1REPC

Crystal structure of replication initiator protein repe54 of mini-f plasmid complexed with an iteron dna
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
232
structure length
214
Chain Sequence
SPRIVQSNDLTEAAYSLSRDQKRMLYLFVDQIRKSHDGICEIHVAKYAEIFGLTSAEASKDIRQALKSFAGKEVVFYESFPWFIKPAHSPSRGLYSVHINPYLIPFFIGLQNRFTQFRLSETKEITNPYAMRLYESLCQYRKPDGSGIVSLKIDWIIERYQLPQSYQRMPDFRRRFLQVCVNEINSRTPMRLSYIEKKKGRQTTHIVFSFRDIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*CP*CP*TP*GP*TP*GP*AP*CP*AP*AP*AP*TP*TP*GP*CP*CP*C
publication title Crystal structure of a prokaryotic replication initiator protein bound to DNA at 2.6 A resolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Replication/dna
total genus 62
structure length 214
sequence length 232
ec nomenclature
pdb deposition date 1999-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01051 Rep_3 Initiator Replication protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1repC02
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1repC01
1BI2A 4RS8A 2ELHA 3OOPA 5HDKA 4HDVA 4IRGA 4EQQA 4I7HA 2MH2A 2XASA 1D3YA 5ILVA 5L3DA 2E7WA 3E6BA 1WWXA 3LQQA 1YS7A 3ZN0A 2EFNA 1ZG5A 3IWFA 3QP6A 4WXCA 2W57A 4EJTA 4RGRA 2ZNYA 2FNPA 4LFUA 1YQAA 4P5OA 2LNBA 4M9XA 3ML6A 3J80Z 3K9TA 1G6NA 3D5LA 1DP7P 2HKXA 2IA0A 1U2WA 5IT9Z 5D8LB 3R4KA 2DPUA 2L4AA 1ULYA 2FE3A 3D0SA 4R8HA 4OMYA 4R79A 1HSTA 1FP2A 4L0YB 3Q9VA 4ESFA 1TQIA 2HTSA 3FM5A 4NB5A 5D6EA 1KQ9A 2L02A 2XAQA 4HZFA 2FOKA 2Y48A 5EEHA 2LKPA 1XB4A 1GVJA 1FNNA 2CQKA 3KZZA 3JSPA 3E6CC 4U0WA 1JHFA 1QGPA 2XV4S 5CLSA 3GVAA 1YW9A 2XRNA 2AS5F 3LA7A 4UVAA 5E18F 5ED4A 3K0LA 3KP6A 5D4RA 2DK8A 3DFGA 3DKWA 3KEQA 5LRSA 2PJPA 4UNOA 1IXCA 2BE5F 4BNCA 3KLNA 2XKPA 3L2CA 4DQ2A 2OU2A 2XAGA 5CVRA 4GYIA 3PQKA 2VOPA 2GIVA 1HW2A 2EFPA 3HOTA 3QRFF 4ZYHA 2NNYA 3ISPA 1EH8A 1F5TA 2ETHA 3CJNA 4KMFA 1F1ZA 1HBXG 2FF4A 5LGNA 5LLQA 1W5TA 1WKMA 3DXJF 3RPUA 3TDUC 3DEUA 2W24A 4M72A 1W7PD 2XKOA 5A2QZ 4GO1A 4HV5A 4GYGA 1XSXA 1BI3A 4L0ZB 1R23A 1RZ4A 2PEXA 4UHTA 2QQBA 3WTTC 1J7KA 3ZP5A 2Z3YA 3BDDA 2JPCA 3HTUA 4BHCA 3FHZA 4KT5C 4Q4ZF 3R60A 3FMQA 3I71A 2M45A 3N4MA 1EH6A 1NHAA 4XRFA 3ABTA 1BC7C 5LEJA 4XBFA 4A6DA 3BZ6A 4EM1A 2HKOA 3BROA 5E1WA 1Z6TA 2EWNA 2G7UA 2KIFA 2V6CA 4WCGA 4XSXF 5BPIA 1XGNA 2QQ9A 3J80K 2F2EA 2VC0A 2HYFA 4EJUA 1I1SA 1FWZA 1J75A 3GX4X 1ZG1A 2O03A 5IT9K 1TQPA 3F8NA 3HRUA 3V7RA 4ENJA 3HRMA 1TQMA 2PMHA 1YIOA 4IRHA 3TO6A 3BPVA 5BQTA 1R1TA 3B73A 5DCMB 1LQ1A 2A68F 3CUOA 4LD5A 1I5ZA 2WWYA 2DBBA 2IRFG 2V1XA 3I54A 2CGPA 1QQIA 2DPDA 1MD0A 2HR3A 3E5QA 3KP5A 1O57A 3I58A 3V7SA 2Y0MA 1P2FA 4L9VA 2MBFA 4OMZA 4MEXF 4LJZF 1IRFA 2NS0A 2EA2A 3IKVA 4IXAA 3MWMA 4QLCU 2XVCA 3GWZA 4EGZA 5K5OA 3T8TA 2OBPA 2RDPA 3R61A 4HLXA 4MTEA 3CDHA 3M9AA 3C7JA 4IJAA 3O2PE 5LGTA 3HUGA 2M87A 1Z1DA 1R1UA 2W85A 2XROA 2O8XA 2BBYA 5K5RA 1XN7A 2HWVA 2NNNA 1XGSA 2STTA 3M1EA 4ZZDA 1P6RA 3COAC 4M71A 1FPQA 1BM9A 2DAOA 3QAHA 3T5XA 3TGNA 2AXLA 2GQQA 4NHJA 3H92A 1SFEA 1XDUA 3LFKA 2K7LA 1EV7A 4KIBA 3W6KB 2Z5UA 2PQ8A 3T8RA 1TBXA 3CLOA 4MQVA 2DQLA 2EA4A 4ZYEA 3Q5FA 4ENMA 3WTZA 2TDXA 1FBQA 4RGXA 2OZUA 2XGXA 1ZREA 1T0FA 3VEPA 1B9MA 4QWQA 4EGYA 1OR7A 2RKHA 1VTNC 4Q47A 5D5WB 4M9ZA 1FZPB 3MEXA 1R22A 2M30A 4Z2YA 3RI4A 2DFIA 3VFZA 1J9IA 4JBAA 2Q0OA 1H9GA 1KA8A 4AWXB 4EVIA 2LF8A 1XMKA 2IPQX 3ROUA 1XD7A 4U88A 5LBQA 4KIFA 3KCCA 3NEUA 3V7CA 1PUEE 4KDPA 1TTYA 4O6JA 3L9FA 4U7BA 2DT5A 4HX8A 5LHGA 2FNAA 4AIHA 5ICGA 2JT1A 3E5XA 2VOOA 3IRQA 4YFXF 3ZMZA 1JHHA 1FX7A 5H20A 4ON0A 4LB5A 4KIGA 3MCZA 3RTRA 4S04A 4U0YA 4ZZLA 3IKTA 2L3DA 3TO7A 4UV8A 4EV0A 3F6OA 5AIPA 3KP2A 1Y0UA 3DP7A 2RV8A 1K7AA 1GXPA 3ABUA 3F8MA 5D5UB 3LSTA 4M74A 2VE8A 1R1VA 1YFHA 5BS6A 2QM3A 3P7NA 5JHUA 1RNLA 3GLXA 4Y15A 1W5SA 1FSHA 1IN7A 1T38A 4BHPA 2W84A 3SXYA 1C0WA 3WTSC 1XGOA 4ASNA 5D5VB 2ZKZA 2G7HA 4LMYA 4HA8A 4FX0A 1P92A 3SZPA 3J81K 5HVQC 1X3UA 4A6EA 1IN5A 2ZNZA 4DNCA 1I6XA 1IF1A 4P9FA 4MQ9F 4CHUA 2M8EA 3CUQA 1O3SA 2QZ8A 2ESHA 1K78B 1R00A 2A61A 5J6XA 4B09A 1RUNA 3L7WA 4LK1F 2PI0A 4LLGF 2E1NA 1XMAA 1H9TA 2KRFA 4I01A 2Z9OA 4A0XA 1STZA 4EJVA 2PG4A 5F64A 1XSVA 1FP1D 4A0YA 3W6JB 2IW5A 3F8CA 1WSUA 3C3WA 2EFWA 3V8KA 4HYEA 1GXQA 2COMA 5DEQA 4O3MA 2YPRA 1ON1A 2ESNA 1LB2A 3DF8A 4MHGA 3L09A 4OIOF 2A6HF 3P9IA 5BMZA 1YS6A 2OZ6A 3B02A 2YSRA 2KIUA 1IXRC 4HF0A 2HQNA 2VODA 4L9TA 2RVCA 1DPRA 3H3UA 2FMYA 1F4KA 2XHKA 1IZ1A 2DK5A 4ESBA 5J8FA 3I5UA 3O6BB 2GA1A 2RN7A 3WU0A 5L3FA 1ZGAA 4FT8A 3TO9A 2OA4A 3LAJA 4YFNF 4N9IA 1KU9A 1LNWA 4A5MA 2OD5A 2BEOA 1W7PB 2P6SA 3HSEA 3I64A 3V8JA 1WI9A 2P5KA 4L5IA 1LVAA 2EK5A 1U5TA 3LQRA 1OKRA 1XCBA 3GFIA 5H6RA 3SHFA 4D0PA 1T2KA 1KU7A 2E7XA 1B6AA 3JTHA 4G94A 3FM3A 5HS9A 4AIKA 5HDGA 1UB9A 2VT3A 2O0YA 3K69A 1TLHB 2YX4A 5J8CA 1YO5C 3F21A 5E17F 3BWGA 3I4PA 3JSOA 1LDKB 1QPMA 3NQOA 1OPCA 1T39A 4G7OF 3FXRA 2FBKA 2V9VA 3I53A 1S7OA 3U2RA 4I2OA 2DTRA 2IJLA 1U8RA 2HEOA 3G3ZA 5IT3A 4I09A 2R3SA 1XDSA 4WWCA 1IAWA 1OYIA 1ONVA 2K4JA 2RNJA 2OQRA 3REOA 5LHIA 2ISZA 5AONA 2Z33A 1XCVA 4LLNA 1D8KA 3TQNA 1FYLA 4HX4A 2K86A 1BOAA 2QQAA 4PGGA 4ETSA 4GXOA 2O3FA 1J59A 4IF4A 3WGIA 2EB7A 2CO5A 5JR3A 1DDNA 5E8IA 2JSCA 1G3TA 3IWZA 2VT2A 3HRTA 4AIJA 5F1RA 5CVUA 2HYGD 1SD4A 2H6BA 3R6SA 1KYZA 1QZZA 2A3SA 1ZRFA 3EQLF 3F22A 1FYKA 1DPUA 1FOKA 3GFJA 2IT0A 4FHTA 3ZMUA 5FLXK 2V79A 2LSOA 3BJOA 2BV6A 1S6LA 3SFZA 3LWFA 1BC8C 1MJAA 5ICCA 4MGRA 4KFCA 3HSFA 4ZH4F 5CYVA 4HQEA 1MDMA 2HQRA 3JW4A 2FQ3A 3ZQ7A 2FSWA 1SFXA 4AVPA 1WRJA 3HHGA 4KYWA 1FBSA 1R58A 4HF2A 4HAMA 5D5XB 3U1DA 5L3CA 4IHSA 3U9GA 4MTDA 2P5LC 1Z91A 2RQPA 2XUBA 3RIRA 5CVVA 4KUMA 1EH7A 2LDUA 4N0BA 3CUQC 1TNTA 3F8FA 2DLLA 1BI0A 1O7LA 4K2EA 1O3RA 2Q2EA 2HGCA 2EV6A 3HYIA 2XAJA 3F8BA 1MKMA 3KEOA 1SMYF 2FEZA 3C1DA 2VBWA 3LA2A 5E1XA 3HTSB 1USTA 3GFLA 1KQ8A 2VBZA 4UUVA 2VBYA 1O3TA 3BJAA 2GXBA 2W25A 3I59B 1B9NA 1BN5A 4G8XA 2QVOA 2QBYA 4XLPF 4RB3C 3J81Z 4LLLA 1SD6A 5CJ9A 3K1MA 2ZMEA 1IUYA 1ZG3A 4KICA 5LEKA 4A5NA 1HW1A 2GAUA 3ELKA 2FBHA 1FSEA 3GF2A 2KJCA 3CO7C 5LRRA 4GGGA 2FU4A 2L01A 5DCMA 1IN4A 2VXZA 1MZBA 3KP3A 4OIRF 3WODF 1ZN2A 2H09A 4M6YA 2QLZA 2M1BA 2EJRA 5E1ZB 1TNSA 4HW0A 4N9HA 4OIPF 4EM0B 5L3EA 1RUOA 2Z99A 1E2XA 5KK1A 5D8KB 3DPLC 1KU2A 3RYPA 2XAFA 2V1DA 4I02A 3IRRA 4MEYF 1TW3A 2FA5A 5FFZA 4IRIA 3RDIA 1IN8A 1D5VA 2MD5A 5FD5A 1ZLKA 3GFMA 4A0ZA 4PCQA 1U5TC 1PP8F 3T0YA 5ERIA 1MJ9A 2DQRA 3IHUA 3RPQA 4YIFA 3J7AO 1I27A 2L54A 2UWMA 2Y75A 2P8TA 2ZFWA 2GXGA 1AWCA 1LJ9A 1BBYA 2H94A 3DPTA 1KU3A 4Y17A 3ZMVA 5ICEA 3WTXC 1LEAA 5DUIA 2C6YA 2RGVA 4M73A 1YYVA 4R1HA 1G3WA 1L0OC 5DV5A 1Z9CA 1ZHFA 4AD9A 5FO5A 1CF7A 4P55A 4U7DA 3G73A 1WQ2A 4G6QA 3WTYC 5FD6A 2DI3A 4S05A 2D1HA 2KIMA 1BI1A 5E8GA 2XIGA 1O7FA 2PBIA 1W4MA 1U78A 2JRTA 4JQFA 1AOYA 4OOIA 3V4GA 1Z05A 3AAFA 4OINF 3LAPA 3PQJA 2NYXA 1LDDA 3EYIA 3RJPA 2EV0A 1FBUA 3KE2A 2RC4A 2NAZA 1XSDA 2J5PA 4CDGA 1R36A 4IHTA 1REPC 3ECHA 5L3GA 3H3ZA 3L00A 4RB2C 4KN4X 3KETA 3GO5A 3E5UA 2VE9A 3GEZA 4EM2A 3F3XA 2YU3A 2P6TA 4M9SA 4LG0A 1FC3A 3M8EA 1ZRDA 4ENNA 3BPXA 3RKXA 1S29A 2DU9A 2FXAA 3WE3A 2CW0F 4LK0F 3M8FA 3K2ZA 2DW4A 3E6DA 2V1UA 6PAXA 1S3JA 2OQGA 3ECOA 1USSA 3QP5A 5HS8A 5BPDA 3RKWA 1KGSA 3ZMDA 5TJJA 2D2WA 2M5WA 3MQ0A 4F7ZA 5TRDA 5ILSA 1FYMA 2O61A 4WXHA 1TW2A 3EUHA 3ZPLA 1Q1HA 2H6CA 2R7DA 3SQNA 1JXSA 4PDKA 2F5CA 1IW7F 5HLIA 2CSOA 3MAJA 5FLXZ 2VN2A 2GWRA 2PN6A 4XLNF 3RYRA 2ZXJA 4XSZF 5DD8A 3P9CA 2P7VB 3WGHA 5DCFA 2WC2A 3OV8A 2HOEA 3JAMZ 4G9YA 4JK1X 3QPHA 3MZHA 5FGMA 3HIFA 3GZ5A 2B0LA 2X4HA 3PFIA 2ZBKA 2QENA 2F5DA 4WXDA 4HQMA 5DDGA 4IPAA 3P9KA 1U5TB 1HKSA 3BOQA 2WTEA 3FMRA 4YIIA 1K78A 2BYVE 2JTVA 1J5YA 4P96A 1ZRCA 4RB0A 2IVMA 5FB2A 3ZN1A 3DV8A 4HV6A 3RKYA 2VBXA 2GZWA 5DUKA 4PGHA 3QU3A 4OU0A 5ILUA 1OMIA 2R7FA 1QZYA 5JI6A 1YW7A 1UHMA 2VC1A 1V4RA 3TDZC 5LGUA 4NQWA 3FXUA 2P4WA 1ZARA 2MA3A 4A2UA 3QPTA 2CYYA 1T6SA 3EETA 3WE2A 3KLOA 1OYWA 4OIQF 1KQ0A 1YLFA 1P4AA 1OYYA 1FT9A 2EFQA 2A07F 2ZCWA 1R5HA 1I1GA 5CVIA 4KNYA 3EDPA 2CWEA 4O5VA 5CVJA 1K79A 4CGZA 3DQVC 2OAZA 1W7PA 3QOPA 3HOSA 1HQCA 1HW5A 4RAZA 2IA2A 5JFRA 3TOAA 4BQAA 2HFHA 4HLYA 1GHCA 1ZLJA 1LDJA 2DO7A 1YTYA 2QWWA 5HLHA 1RI7A 2XAHA 1SD5A 1MDMB 2K02A 2UXXA 4H0EA 2EV5A 2FRHA 2NRAC 2YX7A 1RIOH 5AIQA 3ERED 3ULQB 1R7JA 2F5EA 3WG9A 1HKTA 5D6FA 5HDNA 1B59A 3E97A 4EJOA 3IL2A 3LA3A 2HZTA 3IC7A 4M6XA 4ZYDA 1XGMA 2QUFA 5HLGA 4I0AA 5F6FA 1O3QA 1ZAOA 1J0RA 4BHBA 1R5GA 3JAMK 4B8XA 2MLGA 1YG2A 3C18A 3CTAA 1DUXC 1T98A 3CO6C 1F9NA 4ENKA 4CZZA 4L5JA 4LGWA 4GCVA 3GUDA 3BY6A 3FX3A 4ZYGA 2IA1A 3EYYA 2VONA 2K27A 5KVRA 2Q8KA 1G3YA 1U6GA 1G4DA 4A12A 2QBYB 4HDUA 3WU1B 2KJBA 4Q48A 1K6OA 1P4WA 4P9UA 1P4XA 2ZMEB 4UVBA 1QBJA 4UV9A 1MGTA 2KKOA 3BP8A 1IRGA 2ACJA 1FLIA 3S2WA 1YW8A 1QO0D 5HS7A 2QYOA 3GYHX 1BJAA 1U3EM 2O6GE 2ISYA 3F72A 4FX4A 2UZKA 4YFKF 4KN7X 5FFXA 2PFBA 2P7CB 3VB2A 1ODDA 4CYDA 1JGSA 4BH9A 3ZMSA 4RB1A 3KFWX 2F5FA 3VOEA 2UXNA 2D1VA 4L18B 4BAYA 2ZJ2A 4UVCA 3FZVA 1E17A 4IVNA 2HTJA 3GXOA 4WF2A 4TV7A 2GA2A 4I98B 4CXFA 2P5VA 2MH9A 3HRSA 3HSRA 2E1CA 1ZYRF 2A5YB 1Z7UA 4CO8A 4PZJA 2JZYA 4E70A 5H6QA 2A6EF 1BIAA 1CF7B 3GW2A 1ON2A 3I59A 3SZTA 1IXSB 1V3FA 4CICA 5K5QA 4WX9A 3Q9SA 1Z6RA 3WTUC 3K1NA 3HHHA 1ZGJA 2X0LA 4G7ZF 1L3LA 4UXNA 2IP2A 3F6VA 3V8LA 5A2QK 2G9WA 3FF5A 4HX7A 5E20A 1UHWA 5BOXA 2ZO4A 1UCRA 1UFMA 3R0AA 1JE8A 5ICFA 4HF1A 1BIBA 2HS5A 4Y13A 2A69F 2J5OA 1SMTA 5JVTA 4RGUA 1MJBA 1G3SA 3O3KA 2YR2A 3TKYA 3I0TA 3FXQA 1KYWA 3R0JA 1B4AA 4RGSA 2LF7A 4LG0B 1S8NA 4WK8F 3N97A 3WTWC 3MZYA 3M7GA 1A04A 2EFOA 5L3BA 4KMUX 5DD4A 4KA4A 4Q5SF 3TOBA 4RAYA 3F23A 3NRVA 5EEGA 3K1PA 3ZMTA 2L4MA 4BXUA 4YG2F 2CG4A 3FMSA 1CGPA 4EMSA 3VODA 1QNTA 4I0BA 3JTGA 4G7HF 1SAXA 5D4SA 2BGCA 3FWEA 4BYYA 4U0VA 1ZH5A 4HOBA 1LEBA 2CFXA 3CUQB 2WV0A 2D45A 5K1YA 3KZYA 3E3VA 5HOOA 1B1BA 1SD7A 3KP4A 3WGGA 1HSJA 3BJ6A 2MLKA 4ESJA 2H27A 3MFKA 3T1BA 4L9NA 2HDCA 1J2XA 2PMUA 4G6DA 1D8JA 5DYMA 3KP7A 4EJWA 1H0MA 1SFUA 2FMLA 2STWA 3WTVC 1PP7U 3GZ6A 1S7AA 3QU6A 3E6MA 4MNUA 4LB6B 5LHHA 4L9JA 4HBLA 2PLYA 2K4BA 1FY7A 2FBIA 1IN6A 1HXDA 2ADUA 2JPBA 1PDNC 2MC3A 1HKQA
chains in the Genus database with same CATH superfamily
1BI2A 3BR1A 3NWTA 4RS8A 2ELHA 3OOPA 5HDKA 2B63J 4D9JA 3OWTA 4IRGA 4EQQA 4HDVA 4I7HA 1ZK8A 4YIRX 4CYCB 2A6TA 5KNLA 2MH2A 3LSIA 2E34A 2XASA 2LG4A 3WU2C 1D3YA 2B7EA 1FMWA 4M3GA 4UY8I 1S5LC 1HDPA 5ILVA 5L3DA 3TP3A 2E7WA 3E6BA 1WWXA 1X1DA 3AG1H 3B6CA 3LQQA 1YS7A 2R7ZJ 3ZN0A 2EFNA 1ZG5A 2R5YA 3IWFA 3QP6A 4A3EJ 5IYBJ 1I39A 3FKIJ 4WXCA 3GTJJ 2DA4A 2W57A 4EJTA 4RGRA 4F3QA 2DA5A 2R7XA 2ZNYA 2FNPA 4LFUA 2E2JJ 1W1WE 1YQAA 1TWHJ 4P5OA 2DFEA 2LNBA 4C30A 4OWRB 4M9XA 4YEJA 2M0CA 3ML6A 3J80Z 1JT6A 3K9TA 1G6NA 2F5VA 1Z77A 3D5LA 5IY5H 1DP7P 2HKXA 2IA0A 1U2WA 4A3KJ 2CUFA 3AL0C 3HPGA 5IT9Z 4LOCA 2JUGA 5D8LB 3R4KA 2V26A 4F92B 3A02A 4PFOA 1R4MB 3P5JA 2DPUA 4XRSG 1QHHD 2L4AA 1BL0A 3LFUA 1ULYA 3CCSI 2FE3A 1TP4A 1KONA 1W0UA 3D0SA 5EZGA 4R8HA 4OMYA 2KQRA 4R79A 2IS1A 1HSTA 1FP2A 4L0YB 2VL8A 3KZIC 3OYJA 3Q9VA 3CCUI 4ESFA 1TQIA 1TT5B 2HTSA 3FM5A 4NB5A 1LUJB 5D6EA 3J7AY 2R7UA 3PSIA 3ZGKA 1RR7A 3S3OA 1KQ9A 2L02A 2XAQA 4YRVA 4IZZA 4HZFA 1WCMJ 3JREA 1T08B 2FOKA 2BZTA 4RM2A 2Y48A 5J1UA 2CUEA 5EEHA 2LKPA 1JKPC 1XB4A 1U9OA 4F55A 1ETOA 3ASNH 3OYMA 3OYLA 1GVJA 1VI0A 1FNNA 2CQKA 2EPFA 3KZZA 4BJ5C 3JSPA 1YI2I 3E6CC 3AKZA 1UG0A 1ERDA 3ASOH 4U0WA 5FKMA 2QEXI 1MSFC 1QHGA 2ZJQF 1JHFA 1QGPA 2XV4S 5CLSA 3OIOA 3GVAA 4DYQA 3JR9A 3S3NA 3CC2I 1YW9A 4PSXA 2XRNA 2AS5F 3LA7A 1MBKA 4B1RA 4UVAA 4AC0A 2K85A 5E18F 5ED4A 3PNYA 3HOUJ 2WY8Q 2FOWA 2K40A 2JN6A 3IP4B 2X85A 3LSGA 4BEHA 3K0LA 3KP6A 5D4RA 2DK8A 3DFGA 3DKWA 3KEQA 2HOSA 2L9NA 5LRSA 2PJPA 1YHQI 1SAUA 2W1OA 4UNOA 3S1NJ 3VYTB 1IXCA 2KL4A 2BE5F 4BNCA 3KLNA 2LBFA 2XKPA 3L2CA 4DQ2A 1BR2A 2OU2A 2XAGA 5CVRA 1Z3XA 1X1CA 4GYIA 4DJAA 3PQKA 2LD5A 2VOPA 2GIVA 2EIKH 4JOMA 5F04A 3DTEA 1OQYA 1HW2A 3K4KA 2EFPA 1OCTC 2K9QA 3HOTA 3NWSA 2Y69H 3QRFF 4ZYHA 2NNYA 5EGOA 1K61A 3H1CA 3ISPA 1EH8A 1F5TA 2ETHA 4B4CA 3CJNA 4KMFA 1F1ZA 1HBXG 2FF4A 4CCOA 1YRNA 5LGNA 2DXIA 4ZDPA 4BDYA 5LLQA 1W5TA 1WKMA 3DXJF 1TZLA 3RPUA 3TDUC 3DEUA 3CMEI 1NTCA 2NVQJ 2W24A 2ZXHA 4M72A 1W7PD 2XKOA 2Y0SA 1FOXA 2ZSIB 2DA2A 4AIDA 5A2QZ 4I6ZA 4GO1A 5EEAA 4HV5A 2Z2SB 4BJTA 3ZQCA 1WPKA 3BCBA 1RESA 3E1SA 3QPSA 1KZHA 2FD5A 4BE2A 1OCOH 4GYGA 4UUSB 1XSXA 1FEXA 1BI3A 4L0ZB 1R23A 1RZ4A 4AYBN 5B66C 1SEUA 2PEXA 2QSHX 2DOFA 4UHTA 2QQBA 3WTTC 4C3JJ 1J7KA 3ZP5A 2Z3YA 3BDDA 3K4LA 1H89C 2JPCA 3HTUA 4BHCA 3FHZA 5M3FJ 3PL8A 3SDGA 2H8WA 4KT5C 4Q4ZF 2ZFUA 3R60A 2F4MB 1GVDA 3FMQA 3I71A 3DCFA 2Q2EB 2IAIA 1Y8QB 5J1RA 2M45A 3N4MA 2W00A 1VQ6I 1EH6A 1NHAA 4XRFA 3ABTA 1BC7C 5LEJA 4BY7J 4XBFA 5FKLA 4A6DA 5EJCA 3BZ6A 4EM1A 2HKOA 3BROA 5E1WA 1Z6TA 2EWNA 2G7UA 2XPUA 4IKFA 2O9LA 2COBA 4E6KG 4A3CJ 2KIFA 2V6CA 4WCGA 4XSXF 5BPIA 3C2GA 2DA6A 1XGNA 2QQ9A 3AG4H 4BE1A 3J80K 2M8GX 1IRZA 2F2EA 2VC0A 2HYFA 4EJUA 2NVXJ 3OIPA 1I1SA 3FXKA 1FWZA 1J75A 4HSTA 3GX4X 3OR1C 4LIVA 1ZG1A 3DEWA 2OV7A 2X6YA 1UMQA 3OL4A 4BL0B 2ZXIA 2O03A 5IT9K 1TQPA 2XF5A 3F8NA 3HRUA 3V7RA 4FE7A 5F27A 4ENJA 2XPWA 3HRMA 4I99C 2R4GA 1X58A 1TQMA 2PMHA 1YIOA 2LY9A 4IRHA 3TO6A 1EA3A 3BPVA 5BQTA 2HOAA 1R1TA 2ZSHB 1OISA 2E2IJ 3B73A 4QSHA 5DCMB 2BY0A 1LQ1A 3DTKA 4Y3OA 1GUUA 2A68F 3CUOA 1T56A 1I5ZA 3CCYA 4LD5A 4UUTA 2WWYA 1X19A 2DBBA 3FXMA 2IRFG 2BY3A 2V1XA 3I54A 2CGPA 3MZ8A 4XORA 5JLWA 1QQIA 4D5CA 2DPDA 3GMEA 2LVSA 1MD0A 1E3PA 2HR3A 3E5QA 1O57A 3I58A 3KP5A 3V7SA 2HZDA 1HA8A 2OUMA 2R7QA 1RETA 3HC7A 5E3MA 2Y0MA 1P2FA 2VKDA 4L9VA 2MBFA 4OMZA 4MEXF 3H5AA 4XKBA 5IOYA 4LJZF 1IRFA 2X6XA 1HLVA 2NS0A 2X1DA 2EA2A 1U8BA 3IKVA 4IXAA 3MWMA 1RR8C 3QWLA 4QLCU 2XVCA 3GWZA 4EGZA 5K5OA 1DP3A 3T8TA 2OBPA 2RDPA 1HOMA 2WADA 4HEA2 3R61A 4HLXA 5B1AH 3GTPJ 4MTEA 3CDHA 3S17J 3M9AA 3C7JA 4IJAA 4XN3A 3O2PE 5LGTA 5BNGA 1IJWC 3HUGA 2M87A 2NOJB 3SEQA 3BG5A 3BZKA 1Z1DA 1R1UA 2M2EA 2R93J 4LG3A 2W85A 4BQNA 2XROA 2O8XA 2BBYA 5K5RA 2H8RA 1XN7A 5HNFA 5JVGF 2HWVA 4Y52J 2NNNA 2DMQA 1XGSA 2STTA 3JRAA 2RQQA 3M1EA 4ZZDA 1P6RA 3COAC 4M71A 2AXTC 4D5FA 1FPQA 3OYFA 2DCEA 4QPQA 4XR6A 1BM9A 1WI3A 2DAOA 2KZVA 3QAHA 4FISA 3T5XA 3TGNA 5GTHC 5IP9J 2AXLA 4EEFG 2GQQA 4NHJA 3S15J 3H92A 3D1NI 1SFEA 1XDUA 4ZDOA 3LFKA 2K7LA 2XF7A 1EV7A 2JMWA 3BG3A 5FROA 2F4IA 4KIBA 4FCYA 1LVKA 3W6KB 2Z5UA 1WZ2A 5C4JJ 2PQ8A 1W5CC 4HSRA 3T8RA 1TBXA 3HZJA 2DMNA 3CLOA 4MQVA 2DQLA 2CRGA 2EA4A 5EZHA 3GTOJ 4ZYEA 1GV2A 3Q5FA 4ENMA 3WTZA 3GTMJ 1BR4A 3G4SI 3S32A 1ZGWA 1N77A 2RNGA 2TDXA 1TL8A 1AKHB 2HDWA 4E7LA 1FBQA 2K5CA 3H0DA 2LK2A 3CLQA 2G0EA 2OZUA 2XGXA 4IEJA 4RGXA 4DYRA 1ZREA 2F48A 1T0FA 5FJ8J 3VEPA 1PUFA 3VWBA 1K83J 1B9MA 1D0YA 1M1EB 1V5EA 2FUG2 4XLAA 3NAUA 4QWQA 3K4MA 4EGYA 1OR7A 1BR1A 3ZXSA 2RKHA 1VTNC 3EUKL 3JRIA 3IH4A 4FE4A 4Q47A 5D5WB 3LL7A 4M9ZA 1IO2A 1YITI 1K4SA 2CQQA 1FZPB 3MEXA 4XLFA 2IGMA 1R22A 2M30A 4Z2YA 4E7SA 3RI4A 3HKZN 2DFIA 3VFZA 1O4XA 4JBAA 1ACIA 3ZRGA 2Q0OA 1J9IA 2HI3A 4II3A 2DODA 1H9GA 1I3QJ 1KA8A 4AWXB 4EVIA 1YX5A 1ETKA 2LF8A 1MIJA 1XMKA 2IPQX 2JK3A 3OYEA 4XQFA 3A1YA 3ROUA 3PJRA 1XD7A 1ZTRA 1N78A 3HG9A 3HOWJ 4U88A 3JRGA 1Y0NA 5LBQA 4X1EA 4A3MJ 1UAAA 2LMDA 2R7VA 4KIFA 2LC2A 3KCCA 4XKVA 3NEUA 3V7CA 5GP9A 2KRCA 1PUEE 4ZC3A 4KDPA 1MBJA 2CMPA 1TTYA 4O6JA 3L9FA 3CQZJ 3BQYA 2KDOA 2E60A 4U7BA 5J3LA 2DT5A 3A01B 4OAZA 4HX8A 4W97A 5LHGA 1NK3P 3GTGJ 2R7SA 3RKQA 2FNAA 4AIHA 2R5ZA 4AU7A 5J4YA 5ICGA 2JT1A 3E5XA 2VOOA 4BBSJ 3IRQA 1ITYA 4YFXF 3ZMZA 1JHHA 1FX7A 1DU6A 4NC7A 1B72A 2K9MA 5H20A 3DLAA 4BJ6C 2LY1A 4Y33A 4ON0A 3F0CA 4V19K 2DT6A 4KIGA 2KPMA 4LB5A 1WHUA 3MCZA 3RTRA 4S04A 3DBRB 3JCUC 4U0YA 3L1PA 4ZZLA 4F93B 3IKTA 2L3DA 3TO7A 1X1AA 4UV8A 4EV0A 4J00A 2XAUA 3F6OA 2DJIA 5AIPA 3KP2A 3A0BC 3MD2A 3WHBA 3I4NJ 1Y0UA 3DP7A 1CQTA 1A36A 2RV8A 2L2OA 1K7AA 1GXPA 3ABUA 3F8MA 2VKHA 5D5UB 1FIPA 2LYCA 2MW8A 4XIDA 3LSTA 4M74A 2VE8A 3ESWB 1R1VA 3OSFA 1JUSA 3TP0A 1WGXA 2H1LA 4B3XA 3BTIA 5BS6A 2QM3A 1YFHA 2QSGX 3P7NA 5JHUA 1RNLA 1DU0A 3GLXA 4Y15A 2DA3A 4MFDA 4Y4RA 2HXIA 3CESA 2QCOA 1W5SA 4A3LJ 1V5FA 1FSHA 1IN7A 1T38A 4BHPA 2W84A 3SXYA 1C0WA 3WTSC 2M3AA 2JA5J 2AQEA 1S7EA 1XGOA 4N4OB 3LSJA 2PMZA 2R7RA 1LFBA 3VSLA 5J4VA 4ASNA 3FK7A 4QIWN 5D5VB 3ZQFA 1IGNA 2CUJA 4B44A 2ZKZA 4GDFA 2G7HA 1RKTA 4LMYA 4CH7A 4DOZA 3Q3SA 4KT6A 4HA8A 4FX0A 1P92A 3VSKA 3SZPA 3J81K 2PJRA 2XGEA 5HVQC 1X3UA 3RZOJ 4A6EA 1IN5A 2ZNZA 4DNCA 1I6XA 1IF1A 4P9FA 4MQ9F 4CHUA 3S14J 1BW5A 3MKLA 2M8EA 3CUQA 1O3SA 2OJED 3W2AA 2QZ8A 2ESHA 1K78B 1R00A 2A61A 5J6XA 2BHZA 4B09A 1RUNA 3L7WA 4LK1F 2PI0A 3IAM2 1XC5A 4LLGF 4J19A 2E1NA 1XMAA 2CW7A 1H9TA 2KRFA 4I01A 5B5EC 4N4NB 2Z9OA 4A0XA 2RAEA 1STZA 1WFXA 2EZHA 1RC9A 4EJVA 2PG4A 5F64A 1XSVA 2DFHA 2GOMA 1FP1D 2X51A 1SFKA 4A0YA 3W6JB 1Z7LA 2M4GA 1NH3A 2IW5A 2LFBA 2WAFA 3F8CA 1WSUA 1G8XA 1MMSA 3C3WA 3G1MA 1B8IB 1YJWI 4AM3A 2EFWA 3ERMA 2VB6A 2AO9A 5CQEA 3LSPA 4BACA 2ECBA 4NQWB 4HYEA 2CQXA 3V8KA 5HNHA 1GXQA 1X1BA 2COMA 5DEQA 2CW8A 2YS9A 4O3MA 5FKNA 2DOAA 2YPRA 1ON1A 2ESNA 1LB2A 2WAEA 3DF8A 4MHGA 3L09A 3H3VK 4OIOF 2A6HF 3P9IA 5BMZA 1YS6A 2OZ6A 1QPIA 3B02A 2YSRA 2KIUA 1IXRC 4HF0A 2HQNA 2VODA 4L9TA 2RVCA 4CYCA 1DPRA 3I3LA 2IS6A 1JKRC 3L2VA 1QU3A 2P81A 3H3UA 2FMYA 1F4KA 2HPIA 3I9V2 2XHKA 3LSHA 3SYTA 3FBIB 1ETQA 1VQPI 1JI8A 1IZ1A 1P9QC 2DK5A 1J09A 2OCCH 4ESBA 4RMNA 3I5UA 5J8FA 3LMMA 2QQ8A 3O6BB 4MO7A 3L2WA 1LE8B 2GA1A 2RN7A 5KCMA 3WU0A 5L3FA 1ZGAA 4FT8A 4RA2A 3TO9A 2OA4A 3LAJA 2H1KA 4YFNF 3GCMA 3DBHB 4N9IA 4BXFA 4PK4A 1KU9A 1VQ9I 1LNWA 2V6EA 4A5MA 1PJRA 2OD5A 2BEOA 2L0KA 3BLYA 1W7PB 2P6SA 3Q0UA 5FRMA 3HSEA 3I64A 3V8JA 1WI9A 2EZLA 2P5KA 1LVAA 1WJAA 2EK5A 4L5IA 4PJMA 2HVRA 2CS3A 1IC8A 1U5TA 1X3WB 1X3ZB 1WJBA 1TT0A 3LQRA 3W6VA 1OKRA 1XCBA 3GFIA 5H6RA 3SHFA 3OSGA 4D0PA 3QYEA 1T2KA 1KU7A 4NDLA 1VQNI 2E7XA 1B6AA 3JTHA 2GOXB 4G94A 1WVRA 3FM3A 4XNFA 4A93J 5HS9A 4AIKA 5HDGA 1VQ5I 1UB9A 3DWLE 1T0FC 4XKCA 2VT3A 2O0YA 1VQ8I 3K4NA 2W48A 3K69A 1PVEA 1TLHB 2BVMA 2YX4A 5J8CA 1YO5C 2LLKA 2HVQA 4BS9A 3F21A 5HODA 2GLOA 5E17F 1D0XA 3BWGA 1OR7C 4X6AJ 3I4PA 3JSOA 2HVSA 1X4OA 2M34A 1LDKB 4G6TB 4NBQA 4H4KC 1P7IA 5EG0B 2M4KA 1QPMA 3ZQLA 3NQOA 1OPCA 1T39A 2X9DA 4G7OF 3FXRA 2FBKA 2V9VA 1MNMC 3I53A 3MN2A 2BY1A 1S7OA 2X1CA 1GLNA 2XDVA 3U2RA 1S9HA 2DTRA 2IJLA 4I2OA 1U8RA 4ABZA 2HEOA 3G3ZA 1OCRH 5IT3A 4I09A 2R3SA 2HOTA 1XDSA 3CF2A 4WWCA 3E7LA 1IAWA 2ICWG 1OYIA 1ONVA 2K4JA 2KFDA 2RNJA 2LOOA 3FXLA 3M8JA 2OQRA 3REOA 1XPXA 3H5NA 4C2UA 1TC3C 1WH5A 5LHIA 2XPVA 4M6VA 2ISZA 1D1BA 5AONA 2Z33A 4XN0A 1XCVA 5DM7F 4LLNA 1D8KA 3TQNA 1U9NA 1FYLA 4HX4A 1HC8A 3CDIA 2K86A 1BOAA 2QQAA 4PGGA 2KT0A 4GXOA 4ETSA 4QPOA 4C3IJ 2O3FA 1J59A 4IF4A 4XONA 3QYFA 2EB7A 2CO5A 3GZNB 3RPUD 4BUPA 5JR3A 3WGIA 1DDNA 3S2HJ 5E8IA 2JSCA 3CZ6A 3OYHA 1JUMA 3ABKH 1G3TA 2A05A 3IWZA 2VT2A 3HRTA 1VFCA 4AIJA 2LKSA 5F1RA 5CVUA 4U87A 2HYGD 1SD4A 2H6BA 3R6SA 2WA0A 1KYZA 1QZZA 2A3SA 4C9YA 1ZRFA 3A03A 3EQLF 3JRHA 3F22A 1FYKA 3G6EI 1DPUA 3K6GA 3Q0VA 2VIXA 3PFYA 4A69C 1FOKA 3IAS2 5E3NA 3GFJA 2IT0A 2QGUA 3M07A 4FHTA 3ZMUA 3K4CA 5FLXK 2VPRA 2V79A 4FETA 3BJOA 1BJZA 2WB1A 2LSOA 2BV6A 1S6LA 3SFZA 3TL4X 3M4OJ 2WV1A 3LWFA 5TGTA 1BC8C 3HM5A 2L9VA 3RQ4A 4ZTJA 1MJAA 2K3FA 2CV1A 5ICCA 3JRBA 3DEEA 1ENHA 4MGRA 4KFCA 3HSFA 2PX9A 4ZH4F 5CYVA 4HQEA 4RLFA 4B43A 2ME0A 4G12A 3I56I 1MDMA 3S1RJ 2HQRA 3JW4A 2VJJA 2FQ3A 3DKYA 3ZQ7A 3IUOA 2FSWA 4L5EA 2Y0SN 4BU2A 1SFXA 2W4SA 1WRJA 3D5RC 3HHGA 4AVPA 1S72I 4KYWA 4UUSA 3TW6A 1FBSA 3O8HA 3HGYA 3CCJI 1R58A 4HF2A 4EATA 4HAMA 5D5XB 3VYSB 3U1DA 1ORKA 1R9TJ 2DTZA 5L3CA 4IHSA 3L2QA 2MC4A 1YJ9I 1TWCJ 1AHDP 3U9GA 4MTDA 4IL6C 1TWFJ 4D7MA 2P5LC 3AL0B 1Z91A 1NG6A 2RQPA 2XUBA 3RIRA 5CVVA 4KUMA 1EH7A 2LDUA 4N0BA 2LY2A 3CUQC 3K2AA 2V1NA 1TNTA 3F8FA 2QF7A 5FRNA 2DLLA 1BI0A 1O7LA 2IGOA 4K2EA 5B3SH 2Q2EA 2HGCA 1O3RA 2EV6A 1MSEC 4RLQA 3HYIA 2XAJA 3F8BA 3CCVI 4CCLA 2VQGA 2LTPA 1ETVA 1LKXA 4E4HA 1MKMA 3KEOA 1RRJA 1Z67A 1SMYF 2FEZA 4B47A 2NVYJ 3C1DA 2VBWA 2Y31A 2ZJRF 2NOGA 3LA2A 1G59A 5E1XA 2ID3A 4YELA 3HTSB 1USTA 4CCKA 3UNGC 3GFLA 1VQOI 4BE0A 1KQ8A 2VBZA 2DA1A 3G1LA 4UUVA 2VBYA 1O3TA 3BJAA 2GXBA 3HOZJ 3CMMA 2W25A 3OY9A 3I59B 1B9NA 1BN5A 3N05A 4G8XA 1WH7A 2QVOA 3BR5A 2QBYA 4XLPF 3VDXA 2L9SA 4RB3C 2V4JC 3DTIA 2OPTA 1XX5A 5GAEJ 3J81Z 1OCPA 2E1MC 4LITA 4C2TA 1OLTA 4XOPA 4LLLA 1SD6A 5CJ9A 1VZ0A 2EINH 1I50J 2HNHA 4CZCA 3K1MA 2ZMEA 3CP2A 1RKWA 1IUYA 1ZG3A 4KICA 5LEKA 4JX4A 3G71I 4A5NA 1HW1A 5IPAA 1A6QA 2GAUA 2EZKA 1ZKGA 2LR8A 1F36A 2FBHA 3ELKA 3KX2A 1FSEA 5C3EJ 3GF2A 2KJCA 3QODA 1W0TA 3CO7C 4IHYA 1MMNA 5LRRA 4GGGA 2FU4A 2L01A 5DCMA 1IN4A 2KZGA 2VXZA 1MZBA 3KP3A 4OIRF 1WJFA 2VXDA 4I76A 2CV0A 4E7JA 3WODF 1ZN2A 2H09A 4M6YA 2QLZA 2X48A 2M1BA 2EJRA 2E36A 4PFPA 5E1ZB 1TNSA 4HW0A 4N9HA 3J7YJ 4OIPF 4KJZA 4EM0B 5L3EA 3FBNB 1RUOA 2Z99A 1E2XA 3FIWA 5KK1A 3MMYB 3HB9A 1LPQA 5D8KB 3DPLC 1KU2A 3SFIA 1MMAA 3RYPA 1A5JA 2XAFA 2V1DA 2ZC2A 4IHWA 4I02A 4IQ4A 3IRRA 4MEYF 1TW3A 2VQCA 3ZQHA 3IH3A 2FA5A 2CU7A 5FFZA 2M9HA 4IRIA 2DN0A 3RDIA 1IN8A 2ZB9A 1D5VA 2MD5A 2VKEA 2DOEA 5FD5A 4DW6A 3CJTB 2KRHA 1ZLKA 4C2MJ 4RBOA 3GFMA 4A0ZA 4PCQA 4A3IJ 1MNDA 1U5TC 4P1WA 1PP8F 3BZCA 3T0YA 2ECCA 2FJ1A 5ERIA 1MJ9A 2DQRA 2NXNB 3IHUA 3RPQA 4YIFA 2VI6A 3J7AO 1I27A 2L54A 4XL9A 2UWMA 2BW3B 2Y75A 2P8TA 2ZFWA 2GXGA 1AWCA 1LJ9A 1BBYA 2GM4A 5CKTA 2H94A 4V2GA 2E5NA 3DPTA 1KU3A 4Y17A 3ZMVA 3M1CA 5ICEA 3WTXC 3OYAA 1LEAA 2HQ5A 5DUIA 5FLVA 2C6YA 2E19A 2RGVA 4M73A 1YYVA 4R1HA 1B72B 1G3WA 2P0WA 1AU7A 4F91B 3X2QH 1L0OC 3JRDA 3FDYA 5DV5A 1Z9CA 1ZHFA 4AD9A 5FO5A 1CF7A 4P55A 4PJLA 4U7DA 3G73A 1WQ2A 4ZDLA 4G6QA 5KHDA 3WTYC 5FD6A 2MYSA 1T33A 2DI3A 4S05A 3J7ZI 2D1HA 2KIMA 1BI1A 2ID6A 4LIUA 5E8GA 2XIGA 3O8GA 4AVZA 4M3EA 3OYIA 1SC7A 1O7FA 2PBIA 1W4MA 3S93A 1U78A 2JRTA 5DS9A 2VQHA 4JQFA 1AOYA 2IXSA 3S3MA 4XLHA 3ZOBA 1LFUP 2VQLA 2FX0A 1AKHA 5M5WJ 4OOIA 3V4GA 1Z05A 1XG1A 3AAFA 1SVMA 1JTXA 2X6WA 4OINF 3LAPA 3BG6A 3PQJA 2NYXA 2JWTA 3QOEA 1MH3A 1IV6A 1LDDA 4BQOA 2OTLI 2OF7A 2VJ4A 3EYIA 1X2MA 4F52A 1XS9A 5FKOA 3RCOA 3RJPA 3SDBA 2EV0A 1FBUA 3KE2A 2RC4A 4CSWA 2NAZA 2R7WA 1XSDA 4B48A 1UHSA 2J5PA 2KP6A 4CDGA 3C2BA 3BR6A 1R36A 4IHTA 1REPC 3ECHA 2W7NA 2A5WA 1PYVA 1OJLA 5L3GA 3H3ZA 2O7OA 3L00A 5F0HA 4XRSA 4RB2C 4KN4X 3KETA 3GBGA 3GO5A 3E5UA 2VE9A 4OAYA 2OC6A 2DMPA 5J47A 4MLOA 3GEZA 1BW6A 3ZQQA 2V9PA 4EM2A 3F3XA 1VNDA 2YU3A 4UB6C 5GAGJ 2P6TA 4M9SA 3HEFA 2E2HJ 2I8DA 4LG0A 9ANTA 4BY1J 1FC3A 3BC8A 1XMXA 1BOBA 3PO2J 1Z0XA 3M8EA 2DA7A 2O8KA 1ZRDA 4ENNA 3BPXA 3UKGA 3RKXA 4A3JJ 1S29A 2JSPA 3A4CA 2DU9A 3GTKJ 2FXAA 3WE3A 2CW0F 4LK0F 3FKJA 1N25A 3M8FA 4W1UA 1TWGJ 1YX3A 1FJLA 3K2ZA 1WJCA 2DW4A 3DU6A 1UJ8A 3VYRB 4DGWB 4IQJA 3E6DA 2V1UA 6PAXA 3PUFA 1S3JA 2OQGA 2R5YB 3HPHA 2IGNA 4A3FJ 3ECOA 1USSA 3QP5A 5HS8A 2Y2ZA 5BPDA 3RKWA 1Y1WJ 1KGSA 3ZMDA 3G1OA 5KAIC 5TJJA 2D2WA 2M5WA 1IG7A 1EJ9A 3CCLI 3MQ0A 4NC6A 4F7ZA 1R4NB 3H36A 3ZQIA 5TRDA 5ILSA 1FYMA 2GXAA 3IH2A 1TW2A 4WXHA 2O61A 3EUHA 3ZPLA 1Q1HA 2H6CA 2R7DA 4HG2A 3SQNA 3BQZA 1JXSA 4PDKA 3BG9A 3OYCA 2F5CA 1IW7F 5HLIA 5FKKA 5J40A 4ITVA 2WAQA 2CSOA 3K4BA 3PIOF 2Y30A 3H9QA 3MAJA 5M5XJ 5FLXZ 2UUZA 1POGA 1QA6A 3FISA 2DYSH 2VN2A 2GWRA 2PN6A 3PO3J 1EF4A 4XLNF 5F08A 4A3BJ 3RYRA 3OYDA 3H5RA 3FXOA 2I10A 2ZXJA 2MG4A 4XSZF 3K7AJ 4PSWA 5DD8A 3U21A 5IP7J 3P9CA 3L2UA 2JA2A 1Y6IA 2P7VB 3WGHA 5DCFA 2WC2A 3OV8A 3UR3C 2L7FP 2HOEA 3JAMZ 4G9YA 4JK1X 1FOWA 3QPHA 2DJNA 1JJ6C 2K9SA 5FGMA 3MZHA 3HIFA 1OFCX 3GZ5A 2JVGA 3K70C 2PMZN 2LKXA 2BXZA 3EUAA 2B0LA 2X4HA 3PFIA 2ELKA 2ZBKA 4XKWA 2DDAA 4CA0A 1BA5A 2QENA 1R49A 2F5DA 3C2HA 4WXDA 2Z1DA 4HQMA 2M7AA 5DDGA 3EPZA 4IPAA 3KPHA 3CCEI 2M7BA 3P9KA 2QA4I 1U5TB 1HKSA 2KLOA 2WTEA 3BOQA 3FMRA 3PUBA 1ETWA 2OCEA 4GFBA 2ZMEC 4YIIA 4XRMA 4D7NA 1K78A 2BYVE 2JTVA 1J5YA 2JVHA 3CF5F 2F4OB 4P96A 3CJRB 2XB5A 2IBDA 1H8AC 3BR2A 1FIAA 1ZRCA 2VASA 1Y1VJ 4BEHB 4CCNA 4RB0A 2IVMA 3OR2C 5FB2A 3ZN1A 3DV8A 2WAQN 3QQAA 4HV6A 4XK4A 3BTJA 3RKYA 2VBXA 2LBFB 2GZWA 5DUKA 4PGHA 4IOAF 3QU3A 4OU0A 5GAHJ 5DTDA 2VJ5A 2CV2A 5ILUA 2KISA 1OMIA 3OS1A 4XLCA 1A6IA 1FOYA 1F43A 1E3HA 2R7FA 1QZYA 5JI6A 1YW7A 3NARA 1UHMA 2VC1A 3ZQGA 1B8IA 1V4RA 3TDZC 1D1AA 5EGOB 2X1EA 5LGUA 4NQWA 4J01A 2JA8J 3FXUA 2EH3A 2KIQA 2P4WA 2Q1ZB 4PJNA 3L2RA 2WBMA 1ZARA 2MA3A 4IHXA 1YRNB 4A2UA 1R6RA 3QPTA 3ZCOA 4UB8C 4ZJZA 3QYBA 1EKEA 2IGKA 4II2A 2TCTA 2CYYA 1T6SA 3EETA 1FTTA 3WE2A 3KLOA 2IS2A 4HPQA 4XM3A 3DBLB 2AQFA 2DFFA 2MABA 2XF6A 1OYWA 1TWAJ 3AG3H 3U1KA 2E35A 3PM1A 2N8GA 4HNVA 4OIQF 1KQ0A 1OCCH 1MW7A 3KYLA 4AYBA 1QVTA 1N75A 1YLFA 1P4AA 1DGRM 1FT9A 1OYYA 5GTIC 2EFQA 3W2WA 1UZCA 2A07F 1VQKI 2NS7A 5M3MJ 1LE8A 2ZCWA 4JX5A 3LNQA 1R71A 4Y7NJ 1R5HA 1I1GA 2JRMA 5CVIA 4JP0A 4KNYA 2JUCA 2XRLA 3EDPA 2CWEA 4O5VA 5CVJA 1K79A 3HJEA 4JX6A 1ETYA 4CGZA 3MKWB 3DQVC 3FK6A 2CQNA 2IS4A 2OAZA 1W7PA 3QOPA 3HOSA 1HQCA 1HW5A 1JKQC 3RSNA 4RAZA 3HBLA 2IA2A 5JFRA 1JTYA 5KAFC 3TEDA 3JRFA 3TOAA 3A0HC 3S16J 4BQAA 5F0CA 5K7HA 2HFHA 4NUBA 4RAFA 1D1CA 5EYRA 3OOUA 1Y39A 4HLYA 1LFPA 3LSMA 4E7IA 3WHCA 3JRCA 1GHCA 1ZLJA 1LDJA 2DO7A 1YTYA 1W36C 3BR3A 2QWWA 5HLHA 3FXJA 1DQUA 2YUSA 3PNVA 1RI7A 2XAHA 1SD5A 1MDMB 2K02A 2UXXA 4H0EA 2EV5A 2FRHA 4B3AA 2NRAC 2KHMA 2YX7A 1RIOH 3Q0WA 5AIQA 5EG0A 1NK2P 3CC4I 3ERED 2L7MP 2AHQA 3KYCB 1WJ5A 2O5RA 3BTCA 3ULQB 2Z16A 1R7JA 1U0JA 2BHYA 2EQRA 2BXYA 2XSDC 2LP0A 2F5EA 1APLC 1HDDC 3WG9A 4M3FA 2HU9A 1HKTA 4MIMA 2R92J 2V9KA 5D6FA 1A35A 4FQGA 1P7JA 4M3DA 4NC8A 5HDNA 2CUZA 4CUGA 5IYCJ 1VQ7I 1B59A 3E97A 4EJOA 3IL2A 2VPLA 2B9SA 2MGQA 3LA3A 3TW7A 3OS2A 1HCRA 2HZTA 3IC7A 1VQMI 3BTLA 4M6XA 4ZYDA 4PJJA 3SZGA 5JHFA 1XGMA 2QUFA 3KYDB 3S2DJ 5HLGA 4I0AA 2JQ7A 3OL3A 3CD6I 2EZIA 5F6FA 1O3QA 1ZAOA 1J0RA 3OS0A 4BHBA 1R5GA 2KMUA 2NS8A 1JKOC 3JAMK 4B8XA 2MLGA 4HRIA 5F1JA 3G2BA 1YG2A 3C18A 3DU5A 3CTAA 3PNTA 1DUXC 1X4PA 1T98A 3CO6C 1F9NA 1VF9A 3SJMA 1D5YA 4ENKA 4CZZA 2BVLA 4L5JA 4LGWA 3TMOA 4GCVA 3GUDA 2ZXWH 1RPWA 3GTQJ 3BY6A 3FX3A 4ZYGA 2IA1A 3EYYA 2VONA 2K27A 3DLLF 5KVRA 2Q8KA 3BG7A 1G3YA 1U6GA 3TBIA 1G4DA 4A12A 2QBYB 3OYKA 4GRIA 4HDUA 3EUHC 2JA7J 3WU1B 3WG7H 1IUFA 2KJBA 4S0HB 4Q48A 2D5VA 1FTZA 1K6OA 4BDZA 1P4WA 3LSKA 3SEZA 1UG2A 3GLLA 3VYUB 4P9UA 3CCQI 3CC7I 1P4XA 2ZMEB 4UVBA 1QBJA 3M3YJ 3HUGB 4PUSA 4UV9A 2OTJI 1SANA 1MGTA 2KKOA 2WY7Q 3BP8A 1T95A 5DM6F 3W3CA 1IRGA 2EIJH 4IX7A 5C4XJ 2EILH 2ACJA 1FLIA 5IOZA 3KIOA 3S2WA 2WB1N 2MSYA 1YW8A 1QO0D 3MKZA 2LH9A 1IV8A 1YOVB 5HS7A 2QYOA 5K7FA 3GYHX 2R0QC 3HDDA 1ZR2A 1BJAA 2BY2A 2W82A 5CQGA 1U3EM 2O6GE 5EF6A 2ISYA 3F72A 4DYCA 2HXOA 4FX4A 2UZKA 4YFKF 1MBGA 2M0MA 3D5SC 4KN7X 4HNUA 5FFXA 2PFBA 1AA7A 2P7CB 3VB2A 2RREA 1ODDA 4ANJA 3OMYA 4CYDA 1JGSA 4Z6YA 2HYJA 5B1BH 2K9LA 3E0JB 4BH9A 2MFZA 1H88C 3ZMSA 2TRTA 2ME6A 5HLTA 4AUXA 4RB1A 3I55I 1G2HA 4RAGA 4C3HJ 3KFWX 2DDBA 2F5FA 3K70D 3HOVJ 3VOEA 5M5YJ 1Q1VA 2UXNA 2D1VA 4BKXA 1PUFB 2IEKA 4BAYA 4L18B 2ZJ2A 1YJNI 4UVCA 3FZVA 3AG2H 1E17A 3H9GA 4IVNA 2HTJA 3GXOA 2L5QA 3PSFA 2HDDA 4WF2A 4TV7A 3HGGA 2GA2A 3B6AA 1Z21A 3HKZA 4I98B 3VPRA 5IYDJ 1I3AA 3CP8A 4CXFA 2P5VA 1ZR4A 2MH9A 3HRSA 3PIPF 4DBQA 3HSRA 5E3LA 2E1CA 2Y9YA 1ZYRF 4DZPA 2A5YB 2VKVA 3RQIA 2JJ7A 2X6OA 5TISC 1VQ4I 5LD2C 1Z7UA 2I5UA 4HNTA 4CO8A 4PZJA 2JZYA 4RM3A 4DZJA 4E70A 5H6QA 2A6EF 1BIAA 1FMVA 1CF7B 3GW2A 1Z3YA 1ON2A 4XLEA 1D0ZA 3I59A 3CMYA 1NG7A 5F0FA 3SZTA 1IXSB 3K4JA 4XOTA 1V3FA 5EDNA 4JYKA 4CICA 3HOXJ 5K5QA 2F6CA 1MBEA 1ETXA 1GT0C 4WX9A 5GPAA 4A3GJ 3Q9SA 4E7HA 2KDZA 2Y9ZA 1Z6RA 1IRXA 2BOLA 1SVLA 3WTUC 2DYRH 3K1NA 3H0GJ 3OYNA 3AFHA 4FTHA 2R7TA 3HHHA 1ZGJA 2X0LA 4G7ZF 1L3LA 5IP6A 2R5ZB 4V2FA 4UXNA 2IP2A 5CPRB 3F6VA 3V8LA 5A2QK 4E7ZA 2G9WA 3FF5A 4HX7A 4XICA 5E20A 4ZTFA 1QRYA 2GBYA 4A3DJ 1UHWA 3GTLJ 5BOXA 2LREA 2ZO4A 1UCRA 4IOCF 4BXXJ 1UFMA 2E1OA 2DMUA 3R0AA 1Y56A 1JE8A 5ICFA 4HF1A 1E0EA 1BIBA 2HS5A 3W2VA 4Y13A 1HF0A 2V7FA 5FLMJ 5E3OA 2A69F 3ONQA 4FASD 2J5OA 3HL2A 1SMTA 2K3PA 5JVTA 1R5ID 4RGUA 1MJBA 3BR0A 1JT0A 1G3SA 2FQ4A 3O3KA 2YR2A 2CH0A 3TKYA 3I0TA 3FXQA 2L9RA 2XGDA 3ABLH 1X1PA 2YU9J 2GIZA 1QZEA 2DMTA 2K9NA 1KYWA 3OIQA 3R0JA 3CCRI 2VJIA 1B4AA 1WJEA 4RGSA 3HXLA 3OYGA 3RZDJ 2LF7A 3F9KA 2HPMA 4LG0B 2EBIA 1S8NA 4KITB 4WK8F 3N97A 3WTWC 1MMDA 3MZYA 1GDTA 3M7GA 2CJJA 3HOYJ 1A04A 2EFOA 5L3BA 4RDUA 4IO9F 4KMUX 5DD4A 4KA4A 2BW3A 4Q5SF 4KISA 3A2KA 5C44J 5LFAA 3TOBA 4QTRA 4BBRJ 1XTAA 3ABMH 4NNJA 4RAYA 5K7ZA 3F23A 1MH4A 3NRVA 1UELB 2QKLB 5EEGA 3K1PA 1MMGA 3ZMTA 3CJQB 4DBRA 3BT9A 2QSFX 1QVUA 1IDYA 2ELJA 2L4MA 3BCAA 4BXUA 2CQ7A 5H2FC 4YG2F 2CG4A 3DKXA 2E5ZA 1DGWY 1YE9A 3I4MJ 3CCMI 1V55H 3FMSA 1CGPA 1V54H 4EMSA 2XB0X 3VODA 3LSRA 1QNTA 4I0BA 1T8IA 4ZYAA 1W36D 2UV1A 1V5GA 2PJRB 1WJDA 3OYBA 3JTGA 1ZELA 4G7HF 2VLAA 1Y8RB 1SAXA 1YIJI 5D4SA 2BGCA 1SFOJ 3FWEA 1JJ8C 3K10A 4U0VA 4BYYA 3IV5A 1ZH5A 4CCJA 4HOBA 3S1QJ 1LEBA 2CFXA 3CUQB 4BGDA 2VUMJ 2WV0A 1JUPA 3CDLA 5GADJ 2D45A 5J1YA 1A31A 4DIQA 3LOCA 5K1YA 4BQQA 3KZYA 1I6HJ 3E3VA 5HOOA 4X0GA 4D1QA 4M3BA 3ZR8X 2EIMH 1B1BA 5JLXA 1K4TA 2ZJPF 1SD7A 3KP4A 3MVPA 3WGGA 3MKYB 1HSJA 1E3OC 3A01A 5GPCA 3BJ6A 3FHNA 3S8PA 4CCMA 2R7OA 3CMAI 2LRDA 1ZQ3P 2MLKA 4ESJA 2XC7A 3MFKA 3T1BA 4L9NA 1VQLI 2H27A 3S1MJ 2HDCA 1J2XA 1IDZA 2CFOA 4PJ0C 3KEYA 3QPLA 4XMYA 2PMUA 2DT7B 4G6DA 1MBHA 1D8JA 2L7ZA 5DYMA 1K6YA 3KP7A 4EJWA 1H0MA 1SFUA 2FMLA 2STWA 2MD0A 2XGCA 2NVTJ 2XSJC 1X2NA 3H9JA 1MBFA 3WTVC 1PP7U 3GZ6A 3DPUA 1S7AA 3QU6A 5E79C 1MNEA 3E6MA 2QKMB 4MNUA 2JA6J 2E1MB 4LB6B 1OCZH 3H35A 5LHHA 4L9JA 4HBLA 2PLYA 2K4BA 1FY7A 2FBIA 1IN6A 1HXDA 2ADUA 2JPBA 2L7KA 4E7KA 3V42A 1PDNC 2MC3A 1GV5A 1HKQA 1JGGA 4IHVA 2E71A 1SVOA 4MFEA 2HQAA 2NVUB
chains in the Genus database with same CATH topology
1BI2A 4RS8A 2ELHA 3OOPA 5HDKA 4HDVA 4IRGA 4EQQA 4I7HA 2MH2A 2XASA 1D3YA 5ILVA 5L3DA 2E7WA 3E6BA 1WWXA 3LQQA 1YS7A 3ZN0A 2EFNA 1ZG5A 3IWFA 3QP6A 4WXCA 2W57A 4EJTA 4RGRA 2ZNYA 2FNPA 4LFUA 1YQAA 4P5OA 2LNBA 4M9XA 3ML6A 3J80Z 3K9TA 1G6NA 3D5LA 1DP7P 2HKXA 2IA0A 1U2WA 5IT9Z 5D8LB 3R4KA 2DPUA 2L4AA 1ULYA 2FE3A 3D0SA 4R8HA 4OMYA 4R79A 1HSTA 1FP2A 4L0YB 3Q9VA 4ESFA 1TQIA 2HTSA 3FM5A 4NB5A 5D6EA 1KQ9A 2L02A 2XAQA 4HZFA 2FOKA 2Y48A 5EEHA 2LKPA 1XB4A 1GVJA 1FNNA 2CQKA 3KZZA 3JSPA 3E6CC 4U0WA 1JHFA 1QGPA 2XV4S 5CLSA 3GVAA 1YW9A 2XRNA 2AS5F 3LA7A 4UVAA 5E18F 5ED4A 3K0LA 3KP6A 5D4RA 2DK8A 3DFGA 3DKWA 3KEQA 5LRSA 2PJPA 4UNOA 1IXCA 2BE5F 4BNCA 3KLNA 2XKPA 3L2CA 4DQ2A 2OU2A 2XAGA 5CVRA 4GYIA 3PQKA 2VOPA 2GIVA 1HW2A 2EFPA 3HOTA 3QRFF 4ZYHA 2NNYA 3ISPA 1EH8A 1F5TA 2ETHA 3CJNA 4KMFA 1F1ZA 1HBXG 2FF4A 5LGNA 5LLQA 1W5TA 1WKMA 3DXJF 3RPUA 3TDUC 3DEUA 2W24A 4M72A 1W7PD 2XKOA 5A2QZ 4GO1A 4HV5A 4GYGA 1XSXA 1BI3A 4L0ZB 1R23A 1RZ4A 2PEXA 4UHTA 2QQBA 3WTTC 1J7KA 3ZP5A 2Z3YA 3BDDA 2JPCA 3HTUA 4BHCA 3FHZA 4KT5C 4Q4ZF 3R60A 3FMQA 3I71A 2M45A 3N4MA 1EH6A 1NHAA 4XRFA 3ABTA 1BC7C 5LEJA 4XBFA 4A6DA 3BZ6A 4EM1A 2HKOA 3BROA 5E1WA 1Z6TA 2EWNA 2G7UA 2KIFA 2V6CA 4WCGA 4XSXF 5BPIA 1XGNA 2QQ9A 3J80K 2F2EA 2VC0A 2HYFA 4EJUA 1I1SA 1FWZA 1J75A 3GX4X 1ZG1A 2O03A 5IT9K 1TQPA 3F8NA 3HRUA 3V7RA 4ENJA 3HRMA 1TQMA 2PMHA 1YIOA 4IRHA 3TO6A 3BPVA 5BQTA 1R1TA 3B73A 5DCMB 1LQ1A 2A68F 3CUOA 4LD5A 1I5ZA 2WWYA 2DBBA 2IRFG 2V1XA 3I54A 2CGPA 1QQIA 2DPDA 1MD0A 2HR3A 3E5QA 3KP5A 1O57A 3I58A 3V7SA 2Y0MA 1P2FA 4L9VA 2MBFA 4OMZA 4MEXF 4LJZF 1IRFA 2NS0A 2EA2A 3IKVA 4IXAA 3MWMA 4QLCU 2XVCA 3GWZA 4EGZA 5K5OA 3T8TA 2OBPA 2RDPA 3R61A 4HLXA 4MTEA 3CDHA 3M9AA 3C7JA 4IJAA 3O2PE 5LGTA 3HUGA 2M87A 1Z1DA 1R1UA 2W85A 2XROA 2O8XA 2BBYA 5K5RA 1XN7A 2HWVA 2NNNA 1XGSA 2STTA 3M1EA 4ZZDA 1P6RA 3COAC 4M71A 1FPQA 1BM9A 2DAOA 3QAHA 3T5XA 3TGNA 2AXLA 2GQQA 4NHJA 3H92A 1SFEA 1XDUA 3LFKA 2K7LA 1EV7A 4KIBA 3W6KB 2Z5UA 2PQ8A 3T8RA 1TBXA 3CLOA 4MQVA 2DQLA 2EA4A 4ZYEA 3Q5FA 4ENMA 3WTZA 2TDXA 1FBQA 4RGXA 2OZUA 2XGXA 1ZREA 1T0FA 3VEPA 1B9MA 4QWQA 4EGYA 1OR7A 2RKHA 1VTNC 4Q47A 5D5WB 4M9ZA 1FZPB 3MEXA 1R22A 2M30A 4Z2YA 3RI4A 2DFIA 3VFZA 1J9IA 4JBAA 2Q0OA 1H9GA 1KA8A 4AWXB 4EVIA 2LF8A 1XMKA 2IPQX 3ROUA 1XD7A 4U88A 5LBQA 4KIFA 3KCCA 3NEUA 3V7CA 1PUEE 4KDPA 1TTYA 4O6JA 3L9FA 4U7BA 2DT5A 4HX8A 5LHGA 2FNAA 4AIHA 5ICGA 2JT1A 3E5XA 2VOOA 3IRQA 4YFXF 3ZMZA 1JHHA 1FX7A 5H20A 4ON0A 4LB5A 4KIGA 3MCZA 3RTRA 4S04A 4U0YA 4ZZLA 3IKTA 2L3DA 3TO7A 4UV8A 4EV0A 3F6OA 5AIPA 3KP2A 1Y0UA 3DP7A 2RV8A 1K7AA 1GXPA 3ABUA 3F8MA 5D5UB 3LSTA 4M74A 2VE8A 1R1VA 1YFHA 5BS6A 2QM3A 3P7NA 5JHUA 1RNLA 3GLXA 4Y15A 1W5SA 1FSHA 1IN7A 1T38A 4BHPA 2W84A 3SXYA 1C0WA 3WTSC 1XGOA 4ASNA 5D5VB 2ZKZA 2G7HA 4LMYA 4HA8A 4FX0A 1P92A 3SZPA 3J81K 5HVQC 1X3UA 4A6EA 1IN5A 2ZNZA 4DNCA 1I6XA 1IF1A 4P9FA 4MQ9F 4CHUA 2M8EA 3CUQA 1O3SA 2QZ8A 2ESHA 1K78B 1R00A 2A61A 5J6XA 4B09A 1RUNA 3L7WA 4LK1F 2PI0A 4LLGF 2E1NA 1XMAA 1H9TA 2KRFA 4I01A 2Z9OA 4A0XA 1STZA 4EJVA 2PG4A 5F64A 1XSVA 1FP1D 4A0YA 3W6JB 2IW5A 3F8CA 1WSUA 3C3WA 2EFWA 3V8KA 4HYEA 1GXQA 2COMA 5DEQA 4O3MA 2YPRA 1ON1A 2ESNA 1LB2A 3DF8A 4MHGA 3L09A 4OIOF 2A6HF 3P9IA 5BMZA 1YS6A 2OZ6A 3B02A 2YSRA 2KIUA 1IXRC 4HF0A 2HQNA 2VODA 4L9TA 2RVCA 1DPRA 3H3UA 2FMYA 1F4KA 2XHKA 1IZ1A 2DK5A 4ESBA 5J8FA 3I5UA 3O6BB 2GA1A 2RN7A 3WU0A 5L3FA 1ZGAA 4FT8A 3TO9A 2OA4A 3LAJA 4YFNF 4N9IA 1KU9A 1LNWA 4A5MA 2OD5A 2BEOA 1W7PB 2P6SA 3HSEA 3I64A 3V8JA 1WI9A 2P5KA 4L5IA 1LVAA 2EK5A 1U5TA 3LQRA 1OKRA 1XCBA 3GFIA 5H6RA 3SHFA 4D0PA 1T2KA 1KU7A 2E7XA 1B6AA 3JTHA 4G94A 3FM3A 5HS9A 4AIKA 5HDGA 1UB9A 2VT3A 2O0YA 3K69A 1TLHB 2YX4A 5J8CA 1YO5C 3F21A 5E17F 3BWGA 3I4PA 3JSOA 1LDKB 1QPMA 3NQOA 1OPCA 1T39A 4G7OF 3FXRA 2FBKA 2V9VA 3I53A 1S7OA 3U2RA 4I2OA 2DTRA 2IJLA 1U8RA 2HEOA 3G3ZA 5IT3A 4I09A 2R3SA 1XDSA 4WWCA 1IAWA 1OYIA 1ONVA 2K4JA 2RNJA 2OQRA 3REOA 5LHIA 2ISZA 5AONA 2Z33A 1XCVA 4LLNA 1D8KA 3TQNA 1FYLA 4HX4A 2K86A 1BOAA 2QQAA 4PGGA 4ETSA 4GXOA 2O3FA 1J59A 4IF4A 3WGIA 2EB7A 2CO5A 5JR3A 1DDNA 5E8IA 2JSCA 1G3TA 3IWZA 2VT2A 3HRTA 4AIJA 5F1RA 5CVUA 2HYGD 1SD4A 2H6BA 3R6SA 1KYZA 1QZZA 2A3SA 1ZRFA 3EQLF 3F22A 1FYKA 1DPUA 1FOKA 3GFJA 2IT0A 4FHTA 3ZMUA 5FLXK 2V79A 2LSOA 3BJOA 2BV6A 1S6LA 3SFZA 3LWFA 1BC8C 1MJAA 5ICCA 4MGRA 4KFCA 3HSFA 4ZH4F 5CYVA 4HQEA 1MDMA 2HQRA 3JW4A 2FQ3A 3ZQ7A 2FSWA 1SFXA 4AVPA 1WRJA 3HHGA 4KYWA 1FBSA 1R58A 4HF2A 4HAMA 5D5XB 3U1DA 5L3CA 4IHSA 3U9GA 4MTDA 2P5LC 1Z91A 2RQPA 2XUBA 3RIRA 5CVVA 4KUMA 1EH7A 2LDUA 4N0BA 3CUQC 1TNTA 3F8FA 2DLLA 1BI0A 1O7LA 4K2EA 1O3RA 2Q2EA 2HGCA 2EV6A 3HYIA 2XAJA 3F8BA 1MKMA 3KEOA 1SMYF 2FEZA 3C1DA 2VBWA 3LA2A 5E1XA 3HTSB 1USTA 3GFLA 1KQ8A 2VBZA 4UUVA 2VBYA 1O3TA 3BJAA 2GXBA 2W25A 3I59B 1B9NA 1BN5A 4G8XA 2QVOA 2QBYA 4XLPF 4RB3C 3J81Z 4LLLA 1SD6A 5CJ9A 3K1MA 2ZMEA 1IUYA 1ZG3A 4KICA 5LEKA 4A5NA 1HW1A 2GAUA 3ELKA 2FBHA 1FSEA 3GF2A 2KJCA 3CO7C 5LRRA 4GGGA 2FU4A 2L01A 5DCMA 1IN4A 2VXZA 1MZBA 3KP3A 4OIRF 3WODF 1ZN2A 2H09A 4M6YA 2QLZA 2M1BA 2EJRA 5E1ZB 1TNSA 4HW0A 4N9HA 4OIPF 4EM0B 5L3EA 1RUOA 2Z99A 1E2XA 5KK1A 5D8KB 3DPLC 1KU2A 3RYPA 2XAFA 2V1DA 4I02A 3IRRA 4MEYF 1TW3A 2FA5A 5FFZA 4IRIA 3RDIA 1IN8A 1D5VA 2MD5A 5FD5A 1ZLKA 3GFMA 4A0ZA 4PCQA 1U5TC 1PP8F 3T0YA 5ERIA 1MJ9A 2DQRA 3IHUA 3RPQA 4YIFA 3J7AO 1I27A 2L54A 2UWMA 2Y75A 2P8TA 2ZFWA 2GXGA 1AWCA 1LJ9A 1BBYA 2H94A 3DPTA 1KU3A 4Y17A 3ZMVA 5ICEA 3WTXC 1LEAA 5DUIA 2C6YA 2RGVA 4M73A 1YYVA 4R1HA 1G3WA 1L0OC 5DV5A 1Z9CA 1ZHFA 4AD9A 5FO5A 1CF7A 4P55A 4U7DA 3G73A 1WQ2A 4G6QA 3WTYC 5FD6A 2DI3A 4S05A 2D1HA 2KIMA 1BI1A 5E8GA 2XIGA 1O7FA 2PBIA 1W4MA 1U78A 2JRTA 4JQFA 1AOYA 4OOIA 3V4GA 1Z05A 3AAFA 4OINF 3LAPA 3PQJA 2NYXA 1LDDA 3EYIA 3RJPA 2EV0A 1FBUA 3KE2A 2RC4A 2NAZA 1XSDA 2J5PA 4CDGA 1R36A 4IHTA 1REPC 3ECHA 5L3GA 3H3ZA 3L00A 4RB2C 4KN4X 3KETA 3GO5A 3E5UA 2VE9A 3GEZA 4EM2A 3F3XA 2YU3A 2P6TA 4M9SA 4LG0A 1FC3A 3M8EA 1ZRDA 4ENNA 3BPXA 3RKXA 1S29A 2DU9A 2FXAA 3WE3A 2CW0F 4LK0F 3M8FA 3K2ZA 2DW4A 3E6DA 2V1UA 6PAXA 1S3JA 2OQGA 3ECOA 1USSA 3QP5A 5HS8A 5BPDA 3RKWA 1KGSA 3ZMDA 5TJJA 2D2WA 2M5WA 3MQ0A 4F7ZA 5TRDA 5ILSA 1FYMA 2O61A 4WXHA 1TW2A 3EUHA 3ZPLA 1Q1HA 2H6CA 2R7DA 3SQNA 1JXSA 4PDKA 2F5CA 1IW7F 5HLIA 2CSOA 3MAJA 5FLXZ 2VN2A 2GWRA 2PN6A 4XLNF 3RYRA 2ZXJA 4XSZF 5DD8A 3P9CA 2P7VB 3WGHA 5DCFA 2WC2A 3OV8A 2HOEA 3JAMZ 4G9YA 4JK1X 3QPHA 3MZHA 5FGMA 3HIFA 3GZ5A 2B0LA 2X4HA 3PFIA 2ZBKA 2QENA 2F5DA 4WXDA 4HQMA 5DDGA 4IPAA 3P9KA 1U5TB 1HKSA 3BOQA 2WTEA 3FMRA 4YIIA 1K78A 2BYVE 2JTVA 1J5YA 4P96A 1ZRCA 4RB0A 2IVMA 5FB2A 3ZN1A 3DV8A 4HV6A 3RKYA 2VBXA 2GZWA 5DUKA 4PGHA 3QU3A 4OU0A 5ILUA 1OMIA 2R7FA 1QZYA 5JI6A 1YW7A 1UHMA 2VC1A 1V4RA 3TDZC 5LGUA 4NQWA 3FXUA 2P4WA 1ZARA 2MA3A 4A2UA 3QPTA 2CYYA 1T6SA 3EETA 3WE2A 3KLOA 1OYWA 4OIQF 1KQ0A 1YLFA 1P4AA 1OYYA 1FT9A 2EFQA 2A07F 2ZCWA 1R5HA 1I1GA 5CVIA 4KNYA 3EDPA 2CWEA 4O5VA 5CVJA 1K79A 4CGZA 3DQVC 2OAZA 1W7PA 3QOPA 3HOSA 1HQCA 1HW5A 4RAZA 2IA2A 5JFRA 3TOAA 4BQAA 2HFHA 4HLYA 1GHCA 1ZLJA 1LDJA 2DO7A 1YTYA 2QWWA 5HLHA 1RI7A 2XAHA 1SD5A 1MDMB 2K02A 2UXXA 4H0EA 2EV5A 2FRHA 2NRAC 2YX7A 1RIOH 5AIQA 3ERED 3ULQB 1R7JA 2F5EA 3WG9A 1HKTA 5D6FA 5HDNA 1B59A 3E97A 4EJOA 3IL2A 3LA3A 2HZTA 3IC7A 4M6XA 4ZYDA 1XGMA 2QUFA 5HLGA 4I0AA 5F6FA 1O3QA 1ZAOA 1J0RA 4BHBA 1R5GA 3JAMK 4B8XA 2MLGA 1YG2A 3C18A 3CTAA 1DUXC 1T98A 3CO6C 1F9NA 4ENKA 4CZZA 4L5JA 4LGWA 4GCVA 3GUDA 3BY6A 3FX3A 4ZYGA 2IA1A 3EYYA 2VONA 2K27A 5KVRA 2Q8KA 1G3YA 1U6GA 1G4DA 4A12A 2QBYB 4HDUA 3WU1B 2KJBA 4Q48A 1K6OA 1P4WA 4P9UA 1P4XA 2ZMEB 4UVBA 1QBJA 4UV9A 1MGTA 2KKOA 3BP8A 1IRGA 2ACJA 1FLIA 3S2WA 1YW8A 1QO0D 5HS7A 2QYOA 3GYHX 1BJAA 1U3EM 2O6GE 2ISYA 3F72A 4FX4A 2UZKA 4YFKF 4KN7X 5FFXA 2PFBA 2P7CB 3VB2A 1ODDA 4CYDA 1JGSA 4BH9A 3ZMSA 4RB1A 3KFWX 2F5FA 3VOEA 2UXNA 2D1VA 4L18B 4BAYA 2ZJ2A 4UVCA 3FZVA 1E17A 4IVNA 2HTJA 3GXOA 4WF2A 4TV7A 2GA2A 4I98B 4CXFA 2P5VA 2MH9A 3HRSA 3HSRA 2E1CA 1ZYRF 2A5YB 1Z7UA 4CO8A 4PZJA 2JZYA 4E70A 5H6QA 2A6EF 1BIAA 1CF7B 3GW2A 1ON2A 3I59A 3SZTA 1IXSB 1V3FA 4CICA 5K5QA 4WX9A 3Q9SA 1Z6RA 3WTUC 3K1NA 3HHHA 1ZGJA 2X0LA 4G7ZF 1L3LA 4UXNA 2IP2A 3F6VA 3V8LA 5A2QK 2G9WA 3FF5A 4HX7A 5E20A 1UHWA 5BOXA 2ZO4A 1UCRA 1UFMA 3R0AA 1JE8A 5ICFA 4HF1A 1BIBA 2HS5A 4Y13A 2A69F 2J5OA 1SMTA 5JVTA 4RGUA 1MJBA 1G3SA 3O3KA 2YR2A 3TKYA 3I0TA 3FXQA 1KYWA 3R0JA 1B4AA 4RGSA 2LF7A 4LG0B 1S8NA 4WK8F 3N97A 3WTWC 3MZYA 3M7GA 1A04A 2EFOA 5L3BA 4KMUX 5DD4A 4KA4A 4Q5SF 3TOBA 4RAYA 3F23A 3NRVA 5EEGA 3K1PA 3ZMTA 2L4MA 4BXUA 4YG2F 2CG4A 3FMSA 1CGPA 4EMSA 3VODA 1QNTA 4I0BA 3JTGA 4G7HF 1SAXA 5D4SA 2BGCA 3FWEA 4BYYA 4U0VA 1ZH5A 4HOBA 1LEBA 2CFXA 3CUQB 2WV0A 2D45A 5K1YA 3KZYA 3E3VA 5HOOA 1B1BA 1SD7A 3KP4A 3WGGA 1HSJA 3BJ6A 2MLKA 4ESJA 2H27A 3MFKA 3T1BA 4L9NA 2HDCA 1J2XA 2PMUA 4G6DA 1D8JA 5DYMA 3KP7A 4EJWA 1H0MA 1SFUA 2FMLA 2STWA 3WTVC 1PP7U 3GZ6A 1S7AA 3QU6A 3E6MA 4MNUA 4LB6B 5LHHA 4L9JA 4HBLA 2PLYA 2K4BA 1FY7A 2FBIA 1IN6A 1HXDA 2ADUA 2JPBA 1PDNC 2MC3A 1HKQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BI2 A;  4RS8 A;  2ELH A;  3OOP A;  5HDK A;  4HDV A;  4IRG A;  4EQQ A;  4I7H A;  2MH2 A;  2XAS A;  1D3Y A;  5ILV A;  5L3D A;  2E7W A;  3E6B A;  1WWX A;  3LQQ A;  1YS7 A;  3ZN0 A;  2EFN A;  1ZG5 A;  3IWF A;  3QP6 A;  4WXC A;  2W57 A;  4EJT A;  4RGR A;  2ZNY A;  2FNP A;  4LFU A;  1YQA A;  4P5O A;  2LNB A;  4M9X A;  3ML6 A;  3J80 Z;  3K9T A;  1G6N A;  3D5L A;  1DP7 P;  2HKX A;  2IA0 A;  1U2W A;  5IT9 Z;  5D8L B;  3R4K A;  2DPU A;  2L4A A;  1ULY A;  2FE3 A;  3D0S A;  4R8H A;  4OMY A;  4R79 A;  1HST A;  1FP2 A;  4L0Y B;  3Q9V A;  4ESF A;  1TQI A;  2HTS A;  3FM5 A;  4NB5 A;  5D6E A;  1KQ9 A;  2L02 A;  2XAQ A;  4HZF A;  2FOK A;  2Y48 A;  5EEH A;  2LKP A;  1XB4 A;  1GVJ A;  1FNN A;  2CQK A;  3KZZ A;  3JSP A;  3E6C C;  4U0W A;  1JHF A;  1QGP A;  2XV4 S;  5CLS A;  3GVA A;  1YW9 A;  2XRN A;  2AS5 F;  3LA7 A;  4UVA A;  5E18 F;  5ED4 A;  3K0L A;  3KP6 A;  5D4R A;  2DK8 A;  3DFG A;  3DKW A;  3KEQ A;  5LRS A;  2PJP A;  4UNO A;  1IXC A;  2BE5 F;  4BNC A;  3KLN A;  2XKP A;  3L2C A;  4DQ2 A;  2OU2 A;  2XAG A;  5CVR A;  4GYI A;  3PQK A;  2VOP A;  2GIV A;  1HW2 A;  2EFP A;  3HOT A;  3QRF F;  4ZYH A;  2NNY A;  3ISP A;  1EH8 A;  1F5T A;  2ETH A;  3CJN A;  4KMF A;  1F1Z A;  1HBX G;  2FF4 A;  5LGN A;  5LLQ A;  1W5T A;  1WKM A;  3DXJ F;  3RPU A;  3TDU C;  3DEU A;  2W24 A;  4M72 A;  1W7P D;  2XKO A;  5A2Q Z;  4GO1 A;  4HV5 A;  4GYG A;  1XSX A;  1BI3 A;  4L0Z B;  1R23 A;  1RZ4 A;  2PEX A;  4UHT A;  2QQB A;  3WTT C;  1J7K A;  3ZP5 A;  2Z3Y A;  3BDD A;  2JPC A;  3HTU A;  4BHC A;  3FHZ A;  4KT5 C;  4Q4Z F;  3R60 A;  3FMQ A;  3I71 A;  2M45 A;  3N4M A;  1EH6 A;  1NHA A;  4XRF A;  3ABT A;  1BC7 C;  5LEJ A;  4XBF A;  4A6D A;  3BZ6 A;  4EM1 A;  2HKO A;  3BRO A;  5E1W A;  1Z6T A;  2EWN A;  2G7U A;  2KIF A;  2V6C A;  4WCG A;  4XSX F;  5BPI A;  1XGN A;  2QQ9 A;  3J80 K;  2F2E A;  2VC0 A;  2HYF A;  4EJU A;  1I1S A;  1FWZ A;  1J75 A;  3GX4 X;  1ZG1 A;  2O03 A;  5IT9 K;  1TQP A;  3F8N A;  3HRU A;  3V7R A;  4ENJ A;  3HRM A;  1TQM A;  2PMH A;  1YIO A;  4IRH A;  3TO6 A;  3BPV A;  5BQT A;  1R1T A;  3B73 A;  5DCM B;  1LQ1 A;  2A68 F;  3CUO A;  4LD5 A;  1I5Z A;  2WWY A;  2DBB A;  2IRF G;  2V1X A;  3I54 A;  2CGP A;  1QQI A;  2DPD A;  1MD0 A;  2HR3 A;  3E5Q A;  3KP5 A;  1O57 A;  3I58 A;  3V7S A;  2Y0M A;  1P2F A;  4L9V A;  2MBF A;  4OMZ A;  4MEX F;  4LJZ F;  1IRF A;  2NS0 A;  2EA2 A;  3IKV A;  4IXA A;  3MWM A;  4QLC U;  2XVC A;  3GWZ A;  4EGZ A;  5K5O A;  3T8T A;  2OBP A;  2RDP A;  3R61 A;  4HLX A;  4MTE A;  3CDH A;  3M9A A;  3C7J A;  4IJA A;  3O2P E;  5LGT A;  3HUG A;  2M87 A;  1Z1D A;  1R1U A;  2W85 A;  2XRO A;  2O8X A;  2BBY A;  5K5R A;  1XN7 A;  2HWV A;  2NNN A;  1XGS A;  2STT A;  3M1E A;  4ZZD A;  1P6R A;  3COA C;  4M71 A;  1FPQ A;  1BM9 A;  2DAO A;  3QAH A;  3T5X A;  3TGN A;  2AXL A;  2GQQ A;  4NHJ A;  3H92 A;  1SFE A;  1XDU A;  3LFK A;  2K7L A;  1EV7 A;  4KIB A;  3W6K B;  2Z5U A;  2PQ8 A;  3T8R A;  1TBX A;  3CLO A;  4MQV A;  2DQL A;  2EA4 A;  4ZYE A;  3Q5F A;  4ENM A;  3WTZ A;  2TDX A;  1FBQ A;  4RGX A;  2OZU A;  2XGX A;  1ZRE A;  1T0F A;  3VEP A;  1B9M A;  4QWQ A;  4EGY A;  1OR7 A;  2RKH A;  1VTN C;  4Q47 A;  5D5W B;  4M9Z A;  1FZP B;  3MEX A;  1R22 A;  2M30 A;  4Z2Y A;  3RI4 A;  2DFI A;  3VFZ A;  1J9I A;  4JBA A;  2Q0O A;  1H9G A;  1KA8 A;  4AWX B;  4EVI A;  2LF8 A;  1XMK A;  2IPQ X;  3ROU A;  1XD7 A;  4U88 A;  5LBQ A;  4KIF A;  3KCC A;  3NEU A;  3V7C A;  1PUE E;  4KDP A;  1TTY A;  4O6J A;  3L9F A;  4U7B A;  2DT5 A;  4HX8 A;  5LHG A;  2FNA A;  4AIH A;  5ICG A;  2JT1 A;  3E5X A;  2VOO A;  3IRQ A;  4YFX F;  3ZMZ A;  1JHH A;  1FX7 A;  5H20 A;  4ON0 A;  4LB5 A;  4KIG A;  3MCZ A;  3RTR A;  4S04 A;  4U0Y A;  4ZZL A;  3IKT A;  2L3D A;  3TO7 A;  4UV8 A;  4EV0 A;  3F6O A;  5AIP A;  3KP2 A;  1Y0U A;  3DP7 A;  2RV8 A;  1K7A A;  1GXP A;  3ABU A;  3F8M A;  5D5U B;  3LST A;  4M74 A;  2VE8 A;  1R1V A;  1YFH A;  5BS6 A;  2QM3 A;  3P7N A;  5JHU A;  1RNL A;  3GLX A;  4Y15 A;  1W5S A;  1FSH A;  1IN7 A;  1T38 A;  4BHP A;  2W84 A;  3SXY A;  1C0W A;  3WTS C;  1XGO A;  4ASN A;  5D5V B;  2ZKZ A;  2G7H A;  4LMY A;  4HA8 A;  4FX0 A;  1P92 A;  3SZP A;  3J81 K;  5HVQ C;  1X3U A;  4A6E A;  1IN5 A;  2ZNZ A;  4DNC A;  1I6X A;  1IF1 A;  4P9F A;  4MQ9 F;  4CHU A;  2M8E A;  3CUQ A;  1O3S A;  2QZ8 A;  2ESH A;  1K78 B;  1R00 A;  2A61 A;  5J6X A;  4B09 A;  1RUN A;  3L7W A;  4LK1 F;  2PI0 A;  4LLG F;  2E1N A;  1XMA A;  1H9T A;  2KRF A;  4I01 A;  2Z9O A;  4A0X A;  1STZ A;  4EJV A;  2PG4 A;  5F64 A;  1XSV A;  1FP1 D;  4A0Y A;  3W6J B;  2IW5 A;  3F8C A;  1WSU A;  3C3W A;  2EFW A;  3V8K A;  4HYE A;  1GXQ A;  2COM A;  5DEQ A;  4O3M A;  2YPR A;  1ON1 A;  2ESN A;  1LB2 A;  3DF8 A;  4MHG A;  3L09 A;  4OIO F;  2A6H F;  3P9I A;  5BMZ A;  1YS6 A;  2OZ6 A;  3B02 A;  2YSR A;  2KIU A;  1IXR C;  4HF0 A;  2HQN A;  2VOD A;  4L9T A;  2RVC A;  1DPR A;  3H3U A;  2FMY A;  1F4K A;  2XHK A;  1IZ1 A;  2DK5 A;  4ESB A;  5J8F A;  3I5U A;  3O6B B;  2GA1 A;  2RN7 A;  3WU0 A;  5L3F A;  1ZGA A;  4FT8 A;  3TO9 A;  2OA4 A;  3LAJ A;  4YFN F;  4N9I A;  1KU9 A;  1LNW A;  4A5M A;  2OD5 A;  2BEO A;  1W7P B;  2P6S A;  3HSE A;  3I64 A;  3V8J A;  1WI9 A;  2P5K A;  4L5I A;  1LVA A;  2EK5 A;  1U5T A;  3LQR A;  1OKR A;  1XCB A;  3GFI A;  5H6R A;  3SHF A;  4D0P A;  1T2K A;  1KU7 A;  2E7X A;  1B6A A;  3JTH A;  4G94 A;  3FM3 A;  5HS9 A;  4AIK A;  5HDG A;  1UB9 A;  2VT3 A;  2O0Y A;  3K69 A;  1TLH B;  2YX4 A;  5J8C A;  1YO5 C;  3F21 A;  5E17 F;  3BWG A;  3I4P A;  3JSO A;  1LDK B;  1QPM A;  3NQO A;  1OPC A;  1T39 A;  4G7O F;  3FXR A;  2FBK A;  2V9V A;  3I53 A;  1S7O A;  3U2R A;  4I2O A;  2DTR A;  2IJL A;  1U8R A;  2HEO A;  3G3Z A;  5IT3 A;  4I09 A;  2R3S A;  1XDS A;  4WWC A;  1IAW A;  1OYI A;  1ONV A;  2K4J A;  2RNJ A;  2OQR A;  3REO A;  5LHI A;  2ISZ A;  5AON A;  2Z33 A;  1XCV A;  4LLN A;  1D8K A;  3TQN A;  1FYL A;  4HX4 A;  2K86 A;  1BOA A;  2QQA A;  4PGG A;  4ETS A;  4GXO A;  2O3F A;  1J59 A;  4IF4 A;  3WGI A;  2EB7 A;  2CO5 A;  5JR3 A;  1DDN A;  5E8I A;  2JSC A;  1G3T A;  3IWZ A;  2VT2 A;  3HRT A;  4AIJ A;  5F1R A;  5CVU A;  2HYG D;  1SD4 A;  2H6B A;  3R6S A;  1KYZ A;  1QZZ A;  2A3S A;  1ZRF A;  3EQL F;  3F22 A;  1FYK A;  1DPU A;  1FOK A;  3GFJ A;  2IT0 A;  4FHT A;  3ZMU A;  5FLX K;  2V79 A;  2LSO A;  3BJO A;  2BV6 A;  1S6L A;  3SFZ A;  3LWF A;  1BC8 C;  1MJA A;  5ICC A;  4MGR A;  4KFC A;  3HSF A;  4ZH4 F;  5CYV A;  4HQE A;  1MDM A;  2HQR A;  3JW4 A;  2FQ3 A;  3ZQ7 A;  2FSW A;  1SFX A;  4AVP A;  1WRJ A;  3HHG A;  4KYW A;  1FBS A;  1R58 A;  4HF2 A;  4HAM A;  5D5X B;  3U1D A;  5L3C A;  4IHS A;  3U9G A;  4MTD A;  2P5L C;  1Z91 A;  2RQP A;  2XUB A;  3RIR A;  5CVV A;  4KUM A;  1EH7 A;  2LDU A;  4N0B A;  3CUQ C;  1TNT A;  3F8F A;  2DLL A;  1BI0 A;  1O7L A;  4K2E A;  1O3R A;  2Q2E A;  2HGC A;  2EV6 A;  3HYI A;  2XAJ A;  3F8B A;  1MKM A;  3KEO A;  1SMY F;  2FEZ A;  3C1D A;  2VBW A;  3LA2 A;  5E1X A;  3HTS B;  1UST A;  3GFL A;  1KQ8 A;  2VBZ A;  4UUV A;  2VBY A;  1O3T A;  3BJA A;  2GXB A;  2W25 A;  3I59 B;  1B9N A;  1BN5 A;  4G8X A;  2QVO A;  2QBY A;  4XLP F;  4RB3 C;  3J81 Z;  4LLL A;  1SD6 A;  5CJ9 A;  3K1M A;  2ZME A;  1IUY A;  1ZG3 A;  4KIC A;  5LEK A;  4A5N A;  1HW1 A;  2GAU A;  3ELK A;  2FBH A;  1FSE A;  3GF2 A;  2KJC A;  3CO7 C;  5LRR A;  4GGG A;  2FU4 A;  2L01 A;  5DCM A;  1IN4 A;  2VXZ A;  1MZB A;  3KP3 A;  4OIR F;  3WOD F;  1ZN2 A;  2H09 A;  4M6Y A;  2QLZ A;  2M1B A;  2EJR A;  5E1Z B;  1TNS A;  4HW0 A;  4N9H A;  4OIP F;  4EM0 B;  5L3E A;  1RUO A;  2Z99 A;  1E2X A;  5KK1 A;  5D8K B;  3DPL C;  1KU2 A;  3RYP A;  2XAF A;  2V1D A;  4I02 A;  3IRR A;  4MEY F;  1TW3 A;  2FA5 A;  5FFZ A;  4IRI A;  3RDI A;  1IN8 A;  1D5V A;  2MD5 A;  5FD5 A;  1ZLK A;  3GFM A;  4A0Z A;  4PCQ A;  1U5T C;  1PP8 F;  3T0Y A;  5ERI A;  1MJ9 A;  2DQR A;  3IHU A;  3RPQ A;  4YIF A;  3J7A O;  1I27 A;  2L54 A;  2UWM A;  2Y75 A;  2P8T A;  2ZFW A;  2GXG A;  1AWC A;  1LJ9 A;  1BBY A;  2H94 A;  3DPT A;  1KU3 A;  4Y17 A;  3ZMV A;  5ICE A;  3WTX C;  1LEA A;  5DUI A;  2C6Y A;  2RGV A;  4M73 A;  1YYV A;  4R1H A;  1G3W A;  1L0O C;  5DV5 A;  1Z9C A;  1ZHF A;  4AD9 A;  5FO5 A;  1CF7 A;  4P55 A;  4U7D A;  3G73 A;  1WQ2 A;  4G6Q A;  3WTY C;  5FD6 A;  2DI3 A;  4S05 A;  2D1H A;  2KIM A;  1BI1 A;  5E8G A;  2XIG A;  1O7F A;  2PBI A;  1W4M A;  1U78 A;  2JRT A;  4JQF A;  1AOY A;  4OOI A;  3V4G A;  1Z05 A;  3AAF A;  4OIN F;  3LAP A;  3PQJ A;  2NYX A;  1LDD A;  3EYI A;  3RJP A;  2EV0 A;  1FBU A;  3KE2 A;  2RC4 A;  2NAZ A;  1XSD A;  2J5P A;  4CDG A;  1R36 A;  4IHT A;  1REP C;  3ECH A;  5L3G A;  3H3Z A;  3L00 A;  4RB2 C;  4KN4 X;  3KET A;  3GO5 A;  3E5U A;  2VE9 A;  3GEZ A;  4EM2 A;  3F3X A;  2YU3 A;  2P6T A;  4M9S A;  4LG0 A;  1FC3 A;  3M8E A;  1ZRD A;  4ENN A;  3BPX A;  3RKX A;  1S29 A;  2DU9 A;  2FXA A;  3WE3 A;  2CW0 F;  4LK0 F;  3M8F A;  3K2Z A;  2DW4 A;  3E6D A;  2V1U A;  6PAX A;  1S3J A;  2OQG A;  3ECO A;  1USS A;  3QP5 A;  5HS8 A;  5BPD A;  3RKW A;  1KGS A;  3ZMD A;  5TJJ A;  2D2W A;  2M5W A;  3MQ0 A;  4F7Z A;  5TRD A;  5ILS A;  1FYM A;  2O61 A;  4WXH A;  1TW2 A;  3EUH A;  3ZPL A;  1Q1H A;  2H6C A;  2R7D A;  3SQN A;  1JXS A;  4PDK A;  2F5C A;  1IW7 F;  5HLI A;  2CSO A;  3MAJ A;  5FLX Z;  2VN2 A;  2GWR A;  2PN6 A;  4XLN F;  3RYR A;  2ZXJ A;  4XSZ F;  5DD8 A;  3P9C A;  2P7V B;  3WGH A;  5DCF A;  2WC2 A;  3OV8 A;  2HOE A;  3JAM Z;  4G9Y A;  4JK1 X;  3QPH A;  3MZH A;  5FGM A;  3HIF A;  3GZ5 A;  2B0L A;  2X4H A;  3PFI A;  2ZBK A;  2QEN A;  2F5D A;  4WXD A;  4HQM A;  5DDG A;  4IPA A;  3P9K A;  1U5T B;  1HKS A;  3BOQ A;  2WTE A;  3FMR A;  4YII A;  1K78 A;  2BYV E;  2JTV A;  1J5Y A;  4P96 A;  1ZRC A;  4RB0 A;  2IVM A;  5FB2 A;  3ZN1 A;  3DV8 A;  4HV6 A;  3RKY A;  2VBX A;  2GZW A;  5DUK A;  4PGH A;  3QU3 A;  4OU0 A;  5ILU A;  1OMI A;  2R7F A;  1QZY A;  5JI6 A;  1YW7 A;  1UHM A;  2VC1 A;  1V4R A;  3TDZ C;  5LGU A;  4NQW A;  3FXU A;  2P4W A;  1ZAR A;  2MA3 A;  4A2U A;  3QPT A;  2CYY A;  1T6S A;  3EET A;  3WE2 A;  3KLO A;  1OYW A;  4OIQ F;  1KQ0 A;  1YLF A;  1P4A A;  1OYY A;  1FT9 A;  2EFQ A;  2A07 F;  2ZCW A;  1R5H A;  1I1G A;  5CVI A;  4KNY A;  3EDP A;  2CWE A;  4O5V A;  5CVJ A;  1K79 A;  4CGZ A;  3DQV C;  2OAZ A;  1W7P A;  3QOP A;  3HOS A;  1HQC A;  1HW5 A;  4RAZ A;  2IA2 A;  5JFR A;  3TOA A;  4BQA A;  2HFH A;  4HLY A;  1GHC A;  1ZLJ A;  1LDJ A;  2DO7 A;  1YTY A;  2QWW A;  5HLH A;  1RI7 A;  2XAH A;  1SD5 A;  1MDM B;  2K02 A;  2UXX A;  4H0E A;  2EV5 A;  2FRH A;  2NRA C;  2YX7 A;  1RIO H;  5AIQ A;  3ERE D;  3ULQ B;  1R7J A;  2F5E A;  3WG9 A;  1HKT A;  5D6F A;  5HDN A;  1B59 A;  3E97 A;  4EJO A;  3IL2 A;  3LA3 A;  2HZT A;  3IC7 A;  4M6X A;  4ZYD A;  1XGM A;  2QUF A;  5HLG A;  4I0A A;  5F6F A;  1O3Q A;  1ZAO A;  1J0R A;  4BHB A;  1R5G A;  3JAM K;  4B8X A;  2MLG A;  1YG2 A;  3C18 A;  3CTA A;  1DUX C;  1T98 A;  3CO6 C;  1F9N A;  4ENK A;  4CZZ A;  4L5J A;  4LGW A;  4GCV A;  3GUD A;  3BY6 A;  3FX3 A;  4ZYG A;  2IA1 A;  3EYY A;  2VON A;  2K27 A;  5KVR A;  2Q8K A;  1G3Y A;  1U6G A;  1G4D A;  4A12 A;  2QBY B;  4HDU A;  3WU1 B;  2KJB A;  4Q48 A;  1K6O A;  1P4W A;  4P9U A;  1P4X A;  2ZME B;  4UVB A;  1QBJ A;  4UV9 A;  1MGT A;  2KKO A;  3BP8 A;  1IRG A;  2ACJ A;  1FLI A;  3S2W A;  1YW8 A;  1QO0 D;  5HS7 A;  2QYO A;  3GYH X;  1BJA A;  1U3E M;  2O6G E;  2ISY A;  3F72 A;  4FX4 A;  2UZK A;  4YFK F;  4KN7 X;  5FFX A;  2PFB A;  2P7C B;  3VB2 A;  1ODD A;  4CYD A;  1JGS A;  4BH9 A;  3ZMS A;  4RB1 A;  3KFW X;  2F5F A;  3VOE A;  2UXN A;  2D1V A;  4L18 B;  4BAY A;  2ZJ2 A;  4UVC A;  3FZV A;  1E17 A;  4IVN A;  2HTJ A;  3GXO A;  4WF2 A;  4TV7 A;  2GA2 A;  4I98 B;  4CXF A;  2P5V A;  2MH9 A;  3HRS A;  3HSR A;  2E1C A;  1ZYR F;  2A5Y B;  1Z7U A;  4CO8 A;  4PZJ A;  2JZY A;  4E70 A;  5H6Q A;  2A6E F;  1BIA A;  1CF7 B;  3GW2 A;  1ON2 A;  3I59 A;  3SZT A;  1IXS B;  1V3F A;  4CIC A;  5K5Q A;  4WX9 A;  3Q9S A;  1Z6R A;  3WTU C;  3K1N A;  3HHH A;  1ZGJ A;  2X0L A;  4G7Z F;  1L3L A;  4UXN A;  2IP2 A;  3F6V A;  3V8L A;  5A2Q K;  2G9W A;  3FF5 A;  4HX7 A;  5E20 A;  1UHW A;  5BOX A;  2ZO4 A;  1UCR A;  1UFM A;  3R0A A;  1JE8 A;  5ICF A;  4HF1 A;  1BIB A;  2HS5 A;  4Y13 A;  2A69 F;  2J5O A;  1SMT A;  5JVT A;  4RGU A;  1MJB A;  1G3S A;  3O3K A;  2YR2 A;  3TKY A;  3I0T A;  3FXQ A;  1KYW A;  3R0J A;  1B4A A;  4RGS A;  2LF7 A;  4LG0 B;  1S8N A;  4WK8 F;  3N97 A;  3WTW C;  3MZY A;  3M7G A;  1A04 A;  2EFO A;  5L3B A;  4KMU X;  5DD4 A;  4KA4 A;  4Q5S F;  3TOB A;  4RAY A;  3F23 A;  3NRV A;  5EEG A;  3K1P A;  3ZMT A;  2L4M A;  4BXU A;  4YG2 F;  2CG4 A;  3FMS A;  1CGP A;  4EMS A;  3VOD A;  1QNT A;  4I0B A;  3JTG A;  4G7H F;  1SAX A;  5D4S A;  2BGC A;  3FWE A;  4BYY A;  4U0V A;  1ZH5 A;  4HOB A;  1LEB A;  2CFX A;  3CUQ B;  2WV0 A;  2D45 A;  5K1Y A;  3KZY A;  3E3V A;  5HOO A;  1B1B A;  1SD7 A;  3KP4 A;  3WGG A;  1HSJ A;  3BJ6 A;  2MLK A;  4ESJ A;  2H27 A;  3MFK A;  3T1B A;  4L9N A;  2HDC A;  1J2X A;  2PMU A;  4G6D A;  1D8J A;  5DYM A;  3KP7 A;  4EJW A;  1H0M A;  1SFU A;  2FML A;  2STW A;  3WTV C;  1PP7 U;  3GZ6 A;  1S7A A;  3QU6 A;  3E6M A;  4MNU A;  4LB6 B;  5LHH A;  4L9J A;  4HBL A;  2PLY A;  2K4B A;  1FY7 A;  2FBI A;  1IN6 A;  1HXD A;  2ADU A;  2JPB A;  1PDN C;  2MC3 A;  1HKQ A; 
#chains in the Genus database with same CATH topology
 1BI2 A;  3BR1 A;  3NWT A;  4RS8 A;  2ELH A;  3OOP A;  5HDK A;  2B63 J;  4D9J A;  3OWT A;  4IRG A;  4EQQ A;  4HDV A;  4I7H A;  1ZK8 A;  4YIR X;  4CYC B;  2A6T A;  5KNL A;  2MH2 A;  3LSI A;  2E34 A;  2XAS A;  2LG4 A;  3WU2 C;  1D3Y A;  2B7E A;  1FMW A;  4M3G A;  4UY8 I;  1S5L C;  1HDP A;  5ILV A;  5L3D A;  3TP3 A;  2E7W A;  3E6B A;  1WWX A;  1X1D A;  3AG1 H;  3B6C A;  3LQQ A;  1YS7 A;  2R7Z J;  3ZN0 A;  2EFN A;  1ZG5 A;  2R5Y A;  3IWF A;  3QP6 A;  4A3E J;  5IYB J;  1I39 A;  3FKI J;  4WXC A;  3GTJ J;  2DA4 A;  2W57 A;  4EJT A;  4RGR A;  4F3Q A;  2DA5 A;  2R7X A;  2ZNY A;  2FNP A;  4LFU A;  2E2J J;  1W1W E;  1YQA A;  1TWH J;  4P5O A;  2DFE A;  2LNB A;  4C30 A;  4OWR B;  4M9X A;  4YEJ A;  2M0C A;  3ML6 A;  3J80 Z;  1JT6 A;  3K9T A;  1G6N A;  2F5V A;  1Z77 A;  3D5L A;  5IY5 H;  1DP7 P;  2HKX A;  2IA0 A;  1U2W A;  4A3K J;  2CUF A;  3AL0 C;  3HPG A;  5IT9 Z;  4LOC A;  2JUG A;  5D8L B;  3R4K A;  2V26 A;  4F92 B;  3A02 A;  4PFO A;  1R4M B;  3P5J A;  2DPU A;  4XRS G;  1QHH D;  2L4A A;  1BL0 A;  3LFU A;  1ULY A;  3CCS I;  2FE3 A;  1TP4 A;  1KON A;  1W0U A;  3D0S A;  5EZG A;  4R8H A;  4OMY A;  2KQR A;  4R79 A;  2IS1 A;  1HST A;  1FP2 A;  4L0Y B;  2VL8 A;  3KZI C;  3OYJ A;  3Q9V A;  3CCU I;  4ESF A;  1TQI A;  1TT5 B;  2HTS A;  3FM5 A;  4NB5 A;  1LUJ B;  5D6E A;  3J7A Y;  2R7U A;  3PSI A;  3ZGK A;  1RR7 A;  3S3O A;  1KQ9 A;  2L02 A;  2XAQ A;  4YRV A;  4IZZ A;  4HZF A;  1WCM J;  3JRE A;  1T08 B;  2FOK A;  2BZT A;  4RM2 A;  2Y48 A;  5J1U A;  2CUE A;  5EEH A;  2LKP A;  1JKP C;  1XB4 A;  1U9O A;  4F55 A;  1ETO A;  3ASN H;  3OYM A;  3OYL A;  1GVJ A;  1VI0 A;  1FNN A;  2CQK A;  2EPF A;  3KZZ A;  4BJ5 C;  3JSP A;  1YI2 I;  3E6C C;  3AKZ A;  1UG0 A;  1ERD A;  3ASO H;  4U0W A;  5FKM A;  2QEX I;  1MSF C;  1QHG A;  2ZJQ F;  1JHF A;  1QGP A;  2XV4 S;  5CLS A;  3OIO A;  3GVA A;  4DYQ A;  3JR9 A;  3S3N A;  3CC2 I;  1YW9 A;  4PSX A;  2XRN A;  2AS5 F;  3LA7 A;  1MBK A;  4B1R A;  4UVA A;  4AC0 A;  2K85 A;  5E18 F;  5ED4 A;  3PNY A;  3HOU J;  2WY8 Q;  2FOW A;  2K40 A;  2JN6 A;  3IP4 B;  2X85 A;  3LSG A;  4BEH A;  3K0L A;  3KP6 A;  5D4R A;  2DK8 A;  3DFG A;  3DKW A;  3KEQ A;  2HOS A;  2L9N A;  5LRS A;  2PJP A;  1YHQ I;  1SAU A;  2W1O A;  4UNO A;  3S1N J;  3VYT B;  1IXC A;  2KL4 A;  2BE5 F;  4BNC A;  3KLN A;  2LBF A;  2XKP A;  3L2C A;  4DQ2 A;  1BR2 A;  2OU2 A;  2XAG A;  5CVR A;  1Z3X A;  1X1C A;  4GYI A;  4DJA A;  3PQK A;  2LD5 A;  2VOP A;  2GIV A;  2EIK H;  4JOM A;  5F04 A;  3DTE A;  1OQY A;  1HW2 A;  3K4K A;  2EFP A;  1OCT C;  2K9Q A;  3HOT A;  3NWS A;  2Y69 H;  3QRF F;  4ZYH A;  2NNY A;  5EGO A;  1K61 A;  3H1C A;  3ISP A;  1EH8 A;  1F5T A;  2ETH A;  4B4C A;  3CJN A;  4KMF A;  1F1Z A;  1HBX G;  2FF4 A;  4CCO A;  1YRN A;  5LGN A;  2DXI A;  4ZDP A;  4BDY A;  5LLQ A;  1W5T A;  1WKM A;  3DXJ F;  1TZL A;  3RPU A;  3TDU C;  3DEU A;  3CME I;  1NTC A;  2NVQ J;  2W24 A;  2ZXH A;  4M72 A;  1W7P D;  2XKO A;  2Y0S A;  1FOX A;  2ZSI B;  2DA2 A;  4AID A;  5A2Q Z;  4I6Z A;  4GO1 A;  5EEA A;  4HV5 A;  2Z2S B;  4BJT A;  3ZQC A;  1WPK A;  3BCB A;  1RES A;  3E1S A;  3QPS A;  1KZH A;  2FD5 A;  4BE2 A;  1OCO H;  4GYG A;  4UUS B;  1XSX A;  1FEX A;  1BI3 A;  4L0Z B;  1R23 A;  1RZ4 A;  4AYB N;  5B66 C;  1SEU A;  2PEX A;  2QSH X;  2DOF A;  4UHT A;  2QQB A;  3WTT C;  4C3J J;  1J7K A;  3ZP5 A;  2Z3Y A;  3BDD A;  3K4L A;  1H89 C;  2JPC A;  3HTU A;  4BHC A;  3FHZ A;  5M3F J;  3PL8 A;  3SDG A;  2H8W A;  4KT5 C;  4Q4Z F;  2ZFU A;  3R60 A;  2F4M B;  1GVD A;  3FMQ A;  3I71 A;  3DCF A;  2Q2E B;  2IAI A;  1Y8Q B;  5J1R A;  2M45 A;  3N4M A;  2W00 A;  1VQ6 I;  1EH6 A;  1NHA A;  4XRF A;  3ABT A;  1BC7 C;  5LEJ A;  4BY7 J;  4XBF A;  5FKL A;  4A6D A;  5EJC A;  3BZ6 A;  4EM1 A;  2HKO A;  3BRO A;  5E1W A;  1Z6T A;  2EWN A;  2G7U A;  2XPU A;  4IKF A;  2O9L A;  2COB A;  4E6K G;  4A3C J;  2KIF A;  2V6C A;  4WCG A;  4XSX F;  5BPI A;  3C2G A;  2DA6 A;  1XGN A;  2QQ9 A;  3AG4 H;  4BE1 A;  3J80 K;  2M8G X;  1IRZ A;  2F2E A;  2VC0 A;  2HYF A;  4EJU A;  2NVX J;  3OIP A;  1I1S A;  3FXK A;  1FWZ A;  1J75 A;  4HST A;  3GX4 X;  3OR1 C;  4LIV A;  1ZG1 A;  3DEW A;  2OV7 A;  2X6Y A;  1UMQ A;  3OL4 A;  4BL0 B;  2ZXI A;  2O03 A;  5IT9 K;  1TQP A;  2XF5 A;  3F8N A;  3HRU A;  3V7R A;  4FE7 A;  5F27 A;  4ENJ A;  2XPW A;  3HRM A;  4I99 C;  2R4G A;  1X58 A;  1TQM A;  2PMH A;  1YIO A;  2LY9 A;  4IRH A;  3TO6 A;  1EA3 A;  3BPV A;  5BQT A;  2HOA A;  1R1T A;  2ZSH B;  1OIS A;  2E2I J;  3B73 A;  4QSH A;  5DCM B;  2BY0 A;  1LQ1 A;  3DTK A;  4Y3O A;  1GUU A;  2A68 F;  3CUO A;  1T56 A;  1I5Z A;  3CCY A;  4LD5 A;  4UUT A;  2WWY A;  1X19 A;  2DBB A;  3FXM A;  2IRF G;  2BY3 A;  2V1X A;  3I54 A;  2CGP A;  3MZ8 A;  4XOR A;  5JLW A;  1QQI A;  4D5C A;  2DPD A;  3GME A;  2LVS A;  1MD0 A;  1E3P A;  2HR3 A;  3E5Q A;  1O57 A;  3I58 A;  3KP5 A;  3V7S A;  2HZD A;  1HA8 A;  2OUM A;  2R7Q A;  1RET A;  3HC7 A;  5E3M A;  2Y0M A;  1P2F A;  2VKD A;  4L9V A;  2MBF A;  4OMZ A;  4MEX F;  3H5A A;  4XKB A;  5IOY A;  4LJZ F;  1IRF A;  2X6X A;  1HLV A;  2NS0 A;  2X1D A;  2EA2 A;  1U8B A;  3IKV A;  4IXA A;  3MWM A;  1RR8 C;  3QWL A;  4QLC U;  2XVC A;  3GWZ A;  4EGZ A;  5K5O A;  1DP3 A;  3T8T A;  2OBP A;  2RDP A;  1HOM A;  2WAD A;  4HEA 2;  3R61 A;  4HLX A;  5B1A H;  3GTP J;  4MTE A;  3CDH A;  3S17 J;  3M9A A;  3C7J A;  4IJA A;  4XN3 A;  3O2P E;  5LGT A;  5BNG A;  1IJW C;  3HUG A;  2M87 A;  2NOJ B;  3SEQ A;  3BG5 A;  3BZK A;  1Z1D A;  1R1U A;  2M2E A;  2R93 J;  4LG3 A;  2W85 A;  4BQN A;  2XRO A;  2O8X A;  2BBY A;  5K5R A;  2H8R A;  1XN7 A;  5HNF A;  5JVG F;  2HWV A;  4Y52 J;  2NNN A;  2DMQ A;  1XGS A;  2STT A;  3JRA A;  2RQQ A;  3M1E A;  4ZZD A;  1P6R A;  3COA C;  4M71 A;  2AXT C;  4D5F A;  1FPQ A;  3OYF A;  2DCE A;  4QPQ A;  4XR6 A;  1BM9 A;  1WI3 A;  2DAO A;  2KZV A;  3QAH A;  4FIS A;  3T5X A;  3TGN A;  5GTH C;  5IP9 J;  2AXL A;  4EEF G;  2GQQ A;  4NHJ A;  3S15 J;  3H92 A;  3D1N I;  1SFE A;  1XDU A;  4ZDO A;  3LFK A;  2K7L A;  2XF7 A;  1EV7 A;  2JMW A;  3BG3 A;  5FRO A;  2F4I A;  4KIB A;  4FCY A;  1LVK A;  3W6K B;  2Z5U A;  1WZ2 A;  5C4J J;  2PQ8 A;  1W5C C;  4HSR A;  3T8R A;  1TBX A;  3HZJ A;  2DMN A;  3CLO A;  4MQV A;  2DQL A;  2CRG A;  2EA4 A;  5EZH A;  3GTO J;  4ZYE A;  1GV2 A;  3Q5F A;  4ENM A;  3WTZ A;  3GTM J;  1BR4 A;  3G4S I;  3S32 A;  1ZGW A;  1N77 A;  2RNG A;  2TDX A;  1TL8 A;  1AKH B;  2HDW A;  4E7L A;  1FBQ A;  2K5C A;  3H0D A;  2LK2 A;  3CLQ A;  2G0E A;  2OZU A;  2XGX A;  4IEJ A;  4RGX A;  4DYR A;  1ZRE A;  2F48 A;  1T0F A;  5FJ8 J;  3VEP A;  1PUF A;  3VWB A;  1K83 J;  1B9M A;  1D0Y A;  1M1E B;  1V5E A;  2FUG 2;  4XLA A;  3NAU A;  4QWQ A;  3K4M A;  4EGY A;  1OR7 A;  1BR1 A;  3ZXS A;  2RKH A;  1VTN C;  3EUK L;  3JRI A;  3IH4 A;  4FE4 A;  4Q47 A;  5D5W B;  3LL7 A;  4M9Z A;  1IO2 A;  1YIT I;  1K4S A;  2CQQ A;  1FZP B;  3MEX A;  4XLF A;  2IGM A;  1R22 A;  2M30 A;  4Z2Y A;  4E7S A;  3RI4 A;  3HKZ N;  2DFI A;  3VFZ A;  1O4X A;  4JBA A;  1ACI A;  3ZRG A;  2Q0O A;  1J9I A;  2HI3 A;  4II3 A;  2DOD A;  1H9G A;  1I3Q J;  1KA8 A;  4AWX B;  4EVI A;  1YX5 A;  1ETK A;  2LF8 A;  1MIJ A;  1XMK A;  2IPQ X;  2JK3 A;  3OYE A;  4XQF A;  3A1Y A;  3ROU A;  3PJR A;  1XD7 A;  1ZTR A;  1N78 A;  3HG9 A;  3HOW J;  4U88 A;  3JRG A;  1Y0N A;  5LBQ A;  4X1E A;  4A3M J;  1UAA A;  2LMD A;  2R7V A;  4KIF A;  2LC2 A;  3KCC A;  4XKV A;  3NEU A;  3V7C A;  5GP9 A;  2KRC A;  1PUE E;  4ZC3 A;  4KDP A;  1MBJ A;  2CMP A;  1TTY A;  4O6J A;  3L9F A;  3CQZ J;  3BQY A;  2KDO A;  2E60 A;  4U7B A;  5J3L A;  2DT5 A;  3A01 B;  4OAZ A;  4HX8 A;  4W97 A;  5LHG A;  1NK3 P;  3GTG J;  2R7S A;  3RKQ A;  2FNA A;  4AIH A;  2R5Z A;  4AU7 A;  5J4Y A;  5ICG A;  2JT1 A;  3E5X A;  2VOO A;  4BBS J;  3IRQ A;  1ITY A;  4YFX F;  3ZMZ A;  1JHH A;  1FX7 A;  1DU6 A;  4NC7 A;  1B72 A;  2K9M A;  5H20 A;  3DLA A;  4BJ6 C;  2LY1 A;  4Y33 A;  4ON0 A;  3F0C A;  4V19 K;  2DT6 A;  4KIG A;  2KPM A;  4LB5 A;  1WHU A;  3MCZ A;  3RTR A;  4S04 A;  3DBR B;  3JCU C;  4U0Y A;  3L1P A;  4ZZL A;  4F93 B;  3IKT A;  2L3D A;  3TO7 A;  1X1A A;  4UV8 A;  4EV0 A;  4J00 A;  2XAU A;  3F6O A;  2DJI A;  5AIP A;  3KP2 A;  3A0B C;  3MD2 A;  3WHB A;  3I4N J;  1Y0U A;  3DP7 A;  1CQT A;  1A36 A;  2RV8 A;  2L2O A;  1K7A A;  1GXP A;  3ABU A;  3F8M A;  2VKH A;  5D5U B;  1FIP A;  2LYC A;  2MW8 A;  4XID A;  3LST A;  4M74 A;  2VE8 A;  3ESW B;  1R1V A;  3OSF A;  1JUS A;  3TP0 A;  1WGX A;  2H1L A;  4B3X A;  3BTI A;  5BS6 A;  2QM3 A;  1YFH A;  2QSG X;  3P7N A;  5JHU A;  1RNL A;  1DU0 A;  3GLX A;  4Y15 A;  2DA3 A;  4MFD A;  4Y4R A;  2HXI A;  3CES A;  2QCO A;  1W5S A;  4A3L J;  1V5F A;  1FSH A;  1IN7 A;  1T38 A;  4BHP A;  2W84 A;  3SXY A;  1C0W A;  3WTS C;  2M3A A;  2JA5 J;  2AQE A;  1S7E A;  1XGO A;  4N4O B;  3LSJ A;  2PMZ A;  2R7R A;  1LFB A;  3VSL A;  5J4V A;  4ASN A;  3FK7 A;  4QIW N;  5D5V B;  3ZQF A;  1IGN A;  2CUJ A;  4B44 A;  2ZKZ A;  4GDF A;  2G7H A;  1RKT A;  4LMY A;  4CH7 A;  4DOZ A;  3Q3S A;  4KT6 A;  4HA8 A;  4FX0 A;  1P92 A;  3VSK A;  3SZP A;  3J81 K;  2PJR A;  2XGE A;  5HVQ C;  1X3U A;  3RZO J;  4A6E A;  1IN5 A;  2ZNZ A;  4DNC A;  1I6X A;  1IF1 A;  4P9F A;  4MQ9 F;  4CHU A;  3S14 J;  1BW5 A;  3MKL A;  2M8E A;  3CUQ A;  1O3S A;  2OJE D;  3W2A A;  2QZ8 A;  2ESH A;  1K78 B;  1R00 A;  2A61 A;  5J6X A;  2BHZ A;  4B09 A;  1RUN A;  3L7W A;  4LK1 F;  2PI0 A;  3IAM 2;  1XC5 A;  4LLG F;  4J19 A;  2E1N A;  1XMA A;  2CW7 A;  1H9T A;  2KRF A;  4I01 A;  5B5E C;  4N4N B;  2Z9O A;  4A0X A;  2RAE A;  1STZ A;  1WFX A;  2EZH A;  1RC9 A;  4EJV A;  2PG4 A;  5F64 A;  1XSV A;  2DFH A;  2GOM A;  1FP1 D;  2X51 A;  1SFK A;  4A0Y A;  3W6J B;  1Z7L A;  2M4G A;  1NH3 A;  2IW5 A;  2LFB A;  2WAF A;  3F8C A;  1WSU A;  1G8X A;  1MMS A;  3C3W A;  3G1M A;  1B8I B;  1YJW I;  4AM3 A;  2EFW A;  3ERM A;  2VB6 A;  2AO9 A;  5CQE A;  3LSP A;  4BAC A;  2ECB A;  4NQW B;  4HYE A;  2CQX A;  3V8K A;  5HNH A;  1GXQ A;  1X1B A;  2COM A;  5DEQ A;  2CW8 A;  2YS9 A;  4O3M A;  5FKN A;  2DOA A;  2YPR A;  1ON1 A;  2ESN A;  1LB2 A;  2WAE A;  3DF8 A;  4MHG A;  3L09 A;  3H3V K;  4OIO F;  2A6H F;  3P9I A;  5BMZ A;  1YS6 A;  2OZ6 A;  1QPI A;  3B02 A;  2YSR A;  2KIU A;  1IXR C;  4HF0 A;  2HQN A;  2VOD A;  4L9T A;  2RVC A;  4CYC A;  1DPR A;  3I3L A;  2IS6 A;  1JKR C;  3L2V A;  1QU3 A;  2P81 A;  3H3U A;  2FMY A;  1F4K A;  2HPI A;  3I9V 2;  2XHK A;  3LSH A;  3SYT A;  3FBI B;  1ETQ A;  1VQP I;  1JI8 A;  1IZ1 A;  1P9Q C;  2DK5 A;  1J09 A;  2OCC H;  4ESB A;  4RMN A;  3I5U A;  5J8F A;  3LMM A;  2QQ8 A;  3O6B B;  4MO7 A;  3L2W A;  1LE8 B;  2GA1 A;  2RN7 A;  5KCM A;  3WU0 A;  5L3F A;  1ZGA A;  4FT8 A;  4RA2 A;  3TO9 A;  2OA4 A;  3LAJ A;  2H1K A;  4YFN F;  3GCM A;  3DBH B;  4N9I A;  4BXF A;  4PK4 A;  1KU9 A;  1VQ9 I;  1LNW A;  2V6E A;  4A5M A;  1PJR A;  2OD5 A;  2BEO A;  2L0K A;  3BLY A;  1W7P B;  2P6S A;  3Q0U A;  5FRM A;  3HSE A;  3I64 A;  3V8J A;  1WI9 A;  2EZL A;  2P5K A;  1LVA A;  1WJA A;  2EK5 A;  4L5I A;  4PJM A;  2HVR A;  2CS3 A;  1IC8 A;  1U5T A;  1X3W B;  1X3Z B;  1WJB A;  1TT0 A;  3LQR A;  3W6V A;  1OKR A;  1XCB A;  3GFI A;  5H6R A;  3SHF A;  3OSG A;  4D0P A;  3QYE A;  1T2K A;  1KU7 A;  4NDL A;  1VQN I;  2E7X A;  1B6A A;  3JTH A;  2GOX B;  4G94 A;  1WVR A;  3FM3 A;  4XNF A;  4A93 J;  5HS9 A;  4AIK A;  5HDG A;  1VQ5 I;  1UB9 A;  3DWL E;  1T0F C;  4XKC A;  2VT3 A;  2O0Y A;  1VQ8 I;  3K4N A;  2W48 A;  3K69 A;  1PVE A;  1TLH B;  2BVM A;  2YX4 A;  5J8C A;  1YO5 C;  2LLK A;  2HVQ A;  4BS9 A;  3F21 A;  5HOD A;  2GLO A;  5E17 F;  1D0X A;  3BWG A;  1OR7 C;  4X6A J;  3I4P A;  3JSO A;  2HVS A;  1X4O A;  2M34 A;  1LDK B;  4G6T B;  4NBQ A;  4H4K C;  1P7I A;  5EG0 B;  2M4K A;  1QPM A;  3ZQL A;  3NQO A;  1OPC A;  1T39 A;  2X9D A;  4G7O F;  3FXR A;  2FBK A;  2V9V A;  1MNM C;  3I53 A;  3MN2 A;  2BY1 A;  1S7O A;  2X1C A;  1GLN A;  2XDV A;  3U2R A;  1S9H A;  2DTR A;  2IJL A;  4I2O A;  1U8R A;  4ABZ A;  2HEO A;  3G3Z A;  1OCR H;  5IT3 A;  4I09 A;  2R3S A;  2HOT A;  1XDS A;  3CF2 A;  4WWC A;  3E7L A;  1IAW A;  2ICW G;  1OYI A;  1ONV A;  2K4J A;  2KFD A;  2RNJ A;  2LOO A;  3FXL A;  3M8J A;  2OQR A;  3REO A;  1XPX A;  3H5N A;  4C2U A;  1TC3 C;  1WH5 A;  5LHI A;  2XPV A;  4M6V A;  2ISZ A;  1D1B A;  5AON A;  2Z33 A;  4XN0 A;  1XCV A;  5DM7 F;  4LLN A;  1D8K A;  3TQN A;  1U9N A;  1FYL A;  4HX4 A;  1HC8 A;  3CDI A;  2K86 A;  1BOA A;  2QQA A;  4PGG A;  2KT0 A;  4GXO A;  4ETS A;  4QPO A;  4C3I J;  2O3F A;  1J59 A;  4IF4 A;  4XON A;  3QYF A;  2EB7 A;  2CO5 A;  3GZN B;  3RPU D;  4BUP A;  5JR3 A;  3WGI A;  1DDN A;  3S2H J;  5E8I A;  2JSC A;  3CZ6 A;  3OYH A;  1JUM A;  3ABK H;  1G3T A;  2A05 A;  3IWZ A;  2VT2 A;  3HRT A;  1VFC A;  4AIJ A;  2LKS A;  5F1R A;  5CVU A;  4U87 A;  2HYG D;  1SD4 A;  2H6B A;  3R6S A;  2WA0 A;  1KYZ A;  1QZZ A;  2A3S A;  4C9Y A;  1ZRF A;  3A03 A;  3EQL F;  3JRH A;  3F22 A;  1FYK A;  3G6E I;  1DPU A;  3K6G A;  3Q0V A;  2VIX A;  3PFY A;  4A69 C;  1FOK A;  3IAS 2;  5E3N A;  3GFJ A;  2IT0 A;  2QGU A;  3M07 A;  4FHT A;  3ZMU A;  3K4C A;  5FLX K;  2VPR A;  2V79 A;  4FET A;  3BJO A;  1BJZ A;  2WB1 A;  2LSO A;  2BV6 A;  1S6L A;  3SFZ A;  3TL4 X;  3M4O J;  2WV1 A;  3LWF A;  5TGT A;  1BC8 C;  3HM5 A;  2L9V A;  3RQ4 A;  4ZTJ A;  1MJA A;  2K3F A;  2CV1 A;  5ICC A;  3JRB A;  3DEE A;  1ENH A;  4MGR A;  4KFC A;  3HSF A;  2PX9 A;  4ZH4 F;  5CYV A;  4HQE A;  4RLF A;  4B43 A;  2ME0 A;  4G12 A;  3I56 I;  1MDM A;  3S1R J;  2HQR A;  3JW4 A;  2VJJ A;  2FQ3 A;  3DKY A;  3ZQ7 A;  3IUO A;  2FSW A;  4L5E A;  2Y0S N;  4BU2 A;  1SFX A;  2W4S A;  1WRJ A;  3D5R C;  3HHG A;  4AVP A;  1S72 I;  4KYW A;  4UUS A;  3TW6 A;  1FBS A;  3O8H A;  3HGY A;  3CCJ I;  1R58 A;  4HF2 A;  4EAT A;  4HAM A;  5D5X B;  3VYS B;  3U1D A;  1ORK A;  1R9T J;  2DTZ A;  5L3C A;  4IHS A;  3L2Q A;  2MC4 A;  1YJ9 I;  1TWC J;  1AHD P;  3U9G A;  4MTD A;  4IL6 C;  1TWF J;  4D7M A;  2P5L C;  3AL0 B;  1Z91 A;  1NG6 A;  2RQP A;  2XUB A;  3RIR A;  5CVV A;  4KUM A;  1EH7 A;  2LDU A;  4N0B A;  2LY2 A;  3CUQ C;  3K2A A;  2V1N A;  1TNT A;  3F8F A;  2QF7 A;  5FRN A;  2DLL A;  1BI0 A;  1O7L A;  2IGO A;  4K2E A;  5B3S H;  2Q2E A;  2HGC A;  1O3R A;  2EV6 A;  1MSE C;  4RLQ A;  3HYI A;  2XAJ A;  3F8B A;  3CCV I;  4CCL A;  2VQG A;  2LTP A;  1ETV A;  1LKX A;  4E4H A;  1MKM A;  3KEO A;  1RRJ A;  1Z67 A;  1SMY F;  2FEZ A;  4B47 A;  2NVY J;  3C1D A;  2VBW A;  2Y31 A;  2ZJR F;  2NOG A;  3LA2 A;  1G59 A;  5E1X A;  2ID3 A;  4YEL A;  3HTS B;  1UST A;  4CCK A;  3UNG C;  3GFL A;  1VQO I;  4BE0 A;  1KQ8 A;  2VBZ A;  2DA1 A;  3G1L A;  4UUV A;  2VBY A;  1O3T A;  3BJA A;  2GXB A;  3HOZ J;  3CMM A;  2W25 A;  3OY9 A;  3I59 B;  1B9N A;  1BN5 A;  3N05 A;  4G8X A;  1WH7 A;  2QVO A;  3BR5 A;  2QBY A;  4XLP F;  3VDX A;  2L9S A;  4RB3 C;  2V4J C;  3DTI A;  2OPT A;  1XX5 A;  5GAE J;  3J81 Z;  1OCP A;  2E1M C;  4LIT A;  4C2T A;  1OLT A;  4XOP A;  4LLL A;  1SD6 A;  5CJ9 A;  1VZ0 A;  2EIN H;  1I50 J;  2HNH A;  4CZC A;  3K1M A;  2ZME A;  3CP2 A;  1RKW A;  1IUY A;  1ZG3 A;  4KIC A;  5LEK A;  4JX4 A;  3G71 I;  4A5N A;  1HW1 A;  5IPA A;  1A6Q A;  2GAU A;  2EZK A;  1ZKG A;  2LR8 A;  1F36 A;  2FBH A;  3ELK A;  3KX2 A;  1FSE A;  5C3E J;  3GF2 A;  2KJC A;  3QOD A;  1W0T A;  3CO7 C;  4IHY A;  1MMN A;  5LRR A;  4GGG A;  2FU4 A;  2L01 A;  5DCM A;  1IN4 A;  2KZG A;  2VXZ A;  1MZB A;  3KP3 A;  4OIR F;  1WJF A;  2VXD A;  4I76 A;  2CV0 A;  4E7J A;  3WOD F;  1ZN2 A;  2H09 A;  4M6Y A;  2QLZ A;  2X48 A;  2M1B A;  2EJR A;  2E36 A;  4PFP A;  5E1Z B;  1TNS A;  4HW0 A;  4N9H A;  3J7Y J;  4OIP F;  4KJZ A;  4EM0 B;  5L3E A;  3FBN B;  1RUO A;  2Z99 A;  1E2X A;  3FIW A;  5KK1 A;  3MMY B;  3HB9 A;  1LPQ A;  5D8K B;  3DPL C;  1KU2 A;  3SFI A;  1MMA A;  3RYP A;  1A5J A;  2XAF A;  2V1D A;  2ZC2 A;  4IHW A;  4I02 A;  4IQ4 A;  3IRR A;  4MEY F;  1TW3 A;  2VQC A;  3ZQH A;  3IH3 A;  2FA5 A;  2CU7 A;  5FFZ A;  2M9H A;  4IRI A;  2DN0 A;  3RDI A;  1IN8 A;  2ZB9 A;  1D5V A;  2MD5 A;  2VKE A;  2DOE A;  5FD5 A;  4DW6 A;  3CJT B;  2KRH A;  1ZLK A;  4C2M J;  4RBO A;  3GFM A;  4A0Z A;  4PCQ A;  4A3I J;  1MND A;  1U5T C;  4P1W A;  1PP8 F;  3BZC A;  3T0Y A;  2ECC A;  2FJ1 A;  5ERI A;  1MJ9 A;  2DQR A;  2NXN B;  3IHU A;  3RPQ A;  4YIF A;  2VI6 A;  3J7A O;  1I27 A;  2L54 A;  4XL9 A;  2UWM A;  2BW3 B;  2Y75 A;  2P8T A;  2ZFW A;  2GXG A;  1AWC A;  1LJ9 A;  1BBY A;  2GM4 A;  5CKT A;  2H94 A;  4V2G A;  2E5N A;  3DPT A;  1KU3 A;  4Y17 A;  3ZMV A;  3M1C A;  5ICE A;  3WTX C;  3OYA A;  1LEA A;  2HQ5 A;  5DUI A;  5FLV A;  2C6Y A;  2E19 A;  2RGV A;  4M73 A;  1YYV A;  4R1H A;  1B72 B;  1G3W A;  2P0W A;  1AU7 A;  4F91 B;  3X2Q H;  1L0O C;  3JRD A;  3FDY A;  5DV5 A;  1Z9C A;  1ZHF A;  4AD9 A;  5FO5 A;  1CF7 A;  4P55 A;  4PJL A;  4U7D A;  3G73 A;  1WQ2 A;  4ZDL A;  4G6Q A;  5KHD A;  3WTY C;  5FD6 A;  2MYS A;  1T33 A;  2DI3 A;  4S05 A;  3J7Z I;  2D1H A;  2KIM A;  1BI1 A;  2ID6 A;  4LIU A;  5E8G A;  2XIG A;  3O8G A;  4AVZ A;  4M3E A;  3OYI A;  1SC7 A;  1O7F A;  2PBI A;  1W4M A;  3S93 A;  1U78 A;  2JRT A;  5DS9 A;  2VQH A;  4JQF A;  1AOY A;  2IXS A;  3S3M A;  4XLH A;  3ZOB A;  1LFU P;  2VQL A;  2FX0 A;  1AKH A;  5M5W J;  4OOI A;  3V4G A;  1Z05 A;  1XG1 A;  3AAF A;  1SVM A;  1JTX A;  2X6W A;  4OIN F;  3LAP A;  3BG6 A;  3PQJ A;  2NYX A;  2JWT A;  3QOE A;  1MH3 A;  1IV6 A;  1LDD A;  4BQO A;  2OTL I;  2OF7 A;  2VJ4 A;  3EYI A;  1X2M A;  4F52 A;  1XS9 A;  5FKO A;  3RCO A;  3RJP A;  3SDB A;  2EV0 A;  1FBU A;  3KE2 A;  2RC4 A;  4CSW A;  2NAZ A;  2R7W A;  1XSD A;  4B48 A;  1UHS A;  2J5P A;  2KP6 A;  4CDG A;  3C2B A;  3BR6 A;  1R36 A;  4IHT A;  1REP C;  3ECH A;  2W7N A;  2A5W A;  1PYV A;  1OJL A;  5L3G A;  3H3Z A;  2O7O A;  3L00 A;  5F0H A;  4XRS A;  4RB2 C;  4KN4 X;  3KET A;  3GBG A;  3GO5 A;  3E5U A;  2VE9 A;  4OAY A;  2OC6 A;  2DMP A;  5J47 A;  4MLO A;  3GEZ A;  1BW6 A;  3ZQQ A;  2V9P A;  4EM2 A;  3F3X A;  1VND A;  2YU3 A;  4UB6 C;  5GAG J;  2P6T A;  4M9S A;  3HEF A;  2E2H J;  2I8D A;  4LG0 A;  9ANT A;  4BY1 J;  1FC3 A;  3BC8 A;  1XMX A;  1BOB A;  3PO2 J;  1Z0X A;  3M8E A;  2DA7 A;  2O8K A;  1ZRD A;  4ENN A;  3BPX A;  3UKG A;  3RKX A;  4A3J J;  1S29 A;  2JSP A;  3A4C A;  2DU9 A;  3GTK J;  2FXA A;  3WE3 A;  2CW0 F;  4LK0 F;  3FKJ A;  1N25 A;  3M8F A;  4W1U A;  1TWG J;  1YX3 A;  1FJL A;  3K2Z A;  1WJC A;  2DW4 A;  3DU6 A;  1UJ8 A;  3VYR B;  4DGW B;  4IQJ A;  3E6D A;  2V1U A;  6PAX A;  3PUF A;  1S3J A;  2OQG A;  2R5Y B;  3HPH A;  2IGN A;  4A3F J;  3ECO A;  1USS A;  3QP5 A;  5HS8 A;  2Y2Z A;  5BPD A;  3RKW A;  1Y1W J;  1KGS A;  3ZMD A;  3G1O A;  5KAI C;  5TJJ A;  2D2W A;  2M5W A;  1IG7 A;  1EJ9 A;  3CCL I;  3MQ0 A;  4NC6 A;  4F7Z A;  1R4N B;  3H36 A;  3ZQI A;  5TRD A;  5ILS A;  1FYM A;  2GXA A;  3IH2 A;  1TW2 A;  4WXH A;  2O61 A;  3EUH A;  3ZPL A;  1Q1H A;  2H6C A;  2R7D A;  4HG2 A;  3SQN A;  3BQZ A;  1JXS A;  4PDK A;  3BG9 A;  3OYC A;  2F5C A;  1IW7 F;  5HLI A;  5FKK A;  5J40 A;  4ITV A;  2WAQ A;  2CSO A;  3K4B A;  3PIO F;  2Y30 A;  3H9Q A;  3MAJ A;  5M5X J;  5FLX Z;  2UUZ A;  1POG A;  1QA6 A;  3FIS A;  2DYS H;  2VN2 A;  2GWR A;  2PN6 A;  3PO3 J;  1EF4 A;  4XLN F;  5F08 A;  4A3B J;  3RYR A;  3OYD A;  3H5R A;  3FXO A;  2I10 A;  2ZXJ A;  2MG4 A;  4XSZ F;  3K7A J;  4PSW A;  5DD8 A;  3U21 A;  5IP7 J;  3P9C A;  3L2U A;  2JA2 A;  1Y6I A;  2P7V B;  3WGH A;  5DCF A;  2WC2 A;  3OV8 A;  3UR3 C;  2L7F P;  2HOE A;  3JAM Z;  4G9Y A;  4JK1 X;  1FOW A;  3QPH A;  2DJN A;  1JJ6 C;  2K9S A;  5FGM A;  3MZH A;  3HIF A;  1OFC X;  3GZ5 A;  2JVG A;  3K70 C;  2PMZ N;  2LKX A;  2BXZ A;  3EUA A;  2B0L A;  2X4H A;  3PFI A;  2ELK A;  2ZBK A;  4XKW A;  2DDA A;  4CA0 A;  1BA5 A;  2QEN A;  1R49 A;  2F5D A;  3C2H A;  4WXD A;  2Z1D A;  4HQM A;  2M7A A;  5DDG A;  3EPZ A;  4IPA A;  3KPH A;  3CCE I;  2M7B A;  3P9K A;  2QA4 I;  1U5T B;  1HKS A;  2KLO A;  2WTE A;  3BOQ A;  3FMR A;  3PUB A;  1ETW A;  2OCE A;  4GFB A;  2ZME C;  4YII A;  4XRM A;  4D7N A;  1K78 A;  2BYV E;  2JTV A;  1J5Y A;  2JVH A;  3CF5 F;  2F4O B;  4P96 A;  3CJR B;  2XB5 A;  2IBD A;  1H8A C;  3BR2 A;  1FIA A;  1ZRC A;  2VAS A;  1Y1V J;  4BEH B;  4CCN A;  4RB0 A;  2IVM A;  3OR2 C;  5FB2 A;  3ZN1 A;  3DV8 A;  2WAQ N;  3QQA A;  4HV6 A;  4XK4 A;  3BTJ A;  3RKY A;  2VBX A;  2LBF B;  2GZW A;  5DUK A;  4PGH A;  4IOA F;  3QU3 A;  4OU0 A;  5GAH J;  5DTD A;  2VJ5 A;  2CV2 A;  5ILU A;  2KIS A;  1OMI A;  3OS1 A;  4XLC A;  1A6I A;  1FOY A;  1F43 A;  1E3H A;  2R7F A;  1QZY A;  5JI6 A;  1YW7 A;  3NAR A;  1UHM A;  2VC1 A;  3ZQG A;  1B8I A;  1V4R A;  3TDZ C;  1D1A A;  5EGO B;  2X1E A;  5LGU A;  4NQW A;  4J01 A;  2JA8 J;  3FXU A;  2EH3 A;  2KIQ A;  2P4W A;  2Q1Z B;  4PJN A;  3L2R A;  2WBM A;  1ZAR A;  2MA3 A;  4IHX A;  1YRN B;  4A2U A;  1R6R A;  3QPT A;  3ZCO A;  4UB8 C;  4ZJZ A;  3QYB A;  1EKE A;  2IGK A;  4II2 A;  2TCT A;  2CYY A;  1T6S A;  3EET A;  1FTT A;  3WE2 A;  3KLO A;  2IS2 A;  4HPQ A;  4XM3 A;  3DBL B;  2AQF A;  2DFF A;  2MAB A;  2XF6 A;  1OYW A;  1TWA J;  3AG3 H;  3U1K A;  2E35 A;  3PM1 A;  2N8G A;  4HNV A;  4OIQ F;  1KQ0 A;  1OCC H;  1MW7 A;  3KYL A;  4AYB A;  1QVT A;  1N75 A;  1YLF A;  1P4A A;  1DGR M;  1FT9 A;  1OYY A;  5GTI C;  2EFQ A;  3W2W A;  1UZC A;  2A07 F;  1VQK I;  2NS7 A;  5M3M J;  1LE8 A;  2ZCW A;  4JX5 A;  3LNQ A;  1R71 A;  4Y7N J;  1R5H A;  1I1G A;  2JRM A;  5CVI A;  4JP0 A;  4KNY A;  2JUC A;  2XRL A;  3EDP A;  2CWE A;  4O5V A;  5CVJ A;  1K79 A;  3HJE A;  4JX6 A;  1ETY A;  4CGZ A;  3MKW B;  3DQV C;  3FK6 A;  2CQN A;  2IS4 A;  2OAZ A;  1W7P A;  3QOP A;  3HOS A;  1HQC A;  1HW5 A;  1JKQ C;  3RSN A;  4RAZ A;  3HBL A;  2IA2 A;  5JFR A;  1JTY A;  5KAF C;  3TED A;  3JRF A;  3TOA A;  3A0H C;  3S16 J;  4BQA A;  5F0C A;  5K7H A;  2HFH A;  4NUB A;  4RAF A;  1D1C A;  5EYR A;  3OOU A;  1Y39 A;  4HLY A;  1LFP A;  3LSM A;  4E7I A;  3WHC A;  3JRC A;  1GHC A;  1ZLJ A;  1LDJ A;  2DO7 A;  1YTY A;  1W36 C;  3BR3 A;  2QWW A;  5HLH A;  3FXJ A;  1DQU A;  2YUS A;  3PNV A;  1RI7 A;  2XAH A;  1SD5 A;  1MDM B;  2K02 A;  2UXX A;  4H0E A;  2EV5 A;  2FRH A;  4B3A A;  2NRA C;  2KHM A;  2YX7 A;  1RIO H;  3Q0W A;  5AIQ A;  5EG0 A;  1NK2 P;  3CC4 I;  3ERE D;  2L7M P;  2AHQ A;  3KYC B;  1WJ5 A;  2O5R A;  3BTC A;  3ULQ B;  2Z16 A;  1R7J A;  1U0J A;  2BHY A;  2EQR A;  2BXY A;  2XSD C;  2LP0 A;  2F5E A;  1APL C;  1HDD C;  3WG9 A;  4M3F A;  2HU9 A;  1HKT A;  4MIM A;  2R92 J;  2V9K A;  5D6F A;  1A35 A;  4FQG A;  1P7J A;  4M3D A;  4NC8 A;  5HDN A;  2CUZ A;  4CUG A;  5IYC J;  1VQ7 I;  1B59 A;  3E97 A;  4EJO A;  3IL2 A;  2VPL A;  2B9S A;  2MGQ A;  3LA3 A;  3TW7 A;  3OS2 A;  1HCR A;  2HZT A;  3IC7 A;  1VQM I;  3BTL A;  4M6X A;  4ZYD A;  4PJJ A;  3SZG A;  5JHF A;  1XGM A;  2QUF A;  3KYD B;  3S2D J;  5HLG A;  4I0A A;  2JQ7 A;  3OL3 A;  3CD6 I;  2EZI A;  5F6F A;  1O3Q A;  1ZAO A;  1J0R A;  3OS0 A;  4BHB A;  1R5G A;  2KMU A;  2NS8 A;  1JKO C;  3JAM K;  4B8X A;  2MLG A;  4HRI A;  5F1J A;  3G2B A;  1YG2 A;  3C18 A;  3DU5 A;  3CTA A;  3PNT A;  1DUX C;  1X4P A;  1T98 A;  3CO6 C;  1F9N A;  1VF9 A;  3SJM A;  1D5Y A;  4ENK A;  4CZZ A;  2BVL A;  4L5J A;  4LGW A;  3TMO A;  4GCV A;  3GUD A;  2ZXW H;  1RPW A;  3GTQ J;  3BY6 A;  3FX3 A;  4ZYG A;  2IA1 A;  3EYY A;  2VON A;  2K27 A;  3DLL F;  5KVR A;  2Q8K A;  3BG7 A;  1G3Y A;  1U6G A;  3TBI A;  1G4D A;  4A12 A;  2QBY B;  3OYK A;  4GRI A;  4HDU A;  3EUH C;  2JA7 J;  3WU1 B;  3WG7 H;  1IUF A;  2KJB A;  4S0H B;  4Q48 A;  2D5V A;  1FTZ A;  1K6O A;  4BDZ A;  1P4W A;  3LSK A;  3SEZ A;  1UG2 A;  3GLL A;  3VYU B;  4P9U A;  3CCQ I;  3CC7 I;  1P4X A;  2ZME B;  4UVB A;  1QBJ A;  3M3Y J;  3HUG B;  4PUS A;  4UV9 A;  2OTJ I;  1SAN A;  1MGT A;  2KKO A;  2WY7 Q;  3BP8 A;  1T95 A;  5DM6 F;  3W3C A;  1IRG A;  2EIJ H;  4IX7 A;  5C4X J;  2EIL H;  2ACJ A;  1FLI A;  5IOZ A;  3KIO A;  3S2W A;  2WB1 N;  2MSY A;  1YW8 A;  1QO0 D;  3MKZ A;  2LH9 A;  1IV8 A;  1YOV B;  5HS7 A;  2QYO A;  5K7F A;  3GYH X;  2R0Q C;  3HDD A;  1ZR2 A;  1BJA A;  2BY2 A;  2W82 A;  5CQG A;  1U3E M;  2O6G E;  5EF6 A;  2ISY A;  3F72 A;  4DYC A;  2HXO A;  4FX4 A;  2UZK A;  4YFK F;  1MBG A;  2M0M A;  3D5S C;  4KN7 X;  4HNU A;  5FFX A;  2PFB A;  1AA7 A;  2P7C B;  3VB2 A;  2RRE A;  1ODD A;  4ANJ A;  3OMY A;  4CYD A;  1JGS A;  4Z6Y A;  2HYJ A;  5B1B H;  2K9L A;  3E0J B;  4BH9 A;  2MFZ A;  1H88 C;  3ZMS A;  2TRT A;  2ME6 A;  5HLT A;  4AUX A;  4RB1 A;  3I55 I;  1G2H A;  4RAG A;  4C3H J;  3KFW X;  2DDB A;  2F5F A;  3K70 D;  3HOV J;  3VOE A;  5M5Y J;  1Q1V A;  2UXN A;  2D1V A;  4BKX A;  1PUF B;  2IEK A;  4BAY A;  4L18 B;  2ZJ2 A;  1YJN I;  4UVC A;  3FZV A;  3AG2 H;  1E17 A;  3H9G A;  4IVN A;  2HTJ A;  3GXO A;  2L5Q A;  3PSF A;  2HDD A;  4WF2 A;  4TV7 A;  3HGG A;  2GA2 A;  3B6A A;  1Z21 A;  3HKZ A;  4I98 B;  3VPR A;  5IYD J;  1I3A A;  3CP8 A;  4CXF A;  2P5V A;  1ZR4 A;  2MH9 A;  3HRS A;  3PIP F;  4DBQ A;  3HSR A;  5E3L A;  2E1C A;  2Y9Y A;  1ZYR F;  4DZP A;  2A5Y B;  2VKV A;  3RQI A;  2JJ7 A;  2X6O A;  5TIS C;  1VQ4 I;  5LD2 C;  1Z7U A;  2I5U A;  4HNT A;  4CO8 A;  4PZJ A;  2JZY A;  4RM3 A;  4DZJ A;  4E70 A;  5H6Q A;  2A6E F;  1BIA A;  1FMV A;  1CF7 B;  3GW2 A;  1Z3Y A;  1ON2 A;  4XLE A;  1D0Z A;  3I59 A;  3CMY A;  1NG7 A;  5F0F A;  3SZT A;  1IXS B;  3K4J A;  4XOT A;  1V3F A;  5EDN A;  4JYK A;  4CIC A;  3HOX J;  5K5Q A;  2F6C A;  1MBE A;  1ETX A;  1GT0 C;  4WX9 A;  5GPA A;  4A3G J;  3Q9S A;  4E7H A;  2KDZ A;  2Y9Z A;  1Z6R A;  1IRX A;  2BOL A;  1SVL A;  3WTU C;  2DYR H;  3K1N A;  3H0G J;  3OYN A;  3AFH A;  4FTH A;  2R7T A;  3HHH A;  1ZGJ A;  2X0L A;  4G7Z F;  1L3L A;  5IP6 A;  2R5Z B;  4V2F A;  4UXN A;  2IP2 A;  5CPR B;  3F6V A;  3V8L A;  5A2Q K;  4E7Z A;  2G9W A;  3FF5 A;  4HX7 A;  4XIC A;  5E20 A;  4ZTF A;  1QRY A;  2GBY A;  4A3D J;  1UHW A;  3GTL J;  5BOX A;  2LRE A;  2ZO4 A;  1UCR A;  4IOC F;  4BXX J;  1UFM A;  2E1O A;  2DMU A;  3R0A A;  1Y56 A;  1JE8 A;  5ICF A;  4HF1 A;  1E0E A;  1BIB A;  2HS5 A;  3W2V A;  4Y13 A;  1HF0 A;  2V7F A;  5FLM J;  5E3O A;  2A69 F;  3ONQ A;  4FAS D;  2J5O A;  3HL2 A;  1SMT A;  2K3P A;  5JVT A;  1R5I D;  4RGU A;  1MJB A;  3BR0 A;  1JT0 A;  1G3S A;  2FQ4 A;  3O3K A;  2YR2 A;  2CH0 A;  3TKY A;  3I0T A;  3FXQ A;  2L9R A;  2XGD A;  3ABL H;  1X1P A;  2YU9 J;  2GIZ A;  1QZE A;  2DMT A;  2K9N A;  1KYW A;  3OIQ A;  3R0J A;  3CCR I;  2VJI A;  1B4A A;  1WJE A;  4RGS A;  3HXL A;  3OYG A;  3RZD J;  2LF7 A;  3F9K A;  2HPM A;  4LG0 B;  2EBI A;  1S8N A;  4KIT B;  4WK8 F;  3N97 A;  3WTW C;  1MMD A;  3MZY A;  1GDT A;  3M7G A;  2CJJ A;  3HOY J;  1A04 A;  2EFO A;  5L3B A;  4RDU A;  4IO9 F;  4KMU X;  5DD4 A;  4KA4 A;  2BW3 A;  4Q5S F;  4KIS A;  3A2K A;  5C44 J;  5LFA A;  3TOB A;  4QTR A;  4BBR J;  1XTA A;  3ABM H;  4NNJ A;  4RAY A;  5K7Z A;  3F23 A;  1MH4 A;  3NRV A;  1UEL B;  2QKL B;  5EEG A;  3K1P A;  1MMG A;  3ZMT A;  3CJQ B;  4DBR A;  3BT9 A;  2QSF X;  1QVU A;  1IDY A;  2ELJ A;  2L4M A;  3BCA A;  4BXU A;  2CQ7 A;  5H2F C;  4YG2 F;  2CG4 A;  3DKX A;  2E5Z A;  1DGW Y;  1YE9 A;  3I4M J;  3CCM I;  1V55 H;  3FMS A;  1CGP A;  1V54 H;  4EMS A;  2XB0 X;  3VOD A;  3LSR A;  1QNT A;  4I0B A;  1T8I A;  4ZYA A;  1W36 D;  2UV1 A;  1V5G A;  2PJR B;  1WJD A;  3OYB A;  3JTG A;  1ZEL A;  4G7H F;  2VLA A;  1Y8R B;  1SAX A;  1YIJ I;  5D4S A;  2BGC A;  1SFO J;  3FWE A;  1JJ8 C;  3K10 A;  4U0V A;  4BYY A;  3IV5 A;  1ZH5 A;  4CCJ A;  4HOB A;  3S1Q J;  1LEB A;  2CFX A;  3CUQ B;  4BGD A;  2VUM J;  2WV0 A;  1JUP A;  3CDL A;  5GAD J;  2D45 A;  5J1Y A;  1A31 A;  4DIQ A;  3LOC A;  5K1Y A;  4BQQ A;  3KZY A;  1I6H J;  3E3V A;  5HOO A;  4X0G A;  4D1Q A;  4M3B A;  3ZR8 X;  2EIM H;  1B1B A;  5JLX A;  1K4T A;  2ZJP F;  1SD7 A;  3KP4 A;  3MVP A;  3WGG A;  3MKY B;  1HSJ A;  1E3O C;  3A01 A;  5GPC A;  3BJ6 A;  3FHN A;  3S8P A;  4CCM A;  2R7O A;  3CMA I;  2LRD A;  1ZQ3 P;  2MLK A;  4ESJ A;  2XC7 A;  3MFK A;  3T1B A;  4L9N A;  1VQL I;  2H27 A;  3S1M J;  2HDC A;  1J2X A;  1IDZ A;  2CFO A;  4PJ0 C;  3KEY A;  3QPL A;  4XMY A;  2PMU A;  2DT7 B;  4G6D A;  1MBH A;  1D8J A;  2L7Z A;  5DYM A;  1K6Y A;  3KP7 A;  4EJW A;  1H0M A;  1SFU A;  2FML A;  2STW A;  2MD0 A;  2XGC A;  2NVT J;  2XSJ C;  1X2N A;  3H9J A;  1MBF A;  3WTV C;  1PP7 U;  3GZ6 A;  3DPU A;  1S7A A;  3QU6 A;  5E79 C;  1MNE A;  3E6M A;  2QKM B;  4MNU A;  2JA6 J;  2E1M B;  4LB6 B;  1OCZ H;  3H35 A;  5LHH A;  4L9J A;  4HBL A;  2PLY A;  2K4B A;  1FY7 A;  2FBI A;  1IN6 A;  1HXD A;  2ADU A;  2JPB A;  2L7K A;  4E7K A;  3V42 A;  1PDN C;  2MC3 A;  1GV5 A;  1HKQ A;  1JGG A;  4IHV A;  2E71 A;  1SVO A;  4MFE A;  2HQA A;  2NVU B; 
#chains in the Genus database with same CATH homology
 1BI2 A;  4RS8 A;  2ELH A;  3OOP A;  5HDK A;  4HDV A;  4IRG A;  4EQQ A;  4I7H A;  2MH2 A;  2XAS A;  1D3Y A;  5ILV A;  5L3D A;  2E7W A;  3E6B A;  1WWX A;  3LQQ A;  1YS7 A;  3ZN0 A;  2EFN A;  1ZG5 A;  3IWF A;  3QP6 A;  4WXC A;  2W57 A;  4EJT A;  4RGR A;  2ZNY A;  2FNP A;  4LFU A;  1YQA A;  4P5O A;  2LNB A;  4M9X A;  3ML6 A;  3J80 Z;  3K9T A;  1G6N A;  3D5L A;  1DP7 P;  2HKX A;  2IA0 A;  1U2W A;  5IT9 Z;  5D8L B;  3R4K A;  2DPU A;  2L4A A;  1ULY A;  2FE3 A;  3D0S A;  4R8H A;  4OMY A;  4R79 A;  1HST A;  1FP2 A;  4L0Y B;  3Q9V A;  4ESF A;  1TQI A;  2HTS A;  3FM5 A;  4NB5 A;  5D6E A;  1KQ9 A;  2L02 A;  2XAQ A;  4HZF A;  2FOK A;  2Y48 A;  5EEH A;  2LKP A;  1XB4 A;  1GVJ A;  1FNN A;  2CQK A;  3KZZ A;  3JSP A;  3E6C C;  4U0W A;  1JHF A;  1QGP A;  2XV4 S;  5CLS A;  3GVA A;  1YW9 A;  2XRN A;  2AS5 F;  3LA7 A;  4UVA A;  5E18 F;  5ED4 A;  3K0L A;  3KP6 A;  5D4R A;  2DK8 A;  3DFG A;  3DKW A;  3KEQ A;  5LRS A;  2PJP A;  4UNO A;  1IXC A;  2BE5 F;  4BNC A;  3KLN A;  2XKP A;  3L2C A;  4DQ2 A;  2OU2 A;  2XAG A;  5CVR A;  4GYI A;  3PQK A;  2VOP A;  2GIV A;  1HW2 A;  2EFP A;  3HOT A;  3QRF F;  4ZYH A;  2NNY A;  3ISP A;  1EH8 A;  1F5T A;  2ETH A;  3CJN A;  4KMF A;  1F1Z A;  1HBX G;  2FF4 A;  5LGN A;  5LLQ A;  1W5T A;  1WKM A;  3DXJ F;  3RPU A;  3TDU C;  3DEU A;  2W24 A;  4M72 A;  1W7P D;  2XKO A;  5A2Q Z;  4GO1 A;  4HV5 A;  4GYG A;  1XSX A;  1BI3 A;  4L0Z B;  1R23 A;  1RZ4 A;  2PEX A;  4UHT A;  2QQB A;  3WTT C;  1J7K A;  3ZP5 A;  2Z3Y A;  3BDD A;  2JPC A;  3HTU A;  4BHC A;  3FHZ A;  4KT5 C;  4Q4Z F;  3R60 A;  3FMQ A;  3I71 A;  2M45 A;  3N4M A;  1EH6 A;  1NHA A;  4XRF A;  3ABT A;  1BC7 C;  5LEJ A;  4XBF A;  4A6D A;  3BZ6 A;  4EM1 A;  2HKO A;  3BRO A;  5E1W A;  1Z6T A;  2EWN A;  2G7U A;  2KIF A;  2V6C A;  4WCG A;  4XSX F;  5BPI A;  1XGN A;  2QQ9 A;  3J80 K;  2F2E A;  2VC0 A;  2HYF A;  4EJU A;  1I1S A;  1FWZ A;  1J75 A;  3GX4 X;  1ZG1 A;  2O03 A;  5IT9 K;  1TQP A;  3F8N A;  3HRU A;  3V7R A;  4ENJ A;  3HRM A;  1TQM A;  2PMH A;  1YIO A;  4IRH A;  3TO6 A;  3BPV A;  5BQT A;  1R1T A;  3B73 A;  5DCM B;  1LQ1 A;  2A68 F;  3CUO A;  4LD5 A;  1I5Z A;  2WWY A;  2DBB A;  2IRF G;  2V1X A;  3I54 A;  2CGP A;  1QQI A;  2DPD A;  1MD0 A;  2HR3 A;  3E5Q A;  3KP5 A;  1O57 A;  3I58 A;  3V7S A;  2Y0M A;  1P2F A;  4L9V A;  2MBF A;  4OMZ A;  4MEX F;  4LJZ F;  1IRF A;  2NS0 A;  2EA2 A;  3IKV A;  4IXA A;  3MWM A;  4QLC U;  2XVC A;  3GWZ A;  4EGZ A;  5K5O A;  3T8T A;  2OBP A;  2RDP A;  3R61 A;  4HLX A;  4MTE A;  3CDH A;  3M9A A;  3C7J A;  4IJA A;  3O2P E;  5LGT A;  3HUG A;  2M87 A;  1Z1D A;  1R1U A;  2W85 A;  2XRO A;  2O8X A;  2BBY A;  5K5R A;  1XN7 A;  2HWV A;  2NNN A;  1XGS A;  2STT A;  3M1E A;  4ZZD A;  1P6R A;  3COA C;  4M71 A;  1FPQ A;  1BM9 A;  2DAO A;  3QAH A;  3T5X A;  3TGN A;  2AXL A;  2GQQ A;  4NHJ A;  3H92 A;  1SFE A;  1XDU A;  3LFK A;  2K7L A;  1EV7 A;  4KIB A;  3W6K B;  2Z5U A;  2PQ8 A;  3T8R A;  1TBX A;  3CLO A;  4MQV A;  2DQL A;  2EA4 A;  4ZYE A;  3Q5F A;  4ENM A;  3WTZ A;  2TDX A;  1FBQ A;  4RGX A;  2OZU A;  2XGX A;  1ZRE A;  1T0F A;  3VEP A;  1B9M A;  4QWQ A;  4EGY A;  1OR7 A;  2RKH A;  1VTN C;  4Q47 A;  5D5W B;  4M9Z A;  1FZP B;  3MEX A;  1R22 A;  2M30 A;  4Z2Y A;  3RI4 A;  2DFI A;  3VFZ A;  1J9I A;  4JBA A;  2Q0O A;  1H9G A;  1KA8 A;  4AWX B;  4EVI A;  2LF8 A;  1XMK A;  2IPQ X;  3ROU A;  1XD7 A;  4U88 A;  5LBQ A;  4KIF A;  3KCC A;  3NEU A;  3V7C A;  1PUE E;  4KDP A;  1TTY A;  4O6J A;  3L9F A;  4U7B A;  2DT5 A;  4HX8 A;  5LHG A;  2FNA A;  4AIH A;  5ICG A;  2JT1 A;  3E5X A;  2VOO A;  3IRQ A;  4YFX F;  3ZMZ A;  1JHH A;  1FX7 A;  5H20 A;  4ON0 A;  4LB5 A;  4KIG A;  3MCZ A;  3RTR A;  4S04 A;  4U0Y A;  4ZZL A;  3IKT A;  2L3D A;  3TO7 A;  4UV8 A;  4EV0 A;  3F6O A;  5AIP A;  3KP2 A;  1Y0U A;  3DP7 A;  2RV8 A;  1K7A A;  1GXP A;  3ABU A;  3F8M A;  5D5U B;  3LST A;  4M74 A;  2VE8 A;  1R1V A;  1YFH A;  5BS6 A;  2QM3 A;  3P7N A;  5JHU A;  1RNL A;  3GLX A;  4Y15 A;  1W5S A;  1FSH A;  1IN7 A;  1T38 A;  4BHP A;  2W84 A;  3SXY A;  1C0W A;  3WTS C;  1XGO A;  4ASN A;  5D5V B;  2ZKZ A;  2G7H A;  4LMY A;  4HA8 A;  4FX0 A;  1P92 A;  3SZP A;  3J81 K;  5HVQ C;  1X3U A;  4A6E A;  1IN5 A;  2ZNZ A;  4DNC A;  1I6X A;  1IF1 A;  4P9F A;  4MQ9 F;  4CHU A;  2M8E A;  3CUQ A;  1O3S A;  2QZ8 A;  2ESH A;  1K78 B;  1R00 A;  2A61 A;  5J6X A;  4B09 A;  1RUN A;  3L7W A;  4LK1 F;  2PI0 A;  4LLG F;  2E1N A;  1XMA A;  1H9T A;  2KRF A;  4I01 A;  2Z9O A;  4A0X A;  1STZ A;  4EJV A;  2PG4 A;  5F64 A;  1XSV A;  1FP1 D;  4A0Y A;  3W6J B;  2IW5 A;  3F8C A;  1WSU A;  3C3W A;  2EFW A;  3V8K A;  4HYE A;  1GXQ A;  2COM A;  5DEQ A;  4O3M A;  2YPR A;  1ON1 A;  2ESN A;  1LB2 A;  3DF8 A;  4MHG A;  3L09 A;  4OIO F;  2A6H F;  3P9I A;  5BMZ A;  1YS6 A;  2OZ6 A;  3B02 A;  2YSR A;  2KIU A;  1IXR C;  4HF0 A;  2HQN A;  2VOD A;  4L9T A;  2RVC A;  1DPR A;  3H3U A;  2FMY A;  1F4K A;  2XHK A;  1IZ1 A;  2DK5 A;  4ESB A;  5J8F A;  3I5U A;  3O6B B;  2GA1 A;  2RN7 A;  3WU0 A;  5L3F A;  1ZGA A;  4FT8 A;  3TO9 A;  2OA4 A;  3LAJ A;  4YFN F;  4N9I A;  1KU9 A;  1LNW A;  4A5M A;  2OD5 A;  2BEO A;  1W7P B;  2P6S A;  3HSE A;  3I64 A;  3V8J A;  1WI9 A;  2P5K A;  4L5I A;  1LVA A;  2EK5 A;  1U5T A;  3LQR A;  1OKR A;  1XCB A;  3GFI A;  5H6R A;  3SHF A;  4D0P A;  1T2K A;  1KU7 A;  2E7X A;  1B6A A;  3JTH A;  4G94 A;  3FM3 A;  5HS9 A;  4AIK A;  5HDG A;  1UB9 A;  2VT3 A;  2O0Y A;  3K69 A;  1TLH B;  2YX4 A;  5J8C A;  1YO5 C;  3F21 A;  5E17 F;  3BWG A;  3I4P A;  3JSO A;  1LDK B;  1QPM A;  3NQO A;  1OPC A;  1T39 A;  4G7O F;  3FXR A;  2FBK A;  2V9V A;  3I53 A;  1S7O A;  3U2R A;  4I2O A;  2DTR A;  2IJL A;  1U8R A;  2HEO A;  3G3Z A;  5IT3 A;  4I09 A;  2R3S A;  1XDS A;  4WWC A;  1IAW A;  1OYI A;  1ONV A;  2K4J A;  2RNJ A;  2OQR A;  3REO A;  5LHI A;  2ISZ A;  5AON A;  2Z33 A;  1XCV A;  4LLN A;  1D8K A;  3TQN A;  1FYL A;  4HX4 A;  2K86 A;  1BOA A;  2QQA A;  4PGG A;  4ETS A;  4GXO A;  2O3F A;  1J59 A;  4IF4 A;  3WGI A;  2EB7 A;  2CO5 A;  5JR3 A;  1DDN A;  5E8I A;  2JSC A;  1G3T A;  3IWZ A;  2VT2 A;  3HRT A;  4AIJ A;  5F1R A;  5CVU A;  2HYG D;  1SD4 A;  2H6B A;  3R6S A;  1KYZ A;  1QZZ A;  2A3S A;  1ZRF A;  3EQL F;  3F22 A;  1FYK A;  1DPU A;  1FOK A;  3GFJ A;  2IT0 A;  4FHT A;  3ZMU A;  5FLX K;  2V79 A;  2LSO A;  3BJO A;  2BV6 A;  1S6L A;  3SFZ A;  3LWF A;  1BC8 C;  1MJA A;  5ICC A;  4MGR A;  4KFC A;  3HSF A;  4ZH4 F;  5CYV A;  4HQE A;  1MDM A;  2HQR A;  3JW4 A;  2FQ3 A;  3ZQ7 A;  2FSW A;  1SFX A;  4AVP A;  1WRJ A;  3HHG A;  4KYW A;  1FBS A;  1R58 A;  4HF2 A;  4HAM A;  5D5X B;  3U1D A;  5L3C A;  4IHS A;  3U9G A;  4MTD A;  2P5L C;  1Z91 A;  2RQP A;  2XUB A;  3RIR A;  5CVV A;  4KUM A;  1EH7 A;  2LDU A;  4N0B A;  3CUQ C;  1TNT A;  3F8F A;  2DLL A;  1BI0 A;  1O7L A;  4K2E A;  1O3R A;  2Q2E A;  2HGC A;  2EV6 A;  3HYI A;  2XAJ A;  3F8B A;  1MKM A;  3KEO A;  1SMY F;  2FEZ A;  3C1D A;  2VBW A;  3LA2 A;  5E1X A;  3HTS B;  1UST A;  3GFL A;  1KQ8 A;  2VBZ A;  4UUV A;  2VBY A;  1O3T A;  3BJA A;  2GXB A;  2W25 A;  3I59 B;  1B9N A;  1BN5 A;  4G8X A;  2QVO A;  2QBY A;  4XLP F;  4RB3 C;  3J81 Z;  4LLL A;  1SD6 A;  5CJ9 A;  3K1M A;  2ZME A;  1IUY A;  1ZG3 A;  4KIC A;  5LEK A;  4A5N A;  1HW1 A;  2GAU A;  3ELK A;  2FBH A;  1FSE A;  3GF2 A;  2KJC A;  3CO7 C;  5LRR A;  4GGG A;  2FU4 A;  2L01 A;  5DCM A;  1IN4 A;  2VXZ A;  1MZB A;  3KP3 A;  4OIR F;  3WOD F;  1ZN2 A;  2H09 A;  4M6Y A;  2QLZ A;  2M1B A;  2EJR A;  5E1Z B;  1TNS A;  4HW0 A;  4N9H A;  4OIP F;  4EM0 B;  5L3E A;  1RUO A;  2Z99 A;  1E2X A;  5KK1 A;  5D8K B;  3DPL C;  1KU2 A;  3RYP A;  2XAF A;  2V1D A;  4I02 A;  3IRR A;  4MEY F;  1TW3 A;  2FA5 A;  5FFZ A;  4IRI A;  3RDI A;  1IN8 A;  1D5V A;  2MD5 A;  5FD5 A;  1ZLK A;  3GFM A;  4A0Z A;  4PCQ A;  1U5T C;  1PP8 F;  3T0Y A;  5ERI A;  1MJ9 A;  2DQR A;  3IHU A;  3RPQ A;  4YIF A;  3J7A O;  1I27 A;  2L54 A;  2UWM A;  2Y75 A;  2P8T A;  2ZFW A;  2GXG A;  1AWC A;  1LJ9 A;  1BBY A;  2H94 A;  3DPT A;  1KU3 A;  4Y17 A;  3ZMV A;  5ICE A;  3WTX C;  1LEA A;  5DUI A;  2C6Y A;  2RGV A;  4M73 A;  1YYV A;  4R1H A;  1G3W A;  1L0O C;  5DV5 A;  1Z9C A;  1ZHF A;  4AD9 A;  5FO5 A;  1CF7 A;  4P55 A;  4U7D A;  3G73 A;  1WQ2 A;  4G6Q A;  3WTY C;  5FD6 A;  2DI3 A;  4S05 A;  2D1H A;  2KIM A;  1BI1 A;  5E8G A;  2XIG A;  1O7F A;  2PBI A;  1W4M A;  1U78 A;  2JRT A;  4JQF A;  1AOY A;  4OOI A;  3V4G A;  1Z05 A;  3AAF A;  4OIN F;  3LAP A;  3PQJ A;  2NYX A;  1LDD A;  3EYI A;  3RJP A;  2EV0 A;  1FBU A;  3KE2 A;  2RC4 A;  2NAZ A;  1XSD A;  2J5P A;  4CDG A;  1R36 A;  4IHT A;  1REP C;  3ECH A;  5L3G A;  3H3Z A;  3L00 A;  4RB2 C;  4KN4 X;  3KET A;  3GO5 A;  3E5U A;  2VE9 A;  3GEZ A;  4EM2 A;  3F3X A;  2YU3 A;  2P6T A;  4M9S A;  4LG0 A;  1FC3 A;  3M8E A;  1ZRD A;  4ENN A;  3BPX A;  3RKX A;  1S29 A;  2DU9 A;  2FXA A;  3WE3 A;  2CW0 F;  4LK0 F;  3M8F A;  3K2Z A;  2DW4 A;  3E6D A;  2V1U A;  6PAX A;  1S3J A;  2OQG A;  3ECO A;  1USS A;  3QP5 A;  5HS8 A;  5BPD A;  3RKW A;  1KGS A;  3ZMD A;  5TJJ A;  2D2W A;  2M5W A;  3MQ0 A;  4F7Z A;  5TRD A;  5ILS A;  1FYM A;  2O61 A;  4WXH A;  1TW2 A;  3EUH A;  3ZPL A;  1Q1H A;  2H6C A;  2R7D A;  3SQN A;  1JXS A;  4PDK A;  2F5C A;  1IW7 F;  5HLI A;  2CSO A;  3MAJ A;  5FLX Z;  2VN2 A;  2GWR A;  2PN6 A;  4XLN F;  3RYR A;  2ZXJ A;  4XSZ F;  5DD8 A;  3P9C A;  2P7V B;  3WGH A;  5DCF A;  2WC2 A;  3OV8 A;  2HOE A;  3JAM Z;  4G9Y A;  4JK1 X;  3QPH A;  3MZH A;  5FGM A;  3HIF A;  3GZ5 A;  2B0L A;  2X4H A;  3PFI A;  2ZBK A;  2QEN A;  2F5D A;  4WXD A;  4HQM A;  5DDG A;  4IPA A;  3P9K A;  1U5T B;  1HKS A;  3BOQ A;  2WTE A;  3FMR A;  4YII A;  1K78 A;  2BYV E;  2JTV A;  1J5Y A;  4P96 A;  1ZRC A;  4RB0 A;  2IVM A;  5FB2 A;  3ZN1 A;  3DV8 A;  4HV6 A;  3RKY A;  2VBX A;  2GZW A;  5DUK A;  4PGH A;  3QU3 A;  4OU0 A;  5ILU A;  1OMI A;  2R7F A;  1QZY A;  5JI6 A;  1YW7 A;  1UHM A;  2VC1 A;  1V4R A;  3TDZ C;  5LGU A;  4NQW A;  3FXU A;  2P4W A;  1ZAR A;  2MA3 A;  4A2U A;  3QPT A;  2CYY A;  1T6S A;  3EET A;  3WE2 A;  3KLO A;  1OYW A;  4OIQ F;  1KQ0 A;  1YLF A;  1P4A A;  1OYY A;  1FT9 A;  2EFQ A;  2A07 F;  2ZCW A;  1R5H A;  1I1G A;  5CVI A;  4KNY A;  3EDP A;  2CWE A;  4O5V A;  5CVJ A;  1K79 A;  4CGZ A;  3DQV C;  2OAZ A;  1W7P A;  3QOP A;  3HOS A;  1HQC A;  1HW5 A;  4RAZ A;  2IA2 A;  5JFR A;  3TOA A;  4BQA A;  2HFH A;  4HLY A;  1GHC A;  1ZLJ A;  1LDJ A;  2DO7 A;  1YTY A;  2QWW A;  5HLH A;  1RI7 A;  2XAH A;  1SD5 A;  1MDM B;  2K02 A;  2UXX A;  4H0E A;  2EV5 A;  2FRH A;  2NRA C;  2YX7 A;  1RIO H;  5AIQ A;  3ERE D;  3ULQ B;  1R7J A;  2F5E A;  3WG9 A;  1HKT A;  5D6F A;  5HDN A;  1B59 A;  3E97 A;  4EJO A;  3IL2 A;  3LA3 A;  2HZT A;  3IC7 A;  4M6X A;  4ZYD A;  1XGM A;  2QUF A;  5HLG A;  4I0A A;  5F6F A;  1O3Q A;  1ZAO A;  1J0R A;  4BHB A;  1R5G A;  3JAM K;  4B8X A;  2MLG A;  1YG2 A;  3C18 A;  3CTA A;  1DUX C;  1T98 A;  3CO6 C;  1F9N A;  4ENK A;  4CZZ A;  4L5J A;  4LGW A;  4GCV A;  3GUD A;  3BY6 A;  3FX3 A;  4ZYG A;  2IA1 A;  3EYY A;  2VON A;  2K27 A;  5KVR A;  2Q8K A;  1G3Y A;  1U6G A;  1G4D A;  4A12 A;  2QBY B;  4HDU A;  3WU1 B;  2KJB A;  4Q48 A;  1K6O A;  1P4W A;  4P9U A;  1P4X A;  2ZME B;  4UVB A;  1QBJ A;  4UV9 A;  1MGT A;  2KKO A;  3BP8 A;  1IRG A;  2ACJ A;  1FLI A;  3S2W A;  1YW8 A;  1QO0 D;  5HS7 A;  2QYO A;  3GYH X;  1BJA A;  1U3E M;  2O6G E;  2ISY A;  3F72 A;  4FX4 A;  2UZK A;  4YFK F;  4KN7 X;  5FFX A;  2PFB A;  2P7C B;  3VB2 A;  1ODD A;  4CYD A;  1JGS A;  4BH9 A;  3ZMS A;  4RB1 A;  3KFW X;  2F5F A;  3VOE A;  2UXN A;  2D1V A;  4L18 B;  4BAY A;  2ZJ2 A;  4UVC A;  3FZV A;  1E17 A;  4IVN A;  2HTJ A;  3GXO A;  4WF2 A;  4TV7 A;  2GA2 A;  4I98 B;  4CXF A;  2P5V A;  2MH9 A;  3HRS A;  3HSR A;  2E1C A;  1ZYR F;  2A5Y B;  1Z7U A;  4CO8 A;  4PZJ A;  2JZY A;  4E70 A;  5H6Q A;  2A6E F;  1BIA A;  1CF7 B;  3GW2 A;  1ON2 A;  3I59 A;  3SZT A;  1IXS B;  1V3F A;  4CIC A;  5K5Q A;  4WX9 A;  3Q9S A;  1Z6R A;  3WTU C;  3K1N A;  3HHH A;  1ZGJ A;  2X0L A;  4G7Z F;  1L3L A;  4UXN A;  2IP2 A;  3F6V A;  3V8L A;  5A2Q K;  2G9W A;  3FF5 A;  4HX7 A;  5E20 A;  1UHW A;  5BOX A;  2ZO4 A;  1UCR A;  1UFM A;  3R0A A;  1JE8 A;  5ICF A;  4HF1 A;  1BIB A;  2HS5 A;  4Y13 A;  2A69 F;  2J5O A;  1SMT A;  5JVT A;  4RGU A;  1MJB A;  1G3S A;  3O3K A;  2YR2 A;  3TKY A;  3I0T A;  3FXQ A;  1KYW A;  3R0J A;  1B4A A;  4RGS A;  2LF7 A;  4LG0 B;  1S8N A;  4WK8 F;  3N97 A;  3WTW C;  3MZY A;  3M7G A;  1A04 A;  2EFO A;  5L3B A;  4KMU X;  5DD4 A;  4KA4 A;  4Q5S F;  3TOB A;  4RAY A;  3F23 A;  3NRV A;  5EEG A;  3K1P A;  3ZMT A;  2L4M A;  4BXU A;  4YG2 F;  2CG4 A;  3FMS A;  1CGP A;  4EMS A;  3VOD A;  1QNT A;  4I0B A;  3JTG A;  4G7H F;  1SAX A;  5D4S A;  2BGC A;  3FWE A;  4BYY A;  4U0V A;  1ZH5 A;  4HOB A;  1LEB A;  2CFX A;  3CUQ B;  2WV0 A;  2D45 A;  5K1Y A;  3KZY A;  3E3V A;  5HOO A;  1B1B A;  1SD7 A;  3KP4 A;  3WGG A;  1HSJ A;  3BJ6 A;  2MLK A;  4ESJ A;  2H27 A;  3MFK A;  3T1B A;  4L9N A;  2HDC A;  1J2X A;  2PMU A;  4G6D A;  1D8J A;  5DYM A;  3KP7 A;  4EJW A;  1H0M A;  1SFU A;  2FML A;  2STW A;  3WTV C;  1PP7 U;  3GZ6 A;  1S7A A;  3QU6 A;  3E6M A;  4MNU A;  4LB6 B;  5LHH A;  4L9J A;  4HBL A;  2PLY A;  2K4B A;  1FY7 A;  2FBI A;  1IN6 A;  1HXD A;  2ADU A;  2JPB A;  1PDN C;  2MC3 A;  1HKQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...