1VQKI

The structure of ccda-phe-cap-bio bound to the a site of the ribosomal subunit of haloarcula marismortui
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
total genus 15
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 1vqkI00
5JVGF 5GADJ 3CCUI 4UY8I 2ZJQF 3CCLI 2FOWA 3CC4I 1S72I 2E35A 2OTLI 1VQLI 3J7ZI 1VQ6I 3DLLF 3CC2I 3I55I 1FOXA 3CMEI 1VQ5I 4V19K 1VQ7I 1VQPI 3CCSI 3G4SI 2NXNB 1Y39A 3CCJI 3CC7I 2E34A 5GAGJ 1YI2I 1VQ4I 1YIJI 5DM7F 3CCRI 1HC8A 2ZJRF 1YJNI 3J7YJ 2H8WA 2ZJPF 3G71I 3CCQI 3PIPF 2K3FA 3CMAI 2OTJI 1YITI 2QEXI 1QA6A 3CD6I 3CJTB 5DM6F 1FOYA 3CCMI 1VQ9I 4IOAF 1FOWA 5GAHJ 3G6EI 1VQ8I 1VQOI 4IO9F 2JQ7A 1YHQI 2E36A 1ACIA 3PIOF 3CF5F 2QA4I 3CCEI 4IOCF 3I56I 3CCVI 1YJ9I 5GAEJ 1MMSA 1VQKI 1VQMI 1YJWI 1VQNI
chains in the Genus database with same CATH superfamily
4EJOA 2P7VB 4BHCA 3HOXJ 1SD4A 1JTXA 2R3SA 5C3EJ 3ZXSA 4RM3A 4CZCA 1V55H 1VTNC 3BR1A 5EEGA 2ELHA 2M4KA 3T8RA 1P4XA 2XGXA 3I59A 1LDJA 2QBYB 1ZG3A 5CLSA 1VI0A 1BOAA 4OIOF 4LOCA 3P9IA 4DGWB 4DYCA 1Q1HA 2E1MC 1XMAA 4M3DA 4IXAA 4HRIA 4I01A 5J8FA 1BA5A 1QZEA 3MVPA 2EINH 3VDXA 2O03A 5J6XA 4GCVA 4BEHB 2R7WA 2X51A 3HOSA 3Q9SA 1GVDA 5FLMJ 2A3SA 2P7CB 3ZN0A 3NRVA 2ZC2A 2E1CA 2DTRA 3E6DA 1WJEA 3ABTA 3OYFA 4BXXJ 4BXUA 4OIRF 2Z3YA 1YRNB 3OIQA 2FOKA 2E60A 3A0HC 2PMZN 2A5WA 2VC1A 2ID3A 4HEA2 4RLQA 4ASNA 1OCCH 3OOPA 4MIMA 4DNCA 3ZN1A 2LNBA 3FF5A 2CUZA 1U5TB 5IY5H 5F04A 2VKDA 3ML6A 2NAZA 3QWLA 3QPHA 3D1NI 3K69A 4OMYA 1C0WA 3LSPA 4L9JA 2FSWA 2KRCA 3GZNB 2GXAA 4OU0A 1BW6A 2BY2A 2M8EA 1JT0A 4XIDA 4PDKA 5D4SA 4E6KG 1YTYA 1DUXC 4RM2A 4IX7A 1FY7A 2DA1A 2CRGA 2ZB9A 3M4OJ 1K83J 1F4KA 2MABA 2DXIA 4A3JJ 2OUMA 1YG2A 5J40A 3PQKA 3ZQFA 1KQ0A 2V1UA 3MMYB 2KZVA 1WPKA 2EV6A 1UAAA 3P9KA 2H6CA 1VNDA 3GX4X 3GBGA 4KIGA 1IJWC 2QUFA 3REOA 2LF7A 5LEJA 1TWFJ 3TL4X 2KRFA 3PUFA 3I4PA 2O3FA 4WXCA 1TT0A 5J47A 1WJ5A 2EFPA 2LH9A 3W2WA 3HG9A 2NYXA 2B0LA 2PMHA 2ZJ2A 1E3HA 5GPAA 2MSYA 5L3EA 1YJ9I 2EJRA 3G2BA 2IGOA 2FEZA 1ZYRF 2CS3A 2VB6A 5DCMA 3JSOA 2LKSA 4G94A 2LRDA 2BHZA 3I64A 2FNPA 4KNYA 2XB0X 2AXLA 2K3PA 3I5UA 3KIOA 3MQ0A 3PNYA 1XGOA 4TV7A 3ULQB 3VYRB 4ZDOA 3OY9A 2NVUB 2F2EA 2HYGD 2IRFG 3K70D 5AIPA 1ZLKA 1WHUA 4NNJA 1S3JA 3F8FA 4LG3A 2A69F 2X85A 4J00A 2L9NA 1FLIA 2OD5A 3V8LA 3CC2I 3I55I 5GPCA 1NH3A 2KT0A 4L5IA 5HDKA 5E1WA 2XUBA 1R00A 3B73A 3L09A 4Y3OA 1HSJA 4A3LJ 1MNDA 2D1HA 2KRHA 2IBDA 5FRMA 2D2WA 2RVCA 2RREA 1Z1DA 1VQPI 1W0UA 3SDBA 4RBOA 1V54H 3LAPA 4P1WA 5DS9A 3CJQB 4X0GA 1UELB 2YU3A 2Z99A 2F4OB 1CF7A 2XHKA 3E6BA 1B9NA 3PL8A 4HYEA 5B66C 2JT1A 2PI0A 1PUEE 4PGGA 5FFXA 3D5LA 1MH4A 1XDSA 3QYFA 3EUHC 4RGXA 1X2NA 2H6BA 1BR1A 4AYBA 5KAFC 5L3CA 2ME0A 3JCUC 1R5ID 2KDOA 1GT0C 3ABKH 2Q1ZB 3TO6A 4XR6A 2BV6A 4MQ9F 5FGMA 1OMIA 4PGHA 3E97A 3A01B 4YEJA 2EFQA 5A2QK 4FHTA 4IEJA 1YJNI 4UUVA 4YRVA 2E2IJ 2DO7A 4E7LA 3KEOA 3VYSB 2LREA 4A0XA 2L54A 3AG4H 4UVBA 2K3FA 1V5GA 2ZFWA 2WB1N 2KPMA 4XLNF 2ZMEB 5HLTA 1YITI 4ZYAA 3TOAA 4BQAA 2LTPA 4B3AA 1GXPA 3MEXA 2OPTA 3F8CA 1P7IA 4B4CA 5EJCA 4IRHA 3CCMI 1FT9A 2DA2A 4I0BA 4DQ2A 1QPMA 1WVRA 4OMZA 4W1UA 2JSCA 2K7LA 2JPCA 2Y75A 3QOPA 1VQ8I 3L1PA 1R58A 2K02A 3O8GA 1TWHJ 4L5JA 4YG2F 3FDYA 4E7SA 4BKXA 5DEQA 4A3KJ 4J19A 1YX3A 3KP3A 3DBHB 3GTOJ 3L2WA 5D8LB 4WXHA 1XMKA 1G3TA 4HW0A 4EJVA 1ETOA 1Z05A 3QQAA 3WTXC 3HOYJ 1OFCX 5BPDA 1ZRFA 2BEOA 1K79A 1G8XA 4UY8I 2QCOA 1E3PA 1T56A 2FOWA 1WI3A 3FXQA 3HTUA 4XSXF 3MKWB 1FZPB 2IJLA 2DFEA 2QQBA 1PJRA 1W5TA 2XC7A 3DKXA 1IF1A 1MNMC 1VQLI 3HTSB 2FU4A 4WWCA 3TEDA 2JPBA 5IP6A 2R5YA 1MBFA 1U8BA 1D1AA 2V6CA 3WGIA 3S3NA 2G9WA 1XD7A 4C2MJ 2FMYA 2M0CA 4L9TA 1VQ7I 5ICGA 1P92A 2DU9A 1MSEC 4Y52J 2VN2A 5ERIA 2OV7A 3D5SC 2KIQA 2HZTA 5FKNA 2JRMA 1ZRCA 1ZG5A 1W7PA 1IN7A 1Y6IA 2MG4A 4L18B 2JA2A 1TNTA 1LNWA 4BAYA 2DMNA 3FMSA 1WJFA 3EUHA 1YIJI 1VQ4I 1EH7A 4XLEA 1I27A 4C30A 4LD5A 1S8NA 3LL7A 4I02A 3BOQA 1LQ1A 4WF2A 3GTQJ 2PJRB 5TJJA 1PDNC 2DMUA 4CCMA 3S93A 3M3YJ 3RPUA 1WWXA 4DZPA 1M1EB 1OR7C 2HVQA 2EV5A 3OS1A 2DQRA 3O2PE 2P4WA 5IPAA 1QRYA 5GP9A 2QEXI 3LA3A 3IAS2 1JHFA 1JGGA 2JUCA 2QZ8A 4IQ4A 2NNYA 5JHUA 1U5TC 4LIUA 1P4WA 1AHDP 2R5ZA 4FQGA 3CQZJ 3H9JA 2JK3A 2JSPA 1A6IA 2ZNZA 5LD2C 3KEQA 2W84A 1WH7A 3ECOA 4BL0B 1OYIA 4LMYA 5ICCA 2RNJA 5ILSA 1OYWA 4WX9A 3DTEA 1S9HA 3DU6A 4HDUA 3FZVA 1A35A 3H35A 4YFXF 1YHQI 3FX3A 2NVYJ 1X4OA 3RQIA 2CGPA 3P9CA 2EFOA 3M1EA 2D1VA 5E8IA 2IS1A 2ZO4A 3E5XA 3BZ6A 4QTRA 3KP6A 1UCRA 1ZQ3P 3CMYA 3SEQA 1T6SA 3F8MA 1WZ2A 3VYTB 3A1YA 4AIJA 3C3WA 2IGKA 3K0LA 2M2EA 1W36D 4XLAA 1JT6A 4HX4A 2W25A 1V4RA 3E0JB 1GDTA 3PM1A 2F5FA 3O3KA 2V9KA 2VQGA 4MQVA 4GDFA 4I7HA 4I76A 4UXNA 4C3HJ 3CESA 3O6BB 5HLGA 4NQWA 2OTLI 1ETVA 3G1OA 1ZR2A 2KP6A 4EM2A 5D6FA 4F3QA 4IHWA 4A3MJ 3HPGA 4P9FA 3I4MJ 2LLKA 3I58A 4BQOA 4ENJA 2HPMA 1X3WB 5ED4A 3MD2A 2N8GA 4PFPA 1JUPA 5LHHA 4UNOA 1UHMA 3RYRA 1BC7C 2RKHA 2M87A 3HRTA 1DPUA 1G3YA 3H3VK 3T0YA 4JX5A 2ID6A 3Q0WA 4M3FA 1B59A 4Y4RA 1KZHA 2QBYA 1ITYA 4M74A 1R4MB 2HZDA 4A6DA 3L2VA 4Z6YA 5J4VA 1I1SA 1CF7B 2NS8A 3QPSA 5FD5A 2CYYA 2VE8A 3V7SA 3OSFA 1LVAA 1J09A 3GEZA 3EQLF 3KFWX 3S16J 1R49A 4O6JA 4BEHA 2O5RA 4L5EA 1MW7A 3G73A 2NOGA 3AL0B 4IKFA 2O7OA 3BG9A 3HKZN 5HVQC 5JHFA 2XSJC 3TGNA 3R0JA 1JE8A 3CJRB 3ZCOA 1Y0UA 3DKYA 3H0GJ 3ABMH 3NAUA 4Y13A 2RN7A 3I3LA 3TP0A 4DBQA 3FBNB 4U88A 3M9AA 5DDGA 1OR7A 3Q5FA 5IP9J 3HL2A 2HYFA 5CVRA 2IEKA 1F5TA 1WI9A 1YE9A 4I99C 4MNUA 2XAQA 4UVAA 3R61A 1U5TA 1K61A 1WSUA 2XVCA 2VLAA 4HZFA 2QWWA 4EQQA 1JKPC 3ZQIA 1XG1A 3PO3J 4O3MA 4XN3A 2CH0A 1GUUA 2BOLA 3AFHA 4HAMA 3ZGKA 3J7AY 2MH2A 2L3DA 5HLHA 1G3WA 3WTYC 1XS9A 4U0WA 4HA8A 3L2CA 3N97A 3QODA 3H9GA 4F7ZA 3H3ZA 1TWGJ 5FD6A 5FRNA 1UHSA 2F5EA 1WJBA 4PJLA 2DFFA 3BG7A 4L9VA 4LG0B 2EZIA 2VJIA 3IH2A 1VQMI 4M71A 2P5VA 2ADUA 4KUMA 1IC8A 2XF7A 2DJNA 4HV6A 1FOKA 1OKRA 3BTIA 3K4JA 4DJAA 3JRDA 4RAZA 1OPCA 3KP5A 2DYRH 2XF5A 2PLYA 5A2QZ 2DYSH 5D5VB 4CH7A 4AYBN 1FMVA 3OMYA 2C6YA 2WC2A 4D7MA 3MZHA 1VQ6I 2L02A 4YELA 3BG6A 3BTLA 1W1WE 2WB1A 1FBQA 4UVCA 1PUFB 3OIOA 1MSFC 2LC2A 2P8TA 1W0TA 3CMEI 4U7DA 4KIBA 1XCVA 2P6TA 1GLNA 3ZQCA 4NC8A 4BBRJ 4L9NA 3BJAA 2EQRA 2F4MB 2KIFA 4B44A 2JWTA 3DPTA 2L9VA 2CUEA 5JLWA 5J1UA 3D0SA 3I53A 1K6YA 2K9SA 4AVPA 2COMA 3KP7A 1K4TA 1WFXA 1YLFA 3JRGA 1JI8A 2LVSA 3L00A 1P6RA 1ENHA 1U0JA 3BC8A 1D5YA 3MZ8A 2PJPA 3B02A 5BPIA 3HJEA 3FISA 3K70C 2R7XA 2KDZA 3J81K 1V5FA 3WHBA 4BHBA 1TLHB 1KU3A 4IPAA 3FMQA 4MFDA 1FJLA 9ANTA 2HDDA 3OSGA 2VONA 3LOCA 5LLQA 4O5VA 3CO6C 3E6CC 1DDNA 4Y17A 5CVUA 5L3BA 1OCPA 2Y31A 3DEUA 1Z91A 3IHUA 2A6EF 1GHCA 3MKZA 1UG0A 2Y9YA 2GBYA 2V1DA 4XM3A 4RA2A 5B1AH 3IKTA 1LVKA 3OYGA 3A01A 1TQMA 2HR3A 3GYHX 1JJ8C 3HHHA 1H0MA 2E19A 3I9V2 2VPRA 1A31A 1Z6RA 3BROA 1F1ZA 5H6RA 2V6EA 2DPDA 5FROA 4I2OA 3BPVA 4BH9A 1OLTA 2HDCA 1HBXG 2BBYA 2ZMEA 4DOZA 3KPHA 1IW7F 1UG2A 3DKWA 4D0PA 1VQOI 2JQ7A 3G1MA 4EJUA 2AQEA 4BY7J 2GA1A 4QWQA 3RI4A 5KNLA 1R1VA 4IRIA 4G12A 4RGSA 4IOCF 1LKXA 3LQRA 4JK1X 4A93J 5GAEJ 1BR2A 1X2MA 5IOYA 2IXSA 3CCYA 4GYGA 2TRTA 2PMUA 1HCRA 2O0YA 5B1BH 5HOOA 3LSRA 2AQFA 1O3QA 2IVMA 4ZYGA 3JR9A 5DCFA 4BE0A 1FX7A 4XRSG 2V1XA 3WTSC 4AWXB 2ZXWH 2HOEA 4M6VA 2PG4A 5M5XJ 3EPZA 3H36A 4GRIA 3HXLA 4G6TB 2DK5A 4FETA 2XRLA 2AS5F 5ICFA 4C3JJ 1LDKB 2R7QA 2ZKZA 4ZH4F 5D5UB 4C3IJ 4N0BA 2MD0A 5HDGA 3S2WA 3R60A 1ON2A 2IPQX 4CXFA 4NHJA 4EATA 1ZELA 3LFUA 2KIUA 3SZPA 4Q5SF 3TBIA 3OR2C 3OS0A 3ZQLA 4A2UA 3IRQA 1QBJA 3U21A 2VBYA 5C4JJ 2M34A 2XAGA 4IZZA 3KETA 2E7WA 2VXDA 2JTVA 1USSA 1LFPA 4XN0A 3WTWC 3ZQ7A 1VZ0A 4I0AA 4LLGF 4M9XA 2E1OA 3CCJI 2HTJA 1FNNA 2QF7A 1KQ9A 3GF2A 5GAGJ 1XSXA 2VBZA 2CQ7A 2YX4A 3GZ6A 1IXRC 1J5YA 1IN8A 3DP7A 2R93J 4RGRA 1MMAA 2QKLB 2X6WA 2X6OA 3TP3A 2ZJRF 1FYLA 3OWTA 4DBRA 4HOBA 3TO9A 3PNVA 3OYAA 2ESNA 3DV8A 4A6EA 1QHGA 1O4XA 4ZZLA 4UV9A 4RB0A 2X9DA 2Y0MA 3TO7A 1XPXA 1E3OC 1N78A 4BHPA 4PSXA 1HDPA 4A3GJ 1J75A 2MD5A 3JRFA 3BTJA 3AL0C 2BVLA 4XKWA 3S1QJ 2XDVA 2PJRA 2HXOA 1BM9A 1TQIA 3K4MA 3BJ6A 4DYRA 1D1CA 5KHDA 3C18A 2VKEA 4MLOA 2AO9A 2Y0SN 1NTCA 2Y48A 2DCEA 3IL2A 2K86A 4UUSB 2UUZA 1QGPA 2Q2EB 2IS4A 2HTSA 2RQQA 1B72A 3JTHA 4D9JA 2EILH 1IV8A 2KISA 3MN2A 5LBQA 1Y8RB 2H1LA 3QP5A 3R0AA 2WTEA 2DA6A 2E1NA 2LDUA 1XC5A 1T98A 2OQGA 2KQRA 1ETXA 2M9HA 4IHXA 3S14J 3FM5A 1ZGWA 4H0EA 4RAYA 4U7BA 2HQRA 2IS6A 3BZCA 5E3OA 4W97A 2L01A 3HKZA 3BLYA 4YIRX 2HYJA 3LFKA 1R5GA 2DN0A 1FOXA 3FM3A 4KIFA 3Q0VA 4IL6C 3A03A 3COAC 1O7FA 1XX5A 3H0DA 3WE3A 1OCOH 4HG2A 3M07A 1MMDA 3ZOBA 3NWSA 1Z21A 1Z3YA 1Z7LA 3ERMA 2BXYA 3M8FA 2X1DA 5KVRA 5JFRA 5FLXK 1CQTA 2F5DA 3HSFA 2LOOA 4HF1A 3ASOH 5LHIA 1YW7A 1XSVA 2WY7Q 2Q8KA 2ZCWA 3N4MA 1W36C 2XGDA 3CTAA 3RIRA 5ICEA 5J4YA 3CJNA 2VT2A 1PVEA 1MJBA 5K7FA 5D5WB 1MDMB 4KDPA 3BQYA 3DU5A 2FMLA 3CCRI 1FBSA 3QYBA 1XTAA 1TBXA 2L7FP 4PZJA 4AUXA 4IHYA 4LJZF 1MGTA 1DPRA 5H20A 1TQPA 1OCTC 4N9HA 1EH6A 3KYDB 2H8WA 2RAEA 1SFKA 1POGA 1IRXA 2XF6A 3EDPA 4U0VA 2Z1DA 2IGMA 3OYLA 2HDWA 4M3GA 5EEAA 3F6VA 4FTHA 4Q48A 1B4AA 1IN5A 4OAYA 5KCMA 5E18F 1BI2A 2HI3A 2FUG2 2XIGA 1KONA 3MCZA 2FRHA 1S6LA 3MFKA 5IT9K 1JJ6C 4NUBA 1ORKA 1D1BA 1DQUA 2RV8A 2CV2A 4L0YB 3F8BA 1FTZA 4U87A 2NS7A 3SEZA 5GAHJ 2F4IA 2K9MA 3KLOA 1EKEA 2X1EA 3WTVC 4F52A 1R5HA 2H09A 5E3MA 3LSHA 4HSTA 3E6MA 1IO2A 1R9TJ 2K5CA 4HF0A 1KU2A 2E36A 3OYMA 1DP7P 1TWCJ 2QYOA 2LK2A 2FQ3A 1FYMA 1BR4A 1P2FA 1ETQA 4G8XA 1LFUP 4XLPF 2VJ4A 1N77A 1LEAA 3U9GA 3F21A 2DLLA 2FJ1A 3QU3A 1SEUA 2F6CA 4PJNA 4BQNA 4ESFA 3J81Z 2CU7A 2CSOA 2EPFA 2HEOA 3CDLA 5E8GA 2GWRA 2EFWA 1Z6TA 4ANJA 2FBIA 1WJAA 1HXDA 4LG0A 5IYCJ 2LMDA 2WWYA 4BS9A 2MGQA 4NBQA 2HKOA 1HF0A 5FJ8J 1Z3XA 3OYBA 1A36A 5BS6A 4I09A 4AD9A 4RLFA 3I0TA 1XMXA 1YS7A 1SAUA 3BR6A 4C2TA 5D8KB 4BNCA 3EUKL 2LBFB 4FASD 2G7UA 5DD4A 4NC7A 1LJ9A 1I5ZA 2HPIA 1QPIA 2ETHA 3VWBA 5K7HA 1XN7A 3FBIB 3WG9A 4LLLA 2PN6A 4GXOA 1ZARA 2DFHA 1PUFA 3S17J 4IJAA 5F6FA 4ZDLA 3AKZA 1P4AA 4NC6A 4PJMA 3CDIA 2MLGA 3GTKJ 3GTPJ 3DLAA 3ROUA 1ZR4A 1WRJA 1SMYF 4XL9A 5EDNA 2R7TA 1GVJA 4XKVA 2M8GX 1MD0A 4MHGA 2IT0A 2VQLA 3HOZJ 1HA8A 4ZYHA 3FHNA 4CSWA 5LGNA 1ETKA 2ZJPF 5TRDA 2HOTA 3FKIJ 3OL4A 5CQEA 4CCNA 3WU1B 4R79A 1Q1VA 4K2EA 3GFLA 2DMTA 2KZGA 4BDZA 3WTTC 2V26A 1AKHB 3CUOA 1R4NB 4KISA 2R92J 1YYVA 2OTJI 1ZHFA 3HSRA 2BW3B 1YX5A 5FFZA 3CUQB 4S04A 1NG7A 4DIQA 1JKRC 3OOUA 5LGTA 3H5NA 3DQVC 1H9GA 5M5YJ 1IZ1A 3HRMA 2ICWG 1R22A 2VIXA 3SZTA 2LG4A 4EGYA 4BXFA 1DP3A 4UB8C 2W24A 2JA7J 2ZSHB 2NS0A 3SZGA 1ZG1A 1OQYA 1BI0A 2P5KA 5F08A 2XB5A 3NEUA 1U78A 2QSHX 2J5PA 3JRBA 2LKXA 5FLVA 5CQGA 3SHFA 4MTDA 3OL3A 4CCKA 3OV8A 2MW8A 4X1EA 3MKLA 4XBFA 3BQZA 2AXTC 3B6AA 5FB2A 1B72B 2QVOA 2DTZA 1O3SA 4ZYEA 4QIWN 4YIIA 2JN6A 3LNQA 1H9TA 2LF8A 1TTYA 1MH3A 1NHAA 3A2KA 5HNFA 3M8JA 3PSIA 3K1PA 2E5NA 4Y15A 2EIMH 4HQMA 5B5EC 4BE2A 2I5UA 3BP8A 4EJWA 3VOEA 1CGPA 2M45A 1IAWA 4EM0B 4OIPF 1SFXA 3F72A 3TDUC 4BJ5C 1BL0A 2HU9A 3QU6A 2Y30A 1YQAA 1RI7A 2R7FA 3SDGA 2MC3A 2QLZA 4CHUA 4RAGA 2YX7A 4AU7A 1HKQA 1B9MA 2IAIA 3UR3C 5BQTA 4V2GA 3TQNA 4II2A 2VJ5A 4G6DA 4IF4A 3RYPA 5EG0B 3ZQGA 3G3ZA 2WA0A 3OYCA 3OYJA 5J3LA 3BCBA 2Y0SA 4UUTA 1YI2I 1AOYA 2FD5A 3V42A 3BR5A 2JA5J 1MMGA 2EB7A 3IAM2 4M9SA 2VKVA 3VYUB 2HKXA 1BJZA 2OJED 2X1CA 3U2RA 4PK4A 4E7JA 1ZK8A 5IOZA 2XGCA 2MH9A 2EA4A 2H1KA 2RQPA 4HNVA 3ZQQA 1JHHA 2STTA 3E3VA 4BUPA 1HQCA 5HS7A 3ASNH 1G59A 1ZREA 5DUIA 3WU2C 2OC6A 2ACJA 1OCRH 2WAEA 3ERED 4CYDA 5B3SH 1ETWA 3HBLA 3SFIA 3BG3A 3EETA 2YS9A 4EGZA 2EK5A 1HW1A 3F8NA 1H88C 3JRCA 3ZR8X 3ZPLA 4KJZA 3LQQA 3V4GA 1IDZA 3GW2A 5E3LA 1LUJB 2R7UA 1X1AA 3CF2A 2V79A 2HS5A 3K4NA 4A3FJ 3ONQA 1G4DA 2E1MB 2CUFA 2QSGX 4FE4A 2D45A 1K4SA 1WCMJ 3ZMVA 3VSLA 1Z67A 2CG4A 2XV4S 4DZJA 2WADA 1MKMA 3S1MJ 5FLXZ 5E17F 2Z2SB 1QU3A 2QA4I 2IA2A 2W57A 3QOEA 3RKXA 3I56I 1TW3A 2X6YA 5F64A 1H89C 1H8AC 2EA2A 1HKTA 3FXKA 3A02A 3FWEA 1USTA 4EJTA 1JUSA 3PUBA 4BE1A 5GTIC 3OYNA 2ISYA 5GADJ 3RTRA 5JVGF 2ZMEC 2HGCA 1O57A 2XPVA 3RJPA 5LFAA 5D6EA 4UUSA 2VOOA 2Q2EA 4A0ZA 4HNTA 3L2RA 4AM3A 5H6QA 1ETYA 1UFMA 3W6JB 1DGRM 2DQLA 5K5RA 3LAJA 2NRAC 3DWLE 4ZJZA 4BJ6C 3J7ZI 1E0EA 5L3DA 2R7OA 2ZFUA 2OQRA 2XROA 5DV5A 2DODA 3WE2A 1ZTRA 2KHMA 1ZGAA 3DPUA 3QPLA 3GTMJ 3MKYB 2O8XA 2PQ8A 3BR0A 4IHSA 2OA4A 1LE8B 3TMOA 1T08B 3FXOA 3G4SI 1TZLA 2TDXA 3I71A 1I3AA 4XKBA 2VXZA 3JREA 4B09A 1KYWA 4CCOA 1S7AA 3CC7I 2JVHA 3AG1H 2HFHA 3FK6A 2E71A 3EYYA 3NARA 4LGWA 1FEXA 2OZ6A 1FSEA 3MAJA 1OISA 3BG5A 4P9UA 4HLYA 1R1TA 3SXYA 4M73A 1YW9A 2JA6J 3GCMA 1U9NA 5D4RA 4ESBA 4RAFA 1IN6A 2FBKA 2UXXA 2W4SA 1ZRDA 4XONA 3J7YJ 3H1CA 2DPUA 2D5VA 5HS8A 2A6HF 1RC9A 1O7LA 1XB4A 2EV0A 3CO7C 1FP2A 2X48A 4E70A 1MDMA 1RPWA 2I8DA 4KMUX 4PUSA 3VPRA 3KP2A 2LFBA 1BC8C 1I39A 4LLNA 3FXUA 2L4MA 2XSDC 1IXCA 3BR3A 1NG6A 4HBLA 3LSKA 1FOYA 1TWAJ 4ZTFA 2ISZA 1VF9A 4IHTA 1FOWA 3H5RA 4ZC3A 2CW8A 3LMMA 5E20A 5EZHA 4BBSJ 5F1RA 1Y0NA 1E2XA 3CUQC 2G0EA 4E7ZA 1TW2A 2A5YB 1OJLA 1RNLA 3I54A 4IRGA 4LK0F 5HODA 1ONVA 1I6XA 5M3FJ 1HKSA 4CO8A 4YIFA 1T8IA 4IHVA 4PSWA 3PIOF 1J7KA 1BJAA 1KYZA 1G3SA 2HOAA 3Q3SA 1VFCA 2EH3A 2GQQA 2XGEA 4JQFA 2RDPA 4G7HF 4B48A 3H9QA 1YJWI 1VQNI 1D0ZA 2CQKA 5CVVA 2ZBKA 4RB2C 1X4PA 2KL4A 3PFIA 1JUMA 1IRZA 2L7KA 3CCUI 1J9IA 2CWEA 2R7SA 4B1RA 2IA0A 3IH4A 2F5VA 4F93B 3V8JA 2MA3A 3FMRA 2L2OA 1MBEA 3PSFA 1HLVA 1BI1A 4S05A 2BY3A 3QP6A 3J80K 2BGCA 3BY6A 3ABLH 3DEWA 4ZTJA 1YIOA 3HGGA 5DUKA 1D8JA 3BPXA 1R36A 3K1NA 2Q0OA 4QSHA 5LRSA 2K85A 4N4NB 1IRGA 2HXIA 2JRTA 2BXZA 3ZMSA 1PP7U 2LKPA 1ZLJA 5F0CA 1GV2A 2QKMB 2VUMJ 2OF7A 5LRRA 4CZZA 1KGSA 1T39A 4A0YA 1BW5A 3S1NJ 2HVSA 5FO5A 1SD6A 1T33A 2YPRA 5IYBJ 3BDDA 3QYEA 3HEFA 2VBXA 2ECCA 4FISA 2UXNA 3C7JA 2GXBA 5IYDJ 5E79C 2PEXA 1ODDA 3K2ZA 2LBFA 3OR1C 3E7LA 3DPLC 3GWZA 2DA5A 3V8KA 2ZXIA 2YU9J 1SMTA 2CW7A 3IWFA 1SD5A 1V3FA 4UB6C 3F6OA 1F9NA 4FT8A 2BY1A 3RCOA 2CO5A 3JRAA 4D5FA 2K9NA 1HDDC 4XKCA 4HLXA 1W5SA 2R4GA 2A61A 4WK8F 3G1LA 1KU9A 4E7KA 1PYVA 1ZAOA 3CD6I 3TDZC 1AU7A 2ZXHA 2IA1A 2P0WA 2W1OA 1MBKA 4IVNA 1XCBA 1FWZA 2RC4A 3AG3H 1QHHD 3KZYA 4HNUA 1E17A 4FX0A 3G6EI 1AKHA 4QLCU 1OYYA 4RDUA 1X58A 2OBPA 1SFUA 2BW3A 1Y56A 3CUQA 4CA0A 2BVMA 2DK8A 2BY0A 3KP4A 5CVIA 3A4CA 2CQNA 3L7WA 4LIVA 3S32A 2A05A 4H4KC 3CCVI 1SVOA 4KMFA 4KN7X 4BYYA 2UWMA 1VQKI 2ELKA 4M6YA 3RKYA 3KZIC 1Z7UA 2KJBA 4RMNA 1SC7A 1NK2P 1MJAA 2VJJA 1REPC 5KK1A 3BWGA 4M3BA 4XLFA 3PO2J 1X3ZB 2L9SA 3RZOJ 1SANA 4RGUA 3FKJA 4NDLA 5E1ZB 2ZJQF 1U3EM 1R71A 2I10A 3CC4I 1S72I 2Z9OA 1BI3A 4HPQA 2HWVA 2LP0A 4R1HA 2WV0A 4HX7A 4OINF 3BZKA 2MLKA 1XSDA 1YW8A 4P5OA 1IUFA 1BN5A 2M30A 1Y1VJ 4F92B 3S2HJ 3K2AA 3M1CA 2VQHA 2KJCA 4B43A 5L3GA 3JRIA 4FX4A 1FSHA 2DT7B 1S7EA 3F23A 3LWFA 2VT3A 4A3DJ 1GV5A 4GYIA 4A5MA 4G7OF 3P7NA 1ON1A 1R23A 4ENMA 2E34A 3W2AA 3PNTA 2JUGA 2Y69H 3TW7A 2JJ7A 1J2XA 2E7XA 2OCCH 2B63J 4G7ZF 2CFOA 2CW0F 3ZQHA 3HIFA 1HC8A 1A5JA 1WQ2A 1J59A 1U6GA 5JVTA 3PJRA 1T95A 1UHWA 2IW5A 1RUNA 4AC0A 2XKOA 3S15J 4A3BJ 3RZDJ 1X1PA 1S7OA 3OYIA 2EIJH 2VODA 3RDIA 1S5LC 2XPWA 2WBMA 5EG0A 1PP8F 3WTZA 2EIKH 2NOJB 5KAIC 2HQNA 3IP4B 3C2GA 1LFBA 3ISPA 4MFEA 5F0FA 3RKWA 4XNFA 1HW5A 3K4LA 3S3OA 4P55A 2OCEA 2O8KA 1ZGJA 2L7MP 3DTIA 3F9KA 3HZJA 2XAFA 4ITVA 3GTJJ 3DF8A 4KT5C 4M3EA 2ZNYA 2ELJA 3VFZA 2XAJA 1LPQA 1Z0XA 1X19A 3JAMK 1B1BA 3LSTA 3OYHA 1G2HA 1FYKA 5K1YA 2DAOA 2Z16A 4QPOA 4BU2A 4MTEA 4XLHA 2M4GA 3KE2A 1RZ4A 5J1RA 3OS2A 1EV7A 3K6GA 4Y33A 3S2DJ 4U0YA 2CUJA 1S29A 2H27A 3FHZA 3K10A 2LR8A 3S8PA 4XOTA 1MMSA 4E7IA 2A07F 3C1DA 3L2QA 2QM3A 1A6QA 1LB2A 1K78B 2COBA 3ECHA 1IUYA 3AG2H 3HOVJ 4MO7A 2W82A 4XRFA 2VKHA 1RESA 2V9VA 2GLOA 3ZP5A 1WKMA 3ESWB 3C2BA 1L3LA 3GFMA 4D7NA 2E35A 3FXRA 3HC7A 4PCQA 5DYMA 4UHTA 5J1YA 1WJCA 1RKTA 4XLCA 2GIVA 1SVMA 3OYDA 3GLLA 5HS9A 3WG7H 4ESJA 2LD5A 3V7RA 4XRMA 3LA2A 5BMZA 1EF4A 4XORA 4YFNF 5TISC 5LEKA 3V7CA 4LITA 2XRNA 2VOPA 3KEYA 1UZCA 5HNHA 1G6NA 2W48A 1B6AA 3HUGA 1K6OA 3WHCA 2OAZA 3T1BA 1ERDA 4CYCB 1WGXA 4E7HA 1FPQA 1T0FC 2FBHA 3HPHA 3KLNA 2VC0A 4Z2YA 5K5QA 4II3A 1QQIA 2K27A 4G6QA 4OAZA 3RQ4A 4L0ZB 1D0YA 5CKTA 3N05A 1LE8A 2Y2ZA 1MBJA 3VSKA 4B47A 5CJ9A 2XASA 3KYLA 3CDHA 2P6SA 4Q47A 1KU7A 3W3CA 3B6CA 4F91B 3WGGA 1FP1D 3WU0A 3NQOA 3G71I 4PJJA 1W5CC 3PIPF 3JTGA 1HSTA 4WCGA 1JGSA 4EMSA 3E5UA 2ECBA 2E5ZA 2H8RA 3CMAI 5JLXA 1RETA 4G9YA 4KFCA 3KCCA 2P5LC 1BIBA 3LSIA 2K9LA 4B3XA 1HW2A 1QZZA 2NNNA 5EF6A 5EGOB 3VODA 1Z77A 1QVTA 3F3XA 4C9YA 1SFOJ 4JBAA 1HOMA 2DMPA 2YUSA 2FA5A 1R6RA 3J80Z 1VQ9I 2EZKA 3W6KB 3GZ5A 1SFEA 4IQJA 3U1KA 1B8IB 2F48A 3WGHA 4EVIA 4ZYDA 4LB6B 3LSMA 4AVZA 5ILVA 3CCEI 2MBFA 5E1XA 3DFGA 3IRRA 2O61A 5K7ZA 1IRFA 1V5EA 3F22A 4BY1J 3RKQA 1WH5A 2RGVA 2XAHA 2PFBA 3C2HA 3I59B 2Z5UA 2CQXA 2W7NA 2EZLA 3U1DA 2DOAA 2FE3A 5EEHA 5HLIA 5CVJA 2HVRA 2K9QA 4P96A 3CCLI 4ZZDA 2IGNA 2L9RA 4JX6A 2VASA 4GO1A 1JXSA 4WXDA 2EZHA 2O6GE 4I6ZA 3KYCB 3DTKA 4A69C 4EV0A 3DLLF 3GTLJ 1YO5C 1UB9A 5BNGA 1MBHA 3CZ6A 5JI6A 1F36A 3JW4A 4KYWA 2GOMA 2WAQN 4UV8A 5K5OA 2NVQJ 3L2UA 1FBUA 2DW4A 4LFUA 2M5WA 2BZTA 2GA2A 2HNHA 5GTHC 1I6HJ 1ZKGA 4KICA 4MEYF 4A12A 2GOXB 2R7RA 1BBYA 5F27A 2YSRA 3GLXA 1SAXA 1Y39A 3MZYA 5F0HA 4PFOA 1GXQA 1TP4A 2MFZA 3LA7A 1IN4A 1T0FA 3OIPA 4FE7A 3FIWA 3FXJA 3CP2A 4CICA 1I1GA 1YFHA 3H92A 2YR2A 1Y1WJ 3ZRGA 1SVLA 2DJIA 2W00A 4OIQF 3L9FA 4BGDA 3QPTA 1KA8A 2M0MA 1YS6A 2EBIA 4ON0A 3FXMA 2Y9ZA 4HF2A 3CCQI 4BDYA 2K4BA 2DT5A 2ZSIB 3K9TA 4D1QA 1SD7A 2IP2A 2ZXJA 4CCLA 2DDBA 3SQNA 2MC4A 1N75A 2FX0A 3HHGA 1LEBA 5L3FA 3VB2A 2DOEA 1YOVB 3CLOA 5FKLA 3HOWJ 3WTUC 4J01A 2CFXA 2CV0A 3GVAA 1RIOH 2M1BA 1NK3P 1IDYA 2QQ8A 2PMZA 2DDAA 1FIPA 5DCMB 3HGYA 3HM5A 4Q4ZF 2DA3A 3BR2A 3HYIA 4B8XA 3OYKA 1EJ9A 1XDUA 4LB5A 2XPUA 1FTTA 2LSOA 5CYVA 1OCZH 2K40A 2QQAA 1ZN2A 3PFYA 5LGUA 5FKOA 4KA4A 4R8HA 4C2UA 2UZKA 4AIKA 2JMWA 4ENNA 3IUOA 1X3UA 1X1DA 3W6VA 1T38A 5EZGA 3H3UA 2AHQA 2BE5F 1K7AA 4PJ0C 1W7PD 4QPQA 4YFKF 5DD8A 1I3QJ 3GFJA 4CDGA 4OOIA 4ABZA 2NVTJ 4NB5A 3I4NJ 1QO0D 2L4AA 5C4XJ 3CLQA 4XK4A 3ABUA 3FXLA 4I98B 1IG7A 5M3MJ 3H5AA 3M8EA 3ZMZA 2P81A 2KKOA 3IH3A 3KX2A 2DT6A 3FK7A 2FNAA 2L0KA 2RNGA 2WAFA 1RUOA 4JYKA 3CMMA 1LDDA 3RPUD 1AWCA 4XOPA 5J8CA 4E4HA 3BJOA 3CP8A 2EWNA 1U9OA 1IGNA 2G7HA 2PBIA 4HQEA 3T5XA 4JX4A 3RPQA 1JKQC 4MEXF 5DTDA 1RR7A 3SFZA 3GUDA 3RSNA 2M7AA 3A0BC 3CCSI 4MGRA 3KZZA 1MBGA 1YRNA 2DOFA 3BTCA 3M7GA 4N9IA 3JAMZ 1XGNA 3W2VA 4EEFG 2DMQA 2F5CA 1T2KA 3HUGB 3K4KA 4RS8A 4BACA 5F1JA 2X4HA 4AIDA 5JR3A 2L7ZA 4V2FA 4A3IJ 1XGSA 5DM7F 3D5RC 3EYIA 3R6SA 4F55A 2CV1A 4JP0A 1MNEA 1AA7A 5HDNA 2OU2A 1U8RA 2VPLA 2B9SA 2PX9A 1QZYA 5IT9Z 4XICA 3AAFA 1F43A 5BOXA 4RB1A 2STWA 1X1BA 4DYQA 3GMEA 1DU0A 3EUAA 4OWRB 3MWMA 2R7VA 2MYSA 3K4BA 2CMPA 4D5CA 4EM1A 2ESHA 2VL8A 5E3NA 1A04A 1BOBA 1QA6A 1TL8A 1L0OC 1DU6A 2H94A 2LY9A 2JA8J 5D5XB 1RRJA 3ZMUA 4KITB 2W85A 3CJTB 4A5NA 2E2HJ 5CPRB 2BHYA 1W4MA 2WV1A 4IOAF 1R7JA 2ME6A 3GO5A 4X6AJ 2JZYA 1TNSA 3IWZA 3VEPA 1D0XA 3DEEA 3DCFA 5FKMA 2LY1A 4KN4X 2VBWA 4IO9F 2VQCA 1ACIA 1J0RA 3K4CA 5H2FC 4RB3C 3HB9A 3J7AO 2V4JC 4CCJA 1MMNA 3S3MA 5EYRA 2X0LA 6PAXA 3SJMA 1IXSB 3IKVA 2R5YB 1UMQA 4BJTA 3HOTA 2GIZA 4XMYA 2DA4A 1R1UA 1ZH5A 5AONA 3DBRB 1N25A 2A68F 1O3TA 2NVXJ 4XSZF 4ENKA 4A3CJ 1EA3A 2J5OA 2HOSA 4HDVA 3X2QH 1UJ8A 2LYCA 2X6XA 3UKGA 1RKWA 4LK1F 4Y7NJ 1I50J 3BCAA 2QQ9A 4FCYA 3K1MA 5TGTA 1W7PB 3JSPA 1BIAA 3JRHA 1K78A 2O9LA 4HV5A 2KIMA 1X1CA 3QRFF 2E2JJ 2CQQA 2R7ZJ 1VQ5I 1QNTA 3Q9VA 3DBLB 3GFIA 2FXAA 3DXJF 4V19K 2QSFX 2QENA 2A6TA 2WY8Q 2KMUA 3R4KA 5FKKA 2VI6A 2OZUA 3T8TA 3ELKA 1MZBA 3HOUJ 3IC7A 1U2WA 3QAHA 2NXNB 1FMWA 1Y8QB 2UV1A 1O3RA 1EH8A 5IP7J 4S0HB 1XGMA 3TOBA 2FQ4A 4HSRA 4JOMA 1RR8C 1KQ8A 2HQAA 3Q0UA 4CUGA 4CGZA 2DI3A 1D5VA 4ETSA 2XKPA 1D8KA 1P9QC 2M3AA 5IT3A 1TC3C 4M9ZA 2DBBA 1FC3A 2GAUA 4N4OB 3ZMDA 2EFNA 4CYCA 2Z33A 2IS2A 2R5ZB 4XRSA 1DGWY 3LSGA 2JVGA 1JKOC 2GM4A 1D3YA 5AIQA 2GZWA 4GFBA 4BQQA 4KT6A 2KLOA 3TW6A 2V1NA 3HSEA 2FF4A 3UNGC 1WJDA 2GXGA 3WODF 2M7BA 2LY2A 2V9PA 5ILUA 3HRUA 2BYVE 2L5QA 1Z9CA 3LSJA 2XAUA 2KFDA 4M72A 2DFIA 4DW6A 1ULYA 1MIJA 4AIHA 3S1RJ 3E1SA 5M5WJ 5DM6F 3P5JA 2VE9A 3K7AJ 2R0QC 1FIAA 2DA7A 2K4JA 2WAQA 2TCTA 5C44J 1STZA 2R7DA 2V7FA 1IV6A 3NWTA 3SYTA 1P7JA 4M6XA 4ZDPA 4XQFA 1APLC 4A3EJ 4HX8A 3F0CA 3O8HA 5EGOA 3PQJA 4GGGA 3CF5F 3OYEA 2QGUA 1MJ9A 3TKYA 1JTYA 3E5QA 5LHGA 3IV5A 1TT5B 3HRSA 4NQWB 3HDDA 2CJJA 3BT9A 1QVUA 3GXOA 3ZMTA 2HQ5A 1B8IA 3GTGJ 2B7EA
chains in the Genus database with same CATH topology
5JVGF 5GADJ 3CCUI 4UY8I 2ZJQF 3CCLI 2FOWA 3CC4I 1S72I 2E35A 2OTLI 1VQLI 3J7ZI 1VQ6I 3DLLF 3CC2I 3I55I 1FOXA 3CMEI 1VQ5I 4V19K 1VQ7I 1VQPI 3CCSI 3G4SI 2NXNB 1Y39A 3CCJI 3CC7I 2E34A 5GAGJ 1YI2I 1VQ4I 1YIJI 5DM7F 3CCRI 1HC8A 2ZJRF 1YJNI 3J7YJ 2H8WA 2ZJPF 3G71I 3CCQI 3PIPF 2K3FA 3CMAI 2OTJI 1YITI 2QEXI 1QA6A 3CD6I 3CJTB 5DM6F 1FOYA 3CCMI 1VQ9I 4IOAF 1FOWA 5GAHJ 3G6EI 1VQ8I 1VQOI 4IO9F 2JQ7A 1YHQI 2E36A 1ACIA 3PIOF 3CF5F 2QA4I 3CCEI 4IOCF 3I56I 3CCVI 1YJ9I 5GAEJ 1MMSA 1VQKI 1VQMI 1YJWI 1VQNI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JVG F;  5GAD J;  3CCU I;  4UY8 I;  2ZJQ F;  3CCL I;  2FOW A;  3CC4 I;  1S72 I;  2E35 A;  2OTL I;  1VQL I;  3J7Z I;  1VQ6 I;  3DLL F;  3CC2 I;  3I55 I;  1FOX A;  3CME I;  1VQ5 I;  4V19 K;  1VQ7 I;  1VQP I;  3CCS I;  3G4S I;  2NXN B;  1Y39 A;  3CCJ I;  3CC7 I;  2E34 A;  5GAG J;  1YI2 I;  1VQ4 I;  1YIJ I;  5DM7 F;  3CCR I;  1HC8 A;  2ZJR F;  1YJN I;  3J7Y J;  2H8W A;  2ZJP F;  3G71 I;  3CCQ I;  3PIP F;  2K3F A;  3CMA I;  2OTJ I;  1YIT I;  2QEX I;  1QA6 A;  3CD6 I;  3CJT B;  5DM6 F;  1FOY A;  3CCM I;  1VQ9 I;  4IOA F;  1FOW A;  5GAH J;  3G6E I;  1VQ8 I;  1VQO I;  4IO9 F;  2JQ7 A;  1YHQ I;  2E36 A;  1ACI A;  3PIO F;  3CF5 F;  2QA4 I;  3CCE I;  4IOC F;  3I56 I;  3CCV I;  1YJ9 I;  5GAE J;  1MMS A;  1VQK I;  1VQM I;  1YJW I;  1VQN I; 
#chains in the Genus database with same CATH topology
 4EJO A;  2P7V B;  4BHC A;  3HOX J;  1SD4 A;  1JTX A;  2R3S A;  5C3E J;  3ZXS A;  4RM3 A;  4CZC A;  1V55 H;  1VTN C;  3BR1 A;  5EEG A;  2ELH A;  2M4K A;  3T8R A;  1P4X A;  2XGX A;  3I59 A;  1LDJ A;  2QBY B;  1ZG3 A;  5CLS A;  1VI0 A;  1BOA A;  4OIO F;  4LOC A;  3P9I A;  4DGW B;  4DYC A;  1Q1H A;  2E1M C;  1XMA A;  4M3D A;  4IXA A;  4HRI A;  4I01 A;  5J8F A;  1BA5 A;  1QZE A;  3MVP A;  2EIN H;  3VDX A;  2O03 A;  5J6X A;  4GCV A;  4BEH B;  2R7W A;  2X51 A;  3HOS A;  3Q9S A;  1GVD A;  5FLM J;  2A3S A;  2P7C B;  3ZN0 A;  3NRV A;  2ZC2 A;  2E1C A;  2DTR A;  3E6D A;  1WJE A;  3ABT A;  3OYF A;  4BXX J;  4BXU A;  4OIR F;  2Z3Y A;  1YRN B;  3OIQ A;  2FOK A;  2E60 A;  3A0H C;  2PMZ N;  2A5W A;  2VC1 A;  2ID3 A;  4HEA 2;  4RLQ A;  4ASN A;  1OCC H;  3OOP A;  4MIM A;  4DNC A;  3ZN1 A;  2LNB A;  3FF5 A;  2CUZ A;  1U5T B;  5IY5 H;  5F04 A;  2VKD A;  3ML6 A;  2NAZ A;  3QWL A;  3QPH A;  3D1N I;  3K69 A;  4OMY A;  1C0W A;  3LSP A;  4L9J A;  2FSW A;  2KRC A;  3GZN B;  2GXA A;  4OU0 A;  1BW6 A;  2BY2 A;  2M8E A;  1JT0 A;  4XID A;  4PDK A;  5D4S A;  4E6K G;  1YTY A;  1DUX C;  4RM2 A;  4IX7 A;  1FY7 A;  2DA1 A;  2CRG A;  2ZB9 A;  3M4O J;  1K83 J;  1F4K A;  2MAB A;  2DXI A;  4A3J J;  2OUM A;  1YG2 A;  5J40 A;  3PQK A;  3ZQF A;  1KQ0 A;  2V1U A;  3MMY B;  2KZV A;  1WPK A;  2EV6 A;  1UAA A;  3P9K A;  2H6C A;  1VND A;  3GX4 X;  3GBG A;  4KIG A;  1IJW C;  2QUF A;  3REO A;  2LF7 A;  5LEJ A;  1TWF J;  3TL4 X;  2KRF A;  3PUF A;  3I4P A;  2O3F A;  4WXC A;  1TT0 A;  5J47 A;  1WJ5 A;  2EFP A;  2LH9 A;  3W2W A;  3HG9 A;  2NYX A;  2B0L A;  2PMH A;  2ZJ2 A;  1E3H A;  5GPA A;  2MSY A;  5L3E A;  1YJ9 I;  2EJR A;  3G2B A;  2IGO A;  2FEZ A;  1ZYR F;  2CS3 A;  2VB6 A;  5DCM A;  3JSO A;  2LKS A;  4G94 A;  2LRD A;  2BHZ A;  3I64 A;  2FNP A;  4KNY A;  2XB0 X;  2AXL A;  2K3P A;  3I5U A;  3KIO A;  3MQ0 A;  3PNY A;  1XGO A;  4TV7 A;  3ULQ B;  3VYR B;  4ZDO A;  3OY9 A;  2NVU B;  2F2E A;  2HYG D;  2IRF G;  3K70 D;  5AIP A;  1ZLK A;  1WHU A;  4NNJ A;  1S3J A;  3F8F A;  4LG3 A;  2A69 F;  2X85 A;  4J00 A;  2L9N A;  1FLI A;  2OD5 A;  3V8L A;  3CC2 I;  3I55 I;  5GPC A;  1NH3 A;  2KT0 A;  4L5I A;  5HDK A;  5E1W A;  2XUB A;  1R00 A;  3B73 A;  3L09 A;  4Y3O A;  1HSJ A;  4A3L J;  1MND A;  2D1H A;  2KRH A;  2IBD A;  5FRM A;  2D2W A;  2RVC A;  2RRE A;  1Z1D A;  1VQP I;  1W0U A;  3SDB A;  4RBO A;  1V54 H;  3LAP A;  4P1W A;  5DS9 A;  3CJQ B;  4X0G A;  1UEL B;  2YU3 A;  2Z99 A;  2F4O B;  1CF7 A;  2XHK A;  3E6B A;  1B9N A;  3PL8 A;  4HYE A;  5B66 C;  2JT1 A;  2PI0 A;  1PUE E;  4PGG A;  5FFX A;  3D5L A;  1MH4 A;  1XDS A;  3QYF A;  3EUH C;  4RGX A;  1X2N A;  2H6B A;  1BR1 A;  4AYB A;  5KAF C;  5L3C A;  2ME0 A;  3JCU C;  1R5I D;  2KDO A;  1GT0 C;  3ABK H;  2Q1Z B;  3TO6 A;  4XR6 A;  2BV6 A;  4MQ9 F;  5FGM A;  1OMI A;  4PGH A;  3E97 A;  3A01 B;  4YEJ A;  2EFQ A;  5A2Q K;  4FHT A;  4IEJ A;  1YJN I;  4UUV A;  4YRV A;  2E2I J;  2DO7 A;  4E7L A;  3KEO A;  3VYS B;  2LRE A;  4A0X A;  2L54 A;  3AG4 H;  4UVB A;  2K3F A;  1V5G A;  2ZFW A;  2WB1 N;  2KPM A;  4XLN F;  2ZME B;  5HLT A;  1YIT I;  4ZYA A;  3TOA A;  4BQA A;  2LTP A;  4B3A A;  1GXP A;  3MEX A;  2OPT A;  3F8C A;  1P7I A;  4B4C A;  5EJC A;  4IRH A;  3CCM I;  1FT9 A;  2DA2 A;  4I0B A;  4DQ2 A;  1QPM A;  1WVR A;  4OMZ A;  4W1U A;  2JSC A;  2K7L A;  2JPC A;  2Y75 A;  3QOP A;  1VQ8 I;  3L1P A;  1R58 A;  2K02 A;  3O8G A;  1TWH J;  4L5J A;  4YG2 F;  3FDY A;  4E7S A;  4BKX A;  5DEQ A;  4A3K J;  4J19 A;  1YX3 A;  3KP3 A;  3DBH B;  3GTO J;  3L2W A;  5D8L B;  4WXH A;  1XMK A;  1G3T A;  4HW0 A;  4EJV A;  1ETO A;  1Z05 A;  3QQA A;  3WTX C;  3HOY J;  1OFC X;  5BPD A;  1ZRF A;  2BEO A;  1K79 A;  1G8X A;  4UY8 I;  2QCO A;  1E3P A;  1T56 A;  2FOW A;  1WI3 A;  3FXQ A;  3HTU A;  4XSX F;  3MKW B;  1FZP B;  2IJL A;  2DFE A;  2QQB A;  1PJR A;  1W5T A;  2XC7 A;  3DKX A;  1IF1 A;  1MNM C;  1VQL I;  3HTS B;  2FU4 A;  4WWC A;  3TED A;  2JPB A;  5IP6 A;  2R5Y A;  1MBF A;  1U8B A;  1D1A A;  2V6C A;  3WGI A;  3S3N A;  2G9W A;  1XD7 A;  4C2M J;  2FMY A;  2M0C A;  4L9T A;  1VQ7 I;  5ICG A;  1P92 A;  2DU9 A;  1MSE C;  4Y52 J;  2VN2 A;  5ERI A;  2OV7 A;  3D5S C;  2KIQ A;  2HZT A;  5FKN A;  2JRM A;  1ZRC A;  1ZG5 A;  1W7P A;  1IN7 A;  1Y6I A;  2MG4 A;  4L18 B;  2JA2 A;  1TNT A;  1LNW A;  4BAY A;  2DMN A;  3FMS A;  1WJF A;  3EUH A;  1YIJ I;  1VQ4 I;  1EH7 A;  4XLE A;  1I27 A;  4C30 A;  4LD5 A;  1S8N A;  3LL7 A;  4I02 A;  3BOQ A;  1LQ1 A;  4WF2 A;  3GTQ J;  2PJR B;  5TJJ A;  1PDN C;  2DMU A;  4CCM A;  3S93 A;  3M3Y J;  3RPU A;  1WWX A;  4DZP A;  1M1E B;  1OR7 C;  2HVQ A;  2EV5 A;  3OS1 A;  2DQR A;  3O2P E;  2P4W A;  5IPA A;  1QRY A;  5GP9 A;  2QEX I;  3LA3 A;  3IAS 2;  1JHF A;  1JGG A;  2JUC A;  2QZ8 A;  4IQ4 A;  2NNY A;  5JHU A;  1U5T C;  4LIU A;  1P4W A;  1AHD P;  2R5Z A;  4FQG A;  3CQZ J;  3H9J A;  2JK3 A;  2JSP A;  1A6I A;  2ZNZ A;  5LD2 C;  3KEQ A;  2W84 A;  1WH7 A;  3ECO A;  4BL0 B;  1OYI A;  4LMY A;  5ICC A;  2RNJ A;  5ILS A;  1OYW A;  4WX9 A;  3DTE A;  1S9H A;  3DU6 A;  4HDU A;  3FZV A;  1A35 A;  3H35 A;  4YFX F;  1YHQ I;  3FX3 A;  2NVY J;  1X4O A;  3RQI A;  2CGP A;  3P9C A;  2EFO A;  3M1E A;  2D1V A;  5E8I A;  2IS1 A;  2ZO4 A;  3E5X A;  3BZ6 A;  4QTR A;  3KP6 A;  1UCR A;  1ZQ3 P;  3CMY A;  3SEQ A;  1T6S A;  3F8M A;  1WZ2 A;  3VYT B;  3A1Y A;  4AIJ A;  3C3W A;  2IGK A;  3K0L A;  2M2E A;  1W36 D;  4XLA A;  1JT6 A;  4HX4 A;  2W25 A;  1V4R A;  3E0J B;  1GDT A;  3PM1 A;  2F5F A;  3O3K A;  2V9K A;  2VQG A;  4MQV A;  4GDF A;  4I7H A;  4I76 A;  4UXN A;  4C3H J;  3CES A;  3O6B B;  5HLG A;  4NQW A;  2OTL I;  1ETV A;  3G1O A;  1ZR2 A;  2KP6 A;  4EM2 A;  5D6F A;  4F3Q A;  4IHW A;  4A3M J;  3HPG A;  4P9F A;  3I4M J;  2LLK A;  3I58 A;  4BQO A;  4ENJ A;  2HPM A;  1X3W B;  5ED4 A;  3MD2 A;  2N8G A;  4PFP A;  1JUP A;  5LHH A;  4UNO A;  1UHM A;  3RYR A;  1BC7 C;  2RKH A;  2M87 A;  3HRT A;  1DPU A;  1G3Y A;  3H3V K;  3T0Y A;  4JX5 A;  2ID6 A;  3Q0W A;  4M3F A;  1B59 A;  4Y4R A;  1KZH A;  2QBY A;  1ITY A;  4M74 A;  1R4M B;  2HZD A;  4A6D A;  3L2V A;  4Z6Y A;  5J4V A;  1I1S A;  1CF7 B;  2NS8 A;  3QPS A;  5FD5 A;  2CYY A;  2VE8 A;  3V7S A;  3OSF A;  1LVA A;  1J09 A;  3GEZ A;  3EQL F;  3KFW X;  3S16 J;  1R49 A;  4O6J A;  4BEH A;  2O5R A;  4L5E A;  1MW7 A;  3G73 A;  2NOG A;  3AL0 B;  4IKF A;  2O7O A;  3BG9 A;  3HKZ N;  5HVQ C;  5JHF A;  2XSJ C;  3TGN A;  3R0J A;  1JE8 A;  3CJR B;  3ZCO A;  1Y0U A;  3DKY A;  3H0G J;  3ABM H;  3NAU A;  4Y13 A;  2RN7 A;  3I3L A;  3TP0 A;  4DBQ A;  3FBN B;  4U88 A;  3M9A A;  5DDG A;  1OR7 A;  3Q5F A;  5IP9 J;  3HL2 A;  2HYF A;  5CVR A;  2IEK A;  1F5T A;  1WI9 A;  1YE9 A;  4I99 C;  4MNU A;  2XAQ A;  4UVA A;  3R61 A;  1U5T A;  1K61 A;  1WSU A;  2XVC A;  2VLA A;  4HZF A;  2QWW A;  4EQQ A;  1JKP C;  3ZQI A;  1XG1 A;  3PO3 J;  4O3M A;  4XN3 A;  2CH0 A;  1GUU A;  2BOL A;  3AFH A;  4HAM A;  3ZGK A;  3J7A Y;  2MH2 A;  2L3D A;  5HLH A;  1G3W A;  3WTY C;  1XS9 A;  4U0W A;  4HA8 A;  3L2C A;  3N97 A;  3QOD A;  3H9G A;  4F7Z A;  3H3Z A;  1TWG J;  5FD6 A;  5FRN A;  1UHS A;  2F5E A;  1WJB A;  4PJL A;  2DFF A;  3BG7 A;  4L9V A;  4LG0 B;  2EZI A;  2VJI A;  3IH2 A;  1VQM I;  4M71 A;  2P5V A;  2ADU A;  4KUM A;  1IC8 A;  2XF7 A;  2DJN A;  4HV6 A;  1FOK A;  1OKR A;  3BTI A;  3K4J A;  4DJA A;  3JRD A;  4RAZ A;  1OPC A;  3KP5 A;  2DYR H;  2XF5 A;  2PLY A;  5A2Q Z;  2DYS H;  5D5V B;  4CH7 A;  4AYB N;  1FMV A;  3OMY A;  2C6Y A;  2WC2 A;  4D7M A;  3MZH A;  1VQ6 I;  2L02 A;  4YEL A;  3BG6 A;  3BTL A;  1W1W E;  2WB1 A;  1FBQ A;  4UVC A;  1PUF B;  3OIO A;  1MSF C;  2LC2 A;  2P8T A;  1W0T A;  3CME I;  4U7D A;  4KIB A;  1XCV A;  2P6T A;  1GLN A;  3ZQC A;  4NC8 A;  4BBR J;  4L9N A;  3BJA A;  2EQR A;  2F4M B;  2KIF A;  4B44 A;  2JWT A;  3DPT A;  2L9V A;  2CUE A;  5JLW A;  5J1U A;  3D0S A;  3I53 A;  1K6Y A;  2K9S A;  4AVP A;  2COM A;  3KP7 A;  1K4T A;  1WFX A;  1YLF A;  3JRG A;  1JI8 A;  2LVS A;  3L00 A;  1P6R A;  1ENH A;  1U0J A;  3BC8 A;  1D5Y A;  3MZ8 A;  2PJP A;  3B02 A;  5BPI A;  3HJE A;  3FIS A;  3K70 C;  2R7X A;  2KDZ A;  3J81 K;  1V5F A;  3WHB A;  4BHB A;  1TLH B;  1KU3 A;  4IPA A;  3FMQ A;  4MFD A;  1FJL A;  9ANT A;  2HDD A;  3OSG A;  2VON A;  3LOC A;  5LLQ A;  4O5V A;  3CO6 C;  3E6C C;  1DDN A;  4Y17 A;  5CVU A;  5L3B A;  1OCP A;  2Y31 A;  3DEU A;  1Z91 A;  3IHU A;  2A6E F;  1GHC A;  3MKZ A;  1UG0 A;  2Y9Y A;  2GBY A;  2V1D A;  4XM3 A;  4RA2 A;  5B1A H;  3IKT A;  1LVK A;  3OYG A;  3A01 A;  1TQM A;  2HR3 A;  3GYH X;  1JJ8 C;  3HHH A;  1H0M A;  2E19 A;  3I9V 2;  2VPR A;  1A31 A;  1Z6R A;  3BRO A;  1F1Z A;  5H6R A;  2V6E A;  2DPD A;  5FRO A;  4I2O A;  3BPV A;  4BH9 A;  1OLT A;  2HDC A;  1HBX G;  2BBY A;  2ZME A;  4DOZ A;  3KPH A;  1IW7 F;  1UG2 A;  3DKW A;  4D0P A;  1VQO I;  2JQ7 A;  3G1M A;  4EJU A;  2AQE A;  4BY7 J;  2GA1 A;  4QWQ A;  3RI4 A;  5KNL A;  1R1V A;  4IRI A;  4G12 A;  4RGS A;  4IOC F;  1LKX A;  3LQR A;  4JK1 X;  4A93 J;  5GAE J;  1BR2 A;  1X2M A;  5IOY A;  2IXS A;  3CCY A;  4GYG A;  2TRT A;  2PMU A;  1HCR A;  2O0Y A;  5B1B H;  5HOO A;  3LSR A;  2AQF A;  1O3Q A;  2IVM A;  4ZYG A;  3JR9 A;  5DCF A;  4BE0 A;  1FX7 A;  4XRS G;  2V1X A;  3WTS C;  4AWX B;  2ZXW H;  2HOE A;  4M6V A;  2PG4 A;  5M5X J;  3EPZ A;  3H36 A;  4GRI A;  3HXL A;  4G6T B;  2DK5 A;  4FET A;  2XRL A;  2AS5 F;  5ICF A;  4C3J J;  1LDK B;  2R7Q A;  2ZKZ A;  4ZH4 F;  5D5U B;  4C3I J;  4N0B A;  2MD0 A;  5HDG A;  3S2W A;  3R60 A;  1ON2 A;  2IPQ X;  4CXF A;  4NHJ A;  4EAT A;  1ZEL A;  3LFU A;  2KIU A;  3SZP A;  4Q5S F;  3TBI A;  3OR2 C;  3OS0 A;  3ZQL A;  4A2U A;  3IRQ A;  1QBJ A;  3U21 A;  2VBY A;  5C4J J;  2M34 A;  2XAG A;  4IZZ A;  3KET A;  2E7W A;  2VXD A;  2JTV A;  1USS A;  1LFP A;  4XN0 A;  3WTW C;  3ZQ7 A;  1VZ0 A;  4I0A A;  4LLG F;  4M9X A;  2E1O A;  3CCJ I;  2HTJ A;  1FNN A;  2QF7 A;  1KQ9 A;  3GF2 A;  5GAG J;  1XSX A;  2VBZ A;  2CQ7 A;  2YX4 A;  3GZ6 A;  1IXR C;  1J5Y A;  1IN8 A;  3DP7 A;  2R93 J;  4RGR A;  1MMA A;  2QKL B;  2X6W A;  2X6O A;  3TP3 A;  2ZJR F;  1FYL A;  3OWT A;  4DBR A;  4HOB A;  3TO9 A;  3PNV A;  3OYA A;  2ESN A;  3DV8 A;  4A6E A;  1QHG A;  1O4X A;  4ZZL A;  4UV9 A;  4RB0 A;  2X9D A;  2Y0M A;  3TO7 A;  1XPX A;  1E3O C;  1N78 A;  4BHP A;  4PSX A;  1HDP A;  4A3G J;  1J75 A;  2MD5 A;  3JRF A;  3BTJ A;  3AL0 C;  2BVL A;  4XKW A;  3S1Q J;  2XDV A;  2PJR A;  2HXO A;  1BM9 A;  1TQI A;  3K4M A;  3BJ6 A;  4DYR A;  1D1C A;  5KHD A;  3C18 A;  2VKE A;  4MLO A;  2AO9 A;  2Y0S N;  1NTC A;  2Y48 A;  2DCE A;  3IL2 A;  2K86 A;  4UUS B;  2UUZ A;  1QGP A;  2Q2E B;  2IS4 A;  2HTS A;  2RQQ A;  1B72 A;  3JTH A;  4D9J A;  2EIL H;  1IV8 A;  2KIS A;  3MN2 A;  5LBQ A;  1Y8R B;  2H1L A;  3QP5 A;  3R0A A;  2WTE A;  2DA6 A;  2E1N A;  2LDU A;  1XC5 A;  1T98 A;  2OQG A;  2KQR A;  1ETX A;  2M9H A;  4IHX A;  3S14 J;  3FM5 A;  1ZGW A;  4H0E A;  4RAY A;  4U7B A;  2HQR A;  2IS6 A;  3BZC A;  5E3O A;  4W97 A;  2L01 A;  3HKZ A;  3BLY A;  4YIR X;  2HYJ A;  3LFK A;  1R5G A;  2DN0 A;  1FOX A;  3FM3 A;  4KIF A;  3Q0V A;  4IL6 C;  3A03 A;  3COA C;  1O7F A;  1XX5 A;  3H0D A;  3WE3 A;  1OCO H;  4HG2 A;  3M07 A;  1MMD A;  3ZOB A;  3NWS A;  1Z21 A;  1Z3Y A;  1Z7L A;  3ERM A;  2BXY A;  3M8F A;  2X1D A;  5KVR A;  5JFR A;  5FLX K;  1CQT A;  2F5D A;  3HSF A;  2LOO A;  4HF1 A;  3ASO H;  5LHI A;  1YW7 A;  1XSV A;  2WY7 Q;  2Q8K A;  2ZCW A;  3N4M A;  1W36 C;  2XGD A;  3CTA A;  3RIR A;  5ICE A;  5J4Y A;  3CJN A;  2VT2 A;  1PVE A;  1MJB A;  5K7F A;  5D5W B;  1MDM B;  4KDP A;  3BQY A;  3DU5 A;  2FML A;  3CCR I;  1FBS A;  3QYB A;  1XTA A;  1TBX A;  2L7F P;  4PZJ A;  4AUX A;  4IHY A;  4LJZ F;  1MGT A;  1DPR A;  5H20 A;  1TQP A;  1OCT C;  4N9H A;  1EH6 A;  3KYD B;  2H8W A;  2RAE A;  1SFK A;  1POG A;  1IRX A;  2XF6 A;  3EDP A;  4U0V A;  2Z1D A;  2IGM A;  3OYL A;  2HDW A;  4M3G A;  5EEA A;  3F6V A;  4FTH A;  4Q48 A;  1B4A A;  1IN5 A;  4OAY A;  5KCM A;  5E18 F;  1BI2 A;  2HI3 A;  2FUG 2;  2XIG A;  1KON A;  3MCZ A;  2FRH A;  1S6L A;  3MFK A;  5IT9 K;  1JJ6 C;  4NUB A;  1ORK A;  1D1B A;  1DQU A;  2RV8 A;  2CV2 A;  4L0Y B;  3F8B A;  1FTZ A;  4U87 A;  2NS7 A;  3SEZ A;  5GAH J;  2F4I A;  2K9M A;  3KLO A;  1EKE A;  2X1E A;  3WTV C;  4F52 A;  1R5H A;  2H09 A;  5E3M A;  3LSH A;  4HST A;  3E6M A;  1IO2 A;  1R9T J;  2K5C A;  4HF0 A;  1KU2 A;  2E36 A;  3OYM A;  1DP7 P;  1TWC J;  2QYO A;  2LK2 A;  2FQ3 A;  1FYM A;  1BR4 A;  1P2F A;  1ETQ A;  4G8X A;  1LFU P;  4XLP F;  2VJ4 A;  1N77 A;  1LEA A;  3U9G A;  3F21 A;  2DLL A;  2FJ1 A;  3QU3 A;  1SEU A;  2F6C A;  4PJN A;  4BQN A;  4ESF A;  3J81 Z;  2CU7 A;  2CSO A;  2EPF A;  2HEO A;  3CDL A;  5E8G A;  2GWR A;  2EFW A;  1Z6T A;  4ANJ A;  2FBI A;  1WJA A;  1HXD A;  4LG0 A;  5IYC J;  2LMD A;  2WWY A;  4BS9 A;  2MGQ A;  4NBQ A;  2HKO A;  1HF0 A;  5FJ8 J;  1Z3X A;  3OYB A;  1A36 A;  5BS6 A;  4I09 A;  4AD9 A;  4RLF A;  3I0T A;  1XMX A;  1YS7 A;  1SAU A;  3BR6 A;  4C2T A;  5D8K B;  4BNC A;  3EUK L;  2LBF B;  4FAS D;  2G7U A;  5DD4 A;  4NC7 A;  1LJ9 A;  1I5Z A;  2HPI A;  1QPI A;  2ETH A;  3VWB A;  5K7H A;  1XN7 A;  3FBI B;  3WG9 A;  4LLL A;  2PN6 A;  4GXO A;  1ZAR A;  2DFH A;  1PUF A;  3S17 J;  4IJA A;  5F6F A;  4ZDL A;  3AKZ A;  1P4A A;  4NC6 A;  4PJM A;  3CDI A;  2MLG A;  3GTK J;  3GTP J;  3DLA A;  3ROU A;  1ZR4 A;  1WRJ A;  1SMY F;  4XL9 A;  5EDN A;  2R7T A;  1GVJ A;  4XKV A;  2M8G X;  1MD0 A;  4MHG A;  2IT0 A;  2VQL A;  3HOZ J;  1HA8 A;  4ZYH A;  3FHN A;  4CSW A;  5LGN A;  1ETK A;  2ZJP F;  5TRD A;  2HOT A;  3FKI J;  3OL4 A;  5CQE A;  4CCN A;  3WU1 B;  4R79 A;  1Q1V A;  4K2E A;  3GFL A;  2DMT A;  2KZG A;  4BDZ A;  3WTT C;  2V26 A;  1AKH B;  3CUO A;  1R4N B;  4KIS A;  2R92 J;  1YYV A;  2OTJ I;  1ZHF A;  3HSR A;  2BW3 B;  1YX5 A;  5FFZ A;  3CUQ B;  4S04 A;  1NG7 A;  4DIQ A;  1JKR C;  3OOU A;  5LGT A;  3H5N A;  3DQV C;  1H9G A;  5M5Y J;  1IZ1 A;  3HRM A;  2ICW G;  1R22 A;  2VIX A;  3SZT A;  2LG4 A;  4EGY A;  4BXF A;  1DP3 A;  4UB8 C;  2W24 A;  2JA7 J;  2ZSH B;  2NS0 A;  3SZG A;  1ZG1 A;  1OQY A;  1BI0 A;  2P5K A;  5F08 A;  2XB5 A;  3NEU A;  1U78 A;  2QSH X;  2J5P A;  3JRB A;  2LKX A;  5FLV A;  5CQG A;  3SHF A;  4MTD A;  3OL3 A;  4CCK A;  3OV8 A;  2MW8 A;  4X1E A;  3MKL A;  4XBF A;  3BQZ A;  2AXT C;  3B6A A;  5FB2 A;  1B72 B;  2QVO A;  2DTZ A;  1O3S A;  4ZYE A;  4QIW N;  4YII A;  2JN6 A;  3LNQ A;  1H9T A;  2LF8 A;  1TTY A;  1MH3 A;  1NHA A;  3A2K A;  5HNF A;  3M8J A;  3PSI A;  3K1P A;  2E5N A;  4Y15 A;  2EIM H;  4HQM A;  5B5E C;  4BE2 A;  2I5U A;  3BP8 A;  4EJW A;  3VOE A;  1CGP A;  2M45 A;  1IAW A;  4EM0 B;  4OIP F;  1SFX A;  3F72 A;  3TDU C;  4BJ5 C;  1BL0 A;  2HU9 A;  3QU6 A;  2Y30 A;  1YQA A;  1RI7 A;  2R7F A;  3SDG A;  2MC3 A;  2QLZ A;  4CHU A;  4RAG A;  2YX7 A;  4AU7 A;  1HKQ A;  1B9M A;  2IAI A;  3UR3 C;  5BQT A;  4V2G A;  3TQN A;  4II2 A;  2VJ5 A;  4G6D A;  4IF4 A;  3RYP A;  5EG0 B;  3ZQG A;  3G3Z A;  2WA0 A;  3OYC A;  3OYJ A;  5J3L A;  3BCB A;  2Y0S A;  4UUT A;  1YI2 I;  1AOY A;  2FD5 A;  3V42 A;  3BR5 A;  2JA5 J;  1MMG A;  2EB7 A;  3IAM 2;  4M9S A;  2VKV A;  3VYU B;  2HKX A;  1BJZ A;  2OJE D;  2X1C A;  3U2R A;  4PK4 A;  4E7J A;  1ZK8 A;  5IOZ A;  2XGC A;  2MH9 A;  2EA4 A;  2H1K A;  2RQP A;  4HNV A;  3ZQQ A;  1JHH A;  2STT A;  3E3V A;  4BUP A;  1HQC A;  5HS7 A;  3ASN H;  1G59 A;  1ZRE A;  5DUI A;  3WU2 C;  2OC6 A;  2ACJ A;  1OCR H;  2WAE A;  3ERE D;  4CYD A;  5B3S H;  1ETW A;  3HBL A;  3SFI A;  3BG3 A;  3EET A;  2YS9 A;  4EGZ A;  2EK5 A;  1HW1 A;  3F8N A;  1H88 C;  3JRC A;  3ZR8 X;  3ZPL A;  4KJZ A;  3LQQ A;  3V4G A;  1IDZ A;  3GW2 A;  5E3L A;  1LUJ B;  2R7U A;  1X1A A;  3CF2 A;  2V79 A;  2HS5 A;  3K4N A;  4A3F J;  3ONQ A;  1G4D A;  2E1M B;  2CUF A;  2QSG X;  4FE4 A;  2D45 A;  1K4S A;  1WCM J;  3ZMV A;  3VSL A;  1Z67 A;  2CG4 A;  2XV4 S;  4DZJ A;  2WAD A;  1MKM A;  3S1M J;  5FLX Z;  5E17 F;  2Z2S B;  1QU3 A;  2QA4 I;  2IA2 A;  2W57 A;  3QOE A;  3RKX A;  3I56 I;  1TW3 A;  2X6Y A;  5F64 A;  1H89 C;  1H8A C;  2EA2 A;  1HKT A;  3FXK A;  3A02 A;  3FWE A;  1UST A;  4EJT A;  1JUS A;  3PUB A;  4BE1 A;  5GTI C;  3OYN A;  2ISY A;  5GAD J;  3RTR A;  5JVG F;  2ZME C;  2HGC A;  1O57 A;  2XPV A;  3RJP A;  5LFA A;  5D6E A;  4UUS A;  2VOO A;  2Q2E A;  4A0Z A;  4HNT A;  3L2R A;  4AM3 A;  5H6Q A;  1ETY A;  1UFM A;  3W6J B;  1DGR M;  2DQL A;  5K5R A;  3LAJ A;  2NRA C;  3DWL E;  4ZJZ A;  4BJ6 C;  3J7Z I;  1E0E A;  5L3D A;  2R7O A;  2ZFU A;  2OQR A;  2XRO A;  5DV5 A;  2DOD A;  3WE2 A;  1ZTR A;  2KHM A;  1ZGA A;  3DPU A;  3QPL A;  3GTM J;  3MKY B;  2O8X A;  2PQ8 A;  3BR0 A;  4IHS A;  2OA4 A;  1LE8 B;  3TMO A;  1T08 B;  3FXO A;  3G4S I;  1TZL A;  2TDX A;  3I71 A;  1I3A A;  4XKB A;  2VXZ A;  3JRE A;  4B09 A;  1KYW A;  4CCO A;  1S7A A;  3CC7 I;  2JVH A;  3AG1 H;  2HFH A;  3FK6 A;  2E71 A;  3EYY A;  3NAR A;  4LGW A;  1FEX A;  2OZ6 A;  1FSE A;  3MAJ A;  1OIS A;  3BG5 A;  4P9U A;  4HLY A;  1R1T A;  3SXY A;  4M73 A;  1YW9 A;  2JA6 J;  3GCM A;  1U9N A;  5D4R A;  4ESB A;  4RAF A;  1IN6 A;  2FBK A;  2UXX A;  2W4S A;  1ZRD A;  4XON A;  3J7Y J;  3H1C A;  2DPU A;  2D5V A;  5HS8 A;  2A6H F;  1RC9 A;  1O7L A;  1XB4 A;  2EV0 A;  3CO7 C;  1FP2 A;  2X48 A;  4E70 A;  1MDM A;  1RPW A;  2I8D A;  4KMU X;  4PUS A;  3VPR A;  3KP2 A;  2LFB A;  1BC8 C;  1I39 A;  4LLN A;  3FXU A;  2L4M A;  2XSD C;  1IXC A;  3BR3 A;  1NG6 A;  4HBL A;  3LSK A;  1FOY A;  1TWA J;  4ZTF A;  2ISZ A;  1VF9 A;  4IHT A;  1FOW A;  3H5R A;  4ZC3 A;  2CW8 A;  3LMM A;  5E20 A;  5EZH A;  4BBS J;  5F1R A;  1Y0N A;  1E2X A;  3CUQ C;  2G0E A;  4E7Z A;  1TW2 A;  2A5Y B;  1OJL A;  1RNL A;  3I54 A;  4IRG A;  4LK0 F;  5HOD A;  1ONV A;  1I6X A;  5M3F J;  1HKS A;  4CO8 A;  4YIF A;  1T8I A;  4IHV A;  4PSW A;  3PIO F;  1J7K A;  1BJA A;  1KYZ A;  1G3S A;  2HOA A;  3Q3S A;  1VFC A;  2EH3 A;  2GQQ A;  2XGE A;  4JQF A;  2RDP A;  4G7H F;  4B48 A;  3H9Q A;  1YJW I;  1VQN I;  1D0Z A;  2CQK A;  5CVV A;  2ZBK A;  4RB2 C;  1X4P A;  2KL4 A;  3PFI A;  1JUM A;  1IRZ A;  2L7K A;  3CCU I;  1J9I A;  2CWE A;  2R7S A;  4B1R A;  2IA0 A;  3IH4 A;  2F5V A;  4F93 B;  3V8J A;  2MA3 A;  3FMR A;  2L2O A;  1MBE A;  3PSF A;  1HLV A;  1BI1 A;  4S05 A;  2BY3 A;  3QP6 A;  3J80 K;  2BGC A;  3BY6 A;  3ABL H;  3DEW A;  4ZTJ A;  1YIO A;  3HGG A;  5DUK A;  1D8J A;  3BPX A;  1R36 A;  3K1N A;  2Q0O A;  4QSH A;  5LRS A;  2K85 A;  4N4N B;  1IRG A;  2HXI A;  2JRT A;  2BXZ A;  3ZMS A;  1PP7 U;  2LKP A;  1ZLJ A;  5F0C A;  1GV2 A;  2QKM B;  2VUM J;  2OF7 A;  5LRR A;  4CZZ A;  1KGS A;  1T39 A;  4A0Y A;  1BW5 A;  3S1N J;  2HVS A;  5FO5 A;  1SD6 A;  1T33 A;  2YPR A;  5IYB J;  3BDD A;  3QYE A;  3HEF A;  2VBX A;  2ECC A;  4FIS A;  2UXN A;  3C7J A;  2GXB A;  5IYD J;  5E79 C;  2PEX A;  1ODD A;  3K2Z A;  2LBF A;  3OR1 C;  3E7L A;  3DPL C;  3GWZ A;  2DA5 A;  3V8K A;  2ZXI A;  2YU9 J;  1SMT A;  2CW7 A;  3IWF A;  1SD5 A;  1V3F A;  4UB6 C;  3F6O A;  1F9N A;  4FT8 A;  2BY1 A;  3RCO A;  2CO5 A;  3JRA A;  4D5F A;  2K9N A;  1HDD C;  4XKC A;  4HLX A;  1W5S A;  2R4G A;  2A61 A;  4WK8 F;  3G1L A;  1KU9 A;  4E7K A;  1PYV A;  1ZAO A;  3CD6 I;  3TDZ C;  1AU7 A;  2ZXH A;  2IA1 A;  2P0W A;  2W1O A;  1MBK A;  4IVN A;  1XCB A;  1FWZ A;  2RC4 A;  3AG3 H;  1QHH D;  3KZY A;  4HNU A;  1E17 A;  4FX0 A;  3G6E I;  1AKH A;  4QLC U;  1OYY A;  4RDU A;  1X58 A;  2OBP A;  1SFU A;  2BW3 A;  1Y56 A;  3CUQ A;  4CA0 A;  2BVM A;  2DK8 A;  2BY0 A;  3KP4 A;  5CVI A;  3A4C A;  2CQN A;  3L7W A;  4LIV A;  3S32 A;  2A05 A;  4H4K C;  3CCV I;  1SVO A;  4KMF A;  4KN7 X;  4BYY A;  2UWM A;  1VQK I;  2ELK A;  4M6Y A;  3RKY A;  3KZI C;  1Z7U A;  2KJB A;  4RMN A;  1SC7 A;  1NK2 P;  1MJA A;  2VJJ A;  1REP C;  5KK1 A;  3BWG A;  4M3B A;  4XLF A;  3PO2 J;  1X3Z B;  2L9S A;  3RZO J;  1SAN A;  4RGU A;  3FKJ A;  4NDL A;  5E1Z B;  2ZJQ F;  1U3E M;  1R71 A;  2I10 A;  3CC4 I;  1S72 I;  2Z9O A;  1BI3 A;  4HPQ A;  2HWV A;  2LP0 A;  4R1H A;  2WV0 A;  4HX7 A;  4OIN F;  3BZK A;  2MLK A;  1XSD A;  1YW8 A;  4P5O A;  1IUF A;  1BN5 A;  2M30 A;  1Y1V J;  4F92 B;  3S2H J;  3K2A A;  3M1C A;  2VQH A;  2KJC A;  4B43 A;  5L3G A;  3JRI A;  4FX4 A;  1FSH A;  2DT7 B;  1S7E A;  3F23 A;  3LWF A;  2VT3 A;  4A3D J;  1GV5 A;  4GYI A;  4A5M A;  4G7O F;  3P7N A;  1ON1 A;  1R23 A;  4ENM A;  2E34 A;  3W2A A;  3PNT A;  2JUG A;  2Y69 H;  3TW7 A;  2JJ7 A;  1J2X A;  2E7X A;  2OCC H;  2B63 J;  4G7Z F;  2CFO A;  2CW0 F;  3ZQH A;  3HIF A;  1HC8 A;  1A5J A;  1WQ2 A;  1J59 A;  1U6G A;  5JVT A;  3PJR A;  1T95 A;  1UHW A;  2IW5 A;  1RUN A;  4AC0 A;  2XKO A;  3S15 J;  4A3B J;  3RZD J;  1X1P A;  1S7O A;  3OYI A;  2EIJ H;  2VOD A;  3RDI A;  1S5L C;  2XPW A;  2WBM A;  5EG0 A;  1PP8 F;  3WTZ A;  2EIK H;  2NOJ B;  5KAI C;  2HQN A;  3IP4 B;  3C2G A;  1LFB A;  3ISP A;  4MFE A;  5F0F A;  3RKW A;  4XNF A;  1HW5 A;  3K4L A;  3S3O A;  4P55 A;  2OCE A;  2O8K A;  1ZGJ A;  2L7M P;  3DTI A;  3F9K A;  3HZJ A;  2XAF A;  4ITV A;  3GTJ J;  3DF8 A;  4KT5 C;  4M3E A;  2ZNY A;  2ELJ A;  3VFZ A;  2XAJ A;  1LPQ A;  1Z0X A;  1X19 A;  3JAM K;  1B1B A;  3LST A;  3OYH A;  1G2H A;  1FYK A;  5K1Y A;  2DAO A;  2Z16 A;  4QPO A;  4BU2 A;  4MTE A;  4XLH A;  2M4G A;  3KE2 A;  1RZ4 A;  5J1R A;  3OS2 A;  1EV7 A;  3K6G A;  4Y33 A;  3S2D J;  4U0Y A;  2CUJ A;  1S29 A;  2H27 A;  3FHZ A;  3K10 A;  2LR8 A;  3S8P A;  4XOT A;  1MMS A;  4E7I A;  2A07 F;  3C1D A;  3L2Q A;  2QM3 A;  1A6Q A;  1LB2 A;  1K78 B;  2COB A;  3ECH A;  1IUY A;  3AG2 H;  3HOV J;  4MO7 A;  2W82 A;  4XRF A;  2VKH A;  1RES A;  2V9V A;  2GLO A;  3ZP5 A;  1WKM A;  3ESW B;  3C2B A;  1L3L A;  3GFM A;  4D7N A;  2E35 A;  3FXR A;  3HC7 A;  4PCQ A;  5DYM A;  4UHT A;  5J1Y A;  1WJC A;  1RKT A;  4XLC A;  2GIV A;  1SVM A;  3OYD A;  3GLL A;  5HS9 A;  3WG7 H;  4ESJ A;  2LD5 A;  3V7R A;  4XRM A;  3LA2 A;  5BMZ A;  1EF4 A;  4XOR A;  4YFN F;  5TIS C;  5LEK A;  3V7C A;  4LIT A;  2XRN A;  2VOP A;  3KEY A;  1UZC A;  5HNH A;  1G6N A;  2W48 A;  1B6A A;  3HUG A;  1K6O A;  3WHC A;  2OAZ A;  3T1B A;  1ERD A;  4CYC B;  1WGX A;  4E7H A;  1FPQ A;  1T0F C;  2FBH A;  3HPH A;  3KLN A;  2VC0 A;  4Z2Y A;  5K5Q A;  4II3 A;  1QQI A;  2K27 A;  4G6Q A;  4OAZ A;  3RQ4 A;  4L0Z B;  1D0Y A;  5CKT A;  3N05 A;  1LE8 A;  2Y2Z A;  1MBJ A;  3VSK A;  4B47 A;  5CJ9 A;  2XAS A;  3KYL A;  3CDH A;  2P6S A;  4Q47 A;  1KU7 A;  3W3C A;  3B6C A;  4F91 B;  3WGG A;  1FP1 D;  3WU0 A;  3NQO A;  3G71 I;  4PJJ A;  1W5C C;  3PIP F;  3JTG A;  1HST A;  4WCG A;  1JGS A;  4EMS A;  3E5U A;  2ECB A;  2E5Z A;  2H8R A;  3CMA I;  5JLX A;  1RET A;  4G9Y A;  4KFC A;  3KCC A;  2P5L C;  1BIB A;  3LSI A;  2K9L A;  4B3X A;  1HW2 A;  1QZZ A;  2NNN A;  5EF6 A;  5EGO B;  3VOD A;  1Z77 A;  1QVT A;  3F3X A;  4C9Y A;  1SFO J;  4JBA A;  1HOM A;  2DMP A;  2YUS A;  2FA5 A;  1R6R A;  3J80 Z;  1VQ9 I;  2EZK A;  3W6K B;  3GZ5 A;  1SFE A;  4IQJ A;  3U1K A;  1B8I B;  2F48 A;  3WGH A;  4EVI A;  4ZYD A;  4LB6 B;  3LSM A;  4AVZ A;  5ILV A;  3CCE I;  2MBF A;  5E1X A;  3DFG A;  3IRR A;  2O61 A;  5K7Z A;  1IRF A;  1V5E A;  3F22 A;  4BY1 J;  3RKQ A;  1WH5 A;  2RGV A;  2XAH A;  2PFB A;  3C2H A;  3I59 B;  2Z5U A;  2CQX A;  2W7N A;  2EZL A;  3U1D A;  2DOA A;  2FE3 A;  5EEH A;  5HLI A;  5CVJ A;  2HVR A;  2K9Q A;  4P96 A;  3CCL I;  4ZZD A;  2IGN A;  2L9R A;  4JX6 A;  2VAS A;  4GO1 A;  1JXS A;  4WXD A;  2EZH A;  2O6G E;  4I6Z A;  3KYC B;  3DTK A;  4A69 C;  4EV0 A;  3DLL F;  3GTL J;  1YO5 C;  1UB9 A;  5BNG A;  1MBH A;  3CZ6 A;  5JI6 A;  1F36 A;  3JW4 A;  4KYW A;  2GOM A;  2WAQ N;  4UV8 A;  5K5O A;  2NVQ J;  3L2U A;  1FBU A;  2DW4 A;  4LFU A;  2M5W A;  2BZT A;  2GA2 A;  2HNH A;  5GTH C;  1I6H J;  1ZKG A;  4KIC A;  4MEY F;  4A12 A;  2GOX B;  2R7R A;  1BBY A;  5F27 A;  2YSR A;  3GLX A;  1SAX A;  1Y39 A;  3MZY A;  5F0H A;  4PFO A;  1GXQ A;  1TP4 A;  2MFZ A;  3LA7 A;  1IN4 A;  1T0F A;  3OIP A;  4FE7 A;  3FIW A;  3FXJ A;  3CP2 A;  4CIC A;  1I1G A;  1YFH A;  3H92 A;  2YR2 A;  1Y1W J;  3ZRG A;  1SVL A;  2DJI A;  2W00 A;  4OIQ F;  3L9F A;  4BGD A;  3QPT A;  1KA8 A;  2M0M A;  1YS6 A;  2EBI A;  4ON0 A;  3FXM A;  2Y9Z A;  4HF2 A;  3CCQ I;  4BDY A;  2K4B A;  2DT5 A;  2ZSI B;  3K9T A;  4D1Q A;  1SD7 A;  2IP2 A;  2ZXJ A;  4CCL A;  2DDB A;  3SQN A;  2MC4 A;  1N75 A;  2FX0 A;  3HHG A;  1LEB A;  5L3F A;  3VB2 A;  2DOE A;  1YOV B;  3CLO A;  5FKL A;  3HOW J;  3WTU C;  4J01 A;  2CFX A;  2CV0 A;  3GVA A;  1RIO H;  2M1B A;  1NK3 P;  1IDY A;  2QQ8 A;  2PMZ A;  2DDA A;  1FIP A;  5DCM B;  3HGY A;  3HM5 A;  4Q4Z F;  2DA3 A;  3BR2 A;  3HYI A;  4B8X A;  3OYK A;  1EJ9 A;  1XDU A;  4LB5 A;  2XPU A;  1FTT A;  2LSO A;  5CYV A;  1OCZ H;  2K40 A;  2QQA A;  1ZN2 A;  3PFY A;  5LGU A;  5FKO A;  4KA4 A;  4R8H A;  4C2U A;  2UZK A;  4AIK A;  2JMW A;  4ENN A;  3IUO A;  1X3U A;  1X1D A;  3W6V A;  1T38 A;  5EZG A;  3H3U A;  2AHQ A;  2BE5 F;  1K7A A;  4PJ0 C;  1W7P D;  4QPQ A;  4YFK F;  5DD8 A;  1I3Q J;  3GFJ A;  4CDG A;  4OOI A;  4ABZ A;  2NVT J;  4NB5 A;  3I4N J;  1QO0 D;  2L4A A;  5C4X J;  3CLQ A;  4XK4 A;  3ABU A;  3FXL A;  4I98 B;  1IG7 A;  5M3M J;  3H5A A;  3M8E A;  3ZMZ A;  2P81 A;  2KKO A;  3IH3 A;  3KX2 A;  2DT6 A;  3FK7 A;  2FNA A;  2L0K A;  2RNG A;  2WAF A;  1RUO A;  4JYK A;  3CMM A;  1LDD A;  3RPU D;  1AWC A;  4XOP A;  5J8C A;  4E4H A;  3BJO A;  3CP8 A;  2EWN A;  1U9O A;  1IGN A;  2G7H A;  2PBI A;  4HQE A;  3T5X A;  4JX4 A;  3RPQ A;  1JKQ C;  4MEX F;  5DTD A;  1RR7 A;  3SFZ A;  3GUD A;  3RSN A;  2M7A A;  3A0B C;  3CCS I;  4MGR A;  3KZZ A;  1MBG A;  1YRN A;  2DOF A;  3BTC A;  3M7G A;  4N9I A;  3JAM Z;  1XGN A;  3W2V A;  4EEF G;  2DMQ A;  2F5C A;  1T2K A;  3HUG B;  3K4K A;  4RS8 A;  4BAC A;  5F1J A;  2X4H A;  4AID A;  5JR3 A;  2L7Z A;  4V2F A;  4A3I J;  1XGS A;  5DM7 F;  3D5R C;  3EYI A;  3R6S A;  4F55 A;  2CV1 A;  4JP0 A;  1MNE A;  1AA7 A;  5HDN A;  2OU2 A;  1U8R A;  2VPL A;  2B9S A;  2PX9 A;  1QZY A;  5IT9 Z;  4XIC A;  3AAF A;  1F43 A;  5BOX A;  4RB1 A;  2STW A;  1X1B A;  4DYQ A;  3GME A;  1DU0 A;  3EUA A;  4OWR B;  3MWM A;  2R7V A;  2MYS A;  3K4B A;  2CMP A;  4D5C A;  4EM1 A;  2ESH A;  2VL8 A;  5E3N A;  1A04 A;  1BOB A;  1QA6 A;  1TL8 A;  1L0O C;  1DU6 A;  2H94 A;  2LY9 A;  2JA8 J;  5D5X B;  1RRJ A;  3ZMU A;  4KIT B;  2W85 A;  3CJT B;  4A5N A;  2E2H J;  5CPR B;  2BHY A;  1W4M A;  2WV1 A;  4IOA F;  1R7J A;  2ME6 A;  3GO5 A;  4X6A J;  2JZY A;  1TNS A;  3IWZ A;  3VEP A;  1D0X A;  3DEE A;  3DCF A;  5FKM A;  2LY1 A;  4KN4 X;  2VBW A;  4IO9 F;  2VQC A;  1ACI A;  1J0R A;  3K4C A;  5H2F C;  4RB3 C;  3HB9 A;  3J7A O;  2V4J C;  4CCJ A;  1MMN A;  3S3M A;  5EYR A;  2X0L A;  6PAX A;  3SJM A;  1IXS B;  3IKV A;  2R5Y B;  1UMQ A;  4BJT A;  3HOT A;  2GIZ A;  4XMY A;  2DA4 A;  1R1U A;  1ZH5 A;  5AON A;  3DBR B;  1N25 A;  2A68 F;  1O3T A;  2NVX J;  4XSZ F;  4ENK A;  4A3C J;  1EA3 A;  2J5O A;  2HOS A;  4HDV A;  3X2Q H;  1UJ8 A;  2LYC A;  2X6X A;  3UKG A;  1RKW A;  4LK1 F;  4Y7N J;  1I50 J;  3BCA A;  2QQ9 A;  4FCY A;  3K1M A;  5TGT A;  1W7P B;  3JSP A;  1BIA A;  3JRH A;  1K78 A;  2O9L A;  4HV5 A;  2KIM A;  1X1C A;  3QRF F;  2E2J J;  2CQQ A;  2R7Z J;  1VQ5 I;  1QNT A;  3Q9V A;  3DBL B;  3GFI A;  2FXA A;  3DXJ F;  4V19 K;  2QSF X;  2QEN A;  2A6T A;  2WY8 Q;  2KMU A;  3R4K A;  5FKK A;  2VI6 A;  2OZU A;  3T8T A;  3ELK A;  1MZB A;  3HOU J;  3IC7 A;  1U2W A;  3QAH A;  2NXN B;  1FMW A;  1Y8Q B;  2UV1 A;  1O3R A;  1EH8 A;  5IP7 J;  4S0H B;  1XGM A;  3TOB A;  2FQ4 A;  4HSR A;  4JOM A;  1RR8 C;  1KQ8 A;  2HQA A;  3Q0U A;  4CUG A;  4CGZ A;  2DI3 A;  1D5V A;  4ETS A;  2XKP A;  1D8K A;  1P9Q C;  2M3A A;  5IT3 A;  1TC3 C;  4M9Z A;  2DBB A;  1FC3 A;  2GAU A;  4N4O B;  3ZMD A;  2EFN A;  4CYC A;  2Z33 A;  2IS2 A;  2R5Z B;  4XRS A;  1DGW Y;  3LSG A;  2JVG A;  1JKO C;  2GM4 A;  1D3Y A;  5AIQ A;  2GZW A;  4GFB A;  4BQQ A;  4KT6 A;  2KLO A;  3TW6 A;  2V1N A;  3HSE A;  2FF4 A;  3UNG C;  1WJD A;  2GXG A;  3WOD F;  2M7B A;  2LY2 A;  2V9P A;  5ILU A;  3HRU A;  2BYV E;  2L5Q A;  1Z9C A;  3LSJ A;  2XAU A;  2KFD A;  4M72 A;  2DFI A;  4DW6 A;  1ULY A;  1MIJ A;  4AIH A;  3S1R J;  3E1S A;  5M5W J;  5DM6 F;  3P5J A;  2VE9 A;  3K7A J;  2R0Q C;  1FIA A;  2DA7 A;  2K4J A;  2WAQ A;  2TCT A;  5C44 J;  1STZ A;  2R7D A;  2V7F A;  1IV6 A;  3NWT A;  3SYT A;  1P7J A;  4M6X A;  4ZDP A;  4XQF A;  1APL C;  4A3E J;  4HX8 A;  3F0C A;  3O8H A;  5EGO A;  3PQJ A;  4GGG A;  3CF5 F;  3OYE A;  2QGU A;  1MJ9 A;  3TKY A;  1JTY A;  3E5Q A;  5LHG A;  3IV5 A;  1TT5 B;  3HRS A;  4NQW B;  3HDD A;  2CJJ A;  3BT9 A;  1QVU A;  3GXO A;  3ZMT A;  2HQ5 A;  1B8I A;  3GTG J;  2B7E A; 
#chains in the Genus database with same CATH homology
 5JVG F;  5GAD J;  3CCU I;  4UY8 I;  2ZJQ F;  3CCL I;  2FOW A;  3CC4 I;  1S72 I;  2E35 A;  2OTL I;  1VQL I;  3J7Z I;  1VQ6 I;  3DLL F;  3CC2 I;  3I55 I;  1FOX A;  3CME I;  1VQ5 I;  4V19 K;  1VQ7 I;  1VQP I;  3CCS I;  3G4S I;  2NXN B;  1Y39 A;  3CCJ I;  3CC7 I;  2E34 A;  5GAG J;  1YI2 I;  1VQ4 I;  1YIJ I;  5DM7 F;  3CCR I;  1HC8 A;  2ZJR F;  1YJN I;  3J7Y J;  2H8W A;  2ZJP F;  3G71 I;  3CCQ I;  3PIP F;  2K3F A;  3CMA I;  2OTJ I;  1YIT I;  2QEX I;  1QA6 A;  3CD6 I;  3CJT B;  5DM6 F;  1FOY A;  3CCM I;  1VQ9 I;  4IOA F;  1FOW A;  5GAH J;  3G6E I;  1VQ8 I;  1VQO I;  4IO9 F;  2JQ7 A;  1YHQ I;  2E36 A;  1ACI A;  3PIO F;  3CF5 F;  2QA4 I;  3CCE I;  4IOC F;  3I56 I;  3CCV I;  1YJ9 I;  5GAE J;  1MMS A;  1VQK I;  1VQM I;  1YJW I;  1VQN I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...