2M30A

Solution nmr refinement of a metal ion bound protein using quantum mechanical/molecular mechanical and molecular dynamics methods
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
95
structure length
95
Chain Sequence
NTDTLERVTEIFKALGDYNRIRIMELLSVSEASVGHISHQLNLSQSNVSHQLKLLKSVHLVKAKRQGQSMIYSLDDIHVATMLKQAIHHANHPKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Repressor protein
publication title Solution NMR refinement of a metal ion bound protein using metal ion inclusive restrained molecular dynamics methods.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription repressor
total genus 26
structure length 95
sequence length 95
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01022 HTH_5 Bacterial regulatory protein, arsR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2m30A00
5H6RA 1S29A 3HOTA 4K2EA 4XRFA 4UUVA 3F8CA 3LQRA 4PGHA 1Q1HA 1OR7A 5H6QA 2O6GE 4BH9A 2IJLA 3FMRA 4FHTA 3RKXA 4O6JA 1Z7UA 3RYPA 1GXPA 1G6NA 4I98B 1I6XA 5DCMA 4OINF 2EFQA 2Q8KA 4XLPF 4Q5SF 2JPBA 2P5KA 1YO5C 4HLXA 4ZYDA 4ESFA 3EUHA 3N97A 1WSUA 1J75A 4MQ9F 1OYYA 2DW4A 1JXSA 3GX4X 3HUGA 1XGOA 4A6EA 4U0YA 3GWZA 3TDZC 1ZLKA 5F1RA 4U0WA 2F5CA 1CF7B 4IPAA 2D45A 3M9AA 2VONA 2KIUA 3F8FA 3ZMTA 2D1VA 3DP7A 4Q47A 3HHHA 1FSEA 1W7PB 3B73A 2QWWA 4DQ2A 4M72A 3GFMA 2HTJA 1G4DA 2ELHA 2RNJA 4WX9A 4AD9A 2FRHA 3SXYA 1FPQA 3ZMZA 1D8KA 1LJ9A 4ASNA 1B59A 1KU9A 3BWGA 3ZMDA 2Z9OA 5J8FA 1Z91A 2IW5A 4PGGA 5ICGA 4YFNF 3WTZA 1OPCA 5CVVA 2XV4S 2WWYA 5D8KB 5HDGA 3F6OA 2L54A 3VEPA 1O3TA 1BC7C 4I01A 1R23A 3IRQA 4CDGA 3L00A 4A0YA 4LK0F 2MC3A 3ABUA 3BJAA 2P5VA 1PP7U 1BIBA 1Z9CA 2OQRA 3F21A 2NRAC 3E5XA 4CHUA 5E1XA 5K5QA 2XUBA 3MEXA 4YIFA 2J5PA 2Z3YA 1MJBA 5ED4A 4XSZF 1P4AA 3I5UA 1Z6TA 5LEKA 3R0JA 4RAYA 3IL2A 3CUOA 1F4KA 1KQ9A 1XMKA 3QP6A 4OIRF 4M9XA 5EEGA 4DNCA 4EJWA 1XGMA 3V8LA 1HW5A 4LD5A 3DKWA 4YG2F 4HQEA 3MZYA 4U7BA 1UCRA 3EDPA 3GEZA 1VTNC 4UNOA 2HGCA 2COMA 2WTEA 4MEXF 2ZKZA 4KN7X 3TDUC 3TOBA 1MJ9A 3ECOA 5E18F 3O3KA 5FO5A 2DPUA 2M30A 2HYGD 3ECHA 5FFXA 1MDMB 4RGSA 3Q5FA 5JR3A 1WQ2A 3REOA 2UZKA 4L0ZB 2Y75A 5L3EA 1OMIA 4L18B 4N0BA 1BJAA 4L9TA 2LSOA 4CO8A 2KRFA 2ADUA 1S7AA 1XN7A 3FXQA 2HWVA 3IKVA 2FE3A 2A61A 2PG4A 2PEXA 4EJTA 2P7CB 2VOOA 3PQKA 3KZZA 1HW1A 3CUQC 2XRNA 3G3ZA 1IZ1A 1P2FA 4ZZDA 4AIJA 2PJPA 2AS5F 4KIGA 2EFWA 4Z2YA 4ZYHA 2XAQA 3IWZA 5FFZA 2A6EF 3VODA 5JFRA 1W5SA 1HW2A 5LBQA 3RYRA 3K1NA 2E7XA 1B9MA 4HLYA 1FYKA 3QRFF 2O61A 4P55A 1AWCA 1LVAA 2ZO4A 1TLHB 3WTUC 5L3FA 3EYYA 2DO7A 3V7RA 2YU3A 3IKTA 4PZJA 1KQ8A 2FSWA 4L5IA 1H9TA 2PFBA 3ZN1A 2VODA 1UB9A 2HKXA 1KU2A 1FOKA 1IW7F 5LLQA 2V1XA 4UHTA 2BV6A 1O57A 4M71A 4IVNA 3GFIA 2QBYA 5J6XA 3E3VA 3CLOA 1K78A 2FF4A 4ENJA 3RI4A 2E7WA 3N4MA 2HEOA 1V4RA 2VBYA 3WE3A 1QPMA 4IRGA 1S7OA 2DT5A 4JK1X 4HAMA 2STTA 1T6SA 2XIGA 3U2RA 1P4WA 4CXFA 2PBIA 2FBHA 3RPUA 2R3SA 2NAZA 1TNSA 3P9CA 3QOPA 4M73A 3HRSA 3D5LA 3FHZA 5D8LB 4ETSA 2EA2A 4N9HA 4HX4A 2Y0MA 2K27A 3MAJA 1FP1D 4LG0A 1MJAA 2IA2A 1IXCA 2QYOA 2P7VB 3BROA 2RDPA 5L3GA 4P96A 4AVPA 4I7HA 1QGPA 2HR3A 2W57A 2XVCA 1O7LA 1B9NA 5CYVA 4MEYF 4EGZA 4CZZA 2V1UA 3IWFA 5F6FA 1ULYA 4EQQA 2FOKA 2V6CA 1KA8A 2DLLA 3M1EA 1YS7A 5JHUA 2RVCA 2BE5F 3BOQA 3DPTA 4AIHA 2DQLA 1XCBA 3QU3A 2W24A 1UFMA 2QZ8A 2FBKA 4NQWA 1I1GA 4KNYA 4QLCU 1BBYA 4L9VA 3WGIA 2Y48A 4MGRA 1DP7P 1KQ0A 5BS6A 5KK1A 3NRVA 1IN7A 2HTSA 1F9NA 1GVJA 3RDIA 4M74A 2G7UA 2CW0F 3CO6C 4ZZLA 3IHUA 4GO1A 4RGRA 1B4AA 1QZYA 2XAJA 4AIKA 5ICFA 2CFXA 4NB5A 2VT3A 3KP4A 1P6RA 2JZYA 1TQPA 5FD5A 1WKMA 1XSXA 3NEUA 5DCMB 1H9GA 2OQGA 2IRFG 2Z5UA 2CO5A 3WTTC 4A6DA 2P8TA 2ETHA 1EV7A 1I5ZA 3S2WA 2X0LA 4LB5A 2PMUA 1W5TA 2HFHA 4IRIA 1FYLA 2K02A 4LJZF 3MQ0A 2OBPA 4KICA 1U5TA 4PDKA 2G9WA 1T0FA 1SAXA 1RZ4A 2G7HA 4G7ZF 4OU0A 4HF2A 5H20A 5CVUA 1XCVA 1U3EM 5DD4A 2E1CA 4GCVA 5L3DA 2YX7A 4MHGA 3KETA 2F5DA 4IHTA 5CVJA 1YFHA 1FBQA 2A69F 1K6OA 3ZMSA 4D0PA 4WF2A 2FEZA 2L4AA 4EVIA 5LHHA 3KP5A 5E1WA 4H0EA 4MTDA 3F23A 3RKWA 5D6EA 4HA8A 1KGSA 2YR2A 1W7PD 1IN4A 2RV8A 3J80Z 2K4BA 3IRRA 2EV5A 1ZG1A 1BM9A 1K79A 4R79A 4A0XA 1XD7A 4BHCA 4EJOA 1XDSA 3WODF 2PN6A 3LQQA 3HOSA 5F64A 2D2WA 2JRTA 3J81Z 2VE9A 2IT0A 5LRRA 1S3JA 2HKOA 2CSOA 1J59A 3TQNA 5HS7A 1XSDA 4XBFA 3EYIA 2Q2EA 1IAWA 3GF2A 3HYIA 1EH8A 3WE2A 1D8JA 1ZH5A 3GVAA 2M8EA 4WXDA 5ILSA 2H6BA 5E1ZB 4IJAA 3DV8A 4A12A 1AOYA 1ZREA 2P5LC 1ZLJA 2VXZA 4ON0A 1HXDA 3I71A 1G3YA 2STWA 1RNLA 2LDUA 1HKSA 2BGCA 1LB2A 2L02A 1YW8A 3GXOA 5HLIA 4WWCA 1IRGA 4G6QA 2BYVE 2O3FA 3E6BA 1KYZA 1ZARA 2L01A 2W25A 3EETA 5CVIA 2ESNA 1DPUA 3T8TA 3V4GA 1E2XA 1X3UA 2MH2A 3I53A 4LMYA 3M8EA 5LGNA 4HV6A 2O0YA 3JSOA 3FMSA 4G8XA 3K1MA 3T0YA 4GYGA 4YFXF 5LHIA 3LA7A 4M6YA 1W4MA 1HBXG 1IUYA 2ESHA 3B02A 1ONVA 1RUOA 5E17F 2GWRA 1MZBA 4CYDA 1QO0D 3KP6A 2UXNA 3OOPA 3JSPA 4BHPA 4IF4A 2P4WA 3HSFA 5HOOA 2GXBA 3VB2A 1GXQA 3HSRA 1ZN2A 4IXAA 2RGVA 4ENNA 3V7CA 2CGPA 1YYVA 2VBZA 5KVRA 2EV6A 4HQMA 4L0YB 1ZG3A 1NHAA 2P6SA 6PAXA 4UVBA 2H6CA 3R61A 2MLGA 2M87A 2RQPA 4O5VA 1L0OC 2Z33A 1B1BA 3DFGA 4KN4X 3HRTA 3RJPA 4A2UA 2QBYB 4G7OF 1K78B 5FLXZ 2IVMA 1J9IA 2ZFWA 3QPTA 3Q9VA 5DUIA 2KIMA 3BZ6A 4EV0A 3F3XA 2IP2A 1ODDA 4UV8A 1L3LA 3KEQA 4JBAA 2FQ3A 4HF0A 2OZ6A 3I64A 4HDUA 4MQVA 3WTSC 3DQVC 1YLFA 3R6SA 1STZA 2EFNA 4RAZA 3TO9A 4JQFA 4M6XA 4LG0B 3KP7A 2ZMEA 2PI0A 3KZYA 1ZHFA 4A0ZA 1WI9A 5ILVA 2Q0OA 2FBIA 5ERIA 2HOEA 5K1YA 1R1TA 1TBXA 2HQNA 3HIFA 2VC0A 2W85A 3SHFA 4HX7A 2XHKA 4LB6B 1YW9A 1SFUA 3V7SA 5ILUA 1LQ1A 5IT9Z 3BP8A 2ZNZA 2XASA 3ABTA 3DXJF 3K1PA 2EWNA 1T2KA 3GLXA 3L09A 3M7GA 5DEQA 3L9FA 5L3BA 3KP2A 1QBJA 2M1BA 3WU0A 4OOIA 4ZH4F 5D5XB 2FA5A 5ICEA 4L9JA 3ZMVA 1R00A 4GYIA 4FT8A 2F2EA 3F6VA 3HRMA 3NQOA 4HW0A 1D3YA 3GFLA 3T1BA 4LK1F 4G6DA 1OKRA 2MLKA 2LKPA 3FXRA 4B8XA 2OU2A 3C3WA 2PLYA 1BI1A 3FZVA 4I0AA 1JGSA 5BOXA 4GXOA 1J0RA 3ELKA 5JI6A 3WTXC 4LLGF 4G94A 3SQNA 3JTHA 3H92A 4I02A 5BMZA 4BAYA 2RC4A 4Y15A 4O3MA 3DEUA 4KUMA 3F8MA 4HX8A 2CQKA 5LHGA 4WXHA 1RIOH 1Z05A 3H3ZA 3HRUA 1ZG5A 1D5VA 1J2XA 2KJBA 1BI0A 1R1UA 5FGMA 2R7FA 1U5TB 5HLHA 3MWMA 2DU9A 1SD4A 1HKTA 4L5JA 3CUQA 2GA2A 5CVRA 3LA2A 5DUKA 4A5MA 5DD8A 2HQRA 4OIQF 5LRSA 2ZNYA 3E6MA 1EH7A 1ZRFA 4HOBA 4BHBA 4ENMA 1YTYA 3KE2A 3KEOA 4U88A 4U7DA 4RB0A 3I59A 1U8RA 2H27A 2ZJ2A 2DK5A 1FX7A 3KFWX 5BPIA 3BPXA 2VBWA 3TGNA 1QZZA 3MCZA 2VOPA 4YIIA 3GZ6A 2L3DA 4LGWA 3C18A 3LAPA 1XMAA 3CO7C 3KP3A 4RB1A 1JHFA 2ZCWA 3HHGA 3J80K 3TKYA 4I2OA 1DPRA 1Z1DA 3WGHA 5DV5A 1IN5A 2FMLA 3JAMK 3PFIA 1R58A 2B0LA 5D5WB 5HLGA 4QWQA 3TO7A 1FYMA 2NYXA 1LDKB 1UHWA 2OD5A 4I0BA 1BIAA 1HSJA 3J81K 5HDNA 3E97A 3BJ6A 4S05A 5D4SA 4KT5C 1IXRC 4R8HA 2EFOA 4WXCA 3P7NA 3BPVA 1BC8C 3TO6A 4FX0A 2IA1A 3D0SA 1ON2A 2QM3A 2JSCA 2TDXA 2W84A 2VN2A 2UWMA 5LEJA 4IHSA 3T8RA 5TJJA 5E8GA 1IXSB 3ERED 3L2CA 3WTWC 2LF7A 4BQAA 3WTVC 4G7HF 4B09A 2DBBA 1ZAOA 3GUDA 2F5FA 1B6AA 4UXNA 1PP8F 3FX3A 3GYHX 5A2QZ 1S8NA 2K86A 2M5WA 4PCQA 4EM2A 2UXXA 3CJNA 1SMYF 2QQBA 1U78A 2ISYA 4EM1A 5TRDA 2QQAA 5IT3A 3Q9SA 3LAJA 1PDNC 1ON1A 2H94A 3SFZA 4AWXB 4E70A 2OA4A 1F1ZA 1RUNA 5DCFA 3JAMZ 4RB3C 2YPRA 1SD6A 4BNCA 1E17A 4Y13A 4I09A 5E20A 4R1HA 2K4JA 2YX4A 5D6FA 3V8KA 4MTEA 3O2PE 1MD0A 1TQIA 2EV0A 3FMQA 4ZYGA 2M45A 1A04A 1R36A 1LEAA 3W6JB 1J5YA 2AXLA 3E6CC 1YW7A 3TOAA 3R0AA 1OYWA 2HZTA 4KA4A 2Z99A 3E5UA 2EA4A 1LEBA 5E8IA 3ROUA 3RPQA 4F7ZA 4NHJA 2LNBA 3LSTA 3SZPA 3FF5A 1IF1A 4KDPA 3W6KB 1MGTA 2QQ9A 3ZPLA 4ESBA 4OMZA 4IRHA 4EJUA 3RTRA 2MBFA 4TV7A 3T5XA 3FWEA 3V8JA 2HS5A 2IPQX 4P9UA 1YIOA 3COAC 3LFKA 1C0WA 3C1DA 1KYWA 1G3SA 1REPC 1YQAA 2VC1A 4RS8A 2GZWA 1SD7A 5LGTA 2C6YA 3PQJA 2KKOA 5FLXK 4XLNF 3F72A 4A5NA 5BQTA 1G3TA 2D1HA 1Y0UA 4HBLA 4WK8F 4P9FA 3LA3A 1SFXA 3JW4A 5J8CA 3VFZA 4G9YA 3E6DA 3WTYC 3I4PA 5DYMA 1PUEE 1FT9A 5AONA 1MKMA 1XGSA 2MH9A 3ZP5A 2HDCA 1O7FA 1S6LA 3K9TA 3M8FA 4RGUA 1O3QA 1G3WA 3FXUA 2R7DA 4Q48A 5D4RA 1T39A 2FXAA 2ZMEB 1HKQA 4HDVA 3EQLF 2X4HA 5AIPA 3E5QA 5EEHA 3CDHA 4KMFA 1ZGJA 1HSTA 5CJ9A 4LLLA 3ZN0A 5FB2A 2FNPA 1ZRDA 2DQRA 3GO5A 2GQQA 1CF7A 2BEOA 5AIQA 2RKHA 4HV5A 3O6BB 5D5VB 1W7PA 5IT9K 1BOAA 3U9GA 2DTRA 3QU6A 3GW2A 3F22A 3ZMUA 3K2ZA 1FY7A 3SZTA 4S04A 2FNAA 2A6HF 2YSRA 3C7JA 4HF1A 3JTGA 2KIFA 4OIOF 1TTYA 1FNNA 3DF8A 1T38A 3GZ5A 4KMUX 3CTAA 3P9KA 4YFKF 2V9VA 5DDGA 2IA0A 1ZYRF 3R4KA 1UHMA 2GAUA 4XSXF 1U2WA 1O3RA 3ZQ7A 1IRFA 2ZBKA 1GHCA 5HS9A 3HSEA 3MZHA 2XROA 2EFPA 3KCCA 4L9NA 3I54A 1USSA 2A68F 2OZUA 5ICCA 1FZPB 1LDJA 4UV9A 2HYFA 2VT2A 3HTUA 1BN5A 3QPHA 1QNTA 2MA3A 4RGXA 1FBSA 1FBUA 1O3SA 4LLNA 3WU1B 2NNNA 1WRJA 2K7LA 4BYYA 1YS6A 3I58A 2A3SA 1WWXA 2GXGA 4UVAA 2H09A 1IN8A 1R1VA 2P6TA 3CUQB 4OIPF 4EM0B 1XGNA 2EJRA 4ZYEA 1Z6RA 4WCGA 2FU4A 4BXUA 3RKYA 2WV0A 4KFCA 3BJOA 1MDMA 1DUXC 3J7AO 4GGGA 2NS0A 5K5OA 2EB7A 3I59B 3QAHA 3ISPA 1TW2A 4CGZA 1TNTA 2CYYA 1U5TC 4KYWA 1ZGAA 2EK5A 2J5OA 1F5TA 2A07F 2ZXJA 1ZRCA 1LDDA 4HZFA 1J7KA 5HDKA 4ESJA 4UVCA 5K5RA 1R22A 2WC2A 2CG4A 2L4MA 5CLSA 2KJCA 4KIBA 2DK8A 1RI7A 4CICA 1P92A 1KU7A 2DFIA 4LFUA 1TW3A 3VOEA 2NNYA 2JPCA 5HS8A 3WG9A 4HYEA 2BBYA 2JTVA 3FM3A 1JHHA 4EJVA 1HQCA 3AAFA 1XB4A 5FD6A 3FM5A 1DDNA 1T98A 2ACJA 1TQMA 3I0TA 1H0MA 1XSVA 3R60A 3BDDA 2V79A 5L3CA 2PMHA 1R7JA 4EGYA 2VBXA 3WGGA 2LF8A 1OYIA 1FP2A 1V3FA 1U6GA 2XAHA 2PQ8A 2GIVA 2QENA 3ML6A 3F8NA 3LWFA 3F8BA 1BI3A 5A2QK 1K7AA 4RB2C 1SMTA 2XGXA 4M9ZA 2V1DA 2FMYA 1BI2A 3IC7A 3L7WA 3QP5A 2F5EA 3HTSB 3ULQB 5JVTA 1IN6A 4U0VA 3U1DA 1YG2A 2XAFA 5LGUA 5BPDA 4EMSA 2MD5A 2RN7A 2GA1A 1R5GA 1JE8A 1R5HA 5D5UB 3KLOA 4ENKA 1FSHA 2ISZA 1I1SA 2VE8A 1USTA 2DAOA 4M9SA 3DPLC 3MFKA 1QQIA 2E1NA 2OAZA 1LNWA 2QVOA 2JT1A 3BY6A 3H3UA 1XDUA 1FWZA 4MNUA 4N9IA 2XKOA 3RIRA 2QLZA 3G73A 3K0LA 2DPDA 4Y17A 1FLIA 4FX4A 1SD5A 3KLNA 2O03A 3K69A 4OMYA 2CWEA 3GFJA 4P5OA 2XKPA 2DI3A 1CGPA 4Q4ZF 3P9IA 5HVQC 2XAGA 1EH6A 2O8XA 1SFEA 2QUFA 1I27A 4KIFA 1KU3A 1P4XA 3OV8A 2A5YB 1FC3A
chains in the Genus database with same CATH superfamily
5H6RA 5B1AH 1R9TJ 1S29A 2K9MA 3S1MJ 3HOTA 3GMEA 2QCOA 1X19A 4K2EA 5FJ8J 4XRFA 2EZKA 4UUVA 1JUMA 3F8CA 3M1CA 3LQRA 4PGHA 2R5YA 1Q1HA 2L0KA 1BJZA 2DA1A 4BY1J 1OR7A 5H6QA 2O6GE 4BH9A 5F0CA 1B72A 2IJLA 2QF7A 3FMRA 4FHTA 3RKXA 4O6JA 3HB9A 4PJJA 1E3HA 1Z7UA 3RYPA 1GXPA 1G6NA 2DFFA 4I98B 1I6XA 5DCMA 4OINF 2EFQA 3DU5A 2Q8KA 4XLPF 3OR2C 4Q5SF 2CRGA 2BW3B 1VF9A 2JPBA 2P5KA 1YO5C 4HLXA 1IG7A 4ZYDA 4ESFA 1SAUA 3EUHA 1HLVA 3N97A 1E0EA 1WSUA 1J75A 1T56A 5M5WJ 4AC0A 4MQ9F 1OYYA 2DW4A 2WY8Q 1TZLA 1JXSA 3I56I 3CC4I 3GX4X 3HUGA 1XGOA 1SFKA 3K7AJ 3GWZA 3H35A 4A6EA 4U0YA 1MNMC 1RKWA 3TDZC 4D5CA 3L2WA 1S7EA 3OMYA 1ZLKA 5F1RA 2K9QA 3OOUA 4U0WA 3OIQA 2F5CA 1V5EA 2GBYA 1CF7B 3C2BA 3H9QA 1K61A 4IPAA 2D45A 3M9AA 3BR1A 3ONQA 2VONA 2VJIA 2KIUA 4RLQA 3F8FA 1U0JA 2M7BA 1VQNI 2QSFX 4IX7A 3ZMTA 2K9LA 3CESA 2D1VA 2Z2SB 3DP7A 4Q47A 3HHHA 1FSEA 1W7PB 3B73A 1CQTA 3C2GA 2V26A 2QWWA 5IYBJ 4DQ2A 4M72A 3GFMA 2ZSIB 1BR2A 2HTJA 2LR8A 4N4OB 1G4DA 2ELHA 4A3IJ 2DDBA 2RNJA 4WX9A 2LD5A 4AD9A 3HC7A 3AG2H 4CH7A 2VLAA 2KHMA 2R5ZA 2FRHA 2R7WA 2EH3A 3SXYA 1FPQA 3ZMZA 1OCTC 1ZQ3P 1D8KA 1YJNI 1LJ9A 3CDLA 2TCTA 3W3CA 3N05A 5CQGA 1ORKA 3DEWA 4ASNA 4B1RA 3IAS2 1B59A 1KU9A 2WBMA 3BWGA 3ZMDA 2MG4A 3I55I 2Z9OA 3CMAI 5J8FA 1Z91A 2IW5A 4PGGA 5ICGA 3OS1A 4YFNF 2DYSH 2ZXWH 3GTJJ 2XB0X 3WTZA 1OPCA 2V4JC 3M8JA 5CVVA 1VQPI 2XV4S 3H3VK 2WWYA 5D8KB 1UMQA 5HDGA 3F6OA 1SC7A 3BTJA 2L54A 3VEPA 2E35A 4XL9A 3OYLA 1O3TA 1IUFA 3ZQFA 1BC7C 4I01A 2VIXA 4HSTA 2VQCA 1S9HA 1R23A 5IOYA 3IRQA 1VQKI 4CDGA 2FX0A 3L00A 3FK6A 4IQ4A 4IOCF 4A0YA 1TT0A 4LK0F 2MC3A 3ABUA 3BJAA 2P5VA 2ELKA 3LNQA 2EIJH 2WY7Q 2R7RA 1PP7U 2GLOA 1BIBA 3KIOA 2EIKH 2CUFA 2HPMA 1Z9CA 3ZQGA 2KP6A 2OQRA 3ESWB 3F21A 2NRAC 2BY0A 2E2JJ 3E5XA 2AXTC 4CHUA 5E1XA 5K5QA 2XUBA 4IQJA 3MEXA 4YIFA 3GTKJ 2J5PA 3DKXA 4ABZA 5J4VA 2Z3YA 1MJBA 5ED4A 4XSZF 1P4AA 3I5UA 1Z6TA 5LEKA 1UZCA 3R0JA 3WHCA 1FMVA 4RAYA 3IL2A 3CUOA 1A5JA 1F4KA 2OF7A 2CUJA 2YS9A 1KQ9A 1XMKA 5CQEA 3QP6A 1DGRM 4OIRF 4M9XA 5EEGA 4DNCA 1DU0A 4EJWA 1XGMA 3BTLA 3G1LA 3A2KA 3V8LA 2ZSHB 1HW5A 4LD5A 3DKWA 1UELB 4B3XA 1XS9A 4YG2F 4HQEA 3MZYA 4U7BA 1UCRA 3EDPA 3GEZA 5JLXA 1VTNC 3JRHA 1K4SA 4UNOA 2HGCA 2COMA 2WTEA 4MEXF 2ZKZA 2HPIA 4KN7X 3TDUC 4BDZA 3TOBA 1MJ9A 3ECOA 5E18F 1D0YA 3O3KA 3OYAA 5EZGA 2IS1A 4V2FA 5FO5A 2DPUA 3S17J 3OS0A 4XICA 3CCEI 2M30A 3S3NA 2HYGD 3ECHA 1MMSA 2HXOA 3Q3SA 1X1PA 5E79C 5FFXA 1MDMB 4RGSA 4C3IJ 3Q5FA 5JR3A 3AL0C 1WQ2A 1F43A 2IEKA 2NVXJ 2XSJC 3REOA 2JN6A 2UZKA 1W0UA 4L0ZB 2Y75A 3A4CA 4IO9F 5L3EA 1OMIA 5E3NA 4N0BA 1BJAA 4L18B 4L9TA 1AA7A 2LSOA 4CO8A 2KRFA 3A02A 3S14J 2ADUA 1S7AA 4HSRA 1XN7A 3FXQA 2HWVA 1TP4A 3IKVA 1PUFA 2FE3A 2A61A 2W4SA 2PG4A 3G4SI 2PEXA 4EJTA 2P7CB 1A6QA 2VOOA 3L2RA 4S0HB 2MC4A 3PQKA 4BE1A 1A6IA 3K6GA 3KZZA 2KISA 2LC2A 3A1YA 1HW1A 5HODA 3K4LA 4BY7J 3CUQC 1IRZA 2XRNA 3G3ZA 3VYSB 4FE7A 5BNGA 1VQLI 1IZ1A 3TW7A 2UV1A 1AKHB 1P2FA 2A5WA 4ZZDA 4AIJA 2PJPA 2AS5F 4KITB 4B3AA 3SEZA 4E7LA 4F52A 4KIGA 2EFWA 4Z2YA 4ZYHA 5F04A 2XAQA 3EPZA 3IWZA 1QHHD 2RQQA 5FFZA 4B47A 3CJRB 4NC6A 2A6EF 2VL8A 2F5VA 3VODA 5JFRA 3A0HC 2KDZA 1W5SA 1K4TA 3BR3A 3HOXJ 1HW2A 5FRNA 5LBQA 5C4JJ 1MMGA 1M1EB 3TMOA 1RR7A 3K1NA 3RYRA 1I3AA 2E7XA 1B9MA 4HLYA 1FYKA 4IHVA 3QRFF 1WVRA 4C2UA 2O61A 2XPWA 1JTYA 4E6KG 2HVQA 4P55A 1AWCA 1YRNA 1LVAA 2ZO4A 1TLHB 3WTUC 3DLLF 5L3FA 3EYYA 2DO7A 1T33A 2X6WA 3V7RA 3HM5A 2YU3A 4A3KJ 1MSEC 3IKTA 1P7IA 4UUSA 3TP0A 3W6VA 4PFPA 3UKGA 3G6EI 2Y2ZA 4PZJA 1KQ8A 1AHDP 3WG7H 2FSWA 4L5IA 1XG1A 5J1YA 4I76A 3BR2A 4LOCA 3W2WA 1QRYA 1H9TA 3BG3A 2XGEA 2PFBA 4XKVA 3LSGA 3ZN1A 2VODA 2OUMA 3ZOBA 4PSXA 1UB9A 2HKXA 2OC6A 1RRJA 1KU2A 1FOKA 2EPFA 1IW7F 5LLQA 3SZGA 4CCJA 2V1XA 4UHTA 4II3A 2BV6A 1O57A 4M71A 4IVNA 3GFIA 4MIMA 2QBYA 2COBA 5J6XA 3E3VA 3CLOA 1K78A 3L1PA 2FF4A 2Y30A 4V19K 4ENJA 1DGWY 4XKCA 3RI4A 1Z3YA 2E7WA 4HG2A 5EF6A 3N4MA 2LREA 2VQHA 2HEOA 1OCZH 3HBLA 4Y4RA 1V4RA 4A3BJ 2VBYA 3WE3A 1QPMA 4IRGA 4EATA 5M3FJ 1MW7A 1S7OA 2DT5A 4JK1X 4HAMA 3QPSA 2STTA 1T6SA 2XIGA 3FKJA 3OYDA 4HRIA 3U2RA 2LMDA 3GCMA 1P4WA 4CXFA 2PBIA 3KYLA 2FBHA 4JP0A 3S1NJ 2Z1DA 5E3OA 3RPUA 1VQ6I 2R3SA 2JA6J 2NAZA 1TNSA 3P9CA 3QOPA 3RKQA 4M73A 3HRSA 4AYBN 3D5LA 4DBQA 3PL8A 3FHZA 5D8LB 4ETSA 2EA2A 4N9HA 4HX4A 2Y0MA 2K27A 3MAJA 4AYBA 1D1AA 1FP1D 3O8GA 4LG0A 1MJAA 2IA2A 2A6TA 1IXCA 3TP3A 3M4OJ 3F9KA 2QYOA 2P7VB 1ZELA 4BQOA 3BROA 2RDPA 1X2NA 4CCOA 5L3GA 4P96A 4AVPA 4I7HA 2HOAA 1QGPA 2HR3A 2W57A 3TW6A 4G12A 2LKSA 4PJ0C 2XVCA 1MH4A 1O7LA 3BC8A 1B9NA 5CYVA 3ZGKA 4MEYF 4EGZA 4CZZA 2V1UA 3D1NI 2JSPA 2V9PA 3IWFA 2OCEA 5F6FA 1ULYA 4EQQA 2FOKA 2V6CA 1KA8A 2DLLA 1S72I 3ASOH 3M1EA 1YS7A 1EJ9A 4A93J 2JK3A 2LFBA 5JHUA 4PSWA 2RVCA 1FOWA 2BE5F 3BOQA 2DJIA 3DPTA 4G6TB 4AIHA 1HCRA 4C2TA 5KAFC 2HOTA 2FD5A 3HZJA 2KT0A 2MFZA 3IP4B 4OWRB 2DA6A 2DQLA 1XCBA 2VASA 3TL4X 2E5ZA 3OR1C 4M3BA 3QU3A 2XPVA 3BG7A 1ETVA 2W24A 3MD2A 1QA6A 4M3FA 2DOEA 3K70D 1UFMA 3S2HJ 4XQFA 2QZ8A 3PNVA 2FBKA 4XRMA 3JRCA 2OTLI 3LSMA 1I1GA 4NQWA 2ZC2A 1LKXA 4KNYA 4QLCU 2QGUA 1BBYA 4L9VA 3WGIA 2KRHA 4JX6A 1J09A 1I39A 2Y48A 2K9NA 4MGRA 1DP7P 4A3JJ 1KQ0A 5BS6A 5KK1A 3B6CA 3NRVA 1TT5B 1IN7A 2HTSA 3FXJA 2M7AA 4B4CA 4DJAA 1F9NA 1GVJA 3RDIA 4M74A 3K70C 1ETOA 4BUPA 4ZTFA 5K7HA 4ZDOA 3CCJI 5IP9J 2G7UA 3EUKL 1WJEA 4BEHB 1IV6A 1Y1VJ 2WAFA 2CW0F 4RM2A 3CO6C 4ZZLA 2AQFA 3IHUA 4GO1A 1IJWC 2BVLA 2ZXIA 4RGRA 5DM7F 1B4AA 1QZYA 3GZNB 5KCMA 4F55A 2DOFA 9ANTA 4LITA 2XAJA 4BQQA 1WJFA 4AIKA 5ICFA 3HL2A 2CFXA 4ZYAA 1JKQC 2DOAA 2E60A 4NB5A 2R5YB 2VT3A 3KP4A 1P6RA 3ASNH 1B72B 2JZYA 1TQPA 2VKHA 4A3GJ 5FD5A 5GAHJ 1WKMA 4XONA 1XSXA 4BJTA 3NEUA 5DCMB 3VSKA 1H9GA 2OQGA 2IRFG 5GP9A 2Z5UA 2AQEA 2CO5A 3WTTC 2NOJB 3S32A 4A6DA 2P8TA 2R92J 2O9LA 2ETHA 1EV7A 1I5ZA 2GIZA 4PUSA 3S2WA 3L2QA 2X0LA 4CUGA 1OCCH 4LB5A 2PMUA 1W5TA 2HFHA 2Y9YA 2OCCH 2K3PA 4IRIA 1FYLA 2K02A 3FXMA 5FKMA 4LJZF 3MQ0A 2OBPA 1T08B 3B6AA 3J7YJ 4KICA 3HUGB 5E3MA 1U5TA 1YE9A 4PDKA 2G9WA 1T0FA 1B8IA 1SAXA 1O4XA 2M3AA 3DPUA 1IDZA 1RZ4A 2G7HA 4G7ZF 1MBFA 4OU0A 1A36A 3K2AA 4HF2A 3HJEA 5H20A 2IGKA 2DA2A 1RPWA 4RBOA 5CVUA 1XCVA 1W36D 5FKNA 1X58A 1U3EM 4MO7A 5DD4A 4MFDA 3RZDJ 2GOXB 2E1CA 3DBHB 4GCVA 5L3DA 2YX7A 2BHYA 1JJ8C 4XIDA 4MHGA 3KETA 2F5DA 1P9QC 2EQRA 4IHTA 5CVJA 4FETA 1YFHA 1FBQA 2A69F 2R5ZB 1K6OA 3ZMSA 4D0PA 4WF2A 3G1OA 5J1UA 4IHYA 1W0TA 2FEZA 2L4AA 4EVIA 3V42A 5LHHA 1U9OA 3KP5A 5JHFA 5E1WA 4UB6C 2Z16A 4H0EA 1W36C 4MTDA 3F23A 2R7ZJ 3BZCA 3RKWA 1YIJI 3BTIA 5D6EA 4HA8A 4Y3OA 1PVEA 4ZDLA 1KGSA 5IY5H 4A3DJ 1KONA 2YR2A 4AUXA 3KPHA 4E7SA 1YOVB 1MBKA 1SANA 1W7PD 3ERMA 1IN4A 2RV8A 1W1WE 3J80Z 2K4BA 2K9SA 3IRRA 2FUG2 2EV5A 2EZLA 4ZDPA 1ZG1A 1BM9A 2CFOA 1K79A 4R79A 4A0XA 2PJRA 1XD7A 4BHCA 3PO2J 4EJOA 3OL4A 3LSRA 1XDSA 4ZJZA 2R7VA 3WODF 1WH7A 2PN6A 3LQQA 2L5QA 3HOSA 1AU7A 4RA2A 3L2UA 2E5NA 5F64A 2HQ5A 2D2WA 2L7KA 3QODA 5EGOA 2JRTA 3J81Z 2VE9A 2HXIA 2JJ7A 3CMMA 4IEJA 4FCYA 2IT0A 2HVRA 5LRRA 1S3JA 2HKOA 2CSOA 4D9JA 1RKTA 4N4NB 3I4MJ 3BR0A 1J59A 2H1LA 3TQNA 2WADA 5HS7A 2R93J 1TWHJ 1MBEA 4XBFA 5F1JA 3CJQB 1XSDA 2RAEA 3EYIA 3DU6A 2Q2EA 3QWLA 5J3LA 1JJ6C 1IAWA 3GF2A 2V6EA 3HYIA 1EH8A 3VYUB 3WE2A 1D8JA 1ZH5A 4X6AJ 4OAYA 3GVAA 2XPUA 2M34A 2M8EA 4NDLA 4EEFG 2DJNA 4WXDA 5ILSA 2DCEA 2W82A 3CCQI 2H6BA 4CA0A 4KISA 1FMWA 4BBSJ 5E1ZB 2MABA 4BU2A 2ID3A 4IJAA 5DS9A 2ELJA 3DV8A 3U21A 5J4YA 2CUEA 2W48A 4A12A 1AOYA 4E7JA 4QTRA 1ZREA 5C3EJ 1ETWA 2P5LC 1ZLJA 2VXZA 3HOVJ 1WJ5A 3FISA 4ON0A 4E7HA 2OJED 4UUTA 4PJMA 2NVUB 1HXDA 4CCLA 2F4MB 3I71A 1G3YA 2STWA 1RNLA 3E1SA 1QVTA 2LDUA 1HKSA 4XLAA 4CZCA 2BGCA 2ZMEC 5TGTA 2DTZA 1LB2A 2L02A 1YW8A 3GXOA 5HLIA 4WWCA 2QQ8A 1IRGA 2E1MC 2IGMA 4G6QA 2BYVE 2O3FA 3E6BA 3AG3H 1KYZA 1G59A 2W00A 1ZARA 2L01A 2W25A 3EETA 2M2EA 5CVIA 3OYJA 4Y33A 2LBFA 1KZHA 1MBGA 4W1UA 1LPQA 2ESNA 1DPUA 3T8TA 4XKWA 1PUFB 2XB5A 3AFHA 4NNJA 3V4GA 1E2XA 2I10A 1X3UA 2MH2A 3S16J 3I53A 4LMYA 3M8EA 4BKXA 5LGNA 4HNUA 2B9SA 4HV6A 1ZR4A 2O0YA 3JSOA 3FMSA 4G8XA 3K1MA 1MMNA 3T0YA 3HPHA 4GYGA 4YFXF 3AKZA 5LHIA 3LA7A 5JLWA 1GLNA 2LG4A 4M6YA 3OYCA 1TL8A 1W4MA 1HBXG 1IUYA 2ICWG 4NC8A 2ESHA 2DXIA 2AHQA 3B02A 1ONVA 1RUOA 2KIQA 5E17F 2M0CA 2QKLB 3JRGA 2GWRA 1MZBA 3S15J 2IS2A 4CYDA 1QO0D 3KP6A 2UXNA 3H36A 4XN0A 3OOPA 4HNTA 2DMTA 5IPAA 1WH5A 5B66C 3JSPA 2R7SA 2LY1A 2NOGA 4C9YA 1MMDA 2DA5A 2EBIA 4BHPA 4IF4A 2P4WA 4IHWA 3HSFA 2EZHA 5HOOA 3MN2A 4YELA 3H5RA 4FASD 5K7FA 3VB2A 1R71A 2GXBA 2HDDA 1QZEA 3LSKA 1GXQA 3HG9A 1Z7LA 3HSRA 1ZN2A 4IXAA 1YRNB 1Y39A 2BY3A 1JTXA 2RGVA 1MNDA 2L2OA 2K3FA 4ENNA 4DBRA 3K10A 3V7CA 4X0GA 2CGPA 1YYVA 2VBZA 3BQZA 5KVRA 1YHQI 2EV6A 4HQMA 2KZVA 3OYMA 5B3SH 4L0YB 4LG3A 1ZG3A 3BG5A 1NHAA 2P6SA 6PAXA 2L9VA 2DDAA 2EILH 4J19A 3OYIA 2L7MP 4UVBA 2BXYA 2H6CA 3W2VA 1TWCJ 2JVHA 3R61A 3CCUI 3A0BC 2X1EA 2MLGA 1FTTA 2JVGA 3CP8A 4RM3A 2Y69H 2X1DA 2HOSA 2M87A 2RQPA 3QYEA 3A01A 4ZC3A 4O5VA 3X2QH 1L0OC 2Z33A 1B1BA 2XF5A 4PK4A 4A3CJ 3DFGA 4KN4X 4CCKA 2CQ7A 3HRTA 1FOXA 5F0FA 1P7JA 4MFEA 3RJPA 4A2UA 2QBYB 4G7OF 3RZOJ 1K78B 5FLXZ 2QKMB 2IVMA 5GTHC 1LFUP 1J9IA 3J7AY 2ZFWA 3QPTA 3Q9VA 4NUBA 5DUIA 2CJJA 2KIMA 3BZ6A 3LOCA 4XMYA 4EV0A 3JRIA 3F3XA 2JA7J 4ZTJA 3H9JA 2IP2A 2DYRH 4BBRJ 1ODDA 1OCOH 2ZXHA 2JWTA 4UV8A 1TWAJ 3IH4A 2ME0A 3JRFA 3ZQLA 1L3LA 3KEQA 4JBAA 2FQ3A 2DMUA 3SEQA 4HF0A 5GADJ 2OZ6A 2WA0A 4XLCA 3FHNA 3I64A 4HDUA 4MQVA 3TBIA 3WTSC 3K4MA 3DQVC 1I3QJ 3FKIJ 1YLFA 3LFUA 1Z21A 3R6SA 4IKFA 3K4BA 5FKOA 2B7EA 1STZA 2EFNA 4RAZA 3TO9A 4JQFA 4M6XA 4LG0B 4RMNA 3KP7A 2ZMEA 1UG0A 2OPTA 2PI0A 2ZB9A 3VSLA 1X1BA 3KZYA 1RETA 3FXKA 1ZHFA 1X1DA 4A0ZA 4M3GA 1WI9A 5ILVA 1FTZA 2Q0OA 3KYCB 2FBIA 5ERIA 5EG0A 2E19A 4B48A 1VFCA 2HOEA 5K1YA 4BJ6C 1R1TA 2OV7A 4H4KC 3VDXA 1TBXA 1IV8A 2HQNA 4JX4A 3H9GA 3HIFA 2VC0A 2E1OA 2W85A 3SHFA 2FJ1A 2KMUA 4HX7A 1VQ5I 2XHKA 4JYKA 4LB6B 1SVLA 3DTIA 3SDBA 2LVSA 2VUMJ 1YW9A 1SFUA 3V7SA 5ILUA 1LQ1A 5IT9Z 3BP8A 3LL7A 2H1KA 5JVGF 1JT0A 5TISC 2ZNZA 3OWTA 2XASA 3ABTA 3DXJF 3K1PA 5EEAA 5FLMJ 2RNGA 1IO2A 2EWNA 2IS4A 1APLC 1T2KA 4C2MJ 1N77A 2W7NA 3Q0UA 3M07A 3GLXA 3L09A 3M7GA 2VJ4A 2VKDA 4AU7A 5DEQA 3L9FA 5L3BA 3KP2A 2TRTA 5FROA 4RAFA 4BDYA 2R4GA 1Z67A 2KL4A 3BCAA 1QBJA 4NQWB 3WHBA 2M1BA 2CMPA 3WU0A 4OOIA 1XMXA 4ZH4F 5D5XB 2FA5A 5ICEA 1ETKA 4L9JA 2KQRA 1XC5A 5DTDA 5EJCA 3ZMVA 1TWGJ 2VB6A 1GV5A 2XRLA 2L9SA 3OYNA 4NBQA 1R00A 4GYIA 4FT8A 1UJ8A 2F2EA 4FE4A 3F6VA 1BR4A 3DBLB 3HRMA 3NQOA 3NWTA 4YEJA 4E4HA 4HW0A 1D3YA 3GFLA 3T1BA 4LK1F 4G6DA 1OKRA 1WCMJ 4BGDA 2MLKA 1WJDA 5HLTA 3ZQHA 2LKPA 4OAZA 3FXRA 2BY2A 4B8XA 2OU2A 3K4NA 3C3WA 2PLYA 1BI1A 3FZVA 4I0AA 3NWSA 1JGSA 5BOXA 4GXOA 1J0RA 3ELKA 3OIOA 5JI6A 3KZIC 3WTXC 3ABLH 4LLGF 4GFBA 4G94A 3DTKA 3SQNA 3JTHA 3H92A 4I02A 1VQ8I 4Y52J 2QA4I 5BMZA 4BAYA 2RC4A 2X6YA 4UB8C 4Y15A 5DM6F 2DA7A 3GTMJ 4O3MA 3DEUA 4KUMA 3NARA 3F8MA 4HX8A 3RQ4A 2CQKA 3H0DA 5LHGA 2M8GX 4WXHA 2EIMH 1F36A 2LP0A 5IP7J 2LKXA 1RIOH 1UAAA 1Z05A 3H3ZA 3HRUA 3PSIA 4CCMA 4F3QA 1ZG5A 3OIPA 1D5VA 1J2XA 1D1CA 1BI0A 1NG7A 1R1UA 2KJBA 5FGMA 4AVZA 2HDWA 4BACA 3GBGA 1Y6IA 2L9NA 2R7FA 4B44A 1U5TB 2WB1N 3MWMA 5HLHA 2DU9A 1SD4A 3KEYA 1YJ9I 1B8IB 3S93A 3PIOF 1JT6A 2L7ZA 1HKTA 1K83J 1SEUA 1E3OC 4L5JA 2WB1A 3PJRA 3CUQA 4PFOA 2GA2A 4HEA2 1YX3A 4XKBA 5CVRA 2LY2A 3CP2A 3FBIB 3LA2A 5DUKA 3ZCOA 2X1CA 4A5MA 5DD8A 4L5EA 5C4XJ 2HQRA 1YX5A 5LD2C 5GAGJ 3BCBA 4DZPA 4OIQF 1WPKA 4XR6A 1N25A 3MMYB 5LRSA 2ZNYA 3E6MA 2KLOA 2VXDA 1EH7A 1ZRFA 4HOBA 4BHBA 4ENMA 1YTYA 4BXXJ 3KE2A 2CH0A 3KEOA 3IV5A 4FTHA 4D5FA 3PIPF 4U88A 3NAUA 4QPOA 4U7DA 1X3WB 1VI0A 1PJRA 4RB0A 3I59A 1U8RA 2H27A 2E34A 2ZJ2A 3EUHC 2DK5A 3DKYA 1FX7A 1JKPC 3KFWX 5BPIA 1FJLA 1ERDA 1BW6A 3BPXA 2VBWA 3TGNA 3CCRI 4XOTA 1IRXA 3PO3J 1QZZA 3MCZA 1V5GA 3CD6I 2VOPA 4YIIA 3GZ6A 2L3DA 1WZ2A 4LGWA 3C18A 2LH9A 2VKEA 2L7FP 1XMAA 3LAPA 3CO7C 1YITI 3KP3A 4RB1A 2K5CA 1JHFA 2ZCWA 3HHGA 3OSGA 2G0EA 1DQUA 3J80K 2DA3A 3TKYA 2VQGA 4I2OA 3ABMH 2JRMA 1DPRA 1Z1DA 3WGHA 1OQYA 5DV5A 1IN5A 2CQNA 2FMLA 2HU9A 3IAM2 3ZRGA 3OY9A 1I6HJ 3RCOA 4MLOA 4DOZA 3JAMK 3MKZA 3PFIA 2O5RA 5B1BH 1R58A 2B0LA 2CW8A 5D5WB 5HLGA 4QWQA 4QPQA 3TO7A 3LSJA 4A3MJ 1FYMA 4M3DA 5EGOB 2NYXA 1LDKB 1N75A 1UHWA 2M0MA 2OD5A 3PNTA 1Z77A 4I0BA 1BIAA 1HSJA 4C30A 3J81K 5HDNA 1Z3XA 2CUZA 4HNVA 3E97A 2NS8A 1Q1VA 2IAIA 3BJ6A 4S05A 5D4SA 3HKZN 4KT5C 2Y9ZA 1G8XA 1IXRC 4R8HA 2EFOA 4P1WA 4WXCA 1FIPA 2Q2EB 3P7NA 3BPVA 3LSPA 2OTJI 1X2MA 1BC8C 3TO6A 4FX0A 3L2VA 3BR6A 3HKZA 2IA1A 3D0SA 1ON2A 2QM3A 3JRDA 1D5YA 2JSCA 2TDXA 2W84A 5FKKA 2VN2A 2UWMA 5LEJA 4IHSA 3TEDA 3T8RA 5TJJA 4A3FJ 2R7XA 5E8GA 3CF2A 1POGA 3UNGC 3ZQIA 2CV1A 4FISA 3BZKA 1IXSB 3ERED 3L2CA 1VZ0A 3J7ZI 5CKTA 3WTWC 2LF7A 2X85A 1HDDC 1GUUA 1UG2A 4BQAA 3WTVC 4G7HF 4B09A 2DBBA 1ZAOA 3GUDA 2V1NA 1XTAA 4CYCA 2X51A 1OJLA 2F5FA 4X1EA 1B6AA 2R7QA 4UXNA 1PP8F 3FX3A 2F4OB 2B63J 3GYHX 5A2QZ 1S8NA 5J40A 4J00A 2K86A 2M5WA 4PCQA 4D1QA 4EM2A 1JI8A 3CLQA 3A03A 2UXXA 3VPRA 3CJNA 1SMYF 2LBFB 2QQBA 4V2GA 3S3MA 1U78A 2ISYA 3PM1A 4EM1A 3DWLE 5TRDA 2QQAA 3FXOA 5IT3A 1OISA 3Q9SA 4QIWN 3LAJA 1PDNC 1ON1A 2H94A 2CW7A 5EYRA 3SFZA 4AWXB 4E70A 2OA4A 1F1ZA 1RUNA 4II2A 5DCFA 3JAMZ 2Y0SN 4RB3C 2YPRA 1QPIA 1SD6A 2DA4A 4BNCA 4J01A 4A3EJ 1BR1A 1GDTA 1E17A 4Y13A 1SVMA 2PMZN 2Y0SA 4I09A 2K4JA 1U9NA 2VQLA 4R1HA 5E20A 2MGQA 2YX4A 5D6FA 3V8KA 4YIRX 1ACIA 1DP3A 4MTEA 4JX5A 3O2PE 1MD0A 1TQIA 2EV0A 3MVPA 3FMQA 4PJNA 2M45A 4ZYGA 5GPCA 3GTLJ 2LLKA 2JUGA 4M3EA 4BE2A 2PMZA 4XK4A 1A04A 1LFPA 4A69C 2FOWA 2VJ5A 1R36A 3DBRB 1LEAA 3W6JB 1J5YA 2AXLA 4NC7A 3E6CC 1YW7A 4IL6C 3R0AA 1OYWA 3TOAA 2F48A 2HZTA 1D0ZA 1NK3P 3E0JB 1ZGWA 4KA4A 2Z99A 2BVMA 3E5UA 2EA4A 1LEBA 2NVQJ 1V54H 2BZTA 2ZJPF 5IYCJ 3CQZJ 5E8IA 3ROUA 3CCYA 3RPQA 4F7ZA 1ZR2A 4NHJA 5EZHA 3BLYA 2LNBA 3LSTA 1MMAA 3SZPA 3FF5A 1IF1A 2CS3A 4I99C 2KFDA 4XLHA 3W6KB 3Q0WA 4KDPA 1MGTA 2QQ9A 3H0GJ 5KAIC 5HNFA 3ZPLA 5F08A 1X4OA 4ESBA 2DN0A 4OMZA 2CQQA 3HOYJ 3OYFA 2HNHA 4IRHA 4EJUA 2YU9J 1N78A 1RC9A 3RTRA 3CCSI 1LE8A 3IUOA 2VI6A 2MBFA 2DODA 1LFBA 2JA2A 2L9RA 2VKVA 3HPGA 4TV7A 3T5XA 3SJMA 3FWEA 3V8JA 2HS5A 2IPQX 3AG4H 2DT7B 3PFYA 4P9UA 4C3JJ 2CV0A 3HOWJ 2CU7A 3PUBA 1MBHA 1IC8A 1YIOA 4RLFA 2AO9A 5IOZA 3COAC 4DIQA 2R7UA 3LFKA 1C0WA 1GVDA 2FQ4A 3C1DA 3CJTB 1KYWA 3A01B 4BS9A 2KPMA 1G3SA 3DEEA 2ECCA 2WV1A 1REPC 1YQAA 2VC1A 3PSFA 4RS8A 2GZWA 1SD7A 3U1KA 2K85A 5LGTA 3O8HA 1I50J 4KT6A 2C6YA 2MW8A 3PQJA 2KKOA 2K40A 3GTPJ 3JRAA 5FLXK 4XLNF 3F72A 5M3MJ 4A5NA 5BQTA 1G3TA 2D1HA 4IZZA 3HXLA 1Y0UA 2DMNA 4HBLA 5FLVA 4WK8F 1HF0A 5J1RA 4P9FA 3LA3A 3BQYA 1SFXA 3JW4A 5J8CA 3VFZA 4DYCA 4G9YA 3E6DA 3WTYC 2D5VA 2M4GA 3I4PA 5FRMA 4XORA 5DYMA 1A35A 1PUEE 1FT9A 2HI3A 5AONA 1H88C 1MKMA 1XGSA 3K4KA 2MH9A 3ZP5A 2DT6A 2HDCA 2Q1ZB 1O7FA 1S6LA 3OSFA 3K9TA 1W5CC 3WU2C 5J47A 2ECBA 2BW3A 3M8FA 4F93B 4RGUA 1O3QA 1G3WA 2E71A 3MZ8A 3FXUA 2R7DA 1IDYA 2LOOA 4Q48A 5D4RA 1T39A 2FXAA 2ZMEB 1HKQA 4HDVA 1JKOC 3EQLF 2X4HA 5AIPA 3E5QA 5EEHA 3CDHA 5EG0B 2LK2A 4KMFA 2E1MB 1ZGJA 2VPRA 3LSHA 1HSTA 5CJ9A 4XLFA 4LLLA 1D1BA 3ZN0A 5FB2A 5GAEJ 5CPRB 4BJ5C 2FNPA 1YJWI 3OYBA 2P81A 1ZRDA 2I5UA 2DQRA 3GO5A 4CSWA 2GQQA 3RPUD 1CF7A 3QYFA 4UUSB 2BEOA 3FXLA 1EA3A 1HDPA 2M9HA 3CZ6A 5AIQA 2JA5J 2LY9A 2RKHA 2BHZA 4HV5A 5M5XJ 4PJLA 3O6BB 2MD0A 5D5VB 1W7PA 3BR5A 5IT9K 1BOAA 4LIVA 3U9GA 5F0HA 2DTRA 3QU6A 3GW2A 2HQAA 4FQGA 2CQXA 3F22A 1NG6A 3ZMUA 3K2ZA 1MSFC 3RQIA 3OYEA 3ZXSA 1FY7A 2JA8J 1EF4A 3SZTA 4S04A 2FNAA 2A6HF 2YSRA 3CF5F 2ID6A 3C7JA 4HF1A 3S1QJ 3JTGA 2KIFA 1T95A 1X1AA 4OIOF 2ZJRF 3QPLA 1XPXA 1TTYA 1FNNA 4C3HJ 3GTGJ 3DF8A 1S5LC 1T38A 3GZ5A 4KMUX 3CTAA 3P9KA 4YFKF 2V9VA 2R7OA 3SFIA 5IYDJ 5DDGA 4AM3A 2IA0A 1ZYRF 3R4KA 4GRIA 1UHMA 3D5SC 2GAUA 2DFEA 4XSXF 1U2WA 2XGDA 3MKLA 3LMMA 1WJCA 1O3RA 1ZKGA 5M5YJ 3ZQ7A 1IRFA 2ZBKA 3ABKH 1GHCA 1HA8A 5HS9A 1QVUA 3HSEA 3MZHA 4UY8I 2XROA 3G2BA 2EFPA 1V55H 5FKLA 3KCCA 4L9NA 3I54A 1USSA 3GLLA 2A68F 2OZUA 2RREA 5ICCA 1U8BA 1FZPB 1LDJA 4BXFA 2NS7A 4UV9A 2HYFA 2VT2A 3HTUA 3AL0B 1BN5A 4IHXA 1DU6A 2IGOA 3QPHA 4D7NA 1QNTA 3MKYB 1MH3A 3QYBA 4AIDA 2A05A 4RDUA 2GOMA 3OS2A 1OCPA 2MA3A 3CC2I 4Y7NJ 3H5NA 4RGXA 2NVTJ 1FBSA 1FBUA 1O3SA 2XF7A 4LLNA 5GPAA 3WU1B 2NNNA 2HVSA 1HC8A 2UUZA 1WRJA 1Y1WJ 2ZJQF 2XGCA 2HZDA 2K7LA 4BYYA 1YS6A 3I58A 2A3SA 2R7TA 1BA5A 1WWXA 2GXGA 4UVAA 2H09A 3FDYA 1SVOA 5LFAA 1IN8A 1R1VA 1ZK8A 2MYSA 2P6TA 3CUQB 2XF6A 4F92B 1MIJA 3QOEA 5E3LA 1VQ7I 1JGGA 2Y31A 3BG6A 1BW5A 2CV2A 2DFHA 4M6VA 1WI3A 4OIPF 5EDNA 1WHUA 3GTQJ 4EM0B 1XGNA 2EJRA 4ZYEA 3D5RC 3G71I 2WAEA 4DZJA 3DTEA 1E3PA 1WJBA 1Z6RA 1VQ4I 4WCGA 2E2IJ 2FU4A 1IGNA 2I8DA 4BXUA 3RKYA 2WV0A 3JREA 4KFCA 3BJOA 1MDMA 1DUXC 3J7AO 2NXNB 1RR8C 4GGGA 4DYRA 2NS0A 5K5OA 1MBJA 4XNFA 2EB7A 1BOBA 3I59B 3Q0VA 3QAHA 1A31A 3ISPA 1TW2A 4CGZA 3KYDB 3SDGA 1TNTA 2CYYA 3K4JA 2VJJA 2F6CA 2PX9A 1U5TC 2O8KA 4KYWA 2YUSA 2X48A 1T0FC 1ZGAA 2EK5A 1LUJB 2J5OA 3I4NJ 1F5TA 3CCMI 3OYGA 2ZXJA 2A07F 2VPLA 3FBNB 1LDDA 4HZFA 1J7KA 1Y56A 2KZGA 1ZRCA 2WAQN 5HDKA 3HOUJ 2N8GA 4W97A 4ESJA 4E7ZA 1AKHA 4UVCA 4XOPA 5K5RA 5C44J 1R22A 4Z6YA 2WC2A 2CG4A 1GV2A 2WAQA 2EINH 5KNLA 2X6OA 1VQMI 2L4MA 4ANJA 1WJAA 5CLSA 1R49A 2KJCA 4E7KA 1HOMA 2IGNA 4KIBA 2BXZA 2DK8A 1WFXA 1RI7A 4CICA 1P92A 1KU7A 3DLAA 4IOAF 3C2HA 2DFIA 1QHGA 2QSGX 2EZIA 1MNEA 3P5JA 4LFUA 1TW3A 1OCRH 3VOEA 3PUFA 3S8PA 2NNYA 2JPCA 5HS8A 2M4KA 3WG9A 1FEXA 4DGWB 4HYEA 4BE0A 2BBYA 2JTVA 2ME6A 1X4PA 1TC3C 3JCUC 2R0QC 2DMQA 2H8WA 3DCFA 3FM3A 2XSDC 1JHHA 4EJVA 1HQCA 3AAFA 3I9V2 3OYKA 4JOMA 1NK2P 1XB4A 5FD6A 3FM5A 1DDNA 3ZQQA 3CDIA 1T98A 1JUPA 2ACJA 3UR3C 1TQMA 3CCVI 1OR7C 3I0TA 1XSVA 2HYJA 1H0MA 3OYHA 1VQ9I 3KX2A 3R60A 2X9DA 3BDDA 2V79A 1Y0NA 5L3CA 1LVKA 2PMHA 1R7JA 4EGYA 3CMEI 2VBXA 3WGGA 4GDFA 2LF8A 1Z0XA 4CCNA 4ITVA 1OYIA 2XC7A 4A3LJ 1FP2A 1V3FA 1U6GA 2XAHA 2PQ8A 2GIVA 2GXAA 2QENA 3ML6A 3EUAA 4B43A 4XRSG 2KDOA 3F8NA 3HDDA 4CYCB 3IH2A 1RESA 1JUSA 1ITYA 3HOZJ 5F27A 1EKEA 3LWFA 2E36A 2ZFUA 3BG9A 1NH3A 3VWBA 3F8BA 1BI3A 3HEFA 2XAUA 2V9KA 5A2QK 1K7AA 4BL0B 2IS6A 4LIUA 4RB2C 3G1MA 4RAGA 5IP6A 2XDVA 2QSHX 3E7LA 2F4IA 3JR9A 3H5AA 1SMTA 2XGXA 1OLTA 3QQAA 3HGGA 4M9ZA 2V1DA 2FMYA 1BI2A 4YRVA 1K6YA 3IC7A 5KHDA 3CC7I 3L7WA 3QP5A 2F5EA 5K7ZA 3HTSB 3ULQB 1VQOI 1XX5A 1ETQA 5JVTA 1IN6A 3H1CA 2PJRB 4U0VA 1R5ID 3U1DA 1TWFJ 1YG2A 2XAFA 4QSHA 5LGUA 5BPDA 3BT9A 1GT0C 4EMSA 1V5FA 2MD5A 3CMYA 2RN7A 1R4NB 2BY1A 1PYVA 2JQ7A 2GA1A 1R5GA 3LSIA 3HGYA 1JE8A 3VYRB 1R5HA 3F0CA 4D7MA 5HNHA 5D5UB 3KLOA 4ENKA 1OFCX 1G2HA 1ETXA 1H8AC 1FSHA 2ISZA 1Y8QB 2VE8A 1SFOJ 1USTA 1I1SA 2DAOA 4M9SA 3DPLC 3MFKA 1QQIA 1VNDA 2E1NA 5GTIC 1FIAA 5B5EC 3S1RJ 4BQNA 3OL3A 2OAZA 2O7OA 2V7FA 1LNWA 3MKWB 2QVOA 2GM4A 2JT1A 3BY6A 2BOLA 2LRDA 2P0WA 3H3UA 4DW6A 2KRCA 1XDUA 4DYQA 1R4MB 1FWZA 2MSYA 2E2HJ 2IXSA 4MNUA 4N9IA 3S3OA 2XKOA 1H89C 4F91B 3S2DJ 3W2AA 1D0XA 3RIRA 3CCLI 3K4CA 3JRBA 2QLZA 3G73A 3K0LA 2DPDA 4Y17A 1R6RA 2H8RA 1FLIA 1FOYA 4FX4A 1SD5A 3PNYA 2JUCA 4XLEA 3ZQCA 3KLNA 3FIWA 2O03A 2QEXI 1X1CA 2IBDA 3K69A 1LE8B 4OMYA 2CWEA 3GFJA 3VYTB 4P5OA 1NTCA 1UHSA 1Y8RB 2NVYJ 2XKPA 2DI3A 2W1OA 3SYTA 1BL0A 4XRSA 3ZR8X 1CGPA 3FK7A 1ENHA 4Q4ZF 2X6XA 4KJZA 3I3LA 1T8IA 1JKRC 3P9IA 5HVQC 2LTPA 2XAGA 1EH6A 1WGXA 3AG1H 3IH3A 2JMWA 4U87A 4E7IA 1QU3A 3RSNA 2O8XA 2LYCA 3GTOJ 4XM3A 1SFEA 1YI2I 2QUFA 1I27A 4KIFA 1KU3A 4XN3A 3M3YJ 2DMPA 1ETYA 1P4XA 3OV8A 4BEHA 4HPQA 1X3ZB 1ZTRA 2A5YB 4I6ZA 5H2FC 1FC3A 3BTCA
chains in the Genus database with same CATH topology
5H6RA 1S29A 3HOTA 4K2EA 4XRFA 4UUVA 3F8CA 3LQRA 4PGHA 1Q1HA 1OR7A 5H6QA 2O6GE 4BH9A 2IJLA 3FMRA 4FHTA 3RKXA 4O6JA 1Z7UA 3RYPA 1GXPA 1G6NA 4I98B 1I6XA 5DCMA 4OINF 2EFQA 2Q8KA 4XLPF 4Q5SF 2JPBA 2P5KA 1YO5C 4HLXA 4ZYDA 4ESFA 3EUHA 3N97A 1WSUA 1J75A 4MQ9F 1OYYA 2DW4A 1JXSA 3GX4X 3HUGA 1XGOA 4A6EA 4U0YA 3GWZA 3TDZC 1ZLKA 5F1RA 4U0WA 2F5CA 1CF7B 4IPAA 2D45A 3M9AA 2VONA 2KIUA 3F8FA 3ZMTA 2D1VA 3DP7A 4Q47A 3HHHA 1FSEA 1W7PB 3B73A 2QWWA 4DQ2A 4M72A 3GFMA 2HTJA 1G4DA 2ELHA 2RNJA 4WX9A 4AD9A 2FRHA 3SXYA 1FPQA 3ZMZA 1D8KA 1LJ9A 4ASNA 1B59A 1KU9A 3BWGA 3ZMDA 2Z9OA 5J8FA 1Z91A 2IW5A 4PGGA 5ICGA 4YFNF 3WTZA 1OPCA 5CVVA 2XV4S 2WWYA 5D8KB 5HDGA 3F6OA 2L54A 3VEPA 1O3TA 1BC7C 4I01A 1R23A 3IRQA 4CDGA 3L00A 4A0YA 4LK0F 2MC3A 3ABUA 3BJAA 2P5VA 1PP7U 1BIBA 1Z9CA 2OQRA 3F21A 2NRAC 3E5XA 4CHUA 5E1XA 5K5QA 2XUBA 3MEXA 4YIFA 2J5PA 2Z3YA 1MJBA 5ED4A 4XSZF 1P4AA 3I5UA 1Z6TA 5LEKA 3R0JA 4RAYA 3IL2A 3CUOA 1F4KA 1KQ9A 1XMKA 3QP6A 4OIRF 4M9XA 5EEGA 4DNCA 4EJWA 1XGMA 3V8LA 1HW5A 4LD5A 3DKWA 4YG2F 4HQEA 3MZYA 4U7BA 1UCRA 3EDPA 3GEZA 1VTNC 4UNOA 2HGCA 2COMA 2WTEA 4MEXF 2ZKZA 4KN7X 3TDUC 3TOBA 1MJ9A 3ECOA 5E18F 3O3KA 5FO5A 2DPUA 2M30A 2HYGD 3ECHA 5FFXA 1MDMB 4RGSA 3Q5FA 5JR3A 1WQ2A 3REOA 2UZKA 4L0ZB 2Y75A 5L3EA 1OMIA 4L18B 4N0BA 1BJAA 4L9TA 2LSOA 4CO8A 2KRFA 2ADUA 1S7AA 1XN7A 3FXQA 2HWVA 3IKVA 2FE3A 2A61A 2PG4A 2PEXA 4EJTA 2P7CB 2VOOA 3PQKA 3KZZA 1HW1A 3CUQC 2XRNA 3G3ZA 1IZ1A 1P2FA 4ZZDA 4AIJA 2PJPA 2AS5F 4KIGA 2EFWA 4Z2YA 4ZYHA 2XAQA 3IWZA 5FFZA 2A6EF 3VODA 5JFRA 1W5SA 1HW2A 5LBQA 3RYRA 3K1NA 2E7XA 1B9MA 4HLYA 1FYKA 3QRFF 2O61A 4P55A 1AWCA 1LVAA 2ZO4A 1TLHB 3WTUC 5L3FA 3EYYA 2DO7A 3V7RA 2YU3A 3IKTA 4PZJA 1KQ8A 2FSWA 4L5IA 1H9TA 2PFBA 3ZN1A 2VODA 1UB9A 2HKXA 1KU2A 1FOKA 1IW7F 5LLQA 2V1XA 4UHTA 2BV6A 1O57A 4M71A 4IVNA 3GFIA 2QBYA 5J6XA 3E3VA 3CLOA 1K78A 2FF4A 4ENJA 3RI4A 2E7WA 3N4MA 2HEOA 1V4RA 2VBYA 3WE3A 1QPMA 4IRGA 1S7OA 2DT5A 4JK1X 4HAMA 2STTA 1T6SA 2XIGA 3U2RA 1P4WA 4CXFA 2PBIA 2FBHA 3RPUA 2R3SA 2NAZA 1TNSA 3P9CA 3QOPA 4M73A 3HRSA 3D5LA 3FHZA 5D8LB 4ETSA 2EA2A 4N9HA 4HX4A 2Y0MA 2K27A 3MAJA 1FP1D 4LG0A 1MJAA 2IA2A 1IXCA 2QYOA 2P7VB 3BROA 2RDPA 5L3GA 4P96A 4AVPA 4I7HA 1QGPA 2HR3A 2W57A 2XVCA 1O7LA 1B9NA 5CYVA 4MEYF 4EGZA 4CZZA 2V1UA 3IWFA 5F6FA 1ULYA 4EQQA 2FOKA 2V6CA 1KA8A 2DLLA 3M1EA 1YS7A 5JHUA 2RVCA 2BE5F 3BOQA 3DPTA 4AIHA 2DQLA 1XCBA 3QU3A 2W24A 1UFMA 2QZ8A 2FBKA 4NQWA 1I1GA 4KNYA 4QLCU 1BBYA 4L9VA 3WGIA 2Y48A 4MGRA 1DP7P 1KQ0A 5BS6A 5KK1A 3NRVA 1IN7A 2HTSA 1F9NA 1GVJA 3RDIA 4M74A 2G7UA 2CW0F 3CO6C 4ZZLA 3IHUA 4GO1A 4RGRA 1B4AA 1QZYA 2XAJA 4AIKA 5ICFA 2CFXA 4NB5A 2VT3A 3KP4A 1P6RA 2JZYA 1TQPA 5FD5A 1WKMA 1XSXA 3NEUA 5DCMB 1H9GA 2OQGA 2IRFG 2Z5UA 2CO5A 3WTTC 4A6DA 2P8TA 2ETHA 1EV7A 1I5ZA 3S2WA 2X0LA 4LB5A 2PMUA 1W5TA 2HFHA 4IRIA 1FYLA 2K02A 4LJZF 3MQ0A 2OBPA 4KICA 1U5TA 4PDKA 2G9WA 1T0FA 1SAXA 1RZ4A 2G7HA 4G7ZF 4OU0A 4HF2A 5H20A 5CVUA 1XCVA 1U3EM 5DD4A 2E1CA 4GCVA 5L3DA 2YX7A 4MHGA 3KETA 2F5DA 4IHTA 5CVJA 1YFHA 1FBQA 2A69F 1K6OA 3ZMSA 4D0PA 4WF2A 2FEZA 2L4AA 4EVIA 5LHHA 3KP5A 5E1WA 4H0EA 4MTDA 3F23A 3RKWA 5D6EA 4HA8A 1KGSA 2YR2A 1W7PD 1IN4A 2RV8A 3J80Z 2K4BA 3IRRA 2EV5A 1ZG1A 1BM9A 1K79A 4R79A 4A0XA 1XD7A 4BHCA 4EJOA 1XDSA 3WODF 2PN6A 3LQQA 3HOSA 5F64A 2D2WA 2JRTA 3J81Z 2VE9A 2IT0A 5LRRA 1S3JA 2HKOA 2CSOA 1J59A 3TQNA 5HS7A 1XSDA 4XBFA 3EYIA 2Q2EA 1IAWA 3GF2A 3HYIA 1EH8A 3WE2A 1D8JA 1ZH5A 3GVAA 2M8EA 4WXDA 5ILSA 2H6BA 5E1ZB 4IJAA 3DV8A 4A12A 1AOYA 1ZREA 2P5LC 1ZLJA 2VXZA 4ON0A 1HXDA 3I71A 1G3YA 2STWA 1RNLA 2LDUA 1HKSA 2BGCA 1LB2A 2L02A 1YW8A 3GXOA 5HLIA 4WWCA 1IRGA 4G6QA 2BYVE 2O3FA 3E6BA 1KYZA 1ZARA 2L01A 2W25A 3EETA 5CVIA 2ESNA 1DPUA 3T8TA 3V4GA 1E2XA 1X3UA 2MH2A 3I53A 4LMYA 3M8EA 5LGNA 4HV6A 2O0YA 3JSOA 3FMSA 4G8XA 3K1MA 3T0YA 4GYGA 4YFXF 5LHIA 3LA7A 4M6YA 1W4MA 1HBXG 1IUYA 2ESHA 3B02A 1ONVA 1RUOA 5E17F 2GWRA 1MZBA 4CYDA 1QO0D 3KP6A 2UXNA 3OOPA 3JSPA 4BHPA 4IF4A 2P4WA 3HSFA 5HOOA 2GXBA 3VB2A 1GXQA 3HSRA 1ZN2A 4IXAA 2RGVA 4ENNA 3V7CA 2CGPA 1YYVA 2VBZA 5KVRA 2EV6A 4HQMA 4L0YB 1ZG3A 1NHAA 2P6SA 6PAXA 4UVBA 2H6CA 3R61A 2MLGA 2M87A 2RQPA 4O5VA 1L0OC 2Z33A 1B1BA 3DFGA 4KN4X 3HRTA 3RJPA 4A2UA 2QBYB 4G7OF 1K78B 5FLXZ 2IVMA 1J9IA 2ZFWA 3QPTA 3Q9VA 5DUIA 2KIMA 3BZ6A 4EV0A 3F3XA 2IP2A 1ODDA 4UV8A 1L3LA 3KEQA 4JBAA 2FQ3A 4HF0A 2OZ6A 3I64A 4HDUA 4MQVA 3WTSC 3DQVC 1YLFA 3R6SA 1STZA 2EFNA 4RAZA 3TO9A 4JQFA 4M6XA 4LG0B 3KP7A 2ZMEA 2PI0A 3KZYA 1ZHFA 4A0ZA 1WI9A 5ILVA 2Q0OA 2FBIA 5ERIA 2HOEA 5K1YA 1R1TA 1TBXA 2HQNA 3HIFA 2VC0A 2W85A 3SHFA 4HX7A 2XHKA 4LB6B 1YW9A 1SFUA 3V7SA 5ILUA 1LQ1A 5IT9Z 3BP8A 2ZNZA 2XASA 3ABTA 3DXJF 3K1PA 2EWNA 1T2KA 3GLXA 3L09A 3M7GA 5DEQA 3L9FA 5L3BA 3KP2A 1QBJA 2M1BA 3WU0A 4OOIA 4ZH4F 5D5XB 2FA5A 5ICEA 4L9JA 3ZMVA 1R00A 4GYIA 4FT8A 2F2EA 3F6VA 3HRMA 3NQOA 4HW0A 1D3YA 3GFLA 3T1BA 4LK1F 4G6DA 1OKRA 2MLKA 2LKPA 3FXRA 4B8XA 2OU2A 3C3WA 2PLYA 1BI1A 3FZVA 4I0AA 1JGSA 5BOXA 4GXOA 1J0RA 3ELKA 5JI6A 3WTXC 4LLGF 4G94A 3SQNA 3JTHA 3H92A 4I02A 5BMZA 4BAYA 2RC4A 4Y15A 4O3MA 3DEUA 4KUMA 3F8MA 4HX8A 2CQKA 5LHGA 4WXHA 1RIOH 1Z05A 3H3ZA 3HRUA 1ZG5A 1D5VA 1J2XA 2KJBA 1BI0A 1R1UA 5FGMA 2R7FA 1U5TB 5HLHA 3MWMA 2DU9A 1SD4A 1HKTA 4L5JA 3CUQA 2GA2A 5CVRA 3LA2A 5DUKA 4A5MA 5DD8A 2HQRA 4OIQF 5LRSA 2ZNYA 3E6MA 1EH7A 1ZRFA 4HOBA 4BHBA 4ENMA 1YTYA 3KE2A 3KEOA 4U88A 4U7DA 4RB0A 3I59A 1U8RA 2H27A 2ZJ2A 2DK5A 1FX7A 3KFWX 5BPIA 3BPXA 2VBWA 3TGNA 1QZZA 3MCZA 2VOPA 4YIIA 3GZ6A 2L3DA 4LGWA 3C18A 3LAPA 1XMAA 3CO7C 3KP3A 4RB1A 1JHFA 2ZCWA 3HHGA 3J80K 3TKYA 4I2OA 1DPRA 1Z1DA 3WGHA 5DV5A 1IN5A 2FMLA 3JAMK 3PFIA 1R58A 2B0LA 5D5WB 5HLGA 4QWQA 3TO7A 1FYMA 2NYXA 1LDKB 1UHWA 2OD5A 4I0BA 1BIAA 1HSJA 3J81K 5HDNA 3E97A 3BJ6A 4S05A 5D4SA 4KT5C 1IXRC 4R8HA 2EFOA 4WXCA 3P7NA 3BPVA 1BC8C 3TO6A 4FX0A 2IA1A 3D0SA 1ON2A 2QM3A 2JSCA 2TDXA 2W84A 2VN2A 2UWMA 5LEJA 4IHSA 3T8RA 5TJJA 5E8GA 1IXSB 3ERED 3L2CA 3WTWC 2LF7A 4BQAA 3WTVC 4G7HF 4B09A 2DBBA 1ZAOA 3GUDA 2F5FA 1B6AA 4UXNA 1PP8F 3FX3A 3GYHX 5A2QZ 1S8NA 2K86A 2M5WA 4PCQA 4EM2A 2UXXA 3CJNA 1SMYF 2QQBA 1U78A 2ISYA 4EM1A 5TRDA 2QQAA 5IT3A 3Q9SA 3LAJA 1PDNC 1ON1A 2H94A 3SFZA 4AWXB 4E70A 2OA4A 1F1ZA 1RUNA 5DCFA 3JAMZ 4RB3C 2YPRA 1SD6A 4BNCA 1E17A 4Y13A 4I09A 5E20A 4R1HA 2K4JA 2YX4A 5D6FA 3V8KA 4MTEA 3O2PE 1MD0A 1TQIA 2EV0A 3FMQA 4ZYGA 2M45A 1A04A 1R36A 1LEAA 3W6JB 1J5YA 2AXLA 3E6CC 1YW7A 3TOAA 3R0AA 1OYWA 2HZTA 4KA4A 2Z99A 3E5UA 2EA4A 1LEBA 5E8IA 3ROUA 3RPQA 4F7ZA 4NHJA 2LNBA 3LSTA 3SZPA 3FF5A 1IF1A 4KDPA 3W6KB 1MGTA 2QQ9A 3ZPLA 4ESBA 4OMZA 4IRHA 4EJUA 3RTRA 2MBFA 4TV7A 3T5XA 3FWEA 3V8JA 2HS5A 2IPQX 4P9UA 1YIOA 3COAC 3LFKA 1C0WA 3C1DA 1KYWA 1G3SA 1REPC 1YQAA 2VC1A 4RS8A 2GZWA 1SD7A 5LGTA 2C6YA 3PQJA 2KKOA 5FLXK 4XLNF 3F72A 4A5NA 5BQTA 1G3TA 2D1HA 1Y0UA 4HBLA 4WK8F 4P9FA 3LA3A 1SFXA 3JW4A 5J8CA 3VFZA 4G9YA 3E6DA 3WTYC 3I4PA 5DYMA 1PUEE 1FT9A 5AONA 1MKMA 1XGSA 2MH9A 3ZP5A 2HDCA 1O7FA 1S6LA 3K9TA 3M8FA 4RGUA 1O3QA 1G3WA 3FXUA 2R7DA 4Q48A 5D4RA 1T39A 2FXAA 2ZMEB 1HKQA 4HDVA 3EQLF 2X4HA 5AIPA 3E5QA 5EEHA 3CDHA 4KMFA 1ZGJA 1HSTA 5CJ9A 4LLLA 3ZN0A 5FB2A 2FNPA 1ZRDA 2DQRA 3GO5A 2GQQA 1CF7A 2BEOA 5AIQA 2RKHA 4HV5A 3O6BB 5D5VB 1W7PA 5IT9K 1BOAA 3U9GA 2DTRA 3QU6A 3GW2A 3F22A 3ZMUA 3K2ZA 1FY7A 3SZTA 4S04A 2FNAA 2A6HF 2YSRA 3C7JA 4HF1A 3JTGA 2KIFA 4OIOF 1TTYA 1FNNA 3DF8A 1T38A 3GZ5A 4KMUX 3CTAA 3P9KA 4YFKF 2V9VA 5DDGA 2IA0A 1ZYRF 3R4KA 1UHMA 2GAUA 4XSXF 1U2WA 1O3RA 3ZQ7A 1IRFA 2ZBKA 1GHCA 5HS9A 3HSEA 3MZHA 2XROA 2EFPA 3KCCA 4L9NA 3I54A 1USSA 2A68F 2OZUA 5ICCA 1FZPB 1LDJA 4UV9A 2HYFA 2VT2A 3HTUA 1BN5A 3QPHA 1QNTA 2MA3A 4RGXA 1FBSA 1FBUA 1O3SA 4LLNA 3WU1B 2NNNA 1WRJA 2K7LA 4BYYA 1YS6A 3I58A 2A3SA 1WWXA 2GXGA 4UVAA 2H09A 1IN8A 1R1VA 2P6TA 3CUQB 4OIPF 4EM0B 1XGNA 2EJRA 4ZYEA 1Z6RA 4WCGA 2FU4A 4BXUA 3RKYA 2WV0A 4KFCA 3BJOA 1MDMA 1DUXC 3J7AO 4GGGA 2NS0A 5K5OA 2EB7A 3I59B 3QAHA 3ISPA 1TW2A 4CGZA 1TNTA 2CYYA 1U5TC 4KYWA 1ZGAA 2EK5A 2J5OA 1F5TA 2A07F 2ZXJA 1ZRCA 1LDDA 4HZFA 1J7KA 5HDKA 4ESJA 4UVCA 5K5RA 1R22A 2WC2A 2CG4A 2L4MA 5CLSA 2KJCA 4KIBA 2DK8A 1RI7A 4CICA 1P92A 1KU7A 2DFIA 4LFUA 1TW3A 3VOEA 2NNYA 2JPCA 5HS8A 3WG9A 4HYEA 2BBYA 2JTVA 3FM3A 1JHHA 4EJVA 1HQCA 3AAFA 1XB4A 5FD6A 3FM5A 1DDNA 1T98A 2ACJA 1TQMA 3I0TA 1H0MA 1XSVA 3R60A 3BDDA 2V79A 5L3CA 2PMHA 1R7JA 4EGYA 2VBXA 3WGGA 2LF8A 1OYIA 1FP2A 1V3FA 1U6GA 2XAHA 2PQ8A 2GIVA 2QENA 3ML6A 3F8NA 3LWFA 3F8BA 1BI3A 5A2QK 1K7AA 4RB2C 1SMTA 2XGXA 4M9ZA 2V1DA 2FMYA 1BI2A 3IC7A 3L7WA 3QP5A 2F5EA 3HTSB 3ULQB 5JVTA 1IN6A 4U0VA 3U1DA 1YG2A 2XAFA 5LGUA 5BPDA 4EMSA 2MD5A 2RN7A 2GA1A 1R5GA 1JE8A 1R5HA 5D5UB 3KLOA 4ENKA 1FSHA 2ISZA 1I1SA 2VE8A 1USTA 2DAOA 4M9SA 3DPLC 3MFKA 1QQIA 2E1NA 2OAZA 1LNWA 2QVOA 2JT1A 3BY6A 3H3UA 1XDUA 1FWZA 4MNUA 4N9IA 2XKOA 3RIRA 2QLZA 3G73A 3K0LA 2DPDA 4Y17A 1FLIA 4FX4A 1SD5A 3KLNA 2O03A 3K69A 4OMYA 2CWEA 3GFJA 4P5OA 2XKPA 2DI3A 1CGPA 4Q4ZF 3P9IA 5HVQC 2XAGA 1EH6A 2O8XA 1SFEA 2QUFA 1I27A 4KIFA 1KU3A 1P4XA 3OV8A 2A5YB 1FC3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H6R A;  1S29 A;  3HOT A;  4K2E A;  4XRF A;  4UUV A;  3F8C A;  3LQR A;  4PGH A;  1Q1H A;  1OR7 A;  5H6Q A;  2O6G E;  4BH9 A;  2IJL A;  3FMR A;  4FHT A;  3RKX A;  4O6J A;  1Z7U A;  3RYP A;  1GXP A;  1G6N A;  4I98 B;  1I6X A;  5DCM A;  4OIN F;  2EFQ A;  2Q8K A;  4XLP F;  4Q5S F;  2JPB A;  2P5K A;  1YO5 C;  4HLX A;  4ZYD A;  4ESF A;  3EUH A;  3N97 A;  1WSU A;  1J75 A;  4MQ9 F;  1OYY A;  2DW4 A;  1JXS A;  3GX4 X;  3HUG A;  1XGO A;  4A6E A;  4U0Y A;  3GWZ A;  3TDZ C;  1ZLK A;  5F1R A;  4U0W A;  2F5C A;  1CF7 B;  4IPA A;  2D45 A;  3M9A A;  2VON A;  2KIU A;  3F8F A;  3ZMT A;  2D1V A;  3DP7 A;  4Q47 A;  3HHH A;  1FSE A;  1W7P B;  3B73 A;  2QWW A;  4DQ2 A;  4M72 A;  3GFM A;  2HTJ A;  1G4D A;  2ELH A;  2RNJ A;  4WX9 A;  4AD9 A;  2FRH A;  3SXY A;  1FPQ A;  3ZMZ A;  1D8K A;  1LJ9 A;  4ASN A;  1B59 A;  1KU9 A;  3BWG A;  3ZMD A;  2Z9O A;  5J8F A;  1Z91 A;  2IW5 A;  4PGG A;  5ICG A;  4YFN F;  3WTZ A;  1OPC A;  5CVV A;  2XV4 S;  2WWY A;  5D8K B;  5HDG A;  3F6O A;  2L54 A;  3VEP A;  1O3T A;  1BC7 C;  4I01 A;  1R23 A;  3IRQ A;  4CDG A;  3L00 A;  4A0Y A;  4LK0 F;  2MC3 A;  3ABU A;  3BJA A;  2P5V A;  1PP7 U;  1BIB A;  1Z9C A;  2OQR A;  3F21 A;  2NRA C;  3E5X A;  4CHU A;  5E1X A;  5K5Q A;  2XUB A;  3MEX A;  4YIF A;  2J5P A;  2Z3Y A;  1MJB A;  5ED4 A;  4XSZ F;  1P4A A;  3I5U A;  1Z6T A;  5LEK A;  3R0J A;  4RAY A;  3IL2 A;  3CUO A;  1F4K A;  1KQ9 A;  1XMK A;  3QP6 A;  4OIR F;  4M9X A;  5EEG A;  4DNC A;  4EJW A;  1XGM A;  3V8L A;  1HW5 A;  4LD5 A;  3DKW A;  4YG2 F;  4HQE A;  3MZY A;  4U7B A;  1UCR A;  3EDP A;  3GEZ A;  1VTN C;  4UNO A;  2HGC A;  2COM A;  2WTE A;  4MEX F;  2ZKZ A;  4KN7 X;  3TDU C;  3TOB A;  1MJ9 A;  3ECO A;  5E18 F;  3O3K A;  5FO5 A;  2DPU A;  2M30 A;  2HYG D;  3ECH A;  5FFX A;  1MDM B;  4RGS A;  3Q5F A;  5JR3 A;  1WQ2 A;  3REO A;  2UZK A;  4L0Z B;  2Y75 A;  5L3E A;  1OMI A;  4L18 B;  4N0B A;  1BJA A;  4L9T A;  2LSO A;  4CO8 A;  2KRF A;  2ADU A;  1S7A A;  1XN7 A;  3FXQ A;  2HWV A;  3IKV A;  2FE3 A;  2A61 A;  2PG4 A;  2PEX A;  4EJT A;  2P7C B;  2VOO A;  3PQK A;  3KZZ A;  1HW1 A;  3CUQ C;  2XRN A;  3G3Z A;  1IZ1 A;  1P2F A;  4ZZD A;  4AIJ A;  2PJP A;  2AS5 F;  4KIG A;  2EFW A;  4Z2Y A;  4ZYH A;  2XAQ A;  3IWZ A;  5FFZ A;  2A6E F;  3VOD A;  5JFR A;  1W5S A;  1HW2 A;  5LBQ A;  3RYR A;  3K1N A;  2E7X A;  1B9M A;  4HLY A;  1FYK A;  3QRF F;  2O61 A;  4P55 A;  1AWC A;  1LVA A;  2ZO4 A;  1TLH B;  3WTU C;  5L3F A;  3EYY A;  2DO7 A;  3V7R A;  2YU3 A;  3IKT A;  4PZJ A;  1KQ8 A;  2FSW A;  4L5I A;  1H9T A;  2PFB A;  3ZN1 A;  2VOD A;  1UB9 A;  2HKX A;  1KU2 A;  1FOK A;  1IW7 F;  5LLQ A;  2V1X A;  4UHT A;  2BV6 A;  1O57 A;  4M71 A;  4IVN A;  3GFI A;  2QBY A;  5J6X A;  3E3V A;  3CLO A;  1K78 A;  2FF4 A;  4ENJ A;  3RI4 A;  2E7W A;  3N4M A;  2HEO A;  1V4R A;  2VBY A;  3WE3 A;  1QPM A;  4IRG A;  1S7O A;  2DT5 A;  4JK1 X;  4HAM A;  2STT A;  1T6S A;  2XIG A;  3U2R A;  1P4W A;  4CXF A;  2PBI A;  2FBH A;  3RPU A;  2R3S A;  2NAZ A;  1TNS A;  3P9C A;  3QOP A;  4M73 A;  3HRS A;  3D5L A;  3FHZ A;  5D8L B;  4ETS A;  2EA2 A;  4N9H A;  4HX4 A;  2Y0M A;  2K27 A;  3MAJ A;  1FP1 D;  4LG0 A;  1MJA A;  2IA2 A;  1IXC A;  2QYO A;  2P7V B;  3BRO A;  2RDP A;  5L3G A;  4P96 A;  4AVP A;  4I7H A;  1QGP A;  2HR3 A;  2W57 A;  2XVC A;  1O7L A;  1B9N A;  5CYV A;  4MEY F;  4EGZ A;  4CZZ A;  2V1U A;  3IWF A;  5F6F A;  1ULY A;  4EQQ A;  2FOK A;  2V6C A;  1KA8 A;  2DLL A;  3M1E A;  1YS7 A;  5JHU A;  2RVC A;  2BE5 F;  3BOQ A;  3DPT A;  4AIH A;  2DQL A;  1XCB A;  3QU3 A;  2W24 A;  1UFM A;  2QZ8 A;  2FBK A;  4NQW A;  1I1G A;  4KNY A;  4QLC U;  1BBY A;  4L9V A;  3WGI A;  2Y48 A;  4MGR A;  1DP7 P;  1KQ0 A;  5BS6 A;  5KK1 A;  3NRV A;  1IN7 A;  2HTS A;  1F9N A;  1GVJ A;  3RDI A;  4M74 A;  2G7U A;  2CW0 F;  3CO6 C;  4ZZL A;  3IHU A;  4GO1 A;  4RGR A;  1B4A A;  1QZY A;  2XAJ A;  4AIK A;  5ICF A;  2CFX A;  4NB5 A;  2VT3 A;  3KP4 A;  1P6R A;  2JZY A;  1TQP A;  5FD5 A;  1WKM A;  1XSX A;  3NEU A;  5DCM B;  1H9G A;  2OQG A;  2IRF G;  2Z5U A;  2CO5 A;  3WTT C;  4A6D A;  2P8T A;  2ETH A;  1EV7 A;  1I5Z A;  3S2W A;  2X0L A;  4LB5 A;  2PMU A;  1W5T A;  2HFH A;  4IRI A;  1FYL A;  2K02 A;  4LJZ F;  3MQ0 A;  2OBP A;  4KIC A;  1U5T A;  4PDK A;  2G9W A;  1T0F A;  1SAX A;  1RZ4 A;  2G7H A;  4G7Z F;  4OU0 A;  4HF2 A;  5H20 A;  5CVU A;  1XCV A;  1U3E M;  5DD4 A;  2E1C A;  4GCV A;  5L3D A;  2YX7 A;  4MHG A;  3KET A;  2F5D A;  4IHT A;  5CVJ A;  1YFH A;  1FBQ A;  2A69 F;  1K6O A;  3ZMS A;  4D0P A;  4WF2 A;  2FEZ A;  2L4A A;  4EVI A;  5LHH A;  3KP5 A;  5E1W A;  4H0E A;  4MTD A;  3F23 A;  3RKW A;  5D6E A;  4HA8 A;  1KGS A;  2YR2 A;  1W7P D;  1IN4 A;  2RV8 A;  3J80 Z;  2K4B A;  3IRR A;  2EV5 A;  1ZG1 A;  1BM9 A;  1K79 A;  4R79 A;  4A0X A;  1XD7 A;  4BHC A;  4EJO A;  1XDS A;  3WOD F;  2PN6 A;  3LQQ A;  3HOS A;  5F64 A;  2D2W A;  2JRT A;  3J81 Z;  2VE9 A;  2IT0 A;  5LRR A;  1S3J A;  2HKO A;  2CSO A;  1J59 A;  3TQN A;  5HS7 A;  1XSD A;  4XBF A;  3EYI A;  2Q2E A;  1IAW A;  3GF2 A;  3HYI A;  1EH8 A;  3WE2 A;  1D8J A;  1ZH5 A;  3GVA A;  2M8E A;  4WXD A;  5ILS A;  2H6B A;  5E1Z B;  4IJA A;  3DV8 A;  4A12 A;  1AOY A;  1ZRE A;  2P5L C;  1ZLJ A;  2VXZ A;  4ON0 A;  1HXD A;  3I71 A;  1G3Y A;  2STW A;  1RNL A;  2LDU A;  1HKS A;  2BGC A;  1LB2 A;  2L02 A;  1YW8 A;  3GXO A;  5HLI A;  4WWC A;  1IRG A;  4G6Q A;  2BYV E;  2O3F A;  3E6B A;  1KYZ A;  1ZAR A;  2L01 A;  2W25 A;  3EET A;  5CVI A;  2ESN A;  1DPU A;  3T8T A;  3V4G A;  1E2X A;  1X3U A;  2MH2 A;  3I53 A;  4LMY A;  3M8E A;  5LGN A;  4HV6 A;  2O0Y A;  3JSO A;  3FMS A;  4G8X A;  3K1M A;  3T0Y A;  4GYG A;  4YFX F;  5LHI A;  3LA7 A;  4M6Y A;  1W4M A;  1HBX G;  1IUY A;  2ESH A;  3B02 A;  1ONV A;  1RUO A;  5E17 F;  2GWR A;  1MZB A;  4CYD A;  1QO0 D;  3KP6 A;  2UXN A;  3OOP A;  3JSP A;  4BHP A;  4IF4 A;  2P4W A;  3HSF A;  5HOO A;  2GXB A;  3VB2 A;  1GXQ A;  3HSR A;  1ZN2 A;  4IXA A;  2RGV A;  4ENN A;  3V7C A;  2CGP A;  1YYV A;  2VBZ A;  5KVR A;  2EV6 A;  4HQM A;  4L0Y B;  1ZG3 A;  1NHA A;  2P6S A;  6PAX A;  4UVB A;  2H6C A;  3R61 A;  2MLG A;  2M87 A;  2RQP A;  4O5V A;  1L0O C;  2Z33 A;  1B1B A;  3DFG A;  4KN4 X;  3HRT A;  3RJP A;  4A2U A;  2QBY B;  4G7O F;  1K78 B;  5FLX Z;  2IVM A;  1J9I A;  2ZFW A;  3QPT A;  3Q9V A;  5DUI A;  2KIM A;  3BZ6 A;  4EV0 A;  3F3X A;  2IP2 A;  1ODD A;  4UV8 A;  1L3L A;  3KEQ A;  4JBA A;  2FQ3 A;  4HF0 A;  2OZ6 A;  3I64 A;  4HDU A;  4MQV A;  3WTS C;  3DQV C;  1YLF A;  3R6S A;  1STZ A;  2EFN A;  4RAZ A;  3TO9 A;  4JQF A;  4M6X A;  4LG0 B;  3KP7 A;  2ZME A;  2PI0 A;  3KZY A;  1ZHF A;  4A0Z A;  1WI9 A;  5ILV A;  2Q0O A;  2FBI A;  5ERI A;  2HOE A;  5K1Y A;  1R1T A;  1TBX A;  2HQN A;  3HIF A;  2VC0 A;  2W85 A;  3SHF A;  4HX7 A;  2XHK A;  4LB6 B;  1YW9 A;  1SFU A;  3V7S A;  5ILU A;  1LQ1 A;  5IT9 Z;  3BP8 A;  2ZNZ A;  2XAS A;  3ABT A;  3DXJ F;  3K1P A;  2EWN A;  1T2K A;  3GLX A;  3L09 A;  3M7G A;  5DEQ A;  3L9F A;  5L3B A;  3KP2 A;  1QBJ A;  2M1B A;  3WU0 A;  4OOI A;  4ZH4 F;  5D5X B;  2FA5 A;  5ICE A;  4L9J A;  3ZMV A;  1R00 A;  4GYI A;  4FT8 A;  2F2E A;  3F6V A;  3HRM A;  3NQO A;  4HW0 A;  1D3Y A;  3GFL A;  3T1B A;  4LK1 F;  4G6D A;  1OKR A;  2MLK A;  2LKP A;  3FXR A;  4B8X A;  2OU2 A;  3C3W A;  2PLY A;  1BI1 A;  3FZV A;  4I0A A;  1JGS A;  5BOX A;  4GXO A;  1J0R A;  3ELK A;  5JI6 A;  3WTX C;  4LLG F;  4G94 A;  3SQN A;  3JTH A;  3H92 A;  4I02 A;  5BMZ A;  4BAY A;  2RC4 A;  4Y15 A;  4O3M A;  3DEU A;  4KUM A;  3F8M A;  4HX8 A;  2CQK A;  5LHG A;  4WXH A;  1RIO H;  1Z05 A;  3H3Z A;  3HRU A;  1ZG5 A;  1D5V A;  1J2X A;  2KJB A;  1BI0 A;  1R1U A;  5FGM A;  2R7F A;  1U5T B;  5HLH A;  3MWM A;  2DU9 A;  1SD4 A;  1HKT A;  4L5J A;  3CUQ A;  2GA2 A;  5CVR A;  3LA2 A;  5DUK A;  4A5M A;  5DD8 A;  2HQR A;  4OIQ F;  5LRS A;  2ZNY A;  3E6M A;  1EH7 A;  1ZRF A;  4HOB A;  4BHB A;  4ENM A;  1YTY A;  3KE2 A;  3KEO A;  4U88 A;  4U7D A;  4RB0 A;  3I59 A;  1U8R A;  2H27 A;  2ZJ2 A;  2DK5 A;  1FX7 A;  3KFW X;  5BPI A;  3BPX A;  2VBW A;  3TGN A;  1QZZ A;  3MCZ A;  2VOP A;  4YII A;  3GZ6 A;  2L3D A;  4LGW A;  3C18 A;  3LAP A;  1XMA A;  3CO7 C;  3KP3 A;  4RB1 A;  1JHF A;  2ZCW A;  3HHG A;  3J80 K;  3TKY A;  4I2O A;  1DPR A;  1Z1D A;  3WGH A;  5DV5 A;  1IN5 A;  2FML A;  3JAM K;  3PFI A;  1R58 A;  2B0L A;  5D5W B;  5HLG A;  4QWQ A;  3TO7 A;  1FYM A;  2NYX A;  1LDK B;  1UHW A;  2OD5 A;  4I0B A;  1BIA A;  1HSJ A;  3J81 K;  5HDN A;  3E97 A;  3BJ6 A;  4S05 A;  5D4S A;  4KT5 C;  1IXR C;  4R8H A;  2EFO A;  4WXC A;  3P7N A;  3BPV A;  1BC8 C;  3TO6 A;  4FX0 A;  2IA1 A;  3D0S A;  1ON2 A;  2QM3 A;  2JSC A;  2TDX A;  2W84 A;  2VN2 A;  2UWM A;  5LEJ A;  4IHS A;  3T8R A;  5TJJ A;  5E8G A;  1IXS B;  3ERE D;  3L2C A;  3WTW C;  2LF7 A;  4BQA A;  3WTV C;  4G7H F;  4B09 A;  2DBB A;  1ZAO A;  3GUD A;  2F5F A;  1B6A A;  4UXN A;  1PP8 F;  3FX3 A;  3GYH X;  5A2Q Z;  1S8N A;  2K86 A;  2M5W A;  4PCQ A;  4EM2 A;  2UXX A;  3CJN A;  1SMY F;  2QQB A;  1U78 A;  2ISY A;  4EM1 A;  5TRD A;  2QQA A;  5IT3 A;  3Q9S A;  3LAJ A;  1PDN C;  1ON1 A;  2H94 A;  3SFZ A;  4AWX B;  4E70 A;  2OA4 A;  1F1Z A;  1RUN A;  5DCF A;  3JAM Z;  4RB3 C;  2YPR A;  1SD6 A;  4BNC A;  1E17 A;  4Y13 A;  4I09 A;  5E20 A;  4R1H A;  2K4J A;  2YX4 A;  5D6F A;  3V8K A;  4MTE A;  3O2P E;  1MD0 A;  1TQI A;  2EV0 A;  3FMQ A;  4ZYG A;  2M45 A;  1A04 A;  1R36 A;  1LEA A;  3W6J B;  1J5Y A;  2AXL A;  3E6C C;  1YW7 A;  3TOA A;  3R0A A;  1OYW A;  2HZT A;  4KA4 A;  2Z99 A;  3E5U A;  2EA4 A;  1LEB A;  5E8I A;  3ROU A;  3RPQ A;  4F7Z A;  4NHJ A;  2LNB A;  3LST A;  3SZP A;  3FF5 A;  1IF1 A;  4KDP A;  3W6K B;  1MGT A;  2QQ9 A;  3ZPL A;  4ESB A;  4OMZ A;  4IRH A;  4EJU A;  3RTR A;  2MBF A;  4TV7 A;  3T5X A;  3FWE A;  3V8J A;  2HS5 A;  2IPQ X;  4P9U A;  1YIO A;  3COA C;  3LFK A;  1C0W A;  3C1D A;  1KYW A;  1G3S A;  1REP C;  1YQA A;  2VC1 A;  4RS8 A;  2GZW A;  1SD7 A;  5LGT A;  2C6Y A;  3PQJ A;  2KKO A;  5FLX K;  4XLN F;  3F72 A;  4A5N A;  5BQT A;  1G3T A;  2D1H A;  1Y0U A;  4HBL A;  4WK8 F;  4P9F A;  3LA3 A;  1SFX A;  3JW4 A;  5J8C A;  3VFZ A;  4G9Y A;  3E6D A;  3WTY C;  3I4P A;  5DYM A;  1PUE E;  1FT9 A;  5AON A;  1MKM A;  1XGS A;  2MH9 A;  3ZP5 A;  2HDC A;  1O7F A;  1S6L A;  3K9T A;  3M8F A;  4RGU A;  1O3Q A;  1G3W A;  3FXU A;  2R7D A;  4Q48 A;  5D4R A;  1T39 A;  2FXA A;  2ZME B;  1HKQ A;  4HDV A;  3EQL F;  2X4H A;  5AIP A;  3E5Q A;  5EEH A;  3CDH A;  4KMF A;  1ZGJ A;  1HST A;  5CJ9 A;  4LLL A;  3ZN0 A;  5FB2 A;  2FNP A;  1ZRD A;  2DQR A;  3GO5 A;  2GQQ A;  1CF7 A;  2BEO A;  5AIQ A;  2RKH A;  4HV5 A;  3O6B B;  5D5V B;  1W7P A;  5IT9 K;  1BOA A;  3U9G A;  2DTR A;  3QU6 A;  3GW2 A;  3F22 A;  3ZMU A;  3K2Z A;  1FY7 A;  3SZT A;  4S04 A;  2FNA A;  2A6H F;  2YSR A;  3C7J A;  4HF1 A;  3JTG A;  2KIF A;  4OIO F;  1TTY A;  1FNN A;  3DF8 A;  1T38 A;  3GZ5 A;  4KMU X;  3CTA A;  3P9K A;  4YFK F;  2V9V A;  5DDG A;  2IA0 A;  1ZYR F;  3R4K A;  1UHM A;  2GAU A;  4XSX F;  1U2W A;  1O3R A;  3ZQ7 A;  1IRF A;  2ZBK A;  1GHC A;  5HS9 A;  3HSE A;  3MZH A;  2XRO A;  2EFP A;  3KCC A;  4L9N A;  3I54 A;  1USS A;  2A68 F;  2OZU A;  5ICC A;  1FZP B;  1LDJ A;  4UV9 A;  2HYF A;  2VT2 A;  3HTU A;  1BN5 A;  3QPH A;  1QNT A;  2MA3 A;  4RGX A;  1FBS A;  1FBU A;  1O3S A;  4LLN A;  3WU1 B;  2NNN A;  1WRJ A;  2K7L A;  4BYY A;  1YS6 A;  3I58 A;  2A3S A;  1WWX A;  2GXG A;  4UVA A;  2H09 A;  1IN8 A;  1R1V A;  2P6T A;  3CUQ B;  4OIP F;  4EM0 B;  1XGN A;  2EJR A;  4ZYE A;  1Z6R A;  4WCG A;  2FU4 A;  4BXU A;  3RKY A;  2WV0 A;  4KFC A;  3BJO A;  1MDM A;  1DUX C;  3J7A O;  4GGG A;  2NS0 A;  5K5O A;  2EB7 A;  3I59 B;  3QAH A;  3ISP A;  1TW2 A;  4CGZ A;  1TNT A;  2CYY A;  1U5T C;  4KYW A;  1ZGA A;  2EK5 A;  2J5O A;  1F5T A;  2A07 F;  2ZXJ A;  1ZRC A;  1LDD A;  4HZF A;  1J7K A;  5HDK A;  4ESJ A;  4UVC A;  5K5R A;  1R22 A;  2WC2 A;  2CG4 A;  2L4M A;  5CLS A;  2KJC A;  4KIB A;  2DK8 A;  1RI7 A;  4CIC A;  1P92 A;  1KU7 A;  2DFI A;  4LFU A;  1TW3 A;  3VOE A;  2NNY A;  2JPC A;  5HS8 A;  3WG9 A;  4HYE A;  2BBY A;  2JTV A;  3FM3 A;  1JHH A;  4EJV A;  1HQC A;  3AAF A;  1XB4 A;  5FD6 A;  3FM5 A;  1DDN A;  1T98 A;  2ACJ A;  1TQM A;  3I0T A;  1H0M A;  1XSV A;  3R60 A;  3BDD A;  2V79 A;  5L3C A;  2PMH A;  1R7J A;  4EGY A;  2VBX A;  3WGG A;  2LF8 A;  1OYI A;  1FP2 A;  1V3F A;  1U6G A;  2XAH A;  2PQ8 A;  2GIV A;  2QEN A;  3ML6 A;  3F8N A;  3LWF A;  3F8B A;  1BI3 A;  5A2Q K;  1K7A A;  4RB2 C;  1SMT A;  2XGX A;  4M9Z A;  2V1D A;  2FMY A;  1BI2 A;  3IC7 A;  3L7W A;  3QP5 A;  2F5E A;  3HTS B;  3ULQ B;  5JVT A;  1IN6 A;  4U0V A;  3U1D A;  1YG2 A;  2XAF A;  5LGU A;  5BPD A;  4EMS A;  2MD5 A;  2RN7 A;  2GA1 A;  1R5G A;  1JE8 A;  1R5H A;  5D5U B;  3KLO A;  4ENK A;  1FSH A;  2ISZ A;  1I1S A;  2VE8 A;  1UST A;  2DAO A;  4M9S A;  3DPL C;  3MFK A;  1QQI A;  2E1N A;  2OAZ A;  1LNW A;  2QVO A;  2JT1 A;  3BY6 A;  3H3U A;  1XDU A;  1FWZ A;  4MNU A;  4N9I A;  2XKO A;  3RIR A;  2QLZ A;  3G73 A;  3K0L A;  2DPD A;  4Y17 A;  1FLI A;  4FX4 A;  1SD5 A;  3KLN A;  2O03 A;  3K69 A;  4OMY A;  2CWE A;  3GFJ A;  4P5O A;  2XKP A;  2DI3 A;  1CGP A;  4Q4Z F;  3P9I A;  5HVQ C;  2XAG A;  1EH6 A;  2O8X A;  1SFE A;  2QUF A;  1I27 A;  4KIF A;  1KU3 A;  1P4X A;  3OV8 A;  2A5Y B;  1FC3 A; 
#chains in the Genus database with same CATH topology
 5H6R A;  5B1A H;  1R9T J;  1S29 A;  2K9M A;  3S1M J;  3HOT A;  3GME A;  2QCO A;  1X19 A;  4K2E A;  5FJ8 J;  4XRF A;  2EZK A;  4UUV A;  1JUM A;  3F8C A;  3M1C A;  3LQR A;  4PGH A;  2R5Y A;  1Q1H A;  2L0K A;  1BJZ A;  2DA1 A;  4BY1 J;  1OR7 A;  5H6Q A;  2O6G E;  4BH9 A;  5F0C A;  1B72 A;  2IJL A;  2QF7 A;  3FMR A;  4FHT A;  3RKX A;  4O6J A;  3HB9 A;  4PJJ A;  1E3H A;  1Z7U A;  3RYP A;  1GXP A;  1G6N A;  2DFF A;  4I98 B;  1I6X A;  5DCM A;  4OIN F;  2EFQ A;  3DU5 A;  2Q8K A;  4XLP F;  3OR2 C;  4Q5S F;  2CRG A;  2BW3 B;  1VF9 A;  2JPB A;  2P5K A;  1YO5 C;  4HLX A;  1IG7 A;  4ZYD A;  4ESF A;  1SAU A;  3EUH A;  1HLV A;  3N97 A;  1E0E A;  1WSU A;  1J75 A;  1T56 A;  5M5W J;  4AC0 A;  4MQ9 F;  1OYY A;  2DW4 A;  2WY8 Q;  1TZL A;  1JXS A;  3I56 I;  3CC4 I;  3GX4 X;  3HUG A;  1XGO A;  1SFK A;  3K7A J;  3GWZ A;  3H35 A;  4A6E A;  4U0Y A;  1MNM C;  1RKW A;  3TDZ C;  4D5C A;  3L2W A;  1S7E A;  3OMY A;  1ZLK A;  5F1R A;  2K9Q A;  3OOU A;  4U0W A;  3OIQ A;  2F5C A;  1V5E A;  2GBY A;  1CF7 B;  3C2B A;  3H9Q A;  1K61 A;  4IPA A;  2D45 A;  3M9A A;  3BR1 A;  3ONQ A;  2VON A;  2VJI A;  2KIU A;  4RLQ A;  3F8F A;  1U0J A;  2M7B A;  1VQN I;  2QSF X;  4IX7 A;  3ZMT A;  2K9L A;  3CES A;  2D1V A;  2Z2S B;  3DP7 A;  4Q47 A;  3HHH A;  1FSE A;  1W7P B;  3B73 A;  1CQT A;  3C2G A;  2V26 A;  2QWW A;  5IYB J;  4DQ2 A;  4M72 A;  3GFM A;  2ZSI B;  1BR2 A;  2HTJ A;  2LR8 A;  4N4O B;  1G4D A;  2ELH A;  4A3I J;  2DDB A;  2RNJ A;  4WX9 A;  2LD5 A;  4AD9 A;  3HC7 A;  3AG2 H;  4CH7 A;  2VLA A;  2KHM A;  2R5Z A;  2FRH A;  2R7W A;  2EH3 A;  3SXY A;  1FPQ A;  3ZMZ A;  1OCT C;  1ZQ3 P;  1D8K A;  1YJN I;  1LJ9 A;  3CDL A;  2TCT A;  3W3C A;  3N05 A;  5CQG A;  1ORK A;  3DEW A;  4ASN A;  4B1R A;  3IAS 2;  1B59 A;  1KU9 A;  2WBM A;  3BWG A;  3ZMD A;  2MG4 A;  3I55 I;  2Z9O A;  3CMA I;  5J8F A;  1Z91 A;  2IW5 A;  4PGG A;  5ICG A;  3OS1 A;  4YFN F;  2DYS H;  2ZXW H;  3GTJ J;  2XB0 X;  3WTZ A;  1OPC A;  2V4J C;  3M8J A;  5CVV A;  1VQP I;  2XV4 S;  3H3V K;  2WWY A;  5D8K B;  1UMQ A;  5HDG A;  3F6O A;  1SC7 A;  3BTJ A;  2L54 A;  3VEP A;  2E35 A;  4XL9 A;  3OYL A;  1O3T A;  1IUF A;  3ZQF A;  1BC7 C;  4I01 A;  2VIX A;  4HST A;  2VQC A;  1S9H A;  1R23 A;  5IOY A;  3IRQ A;  1VQK I;  4CDG A;  2FX0 A;  3L00 A;  3FK6 A;  4IQ4 A;  4IOC F;  4A0Y A;  1TT0 A;  4LK0 F;  2MC3 A;  3ABU A;  3BJA A;  2P5V A;  2ELK A;  3LNQ A;  2EIJ H;  2WY7 Q;  2R7R A;  1PP7 U;  2GLO A;  1BIB A;  3KIO A;  2EIK H;  2CUF A;  2HPM A;  1Z9C A;  3ZQG A;  2KP6 A;  2OQR A;  3ESW B;  3F21 A;  2NRA C;  2BY0 A;  2E2J J;  3E5X A;  2AXT C;  4CHU A;  5E1X A;  5K5Q A;  2XUB A;  4IQJ A;  3MEX A;  4YIF A;  3GTK J;  2J5P A;  3DKX A;  4ABZ A;  5J4V A;  2Z3Y A;  1MJB A;  5ED4 A;  4XSZ F;  1P4A A;  3I5U A;  1Z6T A;  5LEK A;  1UZC A;  3R0J A;  3WHC A;  1FMV A;  4RAY A;  3IL2 A;  3CUO A;  1A5J A;  1F4K A;  2OF7 A;  2CUJ A;  2YS9 A;  1KQ9 A;  1XMK A;  5CQE A;  3QP6 A;  1DGR M;  4OIR F;  4M9X A;  5EEG A;  4DNC A;  1DU0 A;  4EJW A;  1XGM A;  3BTL A;  3G1L A;  3A2K A;  3V8L A;  2ZSH B;  1HW5 A;  4LD5 A;  3DKW A;  1UEL B;  4B3X A;  1XS9 A;  4YG2 F;  4HQE A;  3MZY A;  4U7B A;  1UCR A;  3EDP A;  3GEZ A;  5JLX A;  1VTN C;  3JRH A;  1K4S A;  4UNO A;  2HGC A;  2COM A;  2WTE A;  4MEX F;  2ZKZ A;  2HPI A;  4KN7 X;  3TDU C;  4BDZ A;  3TOB A;  1MJ9 A;  3ECO A;  5E18 F;  1D0Y A;  3O3K A;  3OYA A;  5EZG A;  2IS1 A;  4V2F A;  5FO5 A;  2DPU A;  3S17 J;  3OS0 A;  4XIC A;  3CCE I;  2M30 A;  3S3N A;  2HYG D;  3ECH A;  1MMS A;  2HXO A;  3Q3S A;  1X1P A;  5E79 C;  5FFX A;  1MDM B;  4RGS A;  4C3I J;  3Q5F A;  5JR3 A;  3AL0 C;  1WQ2 A;  1F43 A;  2IEK A;  2NVX J;  2XSJ C;  3REO A;  2JN6 A;  2UZK A;  1W0U A;  4L0Z B;  2Y75 A;  3A4C A;  4IO9 F;  5L3E A;  1OMI A;  5E3N A;  4N0B A;  1BJA A;  4L18 B;  4L9T A;  1AA7 A;  2LSO A;  4CO8 A;  2KRF A;  3A02 A;  3S14 J;  2ADU A;  1S7A A;  4HSR A;  1XN7 A;  3FXQ A;  2HWV A;  1TP4 A;  3IKV A;  1PUF A;  2FE3 A;  2A61 A;  2W4S A;  2PG4 A;  3G4S I;  2PEX A;  4EJT A;  2P7C B;  1A6Q A;  2VOO A;  3L2R A;  4S0H B;  2MC4 A;  3PQK A;  4BE1 A;  1A6I A;  3K6G A;  3KZZ A;  2KIS A;  2LC2 A;  3A1Y A;  1HW1 A;  5HOD A;  3K4L A;  4BY7 J;  3CUQ C;  1IRZ A;  2XRN A;  3G3Z A;  3VYS B;  4FE7 A;  5BNG A;  1VQL I;  1IZ1 A;  3TW7 A;  2UV1 A;  1AKH B;  1P2F A;  2A5W A;  4ZZD A;  4AIJ A;  2PJP A;  2AS5 F;  4KIT B;  4B3A A;  3SEZ A;  4E7L A;  4F52 A;  4KIG A;  2EFW A;  4Z2Y A;  4ZYH A;  5F04 A;  2XAQ A;  3EPZ A;  3IWZ A;  1QHH D;  2RQQ A;  5FFZ A;  4B47 A;  3CJR B;  4NC6 A;  2A6E F;  2VL8 A;  2F5V A;  3VOD A;  5JFR A;  3A0H C;  2KDZ A;  1W5S A;  1K4T A;  3BR3 A;  3HOX J;  1HW2 A;  5FRN A;  5LBQ A;  5C4J J;  1MMG A;  1M1E B;  3TMO A;  1RR7 A;  3K1N A;  3RYR A;  1I3A A;  2E7X A;  1B9M A;  4HLY A;  1FYK A;  4IHV A;  3QRF F;  1WVR A;  4C2U A;  2O61 A;  2XPW A;  1JTY A;  4E6K G;  2HVQ A;  4P55 A;  1AWC A;  1YRN A;  1LVA A;  2ZO4 A;  1TLH B;  3WTU C;  3DLL F;  5L3F A;  3EYY A;  2DO7 A;  1T33 A;  2X6W A;  3V7R A;  3HM5 A;  2YU3 A;  4A3K J;  1MSE C;  3IKT A;  1P7I A;  4UUS A;  3TP0 A;  3W6V A;  4PFP A;  3UKG A;  3G6E I;  2Y2Z A;  4PZJ A;  1KQ8 A;  1AHD P;  3WG7 H;  2FSW A;  4L5I A;  1XG1 A;  5J1Y A;  4I76 A;  3BR2 A;  4LOC A;  3W2W A;  1QRY A;  1H9T A;  3BG3 A;  2XGE A;  2PFB A;  4XKV A;  3LSG A;  3ZN1 A;  2VOD A;  2OUM A;  3ZOB A;  4PSX A;  1UB9 A;  2HKX A;  2OC6 A;  1RRJ A;  1KU2 A;  1FOK A;  2EPF A;  1IW7 F;  5LLQ A;  3SZG A;  4CCJ A;  2V1X A;  4UHT A;  4II3 A;  2BV6 A;  1O57 A;  4M71 A;  4IVN A;  3GFI A;  4MIM A;  2QBY A;  2COB A;  5J6X A;  3E3V A;  3CLO A;  1K78 A;  3L1P A;  2FF4 A;  2Y30 A;  4V19 K;  4ENJ A;  1DGW Y;  4XKC A;  3RI4 A;  1Z3Y A;  2E7W A;  4HG2 A;  5EF6 A;  3N4M A;  2LRE A;  2VQH A;  2HEO A;  1OCZ H;  3HBL A;  4Y4R A;  1V4R A;  4A3B J;  2VBY A;  3WE3 A;  1QPM A;  4IRG A;  4EAT A;  5M3F J;  1MW7 A;  1S7O A;  2DT5 A;  4JK1 X;  4HAM A;  3QPS A;  2STT A;  1T6S A;  2XIG A;  3FKJ A;  3OYD A;  4HRI A;  3U2R A;  2LMD A;  3GCM A;  1P4W A;  4CXF A;  2PBI A;  3KYL A;  2FBH A;  4JP0 A;  3S1N J;  2Z1D A;  5E3O A;  3RPU A;  1VQ6 I;  2R3S A;  2JA6 J;  2NAZ A;  1TNS A;  3P9C A;  3QOP A;  3RKQ A;  4M73 A;  3HRS A;  4AYB N;  3D5L A;  4DBQ A;  3PL8 A;  3FHZ A;  5D8L B;  4ETS A;  2EA2 A;  4N9H A;  4HX4 A;  2Y0M A;  2K27 A;  3MAJ A;  4AYB A;  1D1A A;  1FP1 D;  3O8G A;  4LG0 A;  1MJA A;  2IA2 A;  2A6T A;  1IXC A;  3TP3 A;  3M4O J;  3F9K A;  2QYO A;  2P7V B;  1ZEL A;  4BQO A;  3BRO A;  2RDP A;  1X2N A;  4CCO A;  5L3G A;  4P96 A;  4AVP A;  4I7H A;  2HOA A;  1QGP A;  2HR3 A;  2W57 A;  3TW6 A;  4G12 A;  2LKS A;  4PJ0 C;  2XVC A;  1MH4 A;  1O7L A;  3BC8 A;  1B9N A;  5CYV A;  3ZGK A;  4MEY F;  4EGZ A;  4CZZ A;  2V1U A;  3D1N I;  2JSP A;  2V9P A;  3IWF A;  2OCE A;  5F6F A;  1ULY A;  4EQQ A;  2FOK A;  2V6C A;  1KA8 A;  2DLL A;  1S72 I;  3ASO H;  3M1E A;  1YS7 A;  1EJ9 A;  4A93 J;  2JK3 A;  2LFB A;  5JHU A;  4PSW A;  2RVC A;  1FOW A;  2BE5 F;  3BOQ A;  2DJI A;  3DPT A;  4G6T B;  4AIH A;  1HCR A;  4C2T A;  5KAF C;  2HOT A;  2FD5 A;  3HZJ A;  2KT0 A;  2MFZ A;  3IP4 B;  4OWR B;  2DA6 A;  2DQL A;  1XCB A;  2VAS A;  3TL4 X;  2E5Z A;  3OR1 C;  4M3B A;  3QU3 A;  2XPV A;  3BG7 A;  1ETV A;  2W24 A;  3MD2 A;  1QA6 A;  4M3F A;  2DOE A;  3K70 D;  1UFM A;  3S2H J;  4XQF A;  2QZ8 A;  3PNV A;  2FBK A;  4XRM A;  3JRC A;  2OTL I;  3LSM A;  1I1G A;  4NQW A;  2ZC2 A;  1LKX A;  4KNY A;  4QLC U;  2QGU A;  1BBY A;  4L9V A;  3WGI A;  2KRH A;  4JX6 A;  1J09 A;  1I39 A;  2Y48 A;  2K9N A;  4MGR A;  1DP7 P;  4A3J J;  1KQ0 A;  5BS6 A;  5KK1 A;  3B6C A;  3NRV A;  1TT5 B;  1IN7 A;  2HTS A;  3FXJ A;  2M7A A;  4B4C A;  4DJA A;  1F9N A;  1GVJ A;  3RDI A;  4M74 A;  3K70 C;  1ETO A;  4BUP A;  4ZTF A;  5K7H A;  4ZDO A;  3CCJ I;  5IP9 J;  2G7U A;  3EUK L;  1WJE A;  4BEH B;  1IV6 A;  1Y1V J;  2WAF A;  2CW0 F;  4RM2 A;  3CO6 C;  4ZZL A;  2AQF A;  3IHU A;  4GO1 A;  1IJW C;  2BVL A;  2ZXI A;  4RGR A;  5DM7 F;  1B4A A;  1QZY A;  3GZN B;  5KCM A;  4F55 A;  2DOF A;  9ANT A;  4LIT A;  2XAJ A;  4BQQ A;  1WJF A;  4AIK A;  5ICF A;  3HL2 A;  2CFX A;  4ZYA A;  1JKQ C;  2DOA A;  2E60 A;  4NB5 A;  2R5Y B;  2VT3 A;  3KP4 A;  1P6R A;  3ASN H;  1B72 B;  2JZY A;  1TQP A;  2VKH A;  4A3G J;  5FD5 A;  5GAH J;  1WKM A;  4XON A;  1XSX A;  4BJT A;  3NEU A;  5DCM B;  3VSK A;  1H9G A;  2OQG A;  2IRF G;  5GP9 A;  2Z5U A;  2AQE A;  2CO5 A;  3WTT C;  2NOJ B;  3S32 A;  4A6D A;  2P8T A;  2R92 J;  2O9L A;  2ETH A;  1EV7 A;  1I5Z A;  2GIZ A;  4PUS A;  3S2W A;  3L2Q A;  2X0L A;  4CUG A;  1OCC H;  4LB5 A;  2PMU A;  1W5T A;  2HFH A;  2Y9Y A;  2OCC H;  2K3P A;  4IRI A;  1FYL A;  2K02 A;  3FXM A;  5FKM A;  4LJZ F;  3MQ0 A;  2OBP A;  1T08 B;  3B6A A;  3J7Y J;  4KIC A;  3HUG B;  5E3M A;  1U5T A;  1YE9 A;  4PDK A;  2G9W A;  1T0F A;  1B8I A;  1SAX A;  1O4X A;  2M3A A;  3DPU A;  1IDZ A;  1RZ4 A;  2G7H A;  4G7Z F;  1MBF A;  4OU0 A;  1A36 A;  3K2A A;  4HF2 A;  3HJE A;  5H20 A;  2IGK A;  2DA2 A;  1RPW A;  4RBO A;  5CVU A;  1XCV A;  1W36 D;  5FKN A;  1X58 A;  1U3E M;  4MO7 A;  5DD4 A;  4MFD A;  3RZD J;  2GOX B;  2E1C A;  3DBH B;  4GCV A;  5L3D A;  2YX7 A;  2BHY A;  1JJ8 C;  4XID A;  4MHG A;  3KET A;  2F5D A;  1P9Q C;  2EQR A;  4IHT A;  5CVJ A;  4FET A;  1YFH A;  1FBQ A;  2A69 F;  2R5Z B;  1K6O A;  3ZMS A;  4D0P A;  4WF2 A;  3G1O A;  5J1U A;  4IHY A;  1W0T A;  2FEZ A;  2L4A A;  4EVI A;  3V42 A;  5LHH A;  1U9O A;  3KP5 A;  5JHF A;  5E1W A;  4UB6 C;  2Z16 A;  4H0E A;  1W36 C;  4MTD A;  3F23 A;  2R7Z J;  3BZC A;  3RKW A;  1YIJ I;  3BTI A;  5D6E A;  4HA8 A;  4Y3O A;  1PVE A;  4ZDL A;  1KGS A;  5IY5 H;  4A3D J;  1KON A;  2YR2 A;  4AUX A;  3KPH A;  4E7S A;  1YOV B;  1MBK A;  1SAN A;  1W7P D;  3ERM A;  1IN4 A;  2RV8 A;  1W1W E;  3J80 Z;  2K4B A;  2K9S A;  3IRR A;  2FUG 2;  2EV5 A;  2EZL A;  4ZDP A;  1ZG1 A;  1BM9 A;  2CFO A;  1K79 A;  4R79 A;  4A0X A;  2PJR A;  1XD7 A;  4BHC A;  3PO2 J;  4EJO A;  3OL4 A;  3LSR A;  1XDS A;  4ZJZ A;  2R7V A;  3WOD F;  1WH7 A;  2PN6 A;  3LQQ A;  2L5Q A;  3HOS A;  1AU7 A;  4RA2 A;  3L2U A;  2E5N A;  5F64 A;  2HQ5 A;  2D2W A;  2L7K A;  3QOD A;  5EGO A;  2JRT A;  3J81 Z;  2VE9 A;  2HXI A;  2JJ7 A;  3CMM A;  4IEJ A;  4FCY A;  2IT0 A;  2HVR A;  5LRR A;  1S3J A;  2HKO A;  2CSO A;  4D9J A;  1RKT A;  4N4N B;  3I4M J;  3BR0 A;  1J59 A;  2H1L A;  3TQN A;  2WAD A;  5HS7 A;  2R93 J;  1TWH J;  1MBE A;  4XBF A;  5F1J A;  3CJQ B;  1XSD A;  2RAE A;  3EYI A;  3DU6 A;  2Q2E A;  3QWL A;  5J3L A;  1JJ6 C;  1IAW A;  3GF2 A;  2V6E A;  3HYI A;  1EH8 A;  3VYU B;  3WE2 A;  1D8J A;  1ZH5 A;  4X6A J;  4OAY A;  3GVA A;  2XPU A;  2M34 A;  2M8E A;  4NDL A;  4EEF G;  2DJN A;  4WXD A;  5ILS A;  2DCE A;  2W82 A;  3CCQ I;  2H6B A;  4CA0 A;  4KIS A;  1FMW A;  4BBS J;  5E1Z B;  2MAB A;  4BU2 A;  2ID3 A;  4IJA A;  5DS9 A;  2ELJ A;  3DV8 A;  3U21 A;  5J4Y A;  2CUE A;  2W48 A;  4A12 A;  1AOY A;  4E7J A;  4QTR A;  1ZRE A;  5C3E J;  1ETW A;  2P5L C;  1ZLJ A;  2VXZ A;  3HOV J;  1WJ5 A;  3FIS A;  4ON0 A;  4E7H A;  2OJE D;  4UUT A;  4PJM A;  2NVU B;  1HXD A;  4CCL A;  2F4M B;  3I71 A;  1G3Y A;  2STW A;  1RNL A;  3E1S A;  1QVT A;  2LDU A;  1HKS A;  4XLA A;  4CZC A;  2BGC A;  2ZME C;  5TGT A;  2DTZ A;  1LB2 A;  2L02 A;  1YW8 A;  3GXO A;  5HLI A;  4WWC A;  2QQ8 A;  1IRG A;  2E1M C;  2IGM A;  4G6Q A;  2BYV E;  2O3F A;  3E6B A;  3AG3 H;  1KYZ A;  1G59 A;  2W00 A;  1ZAR A;  2L01 A;  2W25 A;  3EET A;  2M2E A;  5CVI A;  3OYJ A;  4Y33 A;  2LBF A;  1KZH A;  1MBG A;  4W1U A;  1LPQ A;  2ESN A;  1DPU A;  3T8T A;  4XKW A;  1PUF B;  2XB5 A;  3AFH A;  4NNJ A;  3V4G A;  1E2X A;  2I10 A;  1X3U A;  2MH2 A;  3S16 J;  3I53 A;  4LMY A;  3M8E A;  4BKX A;  5LGN A;  4HNU A;  2B9S A;  4HV6 A;  1ZR4 A;  2O0Y A;  3JSO A;  3FMS A;  4G8X A;  3K1M A;  1MMN A;  3T0Y A;  3HPH A;  4GYG A;  4YFX F;  3AKZ A;  5LHI A;  3LA7 A;  5JLW A;  1GLN A;  2LG4 A;  4M6Y A;  3OYC A;  1TL8 A;  1W4M A;  1HBX G;  1IUY A;  2ICW G;  4NC8 A;  2ESH A;  2DXI A;  2AHQ A;  3B02 A;  1ONV A;  1RUO A;  2KIQ A;  5E17 F;  2M0C A;  2QKL B;  3JRG A;  2GWR A;  1MZB A;  3S15 J;  2IS2 A;  4CYD A;  1QO0 D;  3KP6 A;  2UXN A;  3H36 A;  4XN0 A;  3OOP A;  4HNT A;  2DMT A;  5IPA A;  1WH5 A;  5B66 C;  3JSP A;  2R7S A;  2LY1 A;  2NOG A;  4C9Y A;  1MMD A;  2DA5 A;  2EBI A;  4BHP A;  4IF4 A;  2P4W A;  4IHW A;  3HSF A;  2EZH A;  5HOO A;  3MN2 A;  4YEL A;  3H5R A;  4FAS D;  5K7F A;  3VB2 A;  1R71 A;  2GXB A;  2HDD A;  1QZE A;  3LSK A;  1GXQ A;  3HG9 A;  1Z7L A;  3HSR A;  1ZN2 A;  4IXA A;  1YRN B;  1Y39 A;  2BY3 A;  1JTX A;  2RGV A;  1MND A;  2L2O A;  2K3F A;  4ENN A;  4DBR A;  3K10 A;  3V7C A;  4X0G A;  2CGP A;  1YYV A;  2VBZ A;  3BQZ A;  5KVR A;  1YHQ I;  2EV6 A;  4HQM A;  2KZV A;  3OYM A;  5B3S H;  4L0Y B;  4LG3 A;  1ZG3 A;  3BG5 A;  1NHA A;  2P6S A;  6PAX A;  2L9V A;  2DDA A;  2EIL H;  4J19 A;  3OYI A;  2L7M P;  4UVB A;  2BXY A;  2H6C A;  3W2V A;  1TWC J;  2JVH A;  3R61 A;  3CCU I;  3A0B C;  2X1E A;  2MLG A;  1FTT A;  2JVG A;  3CP8 A;  4RM3 A;  2Y69 H;  2X1D A;  2HOS A;  2M87 A;  2RQP A;  3QYE A;  3A01 A;  4ZC3 A;  4O5V A;  3X2Q H;  1L0O C;  2Z33 A;  1B1B A;  2XF5 A;  4PK4 A;  4A3C J;  3DFG A;  4KN4 X;  4CCK A;  2CQ7 A;  3HRT A;  1FOX A;  5F0F A;  1P7J A;  4MFE A;  3RJP A;  4A2U A;  2QBY B;  4G7O F;  3RZO J;  1K78 B;  5FLX Z;  2QKM B;  2IVM A;  5GTH C;  1LFU P;  1J9I A;  3J7A Y;  2ZFW A;  3QPT A;  3Q9V A;  4NUB A;  5DUI A;  2CJJ A;  2KIM A;  3BZ6 A;  3LOC A;  4XMY A;  4EV0 A;  3JRI A;  3F3X A;  2JA7 J;  4ZTJ A;  3H9J A;  2IP2 A;  2DYR H;  4BBR J;  1ODD A;  1OCO H;  2ZXH A;  2JWT A;  4UV8 A;  1TWA J;  3IH4 A;  2ME0 A;  3JRF A;  3ZQL A;  1L3L A;  3KEQ A;  4JBA A;  2FQ3 A;  2DMU A;  3SEQ A;  4HF0 A;  5GAD J;  2OZ6 A;  2WA0 A;  4XLC A;  3FHN A;  3I64 A;  4HDU A;  4MQV A;  3TBI A;  3WTS C;  3K4M A;  3DQV C;  1I3Q J;  3FKI J;  1YLF A;  3LFU A;  1Z21 A;  3R6S A;  4IKF A;  3K4B A;  5FKO A;  2B7E A;  1STZ A;  2EFN A;  4RAZ A;  3TO9 A;  4JQF A;  4M6X A;  4LG0 B;  4RMN A;  3KP7 A;  2ZME A;  1UG0 A;  2OPT A;  2PI0 A;  2ZB9 A;  3VSL A;  1X1B A;  3KZY A;  1RET A;  3FXK A;  1ZHF A;  1X1D A;  4A0Z A;  4M3G A;  1WI9 A;  5ILV A;  1FTZ A;  2Q0O A;  3KYC B;  2FBI A;  5ERI A;  5EG0 A;  2E19 A;  4B48 A;  1VFC A;  2HOE A;  5K1Y A;  4BJ6 C;  1R1T A;  2OV7 A;  4H4K C;  3VDX A;  1TBX A;  1IV8 A;  2HQN A;  4JX4 A;  3H9G A;  3HIF A;  2VC0 A;  2E1O A;  2W85 A;  3SHF A;  2FJ1 A;  2KMU A;  4HX7 A;  1VQ5 I;  2XHK A;  4JYK A;  4LB6 B;  1SVL A;  3DTI A;  3SDB A;  2LVS A;  2VUM J;  1YW9 A;  1SFU A;  3V7S A;  5ILU A;  1LQ1 A;  5IT9 Z;  3BP8 A;  3LL7 A;  2H1K A;  5JVG F;  1JT0 A;  5TIS C;  2ZNZ A;  3OWT A;  2XAS A;  3ABT A;  3DXJ F;  3K1P A;  5EEA A;  5FLM J;  2RNG A;  1IO2 A;  2EWN A;  2IS4 A;  1APL C;  1T2K A;  4C2M J;  1N77 A;  2W7N A;  3Q0U A;  3M07 A;  3GLX A;  3L09 A;  3M7G A;  2VJ4 A;  2VKD A;  4AU7 A;  5DEQ A;  3L9F A;  5L3B A;  3KP2 A;  2TRT A;  5FRO A;  4RAF A;  4BDY A;  2R4G A;  1Z67 A;  2KL4 A;  3BCA A;  1QBJ A;  4NQW B;  3WHB A;  2M1B A;  2CMP A;  3WU0 A;  4OOI A;  1XMX A;  4ZH4 F;  5D5X B;  2FA5 A;  5ICE A;  1ETK A;  4L9J A;  2KQR A;  1XC5 A;  5DTD A;  5EJC A;  3ZMV A;  1TWG J;  2VB6 A;  1GV5 A;  2XRL A;  2L9S A;  3OYN A;  4NBQ A;  1R00 A;  4GYI A;  4FT8 A;  1UJ8 A;  2F2E A;  4FE4 A;  3F6V A;  1BR4 A;  3DBL B;  3HRM A;  3NQO A;  3NWT A;  4YEJ A;  4E4H A;  4HW0 A;  1D3Y A;  3GFL A;  3T1B A;  4LK1 F;  4G6D A;  1OKR A;  1WCM J;  4BGD A;  2MLK A;  1WJD A;  5HLT A;  3ZQH A;  2LKP A;  4OAZ A;  3FXR A;  2BY2 A;  4B8X A;  2OU2 A;  3K4N A;  3C3W A;  2PLY A;  1BI1 A;  3FZV A;  4I0A A;  3NWS A;  1JGS A;  5BOX A;  4GXO A;  1J0R A;  3ELK A;  3OIO A;  5JI6 A;  3KZI C;  3WTX C;  3ABL H;  4LLG F;  4GFB A;  4G94 A;  3DTK A;  3SQN A;  3JTH A;  3H92 A;  4I02 A;  1VQ8 I;  4Y52 J;  2QA4 I;  5BMZ A;  4BAY A;  2RC4 A;  2X6Y A;  4UB8 C;  4Y15 A;  5DM6 F;  2DA7 A;  3GTM J;  4O3M A;  3DEU A;  4KUM A;  3NAR A;  3F8M A;  4HX8 A;  3RQ4 A;  2CQK A;  3H0D A;  5LHG A;  2M8G X;  4WXH A;  2EIM H;  1F36 A;  2LP0 A;  5IP7 J;  2LKX A;  1RIO H;  1UAA A;  1Z05 A;  3H3Z A;  3HRU A;  3PSI A;  4CCM A;  4F3Q A;  1ZG5 A;  3OIP A;  1D5V A;  1J2X A;  1D1C A;  1BI0 A;  1NG7 A;  1R1U A;  2KJB A;  5FGM A;  4AVZ A;  2HDW A;  4BAC A;  3GBG A;  1Y6I A;  2L9N A;  2R7F A;  4B44 A;  1U5T B;  2WB1 N;  3MWM A;  5HLH A;  2DU9 A;  1SD4 A;  3KEY A;  1YJ9 I;  1B8I B;  3S93 A;  3PIO F;  1JT6 A;  2L7Z A;  1HKT A;  1K83 J;  1SEU A;  1E3O C;  4L5J A;  2WB1 A;  3PJR A;  3CUQ A;  4PFO A;  2GA2 A;  4HEA 2;  1YX3 A;  4XKB A;  5CVR A;  2LY2 A;  3CP2 A;  3FBI B;  3LA2 A;  5DUK A;  3ZCO A;  2X1C A;  4A5M A;  5DD8 A;  4L5E A;  5C4X J;  2HQR A;  1YX5 A;  5LD2 C;  5GAG J;  3BCB A;  4DZP A;  4OIQ F;  1WPK A;  4XR6 A;  1N25 A;  3MMY B;  5LRS A;  2ZNY A;  3E6M A;  2KLO A;  2VXD A;  1EH7 A;  1ZRF A;  4HOB A;  4BHB A;  4ENM A;  1YTY A;  4BXX J;  3KE2 A;  2CH0 A;  3KEO A;  3IV5 A;  4FTH A;  4D5F A;  3PIP F;  4U88 A;  3NAU A;  4QPO A;  4U7D A;  1X3W B;  1VI0 A;  1PJR A;  4RB0 A;  3I59 A;  1U8R A;  2H27 A;  2E34 A;  2ZJ2 A;  3EUH C;  2DK5 A;  3DKY A;  1FX7 A;  1JKP C;  3KFW X;  5BPI A;  1FJL A;  1ERD A;  1BW6 A;  3BPX A;  2VBW A;  3TGN A;  3CCR I;  4XOT A;  1IRX A;  3PO3 J;  1QZZ A;  3MCZ A;  1V5G A;  3CD6 I;  2VOP A;  4YII A;  3GZ6 A;  2L3D A;  1WZ2 A;  4LGW A;  3C18 A;  2LH9 A;  2VKE A;  2L7F P;  1XMA A;  3LAP A;  3CO7 C;  1YIT I;  3KP3 A;  4RB1 A;  2K5C A;  1JHF A;  2ZCW A;  3HHG A;  3OSG A;  2G0E A;  1DQU A;  3J80 K;  2DA3 A;  3TKY A;  2VQG A;  4I2O A;  3ABM H;  2JRM A;  1DPR A;  1Z1D A;  3WGH A;  1OQY A;  5DV5 A;  1IN5 A;  2CQN A;  2FML A;  2HU9 A;  3IAM 2;  3ZRG A;  3OY9 A;  1I6H J;  3RCO A;  4MLO A;  4DOZ A;  3JAM K;  3MKZ A;  3PFI A;  2O5R A;  5B1B H;  1R58 A;  2B0L A;  2CW8 A;  5D5W B;  5HLG A;  4QWQ A;  4QPQ A;  3TO7 A;  3LSJ A;  4A3M J;  1FYM A;  4M3D A;  5EGO B;  2NYX A;  1LDK B;  1N75 A;  1UHW A;  2M0M A;  2OD5 A;  3PNT A;  1Z77 A;  4I0B A;  1BIA A;  1HSJ A;  4C30 A;  3J81 K;  5HDN A;  1Z3X A;  2CUZ A;  4HNV A;  3E97 A;  2NS8 A;  1Q1V A;  2IAI A;  3BJ6 A;  4S05 A;  5D4S A;  3HKZ N;  4KT5 C;  2Y9Z A;  1G8X A;  1IXR C;  4R8H A;  2EFO A;  4P1W A;  4WXC A;  1FIP A;  2Q2E B;  3P7N A;  3BPV A;  3LSP A;  2OTJ I;  1X2M A;  1BC8 C;  3TO6 A;  4FX0 A;  3L2V A;  3BR6 A;  3HKZ A;  2IA1 A;  3D0S A;  1ON2 A;  2QM3 A;  3JRD A;  1D5Y A;  2JSC A;  2TDX A;  2W84 A;  5FKK A;  2VN2 A;  2UWM A;  5LEJ A;  4IHS A;  3TED A;  3T8R A;  5TJJ A;  4A3F J;  2R7X A;  5E8G A;  3CF2 A;  1POG A;  3UNG C;  3ZQI A;  2CV1 A;  4FIS A;  3BZK A;  1IXS B;  3ERE D;  3L2C A;  1VZ0 A;  3J7Z I;  5CKT A;  3WTW C;  2LF7 A;  2X85 A;  1HDD C;  1GUU A;  1UG2 A;  4BQA A;  3WTV C;  4G7H F;  4B09 A;  2DBB A;  1ZAO A;  3GUD A;  2V1N A;  1XTA A;  4CYC A;  2X51 A;  1OJL A;  2F5F A;  4X1E A;  1B6A A;  2R7Q A;  4UXN A;  1PP8 F;  3FX3 A;  2F4O B;  2B63 J;  3GYH X;  5A2Q Z;  1S8N A;  5J40 A;  4J00 A;  2K86 A;  2M5W A;  4PCQ A;  4D1Q A;  4EM2 A;  1JI8 A;  3CLQ A;  3A03 A;  2UXX A;  3VPR A;  3CJN A;  1SMY F;  2LBF B;  2QQB A;  4V2G A;  3S3M A;  1U78 A;  2ISY A;  3PM1 A;  4EM1 A;  3DWL E;  5TRD A;  2QQA A;  3FXO A;  5IT3 A;  1OIS A;  3Q9S A;  4QIW N;  3LAJ A;  1PDN C;  1ON1 A;  2H94 A;  2CW7 A;  5EYR A;  3SFZ A;  4AWX B;  4E70 A;  2OA4 A;  1F1Z A;  1RUN A;  4II2 A;  5DCF A;  3JAM Z;  2Y0S N;  4RB3 C;  2YPR A;  1QPI A;  1SD6 A;  2DA4 A;  4BNC A;  4J01 A;  4A3E J;  1BR1 A;  1GDT A;  1E17 A;  4Y13 A;  1SVM A;  2PMZ N;  2Y0S A;  4I09 A;  2K4J A;  1U9N A;  2VQL A;  4R1H A;  5E20 A;  2MGQ A;  2YX4 A;  5D6F A;  3V8K A;  4YIR X;  1ACI A;  1DP3 A;  4MTE A;  4JX5 A;  3O2P E;  1MD0 A;  1TQI A;  2EV0 A;  3MVP A;  3FMQ A;  4PJN A;  2M45 A;  4ZYG A;  5GPC A;  3GTL J;  2LLK A;  2JUG A;  4M3E A;  4BE2 A;  2PMZ A;  4XK4 A;  1A04 A;  1LFP A;  4A69 C;  2FOW A;  2VJ5 A;  1R36 A;  3DBR B;  1LEA A;  3W6J B;  1J5Y A;  2AXL A;  4NC7 A;  3E6C C;  1YW7 A;  4IL6 C;  3R0A A;  1OYW A;  3TOA A;  2F48 A;  2HZT A;  1D0Z A;  1NK3 P;  3E0J B;  1ZGW A;  4KA4 A;  2Z99 A;  2BVM A;  3E5U A;  2EA4 A;  1LEB A;  2NVQ J;  1V54 H;  2BZT A;  2ZJP F;  5IYC J;  3CQZ J;  5E8I A;  3ROU A;  3CCY A;  3RPQ A;  4F7Z A;  1ZR2 A;  4NHJ A;  5EZH A;  3BLY A;  2LNB A;  3LST A;  1MMA A;  3SZP A;  3FF5 A;  1IF1 A;  2CS3 A;  4I99 C;  2KFD A;  4XLH A;  3W6K B;  3Q0W A;  4KDP A;  1MGT A;  2QQ9 A;  3H0G J;  5KAI C;  5HNF A;  3ZPL A;  5F08 A;  1X4O A;  4ESB A;  2DN0 A;  4OMZ A;  2CQQ A;  3HOY J;  3OYF A;  2HNH A;  4IRH A;  4EJU A;  2YU9 J;  1N78 A;  1RC9 A;  3RTR A;  3CCS I;  1LE8 A;  3IUO A;  2VI6 A;  2MBF A;  2DOD A;  1LFB A;  2JA2 A;  2L9R A;  2VKV A;  3HPG A;  4TV7 A;  3T5X A;  3SJM A;  3FWE A;  3V8J A;  2HS5 A;  2IPQ X;  3AG4 H;  2DT7 B;  3PFY A;  4P9U A;  4C3J J;  2CV0 A;  3HOW J;  2CU7 A;  3PUB A;  1MBH A;  1IC8 A;  1YIO A;  4RLF A;  2AO9 A;  5IOZ A;  3COA C;  4DIQ A;  2R7U A;  3LFK A;  1C0W A;  1GVD A;  2FQ4 A;  3C1D A;  3CJT B;  1KYW A;  3A01 B;  4BS9 A;  2KPM A;  1G3S A;  3DEE A;  2ECC A;  2WV1 A;  1REP C;  1YQA A;  2VC1 A;  3PSF A;  4RS8 A;  2GZW A;  1SD7 A;  3U1K A;  2K85 A;  5LGT A;  3O8H A;  1I50 J;  4KT6 A;  2C6Y A;  2MW8 A;  3PQJ A;  2KKO A;  2K40 A;  3GTP J;  3JRA A;  5FLX K;  4XLN F;  3F72 A;  5M3M J;  4A5N A;  5BQT A;  1G3T A;  2D1H A;  4IZZ A;  3HXL A;  1Y0U A;  2DMN A;  4HBL A;  5FLV A;  4WK8 F;  1HF0 A;  5J1R A;  4P9F A;  3LA3 A;  3BQY A;  1SFX A;  3JW4 A;  5J8C A;  3VFZ A;  4DYC A;  4G9Y A;  3E6D A;  3WTY C;  2D5V A;  2M4G A;  3I4P A;  5FRM A;  4XOR A;  5DYM A;  1A35 A;  1PUE E;  1FT9 A;  2HI3 A;  5AON A;  1H88 C;  1MKM A;  1XGS A;  3K4K A;  2MH9 A;  3ZP5 A;  2DT6 A;  2HDC A;  2Q1Z B;  1O7F A;  1S6L A;  3OSF A;  3K9T A;  1W5C C;  3WU2 C;  5J47 A;  2ECB A;  2BW3 A;  3M8F A;  4F93 B;  4RGU A;  1O3Q A;  1G3W A;  2E71 A;  3MZ8 A;  3FXU A;  2R7D A;  1IDY A;  2LOO A;  4Q48 A;  5D4R A;  1T39 A;  2FXA A;  2ZME B;  1HKQ A;  4HDV A;  1JKO C;  3EQL F;  2X4H A;  5AIP A;  3E5Q A;  5EEH A;  3CDH A;  5EG0 B;  2LK2 A;  4KMF A;  2E1M B;  1ZGJ A;  2VPR A;  3LSH A;  1HST A;  5CJ9 A;  4XLF A;  4LLL A;  1D1B A;  3ZN0 A;  5FB2 A;  5GAE J;  5CPR B;  4BJ5 C;  2FNP A;  1YJW I;  3OYB A;  2P81 A;  1ZRD A;  2I5U A;  2DQR A;  3GO5 A;  4CSW A;  2GQQ A;  3RPU D;  1CF7 A;  3QYF A;  4UUS B;  2BEO A;  3FXL A;  1EA3 A;  1HDP A;  2M9H A;  3CZ6 A;  5AIQ A;  2JA5 J;  2LY9 A;  2RKH A;  2BHZ A;  4HV5 A;  5M5X J;  4PJL A;  3O6B B;  2MD0 A;  5D5V B;  1W7P A;  3BR5 A;  5IT9 K;  1BOA A;  4LIV A;  3U9G A;  5F0H A;  2DTR A;  3QU6 A;  3GW2 A;  2HQA A;  4FQG A;  2CQX A;  3F22 A;  1NG6 A;  3ZMU A;  3K2Z A;  1MSF C;  3RQI A;  3OYE A;  3ZXS A;  1FY7 A;  2JA8 J;  1EF4 A;  3SZT A;  4S04 A;  2FNA A;  2A6H F;  2YSR A;  3CF5 F;  2ID6 A;  3C7J A;  4HF1 A;  3S1Q J;  3JTG A;  2KIF A;  1T95 A;  1X1A A;  4OIO F;  2ZJR F;  3QPL A;  1XPX A;  1TTY A;  1FNN A;  4C3H J;  3GTG J;  3DF8 A;  1S5L C;  1T38 A;  3GZ5 A;  4KMU X;  3CTA A;  3P9K A;  4YFK F;  2V9V A;  2R7O A;  3SFI A;  5IYD J;  5DDG A;  4AM3 A;  2IA0 A;  1ZYR F;  3R4K A;  4GRI A;  1UHM A;  3D5S C;  2GAU A;  2DFE A;  4XSX F;  1U2W A;  2XGD A;  3MKL A;  3LMM A;  1WJC A;  1O3R A;  1ZKG A;  5M5Y J;  3ZQ7 A;  1IRF A;  2ZBK A;  3ABK H;  1GHC A;  1HA8 A;  5HS9 A;  1QVU A;  3HSE A;  3MZH A;  4UY8 I;  2XRO A;  3G2B A;  2EFP A;  1V55 H;  5FKL A;  3KCC A;  4L9N A;  3I54 A;  1USS A;  3GLL A;  2A68 F;  2OZU A;  2RRE A;  5ICC A;  1U8B A;  1FZP B;  1LDJ A;  4BXF A;  2NS7 A;  4UV9 A;  2HYF A;  2VT2 A;  3HTU A;  3AL0 B;  1BN5 A;  4IHX A;  1DU6 A;  2IGO A;  3QPH A;  4D7N A;  1QNT A;  3MKY B;  1MH3 A;  3QYB A;  4AID A;  2A05 A;  4RDU A;  2GOM A;  3OS2 A;  1OCP A;  2MA3 A;  3CC2 I;  4Y7N J;  3H5N A;  4RGX A;  2NVT J;  1FBS A;  1FBU A;  1O3S A;  2XF7 A;  4LLN A;  5GPA A;  3WU1 B;  2NNN A;  2HVS A;  1HC8 A;  2UUZ A;  1WRJ A;  1Y1W J;  2ZJQ F;  2XGC A;  2HZD A;  2K7L A;  4BYY A;  1YS6 A;  3I58 A;  2A3S A;  2R7T A;  1BA5 A;  1WWX A;  2GXG A;  4UVA A;  2H09 A;  3FDY A;  1SVO A;  5LFA A;  1IN8 A;  1R1V A;  1ZK8 A;  2MYS A;  2P6T A;  3CUQ B;  2XF6 A;  4F92 B;  1MIJ A;  3QOE A;  5E3L A;  1VQ7 I;  1JGG A;  2Y31 A;  3BG6 A;  1BW5 A;  2CV2 A;  2DFH A;  4M6V A;  1WI3 A;  4OIP F;  5EDN A;  1WHU A;  3GTQ J;  4EM0 B;  1XGN A;  2EJR A;  4ZYE A;  3D5R C;  3G71 I;  2WAE A;  4DZJ A;  3DTE A;  1E3P A;  1WJB A;  1Z6R A;  1VQ4 I;  4WCG A;  2E2I J;  2FU4 A;  1IGN A;  2I8D A;  4BXU A;  3RKY A;  2WV0 A;  3JRE A;  4KFC A;  3BJO A;  1MDM A;  1DUX C;  3J7A O;  2NXN B;  1RR8 C;  4GGG A;  4DYR A;  2NS0 A;  5K5O A;  1MBJ A;  4XNF A;  2EB7 A;  1BOB A;  3I59 B;  3Q0V A;  3QAH A;  1A31 A;  3ISP A;  1TW2 A;  4CGZ A;  3KYD B;  3SDG A;  1TNT A;  2CYY A;  3K4J A;  2VJJ A;  2F6C A;  2PX9 A;  1U5T C;  2O8K A;  4KYW A;  2YUS A;  2X48 A;  1T0F C;  1ZGA A;  2EK5 A;  1LUJ B;  2J5O A;  3I4N J;  1F5T A;  3CCM I;  3OYG A;  2ZXJ A;  2A07 F;  2VPL A;  3FBN B;  1LDD A;  4HZF A;  1J7K A;  1Y56 A;  2KZG A;  1ZRC A;  2WAQ N;  5HDK A;  3HOU J;  2N8G A;  4W97 A;  4ESJ A;  4E7Z A;  1AKH A;  4UVC A;  4XOP A;  5K5R A;  5C44 J;  1R22 A;  4Z6Y A;  2WC2 A;  2CG4 A;  1GV2 A;  2WAQ A;  2EIN H;  5KNL A;  2X6O A;  1VQM I;  2L4M A;  4ANJ A;  1WJA A;  5CLS A;  1R49 A;  2KJC A;  4E7K A;  1HOM A;  2IGN A;  4KIB A;  2BXZ A;  2DK8 A;  1WFX A;  1RI7 A;  4CIC A;  1P92 A;  1KU7 A;  3DLA A;  4IOA F;  3C2H A;  2DFI A;  1QHG A;  2QSG X;  2EZI A;  1MNE A;  3P5J A;  4LFU A;  1TW3 A;  1OCR H;  3VOE A;  3PUF A;  3S8P A;  2NNY A;  2JPC A;  5HS8 A;  2M4K A;  3WG9 A;  1FEX A;  4DGW B;  4HYE A;  4BE0 A;  2BBY A;  2JTV A;  2ME6 A;  1X4P A;  1TC3 C;  3JCU C;  2R0Q C;  2DMQ A;  2H8W A;  3DCF A;  3FM3 A;  2XSD C;  1JHH A;  4EJV A;  1HQC A;  3AAF A;  3I9V 2;  3OYK A;  4JOM A;  1NK2 P;  1XB4 A;  5FD6 A;  3FM5 A;  1DDN A;  3ZQQ A;  3CDI A;  1T98 A;  1JUP A;  2ACJ A;  3UR3 C;  1TQM A;  3CCV I;  1OR7 C;  3I0T A;  1XSV A;  2HYJ A;  1H0M A;  3OYH A;  1VQ9 I;  3KX2 A;  3R60 A;  2X9D A;  3BDD A;  2V79 A;  1Y0N A;  5L3C A;  1LVK A;  2PMH A;  1R7J A;  4EGY A;  3CME I;  2VBX A;  3WGG A;  4GDF A;  2LF8 A;  1Z0X A;  4CCN A;  4ITV A;  1OYI A;  2XC7 A;  4A3L J;  1FP2 A;  1V3F A;  1U6G A;  2XAH A;  2PQ8 A;  2GIV A;  2GXA A;  2QEN A;  3ML6 A;  3EUA A;  4B43 A;  4XRS G;  2KDO A;  3F8N A;  3HDD A;  4CYC B;  3IH2 A;  1RES A;  1JUS A;  1ITY A;  3HOZ J;  5F27 A;  1EKE A;  3LWF A;  2E36 A;  2ZFU A;  3BG9 A;  1NH3 A;  3VWB A;  3F8B A;  1BI3 A;  3HEF A;  2XAU A;  2V9K A;  5A2Q K;  1K7A A;  4BL0 B;  2IS6 A;  4LIU A;  4RB2 C;  3G1M A;  4RAG A;  5IP6 A;  2XDV A;  2QSH X;  3E7L A;  2F4I A;  3JR9 A;  3H5A A;  1SMT A;  2XGX A;  1OLT A;  3QQA A;  3HGG A;  4M9Z A;  2V1D A;  2FMY A;  1BI2 A;  4YRV A;  1K6Y A;  3IC7 A;  5KHD A;  3CC7 I;  3L7W A;  3QP5 A;  2F5E A;  5K7Z A;  3HTS B;  3ULQ B;  1VQO I;  1XX5 A;  1ETQ A;  5JVT A;  1IN6 A;  3H1C A;  2PJR B;  4U0V A;  1R5I D;  3U1D A;  1TWF J;  1YG2 A;  2XAF A;  4QSH A;  5LGU A;  5BPD A;  3BT9 A;  1GT0 C;  4EMS A;  1V5F A;  2MD5 A;  3CMY A;  2RN7 A;  1R4N B;  2BY1 A;  1PYV A;  2JQ7 A;  2GA1 A;  1R5G A;  3LSI A;  3HGY A;  1JE8 A;  3VYR B;  1R5H A;  3F0C A;  4D7M A;  5HNH A;  5D5U B;  3KLO A;  4ENK A;  1OFC X;  1G2H A;  1ETX A;  1H8A C;  1FSH A;  2ISZ A;  1Y8Q B;  2VE8 A;  1SFO J;  1UST A;  1I1S A;  2DAO A;  4M9S A;  3DPL C;  3MFK A;  1QQI A;  1VND A;  2E1N A;  5GTI C;  1FIA A;  5B5E C;  3S1R J;  4BQN A;  3OL3 A;  2OAZ A;  2O7O A;  2V7F A;  1LNW A;  3MKW B;  2QVO A;  2GM4 A;  2JT1 A;  3BY6 A;  2BOL A;  2LRD A;  2P0W A;  3H3U A;  4DW6 A;  2KRC A;  1XDU A;  4DYQ A;  1R4M B;  1FWZ A;  2MSY A;  2E2H J;  2IXS A;  4MNU A;  4N9I A;  3S3O A;  2XKO A;  1H89 C;  4F91 B;  3S2D J;  3W2A A;  1D0X A;  3RIR A;  3CCL I;  3K4C A;  3JRB A;  2QLZ A;  3G73 A;  3K0L A;  2DPD A;  4Y17 A;  1R6R A;  2H8R A;  1FLI A;  1FOY A;  4FX4 A;  1SD5 A;  3PNY A;  2JUC A;  4XLE A;  3ZQC A;  3KLN A;  3FIW A;  2O03 A;  2QEX I;  1X1C A;  2IBD A;  3K69 A;  1LE8 B;  4OMY A;  2CWE A;  3GFJ A;  3VYT B;  4P5O A;  1NTC A;  1UHS A;  1Y8R B;  2NVY J;  2XKP A;  2DI3 A;  2W1O A;  3SYT A;  1BL0 A;  4XRS A;  3ZR8 X;  1CGP A;  3FK7 A;  1ENH A;  4Q4Z F;  2X6X A;  4KJZ A;  3I3L A;  1T8I A;  1JKR C;  3P9I A;  5HVQ C;  2LTP A;  2XAG A;  1EH6 A;  1WGX A;  3AG1 H;  3IH3 A;  2JMW A;  4U87 A;  4E7I A;  1QU3 A;  3RSN A;  2O8X A;  2LYC A;  3GTO J;  4XM3 A;  1SFE A;  1YI2 I;  2QUF A;  1I27 A;  4KIF A;  1KU3 A;  4XN3 A;  3M3Y J;  2DMP A;  1ETY A;  1P4X A;  3OV8 A;  4BEH A;  4HPQ A;  1X3Z B;  1ZTR A;  2A5Y B;  4I6Z A;  5H2F C;  1FC3 A;  3BTC A; 
#chains in the Genus database with same CATH homology
 5H6R A;  1S29 A;  3HOT A;  4K2E A;  4XRF A;  4UUV A;  3F8C A;  3LQR A;  4PGH A;  1Q1H A;  1OR7 A;  5H6Q A;  2O6G E;  4BH9 A;  2IJL A;  3FMR A;  4FHT A;  3RKX A;  4O6J A;  1Z7U A;  3RYP A;  1GXP A;  1G6N A;  4I98 B;  1I6X A;  5DCM A;  4OIN F;  2EFQ A;  2Q8K A;  4XLP F;  4Q5S F;  2JPB A;  2P5K A;  1YO5 C;  4HLX A;  4ZYD A;  4ESF A;  3EUH A;  3N97 A;  1WSU A;  1J75 A;  4MQ9 F;  1OYY A;  2DW4 A;  1JXS A;  3GX4 X;  3HUG A;  1XGO A;  4A6E A;  4U0Y A;  3GWZ A;  3TDZ C;  1ZLK A;  5F1R A;  4U0W A;  2F5C A;  1CF7 B;  4IPA A;  2D45 A;  3M9A A;  2VON A;  2KIU A;  3F8F A;  3ZMT A;  2D1V A;  3DP7 A;  4Q47 A;  3HHH A;  1FSE A;  1W7P B;  3B73 A;  2QWW A;  4DQ2 A;  4M72 A;  3GFM A;  2HTJ A;  1G4D A;  2ELH A;  2RNJ A;  4WX9 A;  4AD9 A;  2FRH A;  3SXY A;  1FPQ A;  3ZMZ A;  1D8K A;  1LJ9 A;  4ASN A;  1B59 A;  1KU9 A;  3BWG A;  3ZMD A;  2Z9O A;  5J8F A;  1Z91 A;  2IW5 A;  4PGG A;  5ICG A;  4YFN F;  3WTZ A;  1OPC A;  5CVV A;  2XV4 S;  2WWY A;  5D8K B;  5HDG A;  3F6O A;  2L54 A;  3VEP A;  1O3T A;  1BC7 C;  4I01 A;  1R23 A;  3IRQ A;  4CDG A;  3L00 A;  4A0Y A;  4LK0 F;  2MC3 A;  3ABU A;  3BJA A;  2P5V A;  1PP7 U;  1BIB A;  1Z9C A;  2OQR A;  3F21 A;  2NRA C;  3E5X A;  4CHU A;  5E1X A;  5K5Q A;  2XUB A;  3MEX A;  4YIF A;  2J5P A;  2Z3Y A;  1MJB A;  5ED4 A;  4XSZ F;  1P4A A;  3I5U A;  1Z6T A;  5LEK A;  3R0J A;  4RAY A;  3IL2 A;  3CUO A;  1F4K A;  1KQ9 A;  1XMK A;  3QP6 A;  4OIR F;  4M9X A;  5EEG A;  4DNC A;  4EJW A;  1XGM A;  3V8L A;  1HW5 A;  4LD5 A;  3DKW A;  4YG2 F;  4HQE A;  3MZY A;  4U7B A;  1UCR A;  3EDP A;  3GEZ A;  1VTN C;  4UNO A;  2HGC A;  2COM A;  2WTE A;  4MEX F;  2ZKZ A;  4KN7 X;  3TDU C;  3TOB A;  1MJ9 A;  3ECO A;  5E18 F;  3O3K A;  5FO5 A;  2DPU A;  2M30 A;  2HYG D;  3ECH A;  5FFX A;  1MDM B;  4RGS A;  3Q5F A;  5JR3 A;  1WQ2 A;  3REO A;  2UZK A;  4L0Z B;  2Y75 A;  5L3E A;  1OMI A;  4L18 B;  4N0B A;  1BJA A;  4L9T A;  2LSO A;  4CO8 A;  2KRF A;  2ADU A;  1S7A A;  1XN7 A;  3FXQ A;  2HWV A;  3IKV A;  2FE3 A;  2A61 A;  2PG4 A;  2PEX A;  4EJT A;  2P7C B;  2VOO A;  3PQK A;  3KZZ A;  1HW1 A;  3CUQ C;  2XRN A;  3G3Z A;  1IZ1 A;  1P2F A;  4ZZD A;  4AIJ A;  2PJP A;  2AS5 F;  4KIG A;  2EFW A;  4Z2Y A;  4ZYH A;  2XAQ A;  3IWZ A;  5FFZ A;  2A6E F;  3VOD A;  5JFR A;  1W5S A;  1HW2 A;  5LBQ A;  3RYR A;  3K1N A;  2E7X A;  1B9M A;  4HLY A;  1FYK A;  3QRF F;  2O61 A;  4P55 A;  1AWC A;  1LVA A;  2ZO4 A;  1TLH B;  3WTU C;  5L3F A;  3EYY A;  2DO7 A;  3V7R A;  2YU3 A;  3IKT A;  4PZJ A;  1KQ8 A;  2FSW A;  4L5I A;  1H9T A;  2PFB A;  3ZN1 A;  2VOD A;  1UB9 A;  2HKX A;  1KU2 A;  1FOK A;  1IW7 F;  5LLQ A;  2V1X A;  4UHT A;  2BV6 A;  1O57 A;  4M71 A;  4IVN A;  3GFI A;  2QBY A;  5J6X A;  3E3V A;  3CLO A;  1K78 A;  2FF4 A;  4ENJ A;  3RI4 A;  2E7W A;  3N4M A;  2HEO A;  1V4R A;  2VBY A;  3WE3 A;  1QPM A;  4IRG A;  1S7O A;  2DT5 A;  4JK1 X;  4HAM A;  2STT A;  1T6S A;  2XIG A;  3U2R A;  1P4W A;  4CXF A;  2PBI A;  2FBH A;  3RPU A;  2R3S A;  2NAZ A;  1TNS A;  3P9C A;  3QOP A;  4M73 A;  3HRS A;  3D5L A;  3FHZ A;  5D8L B;  4ETS A;  2EA2 A;  4N9H A;  4HX4 A;  2Y0M A;  2K27 A;  3MAJ A;  1FP1 D;  4LG0 A;  1MJA A;  2IA2 A;  1IXC A;  2QYO A;  2P7V B;  3BRO A;  2RDP A;  5L3G A;  4P96 A;  4AVP A;  4I7H A;  1QGP A;  2HR3 A;  2W57 A;  2XVC A;  1O7L A;  1B9N A;  5CYV A;  4MEY F;  4EGZ A;  4CZZ A;  2V1U A;  3IWF A;  5F6F A;  1ULY A;  4EQQ A;  2FOK A;  2V6C A;  1KA8 A;  2DLL A;  3M1E A;  1YS7 A;  5JHU A;  2RVC A;  2BE5 F;  3BOQ A;  3DPT A;  4AIH A;  2DQL A;  1XCB A;  3QU3 A;  2W24 A;  1UFM A;  2QZ8 A;  2FBK A;  4NQW A;  1I1G A;  4KNY A;  4QLC U;  1BBY A;  4L9V A;  3WGI A;  2Y48 A;  4MGR A;  1DP7 P;  1KQ0 A;  5BS6 A;  5KK1 A;  3NRV A;  1IN7 A;  2HTS A;  1F9N A;  1GVJ A;  3RDI A;  4M74 A;  2G7U A;  2CW0 F;  3CO6 C;  4ZZL A;  3IHU A;  4GO1 A;  4RGR A;  1B4A A;  1QZY A;  2XAJ A;  4AIK A;  5ICF A;  2CFX A;  4NB5 A;  2VT3 A;  3KP4 A;  1P6R A;  2JZY A;  1TQP A;  5FD5 A;  1WKM A;  1XSX A;  3NEU A;  5DCM B;  1H9G A;  2OQG A;  2IRF G;  2Z5U A;  2CO5 A;  3WTT C;  4A6D A;  2P8T A;  2ETH A;  1EV7 A;  1I5Z A;  3S2W A;  2X0L A;  4LB5 A;  2PMU A;  1W5T A;  2HFH A;  4IRI A;  1FYL A;  2K02 A;  4LJZ F;  3MQ0 A;  2OBP A;  4KIC A;  1U5T A;  4PDK A;  2G9W A;  1T0F A;  1SAX A;  1RZ4 A;  2G7H A;  4G7Z F;  4OU0 A;  4HF2 A;  5H20 A;  5CVU A;  1XCV A;  1U3E M;  5DD4 A;  2E1C A;  4GCV A;  5L3D A;  2YX7 A;  4MHG A;  3KET A;  2F5D A;  4IHT A;  5CVJ A;  1YFH A;  1FBQ A;  2A69 F;  1K6O A;  3ZMS A;  4D0P A;  4WF2 A;  2FEZ A;  2L4A A;  4EVI A;  5LHH A;  3KP5 A;  5E1W A;  4H0E A;  4MTD A;  3F23 A;  3RKW A;  5D6E A;  4HA8 A;  1KGS A;  2YR2 A;  1W7P D;  1IN4 A;  2RV8 A;  3J80 Z;  2K4B A;  3IRR A;  2EV5 A;  1ZG1 A;  1BM9 A;  1K79 A;  4R79 A;  4A0X A;  1XD7 A;  4BHC A;  4EJO A;  1XDS A;  3WOD F;  2PN6 A;  3LQQ A;  3HOS A;  5F64 A;  2D2W A;  2JRT A;  3J81 Z;  2VE9 A;  2IT0 A;  5LRR A;  1S3J A;  2HKO A;  2CSO A;  1J59 A;  3TQN A;  5HS7 A;  1XSD A;  4XBF A;  3EYI A;  2Q2E A;  1IAW A;  3GF2 A;  3HYI A;  1EH8 A;  3WE2 A;  1D8J A;  1ZH5 A;  3GVA A;  2M8E A;  4WXD A;  5ILS A;  2H6B A;  5E1Z B;  4IJA A;  3DV8 A;  4A12 A;  1AOY A;  1ZRE A;  2P5L C;  1ZLJ A;  2VXZ A;  4ON0 A;  1HXD A;  3I71 A;  1G3Y A;  2STW A;  1RNL A;  2LDU A;  1HKS A;  2BGC A;  1LB2 A;  2L02 A;  1YW8 A;  3GXO A;  5HLI A;  4WWC A;  1IRG A;  4G6Q A;  2BYV E;  2O3F A;  3E6B A;  1KYZ A;  1ZAR A;  2L01 A;  2W25 A;  3EET A;  5CVI A;  2ESN A;  1DPU A;  3T8T A;  3V4G A;  1E2X A;  1X3U A;  2MH2 A;  3I53 A;  4LMY A;  3M8E A;  5LGN A;  4HV6 A;  2O0Y A;  3JSO A;  3FMS A;  4G8X A;  3K1M A;  3T0Y A;  4GYG A;  4YFX F;  5LHI A;  3LA7 A;  4M6Y A;  1W4M A;  1HBX G;  1IUY A;  2ESH A;  3B02 A;  1ONV A;  1RUO A;  5E17 F;  2GWR A;  1MZB A;  4CYD A;  1QO0 D;  3KP6 A;  2UXN A;  3OOP A;  3JSP A;  4BHP A;  4IF4 A;  2P4W A;  3HSF A;  5HOO A;  2GXB A;  3VB2 A;  1GXQ A;  3HSR A;  1ZN2 A;  4IXA A;  2RGV A;  4ENN A;  3V7C A;  2CGP A;  1YYV A;  2VBZ A;  5KVR A;  2EV6 A;  4HQM A;  4L0Y B;  1ZG3 A;  1NHA A;  2P6S A;  6PAX A;  4UVB A;  2H6C A;  3R61 A;  2MLG A;  2M87 A;  2RQP A;  4O5V A;  1L0O C;  2Z33 A;  1B1B A;  3DFG A;  4KN4 X;  3HRT A;  3RJP A;  4A2U A;  2QBY B;  4G7O F;  1K78 B;  5FLX Z;  2IVM A;  1J9I A;  2ZFW A;  3QPT A;  3Q9V A;  5DUI A;  2KIM A;  3BZ6 A;  4EV0 A;  3F3X A;  2IP2 A;  1ODD A;  4UV8 A;  1L3L A;  3KEQ A;  4JBA A;  2FQ3 A;  4HF0 A;  2OZ6 A;  3I64 A;  4HDU A;  4MQV A;  3WTS C;  3DQV C;  1YLF A;  3R6S A;  1STZ A;  2EFN A;  4RAZ A;  3TO9 A;  4JQF A;  4M6X A;  4LG0 B;  3KP7 A;  2ZME A;  2PI0 A;  3KZY A;  1ZHF A;  4A0Z A;  1WI9 A;  5ILV A;  2Q0O A;  2FBI A;  5ERI A;  2HOE A;  5K1Y A;  1R1T A;  1TBX A;  2HQN A;  3HIF A;  2VC0 A;  2W85 A;  3SHF A;  4HX7 A;  2XHK A;  4LB6 B;  1YW9 A;  1SFU A;  3V7S A;  5ILU A;  1LQ1 A;  5IT9 Z;  3BP8 A;  2ZNZ A;  2XAS A;  3ABT A;  3DXJ F;  3K1P A;  2EWN A;  1T2K A;  3GLX A;  3L09 A;  3M7G A;  5DEQ A;  3L9F A;  5L3B A;  3KP2 A;  1QBJ A;  2M1B A;  3WU0 A;  4OOI A;  4ZH4 F;  5D5X B;  2FA5 A;  5ICE A;  4L9J A;  3ZMV A;  1R00 A;  4GYI A;  4FT8 A;  2F2E A;  3F6V A;  3HRM A;  3NQO A;  4HW0 A;  1D3Y A;  3GFL A;  3T1B A;  4LK1 F;  4G6D A;  1OKR A;  2MLK A;  2LKP A;  3FXR A;  4B8X A;  2OU2 A;  3C3W A;  2PLY A;  1BI1 A;  3FZV A;  4I0A A;  1JGS A;  5BOX A;  4GXO A;  1J0R A;  3ELK A;  5JI6 A;  3WTX C;  4LLG F;  4G94 A;  3SQN A;  3JTH A;  3H92 A;  4I02 A;  5BMZ A;  4BAY A;  2RC4 A;  4Y15 A;  4O3M A;  3DEU A;  4KUM A;  3F8M A;  4HX8 A;  2CQK A;  5LHG A;  4WXH A;  1RIO H;  1Z05 A;  3H3Z A;  3HRU A;  1ZG5 A;  1D5V A;  1J2X A;  2KJB A;  1BI0 A;  1R1U A;  5FGM A;  2R7F A;  1U5T B;  5HLH A;  3MWM A;  2DU9 A;  1SD4 A;  1HKT A;  4L5J A;  3CUQ A;  2GA2 A;  5CVR A;  3LA2 A;  5DUK A;  4A5M A;  5DD8 A;  2HQR A;  4OIQ F;  5LRS A;  2ZNY A;  3E6M A;  1EH7 A;  1ZRF A;  4HOB A;  4BHB A;  4ENM A;  1YTY A;  3KE2 A;  3KEO A;  4U88 A;  4U7D A;  4RB0 A;  3I59 A;  1U8R A;  2H27 A;  2ZJ2 A;  2DK5 A;  1FX7 A;  3KFW X;  5BPI A;  3BPX A;  2VBW A;  3TGN A;  1QZZ A;  3MCZ A;  2VOP A;  4YII A;  3GZ6 A;  2L3D A;  4LGW A;  3C18 A;  3LAP A;  1XMA A;  3CO7 C;  3KP3 A;  4RB1 A;  1JHF A;  2ZCW A;  3HHG A;  3J80 K;  3TKY A;  4I2O A;  1DPR A;  1Z1D A;  3WGH A;  5DV5 A;  1IN5 A;  2FML A;  3JAM K;  3PFI A;  1R58 A;  2B0L A;  5D5W B;  5HLG A;  4QWQ A;  3TO7 A;  1FYM A;  2NYX A;  1LDK B;  1UHW A;  2OD5 A;  4I0B A;  1BIA A;  1HSJ A;  3J81 K;  5HDN A;  3E97 A;  3BJ6 A;  4S05 A;  5D4S A;  4KT5 C;  1IXR C;  4R8H A;  2EFO A;  4WXC A;  3P7N A;  3BPV A;  1BC8 C;  3TO6 A;  4FX0 A;  2IA1 A;  3D0S A;  1ON2 A;  2QM3 A;  2JSC A;  2TDX A;  2W84 A;  2VN2 A;  2UWM A;  5LEJ A;  4IHS A;  3T8R A;  5TJJ A;  5E8G A;  1IXS B;  3ERE D;  3L2C A;  3WTW C;  2LF7 A;  4BQA A;  3WTV C;  4G7H F;  4B09 A;  2DBB A;  1ZAO A;  3GUD A;  2F5F A;  1B6A A;  4UXN A;  1PP8 F;  3FX3 A;  3GYH X;  5A2Q Z;  1S8N A;  2K86 A;  2M5W A;  4PCQ A;  4EM2 A;  2UXX A;  3CJN A;  1SMY F;  2QQB A;  1U78 A;  2ISY A;  4EM1 A;  5TRD A;  2QQA A;  5IT3 A;  3Q9S A;  3LAJ A;  1PDN C;  1ON1 A;  2H94 A;  3SFZ A;  4AWX B;  4E70 A;  2OA4 A;  1F1Z A;  1RUN A;  5DCF A;  3JAM Z;  4RB3 C;  2YPR A;  1SD6 A;  4BNC A;  1E17 A;  4Y13 A;  4I09 A;  5E20 A;  4R1H A;  2K4J A;  2YX4 A;  5D6F A;  3V8K A;  4MTE A;  3O2P E;  1MD0 A;  1TQI A;  2EV0 A;  3FMQ A;  4ZYG A;  2M45 A;  1A04 A;  1R36 A;  1LEA A;  3W6J B;  1J5Y A;  2AXL A;  3E6C C;  1YW7 A;  3TOA A;  3R0A A;  1OYW A;  2HZT A;  4KA4 A;  2Z99 A;  3E5U A;  2EA4 A;  1LEB A;  5E8I A;  3ROU A;  3RPQ A;  4F7Z A;  4NHJ A;  2LNB A;  3LST A;  3SZP A;  3FF5 A;  1IF1 A;  4KDP A;  3W6K B;  1MGT A;  2QQ9 A;  3ZPL A;  4ESB A;  4OMZ A;  4IRH A;  4EJU A;  3RTR A;  2MBF A;  4TV7 A;  3T5X A;  3FWE A;  3V8J A;  2HS5 A;  2IPQ X;  4P9U A;  1YIO A;  3COA C;  3LFK A;  1C0W A;  3C1D A;  1KYW A;  1G3S A;  1REP C;  1YQA A;  2VC1 A;  4RS8 A;  2GZW A;  1SD7 A;  5LGT A;  2C6Y A;  3PQJ A;  2KKO A;  5FLX K;  4XLN F;  3F72 A;  4A5N A;  5BQT A;  1G3T A;  2D1H A;  1Y0U A;  4HBL A;  4WK8 F;  4P9F A;  3LA3 A;  1SFX A;  3JW4 A;  5J8C A;  3VFZ A;  4G9Y A;  3E6D A;  3WTY C;  3I4P A;  5DYM A;  1PUE E;  1FT9 A;  5AON A;  1MKM A;  1XGS A;  2MH9 A;  3ZP5 A;  2HDC A;  1O7F A;  1S6L A;  3K9T A;  3M8F A;  4RGU A;  1O3Q A;  1G3W A;  3FXU A;  2R7D A;  4Q48 A;  5D4R A;  1T39 A;  2FXA A;  2ZME B;  1HKQ A;  4HDV A;  3EQL F;  2X4H A;  5AIP A;  3E5Q A;  5EEH A;  3CDH A;  4KMF A;  1ZGJ A;  1HST A;  5CJ9 A;  4LLL A;  3ZN0 A;  5FB2 A;  2FNP A;  1ZRD A;  2DQR A;  3GO5 A;  2GQQ A;  1CF7 A;  2BEO A;  5AIQ A;  2RKH A;  4HV5 A;  3O6B B;  5D5V B;  1W7P A;  5IT9 K;  1BOA A;  3U9G A;  2DTR A;  3QU6 A;  3GW2 A;  3F22 A;  3ZMU A;  3K2Z A;  1FY7 A;  3SZT A;  4S04 A;  2FNA A;  2A6H F;  2YSR A;  3C7J A;  4HF1 A;  3JTG A;  2KIF A;  4OIO F;  1TTY A;  1FNN A;  3DF8 A;  1T38 A;  3GZ5 A;  4KMU X;  3CTA A;  3P9K A;  4YFK F;  2V9V A;  5DDG A;  2IA0 A;  1ZYR F;  3R4K A;  1UHM A;  2GAU A;  4XSX F;  1U2W A;  1O3R A;  3ZQ7 A;  1IRF A;  2ZBK A;  1GHC A;  5HS9 A;  3HSE A;  3MZH A;  2XRO A;  2EFP A;  3KCC A;  4L9N A;  3I54 A;  1USS A;  2A68 F;  2OZU A;  5ICC A;  1FZP B;  1LDJ A;  4UV9 A;  2HYF A;  2VT2 A;  3HTU A;  1BN5 A;  3QPH A;  1QNT A;  2MA3 A;  4RGX A;  1FBS A;  1FBU A;  1O3S A;  4LLN A;  3WU1 B;  2NNN A;  1WRJ A;  2K7L A;  4BYY A;  1YS6 A;  3I58 A;  2A3S A;  1WWX A;  2GXG A;  4UVA A;  2H09 A;  1IN8 A;  1R1V A;  2P6T A;  3CUQ B;  4OIP F;  4EM0 B;  1XGN A;  2EJR A;  4ZYE A;  1Z6R A;  4WCG A;  2FU4 A;  4BXU A;  3RKY A;  2WV0 A;  4KFC A;  3BJO A;  1MDM A;  1DUX C;  3J7A O;  4GGG A;  2NS0 A;  5K5O A;  2EB7 A;  3I59 B;  3QAH A;  3ISP A;  1TW2 A;  4CGZ A;  1TNT A;  2CYY A;  1U5T C;  4KYW A;  1ZGA A;  2EK5 A;  2J5O A;  1F5T A;  2A07 F;  2ZXJ A;  1ZRC A;  1LDD A;  4HZF A;  1J7K A;  5HDK A;  4ESJ A;  4UVC A;  5K5R A;  1R22 A;  2WC2 A;  2CG4 A;  2L4M A;  5CLS A;  2KJC A;  4KIB A;  2DK8 A;  1RI7 A;  4CIC A;  1P92 A;  1KU7 A;  2DFI A;  4LFU A;  1TW3 A;  3VOE A;  2NNY A;  2JPC A;  5HS8 A;  3WG9 A;  4HYE A;  2BBY A;  2JTV A;  3FM3 A;  1JHH A;  4EJV A;  1HQC A;  3AAF A;  1XB4 A;  5FD6 A;  3FM5 A;  1DDN A;  1T98 A;  2ACJ A;  1TQM A;  3I0T A;  1H0M A;  1XSV A;  3R60 A;  3BDD A;  2V79 A;  5L3C A;  2PMH A;  1R7J A;  4EGY A;  2VBX A;  3WGG A;  2LF8 A;  1OYI A;  1FP2 A;  1V3F A;  1U6G A;  2XAH A;  2PQ8 A;  2GIV A;  2QEN A;  3ML6 A;  3F8N A;  3LWF A;  3F8B A;  1BI3 A;  5A2Q K;  1K7A A;  4RB2 C;  1SMT A;  2XGX A;  4M9Z A;  2V1D A;  2FMY A;  1BI2 A;  3IC7 A;  3L7W A;  3QP5 A;  2F5E A;  3HTS B;  3ULQ B;  5JVT A;  1IN6 A;  4U0V A;  3U1D A;  1YG2 A;  2XAF A;  5LGU A;  5BPD A;  4EMS A;  2MD5 A;  2RN7 A;  2GA1 A;  1R5G A;  1JE8 A;  1R5H A;  5D5U B;  3KLO A;  4ENK A;  1FSH A;  2ISZ A;  1I1S A;  2VE8 A;  1UST A;  2DAO A;  4M9S A;  3DPL C;  3MFK A;  1QQI A;  2E1N A;  2OAZ A;  1LNW A;  2QVO A;  2JT1 A;  3BY6 A;  3H3U A;  1XDU A;  1FWZ A;  4MNU A;  4N9I A;  2XKO A;  3RIR A;  2QLZ A;  3G73 A;  3K0L A;  2DPD A;  4Y17 A;  1FLI A;  4FX4 A;  1SD5 A;  3KLN A;  2O03 A;  3K69 A;  4OMY A;  2CWE A;  3GFJ A;  4P5O A;  2XKP A;  2DI3 A;  1CGP A;  4Q4Z F;  3P9I A;  5HVQ C;  2XAG A;  1EH6 A;  2O8X A;  1SFE A;  2QUF A;  1I27 A;  4KIF A;  1KU3 A;  1P4X A;  3OV8 A;  2A5Y B;  1FC3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...