1REPC

Crystal structure of replication initiator protein repe54 of mini-f plasmid complexed with an iteron dna
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
232
structure length
214
Chain Sequence
SPRIVQSNDLTEAAYSLSRDQKRMLYLFVDQIRKSHDGICEIHVAKYAEIFGLTSAEASKDIRQALKSFAGKEVVFYESFPWFIKPAHSPSRGLYSVHINPYLIPFFIGLQNRFTQFRLSETKEITNPYAMRLYESLCQYRKPDGSGIVSLKIDWIIERYQLPQSYQRMPDFRRRFLQVCVNEINSRTPMRLSYIEKKKGRQTTHIVFSFRDIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Replication/dna
molecule keywords DNA (5'-D(*CP*CP*TP*GP*TP*GP*AP*CP*AP*AP*AP*TP*TP*GP*CP*CP*C
publication title Crystal structure of a prokaryotic replication initiator protein bound to DNA at 2.6 A resolution.
pubmed doi rcsb
source organism Escherichia coli
total genus 62
structure length 214
sequence length 232
ec nomenclature
pdb deposition date 1999-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01051 Rep_3 Initiator Replication protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1repC02
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1repC01
2M45A 4LLGF 3FXRA 1EH6A 2VBZA 5ICCA 1KU7A 4ZH4F 5D4SA 2GQQA 4MHGA 3C18A 4EJVA 4ZYGA 2K4BA 3JSPA 5DUKA 1D3YA 2QWWA 5TJJA 1OYIA 2KRFA 4EJUA 2A6EF 1ULYA 1TLHB 2P6TA 3R0AA 4P9FA 3RKYA 1FBUA 3L9FA 4A6EA 1WWXA 5K5QA 5AIQA 4UUVA 5D8KB 1NHAA 5HLHA 3HSRA 5L3FA 2VODA 3HSEA 3HRSA 1IAWA 2JTVA 5DDGA 2GXBA 4RGSA 4IPAA 2JRTA 5CYVA 6PAXA 3HRTA 2B0LA 2GIVA 2DT5A 5JI6A 3KCCA 1IN4A 2FQ3A 2EK5A 5DYMA 4H0EA 2A5YB 1YG2A 2ZJ2A 1RIOH 1I27A 3J81Z 3F8NA 1DDNA 4Z2YA 2VC1A 3K69A 1F5TA 4I2OA 4HX7A 2V1XA 1WSUA 4U7BA 2BV6A 2DFIA 3WG9A 1S3JA 2A69F 3V7RA 2F5CA 5H20A 1JE8A 2HS5A 3F3XA 1BN5A 4P96A 3GO5A 4EGZA 4R8HA 3PQJA 3I71A 2XKPA 3BPVA 4G6DA 3WTTC 2P5VA 5BS6A 4RB0A 3T0YA 1EH7A 2GWRA 4KYWA 5KK1A 3HOTA 1KU2A 4UNOA 2CSOA 2XKOA 3W6JB 1ZYRF 1T98A 1FC3A 2J5OA 4L18B 1BOAA 5HVQC 1V3FA 4RGUA 3WU0A 4AD9A 4RB1A 1Z6RA 4I09A 4XBFA 3I54A 1JHFA 3RPQA 4LFUA 4LK0F 2XAHA 3I64A 1BJAA 2RKHA 5ICFA 1ZG1A 2XV4S 4G9YA 4CYDA 5D5WB 4RS8A 1OYWA 2HGCA 3W6KB 2HOEA 2DTRA 2NYXA 1QO0D 1CF7B 5L3EA 1R5GA 2GAUA 3CLOA 4A5NA 3I59A 5E18F 1RUNA 5KVRA 3KE2A 2VXZA 1HSJA 3QAHA 1DPUA 4RAYA 4ZYEA 1YS7A 2P5KA 4OMZA 5LHHA 1KA8A 4D0PA 2QQBA 1BC8C 4M73A 4A2UA 2PG4A 4WK8F 2W85A 5D4RA 1R22A 3ZMZA 3GVAA 1Z1DA 3KZZA 1P2FA 5LHIA 1T2KA 1HSTA 3KLOA 4KA4A 4LGWA 4WX9A 1SD5A 2E7XA 4KIGA 2EWNA 3REOA 2VT3A 1D8KA 1O3RA 1TQMA 3R4KA 1ON1A 3WGHA 2EV5A 3ROUA 4BQAA 4YFNF 3KLNA 1K6OA 4I01A 2YPRA 5LEJA 2AXLA 3QOPA 4UXNA 1LDDA 4O3MA 1R23A 3KFWX 3Q9SA 3BOQA 2PI0A 2QQ9A 2FMYA 4HV5A 1OPCA 1IN7A 3K0LA 5LGTA 4ASNA 4JK1X 4HDUA 2FE3A 3GWZA 2M87A 2L4MA 2NS0A 1IRGA 3LQQA 4OIPF 4A5MA 1G3YA 2ISZA 1IXSB 3LAJA 2Z33A 1XMAA 4HQMA 3CUOA 3H92A 2Q0OA 3E5XA 3IKVA 5DCMB 4R79A 4CICA 4GXOA 2X4HA 1MD0A 2BBYA 4L9JA 1BI0A 4IVNA 2WTEA 2ZCWA 3MQ0A 3HOSA 4XSZF 4ZYHA 3DXJF 1MJAA 5AIPA 5IT9K 3MZHA 1I1SA 4G6QA 4O6JA 4UVBA 2P7VB 1U8RA 1SD6A 2A6HF 1ZRCA 3GEZA 3GZ6A 3BZ6A 3G73A 4XRFA 1BI2A 2ETHA 1P6RA 2PLYA 2BGCA 2VT2A 2CW0F 2FBIA 5DUIA 3LSTA 4S04A 4G7OF 1S7OA 1JHHA 3L09A 2FBKA 3PQKA 3GF2A 1QBJA 3ECOA 1YYVA 1GXPA 4KN4X 3ML6A 2CFXA 1U3EM 3E97A 1HKQA 3DPLC 1L0OC 3WODF 3QPTA 3DFGA 2FNAA 3WE3A 4ENJA 3HTUA 1QGPA 3KP3A 5A2QZ 4Y13A 2XAFA 1REPC 1LQ1A 5ILUA 3CDHA 4IXAA 3V8JA 2OD5A 5E1XA 1F1ZA 2ZNZA 1FX7A 4S05A 2DK8A 2Q2EA 5K5RA 4ESBA 2E7WA 3ELKA 1Z9CA 4IRIA 3S2WA 3ECHA 1XDUA 1AOYA 5FLXZ 1O57A 3NRVA 4HLXA 3GW2A 1HW5A 2HR3A 1XCVA 5L3DA 2IPQX 1R1VA 1U5TA 4EM1A 1FYLA 4L9TA 4DNCA 4PDKA 1E2XA 4I02A 2F5EA 5EEHA 3IWFA 4HV6A 3ZMVA 3O3KA 2PMHA 3O2PE 1MKMA 5IT9Z 1IXCA 1OR7A 3WGGA 4FHTA 2KIFA 2VE8A 5FFXA 1B4AA 2UXXA 3KZYA 4QLCU 4EQQA 2L3DA 4YIFA 3F72A 4UVCA 1QPMA 1SMTA 3BJOA 3T8RA 4U88A 4OMYA 2HKXA 4M9ZA 1ODDA 3R60A 3ABUA 1L3LA 2E1NA 4KT5C 3ZMTA 1YIOA 1FSEA 4OIOF 1Z05A 4ZZDA 3CO7C 1MDMA 2FMLA 2EFOA 5LLQA 3SXYA 3B73A 1YTYA 3K1MA 3FM5A 1ZG3A 2A07F 3M8EA 1TNTA 2IP2A 5E1WA 2XHKA 3GLXA 3TO6A 3AAFA 1IF1A 2JT1A 5BOXA 5FGMA 5F1RA 3M1EA 4EVIA 1XCBA 3EYIA 1HW2A 2QM3A 1SD4A 2Y0MA 1B9MA 1P4XA 3RYPA 5K5OA 1LDJA 4L9NA 3KP2A 3CO6C 3JSOA 5D5VB 1JGSA 1LVAA 3DF8A 3DP7A 5ICEA 3BJAA 4YFXF 3FWEA 5LRSA 4A6DA 3D5LA 4HZFA 2OBPA 1MJBA 4M9SA 3RTRA 2AS5F 4EM2A 3HIFA 2QBYB 2HWVA 4GYIA 3ZQ7A 1G6NA 4LG0A 2H6BA 1SAXA 4HW0A 3FF5A 1B6AA 1SFXA 4RAZA 4IHTA 3E6DA 2VBWA 3HHHA 2DPDA 2MH2A 1FBQA 3ERED 1RUOA 2EFWA 2NNYA 3CTAA 2K86A 2MLKA 1TTYA 1USSA 3VEPA 1IRFA 2P5LC 4CHUA 3F8FA 4A12A 3C7JA 3FHZA 1KQ9A 3E6BA 2LF7A 4XSXF 4LMYA 4GCVA 3CUQA 2UZKA 5CVJA 5J6XA 2ESHA 4YG2F 2ACJA 3V7CA 1A04A 5JHUA 1U5TC 5H6QA 4RGXA 1S7AA 1LDKB 2CYYA 1EV7A 1WKMA 3RJPA 4BAYA 2C6YA 2HQNA 5L3BA 3LAPA 5L3GA 3F6VA 3DPTA 3V8LA 3E6MA 5HS8A 4P9UA 4U0YA 3V8KA 3IKTA 1K78A 3GYHX 2ZMEA 1BBYA 2K7LA 3OV8A 1S6LA 1I6XA 2YR2A 5HDKA 1KGSA 2FEZA 4I0AA 3E5QA 1FY7A 2A61A 3F23A 3FXQA 4PGGA 2DW4A 1PP8F 3GXOA 3EYYA 3Q9VA 2EFQA 1K7AA 4HF1A 2RV8A 3F22A 1U6GA 2VBYA 3I58A 4IF4A 4IJAA 2KIMA 4EV0A 2Y75A 1S29A 1R7JA 1XGNA 5LGUA 4Q5SF 1XGOA 1FYKA 2ZKZA 4WCGA 1LJ9A 2L4AA 5D6EA 1O3QA 5FO5A 3JW4A 1H9GA 5L3CA 3WTVC 1LNWA 1W7PD 3DV8A 1UHWA 1EH8A 2QLZA 3RIRA 2V6CA 4CGZA 4BNCA 2EA4A 3WTUC 1ZGAA 3F8MA 2DI3A 2BEOA 4M6XA 1B9NA 1GVJA 5FFZA 3O6BB 4OINF 1TQIA 2EFPA 2QQAA 2ESNA 4MTEA 3HSFA 5D8LB 5TRDA 1W7PA 2P4WA 2EJRA 1IN8A 3TKYA 4U7DA 1ZREA 2O0YA 5CVIA 4LD5A 3J80K 1WRJA 2O8XA 3ZMUA 2GZWA 2Y48A 2ZNYA 2MH9A 4HF0A 5DD8A 1ZH5A 5HLIA 4GO1A 3GX4X 5ERIA 2V1DA 1BIBA 3TDZC 4G8XA 3KP5A 3EETA 2W57A 5E20A 2UXNA 3GUDA 4UV9A 4HOBA 4IHSA 2WV0A 4BXUA 1XSDA 2YX7A 2QVOA 2OQRA 3IHUA 3IC7A 5FB2A 4IRHA 3F8CA 3I0TA 3SFZA 4A0XA 2D1VA 5E8GA 1KQ8A 2OA4A 2ISYA 2Z99A 4ENNA 2L01A 4N9HA 3KP4A 3V4GA 3E6CC 1FP2A 2LF8A 1ON2A 5AONA 2OQGA 4ZYDA 3WTYC 2RC4A 3HUGA 2V9VA 3IRRA 3VB2A 4Q48A 4FT8A 3R6SA 3WTSC 4JQFA 2H6CA 2CG4A 3I53A 1UCRA 2BE5F 1J59A 2MA3A 4MEYF 1YLFA 2LKPA 2A68F 2HTSA 2VC0A 5LGNA 2D1HA 3P7NA 3ABTA 3TOBA 2NRAC 4OIQF 3M9AA 2IVMA 2F2EA 1XD7A 2M5WA 4L5IA 5BPIA 1TW2A 2LNBA 2OU2A 3KP6A 1Z6TA 3HHGA 3QP5A 4ESFA 2EV0A 4I0BA 3KEQA 3J80Z 2O03A 2DAOA 1ZHFA 3QPHA 4M9XA 1AWCA 3VOEA 2MBFA 4WXHA 4L0ZB 2L54A 3LA2A 1ZARA 4BYYA 4KNYA 1SMYF 1U2WA 3MAJA 2GXGA 1T0FA 5EEGA 2G9WA 1MGTA 1YW9A 3FMRA 2FBHA 2P7CB 1JXSA 3ZMDA 2HTJA 3WTWC 4AIJA 4M6YA 4ESJA 5BQTA 2EB7A 1S8NA 4MEXF 3P9IA 1YW8A 2JPCA 2W24A 2R7DA 3N4MA 1TQPA 3EQLF 4NB5A 5JFRA 1QZYA 4HAMA 4B8XA 2WC2A 4PZJA 1H0MA 2KIUA 3I59B 1O7FA 4U0WA 1W5SA 4PGHA 2G7UA 1FBSA 5CVRA 1CF7A 2FXAA 2RNJA 1XN7A 2HFHA 2CQKA 5HS9A 1UFMA 3DQVC 2W84A 1XB4A 3MEXA 5J8FA 2CO5A 3DKWA 3K1NA 4LLNA 3FMQA 2PN6A 3VODA 2RN7A 3FZVA 2PFBA 1G3WA 3B02A 4HYEA 3RYRA 3HYIA 1R58A 2PMUA 3BWGA 1GXQA 1MJ9A 3N97A 2RQPA 2FU4A 3U1DA 2NNNA 1ONVA 2ELHA 3JAMK 3QU3A 3GFIA 3COAC 5J8CA 2JSCA 3JTHA 4HF2A 2YU3A 3K1PA 3U2RA 4CDGA 2DQRA 3BJ6A 1W4MA 4WF2A 4WWCA 4HLYA 2H09A 3WE2A 4ETSA 5JVTA 4M71A 4EJTA 4BHCA 4QWQA 4NQWA 4HQEA 2IJLA 3TGNA 1I5ZA 5HS7A 3RKXA 3WGIA 1KU9A 1ZGJA 4LB6B 3KP7A 5LHGA 4BHPA 1WI9A 2Z9OA 3T1BA 3GFJA 3QP6A 5DD4A 2O3FA 3ISPA 3SZTA 2O61A 1XMKA 1ZAOA 3IL2A 1KQ0A 3I5UA 2IT0A 2OAZA 3U9GA 4MNUA 4UV8A 3MFKA 1Q1HA 1F9NA 3T8TA 4M74A 3GFMA 2ZO4A 1ZLKA 5FD5A 1RZ4A 4OIRF 5F6FA 3HRMA 1J5YA 1KYWA 4CZZA 5BPDA 3NEUA 2KJBA 1T6SA 2YX4A 4OOIA 3ZP5A 3H3UA 3C3WA 1TW3A 1O3SA 5E1ZB 4YFKF 3G3ZA 2M8EA 1IN5A 2QENA 2P8TA 2VN2A 1SFUA 5CVUA 4E70A 1OKRA 2M30A 1HKTA 1R36A 1XDSA 5CLSA 2IA2A 2ZBKA 2L02A 2JPBA 3FM3A 1O7LA 3E3VA 5DCMA 2MLGA 5LEKA 2G7HA 2D2WA 2LSOA 4BH9A 1B59A 1YO5C 3L00A 1LB2A 2FNPA 1W5TA 4G7ZF 4TV7A 3JAMZ 1PP7U 2ZXJA 3CJNA 2HKOA 1CGPA 4HDVA 4KFCA 1H9TA 1P4AA 2O6GE 2J5PA 2Z5UA 2PQ8A 4N0BA 4KN7X 4Y17A 4HA8A 1GHCA 2XUBA 4FX4A 3M8FA 3BROA 5FD6A 5DEQA 2HZTA 3J7AO 2RVCA 1KYZA 1YS6A 2IA0A 1XGMA 5D5UB 2V79A 2A3SA 4A0ZA 2PEXA 1T39A 3WTXC 2HQRA 2DBBA 1FOKA 1HW1A 1P4WA 5DCFA 1YFHA 4EMSA 4Q47A 2XASA 1BIAA 4G94A 1X3UA 1J7KA 3MCZA 1MZBA 1O3TA 1TNSA 2FRHA 2D45A 4O5VA 1IN6A 1FYMA 2VONA 4WXDA 1IZ1A 2STTA 4FX0A 5H6RA 3JTGA 4K2EA 3M7GA 2KJCA 3P9CA 5D5XB 1U5TB 4DQ2A 2PBIA 1QQIA 5HDGA 1DP7P 4EGYA 4MTDA 2K4JA 1Z7UA 1UB9A 1XSVA 2YSRA 2F5DA 2ADUA 3IRQA 1ZLJA 1HKSA 3GFLA 3RI4A 4N9IA 4LK1F 4MQVA 1RI7A 2IA1A 1D5VA 1HQCA 5LBQA 3ZN1A 1DUXC 1YW7A 4EM0B 2M1BA 1USTA 3RPUA 2DPUA 4KMFA 2UWMA 3SQNA 1G3TA 2QYOA 4YIIA 1FPQA 1MDMB 3WU1B 1VTNC 3ZN0A 1BI1A 4CO8A 5ED4A 2KKOA 2P6SA 2IW5A 1PDNC 3K9TA 1OYYA 4KIBA 1FP1D 2VOOA 5LRRA 4LB5A 4G7HF 1XGSA 4I7HA 2QUFA 4CXFA 1HXDA 4JBAA 4WXCA 1K79A 3QRFF 3L2CA 4Y15A 5IT3A 3RDIA 4KIFA 5BMZA 4AIHA 4MQ9F 5ILVA 3EDPA 1G4DA 4GGGA 1RNLA 3V7SA 5E17F 3P9KA 2IRFG 2XVCA 3BDDA 1QNTA 3L7WA 3MZYA 2EFNA 4OU0A 4Q4ZF 4RGRA 4XLNF 3CUQC 3SHFA 3ULQB 3C1DA 4U0VA 5ICGA 1J9IA 3MWMA 1C0WA 2CGPA 1DPRA 3D0SA 4NHJA 4AWXB 4P55A 3EUHA 3F21A 1BI3A 5A2QK 1IW7F 2DQLA 4L9VA 5K1YA 4RB3C 3FXUA 4KICA 1WQ2A 2V1UA 2QZ8A 4LG0B 1TBXA 3TO7A 4XLPF 2FOKA 2K02A 3K2ZA 1QZZA 2HDCA 2PJPA 2H94A 1FSHA 2R3SA 1LEBA 4P5OA 5CVVA 2QBYA 3FX3A 3LA7A 1PUEE 5FLXK 2DK5A 4ENMA 1J75A 1SFEA 4ENKA 3BY6A 3HTSB 2Q8KA 1BM9A 2WWYA 5HDNA 4KMUX 2OZUA 1E17A 3KETA 4LJZF 3ZPLA 5E8IA 4BHBA 3PFIA 2HEOA 1R1TA 2FSWA 5JR3A 3CUQB 2XRNA 3TDUC 3I4PA 1BC7C 1SD7A 2FA5A 3LA3A 2EA2A 2XAQA 1XSXA 1ZRDA 4KDPA 1YQAA 3RKWA 5D6FA 4AIKA 1FT9A 3TO9A 3DEUA 3F6OA 3Q5FA 1FZPB 3H3ZA 4L5JA 2LDUA 3F8BA 1FLIA 4AVPA 2VBXA 2CWEA 1IUYA 3LFKA 2DLLA 4I98B 5DV5A 2K27A 1OMIA 1F4KA 4ZZLA 3VFZA 2R7FA 2ZFWA 1K78B 3E5UA 4UHTA 2ZMEB 3R0JA 2VE9A 4EJWA 2XAJA 2X0LA 1U78A 1IXRC 4R1HA 2E1CA 1ZN2A 1KU3A 2RDPA 2TDXA 5HLGA 3BPXA 2FF4A 4HX4A 3R61A 2Z3YA 2COMA 2GA2A 2XIGA 3NQOA 4F7ZA 3ZMSA 3KEOA 4A0YA 4MGRA 4HX8A 2NAZA 3QU6A 2DO7A 2XAGA 2GA1A 2W25A 3SZPA 5CJ9A 1Z91A 4GYGA 3WTZA 1T38A 2RGVA 3LQRA 1ZRFA 1R00A 1P92A 2F5FA 1D8JA 2XGXA 3FMSA 4UVAA 4ON0A 1G3SA 3HRUA 5F64A 1R5HA 5ILSA 1Y0UA 1I1GA 1HBXG 4M72A 3T5XA 1UHMA 2XROA 2HYFA 1R1UA 4LLLA 4HBLA 1J0RA 3J81K 4L0YB 5HOOA 1FWZA 1J2XA 4B09A 3LWFA 4PCQA 2OZ6A 1W7PB 3OOPA 2MD5A 1STZA 4KUMA 2EV6A 3TOAA 2STWA 1ZG5A 1V4RA 2VOPA 2DU9A 2H27A 4RB2C 2BYVE 4IRGA 2JZYA 1B1BA 3BP8A 3GZ5A 2HYGD 1FNNA 3TQNA 3IWZA 1LEAA 4EJOA 2MC3A
chains in the Genus database with same CATH superfamily
3CCMI 2M45A 2O8KA 4LLGF 1ZGWA 3FXRA 1EH6A 3CCUI 2VBZA 5ICCA 5IP9J 1KU7A 4ZH4F 2GOMA 2O7OA 2K9LA 5D4SA 4UB8C 2L5QA 2GQQA 3CD6I 1BL0A 4MHGA 2CW8A 4AYBA 3C18A 3OWTA 4EJVA 4ZYGA 2K4BA 2CQNA 2VL8A 1VQNI 3JSPA 5DUKA 1D3YA 2OC6A 2QWWA 2Y31A 5CQGA 5TJJA 1OYIA 2KRFA 4EJUA 2FD5A 2A6EF 2X6OA 2CQ7A 1ULYA 1TLHB 2P6TA 3R0AA 4P9FA 3RKYA 1FBUA 3PO3J 3L9FA 2VJIA 4A6EA 1WWXA 1LFUP 5K5QA 3HUGB 3G2BA 3PUBA 5AIQA 5D8KB 4UUVA 1NHAA 5HLHA 3HSRA 3HGYA 2DA3A 4AVZA 5L3FA 4RLQA 2VODA 2HXOA 2L7FP 1WJCA 1JJ8C 3SYTA 5C4XJ 5J4YA 3HSEA 3HRSA 1IAWA 2JTVA 2JA6J 5DDGA 3QQAA 3PIPF 2GXBA 3GTLJ 4RGSA 4IPAA 5GPCA 2KT0A 2JRTA 5CYVA 1JKRC 6PAXA 2M34A 2K3FA 3HRTA 4KT6A 2B0LA 3K4CA 4LIVA 2GIVA 2VQHA 5FKLA 2DT5A 1RR7A 5JI6A 3K4NA 3KCCA 5E3NA 1IN4A 4C2TA 2FQ3A 2EK5A 5DYMA 4H0EA 2A5YB 1YG2A 5J40A 2LY2A 2ZJ2A 2K40A 1RIOH 4I76A 1HDDC 1I27A 3LSGA 3J81Z 3JRBA 4F55A 5F08A 3F8NA 2KPMA 3FBIB 1DDNA 1Y1VJ 3AG3H 4Z2YA 2VC1A 2KZVA 3K69A 1F5TA 4I2OA 4HX7A 1A31A 1IDYA 2V1XA 1WSUA 3S1MJ 1YX5A 4ABZA 1RKTA 3FBNB 2OJED 4U7BA 3CCJI 4A3IJ 2BV6A 1MSFC 3FISA 2DFIA 3WG9A 1S3JA 4D9JA 2A69F 3BG3A 3V7RA 3A0BC 2X6XA 2F5CA 2CFOA 5H20A 1JE8A 5M5WJ 2HS5A 4BY7J 4BE2A 2ELKA 2EZKA 3F3XA 4CCMA 5GADJ 1W1WE 1BN5A 4P96A 3I4NJ 3GO5A 4EGZA 4A3MJ 4R8HA 3PQJA 2KQRA 3I71A 4MFDA 2XKPA 1RC9A 3BPVA 1FOXA 3S1QJ 4G6DA 4RM3A 3WTTC 3IP4B 2LC2A 2P5VA 5BS6A 3OOUA 4RB0A 5F27A 2X9DA 3VYTB 4XRMA 3T0YA 1EH7A 2GWRA 2IGMA 4KYWA 5KK1A 4KISA 3HOTA 1KU2A 4IQJA 2R7UA 2DA6A 4LG3A 4UNOA 2CSOA 2XKOA 3EUAA 3W6JB 1ZYRF 1T98A 1VNDA 1VI0A 3SEZA 5KCMA 1FC3A 1SEUA 2J5OA 4L18B 1BOAA 3H5NA 5HVQC 1V3FA 4RGUA 4YEJA 4XRSG 3WU0A 4AD9A 4RB1A 1Z6RA 4I09A 4XBFA 4Y3OA 5IOZA 3I54A 1Z7LA 1JHFA 5IYCJ 3RPQA 4LFUA 1Z0XA 2DDBA 4LK0F 2XAHA 5FKNA 3I64A 1BJAA 2RKHA 5ICFA 4XLEA 1ZG1A 2XV4S 4G9YA 2IS4A 4CYDA 2Z2SB 2OF7A 3HB9A 5D5WB 1B8IA 1NTCA 1E0EA 3CZ6A 4RS8A 1YOVB 1RR8C 1OYWA 2XRLA 1ZQ3P 2HGCA 3IH3A 1SVOA 3W6KB 1V5EA 1JTXA 2HOEA 2XGEA 2LY1A 2DTRA 2NYXA 2LRDA 1QO0D 1CF7B 2XAUA 5L3EA 1R5GA 3I9V2 2GAUA 3CLOA 4A5NA 3I59A 5FJ8J 2E2HJ 3BQZA 5E18F 2EILH 1RUNA 5KVRA 3KE2A 2VXZA 1HSJA 3QYFA 2PJRB 5FLVA 3QAHA 1DPUA 3OYGA 3CMAI 4RAYA 4ZYEA 1YS7A 2KZGA 1WGXA 2P5KA 1IO2A 1X1BA 2KHMA 5FLMJ 3OYAA 4OMZA 1U9OA 3A01A 5LHHA 3CDIA 1S7EA 5IP6A 4DYRA 4A3KJ 4BACA 4F52A 1KA8A 3ZQFA 4D0PA 2QQBA 2XPWA 2NS7A 1BC8C 4M73A 1ENHA 5K7FA 3F0CA 3W3CA 3KX2A 4A2UA 2PG4A 4DZPA 3CLQA 4WK8F 2W85A 1IG7A 2Y69H 5D4RA 2R5YA 1R22A 3ZMZA 1WFXA 2BY0A 2NVXJ 3GVAA 1Z1DA 3KZZA 2ZXIA 3CF2A 3CCRI 1VQ4I 3S2DJ 1P2FA 2XGCA 5LHIA 1T2KA 3JRIA 1HSTA 4A3JJ 1PUFA 3PNVA 2CV1A 1ACIA 2BVMA 3KLOA 4LGWA 4WX9A 4KA4A 1SD5A 4E7SA 2E7XA 4KIGA 2K9MA 3ZQHA 2EWNA 4NQWB 3REOA 2VT3A 2QEXI 4BGDA 1XX5A 1D8KA 3A03A 1O3RA 2CJJA 1TQMA 3A02A 4XLHA 3R4KA 1ON1A 3RKQA 3BC8A 1OFCX 3WGHA 3U1KA 2EV5A 3U21A 4CCLA 3ROUA 1S72I 2HDWA 4BQAA 4YFNF 3KLNA 1K6OA 3F9KA 3G6EI 3S16J 4I01A 2YPRA 3H35A 1OCOH 2HVRA 2R7ZJ 5LEJA 1FIPA 2AXLA 3QOPA 4UXNA 2XF6A 4DGWB 2NVUB 2HDDA 1LDDA 1TL8A 3PFYA 4PJNA 3SFIA 2K3PA 2KDZA 4O3MA 1R23A 1E3PA 2HOAA 1BA5A 1POGA 3ZGKA 5E79C 3HOYJ 3KFWX 1R71A 3Q9SA 3BOQA 5HNHA 2L9SA 2BY3A 2MFZA 2PI0A 5HNFA 2QQ9A 2FMYA 4XR6A 4HV5A 1OQYA 2RNGA 1OPCA 2DFFA 1I6HJ 4S0HB 4CCKA 2JRMA 1IN7A 3K0LA 5GAGJ 5LGTA 2DJIA 4ASNA 4JK1X 4NBQA 5IY5H 2FE3A 3GWZA 4HDUA 1WVRA 3OYKA 2M87A 2L4MA 3DBHB 4C30A 2NS0A 2O9LA 4BBSJ 1IRGA 1TWGJ 3LQQA 3A4CA 2EIJH 3CCVI 4RDUA 4FASD 4OIPF 4A5MA 1G3YA 3DKYA 2ISZA 3AKZA 1IXSB 2DODA 2IBDA 3LAJA 2Z33A 1XMAA 3PNTA 4HQMA 2DTZA 3CUOA 3H92A 2Q0OA 3E5XA 2AQFA 3IKVA 1BR4A 3PO2J 5DCMB 4R79A 3IAS2 2E1MB 1Y39A 2QSHX 4CICA 4GXOA 2X4HA 4PUSA 1EA3A 1HLVA 3GTOJ 1MD0A 2BBYA 1D0XA 4L9JA 5EGOB 1BI0A 2BHZA 4IVNA 1MBGA 2WTEA 1TT5B 2ZCWA 3MQ0A 4AU7A 3HOSA 4XSZF 4ZYHA 4RAFA 3DXJF 5J1YA 1MJAA 5AIPA 2LY9A 5IT9K 4HPQA 3OYEA 2RQQA 3MZHA 2KDOA 1MBJA 1GV2A 1I1SA 1YJ9I 2M4KA 4G6QA 4C2UA 3GMEA 4O6JA 2MYSA 4UVBA 3LSJA 1JKQC 1BW5A 2WY8Q 2P7VB 1U8RA 2Y0SA 3K2AA 2NVQJ 1SD6A 3ZR8X 2A6HF 1ZRCA 2XB0X 1I3QJ 3G4SI 5B3SH 2R5ZB 3E0JB 3GEZA 3GZ6A 2DMTA 3BZ6A 4D5CA 3G73A 4XRFA 1A6QA 1BI2A 2A6TA 4QSHA 2OTJI 2ETHA 4E7LA 1P6RA 1KONA 4XLCA 1MMSA 2PLYA 2BGCA 2VT2A 2EINH 2CW0F 3LSHA 2FBIA 5DUIA 1TWHJ 1W0TA 3LSTA 4F92B 4S04A 4BDYA 4G7OF 2W4SA 1BJZA 1MIJA 1S7OA 1SAUA 4HSTA 2VPLA 1JHHA 2HPMA 2B9SA 2FOWA 3L09A 3VYUB 2FBKA 1T33A 3PQKA 3AFHA 3GF2A 1QBJA 4XONA 3ECOA 3Q3SA 1YYVA 1GXPA 4KN4X 1WH5A 3I56I 3ML6A 2CFXA 1U3EM 5J1RA 2E19A 2HPIA 3A0HC 3E97A 1HKQA 3DPLC 3S3MA 3TP0A 4DBQA 4OAZA 1L0OC 1NH3A 3WODF 3ONQA 3QPTA 4E7KA 3DFGA 2FNAA 3WE3A 4ENJA 2EZIA 3HTUA 3DU6A 1QGPA 3KP3A 3K4BA 3BG7A 5A2QZ 2LH9A 4M3FA 3B6CA 4Y13A 2XAFA 1VQ9I 1Z77A 1OCRH 1REPC 4A3CJ 1LQ1A 2F4MB 5ILUA 4RM2A 3I55I 3CDHA 4IXAA 3V8JA 2OD5A 2DA2A 2VB6A 5E1XA 4Y7NJ 3HDDA 1F1ZA 2ZNZA 2IAIA 1FX7A 2Y30A 4S05A 2L9NA 1FMWA 1LE8B 2ZFUA 4DZJA 2DK8A 4NC8A 5EJCA 2Q2EA 2E34A 3GLLA 5K5RA 2DXIA 1YITI 2M9HA 4ESBA 3OSFA 2E7WA 3ELKA 1Z9CA 2BOLA 4IRIA 2DMPA 3ECHA 3S2WA 2LD5A 1XDUA 1AOYA 5FLXZ 1O57A 3NRVA 4HLXA 3GW2A 2BY1A 2R7SA 1HW5A 1IV8A 2HR3A 3DLAA 3MMYB 1XS9A 1XCVA 5L3DA 4DIQA 2LFBA 2IPQX 1R1VA 1U5TA 3ESWB 2E1OA 2JA2A 3BTJA 4EM1A 4CSWA 3AG2H 1FYLA 4L9TA 4DNCA 4E6KG 3IAM2 4PDKA 1E2XA 4I02A 1WJDA 2F5EA 5EEHA 3IWFA 4JX6A 4HV6A 3ZMVA 3O3KA 4V2GA 2PMHA 3O2PE 3JRGA 1MKMA 3ASNH 5IT9Z 1IXCA 2XPUA 1OR7A 4JP0A 4OAYA 4QPQA 3WGGA 4BQOA 2DN0A 1N78A 2DMNA 2X51A 2KIFA 4FHTA 3FK7A 2VE8A 5FFXA 4XIDA 1B4AA 2D5VA 2UXXA 3K6GA 3KZYA 1A35A 1GUUA 3HOXJ 2E2IJ 4QLCU 4EQQA 2Q1ZB 2L3DA 3BTCA 2A5WA 4YIFA 1A5JA 3F72A 2CUZA 4UVCA 2JA7J 1QPMA 1SMTA 4BU2A 2HVQA 3BJOA 3OS2A 3T8RA 2H1LA 4U88A 4OMYA 2HKXA 2DT7B 4M9ZA 2R92J 2XF7A 3DBLB 1ODDA 2M7BA 3R60A 3ABUA 1L3LA 2K9SA 3LSRA 2E1NA 4KT5C 3ZMTA 9ANTA 1ETKA 3ZOBA 4XQFA 3ZRGA 2HOTA 2CMPA 1YIOA 2X6WA 1FSEA 1D0YA 1Y6IA 1Z05A 2W48A 3AG1H 2W82A 4OIOF 4ZZDA 4M3GA 3ERMA 4ANJA 3CO7C 1MDMA 2FMLA 2EFOA 5LLQA 2BHYA 3DKXA 3SEQA 3SXYA 3B73A 3TW7A 1YTYA 1HOMA 4V2FA 3K1MA 4D1QA 4XRSA 3ASOH 3FM5A 3KYDB 2FJ1A 1ZG3A 2A07F 4HRIA 3K10A 3M8EA 4UY8I 1TNTA 1AKHA 2IP2A 5E1WA 3WU2C 2XHKA 3GLXA 3TO6A 3AAFA 1IF1A 1FMVA 4HG2A 2JT1A 5BOXA 5FGMA 2EZHA 3KZIC 2RREA 5F1RA 3M1EA 3CQZJ 4EVIA 1XCBA 3EYIA 1B72B 5CKTA 4ZJZA 4PK4A 2GLOA 1HW2A 3RQIA 2P81A 3DTEA 2QM3A 1SD4A 2Y0MA 1B9MA 1P4XA 3S3NA 4EATA 3G1LA 3RYPA 5K5OA 1P7JA 1LDJA 2L7KA 1MMNA 4J01A 4L9NA 4X1EA 4RA2A 3CMYA 3KP2A 1UG0A 3CO6C 3JSOA 4LIUA 3DBRB 2CS3A 3MN2A 5D5VB 1ETYA 1JGSA 2V26A 5TGTA 1LVAA 1FIAA 2DT6A 3ZXSA 3DF8A 2CU7A 3DP7A 2GBYA 3TP3A 4E7HA 5ICEA 3BJAA 4YFXF 5IYBJ 1HDPA 1X3ZB 2ZSIB 5EDNA 3FWEA 5LRSA 2K85A 4NDLA 4A6DA 2R7OA 4B43A 3D5LA 4HZFA 4IHVA 2L7MP 4E4HA 5IOYA 2OBPA 1MJBA 4FCYA 4M9SA 3RTRA 5JHFA 2AS5F 3OL4A 2BW3A 4EM2A 3HIFA 2XB5A 2VKHA 2R4GA 3X2QH 2QBYB 3OYJA 2HWVA 4I6ZA 2MD0A 1XTAA 4GYIA 3ZQ7A 3QODA 3LSKA 2R7RA 1G6NA 1GV5A 4LG0A 1UJ8A 2H6BA 2JVGA 2VQLA 4MLOA 1SAXA 2VIXA 1K4SA 4HW0A 3LOCA 3Q0WA 3FF5A 5FRMA 1B6AA 1SFXA 4RAZA 1ZR2A 2N8GA 4IHTA 4AM3A 2TRTA 3E6DA 2VBWA 1IUFA 3HHHA 4BQQA 2DPDA 3HKZN 2MH2A 1OCCH 1RRJA 1FBQA 2CRGA 3ERED 1RUOA 2EFWA 2HVSA 2NNYA 1LPQA 3CTAA 1MSEC 2K86A 2MLKA 4JYKA 3S93A 1IV6A 4QPOA 1TTYA 1USSA 3VEPA 1R4MB 1SFOJ 1IRFA 3FHNA 2P5LC 2HU9A 5DS9A 3F8FA 2KRCA 4CHUA 2CQXA 3BZCA 4A12A 3DLLF 2LOOA 3C7JA 2X1EA 3FHZA 3KEYA 3IH2A 1KQ9A 2VKEA 1YIJI 2NVTJ 2VJ4A 4CA0A 3E6BA 2LF7A 4XSXF 2DMQA 1NG7A 1LVKA 4LMYA 4GCVA 3CUQA 2UZKA 2LK2A 4BEHA 2DOAA 2E36A 5CVJA 1MNEA 2KIQA 3I3LA 4XOTA 5J6XA 2ESHA 4Y4RA 4YG2F 3NAUA 2DA5A 3LL7A 2ACJA 1YX3A 3V7CA 4IHWA 1A04A 5JHUA 1U5TC 5H6QA 2E5NA 4RGXA 1S7AA 1LDKB 2CYYA 1UG2A 1EV7A 4MIMA 4BXFA 3QOEA 1N77A 1WKMA 3RJPA 3HOUJ 1JKPC 3GTGJ 4BAYA 2C6YA 1P7IA 2FX0A 3BZKA 2HQNA 5FRNA 1I3AA 5L3BA 3LAPA 5L3GA 1Z67A 3F6VA 3DPTA 3MVPA 3V8LA 3E6MA 1X1AA 2R93J 5HS8A 5E3MA 2JA8J 3H1CA 5IP7J 3OYCA 1OLTA 5KAIC 4P9UA 4U0YA 1WHUA 2OTLI 3V8KA 4CYCB 1EJ9A 3IKTA 3CDLA 1K78A 3GYHX 5J3LA 2ZMEA 1BBYA 2K7LA 2X85A 3H5AA 2JN6A 3CCYA 1S6LA 3OV8A 1I6XA 4N4OB 3CC2I 1FTZA 2YR2A 5HDKA 3KYCB 5IPAA 1KGSA 3TBIA 3BCAA 2FEZA 4I0AA 5TISC 3E5QA 1FY7A 2A61A 5CQEA 3F23A 3FXQA 4PGGA 4B3AA 4XLFA 1GVDA 5DM6F 2DW4A 1PP8F 5C3EJ 2M7AA 4HNTA 3GXOA 3EYYA 2PX9A 2ECCA 3TL4X 3Q9VA 2EFQA 4NUBA 3L2UA 1Z21A 3CMMA 4Y33A 1EKEA 2XSDC 1K7AA 1OCTC 4UUSB 4HF1A 3RZDJ 2RV8A 3F22A 3K4KA 1U6GA 1IJWC 1JKOC 2VBYA 3I58A 4IF4A 4IJAA 2F4OB 2KIMA 4EV0A 2L2OA 1TWAJ 3HC7A 2DMUA 4A3BJ 2Y75A 1TP4A 1S29A 5F0FA 1W0UA 1R7JA 3BR3A 1XGNA 5LGUA 3H9JA 4CUGA 4Q5SF 1W36D 1XGOA 4BJTA 2AHQA 1I50J 1FYKA 2XC7A 2CV2A 4BKXA 3ZQLA 2ZKZA 2EH3A 3FIWA 4WCGA 1LJ9A 1N75A 2L4AA 2LBFB 5D6EA 1O3QA 3GTQJ 4FTHA 5FO5A 3JW4A 2ID6A 1V54H 4JX5A 1H9GA 2LYCA 2ID3A 5L3CA 3QYEA 3WTVC 3S3OA 4FISA 1FJLA 2UUZA 4ITVA 4HNUA 1NK2P 4DJAA 1LNWA 1W7PD 4F91B 4IO9F 1QPIA 3DV8A 1UHWA 1EH8A 2OCEA 2QLZA 3RIRA 1M1EB 5LD2C 2V6CA 4CGZA 4BNCA 1E3OC 1YRNB 1JT6A 2EA4A 3WTUC 4YRVA 3OR2C 2PMZN 1OJLA 1ZGAA 3F8MA 2DI3A 2BEOA 3OL3A 4M6XA 1B9NA 4PJ0C 1X4PA 2MGQA 3FDYA 1N25A 1GVJA 1GDTA 4CCOA 5FFZA 1Q1VA 2WAQN 3S15J 3O6BB 4OINF 1TQIA 3HGGA 2EFPA 5M3MJ 2QQAA 3OS1A 1X1PA 1JGGA 3NWTA 3FK6A 3W2AA 2ESNA 3HL2A 3H36A 4MTEA 3JRDA 5EG0A 3HSFA 5D8LB 5TRDA 4II2A 3BG5A 1W7PA 2P4WA 2EJRA 3CP2A 3V42A 1AKHB 1IN8A 3H5RA 5KAFC 2LKXA 3TKYA 4U7DA 1ZREA 5B66C 2O0YA 5CVIA 4LD5A 3J80K 2EQRA 1A36A 1WRJA 2O8XA 3ZMUA 2GZWA 4BY1J 2Y48A 4C3JJ 1JI8A 2ZNYA 2MH9A 1K83J 3D1NI 4HF0A 5DD8A 1ZH5A 1UHSA 4GO1A 5HLIA 3NARA 3GX4X 5ERIA 3A2KA 2BXYA 2O5RA 2V1DA 2R7WA 5GTIC 3VYSB 4JOMA 1BIBA 3TDZC 4G8XA 1WJFA 2H8RA 2JSPA 1ETQA 5BNGA 3KP5A 3EETA 2GIZA 2ZJPF 2W57A 4RLFA 5E20A 2UXNA 1X19A 3GUDA 4UV9A 2LKSA 4HOBA 2ECBA 2I10A 4IHSA 2WV0A 4Y52J 4BXUA 4A3GJ 1XSDA 1WJAA 1ETVA 2YX7A 2QVOA 2OQRA 1MNMC 1J09A 1MBKA 3IHUA 1PJRA 3IC7A 3LNQA 3JREA 5FB2A 1MBHA 3F8CA 3I0TA 4IRHA 3SFZA 4A0XA 2D1VA 5E8GA 1KQ8A 2OA4A 2WADA 2QF7A 1WCMJ 2ISYA 2Z99A 3RQ4A 3UNGC 4ENNA 1VQPI 4DYQA 2HOSA 4LITA 1NK3P 1F36A 3O8GA 3LSIA 2L01A 2ZXHA 3HZJA 4N9HA 3KP4A 1S9HA 3IUOA 3V4GA 1X4OA 4XN0A 2IEKA 3E6CC 2V6EA 1MH3A 2GOXB 2V1NA 1FP2A 2LF8A 3CCLI 3MD2A 3DTKA 1ON2A 4A3FJ 5AONA 2OQGA 1F43A 4ZYDA 3WTYC 1E3HA 2RC4A 3HUGA 3KIOA 2V9VA 3IRRA 3VB2A 4Q48A 1FEXA 1QVTA 4FT8A 3K4LA 3R6SA 3WTSC 1JJ6C 4C3HJ 4JQFA 2VQCA 4V19K 2H6CA 3C2BA 2BVLA 2B63J 2CG4A 4BXXJ 3I53A 3L2WA 3ZQQA 1UCRA 1OCZH 3KYLA 2OUMA 2BE5F 1HC8A 3M3YJ 1VF9A 2K9QA 1J59A 2MA3A 4MEYF 1YLFA 3JCUC 2LKPA 5DTDA 1ETOA 2YUSA 1DU0A 2A68F 5EZHA 3OIOA 1V5FA 2HTSA 2VC0A 2M4GA 4ZYAA 2D1HA 2JJ7A 3P7NA 3ABTA 5LGNA 2TCTA 3TOBA 4M3EA 3CCEI 2NRAC 4OIQF 3M9AA 4UUTA 2IVMA 2F2EA 1XD7A 4XM3A 2M5WA 4L5IA 2R7TA 1PYVA 3E1SA 2P0WA 5BPIA 1TW2A 2LNBA 2OU2A 3KP6A 3M07A 1Z6TA 1DGWY 2ELJA 3FXKA 3HHGA 3QP5A 4ESFA 2EV0A 1S5LC 2CUJA 1XG1A 2W00A 4I0BA 2M0MA 3KEQA 1R6RA 2LLKA 3J80Z 2O03A 2VI6A 4FQGA 2DAOA 1ZHFA 3QPHA 4M9XA 2R7VA 3SDBA 3SDGA 1AWCA 3VOEA 2MBFA 3BR0A 4WXHA 4L0ZB 3TMOA 2L54A 3LA2A 3OYIA 1ZARA 2XDVA 2BY2A 4BYYA 1H89C 4KNYA 3OYNA 1SMYF 1U2WA 5HODA 2X1DA 4C9YA 3MAJA 2GXGA 4YELA 4A69C 1T0FA 3K4JA 2G9WA 1MGTA 1YW9A 3FMRA 4P1WA 5EEGA 3S8PA 2FBHA 1K61A 2P7CB 1JXSA 3ZMDA 1Y8RB 2HQAA 4HSRA 1ZTRA 2HTJA 3WTWC 1D0ZA 4AIJA 4M6YA 3OYBA 1IRZA 1SC7A 1ETWA 3IH4A 3M4OJ 4ESJA 5BQTA 1HCRA 4D7MA 2EB7A 4KJZA 1HA8A 1H8AC 1S8NA 4MEXF 3CC7I 3P9IA 3OYLA 1BR1A 1YW8A 2JPCA 2W24A 4IHYA 2R7DA 1W36C 4LOCA 2NXNB 1B8IB 3N4MA 1TQPA 3EQLF 3FKIJ 2Y9ZA 4NB5A 2COBA 4BUPA 5JFRA 2F6CA 4J00A 2YU9J 2JUGA 1QZYA 4ZDLA 2WBMA 3FXOA 4F93B 2NOJB 3BR5A 4HAMA 2ZJRF 3G1OA 4B8XA 2WC2A 1R5ID 4PZJA 1K4TA 1RKWA 1H0MA 1D1AA 2KIUA 5DM7F 3I59B 1O7FA 4U0WA 2CUEA 2ZC2A 1W5SA 4PGHA 1MMGA 2G7UA 1FBSA 1VQ6I 4AIDA 3BQYA 5CVRA 2JQ7A 2FQ4A 1CF7A 2WY7Q 3Q0VA 3AL0C 2FXAA 2JA5J 2RNJA 2XF5A 3A01B 1XN7A 3VYRB 2Y2ZA 2HFHA 1ETXA 2CQKA 5HS9A 1HF0A 1UFMA 3DQVC 2W84A 1VQLI 1XB4A 3MEXA 4MFEA 5J8FA 2M0CA 4ZC3A 3MKYB 1MBFA 2CO5A 3DKWA 3K1NA 5KNLA 2PJRA 4LLNA 3FMQA 4IKFA 3HKZA 2M3AA 2LTPA 2PN6A 4KITB 5IYDJ 2JUCA 3AG4H 3GBGA 2R5YB 3VODA 2RN7A 1AA7A 3FZVA 2PFBA 2DA1A 4M6VA 4BBRJ 1VQ5I 1G59A 1DU6A 2L0KA 2NOGA 1G3WA 2VXDA 3B02A 4HYEA 3RYRA 3HYIA 1R58A 2PMUA 5C4JJ 3BWGA 1GXQA 1MJ9A 1XC5A 3N97A 2RQPA 1K6YA 2FU4A 1PUFB 3U1DA 2F48A 2NNNA 4XOPA 2Y0SN 1ONVA 2ELHA 1T56A 2JMWA 5B1AH 3JAMK 4XICA 3QU3A 3GFIA 3OMYA 3COAC 2KRHA 1TWFJ 5J8CA 2JSCA 1V5GA 3JTHA 3G71I 4HF2A 3BR6A 2YU3A 3S2HJ 3K1PA 3DTIA 1V55H 3U2RA 2QKMB 4CDGA 2DQRA 2E2JJ 3BJ6A 1DGRM 1W4MA 5LFAA 4WF2A 1SVLA 4NC7A 4WWCA 4HLYA 3HXLA 4BL0B 2H09A 3WE2A 4ETSA 5JVTA 4PJJA 4YIRX 4M71A 4EJTA 4BHCA 4XKWA 2QKLB 4QWQA 4NQWA 4HQEA 2IJLA 2KL4A 1Y56A 5F04A 1JUMA 3TGNA 1D5YA 1I5ZA 2K9NA 5HS7A 3RKXA 3WGIA 1KU9A 1ZGJA 4PJLA 3GCMA 3KP7A 4W1UA 4LB6B 5LHGA 4BHPA 1WI9A 3B6AA 2Z9OA 4IL6C 3T1BA 3GFJA 3QP6A 5DD4A 2O3FA 3LSPA 3ISPA 3SZTA 2O61A 1XMKA 1ZAOA 2E35A 2GXAA 3H3VK 3IL2A 1KQ0A 3I5UA 2IT0A 2OAZA 3U9GA 4XLAA 4MNUA 2H8WA 2KFDA 5C44J 4UV8A 3MFKA 2L7ZA 1YHQI 3K4MA 1Q1HA 1X3WB 1F9NA 5B1BH 3JRCA 1MBEA 3HEFA 3T8TA 3IV5A 4M74A 3GFMA 2ZO4A 1ZLKA 5FD5A 1RZ4A 4G6TB 4OIRF 5F6FA 2BXZA 1QVUA 3HRMA 1YI2I 5EF6A 5E3LA 1AU7A 3A1YA 1J5YA 1KYWA 4CZZA 1YJNI 3DPUA 5BPDA 1QRYA 3NEUA 2KJBA 1T6SA 2YX4A 1SANA 2Z16A 2IS6A 1MH4A 4OOIA 3ZP5A 3H3UA 2VKVA 3C3WA 3PJRA 1TW3A 1O3SA 3FXJA 5E1ZB 4YFKF 3G3ZA 1X2MA 2M8EA 1IN5A 2NS8A 4N4NB 2QENA 2P8TA 1JUSA 2VN2A 1VQ7I 4EEFG 1WJBA 1SFUA 3RSNA 3EUKL 5CVUA 1NG6A 3PNYA 4E70A 1OKRA 2M30A 1HKTA 1R36A 1TT0A 2EZLA 4CCNA 1X1CA 2F5VA 1XDSA 5CLSA 2IA2A 2ME0A 2ZBKA 1CQTA 2L02A 2JPBA 4B47A 3FM3A 1O7LA 3E3VA 1T0FC 2LG4A 2WB1N 3BR2A 4C3IJ 2DA7A 4AC0A 5DCMA 2MLGA 5LEKA 2G7HA 1U0JA 2D2WA 2LSOA 3Q0UA 4BH9A 1ZK8A 1B59A 1YO5C 4B4CA 1RETA 3W2VA 4HEA2 5EGOA 1ORKA 3L00A 3GZNB 2DA4A 1LB2A 2FNPA 1W5TA 2CW7A 4G7ZF 4GRIA 2IS2A 3S14J 3S1RJ 3OYFA 4HNVA 5M3FJ 4TV7A 1R9TJ 2VQGA 3JAMZ 1PP7U 2KISA 2ZXJA 3CJNA 4M3BA 2HKOA 1CGPA 2MG4A 2DOFA 2WV1A 4HDVA 4KFCA 1H9TA 1UAAA 1UELB 1P4AA 4BJ6C 2O6GE 2PMZA 2J5PA 3QWLA 2DYSH 1ERDA 2QGUA 2E5ZA 4BJ5C 2WAQA 2Z5UA 4E7IA 3J7YJ 3GTMJ 2PQ8A 1D1BA 4N0BA 4KN7X 4Y17A 3DEWA 1Z3YA 1X2NA 4HA8A 4RAGA 2R5ZA 1GHCA 2WAEA 4XK4A 2FUG2 2XUBA 3MKLA 4FX4A 3M8FA 5K7HA 1FOWA 3BROA 1IRXA 5FD6A 5DEQA 1UMQA 4W97A 2HZTA 3J7AO 4DYCA 1OR7C 2RVCA 5EZGA 1T95A 1XMXA 4RBOA 1KYZA 1YS6A 5JLWA 1VQ8I 4I99C 2IA0A 3D5RC 1WJ5A 1XGMA 5D5UB 2V79A 5FKKA 1OCPA 2A3SA 5F1JA 4A0ZA 2PEXA 3VSLA 3MKZA 1T39A 3WTXC 2WAFA 3SJMA 2HQRA 2DBBA 3RCOA 1FOKA 5M5YJ 1HW1A 1P4WA 2A05A 3H9QA 5CPRB 5DCFA 3TW6A 1XPXA 1YFHA 4EMSA 2QSGX 4Q47A 4D7NA 3BTIA 3ABLH 3WHCA 2XASA 4CH7A 1BIAA 4A3EJ 1IDZA 3QPSA 4G94A 1X3UA 1J7KA 3MCZA 4AYBN 4A3DJ 1MZBA 2EIMH 2VLAA 2HNHA 3OSGA 4B1RA 3LSMA 1O3TA 1TNSA 2FRHA 2Q2EB 2D45A 1WI3A 4O5VA 2JK3A 3ZCOA 3HG9A 1IN6A 3BLYA 1FYMA 2VONA 4WXDA 1IZ1A 2STTA 4FX0A 2YS9A 5H6RA 3JTGA 4K2EA 3M8JA 3M7GA 1SVMA 2KJCA 5J47A 3P9CA 3CJRB 5D5XB 4OWRB 2VPRA 1U5TB 4DQ2A 1LE8A 3CC4I 4BE0A 1W5CC 2PBIA 4II3A 1EF4A 1QQIA 5HDGA 1DP7P 3RPUD 2V7FA 2AXTC 1P9QC 3G1MA 4EGYA 4G12A 3WHBA 2XSJC 4MTDA 2K4JA 2X48A 4ZTFA 3BG6A 2GM4A 2R7QA 1VQOI 3L2QA 2EBIA 2R0QC 1Z7UA 1UB9A 1XSVA 3OIQA 2QQ8A 2YSRA 2F5DA 2ADUA 2W7NA 2VUMJ 3IRQA 4PFPA 2E60A 3PL8A 2VJJA 1ZLJA 1Y1WJ 1HKSA 3GFLA 2DFHA 3RI4A 4N9IA 1G8XA 5J1UA 4LK1F 4MQVA 1RI7A 1VZ0A 5GAEJ 2IA1A 4Z6YA 3L2RA 3VWBA 1D5VA 1HQCA 5LBQA 4JX4A 3WG7H 3ZN1A 3EPZA 3C2GA 1YW7A 1DUXC 2VJ5A 4EM0B 2M1BA 1USTA 3RPUA 2DPUA 3MKWB 3HOZJ 3BR1A 4KMFA 2UWMA 2LP0A 3SQNA 1G3TA 2DFEA 2QYOA 4YIIA 4AUXA 2M8GX 1FPQA 4RMNA 1MDMB 1TC3C 3GTPJ 2W1OA 5EEAA 3WU1B 1VTNC 3J7AY 2DCEA 1RPWA 3H0DA 3ZN0A 1BI1A 4F3QA 4L5EA 1DQUA 2KKOA 2P6SA 4CO8A 2IW5A 5ED4A 3CF5F 4J19A 1PDNC 3K9TA 1T8IA 1OYYA 4X6AJ 5JVGF 4KIBA 1FP1D 2VOOA 5LRRA 4LB5A 4G7HF 3OS0A 1BW6A 1XGSA 2MC4A 4I7HA 1RESA 4XNFA 4FE4A 2IGKA 2QUFA 4CXFA 5E3OA 4D5FA 1HXDA 3RZOJ 4JBAA 4DOZA 4WXCA 3HPGA 1K79A 3ZQGA 2AQEA 3CJQB 3QRFF 2ICWG 2RAEA 4Y15A 3L2CA 3UR3C 5IT3A 3CCQI 3RDIA 4KIFA 2E1MC 5BMZA 4AIHA 4M3DA 4MQ9F 5FROA 5ILVA 1G2HA 3EDPA 1G4DA 1OISA 4GGGA 1RNLA 2XGDA 3PSFA 3V7SA 3K70D 5E17F 1B72A 3P9KA 2IRFG 3FKJA 2HI3A 3VPRA 2XVCA 3BG9A 3BDDA 1QNTA 3L7WA 3MZYA 1ZKGA 2EFNA 4OU0A 2OV7A 2DJNA 2HQ5A 3FXLA 4Q4ZF 1R4NB 3JRFA 1WH7A 2V9PA 4RGRA 2HYJA 1X1DA 1ZR4A 4XLNF 3CUQC 2CQQA 3SHFA 3ULQB 3CMEI 4B48A 3C1DA 4U0VA 5ICGA 1J9IA 2ZXWH 3MWMA 1C0WA 4XKVA 2CGPA 1DPRA 3D0SA 1X58A 4NHJA 4AWXB 4P55A 3EUHA 3F21A 1BI3A 2IXSA 3OYDA 5A2QK 1IW7F 2DQLA 2I8DA 2OPTA 2MW8A 2BW3B 4L9VA 5K1YA 2KMUA 1FTTA 1ZELA 4RB3C 1D1CA 3FXUA 4KICA 1WQ2A 4ZDPA 4C2MJ 2V1UA 2QZ8A 4LG0B 3PUFA 3DEEA 1TBXA 3TO7A 4XLPF 2FOKA 1GT0C 1DP3A 2K02A 3JRHA 3K2ZA 4BE1A 1QZZA 2HDCA 2PJPA 2H94A 3ZQCA 1FSHA 2Z1DA 2R3SA 1LEBA 3W2WA 4P5OA 1QZEA 4PSXA 4XN3A 2G0EA 3PM1A 5CVVA 2CV0A 4IX7A 2QBYA 3FX3A 3I4MJ 2X6YA 4IEJA 2HXIA 1O4XA 3LA7A 1PUEE 1QU3A 5FLXK 2DK5A 4XKCA 3TEDA 2KP6A 3L1PA 2M2EA 2LVSA 4ENMA 1J75A 1WPKA 2ZMEC 1SFEA 4DW6A 2DYRH 4ENKA 5JLXA 4PSWA 2E71A 3BY6A 3HTSB 2Q8KA 1BM9A 2WWYA 5HDNA 4KMUX 4B3XA 3HPHA 2OZUA 1E17A 2ME6A 4LJZF 1WJEA 2HZDA 3KETA 2QA4I 5F0HA 2K5CA 3ZPLA 1T08B 3PSIA 5E8IA 4BHBA 3HOWJ 3PFIA 2HEOA 1R1TA 2FSWA 2IGNA 3JRAA 5JR3A 2MABA 2NVYJ 2XRNA 3CUQB 4NC6A 3TDUC 3I4PA 1BC7C 3OR1C 4BEHB 2CH0A 3HJEA 4BQNA 1SD7A 2FA5A 3DWLE 5GAHJ 3LA3A 2EA2A 3S17J 2XAQA 2I5UA 1PVEA 5GPAA 1XSXA 4BDZA 1ZRDA 2EPFA 4KDPA 1YQAA 3RKWA 2QCOA 5D6FA 4AIKA 1FT9A 3TO9A 3DEUA 4PJMA 3F6OA 2DDAA 3Q5FA 1FZPB 4IHXA 1MNDA 4QTRA 4XORA 5FKOA 4IZZA 3H3ZA 1LKXA 4L5JA 1WZ2A 2LDUA 4DBRA 3F8BA 1QHGA 2L9RA 1UZCA 1FLIA 3OY9A 4AVPA 4MO7A 2VBXA 3OIPA 3M1CA 1Y8QB 2CWEA 3LFUA 3LFKA 3S32A 1IUYA 2DLLA 1KZHA 4I98B 5DV5A 5FKMA 3JR9A 3HOVJ 2K27A 1R49A 1QHHD 1OMIA 1F4KA 4ZZLA 1A6IA 5J4VA 4GFBA 3VFZA 2R7FA 2ZFWA 1K78B 3E5UA 3P5JA 4UHTA 2ZJQF 1APLC 2ZMEB 3BT9A 1BR2A 1ITYA 3DU5A 3R0JA 3OYHA 2VE9A 3DCFA 4A3LJ 3VSKA 4EJWA 2OCCH 1MMDA 4ZTJA 2JWTA 2XAJA 3QPLA 2X0LA 3ABKH 1TWCJ 5GTHC 1U78A 1IXRC 4CYCA 1TZLA 4R1HA 2E1CA 1ZN2A 1KU3A 2RDPA 3QYBA 2TDXA 5B5EC 5HLGA 3CESA 3BPXA 2FF4A 4HX4A 4FETA 1I39A 3R61A 1H88C 1U9NA 2COMA 2Z3YA 1JT0A 4E7JA 5HLTA 2GA2A 4CZCA 2IS1A 4GDFA 2XIGA 3NQOA 4UB6C 3ZMSA 4F7ZA 3KEOA 4A0YA 4MGRA 4HX8A 2V9KA 3J7ZI 4XL9A 2NAZA 3QU6A 2DO7A 3GTJJ 3N05A 2VKDA 2XAGA 1SFKA 2GA1A 4X0GA 4UUSA 2AO9A 1U8BA 1Y0NA 4PFOA 2W25A 3ABMH 2V4JC 1IGNA 3UKGA 3SZPA 5CJ9A 2LREA 2XPVA 1IC8A 1Z91A 3H9GA 4GYGA 3WTZA 1T38A 2RGVA 1MMAA 2EIKH 3LQRA 3NWSA 5GP9A 3GTKJ 1ZRFA 1R00A 1P92A 3BCBA 2F5FA 1D8JA 3O8HA 5M5XJ 4CCJA 3BTLA 2R7XA 2XGXA 2QSFX 3FMSA 4UVAA 4ON0A 3L2VA 4A93J 1G3SA 5H2FC 1GLNA 3HRUA 3H0GJ 5F64A 2LBFA 2WB1A 1R5HA 5ILSA 1Y0UA 3KPHA 3VDXA 3FXMA 4U87A 1LFBA 4H4KC 2CUFA 1JTYA 1I1GA 1HBXG 4M72A 3T5XA 5K7ZA 4XMYA 1UHMA 2XROA 4ZDOA 4IOCF 1YJWI 2HYFA 3HM5A 3ZQIA 1R1UA 1LFPA 4LLLA 4HBLA 4IQ4A 2KLOA 2DOEA 1YRNA 2X1CA 1J0RA 3EUHC 1MW7A 2ZSHB 3J81K 5EG0B 4L0YB 2JVHA 5HOOA 3MZ8A 3PIOF 3OYMA 1FWZA 1JUPA 1VQMI 1VQKI 2WA0A 1J2XA 1LUJB 2Y9YA 4NNJA 4B09A 3K7AJ 3HBLA 2L9VA 3LWFA 3W6VA 4PCQA 2OZ6A 1YE9A 4IOAF 1W7PB 3OOPA 2MD5A 1STZA 4BS9A 3E7LA 4KUMA 2EV6A 3LMMA 2LR8A 3TOAA 2H1KA 4XKBA 2BZTA 3K70C 2STWA 1ZG5A 1V4RA 3CJTB 2F4IA 1AHDP 1BOBA 2B7EA 2LMDA 1FOYA 5KHDA 2VOPA 4E7ZA 2DU9A 2H27A 3CCSI 2MSYA 4QIWN 2BYVE 4RB2C 4IRGA 1QA6A 3AL0B 2IGOA 2ZB9A 2JZYA 1B1BA 3BP8A 3GZ5A 3D5SC 2HYGD 1FNNA 3TQNA 4FE7A 3IWZA 1VFCA 5EYRA 1Z3XA 3S1NJ 3CP8A 1LEAA 4B44A 5F0CA 4EJOA 2VASA 3SZGA 3C2HA 2UV1A 2MC3A
chains in the Genus database with same CATH topology
2M45A 4LLGF 3FXRA 1EH6A 2VBZA 5ICCA 1KU7A 4ZH4F 5D4SA 2GQQA 4MHGA 3C18A 4EJVA 4ZYGA 2K4BA 3JSPA 5DUKA 1D3YA 2QWWA 5TJJA 1OYIA 2KRFA 4EJUA 2A6EF 1ULYA 1TLHB 2P6TA 3R0AA 4P9FA 3RKYA 1FBUA 3L9FA 4A6EA 1WWXA 5K5QA 5AIQA 4UUVA 5D8KB 1NHAA 5HLHA 3HSRA 5L3FA 2VODA 3HSEA 3HRSA 1IAWA 2JTVA 5DDGA 2GXBA 4RGSA 4IPAA 2JRTA 5CYVA 6PAXA 3HRTA 2B0LA 2GIVA 2DT5A 5JI6A 3KCCA 1IN4A 2FQ3A 2EK5A 5DYMA 4H0EA 2A5YB 1YG2A 2ZJ2A 1RIOH 1I27A 3J81Z 3F8NA 1DDNA 4Z2YA 2VC1A 3K69A 1F5TA 4I2OA 4HX7A 2V1XA 1WSUA 4U7BA 2BV6A 2DFIA 3WG9A 1S3JA 2A69F 3V7RA 2F5CA 5H20A 1JE8A 2HS5A 3F3XA 1BN5A 4P96A 3GO5A 4EGZA 4R8HA 3PQJA 3I71A 2XKPA 3BPVA 4G6DA 3WTTC 2P5VA 5BS6A 4RB0A 3T0YA 1EH7A 2GWRA 4KYWA 5KK1A 3HOTA 1KU2A 4UNOA 2CSOA 2XKOA 3W6JB 1ZYRF 1T98A 1FC3A 2J5OA 4L18B 1BOAA 5HVQC 1V3FA 4RGUA 3WU0A 4AD9A 4RB1A 1Z6RA 4I09A 4XBFA 3I54A 1JHFA 3RPQA 4LFUA 4LK0F 2XAHA 3I64A 1BJAA 2RKHA 5ICFA 1ZG1A 2XV4S 4G9YA 4CYDA 5D5WB 4RS8A 1OYWA 2HGCA 3W6KB 2HOEA 2DTRA 2NYXA 1QO0D 1CF7B 5L3EA 1R5GA 2GAUA 3CLOA 4A5NA 3I59A 5E18F 1RUNA 5KVRA 3KE2A 2VXZA 1HSJA 3QAHA 1DPUA 4RAYA 4ZYEA 1YS7A 2P5KA 4OMZA 5LHHA 1KA8A 4D0PA 2QQBA 1BC8C 4M73A 4A2UA 2PG4A 4WK8F 2W85A 5D4RA 1R22A 3ZMZA 3GVAA 1Z1DA 3KZZA 1P2FA 5LHIA 1T2KA 1HSTA 3KLOA 4KA4A 4LGWA 4WX9A 1SD5A 2E7XA 4KIGA 2EWNA 3REOA 2VT3A 1D8KA 1O3RA 1TQMA 3R4KA 1ON1A 3WGHA 2EV5A 3ROUA 4BQAA 4YFNF 3KLNA 1K6OA 4I01A 2YPRA 5LEJA 2AXLA 3QOPA 4UXNA 1LDDA 4O3MA 1R23A 3KFWX 3Q9SA 3BOQA 2PI0A 2QQ9A 2FMYA 4HV5A 1OPCA 1IN7A 3K0LA 5LGTA 4ASNA 4JK1X 4HDUA 2FE3A 3GWZA 2M87A 2L4MA 2NS0A 1IRGA 3LQQA 4OIPF 4A5MA 1G3YA 2ISZA 1IXSB 3LAJA 2Z33A 1XMAA 4HQMA 3CUOA 3H92A 2Q0OA 3E5XA 3IKVA 5DCMB 4R79A 4CICA 4GXOA 2X4HA 1MD0A 2BBYA 4L9JA 1BI0A 4IVNA 2WTEA 2ZCWA 3MQ0A 3HOSA 4XSZF 4ZYHA 3DXJF 1MJAA 5AIPA 5IT9K 3MZHA 1I1SA 4G6QA 4O6JA 4UVBA 2P7VB 1U8RA 1SD6A 2A6HF 1ZRCA 3GEZA 3GZ6A 3BZ6A 3G73A 4XRFA 1BI2A 2ETHA 1P6RA 2PLYA 2BGCA 2VT2A 2CW0F 2FBIA 5DUIA 3LSTA 4S04A 4G7OF 1S7OA 1JHHA 3L09A 2FBKA 3PQKA 3GF2A 1QBJA 3ECOA 1YYVA 1GXPA 4KN4X 3ML6A 2CFXA 1U3EM 3E97A 1HKQA 3DPLC 1L0OC 3WODF 3QPTA 3DFGA 2FNAA 3WE3A 4ENJA 3HTUA 1QGPA 3KP3A 5A2QZ 4Y13A 2XAFA 1REPC 1LQ1A 5ILUA 3CDHA 4IXAA 3V8JA 2OD5A 5E1XA 1F1ZA 2ZNZA 1FX7A 4S05A 2DK8A 2Q2EA 5K5RA 4ESBA 2E7WA 3ELKA 1Z9CA 4IRIA 3S2WA 3ECHA 1XDUA 1AOYA 5FLXZ 1O57A 3NRVA 4HLXA 3GW2A 1HW5A 2HR3A 1XCVA 5L3DA 2IPQX 1R1VA 1U5TA 4EM1A 1FYLA 4L9TA 4DNCA 4PDKA 1E2XA 4I02A 2F5EA 5EEHA 3IWFA 4HV6A 3ZMVA 3O3KA 2PMHA 3O2PE 1MKMA 5IT9Z 1IXCA 1OR7A 3WGGA 4FHTA 2KIFA 2VE8A 5FFXA 1B4AA 2UXXA 3KZYA 4QLCU 4EQQA 2L3DA 4YIFA 3F72A 4UVCA 1QPMA 1SMTA 3BJOA 3T8RA 4U88A 4OMYA 2HKXA 4M9ZA 1ODDA 3R60A 3ABUA 1L3LA 2E1NA 4KT5C 3ZMTA 1YIOA 1FSEA 4OIOF 1Z05A 4ZZDA 3CO7C 1MDMA 2FMLA 2EFOA 5LLQA 3SXYA 3B73A 1YTYA 3K1MA 3FM5A 1ZG3A 2A07F 3M8EA 1TNTA 2IP2A 5E1WA 2XHKA 3GLXA 3TO6A 3AAFA 1IF1A 2JT1A 5BOXA 5FGMA 5F1RA 3M1EA 4EVIA 1XCBA 3EYIA 1HW2A 2QM3A 1SD4A 2Y0MA 1B9MA 1P4XA 3RYPA 5K5OA 1LDJA 4L9NA 3KP2A 3CO6C 3JSOA 5D5VB 1JGSA 1LVAA 3DF8A 3DP7A 5ICEA 3BJAA 4YFXF 3FWEA 5LRSA 4A6DA 3D5LA 4HZFA 2OBPA 1MJBA 4M9SA 3RTRA 2AS5F 4EM2A 3HIFA 2QBYB 2HWVA 4GYIA 3ZQ7A 1G6NA 4LG0A 2H6BA 1SAXA 4HW0A 3FF5A 1B6AA 1SFXA 4RAZA 4IHTA 3E6DA 2VBWA 3HHHA 2DPDA 2MH2A 1FBQA 3ERED 1RUOA 2EFWA 2NNYA 3CTAA 2K86A 2MLKA 1TTYA 1USSA 3VEPA 1IRFA 2P5LC 4CHUA 3F8FA 4A12A 3C7JA 3FHZA 1KQ9A 3E6BA 2LF7A 4XSXF 4LMYA 4GCVA 3CUQA 2UZKA 5CVJA 5J6XA 2ESHA 4YG2F 2ACJA 3V7CA 1A04A 5JHUA 1U5TC 5H6QA 4RGXA 1S7AA 1LDKB 2CYYA 1EV7A 1WKMA 3RJPA 4BAYA 2C6YA 2HQNA 5L3BA 3LAPA 5L3GA 3F6VA 3DPTA 3V8LA 3E6MA 5HS8A 4P9UA 4U0YA 3V8KA 3IKTA 1K78A 3GYHX 2ZMEA 1BBYA 2K7LA 3OV8A 1S6LA 1I6XA 2YR2A 5HDKA 1KGSA 2FEZA 4I0AA 3E5QA 1FY7A 2A61A 3F23A 3FXQA 4PGGA 2DW4A 1PP8F 3GXOA 3EYYA 3Q9VA 2EFQA 1K7AA 4HF1A 2RV8A 3F22A 1U6GA 2VBYA 3I58A 4IF4A 4IJAA 2KIMA 4EV0A 2Y75A 1S29A 1R7JA 1XGNA 5LGUA 4Q5SF 1XGOA 1FYKA 2ZKZA 4WCGA 1LJ9A 2L4AA 5D6EA 1O3QA 5FO5A 3JW4A 1H9GA 5L3CA 3WTVC 1LNWA 1W7PD 3DV8A 1UHWA 1EH8A 2QLZA 3RIRA 2V6CA 4CGZA 4BNCA 2EA4A 3WTUC 1ZGAA 3F8MA 2DI3A 2BEOA 4M6XA 1B9NA 1GVJA 5FFZA 3O6BB 4OINF 1TQIA 2EFPA 2QQAA 2ESNA 4MTEA 3HSFA 5D8LB 5TRDA 1W7PA 2P4WA 2EJRA 1IN8A 3TKYA 4U7DA 1ZREA 2O0YA 5CVIA 4LD5A 3J80K 1WRJA 2O8XA 3ZMUA 2GZWA 2Y48A 2ZNYA 2MH9A 4HF0A 5DD8A 1ZH5A 5HLIA 4GO1A 3GX4X 5ERIA 2V1DA 1BIBA 3TDZC 4G8XA 3KP5A 3EETA 2W57A 5E20A 2UXNA 3GUDA 4UV9A 4HOBA 4IHSA 2WV0A 4BXUA 1XSDA 2YX7A 2QVOA 2OQRA 3IHUA 3IC7A 5FB2A 4IRHA 3F8CA 3I0TA 3SFZA 4A0XA 2D1VA 5E8GA 1KQ8A 2OA4A 2ISYA 2Z99A 4ENNA 2L01A 4N9HA 3KP4A 3V4GA 3E6CC 1FP2A 2LF8A 1ON2A 5AONA 2OQGA 4ZYDA 3WTYC 2RC4A 3HUGA 2V9VA 3IRRA 3VB2A 4Q48A 4FT8A 3R6SA 3WTSC 4JQFA 2H6CA 2CG4A 3I53A 1UCRA 2BE5F 1J59A 2MA3A 4MEYF 1YLFA 2LKPA 2A68F 2HTSA 2VC0A 5LGNA 2D1HA 3P7NA 3ABTA 3TOBA 2NRAC 4OIQF 3M9AA 2IVMA 2F2EA 1XD7A 2M5WA 4L5IA 5BPIA 1TW2A 2LNBA 2OU2A 3KP6A 1Z6TA 3HHGA 3QP5A 4ESFA 2EV0A 4I0BA 3KEQA 3J80Z 2O03A 2DAOA 1ZHFA 3QPHA 4M9XA 1AWCA 3VOEA 2MBFA 4WXHA 4L0ZB 2L54A 3LA2A 1ZARA 4BYYA 4KNYA 1SMYF 1U2WA 3MAJA 2GXGA 1T0FA 5EEGA 2G9WA 1MGTA 1YW9A 3FMRA 2FBHA 2P7CB 1JXSA 3ZMDA 2HTJA 3WTWC 4AIJA 4M6YA 4ESJA 5BQTA 2EB7A 1S8NA 4MEXF 3P9IA 1YW8A 2JPCA 2W24A 2R7DA 3N4MA 1TQPA 3EQLF 4NB5A 5JFRA 1QZYA 4HAMA 4B8XA 2WC2A 4PZJA 1H0MA 2KIUA 3I59B 1O7FA 4U0WA 1W5SA 4PGHA 2G7UA 1FBSA 5CVRA 1CF7A 2FXAA 2RNJA 1XN7A 2HFHA 2CQKA 5HS9A 1UFMA 3DQVC 2W84A 1XB4A 3MEXA 5J8FA 2CO5A 3DKWA 3K1NA 4LLNA 3FMQA 2PN6A 3VODA 2RN7A 3FZVA 2PFBA 1G3WA 3B02A 4HYEA 3RYRA 3HYIA 1R58A 2PMUA 3BWGA 1GXQA 1MJ9A 3N97A 2RQPA 2FU4A 3U1DA 2NNNA 1ONVA 2ELHA 3JAMK 3QU3A 3GFIA 3COAC 5J8CA 2JSCA 3JTHA 4HF2A 2YU3A 3K1PA 3U2RA 4CDGA 2DQRA 3BJ6A 1W4MA 4WF2A 4WWCA 4HLYA 2H09A 3WE2A 4ETSA 5JVTA 4M71A 4EJTA 4BHCA 4QWQA 4NQWA 4HQEA 2IJLA 3TGNA 1I5ZA 5HS7A 3RKXA 3WGIA 1KU9A 1ZGJA 4LB6B 3KP7A 5LHGA 4BHPA 1WI9A 2Z9OA 3T1BA 3GFJA 3QP6A 5DD4A 2O3FA 3ISPA 3SZTA 2O61A 1XMKA 1ZAOA 3IL2A 1KQ0A 3I5UA 2IT0A 2OAZA 3U9GA 4MNUA 4UV8A 3MFKA 1Q1HA 1F9NA 3T8TA 4M74A 3GFMA 2ZO4A 1ZLKA 5FD5A 1RZ4A 4OIRF 5F6FA 3HRMA 1J5YA 1KYWA 4CZZA 5BPDA 3NEUA 2KJBA 1T6SA 2YX4A 4OOIA 3ZP5A 3H3UA 3C3WA 1TW3A 1O3SA 5E1ZB 4YFKF 3G3ZA 2M8EA 1IN5A 2QENA 2P8TA 2VN2A 1SFUA 5CVUA 4E70A 1OKRA 2M30A 1HKTA 1R36A 1XDSA 5CLSA 2IA2A 2ZBKA 2L02A 2JPBA 3FM3A 1O7LA 3E3VA 5DCMA 2MLGA 5LEKA 2G7HA 2D2WA 2LSOA 4BH9A 1B59A 1YO5C 3L00A 1LB2A 2FNPA 1W5TA 4G7ZF 4TV7A 3JAMZ 1PP7U 2ZXJA 3CJNA 2HKOA 1CGPA 4HDVA 4KFCA 1H9TA 1P4AA 2O6GE 2J5PA 2Z5UA 2PQ8A 4N0BA 4KN7X 4Y17A 4HA8A 1GHCA 2XUBA 4FX4A 3M8FA 3BROA 5FD6A 5DEQA 2HZTA 3J7AO 2RVCA 1KYZA 1YS6A 2IA0A 1XGMA 5D5UB 2V79A 2A3SA 4A0ZA 2PEXA 1T39A 3WTXC 2HQRA 2DBBA 1FOKA 1HW1A 1P4WA 5DCFA 1YFHA 4EMSA 4Q47A 2XASA 1BIAA 4G94A 1X3UA 1J7KA 3MCZA 1MZBA 1O3TA 1TNSA 2FRHA 2D45A 4O5VA 1IN6A 1FYMA 2VONA 4WXDA 1IZ1A 2STTA 4FX0A 5H6RA 3JTGA 4K2EA 3M7GA 2KJCA 3P9CA 5D5XB 1U5TB 4DQ2A 2PBIA 1QQIA 5HDGA 1DP7P 4EGYA 4MTDA 2K4JA 1Z7UA 1UB9A 1XSVA 2YSRA 2F5DA 2ADUA 3IRQA 1ZLJA 1HKSA 3GFLA 3RI4A 4N9IA 4LK1F 4MQVA 1RI7A 2IA1A 1D5VA 1HQCA 5LBQA 3ZN1A 1DUXC 1YW7A 4EM0B 2M1BA 1USTA 3RPUA 2DPUA 4KMFA 2UWMA 3SQNA 1G3TA 2QYOA 4YIIA 1FPQA 1MDMB 3WU1B 1VTNC 3ZN0A 1BI1A 4CO8A 5ED4A 2KKOA 2P6SA 2IW5A 1PDNC 3K9TA 1OYYA 4KIBA 1FP1D 2VOOA 5LRRA 4LB5A 4G7HF 1XGSA 4I7HA 2QUFA 4CXFA 1HXDA 4JBAA 4WXCA 1K79A 3QRFF 3L2CA 4Y15A 5IT3A 3RDIA 4KIFA 5BMZA 4AIHA 4MQ9F 5ILVA 3EDPA 1G4DA 4GGGA 1RNLA 3V7SA 5E17F 3P9KA 2IRFG 2XVCA 3BDDA 1QNTA 3L7WA 3MZYA 2EFNA 4OU0A 4Q4ZF 4RGRA 4XLNF 3CUQC 3SHFA 3ULQB 3C1DA 4U0VA 5ICGA 1J9IA 3MWMA 1C0WA 2CGPA 1DPRA 3D0SA 4NHJA 4AWXB 4P55A 3EUHA 3F21A 1BI3A 5A2QK 1IW7F 2DQLA 4L9VA 5K1YA 4RB3C 3FXUA 4KICA 1WQ2A 2V1UA 2QZ8A 4LG0B 1TBXA 3TO7A 4XLPF 2FOKA 2K02A 3K2ZA 1QZZA 2HDCA 2PJPA 2H94A 1FSHA 2R3SA 1LEBA 4P5OA 5CVVA 2QBYA 3FX3A 3LA7A 1PUEE 5FLXK 2DK5A 4ENMA 1J75A 1SFEA 4ENKA 3BY6A 3HTSB 2Q8KA 1BM9A 2WWYA 5HDNA 4KMUX 2OZUA 1E17A 3KETA 4LJZF 3ZPLA 5E8IA 4BHBA 3PFIA 2HEOA 1R1TA 2FSWA 5JR3A 3CUQB 2XRNA 3TDUC 3I4PA 1BC7C 1SD7A 2FA5A 3LA3A 2EA2A 2XAQA 1XSXA 1ZRDA 4KDPA 1YQAA 3RKWA 5D6FA 4AIKA 1FT9A 3TO9A 3DEUA 3F6OA 3Q5FA 1FZPB 3H3ZA 4L5JA 2LDUA 3F8BA 1FLIA 4AVPA 2VBXA 2CWEA 1IUYA 3LFKA 2DLLA 4I98B 5DV5A 2K27A 1OMIA 1F4KA 4ZZLA 3VFZA 2R7FA 2ZFWA 1K78B 3E5UA 4UHTA 2ZMEB 3R0JA 2VE9A 4EJWA 2XAJA 2X0LA 1U78A 1IXRC 4R1HA 2E1CA 1ZN2A 1KU3A 2RDPA 2TDXA 5HLGA 3BPXA 2FF4A 4HX4A 3R61A 2Z3YA 2COMA 2GA2A 2XIGA 3NQOA 4F7ZA 3ZMSA 3KEOA 4A0YA 4MGRA 4HX8A 2NAZA 3QU6A 2DO7A 2XAGA 2GA1A 2W25A 3SZPA 5CJ9A 1Z91A 4GYGA 3WTZA 1T38A 2RGVA 3LQRA 1ZRFA 1R00A 1P92A 2F5FA 1D8JA 2XGXA 3FMSA 4UVAA 4ON0A 1G3SA 3HRUA 5F64A 1R5HA 5ILSA 1Y0UA 1I1GA 1HBXG 4M72A 3T5XA 1UHMA 2XROA 2HYFA 1R1UA 4LLLA 4HBLA 1J0RA 3J81K 4L0YB 5HOOA 1FWZA 1J2XA 4B09A 3LWFA 4PCQA 2OZ6A 1W7PB 3OOPA 2MD5A 1STZA 4KUMA 2EV6A 3TOAA 2STWA 1ZG5A 1V4RA 2VOPA 2DU9A 2H27A 4RB2C 2BYVE 4IRGA 2JZYA 1B1BA 3BP8A 3GZ5A 2HYGD 1FNNA 3TQNA 3IWZA 1LEAA 4EJOA 2MC3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M45 A;  4LLG F;  3FXR A;  1EH6 A;  2VBZ A;  5ICC A;  1KU7 A;  4ZH4 F;  5D4S A;  2GQQ A;  4MHG A;  3C18 A;  4EJV A;  4ZYG A;  2K4B A;  3JSP A;  5DUK A;  1D3Y A;  2QWW A;  5TJJ A;  1OYI A;  2KRF A;  4EJU A;  2A6E F;  1ULY A;  1TLH B;  2P6T A;  3R0A A;  4P9F A;  3RKY A;  1FBU A;  3L9F A;  4A6E A;  1WWX A;  5K5Q A;  5AIQ A;  4UUV A;  5D8K B;  1NHA A;  5HLH A;  3HSR A;  5L3F A;  2VOD A;  3HSE A;  3HRS A;  1IAW A;  2JTV A;  5DDG A;  2GXB A;  4RGS A;  4IPA A;  2JRT A;  5CYV A;  6PAX A;  3HRT A;  2B0L A;  2GIV A;  2DT5 A;  5JI6 A;  3KCC A;  1IN4 A;  2FQ3 A;  2EK5 A;  5DYM A;  4H0E A;  2A5Y B;  1YG2 A;  2ZJ2 A;  1RIO H;  1I27 A;  3J81 Z;  3F8N A;  1DDN A;  4Z2Y A;  2VC1 A;  3K69 A;  1F5T A;  4I2O A;  4HX7 A;  2V1X A;  1WSU A;  4U7B A;  2BV6 A;  2DFI A;  3WG9 A;  1S3J A;  2A69 F;  3V7R A;  2F5C A;  5H20 A;  1JE8 A;  2HS5 A;  3F3X A;  1BN5 A;  4P96 A;  3GO5 A;  4EGZ A;  4R8H A;  3PQJ A;  3I71 A;  2XKP A;  3BPV A;  4G6D A;  3WTT C;  2P5V A;  5BS6 A;  4RB0 A;  3T0Y A;  1EH7 A;  2GWR A;  4KYW A;  5KK1 A;  3HOT A;  1KU2 A;  4UNO A;  2CSO A;  2XKO A;  3W6J B;  1ZYR F;  1T98 A;  1FC3 A;  2J5O A;  4L18 B;  1BOA A;  5HVQ C;  1V3F A;  4RGU A;  3WU0 A;  4AD9 A;  4RB1 A;  1Z6R A;  4I09 A;  4XBF A;  3I54 A;  1JHF A;  3RPQ A;  4LFU A;  4LK0 F;  2XAH A;  3I64 A;  1BJA A;  2RKH A;  5ICF A;  1ZG1 A;  2XV4 S;  4G9Y A;  4CYD A;  5D5W B;  4RS8 A;  1OYW A;  2HGC A;  3W6K B;  2HOE A;  2DTR A;  2NYX A;  1QO0 D;  1CF7 B;  5L3E A;  1R5G A;  2GAU A;  3CLO A;  4A5N A;  3I59 A;  5E18 F;  1RUN A;  5KVR A;  3KE2 A;  2VXZ A;  1HSJ A;  3QAH A;  1DPU A;  4RAY A;  4ZYE A;  1YS7 A;  2P5K A;  4OMZ A;  5LHH A;  1KA8 A;  4D0P A;  2QQB A;  1BC8 C;  4M73 A;  4A2U A;  2PG4 A;  4WK8 F;  2W85 A;  5D4R A;  1R22 A;  3ZMZ A;  3GVA A;  1Z1D A;  3KZZ A;  1P2F A;  5LHI A;  1T2K A;  1HST A;  3KLO A;  4KA4 A;  4LGW A;  4WX9 A;  1SD5 A;  2E7X A;  4KIG A;  2EWN A;  3REO A;  2VT3 A;  1D8K A;  1O3R A;  1TQM A;  3R4K A;  1ON1 A;  3WGH A;  2EV5 A;  3ROU A;  4BQA A;  4YFN F;  3KLN A;  1K6O A;  4I01 A;  2YPR A;  5LEJ A;  2AXL A;  3QOP A;  4UXN A;  1LDD A;  4O3M A;  1R23 A;  3KFW X;  3Q9S A;  3BOQ A;  2PI0 A;  2QQ9 A;  2FMY A;  4HV5 A;  1OPC A;  1IN7 A;  3K0L A;  5LGT A;  4ASN A;  4JK1 X;  4HDU A;  2FE3 A;  3GWZ A;  2M87 A;  2L4M A;  2NS0 A;  1IRG A;  3LQQ A;  4OIP F;  4A5M A;  1G3Y A;  2ISZ A;  1IXS B;  3LAJ A;  2Z33 A;  1XMA A;  4HQM A;  3CUO A;  3H92 A;  2Q0O A;  3E5X A;  3IKV A;  5DCM B;  4R79 A;  4CIC A;  4GXO A;  2X4H A;  1MD0 A;  2BBY A;  4L9J A;  1BI0 A;  4IVN A;  2WTE A;  2ZCW A;  3MQ0 A;  3HOS A;  4XSZ F;  4ZYH A;  3DXJ F;  1MJA A;  5AIP A;  5IT9 K;  3MZH A;  1I1S A;  4G6Q A;  4O6J A;  4UVB A;  2P7V B;  1U8R A;  1SD6 A;  2A6H F;  1ZRC A;  3GEZ A;  3GZ6 A;  3BZ6 A;  3G73 A;  4XRF A;  1BI2 A;  2ETH A;  1P6R A;  2PLY A;  2BGC A;  2VT2 A;  2CW0 F;  2FBI A;  5DUI A;  3LST A;  4S04 A;  4G7O F;  1S7O A;  1JHH A;  3L09 A;  2FBK A;  3PQK A;  3GF2 A;  1QBJ A;  3ECO A;  1YYV A;  1GXP A;  4KN4 X;  3ML6 A;  2CFX A;  1U3E M;  3E97 A;  1HKQ A;  3DPL C;  1L0O C;  3WOD F;  3QPT A;  3DFG A;  2FNA A;  3WE3 A;  4ENJ A;  3HTU A;  1QGP A;  3KP3 A;  5A2Q Z;  4Y13 A;  2XAF A;  1REP C;  1LQ1 A;  5ILU A;  3CDH A;  4IXA A;  3V8J A;  2OD5 A;  5E1X A;  1F1Z A;  2ZNZ A;  1FX7 A;  4S05 A;  2DK8 A;  2Q2E A;  5K5R A;  4ESB A;  2E7W A;  3ELK A;  1Z9C A;  4IRI A;  3S2W A;  3ECH A;  1XDU A;  1AOY A;  5FLX Z;  1O57 A;  3NRV A;  4HLX A;  3GW2 A;  1HW5 A;  2HR3 A;  1XCV A;  5L3D A;  2IPQ X;  1R1V A;  1U5T A;  4EM1 A;  1FYL A;  4L9T A;  4DNC A;  4PDK A;  1E2X A;  4I02 A;  2F5E A;  5EEH A;  3IWF A;  4HV6 A;  3ZMV A;  3O3K A;  2PMH A;  3O2P E;  1MKM A;  5IT9 Z;  1IXC A;  1OR7 A;  3WGG A;  4FHT A;  2KIF A;  2VE8 A;  5FFX A;  1B4A A;  2UXX A;  3KZY A;  4QLC U;  4EQQ A;  2L3D A;  4YIF A;  3F72 A;  4UVC A;  1QPM A;  1SMT A;  3BJO A;  3T8R A;  4U88 A;  4OMY A;  2HKX A;  4M9Z A;  1ODD A;  3R60 A;  3ABU A;  1L3L A;  2E1N A;  4KT5 C;  3ZMT A;  1YIO A;  1FSE A;  4OIO F;  1Z05 A;  4ZZD A;  3CO7 C;  1MDM A;  2FML A;  2EFO A;  5LLQ A;  3SXY A;  3B73 A;  1YTY A;  3K1M A;  3FM5 A;  1ZG3 A;  2A07 F;  3M8E A;  1TNT A;  2IP2 A;  5E1W A;  2XHK A;  3GLX A;  3TO6 A;  3AAF A;  1IF1 A;  2JT1 A;  5BOX A;  5FGM A;  5F1R A;  3M1E A;  4EVI A;  1XCB A;  3EYI A;  1HW2 A;  2QM3 A;  1SD4 A;  2Y0M A;  1B9M A;  1P4X A;  3RYP A;  5K5O A;  1LDJ A;  4L9N A;  3KP2 A;  3CO6 C;  3JSO A;  5D5V B;  1JGS A;  1LVA A;  3DF8 A;  3DP7 A;  5ICE A;  3BJA A;  4YFX F;  3FWE A;  5LRS A;  4A6D A;  3D5L A;  4HZF A;  2OBP A;  1MJB A;  4M9S A;  3RTR A;  2AS5 F;  4EM2 A;  3HIF A;  2QBY B;  2HWV A;  4GYI A;  3ZQ7 A;  1G6N A;  4LG0 A;  2H6B A;  1SAX A;  4HW0 A;  3FF5 A;  1B6A A;  1SFX A;  4RAZ A;  4IHT A;  3E6D A;  2VBW A;  3HHH A;  2DPD A;  2MH2 A;  1FBQ A;  3ERE D;  1RUO A;  2EFW A;  2NNY A;  3CTA A;  2K86 A;  2MLK A;  1TTY A;  1USS A;  3VEP A;  1IRF A;  2P5L C;  4CHU A;  3F8F A;  4A12 A;  3C7J A;  3FHZ A;  1KQ9 A;  3E6B A;  2LF7 A;  4XSX F;  4LMY A;  4GCV A;  3CUQ A;  2UZK A;  5CVJ A;  5J6X A;  2ESH A;  4YG2 F;  2ACJ A;  3V7C A;  1A04 A;  5JHU A;  1U5T C;  5H6Q A;  4RGX A;  1S7A A;  1LDK B;  2CYY A;  1EV7 A;  1WKM A;  3RJP A;  4BAY A;  2C6Y A;  2HQN A;  5L3B A;  3LAP A;  5L3G A;  3F6V A;  3DPT A;  3V8L A;  3E6M A;  5HS8 A;  4P9U A;  4U0Y A;  3V8K A;  3IKT A;  1K78 A;  3GYH X;  2ZME A;  1BBY A;  2K7L A;  3OV8 A;  1S6L A;  1I6X A;  2YR2 A;  5HDK A;  1KGS A;  2FEZ A;  4I0A A;  3E5Q A;  1FY7 A;  2A61 A;  3F23 A;  3FXQ A;  4PGG A;  2DW4 A;  1PP8 F;  3GXO A;  3EYY A;  3Q9V A;  2EFQ A;  1K7A A;  4HF1 A;  2RV8 A;  3F22 A;  1U6G A;  2VBY A;  3I58 A;  4IF4 A;  4IJA A;  2KIM A;  4EV0 A;  2Y75 A;  1S29 A;  1R7J A;  1XGN A;  5LGU A;  4Q5S F;  1XGO A;  1FYK A;  2ZKZ A;  4WCG A;  1LJ9 A;  2L4A A;  5D6E A;  1O3Q A;  5FO5 A;  3JW4 A;  1H9G A;  5L3C A;  3WTV C;  1LNW A;  1W7P D;  3DV8 A;  1UHW A;  1EH8 A;  2QLZ A;  3RIR A;  2V6C A;  4CGZ A;  4BNC A;  2EA4 A;  3WTU C;  1ZGA A;  3F8M A;  2DI3 A;  2BEO A;  4M6X A;  1B9N A;  1GVJ A;  5FFZ A;  3O6B B;  4OIN F;  1TQI A;  2EFP A;  2QQA A;  2ESN A;  4MTE A;  3HSF A;  5D8L B;  5TRD A;  1W7P A;  2P4W A;  2EJR A;  1IN8 A;  3TKY A;  4U7D A;  1ZRE A;  2O0Y A;  5CVI A;  4LD5 A;  3J80 K;  1WRJ A;  2O8X A;  3ZMU A;  2GZW A;  2Y48 A;  2ZNY A;  2MH9 A;  4HF0 A;  5DD8 A;  1ZH5 A;  5HLI A;  4GO1 A;  3GX4 X;  5ERI A;  2V1D A;  1BIB A;  3TDZ C;  4G8X A;  3KP5 A;  3EET A;  2W57 A;  5E20 A;  2UXN A;  3GUD A;  4UV9 A;  4HOB A;  4IHS A;  2WV0 A;  4BXU A;  1XSD A;  2YX7 A;  2QVO A;  2OQR A;  3IHU A;  3IC7 A;  5FB2 A;  4IRH A;  3F8C A;  3I0T A;  3SFZ A;  4A0X A;  2D1V A;  5E8G A;  1KQ8 A;  2OA4 A;  2ISY A;  2Z99 A;  4ENN A;  2L01 A;  4N9H A;  3KP4 A;  3V4G A;  3E6C C;  1FP2 A;  2LF8 A;  1ON2 A;  5AON A;  2OQG A;  4ZYD A;  3WTY C;  2RC4 A;  3HUG A;  2V9V A;  3IRR A;  3VB2 A;  4Q48 A;  4FT8 A;  3R6S A;  3WTS C;  4JQF A;  2H6C A;  2CG4 A;  3I53 A;  1UCR A;  2BE5 F;  1J59 A;  2MA3 A;  4MEY F;  1YLF A;  2LKP A;  2A68 F;  2HTS A;  2VC0 A;  5LGN A;  2D1H A;  3P7N A;  3ABT A;  3TOB A;  2NRA C;  4OIQ F;  3M9A A;  2IVM A;  2F2E A;  1XD7 A;  2M5W A;  4L5I A;  5BPI A;  1TW2 A;  2LNB A;  2OU2 A;  3KP6 A;  1Z6T A;  3HHG A;  3QP5 A;  4ESF A;  2EV0 A;  4I0B A;  3KEQ A;  3J80 Z;  2O03 A;  2DAO A;  1ZHF A;  3QPH A;  4M9X A;  1AWC A;  3VOE A;  2MBF A;  4WXH A;  4L0Z B;  2L54 A;  3LA2 A;  1ZAR A;  4BYY A;  4KNY A;  1SMY F;  1U2W A;  3MAJ A;  2GXG A;  1T0F A;  5EEG A;  2G9W A;  1MGT A;  1YW9 A;  3FMR A;  2FBH A;  2P7C B;  1JXS A;  3ZMD A;  2HTJ A;  3WTW C;  4AIJ A;  4M6Y A;  4ESJ A;  5BQT A;  2EB7 A;  1S8N A;  4MEX F;  3P9I A;  1YW8 A;  2JPC A;  2W24 A;  2R7D A;  3N4M A;  1TQP A;  3EQL F;  4NB5 A;  5JFR A;  1QZY A;  4HAM A;  4B8X A;  2WC2 A;  4PZJ A;  1H0M A;  2KIU A;  3I59 B;  1O7F A;  4U0W A;  1W5S A;  4PGH A;  2G7U A;  1FBS A;  5CVR A;  1CF7 A;  2FXA A;  2RNJ A;  1XN7 A;  2HFH A;  2CQK A;  5HS9 A;  1UFM A;  3DQV C;  2W84 A;  1XB4 A;  3MEX A;  5J8F A;  2CO5 A;  3DKW A;  3K1N A;  4LLN A;  3FMQ A;  2PN6 A;  3VOD A;  2RN7 A;  3FZV A;  2PFB A;  1G3W A;  3B02 A;  4HYE A;  3RYR A;  3HYI A;  1R58 A;  2PMU A;  3BWG A;  1GXQ A;  1MJ9 A;  3N97 A;  2RQP A;  2FU4 A;  3U1D A;  2NNN A;  1ONV A;  2ELH A;  3JAM K;  3QU3 A;  3GFI A;  3COA C;  5J8C A;  2JSC A;  3JTH A;  4HF2 A;  2YU3 A;  3K1P A;  3U2R A;  4CDG A;  2DQR A;  3BJ6 A;  1W4M A;  4WF2 A;  4WWC A;  4HLY A;  2H09 A;  3WE2 A;  4ETS A;  5JVT A;  4M71 A;  4EJT A;  4BHC A;  4QWQ A;  4NQW A;  4HQE A;  2IJL A;  3TGN A;  1I5Z A;  5HS7 A;  3RKX A;  3WGI A;  1KU9 A;  1ZGJ A;  4LB6 B;  3KP7 A;  5LHG A;  4BHP A;  1WI9 A;  2Z9O A;  3T1B A;  3GFJ A;  3QP6 A;  5DD4 A;  2O3F A;  3ISP A;  3SZT A;  2O61 A;  1XMK A;  1ZAO A;  3IL2 A;  1KQ0 A;  3I5U A;  2IT0 A;  2OAZ A;  3U9G A;  4MNU A;  4UV8 A;  3MFK A;  1Q1H A;  1F9N A;  3T8T A;  4M74 A;  3GFM A;  2ZO4 A;  1ZLK A;  5FD5 A;  1RZ4 A;  4OIR F;  5F6F A;  3HRM A;  1J5Y A;  1KYW A;  4CZZ A;  5BPD A;  3NEU A;  2KJB A;  1T6S A;  2YX4 A;  4OOI A;  3ZP5 A;  3H3U A;  3C3W A;  1TW3 A;  1O3S A;  5E1Z B;  4YFK F;  3G3Z A;  2M8E A;  1IN5 A;  2QEN A;  2P8T A;  2VN2 A;  1SFU A;  5CVU A;  4E70 A;  1OKR A;  2M30 A;  1HKT A;  1R36 A;  1XDS A;  5CLS A;  2IA2 A;  2ZBK A;  2L02 A;  2JPB A;  3FM3 A;  1O7L A;  3E3V A;  5DCM A;  2MLG A;  5LEK A;  2G7H A;  2D2W A;  2LSO A;  4BH9 A;  1B59 A;  1YO5 C;  3L00 A;  1LB2 A;  2FNP A;  1W5T A;  4G7Z F;  4TV7 A;  3JAM Z;  1PP7 U;  2ZXJ A;  3CJN A;  2HKO A;  1CGP A;  4HDV A;  4KFC A;  1H9T A;  1P4A A;  2O6G E;  2J5P A;  2Z5U A;  2PQ8 A;  4N0B A;  4KN7 X;  4Y17 A;  4HA8 A;  1GHC A;  2XUB A;  4FX4 A;  3M8F A;  3BRO A;  5FD6 A;  5DEQ A;  2HZT A;  3J7A O;  2RVC A;  1KYZ A;  1YS6 A;  2IA0 A;  1XGM A;  5D5U B;  2V79 A;  2A3S A;  4A0Z A;  2PEX A;  1T39 A;  3WTX C;  2HQR A;  2DBB A;  1FOK A;  1HW1 A;  1P4W A;  5DCF A;  1YFH A;  4EMS A;  4Q47 A;  2XAS A;  1BIA A;  4G94 A;  1X3U A;  1J7K A;  3MCZ A;  1MZB A;  1O3T A;  1TNS A;  2FRH A;  2D45 A;  4O5V A;  1IN6 A;  1FYM A;  2VON A;  4WXD A;  1IZ1 A;  2STT A;  4FX0 A;  5H6R A;  3JTG A;  4K2E A;  3M7G A;  2KJC A;  3P9C A;  5D5X B;  1U5T B;  4DQ2 A;  2PBI A;  1QQI A;  5HDG A;  1DP7 P;  4EGY A;  4MTD A;  2K4J A;  1Z7U A;  1UB9 A;  1XSV A;  2YSR A;  2F5D A;  2ADU A;  3IRQ A;  1ZLJ A;  1HKS A;  3GFL A;  3RI4 A;  4N9I A;  4LK1 F;  4MQV A;  1RI7 A;  2IA1 A;  1D5V A;  1HQC A;  5LBQ A;  3ZN1 A;  1DUX C;  1YW7 A;  4EM0 B;  2M1B A;  1UST A;  3RPU A;  2DPU A;  4KMF A;  2UWM A;  3SQN A;  1G3T A;  2QYO A;  4YII A;  1FPQ A;  1MDM B;  3WU1 B;  1VTN C;  3ZN0 A;  1BI1 A;  4CO8 A;  5ED4 A;  2KKO A;  2P6S A;  2IW5 A;  1PDN C;  3K9T A;  1OYY A;  4KIB A;  1FP1 D;  2VOO A;  5LRR A;  4LB5 A;  4G7H F;  1XGS A;  4I7H A;  2QUF A;  4CXF A;  1HXD A;  4JBA A;  4WXC A;  1K79 A;  3QRF F;  3L2C A;  4Y15 A;  5IT3 A;  3RDI A;  4KIF A;  5BMZ A;  4AIH A;  4MQ9 F;  5ILV A;  3EDP A;  1G4D A;  4GGG A;  1RNL A;  3V7S A;  5E17 F;  3P9K A;  2IRF G;  2XVC A;  3BDD A;  1QNT A;  3L7W A;  3MZY A;  2EFN A;  4OU0 A;  4Q4Z F;  4RGR A;  4XLN F;  3CUQ C;  3SHF A;  3ULQ B;  3C1D A;  4U0V A;  5ICG A;  1J9I A;  3MWM A;  1C0W A;  2CGP A;  1DPR A;  3D0S A;  4NHJ A;  4AWX B;  4P55 A;  3EUH A;  3F21 A;  1BI3 A;  5A2Q K;  1IW7 F;  2DQL A;  4L9V A;  5K1Y A;  4RB3 C;  3FXU A;  4KIC A;  1WQ2 A;  2V1U A;  2QZ8 A;  4LG0 B;  1TBX A;  3TO7 A;  4XLP F;  2FOK A;  2K02 A;  3K2Z A;  1QZZ A;  2HDC A;  2PJP A;  2H94 A;  1FSH A;  2R3S A;  1LEB A;  4P5O A;  5CVV A;  2QBY A;  3FX3 A;  3LA7 A;  1PUE E;  5FLX K;  2DK5 A;  4ENM A;  1J75 A;  1SFE A;  4ENK A;  3BY6 A;  3HTS B;  2Q8K A;  1BM9 A;  2WWY A;  5HDN A;  4KMU X;  2OZU A;  1E17 A;  3KET A;  4LJZ F;  3ZPL A;  5E8I A;  4BHB A;  3PFI A;  2HEO A;  1R1T A;  2FSW A;  5JR3 A;  3CUQ B;  2XRN A;  3TDU C;  3I4P A;  1BC7 C;  1SD7 A;  2FA5 A;  3LA3 A;  2EA2 A;  2XAQ A;  1XSX A;  1ZRD A;  4KDP A;  1YQA A;  3RKW A;  5D6F A;  4AIK A;  1FT9 A;  3TO9 A;  3DEU A;  3F6O A;  3Q5F A;  1FZP B;  3H3Z A;  4L5J A;  2LDU A;  3F8B A;  1FLI A;  4AVP A;  2VBX A;  2CWE A;  1IUY A;  3LFK A;  2DLL A;  4I98 B;  5DV5 A;  2K27 A;  1OMI A;  1F4K A;  4ZZL A;  3VFZ A;  2R7F A;  2ZFW A;  1K78 B;  3E5U A;  4UHT A;  2ZME B;  3R0J A;  2VE9 A;  4EJW A;  2XAJ A;  2X0L A;  1U78 A;  1IXR C;  4R1H A;  2E1C A;  1ZN2 A;  1KU3 A;  2RDP A;  2TDX A;  5HLG A;  3BPX A;  2FF4 A;  4HX4 A;  3R61 A;  2Z3Y A;  2COM A;  2GA2 A;  2XIG A;  3NQO A;  4F7Z A;  3ZMS A;  3KEO A;  4A0Y A;  4MGR A;  4HX8 A;  2NAZ A;  3QU6 A;  2DO7 A;  2XAG A;  2GA1 A;  2W25 A;  3SZP A;  5CJ9 A;  1Z91 A;  4GYG A;  3WTZ A;  1T38 A;  2RGV A;  3LQR A;  1ZRF A;  1R00 A;  1P92 A;  2F5F A;  1D8J A;  2XGX A;  3FMS A;  4UVA A;  4ON0 A;  1G3S A;  3HRU A;  5F64 A;  1R5H A;  5ILS A;  1Y0U A;  1I1G A;  1HBX G;  4M72 A;  3T5X A;  1UHM A;  2XRO A;  2HYF A;  1R1U A;  4LLL A;  4HBL A;  1J0R A;  3J81 K;  4L0Y B;  5HOO A;  1FWZ A;  1J2X A;  4B09 A;  3LWF A;  4PCQ A;  2OZ6 A;  1W7P B;  3OOP A;  2MD5 A;  1STZ A;  4KUM A;  2EV6 A;  3TOA A;  2STW A;  1ZG5 A;  1V4R A;  2VOP A;  2DU9 A;  2H27 A;  4RB2 C;  2BYV E;  4IRG A;  2JZY A;  1B1B A;  3BP8 A;  3GZ5 A;  2HYG D;  1FNN A;  3TQN A;  3IWZ A;  1LEA A;  4EJO A;  2MC3 A; 
#chains in the Genus database with same CATH topology
 3CCM I;  2M45 A;  2O8K A;  4LLG F;  1ZGW A;  3FXR A;  1EH6 A;  3CCU I;  2VBZ A;  5ICC A;  5IP9 J;  1KU7 A;  4ZH4 F;  2GOM A;  2O7O A;  2K9L A;  5D4S A;  4UB8 C;  2L5Q A;  2GQQ A;  3CD6 I;  1BL0 A;  4MHG A;  2CW8 A;  4AYB A;  3C18 A;  3OWT A;  4EJV A;  4ZYG A;  2K4B A;  2CQN A;  2VL8 A;  1VQN I;  3JSP A;  5DUK A;  1D3Y A;  2OC6 A;  2QWW A;  2Y31 A;  5CQG A;  5TJJ A;  1OYI A;  2KRF A;  4EJU A;  2FD5 A;  2A6E F;  2X6O A;  2CQ7 A;  1ULY A;  1TLH B;  2P6T A;  3R0A A;  4P9F A;  3RKY A;  1FBU A;  3PO3 J;  3L9F A;  2VJI A;  4A6E A;  1WWX A;  1LFU P;  5K5Q A;  3HUG B;  3G2B A;  3PUB A;  5AIQ A;  5D8K B;  4UUV A;  1NHA A;  5HLH A;  3HSR A;  3HGY A;  2DA3 A;  4AVZ A;  5L3F A;  4RLQ A;  2VOD A;  2HXO A;  2L7F P;  1WJC A;  1JJ8 C;  3SYT A;  5C4X J;  5J4Y A;  3HSE A;  3HRS A;  1IAW A;  2JTV A;  2JA6 J;  5DDG A;  3QQA A;  3PIP F;  2GXB A;  3GTL J;  4RGS A;  4IPA A;  5GPC A;  2KT0 A;  2JRT A;  5CYV A;  1JKR C;  6PAX A;  2M34 A;  2K3F A;  3HRT A;  4KT6 A;  2B0L A;  3K4C A;  4LIV A;  2GIV A;  2VQH A;  5FKL A;  2DT5 A;  1RR7 A;  5JI6 A;  3K4N A;  3KCC A;  5E3N A;  1IN4 A;  4C2T A;  2FQ3 A;  2EK5 A;  5DYM A;  4H0E A;  2A5Y B;  1YG2 A;  5J40 A;  2LY2 A;  2ZJ2 A;  2K40 A;  1RIO H;  4I76 A;  1HDD C;  1I27 A;  3LSG A;  3J81 Z;  3JRB A;  4F55 A;  5F08 A;  3F8N A;  2KPM A;  3FBI B;  1DDN A;  1Y1V J;  3AG3 H;  4Z2Y A;  2VC1 A;  2KZV A;  3K69 A;  1F5T A;  4I2O A;  4HX7 A;  1A31 A;  1IDY A;  2V1X A;  1WSU A;  3S1M J;  1YX5 A;  4ABZ A;  1RKT A;  3FBN B;  2OJE D;  4U7B A;  3CCJ I;  4A3I J;  2BV6 A;  1MSF C;  3FIS A;  2DFI A;  3WG9 A;  1S3J A;  4D9J A;  2A69 F;  3BG3 A;  3V7R A;  3A0B C;  2X6X A;  2F5C A;  2CFO A;  5H20 A;  1JE8 A;  5M5W J;  2HS5 A;  4BY7 J;  4BE2 A;  2ELK A;  2EZK A;  3F3X A;  4CCM A;  5GAD J;  1W1W E;  1BN5 A;  4P96 A;  3I4N J;  3GO5 A;  4EGZ A;  4A3M J;  4R8H A;  3PQJ A;  2KQR A;  3I71 A;  4MFD A;  2XKP A;  1RC9 A;  3BPV A;  1FOX A;  3S1Q J;  4G6D A;  4RM3 A;  3WTT C;  3IP4 B;  2LC2 A;  2P5V A;  5BS6 A;  3OOU A;  4RB0 A;  5F27 A;  2X9D A;  3VYT B;  4XRM A;  3T0Y A;  1EH7 A;  2GWR A;  2IGM A;  4KYW A;  5KK1 A;  4KIS A;  3HOT A;  1KU2 A;  4IQJ A;  2R7U A;  2DA6 A;  4LG3 A;  4UNO A;  2CSO A;  2XKO A;  3EUA A;  3W6J B;  1ZYR F;  1T98 A;  1VND A;  1VI0 A;  3SEZ A;  5KCM A;  1FC3 A;  1SEU A;  2J5O A;  4L18 B;  1BOA A;  3H5N A;  5HVQ C;  1V3F A;  4RGU A;  4YEJ A;  4XRS G;  3WU0 A;  4AD9 A;  4RB1 A;  1Z6R A;  4I09 A;  4XBF A;  4Y3O A;  5IOZ A;  3I54 A;  1Z7L A;  1JHF A;  5IYC J;  3RPQ A;  4LFU A;  1Z0X A;  2DDB A;  4LK0 F;  2XAH A;  5FKN A;  3I64 A;  1BJA A;  2RKH A;  5ICF A;  4XLE A;  1ZG1 A;  2XV4 S;  4G9Y A;  2IS4 A;  4CYD A;  2Z2S B;  2OF7 A;  3HB9 A;  5D5W B;  1B8I A;  1NTC A;  1E0E A;  3CZ6 A;  4RS8 A;  1YOV B;  1RR8 C;  1OYW A;  2XRL A;  1ZQ3 P;  2HGC A;  3IH3 A;  1SVO A;  3W6K B;  1V5E A;  1JTX A;  2HOE A;  2XGE A;  2LY1 A;  2DTR A;  2NYX A;  2LRD A;  1QO0 D;  1CF7 B;  2XAU A;  5L3E A;  1R5G A;  3I9V 2;  2GAU A;  3CLO A;  4A5N A;  3I59 A;  5FJ8 J;  2E2H J;  3BQZ A;  5E18 F;  2EIL H;  1RUN A;  5KVR A;  3KE2 A;  2VXZ A;  1HSJ A;  3QYF A;  2PJR B;  5FLV A;  3QAH A;  1DPU A;  3OYG A;  3CMA I;  4RAY A;  4ZYE A;  1YS7 A;  2KZG A;  1WGX A;  2P5K A;  1IO2 A;  1X1B A;  2KHM A;  5FLM J;  3OYA A;  4OMZ A;  1U9O A;  3A01 A;  5LHH A;  3CDI A;  1S7E A;  5IP6 A;  4DYR A;  4A3K J;  4BAC A;  4F52 A;  1KA8 A;  3ZQF A;  4D0P A;  2QQB A;  2XPW A;  2NS7 A;  1BC8 C;  4M73 A;  1ENH A;  5K7F A;  3F0C A;  3W3C A;  3KX2 A;  4A2U A;  2PG4 A;  4DZP A;  3CLQ A;  4WK8 F;  2W85 A;  1IG7 A;  2Y69 H;  5D4R A;  2R5Y A;  1R22 A;  3ZMZ A;  1WFX A;  2BY0 A;  2NVX J;  3GVA A;  1Z1D A;  3KZZ A;  2ZXI A;  3CF2 A;  3CCR I;  1VQ4 I;  3S2D J;  1P2F A;  2XGC A;  5LHI A;  1T2K A;  3JRI A;  1HST A;  4A3J J;  1PUF A;  3PNV A;  2CV1 A;  1ACI A;  2BVM A;  3KLO A;  4LGW A;  4WX9 A;  4KA4 A;  1SD5 A;  4E7S A;  2E7X A;  4KIG A;  2K9M A;  3ZQH A;  2EWN A;  4NQW B;  3REO A;  2VT3 A;  2QEX I;  4BGD A;  1XX5 A;  1D8K A;  3A03 A;  1O3R A;  2CJJ A;  1TQM A;  3A02 A;  4XLH A;  3R4K A;  1ON1 A;  3RKQ A;  3BC8 A;  1OFC X;  3WGH A;  3U1K A;  2EV5 A;  3U21 A;  4CCL A;  3ROU A;  1S72 I;  2HDW A;  4BQA A;  4YFN F;  3KLN A;  1K6O A;  3F9K A;  3G6E I;  3S16 J;  4I01 A;  2YPR A;  3H35 A;  1OCO H;  2HVR A;  2R7Z J;  5LEJ A;  1FIP A;  2AXL A;  3QOP A;  4UXN A;  2XF6 A;  4DGW B;  2NVU B;  2HDD A;  1LDD A;  1TL8 A;  3PFY A;  4PJN A;  3SFI A;  2K3P A;  2KDZ A;  4O3M A;  1R23 A;  1E3P A;  2HOA A;  1BA5 A;  1POG A;  3ZGK A;  5E79 C;  3HOY J;  3KFW X;  1R71 A;  3Q9S A;  3BOQ A;  5HNH A;  2L9S A;  2BY3 A;  2MFZ A;  2PI0 A;  5HNF A;  2QQ9 A;  2FMY A;  4XR6 A;  4HV5 A;  1OQY A;  2RNG A;  1OPC A;  2DFF A;  1I6H J;  4S0H B;  4CCK A;  2JRM A;  1IN7 A;  3K0L A;  5GAG J;  5LGT A;  2DJI A;  4ASN A;  4JK1 X;  4NBQ A;  5IY5 H;  2FE3 A;  3GWZ A;  4HDU A;  1WVR A;  3OYK A;  2M87 A;  2L4M A;  3DBH B;  4C30 A;  2NS0 A;  2O9L A;  4BBS J;  1IRG A;  1TWG J;  3LQQ A;  3A4C A;  2EIJ H;  3CCV I;  4RDU A;  4FAS D;  4OIP F;  4A5M A;  1G3Y A;  3DKY A;  2ISZ A;  3AKZ A;  1IXS B;  2DOD A;  2IBD A;  3LAJ A;  2Z33 A;  1XMA A;  3PNT A;  4HQM A;  2DTZ A;  3CUO A;  3H92 A;  2Q0O A;  3E5X A;  2AQF A;  3IKV A;  1BR4 A;  3PO2 J;  5DCM B;  4R79 A;  3IAS 2;  2E1M B;  1Y39 A;  2QSH X;  4CIC A;  4GXO A;  2X4H A;  4PUS A;  1EA3 A;  1HLV A;  3GTO J;  1MD0 A;  2BBY A;  1D0X A;  4L9J A;  5EGO B;  1BI0 A;  2BHZ A;  4IVN A;  1MBG A;  2WTE A;  1TT5 B;  2ZCW A;  3MQ0 A;  4AU7 A;  3HOS A;  4XSZ F;  4ZYH A;  4RAF A;  3DXJ F;  5J1Y A;  1MJA A;  5AIP A;  2LY9 A;  5IT9 K;  4HPQ A;  3OYE A;  2RQQ A;  3MZH A;  2KDO A;  1MBJ A;  1GV2 A;  1I1S A;  1YJ9 I;  2M4K A;  4G6Q A;  4C2U A;  3GME A;  4O6J A;  2MYS A;  4UVB A;  3LSJ A;  1JKQ C;  1BW5 A;  2WY8 Q;  2P7V B;  1U8R A;  2Y0S A;  3K2A A;  2NVQ J;  1SD6 A;  3ZR8 X;  2A6H F;  1ZRC A;  2XB0 X;  1I3Q J;  3G4S I;  5B3S H;  2R5Z B;  3E0J B;  3GEZ A;  3GZ6 A;  2DMT A;  3BZ6 A;  4D5C A;  3G73 A;  4XRF A;  1A6Q A;  1BI2 A;  2A6T A;  4QSH A;  2OTJ I;  2ETH A;  4E7L A;  1P6R A;  1KON A;  4XLC A;  1MMS A;  2PLY A;  2BGC A;  2VT2 A;  2EIN H;  2CW0 F;  3LSH A;  2FBI A;  5DUI A;  1TWH J;  1W0T A;  3LST A;  4F92 B;  4S04 A;  4BDY A;  4G7O F;  2W4S A;  1BJZ A;  1MIJ A;  1S7O A;  1SAU A;  4HST A;  2VPL A;  1JHH A;  2HPM A;  2B9S A;  2FOW A;  3L09 A;  3VYU B;  2FBK A;  1T33 A;  3PQK A;  3AFH A;  3GF2 A;  1QBJ A;  4XON A;  3ECO A;  3Q3S A;  1YYV A;  1GXP A;  4KN4 X;  1WH5 A;  3I56 I;  3ML6 A;  2CFX A;  1U3E M;  5J1R A;  2E19 A;  2HPI A;  3A0H C;  3E97 A;  1HKQ A;  3DPL C;  3S3M A;  3TP0 A;  4DBQ A;  4OAZ A;  1L0O C;  1NH3 A;  3WOD F;  3ONQ A;  3QPT A;  4E7K A;  3DFG A;  2FNA A;  3WE3 A;  4ENJ A;  2EZI A;  3HTU A;  3DU6 A;  1QGP A;  3KP3 A;  3K4B A;  3BG7 A;  5A2Q Z;  2LH9 A;  4M3F A;  3B6C A;  4Y13 A;  2XAF A;  1VQ9 I;  1Z77 A;  1OCR H;  1REP C;  4A3C J;  1LQ1 A;  2F4M B;  5ILU A;  4RM2 A;  3I55 I;  3CDH A;  4IXA A;  3V8J A;  2OD5 A;  2DA2 A;  2VB6 A;  5E1X A;  4Y7N J;  3HDD A;  1F1Z A;  2ZNZ A;  2IAI A;  1FX7 A;  2Y30 A;  4S05 A;  2L9N A;  1FMW A;  1LE8 B;  2ZFU A;  4DZJ A;  2DK8 A;  4NC8 A;  5EJC A;  2Q2E A;  2E34 A;  3GLL A;  5K5R A;  2DXI A;  1YIT I;  2M9H A;  4ESB A;  3OSF A;  2E7W A;  3ELK A;  1Z9C A;  2BOL A;  4IRI A;  2DMP A;  3ECH A;  3S2W A;  2LD5 A;  1XDU A;  1AOY A;  5FLX Z;  1O57 A;  3NRV A;  4HLX A;  3GW2 A;  2BY1 A;  2R7S A;  1HW5 A;  1IV8 A;  2HR3 A;  3DLA A;  3MMY B;  1XS9 A;  1XCV A;  5L3D A;  4DIQ A;  2LFB A;  2IPQ X;  1R1V A;  1U5T A;  3ESW B;  2E1O A;  2JA2 A;  3BTJ A;  4EM1 A;  4CSW A;  3AG2 H;  1FYL A;  4L9T A;  4DNC A;  4E6K G;  3IAM 2;  4PDK A;  1E2X A;  4I02 A;  1WJD A;  2F5E A;  5EEH A;  3IWF A;  4JX6 A;  4HV6 A;  3ZMV A;  3O3K A;  4V2G A;  2PMH A;  3O2P E;  3JRG A;  1MKM A;  3ASN H;  5IT9 Z;  1IXC A;  2XPU A;  1OR7 A;  4JP0 A;  4OAY A;  4QPQ A;  3WGG A;  4BQO A;  2DN0 A;  1N78 A;  2DMN A;  2X51 A;  2KIF A;  4FHT A;  3FK7 A;  2VE8 A;  5FFX A;  4XID A;  1B4A A;  2D5V A;  2UXX A;  3K6G A;  3KZY A;  1A35 A;  1GUU A;  3HOX J;  2E2I J;  4QLC U;  4EQQ A;  2Q1Z B;  2L3D A;  3BTC A;  2A5W A;  4YIF A;  1A5J A;  3F72 A;  2CUZ A;  4UVC A;  2JA7 J;  1QPM A;  1SMT A;  4BU2 A;  2HVQ A;  3BJO A;  3OS2 A;  3T8R A;  2H1L A;  4U88 A;  4OMY A;  2HKX A;  2DT7 B;  4M9Z A;  2R92 J;  2XF7 A;  3DBL B;  1ODD A;  2M7B A;  3R60 A;  3ABU A;  1L3L A;  2K9S A;  3LSR A;  2E1N A;  4KT5 C;  3ZMT A;  9ANT A;  1ETK A;  3ZOB A;  4XQF A;  3ZRG A;  2HOT A;  2CMP A;  1YIO A;  2X6W A;  1FSE A;  1D0Y A;  1Y6I A;  1Z05 A;  2W48 A;  3AG1 H;  2W82 A;  4OIO F;  4ZZD A;  4M3G A;  3ERM A;  4ANJ A;  3CO7 C;  1MDM A;  2FML A;  2EFO A;  5LLQ A;  2BHY A;  3DKX A;  3SEQ A;  3SXY A;  3B73 A;  3TW7 A;  1YTY A;  1HOM A;  4V2F A;  3K1M A;  4D1Q A;  4XRS A;  3ASO H;  3FM5 A;  3KYD B;  2FJ1 A;  1ZG3 A;  2A07 F;  4HRI A;  3K10 A;  3M8E A;  4UY8 I;  1TNT A;  1AKH A;  2IP2 A;  5E1W A;  3WU2 C;  2XHK A;  3GLX A;  3TO6 A;  3AAF A;  1IF1 A;  1FMV A;  4HG2 A;  2JT1 A;  5BOX A;  5FGM A;  2EZH A;  3KZI C;  2RRE A;  5F1R A;  3M1E A;  3CQZ J;  4EVI A;  1XCB A;  3EYI A;  1B72 B;  5CKT A;  4ZJZ A;  4PK4 A;  2GLO A;  1HW2 A;  3RQI A;  2P81 A;  3DTE A;  2QM3 A;  1SD4 A;  2Y0M A;  1B9M A;  1P4X A;  3S3N A;  4EAT A;  3G1L A;  3RYP A;  5K5O A;  1P7J A;  1LDJ A;  2L7K A;  1MMN A;  4J01 A;  4L9N A;  4X1E A;  4RA2 A;  3CMY A;  3KP2 A;  1UG0 A;  3CO6 C;  3JSO A;  4LIU A;  3DBR B;  2CS3 A;  3MN2 A;  5D5V B;  1ETY A;  1JGS A;  2V26 A;  5TGT A;  1LVA A;  1FIA A;  2DT6 A;  3ZXS A;  3DF8 A;  2CU7 A;  3DP7 A;  2GBY A;  3TP3 A;  4E7H A;  5ICE A;  3BJA A;  4YFX F;  5IYB J;  1HDP A;  1X3Z B;  2ZSI B;  5EDN A;  3FWE A;  5LRS A;  2K85 A;  4NDL A;  4A6D A;  2R7O A;  4B43 A;  3D5L A;  4HZF A;  4IHV A;  2L7M P;  4E4H A;  5IOY A;  2OBP A;  1MJB A;  4FCY A;  4M9S A;  3RTR A;  5JHF A;  2AS5 F;  3OL4 A;  2BW3 A;  4EM2 A;  3HIF A;  2XB5 A;  2VKH A;  2R4G A;  3X2Q H;  2QBY B;  3OYJ A;  2HWV A;  4I6Z A;  2MD0 A;  1XTA A;  4GYI A;  3ZQ7 A;  3QOD A;  3LSK A;  2R7R A;  1G6N A;  1GV5 A;  4LG0 A;  1UJ8 A;  2H6B A;  2JVG A;  2VQL A;  4MLO A;  1SAX A;  2VIX A;  1K4S A;  4HW0 A;  3LOC A;  3Q0W A;  3FF5 A;  5FRM A;  1B6A A;  1SFX A;  4RAZ A;  1ZR2 A;  2N8G A;  4IHT A;  4AM3 A;  2TRT A;  3E6D A;  2VBW A;  1IUF A;  3HHH A;  4BQQ A;  2DPD A;  3HKZ N;  2MH2 A;  1OCC H;  1RRJ A;  1FBQ A;  2CRG A;  3ERE D;  1RUO A;  2EFW A;  2HVS A;  2NNY A;  1LPQ A;  3CTA A;  1MSE C;  2K86 A;  2MLK A;  4JYK A;  3S93 A;  1IV6 A;  4QPO A;  1TTY A;  1USS A;  3VEP A;  1R4M B;  1SFO J;  1IRF A;  3FHN A;  2P5L C;  2HU9 A;  5DS9 A;  3F8F A;  2KRC A;  4CHU A;  2CQX A;  3BZC A;  4A12 A;  3DLL F;  2LOO A;  3C7J A;  2X1E A;  3FHZ A;  3KEY A;  3IH2 A;  1KQ9 A;  2VKE A;  1YIJ I;  2NVT J;  2VJ4 A;  4CA0 A;  3E6B A;  2LF7 A;  4XSX F;  2DMQ A;  1NG7 A;  1LVK A;  4LMY A;  4GCV A;  3CUQ A;  2UZK A;  2LK2 A;  4BEH A;  2DOA A;  2E36 A;  5CVJ A;  1MNE A;  2KIQ A;  3I3L A;  4XOT A;  5J6X A;  2ESH A;  4Y4R A;  4YG2 F;  3NAU A;  2DA5 A;  3LL7 A;  2ACJ A;  1YX3 A;  3V7C A;  4IHW A;  1A04 A;  5JHU A;  1U5T C;  5H6Q A;  2E5N A;  4RGX A;  1S7A A;  1LDK B;  2CYY A;  1UG2 A;  1EV7 A;  4MIM A;  4BXF A;  3QOE A;  1N77 A;  1WKM A;  3RJP A;  3HOU J;  1JKP C;  3GTG J;  4BAY A;  2C6Y A;  1P7I A;  2FX0 A;  3BZK A;  2HQN A;  5FRN A;  1I3A A;  5L3B A;  3LAP A;  5L3G A;  1Z67 A;  3F6V A;  3DPT A;  3MVP A;  3V8L A;  3E6M A;  1X1A A;  2R93 J;  5HS8 A;  5E3M A;  2JA8 J;  3H1C A;  5IP7 J;  3OYC A;  1OLT A;  5KAI C;  4P9U A;  4U0Y A;  1WHU A;  2OTL I;  3V8K A;  4CYC B;  1EJ9 A;  3IKT A;  3CDL A;  1K78 A;  3GYH X;  5J3L A;  2ZME A;  1BBY A;  2K7L A;  2X85 A;  3H5A A;  2JN6 A;  3CCY A;  1S6L A;  3OV8 A;  1I6X A;  4N4O B;  3CC2 I;  1FTZ A;  2YR2 A;  5HDK A;  3KYC B;  5IPA A;  1KGS A;  3TBI A;  3BCA A;  2FEZ A;  4I0A A;  5TIS C;  3E5Q A;  1FY7 A;  2A61 A;  5CQE A;  3F23 A;  3FXQ A;  4PGG A;  4B3A A;  4XLF A;  1GVD A;  5DM6 F;  2DW4 A;  1PP8 F;  5C3E J;  2M7A A;  4HNT A;  3GXO A;  3EYY A;  2PX9 A;  2ECC A;  3TL4 X;  3Q9V A;  2EFQ A;  4NUB A;  3L2U A;  1Z21 A;  3CMM A;  4Y33 A;  1EKE A;  2XSD C;  1K7A A;  1OCT C;  4UUS B;  4HF1 A;  3RZD J;  2RV8 A;  3F22 A;  3K4K A;  1U6G A;  1IJW C;  1JKO C;  2VBY A;  3I58 A;  4IF4 A;  4IJA A;  2F4O B;  2KIM A;  4EV0 A;  2L2O A;  1TWA J;  3HC7 A;  2DMU A;  4A3B J;  2Y75 A;  1TP4 A;  1S29 A;  5F0F A;  1W0U A;  1R7J A;  3BR3 A;  1XGN A;  5LGU A;  3H9J A;  4CUG A;  4Q5S F;  1W36 D;  1XGO A;  4BJT A;  2AHQ A;  1I50 J;  1FYK A;  2XC7 A;  2CV2 A;  4BKX A;  3ZQL A;  2ZKZ A;  2EH3 A;  3FIW A;  4WCG A;  1LJ9 A;  1N75 A;  2L4A A;  2LBF B;  5D6E A;  1O3Q A;  3GTQ J;  4FTH A;  5FO5 A;  3JW4 A;  2ID6 A;  1V54 H;  4JX5 A;  1H9G A;  2LYC A;  2ID3 A;  5L3C A;  3QYE A;  3WTV C;  3S3O A;  4FIS A;  1FJL A;  2UUZ A;  4ITV A;  4HNU A;  1NK2 P;  4DJA A;  1LNW A;  1W7P D;  4F91 B;  4IO9 F;  1QPI A;  3DV8 A;  1UHW A;  1EH8 A;  2OCE A;  2QLZ A;  3RIR A;  1M1E B;  5LD2 C;  2V6C A;  4CGZ A;  4BNC A;  1E3O C;  1YRN B;  1JT6 A;  2EA4 A;  3WTU C;  4YRV A;  3OR2 C;  2PMZ N;  1OJL A;  1ZGA A;  3F8M A;  2DI3 A;  2BEO A;  3OL3 A;  4M6X A;  1B9N A;  4PJ0 C;  1X4P A;  2MGQ A;  3FDY A;  1N25 A;  1GVJ A;  1GDT A;  4CCO A;  5FFZ A;  1Q1V A;  2WAQ N;  3S15 J;  3O6B B;  4OIN F;  1TQI A;  3HGG A;  2EFP A;  5M3M J;  2QQA A;  3OS1 A;  1X1P A;  1JGG A;  3NWT A;  3FK6 A;  3W2A A;  2ESN A;  3HL2 A;  3H36 A;  4MTE A;  3JRD A;  5EG0 A;  3HSF A;  5D8L B;  5TRD A;  4II2 A;  3BG5 A;  1W7P A;  2P4W A;  2EJR A;  3CP2 A;  3V42 A;  1AKH B;  1IN8 A;  3H5R A;  5KAF C;  2LKX A;  3TKY A;  4U7D A;  1ZRE A;  5B66 C;  2O0Y A;  5CVI A;  4LD5 A;  3J80 K;  2EQR A;  1A36 A;  1WRJ A;  2O8X A;  3ZMU A;  2GZW A;  4BY1 J;  2Y48 A;  4C3J J;  1JI8 A;  2ZNY A;  2MH9 A;  1K83 J;  3D1N I;  4HF0 A;  5DD8 A;  1ZH5 A;  1UHS A;  4GO1 A;  5HLI A;  3NAR A;  3GX4 X;  5ERI A;  3A2K A;  2BXY A;  2O5R A;  2V1D A;  2R7W A;  5GTI C;  3VYS B;  4JOM A;  1BIB A;  3TDZ C;  4G8X A;  1WJF A;  2H8R A;  2JSP A;  1ETQ A;  5BNG A;  3KP5 A;  3EET A;  2GIZ A;  2ZJP F;  2W57 A;  4RLF A;  5E20 A;  2UXN A;  1X19 A;  3GUD A;  4UV9 A;  2LKS A;  4HOB A;  2ECB A;  2I10 A;  4IHS A;  2WV0 A;  4Y52 J;  4BXU A;  4A3G J;  1XSD A;  1WJA A;  1ETV A;  2YX7 A;  2QVO A;  2OQR A;  1MNM C;  1J09 A;  1MBK A;  3IHU A;  1PJR A;  3IC7 A;  3LNQ A;  3JRE A;  5FB2 A;  1MBH A;  3F8C A;  3I0T A;  4IRH A;  3SFZ A;  4A0X A;  2D1V A;  5E8G A;  1KQ8 A;  2OA4 A;  2WAD A;  2QF7 A;  1WCM J;  2ISY A;  2Z99 A;  3RQ4 A;  3UNG C;  4ENN A;  1VQP I;  4DYQ A;  2HOS A;  4LIT A;  1NK3 P;  1F36 A;  3O8G A;  3LSI A;  2L01 A;  2ZXH A;  3HZJ A;  4N9H A;  3KP4 A;  1S9H A;  3IUO A;  3V4G A;  1X4O A;  4XN0 A;  2IEK A;  3E6C C;  2V6E A;  1MH3 A;  2GOX B;  2V1N A;  1FP2 A;  2LF8 A;  3CCL I;  3MD2 A;  3DTK A;  1ON2 A;  4A3F J;  5AON A;  2OQG A;  1F43 A;  4ZYD A;  3WTY C;  1E3H A;  2RC4 A;  3HUG A;  3KIO A;  2V9V A;  3IRR A;  3VB2 A;  4Q48 A;  1FEX A;  1QVT A;  4FT8 A;  3K4L A;  3R6S A;  3WTS C;  1JJ6 C;  4C3H J;  4JQF A;  2VQC A;  4V19 K;  2H6C A;  3C2B A;  2BVL A;  2B63 J;  2CG4 A;  4BXX J;  3I53 A;  3L2W A;  3ZQQ A;  1UCR A;  1OCZ H;  3KYL A;  2OUM A;  2BE5 F;  1HC8 A;  3M3Y J;  1VF9 A;  2K9Q A;  1J59 A;  2MA3 A;  4MEY F;  1YLF A;  3JCU C;  2LKP A;  5DTD A;  1ETO A;  2YUS A;  1DU0 A;  2A68 F;  5EZH A;  3OIO A;  1V5F A;  2HTS A;  2VC0 A;  2M4G A;  4ZYA A;  2D1H A;  2JJ7 A;  3P7N A;  3ABT A;  5LGN A;  2TCT A;  3TOB A;  4M3E A;  3CCE I;  2NRA C;  4OIQ F;  3M9A A;  4UUT A;  2IVM A;  2F2E A;  1XD7 A;  4XM3 A;  2M5W A;  4L5I A;  2R7T A;  1PYV A;  3E1S A;  2P0W A;  5BPI A;  1TW2 A;  2LNB A;  2OU2 A;  3KP6 A;  3M07 A;  1Z6T A;  1DGW Y;  2ELJ A;  3FXK A;  3HHG A;  3QP5 A;  4ESF A;  2EV0 A;  1S5L C;  2CUJ A;  1XG1 A;  2W00 A;  4I0B A;  2M0M A;  3KEQ A;  1R6R A;  2LLK A;  3J80 Z;  2O03 A;  2VI6 A;  4FQG A;  2DAO A;  1ZHF A;  3QPH A;  4M9X A;  2R7V A;  3SDB A;  3SDG A;  1AWC A;  3VOE A;  2MBF A;  3BR0 A;  4WXH A;  4L0Z B;  3TMO A;  2L54 A;  3LA2 A;  3OYI A;  1ZAR A;  2XDV A;  2BY2 A;  4BYY A;  1H89 C;  4KNY A;  3OYN A;  1SMY F;  1U2W A;  5HOD A;  2X1D A;  4C9Y A;  3MAJ A;  2GXG A;  4YEL A;  4A69 C;  1T0F A;  3K4J A;  2G9W A;  1MGT A;  1YW9 A;  3FMR A;  4P1W A;  5EEG A;  3S8P A;  2FBH A;  1K61 A;  2P7C B;  1JXS A;  3ZMD A;  1Y8R B;  2HQA A;  4HSR A;  1ZTR A;  2HTJ A;  3WTW C;  1D0Z A;  4AIJ A;  4M6Y A;  3OYB A;  1IRZ A;  1SC7 A;  1ETW A;  3IH4 A;  3M4O J;  4ESJ A;  5BQT A;  1HCR A;  4D7M A;  2EB7 A;  4KJZ A;  1HA8 A;  1H8A C;  1S8N A;  4MEX F;  3CC7 I;  3P9I A;  3OYL A;  1BR1 A;  1YW8 A;  2JPC A;  2W24 A;  4IHY A;  2R7D A;  1W36 C;  4LOC A;  2NXN B;  1B8I B;  3N4M A;  1TQP A;  3EQL F;  3FKI J;  2Y9Z A;  4NB5 A;  2COB A;  4BUP A;  5JFR A;  2F6C A;  4J00 A;  2YU9 J;  2JUG A;  1QZY A;  4ZDL A;  2WBM A;  3FXO A;  4F93 B;  2NOJ B;  3BR5 A;  4HAM A;  2ZJR F;  3G1O A;  4B8X A;  2WC2 A;  1R5I D;  4PZJ A;  1K4T A;  1RKW A;  1H0M A;  1D1A A;  2KIU A;  5DM7 F;  3I59 B;  1O7F A;  4U0W A;  2CUE A;  2ZC2 A;  1W5S A;  4PGH A;  1MMG A;  2G7U A;  1FBS A;  1VQ6 I;  4AID A;  3BQY A;  5CVR A;  2JQ7 A;  2FQ4 A;  1CF7 A;  2WY7 Q;  3Q0V A;  3AL0 C;  2FXA A;  2JA5 J;  2RNJ A;  2XF5 A;  3A01 B;  1XN7 A;  3VYR B;  2Y2Z A;  2HFH A;  1ETX A;  2CQK A;  5HS9 A;  1HF0 A;  1UFM A;  3DQV C;  2W84 A;  1VQL I;  1XB4 A;  3MEX A;  4MFE A;  5J8F A;  2M0C A;  4ZC3 A;  3MKY B;  1MBF A;  2CO5 A;  3DKW A;  3K1N A;  5KNL A;  2PJR A;  4LLN A;  3FMQ A;  4IKF A;  3HKZ A;  2M3A A;  2LTP A;  2PN6 A;  4KIT B;  5IYD J;  2JUC A;  3AG4 H;  3GBG A;  2R5Y B;  3VOD A;  2RN7 A;  1AA7 A;  3FZV A;  2PFB A;  2DA1 A;  4M6V A;  4BBR J;  1VQ5 I;  1G59 A;  1DU6 A;  2L0K A;  2NOG A;  1G3W A;  2VXD A;  3B02 A;  4HYE A;  3RYR A;  3HYI A;  1R58 A;  2PMU A;  5C4J J;  3BWG A;  1GXQ A;  1MJ9 A;  1XC5 A;  3N97 A;  2RQP A;  1K6Y A;  2FU4 A;  1PUF B;  3U1D A;  2F48 A;  2NNN A;  4XOP A;  2Y0S N;  1ONV A;  2ELH A;  1T56 A;  2JMW A;  5B1A H;  3JAM K;  4XIC A;  3QU3 A;  3GFI A;  3OMY A;  3COA C;  2KRH A;  1TWF J;  5J8C A;  2JSC A;  1V5G A;  3JTH A;  3G71 I;  4HF2 A;  3BR6 A;  2YU3 A;  3S2H J;  3K1P A;  3DTI A;  1V55 H;  3U2R A;  2QKM B;  4CDG A;  2DQR A;  2E2J J;  3BJ6 A;  1DGR M;  1W4M A;  5LFA A;  4WF2 A;  1SVL A;  4NC7 A;  4WWC A;  4HLY A;  3HXL A;  4BL0 B;  2H09 A;  3WE2 A;  4ETS A;  5JVT A;  4PJJ A;  4YIR X;  4M71 A;  4EJT A;  4BHC A;  4XKW A;  2QKL B;  4QWQ A;  4NQW A;  4HQE A;  2IJL A;  2KL4 A;  1Y56 A;  5F04 A;  1JUM A;  3TGN A;  1D5Y A;  1I5Z A;  2K9N A;  5HS7 A;  3RKX A;  3WGI A;  1KU9 A;  1ZGJ A;  4PJL A;  3GCM A;  3KP7 A;  4W1U A;  4LB6 B;  5LHG A;  4BHP A;  1WI9 A;  3B6A A;  2Z9O A;  4IL6 C;  3T1B A;  3GFJ A;  3QP6 A;  5DD4 A;  2O3F A;  3LSP A;  3ISP A;  3SZT A;  2O61 A;  1XMK A;  1ZAO A;  2E35 A;  2GXA A;  3H3V K;  3IL2 A;  1KQ0 A;  3I5U A;  2IT0 A;  2OAZ A;  3U9G A;  4XLA A;  4MNU A;  2H8W A;  2KFD A;  5C44 J;  4UV8 A;  3MFK A;  2L7Z A;  1YHQ I;  3K4M A;  1Q1H A;  1X3W B;  1F9N A;  5B1B H;  3JRC A;  1MBE A;  3HEF A;  3T8T A;  3IV5 A;  4M74 A;  3GFM A;  2ZO4 A;  1ZLK A;  5FD5 A;  1RZ4 A;  4G6T B;  4OIR F;  5F6F A;  2BXZ A;  1QVU A;  3HRM A;  1YI2 I;  5EF6 A;  5E3L A;  1AU7 A;  3A1Y A;  1J5Y A;  1KYW A;  4CZZ A;  1YJN I;  3DPU A;  5BPD A;  1QRY A;  3NEU A;  2KJB A;  1T6S A;  2YX4 A;  1SAN A;  2Z16 A;  2IS6 A;  1MH4 A;  4OOI A;  3ZP5 A;  3H3U A;  2VKV A;  3C3W A;  3PJR A;  1TW3 A;  1O3S A;  3FXJ A;  5E1Z B;  4YFK F;  3G3Z A;  1X2M A;  2M8E A;  1IN5 A;  2NS8 A;  4N4N B;  2QEN A;  2P8T A;  1JUS A;  2VN2 A;  1VQ7 I;  4EEF G;  1WJB A;  1SFU A;  3RSN A;  3EUK L;  5CVU A;  1NG6 A;  3PNY A;  4E70 A;  1OKR A;  2M30 A;  1HKT A;  1R36 A;  1TT0 A;  2EZL A;  4CCN A;  1X1C A;  2F5V A;  1XDS A;  5CLS A;  2IA2 A;  2ME0 A;  2ZBK A;  1CQT A;  2L02 A;  2JPB A;  4B47 A;  3FM3 A;  1O7L A;  3E3V A;  1T0F C;  2LG4 A;  2WB1 N;  3BR2 A;  4C3I J;  2DA7 A;  4AC0 A;  5DCM A;  2MLG A;  5LEK A;  2G7H A;  1U0J A;  2D2W A;  2LSO A;  3Q0U A;  4BH9 A;  1ZK8 A;  1B59 A;  1YO5 C;  4B4C A;  1RET A;  3W2V A;  4HEA 2;  5EGO A;  1ORK A;  3L00 A;  3GZN B;  2DA4 A;  1LB2 A;  2FNP A;  1W5T A;  2CW7 A;  4G7Z F;  4GRI A;  2IS2 A;  3S14 J;  3S1R J;  3OYF A;  4HNV A;  5M3F J;  4TV7 A;  1R9T J;  2VQG A;  3JAM Z;  1PP7 U;  2KIS A;  2ZXJ A;  3CJN A;  4M3B A;  2HKO A;  1CGP A;  2MG4 A;  2DOF A;  2WV1 A;  4HDV A;  4KFC A;  1H9T A;  1UAA A;  1UEL B;  1P4A A;  4BJ6 C;  2O6G E;  2PMZ A;  2J5P A;  3QWL A;  2DYS H;  1ERD A;  2QGU A;  2E5Z A;  4BJ5 C;  2WAQ A;  2Z5U A;  4E7I A;  3J7Y J;  3GTM J;  2PQ8 A;  1D1B A;  4N0B A;  4KN7 X;  4Y17 A;  3DEW A;  1Z3Y A;  1X2N A;  4HA8 A;  4RAG A;  2R5Z A;  1GHC A;  2WAE A;  4XK4 A;  2FUG 2;  2XUB A;  3MKL A;  4FX4 A;  3M8F A;  5K7H A;  1FOW A;  3BRO A;  1IRX A;  5FD6 A;  5DEQ A;  1UMQ A;  4W97 A;  2HZT A;  3J7A O;  4DYC A;  1OR7 C;  2RVC A;  5EZG A;  1T95 A;  1XMX A;  4RBO A;  1KYZ A;  1YS6 A;  5JLW A;  1VQ8 I;  4I99 C;  2IA0 A;  3D5R C;  1WJ5 A;  1XGM A;  5D5U B;  2V79 A;  5FKK A;  1OCP A;  2A3S A;  5F1J A;  4A0Z A;  2PEX A;  3VSL A;  3MKZ A;  1T39 A;  3WTX C;  2WAF A;  3SJM A;  2HQR A;  2DBB A;  3RCO A;  1FOK A;  5M5Y J;  1HW1 A;  1P4W A;  2A05 A;  3H9Q A;  5CPR B;  5DCF A;  3TW6 A;  1XPX A;  1YFH A;  4EMS A;  2QSG X;  4Q47 A;  4D7N A;  3BTI A;  3ABL H;  3WHC A;  2XAS A;  4CH7 A;  1BIA A;  4A3E J;  1IDZ A;  3QPS A;  4G94 A;  1X3U A;  1J7K A;  3MCZ A;  4AYB N;  4A3D J;  1MZB A;  2EIM H;  2VLA A;  2HNH A;  3OSG A;  4B1R A;  3LSM A;  1O3T A;  1TNS A;  2FRH A;  2Q2E B;  2D45 A;  1WI3 A;  4O5V A;  2JK3 A;  3ZCO A;  3HG9 A;  1IN6 A;  3BLY A;  1FYM A;  2VON A;  4WXD A;  1IZ1 A;  2STT A;  4FX0 A;  2YS9 A;  5H6R A;  3JTG A;  4K2E A;  3M8J A;  3M7G A;  1SVM A;  2KJC A;  5J47 A;  3P9C A;  3CJR B;  5D5X B;  4OWR B;  2VPR A;  1U5T B;  4DQ2 A;  1LE8 A;  3CC4 I;  4BE0 A;  1W5C C;  2PBI A;  4II3 A;  1EF4 A;  1QQI A;  5HDG A;  1DP7 P;  3RPU D;  2V7F A;  2AXT C;  1P9Q C;  3G1M A;  4EGY A;  4G12 A;  3WHB A;  2XSJ C;  4MTD A;  2K4J A;  2X48 A;  4ZTF A;  3BG6 A;  2GM4 A;  2R7Q A;  1VQO I;  3L2Q A;  2EBI A;  2R0Q C;  1Z7U A;  1UB9 A;  1XSV A;  3OIQ A;  2QQ8 A;  2YSR A;  2F5D A;  2ADU A;  2W7N A;  2VUM J;  3IRQ A;  4PFP A;  2E60 A;  3PL8 A;  2VJJ A;  1ZLJ A;  1Y1W J;  1HKS A;  3GFL A;  2DFH A;  3RI4 A;  4N9I A;  1G8X A;  5J1U A;  4LK1 F;  4MQV A;  1RI7 A;  1VZ0 A;  5GAE J;  2IA1 A;  4Z6Y A;  3L2R A;  3VWB A;  1D5V A;  1HQC A;  5LBQ A;  4JX4 A;  3WG7 H;  3ZN1 A;  3EPZ A;  3C2G A;  1YW7 A;  1DUX C;  2VJ5 A;  4EM0 B;  2M1B A;  1UST A;  3RPU A;  2DPU A;  3MKW B;  3HOZ J;  3BR1 A;  4KMF A;  2UWM A;  2LP0 A;  3SQN A;  1G3T A;  2DFE A;  2QYO A;  4YII A;  4AUX A;  2M8G X;  1FPQ A;  4RMN A;  1MDM B;  1TC3 C;  3GTP J;  2W1O A;  5EEA A;  3WU1 B;  1VTN C;  3J7A Y;  2DCE A;  1RPW A;  3H0D A;  3ZN0 A;  1BI1 A;  4F3Q A;  4L5E A;  1DQU A;  2KKO A;  2P6S A;  4CO8 A;  2IW5 A;  5ED4 A;  3CF5 F;  4J19 A;  1PDN C;  3K9T A;  1T8I A;  1OYY A;  4X6A J;  5JVG F;  4KIB A;  1FP1 D;  2VOO A;  5LRR A;  4LB5 A;  4G7H F;  3OS0 A;  1BW6 A;  1XGS A;  2MC4 A;  4I7H A;  1RES A;  4XNF A;  4FE4 A;  2IGK A;  2QUF A;  4CXF A;  5E3O A;  4D5F A;  1HXD A;  3RZO J;  4JBA A;  4DOZ A;  4WXC A;  3HPG A;  1K79 A;  3ZQG A;  2AQE A;  3CJQ B;  3QRF F;  2ICW G;  2RAE A;  4Y15 A;  3L2C A;  3UR3 C;  5IT3 A;  3CCQ I;  3RDI A;  4KIF A;  2E1M C;  5BMZ A;  4AIH A;  4M3D A;  4MQ9 F;  5FRO A;  5ILV A;  1G2H A;  3EDP A;  1G4D A;  1OIS A;  4GGG A;  1RNL A;  2XGD A;  3PSF A;  3V7S A;  3K70 D;  5E17 F;  1B72 A;  3P9K A;  2IRF G;  3FKJ A;  2HI3 A;  3VPR A;  2XVC A;  3BG9 A;  3BDD A;  1QNT A;  3L7W A;  3MZY A;  1ZKG A;  2EFN A;  4OU0 A;  2OV7 A;  2DJN A;  2HQ5 A;  3FXL A;  4Q4Z F;  1R4N B;  3JRF A;  1WH7 A;  2V9P A;  4RGR A;  2HYJ A;  1X1D A;  1ZR4 A;  4XLN F;  3CUQ C;  2CQQ A;  3SHF A;  3ULQ B;  3CME I;  4B48 A;  3C1D A;  4U0V A;  5ICG A;  1J9I A;  2ZXW H;  3MWM A;  1C0W A;  4XKV A;  2CGP A;  1DPR A;  3D0S A;  1X58 A;  4NHJ A;  4AWX B;  4P55 A;  3EUH A;  3F21 A;  1BI3 A;  2IXS A;  3OYD A;  5A2Q K;  1IW7 F;  2DQL A;  2I8D A;  2OPT A;  2MW8 A;  2BW3 B;  4L9V A;  5K1Y A;  2KMU A;  1FTT A;  1ZEL A;  4RB3 C;  1D1C A;  3FXU A;  4KIC A;  1WQ2 A;  4ZDP A;  4C2M J;  2V1U A;  2QZ8 A;  4LG0 B;  3PUF A;  3DEE A;  1TBX A;  3TO7 A;  4XLP F;  2FOK A;  1GT0 C;  1DP3 A;  2K02 A;  3JRH A;  3K2Z A;  4BE1 A;  1QZZ A;  2HDC A;  2PJP A;  2H94 A;  3ZQC A;  1FSH A;  2Z1D A;  2R3S A;  1LEB A;  3W2W A;  4P5O A;  1QZE A;  4PSX A;  4XN3 A;  2G0E A;  3PM1 A;  5CVV A;  2CV0 A;  4IX7 A;  2QBY A;  3FX3 A;  3I4M J;  2X6Y A;  4IEJ A;  2HXI A;  1O4X A;  3LA7 A;  1PUE E;  1QU3 A;  5FLX K;  2DK5 A;  4XKC A;  3TED A;  2KP6 A;  3L1P A;  2M2E A;  2LVS A;  4ENM A;  1J75 A;  1WPK A;  2ZME C;  1SFE A;  4DW6 A;  2DYR H;  4ENK A;  5JLX A;  4PSW A;  2E71 A;  3BY6 A;  3HTS B;  2Q8K A;  1BM9 A;  2WWY A;  5HDN A;  4KMU X;  4B3X A;  3HPH A;  2OZU A;  1E17 A;  2ME6 A;  4LJZ F;  1WJE A;  2HZD A;  3KET A;  2QA4 I;  5F0H A;  2K5C A;  3ZPL A;  1T08 B;  3PSI A;  5E8I A;  4BHB A;  3HOW J;  3PFI A;  2HEO A;  1R1T A;  2FSW A;  2IGN A;  3JRA A;  5JR3 A;  2MAB A;  2NVY J;  2XRN A;  3CUQ B;  4NC6 A;  3TDU C;  3I4P A;  1BC7 C;  3OR1 C;  4BEH B;  2CH0 A;  3HJE A;  4BQN A;  1SD7 A;  2FA5 A;  3DWL E;  5GAH J;  3LA3 A;  2EA2 A;  3S17 J;  2XAQ A;  2I5U A;  1PVE A;  5GPA A;  1XSX A;  4BDZ A;  1ZRD A;  2EPF A;  4KDP A;  1YQA A;  3RKW A;  2QCO A;  5D6F A;  4AIK A;  1FT9 A;  3TO9 A;  3DEU A;  4PJM A;  3F6O A;  2DDA A;  3Q5F A;  1FZP B;  4IHX A;  1MND A;  4QTR A;  4XOR A;  5FKO A;  4IZZ A;  3H3Z A;  1LKX A;  4L5J A;  1WZ2 A;  2LDU A;  4DBR A;  3F8B A;  1QHG A;  2L9R A;  1UZC A;  1FLI A;  3OY9 A;  4AVP A;  4MO7 A;  2VBX A;  3OIP A;  3M1C A;  1Y8Q B;  2CWE A;  3LFU A;  3LFK A;  3S32 A;  1IUY A;  2DLL A;  1KZH A;  4I98 B;  5DV5 A;  5FKM A;  3JR9 A;  3HOV J;  2K27 A;  1R49 A;  1QHH D;  1OMI A;  1F4K A;  4ZZL A;  1A6I A;  5J4V A;  4GFB A;  3VFZ A;  2R7F A;  2ZFW A;  1K78 B;  3E5U A;  3P5J A;  4UHT A;  2ZJQ F;  1APL C;  2ZME B;  3BT9 A;  1BR2 A;  1ITY A;  3DU5 A;  3R0J A;  3OYH A;  2VE9 A;  3DCF A;  4A3L J;  3VSK A;  4EJW A;  2OCC H;  1MMD A;  4ZTJ A;  2JWT A;  2XAJ A;  3QPL A;  2X0L A;  3ABK H;  1TWC J;  5GTH C;  1U78 A;  1IXR C;  4CYC A;  1TZL A;  4R1H A;  2E1C A;  1ZN2 A;  1KU3 A;  2RDP A;  3QYB A;  2TDX A;  5B5E C;  5HLG A;  3CES A;  3BPX A;  2FF4 A;  4HX4 A;  4FET A;  1I39 A;  3R61 A;  1H88 C;  1U9N A;  2COM A;  2Z3Y A;  1JT0 A;  4E7J A;  5HLT A;  2GA2 A;  4CZC A;  2IS1 A;  4GDF A;  2XIG A;  3NQO A;  4UB6 C;  3ZMS A;  4F7Z A;  3KEO A;  4A0Y A;  4MGR A;  4HX8 A;  2V9K A;  3J7Z I;  4XL9 A;  2NAZ A;  3QU6 A;  2DO7 A;  3GTJ J;  3N05 A;  2VKD A;  2XAG A;  1SFK A;  2GA1 A;  4X0G A;  4UUS A;  2AO9 A;  1U8B A;  1Y0N A;  4PFO A;  2W25 A;  3ABM H;  2V4J C;  1IGN A;  3UKG A;  3SZP A;  5CJ9 A;  2LRE A;  2XPV A;  1IC8 A;  1Z91 A;  3H9G A;  4GYG A;  3WTZ A;  1T38 A;  2RGV A;  1MMA A;  2EIK H;  3LQR A;  3NWS A;  5GP9 A;  3GTK J;  1ZRF A;  1R00 A;  1P92 A;  3BCB A;  2F5F A;  1D8J A;  3O8H A;  5M5X J;  4CCJ A;  3BTL A;  2R7X A;  2XGX A;  2QSF X;  3FMS A;  4UVA A;  4ON0 A;  3L2V A;  4A93 J;  1G3S A;  5H2F C;  1GLN A;  3HRU A;  3H0G J;  5F64 A;  2LBF A;  2WB1 A;  1R5H A;  5ILS A;  1Y0U A;  3KPH A;  3VDX A;  3FXM A;  4U87 A;  1LFB A;  4H4K C;  2CUF A;  1JTY A;  1I1G A;  1HBX G;  4M72 A;  3T5X A;  5K7Z A;  4XMY A;  1UHM A;  2XRO A;  4ZDO A;  4IOC F;  1YJW I;  2HYF A;  3HM5 A;  3ZQI A;  1R1U A;  1LFP A;  4LLL A;  4HBL A;  4IQ4 A;  2KLO A;  2DOE A;  1YRN A;  2X1C A;  1J0R A;  3EUH C;  1MW7 A;  2ZSH B;  3J81 K;  5EG0 B;  4L0Y B;  2JVH A;  5HOO A;  3MZ8 A;  3PIO F;  3OYM A;  1FWZ A;  1JUP A;  1VQM I;  1VQK I;  2WA0 A;  1J2X A;  1LUJ B;  2Y9Y A;  4NNJ A;  4B09 A;  3K7A J;  3HBL A;  2L9V A;  3LWF A;  3W6V A;  4PCQ A;  2OZ6 A;  1YE9 A;  4IOA F;  1W7P B;  3OOP A;  2MD5 A;  1STZ A;  4BS9 A;  3E7L A;  4KUM A;  2EV6 A;  3LMM A;  2LR8 A;  3TOA A;  2H1K A;  4XKB A;  2BZT A;  3K70 C;  2STW A;  1ZG5 A;  1V4R A;  3CJT B;  2F4I A;  1AHD P;  1BOB A;  2B7E A;  2LMD A;  1FOY A;  5KHD A;  2VOP A;  4E7Z A;  2DU9 A;  2H27 A;  3CCS I;  2MSY A;  4QIW N;  2BYV E;  4RB2 C;  4IRG A;  1QA6 A;  3AL0 B;  2IGO A;  2ZB9 A;  2JZY A;  1B1B A;  3BP8 A;  3GZ5 A;  3D5S C;  2HYG D;  1FNN A;  3TQN A;  4FE7 A;  3IWZ A;  1VFC A;  5EYR A;  1Z3X A;  3S1N J;  3CP8 A;  1LEA A;  4B44 A;  5F0C A;  4EJO A;  2VAS A;  3SZG A;  3C2H A;  2UV1 A;  2MC3 A; 
#chains in the Genus database with same CATH homology
 2M45 A;  4LLG F;  3FXR A;  1EH6 A;  2VBZ A;  5ICC A;  1KU7 A;  4ZH4 F;  5D4S A;  2GQQ A;  4MHG A;  3C18 A;  4EJV A;  4ZYG A;  2K4B A;  3JSP A;  5DUK A;  1D3Y A;  2QWW A;  5TJJ A;  1OYI A;  2KRF A;  4EJU A;  2A6E F;  1ULY A;  1TLH B;  2P6T A;  3R0A A;  4P9F A;  3RKY A;  1FBU A;  3L9F A;  4A6E A;  1WWX A;  5K5Q A;  5AIQ A;  4UUV A;  5D8K B;  1NHA A;  5HLH A;  3HSR A;  5L3F A;  2VOD A;  3HSE A;  3HRS A;  1IAW A;  2JTV A;  5DDG A;  2GXB A;  4RGS A;  4IPA A;  2JRT A;  5CYV A;  6PAX A;  3HRT A;  2B0L A;  2GIV A;  2DT5 A;  5JI6 A;  3KCC A;  1IN4 A;  2FQ3 A;  2EK5 A;  5DYM A;  4H0E A;  2A5Y B;  1YG2 A;  2ZJ2 A;  1RIO H;  1I27 A;  3J81 Z;  3F8N A;  1DDN A;  4Z2Y A;  2VC1 A;  3K69 A;  1F5T A;  4I2O A;  4HX7 A;  2V1X A;  1WSU A;  4U7B A;  2BV6 A;  2DFI A;  3WG9 A;  1S3J A;  2A69 F;  3V7R A;  2F5C A;  5H20 A;  1JE8 A;  2HS5 A;  3F3X A;  1BN5 A;  4P96 A;  3GO5 A;  4EGZ A;  4R8H A;  3PQJ A;  3I71 A;  2XKP A;  3BPV A;  4G6D A;  3WTT C;  2P5V A;  5BS6 A;  4RB0 A;  3T0Y A;  1EH7 A;  2GWR A;  4KYW A;  5KK1 A;  3HOT A;  1KU2 A;  4UNO A;  2CSO A;  2XKO A;  3W6J B;  1ZYR F;  1T98 A;  1FC3 A;  2J5O A;  4L18 B;  1BOA A;  5HVQ C;  1V3F A;  4RGU A;  3WU0 A;  4AD9 A;  4RB1 A;  1Z6R A;  4I09 A;  4XBF A;  3I54 A;  1JHF A;  3RPQ A;  4LFU A;  4LK0 F;  2XAH A;  3I64 A;  1BJA A;  2RKH A;  5ICF A;  1ZG1 A;  2XV4 S;  4G9Y A;  4CYD A;  5D5W B;  4RS8 A;  1OYW A;  2HGC A;  3W6K B;  2HOE A;  2DTR A;  2NYX A;  1QO0 D;  1CF7 B;  5L3E A;  1R5G A;  2GAU A;  3CLO A;  4A5N A;  3I59 A;  5E18 F;  1RUN A;  5KVR A;  3KE2 A;  2VXZ A;  1HSJ A;  3QAH A;  1DPU A;  4RAY A;  4ZYE A;  1YS7 A;  2P5K A;  4OMZ A;  5LHH A;  1KA8 A;  4D0P A;  2QQB A;  1BC8 C;  4M73 A;  4A2U A;  2PG4 A;  4WK8 F;  2W85 A;  5D4R A;  1R22 A;  3ZMZ A;  3GVA A;  1Z1D A;  3KZZ A;  1P2F A;  5LHI A;  1T2K A;  1HST A;  3KLO A;  4KA4 A;  4LGW A;  4WX9 A;  1SD5 A;  2E7X A;  4KIG A;  2EWN A;  3REO A;  2VT3 A;  1D8K A;  1O3R A;  1TQM A;  3R4K A;  1ON1 A;  3WGH A;  2EV5 A;  3ROU A;  4BQA A;  4YFN F;  3KLN A;  1K6O A;  4I01 A;  2YPR A;  5LEJ A;  2AXL A;  3QOP A;  4UXN A;  1LDD A;  4O3M A;  1R23 A;  3KFW X;  3Q9S A;  3BOQ A;  2PI0 A;  2QQ9 A;  2FMY A;  4HV5 A;  1OPC A;  1IN7 A;  3K0L A;  5LGT A;  4ASN A;  4JK1 X;  4HDU A;  2FE3 A;  3GWZ A;  2M87 A;  2L4M A;  2NS0 A;  1IRG A;  3LQQ A;  4OIP F;  4A5M A;  1G3Y A;  2ISZ A;  1IXS B;  3LAJ A;  2Z33 A;  1XMA A;  4HQM A;  3CUO A;  3H92 A;  2Q0O A;  3E5X A;  3IKV A;  5DCM B;  4R79 A;  4CIC A;  4GXO A;  2X4H A;  1MD0 A;  2BBY A;  4L9J A;  1BI0 A;  4IVN A;  2WTE A;  2ZCW A;  3MQ0 A;  3HOS A;  4XSZ F;  4ZYH A;  3DXJ F;  1MJA A;  5AIP A;  5IT9 K;  3MZH A;  1I1S A;  4G6Q A;  4O6J A;  4UVB A;  2P7V B;  1U8R A;  1SD6 A;  2A6H F;  1ZRC A;  3GEZ A;  3GZ6 A;  3BZ6 A;  3G73 A;  4XRF A;  1BI2 A;  2ETH A;  1P6R A;  2PLY A;  2BGC A;  2VT2 A;  2CW0 F;  2FBI A;  5DUI A;  3LST A;  4S04 A;  4G7O F;  1S7O A;  1JHH A;  3L09 A;  2FBK A;  3PQK A;  3GF2 A;  1QBJ A;  3ECO A;  1YYV A;  1GXP A;  4KN4 X;  3ML6 A;  2CFX A;  1U3E M;  3E97 A;  1HKQ A;  3DPL C;  1L0O C;  3WOD F;  3QPT A;  3DFG A;  2FNA A;  3WE3 A;  4ENJ A;  3HTU A;  1QGP A;  3KP3 A;  5A2Q Z;  4Y13 A;  2XAF A;  1REP C;  1LQ1 A;  5ILU A;  3CDH A;  4IXA A;  3V8J A;  2OD5 A;  5E1X A;  1F1Z A;  2ZNZ A;  1FX7 A;  4S05 A;  2DK8 A;  2Q2E A;  5K5R A;  4ESB A;  2E7W A;  3ELK A;  1Z9C A;  4IRI A;  3S2W A;  3ECH A;  1XDU A;  1AOY A;  5FLX Z;  1O57 A;  3NRV A;  4HLX A;  3GW2 A;  1HW5 A;  2HR3 A;  1XCV A;  5L3D A;  2IPQ X;  1R1V A;  1U5T A;  4EM1 A;  1FYL A;  4L9T A;  4DNC A;  4PDK A;  1E2X A;  4I02 A;  2F5E A;  5EEH A;  3IWF A;  4HV6 A;  3ZMV A;  3O3K A;  2PMH A;  3O2P E;  1MKM A;  5IT9 Z;  1IXC A;  1OR7 A;  3WGG A;  4FHT A;  2KIF A;  2VE8 A;  5FFX A;  1B4A A;  2UXX A;  3KZY A;  4QLC U;  4EQQ A;  2L3D A;  4YIF A;  3F72 A;  4UVC A;  1QPM A;  1SMT A;  3BJO A;  3T8R A;  4U88 A;  4OMY A;  2HKX A;  4M9Z A;  1ODD A;  3R60 A;  3ABU A;  1L3L A;  2E1N A;  4KT5 C;  3ZMT A;  1YIO A;  1FSE A;  4OIO F;  1Z05 A;  4ZZD A;  3CO7 C;  1MDM A;  2FML A;  2EFO A;  5LLQ A;  3SXY A;  3B73 A;  1YTY A;  3K1M A;  3FM5 A;  1ZG3 A;  2A07 F;  3M8E A;  1TNT A;  2IP2 A;  5E1W A;  2XHK A;  3GLX A;  3TO6 A;  3AAF A;  1IF1 A;  2JT1 A;  5BOX A;  5FGM A;  5F1R A;  3M1E A;  4EVI A;  1XCB A;  3EYI A;  1HW2 A;  2QM3 A;  1SD4 A;  2Y0M A;  1B9M A;  1P4X A;  3RYP A;  5K5O A;  1LDJ A;  4L9N A;  3KP2 A;  3CO6 C;  3JSO A;  5D5V B;  1JGS A;  1LVA A;  3DF8 A;  3DP7 A;  5ICE A;  3BJA A;  4YFX F;  3FWE A;  5LRS A;  4A6D A;  3D5L A;  4HZF A;  2OBP A;  1MJB A;  4M9S A;  3RTR A;  2AS5 F;  4EM2 A;  3HIF A;  2QBY B;  2HWV A;  4GYI A;  3ZQ7 A;  1G6N A;  4LG0 A;  2H6B A;  1SAX A;  4HW0 A;  3FF5 A;  1B6A A;  1SFX A;  4RAZ A;  4IHT A;  3E6D A;  2VBW A;  3HHH A;  2DPD A;  2MH2 A;  1FBQ A;  3ERE D;  1RUO A;  2EFW A;  2NNY A;  3CTA A;  2K86 A;  2MLK A;  1TTY A;  1USS A;  3VEP A;  1IRF A;  2P5L C;  4CHU A;  3F8F A;  4A12 A;  3C7J A;  3FHZ A;  1KQ9 A;  3E6B A;  2LF7 A;  4XSX F;  4LMY A;  4GCV A;  3CUQ A;  2UZK A;  5CVJ A;  5J6X A;  2ESH A;  4YG2 F;  2ACJ A;  3V7C A;  1A04 A;  5JHU A;  1U5T C;  5H6Q A;  4RGX A;  1S7A A;  1LDK B;  2CYY A;  1EV7 A;  1WKM A;  3RJP A;  4BAY A;  2C6Y A;  2HQN A;  5L3B A;  3LAP A;  5L3G A;  3F6V A;  3DPT A;  3V8L A;  3E6M A;  5HS8 A;  4P9U A;  4U0Y A;  3V8K A;  3IKT A;  1K78 A;  3GYH X;  2ZME A;  1BBY A;  2K7L A;  3OV8 A;  1S6L A;  1I6X A;  2YR2 A;  5HDK A;  1KGS A;  2FEZ A;  4I0A A;  3E5Q A;  1FY7 A;  2A61 A;  3F23 A;  3FXQ A;  4PGG A;  2DW4 A;  1PP8 F;  3GXO A;  3EYY A;  3Q9V A;  2EFQ A;  1K7A A;  4HF1 A;  2RV8 A;  3F22 A;  1U6G A;  2VBY A;  3I58 A;  4IF4 A;  4IJA A;  2KIM A;  4EV0 A;  2Y75 A;  1S29 A;  1R7J A;  1XGN A;  5LGU A;  4Q5S F;  1XGO A;  1FYK A;  2ZKZ A;  4WCG A;  1LJ9 A;  2L4A A;  5D6E A;  1O3Q A;  5FO5 A;  3JW4 A;  1H9G A;  5L3C A;  3WTV C;  1LNW A;  1W7P D;  3DV8 A;  1UHW A;  1EH8 A;  2QLZ A;  3RIR A;  2V6C A;  4CGZ A;  4BNC A;  2EA4 A;  3WTU C;  1ZGA A;  3F8M A;  2DI3 A;  2BEO A;  4M6X A;  1B9N A;  1GVJ A;  5FFZ A;  3O6B B;  4OIN F;  1TQI A;  2EFP A;  2QQA A;  2ESN A;  4MTE A;  3HSF A;  5D8L B;  5TRD A;  1W7P A;  2P4W A;  2EJR A;  1IN8 A;  3TKY A;  4U7D A;  1ZRE A;  2O0Y A;  5CVI A;  4LD5 A;  3J80 K;  1WRJ A;  2O8X A;  3ZMU A;  2GZW A;  2Y48 A;  2ZNY A;  2MH9 A;  4HF0 A;  5DD8 A;  1ZH5 A;  5HLI A;  4GO1 A;  3GX4 X;  5ERI A;  2V1D A;  1BIB A;  3TDZ C;  4G8X A;  3KP5 A;  3EET A;  2W57 A;  5E20 A;  2UXN A;  3GUD A;  4UV9 A;  4HOB A;  4IHS A;  2WV0 A;  4BXU A;  1XSD A;  2YX7 A;  2QVO A;  2OQR A;  3IHU A;  3IC7 A;  5FB2 A;  4IRH A;  3F8C A;  3I0T A;  3SFZ A;  4A0X A;  2D1V A;  5E8G A;  1KQ8 A;  2OA4 A;  2ISY A;  2Z99 A;  4ENN A;  2L01 A;  4N9H A;  3KP4 A;  3V4G A;  3E6C C;  1FP2 A;  2LF8 A;  1ON2 A;  5AON A;  2OQG A;  4ZYD A;  3WTY C;  2RC4 A;  3HUG A;  2V9V A;  3IRR A;  3VB2 A;  4Q48 A;  4FT8 A;  3R6S A;  3WTS C;  4JQF A;  2H6C A;  2CG4 A;  3I53 A;  1UCR A;  2BE5 F;  1J59 A;  2MA3 A;  4MEY F;  1YLF A;  2LKP A;  2A68 F;  2HTS A;  2VC0 A;  5LGN A;  2D1H A;  3P7N A;  3ABT A;  3TOB A;  2NRA C;  4OIQ F;  3M9A A;  2IVM A;  2F2E A;  1XD7 A;  2M5W A;  4L5I A;  5BPI A;  1TW2 A;  2LNB A;  2OU2 A;  3KP6 A;  1Z6T A;  3HHG A;  3QP5 A;  4ESF A;  2EV0 A;  4I0B A;  3KEQ A;  3J80 Z;  2O03 A;  2DAO A;  1ZHF A;  3QPH A;  4M9X A;  1AWC A;  3VOE A;  2MBF A;  4WXH A;  4L0Z B;  2L54 A;  3LA2 A;  1ZAR A;  4BYY A;  4KNY A;  1SMY F;  1U2W A;  3MAJ A;  2GXG A;  1T0F A;  5EEG A;  2G9W A;  1MGT A;  1YW9 A;  3FMR A;  2FBH A;  2P7C B;  1JXS A;  3ZMD A;  2HTJ A;  3WTW C;  4AIJ A;  4M6Y A;  4ESJ A;  5BQT A;  2EB7 A;  1S8N A;  4MEX F;  3P9I A;  1YW8 A;  2JPC A;  2W24 A;  2R7D A;  3N4M A;  1TQP A;  3EQL F;  4NB5 A;  5JFR A;  1QZY A;  4HAM A;  4B8X A;  2WC2 A;  4PZJ A;  1H0M A;  2KIU A;  3I59 B;  1O7F A;  4U0W A;  1W5S A;  4PGH A;  2G7U A;  1FBS A;  5CVR A;  1CF7 A;  2FXA A;  2RNJ A;  1XN7 A;  2HFH A;  2CQK A;  5HS9 A;  1UFM A;  3DQV C;  2W84 A;  1XB4 A;  3MEX A;  5J8F A;  2CO5 A;  3DKW A;  3K1N A;  4LLN A;  3FMQ A;  2PN6 A;  3VOD A;  2RN7 A;  3FZV A;  2PFB A;  1G3W A;  3B02 A;  4HYE A;  3RYR A;  3HYI A;  1R58 A;  2PMU A;  3BWG A;  1GXQ A;  1MJ9 A;  3N97 A;  2RQP A;  2FU4 A;  3U1D A;  2NNN A;  1ONV A;  2ELH A;  3JAM K;  3QU3 A;  3GFI A;  3COA C;  5J8C A;  2JSC A;  3JTH A;  4HF2 A;  2YU3 A;  3K1P A;  3U2R A;  4CDG A;  2DQR A;  3BJ6 A;  1W4M A;  4WF2 A;  4WWC A;  4HLY A;  2H09 A;  3WE2 A;  4ETS A;  5JVT A;  4M71 A;  4EJT A;  4BHC A;  4QWQ A;  4NQW A;  4HQE A;  2IJL A;  3TGN A;  1I5Z A;  5HS7 A;  3RKX A;  3WGI A;  1KU9 A;  1ZGJ A;  4LB6 B;  3KP7 A;  5LHG A;  4BHP A;  1WI9 A;  2Z9O A;  3T1B A;  3GFJ A;  3QP6 A;  5DD4 A;  2O3F A;  3ISP A;  3SZT A;  2O61 A;  1XMK A;  1ZAO A;  3IL2 A;  1KQ0 A;  3I5U A;  2IT0 A;  2OAZ A;  3U9G A;  4MNU A;  4UV8 A;  3MFK A;  1Q1H A;  1F9N A;  3T8T A;  4M74 A;  3GFM A;  2ZO4 A;  1ZLK A;  5FD5 A;  1RZ4 A;  4OIR F;  5F6F A;  3HRM A;  1J5Y A;  1KYW A;  4CZZ A;  5BPD A;  3NEU A;  2KJB A;  1T6S A;  2YX4 A;  4OOI A;  3ZP5 A;  3H3U A;  3C3W A;  1TW3 A;  1O3S A;  5E1Z B;  4YFK F;  3G3Z A;  2M8E A;  1IN5 A;  2QEN A;  2P8T A;  2VN2 A;  1SFU A;  5CVU A;  4E70 A;  1OKR A;  2M30 A;  1HKT A;  1R36 A;  1XDS A;  5CLS A;  2IA2 A;  2ZBK A;  2L02 A;  2JPB A;  3FM3 A;  1O7L A;  3E3V A;  5DCM A;  2MLG A;  5LEK A;  2G7H A;  2D2W A;  2LSO A;  4BH9 A;  1B59 A;  1YO5 C;  3L00 A;  1LB2 A;  2FNP A;  1W5T A;  4G7Z F;  4TV7 A;  3JAM Z;  1PP7 U;  2ZXJ A;  3CJN A;  2HKO A;  1CGP A;  4HDV A;  4KFC A;  1H9T A;  1P4A A;  2O6G E;  2J5P A;  2Z5U A;  2PQ8 A;  4N0B A;  4KN7 X;  4Y17 A;  4HA8 A;  1GHC A;  2XUB A;  4FX4 A;  3M8F A;  3BRO A;  5FD6 A;  5DEQ A;  2HZT A;  3J7A O;  2RVC A;  1KYZ A;  1YS6 A;  2IA0 A;  1XGM A;  5D5U B;  2V79 A;  2A3S A;  4A0Z A;  2PEX A;  1T39 A;  3WTX C;  2HQR A;  2DBB A;  1FOK A;  1HW1 A;  1P4W A;  5DCF A;  1YFH A;  4EMS A;  4Q47 A;  2XAS A;  1BIA A;  4G94 A;  1X3U A;  1J7K A;  3MCZ A;  1MZB A;  1O3T A;  1TNS A;  2FRH A;  2D45 A;  4O5V A;  1IN6 A;  1FYM A;  2VON A;  4WXD A;  1IZ1 A;  2STT A;  4FX0 A;  5H6R A;  3JTG A;  4K2E A;  3M7G A;  2KJC A;  3P9C A;  5D5X B;  1U5T B;  4DQ2 A;  2PBI A;  1QQI A;  5HDG A;  1DP7 P;  4EGY A;  4MTD A;  2K4J A;  1Z7U A;  1UB9 A;  1XSV A;  2YSR A;  2F5D A;  2ADU A;  3IRQ A;  1ZLJ A;  1HKS A;  3GFL A;  3RI4 A;  4N9I A;  4LK1 F;  4MQV A;  1RI7 A;  2IA1 A;  1D5V A;  1HQC A;  5LBQ A;  3ZN1 A;  1DUX C;  1YW7 A;  4EM0 B;  2M1B A;  1UST A;  3RPU A;  2DPU A;  4KMF A;  2UWM A;  3SQN A;  1G3T A;  2QYO A;  4YII A;  1FPQ A;  1MDM B;  3WU1 B;  1VTN C;  3ZN0 A;  1BI1 A;  4CO8 A;  5ED4 A;  2KKO A;  2P6S A;  2IW5 A;  1PDN C;  3K9T A;  1OYY A;  4KIB A;  1FP1 D;  2VOO A;  5LRR A;  4LB5 A;  4G7H F;  1XGS A;  4I7H A;  2QUF A;  4CXF A;  1HXD A;  4JBA A;  4WXC A;  1K79 A;  3QRF F;  3L2C A;  4Y15 A;  5IT3 A;  3RDI A;  4KIF A;  5BMZ A;  4AIH A;  4MQ9 F;  5ILV A;  3EDP A;  1G4D A;  4GGG A;  1RNL A;  3V7S A;  5E17 F;  3P9K A;  2IRF G;  2XVC A;  3BDD A;  1QNT A;  3L7W A;  3MZY A;  2EFN A;  4OU0 A;  4Q4Z F;  4RGR A;  4XLN F;  3CUQ C;  3SHF A;  3ULQ B;  3C1D A;  4U0V A;  5ICG A;  1J9I A;  3MWM A;  1C0W A;  2CGP A;  1DPR A;  3D0S A;  4NHJ A;  4AWX B;  4P55 A;  3EUH A;  3F21 A;  1BI3 A;  5A2Q K;  1IW7 F;  2DQL A;  4L9V A;  5K1Y A;  4RB3 C;  3FXU A;  4KIC A;  1WQ2 A;  2V1U A;  2QZ8 A;  4LG0 B;  1TBX A;  3TO7 A;  4XLP F;  2FOK A;  2K02 A;  3K2Z A;  1QZZ A;  2HDC A;  2PJP A;  2H94 A;  1FSH A;  2R3S A;  1LEB A;  4P5O A;  5CVV A;  2QBY A;  3FX3 A;  3LA7 A;  1PUE E;  5FLX K;  2DK5 A;  4ENM A;  1J75 A;  1SFE A;  4ENK A;  3BY6 A;  3HTS B;  2Q8K A;  1BM9 A;  2WWY A;  5HDN A;  4KMU X;  2OZU A;  1E17 A;  3KET A;  4LJZ F;  3ZPL A;  5E8I A;  4BHB A;  3PFI A;  2HEO A;  1R1T A;  2FSW A;  5JR3 A;  3CUQ B;  2XRN A;  3TDU C;  3I4P A;  1BC7 C;  1SD7 A;  2FA5 A;  3LA3 A;  2EA2 A;  2XAQ A;  1XSX A;  1ZRD A;  4KDP A;  1YQA A;  3RKW A;  5D6F A;  4AIK A;  1FT9 A;  3TO9 A;  3DEU A;  3F6O A;  3Q5F A;  1FZP B;  3H3Z A;  4L5J A;  2LDU A;  3F8B A;  1FLI A;  4AVP A;  2VBX A;  2CWE A;  1IUY A;  3LFK A;  2DLL A;  4I98 B;  5DV5 A;  2K27 A;  1OMI A;  1F4K A;  4ZZL A;  3VFZ A;  2R7F A;  2ZFW A;  1K78 B;  3E5U A;  4UHT A;  2ZME B;  3R0J A;  2VE9 A;  4EJW A;  2XAJ A;  2X0L A;  1U78 A;  1IXR C;  4R1H A;  2E1C A;  1ZN2 A;  1KU3 A;  2RDP A;  2TDX A;  5HLG A;  3BPX A;  2FF4 A;  4HX4 A;  3R61 A;  2Z3Y A;  2COM A;  2GA2 A;  2XIG A;  3NQO A;  4F7Z A;  3ZMS A;  3KEO A;  4A0Y A;  4MGR A;  4HX8 A;  2NAZ A;  3QU6 A;  2DO7 A;  2XAG A;  2GA1 A;  2W25 A;  3SZP A;  5CJ9 A;  1Z91 A;  4GYG A;  3WTZ A;  1T38 A;  2RGV A;  3LQR A;  1ZRF A;  1R00 A;  1P92 A;  2F5F A;  1D8J A;  2XGX A;  3FMS A;  4UVA A;  4ON0 A;  1G3S A;  3HRU A;  5F64 A;  1R5H A;  5ILS A;  1Y0U A;  1I1G A;  1HBX G;  4M72 A;  3T5X A;  1UHM A;  2XRO A;  2HYF A;  1R1U A;  4LLL A;  4HBL A;  1J0R A;  3J81 K;  4L0Y B;  5HOO A;  1FWZ A;  1J2X A;  4B09 A;  3LWF A;  4PCQ A;  2OZ6 A;  1W7P B;  3OOP A;  2MD5 A;  1STZ A;  4KUM A;  2EV6 A;  3TOA A;  2STW A;  1ZG5 A;  1V4R A;  2VOP A;  2DU9 A;  2H27 A;  4RB2 C;  2BYV E;  4IRG A;  2JZY A;  1B1B A;  3BP8 A;  3GZ5 A;  2HYG D;  1FNN A;  3TQN A;  3IWZ A;  1LEA A;  4EJO A;  2MC3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...