1VQKI

The structure of ccda-phe-cap-bio bound to the a site of the ribosomal subunit of haloarcula marismortui
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 15
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 1vqkI00
1VQMI 3I55I 1ACIA 1VQ5I 1VQ9I 5DM7F 1VQ8I 2OTLI 3CCMI 5GAEJ 3CF5F 1YJWI 3CCJI 1YITI 2NXNB 4IOCF 2JQ7A 2E35A 2E34A 1VQPI 1QA6A 2H8WA 3G71I 2ZJRF 3CCEI 3CMEI 1YHQI 3CJTB 3DLLF 5GAHJ 2E36A 3CCSI 1VQKI 3CC7I 1S72I 4V19K 4UY8I 2ZJQF 1FOXA 1MMSA 4IOAF 1FOWA 3CCQI 3PIOF 3CC4I 2QA4I 5GAGJ 2OTJI 3CCLI 5JVGF 1HC8A 1VQ4I 2K3FA 2QEXI 5GADJ 4IO9F 3G4SI 1YI2I 3CC2I 3CCUI 3CD6I 1VQOI 3G6EI 1VQNI 1Y39A 3CMAI 1FOYA 5DM6F 3CCVI 3J7ZI 3PIPF 1YJ9I 2FOWA 3I56I 3CCRI 1YIJI 1VQ7I 1VQ6I 1YJNI 1VQLI 3J7YJ 2ZJPF
chains in the Genus database with same CATH superfamily
2J5OA 1LEAA 5E18F 2DFHA 3I55I 1ACIA 1GV5A 4JP0A 2XAJA 1YS6A 3IC7A 1LFPA 1ETKA 1O3RA 3VEPA 1FTZA 1BI0A 3WU0A 1O4XA 4BE2A 4PDKA 2KISA 3PSIA 1XMAA 3K4KA 2HOSA 1S3JA 3C2HA 4M9SA 4RMNA 3S1QJ 4XLHA 3GTPJ 3BR5A 3E5XA 4R8HA 5ILSA 3N97A 2JVHA 1K4TA 3G1LA 1XTAA 1U5TC 4NB5A 5F27A 5C44J 3JAMK 3ESWB 2QQ9A 2WC2A 4F91B 3LWFA 3V7RA 1OYIA 2CW8A 4ENJA 5TJJA 4BJTA 2FQ4A 2CYYA 3H9QA 4L18B 3I64A 4HA8A 4G8XA 3RPUD 1B4AA 1FIAA 1U78A 3RDIA 5H20A 3HRSA 3OWTA 3JRFA 1H9TA 3LOCA 3GTMJ 2WV1A 2B9SA 3HC7A 4UY8I 3IH4A 2A69F 3BQYA 4II3A 1G8XA 2FD5A 4MIMA 3J80Z 1O3TA 3WTTC 2LLKA 3K4LA 3PL8A 1U5TA 2ESHA 5HDNA 3KLOA 2FE3A 3E6DA 3CO7C 1I1SA 4LK0F 5DV5A 1MJ9A 2EFOA 2KDZA 1OFCX 3G3ZA 4Y33A 2ECCA 2XAGA 1USTA 3ML6A 2XB5A 4A6EA 3FHNA 4IX7A 2RN7A 2Z9OA 2IGOA 4OIRF 2OZ6A 1SVOA 3HOSA 1U9NA 3NRVA 1TT5B 3EPZA 3H9GA 3H5RA 5JLXA 3FHZA 2OQRA 2PG4A 3OIOA 3H35A 4I99C 3ASOH 3MMYB 3PO3J 2CRGA 1D8KA 5FKMA 2K7LA 3H36A 2FSWA 3VYTB 4ZYGA 3HSRA 1ZG1A 3CLQA 1VI0A 2HFHA 4KA4A 4A3MJ 4D1QA 1O3SA 3M1CA 1D3YA 2H94A 4O5VA 1FMWA 3W3CA 1B59A 4BXFA 4Y52J 3HIFA 4PJNA 4CGZA 1LB2A 4RB0A 1UAAA 1HSJA 4F93B 3RKXA 5ED4A 2ZJ2A 4G7ZF 3OOPA 4RLFA 3TW7A 5DTDA 1S8NA 5JVTA 2LG4A 2HQNA 3A1YA 2GXAA 4XM3A 1DPUA 2HS5A 1BIBA 2LOOA 4OINF 4IHTA 1RC9A 2BW3A 1U5TB 2JPCA 3FIWA 4XIDA 3VSKA 2LC2A 4OWRB 4LK1F 3HRTA 2VL8A 1V5EA 3FK7A 2VLAA 2V79A 4XOPA 3IKVA 2CU7A 4CHUA 1TWGJ 2L7ZA 4PK4A 1F43A 3A03A 3BR6A 2E1OA 1I6XA 4L0YB 2WB1N 2Y0SA 5IP6A 3M1EA 1NHAA 5K7HA 1G2HA 3ISPA 3WTXC 1T2KA 1WH7A 2EINH 3MD2A 4JQFA 1R5ID 2XF7A 1FC3A 1OKRA 2OPTA 1TLHB 2EA4A 4CSWA 5L3CA 1YOVB 3S1RJ 1F4KA 3P5JA 4RGXA 5HODA 2FF4A 2VIXA 1MZBA 3DEWA 3F8FA 3K10A 1HLVA 1MBEA 1U6GA 4EJTA 4A3IJ 1X4PA 1WGXA 2LVSA 2Q2EB 2ZMEC 2VPRA 1APLC 4IHWA 2HVSA 4RB2C 2JUCA 3H3VK 5E20A 1ETOA 3ZQLA 1HKQA 4RM3A 2K9NA 1O57A 4BQAA 3HUGA 2R5YB 3QU3A 2QENA 2F5CA 3LL7A 3AG3H 4UB6C 3CMYA 5FB2A 2K3FA 4O3MA 2H8RA 2XROA 2W24A 1T0FA 4CO8A 2BW3B 3MAJA 3KP6A 2HU9A 3K2AA 4MNUA 3KZIC 3J81K 5DS9A 3G6EI 4IHSA 3JRIA 1Z9CA 4G6TB 2UV1A 3IV5A 1EH7A 2W4SA 5A2QK 1WJ5A 2VB6A 4LIVA 1BR1A 4Y13A 2ZMEA 1QQIA 1V5FA 3CDLA 4XLEA 2VBXA 4MFEA 1ZLJA 4ZDPA 4XORA 3K70D 1J0RA 3IL2A 3HOTA 3O8HA 4JX5A 5D6EA 5IT9K 3W6VA 1X19A 3J7YJ 1P4XA 3V8LA 1MMGA 5LD2C 2RQQA 2OBPA 2VKHA 5HNHA 5DM7F 3GZNB 4HNVA 1JGGA 4HRIA 1E3PA 1GXPA 2DOEA 1RRJA 4HDUA 1S6LA 3FXMA 4X6AJ 2A68F 4I7HA 2JN6A 2JVGA 4E70A 4LB6B 5ILVA 3S3NA 2ZSIB 1AKHA 2P4WA 1KU3A 3OS2A 2EBIA 4BY1J 5DD8A 2NS7A 3HSFA 3HUGB 4ENNA 2DTZA 3LSKA 3F21A 5AIPA 3RZDJ 4BXUA 4YIRX 4UV8A 4HDVA 1N25A 2E34A 2EZKA 1T39A 2V6CA 4O6JA 4PGGA 2R0QC 2VE9A 2XV4S 2OQGA 4X0GA 2CWEA 3EYYA 4HLXA 5B1AH 1B1BA 2L9SA 3F72A 4C2MJ 1RI7A 4NC6A 2HTJA 4XK4A 2E2JJ 3F23A 3DLLF 1A5JA 3OR2C 4FT8A 3HKZN 1P92A 4M3EA 2F48A 2MFZA 2ZMEB 2BXYA 1A31A 2BY1A 1Z7UA 2X6WA 2MH2A 3ZQFA 2VJ4A 4JOMA 4BYYA 1A36A 1YX5A 3E6CC 2QQBA 1MBJA 2K40A 1FX7A 4A3DJ 2YSRA 4E7SA 3HTSB 1SANA 2RREA 2G7HA 3PIOF 3GF2A 3CDIA 1Z6RA 4I0AA 1KYWA 3JTGA 2OCCH 3TOBA 1FT9A 2HQAA 3DBHB 4XQFA 3F9KA 2O6GE 4LG3A 3ZRGA 2O7OA 1ZELA 3AL0B 1OCZH 2MABA 4MEYF 1MBGA 1QO0D 3DPLC 1MIJA 4DZJA 2L7FP 1IDZA 3GEZA 1G59A 2Y30A 2W1OA 3S14J 2VC1A 3GZ5A 1FJLA 3PFIA 4XRSA 2IJLA 4UXNA 4ZDLA 4KYWA 4R1HA 3GTKJ 1NK2P 2CV0A 2K9LA 1XC5A 2AO9A 2E1MC 2QWWA 3HHHA 4UVAA 3ZR8X 2P81A 2ZBKA 2R5ZB 1BL0A 2BYVE 3K0LA 1K7AA 2R7TA 4P55A 3I59A 3OYJA 2LYCA 1SAUA 1EH8A 1MKMA 4QPQA 1IGNA 2PFBA 1JKQC 2EIMH 4EVIA 2LD5A 3K69A 4H4KC 4RM2A 1F36A 3D1NI 1U8RA 1P4WA 2EPFA 3IKTA 5IYBJ 2PMZA 3L2WA 2OF7A 2HOTA 2K85A 2CQXA 3JTHA 4RAZA 1JTXA 1J5YA 2DA6A 1BI2A 3Q5FA 3BROA 3UNGC 3BR0A 4EGYA 3TDZC 4BE1A 1V54H 5D8KB 3CCYA 1ETVA 1O7LA 2DA1A 3U2RA 3KP4A 1S5LC 3BZKA 3R0AA 1SD6A 2CS3A 4HX7A 4ZZLA 4HPQA 1IJWC 3G71I 2R7RA 1A6QA 2CFOA 1Y56A 2HKOA 1G6NA 2LBFA 2YX4A 1UZCA 2EQRA 1F1ZA 4KIBA 2OV7A 3S15J 2EZIA 2P7VB 3RKQA 3GBGA 1E0EA 2DT7B 3J7AO 3LSIA 3PUBA 2EIKH 5ILUA 1P7JA 3CJQB 5EJCA 5DCMA 1FIPA 4BJ5C 2EIJH 2JRTA 3I4NJ 2PJRB 2X6XA 1OLTA 4ETSA 1GXQA 2YR2A 4HF0A 4M71A 4DYCA 5F64A 4E6KG 3MZHA 3I59B 1QBJA 5E3OA 2ID3A 3V4GA 4BH9A 4IXAA 2OCEA 4KDPA 4RA2A 3KP3A 3L2UA 2DA4A 1R4MB 1T38A 5GPAA 4ESBA 3VOEA 1HF0A 4JBAA 5BQTA 3TO9A 2M1BA 6PAXA 2LY1A 3HOZJ 3ERED 5FKLA 4HX8A 5E17F 5J4VA 4M3FA 1N78A 3GYHX 2XKPA 2YU3A 1D1BA 3K4JA 2Y9YA 5KCMA 2FEZA 4BHPA 5E79C 2CV1A 4N9IA 1JKPC 2E1MB 2CJJA 2DA7A 1OYWA 3DKWA 4HYEA 4KT5C 4M72A 3WU1B 4OMZA 4E7HA 2FOWA 4RAGA 4KITB 4EM1A 1IRFA 3I54A 4WK8F 1KU2A 3N4MA 2CSOA 4QTRA 3REOA 3RQ4A 2MH9A 3ONQA 4IRHA 4PFOA 1FY7A 2E1CA 2LY2A 4XONA 2L0KA 3ASNH 2GLOA 3FF5A 2YS9A 4DYQA 3G1MA 3ZQQA 3F6OA 3RIRA 4IQJA 2MG4A 4OMYA 2HQ5A 2X51A 3HOWJ 5KHDA 1I6HJ 4PZJA 3FXRA 5M3MJ 5F0CA 1ZG3A 1SD4A 2F5EA 2OJED 4UVCA 2R7UA 4WXDA 1YX3A 3IAM2 3HGYA 1FSHA 2BBYA 3CF5F 2DLLA 3MWMA 2LKPA 1I3QJ 1IRXA 5KAIC 1XSVA 3HSEA 2HYFA 3F8CA 3ZN0A 4BACA 1MH3A 2F4OB 5GTIC 3BJAA 2IAIA 1XCVA 3B6CA 1WJEA 2PEXA 4LD5A 3QODA 3R6SA 4XRSG 1A6IA 4MQVA 2PJPA 1TQMA 2GOMA 3TL4X 2D1HA 5BNGA 1MD0A 5KNLA 1ULYA 2VQCA 2XSDC 2K27A 1B6AA 1Z0XA 2H8WA 2V9KA 1ERDA 1G3YA 4WXHA 2KKOA 3PNTA 1V55H 2ZSHB 3LA2A 3BPVA 1FBUA 1UG0A 3G2BA 4N0BA 4HW0A 1FYMA 3KYDB 4PGHA 1LDDA 2KDOA 2QLZA 4PFPA 1TBXA 4L9NA 1UMQA 3CDHA 1GT0C 2NVUB 1YW7A 4WF2A 2H6BA 1YS7A 4GXOA 3T0YA 2QKMB 1CGPA 2M2EA 1SD7A 1PYVA 1TWFJ 3ABLH 1XB4A 1ORKA 3FXQA 4CCLA 1W0TA 4DYRA 2X6YA 2V9VA 2ZCWA 3KFWX 2VOOA 1BM9A 1HC8A 1D0XA 1BW5A 1BR4A 2A3SA 4KFCA 1KU7A 3AG2H 3BJ6A 5FKNA 2RC4A 3CQZJ 5CVJA 2VXDA 5DYMA 5GADJ 4RBOA 2YX7A 4AIKA 4YEJA 2WBMA 2DK8A 1DDNA 4BBRJ 1DQUA 4BNCA 3KE2A 3ZP5A 2LP0A 3QOEA 4ZYAA 2WAQA 2DU9A 1DPRA 5L3BA 1FZPB 4I98B 1G3WA 1W5SA 1R4NB 1PUEE 4RGRA 3W2VA 1QU3A 4KT6A 5J8FA 4LLGF 2UXXA 1X58A 2Q0OA 4GO1A 1Z91A 3SFZA 4A3CJ 3GLLA 3IAS2 1SEUA 2DW4A 1XGSA 1MDMA 4J00A 2DBBA 1YJNI 1B8IB 3J80K 2ELJA 3DEEA 2W82A 2XPUA 3I9V2 1XSDA 1WKMA 2GIZA 2H1LA 2TDXA 1TZLA 4Y4RA 4MTDA 1U2WA 4N4NB 4A3FJ 1VQ9I 3VODA 1VQ8I 1YYVA 3ZMDA 3ERMA 3NWSA 1FBSA 3HM5A 3OL3A 3LMMA 5ICCA 5LGNA 1RR7A 2E5ZA 5HDKA 2XB0X 4WXCA 5F0HA 4HF1A 4XN3A 1IN7A 3GVAA 4MLOA 3PJRA 3DPUA 4G6DA 3CCJI 3JRCA 1YE9A 1JI8A 1WQ2A 5J1UA 2FOKA 1N75A 2LKSA 5HS7A 3LSGA 1IF1A 2O03A 2LF8A 3RZOJ 1Q1VA 2VASA 1IUFA 1K6YA 3DEUA 2DQRA 3E5QA 1OCCH 2F5DA 2QGUA 1WJAA 2IPQX 4A69C 4AM3A 4DW6A 3HDDA 2L54A 2DI3A 2NVYJ 2X4HA 3TEDA 4M9ZA 2R92J 3GCMA 1S7AA 1NTCA 1XN7A 2M34A 5C4XJ 4DQ2A 2Z33A 3BZ6A 1MMNA 4D7NA 2ZXWH 4KICA 3BR1A 4MHGA 4CZZA 3AKZA 2ECBA 3L9FA 4HNTA 5GPCA 3DFGA 2X1CA 2XGCA 3M8FA 4F55A 3M7GA 3RYRA 1MDMB 3P9KA 2AS5F 3HTUA 1Y1VJ 1JT0A 4HV5A 1M1EB 1XGNA 1D8JA 4I09A 2QBYB 3BQZA 4NQWB 1GDTA 2QA4I 1LPQA 2XAHA 3TBIA 3TW6A 2R4GA 4Y3OA 4I6ZA 2EA2A 2M5WA 4ITVA 2LK2A 4PCQA 1VQ4I 2AQEA 2DMTA 3Q9SA 4YFNF 2A5WA 4DGWB 3SHFA 2O3FA 2DA5A 4C3HJ 3JRHA 1VFCA 1AU7A 4Z2YA 4FTHA 1REPC 5B5EC 3RKWA 2Z16A 2VC0A 1YQAA 4QWQA 1X1DA 1X3WB 3V7SA 3CMAI 2R7FA 1FOYA 3QWLA 1RZ4A 2BY3A 1R6RA 4BEHB 1MBFA 1W5CC 4Y7NJ 3WE2A 4CH7A 4ZJZA 4ZYHA 2MSYA 2VODA 3LAJA 5D5WB 2P6TA 1P2FA 4PJJA 1VQ6I 2CG4A 3S17J 1IN5A 3FM3A 5D4RA 5C3EJ 3BPXA 2HZTA 2HVQA 4PJ0C 4AYBA 1VQMI 1ETQA 1ZGWA 2NRAC 3P7NA 1ZQ3P 2HNHA 4J19A 4XSZF 1TNSA 1SFXA 5DEQA 2LTPA 2ZXIA 1L0OC 2FNAA 1T6SA 5D6FA 1FYLA 1KQ0A 3JSPA 3NWTA 3H92A 4YELA 4M9XA 3HRMA 3LQRA 5D5XB 4A3JJ 3QPHA 1HW2A 1YIOA 4HZFA 1WHUA 4V2GA 2A05A 3C18A 2Q2EA 2IT0A 1OCOH 2MC4A 5EEHA 4IHVA 4EJUA 1W7PA 3WTSC 4B8XA 2DXIA 1ENHA 2Q8KA 3S3MA 2BHZA 3TOAA 5CVUA 2JSCA 2M0MA 2R5YA 4DNCA 4NUBA 3C7JA 4S0HB 4FCYA 2EJRA 1Z3XA 3KP2A 1R22A 2X1EA 1QNTA 3VYRB 2E1NA 1BR2A 3BT9A 2DFIA 3BOQA 3T8TA 3OYHA 3F8MA 4HSRA 3TO7A 2JA6J 4A3LJ 1G3TA 2E36A 3CCSI 4B3XA 1VQKI 1WH5A 3CC7I 1SFEA 1XPXA 5H2FC 2IP2A 1JTYA 2GZWA 3ABUA 3C1DA 2QSHX 2VQLA 2R7ZJ 1ZG5A 2VJIA 1CF7B 2MD0A 4B43A 3JAMZ 1S7OA 2V1DA 4G7HF 2JK3A 3QYEA 3HOYJ 2GAUA 1WI9A 2YPRA 2IS6A 3KZZA 2ZNYA 2NNNA 1BOAA 3KEOA 3CC4I 2PQ8A 2VKDA 3EUHC 3BR3A 3GTLJ 2EZLA 1AA7A 2M8GX 1QHGA 5FKOA 4L5EA 4Z6YA 1N77A 2XKOA 3BC8A 3H1CA 4KIGA 2BE5F 4GRIA 3R0JA 2CQKA 2OA4A 3TO6A 1IRGA 4YRVA 2DDBA 1JE8A 1K83J 3Q0VA 4IQ4A 1QVUA 1VQOI 1R9TJ 2HVRA 2QKLB 5HDGA 3D5SC 5LHIA 1W7PB 2KL4A 1K4SA 1X1CA 3WTYC 3QP5A 3GZ6A 1FSEA 3OY9A 4OIOF 3E0JB 2A6TA 5B1BH 1LNWA 4YIFA 3OS0A 3MKZA 3KP5A 2ME0A 3GUDA 3I4MJ 2FX0A 3CUOA 4EJWA 5FJ8J 3EUHA 3HXLA 2VE8A 3ZQCA 5JI6A 1BC8C 2DJNA 3SEQA 1SMTA 1ZTRA 2EILH 4E7KA 4XR6A 3DBRB 4FQGA 3TKYA 2DN0A 3FMQA 3GFMA 2NVXJ 1IN4A 2JA2A 2QZ8A 2HEOA 3LNQA 2STWA 3L1PA 2RDPA 1KA8A 5GAEJ 9ANTA 3L2VA 3ZXSA 5IOZA 4RDUA 5K1YA 1HSTA 1D0YA 1OMIA 2XAUA 4U88A 3S2HJ 5L3GA 3A4CA 3OYFA 3A01B 1YITI 4KNYA 3AG4H 1QZZA 4HEA2 4IOCF 3HYIA 5IP9J 4C2TA 3S16J 2DMUA 1ZH5A 3V42A 2JA7J 2XPVA 3KPHA 4EGZA 1V4RA 5FKKA 2WY7Q 1QA6A 1VZ0A 2W7NA 1R1UA 2TRTA 5DUKA 2PMHA 5D8LB 1HKSA 2KRFA 2KRCA 2XF5A 4ENMA 3KP7A 4P1WA 2KP6A 3OSFA 5FRNA 1UCRA 2UXNA 1V3FA 1E17A 2BVLA 2M45A 1P9QC 2HGCA 2GOXB 5JLWA 3RI4A 4V19K 1U9OA 2VKVA 1E3OC 4FX4A 1JJ8C 4XLFA 1KGSA 5HLGA 1T56A 5F04A 2K9QA 1QZEA 2BHYA 2X0LA 2R7OA 5B66C 1MSEC 2UZKA 3E1SA 5H6QA 1GV2A 3SEZA 1QHHD 4E4HA 2MA3A 3QRFF 1YW8A 2R5ZA 3T8RA 2ZFWA 2XGDA 1E2XA 5J1YA 1HCRA 2MW8A 2CQQA 2WAEA 2MLKA 4BQNA 2HXOA 2RGVA 4M3DA 1YTYA 3VPRA 1TW3A 3GFLA 2L2OA 3FISA 4OAZA 2L7MP 2EFPA 2F4IA 3DQVC 4AU7A 3G1OA 1I3AA 1IW7F 4RS8A 2K9MA 5CVVA 2LSOA 4DBQA 3BG9A 4G94A 4I2OA 1XG1A 2LR8A 3HG9A 1ZKGA 4HAMA 3WTUC 4J01A 4XN0A 3NQOA 1LUJB 2BOLA 5H6RA 1H89C 4FISA 1R36A 4LG0B 4P9FA 4KN7X 2V1XA 3ECOA 3I56I 3MVPA 4OU0A 4U7DA 2MBFA 2DODA 2VQGA 3U1KA 1R5GA 2WB1A 5CLSA 3LSPA 2X1DA 2KIUA 2GM4A 3K9TA 3OS1A 1PVEA 1PP7U 5D4SA 1BW6A 2D5VA 2COBA 5LGUA 4E7JA 2CO5A 3CF2A 4P5OA 1D0ZA 4XOTA 1EA3A 4XLCA 2D2WA 2ZXJA 3P9IA 1MNEA 1MJAA 3K7AJ 1ONVA 2ZKZA 3J81Z 5AONA 4PJLA 4U0VA 3B6AA 2W25A 3K4MA 5A2QZ 5EZGA 2DYSH 3NAUA 1UHWA 3MN2A 2ISYA 5K5RA 5D5VB 3BG6A 4CCKA 1IG7A 2JT1A 1T98A 2OUMA 2Z3YA 2A6HF 2PJRA 2IS4A 2FMLA 2HQRA 3DTKA 3RPQA 1Z05A 1TT0A 1Z67A 3R60A 3OR1C 1VNDA 4FETA 3A0HC 1MMAA 4BQOA 4BS9A 5IT9Z 1FLIA 3L2CA 1R49A 2H09A 4YFKF 4IL6C 3W2WA 2L4MA 3JRDA 1BI3A 4E7LA 3H5AA 3RTRA 2W84A 4MFDA 4CCNA 3SDGA 2FU4A 2L9RA 1WRJA 3DP7A 2K9SA 2FRHA 3FXOA 1EKEA 1OQYA 4XSXF 1IXSB 1MJBA 2K4JA 1USSA 3L09A 2B63J 1HA8A 2FQ3A 4BL0B 2XIGA 2M9HA 3CUQC 1A35A 5IYCJ 3ZQGA 3D5LA 1SFOJ 3OV8A 3IWFA 3E5UA 2R7QA 3RCOA 1ZK8A 1D5YA 2KJBA 4B3AA 4V2FA 1MNMC 2DQLA 3JW4A 4Q48A 3DCFA 1GHCA 1PP8F 3H9JA 2P5KA 4EATA 2V4JC 2WAFA 2BGCA 2VT3A 2PN6A 1DUXC 4M6YA 3HZJA 4U7BA 2HTSA 3BG3A 4BKXA 3GX4X 3Q0WA 1AHDP 5E1XA 1J9IA 4D5CA 5E3MA 4TV7A 1HBXG 3B02A 3CCVI 3CUQA 2HYGD 4BHBA 4HBLA 1BI1A 3TP3A 1S7EA 4ASNA 2VKEA 1WFXA 3PM1A 3TQNA 1GLNA 3FXUA 2IGKA 5HS8A 1UHSA 1WJFA 2TCTA 3ZOBA 2X6OA 3WU2C 4NHJA 2DMNA 1XGMA 4CA0A 4HOBA 3LA7A 2MLGA 4XLNF 2R93J 2WTEA 4W1UA 1BIAA 1TQPA 4BBSJ 5EYRA 4OIQF 2VT2A 2FA5A 1SFUA 2EB7A 3F8NA 3HKZA 4XBFA 2KFDA 1T8IA 1B72B 1UFMA 2OTLI 4KMUX 3JREA 2BXZA 2CUFA 2QVOA 3S93A 1R00A 2O61A 1UELB 3MZ8A 4DJAA 3CJNA 3F0CA 3E7LA 1F5TA 3OL4A 2ZB9A 3JRBA 4HF2A 2NOJB 2HDDA 2OC6A 2WV0A 5J40A 2OD5A 1J75A 2DJIA 5FLXZ 1K78A 4HG2A 3ABMH 2NXNB 1IC8A 4HQEA 4P9UA 3F22A 3UKGA 4AD9A 3W2AA 1OPCA 4BXXJ 1MNDA 1ZLKA 5IOYA 1JKRC 2ELHA 1T33A 1XD7A 4F92B 4RB3C 3HEFA 1MSFC 2BVMA 4A5NA 4ESJA 2JZYA 1YHQI 3CJTB 2C6YA 4RAYA 2CFXA 3ABKH 1OR7C 3CUQB 1R1TA 5L3EA 1W36C 2IBDA 2P5VA 2KZGA 3I3LA 1FEXA 4AWXB 2R7VA 2CW0F 4S05A 1RKTA 3WE3A 2FUG2 1FOXA 1DP3A 5ERIA 1Q1HA 2AXLA 5K7FA 3FKIJ 2FBIA 4XLAA 5HLIA 4PJMA 4WX9A 1ZRFA 1R23A 4A0YA 3CCQI 1LDJA 4UUSB 3IH2A 3KLNA 3S1MJ 2CMPA 2D1VA 2P0WA 4BHCA 3BJOA 3GFJA 3OMYA 5FD6A 2K5CA 3PQKA 1RPWA 1B8IA 3OYMA 2P8TA 1YRNB 5F08A 4Q47A 4IRIA 4F3QA 4KMFA 1J09A 4LFUA 4DZPA 2L9NA 2W57A 3ABTA 1OCTC 3OYEA 4KJZA 3RSNA 1ETWA 2DYRH 3VYSB 4M73A 1BN5A 3LSRA 4IVNA 1W4MA 1OR7A 5TGTA 1K79A 3ZPLA 1XDSA 3CD6I 3K4CA 1SAXA 2HOAA 2GWRA 1K78B 2PLYA 4C2UA 3PFYA 3ZMZA 2UWMA 1RNLA 1PUFA 4UUTA 2IVMA 2OZUA 3PIPF 5D5UB 1RESA 3DKXA 3CP8A 1YFHA 2W85A 1Z6TA 2COMA 4AC0A 2UUZA 3MKYB 2W48A 2CQ7A 5BOXA 2MGQA 5FLMJ 5M3FJ 1RIOH 4ZH4F 4ENKA 1ZHFA 4YIIA 1P7IA 1JKOC 4ZDOA 2M87A 4AVPA 2M4GA 1P4AA 4FASD 2HYJA 2X9DA 3HBLA 5FGMA 3JRAA 2QQ8A 4D0PA 3BCBA 5HS9A 3BG5A 2CUEA 2NNYA 1ZRCA 1IDYA 4EM2A 2KMUA 2Z5UA 4BUPA 2VUMJ 3ZQIA 4B48A 3C3WA 4NNJA 5TRDA 2HDCA 3LSJA 3FWEA 3COAC 1BBYA 1DU6A 3K2ZA 2IXSA 2M3AA 2PI0A 1QZYA 4XRFA 3LSTA 5GP9A 1H0MA 1HDDC 3OIPA 2KQRA 3U1DA 3WG7H 1TWCJ 3UR3C 2QBYA 2HZDA 4NQWA 4UB8C 3SQNA 4DOZA 3GTQJ 5LRSA 1LVKA 1OISA 2LY9A 4KN4X 4P96A 3OSGA 2A61A 3KX2A 2KRHA 4RLQA 3V8JA 1PUFB 3BTCA 3HPHA 5GAHJ 1WCMJ 2EFNA 1YG2A 5J8CA 5FD5A 2XRNA 4I02A 1POGA 2CGPA 2VBZA 1I1GA 2ZO4A 2IS1A 2P7CB 3QAHA 4BEHA 2ZXHA 1I39A 2EV5A 3LSMA 3PQJA 1FP1D 3QPTA 3QQAA 3RPUA 2A5YB 4G12A 3BCAA 1JT6A 3WHCA 2QF7A 4CZCA 5E3NA 4GGGA 3MFKA 2Y2ZA 3FXKA 1LJ9A 2QUFA 1WSUA 4IKFA 3F8BA 3LQQA 4GCVA 4GYIA 5JFRA 3CCLI 2GQQA 3JSOA 4CYCA 3E3VA 2X48A 3DXJF 2EFWA 1KZHA 1LFUP 2FNPA 2Y0SN 4BQQA 1WZ2A 4JK1X 5GTHC 5K7ZA 2WY8Q 2DOFA 2VXZA 3K1NA 1AWCA 3G73A 1W0UA 1SVLA 1AOYA 3E97A 1YO5C 2E2HJ 2Y9ZA 2CUJA 2ICWG 4KUMA 3FKJA 1Y6IA 2NYXA 2R3SA 1VQNI 2VJ5A 4QIWN 4HV6A 3FBIB 4ZTJA 3L7WA 4BU2A 2FBKA 4RAFA 2LREA 2R7SA 2W00A 2LFBA 5B3SH 5LEKA 1ODDA 3RJPA 1IO2A 1UG2A 2DPDA 3IWZA 5BS6A 4HSTA 3LFUA 3IP4B 2B7EA 1RR8C 4LLLA 2JSPA 3KYLA 2VJJA 2WWYA 2M7AA 3NARA 5EEGA 1FMVA 1H88C 3X2QH 3RKYA 2BV6A 1IN6A 1VTNC 2KIFA 5FROA 1BJZA 2ZJPF 4BDYA 4XLPF 1LFBA 4IHXA 3I58A 4FHTA 3WTVC 2I10A 2V7FA 1JHHA 3A0BC 1W5TA 1X3UA 3TDUC 4YG2F 1DGWY 1VQ5I 2DDAA 3EUAA 3EYIA 3WG9A 5F1JA 3AG1H 2K86A 4ZC3A 3IRRA 1OJLA 3BDDA 3ROUA 3FK6A 2CV2A 2V26A 3ZGKA 2DOAA 3EQLF 3I53A 2G9WA 3CZ6A 5DDGA 5J4YA 1CF7A 2E19A 3OYKA 1XCBA 1X2NA 3GW2A 2L9VA 2DMPA 1FP2A 1ZGAA 2O9LA 2Z1DA 4HLYA 4CYCB 3M3YJ 3PNYA 1GUUA 2HI3A 3OOUA 2ID6A 4LGWA 2ZJRF 4JYKA 3M4OJ 2PMUA 2LKXA 2P5LC 2H27A 3VSLA 2BY2A 3CCEI 3DBLB 5CKTA 5TISC 5ICFA 3CESA 1MBKA 3I4PA 1OCPA 4Y17A 2VPLA 1KU9A 3SZTA 1XDUA 2EV6A 3D0SA 4C3JJ 2XC7A 3I0TA 1JJ6C 3LA3A 1R58A 1UB9A 4QPOA 2K4BA 1FOWA 5CJ9A 2NS0A 2RV8A 3BTJA 2O0YA 2XAFA 3DU5A 5CVRA 1ZR2A 3E6BA 2DPUA 3A2KA 3IHUA 1WVRA 1NH3A 2XDVA 2JA5J 2RAEA 4PSWA 3KIOA 1JUMA 3PUFA 4HNUA 1HOMA 5CYVA 3KEQA 2ZC2A 3FDYA 3K70C 1RUOA 4AVZA 2X85A 4IO9F 2QSGX 3CLOA 3TP0A 2HOEA 1D1AA 1IXCA 5E3LA 2XRLA 1OYYA 3GLXA 4KIFA 4B44A 1HW5A 1XMXA 2G7UA 3ZQ7A 1TWAJ 3ZMUA 4M6XA 5HVQC 2JA8J 3FXJA 1NG6A 3A01A 2L01A 3LSHA 3AFHA 5CQEA 4OOIA 1Y0UA 3CCRI 2ZNZA 4F7ZA 1G3SA 4XKCA 1DGRM 3MQ0A 2HPMA 2KT0A 4EV0A 2ADUA 4CUGA 3T1BA 3L2QA 3WTWC 1X3ZB 4A3KJ 2Y69H 5EF6A 3C2BA 2ZFUA 1X2MA 3B73A 5ICEA 1WI3A 2F6CA 1SMYF 3HJEA 3MKWB 3HRUA 2K3PA 2DO7A 2R7DA 1JXSA 1W7PD 2QM3A 1WPKA 1T0FC 1Z7LA 2EK5A 2I8DA 5EZHA 2BEOA 5HNFA 1MW7A 1TP4A 1FTTA 2ETHA 2M7BA 2RVCA 4MEXF 4LITA 1J59A 4BDZA 4D9JA 5CQGA 2XF6A 1LE8A 4WWCA 1HQCA 1WJCA 2RNGA 4U87A 4CYDA 3ECHA 3DV8A 1IZ1A 2EH3A 2HWVA 2NVQJ 1KONA 1HXDA 1TNTA 1TQIA 1O7FA 2QCOA 1IAWA 2RNJA 1U8BA 3ULQB 2DCEA 1MMDA 4I0BA 3DTIA 4FX0A 2PX9A 3HGGA 5LHHA 5HLTA 3EUKL 4EJOA 2OU2A 1O3QA 3MKLA 1B9MA 1WJDA 5BPIA 4LG0A 3V7CA 3CMMA 5IYDJ 5AIQA 2F5VA 3W6KB 3W6JB 2IEKA 2QSFX 3GTJJ 4ON0A 3AL0C 1BC7C 5EGOA 2A07F 2LH9A 4CCJA 2PMZN 3S1NJ 2DAOA 5FLVA 5EDNA 2L7KA 4GYGA 2F4MB 1MBHA 2E7XA 2VI6A 1K6OA 2HXIA 2IW5A 1RETA 1LQ1A 3VFZA 1J7KA 3EETA 2KIQA 4LJZF 3ZQHA 4A3EJ 4LOCA 4W97A 2VBYA 4NC8A 2E7WA 1TWHJ 3LAPA 3QYFA 4XL9A 5M5WJ 2QEXI 1ZN2A 1A04A 4IF4A 4R79A 3OYBA 3KYCB 2NS8A 3CCUI 3HOXJ 3GTGJ 2R7XA 2WADA 3QPSA 1LE8B 2IA1A 2IRFG 1CQTA 2XAQA 2H6CA 2DT6A 3CP2A 2XSJC 3QPLA 2HDWA 5LLQA 2K02A 1IV6A 4EJVA 5DUIA 1WJBA 4ZZDA 1KYZA 4HQMA 4A93J 1R5HA 4L5JA 3BP8A 3M8JA 2J5PA 4OAYA 5LRRA 3QOPA 1PJRA 3SZPA 5J3LA 2Y31A 3DPTA 1I50J 3O3KA 4CXFA 1VQLI 1UJ8A 2CUZA 3BLYA 1IRZA 2DK5A 4A0ZA 2XHKA 5JR3A 1T95A 3M8EA 1Z77A 4LB5A 1GVDA 1XX5A 1ETXA 2M0CA 1TTYA 3MEXA 3CCMI 3S2WA 1JHFA 2XUBA 5E8IA 5EEAA 2MYSA 5EGOB 5JHFA 3CO6C 2N8GA 1Z1DA 2M8EA 3K1PA 3QP6A 3KZYA 4JX4A 4CDGA 2GA1A 2ACJA 2DMQA 2ESNA 1IUYA 1LEBA 1Y0NA 2FJ1A 3M9AA 1WWXA 3DF8A 4CICA 5ICGA 1SD5A 3PNVA 3SJMA 1RUNA 2B0LA 2F2EA 5HLHA 3C2GA 1Z3YA 1H8AC 4LMYA 1BJAA 1XSXA 4N4OB 2IS2A 5JHUA 2XASA 3BZCA 2EZHA 5LFAA 3OYAA 1I5ZA 4WCGA 3OIQA 2E60A 4S04A 1R1VA 3DTEA 2HPIA 5F6FA 2IA2A 2L5QA 1B9NA 4Q4ZF 4E7ZA 2BY0A 3SZGA 1I27A 4UVBA 4EM0B 1TC3C 3WGHA 2ME6A 4U0WA 4I76A 1AKHB 3KCCA 1QPIA 1SVMA 3M07A 3NEUA 4GFBA 2D45A 4IHYA 3E6MA 2CQNA 4G7OF 4MO7A 4AUXA 2MD5A 5F1RA 4NDLA 3Q9VA 3BG7A 1ON1A 2L02A 5FLXK 3J7AY 5DD4A 3FZVA 1W1WE 2Z99A 5JVGF 1LKXA 2F5FA 2NOGA 3ZMVA 3KEYA 1BA5A 3FBNB 5CPRB 3PO2J 1JGSA 1EF4A 1B72A 5J6XA 2IGNA 4XKBA 3SYTA 1X4OA 2NAZA 5LGTA 1RKWA 3K4BA 4NC7A 4IPAA 2QYOA 4ANJA 4A12A 3H0DA 1R7JA 4EQQA 3D5RC 1D1CA 1ZR4A 3F3XA 3S2DJ 3WODF 2JMWA 1EH6A 4U0YA 2P6SA 2AQFA 3J7ZI 2JRMA 3HOUJ 2JUGA 2XVCA 3QU6A 1YJ9I 3DLAA 5LBQA 5M5YJ 1Y1WJ 1HKTA 1QVTA 2KIMA 3SFIA 3VB2A 1MGTA 4QSHA 4XKVA 3S32A 2V1UA 1QGPA 5FO5A 1NG7A 4MTEA 2FXAA 3DKYA 4DBRA 5E1ZB 1FBQA 4BAYA 4IEJA 1Z21A 5IPAA 1ZARA 4XICA 3HPGA 2JPBA 2E2IJ 4PSXA 2CH0A 2V9PA 4B47A 4LIUA 2Q1ZB 3OYGA 4L0ZB 5E1WA 3H5NA 4IZZA 3TGNA 3OYIA 2WA0A 1FOKA 3OYDA 2GXBA 1QPMA 4ZYEA 1ZRDA 4FE4A 2KPMA 4IRGA 2AXTC 3ZMTA 4F52A 2JTVA 4CCMA 1ZYRF 1X1BA 5HOOA 2WAQN 2VN2A 1DU0A 4XMYA 3FX3A 3I5UA 2XPWA 1ZAOA 2GA2A 5FFXA 3U21A 5IT3A 4UUSA 1GVJA 2DA3A 1JUPA 3HOVJ 2E5NA 1VQPI 1FYKA 2DT5A 3MZYA 1T08B 4UUVA 1X1AA 2DFEA 2QQAA 1H9GA 3H3ZA 3PSFA 3T5XA 1YRNA 4A6DA 2V1NA 1ON2A 5FRMA 4AIDA 1EV7A 2LF7A 3GMEA 3FM5A 1Y8QB 1MH4A 1F9NA 2DTRA 3FXLA 5K5QA 1S72I 4BE0A 3VYUB 2ZJQF 4B4CA 1HDPA 1QRYA 3S8PA 4IOAF 1OCRH 1XMKA 3VDXA 3O8GA 1TW2A 5KVRA 3K6GA 4C30A 4IJAA 1UHMA 2M30A 4FE7A 4A5MA 4I01A 3SXYA 3ZN1A 2KLOA 3OYLA 2KJCA 2STTA 2M4KA 2XGEA 4ABZA 4A3GJ 1ETYA 2I5UA 3GWZA 2LBFB 4B1RA 1J2XA 4XKWA 1E3HA 4H0EA 1YLFA 2JJ7A 3G4SI 5J47A 4BJ6C 2O8XA 1YI2I 4G6QA 4E7IA 3CC2I 3CTAA 4UV9A 3KETA 2ISZA 1FWZA 2Z2SB 3R61A 5EG0A 3TMOA 5DCMB 2PBIA 1SFKA 4JX6A 1DP7P 5L3FA 5BPDA 3GO5A 3WGGA 2HR3A 3ZCOA 2G0EA 1YIJI 3MCZA 2KZVA 4ZTFA 4YFXF 1VQ7I 1ZREA 1S29A 2FMYA 3FMRA 4X1EA 4GDFA 3GTOJ 2DA2A 2IGMA 2Y75A 3JR9A 1U3EM 3OYCA 4XNFA 4BY7J 3RYPA 3U9GA 2HKXA 4Y15A 4M74A 5DCFA 3JCUC 3WHBA 2RQPA 2RKHA 2Y0MA 4QLCU 2VQHA 5C4JJ 1FPQA 3BWGA 5KK1A 4MQ9F 3K4NA 3IH3A 3ZMSA 4AIJA 2LMDA 5LHGA 4A3BJ 2BZTA 4MGRA 5K5OA 1YJWI 3N05A 3CJRB 5FFZA 2LDUA 4NBQA 5L3DA 2EWNA 4L5IA 3BTIA 1ZGJA 2H1KA 3LFKA 1EJ9A 3DU6A 2EFQA 2CW7A 2JQ7A 4L9TA 2E35A 3O6BB 5LEJA 1X1PA 3V8KA 2JWTA 1Y8RB 5BMZA 3IUOA 4RGUA 1FNNA 2OAZA 2FBHA 2L3DA 1TL8A 3FMSA 3SDBA 4AYBN 3CMEI 1IXRC 1K61A 1D5VA 5EG0B 3WGIA 4HX4A 4RB1A 3Q3SA 1PDNC 4UNOA 4BGDA 1JUSA 2V6EA 1L3LA 3F6VA 3P9CA 2E71A 5KAFC 3HL2A 4ZYDA 3VWBA 4AIHA 1R71A 1S9HA 2KHMA 3DWLE 4L9JA 2AHQA 1MMSA 4M6VA 5IP7J 1XS9A 1ITYA 3H3UA 3HB9A 4DIQA 1IN8A 3I71A 4C3IJ 2VBWA 2GXGA 3H0GJ 3GFIA 3WTZA 3K1MA 1HW1A 3JRGA 4KISA 1LDKB 4D5FA 2L4AA 5E8GA 4A2UA 3OYNA 3AAFA 3BTLA 4EEFG 2YU9J 5GAGJ 1W36D 2OTJI 1U0JA 3S3OA 3O2PE 2ELKA 3L2RA 4XRMA 5IY5H 4G9YA 1SC7A 3QYBA 1KQ8A 3BR2A 2LNBA 4M3BA 3EDPA 4RGSA 2DFFA 5CVIA 1STZA 3HHGA 4K2EA 5F0FA 2O8KA 2VOPA 2A6EF 1NK3P 1V5GA 3RQIA 2NVTJ 1Y39A 4OIPF 3R4KA 4UHTA 5J1RA 4C9YA 4PUSA 2Y48A 3A02A 4LLNA 1YW9A 4Q5SF 5DM6F 3GXOA 2MC3A 2LRDA 4L9VA 3ELKA 1C0WA 4B09A 2GIVA 1BOBA 2VONA 3L00A 1KQ9A 4CCOA 4D7MA 4M3GA 3BY6A 3Q0UA 2EV0A 2O5RA 4II2A 1VF9A 1P6RA 1IV8A 4A0XA 2GBYA 1G4DA 2IA0A 4ESFA 1XGOA 1LVAA 5M5XJ 3IRQA 4N9HA 2YUSA 2R7WA 2XGXA 4EMSA
chains in the Genus database with same CATH topology
1VQMI 3I55I 1ACIA 1VQ5I 1VQ9I 5DM7F 1VQ8I 2OTLI 3CCMI 5GAEJ 3CF5F 1YJWI 3CCJI 1YITI 2NXNB 4IOCF 2JQ7A 2E35A 2E34A 1VQPI 1QA6A 2H8WA 3G71I 2ZJRF 3CCEI 3CMEI 1YHQI 3CJTB 3DLLF 5GAHJ 2E36A 3CCSI 1VQKI 3CC7I 1S72I 4V19K 4UY8I 2ZJQF 1FOXA 1MMSA 4IOAF 1FOWA 3CCQI 3PIOF 3CC4I 2QA4I 5GAGJ 2OTJI 3CCLI 5JVGF 1HC8A 1VQ4I 2K3FA 2QEXI 5GADJ 4IO9F 3G4SI 1YI2I 3CC2I 3CCUI 3CD6I 1VQOI 3G6EI 1VQNI 1Y39A 3CMAI 1FOYA 5DM6F 3CCVI 3J7ZI 3PIPF 1YJ9I 2FOWA 3I56I 3CCRI 1YIJI 1VQ7I 1VQ6I 1YJNI 1VQLI 3J7YJ 2ZJPF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQM I;  3I55 I;  1ACI A;  1VQ5 I;  1VQ9 I;  5DM7 F;  1VQ8 I;  2OTL I;  3CCM I;  5GAE J;  3CF5 F;  1YJW I;  3CCJ I;  1YIT I;  2NXN B;  4IOC F;  2JQ7 A;  2E35 A;  2E34 A;  1VQP I;  1QA6 A;  2H8W A;  3G71 I;  2ZJR F;  3CCE I;  3CME I;  1YHQ I;  3CJT B;  3DLL F;  5GAH J;  2E36 A;  3CCS I;  1VQK I;  3CC7 I;  1S72 I;  4V19 K;  4UY8 I;  2ZJQ F;  1FOX A;  1MMS A;  4IOA F;  1FOW A;  3CCQ I;  3PIO F;  3CC4 I;  2QA4 I;  5GAG J;  2OTJ I;  3CCL I;  5JVG F;  1HC8 A;  1VQ4 I;  2K3F A;  2QEX I;  5GAD J;  4IO9 F;  3G4S I;  1YI2 I;  3CC2 I;  3CCU I;  3CD6 I;  1VQO I;  3G6E I;  1VQN I;  1Y39 A;  3CMA I;  1FOY A;  5DM6 F;  3CCV I;  3J7Z I;  3PIP F;  1YJ9 I;  2FOW A;  3I56 I;  3CCR I;  1YIJ I;  1VQ7 I;  1VQ6 I;  1YJN I;  1VQL I;  3J7Y J;  2ZJP F; 
#chains in the Genus database with same CATH topology
 2J5O A;  1LEA A;  5E18 F;  2DFH A;  3I55 I;  1ACI A;  1GV5 A;  4JP0 A;  2XAJ A;  1YS6 A;  3IC7 A;  1LFP A;  1ETK A;  1O3R A;  3VEP A;  1FTZ A;  1BI0 A;  3WU0 A;  1O4X A;  4BE2 A;  4PDK A;  2KIS A;  3PSI A;  1XMA A;  3K4K A;  2HOS A;  1S3J A;  3C2H A;  4M9S A;  4RMN A;  3S1Q J;  4XLH A;  3GTP J;  3BR5 A;  3E5X A;  4R8H A;  5ILS A;  3N97 A;  2JVH A;  1K4T A;  3G1L A;  1XTA A;  1U5T C;  4NB5 A;  5F27 A;  5C44 J;  3JAM K;  3ESW B;  2QQ9 A;  2WC2 A;  4F91 B;  3LWF A;  3V7R A;  1OYI A;  2CW8 A;  4ENJ A;  5TJJ A;  4BJT A;  2FQ4 A;  2CYY A;  3H9Q A;  4L18 B;  3I64 A;  4HA8 A;  4G8X A;  3RPU D;  1B4A A;  1FIA A;  1U78 A;  3RDI A;  5H20 A;  3HRS A;  3OWT A;  3JRF A;  1H9T A;  3LOC A;  3GTM J;  2WV1 A;  2B9S A;  3HC7 A;  4UY8 I;  3IH4 A;  2A69 F;  3BQY A;  4II3 A;  1G8X A;  2FD5 A;  4MIM A;  3J80 Z;  1O3T A;  3WTT C;  2LLK A;  3K4L A;  3PL8 A;  1U5T A;  2ESH A;  5HDN A;  3KLO A;  2FE3 A;  3E6D A;  3CO7 C;  1I1S A;  4LK0 F;  5DV5 A;  1MJ9 A;  2EFO A;  2KDZ A;  1OFC X;  3G3Z A;  4Y33 A;  2ECC A;  2XAG A;  1UST A;  3ML6 A;  2XB5 A;  4A6E A;  3FHN A;  4IX7 A;  2RN7 A;  2Z9O A;  2IGO A;  4OIR F;  2OZ6 A;  1SVO A;  3HOS A;  1U9N A;  3NRV A;  1TT5 B;  3EPZ A;  3H9G A;  3H5R A;  5JLX A;  3FHZ A;  2OQR A;  2PG4 A;  3OIO A;  3H35 A;  4I99 C;  3ASO H;  3MMY B;  3PO3 J;  2CRG A;  1D8K A;  5FKM A;  2K7L A;  3H36 A;  2FSW A;  3VYT B;  4ZYG A;  3HSR A;  1ZG1 A;  3CLQ A;  1VI0 A;  2HFH A;  4KA4 A;  4A3M J;  4D1Q A;  1O3S A;  3M1C A;  1D3Y A;  2H94 A;  4O5V A;  1FMW A;  3W3C A;  1B59 A;  4BXF A;  4Y52 J;  3HIF A;  4PJN A;  4CGZ A;  1LB2 A;  4RB0 A;  1UAA A;  1HSJ A;  4F93 B;  3RKX A;  5ED4 A;  2ZJ2 A;  4G7Z F;  3OOP A;  4RLF A;  3TW7 A;  5DTD A;  1S8N A;  5JVT A;  2LG4 A;  2HQN A;  3A1Y A;  2GXA A;  4XM3 A;  1DPU A;  2HS5 A;  1BIB A;  2LOO A;  4OIN F;  4IHT A;  1RC9 A;  2BW3 A;  1U5T B;  2JPC A;  3FIW A;  4XID A;  3VSK A;  2LC2 A;  4OWR B;  4LK1 F;  3HRT A;  2VL8 A;  1V5E A;  3FK7 A;  2VLA A;  2V79 A;  4XOP A;  3IKV A;  2CU7 A;  4CHU A;  1TWG J;  2L7Z A;  4PK4 A;  1F43 A;  3A03 A;  3BR6 A;  2E1O A;  1I6X A;  4L0Y B;  2WB1 N;  2Y0S A;  5IP6 A;  3M1E A;  1NHA A;  5K7H A;  1G2H A;  3ISP A;  3WTX C;  1T2K A;  1WH7 A;  2EIN H;  3MD2 A;  4JQF A;  1R5I D;  2XF7 A;  1FC3 A;  1OKR A;  2OPT A;  1TLH B;  2EA4 A;  4CSW A;  5L3C A;  1YOV B;  3S1R J;  1F4K A;  3P5J A;  4RGX A;  5HOD A;  2FF4 A;  2VIX A;  1MZB A;  3DEW A;  3F8F A;  3K10 A;  1HLV A;  1MBE A;  1U6G A;  4EJT A;  4A3I J;  1X4P A;  1WGX A;  2LVS A;  2Q2E B;  2ZME C;  2VPR A;  1APL C;  4IHW A;  2HVS A;  4RB2 C;  2JUC A;  3H3V K;  5E20 A;  1ETO A;  3ZQL A;  1HKQ A;  4RM3 A;  2K9N A;  1O57 A;  4BQA A;  3HUG A;  2R5Y B;  3QU3 A;  2QEN A;  2F5C A;  3LL7 A;  3AG3 H;  4UB6 C;  3CMY A;  5FB2 A;  2K3F A;  4O3M A;  2H8R A;  2XRO A;  2W24 A;  1T0F A;  4CO8 A;  2BW3 B;  3MAJ A;  3KP6 A;  2HU9 A;  3K2A A;  4MNU A;  3KZI C;  3J81 K;  5DS9 A;  3G6E I;  4IHS A;  3JRI A;  1Z9C A;  4G6T B;  2UV1 A;  3IV5 A;  1EH7 A;  2W4S A;  5A2Q K;  1WJ5 A;  2VB6 A;  4LIV A;  1BR1 A;  4Y13 A;  2ZME A;  1QQI A;  1V5F A;  3CDL A;  4XLE A;  2VBX A;  4MFE A;  1ZLJ A;  4ZDP A;  4XOR A;  3K70 D;  1J0R A;  3IL2 A;  3HOT A;  3O8H A;  4JX5 A;  5D6E A;  5IT9 K;  3W6V A;  1X19 A;  3J7Y J;  1P4X A;  3V8L A;  1MMG A;  5LD2 C;  2RQQ A;  2OBP A;  2VKH A;  5HNH A;  5DM7 F;  3GZN B;  4HNV A;  1JGG A;  4HRI A;  1E3P A;  1GXP A;  2DOE A;  1RRJ A;  4HDU A;  1S6L A;  3FXM A;  4X6A J;  2A68 F;  4I7H A;  2JN6 A;  2JVG A;  4E70 A;  4LB6 B;  5ILV A;  3S3N A;  2ZSI B;  1AKH A;  2P4W A;  1KU3 A;  3OS2 A;  2EBI A;  4BY1 J;  5DD8 A;  2NS7 A;  3HSF A;  3HUG B;  4ENN A;  2DTZ A;  3LSK A;  3F21 A;  5AIP A;  3RZD J;  4BXU A;  4YIR X;  4UV8 A;  4HDV A;  1N25 A;  2E34 A;  2EZK A;  1T39 A;  2V6C A;  4O6J A;  4PGG A;  2R0Q C;  2VE9 A;  2XV4 S;  2OQG A;  4X0G A;  2CWE A;  3EYY A;  4HLX A;  5B1A H;  1B1B A;  2L9S A;  3F72 A;  4C2M J;  1RI7 A;  4NC6 A;  2HTJ A;  4XK4 A;  2E2J J;  3F23 A;  3DLL F;  1A5J A;  3OR2 C;  4FT8 A;  3HKZ N;  1P92 A;  4M3E A;  2F48 A;  2MFZ A;  2ZME B;  2BXY A;  1A31 A;  2BY1 A;  1Z7U A;  2X6W A;  2MH2 A;  3ZQF A;  2VJ4 A;  4JOM A;  4BYY A;  1A36 A;  1YX5 A;  3E6C C;  2QQB A;  1MBJ A;  2K40 A;  1FX7 A;  4A3D J;  2YSR A;  4E7S A;  3HTS B;  1SAN A;  2RRE A;  2G7H A;  3PIO F;  3GF2 A;  3CDI A;  1Z6R A;  4I0A A;  1KYW A;  3JTG A;  2OCC H;  3TOB A;  1FT9 A;  2HQA A;  3DBH B;  4XQF A;  3F9K A;  2O6G E;  4LG3 A;  3ZRG A;  2O7O A;  1ZEL A;  3AL0 B;  1OCZ H;  2MAB A;  4MEY F;  1MBG A;  1QO0 D;  3DPL C;  1MIJ A;  4DZJ A;  2L7F P;  1IDZ A;  3GEZ A;  1G59 A;  2Y30 A;  2W1O A;  3S14 J;  2VC1 A;  3GZ5 A;  1FJL A;  3PFI A;  4XRS A;  2IJL A;  4UXN A;  4ZDL A;  4KYW A;  4R1H A;  3GTK J;  1NK2 P;  2CV0 A;  2K9L A;  1XC5 A;  2AO9 A;  2E1M C;  2QWW A;  3HHH A;  4UVA A;  3ZR8 X;  2P81 A;  2ZBK A;  2R5Z B;  1BL0 A;  2BYV E;  3K0L A;  1K7A A;  2R7T A;  4P55 A;  3I59 A;  3OYJ A;  2LYC A;  1SAU A;  1EH8 A;  1MKM A;  4QPQ A;  1IGN A;  2PFB A;  1JKQ C;  2EIM H;  4EVI A;  2LD5 A;  3K69 A;  4H4K C;  4RM2 A;  1F36 A;  3D1N I;  1U8R A;  1P4W A;  2EPF A;  3IKT A;  5IYB J;  2PMZ A;  3L2W A;  2OF7 A;  2HOT A;  2K85 A;  2CQX A;  3JTH A;  4RAZ A;  1JTX A;  1J5Y A;  2DA6 A;  1BI2 A;  3Q5F A;  3BRO A;  3UNG C;  3BR0 A;  4EGY A;  3TDZ C;  4BE1 A;  1V54 H;  5D8K B;  3CCY A;  1ETV A;  1O7L A;  2DA1 A;  3U2R A;  3KP4 A;  1S5L C;  3BZK A;  3R0A A;  1SD6 A;  2CS3 A;  4HX7 A;  4ZZL A;  4HPQ A;  1IJW C;  3G71 I;  2R7R A;  1A6Q A;  2CFO A;  1Y56 A;  2HKO A;  1G6N A;  2LBF A;  2YX4 A;  1UZC A;  2EQR A;  1F1Z A;  4KIB A;  2OV7 A;  3S15 J;  2EZI A;  2P7V B;  3RKQ A;  3GBG A;  1E0E A;  2DT7 B;  3J7A O;  3LSI A;  3PUB A;  2EIK H;  5ILU A;  1P7J A;  3CJQ B;  5EJC A;  5DCM A;  1FIP A;  4BJ5 C;  2EIJ H;  2JRT A;  3I4N J;  2PJR B;  2X6X A;  1OLT A;  4ETS A;  1GXQ A;  2YR2 A;  4HF0 A;  4M71 A;  4DYC A;  5F64 A;  4E6K G;  3MZH A;  3I59 B;  1QBJ A;  5E3O A;  2ID3 A;  3V4G A;  4BH9 A;  4IXA A;  2OCE A;  4KDP A;  4RA2 A;  3KP3 A;  3L2U A;  2DA4 A;  1R4M B;  1T38 A;  5GPA A;  4ESB A;  3VOE A;  1HF0 A;  4JBA A;  5BQT A;  3TO9 A;  2M1B A;  6PAX A;  2LY1 A;  3HOZ J;  3ERE D;  5FKL A;  4HX8 A;  5E17 F;  5J4V A;  4M3F A;  1N78 A;  3GYH X;  2XKP A;  2YU3 A;  1D1B A;  3K4J A;  2Y9Y A;  5KCM A;  2FEZ A;  4BHP A;  5E79 C;  2CV1 A;  4N9I A;  1JKP C;  2E1M B;  2CJJ A;  2DA7 A;  1OYW A;  3DKW A;  4HYE A;  4KT5 C;  4M72 A;  3WU1 B;  4OMZ A;  4E7H A;  2FOW A;  4RAG A;  4KIT B;  4EM1 A;  1IRF A;  3I54 A;  4WK8 F;  1KU2 A;  3N4M A;  2CSO A;  4QTR A;  3REO A;  3RQ4 A;  2MH9 A;  3ONQ A;  4IRH A;  4PFO A;  1FY7 A;  2E1C A;  2LY2 A;  4XON A;  2L0K A;  3ASN H;  2GLO A;  3FF5 A;  2YS9 A;  4DYQ A;  3G1M A;  3ZQQ A;  3F6O A;  3RIR A;  4IQJ A;  2MG4 A;  4OMY A;  2HQ5 A;  2X51 A;  3HOW J;  5KHD A;  1I6H J;  4PZJ A;  3FXR A;  5M3M J;  5F0C A;  1ZG3 A;  1SD4 A;  2F5E A;  2OJE D;  4UVC A;  2R7U A;  4WXD A;  1YX3 A;  3IAM 2;  3HGY A;  1FSH A;  2BBY A;  3CF5 F;  2DLL A;  3MWM A;  2LKP A;  1I3Q J;  1IRX A;  5KAI C;  1XSV A;  3HSE A;  2HYF A;  3F8C A;  3ZN0 A;  4BAC A;  1MH3 A;  2F4O B;  5GTI C;  3BJA A;  2IAI A;  1XCV A;  3B6C A;  1WJE A;  2PEX A;  4LD5 A;  3QOD A;  3R6S A;  4XRS G;  1A6I A;  4MQV A;  2PJP A;  1TQM A;  2GOM A;  3TL4 X;  2D1H A;  5BNG A;  1MD0 A;  5KNL A;  1ULY A;  2VQC A;  2XSD C;  2K27 A;  1B6A A;  1Z0X A;  2H8W A;  2V9K A;  1ERD A;  1G3Y A;  4WXH A;  2KKO A;  3PNT A;  1V55 H;  2ZSH B;  3LA2 A;  3BPV A;  1FBU A;  1UG0 A;  3G2B A;  4N0B A;  4HW0 A;  1FYM A;  3KYD B;  4PGH A;  1LDD A;  2KDO A;  2QLZ A;  4PFP A;  1TBX A;  4L9N A;  1UMQ A;  3CDH A;  1GT0 C;  2NVU B;  1YW7 A;  4WF2 A;  2H6B A;  1YS7 A;  4GXO A;  3T0Y A;  2QKM B;  1CGP A;  2M2E A;  1SD7 A;  1PYV A;  1TWF J;  3ABL H;  1XB4 A;  1ORK A;  3FXQ A;  4CCL A;  1W0T A;  4DYR A;  2X6Y A;  2V9V A;  2ZCW A;  3KFW X;  2VOO A;  1BM9 A;  1HC8 A;  1D0X A;  1BW5 A;  1BR4 A;  2A3S A;  4KFC A;  1KU7 A;  3AG2 H;  3BJ6 A;  5FKN A;  2RC4 A;  3CQZ J;  5CVJ A;  2VXD A;  5DYM A;  5GAD J;  4RBO A;  2YX7 A;  4AIK A;  4YEJ A;  2WBM A;  2DK8 A;  1DDN A;  4BBR J;  1DQU A;  4BNC A;  3KE2 A;  3ZP5 A;  2LP0 A;  3QOE A;  4ZYA A;  2WAQ A;  2DU9 A;  1DPR A;  5L3B A;  1FZP B;  4I98 B;  1G3W A;  1W5S A;  1R4N B;  1PUE E;  4RGR A;  3W2V A;  1QU3 A;  4KT6 A;  5J8F A;  4LLG F;  2UXX A;  1X58 A;  2Q0O A;  4GO1 A;  1Z91 A;  3SFZ A;  4A3C J;  3GLL A;  3IAS 2;  1SEU A;  2DW4 A;  1XGS A;  1MDM A;  4J00 A;  2DBB A;  1YJN I;  1B8I B;  3J80 K;  2ELJ A;  3DEE A;  2W82 A;  2XPU A;  3I9V 2;  1XSD A;  1WKM A;  2GIZ A;  2H1L A;  2TDX A;  1TZL A;  4Y4R A;  4MTD A;  1U2W A;  4N4N B;  4A3F J;  1VQ9 I;  3VOD A;  1VQ8 I;  1YYV A;  3ZMD A;  3ERM A;  3NWS A;  1FBS A;  3HM5 A;  3OL3 A;  3LMM A;  5ICC A;  5LGN A;  1RR7 A;  2E5Z A;  5HDK A;  2XB0 X;  4WXC A;  5F0H A;  4HF1 A;  4XN3 A;  1IN7 A;  3GVA A;  4MLO A;  3PJR A;  3DPU A;  4G6D A;  3CCJ I;  3JRC A;  1YE9 A;  1JI8 A;  1WQ2 A;  5J1U A;  2FOK A;  1N75 A;  2LKS A;  5HS7 A;  3LSG A;  1IF1 A;  2O03 A;  2LF8 A;  3RZO J;  1Q1V A;  2VAS A;  1IUF A;  1K6Y A;  3DEU A;  2DQR A;  3E5Q A;  1OCC H;  2F5D A;  2QGU A;  1WJA A;  2IPQ X;  4A69 C;  4AM3 A;  4DW6 A;  3HDD A;  2L54 A;  2DI3 A;  2NVY J;  2X4H A;  3TED A;  4M9Z A;  2R92 J;  3GCM A;  1S7A A;  1NTC A;  1XN7 A;  2M34 A;  5C4X J;  4DQ2 A;  2Z33 A;  3BZ6 A;  1MMN A;  4D7N A;  2ZXW H;  4KIC A;  3BR1 A;  4MHG A;  4CZZ A;  3AKZ A;  2ECB A;  3L9F A;  4HNT A;  5GPC A;  3DFG A;  2X1C A;  2XGC A;  3M8F A;  4F55 A;  3M7G A;  3RYR A;  1MDM B;  3P9K A;  2AS5 F;  3HTU A;  1Y1V J;  1JT0 A;  4HV5 A;  1M1E B;  1XGN A;  1D8J A;  4I09 A;  2QBY B;  3BQZ A;  4NQW B;  1GDT A;  2QA4 I;  1LPQ A;  2XAH A;  3TBI A;  3TW6 A;  2R4G A;  4Y3O A;  4I6Z A;  2EA2 A;  2M5W A;  4ITV A;  2LK2 A;  4PCQ A;  1VQ4 I;  2AQE A;  2DMT A;  3Q9S A;  4YFN F;  2A5W A;  4DGW B;  3SHF A;  2O3F A;  2DA5 A;  4C3H J;  3JRH A;  1VFC A;  1AU7 A;  4Z2Y A;  4FTH A;  1REP C;  5B5E C;  3RKW A;  2Z16 A;  2VC0 A;  1YQA A;  4QWQ A;  1X1D A;  1X3W B;  3V7S A;  3CMA I;  2R7F A;  1FOY A;  3QWL A;  1RZ4 A;  2BY3 A;  1R6R A;  4BEH B;  1MBF A;  1W5C C;  4Y7N J;  3WE2 A;  4CH7 A;  4ZJZ A;  4ZYH A;  2MSY A;  2VOD A;  3LAJ A;  5D5W B;  2P6T A;  1P2F A;  4PJJ A;  1VQ6 I;  2CG4 A;  3S17 J;  1IN5 A;  3FM3 A;  5D4R A;  5C3E J;  3BPX A;  2HZT A;  2HVQ A;  4PJ0 C;  4AYB A;  1VQM I;  1ETQ A;  1ZGW A;  2NRA C;  3P7N A;  1ZQ3 P;  2HNH A;  4J19 A;  4XSZ F;  1TNS A;  1SFX A;  5DEQ A;  2LTP A;  2ZXI A;  1L0O C;  2FNA A;  1T6S A;  5D6F A;  1FYL A;  1KQ0 A;  3JSP A;  3NWT A;  3H92 A;  4YEL A;  4M9X A;  3HRM A;  3LQR A;  5D5X B;  4A3J J;  3QPH A;  1HW2 A;  1YIO A;  4HZF A;  1WHU A;  4V2G A;  2A05 A;  3C18 A;  2Q2E A;  2IT0 A;  1OCO H;  2MC4 A;  5EEH A;  4IHV A;  4EJU A;  1W7P A;  3WTS C;  4B8X A;  2DXI A;  1ENH A;  2Q8K A;  3S3M A;  2BHZ A;  3TOA A;  5CVU A;  2JSC A;  2M0M A;  2R5Y A;  4DNC A;  4NUB A;  3C7J A;  4S0H B;  4FCY A;  2EJR A;  1Z3X A;  3KP2 A;  1R22 A;  2X1E A;  1QNT A;  3VYR B;  2E1N A;  1BR2 A;  3BT9 A;  2DFI A;  3BOQ A;  3T8T A;  3OYH A;  3F8M A;  4HSR A;  3TO7 A;  2JA6 J;  4A3L J;  1G3T A;  2E36 A;  3CCS I;  4B3X A;  1VQK I;  1WH5 A;  3CC7 I;  1SFE A;  1XPX A;  5H2F C;  2IP2 A;  1JTY A;  2GZW A;  3ABU A;  3C1D A;  2QSH X;  2VQL A;  2R7Z J;  1ZG5 A;  2VJI A;  1CF7 B;  2MD0 A;  4B43 A;  3JAM Z;  1S7O A;  2V1D A;  4G7H F;  2JK3 A;  3QYE A;  3HOY J;  2GAU A;  1WI9 A;  2YPR A;  2IS6 A;  3KZZ A;  2ZNY A;  2NNN A;  1BOA A;  3KEO A;  3CC4 I;  2PQ8 A;  2VKD A;  3EUH C;  3BR3 A;  3GTL J;  2EZL A;  1AA7 A;  2M8G X;  1QHG A;  5FKO A;  4L5E A;  4Z6Y A;  1N77 A;  2XKO A;  3BC8 A;  3H1C A;  4KIG A;  2BE5 F;  4GRI A;  3R0J A;  2CQK A;  2OA4 A;  3TO6 A;  1IRG A;  4YRV A;  2DDB A;  1JE8 A;  1K83 J;  3Q0V A;  4IQ4 A;  1QVU A;  1VQO I;  1R9T J;  2HVR A;  2QKL B;  5HDG A;  3D5S C;  5LHI A;  1W7P B;  2KL4 A;  1K4S A;  1X1C A;  3WTY C;  3QP5 A;  3GZ6 A;  1FSE A;  3OY9 A;  4OIO F;  3E0J B;  2A6T A;  5B1B H;  1LNW A;  4YIF A;  3OS0 A;  3MKZ A;  3KP5 A;  2ME0 A;  3GUD A;  3I4M J;  2FX0 A;  3CUO A;  4EJW A;  5FJ8 J;  3EUH A;  3HXL A;  2VE8 A;  3ZQC A;  5JI6 A;  1BC8 C;  2DJN A;  3SEQ A;  1SMT A;  1ZTR A;  2EIL H;  4E7K A;  4XR6 A;  3DBR B;  4FQG A;  3TKY A;  2DN0 A;  3FMQ A;  3GFM A;  2NVX J;  1IN4 A;  2JA2 A;  2QZ8 A;  2HEO A;  3LNQ A;  2STW A;  3L1P A;  2RDP A;  1KA8 A;  5GAE J;  9ANT A;  3L2V A;  3ZXS A;  5IOZ A;  4RDU A;  5K1Y A;  1HST A;  1D0Y A;  1OMI A;  2XAU A;  4U88 A;  3S2H J;  5L3G A;  3A4C A;  3OYF A;  3A01 B;  1YIT I;  4KNY A;  3AG4 H;  1QZZ A;  4HEA 2;  4IOC F;  3HYI A;  5IP9 J;  4C2T A;  3S16 J;  2DMU A;  1ZH5 A;  3V42 A;  2JA7 J;  2XPV A;  3KPH A;  4EGZ A;  1V4R A;  5FKK A;  2WY7 Q;  1QA6 A;  1VZ0 A;  2W7N A;  1R1U A;  2TRT A;  5DUK A;  2PMH A;  5D8L B;  1HKS A;  2KRF A;  2KRC A;  2XF5 A;  4ENM A;  3KP7 A;  4P1W A;  2KP6 A;  3OSF A;  5FRN A;  1UCR A;  2UXN A;  1V3F A;  1E17 A;  2BVL A;  2M45 A;  1P9Q C;  2HGC A;  2GOX B;  5JLW A;  3RI4 A;  4V19 K;  1U9O A;  2VKV A;  1E3O C;  4FX4 A;  1JJ8 C;  4XLF A;  1KGS A;  5HLG A;  1T56 A;  5F04 A;  2K9Q A;  1QZE A;  2BHY A;  2X0L A;  2R7O A;  5B66 C;  1MSE C;  2UZK A;  3E1S A;  5H6Q A;  1GV2 A;  3SEZ A;  1QHH D;  4E4H A;  2MA3 A;  3QRF F;  1YW8 A;  2R5Z A;  3T8R A;  2ZFW A;  2XGD A;  1E2X A;  5J1Y A;  1HCR A;  2MW8 A;  2CQQ A;  2WAE A;  2MLK A;  4BQN A;  2HXO A;  2RGV A;  4M3D A;  1YTY A;  3VPR A;  1TW3 A;  3GFL A;  2L2O A;  3FIS A;  4OAZ A;  2L7M P;  2EFP A;  2F4I A;  3DQV C;  4AU7 A;  3G1O A;  1I3A A;  1IW7 F;  4RS8 A;  2K9M A;  5CVV A;  2LSO A;  4DBQ A;  3BG9 A;  4G94 A;  4I2O A;  1XG1 A;  2LR8 A;  3HG9 A;  1ZKG A;  4HAM A;  3WTU C;  4J01 A;  4XN0 A;  3NQO A;  1LUJ B;  2BOL A;  5H6R A;  1H89 C;  4FIS A;  1R36 A;  4LG0 B;  4P9F A;  4KN7 X;  2V1X A;  3ECO A;  3I56 I;  3MVP A;  4OU0 A;  4U7D A;  2MBF A;  2DOD A;  2VQG A;  3U1K A;  1R5G A;  2WB1 A;  5CLS A;  3LSP A;  2X1D A;  2KIU A;  2GM4 A;  3K9T A;  3OS1 A;  1PVE A;  1PP7 U;  5D4S A;  1BW6 A;  2D5V A;  2COB A;  5LGU A;  4E7J A;  2CO5 A;  3CF2 A;  4P5O A;  1D0Z A;  4XOT A;  1EA3 A;  4XLC A;  2D2W A;  2ZXJ A;  3P9I A;  1MNE A;  1MJA A;  3K7A J;  1ONV A;  2ZKZ A;  3J81 Z;  5AON A;  4PJL A;  4U0V A;  3B6A A;  2W25 A;  3K4M A;  5A2Q Z;  5EZG A;  2DYS H;  3NAU A;  1UHW A;  3MN2 A;  2ISY A;  5K5R A;  5D5V B;  3BG6 A;  4CCK A;  1IG7 A;  2JT1 A;  1T98 A;  2OUM A;  2Z3Y A;  2A6H F;  2PJR A;  2IS4 A;  2FML A;  2HQR A;  3DTK A;  3RPQ A;  1Z05 A;  1TT0 A;  1Z67 A;  3R60 A;  3OR1 C;  1VND A;  4FET A;  3A0H C;  1MMA A;  4BQO A;  4BS9 A;  5IT9 Z;  1FLI A;  3L2C A;  1R49 A;  2H09 A;  4YFK F;  4IL6 C;  3W2W A;  2L4M A;  3JRD A;  1BI3 A;  4E7L A;  3H5A A;  3RTR A;  2W84 A;  4MFD A;  4CCN A;  3SDG A;  2FU4 A;  2L9R A;  1WRJ A;  3DP7 A;  2K9S A;  2FRH A;  3FXO A;  1EKE A;  1OQY A;  4XSX F;  1IXS B;  1MJB A;  2K4J A;  1USS A;  3L09 A;  2B63 J;  1HA8 A;  2FQ3 A;  4BL0 B;  2XIG A;  2M9H A;  3CUQ C;  1A35 A;  5IYC J;  3ZQG A;  3D5L A;  1SFO J;  3OV8 A;  3IWF A;  3E5U A;  2R7Q A;  3RCO A;  1ZK8 A;  1D5Y A;  2KJB A;  4B3A A;  4V2F A;  1MNM C;  2DQL A;  3JW4 A;  4Q48 A;  3DCF A;  1GHC A;  1PP8 F;  3H9J A;  2P5K A;  4EAT A;  2V4J C;  2WAF A;  2BGC A;  2VT3 A;  2PN6 A;  1DUX C;  4M6Y A;  3HZJ A;  4U7B A;  2HTS A;  3BG3 A;  4BKX A;  3GX4 X;  3Q0W A;  1AHD P;  5E1X A;  1J9I A;  4D5C A;  5E3M A;  4TV7 A;  1HBX G;  3B02 A;  3CCV I;  3CUQ A;  2HYG D;  4BHB A;  4HBL A;  1BI1 A;  3TP3 A;  1S7E A;  4ASN A;  2VKE A;  1WFX A;  3PM1 A;  3TQN A;  1GLN A;  3FXU A;  2IGK A;  5HS8 A;  1UHS A;  1WJF A;  2TCT A;  3ZOB A;  2X6O A;  3WU2 C;  4NHJ A;  2DMN A;  1XGM A;  4CA0 A;  4HOB A;  3LA7 A;  2MLG A;  4XLN F;  2R93 J;  2WTE A;  4W1U A;  1BIA A;  1TQP A;  4BBS J;  5EYR A;  4OIQ F;  2VT2 A;  2FA5 A;  1SFU A;  2EB7 A;  3F8N A;  3HKZ A;  4XBF A;  2KFD A;  1T8I A;  1B72 B;  1UFM A;  2OTL I;  4KMU X;  3JRE A;  2BXZ A;  2CUF A;  2QVO A;  3S93 A;  1R00 A;  2O61 A;  1UEL B;  3MZ8 A;  4DJA A;  3CJN A;  3F0C A;  3E7L A;  1F5T A;  3OL4 A;  2ZB9 A;  3JRB A;  4HF2 A;  2NOJ B;  2HDD A;  2OC6 A;  2WV0 A;  5J40 A;  2OD5 A;  1J75 A;  2DJI A;  5FLX Z;  1K78 A;  4HG2 A;  3ABM H;  2NXN B;  1IC8 A;  4HQE A;  4P9U A;  3F22 A;  3UKG A;  4AD9 A;  3W2A A;  1OPC A;  4BXX J;  1MND A;  1ZLK A;  5IOY A;  1JKR C;  2ELH A;  1T33 A;  1XD7 A;  4F92 B;  4RB3 C;  3HEF A;  1MSF C;  2BVM A;  4A5N A;  4ESJ A;  2JZY A;  1YHQ I;  3CJT B;  2C6Y A;  4RAY A;  2CFX A;  3ABK H;  1OR7 C;  3CUQ B;  1R1T A;  5L3E A;  1W36 C;  2IBD A;  2P5V A;  2KZG A;  3I3L A;  1FEX A;  4AWX B;  2R7V A;  2CW0 F;  4S05 A;  1RKT A;  3WE3 A;  2FUG 2;  1FOX A;  1DP3 A;  5ERI A;  1Q1H A;  2AXL A;  5K7F A;  3FKI J;  2FBI A;  4XLA A;  5HLI A;  4PJM A;  4WX9 A;  1ZRF A;  1R23 A;  4A0Y A;  3CCQ I;  1LDJ A;  4UUS B;  3IH2 A;  3KLN A;  3S1M J;  2CMP A;  2D1V A;  2P0W A;  4BHC A;  3BJO A;  3GFJ A;  3OMY A;  5FD6 A;  2K5C A;  3PQK A;  1RPW A;  1B8I A;  3OYM A;  2P8T A;  1YRN B;  5F08 A;  4Q47 A;  4IRI A;  4F3Q A;  4KMF A;  1J09 A;  4LFU A;  4DZP A;  2L9N A;  2W57 A;  3ABT A;  1OCT C;  3OYE A;  4KJZ A;  3RSN A;  1ETW A;  2DYR H;  3VYS B;  4M73 A;  1BN5 A;  3LSR A;  4IVN A;  1W4M A;  1OR7 A;  5TGT A;  1K79 A;  3ZPL A;  1XDS A;  3CD6 I;  3K4C A;  1SAX A;  2HOA A;  2GWR A;  1K78 B;  2PLY A;  4C2U A;  3PFY A;  3ZMZ A;  2UWM A;  1RNL A;  1PUF A;  4UUT A;  2IVM A;  2OZU A;  3PIP F;  5D5U B;  1RES A;  3DKX A;  3CP8 A;  1YFH A;  2W85 A;  1Z6T A;  2COM A;  4AC0 A;  2UUZ A;  3MKY B;  2W48 A;  2CQ7 A;  5BOX A;  2MGQ A;  5FLM J;  5M3F J;  1RIO H;  4ZH4 F;  4ENK A;  1ZHF A;  4YII A;  1P7I A;  1JKO C;  4ZDO A;  2M87 A;  4AVP A;  2M4G A;  1P4A A;  4FAS D;  2HYJ A;  2X9D A;  3HBL A;  5FGM A;  3JRA A;  2QQ8 A;  4D0P A;  3BCB A;  5HS9 A;  3BG5 A;  2CUE A;  2NNY A;  1ZRC A;  1IDY A;  4EM2 A;  2KMU A;  2Z5U A;  4BUP A;  2VUM J;  3ZQI A;  4B48 A;  3C3W A;  4NNJ A;  5TRD A;  2HDC A;  3LSJ A;  3FWE A;  3COA C;  1BBY A;  1DU6 A;  3K2Z A;  2IXS A;  2M3A A;  2PI0 A;  1QZY A;  4XRF A;  3LST A;  5GP9 A;  1H0M A;  1HDD C;  3OIP A;  2KQR A;  3U1D A;  3WG7 H;  1TWC J;  3UR3 C;  2QBY A;  2HZD A;  4NQW A;  4UB8 C;  3SQN A;  4DOZ A;  3GTQ J;  5LRS A;  1LVK A;  1OIS A;  2LY9 A;  4KN4 X;  4P96 A;  3OSG A;  2A61 A;  3KX2 A;  2KRH A;  4RLQ A;  3V8J A;  1PUF B;  3BTC A;  3HPH A;  5GAH J;  1WCM J;  2EFN A;  1YG2 A;  5J8C A;  5FD5 A;  2XRN A;  4I02 A;  1POG A;  2CGP A;  2VBZ A;  1I1G A;  2ZO4 A;  2IS1 A;  2P7C B;  3QAH A;  4BEH A;  2ZXH A;  1I39 A;  2EV5 A;  3LSM A;  3PQJ A;  1FP1 D;  3QPT A;  3QQA A;  3RPU A;  2A5Y B;  4G12 A;  3BCA A;  1JT6 A;  3WHC A;  2QF7 A;  4CZC A;  5E3N A;  4GGG A;  3MFK A;  2Y2Z A;  3FXK A;  1LJ9 A;  2QUF A;  1WSU A;  4IKF A;  3F8B A;  3LQQ A;  4GCV A;  4GYI A;  5JFR A;  3CCL I;  2GQQ A;  3JSO A;  4CYC A;  3E3V A;  2X48 A;  3DXJ F;  2EFW A;  1KZH A;  1LFU P;  2FNP A;  2Y0S N;  4BQQ A;  1WZ2 A;  4JK1 X;  5GTH C;  5K7Z A;  2WY8 Q;  2DOF A;  2VXZ A;  3K1N A;  1AWC A;  3G73 A;  1W0U A;  1SVL A;  1AOY A;  3E97 A;  1YO5 C;  2E2H J;  2Y9Z A;  2CUJ A;  2ICW G;  4KUM A;  3FKJ A;  1Y6I A;  2NYX A;  2R3S A;  1VQN I;  2VJ5 A;  4QIW N;  4HV6 A;  3FBI B;  4ZTJ A;  3L7W A;  4BU2 A;  2FBK A;  4RAF A;  2LRE A;  2R7S A;  2W00 A;  2LFB A;  5B3S H;  5LEK A;  1ODD A;  3RJP A;  1IO2 A;  1UG2 A;  2DPD A;  3IWZ A;  5BS6 A;  4HST A;  3LFU A;  3IP4 B;  2B7E A;  1RR8 C;  4LLL A;  2JSP A;  3KYL A;  2VJJ A;  2WWY A;  2M7A A;  3NAR A;  5EEG A;  1FMV A;  1H88 C;  3X2Q H;  3RKY A;  2BV6 A;  1IN6 A;  1VTN C;  2KIF A;  5FRO A;  1BJZ A;  2ZJP F;  4BDY A;  4XLP F;  1LFB A;  4IHX A;  3I58 A;  4FHT A;  3WTV C;  2I10 A;  2V7F A;  1JHH A;  3A0B C;  1W5T A;  1X3U A;  3TDU C;  4YG2 F;  1DGW Y;  1VQ5 I;  2DDA A;  3EUA A;  3EYI A;  3WG9 A;  5F1J A;  3AG1 H;  2K86 A;  4ZC3 A;  3IRR A;  1OJL A;  3BDD A;  3ROU A;  3FK6 A;  2CV2 A;  2V26 A;  3ZGK A;  2DOA A;  3EQL F;  3I53 A;  2G9W A;  3CZ6 A;  5DDG A;  5J4Y A;  1CF7 A;  2E19 A;  3OYK A;  1XCB A;  1X2N A;  3GW2 A;  2L9V A;  2DMP A;  1FP2 A;  1ZGA A;  2O9L A;  2Z1D A;  4HLY A;  4CYC B;  3M3Y J;  3PNY A;  1GUU A;  2HI3 A;  3OOU A;  2ID6 A;  4LGW A;  2ZJR F;  4JYK A;  3M4O J;  2PMU A;  2LKX A;  2P5L C;  2H27 A;  3VSL A;  2BY2 A;  3CCE I;  3DBL B;  5CKT A;  5TIS C;  5ICF A;  3CES A;  1MBK A;  3I4P A;  1OCP A;  4Y17 A;  2VPL A;  1KU9 A;  3SZT A;  1XDU A;  2EV6 A;  3D0S A;  4C3J J;  2XC7 A;  3I0T A;  1JJ6 C;  3LA3 A;  1R58 A;  1UB9 A;  4QPO A;  2K4B A;  1FOW A;  5CJ9 A;  2NS0 A;  2RV8 A;  3BTJ A;  2O0Y A;  2XAF A;  3DU5 A;  5CVR A;  1ZR2 A;  3E6B A;  2DPU A;  3A2K A;  3IHU A;  1WVR A;  1NH3 A;  2XDV A;  2JA5 J;  2RAE A;  4PSW A;  3KIO A;  1JUM A;  3PUF A;  4HNU A;  1HOM A;  5CYV A;  3KEQ A;  2ZC2 A;  3FDY A;  3K70 C;  1RUO A;  4AVZ A;  2X85 A;  4IO9 F;  2QSG X;  3CLO A;  3TP0 A;  2HOE A;  1D1A A;  1IXC A;  5E3L A;  2XRL A;  1OYY A;  3GLX A;  4KIF A;  4B44 A;  1HW5 A;  1XMX A;  2G7U A;  3ZQ7 A;  1TWA J;  3ZMU A;  4M6X A;  5HVQ C;  2JA8 J;  3FXJ A;  1NG6 A;  3A01 A;  2L01 A;  3LSH A;  3AFH A;  5CQE A;  4OOI A;  1Y0U A;  3CCR I;  2ZNZ A;  4F7Z A;  1G3S A;  4XKC A;  1DGR M;  3MQ0 A;  2HPM A;  2KT0 A;  4EV0 A;  2ADU A;  4CUG A;  3T1B A;  3L2Q A;  3WTW C;  1X3Z B;  4A3K J;  2Y69 H;  5EF6 A;  3C2B A;  2ZFU A;  1X2M A;  3B73 A;  5ICE A;  1WI3 A;  2F6C A;  1SMY F;  3HJE A;  3MKW B;  3HRU A;  2K3P A;  2DO7 A;  2R7D A;  1JXS A;  1W7P D;  2QM3 A;  1WPK A;  1T0F C;  1Z7L A;  2EK5 A;  2I8D A;  5EZH A;  2BEO A;  5HNF A;  1MW7 A;  1TP4 A;  1FTT A;  2ETH A;  2M7B A;  2RVC A;  4MEX F;  4LIT A;  1J59 A;  4BDZ A;  4D9J A;  5CQG A;  2XF6 A;  1LE8 A;  4WWC A;  1HQC A;  1WJC A;  2RNG A;  4U87 A;  4CYD A;  3ECH A;  3DV8 A;  1IZ1 A;  2EH3 A;  2HWV A;  2NVQ J;  1KON A;  1HXD A;  1TNT A;  1TQI A;  1O7F A;  2QCO A;  1IAW A;  2RNJ A;  1U8B A;  3ULQ B;  2DCE A;  1MMD A;  4I0B A;  3DTI A;  4FX0 A;  2PX9 A;  3HGG A;  5LHH A;  5HLT A;  3EUK L;  4EJO A;  2OU2 A;  1O3Q A;  3MKL A;  1B9M A;  1WJD A;  5BPI A;  4LG0 A;  3V7C A;  3CMM A;  5IYD J;  5AIQ A;  2F5V A;  3W6K B;  3W6J B;  2IEK A;  2QSF X;  3GTJ J;  4ON0 A;  3AL0 C;  1BC7 C;  5EGO A;  2A07 F;  2LH9 A;  4CCJ A;  2PMZ N;  3S1N J;  2DAO A;  5FLV A;  5EDN A;  2L7K A;  4GYG A;  2F4M B;  1MBH A;  2E7X A;  2VI6 A;  1K6O A;  2HXI A;  2IW5 A;  1RET A;  1LQ1 A;  3VFZ A;  1J7K A;  3EET A;  2KIQ A;  4LJZ F;  3ZQH A;  4A3E J;  4LOC A;  4W97 A;  2VBY A;  4NC8 A;  2E7W A;  1TWH J;  3LAP A;  3QYF A;  4XL9 A;  5M5W J;  2QEX I;  1ZN2 A;  1A04 A;  4IF4 A;  4R79 A;  3OYB A;  3KYC B;  2NS8 A;  3CCU I;  3HOX J;  3GTG J;  2R7X A;  2WAD A;  3QPS A;  1LE8 B;  2IA1 A;  2IRF G;  1CQT A;  2XAQ A;  2H6C A;  2DT6 A;  3CP2 A;  2XSJ C;  3QPL A;  2HDW A;  5LLQ A;  2K02 A;  1IV6 A;  4EJV A;  5DUI A;  1WJB A;  4ZZD A;  1KYZ A;  4HQM A;  4A93 J;  1R5H A;  4L5J A;  3BP8 A;  3M8J A;  2J5P A;  4OAY A;  5LRR A;  3QOP A;  1PJR A;  3SZP A;  5J3L A;  2Y31 A;  3DPT A;  1I50 J;  3O3K A;  4CXF A;  1VQL I;  1UJ8 A;  2CUZ A;  3BLY A;  1IRZ A;  2DK5 A;  4A0Z A;  2XHK A;  5JR3 A;  1T95 A;  3M8E A;  1Z77 A;  4LB5 A;  1GVD A;  1XX5 A;  1ETX A;  2M0C A;  1TTY A;  3MEX A;  3CCM I;  3S2W A;  1JHF A;  2XUB A;  5E8I A;  5EEA A;  2MYS A;  5EGO B;  5JHF A;  3CO6 C;  2N8G A;  1Z1D A;  2M8E A;  3K1P A;  3QP6 A;  3KZY A;  4JX4 A;  4CDG A;  2GA1 A;  2ACJ A;  2DMQ A;  2ESN A;  1IUY A;  1LEB A;  1Y0N A;  2FJ1 A;  3M9A A;  1WWX A;  3DF8 A;  4CIC A;  5ICG A;  1SD5 A;  3PNV A;  3SJM A;  1RUN A;  2B0L A;  2F2E A;  5HLH A;  3C2G A;  1Z3Y A;  1H8A C;  4LMY A;  1BJA A;  1XSX A;  4N4O B;  2IS2 A;  5JHU A;  2XAS A;  3BZC A;  2EZH A;  5LFA A;  3OYA A;  1I5Z A;  4WCG A;  3OIQ A;  2E60 A;  4S04 A;  1R1V A;  3DTE A;  2HPI A;  5F6F A;  2IA2 A;  2L5Q A;  1B9N A;  4Q4Z F;  4E7Z A;  2BY0 A;  3SZG A;  1I27 A;  4UVB A;  4EM0 B;  1TC3 C;  3WGH A;  2ME6 A;  4U0W A;  4I76 A;  1AKH B;  3KCC A;  1QPI A;  1SVM A;  3M07 A;  3NEU A;  4GFB A;  2D45 A;  4IHY A;  3E6M A;  2CQN A;  4G7O F;  4MO7 A;  4AUX A;  2MD5 A;  5F1R A;  4NDL A;  3Q9V A;  3BG7 A;  1ON1 A;  2L02 A;  5FLX K;  3J7A Y;  5DD4 A;  3FZV A;  1W1W E;  2Z99 A;  5JVG F;  1LKX A;  2F5F A;  2NOG A;  3ZMV A;  3KEY A;  1BA5 A;  3FBN B;  5CPR B;  3PO2 J;  1JGS A;  1EF4 A;  1B72 A;  5J6X A;  2IGN A;  4XKB A;  3SYT A;  1X4O A;  2NAZ A;  5LGT A;  1RKW A;  3K4B A;  4NC7 A;  4IPA A;  2QYO A;  4ANJ A;  4A12 A;  3H0D A;  1R7J A;  4EQQ A;  3D5R C;  1D1C A;  1ZR4 A;  3F3X A;  3S2D J;  3WOD F;  2JMW A;  1EH6 A;  4U0Y A;  2P6S A;  2AQF A;  3J7Z I;  2JRM A;  3HOU J;  2JUG A;  2XVC A;  3QU6 A;  1YJ9 I;  3DLA A;  5LBQ A;  5M5Y J;  1Y1W J;  1HKT A;  1QVT A;  2KIM A;  3SFI A;  3VB2 A;  1MGT A;  4QSH A;  4XKV A;  3S32 A;  2V1U A;  1QGP A;  5FO5 A;  1NG7 A;  4MTE A;  2FXA A;  3DKY A;  4DBR A;  5E1Z B;  1FBQ A;  4BAY A;  4IEJ A;  1Z21 A;  5IPA A;  1ZAR A;  4XIC A;  3HPG A;  2JPB A;  2E2I J;  4PSX A;  2CH0 A;  2V9P A;  4B47 A;  4LIU A;  2Q1Z B;  3OYG A;  4L0Z B;  5E1W A;  3H5N A;  4IZZ A;  3TGN A;  3OYI A;  2WA0 A;  1FOK A;  3OYD A;  2GXB A;  1QPM A;  4ZYE A;  1ZRD A;  4FE4 A;  2KPM A;  4IRG A;  2AXT C;  3ZMT A;  4F52 A;  2JTV A;  4CCM A;  1ZYR F;  1X1B A;  5HOO A;  2WAQ N;  2VN2 A;  1DU0 A;  4XMY A;  3FX3 A;  3I5U A;  2XPW A;  1ZAO A;  2GA2 A;  5FFX A;  3U21 A;  5IT3 A;  4UUS A;  1GVJ A;  2DA3 A;  1JUP A;  3HOV J;  2E5N A;  1VQP I;  1FYK A;  2DT5 A;  3MZY A;  1T08 B;  4UUV A;  1X1A A;  2DFE A;  2QQA A;  1H9G A;  3H3Z A;  3PSF A;  3T5X A;  1YRN A;  4A6D A;  2V1N A;  1ON2 A;  5FRM A;  4AID A;  1EV7 A;  2LF7 A;  3GME A;  3FM5 A;  1Y8Q B;  1MH4 A;  1F9N A;  2DTR A;  3FXL A;  5K5Q A;  1S72 I;  4BE0 A;  3VYU B;  2ZJQ F;  4B4C A;  1HDP A;  1QRY A;  3S8P A;  4IOA F;  1OCR H;  1XMK A;  3VDX A;  3O8G A;  1TW2 A;  5KVR A;  3K6G A;  4C30 A;  4IJA A;  1UHM A;  2M30 A;  4FE7 A;  4A5M A;  4I01 A;  3SXY A;  3ZN1 A;  2KLO A;  3OYL A;  2KJC A;  2STT A;  2M4K A;  2XGE A;  4ABZ A;  4A3G J;  1ETY A;  2I5U A;  3GWZ A;  2LBF B;  4B1R A;  1J2X A;  4XKW A;  1E3H A;  4H0E A;  1YLF A;  2JJ7 A;  3G4S I;  5J47 A;  4BJ6 C;  2O8X A;  1YI2 I;  4G6Q A;  4E7I A;  3CC2 I;  3CTA A;  4UV9 A;  3KET A;  2ISZ A;  1FWZ A;  2Z2S B;  3R61 A;  5EG0 A;  3TMO A;  5DCM B;  2PBI A;  1SFK A;  4JX6 A;  1DP7 P;  5L3F A;  5BPD A;  3GO5 A;  3WGG A;  2HR3 A;  3ZCO A;  2G0E A;  1YIJ I;  3MCZ A;  2KZV A;  4ZTF A;  4YFX F;  1VQ7 I;  1ZRE A;  1S29 A;  2FMY A;  3FMR A;  4X1E A;  4GDF A;  3GTO J;  2DA2 A;  2IGM A;  2Y75 A;  3JR9 A;  1U3E M;  3OYC A;  4XNF A;  4BY7 J;  3RYP A;  3U9G A;  2HKX A;  4Y15 A;  4M74 A;  5DCF A;  3JCU C;  3WHB A;  2RQP A;  2RKH A;  2Y0M A;  4QLC U;  2VQH A;  5C4J J;  1FPQ A;  3BWG A;  5KK1 A;  4MQ9 F;  3K4N A;  3IH3 A;  3ZMS A;  4AIJ A;  2LMD A;  5LHG A;  4A3B J;  2BZT A;  4MGR A;  5K5O A;  1YJW I;  3N05 A;  3CJR B;  5FFZ A;  2LDU A;  4NBQ A;  5L3D A;  2EWN A;  4L5I A;  3BTI A;  1ZGJ A;  2H1K A;  3LFK A;  1EJ9 A;  3DU6 A;  2EFQ A;  2CW7 A;  2JQ7 A;  4L9T A;  2E35 A;  3O6B B;  5LEJ A;  1X1P A;  3V8K A;  2JWT A;  1Y8R B;  5BMZ A;  3IUO A;  4RGU A;  1FNN A;  2OAZ A;  2FBH A;  2L3D A;  1TL8 A;  3FMS A;  3SDB A;  4AYB N;  3CME I;  1IXR C;  1K61 A;  1D5V A;  5EG0 B;  3WGI A;  4HX4 A;  4RB1 A;  3Q3S A;  1PDN C;  4UNO A;  4BGD A;  1JUS A;  2V6E A;  1L3L A;  3F6V A;  3P9C A;  2E71 A;  5KAF C;  3HL2 A;  4ZYD A;  3VWB A;  4AIH A;  1R71 A;  1S9H A;  2KHM A;  3DWL E;  4L9J A;  2AHQ A;  1MMS A;  4M6V A;  5IP7 J;  1XS9 A;  1ITY A;  3H3U A;  3HB9 A;  4DIQ A;  1IN8 A;  3I71 A;  4C3I J;  2VBW A;  2GXG A;  3H0G J;  3GFI A;  3WTZ A;  3K1M A;  1HW1 A;  3JRG A;  4KIS A;  1LDK B;  4D5F A;  2L4A A;  5E8G A;  4A2U A;  3OYN A;  3AAF A;  3BTL A;  4EEF G;  2YU9 J;  5GAG J;  1W36 D;  2OTJ I;  1U0J A;  3S3O A;  3O2P E;  2ELK A;  3L2R A;  4XRM A;  5IY5 H;  4G9Y A;  1SC7 A;  3QYB A;  1KQ8 A;  3BR2 A;  2LNB A;  4M3B A;  3EDP A;  4RGS A;  2DFF A;  5CVI A;  1STZ A;  3HHG A;  4K2E A;  5F0F A;  2O8K A;  2VOP A;  2A6E F;  1NK3 P;  1V5G A;  3RQI A;  2NVT J;  1Y39 A;  4OIP F;  3R4K A;  4UHT A;  5J1R A;  4C9Y A;  4PUS A;  2Y48 A;  3A02 A;  4LLN A;  1YW9 A;  4Q5S F;  5DM6 F;  3GXO A;  2MC3 A;  2LRD A;  4L9V A;  3ELK A;  1C0W A;  4B09 A;  2GIV A;  1BOB A;  2VON A;  3L00 A;  1KQ9 A;  4CCO A;  4D7M A;  4M3G A;  3BY6 A;  3Q0U A;  2EV0 A;  2O5R A;  4II2 A;  1VF9 A;  1P6R A;  1IV8 A;  4A0X A;  2GBY A;  1G4D A;  2IA0 A;  4ESF A;  1XGO A;  1LVA A;  5M5X J;  3IRQ A;  4N9H A;  2YUS A;  2R7W A;  2XGX A;  4EMS A; 
#chains in the Genus database with same CATH homology
 1VQM I;  3I55 I;  1ACI A;  1VQ5 I;  1VQ9 I;  5DM7 F;  1VQ8 I;  2OTL I;  3CCM I;  5GAE J;  3CF5 F;  1YJW I;  3CCJ I;  1YIT I;  2NXN B;  4IOC F;  2JQ7 A;  2E35 A;  2E34 A;  1VQP I;  1QA6 A;  2H8W A;  3G71 I;  2ZJR F;  3CCE I;  3CME I;  1YHQ I;  3CJT B;  3DLL F;  5GAH J;  2E36 A;  3CCS I;  1VQK I;  3CC7 I;  1S72 I;  4V19 K;  4UY8 I;  2ZJQ F;  1FOX A;  1MMS A;  4IOA F;  1FOW A;  3CCQ I;  3PIO F;  3CC4 I;  2QA4 I;  5GAG J;  2OTJ I;  3CCL I;  5JVG F;  1HC8 A;  1VQ4 I;  2K3F A;  2QEX I;  5GAD J;  4IO9 F;  3G4S I;  1YI2 I;  3CC2 I;  3CCU I;  3CD6 I;  1VQO I;  3G6E I;  1VQN I;  1Y39 A;  3CMA I;  1FOY A;  5DM6 F;  3CCV I;  3J7Z I;  3PIP F;  1YJ9 I;  2FOW A;  3I56 I;  3CCR I;  1YIJ I;  1VQ7 I;  1VQ6 I;  1YJN I;  1VQL I;  3J7Y J;  2ZJP F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...