2M30A

Solution nmr refinement of a metal ion bound protein using quantum mechanical/molecular mechanical and molecular dynamics methods
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
95
structure length
95
Chain Sequence
NTDTLERVTEIFKALGDYNRIRIMELLSVSEASVGHISHQLNLSQSNVSHQLKLLKSVHLVKAKRQGQSMIYSLDDIHVATMLKQAIHHANHPKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR refinement of a metal ion bound protein using metal ion inclusive restrained molecular dynamics methods.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription repressor
molecule keywords Repressor protein
total genus 26
structure length 95
sequence length 95
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01022 HTH_5 Bacterial regulatory protein, arsR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2m30A00
4AVPA 4O5VA 1FYLA 1T0FA 4G7HF 2P7CB 3IKVA 3W6KB 3I53A 1WWXA 4CYDA 1Z91A 5ILUA 5IT9Z 1L3LA 3RYRA 5D6EA 5D8LB 2OQRA 4HX8A 3WTVC 2XAFA 5D6FA 4Y13A 4FHTA 1OYYA 1OPCA 2HQRA 4KA4A 2Y0MA 1QBJA 4UVBA 3V7SA 1YTYA 3QPTA 5HS7A 3QOPA 2NRAC 4JBAA 2FE3A 5CJ9A 1JGSA 5DUKA 4DQ2A 2KJBA 3GO5A 4MQ9F 2A6HF 2FA5A 4OIRF 3GW2A 1ZG5A 4P55A 5BMZA 2XVCA 1TQIA 3HRMA 2FSWA 1ULYA 2W24A 1Z9CA 1T6SA 4R79A 3K1MA 2KKOA 5CVIA 3TGNA 4ENNA 2VT2A 5AONA 2STWA 1ZHFA 1ZAOA 4QWQA 2L4MA 4HYEA 1ZG3A 3CO7C 3FHZA 1FBUA 4HV6A 1SAXA 3HOSA 3E5XA 2HFHA 4NHJA 1YW7A 2X0LA 3KP5A 3D0SA 1LB2A 4MTEA 3LAJA 2ZNYA 2IT0A 5LGUA 4HF2A 1Z6RA 2FBIA 4HBLA 5BQTA 2HWVA 5DEQA 1OR7A 3ZPLA 3HYIA 5D4RA 2BYVE 5HVQC 2X4HA 3L00A 3K0LA 2GWRA 2VBZA 2CFXA 2H27A 3MZYA 3KP6A 3RKXA 1ZGJA 3VEPA 1LNWA 5E1ZB 4WCGA 3ZMUA 1XGOA 4Q47A 3FMQA 5F6FA 1TNSA 4QLCU 3ECOA 4PDKA 2FMYA 4HF0A 1R58A 4CDGA 4U88A 1QZYA 5ILSA 1KYWA 1HSJA 3FXUA 3F8FA 2F2EA 4A5NA 4M9ZA 4EJWA 2FF4A 1YS6A 3BP8A 3H3ZA 2M1BA 1KGSA 4IRGA 2W85A 1WKMA 4WWCA 1MD0A 1R00A 1ZH5A 2F5DA 1J7KA 4EM2A 4HQEA 1O3RA 3JSPA 2H6CA 2A61A 2NYXA 1OMIA 2V9VA 4G94A 4UUVA 4XLPF 4JK1X 3E6DA 2QENA 3TO6A 4AIJA 1D8JA 4AIKA 3QU6A 3QP5A 5ICCA 1F1ZA 1T38A 1J59A 3J7AO 2EV5A 1G3SA 4NQWA 1IUYA 3ZN1A 1HW2A 2ESNA 1TLHB 1K79A 1O57A 1RIOH 3IL2A 3REOA 3ZMSA 3IKTA 2YX7A 4ZYHA 5ICEA 1BC7C 1WSUA 4MEXF 2Z3YA 3LAPA 5ILVA 3KP2A 4L18B 3CLOA 5D8KB 3V4GA 2MH2A 2OZUA 2IA2A 3WG9A 2DLLA 5HLHA 2MH9A 1TNTA 2QQ9A 2XGXA 2KRFA 1TTYA 4I2OA 1IN5A 2MBFA 2EFOA 2XAHA 3Q5FA 1IAWA 2DFIA 4ZH4F 4BNCA 4BQAA 1P4XA 3K2ZA 4PCQA 4YG2F 1FT9A 3HSFA 3KZYA 2HS5A 4I0AA 5EEHA 1W7PD 5LGNA 3DQVC 3U1DA 3J80K 4CO8A 5LLQA 1H9GA 3KCCA 3DF8A 5K5OA 4L0ZB 2ETHA 4M9XA 5AIQA 2EB7A 4OIPF 2DW4A 4WK8F 2XAGA 4LG0A 1P6RA 2O61A 5LGTA 2R3SA 4HW0A 3U9GA 5L3BA 2M45A 4HDUA 1IRFA 4BHPA 1UB9A 4ETSA 5D4SA 4KIGA 5DD4A 1OYWA 1YS7A 1R5GA 3IHUA 2K7LA 4UXNA 2CO5A 4LK1F 3I4PA 1STZA 2HTSA 2XIGA 2E1CA 3PQKA 2M5WA 2ZMEA 3PQJA 4AIHA 1DUXC 4PZJA 2VE9A 3IWZA 5FO5A 2VONA 3ZN0A 5J6XA 2IJLA 2GA2A 3M9AA 1F5TA 3JSOA 1QPMA 3ML6A 2RN7A 1W7PA 3ZQ7A 2RQPA 1USTA 1ONVA 1WI9A 3EQLF 3Q9VA 2H09A 3ZMZA 3WTZA 1RZ4A 1I5ZA 3TO7A 2VN2A 4BH9A 2W57A 3N97A 1CF7A 3HUGA 2DPUA 1KU7A 2ISYA 5JHUA 1WRJA 1XGNA 1KQ8A 2P5KA 2L4AA 4U7BA 1SFEA 1U5TA 1YLFA 1P2FA 2LDUA 1ZN2A 3LA7A 3SZTA 2J5PA 2DU9A 3COAC 3V7CA 2PI0A 4BXUA 1GXPA 3BJOA 2PQ8A 2Z5UA 2W25A 4L9VA 1ZG1A 2JPCA 1ZRFA 5JI6A 5K5QA 3DXJF 4LB5A 4A6EA 1HSTA 5D5WB 4HLXA 3C7JA 4KIBA 2H94A 4R8HA 4YFKF 3RKWA 3IRQA 5E18F 5CYVA 3N4MA 1YG2A 3WGIA 2VXZA 3SFZA 1REPC 2WV0A 4RB3C 3SZPA 2Q8KA 3DP7A 1S29A 3KE2A 3F8NA 4G7ZF 4TV7A 4MQVA 4WF2A 1KA8A 1HKTA 1MJAA 2MC3A 5J8FA 2XAQA 5E1WA 5A2QK 2HZTA 4OIOF 2O3FA 4IRIA 3R0JA 1J2XA 1R22A 3M8FA 5LHIA 5CVJA 5F1RA 4LK0F 5L3EA 3FF5A 5TRDA 1X3UA 2DO7A 1QQIA 3P9CA 2V6CA 2WTEA 3ULQB 3J81K 4FT8A 5E17F 4ESJA 2Y75A 3J80Z 1YYVA 4M6YA 2V1DA 2P6TA 3KZZA 4YIIA 4G9YA 1GVJA 1Z6TA 1FZPB 3K9TA 3F8CA 2NNNA 2G7UA 2GQQA 4MHGA 2GA1A 2CSOA 4I09A 2XAJA 3WTUC 3QPHA 3F8MA 2YPRA 5E20A 1ZGAA 4UVAA 1U3EM 5CVRA 3RI4A 4ENKA 3HSRA 3JAMZ 2D1HA 1IN7A 1PUEE 3GWZA 2HOEA 2QWWA 2K86A 3TQNA 3GVAA 5E1XA 3F22A 1USSA 4D0PA 2ISZA 2OAZA 4HLYA 1BIAA 1DPRA 1BC8C 2HKXA 4K2EA 2BBYA 1EV7A 1KQ9A 3EUHA 3LSTA 4KIFA 4N0BA 3BJAA 4B8XA 2HEOA 4I98B 2A6EF 3CDHA 2ZCWA 3C1DA 5LEJA 3P9IA 2PMHA 1FYMA 3WU1B 3MWMA 4RGUA 1Q1HA 2Y48A 5J8CA 1FSHA 2JSCA 1XSVA 3NQOA 4R1HA 1XGSA 2VBYA 3P7NA 3ZMVA 3F23A 2CW0F 2EA4A 5LHHA 1F9NA 2UWMA 2MLGA 2R7FA 1H9TA 3DKWA 4EJVA 1G6NA 3GF2A 2ZMEB 5EEGA 1BOAA 5ERIA 1ZRCA 2JRTA 4IVNA 5D5UB 3JW4A 1JHFA 2MA3A 5CVUA 1J0RA 2ZKZA 2QLZA 2OBPA 2EFPA 4LJZF 3V8KA 3RIRA 4RB0A 2FBHA 3I5UA 1XMKA 1XB4A 4B09A 2RGVA 1U5TC 5HDGA 2D1VA 3KP3A 1HBXG 4LLNA 5DYMA 4JQFA 1PP7U 2NS0A 1TW3A 5FB2A 2VT3A 1O7LA 1FX7A 2M8EA 4Z2YA 1JHHA 3I59A 4P9FA 1R36A 2QBYB 3WTTC 1W4MA 3WGGA 4UVCA 2E7XA 3MEXA 3L09A 4RGSA 3I54A 5DCMB 3F3XA 1LQ1A 2AS5F 4ESBA 3T0YA 5BOXA 3GFMA 2FEZA 2GXBA 4N9HA 1S7AA 2IW5A 3CUQB 2VOPA 4GXOA 4AD9A 5L3GA 2QZ8A 1FPQA 2E1NA 3ABTA 2UZKA 2JPBA 4HF1A 2XUBA 4KICA 1U8RA 1IW7F 4Q5SF 1U2WA 5HS8A 1P4WA 4I01A 4NB5A 3R60A 1MGTA 2CG4A 1HW1A 3ECHA 4WXDA 2VC0A 4M74A 1KU3A 4A5MA 3BY6A 1SMTA 3QRFF 1IXRC 1P92A 1B4AA 1S8NA 4I0BA 2UXNA 2ZNZA 3KETA 3WGHA 4EQQA 2NNYA 1YW9A 2IA0A 3V8JA 5HDKA 3KLOA 3K1PA 4EVIA 2DK5A 1B6AA 3WTYC 1S6LA 3ZP5A 3E5QA 1T2KA 2P6SA 5BS6A 1YO5C 1F4KA 1XSXA 1IXCA 5LBQA 5LRSA 4RAZA 1T98A 2K27A 5BPIA 3O6BB 1K6OA 3D5LA 2V79A 2XKOA 5E8IA 2HDCA 1SD5A 4ON0A 1HW5A 2EA2A 2BGCA 1D5VA 1YQAA 4M6XA 2IA1A 3R0AA 1KU9A 2XKPA 2KIUA 4XSZF 2BV6A 2QVOA 2O6GE 3E6MA 4KUMA 1HKQA 4YFNF 2FQ3A 2XASA 4HDVA 1SD4A 1RUOA 3W6JB 2STTA 1BM9A 3T8RA 3TDZC 3ERED 3MAJA 1IRGA 1BI0A 1H0MA 3IC7A 3QU3A 2V1XA 4L9TA 4LB6B 1K78B 4LG0B 4M72A 2FOKA 4M73A 1MZBA 5HS9A 3VODA 3FX3A 3RPUA 4MTDA 1Y0UA 3GEZA 3KEQA 4G6QA 4ESFA 1QO0D 1U6GA 3VFZA 2L02A 1I6XA 3LA2A 3E6BA 3L7WA 2CWEA 1T39A 4M71A 2O0YA 2J5OA 2IVMA 1R1VA 3F6OA 2L54A 5ED4A 5LHGA 2EFQA 5FD6A 3BROA 4LFUA 2LNBA 4U0VA 4WXHA 2MLKA 3FXQA 3NRVA 4RGRA 3GYHX 3MFKA 1LDJA 4U0YA 2F5EA 4A0YA 1U78A 3H3UA 5HLGA 3KLNA 1Z1DA 5CLSA 3ISPA 4LLLA 2ADUA 1IN6A 3HTUA 3RDIA 3GLXA 2CYYA 4G6DA 1CF7B 2D2WA 2W84A 4BHBA 4OIQF 4ZZDA 2IPQX 1SD6A 4YIFA 3F72A 1HQCA 2ESHA 3M8EA 1SMYF 3T1BA 5KK1A 2CGPA 4GO1A 1XN7A 2COMA 3BDDA 4AWXB 3SQNA 3JTGA 1V3FA 1IN8A 2RNJA 1LVAA 4L9NA 2GZWA 3JTHA 3E5UA 1BJAA 2VODA 2P4WA 1BI2A 4KFCA 1A04A 2P8TA 3SXYA 2Z33A 2RVCA 2PFBA 4HA8A 4ZYGA 3MQ0A 4A0ZA 4S04A 3F6VA 3KP4A 4RB1A 2EJRA 4GYIA 4MNUA 4S05A 3L2CA 1SFXA 3TO9A 1CGPA 4IPAA 2CQKA 3FWEA 3R61A 1LDKB 2HQNA 1BBYA 3VB2A 4KT5C 2A69F 1FSEA 3ZMDA 5L3DA 2XV4S 3FMSA 2E7WA 2QQAA 2EV6A 4L5IA 2RC4A 2RDPA 1RUNA 4KMFA 1TQPA 4N9IA 2B0LA 1QZZA 4HX4A 3BWGA 1Z05A 5KVRA 2QQBA 1I1SA 2WC2A 3DPTA 4HAMA 1FWZA 2MD5A 5DV5A 4OINF 3QAHA 4L5JA 2PG4A 2ELHA 1BIBA 1MKMA 2PMUA 5HLIA 2A3SA 3K69A 1BI3A 2P7VB 1RI7A 2IP2A 3H92A 4KYWA 4FX4A 3EDPA 2PEXA 2O8XA 3ZMTA 4ZYDA 4EJOA 1UCRA 2HR3A 1ZRDA 5FD5A 4ZZLA 4MGRA 1JXSA 4Y15A 1XDSA 1FYKA 3I64A 4CHUA 3ELKA 3S2WA 2A68F 4CZZA 4XSXF 2G7HA 3WTSC 5DD8A 4A0XA 4BAYA 1S3JA 5HDNA 2DK8A 2JZYA 3WE3A 1XD7A 4KN7X 1JE8A 3VOEA 4EM1A 4Q4ZF 1LDDA 1SD7A 1DP7P 5FLXZ 3L9FA 2F5CA 4P96A 1EH8A 2EFNA 2FU4A 1OKRA 3O2PE 2OD5A 5DCFA 1SFUA 4UHTA 3V7RA 1ON1A 3WTWC 2XRNA 2YSRA 2PN6A 2C6YA 3HHGA 1R1TA 3RJPA 1P4AA 3EYIA 5AIPA 3OOPA 3LWFA 4U0WA 4WXCA 5JVTA 1C0WA 3GFJA 1G3TA 3RYPA 1D3YA 1FBQA 2GAUA 1MDMB 2ACJA 2YR2A 2DBBA 1GHCA 5K1YA 2DTRA 1IN4A 3HIFA 4GCVA 1K78A 1D8KA 2LF7A 3GX4X 2H6BA 4IHSA 4P9UA 5CVVA 4WX9A 3G73A 4CXFA 1FLIA 3F21A 1TBXA 2VBWA 4IHTA 3CUOA 4U7DA 3J81Z 1KQ0A 1WQ2A 3FM5A 2KJCA 3B02A 2PBIA 2GXGA 2WWYA 1V4RA 1LEBA 1G3YA 2VE8A 1J9IA 4RS8A 3WODF 4EJUA 3NEUA 1E17A 3I59B 2K02A 5BPDA 4HQMA 1LEAA 3HHHA 1B9NA 3KP7A 3SHFA 1J5YA 5K5RA 4UV8A 4ENMA 3U2RA 1DPUA 1O3TA 3P9KA 3LQQA 2P5VA 3BOQA 1FP1D 2G9WA 4KN4X 3V8LA 5D5XB 4MEYF 2FMLA 2FBKA 2A5YB 3ABUA 1OYIA 2FNPA 2VBXA 3CUQC 3RPQA 3HRUA 3BZ6A 4EJTA 3MZHA 3QP6A 4CICA 3PFIA 4GYGA 2GIVA 4LLGF 1E2XA 1IXSB 4RGXA 5H6RA 2HYFA 3LFKA 3WTXC 3EYYA 4BHCA 1YFHA 2RKHA 1XCBA 4OU0A 4XRFA 1FY7A 4G8XA 3OV8A 2QUFA 2VOOA 3IWFA 1YIOA 3BPXA 1HXDA 1ZREA 4HOBA 3M1EA 1W5SA 3T5XA 3DFGA 2PLYA 2QBYA 5IT9K 1QGPA 2LKPA 5ICGA 4PGHA 1MJBA 3DV8A 5DCMA 4CGZA 4OMYA 1PDNC 3I0TA 1ZARA 1LJ9A 1TW2A 3HRTA 2DI3A 2ZBKA 3GFLA 4IJAA 3JAMK 3CUQA 2F5FA 3BPVA 6PAXA 3RKYA 2HKOA 4IXAA 2YX4A 4UV9A 1O7FA 1I1GA 1KYZA 2YU3A 2PJPA 1ON2A 4HZFA 1KU2A 2FRHA 1R1UA 3O3KA 5LRRA 3WE2A 3E3VA 2LF8A 5H20A 2BE5F 3HTSB 2OA4A 1FBSA 1R7JA 4A2UA 3TKYA 2EFWA 1O3SA 4H0EA 2P5LC 3KFWX 2ZJ2A 3IRRA 4Y17A 2L01A 4LMYA 5IT3A 4P5OA 3KEOA 1J75A 4M9SA 4I02A 1MDMA 4EM0B 5FLXK 2RV8A 4L0YB 2ZXJA 3I58A 4O6JA 1ODDA 1IZ1A 3RTRA 2FXAA 1ZLKA 2OQGA 2KIFA 3EETA 4RB2C 1GXQA 5LEKA 2BEOA 1RNLA 3MCZA 3GUDA 5L3FA 4KDPA 4IRHA 3WU0A 1UFMA 1FC3A 1FNNA 4HV5A 4PGGA 5FFZA 1U5TB 1ZYRF 2M87A 4LGWA 4FX0A 3C18A 4L9JA 3FXRA 1G4DA 1BN5A 1S7OA 1G3WA 1YW8A 4IF4A 1B9MA 2DQLA 2XHKA 4EGYA 1BI1A 3E97A 3HRSA 5F64A 4OMZA 5L3CA 4ASNA 3TOAA 4DNCA 5E8GA 5HOOA 1I27A 4KNYA 1W7PB 3F8BA 1IF1A 4A6DA 2DPDA 1K7AA 3K1NA 2JT1A 3GZ6A 2UXXA 5FGMA 3E6CC 1EH7A 3TDUC 2IRFG 4RAYA 1O3QA 1B1BA 2HTJA 2Z99A 2NAZA 1ZLJA 3R6SA 3TOBA 1XDUA 5H6QA 3G3ZA 1EH6A 2KIMA 2VC1A 4Q48A 3M7GA 4ENJA 5DDGA 1XSDA 4EV0A 3B73A 2L3DA 2A07F 1TQMA 2M30A 3Q9SA 2K4BA 2R7DA 3R4KA 5JR3A 2DQRA 2EV0A 2EWNA 1XGMA 4YFXF 4E70A 4OOIA 4O3MA 1UHWA 1AOYA 2HYGD 1XMAA 3T8TA 3LA3A 3LQRA 4EMSA 1MJ9A 3C3WA 3FM3A 2V1UA 3GXOA 3HSEA 1PP8F 3AAFA 2QM3A 4XLNF 1UHMA 1W5TA 2JTVA 2LSOA 1R23A 1R5HA 2XROA 1NHAA 1QNTA 3DPLC 4G7OF 5DUIA 1XCVA 4XBFA 2Q2EA 2Z9OA 3HOTA 2EK5A 2Q0OA 3CJNA 4GGGA 3GZ5A 2ZFWA 3FMRA 1Z7UA 2TDXA 4BYYA 2OZ6A 1DDNA 2AXLA 4KMUX 3BJ6A 4LD5A 4ZYEA 2K4JA 2O03A 1FOKA 5JFRA 4EGZA 5A2QZ 4I7HA 3GFIA 1B59A 3CO6C 4HX7A 5FFXA 2HGCA 2DT5A 1L0OC 4A12A 5TJJA 2D45A 3DEUA 1FP2A 2OU2A 5D5VB 2QYOA 4UNOA 3I71A 2DAOA 3CTAA 2ZO4A 2FNAA 3ROUA 4F7ZA 1VTNC 5ICFA 1AWCA 1HKSA 3FZVA
chains in the Genus database with same CATH superfamily
2LKSA 1BW5A 5GPCA 2MABA 2CU7A 4AVPA 3HUGB 2L7MP 4RDUA 4O5VA 4EATA 1FYLA 1T0FA 4G7HF 2P7CB 3IKVA 3W6KB 3I53A 5LD2C 1WWXA 4A3DJ 4CYDA 2BY2A 1Z91A 1WJBA 3CP8A 5ILUA 5IT9Z 3G4SI 1L3LA 2XDVA 2R4GA 1QVUA 5J4VA 3GLLA 3IAS2 3S93A 4JX6A 1WJCA 3RYRA 5D6EA 4AUXA 2QCOA 5D8LB 2OQRA 4HX8A 3WTVC 1JT6A 2XAFA 5D6FA 2P81A 4Y13A 2DXIA 5JLXA 4FHTA 4HNVA 1ETQA 1OYYA 3G1MA 1F43A 1OPCA 2HQRA 4XN0A 4A3CJ 4KA4A 2Y0MA 1QBJA 4UVBA 3V7SA 3HKZN 5BNGA 1YTYA 4BU2A 3QPTA 5HLTA 4PUSA 5HS7A 3QOPA 2NRAC 4JBAA 2FE3A 4V2GA 5CJ9A 1JGSA 5DUKA 4DQ2A 2KJBA 3GO5A 3CC2I 3K4CA 4GDFA 4ZTFA 1VQKI 4MQ9F 2A6HF 2FA5A 4OIRF 3GW2A 4XK4A 1MIJA 1ZG5A 4P55A 1TWHJ 5BMZA 2XVCA 1TQIA 3HRMA 1RRJA 1ULYA 2FSWA 1FIAA 2W24A 3G6EI 3LL7A 1Z9CA 1T6SA 1OQYA 2W00A 4R79A 1HOMA 2EIMH 2R5ZB 3K1MA 2KKOA 2KMUA 2ME0A 4LITA 5CVIA 3TGNA 4CCLA 3S2HJ 4AYBN 4ENNA 1WH7A 2VT2A 3H0DA 3CMYA 1B72A 2HVRA 5AONA 2STWA 1IDZA 1ZHFA 5FKKA 2VASA 1ZAOA 4QWQA 3FXJA 2L4MA 4HYEA 2V26A 1ZG3A 3CO7C 2HI3A 1FBUA 3FXLA 2VQHA 3FHZA 4HV6A 1SAXA 3HOSA 2A6TA 3OOUA 4Y4RA 3E5XA 2HFHA 4NHJA 1YW7A 1SVLA 2HOTA 1BW6A 3LSPA 2X0LA 2KQRA 3KP5A 2ME6A 3LSJA 3DLLF 3D0SA 3TEDA 5F0CA 4M3EA 1LB2A 4MTEA 3LAJA 2ZNYA 3FHNA 2IT0A 5LGUA 1OCTC 3DU5A 1Z6RA 4HF2A 3PNVA 3FKIJ 1U9OA 2FBIA 4HBLA 5EZHA 5BQTA 1EF4A 2HWVA 3CF2A 1F36A 5DEQA 3WHBA 4AU7A 1OR7A 3K2AA 3ZPLA 4U87A 3S32A 3HYIA 5D4RA 2BYVE 1MBJA 2X4HA 5HVQC 4PSWA 1A36A 2VPLA 2R7VA 2Y69H 1VFCA 3L00A 3H36A 3K0LA 2GWRA 3A0HC 2VBZA 2CFXA 2H27A 2OPTA 3MZYA 3KP6A 3IV5A 1WJDA 2OCEA 1EKEA 3RKXA 4ZDOA 1ZGJA 3VEPA 4A3MJ 1LNWA 5E1ZB 4WCGA 3ZMUA 1XGOA 2HPIA 3K4MA 1A6IA 4KJZA 4Q47A 2IGNA 2DODA 2L7FP 3AG3H 3FMQA 5EGOA 5F6FA 1TNSA 4QLCU 3ECOA 1RR8C 4PDKA 2FMYA 4HF0A 4RAGA 1R58A 4B3AA 2LMDA 4CDGA 4U88A 1QZYA 3S8PA 2VKHA 2ZXHA 1KYWA 5ILSA 3BQZA 4NNJA 3TW7A 1HSJA 3FXUA 3F8FA 2F2EA 1KONA 4A5NA 3A2KA 3OYMA 4M9ZA 4EJWA 5H2FC 2FF4A 4XIDA 1YS6A 1NK3P 3BP8A 3H3ZA 2M1BA 3TP3A 2BVMA 1KGSA 3LSRA 2EZLA 4IRGA 3ZQHA 5FROA 2W85A 1WKMA 3BZKA 4WWCA 3ASOH 1MD0A 4I99C 3I56I 1FJLA 1R00A 1ZH5A 2F5DA 1J7KA 4FE4A 4EM2A 4HQEA 2VKDA 3NAUA 3WU2C 4F91B 1O3RA 3JSPA 2H6CA 5J1YA 2A61A 4C2MJ 1E3HA 3LNQA 2NYXA 4XONA 4DJAA 1OMIA 2V9VA 2QF7A 4G94A 4CSWA 2PMZN 4DBQA 4UUVA 2AQFA 4XLPF 4JK1X 3E6DA 2QENA 5K7FA 3PIOF 3H5NA 5GAEJ 3TO6A 4AIJA 2FD5A 3FISA 3HBLA 1D8JA 2VJ5A 2W82A 3QP5A 3QU6A 4AIKA 5ICCA 1F1ZA 1T38A 2XGDA 1XX5A 1J59A 3J7AO 2VL8A 2HYJA 4C2TA 2EV5A 3L2WA 1G3SA 3DBHB 4NQWA 1IUYA 2X6WA 3ZN1A 1HW2A 1RR7A 1LUJB 2ESNA 2O5RA 1TLHB 2M4GA 4OWRB 2CFOA 5M3MJ 1K79A 1O57A 4A93J 1RIOH 3IL2A 2JRMA 1NH3A 1R4NB 1W36C 3REOA 1JKRC 3OYFA 1YX3A 4UUSA 3BG5A 2NOJB 1D0ZA 5M5WJ 1R5ID 5M5XJ 1Q1VA 3ZMSA 3MN2A 4XLEA 3IKTA 2EZIA 2O7OA 1TP4A 2X1DA 2FJ1A 1HLVA 4LIVA 2YX7A 2XPUA 3I9V2 4ZYHA 4QTRA 5ICEA 1FTTA 1IV8A 1BC7C 2M0CA 3FIWA 3J7ZI 1WSUA 4MEXF 2Z3YA 1U0JA 3LAPA 3K4JA 3HXLA 5ILVA 3KP2A 4L18B 4DYCA 3W2VA 3CLOA 5D8KB 3V4GA 4FTHA 1MH3A 2MH2A 2OZUA 2IA2A 2H8WA 3BR3A 3EUAA 3WG9A 3S3MA 2DLLA 2XB5A 5HLHA 3HOUJ 3DEEA 1ZGWA 4J01A 2MH9A 1YRNA 5IP7J 1TNTA 2QQ9A 5DM6F 3FXMA 2XGXA 2KRFA 2L7ZA 1TTYA 2RNGA 4I2OA 2VIXA 1OCPA 2W1OA 2CV0A 1IN5A 5M3FJ 2MBFA 2LG4A 3CJQB 2EFOA 2XAHA 3Q5FA 1IAWA 2JVGA 1AU7A 1VI0A 1X2MA 2DFIA 2DA7A 2F5VA 4ZH4F 4BNCA 3RZOJ 3CCUI 4BQAA 1DGWY 1IV6A 1V55H 1ETWA 1P4XA 3K2ZA 4PCQA 1HA8A 3K6GA 1KZHA 2VB6A 3CC4I 4YG2F 1FT9A 3HSFA 3KZYA 2HS5A 2KISA 4I0AA 5EEHA 1W7PD 1SAUA 5LGNA 3DQVC 1HCRA 2NVXJ 3U1DA 2X9DA 3J80K 2CS3A 3C2GA 4A3KJ 1K6YA 4XLHA 4CO8A 3I55I 5LLQA 2GOMA 1H9GA 3KCCA 3JRHA 3DF8A 5K5OA 3BLYA 1BR4A 1OCRH 4BJ6C 1VQ9I 4UB8C 4L0ZB 1H8AC 1X4OA 2ETHA 2XAUA 3UNGC 4M9XA 2DT7B 5AIQA 2EB7A 3ZQGA 1JTYA 1PUFA 4OIPF 1QHGA 4QPQA 2DW4A 4BUPA 2XAGA 3FBNB 4LG0A 4WK8F 1YOVB 1P6RA 2O61A 5LGTA 2R3SA 4BBRJ 4HW0A 3U9GA 5L3BA 2M45A 3LOCA 4HDUA 4Y7NJ 1IRFA 2OCCH 4BHPA 1UB9A 2KLOA 2Q1ZB 4ETSA 5D4SA 4KIGA 2YS9A 1B8IA 1E3OC 5DD4A 1ETYA 1JUPA 1OYWA 1YS7A 1R5GA 3IHUA 2K7LA 4UXNA 2CO5A 3KYLA 4LK1F 3I4PA 1ZR2A 3GBGA 3QWLA 1STZA 2HTSA 2XIGA 2HOAA 3S1RJ 2E1CA 3PQKA 3RQIA 2M5WA 2ZMEA 2VUMJ 3D5SC 3PQJA 1W36D 4AIHA 4CCOA 2ELKA 1Y6IA 3PUBA 1DUXC 2IS2A 4PZJA 2VXDA 4C3JJ 3X2QH 3ZCOA 1UMQA 2O9LA 2VE9A 3IWZA 3PO3J 5FO5A 4D7MA 1QZEA 4BGDA 2QSFX 2VONA 1B72B 2NVTJ 3ZN0A 4AVZA 5J6XA 2I10A 2IJLA 2GA2A 3H3VK 3G1LA 4A3EJ 3M9AA 1F5TA 2IGKA 3JSOA 5TGTA 1QPMA 3ML6A 2BXYA 2RN7A 4ABZA 1W7PA 3ZQ7A 2KIQA 2HNHA 3L1PA 2RQPA 1USTA 1ONVA 1WI9A 3GTGJ 1UELB 2X6YA 1EJ9A 3EQLF 4CA0A 1POGA 3Q9VA 1VQMI 2H09A 3ZMZA 2V4JC 3VPRA 4A3BJ 2R7RA 3WTZA 1RZ4A 3CCJI 1IO2A 1I5ZA 3TO7A 2VN2A 4BH9A 2P0WA 2W57A 2X1CA 4BEHA 1U8BA 3N97A 1JUSA 3JRAA 3KYCB 2LVSA 1CF7A 3HUGA 2DPUA 3S3NA 1TWAJ 1KU7A 3BTLA 2E35A 2ISYA 5JHUA 1WRJA 1XGNA 1KQ8A 4HEA2 1XMXA 2P5KA 2L4AA 4U7BA 1SFEA 2Y9YA 1U5TA 3ABLH 3OL4A 1YLFA 1P2FA 2LDUA 3LSIA 4FETA 4Z6YA 2JA6J 1ZN2A 3LA7A 3CCMI 3SZTA 2J5PA 2BXZA 3OYCA 2LTPA 4D9JA 2DU9A 3COAC 4IOAF 2XRLA 2OC6A 3V7CA 3BCAA 2E1MC 4RA2A 4BXUA 2PI0A 1GXPA 2JJ7A 4RLFA 2KP6A 5J3LA 2E5NA 2CUEA 3HZJA 4A3FJ 3BJOA 2PQ8A 3G71I 2Z5UA 1TWGJ 2W25A 4L9VA 2E2JJ 4BY1J 2M7AA 1ZG1A 2JPCA 1Y8RB 3D1NI 1ZRFA 4E7IA 4C9YA 5JI6A 5K5QA 4NUBA 3DXJF 4LB5A 3DTEA 4IQ4A 3L2RA 1FMVA 1TT0A 3BR1A 4MFDA 4A6EA 4X1EA 2LK2A 1HSTA 5D5WB 3H1CA 4HLXA 3C7JA 4KIBA 3L2UA 2H94A 4R8HA 4YFKF 3RKWA 5JLWA 3JRCA 3IRQA 5E18F 5CYVA 3N4MA 1YG2A 4F93B 2NVQJ 5J1UA 4E7SA 4XORA 1QPIA 3WGIA 2VXZA 3SFZA 1REPC 2WV0A 4RB3C 4HNUA 3SZPA 1J09A 2WA0A 2Q8KA 3DP7A 4GFBA 1ZTRA 2I8DA 5CPRB 1NG6A 1S29A 3KE2A 3F8NA 4G7ZF 5GAGJ 4TV7A 1Z3XA 4MQVA 4WF2A 1X3ZB 1KA8A 3AL0C 4B4CA 1O4XA 1HKTA 5B3SH 2DA1A 3IUOA 3SEQA 1MJAA 2MC3A 3TMOA 5J8FA 1FOXA 2XAQA 1I50J 5E1WA 2HZTA 5A2QK 4OIOF 2EBIA 2O3FA 4IRIA 3R0JA 1J2XA 4DZJA 1JJ8C 2PJRB 3RSNA 1R22A 3M8FA 3Q0VA 5LHIA 4E7JA 2Q2EB 5CVJA 3FK6A 5F1RA 4LK0F 5L3EA 4W97A 5FLMJ 4CZCA 3OYGA 1UZCA 3FF5A 5TRDA 1TL8A 2DA4A 1X3UA 2JA5J 2R7QA 2DO7A 1QQIA 5EDNA 1NTCA 3E0JB 3P9CA 2V6CA 3B6AA 2LD5A 2WTEA 3ULQB 3GTOJ 4BJTA 3BR0A 4F55A 5KHDA 3J81K 4FT8A 2DCEA 5E17F 4ESJA 1DQUA 1E3PA 1V54H 2Y75A 1LE8B 3J80Z 2F48A 1YYVA 3EUKL 4M6YA 2V1DA 2P6TA 3K70D 3KZZA 2ZMEC 1I3QJ 4YIIA 4G9YA 1GVJA 3DBLB 4F52A 3LSMA 1MNDA 4B1RA 2Y30A 1Z6TA 4NC6A 1FZPB 3DPUA 1SVOA 3MD2A 1E0EA 1VZ0A 2XF6A 3K9TA 3F8CA 2NNNA 4DIQA 1Z67A 2G7UA 3VYRB 4Y52J 1PUFB 2GQQA 4MHGA 4A3LJ 2GA1A 4S0HB 2CSOA 2ZB9A 1MSEC 4UB6C 2F6CA 1FIPA 4FASD 3MKWB 3S15J 4I09A 3S2DJ 3ZQQA 2XAJA 1AA7A 3D5RC 3WTUC 3QPHA 3F8MA 2YPRA 1YJ9I 3ZQCA 1VF9A 2DFEA 5E20A 1ZGAA 5C44J 2K9MA 4YIRX 1JUMA 3Q3SA 4E4HA 4CYCB 4UVAA 1U3EM 1RKTA 5CVRA 3RI4A 3FBIB 4ENKA 2M7BA 3HSRA 4NDLA 3GTKJ 3JAMZ 3JR9A 2D1HA 1IN7A 1PUEE 3GWZA 3RPUD 4KISA 2HOEA 2DMTA 4J00A 2QWWA 4RLQA 2K86A 3TQNA 3GVAA 5E1XA 2H8RA 3F22A 3CDIA 1USSA 2L5QA 4D0PA 2ISZA 4BBSJ 2OAZA 1TWFJ 4HLYA 1ETVA 3AG1H 2ZJRF 1BIAA 4BQNA 3JRBA 1DPRA 2KDOA 1BC8C 2HKXA 4K2EA 4E7HA 2BBYA 3S14J 1EV7A 3EUHA 1KQ9A 2LBFB 3ZGKA 3H9QA 3LSTA 2ECCA 1ETOA 4KIFA 5F0FA 4N0BA 3WHCA 1AHDP 3BJAA 4B8XA 3NARA 3OYDA 2HEOA 4I98B 2A6EF 3IH4A 3CDHA 4XM3A 2HXIA 2ZCWA 3C1DA 3A01B 5LEJA 3M4OJ 1WPKA 2WBMA 4DYRA 3OYHA 4RM2A 2KT0A 2KZGA 3P9IA 2PMHA 4QIWN 1FYMA 3WU1B 1YI2I 3MWMA 4RGUA 1Q1HA 2Y48A 5J8CA 1FSHA 2JSCA 3QPSA 1XSVA 3NQOA 4R1HA 1YHQI 4OAZA 1XGSA 2VBYA 1MBKA 3HG9A 2IXSA 3P7NA 3ZMVA 4QPOA 3F23A 2CW0F 2EA4A 4PFOA 4DW6A 5LHHA 1F9NA 4IOCF 2UWMA 1W0UA 2MLGA 2R7FA 1H9TA 4BACA 3DKWA 4EJVA 1G6NA 3GF2A 1QA6A 2ZMEB 5EEGA 3QYEA 1BOAA 1X19A 3IH3A 3ESWB 5ERIA 1ZRCA 3KPHA 4IHYA 2JRTA 3CDLA 4IVNA 5D5UB 3ZQLA 3JW4A 1JHFA 4OAYA 1MMGA 2EZKA 4ZJZA 2MA3A 5CVUA 1J0RA 2ZKZA 5FKOA 1IRZA 1XG1A 4KITB 2QLZA 2OBPA 2EFPA 3GTQJ 4LJZF 3V8KA 3VWBA 2R7SA 3CCSI 3RIRA 3N05A 2QGUA 4PJMA 4RB0A 2FBHA 2JQ7A 1T8IA 3I5UA 2MD0A 1XMKA 1QHHD 2AHQA 1XB4A 4B09A 4LG3A 2OTLI 2RGVA 1U5TC 5HDGA 2D1VA 1HF0A 3KP3A 1HBXG 4LLNA 5DYMA 4JQFA 1PP7U 3KX2A 4LIUA 2NS0A 2LLKA 1TW3A 5B66C 5FB2A 2VT3A 2QSHX 4N4NB 3H5RA 1O7LA 1FX7A 5F0HA 2M8EA 4Z2YA 1JHHA 1ENHA 3I59A 4P9FA 1XPXA 1R36A 3BR6A 3A03A 2QBYB 4PJNA 2V1NA 2NVUB 3AFHA 5E3MA 2DMQA 3WTTC 1W4MA 3KIOA 1NG7A 4UVCA 3WGGA 2E7XA 3MEXA 3L09A 2MFZA 2GOXB 2CJJA 4RGSA 3I54A 2DYSH 5DCMB 3F3XA 1I3AA 1LQ1A 2UV1A 2L2OA 2AS5F 4ESBA 3T0YA 2CH0A 2EIJH 5BOXA 2VQGA 1JJ6C 3NWTA 3GFMA 3DLAA 2FEZA 1VQ7I 2GXBA 4N9HA 5E79C 2L7KA 1S7AA 1WZ2A 2IW5A 3CUQB 2ZC2A 5KAFC 2VOPA 4GXOA 4AD9A 5L3GA 1QVTA 1FPQA 1ZK8A 2E1NA 3ABTA 2QZ8A 3QYFA 2UZKA 2JPBA 2HVSA 3OMYA 4HF1A 2KRHA 2XUBA 1VNDA 2CV1A 1VQOI 2CMPA 4KICA 4G6TB 2H1KA 4C30A 1U8RA 1IW7F 4Q5SF 1U2WA 4DBRA 2HQ5A 5HS8A 1P4WA 4I01A 4NB5A 3MVPA 2LBFA 3R60A 1MGTA 1HW1A 2CG4A 3ECHA 4WXDA 2VC0A 3QODA 2OUMA 2V7FA 4M74A 1KU3A 4A5MA 2E60A 2JMWA 3BY6A 1SMTA 4YEJA 3QRFF 1IXRC 1P92A 1B4AA 1S8NA 4I0BA 4X0GA 3ZRGA 4E6KG 2UXNA 2ZNZA 3KETA 3WGHA 4EQQA 4XQFA 2NNYA 3OWTA 1Y1VJ 1YW9A 2IA0A 2ZSIB 1OCZH 1X3WB 3V8JA 5HDKA 4HSRA 4BQOA 1MW7A 1R4MB 3KLOA 3AG4H 3BTJA 3K1PA 2DK5A 4EVIA 4FE7A 1B6AA 5HNFA 3WTYC 1S6LA 2HDDA 2X6XA 3ZP5A 3E5QA 1T2KA 3OIPA 2P6SA 2LYCA 5BS6A 1YO5C 4BXFA 1F4KA 3F9KA 2HOSA 1AKHA 1XSXA 2VQLA 1IXCA 5FRMA 5LBQA 5LRSA 4RAZA 2HQAA 3OYLA 1T98A 1UG0A 2K27A 1MSFC 5BPIA 3O6BB 2V6EA 1K6OA 3D5LA 2V79A 1TWCJ 2KZVA 2L9NA 3QYBA 1WFXA 3PSFA 1Y1WJ 5CQGA 2XKOA 2DMNA 4FISA 3M3YJ 5E8IA 3KEYA 2HDCA 3CC7I 5EGOB 1SD5A 4UUTA 4ON0A 3HKZA 3CCEI 4II2A 1V5GA 1HW5A 2EA2A 2BGCA 4RMNA 1D5VA 3FK7A 1JT0A 1YQAA 3MKLA 3HPHA 2RAEA 5KCMA 2JN6A 4M6XA 2IA1A 5M5YJ 3R0AA 4CUGA 1KU9A 2XKPA 3KYDB 2VLAA 1EA3A 2KIUA 4XSZF 2BV6A 2O8KA 2QVOA 4QSHA 2O6GE 3E6MA 4KUMA 2DDAA 1HKQA 2N8GA 4YFNF 4C2UA 2FQ3A 2XASA 3FXKA 5K7HA 1SFKA 5J40A 4HDVA 1D1CA 1SD4A 1RUOA 2V9PA 1I39A 3W6JB 2STTA 1BM9A 3T8RA 3TDZC 1IUFA 1RKWA 3SDBA 3I3LA 3ERED 3ASNH 1Z0XA 3MAJA 1X58A 3DBRB 4XRMA 1IRGA 1BI0A 1X1PA 1H0MA 3PSIA 4NQWB 3IC7A 3QU3A 3OYAA 2HZDA 3K4BA 4BEHB 3P5JA 3SZGA 4BS9A 2WADA 4YRVA 2V1XA 4L9TA 5GADJ 4LB6B 1YX5A 1K78B 4LG0B 4UY8I 4M72A 1Y0NA 2FOKA 4M73A 1MZBA 1SEUA 2IS4A 1V5FA 3MKYB 5HS9A 3VODA 3FX3A 3K7AJ 2ID6A 2Z16A 2IGOA 3RPUA 4MTDA 1Y0UA 3GEZA 3KEQA 4NC7A 4G6QA 3VYUB 4ESFA 1QO0D 2DTZA 2K3FA 1U6GA 3BG9A 3VFZA 3GTMJ 2L02A 1I6XA 1YIJI 1UAAA 1HDPA 3OYKA 3LA2A 4DGWB 1JKPC 3E6BA 4XKCA 1N78A 2KRCA 3L7WA 2CWEA 2RQQA 1SVMA 5FKNA 1T39A 4M71A 2XGCA 5F04A 2O0YA 3O8HA 2J5OA 2KHMA 2IVMA 3SDGA 1R1VA 2R7OA 2K9SA 1X1AA 3F6OA 2L54A 2K3PA 4Y3OA 5ED4A 5LHGA 2EFQA 5FD6A 1R49A 3S1NJ 3BROA 3HC7A 1APLC 4LFUA 2LNBA 4U0VA 1BR2A 2Z1DA 4WXHA 2MLKA 2ID3A 3WG7H 1GDTA 3FXQA 3NRVA 4RGRA 4XLCA 3BTIA 1OFCX 3J7YJ 3GYHX 1DU6A 2M3AA 2R5ZA 2QA4I 3MFKA 1ITYA 1BJZA 1LDJA 1VQPI 4U0YA 3V42A 2F5EA 2KFDA 4A0YA 1VQ8I 4HSTA 1U78A 3H3UA 5HLGA 2COBA 4CH7A 3KLNA 3JREA 1Z1DA 5CLSA 3JRFA 3ISPA 4LLLA 4GRIA 2DA5A 3H5AA 2ADUA 2IAIA 1IN6A 3HTUA 4M3GA 4HPQA 3RDIA 3ZQFA 3GLXA 2CYYA 4G6DA 1CF7B 2DJIA 2R7XA 1OCCH 1BR1A 4RBOA 1MH4A 3ONQA 1VQ4I 2PMZA 4IHVA 2D2WA 4V2FA 2W84A 4BHBA 4OIQF 4ZZDA 2IPQX 2VKEA 2R93J 1SD6A 4YIFA 4H4KC 3F72A 1HQCA 2LR8A 2ESHA 3M8EA 2OF7A 4E7KA 1SMYF 3T1BA 5KK1A 2CGPA 4XMYA 1Z77A 3LSKA 2EQRA 4GO1A 1XN7A 2NS8A 1VQ6I 2XC7A 2COMA 3BDDA 3OIOA 5DTDA 3EUHC 4AWXB 3I4MJ 3VSKA 4MIMA 3SQNA 2E5ZA 3K4KA 5IOYA 3JTGA 1V3FA 2CUJA 1IN8A 2RNJA 3L2VA 1LVAA 1N75A 4L9NA 5JVGF 1Y8QB 2GZWA 1VQ5I 3K4LA 1ETKA 3JTHA 2TRTA 3E5UA 4ZDLA 1BJAA 2VODA 3H35A 4DOZA 4C3IJ 2P4WA 1BI2A 3TW6A 5IYDJ 1K83J 1S7EA 1ACIA 3HPGA 4AC0A 2Y0SN 1NK2P 4KFCA 1A04A 2P8TA 3SXYA 2IGMA 3H0GJ 3OYIA 2Z33A 1IGNA 1YE9A 1ZR4A 2RVCA 2PFBA 3DTKA 3HEFA 4HA8A 2IS6A 4ZYGA 4XOPA 2XPVA 2V9KA 1GUUA 1R6RA 3MQ0A 4A0ZA 4S04A 3F6VA 3HB9A 4XLAA 3KP4A 4RB1A 3B6CA 2AQEA 1N77A 2EJRA 4GYIA 4MNUA 2CRGA 4S05A 3VDXA 3L2CA 1S72I 1SFXA 4ZDPA 4ZC3A 2HU9A 3TO9A 1CGPA 5IY5H 4IPAA 2E1OA 3UR3C 2CQKA 3FWEA 3R61A 1LDKB 5GAHJ 2HQNA 2M2EA 1ERDA 3CQZJ 3DEWA 4XKBA 1BBYA 2L9RA 3VB2A 4KT5C 5KNLA 1WJAA 2A69F 1FSEA 3ZMDA 3HOVJ 1MBGA 2XV4S 5L3DA 1A6QA 3FMSA 2E7WA 2QQAA 1HC8A 2EV6A 2B63J 4L5IA 5FJ8J 2RC4A 2RDPA 1RUNA 1SC7A 1QU3A 4KMFA 1TQPA 4N9IA 4CCKA 1BOBA 4ANJA 2X48A 1WJEA 2B0LA 4AM3A 1QZZA 1W5CC 4HX4A 3BWGA 1Z05A 5KVRA 2QQBA 1I1SA 2WC2A 3DPTA 3CD6I 3CMAI 4HAMA 1FWZA 2MD5A 5DV5A 1WJ5A 5KAIC 4OINF 3C2BA 3QAHA 4BXXJ 1S5LC 4L5JA 5TISC 3OS2A 2PG4A 3H9JA 2ELHA 1BIBA 1MKMA 2IS1A 3HOYJ 4BE1A 2L0KA 2CQ7A 3DU6A 1R9TJ 1P7JA 2HXOA 1MMAA 2PMUA 5HLIA 2A3SA 2BHYA 3K69A 1BI3A 2P7VB 2D5VA 3GTPJ 1RI7A 2IP2A 3M07A 3H92A 1RPWA 3W2WA 3OL3A 4KYWA 4FX4A 2EINH 3EDPA 2PEXA 2W7NA 2O8XA 2WAQA 4E7ZA 3GTLJ 1YRNB 4IKFA 1MNMC 3ZMTA 4ZYDA 4EJOA 1U9NA 1T95A 1UCRA 3HM5A 2L9VA 2PX9A 2HR3A 1ZRDA 3OIQA 5FD5A 3A02A 4ZZLA 2BY3A 4MGRA 3S3OA 1JXSA 2X1EA 1MBEA 4Y15A 3BT9A 2Y2ZA 1XDSA 3HOXJ 1TZLA 5FKMA 2WAFA 4AIDA 1IC8A 1FYKA 2DT6A 3I64A 4CHUA 2VJJA 1IG7A 1WJFA 2CV2A 4PK4A 3BR5A 3ELKA 3S2WA 4IHWA 1M1EB 2A68F 2DFHA 5EJCA 4CZZA 1GT0C 3ERMA 3PM1A 3BQYA 4MLOA 4XSXF 3DWLE 2G7HA 3WTSC 5DD8A 1YJWI 3QQAA 1T56A 1X1BA 4A0XA 4BAYA 1S3JA 5IPAA 2KL4A 5J4YA 1R71A 5HDNA 2DK8A 1A31A 2JZYA 3WE3A 4EEFG 2Y0SA 1XD7A 3ABKH 4XLFA 4KN7X 1JE8A 3VOEA 4EM1A 1IDYA 3VYTB 4Q4ZF 3W3CA 3W2AA 1LDDA 1SD7A 1DP7P 4B3XA 5FLXZ 1W1WE 3L9FA 3PIPF 2F5CA 3RCOA 4P96A 1EH8A 4CCNA 2EFNA 2FU4A 2QKMB 2ZJQF 1OKRA 1TT5B 3LMMA 2ZXWH 3AKZA 1P9QC 3O2PE 1LPQA 1PVEA 2OD5A 5DCFA 4UHTA 3V7RA 4J19A 1SFUA 4IL6C 1DGRM 1K4TA 2F4IA 2E34A 1ON1A 3WTWC 4N4OB 2XRNA 1OJLA 2YSRA 2PN6A 5E3OA 3I4NJ 2C6YA 3HHGA 1R1TA 3MMYB 3RJPA 2CW7A 2MGQA 1P4AA 3DKXA 3EYIA 4XNFA 2NXNB 5AIPA 1LE8A 5LFAA 2DOAA 3OOPA 3E1SA 4BJ5C 3LWFA 4U0WA 4WXCA 5JVTA 1C0WA 3GFJA 3RQ4A 1G3TA 3RYPA 2OJED 1D3YA 2WV1A 1FBQA 2GAUA 5EG0B 3S16J 1MDMB 4HRIA 1ZQ3P 2JA7J 2ACJA 1XS9A 2YR2A 4I76A 2DBBA 1GHCA 2WY7Q 4M3DA 5K1YA 2R0QC 2DTRA 1IN4A 3HIFA 5EYRA 5B1AH 4GCVA 1K78A 1D8KA 3ZQIA 2LF7A 2WAEA 1DU0A 2R7WA 1FMWA 3GX4X 2H6BA 3HGYA 4P9UA 4IHSA 5IYBJ 1D1AA 1MMSA 2NS7A 5CVVA 4WX9A 2LY1A 3G73A 4CXFA 1FLIA 4F92B 3F21A 1TBXA 2VBWA 2LY2A 3BR2A 3M1CA 3OYJA 1CQTA 4IHTA 2VQCA 1LFBA 3CUOA 4U7DA 3OS1A 4CYCA 3J81Z 1KQ0A 5F27A 1LVKA 4HNTA 1WQ2A 3OYBA 2EPFA 3CZ6A 3FM5A 2KJCA 2K85A 3HDDA 2E1MB 3B02A 2XSJC 2PBIA 5GTHC 3K70C 2GXGA 2WWYA 1V4RA 1X2NA 2M34A 4I6ZA 3LFUA 4JYKA 2M9HA 3TP0A 3CMEI 1LEBA 4ITVA 2H1LA 1G3YA 2FUG2 1XTAA 2VE8A 1J9IA 1AKHB 3SFIA 4RS8A 3WODF 4EJUA 1RETA 2VJIA 3NEUA 1E17A 3IH2A 3I59B 2K02A 5BPDA 4HQMA 2XSDC 1LEAA 1LKXA 5FKLA 3HHHA 1Z3YA 1B9NA 2LRDA 2ECBA 1GLNA 3KP7A 2DMPA 3SHFA 4V19K 1D0YA 4F3QA 1XC5A 4PJ0C 5DS9A 2R5YB 4D5FA 1J5YA 5K5RA 4UV8A 4ENMA 3U2RA 4A69C 1G59A 1DPUA 4CCJA 5C4XJ 3P9KA 2BY0A 5HODA 1O3TA 3LQQA 5F1JA 2GM4A 2P5VA 1JGGA 3BOQA 1FP1D 2G9WA 4KN4X 2M8GX 3V8LA 2ZXIA 5D5XB 4MEYF 2XF5A 2FMLA 2FBKA 1A35A 2A5YB 9ANTA 5GTIC 2K9LA 2CQNA 3ABUA 1FTZA 4HG2A 1FEXA 1OYIA 2W48A 2FNPA 2XB0X 1PJRA 2VBXA 3CUQC 4M3BA 3RPQA 2MYSA 3HRUA 3BZ6A 4EJTA 5IYCJ 2IBDA 4BDZA 4A3JJ 3SJMA 1YITI 1WVRA 3MZHA 2BW3A 1MMNA 3QP6A 4CICA 1X1CA 2DYRH 3PFIA 4GYGA 2WB1N 5FRNA 4CCMA 4C3HJ 2LREA 4BL0B 2GIVA 3PUFA 4IHXA 4LLGF 3ZXSA 1E2XA 2M0MA 2GBYA 4D5CA 3UKGA 1IXSB 4RGXA 2B9SA 3S1QJ 2DA3A 2TCTA 5EEAA 3CCQI 2ZJPF 5H6RA 2HYFA 4JX5A 3LFKA 3WTXC 3CF5F 3EYYA 5FLVA 2EZHA 4BHCA 1YFHA 2XF7A 3OR2C 2RKHA 1UHSA 2CUFA 1PYVA 1XCBA 4OU0A 4XRFA 3DCFA 4JX4A 1FY7A 4G8XA 2A05A 2QUFA 3OV8A 2VOOA 4DZPA 3EPZA 3CLQA 2UUZA 3IWFA 3JRDA 2JUCA 1YIOA 3BPXA 1HXDA 3SEZA 1ZREA 4HOBA 4D7NA 1G8XA 2FOWA 3M1EA 2XPWA 2K9NA 1W5SA 3DTIA 3T5XA 2EILH 3DFGA 3CMMA 3RKQA 2PLYA 2QBYA 5IT9K 1QGPA 2LKPA 4IX7A 2KPMA 5ICGA 1K4SA 4AYBA 2LH9A 4PSXA 4PGHA 2WAQN 1MJBA 3DV8A 5C3EJ 5DCMA 5JHFA 3BCBA 3OY9A 4CGZA 4OMYA 1PDNC 2LFBA 3KZIC 3I0TA 4XOTA 3IAM2 3K4NA 1ZARA 2LC2A 1LJ9A 2QQ8A 1IJWC 1TW2A 3HRTA 4P1WA 2CQXA 3BG6A 2DI3A 3J7AY 3A4CA 2ZBKA 3GFLA 4IJAA 3JAMK 1G2HA 2R7ZJ 3CUQA 2F5FA 4KT6A 5J47A 3BPVA 2Y9ZA 3VYSB 6PAXA 3RKYA 4PJJA 4DYQA 2HKOA 2DA2A 5C4JJ 4IXAA 3TL4X 2YX4A 4BKXA 3ABMH 1Z21A 2JUGA 1VQNI 1JKOC 2NVYJ 4UV9A 3Q0WA 1O7FA 4M6VA 3ZR8X 3HJEA 1I1GA 1KYZA 2YU3A 1JKQC 4XN3A 2PJPA 1ON2A 4HZFA 1KU2A 2FRHA 3GMEA 1R1UA 3O3KA 5LRRA 3G1OA 3WE2A 2PJRA 3E3VA 2LF8A 5H20A 1Y39A 2JA2A 5IP6A 2BE5F 3RZDJ 4RM3A 3HTSB 2OA4A 1FBSA 5J1RA 5F08A 1R7JA 4A2UA 1MMDA 1D0XA 1BA5A 5E3NA 4XICA 3TKYA 1D1BA 1IRXA 2X51A 2EFWA 1O3SA 4H0EA 1ZELA 3CJRB 2P5LC 1X1DA 3MKZA 5HNHA 2F4MB 3KFWX 3BG3A 4B44A 2ZJ2A 1JI8A 3IRRA 4Y17A 2FX0A 2L01A 1LFPA 4LMYA 3HL2A 1SFOJ 3L2QA 5IT3A 5B5EC 4P5OA 3KEOA 4II3A 4M9SA 3IP4B 1J75A 1LFUP 2GXAA 2DOEA 4I02A 1MDMA 4IQJA 2JA8J 4EM0B 5FLXK 3BG7A 4XKVA 2NOGA 2RV8A 2HPMA 1T08B 3E7LA 4L0YB 2ZXJA 2BOLA 5K7ZA 3I58A 4IO9F 4PFPA 1T0FC 2W4SA 4O6JA 5EF6A 2R92J 2EH3A 1ODDA 4BE0A 1IZ1A 3RTRA 2FXAA 5CKTA 1ZLKA 3FDYA 3AG2H 2OQGA 2KIFA 1OISA 3EETA 4RB2C 3M8JA 2DN0A 1GXQA 3CCRI 5LEKA 2RREA 5GPAA 3JRIA 3H9GA 2BEOA 1RNLA 2F4OB 2LOOA 1GV5A 3MCZA 1HDDC 3GUDA 5L3FA 4X6AJ 4B48A 4KDPA 4IRHA 3WU0A 1UFMA 1FC3A 1FNNA 2QEXI 2B7EA 2A5WA 2JK3A 3GZNB 4HV5A 3TBIA 5IOZA 4PGGA 5FFZA 1U5TB 1ZYRF 2DDBA 2M87A 4L5EA 4LGWA 3Q0UA 4FX0A 3C18A 4L9JA 3FXRA 1MBHA 1G4DA 3OR1C 2E2IJ 1OLTA 1BN5A 3ZOBA 3U21A 4XRSA 1S7OA 3A01A 3A0BC 4RAFA 1G3WA 2DJNA 2LKXA 1RESA 2ELJA 2QKLB 2VI6A 4UUSB 2BZTA 2WY8Q 3BTCA 2OTJI 1YW8A 4IF4A 1B9MA 3S17J 2MW8A 2ZFUA 4NBQA 1ZKGA 2DA6A 2DQLA 2EIKH 2XHKA 1N25A 3DKYA 4XKWA 4EGYA 1Z7LA 4YELA 1BI1A 3E97A 3HRSA 2HDWA 5F64A 2MC4A 4OMZA 3MZ8A 4A3GJ 4MO7A 5L3CA 2YUSA 2DFFA 2R7TA 3JRGA 5GP9A 3CJTB 4ASNA 3TOAA 1FOYA 4DNCA 4BY7J 1ORKA 4MFEA 5E8GA 5HOOA 2L9SA 1SANA 1WH5A 1I27A 4KNYA 1W7PB 4IZZA 3F8BA 1Y56A 2BHZA 4JOMA 4M3FA 1IF1A 4NC8A 4A6DA 2DPDA 3S1MJ 1K7AA 3CP2A 1JTXA 3K1NA 2GIZA 2JT1A 2AO9A 2ICWG 3GZ6A 2UXXA 5FGMA 2E71A 3E6CC 1EH7A 3TDUC 2IRFG 2I5UA 4RAYA 1O3QA 1D5YA 2KDZA 3PNYA 2VPRA 1B1BA 3OSGA 4G12A 4BDYA 3G2BA 2VJ4A 2WB1A 2HTJA 2Z99A 2NAZA 4XRSG 1ZLJA 2R7UA 4W1UA 5IP9J 3R6SA 3W6VA 1V5EA 3HOWJ 3TOBA 1GVDA 1XDUA 3PJRA 5H6QA 3G3ZA 1EH6A 2KIMA 3HOZJ 2JSPA 3GTJJ 2VC1A 4Q48A 1A5JA 3M7GA 4ENJA 5DDGA 1ETXA 4LOCA 3LSHA 2JVHA 4IEJA 1XSDA 3CCVI 4EV0A 5B1BH 3B73A 2L3DA 4BE2A 1OCOH 2HVQA 2ZSHB 2A07F 4D1QA 2M4KA 1H89C 1TQMA 1WI3A 2BVLA 2M30A 3Q9SA 2K4BA 1DP3A 3O8GA 2R7DA 3GCMA 3R4KA 1T33A 2Z2SB 2K40A 3PNTA 1UJ8A 5JR3A 3CESA 2DQRA 2EV0A 2EWNA 1XGMA 4YFXF 2MSYA 4E70A 4OOIA 1MNEA 4XL9A 4O3MA 3FXOA 2JWTA 4ZYAA 1UHWA 2E19A 3LSGA 1AOYA 2HYGD 4A3IJ 4ZTJA 1XMAA 2CUZA 3F0CA 3T8TA 1YJNI 2MG4A 3LA3A 2YU9J 3LQRA 3PFYA 1QRYA 4FCYA 1W0TA 4EMSA 3OYNA 2E2HJ 2X85A 1MJ9A 3C3WA 3FM3A 2V1UA 2DOFA 3GXOA 4Y33A 1B8IB 5DM7F 3CCLI 3HSEA 3SYTA 4B47A 2IEKA 1PP8F 3AAFA 1TC3C 2QM3A 4XLNF 1UHMA 1W5TA 1I6HJ 2JTVA 2LSOA 1R23A 1R5HA 3NWSA 2XROA 1NHAA 2G0EA 1QNTA 4JP0A 1H88C 1FOWA 3DPLC 2QSGX 4B43A 4G7OF 5DUIA 1XCVA 3BC8A 4XBFA 3HGGA 3JCUC 3K10A 2Q2EA 1VQLI 2Z9OA 2GLOA 3HOTA 2EK5A 2K9QA 4FQGA 2Q0OA 3CJNA 2LP0A 3GZ5A 4GGGA 2ZFWA 3FMRA 3VSLA 5E3LA 3OS0A 2X6OA 1Z7UA 4XR6A 1X4PA 2TDXA 4BYYA 2OZ6A 1DDNA 2AXLA 4KMUX 3BJ6A 4LD5A 3QPLA 2BW3B 2FQ4A 3PL8A 4ZYEA 5CQEA 2K4JA 3PO2J 2O03A 2XGEA 4E7LA 1FOKA 1RC9A 2R5YA 5JFRA 1OR7C 3C2HA 1WHUA 1GV2A 4EGZA 1WCMJ 5A2QZ 4I7HA 2BY1A 3GFIA 3A1YA 3CCYA 3FKJA 4BQQA 1B59A 3BZCA 3CO6C 4HX7A 5FFXA 2HGCA 1MBFA 2DT5A 1L0OC 1S9HA 2Y31A 3QOEA 4A12A 1BL0A 2CQQA 3OYEA 5TJJA 3U1KA 2AXTC 2DMUA 2K5CA 2CW8A 2LY9A 2D45A 5EG0A 1K61A 2VKVA 3DEUA 1P7IA 1FP2A 1UG2A 2OU2A 2OV7A 5EZGA 5D5VB 2QYOA 4UNOA 3I71A 4PJLA 2DAOA 3CTAA 3AL0B 1WGXA 2ZO4A 2FNAA 3ROUA 4F7ZA 1VTNC 5ICFA 1AWCA 1HKSA 3OSFA 3FZVA 2E36A
chains in the Genus database with same CATH topology
4AVPA 4O5VA 1FYLA 1T0FA 4G7HF 2P7CB 3IKVA 3W6KB 3I53A 1WWXA 4CYDA 1Z91A 5ILUA 5IT9Z 1L3LA 3RYRA 5D6EA 5D8LB 2OQRA 4HX8A 3WTVC 2XAFA 5D6FA 4Y13A 4FHTA 1OYYA 1OPCA 2HQRA 4KA4A 2Y0MA 1QBJA 4UVBA 3V7SA 1YTYA 3QPTA 5HS7A 3QOPA 2NRAC 4JBAA 2FE3A 5CJ9A 1JGSA 5DUKA 4DQ2A 2KJBA 3GO5A 4MQ9F 2A6HF 2FA5A 4OIRF 3GW2A 1ZG5A 4P55A 5BMZA 2XVCA 1TQIA 3HRMA 2FSWA 1ULYA 2W24A 1Z9CA 1T6SA 4R79A 3K1MA 2KKOA 5CVIA 3TGNA 4ENNA 2VT2A 5AONA 2STWA 1ZHFA 1ZAOA 4QWQA 2L4MA 4HYEA 1ZG3A 3CO7C 3FHZA 1FBUA 4HV6A 1SAXA 3HOSA 3E5XA 2HFHA 4NHJA 1YW7A 2X0LA 3KP5A 3D0SA 1LB2A 4MTEA 3LAJA 2ZNYA 2IT0A 5LGUA 4HF2A 1Z6RA 2FBIA 4HBLA 5BQTA 2HWVA 5DEQA 1OR7A 3ZPLA 3HYIA 5D4RA 2BYVE 5HVQC 2X4HA 3L00A 3K0LA 2GWRA 2VBZA 2CFXA 2H27A 3MZYA 3KP6A 3RKXA 1ZGJA 3VEPA 1LNWA 5E1ZB 4WCGA 3ZMUA 1XGOA 4Q47A 3FMQA 5F6FA 1TNSA 4QLCU 3ECOA 4PDKA 2FMYA 4HF0A 1R58A 4CDGA 4U88A 1QZYA 5ILSA 1KYWA 1HSJA 3FXUA 3F8FA 2F2EA 4A5NA 4M9ZA 4EJWA 2FF4A 1YS6A 3BP8A 3H3ZA 2M1BA 1KGSA 4IRGA 2W85A 1WKMA 4WWCA 1MD0A 1R00A 1ZH5A 2F5DA 1J7KA 4EM2A 4HQEA 1O3RA 3JSPA 2H6CA 2A61A 2NYXA 1OMIA 2V9VA 4G94A 4UUVA 4XLPF 4JK1X 3E6DA 2QENA 3TO6A 4AIJA 1D8JA 4AIKA 3QU6A 3QP5A 5ICCA 1F1ZA 1T38A 1J59A 3J7AO 2EV5A 1G3SA 4NQWA 1IUYA 3ZN1A 1HW2A 2ESNA 1TLHB 1K79A 1O57A 1RIOH 3IL2A 3REOA 3ZMSA 3IKTA 2YX7A 4ZYHA 5ICEA 1BC7C 1WSUA 4MEXF 2Z3YA 3LAPA 5ILVA 3KP2A 4L18B 3CLOA 5D8KB 3V4GA 2MH2A 2OZUA 2IA2A 3WG9A 2DLLA 5HLHA 2MH9A 1TNTA 2QQ9A 2XGXA 2KRFA 1TTYA 4I2OA 1IN5A 2MBFA 2EFOA 2XAHA 3Q5FA 1IAWA 2DFIA 4ZH4F 4BNCA 4BQAA 1P4XA 3K2ZA 4PCQA 4YG2F 1FT9A 3HSFA 3KZYA 2HS5A 4I0AA 5EEHA 1W7PD 5LGNA 3DQVC 3U1DA 3J80K 4CO8A 5LLQA 1H9GA 3KCCA 3DF8A 5K5OA 4L0ZB 2ETHA 4M9XA 5AIQA 2EB7A 4OIPF 2DW4A 4WK8F 2XAGA 4LG0A 1P6RA 2O61A 5LGTA 2R3SA 4HW0A 3U9GA 5L3BA 2M45A 4HDUA 1IRFA 4BHPA 1UB9A 4ETSA 5D4SA 4KIGA 5DD4A 1OYWA 1YS7A 1R5GA 3IHUA 2K7LA 4UXNA 2CO5A 4LK1F 3I4PA 1STZA 2HTSA 2XIGA 2E1CA 3PQKA 2M5WA 2ZMEA 3PQJA 4AIHA 1DUXC 4PZJA 2VE9A 3IWZA 5FO5A 2VONA 3ZN0A 5J6XA 2IJLA 2GA2A 3M9AA 1F5TA 3JSOA 1QPMA 3ML6A 2RN7A 1W7PA 3ZQ7A 2RQPA 1USTA 1ONVA 1WI9A 3EQLF 3Q9VA 2H09A 3ZMZA 3WTZA 1RZ4A 1I5ZA 3TO7A 2VN2A 4BH9A 2W57A 3N97A 1CF7A 3HUGA 2DPUA 1KU7A 2ISYA 5JHUA 1WRJA 1XGNA 1KQ8A 2P5KA 2L4AA 4U7BA 1SFEA 1U5TA 1YLFA 1P2FA 2LDUA 1ZN2A 3LA7A 3SZTA 2J5PA 2DU9A 3COAC 3V7CA 2PI0A 4BXUA 1GXPA 3BJOA 2PQ8A 2Z5UA 2W25A 4L9VA 1ZG1A 2JPCA 1ZRFA 5JI6A 5K5QA 3DXJF 4LB5A 4A6EA 1HSTA 5D5WB 4HLXA 3C7JA 4KIBA 2H94A 4R8HA 4YFKF 3RKWA 3IRQA 5E18F 5CYVA 3N4MA 1YG2A 3WGIA 2VXZA 3SFZA 1REPC 2WV0A 4RB3C 3SZPA 2Q8KA 3DP7A 1S29A 3KE2A 3F8NA 4G7ZF 4TV7A 4MQVA 4WF2A 1KA8A 1HKTA 1MJAA 2MC3A 5J8FA 2XAQA 5E1WA 5A2QK 2HZTA 4OIOF 2O3FA 4IRIA 3R0JA 1J2XA 1R22A 3M8FA 5LHIA 5CVJA 5F1RA 4LK0F 5L3EA 3FF5A 5TRDA 1X3UA 2DO7A 1QQIA 3P9CA 2V6CA 2WTEA 3ULQB 3J81K 4FT8A 5E17F 4ESJA 2Y75A 3J80Z 1YYVA 4M6YA 2V1DA 2P6TA 3KZZA 4YIIA 4G9YA 1GVJA 1Z6TA 1FZPB 3K9TA 3F8CA 2NNNA 2G7UA 2GQQA 4MHGA 2GA1A 2CSOA 4I09A 2XAJA 3WTUC 3QPHA 3F8MA 2YPRA 5E20A 1ZGAA 4UVAA 1U3EM 5CVRA 3RI4A 4ENKA 3HSRA 3JAMZ 2D1HA 1IN7A 1PUEE 3GWZA 2HOEA 2QWWA 2K86A 3TQNA 3GVAA 5E1XA 3F22A 1USSA 4D0PA 2ISZA 2OAZA 4HLYA 1BIAA 1DPRA 1BC8C 2HKXA 4K2EA 2BBYA 1EV7A 1KQ9A 3EUHA 3LSTA 4KIFA 4N0BA 3BJAA 4B8XA 2HEOA 4I98B 2A6EF 3CDHA 2ZCWA 3C1DA 5LEJA 3P9IA 2PMHA 1FYMA 3WU1B 3MWMA 4RGUA 1Q1HA 2Y48A 5J8CA 1FSHA 2JSCA 1XSVA 3NQOA 4R1HA 1XGSA 2VBYA 3P7NA 3ZMVA 3F23A 2CW0F 2EA4A 5LHHA 1F9NA 2UWMA 2MLGA 2R7FA 1H9TA 3DKWA 4EJVA 1G6NA 3GF2A 2ZMEB 5EEGA 1BOAA 5ERIA 1ZRCA 2JRTA 4IVNA 5D5UB 3JW4A 1JHFA 2MA3A 5CVUA 1J0RA 2ZKZA 2QLZA 2OBPA 2EFPA 4LJZF 3V8KA 3RIRA 4RB0A 2FBHA 3I5UA 1XMKA 1XB4A 4B09A 2RGVA 1U5TC 5HDGA 2D1VA 3KP3A 1HBXG 4LLNA 5DYMA 4JQFA 1PP7U 2NS0A 1TW3A 5FB2A 2VT3A 1O7LA 1FX7A 2M8EA 4Z2YA 1JHHA 3I59A 4P9FA 1R36A 2QBYB 3WTTC 1W4MA 3WGGA 4UVCA 2E7XA 3MEXA 3L09A 4RGSA 3I54A 5DCMB 3F3XA 1LQ1A 2AS5F 4ESBA 3T0YA 5BOXA 3GFMA 2FEZA 2GXBA 4N9HA 1S7AA 2IW5A 3CUQB 2VOPA 4GXOA 4AD9A 5L3GA 2QZ8A 1FPQA 2E1NA 3ABTA 2UZKA 2JPBA 4HF1A 2XUBA 4KICA 1U8RA 1IW7F 4Q5SF 1U2WA 5HS8A 1P4WA 4I01A 4NB5A 3R60A 1MGTA 2CG4A 1HW1A 3ECHA 4WXDA 2VC0A 4M74A 1KU3A 4A5MA 3BY6A 1SMTA 3QRFF 1IXRC 1P92A 1B4AA 1S8NA 4I0BA 2UXNA 2ZNZA 3KETA 3WGHA 4EQQA 2NNYA 1YW9A 2IA0A 3V8JA 5HDKA 3KLOA 3K1PA 4EVIA 2DK5A 1B6AA 3WTYC 1S6LA 3ZP5A 3E5QA 1T2KA 2P6SA 5BS6A 1YO5C 1F4KA 1XSXA 1IXCA 5LBQA 5LRSA 4RAZA 1T98A 2K27A 5BPIA 3O6BB 1K6OA 3D5LA 2V79A 2XKOA 5E8IA 2HDCA 1SD5A 4ON0A 1HW5A 2EA2A 2BGCA 1D5VA 1YQAA 4M6XA 2IA1A 3R0AA 1KU9A 2XKPA 2KIUA 4XSZF 2BV6A 2QVOA 2O6GE 3E6MA 4KUMA 1HKQA 4YFNF 2FQ3A 2XASA 4HDVA 1SD4A 1RUOA 3W6JB 2STTA 1BM9A 3T8RA 3TDZC 3ERED 3MAJA 1IRGA 1BI0A 1H0MA 3IC7A 3QU3A 2V1XA 4L9TA 4LB6B 1K78B 4LG0B 4M72A 2FOKA 4M73A 1MZBA 5HS9A 3VODA 3FX3A 3RPUA 4MTDA 1Y0UA 3GEZA 3KEQA 4G6QA 4ESFA 1QO0D 1U6GA 3VFZA 2L02A 1I6XA 3LA2A 3E6BA 3L7WA 2CWEA 1T39A 4M71A 2O0YA 2J5OA 2IVMA 1R1VA 3F6OA 2L54A 5ED4A 5LHGA 2EFQA 5FD6A 3BROA 4LFUA 2LNBA 4U0VA 4WXHA 2MLKA 3FXQA 3NRVA 4RGRA 3GYHX 3MFKA 1LDJA 4U0YA 2F5EA 4A0YA 1U78A 3H3UA 5HLGA 3KLNA 1Z1DA 5CLSA 3ISPA 4LLLA 2ADUA 1IN6A 3HTUA 3RDIA 3GLXA 2CYYA 4G6DA 1CF7B 2D2WA 2W84A 4BHBA 4OIQF 4ZZDA 2IPQX 1SD6A 4YIFA 3F72A 1HQCA 2ESHA 3M8EA 1SMYF 3T1BA 5KK1A 2CGPA 4GO1A 1XN7A 2COMA 3BDDA 4AWXB 3SQNA 3JTGA 1V3FA 1IN8A 2RNJA 1LVAA 4L9NA 2GZWA 3JTHA 3E5UA 1BJAA 2VODA 2P4WA 1BI2A 4KFCA 1A04A 2P8TA 3SXYA 2Z33A 2RVCA 2PFBA 4HA8A 4ZYGA 3MQ0A 4A0ZA 4S04A 3F6VA 3KP4A 4RB1A 2EJRA 4GYIA 4MNUA 4S05A 3L2CA 1SFXA 3TO9A 1CGPA 4IPAA 2CQKA 3FWEA 3R61A 1LDKB 2HQNA 1BBYA 3VB2A 4KT5C 2A69F 1FSEA 3ZMDA 5L3DA 2XV4S 3FMSA 2E7WA 2QQAA 2EV6A 4L5IA 2RC4A 2RDPA 1RUNA 4KMFA 1TQPA 4N9IA 2B0LA 1QZZA 4HX4A 3BWGA 1Z05A 5KVRA 2QQBA 1I1SA 2WC2A 3DPTA 4HAMA 1FWZA 2MD5A 5DV5A 4OINF 3QAHA 4L5JA 2PG4A 2ELHA 1BIBA 1MKMA 2PMUA 5HLIA 2A3SA 3K69A 1BI3A 2P7VB 1RI7A 2IP2A 3H92A 4KYWA 4FX4A 3EDPA 2PEXA 2O8XA 3ZMTA 4ZYDA 4EJOA 1UCRA 2HR3A 1ZRDA 5FD5A 4ZZLA 4MGRA 1JXSA 4Y15A 1XDSA 1FYKA 3I64A 4CHUA 3ELKA 3S2WA 2A68F 4CZZA 4XSXF 2G7HA 3WTSC 5DD8A 4A0XA 4BAYA 1S3JA 5HDNA 2DK8A 2JZYA 3WE3A 1XD7A 4KN7X 1JE8A 3VOEA 4EM1A 4Q4ZF 1LDDA 1SD7A 1DP7P 5FLXZ 3L9FA 2F5CA 4P96A 1EH8A 2EFNA 2FU4A 1OKRA 3O2PE 2OD5A 5DCFA 1SFUA 4UHTA 3V7RA 1ON1A 3WTWC 2XRNA 2YSRA 2PN6A 2C6YA 3HHGA 1R1TA 3RJPA 1P4AA 3EYIA 5AIPA 3OOPA 3LWFA 4U0WA 4WXCA 5JVTA 1C0WA 3GFJA 1G3TA 3RYPA 1D3YA 1FBQA 2GAUA 1MDMB 2ACJA 2YR2A 2DBBA 1GHCA 5K1YA 2DTRA 1IN4A 3HIFA 4GCVA 1K78A 1D8KA 2LF7A 3GX4X 2H6BA 4IHSA 4P9UA 5CVVA 4WX9A 3G73A 4CXFA 1FLIA 3F21A 1TBXA 2VBWA 4IHTA 3CUOA 4U7DA 3J81Z 1KQ0A 1WQ2A 3FM5A 2KJCA 3B02A 2PBIA 2GXGA 2WWYA 1V4RA 1LEBA 1G3YA 2VE8A 1J9IA 4RS8A 3WODF 4EJUA 3NEUA 1E17A 3I59B 2K02A 5BPDA 4HQMA 1LEAA 3HHHA 1B9NA 3KP7A 3SHFA 1J5YA 5K5RA 4UV8A 4ENMA 3U2RA 1DPUA 1O3TA 3P9KA 3LQQA 2P5VA 3BOQA 1FP1D 2G9WA 4KN4X 3V8LA 5D5XB 4MEYF 2FMLA 2FBKA 2A5YB 3ABUA 1OYIA 2FNPA 2VBXA 3CUQC 3RPQA 3HRUA 3BZ6A 4EJTA 3MZHA 3QP6A 4CICA 3PFIA 4GYGA 2GIVA 4LLGF 1E2XA 1IXSB 4RGXA 5H6RA 2HYFA 3LFKA 3WTXC 3EYYA 4BHCA 1YFHA 2RKHA 1XCBA 4OU0A 4XRFA 1FY7A 4G8XA 3OV8A 2QUFA 2VOOA 3IWFA 1YIOA 3BPXA 1HXDA 1ZREA 4HOBA 3M1EA 1W5SA 3T5XA 3DFGA 2PLYA 2QBYA 5IT9K 1QGPA 2LKPA 5ICGA 4PGHA 1MJBA 3DV8A 5DCMA 4CGZA 4OMYA 1PDNC 3I0TA 1ZARA 1LJ9A 1TW2A 3HRTA 2DI3A 2ZBKA 3GFLA 4IJAA 3JAMK 3CUQA 2F5FA 3BPVA 6PAXA 3RKYA 2HKOA 4IXAA 2YX4A 4UV9A 1O7FA 1I1GA 1KYZA 2YU3A 2PJPA 1ON2A 4HZFA 1KU2A 2FRHA 1R1UA 3O3KA 5LRRA 3WE2A 3E3VA 2LF8A 5H20A 2BE5F 3HTSB 2OA4A 1FBSA 1R7JA 4A2UA 3TKYA 2EFWA 1O3SA 4H0EA 2P5LC 3KFWX 2ZJ2A 3IRRA 4Y17A 2L01A 4LMYA 5IT3A 4P5OA 3KEOA 1J75A 4M9SA 4I02A 1MDMA 4EM0B 5FLXK 2RV8A 4L0YB 2ZXJA 3I58A 4O6JA 1ODDA 1IZ1A 3RTRA 2FXAA 1ZLKA 2OQGA 2KIFA 3EETA 4RB2C 1GXQA 5LEKA 2BEOA 1RNLA 3MCZA 3GUDA 5L3FA 4KDPA 4IRHA 3WU0A 1UFMA 1FC3A 1FNNA 4HV5A 4PGGA 5FFZA 1U5TB 1ZYRF 2M87A 4LGWA 4FX0A 3C18A 4L9JA 3FXRA 1G4DA 1BN5A 1S7OA 1G3WA 1YW8A 4IF4A 1B9MA 2DQLA 2XHKA 4EGYA 1BI1A 3E97A 3HRSA 5F64A 4OMZA 5L3CA 4ASNA 3TOAA 4DNCA 5E8GA 5HOOA 1I27A 4KNYA 1W7PB 3F8BA 1IF1A 4A6DA 2DPDA 1K7AA 3K1NA 2JT1A 3GZ6A 2UXXA 5FGMA 3E6CC 1EH7A 3TDUC 2IRFG 4RAYA 1O3QA 1B1BA 2HTJA 2Z99A 2NAZA 1ZLJA 3R6SA 3TOBA 1XDUA 5H6QA 3G3ZA 1EH6A 2KIMA 2VC1A 4Q48A 3M7GA 4ENJA 5DDGA 1XSDA 4EV0A 3B73A 2L3DA 2A07F 1TQMA 2M30A 3Q9SA 2K4BA 2R7DA 3R4KA 5JR3A 2DQRA 2EV0A 2EWNA 1XGMA 4YFXF 4E70A 4OOIA 4O3MA 1UHWA 1AOYA 2HYGD 1XMAA 3T8TA 3LA3A 3LQRA 4EMSA 1MJ9A 3C3WA 3FM3A 2V1UA 3GXOA 3HSEA 1PP8F 3AAFA 2QM3A 4XLNF 1UHMA 1W5TA 2JTVA 2LSOA 1R23A 1R5HA 2XROA 1NHAA 1QNTA 3DPLC 4G7OF 5DUIA 1XCVA 4XBFA 2Q2EA 2Z9OA 3HOTA 2EK5A 2Q0OA 3CJNA 4GGGA 3GZ5A 2ZFWA 3FMRA 1Z7UA 2TDXA 4BYYA 2OZ6A 1DDNA 2AXLA 4KMUX 3BJ6A 4LD5A 4ZYEA 2K4JA 2O03A 1FOKA 5JFRA 4EGZA 5A2QZ 4I7HA 3GFIA 1B59A 3CO6C 4HX7A 5FFXA 2HGCA 2DT5A 1L0OC 4A12A 5TJJA 2D45A 3DEUA 1FP2A 2OU2A 5D5VB 2QYOA 4UNOA 3I71A 2DAOA 3CTAA 2ZO4A 2FNAA 3ROUA 4F7ZA 1VTNC 5ICFA 1AWCA 1HKSA 3FZVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AVP A;  4O5V A;  1FYL A;  1T0F A;  4G7H F;  2P7C B;  3IKV A;  3W6K B;  3I53 A;  1WWX A;  4CYD A;  1Z91 A;  5ILU A;  5IT9 Z;  1L3L A;  3RYR A;  5D6E A;  5D8L B;  2OQR A;  4HX8 A;  3WTV C;  2XAF A;  5D6F A;  4Y13 A;  4FHT A;  1OYY A;  1OPC A;  2HQR A;  4KA4 A;  2Y0M A;  1QBJ A;  4UVB A;  3V7S A;  1YTY A;  3QPT A;  5HS7 A;  3QOP A;  2NRA C;  4JBA A;  2FE3 A;  5CJ9 A;  1JGS A;  5DUK A;  4DQ2 A;  2KJB A;  3GO5 A;  4MQ9 F;  2A6H F;  2FA5 A;  4OIR F;  3GW2 A;  1ZG5 A;  4P55 A;  5BMZ A;  2XVC A;  1TQI A;  3HRM A;  2FSW A;  1ULY A;  2W24 A;  1Z9C A;  1T6S A;  4R79 A;  3K1M A;  2KKO A;  5CVI A;  3TGN A;  4ENN A;  2VT2 A;  5AON A;  2STW A;  1ZHF A;  1ZAO A;  4QWQ A;  2L4M A;  4HYE A;  1ZG3 A;  3CO7 C;  3FHZ A;  1FBU A;  4HV6 A;  1SAX A;  3HOS A;  3E5X A;  2HFH A;  4NHJ A;  1YW7 A;  2X0L A;  3KP5 A;  3D0S A;  1LB2 A;  4MTE A;  3LAJ A;  2ZNY A;  2IT0 A;  5LGU A;  4HF2 A;  1Z6R A;  2FBI A;  4HBL A;  5BQT A;  2HWV A;  5DEQ A;  1OR7 A;  3ZPL A;  3HYI A;  5D4R A;  2BYV E;  5HVQ C;  2X4H A;  3L00 A;  3K0L A;  2GWR A;  2VBZ A;  2CFX A;  2H27 A;  3MZY A;  3KP6 A;  3RKX A;  1ZGJ A;  3VEP A;  1LNW A;  5E1Z B;  4WCG A;  3ZMU A;  1XGO A;  4Q47 A;  3FMQ A;  5F6F A;  1TNS A;  4QLC U;  3ECO A;  4PDK A;  2FMY A;  4HF0 A;  1R58 A;  4CDG A;  4U88 A;  1QZY A;  5ILS A;  1KYW A;  1HSJ A;  3FXU A;  3F8F A;  2F2E A;  4A5N A;  4M9Z A;  4EJW A;  2FF4 A;  1YS6 A;  3BP8 A;  3H3Z A;  2M1B A;  1KGS A;  4IRG A;  2W85 A;  1WKM A;  4WWC A;  1MD0 A;  1R00 A;  1ZH5 A;  2F5D A;  1J7K A;  4EM2 A;  4HQE A;  1O3R A;  3JSP A;  2H6C A;  2A61 A;  2NYX A;  1OMI A;  2V9V A;  4G94 A;  4UUV A;  4XLP F;  4JK1 X;  3E6D A;  2QEN A;  3TO6 A;  4AIJ A;  1D8J A;  4AIK A;  3QU6 A;  3QP5 A;  5ICC A;  1F1Z A;  1T38 A;  1J59 A;  3J7A O;  2EV5 A;  1G3S A;  4NQW A;  1IUY A;  3ZN1 A;  1HW2 A;  2ESN A;  1TLH B;  1K79 A;  1O57 A;  1RIO H;  3IL2 A;  3REO A;  3ZMS A;  3IKT A;  2YX7 A;  4ZYH A;  5ICE A;  1BC7 C;  1WSU A;  4MEX F;  2Z3Y A;  3LAP A;  5ILV A;  3KP2 A;  4L18 B;  3CLO A;  5D8K B;  3V4G A;  2MH2 A;  2OZU A;  2IA2 A;  3WG9 A;  2DLL A;  5HLH A;  2MH9 A;  1TNT A;  2QQ9 A;  2XGX A;  2KRF A;  1TTY A;  4I2O A;  1IN5 A;  2MBF A;  2EFO A;  2XAH A;  3Q5F A;  1IAW A;  2DFI A;  4ZH4 F;  4BNC A;  4BQA A;  1P4X A;  3K2Z A;  4PCQ A;  4YG2 F;  1FT9 A;  3HSF A;  3KZY A;  2HS5 A;  4I0A A;  5EEH A;  1W7P D;  5LGN A;  3DQV C;  3U1D A;  3J80 K;  4CO8 A;  5LLQ A;  1H9G A;  3KCC A;  3DF8 A;  5K5O A;  4L0Z B;  2ETH A;  4M9X A;  5AIQ A;  2EB7 A;  4OIP F;  2DW4 A;  4WK8 F;  2XAG A;  4LG0 A;  1P6R A;  2O61 A;  5LGT A;  2R3S A;  4HW0 A;  3U9G A;  5L3B A;  2M45 A;  4HDU A;  1IRF A;  4BHP A;  1UB9 A;  4ETS A;  5D4S A;  4KIG A;  5DD4 A;  1OYW A;  1YS7 A;  1R5G A;  3IHU A;  2K7L A;  4UXN A;  2CO5 A;  4LK1 F;  3I4P A;  1STZ A;  2HTS A;  2XIG A;  2E1C A;  3PQK A;  2M5W A;  2ZME A;  3PQJ A;  4AIH A;  1DUX C;  4PZJ A;  2VE9 A;  3IWZ A;  5FO5 A;  2VON A;  3ZN0 A;  5J6X A;  2IJL A;  2GA2 A;  3M9A A;  1F5T A;  3JSO A;  1QPM A;  3ML6 A;  2RN7 A;  1W7P A;  3ZQ7 A;  2RQP A;  1UST A;  1ONV A;  1WI9 A;  3EQL F;  3Q9V A;  2H09 A;  3ZMZ A;  3WTZ A;  1RZ4 A;  1I5Z A;  3TO7 A;  2VN2 A;  4BH9 A;  2W57 A;  3N97 A;  1CF7 A;  3HUG A;  2DPU A;  1KU7 A;  2ISY A;  5JHU A;  1WRJ A;  1XGN A;  1KQ8 A;  2P5K A;  2L4A A;  4U7B A;  1SFE A;  1U5T A;  1YLF A;  1P2F A;  2LDU A;  1ZN2 A;  3LA7 A;  3SZT A;  2J5P A;  2DU9 A;  3COA C;  3V7C A;  2PI0 A;  4BXU A;  1GXP A;  3BJO A;  2PQ8 A;  2Z5U A;  2W25 A;  4L9V A;  1ZG1 A;  2JPC A;  1ZRF A;  5JI6 A;  5K5Q A;  3DXJ F;  4LB5 A;  4A6E A;  1HST A;  5D5W B;  4HLX A;  3C7J A;  4KIB A;  2H94 A;  4R8H A;  4YFK F;  3RKW A;  3IRQ A;  5E18 F;  5CYV A;  3N4M A;  1YG2 A;  3WGI A;  2VXZ A;  3SFZ A;  1REP C;  2WV0 A;  4RB3 C;  3SZP A;  2Q8K A;  3DP7 A;  1S29 A;  3KE2 A;  3F8N A;  4G7Z F;  4TV7 A;  4MQV A;  4WF2 A;  1KA8 A;  1HKT A;  1MJA A;  2MC3 A;  5J8F A;  2XAQ A;  5E1W A;  5A2Q K;  2HZT A;  4OIO F;  2O3F A;  4IRI A;  3R0J A;  1J2X A;  1R22 A;  3M8F A;  5LHI A;  5CVJ A;  5F1R A;  4LK0 F;  5L3E A;  3FF5 A;  5TRD A;  1X3U A;  2DO7 A;  1QQI A;  3P9C A;  2V6C A;  2WTE A;  3ULQ B;  3J81 K;  4FT8 A;  5E17 F;  4ESJ A;  2Y75 A;  3J80 Z;  1YYV A;  4M6Y A;  2V1D A;  2P6T A;  3KZZ A;  4YII A;  4G9Y A;  1GVJ A;  1Z6T A;  1FZP B;  3K9T A;  3F8C A;  2NNN A;  2G7U A;  2GQQ A;  4MHG A;  2GA1 A;  2CSO A;  4I09 A;  2XAJ A;  3WTU C;  3QPH A;  3F8M A;  2YPR A;  5E20 A;  1ZGA A;  4UVA A;  1U3E M;  5CVR A;  3RI4 A;  4ENK A;  3HSR A;  3JAM Z;  2D1H A;  1IN7 A;  1PUE E;  3GWZ A;  2HOE A;  2QWW A;  2K86 A;  3TQN A;  3GVA A;  5E1X A;  3F22 A;  1USS A;  4D0P A;  2ISZ A;  2OAZ A;  4HLY A;  1BIA A;  1DPR A;  1BC8 C;  2HKX A;  4K2E A;  2BBY A;  1EV7 A;  1KQ9 A;  3EUH A;  3LST A;  4KIF A;  4N0B A;  3BJA A;  4B8X A;  2HEO A;  4I98 B;  2A6E F;  3CDH A;  2ZCW A;  3C1D A;  5LEJ A;  3P9I A;  2PMH A;  1FYM A;  3WU1 B;  3MWM A;  4RGU A;  1Q1H A;  2Y48 A;  5J8C A;  1FSH A;  2JSC A;  1XSV A;  3NQO A;  4R1H A;  1XGS A;  2VBY A;  3P7N A;  3ZMV A;  3F23 A;  2CW0 F;  2EA4 A;  5LHH A;  1F9N A;  2UWM A;  2MLG A;  2R7F A;  1H9T A;  3DKW A;  4EJV A;  1G6N A;  3GF2 A;  2ZME B;  5EEG A;  1BOA A;  5ERI A;  1ZRC A;  2JRT A;  4IVN A;  5D5U B;  3JW4 A;  1JHF A;  2MA3 A;  5CVU A;  1J0R A;  2ZKZ A;  2QLZ A;  2OBP A;  2EFP A;  4LJZ F;  3V8K A;  3RIR A;  4RB0 A;  2FBH A;  3I5U A;  1XMK A;  1XB4 A;  4B09 A;  2RGV A;  1U5T C;  5HDG A;  2D1V A;  3KP3 A;  1HBX G;  4LLN A;  5DYM A;  4JQF A;  1PP7 U;  2NS0 A;  1TW3 A;  5FB2 A;  2VT3 A;  1O7L A;  1FX7 A;  2M8E A;  4Z2Y A;  1JHH A;  3I59 A;  4P9F A;  1R36 A;  2QBY B;  3WTT C;  1W4M A;  3WGG A;  4UVC A;  2E7X A;  3MEX A;  3L09 A;  4RGS A;  3I54 A;  5DCM B;  3F3X A;  1LQ1 A;  2AS5 F;  4ESB A;  3T0Y A;  5BOX A;  3GFM A;  2FEZ A;  2GXB A;  4N9H A;  1S7A A;  2IW5 A;  3CUQ B;  2VOP A;  4GXO A;  4AD9 A;  5L3G A;  2QZ8 A;  1FPQ A;  2E1N A;  3ABT A;  2UZK A;  2JPB A;  4HF1 A;  2XUB A;  4KIC A;  1U8R A;  1IW7 F;  4Q5S F;  1U2W A;  5HS8 A;  1P4W A;  4I01 A;  4NB5 A;  3R60 A;  1MGT A;  2CG4 A;  1HW1 A;  3ECH A;  4WXD A;  2VC0 A;  4M74 A;  1KU3 A;  4A5M A;  3BY6 A;  1SMT A;  3QRF F;  1IXR C;  1P92 A;  1B4A A;  1S8N A;  4I0B A;  2UXN A;  2ZNZ A;  3KET A;  3WGH A;  4EQQ A;  2NNY A;  1YW9 A;  2IA0 A;  3V8J A;  5HDK A;  3KLO A;  3K1P A;  4EVI A;  2DK5 A;  1B6A A;  3WTY C;  1S6L A;  3ZP5 A;  3E5Q A;  1T2K A;  2P6S A;  5BS6 A;  1YO5 C;  1F4K A;  1XSX A;  1IXC A;  5LBQ A;  5LRS A;  4RAZ A;  1T98 A;  2K27 A;  5BPI A;  3O6B B;  1K6O A;  3D5L A;  2V79 A;  2XKO A;  5E8I A;  2HDC A;  1SD5 A;  4ON0 A;  1HW5 A;  2EA2 A;  2BGC A;  1D5V A;  1YQA A;  4M6X A;  2IA1 A;  3R0A A;  1KU9 A;  2XKP A;  2KIU A;  4XSZ F;  2BV6 A;  2QVO A;  2O6G E;  3E6M A;  4KUM A;  1HKQ A;  4YFN F;  2FQ3 A;  2XAS A;  4HDV A;  1SD4 A;  1RUO A;  3W6J B;  2STT A;  1BM9 A;  3T8R A;  3TDZ C;  3ERE D;  3MAJ A;  1IRG A;  1BI0 A;  1H0M A;  3IC7 A;  3QU3 A;  2V1X A;  4L9T A;  4LB6 B;  1K78 B;  4LG0 B;  4M72 A;  2FOK A;  4M73 A;  1MZB A;  5HS9 A;  3VOD A;  3FX3 A;  3RPU A;  4MTD A;  1Y0U A;  3GEZ A;  3KEQ A;  4G6Q A;  4ESF A;  1QO0 D;  1U6G A;  3VFZ A;  2L02 A;  1I6X A;  3LA2 A;  3E6B A;  3L7W A;  2CWE A;  1T39 A;  4M71 A;  2O0Y A;  2J5O A;  2IVM A;  1R1V A;  3F6O A;  2L54 A;  5ED4 A;  5LHG A;  2EFQ A;  5FD6 A;  3BRO A;  4LFU A;  2LNB A;  4U0V A;  4WXH A;  2MLK A;  3FXQ A;  3NRV A;  4RGR A;  3GYH X;  3MFK A;  1LDJ A;  4U0Y A;  2F5E A;  4A0Y A;  1U78 A;  3H3U A;  5HLG A;  3KLN A;  1Z1D A;  5CLS A;  3ISP A;  4LLL A;  2ADU A;  1IN6 A;  3HTU A;  3RDI A;  3GLX A;  2CYY A;  4G6D A;  1CF7 B;  2D2W A;  2W84 A;  4BHB A;  4OIQ F;  4ZZD A;  2IPQ X;  1SD6 A;  4YIF A;  3F72 A;  1HQC A;  2ESH A;  3M8E A;  1SMY F;  3T1B A;  5KK1 A;  2CGP A;  4GO1 A;  1XN7 A;  2COM A;  3BDD A;  4AWX B;  3SQN A;  3JTG A;  1V3F A;  1IN8 A;  2RNJ A;  1LVA A;  4L9N A;  2GZW A;  3JTH A;  3E5U A;  1BJA A;  2VOD A;  2P4W A;  1BI2 A;  4KFC A;  1A04 A;  2P8T A;  3SXY A;  2Z33 A;  2RVC A;  2PFB A;  4HA8 A;  4ZYG A;  3MQ0 A;  4A0Z A;  4S04 A;  3F6V A;  3KP4 A;  4RB1 A;  2EJR A;  4GYI A;  4MNU A;  4S05 A;  3L2C A;  1SFX A;  3TO9 A;  1CGP A;  4IPA A;  2CQK A;  3FWE A;  3R61 A;  1LDK B;  2HQN A;  1BBY A;  3VB2 A;  4KT5 C;  2A69 F;  1FSE A;  3ZMD A;  5L3D A;  2XV4 S;  3FMS A;  2E7W A;  2QQA A;  2EV6 A;  4L5I A;  2RC4 A;  2RDP A;  1RUN A;  4KMF A;  1TQP A;  4N9I A;  2B0L A;  1QZZ A;  4HX4 A;  3BWG A;  1Z05 A;  5KVR A;  2QQB A;  1I1S A;  2WC2 A;  3DPT A;  4HAM A;  1FWZ A;  2MD5 A;  5DV5 A;  4OIN F;  3QAH A;  4L5J A;  2PG4 A;  2ELH A;  1BIB A;  1MKM A;  2PMU A;  5HLI A;  2A3S A;  3K69 A;  1BI3 A;  2P7V B;  1RI7 A;  2IP2 A;  3H92 A;  4KYW A;  4FX4 A;  3EDP A;  2PEX A;  2O8X A;  3ZMT A;  4ZYD A;  4EJO A;  1UCR A;  2HR3 A;  1ZRD A;  5FD5 A;  4ZZL A;  4MGR A;  1JXS A;  4Y15 A;  1XDS A;  1FYK A;  3I64 A;  4CHU A;  3ELK A;  3S2W A;  2A68 F;  4CZZ A;  4XSX F;  2G7H A;  3WTS C;  5DD8 A;  4A0X A;  4BAY A;  1S3J A;  5HDN A;  2DK8 A;  2JZY A;  3WE3 A;  1XD7 A;  4KN7 X;  1JE8 A;  3VOE A;  4EM1 A;  4Q4Z F;  1LDD A;  1SD7 A;  1DP7 P;  5FLX Z;  3L9F A;  2F5C A;  4P96 A;  1EH8 A;  2EFN A;  2FU4 A;  1OKR A;  3O2P E;  2OD5 A;  5DCF A;  1SFU A;  4UHT A;  3V7R A;  1ON1 A;  3WTW C;  2XRN A;  2YSR A;  2PN6 A;  2C6Y A;  3HHG A;  1R1T A;  3RJP A;  1P4A A;  3EYI A;  5AIP A;  3OOP A;  3LWF A;  4U0W A;  4WXC A;  5JVT A;  1C0W A;  3GFJ A;  1G3T A;  3RYP A;  1D3Y A;  1FBQ A;  2GAU A;  1MDM B;  2ACJ A;  2YR2 A;  2DBB A;  1GHC A;  5K1Y A;  2DTR A;  1IN4 A;  3HIF A;  4GCV A;  1K78 A;  1D8K A;  2LF7 A;  3GX4 X;  2H6B A;  4IHS A;  4P9U A;  5CVV A;  4WX9 A;  3G73 A;  4CXF A;  1FLI A;  3F21 A;  1TBX A;  2VBW A;  4IHT A;  3CUO A;  4U7D A;  3J81 Z;  1KQ0 A;  1WQ2 A;  3FM5 A;  2KJC A;  3B02 A;  2PBI A;  2GXG A;  2WWY A;  1V4R A;  1LEB A;  1G3Y A;  2VE8 A;  1J9I A;  4RS8 A;  3WOD F;  4EJU A;  3NEU A;  1E17 A;  3I59 B;  2K02 A;  5BPD A;  4HQM A;  1LEA A;  3HHH A;  1B9N A;  3KP7 A;  3SHF A;  1J5Y A;  5K5R A;  4UV8 A;  4ENM A;  3U2R A;  1DPU A;  1O3T A;  3P9K A;  3LQQ A;  2P5V A;  3BOQ A;  1FP1 D;  2G9W A;  4KN4 X;  3V8L A;  5D5X B;  4MEY F;  2FML A;  2FBK A;  2A5Y B;  3ABU A;  1OYI A;  2FNP A;  2VBX A;  3CUQ C;  3RPQ A;  3HRU A;  3BZ6 A;  4EJT A;  3MZH A;  3QP6 A;  4CIC A;  3PFI A;  4GYG A;  2GIV A;  4LLG F;  1E2X A;  1IXS B;  4RGX A;  5H6R A;  2HYF A;  3LFK A;  3WTX C;  3EYY A;  4BHC A;  1YFH A;  2RKH A;  1XCB A;  4OU0 A;  4XRF A;  1FY7 A;  4G8X A;  3OV8 A;  2QUF A;  2VOO A;  3IWF A;  1YIO A;  3BPX A;  1HXD A;  1ZRE A;  4HOB A;  3M1E A;  1W5S A;  3T5X A;  3DFG A;  2PLY A;  2QBY A;  5IT9 K;  1QGP A;  2LKP A;  5ICG A;  4PGH A;  1MJB A;  3DV8 A;  5DCM A;  4CGZ A;  4OMY A;  1PDN C;  3I0T A;  1ZAR A;  1LJ9 A;  1TW2 A;  3HRT A;  2DI3 A;  2ZBK A;  3GFL A;  4IJA A;  3JAM K;  3CUQ A;  2F5F A;  3BPV A;  6PAX A;  3RKY A;  2HKO A;  4IXA A;  2YX4 A;  4UV9 A;  1O7F A;  1I1G A;  1KYZ A;  2YU3 A;  2PJP A;  1ON2 A;  4HZF A;  1KU2 A;  2FRH A;  1R1U A;  3O3K A;  5LRR A;  3WE2 A;  3E3V A;  2LF8 A;  5H20 A;  2BE5 F;  3HTS B;  2OA4 A;  1FBS A;  1R7J A;  4A2U A;  3TKY A;  2EFW A;  1O3S A;  4H0E A;  2P5L C;  3KFW X;  2ZJ2 A;  3IRR A;  4Y17 A;  2L01 A;  4LMY A;  5IT3 A;  4P5O A;  3KEO A;  1J75 A;  4M9S A;  4I02 A;  1MDM A;  4EM0 B;  5FLX K;  2RV8 A;  4L0Y B;  2ZXJ A;  3I58 A;  4O6J A;  1ODD A;  1IZ1 A;  3RTR A;  2FXA A;  1ZLK A;  2OQG A;  2KIF A;  3EET A;  4RB2 C;  1GXQ A;  5LEK A;  2BEO A;  1RNL A;  3MCZ A;  3GUD A;  5L3F A;  4KDP A;  4IRH A;  3WU0 A;  1UFM A;  1FC3 A;  1FNN A;  4HV5 A;  4PGG A;  5FFZ A;  1U5T B;  1ZYR F;  2M87 A;  4LGW A;  4FX0 A;  3C18 A;  4L9J A;  3FXR A;  1G4D A;  1BN5 A;  1S7O A;  1G3W A;  1YW8 A;  4IF4 A;  1B9M A;  2DQL A;  2XHK A;  4EGY A;  1BI1 A;  3E97 A;  3HRS A;  5F64 A;  4OMZ A;  5L3C A;  4ASN A;  3TOA A;  4DNC A;  5E8G A;  5HOO A;  1I27 A;  4KNY A;  1W7P B;  3F8B A;  1IF1 A;  4A6D A;  2DPD A;  1K7A A;  3K1N A;  2JT1 A;  3GZ6 A;  2UXX A;  5FGM A;  3E6C C;  1EH7 A;  3TDU C;  2IRF G;  4RAY A;  1O3Q A;  1B1B A;  2HTJ A;  2Z99 A;  2NAZ A;  1ZLJ A;  3R6S A;  3TOB A;  1XDU A;  5H6Q A;  3G3Z A;  1EH6 A;  2KIM A;  2VC1 A;  4Q48 A;  3M7G A;  4ENJ A;  5DDG A;  1XSD A;  4EV0 A;  3B73 A;  2L3D A;  2A07 F;  1TQM A;  2M30 A;  3Q9S A;  2K4B A;  2R7D A;  3R4K A;  5JR3 A;  2DQR A;  2EV0 A;  2EWN A;  1XGM A;  4YFX F;  4E70 A;  4OOI A;  4O3M A;  1UHW A;  1AOY A;  2HYG D;  1XMA A;  3T8T A;  3LA3 A;  3LQR A;  4EMS A;  1MJ9 A;  3C3W A;  3FM3 A;  2V1U A;  3GXO A;  3HSE A;  1PP8 F;  3AAF A;  2QM3 A;  4XLN F;  1UHM A;  1W5T A;  2JTV A;  2LSO A;  1R23 A;  1R5H A;  2XRO A;  1NHA A;  1QNT A;  3DPL C;  4G7O F;  5DUI A;  1XCV A;  4XBF A;  2Q2E A;  2Z9O A;  3HOT A;  2EK5 A;  2Q0O A;  3CJN A;  4GGG A;  3GZ5 A;  2ZFW A;  3FMR A;  1Z7U A;  2TDX A;  4BYY A;  2OZ6 A;  1DDN A;  2AXL A;  4KMU X;  3BJ6 A;  4LD5 A;  4ZYE A;  2K4J A;  2O03 A;  1FOK A;  5JFR A;  4EGZ A;  5A2Q Z;  4I7H A;  3GFI A;  1B59 A;  3CO6 C;  4HX7 A;  5FFX A;  2HGC A;  2DT5 A;  1L0O C;  4A12 A;  5TJJ A;  2D45 A;  3DEU A;  1FP2 A;  2OU2 A;  5D5V B;  2QYO A;  4UNO A;  3I71 A;  2DAO A;  3CTA A;  2ZO4 A;  2FNA A;  3ROU A;  4F7Z A;  1VTN C;  5ICF A;  1AWC A;  1HKS A;  3FZV A; 
#chains in the Genus database with same CATH topology
 2LKS A;  1BW5 A;  5GPC A;  2MAB A;  2CU7 A;  4AVP A;  3HUG B;  2L7M P;  4RDU A;  4O5V A;  4EAT A;  1FYL A;  1T0F A;  4G7H F;  2P7C B;  3IKV A;  3W6K B;  3I53 A;  5LD2 C;  1WWX A;  4A3D J;  4CYD A;  2BY2 A;  1Z91 A;  1WJB A;  3CP8 A;  5ILU A;  5IT9 Z;  3G4S I;  1L3L A;  2XDV A;  2R4G A;  1QVU A;  5J4V A;  3GLL A;  3IAS 2;  3S93 A;  4JX6 A;  1WJC A;  3RYR A;  5D6E A;  4AUX A;  2QCO A;  5D8L B;  2OQR A;  4HX8 A;  3WTV C;  1JT6 A;  2XAF A;  5D6F A;  2P81 A;  4Y13 A;  2DXI A;  5JLX A;  4FHT A;  4HNV A;  1ETQ A;  1OYY A;  3G1M A;  1F43 A;  1OPC A;  2HQR A;  4XN0 A;  4A3C J;  4KA4 A;  2Y0M A;  1QBJ A;  4UVB A;  3V7S A;  3HKZ N;  5BNG A;  1YTY A;  4BU2 A;  3QPT A;  5HLT A;  4PUS A;  5HS7 A;  3QOP A;  2NRA C;  4JBA A;  2FE3 A;  4V2G A;  5CJ9 A;  1JGS A;  5DUK A;  4DQ2 A;  2KJB A;  3GO5 A;  3CC2 I;  3K4C A;  4GDF A;  4ZTF A;  1VQK I;  4MQ9 F;  2A6H F;  2FA5 A;  4OIR F;  3GW2 A;  4XK4 A;  1MIJ A;  1ZG5 A;  4P55 A;  1TWH J;  5BMZ A;  2XVC A;  1TQI A;  3HRM A;  1RRJ A;  1ULY A;  2FSW A;  1FIA A;  2W24 A;  3G6E I;  3LL7 A;  1Z9C A;  1T6S A;  1OQY A;  2W00 A;  4R79 A;  1HOM A;  2EIM H;  2R5Z B;  3K1M A;  2KKO A;  2KMU A;  2ME0 A;  4LIT A;  5CVI A;  3TGN A;  4CCL A;  3S2H J;  4AYB N;  4ENN A;  1WH7 A;  2VT2 A;  3H0D A;  3CMY A;  1B72 A;  2HVR A;  5AON A;  2STW A;  1IDZ A;  1ZHF A;  5FKK A;  2VAS A;  1ZAO A;  4QWQ A;  3FXJ A;  2L4M A;  4HYE A;  2V26 A;  1ZG3 A;  3CO7 C;  2HI3 A;  1FBU A;  3FXL A;  2VQH A;  3FHZ A;  4HV6 A;  1SAX A;  3HOS A;  2A6T A;  3OOU A;  4Y4R A;  3E5X A;  2HFH A;  4NHJ A;  1YW7 A;  1SVL A;  2HOT A;  1BW6 A;  3LSP A;  2X0L A;  2KQR A;  3KP5 A;  2ME6 A;  3LSJ A;  3DLL F;  3D0S A;  3TED A;  5F0C A;  4M3E A;  1LB2 A;  4MTE A;  3LAJ A;  2ZNY A;  3FHN A;  2IT0 A;  5LGU A;  1OCT C;  3DU5 A;  1Z6R A;  4HF2 A;  3PNV A;  3FKI J;  1U9O A;  2FBI A;  4HBL A;  5EZH A;  5BQT A;  1EF4 A;  2HWV A;  3CF2 A;  1F36 A;  5DEQ A;  3WHB A;  4AU7 A;  1OR7 A;  3K2A A;  3ZPL A;  4U87 A;  3S32 A;  3HYI A;  5D4R A;  2BYV E;  1MBJ A;  2X4H A;  5HVQ C;  4PSW A;  1A36 A;  2VPL A;  2R7V A;  2Y69 H;  1VFC A;  3L00 A;  3H36 A;  3K0L A;  2GWR A;  3A0H C;  2VBZ A;  2CFX A;  2H27 A;  2OPT A;  3MZY A;  3KP6 A;  3IV5 A;  1WJD A;  2OCE A;  1EKE A;  3RKX A;  4ZDO A;  1ZGJ A;  3VEP A;  4A3M J;  1LNW A;  5E1Z B;  4WCG A;  3ZMU A;  1XGO A;  2HPI A;  3K4M A;  1A6I A;  4KJZ A;  4Q47 A;  2IGN A;  2DOD A;  2L7F P;  3AG3 H;  3FMQ A;  5EGO A;  5F6F A;  1TNS A;  4QLC U;  3ECO A;  1RR8 C;  4PDK A;  2FMY A;  4HF0 A;  4RAG A;  1R58 A;  4B3A A;  2LMD A;  4CDG A;  4U88 A;  1QZY A;  3S8P A;  2VKH A;  2ZXH A;  1KYW A;  5ILS A;  3BQZ A;  4NNJ A;  3TW7 A;  1HSJ A;  3FXU A;  3F8F A;  2F2E A;  1KON A;  4A5N A;  3A2K A;  3OYM A;  4M9Z A;  4EJW A;  5H2F C;  2FF4 A;  4XID A;  1YS6 A;  1NK3 P;  3BP8 A;  3H3Z A;  2M1B A;  3TP3 A;  2BVM A;  1KGS A;  3LSR A;  2EZL A;  4IRG A;  3ZQH A;  5FRO A;  2W85 A;  1WKM A;  3BZK A;  4WWC A;  3ASO H;  1MD0 A;  4I99 C;  3I56 I;  1FJL A;  1R00 A;  1ZH5 A;  2F5D A;  1J7K A;  4FE4 A;  4EM2 A;  4HQE A;  2VKD A;  3NAU A;  3WU2 C;  4F91 B;  1O3R A;  3JSP A;  2H6C A;  5J1Y A;  2A61 A;  4C2M J;  1E3H A;  3LNQ A;  2NYX A;  4XON A;  4DJA A;  1OMI A;  2V9V A;  2QF7 A;  4G94 A;  4CSW A;  2PMZ N;  4DBQ A;  4UUV A;  2AQF A;  4XLP F;  4JK1 X;  3E6D A;  2QEN A;  5K7F A;  3PIO F;  3H5N A;  5GAE J;  3TO6 A;  4AIJ A;  2FD5 A;  3FIS A;  3HBL A;  1D8J A;  2VJ5 A;  2W82 A;  3QP5 A;  3QU6 A;  4AIK A;  5ICC A;  1F1Z A;  1T38 A;  2XGD A;  1XX5 A;  1J59 A;  3J7A O;  2VL8 A;  2HYJ A;  4C2T A;  2EV5 A;  3L2W A;  1G3S A;  3DBH B;  4NQW A;  1IUY A;  2X6W A;  3ZN1 A;  1HW2 A;  1RR7 A;  1LUJ B;  2ESN A;  2O5R A;  1TLH B;  2M4G A;  4OWR B;  2CFO A;  5M3M J;  1K79 A;  1O57 A;  4A93 J;  1RIO H;  3IL2 A;  2JRM A;  1NH3 A;  1R4N B;  1W36 C;  3REO A;  1JKR C;  3OYF A;  1YX3 A;  4UUS A;  3BG5 A;  2NOJ B;  1D0Z A;  5M5W J;  1R5I D;  5M5X J;  1Q1V A;  3ZMS A;  3MN2 A;  4XLE A;  3IKT A;  2EZI A;  2O7O A;  1TP4 A;  2X1D A;  2FJ1 A;  1HLV A;  4LIV A;  2YX7 A;  2XPU A;  3I9V 2;  4ZYH A;  4QTR A;  5ICE A;  1FTT A;  1IV8 A;  1BC7 C;  2M0C A;  3FIW A;  3J7Z I;  1WSU A;  4MEX F;  2Z3Y A;  1U0J A;  3LAP A;  3K4J A;  3HXL A;  5ILV A;  3KP2 A;  4L18 B;  4DYC A;  3W2V A;  3CLO A;  5D8K B;  3V4G A;  4FTH A;  1MH3 A;  2MH2 A;  2OZU A;  2IA2 A;  2H8W A;  3BR3 A;  3EUA A;  3WG9 A;  3S3M A;  2DLL A;  2XB5 A;  5HLH A;  3HOU J;  3DEE A;  1ZGW A;  4J01 A;  2MH9 A;  1YRN A;  5IP7 J;  1TNT A;  2QQ9 A;  5DM6 F;  3FXM A;  2XGX A;  2KRF A;  2L7Z A;  1TTY A;  2RNG A;  4I2O A;  2VIX A;  1OCP A;  2W1O A;  2CV0 A;  1IN5 A;  5M3F J;  2MBF A;  2LG4 A;  3CJQ B;  2EFO A;  2XAH A;  3Q5F A;  1IAW A;  2JVG A;  1AU7 A;  1VI0 A;  1X2M A;  2DFI A;  2DA7 A;  2F5V A;  4ZH4 F;  4BNC A;  3RZO J;  3CCU I;  4BQA A;  1DGW Y;  1IV6 A;  1V55 H;  1ETW A;  1P4X A;  3K2Z A;  4PCQ A;  1HA8 A;  3K6G A;  1KZH A;  2VB6 A;  3CC4 I;  4YG2 F;  1FT9 A;  3HSF A;  3KZY A;  2HS5 A;  2KIS A;  4I0A A;  5EEH A;  1W7P D;  1SAU A;  5LGN A;  3DQV C;  1HCR A;  2NVX J;  3U1D A;  2X9D A;  3J80 K;  2CS3 A;  3C2G A;  4A3K J;  1K6Y A;  4XLH A;  4CO8 A;  3I55 I;  5LLQ A;  2GOM A;  1H9G A;  3KCC A;  3JRH A;  3DF8 A;  5K5O A;  3BLY A;  1BR4 A;  1OCR H;  4BJ6 C;  1VQ9 I;  4UB8 C;  4L0Z B;  1H8A C;  1X4O A;  2ETH A;  2XAU A;  3UNG C;  4M9X A;  2DT7 B;  5AIQ A;  2EB7 A;  3ZQG A;  1JTY A;  1PUF A;  4OIP F;  1QHG A;  4QPQ A;  2DW4 A;  4BUP A;  2XAG A;  3FBN B;  4LG0 A;  4WK8 F;  1YOV B;  1P6R A;  2O61 A;  5LGT A;  2R3S A;  4BBR J;  4HW0 A;  3U9G A;  5L3B A;  2M45 A;  3LOC A;  4HDU A;  4Y7N J;  1IRF A;  2OCC H;  4BHP A;  1UB9 A;  2KLO A;  2Q1Z B;  4ETS A;  5D4S A;  4KIG A;  2YS9 A;  1B8I A;  1E3O C;  5DD4 A;  1ETY A;  1JUP A;  1OYW A;  1YS7 A;  1R5G A;  3IHU A;  2K7L A;  4UXN A;  2CO5 A;  3KYL A;  4LK1 F;  3I4P A;  1ZR2 A;  3GBG A;  3QWL A;  1STZ A;  2HTS A;  2XIG A;  2HOA A;  3S1R J;  2E1C A;  3PQK A;  3RQI A;  2M5W A;  2ZME A;  2VUM J;  3D5S C;  3PQJ A;  1W36 D;  4AIH A;  4CCO A;  2ELK A;  1Y6I A;  3PUB A;  1DUX C;  2IS2 A;  4PZJ A;  2VXD A;  4C3J J;  3X2Q H;  3ZCO A;  1UMQ A;  2O9L A;  2VE9 A;  3IWZ A;  3PO3 J;  5FO5 A;  4D7M A;  1QZE A;  4BGD A;  2QSF X;  2VON A;  1B72 B;  2NVT J;  3ZN0 A;  4AVZ A;  5J6X A;  2I10 A;  2IJL A;  2GA2 A;  3H3V K;  3G1L A;  4A3E J;  3M9A A;  1F5T A;  2IGK A;  3JSO A;  5TGT A;  1QPM A;  3ML6 A;  2BXY A;  2RN7 A;  4ABZ A;  1W7P A;  3ZQ7 A;  2KIQ A;  2HNH A;  3L1P A;  2RQP A;  1UST A;  1ONV A;  1WI9 A;  3GTG J;  1UEL B;  2X6Y A;  1EJ9 A;  3EQL F;  4CA0 A;  1POG A;  3Q9V A;  1VQM I;  2H09 A;  3ZMZ A;  2V4J C;  3VPR A;  4A3B J;  2R7R A;  3WTZ A;  1RZ4 A;  3CCJ I;  1IO2 A;  1I5Z A;  3TO7 A;  2VN2 A;  4BH9 A;  2P0W A;  2W57 A;  2X1C A;  4BEH A;  1U8B A;  3N97 A;  1JUS A;  3JRA A;  3KYC B;  2LVS A;  1CF7 A;  3HUG A;  2DPU A;  3S3N A;  1TWA J;  1KU7 A;  3BTL A;  2E35 A;  2ISY A;  5JHU A;  1WRJ A;  1XGN A;  1KQ8 A;  4HEA 2;  1XMX A;  2P5K A;  2L4A A;  4U7B A;  1SFE A;  2Y9Y A;  1U5T A;  3ABL H;  3OL4 A;  1YLF A;  1P2F A;  2LDU A;  3LSI A;  4FET A;  4Z6Y A;  2JA6 J;  1ZN2 A;  3LA7 A;  3CCM I;  3SZT A;  2J5P A;  2BXZ A;  3OYC A;  2LTP A;  4D9J A;  2DU9 A;  3COA C;  4IOA F;  2XRL A;  2OC6 A;  3V7C A;  3BCA A;  2E1M C;  4RA2 A;  4BXU A;  2PI0 A;  1GXP A;  2JJ7 A;  4RLF A;  2KP6 A;  5J3L A;  2E5N A;  2CUE A;  3HZJ A;  4A3F J;  3BJO A;  2PQ8 A;  3G71 I;  2Z5U A;  1TWG J;  2W25 A;  4L9V A;  2E2J J;  4BY1 J;  2M7A A;  1ZG1 A;  2JPC A;  1Y8R B;  3D1N I;  1ZRF A;  4E7I A;  4C9Y A;  5JI6 A;  5K5Q A;  4NUB A;  3DXJ F;  4LB5 A;  3DTE A;  4IQ4 A;  3L2R A;  1FMV A;  1TT0 A;  3BR1 A;  4MFD A;  4A6E A;  4X1E A;  2LK2 A;  1HST A;  5D5W B;  3H1C A;  4HLX A;  3C7J A;  4KIB A;  3L2U A;  2H94 A;  4R8H A;  4YFK F;  3RKW A;  5JLW A;  3JRC A;  3IRQ A;  5E18 F;  5CYV A;  3N4M A;  1YG2 A;  4F93 B;  2NVQ J;  5J1U A;  4E7S A;  4XOR A;  1QPI A;  3WGI A;  2VXZ A;  3SFZ A;  1REP C;  2WV0 A;  4RB3 C;  4HNU A;  3SZP A;  1J09 A;  2WA0 A;  2Q8K A;  3DP7 A;  4GFB A;  1ZTR A;  2I8D A;  5CPR B;  1NG6 A;  1S29 A;  3KE2 A;  3F8N A;  4G7Z F;  5GAG J;  4TV7 A;  1Z3X A;  4MQV A;  4WF2 A;  1X3Z B;  1KA8 A;  3AL0 C;  4B4C A;  1O4X A;  1HKT A;  5B3S H;  2DA1 A;  3IUO A;  3SEQ A;  1MJA A;  2MC3 A;  3TMO A;  5J8F A;  1FOX A;  2XAQ A;  1I50 J;  5E1W A;  2HZT A;  5A2Q K;  4OIO F;  2EBI A;  2O3F A;  4IRI A;  3R0J A;  1J2X A;  4DZJ A;  1JJ8 C;  2PJR B;  3RSN A;  1R22 A;  3M8F A;  3Q0V A;  5LHI A;  4E7J A;  2Q2E B;  5CVJ A;  3FK6 A;  5F1R A;  4LK0 F;  5L3E A;  4W97 A;  5FLM J;  4CZC A;  3OYG A;  1UZC A;  3FF5 A;  5TRD A;  1TL8 A;  2DA4 A;  1X3U A;  2JA5 J;  2R7Q A;  2DO7 A;  1QQI A;  5EDN A;  1NTC A;  3E0J B;  3P9C A;  2V6C A;  3B6A A;  2LD5 A;  2WTE A;  3ULQ B;  3GTO J;  4BJT A;  3BR0 A;  4F55 A;  5KHD A;  3J81 K;  4FT8 A;  2DCE A;  5E17 F;  4ESJ A;  1DQU A;  1E3P A;  1V54 H;  2Y75 A;  1LE8 B;  3J80 Z;  2F48 A;  1YYV A;  3EUK L;  4M6Y A;  2V1D A;  2P6T A;  3K70 D;  3KZZ A;  2ZME C;  1I3Q J;  4YII A;  4G9Y A;  1GVJ A;  3DBL B;  4F52 A;  3LSM A;  1MND A;  4B1R A;  2Y30 A;  1Z6T A;  4NC6 A;  1FZP B;  3DPU A;  1SVO A;  3MD2 A;  1E0E A;  1VZ0 A;  2XF6 A;  3K9T A;  3F8C A;  2NNN A;  4DIQ A;  1Z67 A;  2G7U A;  3VYR B;  4Y52 J;  1PUF B;  2GQQ A;  4MHG A;  4A3L J;  2GA1 A;  4S0H B;  2CSO A;  2ZB9 A;  1MSE C;  4UB6 C;  2F6C A;  1FIP A;  4FAS D;  3MKW B;  3S15 J;  4I09 A;  3S2D J;  3ZQQ A;  2XAJ A;  1AA7 A;  3D5R C;  3WTU C;  3QPH A;  3F8M A;  2YPR A;  1YJ9 I;  3ZQC A;  1VF9 A;  2DFE A;  5E20 A;  1ZGA A;  5C44 J;  2K9M A;  4YIR X;  1JUM A;  3Q3S A;  4E4H A;  4CYC B;  4UVA A;  1U3E M;  1RKT A;  5CVR A;  3RI4 A;  3FBI B;  4ENK A;  2M7B A;  3HSR A;  4NDL A;  3GTK J;  3JAM Z;  3JR9 A;  2D1H A;  1IN7 A;  1PUE E;  3GWZ A;  3RPU D;  4KIS A;  2HOE A;  2DMT A;  4J00 A;  2QWW A;  4RLQ A;  2K86 A;  3TQN A;  3GVA A;  5E1X A;  2H8R A;  3F22 A;  3CDI A;  1USS A;  2L5Q A;  4D0P A;  2ISZ A;  4BBS J;  2OAZ A;  1TWF J;  4HLY A;  1ETV A;  3AG1 H;  2ZJR F;  1BIA A;  4BQN A;  3JRB A;  1DPR A;  2KDO A;  1BC8 C;  2HKX A;  4K2E A;  4E7H A;  2BBY A;  3S14 J;  1EV7 A;  3EUH A;  1KQ9 A;  2LBF B;  3ZGK A;  3H9Q A;  3LST A;  2ECC A;  1ETO A;  4KIF A;  5F0F A;  4N0B A;  3WHC A;  1AHD P;  3BJA A;  4B8X A;  3NAR A;  3OYD A;  2HEO A;  4I98 B;  2A6E F;  3IH4 A;  3CDH A;  4XM3 A;  2HXI A;  2ZCW A;  3C1D A;  3A01 B;  5LEJ A;  3M4O J;  1WPK A;  2WBM A;  4DYR A;  3OYH A;  4RM2 A;  2KT0 A;  2KZG A;  3P9I A;  2PMH A;  4QIW N;  1FYM A;  3WU1 B;  1YI2 I;  3MWM A;  4RGU A;  1Q1H A;  2Y48 A;  5J8C A;  1FSH A;  2JSC A;  3QPS A;  1XSV A;  3NQO A;  4R1H A;  1YHQ I;  4OAZ A;  1XGS A;  2VBY A;  1MBK A;  3HG9 A;  2IXS A;  3P7N A;  3ZMV A;  4QPO A;  3F23 A;  2CW0 F;  2EA4 A;  4PFO A;  4DW6 A;  5LHH A;  1F9N A;  4IOC F;  2UWM A;  1W0U A;  2MLG A;  2R7F A;  1H9T A;  4BAC A;  3DKW A;  4EJV A;  1G6N A;  3GF2 A;  1QA6 A;  2ZME B;  5EEG A;  3QYE A;  1BOA A;  1X19 A;  3IH3 A;  3ESW B;  5ERI A;  1ZRC A;  3KPH A;  4IHY A;  2JRT A;  3CDL A;  4IVN A;  5D5U B;  3ZQL A;  3JW4 A;  1JHF A;  4OAY A;  1MMG A;  2EZK A;  4ZJZ A;  2MA3 A;  5CVU A;  1J0R A;  2ZKZ A;  5FKO A;  1IRZ A;  1XG1 A;  4KIT B;  2QLZ A;  2OBP A;  2EFP A;  3GTQ J;  4LJZ F;  3V8K A;  3VWB A;  2R7S A;  3CCS I;  3RIR A;  3N05 A;  2QGU A;  4PJM A;  4RB0 A;  2FBH A;  2JQ7 A;  1T8I A;  3I5U A;  2MD0 A;  1XMK A;  1QHH D;  2AHQ A;  1XB4 A;  4B09 A;  4LG3 A;  2OTL I;  2RGV A;  1U5T C;  5HDG A;  2D1V A;  1HF0 A;  3KP3 A;  1HBX G;  4LLN A;  5DYM A;  4JQF A;  1PP7 U;  3KX2 A;  4LIU A;  2NS0 A;  2LLK A;  1TW3 A;  5B66 C;  5FB2 A;  2VT3 A;  2QSH X;  4N4N B;  3H5R A;  1O7L A;  1FX7 A;  5F0H A;  2M8E A;  4Z2Y A;  1JHH A;  1ENH A;  3I59 A;  4P9F A;  1XPX A;  1R36 A;  3BR6 A;  3A03 A;  2QBY B;  4PJN A;  2V1N A;  2NVU B;  3AFH A;  5E3M A;  2DMQ A;  3WTT C;  1W4M A;  3KIO A;  1NG7 A;  4UVC A;  3WGG A;  2E7X A;  3MEX A;  3L09 A;  2MFZ A;  2GOX B;  2CJJ A;  4RGS A;  3I54 A;  2DYS H;  5DCM B;  3F3X A;  1I3A A;  1LQ1 A;  2UV1 A;  2L2O A;  2AS5 F;  4ESB A;  3T0Y A;  2CH0 A;  2EIJ H;  5BOX A;  2VQG A;  1JJ6 C;  3NWT A;  3GFM A;  3DLA A;  2FEZ A;  1VQ7 I;  2GXB A;  4N9H A;  5E79 C;  2L7K A;  1S7A A;  1WZ2 A;  2IW5 A;  3CUQ B;  2ZC2 A;  5KAF C;  2VOP A;  4GXO A;  4AD9 A;  5L3G A;  1QVT A;  1FPQ A;  1ZK8 A;  2E1N A;  3ABT A;  2QZ8 A;  3QYF A;  2UZK A;  2JPB A;  2HVS A;  3OMY A;  4HF1 A;  2KRH A;  2XUB A;  1VND A;  2CV1 A;  1VQO I;  2CMP A;  4KIC A;  4G6T B;  2H1K A;  4C30 A;  1U8R A;  1IW7 F;  4Q5S F;  1U2W A;  4DBR A;  2HQ5 A;  5HS8 A;  1P4W A;  4I01 A;  4NB5 A;  3MVP A;  2LBF A;  3R60 A;  1MGT A;  1HW1 A;  2CG4 A;  3ECH A;  4WXD A;  2VC0 A;  3QOD A;  2OUM A;  2V7F A;  4M74 A;  1KU3 A;  4A5M A;  2E60 A;  2JMW A;  3BY6 A;  1SMT A;  4YEJ A;  3QRF F;  1IXR C;  1P92 A;  1B4A A;  1S8N A;  4I0B A;  4X0G A;  3ZRG A;  4E6K G;  2UXN A;  2ZNZ A;  3KET A;  3WGH A;  4EQQ A;  4XQF A;  2NNY A;  3OWT A;  1Y1V J;  1YW9 A;  2IA0 A;  2ZSI B;  1OCZ H;  1X3W B;  3V8J A;  5HDK A;  4HSR A;  4BQO A;  1MW7 A;  1R4M B;  3KLO A;  3AG4 H;  3BTJ A;  3K1P A;  2DK5 A;  4EVI A;  4FE7 A;  1B6A A;  5HNF A;  3WTY C;  1S6L A;  2HDD A;  2X6X A;  3ZP5 A;  3E5Q A;  1T2K A;  3OIP A;  2P6S A;  2LYC A;  5BS6 A;  1YO5 C;  4BXF A;  1F4K A;  3F9K A;  2HOS A;  1AKH A;  1XSX A;  2VQL A;  1IXC A;  5FRM A;  5LBQ A;  5LRS A;  4RAZ A;  2HQA A;  3OYL A;  1T98 A;  1UG0 A;  2K27 A;  1MSF C;  5BPI A;  3O6B B;  2V6E A;  1K6O A;  3D5L A;  2V79 A;  1TWC J;  2KZV A;  2L9N A;  3QYB A;  1WFX A;  3PSF A;  1Y1W J;  5CQG A;  2XKO A;  2DMN A;  4FIS A;  3M3Y J;  5E8I A;  3KEY A;  2HDC A;  3CC7 I;  5EGO B;  1SD5 A;  4UUT A;  4ON0 A;  3HKZ A;  3CCE I;  4II2 A;  1V5G A;  1HW5 A;  2EA2 A;  2BGC A;  4RMN A;  1D5V A;  3FK7 A;  1JT0 A;  1YQA A;  3MKL A;  3HPH A;  2RAE A;  5KCM A;  2JN6 A;  4M6X A;  2IA1 A;  5M5Y J;  3R0A A;  4CUG A;  1KU9 A;  2XKP A;  3KYD B;  2VLA A;  1EA3 A;  2KIU A;  4XSZ F;  2BV6 A;  2O8K A;  2QVO A;  4QSH A;  2O6G E;  3E6M A;  4KUM A;  2DDA A;  1HKQ A;  2N8G A;  4YFN F;  4C2U A;  2FQ3 A;  2XAS A;  3FXK A;  5K7H A;  1SFK A;  5J40 A;  4HDV A;  1D1C A;  1SD4 A;  1RUO A;  2V9P A;  1I39 A;  3W6J B;  2STT A;  1BM9 A;  3T8R A;  3TDZ C;  1IUF A;  1RKW A;  3SDB A;  3I3L A;  3ERE D;  3ASN H;  1Z0X A;  3MAJ A;  1X58 A;  3DBR B;  4XRM A;  1IRG A;  1BI0 A;  1X1P A;  1H0M A;  3PSI A;  4NQW B;  3IC7 A;  3QU3 A;  3OYA A;  2HZD A;  3K4B A;  4BEH B;  3P5J A;  3SZG A;  4BS9 A;  2WAD A;  4YRV A;  2V1X A;  4L9T A;  5GAD J;  4LB6 B;  1YX5 A;  1K78 B;  4LG0 B;  4UY8 I;  4M72 A;  1Y0N A;  2FOK A;  4M73 A;  1MZB A;  1SEU A;  2IS4 A;  1V5F A;  3MKY B;  5HS9 A;  3VOD A;  3FX3 A;  3K7A J;  2ID6 A;  2Z16 A;  2IGO A;  3RPU A;  4MTD A;  1Y0U A;  3GEZ A;  3KEQ A;  4NC7 A;  4G6Q A;  3VYU B;  4ESF A;  1QO0 D;  2DTZ A;  2K3F A;  1U6G A;  3BG9 A;  3VFZ A;  3GTM J;  2L02 A;  1I6X A;  1YIJ I;  1UAA A;  1HDP A;  3OYK A;  3LA2 A;  4DGW B;  1JKP C;  3E6B A;  4XKC A;  1N78 A;  2KRC A;  3L7W A;  2CWE A;  2RQQ A;  1SVM A;  5FKN A;  1T39 A;  4M71 A;  2XGC A;  5F04 A;  2O0Y A;  3O8H A;  2J5O A;  2KHM A;  2IVM A;  3SDG A;  1R1V A;  2R7O A;  2K9S A;  1X1A A;  3F6O A;  2L54 A;  2K3P A;  4Y3O A;  5ED4 A;  5LHG A;  2EFQ A;  5FD6 A;  1R49 A;  3S1N J;  3BRO A;  3HC7 A;  1APL C;  4LFU A;  2LNB A;  4U0V A;  1BR2 A;  2Z1D A;  4WXH A;  2MLK A;  2ID3 A;  3WG7 H;  1GDT A;  3FXQ A;  3NRV A;  4RGR A;  4XLC A;  3BTI A;  1OFC X;  3J7Y J;  3GYH X;  1DU6 A;  2M3A A;  2R5Z A;  2QA4 I;  3MFK A;  1ITY A;  1BJZ A;  1LDJ A;  1VQP I;  4U0Y A;  3V42 A;  2F5E A;  2KFD A;  4A0Y A;  1VQ8 I;  4HST A;  1U78 A;  3H3U A;  5HLG A;  2COB A;  4CH7 A;  3KLN A;  3JRE A;  1Z1D A;  5CLS A;  3JRF A;  3ISP A;  4LLL A;  4GRI A;  2DA5 A;  3H5A A;  2ADU A;  2IAI A;  1IN6 A;  3HTU A;  4M3G A;  4HPQ A;  3RDI A;  3ZQF A;  3GLX A;  2CYY A;  4G6D A;  1CF7 B;  2DJI A;  2R7X A;  1OCC H;  1BR1 A;  4RBO A;  1MH4 A;  3ONQ A;  1VQ4 I;  2PMZ A;  4IHV A;  2D2W A;  4V2F A;  2W84 A;  4BHB A;  4OIQ F;  4ZZD A;  2IPQ X;  2VKE A;  2R93 J;  1SD6 A;  4YIF A;  4H4K C;  3F72 A;  1HQC A;  2LR8 A;  2ESH A;  3M8E A;  2OF7 A;  4E7K A;  1SMY F;  3T1B A;  5KK1 A;  2CGP A;  4XMY A;  1Z77 A;  3LSK A;  2EQR A;  4GO1 A;  1XN7 A;  2NS8 A;  1VQ6 I;  2XC7 A;  2COM A;  3BDD A;  3OIO A;  5DTD A;  3EUH C;  4AWX B;  3I4M J;  3VSK A;  4MIM A;  3SQN A;  2E5Z A;  3K4K A;  5IOY A;  3JTG A;  1V3F A;  2CUJ A;  1IN8 A;  2RNJ A;  3L2V A;  1LVA A;  1N75 A;  4L9N A;  5JVG F;  1Y8Q B;  2GZW A;  1VQ5 I;  3K4L A;  1ETK A;  3JTH A;  2TRT A;  3E5U A;  4ZDL A;  1BJA A;  2VOD A;  3H35 A;  4DOZ A;  4C3I J;  2P4W A;  1BI2 A;  3TW6 A;  5IYD J;  1K83 J;  1S7E A;  1ACI A;  3HPG A;  4AC0 A;  2Y0S N;  1NK2 P;  4KFC A;  1A04 A;  2P8T A;  3SXY A;  2IGM A;  3H0G J;  3OYI A;  2Z33 A;  1IGN A;  1YE9 A;  1ZR4 A;  2RVC A;  2PFB A;  3DTK A;  3HEF A;  4HA8 A;  2IS6 A;  4ZYG A;  4XOP A;  2XPV A;  2V9K A;  1GUU A;  1R6R A;  3MQ0 A;  4A0Z A;  4S04 A;  3F6V A;  3HB9 A;  4XLA A;  3KP4 A;  4RB1 A;  3B6C A;  2AQE A;  1N77 A;  2EJR A;  4GYI A;  4MNU A;  2CRG A;  4S05 A;  3VDX A;  3L2C A;  1S72 I;  1SFX A;  4ZDP A;  4ZC3 A;  2HU9 A;  3TO9 A;  1CGP A;  5IY5 H;  4IPA A;  2E1O A;  3UR3 C;  2CQK A;  3FWE A;  3R61 A;  1LDK B;  5GAH J;  2HQN A;  2M2E A;  1ERD A;  3CQZ J;  3DEW A;  4XKB A;  1BBY A;  2L9R A;  3VB2 A;  4KT5 C;  5KNL A;  1WJA A;  2A69 F;  1FSE A;  3ZMD A;  3HOV J;  1MBG A;  2XV4 S;  5L3D A;  1A6Q A;  3FMS A;  2E7W A;  2QQA A;  1HC8 A;  2EV6 A;  2B63 J;  4L5I A;  5FJ8 J;  2RC4 A;  2RDP A;  1RUN A;  1SC7 A;  1QU3 A;  4KMF A;  1TQP A;  4N9I A;  4CCK A;  1BOB A;  4ANJ A;  2X48 A;  1WJE A;  2B0L A;  4AM3 A;  1QZZ A;  1W5C C;  4HX4 A;  3BWG A;  1Z05 A;  5KVR A;  2QQB A;  1I1S A;  2WC2 A;  3DPT A;  3CD6 I;  3CMA I;  4HAM A;  1FWZ A;  2MD5 A;  5DV5 A;  1WJ5 A;  5KAI C;  4OIN F;  3C2B A;  3QAH A;  4BXX J;  1S5L C;  4L5J A;  5TIS C;  3OS2 A;  2PG4 A;  3H9J A;  2ELH A;  1BIB A;  1MKM A;  2IS1 A;  3HOY J;  4BE1 A;  2L0K A;  2CQ7 A;  3DU6 A;  1R9T J;  1P7J A;  2HXO A;  1MMA A;  2PMU A;  5HLI A;  2A3S A;  2BHY A;  3K69 A;  1BI3 A;  2P7V B;  2D5V A;  3GTP J;  1RI7 A;  2IP2 A;  3M07 A;  3H92 A;  1RPW A;  3W2W A;  3OL3 A;  4KYW A;  4FX4 A;  2EIN H;  3EDP A;  2PEX A;  2W7N A;  2O8X A;  2WAQ A;  4E7Z A;  3GTL J;  1YRN B;  4IKF A;  1MNM C;  3ZMT A;  4ZYD A;  4EJO A;  1U9N A;  1T95 A;  1UCR A;  3HM5 A;  2L9V A;  2PX9 A;  2HR3 A;  1ZRD A;  3OIQ A;  5FD5 A;  3A02 A;  4ZZL A;  2BY3 A;  4MGR A;  3S3O A;  1JXS A;  2X1E A;  1MBE A;  4Y15 A;  3BT9 A;  2Y2Z A;  1XDS A;  3HOX J;  1TZL A;  5FKM A;  2WAF A;  4AID A;  1IC8 A;  1FYK A;  2DT6 A;  3I64 A;  4CHU A;  2VJJ A;  1IG7 A;  1WJF A;  2CV2 A;  4PK4 A;  3BR5 A;  3ELK A;  3S2W A;  4IHW A;  1M1E B;  2A68 F;  2DFH A;  5EJC A;  4CZZ A;  1GT0 C;  3ERM A;  3PM1 A;  3BQY A;  4MLO A;  4XSX F;  3DWL E;  2G7H A;  3WTS C;  5DD8 A;  1YJW I;  3QQA A;  1T56 A;  1X1B A;  4A0X A;  4BAY A;  1S3J A;  5IPA A;  2KL4 A;  5J4Y A;  1R71 A;  5HDN A;  2DK8 A;  1A31 A;  2JZY A;  3WE3 A;  4EEF G;  2Y0S A;  1XD7 A;  3ABK H;  4XLF A;  4KN7 X;  1JE8 A;  3VOE A;  4EM1 A;  1IDY A;  3VYT B;  4Q4Z F;  3W3C A;  3W2A A;  1LDD A;  1SD7 A;  1DP7 P;  4B3X A;  5FLX Z;  1W1W E;  3L9F A;  3PIP F;  2F5C A;  3RCO A;  4P96 A;  1EH8 A;  4CCN A;  2EFN A;  2FU4 A;  2QKM B;  2ZJQ F;  1OKR A;  1TT5 B;  3LMM A;  2ZXW H;  3AKZ A;  1P9Q C;  3O2P E;  1LPQ A;  1PVE A;  2OD5 A;  5DCF A;  4UHT A;  3V7R A;  4J19 A;  1SFU A;  4IL6 C;  1DGR M;  1K4T A;  2F4I A;  2E34 A;  1ON1 A;  3WTW C;  4N4O B;  2XRN A;  1OJL A;  2YSR A;  2PN6 A;  5E3O A;  3I4N J;  2C6Y A;  3HHG A;  1R1T A;  3MMY B;  3RJP A;  2CW7 A;  2MGQ A;  1P4A A;  3DKX A;  3EYI A;  4XNF A;  2NXN B;  5AIP A;  1LE8 A;  5LFA A;  2DOA A;  3OOP A;  3E1S A;  4BJ5 C;  3LWF A;  4U0W A;  4WXC A;  5JVT A;  1C0W A;  3GFJ A;  3RQ4 A;  1G3T A;  3RYP A;  2OJE D;  1D3Y A;  2WV1 A;  1FBQ A;  2GAU A;  5EG0 B;  3S16 J;  1MDM B;  4HRI A;  1ZQ3 P;  2JA7 J;  2ACJ A;  1XS9 A;  2YR2 A;  4I76 A;  2DBB A;  1GHC A;  2WY7 Q;  4M3D A;  5K1Y A;  2R0Q C;  2DTR A;  1IN4 A;  3HIF A;  5EYR A;  5B1A H;  4GCV A;  1K78 A;  1D8K A;  3ZQI A;  2LF7 A;  2WAE A;  1DU0 A;  2R7W A;  1FMW A;  3GX4 X;  2H6B A;  3HGY A;  4P9U A;  4IHS A;  5IYB J;  1D1A A;  1MMS A;  2NS7 A;  5CVV A;  4WX9 A;  2LY1 A;  3G73 A;  4CXF A;  1FLI A;  4F92 B;  3F21 A;  1TBX A;  2VBW A;  2LY2 A;  3BR2 A;  3M1C A;  3OYJ A;  1CQT A;  4IHT A;  2VQC A;  1LFB A;  3CUO A;  4U7D A;  3OS1 A;  4CYC A;  3J81 Z;  1KQ0 A;  5F27 A;  1LVK A;  4HNT A;  1WQ2 A;  3OYB A;  2EPF A;  3CZ6 A;  3FM5 A;  2KJC A;  2K85 A;  3HDD A;  2E1M B;  3B02 A;  2XSJ C;  2PBI A;  5GTH C;  3K70 C;  2GXG A;  2WWY A;  1V4R A;  1X2N A;  2M34 A;  4I6Z A;  3LFU A;  4JYK A;  2M9H A;  3TP0 A;  3CME I;  1LEB A;  4ITV A;  2H1L A;  1G3Y A;  2FUG 2;  1XTA A;  2VE8 A;  1J9I A;  1AKH B;  3SFI A;  4RS8 A;  3WOD F;  4EJU A;  1RET A;  2VJI A;  3NEU A;  1E17 A;  3IH2 A;  3I59 B;  2K02 A;  5BPD A;  4HQM A;  2XSD C;  1LEA A;  1LKX A;  5FKL A;  3HHH A;  1Z3Y A;  1B9N A;  2LRD A;  2ECB A;  1GLN A;  3KP7 A;  2DMP A;  3SHF A;  4V19 K;  1D0Y A;  4F3Q A;  1XC5 A;  4PJ0 C;  5DS9 A;  2R5Y B;  4D5F A;  1J5Y A;  5K5R A;  4UV8 A;  4ENM A;  3U2R A;  4A69 C;  1G59 A;  1DPU A;  4CCJ A;  5C4X J;  3P9K A;  2BY0 A;  5HOD A;  1O3T A;  3LQQ A;  5F1J A;  2GM4 A;  2P5V A;  1JGG A;  3BOQ A;  1FP1 D;  2G9W A;  4KN4 X;  2M8G X;  3V8L A;  2ZXI A;  5D5X B;  4MEY F;  2XF5 A;  2FML A;  2FBK A;  1A35 A;  2A5Y B;  9ANT A;  5GTI C;  2K9L A;  2CQN A;  3ABU A;  1FTZ A;  4HG2 A;  1FEX A;  1OYI A;  2W48 A;  2FNP A;  2XB0 X;  1PJR A;  2VBX A;  3CUQ C;  4M3B A;  3RPQ A;  2MYS A;  3HRU A;  3BZ6 A;  4EJT A;  5IYC J;  2IBD A;  4BDZ A;  4A3J J;  3SJM A;  1YIT I;  1WVR A;  3MZH A;  2BW3 A;  1MMN A;  3QP6 A;  4CIC A;  1X1C A;  2DYR H;  3PFI A;  4GYG A;  2WB1 N;  5FRN A;  4CCM A;  4C3H J;  2LRE A;  4BL0 B;  2GIV A;  3PUF A;  4IHX A;  4LLG F;  3ZXS A;  1E2X A;  2M0M A;  2GBY A;  4D5C A;  3UKG A;  1IXS B;  4RGX A;  2B9S A;  3S1Q J;  2DA3 A;  2TCT A;  5EEA A;  3CCQ I;  2ZJP F;  5H6R A;  2HYF A;  4JX5 A;  3LFK A;  3WTX C;  3CF5 F;  3EYY A;  5FLV A;  2EZH A;  4BHC A;  1YFH A;  2XF7 A;  3OR2 C;  2RKH A;  1UHS A;  2CUF A;  1PYV A;  1XCB A;  4OU0 A;  4XRF A;  3DCF A;  4JX4 A;  1FY7 A;  4G8X A;  2A05 A;  2QUF A;  3OV8 A;  2VOO A;  4DZP A;  3EPZ A;  3CLQ A;  2UUZ A;  3IWF A;  3JRD A;  2JUC A;  1YIO A;  3BPX A;  1HXD A;  3SEZ A;  1ZRE A;  4HOB A;  4D7N A;  1G8X A;  2FOW A;  3M1E A;  2XPW A;  2K9N A;  1W5S A;  3DTI A;  3T5X A;  2EIL H;  3DFG A;  3CMM A;  3RKQ A;  2PLY A;  2QBY A;  5IT9 K;  1QGP A;  2LKP A;  4IX7 A;  2KPM A;  5ICG A;  1K4S A;  4AYB A;  2LH9 A;  4PSX A;  4PGH A;  2WAQ N;  1MJB A;  3DV8 A;  5C3E J;  5DCM A;  5JHF A;  3BCB A;  3OY9 A;  4CGZ A;  4OMY A;  1PDN C;  2LFB A;  3KZI C;  3I0T A;  4XOT A;  3IAM 2;  3K4N A;  1ZAR A;  2LC2 A;  1LJ9 A;  2QQ8 A;  1IJW C;  1TW2 A;  3HRT A;  4P1W A;  2CQX A;  3BG6 A;  2DI3 A;  3J7A Y;  3A4C A;  2ZBK A;  3GFL A;  4IJA A;  3JAM K;  1G2H A;  2R7Z J;  3CUQ A;  2F5F A;  4KT6 A;  5J47 A;  3BPV A;  2Y9Z A;  3VYS B;  6PAX A;  3RKY A;  4PJJ A;  4DYQ A;  2HKO A;  2DA2 A;  5C4J J;  4IXA A;  3TL4 X;  2YX4 A;  4BKX A;  3ABM H;  1Z21 A;  2JUG A;  1VQN I;  1JKO C;  2NVY J;  4UV9 A;  3Q0W A;  1O7F A;  4M6V A;  3ZR8 X;  3HJE A;  1I1G A;  1KYZ A;  2YU3 A;  1JKQ C;  4XN3 A;  2PJP A;  1ON2 A;  4HZF A;  1KU2 A;  2FRH A;  3GME A;  1R1U A;  3O3K A;  5LRR A;  3G1O A;  3WE2 A;  2PJR A;  3E3V A;  2LF8 A;  5H20 A;  1Y39 A;  2JA2 A;  5IP6 A;  2BE5 F;  3RZD J;  4RM3 A;  3HTS B;  2OA4 A;  1FBS A;  5J1R A;  5F08 A;  1R7J A;  4A2U A;  1MMD A;  1D0X A;  1BA5 A;  5E3N A;  4XIC A;  3TKY A;  1D1B A;  1IRX A;  2X51 A;  2EFW A;  1O3S A;  4H0E A;  1ZEL A;  3CJR B;  2P5L C;  1X1D A;  3MKZ A;  5HNH A;  2F4M B;  3KFW X;  3BG3 A;  4B44 A;  2ZJ2 A;  1JI8 A;  3IRR A;  4Y17 A;  2FX0 A;  2L01 A;  1LFP A;  4LMY A;  3HL2 A;  1SFO J;  3L2Q A;  5IT3 A;  5B5E C;  4P5O A;  3KEO A;  4II3 A;  4M9S A;  3IP4 B;  1J75 A;  1LFU P;  2GXA A;  2DOE A;  4I02 A;  1MDM A;  4IQJ A;  2JA8 J;  4EM0 B;  5FLX K;  3BG7 A;  4XKV A;  2NOG A;  2RV8 A;  2HPM A;  1T08 B;  3E7L A;  4L0Y B;  2ZXJ A;  2BOL A;  5K7Z A;  3I58 A;  4IO9 F;  4PFP A;  1T0F C;  2W4S A;  4O6J A;  5EF6 A;  2R92 J;  2EH3 A;  1ODD A;  4BE0 A;  1IZ1 A;  3RTR A;  2FXA A;  5CKT A;  1ZLK A;  3FDY A;  3AG2 H;  2OQG A;  2KIF A;  1OIS A;  3EET A;  4RB2 C;  3M8J A;  2DN0 A;  1GXQ A;  3CCR I;  5LEK A;  2RRE A;  5GPA A;  3JRI A;  3H9G A;  2BEO A;  1RNL A;  2F4O B;  2LOO A;  1GV5 A;  3MCZ A;  1HDD C;  3GUD A;  5L3F A;  4X6A J;  4B48 A;  4KDP A;  4IRH A;  3WU0 A;  1UFM A;  1FC3 A;  1FNN A;  2QEX I;  2B7E A;  2A5W A;  2JK3 A;  3GZN B;  4HV5 A;  3TBI A;  5IOZ A;  4PGG A;  5FFZ A;  1U5T B;  1ZYR F;  2DDB A;  2M87 A;  4L5E A;  4LGW A;  3Q0U A;  4FX0 A;  3C18 A;  4L9J A;  3FXR A;  1MBH A;  1G4D A;  3OR1 C;  2E2I J;  1OLT A;  1BN5 A;  3ZOB A;  3U21 A;  4XRS A;  1S7O A;  3A01 A;  3A0B C;  4RAF A;  1G3W A;  2DJN A;  2LKX A;  1RES A;  2ELJ A;  2QKL B;  2VI6 A;  4UUS B;  2BZT A;  2WY8 Q;  3BTC A;  2OTJ I;  1YW8 A;  4IF4 A;  1B9M A;  3S17 J;  2MW8 A;  2ZFU A;  4NBQ A;  1ZKG A;  2DA6 A;  2DQL A;  2EIK H;  2XHK A;  1N25 A;  3DKY A;  4XKW A;  4EGY A;  1Z7L A;  4YEL A;  1BI1 A;  3E97 A;  3HRS A;  2HDW A;  5F64 A;  2MC4 A;  4OMZ A;  3MZ8 A;  4A3G J;  4MO7 A;  5L3C A;  2YUS A;  2DFF A;  2R7T A;  3JRG A;  5GP9 A;  3CJT B;  4ASN A;  3TOA A;  1FOY A;  4DNC A;  4BY7 J;  1ORK A;  4MFE A;  5E8G A;  5HOO A;  2L9S A;  1SAN A;  1WH5 A;  1I27 A;  4KNY A;  1W7P B;  4IZZ A;  3F8B A;  1Y56 A;  2BHZ A;  4JOM A;  4M3F A;  1IF1 A;  4NC8 A;  4A6D A;  2DPD A;  3S1M J;  1K7A A;  3CP2 A;  1JTX A;  3K1N A;  2GIZ A;  2JT1 A;  2AO9 A;  2ICW G;  3GZ6 A;  2UXX A;  5FGM A;  2E71 A;  3E6C C;  1EH7 A;  3TDU C;  2IRF G;  2I5U A;  4RAY A;  1O3Q A;  1D5Y A;  2KDZ A;  3PNY A;  2VPR A;  1B1B A;  3OSG A;  4G12 A;  4BDY A;  3G2B A;  2VJ4 A;  2WB1 A;  2HTJ A;  2Z99 A;  2NAZ A;  4XRS G;  1ZLJ A;  2R7U A;  4W1U A;  5IP9 J;  3R6S A;  3W6V A;  1V5E A;  3HOW J;  3TOB A;  1GVD A;  1XDU A;  3PJR A;  5H6Q A;  3G3Z A;  1EH6 A;  2KIM A;  3HOZ J;  2JSP A;  3GTJ J;  2VC1 A;  4Q48 A;  1A5J A;  3M7G A;  4ENJ A;  5DDG A;  1ETX A;  4LOC A;  3LSH A;  2JVH A;  4IEJ A;  1XSD A;  3CCV I;  4EV0 A;  5B1B H;  3B73 A;  2L3D A;  4BE2 A;  1OCO H;  2HVQ A;  2ZSH B;  2A07 F;  4D1Q A;  2M4K A;  1H89 C;  1TQM A;  1WI3 A;  2BVL A;  2M30 A;  3Q9S A;  2K4B A;  1DP3 A;  3O8G A;  2R7D A;  3GCM A;  3R4K A;  1T33 A;  2Z2S B;  2K40 A;  3PNT A;  1UJ8 A;  5JR3 A;  3CES A;  2DQR A;  2EV0 A;  2EWN A;  1XGM A;  4YFX F;  2MSY A;  4E70 A;  4OOI A;  1MNE A;  4XL9 A;  4O3M A;  3FXO A;  2JWT A;  4ZYA A;  1UHW A;  2E19 A;  3LSG A;  1AOY A;  2HYG D;  4A3I J;  4ZTJ A;  1XMA A;  2CUZ A;  3F0C A;  3T8T A;  1YJN I;  2MG4 A;  3LA3 A;  2YU9 J;  3LQR A;  3PFY A;  1QRY A;  4FCY A;  1W0T A;  4EMS A;  3OYN A;  2E2H J;  2X85 A;  1MJ9 A;  3C3W A;  3FM3 A;  2V1U A;  2DOF A;  3GXO A;  4Y33 A;  1B8I B;  5DM7 F;  3CCL I;  3HSE A;  3SYT A;  4B47 A;  2IEK A;  1PP8 F;  3AAF A;  1TC3 C;  2QM3 A;  4XLN F;  1UHM A;  1W5T A;  1I6H J;  2JTV A;  2LSO A;  1R23 A;  1R5H A;  3NWS A;  2XRO A;  1NHA A;  2G0E A;  1QNT A;  4JP0 A;  1H88 C;  1FOW A;  3DPL C;  2QSG X;  4B43 A;  4G7O F;  5DUI A;  1XCV A;  3BC8 A;  4XBF A;  3HGG A;  3JCU C;  3K10 A;  2Q2E A;  1VQL I;  2Z9O A;  2GLO A;  3HOT A;  2EK5 A;  2K9Q A;  4FQG A;  2Q0O A;  3CJN A;  2LP0 A;  3GZ5 A;  4GGG A;  2ZFW A;  3FMR A;  3VSL A;  5E3L A;  3OS0 A;  2X6O A;  1Z7U A;  4XR6 A;  1X4P A;  2TDX A;  4BYY A;  2OZ6 A;  1DDN A;  2AXL A;  4KMU X;  3BJ6 A;  4LD5 A;  3QPL A;  2BW3 B;  2FQ4 A;  3PL8 A;  4ZYE A;  5CQE A;  2K4J A;  3PO2 J;  2O03 A;  2XGE A;  4E7L A;  1FOK A;  1RC9 A;  2R5Y A;  5JFR A;  1OR7 C;  3C2H A;  1WHU A;  1GV2 A;  4EGZ A;  1WCM J;  5A2Q Z;  4I7H A;  2BY1 A;  3GFI A;  3A1Y A;  3CCY A;  3FKJ A;  4BQQ A;  1B59 A;  3BZC A;  3CO6 C;  4HX7 A;  5FFX A;  2HGC A;  1MBF A;  2DT5 A;  1L0O C;  1S9H A;  2Y31 A;  3QOE A;  4A12 A;  1BL0 A;  2CQQ A;  3OYE A;  5TJJ A;  3U1K A;  2AXT C;  2DMU A;  2K5C A;  2CW8 A;  2LY9 A;  2D45 A;  5EG0 A;  1K61 A;  2VKV A;  3DEU A;  1P7I A;  1FP2 A;  1UG2 A;  2OU2 A;  2OV7 A;  5EZG A;  5D5V B;  2QYO A;  4UNO A;  3I71 A;  4PJL A;  2DAO A;  3CTA A;  3AL0 B;  1WGX A;  2ZO4 A;  2FNA A;  3ROU A;  4F7Z A;  1VTN C;  5ICF A;  1AWC A;  1HKS A;  3OSF A;  3FZV A;  2E36 A; 
#chains in the Genus database with same CATH homology
 4AVP A;  4O5V A;  1FYL A;  1T0F A;  4G7H F;  2P7C B;  3IKV A;  3W6K B;  3I53 A;  1WWX A;  4CYD A;  1Z91 A;  5ILU A;  5IT9 Z;  1L3L A;  3RYR A;  5D6E A;  5D8L B;  2OQR A;  4HX8 A;  3WTV C;  2XAF A;  5D6F A;  4Y13 A;  4FHT A;  1OYY A;  1OPC A;  2HQR A;  4KA4 A;  2Y0M A;  1QBJ A;  4UVB A;  3V7S A;  1YTY A;  3QPT A;  5HS7 A;  3QOP A;  2NRA C;  4JBA A;  2FE3 A;  5CJ9 A;  1JGS A;  5DUK A;  4DQ2 A;  2KJB A;  3GO5 A;  4MQ9 F;  2A6H F;  2FA5 A;  4OIR F;  3GW2 A;  1ZG5 A;  4P55 A;  5BMZ A;  2XVC A;  1TQI A;  3HRM A;  2FSW A;  1ULY A;  2W24 A;  1Z9C A;  1T6S A;  4R79 A;  3K1M A;  2KKO A;  5CVI A;  3TGN A;  4ENN A;  2VT2 A;  5AON A;  2STW A;  1ZHF A;  1ZAO A;  4QWQ A;  2L4M A;  4HYE A;  1ZG3 A;  3CO7 C;  3FHZ A;  1FBU A;  4HV6 A;  1SAX A;  3HOS A;  3E5X A;  2HFH A;  4NHJ A;  1YW7 A;  2X0L A;  3KP5 A;  3D0S A;  1LB2 A;  4MTE A;  3LAJ A;  2ZNY A;  2IT0 A;  5LGU A;  4HF2 A;  1Z6R A;  2FBI A;  4HBL A;  5BQT A;  2HWV A;  5DEQ A;  1OR7 A;  3ZPL A;  3HYI A;  5D4R A;  2BYV E;  5HVQ C;  2X4H A;  3L00 A;  3K0L A;  2GWR A;  2VBZ A;  2CFX A;  2H27 A;  3MZY A;  3KP6 A;  3RKX A;  1ZGJ A;  3VEP A;  1LNW A;  5E1Z B;  4WCG A;  3ZMU A;  1XGO A;  4Q47 A;  3FMQ A;  5F6F A;  1TNS A;  4QLC U;  3ECO A;  4PDK A;  2FMY A;  4HF0 A;  1R58 A;  4CDG A;  4U88 A;  1QZY A;  5ILS A;  1KYW A;  1HSJ A;  3FXU A;  3F8F A;  2F2E A;  4A5N A;  4M9Z A;  4EJW A;  2FF4 A;  1YS6 A;  3BP8 A;  3H3Z A;  2M1B A;  1KGS A;  4IRG A;  2W85 A;  1WKM A;  4WWC A;  1MD0 A;  1R00 A;  1ZH5 A;  2F5D A;  1J7K A;  4EM2 A;  4HQE A;  1O3R A;  3JSP A;  2H6C A;  2A61 A;  2NYX A;  1OMI A;  2V9V A;  4G94 A;  4UUV A;  4XLP F;  4JK1 X;  3E6D A;  2QEN A;  3TO6 A;  4AIJ A;  1D8J A;  4AIK A;  3QU6 A;  3QP5 A;  5ICC A;  1F1Z A;  1T38 A;  1J59 A;  3J7A O;  2EV5 A;  1G3S A;  4NQW A;  1IUY A;  3ZN1 A;  1HW2 A;  2ESN A;  1TLH B;  1K79 A;  1O57 A;  1RIO H;  3IL2 A;  3REO A;  3ZMS A;  3IKT A;  2YX7 A;  4ZYH A;  5ICE A;  1BC7 C;  1WSU A;  4MEX F;  2Z3Y A;  3LAP A;  5ILV A;  3KP2 A;  4L18 B;  3CLO A;  5D8K B;  3V4G A;  2MH2 A;  2OZU A;  2IA2 A;  3WG9 A;  2DLL A;  5HLH A;  2MH9 A;  1TNT A;  2QQ9 A;  2XGX A;  2KRF A;  1TTY A;  4I2O A;  1IN5 A;  2MBF A;  2EFO A;  2XAH A;  3Q5F A;  1IAW A;  2DFI A;  4ZH4 F;  4BNC A;  4BQA A;  1P4X A;  3K2Z A;  4PCQ A;  4YG2 F;  1FT9 A;  3HSF A;  3KZY A;  2HS5 A;  4I0A A;  5EEH A;  1W7P D;  5LGN A;  3DQV C;  3U1D A;  3J80 K;  4CO8 A;  5LLQ A;  1H9G A;  3KCC A;  3DF8 A;  5K5O A;  4L0Z B;  2ETH A;  4M9X A;  5AIQ A;  2EB7 A;  4OIP F;  2DW4 A;  4WK8 F;  2XAG A;  4LG0 A;  1P6R A;  2O61 A;  5LGT A;  2R3S A;  4HW0 A;  3U9G A;  5L3B A;  2M45 A;  4HDU A;  1IRF A;  4BHP A;  1UB9 A;  4ETS A;  5D4S A;  4KIG A;  5DD4 A;  1OYW A;  1YS7 A;  1R5G A;  3IHU A;  2K7L A;  4UXN A;  2CO5 A;  4LK1 F;  3I4P A;  1STZ A;  2HTS A;  2XIG A;  2E1C A;  3PQK A;  2M5W A;  2ZME A;  3PQJ A;  4AIH A;  1DUX C;  4PZJ A;  2VE9 A;  3IWZ A;  5FO5 A;  2VON A;  3ZN0 A;  5J6X A;  2IJL A;  2GA2 A;  3M9A A;  1F5T A;  3JSO A;  1QPM A;  3ML6 A;  2RN7 A;  1W7P A;  3ZQ7 A;  2RQP A;  1UST A;  1ONV A;  1WI9 A;  3EQL F;  3Q9V A;  2H09 A;  3ZMZ A;  3WTZ A;  1RZ4 A;  1I5Z A;  3TO7 A;  2VN2 A;  4BH9 A;  2W57 A;  3N97 A;  1CF7 A;  3HUG A;  2DPU A;  1KU7 A;  2ISY A;  5JHU A;  1WRJ A;  1XGN A;  1KQ8 A;  2P5K A;  2L4A A;  4U7B A;  1SFE A;  1U5T A;  1YLF A;  1P2F A;  2LDU A;  1ZN2 A;  3LA7 A;  3SZT A;  2J5P A;  2DU9 A;  3COA C;  3V7C A;  2PI0 A;  4BXU A;  1GXP A;  3BJO A;  2PQ8 A;  2Z5U A;  2W25 A;  4L9V A;  1ZG1 A;  2JPC A;  1ZRF A;  5JI6 A;  5K5Q A;  3DXJ F;  4LB5 A;  4A6E A;  1HST A;  5D5W B;  4HLX A;  3C7J A;  4KIB A;  2H94 A;  4R8H A;  4YFK F;  3RKW A;  3IRQ A;  5E18 F;  5CYV A;  3N4M A;  1YG2 A;  3WGI A;  2VXZ A;  3SFZ A;  1REP C;  2WV0 A;  4RB3 C;  3SZP A;  2Q8K A;  3DP7 A;  1S29 A;  3KE2 A;  3F8N A;  4G7Z F;  4TV7 A;  4MQV A;  4WF2 A;  1KA8 A;  1HKT A;  1MJA A;  2MC3 A;  5J8F A;  2XAQ A;  5E1W A;  5A2Q K;  2HZT A;  4OIO F;  2O3F A;  4IRI A;  3R0J A;  1J2X A;  1R22 A;  3M8F A;  5LHI A;  5CVJ A;  5F1R A;  4LK0 F;  5L3E A;  3FF5 A;  5TRD A;  1X3U A;  2DO7 A;  1QQI A;  3P9C A;  2V6C A;  2WTE A;  3ULQ B;  3J81 K;  4FT8 A;  5E17 F;  4ESJ A;  2Y75 A;  3J80 Z;  1YYV A;  4M6Y A;  2V1D A;  2P6T A;  3KZZ A;  4YII A;  4G9Y A;  1GVJ A;  1Z6T A;  1FZP B;  3K9T A;  3F8C A;  2NNN A;  2G7U A;  2GQQ A;  4MHG A;  2GA1 A;  2CSO A;  4I09 A;  2XAJ A;  3WTU C;  3QPH A;  3F8M A;  2YPR A;  5E20 A;  1ZGA A;  4UVA A;  1U3E M;  5CVR A;  3RI4 A;  4ENK A;  3HSR A;  3JAM Z;  2D1H A;  1IN7 A;  1PUE E;  3GWZ A;  2HOE A;  2QWW A;  2K86 A;  3TQN A;  3GVA A;  5E1X A;  3F22 A;  1USS A;  4D0P A;  2ISZ A;  2OAZ A;  4HLY A;  1BIA A;  1DPR A;  1BC8 C;  2HKX A;  4K2E A;  2BBY A;  1EV7 A;  1KQ9 A;  3EUH A;  3LST A;  4KIF A;  4N0B A;  3BJA A;  4B8X A;  2HEO A;  4I98 B;  2A6E F;  3CDH A;  2ZCW A;  3C1D A;  5LEJ A;  3P9I A;  2PMH A;  1FYM A;  3WU1 B;  3MWM A;  4RGU A;  1Q1H A;  2Y48 A;  5J8C A;  1FSH A;  2JSC A;  1XSV A;  3NQO A;  4R1H A;  1XGS A;  2VBY A;  3P7N A;  3ZMV A;  3F23 A;  2CW0 F;  2EA4 A;  5LHH A;  1F9N A;  2UWM A;  2MLG A;  2R7F A;  1H9T A;  3DKW A;  4EJV A;  1G6N A;  3GF2 A;  2ZME B;  5EEG A;  1BOA A;  5ERI A;  1ZRC A;  2JRT A;  4IVN A;  5D5U B;  3JW4 A;  1JHF A;  2MA3 A;  5CVU A;  1J0R A;  2ZKZ A;  2QLZ A;  2OBP A;  2EFP A;  4LJZ F;  3V8K A;  3RIR A;  4RB0 A;  2FBH A;  3I5U A;  1XMK A;  1XB4 A;  4B09 A;  2RGV A;  1U5T C;  5HDG A;  2D1V A;  3KP3 A;  1HBX G;  4LLN A;  5DYM A;  4JQF A;  1PP7 U;  2NS0 A;  1TW3 A;  5FB2 A;  2VT3 A;  1O7L A;  1FX7 A;  2M8E A;  4Z2Y A;  1JHH A;  3I59 A;  4P9F A;  1R36 A;  2QBY B;  3WTT C;  1W4M A;  3WGG A;  4UVC A;  2E7X A;  3MEX A;  3L09 A;  4RGS A;  3I54 A;  5DCM B;  3F3X A;  1LQ1 A;  2AS5 F;  4ESB A;  3T0Y A;  5BOX A;  3GFM A;  2FEZ A;  2GXB A;  4N9H A;  1S7A A;  2IW5 A;  3CUQ B;  2VOP A;  4GXO A;  4AD9 A;  5L3G A;  2QZ8 A;  1FPQ A;  2E1N A;  3ABT A;  2UZK A;  2JPB A;  4HF1 A;  2XUB A;  4KIC A;  1U8R A;  1IW7 F;  4Q5S F;  1U2W A;  5HS8 A;  1P4W A;  4I01 A;  4NB5 A;  3R60 A;  1MGT A;  2CG4 A;  1HW1 A;  3ECH A;  4WXD A;  2VC0 A;  4M74 A;  1KU3 A;  4A5M A;  3BY6 A;  1SMT A;  3QRF F;  1IXR C;  1P92 A;  1B4A A;  1S8N A;  4I0B A;  2UXN A;  2ZNZ A;  3KET A;  3WGH A;  4EQQ A;  2NNY A;  1YW9 A;  2IA0 A;  3V8J A;  5HDK A;  3KLO A;  3K1P A;  4EVI A;  2DK5 A;  1B6A A;  3WTY C;  1S6L A;  3ZP5 A;  3E5Q A;  1T2K A;  2P6S A;  5BS6 A;  1YO5 C;  1F4K A;  1XSX A;  1IXC A;  5LBQ A;  5LRS A;  4RAZ A;  1T98 A;  2K27 A;  5BPI A;  3O6B B;  1K6O A;  3D5L A;  2V79 A;  2XKO A;  5E8I A;  2HDC A;  1SD5 A;  4ON0 A;  1HW5 A;  2EA2 A;  2BGC A;  1D5V A;  1YQA A;  4M6X A;  2IA1 A;  3R0A A;  1KU9 A;  2XKP A;  2KIU A;  4XSZ F;  2BV6 A;  2QVO A;  2O6G E;  3E6M A;  4KUM A;  1HKQ A;  4YFN F;  2FQ3 A;  2XAS A;  4HDV A;  1SD4 A;  1RUO A;  3W6J B;  2STT A;  1BM9 A;  3T8R A;  3TDZ C;  3ERE D;  3MAJ A;  1IRG A;  1BI0 A;  1H0M A;  3IC7 A;  3QU3 A;  2V1X A;  4L9T A;  4LB6 B;  1K78 B;  4LG0 B;  4M72 A;  2FOK A;  4M73 A;  1MZB A;  5HS9 A;  3VOD A;  3FX3 A;  3RPU A;  4MTD A;  1Y0U A;  3GEZ A;  3KEQ A;  4G6Q A;  4ESF A;  1QO0 D;  1U6G A;  3VFZ A;  2L02 A;  1I6X A;  3LA2 A;  3E6B A;  3L7W A;  2CWE A;  1T39 A;  4M71 A;  2O0Y A;  2J5O A;  2IVM A;  1R1V A;  3F6O A;  2L54 A;  5ED4 A;  5LHG A;  2EFQ A;  5FD6 A;  3BRO A;  4LFU A;  2LNB A;  4U0V A;  4WXH A;  2MLK A;  3FXQ A;  3NRV A;  4RGR A;  3GYH X;  3MFK A;  1LDJ A;  4U0Y A;  2F5E A;  4A0Y A;  1U78 A;  3H3U A;  5HLG A;  3KLN A;  1Z1D A;  5CLS A;  3ISP A;  4LLL A;  2ADU A;  1IN6 A;  3HTU A;  3RDI A;  3GLX A;  2CYY A;  4G6D A;  1CF7 B;  2D2W A;  2W84 A;  4BHB A;  4OIQ F;  4ZZD A;  2IPQ X;  1SD6 A;  4YIF A;  3F72 A;  1HQC A;  2ESH A;  3M8E A;  1SMY F;  3T1B A;  5KK1 A;  2CGP A;  4GO1 A;  1XN7 A;  2COM A;  3BDD A;  4AWX B;  3SQN A;  3JTG A;  1V3F A;  1IN8 A;  2RNJ A;  1LVA A;  4L9N A;  2GZW A;  3JTH A;  3E5U A;  1BJA A;  2VOD A;  2P4W A;  1BI2 A;  4KFC A;  1A04 A;  2P8T A;  3SXY A;  2Z33 A;  2RVC A;  2PFB A;  4HA8 A;  4ZYG A;  3MQ0 A;  4A0Z A;  4S04 A;  3F6V A;  3KP4 A;  4RB1 A;  2EJR A;  4GYI A;  4MNU A;  4S05 A;  3L2C A;  1SFX A;  3TO9 A;  1CGP A;  4IPA A;  2CQK A;  3FWE A;  3R61 A;  1LDK B;  2HQN A;  1BBY A;  3VB2 A;  4KT5 C;  2A69 F;  1FSE A;  3ZMD A;  5L3D A;  2XV4 S;  3FMS A;  2E7W A;  2QQA A;  2EV6 A;  4L5I A;  2RC4 A;  2RDP A;  1RUN A;  4KMF A;  1TQP A;  4N9I A;  2B0L A;  1QZZ A;  4HX4 A;  3BWG A;  1Z05 A;  5KVR A;  2QQB A;  1I1S A;  2WC2 A;  3DPT A;  4HAM A;  1FWZ A;  2MD5 A;  5DV5 A;  4OIN F;  3QAH A;  4L5J A;  2PG4 A;  2ELH A;  1BIB A;  1MKM A;  2PMU A;  5HLI A;  2A3S A;  3K69 A;  1BI3 A;  2P7V B;  1RI7 A;  2IP2 A;  3H92 A;  4KYW A;  4FX4 A;  3EDP A;  2PEX A;  2O8X A;  3ZMT A;  4ZYD A;  4EJO A;  1UCR A;  2HR3 A;  1ZRD A;  5FD5 A;  4ZZL A;  4MGR A;  1JXS A;  4Y15 A;  1XDS A;  1FYK A;  3I64 A;  4CHU A;  3ELK A;  3S2W A;  2A68 F;  4CZZ A;  4XSX F;  2G7H A;  3WTS C;  5DD8 A;  4A0X A;  4BAY A;  1S3J A;  5HDN A;  2DK8 A;  2JZY A;  3WE3 A;  1XD7 A;  4KN7 X;  1JE8 A;  3VOE A;  4EM1 A;  4Q4Z F;  1LDD A;  1SD7 A;  1DP7 P;  5FLX Z;  3L9F A;  2F5C A;  4P96 A;  1EH8 A;  2EFN A;  2FU4 A;  1OKR A;  3O2P E;  2OD5 A;  5DCF A;  1SFU A;  4UHT A;  3V7R A;  1ON1 A;  3WTW C;  2XRN A;  2YSR A;  2PN6 A;  2C6Y A;  3HHG A;  1R1T A;  3RJP A;  1P4A A;  3EYI A;  5AIP A;  3OOP A;  3LWF A;  4U0W A;  4WXC A;  5JVT A;  1C0W A;  3GFJ A;  1G3T A;  3RYP A;  1D3Y A;  1FBQ A;  2GAU A;  1MDM B;  2ACJ A;  2YR2 A;  2DBB A;  1GHC A;  5K1Y A;  2DTR A;  1IN4 A;  3HIF A;  4GCV A;  1K78 A;  1D8K A;  2LF7 A;  3GX4 X;  2H6B A;  4IHS A;  4P9U A;  5CVV A;  4WX9 A;  3G73 A;  4CXF A;  1FLI A;  3F21 A;  1TBX A;  2VBW A;  4IHT A;  3CUO A;  4U7D A;  3J81 Z;  1KQ0 A;  1WQ2 A;  3FM5 A;  2KJC A;  3B02 A;  2PBI A;  2GXG A;  2WWY A;  1V4R A;  1LEB A;  1G3Y A;  2VE8 A;  1J9I A;  4RS8 A;  3WOD F;  4EJU A;  3NEU A;  1E17 A;  3I59 B;  2K02 A;  5BPD A;  4HQM A;  1LEA A;  3HHH A;  1B9N A;  3KP7 A;  3SHF A;  1J5Y A;  5K5R A;  4UV8 A;  4ENM A;  3U2R A;  1DPU A;  1O3T A;  3P9K A;  3LQQ A;  2P5V A;  3BOQ A;  1FP1 D;  2G9W A;  4KN4 X;  3V8L A;  5D5X B;  4MEY F;  2FML A;  2FBK A;  2A5Y B;  3ABU A;  1OYI A;  2FNP A;  2VBX A;  3CUQ C;  3RPQ A;  3HRU A;  3BZ6 A;  4EJT A;  3MZH A;  3QP6 A;  4CIC A;  3PFI A;  4GYG A;  2GIV A;  4LLG F;  1E2X A;  1IXS B;  4RGX A;  5H6R A;  2HYF A;  3LFK A;  3WTX C;  3EYY A;  4BHC A;  1YFH A;  2RKH A;  1XCB A;  4OU0 A;  4XRF A;  1FY7 A;  4G8X A;  3OV8 A;  2QUF A;  2VOO A;  3IWF A;  1YIO A;  3BPX A;  1HXD A;  1ZRE A;  4HOB A;  3M1E A;  1W5S A;  3T5X A;  3DFG A;  2PLY A;  2QBY A;  5IT9 K;  1QGP A;  2LKP A;  5ICG A;  4PGH A;  1MJB A;  3DV8 A;  5DCM A;  4CGZ A;  4OMY A;  1PDN C;  3I0T A;  1ZAR A;  1LJ9 A;  1TW2 A;  3HRT A;  2DI3 A;  2ZBK A;  3GFL A;  4IJA A;  3JAM K;  3CUQ A;  2F5F A;  3BPV A;  6PAX A;  3RKY A;  2HKO A;  4IXA A;  2YX4 A;  4UV9 A;  1O7F A;  1I1G A;  1KYZ A;  2YU3 A;  2PJP A;  1ON2 A;  4HZF A;  1KU2 A;  2FRH A;  1R1U A;  3O3K A;  5LRR A;  3WE2 A;  3E3V A;  2LF8 A;  5H20 A;  2BE5 F;  3HTS B;  2OA4 A;  1FBS A;  1R7J A;  4A2U A;  3TKY A;  2EFW A;  1O3S A;  4H0E A;  2P5L C;  3KFW X;  2ZJ2 A;  3IRR A;  4Y17 A;  2L01 A;  4LMY A;  5IT3 A;  4P5O A;  3KEO A;  1J75 A;  4M9S A;  4I02 A;  1MDM A;  4EM0 B;  5FLX K;  2RV8 A;  4L0Y B;  2ZXJ A;  3I58 A;  4O6J A;  1ODD A;  1IZ1 A;  3RTR A;  2FXA A;  1ZLK A;  2OQG A;  2KIF A;  3EET A;  4RB2 C;  1GXQ A;  5LEK A;  2BEO A;  1RNL A;  3MCZ A;  3GUD A;  5L3F A;  4KDP A;  4IRH A;  3WU0 A;  1UFM A;  1FC3 A;  1FNN A;  4HV5 A;  4PGG A;  5FFZ A;  1U5T B;  1ZYR F;  2M87 A;  4LGW A;  4FX0 A;  3C18 A;  4L9J A;  3FXR A;  1G4D A;  1BN5 A;  1S7O A;  1G3W A;  1YW8 A;  4IF4 A;  1B9M A;  2DQL A;  2XHK A;  4EGY A;  1BI1 A;  3E97 A;  3HRS A;  5F64 A;  4OMZ A;  5L3C A;  4ASN A;  3TOA A;  4DNC A;  5E8G A;  5HOO A;  1I27 A;  4KNY A;  1W7P B;  3F8B A;  1IF1 A;  4A6D A;  2DPD A;  1K7A A;  3K1N A;  2JT1 A;  3GZ6 A;  2UXX A;  5FGM A;  3E6C C;  1EH7 A;  3TDU C;  2IRF G;  4RAY A;  1O3Q A;  1B1B A;  2HTJ A;  2Z99 A;  2NAZ A;  1ZLJ A;  3R6S A;  3TOB A;  1XDU A;  5H6Q A;  3G3Z A;  1EH6 A;  2KIM A;  2VC1 A;  4Q48 A;  3M7G A;  4ENJ A;  5DDG A;  1XSD A;  4EV0 A;  3B73 A;  2L3D A;  2A07 F;  1TQM A;  2M30 A;  3Q9S A;  2K4B A;  2R7D A;  3R4K A;  5JR3 A;  2DQR A;  2EV0 A;  2EWN A;  1XGM A;  4YFX F;  4E70 A;  4OOI A;  4O3M A;  1UHW A;  1AOY A;  2HYG D;  1XMA A;  3T8T A;  3LA3 A;  3LQR A;  4EMS A;  1MJ9 A;  3C3W A;  3FM3 A;  2V1U A;  3GXO A;  3HSE A;  1PP8 F;  3AAF A;  2QM3 A;  4XLN F;  1UHM A;  1W5T A;  2JTV A;  2LSO A;  1R23 A;  1R5H A;  2XRO A;  1NHA A;  1QNT A;  3DPL C;  4G7O F;  5DUI A;  1XCV A;  4XBF A;  2Q2E A;  2Z9O A;  3HOT A;  2EK5 A;  2Q0O A;  3CJN A;  4GGG A;  3GZ5 A;  2ZFW A;  3FMR A;  1Z7U A;  2TDX A;  4BYY A;  2OZ6 A;  1DDN A;  2AXL A;  4KMU X;  3BJ6 A;  4LD5 A;  4ZYE A;  2K4J A;  2O03 A;  1FOK A;  5JFR A;  4EGZ A;  5A2Q Z;  4I7H A;  3GFI A;  1B59 A;  3CO6 C;  4HX7 A;  5FFX A;  2HGC A;  2DT5 A;  1L0O C;  4A12 A;  5TJJ A;  2D45 A;  3DEU A;  1FP2 A;  2OU2 A;  5D5V B;  2QYO A;  4UNO A;  3I71 A;  2DAO A;  3CTA A;  2ZO4 A;  2FNA A;  3ROU A;  4F7Z A;  1VTN C;  5ICF A;  1AWC A;  1HKS A;  3FZV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...