1REPC

Crystal structure of replication initiator protein repe54 of mini-f plasmid complexed with an iteron dna
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
232
structure length
214
Chain Sequence
SPRIVQSNDLTEAAYSLSRDQKRMLYLFVDQIRKSHDGICEIHVAKYAEIFGLTSAEASKDIRQALKSFAGKEVVFYESFPWFIKPAHSPSRGLYSVHINPYLIPFFIGLQNRFTQFRLSETKEITNPYAMRLYESLCQYRKPDGSGIVSLKIDWIIERYQLPQSYQRMPDFRRRFLQVCVNEINSRTPMRLSYIEKKKGRQTTHIVFSFRDIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a prokaryotic replication initiator protein bound to DNA at 2.6 A resolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Replication/dna
molecule keywords DNA (5'-D(*CP*CP*TP*GP*TP*GP*AP*CP*AP*AP*AP*TP*TP*GP*CP*CP*C
total genus 62
structure length 214
sequence length 232
ec nomenclature
pdb deposition date 1999-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01051 Rep_3 Initiator Replication protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1repC02
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1repC01
3KP3A 2P6TA 3DPTA 4RB0A 2ELHA 2Y75A 1ZG5A 3LA2A 3SZTA 4P5OA 2GAUA 4WF2A 2K4BA 1SD5A 2RNJA 5EEGA 2LKPA 1J75A 2P4WA 3ZQ7A 2VC0A 3D0SA 1Z9CA 2OQGA 1GHCA 1IZ1A 4M72A 4S04A 3F8NA 2D1HA 2QQAA 5JI6A 3C18A 3WE2A 1BIAA 1ZG3A 4A0XA 4BHPA 3MEXA 2VC1A 5HVQC 2F5FA 4ZYDA 5L3CA 2M5WA 4RB2C 3FMRA 2L54A 1IXRC 4EM2A 2LDUA 2MC3A 4RAYA 4R79A 5LEKA 3J7AO 1L3LA 1SAXA 4S05A 4I01A 1AOYA 5H6RA 3ZP5A 3E5UA 4ESBA 2BYVE 4M6YA 1C0WA 3IWZA 5L3FA 1GXQA 1MDMA 2XAFA 2MD5A 3R61A 1E17A 2A61A 2HKXA 4LLGF 2UZKA 1V3FA 1B59A 4A6DA 3KP7A 4NQWA 4KNYA 2HZTA 2O61A 2WC2A 5HS8A 5TRDA 2PLYA 2MH9A 1KQ0A 1IN4A 1XGSA 2ESHA 1OR7A 4N9HA 5D4SA 1JE8A 3FM5A 3COAC 1UHMA 2HQRA 1XCBA 3LA7A 2YPRA 1T98A 2FXAA 1SD6A 1S8NA 1HXDA 2WV0A 3SHFA 4HX4A 1ZH5A 1MJBA 1KU7A 1JGSA 1BI0A 4EM0B 4I02A 3BPVA 3LA3A 3E6BA 5D8LB 3KP5A 1O3QA 1DDNA 3KP4A 3WTTC 3O2PE 5E1WA 5FFXA 3ZMUA 1Z05A 5BMZA 3PFIA 1IN8A 4XRFA 4Y15A 2DK5A 2EFPA 4KMFA 5E1XA 1MD0A 3LWFA 3IWFA 1RUNA 3F8BA 4UVAA 3LSTA 3ROUA 1K78A 2VBZA 3TO9A 1H9GA 1J9IA 3F8FA 1H0MA 2HDCA 3I59A 3ZMZA 3K69A 3BJOA 3HSRA 3C1DA 4QWQA 5ILUA 4EGZA 3I71A 4AWXB 1D5VA 4KMUX 3F3XA 1EH8A 3O3KA 4MNUA 3H3UA 2FBHA 2XAGA 1U5TC 2LF8A 5BQTA 2QBYA 4RGUA 5TJJA 3NQOA 3R60A 5E17F 1Y0UA 1KU9A 5E20A 3IL2A 4FX4A 1IXSB 3TKYA 2OBPA 4WK8F 2QYOA 4Q48A 2BV6A 1OYWA 2PBIA 1R1UA 1Z6TA 3W6JB 2VOOA 1KGSA 1B9NA 2PG4A 1BBYA 1BN5A 4ETSA 3I58A 2DPDA 1YW8A 1G3SA 3TDUC 3G73A 1R22A 4GYIA 3ZMSA 1P92A 2FU4A 4U0YA 4CHUA 2M1BA 2IA0A 4OIPF 4ZYGA 4ENNA 4D0PA 1BI3A 3OV8A 2EJRA 3DV8A 2CSOA 4HV5A 2EFOA 1YO5C 4LK1F 1PP7U 2NRAC 5LHGA 1ZRCA 2QZ8A 5FLXK 1WQ2A 3AAFA 1O7LA 1YS7A 4KN7X 3RI4A 1RUOA 3GZ5A 2IA2A 2E1NA 2BBYA 2LNBA 5FGMA 3TDZC 5DCFA 3FX3A 2KKOA 2CQKA 5KVRA 4H0EA 3I0TA 4MEYF 2Q8KA 1IF1A 3HRUA 4HDVA 2ZJ2A 5ICEA 2H09A 2L4MA 5DD8A 4G9YA 2DTRA 2V1DA 5BPDA 3ISPA 4EQQA 1KU2A 3BPXA 4ENKA 2BGCA 2Y0MA 1HW5A 4WXDA 1F4KA 1DP7P 2G7UA 4LB6B 3RYRA 2JTVA 4U88A 3SXYA 1LEBA 2YU3A 4I2OA 1O57A 4YFNF 3HSEA 1LQ1A 1KU3A 3VB2A 1K7AA 1ZLKA 4OMYA 3WE3A 2DI3A 2EWNA 3EYYA 4KDPA 5FFZA 1R7JA 3FXUA 3E6MA 1J0RA 1QNTA 3JTGA 1BJAA 3RPUA 1F1ZA 4ENJA 1TLHB 3MWMA 1STZA 2O3FA 3HOTA 1HW2A 3IHUA 2A69F 2H6BA 4RGRA 5BS6A 2P7CB 4UUVA 2W24A 3D5LA 2PJPA 2FMYA 3ERED 1BC7C 4L9NA 2D1VA 1YS6A 2GXBA 4KIGA 3HOSA 3K0LA 1TBXA 2MBFA 2M87A 3I54A 3WG9A 3GFIA 3F6OA 2EA2A 1HW1A 2VN2A 1Z1DA 3V8KA 1KYWA 4HX7A 3HTSB 4HQMA 3C7JA 1ZLJA 4I7HA 1IRGA 4G6QA 1NHAA 3MFKA 5IT9Z 3ZMVA 1PDNC 3CO7C 4UXNA 4K2EA 4I0AA 5ILVA 3KFWX 3JW4A 2KIFA 2QLZA 3REOA 5LRRA 3L00A 3DF8A 2ZNYA 2PN6A 1SFUA 3I64A 4HV6A 3CUQA 2DLLA 2FBIA 3T5XA 1WWXA 5DD4A 4PGHA 3CO6C 3FXRA 3ZMDA 5L3EA 4UV8A 1P6RA 3FZVA 1MKMA 3WODF 3WTUC 2VONA 3KETA 3BWGA 3RKWA 3TO7A 3K9TA 5BPIA 2COMA 3GYHX 1P2FA 3K1PA 2PQ8A 2FNAA 1HKQA 4XBFA 4BXUA 5HOOA 4XLNF 4P9FA 5FD6A 3R4KA 1USTA 3PQKA 4M9SA 2MLGA 4ENMA 1O3TA 2ZBKA 4PDKA 1LB2A 2L4AA 3F72A 1I1SA 4LMYA 2Z3YA 2FSWA 3CLOA 1ODDA 2M30A 1IN5A 2VT2A 3WGHA 3HRSA 4FHTA 4EJVA 3FHZA 4M73A 4WXCA 1CF7A 5E18F 2F5CA 1LDJA 2DQLA 1O7FA 3MCZA 1T38A 3HRTA 4CGZA 1TQIA 4LG0B 1OPCA 2BEOA 4WWCA 2XRNA 4IVNA 2EB7A 4G7OF 1JHFA 3DXJF 3FWEA 4EMSA 4L18B 4EM1A 4KIBA 4A5MA 3KEQA 3R0AA 4AD9A 1IRFA 3C3WA 2KRFA 2DO7A 2V6CA 2EK5A 2WWYA 1T0FA 1SFEA 5CJ9A 2XIGA 4U0WA 2ISYA 2VE9A 5LGTA 4LJZF 2JT1A 4GCVA 4HAMA 2EV0A 4JK1X 2H94A 2A6EF 1D3YA 1R5HA 3F8MA 3KLNA 1SMTA 5CVIA 4LGWA 4U7DA 3GEZA 4A2UA 1SD7A 3V7CA 1TW2A 4G7HF 5ERIA 4M9XA 3WTXC 3BOQA 5FD5A 1XD7A 1IW7F 4IRGA 3JSOA 3P9IA 2HS5A 4HF0A 2K02A 2QM3A 1QGPA 1BIBA 1KA8A 1K78B 2P5VA 5E8GA 2R7FA 1REPC 2LF7A 2H27A 1ONVA 2O8XA 3WTWC 2OQRA 1FBUA 5DEQA 1ZRDA 2ZFWA 3H3ZA 3I5UA 1KQ9A 5JHUA 2HYFA 3HYIA 5FB2A 2BE5F 2M8EA 5JR3A 5LHHA 4MEXF 2HOEA 1IXCA 3CUQC 3TOBA 2HTJA 3ZPLA 2GIVA 1YW9A 5L3GA 4Q47A 2P7VB 1CGPA 1FP2A 4HF1A 3JAMK 3QPTA 4RGXA 1I1GA 3RTRA 1YIOA 3R0JA 5HDGA 4CDGA 2F5DA 1DPRA 5D5XB 4ASNA 1GVJA 5J6XA 2IRFG 5LHIA 3RDIA 1V4RA 1Z7UA 2Z99A 3GLXA 4ZH4F 2IJLA 3RYPA 3TO6A 1D8KA 5HDNA 3FMQA 1FYMA 1O3SA 4A5NA 4L0YB 2MLKA 2OAZA 4HDUA 4I98B 3DFGA 1U3EM 2FA5A 1Q1HA 5DUKA 1HQCA 1QZZA 3VFZA 3WGGA 4LG0A 3CDHA 3IKVA 2G9WA 2F2EA 5DV5A 3V7SA 2DT5A 2E7WA 4QLCU 2FNPA 1DPUA 4GXOA 4GYGA 3HSFA 5BOXA 2CG4A 1YG2A 5K5OA 2JSCA 3BROA 5KK1A 4GGGA 1U5TA 3R6SA 4EGYA 2XGXA 1BC8C 1R1VA 2HFHA 4KIFA 4EJOA 1HKSA 1FNNA 4HLXA 1YFHA 1P4AA 1HSTA 1I27A 2VXZA 4ESJA 1SD4A 3BJAA 4BH9A 2K27A 1FOKA 2IVMA 2FMLA 1IN7A 1J59A 2XAJA 3EYIA 2OD5A 4YFKF 2GZWA 4BHCA 3QPHA 2Q0OA 2TDXA 5EEHA 2OA4A 1OYYA 4Q4ZF 1OMIA 2EV5A 4OMZA 1QBJA 1XMKA 1EH7A 2A6HF 4RAZA 3GXOA 4L5JA 2RVCA 5D4RA 2AXLA 2DBBA 2YX7A 2JRTA 4P96A 3CJNA 2R7DA 1AWCA 2DU9A 2DK8A 1LDDA 2PI0A 4EV0A 4AIJA 3KP6A 1U2WA 1YYVA 2DQRA 1ZGAA 3V4GA 2DW4A 4OOIA 2XV4S 3IC7A 4NHJA 2VBXA 1TNTA 2YX4A 3E3VA 1G3WA 2QENA 3GZ6A 4G6DA 3TQNA 4N9IA 1D8JA 4OIRF 3L2CA 1Z6RA 2X4HA 2VBWA 2FEZA 4AIKA 2A3SA 1R36A 5JVTA 2VBYA 1U6GA 5CVJA 1O3RA 3EETA 1R1TA 1IAWA 1R00A 4YG2F 2Z9OA 4CXFA 4HX8A 3VEPA 3JSPA 1B6AA 2QWWA 1QQIA 2V1XA 2IT0A 3NRVA 1MJAA 3DP7A 1FBSA 3BP8A 2A68F 3RJPA 3JAMZ 2RGVA 2E1CA 1RZ4A 4MQVA 2NS0A 4KT5C 3K2ZA 3FXQA 3LQRA 4KICA 1R58A 1QO0D 4G8XA 3KCCA 3F23A 3BY6A 4E70A 4MGRA 4MTDA 4N0BA 3VODA 2B0LA 2CO5A 1BOAA 2NNNA 2W57A 3BDDA 4BQAA 2K7LA 3WTVC 3MAJA 3FM3A 5CYVA 2NNYA 1FYKA 1FP1D 5K5QA 4CO8A 4YIIA 4KN4X 1L0OC 3TOAA 2R3SA 3GUDA 5ICCA 4O3MA 1TNSA 3GWZA 4ZYEA 3V8LA 4WX9A 4RB3C 3V7RA 2P5LC 3E5QA 3Q5FA 3B02A 3GFJA 3F22A 3WTSC 4L5IA 4IHSA 3DQVC 3M9AA 2UWMA 4O5VA 3QU6A 4A0YA 4IRHA 4TV7A 6PAXA 5E8IA 3KP2A 1YTYA 5J8CA 4M71A 2W85A 2HTSA 4HOBA 1W5SA 2V79A 4IHTA 3QOPA 4O6JA 2L01A 4A12A 2KIMA 2CWEA 3HTUA 3DKWA 4JBAA 4UVCA 3LQQA 4HF2A 5E1ZB 2XROA 2UXXA 4Y13A 4EJUA 3CUOA 2D45A 1B9MA 4DNCA 3RIRA 3N4MA 5DDGA 4BHBA 4OU0A 5AONA 1PUEE 5JFRA 4M9ZA 4BAYA 4ESFA 3T0YA 2KJCA 1K79A 4IF4A 3Q9VA 1OYIA 5F1RA 1G3YA 1OKRA 2WTEA 1BI2A 1Z91A 5HS9A 1MJ9A 5LGUA 4ZYHA 2X0LA 2Z5UA 5HLHA 4UVBA 3GFLA 1QPMA 1F9NA 5F6FA 2F5EA 1P4WA 1KYZA 2P5KA 1HSJA 2L02A 4R1HA 3ZMTA 1G4DA 1UB9A 5DCMA 1W7PB 3ULQB 2A5YB 5L3BA 1XMAA 1ZN2A 3VOEA 1FT9A 1JXSA 1FPQA 1PP8F 3IRQA 4CYDA 1ZAOA 4RS8A 2UXNA 3FMSA 1IUYA 1WSUA 1U8RA 5D6EA 3SQNA 2FBKA 5CLSA 4OINF 4PCQA 1MDMB 3KE2A 2NYXA 1S7AA 3KLOA 2QBYB 3K1MA 2HQNA 4KA4A 3ECOA 3GW2A 2JPBA 2LSOA 4B09A 1XN7A 2A07F 4HLYA 4IPAA 4XSZF 2XKOA 3V8JA 3MZHA 2AS5F 1G3TA 1I5ZA 4CZZA 1FC3A 4UHTA 3DEUA 2V1UA 5IT9K 4BNCA 3HUGA 2NAZA 4A6EA 2HEOA 3TGNA 4G94A 1ZG1A 1FBQA 3QRFF 2HR3A 5DUIA 3ZN1A 5LEJA 4G7ZF 3WTZA 5LLQA 4LFUA 3M1EA 4Y17A 5D6FA 3S2WA 2ZO4A 1BM9A 5K1YA 1UCRA 1R23A 2K86A 2V9VA 3J81K 4YFXF 2OU2A 4HYEA 4I09A 4M74A 2RKHA 4NB5A 5ED4A 3ECHA 2XAHA 2QQ9A 2IA1A 2VT3A 5IT3A 3O6BB 2KJBA 1ZGJA 2VODA 5ICGA 1RIOH 1XDSA 2CFXA 3P7NA 4P9UA 4P55A 4HQEA 1XDUA 1FX7A 4M6XA 1RNLA 2L3DA 2VE8A 5DCMB 4XLPF 4RB1A 2QUFA 3I53A 2FRHA 3P9KA 1W5TA 3U9GA 2YSRA 4BYYA 1WKMA 4F7ZA 2JZYA 2PEXA 3M7GA 1ULYA 1ZRFA 3GVAA 2FF4A 5ILSA 4Z2YA 4JQFA 2RDPA 2STWA 3F8CA 2HKOA 1J5YA 2ZNZA 4XSXF 3GFMA 2DFIA 3M8EA 1R5GA 4ON0A 1FLIA 5J8FA 1T39A 3KZZA 1S7OA 3FF5A 2FE3A 1USSA 2H6CA 2XAQA 4WXHA 1SFXA 2Y48A 5HLGA 2ACJA 3WU1B 3IKTA 2ZMEA 5D8KB 2RQPA 3HRMA 3HIFA 5HS7A 1XGOA 1B1BA 1ZHFA 3SZPA 3BJ6A 1U5TB 1FSHA 2RN7A 1S29A 3B73A 1FYLA 1XB4A 2DAOA 2Q2EA 2QVOA 1K6OA 5FLXZ 3RKXA 5L3DA 4UV9A 1E2XA 2HWVA 5LRSA 1EH6A 4IXAA 3J80K 4U7BA 2Z33A 4LLLA 4KYWA 1UHWA 1MZBA 2EV6A 1ON1A 1GXPA 4AVPA 3K1NA 3QU3A 1QZYA 3E6CC 2P8TA 3QAHA 1IN6A 3EDPA 1G6NA 4L9JA 2QQBA 3ABTA 5DYMA 3ABUA 1W7PD 4EJTA 2W25A 3G3ZA 4EJWA 2CYYA 1J7KA 2PMUA 4CICA 3IRRA 4RGSA 3BZ6A 5FO5A 4EVIA 5AIPA 4IJAA 1YQAA 2M45A 1W7PA 2ETHA 2DPUA 3QP5A 2J5PA 1W4MA 4L9TA 1LJ9A 5D5VB 1JHHA 4A0ZA 3T8RA 2EFQA 2ADUA 2D2WA 3Q9SA 2K4JA 4ZZLA 1VTNC 2E7XA 3U1DA 3H92A 5ICFA 1J2XA 2C6YA 2O0YA 4R8HA 3NEUA 5CVUA 4OIOF 3ML6A 2IP2A 3J80Z 4HA8A 3J81Z 2YR2A 1XCVA 3GX4X 1WI9A 2RC4A 2OZ6A 1LDKB 2W84A 3GF2A 2XUBA 3T8TA 3EUHA 3GO5A 3RKYA 3LAPA 1S3JA 3E97A 2J5OA 2EFWA 3QP6A 1XSVA 4KUMA 2EA4A 3LAJA 3RPQA 5H6QA 1FZPB 1MGTA 1TTYA 2IW5A 3W6KB 4FX0A 4PZJA 5A2QK 3L7WA 4ZZDA 2FQ3A 1LEAA 3P9CA 1FY7A 4AIHA 2FOKA 2JPCA 2ZXJA 2G7HA 3I4PA 2PFBA 1HKTA 2VOPA 4LD5A 5CVVA 1LVAA 4I0BA 3L09A 3U2RA 2P6SA 1DUXC 3F6VA 3WTYC 1YLFA 4YIFA 4HBLA 1X3UA 1A04A 3JTHA 4Q5SF 2PMHA 2MA3A 2CW0F 2XVCA 4MQ9F 4B8XA 3N97A 1FWZA 1TQMA 4HZFA 3KEOA 1ZARA 2XKPA 3MQ0A 3OOPA 3CUQB 1LNWA 2XHKA 4LLNA 1XSXA 4U0VA 3EQLF 1S6LA 4UNOA 3T1BA 5LGNA 4DQ2A 3WGIA 1TW3A 2GA1A 5D5UB 3I59B 2GQQA 2RV8A 1UFMA 2KIUA 2XASA 3WU0A 2O6GE 3SFZA 4OIQF 2ZCWA 3L9FA 2ZKZA 5A2QZ 3LFKA 2HGCA 3ELKA 3HHGA 1U78A 5LBQA 3M8FA 5H20A 4L0ZB 1ON2A 1B4AA 1P4XA 3MZYA 1SMYF 2MH2A 4FT8A 1BI1A 1CF7B 3E5XA 3PQJA 1ZREA 2ZMEB 1YW7A 1HBXG 2GXGA 5HDKA 2HYGD 1F5TA 2GWRA 1RI7A 3HHHA 2O03A 3F21A 4GO1A 2ISZA 4LK0F 2CGPA 2IPQX 3DPLC 4L9VA 1XSDA 5HLIA 3KZYA 1WRJA 4MHGA 2OZUA 1T2KA 1H9TA 4IRIA 4PGGA 4WCGA 2GA2A 1FSEA 1KQ8A 1TQPA 1ZYRF 5K5RA 2STTA 3CTAA 4HW0A 5D5WB 5AIQA 1XGMA 2ESNA 5F64A 3ZN0A 4KFCA 5CVRA 3E6DA 1EV7A 1T6SA 1I6XA 2EFNA 4MTEA 1XGNA 4LB5A
chains in the Genus database with same CATH superfamily
3KP3A 2P6TA 3ASNH 3DPTA 2Z2SB 4RB0A 2ELHA 4E7ZA 2Y75A 2R7RA 3LA2A 1ZG5A 3SDGA 3SZTA 4P5OA 2GAUA 2R7ZJ 4WF2A 2DYSH 1SD5A 2RNJA 2K4BA 2LKPA 5EEGA 1J75A 4BBSJ 2P4WA 4XRMA 2UV1A 4UUSB 1BJZA 2GXAA 2CUZA 3ZQ7A 2VC0A 3D0SA 1Z9CA 1R49A 5EEAA 5EZGA 2CQXA 2OQGA 1GHCA 1IZ1A 1MBJA 2M4GA 4M72A 3LSGA 1X1BA 4S04A 1PUFB 5B66C 3VSKA 4DGWB 3F8NA 2D1HA 5HNFA 3MZ8A 2QQAA 5JI6A 3OYEA 1VQMI 3C18A 3WE2A 1BIAA 2JA7J 1ZG3A 4A0XA 4BHPA 3H1CA 3MEXA 5KNLA 2HVRA 3EPZA 4DBRA 2DFFA 3KX2A 4A3DJ 3H9JA 2VC1A 3A02A 5HVQC 2F5FA 4PK4A 4I99C 2KPMA 2KQRA 4ZYDA 5L3CA 2NVUB 2M5WA 3TMOA 4RB2C 3FMRA 2UUZA 2L54A 1RKWA 1IXRC 4EM2A 4NC8A 2LDUA 2MC3A 4HNVA 1MMSA 5HODA 3PSFA 1Y8QB 5M3FJ 4RAYA 1JUMA 2LVSA 1ZKGA 4R79A 5LEKA 1QPIA 4DIQA 2XB5A 3CZ6A 9ANTA 3J7AO 3DBHB 1SAXA 1L3LA 4S05A 2R7WA 4I01A 3JRBA 1AOYA 4DYRA 5H6RA 3ZGKA 3JCUC 3ZP5A 3E5UA 4ESBA 2BYVE 3S1RJ 4M6YA 1C0WA 4ZDPA 3DPUA 3IWZA 5L3FA 1GXQA 1E3OC 4QSHA 5M5XJ 1MDMA 1P9QC 3DEWA 2XAFA 1HC8A 2BY3A 2MD5A 3QPLA 3AG4H 3R61A 4A3GJ 1E17A 2A61A 4OAYA 2BOLA 2IAIA 2DA6A 2HKXA 4LLGF 2UZKA 3DEEA 1V3FA 3I4NJ 1B59A 3PO3J 1WJEA 2E2JJ 2DODA 2KRCA 3FISA 4DJAA 3LSPA 4A6DA 2CRGA 2M7BA 5JHFA 3KP7A 4NQWA 4KNYA 1GV2A 2HZTA 2O61A 2B9SA 2XSDC 2WC2A 1K83J 5HS8A 5TRDA 1YJWI 1H88C 2PLYA 1VQPI 3BCBA 2MH9A 1KQ0A 1IN4A 1XGSA 2ZSIB 2ESHA 4F52A 1OR7A 2VL8A 4N9HA 5D4SA 2L9NA 1FOWA 1JE8A 3FM5A 2Y9ZA 1G2HA 3V42A 1I3AA 2NVXJ 3COAC 3G1LA 1UHMA 2HQRA 4XKWA 1XCBA 3LA7A 2YPRA 2NS8A 1T98A 2FXAA 1B72B 1SD6A 1S8NA 1HXDA 2KZVA 2WV0A 3A0HC 3SHFA 2OTJI 1Z21A 4PJJA 5K7HA 2OUMA 1OCCH 4HX4A 2FOWA 1S72I 2CU7A 3HG9A 1VQ4I 1ZH5A 1MJBA 1KU7A 2HQ5A 1JGSA 2ZXWH 1BI0A 4EM0B 2JVHA 4I02A 2A6TA 4CCNA 3BPVA 3LA3A 4UUTA 3E6BA 5D8LB 5EGOA 3KP5A 2Y9YA 1O3QA 1DDNA 1VZ0A 3KP4A 3WTTC 3TW7A 3O2PE 5E1WA 5FFXA 3ZMUA 3MKZA 1Z05A 5BMZA 1V5GA 2CMPA 3PFIA 4YEJA 5FRMA 1IN8A 4XRFA 4Y15A 2DK5A 2L5QA 2EFPA 1TT5B 2F48A 4KMFA 5E1XA 1MD0A 1ETYA 3LWFA 3IWFA 1SC7A 1RUNA 3F8BA 2K9SA 4UVAA 2MABA 3LSTA 3ROUA 1D1CA 2ZJQF 2VBZA 2I5UA 1K78A 1R5ID 3TO9A 4GFBA 3OYDA 4ZJZA 1H9GA 3GBGA 4PFPA 1J9IA 3M1CA 3F8FA 1H0MA 2HDCA 3I59A 3ZMZA 3K69A 3BJOA 3HSRA 1XX5A 2R7QA 2BVMA 3C1DA 3CP8A 3FHNA 1X19A 4V2FA 3OS2A 2DFHA 3K4NA 4QWQA 1U8BA 3UR3C 5ILUA 4EGZA 2CJJA 3I71A 3LSIA 2E35A 4AWXB 1D5VA 3OYCA 4KMUX 3F3XA 2QQ8A 5FKMA 3H36A 4M3DA 1EH8A 1VF9A 3O3KA 4MNUA 3K70C 3H3UA 1YITI 4ZC3A 1Y1WJ 2FBHA 2NOGA 2XAGA 1U5TC 4P1WA 2LF8A 5BQTA 2QBYA 4RGUA 3ZXSA 3S3OA 2VKDA 5TJJA 3NQOA 3LNQA 3L2RA 2ELKA 3R60A 1W36D 5E17F 3GTJJ 1Y0UA 2CQNA 1KU9A 3FBIB 5E20A 3IL2A 4FX4A 4B44A 4RLFA 3E0JB 1IXSB 3BQZA 2OBPA 3TKYA 2QYOA 4Q48A 4BEHA 4WK8F 3AKZA 3VYRB 2BV6A 1OYWA 3CDIA 2PBIA 4PSWA 3VYSB 1R1UA 1Z6TA 3W6JB 2VOOA 1KGSA 1B9NA 4XIDA 1IGNA 2PG4A 1BBYA 2LKSA 2R4GA 3OL3A 2OTLI 1BN5A 1Z67A 5FRNA 2DOEA 4ETSA 3I58A 2DPDA 1YW8A 1JT6A 1G3SA 4NQWB 4XKBA 3TDUC 3G73A 1R22A 4GYIA 2WA0A 1P92A 2FU4A 3ZMSA 4U0YA 3OYIA 3I56I 2M1BA 1QZEA 4CHUA 3GTGJ 3BR5A 4FQGA 1B8IB 2IA0A 4OIPF 3K4CA 4ZYGA 2RREA 3CCSI 4ENNA 4D0PA 1T0FC 1BI3A 3OV8A 2EJRA 4FE4A 3DV8A 1ZTRA 2DA3A 2CSOA 4FASD 2KLOA 3ZQIA 2WY7Q 3FXOA 5J1UA 4DBQA 4HV5A 2KP6A 2X85A 2EFOA 1YO5C 4LK1F 2Z1DA 1PP7U 2O8KA 3BR2A 2NRAC 1VQ9I 5CQEA 2VB6A 4CH7A 5LHGA 4E7LA 1ZRCA 2EQRA 1PVEA 2VJ4A 3VPRA 1TWAJ 2QZ8A 3B6CA 2WAFA 4D1QA 2XF5A 5FLXK 1WQ2A 3AAFA 1O7LA 1I50J 1YS7A 4KN7X 3RI4A 1RUOA 3AG3H 4Y4RA 4OAZA 5F27A 3GZ5A 2E2HJ 2IA2A 2KT0A 2R7TA 1D1BA 1E3HA 3GTQJ 1VQ7I 4E7IA 2E1NA 2BBYA 2WBMA 3KYCB 4W97A 2GOXB 1ZGWA 2LNBA 5FGMA 1OLTA 5EZHA 3TDZC 5DCFA 3LOCA 3FX3A 2KKOA 2X6YA 2CQKA 5KVRA 3J7ZI 4A3KJ 4H0EA 3I0TA 1BW5A 1JKQC 2AO9A 4MEYF 2Q8KA 3PUFA 1IF1A 3HRUA 4HDVA 1W0TA 2ZJ2A 5ICEA 2H09A 2L4MA 5J1RA 4IOCF 5DD8A 2HYJA 3H9QA 4G9YA 2DTRA 2KMUA 2OCCH 3OYGA 1UMQA 4DW6A 1GUUA 4KITB 2V1DA 5BPDA 2YS9A 4AU7A 2KRHA 2DN0A 3ISPA 2IEKA 1E0EA 2X48A 1KU2A 4EQQA 3BPXA 2M4KA 3CF5F 4ENKA 2BGCA 2ZC2A 2Y0MA 4I76A 1HW5A 1DGRM 4WXDA 1DGWY 4B47A 5GPAA 3ZQHA 2XPVA 1F4KA 5E79C 1DP7P 1N77A 2G7UA 4LB6B 3RYRA 2JTVA 2X6WA 4U88A 3G71I 3SXYA 4CA0A 1W36C 1Z0XA 1A31A 1Y0NA 1LEBA 4NNJA 3JRCA 2YU3A 4I2OA 1O57A 4AYBA 4MIMA 4YFNF 4LOCA 3HSEA 1WH7A 1LQ1A 1KU3A 3VB2A 3OYJA 1FIAA 1K7AA 4CSWA 3OYBA 1QVTA 1ZLKA 4OMYA 3WE3A 2DI3A 2EWNA 3EYYA 4ITVA 5E3OA 2WB1A 4KDPA 4ZDLA 5FFZA 1R7JA 3OL4A 3FXUA 1MH4A 4DZPA 4JOMA 3E6MA 5IYDJ 1J0RA 1QNTA 3JTGA 1BJAA 3HKZN 3RPUA 1DU0A 1F1ZA 4ENJA 1TLHB 2X9DA 3MWMA 1STZA 2O3FA 3HOTA 3QYBA 1SVOA 1HW2A 4PSXA 3IHUA 2A69F 1OCZH 2H6BA 3SEZA 2V26A 3GLLA 4RGRA 1W1WE 2W00A 5BS6A 2P7CB 2M0CA 3CF2A 4UUVA 4XNFA 3JREA 3E1SA 1MBHA 2W24A 1BL0A 3D5LA 2PJPA 2FMYA 3ERED 2MW8A 3HJEA 3PNVA 1BC7C 4L9NA 2W4SA 1YE9A 3OYKA 3VWBA 4LB5A 1WVRA 2D1VA 3LSKA 5EYRA 3TW6A 1YS6A 3VSLA 2GXBA 4KIGA 4NC7A 3HOSA 3K0LA 2A5WA 1TBXA 2MBFA 3CCYA 2QEXI 2M87A 2XF6A 3I54A 3WG9A 2ZMEC 3GFIA 3F6OA 4IHXA 1FMWA 2EA2A 2V7FA 1HW1A 2VQGA 2VN2A 1Z1DA 1IV8A 3CD6I 3V8KA 1KYWA 1RC9A 4HX7A 5EGOB 3HTSB 4HQMA 3C7JA 1ZLJA 4I7HA 1IRGA 1JJ6C 4G6QA 2L0KA 5FLVA 2JJ7A 1T08B 1NHAA 3PNTA 3N05A 3MFKA 5IT9Z 3PFYA 3ZMVA 4IX7A 4D7NA 1PDNC 3CO7C 4UXNA 3GTKJ 2XGDA 4RMNA 1SFOJ 2PX9A 3S2DJ 2F6CA 4K2EA 4I0AA 5ILVA 3H3VK 2JVGA 4F93B 1OJLA 4F91B 1ERDA 3MMYB 3BR1A 4IQ4A 1BR1A 4BQNA 3KFWX 3JW4A 4F3QA 2KIFA 2QLZA 3REOA 2DA7A 5LRRA 3F0CA 1Y1VJ 3L00A 1ENHA 3BLYA 3DF8A 2ZNYA 1J09A 3BCAA 3OR2C 2PN6A 1SFUA 3L1PA 2IGKA 3I64A 4HV6A 4E7KA 3CUQA 1IRZA 2A05A 5FKLA 2DLLA 2FBIA 5C44J 3T5XA 1WWXA 2DOAA 2BVLA 5DD4A 4JX5A 3HKZA 2LFBA 4BU2A 3FXKA 4PGHA 1YOVB 5M5WJ 1DQUA 3CO6C 3FXRA 1VFCA 3LMMA 3ZMDA 5L3EA 4UV8A 2N8GA 2Y31A 5KAFC 2JQ7A 3KEYA 1P6RA 3Q0UA 3FZVA 4HSRA 4RLQA 1TL8A 3GTLJ 3J7AY 1MKMA 3U1KA 3KYLA 3WODF 2NOJB 3WTUC 5IYCJ 3RZDJ 2R92J 1XS9A 4A3LJ 2VONA 3FBNB 3FDYA 5TISC 1NG6A 3KETA 3BWGA 3RKWA 3TO7A 1FTTA 3WG7H 3K9TA 2FUG2 3CMYA 5BPIA 2COMA 3HZJA 3GYHX 5J40A 1UG0A 2HDWA 1QHHD 2X1CA 5DM7F 1P2FA 3K1PA 1ZELA 4M3GA 1VQLI 2PQ8A 3HXLA 1KONA 2FNAA 1HKQA 4XBFA 2LK2A 4BXUA 5HOOA 2L9SA 4XLNF 1JKOC 2BHYA 4N4OB 4P9FA 3HOYJ 2EILH 4MLOA 5FD6A 1K6YA 3R4KA 5IOZA 1USTA 1RR8C 1JKRC 3PQKA 4M9SA 2EIMH 2L7KA 1X58A 2MLGA 3DU6A 4ENMA 1O3TA 5JVGF 3F9KA 2ZBKA 4PDKA 1LB2A 2L4AA 3F72A 1I1SA 4LMYA 1UZCA 1HLVA 2K9QA 3K4JA 2Z3YA 2FSWA 4CZCA 4NC6A 3CLOA 2IGMA 5K7FA 1ODDA 2M30A 1IN5A 2NVTJ 2VT2A 2OPTA 3WGHA 2V1NA 3HRSA 1OCPA 4FHTA 3ZCOA 4AC0A 4EJVA 3OYNA 3FHZA 4M73A 1Y56A 4WXCA 3BG6A 4BS9A 1CF7A 2K3FA 5E18F 3WHCA 1P7JA 3TL4X 2VKEA 2F5CA 1ZK8A 2K40A 1LDJA 1UG2A 2DQLA 2CW8A 3BG9A 1O7FA 3MCZA 2KDZA 3DLAA 1EJ9A 3RQ4A 2WV1A 4QPQA 3HBLA 2K85A 1T38A 1FEXA 3HRTA 2XPWA 1SEUA 2E19A 5B1BH 1TQIA 2AXTC 3M8JA 4LG0B 4CGZA 1OPCA 4LITA 2BEOA 2HU9A 4WWCA 4BBRJ 2XRNA 4BKXA 4IVNA 2EB7A 4G7OF 1JHFA 4N4NB 5GAEJ 3DXJF 5EG0B 2H8WA 1T95A 3FWEA 2K9NA 4BDZA 2W82A 2WAEA 4EMSA 4L18B 4EM1A 4KIBA 2EPFA 4AIDA 4X0GA 4A5MA 2E60A 3KEQA 3CCEI 2HQAA 3R0AA 1ORKA 3H35A 4AD9A 2M7AA 2KIQA 3CESA 1IRFA 3AFHA 4C9YA 2R7OA 3K4LA 3OYMA 3C3WA 1SFKA 1LE8B 4JX6A 1W0UA 5EF6A 2KDOA 2KRFA 2DO7A 1V55H 2V6CA 2EK5A 3DWLE 2M8GX 4BY7J 2WWYA 5F1JA 1T0FA 1Y8RB 3OOUA 1SFEA 5CJ9A 3C2HA 4M6VA 2F5VA 2XIGA 4U0WA 2IS4A 2ISYA 2ZJRF 2VE9A 5LGTA 2X51A 4LJZF 2JT1A 4GCVA 3G6EI 1BR2A 4HAMA 1VQ8I 2EV0A 4JK1X 2H94A 2A6EF 4RAGA 1ZQ3P 2E2IJ 1D3YA 2CV1A 1R5HA 1ETVA 4UB8C 2M3AA 3F8MA 2K5CA 3KLNA 1SMTA 5CVIA 1G59A 4LGWA 2L9RA 4U7DA 4BACA 3CCMI 3GEZA 1NG7A 4A2UA 1SD7A 3V7CA 2DCEA 1TW2A 4G7HF 5ERIA 2QKLB 3PUBA 4M9XA 3WTXC 3SDBA 4CYCA 3BOQA 5FD5A 3IAS2 1XD7A 1IW7F 1BOBA 4IRGA 3JSOA 3VDXA 4F92B 3P9IA 2HS5A 4HF0A 2NS7A 1YJNI 2K02A 2QM3A 4A3JJ 1OCRH 3H0GJ 1QGPA 1BIBA 1KA8A 2VASA 4DZJA 1K78B 2P5VA 5E8GA 2R7FA 3W2VA 3MD2A 4PUSA 5CQGA 1REPC 3VYUB 2LF7A 2F4MB 2H27A 1ONVA 1BR4A 4NUBA 2O8XA 2HVQA 3PO2J 2DDAA 3U21A 4A3IJ 1Z3YA 2CQ7A 3WTWC 2OQRA 1PJRA 2QSHX 1FBUA 3HOVJ 5DEQA 4HEA2 1ZRDA 4B3XA 2ZFWA 3H3ZA 3I5UA 1KQ9A 3M4OJ 1AA7A 1IDYA 1D0YA 5JHUA 2LBFB 4A93J 2EH3A 3ZQQA 2HYFA 1F43A 3HYIA 3CP2A 5FB2A 2NVQJ 2BE5F 2M8EA 5JR3A 2G0EA 3K2AA 5LHHA 5M5YJ 4MEXF 1IRXA 1K4SA 2HOEA 1IXCA 3CUQC 3CMEI 4PJMA 3TOBA 2HTJA 3ZPLA 4QPOA 2GIVA 2Q1ZB 3K4MA 1YW9A 1ETWA 1ETQA 3LSHA 4Q47A 2P7VB 5L3GA 1MW7A 2ID3A 1CGPA 4XOTA 2LP0A 1FP2A 4HF1A 1X4PA 3JAMK 4UUSA 3CCRI 3QPTA 4RGXA 1I1GA 3RTRA 1YIOA 4L5EA 3S15J 3BR0A 3LSJA 3R0JA 3L2VA 1U0JA 2LOOA 5HDGA 4CDGA 2DMPA 2F5DA 4FTHA 1WJBA 1DPRA 5D5XB 4ASNA 1GVJA 4IOAF 5J6XA 1GDTA 2IRFG 5LHIA 3RDIA 2QCOA 1V4RA 1Z7UA 2Z99A 1DU6A 5DM6F 3GLXA 4ZH4F 5KCMA 1IJWC 4JYKA 2IJLA 1LKXA 1X1CA 3RYPA 3TO6A 1YRNB 3ASOH 5GAHJ 1D8KA 4U87A 2BW3A 4M3EA 2FQ4A 1MSEC 5HDNA 5H2FC 1HF0A 3FMQA 1FYMA 3CDLA 3PL8A 3OS0A 5IP9J 1A5JA 1O3SA 4A5NA 4L0YB 2MLKA 2OAZA 4HDUA 5EJCA 1NK3P 4I98B 3EUAA 4XKVA 1RESA 3DFGA 2OJED 2KFDA 1OFCX 1U3EM 2FA5A 1Q1HA 5DUKA 1D0XA 4KISA 1HQCA 2RNGA 3DKXA 1QZZA 5J1YA 2OF7A 3VFZA 3WGGA 4LG0A 3CDHA 3IKVA 3KPHA 4LIUA 2G9WA 1XMXA 2F2EA 5DV5A 4FETA 3V7SA 3MKYB 2DT5A 2E7WA 2LBFA 4M3BA 4QLCU 5FKOA 2FNPA 1DPUA 4GXOA 4GYGA 3HSFA 5BOXA 2CG4A 5FLMJ 1YG2A 3WHBA 5K5OA 2DMQA 4QIWN 2JSCA 2D5VA 3BROA 5KK1A 5CPRB 4HG2A 4GGGA 3IAM2 2VPRA 2NVYJ 4BQQA 1WJFA 1U5TA 3R6SA 4EGYA 2XGXA 4KT6A 1BC8C 2LYCA 4A3MJ 3BR3A 1R1VA 2HFHA 2LKXA 2E1OA 5KAIC 5JLWA 2X1EA 4KIFA 3RPUD 4EJOA 4BE0A 1HKSA 2V9KA 1JI8A 4XLEA 1FNNA 3HGGA 4HLXA 4J01A 1YFHA 2XF7A 5C4XJ 1P4AA 4Z6YA 1HSTA 1I27A 1JTXA 4I6ZA 2P0WA 2VXZA 1EF4A 4ESJA 1R9TJ 3HOZJ 3HUGB 1FTZA 4BGDA 3TP3A 1SD4A 1VNDA 3G1OA 1H89C 3H5NA 3BJAA 4BH9A 1UAAA 2K27A 1MBKA 1AKHB 2AQEA 1FOKA 2Y0SA 2IVMA 3OYLA 2FMLA 1IN7A 1J59A 2XAJA 3LSMA 2LTPA 3EYIA 2OD5A 3PJRA 2GIZA 4YFKF 4A3CJ 2GZWA 2Z16A 4BHCA 3QPHA 2Q0OA 2TDXA 3PIPF 2XPUA 5EEHA 2LY1A 4IO9F 1QVUA 2OA4A 1OYYA 3M07A 3DBLB 4Q4ZF 1OMIA 2EV5A 2E5NA 3K70D 3AL0B 4OMZA 1QBJA 1XMKA 4V19K 1EH7A 4C2TA 2A6HF 4RAZA 3GXOA 4L5JA 4E4HA 1V5FA 2RVCA 1B8IA 5D4RA 2AXLA 5J4YA 4BJTA 3NWSA 4YRVA 3A01B 3IH3A 2DBBA 2YX7A 3I4MJ 1JKPC 2E1MB 3L2WA 2JRTA 3OWTA 4P96A 3CJNA 2R7DA 1AWCA 3JRAA 5TGTA 2DU9A 2DK8A 1LDDA 4EV0A 4AIJA 2PI0A 1N78A 3KP6A 1U2WA 1YYVA 4PJ0C 2DQRA 1ZGAA 3V4GA 2DTZA 2DW4A 4OOIA 2XV4S 3IC7A 2JWTA 4NHJA 2VBXA 1TNTA 1YX3A 2YX4A 5EDNA 2K9MA 3EUHC 3PNYA 3E3VA 1TC3C 4C30A 1G3WA 1RETA 1WFXA 2QENA 2AHQA 1U9OA 3CCLI 3GZ6A 4G6DA 3DKYA 2VQCA 3TQNA 4N9IA 4B3AA 1D8JA 4OIRF 3L2CA 1Z6RA 2X4HA 2RAEA 3G2BA 1I6HJ 2VBWA 2FEZA 4AIKA 1VI0A 1TP4A 3I9V2 2A3SA 1R36A 4HPQA 5JVTA 1OQYA 4EEFG 2OC6A 3X2QH 2VBYA 1U6GA 2ZXIA 5CVJA 1O3RA 2BZTA 3EETA 1R1TA 4CCLA 1IAWA 3TEDA 1R00A 4BXXJ 3KYDB 1TWFJ 4YG2F 2Z9OA 4CXFA 2Q2EB 4IHWA 4HX8A 3VEPA 3JSPA 1B6AA 2QWWA 1QQIA 2V1XA 2IT0A 4BJ5C 2DMUA 3FIWA 2BXYA 3NRVA 4G6TB 1MJAA 3DP7A 1FBSA 3BP8A 4CCOA 3TBIA 2A68F 5LFAA 2H1KA 3RJPA 2JA8J 3JAMZ 2XSJC 2RGVA 2E1CA 1N75A 1RZ4A 2DYRH 1XTAA 2NS0A 4KT5C 4MQVA 4ZYAA 3K2ZA 3FXQA 1XPXA 3LQRA 4KICA 4XR6A 1R58A 3OSFA 2IS2A 3J7YJ 1QO0D 4G8XA 3KCCA 2XRLA 3IH4A 2M2EA 2EIKH 3BY6A 3F23A 1LFPA 2JMWA 3ZR8X 4MGRA 4N0BA 4II3A 3VODA 4E70A 4MTDA 4J00A 3B6AA 3H9GA 1WH5A 2B0LA 2CO5A 2B63J 1X3ZB 2JA2A 3D1NI 1WCMJ 1K61A 1BOAA 1E3PA 2NNNA 1TZLA 2W57A 2MC4A 5FKKA 1R4NB 3S8PA 3CC4I 3BDDA 1T8IA 4BQAA 3CCVI 2K7LA 3MKLA 3WTVC 3MAJA 3FM3A 5CYVA 2NNYA 1FYKA 1FP1D 4MFDA 5K5QA 3HPGA 3DTKA 4CO8A 3WU2C 4YIIA 4KN4X 1L0OC 3TOAA 3GZNB 2R3SA 3GUDA 5ICCA 1RRJA 1TNSA 4O3MA 3GWZA 4ZYEA 3LL7A 4XICA 3V8LA 4WX9A 2FJ1A 4RB3C 3V7RA 2P5LC 3E5QA 2ZJPF 3Q5FA 2EBIA 1SVLA 4FE7A 3W3CA 3B02A 3GFJA 3F22A 3OR1C 3WTSC 2LD5A 4L5IA 4IHSA 3DQVC 3L2UA 3GTOJ 3M9AA 5GTIC 3PIOF 2UWMA 3CJRB 2Y69H 4O5VA 3ZQCA 3QU6A 3FK7A 2VI6A 3OYFA 3OSGA 3Q0WA 3S2HJ 2ZFUA 4A0YA 1MBEA 4IRHA 1A35A 4RDUA 4TV7A 6PAXA 5E8IA 3KP2A 1X2MA 4HNUA 2XGCA 3ZQLA 1LE8A 4EATA 1YTYA 5GTHC 5J8CA 2V6EA 1ZR2A 3H5RA 4II2A 2R7SA 1JGGA 4M71A 1GV5A 3Q0VA 2W85A 2HTSA 4HOBA 2EZIA 2EZHA 1W5SA 4E6KG 2V79A 2HNHA 1V54H 4IHTA 3QOPA 1MIJA 4XKCA 1TWHJ 4O6JA 3S1NJ 3FXLA 2L01A 5E3MA 4A12A 3HPHA 4E7HA 2KIMA 3DBRB 1AU7A 2CWEA 3HTUA 1FIPA 2XB0X 3DKWA 4JBAA 1MMGA 4UVCA 3S16J 3LQQA 2CQQA 3GMEA 5E1ZB 1RPWA 2XROA 3OS1A 4HF2A 2HOTA 4IHVA 2UXXA 1HCRA 3S1MJ 1BW6A 4Y13A 1IO2A 4EJUA 2CV0A 3CUOA 2D45A 1B9MA 4FCYA 4DNCA 2VJIA 3I3LA 3RIRA 3A0BC 4KJZA 3N4MA 2MFZA 3HGYA 2ECCA 1VQOI 5DDGA 4BHBA 4OU0A 4XRSA 2R7XA 3FKIJ 1GVDA 2W1OA 5AONA 5IPAA 3LFUA 3QPSA 1PUEE 3ABMH 5JFRA 4M9ZA 4BAYA 4D7MA 4PJNA 4ESFA 1WJDA 3T0YA 2KJCA 3ZQGA 1T56A 3IP4B 1K79A 4IF4A 1MNMC 1VQ6I 3Q9VA 2M0MA 1OYIA 3AG2H 5F1RA 5C4JJ 1G3YA 4HSTA 4NBQA 1OKRA 2WTEA 3CCQI 1BI2A 1Z91A 3EUKL 5HS9A 4YELA 2ID6A 4Y7NJ 1FOYA 1MJ9A 5LGUA 1VQNI 4ZYHA 2X0LA 2Z5UA 1YI2I 2PMZN 5HLHA 4UVBA 2R5YA 3GFLA 1QPMA 1IG7A 1F9NA 4XK4A 5F6FA 2F5EA 1P4WA 1KYZA 2P5KA 1HSJA 2L02A 4R1HA 2X6XA 3ZMTA 5FJ8J 1MMNA 1G4DA 2NXNB 4LG3A 1UB9A 5DCMA 1W7PB 5B1AH 2YU9J 4XOPA 3ULQB 2QKMB 4C3JJ 2CUFA 3A2KA 2A5YB 2LLKA 5L3BA 1XMAA 3DTEA 4NDLA 3SFIA 4A3BJ 2DT6A 1ZN2A 3VOEA 1OCTC 2LG4A 1FT9A 1NH3A 1JXSA 4HRIA 1FPQA 2WAQA 3QYEA 1I3QJ 4BEHB 1PP8F 3OIOA 3IRQA 1QU3A 4CYDA 3CCJI 1ZAOA 4RS8A 2UXNA 4IL6C 3S1QJ 3FMSA 2HOAA 1IUYA 1WSUA 3GCMA 2F4OB 1U8RA 1ETXA 5D6EA 2BW3B 3SQNA 2FBKA 3I55I 3O8HA 2BY2A 4UY8I 5CLSA 3SYTA 4OINF 4PCQA 1MDMB 2VIXA 4XMYA 3KE2A 1WJ5A 2NYXA 1A36A 2R5YB 1MNEA 1S7AA 3KLOA 3BG7A 4W1UA 1UJ8A 2QBYB 3K1MA 2HQNA 4KA4A 2ME6A 3ECOA 5EG0A 3GW2A 2CV2A 2JPBA 2LSOA 4B09A 1G8XA 1XN7A 1S7EA 2A07F 4HLYA 4IPAA 4XSZF 3GTPJ 3K4KA 2XKOA 1YJ9I 2ZSHB 3V8JA 1U9NA 1Z7LA 1MMAA 1QRYA 3MZHA 2AS5F 1S9HA 1G3TA 1R71A 2JUCA 1I5ZA 4CZZA 1AKHA 1FC3A 3E7LA 1MSFC 4UHTA 2L7ZA 1I39A 5GP9A 1PYVA 3DEUA 2V1UA 4D9JA 1EKEA 5IT9K 2DOFA 2MD0A 4BNCA 3HUGA 3ZQFA 2HDDA 2DMNA 4DYQA 2NAZA 4CCKA 4A6EA 2HEOA 3IH2A 3TGNA 4G94A 2JA5J 3BG3A 1V5EA 2R93J 2R7UA 1ZG1A 3NAUA 5M3MJ 1QHGA 2IBDA 4BUPA 1FBQA 3QRFF 5F08A 2X1DA 2GLOA 5DTDA 3NWTA 3A4CA 1KZHA 2O7OA 4FISA 2CS3A 3MKWB 2HR3A 5DUIA 2KHMA 3ZN1A 5LEJA 2EZKA 4G7ZF 3WTZA 3BTLA 5LLQA 4LFUA 2TRTA 3M1EA 3CMMA 4Y17A 2QSGX 2AQFA 2VKHA 5D6FA 2L7FP 3S2WA 2ZO4A 1BM9A 5K1YA 1ACIA 1UCRA 1P7IA 1R23A 1FMVA 1LUJB 4B48A 2K86A 1TWCJ 2V9VA 2HPIA 4GDFA 3J81K 4YFXF 2B7EA 3JR9A 3ONQA 2R5ZB 4BY1J 2OU2A 5IOYA 4HYEA 4I09A 4M74A 3S3MA 2RKHA 2V4JC 5HLTA 4NB5A 2CFOA 2GBYA 5ED4A 3ECHA 2E36A 2XAHA 5FKNA 2QQ9A 2IA1A 2IGOA 5E3NA 2IS1A 1X4OA 3JRFA 4XLFA 2VT3A 5IT3A 3O6BB 4X1EA 1SAUA 2KJBA 1YX5A 1ZGJA 2QSFX 4MFEA 2DA2A 2HI3A 5ICGA 2VODA 1BA5A 1RIOH 4V2GA 1XDSA 2CFXA 3P7NA 4E7SA 2ELJA 4AYBN 1B72A 1LPQA 4BJ6C 4P9UA 3C2GA 4P55A 4HQEA 2L7MP 1SANA 5FROA 4DYCA 2L2OA 1XDUA 1FX7A 4M6XA 4XLCA 1RNLA 1OISA 5J47A 2L3DA 1RR7A 2VE8A 2LY2A 5DCMB 2DT7B 4IZZA 4XLPF 4RB1A 1D1AA 2DA5A 2E5ZA 2QUFA 3I53A 2FRHA 3P9KA 4XL9A 1W5TA 3U9GA 2YSRA 4BYYA 4C2MJ 1WKMA 3QWLA 2GOMA 4GRIA 2DMTA 4F7ZA 2JZYA 2PEXA 1JT0A 4JX4A 3M7GA 4XORA 1ULYA 1YIJI 1ZRFA 4ZDOA 1H8AC 2CUJA 2W48A 3GVAA 2FF4A 5F04A 3BG5A 5ILSA 4Z2YA 1IC8A 4JQFA 2RDPA 2JK3A 4IKFA 2STWA 2OCEA 3F8CA 3W6VA 2HKOA 1J5YA 2ZNZA 4BDYA 2Y2ZA 4XSXF 3GFMA 2DFIA 3M8EA 3QODA 5LD2C 2MGQA 2XC7A 1R5GA 3K10A 2CUEA 4ON0A 1FLIA 4IEJA 5J8FA 1T39A 1Z3XA 2EINH 3KZZA 1S7OA 3ABLH 3FF5A 2BXZA 1USSA 2FE3A 4B43A 3TP0A 2H6CA 4BQOA 3GTMJ 2XAQA 4WXHA 1POGA 1SFXA 2Y48A 5HLGA 2ACJA 1IDZA 3WU1B 3IKTA 2ZMEA 5D8KB 2Y0SN 2L9VA 4D5FA 1WJCA 2VUMJ 2FX0A 2RQPA 5J3LA 3PM1A 1OCOH 2E71A 3HRMA 3HIFA 5HS7A 5GAGJ 2CW7A 1XGOA 3BZKA 4XONA 5F0FA 2QA4I 3HM5A 2BY0A 1B1BA 5B5EC 2YUSA 1ZHFA 2ECBA 2JSPA 4C3HJ 3SZPA 3BJ6A 1LFUP 5J4VA 2H8RA 1U5TB 4M3FA 1FSHA 2RN7A 2H1LA 1S29A 3B73A 1FYLA 1XB4A 4CYCB 2DAOA 3D5SC 3CJTB 2Q2EA 2BY1A 2QVOA 1K6OA 2COBA 3JRDA 4C2UA 5FLXZ 4ZTFA 3RKXA 4OWRB 5L3DA 3OY9A 4UV9A 1E2XA 2HWVA 5LRSA 1EH6A 2DJIA 2XDVA 4IXAA 5CKTA 3J80K 4DOZA 2ZXHA 4U7BA 2EZLA 2Z33A 3QOEA 4LLLA 4KYWA 3OIPA 1UHWA 1MZBA 4BL0B 3DCFA 2EV6A 1ON1A 1GXPA 4AVPA 1R4MB 3K1NA 3QU3A 4XQFA 1QZYA 3E6CC 2P8TA 3QAHA 3S14J 3LSRA 1IN6A 3EDPA 3QYFA 2MYSA 1G6NA 3O8GA 2ME0A 2MG4A 4L9JA 2QQBA 5KHDA 1WZ2A 3ABTA 3BR6A 4MO7A 2LC2A 5DYMA 3JRGA 4AM3A 1Y39A 3ABUA 2DDBA 1W7PD 3AL0C 1LFBA 4EJTA 2W25A 4RA2A 3G3ZA 1AHDP 1HDPA 4EJWA 2XGEA 1JTYA 2CYYA 1J7KA 2PMUA 4CICA 3IRRA 4RGSA 2LREA 2XAUA 1JJ8C 3BZ6A 2P81A 2W7NA 5FO5A 2PJRB 1R6RA 4EVIA 1WPKA 3BTCA 1YHQI 5AIPA 3NARA 2VPLA 2HXIA 4XRSG 4XN0A 1EA3A 4IJAA 1VQKI 3ERMA 1YQAA 2K9LA 4AUXA 1W5CC 1APLC 2M45A 1W7PA 2ETHA 2KL4A 2DPUA 3QP5A 1NK2P 2J5PA 1W4MA 3W2WA 3JRHA 1VQ5I 3CJQB 4L9TA 1LJ9A 1Y6IA 5D5VB 1XG1A 1JHHA 4A0ZA 5GADJ 1ETKA 3IUOA 3Q3SA 3T8RA 3AG1H 2EFQA 1X3WB 2ADUA 4RM3A 2D2WA 2TCTA 3IV5A 3Q9SA 2R5ZA 3A1YA 1HOMA 2K4JA 4ZZLA 1VTNC 1A6QA 1TWGJ 2E7XA 3K4BA 3U1DA 4XLHA 4S0HB 2LY9A 5E3LA 1SVMA 3H92A 3K7AJ 1J2XA 5ICFA 2C6YA 2O0YA 4R8HA 3CCUI 4B1RA 2IS6A 1Z77A 3OYAA 3NEUA 5CVUA 1GLNA 4OIOF 3ML6A 2IP2A 2HVSA 3J80Z 1WI3A 5DS9A 4HA8A 4A69C 3J81Z 2YR2A 1XCVA 2HZDA 5HNHA 1IUFA 3GX4X 1WI9A 3H0DA 2RC4A 2OZ6A 2V9PA 1LDKB 2W84A 3BZCA 3G4SI 3GF2A 2XUBA 3T8TA 3EUHA 3GO5A 3RKYA 2JUGA 2X6OA 5F0CA 2LR8A 3SZGA 3M3YJ 3LAPA 1S3JA 3E97A 2J5OA 2JRMA 2EFWA 2OV7A 3QP6A 1XSVA 4Y52J 4KUMA 2EA4A 3LAJA 3RPQA 5H6QA 1FZPB 1MGTA 1TTYA 2IW5A 3W6KB 4ABZA 2IGNA 4FX0A 1FJLA 4C3IJ 1K4TA 4J19A 5B3SH 4PZJA 3K6GA 4PJLA 5A2QK 3MVPA 2LMDA 1NTCA 2F4IA 3ESWB 3L7WA 4ZZDA 2FQ3A 3FXJA 1LEAA 3P9CA 2DA4A 5F0HA 1T33A 5IP7J 4BE2A 1X1DA 2I8DA 1FY7A 4CUGA 4AIHA 5IP6A 2FOKA 1LVKA 2LH9A 4ANJA 2JA6J 2JPCA 4AVZA 2ZXJA 2G7HA 3I4PA 3S93A 2PFBA 3CQZJ 4D5CA 3ABKH 4IHYA 1UELB 2VXDA 1HKTA 3HOXJ 1GT0C 4LD5A 1QA6A 2VOPA 5BNGA 3JRIA 2DJNA 5CVVA 1LVAA 1OR7C 4I0BA 2LRDA 3L09A 1X2NA 1MBFA 3SEQA 3U2RA 2BHZA 1ITYA 2P6SA 4BE1A 1DUXC 3F6VA 3G1MA 3UKGA 3WTYC 1YLFA 3MN2A 3DU5A 4YIRX 4YIFA 4HBLA 1RKTA 2EIJH 1X3UA 5IY5H 1XC5A 3A01A 1A04A 3CC2I 3UNGC 2ICWG 3JTHA 2DXIA 1YRNA 4Q5SF 2PMHA 2O9LA 3HOWJ 2MA3A 2CW0F 3S32A 2XVCA 3VYTB 4BXFA 4MQ9F 1ETOA 4B8XA 3N97A 3CLQA 4G12A 2PJRA 1FWZA 2HXOA 3W2AA 1TQMA 4HZFA 3KEOA 4RM2A 1X1AA 1ZARA 2XKPA 2IXSA 3MQ0A 1WJAA 2VQLA 4CCMA 2KZGA 3OOPA 3BTIA 3CUQB 2VKVA 1LNWA 2XHKA 2DFEA 4LLNA 2VJJA 2R0QC 1XSXA 3BC8A 1HDDC 2FD5A 4U0VA 4A3FJ 3HEFA 3EQLF 1S6LA 2R7VA 4UNOA 3T1BA 1FOXA 5LGNA 1HA8A 4DQ2A 1TT0A 1TW3A 1JUPA 3WGIA 3RKQA 3S17J 2GA1A 2QF7A 3OMYA 5D5UB 1CQTA 3P5JA 3I59B 1O4XA 2GQQA 4HNTA 2RV8A 1WGXA 3HDDA 1UFMA 2KIUA 2XASA 3WU0A 2O6GE 4F55A 3SFZA 3CMAI 3C2BA 4XN3A 4B4CA 4OIQF 2ZCWA 3L9FA 1D0ZA 2ZKZA 5A2QZ 3LFKA 4H4KC 2HGCA 3ELKA 3HHGA 2M9HA 3ZOBA 1U78A 3HOUJ 5LBQA 3M8FA 5H20A 2PMZA 1ON2A 1B4AA 1N25A 4L0ZB 1P4XA 3MZYA 4XM3A 1SMYF 3ZRGA 2MH2A 2WADA 4FT8A 1BI1A 2RQQA 1CF7B 3E5XA 2Y30A 3PQJA 5C3EJ 4RBOA 1ZREA 2ZMEB 2VLAA 3L2QA 3BT9A 1YW7A 1HBXG 2GXGA 2M34A 3DTIA 3BTJA 3FXMA 2QGUA 2KISA 1PUFA 3FK6A 3RQIA 5HDKA 4Y3OA 2HYGD 5K7ZA 3RZOJ 3KZIC 1MH3A 3HL2A 1F5TA 2GWRA 1RI7A 2WY8Q 3HHHA 5JLXA 4E7JA 1D5YA 3OIQA 1F36A 3A03A 2O03A 1Q1VA 2VJ5A 3F21A 2ZB9A 2WAQN 4GO1A 4A3EJ 2ISZA 3HB9A 4LK0F 1MBGA 2CGPA 2IPQX 4Y33A 1S5LC 3CC7I 3DPLC 4L9VA 2DA1A 3OYHA 1XSDA 5HLIA 1JUSA 3HC7A 3KIOA 4IQJA 3KZYA 4RAFA 1MMDA 1WRJA 4MHGA 2OZUA 3PSIA 1T2KA 2MSYA 3SJMA 1H9TA 4IRIA 1UHSA 4QTRA 2WB1N 3D5RC 2E1MC 2GA2A 4PGGA 4WCGA 5GPCA 4ZTJA 2HOSA 1FSEA 3S3NA 4X6AJ 1KQ8A 1TQPA 1ZYRF 4CCJA 5K5RA 2E34A 1M1EB 2HPMA 3RSNA 2JN6A 1ZR4A 3QQAA 1IV6A 3RCOA 2STTA 4JP0A 3BQYA 3CTAA 4HW0A 2CH0A 1A6IA 5D5WB 5AIQA 1XGMA 2ESNA 5F64A 3ZN0A 4KFCA 5CVRA 5IYBJ 3E6DA 1EV7A 2K3PA 4PFOA 4UB6C 1DP3A 4LIVA 1T6SA 1I6XA 1WHUA 2O5RA 2EFNA 2I10A 2VQHA 4MTEA 1MNDA 1XGNA 3DLLF 2GM4A 3FKJA 1X1PA 4XLAA 3H5AA
chains in the Genus database with same CATH topology
3KP3A 2P6TA 3DPTA 4RB0A 2ELHA 2Y75A 1ZG5A 3LA2A 3SZTA 4P5OA 2GAUA 4WF2A 2K4BA 1SD5A 2RNJA 5EEGA 2LKPA 1J75A 2P4WA 3ZQ7A 2VC0A 3D0SA 1Z9CA 2OQGA 1GHCA 1IZ1A 4M72A 4S04A 3F8NA 2D1HA 2QQAA 5JI6A 3C18A 3WE2A 1BIAA 1ZG3A 4A0XA 4BHPA 3MEXA 2VC1A 5HVQC 2F5FA 4ZYDA 5L3CA 2M5WA 4RB2C 3FMRA 2L54A 1IXRC 4EM2A 2LDUA 2MC3A 4RAYA 4R79A 5LEKA 3J7AO 1L3LA 1SAXA 4S05A 4I01A 1AOYA 5H6RA 3ZP5A 3E5UA 4ESBA 2BYVE 4M6YA 1C0WA 3IWZA 5L3FA 1GXQA 1MDMA 2XAFA 2MD5A 3R61A 1E17A 2A61A 2HKXA 4LLGF 2UZKA 1V3FA 1B59A 4A6DA 3KP7A 4NQWA 4KNYA 2HZTA 2O61A 2WC2A 5HS8A 5TRDA 2PLYA 2MH9A 1KQ0A 1IN4A 1XGSA 2ESHA 1OR7A 4N9HA 5D4SA 1JE8A 3FM5A 3COAC 1UHMA 2HQRA 1XCBA 3LA7A 2YPRA 1T98A 2FXAA 1SD6A 1S8NA 1HXDA 2WV0A 3SHFA 4HX4A 1ZH5A 1MJBA 1KU7A 1JGSA 1BI0A 4EM0B 4I02A 3BPVA 3LA3A 3E6BA 5D8LB 3KP5A 1O3QA 1DDNA 3KP4A 3WTTC 3O2PE 5E1WA 5FFXA 3ZMUA 1Z05A 5BMZA 3PFIA 1IN8A 4XRFA 4Y15A 2DK5A 2EFPA 4KMFA 5E1XA 1MD0A 3LWFA 3IWFA 1RUNA 3F8BA 4UVAA 3LSTA 3ROUA 1K78A 2VBZA 3TO9A 1H9GA 1J9IA 3F8FA 1H0MA 2HDCA 3I59A 3ZMZA 3K69A 3BJOA 3HSRA 3C1DA 4QWQA 5ILUA 4EGZA 3I71A 4AWXB 1D5VA 4KMUX 3F3XA 1EH8A 3O3KA 4MNUA 3H3UA 2FBHA 2XAGA 1U5TC 2LF8A 5BQTA 2QBYA 4RGUA 5TJJA 3NQOA 3R60A 5E17F 1Y0UA 1KU9A 5E20A 3IL2A 4FX4A 1IXSB 3TKYA 2OBPA 4WK8F 2QYOA 4Q48A 2BV6A 1OYWA 2PBIA 1R1UA 1Z6TA 3W6JB 2VOOA 1KGSA 1B9NA 2PG4A 1BBYA 1BN5A 4ETSA 3I58A 2DPDA 1YW8A 1G3SA 3TDUC 3G73A 1R22A 4GYIA 3ZMSA 1P92A 2FU4A 4U0YA 4CHUA 2M1BA 2IA0A 4OIPF 4ZYGA 4ENNA 4D0PA 1BI3A 3OV8A 2EJRA 3DV8A 2CSOA 4HV5A 2EFOA 1YO5C 4LK1F 1PP7U 2NRAC 5LHGA 1ZRCA 2QZ8A 5FLXK 1WQ2A 3AAFA 1O7LA 1YS7A 4KN7X 3RI4A 1RUOA 3GZ5A 2IA2A 2E1NA 2BBYA 2LNBA 5FGMA 3TDZC 5DCFA 3FX3A 2KKOA 2CQKA 5KVRA 4H0EA 3I0TA 4MEYF 2Q8KA 1IF1A 3HRUA 4HDVA 2ZJ2A 5ICEA 2H09A 2L4MA 5DD8A 4G9YA 2DTRA 2V1DA 5BPDA 3ISPA 4EQQA 1KU2A 3BPXA 4ENKA 2BGCA 2Y0MA 1HW5A 4WXDA 1F4KA 1DP7P 2G7UA 4LB6B 3RYRA 2JTVA 4U88A 3SXYA 1LEBA 2YU3A 4I2OA 1O57A 4YFNF 3HSEA 1LQ1A 1KU3A 3VB2A 1K7AA 1ZLKA 4OMYA 3WE3A 2DI3A 2EWNA 3EYYA 4KDPA 5FFZA 1R7JA 3FXUA 3E6MA 1J0RA 1QNTA 3JTGA 1BJAA 3RPUA 1F1ZA 4ENJA 1TLHB 3MWMA 1STZA 2O3FA 3HOTA 1HW2A 3IHUA 2A69F 2H6BA 4RGRA 5BS6A 2P7CB 4UUVA 2W24A 3D5LA 2PJPA 2FMYA 3ERED 1BC7C 4L9NA 2D1VA 1YS6A 2GXBA 4KIGA 3HOSA 3K0LA 1TBXA 2MBFA 2M87A 3I54A 3WG9A 3GFIA 3F6OA 2EA2A 1HW1A 2VN2A 1Z1DA 3V8KA 1KYWA 4HX7A 3HTSB 4HQMA 3C7JA 1ZLJA 4I7HA 1IRGA 4G6QA 1NHAA 3MFKA 5IT9Z 3ZMVA 1PDNC 3CO7C 4UXNA 4K2EA 4I0AA 5ILVA 3KFWX 3JW4A 2KIFA 2QLZA 3REOA 5LRRA 3L00A 3DF8A 2ZNYA 2PN6A 1SFUA 3I64A 4HV6A 3CUQA 2DLLA 2FBIA 3T5XA 1WWXA 5DD4A 4PGHA 3CO6C 3FXRA 3ZMDA 5L3EA 4UV8A 1P6RA 3FZVA 1MKMA 3WODF 3WTUC 2VONA 3KETA 3BWGA 3RKWA 3TO7A 3K9TA 5BPIA 2COMA 3GYHX 1P2FA 3K1PA 2PQ8A 2FNAA 1HKQA 4XBFA 4BXUA 5HOOA 4XLNF 4P9FA 5FD6A 3R4KA 1USTA 3PQKA 4M9SA 2MLGA 4ENMA 1O3TA 2ZBKA 4PDKA 1LB2A 2L4AA 3F72A 1I1SA 4LMYA 2Z3YA 2FSWA 3CLOA 1ODDA 2M30A 1IN5A 2VT2A 3WGHA 3HRSA 4FHTA 4EJVA 3FHZA 4M73A 4WXCA 1CF7A 5E18F 2F5CA 1LDJA 2DQLA 1O7FA 3MCZA 1T38A 3HRTA 4CGZA 1TQIA 4LG0B 1OPCA 2BEOA 4WWCA 2XRNA 4IVNA 2EB7A 4G7OF 1JHFA 3DXJF 3FWEA 4EMSA 4L18B 4EM1A 4KIBA 4A5MA 3KEQA 3R0AA 4AD9A 1IRFA 3C3WA 2KRFA 2DO7A 2V6CA 2EK5A 2WWYA 1T0FA 1SFEA 5CJ9A 2XIGA 4U0WA 2ISYA 2VE9A 5LGTA 4LJZF 2JT1A 4GCVA 4HAMA 2EV0A 4JK1X 2H94A 2A6EF 1D3YA 1R5HA 3F8MA 3KLNA 1SMTA 5CVIA 4LGWA 4U7DA 3GEZA 4A2UA 1SD7A 3V7CA 1TW2A 4G7HF 5ERIA 4M9XA 3WTXC 3BOQA 5FD5A 1XD7A 1IW7F 4IRGA 3JSOA 3P9IA 2HS5A 4HF0A 2K02A 2QM3A 1QGPA 1BIBA 1KA8A 1K78B 2P5VA 5E8GA 2R7FA 1REPC 2LF7A 2H27A 1ONVA 2O8XA 3WTWC 2OQRA 1FBUA 5DEQA 1ZRDA 2ZFWA 3H3ZA 3I5UA 1KQ9A 5JHUA 2HYFA 3HYIA 5FB2A 2BE5F 2M8EA 5JR3A 5LHHA 4MEXF 2HOEA 1IXCA 3CUQC 3TOBA 2HTJA 3ZPLA 2GIVA 1YW9A 5L3GA 4Q47A 2P7VB 1CGPA 1FP2A 4HF1A 3JAMK 3QPTA 4RGXA 1I1GA 3RTRA 1YIOA 3R0JA 5HDGA 4CDGA 2F5DA 1DPRA 5D5XB 4ASNA 1GVJA 5J6XA 2IRFG 5LHIA 3RDIA 1V4RA 1Z7UA 2Z99A 3GLXA 4ZH4F 2IJLA 3RYPA 3TO6A 1D8KA 5HDNA 3FMQA 1FYMA 1O3SA 4A5NA 4L0YB 2MLKA 2OAZA 4HDUA 4I98B 3DFGA 1U3EM 2FA5A 1Q1HA 5DUKA 1HQCA 1QZZA 3VFZA 3WGGA 4LG0A 3CDHA 3IKVA 2G9WA 2F2EA 5DV5A 3V7SA 2DT5A 2E7WA 4QLCU 2FNPA 1DPUA 4GXOA 4GYGA 3HSFA 5BOXA 2CG4A 1YG2A 5K5OA 2JSCA 3BROA 5KK1A 4GGGA 1U5TA 3R6SA 4EGYA 2XGXA 1BC8C 1R1VA 2HFHA 4KIFA 4EJOA 1HKSA 1FNNA 4HLXA 1YFHA 1P4AA 1HSTA 1I27A 2VXZA 4ESJA 1SD4A 3BJAA 4BH9A 2K27A 1FOKA 2IVMA 2FMLA 1IN7A 1J59A 2XAJA 3EYIA 2OD5A 4YFKF 2GZWA 4BHCA 3QPHA 2Q0OA 2TDXA 5EEHA 2OA4A 1OYYA 4Q4ZF 1OMIA 2EV5A 4OMZA 1QBJA 1XMKA 1EH7A 2A6HF 4RAZA 3GXOA 4L5JA 2RVCA 5D4RA 2AXLA 2DBBA 2YX7A 2JRTA 4P96A 3CJNA 2R7DA 1AWCA 2DU9A 2DK8A 1LDDA 2PI0A 4EV0A 4AIJA 3KP6A 1U2WA 1YYVA 2DQRA 1ZGAA 3V4GA 2DW4A 4OOIA 2XV4S 3IC7A 4NHJA 2VBXA 1TNTA 2YX4A 3E3VA 1G3WA 2QENA 3GZ6A 4G6DA 3TQNA 4N9IA 1D8JA 4OIRF 3L2CA 1Z6RA 2X4HA 2VBWA 2FEZA 4AIKA 2A3SA 1R36A 5JVTA 2VBYA 1U6GA 5CVJA 1O3RA 3EETA 1R1TA 1IAWA 1R00A 4YG2F 2Z9OA 4CXFA 4HX8A 3VEPA 3JSPA 1B6AA 2QWWA 1QQIA 2V1XA 2IT0A 3NRVA 1MJAA 3DP7A 1FBSA 3BP8A 2A68F 3RJPA 3JAMZ 2RGVA 2E1CA 1RZ4A 4MQVA 2NS0A 4KT5C 3K2ZA 3FXQA 3LQRA 4KICA 1R58A 1QO0D 4G8XA 3KCCA 3F23A 3BY6A 4E70A 4MGRA 4MTDA 4N0BA 3VODA 2B0LA 2CO5A 1BOAA 2NNNA 2W57A 3BDDA 4BQAA 2K7LA 3WTVC 3MAJA 3FM3A 5CYVA 2NNYA 1FYKA 1FP1D 5K5QA 4CO8A 4YIIA 4KN4X 1L0OC 3TOAA 2R3SA 3GUDA 5ICCA 4O3MA 1TNSA 3GWZA 4ZYEA 3V8LA 4WX9A 4RB3C 3V7RA 2P5LC 3E5QA 3Q5FA 3B02A 3GFJA 3F22A 3WTSC 4L5IA 4IHSA 3DQVC 3M9AA 2UWMA 4O5VA 3QU6A 4A0YA 4IRHA 4TV7A 6PAXA 5E8IA 3KP2A 1YTYA 5J8CA 4M71A 2W85A 2HTSA 4HOBA 1W5SA 2V79A 4IHTA 3QOPA 4O6JA 2L01A 4A12A 2KIMA 2CWEA 3HTUA 3DKWA 4JBAA 4UVCA 3LQQA 4HF2A 5E1ZB 2XROA 2UXXA 4Y13A 4EJUA 3CUOA 2D45A 1B9MA 4DNCA 3RIRA 3N4MA 5DDGA 4BHBA 4OU0A 5AONA 1PUEE 5JFRA 4M9ZA 4BAYA 4ESFA 3T0YA 2KJCA 1K79A 4IF4A 3Q9VA 1OYIA 5F1RA 1G3YA 1OKRA 2WTEA 1BI2A 1Z91A 5HS9A 1MJ9A 5LGUA 4ZYHA 2X0LA 2Z5UA 5HLHA 4UVBA 3GFLA 1QPMA 1F9NA 5F6FA 2F5EA 1P4WA 1KYZA 2P5KA 1HSJA 2L02A 4R1HA 3ZMTA 1G4DA 1UB9A 5DCMA 1W7PB 3ULQB 2A5YB 5L3BA 1XMAA 1ZN2A 3VOEA 1FT9A 1JXSA 1FPQA 1PP8F 3IRQA 4CYDA 1ZAOA 4RS8A 2UXNA 3FMSA 1IUYA 1WSUA 1U8RA 5D6EA 3SQNA 2FBKA 5CLSA 4OINF 4PCQA 1MDMB 3KE2A 2NYXA 1S7AA 3KLOA 2QBYB 3K1MA 2HQNA 4KA4A 3ECOA 3GW2A 2JPBA 2LSOA 4B09A 1XN7A 2A07F 4HLYA 4IPAA 4XSZF 2XKOA 3V8JA 3MZHA 2AS5F 1G3TA 1I5ZA 4CZZA 1FC3A 4UHTA 3DEUA 2V1UA 5IT9K 4BNCA 3HUGA 2NAZA 4A6EA 2HEOA 3TGNA 4G94A 1ZG1A 1FBQA 3QRFF 2HR3A 5DUIA 3ZN1A 5LEJA 4G7ZF 3WTZA 5LLQA 4LFUA 3M1EA 4Y17A 5D6FA 3S2WA 2ZO4A 1BM9A 5K1YA 1UCRA 1R23A 2K86A 2V9VA 3J81K 4YFXF 2OU2A 4HYEA 4I09A 4M74A 2RKHA 4NB5A 5ED4A 3ECHA 2XAHA 2QQ9A 2IA1A 2VT3A 5IT3A 3O6BB 2KJBA 1ZGJA 2VODA 5ICGA 1RIOH 1XDSA 2CFXA 3P7NA 4P9UA 4P55A 4HQEA 1XDUA 1FX7A 4M6XA 1RNLA 2L3DA 2VE8A 5DCMB 4XLPF 4RB1A 2QUFA 3I53A 2FRHA 3P9KA 1W5TA 3U9GA 2YSRA 4BYYA 1WKMA 4F7ZA 2JZYA 2PEXA 3M7GA 1ULYA 1ZRFA 3GVAA 2FF4A 5ILSA 4Z2YA 4JQFA 2RDPA 2STWA 3F8CA 2HKOA 1J5YA 2ZNZA 4XSXF 3GFMA 2DFIA 3M8EA 1R5GA 4ON0A 1FLIA 5J8FA 1T39A 3KZZA 1S7OA 3FF5A 2FE3A 1USSA 2H6CA 2XAQA 4WXHA 1SFXA 2Y48A 5HLGA 2ACJA 3WU1B 3IKTA 2ZMEA 5D8KB 2RQPA 3HRMA 3HIFA 5HS7A 1XGOA 1B1BA 1ZHFA 3SZPA 3BJ6A 1U5TB 1FSHA 2RN7A 1S29A 3B73A 1FYLA 1XB4A 2DAOA 2Q2EA 2QVOA 1K6OA 5FLXZ 3RKXA 5L3DA 4UV9A 1E2XA 2HWVA 5LRSA 1EH6A 4IXAA 3J80K 4U7BA 2Z33A 4LLLA 4KYWA 1UHWA 1MZBA 2EV6A 1ON1A 1GXPA 4AVPA 3K1NA 3QU3A 1QZYA 3E6CC 2P8TA 3QAHA 1IN6A 3EDPA 1G6NA 4L9JA 2QQBA 3ABTA 5DYMA 3ABUA 1W7PD 4EJTA 2W25A 3G3ZA 4EJWA 2CYYA 1J7KA 2PMUA 4CICA 3IRRA 4RGSA 3BZ6A 5FO5A 4EVIA 5AIPA 4IJAA 1YQAA 2M45A 1W7PA 2ETHA 2DPUA 3QP5A 2J5PA 1W4MA 4L9TA 1LJ9A 5D5VB 1JHHA 4A0ZA 3T8RA 2EFQA 2ADUA 2D2WA 3Q9SA 2K4JA 4ZZLA 1VTNC 2E7XA 3U1DA 3H92A 5ICFA 1J2XA 2C6YA 2O0YA 4R8HA 3NEUA 5CVUA 4OIOF 3ML6A 2IP2A 3J80Z 4HA8A 3J81Z 2YR2A 1XCVA 3GX4X 1WI9A 2RC4A 2OZ6A 1LDKB 2W84A 3GF2A 2XUBA 3T8TA 3EUHA 3GO5A 3RKYA 3LAPA 1S3JA 3E97A 2J5OA 2EFWA 3QP6A 1XSVA 4KUMA 2EA4A 3LAJA 3RPQA 5H6QA 1FZPB 1MGTA 1TTYA 2IW5A 3W6KB 4FX0A 4PZJA 5A2QK 3L7WA 4ZZDA 2FQ3A 1LEAA 3P9CA 1FY7A 4AIHA 2FOKA 2JPCA 2ZXJA 2G7HA 3I4PA 2PFBA 1HKTA 2VOPA 4LD5A 5CVVA 1LVAA 4I0BA 3L09A 3U2RA 2P6SA 1DUXC 3F6VA 3WTYC 1YLFA 4YIFA 4HBLA 1X3UA 1A04A 3JTHA 4Q5SF 2PMHA 2MA3A 2CW0F 2XVCA 4MQ9F 4B8XA 3N97A 1FWZA 1TQMA 4HZFA 3KEOA 1ZARA 2XKPA 3MQ0A 3OOPA 3CUQB 1LNWA 2XHKA 4LLNA 1XSXA 4U0VA 3EQLF 1S6LA 4UNOA 3T1BA 5LGNA 4DQ2A 3WGIA 1TW3A 2GA1A 5D5UB 3I59B 2GQQA 2RV8A 1UFMA 2KIUA 2XASA 3WU0A 2O6GE 3SFZA 4OIQF 2ZCWA 3L9FA 2ZKZA 5A2QZ 3LFKA 2HGCA 3ELKA 3HHGA 1U78A 5LBQA 3M8FA 5H20A 4L0ZB 1ON2A 1B4AA 1P4XA 3MZYA 1SMYF 2MH2A 4FT8A 1BI1A 1CF7B 3E5XA 3PQJA 1ZREA 2ZMEB 1YW7A 1HBXG 2GXGA 5HDKA 2HYGD 1F5TA 2GWRA 1RI7A 3HHHA 2O03A 3F21A 4GO1A 2ISZA 4LK0F 2CGPA 2IPQX 3DPLC 4L9VA 1XSDA 5HLIA 3KZYA 1WRJA 4MHGA 2OZUA 1T2KA 1H9TA 4IRIA 4PGGA 4WCGA 2GA2A 1FSEA 1KQ8A 1TQPA 1ZYRF 5K5RA 2STTA 3CTAA 4HW0A 5D5WB 5AIQA 1XGMA 2ESNA 5F64A 3ZN0A 4KFCA 5CVRA 3E6DA 1EV7A 1T6SA 1I6XA 2EFNA 4MTEA 1XGNA 4LB5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KP3 A;  2P6T A;  3DPT A;  4RB0 A;  2ELH A;  2Y75 A;  1ZG5 A;  3LA2 A;  3SZT A;  4P5O A;  2GAU A;  4WF2 A;  2K4B A;  1SD5 A;  2RNJ A;  5EEG A;  2LKP A;  1J75 A;  2P4W A;  3ZQ7 A;  2VC0 A;  3D0S A;  1Z9C A;  2OQG A;  1GHC A;  1IZ1 A;  4M72 A;  4S04 A;  3F8N A;  2D1H A;  2QQA A;  5JI6 A;  3C18 A;  3WE2 A;  1BIA A;  1ZG3 A;  4A0X A;  4BHP A;  3MEX A;  2VC1 A;  5HVQ C;  2F5F A;  4ZYD A;  5L3C A;  2M5W A;  4RB2 C;  3FMR A;  2L54 A;  1IXR C;  4EM2 A;  2LDU A;  2MC3 A;  4RAY A;  4R79 A;  5LEK A;  3J7A O;  1L3L A;  1SAX A;  4S05 A;  4I01 A;  1AOY A;  5H6R A;  3ZP5 A;  3E5U A;  4ESB A;  2BYV E;  4M6Y A;  1C0W A;  3IWZ A;  5L3F A;  1GXQ A;  1MDM A;  2XAF A;  2MD5 A;  3R61 A;  1E17 A;  2A61 A;  2HKX A;  4LLG F;  2UZK A;  1V3F A;  1B59 A;  4A6D A;  3KP7 A;  4NQW A;  4KNY A;  2HZT A;  2O61 A;  2WC2 A;  5HS8 A;  5TRD A;  2PLY A;  2MH9 A;  1KQ0 A;  1IN4 A;  1XGS A;  2ESH A;  1OR7 A;  4N9H A;  5D4S A;  1JE8 A;  3FM5 A;  3COA C;  1UHM A;  2HQR A;  1XCB A;  3LA7 A;  2YPR A;  1T98 A;  2FXA A;  1SD6 A;  1S8N A;  1HXD A;  2WV0 A;  3SHF A;  4HX4 A;  1ZH5 A;  1MJB A;  1KU7 A;  1JGS A;  1BI0 A;  4EM0 B;  4I02 A;  3BPV A;  3LA3 A;  3E6B A;  5D8L B;  3KP5 A;  1O3Q A;  1DDN A;  3KP4 A;  3WTT C;  3O2P E;  5E1W A;  5FFX A;  3ZMU A;  1Z05 A;  5BMZ A;  3PFI A;  1IN8 A;  4XRF A;  4Y15 A;  2DK5 A;  2EFP A;  4KMF A;  5E1X A;  1MD0 A;  3LWF A;  3IWF A;  1RUN A;  3F8B A;  4UVA A;  3LST A;  3ROU A;  1K78 A;  2VBZ A;  3TO9 A;  1H9G A;  1J9I A;  3F8F A;  1H0M A;  2HDC A;  3I59 A;  3ZMZ A;  3K69 A;  3BJO A;  3HSR A;  3C1D A;  4QWQ A;  5ILU A;  4EGZ A;  3I71 A;  4AWX B;  1D5V A;  4KMU X;  3F3X A;  1EH8 A;  3O3K A;  4MNU A;  3H3U A;  2FBH A;  2XAG A;  1U5T C;  2LF8 A;  5BQT A;  2QBY A;  4RGU A;  5TJJ A;  3NQO A;  3R60 A;  5E17 F;  1Y0U A;  1KU9 A;  5E20 A;  3IL2 A;  4FX4 A;  1IXS B;  3TKY A;  2OBP A;  4WK8 F;  2QYO A;  4Q48 A;  2BV6 A;  1OYW A;  2PBI A;  1R1U A;  1Z6T A;  3W6J B;  2VOO A;  1KGS A;  1B9N A;  2PG4 A;  1BBY A;  1BN5 A;  4ETS A;  3I58 A;  2DPD A;  1YW8 A;  1G3S A;  3TDU C;  3G73 A;  1R22 A;  4GYI A;  3ZMS A;  1P92 A;  2FU4 A;  4U0Y A;  4CHU A;  2M1B A;  2IA0 A;  4OIP F;  4ZYG A;  4ENN A;  4D0P A;  1BI3 A;  3OV8 A;  2EJR A;  3DV8 A;  2CSO A;  4HV5 A;  2EFO A;  1YO5 C;  4LK1 F;  1PP7 U;  2NRA C;  5LHG A;  1ZRC A;  2QZ8 A;  5FLX K;  1WQ2 A;  3AAF A;  1O7L A;  1YS7 A;  4KN7 X;  3RI4 A;  1RUO A;  3GZ5 A;  2IA2 A;  2E1N A;  2BBY A;  2LNB A;  5FGM A;  3TDZ C;  5DCF A;  3FX3 A;  2KKO A;  2CQK A;  5KVR A;  4H0E A;  3I0T A;  4MEY F;  2Q8K A;  1IF1 A;  3HRU A;  4HDV A;  2ZJ2 A;  5ICE A;  2H09 A;  2L4M A;  5DD8 A;  4G9Y A;  2DTR A;  2V1D A;  5BPD A;  3ISP A;  4EQQ A;  1KU2 A;  3BPX A;  4ENK A;  2BGC A;  2Y0M A;  1HW5 A;  4WXD A;  1F4K A;  1DP7 P;  2G7U A;  4LB6 B;  3RYR A;  2JTV A;  4U88 A;  3SXY A;  1LEB A;  2YU3 A;  4I2O A;  1O57 A;  4YFN F;  3HSE A;  1LQ1 A;  1KU3 A;  3VB2 A;  1K7A A;  1ZLK A;  4OMY A;  3WE3 A;  2DI3 A;  2EWN A;  3EYY A;  4KDP A;  5FFZ A;  1R7J A;  3FXU A;  3E6M A;  1J0R A;  1QNT A;  3JTG A;  1BJA A;  3RPU A;  1F1Z A;  4ENJ A;  1TLH B;  3MWM A;  1STZ A;  2O3F A;  3HOT A;  1HW2 A;  3IHU A;  2A69 F;  2H6B A;  4RGR A;  5BS6 A;  2P7C B;  4UUV A;  2W24 A;  3D5L A;  2PJP A;  2FMY A;  3ERE D;  1BC7 C;  4L9N A;  2D1V A;  1YS6 A;  2GXB A;  4KIG A;  3HOS A;  3K0L A;  1TBX A;  2MBF A;  2M87 A;  3I54 A;  3WG9 A;  3GFI A;  3F6O A;  2EA2 A;  1HW1 A;  2VN2 A;  1Z1D A;  3V8K A;  1KYW A;  4HX7 A;  3HTS B;  4HQM A;  3C7J A;  1ZLJ A;  4I7H A;  1IRG A;  4G6Q A;  1NHA A;  3MFK A;  5IT9 Z;  3ZMV A;  1PDN C;  3CO7 C;  4UXN A;  4K2E A;  4I0A A;  5ILV A;  3KFW X;  3JW4 A;  2KIF A;  2QLZ A;  3REO A;  5LRR A;  3L00 A;  3DF8 A;  2ZNY A;  2PN6 A;  1SFU A;  3I64 A;  4HV6 A;  3CUQ A;  2DLL A;  2FBI A;  3T5X A;  1WWX A;  5DD4 A;  4PGH A;  3CO6 C;  3FXR A;  3ZMD A;  5L3E A;  4UV8 A;  1P6R A;  3FZV A;  1MKM A;  3WOD F;  3WTU C;  2VON A;  3KET A;  3BWG A;  3RKW A;  3TO7 A;  3K9T A;  5BPI A;  2COM A;  3GYH X;  1P2F A;  3K1P A;  2PQ8 A;  2FNA A;  1HKQ A;  4XBF A;  4BXU A;  5HOO A;  4XLN F;  4P9F A;  5FD6 A;  3R4K A;  1UST A;  3PQK A;  4M9S A;  2MLG A;  4ENM A;  1O3T A;  2ZBK A;  4PDK A;  1LB2 A;  2L4A A;  3F72 A;  1I1S A;  4LMY A;  2Z3Y A;  2FSW A;  3CLO A;  1ODD A;  2M30 A;  1IN5 A;  2VT2 A;  3WGH A;  3HRS A;  4FHT A;  4EJV A;  3FHZ A;  4M73 A;  4WXC A;  1CF7 A;  5E18 F;  2F5C A;  1LDJ A;  2DQL A;  1O7F A;  3MCZ A;  1T38 A;  3HRT A;  4CGZ A;  1TQI A;  4LG0 B;  1OPC A;  2BEO A;  4WWC A;  2XRN A;  4IVN A;  2EB7 A;  4G7O F;  1JHF A;  3DXJ F;  3FWE A;  4EMS A;  4L18 B;  4EM1 A;  4KIB A;  4A5M A;  3KEQ A;  3R0A A;  4AD9 A;  1IRF A;  3C3W A;  2KRF A;  2DO7 A;  2V6C A;  2EK5 A;  2WWY A;  1T0F A;  1SFE A;  5CJ9 A;  2XIG A;  4U0W A;  2ISY A;  2VE9 A;  5LGT A;  4LJZ F;  2JT1 A;  4GCV A;  4HAM A;  2EV0 A;  4JK1 X;  2H94 A;  2A6E F;  1D3Y A;  1R5H A;  3F8M A;  3KLN A;  1SMT A;  5CVI A;  4LGW A;  4U7D A;  3GEZ A;  4A2U A;  1SD7 A;  3V7C A;  1TW2 A;  4G7H F;  5ERI A;  4M9X A;  3WTX C;  3BOQ A;  5FD5 A;  1XD7 A;  1IW7 F;  4IRG A;  3JSO A;  3P9I A;  2HS5 A;  4HF0 A;  2K02 A;  2QM3 A;  1QGP A;  1BIB A;  1KA8 A;  1K78 B;  2P5V A;  5E8G A;  2R7F A;  1REP C;  2LF7 A;  2H27 A;  1ONV A;  2O8X A;  3WTW C;  2OQR A;  1FBU A;  5DEQ A;  1ZRD A;  2ZFW A;  3H3Z A;  3I5U A;  1KQ9 A;  5JHU A;  2HYF A;  3HYI A;  5FB2 A;  2BE5 F;  2M8E A;  5JR3 A;  5LHH A;  4MEX F;  2HOE A;  1IXC A;  3CUQ C;  3TOB A;  2HTJ A;  3ZPL A;  2GIV A;  1YW9 A;  5L3G A;  4Q47 A;  2P7V B;  1CGP A;  1FP2 A;  4HF1 A;  3JAM K;  3QPT A;  4RGX A;  1I1G A;  3RTR A;  1YIO A;  3R0J A;  5HDG A;  4CDG A;  2F5D A;  1DPR A;  5D5X B;  4ASN A;  1GVJ A;  5J6X A;  2IRF G;  5LHI A;  3RDI A;  1V4R A;  1Z7U A;  2Z99 A;  3GLX A;  4ZH4 F;  2IJL A;  3RYP A;  3TO6 A;  1D8K A;  5HDN A;  3FMQ A;  1FYM A;  1O3S A;  4A5N A;  4L0Y B;  2MLK A;  2OAZ A;  4HDU A;  4I98 B;  3DFG A;  1U3E M;  2FA5 A;  1Q1H A;  5DUK A;  1HQC A;  1QZZ A;  3VFZ A;  3WGG A;  4LG0 A;  3CDH A;  3IKV A;  2G9W A;  2F2E A;  5DV5 A;  3V7S A;  2DT5 A;  2E7W A;  4QLC U;  2FNP A;  1DPU A;  4GXO A;  4GYG A;  3HSF A;  5BOX A;  2CG4 A;  1YG2 A;  5K5O A;  2JSC A;  3BRO A;  5KK1 A;  4GGG A;  1U5T A;  3R6S A;  4EGY A;  2XGX A;  1BC8 C;  1R1V A;  2HFH A;  4KIF A;  4EJO A;  1HKS A;  1FNN A;  4HLX A;  1YFH A;  1P4A A;  1HST A;  1I27 A;  2VXZ A;  4ESJ A;  1SD4 A;  3BJA A;  4BH9 A;  2K27 A;  1FOK A;  2IVM A;  2FML A;  1IN7 A;  1J59 A;  2XAJ A;  3EYI A;  2OD5 A;  4YFK F;  2GZW A;  4BHC A;  3QPH A;  2Q0O A;  2TDX A;  5EEH A;  2OA4 A;  1OYY A;  4Q4Z F;  1OMI A;  2EV5 A;  4OMZ A;  1QBJ A;  1XMK A;  1EH7 A;  2A6H F;  4RAZ A;  3GXO A;  4L5J A;  2RVC A;  5D4R A;  2AXL A;  2DBB A;  2YX7 A;  2JRT A;  4P96 A;  3CJN A;  2R7D A;  1AWC A;  2DU9 A;  2DK8 A;  1LDD A;  2PI0 A;  4EV0 A;  4AIJ A;  3KP6 A;  1U2W A;  1YYV A;  2DQR A;  1ZGA A;  3V4G A;  2DW4 A;  4OOI A;  2XV4 S;  3IC7 A;  4NHJ A;  2VBX A;  1TNT A;  2YX4 A;  3E3V A;  1G3W A;  2QEN A;  3GZ6 A;  4G6D A;  3TQN A;  4N9I A;  1D8J A;  4OIR F;  3L2C A;  1Z6R A;  2X4H A;  2VBW A;  2FEZ A;  4AIK A;  2A3S A;  1R36 A;  5JVT A;  2VBY A;  1U6G A;  5CVJ A;  1O3R A;  3EET A;  1R1T A;  1IAW A;  1R00 A;  4YG2 F;  2Z9O A;  4CXF A;  4HX8 A;  3VEP A;  3JSP A;  1B6A A;  2QWW A;  1QQI A;  2V1X A;  2IT0 A;  3NRV A;  1MJA A;  3DP7 A;  1FBS A;  3BP8 A;  2A68 F;  3RJP A;  3JAM Z;  2RGV A;  2E1C A;  1RZ4 A;  4MQV A;  2NS0 A;  4KT5 C;  3K2Z A;  3FXQ A;  3LQR A;  4KIC A;  1R58 A;  1QO0 D;  4G8X A;  3KCC A;  3F23 A;  3BY6 A;  4E70 A;  4MGR A;  4MTD A;  4N0B A;  3VOD A;  2B0L A;  2CO5 A;  1BOA A;  2NNN A;  2W57 A;  3BDD A;  4BQA A;  2K7L A;  3WTV C;  3MAJ A;  3FM3 A;  5CYV A;  2NNY A;  1FYK A;  1FP1 D;  5K5Q A;  4CO8 A;  4YII A;  4KN4 X;  1L0O C;  3TOA A;  2R3S A;  3GUD A;  5ICC A;  4O3M A;  1TNS A;  3GWZ A;  4ZYE A;  3V8L A;  4WX9 A;  4RB3 C;  3V7R A;  2P5L C;  3E5Q A;  3Q5F A;  3B02 A;  3GFJ A;  3F22 A;  3WTS C;  4L5I A;  4IHS A;  3DQV C;  3M9A A;  2UWM A;  4O5V A;  3QU6 A;  4A0Y A;  4IRH A;  4TV7 A;  6PAX A;  5E8I A;  3KP2 A;  1YTY A;  5J8C A;  4M71 A;  2W85 A;  2HTS A;  4HOB A;  1W5S A;  2V79 A;  4IHT A;  3QOP A;  4O6J A;  2L01 A;  4A12 A;  2KIM A;  2CWE A;  3HTU A;  3DKW A;  4JBA A;  4UVC A;  3LQQ A;  4HF2 A;  5E1Z B;  2XRO A;  2UXX A;  4Y13 A;  4EJU A;  3CUO A;  2D45 A;  1B9M A;  4DNC A;  3RIR A;  3N4M A;  5DDG A;  4BHB A;  4OU0 A;  5AON A;  1PUE E;  5JFR A;  4M9Z A;  4BAY A;  4ESF A;  3T0Y A;  2KJC A;  1K79 A;  4IF4 A;  3Q9V A;  1OYI A;  5F1R A;  1G3Y A;  1OKR A;  2WTE A;  1BI2 A;  1Z91 A;  5HS9 A;  1MJ9 A;  5LGU A;  4ZYH A;  2X0L A;  2Z5U A;  5HLH A;  4UVB A;  3GFL A;  1QPM A;  1F9N A;  5F6F A;  2F5E A;  1P4W A;  1KYZ A;  2P5K A;  1HSJ A;  2L02 A;  4R1H A;  3ZMT A;  1G4D A;  1UB9 A;  5DCM A;  1W7P B;  3ULQ B;  2A5Y B;  5L3B A;  1XMA A;  1ZN2 A;  3VOE A;  1FT9 A;  1JXS A;  1FPQ A;  1PP8 F;  3IRQ A;  4CYD A;  1ZAO A;  4RS8 A;  2UXN A;  3FMS A;  1IUY A;  1WSU A;  1U8R A;  5D6E A;  3SQN A;  2FBK A;  5CLS A;  4OIN F;  4PCQ A;  1MDM B;  3KE2 A;  2NYX A;  1S7A A;  3KLO A;  2QBY B;  3K1M A;  2HQN A;  4KA4 A;  3ECO A;  3GW2 A;  2JPB A;  2LSO A;  4B09 A;  1XN7 A;  2A07 F;  4HLY A;  4IPA A;  4XSZ F;  2XKO A;  3V8J A;  3MZH A;  2AS5 F;  1G3T A;  1I5Z A;  4CZZ A;  1FC3 A;  4UHT A;  3DEU A;  2V1U A;  5IT9 K;  4BNC A;  3HUG A;  2NAZ A;  4A6E A;  2HEO A;  3TGN A;  4G94 A;  1ZG1 A;  1FBQ A;  3QRF F;  2HR3 A;  5DUI A;  3ZN1 A;  5LEJ A;  4G7Z F;  3WTZ A;  5LLQ A;  4LFU A;  3M1E A;  4Y17 A;  5D6F A;  3S2W A;  2ZO4 A;  1BM9 A;  5K1Y A;  1UCR A;  1R23 A;  2K86 A;  2V9V A;  3J81 K;  4YFX F;  2OU2 A;  4HYE A;  4I09 A;  4M74 A;  2RKH A;  4NB5 A;  5ED4 A;  3ECH A;  2XAH A;  2QQ9 A;  2IA1 A;  2VT3 A;  5IT3 A;  3O6B B;  2KJB A;  1ZGJ A;  2VOD A;  5ICG A;  1RIO H;  1XDS A;  2CFX A;  3P7N A;  4P9U A;  4P55 A;  4HQE A;  1XDU A;  1FX7 A;  4M6X A;  1RNL A;  2L3D A;  2VE8 A;  5DCM B;  4XLP F;  4RB1 A;  2QUF A;  3I53 A;  2FRH A;  3P9K A;  1W5T A;  3U9G A;  2YSR A;  4BYY A;  1WKM A;  4F7Z A;  2JZY A;  2PEX A;  3M7G A;  1ULY A;  1ZRF A;  3GVA A;  2FF4 A;  5ILS A;  4Z2Y A;  4JQF A;  2RDP A;  2STW A;  3F8C A;  2HKO A;  1J5Y A;  2ZNZ A;  4XSX F;  3GFM A;  2DFI A;  3M8E A;  1R5G A;  4ON0 A;  1FLI A;  5J8F A;  1T39 A;  3KZZ A;  1S7O A;  3FF5 A;  2FE3 A;  1USS A;  2H6C A;  2XAQ A;  4WXH A;  1SFX A;  2Y48 A;  5HLG A;  2ACJ A;  3WU1 B;  3IKT A;  2ZME A;  5D8K B;  2RQP A;  3HRM A;  3HIF A;  5HS7 A;  1XGO A;  1B1B A;  1ZHF A;  3SZP A;  3BJ6 A;  1U5T B;  1FSH A;  2RN7 A;  1S29 A;  3B73 A;  1FYL A;  1XB4 A;  2DAO A;  2Q2E A;  2QVO A;  1K6O A;  5FLX Z;  3RKX A;  5L3D A;  4UV9 A;  1E2X A;  2HWV A;  5LRS A;  1EH6 A;  4IXA A;  3J80 K;  4U7B A;  2Z33 A;  4LLL A;  4KYW A;  1UHW A;  1MZB A;  2EV6 A;  1ON1 A;  1GXP A;  4AVP A;  3K1N A;  3QU3 A;  1QZY A;  3E6C C;  2P8T A;  3QAH A;  1IN6 A;  3EDP A;  1G6N A;  4L9J A;  2QQB A;  3ABT A;  5DYM A;  3ABU A;  1W7P D;  4EJT A;  2W25 A;  3G3Z A;  4EJW A;  2CYY A;  1J7K A;  2PMU A;  4CIC A;  3IRR A;  4RGS A;  3BZ6 A;  5FO5 A;  4EVI A;  5AIP A;  4IJA A;  1YQA A;  2M45 A;  1W7P A;  2ETH A;  2DPU A;  3QP5 A;  2J5P A;  1W4M A;  4L9T A;  1LJ9 A;  5D5V B;  1JHH A;  4A0Z A;  3T8R A;  2EFQ A;  2ADU A;  2D2W A;  3Q9S A;  2K4J A;  4ZZL A;  1VTN C;  2E7X A;  3U1D A;  3H92 A;  5ICF A;  1J2X A;  2C6Y A;  2O0Y A;  4R8H A;  3NEU A;  5CVU A;  4OIO F;  3ML6 A;  2IP2 A;  3J80 Z;  4HA8 A;  3J81 Z;  2YR2 A;  1XCV A;  3GX4 X;  1WI9 A;  2RC4 A;  2OZ6 A;  1LDK B;  2W84 A;  3GF2 A;  2XUB A;  3T8T A;  3EUH A;  3GO5 A;  3RKY A;  3LAP A;  1S3J A;  3E97 A;  2J5O A;  2EFW A;  3QP6 A;  1XSV A;  4KUM A;  2EA4 A;  3LAJ A;  3RPQ A;  5H6Q A;  1FZP B;  1MGT A;  1TTY A;  2IW5 A;  3W6K B;  4FX0 A;  4PZJ A;  5A2Q K;  3L7W A;  4ZZD A;  2FQ3 A;  1LEA A;  3P9C A;  1FY7 A;  4AIH A;  2FOK A;  2JPC A;  2ZXJ A;  2G7H A;  3I4P A;  2PFB A;  1HKT A;  2VOP A;  4LD5 A;  5CVV A;  1LVA A;  4I0B A;  3L09 A;  3U2R A;  2P6S A;  1DUX C;  3F6V A;  3WTY C;  1YLF A;  4YIF A;  4HBL A;  1X3U A;  1A04 A;  3JTH A;  4Q5S F;  2PMH A;  2MA3 A;  2CW0 F;  2XVC A;  4MQ9 F;  4B8X A;  3N97 A;  1FWZ A;  1TQM A;  4HZF A;  3KEO A;  1ZAR A;  2XKP A;  3MQ0 A;  3OOP A;  3CUQ B;  1LNW A;  2XHK A;  4LLN A;  1XSX A;  4U0V A;  3EQL F;  1S6L A;  4UNO A;  3T1B A;  5LGN A;  4DQ2 A;  3WGI A;  1TW3 A;  2GA1 A;  5D5U B;  3I59 B;  2GQQ A;  2RV8 A;  1UFM A;  2KIU A;  2XAS A;  3WU0 A;  2O6G E;  3SFZ A;  4OIQ F;  2ZCW A;  3L9F A;  2ZKZ A;  5A2Q Z;  3LFK A;  2HGC A;  3ELK A;  3HHG A;  1U78 A;  5LBQ A;  3M8F A;  5H20 A;  4L0Z B;  1ON2 A;  1B4A A;  1P4X A;  3MZY A;  1SMY F;  2MH2 A;  4FT8 A;  1BI1 A;  1CF7 B;  3E5X A;  3PQJ A;  1ZRE A;  2ZME B;  1YW7 A;  1HBX G;  2GXG A;  5HDK A;  2HYG D;  1F5T A;  2GWR A;  1RI7 A;  3HHH A;  2O03 A;  3F21 A;  4GO1 A;  2ISZ A;  4LK0 F;  2CGP A;  2IPQ X;  3DPL C;  4L9V A;  1XSD A;  5HLI A;  3KZY A;  1WRJ A;  4MHG A;  2OZU A;  1T2K A;  1H9T A;  4IRI A;  4PGG A;  4WCG A;  2GA2 A;  1FSE A;  1KQ8 A;  1TQP A;  1ZYR F;  5K5R A;  2STT A;  3CTA A;  4HW0 A;  5D5W B;  5AIQ A;  1XGM A;  2ESN A;  5F64 A;  3ZN0 A;  4KFC A;  5CVR A;  3E6D A;  1EV7 A;  1T6S A;  1I6X A;  2EFN A;  4MTE A;  1XGN A;  4LB5 A; 
#chains in the Genus database with same CATH topology
 3KP3 A;  2P6T A;  3ASN H;  3DPT A;  2Z2S B;  4RB0 A;  2ELH A;  4E7Z A;  2Y75 A;  2R7R A;  3LA2 A;  1ZG5 A;  3SDG A;  3SZT A;  4P5O A;  2GAU A;  2R7Z J;  4WF2 A;  2DYS H;  1SD5 A;  2RNJ A;  2K4B A;  2LKP A;  5EEG A;  1J75 A;  4BBS J;  2P4W A;  4XRM A;  2UV1 A;  4UUS B;  1BJZ A;  2GXA A;  2CUZ A;  3ZQ7 A;  2VC0 A;  3D0S A;  1Z9C A;  1R49 A;  5EEA A;  5EZG A;  2CQX A;  2OQG A;  1GHC A;  1IZ1 A;  1MBJ A;  2M4G A;  4M72 A;  3LSG A;  1X1B A;  4S04 A;  1PUF B;  5B66 C;  3VSK A;  4DGW B;  3F8N A;  2D1H A;  5HNF A;  3MZ8 A;  2QQA A;  5JI6 A;  3OYE A;  1VQM I;  3C18 A;  3WE2 A;  1BIA A;  2JA7 J;  1ZG3 A;  4A0X A;  4BHP A;  3H1C A;  3MEX A;  5KNL A;  2HVR A;  3EPZ A;  4DBR A;  2DFF A;  3KX2 A;  4A3D J;  3H9J A;  2VC1 A;  3A02 A;  5HVQ C;  2F5F A;  4PK4 A;  4I99 C;  2KPM A;  2KQR A;  4ZYD A;  5L3C A;  2NVU B;  2M5W A;  3TMO A;  4RB2 C;  3FMR A;  2UUZ A;  2L54 A;  1RKW A;  1IXR C;  4EM2 A;  4NC8 A;  2LDU A;  2MC3 A;  4HNV A;  1MMS A;  5HOD A;  3PSF A;  1Y8Q B;  5M3F J;  4RAY A;  1JUM A;  2LVS A;  1ZKG A;  4R79 A;  5LEK A;  1QPI A;  4DIQ A;  2XB5 A;  3CZ6 A;  9ANT A;  3J7A O;  3DBH B;  1SAX A;  1L3L A;  4S05 A;  2R7W A;  4I01 A;  3JRB A;  1AOY A;  4DYR A;  5H6R A;  3ZGK A;  3JCU C;  3ZP5 A;  3E5U A;  4ESB A;  2BYV E;  3S1R J;  4M6Y A;  1C0W A;  4ZDP A;  3DPU A;  3IWZ A;  5L3F A;  1GXQ A;  1E3O C;  4QSH A;  5M5X J;  1MDM A;  1P9Q C;  3DEW A;  2XAF A;  1HC8 A;  2BY3 A;  2MD5 A;  3QPL A;  3AG4 H;  3R61 A;  4A3G J;  1E17 A;  2A61 A;  4OAY A;  2BOL A;  2IAI A;  2DA6 A;  2HKX A;  4LLG F;  2UZK A;  3DEE A;  1V3F A;  3I4N J;  1B59 A;  3PO3 J;  1WJE A;  2E2J J;  2DOD A;  2KRC A;  3FIS A;  4DJA A;  3LSP A;  4A6D A;  2CRG A;  2M7B A;  5JHF A;  3KP7 A;  4NQW A;  4KNY A;  1GV2 A;  2HZT A;  2O61 A;  2B9S A;  2XSD C;  2WC2 A;  1K83 J;  5HS8 A;  5TRD A;  1YJW I;  1H88 C;  2PLY A;  1VQP I;  3BCB A;  2MH9 A;  1KQ0 A;  1IN4 A;  1XGS A;  2ZSI B;  2ESH A;  4F52 A;  1OR7 A;  2VL8 A;  4N9H A;  5D4S A;  2L9N A;  1FOW A;  1JE8 A;  3FM5 A;  2Y9Z A;  1G2H A;  3V42 A;  1I3A A;  2NVX J;  3COA C;  3G1L A;  1UHM A;  2HQR A;  4XKW A;  1XCB A;  3LA7 A;  2YPR A;  2NS8 A;  1T98 A;  2FXA A;  1B72 B;  1SD6 A;  1S8N A;  1HXD A;  2KZV A;  2WV0 A;  3A0H C;  3SHF A;  2OTJ I;  1Z21 A;  4PJJ A;  5K7H A;  2OUM A;  1OCC H;  4HX4 A;  2FOW A;  1S72 I;  2CU7 A;  3HG9 A;  1VQ4 I;  1ZH5 A;  1MJB A;  1KU7 A;  2HQ5 A;  1JGS A;  2ZXW H;  1BI0 A;  4EM0 B;  2JVH A;  4I02 A;  2A6T A;  4CCN A;  3BPV A;  3LA3 A;  4UUT A;  3E6B A;  5D8L B;  5EGO A;  3KP5 A;  2Y9Y A;  1O3Q A;  1DDN A;  1VZ0 A;  3KP4 A;  3WTT C;  3TW7 A;  3O2P E;  5E1W A;  5FFX A;  3ZMU A;  3MKZ A;  1Z05 A;  5BMZ A;  1V5G A;  2CMP A;  3PFI A;  4YEJ A;  5FRM A;  1IN8 A;  4XRF A;  4Y15 A;  2DK5 A;  2L5Q A;  2EFP A;  1TT5 B;  2F48 A;  4KMF A;  5E1X A;  1MD0 A;  1ETY A;  3LWF A;  3IWF A;  1SC7 A;  1RUN A;  3F8B A;  2K9S A;  4UVA A;  2MAB A;  3LST A;  3ROU A;  1D1C A;  2ZJQ F;  2VBZ A;  2I5U A;  1K78 A;  1R5I D;  3TO9 A;  4GFB A;  3OYD A;  4ZJZ A;  1H9G A;  3GBG A;  4PFP A;  1J9I A;  3M1C A;  3F8F A;  1H0M A;  2HDC A;  3I59 A;  3ZMZ A;  3K69 A;  3BJO A;  3HSR A;  1XX5 A;  2R7Q A;  2BVM A;  3C1D A;  3CP8 A;  3FHN A;  1X19 A;  4V2F A;  3OS2 A;  2DFH A;  3K4N A;  4QWQ A;  1U8B A;  3UR3 C;  5ILU A;  4EGZ A;  2CJJ A;  3I71 A;  3LSI A;  2E35 A;  4AWX B;  1D5V A;  3OYC A;  4KMU X;  3F3X A;  2QQ8 A;  5FKM A;  3H36 A;  4M3D A;  1EH8 A;  1VF9 A;  3O3K A;  4MNU A;  3K70 C;  3H3U A;  1YIT I;  4ZC3 A;  1Y1W J;  2FBH A;  2NOG A;  2XAG A;  1U5T C;  4P1W A;  2LF8 A;  5BQT A;  2QBY A;  4RGU A;  3ZXS A;  3S3O A;  2VKD A;  5TJJ A;  3NQO A;  3LNQ A;  3L2R A;  2ELK A;  3R60 A;  1W36 D;  5E17 F;  3GTJ J;  1Y0U A;  2CQN A;  1KU9 A;  3FBI B;  5E20 A;  3IL2 A;  4FX4 A;  4B44 A;  4RLF A;  3E0J B;  1IXS B;  3BQZ A;  2OBP A;  3TKY A;  2QYO A;  4Q48 A;  4BEH A;  4WK8 F;  3AKZ A;  3VYR B;  2BV6 A;  1OYW A;  3CDI A;  2PBI A;  4PSW A;  3VYS B;  1R1U A;  1Z6T A;  3W6J B;  2VOO A;  1KGS A;  1B9N A;  4XID A;  1IGN A;  2PG4 A;  1BBY A;  2LKS A;  2R4G A;  3OL3 A;  2OTL I;  1BN5 A;  1Z67 A;  5FRN A;  2DOE A;  4ETS A;  3I58 A;  2DPD A;  1YW8 A;  1JT6 A;  1G3S A;  4NQW B;  4XKB A;  3TDU C;  3G73 A;  1R22 A;  4GYI A;  2WA0 A;  1P92 A;  2FU4 A;  3ZMS A;  4U0Y A;  3OYI A;  3I56 I;  2M1B A;  1QZE A;  4CHU A;  3GTG J;  3BR5 A;  4FQG A;  1B8I B;  2IA0 A;  4OIP F;  3K4C A;  4ZYG A;  2RRE A;  3CCS I;  4ENN A;  4D0P A;  1T0F C;  1BI3 A;  3OV8 A;  2EJR A;  4FE4 A;  3DV8 A;  1ZTR A;  2DA3 A;  2CSO A;  4FAS D;  2KLO A;  3ZQI A;  2WY7 Q;  3FXO A;  5J1U A;  4DBQ A;  4HV5 A;  2KP6 A;  2X85 A;  2EFO A;  1YO5 C;  4LK1 F;  2Z1D A;  1PP7 U;  2O8K A;  3BR2 A;  2NRA C;  1VQ9 I;  5CQE A;  2VB6 A;  4CH7 A;  5LHG A;  4E7L A;  1ZRC A;  2EQR A;  1PVE A;  2VJ4 A;  3VPR A;  1TWA J;  2QZ8 A;  3B6C A;  2WAF A;  4D1Q A;  2XF5 A;  5FLX K;  1WQ2 A;  3AAF A;  1O7L A;  1I50 J;  1YS7 A;  4KN7 X;  3RI4 A;  1RUO A;  3AG3 H;  4Y4R A;  4OAZ A;  5F27 A;  3GZ5 A;  2E2H J;  2IA2 A;  2KT0 A;  2R7T A;  1D1B A;  1E3H A;  3GTQ J;  1VQ7 I;  4E7I A;  2E1N A;  2BBY A;  2WBM A;  3KYC B;  4W97 A;  2GOX B;  1ZGW A;  2LNB A;  5FGM A;  1OLT A;  5EZH A;  3TDZ C;  5DCF A;  3LOC A;  3FX3 A;  2KKO A;  2X6Y A;  2CQK A;  5KVR A;  3J7Z I;  4A3K J;  4H0E A;  3I0T A;  1BW5 A;  1JKQ C;  2AO9 A;  4MEY F;  2Q8K A;  3PUF A;  1IF1 A;  3HRU A;  4HDV A;  1W0T A;  2ZJ2 A;  5ICE A;  2H09 A;  2L4M A;  5J1R A;  4IOC F;  5DD8 A;  2HYJ A;  3H9Q A;  4G9Y A;  2DTR A;  2KMU A;  2OCC H;  3OYG A;  1UMQ A;  4DW6 A;  1GUU A;  4KIT B;  2V1D A;  5BPD A;  2YS9 A;  4AU7 A;  2KRH A;  2DN0 A;  3ISP A;  2IEK A;  1E0E A;  2X48 A;  1KU2 A;  4EQQ A;  3BPX A;  2M4K A;  3CF5 F;  4ENK A;  2BGC A;  2ZC2 A;  2Y0M A;  4I76 A;  1HW5 A;  1DGR M;  4WXD A;  1DGW Y;  4B47 A;  5GPA A;  3ZQH A;  2XPV A;  1F4K A;  5E79 C;  1DP7 P;  1N77 A;  2G7U A;  4LB6 B;  3RYR A;  2JTV A;  2X6W A;  4U88 A;  3G71 I;  3SXY A;  4CA0 A;  1W36 C;  1Z0X A;  1A31 A;  1Y0N A;  1LEB A;  4NNJ A;  3JRC A;  2YU3 A;  4I2O A;  1O57 A;  4AYB A;  4MIM A;  4YFN F;  4LOC A;  3HSE A;  1WH7 A;  1LQ1 A;  1KU3 A;  3VB2 A;  3OYJ A;  1FIA A;  1K7A A;  4CSW A;  3OYB A;  1QVT A;  1ZLK A;  4OMY A;  3WE3 A;  2DI3 A;  2EWN A;  3EYY A;  4ITV A;  5E3O A;  2WB1 A;  4KDP A;  4ZDL A;  5FFZ A;  1R7J A;  3OL4 A;  3FXU A;  1MH4 A;  4DZP A;  4JOM A;  3E6M A;  5IYD J;  1J0R A;  1QNT A;  3JTG A;  1BJA A;  3HKZ N;  3RPU A;  1DU0 A;  1F1Z A;  4ENJ A;  1TLH B;  2X9D A;  3MWM A;  1STZ A;  2O3F A;  3HOT A;  3QYB A;  1SVO A;  1HW2 A;  4PSX A;  3IHU A;  2A69 F;  1OCZ H;  2H6B A;  3SEZ A;  2V26 A;  3GLL A;  4RGR A;  1W1W E;  2W00 A;  5BS6 A;  2P7C B;  2M0C A;  3CF2 A;  4UUV A;  4XNF A;  3JRE A;  3E1S A;  1MBH A;  2W24 A;  1BL0 A;  3D5L A;  2PJP A;  2FMY A;  3ERE D;  2MW8 A;  3HJE A;  3PNV A;  1BC7 C;  4L9N A;  2W4S A;  1YE9 A;  3OYK A;  3VWB A;  4LB5 A;  1WVR A;  2D1V A;  3LSK A;  5EYR A;  3TW6 A;  1YS6 A;  3VSL A;  2GXB A;  4KIG A;  4NC7 A;  3HOS A;  3K0L A;  2A5W A;  1TBX A;  2MBF A;  3CCY A;  2QEX I;  2M87 A;  2XF6 A;  3I54 A;  3WG9 A;  2ZME C;  3GFI A;  3F6O A;  4IHX A;  1FMW A;  2EA2 A;  2V7F A;  1HW1 A;  2VQG A;  2VN2 A;  1Z1D A;  1IV8 A;  3CD6 I;  3V8K A;  1KYW A;  1RC9 A;  4HX7 A;  5EGO B;  3HTS B;  4HQM A;  3C7J A;  1ZLJ A;  4I7H A;  1IRG A;  1JJ6 C;  4G6Q A;  2L0K A;  5FLV A;  2JJ7 A;  1T08 B;  1NHA A;  3PNT A;  3N05 A;  3MFK A;  5IT9 Z;  3PFY A;  3ZMV A;  4IX7 A;  4D7N A;  1PDN C;  3CO7 C;  4UXN A;  3GTK J;  2XGD A;  4RMN A;  1SFO J;  2PX9 A;  3S2D J;  2F6C A;  4K2E A;  4I0A A;  5ILV A;  3H3V K;  2JVG A;  4F93 B;  1OJL A;  4F91 B;  1ERD A;  3MMY B;  3BR1 A;  4IQ4 A;  1BR1 A;  4BQN A;  3KFW X;  3JW4 A;  4F3Q A;  2KIF A;  2QLZ A;  3REO A;  2DA7 A;  5LRR A;  3F0C A;  1Y1V J;  3L00 A;  1ENH A;  3BLY A;  3DF8 A;  2ZNY A;  1J09 A;  3BCA A;  3OR2 C;  2PN6 A;  1SFU A;  3L1P A;  2IGK A;  3I64 A;  4HV6 A;  4E7K A;  3CUQ A;  1IRZ A;  2A05 A;  5FKL A;  2DLL A;  2FBI A;  5C44 J;  3T5X A;  1WWX A;  2DOA A;  2BVL A;  5DD4 A;  4JX5 A;  3HKZ A;  2LFB A;  4BU2 A;  3FXK A;  4PGH A;  1YOV B;  5M5W J;  1DQU A;  3CO6 C;  3FXR A;  1VFC A;  3LMM A;  3ZMD A;  5L3E A;  4UV8 A;  2N8G A;  2Y31 A;  5KAF C;  2JQ7 A;  3KEY A;  1P6R A;  3Q0U A;  3FZV A;  4HSR A;  4RLQ A;  1TL8 A;  3GTL J;  3J7A Y;  1MKM A;  3U1K A;  3KYL A;  3WOD F;  2NOJ B;  3WTU C;  5IYC J;  3RZD J;  2R92 J;  1XS9 A;  4A3L J;  2VON A;  3FBN B;  3FDY A;  5TIS C;  1NG6 A;  3KET A;  3BWG A;  3RKW A;  3TO7 A;  1FTT A;  3WG7 H;  3K9T A;  2FUG 2;  3CMY A;  5BPI A;  2COM A;  3HZJ A;  3GYH X;  5J40 A;  1UG0 A;  2HDW A;  1QHH D;  2X1C A;  5DM7 F;  1P2F A;  3K1P A;  1ZEL A;  4M3G A;  1VQL I;  2PQ8 A;  3HXL A;  1KON A;  2FNA A;  1HKQ A;  4XBF A;  2LK2 A;  4BXU A;  5HOO A;  2L9S A;  4XLN F;  1JKO C;  2BHY A;  4N4O B;  4P9F A;  3HOY J;  2EIL H;  4MLO A;  5FD6 A;  1K6Y A;  3R4K A;  5IOZ A;  1UST A;  1RR8 C;  1JKR C;  3PQK A;  4M9S A;  2EIM H;  2L7K A;  1X58 A;  2MLG A;  3DU6 A;  4ENM A;  1O3T A;  5JVG F;  3F9K A;  2ZBK A;  4PDK A;  1LB2 A;  2L4A A;  3F72 A;  1I1S A;  4LMY A;  1UZC A;  1HLV A;  2K9Q A;  3K4J A;  2Z3Y A;  2FSW A;  4CZC A;  4NC6 A;  3CLO A;  2IGM A;  5K7F A;  1ODD A;  2M30 A;  1IN5 A;  2NVT J;  2VT2 A;  2OPT A;  3WGH A;  2V1N A;  3HRS A;  1OCP A;  4FHT A;  3ZCO A;  4AC0 A;  4EJV A;  3OYN A;  3FHZ A;  4M73 A;  1Y56 A;  4WXC A;  3BG6 A;  4BS9 A;  1CF7 A;  2K3F A;  5E18 F;  3WHC A;  1P7J A;  3TL4 X;  2VKE A;  2F5C A;  1ZK8 A;  2K40 A;  1LDJ A;  1UG2 A;  2DQL A;  2CW8 A;  3BG9 A;  1O7F A;  3MCZ A;  2KDZ A;  3DLA A;  1EJ9 A;  3RQ4 A;  2WV1 A;  4QPQ A;  3HBL A;  2K85 A;  1T38 A;  1FEX A;  3HRT A;  2XPW A;  1SEU A;  2E19 A;  5B1B H;  1TQI A;  2AXT C;  3M8J A;  4LG0 B;  4CGZ A;  1OPC A;  4LIT A;  2BEO A;  2HU9 A;  4WWC A;  4BBR J;  2XRN A;  4BKX A;  4IVN A;  2EB7 A;  4G7O F;  1JHF A;  4N4N B;  5GAE J;  3DXJ F;  5EG0 B;  2H8W A;  1T95 A;  3FWE A;  2K9N A;  4BDZ A;  2W82 A;  2WAE A;  4EMS A;  4L18 B;  4EM1 A;  4KIB A;  2EPF A;  4AID A;  4X0G A;  4A5M A;  2E60 A;  3KEQ A;  3CCE I;  2HQA A;  3R0A A;  1ORK A;  3H35 A;  4AD9 A;  2M7A A;  2KIQ A;  3CES A;  1IRF A;  3AFH A;  4C9Y A;  2R7O A;  3K4L A;  3OYM A;  3C3W A;  1SFK A;  1LE8 B;  4JX6 A;  1W0U A;  5EF6 A;  2KDO A;  2KRF A;  2DO7 A;  1V55 H;  2V6C A;  2EK5 A;  3DWL E;  2M8G X;  4BY7 J;  2WWY A;  5F1J A;  1T0F A;  1Y8R B;  3OOU A;  1SFE A;  5CJ9 A;  3C2H A;  4M6V A;  2F5V A;  2XIG A;  4U0W A;  2IS4 A;  2ISY A;  2ZJR F;  2VE9 A;  5LGT A;  2X51 A;  4LJZ F;  2JT1 A;  4GCV A;  3G6E I;  1BR2 A;  4HAM A;  1VQ8 I;  2EV0 A;  4JK1 X;  2H94 A;  2A6E F;  4RAG A;  1ZQ3 P;  2E2I J;  1D3Y A;  2CV1 A;  1R5H A;  1ETV A;  4UB8 C;  2M3A A;  3F8M A;  2K5C A;  3KLN A;  1SMT A;  5CVI A;  1G59 A;  4LGW A;  2L9R A;  4U7D A;  4BAC A;  3CCM I;  3GEZ A;  1NG7 A;  4A2U A;  1SD7 A;  3V7C A;  2DCE A;  1TW2 A;  4G7H F;  5ERI A;  2QKL B;  3PUB A;  4M9X A;  3WTX C;  3SDB A;  4CYC A;  3BOQ A;  5FD5 A;  3IAS 2;  1XD7 A;  1IW7 F;  1BOB A;  4IRG A;  3JSO A;  3VDX A;  4F92 B;  3P9I A;  2HS5 A;  4HF0 A;  2NS7 A;  1YJN I;  2K02 A;  2QM3 A;  4A3J J;  1OCR H;  3H0G J;  1QGP A;  1BIB A;  1KA8 A;  2VAS A;  4DZJ A;  1K78 B;  2P5V A;  5E8G A;  2R7F A;  3W2V A;  3MD2 A;  4PUS A;  5CQG A;  1REP C;  3VYU B;  2LF7 A;  2F4M B;  2H27 A;  1ONV A;  1BR4 A;  4NUB A;  2O8X A;  2HVQ A;  3PO2 J;  2DDA A;  3U21 A;  4A3I J;  1Z3Y A;  2CQ7 A;  3WTW C;  2OQR A;  1PJR A;  2QSH X;  1FBU A;  3HOV J;  5DEQ A;  4HEA 2;  1ZRD A;  4B3X A;  2ZFW A;  3H3Z A;  3I5U A;  1KQ9 A;  3M4O J;  1AA7 A;  1IDY A;  1D0Y A;  5JHU A;  2LBF B;  4A93 J;  2EH3 A;  3ZQQ A;  2HYF A;  1F43 A;  3HYI A;  3CP2 A;  5FB2 A;  2NVQ J;  2BE5 F;  2M8E A;  5JR3 A;  2G0E A;  3K2A A;  5LHH A;  5M5Y J;  4MEX F;  1IRX A;  1K4S A;  2HOE A;  1IXC A;  3CUQ C;  3CME I;  4PJM A;  3TOB A;  2HTJ A;  3ZPL A;  4QPO A;  2GIV A;  2Q1Z B;  3K4M A;  1YW9 A;  1ETW A;  1ETQ A;  3LSH A;  4Q47 A;  2P7V B;  5L3G A;  1MW7 A;  2ID3 A;  1CGP A;  4XOT A;  2LP0 A;  1FP2 A;  4HF1 A;  1X4P A;  3JAM K;  4UUS A;  3CCR I;  3QPT A;  4RGX A;  1I1G A;  3RTR A;  1YIO A;  4L5E A;  3S15 J;  3BR0 A;  3LSJ A;  3R0J A;  3L2V A;  1U0J A;  2LOO A;  5HDG A;  4CDG A;  2DMP A;  2F5D A;  4FTH A;  1WJB A;  1DPR A;  5D5X B;  4ASN A;  1GVJ A;  4IOA F;  5J6X A;  1GDT A;  2IRF G;  5LHI A;  3RDI A;  2QCO A;  1V4R A;  1Z7U A;  2Z99 A;  1DU6 A;  5DM6 F;  3GLX A;  4ZH4 F;  5KCM A;  1IJW C;  4JYK A;  2IJL A;  1LKX A;  1X1C A;  3RYP A;  3TO6 A;  1YRN B;  3ASO H;  5GAH J;  1D8K A;  4U87 A;  2BW3 A;  4M3E A;  2FQ4 A;  1MSE C;  5HDN A;  5H2F C;  1HF0 A;  3FMQ A;  1FYM A;  3CDL A;  3PL8 A;  3OS0 A;  5IP9 J;  1A5J A;  1O3S A;  4A5N A;  4L0Y B;  2MLK A;  2OAZ A;  4HDU A;  5EJC A;  1NK3 P;  4I98 B;  3EUA A;  4XKV A;  1RES A;  3DFG A;  2OJE D;  2KFD A;  1OFC X;  1U3E M;  2FA5 A;  1Q1H A;  5DUK A;  1D0X A;  4KIS A;  1HQC A;  2RNG A;  3DKX A;  1QZZ A;  5J1Y A;  2OF7 A;  3VFZ A;  3WGG A;  4LG0 A;  3CDH A;  3IKV A;  3KPH A;  4LIU A;  2G9W A;  1XMX A;  2F2E A;  5DV5 A;  4FET A;  3V7S A;  3MKY B;  2DT5 A;  2E7W A;  2LBF A;  4M3B A;  4QLC U;  5FKO A;  2FNP A;  1DPU A;  4GXO A;  4GYG A;  3HSF A;  5BOX A;  2CG4 A;  5FLM J;  1YG2 A;  3WHB A;  5K5O A;  2DMQ A;  4QIW N;  2JSC A;  2D5V A;  3BRO A;  5KK1 A;  5CPR B;  4HG2 A;  4GGG A;  3IAM 2;  2VPR A;  2NVY J;  4BQQ A;  1WJF A;  1U5T A;  3R6S A;  4EGY A;  2XGX A;  4KT6 A;  1BC8 C;  2LYC A;  4A3M J;  3BR3 A;  1R1V A;  2HFH A;  2LKX A;  2E1O A;  5KAI C;  5JLW A;  2X1E A;  4KIF A;  3RPU D;  4EJO A;  4BE0 A;  1HKS A;  2V9K A;  1JI8 A;  4XLE A;  1FNN A;  3HGG A;  4HLX A;  4J01 A;  1YFH A;  2XF7 A;  5C4X J;  1P4A A;  4Z6Y A;  1HST A;  1I27 A;  1JTX A;  4I6Z A;  2P0W A;  2VXZ A;  1EF4 A;  4ESJ A;  1R9T J;  3HOZ J;  3HUG B;  1FTZ A;  4BGD A;  3TP3 A;  1SD4 A;  1VND A;  3G1O A;  1H89 C;  3H5N A;  3BJA A;  4BH9 A;  1UAA A;  2K27 A;  1MBK A;  1AKH B;  2AQE A;  1FOK A;  2Y0S A;  2IVM A;  3OYL A;  2FML A;  1IN7 A;  1J59 A;  2XAJ A;  3LSM A;  2LTP A;  3EYI A;  2OD5 A;  3PJR A;  2GIZ A;  4YFK F;  4A3C J;  2GZW A;  2Z16 A;  4BHC A;  3QPH A;  2Q0O A;  2TDX A;  3PIP F;  2XPU A;  5EEH A;  2LY1 A;  4IO9 F;  1QVU A;  2OA4 A;  1OYY A;  3M07 A;  3DBL B;  4Q4Z F;  1OMI A;  2EV5 A;  2E5N A;  3K70 D;  3AL0 B;  4OMZ A;  1QBJ A;  1XMK A;  4V19 K;  1EH7 A;  4C2T A;  2A6H F;  4RAZ A;  3GXO A;  4L5J A;  4E4H A;  1V5F A;  2RVC A;  1B8I A;  5D4R A;  2AXL A;  5J4Y A;  4BJT A;  3NWS A;  4YRV A;  3A01 B;  3IH3 A;  2DBB A;  2YX7 A;  3I4M J;  1JKP C;  2E1M B;  3L2W A;  2JRT A;  3OWT A;  4P96 A;  3CJN A;  2R7D A;  1AWC A;  3JRA A;  5TGT A;  2DU9 A;  2DK8 A;  1LDD A;  4EV0 A;  4AIJ A;  2PI0 A;  1N78 A;  3KP6 A;  1U2W A;  1YYV A;  4PJ0 C;  2DQR A;  1ZGA A;  3V4G A;  2DTZ A;  2DW4 A;  4OOI A;  2XV4 S;  3IC7 A;  2JWT A;  4NHJ A;  2VBX A;  1TNT A;  1YX3 A;  2YX4 A;  5EDN A;  2K9M A;  3EUH C;  3PNY A;  3E3V A;  1TC3 C;  4C30 A;  1G3W A;  1RET A;  1WFX A;  2QEN A;  2AHQ A;  1U9O A;  3CCL I;  3GZ6 A;  4G6D A;  3DKY A;  2VQC A;  3TQN A;  4N9I A;  4B3A A;  1D8J A;  4OIR F;  3L2C A;  1Z6R A;  2X4H A;  2RAE A;  3G2B A;  1I6H J;  2VBW A;  2FEZ A;  4AIK A;  1VI0 A;  1TP4 A;  3I9V 2;  2A3S A;  1R36 A;  4HPQ A;  5JVT A;  1OQY A;  4EEF G;  2OC6 A;  3X2Q H;  2VBY A;  1U6G A;  2ZXI A;  5CVJ A;  1O3R A;  2BZT A;  3EET A;  1R1T A;  4CCL A;  1IAW A;  3TED A;  1R00 A;  4BXX J;  3KYD B;  1TWF J;  4YG2 F;  2Z9O A;  4CXF A;  2Q2E B;  4IHW A;  4HX8 A;  3VEP A;  3JSP A;  1B6A A;  2QWW A;  1QQI A;  2V1X A;  2IT0 A;  4BJ5 C;  2DMU A;  3FIW A;  2BXY A;  3NRV A;  4G6T B;  1MJA A;  3DP7 A;  1FBS A;  3BP8 A;  4CCO A;  3TBI A;  2A68 F;  5LFA A;  2H1K A;  3RJP A;  2JA8 J;  3JAM Z;  2XSJ C;  2RGV A;  2E1C A;  1N75 A;  1RZ4 A;  2DYR H;  1XTA A;  2NS0 A;  4KT5 C;  4MQV A;  4ZYA A;  3K2Z A;  3FXQ A;  1XPX A;  3LQR A;  4KIC A;  4XR6 A;  1R58 A;  3OSF A;  2IS2 A;  3J7Y J;  1QO0 D;  4G8X A;  3KCC A;  2XRL A;  3IH4 A;  2M2E A;  2EIK H;  3BY6 A;  3F23 A;  1LFP A;  2JMW A;  3ZR8 X;  4MGR A;  4N0B A;  4II3 A;  3VOD A;  4E70 A;  4MTD A;  4J00 A;  3B6A A;  3H9G A;  1WH5 A;  2B0L A;  2CO5 A;  2B63 J;  1X3Z B;  2JA2 A;  3D1N I;  1WCM J;  1K61 A;  1BOA A;  1E3P A;  2NNN A;  1TZL A;  2W57 A;  2MC4 A;  5FKK A;  1R4N B;  3S8P A;  3CC4 I;  3BDD A;  1T8I A;  4BQA A;  3CCV I;  2K7L A;  3MKL A;  3WTV C;  3MAJ A;  3FM3 A;  5CYV A;  2NNY A;  1FYK A;  1FP1 D;  4MFD A;  5K5Q A;  3HPG A;  3DTK A;  4CO8 A;  3WU2 C;  4YII A;  4KN4 X;  1L0O C;  3TOA A;  3GZN B;  2R3S A;  3GUD A;  5ICC A;  1RRJ A;  1TNS A;  4O3M A;  3GWZ A;  4ZYE A;  3LL7 A;  4XIC A;  3V8L A;  4WX9 A;  2FJ1 A;  4RB3 C;  3V7R A;  2P5L C;  3E5Q A;  2ZJP F;  3Q5F A;  2EBI A;  1SVL A;  4FE7 A;  3W3C A;  3B02 A;  3GFJ A;  3F22 A;  3OR1 C;  3WTS C;  2LD5 A;  4L5I A;  4IHS A;  3DQV C;  3L2U A;  3GTO J;  3M9A A;  5GTI C;  3PIO F;  2UWM A;  3CJR B;  2Y69 H;  4O5V A;  3ZQC A;  3QU6 A;  3FK7 A;  2VI6 A;  3OYF A;  3OSG A;  3Q0W A;  3S2H J;  2ZFU A;  4A0Y A;  1MBE A;  4IRH A;  1A35 A;  4RDU A;  4TV7 A;  6PAX A;  5E8I A;  3KP2 A;  1X2M A;  4HNU A;  2XGC A;  3ZQL A;  1LE8 A;  4EAT A;  1YTY A;  5GTH C;  5J8C A;  2V6E A;  1ZR2 A;  3H5R A;  4II2 A;  2R7S A;  1JGG A;  4M71 A;  1GV5 A;  3Q0V A;  2W85 A;  2HTS A;  4HOB A;  2EZI A;  2EZH A;  1W5S A;  4E6K G;  2V79 A;  2HNH A;  1V54 H;  4IHT A;  3QOP A;  1MIJ A;  4XKC A;  1TWH J;  4O6J A;  3S1N J;  3FXL A;  2L01 A;  5E3M A;  4A12 A;  3HPH A;  4E7H A;  2KIM A;  3DBR B;  1AU7 A;  2CWE A;  3HTU A;  1FIP A;  2XB0 X;  3DKW A;  4JBA A;  1MMG A;  4UVC A;  3S16 J;  3LQQ A;  2CQQ A;  3GME A;  5E1Z B;  1RPW A;  2XRO A;  3OS1 A;  4HF2 A;  2HOT A;  4IHV A;  2UXX A;  1HCR A;  3S1M J;  1BW6 A;  4Y13 A;  1IO2 A;  4EJU A;  2CV0 A;  3CUO A;  2D45 A;  1B9M A;  4FCY A;  4DNC A;  2VJI A;  3I3L A;  3RIR A;  3A0B C;  4KJZ A;  3N4M A;  2MFZ A;  3HGY A;  2ECC A;  1VQO I;  5DDG A;  4BHB A;  4OU0 A;  4XRS A;  2R7X A;  3FKI J;  1GVD A;  2W1O A;  5AON A;  5IPA A;  3LFU A;  3QPS A;  1PUE E;  3ABM H;  5JFR A;  4M9Z A;  4BAY A;  4D7M A;  4PJN A;  4ESF A;  1WJD A;  3T0Y A;  2KJC A;  3ZQG A;  1T56 A;  3IP4 B;  1K79 A;  4IF4 A;  1MNM C;  1VQ6 I;  3Q9V A;  2M0M A;  1OYI A;  3AG2 H;  5F1R A;  5C4J J;  1G3Y A;  4HST A;  4NBQ A;  1OKR A;  2WTE A;  3CCQ I;  1BI2 A;  1Z91 A;  3EUK L;  5HS9 A;  4YEL A;  2ID6 A;  4Y7N J;  1FOY A;  1MJ9 A;  5LGU A;  1VQN I;  4ZYH A;  2X0L A;  2Z5U A;  1YI2 I;  2PMZ N;  5HLH A;  4UVB A;  2R5Y A;  3GFL A;  1QPM A;  1IG7 A;  1F9N A;  4XK4 A;  5F6F A;  2F5E A;  1P4W A;  1KYZ A;  2P5K A;  1HSJ A;  2L02 A;  4R1H A;  2X6X A;  3ZMT A;  5FJ8 J;  1MMN A;  1G4D A;  2NXN B;  4LG3 A;  1UB9 A;  5DCM A;  1W7P B;  5B1A H;  2YU9 J;  4XOP A;  3ULQ B;  2QKM B;  4C3J J;  2CUF A;  3A2K A;  2A5Y B;  2LLK A;  5L3B A;  1XMA A;  3DTE A;  4NDL A;  3SFI A;  4A3B J;  2DT6 A;  1ZN2 A;  3VOE A;  1OCT C;  2LG4 A;  1FT9 A;  1NH3 A;  1JXS A;  4HRI A;  1FPQ A;  2WAQ A;  3QYE A;  1I3Q J;  4BEH B;  1PP8 F;  3OIO A;  3IRQ A;  1QU3 A;  4CYD A;  3CCJ I;  1ZAO A;  4RS8 A;  2UXN A;  4IL6 C;  3S1Q J;  3FMS A;  2HOA A;  1IUY A;  1WSU A;  3GCM A;  2F4O B;  1U8R A;  1ETX A;  5D6E A;  2BW3 B;  3SQN A;  2FBK A;  3I55 I;  3O8H A;  2BY2 A;  4UY8 I;  5CLS A;  3SYT A;  4OIN F;  4PCQ A;  1MDM B;  2VIX A;  4XMY A;  3KE2 A;  1WJ5 A;  2NYX A;  1A36 A;  2R5Y B;  1MNE A;  1S7A A;  3KLO A;  3BG7 A;  4W1U A;  1UJ8 A;  2QBY B;  3K1M A;  2HQN A;  4KA4 A;  2ME6 A;  3ECO A;  5EG0 A;  3GW2 A;  2CV2 A;  2JPB A;  2LSO A;  4B09 A;  1G8X A;  1XN7 A;  1S7E A;  2A07 F;  4HLY A;  4IPA A;  4XSZ F;  3GTP J;  3K4K A;  2XKO A;  1YJ9 I;  2ZSH B;  3V8J A;  1U9N A;  1Z7L A;  1MMA A;  1QRY A;  3MZH A;  2AS5 F;  1S9H A;  1G3T A;  1R71 A;  2JUC A;  1I5Z A;  4CZZ A;  1AKH A;  1FC3 A;  3E7L A;  1MSF C;  4UHT A;  2L7Z A;  1I39 A;  5GP9 A;  1PYV A;  3DEU A;  2V1U A;  4D9J A;  1EKE A;  5IT9 K;  2DOF A;  2MD0 A;  4BNC A;  3HUG A;  3ZQF A;  2HDD A;  2DMN A;  4DYQ A;  2NAZ A;  4CCK A;  4A6E A;  2HEO A;  3IH2 A;  3TGN A;  4G94 A;  2JA5 J;  3BG3 A;  1V5E A;  2R93 J;  2R7U A;  1ZG1 A;  3NAU A;  5M3M J;  1QHG A;  2IBD A;  4BUP A;  1FBQ A;  3QRF F;  5F08 A;  2X1D A;  2GLO A;  5DTD A;  3NWT A;  3A4C A;  1KZH A;  2O7O A;  4FIS A;  2CS3 A;  3MKW B;  2HR3 A;  5DUI A;  2KHM A;  3ZN1 A;  5LEJ A;  2EZK A;  4G7Z F;  3WTZ A;  3BTL A;  5LLQ A;  4LFU A;  2TRT A;  3M1E A;  3CMM A;  4Y17 A;  2QSG X;  2AQF A;  2VKH A;  5D6F A;  2L7F P;  3S2W A;  2ZO4 A;  1BM9 A;  5K1Y A;  1ACI A;  1UCR A;  1P7I A;  1R23 A;  1FMV A;  1LUJ B;  4B48 A;  2K86 A;  1TWC J;  2V9V A;  2HPI A;  4GDF A;  3J81 K;  4YFX F;  2B7E A;  3JR9 A;  3ONQ A;  2R5Z B;  4BY1 J;  2OU2 A;  5IOY A;  4HYE A;  4I09 A;  4M74 A;  3S3M A;  2RKH A;  2V4J C;  5HLT A;  4NB5 A;  2CFO A;  2GBY A;  5ED4 A;  3ECH A;  2E36 A;  2XAH A;  5FKN A;  2QQ9 A;  2IA1 A;  2IGO A;  5E3N A;  2IS1 A;  1X4O A;  3JRF A;  4XLF A;  2VT3 A;  5IT3 A;  3O6B B;  4X1E A;  1SAU A;  2KJB A;  1YX5 A;  1ZGJ A;  2QSF X;  4MFE A;  2DA2 A;  2HI3 A;  5ICG A;  2VOD A;  1BA5 A;  1RIO H;  4V2G A;  1XDS A;  2CFX A;  3P7N A;  4E7S A;  2ELJ A;  4AYB N;  1B72 A;  1LPQ A;  4BJ6 C;  4P9U A;  3C2G A;  4P55 A;  4HQE A;  2L7M P;  1SAN A;  5FRO A;  4DYC A;  2L2O A;  1XDU A;  1FX7 A;  4M6X A;  4XLC A;  1RNL A;  1OIS A;  5J47 A;  2L3D A;  1RR7 A;  2VE8 A;  2LY2 A;  5DCM B;  2DT7 B;  4IZZ A;  4XLP F;  4RB1 A;  1D1A A;  2DA5 A;  2E5Z A;  2QUF A;  3I53 A;  2FRH A;  3P9K A;  4XL9 A;  1W5T A;  3U9G A;  2YSR A;  4BYY A;  4C2M J;  1WKM A;  3QWL A;  2GOM A;  4GRI A;  2DMT A;  4F7Z A;  2JZY A;  2PEX A;  1JT0 A;  4JX4 A;  3M7G A;  4XOR A;  1ULY A;  1YIJ I;  1ZRF A;  4ZDO A;  1H8A C;  2CUJ A;  2W48 A;  3GVA A;  2FF4 A;  5F04 A;  3BG5 A;  5ILS A;  4Z2Y A;  1IC8 A;  4JQF A;  2RDP A;  2JK3 A;  4IKF A;  2STW A;  2OCE A;  3F8C A;  3W6V A;  2HKO A;  1J5Y A;  2ZNZ A;  4BDY A;  2Y2Z A;  4XSX F;  3GFM A;  2DFI A;  3M8E A;  3QOD A;  5LD2 C;  2MGQ A;  2XC7 A;  1R5G A;  3K10 A;  2CUE A;  4ON0 A;  1FLI A;  4IEJ A;  5J8F A;  1T39 A;  1Z3X A;  2EIN H;  3KZZ A;  1S7O A;  3ABL H;  3FF5 A;  2BXZ A;  1USS A;  2FE3 A;  4B43 A;  3TP0 A;  2H6C A;  4BQO A;  3GTM J;  2XAQ A;  4WXH A;  1POG A;  1SFX A;  2Y48 A;  5HLG A;  2ACJ A;  1IDZ A;  3WU1 B;  3IKT A;  2ZME A;  5D8K B;  2Y0S N;  2L9V A;  4D5F A;  1WJC A;  2VUM J;  2FX0 A;  2RQP A;  5J3L A;  3PM1 A;  1OCO H;  2E71 A;  3HRM A;  3HIF A;  5HS7 A;  5GAG J;  2CW7 A;  1XGO A;  3BZK A;  4XON A;  5F0F A;  2QA4 I;  3HM5 A;  2BY0 A;  1B1B A;  5B5E C;  2YUS A;  1ZHF A;  2ECB A;  2JSP A;  4C3H J;  3SZP A;  3BJ6 A;  1LFU P;  5J4V A;  2H8R A;  1U5T B;  4M3F A;  1FSH A;  2RN7 A;  2H1L A;  1S29 A;  3B73 A;  1FYL A;  1XB4 A;  4CYC B;  2DAO A;  3D5S C;  3CJT B;  2Q2E A;  2BY1 A;  2QVO A;  1K6O A;  2COB A;  3JRD A;  4C2U A;  5FLX Z;  4ZTF A;  3RKX A;  4OWR B;  5L3D A;  3OY9 A;  4UV9 A;  1E2X A;  2HWV A;  5LRS A;  1EH6 A;  2DJI A;  2XDV A;  4IXA A;  5CKT A;  3J80 K;  4DOZ A;  2ZXH A;  4U7B A;  2EZL A;  2Z33 A;  3QOE A;  4LLL A;  4KYW A;  3OIP A;  1UHW A;  1MZB A;  4BL0 B;  3DCF A;  2EV6 A;  1ON1 A;  1GXP A;  4AVP A;  1R4M B;  3K1N A;  3QU3 A;  4XQF A;  1QZY A;  3E6C C;  2P8T A;  3QAH A;  3S14 J;  3LSR A;  1IN6 A;  3EDP A;  3QYF A;  2MYS A;  1G6N A;  3O8G A;  2ME0 A;  2MG4 A;  4L9J A;  2QQB A;  5KHD A;  1WZ2 A;  3ABT A;  3BR6 A;  4MO7 A;  2LC2 A;  5DYM A;  3JRG A;  4AM3 A;  1Y39 A;  3ABU A;  2DDB A;  1W7P D;  3AL0 C;  1LFB A;  4EJT A;  2W25 A;  4RA2 A;  3G3Z A;  1AHD P;  1HDP A;  4EJW A;  2XGE A;  1JTY A;  2CYY A;  1J7K A;  2PMU A;  4CIC A;  3IRR A;  4RGS A;  2LRE A;  2XAU A;  1JJ8 C;  3BZ6 A;  2P81 A;  2W7N A;  5FO5 A;  2PJR B;  1R6R A;  4EVI A;  1WPK A;  3BTC A;  1YHQ I;  5AIP A;  3NAR A;  2VPL A;  2HXI A;  4XRS G;  4XN0 A;  1EA3 A;  4IJA A;  1VQK I;  3ERM A;  1YQA A;  2K9L A;  4AUX A;  1W5C C;  1APL C;  2M45 A;  1W7P A;  2ETH A;  2KL4 A;  2DPU A;  3QP5 A;  1NK2 P;  2J5P A;  1W4M A;  3W2W A;  3JRH A;  1VQ5 I;  3CJQ B;  4L9T A;  1LJ9 A;  1Y6I A;  5D5V B;  1XG1 A;  1JHH A;  4A0Z A;  5GAD J;  1ETK A;  3IUO A;  3Q3S A;  3T8R A;  3AG1 H;  2EFQ A;  1X3W B;  2ADU A;  4RM3 A;  2D2W A;  2TCT A;  3IV5 A;  3Q9S A;  2R5Z A;  3A1Y A;  1HOM A;  2K4J A;  4ZZL A;  1VTN C;  1A6Q A;  1TWG J;  2E7X A;  3K4B A;  3U1D A;  4XLH A;  4S0H B;  2LY9 A;  5E3L A;  1SVM A;  3H92 A;  3K7A J;  1J2X A;  5ICF A;  2C6Y A;  2O0Y A;  4R8H A;  3CCU I;  4B1R A;  2IS6 A;  1Z77 A;  3OYA A;  3NEU A;  5CVU A;  1GLN A;  4OIO F;  3ML6 A;  2IP2 A;  2HVS A;  3J80 Z;  1WI3 A;  5DS9 A;  4HA8 A;  4A69 C;  3J81 Z;  2YR2 A;  1XCV A;  2HZD A;  5HNH A;  1IUF A;  3GX4 X;  1WI9 A;  3H0D A;  2RC4 A;  2OZ6 A;  2V9P A;  1LDK B;  2W84 A;  3BZC A;  3G4S I;  3GF2 A;  2XUB A;  3T8T A;  3EUH A;  3GO5 A;  3RKY A;  2JUG A;  2X6O A;  5F0C A;  2LR8 A;  3SZG A;  3M3Y J;  3LAP A;  1S3J A;  3E97 A;  2J5O A;  2JRM A;  2EFW A;  2OV7 A;  3QP6 A;  1XSV A;  4Y52 J;  4KUM A;  2EA4 A;  3LAJ A;  3RPQ A;  5H6Q A;  1FZP B;  1MGT A;  1TTY A;  2IW5 A;  3W6K B;  4ABZ A;  2IGN A;  4FX0 A;  1FJL A;  4C3I J;  1K4T A;  4J19 A;  5B3S H;  4PZJ A;  3K6G A;  4PJL A;  5A2Q K;  3MVP A;  2LMD A;  1NTC A;  2F4I A;  3ESW B;  3L7W A;  4ZZD A;  2FQ3 A;  3FXJ A;  1LEA A;  3P9C A;  2DA4 A;  5F0H A;  1T33 A;  5IP7 J;  4BE2 A;  1X1D A;  2I8D A;  1FY7 A;  4CUG A;  4AIH A;  5IP6 A;  2FOK A;  1LVK A;  2LH9 A;  4ANJ A;  2JA6 J;  2JPC A;  4AVZ A;  2ZXJ A;  2G7H A;  3I4P A;  3S93 A;  2PFB A;  3CQZ J;  4D5C A;  3ABK H;  4IHY A;  1UEL B;  2VXD A;  1HKT A;  3HOX J;  1GT0 C;  4LD5 A;  1QA6 A;  2VOP A;  5BNG A;  3JRI A;  2DJN A;  5CVV A;  1LVA A;  1OR7 C;  4I0B A;  2LRD A;  3L09 A;  1X2N A;  1MBF A;  3SEQ A;  3U2R A;  2BHZ A;  1ITY A;  2P6S A;  4BE1 A;  1DUX C;  3F6V A;  3G1M A;  3UKG A;  3WTY C;  1YLF A;  3MN2 A;  3DU5 A;  4YIR X;  4YIF A;  4HBL A;  1RKT A;  2EIJ H;  1X3U A;  5IY5 H;  1XC5 A;  3A01 A;  1A04 A;  3CC2 I;  3UNG C;  2ICW G;  3JTH A;  2DXI A;  1YRN A;  4Q5S F;  2PMH A;  2O9L A;  3HOW J;  2MA3 A;  2CW0 F;  3S32 A;  2XVC A;  3VYT B;  4BXF A;  4MQ9 F;  1ETO A;  4B8X A;  3N97 A;  3CLQ A;  4G12 A;  2PJR A;  1FWZ A;  2HXO A;  3W2A A;  1TQM A;  4HZF A;  3KEO A;  4RM2 A;  1X1A A;  1ZAR A;  2XKP A;  2IXS A;  3MQ0 A;  1WJA A;  2VQL A;  4CCM A;  2KZG A;  3OOP A;  3BTI A;  3CUQ B;  2VKV A;  1LNW A;  2XHK A;  2DFE A;  4LLN A;  2VJJ A;  2R0Q C;  1XSX A;  3BC8 A;  1HDD C;  2FD5 A;  4U0V A;  4A3F J;  3HEF A;  3EQL F;  1S6L A;  2R7V A;  4UNO A;  3T1B A;  1FOX A;  5LGN A;  1HA8 A;  4DQ2 A;  1TT0 A;  1TW3 A;  1JUP A;  3WGI A;  3RKQ A;  3S17 J;  2GA1 A;  2QF7 A;  3OMY A;  5D5U B;  1CQT A;  3P5J A;  3I59 B;  1O4X A;  2GQQ A;  4HNT A;  2RV8 A;  1WGX A;  3HDD A;  1UFM A;  2KIU A;  2XAS A;  3WU0 A;  2O6G E;  4F55 A;  3SFZ A;  3CMA I;  3C2B A;  4XN3 A;  4B4C A;  4OIQ F;  2ZCW A;  3L9F A;  1D0Z A;  2ZKZ A;  5A2Q Z;  3LFK A;  4H4K C;  2HGC A;  3ELK A;  3HHG A;  2M9H A;  3ZOB A;  1U78 A;  3HOU J;  5LBQ A;  3M8F A;  5H20 A;  2PMZ A;  1ON2 A;  1B4A A;  1N25 A;  4L0Z B;  1P4X A;  3MZY A;  4XM3 A;  1SMY F;  3ZRG A;  2MH2 A;  2WAD A;  4FT8 A;  1BI1 A;  2RQQ A;  1CF7 B;  3E5X A;  2Y30 A;  3PQJ A;  5C3E J;  4RBO A;  1ZRE A;  2ZME B;  2VLA A;  3L2Q A;  3BT9 A;  1YW7 A;  1HBX G;  2GXG A;  2M34 A;  3DTI A;  3BTJ A;  3FXM A;  2QGU A;  2KIS A;  1PUF A;  3FK6 A;  3RQI A;  5HDK A;  4Y3O A;  2HYG D;  5K7Z A;  3RZO J;  3KZI C;  1MH3 A;  3HL2 A;  1F5T A;  2GWR A;  1RI7 A;  2WY8 Q;  3HHH A;  5JLX A;  4E7J A;  1D5Y A;  3OIQ A;  1F36 A;  3A03 A;  2O03 A;  1Q1V A;  2VJ5 A;  3F21 A;  2ZB9 A;  2WAQ N;  4GO1 A;  4A3E J;  2ISZ A;  3HB9 A;  4LK0 F;  1MBG A;  2CGP A;  2IPQ X;  4Y33 A;  1S5L C;  3CC7 I;  3DPL C;  4L9V A;  2DA1 A;  3OYH A;  1XSD A;  5HLI A;  1JUS A;  3HC7 A;  3KIO A;  4IQJ A;  3KZY A;  4RAF A;  1MMD A;  1WRJ A;  4MHG A;  2OZU A;  3PSI A;  1T2K A;  2MSY A;  3SJM A;  1H9T A;  4IRI A;  1UHS A;  4QTR A;  2WB1 N;  3D5R C;  2E1M C;  2GA2 A;  4PGG A;  4WCG A;  5GPC A;  4ZTJ A;  2HOS A;  1FSE A;  3S3N A;  4X6A J;  1KQ8 A;  1TQP A;  1ZYR F;  4CCJ A;  5K5R A;  2E34 A;  1M1E B;  2HPM A;  3RSN A;  2JN6 A;  1ZR4 A;  3QQA A;  1IV6 A;  3RCO A;  2STT A;  4JP0 A;  3BQY A;  3CTA A;  4HW0 A;  2CH0 A;  1A6I A;  5D5W B;  5AIQ A;  1XGM A;  2ESN A;  5F64 A;  3ZN0 A;  4KFC A;  5CVR A;  5IYB J;  3E6D A;  1EV7 A;  2K3P A;  4PFO A;  4UB6 C;  1DP3 A;  4LIV A;  1T6S A;  1I6X A;  1WHU A;  2O5R A;  2EFN A;  2I10 A;  2VQH A;  4MTE A;  1MND A;  1XGN A;  3DLL F;  2GM4 A;  3FKJ A;  1X1P A;  4XLA A;  3H5A A; 
#chains in the Genus database with same CATH homology
 3KP3 A;  2P6T A;  3DPT A;  4RB0 A;  2ELH A;  2Y75 A;  1ZG5 A;  3LA2 A;  3SZT A;  4P5O A;  2GAU A;  4WF2 A;  2K4B A;  1SD5 A;  2RNJ A;  5EEG A;  2LKP A;  1J75 A;  2P4W A;  3ZQ7 A;  2VC0 A;  3D0S A;  1Z9C A;  2OQG A;  1GHC A;  1IZ1 A;  4M72 A;  4S04 A;  3F8N A;  2D1H A;  2QQA A;  5JI6 A;  3C18 A;  3WE2 A;  1BIA A;  1ZG3 A;  4A0X A;  4BHP A;  3MEX A;  2VC1 A;  5HVQ C;  2F5F A;  4ZYD A;  5L3C A;  2M5W A;  4RB2 C;  3FMR A;  2L54 A;  1IXR C;  4EM2 A;  2LDU A;  2MC3 A;  4RAY A;  4R79 A;  5LEK A;  3J7A O;  1L3L A;  1SAX A;  4S05 A;  4I01 A;  1AOY A;  5H6R A;  3ZP5 A;  3E5U A;  4ESB A;  2BYV E;  4M6Y A;  1C0W A;  3IWZ A;  5L3F A;  1GXQ A;  1MDM A;  2XAF A;  2MD5 A;  3R61 A;  1E17 A;  2A61 A;  2HKX A;  4LLG F;  2UZK A;  1V3F A;  1B59 A;  4A6D A;  3KP7 A;  4NQW A;  4KNY A;  2HZT A;  2O61 A;  2WC2 A;  5HS8 A;  5TRD A;  2PLY A;  2MH9 A;  1KQ0 A;  1IN4 A;  1XGS A;  2ESH A;  1OR7 A;  4N9H A;  5D4S A;  1JE8 A;  3FM5 A;  3COA C;  1UHM A;  2HQR A;  1XCB A;  3LA7 A;  2YPR A;  1T98 A;  2FXA A;  1SD6 A;  1S8N A;  1HXD A;  2WV0 A;  3SHF A;  4HX4 A;  1ZH5 A;  1MJB A;  1KU7 A;  1JGS A;  1BI0 A;  4EM0 B;  4I02 A;  3BPV A;  3LA3 A;  3E6B A;  5D8L B;  3KP5 A;  1O3Q A;  1DDN A;  3KP4 A;  3WTT C;  3O2P E;  5E1W A;  5FFX A;  3ZMU A;  1Z05 A;  5BMZ A;  3PFI A;  1IN8 A;  4XRF A;  4Y15 A;  2DK5 A;  2EFP A;  4KMF A;  5E1X A;  1MD0 A;  3LWF A;  3IWF A;  1RUN A;  3F8B A;  4UVA A;  3LST A;  3ROU A;  1K78 A;  2VBZ A;  3TO9 A;  1H9G A;  1J9I A;  3F8F A;  1H0M A;  2HDC A;  3I59 A;  3ZMZ A;  3K69 A;  3BJO A;  3HSR A;  3C1D A;  4QWQ A;  5ILU A;  4EGZ A;  3I71 A;  4AWX B;  1D5V A;  4KMU X;  3F3X A;  1EH8 A;  3O3K A;  4MNU A;  3H3U A;  2FBH A;  2XAG A;  1U5T C;  2LF8 A;  5BQT A;  2QBY A;  4RGU A;  5TJJ A;  3NQO A;  3R60 A;  5E17 F;  1Y0U A;  1KU9 A;  5E20 A;  3IL2 A;  4FX4 A;  1IXS B;  3TKY A;  2OBP A;  4WK8 F;  2QYO A;  4Q48 A;  2BV6 A;  1OYW A;  2PBI A;  1R1U A;  1Z6T A;  3W6J B;  2VOO A;  1KGS A;  1B9N A;  2PG4 A;  1BBY A;  1BN5 A;  4ETS A;  3I58 A;  2DPD A;  1YW8 A;  1G3S A;  3TDU C;  3G73 A;  1R22 A;  4GYI A;  3ZMS A;  1P92 A;  2FU4 A;  4U0Y A;  4CHU A;  2M1B A;  2IA0 A;  4OIP F;  4ZYG A;  4ENN A;  4D0P A;  1BI3 A;  3OV8 A;  2EJR A;  3DV8 A;  2CSO A;  4HV5 A;  2EFO A;  1YO5 C;  4LK1 F;  1PP7 U;  2NRA C;  5LHG A;  1ZRC A;  2QZ8 A;  5FLX K;  1WQ2 A;  3AAF A;  1O7L A;  1YS7 A;  4KN7 X;  3RI4 A;  1RUO A;  3GZ5 A;  2IA2 A;  2E1N A;  2BBY A;  2LNB A;  5FGM A;  3TDZ C;  5DCF A;  3FX3 A;  2KKO A;  2CQK A;  5KVR A;  4H0E A;  3I0T A;  4MEY F;  2Q8K A;  1IF1 A;  3HRU A;  4HDV A;  2ZJ2 A;  5ICE A;  2H09 A;  2L4M A;  5DD8 A;  4G9Y A;  2DTR A;  2V1D A;  5BPD A;  3ISP A;  4EQQ A;  1KU2 A;  3BPX A;  4ENK A;  2BGC A;  2Y0M A;  1HW5 A;  4WXD A;  1F4K A;  1DP7 P;  2G7U A;  4LB6 B;  3RYR A;  2JTV A;  4U88 A;  3SXY A;  1LEB A;  2YU3 A;  4I2O A;  1O57 A;  4YFN F;  3HSE A;  1LQ1 A;  1KU3 A;  3VB2 A;  1K7A A;  1ZLK A;  4OMY A;  3WE3 A;  2DI3 A;  2EWN A;  3EYY A;  4KDP A;  5FFZ A;  1R7J A;  3FXU A;  3E6M A;  1J0R A;  1QNT A;  3JTG A;  1BJA A;  3RPU A;  1F1Z A;  4ENJ A;  1TLH B;  3MWM A;  1STZ A;  2O3F A;  3HOT A;  1HW2 A;  3IHU A;  2A69 F;  2H6B A;  4RGR A;  5BS6 A;  2P7C B;  4UUV A;  2W24 A;  3D5L A;  2PJP A;  2FMY A;  3ERE D;  1BC7 C;  4L9N A;  2D1V A;  1YS6 A;  2GXB A;  4KIG A;  3HOS A;  3K0L A;  1TBX A;  2MBF A;  2M87 A;  3I54 A;  3WG9 A;  3GFI A;  3F6O A;  2EA2 A;  1HW1 A;  2VN2 A;  1Z1D A;  3V8K A;  1KYW A;  4HX7 A;  3HTS B;  4HQM A;  3C7J A;  1ZLJ A;  4I7H A;  1IRG A;  4G6Q A;  1NHA A;  3MFK A;  5IT9 Z;  3ZMV A;  1PDN C;  3CO7 C;  4UXN A;  4K2E A;  4I0A A;  5ILV A;  3KFW X;  3JW4 A;  2KIF A;  2QLZ A;  3REO A;  5LRR A;  3L00 A;  3DF8 A;  2ZNY A;  2PN6 A;  1SFU A;  3I64 A;  4HV6 A;  3CUQ A;  2DLL A;  2FBI A;  3T5X A;  1WWX A;  5DD4 A;  4PGH A;  3CO6 C;  3FXR A;  3ZMD A;  5L3E A;  4UV8 A;  1P6R A;  3FZV A;  1MKM A;  3WOD F;  3WTU C;  2VON A;  3KET A;  3BWG A;  3RKW A;  3TO7 A;  3K9T A;  5BPI A;  2COM A;  3GYH X;  1P2F A;  3K1P A;  2PQ8 A;  2FNA A;  1HKQ A;  4XBF A;  4BXU A;  5HOO A;  4XLN F;  4P9F A;  5FD6 A;  3R4K A;  1UST A;  3PQK A;  4M9S A;  2MLG A;  4ENM A;  1O3T A;  2ZBK A;  4PDK A;  1LB2 A;  2L4A A;  3F72 A;  1I1S A;  4LMY A;  2Z3Y A;  2FSW A;  3CLO A;  1ODD A;  2M30 A;  1IN5 A;  2VT2 A;  3WGH A;  3HRS A;  4FHT A;  4EJV A;  3FHZ A;  4M73 A;  4WXC A;  1CF7 A;  5E18 F;  2F5C A;  1LDJ A;  2DQL A;  1O7F A;  3MCZ A;  1T38 A;  3HRT A;  4CGZ A;  1TQI A;  4LG0 B;  1OPC A;  2BEO A;  4WWC A;  2XRN A;  4IVN A;  2EB7 A;  4G7O F;  1JHF A;  3DXJ F;  3FWE A;  4EMS A;  4L18 B;  4EM1 A;  4KIB A;  4A5M A;  3KEQ A;  3R0A A;  4AD9 A;  1IRF A;  3C3W A;  2KRF A;  2DO7 A;  2V6C A;  2EK5 A;  2WWY A;  1T0F A;  1SFE A;  5CJ9 A;  2XIG A;  4U0W A;  2ISY A;  2VE9 A;  5LGT A;  4LJZ F;  2JT1 A;  4GCV A;  4HAM A;  2EV0 A;  4JK1 X;  2H94 A;  2A6E F;  1D3Y A;  1R5H A;  3F8M A;  3KLN A;  1SMT A;  5CVI A;  4LGW A;  4U7D A;  3GEZ A;  4A2U A;  1SD7 A;  3V7C A;  1TW2 A;  4G7H F;  5ERI A;  4M9X A;  3WTX C;  3BOQ A;  5FD5 A;  1XD7 A;  1IW7 F;  4IRG A;  3JSO A;  3P9I A;  2HS5 A;  4HF0 A;  2K02 A;  2QM3 A;  1QGP A;  1BIB A;  1KA8 A;  1K78 B;  2P5V A;  5E8G A;  2R7F A;  1REP C;  2LF7 A;  2H27 A;  1ONV A;  2O8X A;  3WTW C;  2OQR A;  1FBU A;  5DEQ A;  1ZRD A;  2ZFW A;  3H3Z A;  3I5U A;  1KQ9 A;  5JHU A;  2HYF A;  3HYI A;  5FB2 A;  2BE5 F;  2M8E A;  5JR3 A;  5LHH A;  4MEX F;  2HOE A;  1IXC A;  3CUQ C;  3TOB A;  2HTJ A;  3ZPL A;  2GIV A;  1YW9 A;  5L3G A;  4Q47 A;  2P7V B;  1CGP A;  1FP2 A;  4HF1 A;  3JAM K;  3QPT A;  4RGX A;  1I1G A;  3RTR A;  1YIO A;  3R0J A;  5HDG A;  4CDG A;  2F5D A;  1DPR A;  5D5X B;  4ASN A;  1GVJ A;  5J6X A;  2IRF G;  5LHI A;  3RDI A;  1V4R A;  1Z7U A;  2Z99 A;  3GLX A;  4ZH4 F;  2IJL A;  3RYP A;  3TO6 A;  1D8K A;  5HDN A;  3FMQ A;  1FYM A;  1O3S A;  4A5N A;  4L0Y B;  2MLK A;  2OAZ A;  4HDU A;  4I98 B;  3DFG A;  1U3E M;  2FA5 A;  1Q1H A;  5DUK A;  1HQC A;  1QZZ A;  3VFZ A;  3WGG A;  4LG0 A;  3CDH A;  3IKV A;  2G9W A;  2F2E A;  5DV5 A;  3V7S A;  2DT5 A;  2E7W A;  4QLC U;  2FNP A;  1DPU A;  4GXO A;  4GYG A;  3HSF A;  5BOX A;  2CG4 A;  1YG2 A;  5K5O A;  2JSC A;  3BRO A;  5KK1 A;  4GGG A;  1U5T A;  3R6S A;  4EGY A;  2XGX A;  1BC8 C;  1R1V A;  2HFH A;  4KIF A;  4EJO A;  1HKS A;  1FNN A;  4HLX A;  1YFH A;  1P4A A;  1HST A;  1I27 A;  2VXZ A;  4ESJ A;  1SD4 A;  3BJA A;  4BH9 A;  2K27 A;  1FOK A;  2IVM A;  2FML A;  1IN7 A;  1J59 A;  2XAJ A;  3EYI A;  2OD5 A;  4YFK F;  2GZW A;  4BHC A;  3QPH A;  2Q0O A;  2TDX A;  5EEH A;  2OA4 A;  1OYY A;  4Q4Z F;  1OMI A;  2EV5 A;  4OMZ A;  1QBJ A;  1XMK A;  1EH7 A;  2A6H F;  4RAZ A;  3GXO A;  4L5J A;  2RVC A;  5D4R A;  2AXL A;  2DBB A;  2YX7 A;  2JRT A;  4P96 A;  3CJN A;  2R7D A;  1AWC A;  2DU9 A;  2DK8 A;  1LDD A;  2PI0 A;  4EV0 A;  4AIJ A;  3KP6 A;  1U2W A;  1YYV A;  2DQR A;  1ZGA A;  3V4G A;  2DW4 A;  4OOI A;  2XV4 S;  3IC7 A;  4NHJ A;  2VBX A;  1TNT A;  2YX4 A;  3E3V A;  1G3W A;  2QEN A;  3GZ6 A;  4G6D A;  3TQN A;  4N9I A;  1D8J A;  4OIR F;  3L2C A;  1Z6R A;  2X4H A;  2VBW A;  2FEZ A;  4AIK A;  2A3S A;  1R36 A;  5JVT A;  2VBY A;  1U6G A;  5CVJ A;  1O3R A;  3EET A;  1R1T A;  1IAW A;  1R00 A;  4YG2 F;  2Z9O A;  4CXF A;  4HX8 A;  3VEP A;  3JSP A;  1B6A A;  2QWW A;  1QQI A;  2V1X A;  2IT0 A;  3NRV A;  1MJA A;  3DP7 A;  1FBS A;  3BP8 A;  2A68 F;  3RJP A;  3JAM Z;  2RGV A;  2E1C A;  1RZ4 A;  4MQV A;  2NS0 A;  4KT5 C;  3K2Z A;  3FXQ A;  3LQR A;  4KIC A;  1R58 A;  1QO0 D;  4G8X A;  3KCC A;  3F23 A;  3BY6 A;  4E70 A;  4MGR A;  4MTD A;  4N0B A;  3VOD A;  2B0L A;  2CO5 A;  1BOA A;  2NNN A;  2W57 A;  3BDD A;  4BQA A;  2K7L A;  3WTV C;  3MAJ A;  3FM3 A;  5CYV A;  2NNY A;  1FYK A;  1FP1 D;  5K5Q A;  4CO8 A;  4YII A;  4KN4 X;  1L0O C;  3TOA A;  2R3S A;  3GUD A;  5ICC A;  4O3M A;  1TNS A;  3GWZ A;  4ZYE A;  3V8L A;  4WX9 A;  4RB3 C;  3V7R A;  2P5L C;  3E5Q A;  3Q5F A;  3B02 A;  3GFJ A;  3F22 A;  3WTS C;  4L5I A;  4IHS A;  3DQV C;  3M9A A;  2UWM A;  4O5V A;  3QU6 A;  4A0Y A;  4IRH A;  4TV7 A;  6PAX A;  5E8I A;  3KP2 A;  1YTY A;  5J8C A;  4M71 A;  2W85 A;  2HTS A;  4HOB A;  1W5S A;  2V79 A;  4IHT A;  3QOP A;  4O6J A;  2L01 A;  4A12 A;  2KIM A;  2CWE A;  3HTU A;  3DKW A;  4JBA A;  4UVC A;  3LQQ A;  4HF2 A;  5E1Z B;  2XRO A;  2UXX A;  4Y13 A;  4EJU A;  3CUO A;  2D45 A;  1B9M A;  4DNC A;  3RIR A;  3N4M A;  5DDG A;  4BHB A;  4OU0 A;  5AON A;  1PUE E;  5JFR A;  4M9Z A;  4BAY A;  4ESF A;  3T0Y A;  2KJC A;  1K79 A;  4IF4 A;  3Q9V A;  1OYI A;  5F1R A;  1G3Y A;  1OKR A;  2WTE A;  1BI2 A;  1Z91 A;  5HS9 A;  1MJ9 A;  5LGU A;  4ZYH A;  2X0L A;  2Z5U A;  5HLH A;  4UVB A;  3GFL A;  1QPM A;  1F9N A;  5F6F A;  2F5E A;  1P4W A;  1KYZ A;  2P5K A;  1HSJ A;  2L02 A;  4R1H A;  3ZMT A;  1G4D A;  1UB9 A;  5DCM A;  1W7P B;  3ULQ B;  2A5Y B;  5L3B A;  1XMA A;  1ZN2 A;  3VOE A;  1FT9 A;  1JXS A;  1FPQ A;  1PP8 F;  3IRQ A;  4CYD A;  1ZAO A;  4RS8 A;  2UXN A;  3FMS A;  1IUY A;  1WSU A;  1U8R A;  5D6E A;  3SQN A;  2FBK A;  5CLS A;  4OIN F;  4PCQ A;  1MDM B;  3KE2 A;  2NYX A;  1S7A A;  3KLO A;  2QBY B;  3K1M A;  2HQN A;  4KA4 A;  3ECO A;  3GW2 A;  2JPB A;  2LSO A;  4B09 A;  1XN7 A;  2A07 F;  4HLY A;  4IPA A;  4XSZ F;  2XKO A;  3V8J A;  3MZH A;  2AS5 F;  1G3T A;  1I5Z A;  4CZZ A;  1FC3 A;  4UHT A;  3DEU A;  2V1U A;  5IT9 K;  4BNC A;  3HUG A;  2NAZ A;  4A6E A;  2HEO A;  3TGN A;  4G94 A;  1ZG1 A;  1FBQ A;  3QRF F;  2HR3 A;  5DUI A;  3ZN1 A;  5LEJ A;  4G7Z F;  3WTZ A;  5LLQ A;  4LFU A;  3M1E A;  4Y17 A;  5D6F A;  3S2W A;  2ZO4 A;  1BM9 A;  5K1Y A;  1UCR A;  1R23 A;  2K86 A;  2V9V A;  3J81 K;  4YFX F;  2OU2 A;  4HYE A;  4I09 A;  4M74 A;  2RKH A;  4NB5 A;  5ED4 A;  3ECH A;  2XAH A;  2QQ9 A;  2IA1 A;  2VT3 A;  5IT3 A;  3O6B B;  2KJB A;  1ZGJ A;  2VOD A;  5ICG A;  1RIO H;  1XDS A;  2CFX A;  3P7N A;  4P9U A;  4P55 A;  4HQE A;  1XDU A;  1FX7 A;  4M6X A;  1RNL A;  2L3D A;  2VE8 A;  5DCM B;  4XLP F;  4RB1 A;  2QUF A;  3I53 A;  2FRH A;  3P9K A;  1W5T A;  3U9G A;  2YSR A;  4BYY A;  1WKM A;  4F7Z A;  2JZY A;  2PEX A;  3M7G A;  1ULY A;  1ZRF A;  3GVA A;  2FF4 A;  5ILS A;  4Z2Y A;  4JQF A;  2RDP A;  2STW A;  3F8C A;  2HKO A;  1J5Y A;  2ZNZ A;  4XSX F;  3GFM A;  2DFI A;  3M8E A;  1R5G A;  4ON0 A;  1FLI A;  5J8F A;  1T39 A;  3KZZ A;  1S7O A;  3FF5 A;  2FE3 A;  1USS A;  2H6C A;  2XAQ A;  4WXH A;  1SFX A;  2Y48 A;  5HLG A;  2ACJ A;  3WU1 B;  3IKT A;  2ZME A;  5D8K B;  2RQP A;  3HRM A;  3HIF A;  5HS7 A;  1XGO A;  1B1B A;  1ZHF A;  3SZP A;  3BJ6 A;  1U5T B;  1FSH A;  2RN7 A;  1S29 A;  3B73 A;  1FYL A;  1XB4 A;  2DAO A;  2Q2E A;  2QVO A;  1K6O A;  5FLX Z;  3RKX A;  5L3D A;  4UV9 A;  1E2X A;  2HWV A;  5LRS A;  1EH6 A;  4IXA A;  3J80 K;  4U7B A;  2Z33 A;  4LLL A;  4KYW A;  1UHW A;  1MZB A;  2EV6 A;  1ON1 A;  1GXP A;  4AVP A;  3K1N A;  3QU3 A;  1QZY A;  3E6C C;  2P8T A;  3QAH A;  1IN6 A;  3EDP A;  1G6N A;  4L9J A;  2QQB A;  3ABT A;  5DYM A;  3ABU A;  1W7P D;  4EJT A;  2W25 A;  3G3Z A;  4EJW A;  2CYY A;  1J7K A;  2PMU A;  4CIC A;  3IRR A;  4RGS A;  3BZ6 A;  5FO5 A;  4EVI A;  5AIP A;  4IJA A;  1YQA A;  2M45 A;  1W7P A;  2ETH A;  2DPU A;  3QP5 A;  2J5P A;  1W4M A;  4L9T A;  1LJ9 A;  5D5V B;  1JHH A;  4A0Z A;  3T8R A;  2EFQ A;  2ADU A;  2D2W A;  3Q9S A;  2K4J A;  4ZZL A;  1VTN C;  2E7X A;  3U1D A;  3H92 A;  5ICF A;  1J2X A;  2C6Y A;  2O0Y A;  4R8H A;  3NEU A;  5CVU A;  4OIO F;  3ML6 A;  2IP2 A;  3J80 Z;  4HA8 A;  3J81 Z;  2YR2 A;  1XCV A;  3GX4 X;  1WI9 A;  2RC4 A;  2OZ6 A;  1LDK B;  2W84 A;  3GF2 A;  2XUB A;  3T8T A;  3EUH A;  3GO5 A;  3RKY A;  3LAP A;  1S3J A;  3E97 A;  2J5O A;  2EFW A;  3QP6 A;  1XSV A;  4KUM A;  2EA4 A;  3LAJ A;  3RPQ A;  5H6Q A;  1FZP B;  1MGT A;  1TTY A;  2IW5 A;  3W6K B;  4FX0 A;  4PZJ A;  5A2Q K;  3L7W A;  4ZZD A;  2FQ3 A;  1LEA A;  3P9C A;  1FY7 A;  4AIH A;  2FOK A;  2JPC A;  2ZXJ A;  2G7H A;  3I4P A;  2PFB A;  1HKT A;  2VOP A;  4LD5 A;  5CVV A;  1LVA A;  4I0B A;  3L09 A;  3U2R A;  2P6S A;  1DUX C;  3F6V A;  3WTY C;  1YLF A;  4YIF A;  4HBL A;  1X3U A;  1A04 A;  3JTH A;  4Q5S F;  2PMH A;  2MA3 A;  2CW0 F;  2XVC A;  4MQ9 F;  4B8X A;  3N97 A;  1FWZ A;  1TQM A;  4HZF A;  3KEO A;  1ZAR A;  2XKP A;  3MQ0 A;  3OOP A;  3CUQ B;  1LNW A;  2XHK A;  4LLN A;  1XSX A;  4U0V A;  3EQL F;  1S6L A;  4UNO A;  3T1B A;  5LGN A;  4DQ2 A;  3WGI A;  1TW3 A;  2GA1 A;  5D5U B;  3I59 B;  2GQQ A;  2RV8 A;  1UFM A;  2KIU A;  2XAS A;  3WU0 A;  2O6G E;  3SFZ A;  4OIQ F;  2ZCW A;  3L9F A;  2ZKZ A;  5A2Q Z;  3LFK A;  2HGC A;  3ELK A;  3HHG A;  1U78 A;  5LBQ A;  3M8F A;  5H20 A;  4L0Z B;  1ON2 A;  1B4A A;  1P4X A;  3MZY A;  1SMY F;  2MH2 A;  4FT8 A;  1BI1 A;  1CF7 B;  3E5X A;  3PQJ A;  1ZRE A;  2ZME B;  1YW7 A;  1HBX G;  2GXG A;  5HDK A;  2HYG D;  1F5T A;  2GWR A;  1RI7 A;  3HHH A;  2O03 A;  3F21 A;  4GO1 A;  2ISZ A;  4LK0 F;  2CGP A;  2IPQ X;  3DPL C;  4L9V A;  1XSD A;  5HLI A;  3KZY A;  1WRJ A;  4MHG A;  2OZU A;  1T2K A;  1H9T A;  4IRI A;  4PGG A;  4WCG A;  2GA2 A;  1FSE A;  1KQ8 A;  1TQP A;  1ZYR F;  5K5R A;  2STT A;  3CTA A;  4HW0 A;  5D5W B;  5AIQ A;  1XGM A;  2ESN A;  5F64 A;  3ZN0 A;  4KFC A;  5CVR A;  3E6D A;  1EV7 A;  1T6S A;  1I6X A;  2EFN A;  4MTE A;  1XGN A;  4LB5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...