1VQ7I

The structure of the transition state analogue "dca" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 23S ribosomal rna
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
molecule tags Ribosome
total genus 17
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 1vq7I00
3CC4I 5DM7F 1VQKI 1QA6A 1FOWA 2JQ7A 1ACIA 3DLLF 3CCRI 3CD6I 2ZJPF 3CF5F 1HC8A 1S72I 4IOAF 3CCJI 1YJ9I 2OTLI 1FOXA 3I56I 3CCMI 3CCQI 3CCUI 1VQOI 3J7ZI 1FOYA 3CCEI 2ZJQF 1YJNI 1Y39A 1VQPI 1VQ7I 3CMEI 1YJWI 1VQ4I 5GAEJ 1VQMI 1YI2I 5GAHJ 4IO9F 2OTJI 3CC7I 3G4SI 1VQLI 3CJTB 2E35A 5GAGJ 3PIOF 2FOWA 3CCVI 4IOCF 2QEXI 2QA4I 3J7YJ 1VQNI 3CCLI 3CCSI 4UY8I 2NXNB 1VQ8I 2ZJRF 4V19K 2K3FA 5DM6F 1YITI 1VQ5I 5GADJ 1VQ9I 5JVGF 3PIPF 2E36A 1YIJI 3G6EI 1VQ6I 1MMSA 3CMAI 3G71I 3I55I 1YHQI 3CC2I 2E34A 2H8WA
chains in the Genus database with same CATH superfamily
5TGTA 1SD7A 3AKZA 3EQLF 3J81Z 1LEBA 3HOZJ 2CQQA 5M3FJ 3QYFA 4XICA 4H4KC 3AG3H 2L9VA 1Y8RB 1R00A 3DLLF 3S93A 4UUVA 2R7OA 4W1UA 3CD6I 2VLAA 5LBQA 3H3VK 3JRCA 1NK3P 4KJZA 1ULYA 4MEXF 1XGMA 2EFQA 2XF5A 3CF5F 3J80Z 1K4TA 5KVRA 1N25A 2KISA 3FXKA 4YIIA 5EF6A 3FHZA 1OR7C 1T95A 3EUAA 3JRGA 1N78A 4FHTA 4K2EA 4A3MJ 3GTQJ 1X1PA 2ZNZA 3MKWB 4R79A 3D1NI 4OINF 1S6LA 2X0LA 4A3CJ 3CDLA 3I53A 3HOSA 3OYBA 1LFUP 5KAIC 4NC6A 3R61A 1FYMA 3D5RC 3CZ6A 3K1MA 4DGWB 4DQ2A 4RB3C 1VQ7I 3CMEI 4M9ZA 3GFMA 1X1AA 3KIOA 3WU1B 2XPWA 2ZSIB 1MMGA 3GTGJ 2L0KA 2CUJA 4AVPA 3FMRA 5BMZA 4PJNA 2COMA 4OU0A 2L3DA 2CQ7A 2K9MA 1TT0A 2QLZA 4XQFA 1WJDA 3AG2H 1POGA 3U1DA 3CMMA 4G9YA 4UB8C 3RYRA 2V4JC 3ASNH 3GW2A 2M87A 1BIBA 1T08B 4BU2A 1KU2A 4WX9A 2K4BA 3MKZA 2M7AA 3IL2A 2E7WA 3AFHA 5IP9J 4KIFA 3OYCA 3E5QA 2LSOA 3S3MA 4PDKA 5CKTA 4HYEA 2E1NA 2PQ8A 5DD8A 4B47A 4TV7A 2DA2A 2VBYA 5IYCJ 2HQRA 4XLCA 4A3BJ 1WSUA 4XM3A 3CJNA 4AUXA 1JUPA 4XKVA 4A6EA 2Y75A 3WTZA 4RAYA 1LE8A 1LDDA 3GZNB 1G2HA 2W00A 4N4NB 4HV6A 2RVCA 3DV8A 5JFRA 4IKFA 1I3QJ 3C2GA 2ELHA 1WJAA 2R7SA 2MH9A 2AO9A 1X1BA 3I64A 2GIZA 1A6QA 5EGOB 2DA1A 2LD5A 1HDDC 5D8LB 1D1BA 3WG9A 1OISA 2EZHA 2I10A 3K6GA 4L9VA 4ENJA 1FMVA 3TGNA 4F93B 4CGZA 3HSEA 1V55H 1OPCA 1A31A 2W4SA 1TC3C 3BR3A 3IWZA 2JZYA 3GTMJ 5H2FC 2OUMA 4XLAA 5F0FA 3S1QJ 2RC4A 5K5OA 1L0OC 2LNBA 4CO8A 4YFKF 5E20A 2RAEA 3LWFA 3IH3A 4M74A 2HDCA 5M3MJ 3OYLA 3L1PA 3SZGA 1FBUA 2FF4A 4DYQA 2QSGX 3SZTA 3NEUA 1XB4A 1WH7A 2FX0A 5B66C 1O57A 3TKYA 3JRHA 5BQTA 1Y6IA 2MABA 1B9MA 4A69C 1HOMA 3KP3A 2OD5A 2BOLA 3DFGA 5FB2A 1UG2A 1XSVA 5ERIA 2AXTC 1W5SA 4MLOA 3CCMI 1RUOA 2XGDA 3CCUI 2VQGA 1JJ8C 4RS8A 4FASD 4RDUA 1FYKA 1FNNA 2OZUA 2KZGA 1WJBA 4M71A 2ELJA 5F64A 1X3WB 3RIRA 1YW9A 3E6MA 2XAUA 1WI3A 1ZK8A 2VIXA 3CQZJ 5FLXZ 4XLPF 3RKQA 3IV5A 2GA2A 4BL0B 2OTJI 1FSEA 2Q1ZB 2ZXJA 4Y4RA 5IT3A 5AIPA 1DGRM 4LLLA 3BT9A 2Z33A 5LHGA 4A5NA 3JREA 2AS5F 3G1LA 3KFWX 3OS0A 1AKHB 3HRUA 4M6XA 2JJ7A 4V2GA 1R49A 3ZQGA 4CCLA 4M9XA 2V1XA 5L3EA 1JI8A 2M0CA 1HSJA 3ABUA 3IAS2 2HDDA 2F5VA 4EM1A 5FD6A 3BG7A 3WU0A 3BZ6A 1MJAA 4BE1A 3J7YJ 1RNLA 1K6YA 1PYVA 2MD5A 2CH0A 2KL4A 2DXIA 2BHZA 2Z3YA 1UELB 1Z0XA 2P5KA 4DIQA 3HYIA 3RTRA 2CUZA 2CS3A 2HOTA 1FTTA 1FY7A 3FXQA 1ETOA 4V19K 2IPQX 2FEZA 2NVXJ 4G94A 3DEUA 1SEUA 2IS6A 3CUQA 4GRIA 1S3JA 5M5WJ 3BDDA 2HXOA 2LC2A 3K70D 2HGCA 2HOAA 2XRLA 5F27A 2IA1A 3QAHA 1JHHA 2E36A 2F5CA 2VN2A 1YIJI 1N77A 1JE8A 3B6CA 5J8FA 3T8TA 1K78B 4N9IA 3PQKA 1ZGJA 3ML6A 1U5TC 3M8JA 3CC2I 2WA0A 1A35A 2O3FA 5L3BA 4BGDA 2OA4A 5ILSA 5FFXA 2OQRA 5J1UA 4B09A 5K7ZA 4FISA 3L2CA 1LJ9A 4CDGA 4PGHA 3P9IA 2FA5A 3K4LA 3VFZA 3BJAA 4HPQA 3I0TA 1ZRCA 1O3RA 3GZ5A 5K7HA 1MBFA 4LLGF 4G6TB 1HW5A 2X6YA 4UV8A 4ZYAA 1KU9A 4J01A 2RGVA 4FX0A 4PJLA 3TO7A 5LHIA 4PZJA 3D5LA 2ZMEB 2AQEA 4IHXA 3M9AA 3IRQA 5EJCA 4X1EA 1QPMA 1E0EA 1VQOI 2X4HA 4I0AA 1VFCA 3KYDB 1BI2A 3LSGA 4DOZA 2ICWG 1HW2A 2O8KA 3MZ8A 4MEYF 2ZJQF 2ZKZA 1A6IA 3N97A 3CP8A 1YW7A 2YX7A 5CVJA 1FJLA 4UUSA 3OYKA 2W24A 2WAQA 3I4PA 2JA5J 3HPHA 3PM1A 2X1EA 3OYJA 2K40A 2QENA 2HZTA 1VQLI 3CJTB 1X3UA 2HR3A 2XAJA 4B44A 1H88C 3BCAA 4XRFA 4AYBN 3U9GA 3HOXJ 2H27A 1I3AA 4XLHA 2L5QA 1ON2A 3H5RA 3NQOA 1BC7C 2FXAA 2HI3A 3ECOA 2BW3B 2R7XA 1OLTA 2MD0A 3GLXA 2KMUA 3SQNA 4R8HA 4IOCF 3ABKH 1S8NA 1RETA 3MZHA 4YFXF 1V3FA 4CZZA 4E7ZA 3NARA 1X4PA 2VE9A 1RKTA 3CCLI 4HQEA 2LKXA 1Q1HA 2DA3A 3HKZN 1K79A 1SMYF 2CSOA 2NXNB 1MJBA 4NC8A 5EEGA 1Z91A 1ZN2A 1D8JA 3SDBA 1DPRA 2DJIA 2EFPA 2KIQA 2VJ4A 4ZJZA 2GLOA 3DP7A 2VQHA 5JLWA 5E8IA 2Z1DA 4EJUA 3QOPA 3TOBA 3JTGA 2HKXA 3R60A 2NS8A 5E3NA 3IKTA 2JT1A 3SFIA 2X48A 2DK5A 2WV0A 4BACA 3BR5A 5IYBJ 2R5ZB 4RGUA 1JUMA 2VKHA 4B4CA 2CMPA 5F04A 4XK4A 3JAMZ 2L02A 3KLOA 4IQ4A 1UZCA 2Y0MA 1YO5C 1F9NA 1SFXA 3KP2A 4PSXA 4GCVA 2BXYA 4NBQA 2M5WA 3LSRA 2VJIA 1HA8A 5HODA 4A3FJ 2R5YA 3GTOJ 5CVIA 4ESFA 1RZ4A 2PMZN 1S7AA 4HAMA 1YJ9I 1B72A 2CUEA 2KLOA 4Y33A 1YE9A 1LFPA 1Y0UA 2V9VA 2K27A 3K2ZA 1O4XA 2EIKH 3ELKA 3WG7H 1PP8F 1P2FA 3PNVA 4U88A 2EFNA 1MJ9A 3ZQHA 1WJ5A 2X6OA 4R1HA 4GO1A 4XRSA 3RZOJ 1IN6A 4HEA2 2R7ZJ 3F3XA 1W0TA 2EWNA 2WB1N 3DBRB 5M5YJ 4IXAA 2E5ZA 1W36C 1FLIA 3EPZA 3L7WA 1J9IA 2DMPA 1UG0A 3L2UA 1IJWC 1HXDA 1ZH5A 3ROUA 5D6FA 3LSTA 3F22A 4IZZA 2W48A 3TP3A 3IH4A 3Q9SA 2PJRB 3F8FA 2BY2A 3VWBA 4XSXF 1USSA 2RREA 4CICA 1GXPA 3H5AA 3KX2A 1GXQA 2W1OA 5J1RA 4HNTA 1O3SA 3BJ6A 2LBFB 1TWCJ 2IP2A 3CUOA 4I98B 3A0HC 4RM3A 4H0EA 1JKOC 3RKWA 2YU9J 2A6HF 5FKLA 5C4JJ 1DQUA 3BP8A 2GXAA 3FK6A 4EMSA 4PFPA 2KJCA 2XSJC 2BEOA 3K0LA 1N75A 3DCFA 1LKXA 1MMAA 4AIDA 4IHYA 5FLVA 1XS9A 2R7UA 3ISPA 4II2A 3VEPA 3HRTA 5D5XB 2LOOA 3TOAA 1WFXA 1BR1A 1XMKA 3I3LA 4I02A 4CYCB 4BQOA 2CW0F 2M1BA 5IT9K 4RAFA 5LEJA 1MBEA 4O5VA 3RYPA 3A0BC 1A04A 3BJOA 3BTLA 5FKMA 1YRNA 5ILVA 2HKOA 2UXXA 1PUEE 4L5JA 4ASNA 5HLGA 3AAFA 1VQ9I 3S1RJ 1RKWA 2JRMA 3OV8A 3LOCA 5HLHA 1I39A 2O5RA 1GUUA 3KZIC 3RPUD 2DT7B 4BEHA 4EVIA 5LD2C 4OIPF 2NVUB 1A36A 3G71I 3HTUA 2ISZA 2R7QA 3RSNA 1LB2A 2H94A 3HHHA 3F23A 3BG6A 2KP6A 5LRSA 3DWLE 2MYSA 3JRAA 4X0GA 3OIOA 3F21A 1TL8A 1LPQA 2R93J 2QQBA 4LK0F 1R23A 2ZNYA 1MSEC 2LF7A 4A6DA 1B1BA 2VE8A 2JQ7A 4C2TA 2VT2A 3HOVJ 4NC7A 2VXZA 1FT9A 2IGKA 2NS0A 3S3NA 4M3DA 2OPTA 2A5YB 1TQIA 3TDZC 3TL4X 4MTEA 4EM0B 5JLXA 2FSWA 3TDUC 1YIOA 3GLLA 2Q0OA 4NDLA 1J5YA 2DQRA 3HC7A 1U5TB 1F1ZA 2KJBA 3I5UA 1Q1VA 2DYSH 4BNCA 3J7ZI 1TQPA 3SEZA 1P4XA 4WCGA 2LP0A 2XASA 3MKYB 1KQ8A 4HDUA 4QWQA 3BR2A 1Y39A 1FSHA 1EH6A 4HX4A 1PDNC 4XMYA 1J09A 5IOYA 2CW8A 1YJWI 3RKXA 3BPXA 3FXOA 1UMQA 4PFOA 4XBFA 1E3HA 4NQWB 1AKHA 1JKQC 2NAZA 2QVOA 2EIJH 2UXNA 2VOOA 2EV6A 3IWFA 5DV5A 2DPUA 1T6SA 3I58A 3G4SI 1D0ZA 1SFKA 4LG0B 5C4XJ 2A6TA 4CH7A 2F5FA 4MFEA 2VT3A 3E5XA 2KRFA 4WK8F 4KIBA 4EJOA 3DU6A 2WWYA 2JTVA 3RPQA 2UUZA 2HTSA 2NOGA 2UV1A 4QSHA 3FBIB 3WODF 2HEOA 5FD5A 3ZMSA 3F8CA 4A3DJ 4UHTA 5CLSA 4OIRF 1ZG3A 1Z1DA 4FCYA 1IRZA 1Z21A 4G7OF 4D5CA 3ULQB 4N0BA 5HLTA 1P7JA 2STWA 3HSRA 5HS7A 2DCEA 1I6HJ 1G3WA 4ZDOA 1O3TA 4OIOF 2QKLB 3LSIA 2DO7A 1JT0A 1DDNA 2GIVA 3G2BA 1USTA 4BE2A 1WJCA 3RI4A 1S29A 4RGXA 1SC7A 3H0GJ 2Z16A 4QTRA 2CV2A 4CCKA 5H6RA 1X58A 3WTTC 3DKXA 5JI6A 2NNNA 2RN7A 2D5VA 2BVLA 3ZQCA 2DQLA 2L7FP 1H9TA 3Q9VA 5E3MA 2IBDA 2E71A 1U9NA 4BXFA 4D1QA 4F91B 2Z99A 1QHHD 1EV7A 1T0FA 2GA1A 2XGCA 2DDAA 1U3EM 3LFKA 3OL4A 3OYIA 1I27A 3HSFA 1TP4A 4M6VA 1HCRA 4ANJA 4M3GA 5E79C 2CO5A 1LDJA 1K6OA 3KEQA 1IXCA 3EYIA 1WKMA 5LGNA 2CQXA 2L7ZA 4I76A 1FP1D 5CVVA 5DS9A 4EJTA 4ABZA 2JVGA 3G3ZA 3TMOA 4BJ5C 3S15J 1ZQ3P 4I6ZA 5IP7J 2M34A 3REOA 3GCMA 3GUDA 4HX8A 4DYCA 3M7GA 2FE3A 4AIJA 2GBYA 2O6GE 3L2RA 2BYVE 4IHWA 1OMIA 1ZAOA 2OCCH 3GX4X 2D1HA 2R7TA 3X2QH 3ZXSA 3HGGA 4XR6A 3GTPJ 5ICFA 2JA7J 3OOPA 4Q5SF 4BHPA 2N8GA 1YJNI 1EF4A 2BXZA 2E2JJ 3MAJA 5GAEJ 1H8AC 3HIFA 5IP6A 2LY2A 4U7DA 1U2WA 2Z2SB 5TRDA 4G8XA 4KMUX 5GAHJ 1YS7A 3QPLA 1IN5A 4LOCA 2EA4A 3VOEA 5J4YA 1JKRC 2IGMA 2HVSA 2JN6A 2UZKA 1IRGA 3BY6A 2OV7A 3FWEA 4HX7A 4I2OA 1UHSA 2VBZA 1OYWA 3MCZA 3M1CA 4ZYEA 3T5XA 2JMWA 2VBXA 4L0ZB 1KU3A 2VASA 1JGGA 4OWRB 4KFCA 2BZTA 1ON1A 5E1WA 1SVMA 1ZGWA 2Z9OA 2QYOA 4PCQA 2WC2A 5A2QK 4PGGA 5EG0B 1MBHA 1Z67A 3TBIA 2EJRA 1VI0A 4XOTA 4A12A 2DU9A 3LSJA 4JP0A 1HKTA 4MQ9F 2L01A 2BY0A 3H9GA 4HDVA 4ZDPA 4PJ0C 2IVMA 2W85A 4FETA 4HG2A 2ESHA 1XDUA 4IHSA 1FZPB 1PUFA 3P9CA 2R5ZA 2DMTA 3HBLA 1E17A 2Y2ZA 2F5DA 2MLKA 1BJZA 3WTWC 3GFJA 3CMAI 2MGQA 1HBXG 2JA2A 4D0PA 4FE4A 4AYBA 3I55I 3KZYA 1ETYA 1YHQI 3I4NJ 1Z6RA 4BUPA 2X51A 4RM2A 2QQ8A 3PO3J 4MFDA 5KCMA 3W6JB 2LK2A 5GTIC 3K2AA 4M9SA 1W0UA 1FWZA 1MNMC 3OIQA 3U2RA 1KYWA 4U0VA 3SDGA 3ZQ7A 2YPRA 1B4AA 2JSCA 1MNDA 3L00A 4F55A 2ZB9A 1W7PB 2LLKA 2MC4A 4UNOA 2Q2EB 5EEAA 3HKZA 2V6EA 2OTLI 2F4IA 2QUFA 3SYTA 3QOEA 2E2IJ 4XN3A 1IW7F 1X4OA 2VQCA 4KT5C 1MW7A 2K4JA 4WWCA 1FTZA 3WGHA 1IF1A 4Y52J 3O8HA 3ZR8X 1STZA 2DFFA 3LFUA 3OYGA 3ZMUA 2E1MC 2ISYA 3H1CA 3WU2C 3QP6A 2PJRA 1P4AA 5ICGA 1QPIA 2FD5A 3S2DJ 1ORKA 4EV0A 2XF7A 1VQMI 2FRHA 3JRBA 2DMUA 3ASOH 6PAXA 2WBMA 2IAIA 4U87A 5B1BH 1XN7A 2P8TA 1JUSA 2LBFA 2KRCA 2O7OA 1BJAA 2V1UA 1YQAA 3QP5A 1SFEA 5FROA 3FXLA 1IZ1A 3A01B 1ZYRF 1Z77A 3JRDA 2W7NA 2IT0A 4E7SA 3V8LA 3QYBA 1KU7A 2WY7Q 2GAUA 2V9KA 3HXLA 4GFBA 2IRFG 2STTA 3JW4A 3KEOA 2Y48A 1XX5A 3FIWA 5LHHA 3WTUC 2FUG2 1AOYA 4CYCA 1RESA 4HF1A 2PMZA 3LQQA 2LKPA 3F0CA 2ESNA 2HPIA 3ZP5A 4ESJA 3OYEA 1FP2A 1VQNI 1BR2A 3K1NA 3CCSI 2JA8J 3K69A 3GMEA 3JRIA 2VKVA 4WXHA 2EZLA 3CP2A 5TISC 2VBWA 4MNUA 3ZQIA 2WB1A 1DU6A 2R3SA 2QKMB 3B73A 5JHFA 1TTYA 2EQRA 5JVGF 5KHDA 5GPCA 3OS1A 1R22A 1RI7A 2PX9A 2QZ8A 3ZQQA 3PIPF 1YOVB 1UHWA 2V1DA 4OAZA 1VQ6I 1OCTC 2HZDA 4PUSA 5D5VB 3WGGA 4L9TA 1QRYA 3DPUA 1IAWA 2AQFA 2LR8A 2E1CA 2I8DA 4AC0A 4GGGA 2QQ9A 3BLYA 3R0JA 3I4MJ 2Y30A 3S1NJ 1TNTA 2X1CA 4JYKA 5J40A 4C30A 2CUFA 4KMFA 3HOUJ 3FISA 4XLFA 3R4KA 3H9JA 2E2HJ 3CCRI 3IRRA 3PUFA 5GPAA 2ZJPF 4W97A 2Q8KA 1LNWA 1BOAA 4D5FA 2PLYA 4P1WA 2QWWA 3OMYA 1FC3A 4CCMA 3O8GA 5D4RA 3HL2A 3BR6A 4YEJA 2O0YA 1HLVA 2IS2A 1UJ8A 2ZBKA 2EPFA 3RZDJ 2W84A 4M6YA 3ZQFA 1T39A 1G3SA 2VJJA 4AVZA 1RRJA 1REPC 2L7KA 1S5LC 2A05A 1BC8C 3JCUC 4F92B 3CJRB 4LG0A 1RR7A 3FXUA 2HS5A 1R5HA 3KP6A 2PMUA 4XNFA 1Z7LA 4IO9F 3ECHA 4M3BA 3ZOBA 1BI0A 1OYIA 3Q0WA 4C3IJ 5ICEA 5F1JA 2OJED 2R7WA 2FQ3A 3W2AA 3JSOA 2EZKA 3M8EA 1QO0D 1R4MB 4ETSA 5DD4A 2QQAA 3F72A 1K83J 2MW8A 1P6RA 3FXMA 4L18B 2EIMH 4QIWN 3LAPA 1W36D 2DOEA 5BNGA 1P92A 2ZO4A 3H0DA 3FKJA 1EA3A 3HOTA 2BBYA 1SANA 2P4WA 3KP7A 2L4MA 3DQVC 3LA3A 4KISA 2FMYA 3JAMK 4O3MA 2KRHA 3LQRA 1HSTA 3SHFA 1JJ6C 1ZR4A 1R5GA 4BJTA 4N4OB 2DA6A 1RUNA 2DA4A 1VQ8I 1B8IB 1G3YA 4B48A 3OYNA 2ZC2A 2V6CA 1XD7A 4XONA 2CJJA 2IGNA 1FEXA 1TWGJ 2NVQJ 2EH3A 5K7FA 5D6EA 2D45A 4UVBA 3VODA 1NG7A 3BZCA 3OSFA 2A6EF 3FXRA 3MQ0A 1H89C 2YSRA 3EYYA 4EJVA 4E7LA 2F5EA 2MG4A 3HUGB 4LLNA 2ACJA 1MSFC 3U21A 1KZHA 1VQKI 2GOXB 2AHQA 4C3HJ 4ZH4F 3CMYA 2MLGA 1QZYA 2ECBA 3FM5A 4P96A 2KZVA 5D4SA 1OKRA 1W7PD 4BDZA 1SMTA 2HOEA 4XLEA 5GTHC 1MMNA 5HS8A 2XAGA 3ERMA 4YELA 5F6FA 2D2WA 4V2FA 2WY8Q 3MMYB 3VYSB 4BHCA 2BE5F 3K1PA 2P81A 3V7SA 4EGYA 3A1YA 4ENKA 2H1LA 3NAUA 2Z5UA 1GV5A 3G1OA 2GM4A 5F0CA 4AU7A 5HDKA 2VJ5A 3P5JA 1OFCX 2VUMJ 1B6AA 1GHCA 2P0WA 3K4MA 1XC5A 5DUIA 2EK5A 2B9SA 1HW1A 4ESBA 4WF2A 1LVAA 5M5XJ 1LQ1A 1ENHA 2AXLA 2DT6A 4I99C 1IO2A 4HNUA 2VQLA 1U9OA 4EATA 4I7HA 3KLNA 1IUYA 4CCJA 4MTDA 3PFIA 3C7JA 2MA3A 3CO6C 3F6OA 4HLYA 2EBIA 1X19A 3H3ZA 4A5MA 3EETA 3GEZA 5CVUA 1HKQA 2HFHA 1Z9CA 5BS6A 5EG0A 2KFDA 2G7UA 5DDGA 3OR2C 1IN8A 2HYGD 2DFHA 2JUGA 5EZGA 2IS4A 1I1SA 1OJLA 4RA2A 1S9HA 2DYRH 2E1MB 5AIQA 1OCPA 2F48A 1LE8B 4U0WA 3F8BA 5LGUA 2CQNA 3OSGA 4A3IJ 3GTKJ 1O7FA 1JHFA 3CESA 2DW4A 3KE2A 2BVMA 2ECCA 4RMNA 3HRSA 1ZTRA 2KIUA 4D9JA 2XAFA 4UV9A 5TJJA 1WHUA 4CZCA 4DZJA 2X9DA 3IHUA 1ETWA 1WVRA 3HB9A 5DCMB 2A3SA 1I6XA 2R7VA 2V9PA 4A0ZA 4IL6C 1Z3YA 2ID3A 2UWMA 2VKDA 2ZXHA 4WXCA 3V42A 3GXOA 1B59A 4E7IA 3GFLA 3W2WA 2VPRA 4GDFA 2XAQA 3S32A 3WE2A 2K9SA 5FRMA 3G6EI 2RDPA 2IS1A 1V5FA 1K7AA 2DBBA 1P9QC 3T8RA 1ZR2A 2DDBA 4Z2YA 2VL8A 2IW5A 5EGOA 2V79A 3J7AO 3FF5A 3O6BB 2OZ6A 1W7PA 3BTJA 4CSWA 3GO5A 3RDIA 2EB7A 4XSZF 3W2VA 2ZXWH 4Y17A 5E1XA 4CUGA 3DKWA 4C3JJ 2H8RA 3GYHX 5BOXA 1U6GA 2DN0A 3QU3A 2A5WA 1G4DA 2PEXA 3ONQA 2R4GA 3FHNA 3KZZA 3FMQA 4IOAF 2XF6A 3PSIA 1MH3A 5AONA 3I59B 1ITYA 2CYYA 1D0XA 2DJNA 1BOBA 2P5VA 3EUHC 4IEJA 3Q0UA 1W1WE 2PMHA 5K5RA 2XPVA 2XVCA 1IDYA 3I54A 5JR3A 3NWSA 2D1VA 1AA7A 3A2KA 1FOYA 2X85A 1AU7A 2DT5A 2QM3A 1R7JA 2DLLA 2RQQA 4EQQA 4RBOA 1D0YA 5CVRA 2F6CA 2DA5A 5FKNA 4XL9A 2HQNA 2DPDA 1GDTA 2XSDC 1FIAA 2R7FA 4M3EA 2L54A 2PBIA 3DF8A 4KICA 1W4MA 1EH7A 3A02A 2E35A 3C2HA 1QQIA 1W5TA 3FX3A 2L9NA 1D8KA 3BQZA 3CDHA 5HS9A 4BE0A 5HNFA 3NRVA 2A69F 4RGSA 1BW5A 3C2BA 1EKEA 2DODA 5LEKA 3KCCA 2VC0A 1BN5A 3TEDA 1TNSA 4XN0A 2COBA 3CF2A 1MDMB 2M4KA 2HNHA 4CXFA 3VB2A 3ABLH 3GFIA 2M3AA 2DK8A 3H9QA 2OU2A 1SFOJ 2HPMA 4A3EJ 2K85A 2LKSA 2OAZA 4C2UA 4ENNA 2IA2A 2QBYB 1R1UA 2A07F 3AL0B 1YITI 2W25A 3RCOA 4MQVA 1E3OC 1ZARA 1S7OA 5KAFC 4CCOA 3OS2A 5J47A 5IT9Z 2XV4S 3BG3A 1FX7A 2DMQA 3HPGA 4BY7J 3ERED 4LITA 1QZZA 1UFMA 3S16J 2M8EA 4E6KG 3J81K 3B6AA 4BXUA 3CO7C 4U7BA 3EDPA 2ETHA 3DTEA 4RAGA 1YTYA 2W82A 1HKSA 2F2EA 1KYZA 2K9LA 1R5ID 2Y9YA 1XGOA 4ZZDA 1F36A 3E6DA 1QU3A 2OF7A 4DJAA 5DM7F 2G7HA 2A61A 2NRAC 1K78A 1XTAA 2HVQA 4KNYA 1YG2A 1JKPC 3J80K 3RPUA 2GOMA 4DW6A 2R7RA 4DNCA 4J00A 1UAAA 3K4JA 2L2OA 1XPXA 4IHTA 3DBHB 3R0AA 1Z05A 1S72I 4HV5A 5EZHA 1GVJA 4KIGA 4E7JA 4YG2F 1QZEA 1XGSA 3P9KA 3MKLA 3W3CA 1FOXA 1XG1A 1KA8A 4S0HB 3IAM2 2V26A 3ZN0A 2M9HA 3H36A 4IRGA 4XLNF 3BOQA 3OYMA 2KIFA 2XAHA 3WTYC 2KDZA 4UUSB 4EGZA 5C44J 1IN4A 1JTYA 1DUXC 2L4AA 5IPAA 2CWEA 4IPAA 4UB6C 5FKOA 2ZMEA 3CTAA 4KN7X 5JHUA 4CHUA 2DI3A 1MIJA 5CYVA 1IDZA 5J6XA 1ZG1A 3DPTA 1TWFJ 3N4MA 2B63J 1GT0C 3ZN1A 1YI2I 2QGUA 1T38A 2WAEA 4AWXB 2JK3A 4HRIA 3LA2A 1BBYA 3U1KA 2VC1A 2YU3A 1BW6A 2LYCA 3Q0VA 4UVCA 1GV2A 4U0YA 4OIQF 2VONA 2HYFA 2V1NA 2CFXA 3OR1C 1WZ2A 3FBNB 2IJLA 3QODA 2RQPA 4G6QA 4S04A 1EJ9A 3OWTA 3A03A 4Y3OA 5L3FA 4JQFA 1MKMA 1T0FC 1WPKA 1R6RA 1LVKA 2XROA 3JRFA 2EFOA 3F8NA 5D5UB 2FJ1A 1R9TJ 1RIOH 1J75A 2CQKA 1OR7A 5KK1A 2DOFA 1ETVA 5B5EC 2QF7A 4G7HF 1I5ZA 1R1TA 1B8IA 3DLAA 1F43A 3ZPLA 2BW3A 1RC9A 2EINH 5B3SH 3QQAA 4HBLA 1HQCA 3MZYA 2NOJB 3I71A 4GYIA 2MH2A 1G8XA 2V7FA 3IKVA 1YX5A 2PFBA 3MEXA 2VKEA 1LDKB 1FBSA 2P6TA 2P7VB 2QCOA 2IA0A 2XKOA 5CQEA 3QU6A 3S8PA 4A0YA 3GTLJ 3BCBA 1D1CA 1TQMA 5LLQA 3WTVC 1G6NA 3HUGA 4BQNA 3LAJA 2OCEA 2K02A 5J4VA 4BBRJ 3OYHA 1Y56A 1MH4A 1IRXA 1G59A 2FNAA 1KQ0A 2KT0A 4FT8A 2CW7A 4B3AA 1D5YA 5F1RA 2EV5A 2HXIA 1R71A 1IG7A 1WCMJ 4HF2A 1W5CC 2XKPA 4HA8A 2CG4A 2FMLA 5E17F 2PJPA 5IOZA 4RB1A 1KONA 2LF8A 2R5YB 3QRFF 2H6CA 1CGPA 1WQ2A 1FOWA 2K86A 3LSMA 4RB2C 5E3OA 2QSHX 4RLFA 2B0LA 1ACIA 2VPLA 1B72B 4D7NA 3E6CC 4AIKA 4A0XA 3IH2A 2NVTJ 1EH8A 3FXJA 1NG6A 3RKYA 2M2EA 5L3GA 4HZFA 5J3LA 3WTSC 4NHJA 2GQQA 2VI6A 4IF4A 1UB9A 4L9NA 5D8KB 3S2HJ 3CJQB 4OOIA 1X2MA 4A3KJ 3DTKA 1UCRA 2K9NA 1BI3A 1TWAJ 3IP4B 2DTZA 4Q47A 4FTHA 4Y15A 4EJWA 2XGXA 1P4WA 2FBIA 2X1DA 5FLXK 3T1BA 2K3PA 4XKBA 3E97A 4RB0A 3HDDA 2L7MP 4MIMA 5CQGA 4L9JA 1ERDA 1J59A 3DTIA 2M0MA 3ABMH 4LIVA 2Y9ZA 4KN4X 1ETKA 4JK1X 5DTDA 3PO2J 3S14J 3B02A 2Y69H 5DEQA 3CC7I 2JWTA 1D1AA 3WHCA 3JSPA 2XC7A 3QPTA 3GZ6A 1WWXA 1TT5B 2LG4A 5E3LA 1MNEA 1WI9A 1ZREA 3JR9A 4CA0A 3ZRGA 3V7CA 4BQAA 1QHGA 1DP3A 3COAC 2ZFWA 5K1YA 4ZC3A 1YFHA 5DCMA 1B9NA 2ZSHB 4B1RA 2DFIA 5K5QA 2Y31A 1YRNB 2HWVA 3TO9A 4UXNA 5E18F 3O2PE 1Y8QB 3C1DA 2WV1A 5A2QZ 4CYDA 3SEQA 1Z6TA 5HDNA 3GVAA 2B7EA 4BEHB 2K3FA 5BPDA 1T98A 2CU7A 2H6BA 4ON0A 1OCOH 2X6WA 4PJMA 3BG5A 4I09A 2DAOA 5GADJ 3L2QA 1L3LA 4HW0A 1IUFA 4MHGA 5EEHA 1SAXA 1QBJA 3K9TA 3ZGKA 2R7DA 2Y0SN 4IRIA 3S1MJ 4DZPA 2MC3A 3L2WA 2HTJA 1MMSA 1FPQA 4ZYHA 4ITVA 3S2WA 4E7KA 4ZDLA 4X6AJ 3DEEA 3MD2A 2VODA 2TRTA 3C18A 2E34A 1V4RA 4BKXA 3KP5A 2GXBA 3BPVA 1CF7B 1MZBA 1QA6A 1JT6A 1SD6A 4IQJA 3I59A 1QNTA 3K4KA 4MGRA 5H6QA 4IX7A 1TW2A 1U78A 1D3YA 1HDPA 1IC8A 4EM2A 5HNHA 5F0HA 2HOSA 5DYMA 1YX3A 1KGSA 4S05A 1MD0A 1T8IA 5LGTA 2TDXA 4AM3A 1Z7UA 2JPBA 3BR1A 1J0RA 1ETQA 3BWGA 4Q48A 1NK2P 1XSXA 4M72A 1X2NA 1TBXA 3VDXA 1PP7U 5HLIA 4CCNA 1JTXA 1LEAA 1RPWA 4J19A 2M7BA 1SD4A 3V4GA 1FYLA 3DEWA 5FJ8J 2PI0A 4RAZA 1U5TA 3OYDA 1MBGA 2CGPA 1ONVA 2E1OA 2EZIA 3SXYA 3VPRA 1Y1WJ 2P7CB 5IY5H 2XIGA 4YFNF 1DPUA 2K7LA 4PK4A 1ZLKA 1OCCH 1V54H 3PFYA 1E3PA 1MDMA 3IC7A 2WADA 4QPQA 2DTRA 4LIUA 4NQWA 3OYFA 2KPMA 3CCVI 1YS6A 5C3EJ 1XCVA 4JBAA 4LD5A 2VXDA 1AWCA 1LUJB 1ZHFA 5HDGA 2IXSA 4KT6A 2KQRA 4AD9A 4QLCU 2QBYA 1NHAA 1T56A 2G9WA 1F4KA 3J7AY 2RKHA 1QGPA 2JUCA 3CUQC 3L09A 3N05A 4C9YA 1E2XA 1U0JA 2M45A 2W57A 5HVQC 4G6DA 4XIDA 5FRNA 3MN2A 1AHDP 5FLMJ 2RV8A 3AL0C 4IVNA 1FIPA 4JOMA 2ID6A 4II3A 3GBGA 5DM6F 3TO6A 3MWMA 1IN7A 3A4CA 2O9LA 3PNYA 3FMSA 3D5SC 4BQQA 3DBLB 3VYUB 1DGWY 3KYCB 1SD5A 4AIHA 3K4BA 1VNDA 3LNQA 3V8KA 3V7RA 5CPRB 3S3OA 1DP7P 1MMDA 2CRGA 2F4MB 3H92A 5EDNA 2EILH 5FKKA 3HZJA 3UKGA 1IXRC 1FOKA 5ICCA 1CQTA 1D5VA 2H8WA 3GF2A 2YS9A 4ZTJA 4ZZLA 3CC4I 1FBQA 3SJMA 2M30A 1XDSA 3BR0A 3PUBA 1BL0A 1FMWA 1I1GA 1SVOA 2HYJA 2FU4A 4N9HA 3D0SA 3PL8A 2MBFA 4LK1F 3TQNA 4LFUA 4JX4A 4HSRA 1R4NB 4BDYA 3MFKA 1J2XA 1R36A 2LY9A 5DCFA 2VB6A 3KYLA 3QPHA 1WJEA 3C3WA 3M1EA 5FFZA 4FQGA 4LG3A 2DA7A 4I0BA 1SAUA 2KIMA 3HEFA 1TZLA 3BTIA 4D7MA 4ZYDA 3LA7A 3CCQI 1M1EB 3VYTB 3KEYA 4P9UA 1R58A 2LY1A 3L9FA 3HG9A 4HLXA 2OC6A 2ME6A 3O3KA 3PQJA 4FX4A 4IRHA 2HQ5A 1VZ0A 1VQ4I 4HF0A 1TLHB 5E8GA 2ZFUA 2PG4A 5L3CA 3BZKA 1A5JA 3E7LA 3R6SA 1XMAA 1C0WA 3NWTA 4BJ6C 2XB5A 2E60A 4F3QA 3PJRA 4I01A 1MBKA 4OMZA 3HOWJ 3S17J 3BC8A 2BV6A 1OCRH 1ZG5A 5JVTA 4XKWA 5H20A 2EV0A 2FBHA 3PNTA 5J8CA 2O61A 1ZLJA 3K70C 3CCYA 1IGNA 1ZELA 2PN6A 2QEXI 2QA4I 4KA4A 1NH3A 4HSTA 2JA6J 2L9RA 1PUFB 1VTNC 2K5CA 3H5NA 4IJAA 2G0EA 2GWRA 2J5OA 3BG9A 9ANTA 3TW6A 3M4OJ 2XDVA 4KDPA 3W6KB 5B1AH 3HM5A 4Q4ZF 3L2VA 4OMYA 1PJRA 2JSPA 1XGNA 1YYVA 3ZMVA 2R92J 4HNVA 3E6BA 1K61A 4A2UA 1MGTA 2JRTA 2ELKA 4A3LJ 2HQAA 3MVPA 5HOOA 3ZMZA 2J5PA 3CLQA 2KKOA 4NNJA 1T33A 3V8JA 3LSHA 2BGCA 3HTSB 4RLQA 5F08A 1ZGAA 1GVDA 1J7KA 2XB0X 4OAYA 3HJEA 2ZJ2A 3K10A 3FDYA 1XMXA 2NS7A 2XGEA 4E70A 1U8RA 2BY3A 3DPLC 1APLC 3HHGA 3K4CA 4XOPA 5BPIA 2M4GA 4G7ZF 1P7IA 1WRJA 4UVAA 3BTCA 2NVYJ 2DOAA 1IRFA 2H1KA 4LJZF 3SFZA 3H35A 4Y7NJ 1U8BA 1QVTA 4BAYA 3I56I 2C6YA 2IEKA 3F8MA 4NB5A 1ODDA 2M8GX 3JTHA 2FOKA 2ZXIA 1DU0A 2Q2EA 3VSKA 3KPHA 4L5EA 4BBSJ 2JVHA 2FNPA 3LSKA 3CCEI 2MFZA 5GP9A 1HF0A 4F52A 4PJJA 1X3ZB 4XRMA 4JX5A 4E7HA 4YIRX 3K4NA 2P5LC 3E5UA 1BI1A 2TCTA 3BROA 3FZVA 3WTXC 3ZQLA 3EUHA 2GZWA 3RQIA 1SFUA 5ILUA 2WAFA 2HDWA 3G1MA 5EYRA 5FGMA 3E3VA 3K7AJ 4O6JA 1G3TA 3M07A 4PSWA 5KNLA 4QPOA 5CJ9A 3PIOF 1RR8C 3OL3A 3ZCOA 4Y13A 2DFEA 2JPCA 5DUKA 4F7ZA 2E19A 1OYYA 4BY1J 4RGRA 1IXSB 2LVSA 1WJFA 4GYGA 2LREA 2CV0A 4L0YB 3A01A 3HRMA 4DYRA 4BS9A 2OBPA 1F5TA 4YIFA 3BQYA 2KDOA 3EUKL 3FKIJ 2LRDA 4YRVA 4ZTFA 1IV8A 3AG1H 4P9FA 1ETXA 1S7EA 2NNYA 3TW7A 1TWHJ 5LRRA 3SZPA 4P55A 2F4OB 1BA5A 5D5WB 2P6SA 3Q5FA 1UHMA 3UNGC 1H9GA 4UUTA 1V5GA 1KQ9A 1X1DA 2LH9A 2LDUA 4GXOA 1WGXA 4A93J 4G12A 3FM3A 3I9V2 2E7XA 1CF7A 5LFAA 4BXXJ 3HGYA 4XORA 3T0YA 4DBQA 2CFOA 2WAQN 3M3YJ 2ADUA 3CUQB 1I50J 4L5IA 1TW3A 3OY9A 2BHYA 2A68F 2YUSA 4ENMA 4BHBA 3QYEA 4P5OA 1YW8A 2LFBA 1ZKGA 2FQ4A 2XPUA 1GLNA 4LGWA 1R1VA 3LMMA 1O3QA 3IUOA 3G73A 2MSYA 3GTJJ 4JX6A 2LMDA 2RNGA 4BH9A 2QSFX 2IGOA 1Y0NA 1YLFA 3W6VA 2H09A 2RNJA 1MBJA 1HC8A 2EA2A 3CCJI 5IYDJ 2OQGA 1BIAA 1OCZH 3DU5A 3OOUA 1IV6A 3KP4A 4MO7A 3ZMDA 2I5UA 4HQMA 4LB6B 2NYXA 3HOYJ 1O7LA 4NUBA 3LSPA 3QWLA 1BR4A 2BY1A 5J1YA 1K4SA 2GXGA 4HOBA 2ME0A 3FK7A 2Y0SA 4KUMA 1VQPI 3RQ4A 1VF9A 1BM9A 3GWZA 4M73A 2WTEA 2R0QC 2EFWA 1XCBA 2XHKA 4LMYA 3WE3A 3F6VA 3VYRB 2CV1A 3VSLA 3UR3C 2DMNA 3CLOA 4M3FA 3TP0A 3ABTA 1SVLA 1X1CA 3LL7A 5GAGJ 4B3XA 4EEFG 4A3JJ 3WGIA 2XUBA 2HVRA 3DXJF 3KETA 2FOWA 3DKYA 5E1ZB 3OYAA 3M8FA 4A3GJ 2VOPA 3ZMTA 3AG4H 1Z3XA 2E5NA 4E4HA 4DBRA 3ESWB 1V5EA 3P7NA 1OQYA 2ZCWA 3Q3SA 4KITB 4XKCA 5L3DA 1JGSA 1PVEA 3OIPA 4ZYGA 2YX4A 3RJPA 1WH5A 5FO5A 1LFBA 4XRSG 2KHMA 4KYWA 4LB5A 2HU9A 3F9KA 4B43A 1ZRFA 4UY8I 2K9QA 4C2MJ 4IHVA 3WHBA 4B8XA 2L9SA 2ZJRF 3PSFA 4Z6YA 4FE7A 1T2KA 2XRNA 4WXDA 1QVUA 3H3UA 3QPSA 3E1SA 1VQ5I 1Y1VJ 1XSDA 1NTCA 5ED4A 1H0MA 1JXSA 2X6XA 2FBKA 2ZMEC 1ZRDA 2O03A 3E0JB 2O8XA 3CDIA 4BYYA 2LTPA 2YR2A
chains in the Genus database with same CATH topology
3CC4I 5DM7F 1VQKI 1QA6A 1FOWA 2JQ7A 1ACIA 3DLLF 3CCRI 3CD6I 2ZJPF 3CF5F 1HC8A 1S72I 4IOAF 3CCJI 1YJ9I 2OTLI 1FOXA 3I56I 3CCMI 3CCQI 3CCUI 1VQOI 3J7ZI 1FOYA 3CCEI 2ZJQF 1YJNI 1Y39A 1VQPI 1VQ7I 3CMEI 1YJWI 1VQ4I 5GAEJ 1VQMI 1YI2I 5GAHJ 4IO9F 2OTJI 3CC7I 3G4SI 1VQLI 3CJTB 2E35A 5GAGJ 3PIOF 2FOWA 3CCVI 4IOCF 2QEXI 2QA4I 3J7YJ 1VQNI 3CCLI 3CCSI 4UY8I 2NXNB 1VQ8I 2ZJRF 4V19K 2K3FA 5DM6F 1YITI 1VQ5I 5GADJ 1VQ9I 5JVGF 3PIPF 2E36A 1YIJI 3G6EI 1VQ6I 1MMSA 3CMAI 3G71I 3I55I 1YHQI 3CC2I 2E34A 2H8WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC4 I;  5DM7 F;  1VQK I;  1QA6 A;  1FOW A;  2JQ7 A;  1ACI A;  3DLL F;  3CCR I;  3CD6 I;  2ZJP F;  3CF5 F;  1HC8 A;  1S72 I;  4IOA F;  3CCJ I;  1YJ9 I;  2OTL I;  1FOX A;  3I56 I;  3CCM I;  3CCQ I;  3CCU I;  1VQO I;  3J7Z I;  1FOY A;  3CCE I;  2ZJQ F;  1YJN I;  1Y39 A;  1VQP I;  1VQ7 I;  3CME I;  1YJW I;  1VQ4 I;  5GAE J;  1VQM I;  1YI2 I;  5GAH J;  4IO9 F;  2OTJ I;  3CC7 I;  3G4S I;  1VQL I;  3CJT B;  2E35 A;  5GAG J;  3PIO F;  2FOW A;  3CCV I;  4IOC F;  2QEX I;  2QA4 I;  3J7Y J;  1VQN I;  3CCL I;  3CCS I;  4UY8 I;  2NXN B;  1VQ8 I;  2ZJR F;  4V19 K;  2K3F A;  5DM6 F;  1YIT I;  1VQ5 I;  5GAD J;  1VQ9 I;  5JVG F;  3PIP F;  2E36 A;  1YIJ I;  3G6E I;  1VQ6 I;  1MMS A;  3CMA I;  3G71 I;  3I55 I;  1YHQ I;  3CC2 I;  2E34 A;  2H8W A; 
#chains in the Genus database with same CATH topology
 5TGT A;  1SD7 A;  3AKZ A;  3EQL F;  3J81 Z;  1LEB A;  3HOZ J;  2CQQ A;  5M3F J;  3QYF A;  4XIC A;  4H4K C;  3AG3 H;  2L9V A;  1Y8R B;  1R00 A;  3DLL F;  3S93 A;  4UUV A;  2R7O A;  4W1U A;  3CD6 I;  2VLA A;  5LBQ A;  3H3V K;  3JRC A;  1NK3 P;  4KJZ A;  1ULY A;  4MEX F;  1XGM A;  2EFQ A;  2XF5 A;  3CF5 F;  3J80 Z;  1K4T A;  5KVR A;  1N25 A;  2KIS A;  3FXK A;  4YII A;  5EF6 A;  3FHZ A;  1OR7 C;  1T95 A;  3EUA A;  3JRG A;  1N78 A;  4FHT A;  4K2E A;  4A3M J;  3GTQ J;  1X1P A;  2ZNZ A;  3MKW B;  4R79 A;  3D1N I;  4OIN F;  1S6L A;  2X0L A;  4A3C J;  3CDL A;  3I53 A;  3HOS A;  3OYB A;  1LFU P;  5KAI C;  4NC6 A;  3R61 A;  1FYM A;  3D5R C;  3CZ6 A;  3K1M A;  4DGW B;  4DQ2 A;  4RB3 C;  1VQ7 I;  3CME I;  4M9Z A;  3GFM A;  1X1A A;  3KIO A;  3WU1 B;  2XPW A;  2ZSI B;  1MMG A;  3GTG J;  2L0K A;  2CUJ A;  4AVP A;  3FMR A;  5BMZ A;  4PJN A;  2COM A;  4OU0 A;  2L3D A;  2CQ7 A;  2K9M A;  1TT0 A;  2QLZ A;  4XQF A;  1WJD A;  3AG2 H;  1POG A;  3U1D A;  3CMM A;  4G9Y A;  4UB8 C;  3RYR A;  2V4J C;  3ASN H;  3GW2 A;  2M87 A;  1BIB A;  1T08 B;  4BU2 A;  1KU2 A;  4WX9 A;  2K4B A;  3MKZ A;  2M7A A;  3IL2 A;  2E7W A;  3AFH A;  5IP9 J;  4KIF A;  3OYC A;  3E5Q A;  2LSO A;  3S3M A;  4PDK A;  5CKT A;  4HYE A;  2E1N A;  2PQ8 A;  5DD8 A;  4B47 A;  4TV7 A;  2DA2 A;  2VBY A;  5IYC J;  2HQR A;  4XLC A;  4A3B J;  1WSU A;  4XM3 A;  3CJN A;  4AUX A;  1JUP A;  4XKV A;  4A6E A;  2Y75 A;  3WTZ A;  4RAY A;  1LE8 A;  1LDD A;  3GZN B;  1G2H A;  2W00 A;  4N4N B;  4HV6 A;  2RVC A;  3DV8 A;  5JFR A;  4IKF A;  1I3Q J;  3C2G A;  2ELH A;  1WJA A;  2R7S A;  2MH9 A;  2AO9 A;  1X1B A;  3I64 A;  2GIZ A;  1A6Q A;  5EGO B;  2DA1 A;  2LD5 A;  1HDD C;  5D8L B;  1D1B A;  3WG9 A;  1OIS A;  2EZH A;  2I10 A;  3K6G A;  4L9V A;  4ENJ A;  1FMV A;  3TGN A;  4F93 B;  4CGZ A;  3HSE A;  1V55 H;  1OPC A;  1A31 A;  2W4S A;  1TC3 C;  3BR3 A;  3IWZ A;  2JZY A;  3GTM J;  5H2F C;  2OUM A;  4XLA A;  5F0F A;  3S1Q J;  2RC4 A;  5K5O A;  1L0O C;  2LNB A;  4CO8 A;  4YFK F;  5E20 A;  2RAE A;  3LWF A;  3IH3 A;  4M74 A;  2HDC A;  5M3M J;  3OYL A;  3L1P A;  3SZG A;  1FBU A;  2FF4 A;  4DYQ A;  2QSG X;  3SZT A;  3NEU A;  1XB4 A;  1WH7 A;  2FX0 A;  5B66 C;  1O57 A;  3TKY A;  3JRH A;  5BQT A;  1Y6I A;  2MAB A;  1B9M A;  4A69 C;  1HOM A;  3KP3 A;  2OD5 A;  2BOL A;  3DFG A;  5FB2 A;  1UG2 A;  1XSV A;  5ERI A;  2AXT C;  1W5S A;  4MLO A;  3CCM I;  1RUO A;  2XGD A;  3CCU I;  2VQG A;  1JJ8 C;  4RS8 A;  4FAS D;  4RDU A;  1FYK A;  1FNN A;  2OZU A;  2KZG A;  1WJB A;  4M71 A;  2ELJ A;  5F64 A;  1X3W B;  3RIR A;  1YW9 A;  3E6M A;  2XAU A;  1WI3 A;  1ZK8 A;  2VIX A;  3CQZ J;  5FLX Z;  4XLP F;  3RKQ A;  3IV5 A;  2GA2 A;  4BL0 B;  2OTJ I;  1FSE A;  2Q1Z B;  2ZXJ A;  4Y4R A;  5IT3 A;  5AIP A;  1DGR M;  4LLL A;  3BT9 A;  2Z33 A;  5LHG A;  4A5N A;  3JRE A;  2AS5 F;  3G1L A;  3KFW X;  3OS0 A;  1AKH B;  3HRU A;  4M6X A;  2JJ7 A;  4V2G A;  1R49 A;  3ZQG A;  4CCL A;  4M9X A;  2V1X A;  5L3E A;  1JI8 A;  2M0C A;  1HSJ A;  3ABU A;  3IAS 2;  2HDD A;  2F5V A;  4EM1 A;  5FD6 A;  3BG7 A;  3WU0 A;  3BZ6 A;  1MJA A;  4BE1 A;  3J7Y J;  1RNL A;  1K6Y A;  1PYV A;  2MD5 A;  2CH0 A;  2KL4 A;  2DXI A;  2BHZ A;  2Z3Y A;  1UEL B;  1Z0X A;  2P5K A;  4DIQ A;  3HYI A;  3RTR A;  2CUZ A;  2CS3 A;  2HOT A;  1FTT A;  1FY7 A;  3FXQ A;  1ETO A;  4V19 K;  2IPQ X;  2FEZ A;  2NVX J;  4G94 A;  3DEU A;  1SEU A;  2IS6 A;  3CUQ A;  4GRI A;  1S3J A;  5M5W J;  3BDD A;  2HXO A;  2LC2 A;  3K70 D;  2HGC A;  2HOA A;  2XRL A;  5F27 A;  2IA1 A;  3QAH A;  1JHH A;  2E36 A;  2F5C A;  2VN2 A;  1YIJ I;  1N77 A;  1JE8 A;  3B6C A;  5J8F A;  3T8T A;  1K78 B;  4N9I A;  3PQK A;  1ZGJ A;  3ML6 A;  1U5T C;  3M8J A;  3CC2 I;  2WA0 A;  1A35 A;  2O3F A;  5L3B A;  4BGD A;  2OA4 A;  5ILS A;  5FFX A;  2OQR A;  5J1U A;  4B09 A;  5K7Z A;  4FIS A;  3L2C A;  1LJ9 A;  4CDG A;  4PGH A;  3P9I A;  2FA5 A;  3K4L A;  3VFZ A;  3BJA A;  4HPQ A;  3I0T A;  1ZRC A;  1O3R A;  3GZ5 A;  5K7H A;  1MBF A;  4LLG F;  4G6T B;  1HW5 A;  2X6Y A;  4UV8 A;  4ZYA A;  1KU9 A;  4J01 A;  2RGV A;  4FX0 A;  4PJL A;  3TO7 A;  5LHI A;  4PZJ A;  3D5L A;  2ZME B;  2AQE A;  4IHX A;  3M9A A;  3IRQ A;  5EJC A;  4X1E A;  1QPM A;  1E0E A;  1VQO I;  2X4H A;  4I0A A;  1VFC A;  3KYD B;  1BI2 A;  3LSG A;  4DOZ A;  2ICW G;  1HW2 A;  2O8K A;  3MZ8 A;  4MEY F;  2ZJQ F;  2ZKZ A;  1A6I A;  3N97 A;  3CP8 A;  1YW7 A;  2YX7 A;  5CVJ A;  1FJL A;  4UUS A;  3OYK A;  2W24 A;  2WAQ A;  3I4P A;  2JA5 J;  3HPH A;  3PM1 A;  2X1E A;  3OYJ A;  2K40 A;  2QEN A;  2HZT A;  1VQL I;  3CJT B;  1X3U A;  2HR3 A;  2XAJ A;  4B44 A;  1H88 C;  3BCA A;  4XRF A;  4AYB N;  3U9G A;  3HOX J;  2H27 A;  1I3A A;  4XLH A;  2L5Q A;  1ON2 A;  3H5R A;  3NQO A;  1BC7 C;  2FXA A;  2HI3 A;  3ECO A;  2BW3 B;  2R7X A;  1OLT A;  2MD0 A;  3GLX A;  2KMU A;  3SQN A;  4R8H A;  4IOC F;  3ABK H;  1S8N A;  1RET A;  3MZH A;  4YFX F;  1V3F A;  4CZZ A;  4E7Z A;  3NAR A;  1X4P A;  2VE9 A;  1RKT A;  3CCL I;  4HQE A;  2LKX A;  1Q1H A;  2DA3 A;  3HKZ N;  1K79 A;  1SMY F;  2CSO A;  2NXN B;  1MJB A;  4NC8 A;  5EEG A;  1Z91 A;  1ZN2 A;  1D8J A;  3SDB A;  1DPR A;  2DJI A;  2EFP A;  2KIQ A;  2VJ4 A;  4ZJZ A;  2GLO A;  3DP7 A;  2VQH A;  5JLW A;  5E8I A;  2Z1D A;  4EJU A;  3QOP A;  3TOB A;  3JTG A;  2HKX A;  3R60 A;  2NS8 A;  5E3N A;  3IKT A;  2JT1 A;  3SFI A;  2X48 A;  2DK5 A;  2WV0 A;  4BAC A;  3BR5 A;  5IYB J;  2R5Z B;  4RGU A;  1JUM A;  2VKH A;  4B4C A;  2CMP A;  5F04 A;  4XK4 A;  3JAM Z;  2L02 A;  3KLO A;  4IQ4 A;  1UZC A;  2Y0M A;  1YO5 C;  1F9N A;  1SFX A;  3KP2 A;  4PSX A;  4GCV A;  2BXY A;  4NBQ A;  2M5W A;  3LSR A;  2VJI A;  1HA8 A;  5HOD A;  4A3F J;  2R5Y A;  3GTO J;  5CVI A;  4ESF A;  1RZ4 A;  2PMZ N;  1S7A A;  4HAM A;  1YJ9 I;  1B72 A;  2CUE A;  2KLO A;  4Y33 A;  1YE9 A;  1LFP A;  1Y0U A;  2V9V A;  2K27 A;  3K2Z A;  1O4X A;  2EIK H;  3ELK A;  3WG7 H;  1PP8 F;  1P2F A;  3PNV A;  4U88 A;  2EFN A;  1MJ9 A;  3ZQH A;  1WJ5 A;  2X6O A;  4R1H A;  4GO1 A;  4XRS A;  3RZO J;  1IN6 A;  4HEA 2;  2R7Z J;  3F3X A;  1W0T A;  2EWN A;  2WB1 N;  3DBR B;  5M5Y J;  4IXA A;  2E5Z A;  1W36 C;  1FLI A;  3EPZ A;  3L7W A;  1J9I A;  2DMP A;  1UG0 A;  3L2U A;  1IJW C;  1HXD A;  1ZH5 A;  3ROU A;  5D6F A;  3LST A;  3F22 A;  4IZZ A;  2W48 A;  3TP3 A;  3IH4 A;  3Q9S A;  2PJR B;  3F8F A;  2BY2 A;  3VWB A;  4XSX F;  1USS A;  2RRE A;  4CIC A;  1GXP A;  3H5A A;  3KX2 A;  1GXQ A;  2W1O A;  5J1R A;  4HNT A;  1O3S A;  3BJ6 A;  2LBF B;  1TWC J;  2IP2 A;  3CUO A;  4I98 B;  3A0H C;  4RM3 A;  4H0E A;  1JKO C;  3RKW A;  2YU9 J;  2A6H F;  5FKL A;  5C4J J;  1DQU A;  3BP8 A;  2GXA A;  3FK6 A;  4EMS A;  4PFP A;  2KJC A;  2XSJ C;  2BEO A;  3K0L A;  1N75 A;  3DCF A;  1LKX A;  1MMA A;  4AID A;  4IHY A;  5FLV A;  1XS9 A;  2R7U A;  3ISP A;  4II2 A;  3VEP A;  3HRT A;  5D5X B;  2LOO A;  3TOA A;  1WFX A;  1BR1 A;  1XMK A;  3I3L A;  4I02 A;  4CYC B;  4BQO A;  2CW0 F;  2M1B A;  5IT9 K;  4RAF A;  5LEJ A;  1MBE A;  4O5V A;  3RYP A;  3A0B C;  1A04 A;  3BJO A;  3BTL A;  5FKM A;  1YRN A;  5ILV A;  2HKO A;  2UXX A;  1PUE E;  4L5J A;  4ASN A;  5HLG A;  3AAF A;  1VQ9 I;  3S1R J;  1RKW A;  2JRM A;  3OV8 A;  3LOC A;  5HLH A;  1I39 A;  2O5R A;  1GUU A;  3KZI C;  3RPU D;  2DT7 B;  4BEH A;  4EVI A;  5LD2 C;  4OIP F;  2NVU B;  1A36 A;  3G71 I;  3HTU A;  2ISZ A;  2R7Q A;  3RSN A;  1LB2 A;  2H94 A;  3HHH A;  3F23 A;  3BG6 A;  2KP6 A;  5LRS A;  3DWL E;  2MYS A;  3JRA A;  4X0G A;  3OIO A;  3F21 A;  1TL8 A;  1LPQ A;  2R93 J;  2QQB A;  4LK0 F;  1R23 A;  2ZNY A;  1MSE C;  2LF7 A;  4A6D A;  1B1B A;  2VE8 A;  2JQ7 A;  4C2T A;  2VT2 A;  3HOV J;  4NC7 A;  2VXZ A;  1FT9 A;  2IGK A;  2NS0 A;  3S3N A;  4M3D A;  2OPT A;  2A5Y B;  1TQI A;  3TDZ C;  3TL4 X;  4MTE A;  4EM0 B;  5JLX A;  2FSW A;  3TDU C;  1YIO A;  3GLL A;  2Q0O A;  4NDL A;  1J5Y A;  2DQR A;  3HC7 A;  1U5T B;  1F1Z A;  2KJB A;  3I5U A;  1Q1V A;  2DYS H;  4BNC A;  3J7Z I;  1TQP A;  3SEZ A;  1P4X A;  4WCG A;  2LP0 A;  2XAS A;  3MKY B;  1KQ8 A;  4HDU A;  4QWQ A;  3BR2 A;  1Y39 A;  1FSH A;  1EH6 A;  4HX4 A;  1PDN C;  4XMY A;  1J09 A;  5IOY A;  2CW8 A;  1YJW I;  3RKX A;  3BPX A;  3FXO A;  1UMQ A;  4PFO A;  4XBF A;  1E3H A;  4NQW B;  1AKH A;  1JKQ C;  2NAZ A;  2QVO A;  2EIJ H;  2UXN A;  2VOO A;  2EV6 A;  3IWF A;  5DV5 A;  2DPU A;  1T6S A;  3I58 A;  3G4S I;  1D0Z A;  1SFK A;  4LG0 B;  5C4X J;  2A6T A;  4CH7 A;  2F5F A;  4MFE A;  2VT3 A;  3E5X A;  2KRF A;  4WK8 F;  4KIB A;  4EJO A;  3DU6 A;  2WWY A;  2JTV A;  3RPQ A;  2UUZ A;  2HTS A;  2NOG A;  2UV1 A;  4QSH A;  3FBI B;  3WOD F;  2HEO A;  5FD5 A;  3ZMS A;  3F8C A;  4A3D J;  4UHT A;  5CLS A;  4OIR F;  1ZG3 A;  1Z1D A;  4FCY A;  1IRZ A;  1Z21 A;  4G7O F;  4D5C A;  3ULQ B;  4N0B A;  5HLT A;  1P7J A;  2STW A;  3HSR A;  5HS7 A;  2DCE A;  1I6H J;  1G3W A;  4ZDO A;  1O3T A;  4OIO F;  2QKL B;  3LSI A;  2DO7 A;  1JT0 A;  1DDN A;  2GIV A;  3G2B A;  1UST A;  4BE2 A;  1WJC A;  3RI4 A;  1S29 A;  4RGX A;  1SC7 A;  3H0G J;  2Z16 A;  4QTR A;  2CV2 A;  4CCK A;  5H6R A;  1X58 A;  3WTT C;  3DKX A;  5JI6 A;  2NNN A;  2RN7 A;  2D5V A;  2BVL A;  3ZQC A;  2DQL A;  2L7F P;  1H9T A;  3Q9V A;  5E3M A;  2IBD A;  2E71 A;  1U9N A;  4BXF A;  4D1Q A;  4F91 B;  2Z99 A;  1QHH D;  1EV7 A;  1T0F A;  2GA1 A;  2XGC A;  2DDA A;  1U3E M;  3LFK A;  3OL4 A;  3OYI A;  1I27 A;  3HSF A;  1TP4 A;  4M6V A;  1HCR A;  4ANJ A;  4M3G A;  5E79 C;  2CO5 A;  1LDJ A;  1K6O A;  3KEQ A;  1IXC A;  3EYI A;  1WKM A;  5LGN A;  2CQX A;  2L7Z A;  4I76 A;  1FP1 D;  5CVV A;  5DS9 A;  4EJT A;  4ABZ A;  2JVG A;  3G3Z A;  3TMO A;  4BJ5 C;  3S15 J;  1ZQ3 P;  4I6Z A;  5IP7 J;  2M34 A;  3REO A;  3GCM A;  3GUD A;  4HX8 A;  4DYC A;  3M7G A;  2FE3 A;  4AIJ A;  2GBY A;  2O6G E;  3L2R A;  2BYV E;  4IHW A;  1OMI A;  1ZAO A;  2OCC H;  3GX4 X;  2D1H A;  2R7T A;  3X2Q H;  3ZXS A;  3HGG A;  4XR6 A;  3GTP J;  5ICF A;  2JA7 J;  3OOP A;  4Q5S F;  4BHP A;  2N8G A;  1YJN I;  1EF4 A;  2BXZ A;  2E2J J;  3MAJ A;  5GAE J;  1H8A C;  3HIF A;  5IP6 A;  2LY2 A;  4U7D A;  1U2W A;  2Z2S B;  5TRD A;  4G8X A;  4KMU X;  5GAH J;  1YS7 A;  3QPL A;  1IN5 A;  4LOC A;  2EA4 A;  3VOE A;  5J4Y A;  1JKR C;  2IGM A;  2HVS A;  2JN6 A;  2UZK A;  1IRG A;  3BY6 A;  2OV7 A;  3FWE A;  4HX7 A;  4I2O A;  1UHS A;  2VBZ A;  1OYW A;  3MCZ A;  3M1C A;  4ZYE A;  3T5X A;  2JMW A;  2VBX A;  4L0Z B;  1KU3 A;  2VAS A;  1JGG A;  4OWR B;  4KFC A;  2BZT A;  1ON1 A;  5E1W A;  1SVM A;  1ZGW A;  2Z9O A;  2QYO A;  4PCQ A;  2WC2 A;  5A2Q K;  4PGG A;  5EG0 B;  1MBH A;  1Z67 A;  3TBI A;  2EJR A;  1VI0 A;  4XOT A;  4A12 A;  2DU9 A;  3LSJ A;  4JP0 A;  1HKT A;  4MQ9 F;  2L01 A;  2BY0 A;  3H9G A;  4HDV A;  4ZDP A;  4PJ0 C;  2IVM A;  2W85 A;  4FET A;  4HG2 A;  2ESH A;  1XDU A;  4IHS A;  1FZP B;  1PUF A;  3P9C A;  2R5Z A;  2DMT A;  3HBL A;  1E17 A;  2Y2Z A;  2F5D A;  2MLK A;  1BJZ A;  3WTW C;  3GFJ A;  3CMA I;  2MGQ A;  1HBX G;  2JA2 A;  4D0P A;  4FE4 A;  4AYB A;  3I55 I;  3KZY A;  1ETY A;  1YHQ I;  3I4N J;  1Z6R A;  4BUP A;  2X51 A;  4RM2 A;  2QQ8 A;  3PO3 J;  4MFD A;  5KCM A;  3W6J B;  2LK2 A;  5GTI C;  3K2A A;  4M9S A;  1W0U A;  1FWZ A;  1MNM C;  3OIQ A;  3U2R A;  1KYW A;  4U0V A;  3SDG A;  3ZQ7 A;  2YPR A;  1B4A A;  2JSC A;  1MND A;  3L00 A;  4F55 A;  2ZB9 A;  1W7P B;  2LLK A;  2MC4 A;  4UNO A;  2Q2E B;  5EEA A;  3HKZ A;  2V6E A;  2OTL I;  2F4I A;  2QUF A;  3SYT A;  3QOE A;  2E2I J;  4XN3 A;  1IW7 F;  1X4O A;  2VQC A;  4KT5 C;  1MW7 A;  2K4J A;  4WWC A;  1FTZ A;  3WGH A;  1IF1 A;  4Y52 J;  3O8H A;  3ZR8 X;  1STZ A;  2DFF A;  3LFU A;  3OYG A;  3ZMU A;  2E1M C;  2ISY A;  3H1C A;  3WU2 C;  3QP6 A;  2PJR A;  1P4A A;  5ICG A;  1QPI A;  2FD5 A;  3S2D J;  1ORK A;  4EV0 A;  2XF7 A;  1VQM I;  2FRH A;  3JRB A;  2DMU A;  3ASO H;  6PAX A;  2WBM A;  2IAI A;  4U87 A;  5B1B H;  1XN7 A;  2P8T A;  1JUS A;  2LBF A;  2KRC A;  2O7O A;  1BJA A;  2V1U A;  1YQA A;  3QP5 A;  1SFE A;  5FRO A;  3FXL A;  1IZ1 A;  3A01 B;  1ZYR F;  1Z77 A;  3JRD A;  2W7N A;  2IT0 A;  4E7S A;  3V8L A;  3QYB A;  1KU7 A;  2WY7 Q;  2GAU A;  2V9K A;  3HXL A;  4GFB A;  2IRF G;  2STT A;  3JW4 A;  3KEO A;  2Y48 A;  1XX5 A;  3FIW A;  5LHH A;  3WTU C;  2FUG 2;  1AOY A;  4CYC A;  1RES A;  4HF1 A;  2PMZ A;  3LQQ A;  2LKP A;  3F0C A;  2ESN A;  2HPI A;  3ZP5 A;  4ESJ A;  3OYE A;  1FP2 A;  1VQN I;  1BR2 A;  3K1N A;  3CCS I;  2JA8 J;  3K69 A;  3GME A;  3JRI A;  2VKV A;  4WXH A;  2EZL A;  3CP2 A;  5TIS C;  2VBW A;  4MNU A;  3ZQI A;  2WB1 A;  1DU6 A;  2R3S A;  2QKM B;  3B73 A;  5JHF A;  1TTY A;  2EQR A;  5JVG F;  5KHD A;  5GPC A;  3OS1 A;  1R22 A;  1RI7 A;  2PX9 A;  2QZ8 A;  3ZQQ A;  3PIP F;  1YOV B;  1UHW A;  2V1D A;  4OAZ A;  1VQ6 I;  1OCT C;  2HZD A;  4PUS A;  5D5V B;  3WGG A;  4L9T A;  1QRY A;  3DPU A;  1IAW A;  2AQF A;  2LR8 A;  2E1C A;  2I8D A;  4AC0 A;  4GGG A;  2QQ9 A;  3BLY A;  3R0J A;  3I4M J;  2Y30 A;  3S1N J;  1TNT A;  2X1C A;  4JYK A;  5J40 A;  4C30 A;  2CUF A;  4KMF A;  3HOU J;  3FIS A;  4XLF A;  3R4K A;  3H9J A;  2E2H J;  3CCR I;  3IRR A;  3PUF A;  5GPA A;  2ZJP F;  4W97 A;  2Q8K A;  1LNW A;  1BOA A;  4D5F A;  2PLY A;  4P1W A;  2QWW A;  3OMY A;  1FC3 A;  4CCM A;  3O8G A;  5D4R A;  3HL2 A;  3BR6 A;  4YEJ A;  2O0Y A;  1HLV A;  2IS2 A;  1UJ8 A;  2ZBK A;  2EPF A;  3RZD J;  2W84 A;  4M6Y A;  3ZQF A;  1T39 A;  1G3S A;  2VJJ A;  4AVZ A;  1RRJ A;  1REP C;  2L7K A;  1S5L C;  2A05 A;  1BC8 C;  3JCU C;  4F92 B;  3CJR B;  4LG0 A;  1RR7 A;  3FXU A;  2HS5 A;  1R5H A;  3KP6 A;  2PMU A;  4XNF A;  1Z7L A;  4IO9 F;  3ECH A;  4M3B A;  3ZOB A;  1BI0 A;  1OYI A;  3Q0W A;  4C3I J;  5ICE A;  5F1J A;  2OJE D;  2R7W A;  2FQ3 A;  3W2A A;  3JSO A;  2EZK A;  3M8E A;  1QO0 D;  1R4M B;  4ETS A;  5DD4 A;  2QQA A;  3F72 A;  1K83 J;  2MW8 A;  1P6R A;  3FXM A;  4L18 B;  2EIM H;  4QIW N;  3LAP A;  1W36 D;  2DOE A;  5BNG A;  1P92 A;  2ZO4 A;  3H0D A;  3FKJ A;  1EA3 A;  3HOT A;  2BBY A;  1SAN A;  2P4W A;  3KP7 A;  2L4M A;  3DQV C;  3LA3 A;  4KIS A;  2FMY A;  3JAM K;  4O3M A;  2KRH A;  3LQR A;  1HST A;  3SHF A;  1JJ6 C;  1ZR4 A;  1R5G A;  4BJT A;  4N4O B;  2DA6 A;  1RUN A;  2DA4 A;  1VQ8 I;  1B8I B;  1G3Y A;  4B48 A;  3OYN A;  2ZC2 A;  2V6C A;  1XD7 A;  4XON A;  2CJJ A;  2IGN A;  1FEX A;  1TWG J;  2NVQ J;  2EH3 A;  5K7F A;  5D6E A;  2D45 A;  4UVB A;  3VOD A;  1NG7 A;  3BZC A;  3OSF A;  2A6E F;  3FXR A;  3MQ0 A;  1H89 C;  2YSR A;  3EYY A;  4EJV A;  4E7L A;  2F5E A;  2MG4 A;  3HUG B;  4LLN A;  2ACJ A;  1MSF C;  3U21 A;  1KZH A;  1VQK I;  2GOX B;  2AHQ A;  4C3H J;  4ZH4 F;  3CMY A;  2MLG A;  1QZY A;  2ECB A;  3FM5 A;  4P96 A;  2KZV A;  5D4S A;  1OKR A;  1W7P D;  4BDZ A;  1SMT A;  2HOE A;  4XLE A;  5GTH C;  1MMN A;  5HS8 A;  2XAG A;  3ERM A;  4YEL A;  5F6F A;  2D2W A;  4V2F A;  2WY8 Q;  3MMY B;  3VYS B;  4BHC A;  2BE5 F;  3K1P A;  2P81 A;  3V7S A;  4EGY A;  3A1Y A;  4ENK A;  2H1L A;  3NAU A;  2Z5U A;  1GV5 A;  3G1O A;  2GM4 A;  5F0C A;  4AU7 A;  5HDK A;  2VJ5 A;  3P5J A;  1OFC X;  2VUM J;  1B6A A;  1GHC A;  2P0W A;  3K4M A;  1XC5 A;  5DUI A;  2EK5 A;  2B9S A;  1HW1 A;  4ESB A;  4WF2 A;  1LVA A;  5M5X J;  1LQ1 A;  1ENH A;  2AXL A;  2DT6 A;  4I99 C;  1IO2 A;  4HNU A;  2VQL A;  1U9O A;  4EAT A;  4I7H A;  3KLN A;  1IUY A;  4CCJ A;  4MTD A;  3PFI A;  3C7J A;  2MA3 A;  3CO6 C;  3F6O A;  4HLY A;  2EBI A;  1X19 A;  3H3Z A;  4A5M A;  3EET A;  3GEZ A;  5CVU A;  1HKQ A;  2HFH A;  1Z9C A;  5BS6 A;  5EG0 A;  2KFD A;  2G7U A;  5DDG A;  3OR2 C;  1IN8 A;  2HYG D;  2DFH A;  2JUG A;  5EZG A;  2IS4 A;  1I1S A;  1OJL A;  4RA2 A;  1S9H A;  2DYR H;  2E1M B;  5AIQ A;  1OCP A;  2F48 A;  1LE8 B;  4U0W A;  3F8B A;  5LGU A;  2CQN A;  3OSG A;  4A3I J;  3GTK J;  1O7F A;  1JHF A;  3CES A;  2DW4 A;  3KE2 A;  2BVM A;  2ECC A;  4RMN A;  3HRS A;  1ZTR A;  2KIU A;  4D9J A;  2XAF A;  4UV9 A;  5TJJ A;  1WHU A;  4CZC A;  4DZJ A;  2X9D A;  3IHU A;  1ETW A;  1WVR A;  3HB9 A;  5DCM B;  2A3S A;  1I6X A;  2R7V A;  2V9P A;  4A0Z A;  4IL6 C;  1Z3Y A;  2ID3 A;  2UWM A;  2VKD A;  2ZXH A;  4WXC A;  3V42 A;  3GXO A;  1B59 A;  4E7I A;  3GFL A;  3W2W A;  2VPR A;  4GDF A;  2XAQ A;  3S32 A;  3WE2 A;  2K9S A;  5FRM A;  3G6E I;  2RDP A;  2IS1 A;  1V5F A;  1K7A A;  2DBB A;  1P9Q C;  3T8R A;  1ZR2 A;  2DDB A;  4Z2Y A;  2VL8 A;  2IW5 A;  5EGO A;  2V79 A;  3J7A O;  3FF5 A;  3O6B B;  2OZ6 A;  1W7P A;  3BTJ A;  4CSW A;  3GO5 A;  3RDI A;  2EB7 A;  4XSZ F;  3W2V A;  2ZXW H;  4Y17 A;  5E1X A;  4CUG A;  3DKW A;  4C3J J;  2H8R A;  3GYH X;  5BOX A;  1U6G A;  2DN0 A;  3QU3 A;  2A5W A;  1G4D A;  2PEX A;  3ONQ A;  2R4G A;  3FHN A;  3KZZ A;  3FMQ A;  4IOA F;  2XF6 A;  3PSI A;  1MH3 A;  5AON A;  3I59 B;  1ITY A;  2CYY A;  1D0X A;  2DJN A;  1BOB A;  2P5V A;  3EUH C;  4IEJ A;  3Q0U A;  1W1W E;  2PMH A;  5K5R A;  2XPV A;  2XVC A;  1IDY A;  3I54 A;  5JR3 A;  3NWS A;  2D1V A;  1AA7 A;  3A2K A;  1FOY A;  2X85 A;  1AU7 A;  2DT5 A;  2QM3 A;  1R7J A;  2DLL A;  2RQQ A;  4EQQ A;  4RBO A;  1D0Y A;  5CVR A;  2F6C A;  2DA5 A;  5FKN A;  4XL9 A;  2HQN A;  2DPD A;  1GDT A;  2XSD C;  1FIA A;  2R7F A;  4M3E A;  2L54 A;  2PBI A;  3DF8 A;  4KIC A;  1W4M A;  1EH7 A;  3A02 A;  2E35 A;  3C2H A;  1QQI A;  1W5T A;  3FX3 A;  2L9N A;  1D8K A;  3BQZ A;  3CDH A;  5HS9 A;  4BE0 A;  5HNF A;  3NRV A;  2A69 F;  4RGS A;  1BW5 A;  3C2B A;  1EKE A;  2DOD A;  5LEK A;  3KCC A;  2VC0 A;  1BN5 A;  3TED A;  1TNS A;  4XN0 A;  2COB A;  3CF2 A;  1MDM B;  2M4K A;  2HNH A;  4CXF A;  3VB2 A;  3ABL H;  3GFI A;  2M3A A;  2DK8 A;  3H9Q A;  2OU2 A;  1SFO J;  2HPM A;  4A3E J;  2K85 A;  2LKS A;  2OAZ A;  4C2U A;  4ENN A;  2IA2 A;  2QBY B;  1R1U A;  2A07 F;  3AL0 B;  1YIT I;  2W25 A;  3RCO A;  4MQV A;  1E3O C;  1ZAR A;  1S7O A;  5KAF C;  4CCO A;  3OS2 A;  5J47 A;  5IT9 Z;  2XV4 S;  3BG3 A;  1FX7 A;  2DMQ A;  3HPG A;  4BY7 J;  3ERE D;  4LIT A;  1QZZ A;  1UFM A;  3S16 J;  2M8E A;  4E6K G;  3J81 K;  3B6A A;  4BXU A;  3CO7 C;  4U7B A;  3EDP A;  2ETH A;  3DTE A;  4RAG A;  1YTY A;  2W82 A;  1HKS A;  2F2E A;  1KYZ A;  2K9L A;  1R5I D;  2Y9Y A;  1XGO A;  4ZZD A;  1F36 A;  3E6D A;  1QU3 A;  2OF7 A;  4DJA A;  5DM7 F;  2G7H A;  2A61 A;  2NRA C;  1K78 A;  1XTA A;  2HVQ A;  4KNY A;  1YG2 A;  1JKP C;  3J80 K;  3RPU A;  2GOM A;  4DW6 A;  2R7R A;  4DNC A;  4J00 A;  1UAA A;  3K4J A;  2L2O A;  1XPX A;  4IHT A;  3DBH B;  3R0A A;  1Z05 A;  1S72 I;  4HV5 A;  5EZH A;  1GVJ A;  4KIG A;  4E7J A;  4YG2 F;  1QZE A;  1XGS A;  3P9K A;  3MKL A;  3W3C A;  1FOX A;  1XG1 A;  1KA8 A;  4S0H B;  3IAM 2;  2V26 A;  3ZN0 A;  2M9H A;  3H36 A;  4IRG A;  4XLN F;  3BOQ A;  3OYM A;  2KIF A;  2XAH A;  3WTY C;  2KDZ A;  4UUS B;  4EGZ A;  5C44 J;  1IN4 A;  1JTY A;  1DUX C;  2L4A A;  5IPA A;  2CWE A;  4IPA A;  4UB6 C;  5FKO A;  2ZME A;  3CTA A;  4KN7 X;  5JHU A;  4CHU A;  2DI3 A;  1MIJ A;  5CYV A;  1IDZ A;  5J6X A;  1ZG1 A;  3DPT A;  1TWF J;  3N4M A;  2B63 J;  1GT0 C;  3ZN1 A;  1YI2 I;  2QGU A;  1T38 A;  2WAE A;  4AWX B;  2JK3 A;  4HRI A;  3LA2 A;  1BBY A;  3U1K A;  2VC1 A;  2YU3 A;  1BW6 A;  2LYC A;  3Q0V A;  4UVC A;  1GV2 A;  4U0Y A;  4OIQ F;  2VON A;  2HYF A;  2V1N A;  2CFX A;  3OR1 C;  1WZ2 A;  3FBN B;  2IJL A;  3QOD A;  2RQP A;  4G6Q A;  4S04 A;  1EJ9 A;  3OWT A;  3A03 A;  4Y3O A;  5L3F A;  4JQF A;  1MKM A;  1T0F C;  1WPK A;  1R6R A;  1LVK A;  2XRO A;  3JRF A;  2EFO A;  3F8N A;  5D5U B;  2FJ1 A;  1R9T J;  1RIO H;  1J75 A;  2CQK A;  1OR7 A;  5KK1 A;  2DOF A;  1ETV A;  5B5E C;  2QF7 A;  4G7H F;  1I5Z A;  1R1T A;  1B8I A;  3DLA A;  1F43 A;  3ZPL A;  2BW3 A;  1RC9 A;  2EIN H;  5B3S H;  3QQA A;  4HBL A;  1HQC A;  3MZY A;  2NOJ B;  3I71 A;  4GYI A;  2MH2 A;  1G8X A;  2V7F A;  3IKV A;  1YX5 A;  2PFB A;  3MEX A;  2VKE A;  1LDK B;  1FBS A;  2P6T A;  2P7V B;  2QCO A;  2IA0 A;  2XKO A;  5CQE A;  3QU6 A;  3S8P A;  4A0Y A;  3GTL J;  3BCB A;  1D1C A;  1TQM A;  5LLQ A;  3WTV C;  1G6N A;  3HUG A;  4BQN A;  3LAJ A;  2OCE A;  2K02 A;  5J4V A;  4BBR J;  3OYH A;  1Y56 A;  1MH4 A;  1IRX A;  1G59 A;  2FNA A;  1KQ0 A;  2KT0 A;  4FT8 A;  2CW7 A;  4B3A A;  1D5Y A;  5F1R A;  2EV5 A;  2HXI A;  1R71 A;  1IG7 A;  1WCM J;  4HF2 A;  1W5C C;  2XKP A;  4HA8 A;  2CG4 A;  2FML A;  5E17 F;  2PJP A;  5IOZ A;  4RB1 A;  1KON A;  2LF8 A;  2R5Y B;  3QRF F;  2H6C A;  1CGP A;  1WQ2 A;  1FOW A;  2K86 A;  3LSM A;  4RB2 C;  5E3O A;  2QSH X;  4RLF A;  2B0L A;  1ACI A;  2VPL A;  1B72 B;  4D7N A;  3E6C C;  4AIK A;  4A0X A;  3IH2 A;  2NVT J;  1EH8 A;  3FXJ A;  1NG6 A;  3RKY A;  2M2E A;  5L3G A;  4HZF A;  5J3L A;  3WTS C;  4NHJ A;  2GQQ A;  2VI6 A;  4IF4 A;  1UB9 A;  4L9N A;  5D8K B;  3S2H J;  3CJQ B;  4OOI A;  1X2M A;  4A3K J;  3DTK A;  1UCR A;  2K9N A;  1BI3 A;  1TWA J;  3IP4 B;  2DTZ A;  4Q47 A;  4FTH A;  4Y15 A;  4EJW A;  2XGX A;  1P4W A;  2FBI A;  2X1D A;  5FLX K;  3T1B A;  2K3P A;  4XKB A;  3E97 A;  4RB0 A;  3HDD A;  2L7M P;  4MIM A;  5CQG A;  4L9J A;  1ERD A;  1J59 A;  3DTI A;  2M0M A;  3ABM H;  4LIV A;  2Y9Z A;  4KN4 X;  1ETK A;  4JK1 X;  5DTD A;  3PO2 J;  3S14 J;  3B02 A;  2Y69 H;  5DEQ A;  3CC7 I;  2JWT A;  1D1A A;  3WHC A;  3JSP A;  2XC7 A;  3QPT A;  3GZ6 A;  1WWX A;  1TT5 B;  2LG4 A;  5E3L A;  1MNE A;  1WI9 A;  1ZRE A;  3JR9 A;  4CA0 A;  3ZRG A;  3V7C A;  4BQA A;  1QHG A;  1DP3 A;  3COA C;  2ZFW A;  5K1Y A;  4ZC3 A;  1YFH A;  5DCM A;  1B9N A;  2ZSH B;  4B1R A;  2DFI A;  5K5Q A;  2Y31 A;  1YRN B;  2HWV A;  3TO9 A;  4UXN A;  5E18 F;  3O2P E;  1Y8Q B;  3C1D A;  2WV1 A;  5A2Q Z;  4CYD A;  3SEQ A;  1Z6T A;  5HDN A;  3GVA A;  2B7E A;  4BEH B;  2K3F A;  5BPD A;  1T98 A;  2CU7 A;  2H6B A;  4ON0 A;  1OCO H;  2X6W A;  4PJM A;  3BG5 A;  4I09 A;  2DAO A;  5GAD J;  3L2Q A;  1L3L A;  4HW0 A;  1IUF A;  4MHG A;  5EEH A;  1SAX A;  1QBJ A;  3K9T A;  3ZGK A;  2R7D A;  2Y0S N;  4IRI A;  3S1M J;  4DZP A;  2MC3 A;  3L2W A;  2HTJ A;  1MMS A;  1FPQ A;  4ZYH A;  4ITV A;  3S2W A;  4E7K A;  4ZDL A;  4X6A J;  3DEE A;  3MD2 A;  2VOD A;  2TRT A;  3C18 A;  2E34 A;  1V4R A;  4BKX A;  3KP5 A;  2GXB A;  3BPV A;  1CF7 B;  1MZB A;  1QA6 A;  1JT6 A;  1SD6 A;  4IQJ A;  3I59 A;  1QNT A;  3K4K A;  4MGR A;  5H6Q A;  4IX7 A;  1TW2 A;  1U78 A;  1D3Y A;  1HDP A;  1IC8 A;  4EM2 A;  5HNH A;  5F0H A;  2HOS A;  5DYM A;  1YX3 A;  1KGS A;  4S05 A;  1MD0 A;  1T8I A;  5LGT A;  2TDX A;  4AM3 A;  1Z7U A;  2JPB A;  3BR1 A;  1J0R A;  1ETQ A;  3BWG A;  4Q48 A;  1NK2 P;  1XSX A;  4M72 A;  1X2N A;  1TBX A;  3VDX A;  1PP7 U;  5HLI A;  4CCN A;  1JTX A;  1LEA A;  1RPW A;  4J19 A;  2M7B A;  1SD4 A;  3V4G A;  1FYL A;  3DEW A;  5FJ8 J;  2PI0 A;  4RAZ A;  1U5T A;  3OYD A;  1MBG A;  2CGP A;  1ONV A;  2E1O A;  2EZI A;  3SXY A;  3VPR A;  1Y1W J;  2P7C B;  5IY5 H;  2XIG A;  4YFN F;  1DPU A;  2K7L A;  4PK4 A;  1ZLK A;  1OCC H;  1V54 H;  3PFY A;  1E3P A;  1MDM A;  3IC7 A;  2WAD A;  4QPQ A;  2DTR A;  4LIU A;  4NQW A;  3OYF A;  2KPM A;  3CCV I;  1YS6 A;  5C3E J;  1XCV A;  4JBA A;  4LD5 A;  2VXD A;  1AWC A;  1LUJ B;  1ZHF A;  5HDG A;  2IXS A;  4KT6 A;  2KQR A;  4AD9 A;  4QLC U;  2QBY A;  1NHA A;  1T56 A;  2G9W A;  1F4K A;  3J7A Y;  2RKH A;  1QGP A;  2JUC A;  3CUQ C;  3L09 A;  3N05 A;  4C9Y A;  1E2X A;  1U0J A;  2M45 A;  2W57 A;  5HVQ C;  4G6D A;  4XID A;  5FRN A;  3MN2 A;  1AHD P;  5FLM J;  2RV8 A;  3AL0 C;  4IVN A;  1FIP A;  4JOM A;  2ID6 A;  4II3 A;  3GBG A;  5DM6 F;  3TO6 A;  3MWM A;  1IN7 A;  3A4C A;  2O9L A;  3PNY A;  3FMS A;  3D5S C;  4BQQ A;  3DBL B;  3VYU B;  1DGW Y;  3KYC B;  1SD5 A;  4AIH A;  3K4B A;  1VND A;  3LNQ A;  3V8K A;  3V7R A;  5CPR B;  3S3O A;  1DP7 P;  1MMD A;  2CRG A;  2F4M B;  3H92 A;  5EDN A;  2EIL H;  5FKK A;  3HZJ A;  3UKG A;  1IXR C;  1FOK A;  5ICC A;  1CQT A;  1D5V A;  2H8W A;  3GF2 A;  2YS9 A;  4ZTJ A;  4ZZL A;  3CC4 I;  1FBQ A;  3SJM A;  2M30 A;  1XDS A;  3BR0 A;  3PUB A;  1BL0 A;  1FMW A;  1I1G A;  1SVO A;  2HYJ A;  2FU4 A;  4N9H A;  3D0S A;  3PL8 A;  2MBF A;  4LK1 F;  3TQN A;  4LFU A;  4JX4 A;  4HSR A;  1R4N B;  4BDY A;  3MFK A;  1J2X A;  1R36 A;  2LY9 A;  5DCF A;  2VB6 A;  3KYL A;  3QPH A;  1WJE A;  3C3W A;  3M1E A;  5FFZ A;  4FQG A;  4LG3 A;  2DA7 A;  4I0B A;  1SAU A;  2KIM A;  3HEF A;  1TZL A;  3BTI A;  4D7M A;  4ZYD A;  3LA7 A;  3CCQ I;  1M1E B;  3VYT B;  3KEY A;  4P9U A;  1R58 A;  2LY1 A;  3L9F A;  3HG9 A;  4HLX A;  2OC6 A;  2ME6 A;  3O3K A;  3PQJ A;  4FX4 A;  4IRH A;  2HQ5 A;  1VZ0 A;  1VQ4 I;  4HF0 A;  1TLH B;  5E8G A;  2ZFU A;  2PG4 A;  5L3C A;  3BZK A;  1A5J A;  3E7L A;  3R6S A;  1XMA A;  1C0W A;  3NWT A;  4BJ6 C;  2XB5 A;  2E60 A;  4F3Q A;  3PJR A;  4I01 A;  1MBK A;  4OMZ A;  3HOW J;  3S17 J;  3BC8 A;  2BV6 A;  1OCR H;  1ZG5 A;  5JVT A;  4XKW A;  5H20 A;  2EV0 A;  2FBH A;  3PNT A;  5J8C A;  2O61 A;  1ZLJ A;  3K70 C;  3CCY A;  1IGN A;  1ZEL A;  2PN6 A;  2QEX I;  2QA4 I;  4KA4 A;  1NH3 A;  4HST A;  2JA6 J;  2L9R A;  1PUF B;  1VTN C;  2K5C A;  3H5N A;  4IJA A;  2G0E A;  2GWR A;  2J5O A;  3BG9 A;  9ANT A;  3TW6 A;  3M4O J;  2XDV A;  4KDP A;  3W6K B;  5B1A H;  3HM5 A;  4Q4Z F;  3L2V A;  4OMY A;  1PJR A;  2JSP A;  1XGN A;  1YYV A;  3ZMV A;  2R92 J;  4HNV A;  3E6B A;  1K61 A;  4A2U A;  1MGT A;  2JRT A;  2ELK A;  4A3L J;  2HQA A;  3MVP A;  5HOO A;  3ZMZ A;  2J5P A;  3CLQ A;  2KKO A;  4NNJ A;  1T33 A;  3V8J A;  3LSH A;  2BGC A;  3HTS B;  4RLQ A;  5F08 A;  1ZGA A;  1GVD A;  1J7K A;  2XB0 X;  4OAY A;  3HJE A;  2ZJ2 A;  3K10 A;  3FDY A;  1XMX A;  2NS7 A;  2XGE A;  4E70 A;  1U8R A;  2BY3 A;  3DPL C;  1APL C;  3HHG A;  3K4C A;  4XOP A;  5BPI A;  2M4G A;  4G7Z F;  1P7I A;  1WRJ A;  4UVA A;  3BTC A;  2NVY J;  2DOA A;  1IRF A;  2H1K A;  4LJZ F;  3SFZ A;  3H35 A;  4Y7N J;  1U8B A;  1QVT A;  4BAY A;  3I56 I;  2C6Y A;  2IEK A;  3F8M A;  4NB5 A;  1ODD A;  2M8G X;  3JTH A;  2FOK A;  2ZXI A;  1DU0 A;  2Q2E A;  3VSK A;  3KPH A;  4L5E A;  4BBS J;  2JVH A;  2FNP A;  3LSK A;  3CCE I;  2MFZ A;  5GP9 A;  1HF0 A;  4F52 A;  4PJJ A;  1X3Z B;  4XRM A;  4JX5 A;  4E7H A;  4YIR X;  3K4N A;  2P5L C;  3E5U A;  1BI1 A;  2TCT A;  3BRO A;  3FZV A;  3WTX C;  3ZQL A;  3EUH A;  2GZW A;  3RQI A;  1SFU A;  5ILU A;  2WAF A;  2HDW A;  3G1M A;  5EYR A;  5FGM A;  3E3V A;  3K7A J;  4O6J A;  1G3T A;  3M07 A;  4PSW A;  5KNL A;  4QPO A;  5CJ9 A;  3PIO F;  1RR8 C;  3OL3 A;  3ZCO A;  4Y13 A;  2DFE A;  2JPC A;  5DUK A;  4F7Z A;  2E19 A;  1OYY A;  4BY1 J;  4RGR A;  1IXS B;  2LVS A;  1WJF A;  4GYG A;  2LRE A;  2CV0 A;  4L0Y B;  3A01 A;  3HRM A;  4DYR A;  4BS9 A;  2OBP A;  1F5T A;  4YIF A;  3BQY A;  2KDO A;  3EUK L;  3FKI J;  2LRD A;  4YRV A;  4ZTF A;  1IV8 A;  3AG1 H;  4P9F A;  1ETX A;  1S7E A;  2NNY A;  3TW7 A;  1TWH J;  5LRR A;  3SZP A;  4P55 A;  2F4O B;  1BA5 A;  5D5W B;  2P6S A;  3Q5F A;  1UHM A;  3UNG C;  1H9G A;  4UUT A;  1V5G A;  1KQ9 A;  1X1D A;  2LH9 A;  2LDU A;  4GXO A;  1WGX A;  4A93 J;  4G12 A;  3FM3 A;  3I9V 2;  2E7X A;  1CF7 A;  5LFA A;  4BXX J;  3HGY A;  4XOR A;  3T0Y A;  4DBQ A;  2CFO A;  2WAQ N;  3M3Y J;  2ADU A;  3CUQ B;  1I50 J;  4L5I A;  1TW3 A;  3OY9 A;  2BHY A;  2A68 F;  2YUS A;  4ENM A;  4BHB A;  3QYE A;  4P5O A;  1YW8 A;  2LFB A;  1ZKG A;  2FQ4 A;  2XPU A;  1GLN A;  4LGW A;  1R1V A;  3LMM A;  1O3Q A;  3IUO A;  3G73 A;  2MSY A;  3GTJ J;  4JX6 A;  2LMD A;  2RNG A;  4BH9 A;  2QSF X;  2IGO A;  1Y0N A;  1YLF A;  3W6V A;  2H09 A;  2RNJ A;  1MBJ A;  1HC8 A;  2EA2 A;  3CCJ I;  5IYD J;  2OQG A;  1BIA A;  1OCZ H;  3DU5 A;  3OOU A;  1IV6 A;  3KP4 A;  4MO7 A;  3ZMD A;  2I5U A;  4HQM A;  4LB6 B;  2NYX A;  3HOY J;  1O7L A;  4NUB A;  3LSP A;  3QWL A;  1BR4 A;  2BY1 A;  5J1Y A;  1K4S A;  2GXG A;  4HOB A;  2ME0 A;  3FK7 A;  2Y0S A;  4KUM A;  1VQP I;  3RQ4 A;  1VF9 A;  1BM9 A;  3GWZ A;  4M73 A;  2WTE A;  2R0Q C;  2EFW A;  1XCB A;  2XHK A;  4LMY A;  3WE3 A;  3F6V A;  3VYR B;  2CV1 A;  3VSL A;  3UR3 C;  2DMN A;  3CLO A;  4M3F A;  3TP0 A;  3ABT A;  1SVL A;  1X1C A;  3LL7 A;  5GAG J;  4B3X A;  4EEF G;  4A3J J;  3WGI A;  2XUB A;  2HVR A;  3DXJ F;  3KET A;  2FOW A;  3DKY A;  5E1Z B;  3OYA A;  3M8F A;  4A3G J;  2VOP A;  3ZMT A;  3AG4 H;  1Z3X A;  2E5N A;  4E4H A;  4DBR A;  3ESW B;  1V5E A;  3P7N A;  1OQY A;  2ZCW A;  3Q3S A;  4KIT B;  4XKC A;  5L3D A;  1JGS A;  1PVE A;  3OIP A;  4ZYG A;  2YX4 A;  3RJP A;  1WH5 A;  5FO5 A;  1LFB A;  4XRS G;  2KHM A;  4KYW A;  4LB5 A;  2HU9 A;  3F9K A;  4B43 A;  1ZRF A;  4UY8 I;  2K9Q A;  4C2M J;  4IHV A;  3WHB A;  4B8X A;  2L9S A;  2ZJR F;  3PSF A;  4Z6Y A;  4FE7 A;  1T2K A;  2XRN A;  4WXD A;  1QVU A;  3H3U A;  3QPS A;  3E1S A;  1VQ5 I;  1Y1V J;  1XSD A;  1NTC A;  5ED4 A;  1H0M A;  1JXS A;  2X6X A;  2FBK A;  2ZME C;  1ZRD A;  2O03 A;  3E0J B;  2O8X A;  3CDI A;  4BYY A;  2LTP A;  2YR2 A; 
#chains in the Genus database with same CATH homology
 3CC4 I;  5DM7 F;  1VQK I;  1QA6 A;  1FOW A;  2JQ7 A;  1ACI A;  3DLL F;  3CCR I;  3CD6 I;  2ZJP F;  3CF5 F;  1HC8 A;  1S72 I;  4IOA F;  3CCJ I;  1YJ9 I;  2OTL I;  1FOX A;  3I56 I;  3CCM I;  3CCQ I;  3CCU I;  1VQO I;  3J7Z I;  1FOY A;  3CCE I;  2ZJQ F;  1YJN I;  1Y39 A;  1VQP I;  1VQ7 I;  3CME I;  1YJW I;  1VQ4 I;  5GAE J;  1VQM I;  1YI2 I;  5GAH J;  4IO9 F;  2OTJ I;  3CC7 I;  3G4S I;  1VQL I;  3CJT B;  2E35 A;  5GAG J;  3PIO F;  2FOW A;  3CCV I;  4IOC F;  2QEX I;  2QA4 I;  3J7Y J;  1VQN I;  3CCL I;  3CCS I;  4UY8 I;  2NXN B;  1VQ8 I;  2ZJR F;  4V19 K;  2K3F A;  5DM6 F;  1YIT I;  1VQ5 I;  5GAD J;  1VQ9 I;  5JVG F;  3PIP F;  2E36 A;  1YIJ I;  3G6E I;  1VQ6 I;  1MMS A;  3CMA I;  3G71 I;  3I55 I;  1YHQ I;  3CC2 I;  2E34 A;  2H8W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...