2NOJB

Crystal structure of ehp / c3d complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
58
structure length
58
Chain Sequence
NKKVVDAQKAVELFKRTRTVATHRKAQRAVNLIHFQHSYEKKKLQRQIDLVLKYNTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Complement C3
publication title Characterization of Ehp, a Secreted Complement Inhibitory Protein from Staphylococcus aureus.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 23
structure length 58
sequence length 58
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2006-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12199 efb-c Extracellular fibrinogen binding protein C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1270 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2nojB00
2JVHA 2WY7Q 2WY8Q 3D5SC 2NOJB 3D5RC 2GOXB 2GOMA 2JVGA
chains in the Genus database with same CATH superfamily
4M9SA 2B0LA 1MW7A 1B72B 2VKVA 3K4CA 4PJMA 1V5EA 2LNBA 4EEFG 2E2IJ 4BKXA 2X1EA 3CCJI 4HNTA 2K27A 2OCEA 2XPWA 3D0SA 1BA5A 3I4NJ 1Y39A 4CYCA 4OIQF 4UV8A 5C4XJ 2WADA 4OINF 4AM3A 1ENHA 3EUAA 3M8FA 1WZ2A 4HLYA 3L2VA 2IA0A 2VI6A 2PMHA 1F5TA 3ABLH 2BOLA 1ZG1A 4HG2A 1VQ7I 2ISZA 4OAYA 5FLXK 3GW2A 1I3QJ 5DS9A 1P4WA 1ETYA 3OS0A 3CMYA 1IGNA 4RLQA 1USSA 2Q2EB 5F0FA 5JR3A 4KMUX 2D1VA 2RQPA 2Y75A 4UY8I 3OYIA 1XPXA 3LQRA 4A3DJ 4RGUA 4OIOF 2W00A 4IKFA 2ESNA 2LLKA 2ZXHA 5B66C 2HOTA 5B1BH 1G6NA 2LBFB 1XGSA 1ON1A 5HS9A 1U9NA 3AG2H 5IP9J 3SFZA 4IEJA 1EA3A 5HS8A 1W0UA 2M4KA 2QQ9A 4XR6A 3BCAA 1E0EA 4PZJA 1OCCH 2IPQX 2BY0A 1TQMA 2Y30A 2DDBA 2MC3A 3R0JA 2XKPA 2H1LA 3SQNA 1ZLKA 1YE9A 1QQIA 2JVGA 2HQAA 3E1SA 4ENMA 4KJZA 3JRBA 1VQKI 4G6TB 1IRXA 1JHFA 1G59A 3QAHA 4XRMA 1P4XA 1B8IB 1ZN2A 2DMPA 3PM1A 2CU7A 3ZGKA 2UXXA 2QWWA 2VC1A 4E7SA 2HQ5A 3H5NA 3OOUA 2R7OA 3VYUB 1R5ID 3O2PE 3WE3A 1BI1A 3RCOA 2E1OA 2ZO4A 3ASNH 3S2DJ 5CLSA 3TQNA 2F2EA 2KIUA 5L3FA 1KYWA 1JI8A 2KJCA 4WK8F 1YG2A 2DU9A 2GQQA 3HBLA 2JK3A 4DNCA 3FMRA 1XC5A 2COBA 2XB0X 4ASNA 1N77A 5LEJA 1XN7A 3FWEA 2YX7A 1SAXA 3HIFA 1Y1VJ 1UHSA 2IBDA 4XRFA 5EG0A 4HV6A 2ZFWA 2VN2A 5FD5A 3F3XA 1PUFB 3DPLC 3J7YJ 2PMZN 2W48A 4GYGA 1IN7A 2UUZA 2HXIA 1XSDA 3ABUA 2CGPA 2MGQA 2R4GA 3CCQI 4ZH4F 2CWEA 4FCYA 3P7NA 1AWCA 5K7HA 4RLFA 4D0PA 2NVTJ 1MNDA 1YTYA 3BG6A 4L5JA 2M7BA 4HSTA 3OYJA 5BOXA 3OS2A 2VT2A 1GT0C 2DT7B 1S72I 4ZJZA 3CLQA 1IZ1A 2VL8A 3TW6A 3OIOA 4FX0A 4BY7J 1RR8C 1WWXA 3C2HA 3FM3A 1S7EA 3LSKA 2KRHA 5LGUA 3ABTA 4U7DA 2CYYA 2DFHA 2ISYA 2QSFX 4BGDA 1VNDA 3S1MJ 5GTHC 2OZUA 3CCRI 2CJJA 1SAUA 5CVVA 2GLOA 1XGMA 3KCCA 1LPQA 2PLYA 1Z6RA 1FMWA 5HDNA 2EQRA 1MBHA 4OU0A 2V6CA 1R4MB 3S16J 1U0JA 4E7ZA 4Y52J 4BNCA 4P96A 1ZELA 1ZGWA 3BR2A 5E20A 3BJOA 3WU1B 2MG4A 5D6FA 2OV7A 1IN6A 3KLOA 2DA3A 1ZARA 2RN7A 3V7SA 1MNEA 4L9NA 4CCMA 3CCUI 5DUIA 3JRIA 2UWMA 5BNGA 5E17F 1WJFA 1OCRH 3OYKA 2XDVA 3F8FA 2FU4A 1XMXA 3DKYA 1GXPA 1DU0A 3H3VK 4KIBA 2V1DA 3HKZA 3HOWJ 1H9TA 1K78B 3ZMDA 2DPUA 3TOAA 1ZRFA 3J80Z 1T6SA 4LG3A 4PCQA 2DFFA 2NXNB 2VB6A 4PFPA 1OCPA 1WKMA 2MYSA 4G94A 3F9KA 1LB2A 4RB2C 4YEJA 2M8EA 1WFXA 2XV4S 2COMA 1Y56A 4ON0A 5HODA 4BYYA 3K2AA 4HV5A 5K5OA 1QPIA 2MH9A 2LC2A 5AIPA 2ZNYA 2GXBA 1Z0XA 3JREA 3Q0VA 5LRRA 4HQEA 2GXGA 2TCTA 4U88A 4N4NB 2WB1N 2LKXA 4XLEA 4GFBA 1A6QA 1U5TB 1I5ZA 2VIXA 4CCJA 3OYLA 1JKRC 4KT6A 1EKEA 1YJWI 3QYEA 1TBXA 5EGOA 4PJLA 4E6KG 2VC0A 3OYFA 3K9TA 2M2EA 1ZLJA 1DGRM 4BXFA 4YFNF 2E5ZA 3LNQA 3VSLA 1X1DA 2MABA 4OIRF 4I0BA 3W6JB 2RDPA 3IUOA 5GTIC 4BDZA 3DLLF 3R61A 1Z77A 3FX3A 4KNYA 5FKMA 4UV9A 2O61A 1BIAA 3HC7A 1Y1WJ 2QQ8A 5FRNA 3DF8A 3G1OA 1AKHA 3HPHA 2IAIA 1RZ4A 3DBHB 3KZIC 5A2QK 1F9NA 2XPUA 3BTIA 5L3BA 1ODDA 2VBXA 2R7UA 3EETA 3BDDA 1KONA 4IQ4A 4MGRA 3JAMZ 1HQCA 4XKWA 3UNGC 1IDZA 2JA5J 2W1OA 3E6BA 2PFBA 5EJCA 1I50J 4G6DA 2HZDA 2ZJRF 3CCEI 1X2MA 1HKSA 4U7BA 1QA6A 2W24A 3GTLJ 5E3MA 1D8JA 2VODA 4PDKA 1X1CA 3OYMA 4Y13A 4A0YA 2KDOA 4KT5C 1FIAA 1U3EM 1QU3A 2PQ8A 3GFIA 3BZCA 5DCFA 5D8LB 3RKWA 4FQGA 2JPBA 3DTKA 2BZTA 5E79C 2M87A 3GFJA 2EFPA 2LKSA 1M1EB 2EZHA 1IC8A 3DXJF 2LY1A 2M7AA 2KT0A 1JKPC 1ETWA 5LBQA 3GTJJ 5KK1A 5IOZA 1VQ5I 1KA8A 4LIUA 3GTGJ 3FXMA 2Y0SN 1Q1VA 1BN5A 4GDFA 3RKYA 1I1GA 3GF2A 4XLNF 4ZYGA 2BVMA 2PN6A 3TMOA 5B1AH 4XN0A 2F4OB 2L9VA 2XB5A 5M5YJ 3FXQA 2K9NA 3CMAI 4KIFA 2OQRA 4CXFA 2M9HA 3CMMA 4XOTA 3JRHA 2ECBA 4CYDA 2RNGA 2LDUA 2O5RA 1POGA 2FEZA 2K9SA 4HSRA 2JVHA 4JX6A 4FE7A 2EJRA 2GOXB 1MMGA 4EJWA 2Z3YA 1GV5A 2DTZA 1YITI 2UV1A 2IEKA 1VQNI 1D8KA 4RB0A 5D5WB 3CDHA 4Z6YA 1XDSA 4XL9A 2H6BA 2W4SA 4GCVA 3G2BA 3CUQB 2Z16A 2K40A 3H9GA 3VFZA 2F5VA 4AC0A 1NG6A 1QPMA 1DPRA 5F64A 2CRGA 4RAZA 3HM5A 4BBSJ 4BXUA 2IP2A 3DV8A 3ZQ7A 2JA2A 2LFBA 2O9LA 2JSPA 3QP5A 4XQFA 2Z33A 1FYMA 1S6LA 1HXDA 5GADJ 1LVKA 1CF7B 2MA3A 4BU2A 1R58A 1REPC 1MMSA 4Y4RA 3VYRB 4HF0A 3LSGA 2WAEA 4XN3A 3L2CA 1PDNC 3H1CA 1VQOI 1P7JA 5GAEJ 3IRQA 2G9WA 4NC8A 5J1UA 4X0GA 2DMNA 3AG3H 1IRGA 3LSTA 4A93J 2R5ZB 4L18B 1BOAA 3OYGA 4UXNA 5GP9A 3HOXJ 4BQQA 2XAQA 3VDXA 1Y0UA 3BTLA 1UZCA 4P9UA 3BG9A 4J19A 1IRZA 3I59A 3WTVC 2F4MB 3TKYA 4KUMA 2VBYA 3Q3SA 2D5VA 3F8NA 2X4HA 4PFOA 2XAJA 2H94A 1RNLA 2CG4A 2F5FA 2XAUA 2PJRB 1QO0D 5DM7F 2ICWG 3EDPA 1EH6A 4ENKA 1FIPA 9ANTA 3LSPA 3FDYA 2CUZA 2MFZA 3PQKA 4L0ZB 4WCGA 5E3OA 5E18F 3QWLA 3ZOBA 5IP6A 1KZHA 4CICA 1O3RA 4ZYHA 4KN7X 3HSFA 5F08A 5BPDA 1O4XA 1IO2A 1TT0A 3GFMA 3KIOA 2IS1A 4XK4A 1LEBA 1G4DA 1PP8F 1K4SA 1ULYA 1HSJA 1J9IA 2XUBA 1FSEA 2P5LC 3LA7A 3S32A 4A3MJ 2V1NA 4DW6A 3J7AY 4UUTA 5E1XA 1D0XA 1SVLA 1J2XA 3DKXA 1XB4A 1SMYF 2Z2SB 5D4RA 2DW4A 2R93J 1JTYA 1JHHA 2L4AA 3PL8A 4IQJA 3LSRA 1EJ9A 1XMAA 1RPWA 4N9HA 1GVJA 4XSXF 3IKVA 1OYIA 2VONA 1B4AA 3QQAA 1IF1A 1LEAA 3DTIA 3GTOJ 1U9OA 3IC7A 4PJNA 1O3SA 1FY7A 3KP5A 3LL7A 4RAGA 5K5RA 2B7EA 2EINH 1MMNA 3DU6A 4A2UA 2JTVA 3K1MA 2A69F 2R0QC 2DCEA 2EZKA 3HRMA 2STWA 2BV6A 1ITYA 2DJNA 4FTHA 4UVAA 4CH7A 2XASA 5C44J 3W2AA 2L4MA 3BTCA 2BVLA 3BROA 1GDTA 1SFXA 2YS9A 3VWBA 1I39A 1RESA 2PMZA 3CDIA 4HDUA 2EIMH 1OJLA 3C18A 1MMAA 4IHSA 3A01A 3FK6A 4IZZA 2JSCA 2B63J 3MFKA 3CDLA 4HEA2 2R7TA 1LJ9A 1B6AA 3ELKA 4IPAA 3JR9A 4C2TA 2A3SA 2VJJA 2CV2A 4BJ6C 2XSDC 4IHXA 4XKBA 1WJCA 2G7UA 3HOSA 3CUQA 1JXSA 4NQWA 3RQIA 4EGYA 2ESHA 1SFOJ 5C4JJ 1I1SA 4IJAA 3GZ6A 4R79A 4X6AJ 1C0WA 3ML6A 3T8TA 1JGSA 2Z99A 1MH4A 2CO5A 4U0VA 5JI6A 1FT9A 2WTEA 1O3QA 1YIJI 1YYVA 4QWQA 3F8MA 4ENNA 1TWFJ 3I58A 1V3FA 3PSFA 3A4CA 1ZR2A 3LA3A 3HTUA 1EH7A 4DZPA 2FOKA 3L2RA 3F22A 2XSJC 3A02A 4WF2A 5FLMJ 3CLOA 3E97A 4G7ZF 1B9NA 3ZQLA 1TWGJ 3L00A 5HS7A 3J80K 2HNHA 3K70D 3CO6C 1I6HJ 2FF4A 4A3FJ 3DLAA 2DOAA 5FO5A 1ZHFA 3QPSA 1BI2A 1MMDA 3TDUC 2IW5A 3PUFA 1J0RA 3VODA 2Y48A 1FBUA 4AVZA 2M45A 2MC4A 2E1CA 2X6XA 5B3SH 2E35A 1XX5A 2DOEA 1B59A 4JQFA 4RAFA 3DEUA 2KMUA 3CCVI 1ETKA 5H6RA 3ABKH 2H8WA 1FPQA 2XVCA 3CUOA 3DFGA 4B48A 3NQOA 4XBFA 1WJDA 1Y6IA 1P4AA 2TRTA 1WI3A 3KE2A 3NEUA 2DJIA 1S9HA 1KU7A 2IVMA 2X9DA 1HKTA 4LB5A 3BY6A 4B1RA 2VASA 2JQ7A 3G6EI 3CCLI 2MBFA 4AYBN 1SD7A 1WI9A 2QLZA 2F5EA 2TDXA 1Y8QB 4ZC3A 1HBXG 1OMIA 5LEKA 3ZXSA 4BQNA 1MBJA 4BJ5C 3GX4X 4FE4A 1UCRA 2I5UA 2O8XA 4YFKF 5BMZA 1DP3A 4M6VA 2WB1A 3JTGA 2I10A 4NNJA 3A0BC 3BCBA 3GTQJ 2X85A 2HQRA 4C3JJ 2A5WA 2HKXA 2K5CA 3BQZA 3OYHA 1VQ8I 4M6XA 1TLHB 2DAOA 1V5FA 2DT5A 5TISC 3MZHA 3KX2A 4M72A 3JAMK 1N25A 4M3EA 4BACA 3UKGA 5M3MJ 1RR7A 2KIMA 3HSRA 3ZN0A 1Z7LA 3E6CC 4EVIA 2K86A 2BY3A 3FXJA 1XGNA 1BC7C 2NYXA 2M30A 3O8HA 4KDPA 1PJRA 5CKTA 4FT8A 1MD0A 2A05A 4E4HA 1LFUP 1X58A 4BHBA 3OWTA 1IW7F 3I3LA 1ON2A 4HOBA 4L5EA 5IYDJ 2WV1A 1OYYA 4XMYA 4MTDA 4KYWA 2XHKA 3AG4H 3FXRA 3MWMA 3T8RA 2OTLI 2NNNA 5DCMB 2DBBA 1D0YA 3FM5A 1DU6A 5E1WA 2C6YA 2HVQA 4IHTA 1O57A 1VFCA 3MN2A 1D5VA 3R6SA 5HVQC 4QLCU 1FJLA 3FXUA 4XLPF 3CZ6A 1D1CA 3L2WA 4EJUA 3PNYA 4C2UA 2LD5A 2X48A 3TL4X 3WTSC 3F23A 1VTNC 3GCMA 1UHMA 2V4JC 1JKOC 3S1NJ 5HLHA 2VJ5A 4Y3OA 2HVSA 2PEXA 2IJLA 1ZKGA 2XRNA 5HDGA 3AAFA 1U8BA 3VSKA 4BHPA 2VT3A 5CVUA 3IAS2 1QZYA 4M3FA 2V79A 3F6VA 3JRDA 1G8XA 3I54A 4LG0B 1Z05A 4ITVA 1K6YA 1XMKA 1F4KA 2QSHX 2Z5UA 1SFKA 2Y0SA 2LY9A 2ZJQF 3EYIA 5HLTA 2L7KA 3B6CA 5J4VA 2HVRA 1V5GA 2NS0A 5GPAA 2DQLA 2AHQA 2MD5A 1KQ9A 5IT9Z 1L0OC 2NOJB 4BEHB 2P81A 5L3DA 5BS6A 3CD6I 4LB6B 3TO6A 1MBFA 2E7WA 2F5CA 3QU6A 4NC6A 1K79A 4OMYA 2DA5A 4HAMA 4UB8C 3Q0WA 4A5NA 2IS2A 2L2OA 4II2A 4XRSG 2L0KA 3TDZC 2ZSHB 1JGGA 2FX0A 3K0LA 5IYCJ 3WU2C 2QENA 5FRMA 3U2RA 5CQGA 4ETSA 1IV6A 1QHGA 1LDDA 1MJAA 4XIDA 2EIJH 3ZQIA 3FKJA 2W25A 2NRAC 1MJ9A 5H20A 2EFNA 3E5UA 2EWNA 1LE8B 2FRHA 4XONA 2V9VA 3CQZJ 4XORA 5FFXA 5JVTA 4B09A 2CQQA 3CJRB 4M73A 3PO2J 4ENJA 2DODA 1VZ0A 2E5NA 1FTZA 3SEQA 2O03A 1GXQA 1YRNB 3CC2I 3FIWA 2E2JJ 2AS5F 5DD4A 3WG9A 4Q48A 5L3GA 4BQAA 1XS9A 1SANA 2VXZA 3F21A 3A0HC 4HRIA 2DTRA 1NTCA 4PJJA 2AXTC 3ZQFA 3CMEI 2JJ7A 1FP2A 1S8NA 2V9PA 3MMYB 1TL8A 2DFEA 4M71A 2L3DA 1EF4A 2H1KA 4BS9A 4M3GA 3U9GA 1UFMA 4M74A 5J4YA 2D45A 3O6BB 2JUGA 4HNUA 1WGXA 3NWSA 3OYDA 2XGCA 3L7WA 3QPLA 3RQ4A 3RYRA 3QODA 2HKOA 3G71I 2GBYA 1CGPA 1NHAA 2HDCA 4L0YB 2OD5A 2FMLA 2JZYA 4IX7A 5FKOA 3ZMTA 1MSFC 3BJAA 3U1KA 1VQPI 2ZMEB 2R3SA 2WBMA 4LGWA 2LRDA 3TEDA 1W7PB 4IHYA 3CF5F 2GA2A 2KISA 2DMTA 3MQ0A 3RZDJ 2BXZA 3FKIJ 1DPUA 3FHNA 4DJAA 3DP7A 3K4KA 2JA7J 2D1HA 3WHBA 3S3NA 4BXXJ 1B72A 4MHGA 3OL4A 2PMUA 3O8GA 5IYBJ 2HXOA 1MGTA 3BTJA 3MAJA 2GA1A 1N75A 2VBZA 5LLQA 1VQ4I 2OQGA 4B3XA 5ICGA 3KP2A 3L9FA 2QM3A 4A5MA 1ZTRA 2K3PA 4C30A 1K83J 1J75A 1RRJA 4EGZA 4IHWA 1D5YA 4E7HA 4C3HJ 4P55A 2AQEA 4A6EA 3IAM2 3I64A 1RIOH 3I9V2 1ZRCA 1BR1A 2PJPA 1LDKB 4EATA 4A0ZA 3I56I 2Q2EA 3PNTA 4L9TA 2O0YA 4LG0A 3I4MJ 3I4PA 4A6DA 2XF5A 3QOPA 2DK5A 2ID3A 2RC4A 4CCLA 2MLKA 3RZOJ 3DPTA 1H0MA 1JT6A 5F27A 1QGPA 2R7DA 2LBFA 2E19A 2MLGA 4Q4ZF 2HTSA 2CW0F 5H2FC 4PGHA 2FSWA 1T39A 1ZK8A 4Z2YA 1B1BA 4HA8A 1SD5A 1W36D 2R5YB 3PUBA 4E7LA 2LTPA 3S2WA 2OU2A 1Y0NA 2NVQJ 2F4IA 3IWFA 2KIFA 3H0DA 3E6DA 3J7ZI 2FBIA 1WRJA 2EV0A 2A61A 3J7AO 3OR2C 3BC8A 1J59A 2DI3A 3SZTA 1WJEA 4B8XA 2P0WA 1LKXA 2EA4A 4XLAA 1JJ8C 1XGOA 1A35A 5LRSA 1ZAOA 4ESBA 1B8IA 1NG7A 3BPVA 2XGEA 1Z3XA 2E1MC 1X4OA 2HU9A 1TW2A 3HHHA 1TNSA 2P6SA 4F92B 3MD2A 1LE8A 3F8CA 2IGOA 2KHMA 5JFRA 2VJIA 4AIHA 2A07F 1X3UA 3QP6A 5FKNA 4E7IA 4DIQA 1X1PA 1KU9A 3SXYA 2NS8A 3K69A 4MFEA 2K9LA 1JUMA 2KIQA 1USTA 3DQVC 2JT1A 3E0JB 1U78A 2QGUA 1OPCA 4G7OF 1PUFA 3HUGB 1GLNA 4NC7A 4I6ZA 1R7JA 4RA2A 3K1NA 3LWFA 4CZCA 2LKPA 2X6WA 1SC7A 3IH3A 2VKEA 2HTJA 2WY8Q 3HSEA 4MQVA 5FGMA 3ESWB 1FYLA 4JOMA 1SEUA 1P2FA 1STZA 1R6RA 3N05A 2BY2A 4RDUA 3S14J 1FOKA 3EYYA 3HRTA 4QPOA 4DYRA 1X2NA 3BG5A 5D5VB 5DV5A 1SD6A 2DOFA 1OYWA 3Q5FA 5M5XJ 4FHTA 2KLOA 2OBPA 3DBRB 2N8GA 4KIGA 1MDMB 4DBRA 2NVXJ 3CJTB 2ZFUA 2LYCA 2XF6A 1P7IA 1TWAJ 1RI7A 1IN5A 2HZTA 3WTZA 5FB2A 2NS7A 4AIDA 1BI3A 3PQJA 3BR0A 3ONQA 1BR2A 4ESJA 5D6EA 4HDVA 2VKHA 4PSWA 4JYKA 1VQ6I 2IGNA 2MH2A 3IRRA 1S7OA 3V8JA 2DFIA 4IRHA 4JP0A 5GAGJ 4NBQA 2R7RA 1UELB 1YFHA 5EEAA 2K7LA 4KISA 4AYBA 1HW5A 2DDAA 1MBGA 1E3OC 2RVCA 3SDBA 2V1UA 5LFAA 3KP4A 5K1YA 3K4LA 3HJEA 4AU7A 3JSPA 3K10A 2QBYB 1A5JA 2VKDA 4UUVA 1LVAA 1V55H 6PAXA 2HOSA 2WV0A 5F1JA 4B47A 4DZJA 4J00A 3HGGA 2DYSH 2UXNA 3VPRA 2XAHA 1K78A 1BC8C 2E34A 5L3EA 1S7AA 3DTEA 3V8LA 3TW7A 1RUNA 2ZC2A 4A3BJ 1YLFA 3I5UA 1LQ1A 4IO9F 4C3IJ 1K6OA 2P7CB 1Q1HA 4I2OA 3OYBA 4G8XA 1JT0A 1A04A 4Q5SF 2JWTA 1PP7U 5HDKA 2NVUB 1S3JA 3AKZA 4HQMA 4YIFA 2D2WA 2LMDA 4RM3A 1YW9A 3CF2A 4V2GA 4BJTA 2IA2A 5LD2C 1H88C 3CCMI 1U5TA 1I3AA 4P1WA 5DUKA 4QIWN 2OJED 3BT9A 3HB9A 3WGIA 1W5SA 2XAFA 3HOVJ 3HOZJ 2WAQN 2QEXI 5LHIA 4UVBA 4ZTFA 5IT9K 2KPMA 1PYVA 4YIRX 4BH9A 4ZZLA 2EZLA 4C9YA 3AG1H 2M3AA 2Q1ZB 2DA6A 5EEGA 3TOBA 1U8RA 3FMQA 2L7MP 3H35A 3OS1A 2MW8A 1KQ8A 1CQTA 2V26A 4F3QA 3X2QH 1OR7A 2ZXWH 3V7CA 2VOPA 2CV0A 1V54H 3IH4A 2K9MA 5FROA 2CQKA 2CSOA 1LDJA 1AOYA 3H36A 4CGZA 1TWHJ 1MSEC 1T56A 2QSGX 1UG0A 2YPRA 1FNNA 4HW0A 1ZGJA 2A6EF 5E3LA 3T0YA 4A3IJ 1QHHD 2KFDA 3ZPLA 2HQNA 1SVOA 2OTJI 4RGRA 2X1CA 1TW3A 1FOWA 3JRCA 2ELKA 1OKRA 3L09A 1HA8A 1XDUA 1BR4A 4A0XA 3I0TA 2QVOA 4I01A 2DA2A 4X1EA 2Z9OA 3OR1C 3ASOH 2CFXA 2H09A 3BR6A 3K7AJ 2XKOA 4BHCA 5DM6F 2V1XA 3L2UA 1GV2A 4H0EA 4LMYA 1Z7UA 3H5AA 5J3LA 5C3EJ 3U21A 3BLYA 5JVGF 5JHFA 3K4JA 5CYVA 2KJBA 1KU3A 3BR1A 3DU5A 2L01A 5K7ZA 4ZYEA 3PIPF 3FXKA 1F43A 3S93A 1IN8A 5KNLA 1T98A 2CH0A 4I0AA 1DQUA 3ULQB 1YW8A 2QQAA 3BZ6A 3GXOA 5F0CA 5ICEA 5LGNA 2JA8J 1X1BA 3C7JA 1R22A 1HDPA 1DUXC 3DWLE 3CP8A 1OISA 1N78A 5IOYA 3P9KA 2BE5F 4YG2F 4AWXB 1W5CC 1Z3YA 2DN0A 2JA6J 1W4MA 2OZ6A 4GYIA 3OY9A 3E7LA 3KLNA 2HGCA 2Q8KA 4E7JA 1S5LC 3MZYA 3D5SC 3LSIA 2RAEA 3GLXA 5KHDA 3IKTA 3H3UA 3QYFA 4F93B 3RDIA 3D1NI 5DD8A 4MEYF 4CYCB 3CESA 3R4KA 4OMZA 3S2HJ 1FWZA 4BQOA 1JTXA 2BBYA 3KP6A 2P4WA 2LVSA 2MD0A 3CCYA 1CF7A 4L9JA 1ZGAA 3S3MA 5J1RA 2NOGA 3H0GJ 3WODF 4ZYAA 4RS8A 1QZZA 1O7LA 1XD7A 3S1RJ 2CW7A 2P5VA 3GZNB 4U0WA 3ERED 3BJ6A 1BJZA 1YO5C 2DT6A 2FBHA 2V6EA 4A3LJ 2R5ZA 3OV8A 3GYHX 1FX7A 3M4OJ 4OWRB 1L3LA 2L9RA 3HOUJ 5FJ8J 3G1LA 2A68F 2F48A 3W2VA 2GM4A 1ZG5A 4LLNA 1U2WA 4N0BA 3ZQHA 2RQQA 2ME6A 3RYPA 2CW8A 3KYCB 1IN4A 4DYCA 4E70A 5JLWA 4M3DA 2RREA 3GFLA 2KRFA 2VBWA 2VQCA 3ECOA 2PJRA 3OYNA 1NK2P 1YOVB 3HDDA 2W7NA 3IH2A 3GZ5A 3LSHA 4J01A 4PSXA 5ICCA 5TJJA 3M3YJ 1A6IA 3LSMA 4HBLA 1FEXA 1IDYA 4WXDA 2KL4A 2K3FA 5ED4A 3RPQA 3B73A 3H3ZA 5KCMA 2W57A 5HLIA 1WHUA 1WJBA 1YW7A 1TTYA 2CUEA 4LD5A 3K2ZA 2F5DA 2J5OA 3A1YA 3H5RA 4MIMA 2VQHA 5AIQA 5HNFA 4RB3C 3MEXA 4YFXF 3MKLA 3MKWB 3RTRA 1X19A 2XROA 2HYJA 2L5QA 3KEYA 3VB2A 1MNMC 3BG3A 1DGWY 3HG9A 3V4GA 1FMVA 1KGSA 2A5YB 3OOPA 5J40A 3E5XA 3T5XA 3OIQA 3K4NA 4U87A 5FLVA 2KZGA 4IVNA 5CPRB 2BHZA 4UNOA 2E36A 2PX9A 5EG0B 4YIIA 3T1BA 4BUPA 3LAJA 1VQ9I 4LFUA 2FOWA 5ILSA 4ESFA 2GIZA 2ME0A 2M8GX 4LLLA 1R71A 3GBGA 4FASD 3CJQB 1U5TC 2WAFA 1WQ2A 1XCVA 5J8CA 4BE1A 2CQXA 4XM3A 2KQRA 1W1WE 4DBQA 1DDNA 2GAUA 3KEOA 1I6XA 3WGHA 5IPAA 3LAPA 2HS5A 5CQEA 1X3ZB 3G73A 4Y33A 4DQ2A 3SZPA 1MJBA 2FE3A 1ETXA 1F1ZA 3REOA 3OSGA 4EJVA 1KQ0A 5L3CA 3ZMVA 5IY5H 3G3ZA 4F91B 3KYLA 4G12A 3L2QA 2DA4A 2BW3B 5ICFA 4F52A 4DOZA 3DBLB 3V8KA 3ROUA 3RI4A 1VF9A 3BQYA 2EFWA 3CP2A 2XGXA 5GAHJ 4LOCA 1UHWA 5M3FJ 4D5CA 1WPKA 2ZNZA 2R7QA 4I7HA 4Y7NJ 1IG7A 4FETA 1WH5A 2NAZA 2LSOA 2VPRA 1YQAA 3OYCA 2LF8A 4BAYA 3NARA 4Y15A 1FC3A 2DXIA 3FISA 1XSXA 4E7KA 1ZH5A 2EK5A 2JRMA 4D7MA 2WY7Q 1IAWA 1TC3C 5GPCA 2XC7A 1YIOA 5EYRA 3CC4I 2QKLB 2FQ3A 4M3BA 2K02A 3FK7A 3HOYJ 2BHYA 4P9FA 4R1HA 5AONA 3F0CA 3PJRA 2E1NA 2CMPA 3TBIA 3ZMUA 2IGMA 1TNTA 3JRFA 4ANJA 4OIPF 3CJNA 4W97A 2FMYA 3M7GA 4F55A 1XTAA 4WWCA 1O3TA 3GLLA 2ZJ2A 3K4MA 1MIJA 2HPMA 2HDWA 5F0HA 2M1BA 5KVRA 3S15J 2IS4A 2OAZA 2H6CA 3R60A 3SDGA 5EGOB 1HKQA 2AQFA 4MQ9F 1AHDP 4RGXA 2CQ7A 2FD5A 5J47A 2R7XA 1Z21A 3TO9A 2YR2A 3TGNA 4UUSB 4CZZA 1FYKA 1J09A 2V7FA 3CUQC 4GXOA 2LG4A 2ZBKA 4A69C 2IGKA 4BE0A 3F6OA 3W2WA 3HHGA 1BL0A 2K85A 4A12A 3ZQGA 1YI2I 4JBAA 4JK1X 3K4BA 4LJZF 4I02A 3KZYA 1K61A 1JUSA 3JW4A 3PFYA 1AKHB 4MTEA 4XKCA 1FBQA 3JRAA 1WVRA 1T8IA 4HX7A 2IRFG 4G7HF 3K1PA 2W84A 4CSWA 4KITB 4LITA 2VJ4A 2WAQA 3VYTB 5F04A 3KEQA 5CVRA 1JJ6C 1FP1D 1SD4A 2X6YA 2VQGA 3HGYA 2OPTA 2G7HA 2R7WA 1BM9A 4WXCA 1PUEE 1RETA 4I09A 2LY2A 1W7PD 3ABMH 4V2FA 3RJPA 2GXAA 2HDDA 2X1DA 1EV7A 4B43A 4M9XA 5ERIA 3RPUD 3VEPA 4EMSA 4NB5A 4C2MJ 3B6AA 4LK0F 5F6FA 3C2BA 3AL0C 1U6GA 1HOMA 2DO7A 1YHQI 4HF1A 2HOEA 4GRIA 4IF4A 5DCMA 4I98B 3OYAA 2JUCA 4XNFA 3PO3J 1AA7A 3QOEA 1IV8A 1Z1DA 2R7SA 1OCTC 3QRFF 5J8FA 2Y0MA 5D5UB 1F36A 4NDLA 1K4TA 3NRVA 2O8KA 2BW3A 3UR3C 2K9QA 2NVYJ 5DTDA 2WA0A 2B9SA 1IXCA 1MBEA 5BQTA 3G4SI 1HF0A 1D3YA 2P5KA 3OL3A 2OC6A 4LK1F 1MZBA 3LOCA 2EA2A 4IOCF 1R49A 2PI0A 3FZVA 1GUUA 1SFEA 3S17J 3S1QJ 5CVJA 3OYEA 2BXYA 4RBOA 1K7AA 1P6RA 2YU3A 1T95A 4N4OB 1UJ8A 2ECCA 1IJWC 4V19K 5D5XB 3J81Z 3RSNA 1FZPB 3KFWX 2FNPA 4BEHA 2GOMA 1YX5A 1SFUA 1FSHA 3B02A 1ETOA 4B3AA 1R1TA 1UB9A 3ERMA 4NHJA 3HXLA 3ZN1A 3SHFA 1WH7A 1WJ5A 2DLLA 2BY1A 1OQYA 5J6XA 4ZDOA 3KZZA 5E8IA 2A6TA 2EZIA 2QZ8A 4GGGA 3U1DA 4AVPA 5K5QA 3GMEA 2CFOA 4S0HB 3WU0A 2M34A 1OCOH 4BDYA 1W0TA 2XPVA 1HDDC 4HX8A 2BEOA 3SEZA 4L9VA 4RAYA 2HYFA 2E71A 3KYDB 1G3TA 1ZRDA 2JN6A 1IXRC 5EZHA 2R92J 2L7ZA 2Y9YA 3DCFA 3JTHA 3P9IA 4XOPA 5FKLA 3BOQA 2ZJPF 4FX4A 1ORKA 2HI3A 1R9TJ 3QPTA 2L7FP 2FNAA 2RV8A 3BPXA 5IP7J 2ELHA 1QVTA 2M5WA 2ID6A 1ZREA 3H92A 1YRNA 2ZKZA 3I59B 5TGTA 2DQRA 1MBKA 4A3JJ 2YX4A 4W1UA 2VLAA 2KP6A 2A6HF 2VQLA 2IT0A 4YRVA 4QSHA 1WJAA 1BOBA 2KDZA 3FBIB 1KYZA 1LUJB 1TZLA 2DA7A 5J1YA 4UUSA 5CJ9A 3C3WA 4Y17A 1H89C 3W3CA 2QKMB 2E60A 3M9AA 1R1UA 5DYMA 1T0FA 2VPLA 2VUMJ 1R5GA 2L9SA 4MFDA 1Z67A 3PSIA 3I53A 1YX3A 4RM2A 1A31A 2Y2ZA 2GIVA 3CTAA 3IP4B 5KAFC 1E2XA 3M8EA 1TWCJ 4A3CJ 4P5OA 2H8RA 2JMWA 1E17A 2CUFA 3ZMZA 1E3HA 1G3WA 5IT3A 2XIGA 3LA2A 3SFIA 3FXLA 3CCSI 4XSZF 5HLGA 1DP7P 2ZMEA 3QPHA 3K70C 4OAZA 1D1BA 1R5HA 2BYVE 3FHZA 1W7PA 4CCOA 1FBSA 2EB7A 1Z6TA 2FQ4A 3RPUA 3JCUC 3M07A 3MKYB 3S3OA 2LK2A 2ZSIB 1BBYA 3MVPA 4EM0B 2YU9J 2FJ1A 2O6GE 1T38A 5EZGA 1SVMA 4OOIA 5ILVA 5B5EC 3WTYC 1S29A 3BR5A 2IS6A 3M1CA 3NWTA 2L54A 2PBIA 1FTTA 2AO9A 2EPFA 1NH3A 4TV7A 1RC9A 5HNHA 4HZFA 4LLGF 1IRFA 1XSVA 1ZG3A 3BP8A 1Z9CA 3IWZA 3LMMA 3HZJA 5FLXZ 3PIOF 3EUHA 4KICA 4XLHA 5BPIA 3TP3A 2HPIA 3FBNB 4ZDLA 3C1DA 4CCNA 2O7OA 2FXAA 4IL6C 1HC8A 4D5FA 4ABZA 2YUSA 2FUG2 3W6KB 1T08B 3A01B 1V4RA 4AIJA 4M9ZA 4XKVA 1QNTA 3ZP5A 3FXOA 4HLXA 4S05A 5ILUA 3L1PA 4NQWB 4H4KC 1HSTA 3HL2A 2W85A 4R8HA 2R5YA 4XLCA 4S04A 3BR3A 3PNVA 3DKWA 1WCMJ 1APLC 1P92A 3WG7H 2Y69H 3S8PA 2Z1DA 1O7FA 4YELA 2LREA 4MO7A 3AFHA 1QZEA 4IRGA 4IOAF 5FKKA 2HR3A 3M1EA 2XGDA 4O5VA 3ZR8X 2V9KA 1R00A 3HTSB 1IUFA 1D1AA 4EJTA 2M0CA 2IXSA 2X0LA 3HRUA 1P9QC 2FA5A 3COAC 4F7ZA 2ACJA 2EV5A 3H9QA 5E3NA 2JPCA 1E3PA 1VQMI 1TQPA 2ADUA 4K2EA 1YJNI 3HPGA 2VE9A 2VE8A 3WE2A 1Y8RB 2CUJA 3IV5A 4RMNA 4A3KJ 3EQLF 1JKQC 1VQLI 4ZTJA 2EILH 4UHTA 5TRDA 1T2KA 1RUOA 1UMQA 3CO7C 1FLIA 3AL0B 2QF7A 4PGGA 4XLFA 1TQIA 2QQBA 5KAIC 3VOEA 1H9GA 1G3YA 2KKOA 3HUGA 4O6JA 1ZQ3P 3BWGA 1JE8A 1HW2A 2F6CA 3LFKA 4CHUA 3JSOA 2Y9ZA 2L9NA 5DEQA 3KETA 2OCCH 2DPDA 1RKWA 3E6MA 2QA4I 1QVUA 2E7XA 1BJAA 3IHUA 4MLOA 3HOTA 1YJ9I 3SJMA 1GVDA 3D5RC 2M4GA 1R1VA 2AXLA 2W82A 1Z91A 2HFHA 3GVAA 4LIVA 3P9CA 4A3GJ 1KU2A 3O3KA 4UB6C 5EF6A 1UAAA 4IXAA 3TO7A 4JX4A 5F1RA 3GTPJ 3SYTA 1MDMA 3EPZA 1A36A 4BY1J 3VYSB 1IUYA 1GHCA 2HYGD 3WTUC 2CQNA 1W5TA 2BGCA 1YS6A 3E5QA 3ZMSA 2DK8A 3HKZN 1X4PA 3MKZA 3FMSA 2KZVA 2Y31A 4B4CA 1ETQA 2Q0OA 2RGVA 3W6VA 2JRTA 1AU7A 5LGTA 1LNWA 3GUDA 4DYQA 2DMUA 2XRLA 1J7KA 2ZB9A 3GTKJ 1FOXA 3RKQA 4CA0A 2X51A 3C2GA 5H6QA 3H9JA 2HEOA 2R7FA 1H8AC 2KRCA 3WHCA 4D1QA 2QBYA 2K4JA 2X6OA 4EM1A 3GO5A 2RNJA 3GEZA 2XF7A 3DEEA 3DPUA 2E1MB 3DEWA 1BI0A 4KA4A 2LP0A 3IL2A 2P8TA 2ELJA 3EUKL 4FISA 3MCZA 5K7FA 1R4NB 4IRIA 2OA4A 3V42A 1ONVA 5E8GA 3R0AA 1SMTA 5D4SA 3D5LA 2LOOA 3OMYA 1PVEA 1HCRA 1T0FC 1B9MA 4BE2A 3HEFA 4RGSA 2VXDA 2LH9A 1D0ZA 4HYEA 1XCBA 5JHUA 3ISPA 5M5WJ 4XRSA 4GO1A 4IHVA 2GWRA 5FFZA 2DMQA 1BW6A 2RKHA 1R23A 5LHGA 3I71A 2GZWA 4EJOA 4BL0B 3TP0A 1ZYRF 2P6TA 3CC7I 4I76A 1I27A 2L02A 2FBKA 4EM2A 2ZMEC 2OUMA 4G9YA 3RKXA 4HF2A 4D9JA 3QYBA 4BBRJ 2WC2A 3KP7A 5D8KB 1BIBA 4N9IA 1QBJA 1J5YA 2VOOA 3K6GA 3FF5A 5LHHA 3KP3A 4ZYDA 3J81K 2R7ZJ 3Q9SA 1T33A 2G0EA 5EEHA 1ERDA 2H27A 2STTA 3OIPA 2CS3A 3LFUA 1RKTA 1VI0A 2MSYA 1WSUA 3A03A 4AD9A 3E3VA 3ZQQA 3NAUA 5DDGA 5FD6A 5A2QZ 3A2KA 1NK3P 4QTRA 2XAGA 1UG2A 4G6QA 3F8BA 2P7VB 4KFCA 2DYRH 2QCOA 4HX4A 4AIKA 5EDNA 1LFPA 4DGWB 2OF7A 3ECHA 5CVIA 4MNUA 3EUHC 3RIRA 4A3EJ 3Q0UA 4QPQA 5JLXA 4AUXA 2EFOA 4CCKA 3QU3A 4JX5A 2ETHA 4M6YA 3HYIA 1X1AA 3N4MA 2NNYA 1X3WB 2DA1A 2YSRA 2M0MA 3WTXC 4UVCA 3WTWC 4HNVA 3HRSA 3ZCOA 1IXSB 3LQQA 4NUBA 4PJ0C 3GTMJ 4I99C 2LF7A 4B44A 1G2HA 2ZXIA 3ZQCA 4PK4A 3P5JA 3BZKA 2ZCWA 3V7RA 3SZGA 4WXHA 1TT5B 4HPQA 1ETVA 2EH3A 2K4BA 2IA1A 3M8JA 1ZR4A 1OLTA 2J5PA 1LFBA 3GWZA 3KPHA 3JRGA 4KMFA 3BG7A 1W36C 3OSFA 1OCZH 1EH8A 4RB1A 2QUFA 4CO8A 2O3FA 1MH3A 2EFQA 2ZXJA 3MZ8A 4L5IA 1FOYA 4II3A 4U0YA 2LR8A 1JUPA 4CUGA 4ZZDA 4XICA 2PG4A 4O3MA 3WTTC 2R7VA 4PUSA 4EQQA 2EV6A 1QRYA 4CDGA 4ZDPA 3F72A 4WX9A 2EIKH 1YS7A 3Q9VA 3ZRGA 1TP4A 1BW5A 3PFIA 1R36A 1HLVA 4MEXF 1OFCX 4KN4X 4EV0A 3WGGA 2QYOA 1ACIA 2I8DA 2WWYA 2UZKA 3LSJA 1HW1A 1MKMA 3N97A 5HOOA 4D7NA 2E2HJ 1OR7C 2CV1A 1G3SA 5E1ZB 2HOAA 1XG1A 3G1MA 2HWVA 3I55I 2EBIA 4Q47A
chains in the Genus database with same CATH topology
4CH7A 5LFAA 2R7SA 3W2AA 1MW7A 3K4LA 2BVLA 3K4CA 4PJMA 4AU7A 1V5EA 3VWBA 3K10A 2PMZA 2VKDA 2BW3A 2X1EA 3UR3C 4HNTA 2WA0A 4B47A 1MMAA 2WADA 4IZZA 3OL3A 2OC6A 4J00A 3EUAA 4HEA2 2R7TA 3L2VA 3OYEA 3DTEA 4C2TA 2CV2A 2VJJA 2BOLA 4BJ6C 4XKBA 1WJCA 3HOSA 4HG2A 1T95A 4N4OB 4OAYA 3OYBA 4R79A 3RSNA 3OS0A 4RLQA 2Q2EB 4BEHA 2GOMA 1YX5A 3AKZA 3OYIA 3HXLA 2W00A 1WJ5A 4RM3A 4IKFA 3PSFA 2ZXHA 3A4CA 3CF2A 2LBFB 4ZDOA 3L2RA 2A6TA 4BJTA 2XSJC 2CFOA 5LD2C 1EA3A 4P1WA 4BDYA 2M4KA 4XR6A 3BCAA 3SEZA 2HNHA 3K70D 1E0EA 3DLAA 2DOAA 1MMDA 4XOPA 4ZTFA 2KPMA 1PYVA 1YE9A 4C9YA 4AVZA 2M3AA 2Q1ZB 2JVGA 2MC4A 2HQAA 2X6XA 3E1SA 4KJZA 3H35A 4JQFA 3OS1A 4G6TB 1IRXA 1G59A 2KMUA 5TGTA 2V26A 4F3QA 2CV0A 2VLAA 2KP6A 3ZGKA 2VQLA 4B48A 2K9MA 4E7SA 3H5NA 3OOUA 5FROA 2R7OA 3VYUB 1WJAA 1BOBA 4YRVA 3FBIB 1WJDA 1Y6IA 3RCOA 1TZLA 1JI8A 2DJIA 2QKMB 3W3CA 2E60A 1UG0A 1S9HA 1N77A 2VASA 2VPLA 1QHHD 2L9SA 3PSIA 4ZC3A 2X1CA 1YX3A 4RM2A 3ZXSA 4BQNA 4BJ5C 1HA8A 3IP4B 3DPLC 1BR4A 1DP3A 2WB1A 4P5OA 4NNJA 2UUZA 3BCBA 2X85A 2K5CA 2A5WA 3OR1C 3OYHA 2R4GA 3K70C 1V5FA 4OAZA 1D1BA 4RLFA 3L2UA 3KX2A 3H5AA 1MNDA 4CCOA 3BG6A 2M7BA 4HSTA 3OYJA 4BACA 3OS2A 3U21A 3BLYA 3MKYB 2DT7B 5JHFA 3S3OA 1Z7LA 2ZSIB 4ZJZA 3K4JA 2VL8A 3C2HA 3LSKA 2KRHA 3DU5A 3S93A 4BGDA 5KNLA 1PJRA 5CKTA 2CH0A 1DQUA 4E4HA 1X1BA 2IS6A 3OWTA 3I3LA 1SAUA 3DWLE 3M1CA 3NWTA 3CP8A 4XMYA 1FMWA 1N78A 5HNHA 1U0JA 1Z3YA 4E7ZA 1D0YA 3LMMA 1ZELA 2HVQA 3OY9A 4XLHA 5HVQC 2HPIA 3FBNB 4ZDLA 3CZ6A 2OV7A 1D1CA 3L2WA 4E7JA 3PNYA 4CCNA 4C2UA 3TL4X 3D5SC 1MNEA 2V4JC 4CCMA 3LSIA 2VJ5A 4Y3OA 2UWMA 5KHDA 1WJFA 3OYKA 3QYFA 2FUG2 2XDVA 3VSKA 4F93B 3CESA 3DKYA 3IAS2 4BQOA 3HKZA 4XKVA 1G8XA 2MD0A 4ITVA 1K6YA 3S3MA 1SFKA 2Y0SA 4LG3A 4ZYAA 2VB6A 4NQWB 4H4KC 4PFPA 5HLTA 3HL2A 2L7KA 2CW7A 1V5GA 2HVRA 2MYSA 4XLCA 3PNVA 3F9KA 4YEJA 2NOJB 4BEHB 1WFXA 2DT6A 2Z1DA 3S8PA 1Y56A 2V6EA 4YELA 2LREA 3AFHA 4OWRB 2LC2A 3ZR8X 2V9KA 1D1AA 3W2VA 2IS2A 2IXSA 2L2OA 2RQQA 1P9QC 2CW8A 4II2A 4N4NB 4XLEA 3H9QA 2RREA 2ZSHB 2VIXA 4CCJA 3OYLA 2VQCA 4KT6A 5FRMA 2PJRA 3OYNA 3QYEA 3HPGA 5CQGA 4PJLA 4E6KG 1QHGA 2W7NA 3OYFA 3LSHA 4J01A 4PSXA 3FKJA 1DGRM 4BXFA 2CUJA 2E5ZA 3LSMA 4RMNA 4XONA 4XORA 3VSLA 2MABA 1X1DA 4ZTJA 3CJRB 2KL4A 3IUOA 4BDZA 1VZ0A 3AL0B 2E5NA 5KCMA 3SEQA 4XLFA 1WJBA 3HC7A 5FRNA 3A1YA 3H5RA 3HPHA 2VQHA 5HNFA 2F6CA 2R7UA 2VXZA 2L9NA 3MKWB 4IQ4A 1KONA 1X19A 3RTRA 4HRIA 2L5QA 3KEYA 4XKWA 3UNGC 4MLOA 4PJJA 2W1OA 3HOTA 1DGWY 3HG9A 1FMVA 3D5RC 2M4GA 2HZDA 4U7BA 2W82A 3OIQA 3K4NA 3MMYB 4U87A 4LIVA 5CPRB 1X1CA 3OYMA 4BS9A 1UAAA 4BUPA 2KDOA 1QU3A 2JUGA 4HNUA 3SYTA 3EPZA 3NWSA 3OYDA 3RQ4A 3VYSB 3DTKA 3QODA 3GBGA 4FASD 4IX7A 3CJQB 2LY1A 2M7AA 2WAFA 1X4PA 3MKZA 2WBMA 2KZVA 4BE1A 2LRDA 4XM3A 4LIUA 2KQRA 4DBQA 3FHNA 2BVMA 3K4KA 4DJAA 3S3NA 3TMOA 5CQEA 4CA0A 2X51A 3C2GA 3OL4A 4XN0A 3H9JA 4Y33A 2KRCA 4D1QA 1N75A 2XF7A 3DEEA 3CMMA 4XOTA 3DPUA 2E1MB 2RNGA 4B3XA 2O5RA 2ELJA 4F91B 3EUKL 4HSRA 3KYLA 2K3PA 2JVHA 4C30A 3L2QA 2BW3B 4F52A 3V42A 4DOZA 2GOXB 1MMGA 4E7HA 2UV1A 3D5LA 2LOOA 3OMYA 2AQEA 3CP2A 3IAM2 1T0FC 4BE2A 2VXDA 3I9V2 2LH9A 1D0ZA 1BR1A 4XL9A 2R7QA 1LDKB 4EATA 2W4SA 3PNTA 3G2BA 2Z16A 3H9GA 4FETA 2F5VA 1NG6A 2XF5A 3OYCA 4CCLA 3DPTA 2JA2A 4BL0B 2JSPA 4XQFA 2DXIA 2LBFA 4E7KA 1LVKA 2WY7Q 4BU2A 2OUMA 4Y4RA 3VYRB 2XC7A 4D9JA 3LSGA 2WAEA 4XN3A 3QYBA 2QKLB 1W36D 3PUBA 4E7LA 4NC8A 3K6GA 2F4IA 4X0GA 3H0DA 3PJRA 2CMPA 3TBIA 2IGMA 4ANJA 3OR2C 3OYGA 3BC8A 4BQQA 1ERDA 3VDXA 1WJEA 2P0WA 1LKXA 4XLAA 4F55A 3OIPA 2CS3A 3LFUA 3ZQQA 3A2KA 3K4MA 1NG7A 1Z3XA 2E1MC 2HU9A 2HDWA 1X4OA 2HPMA 4PFOA 2IS4A 4F92B 3MD2A 2IGOA 2KHMA 2XAUA 2PJRB 1LFPA 4DGWB 2AQFA 2VJIA 3EUHC 4E7IA 3FDYA 2CUZA 2MFZA 4DIQA 4QPQA 2R7XA 4CCKA 1Z21A 1X1AA 2K9LA 2M0MA 1J09A 2V7FA 2LG4A 3ZCOA 2IGKA 3DQVC 3E0JB 4NUBA 1TT0A 4BE0A 3W2WA 4B44A 2ZXIA 3HUGB 1GLNA 3K4BA 4NC7A 4PK4A 2IS1A 3PFYA 3SZGA 4CZCA 4HPQA 2X6WA 3M8JA 1OLTA 4XKCA 2WY8Q 4JOMA 3BG7A 1W36C 3S32A 1R6RA 3N05A 4KITB 4CSWA 2V1NA 4LITA 2VJ4A 2WAQA 4QPOA 3J7AY 3VYTB 1D0XA 3DKXA 2X6YA 4II3A 2Z2SB 2VQGA 4CUGA 2KLOA 2R7WA 3PL8A 4IQJA 4DBRA 2R7VA 4PUSA 2LY2A 4ZDPA 2ZFUA 2LYCA 2X1DA 2XF6A 4B43A 3RPUD 3ZRGA 3DTIA 4PJNA 3AL0C 3LL7A 2I8DA 3ONQA 1BR2A 1MMNA 3DU6A 4PSWA 2IGNA 5HOOA 2CV1A 1OR7C 2DCEA 4GRIA 2R7RA 3OYAA 1UELB 4XNFA 4KISA 4AYBA 1AA7A 2VKHA 3QOEA 3SDBA 2HVSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JVH A;  2WY7 Q;  2WY8 Q;  3D5S C;  2NOJ B;  3D5R C;  2GOX B;  2GOM A;  2JVG A; 
#chains in the Genus database with same CATH topology
 4M9S A;  2B0L A;  1MW7 A;  1B72 B;  2VKV A;  3K4C A;  4PJM A;  1V5E A;  2LNB A;  4EEF G;  2E2I J;  4BKX A;  2X1E A;  3CCJ I;  4HNT A;  2K27 A;  2OCE A;  2XPW A;  3D0S A;  1BA5 A;  3I4N J;  1Y39 A;  4CYC A;  4OIQ F;  4UV8 A;  5C4X J;  2WAD A;  4OIN F;  4AM3 A;  1ENH A;  3EUA A;  3M8F A;  1WZ2 A;  4HLY A;  3L2V A;  2IA0 A;  2VI6 A;  2PMH A;  1F5T A;  3ABL H;  2BOL A;  1ZG1 A;  4HG2 A;  1VQ7 I;  2ISZ A;  4OAY A;  5FLX K;  3GW2 A;  1I3Q J;  5DS9 A;  1P4W A;  1ETY A;  3OS0 A;  3CMY A;  1IGN A;  4RLQ A;  1USS A;  2Q2E B;  5F0F A;  5JR3 A;  4KMU X;  2D1V A;  2RQP A;  2Y75 A;  4UY8 I;  3OYI A;  1XPX A;  3LQR A;  4A3D J;  4RGU A;  4OIO F;  2W00 A;  4IKF A;  2ESN A;  2LLK A;  2ZXH A;  5B66 C;  2HOT A;  5B1B H;  1G6N A;  2LBF B;  1XGS A;  1ON1 A;  5HS9 A;  1U9N A;  3AG2 H;  5IP9 J;  3SFZ A;  4IEJ A;  1EA3 A;  5HS8 A;  1W0U A;  2M4K A;  2QQ9 A;  4XR6 A;  3BCA A;  1E0E A;  4PZJ A;  1OCC H;  2IPQ X;  2BY0 A;  1TQM A;  2Y30 A;  2DDB A;  2MC3 A;  3R0J A;  2XKP A;  2H1L A;  3SQN A;  1ZLK A;  1YE9 A;  1QQI A;  2JVG A;  2HQA A;  3E1S A;  4ENM A;  4KJZ A;  3JRB A;  1VQK I;  4G6T B;  1IRX A;  1JHF A;  1G59 A;  3QAH A;  4XRM A;  1P4X A;  1B8I B;  1ZN2 A;  2DMP A;  3PM1 A;  2CU7 A;  3ZGK A;  2UXX A;  2QWW A;  2VC1 A;  4E7S A;  2HQ5 A;  3H5N A;  3OOU A;  2R7O A;  3VYU B;  1R5I D;  3O2P E;  3WE3 A;  1BI1 A;  3RCO A;  2E1O A;  2ZO4 A;  3ASN H;  3S2D J;  5CLS A;  3TQN A;  2F2E A;  2KIU A;  5L3F A;  1KYW A;  1JI8 A;  2KJC A;  4WK8 F;  1YG2 A;  2DU9 A;  2GQQ A;  3HBL A;  2JK3 A;  4DNC A;  3FMR A;  1XC5 A;  2COB A;  2XB0 X;  4ASN A;  1N77 A;  5LEJ A;  1XN7 A;  3FWE A;  2YX7 A;  1SAX A;  3HIF A;  1Y1V J;  1UHS A;  2IBD A;  4XRF A;  5EG0 A;  4HV6 A;  2ZFW A;  2VN2 A;  5FD5 A;  3F3X A;  1PUF B;  3DPL C;  3J7Y J;  2PMZ N;  2W48 A;  4GYG A;  1IN7 A;  2UUZ A;  2HXI A;  1XSD A;  3ABU A;  2CGP A;  2MGQ A;  2R4G A;  3CCQ I;  4ZH4 F;  2CWE A;  4FCY A;  3P7N A;  1AWC A;  5K7H A;  4RLF A;  4D0P A;  2NVT J;  1MND A;  1YTY A;  3BG6 A;  4L5J A;  2M7B A;  4HST A;  3OYJ A;  5BOX A;  3OS2 A;  2VT2 A;  1GT0 C;  2DT7 B;  1S72 I;  4ZJZ A;  3CLQ A;  1IZ1 A;  2VL8 A;  3TW6 A;  3OIO A;  4FX0 A;  4BY7 J;  1RR8 C;  1WWX A;  3C2H A;  3FM3 A;  1S7E A;  3LSK A;  2KRH A;  5LGU A;  3ABT A;  4U7D A;  2CYY A;  2DFH A;  2ISY A;  2QSF X;  4BGD A;  1VND A;  3S1M J;  5GTH C;  2OZU A;  3CCR I;  2CJJ A;  1SAU A;  5CVV A;  2GLO A;  1XGM A;  3KCC A;  1LPQ A;  2PLY A;  1Z6R A;  1FMW A;  5HDN A;  2EQR A;  1MBH A;  4OU0 A;  2V6C A;  1R4M B;  3S16 J;  1U0J A;  4E7Z A;  4Y52 J;  4BNC A;  4P96 A;  1ZEL A;  1ZGW A;  3BR2 A;  5E20 A;  3BJO A;  3WU1 B;  2MG4 A;  5D6F A;  2OV7 A;  1IN6 A;  3KLO A;  2DA3 A;  1ZAR A;  2RN7 A;  3V7S A;  1MNE A;  4L9N A;  4CCM A;  3CCU I;  5DUI A;  3JRI A;  2UWM A;  5BNG A;  5E17 F;  1WJF A;  1OCR H;  3OYK A;  2XDV A;  3F8F A;  2FU4 A;  1XMX A;  3DKY A;  1GXP A;  1DU0 A;  3H3V K;  4KIB A;  2V1D A;  3HKZ A;  3HOW J;  1H9T A;  1K78 B;  3ZMD A;  2DPU A;  3TOA A;  1ZRF A;  3J80 Z;  1T6S A;  4LG3 A;  4PCQ A;  2DFF A;  2NXN B;  2VB6 A;  4PFP A;  1OCP A;  1WKM A;  2MYS A;  4G94 A;  3F9K A;  1LB2 A;  4RB2 C;  4YEJ A;  2M8E A;  1WFX A;  2XV4 S;  2COM A;  1Y56 A;  4ON0 A;  5HOD A;  4BYY A;  3K2A A;  4HV5 A;  5K5O A;  1QPI A;  2MH9 A;  2LC2 A;  5AIP A;  2ZNY A;  2GXB A;  1Z0X A;  3JRE A;  3Q0V A;  5LRR A;  4HQE A;  2GXG A;  2TCT A;  4U88 A;  4N4N B;  2WB1 N;  2LKX A;  4XLE A;  4GFB A;  1A6Q A;  1U5T B;  1I5Z A;  2VIX A;  4CCJ A;  3OYL A;  1JKR C;  4KT6 A;  1EKE A;  1YJW I;  3QYE A;  1TBX A;  5EGO A;  4PJL A;  4E6K G;  2VC0 A;  3OYF A;  3K9T A;  2M2E A;  1ZLJ A;  1DGR M;  4BXF A;  4YFN F;  2E5Z A;  3LNQ A;  3VSL A;  1X1D A;  2MAB A;  4OIR F;  4I0B A;  3W6J B;  2RDP A;  3IUO A;  5GTI C;  4BDZ A;  3DLL F;  3R61 A;  1Z77 A;  3FX3 A;  4KNY A;  5FKM A;  4UV9 A;  2O61 A;  1BIA A;  3HC7 A;  1Y1W J;  2QQ8 A;  5FRN A;  3DF8 A;  3G1O A;  1AKH A;  3HPH A;  2IAI A;  1RZ4 A;  3DBH B;  3KZI C;  5A2Q K;  1F9N A;  2XPU A;  3BTI A;  5L3B A;  1ODD A;  2VBX A;  2R7U A;  3EET A;  3BDD A;  1KON A;  4IQ4 A;  4MGR A;  3JAM Z;  1HQC A;  4XKW A;  3UNG C;  1IDZ A;  2JA5 J;  2W1O A;  3E6B A;  2PFB A;  5EJC A;  1I50 J;  4G6D A;  2HZD A;  2ZJR F;  3CCE I;  1X2M A;  1HKS A;  4U7B A;  1QA6 A;  2W24 A;  3GTL J;  5E3M A;  1D8J A;  2VOD A;  4PDK A;  1X1C A;  3OYM A;  4Y13 A;  4A0Y A;  2KDO A;  4KT5 C;  1FIA A;  1U3E M;  1QU3 A;  2PQ8 A;  3GFI A;  3BZC A;  5DCF A;  5D8L B;  3RKW A;  4FQG A;  2JPB A;  3DTK A;  2BZT A;  5E79 C;  2M87 A;  3GFJ A;  2EFP A;  2LKS A;  1M1E B;  2EZH A;  1IC8 A;  3DXJ F;  2LY1 A;  2M7A A;  2KT0 A;  1JKP C;  1ETW A;  5LBQ A;  3GTJ J;  5KK1 A;  5IOZ A;  1VQ5 I;  1KA8 A;  4LIU A;  3GTG J;  3FXM A;  2Y0S N;  1Q1V A;  1BN5 A;  4GDF A;  3RKY A;  1I1G A;  3GF2 A;  4XLN F;  4ZYG A;  2BVM A;  2PN6 A;  3TMO A;  5B1A H;  4XN0 A;  2F4O B;  2L9V A;  2XB5 A;  5M5Y J;  3FXQ A;  2K9N A;  3CMA I;  4KIF A;  2OQR A;  4CXF A;  2M9H A;  3CMM A;  4XOT A;  3JRH A;  2ECB A;  4CYD A;  2RNG A;  2LDU A;  2O5R A;  1POG A;  2FEZ A;  2K9S A;  4HSR A;  2JVH A;  4JX6 A;  4FE7 A;  2EJR A;  2GOX B;  1MMG A;  4EJW A;  2Z3Y A;  1GV5 A;  2DTZ A;  1YIT I;  2UV1 A;  2IEK A;  1VQN I;  1D8K A;  4RB0 A;  5D5W B;  3CDH A;  4Z6Y A;  1XDS A;  4XL9 A;  2H6B A;  2W4S A;  4GCV A;  3G2B A;  3CUQ B;  2Z16 A;  2K40 A;  3H9G A;  3VFZ A;  2F5V A;  4AC0 A;  1NG6 A;  1QPM A;  1DPR A;  5F64 A;  2CRG A;  4RAZ A;  3HM5 A;  4BBS J;  4BXU A;  2IP2 A;  3DV8 A;  3ZQ7 A;  2JA2 A;  2LFB A;  2O9L A;  2JSP A;  3QP5 A;  4XQF A;  2Z33 A;  1FYM A;  1S6L A;  1HXD A;  5GAD J;  1LVK A;  1CF7 B;  2MA3 A;  4BU2 A;  1R58 A;  1REP C;  1MMS A;  4Y4R A;  3VYR B;  4HF0 A;  3LSG A;  2WAE A;  4XN3 A;  3L2C A;  1PDN C;  3H1C A;  1VQO I;  1P7J A;  5GAE J;  3IRQ A;  2G9W A;  4NC8 A;  5J1U A;  4X0G A;  2DMN A;  3AG3 H;  1IRG A;  3LST A;  4A93 J;  2R5Z B;  4L18 B;  1BOA A;  3OYG A;  4UXN A;  5GP9 A;  3HOX J;  4BQQ A;  2XAQ A;  3VDX A;  1Y0U A;  3BTL A;  1UZC A;  4P9U A;  3BG9 A;  4J19 A;  1IRZ A;  3I59 A;  3WTV C;  2F4M B;  3TKY A;  4KUM A;  2VBY A;  3Q3S A;  2D5V A;  3F8N A;  2X4H A;  4PFO A;  2XAJ A;  2H94 A;  1RNL A;  2CG4 A;  2F5F A;  2XAU A;  2PJR B;  1QO0 D;  5DM7 F;  2ICW G;  3EDP A;  1EH6 A;  4ENK A;  1FIP A;  9ANT A;  3LSP A;  3FDY A;  2CUZ A;  2MFZ A;  3PQK A;  4L0Z B;  4WCG A;  5E3O A;  5E18 F;  3QWL A;  3ZOB A;  5IP6 A;  1KZH A;  4CIC A;  1O3R A;  4ZYH A;  4KN7 X;  3HSF A;  5F08 A;  5BPD A;  1O4X A;  1IO2 A;  1TT0 A;  3GFM A;  3KIO A;  2IS1 A;  4XK4 A;  1LEB A;  1G4D A;  1PP8 F;  1K4S A;  1ULY A;  1HSJ A;  1J9I A;  2XUB A;  1FSE A;  2P5L C;  3LA7 A;  3S32 A;  4A3M J;  2V1N A;  4DW6 A;  3J7A Y;  4UUT A;  5E1X A;  1D0X A;  1SVL A;  1J2X A;  3DKX A;  1XB4 A;  1SMY F;  2Z2S B;  5D4R A;  2DW4 A;  2R93 J;  1JTY A;  1JHH A;  2L4A A;  3PL8 A;  4IQJ A;  3LSR A;  1EJ9 A;  1XMA A;  1RPW A;  4N9H A;  1GVJ A;  4XSX F;  3IKV A;  1OYI A;  2VON A;  1B4A A;  3QQA A;  1IF1 A;  1LEA A;  3DTI A;  3GTO J;  1U9O A;  3IC7 A;  4PJN A;  1O3S A;  1FY7 A;  3KP5 A;  3LL7 A;  4RAG A;  5K5R A;  2B7E A;  2EIN H;  1MMN A;  3DU6 A;  4A2U A;  2JTV A;  3K1M A;  2A69 F;  2R0Q C;  2DCE A;  2EZK A;  3HRM A;  2STW A;  2BV6 A;  1ITY A;  2DJN A;  4FTH A;  4UVA A;  4CH7 A;  2XAS A;  5C44 J;  3W2A A;  2L4M A;  3BTC A;  2BVL A;  3BRO A;  1GDT A;  1SFX A;  2YS9 A;  3VWB A;  1I39 A;  1RES A;  2PMZ A;  3CDI A;  4HDU A;  2EIM H;  1OJL A;  3C18 A;  1MMA A;  4IHS A;  3A01 A;  3FK6 A;  4IZZ A;  2JSC A;  2B63 J;  3MFK A;  3CDL A;  4HEA 2;  2R7T A;  1LJ9 A;  1B6A A;  3ELK A;  4IPA A;  3JR9 A;  4C2T A;  2A3S A;  2VJJ A;  2CV2 A;  4BJ6 C;  2XSD C;  4IHX A;  4XKB A;  1WJC A;  2G7U A;  3HOS A;  3CUQ A;  1JXS A;  4NQW A;  3RQI A;  4EGY A;  2ESH A;  1SFO J;  5C4J J;  1I1S A;  4IJA A;  3GZ6 A;  4R79 A;  4X6A J;  1C0W A;  3ML6 A;  3T8T A;  1JGS A;  2Z99 A;  1MH4 A;  2CO5 A;  4U0V A;  5JI6 A;  1FT9 A;  2WTE A;  1O3Q A;  1YIJ I;  1YYV A;  4QWQ A;  3F8M A;  4ENN A;  1TWF J;  3I58 A;  1V3F A;  3PSF A;  3A4C A;  1ZR2 A;  3LA3 A;  3HTU A;  1EH7 A;  4DZP A;  2FOK A;  3L2R A;  3F22 A;  2XSJ C;  3A02 A;  4WF2 A;  5FLM J;  3CLO A;  3E97 A;  4G7Z F;  1B9N A;  3ZQL A;  1TWG J;  3L00 A;  5HS7 A;  3J80 K;  2HNH A;  3K70 D;  3CO6 C;  1I6H J;  2FF4 A;  4A3F J;  3DLA A;  2DOA A;  5FO5 A;  1ZHF A;  3QPS A;  1BI2 A;  1MMD A;  3TDU C;  2IW5 A;  3PUF A;  1J0R A;  3VOD A;  2Y48 A;  1FBU A;  4AVZ A;  2M45 A;  2MC4 A;  2E1C A;  2X6X A;  5B3S H;  2E35 A;  1XX5 A;  2DOE A;  1B59 A;  4JQF A;  4RAF A;  3DEU A;  2KMU A;  3CCV I;  1ETK A;  5H6R A;  3ABK H;  2H8W A;  1FPQ A;  2XVC A;  3CUO A;  3DFG A;  4B48 A;  3NQO A;  4XBF A;  1WJD A;  1Y6I A;  1P4A A;  2TRT A;  1WI3 A;  3KE2 A;  3NEU A;  2DJI A;  1S9H A;  1KU7 A;  2IVM A;  2X9D A;  1HKT A;  4LB5 A;  3BY6 A;  4B1R A;  2VAS A;  2JQ7 A;  3G6E I;  3CCL I;  2MBF A;  4AYB N;  1SD7 A;  1WI9 A;  2QLZ A;  2F5E A;  2TDX A;  1Y8Q B;  4ZC3 A;  1HBX G;  1OMI A;  5LEK A;  3ZXS A;  4BQN A;  1MBJ A;  4BJ5 C;  3GX4 X;  4FE4 A;  1UCR A;  2I5U A;  2O8X A;  4YFK F;  5BMZ A;  1DP3 A;  4M6V A;  2WB1 A;  3JTG A;  2I10 A;  4NNJ A;  3A0B C;  3BCB A;  3GTQ J;  2X85 A;  2HQR A;  4C3J J;  2A5W A;  2HKX A;  2K5C A;  3BQZ A;  3OYH A;  1VQ8 I;  4M6X A;  1TLH B;  2DAO A;  1V5F A;  2DT5 A;  5TIS C;  3MZH A;  3KX2 A;  4M72 A;  3JAM K;  1N25 A;  4M3E A;  4BAC A;  3UKG A;  5M3M J;  1RR7 A;  2KIM A;  3HSR A;  3ZN0 A;  1Z7L A;  3E6C C;  4EVI A;  2K86 A;  2BY3 A;  3FXJ A;  1XGN A;  1BC7 C;  2NYX A;  2M30 A;  3O8H A;  4KDP A;  1PJR A;  5CKT A;  4FT8 A;  1MD0 A;  2A05 A;  4E4H A;  1LFU P;  1X58 A;  4BHB A;  3OWT A;  1IW7 F;  3I3L A;  1ON2 A;  4HOB A;  4L5E A;  5IYD J;  2WV1 A;  1OYY A;  4XMY A;  4MTD A;  4KYW A;  2XHK A;  3AG4 H;  3FXR A;  3MWM A;  3T8R A;  2OTL I;  2NNN A;  5DCM B;  2DBB A;  1D0Y A;  3FM5 A;  1DU6 A;  5E1W A;  2C6Y A;  2HVQ A;  4IHT A;  1O57 A;  1VFC A;  3MN2 A;  1D5V A;  3R6S A;  5HVQ C;  4QLC U;  1FJL A;  3FXU A;  4XLP F;  3CZ6 A;  1D1C A;  3L2W A;  4EJU A;  3PNY A;  4C2U A;  2LD5 A;  2X48 A;  3TL4 X;  3WTS C;  3F23 A;  1VTN C;  3GCM A;  1UHM A;  2V4J C;  1JKO C;  3S1N J;  5HLH A;  2VJ5 A;  4Y3O A;  2HVS A;  2PEX A;  2IJL A;  1ZKG A;  2XRN A;  5HDG A;  3AAF A;  1U8B A;  3VSK A;  4BHP A;  2VT3 A;  5CVU A;  3IAS 2;  1QZY A;  4M3F A;  2V79 A;  3F6V A;  3JRD A;  1G8X A;  3I54 A;  4LG0 B;  1Z05 A;  4ITV A;  1K6Y A;  1XMK A;  1F4K A;  2QSH X;  2Z5U A;  1SFK A;  2Y0S A;  2LY9 A;  2ZJQ F;  3EYI A;  5HLT A;  2L7K A;  3B6C A;  5J4V A;  2HVR A;  1V5G A;  2NS0 A;  5GPA A;  2DQL A;  2AHQ A;  2MD5 A;  1KQ9 A;  5IT9 Z;  1L0O C;  2NOJ B;  4BEH B;  2P81 A;  5L3D A;  5BS6 A;  3CD6 I;  4LB6 B;  3TO6 A;  1MBF A;  2E7W A;  2F5C A;  3QU6 A;  4NC6 A;  1K79 A;  4OMY A;  2DA5 A;  4HAM A;  4UB8 C;  3Q0W A;  4A5N A;  2IS2 A;  2L2O A;  4II2 A;  4XRS G;  2L0K A;  3TDZ C;  2ZSH B;  1JGG A;  2FX0 A;  3K0L A;  5IYC J;  3WU2 C;  2QEN A;  5FRM A;  3U2R A;  5CQG A;  4ETS A;  1IV6 A;  1QHG A;  1LDD A;  1MJA A;  4XID A;  2EIJ H;  3ZQI A;  3FKJ A;  2W25 A;  2NRA C;  1MJ9 A;  5H20 A;  2EFN A;  3E5U A;  2EWN A;  1LE8 B;  2FRH A;  4XON A;  2V9V A;  3CQZ J;  4XOR A;  5FFX A;  5JVT A;  4B09 A;  2CQQ A;  3CJR B;  4M73 A;  3PO2 J;  4ENJ A;  2DOD A;  1VZ0 A;  2E5N A;  1FTZ A;  3SEQ A;  2O03 A;  1GXQ A;  1YRN B;  3CC2 I;  3FIW A;  2E2J J;  2AS5 F;  5DD4 A;  3WG9 A;  4Q48 A;  5L3G A;  4BQA A;  1XS9 A;  1SAN A;  2VXZ A;  3F21 A;  3A0H C;  4HRI A;  2DTR A;  1NTC A;  4PJJ A;  2AXT C;  3ZQF A;  3CME I;  2JJ7 A;  1FP2 A;  1S8N A;  2V9P A;  3MMY B;  1TL8 A;  2DFE A;  4M71 A;  2L3D A;  1EF4 A;  2H1K A;  4BS9 A;  4M3G A;  3U9G A;  1UFM A;  4M74 A;  5J4Y A;  2D45 A;  3O6B B;  2JUG A;  4HNU A;  1WGX A;  3NWS A;  3OYD A;  2XGC A;  3L7W A;  3QPL A;  3RQ4 A;  3RYR A;  3QOD A;  2HKO A;  3G71 I;  2GBY A;  1CGP A;  1NHA A;  2HDC A;  4L0Y B;  2OD5 A;  2FML A;  2JZY A;  4IX7 A;  5FKO A;  3ZMT A;  1MSF C;  3BJA A;  3U1K A;  1VQP I;  2ZME B;  2R3S A;  2WBM A;  4LGW A;  2LRD A;  3TED A;  1W7P B;  4IHY A;  3CF5 F;  2GA2 A;  2KIS A;  2DMT A;  3MQ0 A;  3RZD J;  2BXZ A;  3FKI J;  1DPU A;  3FHN A;  4DJA A;  3DP7 A;  3K4K A;  2JA7 J;  2D1H A;  3WHB A;  3S3N A;  4BXX J;  1B72 A;  4MHG A;  3OL4 A;  2PMU A;  3O8G A;  5IYB J;  2HXO A;  1MGT A;  3BTJ A;  3MAJ A;  2GA1 A;  1N75 A;  2VBZ A;  5LLQ A;  1VQ4 I;  2OQG A;  4B3X A;  5ICG A;  3KP2 A;  3L9F A;  2QM3 A;  4A5M A;  1ZTR A;  2K3P A;  4C30 A;  1K83 J;  1J75 A;  1RRJ A;  4EGZ A;  4IHW A;  1D5Y A;  4E7H A;  4C3H J;  4P55 A;  2AQE A;  4A6E A;  3IAM 2;  3I64 A;  1RIO H;  3I9V 2;  1ZRC A;  1BR1 A;  2PJP A;  1LDK B;  4EAT A;  4A0Z A;  3I56 I;  2Q2E A;  3PNT A;  4L9T A;  2O0Y A;  4LG0 A;  3I4M J;  3I4P A;  4A6D A;  2XF5 A;  3QOP A;  2DK5 A;  2ID3 A;  2RC4 A;  4CCL A;  2MLK A;  3RZO J;  3DPT A;  1H0M A;  1JT6 A;  5F27 A;  1QGP A;  2R7D A;  2LBF A;  2E19 A;  2MLG A;  4Q4Z F;  2HTS A;  2CW0 F;  5H2F C;  4PGH A;  2FSW A;  1T39 A;  1ZK8 A;  4Z2Y A;  1B1B A;  4HA8 A;  1SD5 A;  1W36 D;  2R5Y B;  3PUB A;  4E7L A;  2LTP A;  3S2W A;  2OU2 A;  1Y0N A;  2NVQ J;  2F4I A;  3IWF A;  2KIF A;  3H0D A;  3E6D A;  3J7Z I;  2FBI A;  1WRJ A;  2EV0 A;  2A61 A;  3J7A O;  3OR2 C;  3BC8 A;  1J59 A;  2DI3 A;  3SZT A;  1WJE A;  4B8X A;  2P0W A;  1LKX A;  2EA4 A;  4XLA A;  1JJ8 C;  1XGO A;  1A35 A;  5LRS A;  1ZAO A;  4ESB A;  1B8I A;  1NG7 A;  3BPV A;  2XGE A;  1Z3X A;  2E1M C;  1X4O A;  2HU9 A;  1TW2 A;  3HHH A;  1TNS A;  2P6S A;  4F92 B;  3MD2 A;  1LE8 A;  3F8C A;  2IGO A;  2KHM A;  5JFR A;  2VJI A;  4AIH A;  2A07 F;  1X3U A;  3QP6 A;  5FKN A;  4E7I A;  4DIQ A;  1X1P A;  1KU9 A;  3SXY A;  2NS8 A;  3K69 A;  4MFE A;  2K9L A;  1JUM A;  2KIQ A;  1UST A;  3DQV C;  2JT1 A;  3E0J B;  1U78 A;  2QGU A;  1OPC A;  4G7O F;  1PUF A;  3HUG B;  1GLN A;  4NC7 A;  4I6Z A;  1R7J A;  4RA2 A;  3K1N A;  3LWF A;  4CZC A;  2LKP A;  2X6W A;  1SC7 A;  3IH3 A;  2VKE A;  2HTJ A;  2WY8 Q;  3HSE A;  4MQV A;  5FGM A;  3ESW B;  1FYL A;  4JOM A;  1SEU A;  1P2F A;  1STZ A;  1R6R A;  3N05 A;  2BY2 A;  4RDU A;  3S14 J;  1FOK A;  3EYY A;  3HRT A;  4QPO A;  4DYR A;  1X2N A;  3BG5 A;  5D5V B;  5DV5 A;  1SD6 A;  2DOF A;  1OYW A;  3Q5F A;  5M5X J;  4FHT A;  2KLO A;  2OBP A;  3DBR B;  2N8G A;  4KIG A;  1MDM B;  4DBR A;  2NVX J;  3CJT B;  2ZFU A;  2LYC A;  2XF6 A;  1P7I A;  1TWA J;  1RI7 A;  1IN5 A;  2HZT A;  3WTZ A;  5FB2 A;  2NS7 A;  4AID A;  1BI3 A;  3PQJ A;  3BR0 A;  3ONQ A;  1BR2 A;  4ESJ A;  5D6E A;  4HDV A;  2VKH A;  4PSW A;  4JYK A;  1VQ6 I;  2IGN A;  2MH2 A;  3IRR A;  1S7O A;  3V8J A;  2DFI A;  4IRH A;  4JP0 A;  5GAG J;  4NBQ A;  2R7R A;  1UEL B;  1YFH A;  5EEA A;  2K7L A;  4KIS A;  4AYB A;  1HW5 A;  2DDA A;  1MBG A;  1E3O C;  2RVC A;  3SDB A;  2V1U A;  5LFA A;  3KP4 A;  5K1Y A;  3K4L A;  3HJE A;  4AU7 A;  3JSP A;  3K10 A;  2QBY B;  1A5J A;  2VKD A;  4UUV A;  1LVA A;  1V55 H;  6PAX A;  2HOS A;  2WV0 A;  5F1J A;  4B47 A;  4DZJ A;  4J00 A;  3HGG A;  2DYS H;  2UXN A;  3VPR A;  2XAH A;  1K78 A;  1BC8 C;  2E34 A;  5L3E A;  1S7A A;  3DTE A;  3V8L A;  3TW7 A;  1RUN A;  2ZC2 A;  4A3B J;  1YLF A;  3I5U A;  1LQ1 A;  4IO9 F;  4C3I J;  1K6O A;  2P7C B;  1Q1H A;  4I2O A;  3OYB A;  4G8X A;  1JT0 A;  1A04 A;  4Q5S F;  2JWT A;  1PP7 U;  5HDK A;  2NVU B;  1S3J A;  3AKZ A;  4HQM A;  4YIF A;  2D2W A;  2LMD A;  4RM3 A;  1YW9 A;  3CF2 A;  4V2G A;  4BJT A;  2IA2 A;  5LD2 C;  1H88 C;  3CCM I;  1U5T A;  1I3A A;  4P1W A;  5DUK A;  4QIW N;  2OJE D;  3BT9 A;  3HB9 A;  3WGI A;  1W5S A;  2XAF A;  3HOV J;  3HOZ J;  2WAQ N;  2QEX I;  5LHI A;  4UVB A;  4ZTF A;  5IT9 K;  2KPM A;  1PYV A;  4YIR X;  4BH9 A;  4ZZL A;  2EZL A;  4C9Y A;  3AG1 H;  2M3A A;  2Q1Z B;  2DA6 A;  5EEG A;  3TOB A;  1U8R A;  3FMQ A;  2L7M P;  3H35 A;  3OS1 A;  2MW8 A;  1KQ8 A;  1CQT A;  2V26 A;  4F3Q A;  3X2Q H;  1OR7 A;  2ZXW H;  3V7C A;  2VOP A;  2CV0 A;  1V54 H;  3IH4 A;  2K9M A;  5FRO A;  2CQK A;  2CSO A;  1LDJ A;  1AOY A;  3H36 A;  4CGZ A;  1TWH J;  1MSE C;  1T56 A;  2QSG X;  1UG0 A;  2YPR A;  1FNN A;  4HW0 A;  1ZGJ A;  2A6E F;  5E3L A;  3T0Y A;  4A3I J;  1QHH D;  2KFD A;  3ZPL A;  2HQN A;  1SVO A;  2OTJ I;  4RGR A;  2X1C A;  1TW3 A;  1FOW A;  3JRC A;  2ELK A;  1OKR A;  3L09 A;  1HA8 A;  1XDU A;  1BR4 A;  4A0X A;  3I0T A;  2QVO A;  4I01 A;  2DA2 A;  4X1E A;  2Z9O A;  3OR1 C;  3ASO H;  2CFX A;  2H09 A;  3BR6 A;  3K7A J;  2XKO A;  4BHC A;  5DM6 F;  2V1X A;  3L2U A;  1GV2 A;  4H0E A;  4LMY A;  1Z7U A;  3H5A A;  5J3L A;  5C3E J;  3U21 A;  3BLY A;  5JVG F;  5JHF A;  3K4J A;  5CYV A;  2KJB A;  1KU3 A;  3BR1 A;  3DU5 A;  2L01 A;  5K7Z A;  4ZYE A;  3PIP F;  3FXK A;  1F43 A;  3S93 A;  1IN8 A;  5KNL A;  1T98 A;  2CH0 A;  4I0A A;  1DQU A;  3ULQ B;  1YW8 A;  2QQA A;  3BZ6 A;  3GXO A;  5F0C A;  5ICE A;  5LGN A;  2JA8 J;  1X1B A;  3C7J A;  1R22 A;  1HDP A;  1DUX C;  3DWL E;  3CP8 A;  1OIS A;  1N78 A;  5IOY A;  3P9K A;  2BE5 F;  4YG2 F;  4AWX B;  1W5C C;  1Z3Y A;  2DN0 A;  2JA6 J;  1W4M A;  2OZ6 A;  4GYI A;  3OY9 A;  3E7L A;  3KLN A;  2HGC A;  2Q8K A;  4E7J A;  1S5L C;  3MZY A;  3D5S C;  3LSI A;  2RAE A;  3GLX A;  5KHD A;  3IKT A;  3H3U A;  3QYF A;  4F93 B;  3RDI A;  3D1N I;  5DD8 A;  4MEY F;  4CYC B;  3CES A;  3R4K A;  4OMZ A;  3S2H J;  1FWZ A;  4BQO A;  1JTX A;  2BBY A;  3KP6 A;  2P4W A;  2LVS A;  2MD0 A;  3CCY A;  1CF7 A;  4L9J A;  1ZGA A;  3S3M A;  5J1R A;  2NOG A;  3H0G J;  3WOD F;  4ZYA A;  4RS8 A;  1QZZ A;  1O7L A;  1XD7 A;  3S1R J;  2CW7 A;  2P5V A;  3GZN B;  4U0W A;  3ERE D;  3BJ6 A;  1BJZ A;  1YO5 C;  2DT6 A;  2FBH A;  2V6E A;  4A3L J;  2R5Z A;  3OV8 A;  3GYH X;  1FX7 A;  3M4O J;  4OWR B;  1L3L A;  2L9R A;  3HOU J;  5FJ8 J;  3G1L A;  2A68 F;  2F48 A;  3W2V A;  2GM4 A;  1ZG5 A;  4LLN A;  1U2W A;  4N0B A;  3ZQH A;  2RQQ A;  2ME6 A;  3RYP A;  2CW8 A;  3KYC B;  1IN4 A;  4DYC A;  4E70 A;  5JLW A;  4M3D A;  2RRE A;  3GFL A;  2KRF A;  2VBW A;  2VQC A;  3ECO A;  2PJR A;  3OYN A;  1NK2 P;  1YOV B;  3HDD A;  2W7N A;  3IH2 A;  3GZ5 A;  3LSH A;  4J01 A;  4PSX A;  5ICC A;  5TJJ A;  3M3Y J;  1A6I A;  3LSM A;  4HBL A;  1FEX A;  1IDY A;  4WXD A;  2KL4 A;  2K3F A;  5ED4 A;  3RPQ A;  3B73 A;  3H3Z A;  5KCM A;  2W57 A;  5HLI A;  1WHU A;  1WJB A;  1YW7 A;  1TTY A;  2CUE A;  4LD5 A;  3K2Z A;  2F5D A;  2J5O A;  3A1Y A;  3H5R A;  4MIM A;  2VQH A;  5AIQ A;  5HNF A;  4RB3 C;  3MEX A;  4YFX F;  3MKL A;  3MKW B;  3RTR A;  1X19 A;  2XRO A;  2HYJ A;  2L5Q A;  3KEY A;  3VB2 A;  1MNM C;  3BG3 A;  1DGW Y;  3HG9 A;  3V4G A;  1FMV A;  1KGS A;  2A5Y B;  3OOP A;  5J40 A;  3E5X A;  3T5X A;  3OIQ A;  3K4N A;  4U87 A;  5FLV A;  2KZG A;  4IVN A;  5CPR B;  2BHZ A;  4UNO A;  2E36 A;  2PX9 A;  5EG0 B;  4YII A;  3T1B A;  4BUP A;  3LAJ A;  1VQ9 I;  4LFU A;  2FOW A;  5ILS A;  4ESF A;  2GIZ A;  2ME0 A;  2M8G X;  4LLL A;  1R71 A;  3GBG A;  4FAS D;  3CJQ B;  1U5T C;  2WAF A;  1WQ2 A;  1XCV A;  5J8C A;  4BE1 A;  2CQX A;  4XM3 A;  2KQR A;  1W1W E;  4DBQ A;  1DDN A;  2GAU A;  3KEO A;  1I6X A;  3WGH A;  5IPA A;  3LAP A;  2HS5 A;  5CQE A;  1X3Z B;  3G73 A;  4Y33 A;  4DQ2 A;  3SZP A;  1MJB A;  2FE3 A;  1ETX A;  1F1Z A;  3REO A;  3OSG A;  4EJV A;  1KQ0 A;  5L3C A;  3ZMV A;  5IY5 H;  3G3Z A;  4F91 B;  3KYL A;  4G12 A;  3L2Q A;  2DA4 A;  2BW3 B;  5ICF A;  4F52 A;  4DOZ A;  3DBL B;  3V8K A;  3ROU A;  3RI4 A;  1VF9 A;  3BQY A;  2EFW A;  3CP2 A;  2XGX A;  5GAH J;  4LOC A;  1UHW A;  5M3F J;  4D5C A;  1WPK A;  2ZNZ A;  2R7Q A;  4I7H A;  4Y7N J;  1IG7 A;  4FET A;  1WH5 A;  2NAZ A;  2LSO A;  2VPR A;  1YQA A;  3OYC A;  2LF8 A;  4BAY A;  3NAR A;  4Y15 A;  1FC3 A;  2DXI A;  3FIS A;  1XSX A;  4E7K A;  1ZH5 A;  2EK5 A;  2JRM A;  4D7M A;  2WY7 Q;  1IAW A;  1TC3 C;  5GPC A;  2XC7 A;  1YIO A;  5EYR A;  3CC4 I;  2QKL B;  2FQ3 A;  4M3B A;  2K02 A;  3FK7 A;  3HOY J;  2BHY A;  4P9F A;  4R1H A;  5AON A;  3F0C A;  3PJR A;  2E1N A;  2CMP A;  3TBI A;  3ZMU A;  2IGM A;  1TNT A;  3JRF A;  4ANJ A;  4OIP F;  3CJN A;  4W97 A;  2FMY A;  3M7G A;  4F55 A;  1XTA A;  4WWC A;  1O3T A;  3GLL A;  2ZJ2 A;  3K4M A;  1MIJ A;  2HPM A;  2HDW A;  5F0H A;  2M1B A;  5KVR A;  3S15 J;  2IS4 A;  2OAZ A;  2H6C A;  3R60 A;  3SDG A;  5EGO B;  1HKQ A;  2AQF A;  4MQ9 F;  1AHD P;  4RGX A;  2CQ7 A;  2FD5 A;  5J47 A;  2R7X A;  1Z21 A;  3TO9 A;  2YR2 A;  3TGN A;  4UUS B;  4CZZ A;  1FYK A;  1J09 A;  2V7F A;  3CUQ C;  4GXO A;  2LG4 A;  2ZBK A;  4A69 C;  2IGK A;  4BE0 A;  3F6O A;  3W2W A;  3HHG A;  1BL0 A;  2K85 A;  4A12 A;  3ZQG A;  1YI2 I;  4JBA A;  4JK1 X;  3K4B A;  4LJZ F;  4I02 A;  3KZY A;  1K61 A;  1JUS A;  3JW4 A;  3PFY A;  1AKH B;  4MTE A;  4XKC A;  1FBQ A;  3JRA A;  1WVR A;  1T8I A;  4HX7 A;  2IRF G;  4G7H F;  3K1P A;  2W84 A;  4CSW A;  4KIT B;  4LIT A;  2VJ4 A;  2WAQ A;  3VYT B;  5F04 A;  3KEQ A;  5CVR A;  1JJ6 C;  1FP1 D;  1SD4 A;  2X6Y A;  2VQG A;  3HGY A;  2OPT A;  2G7H A;  2R7W A;  1BM9 A;  4WXC A;  1PUE E;  1RET A;  4I09 A;  2LY2 A;  1W7P D;  3ABM H;  4V2F A;  3RJP A;  2GXA A;  2HDD A;  2X1D A;  1EV7 A;  4B43 A;  4M9X A;  5ERI A;  3RPU D;  3VEP A;  4EMS A;  4NB5 A;  4C2M J;  3B6A A;  4LK0 F;  5F6F A;  3C2B A;  3AL0 C;  1U6G A;  1HOM A;  2DO7 A;  1YHQ I;  4HF1 A;  2HOE A;  4GRI A;  4IF4 A;  5DCM A;  4I98 B;  3OYA A;  2JUC A;  4XNF A;  3PO3 J;  1AA7 A;  3QOE A;  1IV8 A;  1Z1D A;  2R7S A;  1OCT C;  3QRF F;  5J8F A;  2Y0M A;  5D5U B;  1F36 A;  4NDL A;  1K4T A;  3NRV A;  2O8K A;  2BW3 A;  3UR3 C;  2K9Q A;  2NVY J;  5DTD A;  2WA0 A;  2B9S A;  1IXC A;  1MBE A;  5BQT A;  3G4S I;  1HF0 A;  1D3Y A;  2P5K A;  3OL3 A;  2OC6 A;  4LK1 F;  1MZB A;  3LOC A;  2EA2 A;  4IOC F;  1R49 A;  2PI0 A;  3FZV A;  1GUU A;  1SFE A;  3S17 J;  3S1Q J;  5CVJ A;  3OYE A;  2BXY A;  4RBO A;  1K7A A;  1P6R A;  2YU3 A;  1T95 A;  4N4O B;  1UJ8 A;  2ECC A;  1IJW C;  4V19 K;  5D5X B;  3J81 Z;  3RSN A;  1FZP B;  3KFW X;  2FNP A;  4BEH A;  2GOM A;  1YX5 A;  1SFU A;  1FSH A;  3B02 A;  1ETO A;  4B3A A;  1R1T A;  1UB9 A;  3ERM A;  4NHJ A;  3HXL A;  3ZN1 A;  3SHF A;  1WH7 A;  1WJ5 A;  2DLL A;  2BY1 A;  1OQY A;  5J6X A;  4ZDO A;  3KZZ A;  5E8I A;  2A6T A;  2EZI A;  2QZ8 A;  4GGG A;  3U1D A;  4AVP A;  5K5Q A;  3GME A;  2CFO A;  4S0H B;  3WU0 A;  2M34 A;  1OCO H;  4BDY A;  1W0T A;  2XPV A;  1HDD C;  4HX8 A;  2BEO A;  3SEZ A;  4L9V A;  4RAY A;  2HYF A;  2E71 A;  3KYD B;  1G3T A;  1ZRD A;  2JN6 A;  1IXR C;  5EZH A;  2R92 J;  2L7Z A;  2Y9Y A;  3DCF A;  3JTH A;  3P9I A;  4XOP A;  5FKL A;  3BOQ A;  2ZJP F;  4FX4 A;  1ORK A;  2HI3 A;  1R9T J;  3QPT A;  2L7F P;  2FNA A;  2RV8 A;  3BPX A;  5IP7 J;  2ELH A;  1QVT A;  2M5W A;  2ID6 A;  1ZRE A;  3H92 A;  1YRN A;  2ZKZ A;  3I59 B;  5TGT A;  2DQR A;  1MBK A;  4A3J J;  2YX4 A;  4W1U A;  2VLA A;  2KP6 A;  2A6H F;  2VQL A;  2IT0 A;  4YRV A;  4QSH A;  1WJA A;  1BOB A;  2KDZ A;  3FBI B;  1KYZ A;  1LUJ B;  1TZL A;  2DA7 A;  5J1Y A;  4UUS A;  5CJ9 A;  3C3W A;  4Y17 A;  1H89 C;  3W3C A;  2QKM B;  2E60 A;  3M9A A;  1R1U A;  5DYM A;  1T0F A;  2VPL A;  2VUM J;  1R5G A;  2L9S A;  4MFD A;  1Z67 A;  3PSI A;  3I53 A;  1YX3 A;  4RM2 A;  1A31 A;  2Y2Z A;  2GIV A;  3CTA A;  3IP4 B;  5KAF C;  1E2X A;  3M8E A;  1TWC J;  4A3C J;  4P5O A;  2H8R A;  2JMW A;  1E17 A;  2CUF A;  3ZMZ A;  1E3H A;  1G3W A;  5IT3 A;  2XIG A;  3LA2 A;  3SFI A;  3FXL A;  3CCS I;  4XSZ F;  5HLG A;  1DP7 P;  2ZME A;  3QPH A;  3K70 C;  4OAZ A;  1D1B A;  1R5H A;  2BYV E;  3FHZ A;  1W7P A;  4CCO A;  1FBS A;  2EB7 A;  1Z6T A;  2FQ4 A;  3RPU A;  3JCU C;  3M07 A;  3MKY B;  3S3O A;  2LK2 A;  2ZSI B;  1BBY A;  3MVP A;  4EM0 B;  2YU9 J;  2FJ1 A;  2O6G E;  1T38 A;  5EZG A;  1SVM A;  4OOI A;  5ILV A;  5B5E C;  3WTY C;  1S29 A;  3BR5 A;  2IS6 A;  3M1C A;  3NWT A;  2L54 A;  2PBI A;  1FTT A;  2AO9 A;  2EPF A;  1NH3 A;  4TV7 A;  1RC9 A;  5HNH A;  4HZF A;  4LLG F;  1IRF A;  1XSV A;  1ZG3 A;  3BP8 A;  1Z9C A;  3IWZ A;  3LMM A;  3HZJ A;  5FLX Z;  3PIO F;  3EUH A;  4KIC A;  4XLH A;  5BPI A;  3TP3 A;  2HPI A;  3FBN B;  4ZDL A;  3C1D A;  4CCN A;  2O7O A;  2FXA A;  4IL6 C;  1HC8 A;  4D5F A;  4ABZ A;  2YUS A;  2FUG 2;  3W6K B;  1T08 B;  3A01 B;  1V4R A;  4AIJ A;  4M9Z A;  4XKV A;  1QNT A;  3ZP5 A;  3FXO A;  4HLX A;  4S05 A;  5ILU A;  3L1P A;  4NQW B;  4H4K C;  1HST A;  3HL2 A;  2W85 A;  4R8H A;  2R5Y A;  4XLC A;  4S04 A;  3BR3 A;  3PNV A;  3DKW A;  1WCM J;  1APL C;  1P92 A;  3WG7 H;  2Y69 H;  3S8P A;  2Z1D A;  1O7F A;  4YEL A;  2LRE A;  4MO7 A;  3AFH A;  1QZE A;  4IRG A;  4IOA F;  5FKK A;  2HR3 A;  3M1E A;  2XGD A;  4O5V A;  3ZR8 X;  2V9K A;  1R00 A;  3HTS B;  1IUF A;  1D1A A;  4EJT A;  2M0C A;  2IXS A;  2X0L A;  3HRU A;  1P9Q C;  2FA5 A;  3COA C;  4F7Z A;  2ACJ A;  2EV5 A;  3H9Q A;  5E3N A;  2JPC A;  1E3P A;  1VQM I;  1TQP A;  2ADU A;  4K2E A;  1YJN I;  3HPG A;  2VE9 A;  2VE8 A;  3WE2 A;  1Y8R B;  2CUJ A;  3IV5 A;  4RMN A;  4A3K J;  3EQL F;  1JKQ C;  1VQL I;  4ZTJ A;  2EIL H;  4UHT A;  5TRD A;  1T2K A;  1RUO A;  1UMQ A;  3CO7 C;  1FLI A;  3AL0 B;  2QF7 A;  4PGG A;  4XLF A;  1TQI A;  2QQB A;  5KAI C;  3VOE A;  1H9G A;  1G3Y A;  2KKO A;  3HUG A;  4O6J A;  1ZQ3 P;  3BWG A;  1JE8 A;  1HW2 A;  2F6C A;  3LFK A;  4CHU A;  3JSO A;  2Y9Z A;  2L9N A;  5DEQ A;  3KET A;  2OCC H;  2DPD A;  1RKW A;  3E6M A;  2QA4 I;  1QVU A;  2E7X A;  1BJA A;  3IHU A;  4MLO A;  3HOT A;  1YJ9 I;  3SJM A;  1GVD A;  3D5R C;  2M4G A;  1R1V A;  2AXL A;  2W82 A;  1Z91 A;  2HFH A;  3GVA A;  4LIV A;  3P9C A;  4A3G J;  1KU2 A;  3O3K A;  4UB6 C;  5EF6 A;  1UAA A;  4IXA A;  3TO7 A;  4JX4 A;  5F1R A;  3GTP J;  3SYT A;  1MDM A;  3EPZ A;  1A36 A;  4BY1 J;  3VYS B;  1IUY A;  1GHC A;  2HYG D;  3WTU C;  2CQN A;  1W5T A;  2BGC A;  1YS6 A;  3E5Q A;  3ZMS A;  2DK8 A;  3HKZ N;  1X4P A;  3MKZ A;  3FMS A;  2KZV A;  2Y31 A;  4B4C A;  1ETQ A;  2Q0O A;  2RGV A;  3W6V A;  2JRT A;  1AU7 A;  5LGT A;  1LNW A;  3GUD A;  4DYQ A;  2DMU A;  2XRL A;  1J7K A;  2ZB9 A;  3GTK J;  1FOX A;  3RKQ A;  4CA0 A;  2X51 A;  3C2G A;  5H6Q A;  3H9J A;  2HEO A;  2R7F A;  1H8A C;  2KRC A;  3WHC A;  4D1Q A;  2QBY A;  2K4J A;  2X6O A;  4EM1 A;  3GO5 A;  2RNJ A;  3GEZ A;  2XF7 A;  3DEE A;  3DPU A;  2E1M B;  3DEW A;  1BI0 A;  4KA4 A;  2LP0 A;  3IL2 A;  2P8T A;  2ELJ A;  3EUK L;  4FIS A;  3MCZ A;  5K7F A;  1R4N B;  4IRI A;  2OA4 A;  3V42 A;  1ONV A;  5E8G A;  3R0A A;  1SMT A;  5D4S A;  3D5L A;  2LOO A;  3OMY A;  1PVE A;  1HCR A;  1T0F C;  1B9M A;  4BE2 A;  3HEF A;  4RGS A;  2VXD A;  2LH9 A;  1D0Z A;  4HYE A;  1XCB A;  5JHU A;  3ISP A;  5M5W J;  4XRS A;  4GO1 A;  4IHV A;  2GWR A;  5FFZ A;  2DMQ A;  1BW6 A;  2RKH A;  1R23 A;  5LHG A;  3I71 A;  2GZW A;  4EJO A;  4BL0 B;  3TP0 A;  1ZYR F;  2P6T A;  3CC7 I;  4I76 A;  1I27 A;  2L02 A;  2FBK A;  4EM2 A;  2ZME C;  2OUM A;  4G9Y A;  3RKX A;  4HF2 A;  4D9J A;  3QYB A;  4BBR J;  2WC2 A;  3KP7 A;  5D8K B;  1BIB A;  4N9I A;  1QBJ A;  1J5Y A;  2VOO A;  3K6G A;  3FF5 A;  5LHH A;  3KP3 A;  4ZYD A;  3J81 K;  2R7Z J;  3Q9S A;  1T33 A;  2G0E A;  5EEH A;  1ERD A;  2H27 A;  2STT A;  3OIP A;  2CS3 A;  3LFU A;  1RKT A;  1VI0 A;  2MSY A;  1WSU A;  3A03 A;  4AD9 A;  3E3V A;  3ZQQ A;  3NAU A;  5DDG A;  5FD6 A;  5A2Q Z;  3A2K A;  1NK3 P;  4QTR A;  2XAG A;  1UG2 A;  4G6Q A;  3F8B A;  2P7V B;  4KFC A;  2DYR H;  2QCO A;  4HX4 A;  4AIK A;  5EDN A;  1LFP A;  4DGW B;  2OF7 A;  3ECH A;  5CVI A;  4MNU A;  3EUH C;  3RIR A;  4A3E J;  3Q0U A;  4QPQ A;  5JLX A;  4AUX A;  2EFO A;  4CCK A;  3QU3 A;  4JX5 A;  2ETH A;  4M6Y A;  3HYI A;  1X1A A;  3N4M A;  2NNY A;  1X3W B;  2DA1 A;  2YSR A;  2M0M A;  3WTX C;  4UVC A;  3WTW C;  4HNV A;  3HRS A;  3ZCO A;  1IXS B;  3LQQ A;  4NUB A;  4PJ0 C;  3GTM J;  4I99 C;  2LF7 A;  4B44 A;  1G2H A;  2ZXI A;  3ZQC A;  4PK4 A;  3P5J A;  3BZK A;  2ZCW A;  3V7R A;  3SZG A;  4WXH A;  1TT5 B;  4HPQ A;  1ETV A;  2EH3 A;  2K4B A;  2IA1 A;  3M8J A;  1ZR4 A;  1OLT A;  2J5P A;  1LFB A;  3GWZ A;  3KPH A;  3JRG A;  4KMF A;  3BG7 A;  1W36 C;  3OSF A;  1OCZ H;  1EH8 A;  4RB1 A;  2QUF A;  4CO8 A;  2O3F A;  1MH3 A;  2EFQ A;  2ZXJ A;  3MZ8 A;  4L5I A;  1FOY A;  4II3 A;  4U0Y A;  2LR8 A;  1JUP A;  4CUG A;  4ZZD A;  4XIC A;  2PG4 A;  4O3M A;  3WTT C;  2R7V A;  4PUS A;  4EQQ A;  2EV6 A;  1QRY A;  4CDG A;  4ZDP A;  3F72 A;  4WX9 A;  2EIK H;  1YS7 A;  3Q9V A;  3ZRG A;  1TP4 A;  1BW5 A;  3PFI A;  1R36 A;  1HLV A;  4MEX F;  1OFC X;  4KN4 X;  4EV0 A;  3WGG A;  2QYO A;  1ACI A;  2I8D A;  2WWY A;  2UZK A;  3LSJ A;  1HW1 A;  1MKM A;  3N97 A;  5HOO A;  4D7N A;  2E2H J;  1OR7 C;  2CV1 A;  1G3S A;  5E1Z B;  2HOA A;  1XG1 A;  3G1M A;  2HWV A;  3I55 I;  2EBI A;  4Q47 A; 
#chains in the Genus database with same CATH homology
 4CH7 A;  5LFA A;  2R7S A;  3W2A A;  1MW7 A;  3K4L A;  2BVL A;  3K4C A;  4PJM A;  4AU7 A;  1V5E A;  3VWB A;  3K10 A;  2PMZ A;  2VKD A;  2BW3 A;  2X1E A;  3UR3 C;  4HNT A;  2WA0 A;  4B47 A;  1MMA A;  2WAD A;  4IZZ A;  3OL3 A;  2OC6 A;  4J00 A;  3EUA A;  4HEA 2;  2R7T A;  3L2V A;  3OYE A;  3DTE A;  4C2T A;  2CV2 A;  2VJJ A;  2BOL A;  4BJ6 C;  4XKB A;  1WJC A;  3HOS A;  4HG2 A;  1T95 A;  4N4O B;  4OAY A;  3OYB A;  4R79 A;  3RSN A;  3OS0 A;  4RLQ A;  2Q2E B;  4BEH A;  2GOM A;  1YX5 A;  3AKZ A;  3OYI A;  3HXL A;  2W00 A;  1WJ5 A;  4RM3 A;  4IKF A;  3PSF A;  2ZXH A;  3A4C A;  3CF2 A;  2LBF B;  4ZDO A;  3L2R A;  2A6T A;  4BJT A;  2XSJ C;  2CFO A;  5LD2 C;  1EA3 A;  4P1W A;  4BDY A;  2M4K A;  4XR6 A;  3BCA A;  3SEZ A;  2HNH A;  3K70 D;  1E0E A;  3DLA A;  2DOA A;  1MMD A;  4XOP A;  4ZTF A;  2KPM A;  1PYV A;  1YE9 A;  4C9Y A;  4AVZ A;  2M3A A;  2Q1Z B;  2JVG A;  2MC4 A;  2HQA A;  2X6X A;  3E1S A;  4KJZ A;  3H35 A;  4JQF A;  3OS1 A;  4G6T B;  1IRX A;  1G59 A;  2KMU A;  5TGT A;  2V26 A;  4F3Q A;  2CV0 A;  2VLA A;  2KP6 A;  3ZGK A;  2VQL A;  4B48 A;  2K9M A;  4E7S A;  3H5N A;  3OOU A;  5FRO A;  2R7O A;  3VYU B;  1WJA A;  1BOB A;  4YRV A;  3FBI B;  1WJD A;  1Y6I A;  3RCO A;  1TZL A;  1JI8 A;  2DJI A;  2QKM B;  3W3C A;  2E60 A;  1UG0 A;  1S9H A;  1N77 A;  2VAS A;  2VPL A;  1QHH D;  2L9S A;  3PSI A;  4ZC3 A;  2X1C A;  1YX3 A;  4RM2 A;  3ZXS A;  4BQN A;  4BJ5 C;  1HA8 A;  3IP4 B;  3DPL C;  1BR4 A;  1DP3 A;  2WB1 A;  4P5O A;  4NNJ A;  2UUZ A;  3BCB A;  2X85 A;  2K5C A;  2A5W A;  3OR1 C;  3OYH A;  2R4G A;  3K70 C;  1V5F A;  4OAZ A;  1D1B A;  4RLF A;  3L2U A;  3KX2 A;  3H5A A;  1MND A;  4CCO A;  3BG6 A;  2M7B A;  4HST A;  3OYJ A;  4BAC A;  3OS2 A;  3U21 A;  3BLY A;  3MKY B;  2DT7 B;  5JHF A;  3S3O A;  1Z7L A;  2ZSI B;  4ZJZ A;  3K4J A;  2VL8 A;  3C2H A;  3LSK A;  2KRH A;  3DU5 A;  3S93 A;  4BGD A;  5KNL A;  1PJR A;  5CKT A;  2CH0 A;  1DQU A;  4E4H A;  1X1B A;  2IS6 A;  3OWT A;  3I3L A;  1SAU A;  3DWL E;  3M1C A;  3NWT A;  3CP8 A;  4XMY A;  1FMW A;  1N78 A;  5HNH A;  1U0J A;  1Z3Y A;  4E7Z A;  1D0Y A;  3LMM A;  1ZEL A;  2HVQ A;  3OY9 A;  4XLH A;  5HVQ C;  2HPI A;  3FBN B;  4ZDL A;  3CZ6 A;  2OV7 A;  1D1C A;  3L2W A;  4E7J A;  3PNY A;  4CCN A;  4C2U A;  3TL4 X;  3D5S C;  1MNE A;  2V4J C;  4CCM A;  3LSI A;  2VJ5 A;  4Y3O A;  2UWM A;  5KHD A;  1WJF A;  3OYK A;  3QYF A;  2FUG 2;  2XDV A;  3VSK A;  4F93 B;  3CES A;  3DKY A;  3IAS 2;  4BQO A;  3HKZ A;  4XKV A;  1G8X A;  2MD0 A;  4ITV A;  1K6Y A;  3S3M A;  1SFK A;  2Y0S A;  4LG3 A;  4ZYA A;  2VB6 A;  4NQW B;  4H4K C;  4PFP A;  5HLT A;  3HL2 A;  2L7K A;  2CW7 A;  1V5G A;  2HVR A;  2MYS A;  4XLC A;  3PNV A;  3F9K A;  4YEJ A;  2NOJ B;  4BEH B;  1WFX A;  2DT6 A;  2Z1D A;  3S8P A;  1Y56 A;  2V6E A;  4YEL A;  2LRE A;  3AFH A;  4OWR B;  2LC2 A;  3ZR8 X;  2V9K A;  1D1A A;  3W2V A;  2IS2 A;  2IXS A;  2L2O A;  2RQQ A;  1P9Q C;  2CW8 A;  4II2 A;  4N4N B;  4XLE A;  3H9Q A;  2RRE A;  2ZSH B;  2VIX A;  4CCJ A;  3OYL A;  2VQC A;  4KT6 A;  5FRM A;  2PJR A;  3OYN A;  3QYE A;  3HPG A;  5CQG A;  4PJL A;  4E6K G;  1QHG A;  2W7N A;  3OYF A;  3LSH A;  4J01 A;  4PSX A;  3FKJ A;  1DGR M;  4BXF A;  2CUJ A;  2E5Z A;  3LSM A;  4RMN A;  4XON A;  4XOR A;  3VSL A;  2MAB A;  1X1D A;  4ZTJ A;  3CJR B;  2KL4 A;  3IUO A;  4BDZ A;  1VZ0 A;  3AL0 B;  2E5N A;  5KCM A;  3SEQ A;  4XLF A;  1WJB A;  3HC7 A;  5FRN A;  3A1Y A;  3H5R A;  3HPH A;  2VQH A;  5HNF A;  2F6C A;  2R7U A;  2VXZ A;  2L9N A;  3MKW B;  4IQ4 A;  1KON A;  1X19 A;  3RTR A;  4HRI A;  2L5Q A;  3KEY A;  4XKW A;  3UNG C;  4MLO A;  4PJJ A;  2W1O A;  3HOT A;  1DGW Y;  3HG9 A;  1FMV A;  3D5R C;  2M4G A;  2HZD A;  4U7B A;  2W82 A;  3OIQ A;  3K4N A;  3MMY B;  4U87 A;  4LIV A;  5CPR B;  1X1C A;  3OYM A;  4BS9 A;  1UAA A;  4BUP A;  2KDO A;  1QU3 A;  2JUG A;  4HNU A;  3SYT A;  3EPZ A;  3NWS A;  3OYD A;  3RQ4 A;  3VYS B;  3DTK A;  3QOD A;  3GBG A;  4FAS D;  4IX7 A;  3CJQ B;  2LY1 A;  2M7A A;  2WAF A;  1X4P A;  3MKZ A;  2WBM A;  2KZV A;  4BE1 A;  2LRD A;  4XM3 A;  4LIU A;  2KQR A;  4DBQ A;  3FHN A;  2BVM A;  3K4K A;  4DJA A;  3S3N A;  3TMO A;  5CQE A;  4CA0 A;  2X51 A;  3C2G A;  3OL4 A;  4XN0 A;  3H9J A;  4Y33 A;  2KRC A;  4D1Q A;  1N75 A;  2XF7 A;  3DEE A;  3CMM A;  4XOT A;  3DPU A;  2E1M B;  2RNG A;  4B3X A;  2O5R A;  2ELJ A;  4F91 B;  3EUK L;  4HSR A;  3KYL A;  2K3P A;  2JVH A;  4C30 A;  3L2Q A;  2BW3 B;  4F52 A;  3V42 A;  4DOZ A;  2GOX B;  1MMG A;  4E7H A;  2UV1 A;  3D5L A;  2LOO A;  3OMY A;  2AQE A;  3CP2 A;  3IAM 2;  1T0F C;  4BE2 A;  2VXD A;  3I9V 2;  2LH9 A;  1D0Z A;  1BR1 A;  4XL9 A;  2R7Q A;  1LDK B;  4EAT A;  2W4S A;  3PNT A;  3G2B A;  2Z16 A;  3H9G A;  4FET A;  2F5V A;  1NG6 A;  2XF5 A;  3OYC A;  4CCL A;  3DPT A;  2JA2 A;  4BL0 B;  2JSP A;  4XQF A;  2DXI A;  2LBF A;  4E7K A;  1LVK A;  2WY7 Q;  4BU2 A;  2OUM A;  4Y4R A;  3VYR B;  2XC7 A;  4D9J A;  3LSG A;  2WAE A;  4XN3 A;  3QYB A;  2QKL B;  1W36 D;  3PUB A;  4E7L A;  4NC8 A;  3K6G A;  2F4I A;  4X0G A;  3H0D A;  3PJR A;  2CMP A;  3TBI A;  2IGM A;  4ANJ A;  3OR2 C;  3OYG A;  3BC8 A;  4BQQ A;  1ERD A;  3VDX A;  1WJE A;  2P0W A;  1LKX A;  4XLA A;  4F55 A;  3OIP A;  2CS3 A;  3LFU A;  3ZQQ A;  3A2K A;  3K4M A;  1NG7 A;  1Z3X A;  2E1M C;  2HU9 A;  2HDW A;  1X4O A;  2HPM A;  4PFO A;  2IS4 A;  4F92 B;  3MD2 A;  2IGO A;  2KHM A;  2XAU A;  2PJR B;  1LFP A;  4DGW B;  2AQF A;  2VJI A;  3EUH C;  4E7I A;  3FDY A;  2CUZ A;  2MFZ A;  4DIQ A;  4QPQ A;  2R7X A;  4CCK A;  1Z21 A;  1X1A A;  2K9L A;  2M0M A;  1J09 A;  2V7F A;  2LG4 A;  3ZCO A;  2IGK A;  3DQV C;  3E0J B;  4NUB A;  1TT0 A;  4BE0 A;  3W2W A;  4B44 A;  2ZXI A;  3HUG B;  1GLN A;  3K4B A;  4NC7 A;  4PK4 A;  2IS1 A;  3PFY A;  3SZG A;  4CZC A;  4HPQ A;  2X6W A;  3M8J A;  1OLT A;  4XKC A;  2WY8 Q;  4JOM A;  3BG7 A;  1W36 C;  3S32 A;  1R6R A;  3N05 A;  4KIT B;  4CSW A;  2V1N A;  4LIT A;  2VJ4 A;  2WAQ A;  4QPO A;  3J7A Y;  3VYT B;  1D0X A;  3DKX A;  2X6Y A;  4II3 A;  2Z2S B;  2VQG A;  4CUG A;  2KLO A;  2R7W A;  3PL8 A;  4IQJ A;  4DBR A;  2R7V A;  4PUS A;  2LY2 A;  4ZDP A;  2ZFU A;  2LYC A;  2X1D A;  2XF6 A;  4B43 A;  3RPU D;  3ZRG A;  3DTI A;  4PJN A;  3AL0 C;  3LL7 A;  2I8D A;  3ONQ A;  1BR2 A;  1MMN A;  3DU6 A;  4PSW A;  2IGN A;  5HOO A;  2CV1 A;  1OR7 C;  2DCE A;  4GRI A;  2R7R A;  3OYA A;  1UEL B;  4XNF A;  4KIS A;  4AYB A;  1AA7 A;  2VKH A;  3QOE A;  3SDB A;  2HVS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...