M A;  1XD7 A;  5BPD A;  4LG0 B;  1OYW A;  5AIP A;  2DLL A;  3OOP A;  4EV0 A;  3MZY A;  4H0E A;  3M1E A;  5CJ9 A;  2ESH A;  3CUO A;  3FWE A;  5D4R A;  4AIK A;  2V1X A;  1EH8 A;  4KA4 A;  3LA3 A;  1G3T A;  4M71 A;  5E17 F;  2IA1 A;  5E1X A;  1R1V A;  4L9J A;  2QM3 A;  5LRS A;  2MH2 A;  1HKQ A;  1ZRF A;  2EFP A;  2H94 A;  1BI3 A;  3H92 A;  2JT1 A;  2QZ8 A;  3OV8 A;  1WWX A;  4XRF A;  1BI2 A;  4I0B A;  3WTU C;  3ZN0 A;  2LF7 A;  1FLI A;  1AWC A;  3R4K A;  4ESJ A;  5KVR A;  2HDC A;  2IT0 A;  2P8T A;  3K1P A;  1JXS A;  5ILS A;  1SAX A;  3LA2 A;  1ZGJ A;  4GO1 A;  1R23 A;  5ILU A;  2XKO A;  3FM5 A;  2H27 A;  4HF0 A;  4LGW A;  4HQM A;  1K7A A;  4AWX B;  4U7B A;  2M1B A;  2ISY A;  5D5U B;  2A6H F;  2FA5 A;  3WE3 A;  1B9N A;  4G7Z F;  5BS6 A;  5JFR A;  2NS0 A;  3P9C A;  1LDD A;  4G6Q A;  1OYY A;  2MBF A;  5E8G A;  1K79 A;  4R1H A;  3I59 A;  4IJA A;  2ELH A;  1UFM A;  3L00 A;  1FBS A;  1OR7 A;  3T8R A;  2FEZ A;  1YYV A;  1HST A;  3GYH X;  2H09 A;  2CWE A;  2YSR A;  2IJL A;  1TQM A;  4UVA A;  1J0R A;  4OIQ F;  4AD9 A;  1GHC A;  2JPC A;  1GXP A;  2BEO A;  1BBY A;  2Y0M A;  1FSH A;  3LQQ A;  4A2U A;  1J59 A;  5CVU A;  2A3S A;  4MHG A;  1TW3 A;  4RB0 A;  1KYZ A;  3GFJ A;  3S2W A;  4E70 A;  3VEP A;  3R61 A;  2D1V A;  2BE5 F;  1RNL A;  4G9Y A;  1P92 A;  5DYM A;  4A12 A;  5A2Q Z;  5BPI A;  2JPB A;  1MD0 A;  2STW A;  1BIB A;  2NYX A;  4I01 A;  1YW7 A;  1WQ2 A;  2CW0 F;  4L9N A;  3BJO A;  1O3T A;  2FBK A;  3HUG A;  1X3U A;  5HOO A;  1FP1 D;  4Q48 A;  2VOD A;  3CLO A;  1U78 A;  2Z99 A;  4ZYD A;  3O6B B;  2J5P A;  4RB3 C;  5E1W A;  2W84 A;  2IA2 A;  4XSX F;  3D0S A;  3MCZ A;  2IW5 A;  1Y0U A;  1HW1 A;  5LLQ A;  1J9I A;  1U6G A;  4U0V A;  1ZG1 A;  1R5G A;  1MDM A;  2V1D A;  2HFH A;  3KEO A;  2QWW A;  1UHW A;  3V8J A;  2PN6 A;  1H0M A;  5A2Q K;  1OMI A;  5ED4 A;  2EV0 A;  2IA0 A;  2NRA C;  2QBY B;  1YW9 A;  2NAZ A;  3IHU A;  2A69 F;  2LSO A;  2QYO A;  3K0L A;  1W7P A;  1ZG3 A;  3RPU A;  2LNB A;  3EQL F;  3L7W A;  4M9S A;  3V4G A;  4P9F A;  4I0A A;  1D8J A;  1ODD A;  3DKW A;  4L9T A;  3ZMZ A;  2B0L A;  5FD5 A;  4A0X A;  1F9N A;  3I58 A;  5F6F A;  1LVA A;  1SFX A;  5F64 A;  1YS6 A;  1K78 B;  3TO7 A;  3RDI A;  4JBA A;  4TV7 A;  3LAJ A;  4LK0 F;  4YFX F;  1SMT A;  1QNT A;  1DP7 P;  3F6V A;  2RC4 A;  4B09 A;  1PP7 U;  1IZ1 A;  1K6O A;  2YPR A;  1I27 A;  3PFI A;  4WXH A;  1RIO H;  1IXR C;  1E2X A;  1R00 A;  1KU2 A;  1ZN2 A;  4QWQ A;  5ICE A;  2FU4 A;  3F72 A;  3KFW X;  2Q2E A;  4KIC A;  1OYI A;  1P4A A;  1MGT A;  3H3U A;  3FXQ A;  2M45 A;  3FMQ A;  3LA7 A;  4P5O A;  1U2W A;  1IF1 A;  2RQP A;  1TW2 A;  1G3W A;  2XAS A;  1WKM A;  1ZLJ A;  3LWF A;  2HZT A;  3KP2 A;  2WC2 A;  3SFZ A;  1WRJ A;  3PQJ A;  4O6J A;  4RGS A;  2E1C A;  4FX0 A;  1LB2 A;  3HOT A;  1U3E M;  4IPA A;  1XSD A;  1KA8 A;  3JSP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...