2NOJB

Crystal structure of ehp / c3d complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
58
structure length
58
Chain Sequence
NKKVVDAQKAVELFKRTRTVATHRKAQRAVNLIHFQHSYEKKKLQRQIDLVLKYNTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Complement C3
publication title Characterization of Ehp, a Secreted Complement Inhibitory Protein from Staphylococcus aureus.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 23
structure length 58
sequence length 58
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2006-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12199 efb-c Extracellular fibrinogen binding protein C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1270 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2nojB00
3D5RC 2WY7Q 2GOXB 2NOJB 2GOMA 3D5SC 2JVGA 2JVHA 2WY8Q
chains in the Genus database with same CATH superfamily
3CUQC 5HNHA 5C4XJ 2EK5A 3J7YJ 4BY1J 2K9SA 4UNOA 3CZ6A 3TL4X 1TL8A 2HQ5A 4LIUA 1XX5A 1SAUA 2R7QA 5DCMA 3EUHA 3HYIA 2CS3A 4WWCA 3F6OA 3CF2A 4CCKA 4RBOA 2GQQA 4UUTA 1YRNB 3LNQA 1UFMA 3DQVC 4A3KJ 1IV8A 2R7OA 4ZYHA 3S3OA 1VQ7I 2XKPA 4UVBA 1FC3A 1I27A 1JUSA 4NHJA 1ZG5A 3JW4A 4BKXA 4GFBA 3V7CA 1ZYRF 2M5WA 4A6DA 4E7LA 4IRGA 1OKRA 3K4NA 1DP3A 1W0TA 2K5CA 5J47A 1P4XA 3TQNA 3MKLA 2XGXA 3P9CA 4ITVA 1VQOI 3WTXC 2DPUA 1VQ8I 2HEOA 2BBYA 2QQAA 4NB5A 4GCVA 2XGDA 3PQKA 3ONQA 3HRUA 2JRMA 3U9GA 5IP6A 3EYYA 3H5RA 1YX5A 3S14J 2X85A 4M3EA 1VQ9I 2CYYA 4P1WA 2IEKA 2PFBA 1VI0A 3DBLB 1CF7B 1SFUA 1WJAA 4UUSA 1W5TA 2CW7A 4P96A 1FBUA 1J75A 1N78A 3SEZA 1I50J 3O6BB 3HOZJ 2AHQA 2W82A 2OZUA 5EGOA 1GT0C 3GMEA 3FM3A 4YIRX 3K69A 2OQRA 4PJJA 2QSGX 2VOOA 1IRXA 1K4SA 4XONA 1EH6A 5D4RA 4C30A 2K9QA 2VBZA 1XSXA 3LFKA 1MMAA 2XAUA 4M6XA 1YW7A 2M0CA 1NK2P 4D1QA 3SDGA 2GIZA 3AG2H 4Y4RA 3WTZA 5B3SH 2LYCA 3SJMA 1P4WA 4WXDA 1LE8B 1J2XA 4W1UA 5FD6A 1FP2A 3E3VA 3J81K 1VFCA 3I4PA 3PIOF 2A5YB 4OWRB 3JRFA 4A2UA 2EWNA 1F5TA 5H20A 3MKYB 3HM5A 1QZEA 3W2WA 1S7AA 2CQNA 2E1MB 4UVAA 5F1JA 4XKCA 3I64A 2FBIA 1P9QC 2LDUA 3EUHC 2LRDA 1Z77A 4IHTA 5E79C 2DBBA 2J5PA 4Q48A 3V8LA 1QHHD 3FXLA 3G6EI 2P7VB 3HDDA 4Y3OA 1LVKA 1LDJA 3KP5A 2PLYA 2VC1A 1T0FA 1ETYA 1YW8A 2CUEA 2GZWA 3KP4A 2BGCA 4BDZA 4V19K 2HI3A 5GP9A 3VYUB 3ABLH 2IA0A 2RAEA 3NAUA 4QSHA 3IC7A 2QUFA 4OIRF 1YITI 4PFPA 2QQ9A 2HTSA 1JTYA 1WI3A 5FLXZ 2K86A 2DYRH 3FK7A 1BM9A 1BBYA 3KLOA 4FASD 4ENJA 1LJ9A 1WH7A 3BP8A 2QVOA 3L2CA 2KP6A 2QYOA 1IDZA 5IYDJ 3WGIA 2CW8A 1BI3A 3WHCA 1YJWI 1EV7A 1OFCX 2VBYA 3C3WA 3PQJA 1ZQ3P 3ZOBA 2NVTJ 2ZJRF 3C2HA 3S1QJ 3ASOH 2E7XA 2G7UA 3JAMK 1E3OC 3HKZA 1L0OC 5F0FA 3WTWC 1WZ2A 3QPLA 3LSRA 1YO5C 1X1CA 1TW2A 3S2WA 1POGA 2VC0A 3LSHA 3K70C 1R4NB 5B5EC 2PI0A 3QYEA 1HW1A 3IHUA 3VPRA 5EG0A 3P9KA 1Z91A 2H6CA 1VQ5I 1S8NA 3C18A 2DODA 4BJ5C 2JPBA 1UG0A 1XMXA 4KFCA 4XM3A 2OPTA 3OYNA 1FNNA 1X19A 2FE3A 1BR4A 2DMTA 5K7ZA 3R0JA 2LK2A 1OCCH 2MC4A 4FTHA 2LBFA 1YQAA 5FB2A 2F5FA 1PUEE 1G4DA 2L2OA 3QYFA 4KMUX 5C4JJ 3OYIA 2V9KA 2EIJH 2EV6A 2VT3A 1ODDA 3R60A 1W36D 4KISA 3ERMA 2YU9J 2XB0X 4H0EA 1R5ID 4Y17A 4RB1A 3GF2A 1U8RA 1WSUA 4PK4A 1WPKA 5GAGJ 4M73A 5M5YJ 1XGOA 2XIGA 3C7JA 4HLXA 4C2MJ 4LMYA 3JRBA 4EVIA 5DM7F 4M71A 1G8XA 2DCEA 1ETKA 1IN5A 2L7MP 2E34A 1P7IA 1T0FC 1SFXA 3IP4B 3ULQB 2LSOA 4CDGA 2MLKA 3CLQA 4U7DA 1ZELA 2Z1DA 1H89C 1V5FA 2R4GA 5HLGA 5FLXK 3J7ZI 2R92J 4ZYDA 1T38A 2FNPA 1J0RA 2BHZA 1D5VA 1N75A 2N8GA 2WC2A 3H0GJ 5DV5A 5ICEA 4CA0A 3FM5A 1QHGA 1T8IA 1HC8A 1GVJA 2QENA 5LLQA 1R1VA 2OJED 1GV5A 3GX4X 1UMQA 2ICWG 1ZARA 2FEZA 1TLHB 3I4MJ 3LSIA 4RB0A 2DFFA 4L18B 3IKVA 2ZXJA 1D0ZA 2EPFA 2R5ZA 4X1EA 1TQPA 3WTYC 2IS2A 5AIPA 5M3FJ 4CUGA 2FF4A 1QPMA 1G6NA 2CUFA 2DOAA 3E7LA 3KX2A 1MSFC 1STZA 4ZYEA 4AC0A 4P5OA 3P7NA 5E20A 1R1UA 5E1WA 4XK4A 4HEA2 1PVEA 2ZSHB 3HXLA 1R1TA 1Z0XA 3WTUC 2HVQA 1HW2A 2MH9A 2FX0A 4J00A 2ECBA 2E60A 1IN6A 4BEHA 1K78B 1V54H 3SEQA 1RI7A 4JBAA 2DT5A 1I1GA 5KAIC 2XSJC 3JSOA 5HS8A 1O57A 5L3CA 2X9DA 1J9IA 3TW6A 4CCOA 5D5VB 1R4MB 4KMFA 4UHTA 1EKEA 2OCEA 1X3WB 2UXNA 3LSJA 3JRDA 4Z6YA 3FXMA 4DIQA 1D1CA 3CESA 1FP1D 1NH3A 1ZH5A 1A6QA 1DU0A 4YFKF 3I71A 4XRMA 4LLNA 2VOPA 2PJRB 4X0GA 3N4MA 3QOPA 2CV0A 1Z67A 2A69F 4DYRA 2DAOA 2K4BA 4XICA 2V4JC 1ZHFA 4BAYA 5F6FA 3TP0A 1ZAOA 2ZFWA 4BE0A 1S6LA 2PMZA 3DU5A 1HXDA 2F4OB 4ETSA 5FO5A 1F36A 4WXCA 3CP2A 4Q4ZF 4IHWA 5CQEA 3GBGA 3K2ZA 3SZTA 4HQMA 2V26A 5LGTA 2OU2A 1Z7UA 4DZJA 4HBLA 1Y6IA 2VQLA 2QBYB 1FYLA 2O0YA 5HLIA 3MZHA 4HNUA 3P9IA 4EM0B 3IAM2 4M6YA 2JPCA 1U3EM 5EDNA 2H6BA 2NYXA 2VBXA 3GWZA 3JSPA 3NQOA 1YOVB 3ROUA 3OS1A 2XGCA 2P4WA 4FISA 1RUOA 2OF7A 2LNBA 3KEQA 2M2EA 2G0EA 1BI0A 2V9PA 2RVCA 1A36A 5F08A 2E36A 3BR3A 3S15J 2V9VA 3HB9A 1ZRCA 2YU3A 3BR0A 1W5SA 5E8IA 3VFZA 2V79A 3V7RA 4YIFA 2HXIA 3RKXA 2KISA 2QWWA 4XLNF 2AXTC 4RS8A 2CV2A 3QU3A 5D6EA 3W2AA 2EZIA 4HQEA 3ECHA 2Y9YA 2EINH 2HYFA 3VSKA 2L9SA 4N9IA 3MKWB 3BCAA 3NARA 3LA2A 1SFKA 5K5RA 1FZPB 1SMTA 4G6DA 3H35A 1O3SA 3MWMA 3R61A 2X48A 4PGGA 4RM2A 2COMA 1X58A 3LSPA 5FKKA 1OLTA 4HNTA 3K7AJ 5CVRA 1OYIA 3V8JA 3OR2C 3GTGJ 3AG4H 2DW4A 2VXDA 5FRNA 1TTYA 4PSWA 5JI6A 5JHFA 3C2BA 3QQAA 3QP5A 3ZP5A 1G3TA 2W00A 2B7EA 3ECOA 3PIPF 4EGZA 4BY7J 4BGDA 1FY7A 4E7KA 3FHNA 1UZCA 4G7ZF 3O8HA 3OOUA 2XAJA 3P5JA 2LMDA 2ZMEB 3HOUJ 3L2WA 3WG9A 2XF7A 3CDIA 2L9NA 2HDWA 4F92B 1RESA 2CO5A 2R7FA 2F5EA 2EZKA 4ZDOA 3DBHB 3I0TA 2KT0A 2JQ7A 5E18F 1SD4A 1WJBA 4C3IJ 1BR1A 4B47A 1Z3XA 3DV8A 1PP8F 3HSEA 2MG4A 4PJNA 5H6RA 4XRSG 1D8JA 2B63J 2IGKA 1AU7A 4B8XA 5ICGA 3CCQI 1MDMB 3H3UA 3BG5A 2V7FA 4JK1X 2L4MA 2QA4I 4IQ4A 2QKMB 3RSNA 1SAXA 3M1CA 4M3GA 4CSWA 4KITB 4A12A 4U87A 4D5FA 3IRQA 2DTRA 4II3A 4XKWA 2OZ6A 1WI9A 1VNDA 5K7HA 1KGSA 3OY9A 2Y0SA 5DM6F 2H1LA 3BLYA 3EQLF 3GTMJ 4AUXA 1WFXA 3Q0UA 2HGCA 1U9OA 3DPUA 3LSKA 3LMMA 3WU0A 1I39A 3ZRGA 1IN8A 5D8LB 4RGRA 3KP2A 1H88C 3FXKA 3F21A 2V6CA 1J7KA 2MD0A 4IPAA 2BV6A 3FDYA 3S1MJ 4PJ0C 3K10A 1X2NA 2P8TA 1VQKI 5KHDA 2DT6A 2MLGA 3SYTA 4IX7A 1HCRA 2EH3A 4XN0A 4UB6C 3CCEI 4KYWA 4C9YA 3U1DA 1R00A 3H0DA 3HSRA 3NEUA 1YE9A 5D5XB 1OCRH 1SD5A 1X3ZB 2RNGA 3GLLA 3CO6C 1D1BA 2R93J 1S5LC 3GTKJ 4G6TB 1U5TB 5IYCJ 3AG3H 2ZC2A 2K7LA 5D8KB 1YIOA 2VJ4A 4PJMA 3QPSA 2KKOA 3BTIA 3FBNB 3EUKL 2HPIA 1I6HJ 4HA8A 1AKHA 1D5YA 2KDZA 2NS0A 4N0BA 2D5VA 2IVMA 1WH5A 2D1VA 5HDKA 2RGVA 3BG9A 3OYCA 5J6XA 2WTEA 1QRYA 4B3XA 2HYJA 3E6DA 3EYIA 3ZMZA 5D4SA 1MBKA 2VJ5A 3K4BA 1OPCA 4KIGA 5AIQA 3L2QA 1YRNA 3FXOA 3QRFF 2R7WA 2XVCA 4XLAA 2COBA 3Q9SA 3DLLF 4TV7A 1G3SA 4WK8F 2ZXWH 1WJEA 4HX8A 2MYSA 3I55I 4XORA 5H2FC 2HOEA 3S2DJ 4XLFA 3FK6A 4HAMA 2FA5A 1WRJA 1IW7F 3IWFA 2NVQJ 2M34A 2A3SA 3DEEA 4MNUA 3ZCOA 2LC2A 3BJ6A 3OWTA 4OINF 3HL2A 1HLVA 1KU3A 4YIIA 3SHFA 2EIKH 2R3SA 1WQ2A 4F52A 3KPHA 3SXYA 1XMKA 3ZQ7A 1VQ4I 1TQMA 1JKOC 2OQGA 2X1DA 3HIFA 3PNTA 2OTLI 1CF7A 2FOWA 4AYBA 2FXAA 2O8XA 3SDBA 1ZRDA 3VODA 1QGPA 2EA2A 3I58A 2M0MA 4U0YA 5A2QK 2GOMA 1FJLA 2MBFA 3R4KA 2QCOA 4BUPA 4E7HA 3DWLE 1OYWA 3HEFA 1MSEC 1MIJA 1B8IA 1ZKGA 3RKYA 1FOYA 1XSVA 2M9HA 5FKLA 5K7FA 3IKTA 3CUQB 3BG7A 3T8TA 2XF6A 2Y30A 4P55A 3MN2A 3J81Z 2R7DA 3U21A 3FISA 3K1NA 3S1NJ 1UJ8A 1ZGAA 5LEJA 2QM3A 2HDDA 4EV0A 3CCSI 1A5JA 2FMYA 2L3DA 5L3BA 2MA3A 4RM3A 2KRFA 4IVNA 4D5CA 5HODA 1Z05A 3GTOJ 3LQRA 3FMSA 2TDXA 2FSWA 1LE8A 4QWQA 4KA4A 1T08B 1SFEA 2A61A 2B0LA 2OC6A 1KQ9A 4O5VA 5EF6A 4FE4A 4ZTJA 2V1DA 5J40A 1FOKA 4BJ6C 3JRAA 2DLLA 3VWBA 4HF1A 3Q0VA 4QIWN 3O8GA 2O7OA 5F1RA 2EFWA 4HLYA 5KK1A 2ZXIA 1SMYF 4F3QA 1JKQC 4RGSA 4ENMA 1T56A 1I5ZA 1S72I 2LLKA 2ELKA 5IY5H 2Y69H 3BROA 2CV1A 1B6AA 4QLCU 5LFAA 3S3MA 3FXRA 2CH0A 4CCNA 2DI3A 5CLSA 5M3MJ 2DA2A 5HOOA 4EEFG 3TOBA 2HQNA 3MQ0A 4L9VA 4MLOA 1TWGJ 1RR7A 1AOYA 3HOSA 4C3HJ 3SFZA 2BE5F 1XPXA 3LL7A 1Y8RB 3R6SA 3I4NJ 2ID6A 2EILH 3BTCA 3HOXJ 4EM2A 3I53A 3JAMZ 1WJDA 3D5SC 2K85A 4FE7A 3JRGA 2EA4A 2W48A 5CQGA 1SEUA 3MCZA 3H5NA 5ICCA 1JT0A 5CVUA 5DDGA 3DBRB 1R23A 4RB2C 3J7AO 1TT5B 2E1OA 1OJLA 2OUMA 4GGGA 4BHCA 1WJCA 3HOTA 2I8DA 3QAHA 3QU6A 2O61A 1W7PD 4ZJZA 3TW7A 2R7RA 1EH8A 2RN7A 4DGWB 4UXNA 1WVRA 1ZGJA 4HV6A 2ECCA 1F9NA 3I9V2 2M1BA 1IRFA 4ZDLA 1JHFA 1HKTA 1EH7A 2ME6A 2CFOA 2VBWA 4GYIA 2H27A 5IPAA 1T33A 4E7IA 3ZN0A 4F55A 1IV6A 2E7WA 4U88A 4XOPA 3HOWJ 5ERIA 2F4IA 3I5UA 3M07A 3L00A 2KIUA 4ESFA 2VL8A 2XRLA 1BR2A 3U2RA 4FX4A 3GTJJ 2FQ4A 5HS9A 1NHAA 4CYDA 1TWAJ 3F8FA 4XKBA 3RYPA 3CCYA 4DOZA 2JRTA 1JT6A 4N9HA 2NNNA 3H5AA 1EA3A 3BOQA 1KQ0A 4MQ9F 4D9JA 1IDYA 2X6XA 2E1MC 4LB5A 3BZKA 2IT0A 3L09A 4Y15A 1IN4A 2Z33A 4WCGA 2IPQX 4AD9A 1RZ4A 2GOXB 3F8BA 2ZJQF 2EV0A 3GFMA 3S8PA 2LD5A 3C1DA 4UV9A 2HR3A 2RQQA 2IBDA 2UXXA 2VASA 4XNFA 1H9TA 2LG4A 4WX9A 2EZLA 3BTJA 5HDGA 3RTRA 2HZTA 3PJRA 3HRMA 2HOAA 5E1XA 4XLCA 2XPUA 4I0BA 2XGEA 3OR1C 4OAZA 4ZC3A 4EJOA 3ZMDA 1LDKB 1MBJA 3TO6A 1UHSA 2BEOA 2BVLA 2GXAA 5DTDA 2DJIA 4IO9F 3VB2A 1KA8A 1KYZA 3M8EA 5EGOB 2R7UA 2DMNA 5LHIA 1GLNA 5EEHA 3LAJA 9ANTA 4BE1A 4ENKA 2KMUA 2AS5F 2DPDA 4BACA 2O9LA 3OIOA 3DPTA 3SFIA 3RQIA 1LEBA 1OCPA 4JX5A 4EM1A 1ERDA 3UR3C 3L1PA 4O3MA 3OL3A 5CVIA 1A6IA 2GBYA 4A3GJ 1W5CC 3D5LA 2I5UA 2KIMA 2DQLA 1RPWA 2E71A 1TWCJ 1FOWA 1BIBA 4II2A 3RYRA 4PCQA 3V8KA 1Y56A 2BHYA 2ETHA 2P5KA 1O3TA 4LJZF 3ZN1A 1SC7A 2UUZA 1FMVA 2HOTA 3CDLA 1GV2A 4I7HA 3RPQA 2HOSA 1JHHA 1JJ6C 3Q3SA 1T39A 4G9YA 3TKYA 3OYMA 2DMUA 3OYFA 3L2UA 1TZLA 3GTQJ 2DFEA 1QZZA 3ABUA 1MD0A 4AVPA 3LOCA 2VQCA 1IRZA 4BBRJ 4J01A 4I6ZA 2HVSA 4Q47A 3E97A 4L5JA 4IL6C 2CQ7A 3ZR8X 2H09A 4N4NB 1OISA 1X1BA 5LRRA 5L3FA 2WY8Q 1JXSA 2ZJPF 3OYKA 2CQQA 3BJOA 1HQCA 3BG3A 3CMMA 1A31A 2JUGA 3KETA 4HNVA 4D0PA 5TRDA 3BC8A 1FSHA 5HNFA 2W24A 1R9TJ 2MGQA 1TNTA 2GWRA 3R0AA 4I02A 2JA7J 1TBXA 4HDUA 3BCBA 3BR6A 3HUGA 1O3RA 2HKOA 1XTAA 2CMPA 1YTYA 3HSFA 2PJRA 4U0VA 3HGGA 1HOMA 1F4KA 1USTA 4Y52J 2DK8A 1Z6RA 5TJJA 4B3AA 1BL0A 4EQQA 2PEXA 3TP3A 2W85A 4NNJA 5JLWA 5TGTA 1FTTA 3SZPA 1DQUA 5ILUA 5IT3A 3F23A 3D1NI 4A3JJ 4IHYA 4XLPF 4IHXA 1D3YA 1M1EB 2K3PA 2PBIA 4RGXA 3WTSC 1Q1HA 4FETA 1RKTA 1LB2A 4NC7A 3DPLC 1OCOH 1U2WA 3M8FA 1HSJA 3O2PE 5B1BH 2VUMJ 2QBYA 1OQYA 2GXBA 3S16J 1P92A 5KVRA 4BXUA 5BS6A 3ESWB 3QOEA 1I6XA 4EJWA 2NNYA 5EG0B 4PFOA 2LFBA 3KYLA 3JCUC 2RV8A 4BQOA 4X6AJ 3PFIA 3GZNB 3QODA 4DJAA 1JGGA 4CZZA 1QVTA 4BXXJ 2LKSA 2K3FA 1GVDA 2M3AA 3KYDB 1U8BA 1D1AA 1ORKA 4PDKA 1MKMA 1SANA 1XC5A 3LSMA 3BR2A 4UB8C 4AIDA 5K5QA 3GYHX 2ESNA 1Z1DA 3F0CA 2LBFB 3IUOA 1ULYA 2KIQA 4JQFA 2L7FP 4AM3A 3M7GA 4Y7NJ 2D1HA 4IOAF 3WTVC 2JN6A 2A6EF 2K9LA 1PP7U 3G2BA 3CO7C 2CQXA 2H1KA 3FXUA 2WA0A 2DFHA 3KLNA 2QQBA 3DU6A 4I09A 5IOZA 2YX7A 2IRFG 5DCFA 2BY1A 2X51A 4XRSA 4JP0A 1RUNA 3ZMVA 4BHBA 3ERED 1B72A 3TO7A 2QLZA 3ZQFA 3L2VA 1NTCA 3I59A 3F3XA 5FJ8J 1GUUA 2A68F 1Z3YA 3TDZC 5BPDA 5LBQA 3CJNA 3OYBA 2HWVA 4L9NA 2KHMA 2CW0F 1R58A 3MFKA 1P2FA 4I99C 1IUFA 2YSRA 2K9MA 4IOCF 1MBEA 5FLMJ 1G59A 2NVXJ 3H36A 1IGNA 1LFBA 1TC3C 3OYEA 2LY9A 2PG4A 1YYVA 4ZYGA 2FBKA 5LRSA 3G3ZA 2ZMEA 2EQRA 1U9NA 3N97A 4GRIA 4A69C 1R6RA 2JVHA 2L9RA 2MABA 3RDIA 4YELA 3GFJA 3CMAI 3EPZA 4G94A 4AVZA 3GZ5A 2WAQN 2Z5UA 4OOIA 4XIDA 3GEZA 6PAXA 1IN7A 1HBXG 2R5ZB 2Q8KA 2QGUA 5M5XJ 1MMGA 2M4KA 4B44A 5B1AH 4M6VA 2DXIA 2ZB9A 3FHZA 2DA3A 3B73A 3RPUA 1MDMA 1TW3A 2JA2A 3HPGA 1X1PA 1OR7C 1MJAA 2ISYA 3F72A 2R0QC 4EATA 4LD5A 3CLOA 4M9ZA 3GXOA 3ZXSA 2DYSH 3S3NA 3I56I 1CQTA 3V42A 2Z16A 3WU1B 3A01A 3GZ6A 1MZBA 1HDDC 1R5HA 2KPMA 3QPHA 4G12A 4BEHB 3K70D 2Y9ZA 2NVYJ 3CCMI 1LQ1A 1TWFJ 3RZOJ 2MW8A 1QZYA 5DUKA 2HS5A 1HF0A 3HZJA 2WAEA 1WJ5A 2BW3B 2JA8J 2XAQA 2KJBA 2LKXA 2G7HA 1WHUA 2LY2A 5GPAA 1T2KA 4HF0A 4NDLA 1UB9A 5HDNA 2CRGA 4LGWA 4RLQA 1KU7A 3OYGA 2WB1N 2EFPA 3KEOA 4MTEA 4Y13A 1XG1A 1LKXA 2D45A 4F91B 1A35A 4M74A 2GIVA 2M87A 1RETA 2O5RA 3H3ZA 1MNMC 2L02A 3BJAA 4M9XA 5C3EJ 1W0UA 2FD5A 1O4XA 1R71A 5HVQC 5F0HA 4HV5A 1V55H 1S29A 1U5TA 2W25A 4DZPA 2EFQA 1YS7A 4I98B 3ZQCA 2JSPA 3HTUA 5E8GA 3B02A 5EJCA 4BBSJ 2JZYA 1Z7LA 4A0YA 4CXFA 2ISZA 3OSFA 4A3DJ 1BW5A 5F27A 4OIQF 1I1SA 2O03A 2VE8A 4E70A 3ZMUA 1QPIA 4NQWA 1MBFA 2O6GE 2IAIA 3FIWA 3ZPLA 3WU2C 2FU4A 3BDDA 2XHKA 5DUIA 2ZMEC 3GFLA 2XKOA 4WF2A 2VKHA 3BR5A 1BI2A 2DA1A 1ENHA 3EUAA 5KCMA 1VQ6I 1HSTA 2CUZA 5IT9K 4YFXF 1Z9CA 5D6FA 3AL0C 3C2GA 5FLVA 4MQVA 1Y8QB 4LG0B 1W7PB 1Y0NA 3A4CA 1T95A 2HQRA 4FT8A 3K1MA 3G4SI 3TGNA 3J7AY 2HQAA 1PUFA 4V2FA 4S04A 3IV5A 1X1DA 3IH2A 4DQ2A 1RIOH 3OS2A 2K40A 3HBLA 1CGPA 1VQNI 2XAHA 1K4TA 4FQGA 4IEJA 4MO7A 4XRFA 1SD7A 1LNWA 4V2GA 1FWZA 1FIAA 2XC7A 2R5YA 1KU2A 2JMWA 1IUYA 5A2QZ 2P6TA 3D5RC 1QVUA 2GM4A 1TT0A 3ML6A 3ZQHA 3OYLA 2GXGA 1MBGA 2LOOA 4UV8A 5ICFA 3W6KB 2L54A 3GLXA 3U1KA 2ELHA 3GTLJ 2E19A 2OCCH 4RAFA 5M5WJ 4YRVA 4FHTA 2VKVA 1EJ9A 2R7TA 4Z2YA 1ZLKA 4F7ZA 2CQKA 5B66C 4LLLA 1K6OA 2OTJI 1KZHA 4KIFA 4DNCA 2ZSIB 1OCTC 3BY6A 4MFEA 2VI6A 3N05A 2L7ZA 2L5QA 2JT1A 2Q2EB 2VKDA 4PGHA 3HRSA 4IJAA 3Q5FA 3CCJI 2Z3YA 5AONA 4IRHA 4NUBA 2XSDC 2LVSA 3RJPA 3E5QA 4OU0A 3G1MA 4M3FA 2P0WA 4AIKA 2KJCA 1U0JA 1U5TC 5LHGA 4HZFA 1QBJA 3QP6A 3BQYA 4B09A 5JVGF 4CGZA 4D7NA 1J09A 1ZG3A 5LGNA 2IA1A 1V5GA 4KJZA 4LB6B 2DA6A 1E3HA 3COAC 2H94A 2W84A 2X1EA 3CF5F 2VKEA 3GO5A 3MMYB 5GAEJ 4OIPF 5BQTA 1HKQA 4XLHA 3AAFA 3F22A 3OYJA 5GTHC 1ETVA 4DBQA 1U78A 3E5UA 2IP2A 3KZZA 3FF5A 5LD2C 2HPMA 1UG2A 1DPUA 1YIJI 2X0LA 3DKYA 3K0LA 5IP9J 2V1NA 5K5OA 2E1CA 3PO2J 4RGUA 1WGXA 2VXZA 5E3MA 3PNYA 1ZN2A 1RKWA 2YPRA 3T0YA 1YW9A 4I76A 3CD6I 4M3DA 5H6QA 2HXOA 4ENNA 2A07F 2BXZA 4AIHA 1ETXA 5IYBJ 5GADJ 2X6OA 4C2UA 3E6BA 3PM1A 4ZH4F 2LF8A 1DPRA 2X4HA 1JJ8C 4MEXF 2G9WA 5HLTA 1IXCA 5L3DA 3WODF 3GW2A 2XROA 1H8AC 3TEDA 3ZQIA 4YFNF 2UV1A 3AG1H 1K83J 3PO3J 2VPLA 3F6VA 1Y1VJ 4OMZA 5IOYA 3KEYA 4WXHA 2HU9A 3JR9A 1IAWA 3PSFA 1U6GA 5CJ9A 5J1UA 3OIQA 2DTZA 1TNSA 2UWMA 4IQJA 1ZGWA 2D2WA 1DGRM 2X1CA 4GXOA 1WCMJ 4BQNA 2MD5A 1YHQI 1E17A 4ESJA 3A0BC 1UHWA 1XD7A 3WHBA 1W1WE 3E0JB 1F1ZA 5CYVA 1C0WA 2Q1ZB 1YG2A 3GTPJ 4UVCA 4CCMA 4U0WA 3S93A 3NWSA 2JWTA 5EEAA 4ASNA 4A3CJ 3OMYA 4YG2F 1REPC 2PMUA 2LP0A 3V7SA 4CO8A 3CQZJ 3GVAA 1W36C 4A0XA 5JHUA 3OYDA 4BU2A 4JX4A 1YJNI 3TBIA 2DMPA 1D8KA 1FT9A 1R5GA 1VZ0A 2PN6A 2OA4A 2XPWA 3F8CA 2NRAC 2RDPA 5E3OA 1P4AA 2CJJA 4K2EA 3RCOA 4E7SA 2HVRA 4DYCA 3DCFA 2PQ8A 3A02A 2L7KA 2WY7Q 3MEXA 4HRIA 1HW5A 1R36A 2CGPA 4CYCB 4GO1A 3LA3A 3H1CA 4L0ZB 1MW7A 4CH7A 2E2JJ 4NC8A 4BYYA 3WE3A 2XV4S 4E6KG 5J1RA 1KQ8A 2DA4A 3BPXA 1ITYA 1FSEA 1K6YA 2JK3A 2B9SA 3OSGA 4E7ZA 3E1SA 4BL0B 5BPIA 2Y48A 4XL9A 3WE2A 5J8CA 4LOCA 4PSXA 2M8GX 2VB6A 1LEAA 2QEXI 1XGMA 2ADUA 4KDPA 2CWEA 5F64A 3F8MA 2EIMH 1NG7A 3ZMSA 3RKWA 5JFRA 1B9NA 4BS9A 3PSIA 3B6CA 4O6JA 2ZKZA 2IGOA 1QQIA 3UKGA 1BC8C 2QKLB 4B43A 3M9AA 3RPUD 3LFUA 1GXPA 3JTGA 2KIFA 4KN4X 3HKZN 1S3JA 1DUXC 1B8IB 4XN3A 2ZNZA 2JA6J 4HSTA 4LK0F 1RRJA 1IF1A 2HTJA 5EYRA 2HYGD 1Z21A 5L3GA 4G6QA 3E5XA 1VQMI 1OCZH 1DGWY 3MD2A 4KT6A 5FKOA 2PMHA 3H92A 3I3LA 3Q9VA 2LREA 2IW5A 2LTPA 4IZZA 2M7BA 5DD4A 2JSCA 1MH3A 2DA5A 3KP6A 5DCMB 2VE9A 1BJZA 4DBRA 3T8RA 4U7BA 1AA7A 4RAGA 2W7NA 4I2OA 1BOBA 1TP4A 3OS0A 2WAFA 2R7SA 1K79A 1BC7C 3K1PA 2ZNYA 3H9QA 1XCBA 4HOBA 5EZGA 3K4KA 2VN2A 1XGSA 3KE2A 2K27A 2ID3A 3A03A 1YX3A 2YS9A 1R22A 2FRHA 2IS4A 3DXJF 1E2XA 2DDBA 1VF9A 4CICA 5E17F 3VEPA 4RDUA 4XSXF 2E5NA 4RLFA 2KRHA 1G3WA 3DKXA 3KIOA 4AIJA 1MBHA 4NBQA 4C3JJ 1OMIA 2OBPA 4HW0A 4L5IA 1R49A 2MSYA 1XCVA 4Y33A 3CCLI 3K2AA 3AKZA 3VYSB 1GHCA 4A3FJ 2UZKA 5BMZA 4LG3A 4KUMA 5GPCA 1ON1A 2V1UA 1WJFA 2L9VA 1YFHA 1S7EA 2EJRA 3CJQB 3WGHA 1MMNA 3LQQA 3NWTA 1SVMA 1F43A 2FOKA 3FBIB 4UUSB 4BDYA 1HKSA 4LLGF 1LPQA 4L9JA 2RQPA 4OIOF 2QSFX 1NG6A 1XSDA 3KP7A 1UAAA 1G3YA 4ZZLA 4H4KC 3HGYA 4KT5C 1BJAA 4ZYAA 4ABZA 2KLOA 1ON2A 2E2HJ 1ETQA 4A3MJ 2GA2A 3IL2A 4EMSA 1T98A 3HG9A 1FLIA 3JRIA 1WWXA 2KDOA 3D0SA 1SD6A 4HF2A 2IXSA 4RA2A 4MGRA 2LR8A 2XASA 3REOA 1FPQA 1Y1WJ 5LGUA 3TMOA 1J59A 2DOFA 1JUPA 4S05A 3UNGC 4G8XA 5E3NA 2ZBKA 1IXRC 5JVTA 2ZCWA 3LSTA 5FROA 3PL8A 2MFZA 2VODA 3JRCA 2E35A 2M4GA 3OL4A 4PJLA 5CPRB 4IHVA 5E3LA 3BZ6A 4IF4A 1L3LA 2OAZA 4XKVA 2Z2SB 3HPHA 1K78A 4M3BA 3DKWA 1I3AA 1TQIA 2EFNA 2DMQA 5J4YA 2AO9A 2YR2A 5FGMA 5D5UB 1S7OA 5J8FA 2L4AA 5GAHJ 2DA7A 1X3UA 3NRVA 4A5NA 4G7OF 5FFXA 3BR1A 1T6SA 1A04A 4LITA 4RAZA 1V3FA 2IS6A 4XBFA 4BH9A 3CJTB 5DYMA 2FQ3A 3VDXA 3ZQLA 2M30A 1YI2I 1JTXA 3TOAA 3CC2I 2LF7A 2JA5J 3CMEI 3VYRB 2K4JA 4RMNA 3KZYA 4RAYA 2P5VA 2PJPA 3PUFA 2Y0MA 3K9TA 4A3BJ 1USSA 5FRMA 4F93B 2QF7A 1VQLI 1FYMA 2KRCA 4AWXB 4EJVA 3RI4A 2HKXA 2P6SA 1FBSA 3TDUC 2Q0OA 4IRIA 2MC3A 2PMZN 2KQRA 4M72A 2WWYA 1LVAA 4UUVA 3MVPA 1E0EA 4R1HA 1ETOA 4KN7X 3PUBA 1QNTA 4CZCA 3CJRB 2VPRA 2E5ZA 2XAGA 2FJ1A 3MAJA 3WGGA 1FOXA 1OR7A 3S17J 1LUJB 2OV7A 3FZVA 3A2KA 3S32A 4C2TA 3RQ4A 2HNHA 2JUCA 3FXJA 3T5XA 4IXAA 3SZGA 1PJRA 2E2IJ 2NAZA 3H3VK 1KU9A 5L3EA 4Q5SF 1DU6A 4ESBA 5HLHA 1PDNC 3HTSB 4R8HA 2NXNB 3W6VA 1YJ9I 1YLFA 2DN0A 2NS7A 4XR6A 2EZHA 2LY1A 4XOTA 4UY8I 1KYWA 1ZTRA 3RIRA 2BVMA 4ZZDA 1YS6A 5GTIC 4JOMA 1ZRFA 4PZJA 5F04A 4B48A 2STWA 3HOVJ 2IA2A 3G1OA 4BQAA 1JKPC 1O7LA 3E6MA 2RNJA 1LDDA 2A6TA 2RC4A 1P7JA 2VT2A 3PNVA 3BT9A 1XGNA 4MEYF 3GCMA 3WTTC 1FEXA 2BW3A 3GFIA 1XDSA 2Z99A 3ZQQA 5FKMA 1DDNA 3W3CA 3FXQA 2KFDA 3CCUI 1JUMA 3AFHA 2JJ7A 2A5WA 2H8RA 3CCRI 3JRHA 1KONA 2Y31A 3HUGB 3LSGA 2GA1A 3OV8A 3CC7I 1O3QA 1DP7P 5J1YA 2F4MB 2ZO4A 1X2MA 2XPVA 2ZXHA 2CSOA 5HS7A 5JLXA 5J4VA 2NOJB 1K61A 1ZK8A 4ANJA 3K4CA 5FFZA 3I54A 3K4LA 2IS1A 3B6AA 1BN5A 4M9SA 2ZFUA 3IH3A 1FIPA 3ZMTA 2STTA 2KZVA 4HX4A 4JYKA 1D0XA 2FUG2 1LFUP 3M4OJ 2J5OA 4AU7A 2QQ8A 5IT9Z 2DFIA 3IAS2 3K4MA 1EF4A 1SFOJ 3RZDJ 3X2QH 3W6JB 4KNYA 2F6CA 1H0MA 1S9HA 5CVVA 2GAUA 3M1EA 2P5LC 1AHDP 5DS9A 3EETA 4EJTA 1V4RA 2IJLA 3DTIA 4D7MA 2ZJ2A 2M7AA 3BPVA 5DD8A 1JI8A 2ESHA 3DEWA 4A5MA 2XUBA 3M3YJ 2O8KA 3HHHA 2CUJA 1ZR2A 3KCCA 2X6YA 3BWGA 1B9MA 2L01A 5ILVA 4LG0A 3MKZA 1W7PA 3IWZA 4I01A 2YUSA 3FX3A 1V5EA 2Y0SN 2NVUB 3DFGA 2W4SA 4BHPA 2AXLA 2VONA 3QWLA 2BXYA 1IG7A 2M45A 3E6CC 4J19A 3ELKA 2FBHA 3BG6A 1H9GA 4E4HA 5KAFC 3HOYJ 3CMYA 2ACJA 2I10A 3VOEA 1RR8C 2QSHX 4MTDA 5C44J 2F5CA 1XN7A 2IGNA 2DDAA 2F5DA 2W57A 1XDUA 2WV0A 1JKRC 1PYVA 2LH9A 3DTEA 4ON0A 4CCLA 1IZ1A 3CCVI 4E7JA 1O7FA 3BZCA 1K7AA 2GLOA 1X1AA 1FX7A 2HDCA 3G73A 1B72B 2HZDA 3ZQGA 1ZLJA 2KZGA 3DF8A 1UELB 3ABKH 1IJWC 2ME0A 3I59B 3OYHA 2RKHA 2LKPA 2AQFA 2E1NA 1Q1VA 2EBIA 4MIMA 1RC9A 1Y0UA 3L7WA 3M8JA 2F2EA 2O3FA 2DU9A 2KL4A 1UHMA 3FMRA 4KIBA 3PFYA 4HG2A 2Q2EA 1P6RA 5FKNA 4XSZF 2Y2ZA 3KP3A 3DTKA 1MMDA 3H9JA 1N77A 1FBQA 1MMSA 4FCYA 3CTAA 3GUDA 3V4GA 2V6EA 2WAQA 1MNEA 4A3EJ 3FMQA 2DOEA 3AL0B 4L9TA 4BQQA 4QTRA 1R7JA 4HX7A 4MFDA 3W2VA 1NK3P 3O3KA 3OYAA 1TWHJ 1XB4A 3ASNH 5KNLA 3TO9A 4A0ZA 1LFPA 4W97A 4A3LJ 3LWFA 3KZIC 3HJEA 3IRRA 3G1LA 3FKJA 3JTHA 1FYKA 2L0KA 2YX4A 4GYGA 1APLC 3CC4I 1WKMA 1MGTA 1W4MA 1JGSA 1I3QJ 2VJJA 4CCJA 2P7CB 1BA5A 4QPQA 4QPOA 1QO0D 4XQFA 2EV5A 3KYCB 2K9NA 4YEJA 4DW6A 3HC7A 3A01B 4A6EA 1VQPI 5IP7J 3ABTA 2JVGA 2CG4A 4IKFA 1B1BA 1SVOA 2RREA 4OMYA 1D0YA 4LIVA 4DYQA 2QZ8A 5DEQA 2V1XA 3K6GA 4L5EA 1AWCA 3J80Z 1MJBA 3LA7A 4R79A 4GDFA 2XAFA 5FD5A 5TISC 1ETWA 2X6WA 1BOAA 4AYBN 1ACIA 3EDPA 2WV1A 1XMAA 4HYEA 4KICA 2WB1A 4ZDPA 1QA6A 3DP7A 5CVJA 1MH4A 3Q0WA 4JX6A 5BOXA 2XRNA 2A05A 3WG7H 2VQHA 4BJTA 3CUQA 1BIAA 3OIPA 1HDPA 2EFOA 4FX0A 1X4PA 2AQEA 3VYTB 4CHUA 4A3IJ 2NS8A 1BI1A 3ZGKA 2M8EA 4RB3C 3ISPA 1MJ9A 1X4OA 1UCRA 3MZ8A 4BE2A 1ONVA 2XF5A 4A93J 4P9UA 4EGYA 3H9GA 1SVLA 2VQGA 4OAYA 2XB5A 2R7XA 5CKTA 4XMYA 2BY3A 3HRTA 3L2RA 2DO7A 3CUOA 2Y75A 2BY0A 5EZHA 3S2HJ 3OOPA 1IRGA 1IXSB 1N25A 4NQWB 5E1ZB 2TRTA 3L9FA 2K02A 1IC8A 2A6HF 1OYYA 1G2HA 2PX9A 5LHHA 4G7HF 2Z9OA 3SQNA 3DEUA 3MZYA 5EEGA 3CDHA 5K1YA 4EJUA 2JTVA 4HSRA 3LAPA 2XDVA 3T1BA 4IHSA 4MHGA 1XS9A 2DK5A 3BTLA 1BW6A 4ZTFA 2DJNA 3CP8A 2HFHA 4BNCA 4N4OB 2C6YA 4CYCA 1ZREA 1PUFB 2VJIA 4P9FA 1ZG1A 4L0YB 2P81A 1QU3A 2CU7A 2DT7B 1GDTA 2R7ZJ 3K4JA 4HDVA 2FMLA 3F9KA 2MH2A 5ED4A 3FWEA 3A0HC 3HHGA 4LK1F 4B1RA 1VTNC 4BXFA 3KFWX 2IGMA 1FTZA 1FMWA 2H8WA 2WBMA 3A1YA 5JR3A 1J5YA 3QPTA 4HPQA 3VSLA 4LFUA 2R5YB 3S1RJ 2FNAA 3G71I 2F5VA 2BYVE 1Y39A 1MNDA 1Z6TA 5D5WB 1B59A 2DQRA 3BQZA 3RKQA 5BNGA 5ILSA 2VIXA 3F8NA 3J80K 1RNLA 3ABMH 3IH4A 1JE8A 2R7VA 4PUSA 2OD5A 3DLAA 4S0HB 2TCTA 5J3LA 2W1OA 2NOGA 1GXQA 2EB7A 1B4AA 1E3PA 3QYBA 2ELJA 4XLEA 4B4CA 5LEKA 1ZR4A 1HA8A 2BZTA 3FKIJ 3JREA 5F0CA 2F48A 2VLAA 2BOLA 2CFXA 1AKHB 4I0AA 1IO2A 2WADA 2BY2A 4NC6A
chains in the Genus database with same CATH topology
4CSWA 1UAAA 4KITB 5HNHA 4H4KC 2WA0A 4U87A 4ZYAA 2KLOA 3DU6A 3CZ6A 4II3A 4XKWA 3TL4X 4LIUA 1SAUA 2R7QA 3HG9A 2CS3A 3OY9A 2X51A 2Y0SA 3CF2A 2KDOA 4CCKA 3BLYA 3DQVC 1WFXA 2IXSA 3DPUA 3LSKA 3LMMA 3L2VA 2R7OA 3S3OA 3ZRGA 1Z3YA 3TMOA 3OYBA 3UNGC 2KHMA 2MD0A 3FDYA 2K9MA 5FROA 3PL8A 3K10A 4E7LA 1G59A 2MFZA 3K4NA 5KHDA 3OYEA 1DP3A 2DT6A 2K5CA 3OL4A 2M4GA 4PJLA 5CPRB 3SYTA 4ITVA 4IX7A 4XN0A 4GRIA 4XKVA 1R6RA 2JVHA 4C9YA 2MABA 2Z2SB 3HPHA 4YELA 3H0DA 3ONQA 3EPZA 4AVZA 1YE9A 2RNGA 3H5RA 1YX5A 1D1BA 4G6TB 2X85A 1MMGA 2M4KA 4B44A 2DXIA 4P1WA 4LITA 2VJ4A 4PJMA 2IS6A 2JA2A 3VDXA 3HPGA 1WJAA 3FBNB 3EUKL 2CW7A 2HPIA 1OR7C 1N78A 3SEZA 4EATA 2W82A 3VYRB 4RMNA 3ZXSA 4PJJA 1IRXA 3S3NA 3OYCA 4XONA 4C30A 3V42A 4B3XA 2Z16A 5FRMA 4F93B 4BEHB 2KPMA 2VJ5A 3K70D 3K4BA 1MMAA 2XAUA 3L2QA 2KRCA 2WAEA 2R7WA 4XLAA 1WJ5A 2BW3B 4D1QA 2KQRA 4Y4RA 1E0EA 2LY2A 2LYCA 1WJEA 2MYSA 3PUBA 4CZCA 4XORA 3CJRB 2E5ZA 4XLFA 4RLQA 3OYGA 4OWRB 2OV7A 3MKYB 3A2KA 1LKXA 3S32A 4F91B 3DEEA 3W2WA 2O5RA 3ZCOA 4C2TA 2LC2A 3OWTA 3RQ4A 2HNHA 3SZGA 2E1MB 3HL2A 1PJRA 4XKCA 3EUHC 1P9QC 5HVQC 2LRDA 4F52A 1QHHD 2JSPA 2X1DA 4XR6A 3PNTA 1Z7LA 4Y3OA 2LY1A 1LVKA 4XOTA 4AYBA 2BVMA 3SDBA 2M0MA 4BDZA 4JOMA 2GOMA 4BUPA 4E7HA 3VYUB 3DWLE 4B48A 3BG7A 2XF6A 4PFPA 3U21A 2A6TA 2VKHA 3EUAA 3PNVA 4FASD 5KCMA 2CUZA 3AL0C 2KP6A 3C2GA 2BW3A 4RM3A 2CW8A 3ZQQA 3A4CA 3W3CA 1T95A 3J7AY 2HQAA 3C2HA 3AFHA 1X1DA 2OC6A 2A5WA 3OS2A 1KONA 4ZTJA 3HUGB 3HKZA 3LSGA 4BJ6C 3VWBA 1X1CA 2ZXHA 2NOJB 3LSHA 3K70C 2XC7A 2ZXIA 4ANJA 3QYEA 4F3QA 3K4CA 3D5RC 3K4LA 2IS1A 1TT0A 2ZFUA 3OYLA 2LOOA 2KZVA 4BJ5C 1D0XA 2FUG2 2CV1A 1UG0A 4AU7A 5LFAA 3S3MA 4XM3A 2CH0A 4CCNA 3OYNA 1X19A 3IAS2 3K4MA 4YRVA 1BR4A 5HOOA 2R7TA 2F6CA 4MLOA 1S9HA 2MC4A 2LBFA 3HOSA 2L2OA 3LL7A 3QYFA 2ZSIB 3OYIA 2V9KA 3DTIA 2M7AA 3N05A 2L5QA 1JI8A 2VKDA 2Q2EB 1WJDA 3D5SC 1W36D 5CQGA 4KISA 4NUBA 3H5NA 2CUJA 2P0WA 2X6YA 1U0JA 4PK4A 3MKZA 2OUMA 1V5EA 1J09A 1WJCA 2W4SA 2I8DA 3HOTA 1V5GA 4KJZA 4ZJZA 3BG6A 2R7RA 4E4HA 2X1EA 1G8XA 2DCEA 3MMYB 4DGWB 1T0FC 3IP4B 4XLHA 3OYJA 1ZELA 2Z1DA 1V5FA 2R4GA 4DBQA 2IGNA 3I9V2 4ZDLA 1N75A 2CFOA 5LD2C 2HPMA 1PYVA 2LH9A 4CA0A 4E7IA 1QHGA 3DTEA 4F55A 3DKYA 4XOPA 4CCLA 4E7JA 2V1NA 1X1AA 2VXZA 3LSIA 3PNYA 2F4IA 2HZDA 1D0ZA 1UELB 3OYHA 4C2UA 2AQFA 2VL8A 2IS2A 1BR2A 4CUGA 3M8JA 2DOAA 3KX2A 5HLTA 4XKBA 2KL4A 2UV1A 4DOZA 2VPLA 4P5OA 3PFYA 4HG2A 3H5AA 1EA3A 4HEA2 2ZSHB 3HXLA 4D9JA 3KEYA 2X6XA 2E1MC 3DTKA 1MMDA 3H9JA 2HU9A 2HVQA 1N77A 3PSFA 4J00A 3OIQA 2E60A 2V6EA 2UWMA 4IQJA 2GOXB 2WAQA 4BEHA 1MNEA 3SEQA 1DGRM 2X1CA 3S8PA 4BQNA 3AL0B 2RQQA 2VASA 4XNFA 2XSJC 4BQQA 2LG4A 3E0JB 2Q1ZB 3RTRA 3PJRA 3W2VA 3OYAA 4XLCA 4CCOA 4CCMA 3S93A 5KNLA 3NWSA 3OR1C 4OAZA 4ZC3A 1LFPA 3OMYA 1LDKB 2BVLA 2DJIA 1W36C 4DIQA 1D1CA 3CESA 3FKJA 3OYDA 4BU2A 2R7UA 1GLNA 3TBIA 4BE1A 2VJJA 4CCJA 2PJRB 4X0GA 2KMUA 4QPQA 4BACA 4QPOA 4XQFA 2CV0A 3DPTA 1VZ0A 4YEJA 1ERDA 3UR3C 3HC7A 2V4JC 3OL3A 3RCOA 4E7SA 2HVRA 4BE0A 2JVGA 3D5LA 4IKFA 2RREA 2PMZA 1D0YA 4LIVA 4II2A 3DU5A 2L7KA 2WY7Q 1Y56A 4HRIA 3K6GA 4R79A 3CP2A 5CQEA 2UUZA 2X6WA 1FMVA 1MW7A 4CH7A 3GBGA 4NC8A 2V26A 4ZDPA 4E6KG 2WB1A 1Y6IA 2VQLA 1K6YA 3OYMA 4HNUA 3OYFA 3L2UA 1TZLA 4E7ZA 2VQHA 3E1SA 4BL0B 3IAM2 4BJTA 4XL9A 3OIPA 2VQCA 2HVSA 1X4PA 4J01A 2AQEA 3VYTB 4PSXA 3OS1A 2VB6A 3ZGKA 3ZR8X 4N4NB 1X1BA 2WY8Q 3OYKA 1NG7A 1X4OA 3CMMA 4BE2A 2XF5A 2JUGA 3H9GA 4BS9A 2VQGA 4OAYA 2R7XA 3PSIA 3BC8A 5CKTA 4XMYA 2IGOA 5HNFA 3L2RA 2QKLB 4B43A 3RPUD 3LFUA 3BCBA 2CMPA 4NQWB 2PJRA 4XN3A 4HSTA 1Z21A 2CV2A 4KT6A 1DGWY 3MD2A 3W2AA 4HSRA 2XDVA 3VSKA 2L9SA 3I3LA 3MKWB 4NNJA 2LREA 4IZZA 2M7BA 3BCAA 1SFKA 3H35A 5TGTA 4ZTFA 4DBRA 1DQUA 3CP8A 4U7BA 1AA7A 2W7NA 4N4OB 1BOBA 3OS0A 2WAFA 4RM2A 2R7SA 2K3PA 2VJIA 1OLTA 4HNTA 3H9QA 1QU3A 3K4KA 2DT7B 4FETA 4NC7A 3K4JA 3OR2C 3DPLC 1YX3A 2IS4A 3F9KA 2VXDA 5FRNA 4PSWA 2E5NA 4BXFA 5JHFA 2IGMA 4RLFA 1FMWA 2WBMA 2KRHA 3A1YA 2W00A 3DKXA 4HPQA 3VSLA 4BGDA 4E7KA 3FHNA 3QOEA 2F5VA 3OOUA 1MNDA 4PFOA 3KYLA 3L2WA 2VIXA 2XF7A 4Y33A 2L9NA 4BQOA 2HDWA 4F92B 3AKZA 3VYSB 3QODA 4DJAA 4ZDOA 2M3AA 2R7VA 4LG3A 4PUSA 3DLAA 1WJBA 1D1AA 2W1OA 1WJFA 1BR1A 4B47A 1Z3XA 3LSMA 3CJQB 4PJNA 3QYBA 1MMNA 3NWTA 2IGKA 2ELJA 2LBFB 3IUOA 4XLEA 4JQFA 1HA8A 3FBIB 2V7FA 4BDYA 2VLAA 2BOLA 4IQ4A 2QKMB 3RSNA 3M1CA 2K9LA 2WADA 1NG6A 3G2BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D5R C;  2WY7 Q;  2GOX B;  2NOJ B;  2GOM A;  3D5S C;  2JVG A;  2JVH A;  2WY8 Q; 
#chains in the Genus database with same CATH topology
 3CUQ C;  5HNH A;  5C4X J;  2EK5 A;  3J7Y J;  4BY1 J;  2K9S A;  4UNO A;  3CZ6 A;  3TL4 X;  1TL8 A;  2HQ5 A;  4LIU A;  1XX5 A;  1SAU A;  2R7Q A;  5DCM A;  3EUH A;  3HYI A;  2CS3 A;  4WWC A;  3F6O A;  3CF2 A;  4CCK A;  4RBO A;  2GQQ A;  4UUT A;  1YRN B;  3LNQ A;  1UFM A;  3DQV C;  4A3K J;  1IV8 A;  2R7O A;  4ZYH A;  3S3O A;  1VQ7 I;  2XKP A;  4UVB A;  1FC3 A;  1I27 A;  1JUS A;  4NHJ A;  1ZG5 A;  3JW4 A;  4BKX A;  4GFB A;  3V7C A;  1ZYR F;  2M5W A;  4A6D A;  4E7L A;  4IRG A;  1OKR A;  3K4N A;  1DP3 A;  1W0T A;  2K5C A;  5J47 A;  1P4X A;  3TQN A;  3MKL A;  2XGX A;  3P9C A;  4ITV A;  1VQO I;  3WTX C;  2DPU A;  1VQ8 I;  2HEO A;  2BBY A;  2QQA A;  4NB5 A;  4GCV A;  2XGD A;  3PQK A;  3ONQ A;  3HRU A;  2JRM A;  3U9G A;  5IP6 A;  3EYY A;  3H5R A;  1YX5 A;  3S14 J;  2X85 A;  4M3E A;  1VQ9 I;  2CYY A;  4P1W A;  2IEK A;  2PFB A;  1VI0 A;  3DBL B;  1CF7 B;  1SFU A;  1WJA A;  4UUS A;  1W5T A;  2CW7 A;  4P96 A;  1FBU A;  1J75 A;  1N78 A;  3SEZ A;  1I50 J;  3O6B B;  3HOZ J;  2AHQ A;  2W82 A;  2OZU A;  5EGO A;  1GT0 C;  3GME A;  3FM3 A;  4YIR X;  3K69 A;  2OQR A;  4PJJ A;  2QSG X;  2VOO A;  1IRX A;  1K4S A;  4XON A;  1EH6 A;  5D4R A;  4C30 A;  2K9Q A;  2VBZ A;  1XSX A;  3LFK A;  1MMA A;  2XAU A;  4M6X A;  1YW7 A;  2M0C A;  1NK2 P;  4D1Q A;  3SDG A;  2GIZ A;  3AG2 H;  4Y4R A;  3WTZ A;  5B3S H;  2LYC A;  3SJM A;  1P4W A;  4WXD A;  1LE8 B;  1J2X A;  4W1U A;  5FD6 A;  1FP2 A;  3E3V A;  3J81 K;  1VFC A;  3I4P A;  3PIO F;  2A5Y B;  4OWR B;  3JRF A;  4A2U A;  2EWN A;  1F5T A;  5H20 A;  3MKY B;  3HM5 A;  1QZE A;  3W2W A;  1S7A A;  2CQN A;  2E1M B;  4UVA A;  5F1J A;  4XKC A;  3I64 A;  2FBI A;  1P9Q C;  2LDU A;  3EUH C;  2LRD A;  1Z77 A;  4IHT A;  5E79 C;  2DBB A;  2J5P A;  4Q48 A;  3V8L A;  1QHH D;  3FXL A;  3G6E I;  2P7V B;  3HDD A;  4Y3O A;  1LVK A;  1LDJ A;  3KP5 A;  2PLY A;  2VC1 A;  1T0F A;  1ETY A;  1YW8 A;  2CUE A;  2GZW A;  3KP4 A;  2BGC A;  4BDZ A;  4V19 K;  2HI3 A;  5GP9 A;  3VYU B;  3ABL H;  2IA0 A;  2RAE A;  3NAU A;  4QSH A;  3IC7 A;  2QUF A;  4OIR F;  1YIT I;  4PFP A;  2QQ9 A;  2HTS A;  1JTY A;  1WI3 A;  5FLX Z;  2K86 A;  2DYR H;  3FK7 A;  1BM9 A;  1BBY A;  3KLO A;  4FAS D;  4ENJ A;  1LJ9 A;  1WH7 A;  3BP8 A;  2QVO A;  3L2C A;  2KP6 A;  2QYO A;  1IDZ A;  5IYD J;  3WGI A;  2CW8 A;  1BI3 A;  3WHC A;  1YJW I;  1EV7 A;  1OFC X;  2VBY A;  3C3W A;  3PQJ A;  1ZQ3 P;  3ZOB A;  2NVT J;  2ZJR F;  3C2H A;  3S1Q J;  3ASO H;  2E7X A;  2G7U A;  3JAM K;  1E3O C;  3HKZ A;  1L0O C;  5F0F A;  3WTW C;  1WZ2 A;  3QPL A;  3LSR A;  1YO5 C;  1X1C A;  1TW2 A;  3S2W A;  1POG A;  2VC0 A;  3LSH A;  3K70 C;  1R4N B;  5B5E C;  2PI0 A;  3QYE A;  1HW1 A;  3IHU A;  3VPR A;  5EG0 A;  3P9K A;  1Z91 A;  2H6C A;  1VQ5 I;  1S8N A;  3C18 A;  2DOD A;  4BJ5 C;  2JPB A;  1UG0 A;  1XMX A;  4KFC A;  4XM3 A;  2OPT A;  3OYN A;  1FNN A;  1X19 A;  2FE3 A;  1BR4 A;  2DMT A;  5K7Z A;  3R0J A;  2LK2 A;  1OCC H;  2MC4 A;  4FTH A;  2LBF A;  1YQA A;  5FB2 A;  2F5F A;  1PUE E;  1G4D A;  2L2O A;  3QYF A;  4KMU X;  5C4J J;  3OYI A;  2V9K A;  2EIJ H;  2EV6 A;  2VT3 A;  1ODD A;  3R60 A;  1W36 D;  4KIS A;  3ERM A;  2YU9 J;  2XB0 X;  4H0E A;  1R5I D;  4Y17 A;  4RB1 A;  3GF2 A;  1U8R A;  1WSU A;  4PK4 A;  1WPK A;  5GAG J;  4M73 A;  5M5Y J;  1XGO A;  2XIG A;  3C7J A;  4HLX A;  4C2M J;  4LMY A;  3JRB A;  4EVI A;  5DM7 F;  4M71 A;  1G8X A;  2DCE A;  1ETK A;  1IN5 A;  2L7M P;  2E34 A;  1P7I A;  1T0F C;  1SFX A;  3IP4 B;  3ULQ B;  2LSO A;  4CDG A;  2MLK A;  3CLQ A;  4U7D A;  1ZEL A;  2Z1D A;  1H89 C;  1V5F A;  2R4G A;  5HLG A;  5FLX K;  3J7Z I;  2R92 J;  4ZYD A;  1T38 A;  2FNP A;  1J0R A;  2BHZ A;  1D5V A;  1N75 A;  2N8G A;  2WC2 A;  3H0G J;  5DV5 A;  5ICE A;  4CA0 A;  3FM5 A;  1QHG A;  1T8I A;  1HC8 A;  1GVJ A;  2QEN A;  5LLQ A;  1R1V A;  2OJE D;  1GV5 A;  3GX4 X;  1UMQ A;  2ICW G;  1ZAR A;  2FEZ A;  1TLH B;  3I4M J;  3LSI A;  4RB0 A;  2DFF A;  4L18 B;  3IKV A;  2ZXJ A;  1D0Z A;  2EPF A;  2R5Z A;  4X1E A;  1TQP A;  3WTY C;  2IS2 A;  5AIP A;  5M3F J;  4CUG A;  2FF4 A;  1QPM A;  1G6N A;  2CUF A;  2DOA A;  3E7L A;  3KX2 A;  1MSF C;  1STZ A;  4ZYE A;  4AC0 A;  4P5O A;  3P7N A;  5E20 A;  1R1U A;  5E1W A;  4XK4 A;  4HEA 2;  1PVE A;  2ZSH B;  3HXL A;  1R1T A;  1Z0X A;  3WTU C;  2HVQ A;  1HW2 A;  2MH9 A;  2FX0 A;  4J00 A;  2ECB A;  2E60 A;  1IN6 A;  4BEH A;  1K78 B;  1V54 H;  3SEQ A;  1RI7 A;  4JBA A;  2DT5 A;  1I1G A;  5KAI C;  2XSJ C;  3JSO A;  5HS8 A;  1O57 A;  5L3C A;  2X9D A;  1J9I A;  3TW6 A;  4CCO A;  5D5V B;  1R4M B;  4KMF A;  4UHT A;  1EKE A;  2OCE A;  1X3W B;  2UXN A;  3LSJ A;  3JRD A;  4Z6Y A;  3FXM A;  4DIQ A;  1D1C A;  3CES A;  1FP1 D;  1NH3 A;  1ZH5 A;  1A6Q A;  1DU0 A;  4YFK F;  3I71 A;  4XRM A;  4LLN A;  2VOP A;  2PJR B;  4X0G A;  3N4M A;  3QOP A;  2CV0 A;  1Z67 A;  2A69 F;  4DYR A;  2DAO A;  2K4B A;  4XIC A;  2V4J C;  1ZHF A;  4BAY A;  5F6F A;  3TP0 A;  1ZAO A;  2ZFW A;  4BE0 A;  1S6L A;  2PMZ A;  3DU5 A;  1HXD A;  2F4O B;  4ETS A;  5FO5 A;  1F36 A;  4WXC A;  3CP2 A;  4Q4Z F;  4IHW A;  5CQE A;  3GBG A;  3K2Z A;  3SZT A;  4HQM A;  2V26 A;  5LGT A;  2OU2 A;  1Z7U A;  4DZJ A;  4HBL A;  1Y6I A;  2VQL A;  2QBY B;  1FYL A;  2O0Y A;  5HLI A;  3MZH A;  4HNU A;  3P9I A;  4EM0 B;  3IAM 2;  4M6Y A;  2JPC A;  1U3E M;  5EDN A;  2H6B A;  2NYX A;  2VBX A;  3GWZ A;  3JSP A;  3NQO A;  1YOV B;  3ROU A;  3OS1 A;  2XGC A;  2P4W A;  4FIS A;  1RUO A;  2OF7 A;  2LNB A;  3KEQ A;  2M2E A;  2G0E A;  1BI0 A;  2V9P A;  2RVC A;  1A36 A;  5F08 A;  2E36 A;  3BR3 A;  3S15 J;  2V9V A;  3HB9 A;  1ZRC A;  2YU3 A;  3BR0 A;  1W5S A;  5E8I A;  3VFZ A;  2V79 A;  3V7R A;  4YIF A;  2HXI A;  3RKX A;  2KIS A;  2QWW A;  4XLN F;  2AXT C;  4RS8 A;  2CV2 A;  3QU3 A;  5D6E A;  3W2A A;  2EZI A;  4HQE A;  3ECH A;  2Y9Y A;  2EIN H;  2HYF A;  3VSK A;  2L9S A;  4N9I A;  3MKW B;  3BCA A;  3NAR A;  3LA2 A;  1SFK A;  5K5R A;  1FZP B;  1SMT A;  4G6D A;  3H35 A;  1O3S A;  3MWM A;  3R61 A;  2X48 A;  4PGG A;  4RM2 A;  2COM A;  1X58 A;  3LSP A;  5FKK A;  1OLT A;  4HNT A;  3K7A J;  5CVR A;  1OYI A;  3V8J A;  3OR2 C;  3GTG J;  3AG4 H;  2DW4 A;  2VXD A;  5FRN A;  1TTY A;  4PSW A;  5JI6 A;  5JHF A;  3C2B A;  3QQA A;  3QP5 A;  3ZP5 A;  1G3T A;  2W00 A;  2B7E A;  3ECO A;  3PIP F;  4EGZ A;  4BY7 J;  4BGD A;  1FY7 A;  4E7K A;  3FHN A;  1UZC A;  4G7Z F;  3O8H A;  3OOU A;  2XAJ A;  3P5J A;  2LMD A;  2ZME B;  3HOU J;  3L2W A;  3WG9 A;  2XF7 A;  3CDI A;  2L9N A;  2HDW A;  4F92 B;  1RES A;  2CO5 A;  2R7F A;  2F5E A;  2EZK A;  4ZDO A;  3DBH B;  3I0T A;  2KT0 A;  2JQ7 A;  5E18 F;  1SD4 A;  1WJB A;  4C3I J;  1BR1 A;  4B47 A;  1Z3X A;  3DV8 A;  1PP8 F;  3HSE A;  2MG4 A;  4PJN A;  5H6R A;  4XRS G;  1D8J A;  2B63 J;  2IGK A;  1AU7 A;  4B8X A;  5ICG A;  3CCQ I;  1MDM B;  3H3U A;  3BG5 A;  2V7F A;  4JK1 X;  2L4M A;  2QA4 I;  4IQ4 A;  2QKM B;  3RSN A;  1SAX A;  3M1C A;  4M3G A;  4CSW A;  4KIT B;  4A12 A;  4U87 A;  4D5F A;  3IRQ A;  2DTR A;  4II3 A;  4XKW A;  2OZ6 A;  1WI9 A;  1VND A;  5K7H A;  1KGS A;  3OY9 A;  2Y0S A;  5DM6 F;  2H1L A;  3BLY A;  3EQL F;  3GTM J;  4AUX A;  1WFX A;  3Q0U A;  2HGC A;  1U9O A;  3DPU A;  3LSK A;  3LMM A;  3WU0 A;  1I39 A;  3ZRG A;  1IN8 A;  5D8L B;  4RGR A;  3KP2 A;  1H88 C;  3FXK A;  3F21 A;  2V6C A;  1J7K A;  2MD0 A;  4IPA A;  2BV6 A;  3FDY A;  3S1M J;  4PJ0 C;  3K10 A;  1X2N A;  2P8T A;  1VQK I;  5KHD A;  2DT6 A;  2MLG A;  3SYT A;  4IX7 A;  1HCR A;  2EH3 A;  4XN0 A;  4UB6 C;  3CCE I;  4KYW A;  4C9Y A;  3U1D A;  1R00 A;  3H0D A;  3HSR A;  3NEU A;  1YE9 A;  5D5X B;  1OCR H;  1SD5 A;  1X3Z B;  2RNG A;  3GLL A;  3CO6 C;  1D1B A;  2R93 J;  1S5L C;  3GTK J;  4G6T B;  1U5T B;  5IYC J;  3AG3 H;  2ZC2 A;  2K7L A;  5D8K B;  1YIO A;  2VJ4 A;  4PJM A;  3QPS A;  2KKO A;  3BTI A;  3FBN B;  3EUK L;  2HPI A;  1I6H J;  4HA8 A;  1AKH A;  1D5Y A;  2KDZ A;  2NS0 A;  4N0B A;  2D5V A;  2IVM A;  1WH5 A;  2D1V A;  5HDK A;  2RGV A;  3BG9 A;  3OYC A;  5J6X A;  2WTE A;  1QRY A;  4B3X A;  2HYJ A;  3E6D A;  3EYI A;  3ZMZ A;  5D4S A;  1MBK A;  2VJ5 A;  3K4B A;  1OPC A;  4KIG A;  5AIQ A;  3L2Q A;  1YRN A;  3FXO A;  3QRF F;  2R7W A;  2XVC A;  4XLA A;  2COB A;  3Q9S A;  3DLL F;  4TV7 A;  1G3S A;  4WK8 F;  2ZXW H;  1WJE A;  4HX8 A;  2MYS A;  3I55 I;  4XOR A;  5H2F C;  2HOE A;  3S2D J;  4XLF A;  3FK6 A;  4HAM A;  2FA5 A;  1WRJ A;  1IW7 F;  3IWF A;  2NVQ J;  2M34 A;  2A3S A;  3DEE A;  4MNU A;  3ZCO A;  2LC2 A;  3BJ6 A;  3OWT A;  4OIN F;  3HL2 A;  1HLV A;  1KU3 A;  4YII A;  3SHF A;  2EIK H;  2R3S A;  1WQ2 A;  4F52 A;  3KPH A;  3SXY A;  1XMK A;  3ZQ7 A;  1VQ4 I;  1TQM A;  1JKO C;  2OQG A;  2X1D A;  3HIF A;  3PNT A;  2OTL I;  1CF7 A;  2FOW A;  4AYB A;  2FXA A;  2O8X A;  3SDB A;  1ZRD A;  3VOD A;  1QGP A;  2EA2 A;  3I58 A;  2M0M A;  4U0Y A;  5A2Q K;  2GOM A;  1FJL A;  2MBF A;  3R4K A;  2QCO A;  4BUP A;  4E7H A;  3DWL E;  1OYW A;  3HEF A;  1MSE C;  1MIJ A;  1B8I A;  1ZKG A;  3RKY A;  1FOY A;  1XSV A;  2M9H A;  5FKL A;  5K7F A;  3IKT A;  3CUQ B;  3BG7 A;  3T8T A;  2XF6 A;  2Y30 A;  4P55 A;  3MN2 A;  3J81 Z;  2R7D A;  3U21 A;  3FIS A;  3K1N A;  3S1N J;  1UJ8 A;  1ZGA A;  5LEJ A;  2QM3 A;  2HDD A;  4EV0 A;  3CCS I;  1A5J A;  2FMY A;  2L3D A;  5L3B A;  2MA3 A;  4RM3 A;  2KRF A;  4IVN A;  4D5C A;  5HOD A;  1Z05 A;  3GTO J;  3LQR A;  3FMS A;  2TDX A;  2FSW A;  1LE8 A;  4QWQ A;  4KA4 A;  1T08 B;  1SFE A;  2A61 A;  2B0L A;  2OC6 A;  1KQ9 A;  4O5V A;  5EF6 A;  4FE4 A;  4ZTJ A;  2V1D A;  5J40 A;  1FOK A;  4BJ6 C;  3JRA A;  2DLL A;  3VWB A;  4HF1 A;  3Q0V A;  4QIW N;  3O8G A;  2O7O A;  5F1R A;  2EFW A;  4HLY A;  5KK1 A;  2ZXI A;  1SMY F;  4F3Q A;  1JKQ C;  4RGS A;  4ENM A;  1T56 A;  1I5Z A;  1S72 I;  2LLK A;  2ELK A;  5IY5 H;  2Y69 H;  3BRO A;  2CV1 A;  1B6A A;  4QLC U;  5LFA A;  3S3M A;  3FXR A;  2CH0 A;  4CCN A;  2DI3 A;  5CLS A;  5M3M J;  2DA2 A;  5HOO A;  4EEF G;  3TOB A;  2HQN A;  3MQ0 A;  4L9V A;  4MLO A;  1TWG J;  1RR7 A;  1AOY A;  3HOS A;  4C3H J;  3SFZ A;  2BE5 F;  1XPX A;  3LL7 A;  1Y8R B;  3R6S A;  3I4N J;  2ID6 A;  2EIL H;  3BTC A;  3HOX J;  4EM2 A;  3I53 A;  3JAM Z;  1WJD A;  3D5S C;  2K85 A;  4FE7 A;  3JRG A;  2EA4 A;  2W48 A;  5CQG A;  1SEU A;  3MCZ A;  3H5N A;  5ICC A;  1JT0 A;  5CVU A;  5DDG A;  3DBR B;  1R23 A;  4RB2 C;  3J7A O;  1TT5 B;  2E1O A;  1OJL A;  2OUM A;  4GGG A;  4BHC A;  1WJC A;  3HOT A;  2I8D A;  3QAH A;  3QU6 A;  2O61 A;  1W7P D;  4ZJZ A;  3TW7 A;  2R7R A;  1EH8 A;  2RN7 A;  4DGW B;  4UXN A;  1WVR A;  1ZGJ A;  4HV6 A;  2ECC A;  1F9N A;  3I9V 2;  2M1B A;  1IRF A;  4ZDL A;  1JHF A;  1HKT A;  1EH7 A;  2ME6 A;  2CFO A;  2VBW A;  4GYI A;  2H27 A;  5IPA A;  1T33 A;  4E7I A;  3ZN0 A;  4F55 A;  1IV6 A;  2E7W A;  4U88 A;  4XOP A;  3HOW J;  5ERI A;  2F4I A;  3I5U A;  3M07 A;  3L00 A;  2KIU A;  4ESF A;  2VL8 A;  2XRL A;  1BR2 A;  3U2R A;  4FX4 A;  3GTJ J;  2FQ4 A;  5HS9 A;  1NHA A;  4CYD A;  1TWA J;  3F8F A;  4XKB A;  3RYP A;  3CCY A;  4DOZ A;  2JRT A;  1JT6 A;  4N9H A;  2NNN A;  3H5A A;  1EA3 A;  3BOQ A;  1KQ0 A;  4MQ9 F;  4D9J A;  1IDY A;  2X6X A;  2E1M C;  4LB5 A;  3BZK A;  2IT0 A;  3L09 A;  4Y15 A;  1IN4 A;  2Z33 A;  4WCG A;  2IPQ X;  4AD9 A;  1RZ4 A;  2GOX B;  3F8B A;  2ZJQ F;  2EV0 A;  3GFM A;  3S8P A;  2LD5 A;  3C1D A;  4UV9 A;  2HR3 A;  2RQQ A;  2IBD A;  2UXX A;  2VAS A;  4XNF A;  1H9T A;  2LG4 A;  4WX9 A;  2EZL A;  3BTJ A;  5HDG A;  3RTR A;  2HZT A;  3PJR A;  3HRM A;  2HOA A;  5E1X A;  4XLC A;  2XPU A;  4I0B A;  2XGE A;  3OR1 C;  4OAZ A;  4ZC3 A;  4EJO A;  3ZMD A;  1LDK B;  1MBJ A;  3TO6 A;  1UHS A;  2BEO A;  2BVL A;  2GXA A;  5DTD A;  2DJI A;  4IO9 F;  3VB2 A;  1KA8 A;  1KYZ A;  3M8E A;  5EGO B;  2R7U A;  2DMN A;  5LHI A;  1GLN A;  5EEH A;  3LAJ A;  9ANT A;  4BE1 A;  4ENK A;  2KMU A;  2AS5 F;  2DPD A;  4BAC A;  2O9L A;  3OIO A;  3DPT A;  3SFI A;  3RQI A;  1LEB A;  1OCP A;  4JX5 A;  4EM1 A;  1ERD A;  3UR3 C;  3L1P A;  4O3M A;  3OL3 A;  5CVI A;  1A6I A;  2GBY A;  4A3G J;  1W5C C;  3D5L A;  2I5U A;  2KIM A;  2DQL A;  1RPW A;  2E71 A;  1TWC J;  1FOW A;  1BIB A;  4II2 A;  3RYR A;  4PCQ A;  3V8K A;  1Y56 A;  2BHY A;  2ETH A;  2P5K A;  1O3T A;  4LJZ F;  3ZN1 A;  1SC7 A;  2UUZ A;  1FMV A;  2HOT A;  3CDL A;  1GV2 A;  4I7H A;  3RPQ A;  2HOS A;  1JHH A;  1JJ6 C;  3Q3S A;  1T39 A;  4G9Y A;  3TKY A;  3OYM A;  2DMU A;  3OYF A;  3L2U A;  1TZL A;  3GTQ J;  2DFE A;  1QZZ A;  3ABU A;  1MD0 A;  4AVP A;  3LOC A;  2VQC A;  1IRZ A;  4BBR J;  4J01 A;  4I6Z A;  2HVS A;  4Q47 A;  3E97 A;  4L5J A;  4IL6 C;  2CQ7 A;  3ZR8 X;  2H09 A;  4N4N B;  1OIS A;  1X1B A;  5LRR A;  5L3F A;  2WY8 Q;  1JXS A;  2ZJP F;  3OYK A;  2CQQ A;  3BJO A;  1HQC A;  3BG3 A;  3CMM A;  1A31 A;  2JUG A;  3KET A;  4HNV A;  4D0P A;  5TRD A;  3BC8 A;  1FSH A;  5HNF A;  2W24 A;  1R9T J;  2MGQ A;  1TNT A;  2GWR A;  3R0A A;  4I02 A;  2JA7 J;  1TBX A;  4HDU A;  3BCB A;  3BR6 A;  3HUG A;  1O3R A;  2HKO A;  1XTA A;  2CMP A;  1YTY A;  3HSF A;  2PJR A;  4U0V A;  3HGG A;  1HOM A;  1F4K A;  1UST A;  4Y52 J;  2DK8 A;  1Z6R A;  5TJJ A;  4B3A A;  1BL0 A;  4EQQ A;  2PEX A;  3TP3 A;  2W85 A;  4NNJ A;  5JLW A;  5TGT A;  1FTT A;  3SZP A;  1DQU A;  5ILU A;  5IT3 A;  3F23 A;  3D1N I;  4A3J J;  4IHY A;  4XLP F;  4IHX A;  1D3Y A;  1M1E B;  2K3P A;  2PBI A;  4RGX A;  3WTS C;  1Q1H A;  4FET A;  1RKT A;  1LB2 A;  4NC7 A;  3DPL C;  1OCO H;  1U2W A;  3M8F A;  1HSJ A;  3O2P E;  5B1B H;  2VUM J;  2QBY A;  1OQY A;  2GXB A;  3S16 J;  1P92 A;  5KVR A;  4BXU A;  5BS6 A;  3ESW B;  3QOE A;  1I6X A;  4EJW A;  2NNY A;  5EG0 B;  4PFO A;  2LFB A;  3KYL A;  3JCU C;  2RV8 A;  4BQO A;  4X6A J;  3PFI A;  3GZN B;  3QOD A;  4DJA A;  1JGG A;  4CZZ A;  1QVT A;  4BXX J;  2LKS A;  2K3F A;  1GVD A;  2M3A A;  3KYD B;  1U8B A;  1D1A A;  1ORK A;  4PDK A;  1MKM A;  1SAN A;  1XC5 A;  3LSM A;  3BR2 A;  4UB8 C;  4AID A;  5K5Q A;  3GYH X;  2ESN A;  1Z1D A;  3F0C A;  2LBF B;  3IUO A;  1ULY A;  2KIQ A;  4JQF A;  2L7F P;  4AM3 A;  3M7G A;  4Y7N J;  2D1H A;  4IOA F;  3WTV C;  2JN6 A;  2A6E F;  2K9L A;  1PP7 U;  3G2B A;  3CO7 C;  2CQX A;  2H1K A;  3FXU A;  2WA0 A;  2DFH A;  3KLN A;  2QQB A;  3DU6 A;  4I09 A;  5IOZ A;  2YX7 A;  2IRF G;  5DCF A;  2BY1 A;  2X51 A;  4XRS A;  4JP0 A;  1RUN A;  3ZMV A;  4BHB A;  3ERE D;  1B72 A;  3TO7 A;  2QLZ A;  3ZQF A;  3L2V A;  1NTC A;  3I59 A;  3F3X A;  5FJ8 J;  1GUU A;  2A68 F;  1Z3Y A;  3TDZ C;  5BPD A;  5LBQ A;  3CJN A;  3OYB A;  2HWV A;  4L9N A;  2KHM A;  2CW0 F;  1R58 A;  3MFK A;  1P2F A;  4I99 C;  1IUF A;  2YSR A;  2K9M A;  4IOC F;  1MBE A;  5FLM J;  1G59 A;  2NVX J;  3H36 A;  1IGN A;  1LFB A;  1TC3 C;  3OYE A;  2LY9 A;  2PG4 A;  1YYV A;  4ZYG A;  2FBK A;  5LRS A;  3G3Z A;  2ZME A;  2EQR A;  1U9N A;  3N97 A;  4GRI A;  4A69 C;  1R6R A;  2JVH A;  2L9R A;  2MAB A;  3RDI A;  4YEL A;  3GFJ A;  3CMA I;  3EPZ A;  4G94 A;  4AVZ A;  3GZ5 A;  2WAQ N;  2Z5U A;  4OOI A;  4XID A;  3GEZ A;  6PAX A;  1IN7 A;  1HBX G;  2R5Z B;  2Q8K A;  2QGU A;  5M5X J;  1MMG A;  2M4K A;  4B44 A;  5B1A H;  4M6V A;  2DXI A;  2ZB9 A;  3FHZ A;  2DA3 A;  3B73 A;  3RPU A;  1MDM A;  1TW3 A;  2JA2 A;  3HPG A;  1X1P A;  1OR7 C;  1MJA A;  2ISY A;  3F72 A;  2R0Q C;  4EAT A;  4LD5 A;  3CLO A;  4M9Z A;  3GXO A;  3ZXS A;  2DYS H;  3S3N A;  3I56 I;  1CQT A;  3V42 A;  2Z16 A;  3WU1 B;  3A01 A;  3GZ6 A;  1MZB A;  1HDD C;  1R5H A;  2KPM A;  3QPH A;  4G12 A;  4BEH B;  3K70 D;  2Y9Z A;  2NVY J;  3CCM I;  1LQ1 A;  1TWF J;  3RZO J;  2MW8 A;  1QZY A;  5DUK A;  2HS5 A;  1HF0 A;  3HZJ A;  2WAE A;  1WJ5 A;  2BW3 B;  2JA8 J;  2XAQ A;  2KJB A;  2LKX A;  2G7H A;  1WHU A;  2LY2 A;  5GPA A;  1T2K A;  4HF0 A;  4NDL A;  1UB9 A;  5HDN A;  2CRG A;  4LGW A;  4RLQ A;  1KU7 A;  3OYG A;  2WB1 N;  2EFP A;  3KEO A;  4MTE A;  4Y13 A;  1XG1 A;  1LKX A;  2D45 A;  4F91 B;  1A35 A;  4M74 A;  2GIV A;  2M87 A;  1RET A;  2O5R A;  3H3Z A;  1MNM C;  2L02 A;  3BJA A;  4M9X A;  5C3E J;  1W0U A;  2FD5 A;  1O4X A;  1R71 A;  5HVQ C;  5F0H A;  4HV5 A;  1V55 H;  1S29 A;  1U5T A;  2W25 A;  4DZP A;  2EFQ A;  1YS7 A;  4I98 B;  3ZQC A;  2JSP A;  3HTU A;  5E8G A;  3B02 A;  5EJC A;  4BBS J;  2JZY A;  1Z7L A;  4A0Y A;  4CXF A;  2ISZ A;  3OSF A;  4A3D J;  1BW5 A;  5F27 A;  4OIQ F;  1I1S A;  2O03 A;  2VE8 A;  4E70 A;  3ZMU A;  1QPI A;  4NQW A;  1MBF A;  2O6G E;  2IAI A;  3FIW A;  3ZPL A;  3WU2 C;  2FU4 A;  3BDD A;  2XHK A;  5DUI A;  2ZME C;  3GFL A;  2XKO A;  4WF2 A;  2VKH A;  3BR5 A;  1BI2 A;  2DA1 A;  1ENH A;  3EUA A;  5KCM A;  1VQ6 I;  1HST A;  2CUZ A;  5IT9 K;  4YFX F;  1Z9C A;  5D6F A;  3AL0 C;  3C2G A;  5FLV A;  4MQV A;  1Y8Q B;  4LG0 B;  1W7P B;  1Y0N A;  3A4C A;  1T95 A;  2HQR A;  4FT8 A;  3K1M A;  3G4S I;  3TGN A;  3J7A Y;  2HQA A;  1PUF A;  4V2F A;  4S04 A;  3IV5 A;  1X1D A;  3IH2 A;  4DQ2 A;  1RIO H;  3OS2 A;  2K40 A;  3HBL A;  1CGP A;  1VQN I;  2XAH A;  1K4T A;  4FQG A;  4IEJ A;  4MO7 A;  4XRF A;  1SD7 A;  1LNW A;  4V2G A;  1FWZ A;  1FIA A;  2XC7 A;  2R5Y A;  1KU2 A;  2JMW A;  1IUY A;  5A2Q Z;  2P6T A;  3D5R C;  1QVU A;  2GM4 A;  1TT0 A;  3ML6 A;  3ZQH A;  3OYL A;  2GXG A;  1MBG A;  2LOO A;  4UV8 A;  5ICF A;  3W6K B;  2L54 A;  3GLX A;  3U1K A;  2ELH A;  3GTL J;  2E19 A;  2OCC H;  4RAF A;  5M5W J;  4YRV A;  4FHT A;  2VKV A;  1EJ9 A;  2R7T A;  4Z2Y A;  1ZLK A;  4F7Z A;  2CQK A;  5B66 C;  4LLL A;  1K6O A;  2OTJ I;  1KZH A;  4KIF A;  4DNC A;  2ZSI B;  1OCT C;  3BY6 A;  4MFE A;  2VI6 A;  3N05 A;  2L7Z A;  2L5Q A;  2JT1 A;  2Q2E B;  2VKD A;  4PGH A;  3HRS A;  4IJA A;  3Q5F A;  3CCJ I;  2Z3Y A;  5AON A;  4IRH A;  4NUB A;  2XSD C;  2LVS A;  3RJP A;  3E5Q A;  4OU0 A;  3G1M A;  4M3F A;  2P0W A;  4AIK A;  2KJC A;  1U0J A;  1U5T C;  5LHG A;  4HZF A;  1QBJ A;  3QP6 A;  3BQY A;  4B09 A;  5JVG F;  4CGZ A;  4D7N A;  1J09 A;  1ZG3 A;  5LGN A;  2IA1 A;  1V5G A;  4KJZ A;  4LB6 B;  2DA6 A;  1E3H A;  3COA C;  2H94 A;  2W84 A;  2X1E A;  3CF5 F;  2VKE A;  3GO5 A;  3MMY B;  5GAE J;  4OIP F;  5BQT A;  1HKQ A;  4XLH A;  3AAF A;  3F22 A;  3OYJ A;  5GTH C;  1ETV A;  4DBQ A;  1U78 A;  3E5U A;  2IP2 A;  3KZZ A;  3FF5 A;  5LD2 C;  2HPM A;  1UG2 A;  1DPU A;  1YIJ I;  2X0L A;  3DKY A;  3K0L A;  5IP9 J;  2V1N A;  5K5O A;  2E1C A;  3PO2 J;  4RGU A;  1WGX A;  2VXZ A;  5E3M A;  3PNY A;  1ZN2 A;  1RKW A;  2YPR A;  3T0Y A;  1YW9 A;  4I76 A;  3CD6 I;  4M3D A;  5H6Q A;  2HXO A;  4ENN A;  2A07 F;  2BXZ A;  4AIH A;  1ETX A;  5IYB J;  5GAD J;  2X6O A;  4C2U A;  3E6B A;  3PM1 A;  4ZH4 F;  2LF8 A;  1DPR A;  2X4H A;  1JJ8 C;  4MEX F;  2G9W A;  5HLT A;  1IXC A;  5L3D A;  3WOD F;  3GW2 A;  2XRO A;  1H8A C;  3TED A;  3ZQI A;  4YFN F;  2UV1 A;  3AG1 H;  1K83 J;  3PO3 J;  2VPL A;  3F6V A;  1Y1V J;  4OMZ A;  5IOY A;  3KEY A;  4WXH A;  2HU9 A;  3JR9 A;  1IAW A;  3PSF A;  1U6G A;  5CJ9 A;  5J1U A;  3OIQ A;  2DTZ A;  1TNS A;  2UWM A;  4IQJ A;  1ZGW A;  2D2W A;  1DGR M;  2X1C A;  4GXO A;  1WCM J;  4BQN A;  2MD5 A;  1YHQ I;  1E17 A;  4ESJ A;  3A0B C;  1UHW A;  1XD7 A;  3WHB A;  1W1W E;  3E0J B;  1F1Z A;  5CYV A;  1C0W A;  2Q1Z B;  1YG2 A;  3GTP J;  4UVC A;  4CCM A;  4U0W A;  3S93 A;  3NWS A;  2JWT A;  5EEA A;  4ASN A;  4A3C J;  3OMY A;  4YG2 F;  1REP C;  2PMU A;  2LP0 A;  3V7S A;  4CO8 A;  3CQZ J;  3GVA A;  1W36 C;  4A0X A;  5JHU A;  3OYD A;  4BU2 A;  4JX4 A;  1YJN I;  3TBI A;  2DMP A;  1D8K A;  1FT9 A;  1R5G A;  1VZ0 A;  2PN6 A;  2OA4 A;  2XPW A;  3F8C A;  2NRA C;  2RDP A;  5E3O A;  1P4A A;  2CJJ A;  4K2E A;  3RCO A;  4E7S A;  2HVR A;  4DYC A;  3DCF A;  2PQ8 A;  3A02 A;  2L7K A;  2WY7 Q;  3MEX A;  4HRI A;  1HW5 A;  1R36 A;  2CGP A;  4CYC B;  4GO1 A;  3LA3 A;  3H1C A;  4L0Z B;  1MW7 A;  4CH7 A;  2E2J J;  4NC8 A;  4BYY A;  3WE3 A;  2XV4 S;  4E6K G;  5J1R A;  1KQ8 A;  2DA4 A;  3BPX A;  1ITY A;  1FSE A;  1K6Y A;  2JK3 A;  2B9S A;  3OSG A;  4E7Z A;  3E1S A;  4BL0 B;  5BPI A;  2Y48 A;  4XL9 A;  3WE2 A;  5J8C A;  4LOC A;  4PSX A;  2M8G X;  2VB6 A;  1LEA A;  2QEX I;  1XGM A;  2ADU A;  4KDP A;  2CWE A;  5F64 A;  3F8M A;  2EIM H;  1NG7 A;  3ZMS A;  3RKW A;  5JFR A;  1B9N A;  4BS9 A;  3PSI A;  3B6C A;  4O6J A;  2ZKZ A;  2IGO A;  1QQI A;  3UKG A;  1BC8 C;  2QKL B;  4B43 A;  3M9A A;  3RPU D;  3LFU A;  1GXP A;  3JTG A;  2KIF A;  4KN4 X;  3HKZ N;  1S3J A;  1DUX C;  1B8I B;  4XN3 A;  2ZNZ A;  2JA6 J;  4HST A;  4LK0 F;  1RRJ A;  1IF1 A;  2HTJ A;  5EYR A;  2HYG D;  1Z21 A;  5L3G A;  4G6Q A;  3E5X A;  1VQM I;  1OCZ H;  1DGW Y;  3MD2 A;  4KT6 A;  5FKO A;  2PMH A;  3H92 A;  3I3L A;  3Q9V A;  2LRE A;  2IW5 A;  2LTP A;  4IZZ A;  2M7B A;  5DD4 A;  2JSC A;  1MH3 A;  2DA5 A;  3KP6 A;  5DCM B;  2VE9 A;  1BJZ A;  4DBR A;  3T8R A;  4U7B A;  1AA7 A;  4RAG A;  2W7N A;  4I2O A;  1BOB A;  1TP4 A;  3OS0 A;  2WAF A;  2R7S A;  1K79 A;  1BC7 C;  3K1P A;  2ZNY A;  3H9Q A;  1XCB A;  4HOB A;  5EZG A;  3K4K A;  2VN2 A;  1XGS A;  3KE2 A;  2K27 A;  2ID3 A;  3A03 A;  1YX3 A;  2YS9 A;  1R22 A;  2FRH A;  2IS4 A;  3DXJ F;  1E2X A;  2DDB A;  1VF9 A;  4CIC A;  5E17 F;  3VEP A;  4RDU A;  4XSX F;  2E5N A;  4RLF A;  2KRH A;  1G3W A;  3DKX A;  3KIO A;  4AIJ A;  1MBH A;  4NBQ A;  4C3J J;  1OMI A;  2OBP A;  4HW0 A;  4L5I A;  1R49 A;  2MSY A;  1XCV A;  4Y33 A;  3CCL I;  3K2A A;  3AKZ A;  3VYS B;  1GHC A;  4A3F J;  2UZK A;  5BMZ A;  4LG3 A;  4KUM A;  5GPC A;  1ON1 A;  2V1U A;  1WJF A;  2L9V A;  1YFH A;  1S7E A;  2EJR A;  3CJQ B;  3WGH A;  1MMN A;  3LQQ A;  3NWT A;  1SVM A;  1F43 A;  2FOK A;  3FBI B;  4UUS B;  4BDY A;  1HKS A;  4LLG F;  1LPQ A;  4L9J A;  2RQP A;  4OIO F;  2QSF X;  1NG6 A;  1XSD A;  3KP7 A;  1UAA A;  1G3Y A;  4ZZL A;  4H4K C;  3HGY A;  4KT5 C;  1BJA A;  4ZYA A;  4ABZ A;  2KLO A;  1ON2 A;  2E2H J;  1ETQ A;  4A3M J;  2GA2 A;  3IL2 A;  4EMS A;  1T98 A;  3HG9 A;  1FLI A;  3JRI A;  1WWX A;  2KDO A;  3D0S A;  1SD6 A;  4HF2 A;  2IXS A;  4RA2 A;  4MGR A;  2LR8 A;  2XAS A;  3REO A;  1FPQ A;  1Y1W J;  5LGU A;  3TMO A;  1J59 A;  2DOF A;  1JUP A;  4S05 A;  3UNG C;  4G8X A;  5E3N A;  2ZBK A;  1IXR C;  5JVT A;  2ZCW A;  3LST A;  5FRO A;  3PL8 A;  2MFZ A;  2VOD A;  3JRC A;  2E35 A;  2M4G A;  3OL4 A;  4PJL A;  5CPR B;  4IHV A;  5E3L A;  3BZ6 A;  4IF4 A;  1L3L A;  2OAZ A;  4XKV A;  2Z2S B;  3HPH A;  1K78 A;  4M3B A;  3DKW A;  1I3A A;  1TQI A;  2EFN A;  2DMQ A;  5J4Y A;  2AO9 A;  2YR2 A;  5FGM A;  5D5U B;  1S7O A;  5J8F A;  2L4A A;  5GAH J;  2DA7 A;  1X3U A;  3NRV A;  4A5N A;  4G7O F;  5FFX A;  3BR1 A;  1T6S A;  1A04 A;  4LIT A;  4RAZ A;  1V3F A;  2IS6 A;  4XBF A;  4BH9 A;  3CJT B;  5DYM A;  2FQ3 A;  3VDX A;  3ZQL A;  2M30 A;  1YI2 I;  1JTX A;  3TOA A;  3CC2 I;  2LF7 A;  2JA5 J;  3CME I;  3VYR B;  2K4J A;  4RMN A;  3KZY A;  4RAY A;  2P5V A;  2PJP A;  3PUF A;  2Y0M A;  3K9T A;  4A3B J;  1USS A;  5FRM A;  4F93 B;  2QF7 A;  1VQL I;  1FYM A;  2KRC A;  4AWX B;  4EJV A;  3RI4 A;  2HKX A;  2P6S A;  1FBS A;  3TDU C;  2Q0O A;  4IRI A;  2MC3 A;  2PMZ N;  2KQR A;  4M72 A;  2WWY A;  1LVA A;  4UUV A;  3MVP A;  1E0E A;  4R1H A;  1ETO A;  4KN7 X;  3PUB A;  1QNT A;  4CZC A;  3CJR B;  2VPR A;  2E5Z A;  2XAG A;  2FJ1 A;  3MAJ A;  3WGG A;  1FOX A;  1OR7 A;  3S17 J;  1LUJ B;  2OV7 A;  3FZV A;  3A2K A;  3S32 A;  4C2T A;  3RQ4 A;  2HNH A;  2JUC A;  3FXJ A;  3T5X A;  4IXA A;  3SZG A;  1PJR A;  2E2I J;  2NAZ A;  3H3V K;  1KU9 A;  5L3E A;  4Q5S F;  1DU6 A;  4ESB A;  5HLH A;  1PDN C;  3HTS B;  4R8H A;  2NXN B;  3W6V A;  1YJ9 I;  1YLF A;  2DN0 A;  2NS7 A;  4XR6 A;  2EZH A;  2LY1 A;  4XOT A;  4UY8 I;  1KYW A;  1ZTR A;  3RIR A;  2BVM A;  4ZZD A;  1YS6 A;  5GTI C;  4JOM A;  1ZRF A;  4PZJ A;  5F04 A;  4B48 A;  2STW A;  3HOV J;  2IA2 A;  3G1O A;  4BQA A;  1JKP C;  1O7L A;  3E6M A;  2RNJ A;  1LDD A;  2A6T A;  2RC4 A;  1P7J A;  2VT2 A;  3PNV A;  3BT9 A;  1XGN A;  4MEY F;  3GCM A;  3WTT C;  1FEX A;  2BW3 A;  3GFI A;  1XDS A;  2Z99 A;  3ZQQ A;  5FKM A;  1DDN A;  3W3C A;  3FXQ A;  2KFD A;  3CCU I;  1JUM A;  3AFH A;  2JJ7 A;  2A5W A;  2H8R A;  3CCR I;  3JRH A;  1KON A;  2Y31 A;  3HUG B;  3LSG A;  2GA1 A;  3OV8 A;  3CC7 I;  1O3Q A;  1DP7 P;  5J1Y A;  2F4M B;  2ZO4 A;  1X2M A;  2XPV A;  2ZXH A;  2CSO A;  5HS7 A;  5JLX A;  5J4V A;  2NOJ B;  1K61 A;  1ZK8 A;  4ANJ A;  3K4C A;  5FFZ A;  3I54 A;  3K4L A;  2IS1 A;  3B6A A;  1BN5 A;  4M9S A;  2ZFU A;  3IH3 A;  1FIP A;  3ZMT A;  2STT A;  2KZV A;  4HX4 A;  4JYK A;  1D0X A;  2FUG 2;  1LFU P;  3M4O J;  2J5O A;  4AU7 A;  2QQ8 A;  5IT9 Z;  2DFI A;  3IAS 2;  3K4M A;  1EF4 A;  1SFO J;  3RZD J;  3X2Q H;  3W6J B;  4KNY A;  2F6C A;  1H0M A;  1S9H A;  5CVV A;  2GAU A;  3M1E A;  2P5L C;  1AHD P;  5DS9 A;  3EET A;  4EJT A;  1V4R A;  2IJL A;  3DTI A;  4D7M A;  2ZJ2 A;  2M7A A;  3BPV A;  5DD8 A;  1JI8 A;  2ESH A;  3DEW A;  4A5M A;  2XUB A;  3M3Y J;  2O8K A;  3HHH A;  2CUJ A;  1ZR2 A;  3KCC A;  2X6Y A;  3BWG A;  1B9M A;  2L01 A;  5ILV A;  4LG0 A;  3MKZ A;  1W7P A;  3IWZ A;  4I01 A;  2YUS A;  3FX3 A;  1V5E A;  2Y0S N;  2NVU B;  3DFG A;  2W4S A;  4BHP A;  2AXL A;  2VON A;  3QWL A;  2BXY A;  1IG7 A;  2M45 A;  3E6C C;  4J19 A;  3ELK A;  2FBH A;  3BG6 A;  1H9G A;  4E4H A;  5KAF C;  3HOY J;  3CMY A;  2ACJ A;  2I10 A;  3VOE A;  1RR8 C;  2QSH X;  4MTD A;  5C44 J;  2F5C A;  1XN7 A;  2IGN A;  2DDA A;  2F5D A;  2W57 A;  1XDU A;  2WV0 A;  1JKR C;  1PYV A;  2LH9 A;  3DTE A;  4ON0 A;  4CCL A;  1IZ1 A;  3CCV I;  4E7J A;  1O7F A;  3BZC A;  1K7A A;  2GLO A;  1X1A A;  1FX7 A;  2HDC A;  3G73 A;  1B72 B;  2HZD A;  3ZQG A;  1ZLJ A;  2KZG A;  3DF8 A;  1UEL B;  3ABK H;  1IJW C;  2ME0 A;  3I59 B;  3OYH A;  2RKH A;  2LKP A;  2AQF A;  2E1N A;  1Q1V A;  2EBI A;  4MIM A;  1RC9 A;  1Y0U A;  3L7W A;  3M8J A;  2F2E A;  2O3F A;  2DU9 A;  2KL4 A;  1UHM A;  3FMR A;  4KIB A;  3PFY A;  4HG2 A;  2Q2E A;  1P6R A;  5FKN A;  4XSZ F;  2Y2Z A;  3KP3 A;  3DTK A;  1MMD A;  3H9J A;  1N77 A;  1FBQ A;  1MMS A;  4FCY A;  3CTA A;  3GUD A;  3V4G A;  2V6E A;  2WAQ A;  1MNE A;  4A3E J;  3FMQ A;  2DOE A;  3AL0 B;  4L9T A;  4BQQ A;  4QTR A;  1R7J A;  4HX7 A;  4MFD A;  3W2V A;  1NK3 P;  3O3K A;  3OYA A;  1TWH J;  1XB4 A;  3ASN H;  5KNL A;  3TO9 A;  4A0Z A;  1LFP A;  4W97 A;  4A3L J;  3LWF A;  3KZI C;  3HJE A;  3IRR A;  3G1L A;  3FKJ A;  3JTH A;  1FYK A;  2L0K A;  2YX4 A;  4GYG A;  1APL C;  3CC4 I;  1WKM A;  1MGT A;  1W4M A;  1JGS A;  1I3Q J;  2VJJ A;  4CCJ A;  2P7C B;  1BA5 A;  4QPQ A;  4QPO A;  1QO0 D;  4XQF A;  2EV5 A;  3KYC B;  2K9N A;  4YEJ A;  4DW6 A;  3HC7 A;  3A01 B;  4A6E A;  1VQP I;  5IP7 J;  3ABT A;  2JVG A;  2CG4 A;  4IKF A;  1B1B A;  1SVO A;  2RRE A;  4OMY A;  1D0Y A;  4LIV A;  4DYQ A;  2QZ8 A;  5DEQ A;  2V1X A;  3K6G A;  4L5E A;  1AWC A;  3J80 Z;  1MJB A;  3LA7 A;  4R79 A;  4GDF A;  2XAF A;  5FD5 A;  5TIS C;  1ETW A;  2X6W A;  1BOA A;  4AYB N;  1ACI A;  3EDP A;  2WV1 A;  1XMA A;  4HYE A;  4KIC A;  2WB1 A;  4ZDP A;  1QA6 A;  3DP7 A;  5CVJ A;  1MH4 A;  3Q0W A;  4JX6 A;  5BOX A;  2XRN A;  2A05 A;  3WG7 H;  2VQH A;  4BJT A;  3CUQ A;  1BIA A;  3OIP A;  1HDP A;  2EFO A;  4FX0 A;  1X4P A;  2AQE A;  3VYT B;  4CHU A;  4A3I J;  2NS8 A;  1BI1 A;  3ZGK A;  2M8E A;  4RB3 C;  3ISP A;  1MJ9 A;  1X4O A;  1UCR A;  3MZ8 A;  4BE2 A;  1ONV A;  2XF5 A;  4A93 J;  4P9U A;  4EGY A;  3H9G A;  1SVL A;  2VQG A;  4OAY A;  2XB5 A;  2R7X A;  5CKT A;  4XMY A;  2BY3 A;  3HRT A;  3L2R A;  2DO7 A;  3CUO A;  2Y75 A;  2BY0 A;  5EZH A;  3S2H J;  3OOP A;  1IRG A;  1IXS B;  1N25 A;  4NQW B;  5E1Z B;  2TRT A;  3L9F A;  2K02 A;  1IC8 A;  2A6H F;  1OYY A;  1G2H A;  2PX9 A;  5LHH A;  4G7H F;  2Z9O A;  3SQN A;  3DEU A;  3MZY A;  5EEG A;  3CDH A;  5K1Y A;  4EJU A;  2JTV A;  4HSR A;  3LAP A;  2XDV A;  3T1B A;  4IHS A;  4MHG A;  1XS9 A;  2DK5 A;  3BTL A;  1BW6 A;  4ZTF A;  2DJN A;  3CP8 A;  2HFH A;  4BNC A;  4N4O B;  2C6Y A;  4CYC A;  1ZRE A;  1PUF B;  2VJI A;  4P9F A;  1ZG1 A;  4L0Y B;  2P81 A;  1QU3 A;  2CU7 A;  2DT7 B;  1GDT A;  2R7Z J;  3K4J A;  4HDV A;  2FML A;  3F9K A;  2MH2 A;  5ED4 A;  3FWE A;  3A0H C;  3HHG A;  4LK1 F;  4B1R A;  1VTN C;  4BXF A;  3KFW X;  2IGM A;  1FTZ A;  1FMW A;  2H8W A;  2WBM A;  3A1Y A;  5JR3 A;  1J5Y A;  3QPT A;  4HPQ A;  3VSL A;  4LFU A;  2R5Y B;  3S1R J;  2FNA A;  3G71 I;  2F5V A;  2BYV E;  1Y39 A;  1MND A;  1Z6T A;  5D5W B;  1B59 A;  2DQR A;  3BQZ A;  3RKQ A;  5BNG A;  5ILS A;  2VIX A;  3F8N A;  3J80 K;  1RNL A;  3ABM H;  3IH4 A;  1JE8 A;  2R7V A;  4PUS A;  2OD5 A;  3DLA A;  4S0H B;  2TCT A;  5J3L A;  2W1O A;  2NOG A;  1GXQ A;  2EB7 A;  1B4A A;  1E3P A;  3QYB A;  2ELJ A;  4XLE A;  4B4C A;  5LEK A;  1ZR4 A;  1HA8 A;  2BZT A;  3FKI J;  3JRE A;  5F0C A;  2F48 A;  2VLA A;  2BOL A;  2CFX A;  1AKH B;  4I0A A;  1IO2 A;  2WAD A;  2BY2 A;  4NC6 A; 
#chains in the Genus database with same CATH homology
 4CSW A;  1UAA A;  4KIT B;  5HNH A;  4H4K C;  2WA0 A;  4U87 A;  4ZYA A;  2KLO A;  3DU6 A;  3CZ6 A;  4II3 A;  4XKW A;  3TL4 X;  4LIU A;  1SAU A;  2R7Q A;  3HG9 A;  2CS3 A;  3OY9 A;  2X51 A;  2Y0S A;  3CF2 A;  2KDO A;  4CCK A;  3BLY A;  3DQV C;  1WFX A;  2IXS A;  3DPU A;  3LSK A;  3LMM A;  3L2V A;  2R7O A;  3S3O A;  3ZRG A;  1Z3Y A;  3TMO A;  3OYB A;  3UNG C;  2KHM A;  2MD0 A;  3FDY A;  2K9M A;  5FRO A;  3PL8 A;  3K10 A;  4E7L A;  1G59 A;  2MFZ A;  3K4N A;  5KHD A;  3OYE A;  1DP3 A;  2DT6 A;  2K5C A;  3OL4 A;  2M4G A;  4PJL A;  5CPR B;  3SYT A;  4ITV A;  4IX7 A;  4XN0 A;  4GRI A;  4XKV A;  1R6R A;  2JVH A;  4C9Y A;  2MAB A;  2Z2S B;  3HPH A;  4YEL A;  3H0D A;  3ONQ A;  3EPZ A;  4AVZ A;  1YE9 A;  2RNG A;  3H5R A;  1YX5 A;  1D1B A;  4G6T B;  2X85 A;  1MMG A;  2M4K A;  4B44 A;  2DXI A;  4P1W A;  4LIT A;  2VJ4 A;  4PJM A;  2IS6 A;  2JA2 A;  3VDX A;  3HPG A;  1WJA A;  3FBN B;  3EUK L;  2CW7 A;  2HPI A;  1OR7 C;  1N78 A;  3SEZ A;  4EAT A;  2W82 A;  3VYR B;  4RMN A;  3ZXS A;  4PJJ A;  1IRX A;  3S3N A;  3OYC A;  4XON A;  4C30 A;  3V42 A;  4B3X A;  2Z16 A;  5FRM A;  4F93 B;  4BEH B;  2KPM A;  2VJ5 A;  3K70 D;  3K4B A;  1MMA A;  2XAU A;  3L2Q A;  2KRC A;  2WAE A;  2R7W A;  4XLA A;  1WJ5 A;  2BW3 B;  4D1Q A;  2KQR A;  4Y4R A;  1E0E A;  2LY2 A;  2LYC A;  1WJE A;  2MYS A;  3PUB A;  4CZC A;  4XOR A;  3CJR B;  2E5Z A;  4XLF A;  4RLQ A;  3OYG A;  4OWR B;  2OV7 A;  3MKY B;  3A2K A;  1LKX A;  3S32 A;  4F91 B;  3DEE A;  3W2W A;  2O5R A;  3ZCO A;  4C2T A;  2LC2 A;  3OWT A;  3RQ4 A;  2HNH A;  3SZG A;  2E1M B;  3HL2 A;  1PJR A;  4XKC A;  3EUH C;  1P9Q C;  5HVQ C;  2LRD A;  4F52 A;  1QHH D;  2JSP A;  2X1D A;  4XR6 A;  3PNT A;  1Z7L A;  4Y3O A;  2LY1 A;  1LVK A;  4XOT A;  4AYB A;  2BVM A;  3SDB A;  2M0M A;  4BDZ A;  4JOM A;  2GOM A;  4BUP A;  4E7H A;  3VYU B;  3DWL E;  4B48 A;  3BG7 A;  2XF6 A;  4PFP A;  3U21 A;  2A6T A;  2VKH A;  3EUA A;  3PNV A;  4FAS D;  5KCM A;  2CUZ A;  3AL0 C;  2KP6 A;  3C2G A;  2BW3 A;  4RM3 A;  2CW8 A;  3ZQQ A;  3A4C A;  3W3C A;  1T95 A;  3J7A Y;  2HQA A;  3C2H A;  3AFH A;  1X1D A;  2OC6 A;  2A5W A;  3OS2 A;  1KON A;  4ZTJ A;  3HUG B;  3HKZ A;  3LSG A;  4BJ6 C;  3VWB A;  1X1C A;  2ZXH A;  2NOJ B;  3LSH A;  3K70 C;  2XC7 A;  2ZXI A;  4ANJ A;  3QYE A;  4F3Q A;  3K4C A;  3D5R C;  3K4L A;  2IS1 A;  1TT0 A;  2ZFU A;  3OYL A;  2LOO A;  2KZV A;  4BJ5 C;  1D0X A;  2FUG 2;  2CV1 A;  1UG0 A;  4AU7 A;  5LFA A;  3S3M A;  4XM3 A;  2CH0 A;  4CCN A;  3OYN A;  1X19 A;  3IAS 2;  3K4M A;  4YRV A;  1BR4 A;  5HOO A;  2R7T A;  2F6C A;  4MLO A;  1S9H A;  2MC4 A;  2LBF A;  3HOS A;  2L2O A;  3LL7 A;  3QYF A;  2ZSI B;  3OYI A;  2V9K A;  3DTI A;  2M7A A;  3N05 A;  2L5Q A;  1JI8 A;  2VKD A;  2Q2E B;  1WJD A;  3D5S C;  1W36 D;  5CQG A;  4KIS A;  4NUB A;  3H5N A;  2CUJ A;  2P0W A;  2X6Y A;  1U0J A;  4PK4 A;  3MKZ A;  2OUM A;  1V5E A;  1J09 A;  1WJC A;  2W4S A;  2I8D A;  3HOT A;  1V5G A;  4KJZ A;  4ZJZ A;  3BG6 A;  2R7R A;  4E4H A;  2X1E A;  1G8X A;  2DCE A;  3MMY B;  4DGW B;  1T0F C;  3IP4 B;  4XLH A;  3OYJ A;  1ZEL A;  2Z1D A;  1V5F A;  2R4G A;  4DBQ A;  2IGN A;  3I9V 2;  4ZDL A;  1N75 A;  2CFO A;  5LD2 C;  2HPM A;  1PYV A;  2LH9 A;  4CA0 A;  4E7I A;  1QHG A;  3DTE A;  4F55 A;  3DKY A;  4XOP A;  4CCL A;  4E7J A;  2V1N A;  1X1A A;  2VXZ A;  3LSI A;  3PNY A;  2F4I A;  2HZD A;  1D0Z A;  1UEL B;  3OYH A;  4C2U A;  2AQF A;  2VL8 A;  2IS2 A;  1BR2 A;  4CUG A;  3M8J A;  2DOA A;  3KX2 A;  5HLT A;  4XKB A;  2KL4 A;  2UV1 A;  4DOZ A;  2VPL A;  4P5O A;  3PFY A;  4HG2 A;  3H5A A;  1EA3 A;  4HEA 2;  2ZSH B;  3HXL A;  4D9J A;  3KEY A;  2X6X A;  2E1M C;  3DTK A;  1MMD A;  3H9J A;  2HU9 A;  2HVQ A;  1N77 A;  3PSF A;  4J00 A;  3OIQ A;  2E60 A;  2V6E A;  2UWM A;  4IQJ A;  2GOX B;  2WAQ A;  4BEH A;  1MNE A;  3SEQ A;  1DGR M;  2X1C A;  3S8P A;  4BQN A;  3AL0 B;  2RQQ A;  2VAS A;  4XNF A;  2XSJ C;  4BQQ A;  2LG4 A;  3E0J B;  2Q1Z B;  3RTR A;  3PJR A;  3W2V A;  3OYA A;  4XLC A;  4CCO A;  4CCM A;  3S93 A;  5KNL A;  3NWS A;  3OR1 C;  4OAZ A;  4ZC3 A;  1LFP A;  3OMY A;  1LDK B;  2BVL A;  2DJI A;  1W36 C;  4DIQ A;  1D1C A;  3CES A;  3FKJ A;  3OYD A;  4BU2 A;  2R7U A;  1GLN A;  3TBI A;  4BE1 A;  2VJJ A;  4CCJ A;  2PJR B;  4X0G A;  2KMU A;  4QPQ A;  4BAC A;  4QPO A;  4XQF A;  2CV0 A;  3DPT A;  1VZ0 A;  4YEJ A;  1ERD A;  3UR3 C;  3HC7 A;  2V4J C;  3OL3 A;  3RCO A;  4E7S A;  2HVR A;  4BE0 A;  2JVG A;  3D5L A;  4IKF A;  2RRE A;  2PMZ A;  1D0Y A;  4LIV A;  4II2 A;  3DU5 A;  2L7K A;  2WY7 Q;  1Y56 A;  4HRI A;  3K6G A;  4R79 A;  3CP2 A;  5CQE A;  2UUZ A;  2X6W A;  1FMV A;  1MW7 A;  4CH7 A;  3GBG A;  4NC8 A;  2V26 A;  4ZDP A;  4E6K G;  2WB1 A;  1Y6I A;  2VQL A;  1K6Y A;  3OYM A;  4HNU A;  3OYF A;  3L2U A;  1TZL A;  4E7Z A;  2VQH A;  3E1S A;  4BL0 B;  3IAM 2;  4BJT A;  4XL9 A;  3OIP A;  2VQC A;  2HVS A;  1X4P A;  4J01 A;  2AQE A;  3VYT B;  4PSX A;  3OS1 A;  2VB6 A;  3ZGK A;  3ZR8 X;  4N4N B;  1X1B A;  2WY8 Q;  3OYK A;  1NG7 A;  1X4O A;  3CMM A;  4BE2 A;  2XF5 A;  2JUG A;  3H9G A;  4BS9 A;  2VQG A;  4OAY A;  2R7X A;  3PSI A;  3BC8 A;  5CKT A;  4XMY A;  2IGO A;  5HNF A;  3L2R A;  2QKL B;  4B43 A;  3RPU D;  3LFU A;  3BCB A;  2CMP A;  4NQW B;  2PJR A;  4XN3 A;  4HST A;  1Z21 A;  2CV2 A;  4KT6 A;  1DGW Y;  3MD2 A;  3W2A A;  4HSR A;  2XDV A;  3VSK A;  2L9S A;  3I3L A;  3MKW B;  4NNJ A;  2LRE A;  4IZZ A;  2M7B A;  3BCA A;  1SFK A;  3H35 A;  5TGT A;  4ZTF A;  4DBR A;  1DQU A;  3CP8 A;  4U7B A;  1AA7 A;  2W7N A;  4N4O B;  1BOB A;  3OS0 A;  2WAF A;  4RM2 A;  2R7S A;  2K3P A;  2VJI A;  1OLT A;  4HNT A;  3H9Q A;  1QU3 A;  3K4K A;  2DT7 B;  4FET A;  4NC7 A;  3K4J A;  3OR2 C;  3DPL C;  1YX3 A;  2IS4 A;  3F9K A;  2VXD A;  5FRN A;  4PSW A;  2E5N A;  4BXF A;  5JHF A;  2IGM A;  4RLF A;  1FMW A;  2WBM A;  2KRH A;  3A1Y A;  2W00 A;  3DKX A;  4HPQ A;  3VSL A;  4BGD A;  4E7K A;  3FHN A;  3QOE A;  2F5V A;  3OOU A;  1MND A;  4PFO A;  3KYL A;  3L2W A;  2VIX A;  2XF7 A;  4Y33 A;  2L9N A;  4BQO A;  2HDW A;  4F92 B;  3AKZ A;  3VYS B;  3QOD A;  4DJA A;  4ZDO A;  2M3A A;  2R7V A;  4LG3 A;  4PUS A;  3DLA A;  1WJB A;  1D1A A;  2W1O A;  1WJF A;  1BR1 A;  4B47 A;  1Z3X A;  3LSM A;  3CJQ B;  4PJN A;  3QYB A;  1MMN A;  3NWT A;  2IGK A;  2ELJ A;  2LBF B;  3IUO A;  4XLE A;  4JQF A;  1HA8 A;  3FBI B;  2V7F A;  4BDY A;  2VLA A;  2BOL A;  4IQ4 A;  2QKM B;  3RSN A;  3M1C A;  2K9L A;  2WAD A;  1NG6 A;  3G2B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...