1VQ7I

The structure of the transition state analogue "dca" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 23S ribosomal rna
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
molecule tags Ribosome
total genus 17
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 1vq7I00
1VQ7I 2ZJPF 2E36A 3G4SI 1S72I 1VQPI 1VQ4I 1VQMI 3CF5F 1VQLI 1YITI 2OTLI 5GAEJ 1YJNI 1VQNI 2E35A 1HC8A 1VQKI 3J7YJ 2H8WA 3CD6I 2NXNB 2ZJRF 5GAGJ 3PIPF 1FOYA 5DM6F 3CC7I 1VQ6I 1YHQI 4V19K 2FOWA 3G6EI 3PIOF 3CCVI 4IOCF 3CMAI 3CCMI 3CCEI 1FOWA 5DM7F 1FOXA 3CCQI 1YJWI 3CC2I 5GADJ 4IOAF 3CCRI 3CC4I 3CCSI 2JQ7A 1VQ5I 3CCJI 1YJ9I 2K3FA 2E34A 3CJTB 5GAHJ 2QA4I 1YIJI 1QA6A 2QEXI 1MMSA 3J7ZI 4UY8I 3I56I 3CMEI 1YI2I 4IO9F 5JVGF 3G71I 3DLLF 1VQ8I 2OTJI 2ZJQF 1ACIA 1Y39A 3I55I 1VQOI 3CCUI 1VQ9I 3CCLI
chains in the Genus database with same CATH superfamily
1IDYA 1B9NA 4G7HF 2RAEA 1S7OA 2CGPA 1TW2A 3IWZA 4NHJA 2F5EA 2WC2A 2DW4A 2MC3A 4V2GA 2AS5F 4J19A 4ENJA 1IN5A 2RQPA 1MMDA 2EFPA 2HOEA 2KFDA 2ISZA 4BY7J 2GA2A 3J81K 2IS6A 1P4AA 5CQGA 4Y15A 3W3CA 4HBLA 2LKPA 2HVSA 3L7WA 1OCTC 3K10A 1TWFJ 2XF5A 1TBXA 3C3WA 3IV5A 2VXZA 4H0EA 1XSXA 2DA2A 5E3NA 2MD5A 3J7YJ 5FLMJ 2PJPA 2JJ7A 4HLXA 3QWLA 5L3DA 1ZG1A 3MKLA 2V9KA 1X3UA 3LNQA 2VXDA 1QU3A 3E6MA 2OD5A 2VQHA 1Z91A 4P1WA 1UELB 1FYKA 2LG4A 3IL2A 3G1MA 3Q9VA 1GXPA 1SD7A 2VODA 4EM1A 1MJBA 1ZAOA 2DFIA 1HDPA 4C3HJ 2QM3A 3JRHA 1O4XA 3ABKH 2O0YA 1U8RA 1XB4A 3H5NA 2VI6A 3VYSB 2MBFA 4I0AA 3GUDA 3GTGJ 3LWFA 1NHAA 1BI3A 2NAZA 2K85A 1G3SA 3NWSA 3RI4A 5KK1A 4YIRX 1K79A 2BXZA 2XAUA 3E7LA 1Z67A 3I0TA 1UZCA 4HW0A 3A01B 3IKTA 2I10A 2L54A 2BHYA 1LDJA 4MFEA 2V1NA 5HLHA 2TCTA 5GTIC 3AL0B 1HA8A 1GLNA 4NB5A 2F48A 4AYBN 3KFWX 2A6TA 2LFBA 2HQ5A 3CP2A 2IPQX 4M71A 3CUQB 3CUQA 3WGIA 5FRNA 1Z05A 1WJ5A 4XSXF 2WWYA 4M73A 3ZR8X 3CESA 4UVBA 2EA2A 5JHUA 4KITB 1BW6A 1I6XA 2W85A 4K2EA 2Y30A 4CA0A 1IRXA 1DGWY 1V3FA 1JHHA 2M4GA 5FROA 1FTZA 1O57A 1QRYA 5K5RA 1ORKA 3K4MA 4X1EA 4O3MA 1JUPA 3JRAA 1QQIA 3I59B 1B72B 3I59A 4WXCA 4V2FA 3NAUA 2KDZA 1B72A 3MAJA 5BMZA 2R7SA 1YS7A 4M3GA 1BI2A 2HVRA 2IP2A 5JHFA 1ODDA 1EH8A 2A3SA 4BXXJ 5B5EC 4G94A 3DEEA 2HR3A 2VT2A 1MSFC 1JT6A 4MNUA 4JOMA 4LK0F 1UJ8A 2D5VA 4HLYA 5LGNA 3KE2A 1V54H 2VKHA 2Q8KA 3I58A 3MEXA 2XASA 4UV9A 1VQ4I 5FO5A 4KT5C 2CW0F 4QIWN 1D0YA 1N75A 4HX7A 2DTRA 2V6EA 4KISA 3IAM2 2WADA 3V7RA 1YW9A 3F72A 2FBKA 1SMYF 3G1LA 1V5GA 3ZMTA 3EUKL 3E97A 3BWGA 2K4JA 5HS9A 1SEUA 4MEYF 1WJAA 3S2WA 2LKSA 3FM3A 1ZRDA 5ILUA 2O8XA 4PCQA 5GAGJ 4BXUA 5DCFA 1P2FA 1MSEC 2CQKA 2KMUA 1D1BA 5DUKA 2J5PA 2FA5A 3HBLA 3GFIA 2VJJA 5F64A 3PIOF 3TW6A 2HOTA 2X9DA 2CW7A 1I3AA 2E1MB 3V7CA 3DP7A 3RPQA 1IRFA 1FOWA 1HBXG 5FRMA 2VIXA 3HJEA 1FOKA 2MG4A 1FBSA 3SZPA 3VEPA 1W5TA 3A4CA 3HRSA 3H5RA 3LSGA 4CYDA 1F5TA 2HZDA 1MNDA 2JQ7A 1P7IA 2MABA 5CLSA 3S16J 2AHQA 3DTKA 1X4PA 2B63J 3HRTA 3OYLA 3O6BB 1Y8QB 1MZBA 4ZYEA 1YX3A 1BBYA 2ACJA 3H5AA 3A02A 2V26A 4D0PA 4CICA 4I7HA 4WWCA 2NRAC 3OS0A 3M8EA 2OBPA 5GPAA 1OCOH 3F6OA 1W0TA 2XAFA 2A05A 4OOIA 2VN2A 1FP1D 2D45A 3E1SA 5D5VB 1Q1HA 4FTHA 3PUFA 5M3FJ 2M2EA 3ECHA 2VE8A 1FPQA 2XROA 4TV7A 4CUGA 1OQYA 3L2CA 1S9HA 5K7ZA 2A6EF 3HOSA 4D9JA 3JTHA 1LEBA 2E1CA 2LYCA 1A6QA 1MMAA 3NARA 4RMNA 4AUXA 3F8NA 2W1OA 2YU3A 4CCLA 2CUZA 5E8GA 3EUHC 4A3CJ 2LK2A 2IA1A 3DWLE 1IG7A 1FZPB 2DPUA 3JRIA 4M6YA 1WJCA 3CCYA 4XKCA 1HQCA 1Z6RA 2HPMA 2VJ4A 2R7FA 5E20A 2X1CA 5EJCA 3AG1H 5ED4A 1Z21A 2HOAA 3Q0VA 4CCKA 3LSKA 2OTLI 2P6SA 1S7EA 1AWCA 4XOPA 5K7HA 4PSXA 4GFBA 1WH5A 5E1ZB 2F5VA 4E7ZA 4UXNA 2IGMA 3B73A 3TOAA 2EFOA 3WU2C 4BACA 4IXAA 5LGUA 4JX4A 4G6TB 3GO5A 5D4RA 3LL7A 2CUFA 3T8TA 5LFAA 4QLCU 4RGXA 2X85A 4I6ZA 1SD5A 2NOGA 5FD5A 3HGYA 2EV6A 1MIJA 2ICWG 2M9HA 2ZFUA 4GYIA 1Z3XA 1SFKA 3FK6A 1P7JA 2FOWA 4BDZA 2DXIA 1P4XA 2FUG2 2P5KA 2Y69H 2PBIA 3MKWB 4YFNF 1EKEA 2CFXA 2LVSA 3A0HC 5DM7F 4IKFA 2E1OA 4UVAA 3WTXC 2Y9YA 5DUIA 4IQ4A 2VPLA 2E5ZA 3LAJA 1M1EB 2KL4A 2R3SA 3DCFA 4RB1A 2XKOA 1EV7A 2XDVA 3PQJA 2ZXJA 3OY9A 1XGSA 2BY3A 4HDVA 1VQ5I 4E70A 4AD9A 1IXRC 2LF7A 1J5YA 3ZQIA 3DPLC 1EJ9A 1A6IA 4F3QA 1OJLA 1FJLA 4RGRA 4UB8C 1QNTA 3HYIA 1ON1A 3ZQGA 1P92A 4BUPA 2ESHA 2CS3A 3Q9SA 4CCOA 1ETWA 2LTPA 3BR1A 4KUMA 2P81A 3W2WA 3P7NA 3GTJJ 3BG6A 3F22A 2HEOA 2PJRB 2YU9J 2PJRA 2QENA 1PJRA 1U3EM 2JPBA 2PX9A 3ESWB 4U7DA 2ESNA 2R93J 2DCEA 3JW4A 2HU9A 3P9IA 3ZQLA 4YRVA 4KDPA 2K27A 4YEJA 3H9QA 3RZOJ 1TNSA 4A3MJ 2JK3A 2FD5A 4ZYDA 3GTLJ 3OSGA 1E0EA 4DW6A 4DOZA 5ICGA 4FE4A 4KIFA 4DQ2A 4DGWB 5GTHC 2HQNA 4LLLA 3UR3C 1R9TJ 2JVGA 4D1QA 3PSIA 2EFWA 1QHGA 4M72A 2DA5A 4PJMA 4D5FA 1VQ7I 1EH6A 3I53A 3N4MA 3TO7A 3H0DA 1IRZA 2VASA 2WB1A 1GHCA 1BI0A 4F93B 4N4OB 3H3ZA 3UKGA 2OZUA 1FY7A 1G3TA 4HOBA 1C0WA 1P4WA 4XLNF 4ZH4F 2OV7A 4EJTA 1S7AA 1T08B 3H36A 5TRDA 3WTVC 2FQ4A 1UHWA 3JRCA 4ANJA 1GVJA 3FKJA 5ICCA 2VQCA 2V1XA 3ISPA 1GXQA 1Z3YA 1BC8C 3WU1B 2WBMA 3L2RA 4UNOA 1G2HA 1WZ2A 4RLFA 4G7OF 1AHDP 4IF4A 3O8GA 3I3LA 2Z3YA 1TC3C 1XS9A 2CWEA 2ELJA 2JVHA 3S2HJ 5IP9J 4UUVA 3U2RA 2NNNA 2HKXA 2HOSA 3F8BA 4A3EJ 3QU3A 2GQQA 3MWMA 1YQAA 4KT6A 3SXYA 4J00A 4MQ9F 1BIAA 3DTEA 3FBNB 3JSOA 3CC4I 5HNHA 2V4JC 2NVTJ 2CV1A 2HNHA 2Q2EB 1XC5A 2Q2EA 1B59A 4BE0A 2Y31A 3A0BC 3E6DA 3P5JA 2E7WA 1YFHA 2C6YA 4OMZA 3W2AA 2K3PA 3ONQA 4S04A 2YS9A 1HW5A 1U5TB 1U5TA 4I99C 2VKDA 5HS8A 2R7TA 4L5IA 2DQLA 3BG7A 4KMFA 2L7MP 3LSRA 4ESFA 5L3EA 5D5XB 1YO5C 2AQEA 2HDDA 4MLOA 1BR4A 3KEYA 3TL4X 3J7ZI 1XX5A 3WU0A 3E0JB 2GXBA 1DDNA 2KPMA 3K4BA 2M8EA 2X6YA 1R6RA 2L4MA 3U21A 4DBRA 2ZSHB 2B0LA 3G71I 4E7IA 5EEAA 2Y9ZA 1IDZA 4BQAA 3V8JA 2HKOA 2XPVA 4BQQA 2PMUA 2VT3A 4P5OA 5J4VA 1BN5A 3D0SA 2EBIA 2LY2A 3FWEA 1Z7LA 4B3AA 5JI6A 3GWZA 1PYVA 4Y13A 1Z7UA 4ZTJA 3FXKA 1IN8A 4OWRB 4IRGA 3LSTA 2EB7A 2FU4A 5FKMA 1RUNA 3HKZN 3D5SC 1VF9A 3WTZA 4B48A 3E5QA 5IYDJ 3H3UA 2W84A 2R0QC 3K70C 2UXNA 2FRHA 3TOBA 3DEUA 4QSHA 5A2QK 4U88A 1LUJB 5GAEJ 3E5XA 2W48A 2MYSA 4E7JA 2QQAA 4RB2C 3GTQJ 2EILH 3CLOA 4PFPA 3SZGA 1D5VA 4AC0A 1SVOA 3LSMA 4OIRF 1TLHB 4RAZA 3DV8A 4P9UA 1MKMA 5LHIA 3H92A 2ZJRF 2F6CA 3HPGA 1DUXC 3A1YA 3FKIJ 5F0FA 1OFCX 4N9IA 3ZN0A 4WX9A 2N8GA 4LK1F 4XRSA 4EVIA 4BHPA 1J9IA 3ZRGA 2EZKA 4G7ZF 1R36A 2ADUA 1CQTA 3KETA 3OYEA 3LSJA 3KEOA 4RAFA 4R79A 1FC3A 2VL8A 3RYPA 3CCQI 2FX0A 1F9NA 3ASOH 1LQ1A 3FK7A 1BR2A 4MFDA 1ZR2A 1VFCA 1JJ6C 3DU6A 3WTYC 1ZGWA 2LOOA 1UCRA 2JWTA 3FDYA 2L7FP 4BAYA 2NNYA 2FBIA 1W7PD 3I54A 3R61A 2Y2ZA 2XSDC 1PUFA 3SFZA 2AXTC 2ELKA 3PSFA 1GUUA 2OQRA 1PUFB 2GXAA 4KJZA 4EJWA 4CH7A 2B9SA 2QQ9A 3WHCA 1K83J 2STTA 3X2QH 1U78A 3I71A 4JP0A 1RZ4A 1TQMA 4BJTA 2K9LA 2DJNA 2L5QA 5HVQC 1LDKB 3H9GA 2LKXA 3L2VA 4L0ZB 4HNUA 4L0YB 4PUSA 3V8LA 3LSIA 3ZQ7A 1USSA 3RPUD 4LITA 2ZJ2A 4EATA 2DFHA 2HPIA 2L02A 2IAIA 4DIQA 4IX7A 1X1PA 4A3JJ 4EJOA 2OTJI 2W82A 3D5RC 3T5XA 1FIPA 2MW8A 4BYYA 4LIUA 2EZLA 3CO7C 1RR7A 2JZYA 1ZR4A 2GOXB 2CSOA 1RKTA 5DD4A 1LVKA 2QYOA 1KU2A 2ZB9A 3BZ6A 3U9GA 4A3IJ 1FSHA 4N9HA 4ZJZA 3S1QJ 4WF2A 2FNPA 3IC7A 2LY1A 3Q0UA 2COBA 3HRUA 3N05A 4E6KG 2V9VA 3OS2A 2DT6A 3K0LA 3GCMA 4NC6A 1MNMC 1UHSA 4M3FA 1QZYA 2RQQA 1AKHB 1AKHA 2G7HA 3K7AJ 2XV4S 3R0AA 3CJNA 2F5CA 4XR6A 1VQNI 1XD7A 4LB6B 3D5LA 1MMNA 4M3BA 3K4KA 5FFZA 3TMOA 3KPHA 4FE7A 2L9VA 1JXSA 2VB6A 1LNWA 5JVTA 4DZJA 5CVUA 4DBQA 1ENHA 1W0UA 3IH4A 4M6VA 1UHMA 2W57A 1MBEA 3ASNH 4PJ0C 1FOYA 3SEQA 3IRRA 2IRFG 4WK8F 2YX4A 3CC7I 2VUMJ 3DTIA 1YHQI 5E18F 2KIQA 2OA4A 5E1XA 2ME6A 5IYBJ 2M7AA 3D1NI 1ETYA 3BZKA 1KU7A 2CV0A 4OIQF 4YELA 5FKNA 5H2FC 3M1CA 1JUMA 1UG2A 3MQ0A 1A04A 2PLYA 2XAGA 3H3VK 2QVOA 5ILSA 2QQ8A 2MD0A 1PUEE 4IHSA 2QQBA 4RA2A 3IKVA 4ENKA 3LMMA 3KX2A 4XK4A 3CCSI 1RETA 2KZVA 3FXOA 1SFXA 2JA6J 3AG2H 3F0CA 2HWVA 4B47A 3S14J 3FMQA 4RAGA 2HYGD 5DCMB 5DCMA 2HQAA 4E7SA 3OIPA 1FBQA 3QQAA 5LHGA 1RPWA 1WHUA 1SFEA 3PNTA 4LLGF 2LRDA 2M1BA 4RM2A 2IGKA 2DO7A 2VPRA 3EQLF 3FMSA 5LD2C 2LD5A 1BM9A 1R58A 3ABTA 3W2VA 2H8RA 1MMSA 1ZKGA 3A01A 1SFOJ 4UY8I 1V5FA 2BY1A 2EIJH 2NOJB 1HLVA 1N77A 2RREA 2Y0MA 1DU0A 3FXQA 1HDDC 1ZH5A 4Q47A 4KNYA 4XKBA 5ICEA 2X51A 2GLOA 3S93A 2ZJQF 4BJ6C 3BCAA 3TP0A 2LY9A 4R8HA 2H6CA 2MH9A 2DA1A 3EDPA 1Y39A 3AL0C 3WE3A 2OQGA 3MZYA 4HZFA 2QSHX 3ABUA 1STZA 3OS1A 3L2UA 3CUQC 2Z1DA 4I02A 3HOVJ 1H0MA 2NS7A 3PNVA 3CF5F 3F8FA 1O7FA 4AVZA 4E4HA 1VQLI 3C2GA 2EPFA 2I8DA 1LFUP 2TDXA 2YX7A 2HDWA 1KGSA 1YITI 5F6FA 3J81Z 1X2MA 3DU5A 3JCUC 4BE1A 1LFPA 2ZMEB 1YW8A 2ZMEA 2L9RA 3FHZA 4CXFA 4RS8A 1XGOA 1OPCA 3RQ4A 2O3FA 1DQUA 5FD6A 1E2XA 2XAHA 2HQRA 1LKXA 1JTYA 1R4NB 3HOTA 4L5JA 4IHXA 1MNEA 4ZC3A 3E5UA 4QWQA 2WAQA 2DA6A 3FF5A 3R6SA 4D7NA 3FHNA 2I5UA 3G73A 1JJ8C 3OOUA 2DI3A 4Q48A 3G6EI 4I09A 4AIJA 5B1BH 1IXSB 4IOCF 3JRDA 2XGCA 1HCRA 1WJBA 4ZYGA 3MZ8A 2L9SA 2RV8A 3HSFA 1I1GA 4A2UA 3BPXA 1FYLA 3REOA 2X0LA 2YSRA 3K1NA 3GZNB 1R00A 3HIFA 1ETQA 3S3NA 2XPWA 1FSEA 4KN4X 4M9XA 1LEAA 4FCYA 1U0JA 1OYIA 1TZLA 1DPRA 1U9OA 3DQVC 2PFBA 2P7VB 3P9CA 3DPUA 3WG7H 4Z2YA 1HF0A 2MSYA 4RM3A 1QPIA 2UWMA 5DS9A 2F5FA 5EYRA 2R7OA 2WTEA 4FQGA 4RBOA 1FLIA 3S32A 5TISC 2H27A 2GOMA 2BHZA 2HI3A 3H0GJ 3V42A 4BBRJ 5LHHA 5HDGA 2ZNZA 5J47A 1T2KA 5DEQA 2PI0A 5HOOA 4YIFA 2QKLB 1IF1A 4HF2A 3QP6A 1IV6A 3I9V2 2VOPA 2E1MC 3ML6A 3EYIA 1XGMA 4IHVA 3FXRA 5EEHA 5DDGA 1RIOH 1KYZA 3RQIA 4C2TA 4HSTA 4A0ZA 2QLZA 2OZ6A 4G6QA 2JMWA 3HL2A 2IS4A 3ERMA 3AG3H 3ZQQA 1R4MB 1KU3A 2COMA 3FZVA 3NEUA 4HX8A 3HOYJ 3LA2A 1U2WA 2L7KA 3VYUB 1B8IB 1B8IA 5D8KB 1P9QC 2CUJA 4CDGA 5E8IA 1XDUA 3FIWA 3FXJA 3RKYA 2ZJPF 1E3PA 2Z9OA 2K9NA 1S72I 2ZKZA 2VC1A 1X4OA 1F1ZA 2LP0A 2M34A 2QZ8A 4L5EA 2AQFA 3KYCB 1YYVA 2DFFA 2BE5F 3HEFA 1FIAA 2L4AA 1HC8A 4UV8A 3UNGC 4HPQA 1HOMA 3VDXA 1WCMJ 3K4NA 4ENMA 1JKRC 2HYFA 3OYMA 1TWHJ 1ZGJA 3U1KA 2NXNB 3C2HA 1UG0A 1YE9A 3KP3A 2A68F 4FETA 4XONA 2BVLA 2KRFA 1QZEA 4O6JA 1Y0UA 4EGZA 4HRIA 1LB2A 1P6RA 1X19A 5J3LA 1H9GA 3JTGA 3OOPA 4ZYAA 4NUBA 3V7SA 1RESA 2HXOA 3ZXSA 4CCJA 1OISA 1SFUA 3VSKA 4A3BJ 2GAUA 3HPHA 4DNCA 5E1WA 1YJWI 1CF7B 1I6HJ 1CF7A 3GFJA 3VB2A 4AVPA 3LQQA 3EYYA 3F8CA 2W24A 3VYRB 3GFMA 4Y52J 3ROUA 2KZGA 3DXJF 1ZG3A 2CH0A 2DN0A 4KIBA 2K40A 2E5NA 5L3GA 3EUAA 1MGTA 4ZZLA 3OYDA 2XAJA 1YJ9I 2DU9A 1HSTA 3MZHA 1NK3P 3IRQA 1T39A 1GV2A 1RUOA 1D1AA 4YFKF 3KYLA 4JBAA 3PFIA 2H09A 1W5SA 4LLNA 2IS2A 2X1DA 1ULYA 2JRTA 1FX7A 1WWXA 1MBHA 1HKQA 4U7BA 5DD8A 1OR7A 1QVTA 2XVCA 2VKVA 2WB1N 2IVMA 2RNGA 1G59A 1OCZH 5FKLA 5BQTA 5JVGF 4FT8A 1WKMA 1FYMA 1Z9CA 2BV6A 3ELKA 3WGHA 3HXLA 4AIDA 5IT9K 3BCBA 2AO9A 4M9ZA 5BPDA 1ZRFA 1R5GA 1W4MA 3BR5A 2JA5J 3CO6C 1MD0A 4RLQA 3WODF 3JAMK 3T8RA 1CGPA 4EM0B 2PMHA 4ZTFA 1VQOI 1U9NA 3CTAA 2G9WA 2KIFA 4F91B 2OU2A 1SAUA 5CYVA 1QPMA 5K1YA 4F55A 2R7QA 3OIOA 4BL0B 2ZC2A 5LEJA 3DEWA 5FLXK 2GZWA 2EWNA 1I39A 3MN2A 1WVRA 4RGSA 3GTPJ 1X1AA 4N0BA 2CO5A 5TGTA 5LGTA 3LAPA 4BJ5C 1OMIA 5J4YA 2BBYA 2K9QA 4HSRA 2K02A 3LFUA 2VKEA 3S1NJ 5LRRA 2M7BA 2V6CA 5IOYA 4CYCB 3VODA 4CYCA 4BE2A 1VQKI 1I5ZA 1YLFA 4RB0A 2KJCA 1X1CA 2F5DA 3ZP5A 3PIPF 2DT5A 1WI3A 2E19A 5DM6F 1BL0A 1KU9A 2E7XA 3CDLA 5C3EJ 2FNAA 2Z16A 1S3JA 2P0WA 3QPSA 1J75A 1YTYA 1E17A 3TGNA 4A6DA 1KA8A 5E3MA 5JR3A 1NG6A 3C2BA 4DYRA 2EZIA 1ON2A 2PN6A 2PMZA 1JE8A 3BJOA 3JREA 3TEDA 3K6GA 3WTTC 2VJ5A 4JYKA 4LMYA 4BBSJ 3BJ6A 4PK4A 1L0OC 5F08A 2Q1ZB 2XF6A 3FXUA 1SD4A 1T0FA 4RAYA 1ZRCA 4S0HB 3MMYB 1PP7U 2K3FA 5E3LA 4C9YA 4A3LJ 4C30A 4Y33A 3HB9A 1G8XA 1EH7A 3WTWC 2K9SA 5H6QA 2QA4I 1XTAA 1YIJI 3BJAA 2ID3A 3L2QA 2FF4A 1UMQA 3ABMH 3BR2A 4L9NA 4HA8A 2UUZA 2DOAA 3BOQA 3OR1C 2DMTA 4IEJA 3TO6A 2DQRA 3OYNA 3S2DJ 4EJUA 1HW1A 1U6GA 1FBUA 1Z6TA 2VE9A 2CV2A 3BY6A 3AFHA 1DP3A 1W5CC 4WXDA 1XMKA 3CJQB 2YR2A 5HS7A 4WCGA 3S3MA 3OL4A 3QAHA 5M5YJ 1FT9A 2R7DA 3TDUC 1K6YA 4AIHA 3OYAA 5F0HA 2IS1A 4ZDLA 3S1RJ 1JKOC 1Y8RB 4LG3A 3L1PA 2DDBA 4XQFA 1W36C 2HXIA 1H88C 3IHUA 5ILVA 3OYCA 1NTCA 5BNGA 5L3FA 2Q0OA 1ACIA 1QZZA 2NVUB 4AIKA 1R5ID 4D7MA 4QPOA 4A3GJ 2W00A 1JKPC 5FB2A 5IP7J 1B6AA 5J1YA 3GTKJ 2E36A 3OYIA 3ERED 4RGUA 1T8IA 1DPUA 1U5TC 1TWCJ 2VJIA 3PFYA 1WJDA 2JSPA 4M3EA 2MC4A 4G12A 2OAZA 4E7LA 3G3ZA 4IHTA 2RN7A 3M3YJ 5HLTA 4BS9A 1YJNI 3OMYA 3L09A 1K4SA 3ZQHA 3FX3A 1HXDA 1RKWA 2LNBA 3PL8A 3QPHA 1SAXA 3GXOA 4J01A 2NYXA 3BTCA 2QBYB 2OCCH 2QBYA 1A31A 4EGYA 1RNLA 3CD6I 2OJED 2XHKA 3HHHA 4FX4A 2ZCWA 2M5WA 3HZJA 4HDUA 3CJRB 3BQZA 3K4CA 2UZKA 5IP6A 1BOAA 1FTTA 1N25A 1T33A 4WXHA 3OR2C 4C2MJ 3BZCA 3BTLA 2L2OA 2XAQA 3J80K 4CGZA 1BIBA 1YW7A 4PJNA 3RPUA 1LFBA 5DYMA 1XN7A 2MGQA 1FEXA 5KCMA 3GTMJ 2K4BA 3CCMI 1K7AA 2O5RA 3QRFF 3S3OA 4L9TA 4DYQA 1A36A 2L0KA 1R1TA 1FOXA 1WRJA 1KONA 2NVQJ 3ZN1A 3M1EA 3TDZC 4KMUX 1V5EA 1BR1A 5LLQA 2M45A 3GW2A 3KP4A 5GPCA 5J8CA 1TTYA 1T95A 2DOFA 2QCOA 4ENNA 1X2NA 2GA1A 4HF1A 2BVMA 3WTSC 4ON0A 2ZXIA 3BT9A 3CZ6A 1ERDA 2CQNA 3AAFA 2JUCA 4I2OA 2EJRA 3ZMSA 3JRGA 3OV8A 2IGNA 1TT0A 1ZYRF 5LBQA 2LDUA 2OPTA 3ZOBA 2RNJA 2KISA 1RRJA 3VSLA 2DYRH 3HM5A 5F1JA 3K4LA 3HRMA 1B4AA 2Y0SA 4P55A 2WAEA 4UUTA 2KKOA 2CU7A 3SZTA 2PG4A 3S8PA 2GXGA 3J7AO 3CLQA 1IXCA 3K1MA 1AA7A 5M5XJ 2Z99A 4RDUA 2ELHA 3IP4B 2DJIA 1LJ9A 3DBHB 3PO2J 1VQ8I 3S15J 5K7FA 4A3FJ 1R5HA 1TQIA 2XSJC 4KFCA 3B6AA 1D0ZA 2RDPA 4XLCA 5K5OA 2FSWA 3GYHX 1H89C 4HV6A 4PSWA 2HDCA 1IV8A 2EIKH 5EZHA 3CCLI 1OCPA 2L01A 3TO9A 2F4MB 3Q0WA 4MQVA 2XIGA 1VQMI 4Y17A 1IZ1A 4NBQA 2A6HF 3IWFA 3FMRA 1YOVB 3BR0A 5H6RA 3F8MA 5A2QZ 5H20A 2M0CA 4LOCA 3K70D 3BP8A 2R7WA 1LVAA 2VLAA 1Y56A 5AIPA 1FNNA 4OIOF 2E71A 2Z5UA 1OYWA 4A3KJ 4ESJA 1R7JA 5EG0B 5EG0A 2IA0A 1MBJA 2Z2SB 3CDIA 4HV5A 4P9FA 2JTVA 3ZMUA 4HQEA 2VOOA 5TJJA 2CQ7A 2ZXHA 2X6WA 1APLC 5D8LB 1G3YA 4PZJA 1V4RA 1IW7F 3HGGA 2VBZA 1R1VA 3HTUA 1FWZA 1TL8A 3MD2A 3BQYA 3KLNA 4MIMA 1OYYA 1XMXA 3KLOA 4DYCA 3GX4X 2X6OA 5J1RA 4B4CA 2IW5A 4CCNA 1W1WE 2Z33A 4PGGA 4KA4A 2A5YB 1DGRM 2LMDA 3BTIA 1BA5A 3E6CC 1ZQ3P 1SVMA 4CSWA 3GZ5A 5CVJA 2K5CA 3ZMVA 2P6TA 3F9KA 5HLIA 1JHFA 3JRBA 3Q5FA 3CP8A 3FBIB 2IEKA 4DZPA 3AG4H 1D0XA 1OLTA 3SQNA 3TP3A 1S8NA 3OWTA 2DPDA 3RJPA 4UB6C 4P96A 2R5YB 2EH3A 2R5YA 2LBFB 3Q3SA 1R23A 2LBFA 1MH4A 4IJAA 2E34A 2XRNA 3DF8A 4EJVA 2GIZA 3L2WA 1XG1A 3LFKA 5BPIA 2W25A 1O3RA 3C18A 1WFXA 3BG3A 5K5QA 2PQ8A 1X58A 4XORA 4M3DA 5LRSA 2V1UA 3BTJA 1XPXA 1SVLA 5FKKA 3I56I 2O03A 4JX6A 4Y4RA 1SD6A 3K4JA 4A93J 4B09A 2KIUA 4NQWB 4NQWA 3HSRA 2LSOA 2D1HA 3FXLA 2LLKA 1HKSA 2EIMH 3BR6A 2OUMA 3K1PA 2R7ZJ 5B1AH 3OYKA 2JUGA 2DMUA 2XF7A 2A61A 3MKYB 2DK8A 1J2XA 2CJJA 3NQOA 3LA3A 2FE3A 3SEZA 4Y7NJ 1K4TA 1ITYA 3FISA 3J7AY 2WAQN 2R4GA 3JR9A 3V4GA 5JLXA 1NH3A 3RKQA 3QPLA 5KNLA 3BDDA 2XUBA 4A0XA 1RI7A 1ZN2A 4E7HA 1G4DA 2DK5A 4L9VA 4C3IJ 3DLAA 3GFLA 4PFOA 3O3KA 1QVUA 2BOLA 4BHCA 3QYFA 2H8WA 1PVEA 3G1OA 1O3QA 2JSCA 1BJZA 3QODA 4II3A 1T6SA 2QF7A 1IRGA 1TT5B 5DV5A 2DA4A 2RKHA 1JGGA 2ZSIB 1WH7A 5E3OA 2AXLA 3P9KA 4XLPF 2VQLA 4II2A 2FEZA 1UB9A 2R5ZB 2R5ZA 2X6XA 3NWTA 2HZTA 4MEXF 4M6XA 2VBYA 4G6DA 2E2IJ 1Y6IA 4XICA 1TNTA 5EDNA 1LPQA 2LF8A 3SHFA 1S5LC 4Z6YA 3IH2A 5FFXA 1JUSA 2ZO4A 2YPRA 1FMVA 2P5LC 1AU7A 4ASNA 2ZMEC 5DTDA 1TW3A 3M8FA 5L3CA 1T98A 2KRCA 5D5WB 3RYRA 1WPKA 2NVYJ 1VNDA 2Y75A 3SDBA 2XRLA 1X1BA 5FGMA 2P8TA 3RDIA 4L18B 1J59A 2O6GE 2QWWA 5E79C 5CVRA 2A07F 2LH9A 3CCVI 3M8JA 4CZCA 4NC7A 3GTOJ 4NC8A 1X3ZB 4HX4A 4I0BA 1QA6A 4XM3A 1USTA 2K7LA 2WY8Q 5JFRA 3HG9A 3QP5A 3VOEA 2JA7J 1T38A 3K2AA 1YI2I 3CQZJ 2R7UA 4ZYHA 3T1BA 3CUOA 3H9JA 3H35A 4AYBA 4IPAA 5F27A 3W6KB 2UXXA 1WSUA 2IBDA 1H8AC 1TWGJ 3MVPA 3ZMDA 2KJBA 3GLLA 1V55H 5HLGA 2V79A 3KCCA 4BY1J 2ZXWH 3GBGA 2CMPA 4GYGA 3MKZA 4IHWA 2ZBKA 1ONVA 3PNYA 2MFZA 2FBHA 1ETKA 4QTRA 1QBJA 1VQ9I 1BOBA 2DA3A 2H1LA 3VWBA 1D3YA 4IVNA 3KEQA 3R60A 1R1UA 1BC7C 3MCZA 1BI1A 2HTJA 2RC4A 3OSFA 2DBBA 2QKMB 1E3OC 4OU0A 2KHMA 4IRHA 5IYCJ 4UHTA 3H1CA 3JSPA 2JT1A 3KZIC 4FX0A 1YRNB 1YRNA 1JTXA 1TQPA 2VBWA 2E35A 2KDOA 2XGEA 1G3WA 5IT3A 3CMYA 5B3SH 2IT0A 3A03A 4NDLA 3WGGA 1POGA 2UV1A 2DLLA 2NVXJ 1EF4A 1LE8B 1LE8A 2JPCA 3GF2A 1LDDA 4A69C 2ME0A 1ZHFA 2DOEA 2L7ZA 4XLAA 3I64A 3QYEA 4B43A 1QHHD 4BEHB 3ECOA 4BEHA 1YIOA 2EV5A 2XC7A 4LB5A 5CJ9A 4BXFA 3CMAI 2K86A 3CCEI 4JQFA 4PJLA 3OYBA 1A35A 1GV5A 1YG2A 4BQNA 4XKVA 1GT0C 2L3DA 4A6EA 3K9TA 3VPRA 2M4KA 1IN7A 2NS0A 3TQNA 1VTNC 2Y48A 1WI9A 2BEOA 3HHGA 3ULQB 4IZZA 3RIRA 3RCOA 3V8KA 3EUHA 2IGOA 5M5WJ 4MTDA 3BROA 4I76A 2DMNA 3M07A 3U1DA 5B66C 3A2KA 5EGOB 5EGOA 5CQEA 4XN3A 1B1BA 2MH2A 2ZFWA 5AIQA 2CUEA 4EV0A 4CO8A 4L9JA 1ZTRA 1D1CA 1SANA 1F4KA 1GVDA 4HF0A 2BGCA 4ABZA 9ANTA 4U0YA 2KRHA 2OCEA 2TRTA 4GGGA 2NS8A 3LQRA 4OIPF 3L9FA 3HTSB 1ZGAA 4MO7A 4M9SA 5HNFA 4YIIA 2F4IA 2QSFX 2MA3A 5GP9A 1D5YA 2WAFA 5ERIA 5KHDA 4LD5A 2ECBA 2ISYA 4U0WA 1O3SA 4GRIA 5FKOA 3F6VA 1Y1WJ 4HEA2 1J09A 2HTSA 3L00A 4ITVA 1HSJA 3HC7A 3OYFA 4XKWA 1MW7A 3DFGA 5IOZA 3QU6A 3TBIA 2H6BA 1KZHA 5KAFC 3JRFA 1MBFA 3PJRA 4HNTA 1KQ8A 1WGXA 1Z77A 2M87A 5KAIC 3LSPA 2GWRA 3I55I 4AM3A 5D6FA 5E17F 3BC8A 3IH3A 3CCUI 3BG9A 2JN6A 2IJLA 4XRFA 2EK5A 4ZDPA 5J8FA 2FMLA 1J7KA 3IAS2 5EF6A 1VQPI 1DU6A 3K2ZA 2DFEA 2CG4A 3T0YA 1UAAA 4OMYA 4A5NA 3I4NJ 1D8KA 3TW7A 1D8JA 1MBGA 3HSEA 2F4OB 1OR7C 2OF7A 4ETSA 1WJEA 4MTEA 4LG0B 1S29A 4LG0A 1S6LA 4A3DJ 3SDGA 2W7NA 4A0YA 1IN6A 3M4OJ 2PMZN 4AWXB 4HNVA 4IQJA 2D2WA 2GIVA 3I4MJ 4Q5SF 3W6JB 2R7RA 2EFQA 4B8XA 3N97A 1PP8F 1Y1VJ 2P5VA 4DJAA 5FJ8J 1Y0NA 4XN0A 1RR8C 2O9LA 1G6NA 2KT0A 4B44A 2R7VA 3BLYA 2E2JJ 5IPAA 1IO2A 2DDAA 1PDNC 1I1SA 2BZTA 2K9MA 3WTUC 3OYJA 1ZREA 3HOUJ 3RSNA 4RB3C 1IC8A 3F3XA 5EZGA 3KZYA 3R0JA 3FM5A 4XNFA 2HGCA 3VFZA 3CC2I 3C7JA 3VYTB 2DMPA 1TP4A 4XIDA 2WV0A 2DAOA 4YFXF 1ZK8A 4IRIA 1H9TA 4HAMA 2CFOA 4XSZF 3HDDA 4OAYA 5CVIA 3KP7A 4YG2F 3CCJI 3ZPLA 4BKXA 3GVAA 4XRSG 4UVCA 1XCVA 3GMEA 4D5CA 1SC7A 2QGUA 2W4SA 3CJTB 1WJFA 3LA7A 2E1NA 3DBLB 3LOCA 4ESBA 1UFMA 1B9MA 4XOTA 4KYWA 2FOKA 2LR8A 2VC0A 1ZLKA 2F2EA 3RKWA 2O61A 3KP2A 4HYEA 4BH9A 4XRMA 1KQ0A 4IO9F 1YS6A 5F04A 4KIGA 5JLWA 5IT9Z 1MDMB 1MDMA 4NNJA 4OINF 2HVQA 3TKYA 2XGXA 3C1DA 4M74A 1SMTA 5C44J 2XKPA 4ZDOA 2RGVA 4GCVA 5CVVA 1YX5A 4AU7A 1JI8A 3JAMZ 3HOXJ 2ID6A 3B6CA 3PM1A 4XLEA 3NRVA 3EPZA 3GEZA 4CHUA 3B02A 4HG2A 4PJJA 1IGNA 4BNCA 2M3AA 3RTRA 1T0FC 3LSHA 3HOWJ 1ETXA 3DKXA 1BJAA 2VBXA 5FLXZ 3G4SI 2GM4A 4O5VA 3GZ6A 5EEGA 2FXAA 5J6XA 2KQRA 2ZNYA 3ZCOA 5F1RA 2P7CB 2PEXA 4U87A 1IN4A 5L3BA 1K78B 2G7UA 5AONA 2OC6A 4F52A 3QYBA 1K78A 3S1MJ 4LFUA 2MLKA 1ZG5A 1I27A 4IHYA 3KP6A 4W97A 3F21A 4X6AJ 3RZDJ 2O7OA 3OL3A 1FMWA 1QO0D 1QGPA 1TWAJ 3DKWA 2MLGA 4H4KC 3PO3J 1MMGA 3I5UA 3PUBA 3ABLH 1OKRA 4R1HA 3O2PE 1IUFA 1FP2A 1K61A 2XGDA 3FXMA 2GBYA 1W7PB 2HS5A 1W7PA 1HKTA 2XPUA 3BR3A 4I01A 4IL6C 4XMYA 4I98B 1ETOA 3R4KA 1BW5A 1L3LA 3CCRI 2R7XA 2Y0SN 4X0GA 3E3VA 1X1DA 2DODA 4UUSB 4UUSA 2EQRA 2L9NA 4BGDA 2IXSA 3O8HA 3ZQFA 4BDYA 1E3HA 2J5OA 1K6OA 1AOYA 3RKXA 2M8GX 4XL9A 5D5UB 2BY2A 2LREA 3QOPA 3BG5A 1Q1VA 1XCBA 2LC2A 3KP5A 2O8KA 1R49A 3MFKA 2P4WA 4F92B 1N78A 1XGNA 1KYWA 1ZLJA 3KZZA 1OCCH 2V7FA 4LIVA 2G0EA 4EEFG 4FISA 4Q4ZF 1MJ9A 2BYVE 1I50J 3I4PA 3IUOA 3AKZA 3E6BA 2EFNA 3CF2A 3DKYA 1JKQC 5D6EA 2H94A 4S05A 1RC9A 4LJZF 1MH3A 3M9AA 2X48A 3DLLF 1XSVA 2VONA 4OAZA 2STWA 1VI0A 2FJ1A 3OIQA 4ZZDA 2BW3B 2BW3A 1W36D 1J0RA 1XMAA 2CYYA 3BPVA 3HUGB 3HUGA 1OCRH 2JA2A 4GO1A 2M0MA 3W6VA 5F0CA 3SYTA 3ZMZA 2HFHA 6PAXA 5LEKA 5FLVA 3M7GA 2JRMA 4C2UA 4JK1X 2FQ3A 1T56A 5HDKA 2XB5A 5D4SA 4PDKA 2YUSA 4KICA 2H1KA 4EMSA 2WY7Q 2JA8J 2XB0X 4QPQA 2E60A 2DA7A 2HYJA 5BOXA 1DP7P 1HW2A 4F7ZA 1R22A 4KN7X 2QSGX 2CQQA 2KIMA 4B1RA 5CKTA 1ZELA 3KIOA 2RVCA 3HOZJ 2DTZA 3HKZA 4XLFA 2DT7B 5C4XJ 2X4HA 3QOEA 2WA0A 4PGHA 3COAC 3OYHA 1NK2P 3SJMA 1VQ6I 2BY0A 3J80Z 4V19K 5CPRB 1IUYA 5M3MJ 5C4JJ 4U0VA 4G9YA 4G8XA 1O3TA 2ECCA 4HQMA 2V9PA 4LGWA 4N4NB 1I3QJ 3OYGA 2ETHA 3GLXA 1F43A 1X3WB 1ETVA 3WE2A 1IAWA 1JGSA 1Z1DA 2DMQA 5GADJ 2E2HJ 2A5WA 2B7EA 4IOAF 1ZARA 2R92J 4FHTA 4C3JJ 2CQXA 1A5JA 3EETA 3KYDB 3PQKA 2A69F 4MHGA 4BU2A 3F23A 4BQOA 1Z0XA 1EA3A 1WQ2A 2IA2A 2X1EA 5HDNA 3S17J 3ZQCA 1MBKA 3CDHA 2FMYA 5J40A 5KVRA 2CRGA 1REPC 3CMMA 4MGRA 5HODA 3DBRB 4FASD 1KQ9A 4A5MA 4EM2A 2V1DA 4Y3OA 5GAHJ 3K69A 5IY5H 5ICFA 1F36A 2CW8A 4W1UA 3ZGKA 3G2BA 2QUFA 4A12A 1NG7A 1R71A 1MJAA 5J1UA 2QEXI 1VZ0A 2KP6A 2EV0A 3CMEI 4BHBA 4JX5A 1IJWC 1GDTA 4CZZA 3QPTA 3SFIA 2VQGA 2BXYA 4XLHA 1U8BA 3WG9A 4CCMA 2D1VA 5BS6A 4EQQA 2EINH 1XDSA 1XSDA 2WV1A 4GXOA 3DPTA 2KLOA 4B3XA 2EZHA 2EA4A 1JT0A 1O7LA 4XBFA 4GDFA 3WHBA 2M30A 2DYSH 4E7KA
chains in the Genus database with same CATH topology
1VQ7I 2ZJPF 2E36A 3G4SI 1S72I 1VQPI 1VQ4I 1VQMI 3CF5F 1VQLI 1YITI 2OTLI 5GAEJ 1YJNI 1VQNI 2E35A 1HC8A 1VQKI 3J7YJ 2H8WA 3CD6I 2NXNB 2ZJRF 5GAGJ 3PIPF 1FOYA 5DM6F 3CC7I 1VQ6I 1YHQI 4V19K 2FOWA 3G6EI 3PIOF 3CCVI 4IOCF 3CMAI 3CCMI 3CCEI 1FOWA 5DM7F 1FOXA 3CCQI 1YJWI 3CC2I 5GADJ 4IOAF 3CCRI 3CC4I 3CCSI 2JQ7A 1VQ5I 3CCJI 1YJ9I 2K3FA 2E34A 3CJTB 5GAHJ 2QA4I 1YIJI 1QA6A 2QEXI 1MMSA 3J7ZI 4UY8I 3I56I 3CMEI 1YI2I 4IO9F 5JVGF 3G71I 3DLLF 1VQ8I 2OTJI 2ZJQF 1ACIA 1Y39A 3I55I 1VQOI 3CCUI 1VQ9I 3CCLI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ7 I;  2ZJP F;  2E36 A;  3G4S I;  1S72 I;  1VQP I;  1VQ4 I;  1VQM I;  3CF5 F;  1VQL I;  1YIT I;  2OTL I;  5GAE J;  1YJN I;  1VQN I;  2E35 A;  1HC8 A;  1VQK I;  3J7Y J;  2H8W A;  3CD6 I;  2NXN B;  2ZJR F;  5GAG J;  3PIP F;  1FOY A;  5DM6 F;  3CC7 I;  1VQ6 I;  1YHQ I;  4V19 K;  2FOW A;  3G6E I;  3PIO F;  3CCV I;  4IOC F;  3CMA I;  3CCM I;  3CCE I;  1FOW A;  5DM7 F;  1FOX A;  3CCQ I;  1YJW I;  3CC2 I;  5GAD J;  4IOA F;  3CCR I;  3CC4 I;  3CCS I;  2JQ7 A;  1VQ5 I;  3CCJ I;  1YJ9 I;  2K3F A;  2E34 A;  3CJT B;  5GAH J;  2QA4 I;  1YIJ I;  1QA6 A;  2QEX I;  1MMS A;  3J7Z I;  4UY8 I;  3I56 I;  3CME I;  1YI2 I;  4IO9 F;  5JVG F;  3G71 I;  3DLL F;  1VQ8 I;  2OTJ I;  2ZJQ F;  1ACI A;  1Y39 A;  3I55 I;  1VQO I;  3CCU I;  1VQ9 I;  3CCL I; 
#chains in the Genus database with same CATH topology
 1IDY A;  1B9N A;  4G7H F;  2RAE A;  1S7O A;  2CGP A;  1TW2 A;  3IWZ A;  4NHJ A;  2F5E A;  2WC2 A;  2DW4 A;  2MC3 A;  4V2G A;  2AS5 F;  4J19 A;  4ENJ A;  1IN5 A;  2RQP A;  1MMD A;  2EFP A;  2HOE A;  2KFD A;  2ISZ A;  4BY7 J;  2GA2 A;  3J81 K;  2IS6 A;  1P4A A;  5CQG A;  4Y15 A;  3W3C A;  4HBL A;  2LKP A;  2HVS A;  3L7W A;  1OCT C;  3K10 A;  1TWF J;  2XF5 A;  1TBX A;  3C3W A;  3IV5 A;  2VXZ A;  4H0E A;  1XSX A;  2DA2 A;  5E3N A;  2MD5 A;  3J7Y J;  5FLM J;  2PJP A;  2JJ7 A;  4HLX A;  3QWL A;  5L3D A;  1ZG1 A;  3MKL A;  2V9K A;  1X3U A;  3LNQ A;  2VXD A;  1QU3 A;  3E6M A;  2OD5 A;  2VQH A;  1Z91 A;  4P1W A;  1UEL B;  1FYK A;  2LG4 A;  3IL2 A;  3G1M A;  3Q9V A;  1GXP A;  1SD7 A;  2VOD A;  4EM1 A;  1MJB A;  1ZAO A;  2DFI A;  1HDP A;  4C3H J;  2QM3 A;  3JRH A;  1O4X A;  3ABK H;  2O0Y A;  1U8R A;  1XB4 A;  3H5N A;  2VI6 A;  3VYS B;  2MBF A;  4I0A A;  3GUD A;  3GTG J;  3LWF A;  1NHA A;  1BI3 A;  2NAZ A;  2K85 A;  1G3S A;  3NWS A;  3RI4 A;  5KK1 A;  4YIR X;  1K79 A;  2BXZ A;  2XAU A;  3E7L A;  1Z67 A;  3I0T A;  1UZC A;  4HW0 A;  3A01 B;  3IKT A;  2I10 A;  2L54 A;  2BHY A;  1LDJ A;  4MFE A;  2V1N A;  5HLH A;  2TCT A;  5GTI C;  3AL0 B;  1HA8 A;  1GLN A;  4NB5 A;  2F48 A;  4AYB N;  3KFW X;  2A6T A;  2LFB A;  2HQ5 A;  3CP2 A;  2IPQ X;  4M71 A;  3CUQ B;  3CUQ A;  3WGI A;  5FRN A;  1Z05 A;  1WJ5 A;  4XSX F;  2WWY A;  4M73 A;  3ZR8 X;  3CES A;  4UVB A;  2EA2 A;  5JHU A;  4KIT B;  1BW6 A;  1I6X A;  2W85 A;  4K2E A;  2Y30 A;  4CA0 A;  1IRX A;  1DGW Y;  1V3F A;  1JHH A;  2M4G A;  5FRO A;  1FTZ A;  1O57 A;  1QRY A;  5K5R A;  1ORK A;  3K4M A;  4X1E A;  4O3M A;  1JUP A;  3JRA A;  1QQI A;  3I59 B;  1B72 B;  3I59 A;  4WXC A;  4V2F A;  3NAU A;  2KDZ A;  1B72 A;  3MAJ A;  5BMZ A;  2R7S A;  1YS7 A;  4M3G A;  1BI2 A;  2HVR A;  2IP2 A;  5JHF A;  1ODD A;  1EH8 A;  2A3S A;  4BXX J;  5B5E C;  4G94 A;  3DEE A;  2HR3 A;  2VT2 A;  1MSF C;  1JT6 A;  4MNU A;  4JOM A;  4LK0 F;  1UJ8 A;  2D5V A;  4HLY A;  5LGN A;  3KE2 A;  1V54 H;  2VKH A;  2Q8K A;  3I58 A;  3MEX A;  2XAS A;  4UV9 A;  1VQ4 I;  5FO5 A;  4KT5 C;  2CW0 F;  4QIW N;  1D0Y A;  1N75 A;  4HX7 A;  2DTR A;  2V6E A;  4KIS A;  3IAM 2;  2WAD A;  3V7R A;  1YW9 A;  3F72 A;  2FBK A;  1SMY F;  3G1L A;  1V5G A;  3ZMT A;  3EUK L;  3E97 A;  3BWG A;  2K4J A;  5HS9 A;  1SEU A;  4MEY F;  1WJA A;  3S2W A;  2LKS A;  3FM3 A;  1ZRD A;  5ILU A;  2O8X A;  4PCQ A;  5GAG J;  4BXU A;  5DCF A;  1P2F A;  1MSE C;  2CQK A;  2KMU A;  1D1B A;  5DUK A;  2J5P A;  2FA5 A;  3HBL A;  3GFI A;  2VJJ A;  5F64 A;  3PIO F;  3TW6 A;  2HOT A;  2X9D A;  2CW7 A;  1I3A A;  2E1M B;  3V7C A;  3DP7 A;  3RPQ A;  1IRF A;  1FOW A;  1HBX G;  5FRM A;  2VIX A;  3HJE A;  1FOK A;  2MG4 A;  1FBS A;  3SZP A;  3VEP A;  1W5T A;  3A4C A;  3HRS A;  3H5R A;  3LSG A;  4CYD A;  1F5T A;  2HZD A;  1MND A;  2JQ7 A;  1P7I A;  2MAB A;  5CLS A;  3S16 J;  2AHQ A;  3DTK A;  1X4P A;  2B63 J;  3HRT A;  3OYL A;  3O6B B;  1Y8Q B;  1MZB A;  4ZYE A;  1YX3 A;  1BBY A;  2ACJ A;  3H5A A;  3A02 A;  2V26 A;  4D0P A;  4CIC A;  4I7H A;  4WWC A;  2NRA C;  3OS0 A;  3M8E A;  2OBP A;  5GPA A;  1OCO H;  3F6O A;  1W0T A;  2XAF A;  2A05 A;  4OOI A;  2VN2 A;  1FP1 D;  2D45 A;  3E1S A;  5D5V B;  1Q1H A;  4FTH A;  3PUF A;  5M3F J;  2M2E A;  3ECH A;  2VE8 A;  1FPQ A;  2XRO A;  4TV7 A;  4CUG A;  1OQY A;  3L2C A;  1S9H A;  5K7Z A;  2A6E F;  3HOS A;  4D9J A;  3JTH A;  1LEB A;  2E1C A;  2LYC A;  1A6Q A;  1MMA A;  3NAR A;  4RMN A;  4AUX A;  3F8N A;  2W1O A;  2YU3 A;  4CCL A;  2CUZ A;  5E8G A;  3EUH C;  4A3C J;  2LK2 A;  2IA1 A;  3DWL E;  1IG7 A;  1FZP B;  2DPU A;  3JRI A;  4M6Y A;  1WJC A;  3CCY A;  4XKC A;  1HQC A;  1Z6R A;  2HPM A;  2VJ4 A;  2R7F A;  5E20 A;  2X1C A;  5EJC A;  3AG1 H;  5ED4 A;  1Z21 A;  2HOA A;  3Q0V A;  4CCK A;  3LSK A;  2OTL I;  2P6S A;  1S7E A;  1AWC A;  4XOP A;  5K7H A;  4PSX A;  4GFB A;  1WH5 A;  5E1Z B;  2F5V A;  4E7Z A;  4UXN A;  2IGM A;  3B73 A;  3TOA A;  2EFO A;  3WU2 C;  4BAC A;  4IXA A;  5LGU A;  4JX4 A;  4G6T B;  3GO5 A;  5D4R A;  3LL7 A;  2CUF A;  3T8T A;  5LFA A;  4QLC U;  4RGX A;  2X85 A;  4I6Z A;  1SD5 A;  2NOG A;  5FD5 A;  3HGY A;  2EV6 A;  1MIJ A;  2ICW G;  2M9H A;  2ZFU A;  4GYI A;  1Z3X A;  1SFK A;  3FK6 A;  1P7J A;  2FOW A;  4BDZ A;  2DXI A;  1P4X A;  2FUG 2;  2P5K A;  2Y69 H;  2PBI A;  3MKW B;  4YFN F;  1EKE A;  2CFX A;  2LVS A;  3A0H C;  5DM7 F;  4IKF A;  2E1O A;  4UVA A;  3WTX C;  2Y9Y A;  5DUI A;  4IQ4 A;  2VPL A;  2E5Z A;  3LAJ A;  1M1E B;  2KL4 A;  2R3S A;  3DCF A;  4RB1 A;  2XKO A;  1EV7 A;  2XDV A;  3PQJ A;  2ZXJ A;  3OY9 A;  1XGS A;  2BY3 A;  4HDV A;  1VQ5 I;  4E70 A;  4AD9 A;  1IXR C;  2LF7 A;  1J5Y A;  3ZQI A;  3DPL C;  1EJ9 A;  1A6I A;  4F3Q A;  1OJL A;  1FJL A;  4RGR A;  4UB8 C;  1QNT A;  3HYI A;  1ON1 A;  3ZQG A;  1P92 A;  4BUP A;  2ESH A;  2CS3 A;  3Q9S A;  4CCO A;  1ETW A;  2LTP A;  3BR1 A;  4KUM A;  2P81 A;  3W2W A;  3P7N A;  3GTJ J;  3BG6 A;  3F22 A;  2HEO A;  2PJR B;  2YU9 J;  2PJR A;  2QEN A;  1PJR A;  1U3E M;  2JPB A;  2PX9 A;  3ESW B;  4U7D A;  2ESN A;  2R93 J;  2DCE A;  3JW4 A;  2HU9 A;  3P9I A;  3ZQL A;  4YRV A;  4KDP A;  2K27 A;  4YEJ A;  3H9Q A;  3RZO J;  1TNS A;  4A3M J;  2JK3 A;  2FD5 A;  4ZYD A;  3GTL J;  3OSG A;  1E0E A;  4DW6 A;  4DOZ A;  5ICG A;  4FE4 A;  4KIF A;  4DQ2 A;  4DGW B;  5GTH C;  2HQN A;  4LLL A;  3UR3 C;  1R9T J;  2JVG A;  4D1Q A;  3PSI A;  2EFW A;  1QHG A;  4M72 A;  2DA5 A;  4PJM A;  4D5F A;  1VQ7 I;  1EH6 A;  3I53 A;  3N4M A;  3TO7 A;  3H0D A;  1IRZ A;  2VAS A;  2WB1 A;  1GHC A;  1BI0 A;  4F93 B;  4N4O B;  3H3Z A;  3UKG A;  2OZU A;  1FY7 A;  1G3T A;  4HOB A;  1C0W A;  1P4W A;  4XLN F;  4ZH4 F;  2OV7 A;  4EJT A;  1S7A A;  1T08 B;  3H36 A;  5TRD A;  3WTV C;  2FQ4 A;  1UHW A;  3JRC A;  4ANJ A;  1GVJ A;  3FKJ A;  5ICC A;  2VQC A;  2V1X A;  3ISP A;  1GXQ A;  1Z3Y A;  1BC8 C;  3WU1 B;  2WBM A;  3L2R A;  4UNO A;  1G2H A;  1WZ2 A;  4RLF A;  4G7O F;  1AHD P;  4IF4 A;  3O8G A;  3I3L A;  2Z3Y A;  1TC3 C;  1XS9 A;  2CWE A;  2ELJ A;  2JVH A;  3S2H J;  5IP9 J;  4UUV A;  3U2R A;  2NNN A;  2HKX A;  2HOS A;  3F8B A;  4A3E J;  3QU3 A;  2GQQ A;  3MWM A;  1YQA A;  4KT6 A;  3SXY A;  4J00 A;  4MQ9 F;  1BIA A;  3DTE A;  3FBN B;  3JSO A;  3CC4 I;  5HNH A;  2V4J C;  2NVT J;  2CV1 A;  2HNH A;  2Q2E B;  1XC5 A;  2Q2E A;  1B59 A;  4BE0 A;  2Y31 A;  3A0B C;  3E6D A;  3P5J A;  2E7W A;  1YFH A;  2C6Y A;  4OMZ A;  3W2A A;  2K3P A;  3ONQ A;  4S04 A;  2YS9 A;  1HW5 A;  1U5T B;  1U5T A;  4I99 C;  2VKD A;  5HS8 A;  2R7T A;  4L5I A;  2DQL A;  3BG7 A;  4KMF A;  2L7M P;  3LSR A;  4ESF A;  5L3E A;  5D5X B;  1YO5 C;  2AQE A;  2HDD A;  4MLO A;  1BR4 A;  3KEY A;  3TL4 X;  3J7Z I;  1XX5 A;  3WU0 A;  3E0J B;  2GXB A;  1DDN A;  2KPM A;  3K4B A;  2M8E A;  2X6Y A;  1R6R A;  2L4M A;  3U21 A;  4DBR A;  2ZSH B;  2B0L A;  3G71 I;  4E7I A;  5EEA A;  2Y9Z A;  1IDZ A;  4BQA A;  3V8J A;  2HKO A;  2XPV A;  4BQQ A;  2PMU A;  2VT3 A;  4P5O A;  5J4V A;  1BN5 A;  3D0S A;  2EBI A;  2LY2 A;  3FWE A;  1Z7L A;  4B3A A;  5JI6 A;  3GWZ A;  1PYV A;  4Y13 A;  1Z7U A;  4ZTJ A;  3FXK A;  1IN8 A;  4OWR B;  4IRG A;  3LST A;  2EB7 A;  2FU4 A;  5FKM A;  1RUN A;  3HKZ N;  3D5S C;  1VF9 A;  3WTZ A;  4B48 A;  3E5Q A;  5IYD J;  3H3U A;  2W84 A;  2R0Q C;  3K70 C;  2UXN A;  2FRH A;  3TOB A;  3DEU A;  4QSH A;  5A2Q K;  4U88 A;  1LUJ B;  5GAE J;  3E5X A;  2W48 A;  2MYS A;  4E7J A;  2QQA A;  4RB2 C;  3GTQ J;  2EIL H;  3CLO A;  4PFP A;  3SZG A;  1D5V A;  4AC0 A;  1SVO A;  3LSM A;  4OIR F;  1TLH B;  4RAZ A;  3DV8 A;  4P9U A;  1MKM A;  5LHI A;  3H92 A;  2ZJR F;  2F6C A;  3HPG A;  1DUX C;  3A1Y A;  3FKI J;  5F0F A;  1OFC X;  4N9I A;  3ZN0 A;  4WX9 A;  2N8G A;  4LK1 F;  4XRS A;  4EVI A;  4BHP A;  1J9I A;  3ZRG A;  2EZK A;  4G7Z F;  1R36 A;  2ADU A;  1CQT A;  3KET A;  3OYE A;  3LSJ A;  3KEO A;  4RAF A;  4R79 A;  1FC3 A;  2VL8 A;  3RYP A;  3CCQ I;  2FX0 A;  1F9N A;  3ASO H;  1LQ1 A;  3FK7 A;  1BR2 A;  4MFD A;  1ZR2 A;  1VFC A;  1JJ6 C;  3DU6 A;  3WTY C;  1ZGW A;  2LOO A;  1UCR A;  2JWT A;  3FDY A;  2L7F P;  4BAY A;  2NNY A;  2FBI A;  1W7P D;  3I54 A;  3R61 A;  2Y2Z A;  2XSD C;  1PUF A;  3SFZ A;  2AXT C;  2ELK A;  3PSF A;  1GUU A;  2OQR A;  1PUF B;  2GXA A;  4KJZ A;  4EJW A;  4CH7 A;  2B9S A;  2QQ9 A;  3WHC A;  1K83 J;  2STT A;  3X2Q H;  1U78 A;  3I71 A;  4JP0 A;  1RZ4 A;  1TQM A;  4BJT A;  2K9L A;  2DJN A;  2L5Q A;  5HVQ C;  1LDK B;  3H9G A;  2LKX A;  3L2V A;  4L0Z B;  4HNU A;  4L0Y B;  4PUS A;  3V8L A;  3LSI A;  3ZQ7 A;  1USS A;  3RPU D;  4LIT A;  2ZJ2 A;  4EAT A;  2DFH A;  2HPI A;  2L02 A;  2IAI A;  4DIQ A;  4IX7 A;  1X1P A;  4A3J J;  4EJO A;  2OTJ I;  2W82 A;  3D5R C;  3T5X A;  1FIP A;  2MW8 A;  4BYY A;  4LIU A;  2EZL A;  3CO7 C;  1RR7 A;  2JZY A;  1ZR4 A;  2GOX B;  2CSO A;  1RKT A;  5DD4 A;  1LVK A;  2QYO A;  1KU2 A;  2ZB9 A;  3BZ6 A;  3U9G A;  4A3I J;  1FSH A;  4N9H A;  4ZJZ A;  3S1Q J;  4WF2 A;  2FNP A;  3IC7 A;  2LY1 A;  3Q0U A;  2COB A;  3HRU A;  3N05 A;  4E6K G;  2V9V A;  3OS2 A;  2DT6 A;  3K0L A;  3GCM A;  4NC6 A;  1MNM C;  1UHS A;  4M3F A;  1QZY A;  2RQQ A;  1AKH B;  1AKH A;  2G7H A;  3K7A J;  2XV4 S;  3R0A A;  3CJN A;  2F5C A;  4XR6 A;  1VQN I;  1XD7 A;  4LB6 B;  3D5L A;  1MMN A;  4M3B A;  3K4K A;  5FFZ A;  3TMO A;  3KPH A;  4FE7 A;  2L9V A;  1JXS A;  2VB6 A;  1LNW A;  5JVT A;  4DZJ A;  5CVU A;  4DBQ A;  1ENH A;  1W0U A;  3IH4 A;  4M6V A;  1UHM A;  2W57 A;  1MBE A;  3ASN H;  4PJ0 C;  1FOY A;  3SEQ A;  3IRR A;  2IRF G;  4WK8 F;  2YX4 A;  3CC7 I;  2VUM J;  3DTI A;  1YHQ I;  5E18 F;  2KIQ A;  2OA4 A;  5E1X A;  2ME6 A;  5IYB J;  2M7A A;  3D1N I;  1ETY A;  3BZK A;  1KU7 A;  2CV0 A;  4OIQ F;  4YEL A;  5FKN A;  5H2F C;  3M1C A;  1JUM A;  1UG2 A;  3MQ0 A;  1A04 A;  2PLY A;  2XAG A;  3H3V K;  2QVO A;  5ILS A;  2QQ8 A;  2MD0 A;  1PUE E;  4IHS A;  2QQB A;  4RA2 A;  3IKV A;  4ENK A;  3LMM A;  3KX2 A;  4XK4 A;  3CCS I;  1RET A;  2KZV A;  3FXO A;  1SFX A;  2JA6 J;  3AG2 H;  3F0C A;  2HWV A;  4B47 A;  3S14 J;  3FMQ A;  4RAG A;  2HYG D;  5DCM B;  5DCM A;  2HQA A;  4E7S A;  3OIP A;  1FBQ A;  3QQA A;  5LHG A;  1RPW A;  1WHU A;  1SFE A;  3PNT A;  4LLG F;  2LRD A;  2M1B A;  4RM2 A;  2IGK A;  2DO7 A;  2VPR A;  3EQL F;  3FMS A;  5LD2 C;  2LD5 A;  1BM9 A;  1R58 A;  3ABT A;  3W2V A;  2H8R A;  1MMS A;  1ZKG A;  3A01 A;  1SFO J;  4UY8 I;  1V5F A;  2BY1 A;  2EIJ H;  2NOJ B;  1HLV A;  1N77 A;  2RRE A;  2Y0M A;  1DU0 A;  3FXQ A;  1HDD C;  1ZH5 A;  4Q47 A;  4KNY A;  4XKB A;  5ICE A;  2X51 A;  2GLO A;  3S93 A;  2ZJQ F;  4BJ6 C;  3BCA A;  3TP0 A;  2LY9 A;  4R8H A;  2H6C A;  2MH9 A;  2DA1 A;  3EDP A;  1Y39 A;  3AL0 C;  3WE3 A;  2OQG A;  3MZY A;  4HZF A;  2QSH X;  3ABU A;  1STZ A;  3OS1 A;  3L2U A;  3CUQ C;  2Z1D A;  4I02 A;  3HOV J;  1H0M A;  2NS7 A;  3PNV A;  3CF5 F;  3F8F A;  1O7F A;  4AVZ A;  4E4H A;  1VQL I;  3C2G A;  2EPF A;  2I8D A;  1LFU P;  2TDX A;  2YX7 A;  2HDW A;  1KGS A;  1YIT I;  5F6F A;  3J81 Z;  1X2M A;  3DU5 A;  3JCU C;  4BE1 A;  1LFP A;  2ZME B;  1YW8 A;  2ZME A;  2L9R A;  3FHZ A;  4CXF A;  4RS8 A;  1XGO A;  1OPC A;  3RQ4 A;  2O3F A;  1DQU A;  5FD6 A;  1E2X A;  2XAH A;  2HQR A;  1LKX A;  1JTY A;  1R4N B;  3HOT A;  4L5J A;  4IHX A;  1MNE A;  4ZC3 A;  3E5U A;  4QWQ A;  2WAQ A;  2DA6 A;  3FF5 A;  3R6S A;  4D7N A;  3FHN A;  2I5U A;  3G73 A;  1JJ8 C;  3OOU A;  2DI3 A;  4Q48 A;  3G6E I;  4I09 A;  4AIJ A;  5B1B H;  1IXS B;  4IOC F;  3JRD A;  2XGC A;  1HCR A;  1WJB A;  4ZYG A;  3MZ8 A;  2L9S A;  2RV8 A;  3HSF A;  1I1G A;  4A2U A;  3BPX A;  1FYL A;  3REO A;  2X0L A;  2YSR A;  3K1N A;  3GZN B;  1R00 A;  3HIF A;  1ETQ A;  3S3N A;  2XPW A;  1FSE A;  4KN4 X;  4M9X A;  1LEA A;  4FCY A;  1U0J A;  1OYI A;  1TZL A;  1DPR A;  1U9O A;  3DQV C;  2PFB A;  2P7V B;  3P9C A;  3DPU A;  3WG7 H;  4Z2Y A;  1HF0 A;  2MSY A;  4RM3 A;  1QPI A;  2UWM A;  5DS9 A;  2F5F A;  5EYR A;  2R7O A;  2WTE A;  4FQG A;  4RBO A;  1FLI A;  3S32 A;  5TIS C;  2H27 A;  2GOM A;  2BHZ A;  2HI3 A;  3H0G J;  3V42 A;  4BBR J;  5LHH A;  5HDG A;  2ZNZ A;  5J47 A;  1T2K A;  5DEQ A;  2PI0 A;  5HOO A;  4YIF A;  2QKL B;  1IF1 A;  4HF2 A;  3QP6 A;  1IV6 A;  3I9V 2;  2VOP A;  2E1M C;  3ML6 A;  3EYI A;  1XGM A;  4IHV A;  3FXR A;  5EEH A;  5DDG A;  1RIO H;  1KYZ A;  3RQI A;  4C2T A;  4HST A;  4A0Z A;  2QLZ A;  2OZ6 A;  4G6Q A;  2JMW A;  3HL2 A;  2IS4 A;  3ERM A;  3AG3 H;  3ZQQ A;  1R4M B;  1KU3 A;  2COM A;  3FZV A;  3NEU A;  4HX8 A;  3HOY J;  3LA2 A;  1U2W A;  2L7K A;  3VYU B;  1B8I B;  1B8I A;  5D8K B;  1P9Q C;  2CUJ A;  4CDG A;  5E8I A;  1XDU A;  3FIW A;  3FXJ A;  3RKY A;  2ZJP F;  1E3P A;  2Z9O A;  2K9N A;  1S72 I;  2ZKZ A;  2VC1 A;  1X4O A;  1F1Z A;  2LP0 A;  2M34 A;  2QZ8 A;  4L5E A;  2AQF A;  3KYC B;  1YYV A;  2DFF A;  2BE5 F;  3HEF A;  1FIA A;  2L4A A;  1HC8 A;  4UV8 A;  3UNG C;  4HPQ A;  1HOM A;  3VDX A;  1WCM J;  3K4N A;  4ENM A;  1JKR C;  2HYF A;  3OYM A;  1TWH J;  1ZGJ A;  3U1K A;  2NXN B;  3C2H A;  1UG0 A;  1YE9 A;  3KP3 A;  2A68 F;  4FET A;  4XON A;  2BVL A;  2KRF A;  1QZE A;  4O6J A;  1Y0U A;  4EGZ A;  4HRI A;  1LB2 A;  1P6R A;  1X19 A;  5J3L A;  1H9G A;  3JTG A;  3OOP A;  4ZYA A;  4NUB A;  3V7S A;  1RES A;  2HXO A;  3ZXS A;  4CCJ A;  1OIS A;  1SFU A;  3VSK A;  4A3B J;  2GAU A;  3HPH A;  4DNC A;  5E1W A;  1YJW I;  1CF7 B;  1I6H J;  1CF7 A;  3GFJ A;  3VB2 A;  4AVP A;  3LQQ A;  3EYY A;  3F8C A;  2W24 A;  3VYR B;  3GFM A;  4Y52 J;  3ROU A;  2KZG A;  3DXJ F;  1ZG3 A;  2CH0 A;  2DN0 A;  4KIB A;  2K40 A;  2E5N A;  5L3G A;  3EUA A;  1MGT A;  4ZZL A;  3OYD A;  2XAJ A;  1YJ9 I;  2DU9 A;  1HST A;  3MZH A;  1NK3 P;  3IRQ A;  1T39 A;  1GV2 A;  1RUO A;  1D1A A;  4YFK F;  3KYL A;  4JBA A;  3PFI A;  2H09 A;  1W5S A;  4LLN A;  2IS2 A;  2X1D A;  1ULY A;  2JRT A;  1FX7 A;  1WWX A;  1MBH A;  1HKQ A;  4U7B A;  5DD8 A;  1OR7 A;  1QVT A;  2XVC A;  2VKV A;  2WB1 N;  2IVM A;  2RNG A;  1G59 A;  1OCZ H;  5FKL A;  5BQT A;  5JVG F;  4FT8 A;  1WKM A;  1FYM A;  1Z9C A;  2BV6 A;  3ELK A;  3WGH A;  3HXL A;  4AID A;  5IT9 K;  3BCB A;  2AO9 A;  4M9Z A;  5BPD A;  1ZRF A;  1R5G A;  1W4M A;  3BR5 A;  2JA5 J;  3CO6 C;  1MD0 A;  4RLQ A;  3WOD F;  3JAM K;  3T8R A;  1CGP A;  4EM0 B;  2PMH A;  4ZTF A;  1VQO I;  1U9N A;  3CTA A;  2G9W A;  2KIF A;  4F91 B;  2OU2 A;  1SAU A;  5CYV A;  1QPM A;  5K1Y A;  4F55 A;  2R7Q A;  3OIO A;  4BL0 B;  2ZC2 A;  5LEJ A;  3DEW A;  5FLX K;  2GZW A;  2EWN A;  1I39 A;  3MN2 A;  1WVR A;  4RGS A;  3GTP J;  1X1A A;  4N0B A;  2CO5 A;  5TGT A;  5LGT A;  3LAP A;  4BJ5 C;  1OMI A;  5J4Y A;  2BBY A;  2K9Q A;  4HSR A;  2K02 A;  3LFU A;  2VKE A;  3S1N J;  5LRR A;  2M7B A;  2V6C A;  5IOY A;  4CYC B;  3VOD A;  4CYC A;  4BE2 A;  1VQK I;  1I5Z A;  1YLF A;  4RB0 A;  2KJC A;  1X1C A;  2F5D A;  3ZP5 A;  3PIP F;  2DT5 A;  1WI3 A;  2E19 A;  5DM6 F;  1BL0 A;  1KU9 A;  2E7X A;  3CDL A;  5C3E J;  2FNA A;  2Z16 A;  1S3J A;  2P0W A;  3QPS A;  1J75 A;  1YTY A;  1E17 A;  3TGN A;  4A6D A;  1KA8 A;  5E3M A;  5JR3 A;  1NG6 A;  3C2B A;  4DYR A;  2EZI A;  1ON2 A;  2PN6 A;  2PMZ A;  1JE8 A;  3BJO A;  3JRE A;  3TED A;  3K6G A;  3WTT C;  2VJ5 A;  4JYK A;  4LMY A;  4BBS J;  3BJ6 A;  4PK4 A;  1L0O C;  5F08 A;  2Q1Z B;  2XF6 A;  3FXU A;  1SD4 A;  1T0F A;  4RAY A;  1ZRC A;  4S0H B;  3MMY B;  1PP7 U;  2K3F A;  5E3L A;  4C9Y A;  4A3L J;  4C30 A;  4Y33 A;  3HB9 A;  1G8X A;  1EH7 A;  3WTW C;  2K9S A;  5H6Q A;  2QA4 I;  1XTA A;  1YIJ I;  3BJA A;  2ID3 A;  3L2Q A;  2FF4 A;  1UMQ A;  3ABM H;  3BR2 A;  4L9N A;  4HA8 A;  2UUZ A;  2DOA A;  3BOQ A;  3OR1 C;  2DMT A;  4IEJ A;  3TO6 A;  2DQR A;  3OYN A;  3S2D J;  4EJU A;  1HW1 A;  1U6G A;  1FBU A;  1Z6T A;  2VE9 A;  2CV2 A;  3BY6 A;  3AFH A;  1DP3 A;  1W5C C;  4WXD A;  1XMK A;  3CJQ B;  2YR2 A;  5HS7 A;  4WCG A;  3S3M A;  3OL4 A;  3QAH A;  5M5Y J;  1FT9 A;  2R7D A;  3TDU C;  1K6Y A;  4AIH A;  3OYA A;  5F0H A;  2IS1 A;  4ZDL A;  3S1R J;  1JKO C;  1Y8R B;  4LG3 A;  3L1P A;  2DDB A;  4XQF A;  1W36 C;  2HXI A;  1H88 C;  3IHU A;  5ILV A;  3OYC A;  1NTC A;  5BNG A;  5L3F A;  2Q0O A;  1ACI A;  1QZZ A;  2NVU B;  4AIK A;  1R5I D;  4D7M A;  4QPO A;  4A3G J;  2W00 A;  1JKP C;  5FB2 A;  5IP7 J;  1B6A A;  5J1Y A;  3GTK J;  2E36 A;  3OYI A;  3ERE D;  4RGU A;  1T8I A;  1DPU A;  1U5T C;  1TWC J;  2VJI A;  3PFY A;  1WJD A;  2JSP A;  4M3E A;  2MC4 A;  4G12 A;  2OAZ A;  4E7L A;  3G3Z A;  4IHT A;  2RN7 A;  3M3Y J;  5HLT A;  4BS9 A;  1YJN I;  3OMY A;  3L09 A;  1K4S A;  3ZQH A;  3FX3 A;  1HXD A;  1RKW A;  2LNB A;  3PL8 A;  3QPH A;  1SAX A;  3GXO A;  4J01 A;  2NYX A;  3BTC A;  2QBY B;  2OCC H;  2QBY A;  1A31 A;  4EGY A;  1RNL A;  3CD6 I;  2OJE D;  2XHK A;  3HHH A;  4FX4 A;  2ZCW A;  2M5W A;  3HZJ A;  4HDU A;  3CJR B;  3BQZ A;  3K4C A;  2UZK A;  5IP6 A;  1BOA A;  1FTT A;  1N25 A;  1T33 A;  4WXH A;  3OR2 C;  4C2M J;  3BZC A;  3BTL A;  2L2O A;  2XAQ A;  3J80 K;  4CGZ A;  1BIB A;  1YW7 A;  4PJN A;  3RPU A;  1LFB A;  5DYM A;  1XN7 A;  2MGQ A;  1FEX A;  5KCM A;  3GTM J;  2K4B A;  3CCM I;  1K7A A;  2O5R A;  3QRF F;  3S3O A;  4L9T A;  4DYQ A;  1A36 A;  2L0K A;  1R1T A;  1FOX A;  1WRJ A;  1KON A;  2NVQ J;  3ZN1 A;  3M1E A;  3TDZ C;  4KMU X;  1V5E A;  1BR1 A;  5LLQ A;  2M45 A;  3GW2 A;  3KP4 A;  5GPC A;  5J8C A;  1TTY A;  1T95 A;  2DOF A;  2QCO A;  4ENN A;  1X2N A;  2GA1 A;  4HF1 A;  2BVM A;  3WTS C;  4ON0 A;  2ZXI A;  3BT9 A;  3CZ6 A;  1ERD A;  2CQN A;  3AAF A;  2JUC A;  4I2O A;  2EJR A;  3ZMS A;  3JRG A;  3OV8 A;  2IGN A;  1TT0 A;  1ZYR F;  5LBQ A;  2LDU A;  2OPT A;  3ZOB A;  2RNJ A;  2KIS A;  1RRJ A;  3VSL A;  2DYR H;  3HM5 A;  5F1J A;  3K4L A;  3HRM A;  1B4A A;  2Y0S A;  4P55 A;  2WAE A;  4UUT A;  2KKO A;  2CU7 A;  3SZT A;  2PG4 A;  3S8P A;  2GXG A;  3J7A O;  3CLQ A;  1IXC A;  3K1M A;  1AA7 A;  5M5X J;  2Z99 A;  4RDU A;  2ELH A;  3IP4 B;  2DJI A;  1LJ9 A;  3DBH B;  3PO2 J;  1VQ8 I;  3S15 J;  5K7F A;  4A3F J;  1R5H A;  1TQI A;  2XSJ C;  4KFC A;  3B6A A;  1D0Z A;  2RDP A;  4XLC A;  5K5O A;  2FSW A;  3GYH X;  1H89 C;  4HV6 A;  4PSW A;  2HDC A;  1IV8 A;  2EIK H;  5EZH A;  3CCL I;  1OCP A;  2L01 A;  3TO9 A;  2F4M B;  3Q0W A;  4MQV A;  2XIG A;  1VQM I;  4Y17 A;  1IZ1 A;  4NBQ A;  2A6H F;  3IWF A;  3FMR A;  1YOV B;  3BR0 A;  5H6R A;  3F8M A;  5A2Q Z;  5H20 A;  2M0C A;  4LOC A;  3K70 D;  3BP8 A;  2R7W A;  1LVA A;  2VLA A;  1Y56 A;  5AIP A;  1FNN A;  4OIO F;  2E71 A;  2Z5U A;  1OYW A;  4A3K J;  4ESJ A;  1R7J A;  5EG0 B;  5EG0 A;  2IA0 A;  1MBJ A;  2Z2S B;  3CDI A;  4HV5 A;  4P9F A;  2JTV A;  3ZMU A;  4HQE A;  2VOO A;  5TJJ A;  2CQ7 A;  2ZXH A;  2X6W A;  1APL C;  5D8L B;  1G3Y A;  4PZJ A;  1V4R A;  1IW7 F;  3HGG A;  2VBZ A;  1R1V A;  3HTU A;  1FWZ A;  1TL8 A;  3MD2 A;  3BQY A;  3KLN A;  4MIM A;  1OYY A;  1XMX A;  3KLO A;  4DYC A;  3GX4 X;  2X6O A;  5J1R A;  4B4C A;  2IW5 A;  4CCN A;  1W1W E;  2Z33 A;  4PGG A;  4KA4 A;  2A5Y B;  1DGR M;  2LMD A;  3BTI A;  1BA5 A;  3E6C C;  1ZQ3 P;  1SVM A;  4CSW A;  3GZ5 A;  5CVJ A;  2K5C A;  3ZMV A;  2P6T A;  3F9K A;  5HLI A;  1JHF A;  3JRB A;  3Q5F A;  3CP8 A;  3FBI B;  2IEK A;  4DZP A;  3AG4 H;  1D0X A;  1OLT A;  3SQN A;  3TP3 A;  1S8N A;  3OWT A;  2DPD A;  3RJP A;  4UB6 C;  4P96 A;  2R5Y B;  2EH3 A;  2R5Y A;  2LBF B;  3Q3S A;  1R23 A;  2LBF A;  1MH4 A;  4IJA A;  2E34 A;  2XRN A;  3DF8 A;  4EJV A;  2GIZ A;  3L2W A;  1XG1 A;  3LFK A;  5BPI A;  2W25 A;  1O3R A;  3C18 A;  1WFX A;  3BG3 A;  5K5Q A;  2PQ8 A;  1X58 A;  4XOR A;  4M3D A;  5LRS A;  2V1U A;  3BTJ A;  1XPX A;  1SVL A;  5FKK A;  3I56 I;  2O03 A;  4JX6 A;  4Y4R A;  1SD6 A;  3K4J A;  4A93 J;  4B09 A;  2KIU A;  4NQW B;  4NQW A;  3HSR A;  2LSO A;  2D1H A;  3FXL A;  2LLK A;  1HKS A;  2EIM H;  3BR6 A;  2OUM A;  3K1P A;  2R7Z J;  5B1A H;  3OYK A;  2JUG A;  2DMU A;  2XF7 A;  2A61 A;  3MKY B;  2DK8 A;  1J2X A;  2CJJ A;  3NQO A;  3LA3 A;  2FE3 A;  3SEZ A;  4Y7N J;  1K4T A;  1ITY A;  3FIS A;  3J7A Y;  2WAQ N;  2R4G A;  3JR9 A;  3V4G A;  5JLX A;  1NH3 A;  3RKQ A;  3QPL A;  5KNL A;  3BDD A;  2XUB A;  4A0X A;  1RI7 A;  1ZN2 A;  4E7H A;  1G4D A;  2DK5 A;  4L9V A;  4C3I J;  3DLA A;  3GFL A;  4PFO A;  3O3K A;  1QVU A;  2BOL A;  4BHC A;  3QYF A;  2H8W A;  1PVE A;  3G1O A;  1O3Q A;  2JSC A;  1BJZ A;  3QOD A;  4II3 A;  1T6S A;  2QF7 A;  1IRG A;  1TT5 B;  5DV5 A;  2DA4 A;  2RKH A;  1JGG A;  2ZSI B;  1WH7 A;  5E3O A;  2AXL A;  3P9K A;  4XLP F;  2VQL A;  4II2 A;  2FEZ A;  1UB9 A;  2R5Z B;  2R5Z A;  2X6X A;  3NWT A;  2HZT A;  4MEX F;  4M6X A;  2VBY A;  4G6D A;  2E2I J;  1Y6I A;  4XIC A;  1TNT A;  5EDN A;  1LPQ A;  2LF8 A;  3SHF A;  1S5L C;  4Z6Y A;  3IH2 A;  5FFX A;  1JUS A;  2ZO4 A;  2YPR A;  1FMV A;  2P5L C;  1AU7 A;  4ASN A;  2ZME C;  5DTD A;  1TW3 A;  3M8F A;  5L3C A;  1T98 A;  2KRC A;  5D5W B;  3RYR A;  1WPK A;  2NVY J;  1VND A;  2Y75 A;  3SDB A;  2XRL A;  1X1B A;  5FGM A;  2P8T A;  3RDI A;  4L18 B;  1J59 A;  2O6G E;  2QWW A;  5E79 C;  5CVR A;  2A07 F;  2LH9 A;  3CCV I;  3M8J A;  4CZC A;  4NC7 A;  3GTO J;  4NC8 A;  1X3Z B;  4HX4 A;  4I0B A;  1QA6 A;  4XM3 A;  1UST A;  2K7L A;  2WY8 Q;  5JFR A;  3HG9 A;  3QP5 A;  3VOE A;  2JA7 J;  1T38 A;  3K2A A;  1YI2 I;  3CQZ J;  2R7U A;  4ZYH A;  3T1B A;  3CUO A;  3H9J A;  3H35 A;  4AYB A;  4IPA A;  5F27 A;  3W6K B;  2UXX A;  1WSU A;  2IBD A;  1H8A C;  1TWG J;  3MVP A;  3ZMD A;  2KJB A;  3GLL A;  1V55 H;  5HLG A;  2V79 A;  3KCC A;  4BY1 J;  2ZXW H;  3GBG A;  2CMP A;  4GYG A;  3MKZ A;  4IHW A;  2ZBK A;  1ONV A;  3PNY A;  2MFZ A;  2FBH A;  1ETK A;  4QTR A;  1QBJ A;  1VQ9 I;  1BOB A;  2DA3 A;  2H1L A;  3VWB A;  1D3Y A;  4IVN A;  3KEQ A;  3R60 A;  1R1U A;  1BC7 C;  3MCZ A;  1BI1 A;  2HTJ A;  2RC4 A;  3OSF A;  2DBB A;  2QKM B;  1E3O C;  4OU0 A;  2KHM A;  4IRH A;  5IYC J;  4UHT A;  3H1C A;  3JSP A;  2JT1 A;  3KZI C;  4FX0 A;  1YRN B;  1YRN A;  1JTX A;  1TQP A;  2VBW A;  2E35 A;  2KDO A;  2XGE A;  1G3W A;  5IT3 A;  3CMY A;  5B3S H;  2IT0 A;  3A03 A;  4NDL A;  3WGG A;  1POG A;  2UV1 A;  2DLL A;  2NVX J;  1EF4 A;  1LE8 B;  1LE8 A;  2JPC A;  3GF2 A;  1LDD A;  4A69 C;  2ME0 A;  1ZHF A;  2DOE A;  2L7Z A;  4XLA A;  3I64 A;  3QYE A;  4B43 A;  1QHH D;  4BEH B;  3ECO A;  4BEH A;  1YIO A;  2EV5 A;  2XC7 A;  4LB5 A;  5CJ9 A;  4BXF A;  3CMA I;  2K86 A;  3CCE I;  4JQF A;  4PJL A;  3OYB A;  1A35 A;  1GV5 A;  1YG2 A;  4BQN A;  4XKV A;  1GT0 C;  2L3D A;  4A6E A;  3K9T A;  3VPR A;  2M4K A;  1IN7 A;  2NS0 A;  3TQN A;  1VTN C;  2Y48 A;  1WI9 A;  2BEO A;  3HHG A;  3ULQ B;  4IZZ A;  3RIR A;  3RCO A;  3V8K A;  3EUH A;  2IGO A;  5M5W J;  4MTD A;  3BRO A;  4I76 A;  2DMN A;  3M07 A;  3U1D A;  5B66 C;  3A2K A;  5EGO B;  5EGO A;  5CQE A;  4XN3 A;  1B1B A;  2MH2 A;  2ZFW A;  5AIQ A;  2CUE A;  4EV0 A;  4CO8 A;  4L9J A;  1ZTR A;  1D1C A;  1SAN A;  1F4K A;  1GVD A;  4HF0 A;  2BGC A;  4ABZ A;  9ANT A;  4U0Y A;  2KRH A;  2OCE A;  2TRT A;  4GGG A;  2NS8 A;  3LQR A;  4OIP F;  3L9F A;  3HTS B;  1ZGA A;  4MO7 A;  4M9S A;  5HNF A;  4YII A;  2F4I A;  2QSF X;  2MA3 A;  5GP9 A;  1D5Y A;  2WAF A;  5ERI A;  5KHD A;  4LD5 A;  2ECB A;  2ISY A;  4U0W A;  1O3S A;  4GRI A;  5FKO A;  3F6V A;  1Y1W J;  4HEA 2;  1J09 A;  2HTS A;  3L00 A;  4ITV A;  1HSJ A;  3HC7 A;  3OYF A;  4XKW A;  1MW7 A;  3DFG A;  5IOZ A;  3QU6 A;  3TBI A;  2H6B A;  1KZH A;  5KAF C;  3JRF A;  1MBF A;  3PJR A;  4HNT A;  1KQ8 A;  1WGX A;  1Z77 A;  2M87 A;  5KAI C;  3LSP A;  2GWR A;  3I55 I;  4AM3 A;  5D6F A;  5E17 F;  3BC8 A;  3IH3 A;  3CCU I;  3BG9 A;  2JN6 A;  2IJL A;  4XRF A;  2EK5 A;  4ZDP A;  5J8F A;  2FML A;  1J7K A;  3IAS 2;  5EF6 A;  1VQP I;  1DU6 A;  3K2Z A;  2DFE A;  2CG4 A;  3T0Y A;  1UAA A;  4OMY A;  4A5N A;  3I4N J;  1D8K A;  3TW7 A;  1D8J A;  1MBG A;  3HSE A;  2F4O B;  1OR7 C;  2OF7 A;  4ETS A;  1WJE A;  4MTE A;  4LG0 B;  1S29 A;  4LG0 A;  1S6L A;  4A3D J;  3SDG A;  2W7N A;  4A0Y A;  1IN6 A;  3M4O J;  2PMZ N;  4AWX B;  4HNV A;  4IQJ A;  2D2W A;  2GIV A;  3I4M J;  4Q5S F;  3W6J B;  2R7R A;  2EFQ A;  4B8X A;  3N97 A;  1PP8 F;  1Y1V J;  2P5V A;  4DJA A;  5FJ8 J;  1Y0N A;  4XN0 A;  1RR8 C;  2O9L A;  1G6N A;  2KT0 A;  4B44 A;  2R7V A;  3BLY A;  2E2J J;  5IPA A;  1IO2 A;  2DDA A;  1PDN C;  1I1S A;  2BZT A;  2K9M A;  3WTU C;  3OYJ A;  1ZRE A;  3HOU J;  3RSN A;  4RB3 C;  1IC8 A;  3F3X A;  5EZG A;  3KZY A;  3R0J A;  3FM5 A;  4XNF A;  2HGC A;  3VFZ A;  3CC2 I;  3C7J A;  3VYT B;  2DMP A;  1TP4 A;  4XID A;  2WV0 A;  2DAO A;  4YFX F;  1ZK8 A;  4IRI A;  1H9T A;  4HAM A;  2CFO A;  4XSZ F;  3HDD A;  4OAY A;  5CVI A;  3KP7 A;  4YG2 F;  3CCJ I;  3ZPL A;  4BKX A;  3GVA A;  4XRS G;  4UVC A;  1XCV A;  3GME A;  4D5C A;  1SC7 A;  2QGU A;  2W4S A;  3CJT B;  1WJF A;  3LA7 A;  2E1N A;  3DBL B;  3LOC A;  4ESB A;  1UFM A;  1B9M A;  4XOT A;  4KYW A;  2FOK A;  2LR8 A;  2VC0 A;  1ZLK A;  2F2E A;  3RKW A;  2O61 A;  3KP2 A;  4HYE A;  4BH9 A;  4XRM A;  1KQ0 A;  4IO9 F;  1YS6 A;  5F04 A;  4KIG A;  5JLW A;  5IT9 Z;  1MDM B;  1MDM A;  4NNJ A;  4OIN F;  2HVQ A;  3TKY A;  2XGX A;  3C1D A;  4M74 A;  1SMT A;  5C44 J;  2XKP A;  4ZDO A;  2RGV A;  4GCV A;  5CVV A;  1YX5 A;  4AU7 A;  1JI8 A;  3JAM Z;  3HOX J;  2ID6 A;  3B6C A;  3PM1 A;  4XLE A;  3NRV A;  3EPZ A;  3GEZ A;  4CHU A;  3B02 A;  4HG2 A;  4PJJ A;  1IGN A;  4BNC A;  2M3A A;  3RTR A;  1T0F C;  3LSH A;  3HOW J;  1ETX A;  3DKX A;  1BJA A;  2VBX A;  5FLX Z;  3G4S I;  2GM4 A;  4O5V A;  3GZ6 A;  5EEG A;  2FXA A;  5J6X A;  2KQR A;  2ZNY A;  3ZCO A;  5F1R A;  2P7C B;  2PEX A;  4U87 A;  1IN4 A;  5L3B A;  1K78 B;  2G7U A;  5AON A;  2OC6 A;  4F52 A;  3QYB A;  1K78 A;  3S1M J;  4LFU A;  2MLK A;  1ZG5 A;  1I27 A;  4IHY A;  3KP6 A;  4W97 A;  3F21 A;  4X6A J;  3RZD J;  2O7O A;  3OL3 A;  1FMW A;  1QO0 D;  1QGP A;  1TWA J;  3DKW A;  2MLG A;  4H4K C;  3PO3 J;  1MMG A;  3I5U A;  3PUB A;  3ABL H;  1OKR A;  4R1H A;  3O2P E;  1IUF A;  1FP2 A;  1K61 A;  2XGD A;  3FXM A;  2GBY A;  1W7P B;  2HS5 A;  1W7P A;  1HKT A;  2XPU A;  3BR3 A;  4I01 A;  4IL6 C;  4XMY A;  4I98 B;  1ETO A;  3R4K A;  1BW5 A;  1L3L A;  3CCR I;  2R7X A;  2Y0S N;  4X0G A;  3E3V A;  1X1D A;  2DOD A;  4UUS B;  4UUS A;  2EQR A;  2L9N A;  4BGD A;  2IXS A;  3O8H A;  3ZQF A;  4BDY A;  1E3H A;  2J5O A;  1K6O A;  1AOY A;  3RKX A;  2M8G X;  4XL9 A;  5D5U B;  2BY2 A;  2LRE A;  3QOP A;  3BG5 A;  1Q1V A;  1XCB A;  2LC2 A;  3KP5 A;  2O8K A;  1R49 A;  3MFK A;  2P4W A;  4F92 B;  1N78 A;  1XGN A;  1KYW A;  1ZLJ A;  3KZZ A;  1OCC H;  2V7F A;  4LIV A;  2G0E A;  4EEF G;  4FIS A;  4Q4Z F;  1MJ9 A;  2BYV E;  1I50 J;  3I4P A;  3IUO A;  3AKZ A;  3E6B A;  2EFN A;  3CF2 A;  3DKY A;  1JKQ C;  5D6E A;  2H94 A;  4S05 A;  1RC9 A;  4LJZ F;  1MH3 A;  3M9A A;  2X48 A;  3DLL F;  1XSV A;  2VON A;  4OAZ A;  2STW A;  1VI0 A;  2FJ1 A;  3OIQ A;  4ZZD A;  2BW3 B;  2BW3 A;  1W36 D;  1J0R A;  1XMA A;  2CYY A;  3BPV A;  3HUG B;  3HUG A;  1OCR H;  2JA2 A;  4GO1 A;  2M0M A;  3W6V A;  5F0C A;  3SYT A;  3ZMZ A;  2HFH A;  6PAX A;  5LEK A;  5FLV A;  3M7G A;  2JRM A;  4C2U A;  4JK1 X;  2FQ3 A;  1T56 A;  5HDK A;  2XB5 A;  5D4S A;  4PDK A;  2YUS A;  4KIC A;  2H1K A;  4EMS A;  2WY7 Q;  2JA8 J;  2XB0 X;  4QPQ A;  2E60 A;  2DA7 A;  2HYJ A;  5BOX A;  1DP7 P;  1HW2 A;  4F7Z A;  1R22 A;  4KN7 X;  2QSG X;  2CQQ A;  2KIM A;  4B1R A;  5CKT A;  1ZEL A;  3KIO A;  2RVC A;  3HOZ J;  2DTZ A;  3HKZ A;  4XLF A;  2DT7 B;  5C4X J;  2X4H A;  3QOE A;  2WA0 A;  4PGH A;  3COA C;  3OYH A;  1NK2 P;  3SJM A;  1VQ6 I;  2BY0 A;  3J80 Z;  4V19 K;  5CPR B;  1IUY A;  5M3M J;  5C4J J;  4U0V A;  4G9Y A;  4G8X A;  1O3T A;  2ECC A;  4HQM A;  2V9P A;  4LGW A;  4N4N B;  1I3Q J;  3OYG A;  2ETH A;  3GLX A;  1F43 A;  1X3W B;  1ETV A;  3WE2 A;  1IAW A;  1JGS A;  1Z1D A;  2DMQ A;  5GAD J;  2E2H J;  2A5W A;  2B7E A;  4IOA F;  1ZAR A;  2R92 J;  4FHT A;  4C3J J;  2CQX A;  1A5J A;  3EET A;  3KYD B;  3PQK A;  2A69 F;  4MHG A;  4BU2 A;  3F23 A;  4BQO A;  1Z0X A;  1EA3 A;  1WQ2 A;  2IA2 A;  2X1E A;  5HDN A;  3S17 J;  3ZQC A;  1MBK A;  3CDH A;  2FMY A;  5J40 A;  5KVR A;  2CRG A;  1REP C;  3CMM A;  4MGR A;  5HOD A;  3DBR B;  4FAS D;  1KQ9 A;  4A5M A;  4EM2 A;  2V1D A;  4Y3O A;  5GAH J;  3K69 A;  5IY5 H;  5ICF A;  1F36 A;  2CW8 A;  4W1U A;  3ZGK A;  3G2B A;  2QUF A;  4A12 A;  1NG7 A;  1R71 A;  1MJA A;  5J1U A;  2QEX I;  1VZ0 A;  2KP6 A;  2EV0 A;  3CME I;  4BHB A;  4JX5 A;  1IJW C;  1GDT A;  4CZZ A;  3QPT A;  3SFI A;  2VQG A;  2BXY A;  4XLH A;  1U8B A;  3WG9 A;  4CCM A;  2D1V A;  5BS6 A;  4EQQ A;  2EIN H;  1XDS A;  1XSD A;  2WV1 A;  4GXO A;  3DPT A;  2KLO A;  4B3X A;  2EZH A;  2EA4 A;  1JT0 A;  1O7L A;  4XBF A;  4GDF A;  3WHB A;  2M30 A;  2DYS H;  4E7K A; 
#chains in the Genus database with same CATH homology
 1VQ7 I;  2ZJP F;  2E36 A;  3G4S I;  1S72 I;  1VQP I;  1VQ4 I;  1VQM I;  3CF5 F;  1VQL I;  1YIT I;  2OTL I;  5GAE J;  1YJN I;  1VQN I;  2E35 A;  1HC8 A;  1VQK I;  3J7Y J;  2H8W A;  3CD6 I;  2NXN B;  2ZJR F;  5GAG J;  3PIP F;  1FOY A;  5DM6 F;  3CC7 I;  1VQ6 I;  1YHQ I;  4V19 K;  2FOW A;  3G6E I;  3PIO F;  3CCV I;  4IOC F;  3CMA I;  3CCM I;  3CCE I;  1FOW A;  5DM7 F;  1FOX A;  3CCQ I;  1YJW I;  3CC2 I;  5GAD J;  4IOA F;  3CCR I;  3CC4 I;  3CCS I;  2JQ7 A;  1VQ5 I;  3CCJ I;  1YJ9 I;  2K3F A;  2E34 A;  3CJT B;  5GAH J;  2QA4 I;  1YIJ I;  1QA6 A;  2QEX I;  1MMS A;  3J7Z I;  4UY8 I;  3I56 I;  3CME I;  1YI2 I;  4IO9 F;  5JVG F;  3G71 I;  3DLL F;  1VQ8 I;  2OTJ I;  2ZJQ F;  1ACI A;  1Y39 A;  3I55 I;  1VQO I;  3CCU I;  1VQ9 I;  3CCL I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...