2OQGA

Arsr-like transcriptional regulator from rhodococcus sp. rha1
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
109
structure length
109
Chain Sequence
GMTVGTYAELASVFAALSDETRWEILTELGRADQSASSLATRLPVSRQAIAKHLNALQACGLVESVKVGREIRYRALGAELNKTARTLERIGAEWDRRLAAIKQIAESM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Possible transcriptional regulator, ArsR family protein
publication title Crystal Structure of the ArsR-like Transcriptional Regulator from Rhodococcus sp. RHA1
rcsb
source organism Rhodococcus sp.
total genus 40
structure length 109
sequence length 109
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12840 HTH_20 Helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2oqgA00
3WODF 3BZ6A 1SMYF 3F3XA 1T39A 3KP4A 3VB2A 1BIAA 2F5DA 1K7AA 2XKPA 4RGRA 2KIFA 4RGSA 1L3LA 1R36A 2OQGA 3H3UA 4DNCA 1OR7A 3AAFA 1BOAA 1JHHA 4LFUA 5L3DA 3C18A 4MNUA 5LGNA 5FD5A 4ENKA 3H3ZA 2XRNA 1KQ8A 3TDZC 1J0RA 3FM3A 3CLOA 2XIGA 5ILUA 3NRVA 2R3SA 3ZMZA 4HZFA 4LD5A 2K02A 2EFOA 1W7PB 3F8MA 3QPTA 4E70A 2VBWA 2ZKZA 3GXOA 2B0LA 4A12A 5TRDA 2QYOA 4NB5A 4BQAA 1BBYA 2XUBA 3J81K 2K4BA 5D4RA 1HSJA 2UXNA 5L3FA 2OQRA 2CW0F 1P2FA 3F6OA 2YX4A 2OZUA 2NS0A 5K5RA 4AIKA 4IXAA 4ESBA 4UVCA 2DQLA 1KU3A 3ML6A 4ENJA 4OOIA 5LRRA 2PJPA 5LLQA 2GXGA 4FX4A 1BN5A 4G6DA 4ZZDA 5ILSA 2NRAC 4PDKA 1Z7UA 3RKYA 2XHKA 5H6RA 4A2UA 2A3SA 2PMUA 4RAYA 1U5TC 5A2QZ 1LEAA 2IRFG 3I0TA 4EM1A 4UVAA 4Q48A 3RJPA 2MH2A 1ZREA 4YG2F 3HUGA 4PCQA 4KN7X 3CUQA 2BYVE 4XSXF 4M72A 4KIBA 3P9KA 2DU9A 5J6XA 3LFKA 2HTJA 3D5LA 2BBYA 3I5UA 3LQRA 3HHHA 4OINF 3WTYC 1USSA 2G7UA 3QAHA 3SHFA 3NQOA 1P6RA 1U3EM 5ICEA 5LEJA 3F8NA 3GF2A 2CGPA 1KA8A 2BE5F 2A6EF 4HQMA 2DW4A 2JT1A 2DBBA 2J5PA 3GEZA 2K27A 3F6VA 4WK8F 1P92A 1XGOA 2VE8A 3BY6A 3GO5A 3GX4X 2CWEA 2A6HF 5ERIA 5L3GA 3ZP5A 3BPXA 2FMYA 1CGPA 3G3ZA 4QWQA 4LB6B 2HGCA 3FM5A 4YIFA 2CFXA 1TBXA 4NHJA 5FFXA 2IPQX 1ON1A 5DCFA 2ZMEA 1OYWA 1H9TA 2V9VA 4G94A 3Q9SA 4L9NA 4I7HA 4U88A 1XCVA 3PQKA 4JQFA 5ICFA 2JTVA 1IW7F 5D8LB 2HDCA 2WTEA 2RN7A 3PQJA 2QVOA 1MJ9A 4XSZF 2OU2A 2STWA 2KRFA 1ZRDA 4KA4A 2R7FA 3IKVA 1AWCA 5LGTA 1UFMA 2FXAA 3KP2A 2RDPA 1K6OA 4MEYF 2IA2A 3QP5A 2ZFWA 1P4XA 2W84A 3Q5FA 1L0OC 1RZ4A 4L9VA 1HBXG 3J80Z 2VBYA 3C3WA 3WTTC 2K7LA 1HKSA 4AWXB 2VOOA 2D1HA 4KDPA 1IXCA 1PP8F 3MQ0A 5D5XB 1FP2A 5AONA 3BROA 5D5UB 5K5QA 2OAZA 1RIOH 2Z3YA 5LHHA 4BHPA 2RVCA 3TO9A 3BWGA 4BH9A 1ZRCA 4ESFA 2BV6A 2NAZA 1YFHA 5CLSA 3L00A 1KQ0A 2VODA 5HLIA 1O7LA 2IA0A 4Y15A 1O57A 3M8EA 4ZYHA 4P55A 2IW5A 3V7RA 4CZZA 3O2PE 4EMSA 3IKTA 2ZCWA 2KKOA 4RAZA 2XASA 1YW9A 4OIRF 2EWNA 2PFBA 5FB2A 1S29A 4GXOA 3KP3A 1OYYA 3ZMVA 5CYVA 4L5JA 4MTEA 3L2CA 3BP8A 2PN6A 1I27A 4LG0B 5ICGA 5HLHA 1W5TA 5LGUA 1B1BA 1QBJA 3E5XA 4IHSA 4EV0A 4JK1X 1GVJA 2HR3A 1J7KA 4ON0A 3IWZA 3O6BB 1TQPA 3F72A 5BQTA 4UV8A 5ILVA 1K78A 4CYDA 2FRHA 4O5VA 2OA4A 5A2QK 2MBFA 3OV8A 3WTZA 5EEGA 3VFZA 1SAXA 3V4GA 1X3UA 4YFNF 4CXFA 4P9FA 4EGYA 4FHTA 3U1DA 4I0BA 5E1ZB 4PZJA 1MJAA 1FT9A 3V8LA 5K1YA 2QENA 1ZG3A 4M73A 1J75A 2UXXA 2PEXA 2M87A 1Z1DA 3BDDA 4Q5SF 3T8TA 1ODDA 3K9TA 3FX3A 4OIOF 4Q4ZF 2NYXA 4XLNF 1QQIA 5BOXA 1F4KA 2ZBKA 3MAJA 1ZLKA 4S05A 3ZN1A 2KIUA 2L3DA 5E8IA 4LK1F 1FPQA 2G7HA 1LB2A 1K78B 4DQ2A 1KYWA 4GYGA 4P9UA 2HQRA 3E3VA 4KIFA 3I59B 2HYGD 3TO6A 4FX0A 2J5OA 3JSOA 1MD0A 1SD6A 1R1VA 2L54A 3JTHA 1SFXA 1D8JA 1IAWA 1B59A 4EJUA 3SXYA 1ZAOA 1H9GA 2WC2A 5CVVA 5D6FA 2W85A 1XSDA 2GA1A 3M1EA 2K86A 2K4JA 1CF7B 2ZNZA 3ROUA 3WGHA 1LEBA 3KFWX 2FBIA 1U78A 1F1ZA 2RC4A 1ZYRF 4EGZA 2HYFA 4M9ZA 2L02A 2VE9A 3KEOA 3IWFA 4UNOA 3OOPA 2HWVA 3RIRA 1ZG5A 5HS8A 1IF1A 3LA7A 3RYPA 3QP6A 2D45A 1XMAA 2XAFA 1R23A 1FWZA 3HRSA 5FLXZ 4L18B 2L4MA 2COMA 1FC3A 3BJ6A 1BI2A 3F8FA 4M71A 3HSEA 4LGWA 2F2EA 3GWZA 3DPLC 1SFUA 1ONVA 3I71A 1TNTA 2XROA 4PGHA 1YQAA 1G3TA 3QOPA 1TLHB 3HRMA 2PBIA 1XGMA 4G7ZF 4I0AA 1OYIA 4GCVA 3SFZA 4HOBA 3R6SA 2HZTA 3ERED 1T98A 3K69A 4OIPF 4IHTA 3BJOA 1R5GA 2QUFA 3IC7A 5LHIA 2F5FA 2TDXA 4HA8A 1GXQA 4LB5A 2XKOA 1TNSA 3LAPA 5E20A 5BPIA 4IRIA 2FQ3A 3WGGA 1IRGA 2HTSA 2LDUA 2DLLA 2UWMA 3KEQA 2FU4A 4P96A 3HIFA 3GYHX 2ESNA 3TKYA 3HHGA 4R1HA 3TOBA 3V7CA 2XGXA 1P4AA 1BM9A 3F21A 1S3JA 2Q8KA 1J59A 2QM3A 4A5MA 4M9SA 2AS5F 2UZKA 2EV5A 4P5OA 4LK0F 3MFKA 5IT9K 2EV6A 1FSEA 1S8NA 2XAHA 1TQMA 1FBUA 4BAYA 4O3MA 3ECOA 2PLYA 1W7PD 1RNLA 3JSPA 4EM2A 1IUYA 1FBSA 1JXSA 2V79A 4G7OF 5J8CA 1R5HA 1FLIA 1AOYA 3R60A 5HOOA 2Y75A 3G73A 1FX7A 3KZZA 2FF4A 1P4WA 1DUXC 4BHBA 1Z91A 1R7JA 4WWCA 1I1SA 3R4KA 4EJVA 4A0XA 4HBLA 1D8KA 1H0MA 1R00A 1XN7A 3CTAA 3FXUA 4N9IA 1BC8C 4M74A 1IN6A 2A69F 2MH9A 3CJNA 1FNNA 3ZQ7A 5CVIA 3ULQB 3Q9VA 2KJBA 2H6BA 4KMUX 4LLNA 2DAOA 2WWYA 3HTSB 2M8EA 1ZHFA 3E5QA 3C1DA 2BEOA 3H92A 2O03A 5DCMA 1K79A 1YS7A 1ON2A 2ACJA 2OBPA 1WRJA 4MQVA 1W5SA 3E5UA 2A61A 3GUDA 2L4AA 1IRFA 3T1BA 4G9YA 4WX9A 2Q0OA 1ZG1A 3EYYA 1XMKA 3CUQB 1YO5C 5CVUA 5D8KB 2X4HA 3WTVC 1NHAA 2YPRA 4HV5A 2NNNA 1VTNC 3F22A 1B9NA 2JZYA 3TGNA 5E18F 3DFGA 1W4MA 2LSOA 2M1BA 4UV9A 4MTDA 3IL2A 3GFIA 4B8XA 3PFIA 5H20A 1D5VA 5AIQA 2E1CA 5DCMB 2QZ8A 1QZZA 5L3CA 4WXCA 4HX8A 1V3FA 1IN8A 2FNPA 5FLXK 4IF4A 5JFRA 1HXDA 4LLGF 2EK5A 5L3BA 3VODA 4HLXA 3TDUC 4ZYEA 4O6JA 1Q1HA 1DPRA 1Z6TA 5DUIA 2VC1A 3TOAA 3U9GA 1KYZA 4GO1A 2XAJA 2FBKA 1KGSA 2DT5A 2ZMEB 5DDGA 1S7OA 2LKPA 2FMLA 5HLGA 2H27A 3CDHA 1FY7A 1RUOA 3E97A 3GLXA 3LQQA 1BIBA 4G7HF 4A6EA 3DKWA 2RGVA 3R0JA 4JBAA 4BHCA 4AD9A 5ICCA 1PP7U 2ETHA 3S2WA 1RUNA 2VN2A 1O3QA 4KICA 1LDKB 3L9FA 1Y0UA 2ZO4A 3M8FA 1EH6A 1IXSB 3WTXC 4HV6A 4I01A 2OD5A 4HF2A 3JAMZ 2D1VA 4KIGA 2MLGA 3IRQA 3RDIA 1O3RA 3WU1B 4L9TA 4ZZLA 1SMTA 4L0YB 2Z5UA 3CUQC 3C7JA 4L9JA 4KMFA 2JPBA 2DPDA 1HSTA 3ISPA 6PAXA 4EM0B 4ZYDA 1JE8A 2RV8A 4I02A 5IT9Z 2FNAA 4MEXF 2P5VA 2V1XA 3HRTA 2CQKA 2RNJA 3L09A 3KP7A 4RB1A 3DEUA 3RKXA 3W6KB 2DTRA 3ABUA 4XRFA 1YW7A 3LA2A 5BPDA 5FD6A 3LSTA 1FYKA 4N0BA 4ASNA 3HTUA 1ZGJA 4F7ZA 1IXRC 1B9MA 2A68F 2Q2EA 4K2EA 4FT8A 1LVAA 2R7DA 2HKXA 5TJJA 4RS8A 2HQNA 2HS5A 4Y17A 1YYVA 2Z33A 1F5TA 2LF8A 2E7WA 5L3EA 1FYLA 2XV4S 1XSVA 2O0YA 1FOKA 3I53A 5LHGA 3I54A 1FZPB 3WE3A 1ZH5A 3KZYA 5EEHA 3B73A 1A04A 1T6SA 1MDMA 4AVPA 3BOQA 1YW8A 2F5CA 4L5IA 4KYWA 3RPUA 2ZJ2A 2DQRA 2V6CA 1WQ2A 3DQVC 4RB3C 3FHZA 2IT0A 2MLKA 1WKMA 5KK1A 1PDNC 1YIOA 4MHGA 1J2XA 3MZHA 1HQCA 4OIQF 1TW3A 3K2ZA 2PG4A 1R1TA 4ZH4F 1XGSA 2EJRA 4LMYA 5F1RA 3DV8A 4IRGA 5HDGA 3QPHA 4CICA 1QZYA 4KT5C 1R58A 1MDMB 3JW4A 2DK8A 2A07F 2YX7A 2GZWA 4Q47A 4HDUA 2ISZA 2AXLA 3IHUA 5JR3A 1B6AA 2Z99A 3J7AO 2W25A 3KETA 5JVTA 2O8XA 3KCCA 3WG9A 2DO7A 5IT3A 2HOEA 4KNYA 2PQ8A 2QLZA 4BYYA 4HAMA 3KP6A 3FMRA 1W7PA 2QWWA 2ELHA 4Y13A 1G6NA 2OZ6A 4ZYGA 4A5NA 2GA2A 2IA1A 4HYEA 2H09A 3KP5A 4U0VA 2MD5A 1QNTA 4M6YA 3ZPLA 1I6XA 1XDUA 4OMYA 4RGUA 5CJ9A 3SZPA 4U0YA 5F6FA 5HVQC 1EV7A 2P7VB 1XDSA 2C6YA 1D3YA 5FFZA 3F23A 2X0LA 4BXUA 3M7GA 3I64A 4H0EA 2EFPA 1J5YA 2FA5A 1IN4A 3W6JB 1KU2A 2JSCA 3CO7C 4AIHA 2FOKA 3WGIA 3N97A 4M9XA 3DP7A 5E8GA 2KJCA 2QQAA 2QQBA 3JAMK 2JRTA 3COAC 2FBHA 4U7DA 2EB7A 3MWMA 3V7SA 2E1NA 3FMQA 3WTUC 4ENNA 3ELKA 2ISYA 4CGZA 5LBQA 5H6QA 1BC7C 4U7BA 2WV0A 4CDGA 1TW2A 1F9NA 3RI4A 1ULYA 3HRUA 1UCRA 1C0WA 3HSFA 4MGRA 2PI0A 1G3YA 4HX4A 1O7FA 3GFMA 3ZMSA 1E17A 1YG2A 2DI3A 1RI7A 5JI6A 5JHUA 2VC0A 2PMHA 2VBXA 4KFCA 4B09A 2F5EA 4GYIA 2YR2A 3RKWA 2LF7A 1WI9A 3F8BA 2M30A 5DV5A 1HW2A 2Y48A 3DPTA 4GGGA 2FE3A 1BI1A 4PGGA 3SQNA 3K1MA 1Z6RA 3LA3A 3ZMDA 2FSWA 2VT3A 1QGPA 3O3KA 3QU3A 3ECHA 2HEOA 2DK5A 2P7CB 4RGXA 1R22A 2YU3A 3FMSA 5BMZA 1I1GA 2D2WA 3EQLF 1QO0D 1DPUA 2W24A 4MQ9F 3KE2A 2CO5A 1EH8A 4IJAA 4G8XA 1LQ1A 3E6DA 1T2KA 2P6SA 4HX7A 1SD5A 1JGSA 2EA2A 2VONA 1IZ1A 5E1XA 3TO7A 4I2OA 4U0WA 2IJLA 3LAJA 3GFLA 1BI3A 1REPC 1T38A 1S6LA 1O3TA 3GFJA 3RPQA 4XBFA 1G3SA 1LDDA 2XVCA 2O61A 4YIIA 2ADUA 4OU0A 1KU7A 1QPMA 1ZARA 5E17F 5J8FA 2Z9OA 1IN7A 3T5XA 2E7XA 1BJAA 5HS7A 4IPAA 1ZRFA 2VBZA 3K1PA 3GZ5A 3ZN0A 1HKQA 4R79A 1U6GA 2P8TA 1UHWA 4EQQA 2IVMA 2VXZA 2STTA 1LNWA 3L7WA 5KVRA 4I98B 1G4DA 3KLNA 5HDNA 5E1WA 2GXBA 3EDPA 1U2WA 3F8CA 2MC3A 5F64A 4LLLA 3HOSA 1XSXA 2DFIA 5CVJA 1B4AA 1GHCA 1LDJA 3RYRA 3CO6C 2XAGA 1G3WA 4I09A 2RKHA 3BPVA 1TQIA 4LG0A 1SD7A 3U2RA 5K5OA 1BI0A 3GVAA 3HOTA 2ZXJA 5LEKA 1U8RA 1TTYA 3RTRA 1UHMA 2M45A 5DYMA 2CG4A 1GXPA 4EJTA 1E2XA 4UUVA 5HS9A 3EUHA 3N4MA 3P7NA 3MZYA 2EFWA 1XGNA 3MCZA 2QQ9A 4AIJA 3V8KA 4HF0A 4WXDA 3QU6A 2P5LC 3EYIA 2EA4A 1DP7P 5AIPA 1XCBA 2CYYA 3E6BA 2Y0MA 1XD7A 2O6GE 2M5WA 3DF8A 2GQQA 4G6QA 5DEQA 4NQWA 3TQNA 3NEUA 3FF5A 5HDKA 3WTSC 1T0FA 2YSRA 4CO8A 1SFEA 4HDVA 2RQPA 4A0YA 3WE2A 4HW0A 2GIVA 4D0PA 3J81Z 4L0ZB 4RB0A 4CHUA 5DUKA 3HYIA 2P5KA 4ENMA 2P4WA 1KU9A 2A5YB 5D4SA 1LJ9A 3M9AA 3FXQA 3GW2A 1WWXA 3B02A 2EFQA 1FP1D 2V1UA 1IN5A 3K1NA 1OMIA 3I4PA 4EJWA 4A0ZA 2HKOA 2VOPA 2KIMA 3I59A 3T0YA 3E6CC 2ESHA 1DDNA 4UVBA 1JHFA 2O3FA 5FO5A 5DD8A 2EFNA 3ZMTA 1PUEE 4N9HA 3T8RA 4TV7A 3MEXA 3D0SA 2LNBA 3DXJF 3R61A 4IRHA 1MZBA 3GZ6A 1HW5A 4UHTA 4WXHA 1ZLJA 1ZN2A 3BJAA 4WF2A 1CF7A 2GWRA 1YS6A 3REOA 1MKMA 3QRFF 2H6CA 3SZTA 3LWFA 4ETSA 4YFKF 2BGCA 5D5WB 4ESJA 3P9IA 4HF1A 4QLCU 3HSRA 3WU0A 1HKTA 3WTWC 4HQEA 3FZVA 4LJZF 3EETA 2VT2A 4A6DA 1U5TA 4IVNA 1MJBA 1S7AA 1STZA 3FXRA 2IP2A 3P9CA 2H94A 5D5VB 1FBQA 3IRRA 2QBYA 2FEZA 4EJOA 2XAQA 1OPCA 1WSUA 4XLPF 1USTA 4YFXF 4R8HA 1KQ9A 1J9IA 1V4RA 4M6XA 3R0AA 1Z9CA 4UXNA 5BS6A 4RB2C 1HW1A 2JPCA 3E6MA 5ED4A 3CUOA 3K0LA 2V1DA 2P6TA 3I58A 2NNYA 3FWEA 3ABTA 3VEPA 2CSOA 1ZGAA 2ZNYA 3JTGA 1SD4A 4S04A 4OMZA 1UB9A 2EV0A 4BNCA 2L01A 4EVIA 3ZMUA 1O3SA 2GAUA 3VOEA 5DD4A 1U5TB 3V8JA 2DPUA 4WCGA 1MGTA 1I5ZA 4Z2YA 5D6EA 5FGMA 2G9WA 4KN4X 1XB4A 2MA3A 1YTYA 2QBYB 1YLFA 3KLOA 4KUMA 1EH7A 3J80K 2W57A 1Z05A 5CVRA 1OKRA 2HFHA 4HLYA 1FYMA 5LRSA 1R1UA 1FSHA
chains in the Genus database with same CATH superfamily
3WODF 2V6EA 3BZ6A 3O8HA 1SMYF 2R92J 4RDUA 2R7TA 3F3XA 1WJ5A 1T39A 3KP4A 3VB2A 4B47A 1I6HJ 1YITI 1BIAA 2F5DA 1V5GA 1V54H 1FMVA 1K7AA 1FIAA 2XKPA 2PMZA 2XSJC 2ZSIB 4RGRA 2YS9A 2KIFA 4RGSA 3ONQA 1L3LA 1R36A 3DWLE 2OQGA 2ZB9A 4NC7A 4J00A 2CRGA 3H3UA 2H1KA 4DNCA 1OR7A 1MBHA 4OAYA 3AAFA 3FKJA 3KIOA 3GTPJ 2ZXHA 4MLOA 1VQ5I 1BOAA 1JHHA 4LFUA 2OTLI 3BG7A 5L3DA 3C18A 4MNUA 5LGNA 4F55A 5FD5A 4ENKA 2YU9J 4UB8C 4CSWA 3WU2C 4FASD 2R5YA 3G1MA 3NARA 1ETKA 2Y2ZA 1WZ2A 3ABLH 3H3ZA 3CMAI 2XRNA 1KQ8A 3I4MJ 3TDZC 2E2IJ 1J0RA 2R7RA 4M3GA 3FM3A 3CLOA 1ZKGA 2XIGA 5ILUA 3NRVA 2IS1A 2R3SA 3ZMZA 4HZFA 4LD5A 1LVKA 2E71A 2K02A 1K4TA 2EFOA 1W7PB 3F8MA 1K83J 3QPTA 4E70A 3H36A 2VBWA 2ZKZA 1IDZA 3GXOA 2B0LA 4A12A 2E2HJ 1R6RA 3AFHA 5TRDA 2BW3A 2QYOA 3FXJA 2LKSA 4NB5A 4BQAA 1BBYA 3IAS2 1X1DA 2H1LA 2XUBA 1IRZA 3J81K 2K4BA 2LD5A 2IGKA 5D4RA 1HSJA 2LY1A 2UXNA 5L3FA 3TEDA 2OQRA 3VYUB 2CW0F 3OIPA 1P2FA 2NS7A 3F6OA 1U0JA 3G1LA 2YX4A 3DLAA 2OZUA 2NS0A 5FKLA 1YIJI 5K5RA 3PFYA 4AIKA 4IXAA 1B8IB 1B72B 5C4XJ 1D0XA 3BC8A 4ESBA 4UVCA 2DQLA 1KU3A 3ML6A 4CA0A 4OOIA 3ZR8X 4ENJA 5LRRA 5FKOA 1XS9A 2PJPA 3HPGA 3ZQQA 3OYAA 5LLQA 3LSIA 4CZCA 3UKGA 2GXGA 5FRMA 4AUXA 5J1YA 4FX4A 2JWTA 1BN5A 4G6DA 2GOMA 4PFOA 4ZZDA 4IHXA 3MVPA 5ILSA 4C3HJ 4QTRA 2NRAC 1WH7A 4PDKA 4AC0A 1FIPA 3CP8A 1Z7UA 1ERDA 2VKHA 3RKYA 2XHKA 5H6RA 4A2UA 2A3SA 3S2DJ 2PMUA 1VQ7I 2E35A 1U5TC 2LMDA 4RAYA 5DM7F 3PO3J 5A2QZ 1LEAA 2JUCA 3BR1A 3L2UA 4B44A 5B1AH 1G59A 2IRFG 3I0TA 4EM1A 4UVAA 5EYRA 4Q48A 2Z16A 3RJPA 5CQEA 1R9TJ 2MH2A 4QPOA 1ZREA 4YG2F 3HUGA 4PCQA 3DEEA 4KN7X 3G4SI 3G71I 3CUQA 2BYVE 4XSXF 4M72A 3HGGA 3BCBA 4KIBA 3P9KA 2DU9A 5J6XA 4IQ4A 1Z77A 2Y9ZA 3LFKA 4IHWA 2E1OA 2HTJA 3BR0A 3D5LA 2BBYA 2JUGA 2VPRA 3I5UA 3KEYA 3LQRA 1YOVB 3HHHA 4OINF 3BZCA 4XLEA 5KAFC 3WTYC 1USSA 1G8XA 2DA2A 2G7UA 3QAHA 3SHFA 3NQOA 1VFCA 1P6RA 1U3EM 5ICEA 5LEJA 1ZQ3P 3F8NA 2HVQA 3O8GA 4XK4A 1QHHD 1A36A 3HOZJ 3GF2A 1WJCA 3LSJA 1TWGJ 2CGPA 1KA8A 2NVXJ 2BE5F 1PUFB 2DDBA 3GCMA 2A6EF 2ZSHB 1S7EA 1YE9A 2BZTA 3HJEA 2HQ5A 2RREA 2G0EA 1LFUP 3CF5F 4HQMA 2DW4A 4E7SA 5M5YJ 2JT1A 2DBBA 2J5PA 3GEZA 2K27A 3F6VA 2R5ZB 4WK8F 2HDWA 4BKXA 2VJ5A 1P92A 1XGOA 3ZXSA 2VE8A 1LUJB 3BY6A 3FBNB 3GO5A 3GX4X 2IS6A 2CWEA 2A6HF 5ERIA 5L3GA 1YHQI 3A0BC 2ELJA 1MNEA 3ZP5A 4IZZA 3BPXA 3ERMA 2FMYA 3OS2A 4BDZA 1CGPA 3G3ZA 2E36A 2OV7A 1IGNA 4A3MJ 4QWQA 4LB6B 2HGCA 3FM5A 4YIFA 2CFXA 4QIWN 2EZIA 2K9SA 1TBXA 4NHJA 5FFXA 1BL0A 3GTMJ 2IPQX 2MYSA 1WVRA 1V5FA 1MMSA 1ON1A 5DCFA 1JUPA 3MN2A 2IS2A 2ZMEA 3HOXJ 1OYWA 1H9TA 3HC7A 1GUUA 2V9VA 4XLHA 3K4CA 4G94A 3S1RJ 3Q9SA 4KJZA 4L9NA 4I7HA 4U88A 1XCVA 3PQKA 4MIMA 4JQFA 5ICFA 3M3YJ 2JTVA 1IW7F 3HOVJ 5D8LB 3OYJA 2HDCA 2WTEA 3IUOA 2RN7A 3PQJA 2QVOA 3H35A 1MJ9A 4F91B 3S1MJ 2O5RA 1E3PA 4XSZF 2OU2A 4JX5A 3D5RC 2WADA 2STWA 2KRFA 1ZRDA 3H9JA 3ESWB 2VLAA 5DS9A 4KA4A 1F43A 1JT6A 2R7FA 4N4OB 5IYBJ 1SC7A 1X3WB 3IKVA 1K61A 1AWCA 5LGTA 1UFMA 4B3XA 2FXAA 3KP2A 3FXLA 2RDPA 1K6OA 4XOTA 4MEYF 2IA2A 2DFHA 1X4PA 5F0HA 4XKWA 3QP5A 4A93J 2ZFWA 1P4XA 4XN3A 1UELB 2F4OB 2W84A 4X0GA 1L0OC 3Q5FA 1RZ4A 4L9VA 1HBXG 3J80Z 3H3VK 2VBYA 3C3WA 5EZHA 5GTIC 2K7LA 1QZEA 1HKSA 4AWXB 3WTTC 1MH4A 1YJ9I 2Y0SA 4IOCF 2VOOA 2D1HA 1WH5A 4Y3OA 4KDPA 1IXCA 1PP8F 1ZK8A 3MQ0A 1O4XA 4D5CA 1BA5A 5D5XB 1FP2A 1YI2I 2WY8Q 5AONA 3BROA 5D5UB 4E7ZA 1XTAA 4QSHA 5K5QA 3KZIC 2M7AA 4IOAF 4NBQA 2OAZA 3OS1A 3GLLA 3JRCA 1RIOH 2B9SA 1NK3P 4C2TA 3A03A 1LFBA 1OCZH 2Z3YA 1ACIA 5FRNA 5LHHA 4BHPA 1G2HA 5J47A 3S93A 2RVCA 3K4BA 3TO9A 3BWGA 4BH9A 4BGDA 1OCPA 1ZRCA 4ESFA 4HNVA 2BV6A 2NAZA 5IP6A 1P9QC 2VJIA 1YFHA 1MMGA 1FMWA 2DA6A 3L00A 1KQ0A 3NWTA 5CLSA 2VODA 5HLIA 1O7LA 3HKZA 2IA0A 4Y15A 2XF7A 3BTCA 2K9NA 1IUFA 5E3LA 4IQJA 4IEJA 5GADJ 1O57A 3M8EA 4ZYHA 4P55A 2NXNB 2QKLB 2IW5A 3TBIA 3V7RA 4JX4A 4DZPA 4DZJA 4CZZA 3PUBA 3HXLA 3O2PE 4EMSA 3IKTA 2ZCWA 1EF4A 2KKOA 4RAZA 2XASA 1YW9A 4OIRF 2EWNA 2PFBA 4BXFA 5FB2A 5E3NA 3H9QA 2L5QA 1S29A 4GXOA 3KP3A 1OYYA 3ZMVA 5CYVA 3VYRB 4L5JA 4A3FJ 2X6OA 2KRHA 3J7YJ 3A0HC 4MTEA 1T33A 4JX6A 3L2CA 3BP8A 3I9V2 3FKIJ 4XR6A 1Z3XA 3ZQCA 2PN6A 1I27A 1N25A 1S9HA 1R4NB 4LG0B 2OCEA 4A3GJ 5ICGA 5HLHA 2PX9A 1W5TA 5LGUA 1B1BA 2X6WA 3QPSA 4C2MJ 4RBOA 3GTLJ 1GV2A 1T95A 1QBJA 3HOYJ 3I4NJ 3E5XA 4IHSA 4EV0A 4JK1X 1GVJA 1W1WE 2HR3A 2L9SA 4IX7A 4DGWB 1J7KA 4ON0A 3IWZA 3BG6A 3O6BB 4NDLA 4A3JJ 4HNTA 3JR9A 1TQPA 3F72A 2EPFA 1UAAA 5BQTA 1RR7A 1ETXA 3ASNH 3M1CA 3PUFA 4UV8A 5ILVA 4M3EA 1A31A 3OIOA 1K78A 1BR1A 1JTYA 4CYDA 3HOWJ 2FRHA 1W0UA 4O5VA 5EGOB 1SFKA 2OA4A 5A2QK 5JVGF 2CQ7A 1DQUA 2IGMA 2MBFA 3DKYA 3OV8A 1E3OC 3WTZA 3K4KA 2Y30A 5EEGA 3VFZA 1SAXA 3V4GA 2K40A 4XOPA 2BY0A 2KFDA 1ORKA 3TW6A 1X3UA 4YFNF 5FJ8J 1A5JA 4CXFA 1VNDA 2KRCA 4NQWB 4P9FA 4EGYA 3K10A 4KITB 4FHTA 3CCJI 3U1DA 4I0BA 2EH3A 4XNFA 1W36D 2VL8A 5E1ZB 2M0MA 3IP4B 4PZJA 1MJAA 2CQQA 1FT9A 3V8LA 3ABMH 5K1YA 2QENA 2M0CA 1ZG3A 2M3AA 2KDOA 4M73A 1J75A 2UXXA 5FKKA 1VQ9I 4LIUA 2PEXA 2MGQA 4ANJA 1R49A 2M87A 3FXMA 3A01B 4PJLA 1X1BA 1Z1DA 3BDDA 2MD0A 1EKEA 1BW5A 4LITA 3LSMA 4Q5SF 3JRAA 3T8TA 4II2A 1ODDA 1JGGA 3K9TA 3FX3A 4XQFA 4OIOF 4Q4ZF 1ITYA 2KIQA 2JN6A 4GRIA 2NYXA 4XLNF 3CCEI 1QQIA 4BL0B 2XB5A 4FETA 1XPXA 2DJNA 5BOXA 4BJ5C 9ANTA 1F4KA 2QKMB 2ZBKA 3MAJA 1ZLKA 1VQ8I 4S05A 3ZN1A 2KIUA 2L3DA 5E8IA 3IV5A 1HLVA 4LK1F 2RNGA 2EIKH 2ZFUA 3OR1C 1FPQA 2G7HA 3HM5A 1QRYA 1BJZA 1LB2A 1K78B 4DQ2A 1KYWA 4GYGA 3CF2A 4P9UA 2HQRA 3E3VA 4KIFA 3LSGA 3I59B 2HYGD 3TO6A 4G12A 2FQ4A 2X1CA 2QF7A 2WB1N 4FX0A 2V4JC 3DBHB 1W0TA 2J5OA 2EQRA 2MW8A 3E7LA 3JSOA 5FKNA 5IY5H 4B1RA 1MD0A 1XG1A 3SEZA 1SD6A 4M3BA 1R1VA 2DOEA 2E19A 3GTGJ 4A3LJ 2L54A 1MW7A 3JTHA 1SFXA 1H8AC 1D8JA 1IAWA 1JTXA 1B59A 4EJUA 3DPUA 2ECCA 3SXYA 1OQYA 1ZAOA 1H9GA 2WC2A 1J09A 5CVVA 5D6FA 2W85A 2WV1A 2LBFB 1XSDA 4BBSJ 5F0CA 2GA1A 3M1EA 2K86A 3CCMI 4V2GA 2DOFA 3ASOH 2K4JA 1CF7B 5M5XJ 4CCMA 2V9PA 2IEKA 2EZHA 2ZNZA 5IP7J 1JT0A 2ZXWH 4HSRA 3ROUA 3WGHA 2CUZA 2P0WA 1LEBA 2WAQA 1OLTA 3H0GJ 2M7BA 3KFWX 2FBIA 1U78A 1DU6A 1F1ZA 2RC4A 1ZYRF 4EGZA 3OYIA 2KLOA 2W48A 2HYFA 3A2KA 4M9ZA 3ZQIA 4RLQA 3EUHC 2L02A 2LVSA 3D1NI 2VE9A 3KEOA 3IWFA 4UNOA 3OOPA 3MKWB 2KISA 2HWVA 3RIRA 1ZG5A 3LSRA 2QSFX 1MIJA 3SYTA 3C2GA 1NTCA 5HS8A 1IF1A 3EUKL 3LA7A 4XORA 1MBFA 1SVMA 3QP6A 2CQNA 3RYPA 4BY1J 1DU0A 2D45A 4XL9A 1XMAA 2XAFA 1MMDA 3ZCOA 1R23A 1I3AA 1FWZA 4PK4A 3HRSA 5FLXZ 2ME0A 4L18B 2L4MA 3NAUA 2COMA 2ECBA 1FC3A 3BJ6A 1X19A 1BI2A 3OYEA 1EA3A 3F8FA 4M71A 3HSEA 1IO2A 1AKHA 4LGWA 2F2EA 3GWZA 3RPUD 3DPLC 4ZDLA 4XRSA 1SFUA 5DM6F 2DMTA 2JA5J 1ONVA 3K4NA 1QA6A 3I71A 1TNTA 2XROA 4PGHA 1YQAA 1XX5A 1G3TA 2X6XA 3OSFA 3QOPA 4IHYA 1TLHB 1T0FC 2AQEA 3HRMA 2PBIA 1XGMA 4G7ZF 4I0AA 1OYIA 4GCVA 1Z3YA 3SFZA 4N4NB 4HOBA 3R6SA 4ITVA 1UJ8A 2HZTA 2QEXI 2HVRA 3ERED 1T98A 3GBGA 3K69A 3RKQA 4OIPF 4PJNA 4ZC3A 4IHTA 3BJOA 3S3MA 1LE8B 4OWRB 1VZ0A 1R5GA 2QUFA 3IC7A 4DW6A 1BR2A 5LHIA 2F5FA 2TDXA 3TL4X 3JRFA 4HA8A 4E4HA 1GXQA 3B6CA 4LB5A 3S3NA 2OPTA 2ZJRF 2XKOA 1TNSA 4XKCA 3LAPA 3JRGA 5E20A 4ZDOA 5BPIA 4IRIA 2FQ3A 2DODA 3AG2H 3WGGA 3MKYB 1IRGA 3PL8A 2IGNA 2HTSA 2LDUA 2DLLA 2UWMA 1WJFA 3KEQA 1T8IA 4E7JA 2FU4A 4P96A 1RPWA 3HIFA 4C30A 1OFCX 1TT5B 3GYHX 2HNHA 2ESNA 2HXOA 3TKYA 2F4MB 3HHGA 4R1HA 3TOBA 3RZDJ 3V7CA 2XGXA 1WJAA 1ETWA 2CUJA 1P4AA 2OF7A 4RA2A 1BM9A 2LY9A 2OUMA 3Q0WA 4E7LA 1CQTA 3F21A 3HPHA 1S3JA 2XB0X 3PIPF 4LOCA 2Q8KA 1J59A 4GDFA 2QM3A 4A5MA 2HOAA 4M9SA 4RLFA 1I3QJ 1BR4A 3FIWA 2E34A 2AS5F 4CCNA 2E60A 1MBKA 2UZKA 4JOMA 2EV5A 3SDBA 4P5OA 4LK0F 3MFKA 5IT9K 2JRMA 2EV6A 2VXDA 4XM3A 3CMYA 5CKTA 1NG7A 2JA2A 1FSEA 1S8NA 2KZGA 2XAHA 1TQMA 1FBUA 2Y69H 4BAYA 4AYBA 4O3MA 3ECOA 4ZDPA 2DXIA 1YJWI 2BVLA 3L2RA 2PLYA 1VI0A 2R5YB 2XGCA 1W7PD 5GAHJ 1RNLA 3JSPA 5F0FA 4EM2A 3SEQA 4BQNA 1IUYA 1WPKA 2ZJQF 1FBSA 1HCRA 2L7MP 1JXSA 2DA3A 5GTHC 2V79A 4G7OF 1YJNI 2VPLA 3PJRA 5J8CA 4C3IJ 2FD5A 2E1MB 2VIXA 1R5HA 4DYRA 1FLIA 1AOYA 2QQ8A 3R60A 5HOOA 2Y75A 1Z7LA 3G73A 2FUG2 2VKDA 2H8WA 1FX7A 3KZZA 2FF4A 1S5LC 2XAUA 4XN0A 1P4WA 1DUXC 2W4SA 1Z91A 1R7JA 4BHBA 3S16J 3BTIA 2BW3B 4WWCA 3VPRA 1I1SA 3R4KA 4EJVA 4HRIA 4A0XA 4HBLA 2AQFA 2L9RA 1D8KA 5TGTA 1H0MA 1R00A 1XN7A 3KYDB 4B43A 3CTAA 3FXUA 2PJRA 1TWFJ 3DTKA 3JRDA 2MFZA 4N9IA 3S1NJ 3OL4A 3CQZJ 3BR6A 5IP9J 1BC8C 3RZOJ 4M74A 1IN6A 2VKEA 2MABA 2BHZA 2A69F 2WAFA 1KZHA 3OYKA 2MH9A 3CJNA 1FNNA 1GDTA 4X6AJ 3ZQ7A 3BQZA 5CVIA 2CUFA 4UUSA 2LYCA 3ULQB 5EG0A 3Q9VA 3HL2A 3PSFA 2KJBA 4I99C 2K85A 2LKXA 2H6BA 2CS3A 2WA0A 4KMUX 4XONA 4A69C 1M1EB 4LLNA 4J01A 1TWHJ 3CC4I 2DAOA 5C44J 2WWYA 3HTSB 2M8EA 1ZHFA 1Z21A 3C1DA 2HPIA 3E5QA 4DJAA 1IV8A 5LFAA 2BEOA 4H4KC 2K5CA 3H92A 2O03A 5DCMA 1K79A 2KL4A 2O9LA 1YS7A 1ON2A 3C2BA 2ACJA 2OBPA 1WRJA 2IGOA 1GLNA 1VQOI 4MQVA 3GTJJ 1W5SA 3E5UA 2A61A 2DA5A 3GUDA 2L4AA 3A4CA 3CLQA 4BQOA 1IRFA 5IYCJ 2VKVA 5J3LA 3T1BA 4E7IA 4G9YA 4WX9A 4BDYA 5F1JA 3HUGB 2Q0OA 2Q1ZB 3QYFA 3UNGC 3EYYA 1ZG1A 2OCCH 1IC8A 1XMKA 2VI6A 3CUQB 1YO5C 5CPRB 3WHCA 3LFUA 3CJTB 2Y31A 5CVUA 2R7VA 5D8KB 3PSIA 2X4HA 3WTVC 1NHAA 3CJQB 1NG6A 2YPRA 3K2AA 4HV5A 2LR8A 3OYMA 2FOWA 2L7FP 2NVTJ 2F6CA 2NNNA 1VTNC 3OY9A 2OJED 3OOUA 3F22A 2Z1DA 1B9NA 3JRIA 2JZYA 1POGA 3TGNA 3LSHA 2AXTC 4HNUA 4II3A 5E18F 3DFGA 1W4MA 1V5EA 2LSOA 2M1BA 4AU7A 4UV9A 2CUEA 4MTDA 3L2WA 2QCOA 1QU3A 3IL2A 5E3MA 5B3SH 1OR7C 3GTOJ 2Y9YA 3GFIA 4B8XA 3QYEA 3PFIA 3OYLA 3OYCA 4ZYAA 1XC5A 2DDAA 3F9KA 2DYRH 2DYSH 4C3JJ 5H20A 1D5VA 5AIQA 2E1CA 1GT0C 5FROA 5DCMB 2QZ8A 1QZZA 3Q0VA 2LK2A 5L3CA 4WXCA 4HX8A 3CCSI 1V3FA 3OL3A 1IN8A 1KONA 2M34A 1OCTC 2FNPA 5FLXK 4IF4A 5C4JJ 5JFRA 4A3IJ 1HXDA 4LLGF 3TMOA 1QPIA 3MMYB 2EK5A 3FDYA 5L3BA 1WI3A 3VODA 4HLXA 3ZQHA 1HOMA 2B7EA 3TDUC 4ZYEA 2E1MC 4O6JA 2LG4A 1TT0A 2CQXA 1Q1HA 2GLOA 3OWTA 1DPRA 1Z6TA 5DUIA 4YIRX 2VC1A 5JLWA 3TOAA 3GTQJ 3U9GA 3PM1A 1MNMC 1KYZA 4GO1A 5TISC 4XLCA 3JRHA 2XAJA 1R5ID 2FBKA 1KGSA 2DMNA 1WCMJ 2DT5A 2ZMEB 5DDGA 2O7OA 4CYCA 1S7OA 2LKPA 2W82A 2FMLA 3OSGA 5EZGA 3S17J 2OTJI 1PVEA 5HLGA 2H27A 3CDHA 1FY7A 1H89C 1A6IA 1RKTA 1RUOA 4RMNA 3OYNA 4CCOA 3VYSB 4Y52J 3E97A 3GLXA 3LQQA 1BIBA 4G7HF 4LIVA 4A6EA 1AU7A 3OR2C 1VQ6I 1UG2A 3DKWA 1QHGA 2RGVA 3R0JA 2VQGA 4JBAA 4XRSG 4BHCA 1R71A 3RQIA 4AD9A 5ICCA 1PP7U 5IOZA 2ETHA 3S2WA 1RUNA 2VN2A 1U9OA 5K7FA 2X9DA 3IH3A 4B3AA 2R7SA 1O3QA 3AG3H 1YX3A 2I8DA 4KICA 1LDKB 1X2MA 3L9FA 3RQ4A 1FOYA 4CUGA 2R0QC 1Y0UA 4F3QA 1WJBA 2ZO4A 2V26A 3M8FA 1Y56A 2BVMA 2PMZN 4YRVA 2KP6A 2ICWG 5K7HA 1EH6A 3JREA 1IXSB 1YRNA 3WTXC 4HV6A 1OCRH 3EUAA 4I01A 1I39A 4UY8I 3CESA 2OD5A 4HF2A 3JAMZ 2D1VA 4HPQA 4KIGA 3S32A 2MLGA 3IRQA 3BG9A 2VASA 3BTJA 4FE7A 3RDIA 1O3RA 3WU1B 1D0YA 3C2HA 2MC4A 3FXOA 4L9TA 4LG3A 4ZZLA 1SMTA 4L0YB 1I50J 2Z5UA 3CUQC 3C7JA 4L9JA 4XIDA 4KMFA 2JPBA 2JA8J 2DPDA 1HSTA 3ISPA 5E79C 1X58A 2JJ7A 2AHQA 2LRDA 2DMPA 6PAXA 2X6YA 4ABZA 1ZTRA 2IBDA 4I76A 4EM0B 4ZYDA 3X2QH 3DKXA 1JE8A 2RV8A 2LP0A 4BBRJ 2JA7J 4I02A 5IT9Z 2JA6J 2FNAA 3BG5A 4MEXF 2P5VA 4PJ0C 4BUPA 4NUBA 5GAGJ 2V1XA 4CH7A 2K9QA 3CP2A 3HRTA 4MFEA 5KNLA 2CQKA 2RNJA 3L09A 3OYDA 3KP7A 4S0HB 2KPMA 4RB1A 3DEUA 3RKXA 3H0DA 3LNQA 1UHSA 2QGUA 3I3LA 3W6KB 4XKBA 1BW6A 2BY2A 2DTRA 2NOGA 5IOYA 4ZTJA 3DCFA 2QSHX 3FHNA 3ABUA 4XRFA 1YW7A 3LA2A 5DTDA 3VWBA 5BPDA 2XPVA 3JCUC 5FD6A 1MSEC 3LSTA 1WFXA 4BACA 1FYKA 4N0BA 5KAIC 1TWAJ 4ASNA 3HTUA 3EPZA 1ZGJA 2LLKA 4F7ZA 1IXRC 1YRNB 4W1UA 1B9MA 2A68F 2Q2EA 4K2EA 4FT8A 1LVAA 2R7DA 3WHBA 1X1PA 2HKXA 3KX2A 5TJJA 4RS8A 2HQNA 2HS5A 4Y17A 1YYVA 2EILH 3CDLA 2Z33A 2NVUB 1F5TA 2JVGA 2LF8A 3A02A 1OCOH 2E7WA 5L3EA 1FYLA 4C2UA 2XV4S 1XSVA 2O0YA 1JKOC 3ZRGA 1FOKA 3I53A 5LHGA 1MBJA 2KQRA 3L1PA 3I54A 1FZPB 2K9LA 3K4LA 1HF0A 3WE3A 3CCQI 2QSGX 3KZYA 5EEHA 1ZH5A 2CW8A 3B73A 1RRJA 4D7MA 1A04A 1T6SA 2ZMEC 3Q3SA 1TL8A 1MDMA 2CU7A 2JSPA 4AVPA 3BOQA 1YW8A 3HEFA 2F5CA 3DBRB 4L5IA 4KYWA 3RPUA 5EJCA 2ZJ2A 3OYBA 1NK2P 1X4OA 3MZ8A 2DQRA 2V6CA 1WQ2A 3DQVC 2BY3A 2UV1A 3BG3A 4RB3C 3CCLI 3FHZA 3Q0UA 3VSKA 2IT0A 2HU9A 1RR8C 3CD6I 2MLKA 5KCMA 1WKMA 5KK1A 2V7FA 3AG1H 1MBEA 1PDNC 2KMUA 3H5NA 1U9NA 1YIOA 2LY2A 4IO9F 4BXXJ 4XKVA 4MHGA 1J2XA 2UUZA 4X1EA 2MSYA 4PJJA 2HXIA 4D9JA 3MZHA 1HQCA 4OIQF 1TW3A 2RAEA 2Q2EB 3K2ZA 1ENHA 3CJRB 4RAGA 2PG4A 2CV1A 1R1TA 4ZH4F 3MKLA 1XGSA 3CCUI 2EJRA 2L9VA 4LMYA 5F1RA 3ZQLA 4ZTFA 3W6VA 3V42A 3DV8A 1TZLA 4IRGA 5HDGA 3QPHA 1VQKI 4CICA 1FEXA 2TRTA 3P5JA 1FOXA 1QZYA 1N77A 2X85A 4KT5C 3S8PA 2F48A 1IJWC 2VUMJ 3RSNA 1R58A 1MDMB 1UMQA 1XMXA 1RKWA 3GMEA 1T08B 2IS4A 2XRLA 2JQ7A 3JW4A 2DK8A 2A07F 2HDDA 2ELKA 2XDVA 3LSKA 2YX7A 2GZWA 4Q47A 4HDUA 1ZR2A 2WAEA 4A3EJ 2ISZA 3JRBA 2AXLA 4PJMA 2JMWA 3IHUA 3ZGKA 5JR3A 1B6AA 5J1RA 2Z99A 3CMMA 1N78A 3J7AO 1HDDC 1JJ8C 3CDIA 2W25A 3K6GA 3KETA 2DN0A 3BTLA 5JVTA 3G2BA 2O8XA 3DLLF 3KCCA 3WG9A 2F5VA 4PUSA 2DO7A 5IT3A 2HOEA 3PIOF 3S14J 4KNYA 2PQ8A 2QLZA 3HGYA 3IH4A 4BYYA 4HAMA 3KP6A 3FMRA 5JHFA 3M8JA 1W7PA 2QWWA 1SEUA 2ELHA 4Y13A 1G6NA 2CV2A 3QOEA 2R7OA 2OZ6A 4NC6A 4ZYGA 4A5NA 3AKZA 5IPAA 4V19K 5LD2C 1Y8RB 2GA2A 1X2NA 2IA1A 2B63J 4DYCA 1Z67A 4HYEA 2H09A 4M6VA 1AHDP 4P1WA 3KP5A 2W00A 2X51A 2MD5A 3A1YA 4HG2A 3BT9A 4U0VA 1JKRC 1QNTA 3L2QA 2H8RA 4M6YA 1EJ9A 3ZPLA 1I6XA 3BCAA 2HOTA 4A3DJ 1D1CA 2DA1A 1XDUA 5M5WJ 1A35A 3OYHA 4OMYA 4RGUA 4DYQA 5B66C 5CJ9A 3OS0A 3SZPA 4U0YA 5F6FA 5HVQC 1EV7A 3PNVA 1B8IA 2P7VB 1B72A 2V1NA 1XDSA 2C6YA 2HI3A 1D3YA 4OAZA 3S15J 5FFZA 3BR5A 1OCCH 2X0LA 3WG7H 3F23A 3GTKJ 2L7ZA 4BXUA 3M7GA 3I64A 2VB6A 4H0EA 2Y0SN 1UG0A 2EFPA 1J5YA 2ZXIA 2FA5A 1IN4A 2F4IA 2CJJA 3W6JB 1DP3A 1KU2A 2JSCA 2FX0A 3CO7C 4AIHA 2FOKA 3WGIA 3N97A 4U87A 1SFOJ 4M9XA 3VSLA 4W97A 3DP7A 5E8GA 2FJ1A 2KJCA 2QQAA 3IAM2 2QQBA 3JAMK 4CCLA 2JRTA 1WGXA 1E3HA 5J4YA 3COAC 2LH9A 2X1DA 4KT6A 1GVDA 1AKHB 4MFDA 4UB6C 2FBHA 3FBIB 4U7DA 2EB7A 1RESA 2XGEA 1TWCJ 3MWMA 4D1QA 1IDYA 2L0KA 3QQAA 3V7SA 2E1NA 3FMQA 3WTUC 3FK6A 5J1UA 3DTEA 3MKZA 4ENNA 2ID6A 3ELKA 4Y4RA 2VQHA 2NVYJ 3K7AJ 3CC7I 1SANA 2ISYA 1PYVA 4CGZA 5LBQA 1X1CA 2IAIA 5H6QA 1DGWY 3HKZN 4DOZA 1BC7C 4U7BA 4E7HA 2WV0A 4CDGA 3J7AY 2QA4I 3K4MA 2WBMA 5EDNA 1TW2A 1F9NA 1N75A 2M4KA 3RI4A 1X1AA 1ULYA 2KHMA 3HRUA 2HYJA 3AL0B 4RM3A 1UCRA 1ETYA 1SAUA 1C0WA 2XPWA 3HSFA 1WJDA 1PUFA 4MGRA 2PI0A 4I6ZA 4BE1A 4M3FA 4A3KJ 1G3YA 3ZQGA 3FK7A 5EF6A 1JUMA 2I10A 4HX4A 3CMEI 1O7FA 3GFMA 2XSDC 3ZMSA 1E17A 2R5ZA 4DBQA 1YG2A 1RI7A 2DI3A 4L5EA 5JI6A 5JHUA 2VC0A 3OMYA 2PMHA 2DFFA 3DU6A 2VBXA 2JK3A 2BY1A 4KFCA 2NS8A 4B09A 1VQ4I 2E5ZA 5C3EJ 2F5EA 1RC9A 4GYIA 4BJTA 1VF9A 4F93B 1HC8A 2YR2A 3IH2A 3RKWA 2LF7A 2JVHA 1WI9A 3F8BA 2M30A 5DV5A 1HW2A 2NVQJ 1QVTA 3BR3A 2Y48A 3DPTA 4GGGA 1Q1VA 3KYLA 4XLAA 1MMAA 3U1KA 5B1BH 2FE3A 2R7UA 1BI1A 4PGGA 1X3ZB 2WB1A 3SQNA 2KDZA 3J7ZI 3K1MA 1D0ZA 2EIMH 3M07A 3CCVI 1Z6RA 3LA3A 3D5SC 2MG4A 3BQYA 3ZMDA 2FSWA 2VT3A 1IG7A 1QGPA 3O3KA 3QU3A 3ECHA 3QYBA 5KHDA 2BHYA 2HEOA 2GM4A 2DK5A 2P7CB 4RGXA 2HOSA 4IL6C 1R22A 2YU3A 3HB9A 3FMSA 5BMZA 5E3OA 2XC7A 1I1GA 2CW7A 2D2WA 1JJ6C 3EQLF 1QO0D 2DJIA 1K4SA 1DPUA 2W24A 2DCEA 4MQ9F 1FTTA 3KE2A 2CO5A 4DBRA 1EH8A 4IJAA 4G8XA 1LQ1A 1MH3A 3E6DA 1T2KA 2P6SA 4B48A 1JUSA 4BY7J 4HX7A 4IHVA 2VJ4A 1SD5A 1JGSA 1JI8A 2EA2A 5JLXA 2VONA 1IZ1A 5E1XA 3TO7A 4I2OA 5H2FC 4U0WA 2IJLA 3LAJA 3GFLA 1BI3A 3W2WA 2M4GA 2VQCA 1T38A 1REPC 1S6LA 3N05A 1O3TA 3GFJA 4KISA 2PJRB 5GAEJ 3RPQA 2L2OA 3DBLB 3ZQFA 1Z0XA 1F36A 4HSTA 3H1CA 4XBFA 4NNJA 5FLMJ 1G3SA 1LDDA 3DTIA 4AM3A 4M3DA 2XVCA 4XLFA 2O61A 1FJLA 4YIIA 2ADUA 4OU0A 4D7NA 1KU7A 4UUSB 1QPMA 5EG0B 1ZARA 5E17F 5J8FA 2Z9OA 1ZR4A 1IN7A 3T5XA 2E7XA 3BR2A 1BJAA 3M4OJ 5HS7A 4IPAA 2R7XA 1ZRFA 2VBZA 5HLTA 3K70D 1R4MB 3HBLA 2EZLA 2GOXB 4Y33A 3K1PA 3GZ5A 3ZN0A 1HKQA 2M8GX 4R79A 3W3CA 3LL7A 3SZGA 1U6GA 4AIDA 2P8TA 1UHWA 3QODA 2IVMA 4EQQA 3AL0C 3HG9A 4JYKA 3TP0A 2VXZA 4XICA 3QPLA 3CC2I 2STTA 1APLC 1T56A 2V9KA 1LNWA 3L7WA 4YEJA 3UR3C 2I5UA 3S3OA 5KVRA 3FISA 5J4VA 4I98B 2LOOA 2LC2A 1G4DA 3KLNA 2W1OA 5HDNA 5E1WA 2GXBA 3EDPA 3HOUJ 2WAQN 2O8KA 2L7KA 1U2WA 3F8CA 1LFPA 2K3FA 1SVOA 2MC3A 5F64A 4LLLA 3HOSA 3MD2A 1XSXA 2DFIA 5CVJA 1B4AA 1GHCA 1LDJA 3RYRA 1D1BA 3OIQA 2DMUA 1LKXA 3CO6C 2XAGA 1G3WA 4I09A 3KYCB 1FTZA 2RKHA 3BPVA 4Y7NJ 1TQIA 1Y1VJ 4UUTA 1SD7A 3G1OA 4LG0A 3U2RA 2BXZA 5K5OA 1BI0A 2EINH 3SFIA 3GVAA 4GFBA 3HOTA 2ZXJA 5LEKA 3I56I 1U8RA 1TTYA 3RTRA 1UHMA 2M9HA 1Y1WJ 1H88C 2M45A 5DYMA 2CG4A 2ME6A 1GXPA 4EJTA 1E2XA 4DIQA 1HDPA 4UUVA 5HS9A 5GP9A 3W2AA 3EUHA 3N4MA 3P7NA 3RCOA 3VYTB 2EZKA 3MZYA 3F0CA 2EFWA 1XGNA 1NH3A 2DMQA 3MCZA 2QQ9A 3QWLA 4CCJA 2VJJA 2LTPA 4AIJA 3V8KA 4B4CA 3H5AA 1D5YA 4HF0A 4WXDA 4JP0A 3QU6A 5EGOA 2P5LC 4E7KA 2X1EA 3EYIA 2EA4A 3S2HJ 1DP7P 3K70C 5AIPA 5GPCA 2LFBA 3PO2J 1XCBA 2CYYA 3E6BA 2Y0MA 2CV0A 1XD7A 2O6GE 2M5WA 1OJLA 3DF8A 2GQQA 1VQMI 4G6QA 1GV5A 5DEQA 1E0EA 2X48A 4NQWA 3TQNA 5K7ZA 3NEUA 2Z2SB 3FF5A 2OC6A 3SDGA 3PNYA 5HDKA 3WTSC 4CYCB 1T0FA 2YSRA 2CMPA 4CO8A 1SFEA 3E1SA 2HZDA 2XPUA 2RQPA 4HDVA 2R7WA 5HNFA 1RETA 4A0YA 3WE2A 4HW0A 2AO9A 1LPQA 2GIVA 4D0PA 3J81Z 3A01A 4L0ZB 4RB0A 4CHUA 1V55H 5DUKA 3HYIA 2CFOA 2DA7A 2A05A 2P5KA 3CCRI 4ENMA 2P4WA 4E6KG 4PFPA 4CCKA 3TP3A 5HNHA 1KU9A 2A5YB 5D4SA 2KZVA 1LJ9A 4F52A 2CH0A 2GIZA 1FOWA 2IXSA 3M9AA 3FXQA 3GW2A 1WWXA 3B02A 3G6EI 2EFQA 1FP1D 2V1UA 1IN5A 4QPQA 2TCTA 3DEWA 5F27A 4BU2A 4BJ6C 4PSWA 3K1NA 1OMIA 1UZCA 3I4PA 4EJWA 2COBA 4A0ZA 2BXYA 2HKOA 1P7JA 4MO7A 2VOPA 2KIMA 2DT6A 3I59A 3T0YA 3VDXA 2NOJB 3E6CC 2ESHA 1OISA 3CCYA 3TW7A 1U8BA 1DDNA 1ZELA 4UVBA 1JHFA 1WJEA 2XGDA 2M2EA 2R7QA 2O3FA 5FO5A 4NC8A 5BNGA 4EEFG 3OYFA 1Y39A 2K3PA 1K6YA 5DD8A 2GXAA 4XMYA 2EFNA 2N8GA 4RAFA 3ZMTA 4N9HA 1ETQA 3T8RA 1PUEE 4YELA 4TV7A 1D1AA 4AYBN 3DU5A 3MEXA 3D0SA 2LNBA 3DXJF 3R61A 4IRHA 1MZBA 3LMMA 3GZ6A 5CQGA 3PNTA 3CZ6A 3I55I 5EEAA 3SJMA 2DOAA 2ZJPF 3GZNB 3LSPA 1HW5A 4UHTA 2LBFA 1VQLI 4WXHA 1ZLJA 1ZN2A 3BJAA 4WF2A 1CF7A 2GWRA 4BS9A 1YS6A 3REOA 3ZOBA 4F92B 1MKMA 2XF5A 1ETVA 3QRFF 2H6CA 3SZTA 4IKFA 3LWFA 4ETSA 4YFKF 2BGCA 5D5WB 4ESJA 3HDDA 3P9IA 4HF1A 2A6TA 1IRXA 4BQQA 5IYDJ 2R4GA 1DGRM 4QLCU 3S1QJ 2HPMA 3H5RA 3HSRA 3WU0A 1HKTA 3WTWC 2BOLA 4HQEA 3FZVA 1Y6IA 4LJZF 3EETA 4XRMA 4BE0A 1PJRA 2VT2A 4BE2A 1JKQC 4A6DA 1A6QA 1HA8A 1U5TA 4IVNA 1VQNI 1MJBA 1VQPI 2YUSA 1S7AA 1STZA 3FXRA 2IP2A 1IV6A 3KPHA 3P9CA 2H94A 2LREA 1FBQA 5D5VB 3IRRA 1W5CC 2P81A 4RM2A 3U21A 4HEA2 2QBYA 2D5VA 2FEZA 4EJOA 2XAQA 3NWSA 2L9NA 5GPAA 1OPCA 2DTZA 1MMNA 1WSUA 4XLPF 4BEHA 1USTA 4YFXF 1QVUA 4R8HA 1TP4A 3K4JA 5FKMA 1KQ9A 5F08A 1J9IA 1V4RA 1SVLA 4M6XA 3R0AA 1Z9CA 1JKPC 4UXNA 4D5FA 5BS6A 4RB2C 2R93J 1HW1A 3BZKA 2R7ZJ 2JPCA 3E6MA 4FCYA 5ED4A 3E0JB 3CUOA 1WHUA 5HODA 3K0LA 2RQQA 4V2FA 4C9YA 1BOBA 2V1DA 2P6TA 3I58A 2NNYA 3FWEA 2DT7B 4FE4A 4A3BJ 3ABTA 1MNDA 2WY7Q 3VEPA 2CSOA 2XF6A 1ZGAA 2ZNYA 2K9MA 4G6TB 3H9GA 1MSFC 1AA7A 4PSXA 4Z6YA 3JTGA 2E2JJ 5FLVA 1SD4A 4S04A 1TC3C 5M3FJ 5F04A 4EATA 4OMZA 5B5EC 1W36C 2HVSA 1LE8A 1UB9A 2EV0A 4BNCA 2GBYA 2L01A 2DFEA 5J40A 3W2VA 4EVIA 2E5NA 3ZMUA 4FTHA 1O3SA 2GAUA 3BLYA 3VOEA 3L2VA 2ZC2A 3FXKA 4ZJZA 5DD4A 1U5TB 3V8JA 2DPUA 4WCGA 1YX5A 2A5WA 1ETOA 3B6AA 1MGTA 1I5ZA 4AVZA 2ID3A 1P7IA 4FISA 4Z2YA 5D6EA 3OYGA 4J19A 5FGMA 2G9WA 2W7NA 2HQAA 2KT0A 1XB4A 3LOCA 4KN4X 3ABKH 2MA3A 1YTYA 1S72I 2QBYB 1YLFA 3KLOA 2EIJH 4FQGA 4KUMA 1EH7A 1ZGWA 3J80K 2W57A 4BEHB 1Z05A 5CVRA 5M3MJ 1OKRA 1Y0NA 2VQLA 1Y8QB 2HFHA 3HZJA 4HLYA 3AG4H 4A3CJ 1FYMA 2DA4A 1MBGA 2EBIA 5LRSA 1R1UA 1FSHA
chains in the Genus database with same CATH topology
3WODF 3BZ6A 1SMYF 3F3XA 1T39A 3KP4A 3VB2A 1BIAA 2F5DA 1K7AA 2XKPA 4RGRA 2KIFA 4RGSA 1L3LA 1R36A 2OQGA 3H3UA 4DNCA 1OR7A 3AAFA 1BOAA 1JHHA 4LFUA 5L3DA 3C18A 4MNUA 5LGNA 5FD5A 4ENKA 3H3ZA 2XRNA 1KQ8A 3TDZC 1J0RA 3FM3A 3CLOA 2XIGA 5ILUA 3NRVA 2R3SA 3ZMZA 4HZFA 4LD5A 2K02A 2EFOA 1W7PB 3F8MA 3QPTA 4E70A 2VBWA 2ZKZA 3GXOA 2B0LA 4A12A 5TRDA 2QYOA 4NB5A 4BQAA 1BBYA 2XUBA 3J81K 2K4BA 5D4RA 1HSJA 2UXNA 5L3FA 2OQRA 2CW0F 1P2FA 3F6OA 2YX4A 2OZUA 2NS0A 5K5RA 4AIKA 4IXAA 4ESBA 4UVCA 2DQLA 1KU3A 3ML6A 4ENJA 4OOIA 5LRRA 2PJPA 5LLQA 2GXGA 4FX4A 1BN5A 4G6DA 4ZZDA 5ILSA 2NRAC 4PDKA 1Z7UA 3RKYA 2XHKA 5H6RA 4A2UA 2A3SA 2PMUA 4RAYA 1U5TC 5A2QZ 1LEAA 2IRFG 3I0TA 4EM1A 4UVAA 4Q48A 3RJPA 2MH2A 1ZREA 4YG2F 3HUGA 4PCQA 4KN7X 3CUQA 2BYVE 4XSXF 4M72A 4KIBA 3P9KA 2DU9A 5J6XA 3LFKA 2HTJA 3D5LA 2BBYA 3I5UA 3LQRA 3HHHA 4OINF 3WTYC 1USSA 2G7UA 3QAHA 3SHFA 3NQOA 1P6RA 1U3EM 5ICEA 5LEJA 3F8NA 3GF2A 2CGPA 1KA8A 2BE5F 2A6EF 4HQMA 2DW4A 2JT1A 2DBBA 2J5PA 3GEZA 2K27A 3F6VA 4WK8F 1P92A 1XGOA 2VE8A 3BY6A 3GO5A 3GX4X 2CWEA 2A6HF 5ERIA 5L3GA 3ZP5A 3BPXA 2FMYA 1CGPA 3G3ZA 4QWQA 4LB6B 2HGCA 3FM5A 4YIFA 2CFXA 1TBXA 4NHJA 5FFXA 2IPQX 1ON1A 5DCFA 2ZMEA 1OYWA 1H9TA 2V9VA 4G94A 3Q9SA 4L9NA 4I7HA 4U88A 1XCVA 3PQKA 4JQFA 5ICFA 2JTVA 1IW7F 5D8LB 2HDCA 2WTEA 2RN7A 3PQJA 2QVOA 1MJ9A 4XSZF 2OU2A 2STWA 2KRFA 1ZRDA 4KA4A 2R7FA 3IKVA 1AWCA 5LGTA 1UFMA 2FXAA 3KP2A 2RDPA 1K6OA 4MEYF 2IA2A 3QP5A 2ZFWA 1P4XA 2W84A 3Q5FA 1L0OC 1RZ4A 4L9VA 1HBXG 3J80Z 2VBYA 3C3WA 3WTTC 2K7LA 1HKSA 4AWXB 2VOOA 2D1HA 4KDPA 1IXCA 1PP8F 3MQ0A 5D5XB 1FP2A 5AONA 3BROA 5D5UB 5K5QA 2OAZA 1RIOH 2Z3YA 5LHHA 4BHPA 2RVCA 3TO9A 3BWGA 4BH9A 1ZRCA 4ESFA 2BV6A 2NAZA 1YFHA 5CLSA 3L00A 1KQ0A 2VODA 5HLIA 1O7LA 2IA0A 4Y15A 1O57A 3M8EA 4ZYHA 4P55A 2IW5A 3V7RA 4CZZA 3O2PE 4EMSA 3IKTA 2ZCWA 2KKOA 4RAZA 2XASA 1YW9A 4OIRF 2EWNA 2PFBA 5FB2A 1S29A 4GXOA 3KP3A 1OYYA 3ZMVA 5CYVA 4L5JA 4MTEA 3L2CA 3BP8A 2PN6A 1I27A 4LG0B 5ICGA 5HLHA 1W5TA 5LGUA 1B1BA 1QBJA 3E5XA 4IHSA 4EV0A 4JK1X 1GVJA 2HR3A 1J7KA 4ON0A 3IWZA 3O6BB 1TQPA 3F72A 5BQTA 4UV8A 5ILVA 1K78A 4CYDA 2FRHA 4O5VA 2OA4A 5A2QK 2MBFA 3OV8A 3WTZA 5EEGA 3VFZA 1SAXA 3V4GA 1X3UA 4YFNF 4CXFA 4P9FA 4EGYA 4FHTA 3U1DA 4I0BA 5E1ZB 4PZJA 1MJAA 1FT9A 3V8LA 5K1YA 2QENA 1ZG3A 4M73A 1J75A 2UXXA 2PEXA 2M87A 1Z1DA 3BDDA 4Q5SF 3T8TA 1ODDA 3K9TA 3FX3A 4OIOF 4Q4ZF 2NYXA 4XLNF 1QQIA 5BOXA 1F4KA 2ZBKA 3MAJA 1ZLKA 4S05A 3ZN1A 2KIUA 2L3DA 5E8IA 4LK1F 1FPQA 2G7HA 1LB2A 1K78B 4DQ2A 1KYWA 4GYGA 4P9UA 2HQRA 3E3VA 4KIFA 3I59B 2HYGD 3TO6A 4FX0A 2J5OA 3JSOA 1MD0A 1SD6A 1R1VA 2L54A 3JTHA 1SFXA 1D8JA 1IAWA 1B59A 4EJUA 3SXYA 1ZAOA 1H9GA 2WC2A 5CVVA 5D6FA 2W85A 1XSDA 2GA1A 3M1EA 2K86A 2K4JA 1CF7B 2ZNZA 3ROUA 3WGHA 1LEBA 3KFWX 2FBIA 1U78A 1F1ZA 2RC4A 1ZYRF 4EGZA 2HYFA 4M9ZA 2L02A 2VE9A 3KEOA 3IWFA 4UNOA 3OOPA 2HWVA 3RIRA 1ZG5A 5HS8A 1IF1A 3LA7A 3RYPA 3QP6A 2D45A 1XMAA 2XAFA 1R23A 1FWZA 3HRSA 5FLXZ 4L18B 2L4MA 2COMA 1FC3A 3BJ6A 1BI2A 3F8FA 4M71A 3HSEA 4LGWA 2F2EA 3GWZA 3DPLC 1SFUA 1ONVA 3I71A 1TNTA 2XROA 4PGHA 1YQAA 1G3TA 3QOPA 1TLHB 3HRMA 2PBIA 1XGMA 4G7ZF 4I0AA 1OYIA 4GCVA 3SFZA 4HOBA 3R6SA 2HZTA 3ERED 1T98A 3K69A 4OIPF 4IHTA 3BJOA 1R5GA 2QUFA 3IC7A 5LHIA 2F5FA 2TDXA 4HA8A 1GXQA 4LB5A 2XKOA 1TNSA 3LAPA 5E20A 5BPIA 4IRIA 2FQ3A 3WGGA 1IRGA 2HTSA 2LDUA 2DLLA 2UWMA 3KEQA 2FU4A 4P96A 3HIFA 3GYHX 2ESNA 3TKYA 3HHGA 4R1HA 3TOBA 3V7CA 2XGXA 1P4AA 1BM9A 3F21A 1S3JA 2Q8KA 1J59A 2QM3A 4A5MA 4M9SA 2AS5F 2UZKA 2EV5A 4P5OA 4LK0F 3MFKA 5IT9K 2EV6A 1FSEA 1S8NA 2XAHA 1TQMA 1FBUA 4BAYA 4O3MA 3ECOA 2PLYA 1W7PD 1RNLA 3JSPA 4EM2A 1IUYA 1FBSA 1JXSA 2V79A 4G7OF 5J8CA 1R5HA 1FLIA 1AOYA 3R60A 5HOOA 2Y75A 3G73A 1FX7A 3KZZA 2FF4A 1P4WA 1DUXC 4BHBA 1Z91A 1R7JA 4WWCA 1I1SA 3R4KA 4EJVA 4A0XA 4HBLA 1D8KA 1H0MA 1R00A 1XN7A 3CTAA 3FXUA 4N9IA 1BC8C 4M74A 1IN6A 2A69F 2MH9A 3CJNA 1FNNA 3ZQ7A 5CVIA 3ULQB 3Q9VA 2KJBA 2H6BA 4KMUX 4LLNA 2DAOA 2WWYA 3HTSB 2M8EA 1ZHFA 3E5QA 3C1DA 2BEOA 3H92A 2O03A 5DCMA 1K79A 1YS7A 1ON2A 2ACJA 2OBPA 1WRJA 4MQVA 1W5SA 3E5UA 2A61A 3GUDA 2L4AA 1IRFA 3T1BA 4G9YA 4WX9A 2Q0OA 1ZG1A 3EYYA 1XMKA 3CUQB 1YO5C 5CVUA 5D8KB 2X4HA 3WTVC 1NHAA 2YPRA 4HV5A 2NNNA 1VTNC 3F22A 1B9NA 2JZYA 3TGNA 5E18F 3DFGA 1W4MA 2LSOA 2M1BA 4UV9A 4MTDA 3IL2A 3GFIA 4B8XA 3PFIA 5H20A 1D5VA 5AIQA 2E1CA 5DCMB 2QZ8A 1QZZA 5L3CA 4WXCA 4HX8A 1V3FA 1IN8A 2FNPA 5FLXK 4IF4A 5JFRA 1HXDA 4LLGF 2EK5A 5L3BA 3VODA 4HLXA 3TDUC 4ZYEA 4O6JA 1Q1HA 1DPRA 1Z6TA 5DUIA 2VC1A 3TOAA 3U9GA 1KYZA 4GO1A 2XAJA 2FBKA 1KGSA 2DT5A 2ZMEB 5DDGA 1S7OA 2LKPA 2FMLA 5HLGA 2H27A 3CDHA 1FY7A 1RUOA 3E97A 3GLXA 3LQQA 1BIBA 4G7HF 4A6EA 3DKWA 2RGVA 3R0JA 4JBAA 4BHCA 4AD9A 5ICCA 1PP7U 2ETHA 3S2WA 1RUNA 2VN2A 1O3QA 4KICA 1LDKB 3L9FA 1Y0UA 2ZO4A 3M8FA 1EH6A 1IXSB 3WTXC 4HV6A 4I01A 2OD5A 4HF2A 3JAMZ 2D1VA 4KIGA 2MLGA 3IRQA 3RDIA 1O3RA 3WU1B 4L9TA 4ZZLA 1SMTA 4L0YB 2Z5UA 3CUQC 3C7JA 4L9JA 4KMFA 2JPBA 2DPDA 1HSTA 3ISPA 6PAXA 4EM0B 4ZYDA 1JE8A 2RV8A 4I02A 5IT9Z 2FNAA 4MEXF 2P5VA 2V1XA 3HRTA 2CQKA 2RNJA 3L09A 3KP7A 4RB1A 3DEUA 3RKXA 3W6KB 2DTRA 3ABUA 4XRFA 1YW7A 3LA2A 5BPDA 5FD6A 3LSTA 1FYKA 4N0BA 4ASNA 3HTUA 1ZGJA 4F7ZA 1IXRC 1B9MA 2A68F 2Q2EA 4K2EA 4FT8A 1LVAA 2R7DA 2HKXA 5TJJA 4RS8A 2HQNA 2HS5A 4Y17A 1YYVA 2Z33A 1F5TA 2LF8A 2E7WA 5L3EA 1FYLA 2XV4S 1XSVA 2O0YA 1FOKA 3I53A 5LHGA 3I54A 1FZPB 3WE3A 1ZH5A 3KZYA 5EEHA 3B73A 1A04A 1T6SA 1MDMA 4AVPA 3BOQA 1YW8A 2F5CA 4L5IA 4KYWA 3RPUA 2ZJ2A 2DQRA 2V6CA 1WQ2A 3DQVC 4RB3C 3FHZA 2IT0A 2MLKA 1WKMA 5KK1A 1PDNC 1YIOA 4MHGA 1J2XA 3MZHA 1HQCA 4OIQF 1TW3A 3K2ZA 2PG4A 1R1TA 4ZH4F 1XGSA 2EJRA 4LMYA 5F1RA 3DV8A 4IRGA 5HDGA 3QPHA 4CICA 1QZYA 4KT5C 1R58A 1MDMB 3JW4A 2DK8A 2A07F 2YX7A 2GZWA 4Q47A 4HDUA 2ISZA 2AXLA 3IHUA 5JR3A 1B6AA 2Z99A 3J7AO 2W25A 3KETA 5JVTA 2O8XA 3KCCA 3WG9A 2DO7A 5IT3A 2HOEA 4KNYA 2PQ8A 2QLZA 4BYYA 4HAMA 3KP6A 3FMRA 1W7PA 2QWWA 2ELHA 4Y13A 1G6NA 2OZ6A 4ZYGA 4A5NA 2GA2A 2IA1A 4HYEA 2H09A 3KP5A 4U0VA 2MD5A 1QNTA 4M6YA 3ZPLA 1I6XA 1XDUA 4OMYA 4RGUA 5CJ9A 3SZPA 4U0YA 5F6FA 5HVQC 1EV7A 2P7VB 1XDSA 2C6YA 1D3YA 5FFZA 3F23A 2X0LA 4BXUA 3M7GA 3I64A 4H0EA 2EFPA 1J5YA 2FA5A 1IN4A 3W6JB 1KU2A 2JSCA 3CO7C 4AIHA 2FOKA 3WGIA 3N97A 4M9XA 3DP7A 5E8GA 2KJCA 2QQAA 2QQBA 3JAMK 2JRTA 3COAC 2FBHA 4U7DA 2EB7A 3MWMA 3V7SA 2E1NA 3FMQA 3WTUC 4ENNA 3ELKA 2ISYA 4CGZA 5LBQA 5H6QA 1BC7C 4U7BA 2WV0A 4CDGA 1TW2A 1F9NA 3RI4A 1ULYA 3HRUA 1UCRA 1C0WA 3HSFA 4MGRA 2PI0A 1G3YA 4HX4A 1O7FA 3GFMA 3ZMSA 1E17A 1YG2A 2DI3A 1RI7A 5JI6A 5JHUA 2VC0A 2PMHA 2VBXA 4KFCA 4B09A 2F5EA 4GYIA 2YR2A 3RKWA 2LF7A 1WI9A 3F8BA 2M30A 5DV5A 1HW2A 2Y48A 3DPTA 4GGGA 2FE3A 1BI1A 4PGGA 3SQNA 3K1MA 1Z6RA 3LA3A 3ZMDA 2FSWA 2VT3A 1QGPA 3O3KA 3QU3A 3ECHA 2HEOA 2DK5A 2P7CB 4RGXA 1R22A 2YU3A 3FMSA 5BMZA 1I1GA 2D2WA 3EQLF 1QO0D 1DPUA 2W24A 4MQ9F 3KE2A 2CO5A 1EH8A 4IJAA 4G8XA 1LQ1A 3E6DA 1T2KA 2P6SA 4HX7A 1SD5A 1JGSA 2EA2A 2VONA 1IZ1A 5E1XA 3TO7A 4I2OA 4U0WA 2IJLA 3LAJA 3GFLA 1BI3A 1REPC 1T38A 1S6LA 1O3TA 3GFJA 3RPQA 4XBFA 1G3SA 1LDDA 2XVCA 2O61A 4YIIA 2ADUA 4OU0A 1KU7A 1QPMA 1ZARA 5E17F 5J8FA 2Z9OA 1IN7A 3T5XA 2E7XA 1BJAA 5HS7A 4IPAA 1ZRFA 2VBZA 3K1PA 3GZ5A 3ZN0A 1HKQA 4R79A 1U6GA 2P8TA 1UHWA 4EQQA 2IVMA 2VXZA 2STTA 1LNWA 3L7WA 5KVRA 4I98B 1G4DA 3KLNA 5HDNA 5E1WA 2GXBA 3EDPA 1U2WA 3F8CA 2MC3A 5F64A 4LLLA 3HOSA 1XSXA 2DFIA 5CVJA 1B4AA 1GHCA 1LDJA 3RYRA 3CO6C 2XAGA 1G3WA 4I09A 2RKHA 3BPVA 1TQIA 4LG0A 1SD7A 3U2RA 5K5OA 1BI0A 3GVAA 3HOTA 2ZXJA 5LEKA 1U8RA 1TTYA 3RTRA 1UHMA 2M45A 5DYMA 2CG4A 1GXPA 4EJTA 1E2XA 4UUVA 5HS9A 3EUHA 3N4MA 3P7NA 3MZYA 2EFWA 1XGNA 3MCZA 2QQ9A 4AIJA 3V8KA 4HF0A 4WXDA 3QU6A 2P5LC 3EYIA 2EA4A 1DP7P 5AIPA 1XCBA 2CYYA 3E6BA 2Y0MA 1XD7A 2O6GE 2M5WA 3DF8A 2GQQA 4G6QA 5DEQA 4NQWA 3TQNA 3NEUA 3FF5A 5HDKA 3WTSC 1T0FA 2YSRA 4CO8A 1SFEA 4HDVA 2RQPA 4A0YA 3WE2A 4HW0A 2GIVA 4D0PA 3J81Z 4L0ZB 4RB0A 4CHUA 5DUKA 3HYIA 2P5KA 4ENMA 2P4WA 1KU9A 2A5YB 5D4SA 1LJ9A 3M9AA 3FXQA 3GW2A 1WWXA 3B02A 2EFQA 1FP1D 2V1UA 1IN5A 3K1NA 1OMIA 3I4PA 4EJWA 4A0ZA 2HKOA 2VOPA 2KIMA 3I59A 3T0YA 3E6CC 2ESHA 1DDNA 4UVBA 1JHFA 2O3FA 5FO5A 5DD8A 2EFNA 3ZMTA 1PUEE 4N9HA 3T8RA 4TV7A 3MEXA 3D0SA 2LNBA 3DXJF 3R61A 4IRHA 1MZBA 3GZ6A 1HW5A 4UHTA 4WXHA 1ZLJA 1ZN2A 3BJAA 4WF2A 1CF7A 2GWRA 1YS6A 3REOA 1MKMA 3QRFF 2H6CA 3SZTA 3LWFA 4ETSA 4YFKF 2BGCA 5D5WB 4ESJA 3P9IA 4HF1A 4QLCU 3HSRA 3WU0A 1HKTA 3WTWC 4HQEA 3FZVA 4LJZF 3EETA 2VT2A 4A6DA 1U5TA 4IVNA 1MJBA 1S7AA 1STZA 3FXRA 2IP2A 3P9CA 2H94A 5D5VB 1FBQA 3IRRA 2QBYA 2FEZA 4EJOA 2XAQA 1OPCA 1WSUA 4XLPF 1USTA 4YFXF 4R8HA 1KQ9A 1J9IA 1V4RA 4M6XA 3R0AA 1Z9CA 4UXNA 5BS6A 4RB2C 1HW1A 2JPCA 3E6MA 5ED4A 3CUOA 3K0LA 2V1DA 2P6TA 3I58A 2NNYA 3FWEA 3ABTA 3VEPA 2CSOA 1ZGAA 2ZNYA 3JTGA 1SD4A 4S04A 4OMZA 1UB9A 2EV0A 4BNCA 2L01A 4EVIA 3ZMUA 1O3SA 2GAUA 3VOEA 5DD4A 1U5TB 3V8JA 2DPUA 4WCGA 1MGTA 1I5ZA 4Z2YA 5D6EA 5FGMA 2G9WA 4KN4X 1XB4A 2MA3A 1YTYA 2QBYB 1YLFA 3KLOA 4KUMA 1EH7A 3J80K 2W57A 1Z05A 5CVRA 1OKRA 2HFHA 4HLYA 1FYMA 5LRSA 1R1UA 1FSHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WOD F;  3BZ6 A;  1SMY F;  3F3X A;  1T39 A;  3KP4 A;  3VB2 A;  1BIA A;  2F5D A;  1K7A A;  2XKP A;  4RGR A;  2KIF A;  4RGS A;  1L3L A;  1R36 A;  2OQG A;  3H3U A;  4DNC A;  1OR7 A;  3AAF A;  1BOA A;  1JHH A;  4LFU A;  5L3D A;  3C18 A;  4MNU A;  5LGN A;  5FD5 A;  4ENK A;  3H3Z A;  2XRN A;  1KQ8 A;  3TDZ C;  1J0R A;  3FM3 A;  3CLO A;  2XIG A;  5ILU A;  3NRV A;  2R3S A;  3ZMZ A;  4HZF A;  4LD5 A;  2K02 A;  2EFO A;  1W7P B;  3F8M A;  3QPT A;  4E70 A;  2VBW A;  2ZKZ A;  3GXO A;  2B0L A;  4A12 A;  5TRD A;  2QYO A;  4NB5 A;  4BQA A;  1BBY A;  2XUB A;  3J81 K;  2K4B A;  5D4R A;  1HSJ A;  2UXN A;  5L3F A;  2OQR A;  2CW0 F;  1P2F A;  3F6O A;  2YX4 A;  2OZU A;  2NS0 A;  5K5R A;  4AIK A;  4IXA A;  4ESB A;  4UVC A;  2DQL A;  1KU3 A;  3ML6 A;  4ENJ A;  4OOI A;  5LRR A;  2PJP A;  5LLQ A;  2GXG A;  4FX4 A;  1BN5 A;  4G6D A;  4ZZD A;  5ILS A;  2NRA C;  4PDK A;  1Z7U A;  3RKY A;  2XHK A;  5H6R A;  4A2U A;  2A3S A;  2PMU A;  4RAY A;  1U5T C;  5A2Q Z;  1LEA A;  2IRF G;  3I0T A;  4EM1 A;  4UVA A;  4Q48 A;  3RJP A;  2MH2 A;  1ZRE A;  4YG2 F;  3HUG A;  4PCQ A;  4KN7 X;  3CUQ A;  2BYV E;  4XSX F;  4M72 A;  4KIB A;  3P9K A;  2DU9 A;  5J6X A;  3LFK A;  2HTJ A;  3D5L A;  2BBY A;  3I5U A;  3LQR A;  3HHH A;  4OIN F;  3WTY C;  1USS A;  2G7U A;  3QAH A;  3SHF A;  3NQO A;  1P6R A;  1U3E M;  5ICE A;  5LEJ A;  3F8N A;  3GF2 A;  2CGP A;  1KA8 A;  2BE5 F;  2A6E F;  4HQM A;  2DW4 A;  2JT1 A;  2DBB A;  2J5P A;  3GEZ A;  2K27 A;  3F6V A;  4WK8 F;  1P92 A;  1XGO A;  2VE8 A;  3BY6 A;  3GO5 A;  3GX4 X;  2CWE A;  2A6H F;  5ERI A;  5L3G A;  3ZP5 A;  3BPX A;  2FMY A;  1CGP A;  3G3Z A;  4QWQ A;  4LB6 B;  2HGC A;  3FM5 A;  4YIF A;  2CFX A;  1TBX A;  4NHJ A;  5FFX A;  2IPQ X;  1ON1 A;  5DCF A;  2ZME A;  1OYW A;  1H9T A;  2V9V A;  4G94 A;  3Q9S A;  4L9N A;  4I7H A;  4U88 A;  1XCV A;  3PQK A;  4JQF A;  5ICF A;  2JTV A;  1IW7 F;  5D8L B;  2HDC A;  2WTE A;  2RN7 A;  3PQJ A;  2QVO A;  1MJ9 A;  4XSZ F;  2OU2 A;  2STW A;  2KRF A;  1ZRD A;  4KA4 A;  2R7F A;  3IKV A;  1AWC A;  5LGT A;  1UFM A;  2FXA A;  3KP2 A;  2RDP A;  1K6O A;  4MEY F;  2IA2 A;  3QP5 A;  2ZFW A;  1P4X A;  2W84 A;  3Q5F A;  1L0O C;  1RZ4 A;  4L9V A;  1HBX G;  3J80 Z;  2VBY A;  3C3W A;  3WTT C;  2K7L A;  1HKS A;  4AWX B;  2VOO A;  2D1H A;  4KDP A;  1IXC A;  1PP8 F;  3MQ0 A;  5D5X B;  1FP2 A;  5AON A;  3BRO A;  5D5U B;  5K5Q A;  2OAZ A;  1RIO H;  2Z3Y A;  5LHH A;  4BHP A;  2RVC A;  3TO9 A;  3BWG A;  4BH9 A;  1ZRC A;  4ESF A;  2BV6 A;  2NAZ A;  1YFH A;  5CLS A;  3L00 A;  1KQ0 A;  2VOD A;  5HLI A;  1O7L A;  2IA0 A;  4Y15 A;  1O57 A;  3M8E A;  4ZYH A;  4P55 A;  2IW5 A;  3V7R A;  4CZZ A;  3O2P E;  4EMS A;  3IKT A;  2ZCW A;  2KKO A;  4RAZ A;  2XAS A;  1YW9 A;  4OIR F;  2EWN A;  2PFB A;  5FB2 A;  1S29 A;  4GXO A;  3KP3 A;  1OYY A;  3ZMV A;  5CYV A;  4L5J A;  4MTE A;  3L2C A;  3BP8 A;  2PN6 A;  1I27 A;  4LG0 B;  5ICG A;  5HLH A;  1W5T A;  5LGU A;  1B1B A;  1QBJ A;  3E5X A;  4IHS A;  4EV0 A;  4JK1 X;  1GVJ A;  2HR3 A;  1J7K A;  4ON0 A;  3IWZ A;  3O6B B;  1TQP A;  3F72 A;  5BQT A;  4UV8 A;  5ILV A;  1K78 A;  4CYD A;  2FRH A;  4O5V A;  2OA4 A;  5A2Q K;  2MBF A;  3OV8 A;  3WTZ A;  5EEG A;  3VFZ A;  1SAX A;  3V4G A;  1X3U A;  4YFN F;  4CXF A;  4P9F A;  4EGY A;  4FHT A;  3U1D A;  4I0B A;  5E1Z B;  4PZJ A;  1MJA A;  1FT9 A;  3V8L A;  5K1Y A;  2QEN A;  1ZG3 A;  4M73 A;  1J75 A;  2UXX A;  2PEX A;  2M87 A;  1Z1D A;  3BDD A;  4Q5S F;  3T8T A;  1ODD A;  3K9T A;  3FX3 A;  4OIO F;  4Q4Z F;  2NYX A;  4XLN F;  1QQI A;  5BOX A;  1F4K A;  2ZBK A;  3MAJ A;  1ZLK A;  4S05 A;  3ZN1 A;  2KIU A;  2L3D A;  5E8I A;  4LK1 F;  1FPQ A;  2G7H A;  1LB2 A;  1K78 B;  4DQ2 A;  1KYW A;  4GYG A;  4P9U A;  2HQR A;  3E3V A;  4KIF A;  3I59 B;  2HYG D;  3TO6 A;  4FX0 A;  2J5O A;  3JSO A;  1MD0 A;  1SD6 A;  1R1V A;  2L54 A;  3JTH A;  1SFX A;  1D8J A;  1IAW A;  1B59 A;  4EJU A;  3SXY A;  1ZAO A;  1H9G A;  2WC2 A;  5CVV A;  5D6F A;  2W85 A;  1XSD A;  2GA1 A;  3M1E A;  2K86 A;  2K4J A;  1CF7 B;  2ZNZ A;  3ROU A;  3WGH A;  1LEB A;  3KFW X;  2FBI A;  1U78 A;  1F1Z A;  2RC4 A;  1ZYR F;  4EGZ A;  2HYF A;  4M9Z A;  2L02 A;  2VE9 A;  3KEO A;  3IWF A;  4UNO A;  3OOP A;  2HWV A;  3RIR A;  1ZG5 A;  5HS8 A;  1IF1 A;  3LA7 A;  3RYP A;  3QP6 A;  2D45 A;  1XMA A;  2XAF A;  1R23 A;  1FWZ A;  3HRS A;  5FLX Z;  4L18 B;  2L4M A;  2COM A;  1FC3 A;  3BJ6 A;  1BI2 A;  3F8F A;  4M71 A;  3HSE A;  4LGW A;  2F2E A;  3GWZ A;  3DPL C;  1SFU A;  1ONV A;  3I71 A;  1TNT A;  2XRO A;  4PGH A;  1YQA A;  1G3T A;  3QOP A;  1TLH B;  3HRM A;  2PBI A;  1XGM A;  4G7Z F;  4I0A A;  1OYI A;  4GCV A;  3SFZ A;  4HOB A;  3R6S A;  2HZT A;  3ERE D;  1T98 A;  3K69 A;  4OIP F;  4IHT A;  3BJO A;  1R5G A;  2QUF A;  3IC7 A;  5LHI A;  2F5F A;  2TDX A;  4HA8 A;  1GXQ A;  4LB5 A;  2XKO A;  1TNS A;  3LAP A;  5E20 A;  5BPI A;  4IRI A;  2FQ3 A;  3WGG A;  1IRG A;  2HTS A;  2LDU A;  2DLL A;  2UWM A;  3KEQ A;  2FU4 A;  4P96 A;  3HIF A;  3GYH X;  2ESN A;  3TKY A;  3HHG A;  4R1H A;  3TOB A;  3V7C A;  2XGX A;  1P4A A;  1BM9 A;  3F21 A;  1S3J A;  2Q8K A;  1J59 A;  2QM3 A;  4A5M A;  4M9S A;  2AS5 F;  2UZK A;  2EV5 A;  4P5O A;  4LK0 F;  3MFK A;  5IT9 K;  2EV6 A;  1FSE A;  1S8N A;  2XAH A;  1TQM A;  1FBU A;  4BAY A;  4O3M A;  3ECO A;  2PLY A;  1W7P D;  1RNL A;  3JSP A;  4EM2 A;  1IUY A;  1FBS A;  1JXS A;  2V79 A;  4G7O F;  5J8C A;  1R5H A;  1FLI A;  1AOY A;  3R60 A;  5HOO A;  2Y75 A;  3G73 A;  1FX7 A;  3KZZ A;  2FF4 A;  1P4W A;  1DUX C;  4BHB A;  1Z91 A;  1R7J A;  4WWC A;  1I1S A;  3R4K A;  4EJV A;  4A0X A;  4HBL A;  1D8K A;  1H0M A;  1R00 A;  1XN7 A;  3CTA A;  3FXU A;  4N9I A;  1BC8 C;  4M74 A;  1IN6 A;  2A69 F;  2MH9 A;  3CJN A;  1FNN A;  3ZQ7 A;  5CVI A;  3ULQ B;  3Q9V A;  2KJB A;  2H6B A;  4KMU X;  4LLN A;  2DAO A;  2WWY A;  3HTS B;  2M8E A;  1ZHF A;  3E5Q A;  3C1D A;  2BEO A;  3H92 A;  2O03 A;  5DCM A;  1K79 A;  1YS7 A;  1ON2 A;  2ACJ A;  2OBP A;  1WRJ A;  4MQV A;  1W5S A;  3E5U A;  2A61 A;  3GUD A;  2L4A A;  1IRF A;  3T1B A;  4G9Y A;  4WX9 A;  2Q0O A;  1ZG1 A;  3EYY A;  1XMK A;  3CUQ B;  1YO5 C;  5CVU A;  5D8K B;  2X4H A;  3WTV C;  1NHA A;  2YPR A;  4HV5 A;  2NNN A;  1VTN C;  3F22 A;  1B9N A;  2JZY A;  3TGN A;  5E18 F;  3DFG A;  1W4M A;  2LSO A;  2M1B A;  4UV9 A;  4MTD A;  3IL2 A;  3GFI A;  4B8X A;  3PFI A;  5H20 A;  1D5V A;  5AIQ A;  2E1C A;  5DCM B;  2QZ8 A;  1QZZ A;  5L3C A;  4WXC A;  4HX8 A;  1V3F A;  1IN8 A;  2FNP A;  5FLX K;  4IF4 A;  5JFR A;  1HXD A;  4LLG F;  2EK5 A;  5L3B A;  3VOD A;  4HLX A;  3TDU C;  4ZYE A;  4O6J A;  1Q1H A;  1DPR A;  1Z6T A;  5DUI A;  2VC1 A;  3TOA A;  3U9G A;  1KYZ A;  4GO1 A;  2XAJ A;  2FBK A;  1KGS A;  2DT5 A;  2ZME B;  5DDG A;  1S7O A;  2LKP A;  2FML A;  5HLG A;  2H27 A;  3CDH A;  1FY7 A;  1RUO A;  3E97 A;  3GLX A;  3LQQ A;  1BIB A;  4G7H F;  4A6E A;  3DKW A;  2RGV A;  3R0J A;  4JBA A;  4BHC A;  4AD9 A;  5ICC A;  1PP7 U;  2ETH A;  3S2W A;  1RUN A;  2VN2 A;  1O3Q A;  4KIC A;  1LDK B;  3L9F A;  1Y0U A;  2ZO4 A;  3M8F A;  1EH6 A;  1IXS B;  3WTX C;  4HV6 A;  4I01 A;  2OD5 A;  4HF2 A;  3JAM Z;  2D1V A;  4KIG A;  2MLG A;  3IRQ A;  3RDI A;  1O3R A;  3WU1 B;  4L9T A;  4ZZL A;  1SMT A;  4L0Y B;  2Z5U A;  3CUQ C;  3C7J A;  4L9J A;  4KMF A;  2JPB A;  2DPD A;  1HST A;  3ISP A;  6PAX A;  4EM0 B;  4ZYD A;  1JE8 A;  2RV8 A;  4I02 A;  5IT9 Z;  2FNA A;  4MEX F;  2P5V A;  2V1X A;  3HRT A;  2CQK A;  2RNJ A;  3L09 A;  3KP7 A;  4RB1 A;  3DEU A;  3RKX A;  3W6K B;  2DTR A;  3ABU A;  4XRF A;  1YW7 A;  3LA2 A;  5BPD A;  5FD6 A;  3LST A;  1FYK A;  4N0B A;  4ASN A;  3HTU A;  1ZGJ A;  4F7Z A;  1IXR C;  1B9M A;  2A68 F;  2Q2E A;  4K2E A;  4FT8 A;  1LVA A;  2R7D A;  2HKX A;  5TJJ A;  4RS8 A;  2HQN A;  2HS5 A;  4Y17 A;  1YYV A;  2Z33 A;  1F5T A;  2LF8 A;  2E7W A;  5L3E A;  1FYL A;  2XV4 S;  1XSV A;  2O0Y A;  1FOK A;  3I53 A;  5LHG A;  3I54 A;  1FZP B;  3WE3 A;  1ZH5 A;  3KZY A;  5EEH A;  3B73 A;  1A04 A;  1T6S A;  1MDM A;  4AVP A;  3BOQ A;  1YW8 A;  2F5C A;  4L5I A;  4KYW A;  3RPU A;  2ZJ2 A;  2DQR A;  2V6C A;  1WQ2 A;  3DQV C;  4RB3 C;  3FHZ A;  2IT0 A;  2MLK A;  1WKM A;  5KK1 A;  1PDN C;  1YIO A;  4MHG A;  1J2X A;  3MZH A;  1HQC A;  4OIQ F;  1TW3 A;  3K2Z A;  2PG4 A;  1R1T A;  4ZH4 F;  1XGS A;  2EJR A;  4LMY A;  5F1R A;  3DV8 A;  4IRG A;  5HDG A;  3QPH A;  4CIC A;  1QZY A;  4KT5 C;  1R58 A;  1MDM B;  3JW4 A;  2DK8 A;  2A07 F;  2YX7 A;  2GZW A;  4Q47 A;  4HDU A;  2ISZ A;  2AXL A;  3IHU A;  5JR3 A;  1B6A A;  2Z99 A;  3J7A O;  2W25 A;  3KET A;  5JVT A;  2O8X A;  3KCC A;  3WG9 A;  2DO7 A;  5IT3 A;  2HOE A;  4KNY A;  2PQ8 A;  2QLZ A;  4BYY A;  4HAM A;  3KP6 A;  3FMR A;  1W7P A;  2QWW A;  2ELH A;  4Y13 A;  1G6N A;  2OZ6 A;  4ZYG A;  4A5N A;  2GA2 A;  2IA1 A;  4HYE A;  2H09 A;  3KP5 A;  4U0V A;  2MD5 A;  1QNT A;  4M6Y A;  3ZPL A;  1I6X A;  1XDU A;  4OMY A;  4RGU A;  5CJ9 A;  3SZP A;  4U0Y A;  5F6F A;  5HVQ C;  1EV7 A;  2P7V B;  1XDS A;  2C6Y A;  1D3Y A;  5FFZ A;  3F23 A;  2X0L A;  4BXU A;  3M7G A;  3I64 A;  4H0E A;  2EFP A;  1J5Y A;  2FA5 A;  1IN4 A;  3W6J B;  1KU2 A;  2JSC A;  3CO7 C;  4AIH A;  2FOK A;  3WGI A;  3N97 A;  4M9X A;  3DP7 A;  5E8G A;  2KJC A;  2QQA A;  2QQB A;  3JAM K;  2JRT A;  3COA C;  2FBH A;  4U7D A;  2EB7 A;  3MWM A;  3V7S A;  2E1N A;  3FMQ A;  3WTU C;  4ENN A;  3ELK A;  2ISY A;  4CGZ A;  5LBQ A;  5H6Q A;  1BC7 C;  4U7B A;  2WV0 A;  4CDG A;  1TW2 A;  1F9N A;  3RI4 A;  1ULY A;  3HRU A;  1UCR A;  1C0W A;  3HSF A;  4MGR A;  2PI0 A;  1G3Y A;  4HX4 A;  1O7F A;  3GFM A;  3ZMS A;  1E17 A;  1YG2 A;  2DI3 A;  1RI7 A;  5JI6 A;  5JHU A;  2VC0 A;  2PMH A;  2VBX A;  4KFC A;  4B09 A;  2F5E A;  4GYI A;  2YR2 A;  3RKW A;  2LF7 A;  1WI9 A;  3F8B A;  2M30 A;  5DV5 A;  1HW2 A;  2Y48 A;  3DPT A;  4GGG A;  2FE3 A;  1BI1 A;  4PGG A;  3SQN A;  3K1M A;  1Z6R A;  3LA3 A;  3ZMD A;  2FSW A;  2VT3 A;  1QGP A;  3O3K A;  3QU3 A;  3ECH A;  2HEO A;  2DK5 A;  2P7C B;  4RGX A;  1R22 A;  2YU3 A;  3FMS A;  5BMZ A;  1I1G A;  2D2W A;  3EQL F;  1QO0 D;  1DPU A;  2W24 A;  4MQ9 F;  3KE2 A;  2CO5 A;  1EH8 A;  4IJA A;  4G8X A;  1LQ1 A;  3E6D A;  1T2K A;  2P6S A;  4HX7 A;  1SD5 A;  1JGS A;  2EA2 A;  2VON A;  1IZ1 A;  5E1X A;  3TO7 A;  4I2O A;  4U0W A;  2IJL A;  3LAJ A;  3GFL A;  1BI3 A;  1REP C;  1T38 A;  1S6L A;  1O3T A;  3GFJ A;  3RPQ A;  4XBF A;  1G3S A;  1LDD A;  2XVC A;  2O61 A;  4YII A;  2ADU A;  4OU0 A;  1KU7 A;  1QPM A;  1ZAR A;  5E17 F;  5J8F A;  2Z9O A;  1IN7 A;  3T5X A;  2E7X A;  1BJA A;  5HS7 A;  4IPA A;  1ZRF A;  2VBZ A;  3K1P A;  3GZ5 A;  3ZN0 A;  1HKQ A;  4R79 A;  1U6G A;  2P8T A;  1UHW A;  4EQQ A;  2IVM A;  2VXZ A;  2STT A;  1LNW A;  3L7W A;  5KVR A;  4I98 B;  1G4D A;  3KLN A;  5HDN A;  5E1W A;  2GXB A;  3EDP A;  1U2W A;  3F8C A;  2MC3 A;  5F64 A;  4LLL A;  3HOS A;  1XSX A;  2DFI A;  5CVJ A;  1B4A A;  1GHC A;  1LDJ A;  3RYR A;  3CO6 C;  2XAG A;  1G3W A;  4I09 A;  2RKH A;  3BPV A;  1TQI A;  4LG0 A;  1SD7 A;  3U2R A;  5K5O A;  1BI0 A;  3GVA A;  3HOT A;  2ZXJ A;  5LEK A;  1U8R A;  1TTY A;  3RTR A;  1UHM A;  2M45 A;  5DYM A;  2CG4 A;  1GXP A;  4EJT A;  1E2X A;  4UUV A;  5HS9 A;  3EUH A;  3N4M A;  3P7N A;  3MZY A;  2EFW A;  1XGN A;  3MCZ A;  2QQ9 A;  4AIJ A;  3V8K A;  4HF0 A;  4WXD A;  3QU6 A;  2P5L C;  3EYI A;  2EA4 A;  1DP7 P;  5AIP A;  1XCB A;  2CYY A;  3E6B A;  2Y0M A;  1XD7 A;  2O6G E;  2M5W A;  3DF8 A;  2GQQ A;  4G6Q A;  5DEQ A;  4NQW A;  3TQN A;  3NEU A;  3FF5 A;  5HDK A;  3WTS C;  1T0F A;  2YSR A;  4CO8 A;  1SFE A;  4HDV A;  2RQP A;  4A0Y A;  3WE2 A;  4HW0 A;  2GIV A;  4D0P A;  3J81 Z;  4L0Z B;  4RB0 A;  4CHU A;  5DUK A;  3HYI A;  2P5K A;  4ENM A;  2P4W A;  1KU9 A;  2A5Y B;  5D4S A;  1LJ9 A;  3M9A A;  3FXQ A;  3GW2 A;  1WWX A;  3B02 A;  2EFQ A;  1FP1 D;  2V1U A;  1IN5 A;  3K1N A;  1OMI A;  3I4P A;  4EJW A;  4A0Z A;  2HKO A;  2VOP A;  2KIM A;  3I59 A;  3T0Y A;  3E6C C;  2ESH A;  1DDN A;  4UVB A;  1JHF A;  2O3F A;  5FO5 A;  5DD8 A;  2EFN A;  3ZMT A;  1PUE E;  4N9H A;  3T8R A;  4TV7 A;  3MEX A;  3D0S A;  2LNB A;  3DXJ F;  3R61 A;  4IRH A;  1MZB A;  3GZ6 A;  1HW5 A;  4UHT A;  4WXH A;  1ZLJ A;  1ZN2 A;  3BJA A;  4WF2 A;  1CF7 A;  2GWR A;  1YS6 A;  3REO A;  1MKM A;  3QRF F;  2H6C A;  3SZT A;  3LWF A;  4ETS A;  4YFK F;  2BGC A;  5D5W B;  4ESJ A;  3P9I A;  4HF1 A;  4QLC U;  3HSR A;  3WU0 A;  1HKT A;  3WTW C;  4HQE A;  3FZV A;  4LJZ F;  3EET A;  2VT2 A;  4A6D A;  1U5T A;  4IVN A;  1MJB A;  1S7A A;  1STZ A;  3FXR A;  2IP2 A;  3P9C A;  2H94 A;  5D5V B;  1FBQ A;  3IRR A;  2QBY A;  2FEZ A;  4EJO A;  2XAQ A;  1OPC A;  1WSU A;  4XLP F;  1UST A;  4YFX F;  4R8H A;  1KQ9 A;  1J9I A;  1V4R A;  4M6X A;  3R0A A;  1Z9C A;  4UXN A;  5BS6 A;  4RB2 C;  1HW1 A;  2JPC A;  3E6M A;  5ED4 A;  3CUO A;  3K0L A;  2V1D A;  2P6T A;  3I58 A;  2NNY A;  3FWE A;  3ABT A;  3VEP A;  2CSO A;  1ZGA A;  2ZNY A;  3JTG A;  1SD4 A;  4S04 A;  4OMZ A;  1UB9 A;  2EV0 A;  4BNC A;  2L01 A;  4EVI A;  3ZMU A;  1O3S A;  2GAU A;  3VOE A;  5DD4 A;  1U5T B;  3V8J A;  2DPU A;  4WCG A;  1MGT A;  1I5Z A;  4Z2Y A;  5D6E A;  5FGM A;  2G9W A;  4KN4 X;  1XB4 A;  2MA3 A;  1YTY A;  2QBY B;  1YLF A;  3KLO A;  4KUM A;  1EH7 A;  3J80 K;  2W57 A;  1Z05 A;  5CVR A;  1OKR A;  2HFH A;  4HLY A;  1FYM A;  5LRS A;  1R1U A;  1FSH A; 
#chains in the Genus database with same CATH topology
 3WOD F;  2V6E A;  3BZ6 A;  3O8H A;  1SMY F;  2R92 J;  4RDU A;  2R7T A;  3F3X A;  1WJ5 A;  1T39 A;  3KP4 A;  3VB2 A;  4B47 A;  1I6H J;  1YIT I;  1BIA A;  2F5D A;  1V5G A;  1V54 H;  1FMV A;  1K7A A;  1FIA A;  2XKP A;  2PMZ A;  2XSJ C;  2ZSI B;  4RGR A;  2YS9 A;  2KIF A;  4RGS A;  3ONQ A;  1L3L A;  1R36 A;  3DWL E;  2OQG A;  2ZB9 A;  4NC7 A;  4J00 A;  2CRG A;  3H3U A;  2H1K A;  4DNC A;  1OR7 A;  1MBH A;  4OAY A;  3AAF A;  3FKJ A;  3KIO A;  3GTP J;  2ZXH A;  4MLO A;  1VQ5 I;  1BOA A;  1JHH A;  4LFU A;  2OTL I;  3BG7 A;  5L3D A;  3C18 A;  4MNU A;  5LGN A;  4F55 A;  5FD5 A;  4ENK A;  2YU9 J;  4UB8 C;  4CSW A;  3WU2 C;  4FAS D;  2R5Y A;  3G1M A;  3NAR A;  1ETK A;  2Y2Z A;  1WZ2 A;  3ABL H;  3H3Z A;  3CMA I;  2XRN A;  1KQ8 A;  3I4M J;  3TDZ C;  2E2I J;  1J0R A;  2R7R A;  4M3G A;  3FM3 A;  3CLO A;  1ZKG A;  2XIG A;  5ILU A;  3NRV A;  2IS1 A;  2R3S A;  3ZMZ A;  4HZF A;  4LD5 A;  1LVK A;  2E71 A;  2K02 A;  1K4T A;  2EFO A;  1W7P B;  3F8M A;  1K83 J;  3QPT A;  4E70 A;  3H36 A;  2VBW A;  2ZKZ A;  1IDZ A;  3GXO A;  2B0L A;  4A12 A;  2E2H J;  1R6R A;  3AFH A;  5TRD A;  2BW3 A;  2QYO A;  3FXJ A;  2LKS A;  4NB5 A;  4BQA A;  1BBY A;  3IAS 2;  1X1D A;  2H1L A;  2XUB A;  1IRZ A;  3J81 K;  2K4B A;  2LD5 A;  2IGK A;  5D4R A;  1HSJ A;  2LY1 A;  2UXN A;  5L3F A;  3TED A;  2OQR A;  3VYU B;  2CW0 F;  3OIP A;  1P2F A;  2NS7 A;  3F6O A;  1U0J A;  3G1L A;  2YX4 A;  3DLA A;  2OZU A;  2NS0 A;  5FKL A;  1YIJ I;  5K5R A;  3PFY A;  4AIK A;  4IXA A;  1B8I B;  1B72 B;  5C4X J;  1D0X A;  3BC8 A;  4ESB A;  4UVC A;  2DQL A;  1KU3 A;  3ML6 A;  4CA0 A;  4OOI A;  3ZR8 X;  4ENJ A;  5LRR A;  5FKO A;  1XS9 A;  2PJP A;  3HPG A;  3ZQQ A;  3OYA A;  5LLQ A;  3LSI A;  4CZC A;  3UKG A;  2GXG A;  5FRM A;  4AUX A;  5J1Y A;  4FX4 A;  2JWT A;  1BN5 A;  4G6D A;  2GOM A;  4PFO A;  4ZZD A;  4IHX A;  3MVP A;  5ILS A;  4C3H J;  4QTR A;  2NRA C;  1WH7 A;  4PDK A;  4AC0 A;  1FIP A;  3CP8 A;  1Z7U A;  1ERD A;  2VKH A;  3RKY A;  2XHK A;  5H6R A;  4A2U A;  2A3S A;  3S2D J;  2PMU A;  1VQ7 I;  2E35 A;  1U5T C;  2LMD A;  4RAY A;  5DM7 F;  3PO3 J;  5A2Q Z;  1LEA A;  2JUC A;  3BR1 A;  3L2U A;  4B44 A;  5B1A H;  1G59 A;  2IRF G;  3I0T A;  4EM1 A;  4UVA A;  5EYR A;  4Q48 A;  2Z16 A;  3RJP A;  5CQE A;  1R9T J;  2MH2 A;  4QPO A;  1ZRE A;  4YG2 F;  3HUG A;  4PCQ A;  3DEE A;  4KN7 X;  3G4S I;  3G71 I;  3CUQ A;  2BYV E;  4XSX F;  4M72 A;  3HGG A;  3BCB A;  4KIB A;  3P9K A;  2DU9 A;  5J6X A;  4IQ4 A;  1Z77 A;  2Y9Z A;  3LFK A;  4IHW A;  2E1O A;  2HTJ A;  3BR0 A;  3D5L A;  2BBY A;  2JUG A;  2VPR A;  3I5U A;  3KEY A;  3LQR A;  1YOV B;  3HHH A;  4OIN F;  3BZC A;  4XLE A;  5KAF C;  3WTY C;  1USS A;  1G8X A;  2DA2 A;  2G7U A;  3QAH A;  3SHF A;  3NQO A;  1VFC A;  1P6R A;  1U3E M;  5ICE A;  5LEJ A;  1ZQ3 P;  3F8N A;  2HVQ A;  3O8G A;  4XK4 A;  1QHH D;  1A36 A;  3HOZ J;  3GF2 A;  1WJC A;  3LSJ A;  1TWG J;  2CGP A;  1KA8 A;  2NVX J;  2BE5 F;  1PUF B;  2DDB A;  3GCM A;  2A6E F;  2ZSH B;  1S7E A;  1YE9 A;  2BZT A;  3HJE A;  2HQ5 A;  2RRE A;  2G0E A;  1LFU P;  3CF5 F;  4HQM A;  2DW4 A;  4E7S A;  5M5Y J;  2JT1 A;  2DBB A;  2J5P A;  3GEZ A;  2K27 A;  3F6V A;  2R5Z B;  4WK8 F;  2HDW A;  4BKX A;  2VJ5 A;  1P92 A;  1XGO A;  3ZXS A;  2VE8 A;  1LUJ B;  3BY6 A;  3FBN B;  3GO5 A;  3GX4 X;  2IS6 A;  2CWE A;  2A6H F;  5ERI A;  5L3G A;  1YHQ I;  3A0B C;  2ELJ A;  1MNE A;  3ZP5 A;  4IZZ A;  3BPX A;  3ERM A;  2FMY A;  3OS2 A;  4BDZ A;  1CGP A;  3G3Z A;  2E36 A;  2OV7 A;  1IGN A;  4A3M J;  4QWQ A;  4LB6 B;  2HGC A;  3FM5 A;  4YIF A;  2CFX A;  4QIW N;  2EZI A;  2K9S A;  1TBX A;  4NHJ A;  5FFX A;  1BL0 A;  3GTM J;  2IPQ X;  2MYS A;  1WVR A;  1V5F A;  1MMS A;  1ON1 A;  5DCF A;  1JUP A;  3MN2 A;  2IS2 A;  2ZME A;  3HOX J;  1OYW A;  1H9T A;  3HC7 A;  1GUU A;  2V9V A;  4XLH A;  3K4C A;  4G94 A;  3S1R J;  3Q9S A;  4KJZ A;  4L9N A;  4I7H A;  4U88 A;  1XCV A;  3PQK A;  4MIM A;  4JQF A;  5ICF A;  3M3Y J;  2JTV A;  1IW7 F;  3HOV J;  5D8L B;  3OYJ A;  2HDC A;  2WTE A;  3IUO A;  2RN7 A;  3PQJ A;  2QVO A;  3H35 A;  1MJ9 A;  4F91 B;  3S1M J;  2O5R A;  1E3P A;  4XSZ F;  2OU2 A;  4JX5 A;  3D5R C;  2WAD A;  2STW A;  2KRF A;  1ZRD A;  3H9J A;  3ESW B;  2VLA A;  5DS9 A;  4KA4 A;  1F43 A;  1JT6 A;  2R7F A;  4N4O B;  5IYB J;  1SC7 A;  1X3W B;  3IKV A;  1K61 A;  1AWC A;  5LGT A;  1UFM A;  4B3X A;  2FXA A;  3KP2 A;  3FXL A;  2RDP A;  1K6O A;  4XOT A;  4MEY F;  2IA2 A;  2DFH A;  1X4P A;  5F0H A;  4XKW A;  3QP5 A;  4A93 J;  2ZFW A;  1P4X A;  4XN3 A;  1UEL B;  2F4O B;  2W84 A;  4X0G A;  1L0O C;  3Q5F A;  1RZ4 A;  4L9V A;  1HBX G;  3J80 Z;  3H3V K;  2VBY A;  3C3W A;  5EZH A;  5GTI C;  2K7L A;  1QZE A;  1HKS A;  4AWX B;  3WTT C;  1MH4 A;  1YJ9 I;  2Y0S A;  4IOC F;  2VOO A;  2D1H A;  1WH5 A;  4Y3O A;  4KDP A;  1IXC A;  1PP8 F;  1ZK8 A;  3MQ0 A;  1O4X A;  4D5C A;  1BA5 A;  5D5X B;  1FP2 A;  1YI2 I;  2WY8 Q;  5AON A;  3BRO A;  5D5U B;  4E7Z A;  1XTA A;  4QSH A;  5K5Q A;  3KZI C;  2M7A A;  4IOA F;  4NBQ A;  2OAZ A;  3OS1 A;  3GLL A;  3JRC A;  1RIO H;  2B9S A;  1NK3 P;  4C2T A;  3A03 A;  1LFB A;  1OCZ H;  2Z3Y A;  1ACI A;  5FRN A;  5LHH A;  4BHP A;  1G2H A;  5J47 A;  3S93 A;  2RVC A;  3K4B A;  3TO9 A;  3BWG A;  4BH9 A;  4BGD A;  1OCP A;  1ZRC A;  4ESF A;  4HNV A;  2BV6 A;  2NAZ A;  5IP6 A;  1P9Q C;  2VJI A;  1YFH A;  1MMG A;  1FMW A;  2DA6 A;  3L00 A;  1KQ0 A;  3NWT A;  5CLS A;  2VOD A;  5HLI A;  1O7L A;  3HKZ A;  2IA0 A;  4Y15 A;  2XF7 A;  3BTC A;  2K9N A;  1IUF A;  5E3L A;  4IQJ A;  4IEJ A;  5GAD J;  1O57 A;  3M8E A;  4ZYH A;  4P55 A;  2NXN B;  2QKL B;  2IW5 A;  3TBI A;  3V7R A;  4JX4 A;  4DZP A;  4DZJ A;  4CZZ A;  3PUB A;  3HXL A;  3O2P E;  4EMS A;  3IKT A;  2ZCW A;  1EF4 A;  2KKO A;  4RAZ A;  2XAS A;  1YW9 A;  4OIR F;  2EWN A;  2PFB A;  4BXF A;  5FB2 A;  5E3N A;  3H9Q A;  2L5Q A;  1S29 A;  4GXO A;  3KP3 A;  1OYY A;  3ZMV A;  5CYV A;  3VYR B;  4L5J A;  4A3F J;  2X6O A;  2KRH A;  3J7Y J;  3A0H C;  4MTE A;  1T33 A;  4JX6 A;  3L2C A;  3BP8 A;  3I9V 2;  3FKI J;  4XR6 A;  1Z3X A;  3ZQC A;  2PN6 A;  1I27 A;  1N25 A;  1S9H A;  1R4N B;  4LG0 B;  2OCE A;  4A3G J;  5ICG A;  5HLH A;  2PX9 A;  1W5T A;  5LGU A;  1B1B A;  2X6W A;  3QPS A;  4C2M J;  4RBO A;  3GTL J;  1GV2 A;  1T95 A;  1QBJ A;  3HOY J;  3I4N J;  3E5X A;  4IHS A;  4EV0 A;  4JK1 X;  1GVJ A;  1W1W E;  2HR3 A;  2L9S A;  4IX7 A;  4DGW B;  1J7K A;  4ON0 A;  3IWZ A;  3BG6 A;  3O6B B;  4NDL A;  4A3J J;  4HNT A;  3JR9 A;  1TQP A;  3F72 A;  2EPF A;  1UAA A;  5BQT A;  1RR7 A;  1ETX A;  3ASN H;  3M1C A;  3PUF A;  4UV8 A;  5ILV A;  4M3E A;  1A31 A;  3OIO A;  1K78 A;  1BR1 A;  1JTY A;  4CYD A;  3HOW J;  2FRH A;  1W0U A;  4O5V A;  5EGO B;  1SFK A;  2OA4 A;  5A2Q K;  5JVG F;  2CQ7 A;  1DQU A;  2IGM A;  2MBF A;  3DKY A;  3OV8 A;  1E3O C;  3WTZ A;  3K4K A;  2Y30 A;  5EEG A;  3VFZ A;  1SAX A;  3V4G A;  2K40 A;  4XOP A;  2BY0 A;  2KFD A;  1ORK A;  3TW6 A;  1X3U A;  4YFN F;  5FJ8 J;  1A5J A;  4CXF A;  1VND A;  2KRC A;  4NQW B;  4P9F A;  4EGY A;  3K10 A;  4KIT B;  4FHT A;  3CCJ I;  3U1D A;  4I0B A;  2EH3 A;  4XNF A;  1W36 D;  2VL8 A;  5E1Z B;  2M0M A;  3IP4 B;  4PZJ A;  1MJA A;  2CQQ A;  1FT9 A;  3V8L A;  3ABM H;  5K1Y A;  2QEN A;  2M0C A;  1ZG3 A;  2M3A A;  2KDO A;  4M73 A;  1J75 A;  2UXX A;  5FKK A;  1VQ9 I;  4LIU A;  2PEX A;  2MGQ A;  4ANJ A;  1R49 A;  2M87 A;  3FXM A;  3A01 B;  4PJL A;  1X1B A;  1Z1D A;  3BDD A;  2MD0 A;  1EKE A;  1BW5 A;  4LIT A;  3LSM A;  4Q5S F;  3JRA A;  3T8T A;  4II2 A;  1ODD A;  1JGG A;  3K9T A;  3FX3 A;  4XQF A;  4OIO F;  4Q4Z F;  1ITY A;  2KIQ A;  2JN6 A;  4GRI A;  2NYX A;  4XLN F;  3CCE I;  1QQI A;  4BL0 B;  2XB5 A;  4FET A;  1XPX A;  2DJN A;  5BOX A;  4BJ5 C;  9ANT A;  1F4K A;  2QKM B;  2ZBK A;  3MAJ A;  1ZLK A;  1VQ8 I;  4S05 A;  3ZN1 A;  2KIU A;  2L3D A;  5E8I A;  3IV5 A;  1HLV A;  4LK1 F;  2RNG A;  2EIK H;  2ZFU A;  3OR1 C;  1FPQ A;  2G7H A;  3HM5 A;  1QRY A;  1BJZ A;  1LB2 A;  1K78 B;  4DQ2 A;  1KYW A;  4GYG A;  3CF2 A;  4P9U A;  2HQR A;  3E3V A;  4KIF A;  3LSG A;  3I59 B;  2HYG D;  3TO6 A;  4G12 A;  2FQ4 A;  2X1C A;  2QF7 A;  2WB1 N;  4FX0 A;  2V4J C;  3DBH B;  1W0T A;  2J5O A;  2EQR A;  2MW8 A;  3E7L A;  3JSO A;  5FKN A;  5IY5 H;  4B1R A;  1MD0 A;  1XG1 A;  3SEZ A;  1SD6 A;  4M3B A;  1R1V A;  2DOE A;  2E19 A;  3GTG J;  4A3L J;  2L54 A;  1MW7 A;  3JTH A;  1SFX A;  1H8A C;  1D8J A;  1IAW A;  1JTX A;  1B59 A;  4EJU A;  3DPU A;  2ECC A;  3SXY A;  1OQY A;  1ZAO A;  1H9G A;  2WC2 A;  1J09 A;  5CVV A;  5D6F A;  2W85 A;  2WV1 A;  2LBF B;  1XSD A;  4BBS J;  5F0C A;  2GA1 A;  3M1E A;  2K86 A;  3CCM I;  4V2G A;  2DOF A;  3ASO H;  2K4J A;  1CF7 B;  5M5X J;  4CCM A;  2V9P A;  2IEK A;  2EZH A;  2ZNZ A;  5IP7 J;  1JT0 A;  2ZXW H;  4HSR A;  3ROU A;  3WGH A;  2CUZ A;  2P0W A;  1LEB A;  2WAQ A;  1OLT A;  3H0G J;  2M7B A;  3KFW X;  2FBI A;  1U78 A;  1DU6 A;  1F1Z A;  2RC4 A;  1ZYR F;  4EGZ A;  3OYI A;  2KLO A;  2W48 A;  2HYF A;  3A2K A;  4M9Z A;  3ZQI A;  4RLQ A;  3EUH C;  2L02 A;  2LVS A;  3D1N I;  2VE9 A;  3KEO A;  3IWF A;  4UNO A;  3OOP A;  3MKW B;  2KIS A;  2HWV A;  3RIR A;  1ZG5 A;  3LSR A;  2QSF X;  1MIJ A;  3SYT A;  3C2G A;  1NTC A;  5HS8 A;  1IF1 A;  3EUK L;  3LA7 A;  4XOR A;  1MBF A;  1SVM A;  3QP6 A;  2CQN A;  3RYP A;  4BY1 J;  1DU0 A;  2D45 A;  4XL9 A;  1XMA A;  2XAF A;  1MMD A;  3ZCO A;  1R23 A;  1I3A A;  1FWZ A;  4PK4 A;  3HRS A;  5FLX Z;  2ME0 A;  4L18 B;  2L4M A;  3NAU A;  2COM A;  2ECB A;  1FC3 A;  3BJ6 A;  1X19 A;  1BI2 A;  3OYE A;  1EA3 A;  3F8F A;  4M71 A;  3HSE A;  1IO2 A;  1AKH A;  4LGW A;  2F2E A;  3GWZ A;  3RPU D;  3DPL C;  4ZDL A;  4XRS A;  1SFU A;  5DM6 F;  2DMT A;  2JA5 J;  1ONV A;  3K4N A;  1QA6 A;  3I71 A;  1TNT A;  2XRO A;  4PGH A;  1YQA A;  1XX5 A;  1G3T A;  2X6X A;  3OSF A;  3QOP A;  4IHY A;  1TLH B;  1T0F C;  2AQE A;  3HRM A;  2PBI A;  1XGM A;  4G7Z F;  4I0A A;  1OYI A;  4GCV A;  1Z3Y A;  3SFZ A;  4N4N B;  4HOB A;  3R6S A;  4ITV A;  1UJ8 A;  2HZT A;  2QEX I;  2HVR A;  3ERE D;  1T98 A;  3GBG A;  3K69 A;  3RKQ A;  4OIP F;  4PJN A;  4ZC3 A;  4IHT A;  3BJO A;  3S3M A;  1LE8 B;  4OWR B;  1VZ0 A;  1R5G A;  2QUF A;  3IC7 A;  4DW6 A;  1BR2 A;  5LHI A;  2F5F A;  2TDX A;  3TL4 X;  3JRF A;  4HA8 A;  4E4H A;  1GXQ A;  3B6C A;  4LB5 A;  3S3N A;  2OPT A;  2ZJR F;  2XKO A;  1TNS A;  4XKC A;  3LAP A;  3JRG A;  5E20 A;  4ZDO A;  5BPI A;  4IRI A;  2FQ3 A;  2DOD A;  3AG2 H;  3WGG A;  3MKY B;  1IRG A;  3PL8 A;  2IGN A;  2HTS A;  2LDU A;  2DLL A;  2UWM A;  1WJF A;  3KEQ A;  1T8I A;  4E7J A;  2FU4 A;  4P96 A;  1RPW A;  3HIF A;  4C30 A;  1OFC X;  1TT5 B;  3GYH X;  2HNH A;  2ESN A;  2HXO A;  3TKY A;  2F4M B;  3HHG A;  4R1H A;  3TOB A;  3RZD J;  3V7C A;  2XGX A;  1WJA A;  1ETW A;  2CUJ A;  1P4A A;  2OF7 A;  4RA2 A;  1BM9 A;  2LY9 A;  2OUM A;  3Q0W A;  4E7L A;  1CQT A;  3F21 A;  3HPH A;  1S3J A;  2XB0 X;  3PIP F;  4LOC A;  2Q8K A;  1J59 A;  4GDF A;  2QM3 A;  4A5M A;  2HOA A;  4M9S A;  4RLF A;  1I3Q J;  1BR4 A;  3FIW A;  2E34 A;  2AS5 F;  4CCN A;  2E60 A;  1MBK A;  2UZK A;  4JOM A;  2EV5 A;  3SDB A;  4P5O A;  4LK0 F;  3MFK A;  5IT9 K;  2JRM A;  2EV6 A;  2VXD A;  4XM3 A;  3CMY A;  5CKT A;  1NG7 A;  2JA2 A;  1FSE A;  1S8N A;  2KZG A;  2XAH A;  1TQM A;  1FBU A;  2Y69 H;  4BAY A;  4AYB A;  4O3M A;  3ECO A;  4ZDP A;  2DXI A;  1YJW I;  2BVL A;  3L2R A;  2PLY A;  1VI0 A;  2R5Y B;  2XGC A;  1W7P D;  5GAH J;  1RNL A;  3JSP A;  5F0F A;  4EM2 A;  3SEQ A;  4BQN A;  1IUY A;  1WPK A;  2ZJQ F;  1FBS A;  1HCR A;  2L7M P;  1JXS A;  2DA3 A;  5GTH C;  2V79 A;  4G7O F;  1YJN I;  2VPL A;  3PJR A;  5J8C A;  4C3I J;  2FD5 A;  2E1M B;  2VIX A;  1R5H A;  4DYR A;  1FLI A;  1AOY A;  2QQ8 A;  3R60 A;  5HOO A;  2Y75 A;  1Z7L A;  3G73 A;  2FUG 2;  2VKD A;  2H8W A;  1FX7 A;  3KZZ A;  2FF4 A;  1S5L C;  2XAU A;  4XN0 A;  1P4W A;  1DUX C;  2W4S A;  1Z91 A;  1R7J A;  4BHB A;  3S16 J;  3BTI A;  2BW3 B;  4WWC A;  3VPR A;  1I1S A;  3R4K A;  4EJV A;  4HRI A;  4A0X A;  4HBL A;  2AQF A;  2L9R A;  1D8K A;  5TGT A;  1H0M A;  1R00 A;  1XN7 A;  3KYD B;  4B43 A;  3CTA A;  3FXU A;  2PJR A;  1TWF J;  3DTK A;  3JRD A;  2MFZ A;  4N9I A;  3S1N J;  3OL4 A;  3CQZ J;  3BR6 A;  5IP9 J;  1BC8 C;  3RZO J;  4M74 A;  1IN6 A;  2VKE A;  2MAB A;  2BHZ A;  2A69 F;  2WAF A;  1KZH A;  3OYK A;  2MH9 A;  3CJN A;  1FNN A;  1GDT A;  4X6A J;  3ZQ7 A;  3BQZ A;  5CVI A;  2CUF A;  4UUS A;  2LYC A;  3ULQ B;  5EG0 A;  3Q9V A;  3HL2 A;  3PSF A;  2KJB A;  4I99 C;  2K85 A;  2LKX A;  2H6B A;  2CS3 A;  2WA0 A;  4KMU X;  4XON A;  4A69 C;  1M1E B;  4LLN A;  4J01 A;  1TWH J;  3CC4 I;  2DAO A;  5C44 J;  2WWY A;  3HTS B;  2M8E A;  1ZHF A;  1Z21 A;  3C1D A;  2HPI A;  3E5Q A;  4DJA A;  1IV8 A;  5LFA A;  2BEO A;  4H4K C;  2K5C A;  3H92 A;  2O03 A;  5DCM A;  1K79 A;  2KL4 A;  2O9L A;  1YS7 A;  1ON2 A;  3C2B A;  2ACJ A;  2OBP A;  1WRJ A;  2IGO A;  1GLN A;  1VQO I;  4MQV A;  3GTJ J;  1W5S A;  3E5U A;  2A61 A;  2DA5 A;  3GUD A;  2L4A A;  3A4C A;  3CLQ A;  4BQO A;  1IRF A;  5IYC J;  2VKV A;  5J3L A;  3T1B A;  4E7I A;  4G9Y A;  4WX9 A;  4BDY A;  5F1J A;  3HUG B;  2Q0O A;  2Q1Z B;  3QYF A;  3UNG C;  3EYY A;  1ZG1 A;  2OCC H;  1IC8 A;  1XMK A;  2VI6 A;  3CUQ B;  1YO5 C;  5CPR B;  3WHC A;  3LFU A;  3CJT B;  2Y31 A;  5CVU A;  2R7V A;  5D8K B;  3PSI A;  2X4H A;  3WTV C;  1NHA A;  3CJQ B;  1NG6 A;  2YPR A;  3K2A A;  4HV5 A;  2LR8 A;  3OYM A;  2FOW A;  2L7F P;  2NVT J;  2F6C A;  2NNN A;  1VTN C;  3OY9 A;  2OJE D;  3OOU A;  3F22 A;  2Z1D A;  1B9N A;  3JRI A;  2JZY A;  1POG A;  3TGN A;  3LSH A;  2AXT C;  4HNU A;  4II3 A;  5E18 F;  3DFG A;  1W4M A;  1V5E A;  2LSO A;  2M1B A;  4AU7 A;  4UV9 A;  2CUE A;  4MTD A;  3L2W A;  2QCO A;  1QU3 A;  3IL2 A;  5E3M A;  5B3S H;  1OR7 C;  3GTO J;  2Y9Y A;  3GFI A;  4B8X A;  3QYE A;  3PFI A;  3OYL A;  3OYC A;  4ZYA A;  1XC5 A;  2DDA A;  3F9K A;  2DYR H;  2DYS H;  4C3J J;  5H20 A;  1D5V A;  5AIQ A;  2E1C A;  1GT0 C;  5FRO A;  5DCM B;  2QZ8 A;  1QZZ A;  3Q0V A;  2LK2 A;  5L3C A;  4WXC A;  4HX8 A;  3CCS I;  1V3F A;  3OL3 A;  1IN8 A;  1KON A;  2M34 A;  1OCT C;  2FNP A;  5FLX K;  4IF4 A;  5C4J J;  5JFR A;  4A3I J;  1HXD A;  4LLG F;  3TMO A;  1QPI A;  3MMY B;  2EK5 A;  3FDY A;  5L3B A;  1WI3 A;  3VOD A;  4HLX A;  3ZQH A;  1HOM A;  2B7E A;  3TDU C;  4ZYE A;  2E1M C;  4O6J A;  2LG4 A;  1TT0 A;  2CQX A;  1Q1H A;  2GLO A;  3OWT A;  1DPR A;  1Z6T A;  5DUI A;  4YIR X;  2VC1 A;  5JLW A;  3TOA A;  3GTQ J;  3U9G A;  3PM1 A;  1MNM C;  1KYZ A;  4GO1 A;  5TIS C;  4XLC A;  3JRH A;  2XAJ A;  1R5I D;  2FBK A;  1KGS A;  2DMN A;  1WCM J;  2DT5 A;  2ZME B;  5DDG A;  2O7O A;  4CYC A;  1S7O A;  2LKP A;  2W82 A;  2FML A;  3OSG A;  5EZG A;  3S17 J;  2OTJ I;  1PVE A;  5HLG A;  2H27 A;  3CDH A;  1FY7 A;  1H89 C;  1A6I A;  1RKT A;  1RUO A;  4RMN A;  3OYN A;  4CCO A;  3VYS B;  4Y52 J;  3E97 A;  3GLX A;  3LQQ A;  1BIB A;  4G7H F;  4LIV A;  4A6E A;  1AU7 A;  3OR2 C;  1VQ6 I;  1UG2 A;  3DKW A;  1QHG A;  2RGV A;  3R0J A;  2VQG A;  4JBA A;  4XRS G;  4BHC A;  1R71 A;  3RQI A;  4AD9 A;  5ICC A;  1PP7 U;  5IOZ A;  2ETH A;  3S2W A;  1RUN A;  2VN2 A;  1U9O A;  5K7F A;  2X9D A;  3IH3 A;  4B3A A;  2R7S A;  1O3Q A;  3AG3 H;  1YX3 A;  2I8D A;  4KIC A;  1LDK B;  1X2M A;  3L9F A;  3RQ4 A;  1FOY A;  4CUG A;  2R0Q C;  1Y0U A;  4F3Q A;  1WJB A;  2ZO4 A;  2V26 A;  3M8F A;  1Y56 A;  2BVM A;  2PMZ N;  4YRV A;  2KP6 A;  2ICW G;  5K7H A;  1EH6 A;  3JRE A;  1IXS B;  1YRN A;  3WTX C;  4HV6 A;  1OCR H;  3EUA A;  4I01 A;  1I39 A;  4UY8 I;  3CES A;  2OD5 A;  4HF2 A;  3JAM Z;  2D1V A;  4HPQ A;  4KIG A;  3S32 A;  2MLG A;  3IRQ A;  3BG9 A;  2VAS A;  3BTJ A;  4FE7 A;  3RDI A;  1O3R A;  3WU1 B;  1D0Y A;  3C2H A;  2MC4 A;  3FXO A;  4L9T A;  4LG3 A;  4ZZL A;  1SMT A;  4L0Y B;  1I50 J;  2Z5U A;  3CUQ C;  3C7J A;  4L9J A;  4XID A;  4KMF A;  2JPB A;  2JA8 J;  2DPD A;  1HST A;  3ISP A;  5E79 C;  1X58 A;  2JJ7 A;  2AHQ A;  2LRD A;  2DMP A;  6PAX A;  2X6Y A;  4ABZ A;  1ZTR A;  2IBD A;  4I76 A;  4EM0 B;  4ZYD A;  3X2Q H;  3DKX A;  1JE8 A;  2RV8 A;  2LP0 A;  4BBR J;  2JA7 J;  4I02 A;  5IT9 Z;  2JA6 J;  2FNA A;  3BG5 A;  4MEX F;  2P5V A;  4PJ0 C;  4BUP A;  4NUB A;  5GAG J;  2V1X A;  4CH7 A;  2K9Q A;  3CP2 A;  3HRT A;  4MFE A;  5KNL A;  2CQK A;  2RNJ A;  3L09 A;  3OYD A;  3KP7 A;  4S0H B;  2KPM A;  4RB1 A;  3DEU A;  3RKX A;  3H0D A;  3LNQ A;  1UHS A;  2QGU A;  3I3L A;  3W6K B;  4XKB A;  1BW6 A;  2BY2 A;  2DTR A;  2NOG A;  5IOY A;  4ZTJ A;  3DCF A;  2QSH X;  3FHN A;  3ABU A;  4XRF A;  1YW7 A;  3LA2 A;  5DTD A;  3VWB A;  5BPD A;  2XPV A;  3JCU C;  5FD6 A;  1MSE C;  3LST A;  1WFX A;  4BAC A;  1FYK A;  4N0B A;  5KAI C;  1TWA J;  4ASN A;  3HTU A;  3EPZ A;  1ZGJ A;  2LLK A;  4F7Z A;  1IXR C;  1YRN B;  4W1U A;  1B9M A;  2A68 F;  2Q2E A;  4K2E A;  4FT8 A;  1LVA A;  2R7D A;  3WHB A;  1X1P A;  2HKX A;  3KX2 A;  5TJJ A;  4RS8 A;  2HQN A;  2HS5 A;  4Y17 A;  1YYV A;  2EIL H;  3CDL A;  2Z33 A;  2NVU B;  1F5T A;  2JVG A;  2LF8 A;  3A02 A;  1OCO H;  2E7W A;  5L3E A;  1FYL A;  4C2U A;  2XV4 S;  1XSV A;  2O0Y A;  1JKO C;  3ZRG A;  1FOK A;  3I53 A;  5LHG A;  1MBJ A;  2KQR A;  3L1P A;  3I54 A;  1FZP B;  2K9L A;  3K4L A;  1HF0 A;  3WE3 A;  3CCQ I;  2QSG X;  3KZY A;  5EEH A;  1ZH5 A;  2CW8 A;  3B73 A;  1RRJ A;  4D7M A;  1A04 A;  1T6S A;  2ZME C;  3Q3S A;  1TL8 A;  1MDM A;  2CU7 A;  2JSP A;  4AVP A;  3BOQ A;  1YW8 A;  3HEF A;  2F5C A;  3DBR B;  4L5I A;  4KYW A;  3RPU A;  5EJC A;  2ZJ2 A;  3OYB A;  1NK2 P;  1X4O A;  3MZ8 A;  2DQR A;  2V6C A;  1WQ2 A;  3DQV C;  2BY3 A;  2UV1 A;  3BG3 A;  4RB3 C;  3CCL I;  3FHZ A;  3Q0U A;  3VSK A;  2IT0 A;  2HU9 A;  1RR8 C;  3CD6 I;  2MLK A;  5KCM A;  1WKM A;  5KK1 A;  2V7F A;  3AG1 H;  1MBE A;  1PDN C;  2KMU A;  3H5N A;  1U9N A;  1YIO A;  2LY2 A;  4IO9 F;  4BXX J;  4XKV A;  4MHG A;  1J2X A;  2UUZ A;  4X1E A;  2MSY A;  4PJJ A;  2HXI A;  4D9J A;  3MZH A;  1HQC A;  4OIQ F;  1TW3 A;  2RAE A;  2Q2E B;  3K2Z A;  1ENH A;  3CJR B;  4RAG A;  2PG4 A;  2CV1 A;  1R1T A;  4ZH4 F;  3MKL A;  1XGS A;  3CCU I;  2EJR A;  2L9V A;  4LMY A;  5F1R A;  3ZQL A;  4ZTF A;  3W6V A;  3V42 A;  3DV8 A;  1TZL A;  4IRG A;  5HDG A;  3QPH A;  1VQK I;  4CIC A;  1FEX A;  2TRT A;  3P5J A;  1FOX A;  1QZY A;  1N77 A;  2X85 A;  4KT5 C;  3S8P A;  2F48 A;  1IJW C;  2VUM J;  3RSN A;  1R58 A;  1MDM B;  1UMQ A;  1XMX A;  1RKW A;  3GME A;  1T08 B;  2IS4 A;  2XRL A;  2JQ7 A;  3JW4 A;  2DK8 A;  2A07 F;  2HDD A;  2ELK A;  2XDV A;  3LSK A;  2YX7 A;  2GZW A;  4Q47 A;  4HDU A;  1ZR2 A;  2WAE A;  4A3E J;  2ISZ A;  3JRB A;  2AXL A;  4PJM A;  2JMW A;  3IHU A;  3ZGK A;  5JR3 A;  1B6A A;  5J1R A;  2Z99 A;  3CMM A;  1N78 A;  3J7A O;  1HDD C;  1JJ8 C;  3CDI A;  2W25 A;  3K6G A;  3KET A;  2DN0 A;  3BTL A;  5JVT A;  3G2B A;  2O8X A;  3DLL F;  3KCC A;  3WG9 A;  2F5V A;  4PUS A;  2DO7 A;  5IT3 A;  2HOE A;  3PIO F;  3S14 J;  4KNY A;  2PQ8 A;  2QLZ A;  3HGY A;  3IH4 A;  4BYY A;  4HAM A;  3KP6 A;  3FMR A;  5JHF A;  3M8J A;  1W7P A;  2QWW A;  1SEU A;  2ELH A;  4Y13 A;  1G6N A;  2CV2 A;  3QOE A;  2R7O A;  2OZ6 A;  4NC6 A;  4ZYG A;  4A5N A;  3AKZ A;  5IPA A;  4V19 K;  5LD2 C;  1Y8R B;  2GA2 A;  1X2N A;  2IA1 A;  2B63 J;  4DYC A;  1Z67 A;  4HYE A;  2H09 A;  4M6V A;  1AHD P;  4P1W A;  3KP5 A;  2W00 A;  2X51 A;  2MD5 A;  3A1Y A;  4HG2 A;  3BT9 A;  4U0V A;  1JKR C;  1QNT A;  3L2Q A;  2H8R A;  4M6Y A;  1EJ9 A;  3ZPL A;  1I6X A;  3BCA A;  2HOT A;  4A3D J;  1D1C A;  2DA1 A;  1XDU A;  5M5W J;  1A35 A;  3OYH A;  4OMY A;  4RGU A;  4DYQ A;  5B66 C;  5CJ9 A;  3OS0 A;  3SZP A;  4U0Y A;  5F6F A;  5HVQ C;  1EV7 A;  3PNV A;  1B8I A;  2P7V B;  1B72 A;  2V1N A;  1XDS A;  2C6Y A;  2HI3 A;  1D3Y A;  4OAZ A;  3S15 J;  5FFZ A;  3BR5 A;  1OCC H;  2X0L A;  3WG7 H;  3F23 A;  3GTK J;  2L7Z A;  4BXU A;  3M7G A;  3I64 A;  2VB6 A;  4H0E A;  2Y0S N;  1UG0 A;  2EFP A;  1J5Y A;  2ZXI A;  2FA5 A;  1IN4 A;  2F4I A;  2CJJ A;  3W6J B;  1DP3 A;  1KU2 A;  2JSC A;  2FX0 A;  3CO7 C;  4AIH A;  2FOK A;  3WGI A;  3N97 A;  4U87 A;  1SFO J;  4M9X A;  3VSL A;  4W97 A;  3DP7 A;  5E8G A;  2FJ1 A;  2KJC A;  2QQA A;  3IAM 2;  2QQB A;  3JAM K;  4CCL A;  2JRT A;  1WGX A;  1E3H A;  5J4Y A;  3COA C;  2LH9 A;  2X1D A;  4KT6 A;  1GVD A;  1AKH B;  4MFD A;  4UB6 C;  2FBH A;  3FBI B;  4U7D A;  2EB7 A;  1RES A;  2XGE A;  1TWC J;  3MWM A;  4D1Q A;  1IDY A;  2L0K A;  3QQA A;  3V7S A;  2E1N A;  3FMQ A;  3WTU C;  3FK6 A;  5J1U A;  3DTE A;  3MKZ A;  4ENN A;  2ID6 A;  3ELK A;  4Y4R A;  2VQH A;  2NVY J;  3K7A J;  3CC7 I;  1SAN A;  2ISY A;  1PYV A;  4CGZ A;  5LBQ A;  1X1C A;  2IAI A;  5H6Q A;  1DGW Y;  3HKZ N;  4DOZ A;  1BC7 C;  4U7B A;  4E7H A;  2WV0 A;  4CDG A;  3J7A Y;  2QA4 I;  3K4M A;  2WBM A;  5EDN A;  1TW2 A;  1F9N A;  1N75 A;  2M4K A;  3RI4 A;  1X1A A;  1ULY A;  2KHM A;  3HRU A;  2HYJ A;  3AL0 B;  4RM3 A;  1UCR A;  1ETY A;  1SAU A;  1C0W A;  2XPW A;  3HSF A;  1WJD A;  1PUF A;  4MGR A;  2PI0 A;  4I6Z A;  4BE1 A;  4M3F A;  4A3K J;  1G3Y A;  3ZQG A;  3FK7 A;  5EF6 A;  1JUM A;  2I10 A;  4HX4 A;  3CME I;  1O7F A;  3GFM A;  2XSD C;  3ZMS A;  1E17 A;  2R5Z A;  4DBQ A;  1YG2 A;  1RI7 A;  2DI3 A;  4L5E A;  5JI6 A;  5JHU A;  2VC0 A;  3OMY A;  2PMH A;  2DFF A;  3DU6 A;  2VBX A;  2JK3 A;  2BY1 A;  4KFC A;  2NS8 A;  4B09 A;  1VQ4 I;  2E5Z A;  5C3E J;  2F5E A;  1RC9 A;  4GYI A;  4BJT A;  1VF9 A;  4F93 B;  1HC8 A;  2YR2 A;  3IH2 A;  3RKW A;  2LF7 A;  2JVH A;  1WI9 A;  3F8B A;  2M30 A;  5DV5 A;  1HW2 A;  2NVQ J;  1QVT A;  3BR3 A;  2Y48 A;  3DPT A;  4GGG A;  1Q1V A;  3KYL A;  4XLA A;  1MMA A;  3U1K A;  5B1B H;  2FE3 A;  2R7U A;  1BI1 A;  4PGG A;  1X3Z B;  2WB1 A;  3SQN A;  2KDZ A;  3J7Z I;  3K1M A;  1D0Z A;  2EIM H;  3M07 A;  3CCV I;  1Z6R A;  3LA3 A;  3D5S C;  2MG4 A;  3BQY A;  3ZMD A;  2FSW A;  2VT3 A;  1IG7 A;  1QGP A;  3O3K A;  3QU3 A;  3ECH A;  3QYB A;  5KHD A;  2BHY A;  2HEO A;  2GM4 A;  2DK5 A;  2P7C B;  4RGX A;  2HOS A;  4IL6 C;  1R22 A;  2YU3 A;  3HB9 A;  3FMS A;  5BMZ A;  5E3O A;  2XC7 A;  1I1G A;  2CW7 A;  2D2W A;  1JJ6 C;  3EQL F;  1QO0 D;  2DJI A;  1K4S A;  1DPU A;  2W24 A;  2DCE A;  4MQ9 F;  1FTT A;  3KE2 A;  2CO5 A;  4DBR A;  1EH8 A;  4IJA A;  4G8X A;  1LQ1 A;  1MH3 A;  3E6D A;  1T2K A;  2P6S A;  4B48 A;  1JUS A;  4BY7 J;  4HX7 A;  4IHV A;  2VJ4 A;  1SD5 A;  1JGS A;  1JI8 A;  2EA2 A;  5JLX A;  2VON A;  1IZ1 A;  5E1X A;  3TO7 A;  4I2O A;  5H2F C;  4U0W A;  2IJL A;  3LAJ A;  3GFL A;  1BI3 A;  3W2W A;  2M4G A;  2VQC A;  1T38 A;  1REP C;  1S6L A;  3N05 A;  1O3T A;  3GFJ A;  4KIS A;  2PJR B;  5GAE J;  3RPQ A;  2L2O A;  3DBL B;  3ZQF A;  1Z0X A;  1F36 A;  4HST A;  3H1C A;  4XBF A;  4NNJ A;  5FLM J;  1G3S A;  1LDD A;  3DTI A;  4AM3 A;  4M3D A;  2XVC A;  4XLF A;  2O61 A;  1FJL A;  4YII A;  2ADU A;  4OU0 A;  4D7N A;  1KU7 A;  4UUS B;  1QPM A;  5EG0 B;  1ZAR A;  5E17 F;  5J8F A;  2Z9O A;  1ZR4 A;  1IN7 A;  3T5X A;  2E7X A;  3BR2 A;  1BJA A;  3M4O J;  5HS7 A;  4IPA A;  2R7X A;  1ZRF A;  2VBZ A;  5HLT A;  3K70 D;  1R4M B;  3HBL A;  2EZL A;  2GOX B;  4Y33 A;  3K1P A;  3GZ5 A;  3ZN0 A;  1HKQ A;  2M8G X;  4R79 A;  3W3C A;  3LL7 A;  3SZG A;  1U6G A;  4AID A;  2P8T A;  1UHW A;  3QOD A;  2IVM A;  4EQQ A;  3AL0 C;  3HG9 A;  4JYK A;  3TP0 A;  2VXZ A;  4XIC A;  3QPL A;  3CC2 I;  2STT A;  1APL C;  1T56 A;  2V9K A;  1LNW A;  3L7W A;  4YEJ A;  3UR3 C;  2I5U A;  3S3O A;  5KVR A;  3FIS A;  5J4V A;  4I98 B;  2LOO A;  2LC2 A;  1G4D A;  3KLN A;  2W1O A;  5HDN A;  5E1W A;  2GXB A;  3EDP A;  3HOU J;  2WAQ N;  2O8K A;  2L7K A;  1U2W A;  3F8C A;  1LFP A;  2K3F A;  1SVO A;  2MC3 A;  5F64 A;  4LLL A;  3HOS A;  3MD2 A;  1XSX A;  2DFI A;  5CVJ A;  1B4A A;  1GHC A;  1LDJ A;  3RYR A;  1D1B A;  3OIQ A;  2DMU A;  1LKX A;  3CO6 C;  2XAG A;  1G3W A;  4I09 A;  3KYC B;  1FTZ A;  2RKH A;  3BPV A;  4Y7N J;  1TQI A;  1Y1V J;  4UUT A;  1SD7 A;  3G1O A;  4LG0 A;  3U2R A;  2BXZ A;  5K5O A;  1BI0 A;  2EIN H;  3SFI A;  3GVA A;  4GFB A;  3HOT A;  2ZXJ A;  5LEK A;  3I56 I;  1U8R A;  1TTY A;  3RTR A;  1UHM A;  2M9H A;  1Y1W J;  1H88 C;  2M45 A;  5DYM A;  2CG4 A;  2ME6 A;  1GXP A;  4EJT A;  1E2X A;  4DIQ A;  1HDP A;  4UUV A;  5HS9 A;  5GP9 A;  3W2A A;  3EUH A;  3N4M A;  3P7N A;  3RCO A;  3VYT B;  2EZK A;  3MZY A;  3F0C A;  2EFW A;  1XGN A;  1NH3 A;  2DMQ A;  3MCZ A;  2QQ9 A;  3QWL A;  4CCJ A;  2VJJ A;  2LTP A;  4AIJ A;  3V8K A;  4B4C A;  3H5A A;  1D5Y A;  4HF0 A;  4WXD A;  4JP0 A;  3QU6 A;  5EGO A;  2P5L C;  4E7K A;  2X1E A;  3EYI A;  2EA4 A;  3S2H J;  1DP7 P;  3K70 C;  5AIP A;  5GPC A;  2LFB A;  3PO2 J;  1XCB A;  2CYY A;  3E6B A;  2Y0M A;  2CV0 A;  1XD7 A;  2O6G E;  2M5W A;  1OJL A;  3DF8 A;  2GQQ A;  1VQM I;  4G6Q A;  1GV5 A;  5DEQ A;  1E0E A;  2X48 A;  4NQW A;  3TQN A;  5K7Z A;  3NEU A;  2Z2S B;  3FF5 A;  2OC6 A;  3SDG A;  3PNY A;  5HDK A;  3WTS C;  4CYC B;  1T0F A;  2YSR A;  2CMP A;  4CO8 A;  1SFE A;  3E1S A;  2HZD A;  2XPU A;  2RQP A;  4HDV A;  2R7W A;  5HNF A;  1RET A;  4A0Y A;  3WE2 A;  4HW0 A;  2AO9 A;  1LPQ A;  2GIV A;  4D0P A;  3J81 Z;  3A01 A;  4L0Z B;  4RB0 A;  4CHU A;  1V55 H;  5DUK A;  3HYI A;  2CFO A;  2DA7 A;  2A05 A;  2P5K A;  3CCR I;  4ENM A;  2P4W A;  4E6K G;  4PFP A;  4CCK A;  3TP3 A;  5HNH A;  1KU9 A;  2A5Y B;  5D4S A;  2KZV A;  1LJ9 A;  4F52 A;  2CH0 A;  2GIZ A;  1FOW A;  2IXS A;  3M9A A;  3FXQ A;  3GW2 A;  1WWX A;  3B02 A;  3G6E I;  2EFQ A;  1FP1 D;  2V1U A;  1IN5 A;  4QPQ A;  2TCT A;  3DEW A;  5F27 A;  4BU2 A;  4BJ6 C;  4PSW A;  3K1N A;  1OMI A;  1UZC A;  3I4P A;  4EJW A;  2COB A;  4A0Z A;  2BXY A;  2HKO A;  1P7J A;  4MO7 A;  2VOP A;  2KIM A;  2DT6 A;  3I59 A;  3T0Y A;  3VDX A;  2NOJ B;  3E6C C;  2ESH A;  1OIS A;  3CCY A;  3TW7 A;  1U8B A;  1DDN A;  1ZEL A;  4UVB A;  1JHF A;  1WJE A;  2XGD A;  2M2E A;  2R7Q A;  2O3F A;  5FO5 A;  4NC8 A;  5BNG A;  4EEF G;  3OYF A;  1Y39 A;  2K3P A;  1K6Y A;  5DD8 A;  2GXA A;  4XMY A;  2EFN A;  2N8G A;  4RAF A;  3ZMT A;  4N9H A;  1ETQ A;  3T8R A;  1PUE E;  4YEL A;  4TV7 A;  1D1A A;  4AYB N;  3DU5 A;  3MEX A;  3D0S A;  2LNB A;  3DXJ F;  3R61 A;  4IRH A;  1MZB A;  3LMM A;  3GZ6 A;  5CQG A;  3PNT A;  3CZ6 A;  3I55 I;  5EEA A;  3SJM A;  2DOA A;  2ZJP F;  3GZN B;  3LSP A;  1HW5 A;  4UHT A;  2LBF A;  1VQL I;  4WXH A;  1ZLJ A;  1ZN2 A;  3BJA A;  4WF2 A;  1CF7 A;  2GWR A;  4BS9 A;  1YS6 A;  3REO A;  3ZOB A;  4F92 B;  1MKM A;  2XF5 A;  1ETV A;  3QRF F;  2H6C A;  3SZT A;  4IKF A;  3LWF A;  4ETS A;  4YFK F;  2BGC A;  5D5W B;  4ESJ A;  3HDD A;  3P9I A;  4HF1 A;  2A6T A;  1IRX A;  4BQQ A;  5IYD J;  2R4G A;  1DGR M;  4QLC U;  3S1Q J;  2HPM A;  3H5R A;  3HSR A;  3WU0 A;  1HKT A;  3WTW C;  2BOL A;  4HQE A;  3FZV A;  1Y6I A;  4LJZ F;  3EET A;  4XRM A;  4BE0 A;  1PJR A;  2VT2 A;  4BE2 A;  1JKQ C;  4A6D A;  1A6Q A;  1HA8 A;  1U5T A;  4IVN A;  1VQN I;  1MJB A;  1VQP I;  2YUS A;  1S7A A;  1STZ A;  3FXR A;  2IP2 A;  1IV6 A;  3KPH A;  3P9C A;  2H94 A;  2LRE A;  1FBQ A;  5D5V B;  3IRR A;  1W5C C;  2P81 A;  4RM2 A;  3U21 A;  4HEA 2;  2QBY A;  2D5V A;  2FEZ A;  4EJO A;  2XAQ A;  3NWS A;  2L9N A;  5GPA A;  1OPC A;  2DTZ A;  1MMN A;  1WSU A;  4XLP F;  4BEH A;  1UST A;  4YFX F;  1QVU A;  4R8H A;  1TP4 A;  3K4J A;  5FKM A;  1KQ9 A;  5F08 A;  1J9I A;  1V4R A;  1SVL A;  4M6X A;  3R0A A;  1Z9C A;  1JKP C;  4UXN A;  4D5F A;  5BS6 A;  4RB2 C;  2R93 J;  1HW1 A;  3BZK A;  2R7Z J;  2JPC A;  3E6M A;  4FCY A;  5ED4 A;  3E0J B;  3CUO A;  1WHU A;  5HOD A;  3K0L A;  2RQQ A;  4V2F A;  4C9Y A;  1BOB A;  2V1D A;  2P6T A;  3I58 A;  2NNY A;  3FWE A;  2DT7 B;  4FE4 A;  4A3B J;  3ABT A;  1MND A;  2WY7 Q;  3VEP A;  2CSO A;  2XF6 A;  1ZGA A;  2ZNY A;  2K9M A;  4G6T B;  3H9G A;  1MSF C;  1AA7 A;  4PSX A;  4Z6Y A;  3JTG A;  2E2J J;  5FLV A;  1SD4 A;  4S04 A;  1TC3 C;  5M3F J;  5F04 A;  4EAT A;  4OMZ A;  5B5E C;  1W36 C;  2HVS A;  1LE8 A;  1UB9 A;  2EV0 A;  4BNC A;  2GBY A;  2L01 A;  2DFE A;  5J40 A;  3W2V A;  4EVI A;  2E5N A;  3ZMU A;  4FTH A;  1O3S A;  2GAU A;  3BLY A;  3VOE A;  3L2V A;  2ZC2 A;  3FXK A;  4ZJZ A;  5DD4 A;  1U5T B;  3V8J A;  2DPU A;  4WCG A;  1YX5 A;  2A5W A;  1ETO A;  3B6A A;  1MGT A;  1I5Z A;  4AVZ A;  2ID3 A;  1P7I A;  4FIS A;  4Z2Y A;  5D6E A;  3OYG A;  4J19 A;  5FGM A;  2G9W A;  2W7N A;  2HQA A;  2KT0 A;  1XB4 A;  3LOC A;  4KN4 X;  3ABK H;  2MA3 A;  1YTY A;  1S72 I;  2QBY B;  1YLF A;  3KLO A;  2EIJ H;  4FQG A;  4KUM A;  1EH7 A;  1ZGW A;  3J80 K;  2W57 A;  4BEH B;  1Z05 A;  5CVR A;  5M3M J;  1OKR A;  1Y0N A;  2VQL A;  1Y8Q B;  2HFH A;  3HZJ A;  4HLY A;  3AG4 H;  4A3C J;  1FYM A;  2DA4 A;  1MBG A;  2EBI A;  5LRS A;  1R1U A;  1FSH A; 
#chains in the Genus database with same CATH homology
 3WOD F;  3BZ6 A;  1SMY F;  3F3X A;  1T39 A;  3KP4 A;  3VB2 A;  1BIA A;  2F5D A;  1K7A A;  2XKP A;  4RGR A;  2KIF A;  4RGS A;  1L3L A;  1R36 A;  2OQG A;  3H3U A;  4DNC A;  1OR7 A;  3AAF A;  1BOA A;  1JHH A;  4LFU A;  5L3D A;  3C18 A;  4MNU A;  5LGN A;  5FD5 A;  4ENK A;  3H3Z A;  2XRN A;  1KQ8 A;  3TDZ C;  1J0R A;  3FM3 A;  3CLO A;  2XIG A;  5ILU A;  3NRV A;  2R3S A;  3ZMZ A;  4HZF A;  4LD5 A;  2K02 A;  2EFO A;  1W7P B;  3F8M A;  3QPT A;  4E70 A;  2VBW A;  2ZKZ A;  3GXO A;  2B0L A;  4A12 A;  5TRD A;  2QYO A;  4NB5 A;  4BQA A;  1BBY A;  2XUB A;  3J81 K;  2K4B A;  5D4R A;  1HSJ A;  2UXN A;  5L3F A;  2OQR A;  2CW0 F;  1P2F A;  3F6O A;  2YX4 A;  2OZU A;  2NS0 A;  5K5R A;  4AIK A;  4IXA A;  4ESB A;  4UVC A;  2DQL A;  1KU3 A;  3ML6 A;  4ENJ A;  4OOI A;  5LRR A;  2PJP A;  5LLQ A;  2GXG A;  4FX4 A;  1BN5 A;  4G6D A;  4ZZD A;  5ILS A;  2NRA C;  4PDK A;  1Z7U A;  3RKY A;  2XHK A;  5H6R A;  4A2U A;  2A3S A;  2PMU A;  4RAY A;  1U5T C;  5A2Q Z;  1LEA A;  2IRF G;  3I0T A;  4EM1 A;  4UVA A;  4Q48 A;  3RJP A;  2MH2 A;  1ZRE A;  4YG2 F;  3HUG A;  4PCQ A;  4KN7 X;  3CUQ A;  2BYV E;  4XSX F;  4M72 A;  4KIB A;  3P9K A;  2DU9 A;  5J6X A;  3LFK A;  2HTJ A;  3D5L A;  2BBY A;  3I5U A;  3LQR A;  3HHH A;  4OIN F;  3WTY C;  1USS A;  2G7U A;  3QAH A;  3SHF A;  3NQO A;  1P6R A;  1U3E M;  5ICE A;  5LEJ A;  3F8N A;  3GF2 A;  2CGP A;  1KA8 A;  2BE5 F;  2A6E F;  4HQM A;  2DW4 A;  2JT1 A;  2DBB A;  2J5P A;  3GEZ A;  2K27 A;  3F6V A;  4WK8 F;  1P92 A;  1XGO A;  2VE8 A;  3BY6 A;  3GO5 A;  3GX4 X;  2CWE A;  2A6H F;  5ERI A;  5L3G A;  3ZP5 A;  3BPX A;  2FMY A;  1CGP A;  3G3Z A;  4QWQ A;  4LB6 B;  2HGC A;  3FM5 A;  4YIF A;  2CFX A;  1TBX A;  4NHJ A;  5FFX A;  2IPQ X;  1ON1 A;  5DCF A;  2ZME A;  1OYW A;  1H9T A;  2V9V A;  4G94 A;  3Q9S A;  4L9N A;  4I7H A;  4U88 A;  1XCV A;  3PQK A;  4JQF A;  5ICF A;  2JTV A;  1IW7 F;  5D8L B;  2HDC A;  2WTE A;  2RN7 A;  3PQJ A;  2QVO A;  1MJ9 A;  4XSZ F;  2OU2 A;  2STW A;  2KRF A;  1ZRD A;  4KA4 A;  2R7F A;  3IKV A;  1AWC A;  5LGT A;  1UFM A;  2FXA A;  3KP2 A;  2RDP A;  1K6O A;  4MEY F;  2IA2 A;  3QP5 A;  2ZFW A;  1P4X A;  2W84 A;  3Q5F A;  1L0O C;  1RZ4 A;  4L9V A;  1HBX G;  3J80 Z;  2VBY A;  3C3W A;  3WTT C;  2K7L A;  1HKS A;  4AWX B;  2VOO A;  2D1H A;  4KDP A;  1IXC A;  1PP8 F;  3MQ0 A;  5D5X B;  1FP2 A;  5AON A;  3BRO A;  5D5U B;  5K5Q A;  2OAZ A;  1RIO H;  2Z3Y A;  5LHH A;  4BHP A;  2RVC A;  3TO9 A;  3BWG A;  4BH9 A;  1ZRC A;  4ESF A;  2BV6 A;  2NAZ A;  1YFH A;  5CLS A;  3L00 A;  1KQ0 A;  2VOD A;  5HLI A;  1O7L A;  2IA0 A;  4Y15 A;  1O57 A;  3M8E A;  4ZYH A;  4P55 A;  2IW5 A;  3V7R A;  4CZZ A;  3O2P E;  4EMS A;  3IKT A;  2ZCW A;  2KKO A;  4RAZ A;  2XAS A;  1YW9 A;  4OIR F;  2EWN A;  2PFB A;  5FB2 A;  1S29 A;  4GXO A;  3KP3 A;  1OYY A;  3ZMV A;  5CYV A;  4L5J A;  4MTE A;  3L2C A;  3BP8 A;  2PN6 A;  1I27 A;  4LG0 B;  5ICG A;  5HLH A;  1W5T A;  5LGU A;  1B1B A;  1QBJ A;  3E5X A;  4IHS A;  4EV0 A;  4JK1 X;  1GVJ A;  2HR3 A;  1J7K A;  4ON0 A;  3IWZ A;  3O6B B;  1TQP A;  3F72 A;  5BQT A;  4UV8 A;  5ILV A;  1K78 A;  4CYD A;  2FRH A;  4O5V A;  2OA4 A;  5A2Q K;  2MBF A;  3OV8 A;  3WTZ A;  5EEG A;  3VFZ A;  1SAX A;  3V4G A;  1X3U A;  4YFN F;  4CXF A;  4P9F A;  4EGY A;  4FHT A;  3U1D A;  4I0B A;  5E1Z B;  4PZJ A;  1MJA A;  1FT9 A;  3V8L A;  5K1Y A;  2QEN A;  1ZG3 A;  4M73 A;  1J75 A;  2UXX A;  2PEX A;  2M87 A;  1Z1D A;  3BDD A;  4Q5S F;  3T8T A;  1ODD A;  3K9T A;  3FX3 A;  4OIO F;  4Q4Z F;  2NYX A;  4XLN F;  1QQI A;  5BOX A;  1F4K A;  2ZBK A;  3MAJ A;  1ZLK A;  4S05 A;  3ZN1 A;  2KIU A;  2L3D A;  5E8I A;  4LK1 F;  1FPQ A;  2G7H A;  1LB2 A;  1K78 B;  4DQ2 A;  1KYW A;  4GYG A;  4P9U A;  2HQR A;  3E3V A;  4KIF A;  3I59 B;  2HYG D;  3TO6 A;  4FX0 A;  2J5O A;  3JSO A;  1MD0 A;  1SD6 A;  1R1V A;  2L54 A;  3JTH A;  1SFX A;  1D8J A;  1IAW A;  1B59 A;  4EJU A;  3SXY A;  1ZAO A;  1H9G A;  2WC2 A;  5CVV A;  5D6F A;  2W85 A;  1XSD A;  2GA1 A;  3M1E A;  2K86 A;  2K4J A;  1CF7 B;  2ZNZ A;  3ROU A;  3WGH A;  1LEB A;  3KFW X;  2FBI A;  1U78 A;  1F1Z A;  2RC4 A;  1ZYR F;  4EGZ A;  2HYF A;  4M9Z A;  2L02 A;  2VE9 A;  3KEO A;  3IWF A;  4UNO A;  3OOP A;  2HWV A;  3RIR A;  1ZG5 A;  5HS8 A;  1IF1 A;  3LA7 A;  3RYP A;  3QP6 A;  2D45 A;  1XMA A;  2XAF A;  1R23 A;  1FWZ A;  3HRS A;  5FLX Z;  4L18 B;  2L4M A;  2COM A;  1FC3 A;  3BJ6 A;  1BI2 A;  3F8F A;  4M71 A;  3HSE A;  4LGW A;  2F2E A;  3GWZ A;  3DPL C;  1SFU A;  1ONV A;  3I71 A;  1TNT A;  2XRO A;  4PGH A;  1YQA A;  1G3T A;  3QOP A;  1TLH B;  3HRM A;  2PBI A;  1XGM A;  4G7Z F;  4I0A A;  1OYI A;  4GCV A;  3SFZ A;  4HOB A;  3R6S A;  2HZT A;  3ERE D;  1T98 A;  3K69 A;  4OIP F;  4IHT A;  3BJO A;  1R5G A;  2QUF A;  3IC7 A;  5LHI A;  2F5F A;  2TDX A;  4HA8 A;  1GXQ A;  4LB5 A;  2XKO A;  1TNS A;  3LAP A;  5E20 A;  5BPI A;  4IRI A;  2FQ3 A;  3WGG A;  1IRG A;  2HTS A;  2LDU A;  2DLL A;  2UWM A;  3KEQ A;  2FU4 A;  4P96 A;  3HIF A;  3GYH X;  2ESN A;  3TKY A;  3HHG A;  4R1H A;  3TOB A;  3V7C A;  2XGX A;  1P4A A;  1BM9 A;  3F21 A;  1S3J A;  2Q8K A;  1J59 A;  2QM3 A;  4A5M A;  4M9S A;  2AS5 F;  2UZK A;  2EV5 A;  4P5O A;  4LK0 F;  3MFK A;  5IT9 K;  2EV6 A;  1FSE A;  1S8N A;  2XAH A;  1TQM A;  1FBU A;  4BAY A;  4O3M A;  3ECO A;  2PLY A;  1W7P D;  1RNL A;  3JSP A;  4EM2 A;  1IUY A;  1FBS A;  1JXS A;  2V79 A;  4G7O F;  5J8C A;  1R5H A;  1FLI A;  1AOY A;  3R60 A;  5HOO A;  2Y75 A;  3G73 A;  1FX7 A;  3KZZ A;  2FF4 A;  1P4W A;  1DUX C;  4BHB A;  1Z91 A;  1R7J A;  4WWC A;  1I1S A;  3R4K A;  4EJV A;  4A0X A;  4HBL A;  1D8K A;  1H0M A;  1R00 A;  1XN7 A;  3CTA A;  3FXU A;  4N9I A;  1BC8 C;  4M74 A;  1IN6 A;  2A69 F;  2MH9 A;  3CJN A;  1FNN A;  3ZQ7 A;  5CVI A;  3ULQ B;  3Q9V A;  2KJB A;  2H6B A;  4KMU X;  4LLN A;  2DAO A;  2WWY A;  3HTS B;  2M8E A;  1ZHF A;  3E5Q A;  3C1D A;  2BEO A;  3H92 A;  2O03 A;  5DCM A;  1K79 A;  1YS7 A;  1ON2 A;  2ACJ A;  2OBP A;  1WRJ A;  4MQV A;  1W5S A;  3E5U A;  2A61 A;  3GUD A;  2L4A A;  1IRF A;  3T1B A;  4G9Y A;  4WX9 A;  2Q0O A;  1ZG1 A;  3EYY A;  1XMK A;  3CUQ B;  1YO5 C;  5CVU A;  5D8K B;  2X4H A;  3WTV C;  1NHA A;  2YPR A;  4HV5 A;  2NNN A;  1VTN C;  3F22 A;  1B9N A;  2JZY A;  3TGN A;  5E18 F;  3DFG A;  1W4M A;  2LSO A;  2M1B A;  4UV9 A;  4MTD A;  3IL2 A;  3GFI A;  4B8X A;  3PFI A;  5H20 A;  1D5V A;  5AIQ A;  2E1C A;  5DCM B;  2QZ8 A;  1QZZ A;  5L3C A;  4WXC A;  4HX8 A;  1V3F A;  1IN8 A;  2FNP A;  5FLX K;  4IF4 A;  5JFR A;  1HXD A;  4LLG F;  2EK5 A;  5L3B A;  3VOD A;  4HLX A;  3TDU C;  4ZYE A;  4O6J A;  1Q1H A;  1DPR A;  1Z6T A;  5DUI A;  2VC1 A;  3TOA A;  3U9G A;  1KYZ A;  4GO1 A;  2XAJ A;  2FBK A;  1KGS A;  2DT5 A;  2ZME B;  5DDG A;  1S7O A;  2LKP A;  2FML A;  5HLG A;  2H27 A;  3CDH A;  1FY7 A;  1RUO A;  3E97 A;  3GLX A;  3LQQ A;  1BIB A;  4G7H F;  4A6E A;  3DKW A;  2RGV A;  3R0J A;  4JBA A;  4BHC A;  4AD9 A;  5ICC A;  1PP7 U;  2ETH A;  3S2W A;  1RUN A;  2VN2 A;  1O3Q A;  4KIC A;  1LDK B;  3L9F A;  1Y0U A;  2ZO4 A;  3M8F A;  1EH6 A;  1IXS B;  3WTX C;  4HV6 A;  4I01 A;  2OD5 A;  4HF2 A;  3JAM Z;  2D1V A;  4KIG A;  2MLG A;  3IRQ A;  3RDI A;  1O3R A;  3WU1 B;  4L9T A;  4ZZL A;  1SMT A;  4L0Y B;  2Z5U A;  3CUQ C;  3C7J A;  4L9J A;  4KMF A;  2JPB A;  2DPD A;  1HST A;  3ISP A;  6PAX A;  4EM0 B;  4ZYD A;  1JE8 A;  2RV8 A;  4I02 A;  5IT9 Z;  2FNA A;  4MEX F;  2P5V A;  2V1X A;  3HRT A;  2CQK A;  2RNJ A;  3L09 A;  3KP7 A;  4RB1 A;  3DEU A;  3RKX A;  3W6K B;  2DTR A;  3ABU A;  4XRF A;  1YW7 A;  3LA2 A;  5BPD A;  5FD6 A;  3LST A;  1FYK A;  4N0B A;  4ASN A;  3HTU A;  1ZGJ A;  4F7Z A;  1IXR C;  1B9M A;  2A68 F;  2Q2E A;  4K2E A;  4FT8 A;  1LVA A;  2R7D A;  2HKX A;  5TJJ A;  4RS8 A;  2HQN A;  2HS5 A;  4Y17 A;  1YYV A;  2Z33 A;  1F5T A;  2LF8 A;  2E7W A;  5L3E A;  1FYL A;  2XV4 S;  1XSV A;  2O0Y A;  1FOK A;  3I53 A;  5LHG A;  3I54 A;  1FZP B;  3WE3 A;  1ZH5 A;  3KZY A;  5EEH A;  3B73 A;  1A04 A;  1T6S A;  1MDM A;  4AVP A;  3BOQ A;  1YW8 A;  2F5C A;  4L5I A;  4KYW A;  3RPU A;  2ZJ2 A;  2DQR A;  2V6C A;  1WQ2 A;  3DQV C;  4RB3 C;  3FHZ A;  2IT0 A;  2MLK A;  1WKM A;  5KK1 A;  1PDN C;  1YIO A;  4MHG A;  1J2X A;  3MZH A;  1HQC A;  4OIQ F;  1TW3 A;  3K2Z A;  2PG4 A;  1R1T A;  4ZH4 F;  1XGS A;  2EJR A;  4LMY A;  5F1R A;  3DV8 A;  4IRG A;  5HDG A;  3QPH A;  4CIC A;  1QZY A;  4KT5 C;  1R58 A;  1MDM B;  3JW4 A;  2DK8 A;  2A07 F;  2YX7 A;  2GZW A;  4Q47 A;  4HDU A;  2ISZ A;  2AXL A;  3IHU A;  5JR3 A;  1B6A A;  2Z99 A;  3J7A O;  2W25 A;  3KET A;  5JVT A;  2O8X A;  3KCC A;  3WG9 A;  2DO7 A;  5IT3 A;  2HOE A;  4KNY A;  2PQ8 A;  2QLZ A;  4BYY A;  4HAM A;  3KP6 A;  3FMR A;  1W7P A;  2QWW A;  2ELH A;  4Y13 A;  1G6N A;  2OZ6 A;  4ZYG A;  4A5N A;  2GA2 A;  2IA1 A;  4HYE A;  2H09 A;  3KP5 A;  4U0V A;  2MD5 A;  1QNT A;  4M6Y A;  3ZPL A;  1I6X A;  1XDU A;  4OMY A;  4RGU A;  5CJ9 A;  3SZP A;  4U0Y A;  5F6F A;  5HVQ C;  1EV7 A;  2P7V B;  1XDS A;  2C6Y A;  1D3Y A;  5FFZ A;  3F23 A;  2X0L A;  4BXU A;  3M7G A;  3I64 A;  4H0E A;  2EFP A;  1J5Y A;  2FA5 A;  1IN4 A;  3W6J B;  1KU2 A;  2JSC A;  3CO7 C;  4AIH A;  2FOK A;  3WGI A;  3N97 A;  4M9X A;  3DP7 A;  5E8G A;  2KJC A;  2QQA A;  2QQB A;  3JAM K;  2JRT A;  3COA C;  2FBH A;  4U7D A;  2EB7 A;  3MWM A;  3V7S A;  2E1N A;  3FMQ A;  3WTU C;  4ENN A;  3ELK A;  2ISY A;  4CGZ A;  5LBQ A;  5H6Q A;  1BC7 C;  4U7B A;  2WV0 A;  4CDG A;  1TW2 A;  1F9N A;  3RI4 A;  1ULY A;  3HRU A;  1UCR A;  1C0W A;  3HSF A;  4MGR A;  2PI0 A;  1G3Y A;  4HX4 A;  1O7F A;  3GFM A;  3ZMS A;  1E17 A;  1YG2 A;  2DI3 A;  1RI7 A;  5JI6 A;  5JHU A;  2VC0 A;  2PMH A;  2VBX A;  4KFC A;  4B09 A;  2F5E A;  4GYI A;  2YR2 A;  3RKW A;  2LF7 A;  1WI9 A;  3F8B A;  2M30 A;  5DV5 A;  1HW2 A;  2Y48 A;  3DPT A;  4GGG A;  2FE3 A;  1BI1 A;  4PGG A;  3SQN A;  3K1M A;  1Z6R A;  3LA3 A;  3ZMD A;  2FSW A;  2VT3 A;  1QGP A;  3O3K A;  3QU3 A;  3ECH A;  2HEO A;  2DK5 A;  2P7C B;  4RGX A;  1R22 A;  2YU3 A;  3FMS A;  5BMZ A;  1I1G A;  2D2W A;  3EQL F;  1QO0 D;  1DPU A;  2W24 A;  4MQ9 F;  3KE2 A;  2CO5 A;  1EH8 A;  4IJA A;  4G8X A;  1LQ1 A;  3E6D A;  1T2K A;  2P6S A;  4HX7 A;  1SD5 A;  1JGS A;  2EA2 A;  2VON A;  1IZ1 A;  5E1X A;  3TO7 A;  4I2O A;  4U0W A;  2IJL A;  3LAJ A;  3GFL A;  1BI3 A;  1REP C;  1T38 A;  1S6L A;  1O3T A;  3GFJ A;  3RPQ A;  4XBF A;  1G3S A;  1LDD A;  2XVC A;  2O61 A;  4YII A;  2ADU A;  4OU0 A;  1KU7 A;  1QPM A;  1ZAR A;  5E17 F;  5J8F A;  2Z9O A;  1IN7 A;  3T5X A;  2E7X A;  1BJA A;  5HS7 A;  4IPA A;  1ZRF A;  2VBZ A;  3K1P A;  3GZ5 A;  3ZN0 A;  1HKQ A;  4R79 A;  1U6G A;  2P8T A;  1UHW A;  4EQQ A;  2IVM A;  2VXZ A;  2STT A;  1LNW A;  3L7W A;  5KVR A;  4I98 B;  1G4D A;  3KLN A;  5HDN A;  5E1W A;  2GXB A;  3EDP A;  1U2W A;  3F8C A;  2MC3 A;  5F64 A;  4LLL A;  3HOS A;  1XSX A;  2DFI A;  5CVJ A;  1B4A A;  1GHC A;  1LDJ A;  3RYR A;  3CO6 C;  2XAG A;  1G3W A;  4I09 A;  2RKH A;  3BPV A;  1TQI A;  4LG0 A;  1SD7 A;  3U2R A;  5K5O A;  1BI0 A;  3GVA A;  3HOT A;  2ZXJ A;  5LEK A;  1U8R A;  1TTY A;  3RTR A;  1UHM A;  2M45 A;  5DYM A;  2CG4 A;  1GXP A;  4EJT A;  1E2X A;  4UUV A;  5HS9 A;  3EUH A;  3N4M A;  3P7N A;  3MZY A;  2EFW A;  1XGN A;  3MCZ A;  2QQ9 A;  4AIJ A;  3V8K A;  4HF0 A;  4WXD A;  3QU6 A;  2P5L C;  3EYI A;  2EA4 A;  1DP7 P;  5AIP A;  1XCB A;  2CYY A;  3E6B A;  2Y0M A;  1XD7 A;  2O6G E;  2M5W A;  3DF8 A;  2GQQ A;  4G6Q A;  5DEQ A;  4NQW A;  3TQN A;  3NEU A;  3FF5 A;  5HDK A;  3WTS C;  1T0F A;  2YSR A;  4CO8 A;  1SFE A;  4HDV A;  2RQP A;  4A0Y A;  3WE2 A;  4HW0 A;  2GIV A;  4D0P A;  3J81 Z;  4L0Z B;  4RB0 A;  4CHU A;  5DUK A;  3HYI A;  2P5K A;  4ENM A;  2P4W A;  1KU9 A;  2A5Y B;  5D4S A;  1LJ9 A;  3M9A A;  3FXQ A;  3GW2 A;  1WWX A;  3B02 A;  2EFQ A;  1FP1 D;  2V1U A;  1IN5 A;  3K1N A;  1OMI A;  3I4P A;  4EJW A;  4A0Z A;  2HKO A;  2VOP A;  2KIM A;  3I59 A;  3T0Y A;  3E6C C;  2ESH A;  1DDN A;  4UVB A;  1JHF A;  2O3F A;  5FO5 A;  5DD8 A;  2EFN A;  3ZMT A;  1PUE E;  4N9H A;  3T8R A;  4TV7 A;  3MEX A;  3D0S A;  2LNB A;  3DXJ F;  3R61 A;  4IRH A;  1MZB A;  3GZ6 A;  1HW5 A;  4UHT A;  4WXH A;  1ZLJ A;  1ZN2 A;  3BJA A;  4WF2 A;  1CF7 A;  2GWR A;  1YS6 A;  3REO A;  1MKM A;  3QRF F;  2H6C A;  3SZT A;  3LWF A;  4ETS A;  4YFK F;  2BGC A;  5D5W B;  4ESJ A;  3P9I A;  4HF1 A;  4QLC U;  3HSR A;  3WU0 A;  1HKT A;  3WTW C;  4HQE A;  3FZV A;  4LJZ F;  3EET A;  2VT2 A;  4A6D A;  1U5T A;  4IVN A;  1MJB A;  1S7A A;  1STZ A;  3FXR A;  2IP2 A;  3P9C A;  2H94 A;  5D5V B;  1FBQ A;  3IRR A;  2QBY A;  2FEZ A;  4EJO A;  2XAQ A;  1OPC A;  1WSU A;  4XLP F;  1UST A;  4YFX F;  4R8H A;  1KQ9 A;  1J9I A;  1V4R A;  4M6X A;  3R0A A;  1Z9C A;  4UXN A;  5BS6 A;  4RB2 C;  1HW1 A;  2JPC A;  3E6M A;  5ED4 A;  3CUO A;  3K0L A;  2V1D A;  2P6T A;  3I58 A;  2NNY A;  3FWE A;  3ABT A;  3VEP A;  2CSO A;  1ZGA A;  2ZNY A;  3JTG A;  1SD4 A;  4S04 A;  4OMZ A;  1UB9 A;  2EV0 A;  4BNC A;  2L01 A;  4EVI A;  3ZMU A;  1O3S A;  2GAU A;  3VOE A;  5DD4 A;  1U5T B;  3V8J A;  2DPU A;  4WCG A;  1MGT A;  1I5Z A;  4Z2Y A;  5D6E A;  5FGM A;  2G9W A;  4KN4 X;  1XB4 A;  2MA3 A;  1YTY A;  2QBY B;  1YLF A;  3KLO A;  4KUM A;  1EH7 A;  3J80 K;  2W57 A;  1Z05 A;  5CVR A;  1OKR A;  2HFH A;  4HLY A;  1FYM A;  5LRS A;  1R1U A;  1FSH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...