1JXSA

Solution structure of the dna-binding domain of interleukin enhancer binding factor
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
98
structure length
98
Chain Sequence
DSKPPYSYAQLIVQAITMAPDKQLTLNGIYTHITKNYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASESKLIEQAFRKRRPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords interleukin enhancer binding factor
publication title Solution structure of the DNA-binding domain of interleukin enhancer binding factor 1 (FOXK1a)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 14
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2001-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00250 Forkhead Forkhead domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1jxsA00
2QQAA 1P4WA 1R22A 1LQ1A 4HA8A 1IXCA 5A2QK 3ZPLA 4CHUA 4ENMA 1IUYA 3CDHA 3PQJA 2V9VA 1ZG5A 1R5HA 1Q1HA 2EFNA 3F8CA 1A04A 1LDDA 3FM3A 3QU3A 4S05A 4AIHA 2EFOA 5K5RA 2YX4A 2PLYA 2FSWA 1VTNC 4UNOA 3HOSA 3TKYA 4G7HF 2D1VA 1ZH5A 1TQIA 3KP6A 3I5UA 2Y48A 4RGXA 4L9JA 4PGGA 4EJWA 2EFQA 5HLGA 2XAHA 1YW8A 4I02A 3BJ6A 2K02A 1DP7P 1SAXA 3IHUA 2GA2A 3G3ZA 1HW5A 2ESHA 2PFBA 3MZHA 1O7LA 3LA3A 3P9KA 1KU3A 1FBSA 1LB2A 1F5TA 4YFNF 5FFXA 3MWMA 3QPHA 4BNCA 2L4AA 1UB9A 2DO7A 5A2QZ 1O3TA 1I27A 1YS6A 5DV5A 1XDUA 3TO9A 2Z5UA 3F6OA 2VONA 2BYVE 1OMIA 4I0BA 4WXHA 2EFWA 3EYYA 2WV0A 1T2KA 2A6EF 5KVRA 4EQQA 5DUKA 1DDNA 2YX7A 1ONVA 3K0LA 2CG4A 5E8GA 2JZYA 1SD6A 5BPDA 4ASNA 1OR7A 1I5ZA 3O2PE 2CFXA 3QPTA 4E70A 1QGPA 3RJPA 1HSTA 5LLQA 4A0XA 4MTEA 2GAUA 3WODF 1DUXC 3H3UA 1YYVA 1BC8C 3I53A 4A5NA 2DBBA 4BXUA 2HKOA 4FT8A 2ZMEB 3JSOA 3K1NA 3WGGA 2VE9A 3GFIA 2L02A 4L9TA 3L00A 4Q4ZF 2XAGA 3HYIA 2H94A 5TRDA 2W24A 2RN7A 5D5XB 3V7RA 2BGCA 3CTAA 4CDGA 2STWA 4M71A 3RYPA 3GLXA 3G73A 2CO5A 3SQNA 1R5GA 1XGMA 5J6XA 1QBJA 1FT9A 2FQ3A 2VOPA 1IRGA 1IXRC 4IF4A 3T1BA 1O57A 1UFMA 4WX9A 1FYKA 5D5UB 2Z9OA 1E2XA 5DCMB 3WTYC 4M9XA 3SZTA 4U7BA 2QLZA 2EWNA 2QUFA 2DAOA 3K1MA 4M74A 4D0PA 2H6CA 2FOKA 4KIFA 3SHFA 3QOPA 4R79A 4B09A 1S7OA 4U0VA 1BJAA 3JTGA 2LKPA 1GXPA 4WCGA 4RAZA 2FA5A 2ZBKA 1RUOA 5AIQA 1XSDA 3ULQB 2P7CB 3Q9VA 3K2ZA 2DK8A 1CF7B 4KDPA 1WRJA 1YFHA 4U0WA 1D3YA 1MJAA 4KUMA 3ZP5A 5FFZA 5LRSA 4AIJA 1FNNA 2EV0A 4MQVA 4A0YA 1W4MA 3HRMA 2JTVA 4HX8A 3D0SA 1G3TA 1STZA 4HX4A 2ZXJA 1BI1A 1IN7A 5L3GA 4BYYA 4O5VA 3R0JA 4KNYA 2VE8A 3ZMZA 4HV6A 1QPMA 1G3YA 4KIGA 5HS9A 3HTUA 4WK8F 4CICA 1IN6A 3FWEA 3HUGA 3M8EA 1TQPA 4HF0A 3KEQA 2HQNA 1JHHA 2K7LA 3M1EA 1R58A 3TOBA 5FD5A 1ZGAA 2QQBA 1J75A 3WTXC 2M1BA 4IHTA 2W85A 1MGTA 2ZMEA 2D1HA 3T5XA 1MD0A 2LDUA 3WTVC 4RGSA 3ZN0A 3BP8A 4OIQF 4ZYEA 4RB0A 2DTRA 3PFIA 4A6DA 2KJBA 2L3DA 1J0RA 3P9IA 2LNBA 2FEZA 4GYIA 5ILUA 1V3FA 3ABTA 5FGMA 5HOOA 4DNCA 4LLGF 3KP7A 4RB3C 2DPUA 3KLOA 3VB2A 3KE2A 2E1CA 2A61A 2XIGA 5DCMA 2ZNYA 3F72A 1BOAA 2HQRA 4G6DA 1MDMB 5HDGA 6PAXA 2NNYA 4GGGA 1Z6TA 5FLXK 5E8IA 3MEXA 4M72A 3E6CC 3W6KB 2L01A 1SFEA 4HV5A 2XV4S 2PJPA 1U78A 1R1VA 1TBXA 3I4PA 3TOAA 2OQRA 4MQ9F 5BQTA 2XUBA 3JSPA 3IWFA 1YTYA 4L9NA 2ESNA 1B9MA 2E7XA 3HIFA 4IXAA 2EV6A 2FXAA 3I54A 4EJUA 5H6QA 1H9TA 3WTWC 2OZUA 4GCVA 4KT5C 1JHFA 3CUQC 4KN4X 3V7CA 1KYWA 1L3LA 2QENA 1U5TB 1S7AA 1FSHA 2JPBA 3C3WA 1PUEE 2FU4A 3HTSB 1ZGJA 1K6OA 3MFKA 2O8XA 1B4AA 1F1ZA 4ENJA 5FLXZ 1JXSA 3MQ0A 1ZG1A 4P9UA 4EVIA 3Q9SA 1D5VA 1J5YA 1Y0UA 1J7KA 4PCQA 1EV7A 2OU2A 4F7ZA 3CLOA 4G94A 2OZ6A 3I59A 2FE3A 1U3EM 5K5OA 3ZMVA 4M6XA 1RUNA 3HSFA 2F2EA 4L18B 3TO6A 1YQAA 2M45A 4BHBA 5JI6A 1SD7A 2GXBA 1I1GA 4G9YA 2LF7A 2HYFA 4PGHA 4KA4A 1IF1A 3VODA 5ILVA 5E1ZB 2IA2A 4I09A 3HHGA 3N97A 1LDKB 2P5KA 4IRIA 4U88A 3IKVA 3M8FA 2K27A 2XASA 4P5OA 3F8BA 5JR3A 3RIRA 3MAJA 2IRFG 5D8LB 2C6YA 4FHTA 5LGUA 2JPCA 4OINF 3EUHA 4EGYA 2UXNA 4KMUX 2RC4A 1FWZA 1U5TC 4P9FA 1T6SA 2NYXA 1MDMA 2Q2EA 2ZO4A 3NEUA 3LAPA 1T39A 4HQEA 1R1TA 3ZQ7A 1T38A 4XRFA 4RAYA 2STTA 1HQCA 1XGNA 1LVAA 3MCZA 3K69A 2XROA 3D5LA 1IRFA 2DQLA 1FSEA 2VT3A 3BOQA 4Y17A 3IC7A 5ICFA 2YSRA 2RQPA 3RPQA 1WWXA 4O3MA 4U7DA 1P6RA 2DPDA 5E1WA 5LBQA 4AVPA 2PN6A 1TLHB 1YG2A 3FZVA 4P96A 1BC7C 2CSOA 3FXRA 3KP4A 1FP2A 1ZRDA 3WE2A 2IA0A 2YPRA 3LQRA 4AIKA 4L5JA 1RNLA 1FZPB 1EH8A 2XHKA 3K1PA 4LLLA 1XGOA 3F22A 3HRTA 2HR3A 4JBAA 1UCRA 3E6DA 3J80Z 3J81Z 1FPQA 2WTEA 2XKOA 2UZKA 4TV7A 2D45A 5CJ9A 5KK1A 4EM2A 3WU1B 1W7PA 2NS0A 2NRAC 1ZREA 1HSJA 2DT5A 4N9IA 4WWCA 2QM3A 2GXGA 1WI9A 2FNAA 2HWVA 5DEQA 4RB1A 2O3FA 1ZLKA 4LFUA 4JQFA 4IVNA 2HZTA 1TW2A 5LGNA 1U8RA 1ULYA 4QWQA 3L09A 2AXLA 2K86A 4XLNF 1OPCA 2HFHA 4ETSA 1OKRA 4WXCA 4R8HA 3L7WA 5DDGA 1REPC 5JFRA 2X4HA 3F6VA 5D5WB 2ADUA 2Z99A 4YG2F 1R23A 4FX0A 4LLNA 1PP7U 3U2RA 3H92A 3F23A 3L9FA 2DK5A 2MLKA 3HSRA 3BROA 3U1DA 1BN5A 4KN7X 1RZ4A 4YIIA 5LRRA 3V4GA 2EJRA 1B9NA 1FC3A 4Y13A 3OOPA 1AWCA 1KU9A 2HYGD 2MC3A 3E5QA 1HKTA 2HTJA 2PEXA 4WF2A 3F8NA 3FX3A 1XCVA 3BZ6A 2HS5A 3JW4A 2RV8A 3HSEA 3BPVA 2O61A 1YW7A 3B02A 1XN7A 3WGIA 5LHGA 4NQWA 5ICEA 3N4MA 2QWWA 3JAMK 1O3QA 1HXDA 4Q48A 2X0LA 1R00A 3DPTA 2W57A 1AOYA 4GO1A 2COMA 2FMYA 2OAZA 1R7JA 3HRSA 3WGHA 1SD5A 2Z3YA 4LB5A 4ZYDA 3F3XA 3VOEA 1LNWA 2H09A 1YW9A 4IRHA 3RYRA 4HZFA 2Q0OA 3GEZA 4LMYA 2EB7A 2R3SA 1W5TA 1PP8F 3DP7A 4MHGA 4CYDA 4UVBA 1KU7A 4P55A 1FY7A 1MKMA 2KIMA 3SXYA 1B59A 2EV5A 2QVOA 3EYIA 3WTSC 1P92A 4GXOA 3RKYA 3GW2A 2XRNA 1CGPA 2RGVA 2EA4A 2R7FA 2Z33A 3JAMZ 5HVQC 4GYGA 1O3RA 3TGNA 5DD4A 2KIUA 2QBYB 4WXDA 1FX7A 1TTYA 4A0ZA 1D8JA 1FYLA 2EFPA 2PBIA 2P6SA 1QO0D 2O0YA 3V8JA 1BI3A 1QNTA 3BDDA 1S8NA 1BBYA 1G4DA 2GWRA 3EQLF 1ZARA 3SFZA 3CUQB 4FX4A 3IL2A 3DEUA 4OIPF 3E5UA 4YIFA 1GVJA 4HAMA 2VC0A 2R7DA 2L54A 3I58A 1I1SA 4HYEA 1ZRCA 5HS8A 3AAFA 3GFMA 3T8TA 4CGZA 2HDCA 3E6BA 2ISZA 3KEOA 1LDJA 4RGRA 2VN2A 2JRTA 3GZ5A 4YFXF 1LJ9A 2VODA 4HQMA 4B8XA 4ZYGA 4G8XA 4S04A 2YR2A 5LHHA 2GIVA 3LSTA 3WTUC 2F5CA 1IW7F 4CXFA 3FMQA 2A69F 3I64A 5E20A 4UUVA 2KIFA 2VBYA 1BIAA 5HS7A 5H20A 1Z1DA 4UXNA 1ZLJA 2RDPA 4HLXA 5ICGA 1YS7A 2VOOA 3FHZA 4I2OA 1XCBA 2VBZA 1SFUA 3T8RA 2E7WA 5CYVA 1I6XA 3KZZA 3MZYA 1R36A 1KQ0A 2HKXA 5L3FA 5DCFA 1RI7A 2VC1A 1CF7A 4HW0A 1GHCA 1MJBA 5E18F 1S29A 1HKSA 3CO6C 2XAJA 2ZKZA 4UVAA 3WTTC 2F5FA 2FBKA 3R60A 4Z2YA 1LEBA 3V8KA 4KIBA 3E3VA 3WU0A 3BJOA 5ERIA 2Q8KA 3R6SA 2J5OA 5D8KB 2HOEA 3IKTA 2ZNZA 3B73A 5E1XA 2P6TA 4XSXF 2DW4A 1FBUA 5JVTA 1JGSA 5D6FA 1TNSA 3DV8A 1BIBA 3JTHA 2CGPA 2H27A 2QYOA 1V4RA 3CJNA 1IN5A 4HF2A 3FMRA 3R61A 2HTSA 1JE8A 4LG0B 4XBFA 4I98B 1HKQA 2ELHA 1H0MA 2IA1A 3CUQA 3QRFF 5FD6A 2K4BA 4G7OF 2CWEA 3KETA 2PMHA 1UHWA 2L4MA 5FO5A 2PI0A 4ZH4F 1OYWA 2W84A 2KRFA 1WSUA 5FB2A 1Z7UA 4O6JA 4AWXB 1XGSA 4ESBA 1ZAOA 3WG9A 4G6QA 2DLLA 4LB6B 1GXQA 1FYMA 4MNUA 2GZWA 3V7SA 1HBXG 4LK1F 3DF8A 4I0AA 1U6GA 4CO8A 5IT9K 4QLCU 2FRHA 1WKMA 4KICA 1H9GA 2V6CA 4ESFA 4LK0F 5HLIA 3M7GA 3J80K 3J81K 4ZZDA 3EDPA 2A68F 1SFXA 2W25A 3LWFA 3CO7C 4ZYHA 2V1UA 2FF4A 3ERED 3TQNA 2G7UA 2ZCWA 3BY6A 1C0WA 1IAWA 4M73A 2A07F 1FOKA 2MH9A 1KU2A 2IPQX 3I0TA 1U5TA 3LA2A 5AIPA 3GVAA 1WQ2A 3KP5A 3LQQA 1SD4A 1TQMA 2IT0A 2VXZA 4N9HA 3GWZA 1IXSB 5IT9Z 2ETHA 2EA2A 3Q5FA 1YO5C 5D5VB 5D4SA 4LGWA 2Y75A 4BHPA 4Q47A 3BPXA 1Z91A 2RNJA 2EK5A 3GYHX 1J59A 3ABUA 1BI0A 2DQRA 2FBHA 2MD5A 2O03A 4LG0A 2VBXA 1E17A 2WC2A 3QP6A 1W5SA 1XD7A 2H6BA 5D6EA 3R0AA 2M5WA 2E1NA 4ON0A 3QU6A 1XMAA 4PDKA 5K1YA 3GXOA 1PDNC 3KCCA 3FMSA 2K4JA 4LJZF 3R4KA 4K2EA 3O6BB 4H0EA 2M30A 3GF2A 1P4AA 3H3ZA 2BBYA 3QAHA 2A3SA 1QQIA 4MGRA 3RPUA 5CVIA 4BAYA 3ROUA 1ON2A 1K79A 4DQ2A 3LAJA 4BHCA 4L0ZB 2HEOA 5LEKA 5HDNA 3K9TA 4PZJA 2ISYA 5BS6A 4HDUA 4Q5SF 4KFCA 2J5PA 3ELKA 2LF8A 1L0OC 1T0FA 4XLPF 1USSA 2OQGA 1F4KA 2IVMA 4Y15A 4UVCA 4R1HA 3GX4X 1IZ1A 3SZPA 4A2UA 3C7JA 2QZ8A 4OIOF 2MA3A 3CUOA 4IHSA 3BWGA 1XSVA 5BMZA 3WE3A 5CLSA 1HW1A 3S2WA 1USTA 5LEJA 2XKPA 3C1DA 1ZG3A 4IJAA 2P8TA 1EH6A 2NNNA 5LHIA 1G3WA 1OYYA 4EV0A 3DXJF 3C18A 1BI2A 3ECHA 2VT2A 4M9ZA 3PQKA 2NAZA 2BV6A 3ZN1A 2M8EA 2D2WA 3DQVC 1J9IA 2XGXA 2QQ9A 1G6NA 3OV8A 5ICCA 3J7AO 3VEPA 1KQ9A 1QZYA 3F8FA 1IN4A 4EJVA 2XAQA 2PMUA 2FMLA 4RB2C 4EJTA 3ML6A 1S6LA 2M87A 1R1UA 3KP2A 3IRRA 4HDVA 5F1RA 1SMYF 4M9SA 3ZMTA 3F21A 2O6GE 1O3SA 3EETA 2DU9A 3HRUA 4HBLA 1KA8A 1XDSA 3GFJA 1B6AA 4CZZA 4EJOA 5K5QA 2BE5F 4HF1A 1ODDA 2BEOA 1DPUA 2ZFWA 4MEXF 5ED4A 3FXQA 5L3DA 5ILSA 4M6YA 1HW2A 3O3KA 4IPAA 3RDIA 4A12A 3DKWA 3GO5A 4AD9A 3QP5A 1P4XA 5DYMA 1D8KA 4LD5A 2UWMA 2AS5F 2F5EA 3LFKA 2PG4A 5F6FA 3DPLC 2MBFA 3BJAA 5EEGA 1NHAA 2IW5A 2CQKA 3KZYA 1FP1D 2XVCA 3GUDA 2GQQA 3I59B 1Z05A 4L9VA 3DFGA 1LEAA 4ZZLA 5E17F 4HLYA 3FXUA 2FNPA 3IRQA 2DI3A 5AONA 4OU0A 1YLFA 3VFZA 3WTZA 2GA1A 4EGZA 2P4WA 5L3CA 2G9WA 1K78B 2OD5A 5H6RA 3FM5A 4ENKA 2JSCA 4EM0B 3RI4A 3E6MA 4A5MA 1FLIA 1Z6RA 3P9CA 1SMTA 4MEYF 5LGTA 4HX7A 4RS8A 4ESJA 3HHHA 5BPIA 2YU3A 1S3JA 2MLGA 3HOTA 4OIRF 1ZRFA 3LA7A 3NRVA 3E5XA 4UV9A 3ZMUA 3ISPA 1G3SA 3GZ6A 1J2XA 3TO7A 3P7NA 1ZHFA 5DUIA 3IWZA 5CVJA 5TJJA 4XSZF 1O7FA 1KGSA 1QZZA 4OOIA 4UHTA 1K7AA 5L3BA 4L0YB 2V1DA 2P5VA 4L5IA 3REOA 2CYYA 5HLHA 4IRGA 2XAFA 2ZJ2A 3I71A 1TNTA 4N0BA 2A5YB 1DPRA 3F8MA 4JK1X 2Y0MA 3RKXA 1ZN2A 1MJ9A 2PQ8A 4NHJA 5BOXA 2P7VB 2IP2A 2OBPA 1BM9A 1EH7A 2V1XA 4RGUA 5CVRA 2OA4A 4OMZA 3TDZC 2IJLA 2QBYA 1XMKA 1UHMA 3ECOA 3ZMDA 5L3EA 3KP3A 2FBIA 5IT3A 5JHUA 2WWYA 3ZMSA 4I7HA 1Z9CA 2A6HF 5EEHA 3RKWA 1P2FA 3COAC 2DFIA 4UV8A 2RVCA 3T0YA 1T98A 4A6EA 5F64A 1ON1A 2TDXA 4EM1A 4NB5A 2VBWA 4U0YA 5CVVA 2B0LA 4ENNA 1OYIA 1RIOH 3KLNA 3RTRA 2KJCA 5D4RA 3E97A 1W7PB 1XSXA 3NQOA 1U2WA 1ZYRF 3L2CA 3M9AA 1B1BA 1MZBA 2LSOA 1KQ8A 4BQAA 4MTDA 2KKOA 4YFKF 5CVUA 4KMFA 1KYZA 2G7HA 5J8CA 2CW0F 4KYWA 2UXXA 2RKHA 1IN8A 2P5LC 3KFWX 1W7PD 4OMYA 3FF5A 2MH2A 5HDKA 2HGCA 3GFLA 2ACJA 1F9NA 1K78A 2V79A 4G7ZF 4EMSA 1XB4A 3TDUC 1TW3A 3W6JB 2JT1A 4HOBA 2F5DA 4BH9A 1FBQA 3V8LA 3U9GA 5DD8A 5J8FA 4I01A 1X3UA 1YIOA
chains in the Genus database with same CATH superfamily
2K9MA 2QQAA 1P4WA 1R22A 2R4GA 3HGYA 3HGGA 1RC9A 3OOUA 1LQ1A 4HA8A 1K4SA 1IXCA 1R71A 3BQZA 4F3QA 5A2QK 3ZPLA 1R5ID 2CU7A 2X9DA 4RDUA 4CHUA 2LD5A 4ENMA 1IUYA 1Z21A 3A1YA 3CDHA 1SVLA 3PQJA 2V9VA 2VASA 1ZG5A 1X1BA 5DS9A 3PFYA 1XG1A 1R5HA 1Q1HA 2EFNA 5EJCA 3F8CA 3LSRA 1BR2A 1A04A 1LDDA 3FM3A 3QU3A 4S05A 4AIHA 2EFOA 5K5RA 2YX4A 3G6EI 2PLYA 2FSWA 1VTNC 1HC8A 4UNOA 4D1QA 4PJ0C 3HOSA 4FETA 3TKYA 4G7HF 2HZDA 1ETVA 2TRTA 2D1VA 1ZH5A 2OCEA 1G59A 1TQIA 3KP6A 3I5UA 3UNGC 3H5AA 2Y48A 4RGXA 3L2VA 4L9JA 3S2HJ 4PGGA 1ZK8A 4EJWA 2BY0A 2EFQA 5HLGA 2XAHA 1YW8A 4I02A 3BJ6A 3K7AJ 2K02A 1DP7P 1SAXA 3IHUA 2GA2A 2MD0A 1NG7A 3G3ZA 1G2HA 3OIPA 2DA1A 1HW5A 1SVMA 2ESHA 2PFBA 3MZHA 1O7LA 3LA3A 3P9KA 3TBIA 1KU3A 3TW7A 5EEAA 3L1PA 2HPIA 1FBSA 1WJFA 4JX6A 1LB2A 1F5TA 5GPCA 4YFNF 1I50J 5FFXA 4BBSJ 3MWMA 1T33A 2CFOA 4DYCA 3HOUJ 3QPHA 4BNCA 4UUSB 2L4AA 1UB9A 3S1NJ 1QVTA 2DO7A 1FOYA 5A2QZ 4A3KJ 1O3TA 1I27A 1U8BA 3DWLE 1O4XA 1YS6A 5GPAA 5E3OA 1VZ0A 1IC8A 5DV5A 1XDUA 2DMQA 4M3FA 1R9TJ 3BG7A 1D0ZA 3TO9A 1FEXA 2Z5UA 4BQQA 2BY2A 3F6OA 5J47A 1MH4A 4B1RA 2VONA 2BYVE 4AIDA 1OMIA 4I0BA 2IGMA 5TISC 3WG7H 4WXHA 3BQYA 2EFWA 3S8PA 3EYYA 2WV0A 1T2KA 2A6EF 4W97A 5KVRA 1I6HJ 2NVQJ 3CZ6A 4XONA 2ZSHB 4EQQA 1HLVA 5DUKA 1DDNA 2YX7A 1ONVA 3K0LA 2CG4A 1MIJA 3CDLA 5C4JJ 5E8GA 2JZYA 3S1RJ 2F4IA 1SD6A 5BPDA 1AA7A 3LSKA 1ETXA 4ASNA 1OR7A 4XRMA 1YE9A 1I5ZA 4MO7A 2O7OA 3J7YJ 1A6IA 3O2PE 2CFXA 2OTJI 4M3GA 2L5QA 1B8IB 1TP4A 2XAUA 2V26A 3QPTA 4E70A 3LSHA 4NDLA 1QGPA 3RJPA 1WJEA 1PYVA 3E7LA 1X1PA 5FKLA 1HSTA 5LLQA 1JUSA 1QU3A 4A0XA 2NOJB 2ZJQF 1MMAA 3HUGB 2EIKH 1JT0A 3ZQHA 4MTEA 2GAUA 2ZXHA 2MC4A 3U1KA 3HBLA 3WODF 3CMAI 1DUXC 3OR2C 1W1WE 3H3UA 1YYVA 2Z2SB 1BC8C 3I53A 1XX5A 4IHWA 3S93A 4A5NA 3A01B 4BJ6C 2DBBA 3TP3A 2EILH 5M5XJ 1RR7A 2ID6A 2L9RA 3BCAA 4BXUA 2HKOA 4FT8A 4A3BJ 2N8GA 2ZMEB 3V42A 3K4KA 5GAEJ 4G12A 3JSOA 3K1NA 2CJJA 3GZNB 3GLLA 3WGGA 2VE9A 3GFIA 2L02A 3ABLH 3F9KA 4L9TA 3L00A 2NS8A 3D1NI 3N05A 4Q4ZF 2XAGA 2KL4A 3HYIA 3HOVJ 2H94A 3CCMI 2W24A 2RN7A 4RLFA 3TW6A 2F6CA 5D5XB 3V7RA 5EDNA 5TRDA 2BGCA 1D0YA 3OSFA 3GTLJ 3CTAA 4CDGA 2STWA 4M71A 3S1MJ 3RYPA 3BR5A 2E19A 3GLXA 2DFHA 1WJBA 3G73A 4I99C 3VDXA 3GTOJ 2CO5A 3TL4X 1UELB 3BCBA 3SQNA 1R5GA 1XGMA 4C3JJ 5J6XA 1QBJA 2L0KA 4M3BA 2V9KA 1FT9A 2FQ3A 3I56I 2VOPA 2KZGA 1IRGA 1IXRC 3C2GA 4DYRA 4IF4A 2VJ5A 2DFEA 2DODA 2M7BA 2Z1DA 5FLVA 3CMEI 3T1BA 1TWCJ 3BR2A 4II3A 1O57A 3FK7A 1UFMA 4WX9A 1FYKA 5D5UB 2Z9OA 1HOMA 5E3MA 1E2XA 5DCMB 2DYRH 4M9XA 3WTYC 3SZTA 3DU5A 4U7BA 2QLZA 1IDYA 2ICWG 2EWNA 4DZPA 5H2FC 2QUFA 2DAOA 3K1MA 1WVRA 2I5UA 4M74A 4D0PA 4HNUA 2H6CA 2COBA 2FOKA 5CQGA 1J09A 4KIFA 3SHFA 3QOPA 2KMUA 2WA0A 4R79A 4B09A 2W48A 3I4MJ 4DBQA 1S7OA 4U0VA 1BJAA 1F36A 3JTGA 3TMOA 2F5VA 3ZQQA 2LKPA 3GTGJ 2E1MC 1GXPA 3WHBA 4WCGA 4RAZA 4ZTFA 2CUZA 2FA5A 2ZBKA 1RUOA 3HKZA 5AIQA 1XSDA 2KHMA 4F93B 3ULQB 5KHDA 2P7CB 3Q9VA 3K2ZA 2DK8A 2K3FA 4ZDOA 1N25A 5K7ZA 1CF7B 5CKTA 1OQYA 1VF9A 4KDPA 4XRSG 1UHSA 2HU9A 5J1YA 3HOWJ 3OS1A 1WRJA 2RNGA 1YFHA 4U0WA 3FXJA 1D3YA 1MJAA 2R7VA 4KUMA 1ETYA 3FISA 3ZP5A 4MFDA 2MG4A 4XNFA 3H5RA 3K2AA 2F4MB 3BT9A 5FFZA 5LRSA 3DBRB 4AIJA 1U9OA 5IY5H 1FNNA 1W5CC 4CZCA 2EV0A 1JGGA 3RKQA 4N4OB 4MQVA 4A0YA 2KQRA 4A3FJ 1VNDA 1W4MA 3IUOA 3HRMA 4EATA 2JTVA 3H0GJ 4B43A 2JQ7A 1ETOA 2GM4A 2R7XA 4HX8A 3D0SA 5IYCJ 1G3TA 1STZA 3OS0A 2VI6A 4HX4A 2ECCA 2ZXJA 1BI1A 1IN7A 5L3GA 3PJRA 4BYYA 4O5VA 3C2HA 2DOFA 2JA7J 3ASNH 3R0JA 4KNYA 2VE8A 2LLKA 2E71A 4DIQA 3ZMZA 4HV6A 1QPMA 1S5LC 1G3YA 4KIGA 5HS9A 3HTUA 4WK8F 1S72I 2VJJA 1HA8A 2DXIA 4CICA 2JA5J 2NOGA 1IN6A 2CQQA 3FWEA 3HUGA 3M8EA 2NVXJ 1TQPA 4HF0A 3KEQA 2HQNA 3ESWB 1JHHA 3QYBA 2CUFA 2VPLA 2K7LA 1ZKGA 3M1EA 1R58A 3TOBA 3A01A 3FDYA 5FD5A 1ZGAA 2R5YA 1N78A 4RAGA 2QQBA 1J75A 3WTXC 2M1BA 4IHTA 2W85A 1MGTA 2ZMEA 1SC7A 1KONA 2D1HA 3T5XA 1MD0A 2LDUA 3J7ZI 2K40A 3WTVC 4B44A 3HDDA 2B63J 2MSYA 4RGSA 3BP8A 3ZN0A 4OIQF 3S17J 4ZYEA 3OYNA 4RB0A 3LSJA 3ZQCA 3K70C 2DTRA 3MVPA 2PMZN 2DA2A 1VQ7I 3PFIA 3FIWA 2M4KA 1B72B 2V9PA 4A6DA 2KJBA 2L3DA 1J0RA 3P9IA 3W2AA 2BXZA 2LNBA 2FEZA 4GYIA 5ILUA 1V3FA 2JVGA 3ABTA 5FGMA 5HOOA 1PJRA 2KDOA 4DNCA 1YX5A 4LLGF 1WCMJ 3VSLA 3KP7A 2RQQA 3FKJA 2BY1A 4RB3C 2DPUA 4AUXA 3KLOA 1MBHA 3VB2A 3O8GA 3KE2A 2IXSA 2E1CA 2A61A 2L7KA 2XIGA 5DCMA 2F48A 1Z77A 2YU9J 2ZNYA 5J1RA 4N4NB 2IS6A 3F72A 3CDIA 3HEFA 4XL9A 1BOAA 2V1NA 2HQRA 2HQ5A 4G6DA 3GMEA 2LRDA 1MDMB 2Q2EB 5HDGA 6PAXA 2NNYA 2G0EA 2BXYA 4GGGA 1Z6TA 5FLXK 5E8IA 3MEXA 2LKXA 4M72A 2KPMA 4IKFA 4QTRA 3E6CC 3W6KB 2ZSIB 5M3FJ 2L01A 4HNVA 2HVSA 3I55I 1XTAA 4XK4A 2FUG2 2NVYJ 1SFEA 4HV5A 2OPTA 2XV4S 3FXOA 2R7SA 2PJPA 1U78A 4H4KC 1R1VA 1TBXA 1YX3A 4V2GA 2GLOA 3I4PA 3TOAA 1I39A 2OQRA 3BR3A 3Q3SA 4KT6A 4MQ9F 5BQTA 2BOLA 2XUBA 1RESA 1Y56A 3IWFA 3JSPA 1YTYA 2JMWA 4L9NA 4YIRX 2LY2A 2QSFX 2ESNA 1A31A 1RPWA 3MMYB 1MBFA 2EINH 1B9MA 2VUMJ 1IG7A 1BR1A 1XPXA 2E7XA 3HIFA 4IXAA 3QQAA 2EV6A 2FXAA 2EBIA 3I54A 4EJUA 5H6QA 2XGEA 1H9TA 3WTWC 2OZUA 4GCVA 4KT5C 1JHFA 3CUQC 1NG6A 2UV1A 4KN4X 1LKXA 3V7CA 3LFUA 1KYWA 1L3LA 3CMYA 2QENA 2P0WA 4M3DA 1U5TB 3GTJJ 1S7AA 5M5YJ 1FSHA 2JPBA 4X6AJ 3C2BA 1Z7LA 3C3WA 2FD5A 2A05A 1PUEE 3QYFA 2FU4A 3HTSB 1ZGJA 1K6OA 2CW7A 2PMZA 3MFKA 1H8AC 2O8XA 2QSHX 3CCUI 1OLTA 2WADA 4X0GA 1B4AA 1F1ZA 5C3EJ 4ENJA 1MBJA 5FLXZ 1JXSA 2WV1A 5FLMJ 2ELKA 1GUUA 4Y7NJ 3MQ0A 1ZG1A 4P9UA 4EVIA 3Q9SA 4JP0A 4Y3OA 4AU7A 1D5VA 1J5YA 2IBDA 1Y0UA 1J7KA 1VQPI 1XC5A 4PCQA 1A35A 3OYHA 3CCVI 1EV7A 3GTPJ 4CSWA 3GTQJ 1WJCA 2IGKA 2OU2A 1EKEA 4BJ5C 1X1CA 2EPFA 1YJNI 2DA5A 4ZJZA 3PIPF 3SEQA 4F7ZA 3CLOA 4AYBA 4NC7A 4G94A 2OZ6A 3I59A 5IP7J 2RAEA 2FE3A 1U3EM 5K5OA 3ZMVA 2Z16A 1X4OA 4M6XA 1T95A 1RUNA 3HSFA 3B6CA 2F2EA 3G1LA 2K9NA 3JRFA 1JUMA 4L18B 1IV8A 3TO6A 3H9GA 5JHFA 1YQAA 2MW8A 2M45A 5C44J 2CQXA 3BTJA 4BHBA 5JI6A 2DMTA 3RQ4A 1Z0XA 1SD7A 2GXBA 5J40A 1QHGA 1I1GA 4IL6C 4G9YA 2E36A 2LF7A 4BS9A 3OL4A 2HYFA 4PGHA 2DYSH 4KA4A 1IF1A 3L2UA 3VODA 5ILVA 5E1ZB 2IA2A 4I09A 4BEHB 4E4HA 3L2RA 2OUMA 3HHGA 3FXLA 3N97A 1LDKB 2P5KA 4IRIA 3ZR8X 4U88A 3IKVA 2PJRA 1RETA 2W00A 3JCUC 3PUFA 5B5EC 3M8FA 2DOAA 2K27A 2XASA 4NC8A 3MN2A 4P5OA 4BL0B 4BY7J 3F8BA 2O9LA 5JR3A 1V5GA 4PJJA 3QOEA 4L5EA 3RIRA 3MAJA 2IRFG 5D8LB 3HOXJ 2C6YA 4FHTA 1UAAA 5LGUA 2JPCA 4OINF 3EUHA 4EGYA 2UXNA 1PUFB 4KMUX 1D0XA 2RC4A 1FWZA 1U5TC 2CRGA 4P9FA 4UUTA 1IDZA 1T6SA 2NYXA 2L7ZA 1ERDA 1MDMA 2Q2EA 2ZO4A 1AKHB 2VXDA 3RPUD 3NEUA 3ZGKA 1HCRA 5EGOB 3LAPA 3MKYB 1T39A 4HQEA 2DOEA 2LFBA 1FIPA 2QEXI 1R1TA 3ZQ7A 4I76A 1T38A 4XRFA 4RAYA 2STTA 1HQCA 3DKYA 1XGNA 1LVAA 2O5RA 3MCZA 5GTIC 3G1MA 5B66C 1UZCA 1T8IA 1P7IA 3NWSA 3K69A 2XROA 2EIMH 3D5LA 1IRFA 4FCYA 2DQLA 1OCZH 1FSEA 2VT3A 5HODA 4C9YA 3BOQA 4Y17A 4XICA 3IC7A 2IGOA 4CCLA 5ICFA 2YSRA 2RQPA 5F04A 3RPQA 2WAEA 1WWXA 2XGDA 4E7KA 4O3MA 4U7DA 1LFUP 1IUFA 4AM3A 1P6RA 2EZLA 2X1EA 2DPDA 5DTDA 1R4MB 3HOYJ 5E1WA 1DGRM 1TL8A 1EF4A 5LBQA 4AVPA 2PN6A 3JRDA 4NQWB 1TLHB 1YG2A 3FZVA 4P96A 4DOZA 2CSOA 3FXRA 3KP4A 1BC7C 4RMNA 1FP2A 1ZRDA 3W3CA 2OJED 1WJ5A 4PK4A 3WE2A 3M3YJ 2IA0A 2YPRA 3BG3A 3LQRA 4AIKA 4L5JA 2R7OA 1RNLA 1FZPB 4DGWB 1EH8A 2DCEA 4XN0A 2B9SA 2XHKA 2XC7A 5HNFA 1JI8A 2LR8A 1GT0C 1MMGA 2M0MA 2CQNA 2QKMB 4XKBA 3K1PA 2K9QA 1FMVA 5B1AH 3CCSI 4ZC3A 2LY1A 5KNLA 4A3DJ 4PFOA 4LLLA 5JLXA 1XGOA 3F22A 3HRTA 4QSHA 2HR3A 3K4JA 4KITB 3G71I 3ZQLA 1MNEA 2R0QC 2XPVA 3D5RC 2LMDA 2L2OA 3Q0VA 4JBAA 2QGUA 1UCRA 3VSKA 3E6DA 3J80Z 3SFIA 3J81Z 1FPQA 1W36C 3CQZJ 4Z6YA 2WTEA 2XKOA 1PVEA 2UZKA 3JRGA 5B1BH 4TV7A 4ABZA 2D45A 3B6AA 5CJ9A 4ZYAA 5KK1A 4J01A 4EM2A 3WU1B 3G1OA 1W7PA 2NS0A 2X6OA 3E0JB 5IYDJ 4IEJA 2NRAC 2L9NA 3S14J 1H89C 1HSJA 1ZREA 2DT5A 4N9IA 4A3MJ 4WWCA 3H36A 2E1MB 2DT7B 3CESA 2QM3A 4ZDLA 3HKZN 2GXGA 3TP0A 1WI9A 2FNAA 2HWVA 1MNMC 1WJAA 2WB1N 1T0FC 3FHNA 5DEQA 2O3FA 4RB1A 1ZLKA 4LFUA 1ENHA 4JQFA 3BR1A 4ITVA 1SEUA 2XPUA 1OCOH 4IVNA 2HZTA 5C4XJ 3GTMJ 1TW2A 5LGNA 3CD6I 1SVOA 2MFZA 1ULYA 3SZGA 1U8RA 3PO3J 1X3WB 1Y0NA 4QWQA 4CH7A 2HOAA 4BKXA 3OYFA 2AO9A 3L09A 2AXLA 2K86A 4QPOA 4BEHA 4XLNF 2XGCA 1OPCA 3M1CA 2HFHA 4ETSA 4DBRA 4J19A 1OKRA 4WXCA 2DMUA 4R8HA 3L7WA 4BACA 4GRIA 5DDGA 1REPC 4E7HA 5JFRA 2W7NA 2XF7A 2UUZA 3HPGA 3OMYA 2IS2A 1IO2A 2X4HA 3W2VA 3F6VA 5D5WB 4U87A 3ZQIA 2ADUA 2Z99A 4YG2F 2R92J 1R23A 4FX0A 4LLNA 1PP7U 1X1DA 4YELA 4BQNA 3U2RA 4HEA2 5DM7F 3OYGA 5KCMA 3H92A 3F23A 2X6YA 3L9FA 4FTHA 3HOZJ 1D1AA 2DK5A 4BUPA 2MLKA 3HSRA 9ANTA 3BROA 1VI0A 3AL0B 3U1DA 1BN5A 4KN7X 1SFKA 1AHDP 3PSFA 4S0HB 1RZ4A 4YIIA 2DN0A 4OWRB 5LRRA 3V4GA 3OYKA 1X58A 2EJRA 4XKCA 5EGOA 3S3NA 1DP3A 1TWFJ 1B9NA 1FC3A 3OYLA 5GP9A 4Y13A 1DU6A 3OOPA 1AWCA 1RKTA 1KU9A 2HYGD 4XN3A 4BBRJ 2MC3A 3E5QA 3A03A 1HKTA 1XMXA 2HTJA 2PEXA 3KEYA 2BY3A 3FX3A 3F8NA 4WF2A 3AG4H 1XCVA 3BZ6A 2HS5A 2A5WA 3JW4A 1ETWA 2RV8A 1HDPA 3SDBA 3HSEA 2VJIA 3BPVA 4RBOA 2O61A 1YW7A 3VYTB 4IOAF 1OCTC 3B02A 4DJAA 1XN7A 1Q1VA 3WGIA 5LHGA 2VKDA 4NQWA 5ICEA 2LG4A 3N4MA 2QWWA 2HDWA 3JAMK 4B3AA 2K3PA 3M8JA 1O3QA 1HXDA 2VKHA 4D7MA 4Q48A 2MABA 3PNYA 2X0LA 3AFHA 1R00A 3DPTA 2W57A 3SJMA 3G2BA 2WB1A 1RKWA 3TEDA 3VYRB 1LE8B 1AOYA 4GO1A 1K83J 2KZVA 2COMA 2FMYA 4UUSA 5EZGA 1WH5A 2OAZA 1R7JA 3HRSA 3LSMA 1Y8QB 3S3OA 3WGHA 1YJ9I 1SD5A 3ABKH 1JTXA 1YI2I 2DFFA 4XLHA 2Z3YA 3CJQB 2R7QA 2WAQA 4LB5A 4ZYDA 3F3XA 5FRNA 3VOEA 1F43A 5FKMA 4XOPA 3BLYA 1LNWA 3K70D 2OTLI 2H09A 2ZXIA 1OCRH 3S1QJ 1Y1WJ 4NUBA 2VLAA 1YW9A 4IRHA 3RYRA 2YUSA 4HZFA 2Q0OA 3GEZA 3LSGA 4LMYA 4FQGA 2EB7A 2R3SA 1X1AA 1W5TA 4PUSA 1MBGA 3BR6A 1PP8F 1POGA 3DP7A 3RQIA 3H0DA 4MHGA 4CYDA 1I3QJ 2E5NA 4UVBA 3SYTA 4BQOA 1KU7A 3OSGA 3AL0C 4P55A 1FY7A 1MKMA 2KIMA 3SXYA 2D5VA 1B59A 2E35A 2EV5A 3CC7I 2QVOA 1BW5A 3EYIA 2H1KA 3WTSC 3CCEI 3CCQI 1P92A 1VQKI 1BL0A 1B8IA 3X2QH 2I8DA 4GXOA 3RKYA 3GW2A 2XRNA 4JOMA 1CGPA 2RGVA 2HYJA 2QQ8A 1VQNI 2EA4A 2R7FA 5F08A 3CJTB 1JKQC 1GV5A 2V6EA 2Z33A 2GXAA 2ZJPF 3JAMZ 5HVQC 4GYGA 4XMYA 1MW7A 1O3RA 3TGNA 2EZKA 5DD4A 2KIUA 2QBYB 3K4BA 4WXDA 2KRCA 1FX7A 2XRLA 4AC0A 3E1SA 4FASD 2KIQA 1TTYA 3L2WA 1YRNB 4A0ZA 3H9JA 1D8JA 1FYLA 1SFOJ 2EFPA 2PBIA 2P6SA 2CW8A 2H1LA 1QO0D 2O0YA 5EZHA 3V8JA 2CUEA 4UY8I 2VL8A 4A3GJ 1BI3A 2Q1ZB 1QNTA 3BDDA 2DT6A 1U9NA 2LY9A 2LH9A 1S8NA 1BBYA 1G4DA 2GWRA 3EQLF 1ZARA 3SFZA 3CUQB 1Y8RB 5E3LA 4FX4A 2BHYA 3IL2A 3DEUA 4OIPF 3E5UA 4YIFA 1GVJA 1X19A 4HAMA 5E79C 2VC0A 3DCFA 2R7DA 2L54A 3ZCOA 4CA0A 3I58A 1I1SA 4F52A 5F0CA 4HYEA 5TGTA 1ZRCA 1LFPA 3OWTA 5HS8A 3AAFA 3GFMA 3T8TA 4CGZA 2HDCA 3E6BA 2ISZA 1OFCX 1RRJA 2CH0A 5K7FA 4DYQA 3KEOA 1LDJA 3SDGA 4RGRA 2VN2A 2JRTA 3GZ5A 1WPKA 4YFXF 1LJ9A 2VODA 4HQMA 2JWTA 4A3CJ 4B8XA 1TC3C 1ZELA 4JX4A 1S7EA 4ZYGA 5J4VA 3I3LA 3ZOBA 4G8XA 4S04A 2KT0A 2YR2A 2QKLB 5LHHA 2GIVA 3LSTA 3WTUC 2CV1A 2NVTJ 2F5CA 4PFPA 1JT6A 1IW7F 1A5JA 4CXFA 1ETKA 3QPSA 3FMQA 2A69F 3I64A 5E20A 4M3EA 3CMMA 4AYBN 2WBMA 4UUVA 3IAM2 2KIFA 2EZIA 2VBYA 2JA6J 1BIAA 1MBKA 5HS7A 4Y33A 2HPMA 2EZHA 5H20A 1Z1DA 4UXNA 1ZLJA 4BJTA 2RDPA 3BZCA 1T56A 4HLXA 3H5NA 5ICGA 2M34A 1YS7A 1YOVB 2DA6A 2VOOA 3FHZA 4I2OA 2GIZA 1XCBA 3PM1A 2VBZA 1SFUA 4D9JA 3T8RA 2E7WA 5CYVA 3OIQA 3IV5A 1I6XA 1MH3A 3KZZA 1FTTA 1OCPA 2LREA 3DLAA 3K4NA 1SAUA 3MZYA 4BE1A 1R36A 1LE8A 1KQ0A 2HKXA 3OS2A 4C2UA 2M7AA 4MIMA 5L3FA 2Y9YA 1LVKA 1VQ9I 1DGWY 3K6GA 5DCFA 4GDFA 2ME0A 5IOYA 1RI7A 3Q0UA 2VC1A 2AXTC 1CF7A 4HW0A 3BC8A 1T08B 1GHCA 5KAIC 1MJBA 1TT0A 3I9V2 4XLEA 5E18F 1V5EA 1S29A 1HKSA 3CO6C 3KYDB 2XAJA 3ASOH 2ZKZA 4MFEA 1LPQA 1JKPC 4UVAA 1QPIA 3WTTC 2F5FA 2M8GX 1ZQ3P 1P7JA 3LOCA 2FBKA 3FK6A 3R60A 4Z2YA 2ZB9A 4IX7A 3V8KA 1LEBA 4CCKA 4KIBA 5LFAA 3E3VA 3CP2A 4HPQA 2DDBA 1IRZA 2VQLA 2L9SA 4FE7A 5HNHA 4A93J 3DU6A 3WU0A 2JA2A 3BJOA 5ERIA 5EG0B 1QHHD 2E34A 2Q8KA 3R6SA 2J5OA 2E2HJ 5D8KB 2HOEA 3IKTA 3HB9A 2ZNZA 4IQ4A 1X2NA 3PSIA 2HOTA 3B73A 5E1XA 3RZDJ 4AVZA 2P6TA 3ZXSA 4XSXF 2DW4A 1FBUA 5JVTA 2JN6A 1JGSA 3A02A 5D6FA 1TNSA 3DV8A 1BIBA 3JTHA 1E3OC 2CGPA 2H27A 2QYOA 2XPWA 1V4RA 1FTZA 4OAYA 3CJNA 4LOCA 1IN5A 4HF2A 3FMRA 3R61A 2HTSA 1JE8A 2FX0A 5IP6A 3CC4I 1MMNA 4LG0B 1UMQA 1IV6A 4XBFA 3JR9A 4I98B 1HKQA 4ANJA 5FKOA 2ELHA 1H0MA 1LFBA 2R5ZB 1ETQA 2JSPA 2R7RA 2IA1A 2NXNB 2JRMA 3CUQA 3OL3A 3QRFF 5FD6A 1UG2A 2DA7A 4E6KG 2K4BA 4G7OF 2CWEA 3KETA 2PMHA 1D1CA 3K10A 1UHWA 2L4MA 5FO5A 2PI0A 1V55H 2PX9A 4RA2A 4ZH4F 2R7UA 3BTCA 1OYWA 2W84A 2KRFA 1WSUA 5FB2A 1S9HA 1Z7UA 4O6JA 1HF0A 3VPRA 3ZQFA 3CF5F 4AWXB 1XGSA 4ESBA 1IGNA 2JUCA 1B72A 1ZAOA 3WG9A 4G6QA 1FMWA 2DLLA 1R4NB 2ZC2A 3OYJA 4LB6B 2GBYA 1GXQA 2VPRA 4KISA 2BVMA 1DQUA 1EJ9A 3DEEA 3F0CA 2X85A 4MNUA 1ZR4A 2GZWA 1FYMA 3HZJA 3V7SA 1HBXG 3Q0WA 3PUBA 1YITI 4PJMA 4LK1F 3PNTA 2V4JC 3DF8A 4CUGA 1Z67A 2E2JJ 4LG3A 4B3XA 5JLWA 2R93J 3BG6A 4I0AA 2HXIA 1U6GA 4ZDPA 1QZEA 2E5ZA 4CO8A 3PIOF 3J7AY 2ELJA 5IT9K 1LUJB 3PNVA 3MKLA 4QLCU 1NH3A 2FRHA 3M07A 1BA5A 1WKMA 4MLOA 1VQMI 3LNQA 4KICA 5GTHC 1H9GA 1TT5B 3S16J 3K4CA 3H1CA 2FJ1A 2V6CA 1W36D 5F0FA 2X1DA 1X3ZB 4ESFA 1BJZA 5F0HA 4LK0F 5HLIA 2M4GA 2ZJRF 3M7GA 4W1UA 3H35A 5IP9J 2TCTA 5CQEA 4F92B 3J80K 3J81K 4PSXA 3ZQGA 4ZZDA 3CP8A 3EDPA 3LSPA 2A68F 4CYCB 1SFXA 2W25A 3LWFA 3KYCB 3CO7C 4UB6C 5FKNA 4ZYHA 2V1UA 2FF4A 3ERED 2QCOA 3TQNA 2G7UA 2ZCWA 3CCJI 3BY6A 4X1EA 2W1OA 1C0WA 3VWBA 2OV7A 1IAWA 3IH3A 4M73A 3HM5A 2A07F 2M0CA 1N75A 1BOBA 4DZJA 2MH9A 4XKWA 3S3MA 1NK2P 1FOKA 2CV0A 1WHUA 1KU2A 1IJWC 2IPQX 2VQHA 3BTIA 1E3HA 2KP6A 2KRHA 2WAFA 1E0EA 3I0TA 3MZ8A 2K85A 1U5TA 3LA2A 5FRMA 3K4LA 4A3IJ 5AIPA 3GVAA 4C30A 4E7ZA 1WQ2A 2RREA 3ABMH 3WU2C 2LC2A 5EG0A 3KP5A 3LQQA 1EA3A 1SD4A 1TQMA 2IT0A 1OR7C 2VXZA 4N9HA 3GWZA 1IXSB 5IT9Z 2ETHA 2EA2A 3Q5FA 1YO5C 2M3AA 2VQGA 5D5VB 5D4SA 4BDZA 3DBLB 4LGWA 2DTZA 4XLCA 2Y75A 4BHPA 3AKZA 1ACIA 3DTEA 4Q47A 3DKXA 1MSFC 2NS7A 1WZ2A 2YS9A 3BPXA 4NC6A 1Z91A 1V5FA 4GFBA 4IHXA 3OYEA 2RNJA 2EK5A 1APLC 3GYHX 1J59A 3ABUA 1BI0A 2DQRA 1E3PA 4HSRA 4J00A 5B3SH 2V7FA 2JA8J 3P5JA 2FBHA 2MD5A 2O03A 4LG0A 3QPLA 2LK2A 2X51A 2VBXA 4PSWA 3KYLA 1E17A 3CCRI 2WC2A 2XF5A 5EYRA 4RLQA 2R5ZA 2R7ZJ 3QP6A 4PJLA 2KISA 1W5SA 1XD7A 2H6BA 5D6EA 1VFCA 5LD2C 3R0AA 2M5WA 4HG2A 3CJRB 4BXFA 2E1NA 3ONQA 3DTIA 1NK3P 4ON0A 3QU6A 1FOWA 1XMAA 4HNTA 2Y69H 4PDKA 4XORA 2HVQA 2KFDA 3GXOA 5K1YA 2QA4I 2VKVA 1PDNC 3KCCA 3FMSA 1G8XA 2B7EA 4M6VA 2LYCA 2K4JA 5F27A 4D5CA 4LJZF 3ERMA 2DA4A 3R4KA 4K2EA 1VQ5I 3O6BB 1YIJI 4H0EA 2M30A 3GF2A 4BU2A 1DU0A 1P4AA 3H3ZA 1RR8C 2WAQN 4A3LJ 2VQCA 2BBYA 1YHQI 2KLOA 1ZR2A 3QAHA 2A3SA 1QQIA 4MGRA 3RPUA 5GAGJ 5CVIA 1BW6A 4BAYA 5DM6F 3S15J 1QVUA 1ON2A 3ROUA 1UJ8A 4XM3A 2AHQA 1K79A 1MMDA 4DQ2A 3LAJA 4XKVA 4E7JA 2X1CA 5GADJ 2XSJC 3OYMA 2VKEA 4BHCA 4L0ZB 2HEOA 2M2EA 2NVUB 1PUFA 5LEKA 5HDNA 1Y39A 1GV2A 4C2TA 4QPQA 2HNHA 2E1OA 3K4MA 2R5YB 3A0BC 3K9TA 4PZJA 2EQRA 1JKRC 2BVLA 1AKHA 2ISYA 5BS6A 2KDZA 2CMPA 1VQLI 4HDUA 2MYSA 4Q5SF 3BR0A 4KFCA 2J5PA 3ELKA 2LF8A 1L0OC 1TWGJ 1T0FA 3VYSB 4XLPF 2BW3B 1CQTA 2LBFB 1MBEA 1USSA 2OQGA 2DMPA 3FBNB 3NWTA 4F91B 5J3LA 4C3HJ 1F4KA 4RM2A 2IVMA 4Y15A 4UVCA 1P9QC 2ZXWH 4R1HA 4E7LA 5IPAA 3GX4X 1IZ1A 4NNJA 3GCMA 3SZPA 4A2UA 4CYCA 5JVGF 3C7JA 2QZ8A 4OIOF 2MA3A 4A3JJ 2IS4A 4Y4RA 3CUOA 4IHSA 4JX5A 3BWGA 5FJ8J 3DEWA 1XSVA 5EF6A 3A0HC 5BMZA 3WE3A 5CLSA 1HW1A 3S2WA 4IO9F 1USTA 4OAZA 5LEJA 2XKPA 2X48A 1WGXA 3C1DA 2XDVA 1ZG3A 4BE0A 1A36A 4IJAA 2P8TA 2BHZA 3RSNA 1EH6A 1HDDC 2NNNA 5LHIA 4CCJA 1G3WA 2CUJA 4ZTJA 1OYYA 3GTKJ 4EV0A 3DXJF 3L2QA 3C18A 1BI2A 3ECHA 2VT2A 4M9ZA 3PQKA 2NAZA 2BV6A 3QYEA 2EIJH 4C3IJ 4BXXJ 4F55A 4JYKA 2LOOA 3ZN1A 2AQEA 1WFXA 1XS9A 2M8EA 2QF7A 1R6RA 2D2WA 3A4CA 3DQVC 1V54H 3FKIJ 1J9IA 5FROA 2XGXA 2QQ9A 2VIXA 1G6NA 3U21A 1W0UA 3FXMA 3DPUA 1JUPA 3OV8A 5ICCA 3J7AO 3VEPA 3JRIA 1KQ9A 2GOMA 1QZYA 1VQ8I 3F8FA 1IN4A 3EPZA 4EJVA 2XAQA 2ID3A 2PMUA 1OJLA 3KIOA 3D5SC 2FMLA 4RB2C 4EJTA 3ML6A 3OYDA 1S6LA 3OYAA 3AG2H 4BE2A 2M87A 1R1UA 3KP2A 5GAHJ 3IRRA 4HDVA 5F1RA 1SMYF 2GOXB 4XIDA 4M9SA 3ZMTA 3F21A 2O6GE 3LSIA 3EETA 2DDAA 2DU9A 1O3SA 2Y30A 1TWAJ 3HRUA 4HBLA 4XLFA 5IOZA 2XF6A 3HJEA 1KA8A 1XDSA 3GFJA 2X6WA 3W2WA 2ZMEC 2LTPA 1B6AA 4CZZA 4EJOA 5K5QA 4BY1J 2BE5F 4HF1A 2HI3A 4V19K 2L7MP 1ODDA 4V2FA 1H88C 2BEOA 4P1WA 1DPUA 2ZFWA 4MEXF 5ED4A 3FXQA 5L3DA 2L7FP 1D5YA 5M3MJ 4E7IA 5ILSA 4E7SA 4M6YA 1HW2A 2Y2ZA 2JUGA 3O3KA 3H3VK 4XQFA 1FJLA 1TWHJ 4IPAA 3VYUB 3RDIA 4A12A 2Y31A 2ZFUA 3DKWA 3GO5A 4AD9A 3QP5A 2HOSA 1I3AA 2BZTA 1P4XA 1OISA 1WI3A 2Y0SN 4EEFG 3JRAA 2DJIA 4FE4A 3IH2A 5DYMA 1D8KA 4LD5A 2UWMA 2AS5F 2F5EA 3LFKA 3QODA 3BG5A 2PG4A 4IQJA 5F6FA 3DPLC 1VQOI 2MBFA 3BJAA 5EEGA 1NHAA 3OIOA 2IW5A 2CQKA 4KJZA 3KZYA 1FP1D 2XVCA 3GUDA 2GQQA 3I59B 1U0JA 1Z05A 4L9VA 3JREA 1UG0A 1QRYA 3DFGA 4LIUA 4CCNA 4XRSA 4IHYA 3MKWB 1LEAA 3DBHB 4ZZLA 4HLYA 1BR4A 5E17F 3HC7A 4NBQA 1ORKA 3FXUA 2FNPA 3CCYA 1Y6IA 3FBIB 3KPHA 1GDTA 2BW3A 3RCOA 5BNGA 2EH3A 2LBFA 1WJDA 3IRQA 2DI3A 4B4CA 5AONA 5M5WJ 4OU0A 1K61A 1JKOC 1YLFA 1JJ6C 3G4SI 1ZGWA 2JK3A 3VFZA 4QIWN 2CV2A 2XB5A 3WTZA 2GA1A 4PJNA 3UKGA 4EGZA 3FXKA 2P4WA 5L3CA 2G9WA 1K78B 2OD5A 3M4OJ 2VJ4A 4A69C 5H6RA 3FM5A 2WY7Q 2K9LA 5F1JA 4ENKA 2PJRB 2JSCA 4EM0B 3S32A 3RI4A 3E6MA 4A5MA 1FLIA 4B48A 1R49A 4HSTA 1Z6RA 2K9SA 3P9CA 1SMTA 4MEYF 5LGTA 1X4PA 2AQFA 2W4SA 4HX7A 4RS8A 4ESJA 1VQ4I 4A3EJ 5HLTA 3SEZA 3HHHA 5BPIA 4I6ZA 4D7NA 2YU3A 4D5FA 1X2MA 3S2DJ 2QSGX 3BZKA 1S3JA 2X6XA 2MLGA 3HOTA 4OIRF 1ZRFA 1JTYA 1Z3YA 3LA7A 3NRVA 3E5XA 3KZIC 1MSEC 2OF7A 4UV9A 3ZMUA 1K4TA 3ISPA 1G3SA 4II2A 2JVHA 5E3NA 3GZ6A 3RZOJ 2HXOA 1J2XA 3TO7A 2CS3A 3O8HA 2FOWA 3P7NA 1ZHFA 5DUIA 3IWZA 5CVJA 4YEJA 5TJJA 3HXLA 2E2IJ 3AG3H 3CF2A 2OCCH 2LP0A 4XSZF 1O7FA 4RM3A 1KGSA 1D1BA 1QZZA 4OOIA 4IOCF 4UHTA 3ZRGA 2Y0SA 2E60A 1K7AA 1IRXA 5L3BA 3HL2A 4L0YB 2V1DA 3OY9A 1FIAA 1M1EB 4YRVA 1AU7A 3A2KA 2IAIA 2P5VA 4L5IA 3REOA 2CYYA 1A6QA 4IRGA 2DJNA 2XAFA 5HLHA 2ZJ2A 3I71A 4IHVA 3I4NJ 3JRHA 1TNTA 3KX2A 4N0BA 1ZTRA 2A5YB 1DPRA 3F8MA 3QWLA 1Z3XA 4DW6A 4JK1X 3CC2I 2Y0MA 2XSDC 2XB0X 3RKXA 1ZN2A 2JJ7A 3W6VA 1WH7A 4CCOA 1MJ9A 2PQ8A 3BG9A 2P81A 4NHJA 3OYIA 5J4YA 5BOXA 2P7VB 5K7HA 1FOXA 2A6TA 2IP2A 2OBPA 1BM9A 1EH7A 2V1XA 3HPHA 4RGUA 5CVRA 2OA4A 3PL8A 2LKSA 4OMZA 2HQAA 2F4OB 4G6TB 2IEKA 3EUKL 1QA6A 3TDZC 2HDDA 2IJLA 1K6YA 2QBYA 2H8WA 1XMKA 1ITYA 1UHMA 3ECOA 3ZMDA 2MGQA 5L3EA 1YRNA 1KZHA 2R7TA 3KP3A 3IAS2 2FBIA 5IT3A 5JHUA 2WWYA 3ZMSA 3NAUA 4I7HA 1Z9CA 2A6HF 1Y1VJ 5EEHA 2FQ4A 1P2FA 3RKWA 2DFIA 3COAC 4UV8A 3NARA 4C2MJ 4LITA 2O8KA 2RVCA 3T0YA 1T98A 4A6EA 5F64A 3AG1H 1ON1A 4BGDA 1YJWI 1GLNA 2Y9ZA 2TDXA 4EM1A 4NB5A 2VB6A 2VBWA 1SANA 2HVRA 4U0YA 3UR3C 5CVVA 3WHCA 2B0LA 2ME6A 4ENNA 3HG9A 1OYIA 3OR1C 1RIOH 3KLNA 3RTRA 3LL7A 2IS1A 5KAFC 4XOTA 3IH4A 2LVSA 3EUHC 2KJCA 5D4RA 3MKZA 2WY8Q 3E97A 1W7PB 3DLLF 2H8RA 1XSXA 3GBGA 3NQOA 1U2WA 1ZYRF 3OYBA 3L2CA 3M9AA 1B1BA 1MZBA 1VQ6I 1MMSA 2LSOA 1KQ8A 4BQAA 4CCMA 4MTDA 2KKOA 3IP4B 2IGNA 4LIVA 2DA3A 4YFKF 4FISA 2W82A 5CVUA 3JRCA 4KMFA 1KYZA 2G7HA 1GVDA 5J8CA 2CW0F 4KYWA 2UXXA 4RAFA 2M9HA 2RKHA 4B47A 5CPRB 1IN8A 2P5LC 5J1UA 3KFWX 1W7PD 2DMNA 1W0TA 4OMYA 1N77A 3FF5A 3MD2A 4XLAA 1JJ8C 4XR6A 2MH2A 5HDKA 2HGCA 2I10A 3GFLA 1MNDA 2ACJA 3PO2J 1F9NA 3CLQA 1K78A 2V79A 4G7ZF 1OCCH 3EUAA 1TZLA 4EMSA 4IZZA 1XB4A 2R7WA 5IYBJ 3TDUC 3OYCA 4Y52J 1TW3A 2CQ7A 3W6JB 2JT1A 1NTCA 3H9QA 4HOBA 3DTKA 2K5CA 2F5DA 4BDYA 4BH9A 1FBQA 2ECBA 2L9VA 3LMMA 3V8LA 3BTLA 3U9GA 3CCLI 5DD8A 5FKKA 5J8FA 2OC6A 4UB8C 3JRBA 4I01A 1X3UA 4HRIA 1YIOA
chains in the Genus database with same CATH topology
2QQAA 1P4WA 1R22A 1LQ1A 4HA8A 1IXCA 5A2QK 3ZPLA 4CHUA 4ENMA 1IUYA 3CDHA 3PQJA 2V9VA 1ZG5A 1R5HA 1Q1HA 2EFNA 3F8CA 1A04A 1LDDA 3FM3A 3QU3A 4S05A 4AIHA 2EFOA 5K5RA 2YX4A 2PLYA 2FSWA 1VTNC 4UNOA 3HOSA 3TKYA 4G7HF 2D1VA 1ZH5A 1TQIA 3KP6A 3I5UA 2Y48A 4RGXA 4L9JA 4PGGA 4EJWA 2EFQA 5HLGA 2XAHA 1YW8A 4I02A 3BJ6A 2K02A 1DP7P 1SAXA 3IHUA 2GA2A 3G3ZA 1HW5A 2ESHA 2PFBA 3MZHA 1O7LA 3LA3A 3P9KA 1KU3A 1FBSA 1LB2A 1F5TA 4YFNF 5FFXA 3MWMA 3QPHA 4BNCA 2L4AA 1UB9A 2DO7A 5A2QZ 1O3TA 1I27A 1YS6A 5DV5A 1XDUA 3TO9A 2Z5UA 3F6OA 2VONA 2BYVE 1OMIA 4I0BA 4WXHA 2EFWA 3EYYA 2WV0A 1T2KA 2A6EF 5KVRA 4EQQA 5DUKA 1DDNA 2YX7A 1ONVA 3K0LA 2CG4A 5E8GA 2JZYA 1SD6A 5BPDA 4ASNA 1OR7A 1I5ZA 3O2PE 2CFXA 3QPTA 4E70A 1QGPA 3RJPA 1HSTA 5LLQA 4A0XA 4MTEA 2GAUA 3WODF 1DUXC 3H3UA 1YYVA 1BC8C 3I53A 4A5NA 2DBBA 4BXUA 2HKOA 4FT8A 2ZMEB 3JSOA 3K1NA 3WGGA 2VE9A 3GFIA 2L02A 4L9TA 3L00A 4Q4ZF 2XAGA 3HYIA 2H94A 5TRDA 2W24A 2RN7A 5D5XB 3V7RA 2BGCA 3CTAA 4CDGA 2STWA 4M71A 3RYPA 3GLXA 3G73A 2CO5A 3SQNA 1R5GA 1XGMA 5J6XA 1QBJA 1FT9A 2FQ3A 2VOPA 1IRGA 1IXRC 4IF4A 3T1BA 1O57A 1UFMA 4WX9A 1FYKA 5D5UB 2Z9OA 1E2XA 5DCMB 3WTYC 4M9XA 3SZTA 4U7BA 2QLZA 2EWNA 2QUFA 2DAOA 3K1MA 4M74A 4D0PA 2H6CA 2FOKA 4KIFA 3SHFA 3QOPA 4R79A 4B09A 1S7OA 4U0VA 1BJAA 3JTGA 2LKPA 1GXPA 4WCGA 4RAZA 2FA5A 2ZBKA 1RUOA 5AIQA 1XSDA 3ULQB 2P7CB 3Q9VA 3K2ZA 2DK8A 1CF7B 4KDPA 1WRJA 1YFHA 4U0WA 1D3YA 1MJAA 4KUMA 3ZP5A 5FFZA 5LRSA 4AIJA 1FNNA 2EV0A 4MQVA 4A0YA 1W4MA 3HRMA 2JTVA 4HX8A 3D0SA 1G3TA 1STZA 4HX4A 2ZXJA 1BI1A 1IN7A 5L3GA 4BYYA 4O5VA 3R0JA 4KNYA 2VE8A 3ZMZA 4HV6A 1QPMA 1G3YA 4KIGA 5HS9A 3HTUA 4WK8F 4CICA 1IN6A 3FWEA 3HUGA 3M8EA 1TQPA 4HF0A 3KEQA 2HQNA 1JHHA 2K7LA 3M1EA 1R58A 3TOBA 5FD5A 1ZGAA 2QQBA 1J75A 3WTXC 2M1BA 4IHTA 2W85A 1MGTA 2ZMEA 2D1HA 3T5XA 1MD0A 2LDUA 3WTVC 4RGSA 3ZN0A 3BP8A 4OIQF 4ZYEA 4RB0A 2DTRA 3PFIA 4A6DA 2KJBA 2L3DA 1J0RA 3P9IA 2LNBA 2FEZA 4GYIA 5ILUA 1V3FA 3ABTA 5FGMA 5HOOA 4DNCA 4LLGF 3KP7A 4RB3C 2DPUA 3KLOA 3VB2A 3KE2A 2E1CA 2A61A 2XIGA 5DCMA 2ZNYA 3F72A 1BOAA 2HQRA 4G6DA 1MDMB 5HDGA 6PAXA 2NNYA 4GGGA 1Z6TA 5FLXK 5E8IA 3MEXA 4M72A 3E6CC 3W6KB 2L01A 1SFEA 4HV5A 2XV4S 2PJPA 1U78A 1R1VA 1TBXA 3I4PA 3TOAA 2OQRA 4MQ9F 5BQTA 2XUBA 3JSPA 3IWFA 1YTYA 4L9NA 2ESNA 1B9MA 2E7XA 3HIFA 4IXAA 2EV6A 2FXAA 3I54A 4EJUA 5H6QA 1H9TA 3WTWC 2OZUA 4GCVA 4KT5C 1JHFA 3CUQC 4KN4X 3V7CA 1KYWA 1L3LA 2QENA 1U5TB 1S7AA 1FSHA 2JPBA 3C3WA 1PUEE 2FU4A 3HTSB 1ZGJA 1K6OA 3MFKA 2O8XA 1B4AA 1F1ZA 4ENJA 5FLXZ 1JXSA 3MQ0A 1ZG1A 4P9UA 4EVIA 3Q9SA 1D5VA 1J5YA 1Y0UA 1J7KA 4PCQA 1EV7A 2OU2A 4F7ZA 3CLOA 4G94A 2OZ6A 3I59A 2FE3A 1U3EM 5K5OA 3ZMVA 4M6XA 1RUNA 3HSFA 2F2EA 4L18B 3TO6A 1YQAA 2M45A 4BHBA 5JI6A 1SD7A 2GXBA 1I1GA 4G9YA 2LF7A 2HYFA 4PGHA 4KA4A 1IF1A 3VODA 5ILVA 5E1ZB 2IA2A 4I09A 3HHGA 3N97A 1LDKB 2P5KA 4IRIA 4U88A 3IKVA 3M8FA 2K27A 2XASA 4P5OA 3F8BA 5JR3A 3RIRA 3MAJA 2IRFG 5D8LB 2C6YA 4FHTA 5LGUA 2JPCA 4OINF 3EUHA 4EGYA 2UXNA 4KMUX 2RC4A 1FWZA 1U5TC 4P9FA 1T6SA 2NYXA 1MDMA 2Q2EA 2ZO4A 3NEUA 3LAPA 1T39A 4HQEA 1R1TA 3ZQ7A 1T38A 4XRFA 4RAYA 2STTA 1HQCA 1XGNA 1LVAA 3MCZA 3K69A 2XROA 3D5LA 1IRFA 2DQLA 1FSEA 2VT3A 3BOQA 4Y17A 3IC7A 5ICFA 2YSRA 2RQPA 3RPQA 1WWXA 4O3MA 4U7DA 1P6RA 2DPDA 5E1WA 5LBQA 4AVPA 2PN6A 1TLHB 1YG2A 3FZVA 4P96A 1BC7C 2CSOA 3FXRA 3KP4A 1FP2A 1ZRDA 3WE2A 2IA0A 2YPRA 3LQRA 4AIKA 4L5JA 1RNLA 1FZPB 1EH8A 2XHKA 3K1PA 4LLLA 1XGOA 3F22A 3HRTA 2HR3A 4JBAA 1UCRA 3E6DA 3J80Z 3J81Z 1FPQA 2WTEA 2XKOA 2UZKA 4TV7A 2D45A 5CJ9A 5KK1A 4EM2A 3WU1B 1W7PA 2NS0A 2NRAC 1ZREA 1HSJA 2DT5A 4N9IA 4WWCA 2QM3A 2GXGA 1WI9A 2FNAA 2HWVA 5DEQA 4RB1A 2O3FA 1ZLKA 4LFUA 4JQFA 4IVNA 2HZTA 1TW2A 5LGNA 1U8RA 1ULYA 4QWQA 3L09A 2AXLA 2K86A 4XLNF 1OPCA 2HFHA 4ETSA 1OKRA 4WXCA 4R8HA 3L7WA 5DDGA 1REPC 5JFRA 2X4HA 3F6VA 5D5WB 2ADUA 2Z99A 4YG2F 1R23A 4FX0A 4LLNA 1PP7U 3U2RA 3H92A 3F23A 3L9FA 2DK5A 2MLKA 3HSRA 3BROA 3U1DA 1BN5A 4KN7X 1RZ4A 4YIIA 5LRRA 3V4GA 2EJRA 1B9NA 1FC3A 4Y13A 3OOPA 1AWCA 1KU9A 2HYGD 2MC3A 3E5QA 1HKTA 2HTJA 2PEXA 4WF2A 3F8NA 3FX3A 1XCVA 3BZ6A 2HS5A 3JW4A 2RV8A 3HSEA 3BPVA 2O61A 1YW7A 3B02A 1XN7A 3WGIA 5LHGA 4NQWA 5ICEA 3N4MA 2QWWA 3JAMK 1O3QA 1HXDA 4Q48A 2X0LA 1R00A 3DPTA 2W57A 1AOYA 4GO1A 2COMA 2FMYA 2OAZA 1R7JA 3HRSA 3WGHA 1SD5A 2Z3YA 4LB5A 4ZYDA 3F3XA 3VOEA 1LNWA 2H09A 1YW9A 4IRHA 3RYRA 4HZFA 2Q0OA 3GEZA 4LMYA 2EB7A 2R3SA 1W5TA 1PP8F 3DP7A 4MHGA 4CYDA 4UVBA 1KU7A 4P55A 1FY7A 1MKMA 2KIMA 3SXYA 1B59A 2EV5A 2QVOA 3EYIA 3WTSC 1P92A 4GXOA 3RKYA 3GW2A 2XRNA 1CGPA 2RGVA 2EA4A 2R7FA 2Z33A 3JAMZ 5HVQC 4GYGA 1O3RA 3TGNA 5DD4A 2KIUA 2QBYB 4WXDA 1FX7A 1TTYA 4A0ZA 1D8JA 1FYLA 2EFPA 2PBIA 2P6SA 1QO0D 2O0YA 3V8JA 1BI3A 1QNTA 3BDDA 1S8NA 1BBYA 1G4DA 2GWRA 3EQLF 1ZARA 3SFZA 3CUQB 4FX4A 3IL2A 3DEUA 4OIPF 3E5UA 4YIFA 1GVJA 4HAMA 2VC0A 2R7DA 2L54A 3I58A 1I1SA 4HYEA 1ZRCA 5HS8A 3AAFA 3GFMA 3T8TA 4CGZA 2HDCA 3E6BA 2ISZA 3KEOA 1LDJA 4RGRA 2VN2A 2JRTA 3GZ5A 4YFXF 1LJ9A 2VODA 4HQMA 4B8XA 4ZYGA 4G8XA 4S04A 2YR2A 5LHHA 2GIVA 3LSTA 3WTUC 2F5CA 1IW7F 4CXFA 3FMQA 2A69F 3I64A 5E20A 4UUVA 2KIFA 2VBYA 1BIAA 5HS7A 5H20A 1Z1DA 4UXNA 1ZLJA 2RDPA 4HLXA 5ICGA 1YS7A 2VOOA 3FHZA 4I2OA 1XCBA 2VBZA 1SFUA 3T8RA 2E7WA 5CYVA 1I6XA 3KZZA 3MZYA 1R36A 1KQ0A 2HKXA 5L3FA 5DCFA 1RI7A 2VC1A 1CF7A 4HW0A 1GHCA 1MJBA 5E18F 1S29A 1HKSA 3CO6C 2XAJA 2ZKZA 4UVAA 3WTTC 2F5FA 2FBKA 3R60A 4Z2YA 1LEBA 3V8KA 4KIBA 3E3VA 3WU0A 3BJOA 5ERIA 2Q8KA 3R6SA 2J5OA 5D8KB 2HOEA 3IKTA 2ZNZA 3B73A 5E1XA 2P6TA 4XSXF 2DW4A 1FBUA 5JVTA 1JGSA 5D6FA 1TNSA 3DV8A 1BIBA 3JTHA 2CGPA 2H27A 2QYOA 1V4RA 3CJNA 1IN5A 4HF2A 3FMRA 3R61A 2HTSA 1JE8A 4LG0B 4XBFA 4I98B 1HKQA 2ELHA 1H0MA 2IA1A 3CUQA 3QRFF 5FD6A 2K4BA 4G7OF 2CWEA 3KETA 2PMHA 1UHWA 2L4MA 5FO5A 2PI0A 4ZH4F 1OYWA 2W84A 2KRFA 1WSUA 5FB2A 1Z7UA 4O6JA 4AWXB 1XGSA 4ESBA 1ZAOA 3WG9A 4G6QA 2DLLA 4LB6B 1GXQA 1FYMA 4MNUA 2GZWA 3V7SA 1HBXG 4LK1F 3DF8A 4I0AA 1U6GA 4CO8A 5IT9K 4QLCU 2FRHA 1WKMA 4KICA 1H9GA 2V6CA 4ESFA 4LK0F 5HLIA 3M7GA 3J80K 3J81K 4ZZDA 3EDPA 2A68F 1SFXA 2W25A 3LWFA 3CO7C 4ZYHA 2V1UA 2FF4A 3ERED 3TQNA 2G7UA 2ZCWA 3BY6A 1C0WA 1IAWA 4M73A 2A07F 1FOKA 2MH9A 1KU2A 2IPQX 3I0TA 1U5TA 3LA2A 5AIPA 3GVAA 1WQ2A 3KP5A 3LQQA 1SD4A 1TQMA 2IT0A 2VXZA 4N9HA 3GWZA 1IXSB 5IT9Z 2ETHA 2EA2A 3Q5FA 1YO5C 5D5VB 5D4SA 4LGWA 2Y75A 4BHPA 4Q47A 3BPXA 1Z91A 2RNJA 2EK5A 3GYHX 1J59A 3ABUA 1BI0A 2DQRA 2FBHA 2MD5A 2O03A 4LG0A 2VBXA 1E17A 2WC2A 3QP6A 1W5SA 1XD7A 2H6BA 5D6EA 3R0AA 2M5WA 2E1NA 4ON0A 3QU6A 1XMAA 4PDKA 5K1YA 3GXOA 1PDNC 3KCCA 3FMSA 2K4JA 4LJZF 3R4KA 4K2EA 3O6BB 4H0EA 2M30A 3GF2A 1P4AA 3H3ZA 2BBYA 3QAHA 2A3SA 1QQIA 4MGRA 3RPUA 5CVIA 4BAYA 3ROUA 1ON2A 1K79A 4DQ2A 3LAJA 4BHCA 4L0ZB 2HEOA 5LEKA 5HDNA 3K9TA 4PZJA 2ISYA 5BS6A 4HDUA 4Q5SF 4KFCA 2J5PA 3ELKA 2LF8A 1L0OC 1T0FA 4XLPF 1USSA 2OQGA 1F4KA 2IVMA 4Y15A 4UVCA 4R1HA 3GX4X 1IZ1A 3SZPA 4A2UA 3C7JA 2QZ8A 4OIOF 2MA3A 3CUOA 4IHSA 3BWGA 1XSVA 5BMZA 3WE3A 5CLSA 1HW1A 3S2WA 1USTA 5LEJA 2XKPA 3C1DA 1ZG3A 4IJAA 2P8TA 1EH6A 2NNNA 5LHIA 1G3WA 1OYYA 4EV0A 3DXJF 3C18A 1BI2A 3ECHA 2VT2A 4M9ZA 3PQKA 2NAZA 2BV6A 3ZN1A 2M8EA 2D2WA 3DQVC 1J9IA 2XGXA 2QQ9A 1G6NA 3OV8A 5ICCA 3J7AO 3VEPA 1KQ9A 1QZYA 3F8FA 1IN4A 4EJVA 2XAQA 2PMUA 2FMLA 4RB2C 4EJTA 3ML6A 1S6LA 2M87A 1R1UA 3KP2A 3IRRA 4HDVA 5F1RA 1SMYF 4M9SA 3ZMTA 3F21A 2O6GE 1O3SA 3EETA 2DU9A 3HRUA 4HBLA 1KA8A 1XDSA 3GFJA 1B6AA 4CZZA 4EJOA 5K5QA 2BE5F 4HF1A 1ODDA 2BEOA 1DPUA 2ZFWA 4MEXF 5ED4A 3FXQA 5L3DA 5ILSA 4M6YA 1HW2A 3O3KA 4IPAA 3RDIA 4A12A 3DKWA 3GO5A 4AD9A 3QP5A 1P4XA 5DYMA 1D8KA 4LD5A 2UWMA 2AS5F 2F5EA 3LFKA 2PG4A 5F6FA 3DPLC 2MBFA 3BJAA 5EEGA 1NHAA 2IW5A 2CQKA 3KZYA 1FP1D 2XVCA 3GUDA 2GQQA 3I59B 1Z05A 4L9VA 3DFGA 1LEAA 4ZZLA 5E17F 4HLYA 3FXUA 2FNPA 3IRQA 2DI3A 5AONA 4OU0A 1YLFA 3VFZA 3WTZA 2GA1A 4EGZA 2P4WA 5L3CA 2G9WA 1K78B 2OD5A 5H6RA 3FM5A 4ENKA 2JSCA 4EM0B 3RI4A 3E6MA 4A5MA 1FLIA 1Z6RA 3P9CA 1SMTA 4MEYF 5LGTA 4HX7A 4RS8A 4ESJA 3HHHA 5BPIA 2YU3A 1S3JA 2MLGA 3HOTA 4OIRF 1ZRFA 3LA7A 3NRVA 3E5XA 4UV9A 3ZMUA 3ISPA 1G3SA 3GZ6A 1J2XA 3TO7A 3P7NA 1ZHFA 5DUIA 3IWZA 5CVJA 5TJJA 4XSZF 1O7FA 1KGSA 1QZZA 4OOIA 4UHTA 1K7AA 5L3BA 4L0YB 2V1DA 2P5VA 4L5IA 3REOA 2CYYA 5HLHA 4IRGA 2XAFA 2ZJ2A 3I71A 1TNTA 4N0BA 2A5YB 1DPRA 3F8MA 4JK1X 2Y0MA 3RKXA 1ZN2A 1MJ9A 2PQ8A 4NHJA 5BOXA 2P7VB 2IP2A 2OBPA 1BM9A 1EH7A 2V1XA 4RGUA 5CVRA 2OA4A 4OMZA 3TDZC 2IJLA 2QBYA 1XMKA 1UHMA 3ECOA 3ZMDA 5L3EA 3KP3A 2FBIA 5IT3A 5JHUA 2WWYA 3ZMSA 4I7HA 1Z9CA 2A6HF 5EEHA 3RKWA 1P2FA 3COAC 2DFIA 4UV8A 2RVCA 3T0YA 1T98A 4A6EA 5F64A 1ON1A 2TDXA 4EM1A 4NB5A 2VBWA 4U0YA 5CVVA 2B0LA 4ENNA 1OYIA 1RIOH 3KLNA 3RTRA 2KJCA 5D4RA 3E97A 1W7PB 1XSXA 3NQOA 1U2WA 1ZYRF 3L2CA 3M9AA 1B1BA 1MZBA 2LSOA 1KQ8A 4BQAA 4MTDA 2KKOA 4YFKF 5CVUA 4KMFA 1KYZA 2G7HA 5J8CA 2CW0F 4KYWA 2UXXA 2RKHA 1IN8A 2P5LC 3KFWX 1W7PD 4OMYA 3FF5A 2MH2A 5HDKA 2HGCA 3GFLA 2ACJA 1F9NA 1K78A 2V79A 4G7ZF 4EMSA 1XB4A 3TDUC 1TW3A 3W6JB 2JT1A 4HOBA 2F5DA 4BH9A 1FBQA 3V8LA 3U9GA 5DD8A 5J8FA 4I01A 1X3UA 1YIOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QQA A;  1P4W A;  1R22 A;  1LQ1 A;  4HA8 A;  1IXC A;  5A2Q K;  3ZPL A;  4CHU A;  4ENM A;  1IUY A;  3CDH A;  3PQJ A;  2V9V A;  1ZG5 A;  1R5H A;  1Q1H A;  2EFN A;  3F8C A;  1A04 A;  1LDD A;  3FM3 A;  3QU3 A;  4S05 A;  4AIH A;  2EFO A;  5K5R A;  2YX4 A;  2PLY A;  2FSW A;  1VTN C;  4UNO A;  3HOS A;  3TKY A;  4G7H F;  2D1V A;  1ZH5 A;  1TQI A;  3KP6 A;  3I5U A;  2Y48 A;  4RGX A;  4L9J A;  4PGG A;  4EJW A;  2EFQ A;  5HLG A;  2XAH A;  1YW8 A;  4I02 A;  3BJ6 A;  2K02 A;  1DP7 P;  1SAX A;  3IHU A;  2GA2 A;  3G3Z A;  1HW5 A;  2ESH A;  2PFB A;  3MZH A;  1O7L A;  3LA3 A;  3P9K A;  1KU3 A;  1FBS A;  1LB2 A;  1F5T A;  4YFN F;  5FFX A;  3MWM A;  3QPH A;  4BNC A;  2L4A A;  1UB9 A;  2DO7 A;  5A2Q Z;  1O3T A;  1I27 A;  1YS6 A;  5DV5 A;  1XDU A;  3TO9 A;  2Z5U A;  3F6O A;  2VON A;  2BYV E;  1OMI A;  4I0B A;  4WXH A;  2EFW A;  3EYY A;  2WV0 A;  1T2K A;  2A6E F;  5KVR A;  4EQQ A;  5DUK A;  1DDN A;  2YX7 A;  1ONV A;  3K0L A;  2CG4 A;  5E8G A;  2JZY A;  1SD6 A;  5BPD A;  4ASN A;  1OR7 A;  1I5Z A;  3O2P E;  2CFX A;  3QPT A;  4E70 A;  1QGP A;  3RJP A;  1HST A;  5LLQ A;  4A0X A;  4MTE A;  2GAU A;  3WOD F;  1DUX C;  3H3U A;  1YYV A;  1BC8 C;  3I53 A;  4A5N A;  2DBB A;  4BXU A;  2HKO A;  4FT8 A;  2ZME B;  3JSO A;  3K1N A;  3WGG A;  2VE9 A;  3GFI A;  2L02 A;  4L9T A;  3L00 A;  4Q4Z F;  2XAG A;  3HYI A;  2H94 A;  5TRD A;  2W24 A;  2RN7 A;  5D5X B;  3V7R A;  2BGC A;  3CTA A;  4CDG A;  2STW A;  4M71 A;  3RYP A;  3GLX A;  3G73 A;  2CO5 A;  3SQN A;  1R5G A;  1XGM A;  5J6X A;  1QBJ A;  1FT9 A;  2FQ3 A;  2VOP A;  1IRG A;  1IXR C;  4IF4 A;  3T1B A;  1O57 A;  1UFM A;  4WX9 A;  1FYK A;  5D5U B;  2Z9O A;  1E2X A;  5DCM B;  3WTY C;  4M9X A;  3SZT A;  4U7B A;  2QLZ A;  2EWN A;  2QUF A;  2DAO A;  3K1M A;  4M74 A;  4D0P A;  2H6C A;  2FOK A;  4KIF A;  3SHF A;  3QOP A;  4R79 A;  4B09 A;  1S7O A;  4U0V A;  1BJA A;  3JTG A;  2LKP A;  1GXP A;  4WCG A;  4RAZ A;  2FA5 A;  2ZBK A;  1RUO A;  5AIQ A;  1XSD A;  3ULQ B;  2P7C B;  3Q9V A;  3K2Z A;  2DK8 A;  1CF7 B;  4KDP A;  1WRJ A;  1YFH A;  4U0W A;  1D3Y A;  1MJA A;  4KUM A;  3ZP5 A;  5FFZ A;  5LRS A;  4AIJ A;  1FNN A;  2EV0 A;  4MQV A;  4A0Y A;  1W4M A;  3HRM A;  2JTV A;  4HX8 A;  3D0S A;  1G3T A;  1STZ A;  4HX4 A;  2ZXJ A;  1BI1 A;  1IN7 A;  5L3G A;  4BYY A;  4O5V A;  3R0J A;  4KNY A;  2VE8 A;  3ZMZ A;  4HV6 A;  1QPM A;  1G3Y A;  4KIG A;  5HS9 A;  3HTU A;  4WK8 F;  4CIC A;  1IN6 A;  3FWE A;  3HUG A;  3M8E A;  1TQP A;  4HF0 A;  3KEQ A;  2HQN A;  1JHH A;  2K7L A;  3M1E A;  1R58 A;  3TOB A;  5FD5 A;  1ZGA A;  2QQB A;  1J75 A;  3WTX C;  2M1B A;  4IHT A;  2W85 A;  1MGT A;  2ZME A;  2D1H A;  3T5X A;  1MD0 A;  2LDU A;  3WTV C;  4RGS A;  3ZN0 A;  3BP8 A;  4OIQ F;  4ZYE A;  4RB0 A;  2DTR A;  3PFI A;  4A6D A;  2KJB A;  2L3D A;  1J0R A;  3P9I A;  2LNB A;  2FEZ A;  4GYI A;  5ILU A;  1V3F A;  3ABT A;  5FGM A;  5HOO A;  4DNC A;  4LLG F;  3KP7 A;  4RB3 C;  2DPU A;  3KLO A;  3VB2 A;  3KE2 A;  2E1C A;  2A61 A;  2XIG A;  5DCM A;  2ZNY A;  3F72 A;  1BOA A;  2HQR A;  4G6D A;  1MDM B;  5HDG A;  6PAX A;  2NNY A;  4GGG A;  1Z6T A;  5FLX K;  5E8I A;  3MEX A;  4M72 A;  3E6C C;  3W6K B;  2L01 A;  1SFE A;  4HV5 A;  2XV4 S;  2PJP A;  1U78 A;  1R1V A;  1TBX A;  3I4P A;  3TOA A;  2OQR A;  4MQ9 F;  5BQT A;  2XUB A;  3JSP A;  3IWF A;  1YTY A;  4L9N A;  2ESN A;  1B9M A;  2E7X A;  3HIF A;  4IXA A;  2EV6 A;  2FXA A;  3I54 A;  4EJU A;  5H6Q A;  1H9T A;  3WTW C;  2OZU A;  4GCV A;  4KT5 C;  1JHF A;  3CUQ C;  4KN4 X;  3V7C A;  1KYW A;  1L3L A;  2QEN A;  1U5T B;  1S7A A;  1FSH A;  2JPB A;  3C3W A;  1PUE E;  2FU4 A;  3HTS B;  1ZGJ A;  1K6O A;  3MFK A;  2O8X A;  1B4A A;  1F1Z A;  4ENJ A;  5FLX Z;  1JXS A;  3MQ0 A;  1ZG1 A;  4P9U A;  4EVI A;  3Q9S A;  1D5V A;  1J5Y A;  1Y0U A;  1J7K A;  4PCQ A;  1EV7 A;  2OU2 A;  4F7Z A;  3CLO A;  4G94 A;  2OZ6 A;  3I59 A;  2FE3 A;  1U3E M;  5K5O A;  3ZMV A;  4M6X A;  1RUN A;  3HSF A;  2F2E A;  4L18 B;  3TO6 A;  1YQA A;  2M45 A;  4BHB A;  5JI6 A;  1SD7 A;  2GXB A;  1I1G A;  4G9Y A;  2LF7 A;  2HYF A;  4PGH A;  4KA4 A;  1IF1 A;  3VOD A;  5ILV A;  5E1Z B;  2IA2 A;  4I09 A;  3HHG A;  3N97 A;  1LDK B;  2P5K A;  4IRI A;  4U88 A;  3IKV A;  3M8F A;  2K27 A;  2XAS A;  4P5O A;  3F8B A;  5JR3 A;  3RIR A;  3MAJ A;  2IRF G;  5D8L B;  2C6Y A;  4FHT A;  5LGU A;  2JPC A;  4OIN F;  3EUH A;  4EGY A;  2UXN A;  4KMU X;  2RC4 A;  1FWZ A;  1U5T C;  4P9F A;  1T6S A;  2NYX A;  1MDM A;  2Q2E A;  2ZO4 A;  3NEU A;  3LAP A;  1T39 A;  4HQE A;  1R1T A;  3ZQ7 A;  1T38 A;  4XRF A;  4RAY A;  2STT A;  1HQC A;  1XGN A;  1LVA A;  3MCZ A;  3K69 A;  2XRO A;  3D5L A;  1IRF A;  2DQL A;  1FSE A;  2VT3 A;  3BOQ A;  4Y17 A;  3IC7 A;  5ICF A;  2YSR A;  2RQP A;  3RPQ A;  1WWX A;  4O3M A;  4U7D A;  1P6R A;  2DPD A;  5E1W A;  5LBQ A;  4AVP A;  2PN6 A;  1TLH B;  1YG2 A;  3FZV A;  4P96 A;  1BC7 C;  2CSO A;  3FXR A;  3KP4 A;  1FP2 A;  1ZRD A;  3WE2 A;  2IA0 A;  2YPR A;  3LQR A;  4AIK A;  4L5J A;  1RNL A;  1FZP B;  1EH8 A;  2XHK A;  3K1P A;  4LLL A;  1XGO A;  3F22 A;  3HRT A;  2HR3 A;  4JBA A;  1UCR A;  3E6D A;  3J80 Z;  3J81 Z;  1FPQ A;  2WTE A;  2XKO A;  2UZK A;  4TV7 A;  2D45 A;  5CJ9 A;  5KK1 A;  4EM2 A;  3WU1 B;  1W7P A;  2NS0 A;  2NRA C;  1ZRE A;  1HSJ A;  2DT5 A;  4N9I A;  4WWC A;  2QM3 A;  2GXG A;  1WI9 A;  2FNA A;  2HWV A;  5DEQ A;  4RB1 A;  2O3F A;  1ZLK A;  4LFU A;  4JQF A;  4IVN A;  2HZT A;  1TW2 A;  5LGN A;  1U8R A;  1ULY A;  4QWQ A;  3L09 A;  2AXL A;  2K86 A;  4XLN F;  1OPC A;  2HFH A;  4ETS A;  1OKR A;  4WXC A;  4R8H A;  3L7W A;  5DDG A;  1REP C;  5JFR A;  2X4H A;  3F6V A;  5D5W B;  2ADU A;  2Z99 A;  4YG2 F;  1R23 A;  4FX0 A;  4LLN A;  1PP7 U;  3U2R A;  3H92 A;  3F23 A;  3L9F A;  2DK5 A;  2MLK A;  3HSR A;  3BRO A;  3U1D A;  1BN5 A;  4KN7 X;  1RZ4 A;  4YII A;  5LRR A;  3V4G A;  2EJR A;  1B9N A;  1FC3 A;  4Y13 A;  3OOP A;  1AWC A;  1KU9 A;  2HYG D;  2MC3 A;  3E5Q A;  1HKT A;  2HTJ A;  2PEX A;  4WF2 A;  3F8N A;  3FX3 A;  1XCV A;  3BZ6 A;  2HS5 A;  3JW4 A;  2RV8 A;  3HSE A;  3BPV A;  2O61 A;  1YW7 A;  3B02 A;  1XN7 A;  3WGI A;  5LHG A;  4NQW A;  5ICE A;  3N4M A;  2QWW A;  3JAM K;  1O3Q A;  1HXD A;  4Q48 A;  2X0L A;  1R00 A;  3DPT A;  2W57 A;  1AOY A;  4GO1 A;  2COM A;  2FMY A;  2OAZ A;  1R7J A;  3HRS A;  3WGH A;  1SD5 A;  2Z3Y A;  4LB5 A;  4ZYD A;  3F3X A;  3VOE A;  1LNW A;  2H09 A;  1YW9 A;  4IRH A;  3RYR A;  4HZF A;  2Q0O A;  3GEZ A;  4LMY A;  2EB7 A;  2R3S A;  1W5T A;  1PP8 F;  3DP7 A;  4MHG A;  4CYD A;  4UVB A;  1KU7 A;  4P55 A;  1FY7 A;  1MKM A;  2KIM A;  3SXY A;  1B59 A;  2EV5 A;  2QVO A;  3EYI A;  3WTS C;  1P92 A;  4GXO A;  3RKY A;  3GW2 A;  2XRN A;  1CGP A;  2RGV A;  2EA4 A;  2R7F A;  2Z33 A;  3JAM Z;  5HVQ C;  4GYG A;  1O3R A;  3TGN A;  5DD4 A;  2KIU A;  2QBY B;  4WXD A;  1FX7 A;  1TTY A;  4A0Z A;  1D8J A;  1FYL A;  2EFP A;  2PBI A;  2P6S A;  1QO0 D;  2O0Y A;  3V8J A;  1BI3 A;  1QNT A;  3BDD A;  1S8N A;  1BBY A;  1G4D A;  2GWR A;  3EQL F;  1ZAR A;  3SFZ A;  3CUQ B;  4FX4 A;  3IL2 A;  3DEU A;  4OIP F;  3E5U A;  4YIF A;  1GVJ A;  4HAM A;  2VC0 A;  2R7D A;  2L54 A;  3I58 A;  1I1S A;  4HYE A;  1ZRC A;  5HS8 A;  3AAF A;  3GFM A;  3T8T A;  4CGZ A;  2HDC A;  3E6B A;  2ISZ A;  3KEO A;  1LDJ A;  4RGR A;  2VN2 A;  2JRT A;  3GZ5 A;  4YFX F;  1LJ9 A;  2VOD A;  4HQM A;  4B8X A;  4ZYG A;  4G8X A;  4S04 A;  2YR2 A;  5LHH A;  2GIV A;  3LST A;  3WTU C;  2F5C A;  1IW7 F;  4CXF A;  3FMQ A;  2A69 F;  3I64 A;  5E20 A;  4UUV A;  2KIF A;  2VBY A;  1BIA A;  5HS7 A;  5H20 A;  1Z1D A;  4UXN A;  1ZLJ A;  2RDP A;  4HLX A;  5ICG A;  1YS7 A;  2VOO A;  3FHZ A;  4I2O A;  1XCB A;  2VBZ A;  1SFU A;  3T8R A;  2E7W A;  5CYV A;  1I6X A;  3KZZ A;  3MZY A;  1R36 A;  1KQ0 A;  2HKX A;  5L3F A;  5DCF A;  1RI7 A;  2VC1 A;  1CF7 A;  4HW0 A;  1GHC A;  1MJB A;  5E18 F;  1S29 A;  1HKS A;  3CO6 C;  2XAJ A;  2ZKZ A;  4UVA A;  3WTT C;  2F5F A;  2FBK A;  3R60 A;  4Z2Y A;  1LEB A;  3V8K A;  4KIB A;  3E3V A;  3WU0 A;  3BJO A;  5ERI A;  2Q8K A;  3R6S A;  2J5O A;  5D8K B;  2HOE A;  3IKT A;  2ZNZ A;  3B73 A;  5E1X A;  2P6T A;  4XSX F;  2DW4 A;  1FBU A;  5JVT A;  1JGS A;  5D6F A;  1TNS A;  3DV8 A;  1BIB A;  3JTH A;  2CGP A;  2H27 A;  2QYO A;  1V4R A;  3CJN A;  1IN5 A;  4HF2 A;  3FMR A;  3R61 A;  2HTS A;  1JE8 A;  4LG0 B;  4XBF A;  4I98 B;  1HKQ A;  2ELH A;  1H0M A;  2IA1 A;  3CUQ A;  3QRF F;  5FD6 A;  2K4B A;  4G7O F;  2CWE A;  3KET A;  2PMH A;  1UHW A;  2L4M A;  5FO5 A;  2PI0 A;  4ZH4 F;  1OYW A;  2W84 A;  2KRF A;  1WSU A;  5FB2 A;  1Z7U A;  4O6J A;  4AWX B;  1XGS A;  4ESB A;  1ZAO A;  3WG9 A;  4G6Q A;  2DLL A;  4LB6 B;  1GXQ A;  1FYM A;  4MNU A;  2GZW A;  3V7S A;  1HBX G;  4LK1 F;  3DF8 A;  4I0A A;  1U6G A;  4CO8 A;  5IT9 K;  4QLC U;  2FRH A;  1WKM A;  4KIC A;  1H9G A;  2V6C A;  4ESF A;  4LK0 F;  5HLI A;  3M7G A;  3J80 K;  3J81 K;  4ZZD A;  3EDP A;  2A68 F;  1SFX A;  2W25 A;  3LWF A;  3CO7 C;  4ZYH A;  2V1U A;  2FF4 A;  3ERE D;  3TQN A;  2G7U A;  2ZCW A;  3BY6 A;  1C0W A;  1IAW A;  4M73 A;  2A07 F;  1FOK A;  2MH9 A;  1KU2 A;  2IPQ X;  3I0T A;  1U5T A;  3LA2 A;  5AIP A;  3GVA A;  1WQ2 A;  3KP5 A;  3LQQ A;  1SD4 A;  1TQM A;  2IT0 A;  2VXZ A;  4N9H A;  3GWZ A;  1IXS B;  5IT9 Z;  2ETH A;  2EA2 A;  3Q5F A;  1YO5 C;  5D5V B;  5D4S A;  4LGW A;  2Y75 A;  4BHP A;  4Q47 A;  3BPX A;  1Z91 A;  2RNJ A;  2EK5 A;  3GYH X;  1J59 A;  3ABU A;  1BI0 A;  2DQR A;  2FBH A;  2MD5 A;  2O03 A;  4LG0 A;  2VBX A;  1E17 A;  2WC2 A;  3QP6 A;  1W5S A;  1XD7 A;  2H6B A;  5D6E A;  3R0A A;  2M5W A;  2E1N A;  4ON0 A;  3QU6 A;  1XMA A;  4PDK A;  5K1Y A;  3GXO A;  1PDN C;  3KCC A;  3FMS A;  2K4J A;  4LJZ F;  3R4K A;  4K2E A;  3O6B B;  4H0E A;  2M30 A;  3GF2 A;  1P4A A;  3H3Z A;  2BBY A;  3QAH A;  2A3S A;  1QQI A;  4MGR A;  3RPU A;  5CVI A;  4BAY A;  3ROU A;  1ON2 A;  1K79 A;  4DQ2 A;  3LAJ A;  4BHC A;  4L0Z B;  2HEO A;  5LEK A;  5HDN A;  3K9T A;  4PZJ A;  2ISY A;  5BS6 A;  4HDU A;  4Q5S F;  4KFC A;  2J5P A;  3ELK A;  2LF8 A;  1L0O C;  1T0F A;  4XLP F;  1USS A;  2OQG A;  1F4K A;  2IVM A;  4Y15 A;  4UVC A;  4R1H A;  3GX4 X;  1IZ1 A;  3SZP A;  4A2U A;  3C7J A;  2QZ8 A;  4OIO F;  2MA3 A;  3CUO A;  4IHS A;  3BWG A;  1XSV A;  5BMZ A;  3WE3 A;  5CLS A;  1HW1 A;  3S2W A;  1UST A;  5LEJ A;  2XKP A;  3C1D A;  1ZG3 A;  4IJA A;  2P8T A;  1EH6 A;  2NNN A;  5LHI A;  1G3W A;  1OYY A;  4EV0 A;  3DXJ F;  3C18 A;  1BI2 A;  3ECH A;  2VT2 A;  4M9Z A;  3PQK A;  2NAZ A;  2BV6 A;  3ZN1 A;  2M8E A;  2D2W A;  3DQV C;  1J9I A;  2XGX A;  2QQ9 A;  1G6N A;  3OV8 A;  5ICC A;  3J7A O;  3VEP A;  1KQ9 A;  1QZY A;  3F8F A;  1IN4 A;  4EJV A;  2XAQ A;  2PMU A;  2FML A;  4RB2 C;  4EJT A;  3ML6 A;  1S6L A;  2M87 A;  1R1U A;  3KP2 A;  3IRR A;  4HDV A;  5F1R A;  1SMY F;  4M9S A;  3ZMT A;  3F21 A;  2O6G E;  1O3S A;  3EET A;  2DU9 A;  3HRU A;  4HBL A;  1KA8 A;  1XDS A;  3GFJ A;  1B6A A;  4CZZ A;  4EJO A;  5K5Q A;  2BE5 F;  4HF1 A;  1ODD A;  2BEO A;  1DPU A;  2ZFW A;  4MEX F;  5ED4 A;  3FXQ A;  5L3D A;  5ILS A;  4M6Y A;  1HW2 A;  3O3K A;  4IPA A;  3RDI A;  4A12 A;  3DKW A;  3GO5 A;  4AD9 A;  3QP5 A;  1P4X A;  5DYM A;  1D8K A;  4LD5 A;  2UWM A;  2AS5 F;  2F5E A;  3LFK A;  2PG4 A;  5F6F A;  3DPL C;  2MBF A;  3BJA A;  5EEG A;  1NHA A;  2IW5 A;  2CQK A;  3KZY A;  1FP1 D;  2XVC A;  3GUD A;  2GQQ A;  3I59 B;  1Z05 A;  4L9V A;  3DFG A;  1LEA A;  4ZZL A;  5E17 F;  4HLY A;  3FXU A;  2FNP A;  3IRQ A;  2DI3 A;  5AON A;  4OU0 A;  1YLF A;  3VFZ A;  3WTZ A;  2GA1 A;  4EGZ A;  2P4W A;  5L3C A;  2G9W A;  1K78 B;  2OD5 A;  5H6R A;  3FM5 A;  4ENK A;  2JSC A;  4EM0 B;  3RI4 A;  3E6M A;  4A5M A;  1FLI A;  1Z6R A;  3P9C A;  1SMT A;  4MEY F;  5LGT A;  4HX7 A;  4RS8 A;  4ESJ A;  3HHH A;  5BPI A;  2YU3 A;  1S3J A;  2MLG A;  3HOT A;  4OIR F;  1ZRF A;  3LA7 A;  3NRV A;  3E5X A;  4UV9 A;  3ZMU A;  3ISP A;  1G3S A;  3GZ6 A;  1J2X A;  3TO7 A;  3P7N A;  1ZHF A;  5DUI A;  3IWZ A;  5CVJ A;  5TJJ A;  4XSZ F;  1O7F A;  1KGS A;  1QZZ A;  4OOI A;  4UHT A;  1K7A A;  5L3B A;  4L0Y B;  2V1D A;  2P5V A;  4L5I A;  3REO A;  2CYY A;  5HLH A;  4IRG A;  2XAF A;  2ZJ2 A;  3I71 A;  1TNT A;  4N0B A;  2A5Y B;  1DPR A;  3F8M A;  4JK1 X;  2Y0M A;  3RKX A;  1ZN2 A;  1MJ9 A;  2PQ8 A;  4NHJ A;  5BOX A;  2P7V B;  2IP2 A;  2OBP A;  1BM9 A;  1EH7 A;  2V1X A;  4RGU A;  5CVR A;  2OA4 A;  4OMZ A;  3TDZ C;  2IJL A;  2QBY A;  1XMK A;  1UHM A;  3ECO A;  3ZMD A;  5L3E A;  3KP3 A;  2FBI A;  5IT3 A;  5JHU A;  2WWY A;  3ZMS A;  4I7H A;  1Z9C A;  2A6H F;  5EEH A;  3RKW A;  1P2F A;  3COA C;  2DFI A;  4UV8 A;  2RVC A;  3T0Y A;  1T98 A;  4A6E A;  5F64 A;  1ON1 A;  2TDX A;  4EM1 A;  4NB5 A;  2VBW A;  4U0Y A;  5CVV A;  2B0L A;  4ENN A;  1OYI A;  1RIO H;  3KLN A;  3RTR A;  2KJC A;  5D4R A;  3E97 A;  1W7P B;  1XSX A;  3NQO A;  1U2W A;  1ZYR F;  3L2C A;  3M9A A;  1B1B A;  1MZB A;  2LSO A;  1KQ8 A;  4BQA A;  4MTD A;  2KKO A;  4YFK F;  5CVU A;  4KMF A;  1KYZ A;  2G7H A;  5J8C A;  2CW0 F;  4KYW A;  2UXX A;  2RKH A;  1IN8 A;  2P5L C;  3KFW X;  1W7P D;  4OMY A;  3FF5 A;  2MH2 A;  5HDK A;  2HGC A;  3GFL A;  2ACJ A;  1F9N A;  1K78 A;  2V79 A;  4G7Z F;  4EMS A;  1XB4 A;  3TDU C;  1TW3 A;  3W6J B;  2JT1 A;  4HOB A;  2F5D A;  4BH9 A;  1FBQ A;  3V8L A;  3U9G A;  5DD8 A;  5J8F A;  4I01 A;  1X3U A;  1YIO A; 
#chains in the Genus database with same CATH topology
 2K9M A;  2QQA A;  1P4W A;  1R22 A;  2R4G A;  3HGY A;  3HGG A;  1RC9 A;  3OOU A;  1LQ1 A;  4HA8 A;  1K4S A;  1IXC A;  1R71 A;  3BQZ A;  4F3Q A;  5A2Q K;  3ZPL A;  1R5I D;  2CU7 A;  2X9D A;  4RDU A;  4CHU A;  2LD5 A;  4ENM A;  1IUY A;  1Z21 A;  3A1Y A;  3CDH A;  1SVL A;  3PQJ A;  2V9V A;  2VAS A;  1ZG5 A;  1X1B A;  5DS9 A;  3PFY A;  1XG1 A;  1R5H A;  1Q1H A;  2EFN A;  5EJC A;  3F8C A;  3LSR A;  1BR2 A;  1A04 A;  1LDD A;  3FM3 A;  3QU3 A;  4S05 A;  4AIH A;  2EFO A;  5K5R A;  2YX4 A;  3G6E I;  2PLY A;  2FSW A;  1VTN C;  1HC8 A;  4UNO A;  4D1Q A;  4PJ0 C;  3HOS A;  4FET A;  3TKY A;  4G7H F;  2HZD A;  1ETV A;  2TRT A;  2D1V A;  1ZH5 A;  2OCE A;  1G59 A;  1TQI A;  3KP6 A;  3I5U A;  3UNG C;  3H5A A;  2Y48 A;  4RGX A;  3L2V A;  4L9J A;  3S2H J;  4PGG A;  1ZK8 A;  4EJW A;  2BY0 A;  2EFQ A;  5HLG A;  2XAH A;  1YW8 A;  4I02 A;  3BJ6 A;  3K7A J;  2K02 A;  1DP7 P;  1SAX A;  3IHU A;  2GA2 A;  2MD0 A;  1NG7 A;  3G3Z A;  1G2H A;  3OIP A;  2DA1 A;  1HW5 A;  1SVM A;  2ESH A;  2PFB A;  3MZH A;  1O7L A;  3LA3 A;  3P9K A;  3TBI A;  1KU3 A;  3TW7 A;  5EEA A;  3L1P A;  2HPI A;  1FBS A;  1WJF A;  4JX6 A;  1LB2 A;  1F5T A;  5GPC A;  4YFN F;  1I50 J;  5FFX A;  4BBS J;  3MWM A;  1T33 A;  2CFO A;  4DYC A;  3HOU J;  3QPH A;  4BNC A;  4UUS B;  2L4A A;  1UB9 A;  3S1N J;  1QVT A;  2DO7 A;  1FOY A;  5A2Q Z;  4A3K J;  1O3T A;  1I27 A;  1U8B A;  3DWL E;  1O4X A;  1YS6 A;  5GPA A;  5E3O A;  1VZ0 A;  1IC8 A;  5DV5 A;  1XDU A;  2DMQ A;  4M3F A;  1R9T J;  3BG7 A;  1D0Z A;  3TO9 A;  1FEX A;  2Z5U A;  4BQQ A;  2BY2 A;  3F6O A;  5J47 A;  1MH4 A;  4B1R A;  2VON A;  2BYV E;  4AID A;  1OMI A;  4I0B A;  2IGM A;  5TIS C;  3WG7 H;  4WXH A;  3BQY A;  2EFW A;  3S8P A;  3EYY A;  2WV0 A;  1T2K A;  2A6E F;  4W97 A;  5KVR A;  1I6H J;  2NVQ J;  3CZ6 A;  4XON A;  2ZSH B;  4EQQ A;  1HLV A;  5DUK A;  1DDN A;  2YX7 A;  1ONV A;  3K0L A;  2CG4 A;  1MIJ A;  3CDL A;  5C4J J;  5E8G A;  2JZY A;  3S1R J;  2F4I A;  1SD6 A;  5BPD A;  1AA7 A;  3LSK A;  1ETX A;  4ASN A;  1OR7 A;  4XRM A;  1YE9 A;  1I5Z A;  4MO7 A;  2O7O A;  3J7Y J;  1A6I A;  3O2P E;  2CFX A;  2OTJ I;  4M3G A;  2L5Q A;  1B8I B;  1TP4 A;  2XAU A;  2V26 A;  3QPT A;  4E70 A;  3LSH A;  4NDL A;  1QGP A;  3RJP A;  1WJE A;  1PYV A;  3E7L A;  1X1P A;  5FKL A;  1HST A;  5LLQ A;  1JUS A;  1QU3 A;  4A0X A;  2NOJ B;  2ZJQ F;  1MMA A;  3HUG B;  2EIK H;  1JT0 A;  3ZQH A;  4MTE A;  2GAU A;  2ZXH A;  2MC4 A;  3U1K A;  3HBL A;  3WOD F;  3CMA I;  1DUX C;  3OR2 C;  1W1W E;  3H3U A;  1YYV A;  2Z2S B;  1BC8 C;  3I53 A;  1XX5 A;  4IHW A;  3S93 A;  4A5N A;  3A01 B;  4BJ6 C;  2DBB A;  3TP3 A;  2EIL H;  5M5X J;  1RR7 A;  2ID6 A;  2L9R A;  3BCA A;  4BXU A;  2HKO A;  4FT8 A;  4A3B J;  2N8G A;  2ZME B;  3V42 A;  3K4K A;  5GAE J;  4G12 A;  3JSO A;  3K1N A;  2CJJ A;  3GZN B;  3GLL A;  3WGG A;  2VE9 A;  3GFI A;  2L02 A;  3ABL H;  3F9K A;  4L9T A;  3L00 A;  2NS8 A;  3D1N I;  3N05 A;  4Q4Z F;  2XAG A;  2KL4 A;  3HYI A;  3HOV J;  2H94 A;  3CCM I;  2W24 A;  2RN7 A;  4RLF A;  3TW6 A;  2F6C A;  5D5X B;  3V7R A;  5EDN A;  5TRD A;  2BGC A;  1D0Y A;  3OSF A;  3GTL J;  3CTA A;  4CDG A;  2STW A;  4M71 A;  3S1M J;  3RYP A;  3BR5 A;  2E19 A;  3GLX A;  2DFH A;  1WJB A;  3G73 A;  4I99 C;  3VDX A;  3GTO J;  2CO5 A;  3TL4 X;  1UEL B;  3BCB A;  3SQN A;  1R5G A;  1XGM A;  4C3J J;  5J6X A;  1QBJ A;  2L0K A;  4M3B A;  2V9K A;  1FT9 A;  2FQ3 A;  3I56 I;  2VOP A;  2KZG A;  1IRG A;  1IXR C;  3C2G A;  4DYR A;  4IF4 A;  2VJ5 A;  2DFE A;  2DOD A;  2M7B A;  2Z1D A;  5FLV A;  3CME I;  3T1B A;  1TWC J;  3BR2 A;  4II3 A;  1O57 A;  3FK7 A;  1UFM A;  4WX9 A;  1FYK A;  5D5U B;  2Z9O A;  1HOM A;  5E3M A;  1E2X A;  5DCM B;  2DYR H;  4M9X A;  3WTY C;  3SZT A;  3DU5 A;  4U7B A;  2QLZ A;  1IDY A;  2ICW G;  2EWN A;  4DZP A;  5H2F C;  2QUF A;  2DAO A;  3K1M A;  1WVR A;  2I5U A;  4M74 A;  4D0P A;  4HNU A;  2H6C A;  2COB A;  2FOK A;  5CQG A;  1J09 A;  4KIF A;  3SHF A;  3QOP A;  2KMU A;  2WA0 A;  4R79 A;  4B09 A;  2W48 A;  3I4M J;  4DBQ A;  1S7O A;  4U0V A;  1BJA A;  1F36 A;  3JTG A;  3TMO A;  2F5V A;  3ZQQ A;  2LKP A;  3GTG J;  2E1M C;  1GXP A;  3WHB A;  4WCG A;  4RAZ A;  4ZTF A;  2CUZ A;  2FA5 A;  2ZBK A;  1RUO A;  3HKZ A;  5AIQ A;  1XSD A;  2KHM A;  4F93 B;  3ULQ B;  5KHD A;  2P7C B;  3Q9V A;  3K2Z A;  2DK8 A;  2K3F A;  4ZDO A;  1N25 A;  5K7Z A;  1CF7 B;  5CKT A;  1OQY A;  1VF9 A;  4KDP A;  4XRS G;  1UHS A;  2HU9 A;  5J1Y A;  3HOW J;  3OS1 A;  1WRJ A;  2RNG A;  1YFH A;  4U0W A;  3FXJ A;  1D3Y A;  1MJA A;  2R7V A;  4KUM A;  1ETY A;  3FIS A;  3ZP5 A;  4MFD A;  2MG4 A;  4XNF A;  3H5R A;  3K2A A;  2F4M B;  3BT9 A;  5FFZ A;  5LRS A;  3DBR B;  4AIJ A;  1U9O A;  5IY5 H;  1FNN A;  1W5C C;  4CZC A;  2EV0 A;  1JGG A;  3RKQ A;  4N4O B;  4MQV A;  4A0Y A;  2KQR A;  4A3F J;  1VND A;  1W4M A;  3IUO A;  3HRM A;  4EAT A;  2JTV A;  3H0G J;  4B43 A;  2JQ7 A;  1ETO A;  2GM4 A;  2R7X A;  4HX8 A;  3D0S A;  5IYC J;  1G3T A;  1STZ A;  3OS0 A;  2VI6 A;  4HX4 A;  2ECC A;  2ZXJ A;  1BI1 A;  1IN7 A;  5L3G A;  3PJR A;  4BYY A;  4O5V A;  3C2H A;  2DOF A;  2JA7 J;  3ASN H;  3R0J A;  4KNY A;  2VE8 A;  2LLK A;  2E71 A;  4DIQ A;  3ZMZ A;  4HV6 A;  1QPM A;  1S5L C;  1G3Y A;  4KIG A;  5HS9 A;  3HTU A;  4WK8 F;  1S72 I;  2VJJ A;  1HA8 A;  2DXI A;  4CIC A;  2JA5 J;  2NOG A;  1IN6 A;  2CQQ A;  3FWE A;  3HUG A;  3M8E A;  2NVX J;  1TQP A;  4HF0 A;  3KEQ A;  2HQN A;  3ESW B;  1JHH A;  3QYB A;  2CUF A;  2VPL A;  2K7L A;  1ZKG A;  3M1E A;  1R58 A;  3TOB A;  3A01 A;  3FDY A;  5FD5 A;  1ZGA A;  2R5Y A;  1N78 A;  4RAG A;  2QQB A;  1J75 A;  3WTX C;  2M1B A;  4IHT A;  2W85 A;  1MGT A;  2ZME A;  1SC7 A;  1KON A;  2D1H A;  3T5X A;  1MD0 A;  2LDU A;  3J7Z I;  2K40 A;  3WTV C;  4B44 A;  3HDD A;  2B63 J;  2MSY A;  4RGS A;  3BP8 A;  3ZN0 A;  4OIQ F;  3S17 J;  4ZYE A;  3OYN A;  4RB0 A;  3LSJ A;  3ZQC A;  3K70 C;  2DTR A;  3MVP A;  2PMZ N;  2DA2 A;  1VQ7 I;  3PFI A;  3FIW A;  2M4K A;  1B72 B;  2V9P A;  4A6D A;  2KJB A;  2L3D A;  1J0R A;  3P9I A;  3W2A A;  2BXZ A;  2LNB A;  2FEZ A;  4GYI A;  5ILU A;  1V3F A;  2JVG A;  3ABT A;  5FGM A;  5HOO A;  1PJR A;  2KDO A;  4DNC A;  1YX5 A;  4LLG F;  1WCM J;  3VSL A;  3KP7 A;  2RQQ A;  3FKJ A;  2BY1 A;  4RB3 C;  2DPU A;  4AUX A;  3KLO A;  1MBH A;  3VB2 A;  3O8G A;  3KE2 A;  2IXS A;  2E1C A;  2A61 A;  2L7K A;  2XIG A;  5DCM A;  2F48 A;  1Z77 A;  2YU9 J;  2ZNY A;  5J1R A;  4N4N B;  2IS6 A;  3F72 A;  3CDI A;  3HEF A;  4XL9 A;  1BOA A;  2V1N A;  2HQR A;  2HQ5 A;  4G6D A;  3GME A;  2LRD A;  1MDM B;  2Q2E B;  5HDG A;  6PAX A;  2NNY A;  2G0E A;  2BXY A;  4GGG A;  1Z6T A;  5FLX K;  5E8I A;  3MEX A;  2LKX A;  4M72 A;  2KPM A;  4IKF A;  4QTR A;  3E6C C;  3W6K B;  2ZSI B;  5M3F J;  2L01 A;  4HNV A;  2HVS A;  3I55 I;  1XTA A;  4XK4 A;  2FUG 2;  2NVY J;  1SFE A;  4HV5 A;  2OPT A;  2XV4 S;  3FXO A;  2R7S A;  2PJP A;  1U78 A;  4H4K C;  1R1V A;  1TBX A;  1YX3 A;  4V2G A;  2GLO A;  3I4P A;  3TOA A;  1I39 A;  2OQR A;  3BR3 A;  3Q3S A;  4KT6 A;  4MQ9 F;  5BQT A;  2BOL A;  2XUB A;  1RES A;  1Y56 A;  3IWF A;  3JSP A;  1YTY A;  2JMW A;  4L9N A;  4YIR X;  2LY2 A;  2QSF X;  2ESN A;  1A31 A;  1RPW A;  3MMY B;  1MBF A;  2EIN H;  1B9M A;  2VUM J;  1IG7 A;  1BR1 A;  1XPX A;  2E7X A;  3HIF A;  4IXA A;  3QQA A;  2EV6 A;  2FXA A;  2EBI A;  3I54 A;  4EJU A;  5H6Q A;  2XGE A;  1H9T A;  3WTW C;  2OZU A;  4GCV A;  4KT5 C;  1JHF A;  3CUQ C;  1NG6 A;  2UV1 A;  4KN4 X;  1LKX A;  3V7C A;  3LFU A;  1KYW A;  1L3L A;  3CMY A;  2QEN A;  2P0W A;  4M3D A;  1U5T B;  3GTJ J;  1S7A A;  5M5Y J;  1FSH A;  2JPB A;  4X6A J;  3C2B A;  1Z7L A;  3C3W A;  2FD5 A;  2A05 A;  1PUE E;  3QYF A;  2FU4 A;  3HTS B;  1ZGJ A;  1K6O A;  2CW7 A;  2PMZ A;  3MFK A;  1H8A C;  2O8X A;  2QSH X;  3CCU I;  1OLT A;  2WAD A;  4X0G A;  1B4A A;  1F1Z A;  5C3E J;  4ENJ A;  1MBJ A;  5FLX Z;  1JXS A;  2WV1 A;  5FLM J;  2ELK A;  1GUU A;  4Y7N J;  3MQ0 A;  1ZG1 A;  4P9U A;  4EVI A;  3Q9S A;  4JP0 A;  4Y3O A;  4AU7 A;  1D5V A;  1J5Y A;  2IBD A;  1Y0U A;  1J7K A;  1VQP I;  1XC5 A;  4PCQ A;  1A35 A;  3OYH A;  3CCV I;  1EV7 A;  3GTP J;  4CSW A;  3GTQ J;  1WJC A;  2IGK A;  2OU2 A;  1EKE A;  4BJ5 C;  1X1C A;  2EPF A;  1YJN I;  2DA5 A;  4ZJZ A;  3PIP F;  3SEQ A;  4F7Z A;  3CLO A;  4AYB A;  4NC7 A;  4G94 A;  2OZ6 A;  3I59 A;  5IP7 J;  2RAE A;  2FE3 A;  1U3E M;  5K5O A;  3ZMV A;  2Z16 A;  1X4O A;  4M6X A;  1T95 A;  1RUN A;  3HSF A;  3B6C A;  2F2E A;  3G1L A;  2K9N A;  3JRF A;  1JUM A;  4L18 B;  1IV8 A;  3TO6 A;  3H9G A;  5JHF A;  1YQA A;  2MW8 A;  2M45 A;  5C44 J;  2CQX A;  3BTJ A;  4BHB A;  5JI6 A;  2DMT A;  3RQ4 A;  1Z0X A;  1SD7 A;  2GXB A;  5J40 A;  1QHG A;  1I1G A;  4IL6 C;  4G9Y A;  2E36 A;  2LF7 A;  4BS9 A;  3OL4 A;  2HYF A;  4PGH A;  2DYS H;  4KA4 A;  1IF1 A;  3L2U A;  3VOD A;  5ILV A;  5E1Z B;  2IA2 A;  4I09 A;  4BEH B;  4E4H A;  3L2R A;  2OUM A;  3HHG A;  3FXL A;  3N97 A;  1LDK B;  2P5K A;  4IRI A;  3ZR8 X;  4U88 A;  3IKV A;  2PJR A;  1RET A;  2W00 A;  3JCU C;  3PUF A;  5B5E C;  3M8F A;  2DOA A;  2K27 A;  2XAS A;  4NC8 A;  3MN2 A;  4P5O A;  4BL0 B;  4BY7 J;  3F8B A;  2O9L A;  5JR3 A;  1V5G A;  4PJJ A;  3QOE A;  4L5E A;  3RIR A;  3MAJ A;  2IRF G;  5D8L B;  3HOX J;  2C6Y A;  4FHT A;  1UAA A;  5LGU A;  2JPC A;  4OIN F;  3EUH A;  4EGY A;  2UXN A;  1PUF B;  4KMU X;  1D0X A;  2RC4 A;  1FWZ A;  1U5T C;  2CRG A;  4P9F A;  4UUT A;  1IDZ A;  1T6S A;  2NYX A;  2L7Z A;  1ERD A;  1MDM A;  2Q2E A;  2ZO4 A;  1AKH B;  2VXD A;  3RPU D;  3NEU A;  3ZGK A;  1HCR A;  5EGO B;  3LAP A;  3MKY B;  1T39 A;  4HQE A;  2DOE A;  2LFB A;  1FIP A;  2QEX I;  1R1T A;  3ZQ7 A;  4I76 A;  1T38 A;  4XRF A;  4RAY A;  2STT A;  1HQC A;  3DKY A;  1XGN A;  1LVA A;  2O5R A;  3MCZ A;  5GTI C;  3G1M A;  5B66 C;  1UZC A;  1T8I A;  1P7I A;  3NWS A;  3K69 A;  2XRO A;  2EIM H;  3D5L A;  1IRF A;  4FCY A;  2DQL A;  1OCZ H;  1FSE A;  2VT3 A;  5HOD A;  4C9Y A;  3BOQ A;  4Y17 A;  4XIC A;  3IC7 A;  2IGO A;  4CCL A;  5ICF A;  2YSR A;  2RQP A;  5F04 A;  3RPQ A;  2WAE A;  1WWX A;  2XGD A;  4E7K A;  4O3M A;  4U7D A;  1LFU P;  1IUF A;  4AM3 A;  1P6R A;  2EZL A;  2X1E A;  2DPD A;  5DTD A;  1R4M B;  3HOY J;  5E1W A;  1DGR M;  1TL8 A;  1EF4 A;  5LBQ A;  4AVP A;  2PN6 A;  3JRD A;  4NQW B;  1TLH B;  1YG2 A;  3FZV A;  4P96 A;  4DOZ A;  2CSO A;  3FXR A;  3KP4 A;  1BC7 C;  4RMN A;  1FP2 A;  1ZRD A;  3W3C A;  2OJE D;  1WJ5 A;  4PK4 A;  3WE2 A;  3M3Y J;  2IA0 A;  2YPR A;  3BG3 A;  3LQR A;  4AIK A;  4L5J A;  2R7O A;  1RNL A;  1FZP B;  4DGW B;  1EH8 A;  2DCE A;  4XN0 A;  2B9S A;  2XHK A;  2XC7 A;  5HNF A;  1JI8 A;  2LR8 A;  1GT0 C;  1MMG A;  2M0M A;  2CQN A;  2QKM B;  4XKB A;  3K1P A;  2K9Q A;  1FMV A;  5B1A H;  3CCS I;  4ZC3 A;  2LY1 A;  5KNL A;  4A3D J;  4PFO A;  4LLL A;  5JLX A;  1XGO A;  3F22 A;  3HRT A;  4QSH A;  2HR3 A;  3K4J A;  4KIT B;  3G71 I;  3ZQL A;  1MNE A;  2R0Q C;  2XPV A;  3D5R C;  2LMD A;  2L2O A;  3Q0V A;  4JBA A;  2QGU A;  1UCR A;  3VSK A;  3E6D A;  3J80 Z;  3SFI A;  3J81 Z;  1FPQ A;  1W36 C;  3CQZ J;  4Z6Y A;  2WTE A;  2XKO A;  1PVE A;  2UZK A;  3JRG A;  5B1B H;  4TV7 A;  4ABZ A;  2D45 A;  3B6A A;  5CJ9 A;  4ZYA A;  5KK1 A;  4J01 A;  4EM2 A;  3WU1 B;  3G1O A;  1W7P A;  2NS0 A;  2X6O A;  3E0J B;  5IYD J;  4IEJ A;  2NRA C;  2L9N A;  3S14 J;  1H89 C;  1HSJ A;  1ZRE A;  2DT5 A;  4N9I A;  4A3M J;  4WWC A;  3H36 A;  2E1M B;  2DT7 B;  3CES A;  2QM3 A;  4ZDL A;  3HKZ N;  2GXG A;  3TP0 A;  1WI9 A;  2FNA A;  2HWV A;  1MNM C;  1WJA A;  2WB1 N;  1T0F C;  3FHN A;  5DEQ A;  2O3F A;  4RB1 A;  1ZLK A;  4LFU A;  1ENH A;  4JQF A;  3BR1 A;  4ITV A;  1SEU A;  2XPU A;  1OCO H;  4IVN A;  2HZT A;  5C4X J;  3GTM J;  1TW2 A;  5LGN A;  3CD6 I;  1SVO A;  2MFZ A;  1ULY A;  3SZG A;  1U8R A;  3PO3 J;  1X3W B;  1Y0N A;  4QWQ A;  4CH7 A;  2HOA A;  4BKX A;  3OYF A;  2AO9 A;  3L09 A;  2AXL A;  2K86 A;  4QPO A;  4BEH A;  4XLN F;  2XGC A;  1OPC A;  3M1C A;  2HFH A;  4ETS A;  4DBR A;  4J19 A;  1OKR A;  4WXC A;  2DMU A;  4R8H A;  3L7W A;  4BAC A;  4GRI A;  5DDG A;  1REP C;  4E7H A;  5JFR A;  2W7N A;  2XF7 A;  2UUZ A;  3HPG A;  3OMY A;  2IS2 A;  1IO2 A;  2X4H A;  3W2V A;  3F6V A;  5D5W B;  4U87 A;  3ZQI A;  2ADU A;  2Z99 A;  4YG2 F;  2R92 J;  1R23 A;  4FX0 A;  4LLN A;  1PP7 U;  1X1D A;  4YEL A;  4BQN A;  3U2R A;  4HEA 2;  5DM7 F;  3OYG A;  5KCM A;  3H92 A;  3F23 A;  2X6Y A;  3L9F A;  4FTH A;  3HOZ J;  1D1A A;  2DK5 A;  4BUP A;  2MLK A;  3HSR A;  9ANT A;  3BRO A;  1VI0 A;  3AL0 B;  3U1D A;  1BN5 A;  4KN7 X;  1SFK A;  1AHD P;  3PSF A;  4S0H B;  1RZ4 A;  4YII A;  2DN0 A;  4OWR B;  5LRR A;  3V4G A;  3OYK A;  1X58 A;  2EJR A;  4XKC A;  5EGO A;  3S3N A;  1DP3 A;  1TWF J;  1B9N A;  1FC3 A;  3OYL A;  5GP9 A;  4Y13 A;  1DU6 A;  3OOP A;  1AWC A;  1RKT A;  1KU9 A;  2HYG D;  4XN3 A;  4BBR J;  2MC3 A;  3E5Q A;  3A03 A;  1HKT A;  1XMX A;  2HTJ A;  2PEX A;  3KEY A;  2BY3 A;  3FX3 A;  3F8N A;  4WF2 A;  3AG4 H;  1XCV A;  3BZ6 A;  2HS5 A;  2A5W A;  3JW4 A;  1ETW A;  2RV8 A;  1HDP A;  3SDB A;  3HSE A;  2VJI A;  3BPV A;  4RBO A;  2O61 A;  1YW7 A;  3VYT B;  4IOA F;  1OCT C;  3B02 A;  4DJA A;  1XN7 A;  1Q1V A;  3WGI A;  5LHG A;  2VKD A;  4NQW A;  5ICE A;  2LG4 A;  3N4M A;  2QWW A;  2HDW A;  3JAM K;  4B3A A;  2K3P A;  3M8J A;  1O3Q A;  1HXD A;  2VKH A;  4D7M A;  4Q48 A;  2MAB A;  3PNY A;  2X0L A;  3AFH A;  1R00 A;  3DPT A;  2W57 A;  3SJM A;  3G2B A;  2WB1 A;  1RKW A;  3TED A;  3VYR B;  1LE8 B;  1AOY A;  4GO1 A;  1K83 J;  2KZV A;  2COM A;  2FMY A;  4UUS A;  5EZG A;  1WH5 A;  2OAZ A;  1R7J A;  3HRS A;  3LSM A;  1Y8Q B;  3S3O A;  3WGH A;  1YJ9 I;  1SD5 A;  3ABK H;  1JTX A;  1YI2 I;  2DFF A;  4XLH A;  2Z3Y A;  3CJQ B;  2R7Q A;  2WAQ A;  4LB5 A;  4ZYD A;  3F3X A;  5FRN A;  3VOE A;  1F43 A;  5FKM A;  4XOP A;  3BLY A;  1LNW A;  3K70 D;  2OTL I;  2H09 A;  2ZXI A;  1OCR H;  3S1Q J;  1Y1W J;  4NUB A;  2VLA A;  1YW9 A;  4IRH A;  3RYR A;  2YUS A;  4HZF A;  2Q0O A;  3GEZ A;  3LSG A;  4LMY A;  4FQG A;  2EB7 A;  2R3S A;  1X1A A;  1W5T A;  4PUS A;  1MBG A;  3BR6 A;  1PP8 F;  1POG A;  3DP7 A;  3RQI A;  3H0D A;  4MHG A;  4CYD A;  1I3Q J;  2E5N A;  4UVB A;  3SYT A;  4BQO A;  1KU7 A;  3OSG A;  3AL0 C;  4P55 A;  1FY7 A;  1MKM A;  2KIM A;  3SXY A;  2D5V A;  1B59 A;  2E35 A;  2EV5 A;  3CC7 I;  2QVO A;  1BW5 A;  3EYI A;  2H1K A;  3WTS C;  3CCE I;  3CCQ I;  1P92 A;  1VQK I;  1BL0 A;  1B8I A;  3X2Q H;  2I8D A;  4GXO A;  3RKY A;  3GW2 A;  2XRN A;  4JOM A;  1CGP A;  2RGV A;  2HYJ A;  2QQ8 A;  1VQN I;  2EA4 A;  2R7F A;  5F08 A;  3CJT B;  1JKQ C;  1GV5 A;  2V6E A;  2Z33 A;  2GXA A;  2ZJP F;  3JAM Z;  5HVQ C;  4GYG A;  4XMY A;  1MW7 A;  1O3R A;  3TGN A;  2EZK A;  5DD4 A;  2KIU A;  2QBY B;  3K4B A;  4WXD A;  2KRC A;  1FX7 A;  2XRL A;  4AC0 A;  3E1S A;  4FAS D;  2KIQ A;  1TTY A;  3L2W A;  1YRN B;  4A0Z A;  3H9J A;  1D8J A;  1FYL A;  1SFO J;  2EFP A;  2PBI A;  2P6S A;  2CW8 A;  2H1L A;  1QO0 D;  2O0Y A;  5EZH A;  3V8J A;  2CUE A;  4UY8 I;  2VL8 A;  4A3G J;  1BI3 A;  2Q1Z B;  1QNT A;  3BDD A;  2DT6 A;  1U9N A;  2LY9 A;  2LH9 A;  1S8N A;  1BBY A;  1G4D A;  2GWR A;  3EQL F;  1ZAR A;  3SFZ A;  3CUQ B;  1Y8R B;  5E3L A;  4FX4 A;  2BHY A;  3IL2 A;  3DEU A;  4OIP F;  3E5U A;  4YIF A;  1GVJ A;  1X19 A;  4HAM A;  5E79 C;  2VC0 A;  3DCF A;  2R7D A;  2L54 A;  3ZCO A;  4CA0 A;  3I58 A;  1I1S A;  4F52 A;  5F0C A;  4HYE A;  5TGT A;  1ZRC A;  1LFP A;  3OWT A;  5HS8 A;  3AAF A;  3GFM A;  3T8T A;  4CGZ A;  2HDC A;  3E6B A;  2ISZ A;  1OFC X;  1RRJ A;  2CH0 A;  5K7F A;  4DYQ A;  3KEO A;  1LDJ A;  3SDG A;  4RGR A;  2VN2 A;  2JRT A;  3GZ5 A;  1WPK A;  4YFX F;  1LJ9 A;  2VOD A;  4HQM A;  2JWT A;  4A3C J;  4B8X A;  1TC3 C;  1ZEL A;  4JX4 A;  1S7E A;  4ZYG A;  5J4V A;  3I3L A;  3ZOB A;  4G8X A;  4S04 A;  2KT0 A;  2YR2 A;  2QKL B;  5LHH A;  2GIV A;  3LST A;  3WTU C;  2CV1 A;  2NVT J;  2F5C A;  4PFP A;  1JT6 A;  1IW7 F;  1A5J A;  4CXF A;  1ETK A;  3QPS A;  3FMQ A;  2A69 F;  3I64 A;  5E20 A;  4M3E A;  3CMM A;  4AYB N;  2WBM A;  4UUV A;  3IAM 2;  2KIF A;  2EZI A;  2VBY A;  2JA6 J;  1BIA A;  1MBK A;  5HS7 A;  4Y33 A;  2HPM A;  2EZH A;  5H20 A;  1Z1D A;  4UXN A;  1ZLJ A;  4BJT A;  2RDP A;  3BZC A;  1T56 A;  4HLX A;  3H5N A;  5ICG A;  2M34 A;  1YS7 A;  1YOV B;  2DA6 A;  2VOO A;  3FHZ A;  4I2O A;  2GIZ A;  1XCB A;  3PM1 A;  2VBZ A;  1SFU A;  4D9J A;  3T8R A;  2E7W A;  5CYV A;  3OIQ A;  3IV5 A;  1I6X A;  1MH3 A;  3KZZ A;  1FTT A;  1OCP A;  2LRE A;  3DLA A;  3K4N A;  1SAU A;  3MZY A;  4BE1 A;  1R36 A;  1LE8 A;  1KQ0 A;  2HKX A;  3OS2 A;  4C2U A;  2M7A A;  4MIM A;  5L3F A;  2Y9Y A;  1LVK A;  1VQ9 I;  1DGW Y;  3K6G A;  5DCF A;  4GDF A;  2ME0 A;  5IOY A;  1RI7 A;  3Q0U A;  2VC1 A;  2AXT C;  1CF7 A;  4HW0 A;  3BC8 A;  1T08 B;  1GHC A;  5KAI C;  1MJB A;  1TT0 A;  3I9V 2;  4XLE A;  5E18 F;  1V5E A;  1S29 A;  1HKS A;  3CO6 C;  3KYD B;  2XAJ A;  3ASO H;  2ZKZ A;  4MFE A;  1LPQ A;  1JKP C;  4UVA A;  1QPI A;  3WTT C;  2F5F A;  2M8G X;  1ZQ3 P;  1P7J A;  3LOC A;  2FBK A;  3FK6 A;  3R60 A;  4Z2Y A;  2ZB9 A;  4IX7 A;  3V8K A;  1LEB A;  4CCK A;  4KIB A;  5LFA A;  3E3V A;  3CP2 A;  4HPQ A;  2DDB A;  1IRZ A;  2VQL A;  2L9S A;  4FE7 A;  5HNH A;  4A93 J;  3DU6 A;  3WU0 A;  2JA2 A;  3BJO A;  5ERI A;  5EG0 B;  1QHH D;  2E34 A;  2Q8K A;  3R6S A;  2J5O A;  2E2H J;  5D8K B;  2HOE A;  3IKT A;  3HB9 A;  2ZNZ A;  4IQ4 A;  1X2N A;  3PSI A;  2HOT A;  3B73 A;  5E1X A;  3RZD J;  4AVZ A;  2P6T A;  3ZXS A;  4XSX F;  2DW4 A;  1FBU A;  5JVT A;  2JN6 A;  1JGS A;  3A02 A;  5D6F A;  1TNS A;  3DV8 A;  1BIB A;  3JTH A;  1E3O C;  2CGP A;  2H27 A;  2QYO A;  2XPW A;  1V4R A;  1FTZ A;  4OAY A;  3CJN A;  4LOC A;  1IN5 A;  4HF2 A;  3FMR A;  3R61 A;  2HTS A;  1JE8 A;  2FX0 A;  5IP6 A;  3CC4 I;  1MMN A;  4LG0 B;  1UMQ A;  1IV6 A;  4XBF A;  3JR9 A;  4I98 B;  1HKQ A;  4ANJ A;  5FKO A;  2ELH A;  1H0M A;  1LFB A;  2R5Z B;  1ETQ A;  2JSP A;  2R7R A;  2IA1 A;  2NXN B;  2JRM A;  3CUQ A;  3OL3 A;  3QRF F;  5FD6 A;  1UG2 A;  2DA7 A;  4E6K G;  2K4B A;  4G7O F;  2CWE A;  3KET A;  2PMH A;  1D1C A;  3K10 A;  1UHW A;  2L4M A;  5FO5 A;  2PI0 A;  1V55 H;  2PX9 A;  4RA2 A;  4ZH4 F;  2R7U A;  3BTC A;  1OYW A;  2W84 A;  2KRF A;  1WSU A;  5FB2 A;  1S9H A;  1Z7U A;  4O6J A;  1HF0 A;  3VPR A;  3ZQF A;  3CF5 F;  4AWX B;  1XGS A;  4ESB A;  1IGN A;  2JUC A;  1B72 A;  1ZAO A;  3WG9 A;  4G6Q A;  1FMW A;  2DLL A;  1R4N B;  2ZC2 A;  3OYJ A;  4LB6 B;  2GBY A;  1GXQ A;  2VPR A;  4KIS A;  2BVM A;  1DQU A;  1EJ9 A;  3DEE A;  3F0C A;  2X85 A;  4MNU A;  1ZR4 A;  2GZW A;  1FYM A;  3HZJ A;  3V7S A;  1HBX G;  3Q0W A;  3PUB A;  1YIT I;  4PJM A;  4LK1 F;  3PNT A;  2V4J C;  3DF8 A;  4CUG A;  1Z67 A;  2E2J J;  4LG3 A;  4B3X A;  5JLW A;  2R93 J;  3BG6 A;  4I0A A;  2HXI A;  1U6G A;  4ZDP A;  1QZE A;  2E5Z A;  4CO8 A;  3PIO F;  3J7A Y;  2ELJ A;  5IT9 K;  1LUJ B;  3PNV A;  3MKL A;  4QLC U;  1NH3 A;  2FRH A;  3M07 A;  1BA5 A;  1WKM A;  4MLO A;  1VQM I;  3LNQ A;  4KIC A;  5GTH C;  1H9G A;  1TT5 B;  3S16 J;  3K4C A;  3H1C A;  2FJ1 A;  2V6C A;  1W36 D;  5F0F A;  2X1D A;  1X3Z B;  4ESF A;  1BJZ A;  5F0H A;  4LK0 F;  5HLI A;  2M4G A;  2ZJR F;  3M7G A;  4W1U A;  3H35 A;  5IP9 J;  2TCT A;  5CQE A;  4F92 B;  3J80 K;  3J81 K;  4PSX A;  3ZQG A;  4ZZD A;  3CP8 A;  3EDP A;  3LSP A;  2A68 F;  4CYC B;  1SFX A;  2W25 A;  3LWF A;  3KYC B;  3CO7 C;  4UB6 C;  5FKN A;  4ZYH A;  2V1U A;  2FF4 A;  3ERE D;  2QCO A;  3TQN A;  2G7U A;  2ZCW A;  3CCJ I;  3BY6 A;  4X1E A;  2W1O A;  1C0W A;  3VWB A;  2OV7 A;  1IAW A;  3IH3 A;  4M73 A;  3HM5 A;  2A07 F;  2M0C A;  1N75 A;  1BOB A;  4DZJ A;  2MH9 A;  4XKW A;  3S3M A;  1NK2 P;  1FOK A;  2CV0 A;  1WHU A;  1KU2 A;  1IJW C;  2IPQ X;  2VQH A;  3BTI A;  1E3H A;  2KP6 A;  2KRH A;  2WAF A;  1E0E A;  3I0T A;  3MZ8 A;  2K85 A;  1U5T A;  3LA2 A;  5FRM A;  3K4L A;  4A3I J;  5AIP A;  3GVA A;  4C30 A;  4E7Z A;  1WQ2 A;  2RRE A;  3ABM H;  3WU2 C;  2LC2 A;  5EG0 A;  3KP5 A;  3LQQ A;  1EA3 A;  1SD4 A;  1TQM A;  2IT0 A;  1OR7 C;  2VXZ A;  4N9H A;  3GWZ A;  1IXS B;  5IT9 Z;  2ETH A;  2EA2 A;  3Q5F A;  1YO5 C;  2M3A A;  2VQG A;  5D5V B;  5D4S A;  4BDZ A;  3DBL B;  4LGW A;  2DTZ A;  4XLC A;  2Y75 A;  4BHP A;  3AKZ A;  1ACI A;  3DTE A;  4Q47 A;  3DKX A;  1MSF C;  2NS7 A;  1WZ2 A;  2YS9 A;  3BPX A;  4NC6 A;  1Z91 A;  1V5F A;  4GFB A;  4IHX A;  3OYE A;  2RNJ A;  2EK5 A;  1APL C;  3GYH X;  1J59 A;  3ABU A;  1BI0 A;  2DQR A;  1E3P A;  4HSR A;  4J00 A;  5B3S H;  2V7F A;  2JA8 J;  3P5J A;  2FBH A;  2MD5 A;  2O03 A;  4LG0 A;  3QPL A;  2LK2 A;  2X51 A;  2VBX A;  4PSW A;  3KYL A;  1E17 A;  3CCR I;  2WC2 A;  2XF5 A;  5EYR A;  4RLQ A;  2R5Z A;  2R7Z J;  3QP6 A;  4PJL A;  2KIS A;  1W5S A;  1XD7 A;  2H6B A;  5D6E A;  1VFC A;  5LD2 C;  3R0A A;  2M5W A;  4HG2 A;  3CJR B;  4BXF A;  2E1N A;  3ONQ A;  3DTI A;  1NK3 P;  4ON0 A;  3QU6 A;  1FOW A;  1XMA A;  4HNT A;  2Y69 H;  4PDK A;  4XOR A;  2HVQ A;  2KFD A;  3GXO A;  5K1Y A;  2QA4 I;  2VKV A;  1PDN C;  3KCC A;  3FMS A;  1G8X A;  2B7E A;  4M6V A;  2LYC A;  2K4J A;  5F27 A;  4D5C A;  4LJZ F;  3ERM A;  2DA4 A;  3R4K A;  4K2E A;  1VQ5 I;  3O6B B;  1YIJ I;  4H0E A;  2M30 A;  3GF2 A;  4BU2 A;  1DU0 A;  1P4A A;  3H3Z A;  1RR8 C;  2WAQ N;  4A3L J;  2VQC A;  2BBY A;  1YHQ I;  2KLO A;  1ZR2 A;  3QAH A;  2A3S A;  1QQI A;  4MGR A;  3RPU A;  5GAG J;  5CVI A;  1BW6 A;  4BAY A;  5DM6 F;  3S15 J;  1QVU A;  1ON2 A;  3ROU A;  1UJ8 A;  4XM3 A;  2AHQ A;  1K79 A;  1MMD A;  4DQ2 A;  3LAJ A;  4XKV A;  4E7J A;  2X1C A;  5GAD J;  2XSJ C;  3OYM A;  2VKE A;  4BHC A;  4L0Z B;  2HEO A;  2M2E A;  2NVU B;  1PUF A;  5LEK A;  5HDN A;  1Y39 A;  1GV2 A;  4C2T A;  4QPQ A;  2HNH A;  2E1O A;  3K4M A;  2R5Y B;  3A0B C;  3K9T A;  4PZJ A;  2EQR A;  1JKR C;  2BVL A;  1AKH A;  2ISY A;  5BS6 A;  2KDZ A;  2CMP A;  1VQL I;  4HDU A;  2MYS A;  4Q5S F;  3BR0 A;  4KFC A;  2J5P A;  3ELK A;  2LF8 A;  1L0O C;  1TWG J;  1T0F A;  3VYS B;  4XLP F;  2BW3 B;  1CQT A;  2LBF B;  1MBE A;  1USS A;  2OQG A;  2DMP A;  3FBN B;  3NWT A;  4F91 B;  5J3L A;  4C3H J;  1F4K A;  4RM2 A;  2IVM A;  4Y15 A;  4UVC A;  1P9Q C;  2ZXW H;  4R1H A;  4E7L A;  5IPA A;  3GX4 X;  1IZ1 A;  4NNJ A;  3GCM A;  3SZP A;  4A2U A;  4CYC A;  5JVG F;  3C7J A;  2QZ8 A;  4OIO F;  2MA3 A;  4A3J J;  2IS4 A;  4Y4R A;  3CUO A;  4IHS A;  4JX5 A;  3BWG A;  5FJ8 J;  3DEW A;  1XSV A;  5EF6 A;  3A0H C;  5BMZ A;  3WE3 A;  5CLS A;  1HW1 A;  3S2W A;  4IO9 F;  1UST A;  4OAZ A;  5LEJ A;  2XKP A;  2X48 A;  1WGX A;  3C1D A;  2XDV A;  1ZG3 A;  4BE0 A;  1A36 A;  4IJA A;  2P8T A;  2BHZ A;  3RSN A;  1EH6 A;  1HDD C;  2NNN A;  5LHI A;  4CCJ A;  1G3W A;  2CUJ A;  4ZTJ A;  1OYY A;  3GTK J;  4EV0 A;  3DXJ F;  3L2Q A;  3C18 A;  1BI2 A;  3ECH A;  2VT2 A;  4M9Z A;  3PQK A;  2NAZ A;  2BV6 A;  3QYE A;  2EIJ H;  4C3I J;  4BXX J;  4F55 A;  4JYK A;  2LOO A;  3ZN1 A;  2AQE A;  1WFX A;  1XS9 A;  2M8E A;  2QF7 A;  1R6R A;  2D2W A;  3A4C A;  3DQV C;  1V54 H;  3FKI J;  1J9I A;  5FRO A;  2XGX A;  2QQ9 A;  2VIX A;  1G6N A;  3U21 A;  1W0U A;  3FXM A;  3DPU A;  1JUP A;  3OV8 A;  5ICC A;  3J7A O;  3VEP A;  3JRI A;  1KQ9 A;  2GOM A;  1QZY A;  1VQ8 I;  3F8F A;  1IN4 A;  3EPZ A;  4EJV A;  2XAQ A;  2ID3 A;  2PMU A;  1OJL A;  3KIO A;  3D5S C;  2FML A;  4RB2 C;  4EJT A;  3ML6 A;  3OYD A;  1S6L A;  3OYA A;  3AG2 H;  4BE2 A;  2M87 A;  1R1U A;  3KP2 A;  5GAH J;  3IRR A;  4HDV A;  5F1R A;  1SMY F;  2GOX B;  4XID A;  4M9S A;  3ZMT A;  3F21 A;  2O6G E;  3LSI A;  3EET A;  2DDA A;  2DU9 A;  1O3S A;  2Y30 A;  1TWA J;  3HRU A;  4HBL A;  4XLF A;  5IOZ A;  2XF6 A;  3HJE A;  1KA8 A;  1XDS A;  3GFJ A;  2X6W A;  3W2W A;  2ZME C;  2LTP A;  1B6A A;  4CZZ A;  4EJO A;  5K5Q A;  4BY1 J;  2BE5 F;  4HF1 A;  2HI3 A;  4V19 K;  2L7M P;  1ODD A;  4V2F A;  1H88 C;  2BEO A;  4P1W A;  1DPU A;  2ZFW A;  4MEX F;  5ED4 A;  3FXQ A;  5L3D A;  2L7F P;  1D5Y A;  5M3M J;  4E7I A;  5ILS A;  4E7S A;  4M6Y A;  1HW2 A;  2Y2Z A;  2JUG A;  3O3K A;  3H3V K;  4XQF A;  1FJL A;  1TWH J;  4IPA A;  3VYU B;  3RDI A;  4A12 A;  2Y31 A;  2ZFU A;  3DKW A;  3GO5 A;  4AD9 A;  3QP5 A;  2HOS A;  1I3A A;  2BZT A;  1P4X A;  1OIS A;  1WI3 A;  2Y0S N;  4EEF G;  3JRA A;  2DJI A;  4FE4 A;  3IH2 A;  5DYM A;  1D8K A;  4LD5 A;  2UWM A;  2AS5 F;  2F5E A;  3LFK A;  3QOD A;  3BG5 A;  2PG4 A;  4IQJ A;  5F6F A;  3DPL C;  1VQO I;  2MBF A;  3BJA A;  5EEG A;  1NHA A;  3OIO A;  2IW5 A;  2CQK A;  4KJZ A;  3KZY A;  1FP1 D;  2XVC A;  3GUD A;  2GQQ A;  3I59 B;  1U0J A;  1Z05 A;  4L9V A;  3JRE A;  1UG0 A;  1QRY A;  3DFG A;  4LIU A;  4CCN A;  4XRS A;  4IHY A;  3MKW B;  1LEA A;  3DBH B;  4ZZL A;  4HLY A;  1BR4 A;  5E17 F;  3HC7 A;  4NBQ A;  1ORK A;  3FXU A;  2FNP A;  3CCY A;  1Y6I A;  3FBI B;  3KPH A;  1GDT A;  2BW3 A;  3RCO A;  5BNG A;  2EH3 A;  2LBF A;  1WJD A;  3IRQ A;  2DI3 A;  4B4C A;  5AON A;  5M5W J;  4OU0 A;  1K61 A;  1JKO C;  1YLF A;  1JJ6 C;  3G4S I;  1ZGW A;  2JK3 A;  3VFZ A;  4QIW N;  2CV2 A;  2XB5 A;  3WTZ A;  2GA1 A;  4PJN A;  3UKG A;  4EGZ A;  3FXK A;  2P4W A;  5L3C A;  2G9W A;  1K78 B;  2OD5 A;  3M4O J;  2VJ4 A;  4A69 C;  5H6R A;  3FM5 A;  2WY7 Q;  2K9L A;  5F1J A;  4ENK A;  2PJR B;  2JSC A;  4EM0 B;  3S32 A;  3RI4 A;  3E6M A;  4A5M A;  1FLI A;  4B48 A;  1R49 A;  4HST A;  1Z6R A;  2K9S A;  3P9C A;  1SMT A;  4MEY F;  5LGT A;  1X4P A;  2AQF A;  2W4S A;  4HX7 A;  4RS8 A;  4ESJ A;  1VQ4 I;  4A3E J;  5HLT A;  3SEZ A;  3HHH A;  5BPI A;  4I6Z A;  4D7N A;  2YU3 A;  4D5F A;  1X2M A;  3S2D J;  2QSG X;  3BZK A;  1S3J A;  2X6X A;  2MLG A;  3HOT A;  4OIR F;  1ZRF A;  1JTY A;  1Z3Y A;  3LA7 A;  3NRV A;  3E5X A;  3KZI C;  1MSE C;  2OF7 A;  4UV9 A;  3ZMU A;  1K4T A;  3ISP A;  1G3S A;  4II2 A;  2JVH A;  5E3N A;  3GZ6 A;  3RZO J;  2HXO A;  1J2X A;  3TO7 A;  2CS3 A;  3O8H A;  2FOW A;  3P7N A;  1ZHF A;  5DUI A;  3IWZ A;  5CVJ A;  4YEJ A;  5TJJ A;  3HXL A;  2E2I J;  3AG3 H;  3CF2 A;  2OCC H;  2LP0 A;  4XSZ F;  1O7F A;  4RM3 A;  1KGS A;  1D1B A;  1QZZ A;  4OOI A;  4IOC F;  4UHT A;  3ZRG A;  2Y0S A;  2E60 A;  1K7A A;  1IRX A;  5L3B A;  3HL2 A;  4L0Y B;  2V1D A;  3OY9 A;  1FIA A;  1M1E B;  4YRV A;  1AU7 A;  3A2K A;  2IAI A;  2P5V A;  4L5I A;  3REO A;  2CYY A;  1A6Q A;  4IRG A;  2DJN A;  2XAF A;  5HLH A;  2ZJ2 A;  3I71 A;  4IHV A;  3I4N J;  3JRH A;  1TNT A;  3KX2 A;  4N0B A;  1ZTR A;  2A5Y B;  1DPR A;  3F8M A;  3QWL A;  1Z3X A;  4DW6 A;  4JK1 X;  3CC2 I;  2Y0M A;  2XSD C;  2XB0 X;  3RKX A;  1ZN2 A;  2JJ7 A;  3W6V A;  1WH7 A;  4CCO A;  1MJ9 A;  2PQ8 A;  3BG9 A;  2P81 A;  4NHJ A;  3OYI A;  5J4Y A;  5BOX A;  2P7V B;  5K7H A;  1FOX A;  2A6T A;  2IP2 A;  2OBP A;  1BM9 A;  1EH7 A;  2V1X A;  3HPH A;  4RGU A;  5CVR A;  2OA4 A;  3PL8 A;  2LKS A;  4OMZ A;  2HQA A;  2F4O B;  4G6T B;  2IEK A;  3EUK L;  1QA6 A;  3TDZ C;  2HDD A;  2IJL A;  1K6Y A;  2QBY A;  2H8W A;  1XMK A;  1ITY A;  1UHM A;  3ECO A;  3ZMD A;  2MGQ A;  5L3E A;  1YRN A;  1KZH A;  2R7T A;  3KP3 A;  3IAS 2;  2FBI A;  5IT3 A;  5JHU A;  2WWY A;  3ZMS A;  3NAU A;  4I7H A;  1Z9C A;  2A6H F;  1Y1V J;  5EEH A;  2FQ4 A;  1P2F A;  3RKW A;  2DFI A;  3COA C;  4UV8 A;  3NAR A;  4C2M J;  4LIT A;  2O8K A;  2RVC A;  3T0Y A;  1T98 A;  4A6E A;  5F64 A;  3AG1 H;  1ON1 A;  4BGD A;  1YJW I;  1GLN A;  2Y9Z A;  2TDX A;  4EM1 A;  4NB5 A;  2VB6 A;  2VBW A;  1SAN A;  2HVR A;  4U0Y A;  3UR3 C;  5CVV A;  3WHC A;  2B0L A;  2ME6 A;  4ENN A;  3HG9 A;  1OYI A;  3OR1 C;  1RIO H;  3KLN A;  3RTR A;  3LL7 A;  2IS1 A;  5KAF C;  4XOT A;  3IH4 A;  2LVS A;  3EUH C;  2KJC A;  5D4R A;  3MKZ A;  2WY8 Q;  3E97 A;  1W7P B;  3DLL F;  2H8R A;  1XSX A;  3GBG A;  3NQO A;  1U2W A;  1ZYR F;  3OYB A;  3L2C A;  3M9A A;  1B1B A;  1MZB A;  1VQ6 I;  1MMS A;  2LSO A;  1KQ8 A;  4BQA A;  4CCM A;  4MTD A;  2KKO A;  3IP4 B;  2IGN A;  4LIV A;  2DA3 A;  4YFK F;  4FIS A;  2W82 A;  5CVU A;  3JRC A;  4KMF A;  1KYZ A;  2G7H A;  1GVD A;  5J8C A;  2CW0 F;  4KYW A;  2UXX A;  4RAF A;  2M9H A;  2RKH A;  4B47 A;  5CPR B;  1IN8 A;  2P5L C;  5J1U A;  3KFW X;  1W7P D;  2DMN A;  1W0T A;  4OMY A;  1N77 A;  3FF5 A;  3MD2 A;  4XLA A;  1JJ8 C;  4XR6 A;  2MH2 A;  5HDK A;  2HGC A;  2I10 A;  3GFL A;  1MND A;  2ACJ A;  3PO2 J;  1F9N A;  3CLQ A;  1K78 A;  2V79 A;  4G7Z F;  1OCC H;  3EUA A;  1TZL A;  4EMS A;  4IZZ A;  1XB4 A;  2R7W A;  5IYB J;  3TDU C;  3OYC A;  4Y52 J;  1TW3 A;  2CQ7 A;  3W6J B;  2JT1 A;  1NTC A;  3H9Q A;  4HOB A;  3DTK A;  2K5C A;  2F5D A;  4BDY A;  4BH9 A;  1FBQ A;  2ECB A;  2L9V A;  3LMM A;  3V8L A;  3BTL A;  3U9G A;  3CCL I;  5DD8 A;  5FKK A;  5J8F A;  2OC6 A;  4UB8 C;  3JRB A;  4I01 A;  1X3U A;  4HRI A;  1YIO A; 
#chains in the Genus database with same CATH homology
 2QQA A;  1P4W A;  1R22 A;  1LQ1 A;  4HA8 A;  1IXC A;  5A2Q K;  3ZPL A;  4CHU A;  4ENM A;  1IUY A;  3CDH A;  3PQJ A;  2V9V A;  1ZG5 A;  1R5H A;  1Q1H A;  2EFN A;  3F8C A;  1A04 A;  1LDD A;  3FM3 A;  3QU3 A;  4S05 A;  4AIH A;  2EFO A;  5K5R A;  2YX4 A;  2PLY A;  2FSW A;  1VTN C;  4UNO A;  3HOS A;  3TKY A;  4G7H F;  2D1V A;  1ZH5 A;  1TQI A;  3KP6 A;  3I5U A;  2Y48 A;  4RGX A;  4L9J A;  4PGG A;  4EJW A;  2EFQ A;  5HLG A;  2XAH A;  1YW8 A;  4I02 A;  3BJ6 A;  2K02 A;  1DP7 P;  1SAX A;  3IHU A;  2GA2 A;  3G3Z A;  1HW5 A;  2ESH A;  2PFB A;  3MZH A;  1O7L A;  3LA3 A;  3P9K A;  1KU3 A;  1FBS A;  1LB2 A;  1F5T A;  4YFN F;  5FFX A;  3MWM A;  3QPH A;  4BNC A;  2L4A A;  1UB9 A;  2DO7 A;  5A2Q Z;  1O3T A;  1I27 A;  1YS6 A;  5DV5 A;  1XDU A;  3TO9 A;  2Z5U A;  3F6O A;  2VON A;  2BYV E;  1OMI A;  4I0B A;  4WXH A;  2EFW A;  3EYY A;  2WV0 A;  1T2K A;  2A6E F;  5KVR A;  4EQQ A;  5DUK A;  1DDN A;  2YX7 A;  1ONV A;  3K0L A;  2CG4 A;  5E8G A;  2JZY A;  1SD6 A;  5BPD A;  4ASN A;  1OR7 A;  1I5Z A;  3O2P E;  2CFX A;  3QPT A;  4E70 A;  1QGP A;  3RJP A;  1HST A;  5LLQ A;  4A0X A;  4MTE A;  2GAU A;  3WOD F;  1DUX C;  3H3U A;  1YYV A;  1BC8 C;  3I53 A;  4A5N A;  2DBB A;  4BXU A;  2HKO A;  4FT8 A;  2ZME B;  3JSO A;  3K1N A;  3WGG A;  2VE9 A;  3GFI A;  2L02 A;  4L9T A;  3L00 A;  4Q4Z F;  2XAG A;  3HYI A;  2H94 A;  5TRD A;  2W24 A;  2RN7 A;  5D5X B;  3V7R A;  2BGC A;  3CTA A;  4CDG A;  2STW A;  4M71 A;  3RYP A;  3GLX A;  3G73 A;  2CO5 A;  3SQN A;  1R5G A;  1XGM A;  5J6X A;  1QBJ A;  1FT9 A;  2FQ3 A;  2VOP A;  1IRG A;  1IXR C;  4IF4 A;  3T1B A;  1O57 A;  1UFM A;  4WX9 A;  1FYK A;  5D5U B;  2Z9O A;  1E2X A;  5DCM B;  3WTY C;  4M9X A;  3SZT A;  4U7B A;  2QLZ A;  2EWN A;  2QUF A;  2DAO A;  3K1M A;  4M74 A;  4D0P A;  2H6C A;  2FOK A;  4KIF A;  3SHF A;  3QOP A;  4R79 A;  4B09 A;  1S7O A;  4U0V A;  1BJA A;  3JTG A;  2LKP A;  1GXP A;  4WCG A;  4RAZ A;  2FA5 A;  2ZBK A;  1RUO A;  5AIQ A;  1XSD A;  3ULQ B;  2P7C B;  3Q9V A;  3K2Z A;  2DK8 A;  1CF7 B;  4KDP A;  1WRJ A;  1YFH A;  4U0W A;  1D3Y A;  1MJA A;  4KUM A;  3ZP5 A;  5FFZ A;  5LRS A;  4AIJ A;  1FNN A;  2EV0 A;  4MQV A;  4A0Y A;  1W4M A;  3HRM A;  2JTV A;  4HX8 A;  3D0S A;  1G3T A;  1STZ A;  4HX4 A;  2ZXJ A;  1BI1 A;  1IN7 A;  5L3G A;  4BYY A;  4O5V A;  3R0J A;  4KNY A;  2VE8 A;  3ZMZ A;  4HV6 A;  1QPM A;  1G3Y A;  4KIG A;  5HS9 A;  3HTU A;  4WK8 F;  4CIC A;  1IN6 A;  3FWE A;  3HUG A;  3M8E A;  1TQP A;  4HF0 A;  3KEQ A;  2HQN A;  1JHH A;  2K7L A;  3M1E A;  1R58 A;  3TOB A;  5FD5 A;  1ZGA A;  2QQB A;  1J75 A;  3WTX C;  2M1B A;  4IHT A;  2W85 A;  1MGT A;  2ZME A;  2D1H A;  3T5X A;  1MD0 A;  2LDU A;  3WTV C;  4RGS A;  3ZN0 A;  3BP8 A;  4OIQ F;  4ZYE A;  4RB0 A;  2DTR A;  3PFI A;  4A6D A;  2KJB A;  2L3D A;  1J0R A;  3P9I A;  2LNB A;  2FEZ A;  4GYI A;  5ILU A;  1V3F A;  3ABT A;  5FGM A;  5HOO A;  4DNC A;  4LLG F;  3KP7 A;  4RB3 C;  2DPU A;  3KLO A;  3VB2 A;  3KE2 A;  2E1C A;  2A61 A;  2XIG A;  5DCM A;  2ZNY A;  3F72 A;  1BOA A;  2HQR A;  4G6D A;  1MDM B;  5HDG A;  6PAX A;  2NNY A;  4GGG A;  1Z6T A;  5FLX K;  5E8I A;  3MEX A;  4M72 A;  3E6C C;  3W6K B;  2L01 A;  1SFE A;  4HV5 A;  2XV4 S;  2PJP A;  1U78 A;  1R1V A;  1TBX A;  3I4P A;  3TOA A;  2OQR A;  4MQ9 F;  5BQT A;  2XUB A;  3JSP A;  3IWF A;  1YTY A;  4L9N A;  2ESN A;  1B9M A;  2E7X A;  3HIF A;  4IXA A;  2EV6 A;  2FXA A;  3I54 A;  4EJU A;  5H6Q A;  1H9T A;  3WTW C;  2OZU A;  4GCV A;  4KT5 C;  1JHF A;  3CUQ C;  4KN4 X;  3V7C A;  1KYW A;  1L3L A;  2QEN A;  1U5T B;  1S7A A;  1FSH A;  2JPB A;  3C3W A;  1PUE E;  2FU4 A;  3HTS B;  1ZGJ A;  1K6O A;  3MFK A;  2O8X A;  1B4A A;  1F1Z A;  4ENJ A;  5FLX Z;  1JXS A;  3MQ0 A;  1ZG1 A;  4P9U A;  4EVI A;  3Q9S A;  1D5V A;  1J5Y A;  1Y0U A;  1J7K A;  4PCQ A;  1EV7 A;  2OU2 A;  4F7Z A;  3CLO A;  4G94 A;  2OZ6 A;  3I59 A;  2FE3 A;  1U3E M;  5K5O A;  3ZMV A;  4M6X A;  1RUN A;  3HSF A;  2F2E A;  4L18 B;  3TO6 A;  1YQA A;  2M45 A;  4BHB A;  5JI6 A;  1SD7 A;  2GXB A;  1I1G A;  4G9Y A;  2LF7 A;  2HYF A;  4PGH A;  4KA4 A;  1IF1 A;  3VOD A;  5ILV A;  5E1Z B;  2IA2 A;  4I09 A;  3HHG A;  3N97 A;  1LDK B;  2P5K A;  4IRI A;  4U88 A;  3IKV A;  3M8F A;  2K27 A;  2XAS A;  4P5O A;  3F8B A;  5JR3 A;  3RIR A;  3MAJ A;  2IRF G;  5D8L B;  2C6Y A;  4FHT A;  5LGU A;  2JPC A;  4OIN F;  3EUH A;  4EGY A;  2UXN A;  4KMU X;  2RC4 A;  1FWZ A;  1U5T C;  4P9F A;  1T6S A;  2NYX A;  1MDM A;  2Q2E A;  2ZO4 A;  3NEU A;  3LAP A;  1T39 A;  4HQE A;  1R1T A;  3ZQ7 A;  1T38 A;  4XRF A;  4RAY A;  2STT A;  1HQC A;  1XGN A;  1LVA A;  3MCZ A;  3K69 A;  2XRO A;  3D5L A;  1IRF A;  2DQL A;  1FSE A;  2VT3 A;  3BOQ A;  4Y17 A;  3IC7 A;  5ICF A;  2YSR A;  2RQP A;  3RPQ A;  1WWX A;  4O3M A;  4U7D A;  1P6R A;  2DPD A;  5E1W A;  5LBQ A;  4AVP A;  2PN6 A;  1TLH B;  1YG2 A;  3FZV A;  4P96 A;  1BC7 C;  2CSO A;  3FXR A;  3KP4 A;  1FP2 A;  1ZRD A;  3WE2 A;  2IA0 A;  2YPR A;  3LQR A;  4AIK A;  4L5J A;  1RNL A;  1FZP B;  1EH8 A;  2XHK A;  3K1P A;  4LLL A;  1XGO A;  3F22 A;  3HRT A;  2HR3 A;  4JBA A;  1UCR A;  3E6D A;  3J80 Z;  3J81 Z;  1FPQ A;  2WTE A;  2XKO A;  2UZK A;  4TV7 A;  2D45 A;  5CJ9 A;  5KK1 A;  4EM2 A;  3WU1 B;  1W7P A;  2NS0 A;  2NRA C;  1ZRE A;  1HSJ A;  2DT5 A;  4N9I A;  4WWC A;  2QM3 A;  2GXG A;  1WI9 A;  2FNA A;  2HWV A;  5DEQ A;  4RB1 A;  2O3F A;  1ZLK A;  4LFU A;  4JQF A;  4IVN A;  2HZT A;  1TW2 A;  5LGN A;  1U8R A;  1ULY A;  4QWQ A;  3L09 A;  2AXL A;  2K86 A;  4XLN F;  1OPC A;  2HFH A;  4ETS A;  1OKR A;  4WXC A;  4R8H A;  3L7W A;  5DDG A;  1REP C;  5JFR A;  2X4H A;  3F6V A;  5D5W B;  2ADU A;  2Z99 A;  4YG2 F;  1R23 A;  4FX0 A;  4LLN A;  1PP7 U;  3U2R A;  3H92 A;  3F23 A;  3L9F A;  2DK5 A;  2MLK A;  3HSR A;  3BRO A;  3U1D A;  1BN5 A;  4KN7 X;  1RZ4 A;  4YII A;  5LRR A;  3V4G A;  2EJR A;  1B9N A;  1FC3 A;  4Y13 A;  3OOP A;  1AWC A;  1KU9 A;  2HYG D;  2MC3 A;  3E5Q A;  1HKT A;  2HTJ A;  2PEX A;  4WF2 A;  3F8N A;  3FX3 A;  1XCV A;  3BZ6 A;  2HS5 A;  3JW4 A;  2RV8 A;  3HSE A;  3BPV A;  2O61 A;  1YW7 A;  3B02 A;  1XN7 A;  3WGI A;  5LHG A;  4NQW A;  5ICE A;  3N4M A;  2QWW A;  3JAM K;  1O3Q A;  1HXD A;  4Q48 A;  2X0L A;  1R00 A;  3DPT A;  2W57 A;  1AOY A;  4GO1 A;  2COM A;  2FMY A;  2OAZ A;  1R7J A;  3HRS A;  3WGH A;  1SD5 A;  2Z3Y A;  4LB5 A;  4ZYD A;  3F3X A;  3VOE A;  1LNW A;  2H09 A;  1YW9 A;  4IRH A;  3RYR A;  4HZF A;  2Q0O A;  3GEZ A;  4LMY A;  2EB7 A;  2R3S A;  1W5T A;  1PP8 F;  3DP7 A;  4MHG A;  4CYD A;  4UVB A;  1KU7 A;  4P55 A;  1FY7 A;  1MKM A;  2KIM A;  3SXY A;  1B59 A;  2EV5 A;  2QVO A;  3EYI A;  3WTS C;  1P92 A;  4GXO A;  3RKY A;  3GW2 A;  2XRN A;  1CGP A;  2RGV A;  2EA4 A;  2R7F A;  2Z33 A;  3JAM Z;  5HVQ C;  4GYG A;  1O3R A;  3TGN A;  5DD4 A;  2KIU A;  2QBY B;  4WXD A;  1FX7 A;  1TTY A;  4A0Z A;  1D8J A;  1FYL A;  2EFP A;  2PBI A;  2P6S A;  1QO0 D;  2O0Y A;  3V8J A;  1BI3 A;  1QNT A;  3BDD A;  1S8N A;  1BBY A;  1G4D A;  2GWR A;  3EQL F;  1ZAR A;  3SFZ A;  3CUQ B;  4FX4 A;  3IL2 A;  3DEU A;  4OIP F;  3E5U A;  4YIF A;  1GVJ A;  4HAM A;  2VC0 A;  2R7D A;  2L54 A;  3I58 A;  1I1S A;  4HYE A;  1ZRC A;  5HS8 A;  3AAF A;  3GFM A;  3T8T A;  4CGZ A;  2HDC A;  3E6B A;  2ISZ A;  3KEO A;  1LDJ A;  4RGR A;  2VN2 A;  2JRT A;  3GZ5 A;  4YFX F;  1LJ9 A;  2VOD A;  4HQM A;  4B8X A;  4ZYG A;  4G8X A;  4S04 A;  2YR2 A;  5LHH A;  2GIV A;  3LST A;  3WTU C;  2F5C A;  1IW7 F;  4CXF A;  3FMQ A;  2A69 F;  3I64 A;  5E20 A;  4UUV A;  2KIF A;  2VBY A;  1BIA A;  5HS7 A;  5H20 A;  1Z1D A;  4UXN A;  1ZLJ A;  2RDP A;  4HLX A;  5ICG A;  1YS7 A;  2VOO A;  3FHZ A;  4I2O A;  1XCB A;  2VBZ A;  1SFU A;  3T8R A;  2E7W A;  5CYV A;  1I6X A;  3KZZ A;  3MZY A;  1R36 A;  1KQ0 A;  2HKX A;  5L3F A;  5DCF A;  1RI7 A;  2VC1 A;  1CF7 A;  4HW0 A;  1GHC A;  1MJB A;  5E18 F;  1S29 A;  1HKS A;  3CO6 C;  2XAJ A;  2ZKZ A;  4UVA A;  3WTT C;  2F5F A;  2FBK A;  3R60 A;  4Z2Y A;  1LEB A;  3V8K A;  4KIB A;  3E3V A;  3WU0 A;  3BJO A;  5ERI A;  2Q8K A;  3R6S A;  2J5O A;  5D8K B;  2HOE A;  3IKT A;  2ZNZ A;  3B73 A;  5E1X A;  2P6T A;  4XSX F;  2DW4 A;  1FBU A;  5JVT A;  1JGS A;  5D6F A;  1TNS A;  3DV8 A;  1BIB A;  3JTH A;  2CGP A;  2H27 A;  2QYO A;  1V4R A;  3CJN A;  1IN5 A;  4HF2 A;  3FMR A;  3R61 A;  2HTS A;  1JE8 A;  4LG0 B;  4XBF A;  4I98 B;  1HKQ A;  2ELH A;  1H0M A;  2IA1 A;  3CUQ A;  3QRF F;  5FD6 A;  2K4B A;  4G7O F;  2CWE A;  3KET A;  2PMH A;  1UHW A;  2L4M A;  5FO5 A;  2PI0 A;  4ZH4 F;  1OYW A;  2W84 A;  2KRF A;  1WSU A;  5FB2 A;  1Z7U A;  4O6J A;  4AWX B;  1XGS A;  4ESB A;  1ZAO A;  3WG9 A;  4G6Q A;  2DLL A;  4LB6 B;  1GXQ A;  1FYM A;  4MNU A;  2GZW A;  3V7S A;  1HBX G;  4LK1 F;  3DF8 A;  4I0A A;  1U6G A;  4CO8 A;  5IT9 K;  4QLC U;  2FRH A;  1WKM A;  4KIC A;  1H9G A;  2V6C A;  4ESF A;  4LK0 F;  5HLI A;  3M7G A;  3J80 K;  3J81 K;  4ZZD A;  3EDP A;  2A68 F;  1SFX A;  2W25 A;  3LWF A;  3CO7 C;  4ZYH A;  2V1U A;  2FF4 A;  3ERE D;  3TQN A;  2G7U A;  2ZCW A;  3BY6 A;  1C0W A;  1IAW A;  4M73 A;  2A07 F;  1FOK A;  2MH9 A;  1KU2 A;  2IPQ X;  3I0T A;  1U5T A;  3LA2 A;  5AIP A;  3GVA A;  1WQ2 A;  3KP5 A;  3LQQ A;  1SD4 A;  1TQM A;  2IT0 A;  2VXZ A;  4N9H A;  3GWZ A;  1IXS B;  5IT9 Z;  2ETH A;  2EA2 A;  3Q5F A;  1YO5 C;  5D5V B;  5D4S A;  4LGW A;  2Y75 A;  4BHP A;  4Q47 A;  3BPX A;  1Z91 A;  2RNJ A;  2EK5 A;  3GYH X;  1J59 A;  3ABU A;  1BI0 A;  2DQR A;  2FBH A;  2MD5 A;  2O03 A;  4LG0 A;  2VBX A;  1E17 A;  2WC2 A;  3QP6 A;  1W5S A;  1XD7 A;  2H6B A;  5D6E A;  3R0A A;  2M5W A;  2E1N A;  4ON0 A;  3QU6 A;  1XMA A;  4PDK A;  5K1Y A;  3GXO A;  1PDN C;  3KCC A;  3FMS A;  2K4J A;  4LJZ F;  3R4K A;  4K2E A;  3O6B B;  4H0E A;  2M30 A;  3GF2 A;  1P4A A;  3H3Z A;  2BBY A;  3QAH A;  2A3S A;  1QQI A;  4MGR A;  3RPU A;  5CVI A;  4BAY A;  3ROU A;  1ON2 A;  1K79 A;  4DQ2 A;  3LAJ A;  4BHC A;  4L0Z B;  2HEO A;  5LEK A;  5HDN A;  3K9T A;  4PZJ A;  2ISY A;  5BS6 A;  4HDU A;  4Q5S F;  4KFC A;  2J5P A;  3ELK A;  2LF8 A;  1L0O C;  1T0F A;  4XLP F;  1USS A;  2OQG A;  1F4K A;  2IVM A;  4Y15 A;  4UVC A;  4R1H A;  3GX4 X;  1IZ1 A;  3SZP A;  4A2U A;  3C7J A;  2QZ8 A;  4OIO F;  2MA3 A;  3CUO A;  4IHS A;  3BWG A;  1XSV A;  5BMZ A;  3WE3 A;  5CLS A;  1HW1 A;  3S2W A;  1UST A;  5LEJ A;  2XKP A;  3C1D A;  1ZG3 A;  4IJA A;  2P8T A;  1EH6 A;  2NNN A;  5LHI A;  1G3W A;  1OYY A;  4EV0 A;  3DXJ F;  3C18 A;  1BI2 A;  3ECH A;  2VT2 A;  4M9Z A;  3PQK A;  2NAZ A;  2BV6 A;  3ZN1 A;  2M8E A;  2D2W A;  3DQV C;  1J9I A;  2XGX A;  2QQ9 A;  1G6N A;  3OV8 A;  5ICC A;  3J7A O;  3VEP A;  1KQ9 A;  1QZY A;  3F8F A;  1IN4 A;  4EJV A;  2XAQ A;  2PMU A;  2FML A;  4RB2 C;  4EJT A;  3ML6 A;  1S6L A;  2M87 A;  1R1U A;  3KP2 A;  3IRR A;  4HDV A;  5F1R A;  1SMY F;  4M9S A;  3ZMT A;  3F21 A;  2O6G E;  1O3S A;  3EET A;  2DU9 A;  3HRU A;  4HBL A;  1KA8 A;  1XDS A;  3GFJ A;  1B6A A;  4CZZ A;  4EJO A;  5K5Q A;  2BE5 F;  4HF1 A;  1ODD A;  2BEO A;  1DPU A;  2ZFW A;  4MEX F;  5ED4 A;  3FXQ A;  5L3D A;  5ILS A;  4M6Y A;  1HW2 A;  3O3K A;  4IPA A;  3RDI A;  4A12 A;  3DKW A;  3GO5 A;  4AD9 A;  3QP5 A;  1P4X A;  5DYM A;  1D8K A;  4LD5 A;  2UWM A;  2AS5 F;  2F5E A;  3LFK A;  2PG4 A;  5F6F A;  3DPL C;  2MBF A;  3BJA A;  5EEG A;  1NHA A;  2IW5 A;  2CQK A;  3KZY A;  1FP1 D;  2XVC A;  3GUD A;  2GQQ A;  3I59 B;  1Z05 A;  4L9V A;  3DFG A;  1LEA A;  4ZZL A;  5E17 F;  4HLY A;  3FXU A;  2FNP A;  3IRQ A;  2DI3 A;  5AON A;  4OU0 A;  1YLF A;  3VFZ A;  3WTZ A;  2GA1 A;  4EGZ A;  2P4W A;  5L3C A;  2G9W A;  1K78 B;  2OD5 A;  5H6R A;  3FM5 A;  4ENK A;  2JSC A;  4EM0 B;  3RI4 A;  3E6M A;  4A5M A;  1FLI A;  1Z6R A;  3P9C A;  1SMT A;  4MEY F;  5LGT A;  4HX7 A;  4RS8 A;  4ESJ A;  3HHH A;  5BPI A;  2YU3 A;  1S3J A;  2MLG A;  3HOT A;  4OIR F;  1ZRF A;  3LA7 A;  3NRV A;  3E5X A;  4UV9 A;  3ZMU A;  3ISP A;  1G3S A;  3GZ6 A;  1J2X A;  3TO7 A;  3P7N A;  1ZHF A;  5DUI A;  3IWZ A;  5CVJ A;  5TJJ A;  4XSZ F;  1O7F A;  1KGS A;  1QZZ A;  4OOI A;  4UHT A;  1K7A A;  5L3B A;  4L0Y B;  2V1D A;  2P5V A;  4L5I A;  3REO A;  2CYY A;  5HLH A;  4IRG A;  2XAF A;  2ZJ2 A;  3I71 A;  1TNT A;  4N0B A;  2A5Y B;  1DPR A;  3F8M A;  4JK1 X;  2Y0M A;  3RKX A;  1ZN2 A;  1MJ9 A;  2PQ8 A;  4NHJ A;  5BOX A;  2P7V B;  2IP2 A;  2OBP A;  1BM9 A;  1EH7 A;  2V1X A;  4RGU A;  5CVR A;  2OA4 A;  4OMZ A;  3TDZ C;  2IJL A;  2QBY A;  1XMK A;  1UHM A;  3ECO A;  3ZMD A;  5L3E A;  3KP3 A;  2FBI A;  5IT3 A;  5JHU A;  2WWY A;  3ZMS A;  4I7H A;  1Z9C A;  2A6H F;  5EEH A;  3RKW A;  1P2F A;  3COA C;  2DFI A;  4UV8 A;  2RVC A;  3T0Y A;  1T98 A;  4A6E A;  5F64 A;  1ON1 A;  2TDX A;  4EM1 A;  4NB5 A;  2VBW A;  4U0Y A;  5CVV A;  2B0L A;  4ENN A;  1OYI A;  1RIO H;  3KLN A;  3RTR A;  2KJC A;  5D4R A;  3E97 A;  1W7P B;  1XSX A;  3NQO A;  1U2W A;  1ZYR F;  3L2C A;  3M9A A;  1B1B A;  1MZB A;  2LSO A;  1KQ8 A;  4BQA A;  4MTD A;  2KKO A;  4YFK F;  5CVU A;  4KMF A;  1KYZ A;  2G7H A;  5J8C A;  2CW0 F;  4KYW A;  2UXX A;  2RKH A;  1IN8 A;  2P5L C;  3KFW X;  1W7P D;  4OMY A;  3FF5 A;  2MH2 A;  5HDK A;  2HGC A;  3GFL A;  2ACJ A;  1F9N A;  1K78 A;  2V79 A;  4G7Z F;  4EMS A;  1XB4 A;  3TDU C;  1TW3 A;  3W6J B;  2JT1 A;  4HOB A;  2F5D A;  4BH9 A;  1FBQ A;  3V8L A;  3U9G A;  5DD8 A;  5J8F A;  4I01 A;  1X3U A;  1YIO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...