1VQ7I

The structure of the transition state analogue "dca" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
total genus 17
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 1vq7I00
5GAHJ 3CC4I 4IOAF 5GAGJ 3CMEI 1VQOI 1FOYA 3CJTB 1VQLI 4IOCF 3CC7I 3CCJI 2NXNB 2E35A 2OTLI 2ZJRF 5JVGF 4V19K 4IO9F 1QA6A 2QA4I 1VQPI 5GAEJ 3CMAI 2E36A 1VQMI 1HC8A 3I55I 3CCMI 3CCSI 3CCUI 2ZJPF 1VQ9I 5DM7F 2ZJQF 1VQ4I 1YJNI 1Y39A 4UY8I 3CCQI 3CCRI 2E34A 1YJWI 1YHQI 3G4SI 1YJ9I 3DLLF 1VQ5I 1YIJI 2H8WA 1FOWA 3CCVI 1VQ8I 1MMSA 1ACIA 3G6EI 2JQ7A 3CF5F 3CC2I 1VQKI 2QEXI 3I56I 3CCEI 1YITI 2FOWA 1S72I 5GADJ 5DM6F 2OTJI 3CCLI 1YI2I 1VQ7I 3CD6I 1VQ6I 2K3FA 3J7ZI 3G71I 1VQNI 1FOXA 3J7YJ 3PIOF 3PIPF
chains in the Genus database with same CATH superfamily
2L7FP 1ZRCA 2LG4A 2RGVA 2OZUA 2IA0A 1X1PA 2VODA 4HZFA 4B8XA 2KIUA 1T33A 3BZKA 3S8PA 3W6JB 3I64A 3SEZA 2XGCA 3HB9A 1S9HA 3CLOA 4AU7A 2XPUA 1X19A 3OYCA 5IP7J 4Y3OA 1N25A 4BUPA 2DXIA 2OV7A 2VJJA 2HQRA 3VEPA 2ZJRF 2DTZA 3C3WA 2ZBKA 4XOPA 1T0FC 3CQZJ 1RNLA 4IRGA 5AONA 3HOTA 4WCGA 2Y9ZA 2XIGA 2ELJA 2WTEA 4KT6A 3E6BA 2ECCA 1JGSA 2AQFA 2E36A 4D5CA 3K4BA 3CCMI 2MYSA 2KISA 2ZCWA 4AWXB 2PMUA 2F5DA 2A5WA 2DQLA 3A0BC 2K85A 4CCOA 5J8CA 2XRNA 2HDWA 3LSJA 1VQ9I 1FP2A 1LUJB 2H27A 1Y39A 4BE1A 3WHCA 3HHHA 3CP8A 1UMQA 2L4MA 1TL8A 1B9NA 4C2UA 4C2MJ 2D45A 2BY1A 1MMAA 3KPHA 1YLFA 1QZYA 2W24A 3DBHB 3FBNB 4F92B 2NNNA 2GXBA 4XKBA 1XMKA 4V2FA 4QPOA 1U9OA 3ROUA 4Z6YA 2DTRA 2L02A 3HXLA 3BCBA 2M3AA 4J00A 2A3SA 4K2EA 3FXKA 1E3PA 1LDDA 3ZCOA 2IW5A 3QPLA 5BQTA 2E1MC 3DV8A 1VFCA 4XICA 1G59A 3BR2A 1QBJA 3I59A 2EIKH 1MW7A 2BXZA 3CUQA 1QNTA 4LIVA 3K70C 5M5WJ 2R7UA 2QGUA 1V4RA 2QENA 2COBA 4Y7NJ 2A6TA 3CCLI 2JUGA 1BIAA 3DPLC 3H5RA 2GOMA 1O4XA 2EK5A 3SZTA 5C3EJ 3DLAA 4FX4A 1RKWA 3A0HC 3V8JA 5M5XJ 4M3GA 4NUBA 2BEOA 2R5YB 1FOXA 1Z67A 4RGRA 1Y1WJ 3I4NJ 2BV6A 2QM3A 1WQ2A 3BR5A 2PMZA 3KETA 1B4AA 2DQRA 3S1MJ 4WXDA 1ZELA 1R4NB 2K9SA 3MVPA 2PQ8A 2X48A 4S04A 4M6YA 5IYBJ 3E6CC 4HX7A 4HNTA 1APLC 1W5TA 1P4WA 2O5RA 3VYRB 1FYLA 4IOAF 3QYBA 1ZRFA 4MGRA 1N77A 2QUFA 2DA1A 2XPWA 5D6FA 2K40A 2VC1A 1DP7P 1TQPA 4CYCA 1FYKA 4OMYA 3GTMJ 2R7SA 3CC7I 5F0FA 3O6BB 3BDDA 2O3FA 2E35A 2O8XA 5FKKA 2R7FA 1WH7A 4LG3A 3FISA 3BR0A 3L2WA 1HF0A 3L09A 1FMVA 3MMYB 1Q1HA 3QP5A 4LLGF 2GA1A 1QA6A 3CDIA 4KISA 4IF4A 4A3DJ 3BG5A 4ETSA 2DT6A 3KYCB 4EATA 1XCBA 2QQ8A 2V1XA 5BS6A 1TTYA 1D5YA 4BY1J 1A35A 3HM5A 3HGGA 2O9LA 2IS2A 1D1BA 1K6YA 1SANA 3BJOA 3KEYA 3BWGA 2HYFA 2CO5A 3V8LA 3S3OA 2ZSHB 3PUBA 4HEA2 2F5FA 3K1PA 2W82A 3M7GA 2ZJ2A 4G6DA 1RKTA 3RYRA 4FE4A 2VQCA 1TW2A 3ESWB 1DP3A 4XM3A 1PUFA 2EA4A 3I4PA 4UY8I 3ABLH 2IS4A 5DV5A 1G6NA 4AVPA 2O7OA 4UUSA 5TRDA 3BOQA 4ENNA 2V6EA 2QSHX 4EVIA 3FK6A 2Z2SB 1N75A 1NG6A 4I98B 1U0JA 3CCVI 2OA4A 3WU2C 1I3AA 2XRLA 2Y69H 4DBQA 2X0LA 3FMRA 3HRTA 2ZXHA 2HXOA 2A61A 3HHGA 2W48A 3HTUA 4RB0A 5FKNA 1JHHA 4MHGA 2IA2A 1GVDA 2Y30A 1U6GA 1YS7A 2JT1A 3LL7A 3PSIA 3LNQA 4YFXF 5DD4A 2B9SA 1IN4A 1CGPA 2W85A 2Q1ZB 4Y17A 3HRMA 4OIOF 3A4CA 5CJ9A 3Q5FA 1R58A 5E1WA 4DGWB 2BY3A 2QKMB 3LWFA 4IVNA 5JHFA 3MAJA 3KP5A 4JX4A 4MTEA 2KRCA 2Y0SN 4FE7A 2JSCA 3EQLF 1K79A 1KQ8A 1UFMA 5HNHA 5K5QA 3KFWX 1ZGJA 1TBXA 3ASOH 4CDGA 4D7NA 3LQRA 1EF4A 4LITA 4XQFA 5GPAA 2VB6A 1Y8QB 1BC8C 2MH2A 3BC8A 3K4MA 3M9AA 3RKWA 3I53A 5LEJA 2EB7A 2GXAA 1IV8A 5KVRA 4CCKA 4MQ9F 2CW8A 3BTCA 2F5CA 1A6QA 2JA5J 2VT2A 2JA6J 1J59A 3H0DA 1P7JA 1ETOA 2XF7A 2VN2A 1HW2A 2OU2A 5J4VA 3ZRGA 4RAYA 3KLOA 4N4OB 1ZRDA 2V1NA 3QP6A 4HYEA 5HDNA 1RR8C 2WV0A 4EJUA 2XGXA 4OOIA 4E7JA 1BI3A 2KLOA 2PMHA 3K4LA 1W1WE 1ZG5A 1PP7U 2CW7A 1FNNA 3AG4H 1ZAOA 2G0EA 2HI3A 3H36A 3RJPA 4A3CJ 2R7TA 2HQ5A 4OINF 1HC8A 4KA4A 2W1OA 2QKLB 3G2BA 2RV8A 5IT9K 2AHQA 5K5OA 3JRAA 3J7AY 1UHMA 3CCUI 1AHDP 1GUUA 4DZJA 1A5JA 4OIRF 2FEZA 4RGSA 2GIZA 4XRMA 4GRIA 1R49A 3HOZJ 4BEHB 1ZREA 2MGQA 5FLVA 3S2HJ 2RVCA 3JRIA 1I3QJ 4HQEA 1SAXA 2YX4A 4UV8A 1B59A 1G3TA 4N9IA 1LB2A 3ZQQA 3E7LA 3F8NA 2JTVA 4QPQA 4LJZF 4NBQA 3GZ6A 2FBKA 3WGHA 2STTA 2EZHA 2OPTA 2YSRA 1IDYA 3G6EI 2DK5A 1WH5A 2R4GA 3TOAA 3KP3A 3CC2I 4BNCA 5FLXK 3QYFA 1MSEC 2ESHA 1EH7A 1BW6A 2A05A 4RBOA 1EKEA 3M8JA 3V7SA 3DFGA 1F4KA 1YITI 1QPMA 2V26A 1FTZA 4UB6C 1WJAA 1R1TA 3FX3A 5AIPA 1IAWA 2JRTA 1TWHJ 3WHBA 2CH0A 2IGMA 4L9TA 1LVKA 2K4JA 2JA8J 2BHZA 2M45A 4D7MA 4MFDA 2LDUA 2ISZA 5HLIA 4O6JA 5IT3A 4LK0F 1WCMJ 1JGGA 2DI3A 4LLNA 4G7OF 4MLOA 4ZYHA 4AD9A 3OWTA 4XLNF 5DEQA 3OS1A 1RUOA 3U1DA 1W0TA 1SD7A 5J8FA 3TGNA 4B3AA 1D0ZA 3MZYA 3ZQGA 4NHJA 1HDPA 3ZQCA 4W1UA 5J6XA 2VJ4A 2KQRA 5J1RA 1LPQA 4BKXA 2IGNA 3VOEA 5JFRA 3RZDJ 1O3RA 4C9YA 1NTCA 2W00A 2GA2A 2MD5A 5IOZA 4I09A 4A69C 3COAC 2XAGA 2DMQA 1XCVA 2L3DA 2ELKA 4J19A 2OTLI 1E0EA 2K86A 1V5FA 2M7BA 4HW0A 1O7FA 1BJAA 3WE2A 1JKRC 1I6HJ 5EYRA 1LVAA 3SDGA 3HG9A 4CYDA 2YS9A 4CCNA 3K10A 4RAZA 4FCYA 2LK2A 2VOPA 2HVRA 1FBUA 2Y2ZA 2KIMA 3TDUC 1SFOJ 2NVYJ 4I99C 5E3MA 3ABMH 1SD6A 2FD5A 3VSLA 5TGTA 3REOA 3OYHA 5LEKA 2CUEA 5GTHC 1P7IA 2IBDA 4P5OA 3JRFA 1TT0A 3BTIA 2RQPA 4XLAA 1O3SA 1IDZA 2EJRA 1MBFA 3S2DJ 3CZ6A 5LGUA 2V9PA 2ZXWH 4KYWA 4BXXJ 2DFEA 2XSJC 2WWYA 3K4CA 1TWGJ 1KU7A 3D5SC 1BC7C 2JA2A 3F72A 2OQGA 2TCTA 2JZYA 5L3CA 2IS6A 3DKXA 2VQGA 3LAPA 4KUMA 2LC2A 4KITB 5E79C 5J1UA 3ZMSA 3HOSA 2X6WA 5DD8A 3OIQA 4TV7A 4BE2A 2GQQA 1T95A 3HPHA 5KAFC 2EILH 2HDCA 4Y13A 4Q5SF 4M73A 2CUFA 2OZ6A 5LBQA 4AM3A 2V7FA 3EETA 4BHCA 1JI8A 1MH3A 1X1BA 1KU2A 2EFOA 4JX6A 1H9TA 1U5TA 3K1MA 1WJFA 3TO7A 2R0QC 1A36A 1QRYA 1X1CA 3FKIJ 3MZHA 2EFPA 1YI2I 4ZDPA 4IHSA 4KN4X 2WAEA 2HXIA 2OD5A 1HDDC 2A5YB 5IP6A 2R5ZA 4CICA 1I6XA 1QQIA 4CA0A 1EA3A 5LD2C 5LLQA 4PJNA 3DKYA 3PIPF 1B72B 2DMTA 1GHCA 2CJJA 4BJ5C 3CC4I 3WTSC 1BR1A 2ZMEA 1ZGWA 1U5TC 3PO3J 2W84A 4BE0A 2PI0A 3QWLA 2Q2EB 1USSA 1VQOI 1GV2A 3SZGA 3S1NJ 3GXOA 3I9V2 1VF9A 2IPQX 3Q3SA 3T8RA 4LG0A 4E7IA 2UUZA 1HCRA 4ESJA 2NXNB 4PJJA 3FM3A 4YFNF 5FD5A 2EZKA 2CQ7A 3C2GA 1REPC 1W4MA 2XAUA 3JTGA 4HG2A 2ISYA 3QPSA 1XGMA 1X4PA 3H92A 3WU0A 3JRBA 4DOZA 4AYBN 3N97A 3F8FA 1ON1A 4UVAA 1SMYF 1YG2A 1AU7A 1O3TA 2ZMEC 1FMWA 4G6TB 4JYKA 3H9QA 1Z21A 3IH2A 1DU6A 1BJZA 2CFXA 3MZ8A 2IRFG 1Z1DA 4RB2C 3C2BA 2L54A 2JN6A 1O3QA 3L2VA 2K3PA 4A3MJ 3OYGA 4HRIA 2NVUB 5LHGA 3EUKL 2DA2A 2XVCA 2KFDA 4G9YA 4UHTA 2WY7Q 1HKQA 2YR2A 4L9VA 5DCMB 2W25A 3OYJA 3C1DA 3RPQA 4YG2F 1X3WB 2B0LA 2ACJA 5BOXA 2VL8A 2ZNZA 4M74A 3ZMVA 2NS8A 2EV6A 4AIHA 1ONVA 1V5EA 2H8WA 2P81A 2R93J 4XR6A 2HKOA 1YRNB 3CF5F 3NWTA 1Y8RB 4B3XA 4E70A 4S0HB 1WRJA 4PFPA 3JRDA 4BHPA 3IWZA 1BBYA 4XLFA 2IA1A 2WADA 1K78B 4ZZDA 2RC4A 4UNOA 2FOWA 4DZPA 3K70D 5L3DA 4MO7A 2VPRA 5GTIC 3CJQB 4M3FA 3BQYA 1R5HA 2PX9A 5EDNA 4U7BA 2F2EA 3S1QJ 1HKTA 3G1OA 2XDVA 2DOFA 2COMA 5B1BH 4RB3C 2BOLA 3HL2A 4HV6A 2WB1A 2WBMA 3HDDA 5E8GA 4FASD 5D5XB 4G7ZF 1IXCA 2VJIA 3FM5A 4NNJA 1DPRA 5E3LA 4B44A 2CWEA 5D4SA 2ZC2A 4XIDA 2UXXA 3L2QA 3WTZA 2HPIA 5EEAA 1LFBA 2LFBA 4FT8A 4EM0B 2LYCA 2DPUA 3F0CA 1POGA 2HYJA 2OF7A 2JSPA 2EV0A 2R7OA 1IRFA 1J75A 3O8GA 2KRHA 4FQGA 4HLYA 1FPQA 4AC0A 3IH3A 1R5ID 2X9DA 3KZZA 4XORA 1XD7A 5FFXA 4ON0A 2MH9A 2XPVA 4BXFA 3KCCA 2HDDA 4XRSG 4ZTJA 3FXUA 3GYHX 4UB8C 5GP9A 3VODA 5F0CA 3S3MA 2RREA 2AO9A 1XGNA 3J80Z 1FYMA 1G8XA 3CMAI 1YTYA 3CMMA 4JBAA 2R7VA 4PZJA 4HAMA 3I55I 3LSPA 1UB9A 2R7XA 1V3FA 1MJAA 3OY9A 3PNVA 3BPVA 1WI9A 2LP0A 3KZYA 2CQQA 3RQIA 3DBRB 2WAQN 4E7LA 4BJ6C 4IRHA 1IG7A 1G3SA 2CUZA 4JP0A 1TQIA 2L9VA 4CSWA 2ETHA 1K6OA 2VLAA 5AIQA 3LSTA 1J9IA 1T2KA 5F27A 5EEGA 1YO5C 5EG0B 2HVSA 2A6EF 3M1EA 1RR7A 2JQ7A 4CCLA 5F1RA 2G7UA 1U9NA 2K9NA 1OYIA 1IN6A 4L0ZB 2XB0X 1W7PD 1IN8A 3LFUA 1Z0XA 5H2FC 3IKTA 4A3EJ 2ZFWA 1OCCH 5K7ZA 1BW5A 1W36C 2HYGD 2L4AA 2LVSA 2HOSA 4G8XA 1LQ1A 2MG4A 4LIUA 1ZR4A 3B6CA 3K7AJ 4CH7A 3W2AA 5FRNA 4LMYA 3BG7A 4HF0A 2PN6A 1FY7A 3JRGA 2DU9A 1ZQ3P 1XDSA 5E20A 1Z6TA 4U0WA 3HOXJ 3QODA 1FC3A 3J7AO 1HA8A 5L3BA 2Z5UA 3KIOA 3IRQA 1OCTC 2K02A 2CV1A 4UVBA 1LEBA 1G4DA 1QO0D 3TW7A 1R1VA 1IGNA 2EFWA 4WWCA 1JT0A 2IT0A 1DU0A 3ONQA 1BI2A 1PUEE 5B66C 2H8RA 2FBHA 1YW7A 4LLLA 3OOUA 1P92A 2Z33A 4EJTA 3IH4A 3I3LA 5F0HA 1MH4A 4X0GA 3JTHA 3PL8A 3HTSB 4OMZA 4F7ZA 1MNMC 2XF5A 2OUMA 4ANJA 1D8KA 4KFCA 3V7CA 1I39A 2V1DA 2ZXIA 3OIOA 4IHYA 3DPUA 3E5UA 3DEUA 4EGZA 1U8BA 1V5GA 1Y6IA 2TDXA 1IJWC 4I7HA 4XLHA 3ASNH 1XDUA 1OYWA 1LFPA 4GCVA 3SXYA 3MWMA 4HX4A 3H5NA 1LJ9A 1Z7LA 2HKXA 1MJBA 3CUQC 1OKRA 1ZLKA 2M7AA 4S05A 2HGCA 1WFXA 4C3IJ 1MBGA 5CVUA 1KZHA 3DU6A 1MMNA 2V6CA 4A0YA 2DOEA 4HQMA 4FETA 2E2JJ 1MJ9A 2D1HA 1VQ4I 2D2WA 2LY9A 1E3OC 1EH6A 1X4OA 2MLGA 4P9FA 2VKEA 3J81Z 2XAJA 5M3FJ 3AG1H 4F3QA 3LSHA 3LFKA 4XLCA 3R4KA 3U1KA 3ZXSA 4E7SA 5LRSA 3G4SI 3B6AA 3DLLF 1HBXG 2E19A 4IPAA 3OL4A 4CZZA 3GTPJ 3WTVC 2O03A 4EMSA 2OBPA 3TP3A 3WG7H 1MMGA 1U78A 1C0WA 3PSFA 3GBGA 4A12A 1QU3A 3WTYC 1R5GA 1FIPA 3V7RA 4D1QA 1ODDA 1MNEA 1DUXC 1I50J 1DPUA 1J2XA 3I56I 3ZMDA 4MFEA 3UR3C 1UCRA 2FNAA 2L7MP 3BLYA 3TDZC 4DW6A 4HV5A 4XKCA 4LFUA 1D1CA 3DEEA 1MBEA 5ICEA 1FX7A 1PJRA 1QPIA 3DKWA 2CQKA 1Z3XA 2PEXA 4RMNA 2LBFB 3TQNA 2L0KA 2VXZA 4AUXA 1NK2P 2LD5A 3VB2A 5CQEA 4HSRA 1XGOA 2F5EA 3LSKA 4PJ0C 4P55A 4A3JJ 2ZO4A 3S16J 1YFHA 2CRGA 2VKHA 1OLTA 3P7NA 5E3OA 1JTXA 3U21A 2EFQA 4CXFA 1WHUA 2HTJA 1IRXA 3TEDA 2BW3A 1B72A 5BMZA 4AIKA 1BL0A 3HOYJ 2E7WA 3DBLB 2K4BA 1SVOA 2HOAA 1TWCJ 2F6CA 1AKHB 1XSXA 1H8AC 2Q2EA 1ETWA 1OR7A 1P4AA 1NK3P 1TC3C 2XROA 1LE8B 3DTEA 4IQ4A 1J5YA 3M3YJ 1T08B 1BI0A 2CU7A 3FXJA 2BY2A 2XAFA 4UV9A 1A6IA 4XN3A 3ERED 1D0YA 4BXUA 5IOYA 2VQLA 4IKFA 3FMSA 1W5SA 3OS2A 3IP4B 2JPCA 3ZN1A 4YIRX 4NDLA 1NH3A 1YW8A 3K69A 3VYTB 3OR2C 3G1LA 3BP8A 2VBYA 5HS8A 4NQWA 2CV2A 1K7AA 1L3LA 3CCSI 4C2TA 4JQFA 3ML6A 4A6EA 5EJCA 1QHGA 2EWNA 1FIAA 4OAZA 3IWFA 1B8IA 1OR7C 2LSOA 3GX4X 4YRVA 5E1XA 1ZG1A 4HOBA 2HPMA 2R92J 1PDNC 2ZXJA 1Q1VA 1WKMA 2CV0A 1UHSA 1YIOA 3KEQA 4ABZA 3SFIA 2XC7A 3CUOA 1SC7A 2P7CB 4U7DA 3O2PE 4M9SA 1HKSA 3TO9A 3GTOJ 2PMZN 3WODF 2V4JC 2E1NA 3T0YA 1YJ9I 1RETA 3NEUA 3SZPA 3DXJF 4U88A 5B3SH 3LA2A 2XAQA 5HOOA 3KP6A 2AXTC 2MA3A 5ICCA 1VQ8I 1MMSA 3SQNA 4LB5A 1ZGAA 1TW3A 1FJLA 2QEXI 3JSPA 1K4TA 3FBIB 3BCAA 1B9MA 1G2HA 3I58A 3OMYA 2BE5F 3CCEI 1D8JA 3Q0VA 4NC6A 3SFZA 4HSTA 1WGXA 3FXLA 1N78A 3SHFA 1R71A 2YPRA 2VBWA 3S15J 2DA3A 3MN2A 3JAMZ 4F93B 1VNDA 5A2QZ 3AL0C 3L2CA 5H6RA 2P4WA 5ED4A 1ZH5A 2X51A 4BS9A 2DA7A 3CDHA 3KP2A 1ZG3A 3IV5A 1A04A 4AIJA 5ICFA 4XBFA 3I5UA 4BYYA 2CGPA 2VPLA 3PIOF 2MABA 2ECBA 1ORKA 2DFFA 1XPXA 1ZKGA 2M4GA 3IKVA 1RIOH 2FU4A 5JR3A 3OYEA 1XN7A 5GAGJ 2A6HF 1UG0A 4A3GJ 5TISC 1JKOC 3F8CA 2FMLA 5CVIA 1Z77A 2E1MB 5ERIA 5D8KB 2QQAA 4XKWA 4HPQA 3GWZA 1JT6A 5C4JJ 3N4MA 4RGXA 4RDUA 4Y4RA 3LA3A 1U3EM 2RQQA 2M34A 5JLXA 1FSEA 5KAIC 2LF8A 3OYAA 3RDIA 3S32A 1UZCA 2EQRA 2DK8A 2IGKA 4ZYAA 2H1KA 1RESA 3K2ZA 3HKZA 2R3SA 1MKMA 4XK4A 3VDXA 2GIVA 1HLVA 3A03A 1JKQC 1SVLA 2ID6A 2QF7A 5LRRA 3GZNB 3HPGA 5ILVA 2DW4A 1R9TJ 4LD5A 3M1CA 2KPMA 3BTJA 1MIJA 2HZTA 4KJZA 5DM7F 2ZJQF 1EH8A 3I59B 2Z1DA 1YX3A 2HTSA 4ZYEA 2E34A 4I01A 2ME6A 1KQ9A 3H5AA 3I0TA 3RI4A 1YE9A 2QZ8A 2DA4A 2ZKZA 1YS6A 3GW2A 4BL0B 1VTNC 2NOJB 4KMFA 3C2HA 2Y31A 4CUGA 2RAEA 1T56A 5CKTA 5EG0A 2DMUA 3HGYA 4XRSA 2M0MA 3TBIA 3SEQA 1IW7F 3HJEA 4L9NA 1RC9A 3FXMA 2EZLA 1GXQA 5CVVA 3FK7A 4KIFA 3X2QH 1USTA 2DYRH 3FXRA 2OTJI 4XLEA 3QU6A 4D0PA 1DGWY 2IEKA 2LTPA 1FTTA 1R22A 2XHKA 1BR4A 1VZ0A 3GFJA 3EYYA 1HQCA 2XV4S 3A01B 2FOKA 2CW0F 3T1BA 4YELA 4Z2YA 1CF7B 3J7ZI 5D4RA 2Q8KA 4OWRB 1VQNI 1IRZA 1OCOH 4FX0A 5HDKA 2XGEA 4ITVA 2E71A 3CDLA 3R61A 4L9JA 3TKYA 4Y15A 1SFUA 2HOTA 1PP8F 1KQ0A 2GXGA 3VSKA 3S1RJ 2L9NA 4BU2A 2RDPA 2LMDA 1B1BA 4B48A 4PSXA 2MFZA 1H0MA 3F3XA 2GWRA 4XOTA 3BG3A 4E6KG 3MEXA 5FLMJ 2A69F 2VE9A 2JA7J 3ZMTA 1AWCA 2XAHA 1QVTA 4IJAA 1OCPA 1W7PB 1PUFB 4XN0A 3RKYA 4B1RA 5JVGF 1OJLA 3I4MJ 2R5YA 2F4MB 3HBLA 5E3NA 2HQNA 4BQOA 1S8NA 5HVQC 2DA5A 2CFOA 4ZC3A 1GLNA 3ELKA 1XGSA 4FTHA 4P1WA 2J5PA 3GMEA 3F8BA 4M6XA 1ZTRA 3CESA 4G94A 4DIQA 4RAGA 4M71A 3WTUC 2FE3A 4U0YA 3K6GA 1ETXA 3WGGA 2PJPA 2DLLA 2O6GE 1TWFJ 4XNFA 3R60A 1JUMA 2CQXA 4DYRA 3RCOA 3OS0A 2VBXA 3RPUA 3NQOA 3L7WA 4CCJA 3P9IA 1UJ8A 2QBYB 3KEOA 3E5XA 2JMWA 4PGGA 5BPIA 3PQJA 5GPCA 3ZPLA 3CCQI 2EPFA 1S29A 3IC7A 3OYNA 2EBIA 5FROA 1M1EB 2DDBA 2RKHA 3N05A 4A3KJ 1XSVA 3U2RA 5B5EC 1FT9A 2H6CA 2JUCA 3W3CA 2KIFA 3KX2A 2VUMJ 3SYTA 3H9GA 3GFLA 3ZR8X 4ESFA 2OCCH 2YUSA 3BT9A 4MIMA 3TP0A 1FEXA 4FISA 1ZK8A 3MD2A 2QQBA 4E7HA 2DFHA 2KRFA 4NB5A 2HOEA 2ZB9A 2DMNA 4A3LJ 5JHUA 5K7HA 5GADJ 4BQNA 3QQAA 3KYDB 4IZZA 3QOPA 3CF2A 2GAUA 1ZN2A 2HU9A 1F1ZA 3M07A 2LBFA 1R36A 3HYIA 2D5VA 1Y56A 1ZR2A 3ZQIA 2BVMA 3CD6I 1P6RA 4EM1A 2K3FA 2DOAA 3EDPA 1G3WA 5CVRA 1DGRM 4ZZLA 2VKVA 4EV0A 1J0RA 4M9XA 2DDAA 3WTWC 1X2NA 1S7OA 1VI0A 3J7YJ 3JSOA 2JRMA 3H3VK 2M4KA 5M3MJ 2F48A 5LFAA 4IHWA 2EZIA 1JKPC 1OMIA 1Z6RA 2NAZA 3BTLA 2KJCA 2KZVA 3OR1C 4PK4A 2O8KA 2AXLA 2KHMA 4F52A 2KP6A 1AKHA 4GDFA 3IRRA 1U8RA 2HNHA 3GTGJ 1EJ9A 5IP9J 1WJDA 4LGWA 4KNYA 2M2EA 3R6SA 4D5FA 1YOVB 4M9ZA 4GFBA 1BA5A 1STZA 4MQVA 1L0OC 2BXYA 1LDKB 3K4JA 1PVEA 4L18B 2P6TA 4BDYA 2L7ZA 2X6YA 1XB4A 4UXNA 1LDJA 1SFXA 4AIDA 1H9GA 2CQNA 2KIQA 2LKSA 2DMPA 2WA0A 5HLHA 1TNSA 3NRVA 2FX0A 3K0LA 3FF5A 3CLQA 4QLCU 3MKZA 1KU9A 5L3EA 2R7QA 4B43A 3VYUB 1MD0A 1GT0C 5LHIA 4E7KA 2YU3A 1ZHFA 1X58A 2MD0A 3EPZA 1YJWI 4WXCA 2CUJA 3WE3A 3TW6A 4LOCA 4WK8F 2B7EA 3MKWB 2GLOA 4L5IA 4ZTFA 1HW5A 1DDNA 3E0JB 2CG4A 4J01A 4F55A 3CTAA 5CVJA 3F6VA 2HS5A 1VQKI 3SDBA 1OISA 1GVJA 3T5XA 4XONA 3PFYA 2K5CA 4IEJA 1T0FA 4N9HA 2DA6A 1FWZA 3OSGA 1RZ4A 1QGPA 2JK3A 4RS8A 4BJTA 2X1CA 4L5EA 3FDYA 4V2GA 4BEHA 2IS1A 3F8MA 1B6AA 4UUTA 4KIGA 1R6RA 2DYSH 2F4IA 2XF6A 2OC6A 2H1LA 2QYOA 3G73A 3D0SA 4ZYDA 5IT9Z 3BG6A 3CJRB 1JXSA 2H6BA 5M5YJ 2BBYA 3GVAA 2RNGA 5D5UB 1IUFA 3G71I 4MNUA 1X3ZB 4I76A 1Y0NA 2IP2A 2Y48A 3BJ6A 3EYIA 3JR9A 1S7EA 3OYIA 1K61A 1HXDA 2M1BA 1SD5A 5CLSA 1HSJA 4BH9A 1SMTA 4HNUA 2V9KA 2IVMA 4BBSJ 3QPTA 3QYEA 4IXAA 4ZDLA 2K9QA 2P5KA 4DYQA 3GTJJ 3K2AA 3Q0WA 2VBZA 5EGOB 4IL6C 4E4HA 3PJRA 1R1UA 4KMUX 5DTDA 2E60A 2MC4A 2A68F 3ZQLA 3WTXC 5FLXZ 3OYBA 2V79A 2DO7A 2HR3A 3CCYA 2QVOA 1G3YA 2P7VB 3RZOJ 3JREA 2VOOA 1U2WA 3QAHA 4RAFA 3CCJI 2LH9A 3P9KA 5K5RA 2V9VA 1GXPA 4II2A 3ECHA 1WJEA 1BIBA 3IAM2 4IO9F 3VFZA 3U9GA 2E2IJ 4B09A 1IXSB 6PAXA 3GFIA 1HSTA 5CQGA 2ELHA 1Z9CA 3OYMA 2DT7B 9ANTA 1MDMB 1VQPI 1ZARA 1S7AA 3QU3A 2XASA 3ABKH 5E18F 1ZYRF 1ETYA 3QPHA 2STWA 2Y0SA 3PNTA 1H89C 3KLNA 1JUSA 3M8EA 2ZJPF 1AA7A 1J09A 1MSFC 1KONA 2E2HJ 2JPBA 3HRSA 3L2RA 5CPRB 3HSRA 3MCZA 1YJNI 5L3GA 1WZ2A 2R7DA 1MNDA 2WV1A 3PO2J 3S17J 3V4GA 2WB1N 2IJLA 3L00A 3OIPA 5KHDA 1F36A 1U5TB 3R0JA 2AQEA 4HDUA 2JJ7A 5B1AH 1ZLJA 5IYCJ 1P2FA 3UKGA 2K9LA 3RKQA 2FQ4A 4XSXF 3W2VA 3RQ4A 1JUPA 1GV5A 2GM4A 4PGHA 2R5ZB 1ACIA 4LB6B 4W97A 2L01A 2EV5A 2K9MA 3GTQJ 2XKPA 4M3DA 4ZYGA 2FA5A 4Y52J 1R7JA 4QSHA 4OAYA 3W2WA 1ENHA 3GFMA 3KYLA 4YIIA 4I2OA 2LY2A 2PBIA 5DM6F 1UELB 2ZMEB 1E2XA 4WF2A 4B47A 1ERDA 1TQMA 2QSFX 3HUGB 2LRDA 2MLKA 5J1YA 4EM2A 3A01A 1IRGA 1F43A 1OPCA 2KT0A 2CMPA 3DCFA 2EFNA 3QOEA 4LG0B 1VQ6I 3RYPA 2VC0A 1CF7A 1FBSA 1UHWA 3M8FA 4U0VA 2JWTA 1X2MA 2WY8Q 5FGMA 5F64A 4IHVA 1ITYA 2DN0A 2DPDA 2DAOA 1BN5A 2F4OB 5FKLA 4M3BA 4Q47A 4OIQF 1TLHB 1WI3A 3ZGKA 4WXHA 1R4MB 3F6OA 4C3HJ 3MKYB 2VIXA 5HS9A 2FBIA 2BYVE 3HRUA 4N0BA 1LKXA 4PCQA 1NHAA 2XUBA 3HOUJ 4BHBA 4JOMA 3BR1A 4IQJA 3CJTB 2L5QA 1NG7A 2M0CA 4IOCF 1YW9A 4EEFG 2QLZA 1XMAA 3QRFF 5J3LA 3IHUA 1D5VA 3ZQFA 1W7PA 4V19K 2ZSIB 3F9KA 4CCMA 4XKVA 3FMQA 2CYYA 3RIRA 4GGGA 4EJWA 2ZNYA 2LR8A 2BY0A 1JJ6C 2WAFA 3JRCA 1FBQA 3FXQA 2KMUA 2XGDA 1MMDA 5D5WB 4KDPA 5F6FA 4EGYA 1Z7UA 4FHTA 3CMYA 2FJ1A 4GO1A 2Z99A 4PJMA 2GOXB 3OOPA 2G9WA 1IUYA 4A5NA 1QZZA 3F22A 4JK1X 4X1EA 5DYMA 1PYVA 3V8KA 1LEAA 1T98A 3VYSB 4ESBA 3BPXA 5KK1A 3FWEA 1FSHA 2HEOA 2QBYA 4CZCA 1ETVA 2ID3A 3E5QA 2ADUA 2NVQJ 5HDGA 5FD6A 3P9CA 4IHTA 3KE2A 1K4SA 1T6SA 3ECOA 5DUIA 2XB5A 1YIJI 1AOYA 3DQVC 1WJBA 2JVGA 5JI6A 3GTLJ 1BM9A 1FOWA 1YX5A 1E17A 4Q4ZF 2LKXA 4G7HF 5DUKA 3W6VA 4A2UA 2L2OA 2Z9OA 3DP7A 5TJJA 2LLKA 3DWLE 3OYDA 2PJRB 4ENJA 3DTKA 2M30A 4PFOA 4BY7J 4I02A 4QWQA 2KJBA 3LSRA 4XRFA 5D8LB 1UG2A 3LMMA 3Q9VA 1IXRC 1K83J 2N8GA 4KN7X 3S14J 4Q48A 5FJ8J 1IZ1A 2X4HA 4IRIA 1S72I 1KU3A 4RLQA 1BI1A 3K4KA 5IYDJ 2AS5F 3I54A 5DCMA 3FIWA 5EF6A 3E97A 4RM2A 5JVTA 2DCEA 4RGUA 1FLIA 2P6SA 5D6EA 1MZBA 2HVQA 1TWAJ 3DEWA 4NC7A 1BR2A 3J80K 2X6XA 4O3MA 1E3HA 1I27A 1XG1A 4DJAA 3C7JA 1W0UA 2KKOA 2HZDA 5EZHA 3WGIA 3HC7A 1I1GA 1ON2A 2R7WA 1YRNA 1MBJA 2MBFA 1O57A 4L5JA 3RSNA 3EUHA 2NS0A 2EA2A 1WPKA 3H1CA 1K78A 3MKLA 5ICGA 3IL2A 2YU9J 4RA2A 1I5ZA 1XMXA 1SD4A 4IHXA 3ZMZA 1LFUP 2ESNA 3WG9A 3HOVJ 5DS9A 1O7LA 3G3ZA 1F9NA 2Z3YA 4A93J 2PFBA 2X1EA 1V54H 3IAS2 1VQLI 2NVXJ 2DT5A 2ZFUA 1YQAA 3O3KA 5F08A 3D1NI 4PJLA 3D5LA 2FRHA 1D0XA 3PUFA 2Z16A 4HLXA 3HSFA 3EUHC 3GLXA 3K9TA 4ZJZA 1TT5B 3GO5A 3CO6C 4CO8A 4I0AA 3WU1B 1R00A 5HS7A 5GAEJ 2A07F 1X3UA 1JHFA 2LY1A 3L2UA 3BZ6A 2NNYA 3H35A 1IC8A 1D1AA 2CS3A 3OSFA 5FRMA 3ZN0A 2X1DA 3MFKA 3BQZA 2JVHA 3FHNA 3PFIA 2OAZA 4P96A 1SEUA 1ETQA 3G1MA 5HODA 2P8TA 2FQ3A 4A3BJ 2HQAA 3BY6A 2XKOA 3S93A 3OYKA 1ETKA 4RLFA 5H20A 3CO7C 4X6AJ 3AFHA 5F04A 3OYFA 4Y33A 1X1DA 3GLLA 2FUG2 4XLPF 3LAJA 2UV1A 5CYVA 1T38A 2M5WA 2VJ5A 3FHZA 1RPWA 2I5UA 3GZ5A 1IO2A 3HOWJ 1OCRH 1XC5A 1KGSA 1LNWA 4A0XA 3B73A 2NS7A 4AVZA 1W5CC 2L7KA 2PG4A 1KA8A 4MTDA 4BAYA 2BZTA 3RPUD 2C6YA 2Y9YA 2Y0MA 1Z3YA 2L9SA 4A6DA 2MSYA 4H0EA 4AYBA 3S3NA 3CUQB 2R7ZJ 3F21A 4II3A 3RKXA 2VASA 4N4NB 3S2WA 4ASNA 1WJCA 2G7HA 3H3UA 3L1PA 5HNFA 4PUSA 4MEXF 3HZJA 2QCOA 1IF1A 5ILUA 4I0BA 2P0WA 3E1SA 2NVTJ 1BOAA 5K7FA 1QVUA 2E5NA 4G6QA 4KICA 5DCFA 5H6QA 1P4XA 4KIBA 1CQTA 2Q0OA 5LGTA 4A3IJ 2E1CA 2DFIA 2KDOA 5GAHJ 3BROA 4ENMA 2LF7A 3J81K 1MGTA 5EGOA 2EINH 4M3EA 3DPTA 2R7RA 2L9RA 3NWSA 1JE8A 4G12A 2GBYA 4CYCB 1J7KA 3E6DA 5E8IA 4RB1A 3I71A 1R23A 3KP7A 5FO5A 4OU0A 3ABUA 3UNGC 5BNGA 1OQYA 4A5MA 1XX5A 1ULYA 4E7ZA 5KNLA 5BPDA 3TO6A 1FP1D 2ICWG 2ME0A 1BOBA 2QQ9A 4DYCA 4EJOA 4DBRA 4QIWN 1QZEA 1TZLA 3M4OJ 4BQAA 4HF1A 4EJVA 1Z05A 4XMYA 4EQQA 1MDMA 2EH3A 5LGNA 2D1VA 3ZMUA 1EV7A 3IUOA 1KYWA 2TRTA 3LSIA 4M6VA 2K7LA 4BBRJ 1FOKA 3OV8A 5FKMA 2V1UA 2VONA 3H0GJ 2PLYA 2IAIA 1S6LA 4GYIA 3LOCA 1IN5A 2H94A 5IY5H 3AKZA 2E5ZA 1TP4A 1OCZH 2FMYA 5FB2A 2MW8A 2VXDA 3CCRI 4NC8A 4PSWA 2QWWA 4UUSB 2NRAC 1KYZA 2W7NA 3LQQA 1VQ5I 3ULQB 5J47A 2WC2A 3AAFA 2DJNA 4B4CA 3ZOBA 2X85A 3BR3A 2NYXA 3KZIC 3Q9SA 5LHHA 3E6MA 2LNBA 3GCMA 2BVLA 2GZWA 5L3FA 3PNYA 2VE8A 2E7XA 4HX8A 2VT3A 1OFCX 3PM1A 2E1OA 2BW3B 1HOMA 4HDVA 3LA7A 4ENKA 1JJ8C 4A3FJ 2OQRA 2LKPA 3DF8A 5EZGA 2P5LC 5K1YA 1Y0UA 2UWMA 3OYLA 1YYVA 3JCUC 4D9JA 3DTIA 2RN7A 3HUGA 2NOGA 3BZCA 1VQ7I 3VWBA 2XSDC 3E3VA 2WAQA 3ZQ7A 3HKZN 2VQHA 4RM3A 2YX7A 3FZVA 1T39A 1A31A 3K1NA 4WX9A 3K4NA 4BQQA 2FF4A 2J5OA 3TMOA 1XTAA 3GF2A 4KT5C 1P9QC 1X1AA 4P9UA 2DODA 2KDZA 4C30A 4R79A 2K27A 2BGCA 5D5VB 5KCMA 3SJMA 5J40A 2UZKA 1SVMA 5E1ZB 3HIFA 4PDKA 5JLWA 3FKJA 3RTRA 2HFHA 1FZPB 2HWVA 5FKOA 3CJNA 2FXAA 4XSZF 2DBBA 1W36D 4NQWB 3EUAA 3CMEI 1SAUA 3ZP5A 4F91B 4H4KC 4R8HA 1B8IB 1FOYA 2I8DA 1GDTA 3KP4A 2O61A 1OYYA 5C4XJ 1XS9A 2KL4A 1DQUA 1RUNA 1F5TA 1JTYA 4OIPF 1V55H 2LOOA 4GXOA 2M8EA 4IX7A 3R0AA 3JW4A 2OJED 1HW1A 4MEYF 5DDGA 2OCEA 3B02A 5F1JA 2W4SA 3BR6A 4BGDA 1Y1VJ 1IN7A 4XL9A 3AL0B 4DNCA 1WSUA 2QA4I 1SFKA 1D3YA 2H09A 3L9FA 3GEZA 1RRJA 2FNPA 4L0YB 1S3JA 4HNVA 1VQMI 2B63J 4QTRA 3LSMA 1QHHD 3JAMK 3DU5A 4CGZA 3BJAA 5A2QK 2I10A 2F5VA 4HBLA 1WJ5A 1TNTA 3W6KB 2W57A 3T8TA 3AG2H 4GYGA 1LE8A 5J4YA 3HSEA 2M87A 4U87A 3H3ZA 4UUVA 1XSDA 3VPRA 4LK1F 1SFEA 3GUDA 4YIFA 1S5LC 5E17F 3ISPA 3D5RC 3H9JA 1WVRA 3WTTC 4HF2A 1H88C 3F23A 1IV6A 2P5VA 3FXOA 3ZQHA 1YHQI 3OL3A 1I1SA 3JRHA 5C44J 3P5JA 4A0ZA 3PQKA 3GTKJ 2O0YA 4ZDOA 1UAAA 1Z91A 3ERMA 3TOBA 2CSOA 3A1YA 4C3JJ 4HA8A 2Y75A 3ABTA 2PJRA 2LREA 2EIJH 4R1HA 5EEHA 3BG9A 3NAUA 3O8HA 3LSGA 3V42A 3AG3H 2IGOA 4I6ZA 2M9HA 2RNJA 4BDZA 3Q0UA 3TL4X 2MC3A 4ZH4F 1RI7A 4YEJA 3A02A 2VKDA 4UVCA 3HEFA 4BACA 1MBHA 2DJIA 4O5VA 2VI6A 2X6OA 5HLGA 3C18A 4YFKF 1T8IA 2UXNA 1WWXA 5FFZA 3CP2A 2KZGA 1MBKA 2EIMH 5ILSA 2QSGX 3A2KA 4M72A 5IPAA 2M8GX 2FSWA 2BHYA 4CHUA 3NARA 4JX5A 3MQ0A 4DQ2A 2IXSA 5HLTA
chains in the Genus database with same CATH topology
5GAHJ 3CC4I 4IOAF 5GAGJ 3CMEI 1VQOI 1FOYA 3CJTB 1VQLI 4IOCF 3CC7I 3CCJI 2NXNB 2E35A 2OTLI 2ZJRF 5JVGF 4V19K 4IO9F 1QA6A 2QA4I 1VQPI 5GAEJ 3CMAI 2E36A 1VQMI 1HC8A 3I55I 3CCMI 3CCSI 3CCUI 2ZJPF 1VQ9I 5DM7F 2ZJQF 1VQ4I 1YJNI 1Y39A 4UY8I 3CCQI 3CCRI 2E34A 1YJWI 1YHQI 3G4SI 1YJ9I 3DLLF 1VQ5I 1YIJI 2H8WA 1FOWA 3CCVI 1VQ8I 1MMSA 1ACIA 3G6EI 2JQ7A 3CF5F 3CC2I 1VQKI 2QEXI 3I56I 3CCEI 1YITI 2FOWA 1S72I 5GADJ 5DM6F 2OTJI 3CCLI 1YI2I 1VQ7I 3CD6I 1VQ6I 2K3FA 3J7ZI 3G71I 1VQNI 1FOXA 3J7YJ 3PIOF 3PIPF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAH J;  3CC4 I;  4IOA F;  5GAG J;  3CME I;  1VQO I;  1FOY A;  3CJT B;  1VQL I;  4IOC F;  3CC7 I;  3CCJ I;  2NXN B;  2E35 A;  2OTL I;  2ZJR F;  5JVG F;  4V19 K;  4IO9 F;  1QA6 A;  2QA4 I;  1VQP I;  5GAE J;  3CMA I;  2E36 A;  1VQM I;  1HC8 A;  3I55 I;  3CCM I;  3CCS I;  3CCU I;  2ZJP F;  1VQ9 I;  5DM7 F;  2ZJQ F;  1VQ4 I;  1YJN I;  1Y39 A;  4UY8 I;  3CCQ I;  3CCR I;  2E34 A;  1YJW I;  1YHQ I;  3G4S I;  1YJ9 I;  3DLL F;  1VQ5 I;  1YIJ I;  2H8W A;  1FOW A;  3CCV I;  1VQ8 I;  1MMS A;  1ACI A;  3G6E I;  2JQ7 A;  3CF5 F;  3CC2 I;  1VQK I;  2QEX I;  3I56 I;  3CCE I;  1YIT I;  2FOW A;  1S72 I;  5GAD J;  5DM6 F;  2OTJ I;  3CCL I;  1YI2 I;  1VQ7 I;  3CD6 I;  1VQ6 I;  2K3F A;  3J7Z I;  3G71 I;  1VQN I;  1FOX A;  3J7Y J;  3PIO F;  3PIP F; 
#chains in the Genus database with same CATH topology
 2L7F P;  1ZRC A;  2LG4 A;  2RGV A;  2OZU A;  2IA0 A;  1X1P A;  2VOD A;  4HZF A;  4B8X A;  2KIU A;  1T33 A;  3BZK A;  3S8P A;  3W6J B;  3I64 A;  3SEZ A;  2XGC A;  3HB9 A;  1S9H A;  3CLO A;  4AU7 A;  2XPU A;  1X19 A;  3OYC A;  5IP7 J;  4Y3O A;  1N25 A;  4BUP A;  2DXI A;  2OV7 A;  2VJJ A;  2HQR A;  3VEP A;  2ZJR F;  2DTZ A;  3C3W A;  2ZBK A;  4XOP A;  1T0F C;  3CQZ J;  1RNL A;  4IRG A;  5AON A;  3HOT A;  4WCG A;  2Y9Z A;  2XIG A;  2ELJ A;  2WTE A;  4KT6 A;  3E6B A;  2ECC A;  1JGS A;  2AQF A;  2E36 A;  4D5C A;  3K4B A;  3CCM I;  2MYS A;  2KIS A;  2ZCW A;  4AWX B;  2PMU A;  2F5D A;  2A5W A;  2DQL A;  3A0B C;  2K85 A;  4CCO A;  5J8C A;  2XRN A;  2HDW A;  3LSJ A;  1VQ9 I;  1FP2 A;  1LUJ B;  2H27 A;  1Y39 A;  4BE1 A;  3WHC A;  3HHH A;  3CP8 A;  1UMQ A;  2L4M A;  1TL8 A;  1B9N A;  4C2U A;  4C2M J;  2D45 A;  2BY1 A;  1MMA A;  3KPH A;  1YLF A;  1QZY A;  2W24 A;  3DBH B;  3FBN B;  4F92 B;  2NNN A;  2GXB A;  4XKB A;  1XMK A;  4V2F A;  4QPO A;  1U9O A;  3ROU A;  4Z6Y A;  2DTR A;  2L02 A;  3HXL A;  3BCB A;  2M3A A;  4J00 A;  2A3S A;  4K2E A;  3FXK A;  1E3P A;  1LDD A;  3ZCO A;  2IW5 A;  3QPL A;  5BQT A;  2E1M C;  3DV8 A;  1VFC A;  4XIC A;  1G59 A;  3BR2 A;  1QBJ A;  3I59 A;  2EIK H;  1MW7 A;  2BXZ A;  3CUQ A;  1QNT A;  4LIV A;  3K70 C;  5M5W J;  2R7U A;  2QGU A;  1V4R A;  2QEN A;  2COB A;  4Y7N J;  2A6T A;  3CCL I;  2JUG A;  1BIA A;  3DPL C;  3H5R A;  2GOM A;  1O4X A;  2EK5 A;  3SZT A;  5C3E J;  3DLA A;  4FX4 A;  1RKW A;  3A0H C;  3V8J A;  5M5X J;  4M3G A;  4NUB A;  2BEO A;  2R5Y B;  1FOX A;  1Z67 A;  4RGR A;  1Y1W J;  3I4N J;  2BV6 A;  2QM3 A;  1WQ2 A;  3BR5 A;  2PMZ A;  3KET A;  1B4A A;  2DQR A;  3S1M J;  4WXD A;  1ZEL A;  1R4N B;  2K9S A;  3MVP A;  2PQ8 A;  2X48 A;  4S04 A;  4M6Y A;  5IYB J;  3E6C C;  4HX7 A;  4HNT A;  1APL C;  1W5T A;  1P4W A;  2O5R A;  3VYR B;  1FYL A;  4IOA F;  3QYB A;  1ZRF A;  4MGR A;  1N77 A;  2QUF A;  2DA1 A;  2XPW A;  5D6F A;  2K40 A;  2VC1 A;  1DP7 P;  1TQP A;  4CYC A;  1FYK A;  4OMY A;  3GTM J;  2R7S A;  3CC7 I;  5F0F A;  3O6B B;  3BDD A;  2O3F A;  2E35 A;  2O8X A;  5FKK A;  2R7F A;  1WH7 A;  4LG3 A;  3FIS A;  3BR0 A;  3L2W A;  1HF0 A;  3L09 A;  1FMV A;  3MMY B;  1Q1H A;  3QP5 A;  4LLG F;  2GA1 A;  1QA6 A;  3CDI A;  4KIS A;  4IF4 A;  4A3D J;  3BG5 A;  4ETS A;  2DT6 A;  3KYC B;  4EAT A;  1XCB A;  2QQ8 A;  2V1X A;  5BS6 A;  1TTY A;  1D5Y A;  4BY1 J;  1A35 A;  3HM5 A;  3HGG A;  2O9L A;  2IS2 A;  1D1B A;  1K6Y A;  1SAN A;  3BJO A;  3KEY A;  3BWG A;  2HYF A;  2CO5 A;  3V8L A;  3S3O A;  2ZSH B;  3PUB A;  4HEA 2;  2F5F A;  3K1P A;  2W82 A;  3M7G A;  2ZJ2 A;  4G6D A;  1RKT A;  3RYR A;  4FE4 A;  2VQC A;  1TW2 A;  3ESW B;  1DP3 A;  4XM3 A;  1PUF A;  2EA4 A;  3I4P A;  4UY8 I;  3ABL H;  2IS4 A;  5DV5 A;  1G6N A;  4AVP A;  2O7O A;  4UUS A;  5TRD A;  3BOQ A;  4ENN A;  2V6E A;  2QSH X;  4EVI A;  3FK6 A;  2Z2S B;  1N75 A;  1NG6 A;  4I98 B;  1U0J A;  3CCV I;  2OA4 A;  3WU2 C;  1I3A A;  2XRL A;  2Y69 H;  4DBQ A;  2X0L A;  3FMR A;  3HRT A;  2ZXH A;  2HXO A;  2A61 A;  3HHG A;  2W48 A;  3HTU A;  4RB0 A;  5FKN A;  1JHH A;  4MHG A;  2IA2 A;  1GVD A;  2Y30 A;  1U6G A;  1YS7 A;  2JT1 A;  3LL7 A;  3PSI A;  3LNQ A;  4YFX F;  5DD4 A;  2B9S A;  1IN4 A;  1CGP A;  2W85 A;  2Q1Z B;  4Y17 A;  3HRM A;  4OIO F;  3A4C A;  5CJ9 A;  3Q5F A;  1R58 A;  5E1W A;  4DGW B;  2BY3 A;  2QKM B;  3LWF A;  4IVN A;  5JHF A;  3MAJ A;  3KP5 A;  4JX4 A;  4MTE A;  2KRC A;  2Y0S N;  4FE7 A;  2JSC A;  3EQL F;  1K79 A;  1KQ8 A;  1UFM A;  5HNH A;  5K5Q A;  3KFW X;  1ZGJ A;  1TBX A;  3ASO H;  4CDG A;  4D7N A;  3LQR A;  1EF4 A;  4LIT A;  4XQF A;  5GPA A;  2VB6 A;  1Y8Q B;  1BC8 C;  2MH2 A;  3BC8 A;  3K4M A;  3M9A A;  3RKW A;  3I53 A;  5LEJ A;  2EB7 A;  2GXA A;  1IV8 A;  5KVR A;  4CCK A;  4MQ9 F;  2CW8 A;  3BTC A;  2F5C A;  1A6Q A;  2JA5 J;  2VT2 A;  2JA6 J;  1J59 A;  3H0D A;  1P7J A;  1ETO A;  2XF7 A;  2VN2 A;  1HW2 A;  2OU2 A;  5J4V A;  3ZRG A;  4RAY A;  3KLO A;  4N4O B;  1ZRD A;  2V1N A;  3QP6 A;  4HYE A;  5HDN A;  1RR8 C;  2WV0 A;  4EJU A;  2XGX A;  4OOI A;  4E7J A;  1BI3 A;  2KLO A;  2PMH A;  3K4L A;  1W1W E;  1ZG5 A;  1PP7 U;  2CW7 A;  1FNN A;  3AG4 H;  1ZAO A;  2G0E A;  2HI3 A;  3H36 A;  3RJP A;  4A3C J;  2R7T A;  2HQ5 A;  4OIN F;  1HC8 A;  4KA4 A;  2W1O A;  2QKL B;  3G2B A;  2RV8 A;  5IT9 K;  2AHQ A;  5K5O A;  3JRA A;  3J7A Y;  1UHM A;  3CCU I;  1AHD P;  1GUU A;  4DZJ A;  1A5J A;  4OIR F;  2FEZ A;  4RGS A;  2GIZ A;  4XRM A;  4GRI A;  1R49 A;  3HOZ J;  4BEH B;  1ZRE A;  2MGQ A;  5FLV A;  3S2H J;  2RVC A;  3JRI A;  1I3Q J;  4HQE A;  1SAX A;  2YX4 A;  4UV8 A;  1B59 A;  1G3T A;  4N9I A;  1LB2 A;  3ZQQ A;  3E7L A;  3F8N A;  2JTV A;  4QPQ A;  4LJZ F;  4NBQ A;  3GZ6 A;  2FBK A;  3WGH A;  2STT A;  2EZH A;  2OPT A;  2YSR A;  1IDY A;  3G6E I;  2DK5 A;  1WH5 A;  2R4G A;  3TOA A;  3KP3 A;  3CC2 I;  4BNC A;  5FLX K;  3QYF A;  1MSE C;  2ESH A;  1EH7 A;  1BW6 A;  2A05 A;  4RBO A;  1EKE A;  3M8J A;  3V7S A;  3DFG A;  1F4K A;  1YIT I;  1QPM A;  2V26 A;  1FTZ A;  4UB6 C;  1WJA A;  1R1T A;  3FX3 A;  5AIP A;  1IAW A;  2JRT A;  1TWH J;  3WHB A;  2CH0 A;  2IGM A;  4L9T A;  1LVK A;  2K4J A;  2JA8 J;  2BHZ A;  2M45 A;  4D7M A;  4MFD A;  2LDU A;  2ISZ A;  5HLI A;  4O6J A;  5IT3 A;  4LK0 F;  1WCM J;  1JGG A;  2DI3 A;  4LLN A;  4G7O F;  4MLO A;  4ZYH A;  4AD9 A;  3OWT A;  4XLN F;  5DEQ A;  3OS1 A;  1RUO A;  3U1D A;  1W0T A;  1SD7 A;  5J8F A;  3TGN A;  4B3A A;  1D0Z A;  3MZY A;  3ZQG A;  4NHJ A;  1HDP A;  3ZQC A;  4W1U A;  5J6X A;  2VJ4 A;  2KQR A;  5J1R A;  1LPQ A;  4BKX A;  2IGN A;  3VOE A;  5JFR A;  3RZD J;  1O3R A;  4C9Y A;  1NTC A;  2W00 A;  2GA2 A;  2MD5 A;  5IOZ A;  4I09 A;  4A69 C;  3COA C;  2XAG A;  2DMQ A;  1XCV A;  2L3D A;  2ELK A;  4J19 A;  2OTL I;  1E0E A;  2K86 A;  1V5F A;  2M7B A;  4HW0 A;  1O7F A;  1BJA A;  3WE2 A;  1JKR C;  1I6H J;  5EYR A;  1LVA A;  3SDG A;  3HG9 A;  4CYD A;  2YS9 A;  4CCN A;  3K10 A;  4RAZ A;  4FCY A;  2LK2 A;  2VOP A;  2HVR A;  1FBU A;  2Y2Z A;  2KIM A;  3TDU C;  1SFO J;  2NVY J;  4I99 C;  5E3M A;  3ABM H;  1SD6 A;  2FD5 A;  3VSL A;  5TGT A;  3REO A;  3OYH A;  5LEK A;  2CUE A;  5GTH C;  1P7I A;  2IBD A;  4P5O A;  3JRF A;  1TT0 A;  3BTI A;  2RQP A;  4XLA A;  1O3S A;  1IDZ A;  2EJR A;  1MBF A;  3S2D J;  3CZ6 A;  5LGU A;  2V9P A;  2ZXW H;  4KYW A;  4BXX J;  2DFE A;  2XSJ C;  2WWY A;  3K4C A;  1TWG J;  1KU7 A;  3D5S C;  1BC7 C;  2JA2 A;  3F72 A;  2OQG A;  2TCT A;  2JZY A;  5L3C A;  2IS6 A;  3DKX A;  2VQG A;  3LAP A;  4KUM A;  2LC2 A;  4KIT B;  5E79 C;  5J1U A;  3ZMS A;  3HOS A;  2X6W A;  5DD8 A;  3OIQ A;  4TV7 A;  4BE2 A;  2GQQ A;  1T95 A;  3HPH A;  5KAF C;  2EIL H;  2HDC A;  4Y13 A;  4Q5S F;  4M73 A;  2CUF A;  2OZ6 A;  5LBQ A;  4AM3 A;  2V7F A;  3EET A;  4BHC A;  1JI8 A;  1MH3 A;  1X1B A;  1KU2 A;  2EFO A;  4JX6 A;  1H9T A;  1U5T A;  3K1M A;  1WJF A;  3TO7 A;  2R0Q C;  1A36 A;  1QRY A;  1X1C A;  3FKI J;  3MZH A;  2EFP A;  1YI2 I;  4ZDP A;  4IHS A;  4KN4 X;  2WAE A;  2HXI A;  2OD5 A;  1HDD C;  2A5Y B;  5IP6 A;  2R5Z A;  4CIC A;  1I6X A;  1QQI A;  4CA0 A;  1EA3 A;  5LD2 C;  5LLQ A;  4PJN A;  3DKY A;  3PIP F;  1B72 B;  2DMT A;  1GHC A;  2CJJ A;  4BJ5 C;  3CC4 I;  3WTS C;  1BR1 A;  2ZME A;  1ZGW A;  1U5T C;  3PO3 J;  2W84 A;  4BE0 A;  2PI0 A;  3QWL A;  2Q2E B;  1USS A;  1VQO I;  1GV2 A;  3SZG A;  3S1N J;  3GXO A;  3I9V 2;  1VF9 A;  2IPQ X;  3Q3S A;  3T8R A;  4LG0 A;  4E7I A;  2UUZ A;  1HCR A;  4ESJ A;  2NXN B;  4PJJ A;  3FM3 A;  4YFN F;  5FD5 A;  2EZK A;  2CQ7 A;  3C2G A;  1REP C;  1W4M A;  2XAU A;  3JTG A;  4HG2 A;  2ISY A;  3QPS A;  1XGM A;  1X4P A;  3H92 A;  3WU0 A;  3JRB A;  4DOZ A;  4AYB N;  3N97 A;  3F8F A;  1ON1 A;  4UVA A;  1SMY F;  1YG2 A;  1AU7 A;  1O3T A;  2ZME C;  1FMW A;  4G6T B;  4JYK A;  3H9Q A;  1Z21 A;  3IH2 A;  1DU6 A;  1BJZ A;  2CFX A;  3MZ8 A;  2IRF G;  1Z1D A;  4RB2 C;  3C2B A;  2L54 A;  2JN6 A;  1O3Q A;  3L2V A;  2K3P A;  4A3M J;  3OYG A;  4HRI A;  2NVU B;  5LHG A;  3EUK L;  2DA2 A;  2XVC A;  2KFD A;  4G9Y A;  4UHT A;  2WY7 Q;  1HKQ A;  2YR2 A;  4L9V A;  5DCM B;  2W25 A;  3OYJ A;  3C1D A;  3RPQ A;  4YG2 F;  1X3W B;  2B0L A;  2ACJ A;  5BOX A;  2VL8 A;  2ZNZ A;  4M74 A;  3ZMV A;  2NS8 A;  2EV6 A;  4AIH A;  1ONV A;  1V5E A;  2H8W A;  2P81 A;  2R93 J;  4XR6 A;  2HKO A;  1YRN B;  3CF5 F;  3NWT A;  1Y8R B;  4B3X A;  4E70 A;  4S0H B;  1WRJ A;  4PFP A;  3JRD A;  4BHP A;  3IWZ A;  1BBY A;  4XLF A;  2IA1 A;  2WAD A;  1K78 B;  4ZZD A;  2RC4 A;  4UNO A;  2FOW A;  4DZP A;  3K70 D;  5L3D A;  4MO7 A;  2VPR A;  5GTI C;  3CJQ B;  4M3F A;  3BQY A;  1R5H A;  2PX9 A;  5EDN A;  4U7B A;  2F2E A;  3S1Q J;  1HKT A;  3G1O A;  2XDV A;  2DOF A;  2COM A;  5B1B H;  4RB3 C;  2BOL A;  3HL2 A;  4HV6 A;  2WB1 A;  2WBM A;  3HDD A;  5E8G A;  4FAS D;  5D5X B;  4G7Z F;  1IXC A;  2VJI A;  3FM5 A;  4NNJ A;  1DPR A;  5E3L A;  4B44 A;  2CWE A;  5D4S A;  2ZC2 A;  4XID A;  2UXX A;  3L2Q A;  3WTZ A;  2HPI A;  5EEA A;  1LFB A;  2LFB A;  4FT8 A;  4EM0 B;  2LYC A;  2DPU A;  3F0C A;  1POG A;  2HYJ A;  2OF7 A;  2JSP A;  2EV0 A;  2R7O A;  1IRF A;  1J75 A;  3O8G A;  2KRH A;  4FQG A;  4HLY A;  1FPQ A;  4AC0 A;  3IH3 A;  1R5I D;  2X9D A;  3KZZ A;  4XOR A;  1XD7 A;  5FFX A;  4ON0 A;  2MH9 A;  2XPV A;  4BXF A;  3KCC A;  2HDD A;  4XRS G;  4ZTJ A;  3FXU A;  3GYH X;  4UB8 C;  5GP9 A;  3VOD A;  5F0C A;  3S3M A;  2RRE A;  2AO9 A;  1XGN A;  3J80 Z;  1FYM A;  1G8X A;  3CMA I;  1YTY A;  3CMM A;  4JBA A;  2R7V A;  4PZJ A;  4HAM A;  3I55 I;  3LSP A;  1UB9 A;  2R7X A;  1V3F A;  1MJA A;  3OY9 A;  3PNV A;  3BPV A;  1WI9 A;  2LP0 A;  3KZY A;  2CQQ A;  3RQI A;  3DBR B;  2WAQ N;  4E7L A;  4BJ6 C;  4IRH A;  1IG7 A;  1G3S A;  2CUZ A;  4JP0 A;  1TQI A;  2L9V A;  4CSW A;  2ETH A;  1K6O A;  2VLA A;  5AIQ A;  3LST A;  1J9I A;  1T2K A;  5F27 A;  5EEG A;  1YO5 C;  5EG0 B;  2HVS A;  2A6E F;  3M1E A;  1RR7 A;  2JQ7 A;  4CCL A;  5F1R A;  2G7U A;  1U9N A;  2K9N A;  1OYI A;  1IN6 A;  4L0Z B;  2XB0 X;  1W7P D;  1IN8 A;  3LFU A;  1Z0X A;  5H2F C;  3IKT A;  4A3E J;  2ZFW A;  1OCC H;  5K7Z A;  1BW5 A;  1W36 C;  2HYG D;  2L4A A;  2LVS A;  2HOS A;  4G8X A;  1LQ1 A;  2MG4 A;  4LIU A;  1ZR4 A;  3B6C A;  3K7A J;  4CH7 A;  3W2A A;  5FRN A;  4LMY A;  3BG7 A;  4HF0 A;  2PN6 A;  1FY7 A;  3JRG A;  2DU9 A;  1ZQ3 P;  1XDS A;  5E20 A;  1Z6T A;  4U0W A;  3HOX J;  3QOD A;  1FC3 A;  3J7A O;  1HA8 A;  5L3B A;  2Z5U A;  3KIO A;  3IRQ A;  1OCT C;  2K02 A;  2CV1 A;  4UVB A;  1LEB A;  1G4D A;  1QO0 D;  3TW7 A;  1R1V A;  1IGN A;  2EFW A;  4WWC A;  1JT0 A;  2IT0 A;  1DU0 A;  3ONQ A;  1BI2 A;  1PUE E;  5B66 C;  2H8R A;  2FBH A;  1YW7 A;  4LLL A;  3OOU A;  1P92 A;  2Z33 A;  4EJT A;  3IH4 A;  3I3L A;  5F0H A;  1MH4 A;  4X0G A;  3JTH A;  3PL8 A;  3HTS B;  4OMZ A;  4F7Z A;  1MNM C;  2XF5 A;  2OUM A;  4ANJ A;  1D8K A;  4KFC A;  3V7C A;  1I39 A;  2V1D A;  2ZXI A;  3OIO A;  4IHY A;  3DPU A;  3E5U A;  3DEU A;  4EGZ A;  1U8B A;  1V5G A;  1Y6I A;  2TDX A;  1IJW C;  4I7H A;  4XLH A;  3ASN H;  1XDU A;  1OYW A;  1LFP A;  4GCV A;  3SXY A;  3MWM A;  4HX4 A;  3H5N A;  1LJ9 A;  1Z7L A;  2HKX A;  1MJB A;  3CUQ C;  1OKR A;  1ZLK A;  2M7A A;  4S05 A;  2HGC A;  1WFX A;  4C3I J;  1MBG A;  5CVU A;  1KZH A;  3DU6 A;  1MMN A;  2V6C A;  4A0Y A;  2DOE A;  4HQM A;  4FET A;  2E2J J;  1MJ9 A;  2D1H A;  1VQ4 I;  2D2W A;  2LY9 A;  1E3O C;  1EH6 A;  1X4O A;  2MLG A;  4P9F A;  2VKE A;  3J81 Z;  2XAJ A;  5M3F J;  3AG1 H;  4F3Q A;  3LSH A;  3LFK A;  4XLC A;  3R4K A;  3U1K A;  3ZXS A;  4E7S A;  5LRS A;  3G4S I;  3B6A A;  3DLL F;  1HBX G;  2E19 A;  4IPA A;  3OL4 A;  4CZZ A;  3GTP J;  3WTV C;  2O03 A;  4EMS A;  2OBP A;  3TP3 A;  3WG7 H;  1MMG A;  1U78 A;  1C0W A;  3PSF A;  3GBG A;  4A12 A;  1QU3 A;  3WTY C;  1R5G A;  1FIP A;  3V7R A;  4D1Q A;  1ODD A;  1MNE A;  1DUX C;  1I50 J;  1DPU A;  1J2X A;  3I56 I;  3ZMD A;  4MFE A;  3UR3 C;  1UCR A;  2FNA A;  2L7M P;  3BLY A;  3TDZ C;  4DW6 A;  4HV5 A;  4XKC A;  4LFU A;  1D1C A;  3DEE A;  1MBE A;  5ICE A;  1FX7 A;  1PJR A;  1QPI A;  3DKW A;  2CQK A;  1Z3X A;  2PEX A;  4RMN A;  2LBF B;  3TQN A;  2L0K A;  2VXZ A;  4AUX A;  1NK2 P;  2LD5 A;  3VB2 A;  5CQE A;  4HSR A;  1XGO A;  2F5E A;  3LSK A;  4PJ0 C;  4P55 A;  4A3J J;  2ZO4 A;  3S16 J;  1YFH A;  2CRG A;  2VKH A;  1OLT A;  3P7N A;  5E3O A;  1JTX A;  3U21 A;  2EFQ A;  4CXF A;  1WHU A;  2HTJ A;  1IRX A;  3TED A;  2BW3 A;  1B72 A;  5BMZ A;  4AIK A;  1BL0 A;  3HOY J;  2E7W A;  3DBL B;  2K4B A;  1SVO A;  2HOA A;  1TWC J;  2F6C A;  1AKH B;  1XSX A;  1H8A C;  2Q2E A;  1ETW A;  1OR7 A;  1P4A A;  1NK3 P;  1TC3 C;  2XRO A;  1LE8 B;  3DTE A;  4IQ4 A;  1J5Y A;  3M3Y J;  1T08 B;  1BI0 A;  2CU7 A;  3FXJ A;  2BY2 A;  2XAF A;  4UV9 A;  1A6I A;  4XN3 A;  3ERE D;  1D0Y A;  4BXU A;  5IOY A;  2VQL A;  4IKF A;  3FMS A;  1W5S A;  3OS2 A;  3IP4 B;  2JPC A;  3ZN1 A;  4YIR X;  4NDL A;  1NH3 A;  1YW8 A;  3K69 A;  3VYT B;  3OR2 C;  3G1L A;  3BP8 A;  2VBY A;  5HS8 A;  4NQW A;  2CV2 A;  1K7A A;  1L3L A;  3CCS I;  4C2T A;  4JQF A;  3ML6 A;  4A6E A;  5EJC A;  1QHG A;  2EWN A;  1FIA A;  4OAZ A;  3IWF A;  1B8I A;  1OR7 C;  2LSO A;  3GX4 X;  4YRV A;  5E1X A;  1ZG1 A;  4HOB A;  2HPM A;  2R92 J;  1PDN C;  2ZXJ A;  1Q1V A;  1WKM A;  2CV0 A;  1UHS A;  1YIO A;  3KEQ A;  4ABZ A;  3SFI A;  2XC7 A;  3CUO A;  1SC7 A;  2P7C B;  4U7D A;  3O2P E;  4M9S A;  1HKS A;  3TO9 A;  3GTO J;  2PMZ N;  3WOD F;  2V4J C;  2E1N A;  3T0Y A;  1YJ9 I;  1RET A;  3NEU A;  3SZP A;  3DXJ F;  4U88 A;  5B3S H;  3LA2 A;  2XAQ A;  5HOO A;  3KP6 A;  2AXT C;  2MA3 A;  5ICC A;  1VQ8 I;  1MMS A;  3SQN A;  4LB5 A;  1ZGA A;  1TW3 A;  1FJL A;  2QEX I;  3JSP A;  1K4T A;  3FBI B;  3BCA A;  1B9M A;  1G2H A;  3I58 A;  3OMY A;  2BE5 F;  3CCE I;  1D8J A;  3Q0V A;  4NC6 A;  3SFZ A;  4HST A;  1WGX A;  3FXL A;  1N78 A;  3SHF A;  1R71 A;  2YPR A;  2VBW A;  3S15 J;  2DA3 A;  3MN2 A;  3JAM Z;  4F93 B;  1VND A;  5A2Q Z;  3AL0 C;  3L2C A;  5H6R A;  2P4W A;  5ED4 A;  1ZH5 A;  2X51 A;  4BS9 A;  2DA7 A;  3CDH A;  3KP2 A;  1ZG3 A;  3IV5 A;  1A04 A;  4AIJ A;  5ICF A;  4XBF A;  3I5U A;  4BYY A;  2CGP A;  2VPL A;  3PIO F;  2MAB A;  2ECB A;  1ORK A;  2DFF A;  1XPX A;  1ZKG A;  2M4G A;  3IKV A;  1RIO H;  2FU4 A;  5JR3 A;  3OYE A;  1XN7 A;  5GAG J;  2A6H F;  1UG0 A;  4A3G J;  5TIS C;  1JKO C;  3F8C A;  2FML A;  5CVI A;  1Z77 A;  2E1M B;  5ERI A;  5D8K B;  2QQA A;  4XKW A;  4HPQ A;  3GWZ A;  1JT6 A;  5C4J J;  3N4M A;  4RGX A;  4RDU A;  4Y4R A;  3LA3 A;  1U3E M;  2RQQ A;  2M34 A;  5JLX A;  1FSE A;  5KAI C;  2LF8 A;  3OYA A;  3RDI A;  3S32 A;  1UZC A;  2EQR A;  2DK8 A;  2IGK A;  4ZYA A;  2H1K A;  1RES A;  3K2Z A;  3HKZ A;  2R3S A;  1MKM A;  4XK4 A;  3VDX A;  2GIV A;  1HLV A;  3A03 A;  1JKQ C;  1SVL A;  2ID6 A;  2QF7 A;  5LRR A;  3GZN B;  3HPG A;  5ILV A;  2DW4 A;  1R9T J;  4LD5 A;  3M1C A;  2KPM A;  3BTJ A;  1MIJ A;  2HZT A;  4KJZ A;  5DM7 F;  2ZJQ F;  1EH8 A;  3I59 B;  2Z1D A;  1YX3 A;  2HTS A;  4ZYE A;  2E34 A;  4I01 A;  2ME6 A;  1KQ9 A;  3H5A A;  3I0T A;  3RI4 A;  1YE9 A;  2QZ8 A;  2DA4 A;  2ZKZ A;  1YS6 A;  3GW2 A;  4BL0 B;  1VTN C;  2NOJ B;  4KMF A;  3C2H A;  2Y31 A;  4CUG A;  2RAE A;  1T56 A;  5CKT A;  5EG0 A;  2DMU A;  3HGY A;  4XRS A;  2M0M A;  3TBI A;  3SEQ A;  1IW7 F;  3HJE A;  4L9N A;  1RC9 A;  3FXM A;  2EZL A;  1GXQ A;  5CVV A;  3FK7 A;  4KIF A;  3X2Q H;  1UST A;  2DYR H;  3FXR A;  2OTJ I;  4XLE A;  3QU6 A;  4D0P A;  1DGW Y;  2IEK A;  2LTP A;  1FTT A;  1R22 A;  2XHK A;  1BR4 A;  1VZ0 A;  3GFJ A;  3EYY A;  1HQC A;  2XV4 S;  3A01 B;  2FOK A;  2CW0 F;  3T1B A;  4YEL A;  4Z2Y A;  1CF7 B;  3J7Z I;  5D4R A;  2Q8K A;  4OWR B;  1VQN I;  1IRZ A;  1OCO H;  4FX0 A;  5HDK A;  2XGE A;  4ITV A;  2E71 A;  3CDL A;  3R61 A;  4L9J A;  3TKY A;  4Y15 A;  1SFU A;  2HOT A;  1PP8 F;  1KQ0 A;  2GXG A;  3VSK A;  3S1R J;  2L9N A;  4BU2 A;  2RDP A;  2LMD A;  1B1B A;  4B48 A;  4PSX A;  2MFZ A;  1H0M A;  3F3X A;  2GWR A;  4XOT A;  3BG3 A;  4E6K G;  3MEX A;  5FLM J;  2A69 F;  2VE9 A;  2JA7 J;  3ZMT A;  1AWC A;  2XAH A;  1QVT A;  4IJA A;  1OCP A;  1W7P B;  1PUF B;  4XN0 A;  3RKY A;  4B1R A;  5JVG F;  1OJL A;  3I4M J;  2R5Y A;  2F4M B;  3HBL A;  5E3N A;  2HQN A;  4BQO A;  1S8N A;  5HVQ C;  2DA5 A;  2CFO A;  4ZC3 A;  1GLN A;  3ELK A;  1XGS A;  4FTH A;  4P1W A;  2J5P A;  3GME A;  3F8B A;  4M6X A;  1ZTR A;  3CES A;  4G94 A;  4DIQ A;  4RAG A;  4M71 A;  3WTU C;  2FE3 A;  4U0Y A;  3K6G A;  1ETX A;  3WGG A;  2PJP A;  2DLL A;  2O6G E;  1TWF J;  4XNF A;  3R60 A;  1JUM A;  2CQX A;  4DYR A;  3RCO A;  3OS0 A;  2VBX A;  3RPU A;  3NQO A;  3L7W A;  4CCJ A;  3P9I A;  1UJ8 A;  2QBY B;  3KEO A;  3E5X A;  2JMW A;  4PGG A;  5BPI A;  3PQJ A;  5GPC A;  3ZPL A;  3CCQ I;  2EPF A;  1S29 A;  3IC7 A;  3OYN A;  2EBI A;  5FRO A;  1M1E B;  2DDB A;  2RKH A;  3N05 A;  4A3K J;  1XSV A;  3U2R A;  5B5E C;  1FT9 A;  2H6C A;  2JUC A;  3W3C A;  2KIF A;  3KX2 A;  2VUM J;  3SYT A;  3H9G A;  3GFL A;  3ZR8 X;  4ESF A;  2OCC H;  2YUS A;  3BT9 A;  4MIM A;  3TP0 A;  1FEX A;  4FIS A;  1ZK8 A;  3MD2 A;  2QQB A;  4E7H A;  2DFH A;  2KRF A;  4NB5 A;  2HOE A;  2ZB9 A;  2DMN A;  4A3L J;  5JHU A;  5K7H A;  5GAD J;  4BQN A;  3QQA A;  3KYD B;  4IZZ A;  3QOP A;  3CF2 A;  2GAU A;  1ZN2 A;  2HU9 A;  1F1Z A;  3M07 A;  2LBF A;  1R36 A;  3HYI A;  2D5V A;  1Y56 A;  1ZR2 A;  3ZQI A;  2BVM A;  3CD6 I;  1P6R A;  4EM1 A;  2K3F A;  2DOA A;  3EDP A;  1G3W A;  5CVR A;  1DGR M;  4ZZL A;  2VKV A;  4EV0 A;  1J0R A;  4M9X A;  2DDA A;  3WTW C;  1X2N A;  1S7O A;  1VI0 A;  3J7Y J;  3JSO A;  2JRM A;  3H3V K;  2M4K A;  5M3M J;  2F48 A;  5LFA A;  4IHW A;  2EZI A;  1JKP C;  1OMI A;  1Z6R A;  2NAZ A;  3BTL A;  2KJC A;  2KZV A;  3OR1 C;  4PK4 A;  2O8K A;  2AXL A;  2KHM A;  4F52 A;  2KP6 A;  1AKH A;  4GDF A;  3IRR A;  1U8R A;  2HNH A;  3GTG J;  1EJ9 A;  5IP9 J;  1WJD A;  4LGW A;  4KNY A;  2M2E A;  3R6S A;  4D5F A;  1YOV B;  4M9Z A;  4GFB A;  1BA5 A;  1STZ A;  4MQV A;  1L0O C;  2BXY A;  1LDK B;  3K4J A;  1PVE A;  4L18 B;  2P6T A;  4BDY A;  2L7Z A;  2X6Y A;  1XB4 A;  4UXN A;  1LDJ A;  1SFX A;  4AID A;  1H9G A;  2CQN A;  2KIQ A;  2LKS A;  2DMP A;  2WA0 A;  5HLH A;  1TNS A;  3NRV A;  2FX0 A;  3K0L A;  3FF5 A;  3CLQ A;  4QLC U;  3MKZ A;  1KU9 A;  5L3E A;  2R7Q A;  4B43 A;  3VYU B;  1MD0 A;  1GT0 C;  5LHI A;  4E7K A;  2YU3 A;  1ZHF A;  1X58 A;  2MD0 A;  3EPZ A;  1YJW I;  4WXC A;  2CUJ A;  3WE3 A;  3TW6 A;  4LOC A;  4WK8 F;  2B7E A;  3MKW B;  2GLO A;  4L5I A;  4ZTF A;  1HW5 A;  1DDN A;  3E0J B;  2CG4 A;  4J01 A;  4F55 A;  3CTA A;  5CVJ A;  3F6V A;  2HS5 A;  1VQK I;  3SDB A;  1OIS A;  1GVJ A;  3T5X A;  4XON A;  3PFY A;  2K5C A;  4IEJ A;  1T0F A;  4N9H A;  2DA6 A;  1FWZ A;  3OSG A;  1RZ4 A;  1QGP A;  2JK3 A;  4RS8 A;  4BJT A;  2X1C A;  4L5E A;  3FDY A;  4V2G A;  4BEH A;  2IS1 A;  3F8M A;  1B6A A;  4UUT A;  4KIG A;  1R6R A;  2DYS H;  2F4I A;  2XF6 A;  2OC6 A;  2H1L A;  2QYO A;  3G73 A;  3D0S A;  4ZYD A;  5IT9 Z;  3BG6 A;  3CJR B;  1JXS A;  2H6B A;  5M5Y J;  2BBY A;  3GVA A;  2RNG A;  5D5U B;  1IUF A;  3G71 I;  4MNU A;  1X3Z B;  4I76 A;  1Y0N A;  2IP2 A;  2Y48 A;  3BJ6 A;  3EYI A;  3JR9 A;  1S7E A;  3OYI A;  1K61 A;  1HXD A;  2M1B A;  1SD5 A;  5CLS A;  1HSJ A;  4BH9 A;  1SMT A;  4HNU A;  2V9K A;  2IVM A;  4BBS J;  3QPT A;  3QYE A;  4IXA A;  4ZDL A;  2K9Q A;  2P5K A;  4DYQ A;  3GTJ J;  3K2A A;  3Q0W A;  2VBZ A;  5EGO B;  4IL6 C;  4E4H A;  3PJR A;  1R1U A;  4KMU X;  5DTD A;  2E60 A;  2MC4 A;  2A68 F;  3ZQL A;  3WTX C;  5FLX Z;  3OYB A;  2V79 A;  2DO7 A;  2HR3 A;  3CCY A;  2QVO A;  1G3Y A;  2P7V B;  3RZO J;  3JRE A;  2VOO A;  1U2W A;  3QAH A;  4RAF A;  3CCJ I;  2LH9 A;  3P9K A;  5K5R A;  2V9V A;  1GXP A;  4II2 A;  3ECH A;  1WJE A;  1BIB A;  3IAM 2;  4IO9 F;  3VFZ A;  3U9G A;  2E2I J;  4B09 A;  1IXS B;  6PAX A;  3GFI A;  1HST A;  5CQG A;  2ELH A;  1Z9C A;  3OYM A;  2DT7 B;  9ANT A;  1MDM B;  1VQP I;  1ZAR A;  1S7A A;  3QU3 A;  2XAS A;  3ABK H;  5E18 F;  1ZYR F;  1ETY A;  3QPH A;  2STW A;  2Y0S A;  3PNT A;  1H89 C;  3KLN A;  1JUS A;  3M8E A;  2ZJP F;  1AA7 A;  1J09 A;  1MSF C;  1KON A;  2E2H J;  2JPB A;  3HRS A;  3L2R A;  5CPR B;  3HSR A;  3MCZ A;  1YJN I;  5L3G A;  1WZ2 A;  2R7D A;  1MND A;  2WV1 A;  3PO2 J;  3S17 J;  3V4G A;  2WB1 N;  2IJL A;  3L00 A;  3OIP A;  5KHD A;  1F36 A;  1U5T B;  3R0J A;  2AQE A;  4HDU A;  2JJ7 A;  5B1A H;  1ZLJ A;  5IYC J;  1P2F A;  3UKG A;  2K9L A;  3RKQ A;  2FQ4 A;  4XSX F;  3W2V A;  3RQ4 A;  1JUP A;  1GV5 A;  2GM4 A;  4PGH A;  2R5Z B;  1ACI A;  4LB6 B;  4W97 A;  2L01 A;  2EV5 A;  2K9M A;  3GTQ J;  2XKP A;  4M3D A;  4ZYG A;  2FA5 A;  4Y52 J;  1R7J A;  4QSH A;  4OAY A;  3W2W A;  1ENH A;  3GFM A;  3KYL A;  4YII A;  4I2O A;  2LY2 A;  2PBI A;  5DM6 F;  1UEL B;  2ZME B;  1E2X A;  4WF2 A;  4B47 A;  1ERD A;  1TQM A;  2QSF X;  3HUG B;  2LRD A;  2MLK A;  5J1Y A;  4EM2 A;  3A01 A;  1IRG A;  1F43 A;  1OPC A;  2KT0 A;  2CMP A;  3DCF A;  2EFN A;  3QOE A;  4LG0 B;  1VQ6 I;  3RYP A;  2VC0 A;  1CF7 A;  1FBS A;  1UHW A;  3M8F A;  4U0V A;  2JWT A;  1X2M A;  2WY8 Q;  5FGM A;  5F64 A;  4IHV A;  1ITY A;  2DN0 A;  2DPD A;  2DAO A;  1BN5 A;  2F4O B;  5FKL A;  4M3B A;  4Q47 A;  4OIQ F;  1TLH B;  1WI3 A;  3ZGK A;  4WXH A;  1R4M B;  3F6O A;  4C3H J;  3MKY B;  2VIX A;  5HS9 A;  2FBI A;  2BYV E;  3HRU A;  4N0B A;  1LKX A;  4PCQ A;  1NHA A;  2XUB A;  3HOU J;  4BHB A;  4JOM A;  3BR1 A;  4IQJ A;  3CJT B;  2L5Q A;  1NG7 A;  2M0C A;  4IOC F;  1YW9 A;  4EEF G;  2QLZ A;  1XMA A;  3QRF F;  5J3L A;  3IHU A;  1D5V A;  3ZQF A;  1W7P A;  4V19 K;  2ZSI B;  3F9K A;  4CCM A;  4XKV A;  3FMQ A;  2CYY A;  3RIR A;  4GGG A;  4EJW A;  2ZNY A;  2LR8 A;  2BY0 A;  1JJ6 C;  2WAF A;  3JRC A;  1FBQ A;  3FXQ A;  2KMU A;  2XGD A;  1MMD A;  5D5W B;  4KDP A;  5F6F A;  4EGY A;  1Z7U A;  4FHT A;  3CMY A;  2FJ1 A;  4GO1 A;  2Z99 A;  4PJM A;  2GOX B;  3OOP A;  2G9W A;  1IUY A;  4A5N A;  1QZZ A;  3F22 A;  4JK1 X;  4X1E A;  5DYM A;  1PYV A;  3V8K A;  1LEA A;  1T98 A;  3VYS B;  4ESB A;  3BPX A;  5KK1 A;  3FWE A;  1FSH A;  2HEO A;  2QBY A;  4CZC A;  1ETV A;  2ID3 A;  3E5Q A;  2ADU A;  2NVQ J;  5HDG A;  5FD6 A;  3P9C A;  4IHT A;  3KE2 A;  1K4S A;  1T6S A;  3ECO A;  5DUI A;  2XB5 A;  1YIJ I;  1AOY A;  3DQV C;  1WJB A;  2JVG A;  5JI6 A;  3GTL J;  1BM9 A;  1FOW A;  1YX5 A;  1E17 A;  4Q4Z F;  2LKX A;  4G7H F;  5DUK A;  3W6V A;  4A2U A;  2L2O A;  2Z9O A;  3DP7 A;  5TJJ A;  2LLK A;  3DWL E;  3OYD A;  2PJR B;  4ENJ A;  3DTK A;  2M30 A;  4PFO A;  4BY7 J;  4I02 A;  4QWQ A;  2KJB A;  3LSR A;  4XRF A;  5D8L B;  1UG2 A;  3LMM A;  3Q9V A;  1IXR C;  1K83 J;  2N8G A;  4KN7 X;  3S14 J;  4Q48 A;  5FJ8 J;  1IZ1 A;  2X4H A;  4IRI A;  1S72 I;  1KU3 A;  4RLQ A;  1BI1 A;  3K4K A;  5IYD J;  2AS5 F;  3I54 A;  5DCM A;  3FIW A;  5EF6 A;  3E97 A;  4RM2 A;  5JVT A;  2DCE A;  4RGU A;  1FLI A;  2P6S A;  5D6E A;  1MZB A;  2HVQ A;  1TWA J;  3DEW A;  4NC7 A;  1BR2 A;  3J80 K;  2X6X A;  4O3M A;  1E3H A;  1I27 A;  1XG1 A;  4DJA A;  3C7J A;  1W0U A;  2KKO A;  2HZD A;  5EZH A;  3WGI A;  3HC7 A;  1I1G A;  1ON2 A;  2R7W A;  1YRN A;  1MBJ A;  2MBF A;  1O57 A;  4L5J A;  3RSN A;  3EUH A;  2NS0 A;  2EA2 A;  1WPK A;  3H1C A;  1K78 A;  3MKL A;  5ICG A;  3IL2 A;  2YU9 J;  4RA2 A;  1I5Z A;  1XMX A;  1SD4 A;  4IHX A;  3ZMZ A;  1LFU P;  2ESN A;  3WG9 A;  3HOV J;  5DS9 A;  1O7L A;  3G3Z A;  1F9N A;  2Z3Y A;  4A93 J;  2PFB A;  2X1E A;  1V54 H;  3IAS 2;  1VQL I;  2NVX J;  2DT5 A;  2ZFU A;  1YQA A;  3O3K A;  5F08 A;  3D1N I;  4PJL A;  3D5L A;  2FRH A;  1D0X A;  3PUF A;  2Z16 A;  4HLX A;  3HSF A;  3EUH C;  3GLX A;  3K9T A;  4ZJZ A;  1TT5 B;  3GO5 A;  3CO6 C;  4CO8 A;  4I0A A;  3WU1 B;  1R00 A;  5HS7 A;  5GAE J;  2A07 F;  1X3U A;  1JHF A;  2LY1 A;  3L2U A;  3BZ6 A;  2NNY A;  3H35 A;  1IC8 A;  1D1A A;  2CS3 A;  3OSF A;  5FRM A;  3ZN0 A;  2X1D A;  3MFK A;  3BQZ A;  2JVH A;  3FHN A;  3PFI A;  2OAZ A;  4P96 A;  1SEU A;  1ETQ A;  3G1M A;  5HOD A;  2P8T A;  2FQ3 A;  4A3B J;  2HQA A;  3BY6 A;  2XKO A;  3S93 A;  3OYK A;  1ETK A;  4RLF A;  5H20 A;  3CO7 C;  4X6A J;  3AFH A;  5F04 A;  3OYF A;  4Y33 A;  1X1D A;  3GLL A;  2FUG 2;  4XLP F;  3LAJ A;  2UV1 A;  5CYV A;  1T38 A;  2M5W A;  2VJ5 A;  3FHZ A;  1RPW A;  2I5U A;  3GZ5 A;  1IO2 A;  3HOW J;  1OCR H;  1XC5 A;  1KGS A;  1LNW A;  4A0X A;  3B73 A;  2NS7 A;  4AVZ A;  1W5C C;  2L7K A;  2PG4 A;  1KA8 A;  4MTD A;  4BAY A;  2BZT A;  3RPU D;  2C6Y A;  2Y9Y A;  2Y0M A;  1Z3Y A;  2L9S A;  4A6D A;  2MSY A;  4H0E A;  4AYB A;  3S3N A;  3CUQ B;  2R7Z J;  3F21 A;  4II3 A;  3RKX A;  2VAS A;  4N4N B;  3S2W A;  4ASN A;  1WJC A;  2G7H A;  3H3U A;  3L1P A;  5HNF A;  4PUS A;  4MEX F;  3HZJ A;  2QCO A;  1IF1 A;  5ILU A;  4I0B A;  2P0W A;  3E1S A;  2NVT J;  1BOA A;  5K7F A;  1QVU A;  2E5N A;  4G6Q A;  4KIC A;  5DCF A;  5H6Q A;  1P4X A;  4KIB A;  1CQT A;  2Q0O A;  5LGT A;  4A3I J;  2E1C A;  2DFI A;  2KDO A;  5GAH J;  3BRO A;  4ENM A;  2LF7 A;  3J81 K;  1MGT A;  5EGO A;  2EIN H;  4M3E A;  3DPT A;  2R7R A;  2L9R A;  3NWS A;  1JE8 A;  4G12 A;  2GBY A;  4CYC B;  1J7K A;  3E6D A;  5E8I A;  4RB1 A;  3I71 A;  1R23 A;  3KP7 A;  5FO5 A;  4OU0 A;  3ABU A;  3UNG C;  5BNG A;  1OQY A;  4A5M A;  1XX5 A;  1ULY A;  4E7Z A;  5KNL A;  5BPD A;  3TO6 A;  1FP1 D;  2ICW G;  2ME0 A;  1BOB A;  2QQ9 A;  4DYC A;  4EJO A;  4DBR A;  4QIW N;  1QZE A;  1TZL A;  3M4O J;  4BQA A;  4HF1 A;  4EJV A;  1Z05 A;  4XMY A;  4EQQ A;  1MDM A;  2EH3 A;  5LGN A;  2D1V A;  3ZMU A;  1EV7 A;  3IUO A;  1KYW A;  2TRT A;  3LSI A;  4M6V A;  2K7L A;  4BBR J;  1FOK A;  3OV8 A;  5FKM A;  2V1U A;  2VON A;  3H0G J;  2PLY A;  2IAI A;  1S6L A;  4GYI A;  3LOC A;  1IN5 A;  2H94 A;  5IY5 H;  3AKZ A;  2E5Z A;  1TP4 A;  1OCZ H;  2FMY A;  5FB2 A;  2MW8 A;  2VXD A;  3CCR I;  4NC8 A;  4PSW A;  2QWW A;  4UUS B;  2NRA C;  1KYZ A;  2W7N A;  3LQQ A;  1VQ5 I;  3ULQ B;  5J47 A;  2WC2 A;  3AAF A;  2DJN A;  4B4C A;  3ZOB A;  2X85 A;  3BR3 A;  2NYX A;  3KZI C;  3Q9S A;  5LHH A;  3E6M A;  2LNB A;  3GCM A;  2BVL A;  2GZW A;  5L3F A;  3PNY A;  2VE8 A;  2E7X A;  4HX8 A;  2VT3 A;  1OFC X;  3PM1 A;  2E1O A;  2BW3 B;  1HOM A;  4HDV A;  3LA7 A;  4ENK A;  1JJ8 C;  4A3F J;  2OQR A;  2LKP A;  3DF8 A;  5EZG A;  2P5L C;  5K1Y A;  1Y0U A;  2UWM A;  3OYL A;  1YYV A;  3JCU C;  4D9J A;  3DTI A;  2RN7 A;  3HUG A;  2NOG A;  3BZC A;  1VQ7 I;  3VWB A;  2XSD C;  3E3V A;  2WAQ A;  3ZQ7 A;  3HKZ N;  2VQH A;  4RM3 A;  2YX7 A;  3FZV A;  1T39 A;  1A31 A;  3K1N A;  4WX9 A;  3K4N A;  4BQQ A;  2FF4 A;  2J5O A;  3TMO A;  1XTA A;  3GF2 A;  4KT5 C;  1P9Q C;  1X1A A;  4P9U A;  2DOD A;  2KDZ A;  4C30 A;  4R79 A;  2K27 A;  2BGC A;  5D5V B;  5KCM A;  3SJM A;  5J40 A;  2UZK A;  1SVM A;  5E1Z B;  3HIF A;  4PDK A;  5JLW A;  3FKJ A;  3RTR A;  2HFH A;  1FZP B;  2HWV A;  5FKO A;  3CJN A;  2FXA A;  4XSZ F;  2DBB A;  1W36 D;  4NQW B;  3EUA A;  3CME I;  1SAU A;  3ZP5 A;  4F91 B;  4H4K C;  4R8H A;  1B8I B;  1FOY A;  2I8D A;  1GDT A;  3KP4 A;  2O61 A;  1OYY A;  5C4X J;  1XS9 A;  2KL4 A;  1DQU A;  1RUN A;  1F5T A;  1JTY A;  4OIP F;  1V55 H;  2LOO A;  4GXO A;  2M8E A;  4IX7 A;  3R0A A;  3JW4 A;  2OJE D;  1HW1 A;  4MEY F;  5DDG A;  2OCE A;  3B02 A;  5F1J A;  2W4S A;  3BR6 A;  4BGD A;  1Y1V J;  1IN7 A;  4XL9 A;  3AL0 B;  4DNC A;  1WSU A;  2QA4 I;  1SFK A;  1D3Y A;  2H09 A;  3L9F A;  3GEZ A;  1RRJ A;  2FNP A;  4L0Y B;  1S3J A;  4HNV A;  1VQM I;  2B63 J;  4QTR A;  3LSM A;  1QHH D;  3JAM K;  3DU5 A;  4CGZ A;  3BJA A;  5A2Q K;  2I10 A;  2F5V A;  4HBL A;  1WJ5 A;  1TNT A;  3W6K B;  2W57 A;  3T8T A;  3AG2 H;  4GYG A;  1LE8 A;  5J4Y A;  3HSE A;  2M87 A;  4U87 A;  3H3Z A;  4UUV A;  1XSD A;  3VPR A;  4LK1 F;  1SFE A;  3GUD A;  4YIF A;  1S5L C;  5E17 F;  3ISP A;  3D5R C;  3H9J A;  1WVR A;  3WTT C;  4HF2 A;  1H88 C;  3F23 A;  1IV6 A;  2P5V A;  3FXO A;  3ZQH A;  1YHQ I;  3OL3 A;  1I1S A;  3JRH A;  5C44 J;  3P5J A;  4A0Z A;  3PQK A;  3GTK J;  2O0Y A;  4ZDO A;  1UAA A;  1Z91 A;  3ERM A;  3TOB A;  2CSO A;  3A1Y A;  4C3J J;  4HA8 A;  2Y75 A;  3ABT A;  2PJR A;  2LRE A;  2EIJ H;  4R1H A;  5EEH A;  3BG9 A;  3NAU A;  3O8H A;  3LSG A;  3V42 A;  3AG3 H;  2IGO A;  4I6Z A;  2M9H A;  2RNJ A;  4BDZ A;  3Q0U A;  3TL4 X;  2MC3 A;  4ZH4 F;  1RI7 A;  4YEJ A;  3A02 A;  2VKD A;  4UVC A;  3HEF A;  4BAC A;  1MBH A;  2DJI A;  4O5V A;  2VI6 A;  2X6O A;  5HLG A;  3C18 A;  4YFK F;  1T8I A;  2UXN A;  1WWX A;  5FFZ A;  3CP2 A;  2KZG A;  1MBK A;  2EIM H;  5ILS A;  2QSG X;  3A2K A;  4M72 A;  5IPA A;  2M8G X;  2FSW A;  2BHY A;  4CHU A;  3NAR A;  4JX5 A;  3MQ0 A;  4DQ2 A;  2IXS A;  5HLT A; 
#chains in the Genus database with same CATH homology
 5GAH J;  3CC4 I;  4IOA F;  5GAG J;  3CME I;  1VQO I;  1FOY A;  3CJT B;  1VQL I;  4IOC F;  3CC7 I;  3CCJ I;  2NXN B;  2E35 A;  2OTL I;  2ZJR F;  5JVG F;  4V19 K;  4IO9 F;  1QA6 A;  2QA4 I;  1VQP I;  5GAE J;  3CMA I;  2E36 A;  1VQM I;  1HC8 A;  3I55 I;  3CCM I;  3CCS I;  3CCU I;  2ZJP F;  1VQ9 I;  5DM7 F;  2ZJQ F;  1VQ4 I;  1YJN I;  1Y39 A;  4UY8 I;  3CCQ I;  3CCR I;  2E34 A;  1YJW I;  1YHQ I;  3G4S I;  1YJ9 I;  3DLL F;  1VQ5 I;  1YIJ I;  2H8W A;  1FOW A;  3CCV I;  1VQ8 I;  1MMS A;  1ACI A;  3G6E I;  2JQ7 A;  3CF5 F;  3CC2 I;  1VQK I;  2QEX I;  3I56 I;  3CCE I;  1YIT I;  2FOW A;  1S72 I;  5GAD J;  5DM6 F;  2OTJ I;  3CCL I;  1YI2 I;  1VQ7 I;  3CD6 I;  1VQ6 I;  2K3F A;  3J7Z I;  3G71 I;  1VQN I;  1FOX A;  3J7Y J;  3PIO F;  3PIP F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...