2OQGA

Arsr-like transcriptional regulator from rhodococcus sp. rha1
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
109
structure length
109
Chain Sequence
GMTVGTYAELASVFAALSDETRWEILTELGRADQSASSLATRLPVSRQAIAKHLNALQACGLVESVKVGREIRYRALGAELNKTARTLERIGAEWDRRLAAIKQIAESM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Possible transcriptional regulator, ArsR family protein
publication title Crystal Structure of the ArsR-like Transcriptional Regulator from Rhodococcus sp. RHA1
rcsb
source organism Rhodococcus sp.
molecule tags Transcription
total genus 40
structure length 109
sequence length 109
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12840 HTH_20 Helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2oqgA00
3PQJA 2DBBA 2HKXA 3CUQC 3M8FA 1O57A 4Q4ZF 1U6GA 1ZRCA 1KU7A 2XV4S 4L9NA 4EJUA 5H6QA 4N9HA 1BI3A 3HTSB 5D8LB 1QNTA 2WV0A 2QM3A 4EMSA 2M30A 3L9FA 4AIJA 2VBWA 2DK5A 2QVOA 1MJAA 2V9VA 5LGTA 4KMFA 1P4WA 5HDNA 4CGZA 1D3YA 1QPMA 3L09A 3TDUC 1DUXC 1A04A 5L3EA 4HF2A 1L0OC 3N4MA 4R79A 1ON1A 2Q8KA 1V3FA 1D8KA 4I01A 2Q2EA 2MA3A 2DLLA 3IRRA 5K5RA 4HV5A 1FYLA 2QYOA 3DQVC 2LF7A 5DCFA 3W6JB 4PCQA 3ELKA 2FOKA 1W7PD 2EA4A 2EV6A 3U9GA 3H92A 1WSUA 1ZLJA 3RI4A 2VONA 2L01A 3NEUA 4FHTA 2XKOA 1IW7F 4AIHA 2D1VA 1TQPA 1G4DA 3F8MA 1P92A 1SD5A 1R1TA 3HRMA 1IZ1A 2XAGA 4RGUA 2FE3A 1ODDA 4RGRA 1XDSA 4OIRF 3BWGA 4KICA 3DKWA 1P4XA 4HF1A 2W24A 4OOIA 4IRIA 4JBAA 1LDJA 4IHSA 5LLQA 5L3GA 5LHHA 4B09A 1R36A 2HFHA 2JPCA 3G73A 4BHBA 4LB6B 3JW4A 1J59A 1JHFA 2KIUA 4EGZA 2A61A 1F1ZA 1YW7A 3OOPA 5F1RA 2ACJA 2HKOA 2EV5A 3ECOA 1S8NA 4MTDA 2HTJA 2GQQA 2VC1A 3R61A 4ZYDA 1KQ0A 1JE8A 3ZPLA 2W85A 3COAC 1STZA 4IXAA 1ZREA 3IWZA 4S04A 1I27A 1YQAA 3HOSA 4RAYA 1HKSA 4L18B 1S29A 3JTGA 2EV0A 3F8NA 1HKQA 5JHUA 4HF0A 1IF1A 2DFIA 1ZG1A 3ML6A 1FX7A 3ZMDA 2FMYA 1G3WA 1R00A 5IT3A 2O6GE 3MWMA 1J7KA 3B73A 4LG0A 1ZHFA 4PDKA 4G6QA 2MH9A 4EJWA 2P6SA 5FO5A 1O3TA 2H09A 2FU4A 2BEOA 1U8RA 4GCVA 5FGMA 2A68F 1YTYA 4A6DA 2FQ3A 2HYFA 4EGYA 4HX7A 3IKVA 3R0JA 3GZ5A 3NQOA 1R1VA 2K86A 3TO7A 4RB3C 2A5YB 4KMUX 1BC8C 3TDZC 3RKWA 2DQRA 1H9GA 5L3CA 1B4AA 2NAZA 4OU0A 5DYMA 1AOYA 1LDKB 3QPHA 1ON2A 3F22A 2QLZA 4MEXF 1PP8F 3KLNA 5HVQC 3IKTA 3QOPA 2D1HA 3FX3A 1HSTA 3WTXC 4XSXF 4WF2A 1U5TB 2R7FA 3MAJA 1LDDA 1O3QA 4WX9A 1X3UA 2L4MA 4G7ZF 3DV8A 5K5QA 3V7SA 3GFLA 4KA4A 3K1MA 3ERED 1ZH5A 2O8XA 5D8KB 2ZCWA 5E18F 3CO7C 4G7HF 1SAXA 1ZGAA 4I0AA 2RQPA 3PFIA 3WE3A 3QAHA 1YYVA 4HDVA 4HQEA 4ZYHA 2JTVA 3DXJF 3O3KA 3FWEA 2MD5A 1R22A 2WTEA 2VE9A 1XB4A 2P5VA 1KQ9A 5LGUA 4BXUA 1P6RA 3J80Z 4EQQA 4XRFA 3SFZA 4D0PA 4IF4A 5CVRA 3V7RA 1MD0A 3B02A 1Z9CA 2HYGD 3I58A 5LRSA 5J6XA 1XGOA 1YW9A 4E70A 3L7WA 4LLNA 4A6EA 1SD6A 5J8CA 1XDUA 3FM3A 3GXOA 2ZXJA 5DUIA 4WXCA 4IPAA 1HKTA 3R0AA 1DPUA 1T6SA 2ZMEA 3I0TA 4HX8A 2P7VB 4IHTA 2M5WA 1MGTA 5F6FA 5BS6A 4CYDA 1RUOA 2FMLA 5J8FA 1FZPB 5HLGA 4KIBA 4OIQF 1E17A 4G6DA 3MEXA 3GFMA 5HDGA 3W6KB 2FRHA 1YW8A 3EETA 3D0SA 1HXDA 1QO0D 4KFCA 5AIQA 2IRFG 2FBKA 2HQRA 3BJAA 4HZFA 2LNBA 1S6LA 1Z91A 1HSJA 3Q9VA 4OIPF 1Z6TA 2V6CA 4P9FA 2CGPA 2MLGA 1FSHA 1J0RA 2EFNA 4M6XA 3WTVC 2FNAA 1JXSA 1FOKA 2AXLA 2K4JA 2RKHA 5LHIA 1IAWA 4UV9A 3JAMK 3QP6A 2XASA 2UZKA 4EJTA 1FLIA 5D6FA 1HBXG 5LEKA 4L9TA 3GVAA 3KFWX 3KP5A 4YFNF 4G8XA 4JQFA 3O6BB 4WK8F 4LGWA 4N9IA 3AAFA 5TRDA 1E2XA 4A5NA 2E1NA 3L2CA 2XRNA 4CHUA 5JVTA 2NNYA 2KKOA 1MJBA 3FXRA 3I59A 4CXFA 4LLGF 4L0YB 1BM9A 1F9NA 1PP7U 2F5CA 2M8EA 2L3DA 1K78A 4GYGA 3RJPA 2MBFA 2IA2A 2RVCA 1TQIA 3WTWC 2BBYA 3E6DA 4UVBA 3T0YA 2A3SA 1LEBA 1B59A 5ICEA 2CFXA 4GO1A 4ESJA 4PGHA 2HGCA 2ZFWA 3FXUA 5KK1A 2EFWA 1SD7A 1USTA 4CO8A 5HLIA 3HOTA 3TO9A 1SFUA 4EJOA 1XGNA 2KRFA 1TNSA 2QENA 4R8HA 4LG0B 3HUGA 3E3VA 4EM0B 1YO5C 2VT3A 3R4KA 3V4GA 5DDGA 3E6BA 5ILVA 4XLNF 1ZN2A 1EV7A 1RI7A 2PMHA 3LA7A 1XGMA 2VC0A 4JK1X 2TDXA 4KIGA 1B1BA 3KP4A 3WTUC 1FP2A 4UVAA 2QQAA 1OPCA 2NNNA 4YIFA 2XROA 2Z33A 1LVAA 4L9JA 4LK1F 1R7JA 3RIRA 2FBIA 1BOAA 2KJCA 2ETHA 2CWEA 3E6MA 1IRGA 5L3BA 4HQMA 4I02A 4YG2F 1KU9A 2P5KA 3HSFA 2O3FA 4KN7X 2VOPA 4G94A 1XGSA 3P7NA 3BOQA 4R1HA 3K0LA 3VODA 1MDMA 2DU9A 1IXRC 2FNPA 5E1XA 1ONVA 2DI3A 2GZWA 5H6RA 2Z99A 3SZPA 3K1NA 5EEGA 2STWA 1DP7P 4XBFA 1SFEA 1CF7B 4O5VA 4MQ9F 3C3WA 5CVUA 1OMIA 5D4SA 2KJBA 3VEPA 4OMZA 2EA2A 1UFMA 1XCVA 2YU3A 1S7OA 2COMA 3WE2A 3IC7A 1H9TA 4LB5A 3ZMZA 1TNTA 2CO5A 1IN8A 2YX7A 3QP5A 4O6JA 3MZHA 2Y48A 2F2EA 1YIOA 2XAJA 4U0WA 3GF2A 4Q47A 4LD5A 1FWZA 4ZZDA 2UXNA 5HS7A 5BPDA 1Y0UA 3F3XA 2DAOA 1QZZA 4M9XA 2VT2A 4RB1A 1MZBA 5F64A 3FMSA 2L4AA 4HW0A 4L5JA 5HS8A 4M9ZA 5KVRA 1IN5A 4P55A 1ZG5A 3FXQA 4BQAA 1XD7A 2STTA 2ZMEB 2P4WA 1ZAOA 2CQKA 3M1EA 4A0YA 4EM2A 1Z1DA 4M71A 5AIPA 3WU0A 2O0YA 5DV5A 4P5OA 2X0LA 3CO6C 2IPQX 3RPQA 2R3SA 2ZKZA 5CYVA 2MC3A 2G7HA 3H3UA 3KCCA 2M87A 3J81K 1G3TA 4UV8A 4AWXB 3RTRA 3I4PA 1RUNA 2D2WA 1SMTA 3KLOA 5LGNA 3EDPA 1U78A 5ILSA 3HSRA 5HLHA 1KA8A 2DT5A 1U5TC 1O3SA 5D5UB 2KIFA 3FMRA 2VBYA 3N97A 2ESHA 4I0BA 1S3JA 1T98A 2DPDA 2H6BA 3ZMSA 1IN6A 3ISPA 1PDNC 5FFZA 2VBZA 3DFGA 2BE5F 2P8TA 2RN7A 1R23A 4HA8A 3ZN0A 2UXXA 1J75A 3I5UA 2W57A 2GA2A 2O03A 3M9AA 4XSZF 2QBYA 2M45A 3F72A 4S05A 4EJVA 4HBLA 4WCGA 1IUYA 2A69F 3CUOA 4ENKA 2LDUA 5FB2A 4HLYA 2H94A 3K9TA 3I53A 3I59B 3VOEA 3WODF 2OQRA 1YFHA 2QQBA 3V7CA 3DPLC 2X4HA 5DEQA 2VXZA 1YS6A 5LBQA 1K78B 2HWVA 4P96A 2K4BA 1FPQA 4G7OF 1B9MA 2CSOA 3BDDA 1I5ZA 2PN6A 1R1UA 4FT8A 1I1SA 3CTAA 2Z3YA 5L3DA 2V79A 3MCZA 3F21A 3HTUA 1UB9A 1K6OA 2FF4A 2IA1A 3JAMZ 4F7ZA 4ON0A 4CDGA 5BMZA 1KU3A 1MKMA 3GX4X 2L02A 3BJ6A 4YFXF 3ROUA 3EYYA 2PMUA 4GXOA 2RC4A 4MNUA 2HEOA 1XSXA 1EH8A 5L3FA 3U2RA 5TJJA 2LF8A 3O2PE 3FF5A 3BPVA 1SFXA 4QWQA 5AONA 2QQ9A 5BOXA 4CZZA 5JR3A 5D5XB 1UHWA 1BBYA 1V4RA 2KIMA 1U3EM 5IT9K 3F8CA 6PAXA 1BIAA 1YLFA 1T39A 3CUQA 4LMYA 1KU2A 2Y0MA 3ZMTA 2JSCA 5EEHA 5A2QK 1MDMB 1XMAA 3T8TA 1BI2A 3FMQA 1BJAA 4DQ2A 2VBXA 3ZMVA 4AVPA 1AWCA 4HYEA 2CYYA 3MQ0A 4KT5C 2J5OA 3ULQB 3EQLF 2EFQA 2FXAA 2PEXA 1D5VA 4NB5A 4M9SA 4YIIA 1J9IA 2PI0A 4KDPA 4Q48A 2IA0A 1LNWA 4AD9A 2YSRA 2XGXA 5FFXA 1R58A 3RDIA 1OYWA 5E20A 3BPXA 5E17F 3Q5FA 4K2EA 1C0WA 3GO5A 4WXHA 4HOBA 2NRAC 3LFKA 3DF8A 5E8GA 4ESBA 4ZZLA 5CVVA 3D5LA 4ZH4F 2K27A 1IXCA 3ABTA 3KP7A 2HZTA 4Y15A 4CICA 2AS5F 3BROA 5D6EA 1FY7A 1K7AA 4HLXA 5HOOA 2WC2A 4XLPF 3RYPA 5K1YA 1DPRA 5ICFA 1QQIA 1I6XA 5ICGA 3SXYA 2DK8A 4H0EA 3E6CC 3VB2A 1QGPA 1KYWA 3HRTA 2JZYA 4UVCA 1LB2A 2DTRA 1SMYF 4A2UA 3SHFA 3NRVA 1TW3A 2OD5A 1QBJA 4BHPA 2NYXA 2O61A 3HSEA 3WGHA 5HDKA 1T38A 1DDNA 3T8RA 2XAQA 1XCBA 2Z5UA 3L00A 4I7HA 2A6EF 3TQNA 4EVIA 2ZJ2A 2NS0A 2B0LA 2W84A 4L5IA 2OZ6A 5CVIA 2HQNA 4NQWA 4P9UA 2QUFA 1UCRA 3KP6A 2BGCA 1ZYRF 3M7GA 4A5MA 3KE2A 1YG2A 3TO6A 3E97A 3FZVA 3JSPA 3E5QA 1NHAA 3RPUA 2QBYB 1XN7A 1U5TA 3P9CA 4UNOA 4Y17A 1LQ1A 1ZLKA 1FSEA 1JHHA 4ETSA 4GGGA 2RDPA 3LSTA 5LEJA 1ZG3A 4A0XA 3J81Z 5DCMA 1W7PA 4M73A 5CJ9A 4L9VA 3DEUA 1P2FA 1Z05A 4FX4A 4IJAA 1WKMA 3F8BA 2K7LA 2ISYA 3KETA 1W5SA 4BYYA 3GFIA 1Q1HA 3WGGA 3K1PA 4BAYA 2DW4A 5FD5A 3KP2A 2IW5A 4U7DA 2ZO4A 4BNCA 2M1BA 2XUBA 3GYHX 4WWCA 3WTSC 3S2WA 4ASNA 3F23A 4O3MA 5H20A 1LJ9A 4A0ZA 4G9YA 5JFRA 3QPTA 1XMKA 1USSA 3C1DA 1FYMA 3HYIA 4M72A 3T1BA 3I71A 3HRUA 3E5XA 1IRFA 3JTHA 3GWZA 1Z7UA 5CLSA 5FLXZ 4UXNA 3LAJA 5ILUA 3HRSA 1GXQA 1FNNA 2FBHA 2PBIA 3QRFF 5BQTA 4IVNA 2PLYA 2V1DA 4RB2C 3V8JA 3HHGA 1F5TA 3CJNA 4Z2YA 3WU1B 1O3RA 3KZYA 3VFZA 3CUQB 2F5DA 1FBUA 3HIFA 4N0BA 4RGSA 4ESFA 1U2WA 5DUKA 3PQKA 3GZ6A 2V1UA 1FP1D 1W4MA 2GIVA 1WQ2A 1OYYA 1BI0A 5E1WA 2P7CB 1HW1A 3F8FA 3LA2A 2GWRA 4ENJA 2H27A 3C18A 1UHMA 2ESNA 2GAUA 2G9WA 2RNJA 3BJOA 2LSOA 1PUEE 1W5TA 2CW0F 3P9KA 4IRGA 4RB0A 5IT9Z 3IWFA 3SZTA 1SD4A 5HS9A 3WG9A 2EWNA 2VODA 4WXDA 1BI1A 2RGVA 2ZBKA 2C6YA 2YR2A 3GLXA 3FM5A 4ZYGA 3ZQ7A 2E7WA 2FA5A 4RAZA 3BP8A 5A2QZ 4ENMA 1MJ9A 3ECHA 3T5XA 3J7AO 2EFPA 4TV7A 5BPIA 2J5PA 3BZ6A 3DP7A 1G3SA 5K5OA 3RKXA 2YPRA 5D5WB 3IRQA 4AIKA 4NHJA 2ELHA 1J5YA 1ZRFA 1FT9A 5LRRA 3WTZA 3CLOA 4PZJA 4MTEA 4M6YA 3OV8A 2JRTA 1T2KA 2UWMA 2HS5A 2WWYA 4HAMA 2YX4A 2LKPA 2D45A 1G3YA 4UHTA 4KNYA 5FLXK 1VTNC 4I09A 4IRHA 2H6CA 3ZN1A 1T0FA 3DPTA 3REOA 3R6SA 4U0YA 2OQGA 3ZMUA 5ICCA 2VOOA 2XAHA 1TW2A 2QZ8A 4QLCU 2K02A 2VN2A 3H3ZA 4BHCA 5FD6A 4KYWA 4MHGA 4RS8A 2ISZA 3WTTC 3LQQA 2DO7A 2ZNYA 3QU3A 1R5GA 3F6OA 2EJRA 3U1DA 1GXPA 2VE8A 3P9IA 2IT0A 1O7LA 2W25A 4PGGA 2Q0OA 2IP2A 1ZARA 2XAFA 2EK5A 4OINF 5DD8A 3JSOA 3IHUA 4ENNA 3K69A 2ADUA 3GFJA 1BC7C 3MZYA 2CG4A 1TQMA 3EUHA 1IXSB 1CF7A 1TBXA 2PFBA 3K2ZA 4U7BA 2OZUA 1F4KA 5DCMB 1W7PB 3KP3A 4MEYF 2A07F 1L3LA 1WRJA 1GHCA 2IJLA 3CDHA 1ULYA 4HX4A 2XKPA 2MLKA 2PQ8A 3MFKA 3RKYA 4B8XA 4OMYA 3G3ZA 1XSVA 4MQVA 2L54A 2GXBA 4LLLA 2XVCA 5JI6A 1FBSA 4I2OA 1ZRDA 3Q9SA 2DQLA 1RZ4A 2V1XA 1FYKA 2HR3A 1KYZA 2RV8A 4U88A 3FHZA 2F5FA 2G7UA 3KEOA 3R60A 3EYIA 1XSDA 4RGXA 1EH7A 5LHGA 5D5VB 3M8EA 1FBQA 4LJZF 3WTYC 1TTYA 1WWXA 1Z6RA 1QZYA 4FX0A 3HHHA 4LFUA 4ZYEA 2BV6A 3WGIA 4EV0A 4I98B 1JGSA 4OIOF 2FSWA 5ED4A 1R5HA 3GEZA 3BY6A 2P6TA 3TOAA 3LWFA 2HOEA 1OYIA 2OBPA 3KEQA 4M74A 1I1GA 3LQRA 2PJPA 4UUVA 1IN4A 4KN4X 1YS7A 1O7FA 3KZZA 2E1CA 2F5EA 3TGNA 4GYIA 1RIOH 4KIFA 5CVJA 2P5LC 2DPUA 2Y75A 2A6HF 4L0ZB 3TKYA 1KQ8A 4Y13A 4MGRA 4LK0F 2Z9OA 2EB7A 3TOBA 2R7DA 1G6NA 1LEAA 2PG4A 2QWWA 1IN7A 1HQCA 3V8LA 2GA1A 1RNLA 4A12A 1B9NA 1S7AA 1ZGJA 3GUDA 3I64A 5DD4A 2HDCA 1HW5A 3LA3A 4HV6A 1EH6A 2E7XA 2XHKA 1GVJA 1WI9A 2FEZA 2MH2A 1D8JA 3RYRA 2EFOA 1K79A 4DNCA 3LAPA 2BYVE 3ABUA 3J80K 5E1ZB 1OR7A 5D4RA 1REPC 2JT1A 4EM1A 2GXGA 1CGPA 1P4AA 1TLHB 2JPBA 2OA4A 3QU6A 1FC3A 3E5UA 4HDUA 3SQNA 3I54A 1B6AA 2OU2A 4U0VA 1H0MA 4KUMA 4BH9A 1OKRA 3C7JA 5ERIA 1KGSA 2OAZA 2HTSA 2IVMA 3GW2A 5E8IA 2XIGA 1HW2A 4YFKF 3IL2A 2ZNZA 1BIBA 3F6VA 4Q5SF 1J2XA 3V8KA 3ZP5A 1BN5A
chains in the Genus database with same CATH superfamily
3PQJA 2DBBA 3IH4A 2LG4A 4CA0A 2CRGA 2HKXA 3FIWA 3CUQC 3M8FA 3VYTB 4B43A 3L1PA 1BW5A 5FRNA 4JX5A 1IRZA 1O57A 4Q4ZF 1U6GA 1ZRCA 1V5FA 1KU7A 2XV4S 4L9NA 3Q3SA 1UMQA 4F55A 4EJUA 5H6QA 1SAUA 1NH3A 4N9HA 1BI3A 3HTSB 2VB6A 1IRXA 2M2EA 3K2AA 3LMMA 1Z3YA 5D8LB 2XSJC 4Y52J 2M34A 1QNTA 1Z7LA 3RQ4A 2ZMEC 4XM3A 2WV0A 2QM3A 2AQFA 4PUSA 1YITI 4EMSA 5HNHA 2M30A 5M5YJ 3L9FA 4IX7A 2CQQA 4AIJA 1O4XA 2VBWA 2DK5A 2QVOA 1MJAA 1X58A 2V9VA 1MIJA 5LGTA 4J01A 3TL4X 5EZHA 3K10A 2QSHX 4KMFA 3DU5A 1LUJB 4M6VA 1P4WA 4YRVA 5HDNA 4CGZA 5F0HA 2DJNA 1D3YA 4XKWA 3D1NI 1QPMA 3L09A 3TDUC 5IPAA 4Y7NJ 3A1YA 1DUXC 4E6KG 1A04A 5L3EA 4HF2A 1L0OC 3SDBA 3S2DJ 4LG3A 4DW6A 1IC8A 3H0GJ 3RPUD 3N4MA 4R79A 1ON1A 2Q8KA 1V3FA 1W0TA 1D8KA 1A6QA 1YJNI 3CCMI 4I01A 2Q2EA 2MA3A 3K4CA 2DLLA 3IRRA 5K5RA 3KX2A 4HV5A 3LFUA 1FYLA 2QYOA 4HNUA 3QYBA 3DQVC 2M0CA 2LF7A 5DCFA 3W6JB 4J19A 2R7XA 2EIKH 3CJRB 4IHYA 4PCQA 3ELKA 2FOKA 1W7PD 2H8WA 3CC4I 2EA4A 2HPMA 4PFPA 2LVSA 3KIOA 1N75A 5F0FA 4M3FA 1WJDA 2EV6A 2VI6A 1QHGA 3U9GA 2L2OA 3H92A 1WSUA 1ZLJA 2LYCA 3RI4A 2OPTA 2KRCA 2VONA 2L01A 3NEUA 2BW3A 4FHTA 2EIJH 4IEJA 2XKOA 1IW7F 2LREA 3FDYA 4AIHA 2QSGX 2WV1A 2D1VA 1TQPA 1G4DA 3F8MA 1P92A 1SD5A 3HC7A 3O8GA 3VYRB 1R1TA 3DTEA 3ZQCA 4IQ4A 3A01B 3HRMA 1IZ1A 1MSFC 3FISA 2XAGA 4RGUA 4CCKA 2VQCA 2FE3A 1ODDA 5GADJ 2CH0A 4RGRA 2GBYA 1XDSA 4OIRF 3BWGA 3IUOA 4KICA 3ZR8X 3DKWA 2EZHA 1P7JA 1P4XA 4NDLA 4HF1A 4IHWA 1I3QJ 2W24A 4OOIA 3I56I 1DGWY 2LR8A 2MFZA 4IRIA 2BXZA 9ANTA 1DP3A 5FKLA 4JBAA 3OR1C 1LDJA 3PNVA 4IHSA 1D0XA 4XRSA 5LLQA 1EA3A 5L3GA 5LHHA 3JRBA 1X1AA 4B09A 1R36A 2HFHA 2MABA 4I99C 4XLEA 2JPCA 3G73A 4II3A 3PJRA 3PO3J 3A02A 4BHBA 3ABMH 2X85A 4XOPA 2X1EA 4LB6B 3CMEI 4BDYA 2BVMA 3JW4A 3HL2A 2QEXI 3W2AA 2ZSHB 1J59A 1JHFA 2KIUA 4EGZA 2A61A 1F1ZA 1YW7A 2VLAA 2R5ZB 4AIDA 2E60A 3AG2H 3OOPA 1JKQC 2KQRA 1WCMJ 2VKHA 4AC0A 5F1RA 3GTMJ 1EF4A 4XN0A 2ACJA 2LY1A 2HKOA 3PUFA 1HLVA 2EV5A 3I9V2 3ECOA 1S8NA 2BZTA 4MTDA 3BG5A 2HTJA 2GQQA 3IP4B 3FKJA 2VC1A 3R61A 4ZYDA 1KQ0A 1WJ5A 1LFBA 1JE8A 3ZPLA 2W85A 3COAC 1STZA 4IXAA 1ZREA 2VJ4A 4HG2A 4BGDA 3IWZA 4S04A 1I27A 3FK7A 1YQAA 3BTJA 3HOSA 2XF6A 4RAYA 3W3CA 1BW6A 1HKSA 4L18B 3VYUB 1S29A 3JTGA 3W2VA 1WJEA 1FJLA 1YJWI 2EV0A 3ZCOA 4P1WA 3F8NA 4GRIA 3ASOH 2W1OA 3FXMA 1RRJA 1HKQA 5JHUA 4DZPA 5F04A 3J7ZI 4HF0A 1IF1A 2DFIA 4HSTA 2R0QC 1ZG1A 3ML6A 1FX7A 5GPAA 3ZMDA 2FMYA 1MMSA 2TCTA 2L9VA 1G3WA 2R7WA 1R00A 5IT3A 1W0UA 2ZJQF 2NOJB 2M4GA 2O6GE 2WAEA 3MWMA 2DMPA 1J7KA 1OCTC 3B73A 2WAQA 1IV6A 4LG0A 2NXNB 1ZHFA 4DBRA 1JTYA 5J47A 4PDKA 4G6QA 2ME6A 3RKQA 2MH9A 1K83J 3VYSB 4EJWA 1I39A 4C3IJ 2R7QA 3RZOJ 2P6SA 4XIDA 5FO5A 1O3TA 2H09A 4AYBN 3E0JB 3BR1A 2FU4A 2H8RA 1U0JA 4C30A 2BEOA 1U8RA 2JA2A 2NOGA 4GCVA 5FGMA 2A68F 1YTYA 4CCLA 1SANA 2KIQA 4A6DA 2FQ3A 3JRFA 1WPKA 3BT9A 2HYFA 2E5ZA 4C2MJ 4EGYA 4HX7A 3IAS2 3IKVA 1GV2A 3R0JA 3GZ5A 3NQOA 4NUBA 1R1VA 2K86A 2DOEA 2JA8J 2ZXHA 3TO7A 1FMWA 2E2JJ 4RB3C 3BG9A 4BEHB 3MVPA 2A5YB 4KMUX 5M3MJ 4A3JJ 1BC8C 3TDZC 3CESA 3RKWA 4XORA 2DQRA 2L0KA 1H9GA 1R6RA 1V54H 5L3CA 1B4AA 2NAZA 4OU0A 5DYMA 1AOYA 1LDKB 3QPHA 4JOMA 5M5XJ 1D0ZA 3OL3A 4EEFG 1ON2A 3F22A 1HOMA 1Y56A 2HXIA 2QLZA 4MEXF 1PP8F 3KLNA 5TGTA 3K4KA 1XPXA 2O7OA 3BG3A 5HVQC 3IKTA 3QOPA 2ZB9A 2D1HA 3DKYA 2X51A 3FX3A 3CCRI 1TWFJ 1HSTA 2E19A 3WTXC 2JK3A 1XTAA 4XSXF 3HGYA 4WF2A 2DFEA 4XK4A 4QPQA 1U5TB 2CUJA 2R7FA 3TW6A 3MAJA 1LDDA 2AXTC 1O3QA 4WX9A 1X3UA 2L4MA 2L7KA 3AG3H 4D9JA 1TL8A 1JKPC 2K9SA 4HNVA 4G7ZF 5BNGA 4CCNA 3DV8A 5K5QA 3V7SA 3GFLA 4KA4A 3K1MA 3JRHA 3ERED 2IEKA 4N4NB 1ZH5A 2O8XA 4B4CA 2PJRB 3JR9A 5D8KB 4GFBA 2ZCWA 5J1YA 5E18F 3CO7C 4G7HF 3OSGA 1SAXA 2EBIA 3J7YJ 1ZGAA 4I0AA 2RQPA 3PFIA 3WE3A 3QAHA 1YYVA 4B44A 4HDVA 4HQEA 4M3DA 4ZYHA 2JTVA 1DGRM 3DXJF 3O3KA 1HCRA 3FWEA 1R4MB 2MD5A 3OIPA 4H4KC 1Y8QB 1RPWA 4KJZA 1R22A 4C2TA 2WTEA 2VE9A 1XB4A 2P5VA 1VQ6I 1KQ9A 5LGUA 2YU9J 4BXUA 1P6RA 3J80Z 1MBEA 3S1MJ 5FKNA 4EQQA 2E1MB 4C3HJ 4XRFA 5IOZA 3SFZA 4D0PA 4IF4A 5CVRA 2JRMA 3V7RA 3EUAA 2W82A 3HOXJ 1MD0A 3SFIA 4B48A 2VIXA 3B02A 1Z9CA 2HYGD 4XKBA 3I58A 5LRSA 5J6XA 1RR8C 1UHSA 1XGOA 1YW9A 5HODA 4S0HB 4E70A 2B9SA 3DU6A 3L7WA 4LLNA 4A3EJ 3QODA 4A6EA 1SD6A 1Z0XA 4MO7A 5J8CA 1XDUA 1K61A 1Z77A 1JJ6C 1UZCA 3FM3A 1J09A 5C4JJ 1XX5A 1MNEA 3GXOA 2ZXJA 1MMGA 1F36A 5DUIA 1JJ8C 1D1BA 4WXCA 4IPAA 5KCMA 4A3FJ 1HKTA 3R0AA 1DPUA 1X19A 3OYLA 3BR3A 1HF0A 1T6SA 2ZMEA 3I0TA 1MH3A 5E3OA 1AHDP 4HX8A 2P7VB 2DXIA 3SEQA 4IHTA 2M5WA 2E1OA 1MGTA 5F6FA 2V1NA 3S14J 3CCVI 5BS6A 4CYDA 1RUOA 2KT0A 1S9HA 2FMLA 1AKHA 3PO2J 5J8FA 2O5RA 1ETOA 4B47A 1FZPB 5HLGA 2DA1A 3H5RA 3G1LA 3H9JA 4KIBA 4OIQF 1E17A 4G6DA 3MEXA 3GFMA 5HDGA 1FIPA 4UUSA 3CCUI 3W6KB 2FRHA 4AYBA 1YW8A 2CQXA 3HPHA 5GPCA 2BW3B 3EETA 5JHFA 3H9GA 3D0SA 1HXDA 1QO0D 4KFCA 5AIQA 2IRFG 2FBKA 3K4JA 2HQRA 3BJAA 1ZK8A 4HZFA 2LNBA 1S6LA 2ZJRF 1Z91A 1HSJA 4L5EA 3CF5F 4GDFA 1OISA 3Q9VA 4OIPF 4OAYA 1Z6TA 2EH3A 2K40A 2V6CA 1LFUP 4P9FA 5JLWA 2XAUA 2CGPA 2MLGA 1FSHA 1J0RA 2EFNA 4M6XA 2R7SA 3LSPA 4FISA 3OS1A 3WTVC 2DMNA 2FNAA 1JXSA 1Y1VJ 1FOKA 2GXAA 2AXLA 2K4JA 2RKHA 2KRHA 5LHIA 1IAWA 1PJRA 4UV9A 3JAMK 2ELKA 2AHQA 3QP6A 1T0FC 2XASA 2UZKA 4EJTA 1FLIA 5D6FA 1HBXG 5LEKA 3AFHA 3MKZA 3S2HJ 4L9TA 4NC7A 3H0DA 1VQLI 2ZSIB 3GVAA 1PVEA 4A3IJ 2YUSA 3KFWX 3KP5A 1VQ4I 4YFNF 1QA6A 4G8XA 4JQFA 3O6BB 4WK8F 3JREA 4LGWA 4N9IA 3AAFA 2ECCA 3LNQA 1E2XA 5TRDA 1YE9A 3BTCA 3L2RA 4A5NA 2HVRA 3CJTB 2K85A 2E1NA 3L2CA 2XRNA 4CHUA 5JVTA 2VJJA 2R7OA 2NNYA 2KKOA 4BBSJ 2IBDA 4IQJA 1MJBA 3FXRA 3I59A 5GTIC 4LLGF 4CXFA 2EZLA 3QPLA 5F08A 4L0YB 2DMTA 1UG2A 1BM9A 1VQ8I 1F9NA 3GTLJ 1ETVA 3BR0A 1PP7U 4X1EA 2F5CA 2M8EA 4UUTA 1MBKA 2L3DA 1K78A 4GYGA 5C44J 3RJPA 2MBFA 2IA2A 2RVCA 3OYDA 1TQIA 3L2QA 3WTWC 2BBYA 2VL8A 3E6DA 3HJEA 4UVBA 3UR3C 3T0YA 3KYLA 2A3SA 2VPLA 1LEBA 1B59A 2K9QA 2DDAA 4PJLA 5ICEA 1WZ2A 2CFXA 4GO1A 3SJMA 4ESJA 4PGHA 1H89C 2HGCA 2ZFWA 3DCFA 3BQZA 3FXUA 2PMZA 3IH3A 5KK1A 2EFWA 1RC9A 1SD7A 4XL9A 1USTA 4CO8A 1TWCJ 5HLIA 3DEWA 3BC8A 3IH2A 3HOTA 3TO9A 2L7MP 1SFUA 3OS0A 4N4OB 4EJOA 1XGNA 2KRFA 1TNSA 2QENA 4AU7A 2VJIA 4R8HA 4LG0B 3HUGA 4BJ6C 1ITYA 2E5NA 5E79C 3E3VA 1OCOH 4EM0B 1YO5C 1WI3A 1R49A 2HXOA 2VT3A 5IP6A 2WA0A 1G2HA 3R4KA 3V4GA 5DDGA 3E6BA 5ILVA 4XLNF 1ZN2A 1EV7A 1RI7A 2PMHA 3LA7A 3OIOA 3Q0VA 1XGMA 2VC0A 4DYCA 2I10A 3HPGA 4JK1X 3CCJI 2IGKA 2TDXA 1VQ9I 4KIGA 3RQIA 5M5WJ 1B1BA 3KP4A 3WTUC 1FP2A 3SYTA 4UVAA 2QQAA 1OCRH 1OPCA 2OCCH 1ERDA 1N77A 2NNNA 3LSHA 4YIFA 1G8XA 1R71A 2XROA 2Z33A 1LVAA 4L9JA 4LK1F 4RM3A 4E7HA 1R7JA 2EQRA 3RIRA 2FBIA 1BOAA 5IY5H 2GM4A 2M8GX 3QPSA 4QIWN 2KJCA 1VF9A 2ETHA 4XQFA 1RKTA 2CWEA 1VFCA 3ZQFA 3E6MA 2HZDA 1PUFA 2NVYJ 1IRGA 3CZ6A 5L3BA 2WAQN 2XPWA 4HQMA 1ZTRA 2VQGA 4I02A 2BHZA 4IL6C 4YG2F 1KU9A 2P5KA 3HSFA 2O3FA 3A0BC 1TWGJ 2XPUA 4KN7X 2VOPA 3GBGA 1TWHJ 3H3VK 4G94A 1RETA 1XGSA 3P7NA 1BJZA 3K7AJ 3BOQA 3BZCA 2VKVA 4R1HA 4IHVA 3K0LA 3VODA 1MDMA 2HOSA 1SEUA 1ZKGA 3DBRB 2DU9A 1IXRC 2FNPA 2X6YA 1TP4A 2X6WA 3SDGA 5J40A 4CYCA 3I55I 2WBMA 1MBHA 3JRDA 2Y9ZA 2HVQA 5E1XA 5E3MA 1ONVA 2DI3A 2GZWA 5H6RA 2Z99A 1RKWA 3SZPA 3IAM2 3K1NA 2CUZA 3M4OJ 3S1RJ 5J4YA 5EEGA 3BG6A 3E7LA 2STWA 4ZJZA 3ABKH 1DP7P 2DJIA 3H5NA 4XBFA 2VUMJ 3G4SI 1W36D 2EILH 1SFEA 3CC7I 1CF7B 4O5VA 4MQ9F 3C3WA 5CVUA 1OMIA 2Q1ZB 5DM7F 1X1BA 2XGCA 2H1LA 5D4SA 2KJBA 2RQQA 3VEPA 2CV0A 3MKWB 4OMZA 2EA2A 1UFMA 3CQZJ 1XCVA 2DDBA 3HOVJ 4FQGA 2YU3A 1S7OA 2COMA 4BQNA 2R7TA 4YIRX 3WE2A 1B72A 3IC7A 1H9TA 4LB5A 4Y33A 4UB6C 3ZMZA 1X1PA 1TNTA 2CO5A 4BY1J 1IN8A 2YX7A 3QP5A 3K4MA 4O6JA 5FLVA 4D1QA 3MZHA 2Y48A 1D1CA 2R5YA 2F2EA 1YIOA 1V55H 1T8IA 1VQ5I 2XAJA 4U0WA 5GP9A 3GF2A 3ZOBA 3GZNB 4Q47A 4LD5A 2OJED 1FWZA 3ZGKA 3S93A 2M7BA 4ZZDA 2UXNA 5HS7A 1D1AA 2V7FA 3V42A 1JUPA 5BPDA 1Y0UA 3BLYA 5CQGA 3F3XA 2DAOA 1QZZA 4M9XA 2VT2A 4RB1A 1WJAA 1MZBA 5F64A 4NC6A 3FMSA 5FKKA 2B7EA 2L4AA 4HW0A 4L5JA 2DTZA 5HS8A 5IYBJ 4M9ZA 5KVRA 1IN5A 4EATA 4P55A 1ZG5A 3FXQA 3H9QA 3S3NA 1QVTA 4BQAA 2OTLI 2LOOA 1XD7A 2STTA 1OCZH 3K70D 4XLAA 2ZMEB 2P4WA 1ZAOA 1X2MA 1S7EA 2BY3A 1IDZA 2CQKA 1YRNA 3M1EA 1QVUA 4IZZA 4A0YA 1W1WE 2X1CA 4EM2A 2YS9A 1Z1DA 4M71A 1G59A 5AIPA 3WU0A 1AU7A 2O0YA 4PK4A 4PSXA 4P5OA 5DV5A 2HVSA 1D5YA 2X0LA 3PFYA 3WU2C 2XRLA 3CMYA 3CO6C 2IPQX 3RPQA 2R3SA 3MKLA 1VQOI 4II2A 2ZKZA 4E4HA 1P7IA 5CYVA 3CF2A 5K7FA 2MC3A 2G7HA 3H3UA 3KCCA 2JWTA 2M87A 3J81K 2ECBA 1Q1VA 2MW8A 3VSLA 1G3TA 2BVLA 4UV8A 2XB5A 3RTRA 3I4PA 4AWXB 4UUSB 3HEFA 5LD2C 2D2WA 4BS9A 1SMTA 2K5CA 1RUNA 3OOUA 1VQKI 3KLOA 1YI2I 3WHCA 5LGNA 2L7ZA 3EDPA 4BU2A 1YOVB 1U78A 5ILSA 5IP7J 1V5EA 1ORKA 3HSRA 5HLHA 1KA8A 3BQYA 2CV2A 2R7ZJ 3BZKA 3DKXA 2L5QA 2LKSA 2DT5A 2RREA 1U5TC 2VKEA 3AL0B 1O3SA 1E3PA 5D5UB 1UG0A 2JUCA 3RSNA 1W36C 5GTHC 2LMDA 2KIFA 3FMRA 4ITVA 2VBYA 3OMYA 3N97A 2ESHA 4I0BA 3ZQHA 1S3JA 3HM5A 1T98A 1XMXA 3S8PA 2DPDA 4DOZA 2H6BA 3OYCA 3ZRGA 1IN6A 3ZMSA 3S1QJ 3ISPA 1PDNC 5FFZA 2VBZA 3DFGA 2BE5F 2P8TA 5IOYA 2RN7A 1R23A 4AUXA 4HA8A 2PX9A 3ZN0A 1LVKA 2HQAA 2R92J 1RESA 2UXXA 1J75A 3I5UA 2W57A 2GA2A 2G0EA 2O03A 1Y6IA 3M9AA 3LSMA 4XSZF 2QBYA 3M3YJ 2M45A 1A6IA 3CCYA 3F72A 4S05A 4C9YA 3CJQB 4EJVA 4HBLA 4WCGA 2LD5A 1IUYA 2DA3A 3HGGA 2A69F 2HYJA 3WG7H 3I3LA 3CUOA 3OY9A 4ENKA 2LDUA 5FB2A 3B6AA 2N8GA 2E1MC 3IV5A 3QOEA 4HLYA 4HRIA 1Z3XA 2OF7A 2FOWA 2H94A 3K9TA 5F1JA 5IYDJ 2ELJA 3I53A 3I59B 5F27A 3VOEA 3WODF 3RZDJ 1TC3C 2NVUB 2OQRA 1YFHA 1ETYA 2QQBA 3HXLA 2XB0X 2W48A 3V7CA 2NS7A 1I3AA 3DPLC 2X4HA 5DEQA 2QQ8A 2VXZA 1BL0A 1YS6A 5LBQA 2COBA 1K78B 2E2IJ 2HWVA 4P96A 1HDDC 2K4BA 4IHXA 1FPQA 4KISA 1ETQA 4JP0A 3U1KA 5J1UA 4G7OF 2I8DA 1B9MA 1VI0A 2CSOA 1OLTA 3BDDA 1I5ZA 2F4MB 1NG6A 2PN6A 1R4NB 1R1UA 2IAIA 4FT8A 3K70C 4A93J 1I1SA 3CTAA 2Z3YA 4G6TB 5L3DA 1EKEA 4MIMA 2V79A 1YX3A 3TP0A 5CPRB 1TT5B 3MCZA 5J3LA 5HNFA 3F21A 3GTKJ 4ZYAA 1TT0A 3HTUA 4X6AJ 1UB9A 3FBIB 4M3EA 2FF4A 2IA1A 4XLHA 3DEEA 1K6OA 3CC2I 3JAMZ 4F7ZA 2JA6J 4ON0A 1UELB 1OJLA 1WGXA 4CDGA 1X4PA 5BMZA 1KU3A 1MKMA 3HUGB 3GX4X 3S3OA 5E3LA 4FETA 2L02A 3BJ6A 4YFXF 4PFOA 3ROUA 3EYYA 3ONQA 3A4CA 2PMUA 4GXOA 1KONA 3LL7A 2RC4A 4MNUA 2HEOA 3GTJJ 3GTGJ 1XSXA 4D7MA 2OC6A 4MFEA 4JYKA 1EH8A 3MMYB 5L3FA 4ABZA 1JTXA 3U2RA 5TJJA 2LF8A 4DGWB 3O2PE 1HDPA 5EGOA 3FF5A 1E3OC 3BPVA 3MN2A 1CQTA 4JX4A 1JT6A 1SFXA 5IP9J 3G71I 3DBLB 1VNDA 2JQ7A 4QWQA 2L9RA 1NK3P 1VZ0A 2QQ9A 5AONA 4C3JJ 5BOXA 3G2BA 4CZZA 5JR3A 2PMZN 5B5EC 2KZGA 5D5XB 4ANJA 1UHWA 2KZVA 4XLFA 1JGGA 1BBYA 3BR6A 1V4RA 3FK6A 2KIMA 1U3EM 5EJCA 4B1RA 3F8CA 5IT9K 6PAXA 4DZJA 2M3AA 1BIAA 1PUFB 4A3KJ 2Z16A 3MKYB 1YLFA 1T39A 3CD6I 1K6YA 3CUQA 4LMYA 1KU2A 2X48A 3HB9A 4XN3A 2Y0MA 3ZMTA 2JSCA 5EEHA 5A2QK 1ZELA 2F6CA 1MDMB 1XMAA 4CCMA 3T8TA 3A2KA 1BI2A 3UKGA 3FMQA 3OYFA 1BJAA 4DQ2A 2VBXA 3ZMVA 1QU3A 4CYCB 4AVPA 1AWCA 4G12A 4HYEA 2CYYA 3MQ0A 4X0GA 4KT5C 2GLOA 2J5OA 3ULQB 1B8IA 2OUMA 3EQLF 2GIZA 2EFQA 3PSIA 2FXAA 2Q2EB 2ZFUA 2PEXA 2BOLA 1IGNA 4E7KA 3LSRA 3S32A 2O8KA 1ZGWA 4CCJA 1D5VA 1MNDA 1XC5A 1BOBA 4NB5A 4PJJA 4M9SA 4YIIA 3QYEA 2HOAA 1J9IA 3HKZN 2PI0A 2LFBA 3M07A 2E2HJ 3K6GA 2NVQJ 3UNGC 4CH7A 3TEDA 1R9TJ 4KDPA 2V9PA 4Q48A 4IOAF 2IS4A 1P9QC 2IA0A 2GOXB 1LNWA 1HA8A 5B1BH 1I50J 5EYRA 4AD9A 2YSRA 2HI3A 1QHHD 2XGXA 5M3FJ 5FFXA 1R58A 3RDIA 1B72B 4V2GA 1OYWA 2LTPA 5E20A 3BPXA 5E17F 3Q5FA 4QSHA 4K2EA 1C0WA 2KISA 2ZXIA 1Y0NA 3GO5A 1X1CA 1ZR4A 4WXHA 4HOBA 2NRAC 4BQOA 3FHNA 2R5YB 3LFKA 1LPQA 3S3MA 4E7IA 1ETWA 3DF8A 3DTIA 4LITA 1HC8A 5E8GA 3JRIA 1Y1WJ 4ESBA 4ZZLA 3BCAA 3AKZA 3LSKA 5CVVA 3D5LA 1AA7A 4ZH4F 4V19K 2JA7J 3OYEA 2K27A 1IXCA 1WHUA 3ABTA 3H36A 3KP7A 2HZTA 4Y15A 4CICA 5HLTA 2AS5F 3GTPJ 3BROA 2K3PA 5D6EA 1FY7A 1MMDA 2Y2ZA 1K7AA 4HLXA 2FUG2 2VQHA 3KPHA 1EJ9A 4OWRB 2WC2A 5HOOA 5FKMA 1Z67A 4XLPF 4ZDLA 3HZJA 3ZQIA 2KFDA 2LBFA 3RYPA 4BY7J 2F4OB 2V4JC 5K1YA 1DPRA 1SFOJ 5ICFA 3DLLF 4CZCA 1SC7A 1QQIA 3TBIA 1YRNB 1I6XA 5ICGA 3S1NJ 4RAGA 3SXYA 2DK8A 2LH9A 5FROA 4H0EA 3E6CC 3VB2A 2DFHA 2DOFA 1QGPA 1KYWA 3HRTA 3JRAA 5GAHJ 1A31A 2JZYA 1E3HA 4ZC3A 1SFKA 2CUEA 3FBNB 4UVCA 4DIQA 2DTRA 1LB2A 3VPRA 1SMYF 1IUFA 5F0CA 4A2UA 3LOCA 5GAGJ 3SHFA 3NRVA 4ZDPA 1TW3A 3OYMA 1IG7A 4MFDA 1UJ8A 2OD5A 1ETXA 1QBJA 4BHPA 4KITB 2NYXA 1H8AC 3KYDB 4BXFA 2O61A 4BJ5C 3FXOA 3HSEA 2DA7A 1FEXA 3WGHA 4XLCA 5HDKA 1T38A 1DDNA 3T8RA 4F52A 2Z1DA 1POGA 2XAQA 2MG4A 2W7NA 1XCBA 2Z5UA 2WAFA 4F91B 3L00A 2M4KA 4I7HA 2ID6A 3TMOA 2WADA 2A6EF 3TQNA 3M8JA 4DYQA 3EPZA 4EVIA 2ZJ2A 5EF6A 2NS0A 2B0LA 2W84A 3OIQA 1ACIA 4L5IA 1T56A 1X2NA 1D0YA 2OZ6A 5CVIA 2HQNA 4NQWA 4P9UA 4IO9F 2QUFA 4CUGA 1GV5A 2QF7A 1UCRA 3EUHC 1JKOC 2K9LA 3KP6A 5KNLA 2H1KA 3F9KA 3PNTA 3TP3A 2BGCA 2W00A 1ZYRF 1VQ7I 2MGQA 3M7GA 4NBQA 2UUZA 2HPIA 2IXSA 4A5MA 1I6HJ 2Y30A 3KE2A 3OSFA 4PJ0C 1YG2A 3GMEA 3TO6A 3K4LA 3E97A 3FZVA 3JSPA 1N78A 3E5QA 1NHAA 3RPUA 2QBYB 1XN7A 2LLKA 1U5TA 2JN6A 3P9CA 4UNOA 1ETKA 3CLQA 4Y17A 5J4VA 3OYHA 1LQ1A 1IV8A 3OWTA 1JT0A 2R93J 1ZLKA 2IGOA 5KAFC 1FSEA 4Z6YA 3A0HC 2DA4A 4W1UA 3JRCA 1JHHA 4ETSA 4GGGA 1WJFA 2RDPA 1MH4A 3LSTA 2IGMA 5LEJA 1ZG3A 3S15J 4A0XA 2K3FA 3J81Z 2CW8A 2I5UA 2F48A 5DCMA 3N05A 3LSJA 1W7PA 4BKXA 4M73A 4NC8A 5CJ9A 4L9VA 5KHDA 3PIPF 3DEUA 3NWSA 1P2FA 1Z05A 4FX4A 3HKZA 4IJAA 1WKMA 4FASD 5DTDA 2DOAA 2JSPA 2QCOA 3F8BA 2K7LA 4XKCA 1PYVA 1JUSA 3NWTA 1WJCA 2ISYA 1K4SA 5EG0A 3KETA 3OYIA 4BACA 1WFXA 3PIOF 1W5SA 4BYYA 3GFIA 1Q1HA 2GOMA 4HSRA 3G6EI 2QKLB 3WGGA 2R4GA 3K1PA 3VSKA 4BAYA 1QPIA 2DW4A 5B66C 5FD5A 3L2UA 3KP2A 2L9NA 2LC2A 3PUBA 2IW5A 4U7DA 2ZO4A 4BNCA 2M1BA 2XUBA 3CDLA 3W2WA 3GYHX 4WWCA 5K7HA 3WTSC 3S2WA 2X9DA 4ASNA 3NAUA 3F23A 3HOZJ 4O3MA 2Y69H 5H20A 3QYFA 4E7LA 3PSFA 2LRDA 1LJ9A 2HQ5A 4A0ZA 3I4NJ 3PNYA 4G9YA 2VKDA 5JFRA 3QPTA 4PJMA 1XMKA 1USSA 2JVGA 3C1DA 3HYIA 1FYMA 4F93B 1ENHA 4M72A 3T1BA 1FTZA 3I71A 2KDOA 3HRUA 4KT6A 3C2BA 2CQNA 3E5XA 2DMQA 1SVMA 5FLMJ 1IRFA 3JTHA 1E0EA 3GWZA 1LE8A 1LKXA 1Z7UA 3CCSI 1T95A 2Z2SB 5CLSA 1BR4A 5EGOB 4LIVA 5FLXZ 4UXNA 3AG1H 3LAJA 5ILUA 3HRSA 1GXQA 1JKRC 1FNNA 2FBHA 4B3AA 2PBIA 4UB8C 3I4MJ 3AL0C 2OCEA 3QRFF 2F5VA 3DBHB 5DS9A 5BQTA 4JX6A 1JI8A 1MMAA 4IVNA 2WB1N 2V1DA 4RB2C 3V8JA 2PLYA 3HHGA 2DT7B 2CFOA 2RAEA 4I76A 1F5TA 3CJNA 3Q0UA 4Z2YA 3WU1B 4FE4A 1O3RA 3KZYA 3VFZA 3VWBA 3CUQB 3LSIA 1TWAJ 2F5DA 1FBUA 2CU7A 1GUUA 3K4NA 4BDZA 1DU0A 4I6ZA 1NG7A 3HIFA 3OYKA 3WHBA 2QA4I 4N0BA 1SVOA 1MBFA 4RGSA 2F4IA 4NNJA 3KEYA 2V9KA 3DTKA 4ESFA 4LIUA 1U2WA 2P81A 4MLOA 5DUKA 3X2QH 1DQUA 2ZXWH 3PQKA 4D5FA 3GZ6A 1GVDA 4RM2A 2V1UA 4E7JA 3B6CA 1FP1D 1W4MA 2GIVA 1WQ2A 1B8IB 1OYYA 1BI0A 5E1WA 4AM3A 1OCCH 1FMVA 3ZQQA 2P7CB 2DYSH 4A3CJ 1YJ9I 1IJWC 2FX0A 2ZJPF 3DWLE 2AO9A 1HW1A 2R7RA 2X6OA 4RAFA 3F8FA 4XOTA 3NARA 1AKHB 1VQNI 3LA2A 1OR7C 1UAAA 2GWRA 2WY7Q 3U21A 4ENJA 2H27A 1X4OA 4Y4RA 3C18A 1UHMA 5GAEJ 2ESNA 2GAUA 1BA5A 2G9WA 2RNJA 2LY9A 1F43A 3BJOA 4ZTFA 1XS9A 3OL4A 5IYCJ 2LSOA 4PSWA 3CP8A 1PUEE 1W5TA 2CW0F 3M1CA 3P9KA 4IRGA 3H35A 3RCOA 4FCYA 3GLLA 3ZQLA 4RB0A 5IT9Z 3IWFA 3SZTA 1SD4A 5HS9A 3WG9A 2EWNA 3PM1A 3CP2A 2EINH 2VODA 4WXDA 1MSEC 1BI1A 2RGVA 2ZBKA 2C6YA 2YR2A 3GLXA 3G1OA 3FM5A 4ZYGA 3ZQ7A 2E7WA 2FA5A 1OQYA 4RAZA 3BP8A 5A2QZ 4ENMA 1MJ9A 4BJTA 3ECHA 3T5XA 2VPRA 3J7AO 2EFPA 4TV7A 5BPIA 1S5LC 5JLXA 2J5PA 3BZ6A 3DP7A 1G3SA 5K5OA 3RKXA 1R5ID 1QZEA 2KMUA 2YPRA 3L2VA 5D5WB 3IRQA 5J1RA 4RBOA 2KPMA 3QWLA 4AIKA 4NHJA 1W5CC 2ELHA 1J5YA 1ZRFA 1FT9A 2ICWG 2DA6A 5LRRA 2LBFB 4BQQA 2M7AA 2DYRH 1YIJI 3WTZA 5E3NA 3CLOA 4PZJA 4MTEA 4BE2A 3D5SC 3OS2A 5TISC 4M6YA 5CQEA 3OV8A 3OYAA 2JRTA 1T2KA 1KZHA 1IDYA 2UWMA 2HS5A 3ASNH 2WWYA 4HAMA 3L2WA 2YX4A 4E7ZA 2LKPA 4XNFA 3FKIJ 2D45A 1G3YA 4B3XA 4M3GA 4UHTA 4QPOA 4KNYA 5B3SH 2HDDA 5FLXK 1VTNC 4I09A 4IRHA 2H6CA 3ZN1A 1T0FA 2MYSA 3DPTA 3REOA 1GLNA 3R6SA 4U0YA 2OQGA 3ZMUA 3HBLA 3C2HA 5ICCA 3C2GA 2VOOA 2XAHA 1TW2A 2QZ8A 2NS8A 4XR6A 4QLCU 2K02A 2VN2A 3BG7A 3H3ZA 3OYNA 1U9OA 2XF5A 4BHCA 4ZTJA 3LSGA 5FD6A 2FJ1A 4KYWA 4MHGA 2DT6A 2EZIA 2O9LA 2X1DA 4RS8A 4F3QA 3FXJA 2ISZA 2E36A 5FKOA 3WTTC 2VQLA 3LQQA 2DO7A 2ZNYA 3QU3A 4AVZA 1R5GA 4UY8I 4XRMA 1WVRA 4RDUA 3F6OA 4IOCF 2EJRA 3U1DA 1GXPA 2VE8A 4XRSG 3P9IA 4A3LJ 2IT0A 1BR1A 2A5WA 4NQWB 1O7LA 2W25A 3ESWB 1VQPI 2JA5J 2R7UA 4PGGA 1SVLA 3CCQI 4HNTA 2Q0OA 2JJ7A 2W4SA 1M1EB 2DODA 2L9SA 2IP2A 3DPUA 1ZARA 2XAFA 2WB1A 2EK5A 1OCPA 2Y0SN 4OINF 2JMWA 5DD8A 3JSOA 1Y8RB 4RA2A 4FE7A 2EIMH 3IHUA 3J7AY 5EEAA 3H1CA 5LFAA 4A3MJ 2NVXJ 3D5RC 4ENNA 3H5AA 1NK2P 3JRGA 3K69A 3DLAA 2X6XA 1BR2A 2ADUA 3GFJA 1BC7C 2M9HA 3HOWJ 2BY1A 2XSDC 3MZYA 1FOWA 3OYBA 1K4TA 2CG4A 1TQMA 4C2UA 3EUHA 5C4XJ 1IXSB 2KP6A 3O8HA 2DFFA 3E1SA 3ERMA 2XC7A 1CF7A 1TBXA 2PFBA 3K2ZA 4U7BA 2BHYA 2OZUA 2LP0A 1F4KA 5DCMB 5B1AH 1W7PB 4QTRA 2EPFA 3KP3A 3MD2A 4MEYF 2A07F 2MC4A 1L3LA 1FTTA 1WRJA 2KLOA 1YX5A 1GHCA 3BTIA 2IJLA 3CDHA 1ULYA 4HX4A 2CV1A 3GTQJ 3S16J 2XKPA 2MLKA 1GT0C 3KYCB 2PQ8A 3ZXSA 3FXKA 2A05A 2MSYA 3HDDA 2JUGA 4HPQA 3MFKA 3RKYA 4B8XA 4OMYA 3G3ZA 1XSVA 1X3ZB 5EG0B 4MQVA 2L54A 2GXBA 1APLC 4DJAA 2KDZA 2JVHA 4LLLA 2XPVA 1XG1A 2XVCA 2L7FP 5JI6A 1FBSA 1U8BA 4I2OA 3BTLA 1QRYA 4BXXJ 1ZRDA 3Q9SA 2DQLA 1IO2A 1RZ4A 2HNHA 3F0CA 1A36A 2V1XA 3A01A 1GDTA 4U87A 2KL4A 1FYKA 4IKFA 2HR3A 2B63J 3K4BA 1KYZA 1FIAA 2RV8A 4U88A 3FHZA 1WH7A 2F5FA 2G7UA 3KEOA 4BE0A 3HG9A 5C3EJ 3CCLI 3R60A 1FOYA 5K7ZA 2KHMA 2M0MA 3EYIA 2DA5A 1XSDA 4RGXA 4RLFA 2VXDA 2VASA 1EH7A 3KZIC 5LHGA 5D5VB 2HOTA 3M8EA 3CDIA 1WH5A 1FBQA 4LJZF 3QQAA 3WTYC 1TTYA 2CS3A 1WWXA 1Z6RA 1QZYA 3TW7A 1LE8B 4OAZA 4FX0A 3HHHA 4LFUA 3CCEI 4RMNA 1T33A 3W6VA 4ZYEA 1LFPA 2BV6A 2BY2A 3WGIA 4D5CA 4EV0A 4I98B 4A3GJ 5FJ8J 1MNMC 3HOUJ 2ZC2A 4YEJA 2A6TA 1JGSA 2CQ7A 4OIOF 2FSWA 2IS1A 4XMYA 2R5ZA 4M3BA 5ED4A 3ABLH 2Y31A 1H88C 1R5HA 2XGEA 2ME0A 3BR5A 5CKTA 2NVTJ 3JCUC 2XDVA 2E71A 3GEZA 3BY6A 4A3BJ 2P6TA 3TOAA 3LWFA 2HOEA 1OYIA 2OBPA 3KEQA 4M74A 1A35A 1RR7A 1I1GA 2DCEA 3LQRA 2PJPA 4UUVA 4PJNA 1IN4A 4KN4X 1YS7A 2R7VA 1O7FA 4DYRA 4D7NA 3KZZA 4RLQA 1VQMI 2E1CA 3GCMA 2F5EA 2XF7A 3TGNA 4GYIA 1RIOH 4KIFA 5CVJA 1NTCA 2P5LC 2DPUA 2BXYA 1WJBA 2FD5A 2Y75A 3CMMA 2A6HF 4L0ZB 2E35A 4A3DJ 2LK2A 3TKYA 2K9MA 1V5GA 1KQ8A 5EDNA 3MZ8A 1T08B 2OTJI 4Y13A 4MGRA 4LK0F 1YHQI 2Z9OA 2LKXA 2HU9A 4XONA 2EB7A 3TOBA 2R7DA 4F92B 2HDWA 1S72I 3OYGA 2DMUA 3EUKL 2EZKA 2IS2A 1N25A 1G6NA 2ID3A 2LY2A 1LEAA 2PG4A 2QWWA 2V26A 2Y0SA 4XKVA 2V6EA 1IN7A 2CW7A 1HQCA 2QGUA 3V8LA 2GA1A 2AQEA 3P5JA 1ZQ3P 3A03A 2IGNA 3SEZA 1RNLA 5JVGF 4A12A 1B9NA 4V2FA 1S7AA 2VJ5A 2MD0A 4J00A 1ZGJA 3GUDA 2FQ4A 3I64A 2OV7A 5DD4A 2HDCA 1HW5A 2RNGA 3LA3A 3BR2A 4HV6A 1EH6A 2E7XA 2XHKA 1GVJA 4A69C 1WI9A 4HEA2 3PL8A 4XICA 5KAIC 1FOXA 2FEZA 2TRTA 3HOYJ 2MH2A 1A5JA 1D8JA 4LOCA 3RYRA 2IS6A 2EFOA 3OR2C 2CMPA 3ZQGA 2E34A 1K79A 2QKMB 4DNCA 3LAPA 2BYVE 4BBRJ 3ABUA 2XGDA 1DU6A 3J80K 4DBQA 5E1ZB 1OR7A 5D4RA 4Y3OA 5DM6F 1REPC 4BEHA 2JT1A 1MMNA 2DN0A 1Z21A 3GTOJ 4EM1A 2K9NA 4BE1A 4W97A 2GXGA 5H2FC 2DA2A 2WY8Q 1CGPA 1P4AA 4ZDOA 2CUFA 1X3WB 1TLHB 2JPBA 2OA4A 3QU6A 1FC3A 3E5UA 3G1MA 4YELA 4E7SA 4HDUA 1TZLA 3SQNA 3I54A 1JUMA 2Y9YA 3S17J 1B6AA 1X1DA 3SZGA 2OU2A 4U0VA 3VDXA 1H0MA 4KUMA 2UV1A 2QSFX 4CSWA 1ZR2A 4BH9A 2CJJA 4FTHA 1OKRA 3C7JA 5ERIA 1KGSA 1Y39A 2OAZA 2HTSA 4CCOA 2D5VA 1OFCX 2IVMA 1MBJA 3GW2A 3Q0WA 5E8IA 1U9NA 2XIGA 1HW2A 4YFKF 3IL2A 5FRMA 2ZNZA 3BCBA 1MW7A 1BIBA 2BY0A 3F6VA 4Q5SF 3FXLA 3AG4H 3CMAI 2P0WA 3OYJA 4BL0B 4BUPA 2PJRA 1MBGA 1J2XA 3V8KA 3ZP5A 1BN5A 5EZGA
chains in the Genus database with same CATH topology
3PQJA 2DBBA 2HKXA 3CUQC 3M8FA 1O57A 4Q4ZF 1U6GA 1ZRCA 1KU7A 2XV4S 4L9NA 4EJUA 5H6QA 4N9HA 1BI3A 3HTSB 5D8LB 1QNTA 2WV0A 2QM3A 4EMSA 2M30A 3L9FA 4AIJA 2VBWA 2DK5A 2QVOA 1MJAA 2V9VA 5LGTA 4KMFA 1P4WA 5HDNA 4CGZA 1D3YA 1QPMA 3L09A 3TDUC 1DUXC 1A04A 5L3EA 4HF2A 1L0OC 3N4MA 4R79A 1ON1A 2Q8KA 1V3FA 1D8KA 4I01A 2Q2EA 2MA3A 2DLLA 3IRRA 5K5RA 4HV5A 1FYLA 2QYOA 3DQVC 2LF7A 5DCFA 3W6JB 4PCQA 3ELKA 2FOKA 1W7PD 2EA4A 2EV6A 3U9GA 3H92A 1WSUA 1ZLJA 3RI4A 2VONA 2L01A 3NEUA 4FHTA 2XKOA 1IW7F 4AIHA 2D1VA 1TQPA 1G4DA 3F8MA 1P92A 1SD5A 1R1TA 3HRMA 1IZ1A 2XAGA 4RGUA 2FE3A 1ODDA 4RGRA 1XDSA 4OIRF 3BWGA 4KICA 3DKWA 1P4XA 4HF1A 2W24A 4OOIA 4IRIA 4JBAA 1LDJA 4IHSA 5LLQA 5L3GA 5LHHA 4B09A 1R36A 2HFHA 2JPCA 3G73A 4BHBA 4LB6B 3JW4A 1J59A 1JHFA 2KIUA 4EGZA 2A61A 1F1ZA 1YW7A 3OOPA 5F1RA 2ACJA 2HKOA 2EV5A 3ECOA 1S8NA 4MTDA 2HTJA 2GQQA 2VC1A 3R61A 4ZYDA 1KQ0A 1JE8A 3ZPLA 2W85A 3COAC 1STZA 4IXAA 1ZREA 3IWZA 4S04A 1I27A 1YQAA 3HOSA 4RAYA 1HKSA 4L18B 1S29A 3JTGA 2EV0A 3F8NA 1HKQA 5JHUA 4HF0A 1IF1A 2DFIA 1ZG1A 3ML6A 1FX7A 3ZMDA 2FMYA 1G3WA 1R00A 5IT3A 2O6GE 3MWMA 1J7KA 3B73A 4LG0A 1ZHFA 4PDKA 4G6QA 2MH9A 4EJWA 2P6SA 5FO5A 1O3TA 2H09A 2FU4A 2BEOA 1U8RA 4GCVA 5FGMA 2A68F 1YTYA 4A6DA 2FQ3A 2HYFA 4EGYA 4HX7A 3IKVA 3R0JA 3GZ5A 3NQOA 1R1VA 2K86A 3TO7A 4RB3C 2A5YB 4KMUX 1BC8C 3TDZC 3RKWA 2DQRA 1H9GA 5L3CA 1B4AA 2NAZA 4OU0A 5DYMA 1AOYA 1LDKB 3QPHA 1ON2A 3F22A 2QLZA 4MEXF 1PP8F 3KLNA 5HVQC 3IKTA 3QOPA 2D1HA 3FX3A 1HSTA 3WTXC 4XSXF 4WF2A 1U5TB 2R7FA 3MAJA 1LDDA 1O3QA 4WX9A 1X3UA 2L4MA 4G7ZF 3DV8A 5K5QA 3V7SA 3GFLA 4KA4A 3K1MA 3ERED 1ZH5A 2O8XA 5D8KB 2ZCWA 5E18F 3CO7C 4G7HF 1SAXA 1ZGAA 4I0AA 2RQPA 3PFIA 3WE3A 3QAHA 1YYVA 4HDVA 4HQEA 4ZYHA 2JTVA 3DXJF 3O3KA 3FWEA 2MD5A 1R22A 2WTEA 2VE9A 1XB4A 2P5VA 1KQ9A 5LGUA 4BXUA 1P6RA 3J80Z 4EQQA 4XRFA 3SFZA 4D0PA 4IF4A 5CVRA 3V7RA 1MD0A 3B02A 1Z9CA 2HYGD 3I58A 5LRSA 5J6XA 1XGOA 1YW9A 4E70A 3L7WA 4LLNA 4A6EA 1SD6A 5J8CA 1XDUA 3FM3A 3GXOA 2ZXJA 5DUIA 4WXCA 4IPAA 1HKTA 3R0AA 1DPUA 1T6SA 2ZMEA 3I0TA 4HX8A 2P7VB 4IHTA 2M5WA 1MGTA 5F6FA 5BS6A 4CYDA 1RUOA 2FMLA 5J8FA 1FZPB 5HLGA 4KIBA 4OIQF 1E17A 4G6DA 3MEXA 3GFMA 5HDGA 3W6KB 2FRHA 1YW8A 3EETA 3D0SA 1HXDA 1QO0D 4KFCA 5AIQA 2IRFG 2FBKA 2HQRA 3BJAA 4HZFA 2LNBA 1S6LA 1Z91A 1HSJA 3Q9VA 4OIPF 1Z6TA 2V6CA 4P9FA 2CGPA 2MLGA 1FSHA 1J0RA 2EFNA 4M6XA 3WTVC 2FNAA 1JXSA 1FOKA 2AXLA 2K4JA 2RKHA 5LHIA 1IAWA 4UV9A 3JAMK 3QP6A 2XASA 2UZKA 4EJTA 1FLIA 5D6FA 1HBXG 5LEKA 4L9TA 3GVAA 3KFWX 3KP5A 4YFNF 4G8XA 4JQFA 3O6BB 4WK8F 4LGWA 4N9IA 3AAFA 5TRDA 1E2XA 4A5NA 2E1NA 3L2CA 2XRNA 4CHUA 5JVTA 2NNYA 2KKOA 1MJBA 3FXRA 3I59A 4CXFA 4LLGF 4L0YB 1BM9A 1F9NA 1PP7U 2F5CA 2M8EA 2L3DA 1K78A 4GYGA 3RJPA 2MBFA 2IA2A 2RVCA 1TQIA 3WTWC 2BBYA 3E6DA 4UVBA 3T0YA 2A3SA 1LEBA 1B59A 5ICEA 2CFXA 4GO1A 4ESJA 4PGHA 2HGCA 2ZFWA 3FXUA 5KK1A 2EFWA 1SD7A 1USTA 4CO8A 5HLIA 3HOTA 3TO9A 1SFUA 4EJOA 1XGNA 2KRFA 1TNSA 2QENA 4R8HA 4LG0B 3HUGA 3E3VA 4EM0B 1YO5C 2VT3A 3R4KA 3V4GA 5DDGA 3E6BA 5ILVA 4XLNF 1ZN2A 1EV7A 1RI7A 2PMHA 3LA7A 1XGMA 2VC0A 4JK1X 2TDXA 4KIGA 1B1BA 3KP4A 3WTUC 1FP2A 4UVAA 2QQAA 1OPCA 2NNNA 4YIFA 2XROA 2Z33A 1LVAA 4L9JA 4LK1F 1R7JA 3RIRA 2FBIA 1BOAA 2KJCA 2ETHA 2CWEA 3E6MA 1IRGA 5L3BA 4HQMA 4I02A 4YG2F 1KU9A 2P5KA 3HSFA 2O3FA 4KN7X 2VOPA 4G94A 1XGSA 3P7NA 3BOQA 4R1HA 3K0LA 3VODA 1MDMA 2DU9A 1IXRC 2FNPA 5E1XA 1ONVA 2DI3A 2GZWA 5H6RA 2Z99A 3SZPA 3K1NA 5EEGA 2STWA 1DP7P 4XBFA 1SFEA 1CF7B 4O5VA 4MQ9F 3C3WA 5CVUA 1OMIA 5D4SA 2KJBA 3VEPA 4OMZA 2EA2A 1UFMA 1XCVA 2YU3A 1S7OA 2COMA 3WE2A 3IC7A 1H9TA 4LB5A 3ZMZA 1TNTA 2CO5A 1IN8A 2YX7A 3QP5A 4O6JA 3MZHA 2Y48A 2F2EA 1YIOA 2XAJA 4U0WA 3GF2A 4Q47A 4LD5A 1FWZA 4ZZDA 2UXNA 5HS7A 5BPDA 1Y0UA 3F3XA 2DAOA 1QZZA 4M9XA 2VT2A 4RB1A 1MZBA 5F64A 3FMSA 2L4AA 4HW0A 4L5JA 5HS8A 4M9ZA 5KVRA 1IN5A 4P55A 1ZG5A 3FXQA 4BQAA 1XD7A 2STTA 2ZMEB 2P4WA 1ZAOA 2CQKA 3M1EA 4A0YA 4EM2A 1Z1DA 4M71A 5AIPA 3WU0A 2O0YA 5DV5A 4P5OA 2X0LA 3CO6C 2IPQX 3RPQA 2R3SA 2ZKZA 5CYVA 2MC3A 2G7HA 3H3UA 3KCCA 2M87A 3J81K 1G3TA 4UV8A 4AWXB 3RTRA 3I4PA 1RUNA 2D2WA 1SMTA 3KLOA 5LGNA 3EDPA 1U78A 5ILSA 3HSRA 5HLHA 1KA8A 2DT5A 1U5TC 1O3SA 5D5UB 2KIFA 3FMRA 2VBYA 3N97A 2ESHA 4I0BA 1S3JA 1T98A 2DPDA 2H6BA 3ZMSA 1IN6A 3ISPA 1PDNC 5FFZA 2VBZA 3DFGA 2BE5F 2P8TA 2RN7A 1R23A 4HA8A 3ZN0A 2UXXA 1J75A 3I5UA 2W57A 2GA2A 2O03A 3M9AA 4XSZF 2QBYA 2M45A 3F72A 4S05A 4EJVA 4HBLA 4WCGA 1IUYA 2A69F 3CUOA 4ENKA 2LDUA 5FB2A 4HLYA 2H94A 3K9TA 3I53A 3I59B 3VOEA 3WODF 2OQRA 1YFHA 2QQBA 3V7CA 3DPLC 2X4HA 5DEQA 2VXZA 1YS6A 5LBQA 1K78B 2HWVA 4P96A 2K4BA 1FPQA 4G7OF 1B9MA 2CSOA 3BDDA 1I5ZA 2PN6A 1R1UA 4FT8A 1I1SA 3CTAA 2Z3YA 5L3DA 2V79A 3MCZA 3F21A 3HTUA 1UB9A 1K6OA 2FF4A 2IA1A 3JAMZ 4F7ZA 4ON0A 4CDGA 5BMZA 1KU3A 1MKMA 3GX4X 2L02A 3BJ6A 4YFXF 3ROUA 3EYYA 2PMUA 4GXOA 2RC4A 4MNUA 2HEOA 1XSXA 1EH8A 5L3FA 3U2RA 5TJJA 2LF8A 3O2PE 3FF5A 3BPVA 1SFXA 4QWQA 5AONA 2QQ9A 5BOXA 4CZZA 5JR3A 5D5XB 1UHWA 1BBYA 1V4RA 2KIMA 1U3EM 5IT9K 3F8CA 6PAXA 1BIAA 1YLFA 1T39A 3CUQA 4LMYA 1KU2A 2Y0MA 3ZMTA 2JSCA 5EEHA 5A2QK 1MDMB 1XMAA 3T8TA 1BI2A 3FMQA 1BJAA 4DQ2A 2VBXA 3ZMVA 4AVPA 1AWCA 4HYEA 2CYYA 3MQ0A 4KT5C 2J5OA 3ULQB 3EQLF 2EFQA 2FXAA 2PEXA 1D5VA 4NB5A 4M9SA 4YIIA 1J9IA 2PI0A 4KDPA 4Q48A 2IA0A 1LNWA 4AD9A 2YSRA 2XGXA 5FFXA 1R58A 3RDIA 1OYWA 5E20A 3BPXA 5E17F 3Q5FA 4K2EA 1C0WA 3GO5A 4WXHA 4HOBA 2NRAC 3LFKA 3DF8A 5E8GA 4ESBA 4ZZLA 5CVVA 3D5LA 4ZH4F 2K27A 1IXCA 3ABTA 3KP7A 2HZTA 4Y15A 4CICA 2AS5F 3BROA 5D6EA 1FY7A 1K7AA 4HLXA 5HOOA 2WC2A 4XLPF 3RYPA 5K1YA 1DPRA 5ICFA 1QQIA 1I6XA 5ICGA 3SXYA 2DK8A 4H0EA 3E6CC 3VB2A 1QGPA 1KYWA 3HRTA 2JZYA 4UVCA 1LB2A 2DTRA 1SMYF 4A2UA 3SHFA 3NRVA 1TW3A 2OD5A 1QBJA 4BHPA 2NYXA 2O61A 3HSEA 3WGHA 5HDKA 1T38A 1DDNA 3T8RA 2XAQA 1XCBA 2Z5UA 3L00A 4I7HA 2A6EF 3TQNA 4EVIA 2ZJ2A 2NS0A 2B0LA 2W84A 4L5IA 2OZ6A 5CVIA 2HQNA 4NQWA 4P9UA 2QUFA 1UCRA 3KP6A 2BGCA 1ZYRF 3M7GA 4A5MA 3KE2A 1YG2A 3TO6A 3E97A 3FZVA 3JSPA 3E5QA 1NHAA 3RPUA 2QBYB 1XN7A 1U5TA 3P9CA 4UNOA 4Y17A 1LQ1A 1ZLKA 1FSEA 1JHHA 4ETSA 4GGGA 2RDPA 3LSTA 5LEJA 1ZG3A 4A0XA 3J81Z 5DCMA 1W7PA 4M73A 5CJ9A 4L9VA 3DEUA 1P2FA 1Z05A 4FX4A 4IJAA 1WKMA 3F8BA 2K7LA 2ISYA 3KETA 1W5SA 4BYYA 3GFIA 1Q1HA 3WGGA 3K1PA 4BAYA 2DW4A 5FD5A 3KP2A 2IW5A 4U7DA 2ZO4A 4BNCA 2M1BA 2XUBA 3GYHX 4WWCA 3WTSC 3S2WA 4ASNA 3F23A 4O3MA 5H20A 1LJ9A 4A0ZA 4G9YA 5JFRA 3QPTA 1XMKA 1USSA 3C1DA 1FYMA 3HYIA 4M72A 3T1BA 3I71A 3HRUA 3E5XA 1IRFA 3JTHA 3GWZA 1Z7UA 5CLSA 5FLXZ 4UXNA 3LAJA 5ILUA 3HRSA 1GXQA 1FNNA 2FBHA 2PBIA 3QRFF 5BQTA 4IVNA 2PLYA 2V1DA 4RB2C 3V8JA 3HHGA 1F5TA 3CJNA 4Z2YA 3WU1B 1O3RA 3KZYA 3VFZA 3CUQB 2F5DA 1FBUA 3HIFA 4N0BA 4RGSA 4ESFA 1U2WA 5DUKA 3PQKA 3GZ6A 2V1UA 1FP1D 1W4MA 2GIVA 1WQ2A 1OYYA 1BI0A 5E1WA 2P7CB 1HW1A 3F8FA 3LA2A 2GWRA 4ENJA 2H27A 3C18A 1UHMA 2ESNA 2GAUA 2G9WA 2RNJA 3BJOA 2LSOA 1PUEE 1W5TA 2CW0F 3P9KA 4IRGA 4RB0A 5IT9Z 3IWFA 3SZTA 1SD4A 5HS9A 3WG9A 2EWNA 2VODA 4WXDA 1BI1A 2RGVA 2ZBKA 2C6YA 2YR2A 3GLXA 3FM5A 4ZYGA 3ZQ7A 2E7WA 2FA5A 4RAZA 3BP8A 5A2QZ 4ENMA 1MJ9A 3ECHA 3T5XA 3J7AO 2EFPA 4TV7A 5BPIA 2J5PA 3BZ6A 3DP7A 1G3SA 5K5OA 3RKXA 2YPRA 5D5WB 3IRQA 4AIKA 4NHJA 2ELHA 1J5YA 1ZRFA 1FT9A 5LRRA 3WTZA 3CLOA 4PZJA 4MTEA 4M6YA 3OV8A 2JRTA 1T2KA 2UWMA 2HS5A 2WWYA 4HAMA 2YX4A 2LKPA 2D45A 1G3YA 4UHTA 4KNYA 5FLXK 1VTNC 4I09A 4IRHA 2H6CA 3ZN1A 1T0FA 3DPTA 3REOA 3R6SA 4U0YA 2OQGA 3ZMUA 5ICCA 2VOOA 2XAHA 1TW2A 2QZ8A 4QLCU 2K02A 2VN2A 3H3ZA 4BHCA 5FD6A 4KYWA 4MHGA 4RS8A 2ISZA 3WTTC 3LQQA 2DO7A 2ZNYA 3QU3A 1R5GA 3F6OA 2EJRA 3U1DA 1GXPA 2VE8A 3P9IA 2IT0A 1O7LA 2W25A 4PGGA 2Q0OA 2IP2A 1ZARA 2XAFA 2EK5A 4OINF 5DD8A 3JSOA 3IHUA 4ENNA 3K69A 2ADUA 3GFJA 1BC7C 3MZYA 2CG4A 1TQMA 3EUHA 1IXSB 1CF7A 1TBXA 2PFBA 3K2ZA 4U7BA 2OZUA 1F4KA 5DCMB 1W7PB 3KP3A 4MEYF 2A07F 1L3LA 1WRJA 1GHCA 2IJLA 3CDHA 1ULYA 4HX4A 2XKPA 2MLKA 2PQ8A 3MFKA 3RKYA 4B8XA 4OMYA 3G3ZA 1XSVA 4MQVA 2L54A 2GXBA 4LLLA 2XVCA 5JI6A 1FBSA 4I2OA 1ZRDA 3Q9SA 2DQLA 1RZ4A 2V1XA 1FYKA 2HR3A 1KYZA 2RV8A 4U88A 3FHZA 2F5FA 2G7UA 3KEOA 3R60A 3EYIA 1XSDA 4RGXA 1EH7A 5LHGA 5D5VB 3M8EA 1FBQA 4LJZF 3WTYC 1TTYA 1WWXA 1Z6RA 1QZYA 4FX0A 3HHHA 4LFUA 4ZYEA 2BV6A 3WGIA 4EV0A 4I98B 1JGSA 4OIOF 2FSWA 5ED4A 1R5HA 3GEZA 3BY6A 2P6TA 3TOAA 3LWFA 2HOEA 1OYIA 2OBPA 3KEQA 4M74A 1I1GA 3LQRA 2PJPA 4UUVA 1IN4A 4KN4X 1YS7A 1O7FA 3KZZA 2E1CA 2F5EA 3TGNA 4GYIA 1RIOH 4KIFA 5CVJA 2P5LC 2DPUA 2Y75A 2A6HF 4L0ZB 3TKYA 1KQ8A 4Y13A 4MGRA 4LK0F 2Z9OA 2EB7A 3TOBA 2R7DA 1G6NA 1LEAA 2PG4A 2QWWA 1IN7A 1HQCA 3V8LA 2GA1A 1RNLA 4A12A 1B9NA 1S7AA 1ZGJA 3GUDA 3I64A 5DD4A 2HDCA 1HW5A 3LA3A 4HV6A 1EH6A 2E7XA 2XHKA 1GVJA 1WI9A 2FEZA 2MH2A 1D8JA 3RYRA 2EFOA 1K79A 4DNCA 3LAPA 2BYVE 3ABUA 3J80K 5E1ZB 1OR7A 5D4RA 1REPC 2JT1A 4EM1A 2GXGA 1CGPA 1P4AA 1TLHB 2JPBA 2OA4A 3QU6A 1FC3A 3E5UA 4HDUA 3SQNA 3I54A 1B6AA 2OU2A 4U0VA 1H0MA 4KUMA 4BH9A 1OKRA 3C7JA 5ERIA 1KGSA 2OAZA 2HTSA 2IVMA 3GW2A 5E8IA 2XIGA 1HW2A 4YFKF 3IL2A 2ZNZA 1BIBA 3F6VA 4Q5SF 1J2XA 3V8KA 3ZP5A 1BN5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PQJ A;  2DBB A;  2HKX A;  3CUQ C;  3M8F A;  1O57 A;  4Q4Z F;  1U6G A;  1ZRC A;  1KU7 A;  2XV4 S;  4L9N A;  4EJU A;  5H6Q A;  4N9H A;  1BI3 A;  3HTS B;  5D8L B;  1QNT A;  2WV0 A;  2QM3 A;  4EMS A;  2M30 A;  3L9F A;  4AIJ A;  2VBW A;  2DK5 A;  2QVO A;  1MJA A;  2V9V A;  5LGT A;  4KMF A;  1P4W A;  5HDN A;  4CGZ A;  1D3Y A;  1QPM A;  3L09 A;  3TDU C;  1DUX C;  1A04 A;  5L3E A;  4HF2 A;  1L0O C;  3N4M A;  4R79 A;  1ON1 A;  2Q8K A;  1V3F A;  1D8K A;  4I01 A;  2Q2E A;  2MA3 A;  2DLL A;  3IRR A;  5K5R A;  4HV5 A;  1FYL A;  2QYO A;  3DQV C;  2LF7 A;  5DCF A;  3W6J B;  4PCQ A;  3ELK A;  2FOK A;  1W7P D;  2EA4 A;  2EV6 A;  3U9G A;  3H92 A;  1WSU A;  1ZLJ A;  3RI4 A;  2VON A;  2L01 A;  3NEU A;  4FHT A;  2XKO A;  1IW7 F;  4AIH A;  2D1V A;  1TQP A;  1G4D A;  3F8M A;  1P92 A;  1SD5 A;  1R1T A;  3HRM A;  1IZ1 A;  2XAG A;  4RGU A;  2FE3 A;  1ODD A;  4RGR A;  1XDS A;  4OIR F;  3BWG A;  4KIC A;  3DKW A;  1P4X A;  4HF1 A;  2W24 A;  4OOI A;  4IRI A;  4JBA A;  1LDJ A;  4IHS A;  5LLQ A;  5L3G A;  5LHH A;  4B09 A;  1R36 A;  2HFH A;  2JPC A;  3G73 A;  4BHB A;  4LB6 B;  3JW4 A;  1J59 A;  1JHF A;  2KIU A;  4EGZ A;  2A61 A;  1F1Z A;  1YW7 A;  3OOP A;  5F1R A;  2ACJ A;  2HKO A;  2EV5 A;  3ECO A;  1S8N A;  4MTD A;  2HTJ A;  2GQQ A;  2VC1 A;  3R61 A;  4ZYD A;  1KQ0 A;  1JE8 A;  3ZPL A;  2W85 A;  3COA C;  1STZ A;  4IXA A;  1ZRE A;  3IWZ A;  4S04 A;  1I27 A;  1YQA A;  3HOS A;  4RAY A;  1HKS A;  4L18 B;  1S29 A;  3JTG A;  2EV0 A;  3F8N A;  1HKQ A;  5JHU A;  4HF0 A;  1IF1 A;  2DFI A;  1ZG1 A;  3ML6 A;  1FX7 A;  3ZMD A;  2FMY A;  1G3W A;  1R00 A;  5IT3 A;  2O6G E;  3MWM A;  1J7K A;  3B73 A;  4LG0 A;  1ZHF A;  4PDK A;  4G6Q A;  2MH9 A;  4EJW A;  2P6S A;  5FO5 A;  1O3T A;  2H09 A;  2FU4 A;  2BEO A;  1U8R A;  4GCV A;  5FGM A;  2A68 F;  1YTY A;  4A6D A;  2FQ3 A;  2HYF A;  4EGY A;  4HX7 A;  3IKV A;  3R0J A;  3GZ5 A;  3NQO A;  1R1V A;  2K86 A;  3TO7 A;  4RB3 C;  2A5Y B;  4KMU X;  1BC8 C;  3TDZ C;  3RKW A;  2DQR A;  1H9G A;  5L3C A;  1B4A A;  2NAZ A;  4OU0 A;  5DYM A;  1AOY A;  1LDK B;  3QPH A;  1ON2 A;  3F22 A;  2QLZ A;  4MEX F;  1PP8 F;  3KLN A;  5HVQ C;  3IKT A;  3QOP A;  2D1H A;  3FX3 A;  1HST A;  3WTX C;  4XSX F;  4WF2 A;  1U5T B;  2R7F A;  3MAJ A;  1LDD A;  1O3Q A;  4WX9 A;  1X3U A;  2L4M A;  4G7Z F;  3DV8 A;  5K5Q A;  3V7S A;  3GFL A;  4KA4 A;  3K1M A;  3ERE D;  1ZH5 A;  2O8X A;  5D8K B;  2ZCW A;  5E18 F;  3CO7 C;  4G7H F;  1SAX A;  1ZGA A;  4I0A A;  2RQP A;  3PFI A;  3WE3 A;  3QAH A;  1YYV A;  4HDV A;  4HQE A;  4ZYH A;  2JTV A;  3DXJ F;  3O3K A;  3FWE A;  2MD5 A;  1R22 A;  2WTE A;  2VE9 A;  1XB4 A;  2P5V A;  1KQ9 A;  5LGU A;  4BXU A;  1P6R A;  3J80 Z;  4EQQ A;  4XRF A;  3SFZ A;  4D0P A;  4IF4 A;  5CVR A;  3V7R A;  1MD0 A;  3B02 A;  1Z9C A;  2HYG D;  3I58 A;  5LRS A;  5J6X A;  1XGO A;  1YW9 A;  4E70 A;  3L7W A;  4LLN A;  4A6E A;  1SD6 A;  5J8C A;  1XDU A;  3FM3 A;  3GXO A;  2ZXJ A;  5DUI A;  4WXC A;  4IPA A;  1HKT A;  3R0A A;  1DPU A;  1T6S A;  2ZME A;  3I0T A;  4HX8 A;  2P7V B;  4IHT A;  2M5W A;  1MGT A;  5F6F A;  5BS6 A;  4CYD A;  1RUO A;  2FML A;  5J8F A;  1FZP B;  5HLG A;  4KIB A;  4OIQ F;  1E17 A;  4G6D A;  3MEX A;  3GFM A;  5HDG A;  3W6K B;  2FRH A;  1YW8 A;  3EET A;  3D0S A;  1HXD A;  1QO0 D;  4KFC A;  5AIQ A;  2IRF G;  2FBK A;  2HQR A;  3BJA A;  4HZF A;  2LNB A;  1S6L A;  1Z91 A;  1HSJ A;  3Q9V A;  4OIP F;  1Z6T A;  2V6C A;  4P9F A;  2CGP A;  2MLG A;  1FSH A;  1J0R A;  2EFN A;  4M6X A;  3WTV C;  2FNA A;  1JXS A;  1FOK A;  2AXL A;  2K4J A;  2RKH A;  5LHI A;  1IAW A;  4UV9 A;  3JAM K;  3QP6 A;  2XAS A;  2UZK A;  4EJT A;  1FLI A;  5D6F A;  1HBX G;  5LEK A;  4L9T A;  3GVA A;  3KFW X;  3KP5 A;  4YFN F;  4G8X A;  4JQF A;  3O6B B;  4WK8 F;  4LGW A;  4N9I A;  3AAF A;  5TRD A;  1E2X A;  4A5N A;  2E1N A;  3L2C A;  2XRN A;  4CHU A;  5JVT A;  2NNY A;  2KKO A;  1MJB A;  3FXR A;  3I59 A;  4CXF A;  4LLG F;  4L0Y B;  1BM9 A;  1F9N A;  1PP7 U;  2F5C A;  2M8E A;  2L3D A;  1K78 A;  4GYG A;  3RJP A;  2MBF A;  2IA2 A;  2RVC A;  1TQI A;  3WTW C;  2BBY A;  3E6D A;  4UVB A;  3T0Y A;  2A3S A;  1LEB A;  1B59 A;  5ICE A;  2CFX A;  4GO1 A;  4ESJ A;  4PGH A;  2HGC A;  2ZFW A;  3FXU A;  5KK1 A;  2EFW A;  1SD7 A;  1UST A;  4CO8 A;  5HLI A;  3HOT A;  3TO9 A;  1SFU A;  4EJO A;  1XGN A;  2KRF A;  1TNS A;  2QEN A;  4R8H A;  4LG0 B;  3HUG A;  3E3V A;  4EM0 B;  1YO5 C;  2VT3 A;  3R4K A;  3V4G A;  5DDG A;  3E6B A;  5ILV A;  4XLN F;  1ZN2 A;  1EV7 A;  1RI7 A;  2PMH A;  3LA7 A;  1XGM A;  2VC0 A;  4JK1 X;  2TDX A;  4KIG A;  1B1B A;  3KP4 A;  3WTU C;  1FP2 A;  4UVA A;  2QQA A;  1OPC A;  2NNN A;  4YIF A;  2XRO A;  2Z33 A;  1LVA A;  4L9J A;  4LK1 F;  1R7J A;  3RIR A;  2FBI A;  1BOA A;  2KJC A;  2ETH A;  2CWE A;  3E6M A;  1IRG A;  5L3B A;  4HQM A;  4I02 A;  4YG2 F;  1KU9 A;  2P5K A;  3HSF A;  2O3F A;  4KN7 X;  2VOP A;  4G94 A;  1XGS A;  3P7N A;  3BOQ A;  4R1H A;  3K0L A;  3VOD A;  1MDM A;  2DU9 A;  1IXR C;  2FNP A;  5E1X A;  1ONV A;  2DI3 A;  2GZW A;  5H6R A;  2Z99 A;  3SZP A;  3K1N A;  5EEG A;  2STW A;  1DP7 P;  4XBF A;  1SFE A;  1CF7 B;  4O5V A;  4MQ9 F;  3C3W A;  5CVU A;  1OMI A;  5D4S A;  2KJB A;  3VEP A;  4OMZ A;  2EA2 A;  1UFM A;  1XCV A;  2YU3 A;  1S7O A;  2COM A;  3WE2 A;  3IC7 A;  1H9T A;  4LB5 A;  3ZMZ A;  1TNT A;  2CO5 A;  1IN8 A;  2YX7 A;  3QP5 A;  4O6J A;  3MZH A;  2Y48 A;  2F2E A;  1YIO A;  2XAJ A;  4U0W A;  3GF2 A;  4Q47 A;  4LD5 A;  1FWZ A;  4ZZD A;  2UXN A;  5HS7 A;  5BPD A;  1Y0U A;  3F3X A;  2DAO A;  1QZZ A;  4M9X A;  2VT2 A;  4RB1 A;  1MZB A;  5F64 A;  3FMS A;  2L4A A;  4HW0 A;  4L5J A;  5HS8 A;  4M9Z A;  5KVR A;  1IN5 A;  4P55 A;  1ZG5 A;  3FXQ A;  4BQA A;  1XD7 A;  2STT A;  2ZME B;  2P4W A;  1ZAO A;  2CQK A;  3M1E A;  4A0Y A;  4EM2 A;  1Z1D A;  4M71 A;  5AIP A;  3WU0 A;  2O0Y A;  5DV5 A;  4P5O A;  2X0L A;  3CO6 C;  2IPQ X;  3RPQ A;  2R3S A;  2ZKZ A;  5CYV A;  2MC3 A;  2G7H A;  3H3U A;  3KCC A;  2M87 A;  3J81 K;  1G3T A;  4UV8 A;  4AWX B;  3RTR A;  3I4P A;  1RUN A;  2D2W A;  1SMT A;  3KLO A;  5LGN A;  3EDP A;  1U78 A;  5ILS A;  3HSR A;  5HLH A;  1KA8 A;  2DT5 A;  1U5T C;  1O3S A;  5D5U B;  2KIF A;  3FMR A;  2VBY A;  3N97 A;  2ESH A;  4I0B A;  1S3J A;  1T98 A;  2DPD A;  2H6B A;  3ZMS A;  1IN6 A;  3ISP A;  1PDN C;  5FFZ A;  2VBZ A;  3DFG A;  2BE5 F;  2P8T A;  2RN7 A;  1R23 A;  4HA8 A;  3ZN0 A;  2UXX A;  1J75 A;  3I5U A;  2W57 A;  2GA2 A;  2O03 A;  3M9A A;  4XSZ F;  2QBY A;  2M45 A;  3F72 A;  4S05 A;  4EJV A;  4HBL A;  4WCG A;  1IUY A;  2A69 F;  3CUO A;  4ENK A;  2LDU A;  5FB2 A;  4HLY A;  2H94 A;  3K9T A;  3I53 A;  3I59 B;  3VOE A;  3WOD F;  2OQR A;  1YFH A;  2QQB A;  3V7C A;  3DPL C;  2X4H A;  5DEQ A;  2VXZ A;  1YS6 A;  5LBQ A;  1K78 B;  2HWV A;  4P96 A;  2K4B A;  1FPQ A;  4G7O F;  1B9M A;  2CSO A;  3BDD A;  1I5Z A;  2PN6 A;  1R1U A;  4FT8 A;  1I1S A;  3CTA A;  2Z3Y A;  5L3D A;  2V79 A;  3MCZ A;  3F21 A;  3HTU A;  1UB9 A;  1K6O A;  2FF4 A;  2IA1 A;  3JAM Z;  4F7Z A;  4ON0 A;  4CDG A;  5BMZ A;  1KU3 A;  1MKM A;  3GX4 X;  2L02 A;  3BJ6 A;  4YFX F;  3ROU A;  3EYY A;  2PMU A;  4GXO A;  2RC4 A;  4MNU A;  2HEO A;  1XSX A;  1EH8 A;  5L3F A;  3U2R A;  5TJJ A;  2LF8 A;  3O2P E;  3FF5 A;  3BPV A;  1SFX A;  4QWQ A;  5AON A;  2QQ9 A;  5BOX A;  4CZZ A;  5JR3 A;  5D5X B;  1UHW A;  1BBY A;  1V4R A;  2KIM A;  1U3E M;  5IT9 K;  3F8C A;  6PAX A;  1BIA A;  1YLF A;  1T39 A;  3CUQ A;  4LMY A;  1KU2 A;  2Y0M A;  3ZMT A;  2JSC A;  5EEH A;  5A2Q K;  1MDM B;  1XMA A;  3T8T A;  1BI2 A;  3FMQ A;  1BJA A;  4DQ2 A;  2VBX A;  3ZMV A;  4AVP A;  1AWC A;  4HYE A;  2CYY A;  3MQ0 A;  4KT5 C;  2J5O A;  3ULQ B;  3EQL F;  2EFQ A;  2FXA A;  2PEX A;  1D5V A;  4NB5 A;  4M9S A;  4YII A;  1J9I A;  2PI0 A;  4KDP A;  4Q48 A;  2IA0 A;  1LNW A;  4AD9 A;  2YSR A;  2XGX A;  5FFX A;  1R58 A;  3RDI A;  1OYW A;  5E20 A;  3BPX A;  5E17 F;  3Q5F A;  4K2E A;  1C0W A;  3GO5 A;  4WXH A;  4HOB A;  2NRA C;  3LFK A;  3DF8 A;  5E8G A;  4ESB A;  4ZZL A;  5CVV A;  3D5L A;  4ZH4 F;  2K27 A;  1IXC A;  3ABT A;  3KP7 A;  2HZT A;  4Y15 A;  4CIC A;  2AS5 F;  3BRO A;  5D6E A;  1FY7 A;  1K7A A;  4HLX A;  5HOO A;  2WC2 A;  4XLP F;  3RYP A;  5K1Y A;  1DPR A;  5ICF A;  1QQI A;  1I6X A;  5ICG A;  3SXY A;  2DK8 A;  4H0E A;  3E6C C;  3VB2 A;  1QGP A;  1KYW A;  3HRT A;  2JZY A;  4UVC A;  1LB2 A;  2DTR A;  1SMY F;  4A2U A;  3SHF A;  3NRV A;  1TW3 A;  2OD5 A;  1QBJ A;  4BHP A;  2NYX A;  2O61 A;  3HSE A;  3WGH A;  5HDK A;  1T38 A;  1DDN A;  3T8R A;  2XAQ A;  1XCB A;  2Z5U A;  3L00 A;  4I7H A;  2A6E F;  3TQN A;  4EVI A;  2ZJ2 A;  2NS0 A;  2B0L A;  2W84 A;  4L5I A;  2OZ6 A;  5CVI A;  2HQN A;  4NQW A;  4P9U A;  2QUF A;  1UCR A;  3KP6 A;  2BGC A;  1ZYR F;  3M7G A;  4A5M A;  3KE2 A;  1YG2 A;  3TO6 A;  3E97 A;  3FZV A;  3JSP A;  3E5Q A;  1NHA A;  3RPU A;  2QBY B;  1XN7 A;  1U5T A;  3P9C A;  4UNO A;  4Y17 A;  1LQ1 A;  1ZLK A;  1FSE A;  1JHH A;  4ETS A;  4GGG A;  2RDP A;  3LST A;  5LEJ A;  1ZG3 A;  4A0X A;  3J81 Z;  5DCM A;  1W7P A;  4M73 A;  5CJ9 A;  4L9V A;  3DEU A;  1P2F A;  1Z05 A;  4FX4 A;  4IJA A;  1WKM A;  3F8B A;  2K7L A;  2ISY A;  3KET A;  1W5S A;  4BYY A;  3GFI A;  1Q1H A;  3WGG A;  3K1P A;  4BAY A;  2DW4 A;  5FD5 A;  3KP2 A;  2IW5 A;  4U7D A;  2ZO4 A;  4BNC A;  2M1B A;  2XUB A;  3GYH X;  4WWC A;  3WTS C;  3S2W A;  4ASN A;  3F23 A;  4O3M A;  5H20 A;  1LJ9 A;  4A0Z A;  4G9Y A;  5JFR A;  3QPT A;  1XMK A;  1USS A;  3C1D A;  1FYM A;  3HYI A;  4M72 A;  3T1B A;  3I71 A;  3HRU A;  3E5X A;  1IRF A;  3JTH A;  3GWZ A;  1Z7U A;  5CLS A;  5FLX Z;  4UXN A;  3LAJ A;  5ILU A;  3HRS A;  1GXQ A;  1FNN A;  2FBH A;  2PBI A;  3QRF F;  5BQT A;  4IVN A;  2PLY A;  2V1D A;  4RB2 C;  3V8J A;  3HHG A;  1F5T A;  3CJN A;  4Z2Y A;  3WU1 B;  1O3R A;  3KZY A;  3VFZ A;  3CUQ B;  2F5D A;  1FBU A;  3HIF A;  4N0B A;  4RGS A;  4ESF A;  1U2W A;  5DUK A;  3PQK A;  3GZ6 A;  2V1U A;  1FP1 D;  1W4M A;  2GIV A;  1WQ2 A;  1OYY A;  1BI0 A;  5E1W A;  2P7C B;  1HW1 A;  3F8F A;  3LA2 A;  2GWR A;  4ENJ A;  2H27 A;  3C18 A;  1UHM A;  2ESN A;  2GAU A;  2G9W A;  2RNJ A;  3BJO A;  2LSO A;  1PUE E;  1W5T A;  2CW0 F;  3P9K A;  4IRG A;  4RB0 A;  5IT9 Z;  3IWF A;  3SZT A;  1SD4 A;  5HS9 A;  3WG9 A;  2EWN A;  2VOD A;  4WXD A;  1BI1 A;  2RGV A;  2ZBK A;  2C6Y A;  2YR2 A;  3GLX A;  3FM5 A;  4ZYG A;  3ZQ7 A;  2E7W A;  2FA5 A;  4RAZ A;  3BP8 A;  5A2Q Z;  4ENM A;  1MJ9 A;  3ECH A;  3T5X A;  3J7A O;  2EFP A;  4TV7 A;  5BPI A;  2J5P A;  3BZ6 A;  3DP7 A;  1G3S A;  5K5O A;  3RKX A;  2YPR A;  5D5W B;  3IRQ A;  4AIK A;  4NHJ A;  2ELH A;  1J5Y A;  1ZRF A;  1FT9 A;  5LRR A;  3WTZ A;  3CLO A;  4PZJ A;  4MTE A;  4M6Y A;  3OV8 A;  2JRT A;  1T2K A;  2UWM A;  2HS5 A;  2WWY A;  4HAM A;  2YX4 A;  2LKP A;  2D45 A;  1G3Y A;  4UHT A;  4KNY A;  5FLX K;  1VTN C;  4I09 A;  4IRH A;  2H6C A;  3ZN1 A;  1T0F A;  3DPT A;  3REO A;  3R6S A;  4U0Y A;  2OQG A;  3ZMU A;  5ICC A;  2VOO A;  2XAH A;  1TW2 A;  2QZ8 A;  4QLC U;  2K02 A;  2VN2 A;  3H3Z A;  4BHC A;  5FD6 A;  4KYW A;  4MHG A;  4RS8 A;  2ISZ A;  3WTT C;  3LQQ A;  2DO7 A;  2ZNY A;  3QU3 A;  1R5G A;  3F6O A;  2EJR A;  3U1D A;  1GXP A;  2VE8 A;  3P9I A;  2IT0 A;  1O7L A;  2W25 A;  4PGG A;  2Q0O A;  2IP2 A;  1ZAR A;  2XAF A;  2EK5 A;  4OIN F;  5DD8 A;  3JSO A;  3IHU A;  4ENN A;  3K69 A;  2ADU A;  3GFJ A;  1BC7 C;  3MZY A;  2CG4 A;  1TQM A;  3EUH A;  1IXS B;  1CF7 A;  1TBX A;  2PFB A;  3K2Z A;  4U7B A;  2OZU A;  1F4K A;  5DCM B;  1W7P B;  3KP3 A;  4MEY F;  2A07 F;  1L3L A;  1WRJ A;  1GHC A;  2IJL A;  3CDH A;  1ULY A;  4HX4 A;  2XKP A;  2MLK A;  2PQ8 A;  3MFK A;  3RKY A;  4B8X A;  4OMY A;  3G3Z A;  1XSV A;  4MQV A;  2L54 A;  2GXB A;  4LLL A;  2XVC A;  5JI6 A;  1FBS A;  4I2O A;  1ZRD A;  3Q9S A;  2DQL A;  1RZ4 A;  2V1X A;  1FYK A;  2HR3 A;  1KYZ A;  2RV8 A;  4U88 A;  3FHZ A;  2F5F A;  2G7U A;  3KEO A;  3R60 A;  3EYI A;  1XSD A;  4RGX A;  1EH7 A;  5LHG A;  5D5V B;  3M8E A;  1FBQ A;  4LJZ F;  3WTY C;  1TTY A;  1WWX A;  1Z6R A;  1QZY A;  4FX0 A;  3HHH A;  4LFU A;  4ZYE A;  2BV6 A;  3WGI A;  4EV0 A;  4I98 B;  1JGS A;  4OIO F;  2FSW A;  5ED4 A;  1R5H A;  3GEZ A;  3BY6 A;  2P6T A;  3TOA A;  3LWF A;  2HOE A;  1OYI A;  2OBP A;  3KEQ A;  4M74 A;  1I1G A;  3LQR A;  2PJP A;  4UUV A;  1IN4 A;  4KN4 X;  1YS7 A;  1O7F A;  3KZZ A;  2E1C A;  2F5E A;  3TGN A;  4GYI A;  1RIO H;  4KIF A;  5CVJ A;  2P5L C;  2DPU A;  2Y75 A;  2A6H F;  4L0Z B;  3TKY A;  1KQ8 A;  4Y13 A;  4MGR A;  4LK0 F;  2Z9O A;  2EB7 A;  3TOB A;  2R7D A;  1G6N A;  1LEA A;  2PG4 A;  2QWW A;  1IN7 A;  1HQC A;  3V8L A;  2GA1 A;  1RNL A;  4A12 A;  1B9N A;  1S7A A;  1ZGJ A;  3GUD A;  3I64 A;  5DD4 A;  2HDC A;  1HW5 A;  3LA3 A;  4HV6 A;  1EH6 A;  2E7X A;  2XHK A;  1GVJ A;  1WI9 A;  2FEZ A;  2MH2 A;  1D8J A;  3RYR A;  2EFO A;  1K79 A;  4DNC A;  3LAP A;  2BYV E;  3ABU A;  3J80 K;  5E1Z B;  1OR7 A;  5D4R A;  1REP C;  2JT1 A;  4EM1 A;  2GXG A;  1CGP A;  1P4A A;  1TLH B;  2JPB A;  2OA4 A;  3QU6 A;  1FC3 A;  3E5U A;  4HDU A;  3SQN A;  3I54 A;  1B6A A;  2OU2 A;  4U0V A;  1H0M A;  4KUM A;  4BH9 A;  1OKR A;  3C7J A;  5ERI A;  1KGS A;  2OAZ A;  2HTS A;  2IVM A;  3GW2 A;  5E8I A;  2XIG A;  1HW2 A;  4YFK F;  3IL2 A;  2ZNZ A;  1BIB A;  3F6V A;  4Q5S F;  1J2X A;  3V8K A;  3ZP5 A;  1BN5 A; 
#chains in the Genus database with same CATH topology
 3PQJ A;  2DBB A;  3IH4 A;  2LG4 A;  4CA0 A;  2CRG A;  2HKX A;  3FIW A;  3CUQ C;  3M8F A;  3VYT B;  4B43 A;  3L1P A;  1BW5 A;  5FRN A;  4JX5 A;  1IRZ A;  1O57 A;  4Q4Z F;  1U6G A;  1ZRC A;  1V5F A;  1KU7 A;  2XV4 S;  4L9N A;  3Q3S A;  1UMQ A;  4F55 A;  4EJU A;  5H6Q A;  1SAU A;  1NH3 A;  4N9H A;  1BI3 A;  3HTS B;  2VB6 A;  1IRX A;  2M2E A;  3K2A A;  3LMM A;  1Z3Y A;  5D8L B;  2XSJ C;  4Y52 J;  2M34 A;  1QNT A;  1Z7L A;  3RQ4 A;  2ZME C;  4XM3 A;  2WV0 A;  2QM3 A;  2AQF A;  4PUS A;  1YIT I;  4EMS A;  5HNH A;  2M30 A;  5M5Y J;  3L9F A;  4IX7 A;  2CQQ A;  4AIJ A;  1O4X A;  2VBW A;  2DK5 A;  2QVO A;  1MJA A;  1X58 A;  2V9V A;  1MIJ A;  5LGT A;  4J01 A;  3TL4 X;  5EZH A;  3K10 A;  2QSH X;  4KMF A;  3DU5 A;  1LUJ B;  4M6V A;  1P4W A;  4YRV A;  5HDN A;  4CGZ A;  5F0H A;  2DJN A;  1D3Y A;  4XKW A;  3D1N I;  1QPM A;  3L09 A;  3TDU C;  5IPA A;  4Y7N J;  3A1Y A;  1DUX C;  4E6K G;  1A04 A;  5L3E A;  4HF2 A;  1L0O C;  3SDB A;  3S2D J;  4LG3 A;  4DW6 A;  1IC8 A;  3H0G J;  3RPU D;  3N4M A;  4R79 A;  1ON1 A;  2Q8K A;  1V3F A;  1W0T A;  1D8K A;  1A6Q A;  1YJN I;  3CCM I;  4I01 A;  2Q2E A;  2MA3 A;  3K4C A;  2DLL A;  3IRR A;  5K5R A;  3KX2 A;  4HV5 A;  3LFU A;  1FYL A;  2QYO A;  4HNU A;  3QYB A;  3DQV C;  2M0C A;  2LF7 A;  5DCF A;  3W6J B;  4J19 A;  2R7X A;  2EIK H;  3CJR B;  4IHY A;  4PCQ A;  3ELK A;  2FOK A;  1W7P D;  2H8W A;  3CC4 I;  2EA4 A;  2HPM A;  4PFP A;  2LVS A;  3KIO A;  1N75 A;  5F0F A;  4M3F A;  1WJD A;  2EV6 A;  2VI6 A;  1QHG A;  3U9G A;  2L2O A;  3H92 A;  1WSU A;  1ZLJ A;  2LYC A;  3RI4 A;  2OPT A;  2KRC A;  2VON A;  2L01 A;  3NEU A;  2BW3 A;  4FHT A;  2EIJ H;  4IEJ A;  2XKO A;  1IW7 F;  2LRE A;  3FDY A;  4AIH A;  2QSG X;  2WV1 A;  2D1V A;  1TQP A;  1G4D A;  3F8M A;  1P92 A;  1SD5 A;  3HC7 A;  3O8G A;  3VYR B;  1R1T A;  3DTE A;  3ZQC A;  4IQ4 A;  3A01 B;  3HRM A;  1IZ1 A;  1MSF C;  3FIS A;  2XAG A;  4RGU A;  4CCK A;  2VQC A;  2FE3 A;  1ODD A;  5GAD J;  2CH0 A;  4RGR A;  2GBY A;  1XDS A;  4OIR F;  3BWG A;  3IUO A;  4KIC A;  3ZR8 X;  3DKW A;  2EZH A;  1P7J A;  1P4X A;  4NDL A;  4HF1 A;  4IHW A;  1I3Q J;  2W24 A;  4OOI A;  3I56 I;  1DGW Y;  2LR8 A;  2MFZ A;  4IRI A;  2BXZ A;  9ANT A;  1DP3 A;  5FKL A;  4JBA A;  3OR1 C;  1LDJ A;  3PNV A;  4IHS A;  1D0X A;  4XRS A;  5LLQ A;  1EA3 A;  5L3G A;  5LHH A;  3JRB A;  1X1A A;  4B09 A;  1R36 A;  2HFH A;  2MAB A;  4I99 C;  4XLE A;  2JPC A;  3G73 A;  4II3 A;  3PJR A;  3PO3 J;  3A02 A;  4BHB A;  3ABM H;  2X85 A;  4XOP A;  2X1E A;  4LB6 B;  3CME I;  4BDY A;  2BVM A;  3JW4 A;  3HL2 A;  2QEX I;  3W2A A;  2ZSH B;  1J59 A;  1JHF A;  2KIU A;  4EGZ A;  2A61 A;  1F1Z A;  1YW7 A;  2VLA A;  2R5Z B;  4AID A;  2E60 A;  3AG2 H;  3OOP A;  1JKQ C;  2KQR A;  1WCM J;  2VKH A;  4AC0 A;  5F1R A;  3GTM J;  1EF4 A;  4XN0 A;  2ACJ A;  2LY1 A;  2HKO A;  3PUF A;  1HLV A;  2EV5 A;  3I9V 2;  3ECO A;  1S8N A;  2BZT A;  4MTD A;  3BG5 A;  2HTJ A;  2GQQ A;  3IP4 B;  3FKJ A;  2VC1 A;  3R61 A;  4ZYD A;  1KQ0 A;  1WJ5 A;  1LFB A;  1JE8 A;  3ZPL A;  2W85 A;  3COA C;  1STZ A;  4IXA A;  1ZRE A;  2VJ4 A;  4HG2 A;  4BGD A;  3IWZ A;  4S04 A;  1I27 A;  3FK7 A;  1YQA A;  3BTJ A;  3HOS A;  2XF6 A;  4RAY A;  3W3C A;  1BW6 A;  1HKS A;  4L18 B;  3VYU B;  1S29 A;  3JTG A;  3W2V A;  1WJE A;  1FJL A;  1YJW I;  2EV0 A;  3ZCO A;  4P1W A;  3F8N A;  4GRI A;  3ASO H;  2W1O A;  3FXM A;  1RRJ A;  1HKQ A;  5JHU A;  4DZP A;  5F04 A;  3J7Z I;  4HF0 A;  1IF1 A;  2DFI A;  4HST A;  2R0Q C;  1ZG1 A;  3ML6 A;  1FX7 A;  5GPA A;  3ZMD A;  2FMY A;  1MMS A;  2TCT A;  2L9V A;  1G3W A;  2R7W A;  1R00 A;  5IT3 A;  1W0U A;  2ZJQ F;  2NOJ B;  2M4G A;  2O6G E;  2WAE A;  3MWM A;  2DMP A;  1J7K A;  1OCT C;  3B73 A;  2WAQ A;  1IV6 A;  4LG0 A;  2NXN B;  1ZHF A;  4DBR A;  1JTY A;  5J47 A;  4PDK A;  4G6Q A;  2ME6 A;  3RKQ A;  2MH9 A;  1K83 J;  3VYS B;  4EJW A;  1I39 A;  4C3I J;  2R7Q A;  3RZO J;  2P6S A;  4XID A;  5FO5 A;  1O3T A;  2H09 A;  4AYB N;  3E0J B;  3BR1 A;  2FU4 A;  2H8R A;  1U0J A;  4C30 A;  2BEO A;  1U8R A;  2JA2 A;  2NOG A;  4GCV A;  5FGM A;  2A68 F;  1YTY A;  4CCL A;  1SAN A;  2KIQ A;  4A6D A;  2FQ3 A;  3JRF A;  1WPK A;  3BT9 A;  2HYF A;  2E5Z A;  4C2M J;  4EGY A;  4HX7 A;  3IAS 2;  3IKV A;  1GV2 A;  3R0J A;  3GZ5 A;  3NQO A;  4NUB A;  1R1V A;  2K86 A;  2DOE A;  2JA8 J;  2ZXH A;  3TO7 A;  1FMW A;  2E2J J;  4RB3 C;  3BG9 A;  4BEH B;  3MVP A;  2A5Y B;  4KMU X;  5M3M J;  4A3J J;  1BC8 C;  3TDZ C;  3CES A;  3RKW A;  4XOR A;  2DQR A;  2L0K A;  1H9G A;  1R6R A;  1V54 H;  5L3C A;  1B4A A;  2NAZ A;  4OU0 A;  5DYM A;  1AOY A;  1LDK B;  3QPH A;  4JOM A;  5M5X J;  1D0Z A;  3OL3 A;  4EEF G;  1ON2 A;  3F22 A;  1HOM A;  1Y56 A;  2HXI A;  2QLZ A;  4MEX F;  1PP8 F;  3KLN A;  5TGT A;  3K4K A;  1XPX A;  2O7O A;  3BG3 A;  5HVQ C;  3IKT A;  3QOP A;  2ZB9 A;  2D1H A;  3DKY A;  2X51 A;  3FX3 A;  3CCR I;  1TWF J;  1HST A;  2E19 A;  3WTX C;  2JK3 A;  1XTA A;  4XSX F;  3HGY A;  4WF2 A;  2DFE A;  4XK4 A;  4QPQ A;  1U5T B;  2CUJ A;  2R7F A;  3TW6 A;  3MAJ A;  1LDD A;  2AXT C;  1O3Q A;  4WX9 A;  1X3U A;  2L4M A;  2L7K A;  3AG3 H;  4D9J A;  1TL8 A;  1JKP C;  2K9S A;  4HNV A;  4G7Z F;  5BNG A;  4CCN A;  3DV8 A;  5K5Q A;  3V7S A;  3GFL A;  4KA4 A;  3K1M A;  3JRH A;  3ERE D;  2IEK A;  4N4N B;  1ZH5 A;  2O8X A;  4B4C A;  2PJR B;  3JR9 A;  5D8K B;  4GFB A;  2ZCW A;  5J1Y A;  5E18 F;  3CO7 C;  4G7H F;  3OSG A;  1SAX A;  2EBI A;  3J7Y J;  1ZGA A;  4I0A A;  2RQP A;  3PFI A;  3WE3 A;  3QAH A;  1YYV A;  4B44 A;  4HDV A;  4HQE A;  4M3D A;  4ZYH A;  2JTV A;  1DGR M;  3DXJ F;  3O3K A;  1HCR A;  3FWE A;  1R4M B;  2MD5 A;  3OIP A;  4H4K C;  1Y8Q B;  1RPW A;  4KJZ A;  1R22 A;  4C2T A;  2WTE A;  2VE9 A;  1XB4 A;  2P5V A;  1VQ6 I;  1KQ9 A;  5LGU A;  2YU9 J;  4BXU A;  1P6R A;  3J80 Z;  1MBE A;  3S1M J;  5FKN A;  4EQQ A;  2E1M B;  4C3H J;  4XRF A;  5IOZ A;  3SFZ A;  4D0P A;  4IF4 A;  5CVR A;  2JRM A;  3V7R A;  3EUA A;  2W82 A;  3HOX J;  1MD0 A;  3SFI A;  4B48 A;  2VIX A;  3B02 A;  1Z9C A;  2HYG D;  4XKB A;  3I58 A;  5LRS A;  5J6X A;  1RR8 C;  1UHS A;  1XGO A;  1YW9 A;  5HOD A;  4S0H B;  4E70 A;  2B9S A;  3DU6 A;  3L7W A;  4LLN A;  4A3E J;  3QOD A;  4A6E A;  1SD6 A;  1Z0X A;  4MO7 A;  5J8C A;  1XDU A;  1K61 A;  1Z77 A;  1JJ6 C;  1UZC A;  3FM3 A;  1J09 A;  5C4J J;  1XX5 A;  1MNE A;  3GXO A;  2ZXJ A;  1MMG A;  1F36 A;  5DUI A;  1JJ8 C;  1D1B A;  4WXC A;  4IPA A;  5KCM A;  4A3F J;  1HKT A;  3R0A A;  1DPU A;  1X19 A;  3OYL A;  3BR3 A;  1HF0 A;  1T6S A;  2ZME A;  3I0T A;  1MH3 A;  5E3O A;  1AHD P;  4HX8 A;  2P7V B;  2DXI A;  3SEQ A;  4IHT A;  2M5W A;  2E1O A;  1MGT A;  5F6F A;  2V1N A;  3S14 J;  3CCV I;  5BS6 A;  4CYD A;  1RUO A;  2KT0 A;  1S9H A;  2FML A;  1AKH A;  3PO2 J;  5J8F A;  2O5R A;  1ETO A;  4B47 A;  1FZP B;  5HLG A;  2DA1 A;  3H5R A;  3G1L A;  3H9J A;  4KIB A;  4OIQ F;  1E17 A;  4G6D A;  3MEX A;  3GFM A;  5HDG A;  1FIP A;  4UUS A;  3CCU I;  3W6K B;  2FRH A;  4AYB A;  1YW8 A;  2CQX A;  3HPH A;  5GPC A;  2BW3 B;  3EET A;  5JHF A;  3H9G A;  3D0S A;  1HXD A;  1QO0 D;  4KFC A;  5AIQ A;  2IRF G;  2FBK A;  3K4J A;  2HQR A;  3BJA A;  1ZK8 A;  4HZF A;  2LNB A;  1S6L A;  2ZJR F;  1Z91 A;  1HSJ A;  4L5E A;  3CF5 F;  4GDF A;  1OIS A;  3Q9V A;  4OIP F;  4OAY A;  1Z6T A;  2EH3 A;  2K40 A;  2V6C A;  1LFU P;  4P9F A;  5JLW A;  2XAU A;  2CGP A;  2MLG A;  1FSH A;  1J0R A;  2EFN A;  4M6X A;  2R7S A;  3LSP A;  4FIS A;  3OS1 A;  3WTV C;  2DMN A;  2FNA A;  1JXS A;  1Y1V J;  1FOK A;  2GXA A;  2AXL A;  2K4J A;  2RKH A;  2KRH A;  5LHI A;  1IAW A;  1PJR A;  4UV9 A;  3JAM K;  2ELK A;  2AHQ A;  3QP6 A;  1T0F C;  2XAS A;  2UZK A;  4EJT A;  1FLI A;  5D6F A;  1HBX G;  5LEK A;  3AFH A;  3MKZ A;  3S2H J;  4L9T A;  4NC7 A;  3H0D A;  1VQL I;  2ZSI B;  3GVA A;  1PVE A;  4A3I J;  2YUS A;  3KFW X;  3KP5 A;  1VQ4 I;  4YFN F;  1QA6 A;  4G8X A;  4JQF A;  3O6B B;  4WK8 F;  3JRE A;  4LGW A;  4N9I A;  3AAF A;  2ECC A;  3LNQ A;  1E2X A;  5TRD A;  1YE9 A;  3BTC A;  3L2R A;  4A5N A;  2HVR A;  3CJT B;  2K85 A;  2E1N A;  3L2C A;  2XRN A;  4CHU A;  5JVT A;  2VJJ A;  2R7O A;  2NNY A;  2KKO A;  4BBS J;  2IBD A;  4IQJ A;  1MJB A;  3FXR A;  3I59 A;  5GTI C;  4LLG F;  4CXF A;  2EZL A;  3QPL A;  5F08 A;  4L0Y B;  2DMT A;  1UG2 A;  1BM9 A;  1VQ8 I;  1F9N A;  3GTL J;  1ETV A;  3BR0 A;  1PP7 U;  4X1E A;  2F5C A;  2M8E A;  4UUT A;  1MBK A;  2L3D A;  1K78 A;  4GYG A;  5C44 J;  3RJP A;  2MBF A;  2IA2 A;  2RVC A;  3OYD A;  1TQI A;  3L2Q A;  3WTW C;  2BBY A;  2VL8 A;  3E6D A;  3HJE A;  4UVB A;  3UR3 C;  3T0Y A;  3KYL A;  2A3S A;  2VPL A;  1LEB A;  1B59 A;  2K9Q A;  2DDA A;  4PJL A;  5ICE A;  1WZ2 A;  2CFX A;  4GO1 A;  3SJM A;  4ESJ A;  4PGH A;  1H89 C;  2HGC A;  2ZFW A;  3DCF A;  3BQZ A;  3FXU A;  2PMZ A;  3IH3 A;  5KK1 A;  2EFW A;  1RC9 A;  1SD7 A;  4XL9 A;  1UST A;  4CO8 A;  1TWC J;  5HLI A;  3DEW A;  3BC8 A;  3IH2 A;  3HOT A;  3TO9 A;  2L7M P;  1SFU A;  3OS0 A;  4N4O B;  4EJO A;  1XGN A;  2KRF A;  1TNS A;  2QEN A;  4AU7 A;  2VJI A;  4R8H A;  4LG0 B;  3HUG A;  4BJ6 C;  1ITY A;  2E5N A;  5E79 C;  3E3V A;  1OCO H;  4EM0 B;  1YO5 C;  1WI3 A;  1R49 A;  2HXO A;  2VT3 A;  5IP6 A;  2WA0 A;  1G2H A;  3R4K A;  3V4G A;  5DDG A;  3E6B A;  5ILV A;  4XLN F;  1ZN2 A;  1EV7 A;  1RI7 A;  2PMH A;  3LA7 A;  3OIO A;  3Q0V A;  1XGM A;  2VC0 A;  4DYC A;  2I10 A;  3HPG A;  4JK1 X;  3CCJ I;  2IGK A;  2TDX A;  1VQ9 I;  4KIG A;  3RQI A;  5M5W J;  1B1B A;  3KP4 A;  3WTU C;  1FP2 A;  3SYT A;  4UVA A;  2QQA A;  1OCR H;  1OPC A;  2OCC H;  1ERD A;  1N77 A;  2NNN A;  3LSH A;  4YIF A;  1G8X A;  1R71 A;  2XRO A;  2Z33 A;  1LVA A;  4L9J A;  4LK1 F;  4RM3 A;  4E7H A;  1R7J A;  2EQR A;  3RIR A;  2FBI A;  1BOA A;  5IY5 H;  2GM4 A;  2M8G X;  3QPS A;  4QIW N;  2KJC A;  1VF9 A;  2ETH A;  4XQF A;  1RKT A;  2CWE A;  1VFC A;  3ZQF A;  3E6M A;  2HZD A;  1PUF A;  2NVY J;  1IRG A;  3CZ6 A;  5L3B A;  2WAQ N;  2XPW A;  4HQM A;  1ZTR A;  2VQG A;  4I02 A;  2BHZ A;  4IL6 C;  4YG2 F;  1KU9 A;  2P5K A;  3HSF A;  2O3F A;  3A0B C;  1TWG J;  2XPU A;  4KN7 X;  2VOP A;  3GBG A;  1TWH J;  3H3V K;  4G94 A;  1RET A;  1XGS A;  3P7N A;  1BJZ A;  3K7A J;  3BOQ A;  3BZC A;  2VKV A;  4R1H A;  4IHV A;  3K0L A;  3VOD A;  1MDM A;  2HOS A;  1SEU A;  1ZKG A;  3DBR B;  2DU9 A;  1IXR C;  2FNP A;  2X6Y A;  1TP4 A;  2X6W A;  3SDG A;  5J40 A;  4CYC A;  3I55 I;  2WBM A;  1MBH A;  3JRD A;  2Y9Z A;  2HVQ A;  5E1X A;  5E3M A;  1ONV A;  2DI3 A;  2GZW A;  5H6R A;  2Z99 A;  1RKW A;  3SZP A;  3IAM 2;  3K1N A;  2CUZ A;  3M4O J;  3S1R J;  5J4Y A;  5EEG A;  3BG6 A;  3E7L A;  2STW A;  4ZJZ A;  3ABK H;  1DP7 P;  2DJI A;  3H5N A;  4XBF A;  2VUM J;  3G4S I;  1W36 D;  2EIL H;  1SFE A;  3CC7 I;  1CF7 B;  4O5V A;  4MQ9 F;  3C3W A;  5CVU A;  1OMI A;  2Q1Z B;  5DM7 F;  1X1B A;  2XGC A;  2H1L A;  5D4S A;  2KJB A;  2RQQ A;  3VEP A;  2CV0 A;  3MKW B;  4OMZ A;  2EA2 A;  1UFM A;  3CQZ J;  1XCV A;  2DDB A;  3HOV J;  4FQG A;  2YU3 A;  1S7O A;  2COM A;  4BQN A;  2R7T A;  4YIR X;  3WE2 A;  1B72 A;  3IC7 A;  1H9T A;  4LB5 A;  4Y33 A;  4UB6 C;  3ZMZ A;  1X1P A;  1TNT A;  2CO5 A;  4BY1 J;  1IN8 A;  2YX7 A;  3QP5 A;  3K4M A;  4O6J A;  5FLV A;  4D1Q A;  3MZH A;  2Y48 A;  1D1C A;  2R5Y A;  2F2E A;  1YIO A;  1V55 H;  1T8I A;  1VQ5 I;  2XAJ A;  4U0W A;  5GP9 A;  3GF2 A;  3ZOB A;  3GZN B;  4Q47 A;  4LD5 A;  2OJE D;  1FWZ A;  3ZGK A;  3S93 A;  2M7B A;  4ZZD A;  2UXN A;  5HS7 A;  1D1A A;  2V7F A;  3V42 A;  1JUP A;  5BPD A;  1Y0U A;  3BLY A;  5CQG A;  3F3X A;  2DAO A;  1QZZ A;  4M9X A;  2VT2 A;  4RB1 A;  1WJA A;  1MZB A;  5F64 A;  4NC6 A;  3FMS A;  5FKK A;  2B7E A;  2L4A A;  4HW0 A;  4L5J A;  2DTZ A;  5HS8 A;  5IYB J;  4M9Z A;  5KVR A;  1IN5 A;  4EAT A;  4P55 A;  1ZG5 A;  3FXQ A;  3H9Q A;  3S3N A;  1QVT A;  4BQA A;  2OTL I;  2LOO A;  1XD7 A;  2STT A;  1OCZ H;  3K70 D;  4XLA A;  2ZME B;  2P4W A;  1ZAO A;  1X2M A;  1S7E A;  2BY3 A;  1IDZ A;  2CQK A;  1YRN A;  3M1E A;  1QVU A;  4IZZ A;  4A0Y A;  1W1W E;  2X1C A;  4EM2 A;  2YS9 A;  1Z1D A;  4M71 A;  1G59 A;  5AIP A;  3WU0 A;  1AU7 A;  2O0Y A;  4PK4 A;  4PSX A;  4P5O A;  5DV5 A;  2HVS A;  1D5Y A;  2X0L A;  3PFY A;  3WU2 C;  2XRL A;  3CMY A;  3CO6 C;  2IPQ X;  3RPQ A;  2R3S A;  3MKL A;  1VQO I;  4II2 A;  2ZKZ A;  4E4H A;  1P7I A;  5CYV A;  3CF2 A;  5K7F A;  2MC3 A;  2G7H A;  3H3U A;  3KCC A;  2JWT A;  2M87 A;  3J81 K;  2ECB A;  1Q1V A;  2MW8 A;  3VSL A;  1G3T A;  2BVL A;  4UV8 A;  2XB5 A;  3RTR A;  3I4P A;  4AWX B;  4UUS B;  3HEF A;  5LD2 C;  2D2W A;  4BS9 A;  1SMT A;  2K5C A;  1RUN A;  3OOU A;  1VQK I;  3KLO A;  1YI2 I;  3WHC A;  5LGN A;  2L7Z A;  3EDP A;  4BU2 A;  1YOV B;  1U78 A;  5ILS A;  5IP7 J;  1V5E A;  1ORK A;  3HSR A;  5HLH A;  1KA8 A;  3BQY A;  2CV2 A;  2R7Z J;  3BZK A;  3DKX A;  2L5Q A;  2LKS A;  2DT5 A;  2RRE A;  1U5T C;  2VKE A;  3AL0 B;  1O3S A;  1E3P A;  5D5U B;  1UG0 A;  2JUC A;  3RSN A;  1W36 C;  5GTH C;  2LMD A;  2KIF A;  3FMR A;  4ITV A;  2VBY A;  3OMY A;  3N97 A;  2ESH A;  4I0B A;  3ZQH A;  1S3J A;  3HM5 A;  1T98 A;  1XMX A;  3S8P A;  2DPD A;  4DOZ A;  2H6B A;  3OYC A;  3ZRG A;  1IN6 A;  3ZMS A;  3S1Q J;  3ISP A;  1PDN C;  5FFZ A;  2VBZ A;  3DFG A;  2BE5 F;  2P8T A;  5IOY A;  2RN7 A;  1R23 A;  4AUX A;  4HA8 A;  2PX9 A;  3ZN0 A;  1LVK A;  2HQA A;  2R92 J;  1RES A;  2UXX A;  1J75 A;  3I5U A;  2W57 A;  2GA2 A;  2G0E A;  2O03 A;  1Y6I A;  3M9A A;  3LSM A;  4XSZ F;  2QBY A;  3M3Y J;  2M45 A;  1A6I A;  3CCY A;  3F72 A;  4S05 A;  4C9Y A;  3CJQ B;  4EJV A;  4HBL A;  4WCG A;  2LD5 A;  1IUY A;  2DA3 A;  3HGG A;  2A69 F;  2HYJ A;  3WG7 H;  3I3L A;  3CUO A;  3OY9 A;  4ENK A;  2LDU A;  5FB2 A;  3B6A A;  2N8G A;  2E1M C;  3IV5 A;  3QOE A;  4HLY A;  4HRI A;  1Z3X A;  2OF7 A;  2FOW A;  2H94 A;  3K9T A;  5F1J A;  5IYD J;  2ELJ A;  3I53 A;  3I59 B;  5F27 A;  3VOE A;  3WOD F;  3RZD J;  1TC3 C;  2NVU B;  2OQR A;  1YFH A;  1ETY A;  2QQB A;  3HXL A;  2XB0 X;  2W48 A;  3V7C A;  2NS7 A;  1I3A A;  3DPL C;  2X4H A;  5DEQ A;  2QQ8 A;  2VXZ A;  1BL0 A;  1YS6 A;  5LBQ A;  2COB A;  1K78 B;  2E2I J;  2HWV A;  4P96 A;  1HDD C;  2K4B A;  4IHX A;  1FPQ A;  4KIS A;  1ETQ A;  4JP0 A;  3U1K A;  5J1U A;  4G7O F;  2I8D A;  1B9M A;  1VI0 A;  2CSO A;  1OLT A;  3BDD A;  1I5Z A;  2F4M B;  1NG6 A;  2PN6 A;  1R4N B;  1R1U A;  2IAI A;  4FT8 A;  3K70 C;  4A93 J;  1I1S A;  3CTA A;  2Z3Y A;  4G6T B;  5L3D A;  1EKE A;  4MIM A;  2V79 A;  1YX3 A;  3TP0 A;  5CPR B;  1TT5 B;  3MCZ A;  5J3L A;  5HNF A;  3F21 A;  3GTK J;  4ZYA A;  1TT0 A;  3HTU A;  4X6A J;  1UB9 A;  3FBI B;  4M3E A;  2FF4 A;  2IA1 A;  4XLH A;  3DEE A;  1K6O A;  3CC2 I;  3JAM Z;  4F7Z A;  2JA6 J;  4ON0 A;  1UEL B;  1OJL A;  1WGX A;  4CDG A;  1X4P A;  5BMZ A;  1KU3 A;  1MKM A;  3HUG B;  3GX4 X;  3S3O A;  5E3L A;  4FET A;  2L02 A;  3BJ6 A;  4YFX F;  4PFO A;  3ROU A;  3EYY A;  3ONQ A;  3A4C A;  2PMU A;  4GXO A;  1KON A;  3LL7 A;  2RC4 A;  4MNU A;  2HEO A;  3GTJ J;  3GTG J;  1XSX A;  4D7M A;  2OC6 A;  4MFE A;  4JYK A;  1EH8 A;  3MMY B;  5L3F A;  4ABZ A;  1JTX A;  3U2R A;  5TJJ A;  2LF8 A;  4DGW B;  3O2P E;  1HDP A;  5EGO A;  3FF5 A;  1E3O C;  3BPV A;  3MN2 A;  1CQT A;  4JX4 A;  1JT6 A;  1SFX A;  5IP9 J;  3G71 I;  3DBL B;  1VND A;  2JQ7 A;  4QWQ A;  2L9R A;  1NK3 P;  1VZ0 A;  2QQ9 A;  5AON A;  4C3J J;  5BOX A;  3G2B A;  4CZZ A;  5JR3 A;  2PMZ N;  5B5E C;  2KZG A;  5D5X B;  4ANJ A;  1UHW A;  2KZV A;  4XLF A;  1JGG A;  1BBY A;  3BR6 A;  1V4R A;  3FK6 A;  2KIM A;  1U3E M;  5EJC A;  4B1R A;  3F8C A;  5IT9 K;  6PAX A;  4DZJ A;  2M3A A;  1BIA A;  1PUF B;  4A3K J;  2Z16 A;  3MKY B;  1YLF A;  1T39 A;  3CD6 I;  1K6Y A;  3CUQ A;  4LMY A;  1KU2 A;  2X48 A;  3HB9 A;  4XN3 A;  2Y0M A;  3ZMT A;  2JSC A;  5EEH A;  5A2Q K;  1ZEL A;  2F6C A;  1MDM B;  1XMA A;  4CCM A;  3T8T A;  3A2K A;  1BI2 A;  3UKG A;  3FMQ A;  3OYF A;  1BJA A;  4DQ2 A;  2VBX A;  3ZMV A;  1QU3 A;  4CYC B;  4AVP A;  1AWC A;  4G12 A;  4HYE A;  2CYY A;  3MQ0 A;  4X0G A;  4KT5 C;  2GLO A;  2J5O A;  3ULQ B;  1B8I A;  2OUM A;  3EQL F;  2GIZ A;  2EFQ A;  3PSI A;  2FXA A;  2Q2E B;  2ZFU A;  2PEX A;  2BOL A;  1IGN A;  4E7K A;  3LSR A;  3S32 A;  2O8K A;  1ZGW A;  4CCJ A;  1D5V A;  1MND A;  1XC5 A;  1BOB A;  4NB5 A;  4PJJ A;  4M9S A;  4YII A;  3QYE A;  2HOA A;  1J9I A;  3HKZ N;  2PI0 A;  2LFB A;  3M07 A;  2E2H J;  3K6G A;  2NVQ J;  3UNG C;  4CH7 A;  3TED A;  1R9T J;  4KDP A;  2V9P A;  4Q48 A;  4IOA F;  2IS4 A;  1P9Q C;  2IA0 A;  2GOX B;  1LNW A;  1HA8 A;  5B1B H;  1I50 J;  5EYR A;  4AD9 A;  2YSR A;  2HI3 A;  1QHH D;  2XGX A;  5M3F J;  5FFX A;  1R58 A;  3RDI A;  1B72 B;  4V2G A;  1OYW A;  2LTP A;  5E20 A;  3BPX A;  5E17 F;  3Q5F A;  4QSH A;  4K2E A;  1C0W A;  2KIS A;  2ZXI A;  1Y0N A;  3GO5 A;  1X1C A;  1ZR4 A;  4WXH A;  4HOB A;  2NRA C;  4BQO A;  3FHN A;  2R5Y B;  3LFK A;  1LPQ A;  3S3M A;  4E7I A;  1ETW A;  3DF8 A;  3DTI A;  4LIT A;  1HC8 A;  5E8G A;  3JRI A;  1Y1W J;  4ESB A;  4ZZL A;  3BCA A;  3AKZ A;  3LSK A;  5CVV A;  3D5L A;  1AA7 A;  4ZH4 F;  4V19 K;  2JA7 J;  3OYE A;  2K27 A;  1IXC A;  1WHU A;  3ABT A;  3H36 A;  3KP7 A;  2HZT A;  4Y15 A;  4CIC A;  5HLT A;  2AS5 F;  3GTP J;  3BRO A;  2K3P A;  5D6E A;  1FY7 A;  1MMD A;  2Y2Z A;  1K7A A;  4HLX A;  2FUG 2;  2VQH A;  3KPH A;  1EJ9 A;  4OWR B;  2WC2 A;  5HOO A;  5FKM A;  1Z67 A;  4XLP F;  4ZDL A;  3HZJ A;  3ZQI A;  2KFD A;  2LBF A;  3RYP A;  4BY7 J;  2F4O B;  2V4J C;  5K1Y A;  1DPR A;  1SFO J;  5ICF A;  3DLL F;  4CZC A;  1SC7 A;  1QQI A;  3TBI A;  1YRN B;  1I6X A;  5ICG A;  3S1N J;  4RAG A;  3SXY A;  2DK8 A;  2LH9 A;  5FRO A;  4H0E A;  3E6C C;  3VB2 A;  2DFH A;  2DOF A;  1QGP A;  1KYW A;  3HRT A;  3JRA A;  5GAH J;  1A31 A;  2JZY A;  1E3H A;  4ZC3 A;  1SFK A;  2CUE A;  3FBN B;  4UVC A;  4DIQ A;  2DTR A;  1LB2 A;  3VPR A;  1SMY F;  1IUF A;  5F0C A;  4A2U A;  3LOC A;  5GAG J;  3SHF A;  3NRV A;  4ZDP A;  1TW3 A;  3OYM A;  1IG7 A;  4MFD A;  1UJ8 A;  2OD5 A;  1ETX A;  1QBJ A;  4BHP A;  4KIT B;  2NYX A;  1H8A C;  3KYD B;  4BXF A;  2O61 A;  4BJ5 C;  3FXO A;  3HSE A;  2DA7 A;  1FEX A;  3WGH A;  4XLC A;  5HDK A;  1T38 A;  1DDN A;  3T8R A;  4F52 A;  2Z1D A;  1POG A;  2XAQ A;  2MG4 A;  2W7N A;  1XCB A;  2Z5U A;  2WAF A;  4F91 B;  3L00 A;  2M4K A;  4I7H A;  2ID6 A;  3TMO A;  2WAD A;  2A6E F;  3TQN A;  3M8J A;  4DYQ A;  3EPZ A;  4EVI A;  2ZJ2 A;  5EF6 A;  2NS0 A;  2B0L A;  2W84 A;  3OIQ A;  1ACI A;  4L5I A;  1T56 A;  1X2N A;  1D0Y A;  2OZ6 A;  5CVI A;  2HQN A;  4NQW A;  4P9U A;  4IO9 F;  2QUF A;  4CUG A;  1GV5 A;  2QF7 A;  1UCR A;  3EUH C;  1JKO C;  2K9L A;  3KP6 A;  5KNL A;  2H1K A;  3F9K A;  3PNT A;  3TP3 A;  2BGC A;  2W00 A;  1ZYR F;  1VQ7 I;  2MGQ A;  3M7G A;  4NBQ A;  2UUZ A;  2HPI A;  2IXS A;  4A5M A;  1I6H J;  2Y30 A;  3KE2 A;  3OSF A;  4PJ0 C;  1YG2 A;  3GME A;  3TO6 A;  3K4L A;  3E97 A;  3FZV A;  3JSP A;  1N78 A;  3E5Q A;  1NHA A;  3RPU A;  2QBY B;  1XN7 A;  2LLK A;  1U5T A;  2JN6 A;  3P9C A;  4UNO A;  1ETK A;  3CLQ A;  4Y17 A;  5J4V A;  3OYH A;  1LQ1 A;  1IV8 A;  3OWT A;  1JT0 A;  2R93 J;  1ZLK A;  2IGO A;  5KAF C;  1FSE A;  4Z6Y A;  3A0H C;  2DA4 A;  4W1U A;  3JRC A;  1JHH A;  4ETS A;  4GGG A;  1WJF A;  2RDP A;  1MH4 A;  3LST A;  2IGM A;  5LEJ A;  1ZG3 A;  3S15 J;  4A0X A;  2K3F A;  3J81 Z;  2CW8 A;  2I5U A;  2F48 A;  5DCM A;  3N05 A;  3LSJ A;  1W7P A;  4BKX A;  4M73 A;  4NC8 A;  5CJ9 A;  4L9V A;  5KHD A;  3PIP F;  3DEU A;  3NWS A;  1P2F A;  1Z05 A;  4FX4 A;  3HKZ A;  4IJA A;  1WKM A;  4FAS D;  5DTD A;  2DOA A;  2JSP A;  2QCO A;  3F8B A;  2K7L A;  4XKC A;  1PYV A;  1JUS A;  3NWT A;  1WJC A;  2ISY A;  1K4S A;  5EG0 A;  3KET A;  3OYI A;  4BAC A;  1WFX A;  3PIO F;  1W5S A;  4BYY A;  3GFI A;  1Q1H A;  2GOM A;  4HSR A;  3G6E I;  2QKL B;  3WGG A;  2R4G A;  3K1P A;  3VSK A;  4BAY A;  1QPI A;  2DW4 A;  5B66 C;  5FD5 A;  3L2U A;  3KP2 A;  2L9N A;  2LC2 A;  3PUB A;  2IW5 A;  4U7D A;  2ZO4 A;  4BNC A;  2M1B A;  2XUB A;  3CDL A;  3W2W A;  3GYH X;  4WWC A;  5K7H A;  3WTS C;  3S2W A;  2X9D A;  4ASN A;  3NAU A;  3F23 A;  3HOZ J;  4O3M A;  2Y69 H;  5H20 A;  3QYF A;  4E7L A;  3PSF A;  2LRD A;  1LJ9 A;  2HQ5 A;  4A0Z A;  3I4N J;  3PNY A;  4G9Y A;  2VKD A;  5JFR A;  3QPT A;  4PJM A;  1XMK A;  1USS A;  2JVG A;  3C1D A;  3HYI A;  1FYM A;  4F93 B;  1ENH A;  4M72 A;  3T1B A;  1FTZ A;  3I71 A;  2KDO A;  3HRU A;  4KT6 A;  3C2B A;  2CQN A;  3E5X A;  2DMQ A;  1SVM A;  5FLM J;  1IRF A;  3JTH A;  1E0E A;  3GWZ A;  1LE8 A;  1LKX A;  1Z7U A;  3CCS I;  1T95 A;  2Z2S B;  5CLS A;  1BR4 A;  5EGO B;  4LIV A;  5FLX Z;  4UXN A;  3AG1 H;  3LAJ A;  5ILU A;  3HRS A;  1GXQ A;  1JKR C;  1FNN A;  2FBH A;  4B3A A;  2PBI A;  4UB8 C;  3I4M J;  3AL0 C;  2OCE A;  3QRF F;  2F5V A;  3DBH B;  5DS9 A;  5BQT A;  4JX6 A;  1JI8 A;  1MMA A;  4IVN A;  2WB1 N;  2V1D A;  4RB2 C;  3V8J A;  2PLY A;  3HHG A;  2DT7 B;  2CFO A;  2RAE A;  4I76 A;  1F5T A;  3CJN A;  3Q0U A;  4Z2Y A;  3WU1 B;  4FE4 A;  1O3R A;  3KZY A;  3VFZ A;  3VWB A;  3CUQ B;  3LSI A;  1TWA J;  2F5D A;  1FBU A;  2CU7 A;  1GUU A;  3K4N A;  4BDZ A;  1DU0 A;  4I6Z A;  1NG7 A;  3HIF A;  3OYK A;  3WHB A;  2QA4 I;  4N0B A;  1SVO A;  1MBF A;  4RGS A;  2F4I A;  4NNJ A;  3KEY A;  2V9K A;  3DTK A;  4ESF A;  4LIU A;  1U2W A;  2P81 A;  4MLO A;  5DUK A;  3X2Q H;  1DQU A;  2ZXW H;  3PQK A;  4D5F A;  3GZ6 A;  1GVD A;  4RM2 A;  2V1U A;  4E7J A;  3B6C A;  1FP1 D;  1W4M A;  2GIV A;  1WQ2 A;  1B8I B;  1OYY A;  1BI0 A;  5E1W A;  4AM3 A;  1OCC H;  1FMV A;  3ZQQ A;  2P7C B;  2DYS H;  4A3C J;  1YJ9 I;  1IJW C;  2FX0 A;  2ZJP F;  3DWL E;  2AO9 A;  1HW1 A;  2R7R A;  2X6O A;  4RAF A;  3F8F A;  4XOT A;  3NAR A;  1AKH B;  1VQN I;  3LA2 A;  1OR7 C;  1UAA A;  2GWR A;  2WY7 Q;  3U21 A;  4ENJ A;  2H27 A;  1X4O A;  4Y4R A;  3C18 A;  1UHM A;  5GAE J;  2ESN A;  2GAU A;  1BA5 A;  2G9W A;  2RNJ A;  2LY9 A;  1F43 A;  3BJO A;  4ZTF A;  1XS9 A;  3OL4 A;  5IYC J;  2LSO A;  4PSW A;  3CP8 A;  1PUE E;  1W5T A;  2CW0 F;  3M1C A;  3P9K A;  4IRG A;  3H35 A;  3RCO A;  4FCY A;  3GLL A;  3ZQL A;  4RB0 A;  5IT9 Z;  3IWF A;  3SZT A;  1SD4 A;  5HS9 A;  3WG9 A;  2EWN A;  3PM1 A;  3CP2 A;  2EIN H;  2VOD A;  4WXD A;  1MSE C;  1BI1 A;  2RGV A;  2ZBK A;  2C6Y A;  2YR2 A;  3GLX A;  3G1O A;  3FM5 A;  4ZYG A;  3ZQ7 A;  2E7W A;  2FA5 A;  1OQY A;  4RAZ A;  3BP8 A;  5A2Q Z;  4ENM A;  1MJ9 A;  4BJT A;  3ECH A;  3T5X A;  2VPR A;  3J7A O;  2EFP A;  4TV7 A;  5BPI A;  1S5L C;  5JLX A;  2J5P A;  3BZ6 A;  3DP7 A;  1G3S A;  5K5O A;  3RKX A;  1R5I D;  1QZE A;  2KMU A;  2YPR A;  3L2V A;  5D5W B;  3IRQ A;  5J1R A;  4RBO A;  2KPM A;  3QWL A;  4AIK A;  4NHJ A;  1W5C C;  2ELH A;  1J5Y A;  1ZRF A;  1FT9 A;  2ICW G;  2DA6 A;  5LRR A;  2LBF B;  4BQQ A;  2M7A A;  2DYR H;  1YIJ I;  3WTZ A;  5E3N A;  3CLO A;  4PZJ A;  4MTE A;  4BE2 A;  3D5S C;  3OS2 A;  5TIS C;  4M6Y A;  5CQE A;  3OV8 A;  3OYA A;  2JRT A;  1T2K A;  1KZH A;  1IDY A;  2UWM A;  2HS5 A;  3ASN H;  2WWY A;  4HAM A;  3L2W A;  2YX4 A;  4E7Z A;  2LKP A;  4XNF A;  3FKI J;  2D45 A;  1G3Y A;  4B3X A;  4M3G A;  4UHT A;  4QPO A;  4KNY A;  5B3S H;  2HDD A;  5FLX K;  1VTN C;  4I09 A;  4IRH A;  2H6C A;  3ZN1 A;  1T0F A;  2MYS A;  3DPT A;  3REO A;  1GLN A;  3R6S A;  4U0Y A;  2OQG A;  3ZMU A;  3HBL A;  3C2H A;  5ICC A;  3C2G A;  2VOO A;  2XAH A;  1TW2 A;  2QZ8 A;  2NS8 A;  4XR6 A;  4QLC U;  2K02 A;  2VN2 A;  3BG7 A;  3H3Z A;  3OYN A;  1U9O A;  2XF5 A;  4BHC A;  4ZTJ A;  3LSG A;  5FD6 A;  2FJ1 A;  4KYW A;  4MHG A;  2DT6 A;  2EZI A;  2O9L A;  2X1D A;  4RS8 A;  4F3Q A;  3FXJ A;  2ISZ A;  2E36 A;  5FKO A;  3WTT C;  2VQL A;  3LQQ A;  2DO7 A;  2ZNY A;  3QU3 A;  4AVZ A;  1R5G A;  4UY8 I;  4XRM A;  1WVR A;  4RDU A;  3F6O A;  4IOC F;  2EJR A;  3U1D A;  1GXP A;  2VE8 A;  4XRS G;  3P9I A;  4A3L J;  2IT0 A;  1BR1 A;  2A5W A;  4NQW B;  1O7L A;  2W25 A;  3ESW B;  1VQP I;  2JA5 J;  2R7U A;  4PGG A;  1SVL A;  3CCQ I;  4HNT A;  2Q0O A;  2JJ7 A;  2W4S A;  1M1E B;  2DOD A;  2L9S A;  2IP2 A;  3DPU A;  1ZAR A;  2XAF A;  2WB1 A;  2EK5 A;  1OCP A;  2Y0S N;  4OIN F;  2JMW A;  5DD8 A;  3JSO A;  1Y8R B;  4RA2 A;  4FE7 A;  2EIM H;  3IHU A;  3J7A Y;  5EEA A;  3H1C A;  5LFA A;  4A3M J;  2NVX J;  3D5R C;  4ENN A;  3H5A A;  1NK2 P;  3JRG A;  3K69 A;  3DLA A;  2X6X A;  1BR2 A;  2ADU A;  3GFJ A;  1BC7 C;  2M9H A;  3HOW J;  2BY1 A;  2XSD C;  3MZY A;  1FOW A;  3OYB A;  1K4T A;  2CG4 A;  1TQM A;  4C2U A;  3EUH A;  5C4X J;  1IXS B;  2KP6 A;  3O8H A;  2DFF A;  3E1S A;  3ERM A;  2XC7 A;  1CF7 A;  1TBX A;  2PFB A;  3K2Z A;  4U7B A;  2BHY A;  2OZU A;  2LP0 A;  1F4K A;  5DCM B;  5B1A H;  1W7P B;  4QTR A;  2EPF A;  3KP3 A;  3MD2 A;  4MEY F;  2A07 F;  2MC4 A;  1L3L A;  1FTT A;  1WRJ A;  2KLO A;  1YX5 A;  1GHC A;  3BTI A;  2IJL A;  3CDH A;  1ULY A;  4HX4 A;  2CV1 A;  3GTQ J;  3S16 J;  2XKP A;  2MLK A;  1GT0 C;  3KYC B;  2PQ8 A;  3ZXS A;  3FXK A;  2A05 A;  2MSY A;  3HDD A;  2JUG A;  4HPQ A;  3MFK A;  3RKY A;  4B8X A;  4OMY A;  3G3Z A;  1XSV A;  1X3Z B;  5EG0 B;  4MQV A;  2L54 A;  2GXB A;  1APL C;  4DJA A;  2KDZ A;  2JVH A;  4LLL A;  2XPV A;  1XG1 A;  2XVC A;  2L7F P;  5JI6 A;  1FBS A;  1U8B A;  4I2O A;  3BTL A;  1QRY A;  4BXX J;  1ZRD A;  3Q9S A;  2DQL A;  1IO2 A;  1RZ4 A;  2HNH A;  3F0C A;  1A36 A;  2V1X A;  3A01 A;  1GDT A;  4U87 A;  2KL4 A;  1FYK A;  4IKF A;  2HR3 A;  2B63 J;  3K4B A;  1KYZ A;  1FIA A;  2RV8 A;  4U88 A;  3FHZ A;  1WH7 A;  2F5F A;  2G7U A;  3KEO A;  4BE0 A;  3HG9 A;  5C3E J;  3CCL I;  3R60 A;  1FOY A;  5K7Z A;  2KHM A;  2M0M A;  3EYI A;  2DA5 A;  1XSD A;  4RGX A;  4RLF A;  2VXD A;  2VAS A;  1EH7 A;  3KZI C;  5LHG A;  5D5V B;  2HOT A;  3M8E A;  3CDI A;  1WH5 A;  1FBQ A;  4LJZ F;  3QQA A;  3WTY C;  1TTY A;  2CS3 A;  1WWX A;  1Z6R A;  1QZY A;  3TW7 A;  1LE8 B;  4OAZ A;  4FX0 A;  3HHH A;  4LFU A;  3CCE I;  4RMN A;  1T33 A;  3W6V A;  4ZYE A;  1LFP A;  2BV6 A;  2BY2 A;  3WGI A;  4D5C A;  4EV0 A;  4I98 B;  4A3G J;  5FJ8 J;  1MNM C;  3HOU J;  2ZC2 A;  4YEJ A;  2A6T A;  1JGS A;  2CQ7 A;  4OIO F;  2FSW A;  2IS1 A;  4XMY A;  2R5Z A;  4M3B A;  5ED4 A;  3ABL H;  2Y31 A;  1H88 C;  1R5H A;  2XGE A;  2ME0 A;  3BR5 A;  5CKT A;  2NVT J;  3JCU C;  2XDV A;  2E71 A;  3GEZ A;  3BY6 A;  4A3B J;  2P6T A;  3TOA A;  3LWF A;  2HOE A;  1OYI A;  2OBP A;  3KEQ A;  4M74 A;  1A35 A;  1RR7 A;  1I1G A;  2DCE A;  3LQR A;  2PJP A;  4UUV A;  4PJN A;  1IN4 A;  4KN4 X;  1YS7 A;  2R7V A;  1O7F A;  4DYR A;  4D7N A;  3KZZ A;  4RLQ A;  1VQM I;  2E1C A;  3GCM A;  2F5E A;  2XF7 A;  3TGN A;  4GYI A;  1RIO H;  4KIF A;  5CVJ A;  1NTC A;  2P5L C;  2DPU A;  2BXY A;  1WJB A;  2FD5 A;  2Y75 A;  3CMM A;  2A6H F;  4L0Z B;  2E35 A;  4A3D J;  2LK2 A;  3TKY A;  2K9M A;  1V5G A;  1KQ8 A;  5EDN A;  3MZ8 A;  1T08 B;  2OTJ I;  4Y13 A;  4MGR A;  4LK0 F;  1YHQ I;  2Z9O A;  2LKX A;  2HU9 A;  4XON A;  2EB7 A;  3TOB A;  2R7D A;  4F92 B;  2HDW A;  1S72 I;  3OYG A;  2DMU A;  3EUK L;  2EZK A;  2IS2 A;  1N25 A;  1G6N A;  2ID3 A;  2LY2 A;  1LEA A;  2PG4 A;  2QWW A;  2V26 A;  2Y0S A;  4XKV A;  2V6E A;  1IN7 A;  2CW7 A;  1HQC A;  2QGU A;  3V8L A;  2GA1 A;  2AQE A;  3P5J A;  1ZQ3 P;  3A03 A;  2IGN A;  3SEZ A;  1RNL A;  5JVG F;  4A12 A;  1B9N A;  4V2F A;  1S7A A;  2VJ5 A;  2MD0 A;  4J00 A;  1ZGJ A;  3GUD A;  2FQ4 A;  3I64 A;  2OV7 A;  5DD4 A;  2HDC A;  1HW5 A;  2RNG A;  3LA3 A;  3BR2 A;  4HV6 A;  1EH6 A;  2E7X A;  2XHK A;  1GVJ A;  4A69 C;  1WI9 A;  4HEA 2;  3PL8 A;  4XIC A;  5KAI C;  1FOX A;  2FEZ A;  2TRT A;  3HOY J;  2MH2 A;  1A5J A;  1D8J A;  4LOC A;  3RYR A;  2IS6 A;  2EFO A;  3OR2 C;  2CMP A;  3ZQG A;  2E34 A;  1K79 A;  2QKM B;  4DNC A;  3LAP A;  2BYV E;  4BBR J;  3ABU A;  2XGD A;  1DU6 A;  3J80 K;  4DBQ A;  5E1Z B;  1OR7 A;  5D4R A;  4Y3O A;  5DM6 F;  1REP C;  4BEH A;  2JT1 A;  1MMN A;  2DN0 A;  1Z21 A;  3GTO J;  4EM1 A;  2K9N A;  4BE1 A;  4W97 A;  2GXG A;  5H2F C;  2DA2 A;  2WY8 Q;  1CGP A;  1P4A A;  4ZDO A;  2CUF A;  1X3W B;  1TLH B;  2JPB A;  2OA4 A;  3QU6 A;  1FC3 A;  3E5U A;  3G1M A;  4YEL A;  4E7S A;  4HDU A;  1TZL A;  3SQN A;  3I54 A;  1JUM A;  2Y9Y A;  3S17 J;  1B6A A;  1X1D A;  3SZG A;  2OU2 A;  4U0V A;  3VDX A;  1H0M A;  4KUM A;  2UV1 A;  2QSF X;  4CSW A;  1ZR2 A;  4BH9 A;  2CJJ A;  4FTH A;  1OKR A;  3C7J A;  5ERI A;  1KGS A;  1Y39 A;  2OAZ A;  2HTS A;  4CCO A;  2D5V A;  1OFC X;  2IVM A;  1MBJ A;  3GW2 A;  3Q0W A;  5E8I A;  1U9N A;  2XIG A;  1HW2 A;  4YFK F;  3IL2 A;  5FRM A;  2ZNZ A;  3BCB A;  1MW7 A;  1BIB A;  2BY0 A;  3F6V A;  4Q5S F;  3FXL A;  3AG4 H;  3CMA I;  2P0W A;  3OYJ A;  4BL0 B;  4BUP A;  2PJR A;  1MBG A;  1J2X A;  3V8K A;  3ZP5 A;  1BN5 A;  5EZG A; 
#chains in the Genus database with same CATH homology
 3PQJ A;  2DBB A;  2HKX A;  3CUQ C;  3M8F A;  1O57 A;  4Q4Z F;  1U6G A;  1ZRC A;  1KU7 A;  2XV4 S;  4L9N A;  4EJU A;  5H6Q A;  4N9H A;  1BI3 A;  3HTS B;  5D8L B;  1QNT A;  2WV0 A;  2QM3 A;  4EMS A;  2M30 A;  3L9F A;  4AIJ A;  2VBW A;  2DK5 A;  2QVO A;  1MJA A;  2V9V A;  5LGT A;  4KMF A;  1P4W A;  5HDN A;  4CGZ A;  1D3Y A;  1QPM A;  3L09 A;  3TDU C;  1DUX C;  1A04 A;  5L3E A;  4HF2 A;  1L0O C;  3N4M A;  4R79 A;  1ON1 A;  2Q8K A;  1V3F A;  1D8K A;  4I01 A;  2Q2E A;  2MA3 A;  2DLL A;  3IRR A;  5K5R A;  4HV5 A;  1FYL A;  2QYO A;  3DQV C;  2LF7 A;  5DCF A;  3W6J B;  4PCQ A;  3ELK A;  2FOK A;  1W7P D;  2EA4 A;  2EV6 A;  3U9G A;  3H92 A;  1WSU A;  1ZLJ A;  3RI4 A;  2VON A;  2L01 A;  3NEU A;  4FHT A;  2XKO A;  1IW7 F;  4AIH A;  2D1V A;  1TQP A;  1G4D A;  3F8M A;  1P92 A;  1SD5 A;  1R1T A;  3HRM A;  1IZ1 A;  2XAG A;  4RGU A;  2FE3 A;  1ODD A;  4RGR A;  1XDS A;  4OIR F;  3BWG A;  4KIC A;  3DKW A;  1P4X A;  4HF1 A;  2W24 A;  4OOI A;  4IRI A;  4JBA A;  1LDJ A;  4IHS A;  5LLQ A;  5L3G A;  5LHH A;  4B09 A;  1R36 A;  2HFH A;  2JPC A;  3G73 A;  4BHB A;  4LB6 B;  3JW4 A;  1J59 A;  1JHF A;  2KIU A;  4EGZ A;  2A61 A;  1F1Z A;  1YW7 A;  3OOP A;  5F1R A;  2ACJ A;  2HKO A;  2EV5 A;  3ECO A;  1S8N A;  4MTD A;  2HTJ A;  2GQQ A;  2VC1 A;  3R61 A;  4ZYD A;  1KQ0 A;  1JE8 A;  3ZPL A;  2W85 A;  3COA C;  1STZ A;  4IXA A;  1ZRE A;  3IWZ A;  4S04 A;  1I27 A;  1YQA A;  3HOS A;  4RAY A;  1HKS A;  4L18 B;  1S29 A;  3JTG A;  2EV0 A;  3F8N A;  1HKQ A;  5JHU A;  4HF0 A;  1IF1 A;  2DFI A;  1ZG1 A;  3ML6 A;  1FX7 A;  3ZMD A;  2FMY A;  1G3W A;  1R00 A;  5IT3 A;  2O6G E;  3MWM A;  1J7K A;  3B73 A;  4LG0 A;  1ZHF A;  4PDK A;  4G6Q A;  2MH9 A;  4EJW A;  2P6S A;  5FO5 A;  1O3T A;  2H09 A;  2FU4 A;  2BEO A;  1U8R A;  4GCV A;  5FGM A;  2A68 F;  1YTY A;  4A6D A;  2FQ3 A;  2HYF A;  4EGY A;  4HX7 A;  3IKV A;  3R0J A;  3GZ5 A;  3NQO A;  1R1V A;  2K86 A;  3TO7 A;  4RB3 C;  2A5Y B;  4KMU X;  1BC8 C;  3TDZ C;  3RKW A;  2DQR A;  1H9G A;  5L3C A;  1B4A A;  2NAZ A;  4OU0 A;  5DYM A;  1AOY A;  1LDK B;  3QPH A;  1ON2 A;  3F22 A;  2QLZ A;  4MEX F;  1PP8 F;  3KLN A;  5HVQ C;  3IKT A;  3QOP A;  2D1H A;  3FX3 A;  1HST A;  3WTX C;  4XSX F;  4WF2 A;  1U5T B;  2R7F A;  3MAJ A;  1LDD A;  1O3Q A;  4WX9 A;  1X3U A;  2L4M A;  4G7Z F;  3DV8 A;  5K5Q A;  3V7S A;  3GFL A;  4KA4 A;  3K1M A;  3ERE D;  1ZH5 A;  2O8X A;  5D8K B;  2ZCW A;  5E18 F;  3CO7 C;  4G7H F;  1SAX A;  1ZGA A;  4I0A A;  2RQP A;  3PFI A;  3WE3 A;  3QAH A;  1YYV A;  4HDV A;  4HQE A;  4ZYH A;  2JTV A;  3DXJ F;  3O3K A;  3FWE A;  2MD5 A;  1R22 A;  2WTE A;  2VE9 A;  1XB4 A;  2P5V A;  1KQ9 A;  5LGU A;  4BXU A;  1P6R A;  3J80 Z;  4EQQ A;  4XRF A;  3SFZ A;  4D0P A;  4IF4 A;  5CVR A;  3V7R A;  1MD0 A;  3B02 A;  1Z9C A;  2HYG D;  3I58 A;  5LRS A;  5J6X A;  1XGO A;  1YW9 A;  4E70 A;  3L7W A;  4LLN A;  4A6E A;  1SD6 A;  5J8C A;  1XDU A;  3FM3 A;  3GXO A;  2ZXJ A;  5DUI A;  4WXC A;  4IPA A;  1HKT A;  3R0A A;  1DPU A;  1T6S A;  2ZME A;  3I0T A;  4HX8 A;  2P7V B;  4IHT A;  2M5W A;  1MGT A;  5F6F A;  5BS6 A;  4CYD A;  1RUO A;  2FML A;  5J8F A;  1FZP B;  5HLG A;  4KIB A;  4OIQ F;  1E17 A;  4G6D A;  3MEX A;  3GFM A;  5HDG A;  3W6K B;  2FRH A;  1YW8 A;  3EET A;  3D0S A;  1HXD A;  1QO0 D;  4KFC A;  5AIQ A;  2IRF G;  2FBK A;  2HQR A;  3BJA A;  4HZF A;  2LNB A;  1S6L A;  1Z91 A;  1HSJ A;  3Q9V A;  4OIP F;  1Z6T A;  2V6C A;  4P9F A;  2CGP A;  2MLG A;  1FSH A;  1J0R A;  2EFN A;  4M6X A;  3WTV C;  2FNA A;  1JXS A;  1FOK A;  2AXL A;  2K4J A;  2RKH A;  5LHI A;  1IAW A;  4UV9 A;  3JAM K;  3QP6 A;  2XAS A;  2UZK A;  4EJT A;  1FLI A;  5D6F A;  1HBX G;  5LEK A;  4L9T A;  3GVA A;  3KFW X;  3KP5 A;  4YFN F;  4G8X A;  4JQF A;  3O6B B;  4WK8 F;  4LGW A;  4N9I A;  3AAF A;  5TRD A;  1E2X A;  4A5N A;  2E1N A;  3L2C A;  2XRN A;  4CHU A;  5JVT A;  2NNY A;  2KKO A;  1MJB A;  3FXR A;  3I59 A;  4CXF A;  4LLG F;  4L0Y B;  1BM9 A;  1F9N A;  1PP7 U;  2F5C A;  2M8E A;  2L3D A;  1K78 A;  4GYG A;  3RJP A;  2MBF A;  2IA2 A;  2RVC A;  1TQI A;  3WTW C;  2BBY A;  3E6D A;  4UVB A;  3T0Y A;  2A3S A;  1LEB A;  1B59 A;  5ICE A;  2CFX A;  4GO1 A;  4ESJ A;  4PGH A;  2HGC A;  2ZFW A;  3FXU A;  5KK1 A;  2EFW A;  1SD7 A;  1UST A;  4CO8 A;  5HLI A;  3HOT A;  3TO9 A;  1SFU A;  4EJO A;  1XGN A;  2KRF A;  1TNS A;  2QEN A;  4R8H A;  4LG0 B;  3HUG A;  3E3V A;  4EM0 B;  1YO5 C;  2VT3 A;  3R4K A;  3V4G A;  5DDG A;  3E6B A;  5ILV A;  4XLN F;  1ZN2 A;  1EV7 A;  1RI7 A;  2PMH A;  3LA7 A;  1XGM A;  2VC0 A;  4JK1 X;  2TDX A;  4KIG A;  1B1B A;  3KP4 A;  3WTU C;  1FP2 A;  4UVA A;  2QQA A;  1OPC A;  2NNN A;  4YIF A;  2XRO A;  2Z33 A;  1LVA A;  4L9J A;  4LK1 F;  1R7J A;  3RIR A;  2FBI A;  1BOA A;  2KJC A;  2ETH A;  2CWE A;  3E6M A;  1IRG A;  5L3B A;  4HQM A;  4I02 A;  4YG2 F;  1KU9 A;  2P5K A;  3HSF A;  2O3F A;  4KN7 X;  2VOP A;  4G94 A;  1XGS A;  3P7N A;  3BOQ A;  4R1H A;  3K0L A;  3VOD A;  1MDM A;  2DU9 A;  1IXR C;  2FNP A;  5E1X A;  1ONV A;  2DI3 A;  2GZW A;  5H6R A;  2Z99 A;  3SZP A;  3K1N A;  5EEG A;  2STW A;  1DP7 P;  4XBF A;  1SFE A;  1CF7 B;  4O5V A;  4MQ9 F;  3C3W A;  5CVU A;  1OMI A;  5D4S A;  2KJB A;  3VEP A;  4OMZ A;  2EA2 A;  1UFM A;  1XCV A;  2YU3 A;  1S7O A;  2COM A;  3WE2 A;  3IC7 A;  1H9T A;  4LB5 A;  3ZMZ A;  1TNT A;  2CO5 A;  1IN8 A;  2YX7 A;  3QP5 A;  4O6J A;  3MZH A;  2Y48 A;  2F2E A;  1YIO A;  2XAJ A;  4U0W A;  3GF2 A;  4Q47 A;  4LD5 A;  1FWZ A;  4ZZD A;  2UXN A;  5HS7 A;  5BPD A;  1Y0U A;  3F3X A;  2DAO A;  1QZZ A;  4M9X A;  2VT2 A;  4RB1 A;  1MZB A;  5F64 A;  3FMS A;  2L4A A;  4HW0 A;  4L5J A;  5HS8 A;  4M9Z A;  5KVR A;  1IN5 A;  4P55 A;  1ZG5 A;  3FXQ A;  4BQA A;  1XD7 A;  2STT A;  2ZME B;  2P4W A;  1ZAO A;  2CQK A;  3M1E A;  4A0Y A;  4EM2 A;  1Z1D A;  4M71 A;  5AIP A;  3WU0 A;  2O0Y A;  5DV5 A;  4P5O A;  2X0L A;  3CO6 C;  2IPQ X;  3RPQ A;  2R3S A;  2ZKZ A;  5CYV A;  2MC3 A;  2G7H A;  3H3U A;  3KCC A;  2M87 A;  3J81 K;  1G3T A;  4UV8 A;  4AWX B;  3RTR A;  3I4P A;  1RUN A;  2D2W A;  1SMT A;  3KLO A;  5LGN A;  3EDP A;  1U78 A;  5ILS A;  3HSR A;  5HLH A;  1KA8 A;  2DT5 A;  1U5T C;  1O3S A;  5D5U B;  2KIF A;  3FMR A;  2VBY A;  3N97 A;  2ESH A;  4I0B A;  1S3J A;  1T98 A;  2DPD A;  2H6B A;  3ZMS A;  1IN6 A;  3ISP A;  1PDN C;  5FFZ A;  2VBZ A;  3DFG A;  2BE5 F;  2P8T A;  2RN7 A;  1R23 A;  4HA8 A;  3ZN0 A;  2UXX A;  1J75 A;  3I5U A;  2W57 A;  2GA2 A;  2O03 A;  3M9A A;  4XSZ F;  2QBY A;  2M45 A;  3F72 A;  4S05 A;  4EJV A;  4HBL A;  4WCG A;  1IUY A;  2A69 F;  3CUO A;  4ENK A;  2LDU A;  5FB2 A;  4HLY A;  2H94 A;  3K9T A;  3I53 A;  3I59 B;  3VOE A;  3WOD F;  2OQR A;  1YFH A;  2QQB A;  3V7C A;  3DPL C;  2X4H A;  5DEQ A;  2VXZ A;  1YS6 A;  5LBQ A;  1K78 B;  2HWV A;  4P96 A;  2K4B A;  1FPQ A;  4G7O F;  1B9M A;  2CSO A;  3BDD A;  1I5Z A;  2PN6 A;  1R1U A;  4FT8 A;  1I1S A;  3CTA A;  2Z3Y A;  5L3D A;  2V79 A;  3MCZ A;  3F21 A;  3HTU A;  1UB9 A;  1K6O A;  2FF4 A;  2IA1 A;  3JAM Z;  4F7Z A;  4ON0 A;  4CDG A;  5BMZ A;  1KU3 A;  1MKM A;  3GX4 X;  2L02 A;  3BJ6 A;  4YFX F;  3ROU A;  3EYY A;  2PMU A;  4GXO A;  2RC4 A;  4MNU A;  2HEO A;  1XSX A;  1EH8 A;  5L3F A;  3U2R A;  5TJJ A;  2LF8 A;  3O2P E;  3FF5 A;  3BPV A;  1SFX A;  4QWQ A;  5AON A;  2QQ9 A;  5BOX A;  4CZZ A;  5JR3 A;  5D5X B;  1UHW A;  1BBY A;  1V4R A;  2KIM A;  1U3E M;  5IT9 K;  3F8C A;  6PAX A;  1BIA A;  1YLF A;  1T39 A;  3CUQ A;  4LMY A;  1KU2 A;  2Y0M A;  3ZMT A;  2JSC A;  5EEH A;  5A2Q K;  1MDM B;  1XMA A;  3T8T A;  1BI2 A;  3FMQ A;  1BJA A;  4DQ2 A;  2VBX A;  3ZMV A;  4AVP A;  1AWC A;  4HYE A;  2CYY A;  3MQ0 A;  4KT5 C;  2J5O A;  3ULQ B;  3EQL F;  2EFQ A;  2FXA A;  2PEX A;  1D5V A;  4NB5 A;  4M9S A;  4YII A;  1J9I A;  2PI0 A;  4KDP A;  4Q48 A;  2IA0 A;  1LNW A;  4AD9 A;  2YSR A;  2XGX A;  5FFX A;  1R58 A;  3RDI A;  1OYW A;  5E20 A;  3BPX A;  5E17 F;  3Q5F A;  4K2E A;  1C0W A;  3GO5 A;  4WXH A;  4HOB A;  2NRA C;  3LFK A;  3DF8 A;  5E8G A;  4ESB A;  4ZZL A;  5CVV A;  3D5L A;  4ZH4 F;  2K27 A;  1IXC A;  3ABT A;  3KP7 A;  2HZT A;  4Y15 A;  4CIC A;  2AS5 F;  3BRO A;  5D6E A;  1FY7 A;  1K7A A;  4HLX A;  5HOO A;  2WC2 A;  4XLP F;  3RYP A;  5K1Y A;  1DPR A;  5ICF A;  1QQI A;  1I6X A;  5ICG A;  3SXY A;  2DK8 A;  4H0E A;  3E6C C;  3VB2 A;  1QGP A;  1KYW A;  3HRT A;  2JZY A;  4UVC A;  1LB2 A;  2DTR A;  1SMY F;  4A2U A;  3SHF A;  3NRV A;  1TW3 A;  2OD5 A;  1QBJ A;  4BHP A;  2NYX A;  2O61 A;  3HSE A;  3WGH A;  5HDK A;  1T38 A;  1DDN A;  3T8R A;  2XAQ A;  1XCB A;  2Z5U A;  3L00 A;  4I7H A;  2A6E F;  3TQN A;  4EVI A;  2ZJ2 A;  2NS0 A;  2B0L A;  2W84 A;  4L5I A;  2OZ6 A;  5CVI A;  2HQN A;  4NQW A;  4P9U A;  2QUF A;  1UCR A;  3KP6 A;  2BGC A;  1ZYR F;  3M7G A;  4A5M A;  3KE2 A;  1YG2 A;  3TO6 A;  3E97 A;  3FZV A;  3JSP A;  3E5Q A;  1NHA A;  3RPU A;  2QBY B;  1XN7 A;  1U5T A;  3P9C A;  4UNO A;  4Y17 A;  1LQ1 A;  1ZLK A;  1FSE A;  1JHH A;  4ETS A;  4GGG A;  2RDP A;  3LST A;  5LEJ A;  1ZG3 A;  4A0X A;  3J81 Z;  5DCM A;  1W7P A;  4M73 A;  5CJ9 A;  4L9V A;  3DEU A;  1P2F A;  1Z05 A;  4FX4 A;  4IJA A;  1WKM A;  3F8B A;  2K7L A;  2ISY A;  3KET A;  1W5S A;  4BYY A;  3GFI A;  1Q1H A;  3WGG A;  3K1P A;  4BAY A;  2DW4 A;  5FD5 A;  3KP2 A;  2IW5 A;  4U7D A;  2ZO4 A;  4BNC A;  2M1B A;  2XUB A;  3GYH X;  4WWC A;  3WTS C;  3S2W A;  4ASN A;  3F23 A;  4O3M A;  5H20 A;  1LJ9 A;  4A0Z A;  4G9Y A;  5JFR A;  3QPT A;  1XMK A;  1USS A;  3C1D A;  1FYM A;  3HYI A;  4M72 A;  3T1B A;  3I71 A;  3HRU A;  3E5X A;  1IRF A;  3JTH A;  3GWZ A;  1Z7U A;  5CLS A;  5FLX Z;  4UXN A;  3LAJ A;  5ILU A;  3HRS A;  1GXQ A;  1FNN A;  2FBH A;  2PBI A;  3QRF F;  5BQT A;  4IVN A;  2PLY A;  2V1D A;  4RB2 C;  3V8J A;  3HHG A;  1F5T A;  3CJN A;  4Z2Y A;  3WU1 B;  1O3R A;  3KZY A;  3VFZ A;  3CUQ B;  2F5D A;  1FBU A;  3HIF A;  4N0B A;  4RGS A;  4ESF A;  1U2W A;  5DUK A;  3PQK A;  3GZ6 A;  2V1U A;  1FP1 D;  1W4M A;  2GIV A;  1WQ2 A;  1OYY A;  1BI0 A;  5E1W A;  2P7C B;  1HW1 A;  3F8F A;  3LA2 A;  2GWR A;  4ENJ A;  2H27 A;  3C18 A;  1UHM A;  2ESN A;  2GAU A;  2G9W A;  2RNJ A;  3BJO A;  2LSO A;  1PUE E;  1W5T A;  2CW0 F;  3P9K A;  4IRG A;  4RB0 A;  5IT9 Z;  3IWF A;  3SZT A;  1SD4 A;  5HS9 A;  3WG9 A;  2EWN A;  2VOD A;  4WXD A;  1BI1 A;  2RGV A;  2ZBK A;  2C6Y A;  2YR2 A;  3GLX A;  3FM5 A;  4ZYG A;  3ZQ7 A;  2E7W A;  2FA5 A;  4RAZ A;  3BP8 A;  5A2Q Z;  4ENM A;  1MJ9 A;  3ECH A;  3T5X A;  3J7A O;  2EFP A;  4TV7 A;  5BPI A;  2J5P A;  3BZ6 A;  3DP7 A;  1G3S A;  5K5O A;  3RKX A;  2YPR A;  5D5W B;  3IRQ A;  4AIK A;  4NHJ A;  2ELH A;  1J5Y A;  1ZRF A;  1FT9 A;  5LRR A;  3WTZ A;  3CLO A;  4PZJ A;  4MTE A;  4M6Y A;  3OV8 A;  2JRT A;  1T2K A;  2UWM A;  2HS5 A;  2WWY A;  4HAM A;  2YX4 A;  2LKP A;  2D45 A;  1G3Y A;  4UHT A;  4KNY A;  5FLX K;  1VTN C;  4I09 A;  4IRH A;  2H6C A;  3ZN1 A;  1T0F A;  3DPT A;  3REO A;  3R6S A;  4U0Y A;  2OQG A;  3ZMU A;  5ICC A;  2VOO A;  2XAH A;  1TW2 A;  2QZ8 A;  4QLC U;  2K02 A;  2VN2 A;  3H3Z A;  4BHC A;  5FD6 A;  4KYW A;  4MHG A;  4RS8 A;  2ISZ A;  3WTT C;  3LQQ A;  2DO7 A;  2ZNY A;  3QU3 A;  1R5G A;  3F6O A;  2EJR A;  3U1D A;  1GXP A;  2VE8 A;  3P9I A;  2IT0 A;  1O7L A;  2W25 A;  4PGG A;  2Q0O A;  2IP2 A;  1ZAR A;  2XAF A;  2EK5 A;  4OIN F;  5DD8 A;  3JSO A;  3IHU A;  4ENN A;  3K69 A;  2ADU A;  3GFJ A;  1BC7 C;  3MZY A;  2CG4 A;  1TQM A;  3EUH A;  1IXS B;  1CF7 A;  1TBX A;  2PFB A;  3K2Z A;  4U7B A;  2OZU A;  1F4K A;  5DCM B;  1W7P B;  3KP3 A;  4MEY F;  2A07 F;  1L3L A;  1WRJ A;  1GHC A;  2IJL A;  3CDH A;  1ULY A;  4HX4 A;  2XKP A;  2MLK A;  2PQ8 A;  3MFK A;  3RKY A;  4B8X A;  4OMY A;  3G3Z A;  1XSV A;  4MQV A;  2L54 A;  2GXB A;  4LLL A;  2XVC A;  5JI6 A;  1FBS A;  4I2O A;  1ZRD A;  3Q9S A;  2DQL A;  1RZ4 A;  2V1X A;  1FYK A;  2HR3 A;  1KYZ A;  2RV8 A;  4U88 A;  3FHZ A;  2F5F A;  2G7U A;  3KEO A;  3R60 A;  3EYI A;  1XSD A;  4RGX A;  1EH7 A;  5LHG A;  5D5V B;  3M8E A;  1FBQ A;  4LJZ F;  3WTY C;  1TTY A;  1WWX A;  1Z6R A;  1QZY A;  4FX0 A;  3HHH A;  4LFU A;  4ZYE A;  2BV6 A;  3WGI A;  4EV0 A;  4I98 B;  1JGS A;  4OIO F;  2FSW A;  5ED4 A;  1R5H A;  3GEZ A;  3BY6 A;  2P6T A;  3TOA A;  3LWF A;  2HOE A;  1OYI A;  2OBP A;  3KEQ A;  4M74 A;  1I1G A;  3LQR A;  2PJP A;  4UUV A;  1IN4 A;  4KN4 X;  1YS7 A;  1O7F A;  3KZZ A;  2E1C A;  2F5E A;  3TGN A;  4GYI A;  1RIO H;  4KIF A;  5CVJ A;  2P5L C;  2DPU A;  2Y75 A;  2A6H F;  4L0Z B;  3TKY A;  1KQ8 A;  4Y13 A;  4MGR A;  4LK0 F;  2Z9O A;  2EB7 A;  3TOB A;  2R7D A;  1G6N A;  1LEA A;  2PG4 A;  2QWW A;  1IN7 A;  1HQC A;  3V8L A;  2GA1 A;  1RNL A;  4A12 A;  1B9N A;  1S7A A;  1ZGJ A;  3GUD A;  3I64 A;  5DD4 A;  2HDC A;  1HW5 A;  3LA3 A;  4HV6 A;  1EH6 A;  2E7X A;  2XHK A;  1GVJ A;  1WI9 A;  2FEZ A;  2MH2 A;  1D8J A;  3RYR A;  2EFO A;  1K79 A;  4DNC A;  3LAP A;  2BYV E;  3ABU A;  3J80 K;  5E1Z B;  1OR7 A;  5D4R A;  1REP C;  2JT1 A;  4EM1 A;  2GXG A;  1CGP A;  1P4A A;  1TLH B;  2JPB A;  2OA4 A;  3QU6 A;  1FC3 A;  3E5U A;  4HDU A;  3SQN A;  3I54 A;  1B6A A;  2OU2 A;  4U0V A;  1H0M A;  4KUM A;  4BH9 A;  1OKR A;  3C7J A;  5ERI A;  1KGS A;  2OAZ A;  2HTS A;  2IVM A;  3GW2 A;  5E8I A;  2XIG A;  1HW2 A;  4YFK F;  3IL2 A;  2ZNZ A;  1BIB A;  3F6V A;  4Q5S F;  1J2X A;  3V8K A;  3ZP5 A;  1BN5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...