2OQGA

Arsr-like transcriptional regulator from rhodococcus sp. rha1
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
109
structure length
109
Chain Sequence
GMTVGTYAELASVFAALSDETRWEILTELGRADQSASSLATRLPVSRQAIAKHLNALQACGLVESVKVGREIRYRALGAELNKTARTLERIGAEWDRRLAAIKQIAESM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the ArsR-like Transcriptional Regulator from Rhodococcus sp. RHA1
rcsb
source organism Rhodococcus sp.
molecule tags Transcription
molecule keywords Possible transcriptional regulator, ArsR family protein
total genus 40
structure length 109
sequence length 109
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12840 HTH_20 Helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2oqgA00
3KE2A 1T98A 1SD5A 4WXDA 4O5VA 5LGUA 1V3FA 1T2KA 3O2PE 3H3UA 3PQKA 3VB2A 3QPHA 3F8CA 2HTJA 1TBXA 1U8RA 3Q9SA 2R3SA 2DO7A 4LGWA 1F5TA 5D5VB 4UVAA 4PGGA 2ZJ2A 3WGIA 1HW2A 3GF2A 1IF1A 5LHIA 3HYIA 3K1NA 2YU3A 3ZPLA 4HF2A 4KMUX 4XBFA 1ZGAA 4KIBA 3M8EA 4S04A 4P55A 5D5WB 5FFXA 5LGTA 1GVJA 3QRFF 3O3KA 2EFPA 3ZMDA 2RVCA 5DEQA 3I71A 5J8CA 4QLCU 2FQ3A 1B59A 4UVBA 5J6XA 2EFWA 2XAHA 4G9YA 4IHTA 2XGXA 4HX7A 4EMSA 3E3VA 2F5FA 1KQ9A 5BMZA 1WQ2A 2KRFA 1LDJA 3WTSC 3SXYA 1YS7A 3QP6A 1I27A 1YS6A 2F5CA 4RAYA 1OYYA 1ZYRF 4HA8A 2PI0A 3RIRA 3FXUA 3T8TA 2Q0OA 3FMSA 3MQ0A 2UWMA 2HEOA 4N9HA 1G3TA 1MDMA 2L3DA 4HV6A 1KYZA 4LLGF 1YG2A 2FA5A 1Z9CA 1F1ZA 5D6FA 1Z91A 5DCMB 4HLYA 2E7XA 1XMKA 4F7ZA 5E1XA 1FX7A 3U9GA 2E7WA 1S7OA 5FLXK 4KIGA 1ZRFA 1O3TA 3BJOA 2D45A 4HW0A 1IUYA 4Q5SF 1B4AA 5DD8A 3OV8A 1K6OA 5F1RA 1UB9A 1O7FA 3GFJA 4ZYGA 2L02A 1HBXG 1PDNC 1XN7A 1IRGA 4G7OF 1ONVA 3K2ZA 1ZG5A 3F8FA 1G3WA 3MWMA 4FX4A 1V4RA 2VC1A 1UHMA 1FSEA 1ODDA 3CUQA 3HSRA 1U2WA 2XHKA 1K78B 1YO5C 2HS5A 4N9IA 4HQMA 3KZZA 1GXPA 5L3GA 3TQNA 1BN5A 1DPUA 1W7PD 2HDCA 5FB2A 2H94A 1S6LA 1EH8A 2FNPA 4S05A 4IVNA 4YFKF 1FBQA 5JI6A 3J80K 2PMHA 5E20A 5E1WA 2ZMEB 3HSFA 1OKRA 4DQ2A 3F21A 1OYIA 4RGUA 2QENA 1FY7A 3SQNA 5ERIA 2K86A 4I98B 1J7KA 2KIMA 4BHPA 3HHGA 2G9WA 1L3LA 1YYVA 2RV8A 2JTVA 4KN4X 4OIOF 2PFBA 5CYVA 2ADUA 3V7RA 3F8BA 4GO1A 2IA2A 1D8KA 2OD5A 1ZRDA 3VODA 3RYRA 5CVUA 4BH9A 3I59A 3M7GA 2Y0MA 4GYGA 3U2RA 2DI3A 1JHHA 2XV4S 2XKPA 2V6CA 2ZMEA 4EJVA 1JGSA 2BV6A 2OZUA 3JTHA 4KN7X 2O3FA 2C6YA 1DP7P 2CO5A 5DV5A 1FBSA 3ZN0A 2HKOA 3R0AA 3WU1B 4KA4A 2GQQA 2W84A 3WODF 2IVMA 2PQ8A 4CXFA 1H9GA 3BJAA 2QBYA 4I01A 4A12A 4HX4A 3CLOA 3K9TA 4FHTA 1S8NA 4IRHA 2VBYA 1T6SA 2YPRA 1K7AA 2QLZA 1ZLJA 2ZXJA 1J75A 4G94A 2L54A 3HRTA 1U5TB 3AAFA 3BWGA 3J7AO 1MZBA 3ROUA 3F23A 4HAMA 3RPQA 2XAJA 4PDKA 3E6DA 4KFCA 3J81Z 1TLHB 4P9FA 2HGCA 1JE8A 2VBWA 1ZN2A 4G7HF 3E5UA 1QZYA 1T38A 3RKWA 4Y13A 4UNOA 1DUXC 2V79A 2ZO4A 3GW2A 2BGCA 1GHCA 4JQFA 1RIOH 4XLPF 5LLQA 3MZHA 5FLXZ 3IC7A 3FXRA 4KDPA 1G3YA 3GO5A 1O7LA 2ISZA 1YTYA 3NRVA 3QAHA 3R4KA 1XD7A 5K5QA 4ETSA 3E97A 2COMA 4A5NA 4YG2F 1G4DA 3H92A 4LB5A 2HOEA 3GUDA 3WU0A 3LA3A 4WK8F 5HOOA 1E17A 4KYWA 3GXOA 2VN2A 2GA2A 4L18B 2FF4A 1IZ1A 3KFWX 3OOPA 2FE3A 1XGOA 3ERED 3MEXA 4IXAA 3HOTA 3FWEA 2GAUA 2VXZA 1SFEA 1XCVA 3RI4A 2QWWA 2LF8A 1KYWA 4L9JA 1TQMA 3BZ6A 1R22A 1IRFA 3WTTC 4EM2A 1C0WA 2FMYA 2VE8A 3KETA 2IW5A 3HUGA 4ENMA 4QWQA 4ZZDA 2OQGA 4FX0A 2O6GE 1R1TA 2KJCA 2JT1A 4HDVA 5LHGA 2K02A 5D4RA 1XGMA 1B9MA 5F64A 3B73A 3W6KB 2GXGA 1LQ1A 2FBKA 2A6HF 2PLYA 4UUVA 3VEPA 1KA8A 4EM1A 4KIFA 2X4HA 3WTYC 3IRQA 2IJLA 1CF7B 1BI3A 1REPC 3E6CC 1IN5A 2EA4A 4OU0A 1E2XA 2FXAA 4UVCA 2D1HA 4YFXF 1YW7A 2O8XA 5E8IA 2DW4A 4WXHA 5ICEA 1F9NA 4M71A 2DTRA 5TRDA 2KIUA 1XCBA 2EWNA 1XGNA 2AXLA 5A2QZ 1WSUA 3FX3A 3EYIA 2FU4A 3M1EA 4L5JA 3KLOA 3MFKA 2VBXA 3G73A 2PMUA 2Z5UA 3WGHA 4M6XA 1IXCA 3TOBA 4WWCA 2YSRA 2HYFA 5BOXA 3GZ6A 3ABUA 4D0PA 2IA1A 3GFMA 2M5WA 3FHZA 3EYYA 5ED4A 1WWXA 4I02A 3N97A 5K1YA 2QYOA 5ILUA 2Z33A 3TO6A 4BNCA 2OZ6A 2V1XA 2XVCA 1RUNA 2A07F 1P6RA 3SZPA 2M45A 3N4MA 1ON2A 1PP7U 1LEBA 2MLGA 2QVOA 4AIJA 3RJPA 1PP8F 4I2OA 2WV0A 3V7CA 4A0XA 5DDGA 4ASNA 2MD5A 2BYVE 1CF7A 1TW2A 4A6EA 1ULYA 4ESBA 2XAQA 5L3FA 1TNSA 2ZKZA 1QGPA 5IT9Z 2RC4A 5D5UB 1A04A 3H3ZA 4L0ZB 3ABTA 3NEUA 1HXDA 4G6QA 1LNWA 2FOKA 4N0BA 3FM3A 2RDPA 2JRTA 1KU2A 2LF7A 1BC7C 1QQIA 3V8JA 4CDGA 2ISYA 1P4WA 1UHWA 3CUQB 3F22A 3IRRA 2QQ9A 1HW5A 1ZG3A 3GEZA 3E5QA 5CLSA 4HDUA 4A0YA 1I6XA 4HYEA 4NHJA 5HLIA 5H6QA 5ICGA 4JK1X 1AWCA 3COAC 3ZQ7A 1X3UA 1TQIA 3TO7A 4BHBA 3WTZA 4IF4A 1DPRA 1J2XA 2GA1A 2HWVA 4U7BA 3BY6A 2D2WA 2PG4A 4YFNF 3TDZC 2QUFA 4EJWA 2XROA 1ZHFA 1TTYA 2L4MA 5JR3A 4L9TA 3GLXA 5E18F 2HQNA 3EDPA 1KU9A 2A5YB 1FP1D 1U3EM 2K7LA 2IP2A 1R1UA 2O0YA 3DPLC 1MJ9A 3I4PA 1KQ8A 2WC2A 2ZCWA 4ESFA 1O3SA 2FMLA 3FXQA 2QQAA 5AIQA 2H6CA 3KLNA 3EUHA 1Z6RA 4MTDA 2A3SA 1FZPB 2DT5A 3DQVC 3D5LA 2PN6A 1EH6A 1WRJA 2NAZA 1BC8C 4P9UA 3WE2A 1FYKA 3GYHX 2W24A 2G7HA 4M72A 5ICFA 4A5MA 4EJUA 3E6MA 1XB4A 4OINF 4RAZA 5CVJA 4Y15A 3HRMA 3PFIA 4UHTA 5AONA 1KU7A 3HRUA 3REOA 1QZZA 2ZNZA 4EGZA 5E1ZB 3J80Z 2QM3A 2NNNA 4TV7A 2MBFA 3JAMZ 4MQVA 4WXCA 1DDNA 2GWRA 3HTUA 3KP5A 1Q1HA 2J5OA 3R61A 2EFNA 3RKXA 1U5TC 5JFRA 1KU3A 4U0VA 4R79A 1RUOA 3MCZA 3MAJA 1ZAOA 5CVRA 1RI7A 2ESNA 2VE9A 1LJ9A 3KP2A 1T39A 2RNJA 1QNTA 3KP7A 3P9CA 2RKHA 3ISPA 4ENJA 2F2EA 3W6JB 3HRSA 3Q9VA 2H6BA 2M1BA 3EQLF 2P8TA 1SD6A 1Y0UA 4U88A 2OAZA 4P5OA 5K5RA 1OYWA 1BI0A 2GZWA 1U5TA 5IT9K 1OPCA 1USSA 1JHFA 1YW9A 4MEYF 1ON1A 3O6BB 4EVIA 5BS6A 2P4WA 5BPDA 4YIIA 3VOEA 3CJNA 2EFOA 4CICA 3QOPA 3V8LA 3IL2A 3LWFA 5JHUA 3DEUA 4RB2C 5TJJA 2BEOA 4UV9A 2QBYB 2LNBA 2HYGD 3KZYA 1ZH5A 2DK8A 3LA7A 3SHFA 1FSHA 4EM0B 2M8EA 5CVVA 2WTEA 4LJZF 2K4JA 4HV5A 3J81K 4NB5A 2HKXA 5LGNA 1FNNA 5D5XB 4PZJA 2RN7A 5HS7A 3I5UA 3P7NA 3KP6A 3KP4A 3DFGA 2CSOA 3T8RA 2DBBA 3F8MA 1KGSA 1XDSA 4HF0A 2Y48A 3RTRA 1O3QA 3I59B 4LK1F 1HSTA 1YFHA 4HBLA 4CO8A 2XAGA 1IN7A 4AIHA 2FBHA 4G8XA 5ILSA 1TQPA 1U78A 2EK5A 3P9IA 5HDKA 2VOPA 1XSVA 1ZG1A 2KIFA 3E6BA 2IA0A 2FBIA 3CTAA 2PJPA 2R7FA 4EV0A 2J5PA 1P4XA 5D6EA 4AVPA 1P2FA 3RKYA 1XSDA 1S29A 2RQPA 1IW7F 4Z2YA 3GX4X 3Q5FA 1RNLA 2DLLA 2V1DA 2PBIA 3PQJA 3NQOA 4O3MA 2JSCA 4OIRF 3ZMVA 4L0YB 3ML6A 5LEKA 2EFQA 3R6SA 3F6OA 1LVAA 4RGXA 4M73A 1S7AA 2KKOA 5FD6A 3WTVC 2VBZA 2LDUA 2ACJA 3R0JA 6PAXA 3T0YA 1SFXA 3K0LA 4XSZF 5EEHA 1B1BA 5FFZA 2JPCA 4H0EA 3JTGA 3V4GA 1SD7A 1ZREA 3KEOA 4XRFA 3T1BA 4HQEA 3T5XA 2K4BA 2Q8KA 2DQLA 3HSEA 1P92A 4IRIA 1K79A 3G3ZA 4MGRA 3CUQC 1I1GA 2X0LA 2HR3A 2STTA 1STZA 2OU2A 3ZP5A 2CQKA 3B02A 4OIQF 1H9TA 3HHHA 3WTWC 3JAMK 4MNUA 5FD5A 1MDMB 5D8KB 2DPUA 4P96A 5F6FA 4U0YA 2YR2A 2CWEA 2QZ8A 5ICCA 5FGMA 4AIKA 4HOBA 2XASA 2OBPA 3JSPA 4HZFA 3IKVA 5BPIA 2E1NA 5A2QK 1ZGJA 4EJTA 4ESJA 2A6EF 4M74A 4BXUA 3WTXC 2D1VA 4Q48A 3LAJA 2O61A 2F5EA 3L2CA 2EA2A 4IHSA 1TNTA 2RGVA 4I0AA 2XKOA 4CHUA 4A0ZA 4U7DA 1XSXA 3ZN1A 2LSOA 4RGRA 3JW4A 4WCGA 2VOOA 4LLLA 2CFXA 2NNYA 3QP5A 1J9IA 2H27A 1MD0A 3K1MA 1UCRA 3M9AA 2GIVA 2P5KA 5L3DA 1BIBA 5AIPA 4HLXA 2DK5A 3BPVA 4WF2A 5HVQC 2EV0A 2GXBA 1USTA 3TOAA 2FSWA 1R58A 4DNCA 2IRFG 5HDNA 2XUBA 2P6SA 1WI9A 4AWXB 1R5GA 2V9VA 1FPQA 4RB1A 4M9ZA 1I5ZA 1MJBA 1R36A 3GFIA 2JZYA 1LB2A 4Q4ZF 3E5XA 4OIPF 3BOQA 4R1HA 3HOSA 1ZLKA 4GCVA 1SD4A 2ELHA 4E70A 2ESHA 5BQTA 3QU3A 2E1CA 3ECOA 4PGHA 1R00A 1FYLA 2MLKA 3I54A 1YIOA 3IWFA 1GXQA 4LMYA 4ZZLA 2MC3A 2ZNYA 4CYDA 2OA4A 5L3EA 1IXRC 4ENKA 2MH9A 4RB0A 4BQAA 4KT5C 5LRSA 3S2WA 3C7JA 4EJOA 1Z05A 2L4AA 2FEZA 3L9FA 2A61A 4I0BA 2MA3A 3IWZA 1CGPA 1TW3A 3CO7C 2YX4A 4BYYA 2IT0A 2XIGA 1W7PA 3CUOA 3I58A 4GGGA 4ENNA 1MGTA 4L9NA 5JVTA 3R60A 4ZYHA 5IT3A 3V7SA 5HLHA 1BI2A 2CG4A 3BJ6A 1IN4A 4M6YA 1QO0D 3WGGA 1BJAA 2VT3A 3IHUA 4LFUA 1EV7A 1FYMA 5L3CA 1FC3A 1YQAA 4ZYDA 3L09A 1IXSB 1BM9A 4GXOA 5H20A 3MZYA 1FLIA 1W5SA 1W5TA 2L01A 3BDDA 3JSOA 3ZMSA 1BI1A 3RPUA 1F4KA 5J8FA 1D5VA 2FRHA 3K1PA 1RZ4A 1P4AA 2ZBKA 2R7DA 1B9NA 2Z9OA 4LG0A 1HKSA 1Z6TA 3BROA 3U1DA 4IRGA 1YW8A 3WG9A 5HS8A 4FT8A 2DU9A 3TKYA 3SZTA 3LA2A 3CDHA 1BIAA 2BBYA 4LLNA 2TDXA 4M9SA 1H0MA 4ON0A 1I1SA 4PCQA 4R8HA 4HX8A 1R1VA 4GYIA 1G6NA 2W85A 1ZARA 4UV8A 4Y17A 2UXXA 3WE3A 3ZMZA 3LSTA 3KP3A 4UXNA 2EJRA 1FT9A 2LKPA 4XSXF 3EETA 1K78A 4OMZA 4HF1A 3VFZA 4I7HA 4WX9A 3DKWA 2Z99A 2EB7A 3GWZA 4MTEA 4AD9A 2CYYA 1SAXA 4A6DA 1UFMA 2H09A 2ZFWA 2P7VB 1XGSA 4OOIA 3ECHA 2VC0A 2JPBA 2XAFA 5D8LB 4XLNF 1D8JA 3LQRA 2QQBA 1SMTA 2NYXA 5E8GA 5L3BA 3ZMTA 2HQRA 1IN8A 3DXJF 1HQCA 3F3XA 1U6GA 4IJAA 1MKMA 2G7UA 5DCMA 1XMAA 3KCCA 3F72A 2BE5F 3V8KA 3F6VA 3C3WA 4RS8A 4MQ9F 5K5OA 4KICA 2KJBA 4LD5A 1QPMA 2PEXA 2Z3YA 1BBYA 3HIFA 2B0LA 5H6RA 1LDDA 1Z7UA 3C18A 2EV5A 4NQWA 2VT2A 3DV8A 3D0SA 3WTUC 2K27A 4G7ZF 3I0TA 3I53A 5EEGA 4M9XA 1SMYF 1HKQA 3ELKA 5ILVA 2CW0F 1G3SA 1SFUA 3SFZA 2W57A 4K2EA 3KEQA 1AOYA 2FNAA 1Z1DA 3TGNA 3TO9A 2CGPA 1QBJA 5KK1A 5HS9A 3BPXA 1O3RA 2P7CB 1VTNC 5KVRA 2NRAC 4G6DA 3P9KA 4YIFA 2P5LC 2M87A 4MHGA 4I09A 1KQ0A 5CVIA 1EH7A 3L7WA 3LFKA 4KUMA 5DD4A 4RGSA 2ETHA 2IPQX 3L00A 4B8XA 3QU6A 4BAYA 2VODA 1L0OC 3RDIA 1W4MA 4EQQA 2NS0A 5E17F 1HKTA 1HSJA 1J59A 5D4SA 3C1DA 2EV6A 1OR7A 4IPAA 1XDUA 2Q2EA 4EGYA 4LB6B 4Q47A 2UZKA 3GFLA 3LQQA 2HTSA 3HTSB 3F8NA 1MJAA 4RB3C 2YX7A 2STWA 1J0RA 3BP8A 1FOKA 3FM5A 1IN6A 1YLFA 2HFHA 3DF8A 1WKMA 5HDGA 4ZYEA 3DPTA 5DYMA 4LG0B 1LEAA 4LK0F 5LHHA 5LEJA 1OMIA 1IAWA 1FWZA 5DCFA 2DAOA 4O6JA 1D3YA 1R7JA 3CO6C 1PUEE 1B6AA 5DUKA 1JXSA 2OQRA 3FMQA 2P5VA 4CGZA 2F5DA 3TDUC 5LBQA 1BOAA 2UXNA 5DUIA 3GVAA 4BHCA 4JBAA 3ULQB 4MEXF 2Y75A 4ZH4F 3I64A 2DQRA 4KNYA 3M8FA 1LDKB 4L5IA 3FZVA 2AS5F 1T0FA 2W25A 2V1UA 5LRRA 3RYPA 2WWYA 1J5YA 5HLGA 3FF5A 1O57A 2XRNA 5CJ9A 1W7PB 2DPDA 3DP7A 3QPTA 2HZTA 4L9VA 2P6TA 4OMYA 2DFIA 2A69F 3K69A 5FO5A 1R5HA 2MH2A 1FP2A 1NHAA 3LAPA 1ZRCA 2A68F 3GZ5A 3IKTA 3ZMUA 1FBUA 2O03A 4A2UA 1S3JA 4U0WA 2M30A 1R23A 4B09A 1HW1A 4CZZA 2VONA 3FMRA 4KMFA
chains in the Genus database with same CATH superfamily
3CDIA 3KE2A 2HDWA 1T98A 1SD5A 4XLAA 4WXDA 1B72A 4O5VA 4LIVA 5LGUA 4GRIA 2CFOA 4RM3A 2UUZA 3KYDB 2X48A 4F52A 1V3FA 3LSGA 2DT7B 3OWTA 4XNFA 3S93A 3ZQHA 4AVZA 4NC8A 4KISA 1T2KA 1O4XA 3FXLA 3O2PE 3V42A 1ITYA 4YEJA 2WB1N 4MFEA 5EGOA 1QU3A 3H3UA 2HQ5A 3PQKA 3VB2A 3QPHA 1X2NA 3F8CA 2HTJA 4Y4RA 1TBXA 3PNYA 4PFOA 1U8RA 2M4GA 2DOFA 3Q9SA 1VQMI 2DFHA 2R3SA 2VJ4A 3AG2H 4UY8I 2X1DA 2Z1DA 3PUFA 2VKDA 2DO7A 4LGWA 2ID6A 1F5TA 5D5VB 1TC3C 2Y2ZA 4XICA 1VQ4I 3HBLA 2XF6A 4PJLA 4UVAA 3SDGA 4PGGA 2ZJ2A 2Q1ZB 2VJ5A 3GF2A 3WGIA 1HW2A 4DBQA 1IF1A 5LHIA 3HYIA 3K1NA 2YU3A 4BKXA 3ZPLA 4HF2A 4KMUX 5EJCA 1ZGAA 2M0CA 3G1MA 4XBFA 1Y0NA 4KIBA 4B3AA 3CCQI 1PUFB 2Y0SN 2DA1A 2VQLA 3M8EA 1GDTA 4BXXJ 4S04A 4P55A 5D5WB 5FFXA 5LGTA 2BHZA 2CH0A 1GVJA 3BQYA 5B3SH 3QRFF 3O3KA 2EFPA 3ZMDA 3JRCA 4IOCF 1ETKA 2RVCA 5DEQA 3I71A 5J8CA 4PUSA 1JTXA 2FQ3A 4QLCU 4BDYA 4XMYA 2E35A 4IZZA 2AXTC 1B59A 4OAZA 4UVBA 2VKVA 5J6XA 2EFWA 1ERDA 2XAHA 2VL8A 5J4YA 4G9YA 4IHTA 2XGXA 2NVQJ 3C2HA 4HX7A 3VYUB 4EMSA 2DA5A 3E3VA 4BACA 3BR0A 3OYMA 4E7HA 2VB6A 4CCMA 3M3YJ 1BW5A 1H8AC 2F5FA 1KQ9A 3S3OA 5BMZA 4B48A 1WQ2A 2Y9YA 2KRFA 1LDJA 2HZDA 2LKXA 3WTSC 3SXYA 2WAQN 1YS7A 3QP6A 1I27A 1YS6A 3MZ8A 1JGGA 3Q0UA 2E34A 4RMNA 3SFIA 2F5CA 4RAYA 1VNDA 1OYYA 1ZYRF 1A31A 1A5JA 1X19A 4HA8A 3RIRA 3D1NI 2PI0A 4A3LJ 3FXUA 3T8TA 2E19A 2Q0OA 3FMSA 3MQ0A 2E1MC 2HEOA 3LSKA 2UWMA 4N9HA 1G3TA 1MDMA 2L3DA 3OR1C 3A02A 4HV6A 4E7IA 1JT6A 1KYZA 2L9RA 4C3HJ 4LLGF 1YRNA 3IAS2 1YG2A 2FA5A 1Y56A 1Z9CA 4XL9A 1F1ZA 4XQFA 5D6FA 2NS8A 3PNVA 4HG2A 1Z91A 5DCMB 4HLYA 1GV5A 5IP6A 2E7XA 1XMKA 2ZB9A 4F7ZA 4M3GA 5E1XA 4DIQA 2K40A 1FX7A 3U9GA 2R7ZJ 2E7WA 1S7OA 3AG3H 1MNMC 5FLXK 3UKGA 4KIGA 5IOZA 1ZRFA 1XX5A 4RA2A 2WADA 2KDZA 3H5NA 3F0CA 1O3TA 3CCUI 1IO2A 3BJOA 3BC8A 3W2AA 2D45A 4HW0A 3VYSB 5FJ8J 2GIZA 1IUYA 3FHNA 1FIPA 4Q5SF 3VWBA 5DM6F 1B4AA 5DD8A 3W3CA 3OV8A 1K6OA 3AL0C 3FKIJ 3D5RC 5F1RA 1IDZA 1N75A 1MMAA 2IEKA 2VPRA 1UB9A 1O7FA 3GFJA 4ZYGA 2L02A 3ZOBA 1HBXG 1XN7A 1LFUP 1AHDP 2DODA 1PDNC 1IRGA 1ZELA 4G7OF 2JA2A 1K6YA 1ONVA 3K2ZA 1ZG5A 3F8FA 2V6EA 3H36A 1G3WA 3MWMA 4FX4A 1V4RA 2VC1A 2JRMA 1UHMA 1FSEA 2DJNA 3MVPA 4JX4A 4YRVA 1ODDA 2DA3A 3CUQA 3HSRA 5J47A 5F27A 1ENHA 1AU7A 1P9QC 2OUMA 1IV6A 1U2WA 2DA2A 1WJDA 4IHVA 2XHKA 3K4KA 1K78B 1YO5C 2W00A 2ECBA 3OL4A 2HS5A 3HKZA 4N9IA 4HQMA 3KZZA 2DYSH 1GXPA 5L3GA 1SFKA 3TQNA 4B47A 4RM2A 1BN5A 1DPUA 1W7PD 4MLOA 2HDCA 2HU9A 2PMZN 1Z0XA 2H94A 5FB2A 5C3EJ 3G2BA 3I56I 1S6LA 1EH8A 2FNPA 1D1CA 4S05A 1ETVA 4IVNA 4YFKF 1FBQA 5JI6A 3M4OJ 2R4GA 3J80K 2JK3A 2PMHA 3JRHA 1R4NB 2VXDA 3QPSA 5E20A 5E1WA 1PJRA 2ZMEB 3H9JA 4IX7A 4XKCA 3HSFA 1Y8RB 1OKRA 4DQ2A 3F21A 1OYIA 1U9NA 4RGUA 2QENA 2K3FA 3CMEI 2LLKA 1VQ5I 1YE9A 1FY7A 4YIRX 1MBJA 2CUZA 2Z2SB 1WJ5A 2K86A 4I98B 5ERIA 3SQNA 1J7KA 2KIMA 1GUUA 4A3FJ 3OYDA 4BHPA 3S3NA 1ZKGA 2A05A 4E7SA 4BS9A 3HHGA 3MN2A 4F92B 2G9WA 1L3LA 3I55I 3SZGA 1YYVA 2RV8A 2JTVA 4KN4X 4UUSB 4OIOF 1IDYA 2PFBA 5M5WJ 5H2FC 3JRFA 2X85A 3QOEA 1T8IA 5CYVA 2ID3A 2ADUA 2AHQA 4AYBN 3V7RA 2WA0A 4BGDA 3F8BA 4GO1A 2IA2A 1D8KA 2OD5A 1TP4A 1ZRDA 3VODA 1Z21A 3RYRA 1RR8C 2M9HA 5LD2C 3BG9A 5CVUA 4BH9A 3I59A 3M7GA 2Y0MA 1Z3YA 3EUAA 4GYGA 3U2RA 5BNGA 2DI3A 1SAUA 3J7YJ 4V19K 1JHHA 2XV4S 1JJ6C 5TISC 1MW7A 2XKPA 3PSFA 2V6CA 2ZMEA 3EUHC 4EJVA 3WHBA 4AUXA 1JGSA 2BV6A 2IXSA 5F04A 2OZUA 1QPIA 3JTHA 4KN7X 2O3FA 2C6YA 2MC4A 1IG7A 4E7LA 1U8BA 1DP7P 1ZR2A 2CO5A 4BJ5C 5DV5A 1JUMA 1FBSA 3ZN0A 2HKOA 3R0AA 3WU1B 2OTJI 4C2MJ 5FRMA 4KA4A 4U87A 2GQQA 2W84A 3WODF 1LFBA 2IVMA 3MKWB 2PQ8A 4CXFA 3OSGA 1H9GA 3BJAA 2QBYA 2L7ZA 4I01A 4PJNA 4A12A 4HX4A 1YX3A 3CLOA 3SEZA 3LSPA 4JYKA 3HEFA 2VASA 1YX5A 3K9TA 4FHTA 1S8NA 4C2TA 2GOXB 4IRHA 1SVMA 2VBYA 2W4SA 4LIUA 1T6SA 2YPRA 5JVGF 4ZTFA 1K7AA 2QLZA 3K4JA 3S1MJ 2VQHA 3S16J 3PL8A 3OYHA 1YITI 1D5YA 1ZLJA 2W1OA 3HGYA 2ZXJA 1J75A 3HM5A 2R7WA 4G94A 2L54A 3HRTA 1U5TB 3AAFA 3BWGA 3G6EI 3J7AO 2DMNA 3ZQGA 1MZBA 3MMYB 3ROUA 3TW7A 1D1AA 3F23A 4HAMA 2DMTA 2XB5A 2R7XA 3RPQA 2XAJA 5F0CA 4PDKA 3E6DA 2AO9A 3MKZA 4KFCA 2X6YA 3J81Z 2CQNA 1R71A 1TLHB 1FEXA 4RLQA 1EJ9A 1NG6A 4P9FA 2HGCA 2V9KA 1JE8A 2VPLA 1J09A 2VBWA 3FDYA 1ZN2A 2L9SA 2MD0A 4G7HF 1I3AA 3E5UA 1QZYA 5GAHJ 1A6IA 4D5CA 1T38A 3GLLA 3H0GJ 4BY1J 1MH4A 3RKWA 4Y13A 4UNOA 1DUXC 2V79A 3GTOJ 2HOAA 2ZO4A 3GW2A 2BGCA 1GHCA 2M0MA 4IQJA 3PSIA 4JQFA 1RIOH 1QA6A 4XLPF 5LLQA 3MZHA 2KZVA 5FLXZ 4BXFA 4X6AJ 1S5LC 1A36A 1VQ6I 3IC7A 4XRSG 1YJ9I 3FXRA 4KDPA 1G3YA 3GO5A 1O7LA 2ISZA 2LKSA 1H88C 1MBHA 1YTYA 4NQWB 3NRVA 4UUTA 3QAHA 1ZGWA 3R4KA 3FK7A 4BQOA 1JKPC 2L2OA 1XD7A 3FISA 5K5QA 4B1RA 4CCOA 2RQQA 3E97A 2COMA 4A5NA 4ETSA 5LFAA 2JA6J 4YG2F 1G4DA 3H92A 2FQ4A 2K3PA 4LB5A 2N8GA 2KISA 2XGDA 2L9VA 1FMWA 2HOEA 2LYCA 3GUDA 3WU0A 2JUCA 3JR9A 3LA3A 4WK8F 5HOOA 4PFPA 1E17A 1UAAA 4KYWA 3GXOA 2VN2A 1VQNI 2GA2A 4L18B 1R5ID 1BA5A 4MO7A 2FF4A 4IHXA 2EIJH 5J1YA 1IZ1A 4A3DJ 3KFWX 2CRGA 3OOPA 2FE3A 1XGOA 3ERED 2DXIA 3MEXA 2BHYA 4IXAA 1X1CA 3HOTA 3OYFA 3DKXA 3OYIA 3FWEA 2GAUA 3DTEA 2VXZA 1SFEA 1XCVA 3RI4A 5GTIC 2QWWA 2VKEA 2VQGA 2LF8A 1KYWA 4L9JA 1TQMA 3BZ6A 3QPLA 3WHCA 1R22A 2ZJPF 1IRFA 1PUFA 3WTTC 4D9JA 4EM2A 1C0WA 2EILH 2FMYA 2IBDA 3DTIA 2VE8A 3KETA 2IW5A 3HUGA 4DBRA 4ENMA 4QWQA 1VQOI 3BTLA 2BZTA 4IQ4A 4Y3OA 4ZZDA 2OQGA 5GPCA 4A3CJ 4FX0A 2O6GE 1R1TA 2KJCA 2JT1A 3O8HA 3PUBA 4CA0A 4HDVA 1WVRA 5LHGA 2K02A 4E6KG 3VSLA 5D4RA 3RZDJ 1WCMJ 1XGMA 4ZC3A 1DU6A 1B9MA 4N4OB 5F64A 2Y0SA 3B73A 3W6KB 2GXGA 3BTCA 1LQ1A 3PNTA 2I5UA 2FBKA 1SANA 2LY9A 1G8XA 2A6HF 2PLYA 4UUVA 3VEPA 1MSEC 1KA8A 3GTMJ 4EM1A 4KIFA 2X4HA 3WTYC 3MD2A 3IRQA 2IJLA 1CF7B 1BI3A 5J40A 3OYEA 2ZSHB 5J1RA 1REPC 3E6CC 1IN5A 1N78A 1D0YA 1W0UA 2EA4A 4OU0A 1E2XA 4XRMA 3HOUJ 2FXAA 1UMQA 4UVCA 1JTYA 2D1HA 3OS2A 4IO9F 4YFXF 1YW7A 2WY7Q 4F93B 2O8XA 5E8IA 9ANTA 2DW4A 4WXHA 5ICEA 1F9NA 3LSIA 1BL0A 4M71A 2H8RA 1ORKA 3HOZJ 2DTRA 5TRDA 2KIUA 4FQGA 3BR2A 1XCBA 4IHWA 2EWNA 1XGNA 2K9NA 2AXLA 3HPHA 3W2VA 5EEAA 5A2QZ 1WSUA 1RRJA 3FX3A 4LOCA 4XKVA 3EYIA 4LG3A 2IGKA 2O7OA 5EYRA 2X1CA 4PSXA 2FU4A 2LMDA 3M1EA 3M1CA 4L5JA 4A93J 3KLOA 1MMDA 4BQQA 3MFKA 1Z67A 2VBXA 3SDBA 3G73A 2X6WA 2PMUA 4II2A 2LREA 5CQEA 2QGUA 4BU2A 4A3IJ 1F36A 2Z5UA 3WGHA 1OCOH 2ELKA 1X1DA 4M6XA 3ZQCA 1IXCA 4MIMA 3S2DJ 1X1BA 4A3KJ 1H89C 3TOBA 4WWCA 2YSRA 1I6HJ 2HYFA 5BOXA 3GZ6A 1Y1VJ 2FD5A 1OR7C 1UELB 3OS0A 3A0HC 3ABUA 4PJJA 4D0PA 2IA1A 3GFMA 5IY5H 2JUGA 4DYRA 2EH3A 2M5WA 2PX9A 3FHZA 2OCEA 1K4TA 3EYYA 2XGCA 5ED4A 3IP4B 4DYQA 1WWXA 2KPMA 2IGNA 2NOJB 2MSYA 1RKTA 4I02A 3N97A 5KCMA 5K1YA 1LE8A 1QRYA 1NTCA 3ABKH 1OCTC 4FE4A 1A35A 1GT0C 2QYOA 5ILUA 2Z33A 1X3WB 3TO6A 3RQIA 4BNCA 5TGTA 2JSPA 2OZ6A 2V1XA 3A03A 2XVCA 1RUNA 2A07F 1P6RA 3SZPA 1B8IA 2M45A 3DKYA 3N4MA 2LR8A 1ON2A 1PP7U 1LEBA 2O8KA 1ETWA 5HLTA 2F48A 2MLGA 2QVOA 4OWRB 4AIJA 3RJPA 1PP8F 4I2OA 2WV0A 3M07A 3V7CA 4A0XA 3CCLI 5DDGA 4EEFG 4ASNA 2MD5A 2BYVE 1CF7A 1TW2A 4A6EA 3EPZA 1ULYA 4ESBA 1HCRA 2XAQA 3D5SC 3K4NA 5L3FA 1TNSA 2ZKZA 1QGPA 5IT9Z 2GXAA 2RC4A 5D5UB 3W2WA 2QQ8A 1VQLI 2V1NA 1D0XA 4B44A 5CPRB 3BTJA 3H3ZA 1A04A 3HKZN 3ABTA 3NEUA 3IV5A 1HXDA 1QHGA 4G6QA 4KITB 4L0ZB 1LNWA 2FOKA 3CCYA 3CCMI 4N0BA 4H4KC 3FM3A 3FKJA 3JRAA 2RDPA 2JRTA 4CH7A 1KU2A 1MMSA 2L9NA 2LF7A 2COBA 2NVYJ 1BC7C 1QQIA 2DCEA 3LNQA 4JX5A 3EUKL 3V8JA 4BE1A 4BL0B 2KLOA 5K7HA 4CDGA 1E3PA 1UZCA 4J00A 2ISYA 2MG4A 1RKWA 1P4WA 1GV2A 1E3OC 2B63J 1UHWA 3CUQB 3F22A 2XPUA 3IRRA 1IUFA 2QQ9A 1HW5A 4W1UA 4AU7A 3GMEA 4AIDA 4HPQA 1ZG3A 3GEZA 3E5QA 4G12A 4XN3A 5CLSA 4HDUA 2B7EA 4A0YA 1DGRM 1I6XA 3JRBA 4HYEA 1FOWA 1Q1VA 4ZDLA 4GFBA 3CC2I 4NHJA 5HLIA 5H6QA 2QSFX 2DMUA 5ICGA 4JK1X 4XLEA 1QVTA 4J01A 1AWCA 3COAC 3WU2C 3ZQ7A 3BZCA 2EQRA 5C4JJ 1X3UA 1TQIA 2D5VA 2Q2EB 4EATA 2HVSA 3TO7A 3VYTB 4BHBA 3WTZA 4IF4A 2V9PA 1DPRA 3BG5A 3Q3SA 3LSHA 1LVKA 1J2XA 1VF9A 2GA1A 2ZJRF 4X1EA 4CCLA 1WPKA 4XONA 1SVLA 2HWVA 3BY6A 1MH3A 2D2WA 2XF5A 2DFFA 4U7BA 1JT0A 2PG4A 4YFNF 3TDZC 2QUFA 2E60A 3FXMA 4EJWA 2XROA 4HSTA 2L7FP 1ZHFA 1TTYA 2L4MA 5JR3A 3UNGC 4L9TA 4QTRA 3GLXA 2R5YA 4XOTA 2RREA 5E18F 2HQNA 2CQXA 1PYVA 3EDPA 3HUGB 1KU9A 2A5YB 1FP1D 1RESA 1T56A 2K7LA 2IP2A 1U3EM 1R1UA 2O0YA 3JRDA 3DPLC 1MJ9A 2R7QA 4W97A 3I4PA 1KQ8A 2WC2A 4M6VA 2ZCWA 4ESFA 1O3SA 1G59A 2FMLA 4II3A 2JA7J 3FXQA 2BVMA 1EKEA 2QQAA 5AIQA 3ESWB 2H6CA 3KLNA 3PIPF 1BW6A 3AFHA 3EUHA 1X4PA 3FBIB 1Z6RA 4MTDA 2A3SA 1HLVA 2E5NA 1FZPB 2EZHA 2DT5A 1YIJI 3DQVC 1TL8A 1JI8A 2XRLA 3D5LA 4PJMA 2PN6A 3LL7A 2OC6A 1EH6A 1Y1WJ 1WRJA 2NAZA 4L5EA 1BC8C 2TCTA 5B1AH 4P9UA 2LK2A 5CKTA 3WE2A 1FYKA 2ZXIA 2QSGX 3GYHX 2W24A 2OCCH 2G7HA 4M72A 5ICFA 4A5MA 4EJUA 2XPVA 3U21A 4BE0A 1YJNI 3BR6A 1MMGA 2AQFA 3DBRB 3E6MA 1OQYA 1XB4A 2FOWA 3OY9A 4DJAA 2HXIA 2GLOA 4OINF 4RAZA 4ZYAA 5CVJA 1XPXA 2FJ1A 4Y15A 3HRMA 3PFIA 1FIAA 4UHTA 5AONA 1KU7A 3HRUA 1XS9A 3REOA 1QZZA 2CQQA 2ZNZA 5F0FA 1U9OA 5E1ZB 3J80Z 4EGZA 3SJMA 3LMMA 2QM3A 3OMYA 2NNNA 2W82A 4TV7A 2MBFA 3JAMZ 2LBFB 1BR1A 4MQVA 3K10A 5K7FA 1T33A 3ONQA 4WXCA 1DDNA 2GWRA 3HTUA 3KP5A 1Q1HA 4IKFA 2J5OA 3R61A 2EFNA 4NC7A 1U5TC 3RKXA 5JFRA 3S17J 5KAFC 1KU3A 3AG1H 3CCJI 3TBIA 2ZXWH 4U0VA 2A5WA 3E1SA 4R79A 1RUOA 3MCZA 4V2GA 4QIWN 4RAFA 3MAJA 1R4MB 1D0ZA 1ZAOA 1V54H 1RI7A 5CVRA 2EZLA 2ESNA 2VE9A 1LJ9A 5JLWA 2EZKA 3KP2A 1T39A 2RNJA 2ZXHA 4E7ZA 3CMMA 2HVRA 4DW6A 2CMPA 5J1UA 1QNTA 2QCOA 3IH4A 4C2UA 5EGOB 3KP7A 3P9CA 2RKHA 2CW8A 3ISPA 4ENJA 2F2EA 1VI0A 3W6JB 3HRSA 3Q9VA 4X0GA 3OYBA 2H6BA 2M1BA 1WJFA 4UB6C 3EQLF 2OTLI 2P8TA 1SD6A 4XKWA 2R7VA 1Y0UA 2H1LA 4U88A 1Y39A 3K70C 2OAZA 4P5OA 4AYBA 5K5RA 3H35A 1OYWA 2R7TA 4D5FA 1BI0A 2GZWA 1JUPA 3ZR8X 1W1WE 1U5TA 2KRCA 5IT9K 1OPCA 1USSA 4KT6A 1JHFA 1YW9A 3N05A 5FRNA 1AKHB 4MEYF 1ON1A 2BXYA 3DPUA 5FKLA 3O6BB 2XSDC 4EVIA 3H1CA 5BS6A 3OS1A 2P4WA 4HNVA 5BPDA 4YIIA 1Z3XA 3B6AA 3AL0B 1P7JA 3VOEA 3CJNA 2EFOA 5IP7J 3CESA 4CICA 1V5GA 2HOTA 3QOPA 3V8LA 2HNHA 1WI3A 3IL2A 3LWFA 1ACIA 4JOMA 5JHUA 5JLXA 3OSFA 3DEUA 3TP3A 3OOUA 4RB2C 3C2GA 5TJJA 1VQPI 2NVXJ 3L2RA 2BEOA 5IYCJ 4UV9A 2QBYB 5DS9A 2LH9A 4Y33A 2LNBA 3CCRI 1YHQI 2EZIA 2HYGD 2KT0A 3KZYA 3TL4X 3X2QH 4BBSJ 5FKMA 1OLTA 1ZH5A 2DK8A 4AC0A 1SC7A 3LA7A 1FOYA 3SHFA 3J7AY 1FSHA 2DN0A 3RQ4A 4EM0B 2M8EA 5CVVA 2WTEA 4LJZF 2KP6A 1OCZH 2K4JA 4HV5A 3J81K 3H0DA 4NB5A 2HKXA 2MYSA 3E0JB 4BEHB 1JKQC 5LGNA 1FNNA 2M7AA 5D5XB 3CZ6A 4PZJA 3BCBA 1N25A 1T0FC 2RN7A 5IPAA 4NNJA 5E3LA 4F91B 1N77A 2X1EA 5HS7A 3I5UA 2K9QA 3P7NA 1OCPA 3KP6A 1S9HA 4S0HB 3H9QA 3KP4A 1W0TA 4HSRA 3DFGA 1ZQ3P 3K7AJ 1VFCA 2CSOA 2WY8Q 3DWLE 4XLHA 3T8RA 4Y52J 2DBBA 3F8MA 4UB8C 1LE8B 2HYJA 1KGSA 1MIJA 1MBEA 2AQEA 1XDSA 4HF0A 1NH3A 3MKLA 2WBMA 2Y48A 3RTRA 1O3QA 3I59B 4LK1F 1HSTA 1YFHA 2JWTA 4HBLA 4CO8A 3LSJA 2XAGA 1JKOC 1IN7A 4BJ6C 2R93J 3CF2A 4AIHA 4XORA 1YI2I 2FBHA 4G8XA 5ILSA 4FISA 3ZQQA 3KPHA 1TQPA 1U78A 2EK5A 1EF4A 3P9IA 5HDKA 2VOPA 1XSVA 2DYRH 1ZG1A 2EINH 2KIFA 3E6BA 2IA0A 2FBIA 3CTAA 3CDLA 1MNDA 4BBRJ 3CP2A 1P7IA 3A0BC 3Q0WA 2VJIA 1SFOJ 4Y7NJ 2PJPA 1LKXA 3CCVI 2R7FA 3QQAA 2J5PA 4EV0A 1P4XA 5D6EA 4XIDA 1W36C 3F9KA 1WJEA 2ZJQF 2M3AA 3A01A 4AVPA 4OAYA 4IEJA 4E7KA 1P2FA 3RKYA 2JQ7A 1F43A 2EBIA 3HGGA 1XSDA 1S29A 3DCFA 3OYAA 3OYJA 1E3HA 2RQPA 3PJRA 1IW7F 2ZSIB 5FKNA 3BR5A 4F3QA 4Z2YA 3SYTA 3GX4X 3Q5FA 1RNLA 2DLLA 2V1DA 2V7FA 2PBIA 1KONA 3PQJA 4FE7A 1KZHA 3NQOA 2JSCA 3BLYA 4M3DA 4OIRF 3ZMVA 3ML6A 5LEKA 4L0YB 4O3MA 4ZDOA 1FOXA 2EFQA 3R6SA 3F6OA 5B66C 5J4VA 2MFZA 1LVAA 2L7KA 2X6OA 4M73A 4RGXA 3DLLF 1S7AA 2KKOA 1AA7A 5FD6A 2Y69H 3WTVC 3TEDA 2VBZA 2X51A 2P0WA 3ZXSA 2ZC2A 1JJ8C 2MABA 5E79C 2LDUA 2ACJA 4IHYA 1Z77A 1MMNA 3R0JA 1DQUA 1V55H 4C3JJ 3ZQFA 6PAXA 3UR3C 3T0YA 2V26A 2HVQA 1SFXA 3FXJA 4C3IJ 3K0LA 1CQTA 1VZ0A 2H8WA 1LPQA 2VQCA 4XSZF 1K61A 2CU7A 5EEHA 1ZR4A 1B1BA 2GBYA 5FFZA 2JPCA 4PK4A 4XKBA 3FK6A 2E5ZA 4XN0A 4H0EA 3JTGA 2R92J 1WFXA 3V4GA 2R7RA 3S3MA 1SD7A 3QODA 2E2IJ 1ZREA 3KEOA 4XRFA 3T1BA 2QA4I 2R7SA 3GBGA 3I3LA 2Z16A 1OISA 3FXKA 4HQEA 3T5XA 4RLFA 2K4BA 2Q8KA 2F4MB 4AM3A 2DQLA 3HSEA 1P92A 4IRIA 3G3ZA 1K79A 3RCOA 2DMPA 4CUGA 2ELJA 4MGRA 2NS7A 3HL2A 2LTPA 3CUQC 1S72I 1I1GA 2LRDA 2X0LA 4I99C 2DJIA 2HR3A 2STTA 5IYDJ 1STZA 2OU2A 3ZP5A 2CQKA 1WZ2A 3B02A 4OIQF 1H9TA 3HHHA 3WTWC 3JAMK 5EDNA 4MNUA 5FD5A 1MDMB 3ZQLA 4B3XA 5D8KB 2XDVA 1AKHA 3BG6A 2BXZA 2DPUA 1S7EA 4KJZA 4P96A 3GCMA 5F6FA 4U0YA 2YR2A 2CWEA 4NUBA 2UV1A 2F4IA 2QZ8A 2LBFA 3NAUA 4ITVA 5ICCA 3PM1A 4ZJZA 5CQGA 2VLAA 2LY1A 2B9SA 5FGMA 4AIKA 4HOBA 2XASA 4DGWB 2OBPA 3JSPA 4HZFA 2BW3B 3VYRB 3IKVA 5BPIA 2DOAA 1SVOA 2E1NA 3QYEA 5A2QK 5GP9A 1ZGJA 2W48A 2XPWA 4ESJA 4EJTA 4A3BJ 2A6EF 4M74A 4BXUA 3WTXC 4CCJA 4XLCA 2D1VA 3M8JA 4Q48A 3HG9A 3LAJA 1M1EB 2O61A 2F5EA 3L2CA 2QKLB 4JX6A 2EA2A 5JHFA 1QZEA 2XB0X 5E3MA 4IHSA 1TNTA 2RGVA 4M3FA 4I0AA 4A3GJ 2XKOA 1EA3A 2CUFA 1WHUA 4CHUA 3DLAA 4A0ZA 4U7DA 2ZMEC 1XSXA 3ZN1A 2LSOA 3GTGJ 2JA5J 3DEEA 3ERMA 1BJZA 4RGRA 5M5XJ 3JW4A 4WCGA 2W7NA 2VOOA 4LLLA 3S1NJ 2CFXA 4E4HA 1YRNB 2NVTJ 2NNYA 3I9V2 3DEWA 3QP5A 2KZGA 2P81A 1J9IA 3CF5F 2H27A 1MD0A 3K1MA 4B4CA 1UCRA 2YUSA 3M9AA 2HXOA 2GIVA 2XF7A 2P5KA 5L3DA 4PJ0C 1BIBA 5AIPA 1UG0A 1TT0A 4HLXA 2DK5A 3BPVA 4WF2A 5HVQC 3K4CA 2EV0A 4BJTA 1USTA 3DBHB 2O9LA 3G4SI 3CMAI 2GXBA 3VPRA 3TOAA 2FSWA 3L2VA 4A3EJ 2QKMB 1IGNA 1R58A 4DNCA 2VUMJ 2IRFG 5HDNA 1V5EA 5EZGA 4QPQA 2XUBA 1GLNA 2P6SA 2LC2A 1WI9A 3HJEA 4AWXB 4A3MJ 1R5GA 2GM4A 1XTAA 2R5YB 2V9VA 1FPQA 4RB1A 4RBOA 4M9ZA 3S2HJ 1I5ZA 1MJBA 1R36A 3GFIA 2NXNB 2JVGA 2JZYA 1LB2A 5KNLA 4Q4ZF 3E5XA 4OIPF 1E0EA 1R6RA 3BOQA 3ZRGA 4R1HA 1B72B 1T08B 3H5AA 1TT5B 3HOSA 2R7UA 5M5YJ 4GCVA 1ZLKA 3CC7I 1SD4A 2ELHA 3U1KA 5HNFA 4E70A 2ME6A 2ESHA 3TMOA 5BQTA 2L5QA 3QU3A 2R5ZA 1A6QA 2E1CA 1RR7A 5GADJ 3ECOA 4PGHA 2BY1A 1R00A 1FYLA 1OFCX 1W36D 2MLKA 2CUJA 3I54A 1YIOA 3IWFA 1BOBA 2HPMA 1GXQA 4LMYA 4BY7J 1IV8A 4ZZLA 2MC3A 4HNUA 2ZNYA 4IL6C 3L1PA 4CYDA 4QSHA 2OA4A 5L3EA 1IXRC 4ENKA 1IRXA 2MH9A 2NOGA 2XSJC 4RB0A 3OYLA 2IGMA 4BQAA 4D7NA 2VI6A 4KT5C 2DDBA 3RPUD 5LRSA 3S2WA 3C7JA 1VQ7I 1ETOA 3K4MA 4EJOA 1Z05A 1MBKA 2L4AA 1WGXA 4YELA 3IAM2 2FEZA 2I8DA 3L9FA 4CYCA 2A61A 4A3JJ 2JJ7A 3HPGA 2YU9J 1UJ8A 4I0BA 2MA3A 3IWZA 3S1RJ 1CGPA 3A01B 1TW3A 3CO7C 1DU0A 2HQAA 2YX4A 4BYYA 2IT0A 2XIGA 3NARA 2XAUA 1W7PA 4G6TB 3CUOA 3I58A 2K9MA 4GGGA 2Y30A 4ENNA 3ASNH 1MGTA 4L9NA 5JVTA 3QYFA 2ZFUA 3R60A 4ZYHA 5IT3A 3PIOF 2BY0A 4UUSA 4D7MA 3V7SA 5HLHA 1BI2A 4FETA 2IS2A 1X1AA 3OIPA 3B6CA 2CG4A 2MW8A 5KAIC 3L2UA 3BJ6A 1IN4A 2K9LA 4CZCA 4M6YA 1QO0D 3WGGA 1IC8A 1BJAA 4LITA 3VDXA 1R9TJ 3CP8A 2VT3A 3IHUA 2CS3A 2IGOA 3LSMA 4LFUA 1EV7A 3VSKA 1FYMA 5L3CA 1FC3A 1I3QJ 1OCRH 1YQAA 2FUG2 4ZYDA 3FBNB 3L09A 2WAEA 1IXSB 5B5EC 2KDOA 2PJRA 1BM9A 4GXOA 5H20A 3MZYA 2DOEA 1FMVA 2E71A 4C30A 5GTHC 4BQNA 4C9YA 4DZJA 1FLIA 1W5SA 1HDPA 1W5TA 2L01A 3BDDA 3JSOA 3ZMSA 4I76A 1RC9A 1BI1A 1MBFA 3RPUA 5EG0B 1F4KA 4FTHA 5J8FA 1D5VA 3GTQJ 2OPTA 1QVUA 2FRHA 3K1PA 2ECCA 3A4CA 1RZ4A 4N4NB 3HOWJ 3H5RA 1P4AA 2E2HJ 2G0EA 2ZBKA 5FROA 2R7DA 5C4XJ 1B9NA 1NK3P 1YOVB 3O8GA 1B8IB 2Z9OA 1MNEA 4LG0A 3IUOA 3PFYA 2E1OA 1WJBA 1HKSA 2BOLA 1Z6TA 3BROA 3U1DA 3BQZA 2M8GX 2IS1A 4IRGA 1YW8A 3WG9A 5HS8A 4FT8A 1SEUA 2JN6A 2DU9A 3TKYA 3SEQA 3SZTA 1LFPA 3LA2A 1ZK8A 1X3ZB 2NVUB 3CDHA 2A6TA 1BIAA 2BBYA 1ETXA 2M7BA 1IRZA 2WB1A 4LLNA 2TDXA 1R49A 1TWFJ 4M9SA 2M34A 1H0MA 4ON0A 1I1SA 4PCQA 4R8HA 4HX8A 1R1VA 2K85A 1G6NA 4GYIA 1WJAA 4XRSA 1FTZA 4CCKA 2W85A 1ZARA 4UV8A 4Y17A 2UXXA 3K2AA 3WE3A 3ZMZA 3LSTA 4BEHA 3HXLA 4FASD 3KP3A 2VIXA 4BUPA 4CSWA 2KL4A 4F55A 1OJLA 1I50J 3CMYA 3MKYB 4UXNA 2EJRA 1FT9A 2LG4A 4IOAF 2LKPA 4XSXF 3HOYJ 4NDLA 1GVDA 1MBGA 2E36A 3EETA 2EPFA 1WH5A 4ABZA 2KHMA 2H1KA 1K78A 4OMZA 3FXOA 4HF1A 3VFZA 4I7HA 4WX9A 1UHSA 3DKWA 2Z99A 2EB7A 3KZIC 3GWZA 4MTEA 4AD9A 4ZTJA 2WAFA 1V5FA 3GTJJ 3RZOJ 2CYYA 3I4NJ 3CJQB 1SAXA 5C44J 4A6DA 3CJRB 2R5ZB 3S15J 1UFMA 1HF0A 2H09A 2ZFWA 4D1QA 2P7VB 2QF7A 4PSWA 1I39A 1XGSA 1MSFC 4OOIA 4NBQA 3ECHA 2VC0A 2RAEA 1X2MA 2JPBA 3L2QA 3QYBA 4XLFA 2X6XA 4V2FA 2XAFA 3W6VA 2VKHA 5D8LB 4XLNF 1D8JA 3LQRA 2QQBA 2HDDA 1SMTA 2NYXA 4MFDA 5E8GA 2KFDA 1ETYA 5L3BA 3AG4H 3ZMTA 3RKQA 2EIMH 2HQRA 2WAQA 3OYKA 3GTPJ 1IN8A 3H3VK 5B1BH 3C2BA 3CD6I 3DXJF 1HQCA 3F3XA 1U6GA 3K4LA 3LSRA 1TWCJ 4IJAA 1HDDC 1MKMA 4HNTA 4RDUA 2G7UA 2BW3A 5DCMA 1UG2A 1XMAA 2BVLA 3TW6A 3KCCA 1PVEA 3F72A 5E3OA 5HNHA 2K5CA 2R7OA 2BE5F 3V8KA 3S8PA 3PO3J 3KX2A 2KQRA 3G71I 4Z6YA 2L0KA 3F6VA 3C3WA 3TP0A 4RS8A 3CC4I 4MQ9F 5K5OA 2OF7A 4KICA 2DTZA 2KJBA 1IJWC 5F1JA 3S32A 3DU5A 4XM3A 4LD5A 1BR2A 5KHDA 3E7LA 3ZCOA 1QPMA 3KYCB 5HODA 2PEXA 2Z3YA 1BBYA 3KEYA 4JP0A 3HIFA 2B0LA 3BR3A 4GDFA 5H6RA 1LDDA 1Z7UA 3HOXJ 3C18A 2EV5A 3LOCA 4NQWA 3CQZJ 1HA8A 1RETA 2JA8J 3OIQA 2VT2A 1ETQA 3DV8A 2HI3A 2ICWG 3BT9A 2DMQA 2KRHA 2L7MP 3JRIA 3D0SA 3JRGA 3WTUC 4HRIA 3HB9A 3WG7H 2LY2A 2RNGA 4HEA2 2K27A 5F0HA 4ANJA 4G7ZF 1APLC 2HPIA 3I0TA 3I53A 5EEGA 3S14J 4M9XA 3DU6A 3FIWA 1SMYF 1HKQA 1K83J 3ELKA 1LUJB 5ILVA 3HOVJ 2CW0F 1G3SA 3K6GA 5IOYA 1SFUA 3SFZA 2W57A 4K2EA 1OCCH 4A69C 3KEQA 1AOYA 2FNAA 3JREA 1Z1DA 3TGNA 2OV7A 3TO9A 2CGPA 1QBJA 1TZLA 2CJJA 5KK1A 1Y8QB 4M3EA 5HS9A 2IAIA 3BPXA 1O3RA 3PO2J 3K70D 2P7CB 2BY3A 1VTNC 5M3FJ 2F4OB 2KIQA 5KVRA 2NRAC 4G6DA 3P9KA 3CLQA 4YIFA 2PMZA 3OR2C 3BG7A 2P5LC 2M87A 4MHGA 1DGWY 4I09A 1X58A 1KQ0A 3HC7A 5CVIA 5EZHA 2LD5A 2HOSA 1EH7A 3L7WA 3LFKA 4KUMA 5DD4A 4RGSA 2QEXI 1FJLA 2JMWA 5DM7F 2KMUA 2ETHA 5EG0A 5IYBJ 5FKOA 4DOZA 2F5VA 2IS6A 2IPQX 3L00A 2M2EA 3G1OA 4B8XA 3QU6A 4BAYA 2VODA 1D1BA 1L0OC 1VQ8I 2WV1A 3DTKA 3RDIA 1BR4A 3I4MJ 1W4MA 4EQQA 2NS0A 3LFUA 5E17F 1HKTA 2I10A 1HSJA 1J59A 2QSHX 3NWSA 3L2WA 5D4SA 2DDAA 3C1DA 2CQ7A 1RPWA 2EV6A 3G1LA 1OR7A 4IPAA 3BTIA 2YS9A 3GZNB 1XC5A 1XDUA 3CCEI 2Q2EA 2E2JJ 5FLVA 4EGYA 4LB6B 4Q47A 3OL3A 2ME0A 3GFLA 2UZKA 3LQQA 2HTSA 3CJTB 3HTSB 3F8NA 1VQKI 1X4OA 1XG1A 1MJAA 4RB3C 2YX7A 1QHHD 2STWA 1J0RA 2Y31A 3BP8A 2MGQA 3HZJA 4J19A 1JKRC 1YJWI 4NC6A 1FOKA 3FM5A 2VJJA 3JCUC 5DTDA 3OIOA 1IN6A 1YLFA 2CV2A 3CCSI 4DZPA 2HFHA 2DA6A 3DF8A 4BDZA 1WKMA 5M3MJ 5HDGA 2CW7A 4ZYEA 3DPTA 2FX0A 2JVHA 5DYMA 4LG0B 1XMXA 1TWGJ 2IS4A 3A2KA 4DYCA 1FTTA 1LEAA 4LK0F 5LHHA 5LEJA 4XOPA 5FKKA 1OMIA 3J7ZI 2LP0A 1IAWA 1FWZA 5DCFA 2DAOA 2DA7A 2E1MB 1ZTRA 4O6JA 1D3YA 5GPAA 2R0QC 2CUEA 3IH3A 1R7JA 3KYLA 3CO6C 3QWLA 1W5CC 3A1YA 5IP9J 1B6AA 5DUKA 1PUEE 1JXSA 3ZGKA 2OQRA 3FMQA 5GAGJ 2P5VA 4CGZA 2LFBA 2F5DA 3IH2A 3TDUC 3Q0VA 2EIKH 5LBQA 1BOAA 3BG3A 2UXNA 4XR6A 5DUIA 3OYCA 3GVAA 4BHCA 2DA4A 4JBAA 3ULQB 4MEXF 1Z7LA 2Y75A 5GAEJ 2GOMA 3OYNA 4ZH4F 4CCNA 5J3LA 3I64A 2DQRA 3K4BA 4FCYA 4KNYA 4QPOA 3M8FA 1LDKB 4L5IA 2O5RA 3ASOH 3FZVA 2AS5F 1T0FA 2W25A 2V1UA 5K7ZA 2XC7A 5LRRA 3RYPA 2WWYA 1J5YA 2CV1A 5HLGA 3S1QJ 3FF5A 1O57A 1X1PA 4ZDPA 4E7JA 2XRNA 1K4SA 2LVSA 5CJ9A 2OJED 1HC8A 1T95A 1W7PB 2DT6A 2DPDA 2K9SA 3RSNA 3DBLB 1HOMA 1Y6IA 2F6CA 3DP7A 3QPTA 5FLMJ 2M4KA 3KIOA 3NWTA 2HZTA 4XK4A 4L9VA 4BE2A 3ABLH 3AKZA 2P6TA 4OMYA 2DFIA 2V4JC 1U0JA 4CYCB 3HDDA 2A69F 3P5JA 3K69A 5FO5A 5E3NA 1G2HA 1WJCA 3GTLJ 3ZQIA 3BZKA 1R5HA 3BR1A 2MH2A 1FP2A 1VQ9I 2Y9ZA 2PJRB 1NHAA 3LAPA 1ZRCA 4P1WA 2A68F 3GZ5A 3IKTA 3ZMUA 1FBUA 4RAGA 2O03A 4A2UA 1S3JA 4U0WA 2DFEA 2M30A 3OYGA 1R23A 1TWHJ 4B09A 1HW1A 3ABMH 4CZZA 3H9GA 4M3BA 2VONA 1POGA 1DP3A 4B43A 2CV0A 3FMRA 1WH7A 2BY2A 4KMFA 2TRTA 2XGEA 1NG7A 2X9DA 1NK2P 4I6ZA 1JUSA 5EF6A 3BCAA 1TWAJ 3GTKJ 5F08A 2LOOA
chains in the Genus database with same CATH topology
3KE2A 1T98A 1SD5A 4WXDA 4O5VA 5LGUA 1V3FA 1T2KA 3O2PE 3H3UA 3PQKA 3VB2A 3QPHA 3F8CA 2HTJA 1TBXA 1U8RA 3Q9SA 2R3SA 2DO7A 4LGWA 1F5TA 5D5VB 4UVAA 4PGGA 2ZJ2A 3WGIA 1HW2A 3GF2A 1IF1A 5LHIA 3HYIA 3K1NA 2YU3A 3ZPLA 4HF2A 4KMUX 4XBFA 1ZGAA 4KIBA 3M8EA 4S04A 4P55A 5D5WB 5FFXA 5LGTA 1GVJA 3QRFF 3O3KA 2EFPA 3ZMDA 2RVCA 5DEQA 3I71A 5J8CA 4QLCU 2FQ3A 1B59A 4UVBA 5J6XA 2EFWA 2XAHA 4G9YA 4IHTA 2XGXA 4HX7A 4EMSA 3E3VA 2F5FA 1KQ9A 5BMZA 1WQ2A 2KRFA 1LDJA 3WTSC 3SXYA 1YS7A 3QP6A 1I27A 1YS6A 2F5CA 4RAYA 1OYYA 1ZYRF 4HA8A 2PI0A 3RIRA 3FXUA 3T8TA 2Q0OA 3FMSA 3MQ0A 2UWMA 2HEOA 4N9HA 1G3TA 1MDMA 2L3DA 4HV6A 1KYZA 4LLGF 1YG2A 2FA5A 1Z9CA 1F1ZA 5D6FA 1Z91A 5DCMB 4HLYA 2E7XA 1XMKA 4F7ZA 5E1XA 1FX7A 3U9GA 2E7WA 1S7OA 5FLXK 4KIGA 1ZRFA 1O3TA 3BJOA 2D45A 4HW0A 1IUYA 4Q5SF 1B4AA 5DD8A 3OV8A 1K6OA 5F1RA 1UB9A 1O7FA 3GFJA 4ZYGA 2L02A 1HBXG 1PDNC 1XN7A 1IRGA 4G7OF 1ONVA 3K2ZA 1ZG5A 3F8FA 1G3WA 3MWMA 4FX4A 1V4RA 2VC1A 1UHMA 1FSEA 1ODDA 3CUQA 3HSRA 1U2WA 2XHKA 1K78B 1YO5C 2HS5A 4N9IA 4HQMA 3KZZA 1GXPA 5L3GA 3TQNA 1BN5A 1DPUA 1W7PD 2HDCA 5FB2A 2H94A 1S6LA 1EH8A 2FNPA 4S05A 4IVNA 4YFKF 1FBQA 5JI6A 3J80K 2PMHA 5E20A 5E1WA 2ZMEB 3HSFA 1OKRA 4DQ2A 3F21A 1OYIA 4RGUA 2QENA 1FY7A 3SQNA 5ERIA 2K86A 4I98B 1J7KA 2KIMA 4BHPA 3HHGA 2G9WA 1L3LA 1YYVA 2RV8A 2JTVA 4KN4X 4OIOF 2PFBA 5CYVA 2ADUA 3V7RA 3F8BA 4GO1A 2IA2A 1D8KA 2OD5A 1ZRDA 3VODA 3RYRA 5CVUA 4BH9A 3I59A 3M7GA 2Y0MA 4GYGA 3U2RA 2DI3A 1JHHA 2XV4S 2XKPA 2V6CA 2ZMEA 4EJVA 1JGSA 2BV6A 2OZUA 3JTHA 4KN7X 2O3FA 2C6YA 1DP7P 2CO5A 5DV5A 1FBSA 3ZN0A 2HKOA 3R0AA 3WU1B 4KA4A 2GQQA 2W84A 3WODF 2IVMA 2PQ8A 4CXFA 1H9GA 3BJAA 2QBYA 4I01A 4A12A 4HX4A 3CLOA 3K9TA 4FHTA 1S8NA 4IRHA 2VBYA 1T6SA 2YPRA 1K7AA 2QLZA 1ZLJA 2ZXJA 1J75A 4G94A 2L54A 3HRTA 1U5TB 3AAFA 3BWGA 3J7AO 1MZBA 3ROUA 3F23A 4HAMA 3RPQA 2XAJA 4PDKA 3E6DA 4KFCA 3J81Z 1TLHB 4P9FA 2HGCA 1JE8A 2VBWA 1ZN2A 4G7HF 3E5UA 1QZYA 1T38A 3RKWA 4Y13A 4UNOA 1DUXC 2V79A 2ZO4A 3GW2A 2BGCA 1GHCA 4JQFA 1RIOH 4XLPF 5LLQA 3MZHA 5FLXZ 3IC7A 3FXRA 4KDPA 1G3YA 3GO5A 1O7LA 2ISZA 1YTYA 3NRVA 3QAHA 3R4KA 1XD7A 5K5QA 4ETSA 3E97A 2COMA 4A5NA 4YG2F 1G4DA 3H92A 4LB5A 2HOEA 3GUDA 3WU0A 3LA3A 4WK8F 5HOOA 1E17A 4KYWA 3GXOA 2VN2A 2GA2A 4L18B 2FF4A 1IZ1A 3KFWX 3OOPA 2FE3A 1XGOA 3ERED 3MEXA 4IXAA 3HOTA 3FWEA 2GAUA 2VXZA 1SFEA 1XCVA 3RI4A 2QWWA 2LF8A 1KYWA 4L9JA 1TQMA 3BZ6A 1R22A 1IRFA 3WTTC 4EM2A 1C0WA 2FMYA 2VE8A 3KETA 2IW5A 3HUGA 4ENMA 4QWQA 4ZZDA 2OQGA 4FX0A 2O6GE 1R1TA 2KJCA 2JT1A 4HDVA 5LHGA 2K02A 5D4RA 1XGMA 1B9MA 5F64A 3B73A 3W6KB 2GXGA 1LQ1A 2FBKA 2A6HF 2PLYA 4UUVA 3VEPA 1KA8A 4EM1A 4KIFA 2X4HA 3WTYC 3IRQA 2IJLA 1CF7B 1BI3A 1REPC 3E6CC 1IN5A 2EA4A 4OU0A 1E2XA 2FXAA 4UVCA 2D1HA 4YFXF 1YW7A 2O8XA 5E8IA 2DW4A 4WXHA 5ICEA 1F9NA 4M71A 2DTRA 5TRDA 2KIUA 1XCBA 2EWNA 1XGNA 2AXLA 5A2QZ 1WSUA 3FX3A 3EYIA 2FU4A 3M1EA 4L5JA 3KLOA 3MFKA 2VBXA 3G73A 2PMUA 2Z5UA 3WGHA 4M6XA 1IXCA 3TOBA 4WWCA 2YSRA 2HYFA 5BOXA 3GZ6A 3ABUA 4D0PA 2IA1A 3GFMA 2M5WA 3FHZA 3EYYA 5ED4A 1WWXA 4I02A 3N97A 5K1YA 2QYOA 5ILUA 2Z33A 3TO6A 4BNCA 2OZ6A 2V1XA 2XVCA 1RUNA 2A07F 1P6RA 3SZPA 2M45A 3N4MA 1ON2A 1PP7U 1LEBA 2MLGA 2QVOA 4AIJA 3RJPA 1PP8F 4I2OA 2WV0A 3V7CA 4A0XA 5DDGA 4ASNA 2MD5A 2BYVE 1CF7A 1TW2A 4A6EA 1ULYA 4ESBA 2XAQA 5L3FA 1TNSA 2ZKZA 1QGPA 5IT9Z 2RC4A 5D5UB 1A04A 3H3ZA 4L0ZB 3ABTA 3NEUA 1HXDA 4G6QA 1LNWA 2FOKA 4N0BA 3FM3A 2RDPA 2JRTA 1KU2A 2LF7A 1BC7C 1QQIA 3V8JA 4CDGA 2ISYA 1P4WA 1UHWA 3CUQB 3F22A 3IRRA 2QQ9A 1HW5A 1ZG3A 3GEZA 3E5QA 5CLSA 4HDUA 4A0YA 1I6XA 4HYEA 4NHJA 5HLIA 5H6QA 5ICGA 4JK1X 1AWCA 3COAC 3ZQ7A 1X3UA 1TQIA 3TO7A 4BHBA 3WTZA 4IF4A 1DPRA 1J2XA 2GA1A 2HWVA 4U7BA 3BY6A 2D2WA 2PG4A 4YFNF 3TDZC 2QUFA 4EJWA 2XROA 1ZHFA 1TTYA 2L4MA 5JR3A 4L9TA 3GLXA 5E18F 2HQNA 3EDPA 1KU9A 2A5YB 1FP1D 1U3EM 2K7LA 2IP2A 1R1UA 2O0YA 3DPLC 1MJ9A 3I4PA 1KQ8A 2WC2A 2ZCWA 4ESFA 1O3SA 2FMLA 3FXQA 2QQAA 5AIQA 2H6CA 3KLNA 3EUHA 1Z6RA 4MTDA 2A3SA 1FZPB 2DT5A 3DQVC 3D5LA 2PN6A 1EH6A 1WRJA 2NAZA 1BC8C 4P9UA 3WE2A 1FYKA 3GYHX 2W24A 2G7HA 4M72A 5ICFA 4A5MA 4EJUA 3E6MA 1XB4A 4OINF 4RAZA 5CVJA 4Y15A 3HRMA 3PFIA 4UHTA 5AONA 1KU7A 3HRUA 3REOA 1QZZA 2ZNZA 4EGZA 5E1ZB 3J80Z 2QM3A 2NNNA 4TV7A 2MBFA 3JAMZ 4MQVA 4WXCA 1DDNA 2GWRA 3HTUA 3KP5A 1Q1HA 2J5OA 3R61A 2EFNA 3RKXA 1U5TC 5JFRA 1KU3A 4U0VA 4R79A 1RUOA 3MCZA 3MAJA 1ZAOA 5CVRA 1RI7A 2ESNA 2VE9A 1LJ9A 3KP2A 1T39A 2RNJA 1QNTA 3KP7A 3P9CA 2RKHA 3ISPA 4ENJA 2F2EA 3W6JB 3HRSA 3Q9VA 2H6BA 2M1BA 3EQLF 2P8TA 1SD6A 1Y0UA 4U88A 2OAZA 4P5OA 5K5RA 1OYWA 1BI0A 2GZWA 1U5TA 5IT9K 1OPCA 1USSA 1JHFA 1YW9A 4MEYF 1ON1A 3O6BB 4EVIA 5BS6A 2P4WA 5BPDA 4YIIA 3VOEA 3CJNA 2EFOA 4CICA 3QOPA 3V8LA 3IL2A 3LWFA 5JHUA 3DEUA 4RB2C 5TJJA 2BEOA 4UV9A 2QBYB 2LNBA 2HYGD 3KZYA 1ZH5A 2DK8A 3LA7A 3SHFA 1FSHA 4EM0B 2M8EA 5CVVA 2WTEA 4LJZF 2K4JA 4HV5A 3J81K 4NB5A 2HKXA 5LGNA 1FNNA 5D5XB 4PZJA 2RN7A 5HS7A 3I5UA 3P7NA 3KP6A 3KP4A 3DFGA 2CSOA 3T8RA 2DBBA 3F8MA 1KGSA 1XDSA 4HF0A 2Y48A 3RTRA 1O3QA 3I59B 4LK1F 1HSTA 1YFHA 4HBLA 4CO8A 2XAGA 1IN7A 4AIHA 2FBHA 4G8XA 5ILSA 1TQPA 1U78A 2EK5A 3P9IA 5HDKA 2VOPA 1XSVA 1ZG1A 2KIFA 3E6BA 2IA0A 2FBIA 3CTAA 2PJPA 2R7FA 4EV0A 2J5PA 1P4XA 5D6EA 4AVPA 1P2FA 3RKYA 1XSDA 1S29A 2RQPA 1IW7F 4Z2YA 3GX4X 3Q5FA 1RNLA 2DLLA 2V1DA 2PBIA 3PQJA 3NQOA 4O3MA 2JSCA 4OIRF 3ZMVA 4L0YB 3ML6A 5LEKA 2EFQA 3R6SA 3F6OA 1LVAA 4RGXA 4M73A 1S7AA 2KKOA 5FD6A 3WTVC 2VBZA 2LDUA 2ACJA 3R0JA 6PAXA 3T0YA 1SFXA 3K0LA 4XSZF 5EEHA 1B1BA 5FFZA 2JPCA 4H0EA 3JTGA 3V4GA 1SD7A 1ZREA 3KEOA 4XRFA 3T1BA 4HQEA 3T5XA 2K4BA 2Q8KA 2DQLA 3HSEA 1P92A 4IRIA 1K79A 3G3ZA 4MGRA 3CUQC 1I1GA 2X0LA 2HR3A 2STTA 1STZA 2OU2A 3ZP5A 2CQKA 3B02A 4OIQF 1H9TA 3HHHA 3WTWC 3JAMK 4MNUA 5FD5A 1MDMB 5D8KB 2DPUA 4P96A 5F6FA 4U0YA 2YR2A 2CWEA 2QZ8A 5ICCA 5FGMA 4AIKA 4HOBA 2XASA 2OBPA 3JSPA 4HZFA 3IKVA 5BPIA 2E1NA 5A2QK 1ZGJA 4EJTA 4ESJA 2A6EF 4M74A 4BXUA 3WTXC 2D1VA 4Q48A 3LAJA 2O61A 2F5EA 3L2CA 2EA2A 4IHSA 1TNTA 2RGVA 4I0AA 2XKOA 4CHUA 4A0ZA 4U7DA 1XSXA 3ZN1A 2LSOA 4RGRA 3JW4A 4WCGA 2VOOA 4LLLA 2CFXA 2NNYA 3QP5A 1J9IA 2H27A 1MD0A 3K1MA 1UCRA 3M9AA 2GIVA 2P5KA 5L3DA 1BIBA 5AIPA 4HLXA 2DK5A 3BPVA 4WF2A 5HVQC 2EV0A 2GXBA 1USTA 3TOAA 2FSWA 1R58A 4DNCA 2IRFG 5HDNA 2XUBA 2P6SA 1WI9A 4AWXB 1R5GA 2V9VA 1FPQA 4RB1A 4M9ZA 1I5ZA 1MJBA 1R36A 3GFIA 2JZYA 1LB2A 4Q4ZF 3E5XA 4OIPF 3BOQA 4R1HA 3HOSA 1ZLKA 4GCVA 1SD4A 2ELHA 4E70A 2ESHA 5BQTA 3QU3A 2E1CA 3ECOA 4PGHA 1R00A 1FYLA 2MLKA 3I54A 1YIOA 3IWFA 1GXQA 4LMYA 4ZZLA 2MC3A 2ZNYA 4CYDA 2OA4A 5L3EA 1IXRC 4ENKA 2MH9A 4RB0A 4BQAA 4KT5C 5LRSA 3S2WA 3C7JA 4EJOA 1Z05A 2L4AA 2FEZA 3L9FA 2A61A 4I0BA 2MA3A 3IWZA 1CGPA 1TW3A 3CO7C 2YX4A 4BYYA 2IT0A 2XIGA 1W7PA 3CUOA 3I58A 4GGGA 4ENNA 1MGTA 4L9NA 5JVTA 3R60A 4ZYHA 5IT3A 3V7SA 5HLHA 1BI2A 2CG4A 3BJ6A 1IN4A 4M6YA 1QO0D 3WGGA 1BJAA 2VT3A 3IHUA 4LFUA 1EV7A 1FYMA 5L3CA 1FC3A 1YQAA 4ZYDA 3L09A 1IXSB 1BM9A 4GXOA 5H20A 3MZYA 1FLIA 1W5SA 1W5TA 2L01A 3BDDA 3JSOA 3ZMSA 1BI1A 3RPUA 1F4KA 5J8FA 1D5VA 2FRHA 3K1PA 1RZ4A 1P4AA 2ZBKA 2R7DA 1B9NA 2Z9OA 4LG0A 1HKSA 1Z6TA 3BROA 3U1DA 4IRGA 1YW8A 3WG9A 5HS8A 4FT8A 2DU9A 3TKYA 3SZTA 3LA2A 3CDHA 1BIAA 2BBYA 4LLNA 2TDXA 4M9SA 1H0MA 4ON0A 1I1SA 4PCQA 4R8HA 4HX8A 1R1VA 4GYIA 1G6NA 2W85A 1ZARA 4UV8A 4Y17A 2UXXA 3WE3A 3ZMZA 3LSTA 3KP3A 4UXNA 2EJRA 1FT9A 2LKPA 4XSXF 3EETA 1K78A 4OMZA 4HF1A 3VFZA 4I7HA 4WX9A 3DKWA 2Z99A 2EB7A 3GWZA 4MTEA 4AD9A 2CYYA 1SAXA 4A6DA 1UFMA 2H09A 2ZFWA 2P7VB 1XGSA 4OOIA 3ECHA 2VC0A 2JPBA 2XAFA 5D8LB 4XLNF 1D8JA 3LQRA 2QQBA 1SMTA 2NYXA 5E8GA 5L3BA 3ZMTA 2HQRA 1IN8A 3DXJF 1HQCA 3F3XA 1U6GA 4IJAA 1MKMA 2G7UA 5DCMA 1XMAA 3KCCA 3F72A 2BE5F 3V8KA 3F6VA 3C3WA 4RS8A 4MQ9F 5K5OA 4KICA 2KJBA 4LD5A 1QPMA 2PEXA 2Z3YA 1BBYA 3HIFA 2B0LA 5H6RA 1LDDA 1Z7UA 3C18A 2EV5A 4NQWA 2VT2A 3DV8A 3D0SA 3WTUC 2K27A 4G7ZF 3I0TA 3I53A 5EEGA 4M9XA 1SMYF 1HKQA 3ELKA 5ILVA 2CW0F 1G3SA 1SFUA 3SFZA 2W57A 4K2EA 3KEQA 1AOYA 2FNAA 1Z1DA 3TGNA 3TO9A 2CGPA 1QBJA 5KK1A 5HS9A 3BPXA 1O3RA 2P7CB 1VTNC 5KVRA 2NRAC 4G6DA 3P9KA 4YIFA 2P5LC 2M87A 4MHGA 4I09A 1KQ0A 5CVIA 1EH7A 3L7WA 3LFKA 4KUMA 5DD4A 4RGSA 2ETHA 2IPQX 3L00A 4B8XA 3QU6A 4BAYA 2VODA 1L0OC 3RDIA 1W4MA 4EQQA 2NS0A 5E17F 1HKTA 1HSJA 1J59A 5D4SA 3C1DA 2EV6A 1OR7A 4IPAA 1XDUA 2Q2EA 4EGYA 4LB6B 4Q47A 2UZKA 3GFLA 3LQQA 2HTSA 3HTSB 3F8NA 1MJAA 4RB3C 2YX7A 2STWA 1J0RA 3BP8A 1FOKA 3FM5A 1IN6A 1YLFA 2HFHA 3DF8A 1WKMA 5HDGA 4ZYEA 3DPTA 5DYMA 4LG0B 1LEAA 4LK0F 5LHHA 5LEJA 1OMIA 1IAWA 1FWZA 5DCFA 2DAOA 4O6JA 1D3YA 1R7JA 3CO6C 1PUEE 1B6AA 5DUKA 1JXSA 2OQRA 3FMQA 2P5VA 4CGZA 2F5DA 3TDUC 5LBQA 1BOAA 2UXNA 5DUIA 3GVAA 4BHCA 4JBAA 3ULQB 4MEXF 2Y75A 4ZH4F 3I64A 2DQRA 4KNYA 3M8FA 1LDKB 4L5IA 3FZVA 2AS5F 1T0FA 2W25A 2V1UA 5LRRA 3RYPA 2WWYA 1J5YA 5HLGA 3FF5A 1O57A 2XRNA 5CJ9A 1W7PB 2DPDA 3DP7A 3QPTA 2HZTA 4L9VA 2P6TA 4OMYA 2DFIA 2A69F 3K69A 5FO5A 1R5HA 2MH2A 1FP2A 1NHAA 3LAPA 1ZRCA 2A68F 3GZ5A 3IKTA 3ZMUA 1FBUA 2O03A 4A2UA 1S3JA 4U0WA 2M30A 1R23A 4B09A 1HW1A 4CZZA 2VONA 3FMRA 4KMFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KE2 A;  1T98 A;  1SD5 A;  4WXD A;  4O5V A;  5LGU A;  1V3F A;  1T2K A;  3O2P E;  3H3U A;  3PQK A;  3VB2 A;  3QPH A;  3F8C A;  2HTJ A;  1TBX A;  1U8R A;  3Q9S A;  2R3S A;  2DO7 A;  4LGW A;  1F5T A;  5D5V B;  4UVA A;  4PGG A;  2ZJ2 A;  3WGI A;  1HW2 A;  3GF2 A;  1IF1 A;  5LHI A;  3HYI A;  3K1N A;  2YU3 A;  3ZPL A;  4HF2 A;  4KMU X;  4XBF A;  1ZGA A;  4KIB A;  3M8E A;  4S04 A;  4P55 A;  5D5W B;  5FFX A;  5LGT A;  1GVJ A;  3QRF F;  3O3K A;  2EFP A;  3ZMD A;  2RVC A;  5DEQ A;  3I71 A;  5J8C A;  4QLC U;  2FQ3 A;  1B59 A;  4UVB A;  5J6X A;  2EFW A;  2XAH A;  4G9Y A;  4IHT A;  2XGX A;  4HX7 A;  4EMS A;  3E3V A;  2F5F A;  1KQ9 A;  5BMZ A;  1WQ2 A;  2KRF A;  1LDJ A;  3WTS C;  3SXY A;  1YS7 A;  3QP6 A;  1I27 A;  1YS6 A;  2F5C A;  4RAY A;  1OYY A;  1ZYR F;  4HA8 A;  2PI0 A;  3RIR A;  3FXU A;  3T8T A;  2Q0O A;  3FMS A;  3MQ0 A;  2UWM A;  2HEO A;  4N9H A;  1G3T A;  1MDM A;  2L3D A;  4HV6 A;  1KYZ A;  4LLG F;  1YG2 A;  2FA5 A;  1Z9C A;  1F1Z A;  5D6F A;  1Z91 A;  5DCM B;  4HLY A;  2E7X A;  1XMK A;  4F7Z A;  5E1X A;  1FX7 A;  3U9G A;  2E7W A;  1S7O A;  5FLX K;  4KIG A;  1ZRF A;  1O3T A;  3BJO A;  2D45 A;  4HW0 A;  1IUY A;  4Q5S F;  1B4A A;  5DD8 A;  3OV8 A;  1K6O A;  5F1R A;  1UB9 A;  1O7F A;  3GFJ A;  4ZYG A;  2L02 A;  1HBX G;  1PDN C;  1XN7 A;  1IRG A;  4G7O F;  1ONV A;  3K2Z A;  1ZG5 A;  3F8F A;  1G3W A;  3MWM A;  4FX4 A;  1V4R A;  2VC1 A;  1UHM A;  1FSE A;  1ODD A;  3CUQ A;  3HSR A;  1U2W A;  2XHK A;  1K78 B;  1YO5 C;  2HS5 A;  4N9I A;  4HQM A;  3KZZ A;  1GXP A;  5L3G A;  3TQN A;  1BN5 A;  1DPU A;  1W7P D;  2HDC A;  5FB2 A;  2H94 A;  1S6L A;  1EH8 A;  2FNP A;  4S05 A;  4IVN A;  4YFK F;  1FBQ A;  5JI6 A;  3J80 K;  2PMH A;  5E20 A;  5E1W A;  2ZME B;  3HSF A;  1OKR A;  4DQ2 A;  3F21 A;  1OYI A;  4RGU A;  2QEN A;  1FY7 A;  3SQN A;  5ERI A;  2K86 A;  4I98 B;  1J7K A;  2KIM A;  4BHP A;  3HHG A;  2G9W A;  1L3L A;  1YYV A;  2RV8 A;  2JTV A;  4KN4 X;  4OIO F;  2PFB A;  5CYV A;  2ADU A;  3V7R A;  3F8B A;  4GO1 A;  2IA2 A;  1D8K A;  2OD5 A;  1ZRD A;  3VOD A;  3RYR A;  5CVU A;  4BH9 A;  3I59 A;  3M7G A;  2Y0M A;  4GYG A;  3U2R A;  2DI3 A;  1JHH A;  2XV4 S;  2XKP A;  2V6C A;  2ZME A;  4EJV A;  1JGS A;  2BV6 A;  2OZU A;  3JTH A;  4KN7 X;  2O3F A;  2C6Y A;  1DP7 P;  2CO5 A;  5DV5 A;  1FBS A;  3ZN0 A;  2HKO A;  3R0A A;  3WU1 B;  4KA4 A;  2GQQ A;  2W84 A;  3WOD F;  2IVM A;  2PQ8 A;  4CXF A;  1H9G A;  3BJA A;  2QBY A;  4I01 A;  4A12 A;  4HX4 A;  3CLO A;  3K9T A;  4FHT A;  1S8N A;  4IRH A;  2VBY A;  1T6S A;  2YPR A;  1K7A A;  2QLZ A;  1ZLJ A;  2ZXJ A;  1J75 A;  4G94 A;  2L54 A;  3HRT A;  1U5T B;  3AAF A;  3BWG A;  3J7A O;  1MZB A;  3ROU A;  3F23 A;  4HAM A;  3RPQ A;  2XAJ A;  4PDK A;  3E6D A;  4KFC A;  3J81 Z;  1TLH B;  4P9F A;  2HGC A;  1JE8 A;  2VBW A;  1ZN2 A;  4G7H F;  3E5U A;  1QZY A;  1T38 A;  3RKW A;  4Y13 A;  4UNO A;  1DUX C;  2V79 A;  2ZO4 A;  3GW2 A;  2BGC A;  1GHC A;  4JQF A;  1RIO H;  4XLP F;  5LLQ A;  3MZH A;  5FLX Z;  3IC7 A;  3FXR A;  4KDP A;  1G3Y A;  3GO5 A;  1O7L A;  2ISZ A;  1YTY A;  3NRV A;  3QAH A;  3R4K A;  1XD7 A;  5K5Q A;  4ETS A;  3E97 A;  2COM A;  4A5N A;  4YG2 F;  1G4D A;  3H92 A;  4LB5 A;  2HOE A;  3GUD A;  3WU0 A;  3LA3 A;  4WK8 F;  5HOO A;  1E17 A;  4KYW A;  3GXO A;  2VN2 A;  2GA2 A;  4L18 B;  2FF4 A;  1IZ1 A;  3KFW X;  3OOP A;  2FE3 A;  1XGO A;  3ERE D;  3MEX A;  4IXA A;  3HOT A;  3FWE A;  2GAU A;  2VXZ A;  1SFE A;  1XCV A;  3RI4 A;  2QWW A;  2LF8 A;  1KYW A;  4L9J A;  1TQM A;  3BZ6 A;  1R22 A;  1IRF A;  3WTT C;  4EM2 A;  1C0W A;  2FMY A;  2VE8 A;  3KET A;  2IW5 A;  3HUG A;  4ENM A;  4QWQ A;  4ZZD A;  2OQG A;  4FX0 A;  2O6G E;  1R1T A;  2KJC A;  2JT1 A;  4HDV A;  5LHG A;  2K02 A;  5D4R A;  1XGM A;  1B9M A;  5F64 A;  3B73 A;  3W6K B;  2GXG A;  1LQ1 A;  2FBK A;  2A6H F;  2PLY A;  4UUV A;  3VEP A;  1KA8 A;  4EM1 A;  4KIF A;  2X4H A;  3WTY C;  3IRQ A;  2IJL A;  1CF7 B;  1BI3 A;  1REP C;  3E6C C;  1IN5 A;  2EA4 A;  4OU0 A;  1E2X A;  2FXA A;  4UVC A;  2D1H A;  4YFX F;  1YW7 A;  2O8X A;  5E8I A;  2DW4 A;  4WXH A;  5ICE A;  1F9N A;  4M71 A;  2DTR A;  5TRD A;  2KIU A;  1XCB A;  2EWN A;  1XGN A;  2AXL A;  5A2Q Z;  1WSU A;  3FX3 A;  3EYI A;  2FU4 A;  3M1E A;  4L5J A;  3KLO A;  3MFK A;  2VBX A;  3G73 A;  2PMU A;  2Z5U A;  3WGH A;  4M6X A;  1IXC A;  3TOB A;  4WWC A;  2YSR A;  2HYF A;  5BOX A;  3GZ6 A;  3ABU A;  4D0P A;  2IA1 A;  3GFM A;  2M5W A;  3FHZ A;  3EYY A;  5ED4 A;  1WWX A;  4I02 A;  3N97 A;  5K1Y A;  2QYO A;  5ILU A;  2Z33 A;  3TO6 A;  4BNC A;  2OZ6 A;  2V1X A;  2XVC A;  1RUN A;  2A07 F;  1P6R A;  3SZP A;  2M45 A;  3N4M A;  1ON2 A;  1PP7 U;  1LEB A;  2MLG A;  2QVO A;  4AIJ A;  3RJP A;  1PP8 F;  4I2O A;  2WV0 A;  3V7C A;  4A0X A;  5DDG A;  4ASN A;  2MD5 A;  2BYV E;  1CF7 A;  1TW2 A;  4A6E A;  1ULY A;  4ESB A;  2XAQ A;  5L3F A;  1TNS A;  2ZKZ A;  1QGP A;  5IT9 Z;  2RC4 A;  5D5U B;  1A04 A;  3H3Z A;  4L0Z B;  3ABT A;  3NEU A;  1HXD A;  4G6Q A;  1LNW A;  2FOK A;  4N0B A;  3FM3 A;  2RDP A;  2JRT A;  1KU2 A;  2LF7 A;  1BC7 C;  1QQI A;  3V8J A;  4CDG A;  2ISY A;  1P4W A;  1UHW A;  3CUQ B;  3F22 A;  3IRR A;  2QQ9 A;  1HW5 A;  1ZG3 A;  3GEZ A;  3E5Q A;  5CLS A;  4HDU A;  4A0Y A;  1I6X A;  4HYE A;  4NHJ A;  5HLI A;  5H6Q A;  5ICG A;  4JK1 X;  1AWC A;  3COA C;  3ZQ7 A;  1X3U A;  1TQI A;  3TO7 A;  4BHB A;  3WTZ A;  4IF4 A;  1DPR A;  1J2X A;  2GA1 A;  2HWV A;  4U7B A;  3BY6 A;  2D2W A;  2PG4 A;  4YFN F;  3TDZ C;  2QUF A;  4EJW A;  2XRO A;  1ZHF A;  1TTY A;  2L4M A;  5JR3 A;  4L9T A;  3GLX A;  5E18 F;  2HQN A;  3EDP A;  1KU9 A;  2A5Y B;  1FP1 D;  1U3E M;  2K7L A;  2IP2 A;  1R1U A;  2O0Y A;  3DPL C;  1MJ9 A;  3I4P A;  1KQ8 A;  2WC2 A;  2ZCW A;  4ESF A;  1O3S A;  2FML A;  3FXQ A;  2QQA A;  5AIQ A;  2H6C A;  3KLN A;  3EUH A;  1Z6R A;  4MTD A;  2A3S A;  1FZP B;  2DT5 A;  3DQV C;  3D5L A;  2PN6 A;  1EH6 A;  1WRJ A;  2NAZ A;  1BC8 C;  4P9U A;  3WE2 A;  1FYK A;  3GYH X;  2W24 A;  2G7H A;  4M72 A;  5ICF A;  4A5M A;  4EJU A;  3E6M A;  1XB4 A;  4OIN F;  4RAZ A;  5CVJ A;  4Y15 A;  3HRM A;  3PFI A;  4UHT A;  5AON A;  1KU7 A;  3HRU A;  3REO A;  1QZZ A;  2ZNZ A;  4EGZ A;  5E1Z B;  3J80 Z;  2QM3 A;  2NNN A;  4TV7 A;  2MBF A;  3JAM Z;  4MQV A;  4WXC A;  1DDN A;  2GWR A;  3HTU A;  3KP5 A;  1Q1H A;  2J5O A;  3R61 A;  2EFN A;  3RKX A;  1U5T C;  5JFR A;  1KU3 A;  4U0V A;  4R79 A;  1RUO A;  3MCZ A;  3MAJ A;  1ZAO A;  5CVR A;  1RI7 A;  2ESN A;  2VE9 A;  1LJ9 A;  3KP2 A;  1T39 A;  2RNJ A;  1QNT A;  3KP7 A;  3P9C A;  2RKH A;  3ISP A;  4ENJ A;  2F2E A;  3W6J B;  3HRS A;  3Q9V A;  2H6B A;  2M1B A;  3EQL F;  2P8T A;  1SD6 A;  1Y0U A;  4U88 A;  2OAZ A;  4P5O A;  5K5R A;  1OYW A;  1BI0 A;  2GZW A;  1U5T A;  5IT9 K;  1OPC A;  1USS A;  1JHF A;  1YW9 A;  4MEY F;  1ON1 A;  3O6B B;  4EVI A;  5BS6 A;  2P4W A;  5BPD A;  4YII A;  3VOE A;  3CJN A;  2EFO A;  4CIC A;  3QOP A;  3V8L A;  3IL2 A;  3LWF A;  5JHU A;  3DEU A;  4RB2 C;  5TJJ A;  2BEO A;  4UV9 A;  2QBY B;  2LNB A;  2HYG D;  3KZY A;  1ZH5 A;  2DK8 A;  3LA7 A;  3SHF A;  1FSH A;  4EM0 B;  2M8E A;  5CVV A;  2WTE A;  4LJZ F;  2K4J A;  4HV5 A;  3J81 K;  4NB5 A;  2HKX A;  5LGN A;  1FNN A;  5D5X B;  4PZJ A;  2RN7 A;  5HS7 A;  3I5U A;  3P7N A;  3KP6 A;  3KP4 A;  3DFG A;  2CSO A;  3T8R A;  2DBB A;  3F8M A;  1KGS A;  1XDS A;  4HF0 A;  2Y48 A;  3RTR A;  1O3Q A;  3I59 B;  4LK1 F;  1HST A;  1YFH A;  4HBL A;  4CO8 A;  2XAG A;  1IN7 A;  4AIH A;  2FBH A;  4G8X A;  5ILS A;  1TQP A;  1U78 A;  2EK5 A;  3P9I A;  5HDK A;  2VOP A;  1XSV A;  1ZG1 A;  2KIF A;  3E6B A;  2IA0 A;  2FBI A;  3CTA A;  2PJP A;  2R7F A;  4EV0 A;  2J5P A;  1P4X A;  5D6E A;  4AVP A;  1P2F A;  3RKY A;  1XSD A;  1S29 A;  2RQP A;  1IW7 F;  4Z2Y A;  3GX4 X;  3Q5F A;  1RNL A;  2DLL A;  2V1D A;  2PBI A;  3PQJ A;  3NQO A;  4O3M A;  2JSC A;  4OIR F;  3ZMV A;  4L0Y B;  3ML6 A;  5LEK A;  2EFQ A;  3R6S A;  3F6O A;  1LVA A;  4RGX A;  4M73 A;  1S7A A;  2KKO A;  5FD6 A;  3WTV C;  2VBZ A;  2LDU A;  2ACJ A;  3R0J A;  6PAX A;  3T0Y A;  1SFX A;  3K0L A;  4XSZ F;  5EEH A;  1B1B A;  5FFZ A;  2JPC A;  4H0E A;  3JTG A;  3V4G A;  1SD7 A;  1ZRE A;  3KEO A;  4XRF A;  3T1B A;  4HQE A;  3T5X A;  2K4B A;  2Q8K A;  2DQL A;  3HSE A;  1P92 A;  4IRI A;  1K79 A;  3G3Z A;  4MGR A;  3CUQ C;  1I1G A;  2X0L A;  2HR3 A;  2STT A;  1STZ A;  2OU2 A;  3ZP5 A;  2CQK A;  3B02 A;  4OIQ F;  1H9T A;  3HHH A;  3WTW C;  3JAM K;  4MNU A;  5FD5 A;  1MDM B;  5D8K B;  2DPU A;  4P96 A;  5F6F A;  4U0Y A;  2YR2 A;  2CWE A;  2QZ8 A;  5ICC A;  5FGM A;  4AIK A;  4HOB A;  2XAS A;  2OBP A;  3JSP A;  4HZF A;  3IKV A;  5BPI A;  2E1N A;  5A2Q K;  1ZGJ A;  4EJT A;  4ESJ A;  2A6E F;  4M74 A;  4BXU A;  3WTX C;  2D1V A;  4Q48 A;  3LAJ A;  2O61 A;  2F5E A;  3L2C A;  2EA2 A;  4IHS A;  1TNT A;  2RGV A;  4I0A A;  2XKO A;  4CHU A;  4A0Z A;  4U7D A;  1XSX A;  3ZN1 A;  2LSO A;  4RGR A;  3JW4 A;  4WCG A;  2VOO A;  4LLL A;  2CFX A;  2NNY A;  3QP5 A;  1J9I A;  2H27 A;  1MD0 A;  3K1M A;  1UCR A;  3M9A A;  2GIV A;  2P5K A;  5L3D A;  1BIB A;  5AIP A;  4HLX A;  2DK5 A;  3BPV A;  4WF2 A;  5HVQ C;  2EV0 A;  2GXB A;  1UST A;  3TOA A;  2FSW A;  1R58 A;  4DNC A;  2IRF G;  5HDN A;  2XUB A;  2P6S A;  1WI9 A;  4AWX B;  1R5G A;  2V9V A;  1FPQ A;  4RB1 A;  4M9Z A;  1I5Z A;  1MJB A;  1R36 A;  3GFI A;  2JZY A;  1LB2 A;  4Q4Z F;  3E5X A;  4OIP F;  3BOQ A;  4R1H A;  3HOS A;  1ZLK A;  4GCV A;  1SD4 A;  2ELH A;  4E70 A;  2ESH A;  5BQT A;  3QU3 A;  2E1C A;  3ECO A;  4PGH A;  1R00 A;  1FYL A;  2MLK A;  3I54 A;  1YIO A;  3IWF A;  1GXQ A;  4LMY A;  4ZZL A;  2MC3 A;  2ZNY A;  4CYD A;  2OA4 A;  5L3E A;  1IXR C;  4ENK A;  2MH9 A;  4RB0 A;  4BQA A;  4KT5 C;  5LRS A;  3S2W A;  3C7J A;  4EJO A;  1Z05 A;  2L4A A;  2FEZ A;  3L9F A;  2A61 A;  4I0B A;  2MA3 A;  3IWZ A;  1CGP A;  1TW3 A;  3CO7 C;  2YX4 A;  4BYY A;  2IT0 A;  2XIG A;  1W7P A;  3CUO A;  3I58 A;  4GGG A;  4ENN A;  1MGT A;  4L9N A;  5JVT A;  3R60 A;  4ZYH A;  5IT3 A;  3V7S A;  5HLH A;  1BI2 A;  2CG4 A;  3BJ6 A;  1IN4 A;  4M6Y A;  1QO0 D;  3WGG A;  1BJA A;  2VT3 A;  3IHU A;  4LFU A;  1EV7 A;  1FYM A;  5L3C A;  1FC3 A;  1YQA A;  4ZYD A;  3L09 A;  1IXS B;  1BM9 A;  4GXO A;  5H20 A;  3MZY A;  1FLI A;  1W5S A;  1W5T A;  2L01 A;  3BDD A;  3JSO A;  3ZMS A;  1BI1 A;  3RPU A;  1F4K A;  5J8F A;  1D5V A;  2FRH A;  3K1P A;  1RZ4 A;  1P4A A;  2ZBK A;  2R7D A;  1B9N A;  2Z9O A;  4LG0 A;  1HKS A;  1Z6T A;  3BRO A;  3U1D A;  4IRG A;  1YW8 A;  3WG9 A;  5HS8 A;  4FT8 A;  2DU9 A;  3TKY A;  3SZT A;  3LA2 A;  3CDH A;  1BIA A;  2BBY A;  4LLN A;  2TDX A;  4M9S A;  1H0M A;  4ON0 A;  1I1S A;  4PCQ A;  4R8H A;  4HX8 A;  1R1V A;  4GYI A;  1G6N A;  2W85 A;  1ZAR A;  4UV8 A;  4Y17 A;  2UXX A;  3WE3 A;  3ZMZ A;  3LST A;  3KP3 A;  4UXN A;  2EJR A;  1FT9 A;  2LKP A;  4XSX F;  3EET A;  1K78 A;  4OMZ A;  4HF1 A;  3VFZ A;  4I7H A;  4WX9 A;  3DKW A;  2Z99 A;  2EB7 A;  3GWZ A;  4MTE A;  4AD9 A;  2CYY A;  1SAX A;  4A6D A;  1UFM A;  2H09 A;  2ZFW A;  2P7V B;  1XGS A;  4OOI A;  3ECH A;  2VC0 A;  2JPB A;  2XAF A;  5D8L B;  4XLN F;  1D8J A;  3LQR A;  2QQB A;  1SMT A;  2NYX A;  5E8G A;  5L3B A;  3ZMT A;  2HQR A;  1IN8 A;  3DXJ F;  1HQC A;  3F3X A;  1U6G A;  4IJA A;  1MKM A;  2G7U A;  5DCM A;  1XMA A;  3KCC A;  3F72 A;  2BE5 F;  3V8K A;  3F6V A;  3C3W A;  4RS8 A;  4MQ9 F;  5K5O A;  4KIC A;  2KJB A;  4LD5 A;  1QPM A;  2PEX A;  2Z3Y A;  1BBY A;  3HIF A;  2B0L A;  5H6R A;  1LDD A;  1Z7U A;  3C18 A;  2EV5 A;  4NQW A;  2VT2 A;  3DV8 A;  3D0S A;  3WTU C;  2K27 A;  4G7Z F;  3I0T A;  3I53 A;  5EEG A;  4M9X A;  1SMY F;  1HKQ A;  3ELK A;  5ILV A;  2CW0 F;  1G3S A;  1SFU A;  3SFZ A;  2W57 A;  4K2E A;  3KEQ A;  1AOY A;  2FNA A;  1Z1D A;  3TGN A;  3TO9 A;  2CGP A;  1QBJ A;  5KK1 A;  5HS9 A;  3BPX A;  1O3R A;  2P7C B;  1VTN C;  5KVR A;  2NRA C;  4G6D A;  3P9K A;  4YIF A;  2P5L C;  2M87 A;  4MHG A;  4I09 A;  1KQ0 A;  5CVI A;  1EH7 A;  3L7W A;  3LFK A;  4KUM A;  5DD4 A;  4RGS A;  2ETH A;  2IPQ X;  3L00 A;  4B8X A;  3QU6 A;  4BAY A;  2VOD A;  1L0O C;  3RDI A;  1W4M A;  4EQQ A;  2NS0 A;  5E17 F;  1HKT A;  1HSJ A;  1J59 A;  5D4S A;  3C1D A;  2EV6 A;  1OR7 A;  4IPA A;  1XDU A;  2Q2E A;  4EGY A;  4LB6 B;  4Q47 A;  2UZK A;  3GFL A;  3LQQ A;  2HTS A;  3HTS B;  3F8N A;  1MJA A;  4RB3 C;  2YX7 A;  2STW A;  1J0R A;  3BP8 A;  1FOK A;  3FM5 A;  1IN6 A;  1YLF A;  2HFH A;  3DF8 A;  1WKM A;  5HDG A;  4ZYE A;  3DPT A;  5DYM A;  4LG0 B;  1LEA A;  4LK0 F;  5LHH A;  5LEJ A;  1OMI A;  1IAW A;  1FWZ A;  5DCF A;  2DAO A;  4O6J A;  1D3Y A;  1R7J A;  3CO6 C;  1PUE E;  1B6A A;  5DUK A;  1JXS A;  2OQR A;  3FMQ A;  2P5V A;  4CGZ A;  2F5D A;  3TDU C;  5LBQ A;  1BOA A;  2UXN A;  5DUI A;  3GVA A;  4BHC A;  4JBA A;  3ULQ B;  4MEX F;  2Y75 A;  4ZH4 F;  3I64 A;  2DQR A;  4KNY A;  3M8F A;  1LDK B;  4L5I A;  3FZV A;  2AS5 F;  1T0F A;  2W25 A;  2V1U A;  5LRR A;  3RYP A;  2WWY A;  1J5Y A;  5HLG A;  3FF5 A;  1O57 A;  2XRN A;  5CJ9 A;  1W7P B;  2DPD A;  3DP7 A;  3QPT A;  2HZT A;  4L9V A;  2P6T A;  4OMY A;  2DFI A;  2A69 F;  3K69 A;  5FO5 A;  1R5H A;  2MH2 A;  1FP2 A;  1NHA A;  3LAP A;  1ZRC A;  2A68 F;  3GZ5 A;  3IKT A;  3ZMU A;  1FBU A;  2O03 A;  4A2U A;  1S3J A;  4U0W A;  2M30 A;  1R23 A;  4B09 A;  1HW1 A;  4CZZ A;  2VON A;  3FMR A;  4KMF A; 
#chains in the Genus database with same CATH topology
 3CDI A;  3KE2 A;  2HDW A;  1T98 A;  1SD5 A;  4XLA A;  4WXD A;  1B72 A;  4O5V A;  4LIV A;  5LGU A;  4GRI A;  2CFO A;  4RM3 A;  2UUZ A;  3KYD B;  2X48 A;  4F52 A;  1V3F A;  3LSG A;  2DT7 B;  3OWT A;  4XNF A;  3S93 A;  3ZQH A;  4AVZ A;  4NC8 A;  4KIS A;  1T2K A;  1O4X A;  3FXL A;  3O2P E;  3V42 A;  1ITY A;  4YEJ A;  2WB1 N;  4MFE A;  5EGO A;  1QU3 A;  3H3U A;  2HQ5 A;  3PQK A;  3VB2 A;  3QPH A;  1X2N A;  3F8C A;  2HTJ A;  4Y4R A;  1TBX A;  3PNY A;  4PFO A;  1U8R A;  2M4G A;  2DOF A;  3Q9S A;  1VQM I;  2DFH A;  2R3S A;  2VJ4 A;  3AG2 H;  4UY8 I;  2X1D A;  2Z1D A;  3PUF A;  2VKD A;  2DO7 A;  4LGW A;  2ID6 A;  1F5T A;  5D5V B;  1TC3 C;  2Y2Z A;  4XIC A;  1VQ4 I;  3HBL A;  2XF6 A;  4PJL A;  4UVA A;  3SDG A;  4PGG A;  2ZJ2 A;  2Q1Z B;  2VJ5 A;  3GF2 A;  3WGI A;  1HW2 A;  4DBQ A;  1IF1 A;  5LHI A;  3HYI A;  3K1N A;  2YU3 A;  4BKX A;  3ZPL A;  4HF2 A;  4KMU X;  5EJC A;  1ZGA A;  2M0C A;  3G1M A;  4XBF A;  1Y0N A;  4KIB A;  4B3A A;  3CCQ I;  1PUF B;  2Y0S N;  2DA1 A;  2VQL A;  3M8E A;  1GDT A;  4BXX J;  4S04 A;  4P55 A;  5D5W B;  5FFX A;  5LGT A;  2BHZ A;  2CH0 A;  1GVJ A;  3BQY A;  5B3S H;  3QRF F;  3O3K A;  2EFP A;  3ZMD A;  3JRC A;  4IOC F;  1ETK A;  2RVC A;  5DEQ A;  3I71 A;  5J8C A;  4PUS A;  1JTX A;  2FQ3 A;  4QLC U;  4BDY A;  4XMY A;  2E35 A;  4IZZ A;  2AXT C;  1B59 A;  4OAZ A;  4UVB A;  2VKV A;  5J6X A;  2EFW A;  1ERD A;  2XAH A;  2VL8 A;  5J4Y A;  4G9Y A;  4IHT A;  2XGX A;  2NVQ J;  3C2H A;  4HX7 A;  3VYU B;  4EMS A;  2DA5 A;  3E3V A;  4BAC A;  3BR0 A;  3OYM A;  4E7H A;  2VB6 A;  4CCM A;  3M3Y J;  1BW5 A;  1H8A C;  2F5F A;  1KQ9 A;  3S3O A;  5BMZ A;  4B48 A;  1WQ2 A;  2Y9Y A;  2KRF A;  1LDJ A;  2HZD A;  2LKX A;  3WTS C;  3SXY A;  2WAQ N;  1YS7 A;  3QP6 A;  1I27 A;  1YS6 A;  3MZ8 A;  1JGG A;  3Q0U A;  2E34 A;  4RMN A;  3SFI A;  2F5C A;  4RAY A;  1VND A;  1OYY A;  1ZYR F;  1A31 A;  1A5J A;  1X19 A;  4HA8 A;  3RIR A;  3D1N I;  2PI0 A;  4A3L J;  3FXU A;  3T8T A;  2E19 A;  2Q0O A;  3FMS A;  3MQ0 A;  2E1M C;  2HEO A;  3LSK A;  2UWM A;  4N9H A;  1G3T A;  1MDM A;  2L3D A;  3OR1 C;  3A02 A;  4HV6 A;  4E7I A;  1JT6 A;  1KYZ A;  2L9R A;  4C3H J;  4LLG F;  1YRN A;  3IAS 2;  1YG2 A;  2FA5 A;  1Y56 A;  1Z9C A;  4XL9 A;  1F1Z A;  4XQF A;  5D6F A;  2NS8 A;  3PNV A;  4HG2 A;  1Z91 A;  5DCM B;  4HLY A;  1GV5 A;  5IP6 A;  2E7X A;  1XMK A;  2ZB9 A;  4F7Z A;  4M3G A;  5E1X A;  4DIQ A;  2K40 A;  1FX7 A;  3U9G A;  2R7Z J;  2E7W A;  1S7O A;  3AG3 H;  1MNM C;  5FLX K;  3UKG A;  4KIG A;  5IOZ A;  1ZRF A;  1XX5 A;  4RA2 A;  2WAD A;  2KDZ A;  3H5N A;  3F0C A;  1O3T A;  3CCU I;  1IO2 A;  3BJO A;  3BC8 A;  3W2A A;  2D45 A;  4HW0 A;  3VYS B;  5FJ8 J;  2GIZ A;  1IUY A;  3FHN A;  1FIP A;  4Q5S F;  3VWB A;  5DM6 F;  1B4A A;  5DD8 A;  3W3C A;  3OV8 A;  1K6O A;  3AL0 C;  3FKI J;  3D5R C;  5F1R A;  1IDZ A;  1N75 A;  1MMA A;  2IEK A;  2VPR A;  1UB9 A;  1O7F A;  3GFJ A;  4ZYG A;  2L02 A;  3ZOB A;  1HBX G;  1XN7 A;  1LFU P;  1AHD P;  2DOD A;  1PDN C;  1IRG A;  1ZEL A;  4G7O F;  2JA2 A;  1K6Y A;  1ONV A;  3K2Z A;  1ZG5 A;  3F8F A;  2V6E A;  3H36 A;  1G3W A;  3MWM A;  4FX4 A;  1V4R A;  2VC1 A;  2JRM A;  1UHM A;  1FSE A;  2DJN A;  3MVP A;  4JX4 A;  4YRV A;  1ODD A;  2DA3 A;  3CUQ A;  3HSR A;  5J47 A;  5F27 A;  1ENH A;  1AU7 A;  1P9Q C;  2OUM A;  1IV6 A;  1U2W A;  2DA2 A;  1WJD A;  4IHV A;  2XHK A;  3K4K A;  1K78 B;  1YO5 C;  2W00 A;  2ECB A;  3OL4 A;  2HS5 A;  3HKZ A;  4N9I A;  4HQM A;  3KZZ A;  2DYS H;  1GXP A;  5L3G A;  1SFK A;  3TQN A;  4B47 A;  4RM2 A;  1BN5 A;  1DPU A;  1W7P D;  4MLO A;  2HDC A;  2HU9 A;  2PMZ N;  1Z0X A;  2H94 A;  5FB2 A;  5C3E J;  3G2B A;  3I56 I;  1S6L A;  1EH8 A;  2FNP A;  1D1C A;  4S05 A;  1ETV A;  4IVN A;  4YFK F;  1FBQ A;  5JI6 A;  3M4O J;  2R4G A;  3J80 K;  2JK3 A;  2PMH A;  3JRH A;  1R4N B;  2VXD A;  3QPS A;  5E20 A;  5E1W A;  1PJR A;  2ZME B;  3H9J A;  4IX7 A;  4XKC A;  3HSF A;  1Y8R B;  1OKR A;  4DQ2 A;  3F21 A;  1OYI A;  1U9N A;  4RGU A;  2QEN A;  2K3F A;  3CME I;  2LLK A;  1VQ5 I;  1YE9 A;  1FY7 A;  4YIR X;  1MBJ A;  2CUZ A;  2Z2S B;  1WJ5 A;  2K86 A;  4I98 B;  5ERI A;  3SQN A;  1J7K A;  2KIM A;  1GUU A;  4A3F J;  3OYD A;  4BHP A;  3S3N A;  1ZKG A;  2A05 A;  4E7S A;  4BS9 A;  3HHG A;  3MN2 A;  4F92 B;  2G9W A;  1L3L A;  3I55 I;  3SZG A;  1YYV A;  2RV8 A;  2JTV A;  4KN4 X;  4UUS B;  4OIO F;  1IDY A;  2PFB A;  5M5W J;  5H2F C;  3JRF A;  2X85 A;  3QOE A;  1T8I A;  5CYV A;  2ID3 A;  2ADU A;  2AHQ A;  4AYB N;  3V7R A;  2WA0 A;  4BGD A;  3F8B A;  4GO1 A;  2IA2 A;  1D8K A;  2OD5 A;  1TP4 A;  1ZRD A;  3VOD A;  1Z21 A;  3RYR A;  1RR8 C;  2M9H A;  5LD2 C;  3BG9 A;  5CVU A;  4BH9 A;  3I59 A;  3M7G A;  2Y0M A;  1Z3Y A;  3EUA A;  4GYG A;  3U2R A;  5BNG A;  2DI3 A;  1SAU A;  3J7Y J;  4V19 K;  1JHH A;  2XV4 S;  1JJ6 C;  5TIS C;  1MW7 A;  2XKP A;  3PSF A;  2V6C A;  2ZME A;  3EUH C;  4EJV A;  3WHB A;  4AUX A;  1JGS A;  2BV6 A;  2IXS A;  5F04 A;  2OZU A;  1QPI A;  3JTH A;  4KN7 X;  2O3F A;  2C6Y A;  2MC4 A;  1IG7 A;  4E7L A;  1U8B A;  1DP7 P;  1ZR2 A;  2CO5 A;  4BJ5 C;  5DV5 A;  1JUM A;  1FBS A;  3ZN0 A;  2HKO A;  3R0A A;  3WU1 B;  2OTJ I;  4C2M J;  5FRM A;  4KA4 A;  4U87 A;  2GQQ A;  2W84 A;  3WOD F;  1LFB A;  2IVM A;  3MKW B;  2PQ8 A;  4CXF A;  3OSG A;  1H9G A;  3BJA A;  2QBY A;  2L7Z A;  4I01 A;  4PJN A;  4A12 A;  4HX4 A;  1YX3 A;  3CLO A;  3SEZ A;  3LSP A;  4JYK A;  3HEF A;  2VAS A;  1YX5 A;  3K9T A;  4FHT A;  1S8N A;  4C2T A;  2GOX B;  4IRH A;  1SVM A;  2VBY A;  2W4S A;  4LIU A;  1T6S A;  2YPR A;  5JVG F;  4ZTF A;  1K7A A;  2QLZ A;  3K4J A;  3S1M J;  2VQH A;  3S16 J;  3PL8 A;  3OYH A;  1YIT I;  1D5Y A;  1ZLJ A;  2W1O A;  3HGY A;  2ZXJ A;  1J75 A;  3HM5 A;  2R7W A;  4G94 A;  2L54 A;  3HRT A;  1U5T B;  3AAF A;  3BWG A;  3G6E I;  3J7A O;  2DMN A;  3ZQG A;  1MZB A;  3MMY B;  3ROU A;  3TW7 A;  1D1A A;  3F23 A;  4HAM A;  2DMT A;  2XB5 A;  2R7X A;  3RPQ A;  2XAJ A;  5F0C A;  4PDK A;  3E6D A;  2AO9 A;  3MKZ A;  4KFC A;  2X6Y A;  3J81 Z;  2CQN A;  1R71 A;  1TLH B;  1FEX A;  4RLQ A;  1EJ9 A;  1NG6 A;  4P9F A;  2HGC A;  2V9K A;  1JE8 A;  2VPL A;  1J09 A;  2VBW A;  3FDY A;  1ZN2 A;  2L9S A;  2MD0 A;  4G7H F;  1I3A A;  3E5U A;  1QZY A;  5GAH J;  1A6I A;  4D5C A;  1T38 A;  3GLL A;  3H0G J;  4BY1 J;  1MH4 A;  3RKW A;  4Y13 A;  4UNO A;  1DUX C;  2V79 A;  3GTO J;  2HOA A;  2ZO4 A;  3GW2 A;  2BGC A;  1GHC A;  2M0M A;  4IQJ A;  3PSI A;  4JQF A;  1RIO H;  1QA6 A;  4XLP F;  5LLQ A;  3MZH A;  2KZV A;  5FLX Z;  4BXF A;  4X6A J;  1S5L C;  1A36 A;  1VQ6 I;  3IC7 A;  4XRS G;  1YJ9 I;  3FXR A;  4KDP A;  1G3Y A;  3GO5 A;  1O7L A;  2ISZ A;  2LKS A;  1H88 C;  1MBH A;  1YTY A;  4NQW B;  3NRV A;  4UUT A;  3QAH A;  1ZGW A;  3R4K A;  3FK7 A;  4BQO A;  1JKP C;  2L2O A;  1XD7 A;  3FIS A;  5K5Q A;  4B1R A;  4CCO A;  2RQQ A;  3E97 A;  2COM A;  4A5N A;  4ETS A;  5LFA A;  2JA6 J;  4YG2 F;  1G4D A;  3H92 A;  2FQ4 A;  2K3P A;  4LB5 A;  2N8G A;  2KIS A;  2XGD A;  2L9V A;  1FMW A;  2HOE A;  2LYC A;  3GUD A;  3WU0 A;  2JUC A;  3JR9 A;  3LA3 A;  4WK8 F;  5HOO A;  4PFP A;  1E17 A;  1UAA A;  4KYW A;  3GXO A;  2VN2 A;  1VQN I;  2GA2 A;  4L18 B;  1R5I D;  1BA5 A;  4MO7 A;  2FF4 A;  4IHX A;  2EIJ H;  5J1Y A;  1IZ1 A;  4A3D J;  3KFW X;  2CRG A;  3OOP A;  2FE3 A;  1XGO A;  3ERE D;  2DXI A;  3MEX A;  2BHY A;  4IXA A;  1X1C A;  3HOT A;  3OYF A;  3DKX A;  3OYI A;  3FWE A;  2GAU A;  3DTE A;  2VXZ A;  1SFE A;  1XCV A;  3RI4 A;  5GTI C;  2QWW A;  2VKE A;  2VQG A;  2LF8 A;  1KYW A;  4L9J A;  1TQM A;  3BZ6 A;  3QPL A;  3WHC A;  1R22 A;  2ZJP F;  1IRF A;  1PUF A;  3WTT C;  4D9J A;  4EM2 A;  1C0W A;  2EIL H;  2FMY A;  2IBD A;  3DTI A;  2VE8 A;  3KET A;  2IW5 A;  3HUG A;  4DBR A;  4ENM A;  4QWQ A;  1VQO I;  3BTL A;  2BZT A;  4IQ4 A;  4Y3O A;  4ZZD A;  2OQG A;  5GPC A;  4A3C J;  4FX0 A;  2O6G E;  1R1T A;  2KJC A;  2JT1 A;  3O8H A;  3PUB A;  4CA0 A;  4HDV A;  1WVR A;  5LHG A;  2K02 A;  4E6K G;  3VSL A;  5D4R A;  3RZD J;  1WCM J;  1XGM A;  4ZC3 A;  1DU6 A;  1B9M A;  4N4O B;  5F64 A;  2Y0S A;  3B73 A;  3W6K B;  2GXG A;  3BTC A;  1LQ1 A;  3PNT A;  2I5U A;  2FBK A;  1SAN A;  2LY9 A;  1G8X A;  2A6H F;  2PLY A;  4UUV A;  3VEP A;  1MSE C;  1KA8 A;  3GTM J;  4EM1 A;  4KIF A;  2X4H A;  3WTY C;  3MD2 A;  3IRQ A;  2IJL A;  1CF7 B;  1BI3 A;  5J40 A;  3OYE A;  2ZSH B;  5J1R A;  1REP C;  3E6C C;  1IN5 A;  1N78 A;  1D0Y A;  1W0U A;  2EA4 A;  4OU0 A;  1E2X A;  4XRM A;  3HOU J;  2FXA A;  1UMQ A;  4UVC A;  1JTY A;  2D1H A;  3OS2 A;  4IO9 F;  4YFX F;  1YW7 A;  2WY7 Q;  4F93 B;  2O8X A;  5E8I A;  9ANT A;  2DW4 A;  4WXH A;  5ICE A;  1F9N A;  3LSI A;  1BL0 A;  4M71 A;  2H8R A;  1ORK A;  3HOZ J;  2DTR A;  5TRD A;  2KIU A;  4FQG A;  3BR2 A;  1XCB A;  4IHW A;  2EWN A;  1XGN A;  2K9N A;  2AXL A;  3HPH A;  3W2V A;  5EEA A;  5A2Q Z;  1WSU A;  1RRJ A;  3FX3 A;  4LOC A;  4XKV A;  3EYI A;  4LG3 A;  2IGK A;  2O7O A;  5EYR A;  2X1C A;  4PSX A;  2FU4 A;  2LMD A;  3M1E A;  3M1C A;  4L5J A;  4A93 J;  3KLO A;  1MMD A;  4BQQ A;  3MFK A;  1Z67 A;  2VBX A;  3SDB A;  3G73 A;  2X6W A;  2PMU A;  4II2 A;  2LRE A;  5CQE A;  2QGU A;  4BU2 A;  4A3I J;  1F36 A;  2Z5U A;  3WGH A;  1OCO H;  2ELK A;  1X1D A;  4M6X A;  3ZQC A;  1IXC A;  4MIM A;  3S2D J;  1X1B A;  4A3K J;  1H89 C;  3TOB A;  4WWC A;  2YSR A;  1I6H J;  2HYF A;  5BOX A;  3GZ6 A;  1Y1V J;  2FD5 A;  1OR7 C;  1UEL B;  3OS0 A;  3A0H C;  3ABU A;  4PJJ A;  4D0P A;  2IA1 A;  3GFM A;  5IY5 H;  2JUG A;  4DYR A;  2EH3 A;  2M5W A;  2PX9 A;  3FHZ A;  2OCE A;  1K4T A;  3EYY A;  2XGC A;  5ED4 A;  3IP4 B;  4DYQ A;  1WWX A;  2KPM A;  2IGN A;  2NOJ B;  2MSY A;  1RKT A;  4I02 A;  3N97 A;  5KCM A;  5K1Y A;  1LE8 A;  1QRY A;  1NTC A;  3ABK H;  1OCT C;  4FE4 A;  1A35 A;  1GT0 C;  2QYO A;  5ILU A;  2Z33 A;  1X3W B;  3TO6 A;  3RQI A;  4BNC A;  5TGT A;  2JSP A;  2OZ6 A;  2V1X A;  3A03 A;  2XVC A;  1RUN A;  2A07 F;  1P6R A;  3SZP A;  1B8I A;  2M45 A;  3DKY A;  3N4M A;  2LR8 A;  1ON2 A;  1PP7 U;  1LEB A;  2O8K A;  1ETW A;  5HLT A;  2F48 A;  2MLG A;  2QVO A;  4OWR B;  4AIJ A;  3RJP A;  1PP8 F;  4I2O A;  2WV0 A;  3M07 A;  3V7C A;  4A0X A;  3CCL I;  5DDG A;  4EEF G;  4ASN A;  2MD5 A;  2BYV E;  1CF7 A;  1TW2 A;  4A6E A;  3EPZ A;  1ULY A;  4ESB A;  1HCR A;  2XAQ A;  3D5S C;  3K4N A;  5L3F A;  1TNS A;  2ZKZ A;  1QGP A;  5IT9 Z;  2GXA A;  2RC4 A;  5D5U B;  3W2W A;  2QQ8 A;  1VQL I;  2V1N A;  1D0X A;  4B44 A;  5CPR B;  3BTJ A;  3H3Z A;  1A04 A;  3HKZ N;  3ABT A;  3NEU A;  3IV5 A;  1HXD A;  1QHG A;  4G6Q A;  4KIT B;  4L0Z B;  1LNW A;  2FOK A;  3CCY A;  3CCM I;  4N0B A;  4H4K C;  3FM3 A;  3FKJ A;  3JRA A;  2RDP A;  2JRT A;  4CH7 A;  1KU2 A;  1MMS A;  2L9N A;  2LF7 A;  2COB A;  2NVY J;  1BC7 C;  1QQI A;  2DCE A;  3LNQ A;  4JX5 A;  3EUK L;  3V8J A;  4BE1 A;  4BL0 B;  2KLO A;  5K7H A;  4CDG A;  1E3P A;  1UZC A;  4J00 A;  2ISY A;  2MG4 A;  1RKW A;  1P4W A;  1GV2 A;  1E3O C;  2B63 J;  1UHW A;  3CUQ B;  3F22 A;  2XPU A;  3IRR A;  1IUF A;  2QQ9 A;  1HW5 A;  4W1U A;  4AU7 A;  3GME A;  4AID A;  4HPQ A;  1ZG3 A;  3GEZ A;  3E5Q A;  4G12 A;  4XN3 A;  5CLS A;  4HDU A;  2B7E A;  4A0Y A;  1DGR M;  1I6X A;  3JRB A;  4HYE A;  1FOW A;  1Q1V A;  4ZDL A;  4GFB A;  3CC2 I;  4NHJ A;  5HLI A;  5H6Q A;  2QSF X;  2DMU A;  5ICG A;  4JK1 X;  4XLE A;  1QVT A;  4J01 A;  1AWC A;  3COA C;  3WU2 C;  3ZQ7 A;  3BZC A;  2EQR A;  5C4J J;  1X3U A;  1TQI A;  2D5V A;  2Q2E B;  4EAT A;  2HVS A;  3TO7 A;  3VYT B;  4BHB A;  3WTZ A;  4IF4 A;  2V9P A;  1DPR A;  3BG5 A;  3Q3S A;  3LSH A;  1LVK A;  1J2X A;  1VF9 A;  2GA1 A;  2ZJR F;  4X1E A;  4CCL A;  1WPK A;  4XON A;  1SVL A;  2HWV A;  3BY6 A;  1MH3 A;  2D2W A;  2XF5 A;  2DFF A;  4U7B A;  1JT0 A;  2PG4 A;  4YFN F;  3TDZ C;  2QUF A;  2E60 A;  3FXM A;  4EJW A;  2XRO A;  4HST A;  2L7F P;  1ZHF A;  1TTY A;  2L4M A;  5JR3 A;  3UNG C;  4L9T A;  4QTR A;  3GLX A;  2R5Y A;  4XOT A;  2RRE A;  5E18 F;  2HQN A;  2CQX A;  1PYV A;  3EDP A;  3HUG B;  1KU9 A;  2A5Y B;  1FP1 D;  1RES A;  1T56 A;  2K7L A;  2IP2 A;  1U3E M;  1R1U A;  2O0Y A;  3JRD A;  3DPL C;  1MJ9 A;  2R7Q A;  4W97 A;  3I4P A;  1KQ8 A;  2WC2 A;  4M6V A;  2ZCW A;  4ESF A;  1O3S A;  1G59 A;  2FML A;  4II3 A;  2JA7 J;  3FXQ A;  2BVM A;  1EKE A;  2QQA A;  5AIQ A;  3ESW B;  2H6C A;  3KLN A;  3PIP F;  1BW6 A;  3AFH A;  3EUH A;  1X4P A;  3FBI B;  1Z6R A;  4MTD A;  2A3S A;  1HLV A;  2E5N A;  1FZP B;  2EZH A;  2DT5 A;  1YIJ I;  3DQV C;  1TL8 A;  1JI8 A;  2XRL A;  3D5L A;  4PJM A;  2PN6 A;  3LL7 A;  2OC6 A;  1EH6 A;  1Y1W J;  1WRJ A;  2NAZ A;  4L5E A;  1BC8 C;  2TCT A;  5B1A H;  4P9U A;  2LK2 A;  5CKT A;  3WE2 A;  1FYK A;  2ZXI A;  2QSG X;  3GYH X;  2W24 A;  2OCC H;  2G7H A;  4M72 A;  5ICF A;  4A5M A;  4EJU A;  2XPV A;  3U21 A;  4BE0 A;  1YJN I;  3BR6 A;  1MMG A;  2AQF A;  3DBR B;  3E6M A;  1OQY A;  1XB4 A;  2FOW A;  3OY9 A;  4DJA A;  2HXI A;  2GLO A;  4OIN F;  4RAZ A;  4ZYA A;  5CVJ A;  1XPX A;  2FJ1 A;  4Y15 A;  3HRM A;  3PFI A;  1FIA A;  4UHT A;  5AON A;  1KU7 A;  3HRU A;  1XS9 A;  3REO A;  1QZZ A;  2CQQ A;  2ZNZ A;  5F0F A;  1U9O A;  5E1Z B;  3J80 Z;  4EGZ A;  3SJM A;  3LMM A;  2QM3 A;  3OMY A;  2NNN A;  2W82 A;  4TV7 A;  2MBF A;  3JAM Z;  2LBF B;  1BR1 A;  4MQV A;  3K10 A;  5K7F A;  1T33 A;  3ONQ A;  4WXC A;  1DDN A;  2GWR A;  3HTU A;  3KP5 A;  1Q1H A;  4IKF A;  2J5O A;  3R61 A;  2EFN A;  4NC7 A;  1U5T C;  3RKX A;  5JFR A;  3S17 J;  5KAF C;  1KU3 A;  3AG1 H;  3CCJ I;  3TBI A;  2ZXW H;  4U0V A;  2A5W A;  3E1S A;  4R79 A;  1RUO A;  3MCZ A;  4V2G A;  4QIW N;  4RAF A;  3MAJ A;  1R4M B;  1D0Z A;  1ZAO A;  1V54 H;  1RI7 A;  5CVR A;  2EZL A;  2ESN A;  2VE9 A;  1LJ9 A;  5JLW A;  2EZK A;  3KP2 A;  1T39 A;  2RNJ A;  2ZXH A;  4E7Z A;  3CMM A;  2HVR A;  4DW6 A;  2CMP A;  5J1U A;  1QNT A;  2QCO A;  3IH4 A;  4C2U A;  5EGO B;  3KP7 A;  3P9C A;  2RKH A;  2CW8 A;  3ISP A;  4ENJ A;  2F2E A;  1VI0 A;  3W6J B;  3HRS A;  3Q9V A;  4X0G A;  3OYB A;  2H6B A;  2M1B A;  1WJF A;  4UB6 C;  3EQL F;  2OTL I;  2P8T A;  1SD6 A;  4XKW A;  2R7V A;  1Y0U A;  2H1L A;  4U88 A;  1Y39 A;  3K70 C;  2OAZ A;  4P5O A;  4AYB A;  5K5R A;  3H35 A;  1OYW A;  2R7T A;  4D5F A;  1BI0 A;  2GZW A;  1JUP A;  3ZR8 X;  1W1W E;  1U5T A;  2KRC A;  5IT9 K;  1OPC A;  1USS A;  4KT6 A;  1JHF A;  1YW9 A;  3N05 A;  5FRN A;  1AKH B;  4MEY F;  1ON1 A;  2BXY A;  3DPU A;  5FKL A;  3O6B B;  2XSD C;  4EVI A;  3H1C A;  5BS6 A;  3OS1 A;  2P4W A;  4HNV A;  5BPD A;  4YII A;  1Z3X A;  3B6A A;  3AL0 B;  1P7J A;  3VOE A;  3CJN A;  2EFO A;  5IP7 J;  3CES A;  4CIC A;  1V5G A;  2HOT A;  3QOP A;  3V8L A;  2HNH A;  1WI3 A;  3IL2 A;  3LWF A;  1ACI A;  4JOM A;  5JHU A;  5JLX A;  3OSF A;  3DEU A;  3TP3 A;  3OOU A;  4RB2 C;  3C2G A;  5TJJ A;  1VQP I;  2NVX J;  3L2R A;  2BEO A;  5IYC J;  4UV9 A;  2QBY B;  5DS9 A;  2LH9 A;  4Y33 A;  2LNB A;  3CCR I;  1YHQ I;  2EZI A;  2HYG D;  2KT0 A;  3KZY A;  3TL4 X;  3X2Q H;  4BBS J;  5FKM A;  1OLT A;  1ZH5 A;  2DK8 A;  4AC0 A;  1SC7 A;  3LA7 A;  1FOY A;  3SHF A;  3J7A Y;  1FSH A;  2DN0 A;  3RQ4 A;  4EM0 B;  2M8E A;  5CVV A;  2WTE A;  4LJZ F;  2KP6 A;  1OCZ H;  2K4J A;  4HV5 A;  3J81 K;  3H0D A;  4NB5 A;  2HKX A;  2MYS A;  3E0J B;  4BEH B;  1JKQ C;  5LGN A;  1FNN A;  2M7A A;  5D5X B;  3CZ6 A;  4PZJ A;  3BCB A;  1N25 A;  1T0F C;  2RN7 A;  5IPA A;  4NNJ A;  5E3L A;  4F91 B;  1N77 A;  2X1E A;  5HS7 A;  3I5U A;  2K9Q A;  3P7N A;  1OCP A;  3KP6 A;  1S9H A;  4S0H B;  3H9Q A;  3KP4 A;  1W0T A;  4HSR A;  3DFG A;  1ZQ3 P;  3K7A J;  1VFC A;  2CSO A;  2WY8 Q;  3DWL E;  4XLH A;  3T8R A;  4Y52 J;  2DBB A;  3F8M A;  4UB8 C;  1LE8 B;  2HYJ A;  1KGS A;  1MIJ A;  1MBE A;  2AQE A;  1XDS A;  4HF0 A;  1NH3 A;  3MKL A;  2WBM A;  2Y48 A;  3RTR A;  1O3Q A;  3I59 B;  4LK1 F;  1HST A;  1YFH A;  2JWT A;  4HBL A;  4CO8 A;  3LSJ A;  2XAG A;  1JKO C;  1IN7 A;  4BJ6 C;  2R93 J;  3CF2 A;  4AIH A;  4XOR A;  1YI2 I;  2FBH A;  4G8X A;  5ILS A;  4FIS A;  3ZQQ A;  3KPH A;  1TQP A;  1U78 A;  2EK5 A;  1EF4 A;  3P9I A;  5HDK A;  2VOP A;  1XSV A;  2DYR H;  1ZG1 A;  2EIN H;  2KIF A;  3E6B A;  2IA0 A;  2FBI A;  3CTA A;  3CDL A;  1MND A;  4BBR J;  3CP2 A;  1P7I A;  3A0B C;  3Q0W A;  2VJI A;  1SFO J;  4Y7N J;  2PJP A;  1LKX A;  3CCV I;  2R7F A;  3QQA A;  2J5P A;  4EV0 A;  1P4X A;  5D6E A;  4XID A;  1W36 C;  3F9K A;  1WJE A;  2ZJQ F;  2M3A A;  3A01 A;  4AVP A;  4OAY A;  4IEJ A;  4E7K A;  1P2F A;  3RKY A;  2JQ7 A;  1F43 A;  2EBI A;  3HGG A;  1XSD A;  1S29 A;  3DCF A;  3OYA A;  3OYJ A;  1E3H A;  2RQP A;  3PJR A;  1IW7 F;  2ZSI B;  5FKN A;  3BR5 A;  4F3Q A;  4Z2Y A;  3SYT A;  3GX4 X;  3Q5F A;  1RNL A;  2DLL A;  2V1D A;  2V7F A;  2PBI A;  1KON A;  3PQJ A;  4FE7 A;  1KZH A;  3NQO A;  2JSC A;  3BLY A;  4M3D A;  4OIR F;  3ZMV A;  3ML6 A;  5LEK A;  4L0Y B;  4O3M A;  4ZDO A;  1FOX A;  2EFQ A;  3R6S A;  3F6O A;  5B66 C;  5J4V A;  2MFZ A;  1LVA A;  2L7K A;  2X6O A;  4M73 A;  4RGX A;  3DLL F;  1S7A A;  2KKO A;  1AA7 A;  5FD6 A;  2Y69 H;  3WTV C;  3TED A;  2VBZ A;  2X51 A;  2P0W A;  3ZXS A;  2ZC2 A;  1JJ8 C;  2MAB A;  5E79 C;  2LDU A;  2ACJ A;  4IHY A;  1Z77 A;  1MMN A;  3R0J A;  1DQU A;  1V55 H;  4C3J J;  3ZQF A;  6PAX A;  3UR3 C;  3T0Y A;  2V26 A;  2HVQ A;  1SFX A;  3FXJ A;  4C3I J;  3K0L A;  1CQT A;  1VZ0 A;  2H8W A;  1LPQ A;  2VQC A;  4XSZ F;  1K61 A;  2CU7 A;  5EEH A;  1ZR4 A;  1B1B A;  2GBY A;  5FFZ A;  2JPC A;  4PK4 A;  4XKB A;  3FK6 A;  2E5Z A;  4XN0 A;  4H0E A;  3JTG A;  2R92 J;  1WFX A;  3V4G A;  2R7R A;  3S3M A;  1SD7 A;  3QOD A;  2E2I J;  1ZRE A;  3KEO A;  4XRF A;  3T1B A;  2QA4 I;  2R7S A;  3GBG A;  3I3L A;  2Z16 A;  1OIS A;  3FXK A;  4HQE A;  3T5X A;  4RLF A;  2K4B A;  2Q8K A;  2F4M B;  4AM3 A;  2DQL A;  3HSE A;  1P92 A;  4IRI A;  3G3Z A;  1K79 A;  3RCO A;  2DMP A;  4CUG A;  2ELJ A;  4MGR A;  2NS7 A;  3HL2 A;  2LTP A;  3CUQ C;  1S72 I;  1I1G A;  2LRD A;  2X0L A;  4I99 C;  2DJI A;  2HR3 A;  2STT A;  5IYD J;  1STZ A;  2OU2 A;  3ZP5 A;  2CQK A;  1WZ2 A;  3B02 A;  4OIQ F;  1H9T A;  3HHH A;  3WTW C;  3JAM K;  5EDN A;  4MNU A;  5FD5 A;  1MDM B;  3ZQL A;  4B3X A;  5D8K B;  2XDV A;  1AKH A;  3BG6 A;  2BXZ A;  2DPU A;  1S7E A;  4KJZ A;  4P96 A;  3GCM A;  5F6F A;  4U0Y A;  2YR2 A;  2CWE A;  4NUB A;  2UV1 A;  2F4I A;  2QZ8 A;  2LBF A;  3NAU A;  4ITV A;  5ICC A;  3PM1 A;  4ZJZ A;  5CQG A;  2VLA A;  2LY1 A;  2B9S A;  5FGM A;  4AIK A;  4HOB A;  2XAS A;  4DGW B;  2OBP A;  3JSP A;  4HZF A;  2BW3 B;  3VYR B;  3IKV A;  5BPI A;  2DOA A;  1SVO A;  2E1N A;  3QYE A;  5A2Q K;  5GP9 A;  1ZGJ A;  2W48 A;  2XPW A;  4ESJ A;  4EJT A;  4A3B J;  2A6E F;  4M74 A;  4BXU A;  3WTX C;  4CCJ A;  4XLC A;  2D1V A;  3M8J A;  4Q48 A;  3HG9 A;  3LAJ A;  1M1E B;  2O61 A;  2F5E A;  3L2C A;  2QKL B;  4JX6 A;  2EA2 A;  5JHF A;  1QZE A;  2XB0 X;  5E3M A;  4IHS A;  1TNT A;  2RGV A;  4M3F A;  4I0A A;  4A3G J;  2XKO A;  1EA3 A;  2CUF A;  1WHU A;  4CHU A;  3DLA A;  4A0Z A;  4U7D A;  2ZME C;  1XSX A;  3ZN1 A;  2LSO A;  3GTG J;  2JA5 J;  3DEE A;  3ERM A;  1BJZ A;  4RGR A;  5M5X J;  3JW4 A;  4WCG A;  2W7N A;  2VOO A;  4LLL A;  3S1N J;  2CFX A;  4E4H A;  1YRN B;  2NVT J;  2NNY A;  3I9V 2;  3DEW A;  3QP5 A;  2KZG A;  2P81 A;  1J9I A;  3CF5 F;  2H27 A;  1MD0 A;  3K1M A;  4B4C A;  1UCR A;  2YUS A;  3M9A A;  2HXO A;  2GIV A;  2XF7 A;  2P5K A;  5L3D A;  4PJ0 C;  1BIB A;  5AIP A;  1UG0 A;  1TT0 A;  4HLX A;  2DK5 A;  3BPV A;  4WF2 A;  5HVQ C;  3K4C A;  2EV0 A;  4BJT A;  1UST A;  3DBH B;  2O9L A;  3G4S I;  3CMA I;  2GXB A;  3VPR A;  3TOA A;  2FSW A;  3L2V A;  4A3E J;  2QKM B;  1IGN A;  1R58 A;  4DNC A;  2VUM J;  2IRF G;  5HDN A;  1V5E A;  5EZG A;  4QPQ A;  2XUB A;  1GLN A;  2P6S A;  2LC2 A;  1WI9 A;  3HJE A;  4AWX B;  4A3M J;  1R5G A;  2GM4 A;  1XTA A;  2R5Y B;  2V9V A;  1FPQ A;  4RB1 A;  4RBO A;  4M9Z A;  3S2H J;  1I5Z A;  1MJB A;  1R36 A;  3GFI A;  2NXN B;  2JVG A;  2JZY A;  1LB2 A;  5KNL A;  4Q4Z F;  3E5X A;  4OIP F;  1E0E A;  1R6R A;  3BOQ A;  3ZRG A;  4R1H A;  1B72 B;  1T08 B;  3H5A A;  1TT5 B;  3HOS A;  2R7U A;  5M5Y J;  4GCV A;  1ZLK A;  3CC7 I;  1SD4 A;  2ELH A;  3U1K A;  5HNF A;  4E70 A;  2ME6 A;  2ESH A;  3TMO A;  5BQT A;  2L5Q A;  3QU3 A;  2R5Z A;  1A6Q A;  2E1C A;  1RR7 A;  5GAD J;  3ECO A;  4PGH A;  2BY1 A;  1R00 A;  1FYL A;  1OFC X;  1W36 D;  2MLK A;  2CUJ A;  3I54 A;  1YIO A;  3IWF A;  1BOB A;  2HPM A;  1GXQ A;  4LMY A;  4BY7 J;  1IV8 A;  4ZZL A;  2MC3 A;  4HNU A;  2ZNY A;  4IL6 C;  3L1P A;  4CYD A;  4QSH A;  2OA4 A;  5L3E A;  1IXR C;  4ENK A;  1IRX A;  2MH9 A;  2NOG A;  2XSJ C;  4RB0 A;  3OYL A;  2IGM A;  4BQA A;  4D7N A;  2VI6 A;  4KT5 C;  2DDB A;  3RPU D;  5LRS A;  3S2W A;  3C7J A;  1VQ7 I;  1ETO A;  3K4M A;  4EJO A;  1Z05 A;  1MBK A;  2L4A A;  1WGX A;  4YEL A;  3IAM 2;  2FEZ A;  2I8D A;  3L9F A;  4CYC A;  2A61 A;  4A3J J;  2JJ7 A;  3HPG A;  2YU9 J;  1UJ8 A;  4I0B A;  2MA3 A;  3IWZ A;  3S1R J;  1CGP A;  3A01 B;  1TW3 A;  3CO7 C;  1DU0 A;  2HQA A;  2YX4 A;  4BYY A;  2IT0 A;  2XIG A;  3NAR A;  2XAU A;  1W7P A;  4G6T B;  3CUO A;  3I58 A;  2K9M A;  4GGG A;  2Y30 A;  4ENN A;  3ASN H;  1MGT A;  4L9N A;  5JVT A;  3QYF A;  2ZFU A;  3R60 A;  4ZYH A;  5IT3 A;  3PIO F;  2BY0 A;  4UUS A;  4D7M A;  3V7S A;  5HLH A;  1BI2 A;  4FET A;  2IS2 A;  1X1A A;  3OIP A;  3B6C A;  2CG4 A;  2MW8 A;  5KAI C;  3L2U A;  3BJ6 A;  1IN4 A;  2K9L A;  4CZC A;  4M6Y A;  1QO0 D;  3WGG A;  1IC8 A;  1BJA A;  4LIT A;  3VDX A;  1R9T J;  3CP8 A;  2VT3 A;  3IHU A;  2CS3 A;  2IGO A;  3LSM A;  4LFU A;  1EV7 A;  3VSK A;  1FYM A;  5L3C A;  1FC3 A;  1I3Q J;  1OCR H;  1YQA A;  2FUG 2;  4ZYD A;  3FBN B;  3L09 A;  2WAE A;  1IXS B;  5B5E C;  2KDO A;  2PJR A;  1BM9 A;  4GXO A;  5H20 A;  3MZY A;  2DOE A;  1FMV A;  2E71 A;  4C30 A;  5GTH C;  4BQN A;  4C9Y A;  4DZJ A;  1FLI A;  1W5S A;  1HDP A;  1W5T A;  2L01 A;  3BDD A;  3JSO A;  3ZMS A;  4I76 A;  1RC9 A;  1BI1 A;  1MBF A;  3RPU A;  5EG0 B;  1F4K A;  4FTH A;  5J8F A;  1D5V A;  3GTQ J;  2OPT A;  1QVU A;  2FRH A;  3K1P A;  2ECC A;  3A4C A;  1RZ4 A;  4N4N B;  3HOW J;  3H5R A;  1P4A A;  2E2H J;  2G0E A;  2ZBK A;  5FRO A;  2R7D A;  5C4X J;  1B9N A;  1NK3 P;  1YOV B;  3O8G A;  1B8I B;  2Z9O A;  1MNE A;  4LG0 A;  3IUO A;  3PFY A;  2E1O A;  1WJB A;  1HKS A;  2BOL A;  1Z6T A;  3BRO A;  3U1D A;  3BQZ A;  2M8G X;  2IS1 A;  4IRG A;  1YW8 A;  3WG9 A;  5HS8 A;  4FT8 A;  1SEU A;  2JN6 A;  2DU9 A;  3TKY A;  3SEQ A;  3SZT A;  1LFP A;  3LA2 A;  1ZK8 A;  1X3Z B;  2NVU B;  3CDH A;  2A6T A;  1BIA A;  2BBY A;  1ETX A;  2M7B A;  1IRZ A;  2WB1 A;  4LLN A;  2TDX A;  1R49 A;  1TWF J;  4M9S A;  2M34 A;  1H0M A;  4ON0 A;  1I1S A;  4PCQ A;  4R8H A;  4HX8 A;  1R1V A;  2K85 A;  1G6N A;  4GYI A;  1WJA A;  4XRS A;  1FTZ A;  4CCK A;  2W85 A;  1ZAR A;  4UV8 A;  4Y17 A;  2UXX A;  3K2A A;  3WE3 A;  3ZMZ A;  3LST A;  4BEH A;  3HXL A;  4FAS D;  3KP3 A;  2VIX A;  4BUP A;  4CSW A;  2KL4 A;  4F55 A;  1OJL A;  1I50 J;  3CMY A;  3MKY B;  4UXN A;  2EJR A;  1FT9 A;  2LG4 A;  4IOA F;  2LKP A;  4XSX F;  3HOY J;  4NDL A;  1GVD A;  1MBG A;  2E36 A;  3EET A;  2EPF A;  1WH5 A;  4ABZ A;  2KHM A;  2H1K A;  1K78 A;  4OMZ A;  3FXO A;  4HF1 A;  3VFZ A;  4I7H A;  4WX9 A;  1UHS A;  3DKW A;  2Z99 A;  2EB7 A;  3KZI C;  3GWZ A;  4MTE A;  4AD9 A;  4ZTJ A;  2WAF A;  1V5F A;  3GTJ J;  3RZO J;  2CYY A;  3I4N J;  3CJQ B;  1SAX A;  5C44 J;  4A6D A;  3CJR B;  2R5Z B;  3S15 J;  1UFM A;  1HF0 A;  2H09 A;  2ZFW A;  4D1Q A;  2P7V B;  2QF7 A;  4PSW A;  1I39 A;  1XGS A;  1MSF C;  4OOI A;  4NBQ A;  3ECH A;  2VC0 A;  2RAE A;  1X2M A;  2JPB A;  3L2Q A;  3QYB A;  4XLF A;  2X6X A;  4V2F A;  2XAF A;  3W6V A;  2VKH A;  5D8L B;  4XLN F;  1D8J A;  3LQR A;  2QQB A;  2HDD A;  1SMT A;  2NYX A;  4MFD A;  5E8G A;  2KFD A;  1ETY A;  5L3B A;  3AG4 H;  3ZMT A;  3RKQ A;  2EIM H;  2HQR A;  2WAQ A;  3OYK A;  3GTP J;  1IN8 A;  3H3V K;  5B1B H;  3C2B A;  3CD6 I;  3DXJ F;  1HQC A;  3F3X A;  1U6G A;  3K4L A;  3LSR A;  1TWC J;  4IJA A;  1HDD C;  1MKM A;  4HNT A;  4RDU A;  2G7U A;  2BW3 A;  5DCM A;  1UG2 A;  1XMA A;  2BVL A;  3TW6 A;  3KCC A;  1PVE A;  3F72 A;  5E3O A;  5HNH A;  2K5C A;  2R7O A;  2BE5 F;  3V8K A;  3S8P A;  3PO3 J;  3KX2 A;  2KQR A;  3G71 I;  4Z6Y A;  2L0K A;  3F6V A;  3C3W A;  3TP0 A;  4RS8 A;  3CC4 I;  4MQ9 F;  5K5O A;  2OF7 A;  4KIC A;  2DTZ A;  2KJB A;  1IJW C;  5F1J A;  3S32 A;  3DU5 A;  4XM3 A;  4LD5 A;  1BR2 A;  5KHD A;  3E7L A;  3ZCO A;  1QPM A;  3KYC B;  5HOD A;  2PEX A;  2Z3Y A;  1BBY A;  3KEY A;  4JP0 A;  3HIF A;  2B0L A;  3BR3 A;  4GDF A;  5H6R A;  1LDD A;  1Z7U A;  3HOX J;  3C18 A;  2EV5 A;  3LOC A;  4NQW A;  3CQZ J;  1HA8 A;  1RET A;  2JA8 J;  3OIQ A;  2VT2 A;  1ETQ A;  3DV8 A;  2HI3 A;  2ICW G;  3BT9 A;  2DMQ A;  2KRH A;  2L7M P;  3JRI A;  3D0S A;  3JRG A;  3WTU C;  4HRI A;  3HB9 A;  3WG7 H;  2LY2 A;  2RNG A;  4HEA 2;  2K27 A;  5F0H A;  4ANJ A;  4G7Z F;  1APL C;  2HPI A;  3I0T A;  3I53 A;  5EEG A;  3S14 J;  4M9X A;  3DU6 A;  3FIW A;  1SMY F;  1HKQ A;  1K83 J;  3ELK A;  1LUJ B;  5ILV A;  3HOV J;  2CW0 F;  1G3S A;  3K6G A;  5IOY A;  1SFU A;  3SFZ A;  2W57 A;  4K2E A;  1OCC H;  4A69 C;  3KEQ A;  1AOY A;  2FNA A;  3JRE A;  1Z1D A;  3TGN A;  2OV7 A;  3TO9 A;  2CGP A;  1QBJ A;  1TZL A;  2CJJ A;  5KK1 A;  1Y8Q B;  4M3E A;  5HS9 A;  2IAI A;  3BPX A;  1O3R A;  3PO2 J;  3K70 D;  2P7C B;  2BY3 A;  1VTN C;  5M3F J;  2F4O B;  2KIQ A;  5KVR A;  2NRA C;  4G6D A;  3P9K A;  3CLQ A;  4YIF A;  2PMZ A;  3OR2 C;  3BG7 A;  2P5L C;  2M87 A;  4MHG A;  1DGW Y;  4I09 A;  1X58 A;  1KQ0 A;  3HC7 A;  5CVI A;  5EZH A;  2LD5 A;  2HOS A;  1EH7 A;  3L7W A;  3LFK A;  4KUM A;  5DD4 A;  4RGS A;  2QEX I;  1FJL A;  2JMW A;  5DM7 F;  2KMU A;  2ETH A;  5EG0 A;  5IYB J;  5FKO A;  4DOZ A;  2F5V A;  2IS6 A;  2IPQ X;  3L00 A;  2M2E A;  3G1O A;  4B8X A;  3QU6 A;  4BAY A;  2VOD A;  1D1B A;  1L0O C;  1VQ8 I;  2WV1 A;  3DTK A;  3RDI A;  1BR4 A;  3I4M J;  1W4M A;  4EQQ A;  2NS0 A;  3LFU A;  5E17 F;  1HKT A;  2I10 A;  1HSJ A;  1J59 A;  2QSH X;  3NWS A;  3L2W A;  5D4S A;  2DDA A;  3C1D A;  2CQ7 A;  1RPW A;  2EV6 A;  3G1L A;  1OR7 A;  4IPA A;  3BTI A;  2YS9 A;  3GZN B;  1XC5 A;  1XDU A;  3CCE I;  2Q2E A;  2E2J J;  5FLV A;  4EGY A;  4LB6 B;  4Q47 A;  3OL3 A;  2ME0 A;  3GFL A;  2UZK A;  3LQQ A;  2HTS A;  3CJT B;  3HTS B;  3F8N A;  1VQK I;  1X4O A;  1XG1 A;  1MJA A;  4RB3 C;  2YX7 A;  1QHH D;  2STW A;  1J0R A;  2Y31 A;  3BP8 A;  2MGQ A;  3HZJ A;  4J19 A;  1JKR C;  1YJW I;  4NC6 A;  1FOK A;  3FM5 A;  2VJJ A;  3JCU C;  5DTD A;  3OIO A;  1IN6 A;  1YLF A;  2CV2 A;  3CCS I;  4DZP A;  2HFH A;  2DA6 A;  3DF8 A;  4BDZ A;  1WKM A;  5M3M J;  5HDG A;  2CW7 A;  4ZYE A;  3DPT A;  2FX0 A;  2JVH A;  5DYM A;  4LG0 B;  1XMX A;  1TWG J;  2IS4 A;  3A2K A;  4DYC A;  1FTT A;  1LEA A;  4LK0 F;  5LHH A;  5LEJ A;  4XOP A;  5FKK A;  1OMI A;  3J7Z I;  2LP0 A;  1IAW A;  1FWZ A;  5DCF A;  2DAO A;  2DA7 A;  2E1M B;  1ZTR A;  4O6J A;  1D3Y A;  5GPA A;  2R0Q C;  2CUE A;  3IH3 A;  1R7J A;  3KYL A;  3CO6 C;  3QWL A;  1W5C C;  3A1Y A;  5IP9 J;  1B6A A;  5DUK A;  1PUE E;  1JXS A;  3ZGK A;  2OQR A;  3FMQ A;  5GAG J;  2P5V A;  4CGZ A;  2LFB A;  2F5D A;  3IH2 A;  3TDU C;  3Q0V A;  2EIK H;  5LBQ A;  1BOA A;  3BG3 A;  2UXN A;  4XR6 A;  5DUI A;  3OYC A;  3GVA A;  4BHC A;  2DA4 A;  4JBA A;  3ULQ B;  4MEX F;  1Z7L A;  2Y75 A;  5GAE J;  2GOM A;  3OYN A;  4ZH4 F;  4CCN A;  5J3L A;  3I64 A;  2DQR A;  3K4B A;  4FCY A;  4KNY A;  4QPO A;  3M8F A;  1LDK B;  4L5I A;  2O5R A;  3ASO H;  3FZV A;  2AS5 F;  1T0F A;  2W25 A;  2V1U A;  5K7Z A;  2XC7 A;  5LRR A;  3RYP A;  2WWY A;  1J5Y A;  2CV1 A;  5HLG A;  3S1Q J;  3FF5 A;  1O57 A;  1X1P A;  4ZDP A;  4E7J A;  2XRN A;  1K4S A;  2LVS A;  5CJ9 A;  2OJE D;  1HC8 A;  1T95 A;  1W7P B;  2DT6 A;  2DPD A;  2K9S A;  3RSN A;  3DBL B;  1HOM A;  1Y6I A;  2F6C A;  3DP7 A;  3QPT A;  5FLM J;  2M4K A;  3KIO A;  3NWT A;  2HZT A;  4XK4 A;  4L9V A;  4BE2 A;  3ABL H;  3AKZ A;  2P6T A;  4OMY A;  2DFI A;  2V4J C;  1U0J A;  4CYC B;  3HDD A;  2A69 F;  3P5J A;  3K69 A;  5FO5 A;  5E3N A;  1G2H A;  1WJC A;  3GTL J;  3ZQI A;  3BZK A;  1R5H A;  3BR1 A;  2MH2 A;  1FP2 A;  1VQ9 I;  2Y9Z A;  2PJR B;  1NHA A;  3LAP A;  1ZRC A;  4P1W A;  2A68 F;  3GZ5 A;  3IKT A;  3ZMU A;  1FBU A;  4RAG A;  2O03 A;  4A2U A;  1S3J A;  4U0W A;  2DFE A;  2M30 A;  3OYG A;  1R23 A;  1TWH J;  4B09 A;  1HW1 A;  3ABM H;  4CZZ A;  3H9G A;  4M3B A;  2VON A;  1POG A;  1DP3 A;  4B43 A;  2CV0 A;  3FMR A;  1WH7 A;  2BY2 A;  4KMF A;  2TRT A;  2XGE A;  1NG7 A;  2X9D A;  1NK2 P;  4I6Z A;  1JUS A;  5EF6 A;  3BCA A;  1TWA J;  3GTK J;  5F08 A;  2LOO A; 
#chains in the Genus database with same CATH homology
 3KE2 A;  1T98 A;  1SD5 A;  4WXD A;  4O5V A;  5LGU A;  1V3F A;  1T2K A;  3O2P E;  3H3U A;  3PQK A;  3VB2 A;  3QPH A;  3F8C A;  2HTJ A;  1TBX A;  1U8R A;  3Q9S A;  2R3S A;  2DO7 A;  4LGW A;  1F5T A;  5D5V B;  4UVA A;  4PGG A;  2ZJ2 A;  3WGI A;  1HW2 A;  3GF2 A;  1IF1 A;  5LHI A;  3HYI A;  3K1N A;  2YU3 A;  3ZPL A;  4HF2 A;  4KMU X;  4XBF A;  1ZGA A;  4KIB A;  3M8E A;  4S04 A;  4P55 A;  5D5W B;  5FFX A;  5LGT A;  1GVJ A;  3QRF F;  3O3K A;  2EFP A;  3ZMD A;  2RVC A;  5DEQ A;  3I71 A;  5J8C A;  4QLC U;  2FQ3 A;  1B59 A;  4UVB A;  5J6X A;  2EFW A;  2XAH A;  4G9Y A;  4IHT A;  2XGX A;  4HX7 A;  4EMS A;  3E3V A;  2F5F A;  1KQ9 A;  5BMZ A;  1WQ2 A;  2KRF A;  1LDJ A;  3WTS C;  3SXY A;  1YS7 A;  3QP6 A;  1I27 A;  1YS6 A;  2F5C A;  4RAY A;  1OYY A;  1ZYR F;  4HA8 A;  2PI0 A;  3RIR A;  3FXU A;  3T8T A;  2Q0O A;  3FMS A;  3MQ0 A;  2UWM A;  2HEO A;  4N9H A;  1G3T A;  1MDM A;  2L3D A;  4HV6 A;  1KYZ A;  4LLG F;  1YG2 A;  2FA5 A;  1Z9C A;  1F1Z A;  5D6F A;  1Z91 A;  5DCM B;  4HLY A;  2E7X A;  1XMK A;  4F7Z A;  5E1X A;  1FX7 A;  3U9G A;  2E7W A;  1S7O A;  5FLX K;  4KIG A;  1ZRF A;  1O3T A;  3BJO A;  2D45 A;  4HW0 A;  1IUY A;  4Q5S F;  1B4A A;  5DD8 A;  3OV8 A;  1K6O A;  5F1R A;  1UB9 A;  1O7F A;  3GFJ A;  4ZYG A;  2L02 A;  1HBX G;  1PDN C;  1XN7 A;  1IRG A;  4G7O F;  1ONV A;  3K2Z A;  1ZG5 A;  3F8F A;  1G3W A;  3MWM A;  4FX4 A;  1V4R A;  2VC1 A;  1UHM A;  1FSE A;  1ODD A;  3CUQ A;  3HSR A;  1U2W A;  2XHK A;  1K78 B;  1YO5 C;  2HS5 A;  4N9I A;  4HQM A;  3KZZ A;  1GXP A;  5L3G A;  3TQN A;  1BN5 A;  1DPU A;  1W7P D;  2HDC A;  5FB2 A;  2H94 A;  1S6L A;  1EH8 A;  2FNP A;  4S05 A;  4IVN A;  4YFK F;  1FBQ A;  5JI6 A;  3J80 K;  2PMH A;  5E20 A;  5E1W A;  2ZME B;  3HSF A;  1OKR A;  4DQ2 A;  3F21 A;  1OYI A;  4RGU A;  2QEN A;  1FY7 A;  3SQN A;  5ERI A;  2K86 A;  4I98 B;  1J7K A;  2KIM A;  4BHP A;  3HHG A;  2G9W A;  1L3L A;  1YYV A;  2RV8 A;  2JTV A;  4KN4 X;  4OIO F;  2PFB A;  5CYV A;  2ADU A;  3V7R A;  3F8B A;  4GO1 A;  2IA2 A;  1D8K A;  2OD5 A;  1ZRD A;  3VOD A;  3RYR A;  5CVU A;  4BH9 A;  3I59 A;  3M7G A;  2Y0M A;  4GYG A;  3U2R A;  2DI3 A;  1JHH A;  2XV4 S;  2XKP A;  2V6C A;  2ZME A;  4EJV A;  1JGS A;  2BV6 A;  2OZU A;  3JTH A;  4KN7 X;  2O3F A;  2C6Y A;  1DP7 P;  2CO5 A;  5DV5 A;  1FBS A;  3ZN0 A;  2HKO A;  3R0A A;  3WU1 B;  4KA4 A;  2GQQ A;  2W84 A;  3WOD F;  2IVM A;  2PQ8 A;  4CXF A;  1H9G A;  3BJA A;  2QBY A;  4I01 A;  4A12 A;  4HX4 A;  3CLO A;  3K9T A;  4FHT A;  1S8N A;  4IRH A;  2VBY A;  1T6S A;  2YPR A;  1K7A A;  2QLZ A;  1ZLJ A;  2ZXJ A;  1J75 A;  4G94 A;  2L54 A;  3HRT A;  1U5T B;  3AAF A;  3BWG A;  3J7A O;  1MZB A;  3ROU A;  3F23 A;  4HAM A;  3RPQ A;  2XAJ A;  4PDK A;  3E6D A;  4KFC A;  3J81 Z;  1TLH B;  4P9F A;  2HGC A;  1JE8 A;  2VBW A;  1ZN2 A;  4G7H F;  3E5U A;  1QZY A;  1T38 A;  3RKW A;  4Y13 A;  4UNO A;  1DUX C;  2V79 A;  2ZO4 A;  3GW2 A;  2BGC A;  1GHC A;  4JQF A;  1RIO H;  4XLP F;  5LLQ A;  3MZH A;  5FLX Z;  3IC7 A;  3FXR A;  4KDP A;  1G3Y A;  3GO5 A;  1O7L A;  2ISZ A;  1YTY A;  3NRV A;  3QAH A;  3R4K A;  1XD7 A;  5K5Q A;  4ETS A;  3E97 A;  2COM A;  4A5N A;  4YG2 F;  1G4D A;  3H92 A;  4LB5 A;  2HOE A;  3GUD A;  3WU0 A;  3LA3 A;  4WK8 F;  5HOO A;  1E17 A;  4KYW A;  3GXO A;  2VN2 A;  2GA2 A;  4L18 B;  2FF4 A;  1IZ1 A;  3KFW X;  3OOP A;  2FE3 A;  1XGO A;  3ERE D;  3MEX A;  4IXA A;  3HOT A;  3FWE A;  2GAU A;  2VXZ A;  1SFE A;  1XCV A;  3RI4 A;  2QWW A;  2LF8 A;  1KYW A;  4L9J A;  1TQM A;  3BZ6 A;  1R22 A;  1IRF A;  3WTT C;  4EM2 A;  1C0W A;  2FMY A;  2VE8 A;  3KET A;  2IW5 A;  3HUG A;  4ENM A;  4QWQ A;  4ZZD A;  2OQG A;  4FX0 A;  2O6G E;  1R1T A;  2KJC A;  2JT1 A;  4HDV A;  5LHG A;  2K02 A;  5D4R A;  1XGM A;  1B9M A;  5F64 A;  3B73 A;  3W6K B;  2GXG A;  1LQ1 A;  2FBK A;  2A6H F;  2PLY A;  4UUV A;  3VEP A;  1KA8 A;  4EM1 A;  4KIF A;  2X4H A;  3WTY C;  3IRQ A;  2IJL A;  1CF7 B;  1BI3 A;  1REP C;  3E6C C;  1IN5 A;  2EA4 A;  4OU0 A;  1E2X A;  2FXA A;  4UVC A;  2D1H A;  4YFX F;  1YW7 A;  2O8X A;  5E8I A;  2DW4 A;  4WXH A;  5ICE A;  1F9N A;  4M71 A;  2DTR A;  5TRD A;  2KIU A;  1XCB A;  2EWN A;  1XGN A;  2AXL A;  5A2Q Z;  1WSU A;  3FX3 A;  3EYI A;  2FU4 A;  3M1E A;  4L5J A;  3KLO A;  3MFK A;  2VBX A;  3G73 A;  2PMU A;  2Z5U A;  3WGH A;  4M6X A;  1IXC A;  3TOB A;  4WWC A;  2YSR A;  2HYF A;  5BOX A;  3GZ6 A;  3ABU A;  4D0P A;  2IA1 A;  3GFM A;  2M5W A;  3FHZ A;  3EYY A;  5ED4 A;  1WWX A;  4I02 A;  3N97 A;  5K1Y A;  2QYO A;  5ILU A;  2Z33 A;  3TO6 A;  4BNC A;  2OZ6 A;  2V1X A;  2XVC A;  1RUN A;  2A07 F;  1P6R A;  3SZP A;  2M45 A;  3N4M A;  1ON2 A;  1PP7 U;  1LEB A;  2MLG A;  2QVO A;  4AIJ A;  3RJP A;  1PP8 F;  4I2O A;  2WV0 A;  3V7C A;  4A0X A;  5DDG A;  4ASN A;  2MD5 A;  2BYV E;  1CF7 A;  1TW2 A;  4A6E A;  1ULY A;  4ESB A;  2XAQ A;  5L3F A;  1TNS A;  2ZKZ A;  1QGP A;  5IT9 Z;  2RC4 A;  5D5U B;  1A04 A;  3H3Z A;  4L0Z B;  3ABT A;  3NEU A;  1HXD A;  4G6Q A;  1LNW A;  2FOK A;  4N0B A;  3FM3 A;  2RDP A;  2JRT A;  1KU2 A;  2LF7 A;  1BC7 C;  1QQI A;  3V8J A;  4CDG A;  2ISY A;  1P4W A;  1UHW A;  3CUQ B;  3F22 A;  3IRR A;  2QQ9 A;  1HW5 A;  1ZG3 A;  3GEZ A;  3E5Q A;  5CLS A;  4HDU A;  4A0Y A;  1I6X A;  4HYE A;  4NHJ A;  5HLI A;  5H6Q A;  5ICG A;  4JK1 X;  1AWC A;  3COA C;  3ZQ7 A;  1X3U A;  1TQI A;  3TO7 A;  4BHB A;  3WTZ A;  4IF4 A;  1DPR A;  1J2X A;  2GA1 A;  2HWV A;  4U7B A;  3BY6 A;  2D2W A;  2PG4 A;  4YFN F;  3TDZ C;  2QUF A;  4EJW A;  2XRO A;  1ZHF A;  1TTY A;  2L4M A;  5JR3 A;  4L9T A;  3GLX A;  5E18 F;  2HQN A;  3EDP A;  1KU9 A;  2A5Y B;  1FP1 D;  1U3E M;  2K7L A;  2IP2 A;  1R1U A;  2O0Y A;  3DPL C;  1MJ9 A;  3I4P A;  1KQ8 A;  2WC2 A;  2ZCW A;  4ESF A;  1O3S A;  2FML A;  3FXQ A;  2QQA A;  5AIQ A;  2H6C A;  3KLN A;  3EUH A;  1Z6R A;  4MTD A;  2A3S A;  1FZP B;  2DT5 A;  3DQV C;  3D5L A;  2PN6 A;  1EH6 A;  1WRJ A;  2NAZ A;  1BC8 C;  4P9U A;  3WE2 A;  1FYK A;  3GYH X;  2W24 A;  2G7H A;  4M72 A;  5ICF A;  4A5M A;  4EJU A;  3E6M A;  1XB4 A;  4OIN F;  4RAZ A;  5CVJ A;  4Y15 A;  3HRM A;  3PFI A;  4UHT A;  5AON A;  1KU7 A;  3HRU A;  3REO A;  1QZZ A;  2ZNZ A;  4EGZ A;  5E1Z B;  3J80 Z;  2QM3 A;  2NNN A;  4TV7 A;  2MBF A;  3JAM Z;  4MQV A;  4WXC A;  1DDN A;  2GWR A;  3HTU A;  3KP5 A;  1Q1H A;  2J5O A;  3R61 A;  2EFN A;  3RKX A;  1U5T C;  5JFR A;  1KU3 A;  4U0V A;  4R79 A;  1RUO A;  3MCZ A;  3MAJ A;  1ZAO A;  5CVR A;  1RI7 A;  2ESN A;  2VE9 A;  1LJ9 A;  3KP2 A;  1T39 A;  2RNJ A;  1QNT A;  3KP7 A;  3P9C A;  2RKH A;  3ISP A;  4ENJ A;  2F2E A;  3W6J B;  3HRS A;  3Q9V A;  2H6B A;  2M1B A;  3EQL F;  2P8T A;  1SD6 A;  1Y0U A;  4U88 A;  2OAZ A;  4P5O A;  5K5R A;  1OYW A;  1BI0 A;  2GZW A;  1U5T A;  5IT9 K;  1OPC A;  1USS A;  1JHF A;  1YW9 A;  4MEY F;  1ON1 A;  3O6B B;  4EVI A;  5BS6 A;  2P4W A;  5BPD A;  4YII A;  3VOE A;  3CJN A;  2EFO A;  4CIC A;  3QOP A;  3V8L A;  3IL2 A;  3LWF A;  5JHU A;  3DEU A;  4RB2 C;  5TJJ A;  2BEO A;  4UV9 A;  2QBY B;  2LNB A;  2HYG D;  3KZY A;  1ZH5 A;  2DK8 A;  3LA7 A;  3SHF A;  1FSH A;  4EM0 B;  2M8E A;  5CVV A;  2WTE A;  4LJZ F;  2K4J A;  4HV5 A;  3J81 K;  4NB5 A;  2HKX A;  5LGN A;  1FNN A;  5D5X B;  4PZJ A;  2RN7 A;  5HS7 A;  3I5U A;  3P7N A;  3KP6 A;  3KP4 A;  3DFG A;  2CSO A;  3T8R A;  2DBB A;  3F8M A;  1KGS A;  1XDS A;  4HF0 A;  2Y48 A;  3RTR A;  1O3Q A;  3I59 B;  4LK1 F;  1HST A;  1YFH A;  4HBL A;  4CO8 A;  2XAG A;  1IN7 A;  4AIH A;  2FBH A;  4G8X A;  5ILS A;  1TQP A;  1U78 A;  2EK5 A;  3P9I A;  5HDK A;  2VOP A;  1XSV A;  1ZG1 A;  2KIF A;  3E6B A;  2IA0 A;  2FBI A;  3CTA A;  2PJP A;  2R7F A;  4EV0 A;  2J5P A;  1P4X A;  5D6E A;  4AVP A;  1P2F A;  3RKY A;  1XSD A;  1S29 A;  2RQP A;  1IW7 F;  4Z2Y A;  3GX4 X;  3Q5F A;  1RNL A;  2DLL A;  2V1D A;  2PBI A;  3PQJ A;  3NQO A;  4O3M A;  2JSC A;  4OIR F;  3ZMV A;  4L0Y B;  3ML6 A;  5LEK A;  2EFQ A;  3R6S A;  3F6O A;  1LVA A;  4RGX A;  4M73 A;  1S7A A;  2KKO A;  5FD6 A;  3WTV C;  2VBZ A;  2LDU A;  2ACJ A;  3R0J A;  6PAX A;  3T0Y A;  1SFX A;  3K0L A;  4XSZ F;  5EEH A;  1B1B A;  5FFZ A;  2JPC A;  4H0E A;  3JTG A;  3V4G A;  1SD7 A;  1ZRE A;  3KEO A;  4XRF A;  3T1B A;  4HQE A;  3T5X A;  2K4B A;  2Q8K A;  2DQL A;  3HSE A;  1P92 A;  4IRI A;  1K79 A;  3G3Z A;  4MGR A;  3CUQ C;  1I1G A;  2X0L A;  2HR3 A;  2STT A;  1STZ A;  2OU2 A;  3ZP5 A;  2CQK A;  3B02 A;  4OIQ F;  1H9T A;  3HHH A;  3WTW C;  3JAM K;  4MNU A;  5FD5 A;  1MDM B;  5D8K B;  2DPU A;  4P96 A;  5F6F A;  4U0Y A;  2YR2 A;  2CWE A;  2QZ8 A;  5ICC A;  5FGM A;  4AIK A;  4HOB A;  2XAS A;  2OBP A;  3JSP A;  4HZF A;  3IKV A;  5BPI A;  2E1N A;  5A2Q K;  1ZGJ A;  4EJT A;  4ESJ A;  2A6E F;  4M74 A;  4BXU A;  3WTX C;  2D1V A;  4Q48 A;  3LAJ A;  2O61 A;  2F5E A;  3L2C A;  2EA2 A;  4IHS A;  1TNT A;  2RGV A;  4I0A A;  2XKO A;  4CHU A;  4A0Z A;  4U7D A;  1XSX A;  3ZN1 A;  2LSO A;  4RGR A;  3JW4 A;  4WCG A;  2VOO A;  4LLL A;  2CFX A;  2NNY A;  3QP5 A;  1J9I A;  2H27 A;  1MD0 A;  3K1M A;  1UCR A;  3M9A A;  2GIV A;  2P5K A;  5L3D A;  1BIB A;  5AIP A;  4HLX A;  2DK5 A;  3BPV A;  4WF2 A;  5HVQ C;  2EV0 A;  2GXB A;  1UST A;  3TOA A;  2FSW A;  1R58 A;  4DNC A;  2IRF G;  5HDN A;  2XUB A;  2P6S A;  1WI9 A;  4AWX B;  1R5G A;  2V9V A;  1FPQ A;  4RB1 A;  4M9Z A;  1I5Z A;  1MJB A;  1R36 A;  3GFI A;  2JZY A;  1LB2 A;  4Q4Z F;  3E5X A;  4OIP F;  3BOQ A;  4R1H A;  3HOS A;  1ZLK A;  4GCV A;  1SD4 A;  2ELH A;  4E70 A;  2ESH A;  5BQT A;  3QU3 A;  2E1C A;  3ECO A;  4PGH A;  1R00 A;  1FYL A;  2MLK A;  3I54 A;  1YIO A;  3IWF A;  1GXQ A;  4LMY A;  4ZZL A;  2MC3 A;  2ZNY A;  4CYD A;  2OA4 A;  5L3E A;  1IXR C;  4ENK A;  2MH9 A;  4RB0 A;  4BQA A;  4KT5 C;  5LRS A;  3S2W A;  3C7J A;  4EJO A;  1Z05 A;  2L4A A;  2FEZ A;  3L9F A;  2A61 A;  4I0B A;  2MA3 A;  3IWZ A;  1CGP A;  1TW3 A;  3CO7 C;  2YX4 A;  4BYY A;  2IT0 A;  2XIG A;  1W7P A;  3CUO A;  3I58 A;  4GGG A;  4ENN A;  1MGT A;  4L9N A;  5JVT A;  3R60 A;  4ZYH A;  5IT3 A;  3V7S A;  5HLH A;  1BI2 A;  2CG4 A;  3BJ6 A;  1IN4 A;  4M6Y A;  1QO0 D;  3WGG A;  1BJA A;  2VT3 A;  3IHU A;  4LFU A;  1EV7 A;  1FYM A;  5L3C A;  1FC3 A;  1YQA A;  4ZYD A;  3L09 A;  1IXS B;  1BM9 A;  4GXO A;  5H20 A;  3MZY A;  1FLI A;  1W5S A;  1W5T A;  2L01 A;  3BDD A;  3JSO A;  3ZMS A;  1BI1 A;  3RPU A;  1F4K A;  5J8F A;  1D5V A;  2FRH A;  3K1P A;  1RZ4 A;  1P4A A;  2ZBK A;  2R7D A;  1B9N A;  2Z9O A;  4LG0 A;  1HKS A;  1Z6T A;  3BRO A;  3U1D A;  4IRG A;  1YW8 A;  3WG9 A;  5HS8 A;  4FT8 A;  2DU9 A;  3TKY A;  3SZT A;  3LA2 A;  3CDH A;  1BIA A;  2BBY A;  4LLN A;  2TDX A;  4M9S A;  1H0M A;  4ON0 A;  1I1S A;  4PCQ A;  4R8H A;  4HX8 A;  1R1V A;  4GYI A;  1G6N A;  2W85 A;  1ZAR A;  4UV8 A;  4Y17 A;  2UXX A;  3WE3 A;  3ZMZ A;  3LST A;  3KP3 A;  4UXN A;  2EJR A;  1FT9 A;  2LKP A;  4XSX F;  3EET A;  1K78 A;  4OMZ A;  4HF1 A;  3VFZ A;  4I7H A;  4WX9 A;  3DKW A;  2Z99 A;  2EB7 A;  3GWZ A;  4MTE A;  4AD9 A;  2CYY A;  1SAX A;  4A6D A;  1UFM A;  2H09 A;  2ZFW A;  2P7V B;  1XGS A;  4OOI A;  3ECH A;  2VC0 A;  2JPB A;  2XAF A;  5D8L B;  4XLN F;  1D8J A;  3LQR A;  2QQB A;  1SMT A;  2NYX A;  5E8G A;  5L3B A;  3ZMT A;  2HQR A;  1IN8 A;  3DXJ F;  1HQC A;  3F3X A;  1U6G A;  4IJA A;  1MKM A;  2G7U A;  5DCM A;  1XMA A;  3KCC A;  3F72 A;  2BE5 F;  3V8K A;  3F6V A;  3C3W A;  4RS8 A;  4MQ9 F;  5K5O A;  4KIC A;  2KJB A;  4LD5 A;  1QPM A;  2PEX A;  2Z3Y A;  1BBY A;  3HIF A;  2B0L A;  5H6R A;  1LDD A;  1Z7U A;  3C18 A;  2EV5 A;  4NQW A;  2VT2 A;  3DV8 A;  3D0S A;  3WTU C;  2K27 A;  4G7Z F;  3I0T A;  3I53 A;  5EEG A;  4M9X A;  1SMY F;  1HKQ A;  3ELK A;  5ILV A;  2CW0 F;  1G3S A;  1SFU A;  3SFZ A;  2W57 A;  4K2E A;  3KEQ A;  1AOY A;  2FNA A;  1Z1D A;  3TGN A;  3TO9 A;  2CGP A;  1QBJ A;  5KK1 A;  5HS9 A;  3BPX A;  1O3R A;  2P7C B;  1VTN C;  5KVR A;  2NRA C;  4G6D A;  3P9K A;  4YIF A;  2P5L C;  2M87 A;  4MHG A;  4I09 A;  1KQ0 A;  5CVI A;  1EH7 A;  3L7W A;  3LFK A;  4KUM A;  5DD4 A;  4RGS A;  2ETH A;  2IPQ X;  3L00 A;  4B8X A;  3QU6 A;  4BAY A;  2VOD A;  1L0O C;  3RDI A;  1W4M A;  4EQQ A;  2NS0 A;  5E17 F;  1HKT A;  1HSJ A;  1J59 A;  5D4S A;  3C1D A;  2EV6 A;  1OR7 A;  4IPA A;  1XDU A;  2Q2E A;  4EGY A;  4LB6 B;  4Q47 A;  2UZK A;  3GFL A;  3LQQ A;  2HTS A;  3HTS B;  3F8N A;  1MJA A;  4RB3 C;  2YX7 A;  2STW A;  1J0R A;  3BP8 A;  1FOK A;  3FM5 A;  1IN6 A;  1YLF A;  2HFH A;  3DF8 A;  1WKM A;  5HDG A;  4ZYE A;  3DPT A;  5DYM A;  4LG0 B;  1LEA A;  4LK0 F;  5LHH A;  5LEJ A;  1OMI A;  1IAW A;  1FWZ A;  5DCF A;  2DAO A;  4O6J A;  1D3Y A;  1R7J A;  3CO6 C;  1PUE E;  1B6A A;  5DUK A;  1JXS A;  2OQR A;  3FMQ A;  2P5V A;  4CGZ A;  2F5D A;  3TDU C;  5LBQ A;  1BOA A;  2UXN A;  5DUI A;  3GVA A;  4BHC A;  4JBA A;  3ULQ B;  4MEX F;  2Y75 A;  4ZH4 F;  3I64 A;  2DQR A;  4KNY A;  3M8F A;  1LDK B;  4L5I A;  3FZV A;  2AS5 F;  1T0F A;  2W25 A;  2V1U A;  5LRR A;  3RYP A;  2WWY A;  1J5Y A;  5HLG A;  3FF5 A;  1O57 A;  2XRN A;  5CJ9 A;  1W7P B;  2DPD A;  3DP7 A;  3QPT A;  2HZT A;  4L9V A;  2P6T A;  4OMY A;  2DFI A;  2A69 F;  3K69 A;  5FO5 A;  1R5H A;  2MH2 A;  1FP2 A;  1NHA A;  3LAP A;  1ZRC A;  2A68 F;  3GZ5 A;  3IKT A;  3ZMU A;  1FBU A;  2O03 A;  4A2U A;  1S3J A;  4U0W A;  2M30 A;  1R23 A;  4B09 A;  1HW1 A;  4CZZ A;  2VON A;  3FMR A;  4KMF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...