2OQGA

Arsr-like transcriptional regulator from rhodococcus sp. rha1
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
109
structure length
109
Chain Sequence
GMTVGTYAELASVFAALSDETRWEILTELGRADQSASSLATRLPVSRQAIAKHLNALQACGLVESVKVGREIRYRALGAELNKTARTLERIGAEWDRRLAAIKQIAESM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the ArsR-like Transcriptional Regulator from Rhodococcus sp. RHA1
rcsb
source organism Rhodococcus sp.
molecule tags Transcription
molecule keywords Possible transcriptional regulator, ArsR family protein
total genus 40
structure length 109
sequence length 109
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12840 HTH_20 Helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2oqgA00
4L5JA 4I02A 4A0YA 1IAWA 1OR7A 4HDVA 3FMQA 1FBQA 1OYIA 3LAPA 2VONA 1XSDA 1R5HA 3CO6C 1KYZA 4I09A 4N0BA 3HUGA 5ICEA 3JTHA 1YFHA 1R7JA 1SD4A 1FBSA 1I6XA 4KMFA 1P4XA 2FNAA 5DV5A 5DYMA 5JFRA 1YO5C 1QZZA 1JXSA 1BJAA 5K1YA 3KZZA 4IVNA 2HKOA 3TOBA 3ZP5A 4HZFA 1T0FA 5LRSA 4JQFA 3H3UA 4HOBA 3WTYC 1DUXC 3RYRA 2HGCA 2QM3A 1MDMA 2P4WA 1FWZA 4GO1A 4KIGA 2ZMEB 1Z6TA 2Y48A 1KU3A 1S7AA 4HF1A 3T0YA 1FY7A 5DUKA 4IXAA 3FM3A 2XKPA 2NRAC 5CVIA 2IVMA 1YIOA 1YYVA 3ABTA 4GYGA 1FZPB 3RIRA 5E8IA 4OINF 2EB7A 5K5RA 1J0RA 2KKOA 2XV4S 5KVRA 4S04A 3LA7A 3OOPA 3E6DA 3AAFA 1EV7A 3HRUA 4HQMA 3N97A 2ZXJA 3MCZA 4ZYHA 3MWMA 5L3EA 3TDZC 1S3JA 1W7PD 5LBQA 1KQ0A 5LGTA 1KU7A 1T98A 3GEZA 1CF7A 2FQ3A 4G6QA 2TDXA 1G3SA 3RDIA 4U0YA 2LDUA 2E7XA 2LNBA 1TW3A 5IT9K 1U5TB 4KA4A 3EQLF 1UHMA 3T5XA 1BC7C 3PQJA 1ON1A 3O6BB 5LGNA 1T2KA 4BHBA 2QUFA 4HLYA 2FXAA 4OMZA 3HTUA 3S2WA 2KJBA 1U5TC 5FB2A 4I2OA 2E7WA 4HX8A 3H3ZA 1T6SA 4AD9A 4XSZF 4G94A 3GUDA 1FX7A 2O61A 4YFXF 2YPRA 3BWGA 2R3SA 1MJBA 3FF5A 1STZA 1XDUA 2A3SA 4HV5A 3ECOA 2YX4A 2FE3A 1J9IA 2O0YA 2GA1A 3D5LA 2OBPA 4M73A 3QPTA 2V6CA 2E1NA 2PMHA 5ED4A 1KYWA 4R79A 2K4BA 2ELHA 3DPLC 3PFIA 2P7CB 2D2WA 1K6OA 1Z05A 2QBYB 4ZZDA 2F5CA 4ZYDA 1U5TA 2L01A 3I0TA 1P4WA 5HS9A 3ZMVA 3DEUA 4Z2YA 1W4MA 5CVVA 4CICA 3F21A 3CUQC 5L3BA 3BPXA 3BPVA 4KMUX 3D0SA 4OIOF 1OYWA 1SMYF 2CWEA 2MH2A 2WC2A 4UXNA 3F8NA 2HYGD 3QU6A 3HSRA 1XSXA 3KP3A 3MQ0A 2PN6A 2FRHA 2Y75A 2J5PA 1LQ1A 4ESJA 2NNNA 1KGSA 1ZLJA 3JTGA 5L3DA 3WGHA 1LJ9A 3V7SA 4BH9A 3KCCA 2V1DA 2M1BA 1HKQA 2CO5A 2V1XA 2QZ8A 1W5SA 3F8BA 3I4PA 4MTDA 5H6RA 1G3TA 3LA2A 5EEHA 2M8EA 1FPQA 4U7BA 1QQIA 4EJVA 3H92A 2PMUA 2PQ8A 2O03A 4WXCA 1TQPA 3MEXA 2EFOA 3HOTA 1LDDA 1S29A 2XAFA 1FLIA 4ENJA 3HSEA 1ON2A 1HQCA 4HF2A 1HW5A 2LF7A 5D4SA 1QO0D 1BIAA 3RJPA 2O8XA 4OIQF 1E17A 2H6BA 2L3DA 3HRMA 5HS8A 1RZ4A 3SQNA 1KU9A 1IF1A 4ESFA 1WSUA 3L2CA 4L9NA 1ZN2A 1KQ9A 4RS8A 2HEOA 2P5LC 3CJNA 3QU3A 1OYYA 1V3FA 4FX0A 2HR3A 4OIRF 3FM5A 4CXFA 2VC0A 1HXDA 4LLLA 4L18B 2EV0A 3DV8A 1IXSB 1YW7A 5FGMA 2IA0A 2VN2A 2FBKA 4CYDA 3BJ6A 2STWA 3B02A 4HBLA 2PEXA 5E20A 4A5MA 1DP7P 3J81Z 3R6SA 3F23A 1UHWA 3ZQ7A 3I53A 3KP6A 1H9TA 2D45A 1GVJA 3KETA 3LFKA 2FA5A 3SHFA 1MKMA 1P92A 2VE8A 3V8JA 1MJ9A 4U7DA 4U0WA 3F8FA 1IRFA 5J6XA 2STTA 4NQWA 3ULQB 3C3WA 2Z3YA 3HYIA 2R7FA 3ZMUA 1BI3A 4HYEA 1SAXA 1SFEA 2MH9A 3DXJF 1IRGA 5LHGA 1Z91A 3M8EA 3IL2A 1L3LA 2ETHA 3I64A 5BMZA 2G7UA 1FBUA 3KZYA 1P6RA 3ZMSA 1B4AA 2UZKA 5A2QK 4JBAA 1BOAA 1U8RA 5FD6A 1BC8C 4EJWA 1ODDA 3C7JA 1USSA 3RKYA 2IP2A 4HW0A 4XSXF 2QVOA 4M6XA 1MDMB 3K1PA 2VC1A 4RB1A 1F4KA 4FT8A 5DEQA 4IHSA 2JSCA 2QWWA 4LLGF 1FSEA 1XD7A 2RKHA 1O7LA 3J80Z 3SZPA 5D5XB 4YG2F 2FEZA 4WWCA 4MHGA 3WTSC 2PBIA 2HOEA 3Q9VA 1ZREA 5LLQA 4MEXF 4F7ZA 4L9VA 3ZMZA 1G3WA 2CG4A 1I5ZA 4HA8A 2DO7A 2OQRA 3P7NA 2C6YA 2DU9A 2OZ6A 2P5VA 1GXQA 2K86A 2XKOA 1QPMA 3FXQA 2YX7A 5BPDA 1IXCA 2L54A 4UVAA 4P9UA 3TGNA 2F5FA 1FC3A 3WODF 3E97A 2MD5A 2EV6A 2H94A 1LVAA 4G8XA 4XBFA 5JR3A 4HLXA 2HKXA 2RV8A 4UHTA 1ZGAA 4UVCA 2XGXA 1ZRCA 2P8TA 1W7PA 2M87A 4KYWA 1X3UA 3U9GA 4ZYEA 5L3FA 5ICCA 4EJUA 2MA3A 3G3ZA 2MLGA 3NQOA 3BP8A 1MGTA 2IPQX 4O6JA 4N9IA 2VT2A 3GFMA 4P9FA 4A12A 3EYIA 2L4AA 3JSOA 1OPCA 4KN7X 3GW2A 2AXLA 4BHCA 4U0VA 3F22A 3LQQA 5CYVA 3GYHX 2DT5A 2R7DA 2J5OA 4LG0B 2K4JA 3BJOA 3CUQB 1R1VA 4NB5A 5F1RA 4M74A 1R5GA 4LGWA 1TW2A 1KA8A 1LEBA 3E3VA 2IT0A 4CHUA 3GF2A 1D8KA 3SFZA 3F8CA 5FLXZ 2G9WA 2JT1A 2ZFWA 1XGMA 3J80K 1U6GA 3DP7A 2WV0A 1GHCA 2NAZA 4Y15A 5BOXA 2GXBA 5DD8A 1JGSA 5EEGA 2OAZA 1LEAA 1XMAA 4RGUA 2XASA 1IW7F 4ENMA 4O5VA 3F6VA 4A5NA 2Q2EA 2ZNZA 1LB2A 4MGRA 3KP2A 1AWCA 2QBYA 1K7AA 3I58A 3FMSA 1B59A 2NS0A 2BYVE 4MQ9F 4Q5SF 5BPIA 1XGSA 2QENA 3BJAA 2DQLA 2MC3A 1MJAA 1HW1A 1LNWA 3T1BA 2Z5UA 3IHUA 4PZJA 1B6AA 2O6GE 5CLSA 3J7AO 4IF4A 2CFXA 3CO7C 3P9CA 3R0JA 3WG9A 4BAYA 3RPQA 4YFNF 4UV9A 1ZRFA 5FD5A 3VB2A 1O57A 3KFWX 1C0WA 1ZG3A 5KK1A 2V9VA 5LHHA 4LG0A 3M1EA 3I59B 1P2FA 4QWQA 4H0EA 1J5YA 1R22A 5DUIA 4LJZF 2UWMA 1XMKA 4S05A 1YS6A 2VXZA 5ICGA 1FT9A 2Q0OA 5A2QZ 1UCRA 3WGIA 2MLKA 4EGYA 4IRGA 3WTWC 2VBWA 3WTVC 4BHPA 2A61A 2DFIA 4KIFA 5D6FA 3EUHA 1ZAOA 4RB0A 1I27A 2ISYA 4JK1X 2V1UA 1QNTA 3E6BA 2KIUA 2BE5F 5HVQC 4M71A 3E5UA 3R60A 2FSWA 3L09A 2Y0MA 4EJOA 3P9KA 1WI9A 1WQ2A 3QP5A 3GFIA 1ZHFA 3WTTC 1O7FA 2EK5A 4R1HA 4RGSA 3GVAA 2HTJA 4G7HF 5D8LB 1Z7UA 4UV8A 5FLXK 2EA2A 4I0AA 1BI1A 5E1XA 2XVCA 4IRIA 4G7OF 2XHKA 1T38A 3KLOA 4LK0F 2NNYA 3EYYA 4R8HA 1RUOA 4E70A 2B0LA 1IN7A 3VFZA 3B73A 3GFLA 5J8CA 1F1ZA 3L7WA 3ECHA 2RC4A 4KN4X 3IRQA 5CVUA 6PAXA 3VOEA 2W25A 3ZPLA 5IT3A 2IA2A 2FMYA 1FP2A 2F5EA 3HIFA 3VODA 1G4DA 4G6DA 2ACJA 4CZZA 3IWFA 1VTNC 1PP8F 3EETA 3BZ6A 3R61A 3MAJA 1WKMA 1Z9CA 4RGRA 1J7KA 1HSTA 1REPC 3W6KB 4N9HA 5HS7A 1TLHB 3I5UA 1O3SA 4EQQA 3FMRA 1IN8A 3V4GA 1OMIA 2FU4A 1CGPA 2CYYA 3QRFF 2EV5A 4QLCU 2PLYA 4UVBA 3V8LA 4M72A 4L9TA 1RUNA 1ZYRF 1G6NA 5CJ9A 4L9JA 1Y0UA 4IJAA 4RAZA 5JVTA 4LLNA 3GO5A 2Z9OA 4YIFA 1L0OC 1K78B 3Q5FA 4PGGA 3K1MA 4LB5A 3ISPA 1JHHA 1B9NA 1YLFA 2GZWA 4ZH4F 5E8GA 1SD5A 4KDPA 1S7OA 3GWZA 1IZ1A 1J75A 4KFCA 3HTSB 3LWFA 4BNCA 5JI6A 1ONVA 3HOSA 1BI0A 1ZG1A 5LGUA 5ICFA 1WWXA 4ETSA 4MQVA 4Y17A 1R58A 3I54A 1O3TA 4I7HA 1XDSA 2BBYA 3QP6A 4B09A 4WXDA 3E5XA 2P5KA 3COAC 3EDPA 4HV6A 1H9GA 4Q47A 5HLHA 2M30A 3RYPA 2XAHA 3R0AA 3DF8A 3WE2A 1B1BA 4RAYA 5TRDA 2H27A 1ULYA 5DD4A 2VOOA 4LD5A 3JAMZ 4AWXB 1YS7A 2OA4A 3BY6A 4NHJA 2XROA 2W57A 1HSJA 4G7ZF 4EM0B 2CQKA 3ZMTA 1S8NA 2L02A 3KEQA 5AIQA 2HWVA 2ZCWA 2GQQA 5TJJA 3GZ6A 3SXYA 5FFZA 4MEYF 2W24A 5BQTA 2FBIA 5K5OA 1CF7B 1DPRA 3FXUA 3CUQA 1YTYA 1XCVA 3T8TA 4XRFA 2VBXA 3KP5A 4MTEA 2A07F 4AIKA 3GZ5A 5AONA 4WF2A 1QZYA 1TTYA 1V4RA 5HDKA 4HQEA 5JHUA 2HQRA 3BOQA 2P6TA 1FNNA 5D6EA 1SD7A 1ZARA 2P6SA 3SZTA 4DQ2A 2RN7A 4KNYA 3GLXA 2RQPA 3V7CA 2QYOA 2ZMEA 3P9IA 2OZUA 5H20A 2KIFA 3FXRA 2H6CA 3TO6A 2OU2A 1O3QA 4BXUA 3LSTA 1XN7A 1TNTA 3MZYA 3ELKA 3DFGA 3FWEA 3GX4X 4HAMA 3FZVA 4ESBA 1TBXA 3ML6A 4AIJA 5D5VB 5DCMB 3K9TA 2ZKZA 3N4MA 2V79A 5IT9Z 1R36A 1SD6A 3F8MA 1ZRDA 4DNCA 2VBYA 1E2XA 5D5UB 2XAGA 3ABUA 4EJTA 5HLGA 2MBFA 1UB9A 3R4KA 3TQNA 2JTVA 1O3RA 2XAQA 4FX4A 4YFKF 1W5TA 3J81K 5DCFA 5D4RA 3BDDA 4U88A 2GA2A 3KP4A 2K02A 1PP7U 4EVIA 3LAJA 2PFBA 4GGGA 3WTZA 3U2RA 1A04A 1EH7A 1YQAA 1PUEE 2DQRA 2EWNA 4EGZA 3V8KA 4MNUA 1KU2A 5CVJA 2CW0F 2FBHA 2F2EA 3U1DA 2VBZA 1EH8A 2ZBKA 5HOOA 5FO5A 1SFUA 5E1ZB 4UNOA 2G7HA 1TQMA 2XIGA 2H09A 4A6DA 5HLIA 2Z33A 2EFWA 2RDPA 3T8RA 1QBJA 4HDUA 1J59A 1PDNC 1XSVA 3WU1B 1IN5A 2RVCA 4KIBA 3TKYA 4M9XA 3TO9A 1FOKA 2IW5A 3NEUA 2WWYA 1XCBA 3ZMDA 4KUMA 2DLLA 2VT3A 2A5YB 1R1TA 4LK1F 5H6QA 3KE2A 2YSRA 1UFMA 1DPUA 1XB4A 2A6HF 3WGGA 4OMYA 1K78A 3CLOA 4ON0A 2GXGA 5BS6A 3LA3A 1MZBA 3JSPA 1HBXG 4FHTA 2IRFG 3DKWA 4A0XA 3MFKA 1TQIA 2CGPA 1Z1DA 1D5VA 2BV6A 4G9YA 4TV7A 2KIMA 5ERIA 5F64A 1FYMA 4EM2A 2FMLA 4HX4A 1TNSA 2M5WA 2CSOA 1Z6RA 1KQ8A 2COMA 2QLZA 5LHIA 4ASNA 1HKTA 3FX3A 1BBYA 3G73A 3VEPA 2GAUA 4IHTA 4EM1A 3MZHA 3QOPA 2DW4A 2Z99A 4GYIA 1U3EM 1HW2A 1F5TA 2A6EF 2KJCA 2XRNA 5D5WB 3HSFA 4LB6B 3RTRA 1K79A 1HKSA 4D0PA 2DK5A 3K0LA 3L00A 2K7LA 2ISZA 2HQNA 1FP1D 3QAHA 4KT5C 3IKTA 3IRRA 1SMTA 5E18F 4LMYA 1P4AA 2X4HA 5DCMA 3FHZA 3LQRA 2OQGA 2W84A 4P5OA 2O3FA 4GXOA 2UXXA 3KEOA 3HRSA 2ADUA 3DPTA 1D8JA 3KLNA 3O2PE 4I0BA 4EMSA 3E5QA 4OU0A 2X0LA 1IUYA 2D1VA 1I1SA 2DPDA 3JAMK 3ERED 2EA4A 4WX9A 3I59A 4O3MA 5AIPA 2P7VB 3I71A 1I1GA 3HRTA 3WE3A 4P55A 5HDNA 4IRHA 5CVRA 2A68F 4L0YB 3O3KA 3V7RA 5LRRA 1G3YA 4Y13A 2VOPA 4WK8F 1IN6A 2F5DA 4HF0A 1FYKA 4WCGA 2EJRA 1RIOH 4ZYGA 1BM9A 1R23A 5DDGA 3JW4A 2K27A 2FNPA 5LEJA 3WTXC 3W6JB 1YW8A 1FSHA 2RGVA 4XLPF 1EH6A 2VODA 3ZN1A 3IC7A 1RNLA 1BI2A 3F72A 5E1WA 2IJLA 4IPAA 4CGZA 3HHGA 4L0ZB 1S6LA 4I01A 3E6CC 3WTUC 1F9NA 1XGNA 2PG4A 3K1NA 5L3CA 1NHAA 2GIVA 2DBBA 4K2EA 5ILVA 5FFXA 4I98B 3DQVC 4ENKA 1ZH5A 1LDJA 4LFUA 4OOIA 2XUBA 3PQKA 3TDUC 1ZLKA 1B9MA 2WTEA 4CDGA 1DDNA 2LF8A 1OKRA 5L3GA 2OD5A 3REOA 3HHHA 3M9AA 3QPHA 4Q48A 3TO7A 2ZJ2A 2LKPA 3OV8A 3IWZA 1R00A 2D1HA 2ZNYA 2BEOA 3E6MA 2Q8KA 1JE8A 5D8KB 2E1CA 1YG2A 3L9FA 2RNJA 2M45A 3F3XA 2QQBA 4UUVA 4AVPA 2LSOA 1R1UA 4ENNA 3C1DA 1ZG5A 1U78A 1YW9A 3RPUA 2ZO4A 5ILUA 2YR2A 3TOAA 4M6YA 2FF4A 3K69A 1USTA 3Q9SA 2HFHA 4A6EA 3KP7A 2IA1A 2EFPA 4WXHA 3IKVA 3M7GA 4XLNF 4RB3C 1AOYA 1J2XA 2HS5A 5HDGA 4RB2C 5ILSA 1SFXA 1IXRC 3ROUA 5LEKA 5J8FA 3CDHA 2FOKA 1FYLA 3BROA 3RKWA 2HDCA 2HYFA 4PCQA 1Q1HA 4PGHA 2ESNA 2DI3A 2EFNA 4GCVA 4A2UA 2KRFA 4EV0A 1RI7A 2JPBA 2W85A 3RKXA 2VE9A 2A69F 1T39A 1BIBA 2JZYA 1JHFA 3CTAA 2DTRA 5E17F 1IN4A 2HZTA 5K5QA 4BQAA 3K2ZA 2EFQA 1D3YA 4PDKA 5F6FA 4YIIA 4HX7A 2GWRA 4M9SA 1LDKB 3WU0A 1W7PB 2PI0A 2HTSA 4CO8A 1GXPA 2UXNA 1QGPA 2AS5F 3CUOA 4BYYA 2XAJA 3GFJA 1XGOA 2QQ9A 4ZZLA 2DK8A 3RI4A 2ESHA 2DPUA 2JRTA 1ZGJA 4RGXA 4M9ZA 2BGCA 3GXOA 4KICA 3ZN0A 1WRJA 3NRVA 4Q4ZF 2L4MA 2YU3A 4OIPF 3M8FA 2PJPA 3C18A 4A0ZA 2DAOA 4L5IA 4AIHA 1BN5A 1H0MA 1MD0A 4B8XA 3F6OA 4P96A 2NYXA 2JPCA 2QQAA 1U2WA
chains in the Genus database with same CATH superfamily
3SDBA 4L5JA 4I02A 4A0YA 1IAWA 1OR7A 1A6IA 1UELB 4HDVA 3FMQA 1FBQA 1OYIA 1WZ2A 3LAPA 2VONA 5EYRA 1XSDA 1R5HA 3CO6C 4C9YA 1KYZA 4XK4A 4I09A 4N0BA 3QOEA 3HUGA 4II2A 5ICEA 3JTHA 1AA7A 1YFHA 3CCVI 4BY1J 4M6VA 1R7JA 1LUJB 2GBYA 1X1PA 3HKZA 1SC7A 1N25A 1SD4A 1FBSA 4CCKA 2E5NA 3BR0A 1I6XA 1V5EA 1JKPC 1P4XA 4KMFA 1MW7A 2FNAA 2LP0A 5F27A 4A3IJ 5DV5A 5DYMA 5JFRA 1YO5C 5IY5H 4KJZA 2BXYA 4KT6A 1QZZA 4NC7A 2MSYA 1BR2A 1JXSA 4XOPA 4XNFA 1TT5B 3TW7A 1BJAA 5K1YA 3KZZA 1JKRC 2K5CA 4IVNA 3K70C 2HKOA 1HC8A 3OIPA 3TOBA 1PYVA 3ZP5A 4HZFA 1T0FA 3U21A 5LRSA 4JQFA 3H3UA 4HOBA 4U87A 2DYRH 3OIQA 4QPOA 3WTYC 1DUXC 2A5WA 4I76A 3RYRA 3PL8A 3GCMA 2HGCA 1Z21A 2BHYA 2E35A 1LFUP 2QM3A 2Z16A 1MDMA 3A01B 2P4WA 3CDLA 1FWZA 3BR3A 4GO1A 4KIGA 2ZMEB 1Z6TA 3KEYA 1WJEA 3HPHA 2Y48A 1KU3A 1S7AA 4HF1A 3CCEI 3T0YA 3MD2A 4HRIA 4BBSJ 1FY7A 2JN6A 3FHNA 1XG1A 5DUKA 4IXAA 3FM3A 3RCOA 2HVRA 3PSFA 2XKPA 2ZJQF 2NRAC 3DCFA 2B9SA 1FIPA 1GLNA 2EZLA 5CVIA 2IVMA 1YX5A 4HG2A 1YIOA 4NQWB 1VZ0A 3CCUI 3OSFA 1FTZA 2KDOA 1YYVA 3ABTA 4GYGA 2VXDA 2DA3A 3B6AA 3MKYB 4ZYAA 2IS4A 4E6KG 5FJ8J 1FZPB 2KISA 3ZQLA 3RIRA 2PMZN 5E8IA 4OINF 4IHYA 2EB7A 2E1MB 5K5RA 4F91B 3PUFA 1J0RA 2KKOA 4X1EA 2XV4S 1Y8RB 1QA6A 1JT6A 5EG0B 4E7KA 5KVRA 4S04A 3LA7A 2VLAA 3OOPA 3E6DA 3AAFA 1EV7A 3AG3H 3HRUA 1Y8QB 4XLCA 4HQMA 2R7OA 2F4MB 3MZ8A 4JX5A 4BU2A 3N97A 3M4OJ 3PJRA 2ZXJA 3I56I 3MCZA 5KAIC 3H9JA 2XGCA 1X58A 4ZYHA 5E3LA 3MWMA 5L3EA 2DOEA 3TDZC 3EUAA 1S3JA 1W7PD 3IP4B 2ECBA 3ZXSA 5LBQA 1KQ0A 2DJIA 2JJ7A 5LGTA 2IXSA 2LREA 1KU7A 1QU3A 1T98A 3IH2A 2MFZA 1W0TA 3S93A 3GEZA 3JRAA 2CQXA 3CESA 1CF7A 1S5LC 3BR1A 4HSTA 4C3IJ 2FQ3A 4G6QA 2TDXA 1G3SA 3I9V2 3RDIA 3LNQA 4U0YA 2LDUA 2E7XA 2LNBA 1TW3A 4XIDA 2V7FA 2W1OA 3PNYA 4CCOA 5IT9K 2B63J 1U5TB 5EJCA 1QRYA 3G6EI 1WCMJ 4BXXJ 1FIAA 2RREA 3KZIC 4KA4A 2IGNA 3HXLA 3EQLF 4BQOA 3ZQQA 5J4YA 1UHMA 4XOTA 1VQ8I 3T5XA 2HZDA 2LOOA 2HDDA 3S1MJ 1BC7C 2LG4A 3PQJA 1ON1A 3O6BB 1TWAJ 5LGNA 3CMYA 1ZGWA 1T2KA 4BHBA 1MH4A 2CUEA 2QUFA 4HLYA 2EPFA 2FXAA 4OMZA 3HTUA 3S2WA 2KJBA 1B72A 1U5TC 5FB2A 4I2OA 2L7FP 4NBQA 5IOYA 3OYKA 2E7WA 1Z7LA 4HX8A 3DKXA 3WHBA 3H3ZA 1TZLA 1T6SA 4AD9A 2GLOA 3DBHB 4DGWB 4XSZF 2JUGA 3GUDA 4G94A 1R9TJ 4AU7A 5F1JA 1FX7A 4V2GA 2BZTA 2O61A 4YFXF 2YPRA 3BR2A 3BWGA 3H5RA 2R3SA 1MJBA 3FF5A 1STZA 2XF5A 4B44A 1XDUA 2A3SA 2IS6A 1W5CC 3ECOA 4HV5A 2HI3A 2YX4A 2FE3A 5E3NA 1J9IA 2O0YA 2GA1A 1P7IA 2QA4I 3MKLA 4F3QA 2VKEA 3A4CA 3D5LA 2OBPA 4M73A 3QPTA 2V6CA 2E1NA 3CCQI 2PMHA 5ED4A 2M0MA 1KYWA 3FKIJ 4R79A 2K4BA 2ELHA 3DPLC 5EZHA 2P0WA 3PFIA 4D7MA 2P7CB 2D2WA 1K6OA 1Z05A 2QBYB 4ZZDA 2F5CA 4ZYDA 5LD2C 3GTLJ 5F0HA 2W7NA 3IH4A 5FKLA 4E7JA 2R7UA 1U5TA 2L01A 4FQGA 3I0TA 2CQ7A 3PFYA 1P4WA 3GTGJ 5HS9A 3TP3A 1WGXA 2MGQA 2R7WA 3JREA 1XTAA 2FOWA 2VJ4A 1W36C 2R93J 4PSXA 3ZMVA 3DEUA 5GAEJ 3OR2C 4XKVA 4N4OB 2H1LA 4Z2YA 1W4MA 5CVVA 4CICA 3F21A 3CUQC 5L3BA 3BPXA 3BPVA 2LBFB 2COBA 4KMUX 3D0SA 5IP7J 1OYWA 2HDWA 4OIOF 3SDGA 1NG6A 5B66C 2ZFUA 1SMYF 1D0YA 2CWEA 2MH2A 3BZKA 1XMXA 3TL4X 3L1PA 3KPHA 1V54H 4NNJA 3RZDJ 2R92J 2K3PA 2WC2A 3ESWB 2E60A 3TMOA 4UXNA 3F8NA 2HYGD 2X6XA 3QU6A 2ELJA 3HSRA 3K7AJ 1XSXA 3KP3A 2PN6A 3MQ0A 2Q2EB 4DYRA 2K9LA 3JCUC 2FRHA 2Y75A 2J5PA 2NS8A 3K4NA 1LQ1A 4ESJA 3VSLA 2NNNA 1KGSA 1ZLJA 3JTGA 1ITYA 2X48A 5L3DA 3WGHA 1LJ9A 3V7SA 4BH9A 2FX0A 3KCCA 2V9KA 1WJDA 2V1DA 2M1BA 5J1RA 3M8JA 1HKQA 2CO5A 2V1XA 2QZ8A 2L5QA 1W5SA 3F8BA 3I4PA 4MTDA 1HF0A 5H6RA 5M5WJ 2EZHA 1G3TA 2DXIA 2Y30A 3LA2A 5EEHA 2M8EA 3HOYJ 1FPQA 1QQIA 4U7BA 4EJVA 3JRHA 3H92A 2PMUA 2PQ8A 2O03A 2VASA 3S3MA 4WXCA 1TQPA 3DBLB 3MEXA 4HEA2 2DMTA 2CMPA 2F4IA 2EFOA 2W4SA 3HOTA 1A5JA 1LDDA 1S29A 1FMVA 2XAFA 2KMUA 1FLIA 2Z1DA 4JYKA 4ENJA 4GFBA 3HSEA 1ON2A 1HQCA 4Y4RA 4HF2A 2EH3A 2CRGA 2EBIA 3VYSB 1HW5A 2LF7A 5D4SA 5M3MJ 2DA2A 1QO0D 1BIAA 3EUKL 3RJPA 2O8XA 4OIQF 4D7NA 1E17A 2H6BA 2VQGA 3A03A 1OISA 2L3DA 3HRMA 5HS8A 4XLAA 1RZ4A 3SQNA 1KU9A 2LY9A 3LMMA 1IF1A 4ESFA 3ABKH 1WSUA 1RPWA 3L2CA 4RLQA 2GOXB 2LRDA 4L9NA 2EINH 3SFIA 1ZN2A 1KQ9A 4RS8A 2HEOA 2P5LC 3CJNA 1D0XA 3QU3A 1OYYA 1V3FA 3HZJA 3BG3A 4FX0A 3L2RA 1QHGA 1R71A 1OCRH 2HR3A 4OIRF 3FM5A 4CXFA 5J47A 2VC0A 1HXDA 3DTEA 4LLLA 3GZNB 3S3NA 3ZQFA 4L18B 1B8IB 2EV0A 1HLVA 3DV8A 1IXSB 1YW7A 5FGMA 2IA0A 2VN2A 2NVQJ 2FBKA 4CYDA 1G2HA 3BJ6A 2O8KA 2STWA 4RMNA 2XSDC 3B02A 1VQ9I 4HBLA 2PEXA 1UJ8A 2HVSA 5E20A 4A5MA 2HOAA 2I5UA 3ASNH 3L2WA 1DP7P 1RETA 4BL0B 2DTZA 2WV1A 3S1QJ 3J81Z 1NG7A 3R6SA 3F23A 1AU7A 1UHWA 3ZQ7A 3I53A 3KP6A 1H9TA 3HKZN 2D45A 1GVJA 3KETA 3LFKA 2CUJA 2FA5A 3SHFA 1MKMA 1P92A 2VE8A 3V8JA 1MJ9A 4U7DA 2X1CA 3F8FA 1IRFA 4U0WA 5J6XA 3ZQCA 4BACA 2STTA 2LLKA 1YJ9I 4NQWA 3ULQB 3C3WA 3VDXA 1SEUA 2Z3YA 3TP0A 3HYIA 1SVMA 4CSWA 4OAYA 4XQFA 3OYGA 2R7FA 1VQ6I 3ZMUA 3AFHA 1BI3A 1T95A 4CZCA 2VKVA 4PFPA 1RKWA 4HYEA 1SAXA 1SFEA 2MH9A 3DXJF 1IRGA 5LHGA 4IHWA 1Z91A 4PJNA 3M8EA 3IL2A 2KP6A 2DT6A 1Y39A 1L3LA 3VSKA 1FEXA 4B4CA 3CJRB 2ETHA 2CUFA 3I64A 5BMZA 2G7UA 1FBUA 5KCMA 3KZYA 1P6RA 1TWFJ 3ZMSA 1VQ4I 3C2HA 1B4AA 2UZKA 5A2QK 4JBAA 1BOAA 2WA0A 1U8RA 5FD6A 2DDAA 3H36A 1BC8C 4EJWA 5B1BH 1ODDA 2P81A 3C7JA 1USSA 3RKYA 3HOWJ 2VPLA 1R5ID 2IP2A 1GDTA 4HW0A 4DYCA 1AHDP 3Q0WA 3GTPJ 4XSXF 4XMYA 2R7XA 2QVOA 4M6XA 4A3DJ 3OYBA 2DA6A 1MDMB 1BOBA 4W1UA 3K1PA 2VC1A 5JVGF 3E0JB 5TGTA 3OYHA 2LFBA 1SFOJ 2AQFA 3G1OA 4RB1A 1F4KA 1X1CA 4FT8A 2AHQA 1GUUA 1WI3A 4RLFA 5DEQA 4IHSA 5M5XJ 3HM5A 2JSCA 4ZDPA 2QWWA 2CU7A 4LLGF 3OYAA 3WG7H 2LH9A 3NAUA 4IO9F 4XR6A 1FSEA 2JA7J 1XD7A 1DQUA 2RKHA 1O7LA 3J80Z 3MVPA 3K4LA 3SZPA 5D5XB 4YG2F 2FEZA 4WWCA 2L7MP 4MHGA 3WTSC 4CYCA 3CP2A 2PBIA 1VNDA 4MLOA 3RKQA 1WVRA 4FETA 4XONA 2ID6A 2W00A 1M1EB 2HOEA 2JVGA 4IQ4A 3Q9VA 1ZREA 2KPMA 2PJRB 5LLQA 1WJ5A 1X3WB 1D1CA 4MEXF 4F7ZA 2HNHA 4L9VA 3ZMZA 4BEHA 1G3WA 2CG4A 4ANJA 4ZTJA 4BEHB 2E19A 2DOAA 1I5ZA 4HA8A 3W2WA 1SFKA 2DO7A 3TBIA 1V55H 4J01A 2OQRA 2H8RA 3P7NA 4I6ZA 1NK3P 4J19A 5HNHA 2C6YA 4FASD 3H1CA 5J3LA 3LSMA 2MD0A 2DU9A 2OZ6A 2XAUA 2P5VA 1GXQA 2HOSA 4DIQA 2L9SA 1MNMC 1X2NA 2K86A 2XKOA 2CS3A 4BQQA 1QPMA 2VQLA 3FXQA 2YX7A 2VKDA 3S17J 1QVUA 5BPDA 1IXCA 2L54A 4UVAA 2QF7A 2OJED 2K9MA 3QPLA 4P9UA 3TGNA 2F5FA 1FC3A 3WODF 3E97A 4AC0A 2MD5A 2EV6A 5F0CA 2H94A 2V9PA 4JX6A 3D5RC 1LVAA 4G8XA 2OC6A 5CPRB 4XBFA 4CCMA 5JR3A 4HLXA 3L2VA 5HODA 1LKXA 2HKXA 2RV8A 4LOCA 4UHTA 1ZGAA 4XLFA 4UVCA 4YRVA 2X85A 2XGXA 4ZDLA 1ZRCA 3JRBA 2P8TA 1SANA 2VQCA 4M3FA 1W7PA 2M87A 4GDFA 4KYWA 1X3UA 4XN3A 2L9RA 3U9GA 4C3HJ 2LBFA 4ZYEA 3D1NI 4BY7J 3V42A 1ETVA 5L3FA 1IGNA 4OAZA 1AKHB 5ICCA 3BQYA 4EJUA 3OOUA 2MA3A 3G3ZA 2MLGA 2KL4A 2R7QA 2XPVA 1QZEA 2K9QA 3FXOA 2PJRA 3NQOA 3BP8A 1MGTA 2ZB9A 4A3BJ 1K6YA 4L5EA 4XKWA 1OCPA 1I6HJ 2M9HA 2IPQX 4O6JA 4N9IA 3CCYA 2VT2A 2IBDA 3GFMA 3G1MA 4P9FA 4A12A 3EYIA 5IP9J 2L4AA 3JSOA 1MBJA 1OPCA 2O9LA 3IH3A 1OFCX 5B1AH 4XICA 4M3DA 4KN7X 3GW2A 1WPKA 2AXLA 5EZGA 4PUSA 4U0VA 4BHCA 4AVZA 1TWHJ 2F48A 2XPUA 3AG2H 3F22A 3GTKJ 2R7ZJ 2X6YA 3LQQA 5CYVA 3GYHX 3KYDB 3BTCA 2DT5A 2R7DA 2J5OA 4LG0B 2K4JA 3BJOA 3OYFA 3CUQB 1R1VA 4NB5A 5F1RA 4M74A 1UG0A 1R5GA 5FKOA 3JRFA 2PX9A 4LGWA 1TW2A 1FOWA 3GTJJ 4X6AJ 2X6WA 1KA8A 1A31A 2A05A 3E3VA 4MIMA 2IT0A 1LEBA 4NC8A 3JRCA 2JMWA 1IV6A 4CHUA 4LITA 3I4MJ 2X1EA 3AG4H 1ORKA 3GF2A 1D8KA 3SFZA 1P7JA 1PUFB 3F8CA 5FLXZ 3D5SC 2G9WA 2JT1A 2ZFWA 2I8DA 1XGMA 3GTQJ 3J80K 2OTJI 3CMAI 1U6GA 2BW3A 3DP7A 1O4XA 3L2UA 2WV0A 2K9NA 3SEQA 1GHCA 4E7LA 2NAZA 4Y15A 5BOXA 3ONQA 2MW8A 3BR5A 1Q1VA 3K6GA 2GXBA 5DD8A 1JGSA 2ECCA 2M4GA 4LG3A 5FROA 5EEGA 2OAZA 1FMWA 1RR8C 1LEAA 1XMAA 4RGUA 2XASA 1IW7F 3HOXJ 4O5VA 4ENMA 3F6VA 2RNGA 4A5NA 2Q2EA 2ZNZA 1LB2A 1RESA 4MGRA 3KP2A 1AWCA 2QBYA 1K7AA 4DOZA 4B3XA 2HQAA 3I58A 3FMSA 1B59A 2NS0A 3AL0C 1XC5A 2BYVE 1YRNA 1PJRA 1JUSA 3CCJI 4MQ9F 3SYTA 4Q5SF 5BPIA 1XGSA 2QENA 3BJAA 2DQLA 2MC3A 4FCYA 1IDZA 1DU6A 1MJAA 1HW1A 2MG4A 1LNWA 1SVLA 3T1BA 2Z5UA 3FIWA 3IHUA 4PZJA 1B6AA 4ITVA 2O6GE 3EUHC 2F4OB 5CLSA 3J7AO 4PJJA 2W48A 5HNFA 2BOLA 2XF6A 4IF4A 2CFXA 3CO7C 1OCZH 3P9CA 1LVKA 3R0JA 1A35A 3QWLA 3BTIA 3NARA 5JHFA 1Y1WJ 3WG9A 3UKGA 4BAYA 1UAAA 3RPQA 4YFNF 2CW7A 2ZXWH 4UV9A 5GTHC 1ZRFA 5FD5A 3VB2A 1O57A 3KFWX 4E7SA 1C0WA 2JWTA 3H5NA 5J1YA 1A36A 1E3PA 1ZG3A 5KK1A 2MYSA 2V9VA 5LHHA 4XLEA 2KLOA 4LG0A 2R4GA 3I59B 1P2FA 3M1EA 4QWQA 4H0EA 1JI8A 3AG1H 3OS1A 4LIVA 1J5YA 1S7EA 5E3MA 1R22A 5DUIA 1BR4A 2XSJC 2O7OA 1GVDA 3X2QH 2BHZA 2Y9YA 1U0JA 4LJZF 2UWMA 1XMKA 4S05A 1YJWI 1YS6A 2VXZA 2LYCA 5ICGA 3O8HA 1FT9A 3G1LA 1H88C 2Q0OA 1HA8A 5A2QZ 1IO2A 1NTCA 1UCRA 3WGIA 2MLKA 4ABZA 4EGYA 4IRGA 2EZIA 4QPQA 3WTWC 2VBWA 3WTVC 4BHPA 2A61A 1ZR4A 2DFIA 2FD5A 4KIFA 5E3OA 5D6FA 4XN0A 3EUHA 2QKLB 2WB1N 1ZAOA 4RB0A 1I27A 2E1MC 2ISYA 3GBGA 5H2FC 4JK1X 4D5FA 1T08B 2V1UA 1JTYA 3H5AA 3N05A 1R49A 4I99C 4HNUA 1QNTA 3E6BA 1WHUA 3ZQHA 2KIUA 5J1UA 2BE5F 5HVQC 1T33A 4M71A 3E5UA 5FRNA 1BA5A 1FTTA 3R60A 2FSWA 1S72I 2R7SA 3L09A 2Y0MA 4EJOA 1TWCJ 2Y31A 3P9KA 1D1BA 4BBRJ 1EJ9A 2JA6J 1JTXA 1WI9A 1WQ2A 3QP5A 3GFIA 1ZHFA 3WTTC 1DU0A 1X4OA 1O7FA 2EK5A 3I3LA 2AXTC 4A3EJ 4R1HA 4RGSA 3GVAA 3M3YJ 2HTJA 4BS9A 4G7HF 3P5JA 5D8LB 4FTHA 3OR1C 4XKCA 1Z7UA 2EIJH 4UV8A 5FLXK 1E3HA 4MFDA 4IOCF 2EA2A 4I0AA 2X9DA 4FISA 1BI1A 5E1XA 2XVCA 4XKBA 1D1AA 4JP0A 4IRIA 2BXZA 2XHKA 4IKFA 3DEWA 1T38A 4G7OF 2AO9A 2GIZA 3KLOA 4LK0F 2NNYA 3EYYA 4A3GJ 4R8HA 1MBEA 3BG7A 2QSFX 3HOUJ 1OR7C 1RUOA 1VQLI 3K70D 4E70A 2B0LA 1IN7A 3VFZA 3B73A 3GFLA 5J8CA 4BE1A 3W2AA 1WJFA 1F1ZA 4PJ0C 3MKWB 3L7WA 3ECHA 3OMYA 2IGOA 2RC4A 4KN4X 1MMGA 2LVSA 3IRQA 3JRGA 1VQKI 3C2GA 5CQGA 4UUTA 5CVUA 6PAXA 3VOEA 2W25A 1ETYA 4IQJA 2OV7A 3FBNB 5FRMA 1I3AA 3ZPLA 3LOCA 5K7FA 2KRCA 5IT3A 1VF9A 2BVMA 1ZELA 1MSFC 2IA2A 1UHSA 2FMYA 4KISA 1FP2A 1K61A 2F5EA 3HIFA 3OYDA 3PNVA 4CCNA 3VODA 1G4DA 3H35A 4G6DA 2QEXI 2ACJA 3ERMA 2DA5A 5EF6A 4CZZA 2BY3A 3MN2A 3L2QA 3CC4I 3IWFA 3LL7A 1VTNC 1PP8F 3EETA 1NK2P 3BZ6A 2VJIA 4BQNA 3R61A 3MAJA 2IGMA 5EGOA 1WKMA 2I10A 2DT7B 2DMNA 1Z9CA 4RGRA 1J7KA 1HSTA 4XLHA 2BY2A 1REPC 3W6KB 3H9QA 4N9HA 4A3MJ 3OSGA 5HS7A 2CW8A 3A1YA 5GP9A 1TLHB 3I5UA 4QTRA 3CCMI 4AYBA 5DM6F 1O3SA 2V1NA 1YHQI 4EQQA 3DLAA 3FMRA 4UY8I 2YUSA 1ZK8A 2WY7Q 1IN8A 4IHXA 4AUXA 1U9OA 1GT0C 1DGWY 2WADA 3V4GA 2VL8A 1OMIA 2FU4A 1RC9A 1CGPA 3DU6A 2BY0A 2CYYA 3QRFF 2EV5A 4QLCU 3JRDA 2Q1ZB 2PLYA 2JSPA 4UVBA 1S9HA 4C30A 2E5ZA 3TW6A 3V8LA 1OLTA 1T0FC 4M72A 3VYUB 1X2MA 4L9TA 1RUNA 2NVYJ 4Y3OA 1FOXA 2O5RA 1ZYRF 5DM7F 1RR7A 1G6NA 5CJ9A 4L9JA 2E2IJ 4KITB 1Y0UA 4IJAA 2KZGA 1WJBA 2VIXA 4RAZA 3ZR8X 5JVTA 4LLNA 2L0KA 2B7EA 3GO5A 2Z9OA 1A6QA 1MMDA 4NC6A 4YIFA 3HBLA 1FOYA 2DA1A 2H8WA 1L0OC 2K3FA 3OYCA 1ERDA 5B5EC 3Q5FA 1K78B 1ETQA 2JRMA 4PGGA 3K1MA 5GPCA 4LB5A 3ISPA 1JHHA 1B9NA 3DEEA 1YLFA 2GZWA 4G6TB 4ZH4F 4A3LJ 3PNTA 4D1QA 2NS7A 5E8GA 1YOVB 2ZSHB 1TL8A 1SD5A 4KDPA 1W1WE 1S7OA 3GWZA 1IZ1A 5CKTA 1J75A 4KFCA 1TP4A 3HTSB 3LWFA 4BNCA 4M3GA 5JI6A 2NOJB 1ONVA 1UG2A 2QGUA 3E7LA 3HOSA 1K4SA 1BI0A 4PJLA 5F0FA 4D5CA 1ZG1A 5LGUA 1MH3A 5ICFA 2YU9J 1WWXA 4F92B 3TEDA 3S2HJ 2OCEA 4ETSA 4MQVA 1QPIA 4Y17A 2VUMJ 1UMQA 1R58A 3I54A 4HNTA 2ZJRF 1O3TA 1FJLA 1E0EA 4B3AA 4I7HA 1XDSA 4NUBA 1ZQ3P 3K4KA 2BBYA 1X4PA 3S32A 3QP6A 4YIRX 4RBOA 1MMAA 4B09A 4WXDA 2RQQA 3E5XA 2P5KA 3GLLA 3DTKA 1WJAA 3ASOH 3COAC 2A6TA 3EDPA 4HV6A 1K83J 3HJEA 2HPIA 1H9GA 2ZJPF 4Q47A 5HLHA 2JVHA 2M30A 3RYPA 2XAHA 2KRHA 3R0AA 1ENHA 3DF8A 3WE2A 4HNVA 1B1BA 3LSHA 4RAYA 4AYBN 5TRDA 2H27A 3A2KA 1GV5A 5IYBJ 1TWGJ 1ULYA 5DD4A 1P9QC 2VOOA 3VYRB 4LD5A 3JAMZ 4F93B 4AWXB 1YS7A 2OA4A 3BY6A 4NHJA 1B8IA 2E34A 3NWSA 3FISA 3SJMA 1MBFA 2XROA 4DBRA 3PM1A 2DODA 2W57A 1HSJA 2DFEA 4G7ZF 2VQHA 4II3A 4EM0B 2CQKA 3H0GJ 3ZMTA 1S8NA 2L02A 3KEQA 2HXIA 5AIQA 5GAHJ 2LKXA 2HWVA 2LKSA 3RSNA 2IAIA 2ZCWA 1KZHA 2GQQA 5TJJA 1BW6A 1XX5A 5FLVA 1DGRM 3GZ6A 2IEKA 3SXYA 2KZVA 5FFZA 1VQ5I 1VQOI 2ZMEC 3W2VA 3DWLE 1ETOA 3BC8A 4MEYF 2W24A 1R4NB 2WAQA 5BQTA 3G2BA 2VKHA 2XPWA 1D0ZA 2FBIA 5GADJ 3EPZA 5K5OA 3J7YJ 4YELA 1MMSA 2LR8A 1CF7B 1DPRA 1X1BA 3CUQA 3FXUA 1YTYA 1YIJI 1XCVA 5GTIC 4FE4A 3HOZJ 2EQRA 4IOAF 3T8TA 4XRFA 2VBXA 3KP5A 4BE0A 1JKOC 3CC2I 4MTEA 2A07F 4HSRA 2E1OA 4AIKA 3GZ5A 5AONA 1ETWA 4RM2A 4WF2A 1QZYA 1TTYA 2EZKA 1V4RA 3ZRGA 1PUFA 5HDKA 2R5ZB 4HQEA 5JHUA 5FLMJ 2HQRA 3BOQA 2P6TA 3Q3SA 1N77A 1FNNA 5D6EA 1SD7A 1Z3XA 1ZARA 2P6SA 1YITI 2DOFA 3SZTA 5JLXA 4DQ2A 2RN7A 4KNYA 1IG7A 3OY9A 3GLXA 2RQPA 3V7CA 2OUMA 2QYOA 3A02A 2ZMEA 3P9IA 2OZUA 5H20A 3KYLA 2QSGX 2KIFA 3FXRA 5IPAA 3CDIA 2H6CA 3TO6A 2OU2A 1O3QA 4BXUA 2CH0A 3FDYA 5DTDA 3KYCB 3LSTA 1XN7A 1TNTA 3MZYA 3ELKA 3G71I 2L7ZA 4A3FJ 1IRXA 3DFGA 2ICWG 3FWEA 5FKKA 3GMEA 3GX4X 4DZPA 3CQZJ 2XB0X 1K4TA 4HAMA 3E1SA 2QKMB 3FZVA 2IS1A 4ESBA 1TBXA 3ML6A 4AIJA 4C2UA 5D5VB 5DCMB 3K9TA 2ZXIA 2ZKZA 3N4MA 3OWTA 2V79A 1VI0A 3B6CA 5IT9Z 1R36A 3FK7A 2M0CA 3JRIA 1F43A 1SD6A 1MBHA 5EDNA 3F8MA 3M1CA 3PO3J 1ZRDA 1W36D 4DNCA 2VBYA 2VJJA 2QSHX 1E2XA 3UNGC 5D5UB 2XDVA 2XAGA 2Y0SA 3ABUA 4EJTA 4BE2A 1Y56A 5HLGA 2MBFA 3OYJA 1UB9A 3R4KA 3TQNA 2JTVA 3QODA 1NH3A 2XAQA 4RM3A 2WB1A 1O3RA 4FX4A 4DZJA 4YFKF 1W5TA 1DP3A 3J81K 3LSRA 5DCFA 2HYJA 3BR6A 3VPRA 5D4RA 3BDDA 4U88A 5LFAA 2GA2A 4IL6C 3A0BC 3H3VK 2DDBA 2HVQA 3KP4A 3DPUA 2GOMA 2K02A 4IEJA 1PP7U 4EVIA 2WAQN 3LAJA 2PFBA 4GGGA 2TRTA 2CV0A 3F9KA 4S0HB 3WTZA 2ID3A 1ETKA 1LFBA 4A3JJ 3U2RA 2LMDA 1A04A 1EH7A 1YQAA 2V4JC 2HPMA 2F5VA 2DQRA 1PUEE 4AIDA 2LY1A 2R5ZA 2EWNA 3CCRI 3HEFA 2VB6A 3S14J 4BXFA 4ZJZA 4BJTA 3MKZA 2JK3A 1Y0NA 3K2AA 1HDPA 3HDDA 2XGDA 3BZCA 2EIKH 3Q0VA 5B3SH 3V8KA 4EGZA 2GM4A 1CQTA 4MNUA 9ANTA 1KU2A 5CVJA 4N4NB 2Y69H 2CW0F 1X1DA 2FBHA 1PVEA 2F2EA 2VBZA 3U1DA 5C3EJ 3IV5A 1B72B 1OCCH 1EH8A 2RAEA 3LFUA 5C44J 2NOGA 2ZBKA 5HOOA 5FO5A 2DYSH 3IAS2 3OYIA 1SFUA 5E1ZB 4UNOA 1TQMA 2G7HA 2XIGA 3LSKA 2H09A 4A6DA 2JA8J 3ABMH 5HLIA 5J4VA 2Z33A 2E2JJ 4A3KJ 2EFWA 2RDPA 2DN0A 3T8RA 1QBJA 4F55A 4HDUA 1J59A 2ZXHA 1PDNC 1XSVA 2NVXJ 3WU1B 3QQAA 4JX4A 2M3AA 1IN5A 2RVCA 4KIBA 3TKYA 4YEJA 2WAFA 1ZTRA 2DFFA 4M9XA 1VQMI 3KX2A 4UUSB 3O8GA 1WFXA 3TO9A 4QIWN 4RDUA 1FOKA 2IW5A 2Y2ZA 2OTLI 3M07A 3NEUA 2WWYA 1XCBA 1ZR2A 4Y33A 1I3QJ 3ZMDA 2Y9ZA 2CV1A 3BG9A 4KUMA 1N78A 2DLLA 2VT3A 4X0GA 2A5YB 1R1TA 1E3OC 4LK1F 4DJAA 5H6QA 3KE2A 2YSRA 1HOMA 2XGEA 2FJ1A 3OIOA 1MNEA 1UFMA 1DPUA 3HG9A 1OJLA 2A6HF 1Y6IA 1XB4A 3WGGA 3JR9A 4OMYA 2XF7A 3CLOA 4ON0A 1K78A 2GXGA 4C2MJ 5M5YJ 3FXMA 4BJ5C 5K7ZA 5BS6A 1QHHD 3LA3A 1MZBA 5M3FJ 1MSEC 3JSPA 2CJJA 5GAGJ 1HBXG 4FHTA 4B47A 2IRFG 3ZQGA 2CUZA 3DKWA 3CCSI 4B48A 4A0XA 1YX3A 3MFKA 4QSHA 3W3CA 1TQIA 2CGPA 1Z1DA 1D5VA 2BV6A 4P1WA 4G9YA 4TV7A 4E4HA 2KIMA 5ERIA 5F64A 2LK2A 1FYMA 4EM2A 2FMLA 4HX4A 1TNSA 2M5WA 2CSOA 1F36A 3CLQA 1MNDA 1Z6RA 3MMYB 1KQ8A 4M3BA 5DS9A 2COMA 2DA7A 2QLZA 5LHIA 2BVLA 4ASNA 1HKTA 2HU9A 2DFHA 3FX3A 3DLLF 4XRMA 4A3CJ 1BJZA 1BBYA 4H4KC 4BJ6C 4FE7A 3QYEA 1X1AA 2WBMA 3G73A 3VEPA 2X6OA 1V5GA 2GAUA 2KDZA 1U8BA 4IHTA 4EM1A 2JQ7A 3K4JA 1IRZA 2ME6A 3MZHA 3OYMA 3QOPA 2DW4A 2Z99A 4GYIA 1GV2A 1U3EM 1T8IA 1W0UA 1HW2A 1F5TA 2A6EF 2M7AA 2KJCA 2DMUA 2XRNA 4E7ZA 2M4KA 1Z67A 3HSFA 5D5WB 2TCTA 4LB6B 3HGGA 3RTRA 2XC7A 1K79A 1HKSA 4D0PA 2DK5A 4Z6YA 3K0LA 3L00A 2K7LA 2ISZA 2HQNA 1FP1D 3QAHA 4CUGA 2XRLA 5HLTA 4KT5C 3IKTA 3IRRA 1JJ6C 4CCLA 1SMTA 5E18F 2JA5J 3DTIA 4LMYA 4PFOA 2V6EA 1P4AA 2MABA 2X4HA 1APLC 3AL0B 5DCMA 5EEAA 1JJ8C 3FHZA 3LQRA 1I39A 1JT0A 4ZDOA 2OQGA 2WY8Q 3FBIB 3LSJA 2W84A 4P5OA 2O3FA 4GXOA 3F0CA 3QYFA 1MIJA 2NVTJ 1XS9A 5KAFC 2UXXA 3KEOA 4BGDA 2R7VA 3OS2A 3HRSA 2ADUA 3DPTA 1D8JA 2H1KA 2EIMH 2VPRA 3KLNA 3O2PE 4I0BA 4UB8C 1IDYA 4EMSA 3E5QA 4OU0A 3CF5F 2X0LA 1YI2I 1IUYA 4XL9A 2D1VA 1EKEA 1IUFA 2L7KA 2DPDA 3JAMK 1I1SA 2CQQA 3PIPF 5KHDA 4UUSA 4IX7A 2ME0A 3HB9A 3ERED 1WH7A 3W6VA 3ZQIA 3NWTA 2JA2A 2EA4A 2M2EA 2L9NA 4J00A 4WX9A 4AM3A 4RA2A 3OYLA 3VWBA 4CA0A 2R0QC 3ZCOA 4Y7NJ 2K9SA 3I59A 4O3MA 5AIPA 2P7VB 3I71A 1I1GA 3BLYA 3HRTA 4IHVA 1ETXA 3WE3A 4P55A 5JLWA 4GRIA 2Z2SB 5HDNA 4IRHA 1MBKA 1IC8A 5EG0A 3CMEI 2X1DA 3LSIA 5CVRA 2A68F 4L0YB 3O3KA 2OPTA 3OYNA 3CJQB 3V7RA 1R4MB 5LRRA 2CV2A 1G3YA 4Y13A 2VOPA 2UV1A 4WK8F 1IN6A 2F5DA 1G59A 4ZTFA 4CH7A 4HF0A 1YE9A 1FYKA 2K85A 1MMNA 4LIUA 2N8GA 4WCGA 3HGYA 2HXOA 5TISC 2EJRA 4ZYGA 1BM9A 1RIOH 1R23A 5DDGA 3JW4A 2DA4A 2FNPA 2K27A 3WU2C 3LSPA 5LEJA 1X3ZB 3WTXC 3W6JB 3H0DA 1YW8A 1FSHA 3BTLA 2RGVA 2PMZA 4XLPF 1EH6A 2D5VA 2VODA 3GTOJ 2GXAA 3ZN1A 5GPAA 2DJNA 3IC7A 1RNLA 2YS9A 3PSIA 1U9NA 1BI2A 3F72A 5E1WA 1IJWC 3FXLA 2IJLA 4IPAA 4F52A 4CGZA 4A69C 1T56A 5FKNA 3HHGA 1LFPA 4E7HA 2G0EA 4A93J 1EF4A 3OYEA 5J40A 4L0ZB 1S6LA 2M34A 2X51A 4I01A 1IV8A 3WTUC 3E6CC 1V5FA 1F9NA 1XGNA 3A0HC 2PG4A 1QVTA 2ZC2A 3K1NA 5L3CA 1NHAA 4C2TA 3VYTB 2GIVA 5IOZA 3RQIA 2DBBA 4K2EA 5ILVA 4XRSA 5F04A 5FFXA 2AQEA 4I98B 3DQVC 4ENKA 1ZH5A 1TT0A 3DKYA 1LDJA 4CYCB 2E71A 3H9GA 4LFUA 4OOIA 2XUBA 3CCLI 3S1NJ 3PQKA 1SVOA 3K4BA 3TDUC 1ZLKA 1UZCA 1ACIA 1B9MA 2WTEA 1J09A 3WHCA 3BG6A 4CDGA 1DDNA 2LF8A 1OKRA 3PUBA 5L3GA 1HDDC 3RZOJ 2OD5A 4RAGA 3I55I 3REOA 1OCTC 3HHHA 3K10A 3M9AA 4XORA 3QPHA 1OCOH 4PSWA 4Q48A 5F08A 1VQPI 3TO7A 2ZJ2A 2LKPA 4EEFG 3OV8A 3IWZA 1MBGA 3LSGA 1R00A 4NDLA 2D1HA 3S3OA 2ZNYA 2F6CA 2BEOA 3E6MA 2M8GX 2Q8KA 3ZGKA 3C2BA 1JE8A 1BW5A 3HPGA 4HPQA 5D8KB 4G12A 5C4JJ 2E1CA 4Y52J 1YG2A 3L9FA 2RNJA 1VFCA 3KIOA 2M45A 3S2DJ 2W82A 3F3XA 5FKMA 2QQBA 3DU5A 2IS2A 4UUVA 4AVPA 2NXNB 3IUOA 1X19A 2LSOA 4PJMA 1Z0XA 1R1UA 1N75A 2OCCH 3C1DA 4ENNA 1ZG5A 3FXKA 1U78A 1YW9A 3RPUA 3BCAA 2ZO4A 3RQ4A 2BY1A 2LY2A 5ILUA 3QYBA 1ZKGA 2YR2A 3TOAA 4M6YA 2FF4A 3G4SI 2DMQA 4B1RA 3OL3A 3S1RJ 3K69A 1YRNB 1USTA 3Q9SA 2IGKA 4B43A 1KONA 3PO2J 1OQYA 2HFHA 4CCJA 1R6RA 2HQ5A 3BG5A 4A6EA 4E7IA 3DBRB 3KP7A 2L9VA 2IA1A 3CF2A 2EFPA 4OWRB 4WXHA 3IKVA 3M7GA 4XLNF 4RB3C 1AOYA 3I4NJ 1J2XA 2HS5A 5HDGA 3FK6A 3OL4A 3GTMJ 3SZGA 4RB2C 1H89C 2R5YA 5ILSA 1SFXA 4IZZA 1IXRC 3ROUA 5LEKA 3OS0A 5J8FA 3CC7I 3BCBA 3CDHA 2ZSIB 1POGA 5IYCJ 3Q0UA 2R7TA 2UUZA 3CJTB 2FOKA 4JOMA 2CQNA 4ZC3A 1TC3C 1FYLA 3BROA 3RKWA 2HDCA 1D5YA 2HYFA 2OF7A 4PCQA 1LPQA 1Q1HA 1Z3YA 4PGHA 2ESNA 2DI3A 1BL0A 2LC2A 3K4MA 4EATA 2EFNA 4GCVA 3CMMA 3SEZA 3J7AY 4XM3A 2VI6A 2K40A 4A2UA 2KRFA 3J7ZI 1H8AC 4EV0A 1XPXA 3CD6I 1I50J 1RI7A 2JPBA 2W85A 3RKXA 2VE9A 5C4XJ 1VQNI 2A69F 5BNGA 4XRSG 1T39A 1BIBA 2JZYA 2VJ5A 1JHFA 3QPSA 4V19K 5EGOB 1WH5A 3CTAA 2V26A 5K7HA 2DTRA 1JGGA 1IN4A 2HZTA 2BW3B 2FUG2 2KIQA 5E17F 5K5QA 2JUCA 3UR3C 1AKHA 4BQAA 3K2ZA 2EFQA 1D3YA 4C3JJ 3AKZA 5IYDJ 4PDKA 2QQ8A 5F6FA 3CP8A 4YIIA 1YJNI 3FKJA 4HX7A 2GWRA 2ELKA 3PIOF 4M9SA 1LDKB 3U1KA 3WU0A 1JUPA 2KT0A 5E79C 1G8XA 1W7PB 2HOTA 2E2HJ 3HUGB 2E36A 2MC4A 2LTPA 2PI0A 3S15J 4DW6A 3A01A 2HTSA 2M7BA 1HCRA 3RPUD 4CO8A 1GXPA 4UB6C 2UXNA 1QGPA 4PK4A 2AS5F 4RAFA 3S16J 3CUOA 2DCEA 4BYYA 1RKTA 2XAJA 3GFJA 1XGOA 2QQ9A 4ZZLA 3BTJA 4DYQA 3K4CA 2LD5A 2DK8A 4M3EA 1EA3A 3RI4A 2ESHA 3FXJA 2CFOA 2JRTA 2DPUA 1ZGJA 4RGXA 4M9ZA 2BGCA 4MFEA 3GXOA 3S8PA 4KICA 3ZN0A 4BKXA 4BDYA 4D9JA 1WRJA 3NRVA 2WAEA 3HOVJ 1RRJA 1BR1A 3ZOBA 4Q4ZF 2L4MA 4BUPA 2KQRA 3CZ6A 2YU3A 4OIPF 3M8FA 2EILH 2PJPA 4W97A 2R5YB 3C18A 2KFDA 3BT9A 1SAUA 5CQEA 4A0ZA 2DAOA 2Y0SN 4L5IA 1VQ7I 1Y1VJ 4AIHA 1Z77A 4DBQA 5IP6A 4BDZA 2R7RA 1LE8B 3HC7A 1BN5A 1H0MA 1MD0A 4B8XA 1LE8A 3F6OA 2FQ4A 4P96A 2NYXA 2XB5A 1WJCA 1JKQC 2L2OA 2KHMA 2QCOA 2JPCA 2QQAA 4V2FA 3ABLH 5KNLA 1JUMA 2DMPA 2NVUB 3IAM2 3BQZA 4MO7A 3HL2A 1U2WA
chains in the Genus database with same CATH topology
4L5JA 4I02A 4A0YA 1IAWA 1OR7A 4HDVA 3FMQA 1FBQA 1OYIA 3LAPA 2VONA 1XSDA 1R5HA 3CO6C 1KYZA 4I09A 4N0BA 3HUGA 5ICEA 3JTHA 1YFHA 1R7JA 1SD4A 1FBSA 1I6XA 4KMFA 1P4XA 2FNAA 5DV5A 5DYMA 5JFRA 1YO5C 1QZZA 1JXSA 1BJAA 5K1YA 3KZZA 4IVNA 2HKOA 3TOBA 3ZP5A 4HZFA 1T0FA 5LRSA 4JQFA 3H3UA 4HOBA 3WTYC 1DUXC 3RYRA 2HGCA 2QM3A 1MDMA 2P4WA 1FWZA 4GO1A 4KIGA 2ZMEB 1Z6TA 2Y48A 1KU3A 1S7AA 4HF1A 3T0YA 1FY7A 5DUKA 4IXAA 3FM3A 2XKPA 2NRAC 5CVIA 2IVMA 1YIOA 1YYVA 3ABTA 4GYGA 1FZPB 3RIRA 5E8IA 4OINF 2EB7A 5K5RA 1J0RA 2KKOA 2XV4S 5KVRA 4S04A 3LA7A 3OOPA 3E6DA 3AAFA 1EV7A 3HRUA 4HQMA 3N97A 2ZXJA 3MCZA 4ZYHA 3MWMA 5L3EA 3TDZC 1S3JA 1W7PD 5LBQA 1KQ0A 5LGTA 1KU7A 1T98A 3GEZA 1CF7A 2FQ3A 4G6QA 2TDXA 1G3SA 3RDIA 4U0YA 2LDUA 2E7XA 2LNBA 1TW3A 5IT9K 1U5TB 4KA4A 3EQLF 1UHMA 3T5XA 1BC7C 3PQJA 1ON1A 3O6BB 5LGNA 1T2KA 4BHBA 2QUFA 4HLYA 2FXAA 4OMZA 3HTUA 3S2WA 2KJBA 1U5TC 5FB2A 4I2OA 2E7WA 4HX8A 3H3ZA 1T6SA 4AD9A 4XSZF 4G94A 3GUDA 1FX7A 2O61A 4YFXF 2YPRA 3BWGA 2R3SA 1MJBA 3FF5A 1STZA 1XDUA 2A3SA 4HV5A 3ECOA 2YX4A 2FE3A 1J9IA 2O0YA 2GA1A 3D5LA 2OBPA 4M73A 3QPTA 2V6CA 2E1NA 2PMHA 5ED4A 1KYWA 4R79A 2K4BA 2ELHA 3DPLC 3PFIA 2P7CB 2D2WA 1K6OA 1Z05A 2QBYB 4ZZDA 2F5CA 4ZYDA 1U5TA 2L01A 3I0TA 1P4WA 5HS9A 3ZMVA 3DEUA 4Z2YA 1W4MA 5CVVA 4CICA 3F21A 3CUQC 5L3BA 3BPXA 3BPVA 4KMUX 3D0SA 4OIOF 1OYWA 1SMYF 2CWEA 2MH2A 2WC2A 4UXNA 3F8NA 2HYGD 3QU6A 3HSRA 1XSXA 3KP3A 3MQ0A 2PN6A 2FRHA 2Y75A 2J5PA 1LQ1A 4ESJA 2NNNA 1KGSA 1ZLJA 3JTGA 5L3DA 3WGHA 1LJ9A 3V7SA 4BH9A 3KCCA 2V1DA 2M1BA 1HKQA 2CO5A 2V1XA 2QZ8A 1W5SA 3F8BA 3I4PA 4MTDA 5H6RA 1G3TA 3LA2A 5EEHA 2M8EA 1FPQA 4U7BA 1QQIA 4EJVA 3H92A 2PMUA 2PQ8A 2O03A 4WXCA 1TQPA 3MEXA 2EFOA 3HOTA 1LDDA 1S29A 2XAFA 1FLIA 4ENJA 3HSEA 1ON2A 1HQCA 4HF2A 1HW5A 2LF7A 5D4SA 1QO0D 1BIAA 3RJPA 2O8XA 4OIQF 1E17A 2H6BA 2L3DA 3HRMA 5HS8A 1RZ4A 3SQNA 1KU9A 1IF1A 4ESFA 1WSUA 3L2CA 4L9NA 1ZN2A 1KQ9A 4RS8A 2HEOA 2P5LC 3CJNA 3QU3A 1OYYA 1V3FA 4FX0A 2HR3A 4OIRF 3FM5A 4CXFA 2VC0A 1HXDA 4LLLA 4L18B 2EV0A 3DV8A 1IXSB 1YW7A 5FGMA 2IA0A 2VN2A 2FBKA 4CYDA 3BJ6A 2STWA 3B02A 4HBLA 2PEXA 5E20A 4A5MA 1DP7P 3J81Z 3R6SA 3F23A 1UHWA 3ZQ7A 3I53A 3KP6A 1H9TA 2D45A 1GVJA 3KETA 3LFKA 2FA5A 3SHFA 1MKMA 1P92A 2VE8A 3V8JA 1MJ9A 4U7DA 4U0WA 3F8FA 1IRFA 5J6XA 2STTA 4NQWA 3ULQB 3C3WA 2Z3YA 3HYIA 2R7FA 3ZMUA 1BI3A 4HYEA 1SAXA 1SFEA 2MH9A 3DXJF 1IRGA 5LHGA 1Z91A 3M8EA 3IL2A 1L3LA 2ETHA 3I64A 5BMZA 2G7UA 1FBUA 3KZYA 1P6RA 3ZMSA 1B4AA 2UZKA 5A2QK 4JBAA 1BOAA 1U8RA 5FD6A 1BC8C 4EJWA 1ODDA 3C7JA 1USSA 3RKYA 2IP2A 4HW0A 4XSXF 2QVOA 4M6XA 1MDMB 3K1PA 2VC1A 4RB1A 1F4KA 4FT8A 5DEQA 4IHSA 2JSCA 2QWWA 4LLGF 1FSEA 1XD7A 2RKHA 1O7LA 3J80Z 3SZPA 5D5XB 4YG2F 2FEZA 4WWCA 4MHGA 3WTSC 2PBIA 2HOEA 3Q9VA 1ZREA 5LLQA 4MEXF 4F7ZA 4L9VA 3ZMZA 1G3WA 2CG4A 1I5ZA 4HA8A 2DO7A 2OQRA 3P7NA 2C6YA 2DU9A 2OZ6A 2P5VA 1GXQA 2K86A 2XKOA 1QPMA 3FXQA 2YX7A 5BPDA 1IXCA 2L54A 4UVAA 4P9UA 3TGNA 2F5FA 1FC3A 3WODF 3E97A 2MD5A 2EV6A 2H94A 1LVAA 4G8XA 4XBFA 5JR3A 4HLXA 2HKXA 2RV8A 4UHTA 1ZGAA 4UVCA 2XGXA 1ZRCA 2P8TA 1W7PA 2M87A 4KYWA 1X3UA 3U9GA 4ZYEA 5L3FA 5ICCA 4EJUA 2MA3A 3G3ZA 2MLGA 3NQOA 3BP8A 1MGTA 2IPQX 4O6JA 4N9IA 2VT2A 3GFMA 4P9FA 4A12A 3EYIA 2L4AA 3JSOA 1OPCA 4KN7X 3GW2A 2AXLA 4BHCA 4U0VA 3F22A 3LQQA 5CYVA 3GYHX 2DT5A 2R7DA 2J5OA 4LG0B 2K4JA 3BJOA 3CUQB 1R1VA 4NB5A 5F1RA 4M74A 1R5GA 4LGWA 1TW2A 1KA8A 1LEBA 3E3VA 2IT0A 4CHUA 3GF2A 1D8KA 3SFZA 3F8CA 5FLXZ 2G9WA 2JT1A 2ZFWA 1XGMA 3J80K 1U6GA 3DP7A 2WV0A 1GHCA 2NAZA 4Y15A 5BOXA 2GXBA 5DD8A 1JGSA 5EEGA 2OAZA 1LEAA 1XMAA 4RGUA 2XASA 1IW7F 4ENMA 4O5VA 3F6VA 4A5NA 2Q2EA 2ZNZA 1LB2A 4MGRA 3KP2A 1AWCA 2QBYA 1K7AA 3I58A 3FMSA 1B59A 2NS0A 2BYVE 4MQ9F 4Q5SF 5BPIA 1XGSA 2QENA 3BJAA 2DQLA 2MC3A 1MJAA 1HW1A 1LNWA 3T1BA 2Z5UA 3IHUA 4PZJA 1B6AA 2O6GE 5CLSA 3J7AO 4IF4A 2CFXA 3CO7C 3P9CA 3R0JA 3WG9A 4BAYA 3RPQA 4YFNF 4UV9A 1ZRFA 5FD5A 3VB2A 1O57A 3KFWX 1C0WA 1ZG3A 5KK1A 2V9VA 5LHHA 4LG0A 3M1EA 3I59B 1P2FA 4QWQA 4H0EA 1J5YA 1R22A 5DUIA 4LJZF 2UWMA 1XMKA 4S05A 1YS6A 2VXZA 5ICGA 1FT9A 2Q0OA 5A2QZ 1UCRA 3WGIA 2MLKA 4EGYA 4IRGA 3WTWC 2VBWA 3WTVC 4BHPA 2A61A 2DFIA 4KIFA 5D6FA 3EUHA 1ZAOA 4RB0A 1I27A 2ISYA 4JK1X 2V1UA 1QNTA 3E6BA 2KIUA 2BE5F 5HVQC 4M71A 3E5UA 3R60A 2FSWA 3L09A 2Y0MA 4EJOA 3P9KA 1WI9A 1WQ2A 3QP5A 3GFIA 1ZHFA 3WTTC 1O7FA 2EK5A 4R1HA 4RGSA 3GVAA 2HTJA 4G7HF 5D8LB 1Z7UA 4UV8A 5FLXK 2EA2A 4I0AA 1BI1A 5E1XA 2XVCA 4IRIA 4G7OF 2XHKA 1T38A 3KLOA 4LK0F 2NNYA 3EYYA 4R8HA 1RUOA 4E70A 2B0LA 1IN7A 3VFZA 3B73A 3GFLA 5J8CA 1F1ZA 3L7WA 3ECHA 2RC4A 4KN4X 3IRQA 5CVUA 6PAXA 3VOEA 2W25A 3ZPLA 5IT3A 2IA2A 2FMYA 1FP2A 2F5EA 3HIFA 3VODA 1G4DA 4G6DA 2ACJA 4CZZA 3IWFA 1VTNC 1PP8F 3EETA 3BZ6A 3R61A 3MAJA 1WKMA 1Z9CA 4RGRA 1J7KA 1HSTA 1REPC 3W6KB 4N9HA 5HS7A 1TLHB 3I5UA 1O3SA 4EQQA 3FMRA 1IN8A 3V4GA 1OMIA 2FU4A 1CGPA 2CYYA 3QRFF 2EV5A 4QLCU 2PLYA 4UVBA 3V8LA 4M72A 4L9TA 1RUNA 1ZYRF 1G6NA 5CJ9A 4L9JA 1Y0UA 4IJAA 4RAZA 5JVTA 4LLNA 3GO5A 2Z9OA 4YIFA 1L0OC 1K78B 3Q5FA 4PGGA 3K1MA 4LB5A 3ISPA 1JHHA 1B9NA 1YLFA 2GZWA 4ZH4F 5E8GA 1SD5A 4KDPA 1S7OA 3GWZA 1IZ1A 1J75A 4KFCA 3HTSB 3LWFA 4BNCA 5JI6A 1ONVA 3HOSA 1BI0A 1ZG1A 5LGUA 5ICFA 1WWXA 4ETSA 4MQVA 4Y17A 1R58A 3I54A 1O3TA 4I7HA 1XDSA 2BBYA 3QP6A 4B09A 4WXDA 3E5XA 2P5KA 3COAC 3EDPA 4HV6A 1H9GA 4Q47A 5HLHA 2M30A 3RYPA 2XAHA 3R0AA 3DF8A 3WE2A 1B1BA 4RAYA 5TRDA 2H27A 1ULYA 5DD4A 2VOOA 4LD5A 3JAMZ 4AWXB 1YS7A 2OA4A 3BY6A 4NHJA 2XROA 2W57A 1HSJA 4G7ZF 4EM0B 2CQKA 3ZMTA 1S8NA 2L02A 3KEQA 5AIQA 2HWVA 2ZCWA 2GQQA 5TJJA 3GZ6A 3SXYA 5FFZA 4MEYF 2W24A 5BQTA 2FBIA 5K5OA 1CF7B 1DPRA 3FXUA 3CUQA 1YTYA 1XCVA 3T8TA 4XRFA 2VBXA 3KP5A 4MTEA 2A07F 4AIKA 3GZ5A 5AONA 4WF2A 1QZYA 1TTYA 1V4RA 5HDKA 4HQEA 5JHUA 2HQRA 3BOQA 2P6TA 1FNNA 5D6EA 1SD7A 1ZARA 2P6SA 3SZTA 4DQ2A 2RN7A 4KNYA 3GLXA 2RQPA 3V7CA 2QYOA 2ZMEA 3P9IA 2OZUA 5H20A 2KIFA 3FXRA 2H6CA 3TO6A 2OU2A 1O3QA 4BXUA 3LSTA 1XN7A 1TNTA 3MZYA 3ELKA 3DFGA 3FWEA 3GX4X 4HAMA 3FZVA 4ESBA 1TBXA 3ML6A 4AIJA 5D5VB 5DCMB 3K9TA 2ZKZA 3N4MA 2V79A 5IT9Z 1R36A 1SD6A 3F8MA 1ZRDA 4DNCA 2VBYA 1E2XA 5D5UB 2XAGA 3ABUA 4EJTA 5HLGA 2MBFA 1UB9A 3R4KA 3TQNA 2JTVA 1O3RA 2XAQA 4FX4A 4YFKF 1W5TA 3J81K 5DCFA 5D4RA 3BDDA 4U88A 2GA2A 3KP4A 2K02A 1PP7U 4EVIA 3LAJA 2PFBA 4GGGA 3WTZA 3U2RA 1A04A 1EH7A 1YQAA 1PUEE 2DQRA 2EWNA 4EGZA 3V8KA 4MNUA 1KU2A 5CVJA 2CW0F 2FBHA 2F2EA 3U1DA 2VBZA 1EH8A 2ZBKA 5HOOA 5FO5A 1SFUA 5E1ZB 4UNOA 2G7HA 1TQMA 2XIGA 2H09A 4A6DA 5HLIA 2Z33A 2EFWA 2RDPA 3T8RA 1QBJA 4HDUA 1J59A 1PDNC 1XSVA 3WU1B 1IN5A 2RVCA 4KIBA 3TKYA 4M9XA 3TO9A 1FOKA 2IW5A 3NEUA 2WWYA 1XCBA 3ZMDA 4KUMA 2DLLA 2VT3A 2A5YB 1R1TA 4LK1F 5H6QA 3KE2A 2YSRA 1UFMA 1DPUA 1XB4A 2A6HF 3WGGA 4OMYA 1K78A 3CLOA 4ON0A 2GXGA 5BS6A 3LA3A 1MZBA 3JSPA 1HBXG 4FHTA 2IRFG 3DKWA 4A0XA 3MFKA 1TQIA 2CGPA 1Z1DA 1D5VA 2BV6A 4G9YA 4TV7A 2KIMA 5ERIA 5F64A 1FYMA 4EM2A 2FMLA 4HX4A 1TNSA 2M5WA 2CSOA 1Z6RA 1KQ8A 2COMA 2QLZA 5LHIA 4ASNA 1HKTA 3FX3A 1BBYA 3G73A 3VEPA 2GAUA 4IHTA 4EM1A 3MZHA 3QOPA 2DW4A 2Z99A 4GYIA 1U3EM 1HW2A 1F5TA 2A6EF 2KJCA 2XRNA 5D5WB 3HSFA 4LB6B 3RTRA 1K79A 1HKSA 4D0PA 2DK5A 3K0LA 3L00A 2K7LA 2ISZA 2HQNA 1FP1D 3QAHA 4KT5C 3IKTA 3IRRA 1SMTA 5E18F 4LMYA 1P4AA 2X4HA 5DCMA 3FHZA 3LQRA 2OQGA 2W84A 4P5OA 2O3FA 4GXOA 2UXXA 3KEOA 3HRSA 2ADUA 3DPTA 1D8JA 3KLNA 3O2PE 4I0BA 4EMSA 3E5QA 4OU0A 2X0LA 1IUYA 2D1VA 1I1SA 2DPDA 3JAMK 3ERED 2EA4A 4WX9A 3I59A 4O3MA 5AIPA 2P7VB 3I71A 1I1GA 3HRTA 3WE3A 4P55A 5HDNA 4IRHA 5CVRA 2A68F 4L0YB 3O3KA 3V7RA 5LRRA 1G3YA 4Y13A 2VOPA 4WK8F 1IN6A 2F5DA 4HF0A 1FYKA 4WCGA 2EJRA 1RIOH 4ZYGA 1BM9A 1R23A 5DDGA 3JW4A 2K27A 2FNPA 5LEJA 3WTXC 3W6JB 1YW8A 1FSHA 2RGVA 4XLPF 1EH6A 2VODA 3ZN1A 3IC7A 1RNLA 1BI2A 3F72A 5E1WA 2IJLA 4IPAA 4CGZA 3HHGA 4L0ZB 1S6LA 4I01A 3E6CC 3WTUC 1F9NA 1XGNA 2PG4A 3K1NA 5L3CA 1NHAA 2GIVA 2DBBA 4K2EA 5ILVA 5FFXA 4I98B 3DQVC 4ENKA 1ZH5A 1LDJA 4LFUA 4OOIA 2XUBA 3PQKA 3TDUC 1ZLKA 1B9MA 2WTEA 4CDGA 1DDNA 2LF8A 1OKRA 5L3GA 2OD5A 3REOA 3HHHA 3M9AA 3QPHA 4Q48A 3TO7A 2ZJ2A 2LKPA 3OV8A 3IWZA 1R00A 2D1HA 2ZNYA 2BEOA 3E6MA 2Q8KA 1JE8A 5D8KB 2E1CA 1YG2A 3L9FA 2RNJA 2M45A 3F3XA 2QQBA 4UUVA 4AVPA 2LSOA 1R1UA 4ENNA 3C1DA 1ZG5A 1U78A 1YW9A 3RPUA 2ZO4A 5ILUA 2YR2A 3TOAA 4M6YA 2FF4A 3K69A 1USTA 3Q9SA 2HFHA 4A6EA 3KP7A 2IA1A 2EFPA 4WXHA 3IKVA 3M7GA 4XLNF 4RB3C 1AOYA 1J2XA 2HS5A 5HDGA 4RB2C 5ILSA 1SFXA 1IXRC 3ROUA 5LEKA 5J8FA 3CDHA 2FOKA 1FYLA 3BROA 3RKWA 2HDCA 2HYFA 4PCQA 1Q1HA 4PGHA 2ESNA 2DI3A 2EFNA 4GCVA 4A2UA 2KRFA 4EV0A 1RI7A 2JPBA 2W85A 3RKXA 2VE9A 2A69F 1T39A 1BIBA 2JZYA 1JHFA 3CTAA 2DTRA 5E17F 1IN4A 2HZTA 5K5QA 4BQAA 3K2ZA 2EFQA 1D3YA 4PDKA 5F6FA 4YIIA 4HX7A 2GWRA 4M9SA 1LDKB 3WU0A 1W7PB 2PI0A 2HTSA 4CO8A 1GXPA 2UXNA 1QGPA 2AS5F 3CUOA 4BYYA 2XAJA 3GFJA 1XGOA 2QQ9A 4ZZLA 2DK8A 3RI4A 2ESHA 2DPUA 2JRTA 1ZGJA 4RGXA 4M9ZA 2BGCA 3GXOA 4KICA 3ZN0A 1WRJA 3NRVA 4Q4ZF 2L4MA 2YU3A 4OIPF 3M8FA 2PJPA 3C18A 4A0ZA 2DAOA 4L5IA 4AIHA 1BN5A 1H0MA 1MD0A 4B8XA 3F6OA 4P96A 2NYXA 2JPCA 2QQAA 1U2WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L5J A;  4I02 A;  4A0Y A;  1IAW A;  1OR7 A;  4HDV A;  3FMQ A;  1FBQ A;  1OYI A;  3LAP A;  2VON A;  1XSD A;  1R5H A;  3CO6 C;  1KYZ A;  4I09 A;  4N0B A;  3HUG A;  5ICE A;  3JTH A;  1YFH A;  1R7J A;  1SD4 A;  1FBS A;  1I6X A;  4KMF A;  1P4X A;  2FNA A;  5DV5 A;  5DYM A;  5JFR A;  1YO5 C;  1QZZ A;  1JXS A;  1BJA A;  5K1Y A;  3KZZ A;  4IVN A;  2HKO A;  3TOB A;  3ZP5 A;  4HZF A;  1T0F A;  5LRS A;  4JQF A;  3H3U A;  4HOB A;  3WTY C;  1DUX C;  3RYR A;  2HGC A;  2QM3 A;  1MDM A;  2P4W A;  1FWZ A;  4GO1 A;  4KIG A;  2ZME B;  1Z6T A;  2Y48 A;  1KU3 A;  1S7A A;  4HF1 A;  3T0Y A;  1FY7 A;  5DUK A;  4IXA A;  3FM3 A;  2XKP A;  2NRA C;  5CVI A;  2IVM A;  1YIO A;  1YYV A;  3ABT A;  4GYG A;  1FZP B;  3RIR A;  5E8I A;  4OIN F;  2EB7 A;  5K5R A;  1J0R A;  2KKO A;  2XV4 S;  5KVR A;  4S04 A;  3LA7 A;  3OOP A;  3E6D A;  3AAF A;  1EV7 A;  3HRU A;  4HQM A;  3N97 A;  2ZXJ A;  3MCZ A;  4ZYH A;  3MWM A;  5L3E A;  3TDZ C;  1S3J A;  1W7P D;  5LBQ A;  1KQ0 A;  5LGT A;  1KU7 A;  1T98 A;  3GEZ A;  1CF7 A;  2FQ3 A;  4G6Q A;  2TDX A;  1G3S A;  3RDI A;  4U0Y A;  2LDU A;  2E7X A;  2LNB A;  1TW3 A;  5IT9 K;  1U5T B;  4KA4 A;  3EQL F;  1UHM A;  3T5X A;  1BC7 C;  3PQJ A;  1ON1 A;  3O6B B;  5LGN A;  1T2K A;  4BHB A;  2QUF A;  4HLY A;  2FXA A;  4OMZ A;  3HTU A;  3S2W A;  2KJB A;  1U5T C;  5FB2 A;  4I2O A;  2E7W A;  4HX8 A;  3H3Z A;  1T6S A;  4AD9 A;  4XSZ F;  4G94 A;  3GUD A;  1FX7 A;  2O61 A;  4YFX F;  2YPR A;  3BWG A;  2R3S A;  1MJB A;  3FF5 A;  1STZ A;  1XDU A;  2A3S A;  4HV5 A;  3ECO A;  2YX4 A;  2FE3 A;  1J9I A;  2O0Y A;  2GA1 A;  3D5L A;  2OBP A;  4M73 A;  3QPT A;  2V6C A;  2E1N A;  2PMH A;  5ED4 A;  1KYW A;  4R79 A;  2K4B A;  2ELH A;  3DPL C;  3PFI A;  2P7C B;  2D2W A;  1K6O A;  1Z05 A;  2QBY B;  4ZZD A;  2F5C A;  4ZYD A;  1U5T A;  2L01 A;  3I0T A;  1P4W A;  5HS9 A;  3ZMV A;  3DEU A;  4Z2Y A;  1W4M A;  5CVV A;  4CIC A;  3F21 A;  3CUQ C;  5L3B A;  3BPX A;  3BPV A;  4KMU X;  3D0S A;  4OIO F;  1OYW A;  1SMY F;  2CWE A;  2MH2 A;  2WC2 A;  4UXN A;  3F8N A;  2HYG D;  3QU6 A;  3HSR A;  1XSX A;  3KP3 A;  3MQ0 A;  2PN6 A;  2FRH A;  2Y75 A;  2J5P A;  1LQ1 A;  4ESJ A;  2NNN A;  1KGS A;  1ZLJ A;  3JTG A;  5L3D A;  3WGH A;  1LJ9 A;  3V7S A;  4BH9 A;  3KCC A;  2V1D A;  2M1B A;  1HKQ A;  2CO5 A;  2V1X A;  2QZ8 A;  1W5S A;  3F8B A;  3I4P A;  4MTD A;  5H6R A;  1G3T A;  3LA2 A;  5EEH A;  2M8E A;  1FPQ A;  4U7B A;  1QQI A;  4EJV A;  3H92 A;  2PMU A;  2PQ8 A;  2O03 A;  4WXC A;  1TQP A;  3MEX A;  2EFO A;  3HOT A;  1LDD A;  1S29 A;  2XAF A;  1FLI A;  4ENJ A;  3HSE A;  1ON2 A;  1HQC A;  4HF2 A;  1HW5 A;  2LF7 A;  5D4S A;  1QO0 D;  1BIA A;  3RJP A;  2O8X A;  4OIQ F;  1E17 A;  2H6B A;  2L3D A;  3HRM A;  5HS8 A;  1RZ4 A;  3SQN A;  1KU9 A;  1IF1 A;  4ESF A;  1WSU A;  3L2C A;  4L9N A;  1ZN2 A;  1KQ9 A;  4RS8 A;  2HEO A;  2P5L C;  3CJN A;  3QU3 A;  1OYY A;  1V3F A;  4FX0 A;  2HR3 A;  4OIR F;  3FM5 A;  4CXF A;  2VC0 A;  1HXD A;  4LLL A;  4L18 B;  2EV0 A;  3DV8 A;  1IXS B;  1YW7 A;  5FGM A;  2IA0 A;  2VN2 A;  2FBK A;  4CYD A;  3BJ6 A;  2STW A;  3B02 A;  4HBL A;  2PEX A;  5E20 A;  4A5M A;  1DP7 P;  3J81 Z;  3R6S A;  3F23 A;  1UHW A;  3ZQ7 A;  3I53 A;  3KP6 A;  1H9T A;  2D45 A;  1GVJ A;  3KET A;  3LFK A;  2FA5 A;  3SHF A;  1MKM A;  1P92 A;  2VE8 A;  3V8J A;  1MJ9 A;  4U7D A;  4U0W A;  3F8F A;  1IRF A;  5J6X A;  2STT A;  4NQW A;  3ULQ B;  3C3W A;  2Z3Y A;  3HYI A;  2R7F A;  3ZMU A;  1BI3 A;  4HYE A;  1SAX A;  1SFE A;  2MH9 A;  3DXJ F;  1IRG A;  5LHG A;  1Z91 A;  3M8E A;  3IL2 A;  1L3L A;  2ETH A;  3I64 A;  5BMZ A;  2G7U A;  1FBU A;  3KZY A;  1P6R A;  3ZMS A;  1B4A A;  2UZK A;  5A2Q K;  4JBA A;  1BOA A;  1U8R A;  5FD6 A;  1BC8 C;  4EJW A;  1ODD A;  3C7J A;  1USS A;  3RKY A;  2IP2 A;  4HW0 A;  4XSX F;  2QVO A;  4M6X A;  1MDM B;  3K1P A;  2VC1 A;  4RB1 A;  1F4K A;  4FT8 A;  5DEQ A;  4IHS A;  2JSC A;  2QWW A;  4LLG F;  1FSE A;  1XD7 A;  2RKH A;  1O7L A;  3J80 Z;  3SZP A;  5D5X B;  4YG2 F;  2FEZ A;  4WWC A;  4MHG A;  3WTS C;  2PBI A;  2HOE A;  3Q9V A;  1ZRE A;  5LLQ A;  4MEX F;  4F7Z A;  4L9V A;  3ZMZ A;  1G3W A;  2CG4 A;  1I5Z A;  4HA8 A;  2DO7 A;  2OQR A;  3P7N A;  2C6Y A;  2DU9 A;  2OZ6 A;  2P5V A;  1GXQ A;  2K86 A;  2XKO A;  1QPM A;  3FXQ A;  2YX7 A;  5BPD A;  1IXC A;  2L54 A;  4UVA A;  4P9U A;  3TGN A;  2F5F A;  1FC3 A;  3WOD F;  3E97 A;  2MD5 A;  2EV6 A;  2H94 A;  1LVA A;  4G8X A;  4XBF A;  5JR3 A;  4HLX A;  2HKX A;  2RV8 A;  4UHT A;  1ZGA A;  4UVC A;  2XGX A;  1ZRC A;  2P8T A;  1W7P A;  2M87 A;  4KYW A;  1X3U A;  3U9G A;  4ZYE A;  5L3F A;  5ICC A;  4EJU A;  2MA3 A;  3G3Z A;  2MLG A;  3NQO A;  3BP8 A;  1MGT A;  2IPQ X;  4O6J A;  4N9I A;  2VT2 A;  3GFM A;  4P9F A;  4A12 A;  3EYI A;  2L4A A;  3JSO A;  1OPC A;  4KN7 X;  3GW2 A;  2AXL A;  4BHC A;  4U0V A;  3F22 A;  3LQQ A;  5CYV A;  3GYH X;  2DT5 A;  2R7D A;  2J5O A;  4LG0 B;  2K4J A;  3BJO A;  3CUQ B;  1R1V A;  4NB5 A;  5F1R A;  4M74 A;  1R5G A;  4LGW A;  1TW2 A;  1KA8 A;  1LEB A;  3E3V A;  2IT0 A;  4CHU A;  3GF2 A;  1D8K A;  3SFZ A;  3F8C A;  5FLX Z;  2G9W A;  2JT1 A;  2ZFW A;  1XGM A;  3J80 K;  1U6G A;  3DP7 A;  2WV0 A;  1GHC A;  2NAZ A;  4Y15 A;  5BOX A;  2GXB A;  5DD8 A;  1JGS A;  5EEG A;  2OAZ A;  1LEA A;  1XMA A;  4RGU A;  2XAS A;  1IW7 F;  4ENM A;  4O5V A;  3F6V A;  4A5N A;  2Q2E A;  2ZNZ A;  1LB2 A;  4MGR A;  3KP2 A;  1AWC A;  2QBY A;  1K7A A;  3I58 A;  3FMS A;  1B59 A;  2NS0 A;  2BYV E;  4MQ9 F;  4Q5S F;  5BPI A;  1XGS A;  2QEN A;  3BJA A;  2DQL A;  2MC3 A;  1MJA A;  1HW1 A;  1LNW A;  3T1B A;  2Z5U A;  3IHU A;  4PZJ A;  1B6A A;  2O6G E;  5CLS A;  3J7A O;  4IF4 A;  2CFX A;  3CO7 C;  3P9C A;  3R0J A;  3WG9 A;  4BAY A;  3RPQ A;  4YFN F;  4UV9 A;  1ZRF A;  5FD5 A;  3VB2 A;  1O57 A;  3KFW X;  1C0W A;  1ZG3 A;  5KK1 A;  2V9V A;  5LHH A;  4LG0 A;  3M1E A;  3I59 B;  1P2F A;  4QWQ A;  4H0E A;  1J5Y A;  1R22 A;  5DUI A;  4LJZ F;  2UWM A;  1XMK A;  4S05 A;  1YS6 A;  2VXZ A;  5ICG A;  1FT9 A;  2Q0O A;  5A2Q Z;  1UCR A;  3WGI A;  2MLK A;  4EGY A;  4IRG A;  3WTW C;  2VBW A;  3WTV C;  4BHP A;  2A61 A;  2DFI A;  4KIF A;  5D6F A;  3EUH A;  1ZAO A;  4RB0 A;  1I27 A;  2ISY A;  4JK1 X;  2V1U A;  1QNT A;  3E6B A;  2KIU A;  2BE5 F;  5HVQ C;  4M71 A;  3E5U A;  3R60 A;  2FSW A;  3L09 A;  2Y0M A;  4EJO A;  3P9K A;  1WI9 A;  1WQ2 A;  3QP5 A;  3GFI A;  1ZHF A;  3WTT C;  1O7F A;  2EK5 A;  4R1H A;  4RGS A;  3GVA A;  2HTJ A;  4G7H F;  5D8L B;  1Z7U A;  4UV8 A;  5FLX K;  2EA2 A;  4I0A A;  1BI1 A;  5E1X A;  2XVC A;  4IRI A;  4G7O F;  2XHK A;  1T38 A;  3KLO A;  4LK0 F;  2NNY A;  3EYY A;  4R8H A;  1RUO A;  4E70 A;  2B0L A;  1IN7 A;  3VFZ A;  3B73 A;  3GFL A;  5J8C A;  1F1Z A;  3L7W A;  3ECH A;  2RC4 A;  4KN4 X;  3IRQ A;  5CVU A;  6PAX A;  3VOE A;  2W25 A;  3ZPL A;  5IT3 A;  2IA2 A;  2FMY A;  1FP2 A;  2F5E A;  3HIF A;  3VOD A;  1G4D A;  4G6D A;  2ACJ A;  4CZZ A;  3IWF A;  1VTN C;  1PP8 F;  3EET A;  3BZ6 A;  3R61 A;  3MAJ A;  1WKM A;  1Z9C A;  4RGR A;  1J7K A;  1HST A;  1REP C;  3W6K B;  4N9H A;  5HS7 A;  1TLH B;  3I5U A;  1O3S A;  4EQQ A;  3FMR A;  1IN8 A;  3V4G A;  1OMI A;  2FU4 A;  1CGP A;  2CYY A;  3QRF F;  2EV5 A;  4QLC U;  2PLY A;  4UVB A;  3V8L A;  4M72 A;  4L9T A;  1RUN A;  1ZYR F;  1G6N A;  5CJ9 A;  4L9J A;  1Y0U A;  4IJA A;  4RAZ A;  5JVT A;  4LLN A;  3GO5 A;  2Z9O A;  4YIF A;  1L0O C;  1K78 B;  3Q5F A;  4PGG A;  3K1M A;  4LB5 A;  3ISP A;  1JHH A;  1B9N A;  1YLF A;  2GZW A;  4ZH4 F;  5E8G A;  1SD5 A;  4KDP A;  1S7O A;  3GWZ A;  1IZ1 A;  1J75 A;  4KFC A;  3HTS B;  3LWF A;  4BNC A;  5JI6 A;  1ONV A;  3HOS A;  1BI0 A;  1ZG1 A;  5LGU A;  5ICF A;  1WWX A;  4ETS A;  4MQV A;  4Y17 A;  1R58 A;  3I54 A;  1O3T A;  4I7H A;  1XDS A;  2BBY A;  3QP6 A;  4B09 A;  4WXD A;  3E5X A;  2P5K A;  3COA C;  3EDP A;  4HV6 A;  1H9G A;  4Q47 A;  5HLH A;  2M30 A;  3RYP A;  2XAH A;  3R0A A;  3DF8 A;  3WE2 A;  1B1B A;  4RAY A;  5TRD A;  2H27 A;  1ULY A;  5DD4 A;  2VOO A;  4LD5 A;  3JAM Z;  4AWX B;  1YS7 A;  2OA4 A;  3BY6 A;  4NHJ A;  2XRO A;  2W57 A;  1HSJ A;  4G7Z F;  4EM0 B;  2CQK A;  3ZMT A;  1S8N A;  2L02 A;  3KEQ A;  5AIQ A;  2HWV A;  2ZCW A;  2GQQ A;  5TJJ A;  3GZ6 A;  3SXY A;  5FFZ A;  4MEY F;  2W24 A;  5BQT A;  2FBI A;  5K5O A;  1CF7 B;  1DPR A;  3FXU A;  3CUQ A;  1YTY A;  1XCV A;  3T8T A;  4XRF A;  2VBX A;  3KP5 A;  4MTE A;  2A07 F;  4AIK A;  3GZ5 A;  5AON A;  4WF2 A;  1QZY A;  1TTY A;  1V4R A;  5HDK A;  4HQE A;  5JHU A;  2HQR A;  3BOQ A;  2P6T A;  1FNN A;  5D6E A;  1SD7 A;  1ZAR A;  2P6S A;  3SZT A;  4DQ2 A;  2RN7 A;  4KNY A;  3GLX A;  2RQP A;  3V7C A;  2QYO A;  2ZME A;  3P9I A;  2OZU A;  5H20 A;  2KIF A;  3FXR A;  2H6C A;  3TO6 A;  2OU2 A;  1O3Q A;  4BXU A;  3LST A;  1XN7 A;  1TNT A;  3MZY A;  3ELK A;  3DFG A;  3FWE A;  3GX4 X;  4HAM A;  3FZV A;  4ESB A;  1TBX A;  3ML6 A;  4AIJ A;  5D5V B;  5DCM B;  3K9T A;  2ZKZ A;  3N4M A;  2V79 A;  5IT9 Z;  1R36 A;  1SD6 A;  3F8M A;  1ZRD A;  4DNC A;  2VBY A;  1E2X A;  5D5U B;  2XAG A;  3ABU A;  4EJT A;  5HLG A;  2MBF A;  1UB9 A;  3R4K A;  3TQN A;  2JTV A;  1O3R A;  2XAQ A;  4FX4 A;  4YFK F;  1W5T A;  3J81 K;  5DCF A;  5D4R A;  3BDD A;  4U88 A;  2GA2 A;  3KP4 A;  2K02 A;  1PP7 U;  4EVI A;  3LAJ A;  2PFB A;  4GGG A;  3WTZ A;  3U2R A;  1A04 A;  1EH7 A;  1YQA A;  1PUE E;  2DQR A;  2EWN A;  4EGZ A;  3V8K A;  4MNU A;  1KU2 A;  5CVJ A;  2CW0 F;  2FBH A;  2F2E A;  3U1D A;  2VBZ A;  1EH8 A;  2ZBK A;  5HOO A;  5FO5 A;  1SFU A;  5E1Z B;  4UNO A;  2G7H A;  1TQM A;  2XIG A;  2H09 A;  4A6D A;  5HLI A;  2Z33 A;  2EFW A;  2RDP A;  3T8R A;  1QBJ A;  4HDU A;  1J59 A;  1PDN C;  1XSV A;  3WU1 B;  1IN5 A;  2RVC A;  4KIB A;  3TKY A;  4M9X A;  3TO9 A;  1FOK A;  2IW5 A;  3NEU A;  2WWY A;  1XCB A;  3ZMD A;  4KUM A;  2DLL A;  2VT3 A;  2A5Y B;  1R1T A;  4LK1 F;  5H6Q A;  3KE2 A;  2YSR A;  1UFM A;  1DPU A;  1XB4 A;  2A6H F;  3WGG A;  4OMY A;  1K78 A;  3CLO A;  4ON0 A;  2GXG A;  5BS6 A;  3LA3 A;  1MZB A;  3JSP A;  1HBX G;  4FHT A;  2IRF G;  3DKW A;  4A0X A;  3MFK A;  1TQI A;  2CGP A;  1Z1D A;  1D5V A;  2BV6 A;  4G9Y A;  4TV7 A;  2KIM A;  5ERI A;  5F64 A;  1FYM A;  4EM2 A;  2FML A;  4HX4 A;  1TNS A;  2M5W A;  2CSO A;  1Z6R A;  1KQ8 A;  2COM A;  2QLZ A;  5LHI A;  4ASN A;  1HKT A;  3FX3 A;  1BBY A;  3G73 A;  3VEP A;  2GAU A;  4IHT A;  4EM1 A;  3MZH A;  3QOP A;  2DW4 A;  2Z99 A;  4GYI A;  1U3E M;  1HW2 A;  1F5T A;  2A6E F;  2KJC A;  2XRN A;  5D5W B;  3HSF A;  4LB6 B;  3RTR A;  1K79 A;  1HKS A;  4D0P A;  2DK5 A;  3K0L A;  3L00 A;  2K7L A;  2ISZ A;  2HQN A;  1FP1 D;  3QAH A;  4KT5 C;  3IKT A;  3IRR A;  1SMT A;  5E18 F;  4LMY A;  1P4A A;  2X4H A;  5DCM A;  3FHZ A;  3LQR A;  2OQG A;  2W84 A;  4P5O A;  2O3F A;  4GXO A;  2UXX A;  3KEO A;  3HRS A;  2ADU A;  3DPT A;  1D8J A;  3KLN A;  3O2P E;  4I0B A;  4EMS A;  3E5Q A;  4OU0 A;  2X0L A;  1IUY A;  2D1V A;  1I1S A;  2DPD A;  3JAM K;  3ERE D;  2EA4 A;  4WX9 A;  3I59 A;  4O3M A;  5AIP A;  2P7V B;  3I71 A;  1I1G A;  3HRT A;  3WE3 A;  4P55 A;  5HDN A;  4IRH A;  5CVR A;  2A68 F;  4L0Y B;  3O3K A;  3V7R A;  5LRR A;  1G3Y A;  4Y13 A;  2VOP A;  4WK8 F;  1IN6 A;  2F5D A;  4HF0 A;  1FYK A;  4WCG A;  2EJR A;  1RIO H;  4ZYG A;  1BM9 A;  1R23 A;  5DDG A;  3JW4 A;  2K27 A;  2FNP A;  5LEJ A;  3WTX C;  3W6J B;  1YW8 A;  1FSH A;  2RGV A;  4XLP F;  1EH6 A;  2VOD A;  3ZN1 A;  3IC7 A;  1RNL A;  1BI2 A;  3F72 A;  5E1W A;  2IJL A;  4IPA A;  4CGZ A;  3HHG A;  4L0Z B;  1S6L A;  4I01 A;  3E6C C;  3WTU C;  1F9N A;  1XGN A;  2PG4 A;  3K1N A;  5L3C A;  1NHA A;  2GIV A;  2DBB A;  4K2E A;  5ILV A;  5FFX A;  4I98 B;  3DQV C;  4ENK A;  1ZH5 A;  1LDJ A;  4LFU A;  4OOI A;  2XUB A;  3PQK A;  3TDU C;  1ZLK A;  1B9M A;  2WTE A;  4CDG A;  1DDN A;  2LF8 A;  1OKR A;  5L3G A;  2OD5 A;  3REO A;  3HHH A;  3M9A A;  3QPH A;  4Q48 A;  3TO7 A;  2ZJ2 A;  2LKP A;  3OV8 A;  3IWZ A;  1R00 A;  2D1H A;  2ZNY A;  2BEO A;  3E6M A;  2Q8K A;  1JE8 A;  5D8K B;  2E1C A;  1YG2 A;  3L9F A;  2RNJ A;  2M45 A;  3F3X A;  2QQB A;  4UUV A;  4AVP A;  2LSO A;  1R1U A;  4ENN A;  3C1D A;  1ZG5 A;  1U78 A;  1YW9 A;  3RPU A;  2ZO4 A;  5ILU A;  2YR2 A;  3TOA A;  4M6Y A;  2FF4 A;  3K69 A;  1UST A;  3Q9S A;  2HFH A;  4A6E A;  3KP7 A;  2IA1 A;  2EFP A;  4WXH A;  3IKV A;  3M7G A;  4XLN F;  4RB3 C;  1AOY A;  1J2X A;  2HS5 A;  5HDG A;  4RB2 C;  5ILS A;  1SFX A;  1IXR C;  3ROU A;  5LEK A;  5J8F A;  3CDH A;  2FOK A;  1FYL A;  3BRO A;  3RKW A;  2HDC A;  2HYF A;  4PCQ A;  1Q1H A;  4PGH A;  2ESN A;  2DI3 A;  2EFN A;  4GCV A;  4A2U A;  2KRF A;  4EV0 A;  1RI7 A;  2JPB A;  2W85 A;  3RKX A;  2VE9 A;  2A69 F;  1T39 A;  1BIB A;  2JZY A;  1JHF A;  3CTA A;  2DTR A;  5E17 F;  1IN4 A;  2HZT A;  5K5Q A;  4BQA A;  3K2Z A;  2EFQ A;  1D3Y A;  4PDK A;  5F6F A;  4YII A;  4HX7 A;  2GWR A;  4M9S A;  1LDK B;  3WU0 A;  1W7P B;  2PI0 A;  2HTS A;  4CO8 A;  1GXP A;  2UXN A;  1QGP A;  2AS5 F;  3CUO A;  4BYY A;  2XAJ A;  3GFJ A;  1XGO A;  2QQ9 A;  4ZZL A;  2DK8 A;  3RI4 A;  2ESH A;  2DPU A;  2JRT A;  1ZGJ A;  4RGX A;  4M9Z A;  2BGC A;  3GXO A;  4KIC A;  3ZN0 A;  1WRJ A;  3NRV A;  4Q4Z F;  2L4M A;  2YU3 A;  4OIP F;  3M8F A;  2PJP A;  3C18 A;  4A0Z A;  2DAO A;  4L5I A;  4AIH A;  1BN5 A;  1H0M A;  1MD0 A;  4B8X A;  3F6O A;  4P96 A;  2NYX A;  2JPC A;  2QQA A;  1U2W A; 
#chains in the Genus database with same CATH topology
 3SDB A;  4L5J A;  4I02 A;  4A0Y A;  1IAW A;  1OR7 A;  1A6I A;  1UEL B;  4HDV A;  3FMQ A;  1FBQ A;  1OYI A;  1WZ2 A;  3LAP A;  2VON A;  5EYR A;  1XSD A;  1R5H A;  3CO6 C;  4C9Y A;  1KYZ A;  4XK4 A;  4I09 A;  4N0B A;  3QOE A;  3HUG A;  4II2 A;  5ICE A;  3JTH A;  1AA7 A;  1YFH A;  3CCV I;  4BY1 J;  4M6V A;  1R7J A;  1LUJ B;  2GBY A;  1X1P A;  3HKZ A;  1SC7 A;  1N25 A;  1SD4 A;  1FBS A;  4CCK A;  2E5N A;  3BR0 A;  1I6X A;  1V5E A;  1JKP C;  1P4X A;  4KMF A;  1MW7 A;  2FNA A;  2LP0 A;  5F27 A;  4A3I J;  5DV5 A;  5DYM A;  5JFR A;  1YO5 C;  5IY5 H;  4KJZ A;  2BXY A;  4KT6 A;  1QZZ A;  4NC7 A;  2MSY A;  1BR2 A;  1JXS A;  4XOP A;  4XNF A;  1TT5 B;  3TW7 A;  1BJA A;  5K1Y A;  3KZZ A;  1JKR C;  2K5C A;  4IVN A;  3K70 C;  2HKO A;  1HC8 A;  3OIP A;  3TOB A;  1PYV A;  3ZP5 A;  4HZF A;  1T0F A;  3U21 A;  5LRS A;  4JQF A;  3H3U A;  4HOB A;  4U87 A;  2DYR H;  3OIQ A;  4QPO A;  3WTY C;  1DUX C;  2A5W A;  4I76 A;  3RYR A;  3PL8 A;  3GCM A;  2HGC A;  1Z21 A;  2BHY A;  2E35 A;  1LFU P;  2QM3 A;  2Z16 A;  1MDM A;  3A01 B;  2P4W A;  3CDL A;  1FWZ A;  3BR3 A;  4GO1 A;  4KIG A;  2ZME B;  1Z6T A;  3KEY A;  1WJE A;  3HPH A;  2Y48 A;  1KU3 A;  1S7A A;  4HF1 A;  3CCE I;  3T0Y A;  3MD2 A;  4HRI A;  4BBS J;  1FY7 A;  2JN6 A;  3FHN A;  1XG1 A;  5DUK A;  4IXA A;  3FM3 A;  3RCO A;  2HVR A;  3PSF A;  2XKP A;  2ZJQ F;  2NRA C;  3DCF A;  2B9S A;  1FIP A;  1GLN A;  2EZL A;  5CVI A;  2IVM A;  1YX5 A;  4HG2 A;  1YIO A;  4NQW B;  1VZ0 A;  3CCU I;  3OSF A;  1FTZ A;  2KDO A;  1YYV A;  3ABT A;  4GYG A;  2VXD A;  2DA3 A;  3B6A A;  3MKY B;  4ZYA A;  2IS4 A;  4E6K G;  5FJ8 J;  1FZP B;  2KIS A;  3ZQL A;  3RIR A;  2PMZ N;  5E8I A;  4OIN F;  4IHY A;  2EB7 A;  2E1M B;  5K5R A;  4F91 B;  3PUF A;  1J0R A;  2KKO A;  4X1E A;  2XV4 S;  1Y8R B;  1QA6 A;  1JT6 A;  5EG0 B;  4E7K A;  5KVR A;  4S04 A;  3LA7 A;  2VLA A;  3OOP A;  3E6D A;  3AAF A;  1EV7 A;  3AG3 H;  3HRU A;  1Y8Q B;  4XLC A;  4HQM A;  2R7O A;  2F4M B;  3MZ8 A;  4JX5 A;  4BU2 A;  3N97 A;  3M4O J;  3PJR A;  2ZXJ A;  3I56 I;  3MCZ A;  5KAI C;  3H9J A;  2XGC A;  1X58 A;  4ZYH A;  5E3L A;  3MWM A;  5L3E A;  2DOE A;  3TDZ C;  3EUA A;  1S3J A;  1W7P D;  3IP4 B;  2ECB A;  3ZXS A;  5LBQ A;  1KQ0 A;  2DJI A;  2JJ7 A;  5LGT A;  2IXS A;  2LRE A;  1KU7 A;  1QU3 A;  1T98 A;  3IH2 A;  2MFZ A;  1W0T A;  3S93 A;  3GEZ A;  3JRA A;  2CQX A;  3CES A;  1CF7 A;  1S5L C;  3BR1 A;  4HST A;  4C3I J;  2FQ3 A;  4G6Q A;  2TDX A;  1G3S A;  3I9V 2;  3RDI A;  3LNQ A;  4U0Y A;  2LDU A;  2E7X A;  2LNB A;  1TW3 A;  4XID A;  2V7F A;  2W1O A;  3PNY A;  4CCO A;  5IT9 K;  2B63 J;  1U5T B;  5EJC A;  1QRY A;  3G6E I;  1WCM J;  4BXX J;  1FIA A;  2RRE A;  3KZI C;  4KA4 A;  2IGN A;  3HXL A;  3EQL F;  4BQO A;  3ZQQ A;  5J4Y A;  1UHM A;  4XOT A;  1VQ8 I;  3T5X A;  2HZD A;  2LOO A;  2HDD A;  3S1M J;  1BC7 C;  2LG4 A;  3PQJ A;  1ON1 A;  3O6B B;  1TWA J;  5LGN A;  3CMY A;  1ZGW A;  1T2K A;  4BHB A;  1MH4 A;  2CUE A;  2QUF A;  4HLY A;  2EPF A;  2FXA A;  4OMZ A;  3HTU A;  3S2W A;  2KJB A;  1B72 A;  1U5T C;  5FB2 A;  4I2O A;  2L7F P;  4NBQ A;  5IOY A;  3OYK A;  2E7W A;  1Z7L A;  4HX8 A;  3DKX A;  3WHB A;  3H3Z A;  1TZL A;  1T6S A;  4AD9 A;  2GLO A;  3DBH B;  4DGW B;  4XSZ F;  2JUG A;  3GUD A;  4G94 A;  1R9T J;  4AU7 A;  5F1J A;  1FX7 A;  4V2G A;  2BZT A;  2O61 A;  4YFX F;  2YPR A;  3BR2 A;  3BWG A;  3H5R A;  2R3S A;  1MJB A;  3FF5 A;  1STZ A;  2XF5 A;  4B44 A;  1XDU A;  2A3S A;  2IS6 A;  1W5C C;  3ECO A;  4HV5 A;  2HI3 A;  2YX4 A;  2FE3 A;  5E3N A;  1J9I A;  2O0Y A;  2GA1 A;  1P7I A;  2QA4 I;  3MKL A;  4F3Q A;  2VKE A;  3A4C A;  3D5L A;  2OBP A;  4M73 A;  3QPT A;  2V6C A;  2E1N A;  3CCQ I;  2PMH A;  5ED4 A;  2M0M A;  1KYW A;  3FKI J;  4R79 A;  2K4B A;  2ELH A;  3DPL C;  5EZH A;  2P0W A;  3PFI A;  4D7M A;  2P7C B;  2D2W A;  1K6O A;  1Z05 A;  2QBY B;  4ZZD A;  2F5C A;  4ZYD A;  5LD2 C;  3GTL J;  5F0H A;  2W7N A;  3IH4 A;  5FKL A;  4E7J A;  2R7U A;  1U5T A;  2L01 A;  4FQG A;  3I0T A;  2CQ7 A;  3PFY A;  1P4W A;  3GTG J;  5HS9 A;  3TP3 A;  1WGX A;  2MGQ A;  2R7W A;  3JRE A;  1XTA A;  2FOW A;  2VJ4 A;  1W36 C;  2R93 J;  4PSX A;  3ZMV A;  3DEU A;  5GAE J;  3OR2 C;  4XKV A;  4N4O B;  2H1L A;  4Z2Y A;  1W4M A;  5CVV A;  4CIC A;  3F21 A;  3CUQ C;  5L3B A;  3BPX A;  3BPV A;  2LBF B;  2COB A;  4KMU X;  3D0S A;  5IP7 J;  1OYW A;  2HDW A;  4OIO F;  3SDG A;  1NG6 A;  5B66 C;  2ZFU A;  1SMY F;  1D0Y A;  2CWE A;  2MH2 A;  3BZK A;  1XMX A;  3TL4 X;  3L1P A;  3KPH A;  1V54 H;  4NNJ A;  3RZD J;  2R92 J;  2K3P A;  2WC2 A;  3ESW B;  2E60 A;  3TMO A;  4UXN A;  3F8N A;  2HYG D;  2X6X A;  3QU6 A;  2ELJ A;  3HSR A;  3K7A J;  1XSX A;  3KP3 A;  2PN6 A;  3MQ0 A;  2Q2E B;  4DYR A;  2K9L A;  3JCU C;  2FRH A;  2Y75 A;  2J5P A;  2NS8 A;  3K4N A;  1LQ1 A;  4ESJ A;  3VSL A;  2NNN A;  1KGS A;  1ZLJ A;  3JTG A;  1ITY A;  2X48 A;  5L3D A;  3WGH A;  1LJ9 A;  3V7S A;  4BH9 A;  2FX0 A;  3KCC A;  2V9K A;  1WJD A;  2V1D A;  2M1B A;  5J1R A;  3M8J A;  1HKQ A;  2CO5 A;  2V1X A;  2QZ8 A;  2L5Q A;  1W5S A;  3F8B A;  3I4P A;  4MTD A;  1HF0 A;  5H6R A;  5M5W J;  2EZH A;  1G3T A;  2DXI A;  2Y30 A;  3LA2 A;  5EEH A;  2M8E A;  3HOY J;  1FPQ A;  1QQI A;  4U7B A;  4EJV A;  3JRH A;  3H92 A;  2PMU A;  2PQ8 A;  2O03 A;  2VAS A;  3S3M A;  4WXC A;  1TQP A;  3DBL B;  3MEX A;  4HEA 2;  2DMT A;  2CMP A;  2F4I A;  2EFO A;  2W4S A;  3HOT A;  1A5J A;  1LDD A;  1S29 A;  1FMV A;  2XAF A;  2KMU A;  1FLI A;  2Z1D A;  4JYK A;  4ENJ A;  4GFB A;  3HSE A;  1ON2 A;  1HQC A;  4Y4R A;  4HF2 A;  2EH3 A;  2CRG A;  2EBI A;  3VYS B;  1HW5 A;  2LF7 A;  5D4S A;  5M3M J;  2DA2 A;  1QO0 D;  1BIA A;  3EUK L;  3RJP A;  2O8X A;  4OIQ F;  4D7N A;  1E17 A;  2H6B A;  2VQG A;  3A03 A;  1OIS A;  2L3D A;  3HRM A;  5HS8 A;  4XLA A;  1RZ4 A;  3SQN A;  1KU9 A;  2LY9 A;  3LMM A;  1IF1 A;  4ESF A;  3ABK H;  1WSU A;  1RPW A;  3L2C A;  4RLQ A;  2GOX B;  2LRD A;  4L9N A;  2EIN H;  3SFI A;  1ZN2 A;  1KQ9 A;  4RS8 A;  2HEO A;  2P5L C;  3CJN A;  1D0X A;  3QU3 A;  1OYY A;  1V3F A;  3HZJ A;  3BG3 A;  4FX0 A;  3L2R A;  1QHG A;  1R71 A;  1OCR H;  2HR3 A;  4OIR F;  3FM5 A;  4CXF A;  5J47 A;  2VC0 A;  1HXD A;  3DTE A;  4LLL A;  3GZN B;  3S3N A;  3ZQF A;  4L18 B;  1B8I B;  2EV0 A;  1HLV A;  3DV8 A;  1IXS B;  1YW7 A;  5FGM A;  2IA0 A;  2VN2 A;  2NVQ J;  2FBK A;  4CYD A;  1G2H A;  3BJ6 A;  2O8K A;  2STW A;  4RMN A;  2XSD C;  3B02 A;  1VQ9 I;  4HBL A;  2PEX A;  1UJ8 A;  2HVS A;  5E20 A;  4A5M A;  2HOA A;  2I5U A;  3ASN H;  3L2W A;  1DP7 P;  1RET A;  4BL0 B;  2DTZ A;  2WV1 A;  3S1Q J;  3J81 Z;  1NG7 A;  3R6S A;  3F23 A;  1AU7 A;  1UHW A;  3ZQ7 A;  3I53 A;  3KP6 A;  1H9T A;  3HKZ N;  2D45 A;  1GVJ A;  3KET A;  3LFK A;  2CUJ A;  2FA5 A;  3SHF A;  1MKM A;  1P92 A;  2VE8 A;  3V8J A;  1MJ9 A;  4U7D A;  2X1C A;  3F8F A;  1IRF A;  4U0W A;  5J6X A;  3ZQC A;  4BAC A;  2STT A;  2LLK A;  1YJ9 I;  4NQW A;  3ULQ B;  3C3W A;  3VDX A;  1SEU A;  2Z3Y A;  3TP0 A;  3HYI A;  1SVM A;  4CSW A;  4OAY A;  4XQF A;  3OYG A;  2R7F A;  1VQ6 I;  3ZMU A;  3AFH A;  1BI3 A;  1T95 A;  4CZC A;  2VKV A;  4PFP A;  1RKW A;  4HYE A;  1SAX A;  1SFE A;  2MH9 A;  3DXJ F;  1IRG A;  5LHG A;  4IHW A;  1Z91 A;  4PJN A;  3M8E A;  3IL2 A;  2KP6 A;  2DT6 A;  1Y39 A;  1L3L A;  3VSK A;  1FEX A;  4B4C A;  3CJR B;  2ETH A;  2CUF A;  3I64 A;  5BMZ A;  2G7U A;  1FBU A;  5KCM A;  3KZY A;  1P6R A;  1TWF J;  3ZMS A;  1VQ4 I;  3C2H A;  1B4A A;  2UZK A;  5A2Q K;  4JBA A;  1BOA A;  2WA0 A;  1U8R A;  5FD6 A;  2DDA A;  3H36 A;  1BC8 C;  4EJW A;  5B1B H;  1ODD A;  2P81 A;  3C7J A;  1USS A;  3RKY A;  3HOW J;  2VPL A;  1R5I D;  2IP2 A;  1GDT A;  4HW0 A;  4DYC A;  1AHD P;  3Q0W A;  3GTP J;  4XSX F;  4XMY A;  2R7X A;  2QVO A;  4M6X A;  4A3D J;  3OYB A;  2DA6 A;  1MDM B;  1BOB A;  4W1U A;  3K1P A;  2VC1 A;  5JVG F;  3E0J B;  5TGT A;  3OYH A;  2LFB A;  1SFO J;  2AQF A;  3G1O A;  4RB1 A;  1F4K A;  1X1C A;  4FT8 A;  2AHQ A;  1GUU A;  1WI3 A;  4RLF A;  5DEQ A;  4IHS A;  5M5X J;  3HM5 A;  2JSC A;  4ZDP A;  2QWW A;  2CU7 A;  4LLG F;  3OYA A;  3WG7 H;  2LH9 A;  3NAU A;  4IO9 F;  4XR6 A;  1FSE A;  2JA7 J;  1XD7 A;  1DQU A;  2RKH A;  1O7L A;  3J80 Z;  3MVP A;  3K4L A;  3SZP A;  5D5X B;  4YG2 F;  2FEZ A;  4WWC A;  2L7M P;  4MHG A;  3WTS C;  4CYC A;  3CP2 A;  2PBI A;  1VND A;  4MLO A;  3RKQ A;  1WVR A;  4FET A;  4XON A;  2ID6 A;  2W00 A;  1M1E B;  2HOE A;  2JVG A;  4IQ4 A;  3Q9V A;  1ZRE A;  2KPM A;  2PJR B;  5LLQ A;  1WJ5 A;  1X3W B;  1D1C A;  4MEX F;  4F7Z A;  2HNH A;  4L9V A;  3ZMZ A;  4BEH A;  1G3W A;  2CG4 A;  4ANJ A;  4ZTJ A;  4BEH B;  2E19 A;  2DOA A;  1I5Z A;  4HA8 A;  3W2W A;  1SFK A;  2DO7 A;  3TBI A;  1V55 H;  4J01 A;  2OQR A;  2H8R A;  3P7N A;  4I6Z A;  1NK3 P;  4J19 A;  5HNH A;  2C6Y A;  4FAS D;  3H1C A;  5J3L A;  3LSM A;  2MD0 A;  2DU9 A;  2OZ6 A;  2XAU A;  2P5V A;  1GXQ A;  2HOS A;  4DIQ A;  2L9S A;  1MNM C;  1X2N A;  2K86 A;  2XKO A;  2CS3 A;  4BQQ A;  1QPM A;  2VQL A;  3FXQ A;  2YX7 A;  2VKD A;  3S17 J;  1QVU A;  5BPD A;  1IXC A;  2L54 A;  4UVA A;  2QF7 A;  2OJE D;  2K9M A;  3QPL A;  4P9U A;  3TGN A;  2F5F A;  1FC3 A;  3WOD F;  3E97 A;  4AC0 A;  2MD5 A;  2EV6 A;  5F0C A;  2H94 A;  2V9P A;  4JX6 A;  3D5R C;  1LVA A;  4G8X A;  2OC6 A;  5CPR B;  4XBF A;  4CCM A;  5JR3 A;  4HLX A;  3L2V A;  5HOD A;  1LKX A;  2HKX A;  2RV8 A;  4LOC A;  4UHT A;  1ZGA A;  4XLF A;  4UVC A;  4YRV A;  2X85 A;  2XGX A;  4ZDL A;  1ZRC A;  3JRB A;  2P8T A;  1SAN A;  2VQC A;  4M3F A;  1W7P A;  2M87 A;  4GDF A;  4KYW A;  1X3U A;  4XN3 A;  2L9R A;  3U9G A;  4C3H J;  2LBF A;  4ZYE A;  3D1N I;  4BY7 J;  3V42 A;  1ETV A;  5L3F A;  1IGN A;  4OAZ A;  1AKH B;  5ICC A;  3BQY A;  4EJU A;  3OOU A;  2MA3 A;  3G3Z A;  2MLG A;  2KL4 A;  2R7Q A;  2XPV A;  1QZE A;  2K9Q A;  3FXO A;  2PJR A;  3NQO A;  3BP8 A;  1MGT A;  2ZB9 A;  4A3B J;  1K6Y A;  4L5E A;  4XKW A;  1OCP A;  1I6H J;  2M9H A;  2IPQ X;  4O6J A;  4N9I A;  3CCY A;  2VT2 A;  2IBD A;  3GFM A;  3G1M A;  4P9F A;  4A12 A;  3EYI A;  5IP9 J;  2L4A A;  3JSO A;  1MBJ A;  1OPC A;  2O9L A;  3IH3 A;  1OFC X;  5B1A H;  4XIC A;  4M3D A;  4KN7 X;  3GW2 A;  1WPK A;  2AXL A;  5EZG A;  4PUS A;  4U0V A;  4BHC A;  4AVZ A;  1TWH J;  2F48 A;  2XPU A;  3AG2 H;  3F22 A;  3GTK J;  2R7Z J;  2X6Y A;  3LQQ A;  5CYV A;  3GYH X;  3KYD B;  3BTC A;  2DT5 A;  2R7D A;  2J5O A;  4LG0 B;  2K4J A;  3BJO A;  3OYF A;  3CUQ B;  1R1V A;  4NB5 A;  5F1R A;  4M74 A;  1UG0 A;  1R5G A;  5FKO A;  3JRF A;  2PX9 A;  4LGW A;  1TW2 A;  1FOW A;  3GTJ J;  4X6A J;  2X6W A;  1KA8 A;  1A31 A;  2A05 A;  3E3V A;  4MIM A;  2IT0 A;  1LEB A;  4NC8 A;  3JRC A;  2JMW A;  1IV6 A;  4CHU A;  4LIT A;  3I4M J;  2X1E A;  3AG4 H;  1ORK A;  3GF2 A;  1D8K A;  3SFZ A;  1P7J A;  1PUF B;  3F8C A;  5FLX Z;  3D5S C;  2G9W A;  2JT1 A;  2ZFW A;  2I8D A;  1XGM A;  3GTQ J;  3J80 K;  2OTJ I;  3CMA I;  1U6G A;  2BW3 A;  3DP7 A;  1O4X A;  3L2U A;  2WV0 A;  2K9N A;  3SEQ A;  1GHC A;  4E7L A;  2NAZ A;  4Y15 A;  5BOX A;  3ONQ A;  2MW8 A;  3BR5 A;  1Q1V A;  3K6G A;  2GXB A;  5DD8 A;  1JGS A;  2ECC A;  2M4G A;  4LG3 A;  5FRO A;  5EEG A;  2OAZ A;  1FMW A;  1RR8 C;  1LEA A;  1XMA A;  4RGU A;  2XAS A;  1IW7 F;  3HOX J;  4O5V A;  4ENM A;  3F6V A;  2RNG A;  4A5N A;  2Q2E A;  2ZNZ A;  1LB2 A;  1RES A;  4MGR A;  3KP2 A;  1AWC A;  2QBY A;  1K7A A;  4DOZ A;  4B3X A;  2HQA A;  3I58 A;  3FMS A;  1B59 A;  2NS0 A;  3AL0 C;  1XC5 A;  2BYV E;  1YRN A;  1PJR A;  1JUS A;  3CCJ I;  4MQ9 F;  3SYT A;  4Q5S F;  5BPI A;  1XGS A;  2QEN A;  3BJA A;  2DQL A;  2MC3 A;  4FCY A;  1IDZ A;  1DU6 A;  1MJA A;  1HW1 A;  2MG4 A;  1LNW A;  1SVL A;  3T1B A;  2Z5U A;  3FIW A;  3IHU A;  4PZJ A;  1B6A A;  4ITV A;  2O6G E;  3EUH C;  2F4O B;  5CLS A;  3J7A O;  4PJJ A;  2W48 A;  5HNF A;  2BOL A;  2XF6 A;  4IF4 A;  2CFX A;  3CO7 C;  1OCZ H;  3P9C A;  1LVK A;  3R0J A;  1A35 A;  3QWL A;  3BTI A;  3NAR A;  5JHF A;  1Y1W J;  3WG9 A;  3UKG A;  4BAY A;  1UAA A;  3RPQ A;  4YFN F;  2CW7 A;  2ZXW H;  4UV9 A;  5GTH C;  1ZRF A;  5FD5 A;  3VB2 A;  1O57 A;  3KFW X;  4E7S A;  1C0W A;  2JWT A;  3H5N A;  5J1Y A;  1A36 A;  1E3P A;  1ZG3 A;  5KK1 A;  2MYS A;  2V9V A;  5LHH A;  4XLE A;  2KLO A;  4LG0 A;  2R4G A;  3I59 B;  1P2F A;  3M1E A;  4QWQ A;  4H0E A;  1JI8 A;  3AG1 H;  3OS1 A;  4LIV A;  1J5Y A;  1S7E A;  5E3M A;  1R22 A;  5DUI A;  1BR4 A;  2XSJ C;  2O7O A;  1GVD A;  3X2Q H;  2BHZ A;  2Y9Y A;  1U0J A;  4LJZ F;  2UWM A;  1XMK A;  4S05 A;  1YJW I;  1YS6 A;  2VXZ A;  2LYC A;  5ICG A;  3O8H A;  1FT9 A;  3G1L A;  1H88 C;  2Q0O A;  1HA8 A;  5A2Q Z;  1IO2 A;  1NTC A;  1UCR A;  3WGI A;  2MLK A;  4ABZ A;  4EGY A;  4IRG A;  2EZI A;  4QPQ A;  3WTW C;  2VBW A;  3WTV C;  4BHP A;  2A61 A;  1ZR4 A;  2DFI A;  2FD5 A;  4KIF A;  5E3O A;  5D6F A;  4XN0 A;  3EUH A;  2QKL B;  2WB1 N;  1ZAO A;  4RB0 A;  1I27 A;  2E1M C;  2ISY A;  3GBG A;  5H2F C;  4JK1 X;  4D5F A;  1T08 B;  2V1U A;  1JTY A;  3H5A A;  3N05 A;  1R49 A;  4I99 C;  4HNU A;  1QNT A;  3E6B A;  1WHU A;  3ZQH A;  2KIU A;  5J1U A;  2BE5 F;  5HVQ C;  1T33 A;  4M71 A;  3E5U A;  5FRN A;  1BA5 A;  1FTT A;  3R60 A;  2FSW A;  1S72 I;  2R7S A;  3L09 A;  2Y0M A;  4EJO A;  1TWC J;  2Y31 A;  3P9K A;  1D1B A;  4BBR J;  1EJ9 A;  2JA6 J;  1JTX A;  1WI9 A;  1WQ2 A;  3QP5 A;  3GFI A;  1ZHF A;  3WTT C;  1DU0 A;  1X4O A;  1O7F A;  2EK5 A;  3I3L A;  2AXT C;  4A3E J;  4R1H A;  4RGS A;  3GVA A;  3M3Y J;  2HTJ A;  4BS9 A;  4G7H F;  3P5J A;  5D8L B;  4FTH A;  3OR1 C;  4XKC A;  1Z7U A;  2EIJ H;  4UV8 A;  5FLX K;  1E3H A;  4MFD A;  4IOC F;  2EA2 A;  4I0A A;  2X9D A;  4FIS A;  1BI1 A;  5E1X A;  2XVC A;  4XKB A;  1D1A A;  4JP0 A;  4IRI A;  2BXZ A;  2XHK A;  4IKF A;  3DEW A;  1T38 A;  4G7O F;  2AO9 A;  2GIZ A;  3KLO A;  4LK0 F;  2NNY A;  3EYY A;  4A3G J;  4R8H A;  1MBE A;  3BG7 A;  2QSF X;  3HOU J;  1OR7 C;  1RUO A;  1VQL I;  3K70 D;  4E70 A;  2B0L A;  1IN7 A;  3VFZ A;  3B73 A;  3GFL A;  5J8C A;  4BE1 A;  3W2A A;  1WJF A;  1F1Z A;  4PJ0 C;  3MKW B;  3L7W A;  3ECH A;  3OMY A;  2IGO A;  2RC4 A;  4KN4 X;  1MMG A;  2LVS A;  3IRQ A;  3JRG A;  1VQK I;  3C2G A;  5CQG A;  4UUT A;  5CVU A;  6PAX A;  3VOE A;  2W25 A;  1ETY A;  4IQJ A;  2OV7 A;  3FBN B;  5FRM A;  1I3A A;  3ZPL A;  3LOC A;  5K7F A;  2KRC A;  5IT3 A;  1VF9 A;  2BVM A;  1ZEL A;  1MSF C;  2IA2 A;  1UHS A;  2FMY A;  4KIS A;  1FP2 A;  1K61 A;  2F5E A;  3HIF A;  3OYD A;  3PNV A;  4CCN A;  3VOD A;  1G4D A;  3H35 A;  4G6D A;  2QEX I;  2ACJ A;  3ERM A;  2DA5 A;  5EF6 A;  4CZZ A;  2BY3 A;  3MN2 A;  3L2Q A;  3CC4 I;  3IWF A;  3LL7 A;  1VTN C;  1PP8 F;  3EET A;  1NK2 P;  3BZ6 A;  2VJI A;  4BQN A;  3R61 A;  3MAJ A;  2IGM A;  5EGO A;  1WKM A;  2I10 A;  2DT7 B;  2DMN A;  1Z9C A;  4RGR A;  1J7K A;  1HST A;  4XLH A;  2BY2 A;  1REP C;  3W6K B;  3H9Q A;  4N9H A;  4A3M J;  3OSG A;  5HS7 A;  2CW8 A;  3A1Y A;  5GP9 A;  1TLH B;  3I5U A;  4QTR A;  3CCM I;  4AYB A;  5DM6 F;  1O3S A;  2V1N A;  1YHQ I;  4EQQ A;  3DLA A;  3FMR A;  4UY8 I;  2YUS A;  1ZK8 A;  2WY7 Q;  1IN8 A;  4IHX A;  4AUX A;  1U9O A;  1GT0 C;  1DGW Y;  2WAD A;  3V4G A;  2VL8 A;  1OMI A;  2FU4 A;  1RC9 A;  1CGP A;  3DU6 A;  2BY0 A;  2CYY A;  3QRF F;  2EV5 A;  4QLC U;  3JRD A;  2Q1Z B;  2PLY A;  2JSP A;  4UVB A;  1S9H A;  4C30 A;  2E5Z A;  3TW6 A;  3V8L A;  1OLT A;  1T0F C;  4M72 A;  3VYU B;  1X2M A;  4L9T A;  1RUN A;  2NVY J;  4Y3O A;  1FOX A;  2O5R A;  1ZYR F;  5DM7 F;  1RR7 A;  1G6N A;  5CJ9 A;  4L9J A;  2E2I J;  4KIT B;  1Y0U A;  4IJA A;  2KZG A;  1WJB A;  2VIX A;  4RAZ A;  3ZR8 X;  5JVT A;  4LLN A;  2L0K A;  2B7E A;  3GO5 A;  2Z9O A;  1A6Q A;  1MMD A;  4NC6 A;  4YIF A;  3HBL A;  1FOY A;  2DA1 A;  2H8W A;  1L0O C;  2K3F A;  3OYC A;  1ERD A;  5B5E C;  3Q5F A;  1K78 B;  1ETQ A;  2JRM A;  4PGG A;  3K1M A;  5GPC A;  4LB5 A;  3ISP A;  1JHH A;  1B9N A;  3DEE A;  1YLF A;  2GZW A;  4G6T B;  4ZH4 F;  4A3L J;  3PNT A;  4D1Q A;  2NS7 A;  5E8G A;  1YOV B;  2ZSH B;  1TL8 A;  1SD5 A;  4KDP A;  1W1W E;  1S7O A;  3GWZ A;  1IZ1 A;  5CKT A;  1J75 A;  4KFC A;  1TP4 A;  3HTS B;  3LWF A;  4BNC A;  4M3G A;  5JI6 A;  2NOJ B;  1ONV A;  1UG2 A;  2QGU A;  3E7L A;  3HOS A;  1K4S A;  1BI0 A;  4PJL A;  5F0F A;  4D5C A;  1ZG1 A;  5LGU A;  1MH3 A;  5ICF A;  2YU9 J;  1WWX A;  4F92 B;  3TED A;  3S2H J;  2OCE A;  4ETS A;  4MQV A;  1QPI A;  4Y17 A;  2VUM J;  1UMQ A;  1R58 A;  3I54 A;  4HNT A;  2ZJR F;  1O3T A;  1FJL A;  1E0E A;  4B3A A;  4I7H A;  1XDS A;  4NUB A;  1ZQ3 P;  3K4K A;  2BBY A;  1X4P A;  3S32 A;  3QP6 A;  4YIR X;  4RBO A;  1MMA A;  4B09 A;  4WXD A;  2RQQ A;  3E5X A;  2P5K A;  3GLL A;  3DTK A;  1WJA A;  3ASO H;  3COA C;  2A6T A;  3EDP A;  4HV6 A;  1K83 J;  3HJE A;  2HPI A;  1H9G A;  2ZJP F;  4Q47 A;  5HLH A;  2JVH A;  2M30 A;  3RYP A;  2XAH A;  2KRH A;  3R0A A;  1ENH A;  3DF8 A;  3WE2 A;  4HNV A;  1B1B A;  3LSH A;  4RAY A;  4AYB N;  5TRD A;  2H27 A;  3A2K A;  1GV5 A;  5IYB J;  1TWG J;  1ULY A;  5DD4 A;  1P9Q C;  2VOO A;  3VYR B;  4LD5 A;  3JAM Z;  4F93 B;  4AWX B;  1YS7 A;  2OA4 A;  3BY6 A;  4NHJ A;  1B8I A;  2E34 A;  3NWS A;  3FIS A;  3SJM A;  1MBF A;  2XRO A;  4DBR A;  3PM1 A;  2DOD A;  2W57 A;  1HSJ A;  2DFE A;  4G7Z F;  2VQH A;  4II3 A;  4EM0 B;  2CQK A;  3H0G J;  3ZMT A;  1S8N A;  2L02 A;  3KEQ A;  2HXI A;  5AIQ A;  5GAH J;  2LKX A;  2HWV A;  2LKS A;  3RSN A;  2IAI A;  2ZCW A;  1KZH A;  2GQQ A;  5TJJ A;  1BW6 A;  1XX5 A;  5FLV A;  1DGR M;  3GZ6 A;  2IEK A;  3SXY A;  2KZV A;  5FFZ A;  1VQ5 I;  1VQO I;  2ZME C;  3W2V A;  3DWL E;  1ETO A;  3BC8 A;  4MEY F;  2W24 A;  1R4N B;  2WAQ A;  5BQT A;  3G2B A;  2VKH A;  2XPW A;  1D0Z A;  2FBI A;  5GAD J;  3EPZ A;  5K5O A;  3J7Y J;  4YEL A;  1MMS A;  2LR8 A;  1CF7 B;  1DPR A;  1X1B A;  3CUQ A;  3FXU A;  1YTY A;  1YIJ I;  1XCV A;  5GTI C;  4FE4 A;  3HOZ J;  2EQR A;  4IOA F;  3T8T A;  4XRF A;  2VBX A;  3KP5 A;  4BE0 A;  1JKO C;  3CC2 I;  4MTE A;  2A07 F;  4HSR A;  2E1O A;  4AIK A;  3GZ5 A;  5AON A;  1ETW A;  4RM2 A;  4WF2 A;  1QZY A;  1TTY A;  2EZK A;  1V4R A;  3ZRG A;  1PUF A;  5HDK A;  2R5Z B;  4HQE A;  5JHU A;  5FLM J;  2HQR A;  3BOQ A;  2P6T A;  3Q3S A;  1N77 A;  1FNN A;  5D6E A;  1SD7 A;  1Z3X A;  1ZAR A;  2P6S A;  1YIT I;  2DOF A;  3SZT A;  5JLX A;  4DQ2 A;  2RN7 A;  4KNY A;  1IG7 A;  3OY9 A;  3GLX A;  2RQP A;  3V7C A;  2OUM A;  2QYO A;  3A02 A;  2ZME A;  3P9I A;  2OZU A;  5H20 A;  3KYL A;  2QSG X;  2KIF A;  3FXR A;  5IPA A;  3CDI A;  2H6C A;  3TO6 A;  2OU2 A;  1O3Q A;  4BXU A;  2CH0 A;  3FDY A;  5DTD A;  3KYC B;  3LST A;  1XN7 A;  1TNT A;  3MZY A;  3ELK A;  3G71 I;  2L7Z A;  4A3F J;  1IRX A;  3DFG A;  2ICW G;  3FWE A;  5FKK A;  3GME A;  3GX4 X;  4DZP A;  3CQZ J;  2XB0 X;  1K4T A;  4HAM A;  3E1S A;  2QKM B;  3FZV A;  2IS1 A;  4ESB A;  1TBX A;  3ML6 A;  4AIJ A;  4C2U A;  5D5V B;  5DCM B;  3K9T A;  2ZXI A;  2ZKZ A;  3N4M A;  3OWT A;  2V79 A;  1VI0 A;  3B6C A;  5IT9 Z;  1R36 A;  3FK7 A;  2M0C A;  3JRI A;  1F43 A;  1SD6 A;  1MBH A;  5EDN A;  3F8M A;  3M1C A;  3PO3 J;  1ZRD A;  1W36 D;  4DNC A;  2VBY A;  2VJJ A;  2QSH X;  1E2X A;  3UNG C;  5D5U B;  2XDV A;  2XAG A;  2Y0S A;  3ABU A;  4EJT A;  4BE2 A;  1Y56 A;  5HLG A;  2MBF A;  3OYJ A;  1UB9 A;  3R4K A;  3TQN A;  2JTV A;  3QOD A;  1NH3 A;  2XAQ A;  4RM3 A;  2WB1 A;  1O3R A;  4FX4 A;  4DZJ A;  4YFK F;  1W5T A;  1DP3 A;  3J81 K;  3LSR A;  5DCF A;  2HYJ A;  3BR6 A;  3VPR A;  5D4R A;  3BDD A;  4U88 A;  5LFA A;  2GA2 A;  4IL6 C;  3A0B C;  3H3V K;  2DDB A;  2HVQ A;  3KP4 A;  3DPU A;  2GOM A;  2K02 A;  4IEJ A;  1PP7 U;  4EVI A;  2WAQ N;  3LAJ A;  2PFB A;  4GGG A;  2TRT A;  2CV0 A;  3F9K A;  4S0H B;  3WTZ A;  2ID3 A;  1ETK A;  1LFB A;  4A3J J;  3U2R A;  2LMD A;  1A04 A;  1EH7 A;  1YQA A;  2V4J C;  2HPM A;  2F5V A;  2DQR A;  1PUE E;  4AID A;  2LY1 A;  2R5Z A;  2EWN A;  3CCR I;  3HEF A;  2VB6 A;  3S14 J;  4BXF A;  4ZJZ A;  4BJT A;  3MKZ A;  2JK3 A;  1Y0N A;  3K2A A;  1HDP A;  3HDD A;  2XGD A;  3BZC A;  2EIK H;  3Q0V A;  5B3S H;  3V8K A;  4EGZ A;  2GM4 A;  1CQT A;  4MNU A;  9ANT A;  1KU2 A;  5CVJ A;  4N4N B;  2Y69 H;  2CW0 F;  1X1D A;  2FBH A;  1PVE A;  2F2E A;  2VBZ A;  3U1D A;  5C3E J;  3IV5 A;  1B72 B;  1OCC H;  1EH8 A;  2RAE A;  3LFU A;  5C44 J;  2NOG A;  2ZBK A;  5HOO A;  5FO5 A;  2DYS H;  3IAS 2;  3OYI A;  1SFU A;  5E1Z B;  4UNO A;  1TQM A;  2G7H A;  2XIG A;  3LSK A;  2H09 A;  4A6D A;  2JA8 J;  3ABM H;  5HLI A;  5J4V A;  2Z33 A;  2E2J J;  4A3K J;  2EFW A;  2RDP A;  2DN0 A;  3T8R A;  1QBJ A;  4F55 A;  4HDU A;  1J59 A;  2ZXH A;  1PDN C;  1XSV A;  2NVX J;  3WU1 B;  3QQA A;  4JX4 A;  2M3A A;  1IN5 A;  2RVC A;  4KIB A;  3TKY A;  4YEJ A;  2WAF A;  1ZTR A;  2DFF A;  4M9X A;  1VQM I;  3KX2 A;  4UUS B;  3O8G A;  1WFX A;  3TO9 A;  4QIW N;  4RDU A;  1FOK A;  2IW5 A;  2Y2Z A;  2OTL I;  3M07 A;  3NEU A;  2WWY A;  1XCB A;  1ZR2 A;  4Y33 A;  1I3Q J;  3ZMD A;  2Y9Z A;  2CV1 A;  3BG9 A;  4KUM A;  1N78 A;  2DLL A;  2VT3 A;  4X0G A;  2A5Y B;  1R1T A;  1E3O C;  4LK1 F;  4DJA A;  5H6Q A;  3KE2 A;  2YSR A;  1HOM A;  2XGE A;  2FJ1 A;  3OIO A;  1MNE A;  1UFM A;  1DPU A;  3HG9 A;  1OJL A;  2A6H F;  1Y6I A;  1XB4 A;  3WGG A;  3JR9 A;  4OMY A;  2XF7 A;  3CLO A;  4ON0 A;  1K78 A;  2GXG A;  4C2M J;  5M5Y J;  3FXM A;  4BJ5 C;  5K7Z A;  5BS6 A;  1QHH D;  3LA3 A;  1MZB A;  5M3F J;  1MSE C;  3JSP A;  2CJJ A;  5GAG J;  1HBX G;  4FHT A;  4B47 A;  2IRF G;  3ZQG A;  2CUZ A;  3DKW A;  3CCS I;  4B48 A;  4A0X A;  1YX3 A;  3MFK A;  4QSH A;  3W3C A;  1TQI A;  2CGP A;  1Z1D A;  1D5V A;  2BV6 A;  4P1W A;  4G9Y A;  4TV7 A;  4E4H A;  2KIM A;  5ERI A;  5F64 A;  2LK2 A;  1FYM A;  4EM2 A;  2FML A;  4HX4 A;  1TNS A;  2M5W A;  2CSO A;  1F36 A;  3CLQ A;  1MND A;  1Z6R A;  3MMY B;  1KQ8 A;  4M3B A;  5DS9 A;  2COM A;  2DA7 A;  2QLZ A;  5LHI A;  2BVL A;  4ASN A;  1HKT A;  2HU9 A;  2DFH A;  3FX3 A;  3DLL F;  4XRM A;  4A3C J;  1BJZ A;  1BBY A;  4H4K C;  4BJ6 C;  4FE7 A;  3QYE A;  1X1A A;  2WBM A;  3G73 A;  3VEP A;  2X6O A;  1V5G A;  2GAU A;  2KDZ A;  1U8B A;  4IHT A;  4EM1 A;  2JQ7 A;  3K4J A;  1IRZ A;  2ME6 A;  3MZH A;  3OYM A;  3QOP A;  2DW4 A;  2Z99 A;  4GYI A;  1GV2 A;  1U3E M;  1T8I A;  1W0U A;  1HW2 A;  1F5T A;  2A6E F;  2M7A A;  2KJC A;  2DMU A;  2XRN A;  4E7Z A;  2M4K A;  1Z67 A;  3HSF A;  5D5W B;  2TCT A;  4LB6 B;  3HGG A;  3RTR A;  2XC7 A;  1K79 A;  1HKS A;  4D0P A;  2DK5 A;  4Z6Y A;  3K0L A;  3L00 A;  2K7L A;  2ISZ A;  2HQN A;  1FP1 D;  3QAH A;  4CUG A;  2XRL A;  5HLT A;  4KT5 C;  3IKT A;  3IRR A;  1JJ6 C;  4CCL A;  1SMT A;  5E18 F;  2JA5 J;  3DTI A;  4LMY A;  4PFO A;  2V6E A;  1P4A A;  2MAB A;  2X4H A;  1APL C;  3AL0 B;  5DCM A;  5EEA A;  1JJ8 C;  3FHZ A;  3LQR A;  1I39 A;  1JT0 A;  4ZDO A;  2OQG A;  2WY8 Q;  3FBI B;  3LSJ A;  2W84 A;  4P5O A;  2O3F A;  4GXO A;  3F0C A;  3QYF A;  1MIJ A;  2NVT J;  1XS9 A;  5KAF C;  2UXX A;  3KEO A;  4BGD A;  2R7V A;  3OS2 A;  3HRS A;  2ADU A;  3DPT A;  1D8J A;  2H1K A;  2EIM H;  2VPR A;  3KLN A;  3O2P E;  4I0B A;  4UB8 C;  1IDY A;  4EMS A;  3E5Q A;  4OU0 A;  3CF5 F;  2X0L A;  1YI2 I;  1IUY A;  4XL9 A;  2D1V A;  1EKE A;  1IUF A;  2L7K A;  2DPD A;  3JAM K;  1I1S A;  2CQQ A;  3PIP F;  5KHD A;  4UUS A;  4IX7 A;  2ME0 A;  3HB9 A;  3ERE D;  1WH7 A;  3W6V A;  3ZQI A;  3NWT A;  2JA2 A;  2EA4 A;  2M2E A;  2L9N A;  4J00 A;  4WX9 A;  4AM3 A;  4RA2 A;  3OYL A;  3VWB A;  4CA0 A;  2R0Q C;  3ZCO A;  4Y7N J;  2K9S A;  3I59 A;  4O3M A;  5AIP A;  2P7V B;  3I71 A;  1I1G A;  3BLY A;  3HRT A;  4IHV A;  1ETX A;  3WE3 A;  4P55 A;  5JLW A;  4GRI A;  2Z2S B;  5HDN A;  4IRH A;  1MBK A;  1IC8 A;  5EG0 A;  3CME I;  2X1D A;  3LSI A;  5CVR A;  2A68 F;  4L0Y B;  3O3K A;  2OPT A;  3OYN A;  3CJQ B;  3V7R A;  1R4M B;  5LRR A;  2CV2 A;  1G3Y A;  4Y13 A;  2VOP A;  2UV1 A;  4WK8 F;  1IN6 A;  2F5D A;  1G59 A;  4ZTF A;  4CH7 A;  4HF0 A;  1YE9 A;  1FYK A;  2K85 A;  1MMN A;  4LIU A;  2N8G A;  4WCG A;  3HGY A;  2HXO A;  5TIS C;  2EJR A;  4ZYG A;  1BM9 A;  1RIO H;  1R23 A;  5DDG A;  3JW4 A;  2DA4 A;  2FNP A;  2K27 A;  3WU2 C;  3LSP A;  5LEJ A;  1X3Z B;  3WTX C;  3W6J B;  3H0D A;  1YW8 A;  1FSH A;  3BTL A;  2RGV A;  2PMZ A;  4XLP F;  1EH6 A;  2D5V A;  2VOD A;  3GTO J;  2GXA A;  3ZN1 A;  5GPA A;  2DJN A;  3IC7 A;  1RNL A;  2YS9 A;  3PSI A;  1U9N A;  1BI2 A;  3F72 A;  5E1W A;  1IJW C;  3FXL A;  2IJL A;  4IPA A;  4F52 A;  4CGZ A;  4A69 C;  1T56 A;  5FKN A;  3HHG A;  1LFP A;  4E7H A;  2G0E A;  4A93 J;  1EF4 A;  3OYE A;  5J40 A;  4L0Z B;  1S6L A;  2M34 A;  2X51 A;  4I01 A;  1IV8 A;  3WTU C;  3E6C C;  1V5F A;  1F9N A;  1XGN A;  3A0H C;  2PG4 A;  1QVT A;  2ZC2 A;  3K1N A;  5L3C A;  1NHA A;  4C2T A;  3VYT B;  2GIV A;  5IOZ A;  3RQI A;  2DBB A;  4K2E A;  5ILV A;  4XRS A;  5F04 A;  5FFX A;  2AQE A;  4I98 B;  3DQV C;  4ENK A;  1ZH5 A;  1TT0 A;  3DKY A;  1LDJ A;  4CYC B;  2E71 A;  3H9G A;  4LFU A;  4OOI A;  2XUB A;  3CCL I;  3S1N J;  3PQK A;  1SVO A;  3K4B A;  3TDU C;  1ZLK A;  1UZC A;  1ACI A;  1B9M A;  2WTE A;  1J09 A;  3WHC A;  3BG6 A;  4CDG A;  1DDN A;  2LF8 A;  1OKR A;  3PUB A;  5L3G A;  1HDD C;  3RZO J;  2OD5 A;  4RAG A;  3I55 I;  3REO A;  1OCT C;  3HHH A;  3K10 A;  3M9A A;  4XOR A;  3QPH A;  1OCO H;  4PSW A;  4Q48 A;  5F08 A;  1VQP I;  3TO7 A;  2ZJ2 A;  2LKP A;  4EEF G;  3OV8 A;  3IWZ A;  1MBG A;  3LSG A;  1R00 A;  4NDL A;  2D1H A;  3S3O A;  2ZNY A;  2F6C A;  2BEO A;  3E6M A;  2M8G X;  2Q8K A;  3ZGK A;  3C2B A;  1JE8 A;  1BW5 A;  3HPG A;  4HPQ A;  5D8K B;  4G12 A;  5C4J J;  2E1C A;  4Y52 J;  1YG2 A;  3L9F A;  2RNJ A;  1VFC A;  3KIO A;  2M45 A;  3S2D J;  2W82 A;  3F3X A;  5FKM A;  2QQB A;  3DU5 A;  2IS2 A;  4UUV A;  4AVP A;  2NXN B;  3IUO A;  1X19 A;  2LSO A;  4PJM A;  1Z0X A;  1R1U A;  1N75 A;  2OCC H;  3C1D A;  4ENN A;  1ZG5 A;  3FXK A;  1U78 A;  1YW9 A;  3RPU A;  3BCA A;  2ZO4 A;  3RQ4 A;  2BY1 A;  2LY2 A;  5ILU A;  3QYB A;  1ZKG A;  2YR2 A;  3TOA A;  4M6Y A;  2FF4 A;  3G4S I;  2DMQ A;  4B1R A;  3OL3 A;  3S1R J;  3K69 A;  1YRN B;  1UST A;  3Q9S A;  2IGK A;  4B43 A;  1KON A;  3PO2 J;  1OQY A;  2HFH A;  4CCJ A;  1R6R A;  2HQ5 A;  3BG5 A;  4A6E A;  4E7I A;  3DBR B;  3KP7 A;  2L9V A;  2IA1 A;  3CF2 A;  2EFP A;  4OWR B;  4WXH A;  3IKV A;  3M7G A;  4XLN F;  4RB3 C;  1AOY A;  3I4N J;  1J2X A;  2HS5 A;  5HDG A;  3FK6 A;  3OL4 A;  3GTM J;  3SZG A;  4RB2 C;  1H89 C;  2R5Y A;  5ILS A;  1SFX A;  4IZZ A;  1IXR C;  3ROU A;  5LEK A;  3OS0 A;  5J8F A;  3CC7 I;  3BCB A;  3CDH A;  2ZSI B;  1POG A;  5IYC J;  3Q0U A;  2R7T A;  2UUZ A;  3CJT B;  2FOK A;  4JOM A;  2CQN A;  4ZC3 A;  1TC3 C;  1FYL A;  3BRO A;  3RKW A;  2HDC A;  1D5Y A;  2HYF A;  2OF7 A;  4PCQ A;  1LPQ A;  1Q1H A;  1Z3Y A;  4PGH A;  2ESN A;  2DI3 A;  1BL0 A;  2LC2 A;  3K4M A;  4EAT A;  2EFN A;  4GCV A;  3CMM A;  3SEZ A;  3J7A Y;  4XM3 A;  2VI6 A;  2K40 A;  4A2U A;  2KRF A;  3J7Z I;  1H8A C;  4EV0 A;  1XPX A;  3CD6 I;  1I50 J;  1RI7 A;  2JPB A;  2W85 A;  3RKX A;  2VE9 A;  5C4X J;  1VQN I;  2A69 F;  5BNG A;  4XRS G;  1T39 A;  1BIB A;  2JZY A;  2VJ5 A;  1JHF A;  3QPS A;  4V19 K;  5EGO B;  1WH5 A;  3CTA A;  2V26 A;  5K7H A;  2DTR A;  1JGG A;  1IN4 A;  2HZT A;  2BW3 B;  2FUG 2;  2KIQ A;  5E17 F;  5K5Q A;  2JUC A;  3UR3 C;  1AKH A;  4BQA A;  3K2Z A;  2EFQ A;  1D3Y A;  4C3J J;  3AKZ A;  5IYD J;  4PDK A;  2QQ8 A;  5F6F A;  3CP8 A;  4YII A;  1YJN I;  3FKJ A;  4HX7 A;  2GWR A;  2ELK A;  3PIO F;  4M9S A;  1LDK B;  3U1K A;  3WU0 A;  1JUP A;  2KT0 A;  5E79 C;  1G8X A;  1W7P B;  2HOT A;  2E2H J;  3HUG B;  2E36 A;  2MC4 A;  2LTP A;  2PI0 A;  3S15 J;  4DW6 A;  3A01 A;  2HTS A;  2M7B A;  1HCR A;  3RPU D;  4CO8 A;  1GXP A;  4UB6 C;  2UXN A;  1QGP A;  4PK4 A;  2AS5 F;  4RAF A;  3S16 J;  3CUO A;  2DCE A;  4BYY A;  1RKT A;  2XAJ A;  3GFJ A;  1XGO A;  2QQ9 A;  4ZZL A;  3BTJ A;  4DYQ A;  3K4C A;  2LD5 A;  2DK8 A;  4M3E A;  1EA3 A;  3RI4 A;  2ESH A;  3FXJ A;  2CFO A;  2JRT A;  2DPU A;  1ZGJ A;  4RGX A;  4M9Z A;  2BGC A;  4MFE A;  3GXO A;  3S8P A;  4KIC A;  3ZN0 A;  4BKX A;  4BDY A;  4D9J A;  1WRJ A;  3NRV A;  2WAE A;  3HOV J;  1RRJ A;  1BR1 A;  3ZOB A;  4Q4Z F;  2L4M A;  4BUP A;  2KQR A;  3CZ6 A;  2YU3 A;  4OIP F;  3M8F A;  2EIL H;  2PJP A;  4W97 A;  2R5Y B;  3C18 A;  2KFD A;  3BT9 A;  1SAU A;  5CQE A;  4A0Z A;  2DAO A;  2Y0S N;  4L5I A;  1VQ7 I;  1Y1V J;  4AIH A;  1Z77 A;  4DBQ A;  5IP6 A;  4BDZ A;  2R7R A;  1LE8 B;  3HC7 A;  1BN5 A;  1H0M A;  1MD0 A;  4B8X A;  1LE8 A;  3F6O A;  2FQ4 A;  4P96 A;  2NYX A;  2XB5 A;  1WJC A;  1JKQ C;  2L2O A;  2KHM A;  2QCO A;  2JPC A;  2QQA A;  4V2F A;  3ABL H;  5KNL A;  1JUM A;  2DMP A;  2NVU B;  3IAM 2;  3BQZ A;  4MO7 A;  3HL2 A;  1U2W A; 
#chains in the Genus database with same CATH homology
 4L5J A;  4I02 A;  4A0Y A;  1IAW A;  1OR7 A;  4HDV A;  3FMQ A;  1FBQ A;  1OYI A;  3LAP A;  2VON A;  1XSD A;  1R5H A;  3CO6 C;  1KYZ A;  4I09 A;  4N0B A;  3HUG A;  5ICE A;  3JTH A;  1YFH A;  1R7J A;  1SD4 A;  1FBS A;  1I6X A;  4KMF A;  1P4X A;  2FNA A;  5DV5 A;  5DYM A;  5JFR A;  1YO5 C;  1QZZ A;  1JXS A;  1BJA A;  5K1Y A;  3KZZ A;  4IVN A;  2HKO A;  3TOB A;  3ZP5 A;  4HZF A;  1T0F A;  5LRS A;  4JQF A;  3H3U A;  4HOB A;  3WTY C;  1DUX C;  3RYR A;  2HGC A;  2QM3 A;  1MDM A;  2P4W A;  1FWZ A;  4GO1 A;  4KIG A;  2ZME B;  1Z6T A;  2Y48 A;  1KU3 A;  1S7A A;  4HF1 A;  3T0Y A;  1FY7 A;  5DUK A;  4IXA A;  3FM3 A;  2XKP A;  2NRA C;  5CVI A;  2IVM A;  1YIO A;  1YYV A;  3ABT A;  4GYG A;  1FZP B;  3RIR A;  5E8I A;  4OIN F;  2EB7 A;  5K5R A;  1J0R A;  2KKO A;  2XV4 S;  5KVR A;  4S04 A;  3LA7 A;  3OOP A;  3E6D A;  3AAF A;  1EV7 A;  3HRU A;  4HQM A;  3N97 A;  2ZXJ A;  3MCZ A;  4ZYH A;  3MWM A;  5L3E A;  3TDZ C;  1S3J A;  1W7P D;  5LBQ A;  1KQ0 A;  5LGT A;  1KU7 A;  1T98 A;  3GEZ A;  1CF7 A;  2FQ3 A;  4G6Q A;  2TDX A;  1G3S A;  3RDI A;  4U0Y A;  2LDU A;  2E7X A;  2LNB A;  1TW3 A;  5IT9 K;  1U5T B;  4KA4 A;  3EQL F;  1UHM A;  3T5X A;  1BC7 C;  3PQJ A;  1ON1 A;  3O6B B;  5LGN A;  1T2K A;  4BHB A;  2QUF A;  4HLY A;  2FXA A;  4OMZ A;  3HTU A;  3S2W A;  2KJB A;  1U5T C;  5FB2 A;  4I2O A;  2E7W A;  4HX8 A;  3H3Z A;  1T6S A;  4AD9 A;  4XSZ F;  4G94 A;  3GUD A;  1FX7 A;  2O61 A;  4YFX F;  2YPR A;  3BWG A;  2R3S A;  1MJB A;  3FF5 A;  1STZ A;  1XDU A;  2A3S A;  4HV5 A;  3ECO A;  2YX4 A;  2FE3 A;  1J9I A;  2O0Y A;  2GA1 A;  3D5L A;  2OBP A;  4M73 A;  3QPT A;  2V6C A;  2E1N A;  2PMH A;  5ED4 A;  1KYW A;  4R79 A;  2K4B A;  2ELH A;  3DPL C;  3PFI A;  2P7C B;  2D2W A;  1K6O A;  1Z05 A;  2QBY B;  4ZZD A;  2F5C A;  4ZYD A;  1U5T A;  2L01 A;  3I0T A;  1P4W A;  5HS9 A;  3ZMV A;  3DEU A;  4Z2Y A;  1W4M A;  5CVV A;  4CIC A;  3F21 A;  3CUQ C;  5L3B A;  3BPX A;  3BPV A;  4KMU X;  3D0S A;  4OIO F;  1OYW A;  1SMY F;  2CWE A;  2MH2 A;  2WC2 A;  4UXN A;  3F8N A;  2HYG D;  3QU6 A;  3HSR A;  1XSX A;  3KP3 A;  3MQ0 A;  2PN6 A;  2FRH A;  2Y75 A;  2J5P A;  1LQ1 A;  4ESJ A;  2NNN A;  1KGS A;  1ZLJ A;  3JTG A;  5L3D A;  3WGH A;  1LJ9 A;  3V7S A;  4BH9 A;  3KCC A;  2V1D A;  2M1B A;  1HKQ A;  2CO5 A;  2V1X A;  2QZ8 A;  1W5S A;  3F8B A;  3I4P A;  4MTD A;  5H6R A;  1G3T A;  3LA2 A;  5EEH A;  2M8E A;  1FPQ A;  4U7B A;  1QQI A;  4EJV A;  3H92 A;  2PMU A;  2PQ8 A;  2O03 A;  4WXC A;  1TQP A;  3MEX A;  2EFO A;  3HOT A;  1LDD A;  1S29 A;  2XAF A;  1FLI A;  4ENJ A;  3HSE A;  1ON2 A;  1HQC A;  4HF2 A;  1HW5 A;  2LF7 A;  5D4S A;  1QO0 D;  1BIA A;  3RJP A;  2O8X A;  4OIQ F;  1E17 A;  2H6B A;  2L3D A;  3HRM A;  5HS8 A;  1RZ4 A;  3SQN A;  1KU9 A;  1IF1 A;  4ESF A;  1WSU A;  3L2C A;  4L9N A;  1ZN2 A;  1KQ9 A;  4RS8 A;  2HEO A;  2P5L C;  3CJN A;  3QU3 A;  1OYY A;  1V3F A;  4FX0 A;  2HR3 A;  4OIR F;  3FM5 A;  4CXF A;  2VC0 A;  1HXD A;  4LLL A;  4L18 B;  2EV0 A;  3DV8 A;  1IXS B;  1YW7 A;  5FGM A;  2IA0 A;  2VN2 A;  2FBK A;  4CYD A;  3BJ6 A;  2STW A;  3B02 A;  4HBL A;  2PEX A;  5E20 A;  4A5M A;  1DP7 P;  3J81 Z;  3R6S A;  3F23 A;  1UHW A;  3ZQ7 A;  3I53 A;  3KP6 A;  1H9T A;  2D45 A;  1GVJ A;  3KET A;  3LFK A;  2FA5 A;  3SHF A;  1MKM A;  1P92 A;  2VE8 A;  3V8J A;  1MJ9 A;  4U7D A;  4U0W A;  3F8F A;  1IRF A;  5J6X A;  2STT A;  4NQW A;  3ULQ B;  3C3W A;  2Z3Y A;  3HYI A;  2R7F A;  3ZMU A;  1BI3 A;  4HYE A;  1SAX A;  1SFE A;  2MH9 A;  3DXJ F;  1IRG A;  5LHG A;  1Z91 A;  3M8E A;  3IL2 A;  1L3L A;  2ETH A;  3I64 A;  5BMZ A;  2G7U A;  1FBU A;  3KZY A;  1P6R A;  3ZMS A;  1B4A A;  2UZK A;  5A2Q K;  4JBA A;  1BOA A;  1U8R A;  5FD6 A;  1BC8 C;  4EJW A;  1ODD A;  3C7J A;  1USS A;  3RKY A;  2IP2 A;  4HW0 A;  4XSX F;  2QVO A;  4M6X A;  1MDM B;  3K1P A;  2VC1 A;  4RB1 A;  1F4K A;  4FT8 A;  5DEQ A;  4IHS A;  2JSC A;  2QWW A;  4LLG F;  1FSE A;  1XD7 A;  2RKH A;  1O7L A;  3J80 Z;  3SZP A;  5D5X B;  4YG2 F;  2FEZ A;  4WWC A;  4MHG A;  3WTS C;  2PBI A;  2HOE A;  3Q9V A;  1ZRE A;  5LLQ A;  4MEX F;  4F7Z A;  4L9V A;  3ZMZ A;  1G3W A;  2CG4 A;  1I5Z A;  4HA8 A;  2DO7 A;  2OQR A;  3P7N A;  2C6Y A;  2DU9 A;  2OZ6 A;  2P5V A;  1GXQ A;  2K86 A;  2XKO A;  1QPM A;  3FXQ A;  2YX7 A;  5BPD A;  1IXC A;  2L54 A;  4UVA A;  4P9U A;  3TGN A;  2F5F A;  1FC3 A;  3WOD F;  3E97 A;  2MD5 A;  2EV6 A;  2H94 A;  1LVA A;  4G8X A;  4XBF A;  5JR3 A;  4HLX A;  2HKX A;  2RV8 A;  4UHT A;  1ZGA A;  4UVC A;  2XGX A;  1ZRC A;  2P8T A;  1W7P A;  2M87 A;  4KYW A;  1X3U A;  3U9G A;  4ZYE A;  5L3F A;  5ICC A;  4EJU A;  2MA3 A;  3G3Z A;  2MLG A;  3NQO A;  3BP8 A;  1MGT A;  2IPQ X;  4O6J A;  4N9I A;  2VT2 A;  3GFM A;  4P9F A;  4A12 A;  3EYI A;  2L4A A;  3JSO A;  1OPC A;  4KN7 X;  3GW2 A;  2AXL A;  4BHC A;  4U0V A;  3F22 A;  3LQQ A;  5CYV A;  3GYH X;  2DT5 A;  2R7D A;  2J5O A;  4LG0 B;  2K4J A;  3BJO A;  3CUQ B;  1R1V A;  4NB5 A;  5F1R A;  4M74 A;  1R5G A;  4LGW A;  1TW2 A;  1KA8 A;  1LEB A;  3E3V A;  2IT0 A;  4CHU A;  3GF2 A;  1D8K A;  3SFZ A;  3F8C A;  5FLX Z;  2G9W A;  2JT1 A;  2ZFW A;  1XGM A;  3J80 K;  1U6G A;  3DP7 A;  2WV0 A;  1GHC A;  2NAZ A;  4Y15 A;  5BOX A;  2GXB A;  5DD8 A;  1JGS A;  5EEG A;  2OAZ A;  1LEA A;  1XMA A;  4RGU A;  2XAS A;  1IW7 F;  4ENM A;  4O5V A;  3F6V A;  4A5N A;  2Q2E A;  2ZNZ A;  1LB2 A;  4MGR A;  3KP2 A;  1AWC A;  2QBY A;  1K7A A;  3I58 A;  3FMS A;  1B59 A;  2NS0 A;  2BYV E;  4MQ9 F;  4Q5S F;  5BPI A;  1XGS A;  2QEN A;  3BJA A;  2DQL A;  2MC3 A;  1MJA A;  1HW1 A;  1LNW A;  3T1B A;  2Z5U A;  3IHU A;  4PZJ A;  1B6A A;  2O6G E;  5CLS A;  3J7A O;  4IF4 A;  2CFX A;  3CO7 C;  3P9C A;  3R0J A;  3WG9 A;  4BAY A;  3RPQ A;  4YFN F;  4UV9 A;  1ZRF A;  5FD5 A;  3VB2 A;  1O57 A;  3KFW X;  1C0W A;  1ZG3 A;  5KK1 A;  2V9V A;  5LHH A;  4LG0 A;  3M1E A;  3I59 B;  1P2F A;  4QWQ A;  4H0E A;  1J5Y A;  1R22 A;  5DUI A;  4LJZ F;  2UWM A;  1XMK A;  4S05 A;  1YS6 A;  2VXZ A;  5ICG A;  1FT9 A;  2Q0O A;  5A2Q Z;  1UCR A;  3WGI A;  2MLK A;  4EGY A;  4IRG A;  3WTW C;  2VBW A;  3WTV C;  4BHP A;  2A61 A;  2DFI A;  4KIF A;  5D6F A;  3EUH A;  1ZAO A;  4RB0 A;  1I27 A;  2ISY A;  4JK1 X;  2V1U A;  1QNT A;  3E6B A;  2KIU A;  2BE5 F;  5HVQ C;  4M71 A;  3E5U A;  3R60 A;  2FSW A;  3L09 A;  2Y0M A;  4EJO A;  3P9K A;  1WI9 A;  1WQ2 A;  3QP5 A;  3GFI A;  1ZHF A;  3WTT C;  1O7F A;  2EK5 A;  4R1H A;  4RGS A;  3GVA A;  2HTJ A;  4G7H F;  5D8L B;  1Z7U A;  4UV8 A;  5FLX K;  2EA2 A;  4I0A A;  1BI1 A;  5E1X A;  2XVC A;  4IRI A;  4G7O F;  2XHK A;  1T38 A;  3KLO A;  4LK0 F;  2NNY A;  3EYY A;  4R8H A;  1RUO A;  4E70 A;  2B0L A;  1IN7 A;  3VFZ A;  3B73 A;  3GFL A;  5J8C A;  1F1Z A;  3L7W A;  3ECH A;  2RC4 A;  4KN4 X;  3IRQ A;  5CVU A;  6PAX A;  3VOE A;  2W25 A;  3ZPL A;  5IT3 A;  2IA2 A;  2FMY A;  1FP2 A;  2F5E A;  3HIF A;  3VOD A;  1G4D A;  4G6D A;  2ACJ A;  4CZZ A;  3IWF A;  1VTN C;  1PP8 F;  3EET A;  3BZ6 A;  3R61 A;  3MAJ A;  1WKM A;  1Z9C A;  4RGR A;  1J7K A;  1HST A;  1REP C;  3W6K B;  4N9H A;  5HS7 A;  1TLH B;  3I5U A;  1O3S A;  4EQQ A;  3FMR A;  1IN8 A;  3V4G A;  1OMI A;  2FU4 A;  1CGP A;  2CYY A;  3QRF F;  2EV5 A;  4QLC U;  2PLY A;  4UVB A;  3V8L A;  4M72 A;  4L9T A;  1RUN A;  1ZYR F;  1G6N A;  5CJ9 A;  4L9J A;  1Y0U A;  4IJA A;  4RAZ A;  5JVT A;  4LLN A;  3GO5 A;  2Z9O A;  4YIF A;  1L0O C;  1K78 B;  3Q5F A;  4PGG A;  3K1M A;  4LB5 A;  3ISP A;  1JHH A;  1B9N A;  1YLF A;  2GZW A;  4ZH4 F;  5E8G A;  1SD5 A;  4KDP A;  1S7O A;  3GWZ A;  1IZ1 A;  1J75 A;  4KFC A;  3HTS B;  3LWF A;  4BNC A;  5JI6 A;  1ONV A;  3HOS A;  1BI0 A;  1ZG1 A;  5LGU A;  5ICF A;  1WWX A;  4ETS A;  4MQV A;  4Y17 A;  1R58 A;  3I54 A;  1O3T A;  4I7H A;  1XDS A;  2BBY A;  3QP6 A;  4B09 A;  4WXD A;  3E5X A;  2P5K A;  3COA C;  3EDP A;  4HV6 A;  1H9G A;  4Q47 A;  5HLH A;  2M30 A;  3RYP A;  2XAH A;  3R0A A;  3DF8 A;  3WE2 A;  1B1B A;  4RAY A;  5TRD A;  2H27 A;  1ULY A;  5DD4 A;  2VOO A;  4LD5 A;  3JAM Z;  4AWX B;  1YS7 A;  2OA4 A;  3BY6 A;  4NHJ A;  2XRO A;  2W57 A;  1HSJ A;  4G7Z F;  4EM0 B;  2CQK A;  3ZMT A;  1S8N A;  2L02 A;  3KEQ A;  5AIQ A;  2HWV A;  2ZCW A;  2GQQ A;  5TJJ A;  3GZ6 A;  3SXY A;  5FFZ A;  4MEY F;  2W24 A;  5BQT A;  2FBI A;  5K5O A;  1CF7 B;  1DPR A;  3FXU A;  3CUQ A;  1YTY A;  1XCV A;  3T8T A;  4XRF A;  2VBX A;  3KP5 A;  4MTE A;  2A07 F;  4AIK A;  3GZ5 A;  5AON A;  4WF2 A;  1QZY A;  1TTY A;  1V4R A;  5HDK A;  4HQE A;  5JHU A;  2HQR A;  3BOQ A;  2P6T A;  1FNN A;  5D6E A;  1SD7 A;  1ZAR A;  2P6S A;  3SZT A;  4DQ2 A;  2RN7 A;  4KNY A;  3GLX A;  2RQP A;  3V7C A;  2QYO A;  2ZME A;  3P9I A;  2OZU A;  5H20 A;  2KIF A;  3FXR A;  2H6C A;  3TO6 A;  2OU2 A;  1O3Q A;  4BXU A;  3LST A;  1XN7 A;  1TNT A;  3MZY A;  3ELK A;  3DFG A;  3FWE A;  3GX4 X;  4HAM A;  3FZV A;  4ESB A;  1TBX A;  3ML6 A;  4AIJ A;  5D5V B;  5DCM B;  3K9T A;  2ZKZ A;  3N4M A;  2V79 A;  5IT9 Z;  1R36 A;  1SD6 A;  3F8M A;  1ZRD A;  4DNC A;  2VBY A;  1E2X A;  5D5U B;  2XAG A;  3ABU A;  4EJT A;  5HLG A;  2MBF A;  1UB9 A;  3R4K A;  3TQN A;  2JTV A;  1O3R A;  2XAQ A;  4FX4 A;  4YFK F;  1W5T A;  3J81 K;  5DCF A;  5D4R A;  3BDD A;  4U88 A;  2GA2 A;  3KP4 A;  2K02 A;  1PP7 U;  4EVI A;  3LAJ A;  2PFB A;  4GGG A;  3WTZ A;  3U2R A;  1A04 A;  1EH7 A;  1YQA A;  1PUE E;  2DQR A;  2EWN A;  4EGZ A;  3V8K A;  4MNU A;  1KU2 A;  5CVJ A;  2CW0 F;  2FBH A;  2F2E A;  3U1D A;  2VBZ A;  1EH8 A;  2ZBK A;  5HOO A;  5FO5 A;  1SFU A;  5E1Z B;  4UNO A;  2G7H A;  1TQM A;  2XIG A;  2H09 A;  4A6D A;  5HLI A;  2Z33 A;  2EFW A;  2RDP A;  3T8R A;  1QBJ A;  4HDU A;  1J59 A;  1PDN C;  1XSV A;  3WU1 B;  1IN5 A;  2RVC A;  4KIB A;  3TKY A;  4M9X A;  3TO9 A;  1FOK A;  2IW5 A;  3NEU A;  2WWY A;  1XCB A;  3ZMD A;  4KUM A;  2DLL A;  2VT3 A;  2A5Y B;  1R1T A;  4LK1 F;  5H6Q A;  3KE2 A;  2YSR A;  1UFM A;  1DPU A;  1XB4 A;  2A6H F;  3WGG A;  4OMY A;  1K78 A;  3CLO A;  4ON0 A;  2GXG A;  5BS6 A;  3LA3 A;  1MZB A;  3JSP A;  1HBX G;  4FHT A;  2IRF G;  3DKW A;  4A0X A;  3MFK A;  1TQI A;  2CGP A;  1Z1D A;  1D5V A;  2BV6 A;  4G9Y A;  4TV7 A;  2KIM A;  5ERI A;  5F64 A;  1FYM A;  4EM2 A;  2FML A;  4HX4 A;  1TNS A;  2M5W A;  2CSO A;  1Z6R A;  1KQ8 A;  2COM A;  2QLZ A;  5LHI A;  4ASN A;  1HKT A;  3FX3 A;  1BBY A;  3G73 A;  3VEP A;  2GAU A;  4IHT A;  4EM1 A;  3MZH A;  3QOP A;  2DW4 A;  2Z99 A;  4GYI A;  1U3E M;  1HW2 A;  1F5T A;  2A6E F;  2KJC A;  2XRN A;  5D5W B;  3HSF A;  4LB6 B;  3RTR A;  1K79 A;  1HKS A;  4D0P A;  2DK5 A;  3K0L A;  3L00 A;  2K7L A;  2ISZ A;  2HQN A;  1FP1 D;  3QAH A;  4KT5 C;  3IKT A;  3IRR A;  1SMT A;  5E18 F;  4LMY A;  1P4A A;  2X4H A;  5DCM A;  3FHZ A;  3LQR A;  2OQG A;  2W84 A;  4P5O A;  2O3F A;  4GXO A;  2UXX A;  3KEO A;  3HRS A;  2ADU A;  3DPT A;  1D8J A;  3KLN A;  3O2P E;  4I0B A;  4EMS A;  3E5Q A;  4OU0 A;  2X0L A;  1IUY A;  2D1V A;  1I1S A;  2DPD A;  3JAM K;  3ERE D;  2EA4 A;  4WX9 A;  3I59 A;  4O3M A;  5AIP A;  2P7V B;  3I71 A;  1I1G A;  3HRT A;  3WE3 A;  4P55 A;  5HDN A;  4IRH A;  5CVR A;  2A68 F;  4L0Y B;  3O3K A;  3V7R A;  5LRR A;  1G3Y A;  4Y13 A;  2VOP A;  4WK8 F;  1IN6 A;  2F5D A;  4HF0 A;  1FYK A;  4WCG A;  2EJR A;  1RIO H;  4ZYG A;  1BM9 A;  1R23 A;  5DDG A;  3JW4 A;  2K27 A;  2FNP A;  5LEJ A;  3WTX C;  3W6J B;  1YW8 A;  1FSH A;  2RGV A;  4XLP F;  1EH6 A;  2VOD A;  3ZN1 A;  3IC7 A;  1RNL A;  1BI2 A;  3F72 A;  5E1W A;  2IJL A;  4IPA A;  4CGZ A;  3HHG A;  4L0Z B;  1S6L A;  4I01 A;  3E6C C;  3WTU C;  1F9N A;  1XGN A;  2PG4 A;  3K1N A;  5L3C A;  1NHA A;  2GIV A;  2DBB A;  4K2E A;  5ILV A;  5FFX A;  4I98 B;  3DQV C;  4ENK A;  1ZH5 A;  1LDJ A;  4LFU A;  4OOI A;  2XUB A;  3PQK A;  3TDU C;  1ZLK A;  1B9M A;  2WTE A;  4CDG A;  1DDN A;  2LF8 A;  1OKR A;  5L3G A;  2OD5 A;  3REO A;  3HHH A;  3M9A A;  3QPH A;  4Q48 A;  3TO7 A;  2ZJ2 A;  2LKP A;  3OV8 A;  3IWZ A;  1R00 A;  2D1H A;  2ZNY A;  2BEO A;  3E6M A;  2Q8K A;  1JE8 A;  5D8K B;  2E1C A;  1YG2 A;  3L9F A;  2RNJ A;  2M45 A;  3F3X A;  2QQB A;  4UUV A;  4AVP A;  2LSO A;  1R1U A;  4ENN A;  3C1D A;  1ZG5 A;  1U78 A;  1YW9 A;  3RPU A;  2ZO4 A;  5ILU A;  2YR2 A;  3TOA A;  4M6Y A;  2FF4 A;  3K69 A;  1UST A;  3Q9S A;  2HFH A;  4A6E A;  3KP7 A;  2IA1 A;  2EFP A;  4WXH A;  3IKV A;  3M7G A;  4XLN F;  4RB3 C;  1AOY A;  1J2X A;  2HS5 A;  5HDG A;  4RB2 C;  5ILS A;  1SFX A;  1IXR C;  3ROU A;  5LEK A;  5J8F A;  3CDH A;  2FOK A;  1FYL A;  3BRO A;  3RKW A;  2HDC A;  2HYF A;  4PCQ A;  1Q1H A;  4PGH A;  2ESN A;  2DI3 A;  2EFN A;  4GCV A;  4A2U A;  2KRF A;  4EV0 A;  1RI7 A;  2JPB A;  2W85 A;  3RKX A;  2VE9 A;  2A69 F;  1T39 A;  1BIB A;  2JZY A;  1JHF A;  3CTA A;  2DTR A;  5E17 F;  1IN4 A;  2HZT A;  5K5Q A;  4BQA A;  3K2Z A;  2EFQ A;  1D3Y A;  4PDK A;  5F6F A;  4YII A;  4HX7 A;  2GWR A;  4M9S A;  1LDK B;  3WU0 A;  1W7P B;  2PI0 A;  2HTS A;  4CO8 A;  1GXP A;  2UXN A;  1QGP A;  2AS5 F;  3CUO A;  4BYY A;  2XAJ A;  3GFJ A;  1XGO A;  2QQ9 A;  4ZZL A;  2DK8 A;  3RI4 A;  2ESH A;  2DPU A;  2JRT A;  1ZGJ A;  4RGX A;  4M9Z A;  2BGC A;  3GXO A;  4KIC A;  3ZN0 A;  1WRJ A;  3NRV A;  4Q4Z F;  2L4M A;  2YU3 A;  4OIP F;  3M8F A;  2PJP A;  3C18 A;  4A0Z A;  2DAO A;  4L5I A;  4AIH A;  1BN5 A;  1H0M A;  1MD0 A;  4B8X A;  3F6O A;  4P96 A;  2NYX A;  2JPC A;  2QQA A;  1U2W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...