2NOJB

Crystal structure of ehp / c3d complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
58
structure length
58
Chain Sequence
NKKVVDAQKAVELFKRTRTVATHRKAQRAVNLIHFQHSYEKKKLQRQIDLVLKYNTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Complement C3
publication title Characterization of Ehp, a Secreted Complement Inhibitory Protein from Staphylococcus aureus.
pubmed doi rcsb
source organism Homo sapiens
total genus 23
structure length 58
sequence length 58
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2006-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12199 efb-c Extracellular fibrinogen binding protein C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1270 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2nojB00
3D5SC 2NOJB 2JVHA 2WY7Q 2GOMA 2WY8Q 2JVGA 2GOXB 3D5RC
chains in the Genus database with same CATH superfamily
3BCAA 4FT8A 3L2UA 2IP2A 3X2QH 3PSIA 5E3NA 3U21A 4RAYA 3AG1H 2QCOA 2MH2A 1NH3A 2L9NA 3SDBA 4S04A 2HFHA 3CJQB 1IDZA 5LHGA 3AKZA 3M4OJ 2KIQA 3W2AA 1W5CC 3ROUA 3TO9A 3FKIJ 4N9HA 2UXXA 2DMQA 1X3WB 5F0FA 4U0VA 3RQ4A 3V8KA 1OCPA 4XL9A 1XN7A 2X1EA 1I3AA 3LWFA 3F9KA 3T0YA 3WHBA 2NVXJ 3WTTC 5L3BA 4HQEA 5HODA 1BM9A 2ZXHA 2VXDA 5LFAA 2VBZA 3M07A 1HKTA 1HA8A 5LGTA 1HQCA 1G2HA 3KETA 1MBJA 2R5ZA 3OYJA 2PLYA 4NHJA 4XIDA 1FNNA 1UG2A 4QTRA 3K70C 1SFOJ 4NNJA 4EGYA 4JX5A 3CMYA 4I02A 2FX0A 2ZMEB 1VNDA 2JPBA 3P5JA 3OYCA 4XLPF 1I6XA 3BJAA 4EATA 4RM3A 2DFFA 2KJBA 3BG7A 4RGRA 1HF0A 1VQ8I 3CDHA 5DYMA 1MH3A 5E1XA 1SMYF 1XSDA 4W97A 1T08B 1Z91A 2XAUA 1ENHA 4Y33A 5BPIA 1IRZA 1K7AA 3WU0A 1ZRFA 1E3HA 5IT9K 3QPTA 5E8IA 3WGHA 1JJ8C 2F48A 5EG0B 4KMFA 1MMGA 1ACIA 2HZTA 1E17A 2VKDA 2JSPA 2DYSH 2ECCA 4MQVA 2IGMA 2WY7Q 3OOUA 1SVMA 5HDKA 2DPDA 1HW1A 1ZKGA 5K1YA 1SEUA 1P2FA 3WODF 1F5TA 2VBXA 2MD0A 1SD4A 4ZYEA 2LVSA 2JTVA 3RZDJ 1S7EA 3I4NJ 2O9LA 2HQRA 2OTJI 5ILUA 3VFZA 1ZLKA 3P7NA 4E6KG 1UHMA 3PNVA 3LAPA 1LNWA 3A0BC 2OQGA 1L3LA 4X6AJ 5E79C 4HLYA 2KP6A 4CO8A 2LF7A 3O8GA 5TGTA 3NRVA 4BYYA 4QSHA 1R9TJ 2MFZA 4HX4A 1Y56A 5M5YJ 5GPAA 2Q1ZB 2COBA 5K5RA 1MBHA 4E7LA 4IF4A 2D1HA 2FOKA 2VPRA 2RNGA 1W4MA 2IA1A 5HNFA 1ZG1A 4AVPA 4XRMA 3KX2A 3ZOBA 3N97A 5E8GA 1BI2A 2R5ZB 2JVHA 2XAHA 5EDNA 3P9KA 4XLHA 2L4AA 4OINF 3CLQA 3A02A 2P5LC 3S3OA 4A3IJ 3UKGA 1JGGA 4BHCA 1K6OA 3ZGKA 4CA0A 4OOIA 3E3VA 1SMTA 3HKZN 2CW8A 1KGSA 1J0RA 3M3YJ 1J75A 2DOEA 1HBXG 1YJ9I 4IVNA 4MEXF 4AYBA 2LRDA 3OYEA 1IUYA 2OCEA 1CF7A 5DUIA 2K9QA 4BXFA 5JHUA 4ZH4F 3FDYA 4A3MJ 2K9LA 2HPIA 4GXOA 5EJCA 3KZIC 3H9GA 3BJ6A 4HLXA 3DEUA 2ZBKA 3QU3A 2XB0X 4PK4A 4KT5C 4IXAA 2G7HA 1ETQA 2E7WA 4HV6A 2X0LA 2BXYA 1P4XA 2Z16A 4RGSA 3CD6I 2K86A 2B7EA 2M7BA 2XDVA 4BE0A 3FK6A 4CXFA 3CO7C 3BZ6A 1VFCA 1ZGAA 2LKPA 5GAHJ 1CGPA 1BC7C 3C7JA 1G59A 2A07F 1OCZH 4IRHA 5HS9A 4UVAA 1LFUP 1V5EA 3UNGC 2K4BA 4DJAA 3BR6A 3TDUC 1ON2A 5GTHC 3F8NA 3HIFA 1LE8A 1OYYA 2XF6A 3KCCA 4PJMA 4G8XA 3BR5A 2LC2A 2M7AA 3F8CA 2VUMJ 2M5WA 2OU2A 1PVEA 3KP6A 1I6HJ 3GF2A 2JZYA 2WV1A 4IKFA 5CVUA 2JA7J 2Z1DA 4YIRX 2O61A 4CCJA 1IG7A 4KN7X 2F6CA 2VC1A 4NB5A 3K6GA 3JRAA 5LD2C 2V9VA 5F64A 1J9IA 3BDDA 2IGKA 2NOGA 3BPVA 1WRJA 3L00A 1YFHA 2BHYA 1Y1WJ 2DFEA 5EZHA 5HLHA 1U6GA 4UUVA 1E2XA 3LNQA 1NK3P 2OZUA 2XIGA 5C44J 1N25A 3ZMVA 5FO5A 2ME6A 3JCUC 5ICGA 3EYIA 4A93J 1ZARA 2QKMB 3P9CA 3ZQCA 2DFIA 1REPC 1Z67A 4RB3C 3V7SA 2GIZA 3BG6A 3C2GA 1PYVA 4GYIA 1B72A 2M1BA 3HGYA 3FM3A 3AAFA 1W5SA 4A6EA 2LYCA 2ECBA 3FF5A 2VB6A 3K1MA 2OUMA 4J01A 1E3PA 4XRSA 3SZGA 4U0YA 2TCTA 1CF7B 2VI6A 2QSFX 3M1EA 5M5WJ 1MNMC 2LBFA 1Z9CA 2PJRB 2F5VA 5HNHA 3VSLA 2HZDA 2P6SA 4U7DA 1R36A 2LH9A 3COAC 1V55H 5EEHA 3H0GJ 1MNEA 3RKWA 2J5OA 2HXOA 4ZTFA 3J7ZI 3CESA 1FWZA 2BE5F 1DP7P 4RB2C 2KRCA 3ZP5A 3M8JA 5FROA 2KRHA 1W7PA 2Y0MA 3TL4X 3H36A 1USTA 2XB5A 4HX7A 4EM1A 4U87A 2COMA 3D1NI 2XPVA 5A2QZ 3HSFA 1D1AA 4I01A 4Z6YA 2DJIA 2E36A 2MC4A 5FFZA 4XLFA 4F91B 2CV0A 1MBKA 1TT5B 5HLIA 1LE8B 2M87A 3TQNA 3JRBA 3KYCB 4XR6A 4HNTA 2M0CA 1FP1D 1B59A 4E7KA 2IBDA 2XGDA 2WB1N 1TNSA 3V4GA 2AXTC 4F3QA 3GEZA 4ESJA 1ITYA 3K69A 1IDYA 3VB2A 5DM6F 2KQRA 1YQAA 4F7ZA 2V1DA 3IHUA 1J59A 2Q0OA 3QYEA 3SDGA 2VQHA 1MIJA 1MBFA 1S7OA 2IPQX 4BHPA 4L5EA 2R7OA 3BOQA 3GMEA 3KEYA 3ECOA 3NWSA 4W1UA 2EV6A 4YFNF 1S7AA 2IA2A 3T8TA 2DFHA 3EUAA 1A6IA 4D9JA 3LSRA 3CO6C 2EA2A 4KUMA 3ZMSA 4BE1A 4EGZA 1VQLI 5LRSA 2BY0A 2DA5A 3EYYA 4WF2A 2OJED 4HF2A 1KA8A 4Y17A 4DOZA 2XGEA 1RRJA 2L7ZA 1LUJB 2GWRA 1U5TC 3SXYA 1MJ9A 4Y13A 2HQNA 3KLNA 2Z33A 2HOSA 5CQEA 1JHFA 3CZ6A 1MDMB 2WC2A 1GDTA 4LIVA 3HXLA 1XSVA 1ZLJA 1G3WA 1FOWA 3ZPLA 1SVOA 2EIKH 5CKTA 3K4LA 1B4AA 4EJUA 1PDNC 3MMYB 3ABKH 2V1XA 2EFQA 3KP2A 3LSPA 2AHQA 1I50J 3HRTA 2ELJA 4ZYGA 5B5EC 5IY5H 2RVCA 4ZDOA 1LDJA 3OYGA 4IHVA 2ZXWH 4IOAF 1W7PB 4MFEA 2K4JA 1BR1A 1C0WA 4LB6B 3ERED 5GTIC 4QPOA 3MQ0A 1KZHA 1S72I 2E1CA 3GW2A 3V7CA 4YFKF 1D3YA 1DDNA 4ENNA 5LEJA 1R5GA 3CCYA 2L54A 2KDOA 4P96A 1R49A 2N8GA 2QWWA 4II3A 4XKCA 1P92A 4AWXB 2WAQA 4GYGA 2RNJA 3NQOA 3ISPA 4AU7A 5HVQC 2FBHA 5HOOA 4HYEA 3M7GA 1FZPB 2E35A 1VQNI 1K61A 5FD5A 2R7UA 2DXIA 4KIFA 2EWNA 4C30A 3TOBA 5D8LB 1FLIA 4UUTA 1MGTA 4YEJA 4FISA 1N77A 2MBFA 5FKOA 2XF7A 3BWGA 4ON0A 4CDGA 1UJ8A 2GM4A 3FXMA 4MQ9F 4PCQA 1YX5A 6PAXA 4EVIA 1WSUA 5IPAA 1H9GA 2Q2EA 1OCCH 4Q4ZF 2L9RA 4D7MA 3WGIA 4IEJA 3CUQC 1HDPA 2EB7A 4RGUA 3OV8A 2HS5A 2V9KA 3TBIA 1BN5A 4HOBA 2XGCA 4CCMA 4E4HA 4HNVA 2WAEA 2DBBA 4XM3A 5L3DA 5AONA 3L2RA 3W3CA 3A01A 2LY9A 3EUHC 4ENKA 1LFPA 1TW3A 2W57A 5ED4A 4G7OF 3S17J 2HOAA 4D5FA 3D5RC 4HG2A 4RDUA 1FYMA 2JA5J 3OYBA 3RI4A 2VODA 5HDGA 3SEZA 4KNYA 2JSCA 1VQ5I 3IH2A 4MHGA 2R7XA 4C3JJ 3WTSC 1ETYA 2DA1A 3K2ZA 4XN0A 3QAHA 4JP0A 1MNDA 3NARA 2E19A 2WTEA 3ABMH 2MSYA 3TDZC 1D0YA 3HJEA 1S29A 2L02A 2R3SA 4CCLA 2M8GX 3K1PA 3LSKA 1YX3A 2QQ8A 4EM2A 4YELA 4R79A 3HHGA 5BS6A 1ZK8A 3ZQGA 4A3KJ 9ANTA 3HEFA 3K10A 1F1ZA 4DYCA 4LG0A 1PUFA 1FSHA 3VWBA 2M9HA 2X51A 4OIRF 1P4AA 2A5WA 5C3EJ 1W7PD 3C1DA 4Q48A 3WTXC 3HOSA 4F92B 5CVRA 2PN6A 1J2XA 5ILVA 5KVRA 3MKYB 4JX6A 3CCQI 1RPWA 4LOCA 1Z7UA 4LMYA 1R1TA 5CVVA 5K5QA 4XLNF 2CG4A 4KFCA 3I58A 3BROA 4LGWA 2L9SA 4BACA 1DU0A 3F8MA 2L01A 2FSWA 3E6BA 2EPFA 1XGNA 1HW5A 3I71A 1FEXA 3CMEI 2H27A 5DCFA 3FM5A 3VYRB 2M4KA 2HDCA 2Q2EB 4G6DA 4KDPA 2V26A 4S0HB 4QPQA 1IXCA 2VLAA 1JHHA 5GAGJ 3KE2A 3LFKA 1ZGJA 2XROA 4HF1A 4G94A 3PL8A 1MMAA 1JJ6C 3CCRI 3ELKA 3K1NA 1YW9A 2VJJA 2D2WA 4AM3A 2FEZA 1JTYA 1DGRM 2HXIA 1Y8RB 2NVYJ 3CDLA 3DLAA 3A01B 5A2QK 3A0HC 3S2DJ 1D5VA 2K3FA 2C6YA 2L7FP 4NC6A 1TWFJ 3S8PA 2OAZA 3BR3A 2DYRH 3BQYA 5LGUA 1HKQA 5TISC 1LDDA 3QYFA 4U0WA 2BZTA 1Z6RA 2VJ5A 2UUZA 1A35A 2VT2A 1AKHA 1UG0A 3BCBA 3PM1A 2EV5A 3CCUI 2XF5A 3GYHX 2E1MC 3AG3H 3WE2A 2MA3A 3K2AA 2VKVA 5IP6A 3RQIA 1XGSA 5EYRA 5E1ZB 2IEKA 1IN7A 1YTYA 3D5LA 4XOPA 3G1OA 1XX5A 1NG6A 2R7TA 3GFJA 2Y48A 3GZNB 4NC8A 4P5OA 4RAGA 4LG0B 2XAJA 3IV5A 2CUJA 2ZC2A 2L3DA 2QYOA 3JAMZ 4ENJA 2DTRA 1A6QA 2W48A 3ZMTA 3PUFA 2Y0SN 2MW8A 1KYZA 1XC5A 3CTAA 5FB2A 4H0EA 1QA6A 3S1QJ 5F04A 1LPQA 2QKLB 3HRSA 1X58A 2Y9YA 3ASOH 1X2MA 5J40A 4JX4A 1V3FA 2FMLA 3F72A 4HDVA 2ZNZA 4II2A 5HDNA 2IS2A 2ZCWA 1P7IA 4OWRB 5J8FA 1Q1HA 1KU2A 1FX7A 2B0LA 2DMUA 2EFOA 1HXDA 3OIOA 3IUOA 2F4OB 1SFKA 2ICWG 4ENMA 3KP5A 4PJLA 2I8DA 4ZJZA 3FXJA 4G12A 1ZN2A 3VYSB 1OKRA 5FLMJ 1QNTA 1FBUA 2EQRA 3WTUC 5DD8A 1XDUA 3CC2I 2DT7B 4BS9A 3JR9A 2RN7A 1R58A 1WKMA 4X1EA 4ZYDA 1YO5C 1KU7A 3CQZJ 1O3SA 1OMIA 4B43A 4OAZA 5ILSA 3OIPA 3GTQJ 2DK5A 1VZ0A 2GBYA 3GZ6A 1ZRCA 3I3LA 3FXKA 3ZQIA 2P4WA 5EG0A 1AKHB 1PP7U 5JI6A 1QU3A 1TZLA 5IYCJ 2JVGA 3VSKA 3OR1C 3PJRA 1FIPA 1S9HA 5DTDA 4UVBA 2R93J 3H92A 4PJJA 3O2PE 5F1RA 4NC7A 3MZHA 1ZQ3P 2A68F 1TP4A 2X6OA 3OYHA 5K7FA 4CHUA 2XKPA 2EFNA 1ETOA 1Z77A 5DD4A 3HTUA 1X4OA 2KKOA 4XN3A 2Y30A 3WHCA 2CQNA 1Y6IA 3JTGA 2KFDA 2W25A 3S32A 2ESHA 1TBXA 2KJCA 2QVOA 2XHKA 2P0WA 3CCJI 3M8EA 4LG3A 1K4TA 2DPUA 2VQGA 1D0ZA 3PQJA 2Z99A 4CYDA 2VBWA 4HAMA 1G3TA 4RA2A 2ZO4A 2PBIA 3D5SC 4EQQA 1S8NA 4NUBA 3OSFA 3OYNA 1A5JA 3H5NA 2ADUA 3H9QA 1W1WE 3JRIA 3F22A 4B1RA 4FX0A 1TWHJ 4ESFA 4A3GJ 4IHSA 3ECHA 1GUUA 4UUSA 2FNPA 3DKXA 4M71A 3WE3A 4GGGA 1Z3YA 4MNUA 3HTSB 4YRVA 3K70D 4BU2A 4ZTJA 3S1RJ 1JGSA 2YU3A 3M1CA 1HC8A 1W5TA 5FLVA 1ZG5A 2HKXA 1K6YA 4PGGA 1QHHD 3CP8A 2NAZA 2QLZA 5CVJA 2JPCA 5HS7A 3LSJA 2F5CA 3HKZA 2KIMA 2BY3A 4D1QA 5B1AH 1BOAA 2TDXA 1QQIA 3FXOA 4C3HJ 3Q5FA 4HV5A 3U2RA 4NBQA 2L9VA 3TMOA 3DKYA 2CQKA 4FHTA 3QOEA 2QUFA 5L3FA 1JKOC 2XC7A 1L0OC 1Z3XA 4LFUA 1Y8QB 2VKHA 3OMYA 3ULQB 4ITVA 2DCEA 4A0XA 2D5VA 1FTZA 3DU6A 1FBSA 2ETHA 3WTZA 2DW4A 4P55A 3R0AA 1XGMA 5ERIA 3ZMZA 1AU7A 1CQTA 3R4KA 4IOCF 3U1KA 3HM5A 1X1CA 1LQ1A 2FNAA 5DUKA 2HOTA 3QPSA 1ULYA 3CP2A 5CLSA 4C9YA 2GLOA 1APLC 3LSMA 4A3EJ 1UCRA 5FD6A 1BL0A 1Z6TA 2LMDA 3RCOA 3Q3SA 3W2VA 3HBLA 3Q0UA 1PJRA 5E3MA 2CS3A 3K4KA 2Y9ZA 2BOLA 2JRMA 4NDLA 2P81A 4ZZLA 2JWTA 1B8IA 2HOEA 4WWCA 1XMXA 1XTAA 2PFBA 2CRGA 3OYAA 2W1OA 3IC7A 2NVUB 4UUSB 5EGOA 5J1RA 3HOTA 1ETKA 3REOA 2A69F 2MGQA 3I56I 3B73A 4HQMA 2IJLA 3H35A 1Z05A 3EPZA 3S15J 2LKSA 1JKPC 1R23A 1XD7A 1XDSA 4I98B 1EA3A 5FRNA 4B3AA 1ZELA 1LVKA 3E6CC 5JHFA 5KAIC 2WV0A 1KQ9A 2DQRA 3AL0C 1BR4A 1MBGA 3WG7H 1LJ9A 4UXNA 1E0EA 2PJRA 4M9ZA 1TWCJ 2Y69H 1I27A 4EV0A 2MLGA 4YFXF 3F8FA 2H6CA 2MD5A 4B8XA 1Y39A 1FIAA 4AIKA 1KU9A 3KEOA 4HPQA 5DDGA 3QRFF 3LA2A 3DFGA 4ETSA 1QVUA 1T38A 1HSJA 1WHUA 4UB8C 1BIAA 1W0TA 3SJMA 4HNUA 2RDPA 2CW7A 2YS9A 1GVDA 5GAEJ 2BXZA 2PMZN 2R7WA 2XRLA 4BEHB 3JAMK 3I55I 2Q8KA 2GXAA 4DQ2A 3CF2A 3WU1B 4FETA 2BY2A 1VF9A 2XASA 5FKNA 1JUMA 1XCVA 1G3SA 2O7OA 2FBIA 2VJIA 4RGXA 5FLXZ 3WG9A 2KL4A 2V6CA 2EFPA 2HEOA 2JA2A 1RZ4A 3GFLA 2JN6A 2ZXJA 1MMSA 3CUQA 3BQZA 1JE8A 3O3KA 1B8IB 2WB1A 1GV2A 4JK1X 2ISYA 2ID3A 2HKOA 2QGUA 5J4VA 2STTA 2AQEA 1DP3A 5EGOB 2B63J 2VE9A 1T0FA 2JRTA 3EUHA 4OAYA 1BJAA 2FE3A 2L7MP 3NWTA 1W36C 2FOWA 2MABA 4BNCA 3SQNA 3C2HA 4XLAA 5F08A 3F23A 3SHFA 4JYKA 2CJJA 4XOTA 3HPHA 2X9DA 3Q9SA 1DPRA 1T98A 3E1SA 3K4BA 1BI0A 2CQQA 2HYFA 3E5XA 3FWEA 1MDMA 2AQFA 3I53A 1J7KA 3G71I 3DKWA 4DYQA 3LOCA 4IX7A 1JI8A 4KISA 3RPQA 2BVLA 3ESWB 1JUPA 1F43A 2DU9A 4LLLA 1I3QJ 2WWYA 3IH3A 2VE8A 2EFWA 2O6GE 3MKZA 3K7AJ 4CCNA 1YITI 2OQRA 4U88A 3S3NA 1YRNA 3KP3A 3GFIA 2LLKA 1MMDA 1FSEA 1IV8A 2DT6A 2O3FA 3L2VA 2NNNA 4OMYA 4CGZA 1QZYA 4D0PA 2BW3A 5JLXA 1BBYA 3HOXJ 4EJOA 5LHHA 1ONVA 2GA2A 3RYPA 1R22A 3VDXA 3QP5A 2DMPA 5CYVA 3ZR8X 4BJ6C 1OCRH 2DTZA 2DA4A 1GT0C 3KZYA 3M8FA 4UV8A 5FKLA 3L9FA 2W24A 2ZJRF 2ZJ2A 1FOYA 2K40A 1STZA 2K5CA 4BQQA 3GTKJ 2VPLA 1J5YA 1XMKA 1D8KA 4Y3OA 3LQRA 2AXLA 3CUQB 3DU5A 3KP4A 1X1DA 3V42A 2HPMA 2YSRA 4WXHA 3FXUA 4P9UA 3BR1A 2E1OA 5J1YA 1I1GA 1IV6A 2W00A 3GWZA 2CV2A 2ZFUA 5H6QA 4XONA 3V8LA 2HQ5A 3KEQA 5H6RA 1DQUA 1LB2A 3ZQQA 3MZYA 4RS8A 2FMYA 1X19A 3PNTA 5KCMA 3FMSA 1WQ2A 5LRRA 3CLOA 1UZCA 1QRYA 2CUEA 4GO1A 2YU9J 4UVCA 5LLQA 3FXLA 1XSXA 3K4JA 2K27A 1TW2A 2X1DA 3RJPA 4BQNA 4IO9F 2MG4A 1XGOA 3IKTA 2YX7A 4KMUX 3VEPA 4I99C 4CZCA 4O3MA 1R1UA 4HZFA 1BC8C 1YRNB 3GTLJ 5E18F 2CYYA 2M45A 1X2NA 4RLFA 3RSNA 4XQFA 3G1LA 5L3CA 1JTXA 4I09A 2HVRA 3OL4A 2VN2A 4E7ZA 4H4KC 1FC3A 5EEAA 1ERDA 3IKVA 3SYTA 2MYSA 1ZRDA 2PI0A 1BI3A 3MWMA 2LP0A 2BW3B 2HWVA 4LITA 1WCMJ 1R5ID 1X1PA 2DMNA 4UV9A 4MTEA 4RB1A 3L09A 3MVPA 4Z2YA 3OYDA 3JRGA 2LD5A 2CFOA 1RETA 2ID6A 2EH3A 4AIJA 3FHNA 4E7JA 4C3IJ 3JSOA 4HRIA 3RYRA 3MKLA 1RUNA 4ZYAA 1GHCA 5DEQA 2E7XA 2F5DA 3ONQA 3BZKA 2AS5F 3KYDB 3PIPF 1ZYRF 2QQBA 4KIBA 1K4SA 1JKRC 5J47A 5DCMA 1FBQA 4BE2A 4UB6C 1R4NB 3EQLF 4UHTA 5KHDA 2E5NA 4S05A 1SD6A 1JXSA 3OWTA 1IUFA 2JUCA 1QBJA 4KITB 4UNOA 4LK1F 1HSTA 1AOYA 2R92J 2NXNB 3A1YA 3J7AY 3OY9A 3CDIA 3Q9VA 4U7BA 4PSWA 1TNTA 1UFMA 2DO7A 3WTVC 1U9OA 1X1BA 2EJRA 3E5UA 2WAFA 2E5ZA 1XG1A 2G9WA 5AIQA 3B6AA 1ZGWA 2YPRA 3ASNH 4MLOA 3TEDA 4M3DA 5C4XJ 3HZJA 4ABZA 1ZREA 2Z9OA 3PO3J 3EETA 2E1MB 1BI1A 2X4HA 3T5XA 4OIPF 4P9FA 2Z3YA 1ZR2A 2ME0A 4F52A 4L9JA 4PUSA 3ML6A 3CC4I 1BW5A 4BY7J 1IGNA 3DP7A 3B02A 1NG7A 3HPGA 4A2UA 1U78A 3BC8A 1IW7F 1T2KA 3A03A 2HVQA 3DXJF 2KZVA 1QHGA 5FLXK 1XB4A 1U2WA 5EF6A 1H8AC 4DW6A 3CF5F 2KMUA 1YOVB 1YI2I 2EZLA 3HHHA 1OCOH 2HI3A 3PFIA 2OA4A 4M3EA 5D6EA 5AIPA 4D5CA 3RKQA 3BTCA 3JRDA 4A3JJ 1OCTC 4AC0A 3G4SI 1A36A 3JRCA 2NRAC 2W7NA 1OPCA 2JA8J 3SZPA 2HDDA 1MJAA 2DJNA 3EDPA 2RQQA 3DQVC 4LD5A 4M3FA 1R4MB 1ZR4A 3DPUA 4N0BA 4E70A 1ZAOA 2ESNA 4PDKA 1P6RA 1R00A 3DPLC 4XLEA 4D7NA 4QLCU 1WI9A 2DQLA 5IOYA 1RKTA 3GLLA 1RR8C 2DA2A 3OL3A 1PUEE 4IHYA 1LDKB 2BYVE 3V8JA 3S1MJ 5K5OA 2VC0A 1OR7C 1SAXA 1WFXA 2V1NA 3SEQA 4V2GA 5DCMB 1H88C 2L2OA 4BAYA 2EV0A 3LA7A 3QP6A 3EUKL 2KHMA 4N9IA 3TGNA 4UY8I 2VONA 3S1NJ 3BLYA 2Y0SA 3MAJA 5L3EA 1D8JA 1B6AA 2AO9A 4LLNA 2PEXA 2DT5A 3KYLA 2ZJQF 1Z7LA 1B1BA 3DBRB 2IT0A 1SFUA 4WX9A 1N75A 2ACJA 1KYWA 2CUFA 4O6JA 5J4YA 2VKEA 2F4MB 4HSTA 2HYGD 1OQYA 1OYIA 1P9QC 2UXNA 1BOBA 1O7FA 2X6WA 1POGA 1R71A 3IRRA 1XCBA 2J5PA 5LHIA 1VQPI 3JREA 2KT0A 2W4SA 4HDUA 5TRDA 4WCGA 4B44A 1WJ5A 3KZZA 4BJTA 1IRGA 2Z2SB 4RAFA 2R7ZJ 2A6EF 3J81Z 4ZDLA 3CCMI 5J8CA 5ICEA 5DS9A 5E17F 1WJBA 2A3SA 3CC7I 4FE4A 2CSOA 5M5XJ 2R7DA 4DZPA 1O7LA 3CJRB 2P6TA 3I59A 1ORKA 3W6JB 4V2FA 2PJPA 2ZXIA 1SFEA 2CQXA 2DOAA 4B09A 4YG2F 2O03A 3B6CA 1R5HA 1S6LA 2MH9A 5LBQA 4I2OA 1OYWA 3HGGA 3H9JA 1TQMA 2VL8A 5FFXA 4BQOA 3VPRA 3F21A 2X6XA 1VQ4I 4QIWN 2JT1A 4EEFG 5EZGA 4C2TA 3T1BA 2ZJPF 1T39A 2RV8A 2DDAA 3S14J 1TC3C 4KA4A 3HRUA 3F6OA 1Q1VA 1WJDA 2OC6A 2XSJC 2HTSA 4A5MA 4HSRA 4M72A 2H09A 4BXXJ 1HKSA 2HGCA 2LDUA 1F36A 4IL6C 3GO5A 4A69C 4L9NA 2XSDC 1UELB 2PX9A 2E60A 3I4PA 4KYWA 1YHQI 4XICA 3U1DA 5HLTA 3LAJA 3GTOJ 4A3LJ 4I0AA 3DTKA 3E97A 1WZ2A 2XKOA 1BR2A 4PJ0C 5D5XB 5F27A 4BHBA 4AD9A 5B3SH 3HOVJ 3DWLE 2Z5UA 1BIBA 2BY1A 4XK4A 2IGOA 4DGWB 1FT9A 3I9V2 4DBQA 2I5UA 3QOPA 2KLOA 2OBPA 2WA0A 5IT3A 2IS4A 2O0YA 3GTGJ 4XBFA 4KJZA 4BXUA 2LG4A 4I76A 5KNLA 1PP8F 1JKQC 3H3VK 4CH7A 1IN4A 5GPCA 3BTJA 3PNYA 4XKVA 3C3WA 2LY1A 1EH8A 2A5YB 2WY8Q 3I59B 2GXBA 4CSWA 2BEOA 2M0MA 2RAEA 4BJ5C 4IZZA 2R7SA 5H20A 4PGHA 2IAIA 3S2HJ 4A3BJ 1G6NA 3L2QA 4M3BA 5E20A 3W6KB 3BPXA 4A0ZA 4WK8F 4AUXA 2G0EA 4XSZF 1TL8A 2VASA 3ZRGA 1HW2A 1OFCX 1JUSA 2ISZA 3FMRA 1WPKA 2DLLA 2CQ7A 3G1MA 5FKMA 1AA7A 2LY2A 4I7HA 2K9SA 2LKXA 4M74A 1U8BA 2KZGA 2X48A 2XAQA 4LK0F 1ODDA 3OOPA 1ETXA 4IJAA 1XPXA 1VTNC 1H89C 3KIOA 4RM2A 1IO2A 3AL0B 3RZOJ 1P4WA 2V9PA 4HX8A 1O57A 1FP2A 2I10A 1SAUA 3QWLA 4LJZF 3CMAI 2QBYA 1O3QA 3C2BA 2IRFG 2JA6J 1YW8A 1UMQA 4XNFA 2VOPA 2VQCA 3KP7A 4Y4RA 2DK8A 1RC9A 4EJWA 1SVLA 4YIIA 2B9SA 4HBLA 3FBIB 1IAWA 4MFDA 4IRIA 5K7HA 2R5YA 3R60A 2HQAA 3BG5A 2XVCA 2IGNA 5FRMA 1JT0A 1RI7A 2VIXA 3I54A 3LFUA 1T95A 4IPAA 1TQPA 3V7RA 1O4XA 1WJAA 4Q5SF 5D6FA 2FU4A 1TQIA 1HLVA 2CMPA 2M2EA 4B4CA 2F5EA 2JUGA 2FUG2 1YIJI 1QPMA 3BZCA 3LSGA 4RBOA 4KIGA 2LK2A 2EZHA 1S3JA 2X6YA 4G7ZF 1LEAA 3KFWX 4HA8A 4BEHA 3F6VA 3K4CA 1U9NA 2QSGX 1FYKA 2P5KA 3FKJA 3A2KA 1WI3A 3S16J 3DBLB 2DA3A 4XORA 4XLCA 2ZSHB 2FQ4A 3DTEA 4FTHA 4Q47A 5GP9A 1VQ7I 4M9XA 2Y31A 2VOOA 2PMZA 4F93B 5BNGA 3G3ZA 3LL7A 1RNLA 1R7JA 5JVGF 1VQKI 4TV7A 5CJ9A 3JRFA 3BY6A 3IH4A 2NVTJ 2VT3A 2EBIA 3O6BB 1D1CA 4M73A 4ZZDA 2QENA 1U5TA 4DZJA 3OYMA 4FX4A 4F55A 3MFKA 5CQGA 2M30A 4G6QA 1SFXA 2RC4A 3DTIA 1FOKA 1WJCA 4G9YA 4ESBA 4PFPA 2RKHA 4RMNA 1D1BA 2QBYB 3ZXSA 3TO6A 1GVJA 2H94A 5HLGA 1GLNA 3OSGA 3FK7A 2H1LA 2RREA 1IRXA 3J81K 3F0CA 2V6EA 1X3ZB 2W84A 3ZCOA 2GQQA 5DV5A 3C18A 4P1WA 2LSOA 2R5YB 1TT0A 4BDYA 4WXDA 3QPLA 2OTLI 5F6FA 1K78A 3DCFA 1EH7A 4B47A 4M6XA 3MN2A 4OIQF 2FF4A 3BR0A 3UR3C 2A6HF 4XRSG 2HYJA 1WH7A 3QQAA 4ZC3A 3ZQFA 2R7FA 3TKYA 5LGNA 5JVTA 1UHSA 1YE9A 2EZIA 1NTCA 3GXOA 2V7FA 3CMMA 4JBAA 1GV5A 3GTJJ 3IL2A 1DGWY 1MMNA 2A6TA 2H1KA 2P8TA 1ZH5A 2EA4A 2NS7A 2ZMEC 3A4CA 3AG4H 4CYCA 3K4NA 1H9TA 5D4RA 3FIWA 1XMAA 1HCRA 2LFBA 3FX3A 3OIQA 4BL0B 4OU0A 1YS7A 2BV6A 1IN8A 5E3OA 4CICA 3WTWC 2UV1A 3RKYA 4B3XA 1U0JA 3GFMA 2DDBA 1EKEA 3JW4A 4X0GA 2X1CA 1OISA 3JTHA 4L0YB 4IHTA 5KK1A 2JQ7A 3HRMA 5IYBJ 1BA5A 1U5TB 2YUSA 3TO7A 5K7ZA 2R0QC 4MIMA 2O8KA 3H5AA 2QF7A 1OJLA 1ETWA 2DA7A 3LSIA 1JT6A 2OF7A 2K3PA 5BMZA 1X3UA 1Y1VJ 3RDIA 1SC7A 1FPQA 2ELKA 4BQAA 3L7WA 1W36D 3N05A 1QZZA 3E6DA 4BBRJ 3IP4B 3KLOA 4EM0B 1HOMA 3GX4X 2JK3A 3G6EI 1WJFA 3S3MA 2R7VA 1IXRC 3OYKA 3BG3A 2UWMA 2A05A 4XKBA 5IP7J 4NQWA 3N4MA 3GZ5A 4Y15A 1IN6A 1F9NA 1MZBA 1VQ9I 4I0BA 2NS0A 2XAGA 4AYBN 1AWCA 3H3UA 1K78B 2QA4I 4FQGA 3NAUA 3IRQA 1KU3A 4HW0A 1WJEA 1IZ1A 3BTIA 1J09A 3H3ZA 5C4JJ 4L18B 2DMTA 2OZ6A 3H5RA 4R8HA 1N78A 1U3EM 4M6YA 3J7YJ 3PSFA 1LEBA 2P5VA 1MJBA 3VYTB 3O8HA 2XUBA 2VXZA 1MSFC 4G6TB 1FMWA 2L5QA 3BT9A 1OR7A 1WGXA 1YJWI 2IS6A 2NYXA 4CYCB 3ZQHA 2E71A 2EZKA 2K9MA 1V54H 2FJ1A 2HNHA 3ZN0A 2E34A 2LREA 1LFBA 2FA5A 2GOMA 1SANA 1D0XA 4R1HA 2GIVA 4EJTA 1RKWA 5F0CA 4JQFA 1X4PA 1RESA 1EJ9A 4YIFA 2CU7A 2R7QA 2R4GA 2DN0A 4DYRA 1U8RA 5JFRA 1T6SA 2CGPA 3IAM2 3OS2A 1TTYA 2XRNA 1K79A 1YLFA 1WVRA 3AFHA 3HG9A 1FY7A 1T33A 1V4RA 3HSRA 2LTPA 1F4KA 1IXSB 2RGVA 4GCVA 3S93A 3L1PA 3R61A 3HB9A 2XAFA 2RQPA 4A3FJ 2FXAA 3WGGA 2EK5A 2X85A 4CCOA 2D45A 2PMUA 2EIMH 3ABTA 4A5NA 3GBGA 3GLXA 2DAOA 1M1EB 2ZB9A 3QPHA 2QQAA 4MEYF 4ASNA 3HOYJ 2OCCH 5DM7F 3OS1A 1YG2A 4NQWB 3TP3A 1TWGJ 3GUDA 1ZG3A 2VBYA 1OLTA 4IQ4A 3HL2A 5B1BH 4WXCA 1USSA 4PZJA 3HDDA 3E5QA 1B9NA 2NOJB 2Y75A 4Y52J 1MD0A 3PQKA 1G8XA 3F8BA 2KDZA 2WADA 4A0YA 1B72B 4GDFA 4LB5A 1SD5A 3BTLA 1UHWA 3DEEA 4EMSA 3HOUJ 2PQ8A 5CPRB 3OYIA 5IYDJ 3QODA 2DI3A 3NEUA 1I1SA 4MTDA 2CUZA 2H8RA 2PMHA 4PJNA 5LEKA 3I4MJ 2OPTA 2LBFB 3HSEA 2DOFA 3TOAA 2GZWA 3MZ8A 1WH5A 2OV7A 3RPUA 3DEWA 3T8RA 5F1JA 5B66C 5E1WA 2L4MA 4AIHA 1NHAA 3F3XA 3LQQA 2EIJH 3DPTA 4BDZA 4KN4X 3M9AA 4XSXF 2E2IJ 3ERMA 3BR2A 3FISA 2BVMA 1V5GA 2ELHA 1WWXA 3K4MA 3SZTA 5BOXA 2OD5A 4E7IA 5H2FC 3J80Z 4J19A 1XS9A 2ZFWA 1P7JA 3LMMA 2BBYA 2K7LA 4N4NB 1YJNI 1IF1A 1H0MA 1AHDP 2DA6A 4BH9A 2V79A 3LSHA 3I5UA 1ON1A 5J3LA 2H8WA 4J00A 3FZVA 5GADJ 2FBKA 3OYLA 2LR8A 1LKXA 2M4GA 2VQLA 1ZTRA 3L2CA 1Z21A 3FHZA 2O5RA 5F0HA 1FOXA 3DBHB 1Y0NA 1YS6A 5D5WB 2HU9A 1TWAJ 4IHXA 4BY1J 3DF8A 3HOZJ 5ICCA 1T56A 3S2WA 3PO2J 2XPUA 2KISA 1MBEA 4OIOF 1IRFA 5FKKA 2KIUA 4LLGF 1V5FA 1DU6A 4PFOA 1Z1DA 3JRHA 5TJJA 3GTPJ 3PIOF 1UB9A 3DLLF 3U9GA 1QO0D 4FE7A 3CCSI 3GTMJ 2QQ9A 2IVMA 1QVTA 4ANJA 4GFBA 2H6BA 4L9TA 2K85A 4Y7NJ 2JMWA 1Y0UA 2F5FA 4RLQA 2QSHX 3RIRA 2CFXA 3IWFA 4K2EA 3R6SA 1SD7A 1T0FC 5IOZA 3HUGA 1K83J 2GA1A 4DIQA 3CCVI 3WU2C 4IRGA 5D4SA 3JSPA 2JJ7A 2MC3A 5KAFC 3CCLI 1FYLA 3MKWB 3G73A 2M34A 3TW7A 3SFZA 3PFYA 3HYIA 2EINH 3K9TA 1EV7A 1W0UA 3ZMDA 4MO7A 3ABUA 2HTJA 4M3GA 2CO5A 2LF8A 3LSTA 4ZYHA 3VODA 2P7CB 1X1AA 2WAQN 2D1VA 4CZZA 4AVZA 4BBSJ 5IT9Z 3PUBA 4XRFA 3W2WA 1VQOI 2K9NA 3QYBA 3W6VA 3I0TA 3L2WA 2ZNYA 1G4DA 2Y2ZA 3GCMA 4BKXA 3P9IA 4RAZA 5J6XA 3DV8A 3ZQLA 1VQMI 3ZQ7A 1EF4A 1R1VA 1VI0A 2GXGA 2IA0A 4V19K 3H0DA 2QM3A 2KPMA 3BG9A 1MH4A 1EH6A 4L5JA 5BPDA 4N4OB 3E0JB 2NVQJ 2L7KA 3MEXA 5D8KB 3E6MA 2WBMA 3ZN1A 4DBRA 2R7RA 4HF0A 2UZKA 1O3RA 2QZ8A 5M3MJ 2GOXB 3FMQA 2HVSA 4A12A 4BGDA 1QPIA 3BP8A 2IW5A 5HS8A 1Z0XA 1A04A 4AIDA 3J7AO 2YR2A 3G2BA 4QWQA 1T8IA 1RR7A 1MKMA 4OMZA 3RTRA 1YIOA 2F4IA 4O5VA 3SFIA 4I6ZA 2XGXA 3BJOA 3CCEI 3HC7A 5FGMA 5JR3A 1TLHB 2MLKA 1FTTA 2STWA 1R6RA 3OYFA 2A61A 2ZKZA 1QZEA 2PG4A 4IQJA 5J1UA 3FBNB 2CW0F 1I39A 1O3TA 1UAAA 5CVIA 2V4JC 3R0JA 3HUGB 1MSEC 2LNBA 2CWEA 4MGRA 5IP9J 1BJZA 3VOEA 2XPWA 4FASD 4CUGA 3FXRA 5ICFA 3RKXA 5L3GA 1A31A 3Q0WA 1S5LC 2DODA 3AG2H 4G7HF 3K0LA 4XMYA 3CJNA 3IAS2 1ETVA 3OS0A 1IC8A 4GRIA 3QU6A 4JOMA 4IHWA 1YYVA 1IN5A 1QGPA 4EJVA 2KIFA 2QEXI 2IS1A 1NK2P 2V1UA 5E3LA 4M9SA 4E7SA 2E2JJ 4HEA2 3HOWJ 1KQ8A 4A3CJ 4XKWA 2FRHA 2ZSIB 2NNYA 4A3DJ 2YX4A 1GXQA 3ABLH 3RPUD 1RUOA 4BUPA 1FMVA 2GAUA 1PUFB 5FJ8J 4E7HA 3TP0A 3CUOA 2O8XA 2XV4S 2EILH 4C2UA 2M8EA 4ZDPA 3Q0VA 2NS8A 2FQ3A 3TW6A 3OR2C 3CJTB 3FXQA 2TRTA 3IWZA 4DNCA 4FCYA 2E2HJ 1D5YA 2VJ4A 5JLWA 5BQTA 2F2EA 3E7LA 3MD2A 1LVAA 4L0ZB 2BHZA 4RB0A 2ZMEA 2W82A 4B48A 1G3YA 2LOOA 2KRFA 3GVAA 2W85A 1KQ0A 3WTYC 5D5UB 2K02A 1E3OC 2HR3A 1GXPA 1HDDC 3LA3A 1B9MA 5EEGA 3I64A 3VYUB 4CCKA 5M3FJ 4PSXA 1KONA 1FJLA 1ZHFA 4KICA 1IJWC 2L0KA 1VQ6I 1DPUA 2CV1A 4LIUA 1BW6A 3KPHA 2CH0A 2BGCA 3H1CA 4KT6A 3D0SA 1YW7A 2HDWA 2M3AA 4L5IA 4C2MJ 5D5VB 4A6DA 3MCZA 1DUXC 1MW7A 2P7VB 3J80K 2IXSA 1I5ZA 3ZMUA 4L9VA 2G7UA 1RIOH 2E1NA 2FD5A 4M6VA
chains in the Genus database with same CATH topology
2A5WA 1DQUA 1YE9A 3BCAA 3L2UA 2V7FA 3ZQQA 3CMMA 3PSIA 3HOSA 4F92B 3U21A 1DGWY 1MMNA 1X19A 2A6TA 3PNTA 5KCMA 3MKYB 2L9NA 3SDBA 3CJQB 3AKZA 2L9SA 4BACA 3A4CA 3W2AA 3K4NA 3K4JA 2X1DA 4BQNA 3OIQA 4BL0B 3VYRB 2M4KA 2Q2EB 4CZCA 2V26A 3RQ4A 4QPQA 2VLAA 2UV1A 2X1EA 4XL9A 3F9KA 4B3XA 1U0JA 4RLFA 4XQFA 3RSNA 2HVRA 3OL4A 3PL8A 1MMAA 4X0GA 4E7ZA 2X1CA 4H4KC 2ZXHA 1ERDA 2VXDA 3SYTA 2MYSA 5LFAA 2VJJA 1HA8A 2BW3B 4LITA 1DGRM 3DLAA 3OYDA 3OYJA 2CFOA 3H5AA 3K70C 4NNJA 3LSIA 3FHNA 3S8PA 4E7JA 4HRIA 3QYFA 2K3PA 4ZYAA 2VJ5A 2UUZA 3ONQA 1UG0A 3BCBA 3N05A 1W36D 3OYCA 3IP4B 4EATA 2XF5A 4RM3A 1WJFA 2E1MC 3S3MA 3BG7A 2R7VA 4BE2A 3OYKA 2UWMA 5KHDA 2E5NA 4XKBA 3OWTA 2XAUA 4KITB 4Y33A 3D5LA 4XOPA 1NG6A 2R7TA 3A1YA 3J7AY 3OY9A 4NC8A 4P5OA 4U7BA 4PSWA 1WJEA 1J09A 2CUJA 1X1BA 1MMGA 2WAFA 3H5RA 2E5ZA 1N78A 2VKDA 2JSPA 2IGMA 2WY7Q 3OOUA 3PSFA 3VYTB 4MLOA 2QKLB 2VXZA 4G6TB 1FMWA 2L5QA 2E1MB 2MD0A 2IS6A 4II2A 2IS2A 2K9MA 2HNHA 4OWRB 4F52A 4PUSA 2LREA 4E6KG 2GOMA 3PNVA 1NG7A 3HPGA 1D0XA 3BC8A 2KP6A 3IUOA 5TGTA 4JQFA 1X4PA 1SFKA 2HVQA 2MFZA 2KZVA 1QHGA 1Y56A 4PJLA 2I8DA 2Q1ZB 4ZJZA 4E7LA 2R7QA 3VYSB 2R4GA 2KMUA 2RNGA 5HNFA 3IAM2 3OS2A 3KX2A 2JVHA 2DT7B 3AFHA 3HG9A 4BS9A 4XLHA 2W7NA 3S3OA 3S93A 4B43A 2RQQA 3DQVC 4OAZA 3OIPA 3ZGKA 4CA0A 1VZ0A 3DPUA 2CW8A 3I3LA 3DPLC 4XLEA 2X85A 4CCOA 1QU3A 1TZLA 3OL3A 1LDKB 2JVGA 2LRDA 4AYBA 3VSKA 3OYEA 1OR7C 1WFXA 2V1NA 3OR1C 3GBGA 3SEQA 3FDYA 4BXFA 3PJRA 2K9LA 2L2OA 1S9HA 2HPIA 3H9GA 4PJJA 3OS1A 4NQWB 4NC7A 3EUKL 4PK4A 3OYHA 2KHMA 1OLTA 4IQ4A 3HL2A 3BLYA 2Y0SA 1X4OA 4XN3A 2NOJB 1Y6IA 3KYLA 2Z16A 1Z7LA 1G8XA 3S32A 2WADA 2M7BA 2XDVA 2P0WA 4BE0A 4LG3A 3DEEA 1N75A 2VQGA 5CPRB 1D0ZA 3OYIA 3QODA 1G59A 3D5SC 4HSTA 4NUBA 2CUZA 3OYNA 3H5NA 3H9QA 1V5EA 1P9QC 4PJNA 3UNGC 2LBFB 1BOBA 2X6WA 4DJAA 2XF6A 4PJMA 2OV7A 2LC2A 2M7AA 2W4SA 3DKXA 4B44A 1Z3YA 1WJ5A 4BJTA 4YRVA 2Z2SB 3K70D 4BU2A 4ZTJA 3M1CA 4IKFA 2Z1DA 4ZDLA 4CCJA 1WJBA 3DPTA 4BDZA 1K6YA 2F6CA 3CP8A 1QHHD 3K6GA 5LD2C 2BVMA 3CJRB 1V5GA 3K4MA 2IGKA 4E7IA 2ZXIA 3HKZA 3LMMA 4D1QA 4N4NB 2DOAA 3LSHA 2QKMB 3H9JA 4J00A 3OYLA 2VL8A 3BG6A 3C2GA 1PYVA 3TMOA 4BQOA 1LKXA 2M4GA 2VQLA 2X6XA 3DKYA 2LYCA 1Z21A 3QOEA 2O5RA 2VB6A 4C2TA 2OUMA 2XC7A 1Z3XA 4J01A 2VKHA 3OMYA 3SZGA 4ITVA 2DCEA 1WJDA 2OC6A 2HU9A 2XSJC 3DU6A 2LBFA 4HSRA 2PJRB 2F5VA 5HNHA 3VSLA 2HZDA 1X1CA 1V5FA 2LH9A 4PFOA 3CP2A 1UELB 4C9YA 1MNEA 2E60A 4ZTFA 3CESA 3LSMA 5HLTA 2KRCA 3DTKA 3M8JA 4ANJA 5FROA 3RCOA 2KRHA 3TL4X 3W2VA 1BR2A 1PJRA 2CS3A 3K4KA 2BOLA 4U87A 4RLQA 1D1AA 2DJIA 3DWLE 3OYAA 1T0FC 2IGOA 2MC4A 2W1OA 4XLFA 4DIQA 4F91B 4DGWB 3I9V2 2CV0A 4DBQA 2KLOA 4XR6A 4HNTA 3HOTA 3MKWB 2WA0A 2IS4A 4E7KA 4F3QA 4KJZA 3H35A 2LG4A 3EPZA 3PFYA 5KNLA 2KQRA 4CH7A 5FRNA 1EA3A 4XKVA 3PNYA 3QYEA 2VQHA 1ZELA 2LY1A 1LVKA 2WY8Q 5JHFA 1X1AA 2R7OA 4CSWA 3AL0C 1BR4A 2M0MA 4BJ5C 3KEYA 4AVZA 4IZZA 1E0EA 3PUBA 2R7SA 3W2WA 3NWSA 2PJRA 3QYBA 3L2WA 3EUAA 4D9JA 3L2QA 4BE1A 4HPQA 2VASA 3ZRGA 3H0DA 2KPMA 4DOZA 4N4OB 3E0JB 2L7KA 4HNUA 2CW7A 5CQEA 1AA7A 2WBMA 3CZ6A 2LY2A 4DBRA 2R7RA 2R7WA 4LIVA 3HXLA 4BEHB 3CF2A 2GOXB 2HVSA 5CKTA 4FETA 3K4LA 4BGDA 3MMYB 4RM2A 3AL0B 2VJIA 3G2BA 3RTRA 2ELJA 2KL4A 1SAUA 2F4IA 4ZDOA 2JA2A 3OYGA 3HC7A 4XNFA 2VQCA 4Y4RA 1BR1A 1R6RA 3OYFA 2WB1A 4IQJA 3FBIB 3FBNB 4QPOA 1UAAA 2HQAA 2V4JC 2IGNA 3HUGB 5FRMA 2AQEA 1DP3A 2KDOA 4FASD 4CUGA 2VIXA 1W36C 4II3A 4OAYA 3LFUA 1T95A 3NWTA 4XKCA 1WJAA 2WAQA 4AU7A 2MABA 5HVQC 3C2HA 2CMPA 5HOOA 4XLAA 2JUGA 2FUG2 4XMYA 3IAS2 3LSGA 3HPHA 4XOTA 3OS0A 2R7UA 4GRIA 2DXIA 4JOMA 3K4BA 3E1SA 4C30A 2X6YA 4YEJA 2IS1A 4BEHA 2AQFA 3K4CA 1N77A 4E7SA 4HEA2 2XF7A 3FKJA 3A2KA 4XKWA 4IX7A 1JI8A 4KISA 2ZSIB 4XORA 2BVLA 4XLCA 2ZSHB 3DTEA 3RPUD 1YX5A 4BUPA 2PMZA 1FMVA 4F93B 3MKZA 3LL7A 4CCNA 4E7HA 3S3NA 2V9KA 3TBIA 1MMDA 4C2UA 2DT6A 4CCMA 3L2VA 4E4HA 4ZDPA 2WAEA 1D1CA 2BW3A 4XM3A 3L2RA 3OR2C 3W3CA 3VDXA 3EUHC 3OYMA 1LFPA 4F55A 2VJ4A 5CQGA 3MD2A 3D5RC 3DTIA 3ZR8X 4HG2A 4BJ6C 3OYBA 2W82A 3SEZA 1WJCA 4B48A 2LOOA 2R7XA 4PFPA 4RMNA 4BQQA 1D1BA 2K5CA 2VPLA 3ZXSA 3VYUB 4CCKA 4XN0A 4PSXA 1KONA 1MNDA 4Y3OA 1GLNA 3DU5A 2RREA 1IRXA 1X1DA 3V42A 2V6EA 2HPMA 2CV1A 1D0YA 3ZCOA 4LIUA 4CCLA 4P1WA 2CH0A 3LSKA 1TT0A 4KT6A 1YX3A 4YELA 2HDWA 4R79A 2M3AA 4BDYA 1MW7A 2W00A 3K10A 2CV2A 2ZFUA 2IXSA 4B47A 3UR3C 4XONA 3VWBA 2X51A 4ZC3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D5S C;  2NOJ B;  2JVH A;  2WY7 Q;  2GOM A;  2WY8 Q;  2JVG A;  2GOX B;  3D5R C; 
#chains in the Genus database with same CATH topology
 3BCA A;  4FT8 A;  3L2U A;  2IP2 A;  3X2Q H;  3PSI A;  5E3N A;  3U21 A;  4RAY A;  3AG1 H;  2QCO A;  2MH2 A;  1NH3 A;  2L9N A;  3SDB A;  4S04 A;  2HFH A;  3CJQ B;  1IDZ A;  5LHG A;  3AKZ A;  3M4O J;  2KIQ A;  3W2A A;  1W5C C;  3ROU A;  3TO9 A;  3FKI J;  4N9H A;  2UXX A;  2DMQ A;  1X3W B;  5F0F A;  4U0V A;  3RQ4 A;  3V8K A;  1OCP A;  4XL9 A;  1XN7 A;  2X1E A;  1I3A A;  3LWF A;  3F9K A;  3T0Y A;  3WHB A;  2NVX J;  3WTT C;  5L3B A;  4HQE A;  5HOD A;  1BM9 A;  2ZXH A;  2VXD A;  5LFA A;  2VBZ A;  3M07 A;  1HKT A;  1HA8 A;  5LGT A;  1HQC A;  1G2H A;  3KET A;  1MBJ A;  2R5Z A;  3OYJ A;  2PLY A;  4NHJ A;  4XID A;  1FNN A;  1UG2 A;  4QTR A;  3K70 C;  1SFO J;  4NNJ A;  4EGY A;  4JX5 A;  3CMY A;  4I02 A;  2FX0 A;  2ZME B;  1VND A;  2JPB A;  3P5J A;  3OYC A;  4XLP F;  1I6X A;  3BJA A;  4EAT A;  4RM3 A;  2DFF A;  2KJB A;  3BG7 A;  4RGR A;  1HF0 A;  1VQ8 I;  3CDH A;  5DYM A;  1MH3 A;  5E1X A;  1SMY F;  1XSD A;  4W97 A;  1T08 B;  1Z91 A;  2XAU A;  1ENH A;  4Y33 A;  5BPI A;  1IRZ A;  1K7A A;  3WU0 A;  1ZRF A;  1E3H A;  5IT9 K;  3QPT A;  5E8I A;  3WGH A;  1JJ8 C;  2F48 A;  5EG0 B;  4KMF A;  1MMG A;  1ACI A;  2HZT A;  1E17 A;  2VKD A;  2JSP A;  2DYS H;  2ECC A;  4MQV A;  2IGM A;  2WY7 Q;  3OOU A;  1SVM A;  5HDK A;  2DPD A;  1HW1 A;  1ZKG A;  5K1Y A;  1SEU A;  1P2F A;  3WOD F;  1F5T A;  2VBX A;  2MD0 A;  1SD4 A;  4ZYE A;  2LVS A;  2JTV A;  3RZD J;  1S7E A;  3I4N J;  2O9L A;  2HQR A;  2OTJ I;  5ILU A;  3VFZ A;  1ZLK A;  3P7N A;  4E6K G;  1UHM A;  3PNV A;  3LAP A;  1LNW A;  3A0B C;  2OQG A;  1L3L A;  4X6A J;  5E79 C;  4HLY A;  2KP6 A;  4CO8 A;  2LF7 A;  3O8G A;  5TGT A;  3NRV A;  4BYY A;  4QSH A;  1R9T J;  2MFZ A;  4HX4 A;  1Y56 A;  5M5Y J;  5GPA A;  2Q1Z B;  2COB A;  5K5R A;  1MBH A;  4E7L A;  4IF4 A;  2D1H A;  2FOK A;  2VPR A;  2RNG A;  1W4M A;  2IA1 A;  5HNF A;  1ZG1 A;  4AVP A;  4XRM A;  3KX2 A;  3ZOB A;  3N97 A;  5E8G A;  1BI2 A;  2R5Z B;  2JVH A;  2XAH A;  5EDN A;  3P9K A;  4XLH A;  2L4A A;  4OIN F;  3CLQ A;  3A02 A;  2P5L C;  3S3O A;  4A3I J;  3UKG A;  1JGG A;  4BHC A;  1K6O A;  3ZGK A;  4CA0 A;  4OOI A;  3E3V A;  1SMT A;  3HKZ N;  2CW8 A;  1KGS A;  1J0R A;  3M3Y J;  1J75 A;  2DOE A;  1HBX G;  1YJ9 I;  4IVN A;  4MEX F;  4AYB A;  2LRD A;  3OYE A;  1IUY A;  2OCE A;  1CF7 A;  5DUI A;  2K9Q A;  4BXF A;  5JHU A;  4ZH4 F;  3FDY A;  4A3M J;  2K9L A;  2HPI A;  4GXO A;  5EJC A;  3KZI C;  3H9G A;  3BJ6 A;  4HLX A;  3DEU A;  2ZBK A;  3QU3 A;  2XB0 X;  4PK4 A;  4KT5 C;  4IXA A;  2G7H A;  1ETQ A;  2E7W A;  4HV6 A;  2X0L A;  2BXY A;  1P4X A;  2Z16 A;  4RGS A;  3CD6 I;  2K86 A;  2B7E A;  2M7B A;  2XDV A;  4BE0 A;  3FK6 A;  4CXF A;  3CO7 C;  3BZ6 A;  1VFC A;  1ZGA A;  2LKP A;  5GAH J;  1CGP A;  1BC7 C;  3C7J A;  1G59 A;  2A07 F;  1OCZ H;  4IRH A;  5HS9 A;  4UVA A;  1LFU P;  1V5E A;  3UNG C;  2K4B A;  4DJA A;  3BR6 A;  3TDU C;  1ON2 A;  5GTH C;  3F8N A;  3HIF A;  1LE8 A;  1OYY A;  2XF6 A;  3KCC A;  4PJM A;  4G8X A;  3BR5 A;  2LC2 A;  2M7A A;  3F8C A;  2VUM J;  2M5W A;  2OU2 A;  1PVE A;  3KP6 A;  1I6H J;  3GF2 A;  2JZY A;  2WV1 A;  4IKF A;  5CVU A;  2JA7 J;  2Z1D A;  4YIR X;  2O61 A;  4CCJ A;  1IG7 A;  4KN7 X;  2F6C A;  2VC1 A;  4NB5 A;  3K6G A;  3JRA A;  5LD2 C;  2V9V A;  5F64 A;  1J9I A;  3BDD A;  2IGK A;  2NOG A;  3BPV A;  1WRJ A;  3L00 A;  1YFH A;  2BHY A;  1Y1W J;  2DFE A;  5EZH A;  5HLH A;  1U6G A;  4UUV A;  1E2X A;  3LNQ A;  1NK3 P;  2OZU A;  2XIG A;  5C44 J;  1N25 A;  3ZMV A;  5FO5 A;  2ME6 A;  3JCU C;  5ICG A;  3EYI A;  4A93 J;  1ZAR A;  2QKM B;  3P9C A;  3ZQC A;  2DFI A;  1REP C;  1Z67 A;  4RB3 C;  3V7S A;  2GIZ A;  3BG6 A;  3C2G A;  1PYV A;  4GYI A;  1B72 A;  2M1B A;  3HGY A;  3FM3 A;  3AAF A;  1W5S A;  4A6E A;  2LYC A;  2ECB A;  3FF5 A;  2VB6 A;  3K1M A;  2OUM A;  4J01 A;  1E3P A;  4XRS A;  3SZG A;  4U0Y A;  2TCT A;  1CF7 B;  2VI6 A;  2QSF X;  3M1E A;  5M5W J;  1MNM C;  2LBF A;  1Z9C A;  2PJR B;  2F5V A;  5HNH A;  3VSL A;  2HZD A;  2P6S A;  4U7D A;  1R36 A;  2LH9 A;  3COA C;  1V55 H;  5EEH A;  3H0G J;  1MNE A;  3RKW A;  2J5O A;  2HXO A;  4ZTF A;  3J7Z I;  3CES A;  1FWZ A;  2BE5 F;  1DP7 P;  4RB2 C;  2KRC A;  3ZP5 A;  3M8J A;  5FRO A;  2KRH A;  1W7P A;  2Y0M A;  3TL4 X;  3H36 A;  1UST A;  2XB5 A;  4HX7 A;  4EM1 A;  4U87 A;  2COM A;  3D1N I;  2XPV A;  5A2Q Z;  3HSF A;  1D1A A;  4I01 A;  4Z6Y A;  2DJI A;  2E36 A;  2MC4 A;  5FFZ A;  4XLF A;  4F91 B;  2CV0 A;  1MBK A;  1TT5 B;  5HLI A;  1LE8 B;  2M87 A;  3TQN A;  3JRB A;  3KYC B;  4XR6 A;  4HNT A;  2M0C A;  1FP1 D;  1B59 A;  4E7K A;  2IBD A;  2XGD A;  2WB1 N;  1TNS A;  3V4G A;  2AXT C;  4F3Q A;  3GEZ A;  4ESJ A;  1ITY A;  3K69 A;  1IDY A;  3VB2 A;  5DM6 F;  2KQR A;  1YQA A;  4F7Z A;  2V1D A;  3IHU A;  1J59 A;  2Q0O A;  3QYE A;  3SDG A;  2VQH A;  1MIJ A;  1MBF A;  1S7O A;  2IPQ X;  4BHP A;  4L5E A;  2R7O A;  3BOQ A;  3GME A;  3KEY A;  3ECO A;  3NWS A;  4W1U A;  2EV6 A;  4YFN F;  1S7A A;  2IA2 A;  3T8T A;  2DFH A;  3EUA A;  1A6I A;  4D9J A;  3LSR A;  3CO6 C;  2EA2 A;  4KUM A;  3ZMS A;  4BE1 A;  4EGZ A;  1VQL I;  5LRS A;  2BY0 A;  2DA5 A;  3EYY A;  4WF2 A;  2OJE D;  4HF2 A;  1KA8 A;  4Y17 A;  4DOZ A;  2XGE A;  1RRJ A;  2L7Z A;  1LUJ B;  2GWR A;  1U5T C;  3SXY A;  1MJ9 A;  4Y13 A;  2HQN A;  3KLN A;  2Z33 A;  2HOS A;  5CQE A;  1JHF A;  3CZ6 A;  1MDM B;  2WC2 A;  1GDT A;  4LIV A;  3HXL A;  1XSV A;  1ZLJ A;  1G3W A;  1FOW A;  3ZPL A;  1SVO A;  2EIK H;  5CKT A;  3K4L A;  1B4A A;  4EJU A;  1PDN C;  3MMY B;  3ABK H;  2V1X A;  2EFQ A;  3KP2 A;  3LSP A;  2AHQ A;  1I50 J;  3HRT A;  2ELJ A;  4ZYG A;  5B5E C;  5IY5 H;  2RVC A;  4ZDO A;  1LDJ A;  3OYG A;  4IHV A;  2ZXW H;  4IOA F;  1W7P B;  4MFE A;  2K4J A;  1BR1 A;  1C0W A;  4LB6 B;  3ERE D;  5GTI C;  4QPO A;  3MQ0 A;  1KZH A;  1S72 I;  2E1C A;  3GW2 A;  3V7C A;  4YFK F;  1D3Y A;  1DDN A;  4ENN A;  5LEJ A;  1R5G A;  3CCY A;  2L54 A;  2KDO A;  4P96 A;  1R49 A;  2N8G A;  2QWW A;  4II3 A;  4XKC A;  1P92 A;  4AWX B;  2WAQ A;  4GYG A;  2RNJ A;  3NQO A;  3ISP A;  4AU7 A;  5HVQ C;  2FBH A;  5HOO A;  4HYE A;  3M7G A;  1FZP B;  2E35 A;  1VQN I;  1K61 A;  5FD5 A;  2R7U A;  2DXI A;  4KIF A;  2EWN A;  4C30 A;  3TOB A;  5D8L B;  1FLI A;  4UUT A;  1MGT A;  4YEJ A;  4FIS A;  1N77 A;  2MBF A;  5FKO A;  2XF7 A;  3BWG A;  4ON0 A;  4CDG A;  1UJ8 A;  2GM4 A;  3FXM A;  4MQ9 F;  4PCQ A;  1YX5 A;  6PAX A;  4EVI A;  1WSU A;  5IPA A;  1H9G A;  2Q2E A;  1OCC H;  4Q4Z F;  2L9R A;  4D7M A;  3WGI A;  4IEJ A;  3CUQ C;  1HDP A;  2EB7 A;  4RGU A;  3OV8 A;  2HS5 A;  2V9K A;  3TBI A;  1BN5 A;  4HOB A;  2XGC A;  4CCM A;  4E4H A;  4HNV A;  2WAE A;  2DBB A;  4XM3 A;  5L3D A;  5AON A;  3L2R A;  3W3C A;  3A01 A;  2LY9 A;  3EUH C;  4ENK A;  1LFP A;  1TW3 A;  2W57 A;  5ED4 A;  4G7O F;  3S17 J;  2HOA A;  4D5F A;  3D5R C;  4HG2 A;  4RDU A;  1FYM A;  2JA5 J;  3OYB A;  3RI4 A;  2VOD A;  5HDG A;  3SEZ A;  4KNY A;  2JSC A;  1VQ5 I;  3IH2 A;  4MHG A;  2R7X A;  4C3J J;  3WTS C;  1ETY A;  2DA1 A;  3K2Z A;  4XN0 A;  3QAH A;  4JP0 A;  1MND A;  3NAR A;  2E19 A;  2WTE A;  3ABM H;  2MSY A;  3TDZ C;  1D0Y A;  3HJE A;  1S29 A;  2L02 A;  2R3S A;  4CCL A;  2M8G X;  3K1P A;  3LSK A;  1YX3 A;  2QQ8 A;  4EM2 A;  4YEL A;  4R79 A;  3HHG A;  5BS6 A;  1ZK8 A;  3ZQG A;  4A3K J;  9ANT A;  3HEF A;  3K10 A;  1F1Z A;  4DYC A;  4LG0 A;  1PUF A;  1FSH A;  3VWB A;  2M9H A;  2X51 A;  4OIR F;  1P4A A;  2A5W A;  5C3E J;  1W7P D;  3C1D A;  4Q48 A;  3WTX C;  3HOS A;  4F92 B;  5CVR A;  2PN6 A;  1J2X A;  5ILV A;  5KVR A;  3MKY B;  4JX6 A;  3CCQ I;  1RPW A;  4LOC A;  1Z7U A;  4LMY A;  1R1T A;  5CVV A;  5K5Q A;  4XLN F;  2CG4 A;  4KFC A;  3I58 A;  3BRO A;  4LGW A;  2L9S A;  4BAC A;  1DU0 A;  3F8M A;  2L01 A;  2FSW A;  3E6B A;  2EPF A;  1XGN A;  1HW5 A;  3I71 A;  1FEX A;  3CME I;  2H27 A;  5DCF A;  3FM5 A;  3VYR B;  2M4K A;  2HDC A;  2Q2E B;  4G6D A;  4KDP A;  2V26 A;  4S0H B;  4QPQ A;  1IXC A;  2VLA A;  1JHH A;  5GAG J;  3KE2 A;  3LFK A;  1ZGJ A;  2XRO A;  4HF1 A;  4G94 A;  3PL8 A;  1MMA A;  1JJ6 C;  3CCR I;  3ELK A;  3K1N A;  1YW9 A;  2VJJ A;  2D2W A;  4AM3 A;  2FEZ A;  1JTY A;  1DGR M;  2HXI A;  1Y8R B;  2NVY J;  3CDL A;  3DLA A;  3A01 B;  5A2Q K;  3A0H C;  3S2D J;  1D5V A;  2K3F A;  2C6Y A;  2L7F P;  4NC6 A;  1TWF J;  3S8P A;  2OAZ A;  3BR3 A;  2DYR H;  3BQY A;  5LGU A;  1HKQ A;  5TIS C;  1LDD A;  3QYF A;  4U0W A;  2BZT A;  1Z6R A;  2VJ5 A;  2UUZ A;  1A35 A;  2VT2 A;  1AKH A;  1UG0 A;  3BCB A;  3PM1 A;  2EV5 A;  3CCU I;  2XF5 A;  3GYH X;  2E1M C;  3AG3 H;  3WE2 A;  2MA3 A;  3K2A A;  2VKV A;  5IP6 A;  3RQI A;  1XGS A;  5EYR A;  5E1Z B;  2IEK A;  1IN7 A;  1YTY A;  3D5L A;  4XOP A;  3G1O A;  1XX5 A;  1NG6 A;  2R7T A;  3GFJ A;  2Y48 A;  3GZN B;  4NC8 A;  4P5O A;  4RAG A;  4LG0 B;  2XAJ A;  3IV5 A;  2CUJ A;  2ZC2 A;  2L3D A;  2QYO A;  3JAM Z;  4ENJ A;  2DTR A;  1A6Q A;  2W48 A;  3ZMT A;  3PUF A;  2Y0S N;  2MW8 A;  1KYZ A;  1XC5 A;  3CTA A;  5FB2 A;  4H0E A;  1QA6 A;  3S1Q J;  5F04 A;  1LPQ A;  2QKL B;  3HRS A;  1X58 A;  2Y9Y A;  3ASO H;  1X2M A;  5J40 A;  4JX4 A;  1V3F A;  2FML A;  3F72 A;  4HDV A;  2ZNZ A;  4II2 A;  5HDN A;  2IS2 A;  2ZCW A;  1P7I A;  4OWR B;  5J8F A;  1Q1H A;  1KU2 A;  1FX7 A;  2B0L A;  2DMU A;  2EFO A;  1HXD A;  3OIO A;  3IUO A;  2F4O B;  1SFK A;  2ICW G;  4ENM A;  3KP5 A;  4PJL A;  2I8D A;  4ZJZ A;  3FXJ A;  4G12 A;  1ZN2 A;  3VYS B;  1OKR A;  5FLM J;  1QNT A;  1FBU A;  2EQR A;  3WTU C;  5DD8 A;  1XDU A;  3CC2 I;  2DT7 B;  4BS9 A;  3JR9 A;  2RN7 A;  1R58 A;  1WKM A;  4X1E A;  4ZYD A;  1YO5 C;  1KU7 A;  3CQZ J;  1O3S A;  1OMI A;  4B43 A;  4OAZ A;  5ILS A;  3OIP A;  3GTQ J;  2DK5 A;  1VZ0 A;  2GBY A;  3GZ6 A;  1ZRC A;  3I3L A;  3FXK A;  3ZQI A;  2P4W A;  5EG0 A;  1AKH B;  1PP7 U;  5JI6 A;  1QU3 A;  1TZL A;  5IYC J;  2JVG A;  3VSK A;  3OR1 C;  3PJR A;  1FIP A;  1S9H A;  5DTD A;  4UVB A;  2R93 J;  3H92 A;  4PJJ A;  3O2P E;  5F1R A;  4NC7 A;  3MZH A;  1ZQ3 P;  2A68 F;  1TP4 A;  2X6O A;  3OYH A;  5K7F A;  4CHU A;  2XKP A;  2EFN A;  1ETO A;  1Z77 A;  5DD4 A;  3HTU A;  1X4O A;  2KKO A;  4XN3 A;  2Y30 A;  3WHC A;  2CQN A;  1Y6I A;  3JTG A;  2KFD A;  2W25 A;  3S32 A;  2ESH A;  1TBX A;  2KJC A;  2QVO A;  2XHK A;  2P0W A;  3CCJ I;  3M8E A;  4LG3 A;  1K4T A;  2DPU A;  2VQG A;  1D0Z A;  3PQJ A;  2Z99 A;  4CYD A;  2VBW A;  4HAM A;  1G3T A;  4RA2 A;  2ZO4 A;  2PBI A;  3D5S C;  4EQQ A;  1S8N A;  4NUB A;  3OSF A;  3OYN A;  1A5J A;  3H5N A;  2ADU A;  3H9Q A;  1W1W E;  3JRI A;  3F22 A;  4B1R A;  4FX0 A;  1TWH J;  4ESF A;  4A3G J;  4IHS A;  3ECH A;  1GUU A;  4UUS A;  2FNP A;  3DKX A;  4M71 A;  3WE3 A;  4GGG A;  1Z3Y A;  4MNU A;  3HTS B;  4YRV A;  3K70 D;  4BU2 A;  4ZTJ A;  3S1R J;  1JGS A;  2YU3 A;  3M1C A;  1HC8 A;  1W5T A;  5FLV A;  1ZG5 A;  2HKX A;  1K6Y A;  4PGG A;  1QHH D;  3CP8 A;  2NAZ A;  2QLZ A;  5CVJ A;  2JPC A;  5HS7 A;  3LSJ A;  2F5C A;  3HKZ A;  2KIM A;  2BY3 A;  4D1Q A;  5B1A H;  1BOA A;  2TDX A;  1QQI A;  3FXO A;  4C3H J;  3Q5F A;  4HV5 A;  3U2R A;  4NBQ A;  2L9V A;  3TMO A;  3DKY A;  2CQK A;  4FHT A;  3QOE A;  2QUF A;  5L3F A;  1JKO C;  2XC7 A;  1L0O C;  1Z3X A;  4LFU A;  1Y8Q B;  2VKH A;  3OMY A;  3ULQ B;  4ITV A;  2DCE A;  4A0X A;  2D5V A;  1FTZ A;  3DU6 A;  1FBS A;  2ETH A;  3WTZ A;  2DW4 A;  4P55 A;  3R0A A;  1XGM A;  5ERI A;  3ZMZ A;  1AU7 A;  1CQT A;  3R4K A;  4IOC F;  3U1K A;  3HM5 A;  1X1C A;  1LQ1 A;  2FNA A;  5DUK A;  2HOT A;  3QPS A;  1ULY A;  3CP2 A;  5CLS A;  4C9Y A;  2GLO A;  1APL C;  3LSM A;  4A3E J;  1UCR A;  5FD6 A;  1BL0 A;  1Z6T A;  2LMD A;  3RCO A;  3Q3S A;  3W2V A;  3HBL A;  3Q0U A;  1PJR A;  5E3M A;  2CS3 A;  3K4K A;  2Y9Z A;  2BOL A;  2JRM A;  4NDL A;  2P81 A;  4ZZL A;  2JWT A;  1B8I A;  2HOE A;  4WWC A;  1XMX A;  1XTA A;  2PFB A;  2CRG A;  3OYA A;  2W1O A;  3IC7 A;  2NVU B;  4UUS B;  5EGO A;  5J1R A;  3HOT A;  1ETK A;  3REO A;  2A69 F;  2MGQ A;  3I56 I;  3B73 A;  4HQM A;  2IJL A;  3H35 A;  1Z05 A;  3EPZ A;  3S15 J;  2LKS A;  1JKP C;  1R23 A;  1XD7 A;  1XDS A;  4I98 B;  1EA3 A;  5FRN A;  4B3A A;  1ZEL A;  1LVK A;  3E6C C;  5JHF A;  5KAI C;  2WV0 A;  1KQ9 A;  2DQR A;  3AL0 C;  1BR4 A;  1MBG A;  3WG7 H;  1LJ9 A;  4UXN A;  1E0E A;  2PJR A;  4M9Z A;  1TWC J;  2Y69 H;  1I27 A;  4EV0 A;  2MLG A;  4YFX F;  3F8F A;  2H6C A;  2MD5 A;  4B8X A;  1Y39 A;  1FIA A;  4AIK A;  1KU9 A;  3KEO A;  4HPQ A;  5DDG A;  3QRF F;  3LA2 A;  3DFG A;  4ETS A;  1QVU A;  1T38 A;  1HSJ A;  1WHU A;  4UB8 C;  1BIA A;  1W0T A;  3SJM A;  4HNU A;  2RDP A;  2CW7 A;  2YS9 A;  1GVD A;  5GAE J;  2BXZ A;  2PMZ N;  2R7W A;  2XRL A;  4BEH B;  3JAM K;  3I55 I;  2Q8K A;  2GXA A;  4DQ2 A;  3CF2 A;  3WU1 B;  4FET A;  2BY2 A;  1VF9 A;  2XAS A;  5FKN A;  1JUM A;  1XCV A;  1G3S A;  2O7O A;  2FBI A;  2VJI A;  4RGX A;  5FLX Z;  3WG9 A;  2KL4 A;  2V6C A;  2EFP A;  2HEO A;  2JA2 A;  1RZ4 A;  3GFL A;  2JN6 A;  2ZXJ A;  1MMS A;  3CUQ A;  3BQZ A;  1JE8 A;  3O3K A;  1B8I B;  2WB1 A;  1GV2 A;  4JK1 X;  2ISY A;  2ID3 A;  2HKO A;  2QGU A;  5J4V A;  2STT A;  2AQE A;  1DP3 A;  5EGO B;  2B63 J;  2VE9 A;  1T0F A;  2JRT A;  3EUH A;  4OAY A;  1BJA A;  2FE3 A;  2L7M P;  3NWT A;  1W36 C;  2FOW A;  2MAB A;  4BNC A;  3SQN A;  3C2H A;  4XLA A;  5F08 A;  3F23 A;  3SHF A;  4JYK A;  2CJJ A;  4XOT A;  3HPH A;  2X9D A;  3Q9S A;  1DPR A;  1T98 A;  3E1S A;  3K4B A;  1BI0 A;  2CQQ A;  2HYF A;  3E5X A;  3FWE A;  1MDM A;  2AQF A;  3I53 A;  1J7K A;  3G71 I;  3DKW A;  4DYQ A;  3LOC A;  4IX7 A;  1JI8 A;  4KIS A;  3RPQ A;  2BVL A;  3ESW B;  1JUP A;  1F43 A;  2DU9 A;  4LLL A;  1I3Q J;  2WWY A;  3IH3 A;  2VE8 A;  2EFW A;  2O6G E;  3MKZ A;  3K7A J;  4CCN A;  1YIT I;  2OQR A;  4U88 A;  3S3N A;  1YRN A;  3KP3 A;  3GFI A;  2LLK A;  1MMD A;  1FSE A;  1IV8 A;  2DT6 A;  2O3F A;  3L2V A;  2NNN A;  4OMY A;  4CGZ A;  1QZY A;  4D0P A;  2BW3 A;  5JLX A;  1BBY A;  3HOX J;  4EJO A;  5LHH A;  1ONV A;  2GA2 A;  3RYP A;  1R22 A;  3VDX A;  3QP5 A;  2DMP A;  5CYV A;  3ZR8 X;  4BJ6 C;  1OCR H;  2DTZ A;  2DA4 A;  1GT0 C;  3KZY A;  3M8F A;  4UV8 A;  5FKL A;  3L9F A;  2W24 A;  2ZJR F;  2ZJ2 A;  1FOY A;  2K40 A;  1STZ A;  2K5C A;  4BQQ A;  3GTK J;  2VPL A;  1J5Y A;  1XMK A;  1D8K A;  4Y3O A;  3LQR A;  2AXL A;  3CUQ B;  3DU5 A;  3KP4 A;  1X1D A;  3V42 A;  2HPM A;  2YSR A;  4WXH A;  3FXU A;  4P9U A;  3BR1 A;  2E1O A;  5J1Y A;  1I1G A;  1IV6 A;  2W00 A;  3GWZ A;  2CV2 A;  2ZFU A;  5H6Q A;  4XON A;  3V8L A;  2HQ5 A;  3KEQ A;  5H6R A;  1DQU A;  1LB2 A;  3ZQQ A;  3MZY A;  4RS8 A;  2FMY A;  1X19 A;  3PNT A;  5KCM A;  3FMS A;  1WQ2 A;  5LRR A;  3CLO A;  1UZC A;  1QRY A;  2CUE A;  4GO1 A;  2YU9 J;  4UVC A;  5LLQ A;  3FXL A;  1XSX A;  3K4J A;  2K27 A;  1TW2 A;  2X1D A;  3RJP A;  4BQN A;  4IO9 F;  2MG4 A;  1XGO A;  3IKT A;  2YX7 A;  4KMU X;  3VEP A;  4I99 C;  4CZC A;  4O3M A;  1R1U A;  4HZF A;  1BC8 C;  1YRN B;  3GTL J;  5E18 F;  2CYY A;  2M45 A;  1X2N A;  4RLF A;  3RSN A;  4XQF A;  3G1L A;  5L3C A;  1JTX A;  4I09 A;  2HVR A;  3OL4 A;  2VN2 A;  4E7Z A;  4H4K C;  1FC3 A;  5EEA A;  1ERD A;  3IKV A;  3SYT A;  2MYS A;  1ZRD A;  2PI0 A;  1BI3 A;  3MWM A;  2LP0 A;  2BW3 B;  2HWV A;  4LIT A;  1WCM J;  1R5I D;  1X1P A;  2DMN A;  4UV9 A;  4MTE A;  4RB1 A;  3L09 A;  3MVP A;  4Z2Y A;  3OYD A;  3JRG A;  2LD5 A;  2CFO A;  1RET A;  2ID6 A;  2EH3 A;  4AIJ A;  3FHN A;  4E7J A;  4C3I J;  3JSO A;  4HRI A;  3RYR A;  3MKL A;  1RUN A;  4ZYA A;  1GHC A;  5DEQ A;  2E7X A;  2F5D A;  3ONQ A;  3BZK A;  2AS5 F;  3KYD B;  3PIP F;  1ZYR F;  2QQB A;  4KIB A;  1K4S A;  1JKR C;  5J47 A;  5DCM A;  1FBQ A;  4BE2 A;  4UB6 C;  1R4N B;  3EQL F;  4UHT A;  5KHD A;  2E5N A;  4S05 A;  1SD6 A;  1JXS A;  3OWT A;  1IUF A;  2JUC A;  1QBJ A;  4KIT B;  4UNO A;  4LK1 F;  1HST A;  1AOY A;  2R92 J;  2NXN B;  3A1Y A;  3J7A Y;  3OY9 A;  3CDI A;  3Q9V A;  4U7B A;  4PSW A;  1TNT A;  1UFM A;  2DO7 A;  3WTV C;  1U9O A;  1X1B A;  2EJR A;  3E5U A;  2WAF A;  2E5Z A;  1XG1 A;  2G9W A;  5AIQ A;  3B6A A;  1ZGW A;  2YPR A;  3ASN H;  4MLO A;  3TED A;  4M3D A;  5C4X J;  3HZJ A;  4ABZ A;  1ZRE A;  2Z9O A;  3PO3 J;  3EET A;  2E1M B;  1BI1 A;  2X4H A;  3T5X A;  4OIP F;  4P9F A;  2Z3Y A;  1ZR2 A;  2ME0 A;  4F52 A;  4L9J A;  4PUS A;  3ML6 A;  3CC4 I;  1BW5 A;  4BY7 J;  1IGN A;  3DP7 A;  3B02 A;  1NG7 A;  3HPG A;  4A2U A;  1U78 A;  3BC8 A;  1IW7 F;  1T2K A;  3A03 A;  2HVQ A;  3DXJ F;  2KZV A;  1QHG A;  5FLX K;  1XB4 A;  1U2W A;  5EF6 A;  1H8A C;  4DW6 A;  3CF5 F;  2KMU A;  1YOV B;  1YI2 I;  2EZL A;  3HHH A;  1OCO H;  2HI3 A;  3PFI A;  2OA4 A;  4M3E A;  5D6E A;  5AIP A;  4D5C A;  3RKQ A;  3BTC A;  3JRD A;  4A3J J;  1OCT C;  4AC0 A;  3G4S I;  1A36 A;  3JRC A;  2NRA C;  2W7N A;  1OPC A;  2JA8 J;  3SZP A;  2HDD A;  1MJA A;  2DJN A;  3EDP A;  2RQQ A;  3DQV C;  4LD5 A;  4M3F A;  1R4M B;  1ZR4 A;  3DPU A;  4N0B A;  4E70 A;  1ZAO A;  2ESN A;  4PDK A;  1P6R A;  1R00 A;  3DPL C;  4XLE A;  4D7N A;  4QLC U;  1WI9 A;  2DQL A;  5IOY A;  1RKT A;  3GLL A;  1RR8 C;  2DA2 A;  3OL3 A;  1PUE E;  4IHY A;  1LDK B;  2BYV E;  3V8J A;  3S1M J;  5K5O A;  2VC0 A;  1OR7 C;  1SAX A;  1WFX A;  2V1N A;  3SEQ A;  4V2G A;  5DCM B;  1H88 C;  2L2O A;  4BAY A;  2EV0 A;  3LA7 A;  3QP6 A;  3EUK L;  2KHM A;  4N9I A;  3TGN A;  4UY8 I;  2VON A;  3S1N J;  3BLY A;  2Y0S A;  3MAJ A;  5L3E A;  1D8J A;  1B6A A;  2AO9 A;  4LLN A;  2PEX A;  2DT5 A;  3KYL A;  2ZJQ F;  1Z7L A;  1B1B A;  3DBR B;  2IT0 A;  1SFU A;  4WX9 A;  1N75 A;  2ACJ A;  1KYW A;  2CUF A;  4O6J A;  5J4Y A;  2VKE A;  2F4M B;  4HST A;  2HYG D;  1OQY A;  1OYI A;  1P9Q C;  2UXN A;  1BOB A;  1O7F A;  2X6W A;  1POG A;  1R71 A;  3IRR A;  1XCB A;  2J5P A;  5LHI A;  1VQP I;  3JRE A;  2KT0 A;  2W4S A;  4HDU A;  5TRD A;  4WCG A;  4B44 A;  1WJ5 A;  3KZZ A;  4BJT A;  1IRG A;  2Z2S B;  4RAF A;  2R7Z J;  2A6E F;  3J81 Z;  4ZDL A;  3CCM I;  5J8C A;  5ICE A;  5DS9 A;  5E17 F;  1WJB A;  2A3S A;  3CC7 I;  4FE4 A;  2CSO A;  5M5X J;  2R7D A;  4DZP A;  1O7L A;  3CJR B;  2P6T A;  3I59 A;  1ORK A;  3W6J B;  4V2F A;  2PJP A;  2ZXI A;  1SFE A;  2CQX A;  2DOA A;  4B09 A;  4YG2 F;  2O03 A;  3B6C A;  1R5H A;  1S6L A;  2MH9 A;  5LBQ A;  4I2O A;  1OYW A;  3HGG A;  3H9J A;  1TQM A;  2VL8 A;  5FFX A;  4BQO A;  3VPR A;  3F21 A;  2X6X A;  1VQ4 I;  4QIW N;  2JT1 A;  4EEF G;  5EZG A;  4C2T A;  3T1B A;  2ZJP F;  1T39 A;  2RV8 A;  2DDA A;  3S14 J;  1TC3 C;  4KA4 A;  3HRU A;  3F6O A;  1Q1V A;  1WJD A;  2OC6 A;  2XSJ C;  2HTS A;  4A5M A;  4HSR A;  4M72 A;  2H09 A;  4BXX J;  1HKS A;  2HGC A;  2LDU A;  1F36 A;  4IL6 C;  3GO5 A;  4A69 C;  4L9N A;  2XSD C;  1UEL B;  2PX9 A;  2E60 A;  3I4P A;  4KYW A;  1YHQ I;  4XIC A;  3U1D A;  5HLT A;  3LAJ A;  3GTO J;  4A3L J;  4I0A A;  3DTK A;  3E97 A;  1WZ2 A;  2XKO A;  1BR2 A;  4PJ0 C;  5D5X B;  5F27 A;  4BHB A;  4AD9 A;  5B3S H;  3HOV J;  3DWL E;  2Z5U A;  1BIB A;  2BY1 A;  4XK4 A;  2IGO A;  4DGW B;  1FT9 A;  3I9V 2;  4DBQ A;  2I5U A;  3QOP A;  2KLO A;  2OBP A;  2WA0 A;  5IT3 A;  2IS4 A;  2O0Y A;  3GTG J;  4XBF A;  4KJZ A;  4BXU A;  2LG4 A;  4I76 A;  5KNL A;  1PP8 F;  1JKQ C;  3H3V K;  4CH7 A;  1IN4 A;  5GPC A;  3BTJ A;  3PNY A;  4XKV A;  3C3W A;  2LY1 A;  1EH8 A;  2A5Y B;  2WY8 Q;  3I59 B;  2GXB A;  4CSW A;  2BEO A;  2M0M A;  2RAE A;  4BJ5 C;  4IZZ A;  2R7S A;  5H20 A;  4PGH A;  2IAI A;  3S2H J;  4A3B J;  1G6N A;  3L2Q A;  4M3B A;  5E20 A;  3W6K B;  3BPX A;  4A0Z A;  4WK8 F;  4AUX A;  2G0E A;  4XSZ F;  1TL8 A;  2VAS A;  3ZRG A;  1HW2 A;  1OFC X;  1JUS A;  2ISZ A;  3FMR A;  1WPK A;  2DLL A;  2CQ7 A;  3G1M A;  5FKM A;  1AA7 A;  2LY2 A;  4I7H A;  2K9S A;  2LKX A;  4M74 A;  1U8B A;  2KZG A;  2X48 A;  2XAQ A;  4LK0 F;  1ODD A;  3OOP A;  1ETX A;  4IJA A;  1XPX A;  1VTN C;  1H89 C;  3KIO A;  4RM2 A;  1IO2 A;  3AL0 B;  3RZO J;  1P4W A;  2V9P A;  4HX8 A;  1O57 A;  1FP2 A;  2I10 A;  1SAU A;  3QWL A;  4LJZ F;  3CMA I;  2QBY A;  1O3Q A;  3C2B A;  2IRF G;  2JA6 J;  1YW8 A;  1UMQ A;  4XNF A;  2VOP A;  2VQC A;  3KP7 A;  4Y4R A;  2DK8 A;  1RC9 A;  4EJW A;  1SVL A;  4YII A;  2B9S A;  4HBL A;  3FBI B;  1IAW A;  4MFD A;  4IRI A;  5K7H A;  2R5Y A;  3R60 A;  2HQA A;  3BG5 A;  2XVC A;  2IGN A;  5FRM A;  1JT0 A;  1RI7 A;  2VIX A;  3I54 A;  3LFU A;  1T95 A;  4IPA A;  1TQP A;  3V7R A;  1O4X A;  1WJA A;  4Q5S F;  5D6F A;  2FU4 A;  1TQI A;  1HLV A;  2CMP A;  2M2E A;  4B4C A;  2F5E A;  2JUG A;  2FUG 2;  1YIJ I;  1QPM A;  3BZC A;  3LSG A;  4RBO A;  4KIG A;  2LK2 A;  2EZH A;  1S3J A;  2X6Y A;  4G7Z F;  1LEA A;  3KFW X;  4HA8 A;  4BEH A;  3F6V A;  3K4C A;  1U9N A;  2QSG X;  1FYK A;  2P5K A;  3FKJ A;  3A2K A;  1WI3 A;  3S16 J;  3DBL B;  2DA3 A;  4XOR A;  4XLC A;  2ZSH B;  2FQ4 A;  3DTE A;  4FTH A;  4Q47 A;  5GP9 A;  1VQ7 I;  4M9X A;  2Y31 A;  2VOO A;  2PMZ A;  4F93 B;  5BNG A;  3G3Z A;  3LL7 A;  1RNL A;  1R7J A;  5JVG F;  1VQK I;  4TV7 A;  5CJ9 A;  3JRF A;  3BY6 A;  3IH4 A;  2NVT J;  2VT3 A;  2EBI A;  3O6B B;  1D1C A;  4M73 A;  4ZZD A;  2QEN A;  1U5T A;  4DZJ A;  3OYM A;  4FX4 A;  4F55 A;  3MFK A;  5CQG A;  2M30 A;  4G6Q A;  1SFX A;  2RC4 A;  3DTI A;  1FOK A;  1WJC A;  4G9Y A;  4ESB A;  4PFP A;  2RKH A;  4RMN A;  1D1B A;  2QBY B;  3ZXS A;  3TO6 A;  1GVJ A;  2H94 A;  5HLG A;  1GLN A;  3OSG A;  3FK7 A;  2H1L A;  2RRE A;  1IRX A;  3J81 K;  3F0C A;  2V6E A;  1X3Z B;  2W84 A;  3ZCO A;  2GQQ A;  5DV5 A;  3C18 A;  4P1W A;  2LSO A;  2R5Y B;  1TT0 A;  4BDY A;  4WXD A;  3QPL A;  2OTL I;  5F6F A;  1K78 A;  3DCF A;  1EH7 A;  4B47 A;  4M6X A;  3MN2 A;  4OIQ F;  2FF4 A;  3BR0 A;  3UR3 C;  2A6H F;  4XRS G;  2HYJ A;  1WH7 A;  3QQA A;  4ZC3 A;  3ZQF A;  2R7F A;  3TKY A;  5LGN A;  5JVT A;  1UHS A;  1YE9 A;  2EZI A;  1NTC A;  3GXO A;  2V7F A;  3CMM A;  4JBA A;  1GV5 A;  3GTJ J;  3IL2 A;  1DGW Y;  1MMN A;  2A6T A;  2H1K A;  2P8T A;  1ZH5 A;  2EA4 A;  2NS7 A;  2ZME C;  3A4C A;  3AG4 H;  4CYC A;  3K4N A;  1H9T A;  5D4R A;  3FIW A;  1XMA A;  1HCR A;  2LFB A;  3FX3 A;  3OIQ A;  4BL0 B;  4OU0 A;  1YS7 A;  2BV6 A;  1IN8 A;  5E3O A;  4CIC A;  3WTW C;  2UV1 A;  3RKY A;  4B3X A;  1U0J A;  3GFM A;  2DDB A;  1EKE A;  3JW4 A;  4X0G A;  2X1C A;  1OIS A;  3JTH A;  4L0Y B;  4IHT A;  5KK1 A;  2JQ7 A;  3HRM A;  5IYB J;  1BA5 A;  1U5T B;  2YUS A;  3TO7 A;  5K7Z A;  2R0Q C;  4MIM A;  2O8K A;  3H5A A;  2QF7 A;  1OJL A;  1ETW A;  2DA7 A;  3LSI A;  1JT6 A;  2OF7 A;  2K3P A;  5BMZ A;  1X3U A;  1Y1V J;  3RDI A;  1SC7 A;  1FPQ A;  2ELK A;  4BQA A;  3L7W A;  1W36 D;  3N05 A;  1QZZ A;  3E6D A;  4BBR J;  3IP4 B;  3KLO A;  4EM0 B;  1HOM A;  3GX4 X;  2JK3 A;  3G6E I;  1WJF A;  3S3M A;  2R7V A;  1IXR C;  3OYK A;  3BG3 A;  2UWM A;  2A05 A;  4XKB A;  5IP7 J;  4NQW A;  3N4M A;  3GZ5 A;  4Y15 A;  1IN6 A;  1F9N A;  1MZB A;  1VQ9 I;  4I0B A;  2NS0 A;  2XAG A;  4AYB N;  1AWC A;  3H3U A;  1K78 B;  2QA4 I;  4FQG A;  3NAU A;  3IRQ A;  1KU3 A;  4HW0 A;  1WJE A;  1IZ1 A;  3BTI A;  1J09 A;  3H3Z A;  5C4J J;  4L18 B;  2DMT A;  2OZ6 A;  3H5R A;  4R8H A;  1N78 A;  1U3E M;  4M6Y A;  3J7Y J;  3PSF A;  1LEB A;  2P5V A;  1MJB A;  3VYT B;  3O8H A;  2XUB A;  2VXZ A;  1MSF C;  4G6T B;  1FMW A;  2L5Q A;  3BT9 A;  1OR7 A;  1WGX A;  1YJW I;  2IS6 A;  2NYX A;  4CYC B;  3ZQH A;  2E71 A;  2EZK A;  2K9M A;  1V54 H;  2FJ1 A;  2HNH A;  3ZN0 A;  2E34 A;  2LRE A;  1LFB A;  2FA5 A;  2GOM A;  1SAN A;  1D0X A;  4R1H A;  2GIV A;  4EJT A;  1RKW A;  5F0C A;  4JQF A;  1X4P A;  1RES A;  1EJ9 A;  4YIF A;  2CU7 A;  2R7Q A;  2R4G A;  2DN0 A;  4DYR A;  1U8R A;  5JFR A;  1T6S A;  2CGP A;  3IAM 2;  3OS2 A;  1TTY A;  2XRN A;  1K79 A;  1YLF A;  1WVR A;  3AFH A;  3HG9 A;  1FY7 A;  1T33 A;  1V4R A;  3HSR A;  2LTP A;  1F4K A;  1IXS B;  2RGV A;  4GCV A;  3S93 A;  3L1P A;  3R61 A;  3HB9 A;  2XAF A;  2RQP A;  4A3F J;  2FXA A;  3WGG A;  2EK5 A;  2X85 A;  4CCO A;  2D45 A;  2PMU A;  2EIM H;  3ABT A;  4A5N A;  3GBG A;  3GLX A;  2DAO A;  1M1E B;  2ZB9 A;  3QPH A;  2QQA A;  4MEY F;  4ASN A;  3HOY J;  2OCC H;  5DM7 F;  3OS1 A;  1YG2 A;  4NQW B;  3TP3 A;  1TWG J;  3GUD A;  1ZG3 A;  2VBY A;  1OLT A;  4IQ4 A;  3HL2 A;  5B1B H;  4WXC A;  1USS A;  4PZJ A;  3HDD A;  3E5Q A;  1B9N A;  2NOJ B;  2Y75 A;  4Y52 J;  1MD0 A;  3PQK A;  1G8X A;  3F8B A;  2KDZ A;  2WAD A;  4A0Y A;  1B72 B;  4GDF A;  4LB5 A;  1SD5 A;  3BTL A;  1UHW A;  3DEE A;  4EMS A;  3HOU J;  2PQ8 A;  5CPR B;  3OYI A;  5IYD J;  3QOD A;  2DI3 A;  3NEU A;  1I1S A;  4MTD A;  2CUZ A;  2H8R A;  2PMH A;  4PJN A;  5LEK A;  3I4M J;  2OPT A;  2LBF B;  3HSE A;  2DOF A;  3TOA A;  2GZW A;  3MZ8 A;  1WH5 A;  2OV7 A;  3RPU A;  3DEW A;  3T8R A;  5F1J A;  5B66 C;  5E1W A;  2L4M A;  4AIH A;  1NHA A;  3F3X A;  3LQQ A;  2EIJ H;  3DPT A;  4BDZ A;  4KN4 X;  3M9A A;  4XSX F;  2E2I J;  3ERM A;  3BR2 A;  3FIS A;  2BVM A;  1V5G A;  2ELH A;  1WWX A;  3K4M A;  3SZT A;  5BOX A;  2OD5 A;  4E7I A;  5H2F C;  3J80 Z;  4J19 A;  1XS9 A;  2ZFW A;  1P7J A;  3LMM A;  2BBY A;  2K7L A;  4N4N B;  1YJN I;  1IF1 A;  1H0M A;  1AHD P;  2DA6 A;  4BH9 A;  2V79 A;  3LSH A;  3I5U A;  1ON1 A;  5J3L A;  2H8W A;  4J00 A;  3FZV A;  5GAD J;  2FBK A;  3OYL A;  2LR8 A;  1LKX A;  2M4G A;  2VQL A;  1ZTR A;  3L2C A;  1Z21 A;  3FHZ A;  2O5R A;  5F0H A;  1FOX A;  3DBH B;  1Y0N A;  1YS6 A;  5D5W B;  2HU9 A;  1TWA J;  4IHX A;  4BY1 J;  3DF8 A;  3HOZ J;  5ICC A;  1T56 A;  3S2W A;  3PO2 J;  2XPU A;  2KIS A;  1MBE A;  4OIO F;  1IRF A;  5FKK A;  2KIU A;  4LLG F;  1V5F A;  1DU6 A;  4PFO A;  1Z1D A;  3JRH A;  5TJJ A;  3GTP J;  3PIO F;  1UB9 A;  3DLL F;  3U9G A;  1QO0 D;  4FE7 A;  3CCS I;  3GTM J;  2QQ9 A;  2IVM A;  1QVT A;  4ANJ A;  4GFB A;  2H6B A;  4L9T A;  2K85 A;  4Y7N J;  2JMW A;  1Y0U A;  2F5F A;  4RLQ A;  2QSH X;  3RIR A;  2CFX A;  3IWF A;  4K2E A;  3R6S A;  1SD7 A;  1T0F C;  5IOZ A;  3HUG A;  1K83 J;  2GA1 A;  4DIQ A;  3CCV I;  3WU2 C;  4IRG A;  5D4S A;  3JSP A;  2JJ7 A;  2MC3 A;  5KAF C;  3CCL I;  1FYL A;  3MKW B;  3G73 A;  2M34 A;  3TW7 A;  3SFZ A;  3PFY A;  3HYI A;  2EIN H;  3K9T A;  1EV7 A;  1W0U A;  3ZMD A;  4MO7 A;  3ABU A;  2HTJ A;  4M3G A;  2CO5 A;  2LF8 A;  3LST A;  4ZYH A;  3VOD A;  2P7C B;  1X1A A;  2WAQ N;  2D1V A;  4CZZ A;  4AVZ A;  4BBS J;  5IT9 Z;  3PUB A;  4XRF A;  3W2W A;  1VQO I;  2K9N A;  3QYB A;  3W6V A;  3I0T A;  3L2W A;  2ZNY A;  1G4D A;  2Y2Z A;  3GCM A;  4BKX A;  3P9I A;  4RAZ A;  5J6X A;  3DV8 A;  3ZQL A;  1VQM I;  3ZQ7 A;  1EF4 A;  1R1V A;  1VI0 A;  2GXG A;  2IA0 A;  4V19 K;  3H0D A;  2QM3 A;  2KPM A;  3BG9 A;  1MH4 A;  1EH6 A;  4L5J A;  5BPD A;  4N4O B;  3E0J B;  2NVQ J;  2L7K A;  3MEX A;  5D8K B;  3E6M A;  2WBM A;  3ZN1 A;  4DBR A;  2R7R A;  4HF0 A;  2UZK A;  1O3R A;  2QZ8 A;  5M3M J;  2GOX B;  3FMQ A;  2HVS A;  4A12 A;  4BGD A;  1QPI A;  3BP8 A;  2IW5 A;  5HS8 A;  1Z0X A;  1A04 A;  4AID A;  3J7A O;  2YR2 A;  3G2B A;  4QWQ A;  1T8I A;  1RR7 A;  1MKM A;  4OMZ A;  3RTR A;  1YIO A;  2F4I A;  4O5V A;  3SFI A;  4I6Z A;  2XGX A;  3BJO A;  3CCE I;  3HC7 A;  5FGM A;  5JR3 A;  1TLH B;  2MLK A;  1FTT A;  2STW A;  1R6R A;  3OYF A;  2A61 A;  2ZKZ A;  1QZE A;  2PG4 A;  4IQJ A;  5J1U A;  3FBN B;  2CW0 F;  1I39 A;  1O3T A;  1UAA A;  5CVI A;  2V4J C;  3R0J A;  3HUG B;  1MSE C;  2LNB A;  2CWE A;  4MGR A;  5IP9 J;  1BJZ A;  3VOE A;  2XPW A;  4FAS D;  4CUG A;  3FXR A;  5ICF A;  3RKX A;  5L3G A;  1A31 A;  3Q0W A;  1S5L C;  2DOD A;  3AG2 H;  4G7H F;  3K0L A;  4XMY A;  3CJN A;  3IAS 2;  1ETV A;  3OS0 A;  1IC8 A;  4GRI A;  3QU6 A;  4JOM A;  4IHW A;  1YYV A;  1IN5 A;  1QGP A;  4EJV A;  2KIF A;  2QEX I;  2IS1 A;  1NK2 P;  2V1U A;  5E3L A;  4M9S A;  4E7S A;  2E2J J;  4HEA 2;  3HOW J;  1KQ8 A;  4A3C J;  4XKW A;  2FRH A;  2ZSI B;  2NNY A;  4A3D J;  2YX4 A;  1GXQ A;  3ABL H;  3RPU D;  1RUO A;  4BUP A;  1FMV A;  2GAU A;  1PUF B;  5FJ8 J;  4E7H A;  3TP0 A;  3CUO A;  2O8X A;  2XV4 S;  2EIL H;  4C2U A;  2M8E A;  4ZDP A;  3Q0V A;  2NS8 A;  2FQ3 A;  3TW6 A;  3OR2 C;  3CJT B;  3FXQ A;  2TRT A;  3IWZ A;  4DNC A;  4FCY A;  2E2H J;  1D5Y A;  2VJ4 A;  5JLW A;  5BQT A;  2F2E A;  3E7L A;  3MD2 A;  1LVA A;  4L0Z B;  2BHZ A;  4RB0 A;  2ZME A;  2W82 A;  4B48 A;  1G3Y A;  2LOO A;  2KRF A;  3GVA A;  2W85 A;  1KQ0 A;  3WTY C;  5D5U B;  2K02 A;  1E3O C;  2HR3 A;  1GXP A;  1HDD C;  3LA3 A;  1B9M A;  5EEG A;  3I64 A;  3VYU B;  4CCK A;  5M3F J;  4PSX A;  1KON A;  1FJL A;  1ZHF A;  4KIC A;  1IJW C;  2L0K A;  1VQ6 I;  1DPU A;  2CV1 A;  4LIU A;  1BW6 A;  3KPH A;  2CH0 A;  2BGC A;  3H1C A;  4KT6 A;  3D0S A;  1YW7 A;  2HDW A;  2M3A A;  4L5I A;  4C2M J;  5D5V B;  4A6D A;  3MCZ A;  1DUX C;  1MW7 A;  2P7V B;  3J80 K;  2IXS A;  1I5Z A;  3ZMU A;  4L9V A;  2G7U A;  1RIO H;  2E1N A;  2FD5 A;  4M6V A; 
#chains in the Genus database with same CATH homology
 2A5W A;  1DQU A;  1YE9 A;  3BCA A;  3L2U A;  2V7F A;  3ZQQ A;  3CMM A;  3PSI A;  3HOS A;  4F92 B;  3U21 A;  1DGW Y;  1MMN A;  1X19 A;  2A6T A;  3PNT A;  5KCM A;  3MKY B;  2L9N A;  3SDB A;  3CJQ B;  3AKZ A;  2L9S A;  4BAC A;  3A4C A;  3W2A A;  3K4N A;  3K4J A;  2X1D A;  4BQN A;  3OIQ A;  4BL0 B;  3VYR B;  2M4K A;  2Q2E B;  4CZC A;  2V26 A;  3RQ4 A;  4QPQ A;  2VLA A;  2UV1 A;  2X1E A;  4XL9 A;  3F9K A;  4B3X A;  1U0J A;  4RLF A;  4XQF A;  3RSN A;  2HVR A;  3OL4 A;  3PL8 A;  1MMA A;  4X0G A;  4E7Z A;  2X1C A;  4H4K C;  2ZXH A;  1ERD A;  2VXD A;  3SYT A;  2MYS A;  5LFA A;  2VJJ A;  1HA8 A;  2BW3 B;  4LIT A;  1DGR M;  3DLA A;  3OYD A;  3OYJ A;  2CFO A;  3H5A A;  3K70 C;  4NNJ A;  3LSI A;  3FHN A;  3S8P A;  4E7J A;  4HRI A;  3QYF A;  2K3P A;  4ZYA A;  2VJ5 A;  2UUZ A;  3ONQ A;  1UG0 A;  3BCB A;  3N05 A;  1W36 D;  3OYC A;  3IP4 B;  4EAT A;  2XF5 A;  4RM3 A;  1WJF A;  2E1M C;  3S3M A;  3BG7 A;  2R7V A;  4BE2 A;  3OYK A;  2UWM A;  5KHD A;  2E5N A;  4XKB A;  3OWT A;  2XAU A;  4KIT B;  4Y33 A;  3D5L A;  4XOP A;  1NG6 A;  2R7T A;  3A1Y A;  3J7A Y;  3OY9 A;  4NC8 A;  4P5O A;  4U7B A;  4PSW A;  1WJE A;  1J09 A;  2CUJ A;  1X1B A;  1MMG A;  2WAF A;  3H5R A;  2E5Z A;  1N78 A;  2VKD A;  2JSP A;  2IGM A;  2WY7 Q;  3OOU A;  3PSF A;  3VYT B;  4MLO A;  2QKL B;  2VXZ A;  4G6T B;  1FMW A;  2L5Q A;  2E1M B;  2MD0 A;  2IS6 A;  4II2 A;  2IS2 A;  2K9M A;  2HNH A;  4OWR B;  4F52 A;  4PUS A;  2LRE A;  4E6K G;  2GOM A;  3PNV A;  1NG7 A;  3HPG A;  1D0X A;  3BC8 A;  2KP6 A;  3IUO A;  5TGT A;  4JQF A;  1X4P A;  1SFK A;  2HVQ A;  2MFZ A;  2KZV A;  1QHG A;  1Y56 A;  4PJL A;  2I8D A;  2Q1Z B;  4ZJZ A;  4E7L A;  2R7Q A;  3VYS B;  2R4G A;  2KMU A;  2RNG A;  5HNF A;  3IAM 2;  3OS2 A;  3KX2 A;  2JVH A;  2DT7 B;  3AFH A;  3HG9 A;  4BS9 A;  4XLH A;  2W7N A;  3S3O A;  3S93 A;  4B43 A;  2RQQ A;  3DQV C;  4OAZ A;  3OIP A;  3ZGK A;  4CA0 A;  1VZ0 A;  3DPU A;  2CW8 A;  3I3L A;  3DPL C;  4XLE A;  2X85 A;  4CCO A;  1QU3 A;  1TZL A;  3OL3 A;  1LDK B;  2JVG A;  2LRD A;  4AYB A;  3VSK A;  3OYE A;  1OR7 C;  1WFX A;  2V1N A;  3OR1 C;  3GBG A;  3SEQ A;  3FDY A;  4BXF A;  3PJR A;  2K9L A;  2L2O A;  1S9H A;  2HPI A;  3H9G A;  4PJJ A;  3OS1 A;  4NQW B;  4NC7 A;  3EUK L;  4PK4 A;  3OYH A;  2KHM A;  1OLT A;  4IQ4 A;  3HL2 A;  3BLY A;  2Y0S A;  1X4O A;  4XN3 A;  2NOJ B;  1Y6I A;  3KYL A;  2Z16 A;  1Z7L A;  1G8X A;  3S32 A;  2WAD A;  2M7B A;  2XDV A;  2P0W A;  4BE0 A;  4LG3 A;  3DEE A;  1N75 A;  2VQG A;  5CPR B;  1D0Z A;  3OYI A;  3QOD A;  1G59 A;  3D5S C;  4HST A;  4NUB A;  2CUZ A;  3OYN A;  3H5N A;  3H9Q A;  1V5E A;  1P9Q C;  4PJN A;  3UNG C;  2LBF B;  1BOB A;  2X6W A;  4DJA A;  2XF6 A;  4PJM A;  2OV7 A;  2LC2 A;  2M7A A;  2W4S A;  3DKX A;  4B44 A;  1Z3Y A;  1WJ5 A;  4BJT A;  4YRV A;  2Z2S B;  3K70 D;  4BU2 A;  4ZTJ A;  3M1C A;  4IKF A;  2Z1D A;  4ZDL A;  4CCJ A;  1WJB A;  3DPT A;  4BDZ A;  1K6Y A;  2F6C A;  3CP8 A;  1QHH D;  3K6G A;  5LD2 C;  2BVM A;  3CJR B;  1V5G A;  3K4M A;  2IGK A;  4E7I A;  2ZXI A;  3HKZ A;  3LMM A;  4D1Q A;  4N4N B;  2DOA A;  3LSH A;  2QKM B;  3H9J A;  4J00 A;  3OYL A;  2VL8 A;  3BG6 A;  3C2G A;  1PYV A;  3TMO A;  4BQO A;  1LKX A;  2M4G A;  2VQL A;  2X6X A;  3DKY A;  2LYC A;  1Z21 A;  3QOE A;  2O5R A;  2VB6 A;  4C2T A;  2OUM A;  2XC7 A;  1Z3X A;  4J01 A;  2VKH A;  3OMY A;  3SZG A;  4ITV A;  2DCE A;  1WJD A;  2OC6 A;  2HU9 A;  2XSJ C;  3DU6 A;  2LBF A;  4HSR A;  2PJR B;  2F5V A;  5HNH A;  3VSL A;  2HZD A;  1X1C A;  1V5F A;  2LH9 A;  4PFO A;  3CP2 A;  1UEL B;  4C9Y A;  1MNE A;  2E60 A;  4ZTF A;  3CES A;  3LSM A;  5HLT A;  2KRC A;  3DTK A;  3M8J A;  4ANJ A;  5FRO A;  3RCO A;  2KRH A;  3TL4 X;  3W2V A;  1BR2 A;  1PJR A;  2CS3 A;  3K4K A;  2BOL A;  4U87 A;  4RLQ A;  1D1A A;  2DJI A;  3DWL E;  3OYA A;  1T0F C;  2IGO A;  2MC4 A;  2W1O A;  4XLF A;  4DIQ A;  4F91 B;  4DGW B;  3I9V 2;  2CV0 A;  4DBQ A;  2KLO A;  4XR6 A;  4HNT A;  3HOT A;  3MKW B;  2WA0 A;  2IS4 A;  4E7K A;  4F3Q A;  4KJZ A;  3H35 A;  2LG4 A;  3EPZ A;  3PFY A;  5KNL A;  2KQR A;  4CH7 A;  5FRN A;  1EA3 A;  4XKV A;  3PNY A;  3QYE A;  2VQH A;  1ZEL A;  2LY1 A;  1LVK A;  2WY8 Q;  5JHF A;  1X1A A;  2R7O A;  4CSW A;  3AL0 C;  1BR4 A;  2M0M A;  4BJ5 C;  3KEY A;  4AVZ A;  4IZZ A;  1E0E A;  3PUB A;  2R7S A;  3W2W A;  3NWS A;  2PJR A;  3QYB A;  3L2W A;  3EUA A;  4D9J A;  3L2Q A;  4BE1 A;  4HPQ A;  2VAS A;  3ZRG A;  3H0D A;  2KPM A;  4DOZ A;  4N4O B;  3E0J B;  2L7K A;  4HNU A;  2CW7 A;  5CQE A;  1AA7 A;  2WBM A;  3CZ6 A;  2LY2 A;  4DBR A;  2R7R A;  2R7W A;  4LIV A;  3HXL A;  4BEH B;  3CF2 A;  2GOX B;  2HVS A;  5CKT A;  4FET A;  3K4L A;  4BGD A;  3MMY B;  4RM2 A;  3AL0 B;  2VJI A;  3G2B A;  3RTR A;  2ELJ A;  2KL4 A;  1SAU A;  2F4I A;  4ZDO A;  2JA2 A;  3OYG A;  3HC7 A;  4XNF A;  2VQC A;  4Y4R A;  1BR1 A;  1R6R A;  3OYF A;  2WB1 A;  4IQJ A;  3FBI B;  3FBN B;  4QPO A;  1UAA A;  2HQA A;  2V4J C;  2IGN A;  3HUG B;  5FRM A;  2AQE A;  1DP3 A;  2KDO A;  4FAS D;  4CUG A;  2VIX A;  1W36 C;  4II3 A;  4OAY A;  3LFU A;  1T95 A;  3NWT A;  4XKC A;  1WJA A;  2WAQ A;  4AU7 A;  2MAB A;  5HVQ C;  3C2H A;  2CMP A;  5HOO A;  4XLA A;  2JUG A;  2FUG 2;  4XMY A;  3IAS 2;  3LSG A;  3HPH A;  4XOT A;  3OS0 A;  2R7U A;  4GRI A;  2DXI A;  4JOM A;  3K4B A;  3E1S A;  4C30 A;  2X6Y A;  4YEJ A;  2IS1 A;  4BEH A;  2AQF A;  3K4C A;  1N77 A;  4E7S A;  4HEA 2;  2XF7 A;  3FKJ A;  3A2K A;  4XKW A;  4IX7 A;  1JI8 A;  4KIS A;  2ZSI B;  4XOR A;  2BVL A;  4XLC A;  2ZSH B;  3DTE A;  3RPU D;  1YX5 A;  4BUP A;  2PMZ A;  1FMV A;  4F93 B;  3MKZ A;  3LL7 A;  4CCN A;  4E7H A;  3S3N A;  2V9K A;  3TBI A;  1MMD A;  4C2U A;  2DT6 A;  4CCM A;  3L2V A;  4E4H A;  4ZDP A;  2WAE A;  1D1C A;  2BW3 A;  4XM3 A;  3L2R A;  3OR2 C;  3W3C A;  3VDX A;  3EUH C;  3OYM A;  1LFP A;  4F55 A;  2VJ4 A;  5CQG A;  3MD2 A;  3D5R C;  3DTI A;  3ZR8 X;  4HG2 A;  4BJ6 C;  3OYB A;  2W82 A;  3SEZ A;  1WJC A;  4B48 A;  2LOO A;  2R7X A;  4PFP A;  4RMN A;  4BQQ A;  1D1B A;  2K5C A;  2VPL A;  3ZXS A;  3VYU B;  4CCK A;  4XN0 A;  4PSX A;  1KON A;  1MND A;  4Y3O A;  1GLN A;  3DU5 A;  2RRE A;  1IRX A;  1X1D A;  3V42 A;  2V6E A;  2HPM A;  2CV1 A;  1D0Y A;  3ZCO A;  4LIU A;  4CCL A;  4P1W A;  2CH0 A;  3LSK A;  1TT0 A;  4KT6 A;  1YX3 A;  4YEL A;  2HDW A;  4R79 A;  2M3A A;  4BDY A;  1MW7 A;  2W00 A;  3K10 A;  2CV2 A;  2ZFU A;  2IXS A;  4B47 A;  3UR3 C;  4XON A;  3VWB A;  2X51 A;  4ZC3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...