1JXSA

Solution structure of the dna-binding domain of interleukin enhancer binding factor
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
98
structure length
98
Chain Sequence
DSKPPYSYAQLIVQAITMAPDKQLTLNGIYTHITKNYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASESKLIEQAFRKRRPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords interleukin enhancer binding factor
publication title Solution structure of the DNA-binding domain of interleukin enhancer binding factor 1 (FOXK1a)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 14
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2001-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00250 Forkhead Forkhead domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1jxsA00
4IJAA 1G3WA 4RS8A 2IPQX 2R7FA 4IRHA 3QU6A 2RKHA 3LAJA 1OR7A 2F2EA 3ROUA 4HOBA 4U0VA 3MZHA 3JAMK 1SFEA 3U9GA 4GYIA 1G3SA 1MJBA 5JFRA 4L5JA 2STWA 2KIFA 4GO1A 1FT9A 2JPBA 5TRDA 2DQLA 4MQ9F 3E3VA 4AIJA 3RPUA 3GFLA 4BYYA 3F6VA 2WC2A 2BYVE 2XAGA 2YPRA 5JHUA 3G3ZA 3VB2A 1SFXA 3WTTC 3R61A 2Y0MA 4I2OA 1P2FA 3HHGA 4L0YB 2DO7A 5HOOA 3QOPA 4EJWA 2ISZA 1FNNA 3H3UA 5DYMA 4OMYA 3ECHA 2GQQA 2ZO4A 2O03A 4CGZA 3RI4A 2IVMA 4D0PA 3HUGA 1XSVA 1V3FA 5LGUA 3DFGA 1IN8A 4U0YA 3BWGA 5D8KB 2IRFG 4HAMA 1EH7A 2FF4A 3G73A 2W24A 5HLIA 2Q8KA 4P9FA 4G7HF 1IRFA 5A2QK 1XGOA 3E5QA 1Z91A 4Y13A 4MTEA 4M9SA 2IT0A 4Q4ZF 2ZJ2A 5J8CA 1ZARA 4RAYA 5J6XA 2A61A 1Z6RA 5BPDA 2ZBKA 4ZYHA 4KIGA 2FU4A 3KP5A 3C18A 4PDKA 4QLCU 3LSTA 1EV7A 2IA0A 3K1PA 2P8TA 1P4XA 4LLLA 4LG0B 1ON2A 5JI6A 3N4MA 1GVJA 1LEBA 1P4WA 3KZYA 3ABUA 2IW5A 1G3YA 3LA2A 1FBUA 4KA4A 2NRAC 4UVBA 5E18F 3WGGA 5LRSA 1U3EM 1U78A 2GWRA 5H6RA 2LKPA 3V7CA 4N9IA 2XVCA 1FC3A 5FB2A 3V7SA 2CO5A 1RNLA 3LA7A 2E7XA 2J5OA 3FF5A 2P6TA 4UV8A 2YU3A 3C7JA 3RYPA 1ZGAA 2PEXA 3LFKA 2ZFWA 4KNYA 2HWVA 4CHUA 2VT3A 2NS0A 3V7RA 1FX7A 3TDZC 1BIBA 3M1EA 5DCFA 4M9XA 2CGPA 2XAFA 1K7AA 2HDCA 5DCMA 1R22A 4R8HA 3E6BA 3SXYA 4ON0A 3HOSA 1KQ9A 3NRVA 5F1RA 3M9AA 2EFOA 3Q5FA 4HW0A 4HX4A 4R1HA 5F6FA 4AD9A 1W7PD 4OIPF 4LLGF 4ETSA 4XRFA 5KK1A 3WTYC 1QQIA 2M1BA 4WXDA 1BC8C 4IRIA 4WXHA 2ACJA 2V1DA 1SFUA 4OMZA 3F23A 3RDIA 1DPUA 1ONVA 3EQLF 2RV8A 4UV9A 2XHKA 2HKXA 3KP2A 4GCVA 1S7OA 3R4KA 1GXQA 1I1GA 3TOBA 1I1SA 4O3MA 4LB5A 3KE2A 2D1HA 5KVRA 1W7PA 4ZH4F 5CVUA 2H94A 3HRMA 1O57A 2MA3A 1FYKA 3J80Z 4RAZA 3F8MA 5DUIA 3F8CA 3KP6A 4KN4X 2FBKA 1YQAA 3RKYA 1H0MA 1BI1A 1IAWA 5HVQC 1RUNA 2LF7A 4ENMA 1H9GA 1HKSA 4H0EA 5LLQA 3F8BA 1WI9A 3I71A 3DKWA 1YIOA 4K2EA 1XDUA 1KYZA 3SQNA 3GXOA 2JTVA 2DQRA 5LHGA 4YFXF 3J81Z 1YYVA 3EETA 2PQ8A 4BAYA 2DK5A 1ZGJA 2XAJA 1PP7U 1ZG5A 3TO6A 2OA4A 1B6AA 4EGYA 2L4AA 3QAHA 2K86A 5IT9K 3TGNA 1K78A 1TW2A 2FNAA 2OQRA 4ESFA 1L3LA 3BOQA 4MHGA 4XLNF 4PGHA 4A12A 4YFNF 4DQ2A 5ICEA 3CDHA 3SZTA 1W5TA 2P5KA 3HYIA 1FLIA 4MNUA 3FWEA 1IRGA 4I7HA 5FLXZ 1FYLA 1O3SA 5AIQA 1XCVA 2AXLA 5E20A 2WTEA 1F9NA 1LQ1A 1QBJA 3NQOA 3ZQ7A 3KP3A 2C6YA 3DEUA 2M45A 5L3CA 2MH9A 5HS7A 1IN4A 3CUQB 4G6DA 2P7CB 1IN5A 1F1ZA 1T39A 2OQGA 2XGXA 3DQVC 4MGRA 3RYRA 5ILVA 3RJPA 1U6GA 1KU3A 1T2KA 3MFKA 3ABTA 1ZREA 4KDPA 1WQ2A 4KIBA 2EWNA 1XCBA 1FYMA 1IUYA 1OYYA 3LWFA 4OOIA 4IVNA 4HQMA 4GXOA 4BH9A 1MDMA 1R23A 3V8JA 3ZMZA 3DV8A 1P4AA 3FXQA 3GWZA 1HSJA 1BI0A 1U5TB 4KIFA 4ENJA 1VTNC 1FBSA 3EUHA 2BEOA 1S7AA 4IXAA 3WGHA 2XROA 4N0BA 1D3YA 1K6OA 1LNWA 5CVVA 1XGSA 2RGVA 3WG9A 1QGPA 4IHSA 5ILUA 4FX4A 5HLHA 3TQNA 4HDVA 4BXUA 2ZKZA 4UNOA 1FBQA 4IPAA 1ZLJA 2V9VA 1OMIA 1LDKB 2L3DA 1IXSB 3R0JA 3K69A 2VN2A 3VFZA 1P6RA 3EYIA 3KLOA 1UB9A 1CF7A 1I5ZA 4ZZDA 4OIOF 4KFCA 5K5OA 3FXRA 2K4BA 4CO8A 3L2CA 4HF2A 4DNCA 3IKTA 2XIGA 1FY7A 3L09A 4EMSA 3CO7C 1USTA 5BQTA 2RC4A 2PFBA 2QVOA 2CSOA 2M30A 2B0LA 3RPQA 3FMSA 4KYWA 4L9TA 3HTUA 2FRHA 3PQJA 1W4MA 3D5LA 1HW2A 3I5UA 3BJ6A 2VC1A 2MD5A 5FFZA 4HBLA 1WWXA 3DPTA 5DD4A 2UWMA 2V1XA 2VT2A 1ZYRF 1XSDA 4LD5A 3JAMZ 2W57A 1ZHFA 2ISYA 2HYGD 4HZFA 2O0YA 2FSWA 4U7DA 1FPQA 5DUKA 1BI2A 1DP7P 1SD6A 5EEGA 5FD5A 3F72A 3FM3A 1HW5A 5K5RA 4KUMA 3HRSA 3DP7A 2J5PA 3QP5A 2WWYA 3BY6A 2MH2A 2EK5A 3SHFA 2BE5F 3L7WA 3CO6C 2XRNA 1QPMA 4B09A 4KMFA 1XB4A 4EM2A 2VBXA 2STTA 2ZXJA 2PN6A 2X4HA 4CXFA 2XKPA 1HKTA 1R5GA 3TOAA 1BOAA 3GZ5A 3P7NA 3VOEA 1XD7A 1HQCA 1YW7A 2P4WA 5EEHA 2IA1A 2R3SA 5HLGA 2CG4A 4NHJA 3GEZA 4BHCA 2DLLA 2GXBA 5D5XB 1JXSA 4M9ZA 4HLXA 2Y48A 4LK1F 4PGGA 4LB6B 2QZ8A 1ZH5A 5LBQA 2XUBA 2L02A 2RNJA 2Y75A 5A2QZ 3IWZA 3FMQA 2A3SA 4ZYGA 4LGWA 4EV0A 5BMZA 1YW8A 4WX9A 2OU2A 3MWMA 2D45A 2E1CA 1SMYF 2ZCWA 1R1UA 2FOKA 4RB3C 1JE8A 4I0BA 3FXUA 5D5WB 4UXNA 1Z9CA 4JK1X 4G7OF 2FBIA 1OYWA 2QM3A 1S8NA 2F5CA 4ZYEA 5L3GA 1IN7A 3JTHA 1EH8A 3HSRA 5BOXA 1E17A 2KJBA 3CUOA 4A2UA 3GUDA 4CZZA 4GYGA 1U2WA 3HRTA 3O3KA 2A6EF 1S3JA 1DUXC 2XASA 1GHCA 1WKMA 1USSA 3QPHA 4HF0A 5AIPA 1LB2A 1ZLKA 5ED4A 4LLNA 1R5HA 1UCRA 2L4MA 5K5QA 1PUEE 3REOA 1R58A 3BROA 2FQ3A 3I59A 1HBXG 3WGIA 5E1XA 3MEXA 4EJUA 5BS6A 1RZ4A 2Q0OA 2EJRA 4ZZLA 1T6SA 1XMAA 1LDJA 5H6QA 1Y0UA 2MLGA 5E8IA 2PI0A 5LGNA 3K0LA 1YO5C 3H92A 3V8KA 2HKOA 5DCMB 3WU0A 2V79A 5BPIA 3ZMUA 4Q5SF 1SD4A 1SD5A 2JSCA 2DU9A 1ULYA 2QYOA 3W6JB 1D5VA 1R00A 3T0YA 3QU3A 1LEAA 3Q9VA 1YTYA 3ZMTA 2FXAA 5CYVA 2W25A 1T0FA 1B1BA 4O5VA 1Q1HA 3ISPA 2EV5A 3T8TA 2KRFA 4XLPF 2VE8A 3RKWA 2F5FA 2A69F 1JGSA 1O3QA 5HS9A 4XSXF 4WK8F 3IRQA 3COAC 1B9NA 5D6FA 1NHAA 2NNNA 1K79A 3KEOA 1TQMA 2PMHA 2CQKA 5DEQA 3WU1B 1TNTA 4UUVA 5D8LB 2HTSA 4IF4A 5DD8A 4RB0A 2YSRA 3T8RA 2H6CA 2DTRA 1W7PB 5FGMA 2ZMEB 2O61A 1D8JA 1STZA 3H3ZA 1XN7A 3EYYA 4PCQA 3JW4A 2NNYA 4CDGA 4LK0F 3LAPA 2TDXA 1XGNA 5HDGA 1RIOH 3BJAA 4I01A 3DPLC 1MD0A 3E97A 4EVIA 1I27A 3E5XA 1IN6A 3BPVA 4RGUA 1LDDA 2MBFA 4BNCA 2G7UA 1TQIA 2HR3A 2HFHA 1MZBA 3GFMA 1HSTA 2GXGA 3KEQA 1X3UA 3E6DA 4G7ZF 5IT9Z 4JBAA 2K4JA 2VODA 5J8FA 2EV6A 3ZPLA 2DT5A 3TKYA 1V4RA 1SMTA 3JTGA 1TBXA 3B73A 2QENA 4RB1A 5AONA 4RGSA 4OIQF 4WWCA 3HOTA 1P92A 4HLYA 3FHZA 4IRGA 5IT3A 3SFZA 2D1VA 3M8FA 4HX8A 4EM1A 3HTSB 2JT1A 3WTZA 3ZP5A 4I0AA 1K78B 2KIUA 3GVAA 2WV0A 1PP8F 3KP7A 4MTDA 3B02A 1FP1D 1ZRDA 3U2RA 1Z05A 1YG2A 4YFKF 2DPUA 3R6SA 3Q9SA 2QBYA 2MLKA 1IZ1A 2RDPA 3WTWC 3ZN0A 2OAZA 2EFWA 5ERIA 2LNBA 2KIMA 2AS5F 2EB7A 3QP6A 3ZN1A 2HEOA 3S2WA 4HQEA 3GYHX 5ICFA 1BIAA 3LQRA 4S05A 1BM9A 3IKVA 3MZYA 2EFNA 3GF2A 2HZTA 1O3RA 3RKXA 3TO9A 2PMUA 4QWQA 4A5MA 3ZMDA 4EJVA 1BC7C 2QQBA 2FBHA 3I64A 2CWEA 4P9UA 2EFPA 4BHPA 2VOOA 2ZNZA 1AWCA 5DDGA 1S29A 5D5UB 1MDMB 3D0SA 1MKMA 4OU0A 3OV8A 3R60A 4RGXA 2JZYA 2OD5A 3IL2A 4G8XA 2MC3A 1XMKA 2ETHA 3P9KA 3I0TA 3FMRA 3DXJF 2IJLA 3N97A 2P5LC 4M72A 4A6DA 4R79A 3C3WA 5L3BA 4Y17A 1FZPB 1J5YA 2FE3A 5CJ9A 4HA8A 5E1ZB 4HDUA 3WTXC 2FA5A 3L9FA 1I6XA 1MJ9A 2EA4A 4M6YA 2XV4S 1CF7B 2O3FA 4U7BA 6PAXA 1KGSA 4Q48A 3V8LA 2DI3A 3KFWX 3C1DA 4S04A 2F5EA 3CUQC 1KU7A 1U8RA 4F7ZA 4L18B 1UHMA 2COMA 1ZG3A 2RVCA 3E6CC 5LHHA 1HKQA 2VOPA 1DDNA 2W84A 1O3TA 4G94A 3O2PE 4P96A 2DW4A 3HRUA 5LHIA 2LDUA 3BDDA 2E7WA 3O6BB 4YIFA 5LEKA 3KCCA 3I54A 4LFUA 1ZG1A 1XDSA 1AOYA 1JHFA 1U5TC 5LEJA 5E1WA 2FEZA 1FP2A 1R1VA 4HF1A 3K9TA 1J7KA 4AIKA 1KU2A 4A5NA 3IWFA 2QQ9A 2ZNYA 3E5UA 2H09A 2G7HA 2BGCA 2JPCA 3HSEA 3WTVC 4BQAA 1Z1DA 1F5TA 4ENNA 4L5IA 1QNTA 1QO0D 2ELHA 4L9JA 4ASNA 1QZZA 3FM5A 2NAZA 2CW0F 2H6BA 2OZUA 4N9HA 2Q2EA 2ADUA 4Y15A 1KYWA 4M71A 3ELKA 4YG2F 4ESJA 1KU9A 4FX0A 2CYYA 4AVPA 1Z7UA 4ESBA 3ZMSA 1LJ9A 4P5OA 4TV7A 2P6SA 4LG0A 1BI3A 3SZPA 3ML6A 4CYDA 1DPRA 1H9TA 4KMUX 4MEYF 1TQPA 3I4PA 2VONA 4HYEA 3K1NA 2K02A 1J0RA 1ZRFA 1MGTA 3ZMVA 2A68F 1SD7A 2A6HF 1G4DA 3P9IA 3ERED 1BJAA 3QRFF 3GW2A 5L3DA 3VEPA 2D2WA 4WXCA 1EH6A 4I02A 3BZ6A 2BV6A 3I58A 1B4AA 1YW9A 2HTJA 2HQNA 5ILSA 2PBIA 4YIIA 3J7AO 1OPCA 3MQ0A 1LVAA 5L3EA 5ICGA 2FNPA 4M6XA 1FOKA 1R1TA 2F5DA 2QLZA 1FWZA 1J2XA 3EDPA 3K1MA 3F8FA 3MAJA 4OINF 3WTSC 2K7LA 3F21A 1T98A 3IC7A 3LA3A 1O7LA 2GA1A 2BBYA 2FMYA 4AWXB 3M8EA 2CFXA 4Z2YA 5D4SA 1KQ8A 3CTAA 1PDNC 1R7JA 1UFMA 3GFIA 2DAOA 5CVIA 4A6EA 2VE9A 3M7GA 4NQWA 3HHHA 3LQQA 5CVJA 2M87A 3I59B 2PLYA 5F64A 3CJNA 2DFIA 1TLHB 1WRJA 2Z3YA 2HQRA 4UVCA 2V6CA 5DV5A 1BN5A 1YLFA 2IA2A 3GO5A 1J9IA 4Q47A 2LSOA 1ZRCA 2GA2A 2PG4A 2O6GE 2Z5UA 5D5VB 1J75A 1G6NA 3F6OA 3BJOA 2L54A 2VBZA 2R7DA 3CLOA 5JR3A 3DF8A 1ON1A 1IXRC 2VBWA 2YX7A 1C0WA 3IHUA 3KETA 5TJJA 3NEUA 1RUOA 5HS8A 1JHHA 2EV0A 4L9NA 2DBBA 5LRRA 2ZMEA 1OKRA 4KN7X 3F8NA 4B8XA 1L0OC 5HDNA 1Z6TA 4E70A 3JSOA 3J80K 1TTYA 5JVTA 2P5VA 4LMYA 2V1UA 2A07F 2M5WA 5HDKA 4ENKA 3WTUC 2VBYA 1REPC 1YFHA 3F22A 3U1DA 2M8EA 2QUFA 3HIFA 2VC0A 5D4RA 2XAHA 2A5YB 4KICA 4JQFA 2H27A 1HXDA 3PQKA 3GX4X 3TDUC 2ESHA 3FZVA 4M74A 1TNSA 1FSEA 1SAXA 1W5SA 4G9YA 4GGGA 4U88A 1RI7A 1A04A 3RTRA 4I98B 3GLXA 4P55A 4G6QA 5LGTA 2LF8A 1ODDA 3J81K 4WCGA 1B59A 2IP2A 4I09A 2YR2A 2UZKA 2OZ6A 1ZAOA 1TW3A 2EA2A 2UXNA 3K2ZA 4L9VA 5FFXA 1YS7A 2QWWA 5K1YA 4U0WA 2HS5A 2P7VB 5E8GA 4EQQA 1KA8A 1IXCA 4CICA 4A0XA 2GZWA 2XKOA 1E2XA 4ZYDA 2X0LA 3OOPA 3WE3A 1GXPA 3VODA 2DPDA 3CUQA 2PJPA 4XBFA 1IW7F 5FLXK 1T38A 3AAFA 2W85A 2GIVA 4UHTA 3MCZA 2NYXA 5D6EA 4KT5C 3KZZA 4MEXF 2G9WA 4L0ZB 4A0ZA 4O6JA 1O7FA 3R0AA 1D8KA 3WODF 4FT8A 4EGZA 3BPXA 4RB2C 2KJCA 3WE2A 1U5TA 5CLSA 3HSFA 2Z33A 2OBPA 1XGMA 3BP8A 1WSUA 1IF1A 3IRRA 3KP4A 5CVRA 1XSXA 1MJAA 4HV5A 1CGPA 3QPTA 3E6MA 1R36A 2GAUA 2E1NA 3PFIA 2QBYB 3L00A 1FSHA 2HGCA 3KLNA 2YX4A 4EM0B 3P9CA 4PZJA 2UXXA 1OYIA 4UVAA 1BBYA 3GFJA 3W6KB 5FO5A 1HW1A 3F3XA 2RN7A 4EJTA 5FD6A 2L01A 1UHWA 4A0YA 3RIRA 2VXZA 4HX7A 4XSZF 2ESNA 3T5XA 4BHBA 1S6LA 2Z99A 3JSPA 2EFQA 1QZYA 2HYFA 4FHTA 4MQVA 4IHTA 2K27A 3I53A 2HOEA 5H20A 3TO7A 3GZ6A 3ECOA 2QQAA 1B9MA 1ZN2A 1YS6A 2XAQA 3T1BA 2DK8A 4WF2A 2RQPA 5L3FA 1J59A 4EJOA 3V4GA 4OIRF 3ULQB 4HV6A 4M73A 2O8XA 2FMLA 2JRTA 5ICCA 4AIHA 1G3TA 3FX3A 5E17F 4LJZF 1KQ0A 2Z9OA 2KKOA 1F4KA 4NB5A 4RGRA
chains in the Genus database with same CATH superfamily
1XTAA 2M0CA 4IJAA 4GDFA 1G3WA 3RPUD 4A3LJ 4IQJA 4JX5A 2Y2ZA 4PSXA 4RS8A 3TW6A 4B4CA 2IPQX 1FIPA 2R7FA 4IRHA 1W1WE 3QU6A 4YIRX 2M0MA 2RKHA 3BR0A 2HYJA 2NXNB 3CC7I 4A3JJ 2L2OA 3HPHA 2F4OB 3LAJA 1OR7A 4E6KG 2F2EA 2LLKA 2B9SA 4MO7A 4Y7NJ 3L2QA 1R71A 1SFOJ 3ROUA 1RKWA 4HOBA 4UB8C 5IY5H 4U0VA 1YJNI 4BJ6C 3MZHA 2OF7A 2Z16A 3FK6A 1TC3C 3G1LA 2FJ1A 3VYRB 3JAMK 1SFEA 4A3GJ 3U9GA 2PJRB 4GYIA 1G3SA 2DN0A 1RR8C 1MJBA 1WJBA 3ZGKA 1D1CA 1OFCX 5EDNA 5JFRA 4L5JA 2STWA 2KIFA 5F0HA 4GO1A 1FT9A 2JPBA 4I99C 5TRDA 2DQLA 4MQ9F 2BZTA 3E3VA 4AIJA 3BQZA 5EGOB 1RPWA 3RPUA 3SYTA 2P0WA 3GFLA 4BYYA 2JUGA 3F6VA 2WC2A 1I50J 4D7MA 2BYVE 2IS6A 1XMXA 2XAGA 2YPRA 3ONQA 5E3NA 5JHUA 3JRHA 3G3ZA 4L5EA 4NUBA 3VB2A 5FKOA 1SFXA 3GCMA 3WTTC 4MFDA 3R61A 1U0JA 2Y0MA 4I2OA 1MMDA 1P2FA 3HHGA 1HF0A 5J1RA 1Y8RB 4L0YB 2DO7A 3JRDA 2E2IJ 1FOXA 4H4KC 5HOOA 3QOPA 4EJWA 3HB9A 3I56I 2ISZA 1FNNA 1X2NA 3H3UA 4XN0A 5DYMA 4OMYA 3ECHA 2BXZA 2X1CA 4G6TB 2GQQA 2ZO4A 3M8JA 2O03A 3G1MA 4CGZA 3K4BA 3RI4A 4PFOA 4B47A 2IVMA 3C2GA 3EUHC 3HUGA 4D0PA 1E3HA 4E7SA 1XSVA 3IP4B 1V3FA 5LGUA 3DFGA 1IN8A 4U0YA 4DJAA 3BWGA 5D8KB 2IRFG 4HAMA 1EH7A 1GV5A 1TWAJ 2FF4A 2VKEA 4FISA 5K7ZA 3G73A 1MIJA 2W24A 3LMMA 4HEA2 5HLIA 3PO3J 1YOVB 4AYBN 2Q8KA 1X1AA 3I4NJ 2FUG2 4FCYA 1R4NB 2WAEA 4P9FA 2KL4A 4G7HF 2E19A 1IRFA 3SJMA 5A2QK 1XGOA 3E5QA 3FK7A 4NC8A 1Z91A 3CCYA 4Y13A 1FTZA 2JA8J 4MTEA 4M9SA 1OCTC 2IT0A 4Q4ZF 2OTJI 2XAUA 2ZJ2A 5J8CA 2Q2EB 1ZARA 1F36A 3PUFA 4RAYA 5J6XA 2A61A 1Z6RA 5BPDA 2OJED 2ZBKA 2IAIA 2EPFA 4NDLA 3FISA 1ZTRA 1HA8A 4ZYHA 4KIGA 4MLOA 2FU4A 2KRCA 2JVHA 3KP5A 3C18A 3S93A 1S72I 4PDKA 4QLCU 3LSTA 1XPXA 1EV7A 2IA0A 3K1PA 2P8TA 3MMYB 1P4XA 4LLLA 4ZC3A 1QPIA 4LG0B 1ON2A 3KYLA 5JI6A 3LSPA 3GBGA 3HOXJ 3N4MA 3QQAA 1GVJA 1Z7LA 1LEBA 3H3VK 1P4WA 3KZYA 3ABUA 1SVLA 2IW5A 5E3LA 2Z1DA 3C2HA 2VKDA 1G3YA 2L5QA 3MVPA 3LA2A 3Q0UA 4N4NB 1FBUA 4KA4A 1X1DA 3GZNB 2NRAC 3AL0C 4UVBA 1EKEA 5E18F 3WGGA 1NTCA 5LRSA 1U3EM 1U78A 2GWRA 5H6RA 1VQKI 2MG4A 2LKPA 3V7CA 4ZYAA 4N9IA 2JMWA 3D5RC 2XF7A 2NVYJ 2XVCA 1FC3A 5FB2A 2XRLA 3V7SA 1W0UA 2CO5A 1RNLA 3OYAA 4V2FA 1MH3A 3AFHA 1NG7A 1EA3A 2R0QC 5J1UA 1SFKA 1N25A 1MBEA 3LA7A 1TWCJ 2AQEA 2E7XA 4AYBA 2DT7B 2J5OA 3FF5A 2DMNA 4BUPA 2IS4A 2P6TA 4UV8A 2YU3A 3C7JA 2XB5A 1DGRM 3RYPA 3CCMI 4BE1A 5M5YJ 3VDXA 1ZGAA 1T08B 5JHFA 2PEXA 3LFKA 2ZFWA 4KNYA 4ZDOA 2HWVA 5EJCA 2GLOA 4CHUA 1MSFC 1ETKA 2VT3A 4ANJA 2A5WA 2NS0A 3V7RA 1DU0A 3DKXA 4LG3A 5CQEA 1FX7A 3TDZC 3K70C 1BIBA 3BG3A 2IGKA 3NARA 3M1EA 3FXMA 5DCFA 2IS1A 4KITB 3W3CA 3A01B 4M9XA 4DYRA 2CS3A 2CGPA 1SAUA 4XM3A 3CMYA 2XAFA 4LITA 1H89C 1K7AA 3OY9A 5M3MJ 2QQ8A 2HDCA 5DCMA 3CMEI 2NVTJ 4IOAF 1R22A 2I5UA 4R8HA 2ELKA 1P9QC 3E6BA 4ON0A 3SXYA 2W00A 3HOSA 2KP6A 1KQ9A 1IG7A 3CJTB 1ZQ3P 4C2TA 3NRVA 5F1RA 1LUJB 3M9AA 1T8IA 4CYCB 2KDZA 1TT0A 2EFOA 1RETA 3Q5FA 4HW0A 4HX4A 4R1HA 3OSFA 4AIDA 2IGMA 3J7YJ 4ZJZA 5F6FA 2WV1A 4C3JJ 2VKHA 4AD9A 1X58A 2EILH 1W7PD 2OCEA 5TISC 4BGDA 3GTOJ 4OIPF 4RLFA 4LLGF 4ETSA 4XRFA 5KK1A 3WTYC 1QQIA 2M1BA 4PSWA 4WXDA 1BC8C 4IRIA 4WXHA 3RQ4A 2ACJA 2KRHA 2V1DA 3M07A 4A3MJ 1SFUA 4LIUA 4OMZA 3F23A 2DA4A 3RDIA 3JR9A 2YS9A 3CZ6A 1DPUA 1ONVA 1UJ8A 3BTCA 3EQLF 4DIQA 2RV8A 4UV9A 2XHKA 4NQWB 3CESA 1WI3A 2HKXA 3MN2A 3KP2A 4YRVA 4GCVA 1S7OA 4XR6A 3R4KA 1GXQA 3LSHA 1I1GA 4E4HA 3TOBA 2OCCH 1I1SA 3RKQA 3HC7A 4O3MA 4XQFA 4LB5A 5B66C 3KE2A 2ME6A 3RSNA 1IC8A 2D1HA 1DU6A 2BY3A 2ID6A 1W7PA 2XB0X 5KVRA 5CPRB 4ZH4F 5CVUA 4XKWA 3HZJA 2H94A 3HRMA 3ERMA 2QKLB 1O57A 2MA3A 1PJRA 1T56A 5HODA 3OWTA 1QRYA 1FYKA 4BBSJ 4XOPA 1MW7A 1YX5A 2V9KA 3MD2A 3J80Z 3QWLA 4RLQA 4RAZA 2E71A 2XGEA 3F8MA 5M5XJ 3F8CA 4PK4A 5DUIA 3KP6A 3OYGA 1V5FA 4KN4X 2FBKA 4BJ5C 3CCQI 2YUSA 5GP9A 3FKIJ 1OJLA 1YQAA 3HG9A 2P81A 4XLAA 4BJTA 1QVUA 4D5FA 2AHQA 2E2HJ 2R5YB 3RKYA 4XMYA 1H0MA 1BI1A 1S5LC 4BQOA 4QSHA 1IAWA 2JVGA 3CP2A 3ESWB 5HVQC 1RUNA 1M1EB 2R7SA 2CUEA 2LF7A 3AG2H 1Z3YA 2KFDA 4F55A 4ENMA 1H9GA 1HKSA 3MKZA 2VJ5A 4UB6C 1LFUP 4IKFA 3A2KA 4PJ0C 4H0EA 3OR1C 5TGTA 5LLQA 3F8BA 1WI9A 3I71A 3DKWA 1V5EA 1YIOA 3OYBA 2VQHA 4K2EA 5B1BH 1XDUA 4MFEA 3H0DA 1KYZA 3HGGA 4IHVA 3SQNA 2V4JC 3OYFA 3GXOA 2JTVA 3F9KA 2DQRA 5LHGA 4YFXF 3J81Z 2HZDA 2O9LA 1YYVA 3FIWA 3EETA 1VQ9I 4NNJA 1XG1A 2PQ8A 2Y69H 4FE7A 4BAYA 2WA0A 2DK5A 1ZGJA 4ZDPA 2XAJA 4C3IJ 1PP7U 1YRNA 5FROA 1ZG5A 1YJ9I 3TO6A 2OA4A 3LOCA 5FKNA 2VPLA 2CUFA 1B6AA 2KHMA 3BTJA 3GMEA 3K4MA 1QZEA 4EGYA 2XDVA 2L4AA 2R7ZJ 2OC6A 1WVRA 3QAHA 3CJRB 4DOZA 1N77A 1MNDA 2K86A 5IT9K 3TGNA 5FKKA 3DU6A 4XLEA 2L7KA 4AM3A 4HNTA 1K78A 1TW2A 3J7ZI 2R7QA 2FNAA 3D5SC 2O5RA 1WJ5A 2OQRA 4B3AA 4ESFA 1L3LA 1I3AA 3LNQA 3BOQA 1IO2A 4MHGA 4XLNF 3W2WA 4PGHA 4A12A 4YFNF 4DQ2A 5CKTA 5ICEA 1SEUA 3CDHA 3SZTA 1W5TA 2P5KA 1RR7A 3HYIA 2X85A 4XNFA 1TZLA 4DGWB 3G2BA 5K7HA 3CLQA 2JA5J 1FLIA 4MNUA 3PUBA 1A35A 4KT6A 3FWEA 1IRGA 2BY1A 2CQNA 5FRMA 4I7HA 5FLXZ 2K3FA 1JUMA 3KEYA 1FYLA 1O3SA 2BY0A 1XCVA 2AXLA 5AIQA 5E20A 3S1QJ 2WTEA 1F9NA 3KPHA 1BR2A 1LQ1A 4NC7A 1VFCA 1QBJA 3PNYA 3NQOA 4NC6A 4M3BA 3I3LA 3ZQ7A 3KP3A 3EUAA 2C6YA 3TP0A 2KZGA 3S2DJ 3DEUA 4PJJA 2M45A 3VYSB 4JP0A 5L3CA 2MH9A 1D0ZA 4JX6A 5HS7A 2HOAA 1IN4A 3CUQB 4G6DA 2ICWG 4Y33A 2P7CB 1IN5A 3MZ8A 1F1ZA 4I6ZA 3FDYA 1T39A 2OQGA 2LBFA 2XGXA 3A0HC 3DQVC 4MGRA 3RYRA 2WY7Q 1GT0C 4IOCF 4PFPA 5ILVA 3S16J 3RJPA 5EG0A 1U6GA 1KU3A 2X6XA 1T2KA 3MFKA 3ABTA 1PUFB 1ZREA 4W1UA 4KDPA 3GLLA 2LFBA 2EIMH 3W2AA 1WQ2A 4KIBA 2EWNA 1XCBA 1FYMA 1IUYA 5GTIC 1OYYA 3LWFA 4QPOA 5FKMA 4OOIA 4IVNA 3I4MJ 1JI8A 4HQMA 4GXOA 2VIXA 4BH9A 2BHZA 3CF2A 1MDMA 3S14J 1R23A 3JRFA 3V8JA 2FQ4A 3ZMZA 3DV8A 1P4AA 3FXQA 3GWZA 1HSJA 1BI0A 1U5TB 5KAFC 2EINH 4KIFA 2QF7A 5KAIC 4ENJA 1VQPI 5C4XJ 2R92J 2E1MC 4RBOA 5EZGA 1VTNC 1FBSA 3HOYJ 3EUHA 2BEOA 1S7AA 3CP8A 4IXAA 4IQ4A 1MBJA 1W0TA 3CD6I 3WGHA 4KJZA 2HPIA 2UV1A 2XROA 4N0BA 2H1LA 1D3YA 5M5WJ 3IAS2 4CCJA 1K6OA 1LNWA 3DCFA 5CVVA 1ZK8A 1XGSA 2DA1A 2LK2A 2RGVA 3WG9A 1R4MB 1Y6IA 4DYCA 2E2JJ 3OS0A 1QGPA 2VI6A 2XGDA 5ILUA 2E35A 5HLHA 4LOCA 3TQNA 4HDVA 4BXUA 4FX4A 4IHSA 2Y30A 2ZKZA 3H9GA 4UNOA 1FBQA 2KIQA 1JUSA 4IPAA 1ZLJA 2WB1A 2DOAA 2V9VA 1OMIA 3OYKA 2KPMA 4AC0A 2XPWA 1DP3A 1LDKB 1MMAA 3QPLA 2L3DA 1IXSB 3R0JA 4EATA 3K69A 2VN2A 1V54H 3VFZA 1P6RA 3EYIA 2BY2A 2DDAA 3KLOA 4E7KA 1UB9A 4DZJA 3L2RA 1CF7A 1I5ZA 4UUSA 1IV8A 4ZZDA 2KT0A 4OIOF 4XRSG 4KFCA 2R5ZA 5K5OA 3FXRA 2K4BA 2IGOA 4CO8A 1JKQC 3OYMA 2V26A 4BE0A 3L2CA 1ETQA 4RDUA 3GTJJ 4HF2A 4DNCA 3IKTA 1B72B 3I55I 2VLAA 1POGA 2IGNA 4X6AJ 3OYHA 2XIGA 1FY7A 3L09A 1FMWA 3OYLA 3K70D 4EMSA 2B63J 4U87A 2DODA 1USTA 1UZCA 3CO7C 2WAQN 3GTKJ 2ZXHA 5BQTA 1RESA 5JVGF 2RC4A 1LE8A 2PFBA 2RREA 2QVOA 1D1AA 1P7IA 2CSOA 2R7TA 1BW6A 2DMQA 1RRJA 2M30A 1WJFA 2B0LA 3RPQA 4ZDLA 2O8KA 3FMSA 2HVRA 3ASNH 5J4YA 4KYWA 4XRSA 4L9TA 3HTUA 2FRHA 1WPKA 3PQJA 1W4MA 3D5LA 2NS7A 2KDOA 4YEJA 1HW2A 3I5UA 2VL8A 2EH3A 3BJ6A 3ZQHA 2VPRA 3KIOA 2VC1A 2MD5A 5FFZA 2DA2A 3PSIA 4HBLA 1JKPC 1WWXA 3DPTA 5DD4A 4PUSA 2UWMA 2V1XA 1NG6A 2VT2A 1ZYRF 4HSRA 4FETA 1YI2I 4LD5A 2W7NA 1XSDA 2XSJC 3JAMZ 2W57A 1ZHFA 3OYJA 2HDDA 1K61A 2ISYA 2E34A 2HYGD 4HZFA 2MC4A 2O0YA 2FSWA 5FLVA 5F08A 4U7DA 5DM7F 2JN6A 1FPQA 5DUKA 4XICA 1Y0NA 1BI2A 1DP7P 2JJ7A 2M8GX 2LR8A 1Z3XA 3Q0WA 3RZOJ 1SD6A 2VJJA 5EEGA 4BACA 5FD5A 3HOVJ 3F72A 3FM3A 3WU2C 1HW5A 5K5RA 3PIPF 4KUMA 3SZGA 1R5ID 3HKZN 4CH7A 1A31A 2JA6J 3HRSA 1VQLI 3DP7A 4UUTA 2J5PA 1ETWA 3QP5A 2PX9A 2WWYA 3BY6A 1B8IA 1G59A 2GIZA 4CCKA 4A3EJ 4BU2A 2V6EA 2MH2A 2EK5A 4G12A 3SHFA 2BE5F 3L7WA 2X1DA 3S8PA 3CO6C 2XRNA 1QPMA 4B09A 2WAQA 4KMFA 3A02A 1QHGA 1XB4A 5LD2C 4CCOA 4EM2A 4CCNA 2QA4I 4PJMA 2VBXA 2L7ZA 1IDYA 4XK4A 2STTA 3CDLA 2ZXJA 2PN6A 2X4HA 4CXFA 2XKPA 1ITYA 1HKTA 1R5GA 3TOAA 1BOAA 3GZ5A 3P7NA 3VOEA 1XD7A 3GTQJ 1HQCA 1YW7A 2P4WA 1HC8A 5EEHA 2IA1A 2R3SA 2EZIA 5HLGA 2KMUA 2CG4A 4NHJA 2XPUA 3GEZA 2DLLA 4BHCA 2R7XA 2GXBA 5D5XB 1JXSA 2W4SA 4M9ZA 4HLXA 2A6TA 2BW3A 3OOUA 1JKRC 2X51A 4J19A 3VSKA 3OS1A 2Y48A 3H5AA 3JRGA 4BXXJ 4A93J 4LK1F 1VNDA 2CW8A 4PGGA 4LB6B 3BQYA 2QZ8A 3K4LA 1ZH5A 5LBQA 3M3YJ 2XUBA 2L02A 2RNJA 2Y75A 3OMYA 4QIWN 5A2QZ 3IWZA 3FMQA 2A3SA 4ZYGA 2CH0A 4LGWA 2JUCA 3HKZA 5EF6A 4EV0A 5BMZA 1XX5A 1X1PA 1YW8A 4XLHA 1ZGWA 5KNLA 4WX9A 2OU2A 4D9JA 3DEWA 3HUGB 5J40A 1MH4A 3MWMA 2D45A 2E1CA 1SMYF 2ZCWA 1R1UA 1Y1VJ 3S3OA 2FOKA 1WFXA 2WAFA 4E7HA 3BR6A 2ELJA 3WHBA 2RNGA 4RB3C 2ME0A 3BZKA 3D1NI 3TMOA 1JE8A 2IS2A 4I0BA 4HSTA 2VUMJ 3S1RJ 4BQNA 5GPAA 3FXUA 2XC7A 2MGQA 5D5WB 4RMNA 3OIQA 4UXNA 1Z9CA 4JK1X 2VQLA 4B43A 1R49A 3FKJA 4G7OF 2FBIA 1OYWA 5GAHJ 2QM3A 1S8NA 1TP4A 2F5CA 2MYSA 2QKMB 4A3FJ 2JK3A 4D7NA 3AKZA 4ZYEA 5L3GA 1IN7A 3JTHA 2X1EA 4QPQA 2F6CA 3CCRI 1Q1VA 3O8GA 1EH8A 3E1SA 3HSRA 4Z6YA 2XPVA 5BOXA 4V19K 3K6GA 2AO9A 1ZR4A 1GUUA 3S1NJ 1E17A 2KJBA 3BR2A 3CUOA 2CQXA 4A2UA 3GUDA 4CZZA 5FKLA 3FXJA 5IP9J 3PFYA 4GYGA 3JRIA 2V9PA 2NS8A 1U2WA 3HRTA 3O3KA 3H36A 2A6EF 1S3JA 1DUXC 2XASA 1GHCA 1WKMA 3HEFA 3S15J 2DFEA 3K10A 1USSA 3QPHA 4BL0B 4HF0A 5AIPA 1LB2A 2M9HA 5ED4A 1ZLKA 4FE4A 4LLNA 1R5HA 4DBRA 1UCRA 4A3IJ 5KCMA 2L4MA 4M3DA 5K5QA 1PUEE 4RM3A 1R58A 3REOA 2K9QA 3HPGA 1BOBA 3BROA 5HNHA 2FQ3A 1QA6A 3I59A 2QSHX 1Z77A 1HBXG 3WGIA 5E1XA 4M3GA 1MBKA 4A3KJ 1JJ8C 3MEXA 4EJUA 5BS6A 3CF5F 1RZ4A 2Q0OA 2NOJB 2EJRA 2RAEA 3ASOH 3CCLI 4ZZLA 2LMDA 2CFOA 1T6SA 1ETVA 3AG3H 2QSGX 1XMAA 1LDJA 4XONA 5H6QA 1Y0UA 4XL9A 2MLGA 5E8IA 2PI0A 1OCPA 3DU5A 5LGNA 4AVZA 3K0LA 3ABMH 1YO5C 2F48A 4JX4A 4XLFA 2LC2A 1D1BA 3H92A 3V8KA 2HKOA 4CUGA 5DCMB 3SDGA 5HLTA 3WU0A 3CC4I 1TWGJ 2V79A 5BPIA 2AQFA 3ZMUA 4Q5SF 1SD4A 2Y9ZA 3PJRA 1AHDP 1SD5A 2OPTA 2JSCA 2DU9A 1ULYA 4C9YA 4XIDA 2QYOA 1U8BA 3G71I 3W6JB 4UY8I 2MFZA 1D5VA 1Y56A 4NBQA 1R00A 3T0YA 2NVUB 3QU3A 1LEAA 3Q9VA 5DTDA 1Y39A 1YTYA 3ZMTA 2FXAA 5CYVA 2DA3A 2K9LA 3A4CA 5EEAA 3DKYA 2W25A 1B1BA 3CCJI 2VB6A 2Y0SN 2FX0A 4X1EA 4O5VA 5GADJ 1Q1HA 5F27A 3ISPA 2EV5A 4HNVA 1HLVA 3T8TA 2IEKA 4A3BJ 2DOEA 3QOEA 1HOMA 2KRFA 4XLPF 2VE8A 3RKWA 3H1CA 2F5FA 3BG7A 2A69F 1JGSA 1D5YA 3CJQB 1O3QA 2W82A 2HU9A 4QTRA 5HS9A 4XSXF 4WK8F 4II3A 3IRQA 3FXOA 2LY2A 3COAC 1B9NA 5D6FA 1K4SA 1NHAA 2DFFA 2NNNA 1K79A 1WHUA 3A03A 3KEOA 2BHYA 1TQMA 5J4VA 1U9NA 2PMHA 2CQKA 5DEQA 4IHWA 3WU1B 1TNTA 4UUVA 5D8LB 2HTSA 4IF4A 4JYKA 3CCUI 2Q1ZB 5DD8A 3AG4H 4RB0A 3GTPJ 2YSRA 1PYVA 1OQYA 2H6CA 3T8RA 4OAYA 3H0GJ 4E7ZA 2DTRA 2W1OA 1KZHA 1IV6A 1W7PB 2CQQA 2NOGA 3K4KA 2ZMEB 3IH4A 4XLCA 5FGMA 2O61A 1D8JA 1STZA 1HDPA 1X3WB 3H3ZA 1APLC 3JCUC 2HXOA 2V7FA 1XN7A 3EYYA 2CRGA 4PCQA 2MD0A 3JW4A 2NNYA 4CDGA 4LK0F 5B3SH 3LAPA 2TDXA 3BT9A 3OIOA 1XGNA 2BVMA 5EYRA 5HDGA 2K9SA 1RIOH 3BJAA 4I01A 2JWTA 2Y0SA 1ETYA 1S9HA 3IH2A 1CQTA 4OAZA 3DPLC 1Z21A 1MD0A 3E97A 3IAM2 4EVIA 4AUXA 1I27A 1MMSA 2WBMA 3E5XA 4E7JA 1K83J 1IN6A 2CMPA 3BPVA 3TW7A 2L9NA 4RGUA 1LDDA 1A6QA 4GFBA 4D5CA 2MBFA 1MNMC 1GLNA 2UUZA 2DOFA 2G7UA 1TQIA 4BNCA 1VQ6I 2HR3A 4I76A 2HFHA 1MZBA 3DLLF 3GFMA 4BKXA 2COBA 2L0KA 1HSTA 2GXGA 3NWSA 3KEQA 5FLMJ 1NH3A 1FMVA 2DCEA 1X3UA 3BC8A 4HNUA 3E6DA 4X0GA 4G7ZF 4IX7A 5IT9Z 3H5RA 4JBAA 2K4JA 2OV7A 2VODA 4XORA 5J8FA 2EV6A 3ZPLA 1WH5A 2DT5A 1DQUA 3TKYA 3ZQGA 2EIJH 1V4RA 1SMTA 3JTGA 4C30A 1TBXA 1WH7A 3B73A 1VQ8I 4RA2A 2QENA 4RB1A 5AONA 1YRNB 4RGSA 4OIQF 4WWCA 3HOTA 1VQ4I 3DTIA 1P92A 2M4KA 4HLYA 3FHZA 4IRGA 3GTLJ 5IT3A 3SFZA 2D1VA 3M8FA 2DT6A 2G0EA 1X1BA 3E7LA 4HX8A 1Y8QB 4EM1A 1H88C 3HTSB 4EEFG 1E0EA 3EUKL 2JT1A 2M4GA 3WTZA 2LKXA 1BR1A 2L9RA 3ZP5A 2CQ7A 4I0AA 3TBIA 1K78B 2B7EA 1UG2A 2LTPA 2KIUA 2X6YA 3GVAA 2WV0A 1PP8F 1WJAA 2HOSA 1FJLA 3OYEA 3KP7A 4MTDA 3B02A 1FP1D 1ZRDA 3BTLA 3U2RA 4B1RA 1Z05A 2F5VA 1YG2A 4YFKF 2WB1N 2M7BA 4BEHA 3OL4A 2DPUA 3R6SA 2TRTA 3LSRA 3BR5A 3Q9SA 2QBYA 4CZCA 3NWTA 2MLKA 1IZ1A 2RDPA 3WTWC 3ZN0A 5GAEJ 2OAZA 5E79C 2EFWA 3GTGJ 3I9V2 2VQCA 3QYEA 3DTKA 5ERIA 4RM2A 1GV2A 1TL8A 2LNBA 2KIMA 5K7FA 2AS5F 1X4PA 1AKHA 2EB7A 3QP6A 3ZN1A 1YJWI 2HEOA 2QCOA 3S2WA 4A3CJ 4HQEA 5IOYA 3GYHX 5ICFA 1BIAA 4XKVA 3LQRA 1SVOA 2ID3A 4S05A 3M4OJ 1BM9A 3IKVA 2E1OA 2ZXIA 4II2A 2RQQA 2KZVA 5IYDJ 2DFHA 2LBFB 3RZDJ 3MZYA 2EFNA 3GF2A 1OLTA 3L1PA 2HZTA 1O3RA 3RKXA 1DGWY 3TO9A 1K6YA 4ABZA 1WGXA 2PMUA 4QWQA 4A5MA 2W48A 2KISA 4AU7A 5IPAA 5EG0B 3ZMDA 3RCOA 1WCMJ 4EJVA 1BC7C 2QQBA 3L2WA 1QU3A 2FBHA 3OL3A 1BL0A 2DMTA 3K4CA 3I64A 2CWEA 2DXIA 2NVXJ 4P9UA 1O4XA 1YIJI 3Q0VA 2EFPA 3PO2J 4BHPA 2VOOA 2ZNZA 2OTLI 3K2AA 3CC2I 2WADA 1AWCA 1FTTA 3MKWB 5DDGA 1S29A 5IYCJ 5D5UB 3OYIA 1MDMB 2K3PA 3D0SA 3ABKH 1MKMA 4OU0A 2XF6A 3OV8A 3V42A 3R60A 2LRDA 2L7MP 3FBNB 4RGXA 4A69C 2JZYA 2OD5A 4RAGA 3IL2A 4G8XA 3G4SI 4P1WA 2MC3A 1XMKA 2ETHA 3P9KA 3I0TA 3JREA 3FMRA 1JGGA 1YE9A 2DA6A 1LVKA 2X6WA 3DXJF 4FASD 2IJLA 2ECCA 3N97A 5JLWA 2P5LC 1BW5A 4M72A 4A6DA 4R79A 3C3WA 4F93B 5L3BA 1Y1WJ 4Y17A 1FZPB 1J5YA 2FD5A 2M2EA 2FE3A 3M1CA 5CJ9A 2L9VA 4HA8A 5E1ZB 4N4OB 4HDUA 2OUMA 2LYCA 3H9JA 4DYQA 1A5JA 2KLOA 4BDYA 3WTXC 5DS9A 2HDWA 2FA5A 3L9FA 1I6XA 1VQNI 1MJ9A 2EA4A 4M6YA 4YELA 1AU7A 2XV4S 1CF7B 2O3FA 3CCVI 5E3OA 4UUSB 4ITVA 4U7BA 2PJRA 6PAXA 1KGSA 4Q48A 3V8LA 3PSFA 2DI3A 1S7EA 2R5ZB 3KFWX 2HQAA 3C1DA 4S04A 1BR4A 2F5EA 1WZ2A 3CUQC 1KU7A 1N75A 3IV5A 1LFBA 4B48A 1U8RA 4F7ZA 4L18B 1UHMA 5EGOA 3PM1A 2COMA 1MSEC 3AL0B 2V1NA 1ZG3A 2RVCA 3E6CC 5LHHA 1LE8B 1LKXA 1HKQA 4XRMA 2VOPA 1DDNA 4BXFA 2W84A 5B1AH 1O3TA 2NVQJ 2HNHA 4G94A 3O2PE 4P96A 2DW4A 3HRUA 2BOLA 5LHIA 2GXAA 2LDUA 3BDDA 2E7WA 2HVQA 4BBRJ 1VF9A 4IL6C 1FIAA 3O6BB 2JSPA 4XOTA 4YIFA 4DBQA 2R7OA 5LEKA 3UKGA 4MIMA 4E7IA 3KCCA 3G1OA 1WJDA 3I54A 4LFUA 3OSGA 3LSJA 5M3FJ 1JUPA 1ZG1A 1XDSA 2H8WA 2M34A 1AOYA 1JHFA 1U5TC 5LEJA 5E1WA 2FEZA 1FP2A 1R1VA 2EIKH 2K9MA 3K9TA 1J7KA 4HF1A 3BLYA 4AIKA 2JRMA 3VPRA 2MSYA 2M7AA 1KU2A 2TCTA 2FOWA 4LIVA 4A5NA 3IWFA 2QQ9A 3ZXSA 2ZNYA 1VQOI 3E5UA 3FBIB 4M3EA 1E3PA 2H09A 3VYUB 2G7HA 3PL8A 2BGCA 2JPCA 2CV0A 4F3QA 3HSEA 3WTVC 2ZJPF 4BQAA 5C44J 1Z1DA 4CSWA 1F5TA 4ENNA 1SANA 1JTXA 1A36A 4L5IA 1QNTA 2CU7A 1QO0D 2ELHA 4L9JA 1VQ7I 4ASNA 1B8IB 1QZZA 3EPZA 3K4NA 3FM5A 2NAZA 2CW0F 2E5ZA 2LREA 3L2UA 3LSKA 2H6BA 2OZUA 4N9HA 2Q2EA 2VASA 3ZOBA 3BG5A 3DWLE 2ADUA 4Y15A 1KYWA 3TEDA 2YU9J 4M71A 4CA0A 3ELKA 4YG2F 4ESJA 1KU9A 1OISA 4FX0A 3BR3A 2JA7J 2CYYA 1MMGA 4AVPA 1Z7UA 4ESBA 3ZMSA 5IOZA 1LJ9A 2QSFX 4P5OA 4TV7A 2P6SA 4LG0A 3ZRGA 3OYNA 3BTIA 1BI3A 3BCBA 3SZPA 3LL7A 2PMZN 3ML6A 3WG7H 4CCMA 1MBFA 3HXLA 4CYDA 1DPRA 1H9TA 4XKCA 1OCZH 5CQGA 1HDDC 4KMUX 4MEYF 1TQPA 1JJ6C 2BW3B 3I4PA 3H35A 1MBHA 2VONA 4HYEA 2VQGA 2HQ5A 3K1NA 2L9SA 3S32A 2K02A 1XC5A 1UHSA 2VJ4A 5J3LA 1I6HJ 3ZQCA 1J0RA 1X4OA 1TWFJ 1ZRFA 1I3QJ 2HVSA 2VKVA 2R93J 2R7VA 1MGTA 3ZMVA 2GOMA 2A68F 2I8DA 1SD7A 2ECBA 2CV1A 2A6HF 2VJIA 1G4DA 3H9QA 3P9IA 3CMAI 4S0HB 4Y52J 3ERED 1WJEA 1BJAA 3QRFF 1I39A 5FJ8J 2M3AA 1WJCA 3GW2A 5L3DA 2QBYB 5FRNA 3VEPA 2LG4A 2D2WA 2EBIA 4WXCA 1JT0A 1EH6A 4I02A 1T0FC 4PJNA 3VSLA 3BZ6A 2BV6A 3H5NA 3I58A 1B4AA 5GPCA 1YW9A 3B6AA 1MMNA 5F0CA 2HTJA 3A01A 2HQNA 4F52A 3S3MA 5ILSA 3VYTB 2PBIA 4YIIA 2K5CA 3HBLA 3DBLB 1VQMI 3J7AO 1OPCA 3OYDA 3MQ0A 3LSGA 1LVAA 5L3EA 5ICGA 2PMZA 2LD5A 1OR7C 2FNPA 4M6XA 1FOKA 4IHYA 1R1TA 5JLXA 9ANTA 2F5DA 1SVMA 2QLZA 3PNTA 1GVDA 1FWZA 2QGUA 1J2XA 3EDPA 1FOWA 5F1JA 3K1MA 3ZCOA 3F8FA 3MAJA 3QYFA 2LOOA 4OINF 1IUFA 2K7LA 4B3XA 4CYCA 3BZCA 2CUJA 3WTSC 3F21A 1T98A 1BA5A 3IC7A 5F04A 3E0JB 3LA3A 2K85A 1X2MA 1O7LA 1A6IA 2GA1A 2H1KA 5IYBJ 2BBYA 5IP6A 1ORKA 3K7AJ 4KISA 1ZKGA 2FMYA 2MW8A 1J09A 2GBYA 4AWXB 2R7UA 4M3FA 2EQRA 3M8EA 2CFXA 4C2MJ 4BDZA 4Z2YA 5D4SA 4DZPA 1KQ8A 1IRXA 1JKOC 3CTAA 1PDNC 3DLAA 1YHQI 2DMPA 4A3DJ 1R7JA 3WHCA 2ZFUA 1UFMA 4V2GA 4CCLA 3GFIA 2DAOA 5CVIA 3JRBA 4A6EA 3LSMA 3M7GA 2VE9A 4NQWA 3HHHA 2F4IA 3LQQA 3HDDA 1QVTA 2EZHA 5CVJA 2M87A 2K9NA 3I59B 3PIOF 2PLYA 5F64A 1D0XA 3CJNA 2DMUA 1F43A 2DFIA 5IP7J 1TLHB 1WRJA 4W97A 2Z3YA 4C3HJ 2HQRA 3IUOA 2F4MB 4UVCA 4BQQA 2V6CA 5DV5A 1BN5A 3Q3SA 3CCSI 1YLFA 2IA2A 3GO5A 1J9IA 1T33A 3AG1H 4Q47A 2LSOA 4M6VA 1K4TA 1FEXA 2E36A 2X6OA 1ZRCA 1Z67A 2GA2A 2PG4A 1BJZA 2ZJQF 1AA7A 2O6GE 2Z5UA 2DYSH 2R7RA 1IGNA 5D5VB 1J75A 3JRAA 3HM5A 1G6NA 3UNGC 1ENHA 3F6OA 3BG6A 3BJOA 2L54A 2VBZA 2R7DA 3CDIA 2ZB9A 3DBRB 3CLOA 5JR3A 3DF8A 1ON1A 4IHXA 3BR1A 1IXRC 2VBWA 1IJWC 2YX7A 1C0WA 3IHUA 3KETA 5TJJA 1UG0A 1VQ5I 3HJEA 3NEUA 2ZSHB 2R5YA 1RUOA 2EZKA 5KHDA 5HS8A 1LFPA 5B5EC 1JHHA 3ZQIA 2EV0A 4IZZA 4L9NA 2DBBA 3SEZA 5LRRA 2ZMEA 1OKRA 3BG9A 4KN7X 3KZIC 3HOZJ 3F8NA 4PJLA 4B8XA 1L0OC 5HDNA 1Z6TA 2DTZA 4E70A 1LPQA 3JSOA 1YITI 4DW6A 1RKTA 5LFAA 3C2BA 1TTYA 5JVTA 2JA2A 1JT6A 2P5VA 3J80K 4LMYA 4ZTFA 1NK3P 1MBGA 2A05A 5F0FA 2A07F 2V1UA 3S17J 2M5WA 5HDKA 4ENKA 3WTUC 2VBYA 2ZJRF 1REPC 1YFHA 3F22A 3U1DA 2M8EA 3QYBA 2QUFA 3HIFA 2VC0A 3TL4X 4BY1J 2IXSA 5D4RA 2XAHA 2A5YB 3JRCA 4KICA 3VWBA 3S3NA 4JQFA 2H27A 1HXDA 3PQKA 3RQIA 3ZQLA 3GX4X 3TDUC 2ESHA 3FZVA 4E7LA 4M74A 1TNSA 1TWHJ 4Y3OA 4BE2A 1FSEA 1ETXA 2DYRH 1SAXA 1N78A 3X2QH 1W5SA 2LY9A 2KQRA 4G9YA 1Z0XA 4GGGA 4U88A 2E1MB 3PNVA 1RI7A 3GTMJ 4IO9F 4BY7J 1A04A 1H8AC 4F91B 3RTRA 1W36D 1NK2P 4I98B 2LH9A 3NAUA 3GLXA 5HNFA 4P55A 4G6QA 5LGTA 2LF8A 1ODDA 2ZXWH 4FQGA 3J81K 4WCGA 1B59A 2IP2A 3QPSA 4I09A 3W2VA 1OCCH 2YR2A 5J47A 1W5CC 2UZKA 2JQ7A 1ACIA 2OZ6A 1ZAOA 1TW3A 2EA2A 2ZC2A 4GRIA 1X19A 3S2HJ 2UXNA 3K2ZA 4HG2A 2E5NA 4L9VA 5FFXA 1YS7A 2QWWA 3KX2A 5K1YA 1TT5B 4U0WA 1JTYA 2HS5A 2P7VB 5E8GA 3SEQA 5DM6F 2QEXI 4EQQA 2GOXB 2O7OA 1HCRA 1KA8A 1XS9A 1IXCA 4CICA 4A0XA 1E3OC 3L2VA 3B6CA 2GZWA 2XKOA 1E2XA 4ZYDA 2HI3A 2R4GA 2DDBA 3A0BC 3O8HA 2X0LA 3DPUA 4XKBA 4RGRA 3ZQFA 3OOPA 3WE3A 3CMMA 2LKSA 1P7JA 3VODA 1GXPA 2XGCA 5GTHC 2DPDA 3P5JA 3W6VA 1RC9A 3CUQA 5J1YA 2AXTC 3MKYB 2BXYA 2PJPA 4Y4RA 2DJIA 3SFIA 5C3EJ 4ZTJA 4XBFA 1IW7F 5FLXK 4BS9A 1ETOA 1T38A 4IEJA 3AAFA 1YX3A 2W85A 2GIVA 4UHTA 3MCZA 2NYXA 5D6EA 2IBDA 3CCEI 3HOUJ 1R6RA 4KT5C 3ZQQA 3KZZA 3HOWJ 3F0CA 4MEXF 2G9WA 1PUFA 1OCOH 5EZHA 2R7WA 3N05A 2Y31A 4L0ZB 4A0ZA 3QODA 4OWRB 4J00A 1U9OA 2EZLA 4O6JA 1O7FA 3R0AA 1D8KA 1X3ZB 3WODF 2HPMA 4FT8A 4EGZA 1V55H 3BPXA 4RB2C 2DA5A 3J7AY 2KJCA 3WE2A 1U5TA 4B44A 5CLSA 3HSFA 2Z33A 2OBPA 1T95A 1UMQA 1XGMA 3BP8A 2LVSA 1WSUA 4HRIA 1IF1A 3IRRA 2X9DA 3KP4A 4C2UA 2H8RA 5CVRA 2LY1A 3MKLA 1XSXA 1MJAA 2BVLA 2ZMEC 3ABLH 3DEEA 1G8XA 4HV5A 1CGPA 1ZR2A 4BEHB 3OS2A 3QPTA 2X48A 3E6MA 5GAGJ 4XN3A 1R36A 2GAUA 2E1NA 3PFIA 2CW7A 4HPQA 3UR3C 3L00A 2GM4A 1UAAA 1FSHA 2HGCA 3KLNA 1GDTA 3U1KA 3FXLA 5C4JJ 4JOMA 2YX4A 4EM0B 1EF4A 1SC7A 3P9CA 3LFUA 4PZJA 2UXXA 4FTHA 3KYDB 1OYIA 2VXDA 3FXKA 4UVAA 1BBYA 3GFJA 3W6KB 5FO5A 1AKHB 1HW1A 3F3XA 2RN7A 4EJTA 5FD6A 2XSDC 2L01A 5H2FC 2D5VA 1UHWA 3S1MJ 4A0YA 3RIRA 3A1YA 3OIPA 4RAFA 2VXZA 2LP0A 4HX7A 3OYCA 1QHHD 4J01A 4XSZF 2ESNA 5BNGA 2Y9YA 2XF5A 3T5XA 4BHBA 1KONA 1S6LA 2I10A 3OR2C 3BCAA 1PVEA 1X1CA 2DJNA 2DA7A 2Z99A 1D0YA 3FHNA 1B72A 3JSPA 2EFQA 1QZYA 3KYCB 3LSIA 2HYFA 1IRZA 2K40A 2Z2SB 4FHTA 3HGYA 1EJ9A 4MQVA 4IHTA 1FOYA 2K27A 3I53A 1ZELA 2HOEA 1MNEA 5H20A 3TO7A 3ECOA 3GZ6A 2E60A 2QQAA 1B9MA 1ZN2A 3U21A 1YS6A 2L7FP 1R9TJ 2XAQA 2N8GA 3T1BA 4F92B 2DK8A 2HOTA 1VI0A 2RQPA 4WF2A 5E3MA 3G6EI 2CV2A 3ZR8X 5L3FA 1V5GA 3DTEA 1J59A 4EJOA 2CJJA 3V4GA 1ERDA 4OIRF 3TP3A 1IDZA 3ULQB 1OCRH 4HV6A 2HXIA 4M73A 2WY8Q 4D1QA 2O8XA 3K4JA 1UELB 2FMLA 3DBHB 2JRTA 5ICCA 1VZ0A 4AIHA 1G3TA 3FX3A 5E17F 4LJZF 1KQ0A 3CQZJ 2Z9OA 2MABA 1W36C 2KKOA 1F4KA 2CUZA 3SDBA 3IH3A 4NB5A 2ZSIB 1G2HA 3HL2A 1T0FA
chains in the Genus database with same CATH topology
4IJAA 1G3WA 4RS8A 2IPQX 2R7FA 4IRHA 3QU6A 2RKHA 3LAJA 1OR7A 2F2EA 3ROUA 4HOBA 4U0VA 3MZHA 3JAMK 1SFEA 3U9GA 4GYIA 1G3SA 1MJBA 5JFRA 4L5JA 2STWA 2KIFA 4GO1A 1FT9A 2JPBA 5TRDA 2DQLA 4MQ9F 3E3VA 4AIJA 3RPUA 3GFLA 4BYYA 3F6VA 2WC2A 2BYVE 2XAGA 2YPRA 5JHUA 3G3ZA 3VB2A 1SFXA 3WTTC 3R61A 2Y0MA 4I2OA 1P2FA 3HHGA 4L0YB 2DO7A 5HOOA 3QOPA 4EJWA 2ISZA 1FNNA 3H3UA 5DYMA 4OMYA 3ECHA 2GQQA 2ZO4A 2O03A 4CGZA 3RI4A 2IVMA 4D0PA 3HUGA 1XSVA 1V3FA 5LGUA 3DFGA 1IN8A 4U0YA 3BWGA 5D8KB 2IRFG 4HAMA 1EH7A 2FF4A 3G73A 2W24A 5HLIA 2Q8KA 4P9FA 4G7HF 1IRFA 5A2QK 1XGOA 3E5QA 1Z91A 4Y13A 4MTEA 4M9SA 2IT0A 4Q4ZF 2ZJ2A 5J8CA 1ZARA 4RAYA 5J6XA 2A61A 1Z6RA 5BPDA 2ZBKA 4ZYHA 4KIGA 2FU4A 3KP5A 3C18A 4PDKA 4QLCU 3LSTA 1EV7A 2IA0A 3K1PA 2P8TA 1P4XA 4LLLA 4LG0B 1ON2A 5JI6A 3N4MA 1GVJA 1LEBA 1P4WA 3KZYA 3ABUA 2IW5A 1G3YA 3LA2A 1FBUA 4KA4A 2NRAC 4UVBA 5E18F 3WGGA 5LRSA 1U3EM 1U78A 2GWRA 5H6RA 2LKPA 3V7CA 4N9IA 2XVCA 1FC3A 5FB2A 3V7SA 2CO5A 1RNLA 3LA7A 2E7XA 2J5OA 3FF5A 2P6TA 4UV8A 2YU3A 3C7JA 3RYPA 1ZGAA 2PEXA 3LFKA 2ZFWA 4KNYA 2HWVA 4CHUA 2VT3A 2NS0A 3V7RA 1FX7A 3TDZC 1BIBA 3M1EA 5DCFA 4M9XA 2CGPA 2XAFA 1K7AA 2HDCA 5DCMA 1R22A 4R8HA 3E6BA 3SXYA 4ON0A 3HOSA 1KQ9A 3NRVA 5F1RA 3M9AA 2EFOA 3Q5FA 4HW0A 4HX4A 4R1HA 5F6FA 4AD9A 1W7PD 4OIPF 4LLGF 4ETSA 4XRFA 5KK1A 3WTYC 1QQIA 2M1BA 4WXDA 1BC8C 4IRIA 4WXHA 2ACJA 2V1DA 1SFUA 4OMZA 3F23A 3RDIA 1DPUA 1ONVA 3EQLF 2RV8A 4UV9A 2XHKA 2HKXA 3KP2A 4GCVA 1S7OA 3R4KA 1GXQA 1I1GA 3TOBA 1I1SA 4O3MA 4LB5A 3KE2A 2D1HA 5KVRA 1W7PA 4ZH4F 5CVUA 2H94A 3HRMA 1O57A 2MA3A 1FYKA 3J80Z 4RAZA 3F8MA 5DUIA 3F8CA 3KP6A 4KN4X 2FBKA 1YQAA 3RKYA 1H0MA 1BI1A 1IAWA 5HVQC 1RUNA 2LF7A 4ENMA 1H9GA 1HKSA 4H0EA 5LLQA 3F8BA 1WI9A 3I71A 3DKWA 1YIOA 4K2EA 1XDUA 1KYZA 3SQNA 3GXOA 2JTVA 2DQRA 5LHGA 4YFXF 3J81Z 1YYVA 3EETA 2PQ8A 4BAYA 2DK5A 1ZGJA 2XAJA 1PP7U 1ZG5A 3TO6A 2OA4A 1B6AA 4EGYA 2L4AA 3QAHA 2K86A 5IT9K 3TGNA 1K78A 1TW2A 2FNAA 2OQRA 4ESFA 1L3LA 3BOQA 4MHGA 4XLNF 4PGHA 4A12A 4YFNF 4DQ2A 5ICEA 3CDHA 3SZTA 1W5TA 2P5KA 3HYIA 1FLIA 4MNUA 3FWEA 1IRGA 4I7HA 5FLXZ 1FYLA 1O3SA 5AIQA 1XCVA 2AXLA 5E20A 2WTEA 1F9NA 1LQ1A 1QBJA 3NQOA 3ZQ7A 3KP3A 2C6YA 3DEUA 2M45A 5L3CA 2MH9A 5HS7A 1IN4A 3CUQB 4G6DA 2P7CB 1IN5A 1F1ZA 1T39A 2OQGA 2XGXA 3DQVC 4MGRA 3RYRA 5ILVA 3RJPA 1U6GA 1KU3A 1T2KA 3MFKA 3ABTA 1ZREA 4KDPA 1WQ2A 4KIBA 2EWNA 1XCBA 1FYMA 1IUYA 1OYYA 3LWFA 4OOIA 4IVNA 4HQMA 4GXOA 4BH9A 1MDMA 1R23A 3V8JA 3ZMZA 3DV8A 1P4AA 3FXQA 3GWZA 1HSJA 1BI0A 1U5TB 4KIFA 4ENJA 1VTNC 1FBSA 3EUHA 2BEOA 1S7AA 4IXAA 3WGHA 2XROA 4N0BA 1D3YA 1K6OA 1LNWA 5CVVA 1XGSA 2RGVA 3WG9A 1QGPA 4IHSA 5ILUA 4FX4A 5HLHA 3TQNA 4HDVA 4BXUA 2ZKZA 4UNOA 1FBQA 4IPAA 1ZLJA 2V9VA 1OMIA 1LDKB 2L3DA 1IXSB 3R0JA 3K69A 2VN2A 3VFZA 1P6RA 3EYIA 3KLOA 1UB9A 1CF7A 1I5ZA 4ZZDA 4OIOF 4KFCA 5K5OA 3FXRA 2K4BA 4CO8A 3L2CA 4HF2A 4DNCA 3IKTA 2XIGA 1FY7A 3L09A 4EMSA 3CO7C 1USTA 5BQTA 2RC4A 2PFBA 2QVOA 2CSOA 2M30A 2B0LA 3RPQA 3FMSA 4KYWA 4L9TA 3HTUA 2FRHA 3PQJA 1W4MA 3D5LA 1HW2A 3I5UA 3BJ6A 2VC1A 2MD5A 5FFZA 4HBLA 1WWXA 3DPTA 5DD4A 2UWMA 2V1XA 2VT2A 1ZYRF 1XSDA 4LD5A 3JAMZ 2W57A 1ZHFA 2ISYA 2HYGD 4HZFA 2O0YA 2FSWA 4U7DA 1FPQA 5DUKA 1BI2A 1DP7P 1SD6A 5EEGA 5FD5A 3F72A 3FM3A 1HW5A 5K5RA 4KUMA 3HRSA 3DP7A 2J5PA 3QP5A 2WWYA 3BY6A 2MH2A 2EK5A 3SHFA 2BE5F 3L7WA 3CO6C 2XRNA 1QPMA 4B09A 4KMFA 1XB4A 4EM2A 2VBXA 2STTA 2ZXJA 2PN6A 2X4HA 4CXFA 2XKPA 1HKTA 1R5GA 3TOAA 1BOAA 3GZ5A 3P7NA 3VOEA 1XD7A 1HQCA 1YW7A 2P4WA 5EEHA 2IA1A 2R3SA 5HLGA 2CG4A 4NHJA 3GEZA 4BHCA 2DLLA 2GXBA 5D5XB 1JXSA 4M9ZA 4HLXA 2Y48A 4LK1F 4PGGA 4LB6B 2QZ8A 1ZH5A 5LBQA 2XUBA 2L02A 2RNJA 2Y75A 5A2QZ 3IWZA 3FMQA 2A3SA 4ZYGA 4LGWA 4EV0A 5BMZA 1YW8A 4WX9A 2OU2A 3MWMA 2D45A 2E1CA 1SMYF 2ZCWA 1R1UA 2FOKA 4RB3C 1JE8A 4I0BA 3FXUA 5D5WB 4UXNA 1Z9CA 4JK1X 4G7OF 2FBIA 1OYWA 2QM3A 1S8NA 2F5CA 4ZYEA 5L3GA 1IN7A 3JTHA 1EH8A 3HSRA 5BOXA 1E17A 2KJBA 3CUOA 4A2UA 3GUDA 4CZZA 4GYGA 1U2WA 3HRTA 3O3KA 2A6EF 1S3JA 1DUXC 2XASA 1GHCA 1WKMA 1USSA 3QPHA 4HF0A 5AIPA 1LB2A 1ZLKA 5ED4A 4LLNA 1R5HA 1UCRA 2L4MA 5K5QA 1PUEE 3REOA 1R58A 3BROA 2FQ3A 3I59A 1HBXG 3WGIA 5E1XA 3MEXA 4EJUA 5BS6A 1RZ4A 2Q0OA 2EJRA 4ZZLA 1T6SA 1XMAA 1LDJA 5H6QA 1Y0UA 2MLGA 5E8IA 2PI0A 5LGNA 3K0LA 1YO5C 3H92A 3V8KA 2HKOA 5DCMB 3WU0A 2V79A 5BPIA 3ZMUA 4Q5SF 1SD4A 1SD5A 2JSCA 2DU9A 1ULYA 2QYOA 3W6JB 1D5VA 1R00A 3T0YA 3QU3A 1LEAA 3Q9VA 1YTYA 3ZMTA 2FXAA 5CYVA 2W25A 1T0FA 1B1BA 4O5VA 1Q1HA 3ISPA 2EV5A 3T8TA 2KRFA 4XLPF 2VE8A 3RKWA 2F5FA 2A69F 1JGSA 1O3QA 5HS9A 4XSXF 4WK8F 3IRQA 3COAC 1B9NA 5D6FA 1NHAA 2NNNA 1K79A 3KEOA 1TQMA 2PMHA 2CQKA 5DEQA 3WU1B 1TNTA 4UUVA 5D8LB 2HTSA 4IF4A 5DD8A 4RB0A 2YSRA 3T8RA 2H6CA 2DTRA 1W7PB 5FGMA 2ZMEB 2O61A 1D8JA 1STZA 3H3ZA 1XN7A 3EYYA 4PCQA 3JW4A 2NNYA 4CDGA 4LK0F 3LAPA 2TDXA 1XGNA 5HDGA 1RIOH 3BJAA 4I01A 3DPLC 1MD0A 3E97A 4EVIA 1I27A 3E5XA 1IN6A 3BPVA 4RGUA 1LDDA 2MBFA 4BNCA 2G7UA 1TQIA 2HR3A 2HFHA 1MZBA 3GFMA 1HSTA 2GXGA 3KEQA 1X3UA 3E6DA 4G7ZF 5IT9Z 4JBAA 2K4JA 2VODA 5J8FA 2EV6A 3ZPLA 2DT5A 3TKYA 1V4RA 1SMTA 3JTGA 1TBXA 3B73A 2QENA 4RB1A 5AONA 4RGSA 4OIQF 4WWCA 3HOTA 1P92A 4HLYA 3FHZA 4IRGA 5IT3A 3SFZA 2D1VA 3M8FA 4HX8A 4EM1A 3HTSB 2JT1A 3WTZA 3ZP5A 4I0AA 1K78B 2KIUA 3GVAA 2WV0A 1PP8F 3KP7A 4MTDA 3B02A 1FP1D 1ZRDA 3U2RA 1Z05A 1YG2A 4YFKF 2DPUA 3R6SA 3Q9SA 2QBYA 2MLKA 1IZ1A 2RDPA 3WTWC 3ZN0A 2OAZA 2EFWA 5ERIA 2LNBA 2KIMA 2AS5F 2EB7A 3QP6A 3ZN1A 2HEOA 3S2WA 4HQEA 3GYHX 5ICFA 1BIAA 3LQRA 4S05A 1BM9A 3IKVA 3MZYA 2EFNA 3GF2A 2HZTA 1O3RA 3RKXA 3TO9A 2PMUA 4QWQA 4A5MA 3ZMDA 4EJVA 1BC7C 2QQBA 2FBHA 3I64A 2CWEA 4P9UA 2EFPA 4BHPA 2VOOA 2ZNZA 1AWCA 5DDGA 1S29A 5D5UB 1MDMB 3D0SA 1MKMA 4OU0A 3OV8A 3R60A 4RGXA 2JZYA 2OD5A 3IL2A 4G8XA 2MC3A 1XMKA 2ETHA 3P9KA 3I0TA 3FMRA 3DXJF 2IJLA 3N97A 2P5LC 4M72A 4A6DA 4R79A 3C3WA 5L3BA 4Y17A 1FZPB 1J5YA 2FE3A 5CJ9A 4HA8A 5E1ZB 4HDUA 3WTXC 2FA5A 3L9FA 1I6XA 1MJ9A 2EA4A 4M6YA 2XV4S 1CF7B 2O3FA 4U7BA 6PAXA 1KGSA 4Q48A 3V8LA 2DI3A 3KFWX 3C1DA 4S04A 2F5EA 3CUQC 1KU7A 1U8RA 4F7ZA 4L18B 1UHMA 2COMA 1ZG3A 2RVCA 3E6CC 5LHHA 1HKQA 2VOPA 1DDNA 2W84A 1O3TA 4G94A 3O2PE 4P96A 2DW4A 3HRUA 5LHIA 2LDUA 3BDDA 2E7WA 3O6BB 4YIFA 5LEKA 3KCCA 3I54A 4LFUA 1ZG1A 1XDSA 1AOYA 1JHFA 1U5TC 5LEJA 5E1WA 2FEZA 1FP2A 1R1VA 4HF1A 3K9TA 1J7KA 4AIKA 1KU2A 4A5NA 3IWFA 2QQ9A 2ZNYA 3E5UA 2H09A 2G7HA 2BGCA 2JPCA 3HSEA 3WTVC 4BQAA 1Z1DA 1F5TA 4ENNA 4L5IA 1QNTA 1QO0D 2ELHA 4L9JA 4ASNA 1QZZA 3FM5A 2NAZA 2CW0F 2H6BA 2OZUA 4N9HA 2Q2EA 2ADUA 4Y15A 1KYWA 4M71A 3ELKA 4YG2F 4ESJA 1KU9A 4FX0A 2CYYA 4AVPA 1Z7UA 4ESBA 3ZMSA 1LJ9A 4P5OA 4TV7A 2P6SA 4LG0A 1BI3A 3SZPA 3ML6A 4CYDA 1DPRA 1H9TA 4KMUX 4MEYF 1TQPA 3I4PA 2VONA 4HYEA 3K1NA 2K02A 1J0RA 1ZRFA 1MGTA 3ZMVA 2A68F 1SD7A 2A6HF 1G4DA 3P9IA 3ERED 1BJAA 3QRFF 3GW2A 5L3DA 3VEPA 2D2WA 4WXCA 1EH6A 4I02A 3BZ6A 2BV6A 3I58A 1B4AA 1YW9A 2HTJA 2HQNA 5ILSA 2PBIA 4YIIA 3J7AO 1OPCA 3MQ0A 1LVAA 5L3EA 5ICGA 2FNPA 4M6XA 1FOKA 1R1TA 2F5DA 2QLZA 1FWZA 1J2XA 3EDPA 3K1MA 3F8FA 3MAJA 4OINF 3WTSC 2K7LA 3F21A 1T98A 3IC7A 3LA3A 1O7LA 2GA1A 2BBYA 2FMYA 4AWXB 3M8EA 2CFXA 4Z2YA 5D4SA 1KQ8A 3CTAA 1PDNC 1R7JA 1UFMA 3GFIA 2DAOA 5CVIA 4A6EA 2VE9A 3M7GA 4NQWA 3HHHA 3LQQA 5CVJA 2M87A 3I59B 2PLYA 5F64A 3CJNA 2DFIA 1TLHB 1WRJA 2Z3YA 2HQRA 4UVCA 2V6CA 5DV5A 1BN5A 1YLFA 2IA2A 3GO5A 1J9IA 4Q47A 2LSOA 1ZRCA 2GA2A 2PG4A 2O6GE 2Z5UA 5D5VB 1J75A 1G6NA 3F6OA 3BJOA 2L54A 2VBZA 2R7DA 3CLOA 5JR3A 3DF8A 1ON1A 1IXRC 2VBWA 2YX7A 1C0WA 3IHUA 3KETA 5TJJA 3NEUA 1RUOA 5HS8A 1JHHA 2EV0A 4L9NA 2DBBA 5LRRA 2ZMEA 1OKRA 4KN7X 3F8NA 4B8XA 1L0OC 5HDNA 1Z6TA 4E70A 3JSOA 3J80K 1TTYA 5JVTA 2P5VA 4LMYA 2V1UA 2A07F 2M5WA 5HDKA 4ENKA 3WTUC 2VBYA 1REPC 1YFHA 3F22A 3U1DA 2M8EA 2QUFA 3HIFA 2VC0A 5D4RA 2XAHA 2A5YB 4KICA 4JQFA 2H27A 1HXDA 3PQKA 3GX4X 3TDUC 2ESHA 3FZVA 4M74A 1TNSA 1FSEA 1SAXA 1W5SA 4G9YA 4GGGA 4U88A 1RI7A 1A04A 3RTRA 4I98B 3GLXA 4P55A 4G6QA 5LGTA 2LF8A 1ODDA 3J81K 4WCGA 1B59A 2IP2A 4I09A 2YR2A 2UZKA 2OZ6A 1ZAOA 1TW3A 2EA2A 2UXNA 3K2ZA 4L9VA 5FFXA 1YS7A 2QWWA 5K1YA 4U0WA 2HS5A 2P7VB 5E8GA 4EQQA 1KA8A 1IXCA 4CICA 4A0XA 2GZWA 2XKOA 1E2XA 4ZYDA 2X0LA 3OOPA 3WE3A 1GXPA 3VODA 2DPDA 3CUQA 2PJPA 4XBFA 1IW7F 5FLXK 1T38A 3AAFA 2W85A 2GIVA 4UHTA 3MCZA 2NYXA 5D6EA 4KT5C 3KZZA 4MEXF 2G9WA 4L0ZB 4A0ZA 4O6JA 1O7FA 3R0AA 1D8KA 3WODF 4FT8A 4EGZA 3BPXA 4RB2C 2KJCA 3WE2A 1U5TA 5CLSA 3HSFA 2Z33A 2OBPA 1XGMA 3BP8A 1WSUA 1IF1A 3IRRA 3KP4A 5CVRA 1XSXA 1MJAA 4HV5A 1CGPA 3QPTA 3E6MA 1R36A 2GAUA 2E1NA 3PFIA 2QBYB 3L00A 1FSHA 2HGCA 3KLNA 2YX4A 4EM0B 3P9CA 4PZJA 2UXXA 1OYIA 4UVAA 1BBYA 3GFJA 3W6KB 5FO5A 1HW1A 3F3XA 2RN7A 4EJTA 5FD6A 2L01A 1UHWA 4A0YA 3RIRA 2VXZA 4HX7A 4XSZF 2ESNA 3T5XA 4BHBA 1S6LA 2Z99A 3JSPA 2EFQA 1QZYA 2HYFA 4FHTA 4MQVA 4IHTA 2K27A 3I53A 2HOEA 5H20A 3TO7A 3GZ6A 3ECOA 2QQAA 1B9MA 1ZN2A 1YS6A 2XAQA 3T1BA 2DK8A 4WF2A 2RQPA 5L3FA 1J59A 4EJOA 3V4GA 4OIRF 3ULQB 4HV6A 4M73A 2O8XA 2FMLA 2JRTA 5ICCA 4AIHA 1G3TA 3FX3A 5E17F 4LJZF 1KQ0A 2Z9OA 2KKOA 1F4KA 4NB5A 4RGRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IJA A;  1G3W A;  4RS8 A;  2IPQ X;  2R7F A;  4IRH A;  3QU6 A;  2RKH A;  3LAJ A;  1OR7 A;  2F2E A;  3ROU A;  4HOB A;  4U0V A;  3MZH A;  3JAM K;  1SFE A;  3U9G A;  4GYI A;  1G3S A;  1MJB A;  5JFR A;  4L5J A;  2STW A;  2KIF A;  4GO1 A;  1FT9 A;  2JPB A;  5TRD A;  2DQL A;  4MQ9 F;  3E3V A;  4AIJ A;  3RPU A;  3GFL A;  4BYY A;  3F6V A;  2WC2 A;  2BYV E;  2XAG A;  2YPR A;  5JHU A;  3G3Z A;  3VB2 A;  1SFX A;  3WTT C;  3R61 A;  2Y0M A;  4I2O A;  1P2F A;  3HHG A;  4L0Y B;  2DO7 A;  5HOO A;  3QOP A;  4EJW A;  2ISZ A;  1FNN A;  3H3U A;  5DYM A;  4OMY A;  3ECH A;  2GQQ A;  2ZO4 A;  2O03 A;  4CGZ A;  3RI4 A;  2IVM A;  4D0P A;  3HUG A;  1XSV A;  1V3F A;  5LGU A;  3DFG A;  1IN8 A;  4U0Y A;  3BWG A;  5D8K B;  2IRF G;  4HAM A;  1EH7 A;  2FF4 A;  3G73 A;  2W24 A;  5HLI A;  2Q8K A;  4P9F A;  4G7H F;  1IRF A;  5A2Q K;  1XGO A;  3E5Q A;  1Z91 A;  4Y13 A;  4MTE A;  4M9S A;  2IT0 A;  4Q4Z F;  2ZJ2 A;  5J8C A;  1ZAR A;  4RAY A;  5J6X A;  2A61 A;  1Z6R A;  5BPD A;  2ZBK A;  4ZYH A;  4KIG A;  2FU4 A;  3KP5 A;  3C18 A;  4PDK A;  4QLC U;  3LST A;  1EV7 A;  2IA0 A;  3K1P A;  2P8T A;  1P4X A;  4LLL A;  4LG0 B;  1ON2 A;  5JI6 A;  3N4M A;  1GVJ A;  1LEB A;  1P4W A;  3KZY A;  3ABU A;  2IW5 A;  1G3Y A;  3LA2 A;  1FBU A;  4KA4 A;  2NRA C;  4UVB A;  5E18 F;  3WGG A;  5LRS A;  1U3E M;  1U78 A;  2GWR A;  5H6R A;  2LKP A;  3V7C A;  4N9I A;  2XVC A;  1FC3 A;  5FB2 A;  3V7S A;  2CO5 A;  1RNL A;  3LA7 A;  2E7X A;  2J5O A;  3FF5 A;  2P6T A;  4UV8 A;  2YU3 A;  3C7J A;  3RYP A;  1ZGA A;  2PEX A;  3LFK A;  2ZFW A;  4KNY A;  2HWV A;  4CHU A;  2VT3 A;  2NS0 A;  3V7R A;  1FX7 A;  3TDZ C;  1BIB A;  3M1E A;  5DCF A;  4M9X A;  2CGP A;  2XAF A;  1K7A A;  2HDC A;  5DCM A;  1R22 A;  4R8H A;  3E6B A;  3SXY A;  4ON0 A;  3HOS A;  1KQ9 A;  3NRV A;  5F1R A;  3M9A A;  2EFO A;  3Q5F A;  4HW0 A;  4HX4 A;  4R1H A;  5F6F A;  4AD9 A;  1W7P D;  4OIP F;  4LLG F;  4ETS A;  4XRF A;  5KK1 A;  3WTY C;  1QQI A;  2M1B A;  4WXD A;  1BC8 C;  4IRI A;  4WXH A;  2ACJ A;  2V1D A;  1SFU A;  4OMZ A;  3F23 A;  3RDI A;  1DPU A;  1ONV A;  3EQL F;  2RV8 A;  4UV9 A;  2XHK A;  2HKX A;  3KP2 A;  4GCV A;  1S7O A;  3R4K A;  1GXQ A;  1I1G A;  3TOB A;  1I1S A;  4O3M A;  4LB5 A;  3KE2 A;  2D1H A;  5KVR A;  1W7P A;  4ZH4 F;  5CVU A;  2H94 A;  3HRM A;  1O57 A;  2MA3 A;  1FYK A;  3J80 Z;  4RAZ A;  3F8M A;  5DUI A;  3F8C A;  3KP6 A;  4KN4 X;  2FBK A;  1YQA A;  3RKY A;  1H0M A;  1BI1 A;  1IAW A;  5HVQ C;  1RUN A;  2LF7 A;  4ENM A;  1H9G A;  1HKS A;  4H0E A;  5LLQ A;  3F8B A;  1WI9 A;  3I71 A;  3DKW A;  1YIO A;  4K2E A;  1XDU A;  1KYZ A;  3SQN A;  3GXO A;  2JTV A;  2DQR A;  5LHG A;  4YFX F;  3J81 Z;  1YYV A;  3EET A;  2PQ8 A;  4BAY A;  2DK5 A;  1ZGJ A;  2XAJ A;  1PP7 U;  1ZG5 A;  3TO6 A;  2OA4 A;  1B6A A;  4EGY A;  2L4A A;  3QAH A;  2K86 A;  5IT9 K;  3TGN A;  1K78 A;  1TW2 A;  2FNA A;  2OQR A;  4ESF A;  1L3L A;  3BOQ A;  4MHG A;  4XLN F;  4PGH A;  4A12 A;  4YFN F;  4DQ2 A;  5ICE A;  3CDH A;  3SZT A;  1W5T A;  2P5K A;  3HYI A;  1FLI A;  4MNU A;  3FWE A;  1IRG A;  4I7H A;  5FLX Z;  1FYL A;  1O3S A;  5AIQ A;  1XCV A;  2AXL A;  5E20 A;  2WTE A;  1F9N A;  1LQ1 A;  1QBJ A;  3NQO A;  3ZQ7 A;  3KP3 A;  2C6Y A;  3DEU A;  2M45 A;  5L3C A;  2MH9 A;  5HS7 A;  1IN4 A;  3CUQ B;  4G6D A;  2P7C B;  1IN5 A;  1F1Z A;  1T39 A;  2OQG A;  2XGX A;  3DQV C;  4MGR A;  3RYR A;  5ILV A;  3RJP A;  1U6G A;  1KU3 A;  1T2K A;  3MFK A;  3ABT A;  1ZRE A;  4KDP A;  1WQ2 A;  4KIB A;  2EWN A;  1XCB A;  1FYM A;  1IUY A;  1OYY A;  3LWF A;  4OOI A;  4IVN A;  4HQM A;  4GXO A;  4BH9 A;  1MDM A;  1R23 A;  3V8J A;  3ZMZ A;  3DV8 A;  1P4A A;  3FXQ A;  3GWZ A;  1HSJ A;  1BI0 A;  1U5T B;  4KIF A;  4ENJ A;  1VTN C;  1FBS A;  3EUH A;  2BEO A;  1S7A A;  4IXA A;  3WGH A;  2XRO A;  4N0B A;  1D3Y A;  1K6O A;  1LNW A;  5CVV A;  1XGS A;  2RGV A;  3WG9 A;  1QGP A;  4IHS A;  5ILU A;  4FX4 A;  5HLH A;  3TQN A;  4HDV A;  4BXU A;  2ZKZ A;  4UNO A;  1FBQ A;  4IPA A;  1ZLJ A;  2V9V A;  1OMI A;  1LDK B;  2L3D A;  1IXS B;  3R0J A;  3K69 A;  2VN2 A;  3VFZ A;  1P6R A;  3EYI A;  3KLO A;  1UB9 A;  1CF7 A;  1I5Z A;  4ZZD A;  4OIO F;  4KFC A;  5K5O A;  3FXR A;  2K4B A;  4CO8 A;  3L2C A;  4HF2 A;  4DNC A;  3IKT A;  2XIG A;  1FY7 A;  3L09 A;  4EMS A;  3CO7 C;  1UST A;  5BQT A;  2RC4 A;  2PFB A;  2QVO A;  2CSO A;  2M30 A;  2B0L A;  3RPQ A;  3FMS A;  4KYW A;  4L9T A;  3HTU A;  2FRH A;  3PQJ A;  1W4M A;  3D5L A;  1HW2 A;  3I5U A;  3BJ6 A;  2VC1 A;  2MD5 A;  5FFZ A;  4HBL A;  1WWX A;  3DPT A;  5DD4 A;  2UWM A;  2V1X A;  2VT2 A;  1ZYR F;  1XSD A;  4LD5 A;  3JAM Z;  2W57 A;  1ZHF A;  2ISY A;  2HYG D;  4HZF A;  2O0Y A;  2FSW A;  4U7D A;  1FPQ A;  5DUK A;  1BI2 A;  1DP7 P;  1SD6 A;  5EEG A;  5FD5 A;  3F72 A;  3FM3 A;  1HW5 A;  5K5R A;  4KUM A;  3HRS A;  3DP7 A;  2J5P A;  3QP5 A;  2WWY A;  3BY6 A;  2MH2 A;  2EK5 A;  3SHF A;  2BE5 F;  3L7W A;  3CO6 C;  2XRN A;  1QPM A;  4B09 A;  4KMF A;  1XB4 A;  4EM2 A;  2VBX A;  2STT A;  2ZXJ A;  2PN6 A;  2X4H A;  4CXF A;  2XKP A;  1HKT A;  1R5G A;  3TOA A;  1BOA A;  3GZ5 A;  3P7N A;  3VOE A;  1XD7 A;  1HQC A;  1YW7 A;  2P4W A;  5EEH A;  2IA1 A;  2R3S A;  5HLG A;  2CG4 A;  4NHJ A;  3GEZ A;  4BHC A;  2DLL A;  2GXB A;  5D5X B;  1JXS A;  4M9Z A;  4HLX A;  2Y48 A;  4LK1 F;  4PGG A;  4LB6 B;  2QZ8 A;  1ZH5 A;  5LBQ A;  2XUB A;  2L02 A;  2RNJ A;  2Y75 A;  5A2Q Z;  3IWZ A;  3FMQ A;  2A3S A;  4ZYG A;  4LGW A;  4EV0 A;  5BMZ A;  1YW8 A;  4WX9 A;  2OU2 A;  3MWM A;  2D45 A;  2E1C A;  1SMY F;  2ZCW A;  1R1U A;  2FOK A;  4RB3 C;  1JE8 A;  4I0B A;  3FXU A;  5D5W B;  4UXN A;  1Z9C A;  4JK1 X;  4G7O F;  2FBI A;  1OYW A;  2QM3 A;  1S8N A;  2F5C A;  4ZYE A;  5L3G A;  1IN7 A;  3JTH A;  1EH8 A;  3HSR A;  5BOX A;  1E17 A;  2KJB A;  3CUO A;  4A2U A;  3GUD A;  4CZZ A;  4GYG A;  1U2W A;  3HRT A;  3O3K A;  2A6E F;  1S3J A;  1DUX C;  2XAS A;  1GHC A;  1WKM A;  1USS A;  3QPH A;  4HF0 A;  5AIP A;  1LB2 A;  1ZLK A;  5ED4 A;  4LLN A;  1R5H A;  1UCR A;  2L4M A;  5K5Q A;  1PUE E;  3REO A;  1R58 A;  3BRO A;  2FQ3 A;  3I59 A;  1HBX G;  3WGI A;  5E1X A;  3MEX A;  4EJU A;  5BS6 A;  1RZ4 A;  2Q0O A;  2EJR A;  4ZZL A;  1T6S A;  1XMA A;  1LDJ A;  5H6Q A;  1Y0U A;  2MLG A;  5E8I A;  2PI0 A;  5LGN A;  3K0L A;  1YO5 C;  3H92 A;  3V8K A;  2HKO A;  5DCM B;  3WU0 A;  2V79 A;  5BPI A;  3ZMU A;  4Q5S F;  1SD4 A;  1SD5 A;  2JSC A;  2DU9 A;  1ULY A;  2QYO A;  3W6J B;  1D5V A;  1R00 A;  3T0Y A;  3QU3 A;  1LEA A;  3Q9V A;  1YTY A;  3ZMT A;  2FXA A;  5CYV A;  2W25 A;  1T0F A;  1B1B A;  4O5V A;  1Q1H A;  3ISP A;  2EV5 A;  3T8T A;  2KRF A;  4XLP F;  2VE8 A;  3RKW A;  2F5F A;  2A69 F;  1JGS A;  1O3Q A;  5HS9 A;  4XSX F;  4WK8 F;  3IRQ A;  3COA C;  1B9N A;  5D6F A;  1NHA A;  2NNN A;  1K79 A;  3KEO A;  1TQM A;  2PMH A;  2CQK A;  5DEQ A;  3WU1 B;  1TNT A;  4UUV A;  5D8L B;  2HTS A;  4IF4 A;  5DD8 A;  4RB0 A;  2YSR A;  3T8R A;  2H6C A;  2DTR A;  1W7P B;  5FGM A;  2ZME B;  2O61 A;  1D8J A;  1STZ A;  3H3Z A;  1XN7 A;  3EYY A;  4PCQ A;  3JW4 A;  2NNY A;  4CDG A;  4LK0 F;  3LAP A;  2TDX A;  1XGN A;  5HDG A;  1RIO H;  3BJA A;  4I01 A;  3DPL C;  1MD0 A;  3E97 A;  4EVI A;  1I27 A;  3E5X A;  1IN6 A;  3BPV A;  4RGU A;  1LDD A;  2MBF A;  4BNC A;  2G7U A;  1TQI A;  2HR3 A;  2HFH A;  1MZB A;  3GFM A;  1HST A;  2GXG A;  3KEQ A;  1X3U A;  3E6D A;  4G7Z F;  5IT9 Z;  4JBA A;  2K4J A;  2VOD A;  5J8F A;  2EV6 A;  3ZPL A;  2DT5 A;  3TKY A;  1V4R A;  1SMT A;  3JTG A;  1TBX A;  3B73 A;  2QEN A;  4RB1 A;  5AON A;  4RGS A;  4OIQ F;  4WWC A;  3HOT A;  1P92 A;  4HLY A;  3FHZ A;  4IRG A;  5IT3 A;  3SFZ A;  2D1V A;  3M8F A;  4HX8 A;  4EM1 A;  3HTS B;  2JT1 A;  3WTZ A;  3ZP5 A;  4I0A A;  1K78 B;  2KIU A;  3GVA A;  2WV0 A;  1PP8 F;  3KP7 A;  4MTD A;  3B02 A;  1FP1 D;  1ZRD A;  3U2R A;  1Z05 A;  1YG2 A;  4YFK F;  2DPU A;  3R6S A;  3Q9S A;  2QBY A;  2MLK A;  1IZ1 A;  2RDP A;  3WTW C;  3ZN0 A;  2OAZ A;  2EFW A;  5ERI A;  2LNB A;  2KIM A;  2AS5 F;  2EB7 A;  3QP6 A;  3ZN1 A;  2HEO A;  3S2W A;  4HQE A;  3GYH X;  5ICF A;  1BIA A;  3LQR A;  4S05 A;  1BM9 A;  3IKV A;  3MZY A;  2EFN A;  3GF2 A;  2HZT A;  1O3R A;  3RKX A;  3TO9 A;  2PMU A;  4QWQ A;  4A5M A;  3ZMD A;  4EJV A;  1BC7 C;  2QQB A;  2FBH A;  3I64 A;  2CWE A;  4P9U A;  2EFP A;  4BHP A;  2VOO A;  2ZNZ A;  1AWC A;  5DDG A;  1S29 A;  5D5U B;  1MDM B;  3D0S A;  1MKM A;  4OU0 A;  3OV8 A;  3R60 A;  4RGX A;  2JZY A;  2OD5 A;  3IL2 A;  4G8X A;  2MC3 A;  1XMK A;  2ETH A;  3P9K A;  3I0T A;  3FMR A;  3DXJ F;  2IJL A;  3N97 A;  2P5L C;  4M72 A;  4A6D A;  4R79 A;  3C3W A;  5L3B A;  4Y17 A;  1FZP B;  1J5Y A;  2FE3 A;  5CJ9 A;  4HA8 A;  5E1Z B;  4HDU A;  3WTX C;  2FA5 A;  3L9F A;  1I6X A;  1MJ9 A;  2EA4 A;  4M6Y A;  2XV4 S;  1CF7 B;  2O3F A;  4U7B A;  6PAX A;  1KGS A;  4Q48 A;  3V8L A;  2DI3 A;  3KFW X;  3C1D A;  4S04 A;  2F5E A;  3CUQ C;  1KU7 A;  1U8R A;  4F7Z A;  4L18 B;  1UHM A;  2COM A;  1ZG3 A;  2RVC A;  3E6C C;  5LHH A;  1HKQ A;  2VOP A;  1DDN A;  2W84 A;  1O3T A;  4G94 A;  3O2P E;  4P96 A;  2DW4 A;  3HRU A;  5LHI A;  2LDU A;  3BDD A;  2E7W A;  3O6B B;  4YIF A;  5LEK A;  3KCC A;  3I54 A;  4LFU A;  1ZG1 A;  1XDS A;  1AOY A;  1JHF A;  1U5T C;  5LEJ A;  5E1W A;  2FEZ A;  1FP2 A;  1R1V A;  4HF1 A;  3K9T A;  1J7K A;  4AIK A;  1KU2 A;  4A5N A;  3IWF A;  2QQ9 A;  2ZNY A;  3E5U A;  2H09 A;  2G7H A;  2BGC A;  2JPC A;  3HSE A;  3WTV C;  4BQA A;  1Z1D A;  1F5T A;  4ENN A;  4L5I A;  1QNT A;  1QO0 D;  2ELH A;  4L9J A;  4ASN A;  1QZZ A;  3FM5 A;  2NAZ A;  2CW0 F;  2H6B A;  2OZU A;  4N9H A;  2Q2E A;  2ADU A;  4Y15 A;  1KYW A;  4M71 A;  3ELK A;  4YG2 F;  4ESJ A;  1KU9 A;  4FX0 A;  2CYY A;  4AVP A;  1Z7U A;  4ESB A;  3ZMS A;  1LJ9 A;  4P5O A;  4TV7 A;  2P6S A;  4LG0 A;  1BI3 A;  3SZP A;  3ML6 A;  4CYD A;  1DPR A;  1H9T A;  4KMU X;  4MEY F;  1TQP A;  3I4P A;  2VON A;  4HYE A;  3K1N A;  2K02 A;  1J0R A;  1ZRF A;  1MGT A;  3ZMV A;  2A68 F;  1SD7 A;  2A6H F;  1G4D A;  3P9I A;  3ERE D;  1BJA A;  3QRF F;  3GW2 A;  5L3D A;  3VEP A;  2D2W A;  4WXC A;  1EH6 A;  4I02 A;  3BZ6 A;  2BV6 A;  3I58 A;  1B4A A;  1YW9 A;  2HTJ A;  2HQN A;  5ILS A;  2PBI A;  4YII A;  3J7A O;  1OPC A;  3MQ0 A;  1LVA A;  5L3E A;  5ICG A;  2FNP A;  4M6X A;  1FOK A;  1R1T A;  2F5D A;  2QLZ A;  1FWZ A;  1J2X A;  3EDP A;  3K1M A;  3F8F A;  3MAJ A;  4OIN F;  3WTS C;  2K7L A;  3F21 A;  1T98 A;  3IC7 A;  3LA3 A;  1O7L A;  2GA1 A;  2BBY A;  2FMY A;  4AWX B;  3M8E A;  2CFX A;  4Z2Y A;  5D4S A;  1KQ8 A;  3CTA A;  1PDN C;  1R7J A;  1UFM A;  3GFI A;  2DAO A;  5CVI A;  4A6E A;  2VE9 A;  3M7G A;  4NQW A;  3HHH A;  3LQQ A;  5CVJ A;  2M87 A;  3I59 B;  2PLY A;  5F64 A;  3CJN A;  2DFI A;  1TLH B;  1WRJ A;  2Z3Y A;  2HQR A;  4UVC A;  2V6C A;  5DV5 A;  1BN5 A;  1YLF A;  2IA2 A;  3GO5 A;  1J9I A;  4Q47 A;  2LSO A;  1ZRC A;  2GA2 A;  2PG4 A;  2O6G E;  2Z5U A;  5D5V B;  1J75 A;  1G6N A;  3F6O A;  3BJO A;  2L54 A;  2VBZ A;  2R7D A;  3CLO A;  5JR3 A;  3DF8 A;  1ON1 A;  1IXR C;  2VBW A;  2YX7 A;  1C0W A;  3IHU A;  3KET A;  5TJJ A;  3NEU A;  1RUO A;  5HS8 A;  1JHH A;  2EV0 A;  4L9N A;  2DBB A;  5LRR A;  2ZME A;  1OKR A;  4KN7 X;  3F8N A;  4B8X A;  1L0O C;  5HDN A;  1Z6T A;  4E70 A;  3JSO A;  3J80 K;  1TTY A;  5JVT A;  2P5V A;  4LMY A;  2V1U A;  2A07 F;  2M5W A;  5HDK A;  4ENK A;  3WTU C;  2VBY A;  1REP C;  1YFH A;  3F22 A;  3U1D A;  2M8E A;  2QUF A;  3HIF A;  2VC0 A;  5D4R A;  2XAH A;  2A5Y B;  4KIC A;  4JQF A;  2H27 A;  1HXD A;  3PQK A;  3GX4 X;  3TDU C;  2ESH A;  3FZV A;  4M74 A;  1TNS A;  1FSE A;  1SAX A;  1W5S A;  4G9Y A;  4GGG A;  4U88 A;  1RI7 A;  1A04 A;  3RTR A;  4I98 B;  3GLX A;  4P55 A;  4G6Q A;  5LGT A;  2LF8 A;  1ODD A;  3J81 K;  4WCG A;  1B59 A;  2IP2 A;  4I09 A;  2YR2 A;  2UZK A;  2OZ6 A;  1ZAO A;  1TW3 A;  2EA2 A;  2UXN A;  3K2Z A;  4L9V A;  5FFX A;  1YS7 A;  2QWW A;  5K1Y A;  4U0W A;  2HS5 A;  2P7V B;  5E8G A;  4EQQ A;  1KA8 A;  1IXC A;  4CIC A;  4A0X A;  2GZW A;  2XKO A;  1E2X A;  4ZYD A;  2X0L A;  3OOP A;  3WE3 A;  1GXP A;  3VOD A;  2DPD A;  3CUQ A;  2PJP A;  4XBF A;  1IW7 F;  5FLX K;  1T38 A;  3AAF A;  2W85 A;  2GIV A;  4UHT A;  3MCZ A;  2NYX A;  5D6E A;  4KT5 C;  3KZZ A;  4MEX F;  2G9W A;  4L0Z B;  4A0Z A;  4O6J A;  1O7F A;  3R0A A;  1D8K A;  3WOD F;  4FT8 A;  4EGZ A;  3BPX A;  4RB2 C;  2KJC A;  3WE2 A;  1U5T A;  5CLS A;  3HSF A;  2Z33 A;  2OBP A;  1XGM A;  3BP8 A;  1WSU A;  1IF1 A;  3IRR A;  3KP4 A;  5CVR A;  1XSX A;  1MJA A;  4HV5 A;  1CGP A;  3QPT A;  3E6M A;  1R36 A;  2GAU A;  2E1N A;  3PFI A;  2QBY B;  3L00 A;  1FSH A;  2HGC A;  3KLN A;  2YX4 A;  4EM0 B;  3P9C A;  4PZJ A;  2UXX A;  1OYI A;  4UVA A;  1BBY A;  3GFJ A;  3W6K B;  5FO5 A;  1HW1 A;  3F3X A;  2RN7 A;  4EJT A;  5FD6 A;  2L01 A;  1UHW A;  4A0Y A;  3RIR A;  2VXZ A;  4HX7 A;  4XSZ F;  2ESN A;  3T5X A;  4BHB A;  1S6L A;  2Z99 A;  3JSP A;  2EFQ A;  1QZY A;  2HYF A;  4FHT A;  4MQV A;  4IHT A;  2K27 A;  3I53 A;  2HOE A;  5H20 A;  3TO7 A;  3GZ6 A;  3ECO A;  2QQA A;  1B9M A;  1ZN2 A;  1YS6 A;  2XAQ A;  3T1B A;  2DK8 A;  4WF2 A;  2RQP A;  5L3F A;  1J59 A;  4EJO A;  3V4G A;  4OIR F;  3ULQ B;  4HV6 A;  4M73 A;  2O8X A;  2FML A;  2JRT A;  5ICC A;  4AIH A;  1G3T A;  3FX3 A;  5E17 F;  4LJZ F;  1KQ0 A;  2Z9O A;  2KKO A;  1F4K A;  4NB5 A;  4RGR A; 
#chains in the Genus database with same CATH topology
 1XTA A;  2M0C A;  4IJA A;  4GDF A;  1G3W A;  3RPU D;  4A3L J;  4IQJ A;  4JX5 A;  2Y2Z A;  4PSX A;  4RS8 A;  3TW6 A;  4B4C A;  2IPQ X;  1FIP A;  2R7F A;  4IRH A;  1W1W E;  3QU6 A;  4YIR X;  2M0M A;  2RKH A;  3BR0 A;  2HYJ A;  2NXN B;  3CC7 I;  4A3J J;  2L2O A;  3HPH A;  2F4O B;  3LAJ A;  1OR7 A;  4E6K G;  2F2E A;  2LLK A;  2B9S A;  4MO7 A;  4Y7N J;  3L2Q A;  1R71 A;  1SFO J;  3ROU A;  1RKW A;  4HOB A;  4UB8 C;  5IY5 H;  4U0V A;  1YJN I;  4BJ6 C;  3MZH A;  2OF7 A;  2Z16 A;  3FK6 A;  1TC3 C;  3G1L A;  2FJ1 A;  3VYR B;  3JAM K;  1SFE A;  4A3G J;  3U9G A;  2PJR B;  4GYI A;  1G3S A;  2DN0 A;  1RR8 C;  1MJB A;  1WJB A;  3ZGK A;  1D1C A;  1OFC X;  5EDN A;  5JFR A;  4L5J A;  2STW A;  2KIF A;  5F0H A;  4GO1 A;  1FT9 A;  2JPB A;  4I99 C;  5TRD A;  2DQL A;  4MQ9 F;  2BZT A;  3E3V A;  4AIJ A;  3BQZ A;  5EGO B;  1RPW A;  3RPU A;  3SYT A;  2P0W A;  3GFL A;  4BYY A;  2JUG A;  3F6V A;  2WC2 A;  1I50 J;  4D7M A;  2BYV E;  2IS6 A;  1XMX A;  2XAG A;  2YPR A;  3ONQ A;  5E3N A;  5JHU A;  3JRH A;  3G3Z A;  4L5E A;  4NUB A;  3VB2 A;  5FKO A;  1SFX A;  3GCM A;  3WTT C;  4MFD A;  3R61 A;  1U0J A;  2Y0M A;  4I2O A;  1MMD A;  1P2F A;  3HHG A;  1HF0 A;  5J1R A;  1Y8R B;  4L0Y B;  2DO7 A;  3JRD A;  2E2I J;  1FOX A;  4H4K C;  5HOO A;  3QOP A;  4EJW A;  3HB9 A;  3I56 I;  2ISZ A;  1FNN A;  1X2N A;  3H3U A;  4XN0 A;  5DYM A;  4OMY A;  3ECH A;  2BXZ A;  2X1C A;  4G6T B;  2GQQ A;  2ZO4 A;  3M8J A;  2O03 A;  3G1M A;  4CGZ A;  3K4B A;  3RI4 A;  4PFO A;  4B47 A;  2IVM A;  3C2G A;  3EUH C;  3HUG A;  4D0P A;  1E3H A;  4E7S A;  1XSV A;  3IP4 B;  1V3F A;  5LGU A;  3DFG A;  1IN8 A;  4U0Y A;  4DJA A;  3BWG A;  5D8K B;  2IRF G;  4HAM A;  1EH7 A;  1GV5 A;  1TWA J;  2FF4 A;  2VKE A;  4FIS A;  5K7Z A;  3G73 A;  1MIJ A;  2W24 A;  3LMM A;  4HEA 2;  5HLI A;  3PO3 J;  1YOV B;  4AYB N;  2Q8K A;  1X1A A;  3I4N J;  2FUG 2;  4FCY A;  1R4N B;  2WAE A;  4P9F A;  2KL4 A;  4G7H F;  2E19 A;  1IRF A;  3SJM A;  5A2Q K;  1XGO A;  3E5Q A;  3FK7 A;  4NC8 A;  1Z91 A;  3CCY A;  4Y13 A;  1FTZ A;  2JA8 J;  4MTE A;  4M9S A;  1OCT C;  2IT0 A;  4Q4Z F;  2OTJ I;  2XAU A;  2ZJ2 A;  5J8C A;  2Q2E B;  1ZAR A;  1F36 A;  3PUF A;  4RAY A;  5J6X A;  2A61 A;  1Z6R A;  5BPD A;  2OJE D;  2ZBK A;  2IAI A;  2EPF A;  4NDL A;  3FIS A;  1ZTR A;  1HA8 A;  4ZYH A;  4KIG A;  4MLO A;  2FU4 A;  2KRC A;  2JVH A;  3KP5 A;  3C18 A;  3S93 A;  1S72 I;  4PDK A;  4QLC U;  3LST A;  1XPX A;  1EV7 A;  2IA0 A;  3K1P A;  2P8T A;  3MMY B;  1P4X A;  4LLL A;  4ZC3 A;  1QPI A;  4LG0 B;  1ON2 A;  3KYL A;  5JI6 A;  3LSP A;  3GBG A;  3HOX J;  3N4M A;  3QQA A;  1GVJ A;  1Z7L A;  1LEB A;  3H3V K;  1P4W A;  3KZY A;  3ABU A;  1SVL A;  2IW5 A;  5E3L A;  2Z1D A;  3C2H A;  2VKD A;  1G3Y A;  2L5Q A;  3MVP A;  3LA2 A;  3Q0U A;  4N4N B;  1FBU A;  4KA4 A;  1X1D A;  3GZN B;  2NRA C;  3AL0 C;  4UVB A;  1EKE A;  5E18 F;  3WGG A;  1NTC A;  5LRS A;  1U3E M;  1U78 A;  2GWR A;  5H6R A;  1VQK I;  2MG4 A;  2LKP A;  3V7C A;  4ZYA A;  4N9I A;  2JMW A;  3D5R C;  2XF7 A;  2NVY J;  2XVC A;  1FC3 A;  5FB2 A;  2XRL A;  3V7S A;  1W0U A;  2CO5 A;  1RNL A;  3OYA A;  4V2F A;  1MH3 A;  3AFH A;  1NG7 A;  1EA3 A;  2R0Q C;  5J1U A;  1SFK A;  1N25 A;  1MBE A;  3LA7 A;  1TWC J;  2AQE A;  2E7X A;  4AYB A;  2DT7 B;  2J5O A;  3FF5 A;  2DMN A;  4BUP A;  2IS4 A;  2P6T A;  4UV8 A;  2YU3 A;  3C7J A;  2XB5 A;  1DGR M;  3RYP A;  3CCM I;  4BE1 A;  5M5Y J;  3VDX A;  1ZGA A;  1T08 B;  5JHF A;  2PEX A;  3LFK A;  2ZFW A;  4KNY A;  4ZDO A;  2HWV A;  5EJC A;  2GLO A;  4CHU A;  1MSF C;  1ETK A;  2VT3 A;  4ANJ A;  2A5W A;  2NS0 A;  3V7R A;  1DU0 A;  3DKX A;  4LG3 A;  5CQE A;  1FX7 A;  3TDZ C;  3K70 C;  1BIB A;  3BG3 A;  2IGK A;  3NAR A;  3M1E A;  3FXM A;  5DCF A;  2IS1 A;  4KIT B;  3W3C A;  3A01 B;  4M9X A;  4DYR A;  2CS3 A;  2CGP A;  1SAU A;  4XM3 A;  3CMY A;  2XAF A;  4LIT A;  1H89 C;  1K7A A;  3OY9 A;  5M3M J;  2QQ8 A;  2HDC A;  5DCM A;  3CME I;  2NVT J;  4IOA F;  1R22 A;  2I5U A;  4R8H A;  2ELK A;  1P9Q C;  3E6B A;  4ON0 A;  3SXY A;  2W00 A;  3HOS A;  2KP6 A;  1KQ9 A;  1IG7 A;  3CJT B;  1ZQ3 P;  4C2T A;  3NRV A;  5F1R A;  1LUJ B;  3M9A A;  1T8I A;  4CYC B;  2KDZ A;  1TT0 A;  2EFO A;  1RET A;  3Q5F A;  4HW0 A;  4HX4 A;  4R1H A;  3OSF A;  4AID A;  2IGM A;  3J7Y J;  4ZJZ A;  5F6F A;  2WV1 A;  4C3J J;  2VKH A;  4AD9 A;  1X58 A;  2EIL H;  1W7P D;  2OCE A;  5TIS C;  4BGD A;  3GTO J;  4OIP F;  4RLF A;  4LLG F;  4ETS A;  4XRF A;  5KK1 A;  3WTY C;  1QQI A;  2M1B A;  4PSW A;  4WXD A;  1BC8 C;  4IRI A;  4WXH A;  3RQ4 A;  2ACJ A;  2KRH A;  2V1D A;  3M07 A;  4A3M J;  1SFU A;  4LIU A;  4OMZ A;  3F23 A;  2DA4 A;  3RDI A;  3JR9 A;  2YS9 A;  3CZ6 A;  1DPU A;  1ONV A;  1UJ8 A;  3BTC A;  3EQL F;  4DIQ A;  2RV8 A;  4UV9 A;  2XHK A;  4NQW B;  3CES A;  1WI3 A;  2HKX A;  3MN2 A;  3KP2 A;  4YRV A;  4GCV A;  1S7O A;  4XR6 A;  3R4K A;  1GXQ A;  3LSH A;  1I1G A;  4E4H A;  3TOB A;  2OCC H;  1I1S A;  3RKQ A;  3HC7 A;  4O3M A;  4XQF A;  4LB5 A;  5B66 C;  3KE2 A;  2ME6 A;  3RSN A;  1IC8 A;  2D1H A;  1DU6 A;  2BY3 A;  2ID6 A;  1W7P A;  2XB0 X;  5KVR A;  5CPR B;  4ZH4 F;  5CVU A;  4XKW A;  3HZJ A;  2H94 A;  3HRM A;  3ERM A;  2QKL B;  1O57 A;  2MA3 A;  1PJR A;  1T56 A;  5HOD A;  3OWT A;  1QRY A;  1FYK A;  4BBS J;  4XOP A;  1MW7 A;  1YX5 A;  2V9K A;  3MD2 A;  3J80 Z;  3QWL A;  4RLQ A;  4RAZ A;  2E71 A;  2XGE A;  3F8M A;  5M5X J;  3F8C A;  4PK4 A;  5DUI A;  3KP6 A;  3OYG A;  1V5F A;  4KN4 X;  2FBK A;  4BJ5 C;  3CCQ I;  2YUS A;  5GP9 A;  3FKI J;  1OJL A;  1YQA A;  3HG9 A;  2P81 A;  4XLA A;  4BJT A;  1QVU A;  4D5F A;  2AHQ A;  2E2H J;  2R5Y B;  3RKY A;  4XMY A;  1H0M A;  1BI1 A;  1S5L C;  4BQO A;  4QSH A;  1IAW A;  2JVG A;  3CP2 A;  3ESW B;  5HVQ C;  1RUN A;  1M1E B;  2R7S A;  2CUE A;  2LF7 A;  3AG2 H;  1Z3Y A;  2KFD A;  4F55 A;  4ENM A;  1H9G A;  1HKS A;  3MKZ A;  2VJ5 A;  4UB6 C;  1LFU P;  4IKF A;  3A2K A;  4PJ0 C;  4H0E A;  3OR1 C;  5TGT A;  5LLQ A;  3F8B A;  1WI9 A;  3I71 A;  3DKW A;  1V5E A;  1YIO A;  3OYB A;  2VQH A;  4K2E A;  5B1B H;  1XDU A;  4MFE A;  3H0D A;  1KYZ A;  3HGG A;  4IHV A;  3SQN A;  2V4J C;  3OYF A;  3GXO A;  2JTV A;  3F9K A;  2DQR A;  5LHG A;  4YFX F;  3J81 Z;  2HZD A;  2O9L A;  1YYV A;  3FIW A;  3EET A;  1VQ9 I;  4NNJ A;  1XG1 A;  2PQ8 A;  2Y69 H;  4FE7 A;  4BAY A;  2WA0 A;  2DK5 A;  1ZGJ A;  4ZDP A;  2XAJ A;  4C3I J;  1PP7 U;  1YRN A;  5FRO A;  1ZG5 A;  1YJ9 I;  3TO6 A;  2OA4 A;  3LOC A;  5FKN A;  2VPL A;  2CUF A;  1B6A A;  2KHM A;  3BTJ A;  3GME A;  3K4M A;  1QZE A;  4EGY A;  2XDV A;  2L4A A;  2R7Z J;  2OC6 A;  1WVR A;  3QAH A;  3CJR B;  4DOZ A;  1N77 A;  1MND A;  2K86 A;  5IT9 K;  3TGN A;  5FKK A;  3DU6 A;  4XLE A;  2L7K A;  4AM3 A;  4HNT A;  1K78 A;  1TW2 A;  3J7Z I;  2R7Q A;  2FNA A;  3D5S C;  2O5R A;  1WJ5 A;  2OQR A;  4B3A A;  4ESF A;  1L3L A;  1I3A A;  3LNQ A;  3BOQ A;  1IO2 A;  4MHG A;  4XLN F;  3W2W A;  4PGH A;  4A12 A;  4YFN F;  4DQ2 A;  5CKT A;  5ICE A;  1SEU A;  3CDH A;  3SZT A;  1W5T A;  2P5K A;  1RR7 A;  3HYI A;  2X85 A;  4XNF A;  1TZL A;  4DGW B;  3G2B A;  5K7H A;  3CLQ A;  2JA5 J;  1FLI A;  4MNU A;  3PUB A;  1A35 A;  4KT6 A;  3FWE A;  1IRG A;  2BY1 A;  2CQN A;  5FRM A;  4I7H A;  5FLX Z;  2K3F A;  1JUM A;  3KEY A;  1FYL A;  1O3S A;  2BY0 A;  1XCV A;  2AXL A;  5AIQ A;  5E20 A;  3S1Q J;  2WTE A;  1F9N A;  3KPH A;  1BR2 A;  1LQ1 A;  4NC7 A;  1VFC A;  1QBJ A;  3PNY A;  3NQO A;  4NC6 A;  4M3B A;  3I3L A;  3ZQ7 A;  3KP3 A;  3EUA A;  2C6Y A;  3TP0 A;  2KZG A;  3S2D J;  3DEU A;  4PJJ A;  2M45 A;  3VYS B;  4JP0 A;  5L3C A;  2MH9 A;  1D0Z A;  4JX6 A;  5HS7 A;  2HOA A;  1IN4 A;  3CUQ B;  4G6D A;  2ICW G;  4Y33 A;  2P7C B;  1IN5 A;  3MZ8 A;  1F1Z A;  4I6Z A;  3FDY A;  1T39 A;  2OQG A;  2LBF A;  2XGX A;  3A0H C;  3DQV C;  4MGR A;  3RYR A;  2WY7 Q;  1GT0 C;  4IOC F;  4PFP A;  5ILV A;  3S16 J;  3RJP A;  5EG0 A;  1U6G A;  1KU3 A;  2X6X A;  1T2K A;  3MFK A;  3ABT A;  1PUF B;  1ZRE A;  4W1U A;  4KDP A;  3GLL A;  2LFB A;  2EIM H;  3W2A A;  1WQ2 A;  4KIB A;  2EWN A;  1XCB A;  1FYM A;  1IUY A;  5GTI C;  1OYY A;  3LWF A;  4QPO A;  5FKM A;  4OOI A;  4IVN A;  3I4M J;  1JI8 A;  4HQM A;  4GXO A;  2VIX A;  4BH9 A;  2BHZ A;  3CF2 A;  1MDM A;  3S14 J;  1R23 A;  3JRF A;  3V8J A;  2FQ4 A;  3ZMZ A;  3DV8 A;  1P4A A;  3FXQ A;  3GWZ A;  1HSJ A;  1BI0 A;  1U5T B;  5KAF C;  2EIN H;  4KIF A;  2QF7 A;  5KAI C;  4ENJ A;  1VQP I;  5C4X J;  2R92 J;  2E1M C;  4RBO A;  5EZG A;  1VTN C;  1FBS A;  3HOY J;  3EUH A;  2BEO A;  1S7A A;  3CP8 A;  4IXA A;  4IQ4 A;  1MBJ A;  1W0T A;  3CD6 I;  3WGH A;  4KJZ A;  2HPI A;  2UV1 A;  2XRO A;  4N0B A;  2H1L A;  1D3Y A;  5M5W J;  3IAS 2;  4CCJ A;  1K6O A;  1LNW A;  3DCF A;  5CVV A;  1ZK8 A;  1XGS A;  2DA1 A;  2LK2 A;  2RGV A;  3WG9 A;  1R4M B;  1Y6I A;  4DYC A;  2E2J J;  3OS0 A;  1QGP A;  2VI6 A;  2XGD A;  5ILU A;  2E35 A;  5HLH A;  4LOC A;  3TQN A;  4HDV A;  4BXU A;  4FX4 A;  4IHS A;  2Y30 A;  2ZKZ A;  3H9G A;  4UNO A;  1FBQ A;  2KIQ A;  1JUS A;  4IPA A;  1ZLJ A;  2WB1 A;  2DOA A;  2V9V A;  1OMI A;  3OYK A;  2KPM A;  4AC0 A;  2XPW A;  1DP3 A;  1LDK B;  1MMA A;  3QPL A;  2L3D A;  1IXS B;  3R0J A;  4EAT A;  3K69 A;  2VN2 A;  1V54 H;  3VFZ A;  1P6R A;  3EYI A;  2BY2 A;  2DDA A;  3KLO A;  4E7K A;  1UB9 A;  4DZJ A;  3L2R A;  1CF7 A;  1I5Z A;  4UUS A;  1IV8 A;  4ZZD A;  2KT0 A;  4OIO F;  4XRS G;  4KFC A;  2R5Z A;  5K5O A;  3FXR A;  2K4B A;  2IGO A;  4CO8 A;  1JKQ C;  3OYM A;  2V26 A;  4BE0 A;  3L2C A;  1ETQ A;  4RDU A;  3GTJ J;  4HF2 A;  4DNC A;  3IKT A;  1B72 B;  3I55 I;  2VLA A;  1POG A;  2IGN A;  4X6A J;  3OYH A;  2XIG A;  1FY7 A;  3L09 A;  1FMW A;  3OYL A;  3K70 D;  4EMS A;  2B63 J;  4U87 A;  2DOD A;  1UST A;  1UZC A;  3CO7 C;  2WAQ N;  3GTK J;  2ZXH A;  5BQT A;  1RES A;  5JVG F;  2RC4 A;  1LE8 A;  2PFB A;  2RRE A;  2QVO A;  1D1A A;  1P7I A;  2CSO A;  2R7T A;  1BW6 A;  2DMQ A;  1RRJ A;  2M30 A;  1WJF A;  2B0L A;  3RPQ A;  4ZDL A;  2O8K A;  3FMS A;  2HVR A;  3ASN H;  5J4Y A;  4KYW A;  4XRS A;  4L9T A;  3HTU A;  2FRH A;  1WPK A;  3PQJ A;  1W4M A;  3D5L A;  2NS7 A;  2KDO A;  4YEJ A;  1HW2 A;  3I5U A;  2VL8 A;  2EH3 A;  3BJ6 A;  3ZQH A;  2VPR A;  3KIO A;  2VC1 A;  2MD5 A;  5FFZ A;  2DA2 A;  3PSI A;  4HBL A;  1JKP C;  1WWX A;  3DPT A;  5DD4 A;  4PUS A;  2UWM A;  2V1X A;  1NG6 A;  2VT2 A;  1ZYR F;  4HSR A;  4FET A;  1YI2 I;  4LD5 A;  2W7N A;  1XSD A;  2XSJ C;  3JAM Z;  2W57 A;  1ZHF A;  3OYJ A;  2HDD A;  1K61 A;  2ISY A;  2E34 A;  2HYG D;  4HZF A;  2MC4 A;  2O0Y A;  2FSW A;  5FLV A;  5F08 A;  4U7D A;  5DM7 F;  2JN6 A;  1FPQ A;  5DUK A;  4XIC A;  1Y0N A;  1BI2 A;  1DP7 P;  2JJ7 A;  2M8G X;  2LR8 A;  1Z3X A;  3Q0W A;  3RZO J;  1SD6 A;  2VJJ A;  5EEG A;  4BAC A;  5FD5 A;  3HOV J;  3F72 A;  3FM3 A;  3WU2 C;  1HW5 A;  5K5R A;  3PIP F;  4KUM A;  3SZG A;  1R5I D;  3HKZ N;  4CH7 A;  1A31 A;  2JA6 J;  3HRS A;  1VQL I;  3DP7 A;  4UUT A;  2J5P A;  1ETW A;  3QP5 A;  2PX9 A;  2WWY A;  3BY6 A;  1B8I A;  1G59 A;  2GIZ A;  4CCK A;  4A3E J;  4BU2 A;  2V6E A;  2MH2 A;  2EK5 A;  4G12 A;  3SHF A;  2BE5 F;  3L7W A;  2X1D A;  3S8P A;  3CO6 C;  2XRN A;  1QPM A;  4B09 A;  2WAQ A;  4KMF A;  3A02 A;  1QHG A;  1XB4 A;  5LD2 C;  4CCO A;  4EM2 A;  4CCN A;  2QA4 I;  4PJM A;  2VBX A;  2L7Z A;  1IDY A;  4XK4 A;  2STT A;  3CDL A;  2ZXJ A;  2PN6 A;  2X4H A;  4CXF A;  2XKP A;  1ITY A;  1HKT A;  1R5G A;  3TOA A;  1BOA A;  3GZ5 A;  3P7N A;  3VOE A;  1XD7 A;  3GTQ J;  1HQC A;  1YW7 A;  2P4W A;  1HC8 A;  5EEH A;  2IA1 A;  2R3S A;  2EZI A;  5HLG A;  2KMU A;  2CG4 A;  4NHJ A;  2XPU A;  3GEZ A;  2DLL A;  4BHC A;  2R7X A;  2GXB A;  5D5X B;  1JXS A;  2W4S A;  4M9Z A;  4HLX A;  2A6T A;  2BW3 A;  3OOU A;  1JKR C;  2X51 A;  4J19 A;  3VSK A;  3OS1 A;  2Y48 A;  3H5A A;  3JRG A;  4BXX J;  4A93 J;  4LK1 F;  1VND A;  2CW8 A;  4PGG A;  4LB6 B;  3BQY A;  2QZ8 A;  3K4L A;  1ZH5 A;  5LBQ A;  3M3Y J;  2XUB A;  2L02 A;  2RNJ A;  2Y75 A;  3OMY A;  4QIW N;  5A2Q Z;  3IWZ A;  3FMQ A;  2A3S A;  4ZYG A;  2CH0 A;  4LGW A;  2JUC A;  3HKZ A;  5EF6 A;  4EV0 A;  5BMZ A;  1XX5 A;  1X1P A;  1YW8 A;  4XLH A;  1ZGW A;  5KNL A;  4WX9 A;  2OU2 A;  4D9J A;  3DEW A;  3HUG B;  5J40 A;  1MH4 A;  3MWM A;  2D45 A;  2E1C A;  1SMY F;  2ZCW A;  1R1U A;  1Y1V J;  3S3O A;  2FOK A;  1WFX A;  2WAF A;  4E7H A;  3BR6 A;  2ELJ A;  3WHB A;  2RNG A;  4RB3 C;  2ME0 A;  3BZK A;  3D1N I;  3TMO A;  1JE8 A;  2IS2 A;  4I0B A;  4HST A;  2VUM J;  3S1R J;  4BQN A;  5GPA A;  3FXU A;  2XC7 A;  2MGQ A;  5D5W B;  4RMN A;  3OIQ A;  4UXN A;  1Z9C A;  4JK1 X;  2VQL A;  4B43 A;  1R49 A;  3FKJ A;  4G7O F;  2FBI A;  1OYW A;  5GAH J;  2QM3 A;  1S8N A;  1TP4 A;  2F5C A;  2MYS A;  2QKM B;  4A3F J;  2JK3 A;  4D7N A;  3AKZ A;  4ZYE A;  5L3G A;  1IN7 A;  3JTH A;  2X1E A;  4QPQ A;  2F6C A;  3CCR I;  1Q1V A;  3O8G A;  1EH8 A;  3E1S A;  3HSR A;  4Z6Y A;  2XPV A;  5BOX A;  4V19 K;  3K6G A;  2AO9 A;  1ZR4 A;  1GUU A;  3S1N J;  1E17 A;  2KJB A;  3BR2 A;  3CUO A;  2CQX A;  4A2U A;  3GUD A;  4CZZ A;  5FKL A;  3FXJ A;  5IP9 J;  3PFY A;  4GYG A;  3JRI A;  2V9P A;  2NS8 A;  1U2W A;  3HRT A;  3O3K A;  3H36 A;  2A6E F;  1S3J A;  1DUX C;  2XAS A;  1GHC A;  1WKM A;  3HEF A;  3S15 J;  2DFE A;  3K10 A;  1USS A;  3QPH A;  4BL0 B;  4HF0 A;  5AIP A;  1LB2 A;  2M9H A;  5ED4 A;  1ZLK A;  4FE4 A;  4LLN A;  1R5H A;  4DBR A;  1UCR A;  4A3I J;  5KCM A;  2L4M A;  4M3D A;  5K5Q A;  1PUE E;  4RM3 A;  1R58 A;  3REO A;  2K9Q A;  3HPG A;  1BOB A;  3BRO A;  5HNH A;  2FQ3 A;  1QA6 A;  3I59 A;  2QSH X;  1Z77 A;  1HBX G;  3WGI A;  5E1X A;  4M3G A;  1MBK A;  4A3K J;  1JJ8 C;  3MEX A;  4EJU A;  5BS6 A;  3CF5 F;  1RZ4 A;  2Q0O A;  2NOJ B;  2EJR A;  2RAE A;  3ASO H;  3CCL I;  4ZZL A;  2LMD A;  2CFO A;  1T6S A;  1ETV A;  3AG3 H;  2QSG X;  1XMA A;  1LDJ A;  4XON A;  5H6Q A;  1Y0U A;  4XL9 A;  2MLG A;  5E8I A;  2PI0 A;  1OCP A;  3DU5 A;  5LGN A;  4AVZ A;  3K0L A;  3ABM H;  1YO5 C;  2F48 A;  4JX4 A;  4XLF A;  2LC2 A;  1D1B A;  3H92 A;  3V8K A;  2HKO A;  4CUG A;  5DCM B;  3SDG A;  5HLT A;  3WU0 A;  3CC4 I;  1TWG J;  2V79 A;  5BPI A;  2AQF A;  3ZMU A;  4Q5S F;  1SD4 A;  2Y9Z A;  3PJR A;  1AHD P;  1SD5 A;  2OPT A;  2JSC A;  2DU9 A;  1ULY A;  4C9Y A;  4XID A;  2QYO A;  1U8B A;  3G71 I;  3W6J B;  4UY8 I;  2MFZ A;  1D5V A;  1Y56 A;  4NBQ A;  1R00 A;  3T0Y A;  2NVU B;  3QU3 A;  1LEA A;  3Q9V A;  5DTD A;  1Y39 A;  1YTY A;  3ZMT A;  2FXA A;  5CYV A;  2DA3 A;  2K9L A;  3A4C A;  5EEA A;  3DKY A;  2W25 A;  1B1B A;  3CCJ I;  2VB6 A;  2Y0S N;  2FX0 A;  4X1E A;  4O5V A;  5GAD J;  1Q1H A;  5F27 A;  3ISP A;  2EV5 A;  4HNV A;  1HLV A;  3T8T A;  2IEK A;  4A3B J;  2DOE A;  3QOE A;  1HOM A;  2KRF A;  4XLP F;  2VE8 A;  3RKW A;  3H1C A;  2F5F A;  3BG7 A;  2A69 F;  1JGS A;  1D5Y A;  3CJQ B;  1O3Q A;  2W82 A;  2HU9 A;  4QTR A;  5HS9 A;  4XSX F;  4WK8 F;  4II3 A;  3IRQ A;  3FXO A;  2LY2 A;  3COA C;  1B9N A;  5D6F A;  1K4S A;  1NHA A;  2DFF A;  2NNN A;  1K79 A;  1WHU A;  3A03 A;  3KEO A;  2BHY A;  1TQM A;  5J4V A;  1U9N A;  2PMH A;  2CQK A;  5DEQ A;  4IHW A;  3WU1 B;  1TNT A;  4UUV A;  5D8L B;  2HTS A;  4IF4 A;  4JYK A;  3CCU I;  2Q1Z B;  5DD8 A;  3AG4 H;  4RB0 A;  3GTP J;  2YSR A;  1PYV A;  1OQY A;  2H6C A;  3T8R A;  4OAY A;  3H0G J;  4E7Z A;  2DTR A;  2W1O A;  1KZH A;  1IV6 A;  1W7P B;  2CQQ A;  2NOG A;  3K4K A;  2ZME B;  3IH4 A;  4XLC A;  5FGM A;  2O61 A;  1D8J A;  1STZ A;  1HDP A;  1X3W B;  3H3Z A;  1APL C;  3JCU C;  2HXO A;  2V7F A;  1XN7 A;  3EYY A;  2CRG A;  4PCQ A;  2MD0 A;  3JW4 A;  2NNY A;  4CDG A;  4LK0 F;  5B3S H;  3LAP A;  2TDX A;  3BT9 A;  3OIO A;  1XGN A;  2BVM A;  5EYR A;  5HDG A;  2K9S A;  1RIO H;  3BJA A;  4I01 A;  2JWT A;  2Y0S A;  1ETY A;  1S9H A;  3IH2 A;  1CQT A;  4OAZ A;  3DPL C;  1Z21 A;  1MD0 A;  3E97 A;  3IAM 2;  4EVI A;  4AUX A;  1I27 A;  1MMS A;  2WBM A;  3E5X A;  4E7J A;  1K83 J;  1IN6 A;  2CMP A;  3BPV A;  3TW7 A;  2L9N A;  4RGU A;  1LDD A;  1A6Q A;  4GFB A;  4D5C A;  2MBF A;  1MNM C;  1GLN A;  2UUZ A;  2DOF A;  2G7U A;  1TQI A;  4BNC A;  1VQ6 I;  2HR3 A;  4I76 A;  2HFH A;  1MZB A;  3DLL F;  3GFM A;  4BKX A;  2COB A;  2L0K A;  1HST A;  2GXG A;  3NWS A;  3KEQ A;  5FLM J;  1NH3 A;  1FMV A;  2DCE A;  1X3U A;  3BC8 A;  4HNU A;  3E6D A;  4X0G A;  4G7Z F;  4IX7 A;  5IT9 Z;  3H5R A;  4JBA A;  2K4J A;  2OV7 A;  2VOD A;  4XOR A;  5J8F A;  2EV6 A;  3ZPL A;  1WH5 A;  2DT5 A;  1DQU A;  3TKY A;  3ZQG A;  2EIJ H;  1V4R A;  1SMT A;  3JTG A;  4C30 A;  1TBX A;  1WH7 A;  3B73 A;  1VQ8 I;  4RA2 A;  2QEN A;  4RB1 A;  5AON A;  1YRN B;  4RGS A;  4OIQ F;  4WWC A;  3HOT A;  1VQ4 I;  3DTI A;  1P92 A;  2M4K A;  4HLY A;  3FHZ A;  4IRG A;  3GTL J;  5IT3 A;  3SFZ A;  2D1V A;  3M8F A;  2DT6 A;  2G0E A;  1X1B A;  3E7L A;  4HX8 A;  1Y8Q B;  4EM1 A;  1H88 C;  3HTS B;  4EEF G;  1E0E A;  3EUK L;  2JT1 A;  2M4G A;  3WTZ A;  2LKX A;  1BR1 A;  2L9R A;  3ZP5 A;  2CQ7 A;  4I0A A;  3TBI A;  1K78 B;  2B7E A;  1UG2 A;  2LTP A;  2KIU A;  2X6Y A;  3GVA A;  2WV0 A;  1PP8 F;  1WJA A;  2HOS A;  1FJL A;  3OYE A;  3KP7 A;  4MTD A;  3B02 A;  1FP1 D;  1ZRD A;  3BTL A;  3U2R A;  4B1R A;  1Z05 A;  2F5V A;  1YG2 A;  4YFK F;  2WB1 N;  2M7B A;  4BEH A;  3OL4 A;  2DPU A;  3R6S A;  2TRT A;  3LSR A;  3BR5 A;  3Q9S A;  2QBY A;  4CZC A;  3NWT A;  2MLK A;  1IZ1 A;  2RDP A;  3WTW C;  3ZN0 A;  5GAE J;  2OAZ A;  5E79 C;  2EFW A;  3GTG J;  3I9V 2;  2VQC A;  3QYE A;  3DTK A;  5ERI A;  4RM2 A;  1GV2 A;  1TL8 A;  2LNB A;  2KIM A;  5K7F A;  2AS5 F;  1X4P A;  1AKH A;  2EB7 A;  3QP6 A;  3ZN1 A;  1YJW I;  2HEO A;  2QCO A;  3S2W A;  4A3C J;  4HQE A;  5IOY A;  3GYH X;  5ICF A;  1BIA A;  4XKV A;  3LQR A;  1SVO A;  2ID3 A;  4S05 A;  3M4O J;  1BM9 A;  3IKV A;  2E1O A;  2ZXI A;  4II2 A;  2RQQ A;  2KZV A;  5IYD J;  2DFH A;  2LBF B;  3RZD J;  3MZY A;  2EFN A;  3GF2 A;  1OLT A;  3L1P A;  2HZT A;  1O3R A;  3RKX A;  1DGW Y;  3TO9 A;  1K6Y A;  4ABZ A;  1WGX A;  2PMU A;  4QWQ A;  4A5M A;  2W48 A;  2KIS A;  4AU7 A;  5IPA A;  5EG0 B;  3ZMD A;  3RCO A;  1WCM J;  4EJV A;  1BC7 C;  2QQB A;  3L2W A;  1QU3 A;  2FBH A;  3OL3 A;  1BL0 A;  2DMT A;  3K4C A;  3I64 A;  2CWE A;  2DXI A;  2NVX J;  4P9U A;  1O4X A;  1YIJ I;  3Q0V A;  2EFP A;  3PO2 J;  4BHP A;  2VOO A;  2ZNZ A;  2OTL I;  3K2A A;  3CC2 I;  2WAD A;  1AWC A;  1FTT A;  3MKW B;  5DDG A;  1S29 A;  5IYC J;  5D5U B;  3OYI A;  1MDM B;  2K3P A;  3D0S A;  3ABK H;  1MKM A;  4OU0 A;  2XF6 A;  3OV8 A;  3V42 A;  3R60 A;  2LRD A;  2L7M P;  3FBN B;  4RGX A;  4A69 C;  2JZY A;  2OD5 A;  4RAG A;  3IL2 A;  4G8X A;  3G4S I;  4P1W A;  2MC3 A;  1XMK A;  2ETH A;  3P9K A;  3I0T A;  3JRE A;  3FMR A;  1JGG A;  1YE9 A;  2DA6 A;  1LVK A;  2X6W A;  3DXJ F;  4FAS D;  2IJL A;  2ECC A;  3N97 A;  5JLW A;  2P5L C;  1BW5 A;  4M72 A;  4A6D A;  4R79 A;  3C3W A;  4F93 B;  5L3B A;  1Y1W J;  4Y17 A;  1FZP B;  1J5Y A;  2FD5 A;  2M2E A;  2FE3 A;  3M1C A;  5CJ9 A;  2L9V A;  4HA8 A;  5E1Z B;  4N4O B;  4HDU A;  2OUM A;  2LYC A;  3H9J A;  4DYQ A;  1A5J A;  2KLO A;  4BDY A;  3WTX C;  5DS9 A;  2HDW A;  2FA5 A;  3L9F A;  1I6X A;  1VQN I;  1MJ9 A;  2EA4 A;  4M6Y A;  4YEL A;  1AU7 A;  2XV4 S;  1CF7 B;  2O3F A;  3CCV I;  5E3O A;  4UUS B;  4ITV A;  4U7B A;  2PJR A;  6PAX A;  1KGS A;  4Q48 A;  3V8L A;  3PSF A;  2DI3 A;  1S7E A;  2R5Z B;  3KFW X;  2HQA A;  3C1D A;  4S04 A;  1BR4 A;  2F5E A;  1WZ2 A;  3CUQ C;  1KU7 A;  1N75 A;  3IV5 A;  1LFB A;  4B48 A;  1U8R A;  4F7Z A;  4L18 B;  1UHM A;  5EGO A;  3PM1 A;  2COM A;  1MSE C;  3AL0 B;  2V1N A;  1ZG3 A;  2RVC A;  3E6C C;  5LHH A;  1LE8 B;  1LKX A;  1HKQ A;  4XRM A;  2VOP A;  1DDN A;  4BXF A;  2W84 A;  5B1A H;  1O3T A;  2NVQ J;  2HNH A;  4G94 A;  3O2P E;  4P96 A;  2DW4 A;  3HRU A;  2BOL A;  5LHI A;  2GXA A;  2LDU A;  3BDD A;  2E7W A;  2HVQ A;  4BBR J;  1VF9 A;  4IL6 C;  1FIA A;  3O6B B;  2JSP A;  4XOT A;  4YIF A;  4DBQ A;  2R7O A;  5LEK A;  3UKG A;  4MIM A;  4E7I A;  3KCC A;  3G1O A;  1WJD A;  3I54 A;  4LFU A;  3OSG A;  3LSJ A;  5M3F J;  1JUP A;  1ZG1 A;  1XDS A;  2H8W A;  2M34 A;  1AOY A;  1JHF A;  1U5T C;  5LEJ A;  5E1W A;  2FEZ A;  1FP2 A;  1R1V A;  2EIK H;  2K9M A;  3K9T A;  1J7K A;  4HF1 A;  3BLY A;  4AIK A;  2JRM A;  3VPR A;  2MSY A;  2M7A A;  1KU2 A;  2TCT A;  2FOW A;  4LIV A;  4A5N A;  3IWF A;  2QQ9 A;  3ZXS A;  2ZNY A;  1VQO I;  3E5U A;  3FBI B;  4M3E A;  1E3P A;  2H09 A;  3VYU B;  2G7H A;  3PL8 A;  2BGC A;  2JPC A;  2CV0 A;  4F3Q A;  3HSE A;  3WTV C;  2ZJP F;  4BQA A;  5C44 J;  1Z1D A;  4CSW A;  1F5T A;  4ENN A;  1SAN A;  1JTX A;  1A36 A;  4L5I A;  1QNT A;  2CU7 A;  1QO0 D;  2ELH A;  4L9J A;  1VQ7 I;  4ASN A;  1B8I B;  1QZZ A;  3EPZ A;  3K4N A;  3FM5 A;  2NAZ A;  2CW0 F;  2E5Z A;  2LRE A;  3L2U A;  3LSK A;  2H6B A;  2OZU A;  4N9H A;  2Q2E A;  2VAS A;  3ZOB A;  3BG5 A;  3DWL E;  2ADU A;  4Y15 A;  1KYW A;  3TED A;  2YU9 J;  4M71 A;  4CA0 A;  3ELK A;  4YG2 F;  4ESJ A;  1KU9 A;  1OIS A;  4FX0 A;  3BR3 A;  2JA7 J;  2CYY A;  1MMG A;  4AVP A;  1Z7U A;  4ESB A;  3ZMS A;  5IOZ A;  1LJ9 A;  2QSF X;  4P5O A;  4TV7 A;  2P6S A;  4LG0 A;  3ZRG A;  3OYN A;  3BTI A;  1BI3 A;  3BCB A;  3SZP A;  3LL7 A;  2PMZ N;  3ML6 A;  3WG7 H;  4CCM A;  1MBF A;  3HXL A;  4CYD A;  1DPR A;  1H9T A;  4XKC A;  1OCZ H;  5CQG A;  1HDD C;  4KMU X;  4MEY F;  1TQP A;  1JJ6 C;  2BW3 B;  3I4P A;  3H35 A;  1MBH A;  2VON A;  4HYE A;  2VQG A;  2HQ5 A;  3K1N A;  2L9S A;  3S32 A;  2K02 A;  1XC5 A;  1UHS A;  2VJ4 A;  5J3L A;  1I6H J;  3ZQC A;  1J0R A;  1X4O A;  1TWF J;  1ZRF A;  1I3Q J;  2HVS A;  2VKV A;  2R93 J;  2R7V A;  1MGT A;  3ZMV A;  2GOM A;  2A68 F;  2I8D A;  1SD7 A;  2ECB A;  2CV1 A;  2A6H F;  2VJI A;  1G4D A;  3H9Q A;  3P9I A;  3CMA I;  4S0H B;  4Y52 J;  3ERE D;  1WJE A;  1BJA A;  3QRF F;  1I39 A;  5FJ8 J;  2M3A A;  1WJC A;  3GW2 A;  5L3D A;  2QBY B;  5FRN A;  3VEP A;  2LG4 A;  2D2W A;  2EBI A;  4WXC A;  1JT0 A;  1EH6 A;  4I02 A;  1T0F C;  4PJN A;  3VSL A;  3BZ6 A;  2BV6 A;  3H5N A;  3I58 A;  1B4A A;  5GPC A;  1YW9 A;  3B6A A;  1MMN A;  5F0C A;  2HTJ A;  3A01 A;  2HQN A;  4F52 A;  3S3M A;  5ILS A;  3VYT B;  2PBI A;  4YII A;  2K5C A;  3HBL A;  3DBL B;  1VQM I;  3J7A O;  1OPC A;  3OYD A;  3MQ0 A;  3LSG A;  1LVA A;  5L3E A;  5ICG A;  2PMZ A;  2LD5 A;  1OR7 C;  2FNP A;  4M6X A;  1FOK A;  4IHY A;  1R1T A;  5JLX A;  9ANT A;  2F5D A;  1SVM A;  2QLZ A;  3PNT A;  1GVD A;  1FWZ A;  2QGU A;  1J2X A;  3EDP A;  1FOW A;  5F1J A;  3K1M A;  3ZCO A;  3F8F A;  3MAJ A;  3QYF A;  2LOO A;  4OIN F;  1IUF A;  2K7L A;  4B3X A;  4CYC A;  3BZC A;  2CUJ A;  3WTS C;  3F21 A;  1T98 A;  1BA5 A;  3IC7 A;  5F04 A;  3E0J B;  3LA3 A;  2K85 A;  1X2M A;  1O7L A;  1A6I A;  2GA1 A;  2H1K A;  5IYB J;  2BBY A;  5IP6 A;  1ORK A;  3K7A J;  4KIS A;  1ZKG A;  2FMY A;  2MW8 A;  1J09 A;  2GBY A;  4AWX B;  2R7U A;  4M3F A;  2EQR A;  3M8E A;  2CFX A;  4C2M J;  4BDZ A;  4Z2Y A;  5D4S A;  4DZP A;  1KQ8 A;  1IRX A;  1JKO C;  3CTA A;  1PDN C;  3DLA A;  1YHQ I;  2DMP A;  4A3D J;  1R7J A;  3WHC A;  2ZFU A;  1UFM A;  4V2G A;  4CCL A;  3GFI A;  2DAO A;  5CVI A;  3JRB A;  4A6E A;  3LSM A;  3M7G A;  2VE9 A;  4NQW A;  3HHH A;  2F4I A;  3LQQ A;  3HDD A;  1QVT A;  2EZH A;  5CVJ A;  2M87 A;  2K9N A;  3I59 B;  3PIO F;  2PLY A;  5F64 A;  1D0X A;  3CJN A;  2DMU A;  1F43 A;  2DFI A;  5IP7 J;  1TLH B;  1WRJ A;  4W97 A;  2Z3Y A;  4C3H J;  2HQR A;  3IUO A;  2F4M B;  4UVC A;  4BQQ A;  2V6C A;  5DV5 A;  1BN5 A;  3Q3S A;  3CCS I;  1YLF A;  2IA2 A;  3GO5 A;  1J9I A;  1T33 A;  3AG1 H;  4Q47 A;  2LSO A;  4M6V A;  1K4T A;  1FEX A;  2E36 A;  2X6O A;  1ZRC A;  1Z67 A;  2GA2 A;  2PG4 A;  1BJZ A;  2ZJQ F;  1AA7 A;  2O6G E;  2Z5U A;  2DYS H;  2R7R A;  1IGN A;  5D5V B;  1J75 A;  3JRA A;  3HM5 A;  1G6N A;  3UNG C;  1ENH A;  3F6O A;  3BG6 A;  3BJO A;  2L54 A;  2VBZ A;  2R7D A;  3CDI A;  2ZB9 A;  3DBR B;  3CLO A;  5JR3 A;  3DF8 A;  1ON1 A;  4IHX A;  3BR1 A;  1IXR C;  2VBW A;  1IJW C;  2YX7 A;  1C0W A;  3IHU A;  3KET A;  5TJJ A;  1UG0 A;  1VQ5 I;  3HJE A;  3NEU A;  2ZSH B;  2R5Y A;  1RUO A;  2EZK A;  5KHD A;  5HS8 A;  1LFP A;  5B5E C;  1JHH A;  3ZQI A;  2EV0 A;  4IZZ A;  4L9N A;  2DBB A;  3SEZ A;  5LRR A;  2ZME A;  1OKR A;  3BG9 A;  4KN7 X;  3KZI C;  3HOZ J;  3F8N A;  4PJL A;  4B8X A;  1L0O C;  5HDN A;  1Z6T A;  2DTZ A;  4E70 A;  1LPQ A;  3JSO A;  1YIT I;  4DW6 A;  1RKT A;  5LFA A;  3C2B A;  1TTY A;  5JVT A;  2JA2 A;  1JT6 A;  2P5V A;  3J80 K;  4LMY A;  4ZTF A;  1NK3 P;  1MBG A;  2A05 A;  5F0F A;  2A07 F;  2V1U A;  3S17 J;  2M5W A;  5HDK A;  4ENK A;  3WTU C;  2VBY A;  2ZJR F;  1REP C;  1YFH A;  3F22 A;  3U1D A;  2M8E A;  3QYB A;  2QUF A;  3HIF A;  2VC0 A;  3TL4 X;  4BY1 J;  2IXS A;  5D4R A;  2XAH A;  2A5Y B;  3JRC A;  4KIC A;  3VWB A;  3S3N A;  4JQF A;  2H27 A;  1HXD A;  3PQK A;  3RQI A;  3ZQL A;  3GX4 X;  3TDU C;  2ESH A;  3FZV A;  4E7L A;  4M74 A;  1TNS A;  1TWH J;  4Y3O A;  4BE2 A;  1FSE A;  1ETX A;  2DYR H;  1SAX A;  1N78 A;  3X2Q H;  1W5S A;  2LY9 A;  2KQR A;  4G9Y A;  1Z0X A;  4GGG A;  4U88 A;  2E1M B;  3PNV A;  1RI7 A;  3GTM J;  4IO9 F;  4BY7 J;  1A04 A;  1H8A C;  4F91 B;  3RTR A;  1W36 D;  1NK2 P;  4I98 B;  2LH9 A;  3NAU A;  3GLX A;  5HNF A;  4P55 A;  4G6Q A;  5LGT A;  2LF8 A;  1ODD A;  2ZXW H;  4FQG A;  3J81 K;  4WCG A;  1B59 A;  2IP2 A;  3QPS A;  4I09 A;  3W2V A;  1OCC H;  2YR2 A;  5J47 A;  1W5C C;  2UZK A;  2JQ7 A;  1ACI A;  2OZ6 A;  1ZAO A;  1TW3 A;  2EA2 A;  2ZC2 A;  4GRI A;  1X19 A;  3S2H J;  2UXN A;  3K2Z A;  4HG2 A;  2E5N A;  4L9V A;  5FFX A;  1YS7 A;  2QWW A;  3KX2 A;  5K1Y A;  1TT5 B;  4U0W A;  1JTY A;  2HS5 A;  2P7V B;  5E8G A;  3SEQ A;  5DM6 F;  2QEX I;  4EQQ A;  2GOX B;  2O7O A;  1HCR A;  1KA8 A;  1XS9 A;  1IXC A;  4CIC A;  4A0X A;  1E3O C;  3L2V A;  3B6C A;  2GZW A;  2XKO A;  1E2X A;  4ZYD A;  2HI3 A;  2R4G A;  2DDB A;  3A0B C;  3O8H A;  2X0L A;  3DPU A;  4XKB A;  4RGR A;  3ZQF A;  3OOP A;  3WE3 A;  3CMM A;  2LKS A;  1P7J A;  3VOD A;  1GXP A;  2XGC A;  5GTH C;  2DPD A;  3P5J A;  3W6V A;  1RC9 A;  3CUQ A;  5J1Y A;  2AXT C;  3MKY B;  2BXY A;  2PJP A;  4Y4R A;  2DJI A;  3SFI A;  5C3E J;  4ZTJ A;  4XBF A;  1IW7 F;  5FLX K;  4BS9 A;  1ETO A;  1T38 A;  4IEJ A;  3AAF A;  1YX3 A;  2W85 A;  2GIV A;  4UHT A;  3MCZ A;  2NYX A;  5D6E A;  2IBD A;  3CCE I;  3HOU J;  1R6R A;  4KT5 C;  3ZQQ A;  3KZZ A;  3HOW J;  3F0C A;  4MEX F;  2G9W A;  1PUF A;  1OCO H;  5EZH A;  2R7W A;  3N05 A;  2Y31 A;  4L0Z B;  4A0Z A;  3QOD A;  4OWR B;  4J00 A;  1U9O A;  2EZL A;  4O6J A;  1O7F A;  3R0A A;  1D8K A;  1X3Z B;  3WOD F;  2HPM A;  4FT8 A;  4EGZ A;  1V55 H;  3BPX A;  4RB2 C;  2DA5 A;  3J7A Y;  2KJC A;  3WE2 A;  1U5T A;  4B44 A;  5CLS A;  3HSF A;  2Z33 A;  2OBP A;  1T95 A;  1UMQ A;  1XGM A;  3BP8 A;  2LVS A;  1WSU A;  4HRI A;  1IF1 A;  3IRR A;  2X9D A;  3KP4 A;  4C2U A;  2H8R A;  5CVR A;  2LY1 A;  3MKL A;  1XSX A;  1MJA A;  2BVL A;  2ZME C;  3ABL H;  3DEE A;  1G8X A;  4HV5 A;  1CGP A;  1ZR2 A;  4BEH B;  3OS2 A;  3QPT A;  2X48 A;  3E6M A;  5GAG J;  4XN3 A;  1R36 A;  2GAU A;  2E1N A;  3PFI A;  2CW7 A;  4HPQ A;  3UR3 C;  3L00 A;  2GM4 A;  1UAA A;  1FSH A;  2HGC A;  3KLN A;  1GDT A;  3U1K A;  3FXL A;  5C4J J;  4JOM A;  2YX4 A;  4EM0 B;  1EF4 A;  1SC7 A;  3P9C A;  3LFU A;  4PZJ A;  2UXX A;  4FTH A;  3KYD B;  1OYI A;  2VXD A;  3FXK A;  4UVA A;  1BBY A;  3GFJ A;  3W6K B;  5FO5 A;  1AKH B;  1HW1 A;  3F3X A;  2RN7 A;  4EJT A;  5FD6 A;  2XSD C;  2L01 A;  5H2F C;  2D5V A;  1UHW A;  3S1M J;  4A0Y A;  3RIR A;  3A1Y A;  3OIP A;  4RAF A;  2VXZ A;  2LP0 A;  4HX7 A;  3OYC A;  1QHH D;  4J01 A;  4XSZ F;  2ESN A;  5BNG A;  2Y9Y A;  2XF5 A;  3T5X A;  4BHB A;  1KON A;  1S6L A;  2I10 A;  3OR2 C;  3BCA A;  1PVE A;  1X1C A;  2DJN A;  2DA7 A;  2Z99 A;  1D0Y A;  3FHN A;  1B72 A;  3JSP A;  2EFQ A;  1QZY A;  3KYC B;  3LSI A;  2HYF A;  1IRZ A;  2K40 A;  2Z2S B;  4FHT A;  3HGY A;  1EJ9 A;  4MQV A;  4IHT A;  1FOY A;  2K27 A;  3I53 A;  1ZEL A;  2HOE A;  1MNE A;  5H20 A;  3TO7 A;  3ECO A;  3GZ6 A;  2E60 A;  2QQA A;  1B9M A;  1ZN2 A;  3U21 A;  1YS6 A;  2L7F P;  1R9T J;  2XAQ A;  2N8G A;  3T1B A;  4F92 B;  2DK8 A;  2HOT A;  1VI0 A;  2RQP A;  4WF2 A;  5E3M A;  3G6E I;  2CV2 A;  3ZR8 X;  5L3F A;  1V5G A;  3DTE A;  1J59 A;  4EJO A;  2CJJ A;  3V4G A;  1ERD A;  4OIR F;  3TP3 A;  1IDZ A;  3ULQ B;  1OCR H;  4HV6 A;  2HXI A;  4M73 A;  2WY8 Q;  4D1Q A;  2O8X A;  3K4J A;  1UEL B;  2FML A;  3DBH B;  2JRT A;  5ICC A;  1VZ0 A;  4AIH A;  1G3T A;  3FX3 A;  5E17 F;  4LJZ F;  1KQ0 A;  3CQZ J;  2Z9O A;  2MAB A;  1W36 C;  2KKO A;  1F4K A;  2CUZ A;  3SDB A;  3IH3 A;  4NB5 A;  2ZSI B;  1G2H A;  3HL2 A;  1T0F A; 
#chains in the Genus database with same CATH homology
 4IJA A;  1G3W A;  4RS8 A;  2IPQ X;  2R7F A;  4IRH A;  3QU6 A;  2RKH A;  3LAJ A;  1OR7 A;  2F2E A;  3ROU A;  4HOB A;  4U0V A;  3MZH A;  3JAM K;  1SFE A;  3U9G A;  4GYI A;  1G3S A;  1MJB A;  5JFR A;  4L5J A;  2STW A;  2KIF A;  4GO1 A;  1FT9 A;  2JPB A;  5TRD A;  2DQL A;  4MQ9 F;  3E3V A;  4AIJ A;  3RPU A;  3GFL A;  4BYY A;  3F6V A;  2WC2 A;  2BYV E;  2XAG A;  2YPR A;  5JHU A;  3G3Z A;  3VB2 A;  1SFX A;  3WTT C;  3R61 A;  2Y0M A;  4I2O A;  1P2F A;  3HHG A;  4L0Y B;  2DO7 A;  5HOO A;  3QOP A;  4EJW A;  2ISZ A;  1FNN A;  3H3U A;  5DYM A;  4OMY A;  3ECH A;  2GQQ A;  2ZO4 A;  2O03 A;  4CGZ A;  3RI4 A;  2IVM A;  4D0P A;  3HUG A;  1XSV A;  1V3F A;  5LGU A;  3DFG A;  1IN8 A;  4U0Y A;  3BWG A;  5D8K B;  2IRF G;  4HAM A;  1EH7 A;  2FF4 A;  3G73 A;  2W24 A;  5HLI A;  2Q8K A;  4P9F A;  4G7H F;  1IRF A;  5A2Q K;  1XGO A;  3E5Q A;  1Z91 A;  4Y13 A;  4MTE A;  4M9S A;  2IT0 A;  4Q4Z F;  2ZJ2 A;  5J8C A;  1ZAR A;  4RAY A;  5J6X A;  2A61 A;  1Z6R A;  5BPD A;  2ZBK A;  4ZYH A;  4KIG A;  2FU4 A;  3KP5 A;  3C18 A;  4PDK A;  4QLC U;  3LST A;  1EV7 A;  2IA0 A;  3K1P A;  2P8T A;  1P4X A;  4LLL A;  4LG0 B;  1ON2 A;  5JI6 A;  3N4M A;  1GVJ A;  1LEB A;  1P4W A;  3KZY A;  3ABU A;  2IW5 A;  1G3Y A;  3LA2 A;  1FBU A;  4KA4 A;  2NRA C;  4UVB A;  5E18 F;  3WGG A;  5LRS A;  1U3E M;  1U78 A;  2GWR A;  5H6R A;  2LKP A;  3V7C A;  4N9I A;  2XVC A;  1FC3 A;  5FB2 A;  3V7S A;  2CO5 A;  1RNL A;  3LA7 A;  2E7X A;  2J5O A;  3FF5 A;  2P6T A;  4UV8 A;  2YU3 A;  3C7J A;  3RYP A;  1ZGA A;  2PEX A;  3LFK A;  2ZFW A;  4KNY A;  2HWV A;  4CHU A;  2VT3 A;  2NS0 A;  3V7R A;  1FX7 A;  3TDZ C;  1BIB A;  3M1E A;  5DCF A;  4M9X A;  2CGP A;  2XAF A;  1K7A A;  2HDC A;  5DCM A;  1R22 A;  4R8H A;  3E6B A;  3SXY A;  4ON0 A;  3HOS A;  1KQ9 A;  3NRV A;  5F1R A;  3M9A A;  2EFO A;  3Q5F A;  4HW0 A;  4HX4 A;  4R1H A;  5F6F A;  4AD9 A;  1W7P D;  4OIP F;  4LLG F;  4ETS A;  4XRF A;  5KK1 A;  3WTY C;  1QQI A;  2M1B A;  4WXD A;  1BC8 C;  4IRI A;  4WXH A;  2ACJ A;  2V1D A;  1SFU A;  4OMZ A;  3F23 A;  3RDI A;  1DPU A;  1ONV A;  3EQL F;  2RV8 A;  4UV9 A;  2XHK A;  2HKX A;  3KP2 A;  4GCV A;  1S7O A;  3R4K A;  1GXQ A;  1I1G A;  3TOB A;  1I1S A;  4O3M A;  4LB5 A;  3KE2 A;  2D1H A;  5KVR A;  1W7P A;  4ZH4 F;  5CVU A;  2H94 A;  3HRM A;  1O57 A;  2MA3 A;  1FYK A;  3J80 Z;  4RAZ A;  3F8M A;  5DUI A;  3F8C A;  3KP6 A;  4KN4 X;  2FBK A;  1YQA A;  3RKY A;  1H0M A;  1BI1 A;  1IAW A;  5HVQ C;  1RUN A;  2LF7 A;  4ENM A;  1H9G A;  1HKS A;  4H0E A;  5LLQ A;  3F8B A;  1WI9 A;  3I71 A;  3DKW A;  1YIO A;  4K2E A;  1XDU A;  1KYZ A;  3SQN A;  3GXO A;  2JTV A;  2DQR A;  5LHG A;  4YFX F;  3J81 Z;  1YYV A;  3EET A;  2PQ8 A;  4BAY A;  2DK5 A;  1ZGJ A;  2XAJ A;  1PP7 U;  1ZG5 A;  3TO6 A;  2OA4 A;  1B6A A;  4EGY A;  2L4A A;  3QAH A;  2K86 A;  5IT9 K;  3TGN A;  1K78 A;  1TW2 A;  2FNA A;  2OQR A;  4ESF A;  1L3L A;  3BOQ A;  4MHG A;  4XLN F;  4PGH A;  4A12 A;  4YFN F;  4DQ2 A;  5ICE A;  3CDH A;  3SZT A;  1W5T A;  2P5K A;  3HYI A;  1FLI A;  4MNU A;  3FWE A;  1IRG A;  4I7H A;  5FLX Z;  1FYL A;  1O3S A;  5AIQ A;  1XCV A;  2AXL A;  5E20 A;  2WTE A;  1F9N A;  1LQ1 A;  1QBJ A;  3NQO A;  3ZQ7 A;  3KP3 A;  2C6Y A;  3DEU A;  2M45 A;  5L3C A;  2MH9 A;  5HS7 A;  1IN4 A;  3CUQ B;  4G6D A;  2P7C B;  1IN5 A;  1F1Z A;  1T39 A;  2OQG A;  2XGX A;  3DQV C;  4MGR A;  3RYR A;  5ILV A;  3RJP A;  1U6G A;  1KU3 A;  1T2K A;  3MFK A;  3ABT A;  1ZRE A;  4KDP A;  1WQ2 A;  4KIB A;  2EWN A;  1XCB A;  1FYM A;  1IUY A;  1OYY A;  3LWF A;  4OOI A;  4IVN A;  4HQM A;  4GXO A;  4BH9 A;  1MDM A;  1R23 A;  3V8J A;  3ZMZ A;  3DV8 A;  1P4A A;  3FXQ A;  3GWZ A;  1HSJ A;  1BI0 A;  1U5T B;  4KIF A;  4ENJ A;  1VTN C;  1FBS A;  3EUH A;  2BEO A;  1S7A A;  4IXA A;  3WGH A;  2XRO A;  4N0B A;  1D3Y A;  1K6O A;  1LNW A;  5CVV A;  1XGS A;  2RGV A;  3WG9 A;  1QGP A;  4IHS A;  5ILU A;  4FX4 A;  5HLH A;  3TQN A;  4HDV A;  4BXU A;  2ZKZ A;  4UNO A;  1FBQ A;  4IPA A;  1ZLJ A;  2V9V A;  1OMI A;  1LDK B;  2L3D A;  1IXS B;  3R0J A;  3K69 A;  2VN2 A;  3VFZ A;  1P6R A;  3EYI A;  3KLO A;  1UB9 A;  1CF7 A;  1I5Z A;  4ZZD A;  4OIO F;  4KFC A;  5K5O A;  3FXR A;  2K4B A;  4CO8 A;  3L2C A;  4HF2 A;  4DNC A;  3IKT A;  2XIG A;  1FY7 A;  3L09 A;  4EMS A;  3CO7 C;  1UST A;  5BQT A;  2RC4 A;  2PFB A;  2QVO A;  2CSO A;  2M30 A;  2B0L A;  3RPQ A;  3FMS A;  4KYW A;  4L9T A;  3HTU A;  2FRH A;  3PQJ A;  1W4M A;  3D5L A;  1HW2 A;  3I5U A;  3BJ6 A;  2VC1 A;  2MD5 A;  5FFZ A;  4HBL A;  1WWX A;  3DPT A;  5DD4 A;  2UWM A;  2V1X A;  2VT2 A;  1ZYR F;  1XSD A;  4LD5 A;  3JAM Z;  2W57 A;  1ZHF A;  2ISY A;  2HYG D;  4HZF A;  2O0Y A;  2FSW A;  4U7D A;  1FPQ A;  5DUK A;  1BI2 A;  1DP7 P;  1SD6 A;  5EEG A;  5FD5 A;  3F72 A;  3FM3 A;  1HW5 A;  5K5R A;  4KUM A;  3HRS A;  3DP7 A;  2J5P A;  3QP5 A;  2WWY A;  3BY6 A;  2MH2 A;  2EK5 A;  3SHF A;  2BE5 F;  3L7W A;  3CO6 C;  2XRN A;  1QPM A;  4B09 A;  4KMF A;  1XB4 A;  4EM2 A;  2VBX A;  2STT A;  2ZXJ A;  2PN6 A;  2X4H A;  4CXF A;  2XKP A;  1HKT A;  1R5G A;  3TOA A;  1BOA A;  3GZ5 A;  3P7N A;  3VOE A;  1XD7 A;  1HQC A;  1YW7 A;  2P4W A;  5EEH A;  2IA1 A;  2R3S A;  5HLG A;  2CG4 A;  4NHJ A;  3GEZ A;  4BHC A;  2DLL A;  2GXB A;  5D5X B;  1JXS A;  4M9Z A;  4HLX A;  2Y48 A;  4LK1 F;  4PGG A;  4LB6 B;  2QZ8 A;  1ZH5 A;  5LBQ A;  2XUB A;  2L02 A;  2RNJ A;  2Y75 A;  5A2Q Z;  3IWZ A;  3FMQ A;  2A3S A;  4ZYG A;  4LGW A;  4EV0 A;  5BMZ A;  1YW8 A;  4WX9 A;  2OU2 A;  3MWM A;  2D45 A;  2E1C A;  1SMY F;  2ZCW A;  1R1U A;  2FOK A;  4RB3 C;  1JE8 A;  4I0B A;  3FXU A;  5D5W B;  4UXN A;  1Z9C A;  4JK1 X;  4G7O F;  2FBI A;  1OYW A;  2QM3 A;  1S8N A;  2F5C A;  4ZYE A;  5L3G A;  1IN7 A;  3JTH A;  1EH8 A;  3HSR A;  5BOX A;  1E17 A;  2KJB A;  3CUO A;  4A2U A;  3GUD A;  4CZZ A;  4GYG A;  1U2W A;  3HRT A;  3O3K A;  2A6E F;  1S3J A;  1DUX C;  2XAS A;  1GHC A;  1WKM A;  1USS A;  3QPH A;  4HF0 A;  5AIP A;  1LB2 A;  1ZLK A;  5ED4 A;  4LLN A;  1R5H A;  1UCR A;  2L4M A;  5K5Q A;  1PUE E;  3REO A;  1R58 A;  3BRO A;  2FQ3 A;  3I59 A;  1HBX G;  3WGI A;  5E1X A;  3MEX A;  4EJU A;  5BS6 A;  1RZ4 A;  2Q0O A;  2EJR A;  4ZZL A;  1T6S A;  1XMA A;  1LDJ A;  5H6Q A;  1Y0U A;  2MLG A;  5E8I A;  2PI0 A;  5LGN A;  3K0L A;  1YO5 C;  3H92 A;  3V8K A;  2HKO A;  5DCM B;  3WU0 A;  2V79 A;  5BPI A;  3ZMU A;  4Q5S F;  1SD4 A;  1SD5 A;  2JSC A;  2DU9 A;  1ULY A;  2QYO A;  3W6J B;  1D5V A;  1R00 A;  3T0Y A;  3QU3 A;  1LEA A;  3Q9V A;  1YTY A;  3ZMT A;  2FXA A;  5CYV A;  2W25 A;  1T0F A;  1B1B A;  4O5V A;  1Q1H A;  3ISP A;  2EV5 A;  3T8T A;  2KRF A;  4XLP F;  2VE8 A;  3RKW A;  2F5F A;  2A69 F;  1JGS A;  1O3Q A;  5HS9 A;  4XSX F;  4WK8 F;  3IRQ A;  3COA C;  1B9N A;  5D6F A;  1NHA A;  2NNN A;  1K79 A;  3KEO A;  1TQM A;  2PMH A;  2CQK A;  5DEQ A;  3WU1 B;  1TNT A;  4UUV A;  5D8L B;  2HTS A;  4IF4 A;  5DD8 A;  4RB0 A;  2YSR A;  3T8R A;  2H6C A;  2DTR A;  1W7P B;  5FGM A;  2ZME B;  2O61 A;  1D8J A;  1STZ A;  3H3Z A;  1XN7 A;  3EYY A;  4PCQ A;  3JW4 A;  2NNY A;  4CDG A;  4LK0 F;  3LAP A;  2TDX A;  1XGN A;  5HDG A;  1RIO H;  3BJA A;  4I01 A;  3DPL C;  1MD0 A;  3E97 A;  4EVI A;  1I27 A;  3E5X A;  1IN6 A;  3BPV A;  4RGU A;  1LDD A;  2MBF A;  4BNC A;  2G7U A;  1TQI A;  2HR3 A;  2HFH A;  1MZB A;  3GFM A;  1HST A;  2GXG A;  3KEQ A;  1X3U A;  3E6D A;  4G7Z F;  5IT9 Z;  4JBA A;  2K4J A;  2VOD A;  5J8F A;  2EV6 A;  3ZPL A;  2DT5 A;  3TKY A;  1V4R A;  1SMT A;  3JTG A;  1TBX A;  3B73 A;  2QEN A;  4RB1 A;  5AON A;  4RGS A;  4OIQ F;  4WWC A;  3HOT A;  1P92 A;  4HLY A;  3FHZ A;  4IRG A;  5IT3 A;  3SFZ A;  2D1V A;  3M8F A;  4HX8 A;  4EM1 A;  3HTS B;  2JT1 A;  3WTZ A;  3ZP5 A;  4I0A A;  1K78 B;  2KIU A;  3GVA A;  2WV0 A;  1PP8 F;  3KP7 A;  4MTD A;  3B02 A;  1FP1 D;  1ZRD A;  3U2R A;  1Z05 A;  1YG2 A;  4YFK F;  2DPU A;  3R6S A;  3Q9S A;  2QBY A;  2MLK A;  1IZ1 A;  2RDP A;  3WTW C;  3ZN0 A;  2OAZ A;  2EFW A;  5ERI A;  2LNB A;  2KIM A;  2AS5 F;  2EB7 A;  3QP6 A;  3ZN1 A;  2HEO A;  3S2W A;  4HQE A;  3GYH X;  5ICF A;  1BIA A;  3LQR A;  4S05 A;  1BM9 A;  3IKV A;  3MZY A;  2EFN A;  3GF2 A;  2HZT A;  1O3R A;  3RKX A;  3TO9 A;  2PMU A;  4QWQ A;  4A5M A;  3ZMD A;  4EJV A;  1BC7 C;  2QQB A;  2FBH A;  3I64 A;  2CWE A;  4P9U A;  2EFP A;  4BHP A;  2VOO A;  2ZNZ A;  1AWC A;  5DDG A;  1S29 A;  5D5U B;  1MDM B;  3D0S A;  1MKM A;  4OU0 A;  3OV8 A;  3R60 A;  4RGX A;  2JZY A;  2OD5 A;  3IL2 A;  4G8X A;  2MC3 A;  1XMK A;  2ETH A;  3P9K A;  3I0T A;  3FMR A;  3DXJ F;  2IJL A;  3N97 A;  2P5L C;  4M72 A;  4A6D A;  4R79 A;  3C3W A;  5L3B A;  4Y17 A;  1FZP B;  1J5Y A;  2FE3 A;  5CJ9 A;  4HA8 A;  5E1Z B;  4HDU A;  3WTX C;  2FA5 A;  3L9F A;  1I6X A;  1MJ9 A;  2EA4 A;  4M6Y A;  2XV4 S;  1CF7 B;  2O3F A;  4U7B A;  6PAX A;  1KGS A;  4Q48 A;  3V8L A;  2DI3 A;  3KFW X;  3C1D A;  4S04 A;  2F5E A;  3CUQ C;  1KU7 A;  1U8R A;  4F7Z A;  4L18 B;  1UHM A;  2COM A;  1ZG3 A;  2RVC A;  3E6C C;  5LHH A;  1HKQ A;  2VOP A;  1DDN A;  2W84 A;  1O3T A;  4G94 A;  3O2P E;  4P96 A;  2DW4 A;  3HRU A;  5LHI A;  2LDU A;  3BDD A;  2E7W A;  3O6B B;  4YIF A;  5LEK A;  3KCC A;  3I54 A;  4LFU A;  1ZG1 A;  1XDS A;  1AOY A;  1JHF A;  1U5T C;  5LEJ A;  5E1W A;  2FEZ A;  1FP2 A;  1R1V A;  4HF1 A;  3K9T A;  1J7K A;  4AIK A;  1KU2 A;  4A5N A;  3IWF A;  2QQ9 A;  2ZNY A;  3E5U A;  2H09 A;  2G7H A;  2BGC A;  2JPC A;  3HSE A;  3WTV C;  4BQA A;  1Z1D A;  1F5T A;  4ENN A;  4L5I A;  1QNT A;  1QO0 D;  2ELH A;  4L9J A;  4ASN A;  1QZZ A;  3FM5 A;  2NAZ A;  2CW0 F;  2H6B A;  2OZU A;  4N9H A;  2Q2E A;  2ADU A;  4Y15 A;  1KYW A;  4M71 A;  3ELK A;  4YG2 F;  4ESJ A;  1KU9 A;  4FX0 A;  2CYY A;  4AVP A;  1Z7U A;  4ESB A;  3ZMS A;  1LJ9 A;  4P5O A;  4TV7 A;  2P6S A;  4LG0 A;  1BI3 A;  3SZP A;  3ML6 A;  4CYD A;  1DPR A;  1H9T A;  4KMU X;  4MEY F;  1TQP A;  3I4P A;  2VON A;  4HYE A;  3K1N A;  2K02 A;  1J0R A;  1ZRF A;  1MGT A;  3ZMV A;  2A68 F;  1SD7 A;  2A6H F;  1G4D A;  3P9I A;  3ERE D;  1BJA A;  3QRF F;  3GW2 A;  5L3D A;  3VEP A;  2D2W A;  4WXC A;  1EH6 A;  4I02 A;  3BZ6 A;  2BV6 A;  3I58 A;  1B4A A;  1YW9 A;  2HTJ A;  2HQN A;  5ILS A;  2PBI A;  4YII A;  3J7A O;  1OPC A;  3MQ0 A;  1LVA A;  5L3E A;  5ICG A;  2FNP A;  4M6X A;  1FOK A;  1R1T A;  2F5D A;  2QLZ A;  1FWZ A;  1J2X A;  3EDP A;  3K1M A;  3F8F A;  3MAJ A;  4OIN F;  3WTS C;  2K7L A;  3F21 A;  1T98 A;  3IC7 A;  3LA3 A;  1O7L A;  2GA1 A;  2BBY A;  2FMY A;  4AWX B;  3M8E A;  2CFX A;  4Z2Y A;  5D4S A;  1KQ8 A;  3CTA A;  1PDN C;  1R7J A;  1UFM A;  3GFI A;  2DAO A;  5CVI A;  4A6E A;  2VE9 A;  3M7G A;  4NQW A;  3HHH A;  3LQQ A;  5CVJ A;  2M87 A;  3I59 B;  2PLY A;  5F64 A;  3CJN A;  2DFI A;  1TLH B;  1WRJ A;  2Z3Y A;  2HQR A;  4UVC A;  2V6C A;  5DV5 A;  1BN5 A;  1YLF A;  2IA2 A;  3GO5 A;  1J9I A;  4Q47 A;  2LSO A;  1ZRC A;  2GA2 A;  2PG4 A;  2O6G E;  2Z5U A;  5D5V B;  1J75 A;  1G6N A;  3F6O A;  3BJO A;  2L54 A;  2VBZ A;  2R7D A;  3CLO A;  5JR3 A;  3DF8 A;  1ON1 A;  1IXR C;  2VBW A;  2YX7 A;  1C0W A;  3IHU A;  3KET A;  5TJJ A;  3NEU A;  1RUO A;  5HS8 A;  1JHH A;  2EV0 A;  4L9N A;  2DBB A;  5LRR A;  2ZME A;  1OKR A;  4KN7 X;  3F8N A;  4B8X A;  1L0O C;  5HDN A;  1Z6T A;  4E70 A;  3JSO A;  3J80 K;  1TTY A;  5JVT A;  2P5V A;  4LMY A;  2V1U A;  2A07 F;  2M5W A;  5HDK A;  4ENK A;  3WTU C;  2VBY A;  1REP C;  1YFH A;  3F22 A;  3U1D A;  2M8E A;  2QUF A;  3HIF A;  2VC0 A;  5D4R A;  2XAH A;  2A5Y B;  4KIC A;  4JQF A;  2H27 A;  1HXD A;  3PQK A;  3GX4 X;  3TDU C;  2ESH A;  3FZV A;  4M74 A;  1TNS A;  1FSE A;  1SAX A;  1W5S A;  4G9Y A;  4GGG A;  4U88 A;  1RI7 A;  1A04 A;  3RTR A;  4I98 B;  3GLX A;  4P55 A;  4G6Q A;  5LGT A;  2LF8 A;  1ODD A;  3J81 K;  4WCG A;  1B59 A;  2IP2 A;  4I09 A;  2YR2 A;  2UZK A;  2OZ6 A;  1ZAO A;  1TW3 A;  2EA2 A;  2UXN A;  3K2Z A;  4L9V A;  5FFX A;  1YS7 A;  2QWW A;  5K1Y A;  4U0W A;  2HS5 A;  2P7V B;  5E8G A;  4EQQ A;  1KA8 A;  1IXC A;  4CIC A;  4A0X A;  2GZW A;  2XKO A;  1E2X A;  4ZYD A;  2X0L A;  3OOP A;  3WE3 A;  1GXP A;  3VOD A;  2DPD A;  3CUQ A;  2PJP A;  4XBF A;  1IW7 F;  5FLX K;  1T38 A;  3AAF A;  2W85 A;  2GIV A;  4UHT A;  3MCZ A;  2NYX A;  5D6E A;  4KT5 C;  3KZZ A;  4MEX F;  2G9W A;  4L0Z B;  4A0Z A;  4O6J A;  1O7F A;  3R0A A;  1D8K A;  3WOD F;  4FT8 A;  4EGZ A;  3BPX A;  4RB2 C;  2KJC A;  3WE2 A;  1U5T A;  5CLS A;  3HSF A;  2Z33 A;  2OBP A;  1XGM A;  3BP8 A;  1WSU A;  1IF1 A;  3IRR A;  3KP4 A;  5CVR A;  1XSX A;  1MJA A;  4HV5 A;  1CGP A;  3QPT A;  3E6M A;  1R36 A;  2GAU A;  2E1N A;  3PFI A;  2QBY B;  3L00 A;  1FSH A;  2HGC A;  3KLN A;  2YX4 A;  4EM0 B;  3P9C A;  4PZJ A;  2UXX A;  1OYI A;  4UVA A;  1BBY A;  3GFJ A;  3W6K B;  5FO5 A;  1HW1 A;  3F3X A;  2RN7 A;  4EJT A;  5FD6 A;  2L01 A;  1UHW A;  4A0Y A;  3RIR A;  2VXZ A;  4HX7 A;  4XSZ F;  2ESN A;  3T5X A;  4BHB A;  1S6L A;  2Z99 A;  3JSP A;  2EFQ A;  1QZY A;  2HYF A;  4FHT A;  4MQV A;  4IHT A;  2K27 A;  3I53 A;  2HOE A;  5H20 A;  3TO7 A;  3GZ6 A;  3ECO A;  2QQA A;  1B9M A;  1ZN2 A;  1YS6 A;  2XAQ A;  3T1B A;  2DK8 A;  4WF2 A;  2RQP A;  5L3F A;  1J59 A;  4EJO A;  3V4G A;  4OIR F;  3ULQ B;  4HV6 A;  4M73 A;  2O8X A;  2FML A;  2JRT A;  5ICC A;  4AIH A;  1G3T A;  3FX3 A;  5E17 F;  4LJZ F;  1KQ0 A;  2Z9O A;  2KKO A;  1F4K A;  4NB5 A;  4RGR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...