5KK1A

Structure of pnob8 aspa-dna complex.
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
88
structure length
88
Chain Sequence
STDKYIFLTPRAYIIVHLLKVGKAKASEISENTQIPYQTVIQNIRWLLAEGYVVKEQKGEEIYYKLTDKGKQLATAELEKIRKLVEVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AspA
publication title to be published
rcsb
source organism Sulfolobus sp. nob8h2
molecule tags Transcription/dna
total genus 26
structure length 88
sequence length 88
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2016-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13463 HTH_27 Winged helix DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5kk1A00
1T98A 2NNYA 2FNAA 4HZFA 5ILVA 2HR3A 4A6DA 2ACJA 3GWZA 2DI3A 1ZAOA 1O7FA 4L5IA 1AWCA 2UWMA 1ZH5A 1U78A 1FT9A 2O6GE 3CUQA 3GVAA 2FE3A 4XBFA 2G7HA 5JVTA 1MJAA 4P9FA 1D8JA 3I0TA 3KLOA 3MCZA 4WWCA 2BYVE 2IA0A 3KEOA 1OKRA 5AIPA 1LDKB 4WCGA 1T2KA 4EV0A 3WU0A 2COMA 1KYWA 2M5WA 2P5VA 2NS0A 2VN2A 5HDNA 3KP2A 3R61A 3WGGA 5FGMA 4GO1A 2GIVA 4P9UA 3REOA 3SZTA 1CF7A 1E2XA 4ESJA 5E8IA 3BJAA 3ZP5A 3CO7C 3SFZA 4ENKA 3BOQA 5DD8A 3ZMDA 1SFEA 2HQRA 3HOTA 2EFOA 1XGSA 3QAHA 1LQ1A 2W25A 1Z91A 3RJPA 4YFXF 4A6EA 1HQCA 1DUXC 3MZHA 3CO6C 2H94A 1OYWA 5HLGA 2IA2A 4RB2C 3DXJF 3H3ZA 1K78B 4EGZA 3DPLC 4LJZF 3PQJA 3F6VA 2F5CA 1X3UA 2G9WA 5FLXZ 1ONVA 4HX7A 1J2XA 2ZKZA 5LGNA 4OMZA 5EEHA 5BOXA 1FSEA 4GCVA 4OU0A 5E20A 4FHTA 2J5PA 4MNUA 1FOKA 3C3WA 2M1BA 2FA5A 4ENNA 1TTYA 1YS7A 1UB9A 1W7PA 1YG2A 2HZTA 4L9VA 3E97A 2IT0A 1BOAA 1MZBA 4HV5A 5BPDA 1MGTA 4A0XA 2HKOA 3LA2A 3N4MA 1UHWA 5BMZA 3BROA 2XAJA 2H6BA 1SAXA 3NEUA 2GZWA 2IA1A 3RKWA 5FB2A 2H09A 1G3YA 3CLOA 1XSDA 1WRJA 1K7AA 2E1CA 1USSA 5LGUA 3BP8A 5ILSA 3JW4A 2QZ8A 5F64A 1L3LA 4AD9A 1IN4A 1TNTA 3PQKA 4FX4A 3K0LA 2DU9A 2BV6A 1JHHA 2K86A 2FBIA 1TQIA 2JPCA 2MH9A 4HX8A 1LVAA 2EA4A 3W6KB 2DK8A 3R0AA 5CVVA 3QPHA 2A3SA 3N97A 2DQRA 1SFXA 4HA8A 2QM3A 1EH6A 2RDPA 2FMYA 1Z6RA 2OBPA 3HIFA 3KLNA 4G9YA 2WC2A 4PGGA 2ISYA 1QPMA 4O3MA 4BXUA 2KRFA 4Y17A 4G7HF 2Z5UA 3CUQC 5JFRA 2DTRA 3I59B 2Z99A 2STWA 3G73A 3FWEA 3L09A 5FLXK 2V1UA 1HSJA 3KE2A 1U5TB 5E8GA 4XLNF 3P7NA 2D45A 4EQQA 3O2PE 5ICGA 1YLFA 3SQNA 4MEXF 3IRRA 3GLXA 3O3KA 4BHCA 2C6YA 1B4AA 3LAJA 4OIQF 3WTSC 5H6RA 1V4RA 4ASNA 3FXUA 2XHKA 2R3SA 1NHAA 5D6FA 4IRIA 1IN7A 3BPVA 4R8HA 3CUOA 2DFIA 1YW8A 2W24A 3TDUC 1WKMA 3KP6A 1ON2A 1XGOA 2XRNA 2W84A 4BHBA 4EVIA 1K6OA 4HQMA 2TDXA 4U7BA 1YW7A 2XROA 4IF4A 5J8CA 1P4WA 2V1XA 4HF2A 5DCMB 4UHTA 2ZMEB 1ZG3A 5DEQA 2AS5F 3K2ZA 3KP3A 1UFMA 1FYLA 5HS8A 2CWEA 4B8XA 2LF7A 3DP7A 2PG4A 3GW2A 1D3YA 4GYIA 1H9GA 4M9SA 2XIGA 3R4KA 4ZYEA 1T6SA 4WXDA 3TOAA 1MJ9A 4A2UA 3RPQA 1R1TA 1R1UA 1BI1A 2ETHA 4EJVA 3LSTA 5HVQC 2XKPA 2GXGA 4EM2A 1LDJA 4EM1A 1QGPA 5L3FA 2V6CA 1HBXG 2FMLA 3IHUA 4HX4A 5TJJA 3V4GA 1WQ2A 2PQ8A 4HYEA 2CW0F 4A0YA 2O8XA 2EV0A 5LGTA 2P5LC 1Q1HA 1HSTA 5BPIA 1DPUA 4BYYA 2ADUA 3V8LA 3E6MA 4DQ2A 5L3EA 1RIOH 3KFWX 3Q9VA 5H6QA 1ZG1A 1SD7A 2LKPA 4LFUA 1F1ZA 3M1EA 1FYKA 4LLLA 1ZN2A 2RNJA 2JRTA 2PMHA 4KMUX 4BAYA 3VODA 4IJAA 2GXBA 4LLGF 3ABUA 1U6GA 3ECHA 4IRHA 4L0ZB 2OU2A 1IW7F 1I27A 3C1DA 2PN6A 3MAJA 1TW2A 2K27A 1YQAA 5IT3A 4AIHA 3WTYC 4L9NA 5LEKA 4MTEA 2XUBA 3TO7A 2NNNA 4M6YA 1FSHA 2FRHA 2RV8A 2RC4A 4B09A 2DK5A 3DF8A 2VE9A 1P92A 2M45A 1BIAA 5L3CA 3I64A 4LMYA 4ESFA 4U0YA 4AWXB 5FD5A 4I01A 1YTYA 1UHMA 3COAC 1R22A 4PDKA 4LB6B 3IKVA 4P96A 4UNOA 1BN5A 4KIFA 1ZLKA 3V7RA 3GXOA 2E1NA 3V7SA 3I71A 5CVIA 1L0OC 1G3TA 3WGHA 1RZ4A 1GVJA 4HLXA 3DEUA 3HSFA 5AONA 2DQLA 3RI4A 1HW1A 4WXHA 4K2EA 4KN4X 1EH8A 3E5XA 3E3VA 2A69F 2XAFA 2OQGA 3P9CA 1P2FA 2IRFG 1TBXA 1QO0D 3RYPA 3ZN0A 1Y0UA 3F21A 4ZZLA 2QBYA 1YW9A 1O57A 2QQ9A 1KQ0A 2B0LA 3EYYA 3EUHA 4BH9A 2DT5A 4D0PA 3MQ0A 3FX3A 1ZGAA 1XGNA 1ON1A 3ECOA 1SD4A 5E1ZB 3ML6A 4ON0A 4N9IA 2YR2A 5ILUA 5KK1A 4A5NA 4XSXF 4LG0A 3R60A 3I58A 3WTVC 2QVOA 3FM3A 5J6XA 3MZYA 3V8KA 1BI0A 2ZO4A 4UVBA 4RB3C 4AIJA 2BBYA 2MC3A 4L18B 2YX7A 3GZ6A 2HGCA 3L7WA 4CGZA 3P9KA 5L3GA 1IN5A 1ZREA 1BM9A 1XSXA 2ZXJA 4LD5A 1YFHA 1B6AA 2IJLA 4F7ZA 1LJ9A 2P8TA 2PEXA 2FEZA 5FFZA 1K79A 3JAMZ 4OIOF 5LEJA 4KICA 2YX4A 3GEZA 4KT5C 4Z2YA 4P55A 4ESBA 1XCBA 2F5EA 3ABTA 4G8XA 4M74A 2UZKA 5ICEA 3WTTC 3IC7A 2FF4A 4KIBA 1XDUA 1HKTA 3B73A 2WTEA 1CGPA 2Y0MA 4WK8F 4JQFA 2V1DA 2M8EA 3TGNA 1XN7A 1O3TA 4RGXA 1BJAA 1TQPA 5BS6A 3NRVA 1BI3A 2ESHA 3VB2A 4KMFA 1J59A 3BJOA 2PBIA 4HAMA 4A12A 3IRQA 4EJWA 3K1MA 3BDDA 3ELKA 4WXCA 4IVNA 1FBSA 1HW2A 3Q5FA 2VC0A 4ENMA 4L9JA 1B59A 5D8KB 1G4DA 2ZBKA 2PMUA 3TQNA 5E17F 1WWXA 4MQVA 2HOEA 2VT2A 1RNLA 4PGHA 4H0EA 2A6EF 2ZCWA 3AAFA 2OA4A 4KUMA 4IHTA 1SMTA 1WSUA 4RGUA 5ICFA 2HKXA 2L02A 4MTDA 1LEAA 4KDPA 2F5DA 2A07F 3T8RA 4YFKF 4XRFA 2MLKA 1KU3A 4OIPF 3T5XA 3WGIA 1IXRC 2HTSA 3HRMA 1R58A 2VC1A 4HW0A 2UXXA 3M7GA 4KA4A 3WTZA 5LRRA 3B02A 3GFMA 4QWQA 4XLPF 3KP7A 3M8EA 4HBLA 3SHFA 5K5OA 5E18F 3F72A 3IWZA 5DDGA 3JAMK 4I02A 1P4XA 1FBQA 1T38A 3S2WA 1ZRCA 3GO5A 3KZZA 6PAXA 3E5UA 5CVUA 2A6HF 4G94A 4YIIA 2P6SA 2CYYA 2P7VB 1PP7U 2IPQX 5K1YA 3J80Z 4XSZF 3FMQA 4BNCA 4G7OF 5HS7A 2LNBA 4A0ZA 2D1VA 5E1WA 3SXYA 3BJ6A 1QZZA 4N9HA 3O6BB 4MHGA 3MFKA 3KEQA 2YU3A 4M71A 3E6DA 1TLHB 2GQQA 3F8CA 2Y48A 1GHCA 5A2QZ 2DPDA 1IXSB 2OZ6A 4EM0B 3HHHA 1P6RA 4QLCU 4MQ9F 5JHUA 3GFIA 1XMAA 5DYMA 4RAZA 1YO5C 1KQ9A 4FX0A 1IF1A 5FO5A 3L2CA 4CHUA 2PLYA 3FF5A 2VXZA 3HSRA 2FXAA 1J7KA 1R5GA 1D5VA 2BGCA 4KN7X 4KIGA 3E6BA 3RIRA 4G7ZF 1P4AA 2VONA 3I53A 5HOOA 2L01A 1BIBA 2J5OA 3HUGA 4I98B 2L54A 2FBHA 2BE5F 5CVRA 1U8RA 2FBKA 4UV8A 2CG4A 4S04A 3R0JA 3K1NA 4DNCA 5DUIA 1R1VA 2XAQA 3TOBA 3DV8A 3TO9A 1U2WA 2D2WA 5DCMA 2EWNA 5F1RA 2ZMEA 1I1GA 2ZFWA 3RKXA 4Q5SF 1KU9A 3TDZC 4ZYHA 3CDHA 2STTA 1IXCA 1S7AA 4MGRA 4GXOA 1FZPB 1W4MA 3FXQA 3K9TA 1G6NA 2P4WA 1ZRDA 1FLIA 4A5MA 3GUDA 2Q2EA 2QLZA 2V79A 4LB5A 1Z05A 2GWRA 2KIUA 3T8TA 2Z3YA 3E5QA 1S8NA 2A68F 4UV9A 1FYMA 4ZYDA 2V9VA 1F5TA 2GA2A 3OV8A 5L3DA 5LHGA 5A2QK 4CYDA 1R00A 4IHSA 2HS5A 3LQQA 2O03A 3IL2A 4ENJA 1DP7P 3GF2A 1H9TA 1FP1D 3U2RA 2MLGA 4RGRA 3KETA 3HSEA 2JT1A 4O6JA 2P5KA 3E6CC 1DDNA 2F5FA 4RB0A 3L00A 4GGGA 1JE8A 1KU7A 2XAGA 3ZMSA 1FPQA 2CGPA 5JR3A 4I2OA 1RI7A 2G7UA 1PP8F 2EA2A 3DFGA 5DUKA 2XAHA 3K1PA 1KYZA 4KFCA 3WTUC 1QBJA 1MDMB 4I7HA 3QOPA 5D8LB 1R5HA 2FOKA 1W7PD 4HF1A 3HRTA 2EK5A 4YG2F 3L9FA 1R23A 1QQIA 3D0SA 1REPC 2QENA 3WTWC 4YIFA 1TQMA 1OYIA 2VBXA 3WU1B 2HEOA 2A5YB 2CSOA 3U9GA 3CUQB 3BWGA 4HQEA 1J9IA 1U5TC 2VOOA 1MJBA 1R36A 2WV0A 4BQAA 5LRSA 1EH7A 3KP5A 1AOYA 4HDUA 3D5LA 1T39A 4U7DA 3TKYA 2HTJA 4L9TA 4ZH4F 2P7CB 4LG0B 3QU3A 1IRGA 3EETA 4EJUA 3FZVA 3FXRA 2AXLA 1F4KA 4EGYA 4NB5A 5KVRA 2JPBA 2EFNA 3F6OA 2PJPA 2QQBA 1VTNC 5BQTA 1PUEE 4NHJA 1HW5A 3J81Z 1CF7B 3GX4X 1JHFA 1B9MA 4Q48A 1S7OA 2W85A 1ULYA 1J5YA 1QNTA 3ISPA 4ZYGA 3T1BA 3JTHA 1Z9CA 1W5TA 4CXFA 2KJCA 3RPUA 3LQRA 4I0AA 1A04A 1BC7C 1C0WA 4G6DA 2L3DA 3ULQB 3WE3A 1SMYF 1SFUA 4L5JA 4FT8A 2NAZA 5EEGA 1S3JA 2CQKA 4IRGA 1FNNA 4HOBA 3ZQ7A 4LK1F 2XV4S 2Y75A 3F3XA 3T0YA 3GFJA 1KGSA 4BHPA 2EFWA 1ZRFA 1FP2A 2LSOA 3F8FA 3ROUA 2QWWA 4CDGA 4N0BA 3F8BA 2D1HA 1HXDA 2O3FA 1YYVA 1Z7UA 2ELHA 1TNSA 5JI6A 3LAPA 3HYIA 2XVCA 1O3RA 5K5QA 2DPUA 2HYGD 4NQWA 4M72A 1W7PB 2K02A 3Q9SA 1B9NA 5FFXA 5D4RA 1IZ1A 4GYGA 1KU2A 1OYYA 2JZYA 4U0WA 4E70A 2F2EA 2ZNYA 1IUYA 1W5SA 3G3ZA 4RAYA 4HLYA 2IP2A 1K78A 5HLHA 4M9XA 5D5WB 3QPTA 1T0FA 2P6TA 2KKOA 2OAZA 2FSWA 5LLQA 3KCCA 2MBFA 3ZMTA 3GYHX 1EV7A 2ZJ2A 3MWMA 3R6SA 1G3WA 1S29A 3QU6A 4TV7A 1XSVA 2HWVA 3RDIA 5D4SA 4UVAA 1IN8A 1MKMA 3J81K 3LFKA 1ZYRF 1OR7A 2IW5A 3BZ6A 2QUFA 2ISZA 1RUNA 4Q4ZF 1XGMA 5D5UB 1D8KA 2DBBA 5DV5A 5D5XB 1Z6TA 3W6JB 2RGVA 3JSOA 4ETSA 2WWYA 3CJNA 4HV6A 5H20A 2CO5A 3J7AO 1ZARA 2EFPA 2O61A 1LNWA 4UXNA 4HF0A 1V3FA 4Q47A 1O3SA 1B1BA 5CYVA 1JXSA 1G3SA 4IXAA 4M73A 3I4PA 1USTA 1FY7A 5ED4A 5D6EA 3DKWA 4O5VA 3HTSB 3EYIA 2HQNA 3H92A 2FQ3A 2VT3A 2E7XA 4WF2A 1BBYA 2VBWA 3GZ5A 4ZZDA 1YIOA 3F22A 3I54A 1SD6A 3K69A 4PCQA 2OQRA 3HHGA 5LHHA 3IWFA 1ZLJA 2M87A 1E17A 2EV6A 1GXPA 4Y13A 4MEYF 5IT9Z 2YPRA 4RGSA 3EQLF 1TW3A 3VFZA 3PFIA 2H6CA 3LA7A 5AIQA 2QYOA 3I59A 1FC3A 2X4HA 3RTRA 3ZMVA 4HDVA 3DQVC 1XDSA 3V7CA 5TRDA 4KNYA 1U5TA 4JK1X 1XMKA 1XCVA 5LBQA 3P9IA 5FD6A 2H27A 2VODA 1BC8C 3HRSA 3QP6A 2BEOA 4YFNF 4P5OA 3JTGA 2DLLA 2UXNA 5E1XA 1OMIA 1J0RA 2CFXA 1Z1DA 3WE2A 2KIMA 3VOEA 1I6XA 3ZMZA 2HFHA 2PI0A 4R79A 1WI9A 3F23A 2HYFA 4U0VA 2RN7A 4G6QA 2DO7A 2VBYA 3NQOA 1LEBA 3FMSA 2RQPA 4OINF 1GXQA 1ZHFA 2RVCA 4PZJA 2X0LA 4R1HA 4Y15A 1U3EM 5ICCA 3CTAA 1IRFA 1I5ZA 3KZYA 1ODDA 4RB1A 3H3UA 1IN6A 5ERIA 3FM5A 3BPXA 5DCFA 3ERED 2L4AA 3QP5A 1ZG5A 2XASA 1STZA 2ZNZA 4U88A 4AIKA 2JSCA 3JSPA 3IKTA 3J80K 5HDKA 2EB7A 1R7JA 4UVCA 1SD5A 2Q8KA 1FX7A 2MH2A 2FNPA 3KP4A 1FWZA 2LDUA 2DAOA 5HS9A 2RKHA 2EV5A 3HTUA 2MA3A 4S05A 3I5UA 1O7LA 4M6XA 5CLSA 2XGXA 2EJRA 5IT9K 5K5RA 3ZN1A 2A61A 3WTXC 1YS6A 3HOSA 2Z33A 4L0YB 1I1SA 1PDNC 5HLIA 1QZYA 1DPRA 2QQAA 5CJ9A 2Q0OA 4CICA 2KIFA 4CZZA 2OD5A 2XKOA 3QRFF 4UUVA 1BI2A 2HDCA 3DPTA 2L4MA 4EJTA 2R7DA 1LB2A 1XB4A 3VEPA 1IAWA 1XD7A 3OOPA 4LGWA 3F8NA 1OPCA 5CVJA 4I09A 1H0MA 2GA1A 3EDPA 1F9NA 1S6LA 3LA3A 5F6FA 3TO6A 2VBZA 2O0YA 1J75A 2GAUA 2OZUA 4RS8A 2ESNA 3GFLA 3RYRA 3M9AA 4M9ZA 1ZGJA 3SZPA 5HDGA 1MD0A 2DW4A 5LHIA 1O3QA 1JGSA 2PFBA 5L3BA 3M8FA 4OIRF 1KA8A 2K4JA 1LDDA 1HKQA 1UCRA 2VE8A 4KYWA 3C18A 4EJOA 2K7LA 3FHZA 4OMYA 3MEXA 4AVPA 4EMSA 1FBUA 2EFQA 2VOPA 1KQ8A 4LLNA 3BY6A 4OOIA 2LF8A 2Z9OA 4LK0F 2IVMA 4CO8A 4JBAA 2K4BA 2QBYB 3HRUA 3WODF 3V8JA 2E7WA 3RKYA 2FU4A 2JTVA 3ZMUA 2NRAC 2W57A 2KJBA 3ZPLA 4WX9A 3FMRA 3LWFA 3WG9A 3F8MA 2M30A 5D5VB 2R7FA 5DD4A 2MD5A 3U1DA 5J8FA 4I0BA 1MDMA 3C7JA 1RUOA 4IPAA 1HKSA 2NYXA 2YSRA
chains in the Genus database with same CATH superfamily
1T98A 2NNYA 2FNAA 4HZFA 5ILVA 1S5LC 1HCRA 1RKTA 4PFPA 2HR3A 4F91B 4A6DA 3CC7I 2E1MC 1Y39A 2ACJA 3GWZA 4C2TA 2DI3A 3OYAA 3IH2A 1DQUA 1O7FA 1ZAOA 3BCBA 4L5IA 1AWCA 1YRNA 2OUMA 3O8GA 2UWMA 4A3EJ 1ZH5A 1ENHA 2E2HJ 1U78A 1FT9A 2O6GE 3CUQA 3GVAA 2FE3A 3OR2C 1TWHJ 4XBFA 1D0ZA 2G7HA 3VSLA 3FKJA 2WB1N 5JVTA 2L5QA 3ZQIA 4F55A 4NBQA 2R7OA 3FKIJ 3C2HA 1MJAA 4P9FA 1GUUA 2L2OA 1D8JA 2GLOA 4I76A 4JX5A 3I0TA 1EF4A 3CF2A 2LG4A 3KLOA 2WBMA 3MCZA 4WWCA 3HOWJ 2BYVE 2IA0A 3KEOA 2LK2A 5JLWA 2ZB9A 1OKRA 5AIPA 3UNGC 1Y8QB 2IS4A 3CJRB 1LDKB 4WCGA 3S2HJ 1T2KA 4EV0A 3WU0A 3ZQQA 2COMA 5F0HA 1KYWA 2M5WA 2P5VA 2NS0A 2VN2A 5HDNA 3BZCA 2VJIA 1QVUA 3H5AA 3KP2A 3R61A 3WGGA 1OLTA 5FGMA 3K4NA 3GCMA 4GO1A 2VPLA 2GIVA 4P9UA 1SC7A 3KIOA 3REOA 4NUBA 3SZTA 1CF7A 1DGRM 3K6GA 2Y31A 5CQEA 1Z21A 3AL0B 1E2XA 4ESJA 5E8IA 1R5ID 1FOXA 3BJAA 2A5WA 4II3A 2XGEA 3ZP5A 2JVHA 3CO7C 3SFZA 3S16J 4ENKA 3BOQA 2RNGA 4NDLA 3S14J 4DYQA 5DD8A 3DBRB 1G2HA 3ZMDA 2E35A 1SFEA 2HQRA 3HXLA 3HOTA 4BY1J 2EFOA 1YE9A 4CYCB 3Q0WA 3KZIC 1XGSA 1LFBA 1A6IA 3QAHA 1LQ1A 3BZKA 2W25A 1Z91A 1IRZA 5M5XJ 3RJPA 4YFXF 1MBFA 4A6EA 1HQCA 1DUXC 3MZHA 3CO6C 2H94A 3CP8A 1OYWA 1QRYA 4NNJA 1VNDA 5HLGA 2IA2A 1ORKA 1ZR4A 2JA6J 3RQIA 4RB2C 1X1BA 1PUFB 3DXJF 2EIKH 2R5YB 3H3ZA 1K78B 4EGZA 3DPLC 2QEXI 1YJNI 4LJZF 3PQJA 1XPXA 4EATA 2DDAA 3F6VA 2F5CA 1FMWA 1X3UA 3NWSA 1JUPA 2G9WA 2DXIA 5FLXZ 1PYVA 4HEA2 1ONVA 1AKHA 4A3GJ 4HX7A 1J2XA 2Y2ZA 2ZKZA 5LGNA 4OMZA 2R5ZB 3VYUB 5EEHA 5BOXA 1K4SA 1FSEA 4GCVA 1WJ5A 4OU0A 5E20A 2JA2A 4FHTA 3VDXA 2J5PA 4MNUA 3LFUA 3C3WA 1FOKA 2HVRA 2M1BA 3ABKH 3ERMA 4XK4A 2AQFA 2FA5A 3LOCA 2Z16A 3OYIA 4ENNA 3LSRA 1TTYA 1T33A 1YS7A 1UB9A 1W7PA 4Y7NJ 1YG2A 2E34A 2HZTA 4L9VA 3E97A 2HXIA 1R6RA 3OSFA 3A01B 4XORA 4CCKA 4F52A 3S1QJ 1VQMI 2IT0A 1BOAA 1MZBA 2DN0A 2WA0A 4HV5A 5BPDA 1MGTA 4A0XA 2HKOA 2MSYA 3LA2A 4IKFA 3N4MA 1UHWA 1VFCA 2WAQA 5BMZA 3BROA 2XAJA 3U21A 2H6BA 5IOZA 1SAXA 3NEUA 2GZWA 2IA1A 4IQ4A 3RKWA 3GTMJ 5FB2A 2H09A 2JVGA 5F0CA 1G3YA 3CLOA 2M2EA 1XSDA 5KHDA 3CMAI 1DP3A 3K10A 1UG2A 1JGGA 2EZKA 1WRJA 1K7AA 2E1CA 1USSA 1X2NA 3MD2A 5LGUA 4A3MJ 3BP8A 3HL2A 5ILSA 3A03A 3JW4A 4XLAA 1F36A 2QZ8A 5F64A 1L3LA 2PJRB 4AD9A 1IN4A 3K70D 1TNTA 2X6XA 3PQKA 5J40A 3ZQHA 4FX4A 2P0WA 1J09A 1ZTRA 4BQNA 1JKRC 1R49A 2FUG2 3K0LA 3BR3A 2DU9A 2BV6A 2GBYA 1JHHA 2K86A 2R7RA 2FBIA 1TQIA 3OYMA 2JPCA 3DEWA 4IHYA 2M7BA 2MH9A 2DOFA 2LR8A 2NVQJ 4F3QA 1GVDA 3OYJA 4HX8A 1LVAA 2EA4A 2OTLI 4B3AA 3W6KB 2DK8A 2E71A 3R0AA 5CVVA 3QPHA 4BU2A 2A3SA 3N97A 2DQRA 1SFXA 2ECCA 2M7AA 4CCOA 1JUMA 4HA8A 2QM3A 4AYBA 1EH6A 2RDPA 2FMYA 1UAAA 1Z6RA 4ZDLA 2OBPA 4FETA 1NTCA 3HIFA 3BR1A 3KLNA 1MSEC 2JMWA 3HJEA 4LG3A 4G9YA 2WC2A 4PGGA 2VB6A 2ISYA 3P5JA 3QWLA 2R0QC 1O4XA 4C3IJ 1QPMA 4O3MA 2LTPA 1ETOA 2DTZA 4BXUA 2KRFA 4Y17A 4G7HF 2Z5UA 3CUQC 5GAEJ 5JFRA 2DTRA 5CPRB 5GAGJ 1T95A 3CMMA 3I59B 4B44A 3QODA 3HOXJ 2Z99A 2STWA 1BW5A 3E1SA 3G73A 1JUSA 3X2QH 3GTPJ 3FWEA 3L09A 1VQ9I 1XTAA 2YS9A 2PMZA 5FLXK 2V1UA 1HSJA 3K4MA 3KE2A 3BC8A 4QPOA 2L7ZA 3L2WA 1U5TB 3CCLI 1ETYA 3BR6A 5E8GA 4XLNF 3P7NA 1K83J 2D45A 4EQQA 3O2PE 5ICGA 1TP4A 1YLFA 2ICWG 3CCQI 3OL3A 1YX5A 4AU7A 3SQNA 4MEXF 4A3BJ 4XLFA 3L1PA 3C2GA 2DMPA 3IRRA 3GLXA 3PUFA 2IGKA 3O3KA 4BHCA 2C6YA 1B4AA 3LAJA 4OIQF 3WTSC 5H6RA 2DJNA 5E3NA 2KZVA 3DWLE 4BXFA 1V4RA 3A1YA 4AM3A 3LSHA 4ASNA 3FXUA 2XHKA 2NOGA 1S72I 2LC2A 2R3SA 1Z67A 2DYRH 1OCOH 2MW8A 3TL4X 4M3BA 1NHAA 4HNUA 2ELJA 2OF7A 5D6FA 1IN7A 4IRIA 3BPVA 3TP0A 4R8HA 2JRMA 2M4KA 3EUKL 1CQTA 1Z7LA 3CUOA 1PVEA 2DFIA 1YW8A 2W24A 3TDUC 4IOCF 2KIQA 3W6VA 4QTRA 1WKMA 3KP6A 4C30A 2JSPA 4BJ5C 1ON2A 1XGOA 2XRNA 5HNFA 4RDUA 3ZRGA 4UUSB 1WI3A 2W84A 3HGYA 5B1BH 4BHBA 2HOAA 4EVIA 1K6OA 4HQMA 1NH3A 1ETXA 5IP9J 1V5EA 2TDXA 1TT0A 4U7BA 1R4NB 5GTIC 1YW7A 3ESWB 2XROA 4CZCA 4IF4A 1E0EA 1XMXA 3JRIA 2WAFA 5J8CA 3ZQGA 2K9NA 2EZLA 4D7MA 1P4WA 5M3FJ 2V1XA 4BXXJ 2R7ZJ 4HF2A 5DCMB 1I3AA 4UHTA 3PO2J 2ZMEB 1ZG3A 5DEQA 2XSDC 2ZJPF 2AS5F 3K2ZA 2EQRA 3LSPA 3KP3A 2AQEA 1UFMA 1Y6IA 1FYLA 2CV0A 5HS8A 3G1MA 2IBDA 3CCJI 4RAFA 2CWEA 1VQ7I 4B8XA 4V2GA 3VYRB 3H3VK 4P1WA 2VKHA 2LF7A 1TT5B 3DP7A 3RQ4A 2M4GA 2ZSIB 2PG4A 3ZQFA 3GW2A 1D3YA 2NVXJ 3OIPA 4GYIA 5FRNA 1ERDA 5FKNA 1H9GA 5EJCA 4M9SA 2BVMA 3SDBA 2XIGA 5GAHJ 1B8IB 2VQCA 3JRCA 4NC7A 3R4KA 4ZYEA 1T6SA 2LMDA 4WXDA 1SVMA 4XMYA 3VYSB 3K4KA 3TOAA 1TC3C 3BCAA 1MJ9A 2Q2EB 5IP7J 2R4GA 4A2UA 3RPQA 1LE8B 1X1CA 1R1TA 2M0MA 2HQ5A 3BG6A 4XLEA 1R1UA 3ONQA 1T08B 3OS1A 2K9SA 4L5EA 1BI1A 4ZJZA 5FLVA 3WHBA 1YIJI 3GMEA 2ETHA 4EJVA 3G71I 3H5NA 3HKZN 5FKKA 2CS3A 1V5GA 3LSTA 3LNQA 5HVQC 1EA3A 2XKPA 3MKYB 2GXGA 2WADA 4EM2A 1QHGA 1Z3YA 4M6VA 4XR6A 1LDJA 1B72A 4EM1A 1QGPA 5L3FA 3FXKA 2V6CA 1HBXG 3W2AA 2FMLA 3IHUA 3RPUD 4HX4A 5TJJA 3V4GA 1WQ2A 4I99C 2PQ8A 4HYEA 5EGOA 2CW0F 4PUSA 3HOYJ 3DKYA 2ZC2A 4A0YA 2O8XA 2EV0A 5LGTA 2P5LC 5CQGA 4XRMA 1EKEA 3G2BA 1Q1HA 1HSTA 5BPIA 1DPUA 4BYYA 4BY7J 3OYEA 2ADUA 3V8LA 2RREA 3E6MA 4DQ2A 2CRGA 2V1NA 5L3EA 1RIOH 3KFWX 3Q9VA 5H6QA 5IYDJ 1ZG1A 1OQYA 1SD7A 2LKPA 3BTCA 1F1ZA 3CCYA 4LFUA 4U87A 3M1EA 3NAUA 1S9HA 1T8IA 1FYKA 2HU9A 4LLLA 1ZN2A 4MFDA 3TMOA 5E79C 3PNTA 2L9VA 1X1AA 2RNJA 2JRTA 2PMHA 1LKXA 4XQFA 4KMUX 4BAYA 3VODA 4IJAA 2GXBA 3SEZA 1FIPA 2EBIA 4YELA 2W1OA 4LLGF 1ETQA 2HNHA 3ABUA 1H8AC 1U6GA 3ECHA 2DOAA 1QVTA 1TZLA 3FXJA 4IRHA 4C3HJ 4BS9A 4X1EA 2CFOA 4HSTA 4L0ZB 2OU2A 5F1JA 1IW7F 1I27A 3KEYA 3C1DA 2PN6A 3IH4A 1HOMA 3MAJA 3PNVA 2NVYJ 1TW2A 2K27A 4RM2A 3PIOF 1YQAA 5IT3A 4AIHA 2CJJA 2JUGA 1MIJA 3WTYC 4L9NA 3QYEA 5LEKA 4B43A 4MTEA 5HLTA 1HA8A 4HNTA 2XUBA 3TO7A 2NNNA 4M6YA 1JTYA 3AG4H 2KDOA 1LPQA 1EJ9A 4GFBA 4M3GA 3DPUA 3DLAA 2FRHA 3HZJA 3GTLJ 2RV8A 1FSHA 2RC4A 4B09A 2LREA 2DK5A 3DF8A 2VE9A 1P92A 4X0GA 2M45A 5J1YA 3BT9A 5C44J 2XPWA 1BIAA 3I64A 5L3CA 2H8RA 4LMYA 1LVKA 3ZQCA 4ESFA 1UELB 2Y9YA 4U0YA 4AWXB 5FD5A 4I01A 5GP9A 4J19A 1YTYA 1SVOA 1U9OA 3KYCB 3JRFA 1K6YA 2BVLA 2VJJA 3U1KA 4KITB 1UHMA 2XB0X 3COAC 1R22A 4PDKA 4BDYA 4LB6B 3IKVA 4P96A 4UNOA 4XIDA 3OYLA 2JQ7A 1N75A 2VLAA 5JVGF 1BN5A 4KIFA 1ZLKA 1YI2I 3V7RA 3GXOA 2E1NA 5GPCA 4E7KA 3V7SA 4F93B 3I71A 4M3DA 5CVIA 4BDZA 1L0OC 1G3TA 2QSGX 3WGHA 2QSFX 4S0HB 1RZ4A 1GVJA 4HLXA 3DEUA 4PFOA 3PO3J 3H5RA 3BLYA 4PSXA 2XC7A 3HSFA 5AONA 2DQLA 3RI4A 1HW1A 4WXHA 4RA2A 4K2EA 2EILH 4KN4X 5FKMA 1EH8A 3E5XA 3KX2A 1WJEA 3E3VA 3OSGA 1V54H 2A69F 2XAFA 2OQGA 1DU6A 2JK3A 4CA0A 3P9CA 4JX4A 1WHUA 1P2FA 5GADJ 2QSHX 4DIQA 1WH5A 3OYFA 4BGDA 2IRFG 1TBXA 2XPUA 1QO0D 5EG0B 3RYPA 3ZN0A 1Y0UA 5E3MA 4ITVA 1W1WE 2OJED 4ZZLA 3F21A 3GTOJ 3FXLA 1WGXA 2QBYA 1YW9A 4BKXA 4E7ZA 1O57A 2QQ9A 1KQ0A 3I4MJ 2VJ4A 3FK7A 3HM5A 5B3SH 2B0LA 3EYYA 5EZHA 1NK2P 2QKLB 3ASNH 4KJZA 3EUHA 4BH9A 2KMUA 5EEAA 4E7IA 2DT5A 2M8GX 3MQ0A 3FX3A 4D0PA 1ZGAA 1X1PA 1XGNA 1ON1A 3ECOA 3RZOJ 1SD4A 2BXYA 2K5CA 3BR5A 2BOLA 1R9TJ 5E1ZB 4E4HA 3D5RC 3ML6A 4ON0A 5C3EJ 3IAS2 4N9IA 2YR2A 4XRSA 2VKEA 5ILUA 2E36A 5KK1A 4A5NA 1I50J 4XSXF 4IOAF 4LG0A 3R60A 3I58A 3WTVC 2QVOA 3FM3A 1WFXA 5J6XA 1BR1A 3MZYA 3V8KA 1BI0A 2ZO4A 4UVBA 4RB3C 3TW6A 1E3OC 4AIJA 2BBYA 4ANJA 1MMDA 2MFZA 3VPRA 2UUZA 1VQPI 2MC3A 4L18B 2YX7A 2VQHA 3GZ6A 2HGCA 1OCPA 3L7WA 4CGZA 2DCEA 1JTXA 1WJBA 1ETKA 3P9KA 2ID6A 1AA7A 1SFKA 3NARA 5L3GA 1IN5A 4PK4A 1ZREA 1BM9A 2CV1A 1XSXA 2ZXJA 4BJ6C 4LD5A 2WV1A 5J4VA 2EINH 1YFHA 1B6AA 3CCMI 1VQNI 2IJLA 4F7ZA 1LJ9A 3OS2A 5K7HA 4NQWB 3OIQA 1D0YA 2P8TA 2PEXA 1TWFJ 2FEZA 5FFZA 1K79A 3JAMZ 2HVSA 3HGGA 4XM3A 1VF9A 4NC8A 4OIOF 5LEJA 2DMNA 4X6AJ 4KICA 5J1UA 1ZK8A 5F0FA 3PJRA 3L2UA 2XGDA 2YX4A 2PMZN 1ZQ3P 1OCRH 3GEZA 4LOCA 4KT5C 1A36A 4Z2YA 2IGOA 2X48A 4P55A 2OCEA 4BJTA 3UKGA 4ESBA 1XCBA 2F5EA 3ABTA 2K40A 4G8XA 1WJDA 4M74A 2UZKA 5ICEA 2CU7A 3QPLA 3WTTC 2O5RA 5FROA 3F0CA 1YHQI 2XSJC 3IC7A 2FF4A 4KIBA 4OAZA 4C2MJ 2VI6A 1XDUA 3DBLB 3VSKA 1HKTA 4XLCA 3B73A 2WTEA 3CC4I 2IEKA 1CGPA 1IV6A 2DOEA 2LYCA 3HBLA 2Y0MA 4CYCA 4MIMA 4Y4RA 4WK8F 4JQFA 1BR4A 2V1DA 4XKCA 1N78A 2M8EA 3TGNA 1XN7A 3LMMA 4Z6YA 2B9SA 2LRDA 2NVTJ 2KRHA 1O3TA 1MBGA 4FCYA 4RGXA 2V6EA 3OL4A 1D1CA 1BJAA 2P81A 1TQPA 5BS6A 1JT0A 3OY9A 4BEHA 3NRVA 1BI3A 4DYCA 3FISA 2ESHA 3VB2A 4KMFA 2KPMA 2W82A 3ZOBA 1J59A 3CCUI 3BJOA 2PBIA 1VQ4I 3Q0VA 3LSGA 4HAMA 1I6HJ 4A12A 2FQ4A 4ZDPA 3S3NA 3IRQA 4EJWA 2QF7A 3K1MA 3BDDA 3ELKA 4WXCA 4E7JA 4IVNA 1FBSA 1HW2A 3Q5FA 2VC0A 3I55I 4ENMA 4L9JA 1B59A 5D8KB 1G4DA 4BBSJ 3H36A 2ZBKA 2PMUA 4JP0A 3MKWB 3TQNA 5E17F 3JREA 1WWXA 1WH7A 4MQVA 2HOEA 2VT2A 1RNLA 4PGHA 4H0EA 4QIWN 2A6EF 3RCOA 2R5ZA 1VQ5I 3OYNA 2LBFA 2ZCWA 3AAFA 2OA4A 4KUMA 4IHTA 1NG6A 1SMTA 1WSUA 4H4KC 4RGUA 5ICFA 1V55H 2HKXA 4DOZA 1A31A 4GRIA 3V42A 2L02A 4MTDA 3G6EI 2OTJI 1LEAA 2DA1A 4KDPA 2F5DA 1A5JA 3A2KA 2A07F 3T8RA 4YFKF 1SEUA 2DJIA 1LFUP 4XRFA 5GTHC 2MLKA 1KU3A 4OIPF 3T5XA 5J1RA 3WGIA 1IXRC 4XL9A 4FISA 2HTSA 4PJ0C 3HRMA 2R7SA 1R58A 2VC1A 2Z1DA 4HW0A 4JX6A 3OYDA 5IPAA 2UXXA 3DEEA 3M7GA 3A02A 4KA4A 2CW7A 2H1LA 3WTZA 1UG0A 2CH0A 2IS6A 5LRRA 2EZIA 2E60A 3B02A 3GFMA 4QWQA 4XLPF 3KP7A 3M8EA 4HBLA 3OMYA 2Y30A 2IXSA 3SHFA 4AVZA 5K5OA 5E18F 3F72A 5CKTA 5F08A 4Y3OA 4PJMA 3CCSI 3IWZA 4DZPA 5DDGA 1MW7A 3JAMK 1YX3A 4II2A 5K7ZA 4I02A 3G4SI 1YJ9I 2JWTA 2IAIA 1P4XA 1U0JA 5M5YJ 1FBQA 4PJLA 1T38A 1Y8RB 2PJRA 1KONA 3S2WA 1ZRCA 3GO5A 3KZZA 6PAXA 3E5UA 3GZNB 3K4CA 3OOUA 1U8BA 5CVUA 2A6HF 4G94A 4YIIA 2P6SA 2KDZA 2GIZA 2W7NA 1KZHA 3LL7A 3EUHC 5C4XJ 2CYYA 2P7VB 4CSWA 1PP7U 2IPQX 3BQYA 3FHNA 5K1YA 3J80Z 4XSZF 3FMQA 3K4JA 4D7NA 4BACA 1RRJA 2L9RA 4BNCA 4G7OF 5EYRA 3S93A 2E5NA 3RZDJ 3CMYA 5HS7A 4A93J 2YUSA 3I9V2 4M3FA 2XPVA 2LNBA 4A0ZA 2D1VA 5E1WA 3SXYA 3BJ6A 3FBIB 4IZZA 3HC7A 3TEDA 1QZZA 2EZHA 3WU2C 1I3QJ 3DKXA 4N9HA 4IO9F 3O6BB 4AIDA 3B6AA 4J00A 3S1MJ 4MHGA 3GTGJ 3SEQA 3MFKA 3KEQA 2YU3A 4M71A 2MC4A 1WJFA 3E6DA 3G1OA 3MVPA 1TLHB 2ME0A 2GQQA 2H8WA 3J7YJ 4PSWA 2E1MB 3F8CA 2Y48A 3SZGA 1IGNA 1GHCA 4HRIA 5EDNA 1XG1A 5A2QZ 4IX7A 2DPDA 1APLC 2V7FA 3TW7A 1IXSB 5J4YA 2OZ6A 2F5VA 3S32A 4EM0B 5K7FA 1MMAA 3HHHA 2KZGA 1P6RA 4QLCU 1IDZA 4MQ9F 4OWRB 1SFOJ 5JHUA 2VIXA 3GFIA 1XMAA 5DYMA 3FXMA 3S1NJ 4RAZA 2JA7J 5TISC 1YO5C 1KQ9A 4FX0A 4V19K 1IF1A 5FO5A 2W48A 1QA6A 4ABZA 3L2CA 5KCMA 2PLYA 4CHUA 2CMPA 2L9SA 4RLFA 3FF5A 2VXZA 2QGUA 3HSRA 3EUAA 2FXAA 1J7KA 4RLQA 1R5GA 1VQLI 2W4SA 1RC9A 1D5VA 3CMEI 2BGCA 4IL6C 4KN7X 4D5CA 4XICA 1V5FA 5FJ8J 1OCZH 2CUJA 2HYJA 1Z77A 1M1EB 4KIGA 3BTIA 3E6BA 2EPFA 3RIRA 3AL0C 1RR8C 4G7ZF 2VKDA 1P4AA 2VONA 3I53A 2FOWA 2RQQA 5HOOA 2L01A 3ZXSA 1BIBA 2J5OA 3HUGA 4I98B 4IEJA 2L54A 2FBHA 2BE5F 4LITA 1A6QA 2BW3B 5CVRA 2LKSA 1U8RA 2FBKA 4UV8A 3HOZJ 2CG4A 3E7LA 4YIRX 2ZFUA 1MNEA 4S04A 3R0JA 1RR7A 4UUSA 2R7TA 3PSIA 4PJJA 3CDLA 1VI0A 5C4JJ 3CJQB 1PJRA 4D1QA 2WY8Q 1Y1VJ 3K1NA 4DNCA 1NG7A 1IUFA 1UZCA 3OIOA 5FKOA 5DUIA 1D5YA 1R1VA 2XAQA 3CP2A 3TOBA 3DV8A 3TO9A 1U2WA 2LVSA 4A3IJ 2D2WA 5DCMA 1P9QC 2EWNA 2ZXIA 5F1RA 2ZMEA 1MMGA 1I1GA 2ZFWA 3RKXA 4Q5SF 3W3CA 3SJMA 1MH3A 1XX5A 2RAEA 1KU9A 3TDZC 4ZYHA 2BY2A 2QQ8A 1GDTA 2D5VA 3MZ8A 3CDHA 2O7OA 3DU5A 2STTA 4XOTA 2B7EA 1HC8A 1IXCA 1S7AA 4MGRA 3AG2H 1MNMC 3KPHA 4GXOA 2DA6A 3S3OA 1FZPB 1W4MA 2L7FP 4UUTA 2KRCA 3FXQA 1X2MA 3K9TA 1G6NA 2IGNA 2P4WA 4N4OB 2K3PA 3HOVJ 3BTJA 1ZRDA 1B8IA 1WVRA 4XNFA 1FLIA 3RSNA 4A5MA 3GUDA 2Q2EA 2QLZA 2CUEA 2V79A 1LE8A 2DT6A 1P7JA 4LB5A 1Z05A 3S8PA 2GWRA 2HI3A 2KIUA 1FMVA 3T8TA 2R7QA 2Z3YA 3E5QA 1S8NA 2A68F 3UR3C 4UV9A 3BQZA 1FYMA 4ZYDA 2V9VA 1F5TA 5KNLA 1OCCH 2GA2A 3OV8A 2DMQA 5L3DA 5LHGA 5A2QK 4CYDA 1S7EA 1R00A 4IHSA 2HS5A 3LQQA 2O03A 3I4NJ 3ABMH 3IL2A 4ENJA 1DP7P 3BG5A 2DODA 4E7LA 1OCTC 4M3EA 5DTDA 1X4PA 3GF2A 1H9TA 1FP1D 3U2RA 2MLGA 4RGRA 3KETA 3HSEA 3OYHA 1R71A 2JT1A 4O6JA 2P5KA 1QPIA 3E6CC 3E0JB 3IH3A 3WHCA 1DDNA 2F5FA 4RB0A 3L00A 4GGGA 1JE8A 1KU7A 1IV8A 2XAGA 3WG7H 3ZMSA 4Y52J 3A4CA 3JRAA 2F48A 3CCVI 1E3PA 1FPQA 2CGPA 3AG1H 3DTIA 2X6OA 3MKLA 5DM6F 5JR3A 4PJNA 1WZ2A 4A3KJ 5IP6A 4I2OA 3SYTA 1IG7A 5TGTA 2R93J 2BZTA 3BG9A 1RI7A 2G7UA 2IS2A 4FQGA 4DGWB 2BXZA 1PP8F 2ZXWH 2VQLA 4D9JA 2EA2A 3DFGA 1NK3P 5DUKA 3MMYB 2XAHA 1JKOC 1FIAA 3K1PA 1KYZA 3HOUJ 2GOXB 4KFCA 3H9QA 2I5UA 3WTUC 2OCCH 2X85A 1QBJA 3S2DJ 1MDMB 4I7HA 3QOPA 2NXNB 4MLOA 5D8LB 1R5HA 3MKZA 2FOKA 3PSFA 2I10A 1W7PD 3G1LA 4A3JJ 4HF1A 1FTTA 3HRTA 4DBQA 3IUOA 1YJWI 4XN0A 2O9LA 2FD5A 2EK5A 4YG2F 3L9FA 3FXOA 1R23A 2XGCA 1QQIA 2NS8A 1X19A 2DA5A 4D5FA 3D0SA 3DCFA 2QENA 1REPC 3WTWC 1TQMA 4YIFA 1OYIA 1YRNB 5B66C 2VBXA 3WU1B 2HEOA 2JA8J 2A5YB 5HNHA 2M34A 2CSOA 3U9GA 2K9LA 2CUZA 3CUQB 3BWGA 1JJ6C 2Q1ZB 2F4MB 1G59A 4HQEA 2CQQA 1J9IA 1U5TC 2BY0A 2KQRA 3CDIA 2VOOA 4BE0A 1MJBA 1R36A 2WV0A 4BQAA 2CQNA 2F6CA 2WAQN 5LRSA 3W2VA 2V9PA 1EH7A 3KP5A 1AOYA 4HDUA 2X1DA 3D5LA 2JN6A 3IP4B 1T39A 2HPMA 2R7UA 1RPWA 3OS0A 4U7DA 3TKYA 2EIJH 2HTJA 1VZ0A 4L9TA 4ZH4F 4B47A 2ECBA 1Y0NA 3PUBA 2P7CB 5J3LA 2I8DA 4LG0B 3QU3A 1IJWC 1IRGA 1U9NA 3EETA 2XF7A 4EJUA 3JCUC 3FZVA 2W00A 3FXRA 2AXLA 3HKZA 1F4KA 4EGYA 1MMNA 4NB5A 5KVRA 2JPBA 2EFNA 2LD5A 3F6OA 2Z2SB 2PJPA 1BA5A 2QQBA 1VTNC 2AXTC 5BQTA 1PUEE 2R92J 4NHJA 3H9JA 2LKXA 2R7WA 5KAFC 1JKPC 4MFEA 2JUCA 1LUJB 3LSIA 1HW5A 3J81Z 3HPHA 3GX4X 1CF7B 1JHFA 2K9QA 2V9KA 1B9MA 3LSKA 5EG0A 3GBGA 4Q48A 4IQJA 3GLLA 1S7OA 2W85A 3NWTA 2DMUA 4UB8C 2ZXHA 1ULYA 2L7KA 1J5YA 3QPSA 4CCMA 1H88C 4DYRA 1QNTA 3ISPA 3Q3SA 4C9YA 1TWCJ 3T1BA 4CCNA 4ZYGA 5FLMJ 5F27A 3JTHA 2DT7B 1Z9CA 2QCOA 1W5TA 4CXFA 2KJCA 3RPUA 2R7XA 3LQRA 1IDYA 2LH9A 1D1AA 4N4NB 4C2UA 4I0AA 1A04A 3SFIA 1BC7C 1C0WA 1N77A 3F9KA 4AYBN 4G6DA 2L3DA 3ULQB 1UJ8A 3WE3A 1SMYF 2G0EA 2ZMEC 3I3LA 1TWAJ 1K61A 3BTLA 1SFUA 2OPTA 4L5JA 2M3AA 3D5SC 1MH4A 4FT8A 5FRMA 2WAEA 2M0CA 4DJAA 2NAZA 5EEGA 1S3JA 2CQKA 1X58A 2XRLA 1FNNA 4IRGA 1YITI 5JHFA 5JLXA 3K70C 4HOBA 1GT0C 3ZQ7A 4LK1F 1DGWY 2CUFA 3CCEI 3CJTB 2XV4S 3JR9A 2Y75A 3F3XA 4DW6A 3T0YA 3GFJA 4QPQA 1KGSA 4BHPA 2EFWA 4V2FA 4B3XA 2HXOA 1ZRFA 1FP2A 3FIWA 2LSOA 3F8FA 4MO7A 3ROUA 1BL0A 2QWWA 4CDGA 4N0BA 2Y0SA 4YEJA 3ASOH 3GTQJ 1AKHB 3J7ZI 3S3MA 4KISA 3IV5A 1VQKI 5E3LA 1Z3XA 2LFBA 4W1UA 1P7IA 3F8BA 2D1HA 1HXDA 2O3FA 1YYVA 1Z7UA 2ELHA 4XKBA 1TNSA 5JI6A 1OFCX 3LAPA 3HYIA 2XVCA 1ETWA 1O3RA 5K5QA 2DPUA 5HODA 2LOOA 2HYGD 4NQWA 1G8XA 3TBIA 4BEHB 2CV2A 4M72A 1W7PB 2K02A 3BR0A 3Q9SA 1B9NA 5FFXA 5D4RA 4XLHA 3ABLH 1IZ1A 4GYGA 3ZGKA 3JRGA 4FE4A 3HEFA 1KU2A 1OYYA 2JZYA 1GV2A 2LY9A 4U0WA 3H9GA 2E2IJ 2AO9A 4E70A 2X9DA 2QA4I 2F2EA 4IHVA 3CQZJ 1QU3A 2R7VA 2ZNYA 1IUYA 1W5SA 3AFHA 2E19A 3G3ZA 1HDPA 3AKZA 4A3DJ 1PUFA 3CCRI 4RAYA 3CLQA 2R5YA 4HLYA 1RETA 2IP2A 1K78A 2LBFB 5HLHA 4XOPA 4M9XA 5D5WB 3QPTA 1T0FA 2P6TA 5M5WJ 2KKOA 2OAZA 1K4TA 2FSWA 2E2JJ 2TCTA 2IS1A 2L9NA 5LLQA 1JI8A 3KCCA 4AC0A 2MBFA 3ZMTA 3OYBA 1AHDP 3GYHX 1EV7A 3LSJA 2ZJ2A 2JJ7A 2DYSH 3MWMA 4UY8I 3R6SA 3A0HC 1G3WA 1S29A 3QU6A 4TV7A 1XSVA 2HWVA 1VQOI 4G6TB 3RDIA 5D4SA 2CQXA 4UVAA 1IN8A 1MKMA 3J81K 3LFKA 4W97A 4XKVA 2A6TA 3S17J 3DTKA 4YRVA 1ZYRF 1OR7A 2IW5A 4ZC3A 3BZ6A 1AU7A 2KFDA 3S15J 2V4JC 2QUFA 3PIPF 5J47A 2ISZA 1OJLA 5FKLA 3HG9A 4Q4ZF 1RUNA 3A01A 4ZDOA 1XGMA 5D5UB 1D8KA 2DBBA 1R4MB 2WB1A 5DV5A 5D5XB 2N8GA 3ZCOA 1VQ8I 3TP3A 3QQAA 1Z6TA 3W6JB 2RGVA 3JSOA 4ETSA 4E7HA 1W0UA 2WWYA 3CJNA 2CW8A 3KYLA 4HV6A 5H20A 2CO5A 3J7AO 1ZARA 2EFPA 3Q0UA 2O61A 1LNWA 2E5ZA 4RBOA 3BG7A 4UXNA 1SANA 3M4OJ 4HF0A 1V3FA 4Q47A 1O3SA 1B1BA 1GV5A 4JYKA 3C2BA 4BUPA 5CYVA 1JXSA 3N05A 2HZDA 1G3SA 5B1AH 4IXAA 4M73A 2DFHA 2VKVA 3I4PA 1USTA 2EH3A 3OWTA 1FY7A 4E6KG 5ED4A 5D6EA 3S1RJ 3PM1A 1ZELA 2A05A 3DKWA 4BL0B 1WJAA 2LY1A 2KP6A 4O5VA 4RAGA 4B4CA 3HTSB 3EYIA 2HOSA 3K7AJ 2HQNA 3H92A 2FQ3A 9ANTA 2VT3A 3L2VA 2E7XA 4WF2A 2MD0A 1X4OA 1BBYA 2YU9J 2VBWA 3PNYA 3GZ5A 2HVQA 4RMNA 5DM7F 4ZZDA 1YIOA 5LFAA 3F22A 4E7SA 3I54A 1SD6A 2WY7Q 5KAIC 3PL8A 2L0KA 2HQAA 3K69A 4PCQA 1QZEA 2X1CA 2OQRA 2KT0A 3A0BC 3HHGA 5LHHA 3M3YJ 2E1OA 2F4IA 4XN3A 3IWFA 3K4LA 1ZLJA 3L2RA 2M87A 1E17A 2EV6A 1ITYA 1JT6A 4Y13A 1GXPA 2KLOA 4MEYF 2ELKA 5IT9Z 2CQ7A 2YPRA 4RGSA 1ZKGA 3EQLF 3M8JA 1TW3A 1ZGWA 3VFZA 2H1KA 2QKMB 3PFIA 1X3ZB 1W36C 3RKQA 2VL8A 2H6CA 3LA7A 2VJ5A 2VASA 1A35A 5AIQA 2NVUB 2QYOA 3I59A 1SVLA 1FC3A 2X4HA 3RTRA 3ZMVA 4NC6A 4HDVA 3DQVC 3DLLF 2XF6A 1XDSA 3V7CA 3ZR8X 5TRDA 4KNYA 1U5TA 3H0GJ 4JK1X 4CCLA 4CH7A 1XMKA 4I6ZA 1XCVA 5LBQA 3P9IA 1MBHA 5FD6A 1MMSA 5H2FC 3DBHB 3QYFA 3OYGA 2FJ1A 3H1CA 2ZJQF 4ZTJA 1VQ6I 1IRXA 2H27A 1RKWA 2VODA 1F43A 1BC8C 3HRSA 4OAYA 3QP6A 2TRTA 2BEOA 1HLVA 2EIMH 4YFNF 4P5OA 3HUGB 3JTGA 1WCMJ 1BJZA 2DLLA 3K2AA 2XDVA 4JOMA 2UXNA 5E1XA 3ZQLA 1OMIA 1J0RA 2CFXA 1Z1DA 3WE2A 4F92B 2KIMA 3VOEA 1DU0A 3I56I 3QYBA 4HG2A 4A3FJ 1I6XA 2HOTA 4BE1A 1X3WB 4XONA 4ZYAA 3ZMZA 2HFHA 3LSMA 2K3FA 4A69C 3IAM2 4B1RA 2PI0A 1MBEA 3W2WA 1BW6A 4R79A 4XKWA 1WI9A 3VYTB 3F23A 2HYFA 2GOMA 2ME6A 4U0VA 1WJCA 2RN7A 3L2QA 4G6QA 1OISA 2DO7A 2VBYA 3NQOA 1LEBA 2HPIA 1GLNA 3FMSA 2RQPA 3HB9A 4OINF 1GXQA 4FTHA 1ZHFA 2RVCA 4PZJA 2X0LA 4R1HA 1SAUA 4Y15A 1U3EM 3CD6I 5E3OA 5ICCA 2MYSA 3CTAA 1IRFA 1I5ZA 2VPRA 3MN2A 4ZTFA 2XF5A 3EPZA 2ZJRF 3KZYA 5GPAA 3D1NI 1B72B 4RM3A 2BY1A 1ODDA 4RB1A 4BE2A 3H3UA 3J7AY 5EF6A 4EEFG 1IN6A 5ERIA 5EGOB 3FM5A 3BPXA 1N25A 5DCFA 1TL8A 3JRHA 3ERED 1IO2A 5EZGA 1T0FC 1HF0A 2DMTA 2L4AA 3QP5A 1ZG5A 2XASA 1STZA 2ZNZA 4U88A 4AIKA 2GM4A 3M07A 2NYXA 1FOWA 1FOYA 1Y56A 2JSCA 3JSPA 3IKTA 3J80K 2BW3A 4IHXA 5HDKA 2EB7A 1R7JA 3FDYA 4UVCA 1FEXA 1SD5A 2Q8KA 3B6CA 1FX7A 3H35A 2HDDA 2BHYA 4G12A 3GTKJ 1TWGJ 2MH2A 2FNPA 3KP4A 1FWZA 1W0TA 2LDUA 2DFFA 2DAOA 2X51A 5HS9A 2RKHA 4Y33A 2EV5A 3HTUA 4B48A 2MA3A 4IHWA 3K4BA 1Q1VA 4J01A 2JA5J 4S05A 3I5UA 4A3LJ 3O8HA 4AUXA 4DBRA 1W36D 1O7LA 1JKQC 1OR7C 1MNDA 4M6XA 2NOJB 5CLSA 5B5EC 3JRBA 1D0XA 2XGXA 2DDBA 2EJRA 4KT6A 5IT9K 3CF5F 5K5RA 5IY5H 3ZN1A 2A61A 2MG4A 2BHZA 3WTXC 1YS6A 4GDFA 5DS9A 1ZR2A 2DA2A 3HOSA 2Z33A 4XRSG 4L0YB 1I1SA 2DA3A 1PDNC 5HLIA 4FE7A 1QZYA 1DPRA 5IYCJ 2QQAA 5CJ9A 2IGMA 2KHMA 2Q0OA 2MABA 4CICA 2KIFA 4CZZA 2K9MA 5IYBJ 2OD5A 3HDDA 2XKOA 3QRFF 3BR2A 2F4OB 2LP0A 3PFYA 4BQQA 4UUVA 1WPKA 1QHHD 1BI2A 2HDCA 3GTJJ 4HNVA 3DPTA 1MSFC 2L4MA 3CZ6A 2OV7A 4EJTA 2R7DA 1LB2A 4FASD 1XB4A 1X1DA 3SDGA 3VEPA 2M9HA 2Y9ZA 1IAWA 3QOEA 4LIUA 1XD7A 3OOPA 4LGWA 2X1EA 3F8NA 1E3HA 1OPCA 2ZSHB 5CVJA 4I09A 1H0MA 2GA1A 2V26A 4DZJA 3EDPA 1ACIA 3CESA 1F9NA 2DA7A 2PX9A 1S6LA 3LA3A 5F6FA 3TO6A 2VBZA 4QSHA 2O0YA 2XAUA 1J75A 1FTZA 2GAUA 1Z0XA 2OZUA 4RS8A 2VXDA 2XB5A 2ESNA 2K85A 2Y0SN 5IOYA 3GFLA 3OR1C 3RYRA 1HDDC 3M9AA 4M9ZA 1ZGJA 2DFEA 3SZPA 2HDWA 5HDGA 3DU6A 1ETVA 1T56A 1MD0A 2AHQA 4CCJA 2DW4A 5LHIA 4CUGA 1D1BA 1O3QA 2Y69H 1JGSA 2PFBA 1XC5A 1FJLA 3HPGA 5L3BA 3DTEA 3M8FA 1IC8A 5M3MJ 4OIRF 1KA8A 2K4JA 1MBJA 4BBRJ 1BR2A 1LDDA 1UHSA 5LD2C 2O8KA 3FK6A 4UB6C 1HKQA 1UCRA 2VE8A 4KYWA 4BQOA 3C18A 4EJOA 2K7LA 2MGQA 1RESA 3FHZA 1H89C 1JJ8C 3BG3A 3VWBA 4OMYA 1BOBA 3MEXA 4AVPA 4EMSA 1XS9A 1FBUA 3AG3H 3M1CA 2EFQA 2B63J 2VOPA 1KQ8A 2LY2A 4LLNA 3BY6A 4OOIA 2BY3A 3OYCA 2X6WA 2LF8A 2Z9OA 4LK0F 2IVMA 4CO8A 4JBAA 1Y1WJ 2K4BA 5BNGA 3OYKA 1MBKA 2COBA 2QBYB 3HRUA 2NS7A 4LIVA 3WODF 3V8JA 2OC6A 2E7WA 2FX0A 2FU4A 3RKYA 3H0DA 2JTVA 3ZMUA 3KYDB 2NRAC 2W57A 2KJBA 3ZPLA 4WX9A 2UV1A 1W5CC 4HPQA 3FMRA 3FBNB 3JRDA 1LFPA 4A3CJ 4C3JJ 2KISA 2X6YA 3LWFA 3WG9A 2GXAA 2VUMJ 3F8MA 2L7MP 2M30A 3CC2I 5D5VB 2R7FA 1UMQA 5DD4A 2MD5A 3U1DA 5J8FA 2ID3A 4I0BA 2VQGA 3C7JA 1MDMA 1POGA 1RUOA 4IPAA 2KL4A 1HKSA 1YOVB 5F04A 4HSRA 2LLKA 2DA4A 2YSRA 1I39A
chains in the Genus database with same CATH topology
1T98A 2NNYA 2FNAA 4HZFA 5ILVA 2HR3A 4A6DA 2ACJA 3GWZA 2DI3A 1ZAOA 1O7FA 4L5IA 1AWCA 2UWMA 1ZH5A 1U78A 1FT9A 2O6GE 3CUQA 3GVAA 2FE3A 4XBFA 2G7HA 5JVTA 1MJAA 4P9FA 1D8JA 3I0TA 3KLOA 3MCZA 4WWCA 2BYVE 2IA0A 3KEOA 1OKRA 5AIPA 1LDKB 4WCGA 1T2KA 4EV0A 3WU0A 2COMA 1KYWA 2M5WA 2P5VA 2NS0A 2VN2A 5HDNA 3KP2A 3R61A 3WGGA 5FGMA 4GO1A 2GIVA 4P9UA 3REOA 3SZTA 1CF7A 1E2XA 4ESJA 5E8IA 3BJAA 3ZP5A 3CO7C 3SFZA 4ENKA 3BOQA 5DD8A 3ZMDA 1SFEA 2HQRA 3HOTA 2EFOA 1XGSA 3QAHA 1LQ1A 2W25A 1Z91A 3RJPA 4YFXF 4A6EA 1HQCA 1DUXC 3MZHA 3CO6C 2H94A 1OYWA 5HLGA 2IA2A 4RB2C 3DXJF 3H3ZA 1K78B 4EGZA 3DPLC 4LJZF 3PQJA 3F6VA 2F5CA 1X3UA 2G9WA 5FLXZ 1ONVA 4HX7A 1J2XA 2ZKZA 5LGNA 4OMZA 5EEHA 5BOXA 1FSEA 4GCVA 4OU0A 5E20A 4FHTA 2J5PA 4MNUA 1FOKA 3C3WA 2M1BA 2FA5A 4ENNA 1TTYA 1YS7A 1UB9A 1W7PA 1YG2A 2HZTA 4L9VA 3E97A 2IT0A 1BOAA 1MZBA 4HV5A 5BPDA 1MGTA 4A0XA 2HKOA 3LA2A 3N4MA 1UHWA 5BMZA 3BROA 2XAJA 2H6BA 1SAXA 3NEUA 2GZWA 2IA1A 3RKWA 5FB2A 2H09A 1G3YA 3CLOA 1XSDA 1WRJA 1K7AA 2E1CA 1USSA 5LGUA 3BP8A 5ILSA 3JW4A 2QZ8A 5F64A 1L3LA 4AD9A 1IN4A 1TNTA 3PQKA 4FX4A 3K0LA 2DU9A 2BV6A 1JHHA 2K86A 2FBIA 1TQIA 2JPCA 2MH9A 4HX8A 1LVAA 2EA4A 3W6KB 2DK8A 3R0AA 5CVVA 3QPHA 2A3SA 3N97A 2DQRA 1SFXA 4HA8A 2QM3A 1EH6A 2RDPA 2FMYA 1Z6RA 2OBPA 3HIFA 3KLNA 4G9YA 2WC2A 4PGGA 2ISYA 1QPMA 4O3MA 4BXUA 2KRFA 4Y17A 4G7HF 2Z5UA 3CUQC 5JFRA 2DTRA 3I59B 2Z99A 2STWA 3G73A 3FWEA 3L09A 5FLXK 2V1UA 1HSJA 3KE2A 1U5TB 5E8GA 4XLNF 3P7NA 2D45A 4EQQA 3O2PE 5ICGA 1YLFA 3SQNA 4MEXF 3IRRA 3GLXA 3O3KA 4BHCA 2C6YA 1B4AA 3LAJA 4OIQF 3WTSC 5H6RA 1V4RA 4ASNA 3FXUA 2XHKA 2R3SA 1NHAA 5D6FA 4IRIA 1IN7A 3BPVA 4R8HA 3CUOA 2DFIA 1YW8A 2W24A 3TDUC 1WKMA 3KP6A 1ON2A 1XGOA 2XRNA 2W84A 4BHBA 4EVIA 1K6OA 4HQMA 2TDXA 4U7BA 1YW7A 2XROA 4IF4A 5J8CA 1P4WA 2V1XA 4HF2A 5DCMB 4UHTA 2ZMEB 1ZG3A 5DEQA 2AS5F 3K2ZA 3KP3A 1UFMA 1FYLA 5HS8A 2CWEA 4B8XA 2LF7A 3DP7A 2PG4A 3GW2A 1D3YA 4GYIA 1H9GA 4M9SA 2XIGA 3R4KA 4ZYEA 1T6SA 4WXDA 3TOAA 1MJ9A 4A2UA 3RPQA 1R1TA 1R1UA 1BI1A 2ETHA 4EJVA 3LSTA 5HVQC 2XKPA 2GXGA 4EM2A 1LDJA 4EM1A 1QGPA 5L3FA 2V6CA 1HBXG 2FMLA 3IHUA 4HX4A 5TJJA 3V4GA 1WQ2A 2PQ8A 4HYEA 2CW0F 4A0YA 2O8XA 2EV0A 5LGTA 2P5LC 1Q1HA 1HSTA 5BPIA 1DPUA 4BYYA 2ADUA 3V8LA 3E6MA 4DQ2A 5L3EA 1RIOH 3KFWX 3Q9VA 5H6QA 1ZG1A 1SD7A 2LKPA 4LFUA 1F1ZA 3M1EA 1FYKA 4LLLA 1ZN2A 2RNJA 2JRTA 2PMHA 4KMUX 4BAYA 3VODA 4IJAA 2GXBA 4LLGF 3ABUA 1U6GA 3ECHA 4IRHA 4L0ZB 2OU2A 1IW7F 1I27A 3C1DA 2PN6A 3MAJA 1TW2A 2K27A 1YQAA 5IT3A 4AIHA 3WTYC 4L9NA 5LEKA 4MTEA 2XUBA 3TO7A 2NNNA 4M6YA 1FSHA 2FRHA 2RV8A 2RC4A 4B09A 2DK5A 3DF8A 2VE9A 1P92A 2M45A 1BIAA 5L3CA 3I64A 4LMYA 4ESFA 4U0YA 4AWXB 5FD5A 4I01A 1YTYA 1UHMA 3COAC 1R22A 4PDKA 4LB6B 3IKVA 4P96A 4UNOA 1BN5A 4KIFA 1ZLKA 3V7RA 3GXOA 2E1NA 3V7SA 3I71A 5CVIA 1L0OC 1G3TA 3WGHA 1RZ4A 1GVJA 4HLXA 3DEUA 3HSFA 5AONA 2DQLA 3RI4A 1HW1A 4WXHA 4K2EA 4KN4X 1EH8A 3E5XA 3E3VA 2A69F 2XAFA 2OQGA 3P9CA 1P2FA 2IRFG 1TBXA 1QO0D 3RYPA 3ZN0A 1Y0UA 3F21A 4ZZLA 2QBYA 1YW9A 1O57A 2QQ9A 1KQ0A 2B0LA 3EYYA 3EUHA 4BH9A 2DT5A 4D0PA 3MQ0A 3FX3A 1ZGAA 1XGNA 1ON1A 3ECOA 1SD4A 5E1ZB 3ML6A 4ON0A 4N9IA 2YR2A 5ILUA 5KK1A 4A5NA 4XSXF 4LG0A 3R60A 3I58A 3WTVC 2QVOA 3FM3A 5J6XA 3MZYA 3V8KA 1BI0A 2ZO4A 4UVBA 4RB3C 4AIJA 2BBYA 2MC3A 4L18B 2YX7A 3GZ6A 2HGCA 3L7WA 4CGZA 3P9KA 5L3GA 1IN5A 1ZREA 1BM9A 1XSXA 2ZXJA 4LD5A 1YFHA 1B6AA 2IJLA 4F7ZA 1LJ9A 2P8TA 2PEXA 2FEZA 5FFZA 1K79A 3JAMZ 4OIOF 5LEJA 4KICA 2YX4A 3GEZA 4KT5C 4Z2YA 4P55A 4ESBA 1XCBA 2F5EA 3ABTA 4G8XA 4M74A 2UZKA 5ICEA 3WTTC 3IC7A 2FF4A 4KIBA 1XDUA 1HKTA 3B73A 2WTEA 1CGPA 2Y0MA 4WK8F 4JQFA 2V1DA 2M8EA 3TGNA 1XN7A 1O3TA 4RGXA 1BJAA 1TQPA 5BS6A 3NRVA 1BI3A 2ESHA 3VB2A 4KMFA 1J59A 3BJOA 2PBIA 4HAMA 4A12A 3IRQA 4EJWA 3K1MA 3BDDA 3ELKA 4WXCA 4IVNA 1FBSA 1HW2A 3Q5FA 2VC0A 4ENMA 4L9JA 1B59A 5D8KB 1G4DA 2ZBKA 2PMUA 3TQNA 5E17F 1WWXA 4MQVA 2HOEA 2VT2A 1RNLA 4PGHA 4H0EA 2A6EF 2ZCWA 3AAFA 2OA4A 4KUMA 4IHTA 1SMTA 1WSUA 4RGUA 5ICFA 2HKXA 2L02A 4MTDA 1LEAA 4KDPA 2F5DA 2A07F 3T8RA 4YFKF 4XRFA 2MLKA 1KU3A 4OIPF 3T5XA 3WGIA 1IXRC 2HTSA 3HRMA 1R58A 2VC1A 4HW0A 2UXXA 3M7GA 4KA4A 3WTZA 5LRRA 3B02A 3GFMA 4QWQA 4XLPF 3KP7A 3M8EA 4HBLA 3SHFA 5K5OA 5E18F 3F72A 3IWZA 5DDGA 3JAMK 4I02A 1P4XA 1FBQA 1T38A 3S2WA 1ZRCA 3GO5A 3KZZA 6PAXA 3E5UA 5CVUA 2A6HF 4G94A 4YIIA 2P6SA 2CYYA 2P7VB 1PP7U 2IPQX 5K1YA 3J80Z 4XSZF 3FMQA 4BNCA 4G7OF 5HS7A 2LNBA 4A0ZA 2D1VA 5E1WA 3SXYA 3BJ6A 1QZZA 4N9HA 3O6BB 4MHGA 3MFKA 3KEQA 2YU3A 4M71A 3E6DA 1TLHB 2GQQA 3F8CA 2Y48A 1GHCA 5A2QZ 2DPDA 1IXSB 2OZ6A 4EM0B 3HHHA 1P6RA 4QLCU 4MQ9F 5JHUA 3GFIA 1XMAA 5DYMA 4RAZA 1YO5C 1KQ9A 4FX0A 1IF1A 5FO5A 3L2CA 4CHUA 2PLYA 3FF5A 2VXZA 3HSRA 2FXAA 1J7KA 1R5GA 1D5VA 2BGCA 4KN7X 4KIGA 3E6BA 3RIRA 4G7ZF 1P4AA 2VONA 3I53A 5HOOA 2L01A 1BIBA 2J5OA 3HUGA 4I98B 2L54A 2FBHA 2BE5F 5CVRA 1U8RA 2FBKA 4UV8A 2CG4A 4S04A 3R0JA 3K1NA 4DNCA 5DUIA 1R1VA 2XAQA 3TOBA 3DV8A 3TO9A 1U2WA 2D2WA 5DCMA 2EWNA 5F1RA 2ZMEA 1I1GA 2ZFWA 3RKXA 4Q5SF 1KU9A 3TDZC 4ZYHA 3CDHA 2STTA 1IXCA 1S7AA 4MGRA 4GXOA 1FZPB 1W4MA 3FXQA 3K9TA 1G6NA 2P4WA 1ZRDA 1FLIA 4A5MA 3GUDA 2Q2EA 2QLZA 2V79A 4LB5A 1Z05A 2GWRA 2KIUA 3T8TA 2Z3YA 3E5QA 1S8NA 2A68F 4UV9A 1FYMA 4ZYDA 2V9VA 1F5TA 2GA2A 3OV8A 5L3DA 5LHGA 5A2QK 4CYDA 1R00A 4IHSA 2HS5A 3LQQA 2O03A 3IL2A 4ENJA 1DP7P 3GF2A 1H9TA 1FP1D 3U2RA 2MLGA 4RGRA 3KETA 3HSEA 2JT1A 4O6JA 2P5KA 3E6CC 1DDNA 2F5FA 4RB0A 3L00A 4GGGA 1JE8A 1KU7A 2XAGA 3ZMSA 1FPQA 2CGPA 5JR3A 4I2OA 1RI7A 2G7UA 1PP8F 2EA2A 3DFGA 5DUKA 2XAHA 3K1PA 1KYZA 4KFCA 3WTUC 1QBJA 1MDMB 4I7HA 3QOPA 5D8LB 1R5HA 2FOKA 1W7PD 4HF1A 3HRTA 2EK5A 4YG2F 3L9FA 1R23A 1QQIA 3D0SA 1REPC 2QENA 3WTWC 4YIFA 1TQMA 1OYIA 2VBXA 3WU1B 2HEOA 2A5YB 2CSOA 3U9GA 3CUQB 3BWGA 4HQEA 1J9IA 1U5TC 2VOOA 1MJBA 1R36A 2WV0A 4BQAA 5LRSA 1EH7A 3KP5A 1AOYA 4HDUA 3D5LA 1T39A 4U7DA 3TKYA 2HTJA 4L9TA 4ZH4F 2P7CB 4LG0B 3QU3A 1IRGA 3EETA 4EJUA 3FZVA 3FXRA 2AXLA 1F4KA 4EGYA 4NB5A 5KVRA 2JPBA 2EFNA 3F6OA 2PJPA 2QQBA 1VTNC 5BQTA 1PUEE 4NHJA 1HW5A 3J81Z 1CF7B 3GX4X 1JHFA 1B9MA 4Q48A 1S7OA 2W85A 1ULYA 1J5YA 1QNTA 3ISPA 4ZYGA 3T1BA 3JTHA 1Z9CA 1W5TA 4CXFA 2KJCA 3RPUA 3LQRA 4I0AA 1A04A 1BC7C 1C0WA 4G6DA 2L3DA 3ULQB 3WE3A 1SMYF 1SFUA 4L5JA 4FT8A 2NAZA 5EEGA 1S3JA 2CQKA 4IRGA 1FNNA 4HOBA 3ZQ7A 4LK1F 2XV4S 2Y75A 3F3XA 3T0YA 3GFJA 1KGSA 4BHPA 2EFWA 1ZRFA 1FP2A 2LSOA 3F8FA 3ROUA 2QWWA 4CDGA 4N0BA 3F8BA 2D1HA 1HXDA 2O3FA 1YYVA 1Z7UA 2ELHA 1TNSA 5JI6A 3LAPA 3HYIA 2XVCA 1O3RA 5K5QA 2DPUA 2HYGD 4NQWA 4M72A 1W7PB 2K02A 3Q9SA 1B9NA 5FFXA 5D4RA 1IZ1A 4GYGA 1KU2A 1OYYA 2JZYA 4U0WA 4E70A 2F2EA 2ZNYA 1IUYA 1W5SA 3G3ZA 4RAYA 4HLYA 2IP2A 1K78A 5HLHA 4M9XA 5D5WB 3QPTA 1T0FA 2P6TA 2KKOA 2OAZA 2FSWA 5LLQA 3KCCA 2MBFA 3ZMTA 3GYHX 1EV7A 2ZJ2A 3MWMA 3R6SA 1G3WA 1S29A 3QU6A 4TV7A 1XSVA 2HWVA 3RDIA 5D4SA 4UVAA 1IN8A 1MKMA 3J81K 3LFKA 1ZYRF 1OR7A 2IW5A 3BZ6A 2QUFA 2ISZA 1RUNA 4Q4ZF 1XGMA 5D5UB 1D8KA 2DBBA 5DV5A 5D5XB 1Z6TA 3W6JB 2RGVA 3JSOA 4ETSA 2WWYA 3CJNA 4HV6A 5H20A 2CO5A 3J7AO 1ZARA 2EFPA 2O61A 1LNWA 4UXNA 4HF0A 1V3FA 4Q47A 1O3SA 1B1BA 5CYVA 1JXSA 1G3SA 4IXAA 4M73A 3I4PA 1USTA 1FY7A 5ED4A 5D6EA 3DKWA 4O5VA 3HTSB 3EYIA 2HQNA 3H92A 2FQ3A 2VT3A 2E7XA 4WF2A 1BBYA 2VBWA 3GZ5A 4ZZDA 1YIOA 3F22A 3I54A 1SD6A 3K69A 4PCQA 2OQRA 3HHGA 5LHHA 3IWFA 1ZLJA 2M87A 1E17A 2EV6A 1GXPA 4Y13A 4MEYF 5IT9Z 2YPRA 4RGSA 3EQLF 1TW3A 3VFZA 3PFIA 2H6CA 3LA7A 5AIQA 2QYOA 3I59A 1FC3A 2X4HA 3RTRA 3ZMVA 4HDVA 3DQVC 1XDSA 3V7CA 5TRDA 4KNYA 1U5TA 4JK1X 1XMKA 1XCVA 5LBQA 3P9IA 5FD6A 2H27A 2VODA 1BC8C 3HRSA 3QP6A 2BEOA 4YFNF 4P5OA 3JTGA 2DLLA 2UXNA 5E1XA 1OMIA 1J0RA 2CFXA 1Z1DA 3WE2A 2KIMA 3VOEA 1I6XA 3ZMZA 2HFHA 2PI0A 4R79A 1WI9A 3F23A 2HYFA 4U0VA 2RN7A 4G6QA 2DO7A 2VBYA 3NQOA 1LEBA 3FMSA 2RQPA 4OINF 1GXQA 1ZHFA 2RVCA 4PZJA 2X0LA 4R1HA 4Y15A 1U3EM 5ICCA 3CTAA 1IRFA 1I5ZA 3KZYA 1ODDA 4RB1A 3H3UA 1IN6A 5ERIA 3FM5A 3BPXA 5DCFA 3ERED 2L4AA 3QP5A 1ZG5A 2XASA 1STZA 2ZNZA 4U88A 4AIKA 2JSCA 3JSPA 3IKTA 3J80K 5HDKA 2EB7A 1R7JA 4UVCA 1SD5A 2Q8KA 1FX7A 2MH2A 2FNPA 3KP4A 1FWZA 2LDUA 2DAOA 5HS9A 2RKHA 2EV5A 3HTUA 2MA3A 4S05A 3I5UA 1O7LA 4M6XA 5CLSA 2XGXA 2EJRA 5IT9K 5K5RA 3ZN1A 2A61A 3WTXC 1YS6A 3HOSA 2Z33A 4L0YB 1I1SA 1PDNC 5HLIA 1QZYA 1DPRA 2QQAA 5CJ9A 2Q0OA 4CICA 2KIFA 4CZZA 2OD5A 2XKOA 3QRFF 4UUVA 1BI2A 2HDCA 3DPTA 2L4MA 4EJTA 2R7DA 1LB2A 1XB4A 3VEPA 1IAWA 1XD7A 3OOPA 4LGWA 3F8NA 1OPCA 5CVJA 4I09A 1H0MA 2GA1A 3EDPA 1F9NA 1S6LA 3LA3A 5F6FA 3TO6A 2VBZA 2O0YA 1J75A 2GAUA 2OZUA 4RS8A 2ESNA 3GFLA 3RYRA 3M9AA 4M9ZA 1ZGJA 3SZPA 5HDGA 1MD0A 2DW4A 5LHIA 1O3QA 1JGSA 2PFBA 5L3BA 3M8FA 4OIRF 1KA8A 2K4JA 1LDDA 1HKQA 1UCRA 2VE8A 4KYWA 3C18A 4EJOA 2K7LA 3FHZA 4OMYA 3MEXA 4AVPA 4EMSA 1FBUA 2EFQA 2VOPA 1KQ8A 4LLNA 3BY6A 4OOIA 2LF8A 2Z9OA 4LK0F 2IVMA 4CO8A 4JBAA 2K4BA 2QBYB 3HRUA 3WODF 3V8JA 2E7WA 3RKYA 2FU4A 2JTVA 3ZMUA 2NRAC 2W57A 2KJBA 3ZPLA 4WX9A 3FMRA 3LWFA 3WG9A 3F8MA 2M30A 5D5VB 2R7FA 5DD4A 2MD5A 3U1DA 5J8FA 4I0BA 1MDMA 3C7JA 1RUOA 4IPAA 1HKSA 2NYXA 2YSRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T98 A;  2NNY A;  2FNA A;  4HZF A;  5ILV A;  2HR3 A;  4A6D A;  2ACJ A;  3GWZ A;  2DI3 A;  1ZAO A;  1O7F A;  4L5I A;  1AWC A;  2UWM A;  1ZH5 A;  1U78 A;  1FT9 A;  2O6G E;  3CUQ A;  3GVA A;  2FE3 A;  4XBF A;  2G7H A;  5JVT A;  1MJA A;  4P9F A;  1D8J A;  3I0T A;  3KLO A;  3MCZ A;  4WWC A;  2BYV E;  2IA0 A;  3KEO A;  1OKR A;  5AIP A;  1LDK B;  4WCG A;  1T2K A;  4EV0 A;  3WU0 A;  2COM A;  1KYW A;  2M5W A;  2P5V A;  2NS0 A;  2VN2 A;  5HDN A;  3KP2 A;  3R61 A;  3WGG A;  5FGM A;  4GO1 A;  2GIV A;  4P9U A;  3REO A;  3SZT A;  1CF7 A;  1E2X A;  4ESJ A;  5E8I A;  3BJA A;  3ZP5 A;  3CO7 C;  3SFZ A;  4ENK A;  3BOQ A;  5DD8 A;  3ZMD A;  1SFE A;  2HQR A;  3HOT A;  2EFO A;  1XGS A;  3QAH A;  1LQ1 A;  2W25 A;  1Z91 A;  3RJP A;  4YFX F;  4A6E A;  1HQC A;  1DUX C;  3MZH A;  3CO6 C;  2H94 A;  1OYW A;  5HLG A;  2IA2 A;  4RB2 C;  3DXJ F;  3H3Z A;  1K78 B;  4EGZ A;  3DPL C;  4LJZ F;  3PQJ A;  3F6V A;  2F5C A;  1X3U A;  2G9W A;  5FLX Z;  1ONV A;  4HX7 A;  1J2X A;  2ZKZ A;  5LGN A;  4OMZ A;  5EEH A;  5BOX A;  1FSE A;  4GCV A;  4OU0 A;  5E20 A;  4FHT A;  2J5P A;  4MNU A;  1FOK A;  3C3W A;  2M1B A;  2FA5 A;  4ENN A;  1TTY A;  1YS7 A;  1UB9 A;  1W7P A;  1YG2 A;  2HZT A;  4L9V A;  3E97 A;  2IT0 A;  1BOA A;  1MZB A;  4HV5 A;  5BPD A;  1MGT A;  4A0X A;  2HKO A;  3LA2 A;  3N4M A;  1UHW A;  5BMZ A;  3BRO A;  2XAJ A;  2H6B A;  1SAX A;  3NEU A;  2GZW A;  2IA1 A;  3RKW A;  5FB2 A;  2H09 A;  1G3Y A;  3CLO A;  1XSD A;  1WRJ A;  1K7A A;  2E1C A;  1USS A;  5LGU A;  3BP8 A;  5ILS A;  3JW4 A;  2QZ8 A;  5F64 A;  1L3L A;  4AD9 A;  1IN4 A;  1TNT A;  3PQK A;  4FX4 A;  3K0L A;  2DU9 A;  2BV6 A;  1JHH A;  2K86 A;  2FBI A;  1TQI A;  2JPC A;  2MH9 A;  4HX8 A;  1LVA A;  2EA4 A;  3W6K B;  2DK8 A;  3R0A A;  5CVV A;  3QPH A;  2A3S A;  3N97 A;  2DQR A;  1SFX A;  4HA8 A;  2QM3 A;  1EH6 A;  2RDP A;  2FMY A;  1Z6R A;  2OBP A;  3HIF A;  3KLN A;  4G9Y A;  2WC2 A;  4PGG A;  2ISY A;  1QPM A;  4O3M A;  4BXU A;  2KRF A;  4Y17 A;  4G7H F;  2Z5U A;  3CUQ C;  5JFR A;  2DTR A;  3I59 B;  2Z99 A;  2STW A;  3G73 A;  3FWE A;  3L09 A;  5FLX K;  2V1U A;  1HSJ A;  3KE2 A;  1U5T B;  5E8G A;  4XLN F;  3P7N A;  2D45 A;  4EQQ A;  3O2P E;  5ICG A;  1YLF A;  3SQN A;  4MEX F;  3IRR A;  3GLX A;  3O3K A;  4BHC A;  2C6Y A;  1B4A A;  3LAJ A;  4OIQ F;  3WTS C;  5H6R A;  1V4R A;  4ASN A;  3FXU A;  2XHK A;  2R3S A;  1NHA A;  5D6F A;  4IRI A;  1IN7 A;  3BPV A;  4R8H A;  3CUO A;  2DFI A;  1YW8 A;  2W24 A;  3TDU C;  1WKM A;  3KP6 A;  1ON2 A;  1XGO A;  2XRN A;  2W84 A;  4BHB A;  4EVI A;  1K6O A;  4HQM A;  2TDX A;  4U7B A;  1YW7 A;  2XRO A;  4IF4 A;  5J8C A;  1P4W A;  2V1X A;  4HF2 A;  5DCM B;  4UHT A;  2ZME B;  1ZG3 A;  5DEQ A;  2AS5 F;  3K2Z A;  3KP3 A;  1UFM A;  1FYL A;  5HS8 A;  2CWE A;  4B8X A;  2LF7 A;  3DP7 A;  2PG4 A;  3GW2 A;  1D3Y A;  4GYI A;  1H9G A;  4M9S A;  2XIG A;  3R4K A;  4ZYE A;  1T6S A;  4WXD A;  3TOA A;  1MJ9 A;  4A2U A;  3RPQ A;  1R1T A;  1R1U A;  1BI1 A;  2ETH A;  4EJV A;  3LST A;  5HVQ C;  2XKP A;  2GXG A;  4EM2 A;  1LDJ A;  4EM1 A;  1QGP A;  5L3F A;  2V6C A;  1HBX G;  2FML A;  3IHU A;  4HX4 A;  5TJJ A;  3V4G A;  1WQ2 A;  2PQ8 A;  4HYE A;  2CW0 F;  4A0Y A;  2O8X A;  2EV0 A;  5LGT A;  2P5L C;  1Q1H A;  1HST A;  5BPI A;  1DPU A;  4BYY A;  2ADU A;  3V8L A;  3E6M A;  4DQ2 A;  5L3E A;  1RIO H;  3KFW X;  3Q9V A;  5H6Q A;  1ZG1 A;  1SD7 A;  2LKP A;  4LFU A;  1F1Z A;  3M1E A;  1FYK A;  4LLL A;  1ZN2 A;  2RNJ A;  2JRT A;  2PMH A;  4KMU X;  4BAY A;  3VOD A;  4IJA A;  2GXB A;  4LLG F;  3ABU A;  1U6G A;  3ECH A;  4IRH A;  4L0Z B;  2OU2 A;  1IW7 F;  1I27 A;  3C1D A;  2PN6 A;  3MAJ A;  1TW2 A;  2K27 A;  1YQA A;  5IT3 A;  4AIH A;  3WTY C;  4L9N A;  5LEK A;  4MTE A;  2XUB A;  3TO7 A;  2NNN A;  4M6Y A;  1FSH A;  2FRH A;  2RV8 A;  2RC4 A;  4B09 A;  2DK5 A;  3DF8 A;  2VE9 A;  1P92 A;  2M45 A;  1BIA A;  5L3C A;  3I64 A;  4LMY A;  4ESF A;  4U0Y A;  4AWX B;  5FD5 A;  4I01 A;  1YTY A;  1UHM A;  3COA C;  1R22 A;  4PDK A;  4LB6 B;  3IKV A;  4P96 A;  4UNO A;  1BN5 A;  4KIF A;  1ZLK A;  3V7R A;  3GXO A;  2E1N A;  3V7S A;  3I71 A;  5CVI A;  1L0O C;  1G3T A;  3WGH A;  1RZ4 A;  1GVJ A;  4HLX A;  3DEU A;  3HSF A;  5AON A;  2DQL A;  3RI4 A;  1HW1 A;  4WXH A;  4K2E A;  4KN4 X;  1EH8 A;  3E5X A;  3E3V A;  2A69 F;  2XAF A;  2OQG A;  3P9C A;  1P2F A;  2IRF G;  1TBX A;  1QO0 D;  3RYP A;  3ZN0 A;  1Y0U A;  3F21 A;  4ZZL A;  2QBY A;  1YW9 A;  1O57 A;  2QQ9 A;  1KQ0 A;  2B0L A;  3EYY A;  3EUH A;  4BH9 A;  2DT5 A;  4D0P A;  3MQ0 A;  3FX3 A;  1ZGA A;  1XGN A;  1ON1 A;  3ECO A;  1SD4 A;  5E1Z B;  3ML6 A;  4ON0 A;  4N9I A;  2YR2 A;  5ILU A;  5KK1 A;  4A5N A;  4XSX F;  4LG0 A;  3R60 A;  3I58 A;  3WTV C;  2QVO A;  3FM3 A;  5J6X A;  3MZY A;  3V8K A;  1BI0 A;  2ZO4 A;  4UVB A;  4RB3 C;  4AIJ A;  2BBY A;  2MC3 A;  4L18 B;  2YX7 A;  3GZ6 A;  2HGC A;  3L7W A;  4CGZ A;  3P9K A;  5L3G A;  1IN5 A;  1ZRE A;  1BM9 A;  1XSX A;  2ZXJ A;  4LD5 A;  1YFH A;  1B6A A;  2IJL A;  4F7Z A;  1LJ9 A;  2P8T A;  2PEX A;  2FEZ A;  5FFZ A;  1K79 A;  3JAM Z;  4OIO F;  5LEJ A;  4KIC A;  2YX4 A;  3GEZ A;  4KT5 C;  4Z2Y A;  4P55 A;  4ESB A;  1XCB A;  2F5E A;  3ABT A;  4G8X A;  4M74 A;  2UZK A;  5ICE A;  3WTT C;  3IC7 A;  2FF4 A;  4KIB A;  1XDU A;  1HKT A;  3B73 A;  2WTE A;  1CGP A;  2Y0M A;  4WK8 F;  4JQF A;  2V1D A;  2M8E A;  3TGN A;  1XN7 A;  1O3T A;  4RGX A;  1BJA A;  1TQP A;  5BS6 A;  3NRV A;  1BI3 A;  2ESH A;  3VB2 A;  4KMF A;  1J59 A;  3BJO A;  2PBI A;  4HAM A;  4A12 A;  3IRQ A;  4EJW A;  3K1M A;  3BDD A;  3ELK A;  4WXC A;  4IVN A;  1FBS A;  1HW2 A;  3Q5F A;  2VC0 A;  4ENM A;  4L9J A;  1B59 A;  5D8K B;  1G4D A;  2ZBK A;  2PMU A;  3TQN A;  5E17 F;  1WWX A;  4MQV A;  2HOE A;  2VT2 A;  1RNL A;  4PGH A;  4H0E A;  2A6E F;  2ZCW A;  3AAF A;  2OA4 A;  4KUM A;  4IHT A;  1SMT A;  1WSU A;  4RGU A;  5ICF A;  2HKX A;  2L02 A;  4MTD A;  1LEA A;  4KDP A;  2F5D A;  2A07 F;  3T8R A;  4YFK F;  4XRF A;  2MLK A;  1KU3 A;  4OIP F;  3T5X A;  3WGI A;  1IXR C;  2HTS A;  3HRM A;  1R58 A;  2VC1 A;  4HW0 A;  2UXX A;  3M7G A;  4KA4 A;  3WTZ A;  5LRR A;  3B02 A;  3GFM A;  4QWQ A;  4XLP F;  3KP7 A;  3M8E A;  4HBL A;  3SHF A;  5K5O A;  5E18 F;  3F72 A;  3IWZ A;  5DDG A;  3JAM K;  4I02 A;  1P4X A;  1FBQ A;  1T38 A;  3S2W A;  1ZRC A;  3GO5 A;  3KZZ A;  6PAX A;  3E5U A;  5CVU A;  2A6H F;  4G94 A;  4YII A;  2P6S A;  2CYY A;  2P7V B;  1PP7 U;  2IPQ X;  5K1Y A;  3J80 Z;  4XSZ F;  3FMQ A;  4BNC A;  4G7O F;  5HS7 A;  2LNB A;  4A0Z A;  2D1V A;  5E1W A;  3SXY A;  3BJ6 A;  1QZZ A;  4N9H A;  3O6B B;  4MHG A;  3MFK A;  3KEQ A;  2YU3 A;  4M71 A;  3E6D A;  1TLH B;  2GQQ A;  3F8C A;  2Y48 A;  1GHC A;  5A2Q Z;  2DPD A;  1IXS B;  2OZ6 A;  4EM0 B;  3HHH A;  1P6R A;  4QLC U;  4MQ9 F;  5JHU A;  3GFI A;  1XMA A;  5DYM A;  4RAZ A;  1YO5 C;  1KQ9 A;  4FX0 A;  1IF1 A;  5FO5 A;  3L2C A;  4CHU A;  2PLY A;  3FF5 A;  2VXZ A;  3HSR A;  2FXA A;  1J7K A;  1R5G A;  1D5V A;  2BGC A;  4KN7 X;  4KIG A;  3E6B A;  3RIR A;  4G7Z F;  1P4A A;  2VON A;  3I53 A;  5HOO A;  2L01 A;  1BIB A;  2J5O A;  3HUG A;  4I98 B;  2L54 A;  2FBH A;  2BE5 F;  5CVR A;  1U8R A;  2FBK A;  4UV8 A;  2CG4 A;  4S04 A;  3R0J A;  3K1N A;  4DNC A;  5DUI A;  1R1V A;  2XAQ A;  3TOB A;  3DV8 A;  3TO9 A;  1U2W A;  2D2W A;  5DCM A;  2EWN A;  5F1R A;  2ZME A;  1I1G A;  2ZFW A;  3RKX A;  4Q5S F;  1KU9 A;  3TDZ C;  4ZYH A;  3CDH A;  2STT A;  1IXC A;  1S7A A;  4MGR A;  4GXO A;  1FZP B;  1W4M A;  3FXQ A;  3K9T A;  1G6N A;  2P4W A;  1ZRD A;  1FLI A;  4A5M A;  3GUD A;  2Q2E A;  2QLZ A;  2V79 A;  4LB5 A;  1Z05 A;  2GWR A;  2KIU A;  3T8T A;  2Z3Y A;  3E5Q A;  1S8N A;  2A68 F;  4UV9 A;  1FYM A;  4ZYD A;  2V9V A;  1F5T A;  2GA2 A;  3OV8 A;  5L3D A;  5LHG A;  5A2Q K;  4CYD A;  1R00 A;  4IHS A;  2HS5 A;  3LQQ A;  2O03 A;  3IL2 A;  4ENJ A;  1DP7 P;  3GF2 A;  1H9T A;  1FP1 D;  3U2R A;  2MLG A;  4RGR A;  3KET A;  3HSE A;  2JT1 A;  4O6J A;  2P5K A;  3E6C C;  1DDN A;  2F5F A;  4RB0 A;  3L00 A;  4GGG A;  1JE8 A;  1KU7 A;  2XAG A;  3ZMS A;  1FPQ A;  2CGP A;  5JR3 A;  4I2O A;  1RI7 A;  2G7U A;  1PP8 F;  2EA2 A;  3DFG A;  5DUK A;  2XAH A;  3K1P A;  1KYZ A;  4KFC A;  3WTU C;  1QBJ A;  1MDM B;  4I7H A;  3QOP A;  5D8L B;  1R5H A;  2FOK A;  1W7P D;  4HF1 A;  3HRT A;  2EK5 A;  4YG2 F;  3L9F A;  1R23 A;  1QQI A;  3D0S A;  1REP C;  2QEN A;  3WTW C;  4YIF A;  1TQM A;  1OYI A;  2VBX A;  3WU1 B;  2HEO A;  2A5Y B;  2CSO A;  3U9G A;  3CUQ B;  3BWG A;  4HQE A;  1J9I A;  1U5T C;  2VOO A;  1MJB A;  1R36 A;  2WV0 A;  4BQA A;  5LRS A;  1EH7 A;  3KP5 A;  1AOY A;  4HDU A;  3D5L A;  1T39 A;  4U7D A;  3TKY A;  2HTJ A;  4L9T A;  4ZH4 F;  2P7C B;  4LG0 B;  3QU3 A;  1IRG A;  3EET A;  4EJU A;  3FZV A;  3FXR A;  2AXL A;  1F4K A;  4EGY A;  4NB5 A;  5KVR A;  2JPB A;  2EFN A;  3F6O A;  2PJP A;  2QQB A;  1VTN C;  5BQT A;  1PUE E;  4NHJ A;  1HW5 A;  3J81 Z;  1CF7 B;  3GX4 X;  1JHF A;  1B9M A;  4Q48 A;  1S7O A;  2W85 A;  1ULY A;  1J5Y A;  1QNT A;  3ISP A;  4ZYG A;  3T1B A;  3JTH A;  1Z9C A;  1W5T A;  4CXF A;  2KJC A;  3RPU A;  3LQR A;  4I0A A;  1A04 A;  1BC7 C;  1C0W A;  4G6D A;  2L3D A;  3ULQ B;  3WE3 A;  1SMY F;  1SFU A;  4L5J A;  4FT8 A;  2NAZ A;  5EEG A;  1S3J A;  2CQK A;  4IRG A;  1FNN A;  4HOB A;  3ZQ7 A;  4LK1 F;  2XV4 S;  2Y75 A;  3F3X A;  3T0Y A;  3GFJ A;  1KGS A;  4BHP A;  2EFW A;  1ZRF A;  1FP2 A;  2LSO A;  3F8F A;  3ROU A;  2QWW A;  4CDG A;  4N0B A;  3F8B A;  2D1H A;  1HXD A;  2O3F A;  1YYV A;  1Z7U A;  2ELH A;  1TNS A;  5JI6 A;  3LAP A;  3HYI A;  2XVC A;  1O3R A;  5K5Q A;  2DPU A;  2HYG D;  4NQW A;  4M72 A;  1W7P B;  2K02 A;  3Q9S A;  1B9N A;  5FFX A;  5D4R A;  1IZ1 A;  4GYG A;  1KU2 A;  1OYY A;  2JZY A;  4U0W A;  4E70 A;  2F2E A;  2ZNY A;  1IUY A;  1W5S A;  3G3Z A;  4RAY A;  4HLY A;  2IP2 A;  1K78 A;  5HLH A;  4M9X A;  5D5W B;  3QPT A;  1T0F A;  2P6T A;  2KKO A;  2OAZ A;  2FSW A;  5LLQ A;  3KCC A;  2MBF A;  3ZMT A;  3GYH X;  1EV7 A;  2ZJ2 A;  3MWM A;  3R6S A;  1G3W A;  1S29 A;  3QU6 A;  4TV7 A;  1XSV A;  2HWV A;  3RDI A;  5D4S A;  4UVA A;  1IN8 A;  1MKM A;  3J81 K;  3LFK A;  1ZYR F;  1OR7 A;  2IW5 A;  3BZ6 A;  2QUF A;  2ISZ A;  1RUN A;  4Q4Z F;  1XGM A;  5D5U B;  1D8K A;  2DBB A;  5DV5 A;  5D5X B;  1Z6T A;  3W6J B;  2RGV A;  3JSO A;  4ETS A;  2WWY A;  3CJN A;  4HV6 A;  5H20 A;  2CO5 A;  3J7A O;  1ZAR A;  2EFP A;  2O61 A;  1LNW A;  4UXN A;  4HF0 A;  1V3F A;  4Q47 A;  1O3S A;  1B1B A;  5CYV A;  1JXS A;  1G3S A;  4IXA A;  4M73 A;  3I4P A;  1UST A;  1FY7 A;  5ED4 A;  5D6E A;  3DKW A;  4O5V A;  3HTS B;  3EYI A;  2HQN A;  3H92 A;  2FQ3 A;  2VT3 A;  2E7X A;  4WF2 A;  1BBY A;  2VBW A;  3GZ5 A;  4ZZD A;  1YIO A;  3F22 A;  3I54 A;  1SD6 A;  3K69 A;  4PCQ A;  2OQR A;  3HHG A;  5LHH A;  3IWF A;  1ZLJ A;  2M87 A;  1E17 A;  2EV6 A;  1GXP A;  4Y13 A;  4MEY F;  5IT9 Z;  2YPR A;  4RGS A;  3EQL F;  1TW3 A;  3VFZ A;  3PFI A;  2H6C A;  3LA7 A;  5AIQ A;  2QYO A;  3I59 A;  1FC3 A;  2X4H A;  3RTR A;  3ZMV A;  4HDV A;  3DQV C;  1XDS A;  3V7C A;  5TRD A;  4KNY A;  1U5T A;  4JK1 X;  1XMK A;  1XCV A;  5LBQ A;  3P9I A;  5FD6 A;  2H27 A;  2VOD A;  1BC8 C;  3HRS A;  3QP6 A;  2BEO A;  4YFN F;  4P5O A;  3JTG A;  2DLL A;  2UXN A;  5E1X A;  1OMI A;  1J0R A;  2CFX A;  1Z1D A;  3WE2 A;  2KIM A;  3VOE A;  1I6X A;  3ZMZ A;  2HFH A;  2PI0 A;  4R79 A;  1WI9 A;  3F23 A;  2HYF A;  4U0V A;  2RN7 A;  4G6Q A;  2DO7 A;  2VBY A;  3NQO A;  1LEB A;  3FMS A;  2RQP A;  4OIN F;  1GXQ A;  1ZHF A;  2RVC A;  4PZJ A;  2X0L A;  4R1H A;  4Y15 A;  1U3E M;  5ICC A;  3CTA A;  1IRF A;  1I5Z A;  3KZY A;  1ODD A;  4RB1 A;  3H3U A;  1IN6 A;  5ERI A;  3FM5 A;  3BPX A;  5DCF A;  3ERE D;  2L4A A;  3QP5 A;  1ZG5 A;  2XAS A;  1STZ A;  2ZNZ A;  4U88 A;  4AIK A;  2JSC A;  3JSP A;  3IKT A;  3J80 K;  5HDK A;  2EB7 A;  1R7J A;  4UVC A;  1SD5 A;  2Q8K A;  1FX7 A;  2MH2 A;  2FNP A;  3KP4 A;  1FWZ A;  2LDU A;  2DAO A;  5HS9 A;  2RKH A;  2EV5 A;  3HTU A;  2MA3 A;  4S05 A;  3I5U A;  1O7L A;  4M6X A;  5CLS A;  2XGX A;  2EJR A;  5IT9 K;  5K5R A;  3ZN1 A;  2A61 A;  3WTX C;  1YS6 A;  3HOS A;  2Z33 A;  4L0Y B;  1I1S A;  1PDN C;  5HLI A;  1QZY A;  1DPR A;  2QQA A;  5CJ9 A;  2Q0O A;  4CIC A;  2KIF A;  4CZZ A;  2OD5 A;  2XKO A;  3QRF F;  4UUV A;  1BI2 A;  2HDC A;  3DPT A;  2L4M A;  4EJT A;  2R7D A;  1LB2 A;  1XB4 A;  3VEP A;  1IAW A;  1XD7 A;  3OOP A;  4LGW A;  3F8N A;  1OPC A;  5CVJ A;  4I09 A;  1H0M A;  2GA1 A;  3EDP A;  1F9N A;  1S6L A;  3LA3 A;  5F6F A;  3TO6 A;  2VBZ A;  2O0Y A;  1J75 A;  2GAU A;  2OZU A;  4RS8 A;  2ESN A;  3GFL A;  3RYR A;  3M9A A;  4M9Z A;  1ZGJ A;  3SZP A;  5HDG A;  1MD0 A;  2DW4 A;  5LHI A;  1O3Q A;  1JGS A;  2PFB A;  5L3B A;  3M8F A;  4OIR F;  1KA8 A;  2K4J A;  1LDD A;  1HKQ A;  1UCR A;  2VE8 A;  4KYW A;  3C18 A;  4EJO A;  2K7L A;  3FHZ A;  4OMY A;  3MEX A;  4AVP A;  4EMS A;  1FBU A;  2EFQ A;  2VOP A;  1KQ8 A;  4LLN A;  3BY6 A;  4OOI A;  2LF8 A;  2Z9O A;  4LK0 F;  2IVM A;  4CO8 A;  4JBA A;  2K4B A;  2QBY B;  3HRU A;  3WOD F;  3V8J A;  2E7W A;  3RKY A;  2FU4 A;  2JTV A;  3ZMU A;  2NRA C;  2W57 A;  2KJB A;  3ZPL A;  4WX9 A;  3FMR A;  3LWF A;  3WG9 A;  3F8M A;  2M30 A;  5D5V B;  2R7F A;  5DD4 A;  2MD5 A;  3U1D A;  5J8F A;  4I0B A;  1MDM A;  3C7J A;  1RUO A;  4IPA A;  1HKS A;  2NYX A;  2YSR A; 
#chains in the Genus database with same CATH topology
 1T98 A;  2NNY A;  2FNA A;  4HZF A;  5ILV A;  1S5L C;  1HCR A;  1RKT A;  4PFP A;  2HR3 A;  4F91 B;  4A6D A;  3CC7 I;  2E1M C;  1Y39 A;  2ACJ A;  3GWZ A;  4C2T A;  2DI3 A;  3OYA A;  3IH2 A;  1DQU A;  1O7F A;  1ZAO A;  3BCB A;  4L5I A;  1AWC A;  1YRN A;  2OUM A;  3O8G A;  2UWM A;  4A3E J;  1ZH5 A;  1ENH A;  2E2H J;  1U78 A;  1FT9 A;  2O6G E;  3CUQ A;  3GVA A;  2FE3 A;  3OR2 C;  1TWH J;  4XBF A;  1D0Z A;  2G7H A;  3VSL A;  3FKJ A;  2WB1 N;  5JVT A;  2L5Q A;  3ZQI A;  4F55 A;  4NBQ A;  2R7O A;  3FKI J;  3C2H A;  1MJA A;  4P9F A;  1GUU A;  2L2O A;  1D8J A;  2GLO A;  4I76 A;  4JX5 A;  3I0T A;  1EF4 A;  3CF2 A;  2LG4 A;  3KLO A;  2WBM A;  3MCZ A;  4WWC A;  3HOW J;  2BYV E;  2IA0 A;  3KEO A;  2LK2 A;  5JLW A;  2ZB9 A;  1OKR A;  5AIP A;  3UNG C;  1Y8Q B;  2IS4 A;  3CJR B;  1LDK B;  4WCG A;  3S2H J;  1T2K A;  4EV0 A;  3WU0 A;  3ZQQ A;  2COM A;  5F0H A;  1KYW A;  2M5W A;  2P5V A;  2NS0 A;  2VN2 A;  5HDN A;  3BZC A;  2VJI A;  1QVU A;  3H5A A;  3KP2 A;  3R61 A;  3WGG A;  1OLT A;  5FGM A;  3K4N A;  3GCM A;  4GO1 A;  2VPL A;  2GIV A;  4P9U A;  1SC7 A;  3KIO A;  3REO A;  4NUB A;  3SZT A;  1CF7 A;  1DGR M;  3K6G A;  2Y31 A;  5CQE A;  1Z21 A;  3AL0 B;  1E2X A;  4ESJ A;  5E8I A;  1R5I D;  1FOX A;  3BJA A;  2A5W A;  4II3 A;  2XGE A;  3ZP5 A;  2JVH A;  3CO7 C;  3SFZ A;  3S16 J;  4ENK A;  3BOQ A;  2RNG A;  4NDL A;  3S14 J;  4DYQ A;  5DD8 A;  3DBR B;  1G2H A;  3ZMD A;  2E35 A;  1SFE A;  2HQR A;  3HXL A;  3HOT A;  4BY1 J;  2EFO A;  1YE9 A;  4CYC B;  3Q0W A;  3KZI C;  1XGS A;  1LFB A;  1A6I A;  3QAH A;  1LQ1 A;  3BZK A;  2W25 A;  1Z91 A;  1IRZ A;  5M5X J;  3RJP A;  4YFX F;  1MBF A;  4A6E A;  1HQC A;  1DUX C;  3MZH A;  3CO6 C;  2H94 A;  3CP8 A;  1OYW A;  1QRY A;  4NNJ A;  1VND A;  5HLG A;  2IA2 A;  1ORK A;  1ZR4 A;  2JA6 J;  3RQI A;  4RB2 C;  1X1B A;  1PUF B;  3DXJ F;  2EIK H;  2R5Y B;  3H3Z A;  1K78 B;  4EGZ A;  3DPL C;  2QEX I;  1YJN I;  4LJZ F;  3PQJ A;  1XPX A;  4EAT A;  2DDA A;  3F6V A;  2F5C A;  1FMW A;  1X3U A;  3NWS A;  1JUP A;  2G9W A;  2DXI A;  5FLX Z;  1PYV A;  4HEA 2;  1ONV A;  1AKH A;  4A3G J;  4HX7 A;  1J2X A;  2Y2Z A;  2ZKZ A;  5LGN A;  4OMZ A;  2R5Z B;  3VYU B;  5EEH A;  5BOX A;  1K4S A;  1FSE A;  4GCV A;  1WJ5 A;  4OU0 A;  5E20 A;  2JA2 A;  4FHT A;  3VDX A;  2J5P A;  4MNU A;  3LFU A;  3C3W A;  1FOK A;  2HVR A;  2M1B A;  3ABK H;  3ERM A;  4XK4 A;  2AQF A;  2FA5 A;  3LOC A;  2Z16 A;  3OYI A;  4ENN A;  3LSR A;  1TTY A;  1T33 A;  1YS7 A;  1UB9 A;  1W7P A;  4Y7N J;  1YG2 A;  2E34 A;  2HZT A;  4L9V A;  3E97 A;  2HXI A;  1R6R A;  3OSF A;  3A01 B;  4XOR A;  4CCK A;  4F52 A;  3S1Q J;  1VQM I;  2IT0 A;  1BOA A;  1MZB A;  2DN0 A;  2WA0 A;  4HV5 A;  5BPD A;  1MGT A;  4A0X A;  2HKO A;  2MSY A;  3LA2 A;  4IKF A;  3N4M A;  1UHW A;  1VFC A;  2WAQ A;  5BMZ A;  3BRO A;  2XAJ A;  3U21 A;  2H6B A;  5IOZ A;  1SAX A;  3NEU A;  2GZW A;  2IA1 A;  4IQ4 A;  3RKW A;  3GTM J;  5FB2 A;  2H09 A;  2JVG A;  5F0C A;  1G3Y A;  3CLO A;  2M2E A;  1XSD A;  5KHD A;  3CMA I;  1DP3 A;  3K10 A;  1UG2 A;  1JGG A;  2EZK A;  1WRJ A;  1K7A A;  2E1C A;  1USS A;  1X2N A;  3MD2 A;  5LGU A;  4A3M J;  3BP8 A;  3HL2 A;  5ILS A;  3A03 A;  3JW4 A;  4XLA A;  1F36 A;  2QZ8 A;  5F64 A;  1L3L A;  2PJR B;  4AD9 A;  1IN4 A;  3K70 D;  1TNT A;  2X6X A;  3PQK A;  5J40 A;  3ZQH A;  4FX4 A;  2P0W A;  1J09 A;  1ZTR A;  4BQN A;  1JKR C;  1R49 A;  2FUG 2;  3K0L A;  3BR3 A;  2DU9 A;  2BV6 A;  2GBY A;  1JHH A;  2K86 A;  2R7R A;  2FBI A;  1TQI A;  3OYM A;  2JPC A;  3DEW A;  4IHY A;  2M7B A;  2MH9 A;  2DOF A;  2LR8 A;  2NVQ J;  4F3Q A;  1GVD A;  3OYJ A;  4HX8 A;  1LVA A;  2EA4 A;  2OTL I;  4B3A A;  3W6K B;  2DK8 A;  2E71 A;  3R0A A;  5CVV A;  3QPH A;  4BU2 A;  2A3S A;  3N97 A;  2DQR A;  1SFX A;  2ECC A;  2M7A A;  4CCO A;  1JUM A;  4HA8 A;  2QM3 A;  4AYB A;  1EH6 A;  2RDP A;  2FMY A;  1UAA A;  1Z6R A;  4ZDL A;  2OBP A;  4FET A;  1NTC A;  3HIF A;  3BR1 A;  3KLN A;  1MSE C;  2JMW A;  3HJE A;  4LG3 A;  4G9Y A;  2WC2 A;  4PGG A;  2VB6 A;  2ISY A;  3P5J A;  3QWL A;  2R0Q C;  1O4X A;  4C3I J;  1QPM A;  4O3M A;  2LTP A;  1ETO A;  2DTZ A;  4BXU A;  2KRF A;  4Y17 A;  4G7H F;  2Z5U A;  3CUQ C;  5GAE J;  5JFR A;  2DTR A;  5CPR B;  5GAG J;  1T95 A;  3CMM A;  3I59 B;  4B44 A;  3QOD A;  3HOX J;  2Z99 A;  2STW A;  1BW5 A;  3E1S A;  3G73 A;  1JUS A;  3X2Q H;  3GTP J;  3FWE A;  3L09 A;  1VQ9 I;  1XTA A;  2YS9 A;  2PMZ A;  5FLX K;  2V1U A;  1HSJ A;  3K4M A;  3KE2 A;  3BC8 A;  4QPO A;  2L7Z A;  3L2W A;  1U5T B;  3CCL I;  1ETY A;  3BR6 A;  5E8G A;  4XLN F;  3P7N A;  1K83 J;  2D45 A;  4EQQ A;  3O2P E;  5ICG A;  1TP4 A;  1YLF A;  2ICW G;  3CCQ I;  3OL3 A;  1YX5 A;  4AU7 A;  3SQN A;  4MEX F;  4A3B J;  4XLF A;  3L1P A;  3C2G A;  2DMP A;  3IRR A;  3GLX A;  3PUF A;  2IGK A;  3O3K A;  4BHC A;  2C6Y A;  1B4A A;  3LAJ A;  4OIQ F;  3WTS C;  5H6R A;  2DJN A;  5E3N A;  2KZV A;  3DWL E;  4BXF A;  1V4R A;  3A1Y A;  4AM3 A;  3LSH A;  4ASN A;  3FXU A;  2XHK A;  2NOG A;  1S72 I;  2LC2 A;  2R3S A;  1Z67 A;  2DYR H;  1OCO H;  2MW8 A;  3TL4 X;  4M3B A;  1NHA A;  4HNU A;  2ELJ A;  2OF7 A;  5D6F A;  1IN7 A;  4IRI A;  3BPV A;  3TP0 A;  4R8H A;  2JRM A;  2M4K A;  3EUK L;  1CQT A;  1Z7L A;  3CUO A;  1PVE A;  2DFI A;  1YW8 A;  2W24 A;  3TDU C;  4IOC F;  2KIQ A;  3W6V A;  4QTR A;  1WKM A;  3KP6 A;  4C30 A;  2JSP A;  4BJ5 C;  1ON2 A;  1XGO A;  2XRN A;  5HNF A;  4RDU A;  3ZRG A;  4UUS B;  1WI3 A;  2W84 A;  3HGY A;  5B1B H;  4BHB A;  2HOA A;  4EVI A;  1K6O A;  4HQM A;  1NH3 A;  1ETX A;  5IP9 J;  1V5E A;  2TDX A;  1TT0 A;  4U7B A;  1R4N B;  5GTI C;  1YW7 A;  3ESW B;  2XRO A;  4CZC A;  4IF4 A;  1E0E A;  1XMX A;  3JRI A;  2WAF A;  5J8C A;  3ZQG A;  2K9N A;  2EZL A;  4D7M A;  1P4W A;  5M3F J;  2V1X A;  4BXX J;  2R7Z J;  4HF2 A;  5DCM B;  1I3A A;  4UHT A;  3PO2 J;  2ZME B;  1ZG3 A;  5DEQ A;  2XSD C;  2ZJP F;  2AS5 F;  3K2Z A;  2EQR A;  3LSP A;  3KP3 A;  2AQE A;  1UFM A;  1Y6I A;  1FYL A;  2CV0 A;  5HS8 A;  3G1M A;  2IBD A;  3CCJ I;  4RAF A;  2CWE A;  1VQ7 I;  4B8X A;  4V2G A;  3VYR B;  3H3V K;  4P1W A;  2VKH A;  2LF7 A;  1TT5 B;  3DP7 A;  3RQ4 A;  2M4G A;  2ZSI B;  2PG4 A;  3ZQF A;  3GW2 A;  1D3Y A;  2NVX J;  3OIP A;  4GYI A;  5FRN A;  1ERD A;  5FKN A;  1H9G A;  5EJC A;  4M9S A;  2BVM A;  3SDB A;  2XIG A;  5GAH J;  1B8I B;  2VQC A;  3JRC A;  4NC7 A;  3R4K A;  4ZYE A;  1T6S A;  2LMD A;  4WXD A;  1SVM A;  4XMY A;  3VYS B;  3K4K A;  3TOA A;  1TC3 C;  3BCA A;  1MJ9 A;  2Q2E B;  5IP7 J;  2R4G A;  4A2U A;  3RPQ A;  1LE8 B;  1X1C A;  1R1T A;  2M0M A;  2HQ5 A;  3BG6 A;  4XLE A;  1R1U A;  3ONQ A;  1T08 B;  3OS1 A;  2K9S A;  4L5E A;  1BI1 A;  4ZJZ A;  5FLV A;  3WHB A;  1YIJ I;  3GME A;  2ETH A;  4EJV A;  3G71 I;  3H5N A;  3HKZ N;  5FKK A;  2CS3 A;  1V5G A;  3LST A;  3LNQ A;  5HVQ C;  1EA3 A;  2XKP A;  3MKY B;  2GXG A;  2WAD A;  4EM2 A;  1QHG A;  1Z3Y A;  4M6V A;  4XR6 A;  1LDJ A;  1B72 A;  4EM1 A;  1QGP A;  5L3F A;  3FXK A;  2V6C A;  1HBX G;  3W2A A;  2FML A;  3IHU A;  3RPU D;  4HX4 A;  5TJJ A;  3V4G A;  1WQ2 A;  4I99 C;  2PQ8 A;  4HYE A;  5EGO A;  2CW0 F;  4PUS A;  3HOY J;  3DKY A;  2ZC2 A;  4A0Y A;  2O8X A;  2EV0 A;  5LGT A;  2P5L C;  5CQG A;  4XRM A;  1EKE A;  3G2B A;  1Q1H A;  1HST A;  5BPI A;  1DPU A;  4BYY A;  4BY7 J;  3OYE A;  2ADU A;  3V8L A;  2RRE A;  3E6M A;  4DQ2 A;  2CRG A;  2V1N A;  5L3E A;  1RIO H;  3KFW X;  3Q9V A;  5H6Q A;  5IYD J;  1ZG1 A;  1OQY A;  1SD7 A;  2LKP A;  3BTC A;  1F1Z A;  3CCY A;  4LFU A;  4U87 A;  3M1E A;  3NAU A;  1S9H A;  1T8I A;  1FYK A;  2HU9 A;  4LLL A;  1ZN2 A;  4MFD A;  3TMO A;  5E79 C;  3PNT A;  2L9V A;  1X1A A;  2RNJ A;  2JRT A;  2PMH A;  1LKX A;  4XQF A;  4KMU X;  4BAY A;  3VOD A;  4IJA A;  2GXB A;  3SEZ A;  1FIP A;  2EBI A;  4YEL A;  2W1O A;  4LLG F;  1ETQ A;  2HNH A;  3ABU A;  1H8A C;  1U6G A;  3ECH A;  2DOA A;  1QVT A;  1TZL A;  3FXJ A;  4IRH A;  4C3H J;  4BS9 A;  4X1E A;  2CFO A;  4HST A;  4L0Z B;  2OU2 A;  5F1J A;  1IW7 F;  1I27 A;  3KEY A;  3C1D A;  2PN6 A;  3IH4 A;  1HOM A;  3MAJ A;  3PNV A;  2NVY J;  1TW2 A;  2K27 A;  4RM2 A;  3PIO F;  1YQA A;  5IT3 A;  4AIH A;  2CJJ A;  2JUG A;  1MIJ A;  3WTY C;  4L9N A;  3QYE A;  5LEK A;  4B43 A;  4MTE A;  5HLT A;  1HA8 A;  4HNT A;  2XUB A;  3TO7 A;  2NNN A;  4M6Y A;  1JTY A;  3AG4 H;  2KDO A;  1LPQ A;  1EJ9 A;  4GFB A;  4M3G A;  3DPU A;  3DLA A;  2FRH A;  3HZJ A;  3GTL J;  2RV8 A;  1FSH A;  2RC4 A;  4B09 A;  2LRE A;  2DK5 A;  3DF8 A;  2VE9 A;  1P92 A;  4X0G A;  2M45 A;  5J1Y A;  3BT9 A;  5C44 J;  2XPW A;  1BIA A;  3I64 A;  5L3C A;  2H8R A;  4LMY A;  1LVK A;  3ZQC A;  4ESF A;  1UEL B;  2Y9Y A;  4U0Y A;  4AWX B;  5FD5 A;  4I01 A;  5GP9 A;  4J19 A;  1YTY A;  1SVO A;  1U9O A;  3KYC B;  3JRF A;  1K6Y A;  2BVL A;  2VJJ A;  3U1K A;  4KIT B;  1UHM A;  2XB0 X;  3COA C;  1R22 A;  4PDK A;  4BDY A;  4LB6 B;  3IKV A;  4P96 A;  4UNO A;  4XID A;  3OYL A;  2JQ7 A;  1N75 A;  2VLA A;  5JVG F;  1BN5 A;  4KIF A;  1ZLK A;  1YI2 I;  3V7R A;  3GXO A;  2E1N A;  5GPC A;  4E7K A;  3V7S A;  4F93 B;  3I71 A;  4M3D A;  5CVI A;  4BDZ A;  1L0O C;  1G3T A;  2QSG X;  3WGH A;  2QSF X;  4S0H B;  1RZ4 A;  1GVJ A;  4HLX A;  3DEU A;  4PFO A;  3PO3 J;  3H5R A;  3BLY A;  4PSX A;  2XC7 A;  3HSF A;  5AON A;  2DQL A;  3RI4 A;  1HW1 A;  4WXH A;  4RA2 A;  4K2E A;  2EIL H;  4KN4 X;  5FKM A;  1EH8 A;  3E5X A;  3KX2 A;  1WJE A;  3E3V A;  3OSG A;  1V54 H;  2A69 F;  2XAF A;  2OQG A;  1DU6 A;  2JK3 A;  4CA0 A;  3P9C A;  4JX4 A;  1WHU A;  1P2F A;  5GAD J;  2QSH X;  4DIQ A;  1WH5 A;  3OYF A;  4BGD A;  2IRF G;  1TBX A;  2XPU A;  1QO0 D;  5EG0 B;  3RYP A;  3ZN0 A;  1Y0U A;  5E3M A;  4ITV A;  1W1W E;  2OJE D;  4ZZL A;  3F21 A;  3GTO J;  3FXL A;  1WGX A;  2QBY A;  1YW9 A;  4BKX A;  4E7Z A;  1O57 A;  2QQ9 A;  1KQ0 A;  3I4M J;  2VJ4 A;  3FK7 A;  3HM5 A;  5B3S H;  2B0L A;  3EYY A;  5EZH A;  1NK2 P;  2QKL B;  3ASN H;  4KJZ A;  3EUH A;  4BH9 A;  2KMU A;  5EEA A;  4E7I A;  2DT5 A;  2M8G X;  3MQ0 A;  3FX3 A;  4D0P A;  1ZGA A;  1X1P A;  1XGN A;  1ON1 A;  3ECO A;  3RZO J;  1SD4 A;  2BXY A;  2K5C A;  3BR5 A;  2BOL A;  1R9T J;  5E1Z B;  4E4H A;  3D5R C;  3ML6 A;  4ON0 A;  5C3E J;  3IAS 2;  4N9I A;  2YR2 A;  4XRS A;  2VKE A;  5ILU A;  2E36 A;  5KK1 A;  4A5N A;  1I50 J;  4XSX F;  4IOA F;  4LG0 A;  3R60 A;  3I58 A;  3WTV C;  2QVO A;  3FM3 A;  1WFX A;  5J6X A;  1BR1 A;  3MZY A;  3V8K A;  1BI0 A;  2ZO4 A;  4UVB A;  4RB3 C;  3TW6 A;  1E3O C;  4AIJ A;  2BBY A;  4ANJ A;  1MMD A;  2MFZ A;  3VPR A;  2UUZ A;  1VQP I;  2MC3 A;  4L18 B;  2YX7 A;  2VQH A;  3GZ6 A;  2HGC A;  1OCP A;  3L7W A;  4CGZ A;  2DCE A;  1JTX A;  1WJB A;  1ETK A;  3P9K A;  2ID6 A;  1AA7 A;  1SFK A;  3NAR A;  5L3G A;  1IN5 A;  4PK4 A;  1ZRE A;  1BM9 A;  2CV1 A;  1XSX A;  2ZXJ A;  4BJ6 C;  4LD5 A;  2WV1 A;  5J4V A;  2EIN H;  1YFH A;  1B6A A;  3CCM I;  1VQN I;  2IJL A;  4F7Z A;  1LJ9 A;  3OS2 A;  5K7H A;  4NQW B;  3OIQ A;  1D0Y A;  2P8T A;  2PEX A;  1TWF J;  2FEZ A;  5FFZ A;  1K79 A;  3JAM Z;  2HVS A;  3HGG A;  4XM3 A;  1VF9 A;  4NC8 A;  4OIO F;  5LEJ A;  2DMN A;  4X6A J;  4KIC A;  5J1U A;  1ZK8 A;  5F0F A;  3PJR A;  3L2U A;  2XGD A;  2YX4 A;  2PMZ N;  1ZQ3 P;  1OCR H;  3GEZ A;  4LOC A;  4KT5 C;  1A36 A;  4Z2Y A;  2IGO A;  2X48 A;  4P55 A;  2OCE A;  4BJT A;  3UKG A;  4ESB A;  1XCB A;  2F5E A;  3ABT A;  2K40 A;  4G8X A;  1WJD A;  4M74 A;  2UZK A;  5ICE A;  2CU7 A;  3QPL A;  3WTT C;  2O5R A;  5FRO A;  3F0C A;  1YHQ I;  2XSJ C;  3IC7 A;  2FF4 A;  4KIB A;  4OAZ A;  4C2M J;  2VI6 A;  1XDU A;  3DBL B;  3VSK A;  1HKT A;  4XLC A;  3B73 A;  2WTE A;  3CC4 I;  2IEK A;  1CGP A;  1IV6 A;  2DOE A;  2LYC A;  3HBL A;  2Y0M A;  4CYC A;  4MIM A;  4Y4R A;  4WK8 F;  4JQF A;  1BR4 A;  2V1D A;  4XKC A;  1N78 A;  2M8E A;  3TGN A;  1XN7 A;  3LMM A;  4Z6Y A;  2B9S A;  2LRD A;  2NVT J;  2KRH A;  1O3T A;  1MBG A;  4FCY A;  4RGX A;  2V6E A;  3OL4 A;  1D1C A;  1BJA A;  2P81 A;  1TQP A;  5BS6 A;  1JT0 A;  3OY9 A;  4BEH A;  3NRV A;  1BI3 A;  4DYC A;  3FIS A;  2ESH A;  3VB2 A;  4KMF A;  2KPM A;  2W82 A;  3ZOB A;  1J59 A;  3CCU I;  3BJO A;  2PBI A;  1VQ4 I;  3Q0V A;  3LSG A;  4HAM A;  1I6H J;  4A12 A;  2FQ4 A;  4ZDP A;  3S3N A;  3IRQ A;  4EJW A;  2QF7 A;  3K1M A;  3BDD A;  3ELK A;  4WXC A;  4E7J A;  4IVN A;  1FBS A;  1HW2 A;  3Q5F A;  2VC0 A;  3I55 I;  4ENM A;  4L9J A;  1B59 A;  5D8K B;  1G4D A;  4BBS J;  3H36 A;  2ZBK A;  2PMU A;  4JP0 A;  3MKW B;  3TQN A;  5E17 F;  3JRE A;  1WWX A;  1WH7 A;  4MQV A;  2HOE A;  2VT2 A;  1RNL A;  4PGH A;  4H0E A;  4QIW N;  2A6E F;  3RCO A;  2R5Z A;  1VQ5 I;  3OYN A;  2LBF A;  2ZCW A;  3AAF A;  2OA4 A;  4KUM A;  4IHT A;  1NG6 A;  1SMT A;  1WSU A;  4H4K C;  4RGU A;  5ICF A;  1V55 H;  2HKX A;  4DOZ A;  1A31 A;  4GRI A;  3V42 A;  2L02 A;  4MTD A;  3G6E I;  2OTJ I;  1LEA A;  2DA1 A;  4KDP A;  2F5D A;  1A5J A;  3A2K A;  2A07 F;  3T8R A;  4YFK F;  1SEU A;  2DJI A;  1LFU P;  4XRF A;  5GTH C;  2MLK A;  1KU3 A;  4OIP F;  3T5X A;  5J1R A;  3WGI A;  1IXR C;  4XL9 A;  4FIS A;  2HTS A;  4PJ0 C;  3HRM A;  2R7S A;  1R58 A;  2VC1 A;  2Z1D A;  4HW0 A;  4JX6 A;  3OYD A;  5IPA A;  2UXX A;  3DEE A;  3M7G A;  3A02 A;  4KA4 A;  2CW7 A;  2H1L A;  3WTZ A;  1UG0 A;  2CH0 A;  2IS6 A;  5LRR A;  2EZI A;  2E60 A;  3B02 A;  3GFM A;  4QWQ A;  4XLP F;  3KP7 A;  3M8E A;  4HBL A;  3OMY A;  2Y30 A;  2IXS A;  3SHF A;  4AVZ A;  5K5O A;  5E18 F;  3F72 A;  5CKT A;  5F08 A;  4Y3O A;  4PJM A;  3CCS I;  3IWZ A;  4DZP A;  5DDG A;  1MW7 A;  3JAM K;  1YX3 A;  4II2 A;  5K7Z A;  4I02 A;  3G4S I;  1YJ9 I;  2JWT A;  2IAI A;  1P4X A;  1U0J A;  5M5Y J;  1FBQ A;  4PJL A;  1T38 A;  1Y8R B;  2PJR A;  1KON A;  3S2W A;  1ZRC A;  3GO5 A;  3KZZ A;  6PAX A;  3E5U A;  3GZN B;  3K4C A;  3OOU A;  1U8B A;  5CVU A;  2A6H F;  4G94 A;  4YII A;  2P6S A;  2KDZ A;  2GIZ A;  2W7N A;  1KZH A;  3LL7 A;  3EUH C;  5C4X J;  2CYY A;  2P7V B;  4CSW A;  1PP7 U;  2IPQ X;  3BQY A;  3FHN A;  5K1Y A;  3J80 Z;  4XSZ F;  3FMQ A;  3K4J A;  4D7N A;  4BAC A;  1RRJ A;  2L9R A;  4BNC A;  4G7O F;  5EYR A;  3S93 A;  2E5N A;  3RZD J;  3CMY A;  5HS7 A;  4A93 J;  2YUS A;  3I9V 2;  4M3F A;  2XPV A;  2LNB A;  4A0Z A;  2D1V A;  5E1W A;  3SXY A;  3BJ6 A;  3FBI B;  4IZZ A;  3HC7 A;  3TED A;  1QZZ A;  2EZH A;  3WU2 C;  1I3Q J;  3DKX A;  4N9H A;  4IO9 F;  3O6B B;  4AID A;  3B6A A;  4J00 A;  3S1M J;  4MHG A;  3GTG J;  3SEQ A;  3MFK A;  3KEQ A;  2YU3 A;  4M71 A;  2MC4 A;  1WJF A;  3E6D A;  3G1O A;  3MVP A;  1TLH B;  2ME0 A;  2GQQ A;  2H8W A;  3J7Y J;  4PSW A;  2E1M B;  3F8C A;  2Y48 A;  3SZG A;  1IGN A;  1GHC A;  4HRI A;  5EDN A;  1XG1 A;  5A2Q Z;  4IX7 A;  2DPD A;  1APL C;  2V7F A;  3TW7 A;  1IXS B;  5J4Y A;  2OZ6 A;  2F5V A;  3S32 A;  4EM0 B;  5K7F A;  1MMA A;  3HHH A;  2KZG A;  1P6R A;  4QLC U;  1IDZ A;  4MQ9 F;  4OWR B;  1SFO J;  5JHU A;  2VIX A;  3GFI A;  1XMA A;  5DYM A;  3FXM A;  3S1N J;  4RAZ A;  2JA7 J;  5TIS C;  1YO5 C;  1KQ9 A;  4FX0 A;  4V19 K;  1IF1 A;  5FO5 A;  2W48 A;  1QA6 A;  4ABZ A;  3L2C A;  5KCM A;  2PLY A;  4CHU A;  2CMP A;  2L9S A;  4RLF A;  3FF5 A;  2VXZ A;  2QGU A;  3HSR A;  3EUA A;  2FXA A;  1J7K A;  4RLQ A;  1R5G A;  1VQL I;  2W4S A;  1RC9 A;  1D5V A;  3CME I;  2BGC A;  4IL6 C;  4KN7 X;  4D5C A;  4XIC A;  1V5F A;  5FJ8 J;  1OCZ H;  2CUJ A;  2HYJ A;  1Z77 A;  1M1E B;  4KIG A;  3BTI A;  3E6B A;  2EPF A;  3RIR A;  3AL0 C;  1RR8 C;  4G7Z F;  2VKD A;  1P4A A;  2VON A;  3I53 A;  2FOW A;  2RQQ A;  5HOO A;  2L01 A;  3ZXS A;  1BIB A;  2J5O A;  3HUG A;  4I98 B;  4IEJ A;  2L54 A;  2FBH A;  2BE5 F;  4LIT A;  1A6Q A;  2BW3 B;  5CVR A;  2LKS A;  1U8R A;  2FBK A;  4UV8 A;  3HOZ J;  2CG4 A;  3E7L A;  4YIR X;  2ZFU A;  1MNE A;  4S04 A;  3R0J A;  1RR7 A;  4UUS A;  2R7T A;  3PSI A;  4PJJ A;  3CDL A;  1VI0 A;  5C4J J;  3CJQ B;  1PJR A;  4D1Q A;  2WY8 Q;  1Y1V J;  3K1N A;  4DNC A;  1NG7 A;  1IUF A;  1UZC A;  3OIO A;  5FKO A;  5DUI A;  1D5Y A;  1R1V A;  2XAQ A;  3CP2 A;  3TOB A;  3DV8 A;  3TO9 A;  1U2W A;  2LVS A;  4A3I J;  2D2W A;  5DCM A;  1P9Q C;  2EWN A;  2ZXI A;  5F1R A;  2ZME A;  1MMG A;  1I1G A;  2ZFW A;  3RKX A;  4Q5S F;  3W3C A;  3SJM A;  1MH3 A;  1XX5 A;  2RAE A;  1KU9 A;  3TDZ C;  4ZYH A;  2BY2 A;  2QQ8 A;  1GDT A;  2D5V A;  3MZ8 A;  3CDH A;  2O7O A;  3DU5 A;  2STT A;  4XOT A;  2B7E A;  1HC8 A;  1IXC A;  1S7A A;  4MGR A;  3AG2 H;  1MNM C;  3KPH A;  4GXO A;  2DA6 A;  3S3O A;  1FZP B;  1W4M A;  2L7F P;  4UUT A;  2KRC A;  3FXQ A;  1X2M A;  3K9T A;  1G6N A;  2IGN A;  2P4W A;  4N4O B;  2K3P A;  3HOV J;  3BTJ A;  1ZRD A;  1B8I A;  1WVR A;  4XNF A;  1FLI A;  3RSN A;  4A5M A;  3GUD A;  2Q2E A;  2QLZ A;  2CUE A;  2V79 A;  1LE8 A;  2DT6 A;  1P7J A;  4LB5 A;  1Z05 A;  3S8P A;  2GWR A;  2HI3 A;  2KIU A;  1FMV A;  3T8T A;  2R7Q A;  2Z3Y A;  3E5Q A;  1S8N A;  2A68 F;  3UR3 C;  4UV9 A;  3BQZ A;  1FYM A;  4ZYD A;  2V9V A;  1F5T A;  5KNL A;  1OCC H;  2GA2 A;  3OV8 A;  2DMQ A;  5L3D A;  5LHG A;  5A2Q K;  4CYD A;  1S7E A;  1R00 A;  4IHS A;  2HS5 A;  3LQQ A;  2O03 A;  3I4N J;  3ABM H;  3IL2 A;  4ENJ A;  1DP7 P;  3BG5 A;  2DOD A;  4E7L A;  1OCT C;  4M3E A;  5DTD A;  1X4P A;  3GF2 A;  1H9T A;  1FP1 D;  3U2R A;  2MLG A;  4RGR A;  3KET A;  3HSE A;  3OYH A;  1R71 A;  2JT1 A;  4O6J A;  2P5K A;  1QPI A;  3E6C C;  3E0J B;  3IH3 A;  3WHC A;  1DDN A;  2F5F A;  4RB0 A;  3L00 A;  4GGG A;  1JE8 A;  1KU7 A;  1IV8 A;  2XAG A;  3WG7 H;  3ZMS A;  4Y52 J;  3A4C A;  3JRA A;  2F48 A;  3CCV I;  1E3P A;  1FPQ A;  2CGP A;  3AG1 H;  3DTI A;  2X6O A;  3MKL A;  5DM6 F;  5JR3 A;  4PJN A;  1WZ2 A;  4A3K J;  5IP6 A;  4I2O A;  3SYT A;  1IG7 A;  5TGT A;  2R93 J;  2BZT A;  3BG9 A;  1RI7 A;  2G7U A;  2IS2 A;  4FQG A;  4DGW B;  2BXZ A;  1PP8 F;  2ZXW H;  2VQL A;  4D9J A;  2EA2 A;  3DFG A;  1NK3 P;  5DUK A;  3MMY B;  2XAH A;  1JKO C;  1FIA A;  3K1P A;  1KYZ A;  3HOU J;  2GOX B;  4KFC A;  3H9Q A;  2I5U A;  3WTU C;  2OCC H;  2X85 A;  1QBJ A;  3S2D J;  1MDM B;  4I7H A;  3QOP A;  2NXN B;  4MLO A;  5D8L B;  1R5H A;  3MKZ A;  2FOK A;  3PSF A;  2I10 A;  1W7P D;  3G1L A;  4A3J J;  4HF1 A;  1FTT A;  3HRT A;  4DBQ A;  3IUO A;  1YJW I;  4XN0 A;  2O9L A;  2FD5 A;  2EK5 A;  4YG2 F;  3L9F A;  3FXO A;  1R23 A;  2XGC A;  1QQI A;  2NS8 A;  1X19 A;  2DA5 A;  4D5F A;  3D0S A;  3DCF A;  2QEN A;  1REP C;  3WTW C;  1TQM A;  4YIF A;  1OYI A;  1YRN B;  5B66 C;  2VBX A;  3WU1 B;  2HEO A;  2JA8 J;  2A5Y B;  5HNH A;  2M34 A;  2CSO A;  3U9G A;  2K9L A;  2CUZ A;  3CUQ B;  3BWG A;  1JJ6 C;  2Q1Z B;  2F4M B;  1G59 A;  4HQE A;  2CQQ A;  1J9I A;  1U5T C;  2BY0 A;  2KQR A;  3CDI A;  2VOO A;  4BE0 A;  1MJB A;  1R36 A;  2WV0 A;  4BQA A;  2CQN A;  2F6C A;  2WAQ N;  5LRS A;  3W2V A;  2V9P A;  1EH7 A;  3KP5 A;  1AOY A;  4HDU A;  2X1D A;  3D5L A;  2JN6 A;  3IP4 B;  1T39 A;  2HPM A;  2R7U A;  1RPW A;  3OS0 A;  4U7D A;  3TKY A;  2EIJ H;  2HTJ A;  1VZ0 A;  4L9T A;  4ZH4 F;  4B47 A;  2ECB A;  1Y0N A;  3PUB A;  2P7C B;  5J3L A;  2I8D A;  4LG0 B;  3QU3 A;  1IJW C;  1IRG A;  1U9N A;  3EET A;  2XF7 A;  4EJU A;  3JCU C;  3FZV A;  2W00 A;  3FXR A;  2AXL A;  3HKZ A;  1F4K A;  4EGY A;  1MMN A;  4NB5 A;  5KVR A;  2JPB A;  2EFN A;  2LD5 A;  3F6O A;  2Z2S B;  2PJP A;  1BA5 A;  2QQB A;  1VTN C;  2AXT C;  5BQT A;  1PUE E;  2R92 J;  4NHJ A;  3H9J A;  2LKX A;  2R7W A;  5KAF C;  1JKP C;  4MFE A;  2JUC A;  1LUJ B;  3LSI A;  1HW5 A;  3J81 Z;  3HPH A;  3GX4 X;  1CF7 B;  1JHF A;  2K9Q A;  2V9K A;  1B9M A;  3LSK A;  5EG0 A;  3GBG A;  4Q48 A;  4IQJ A;  3GLL A;  1S7O A;  2W85 A;  3NWT A;  2DMU A;  4UB8 C;  2ZXH A;  1ULY A;  2L7K A;  1J5Y A;  3QPS A;  4CCM A;  1H88 C;  4DYR A;  1QNT A;  3ISP A;  3Q3S A;  4C9Y A;  1TWC J;  3T1B A;  4CCN A;  4ZYG A;  5FLM J;  5F27 A;  3JTH A;  2DT7 B;  1Z9C A;  2QCO A;  1W5T A;  4CXF A;  2KJC A;  3RPU A;  2R7X A;  3LQR A;  1IDY A;  2LH9 A;  1D1A A;  4N4N B;  4C2U A;  4I0A A;  1A04 A;  3SFI A;  1BC7 C;  1C0W A;  1N77 A;  3F9K A;  4AYB N;  4G6D A;  2L3D A;  3ULQ B;  1UJ8 A;  3WE3 A;  1SMY F;  2G0E A;  2ZME C;  3I3L A;  1TWA J;  1K61 A;  3BTL A;  1SFU A;  2OPT A;  4L5J A;  2M3A A;  3D5S C;  1MH4 A;  4FT8 A;  5FRM A;  2WAE A;  2M0C A;  4DJA A;  2NAZ A;  5EEG A;  1S3J A;  2CQK A;  1X58 A;  2XRL A;  1FNN A;  4IRG A;  1YIT I;  5JHF A;  5JLX A;  3K70 C;  4HOB A;  1GT0 C;  3ZQ7 A;  4LK1 F;  1DGW Y;  2CUF A;  3CCE I;  3CJT B;  2XV4 S;  3JR9 A;  2Y75 A;  3F3X A;  4DW6 A;  3T0Y A;  3GFJ A;  4QPQ A;  1KGS A;  4BHP A;  2EFW A;  4V2F A;  4B3X A;  2HXO A;  1ZRF A;  1FP2 A;  3FIW A;  2LSO A;  3F8F A;  4MO7 A;  3ROU A;  1BL0 A;  2QWW A;  4CDG A;  4N0B A;  2Y0S A;  4YEJ A;  3ASO H;  3GTQ J;  1AKH B;  3J7Z I;  3S3M A;  4KIS A;  3IV5 A;  1VQK I;  5E3L A;  1Z3X A;  2LFB A;  4W1U A;  1P7I A;  3F8B A;  2D1H A;  1HXD A;  2O3F A;  1YYV A;  1Z7U A;  2ELH A;  4XKB A;  1TNS A;  5JI6 A;  1OFC X;  3LAP A;  3HYI A;  2XVC A;  1ETW A;  1O3R A;  5K5Q A;  2DPU A;  5HOD A;  2LOO A;  2HYG D;  4NQW A;  1G8X A;  3TBI A;  4BEH B;  2CV2 A;  4M72 A;  1W7P B;  2K02 A;  3BR0 A;  3Q9S A;  1B9N A;  5FFX A;  5D4R A;  4XLH A;  3ABL H;  1IZ1 A;  4GYG A;  3ZGK A;  3JRG A;  4FE4 A;  3HEF A;  1KU2 A;  1OYY A;  2JZY A;  1GV2 A;  2LY9 A;  4U0W A;  3H9G A;  2E2I J;  2AO9 A;  4E70 A;  2X9D A;  2QA4 I;  2F2E A;  4IHV A;  3CQZ J;  1QU3 A;  2R7V A;  2ZNY A;  1IUY A;  1W5S A;  3AFH A;  2E19 A;  3G3Z A;  1HDP A;  3AKZ A;  4A3D J;  1PUF A;  3CCR I;  4RAY A;  3CLQ A;  2R5Y A;  4HLY A;  1RET A;  2IP2 A;  1K78 A;  2LBF B;  5HLH A;  4XOP A;  4M9X A;  5D5W B;  3QPT A;  1T0F A;  2P6T A;  5M5W J;  2KKO A;  2OAZ A;  1K4T A;  2FSW A;  2E2J J;  2TCT A;  2IS1 A;  2L9N A;  5LLQ A;  1JI8 A;  3KCC A;  4AC0 A;  2MBF A;  3ZMT A;  3OYB A;  1AHD P;  3GYH X;  1EV7 A;  3LSJ A;  2ZJ2 A;  2JJ7 A;  2DYS H;  3MWM A;  4UY8 I;  3R6S A;  3A0H C;  1G3W A;  1S29 A;  3QU6 A;  4TV7 A;  1XSV A;  2HWV A;  1VQO I;  4G6T B;  3RDI A;  5D4S A;  2CQX A;  4UVA A;  1IN8 A;  1MKM A;  3J81 K;  3LFK A;  4W97 A;  4XKV A;  2A6T A;  3S17 J;  3DTK A;  4YRV A;  1ZYR F;  1OR7 A;  2IW5 A;  4ZC3 A;  3BZ6 A;  1AU7 A;  2KFD A;  3S15 J;  2V4J C;  2QUF A;  3PIP F;  5J47 A;  2ISZ A;  1OJL A;  5FKL A;  3HG9 A;  4Q4Z F;  1RUN A;  3A01 A;  4ZDO A;  1XGM A;  5D5U B;  1D8K A;  2DBB A;  1R4M B;  2WB1 A;  5DV5 A;  5D5X B;  2N8G A;  3ZCO A;  1VQ8 I;  3TP3 A;  3QQA A;  1Z6T A;  3W6J B;  2RGV A;  3JSO A;  4ETS A;  4E7H A;  1W0U A;  2WWY A;  3CJN A;  2CW8 A;  3KYL A;  4HV6 A;  5H20 A;  2CO5 A;  3J7A O;  1ZAR A;  2EFP A;  3Q0U A;  2O61 A;  1LNW A;  2E5Z A;  4RBO A;  3BG7 A;  4UXN A;  1SAN A;  3M4O J;  4HF0 A;  1V3F A;  4Q47 A;  1O3S A;  1B1B A;  1GV5 A;  4JYK A;  3C2B A;  4BUP A;  5CYV A;  1JXS A;  3N05 A;  2HZD A;  1G3S A;  5B1A H;  4IXA A;  4M73 A;  2DFH A;  2VKV A;  3I4P A;  1UST A;  2EH3 A;  3OWT A;  1FY7 A;  4E6K G;  5ED4 A;  5D6E A;  3S1R J;  3PM1 A;  1ZEL A;  2A05 A;  3DKW A;  4BL0 B;  1WJA A;  2LY1 A;  2KP6 A;  4O5V A;  4RAG A;  4B4C A;  3HTS B;  3EYI A;  2HOS A;  3K7A J;  2HQN A;  3H92 A;  2FQ3 A;  9ANT A;  2VT3 A;  3L2V A;  2E7X A;  4WF2 A;  2MD0 A;  1X4O A;  1BBY A;  2YU9 J;  2VBW A;  3PNY A;  3GZ5 A;  2HVQ A;  4RMN A;  5DM7 F;  4ZZD A;  1YIO A;  5LFA A;  3F22 A;  4E7S A;  3I54 A;  1SD6 A;  2WY7 Q;  5KAI C;  3PL8 A;  2L0K A;  2HQA A;  3K69 A;  4PCQ A;  1QZE A;  2X1C A;  2OQR A;  2KT0 A;  3A0B C;  3HHG A;  5LHH A;  3M3Y J;  2E1O A;  2F4I A;  4XN3 A;  3IWF A;  3K4L A;  1ZLJ A;  3L2R A;  2M87 A;  1E17 A;  2EV6 A;  1ITY A;  1JT6 A;  4Y13 A;  1GXP A;  2KLO A;  4MEY F;  2ELK A;  5IT9 Z;  2CQ7 A;  2YPR A;  4RGS A;  1ZKG A;  3EQL F;  3M8J A;  1TW3 A;  1ZGW A;  3VFZ A;  2H1K A;  2QKM B;  3PFI A;  1X3Z B;  1W36 C;  3RKQ A;  2VL8 A;  2H6C A;  3LA7 A;  2VJ5 A;  2VAS A;  1A35 A;  5AIQ A;  2NVU B;  2QYO A;  3I59 A;  1SVL A;  1FC3 A;  2X4H A;  3RTR A;  3ZMV A;  4NC6 A;  4HDV A;  3DQV C;  3DLL F;  2XF6 A;  1XDS A;  3V7C A;  3ZR8 X;  5TRD A;  4KNY A;  1U5T A;  3H0G J;  4JK1 X;  4CCL A;  4CH7 A;  1XMK A;  4I6Z A;  1XCV A;  5LBQ A;  3P9I A;  1MBH A;  5FD6 A;  1MMS A;  5H2F C;  3DBH B;  3QYF A;  3OYG A;  2FJ1 A;  3H1C A;  2ZJQ F;  4ZTJ A;  1VQ6 I;  1IRX A;  2H27 A;  1RKW A;  2VOD A;  1F43 A;  1BC8 C;  3HRS A;  4OAY A;  3QP6 A;  2TRT A;  2BEO A;  1HLV A;  2EIM H;  4YFN F;  4P5O A;  3HUG B;  3JTG A;  1WCM J;  1BJZ A;  2DLL A;  3K2A A;  2XDV A;  4JOM A;  2UXN A;  5E1X A;  3ZQL A;  1OMI A;  1J0R A;  2CFX A;  1Z1D A;  3WE2 A;  4F92 B;  2KIM A;  3VOE A;  1DU0 A;  3I56 I;  3QYB A;  4HG2 A;  4A3F J;  1I6X A;  2HOT A;  4BE1 A;  1X3W B;  4XON A;  4ZYA A;  3ZMZ A;  2HFH A;  3LSM A;  2K3F A;  4A69 C;  3IAM 2;  4B1R A;  2PI0 A;  1MBE A;  3W2W A;  1BW6 A;  4R79 A;  4XKW A;  1WI9 A;  3VYT B;  3F23 A;  2HYF A;  2GOM A;  2ME6 A;  4U0V A;  1WJC A;  2RN7 A;  3L2Q A;  4G6Q A;  1OIS A;  2DO7 A;  2VBY A;  3NQO A;  1LEB A;  2HPI A;  1GLN A;  3FMS A;  2RQP A;  3HB9 A;  4OIN F;  1GXQ A;  4FTH A;  1ZHF A;  2RVC A;  4PZJ A;  2X0L A;  4R1H A;  1SAU A;  4Y15 A;  1U3E M;  3CD6 I;  5E3O A;  5ICC A;  2MYS A;  3CTA A;  1IRF A;  1I5Z A;  2VPR A;  3MN2 A;  4ZTF A;  2XF5 A;  3EPZ A;  2ZJR F;  3KZY A;  5GPA A;  3D1N I;  1B72 B;  4RM3 A;  2BY1 A;  1ODD A;  4RB1 A;  4BE2 A;  3H3U A;  3J7A Y;  5EF6 A;  4EEF G;  1IN6 A;  5ERI A;  5EGO B;  3FM5 A;  3BPX A;  1N25 A;  5DCF A;  1TL8 A;  3JRH A;  3ERE D;  1IO2 A;  5EZG A;  1T0F C;  1HF0 A;  2DMT A;  2L4A A;  3QP5 A;  1ZG5 A;  2XAS A;  1STZ A;  2ZNZ A;  4U88 A;  4AIK A;  2GM4 A;  3M07 A;  2NYX A;  1FOW A;  1FOY A;  1Y56 A;  2JSC A;  3JSP A;  3IKT A;  3J80 K;  2BW3 A;  4IHX A;  5HDK A;  2EB7 A;  1R7J A;  3FDY A;  4UVC A;  1FEX A;  1SD5 A;  2Q8K A;  3B6C A;  1FX7 A;  3H35 A;  2HDD A;  2BHY A;  4G12 A;  3GTK J;  1TWG J;  2MH2 A;  2FNP A;  3KP4 A;  1FWZ A;  1W0T A;  2LDU A;  2DFF A;  2DAO A;  2X51 A;  5HS9 A;  2RKH A;  4Y33 A;  2EV5 A;  3HTU A;  4B48 A;  2MA3 A;  4IHW A;  3K4B A;  1Q1V A;  4J01 A;  2JA5 J;  4S05 A;  3I5U A;  4A3L J;  3O8H A;  4AUX A;  4DBR A;  1W36 D;  1O7L A;  1JKQ C;  1OR7 C;  1MND A;  4M6X A;  2NOJ B;  5CLS A;  5B5E C;  3JRB A;  1D0X A;  2XGX A;  2DDB A;  2EJR A;  4KT6 A;  5IT9 K;  3CF5 F;  5K5R A;  5IY5 H;  3ZN1 A;  2A61 A;  2MG4 A;  2BHZ A;  3WTX C;  1YS6 A;  4GDF A;  5DS9 A;  1ZR2 A;  2DA2 A;  3HOS A;  2Z33 A;  4XRS G;  4L0Y B;  1I1S A;  2DA3 A;  1PDN C;  5HLI A;  4FE7 A;  1QZY A;  1DPR A;  5IYC J;  2QQA A;  5CJ9 A;  2IGM A;  2KHM A;  2Q0O A;  2MAB A;  4CIC A;  2KIF A;  4CZZ A;  2K9M A;  5IYB J;  2OD5 A;  3HDD A;  2XKO A;  3QRF F;  3BR2 A;  2F4O B;  2LP0 A;  3PFY A;  4BQQ A;  4UUV A;  1WPK A;  1QHH D;  1BI2 A;  2HDC A;  3GTJ J;  4HNV A;  3DPT A;  1MSF C;  2L4M A;  3CZ6 A;  2OV7 A;  4EJT A;  2R7D A;  1LB2 A;  4FAS D;  1XB4 A;  1X1D A;  3SDG A;  3VEP A;  2M9H A;  2Y9Z A;  1IAW A;  3QOE A;  4LIU A;  1XD7 A;  3OOP A;  4LGW A;  2X1E A;  3F8N A;  1E3H A;  1OPC A;  2ZSH B;  5CVJ A;  4I09 A;  1H0M A;  2GA1 A;  2V26 A;  4DZJ A;  3EDP A;  1ACI A;  3CES A;  1F9N A;  2DA7 A;  2PX9 A;  1S6L A;  3LA3 A;  5F6F A;  3TO6 A;  2VBZ A;  4QSH A;  2O0Y A;  2XAU A;  1J75 A;  1FTZ A;  2GAU A;  1Z0X A;  2OZU A;  4RS8 A;  2VXD A;  2XB5 A;  2ESN A;  2K85 A;  2Y0S N;  5IOY A;  3GFL A;  3OR1 C;  3RYR A;  1HDD C;  3M9A A;  4M9Z A;  1ZGJ A;  2DFE A;  3SZP A;  2HDW A;  5HDG A;  3DU6 A;  1ETV A;  1T56 A;  1MD0 A;  2AHQ A;  4CCJ A;  2DW4 A;  5LHI A;  4CUG A;  1D1B A;  1O3Q A;  2Y69 H;  1JGS A;  2PFB A;  1XC5 A;  1FJL A;  3HPG A;  5L3B A;  3DTE A;  3M8F A;  1IC8 A;  5M3M J;  4OIR F;  1KA8 A;  2K4J A;  1MBJ A;  4BBR J;  1BR2 A;  1LDD A;  1UHS A;  5LD2 C;  2O8K A;  3FK6 A;  4UB6 C;  1HKQ A;  1UCR A;  2VE8 A;  4KYW A;  4BQO A;  3C18 A;  4EJO A;  2K7L A;  2MGQ A;  1RES A;  3FHZ A;  1H89 C;  1JJ8 C;  3BG3 A;  3VWB A;  4OMY A;  1BOB A;  3MEX A;  4AVP A;  4EMS A;  1XS9 A;  1FBU A;  3AG3 H;  3M1C A;  2EFQ A;  2B63 J;  2VOP A;  1KQ8 A;  2LY2 A;  4LLN A;  3BY6 A;  4OOI A;  2BY3 A;  3OYC A;  2X6W A;  2LF8 A;  2Z9O A;  4LK0 F;  2IVM A;  4CO8 A;  4JBA A;  1Y1W J;  2K4B A;  5BNG A;  3OYK A;  1MBK A;  2COB A;  2QBY B;  3HRU A;  2NS7 A;  4LIV A;  3WOD F;  3V8J A;  2OC6 A;  2E7W A;  2FX0 A;  2FU4 A;  3RKY A;  3H0D A;  2JTV A;  3ZMU A;  3KYD B;  2NRA C;  2W57 A;  2KJB A;  3ZPL A;  4WX9 A;  2UV1 A;  1W5C C;  4HPQ A;  3FMR A;  3FBN B;  3JRD A;  1LFP A;  4A3C J;  4C3J J;  2KIS A;  2X6Y A;  3LWF A;  3WG9 A;  2GXA A;  2VUM J;  3F8M A;  2L7M P;  2M30 A;  3CC2 I;  5D5V B;  2R7F A;  1UMQ A;  5DD4 A;  2MD5 A;  3U1D A;  5J8F A;  2ID3 A;  4I0B A;  2VQG A;  3C7J A;  1MDM A;  1POG A;  1RUO A;  4IPA A;  2KL4 A;  1HKS A;  1YOV B;  5F04 A;  4HSR A;  2LLK A;  2DA4 A;  2YSR A;  1I39 A; 
#chains in the Genus database with same CATH homology
 1T98 A;  2NNY A;  2FNA A;  4HZF A;  5ILV A;  2HR3 A;  4A6D A;  2ACJ A;  3GWZ A;  2DI3 A;  1ZAO A;  1O7F A;  4L5I A;  1AWC A;  2UWM A;  1ZH5 A;  1U78 A;  1FT9 A;  2O6G E;  3CUQ A;  3GVA A;  2FE3 A;  4XBF A;  2G7H A;  5JVT A;  1MJA A;  4P9F A;  1D8J A;  3I0T A;  3KLO A;  3MCZ A;  4WWC A;  2BYV E;  2IA0 A;  3KEO A;  1OKR A;  5AIP A;  1LDK B;  4WCG A;  1T2K A;  4EV0 A;  3WU0 A;  2COM A;  1KYW A;  2M5W A;  2P5V A;  2NS0 A;  2VN2 A;  5HDN A;  3KP2 A;  3R61 A;  3WGG A;  5FGM A;  4GO1 A;  2GIV A;  4P9U A;  3REO A;  3SZT A;  1CF7 A;  1E2X A;  4ESJ A;  5E8I A;  3BJA A;  3ZP5 A;  3CO7 C;  3SFZ A;  4ENK A;  3BOQ A;  5DD8 A;  3ZMD A;  1SFE A;  2HQR A;  3HOT A;  2EFO A;  1XGS A;  3QAH A;  1LQ1 A;  2W25 A;  1Z91 A;  3RJP A;  4YFX F;  4A6E A;  1HQC A;  1DUX C;  3MZH A;  3CO6 C;  2H94 A;  1OYW A;  5HLG A;  2IA2 A;  4RB2 C;  3DXJ F;  3H3Z A;  1K78 B;  4EGZ A;  3DPL C;  4LJZ F;  3PQJ A;  3F6V A;  2F5C A;  1X3U A;  2G9W A;  5FLX Z;  1ONV A;  4HX7 A;  1J2X A;  2ZKZ A;  5LGN A;  4OMZ A;  5EEH A;  5BOX A;  1FSE A;  4GCV A;  4OU0 A;  5E20 A;  4FHT A;  2J5P A;  4MNU A;  1FOK A;  3C3W A;  2M1B A;  2FA5 A;  4ENN A;  1TTY A;  1YS7 A;  1UB9 A;  1W7P A;  1YG2 A;  2HZT A;  4L9V A;  3E97 A;  2IT0 A;  1BOA A;  1MZB A;  4HV5 A;  5BPD A;  1MGT A;  4A0X A;  2HKO A;  3LA2 A;  3N4M A;  1UHW A;  5BMZ A;  3BRO A;  2XAJ A;  2H6B A;  1SAX A;  3NEU A;  2GZW A;  2IA1 A;  3RKW A;  5FB2 A;  2H09 A;  1G3Y A;  3CLO A;  1XSD A;  1WRJ A;  1K7A A;  2E1C A;  1USS A;  5LGU A;  3BP8 A;  5ILS A;  3JW4 A;  2QZ8 A;  5F64 A;  1L3L A;  4AD9 A;  1IN4 A;  1TNT A;  3PQK A;  4FX4 A;  3K0L A;  2DU9 A;  2BV6 A;  1JHH A;  2K86 A;  2FBI A;  1TQI A;  2JPC A;  2MH9 A;  4HX8 A;  1LVA A;  2EA4 A;  3W6K B;  2DK8 A;  3R0A A;  5CVV A;  3QPH A;  2A3S A;  3N97 A;  2DQR A;  1SFX A;  4HA8 A;  2QM3 A;  1EH6 A;  2RDP A;  2FMY A;  1Z6R A;  2OBP A;  3HIF A;  3KLN A;  4G9Y A;  2WC2 A;  4PGG A;  2ISY A;  1QPM A;  4O3M A;  4BXU A;  2KRF A;  4Y17 A;  4G7H F;  2Z5U A;  3CUQ C;  5JFR A;  2DTR A;  3I59 B;  2Z99 A;  2STW A;  3G73 A;  3FWE A;  3L09 A;  5FLX K;  2V1U A;  1HSJ A;  3KE2 A;  1U5T B;  5E8G A;  4XLN F;  3P7N A;  2D45 A;  4EQQ A;  3O2P E;  5ICG A;  1YLF A;  3SQN A;  4MEX F;  3IRR A;  3GLX A;  3O3K A;  4BHC A;  2C6Y A;  1B4A A;  3LAJ A;  4OIQ F;  3WTS C;  5H6R A;  1V4R A;  4ASN A;  3FXU A;  2XHK A;  2R3S A;  1NHA A;  5D6F A;  4IRI A;  1IN7 A;  3BPV A;  4R8H A;  3CUO A;  2DFI A;  1YW8 A;  2W24 A;  3TDU C;  1WKM A;  3KP6 A;  1ON2 A;  1XGO A;  2XRN A;  2W84 A;  4BHB A;  4EVI A;  1K6O A;  4HQM A;  2TDX A;  4U7B A;  1YW7 A;  2XRO A;  4IF4 A;  5J8C A;  1P4W A;  2V1X A;  4HF2 A;  5DCM B;  4UHT A;  2ZME B;  1ZG3 A;  5DEQ A;  2AS5 F;  3K2Z A;  3KP3 A;  1UFM A;  1FYL A;  5HS8 A;  2CWE A;  4B8X A;  2LF7 A;  3DP7 A;  2PG4 A;  3GW2 A;  1D3Y A;  4GYI A;  1H9G A;  4M9S A;  2XIG A;  3R4K A;  4ZYE A;  1T6S A;  4WXD A;  3TOA A;  1MJ9 A;  4A2U A;  3RPQ A;  1R1T A;  1R1U A;  1BI1 A;  2ETH A;  4EJV A;  3LST A;  5HVQ C;  2XKP A;  2GXG A;  4EM2 A;  1LDJ A;  4EM1 A;  1QGP A;  5L3F A;  2V6C A;  1HBX G;  2FML A;  3IHU A;  4HX4 A;  5TJJ A;  3V4G A;  1WQ2 A;  2PQ8 A;  4HYE A;  2CW0 F;  4A0Y A;  2O8X A;  2EV0 A;  5LGT A;  2P5L C;  1Q1H A;  1HST A;  5BPI A;  1DPU A;  4BYY A;  2ADU A;  3V8L A;  3E6M A;  4DQ2 A;  5L3E A;  1RIO H;  3KFW X;  3Q9V A;  5H6Q A;  1ZG1 A;  1SD7 A;  2LKP A;  4LFU A;  1F1Z A;  3M1E A;  1FYK A;  4LLL A;  1ZN2 A;  2RNJ A;  2JRT A;  2PMH A;  4KMU X;  4BAY A;  3VOD A;  4IJA A;  2GXB A;  4LLG F;  3ABU A;  1U6G A;  3ECH A;  4IRH A;  4L0Z B;  2OU2 A;  1IW7 F;  1I27 A;  3C1D A;  2PN6 A;  3MAJ A;  1TW2 A;  2K27 A;  1YQA A;  5IT3 A;  4AIH A;  3WTY C;  4L9N A;  5LEK A;  4MTE A;  2XUB A;  3TO7 A;  2NNN A;  4M6Y A;  1FSH A;  2FRH A;  2RV8 A;  2RC4 A;  4B09 A;  2DK5 A;  3DF8 A;  2VE9 A;  1P92 A;  2M45 A;  1BIA A;  5L3C A;  3I64 A;  4LMY A;  4ESF A;  4U0Y A;  4AWX B;  5FD5 A;  4I01 A;  1YTY A;  1UHM A;  3COA C;  1R22 A;  4PDK A;  4LB6 B;  3IKV A;  4P96 A;  4UNO A;  1BN5 A;  4KIF A;  1ZLK A;  3V7R A;  3GXO A;  2E1N A;  3V7S A;  3I71 A;  5CVI A;  1L0O C;  1G3T A;  3WGH A;  1RZ4 A;  1GVJ A;  4HLX A;  3DEU A;  3HSF A;  5AON A;  2DQL A;  3RI4 A;  1HW1 A;  4WXH A;  4K2E A;  4KN4 X;  1EH8 A;  3E5X A;  3E3V A;  2A69 F;  2XAF A;  2OQG A;  3P9C A;  1P2F A;  2IRF G;  1TBX A;  1QO0 D;  3RYP A;  3ZN0 A;  1Y0U A;  3F21 A;  4ZZL A;  2QBY A;  1YW9 A;  1O57 A;  2QQ9 A;  1KQ0 A;  2B0L A;  3EYY A;  3EUH A;  4BH9 A;  2DT5 A;  4D0P A;  3MQ0 A;  3FX3 A;  1ZGA A;  1XGN A;  1ON1 A;  3ECO A;  1SD4 A;  5E1Z B;  3ML6 A;  4ON0 A;  4N9I A;  2YR2 A;  5ILU A;  5KK1 A;  4A5N A;  4XSX F;  4LG0 A;  3R60 A;  3I58 A;  3WTV C;  2QVO A;  3FM3 A;  5J6X A;  3MZY A;  3V8K A;  1BI0 A;  2ZO4 A;  4UVB A;  4RB3 C;  4AIJ A;  2BBY A;  2MC3 A;  4L18 B;  2YX7 A;  3GZ6 A;  2HGC A;  3L7W A;  4CGZ A;  3P9K A;  5L3G A;  1IN5 A;  1ZRE A;  1BM9 A;  1XSX A;  2ZXJ A;  4LD5 A;  1YFH A;  1B6A A;  2IJL A;  4F7Z A;  1LJ9 A;  2P8T A;  2PEX A;  2FEZ A;  5FFZ A;  1K79 A;  3JAM Z;  4OIO F;  5LEJ A;  4KIC A;  2YX4 A;  3GEZ A;  4KT5 C;  4Z2Y A;  4P55 A;  4ESB A;  1XCB A;  2F5E A;  3ABT A;  4G8X A;  4M74 A;  2UZK A;  5ICE A;  3WTT C;  3IC7 A;  2FF4 A;  4KIB A;  1XDU A;  1HKT A;  3B73 A;  2WTE A;  1CGP A;  2Y0M A;  4WK8 F;  4JQF A;  2V1D A;  2M8E A;  3TGN A;  1XN7 A;  1O3T A;  4RGX A;  1BJA A;  1TQP A;  5BS6 A;  3NRV A;  1BI3 A;  2ESH A;  3VB2 A;  4KMF A;  1J59 A;  3BJO A;  2PBI A;  4HAM A;  4A12 A;  3IRQ A;  4EJW A;  3K1M A;  3BDD A;  3ELK A;  4WXC A;  4IVN A;  1FBS A;  1HW2 A;  3Q5F A;  2VC0 A;  4ENM A;  4L9J A;  1B59 A;  5D8K B;  1G4D A;  2ZBK A;  2PMU A;  3TQN A;  5E17 F;  1WWX A;  4MQV A;  2HOE A;  2VT2 A;  1RNL A;  4PGH A;  4H0E A;  2A6E F;  2ZCW A;  3AAF A;  2OA4 A;  4KUM A;  4IHT A;  1SMT A;  1WSU A;  4RGU A;  5ICF A;  2HKX A;  2L02 A;  4MTD A;  1LEA A;  4KDP A;  2F5D A;  2A07 F;  3T8R A;  4YFK F;  4XRF A;  2MLK A;  1KU3 A;  4OIP F;  3T5X A;  3WGI A;  1IXR C;  2HTS A;  3HRM A;  1R58 A;  2VC1 A;  4HW0 A;  2UXX A;  3M7G A;  4KA4 A;  3WTZ A;  5LRR A;  3B02 A;  3GFM A;  4QWQ A;  4XLP F;  3KP7 A;  3M8E A;  4HBL A;  3SHF A;  5K5O A;  5E18 F;  3F72 A;  3IWZ A;  5DDG A;  3JAM K;  4I02 A;  1P4X A;  1FBQ A;  1T38 A;  3S2W A;  1ZRC A;  3GO5 A;  3KZZ A;  6PAX A;  3E5U A;  5CVU A;  2A6H F;  4G94 A;  4YII A;  2P6S A;  2CYY A;  2P7V B;  1PP7 U;  2IPQ X;  5K1Y A;  3J80 Z;  4XSZ F;  3FMQ A;  4BNC A;  4G7O F;  5HS7 A;  2LNB A;  4A0Z A;  2D1V A;  5E1W A;  3SXY A;  3BJ6 A;  1QZZ A;  4N9H A;  3O6B B;  4MHG A;  3MFK A;  3KEQ A;  2YU3 A;  4M71 A;  3E6D A;  1TLH B;  2GQQ A;  3F8C A;  2Y48 A;  1GHC A;  5A2Q Z;  2DPD A;  1IXS B;  2OZ6 A;  4EM0 B;  3HHH A;  1P6R A;  4QLC U;  4MQ9 F;  5JHU A;  3GFI A;  1XMA A;  5DYM A;  4RAZ A;  1YO5 C;  1KQ9 A;  4FX0 A;  1IF1 A;  5FO5 A;  3L2C A;  4CHU A;  2PLY A;  3FF5 A;  2VXZ A;  3HSR A;  2FXA A;  1J7K A;  1R5G A;  1D5V A;  2BGC A;  4KN7 X;  4KIG A;  3E6B A;  3RIR A;  4G7Z F;  1P4A A;  2VON A;  3I53 A;  5HOO A;  2L01 A;  1BIB A;  2J5O A;  3HUG A;  4I98 B;  2L54 A;  2FBH A;  2BE5 F;  5CVR A;  1U8R A;  2FBK A;  4UV8 A;  2CG4 A;  4S04 A;  3R0J A;  3K1N A;  4DNC A;  5DUI A;  1R1V A;  2XAQ A;  3TOB A;  3DV8 A;  3TO9 A;  1U2W A;  2D2W A;  5DCM A;  2EWN A;  5F1R A;  2ZME A;  1I1G A;  2ZFW A;  3RKX A;  4Q5S F;  1KU9 A;  3TDZ C;  4ZYH A;  3CDH A;  2STT A;  1IXC A;  1S7A A;  4MGR A;  4GXO A;  1FZP B;  1W4M A;  3FXQ A;  3K9T A;  1G6N A;  2P4W A;  1ZRD A;  1FLI A;  4A5M A;  3GUD A;  2Q2E A;  2QLZ A;  2V79 A;  4LB5 A;  1Z05 A;  2GWR A;  2KIU A;  3T8T A;  2Z3Y A;  3E5Q A;  1S8N A;  2A68 F;  4UV9 A;  1FYM A;  4ZYD A;  2V9V A;  1F5T A;  2GA2 A;  3OV8 A;  5L3D A;  5LHG A;  5A2Q K;  4CYD A;  1R00 A;  4IHS A;  2HS5 A;  3LQQ A;  2O03 A;  3IL2 A;  4ENJ A;  1DP7 P;  3GF2 A;  1H9T A;  1FP1 D;  3U2R A;  2MLG A;  4RGR A;  3KET A;  3HSE A;  2JT1 A;  4O6J A;  2P5K A;  3E6C C;  1DDN A;  2F5F A;  4RB0 A;  3L00 A;  4GGG A;  1JE8 A;  1KU7 A;  2XAG A;  3ZMS A;  1FPQ A;  2CGP A;  5JR3 A;  4I2O A;  1RI7 A;  2G7U A;  1PP8 F;  2EA2 A;  3DFG A;  5DUK A;  2XAH A;  3K1P A;  1KYZ A;  4KFC A;  3WTU C;  1QBJ A;  1MDM B;  4I7H A;  3QOP A;  5D8L B;  1R5H A;  2FOK A;  1W7P D;  4HF1 A;  3HRT A;  2EK5 A;  4YG2 F;  3L9F A;  1R23 A;  1QQI A;  3D0S A;  1REP C;  2QEN A;  3WTW C;  4YIF A;  1TQM A;  1OYI A;  2VBX A;  3WU1 B;  2HEO A;  2A5Y B;  2CSO A;  3U9G A;  3CUQ B;  3BWG A;  4HQE A;  1J9I A;  1U5T C;  2VOO A;  1MJB A;  1R36 A;  2WV0 A;  4BQA A;  5LRS A;  1EH7 A;  3KP5 A;  1AOY A;  4HDU A;  3D5L A;  1T39 A;  4U7D A;  3TKY A;  2HTJ A;  4L9T A;  4ZH4 F;  2P7C B;  4LG0 B;  3QU3 A;  1IRG A;  3EET A;  4EJU A;  3FZV A;  3FXR A;  2AXL A;  1F4K A;  4EGY A;  4NB5 A;  5KVR A;  2JPB A;  2EFN A;  3F6O A;  2PJP A;  2QQB A;  1VTN C;  5BQT A;  1PUE E;  4NHJ A;  1HW5 A;  3J81 Z;  1CF7 B;  3GX4 X;  1JHF A;  1B9M A;  4Q48 A;  1S7O A;  2W85 A;  1ULY A;  1J5Y A;  1QNT A;  3ISP A;  4ZYG A;  3T1B A;  3JTH A;  1Z9C A;  1W5T A;  4CXF A;  2KJC A;  3RPU A;  3LQR A;  4I0A A;  1A04 A;  1BC7 C;  1C0W A;  4G6D A;  2L3D A;  3ULQ B;  3WE3 A;  1SMY F;  1SFU A;  4L5J A;  4FT8 A;  2NAZ A;  5EEG A;  1S3J A;  2CQK A;  4IRG A;  1FNN A;  4HOB A;  3ZQ7 A;  4LK1 F;  2XV4 S;  2Y75 A;  3F3X A;  3T0Y A;  3GFJ A;  1KGS A;  4BHP A;  2EFW A;  1ZRF A;  1FP2 A;  2LSO A;  3F8F A;  3ROU A;  2QWW A;  4CDG A;  4N0B A;  3F8B A;  2D1H A;  1HXD A;  2O3F A;  1YYV A;  1Z7U A;  2ELH A;  1TNS A;  5JI6 A;  3LAP A;  3HYI A;  2XVC A;  1O3R A;  5K5Q A;  2DPU A;  2HYG D;  4NQW A;  4M72 A;  1W7P B;  2K02 A;  3Q9S A;  1B9N A;  5FFX A;  5D4R A;  1IZ1 A;  4GYG A;  1KU2 A;  1OYY A;  2JZY A;  4U0W A;  4E70 A;  2F2E A;  2ZNY A;  1IUY A;  1W5S A;  3G3Z A;  4RAY A;  4HLY A;  2IP2 A;  1K78 A;  5HLH A;  4M9X A;  5D5W B;  3QPT A;  1T0F A;  2P6T A;  2KKO A;  2OAZ A;  2FSW A;  5LLQ A;  3KCC A;  2MBF A;  3ZMT A;  3GYH X;  1EV7 A;  2ZJ2 A;  3MWM A;  3R6S A;  1G3W A;  1S29 A;  3QU6 A;  4TV7 A;  1XSV A;  2HWV A;  3RDI A;  5D4S A;  4UVA A;  1IN8 A;  1MKM A;  3J81 K;  3LFK A;  1ZYR F;  1OR7 A;  2IW5 A;  3BZ6 A;  2QUF A;  2ISZ A;  1RUN A;  4Q4Z F;  1XGM A;  5D5U B;  1D8K A;  2DBB A;  5DV5 A;  5D5X B;  1Z6T A;  3W6J B;  2RGV A;  3JSO A;  4ETS A;  2WWY A;  3CJN A;  4HV6 A;  5H20 A;  2CO5 A;  3J7A O;  1ZAR A;  2EFP A;  2O61 A;  1LNW A;  4UXN A;  4HF0 A;  1V3F A;  4Q47 A;  1O3S A;  1B1B A;  5CYV A;  1JXS A;  1G3S A;  4IXA A;  4M73 A;  3I4P A;  1UST A;  1FY7 A;  5ED4 A;  5D6E A;  3DKW A;  4O5V A;  3HTS B;  3EYI A;  2HQN A;  3H92 A;  2FQ3 A;  2VT3 A;  2E7X A;  4WF2 A;  1BBY A;  2VBW A;  3GZ5 A;  4ZZD A;  1YIO A;  3F22 A;  3I54 A;  1SD6 A;  3K69 A;  4PCQ A;  2OQR A;  3HHG A;  5LHH A;  3IWF A;  1ZLJ A;  2M87 A;  1E17 A;  2EV6 A;  1GXP A;  4Y13 A;  4MEY F;  5IT9 Z;  2YPR A;  4RGS A;  3EQL F;  1TW3 A;  3VFZ A;  3PFI A;  2H6C A;  3LA7 A;  5AIQ A;  2QYO A;  3I59 A;  1FC3 A;  2X4H A;  3RTR A;  3ZMV A;  4HDV A;  3DQV C;  1XDS A;  3V7C A;  5TRD A;  4KNY A;  1U5T A;  4JK1 X;  1XMK A;  1XCV A;  5LBQ A;  3P9I A;  5FD6 A;  2H27 A;  2VOD A;  1BC8 C;  3HRS A;  3QP6 A;  2BEO A;  4YFN F;  4P5O A;  3JTG A;  2DLL A;  2UXN A;  5E1X A;  1OMI A;  1J0R A;  2CFX A;  1Z1D A;  3WE2 A;  2KIM A;  3VOE A;  1I6X A;  3ZMZ A;  2HFH A;  2PI0 A;  4R79 A;  1WI9 A;  3F23 A;  2HYF A;  4U0V A;  2RN7 A;  4G6Q A;  2DO7 A;  2VBY A;  3NQO A;  1LEB A;  3FMS A;  2RQP A;  4OIN F;  1GXQ A;  1ZHF A;  2RVC A;  4PZJ A;  2X0L A;  4R1H A;  4Y15 A;  1U3E M;  5ICC A;  3CTA A;  1IRF A;  1I5Z A;  3KZY A;  1ODD A;  4RB1 A;  3H3U A;  1IN6 A;  5ERI A;  3FM5 A;  3BPX A;  5DCF A;  3ERE D;  2L4A A;  3QP5 A;  1ZG5 A;  2XAS A;  1STZ A;  2ZNZ A;  4U88 A;  4AIK A;  2JSC A;  3JSP A;  3IKT A;  3J80 K;  5HDK A;  2EB7 A;  1R7J A;  4UVC A;  1SD5 A;  2Q8K A;  1FX7 A;  2MH2 A;  2FNP A;  3KP4 A;  1FWZ A;  2LDU A;  2DAO A;  5HS9 A;  2RKH A;  2EV5 A;  3HTU A;  2MA3 A;  4S05 A;  3I5U A;  1O7L A;  4M6X A;  5CLS A;  2XGX A;  2EJR A;  5IT9 K;  5K5R A;  3ZN1 A;  2A61 A;  3WTX C;  1YS6 A;  3HOS A;  2Z33 A;  4L0Y B;  1I1S A;  1PDN C;  5HLI A;  1QZY A;  1DPR A;  2QQA A;  5CJ9 A;  2Q0O A;  4CIC A;  2KIF A;  4CZZ A;  2OD5 A;  2XKO A;  3QRF F;  4UUV A;  1BI2 A;  2HDC A;  3DPT A;  2L4M A;  4EJT A;  2R7D A;  1LB2 A;  1XB4 A;  3VEP A;  1IAW A;  1XD7 A;  3OOP A;  4LGW A;  3F8N A;  1OPC A;  5CVJ A;  4I09 A;  1H0M A;  2GA1 A;  3EDP A;  1F9N A;  1S6L A;  3LA3 A;  5F6F A;  3TO6 A;  2VBZ A;  2O0Y A;  1J75 A;  2GAU A;  2OZU A;  4RS8 A;  2ESN A;  3GFL A;  3RYR A;  3M9A A;  4M9Z A;  1ZGJ A;  3SZP A;  5HDG A;  1MD0 A;  2DW4 A;  5LHI A;  1O3Q A;  1JGS A;  2PFB A;  5L3B A;  3M8F A;  4OIR F;  1KA8 A;  2K4J A;  1LDD A;  1HKQ A;  1UCR A;  2VE8 A;  4KYW A;  3C18 A;  4EJO A;  2K7L A;  3FHZ A;  4OMY A;  3MEX A;  4AVP A;  4EMS A;  1FBU A;  2EFQ A;  2VOP A;  1KQ8 A;  4LLN A;  3BY6 A;  4OOI A;  2LF8 A;  2Z9O A;  4LK0 F;  2IVM A;  4CO8 A;  4JBA A;  2K4B A;  2QBY B;  3HRU A;  3WOD F;  3V8J A;  2E7W A;  3RKY A;  2FU4 A;  2JTV A;  3ZMU A;  2NRA C;  2W57 A;  2KJB A;  3ZPL A;  4WX9 A;  3FMR A;  3LWF A;  3WG9 A;  3F8M A;  2M30 A;  5D5V B;  2R7F A;  5DD4 A;  2MD5 A;  3U1D A;  5J8F A;  4I0B A;  1MDM A;  3C7J A;  1RUO A;  4IPA A;  1HKS A;  2NYX A;  2YSR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...