2IRFG

Crystal structure of an irf-2/dna complex.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
109
structure length
109
Chain Sequence
RMRMRPWLEEQINSNTIPGLKWLNKEKKIFQIPWMHAARHGWDVEKDAPLFRNWAIHTGKHQPGIDKPDPKTWKANFRCAMNSLPDIEEVKDRSIKKGNNAFRVYRMLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an IRF-DNA complex reveals novel DNA recognition and cooperative binding to a tandem repeat of core sequences.
pubmed doi rcsb
source organism Mus musculus
molecule tags Gene regulation/dna
molecule keywords DNA (5'-D(P*AP*AP*GP*TP*GP*AP*AP*AP*GP*(5IU)P*GP*A)-3')
total genus 30
structure length 109
sequence length 109
chains with identical sequence H, I, J, K, L
ec nomenclature
pdb deposition date 1999-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00605 IRF Interferon regulatory factor transcription factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2irfG00
2HOEA 4XLNF 3VFZA 1UCRA 1UHWA 1S3JA 2FBHA 2H6CA 1U78A 4YFXF 1O3QA 1IRGA 4CO8A 4UXNA 3G3ZA 2WWYA 1S29A 5BMZA 3BPXA 4JQFA 1LDDA 3QPHA 1K78A 1S7AA 4A6EA 3ZN1A 2COMA 4S05A 2PMHA 3FMQA 4HX7A 2D45A 3VB2A 2EV6A 2CQKA 3HSEA 2HYFA 3DF8A 4GYGA 3WE2A 2J5OA 1U3EM 4N9IA 3TO6A 3MZYA 2Z99A 4KIBA 3HHGA 4L5IA 1HKTA 4TV7A 2XVCA 5FD6A 3E97A 4CXFA 4DQ2A 1PDNC 3QRFF 1DDNA 1W7PB 2ZNYA 3QU3A 4RB0A 2O8XA 5FFZA 2QQ9A 2KRFA 4UUVA 3GW2A 4MQ9F 3F8BA 2P5LC 3ZP5A 1WQ2A 3EDPA 1CF7A 5HDNA 1OKRA 5HVQC 5JVTA 1BJAA 3JTHA 2FNAA 1STZA 2NAZA 4EM2A 2O3FA 4ASNA 2K4BA 4WXHA 2XV4S 4IHSA 2XROA 4P9FA 1SD6A 1S8NA 2UWMA 5ICFA 3I53A 3RKXA 3I59B 4WXCA 5D6FA 5DD4A 4MTDA 2IA2A 2PEXA 1DPRA 1ZG3A 2MH9A 1CGPA 3WTXC 4UV8A 4B8XA 3HSRA 3QP5A 4EM1A 2O61A 4IRGA 1PP8F 1I6XA 3BJOA 3V7CA 2KKOA 2QLZA 1FYKA 2A6HF 3HHHA 2VOOA 2VT2A 5BPDA 1MDMA 3ZMUA 3E6MA 3N97A 1Z7UA 3F8MA 2AXLA 2ZCWA 1MDMB 2EK5A 3H92A 2EJRA 3DV8A 3GFLA 4U0WA 4P9UA 4LJZF 2JT1A 1LJ9A 3I5UA 4I02A 1RNLA 1FP1D 2A69F 4M9ZA 5F64A 2K4JA 4I2OA 2UXXA 5DCMA 3K2ZA 1MD0A 1KGSA 1HQCA 2ZBKA 1ODDA 2WTEA 2OQRA 4RGRA 4O6JA 3ROUA 2F5EA 3MCZA 1IN4A 2NS0A 2JTVA 1R5GA 1UHMA 2XAHA 1QZZA 4L9NA 3GXOA 3E3VA 3IKTA 1L0OC 4EJWA 3FXQA 3M9AA 2ADUA 3DFGA 4A5NA 1TLHB 1XB4A 1YFHA 1RUOA 3ULQB 1RI7A 1KQ8A 3MZHA 2ZMEB 3LA7A 5HDGA 3LSTA 1GVJA 1GXPA 1ZLKA 2CWEA 5DYMA 4ON0A 5DDGA 1MKMA 4BHCA 2ACJA 4KN7X 2MD5A 2DK5A 1YTYA 2KJBA 3S2WA 2X0LA 4OIRF 4YIFA 3HRTA 5LRSA 1O3TA 1WKMA 4LD5A 5LRRA 2MLKA 2LF8A 3EYYA 5D5UB 1CF7B 5BQTA 2V1DA 2RC4A 2NNYA 4KIFA 4G6DA 4KUMA 5E17F 4Y13A 1QZYA 5E1WA 1QQIA 4OIOF 2CFXA 3BOQA 2A07F 1X3UA 3TOBA 4XRFA 3OOPA 1SFEA 2O03A 5ED4A 1FNNA 2P7CB 3KZZA 2A6EF 4ZYEA 4H0EA 2NRAC 2HDCA 3ZMTA 4FX4A 4LMYA 2K02A 3ML6A 2YX4A 3CJNA 2XHKA 4U0VA 3PFIA 1UB9A 1IW7F 3GZ5A 3WTUC 2PI0A 2JPCA 4YFNF 4KNYA 4BHPA 4MEYF 1FBUA 5ILVA 2DQRA 3PQJA 1BC7C 5DUKA 4HLYA 3CUQA 2HYGD 3Q9SA 1FBQA 3PQKA 3ZMDA 3AAFA 1QNTA 4WCGA 4L9TA 3WTZA 2F5FA 5L3BA 1BM9A 2GZWA 1PUEE 2JSCA 1ZYRF 1K7AA 1U2WA 3CO6C 1H0MA 1J9IA 4IF4A 2Y0MA 4XSXF 2YX7A 2HQRA 2PBIA 3F22A 5FD5A 2WV0A 1ZRCA 3VEPA 1KU7A 3ECOA 4MTEA 4ZZDA 3HUGA 4CDGA 3LAJA 3D0SA 3P7NA 5E1XA 1BOAA 3TKYA 4OIPF 1V4RA 1O7FA 2QM3A 2H09A 2YPRA 5EEHA 2FA5A 3V8JA 4BYYA 3RYRA 3V4GA 2Q2EA 5D8KB 1F5TA 5H20A 1D3YA 2DO7A 1I27A 4HX4A 5AIPA 3MAJA 1T0FA 5K5QA 4Z2YA 4RS8A 1EH6A 1R1VA 3F23A 1QBJA 3BY6A 3E6BA 5DV5A 4BH9A 4DNCA 2PN6A 3FMRA 4ZYDA 5CVUA 1J75A 3IWZA 5E8IA 3F8FA 1W4MA 1WI9A 4G9YA 3W6JB 5FB2A 5E18F 3IKVA 4XLPF 3K9TA 4CZZA 3U2RA 3M8EA 3R0JA 1XSVA 2EFNA 4AIJA 2KIUA 3GFIA 4I0AA 2JPBA 2GIVA 4P55A 4L0ZB 3ZQ7A 1H9TA 1BIBA 3H3ZA 1EV7A 4HBLA 1TNSA 3KEOA 2EA4A 4PDKA 2FEZA 2L4MA 5ILSA 4EM0B 1OR7A 3P9IA 5ICGA 1G3WA 4GGGA 3E6DA 4YG2F 4I09A 5CVRA 3U1DA 3NQOA 5IT9K 3GYHX 3JAMZ 1L3LA 2BV6A 3BJAA 1KU9A 4L0YB 1YIOA 3GWZA 4AIHA 2GWRA 1LDJA 4L18B 5D5VB 3CO7C 5L3EA 1P92A 3FF5A 5BS6A 3R6SA 3F6OA 2ETHA 4UVCA 1IAWA 5EEGA 5CYVA 1TBXA 4HW0A 3WGIA 4BXUA 4UVAA 4RAYA 2HZTA 2CSOA 3SXYA 4EGZA 3LA2A 2Z9OA 4RB2C 3GX4X 2A68F 1JHFA 2E7WA 1SD5A 3ISPA 3TO9A 2RV8A 4HDVA 1K78B 5LLQA 3WU0A 2V1XA 4LLNA 1MZBA 2LF7A 2G7UA 1ZARA 5E20A 2Q8KA 3MQ0A 3F6VA 2M87A 3ABTA 1DPUA 2CGPA 3Q9VA 1E17A 1FBSA 1W7PA 4FT8A 3IL2A 1IN6A 2VOPA 2STWA 1T39A 3H3UA 3HSFA 2ISZA 2P7VB 1AOYA 3JAMK 1JHHA 5A2QK 1OYIA 3ZN0A 3L00A 1HSTA 1FYLA 1Z6RA 2PLYA 1XD7A 2XASA 3B02A 4KMFA 4ENNA 2V9VA 2MC3A 4RB1A 2EA2A 3J81Z 1HSJA 1P2FA 3NEUA 4ENKA 2DW4A 1G3SA 5TRDA 2FQ3A 1A04A 2D1VA 4Q47A 4EJOA 1YW8A 4RAZA 2DI3A 4WK8F 4KN4X 3QAHA 3WTVC 1FP2A 3BDDA 1XDUA 3QU6A 4OOIA 3RTRA 4HF0A 4O3MA 3JTGA 2YU3A 5LHGA 4AD9A 4ENJA 1YS7A 2MH2A 1IXSB 1DUXC 3WODF 3HOSA 4GCVA 1LQ1A 1ZRDA 3QOPA 2BBYA 4NB5A 2L3DA 4M6YA 1B9MA 2Y75A 2IT0A 1SD7A 1USSA 3LAPA 1XMAA 2RNJA 3I54A 1R5HA 1YLFA 2FMLA 2R7DA 2VBYA 2Z33A 2Z3YA 1FC3A 3E6CC 4L5JA 1IXRC 4A5MA 4N0BA 2DTRA 2C6YA 1D8KA 2GXBA 4LG0A 2MLGA 2Z5UA 3K1NA 1REPC 2P4WA 1HW5A 1NHAA 3L2CA 2OZUA 5A2QZ 2XRNA 2TDXA 1EH8A 1J5YA 2M30A 3ERED 4IRIA 3J7AO 3J80K 1F1ZA 3ECHA 2NYXA 1R36A 4IXAA 4HZFA 4GXOA 2QWWA 1W5SA 1FOKA 2PMUA 1G3YA 4HF1A 1W7PD 3R4KA 1DP7P 1XSXA 5CJ9A 2IVMA 4U7DA 1SFUA 3ZMZA 1R22A 1LDKB 3WGGA 5BOXA 4LGWA 2ZKZA 4ESJA 4IRHA 1KA8A 3IC7A 4XBFA 1P4XA 4FHTA 3IRRA 4HF2A 4HLXA 3LWFA 2GXGA 4RGUA 4LB5A 2QENA 4G8XA 2PQ8A 2ZNZA 2EFPA 5FLXZ 3RIRA 4K2EA 4E70A 3FWEA 1ZRFA 5ICEA 2R7FA 2GQQA 1FLIA 5ERIA 3FHZA 3EYIA 3KLNA 3C1DA 4BAYA 1H9GA 3T5XA 4M9SA 2M45A 5K1YA 3F3XA 3F21A 2W25A 4A2UA 4EJVA 4ESFA 2QQAA 4KICA 1OMIA 2XKOA 3R61A 4MNUA 1TQPA 4UNOA 3ABUA 4UV9A 4LLLA 2PJPA 5CLSA 2E1NA 2K7LA 3R60A 2FE3A 5E1ZB 3NRVA 4EGYA 2GAUA 1V3FA 3TQNA 3KLOA 1ZGAA 5HLGA 5K5RA 3T8RA 5DUIA 3CUOA 1XSDA 3FZVA 3FM3A 4M74A 3MFKA 4I0BA 1FX7A 1XGNA 2CW0F 4ETSA 2ELHA 2M8EA 3D5LA 2HFHA 4KIGA 4CYDA 2L01A 2BGCA 1SMYF 3BWGA 4HV6A 2OD5A 1HKQA 1MJBA 2G9WA 2OQGA 4UHTA 1B6AA 1YO5C 3DPLC 1FT9A 1ZHFA 3FM5A 3FXRA 5FO5A 4L9VA 2FRHA 2FF4A 4HQEA 4EV0A 2P5VA 4RB3C 4BHBA 1U5TA 1HW2A 4OIQF 1Z6TA 3EQLF 5D5XB 2IA1A 1OYYA 1BBYA 4KDPA 3WGHA 3KEQA 2Y48A 4OINF 5D8LB 3E5QA 5J8FA 3IRQA 2FNPA 3U9GA 3I59A 3KFWX 1Q1HA 2FOKA 1T2KA 3JW4A 4LK0F 1TQIA 2RVCA 2V1UA 1YS6A 1ONVA 1D8JA 5ICCA 3V8KA 1LEAA 2JZYA 1WWXA 4JK1X 2L4AA 1KYWA 2HKOA 1ZGJA 1I1GA 1F9NA 2DK8A 1P6RA 1Y0UA 5IT9Z 3O2PE 1B59A 1YQAA 4S04A 3KETA 5HOOA 4HX8A 5CVVA 2EV0A 4IPAA 4HAMA 2QVOA 3LFKA 2WC2A 3QP6A 5LBQA 5HS8A 1D5VA 5HS7A 3I64A 3ZMVA 1W5TA 4CGZA 1TTYA 1F4KA 3WTTC 3B73A 3CUQC 4ESBA 2A61A 4ZZLA 4UVBA 2DBBA 4U88A 4QLCU 3C18A 1RZ4A 2CYYA 3FXUA 3T8TA 1IXCA 5AONA 2O6GE 2IW5A 3GVAA 2UZKA 4M72A 1GHCA 1ZG1A 2OBPA 2IRFG 1TW2A 1O57A 1ULYA 3DP7A 1BI2A 4I01A 1GXQA 1ZREA 2KJCA 1T38A 2Q0OA 4AIKA 3GO5A 5LGTA 3R0AA 3FMSA 2W85A 2IJLA 4Q48A 5DCMB 5D5WB 3F8NA 2V79A 4I7HA 5D4SA 1T6SA 2YR2A 2UXNA 1XCVA 4WX9A 3C3WA 4HYEA 3DXJF 3KP4A 3P9KA 1U8RA 2VBWA 4KYWA 5CVJA 4KFCA 3KE2A 4MHGA 4PCQA 3GEZA 4LFUA 2W57A 4L9JA 1B9NA 2GA1A 2DFIA 4IVNA 1O3RA 1S6LA 5J6XA 2VC1A 2A3SA 1RUNA 6PAXA 2H27A 1T98A 5LGUA 4G7ZF 4KMUX 1J2XA 3QPTA 4YFKF 3T0YA 2HS5A 4HQMA 5F6FA 3WTWC 3TDZC 3KP2A 4LK1F 3HTSB 5JHUA 1G4DA 2XKPA 2QBYB 4IHTA 5D4RA 2BYVE 1I5ZA 5TJJA 1HW1A 1JE8A 2O0YA 3SFZA 5LHHA 1Z91A 2VC0A 3HRUA 1UFMA 2H6BA 3DEUA 5JI6A 3SZTA 3BJ6A 2B0LA 3TGNA 4A0ZA 4M71A 3OV8A 1YYVA 3BROA 3ZPLA 1HKSA 4ENMA 3JSOA 2CO5A 1U6GA 1R1TA 1O7LA 3C7JA 1OYWA 2PG4A 4I98B 4A6DA 1BIAA 4ZYGA 2HQNA 4OU0A 2RN7A 4WXDA 2E7XA 3HOTA 1XCBA 1ZH5A 1MJAA 1FSHA 1ZG5A 4D0PA 3KP6A 4HOBA 3SHFA 3WTYC 2DPDA 3FX3A 2X4HA 2VONA 1USTA 2VE9A 4M6XA 1HXDA 4BNCA 1WRJA 3V7SA 2R3SA 5L3FA 3VOEA 2L02A 2CG4A 2KIMA 2DT5A 3JSPA 2FMYA 1P4AA 2IP2A 3N4MA 5FGMA 4HDUA 3K1MA 1VTNC 1XGMA 4PGHA 4RGSA 1BC8C 2MA3A 3RI4A 1HBXG 2ZMEA 2RGVA 2V6CA 5LHIA 2VODA 3WE3A 4LB6B 1K79A 4NQWA 3IHUA 1R23A 4G94A 2NNNA 3TOAA 1J59A 2EFWA 1R7JA 1KQ0A 4P5OA 3K0LA 1R00A 2G7HA 1QPMA 1C0WA 5DCFA 2OZ6A 2RDPA 1OPCA 4MQVA 4GYIA 3CDHA 4M73A 3RKWA 3M7GA 1YW7A 3TO7A 4A12A 2XAFA 5FFXA 1J7KA 2LDUA 2P5KA 2ZJ2A 2DU9A 3KP3A 2PFBA 2L54A 2LSOA 4MGRA 1FZPB 3HRSA 3L9FA 2A5YB 2ZXJA 4EJUA 1SFXA 4FX0A 3DQVC 1ON1A 3SZPA 2EB7A 1IN8A 2OA4A 3K1PA 3KP7A 3O6BB 3E5XA 4A0YA 3GFJA 5FLXK 3KCCA 1IRFA 2AS5F 1U5TC 5IT3A 1I1SA 1ON2A 4CICA 1AWCA 5L3DA 3DPTA 1JXSA 2BEOA 2ZO4A 2HR3A 2JRTA 3F72A 3WG9A 1R1UA 1SMTA 2VE8A 1BN5A 4AVPA 1SAXA 3L09A 2P6TA 1Z1DA 1MGTA 5ILUA 2QUFA 2W24A 5K5OA 3LQQA 1IN7A 4G7OF 4N9HA 1BI3A 3GUDA 3RJPA 2HTJA 4G7HF 5KVRA 3ZMSA 3J80Z 5DEQA 4B09A 5BPIA 1ZN2A 1FY7A 5HS9A 4R1HA 3MWMA 1LB2A 4G6QA 2VN2A 1TW3A 2W84A 1Z9CA 4KA4A 4O5VA 5D6EA 3BP8A 3HIFA 3P9CA 4YIIA 3M1EA 2VT3A 1G3TA 4U0YA 4A0XA 5J8CA 2ISYA 1RIOH 1G6NA 3GF2A 2MBFA 3IWFA 3HRMA 3KZYA 2EFQA 1O3SA 1Z05A 1XDSA 2FBIA 2DQLA 5KK1A 2D2WA 5DD8A 1LNWA 4KT5C 1IZ1A 2BE5F 5LEJA 3DKWA 2VBZA 2FXAA 2K27A 2K86A 3V7RA 1IF1A 3KP5A 4HV5A 4Q4ZF 1BI1A 3CUQB 1TNTA 4RGXA 4ZH4F 2QQBA 2XAQA 1S7OA 1LEBA 3HTUA 1XMKA 2DPUA 1B1BA 2F2EA 5HLIA 1EH7A 1ZAOA 2OU2A 5LEKA 2KIFA 1KQ9A 4AWXB 2VXZA 4EQQA 3BZ6A 1P4WA 4M9XA 4EMSA 2IA0A 3REOA 4Y17A 3SQNA 1QO0D 2M5WA 1B4AA 5HDKA 3M8FA 3EETA 1R58A 2FU4A 3WTSC 3ELKA 1XGOA 2M1BA 3T1BA 5E8GA 2IPQX 1XGSA 2F5DA 1YG2A 2RQPA 1WSUA 2QZ8A 3L7WA 1QGPA 2E1CA 4LG0B 5HLHA 2D1HA 3GZ6A 1FPQA 3J81K 2HEOA 2EWNA 1YW9A 3F8CA 2HKXA 5H6QA 1BI0A 2OAZA 2XAGA 3W6KB 5L3GA 3TDUC 2FSWA 1MJ9A 1LVAA 4R8HA 5AIQA 3BPVA 2P6SA 1E2XA 2EV5A 5F1RA 1KU3A 4R79A 1XN7A 2DLLA 3Q5FA 4PZJA 4ZYHA 1SD4A 2P8TA 1U5TB 3G73A 1FYMA 4OMZA 4WF2A 1IUYA 4JBAA 2H94A 4CHUA 3I58A 3O3KA 3V8LA 3RYPA 1ZLJA 1JGSA 2STTA 3K69A 3MEXA 3RDIA 4QWQA 1KYZA 3RPUA 4F7ZA 2EFOA 5CVIA 4P96A 5LGNA 2HGCA 4NHJA 4Y15A 4XSZF 3I0TA 3CTAA 1KU2A 2QYOA 3RPQA 2YSRA 4EJTA 5L3CA 3LA3A 1IN5A 4PGGA 2HWVA 3EUHA 2XUBA 3RKYA 2ZFWA 5JFRA 4U7BA 2F5CA 3WU1B 3CLOA 4MEXF 5H6RA 4OMYA 1FSEA 2GA2A 2XGXA 3LQRA 4GO1A 1J0RA 3I71A 2QBYA 4IJAA 4Q5SF 3GFMA 4EVIA 5JR3A 3COAC 3GLXA 2VBXA 4BQAA 1FWZA 2HTSA 2ESHA 2FBKA 3HYIA 2J5PA 4HA8A 2RKHA 2LKPA 4LLGF 2LNBA 1PP7U 3VODA 2DAOA 2XAJA 2XIGA 1TQMA 3E5UA 4WWCA 2ESNA 3I4PA 1K6OA
chains in the Genus database with same CATH superfamily
2HOEA 4XLNF 3VFZA 1UCRA 2ZJQF 3S15J 4GDFA 1UHWA 3O8GA 4BE1A 2CH0A 5C44J 1N25A 1LVKA 4OAZA 1GVDA 1MMGA 1S3JA 3PM1A 1APLC 1FIAA 2FBHA 4BUPA 3A2KA 2H6CA 1U78A 4I76A 1B8IB 4YFXF 1O3QA 2CV0A 5K7FA 1IRGA 1OQYA 4CO8A 4UXNA 4XRSG 4M3EA 1WFXA 3G3ZA 4A3JJ 4E7HA 2WWYA 1B8IA 1S29A 5EEAA 5BMZA 3BPXA 4JQFA 2VPRA 5JLXA 1LDDA 3QPHA 1K78A 1S7AA 2ECBA 3ZN1A 4A6EA 2COMA 4S05A 2PMHA 2IS6A 3FMQA 4HX7A 1MH3A 2D45A 2V7FA 3VB2A 2EV6A 2CQKA 2CW8A 3Q0UA 3HSEA 2HYFA 3DF8A 4GYGA 3WE2A 5GTIC 2J5OA 2X85A 3DKXA 3X2QH 2HVQA 1U3EM 2MGQA 4N9IA 5J1UA 3A0HC 3TO6A 2JVGA 3MZYA 2Z99A 4KIBA 4HSTA 1QZEA 3HHGA 4MFEA 5J1RA 3OL3A 3SYTA 1SVOA 4L5IA 1HKTA 4TV7A 1M1EB 3W2AA 4XNFA 2XVCA 5FD6A 3NWTA 3LFUA 3E97A 4CXFA 1UHSA 2E35A 1MBEA 4DQ2A 1PDNC 3OR1C 3L1PA 2UUZA 2XSDC 3HKZA 3QRFF 3CJQB 1DDNA 1W7PB 2ZNYA 3QU3A 1A6QA 2UV1A 4RB0A 2AHQA 2O8XA 2VJJA 2DMQA 5FFZA 2QQ9A 2YS9A 3G1LA 2KRFA 4UUVA 3OYKA 3GW2A 4MQ9F 3F8BA 3JRAA 3JR9A 4AYBN 2HNHA 3PSFA 2P5LC 3LSMA 4IQJA 3ZP5A 1D0ZA 1WQ2A 2EZHA 2Y0SA 2WAQA 3EDPA 1CF7A 3K4MA 2O7OA 4BQQA 5HDNA 1OKRA 1ZGWA 5HVQC 1WH5A 4NQWB 1SEUA 4D1QA 3U21A 5JVTA 2B63J 1BJAA 3JTHA 2FNAA 1STZA 2EIKH 2NAZA 4EM2A 2O3FA 4ASNA 2I5UA 2JN6A 2K4BA 4LOCA 4D5CA 4WXHA 2XV4S 2LLKA 4IHSA 1SFOJ 2XROA 3BTJA 3OYIA 2ID6A 5F04A 4P9FA 2XB5A 1SD6A 1S8NA 2UWMA 5ICFA 4CCOA 3I53A 3RKXA 3I59B 3K4NA 5EYRA 4WXCA 5D6FA 3BQYA 3I56I 5DD4A 4MTDA 2IA2A 4C2MJ 4XLCA 1J09A 3RKQA 2PEXA 3S2DJ 1DPRA 3ZOBA 1ZG3A 5E3NA 4ANJA 2MH9A 1CGPA 3WTXC 1Y8QB 2X1EA 4JP0A 4UV8A 4B8XA 4CZCA 4OIOF 2DMUA 3HSRA 3QP5A 2QQ8A 4EM1A 3G2BA 2O61A 1VF9A 2BW3A 4IRGA 1SFKA 3S1QJ 1PP8F 1I6XA 3S17J 3BCAA 3BJOA 3V7CA 2KKOA 2QLZA 1FYKA 2A6HF 2A6TA 3HHHA 5KCMA 4ZJZA 2VOOA 2L5QA 3H3VK 2VT2A 2DN0A 3OS2A 5BPDA 1MDMA 1X1PA 3ZMUA 2VPLA 3E6MA 3V42A 2H1LA 3N97A 1Z7UA 1YITI 3F8MA 2AXLA 2ZCWA 1MDMB 2EK5A 2HPIA 3OIOA 3H92A 3LSPA 2E1MB 2EJRA 3DV8A 3GFLA 4U0WA 1Y0NA 4P9UA 4LG3A 2JT1A 1LJ9A 3K4CA 4LJZF 1X58A 3I5UA 1RNLA 1FP1D 4I02A 5GAHJ 3TMOA 2MABA 2A69F 4M9ZA 3CC7I 5F64A 2K3FA 2K4JA 4I2OA 2UXXA 2OCEA 5DCMA 2IGKA 3K2ZA 1N78A 1MD0A 2DCEA 1HQCA 1KGSA 3VSKA 2L9NA 2ZBKA 3RCOA 1ODDA 2WTEA 4JOMA 4C9YA 2OQRA 4RGRA 4O6JA 3ROUA 1UMQA 2F5EA 2X6XA 3MCZA 1IN4A 4CCKA 2NS0A 4DBQA 4RM3A 2V9PA 3CCSI 4C3HJ 2CV1A 2JTVA 1R5GA 3BCBA 1UHMA 1SAUA 2DTZA 2XAHA 1QZZA 4L9NA 3C2GA 1FMVA 3GXOA 3E3VA 3IKTA 2ZSHB 2Y2ZA 1L0OC 4DZJA 4EJWA 3H9GA 3FXQA 3M9AA 3MZ8A 5B5EC 2ADUA 1B72A 2QKMB 3DFGA 3JRDA 2QF7A 4XLFA 4A5NA 1TLHB 1XB4A 1YFHA 1RUOA 2KPMA 3ULQB 3L2UA 1X2NA 5IOZA 1RI7A 1KQ8A 1QVTA 4E4HA 2KLOA 4A3CJ 3MZHA 2ZMEB 1WI3A 3LA7A 3B6CA 5HDGA 3LSTA 1P9QC 1GVJA 3OMYA 5B66C 1GXPA 1ZLKA 2BXYA 2CWEA 5DYMA 5DM6F 4ON0A 3D5RC 2HOAA 1XTAA 2CRGA 3S14J 5DDGA 1MKMA 3OSGA 2IAIA 4BHCA 1ACIA 2ACJA 4KN7X 2MD5A 3G1OA 1Z0XA 2DK5A 3CMEI 1X4PA 2FQ4A 1YTYA 2IGMA 5DTDA 2KJBA 3S2WA 2X0LA 4OIRF 4YIFA 3HRTA 5LRSA 1O3TA 1WKMA 3S1NJ 4ABZA 4LD5A 5LRRA 2MLKA 2LF8A 3EYYA 5D5UB 4A3IJ 2CQQA 1CF7B 2EZKA 5BQTA 2V1DA 2QSGX 2RC4A 1TWFJ 3RSNA 2NNYA 4KIFA 1E3HA 4G6DA 4KUMA 4Y13A 5E17F 1QZYA 5E1WA 1QQIA 5IYCJ 1U8BA 1W36C 2CFXA 2LH9A 3BOQA 5GADJ 1CQTA 2A07F 1X2MA 1AA7A 1X3UA 3OWTA 3TOBA 4XRFA 3OOPA 1DU6A 1SFEA 4QTRA 2O03A 3BR2A 5ED4A 2R5ZB 1FNNA 2VQHA 3BG3A 4ZC3A 3OIPA 2P7CB 3KZZA 2A6EF 1A5JA 4ZYEA 4H0EA 3BG7A 2NRAC 2HDCA 3ZMTA 5FKNA 4FX4A 2WY7Q 4LMYA 2K02A 1N75A 3ML6A 2YX4A 2M2EA 3CJNA 2XHKA 3S3OA 4U0VA 3PFIA 4DBRA 1G8XA 1UB9A 1IW7F 3GZ5A 4P1WA 1EJ9A 4FQGA 3WTUC 1UG2A 3DEEA 2PI0A 3L2VA 4KT6A 2JK3A 2JPCA 1MSFC 1X1AA 4YFNF 2JJ7A 4KNYA 4BHPA 2HYJA 5FJ8J 3G4SI 4IX7A 4MEYF 4EATA 2H8WA 5IY5H 5EDNA 1FBUA 3CCLI 5ILVA 5GAGJ 1WH7A 2XRLA 2DQRA 2L7KA 2L7FP 3PQJA 3AG2H 3WG7H 1BC7C 5DUKA 4HLYA 2HDWA 3CUQA 2GXAA 1LPQA 4Y4RA 5JVGF 2HYGD 4RLQA 3Q9SA 1FBQA 3PQKA 3ZMDA 3AAFA 1QNTA 4WCGA 2V9KA 1R6RA 4L9TA 3WTZA 2F5FA 4RA2A 5L3BA 1BM9A 2GZWA 1PUEE 2JSCA 1ZYRF 5FKLA 3H9JA 4CA0A 5IPAA 5F1JA 5TISC 1OR7C 1K7AA 1U2WA 2AO9A 3CO6C 3JCUC 1PJRA 1MIJA 1H0MA 4M6VA 4M3FA 1J9IA 1X4OA 4IF4A 2Y0MA 4XSXF 2YX7A 2JWTA 2HQRA 2PBIA 4FCYA 2DOEA 3RZDJ 3F22A 4FTHA 4IKFA 4BBSJ 5FD5A 1RKTA 2WV0A 1ZRCA 3VEPA 1KU7A 3ECOA 4MTEA 4ZZDA 3HUGA 4CDGA 2LBFB 3LAJA 3D0SA 2V1NA 4BJ6C 3P7NA 4XRMA 1QHGA 1MMNA 1PUFB 5E1XA 1JUMA 4NC7A 2ZFUA 1BOAA 4IHWA 1NTCA 2Y0SN 3TKYA 4OIPF 3ASOH 1BR4A 4D5FA 2VXDA 1V4RA 1O7FA 2Q2EB 2QM3A 5M5YJ 1U0JA 2H09A 2YPRA 5EEHA 2FA5A 3V8JA 4BYYA 3G71I 3GTOJ 3RYRA 1HCRA 3V4GA 2Q2EA 2DT7B 4F93B 3A01A 5D8KB 3BTLA 3ZRGA 1F5TA 5H20A 2F4MB 1D3YA 4PSXA 2DO7A 3TP0A 3ZQLA 1I27A 4PJLA 3O8HA 4HX4A 3F9KA 1WZ2A 3S3NA 5AIPA 3IH4A 1MBFA 1T0FA 3MAJA 5K5QA 3OYBA 1EKEA 3OYHA 4I6ZA 4Z2YA 3SDBA 3A03A 3GCMA 4RS8A 2DMPA 2K9MA 1A31A 1EH6A 1I3QJ 1R1VA 2BVLA 4XL9A 3F23A 1QBJA 3KYLA 3BY6A 4IHVA 3TW7A 3E6BA 4IOAF 5DV5A 2R5YA 4BH9A 4DNCA 2W1OA 2L2OA 2PN6A 2X48A 3S1RJ 3K10A 3FMRA 4C2TA 4ZYDA 1TZLA 4NBQA 2LY9A 3S8PA 5CVUA 1J75A 1NK3P 3IWZA 3VPRA 5E8IA 2QSHX 3F8FA 1W4MA 1OCTC 1WI9A 4G9YA 3W6JB 5FB2A 5E18F 4E7KA 3IKVA 4J19A 2AQFA 5CKTA 3BTCA 4XLPF 3K9TA 4DJAA 3JRFA 1Y39A 4CZZA 2M3AA 4XKBA 3U2RA 1JT6A 3K4JA 3M8EA 2NS8A 2W82A 2NVTJ 2QA4I 3R0JA 2ELJA 1R5ID 1XSVA 4Z6YA 2EFNA 3M3YJ 2CUFA 1JTYA 2VKHA 4AIJA 2KIUA 4OAYA 1AKHA 1MH4A 4FETA 5F27A 3JRCA 3GFIA 4I0AA 1TWAJ 3OYFA 4RMNA 2JPBA 2GIVA 4P55A 1QA6A 4L0ZB 4U87A 5FKOA 3ZQ7A 1H9TA 2VASA 3ABLH 1BIBA 3H3ZA 1EV7A 4HBLA 2DOAA 1TNSA 3P5JA 2AXTC 3KEOA 2DYRH 3HOXJ 4PJJA 2EA4A 4KITB 4PDKA 2FEZA 2L4MA 2L7ZA 1OCPA 1MBGA 3BLYA 5ILSA 4EM0B 1BW5A 1OR7A 3P9IA 5ICGA 1GV2A 4BGDA 1G3WA 4GGGA 3E6DA 4YG2F 4I09A 3CD6I 2L7MP 5CVRA 3NQOA 2WADA 3U1DA 5M3FJ 5IT9K 2CUZA 3GYHX 2DMTA 2HPMA 3PL8A 1X19A 3JAMZ 3NARA 2KZGA 1L3LA 3H36A 2BY2A 2BV6A 1RKWA 2JA6J 1VQNI 3BJAA 1KU9A 4L0YB 2LTPA 1YIOA 3GWZA 2JUCA 3OYEA 1WJCA 1LFUP 2R7SA 3HZJA 5B1BH 4E7ZA 4AIHA 2DA3A 2GWRA 3OYJA 3CCRI 1LDJA 4L18B 4B43A 3A1YA 5K7HA 5D5VB 4Y3OA 3CO7C 4AVZA 5L3EA 1P92A 1YI2I 3FF5A 5BS6A 1JGGA 4JX4A 3R6SA 3F6OA 2ETHA 2BY3A 3FBIB 1S7EA 4UVCA 4CCMA 1IAWA 2MD0A 5EEGA 1IJWC 2FJ1A 5CYVA 2R7RA 1YIJI 1TBXA 2E2IJ 1H89C 2OPTA 5CPRB 4HW0A 5J3LA 3WGIA 1NH3A 4BXUA 4UVAA 2LOOA 4RAYA 1Z3XA 2HZTA 1BR2A 1MBJA 1ETWA 2CSOA 3SXYA 5GP9A 4EGZA 3PO2J 2VL8A 3LA2A 2QEXI 2Z9OA 4RB2C 2WV1A 3GX4X 2A68F 1JHFA 5F0HA 2E7WA 3GMEA 1SD5A 3DTEA 2R4GA 1HLVA 3ISPA 4V2GA 3TO9A 2LKSA 2RV8A 1T8IA 1Y8RB 4HDVA 3B6AA 1V5FA 1K78B 2EH3A 5LLQA 3S16J 3WU0A 4XM3A 1D1BA 2V1XA 4LLNA 1U9OA 3KIOA 4I99C 1MZBA 1WJFA 2LF7A 2G7UA 1NG6A 1LE8B 1R9TJ 3ZXSA 1ZARA 5E20A 2Q8KA 3MQ0A 3F6VA 3G6EI 1IO2A 4IZZA 1DP3A 2M87A 5B1AH 1YRNB 3ABTA 3CC4I 1DPUA 2CGPA 3Q9VA 1E17A 2BY0A 1FBSA 3AG1H 3BT9A 2XB0X 3AG3H 3DPUA 5LFAA 5HNHA 3GBGA 4MIMA 1JKPC 5DS9A 1WPKA 1W7PA 3IP4B 4FT8A 3IL2A 2DYSH 1IN6A 2VOPA 2STWA 1JUPA 4Y33A 1T39A 3QYBA 3HDDA 3H3UA 3HSFA 2ISZA 3KYDB 2DFFA 3GTGJ 2XF6A 3BR6A 3QQAA 1MSEC 2V4JC 2P7VB 1AOYA 2M34A 3OIQA 3JAMK 1IRXA 1JHHA 1OYIA 4CCJA 5A2QK 1UZCA 2M0MA 3ZN0A 2CQXA 1WCMJ 2M9HA 3L00A 2FX0A 2CUEA 1UAAA 1HSTA 1FYLA 3M8JA 1Z6RA 1OISA 4OWRB 2PLYA 1OCOH 2EIMH 1XD7A 2OUMA 4NUBA 1ZR2A 1T08B 3HL2A 3BZKA 2XASA 3B02A 4KMFA 1AKHB 2V9VA 2MC3A 4ENNA 2JVHA 4MFDA 4RB1A 4M3DA 4BBRJ 2RNGA 1VQPI 2EA2A 5C4XJ 1ETVA 1Z7LA 1HSJA 1P2FA 3NEUA 3J81Z 3MKYB 4DYCA 4ENKA 1P7IA 5E3OA 1X1DA 3M4OJ 2DW4A 2JQ7A 1G3SA 2Y30A 1OCZH 5TRDA 1A04A 2FQ3A 4DZPA 3OYCA 3FXKA 5KAIC 1X1CA 1R4MB 2D1VA 4Q47A 3CCVI 4EJOA 1XS9A 1MBHA 1YW8A 3ZGKA 4RAZA 1VQ9I 2DI3A 4WK8F 4KN4X 3QAHA 3JRGA 1PVEA 3WTVC 3CF5F 1FP2A 3BDDA 1XDUA 2GOXB 1HDDC 3QU6A 4OOIA 3RTRA 5JLWA 4HF0A 4O3MA 1I39A 4FE7A 3JTGA 2YU3A 5LHGA 5KNLA 4AD9A 4ENJA 3DWLE 2FD5A 1IV8A 5E79C 1YS7A 2YU9J 2MH2A 5FRNA 3FKIJ 3CZ6A 1IXSB 1UELB 1DUXC 3WODF 2V6EA 2VQGA 3M1CA 3IH3A 4FISA 4BXXJ 3HOSA 4GCVA 1LQ1A 2EZLA 2GLOA 3UR3C 3H0GJ 2PMZN 4LIVA 2K3PA 1OLTA 1ZRDA 5EG0A 1JKRC 3HKZN 3QOPA 2BBYA 4A3EJ 1DU0A 3DEWA 3JREA 4BDZA 4NB5A 3DTKA 2L3DA 2R7OA 4M6YA 1B9MA 2Y75A 5EG0B 2IT0A 1FTTA 1NK2P 1SD7A 1USSA 2LFBA 3LAPA 3GTLJ 1XMAA 4PJMA 2RNJA 3I54A 3K6GA 1R5HA 1YLFA 2FMLA 2R7DA 1T56A 1WHUA 2VBYA 2Z33A 2Z3YA 1U9NA 4A69C 1FC3A 3E6CC 4L5JA 1IXRC 4A5MA 4N0BA 4PJ0C 4YIRX 5HLTA 2DTRA 3DBRB 2C6YA 1D8KA 2GXBA 3FISA 4LG0A 2K9SA 2MLGA 2Z5UA 3K1NA 3ZR8X 2ME6A 1REPC 2K5CA 3FXOA 3MKLA 1PUFA 2P4WA 3DLLF 1H88C 3ASNH 4BY7J 1HW5A 1NHAA 3NAUA 3HOVJ 2X6WA 2OZUA 3L2CA 5A2QZ 2XRNA 1OJLA 3OL4A 4XKWA 4BS9A 2TDXA 1JTXA 1EH8A 2NOJB 1QU3A 1J5YA 2M30A 3QPLA 3ERED 4IL6C 4IRIA 3J7AO 1B72B 3J80K 1Z67A 2DA7A 1F1ZA 4M3BA 3ECHA 2NYXA 1R36A 4IXAA 4HZFA 1BJZA 2QWWA 3AFHA 4GXOA 5M5WJ 1W5SA 3ZCOA 1FOXA 1FOKA 4XQFA 2PMUA 2WAFA 3DU6A 4ZDPA 1G3YA 3H1CA 5FROA 4HF1A 1W7PD 2KP6A 3R4KA 3WHCA 1DP7P 1XSXA 1AU7A 1RETA 2F4OB 4UUSA 2PJRB 3S1MJ 5CJ9A 2IVMA 4B44A 5K7ZA 4XRSA 3QPSA 1R4NB 1S5LC 2F5VA 4U7DA 2LKXA 1SFUA 3FK6A 3ZMZA 1R22A 1LDKB 4UUTA 3WGGA 3TP3A 5BOXA 4LGWA 3VWBA 1YX5A 2ZKZA 3DBHB 3S2HJ 2A5WA 3H0DA 4ESJA 4IRHA 1KA8A 5IP7J 2N8GA 3IC7A 4F92B 4HNUA 3G1MA 4XBFA 4DYQA 1P4XA 4MO7A 2RREA 3CCJI 2W4SA 4FHTA 3N05A 3IRRA 4HF2A 4HLXA 2IXSA 2MC4A 5GPCA 3LWFA 5J4VA 2GXGA 2V26A 4A3DJ 5GTHC 4RGUA 4LB5A 2QENA 4G8XA 2PQ8A 2ZNZA 3BR5A 4N4NB 1GV5A 2BW3B 2EFPA 2XGEA 3RIRA 5FLXZ 2ZJPF 3AL0B 4K2EA 4X1EA 3RZOJ 4E70A 3FWEA 2BOLA 3LSKA 4GRIA 4XICA 2BY1A 5FLMJ 1ZRFA 5ICEA 2R7FA 3BG9A 4BU2A 2GQQA 1IDYA 4KJZA 1FLIA 2ICWG 5ERIA 5LD2C 4E7SA 3FHZA 3EYIA 2XPUA 3KLNA 3C1DA 4BAYA 4ZDOA 1H9GA 1XG1A 1GT0C 4BY1J 4XK4A 3SEQA 3T5XA 1WJEA 2XAUA 4CH7A 3DCFA 4M9SA 2M45A 5K1YA 2GIZA 2W00A 1TP4A 3F3XA 2VLAA 3F21A 2W25A 4A2UA 4EJVA 4XN3A 1I6HJ 4ESFA 2QQAA 2EPFA 4KICA 1OMIA 4Y7NJ 5IYBJ 4ITVA 2XKOA 3R61A 4MNUA 1TQPA 4UNOA 2ZXIA 3I4MJ 3ABUA 1RPWA 3IV5A 2COBA 4UV9A 4LLLA 1Z3YA 1ETYA 2PJPA 2DFHA 2I8DA 2B7EA 5CLSA 4AYBA 2E1NA 2DA5A 2K7LA 4B48A 3R60A 2L9RA 4A3KJ 4XOTA 1ZR4A 2FE3A 3FXMA 1TT5B 2VKDA 5E1ZB 2W48A 3NRVA 2KISA 4EGYA 1XPXA 2GAUA 1MBKA 1V3FA 3AKZA 1W5CC 3TQNA 2JA8J 3K2AA 3F0CA 3KLOA 4RM2A 1X3ZB 1ZGAA 5HLGA 5K5RA 4BDYA 3T8RA 2AQEA 1XC5A 5DUIA 3CUOA 1XSDA 4Y52J 1I50J 1D0XA 2BVMA 2M8GX 1LUJB 2XF5A 3FM3A 3FZVA 3K4LA 4M74A 2WY8Q 3MFKA 4I0BA 1ZKGA 2CU7A 2R7WA 3IAS2 1FX7A 3ZQFA 1XGNA 4B3XA 2CW0F 2DMNA 4ETSA 2ELHA 2MYSA 2GOMA 2LY1A 2M8EA 3D5LA 3IAM2 3GTPJ 3LL7A 2HFHA 1VZ0A 4KIGA 4CYDA 1T0FC 2L01A 2ZC2A 2BGCA 3PNYA 1IG7A 1SMYF 2L9SA 3BWGA 1TWHJ 1TC3C 2O5RA 4HV6A 1ERDA 2OD5A 4F55A 1MMSA 1YJWI 1HKQA 1MJBA 3K4BA 2G9WA 1GDTA 2OQGA 5EZGA 2RAEA 2QCOA 5M3MJ 4UHTA 1B6AA 1VQKI 1YO5C 3DPLC 3OYLA 1FT9A 3TEDA 3CLQA 1ZHFA 4CYCB 3FM5A 3FXRA 5FO5A 4L9VA 2L9VA 3BG6A 2FRHA 2FF4A 4HQEA 1FEXA 1EF4A 1X3WB 4EV0A 4UY8I 3VYSB 2P5VA 4B4CA 4X0GA 1FIPA 4RB3C 4BHBA 1U5TA 1HW2A 4OIQF 3A01B 1Z6TA 3EQLF 5D5XB 2IA1A 3CF2A 4PFPA 1YHQI 1D1CA 1OYYA 4XLAA 1HOMA 1BBYA 2M7BA 4KDPA 3WGHA 4B3AA 3KEQA 3DKYA 2Y48A 4OINF 3W3CA 5D8LB 1O4XA 4UUSB 2K85A 3E5QA 1EA3A 2R5YB 1JJ6C 5J8FA 2JMWA 3IRQA 2FNPA 2CV2A 3H5AA 2OTLI 3U9GA 3I59A 3AG4H 3KFWX 2X6YA 1Q1HA 1MNEA 2FOKA 5B3SH 3U1KA 1T2KA 2DA2A 1D0YA 2QGUA 3JW4A 4LK0F 1TQIA 2LREA 2RVCA 2V1UA 1YS6A 4XONA 5C3EJ 1ONVA 1D8JA 5ICCA 1VI0A 2GBYA 3V8KA 2VJ5A 1IC8A 3DLAA 1LEAA 2DDAA 4UB6C 2JZYA 1WWXA 1OCCH 4DYRA 4JK1X 2R5ZA 3HOWJ 1DGRM 2IS2A 2L4AA 1E0EA 1KYWA 2F48A 2Z1DA 4HRIA 1P7JA 2HKOA 2NS7A 1ZGJA 1I1GA 1F9NA 2DK8A 1P6RA 1Y0UA 4QSHA 5IT9Z 3CCUI 3O2PE 3ZQQA 1B59A 1YQAA 3W6VA 2HVRA 4S04A 3KETA 2DA6A 5HOOA 4HX8A 2TRTA 3HEFA 5CVVA 3LOCA 1ITYA 4JX6A 1ETQA 2EV0A 1ORKA 4IPAA 2KDOA 4HAMA 2QVOA 1BOBA 3LFKA 2WC2A 4AU7A 4F91B 3QP6A 5LBQA 5HS8A 1D5VA 2BZTA 3QYEA 3PJRA 2OF7A 5HS7A 2HXIA 3I64A 3ZQIA 3ZMVA 1W5TA 3E7LA 5CQGA 4CGZA 1TTYA 1ZK8A 2CW7A 1WJDA 1F4KA 2IS4A 3WTTC 1Y1WJ 4D7NA 5M5XJ 3B73A 1LFPA 2VJ4A 3CUQC 3PNVA 4ESBA 2A61A 4ZZLA 2ZSIB 2E2JJ 4UVBA 1LFBA 3BTIA 2P81A 2DBBA 4U88A 4QLCU 3H5NA 3C18A 2ELKA 3EUAA 3HC7A 4CYCA 1RZ4A 2CYYA 2NXNB 3FXUA 2ZXHA 3QOEA 3T8TA 1IXCA 2KT0A 3KPHA 5AONA 2O6GE 2IW5A 3GVAA 2UZKA 4M72A 1GHCA 1ZG1A 2OBPA 3JRHA 4V2FA 4XORA 1KZHA 2OCCH 4PJNA 2IRFG 1TW2A 1O57A 2BXZA 2KRHA 2VQCA 1ULYA 1Y1VJ 2NOGA 3HOZJ 3DP7A 3C2HA 3GLLA 5J47A 3HOUJ 1BI2A 5EGOB 4I01A 1GXQA 1ZREA 2KJCA 1YX3A 3MD2A 1OFCX 1V5GA 5IP9J 2Q0OA 3OY9A 1T38A 3RPUD 4AIKA 3SFIA 3LSRA 1ZQ3P 3GO5A 5LGTA 3A0BC 5IYDJ 3R0AA 3JRBA 3FMSA 2W85A 4ZTJA 2CS3A 3PO3J 2IJLA 2E1OA 4Q48A 5EJCA 5DCMB 5D5WB 3F8NA 1X1BA 2V79A 3CJTB 1PYVA 4I7HA 4ZDLA 3FXJA 5D4SA 1T6SA 2YR2A 2UXNA 1V54H 1XCVA 2I10A 2DXIA 4WX9A 3C3WA 4HYEA 3HM5A 3SEZA 2JA7J 3DXJF 3CC2I 4BJTA 3KP4A 3P9KA 5FLVA 3HUGB 1U8RA 4HSRA 2VBWA 2KQRA 3ABKH 3TW6A 4KYWA 2H1KA 3LSJA 5CVJA 4KFCA 3KE2A 4MHGA 4PCQA 4AIDA 2LD5A 3GEZA 4LFUA 3ZQHA 1YRNA 3GZNB 2W57A 2XPWA 4L9JA 1B9NA 2GA1A 2DFIA 4IVNA 3A4CA 4BE0A 1O3RA 1K83J 4BKXA 2CFOA 2IBDA 4BQOA 1S6LA 5J6XA 2VC1A 2A3SA 2W7NA 1RUNA 6PAXA 2H27A 4RAFA 1T98A 4C3JJ 5LGUA 2CQ7A 4G7ZF 4FASD 4KMUX 1J2XA 3QPTA 2IGNA 1SVMA 4YFKF 3T0YA 2OTJI 2HS5A 4HQMA 4C3IJ 4PK4A 4CCNA 5F6FA 1POGA 1QPIA 2X1CA 3GTQJ 2CUJA 3UKGA 4DIQA 3WTWC 3TDZC 4CSWA 1F43A 3KP2A 2OJED 5GPAA 1QHHD 4LK1F 3HTSB 1Z21A 2XGCA 5JHUA 1G4DA 4S0HB 2XKPA 2QBYB 4IHTA 3WHBA 5D4RA 2BYVE 2K9LA 2M0CA 1I5ZA 4W97A 5TJJA 1HW1A 1JE8A 2O0YA 1GLNA 4NC8A 3SFZA 4BEHB 2QSFX 5DM7F 3FKJA 5LHHA 1Z91A 4B47A 2VC0A 1FOYA 4LITA 3HRUA 1UFMA 4AUXA 2Y69H 5J4YA 2H6BA 1JKOC 1YJ9I 4EEFG 3DEUA 3H35A 5JI6A 3SZTA 3BJ6A 3CJRB 3S3MA 4X6AJ 3RQIA 4NDLA 2B0LA 3TGNA 1FJLA 3EPZA 1W36D 1ZELA 4JYKA 3E1SA 4A0ZA 2XSJC 4M71A 3OV8A 1YYVA 3BROA 2Y9YA 2YUSA 5JHFA 3ZPLA 1HKSA 4ENMA 1NG7A 3BZCA 3JSOA 2R7ZJ 3HB9A 2CO5A 1U6GA 3BR0A 3ZQCA 1R1TA 3FHNA 1O7LA 3C7JA 1OYWA 2PG4A 4I98B 1WJAA 2FOWA 4A6DA 2BHZA 1W0TA 1BIAA 4DW6A 4ZYGA 1YOVB 2HQNA 1HC8A 4OU0A 2RN7A 1JJ8C 3KZIC 4KISA 4WXDA 2E7XA 3HJEA 1XCBA 3HOTA 1K4TA 5IP6A 5FKMA 1ZH5A 4LIUA 1MJAA 3VYRB 4FE4A 1E3PA 1FSHA 1ZG5A 1G2HA 1TWCJ 4D0PA 2E5ZA 4E7LA 4A3LJ 3KP6A 4HOBA 3H9QA 3SHFA 3HBLA 3WTYC 2DPDA 2XDVA 1FMWA 1MMDA 2G0EA 3FX3A 2X4HA 2VONA 1USTA 3DTIA 2VE9A 4E7JA 1WVRA 3CP2A 2K9QA 3DBLB 2KL4A 4M6XA 1HXDA 4BNCA 5EF6A 1WRJA 4A3GJ 2E60A 3NWSA 4RAGA 3W2VA 3V7SA 2R3SA 2ZXWH 5L3FA 1MW7A 5J40A 3VOEA 4BL0B 2HQAA 2L02A 2CG4A 3GTMJ 2KIMA 2DT5A 2ZJRF 3JSPA 2FMYA 1P4AA 2IP2A 3N4MA 3BQZA 3QWLA 5FGMA 2CJJA 1VQ4I 4HDUA 2DJIA 3BR3A 1GUUA 2M4KA 2HZDA 3K1MA 3PIPF 1VTNC 3CCQI 5HODA 1XGMA 4PGHA 1ETXA 2WB1A 4RGSA 4XMYA 3FIWA 1BC8C 4BXFA 1RR7A 3HPHA 1FTZA 2MA3A 2EILH 3RI4A 1HBXG 2ZMEA 4BQNA 4BEHA 2RGVA 2V6CA 5LHIA 2VODA 3WE3A 3OYDA 4LB6B 1K79A 4NQWA 1IGNA 2E2HJ 4IEJA 4RDUA 3IHUA 1R23A 4G94A 3HPGA 2NNNA 3TOAA 1J59A 1RC9A 2HOTA 3DU5A 1R7JA 2EFWA 5E3MA 3CMAI 4F52A 1LE8A 1K61A 1KQ0A 4P5OA 2DFEA 2ZMEC 2KRCA 2MG4A 3K0LA 1R00A 2DJNA 2G7HA 3CCMI 3OYGA 1QPMA 1C0WA 5DCFA 2OZ6A 2KMUA 3WU2C 2RDPA 1OPCA 1A35A 2IS1A 3TL4X 2DDBA 3ERMA 4MQVA 3OYMA 2XGDA 4YRVA 2M7AA 4GYIA 4E6KG 3VYTB 3CDHA 4XLHA 4M73A 3RKWA 3M7GA 1YW7A 3TO7A 4A12A 3J7AY 2DA4A 4B1RA 2XAFA 5F0FA 5FFXA 4AM3A 1VQLI 1J7KA 1ETKA 2HDDA 2LDUA 4MLOA 2P5KA 2ZJ2A 5H2FC 2DU9A 1IV6A 3KP3A 1Y56A 4HPQA 2PFBA 2F4IA 3FBNB 1A6IA 2L54A 2LK2A 2HI3A 3I3LA 2LSOA 3ABMH 2R7VA 4MGRA 5BNGA 4II2A 2ME0A 1FZPB 3HRSA 3L9FA 2HVSA 1IRZA 4C30A 3D1NI 1W0UA 1W1WE 2A5YB 1IDZA 3SDGA 2ZXJA 4EJUA 4F3QA 1XX5A 5IOYA 1SFXA 4G6TB 4A93J 1N77A 1S9HA 2DA1A 3QODA 4FX0A 4C2UA 3DQVC 1ON1A 2QKLB 3LSHA 3SZPA 1SANA 2EQRA 4CUGA 2VKEA 2EB7A 2A05A 1IN8A 3HGYA 2OA4A 3K1PA 3KP7A 2JA2A 4BACA 3O6BB 3E5XA 4A0YA 3GFJA 5FLXK 3KCCA 1LKXA 1IRFA 3ZQGA 2AS5F 1U5TC 1V55H 5IT3A 1I1SA 3S32A 1ON2A 4CICA 1AWCA 4D7MA 5L3DA 3DPTA 1JXSA 2M4GA 3EUKL 2BEOA 2ZO4A 3AL0C 2HR3A 2JRTA 2XF7A 4A3FJ 4A3MJ 2R92J 2LVSA 3F72A 3WG9A 2O8KA 1R1UA 3MMYB 4DGWB 2D5VA 5CQEA 3QYFA 1SMTA 2VE8A 4PUSA 3HOYJ 2ZB9A 4H4KC 2CQNA 1UG0A 4RBOA 4XOPA 1BN5A 1JKQC 4AVPA 1SAXA 4NC6A 3I55I 2DT6A 2LBFA 3L09A 3BC8A 2P6TA 1YE9A 4XLEA 1Z1DA 1MGTA 1VQ6I 5ILUA 3M07A 2QUFA 2W24A 5K5OA 3K4KA 1VQMI 3LQQA 5C4JJ 2E71A 3D5SC 1HF0A 2PX9A 1Y6IA 1IN7A 4G7OF 2MW8A 3S93A 3CDIA 4N9HA 4ZTFA 1BI3A 3LNQA 3GUDA 1UJ8A 4XKVA 4HG2A 1OCRH 2VQLA 3RJPA 2HTJA 2VI6A 4NNJA 3J7YJ 4G7HF 1BA5A 5KVRA 3CMMA 3GTJJ 3ZMSA 3KX2A 1ENHA 1K4SA 2X1DA 3J80Z 4A3BJ 1G59A 2Z16A 5DEQA 2FUG2 4IQ4A 4UB8C 4B09A 2X9DA 3HG9A 3OYNA 2E1MC 5BPIA 1ZN2A 1T95A 1FY7A 5HS9A 2WA0A 2VUMJ 2NVUB 4R1HA 4HNTA 3MWMA 1BW6A 3CDLA 1MMAA 1LB2A 4G6QA 2VN2A 5J1YA 1TW3A 2W84A 2WB1N 4KA4A 4L5EA 1Z9CA 1RR8C 2NVYJ 4O5VA 1S72I 4J01A 2E34A 2LP0A 3ONQA 5D6EA 2Y31A 3BP8A 3HIFA 3P9CA 3CQZJ 4YIIA 2X6OA 2R7TA 3M1EA 2NVQJ 2VT3A 1G3TA 1I3AA 1VNDA 2CMPA 4V19K 4U0YA 4A0XA 5EZHA 2WBMA 5J8CA 2ISYA 1RIOH 1G6NA 3GF2A 2MBFA 4J00A 3OYAA 2LC2A 2GM4A 3IWFA 1JUSA 2IGOA 3HRMA 5F08A 3KZYA 2EFQA 4QIWN 1O3SA 1Z05A 1XDSA 1ETOA 2E19A 2FBIA 2DQLA 4ZYAA 5KK1A 1SC7A 2D2WA 5DD8A 1LNWA 4PSWA 4PFOA 3CCYA 4KT5C 2JUGA 2KZVA 1IZ1A 2BE5F 3UNGC 5LEJA 3FXLA 3ESWB 1VQ5I 2EZIA 2B9SA 3PUFA 1F36A 3OSFA 2LG4A 5HNFA 3E0JB 1KONA 3DKWA 3EUHC 2IEKA 2VBZA 2FXAA 2K27A 2K86A 4XR6A 2MSYA 2VJIA 3V7RA 1IF1A 4CCLA 3KP5A 4HV5A 1H8AC 4Q4ZF 3JRIA 4JX5A 1BI1A 3CUQB 1TNTA 2E5NA 4RGXA 4G12A 4ZH4F 2QQBA 2XAQA 1S7OA 1LEBA 3HTUA 1XMKA 1DQUA 2DPUA 1B1BA 2F2EA 3K7AJ 3I9V2 5HLIA 1EH7A 2OC6A 1ZAOA 2OU2A 2EIJH 2LR8A 5LEKA 2KIFA 1TL8A 1KQ9A 4AWXB 2VXZA 5E3LA 4EQQA 2R7QA 2JSPA 3BZ6A 3CESA 3MN2A 1P4WA 4M9XA 2X51A 4EMSA 3I4NJ 3SZGA 4IO9F 2IA0A 3REOA 4Y17A 2KDZA 4HNVA 5FRMA 1Q1VA 1TT0A 3SQNA 1QO0D 3VDXA 2M5WA 2WAQN 2HXOA 2NVXJ 1B4AA 5HDKA 3L2QA 3M8FA 3W2WA 1QRYA 4N4OB 4XKCA 2VB6A 3EETA 3OOUA 3HGGA 2WAEA 1R58A 2FU4A 3LSIA 3WTSC 3ELKA 1XGOA 3CP8A 3LMMA 2M1BA 4XN0A 3T1BA 3BG5A 2PMZA 5E8GA 2IPQX 1XGSA 2XC7A 3LSGA 2F6CA 4W1UA 2F5DA 1YG2A 1BL0A 2RQPA 4M3GA 1WSUA 2QZ8A 3L7WA 1QGPA 1R49A 2DOFA 2E1CA 4LG0B 5HLHA 2D1HA 2P0WA 3GZ6A 1FPQA 3J81K 2MFZA 2HEOA 2LRDA 2EWNA 5KAFC 1YW9A 3FDYA 1WJBA 3F8CA 5GAEJ 4D9JA 2Q1ZB 1HA8A 4IOCF 3PNTA 2HKXA 5H6QA 5F0CA 3HXLA 3K70D 1BI0A 1FOWA 2KIQA 3GTKJ 2LY2A 2OAZA 3KEYA 1MNDA 2XAGA 3W6KB 1WJ5A 5L3GA 4BJ5C 3TDUC 2FSWA 2R7XA 1DGWY 3PFYA 1MJ9A 1LVAA 4R8HA 5AIQA 3BPVA 4HEA2 2P6SA 1E2XA 3CMYA 4AC0A 3L2RA 2EV5A 5F1RA 1D5YA 1KU3A 4R79A 1XN7A 2DLLA 2HQ5A 2KFDA 4PZJA 3Q5FA 4ZYHA 5KHDA 1SD4A 1AHDP 2P8TA 1U5TB 2DODA 1E3OC 3G73A 5EGOA 1WGXA 4QPQA 3MKWB 1FYMA 1BR1A 4OMZA 4WF2A 1RRJA 3C2BA 1IUYA 4JBAA 1V5EA 2L0KA 3RQ4A 2H94A 1MNMC 3I58A 4CHUA 1TWGJ 3O3KA 2K9NA 3Q0VA 3V8LA 2R93J 2EBIA 2HU9A 2OV7A 3RYPA 1ZLJA 1JGSA 4XIDA 2STTA 3K69A 3MEXA 3RDIA 4QWQA 3A02A 1KYZA 3RPUA 4F7ZA 1XMXA 4II3A 2EFOA 1IUFA 3OR2C 5CVIA 3IUOA 4P96A 1T33A 5LGNA 2HGCA 4NHJA 1SVLA 4Y15A 2RQQA 2ECCA 5FKKA 4XSZF 4QPOA 3I0TA 3L2WA 2LMDA 3CTAA 1KU2A 2QYOA 3RPQA 3PIOF 2YSRA 4YELA 1JT0A 2JRMA 4EJTA 5L3CA 2R0QC 1RESA 3LA3A 1JI8A 9ANTA 1IN5A 4PGGA 2HWVA 3EUHA 2XUBA 3RKYA 2ZFWA 5JFRA 4U7BA 1HDPA 4YEJA 3Q0WA 2F5CA 3WU1B 2PJRA 4GFBA 3CLOA 4MEXF 3KYCB 2EINH 5H6RA 4OMYA 1FSEA 2GA2A 2KHMA 3J7ZI 2XGXA 3LQRA 2R7UA 3PSIA 2XPVA 2O9LA 2VKVA 4GO1A 1K6YA 3FK7A 1J0RA 1VQ8I 3I71A 2QBYA 4IJAA 4E7IA 2HOSA 2Y9ZA 2K40A 5TGTA 3MVPA 4Q5SF 1YJNI 2VIXA 3GFMA 4EVIA 5JR3A 3COAC 4IHYA 1Z77A 2E36A 3GLXA 3TBIA 1VQOI 3PUBA 1QVUA 4DOZA 4RLFA 2VBXA 3SJMA 1VFCA 4BQAA 1FWZA 3H5RA 4IHXA 3K70C 2HTSA 3VSLA 1VQ7I 1A36A 2ESHA 2FBKA 3HYIA 3OS1A 2J5PA 4BE2A 3BR1A 2TCTA 4HA8A 3MKZA 2RKHA 3Q3SA 2LKPA 1R71A 4LLGF 2LYCA 2LNBA 2ID3A 2Z2SB 3IH2A 2BHYA 3OS0A 1PP7U 3VODA 2DAOA 2H8RA 3CCEI 2XAJA 2XIGA 1TQMA 3E5UA 4WWCA 2JA5J 1D1AA 2ESNA 3VYUB 3I4PA 1K6OA 1ZTRA
chains in the Genus database with same CATH topology
2HOEA 4XLNF 3VFZA 1UCRA 1UHWA 1S3JA 2FBHA 2H6CA 1U78A 4YFXF 1O3QA 1IRGA 4CO8A 4UXNA 3G3ZA 2WWYA 1S29A 5BMZA 3BPXA 4JQFA 1LDDA 3QPHA 1K78A 1S7AA 4A6EA 3ZN1A 2COMA 4S05A 2PMHA 3FMQA 4HX7A 2D45A 3VB2A 2EV6A 2CQKA 3HSEA 2HYFA 3DF8A 4GYGA 3WE2A 2J5OA 1U3EM 4N9IA 3TO6A 3MZYA 2Z99A 4KIBA 3HHGA 4L5IA 1HKTA 4TV7A 2XVCA 5FD6A 3E97A 4CXFA 4DQ2A 1PDNC 3QRFF 1DDNA 1W7PB 2ZNYA 3QU3A 4RB0A 2O8XA 5FFZA 2QQ9A 2KRFA 4UUVA 3GW2A 4MQ9F 3F8BA 2P5LC 3ZP5A 1WQ2A 3EDPA 1CF7A 5HDNA 1OKRA 5HVQC 5JVTA 1BJAA 3JTHA 2FNAA 1STZA 2NAZA 4EM2A 2O3FA 4ASNA 2K4BA 4WXHA 2XV4S 4IHSA 2XROA 4P9FA 1SD6A 1S8NA 2UWMA 5ICFA 3I53A 3RKXA 3I59B 4WXCA 5D6FA 5DD4A 4MTDA 2IA2A 2PEXA 1DPRA 1ZG3A 2MH9A 1CGPA 3WTXC 4UV8A 4B8XA 3HSRA 3QP5A 4EM1A 2O61A 4IRGA 1PP8F 1I6XA 3BJOA 3V7CA 2KKOA 2QLZA 1FYKA 2A6HF 3HHHA 2VOOA 2VT2A 5BPDA 1MDMA 3ZMUA 3E6MA 3N97A 1Z7UA 3F8MA 2AXLA 2ZCWA 1MDMB 2EK5A 3H92A 2EJRA 3DV8A 3GFLA 4U0WA 4P9UA 4LJZF 2JT1A 1LJ9A 3I5UA 4I02A 1RNLA 1FP1D 2A69F 4M9ZA 5F64A 2K4JA 4I2OA 2UXXA 5DCMA 3K2ZA 1MD0A 1KGSA 1HQCA 2ZBKA 1ODDA 2WTEA 2OQRA 4RGRA 4O6JA 3ROUA 2F5EA 3MCZA 1IN4A 2NS0A 2JTVA 1R5GA 1UHMA 2XAHA 1QZZA 4L9NA 3GXOA 3E3VA 3IKTA 1L0OC 4EJWA 3FXQA 3M9AA 2ADUA 3DFGA 4A5NA 1TLHB 1XB4A 1YFHA 1RUOA 3ULQB 1RI7A 1KQ8A 3MZHA 2ZMEB 3LA7A 5HDGA 3LSTA 1GVJA 1GXPA 1ZLKA 2CWEA 5DYMA 4ON0A 5DDGA 1MKMA 4BHCA 2ACJA 4KN7X 2MD5A 2DK5A 1YTYA 2KJBA 3S2WA 2X0LA 4OIRF 4YIFA 3HRTA 5LRSA 1O3TA 1WKMA 4LD5A 5LRRA 2MLKA 2LF8A 3EYYA 5D5UB 1CF7B 5BQTA 2V1DA 2RC4A 2NNYA 4KIFA 4G6DA 4KUMA 5E17F 4Y13A 1QZYA 5E1WA 1QQIA 4OIOF 2CFXA 3BOQA 2A07F 1X3UA 3TOBA 4XRFA 3OOPA 1SFEA 2O03A 5ED4A 1FNNA 2P7CB 3KZZA 2A6EF 4ZYEA 4H0EA 2NRAC 2HDCA 3ZMTA 4FX4A 4LMYA 2K02A 3ML6A 2YX4A 3CJNA 2XHKA 4U0VA 3PFIA 1UB9A 1IW7F 3GZ5A 3WTUC 2PI0A 2JPCA 4YFNF 4KNYA 4BHPA 4MEYF 1FBUA 5ILVA 2DQRA 3PQJA 1BC7C 5DUKA 4HLYA 3CUQA 2HYGD 3Q9SA 1FBQA 3PQKA 3ZMDA 3AAFA 1QNTA 4WCGA 4L9TA 3WTZA 2F5FA 5L3BA 1BM9A 2GZWA 1PUEE 2JSCA 1ZYRF 1K7AA 1U2WA 3CO6C 1H0MA 1J9IA 4IF4A 2Y0MA 4XSXF 2YX7A 2HQRA 2PBIA 3F22A 5FD5A 2WV0A 1ZRCA 3VEPA 1KU7A 3ECOA 4MTEA 4ZZDA 3HUGA 4CDGA 3LAJA 3D0SA 3P7NA 5E1XA 1BOAA 3TKYA 4OIPF 1V4RA 1O7FA 2QM3A 2H09A 2YPRA 5EEHA 2FA5A 3V8JA 4BYYA 3RYRA 3V4GA 2Q2EA 5D8KB 1F5TA 5H20A 1D3YA 2DO7A 1I27A 4HX4A 5AIPA 3MAJA 1T0FA 5K5QA 4Z2YA 4RS8A 1EH6A 1R1VA 3F23A 1QBJA 3BY6A 3E6BA 5DV5A 4BH9A 4DNCA 2PN6A 3FMRA 4ZYDA 5CVUA 1J75A 3IWZA 5E8IA 3F8FA 1W4MA 1WI9A 4G9YA 3W6JB 5FB2A 5E18F 3IKVA 4XLPF 3K9TA 4CZZA 3U2RA 3M8EA 3R0JA 1XSVA 2EFNA 4AIJA 2KIUA 3GFIA 4I0AA 2JPBA 2GIVA 4P55A 4L0ZB 3ZQ7A 1H9TA 1BIBA 3H3ZA 1EV7A 4HBLA 1TNSA 3KEOA 2EA4A 4PDKA 2FEZA 2L4MA 5ILSA 4EM0B 1OR7A 3P9IA 5ICGA 1G3WA 4GGGA 3E6DA 4YG2F 4I09A 5CVRA 3U1DA 3NQOA 5IT9K 3GYHX 3JAMZ 1L3LA 2BV6A 3BJAA 1KU9A 4L0YB 1YIOA 3GWZA 4AIHA 2GWRA 1LDJA 4L18B 5D5VB 3CO7C 5L3EA 1P92A 3FF5A 5BS6A 3R6SA 3F6OA 2ETHA 4UVCA 1IAWA 5EEGA 5CYVA 1TBXA 4HW0A 3WGIA 4BXUA 4UVAA 4RAYA 2HZTA 2CSOA 3SXYA 4EGZA 3LA2A 2Z9OA 4RB2C 3GX4X 2A68F 1JHFA 2E7WA 1SD5A 3ISPA 3TO9A 2RV8A 4HDVA 1K78B 5LLQA 3WU0A 2V1XA 4LLNA 1MZBA 2LF7A 2G7UA 1ZARA 5E20A 2Q8KA 3MQ0A 3F6VA 2M87A 3ABTA 1DPUA 2CGPA 3Q9VA 1E17A 1FBSA 1W7PA 4FT8A 3IL2A 1IN6A 2VOPA 2STWA 1T39A 3H3UA 3HSFA 2ISZA 2P7VB 1AOYA 3JAMK 1JHHA 5A2QK 1OYIA 3ZN0A 3L00A 1HSTA 1FYLA 1Z6RA 2PLYA 1XD7A 2XASA 3B02A 4KMFA 4ENNA 2V9VA 2MC3A 4RB1A 2EA2A 3J81Z 1HSJA 1P2FA 3NEUA 4ENKA 2DW4A 1G3SA 5TRDA 2FQ3A 1A04A 2D1VA 4Q47A 4EJOA 1YW8A 4RAZA 2DI3A 4WK8F 4KN4X 3QAHA 3WTVC 1FP2A 3BDDA 1XDUA 3QU6A 4OOIA 3RTRA 4HF0A 4O3MA 3JTGA 2YU3A 5LHGA 4AD9A 4ENJA 1YS7A 2MH2A 1IXSB 1DUXC 3WODF 3HOSA 4GCVA 1LQ1A 1ZRDA 3QOPA 2BBYA 4NB5A 2L3DA 4M6YA 1B9MA 2Y75A 2IT0A 1SD7A 1USSA 3LAPA 1XMAA 2RNJA 3I54A 1R5HA 1YLFA 2FMLA 2R7DA 2VBYA 2Z33A 2Z3YA 1FC3A 3E6CC 4L5JA 1IXRC 4A5MA 4N0BA 2DTRA 2C6YA 1D8KA 2GXBA 4LG0A 2MLGA 2Z5UA 3K1NA 1REPC 2P4WA 1HW5A 1NHAA 3L2CA 2OZUA 5A2QZ 2XRNA 2TDXA 1EH8A 1J5YA 2M30A 3ERED 4IRIA 3J7AO 3J80K 1F1ZA 3ECHA 2NYXA 1R36A 4IXAA 4HZFA 4GXOA 2QWWA 1W5SA 1FOKA 2PMUA 1G3YA 4HF1A 1W7PD 3R4KA 1DP7P 1XSXA 5CJ9A 2IVMA 4U7DA 1SFUA 3ZMZA 1R22A 1LDKB 3WGGA 5BOXA 4LGWA 2ZKZA 4ESJA 4IRHA 1KA8A 3IC7A 4XBFA 1P4XA 4FHTA 3IRRA 4HF2A 4HLXA 3LWFA 2GXGA 4RGUA 4LB5A 2QENA 4G8XA 2PQ8A 2ZNZA 2EFPA 5FLXZ 3RIRA 4K2EA 4E70A 3FWEA 1ZRFA 5ICEA 2R7FA 2GQQA 1FLIA 5ERIA 3FHZA 3EYIA 3KLNA 3C1DA 4BAYA 1H9GA 3T5XA 4M9SA 2M45A 5K1YA 3F3XA 3F21A 2W25A 4A2UA 4EJVA 4ESFA 2QQAA 4KICA 1OMIA 2XKOA 3R61A 4MNUA 1TQPA 4UNOA 3ABUA 4UV9A 4LLLA 2PJPA 5CLSA 2E1NA 2K7LA 3R60A 2FE3A 5E1ZB 3NRVA 4EGYA 2GAUA 1V3FA 3TQNA 3KLOA 1ZGAA 5HLGA 5K5RA 3T8RA 5DUIA 3CUOA 1XSDA 3FZVA 3FM3A 4M74A 3MFKA 4I0BA 1FX7A 1XGNA 2CW0F 4ETSA 2ELHA 2M8EA 3D5LA 2HFHA 4KIGA 4CYDA 2L01A 2BGCA 1SMYF 3BWGA 4HV6A 2OD5A 1HKQA 1MJBA 2G9WA 2OQGA 4UHTA 1B6AA 1YO5C 3DPLC 1FT9A 1ZHFA 3FM5A 3FXRA 5FO5A 4L9VA 2FRHA 2FF4A 4HQEA 4EV0A 2P5VA 4RB3C 4BHBA 1U5TA 1HW2A 4OIQF 1Z6TA 3EQLF 5D5XB 2IA1A 1OYYA 1BBYA 4KDPA 3WGHA 3KEQA 2Y48A 4OINF 5D8LB 3E5QA 5J8FA 3IRQA 2FNPA 3U9GA 3I59A 3KFWX 1Q1HA 2FOKA 1T2KA 3JW4A 4LK0F 1TQIA 2RVCA 2V1UA 1YS6A 1ONVA 1D8JA 5ICCA 3V8KA 1LEAA 2JZYA 1WWXA 4JK1X 2L4AA 1KYWA 2HKOA 1ZGJA 1I1GA 1F9NA 2DK8A 1P6RA 1Y0UA 5IT9Z 3O2PE 1B59A 1YQAA 4S04A 3KETA 5HOOA 4HX8A 5CVVA 2EV0A 4IPAA 4HAMA 2QVOA 3LFKA 2WC2A 3QP6A 5LBQA 5HS8A 1D5VA 5HS7A 3I64A 3ZMVA 1W5TA 4CGZA 1TTYA 1F4KA 3WTTC 3B73A 3CUQC 4ESBA 2A61A 4ZZLA 4UVBA 2DBBA 4U88A 4QLCU 3C18A 1RZ4A 2CYYA 3FXUA 3T8TA 1IXCA 5AONA 2O6GE 2IW5A 3GVAA 2UZKA 4M72A 1GHCA 1ZG1A 2OBPA 2IRFG 1TW2A 1O57A 1ULYA 3DP7A 1BI2A 4I01A 1GXQA 1ZREA 2KJCA 1T38A 2Q0OA 4AIKA 3GO5A 5LGTA 3R0AA 3FMSA 2W85A 2IJLA 4Q48A 5DCMB 5D5WB 3F8NA 2V79A 4I7HA 5D4SA 1T6SA 2YR2A 2UXNA 1XCVA 4WX9A 3C3WA 4HYEA 3DXJF 3KP4A 3P9KA 1U8RA 2VBWA 4KYWA 5CVJA 4KFCA 3KE2A 4MHGA 4PCQA 3GEZA 4LFUA 2W57A 4L9JA 1B9NA 2GA1A 2DFIA 4IVNA 1O3RA 1S6LA 5J6XA 2VC1A 2A3SA 1RUNA 6PAXA 2H27A 1T98A 5LGUA 4G7ZF 4KMUX 1J2XA 3QPTA 4YFKF 3T0YA 2HS5A 4HQMA 5F6FA 3WTWC 3TDZC 3KP2A 4LK1F 3HTSB 5JHUA 1G4DA 2XKPA 2QBYB 4IHTA 5D4RA 2BYVE 1I5ZA 5TJJA 1HW1A 1JE8A 2O0YA 3SFZA 5LHHA 1Z91A 2VC0A 3HRUA 1UFMA 2H6BA 3DEUA 5JI6A 3SZTA 3BJ6A 2B0LA 3TGNA 4A0ZA 4M71A 3OV8A 1YYVA 3BROA 3ZPLA 1HKSA 4ENMA 3JSOA 2CO5A 1U6GA 1R1TA 1O7LA 3C7JA 1OYWA 2PG4A 4I98B 4A6DA 1BIAA 4ZYGA 2HQNA 4OU0A 2RN7A 4WXDA 2E7XA 3HOTA 1XCBA 1ZH5A 1MJAA 1FSHA 1ZG5A 4D0PA 3KP6A 4HOBA 3SHFA 3WTYC 2DPDA 3FX3A 2X4HA 2VONA 1USTA 2VE9A 4M6XA 1HXDA 4BNCA 1WRJA 3V7SA 2R3SA 5L3FA 3VOEA 2L02A 2CG4A 2KIMA 2DT5A 3JSPA 2FMYA 1P4AA 2IP2A 3N4MA 5FGMA 4HDUA 3K1MA 1VTNC 1XGMA 4PGHA 4RGSA 1BC8C 2MA3A 3RI4A 1HBXG 2ZMEA 2RGVA 2V6CA 5LHIA 2VODA 3WE3A 4LB6B 1K79A 4NQWA 3IHUA 1R23A 4G94A 2NNNA 3TOAA 1J59A 2EFWA 1R7JA 1KQ0A 4P5OA 3K0LA 1R00A 2G7HA 1QPMA 1C0WA 5DCFA 2OZ6A 2RDPA 1OPCA 4MQVA 4GYIA 3CDHA 4M73A 3RKWA 3M7GA 1YW7A 3TO7A 4A12A 2XAFA 5FFXA 1J7KA 2LDUA 2P5KA 2ZJ2A 2DU9A 3KP3A 2PFBA 2L54A 2LSOA 4MGRA 1FZPB 3HRSA 3L9FA 2A5YB 2ZXJA 4EJUA 1SFXA 4FX0A 3DQVC 1ON1A 3SZPA 2EB7A 1IN8A 2OA4A 3K1PA 3KP7A 3O6BB 3E5XA 4A0YA 3GFJA 5FLXK 3KCCA 1IRFA 2AS5F 1U5TC 5IT3A 1I1SA 1ON2A 4CICA 1AWCA 5L3DA 3DPTA 1JXSA 2BEOA 2ZO4A 2HR3A 2JRTA 3F72A 3WG9A 1R1UA 1SMTA 2VE8A 1BN5A 4AVPA 1SAXA 3L09A 2P6TA 1Z1DA 1MGTA 5ILUA 2QUFA 2W24A 5K5OA 3LQQA 1IN7A 4G7OF 4N9HA 1BI3A 3GUDA 3RJPA 2HTJA 4G7HF 5KVRA 3ZMSA 3J80Z 5DEQA 4B09A 5BPIA 1ZN2A 1FY7A 5HS9A 4R1HA 3MWMA 1LB2A 4G6QA 2VN2A 1TW3A 2W84A 1Z9CA 4KA4A 4O5VA 5D6EA 3BP8A 3HIFA 3P9CA 4YIIA 3M1EA 2VT3A 1G3TA 4U0YA 4A0XA 5J8CA 2ISYA 1RIOH 1G6NA 3GF2A 2MBFA 3IWFA 3HRMA 3KZYA 2EFQA 1O3SA 1Z05A 1XDSA 2FBIA 2DQLA 5KK1A 2D2WA 5DD8A 1LNWA 4KT5C 1IZ1A 2BE5F 5LEJA 3DKWA 2VBZA 2FXAA 2K27A 2K86A 3V7RA 1IF1A 3KP5A 4HV5A 4Q4ZF 1BI1A 3CUQB 1TNTA 4RGXA 4ZH4F 2QQBA 2XAQA 1S7OA 1LEBA 3HTUA 1XMKA 2DPUA 1B1BA 2F2EA 5HLIA 1EH7A 1ZAOA 2OU2A 5LEKA 2KIFA 1KQ9A 4AWXB 2VXZA 4EQQA 3BZ6A 1P4WA 4M9XA 4EMSA 2IA0A 3REOA 4Y17A 3SQNA 1QO0D 2M5WA 1B4AA 5HDKA 3M8FA 3EETA 1R58A 2FU4A 3WTSC 3ELKA 1XGOA 2M1BA 3T1BA 5E8GA 2IPQX 1XGSA 2F5DA 1YG2A 2RQPA 1WSUA 2QZ8A 3L7WA 1QGPA 2E1CA 4LG0B 5HLHA 2D1HA 3GZ6A 1FPQA 3J81K 2HEOA 2EWNA 1YW9A 3F8CA 2HKXA 5H6QA 1BI0A 2OAZA 2XAGA 3W6KB 5L3GA 3TDUC 2FSWA 1MJ9A 1LVAA 4R8HA 5AIQA 3BPVA 2P6SA 1E2XA 2EV5A 5F1RA 1KU3A 4R79A 1XN7A 2DLLA 3Q5FA 4PZJA 4ZYHA 1SD4A 2P8TA 1U5TB 3G73A 1FYMA 4OMZA 4WF2A 1IUYA 4JBAA 2H94A 4CHUA 3I58A 3O3KA 3V8LA 3RYPA 1ZLJA 1JGSA 2STTA 3K69A 3MEXA 3RDIA 4QWQA 1KYZA 3RPUA 4F7ZA 2EFOA 5CVIA 4P96A 5LGNA 2HGCA 4NHJA 4Y15A 4XSZF 3I0TA 3CTAA 1KU2A 2QYOA 3RPQA 2YSRA 4EJTA 5L3CA 3LA3A 1IN5A 4PGGA 2HWVA 3EUHA 2XUBA 3RKYA 2ZFWA 5JFRA 4U7BA 2F5CA 3WU1B 3CLOA 4MEXF 5H6RA 4OMYA 1FSEA 2GA2A 2XGXA 3LQRA 4GO1A 1J0RA 3I71A 2QBYA 4IJAA 4Q5SF 3GFMA 4EVIA 5JR3A 3COAC 3GLXA 2VBXA 4BQAA 1FWZA 2HTSA 2ESHA 2FBKA 3HYIA 2J5PA 4HA8A 2RKHA 2LKPA 4LLGF 2LNBA 1PP7U 3VODA 2DAOA 2XAJA 2XIGA 1TQMA 3E5UA 4WWCA 2ESNA 3I4PA 1K6OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HOE A;  4XLN F;  3VFZ A;  1UCR A;  1UHW A;  1S3J A;  2FBH A;  2H6C A;  1U78 A;  4YFX F;  1O3Q A;  1IRG A;  4CO8 A;  4UXN A;  3G3Z A;  2WWY A;  1S29 A;  5BMZ A;  3BPX A;  4JQF A;  1LDD A;  3QPH A;  1K78 A;  1S7A A;  4A6E A;  3ZN1 A;  2COM A;  4S05 A;  2PMH A;  3FMQ A;  4HX7 A;  2D45 A;  3VB2 A;  2EV6 A;  2CQK A;  3HSE A;  2HYF A;  3DF8 A;  4GYG A;  3WE2 A;  2J5O A;  1U3E M;  4N9I A;  3TO6 A;  3MZY A;  2Z99 A;  4KIB A;  3HHG A;  4L5I A;  1HKT A;  4TV7 A;  2XVC A;  5FD6 A;  3E97 A;  4CXF A;  4DQ2 A;  1PDN C;  3QRF F;  1DDN A;  1W7P B;  2ZNY A;  3QU3 A;  4RB0 A;  2O8X A;  5FFZ A;  2QQ9 A;  2KRF A;  4UUV A;  3GW2 A;  4MQ9 F;  3F8B A;  2P5L C;  3ZP5 A;  1WQ2 A;  3EDP A;  1CF7 A;  5HDN A;  1OKR A;  5HVQ C;  5JVT A;  1BJA A;  3JTH A;  2FNA A;  1STZ A;  2NAZ A;  4EM2 A;  2O3F A;  4ASN A;  2K4B A;  4WXH A;  2XV4 S;  4IHS A;  2XRO A;  4P9F A;  1SD6 A;  1S8N A;  2UWM A;  5ICF A;  3I53 A;  3RKX A;  3I59 B;  4WXC A;  5D6F A;  5DD4 A;  4MTD A;  2IA2 A;  2PEX A;  1DPR A;  1ZG3 A;  2MH9 A;  1CGP A;  3WTX C;  4UV8 A;  4B8X A;  3HSR A;  3QP5 A;  4EM1 A;  2O61 A;  4IRG A;  1PP8 F;  1I6X A;  3BJO A;  3V7C A;  2KKO A;  2QLZ A;  1FYK A;  2A6H F;  3HHH A;  2VOO A;  2VT2 A;  5BPD A;  1MDM A;  3ZMU A;  3E6M A;  3N97 A;  1Z7U A;  3F8M A;  2AXL A;  2ZCW A;  1MDM B;  2EK5 A;  3H92 A;  2EJR A;  3DV8 A;  3GFL A;  4U0W A;  4P9U A;  4LJZ F;  2JT1 A;  1LJ9 A;  3I5U A;  4I02 A;  1RNL A;  1FP1 D;  2A69 F;  4M9Z A;  5F64 A;  2K4J A;  4I2O A;  2UXX A;  5DCM A;  3K2Z A;  1MD0 A;  1KGS A;  1HQC A;  2ZBK A;  1ODD A;  2WTE A;  2OQR A;  4RGR A;  4O6J A;  3ROU A;  2F5E A;  3MCZ A;  1IN4 A;  2NS0 A;  2JTV A;  1R5G A;  1UHM A;  2XAH A;  1QZZ A;  4L9N A;  3GXO A;  3E3V A;  3IKT A;  1L0O C;  4EJW A;  3FXQ A;  3M9A A;  2ADU A;  3DFG A;  4A5N A;  1TLH B;  1XB4 A;  1YFH A;  1RUO A;  3ULQ B;  1RI7 A;  1KQ8 A;  3MZH A;  2ZME B;  3LA7 A;  5HDG A;  3LST A;  1GVJ A;  1GXP A;  1ZLK A;  2CWE A;  5DYM A;  4ON0 A;  5DDG A;  1MKM A;  4BHC A;  2ACJ A;  4KN7 X;  2MD5 A;  2DK5 A;  1YTY A;  2KJB A;  3S2W A;  2X0L A;  4OIR F;  4YIF A;  3HRT A;  5LRS A;  1O3T A;  1WKM A;  4LD5 A;  5LRR A;  2MLK A;  2LF8 A;  3EYY A;  5D5U B;  1CF7 B;  5BQT A;  2V1D A;  2RC4 A;  2NNY A;  4KIF A;  4G6D A;  4KUM A;  5E17 F;  4Y13 A;  1QZY A;  5E1W A;  1QQI A;  4OIO F;  2CFX A;  3BOQ A;  2A07 F;  1X3U A;  3TOB A;  4XRF A;  3OOP A;  1SFE A;  2O03 A;  5ED4 A;  1FNN A;  2P7C B;  3KZZ A;  2A6E F;  4ZYE A;  4H0E A;  2NRA C;  2HDC A;  3ZMT A;  4FX4 A;  4LMY A;  2K02 A;  3ML6 A;  2YX4 A;  3CJN A;  2XHK A;  4U0V A;  3PFI A;  1UB9 A;  1IW7 F;  3GZ5 A;  3WTU C;  2PI0 A;  2JPC A;  4YFN F;  4KNY A;  4BHP A;  4MEY F;  1FBU A;  5ILV A;  2DQR A;  3PQJ A;  1BC7 C;  5DUK A;  4HLY A;  3CUQ A;  2HYG D;  3Q9S A;  1FBQ A;  3PQK A;  3ZMD A;  3AAF A;  1QNT A;  4WCG A;  4L9T A;  3WTZ A;  2F5F A;  5L3B A;  1BM9 A;  2GZW A;  1PUE E;  2JSC A;  1ZYR F;  1K7A A;  1U2W A;  3CO6 C;  1H0M A;  1J9I A;  4IF4 A;  2Y0M A;  4XSX F;  2YX7 A;  2HQR A;  2PBI A;  3F22 A;  5FD5 A;  2WV0 A;  1ZRC A;  3VEP A;  1KU7 A;  3ECO A;  4MTE A;  4ZZD A;  3HUG A;  4CDG A;  3LAJ A;  3D0S A;  3P7N A;  5E1X A;  1BOA A;  3TKY A;  4OIP F;  1V4R A;  1O7F A;  2QM3 A;  2H09 A;  2YPR A;  5EEH A;  2FA5 A;  3V8J A;  4BYY A;  3RYR A;  3V4G A;  2Q2E A;  5D8K B;  1F5T A;  5H20 A;  1D3Y A;  2DO7 A;  1I27 A;  4HX4 A;  5AIP A;  3MAJ A;  1T0F A;  5K5Q A;  4Z2Y A;  4RS8 A;  1EH6 A;  1R1V A;  3F23 A;  1QBJ A;  3BY6 A;  3E6B A;  5DV5 A;  4BH9 A;  4DNC A;  2PN6 A;  3FMR A;  4ZYD A;  5CVU A;  1J75 A;  3IWZ A;  5E8I A;  3F8F A;  1W4M A;  1WI9 A;  4G9Y A;  3W6J B;  5FB2 A;  5E18 F;  3IKV A;  4XLP F;  3K9T A;  4CZZ A;  3U2R A;  3M8E A;  3R0J A;  1XSV A;  2EFN A;  4AIJ A;  2KIU A;  3GFI A;  4I0A A;  2JPB A;  2GIV A;  4P55 A;  4L0Z B;  3ZQ7 A;  1H9T A;  1BIB A;  3H3Z A;  1EV7 A;  4HBL A;  1TNS A;  3KEO A;  2EA4 A;  4PDK A;  2FEZ A;  2L4M A;  5ILS A;  4EM0 B;  1OR7 A;  3P9I A;  5ICG A;  1G3W A;  4GGG A;  3E6D A;  4YG2 F;  4I09 A;  5CVR A;  3U1D A;  3NQO A;  5IT9 K;  3GYH X;  3JAM Z;  1L3L A;  2BV6 A;  3BJA A;  1KU9 A;  4L0Y B;  1YIO A;  3GWZ A;  4AIH A;  2GWR A;  1LDJ A;  4L18 B;  5D5V B;  3CO7 C;  5L3E A;  1P92 A;  3FF5 A;  5BS6 A;  3R6S A;  3F6O A;  2ETH A;  4UVC A;  1IAW A;  5EEG A;  5CYV A;  1TBX A;  4HW0 A;  3WGI A;  4BXU A;  4UVA A;  4RAY A;  2HZT A;  2CSO A;  3SXY A;  4EGZ A;  3LA2 A;  2Z9O A;  4RB2 C;  3GX4 X;  2A68 F;  1JHF A;  2E7W A;  1SD5 A;  3ISP A;  3TO9 A;  2RV8 A;  4HDV A;  1K78 B;  5LLQ A;  3WU0 A;  2V1X A;  4LLN A;  1MZB A;  2LF7 A;  2G7U A;  1ZAR A;  5E20 A;  2Q8K A;  3MQ0 A;  3F6V A;  2M87 A;  3ABT A;  1DPU A;  2CGP A;  3Q9V A;  1E17 A;  1FBS A;  1W7P A;  4FT8 A;  3IL2 A;  1IN6 A;  2VOP A;  2STW A;  1T39 A;  3H3U A;  3HSF A;  2ISZ A;  2P7V B;  1AOY A;  3JAM K;  1JHH A;  5A2Q K;  1OYI A;  3ZN0 A;  3L00 A;  1HST A;  1FYL A;  1Z6R A;  2PLY A;  1XD7 A;  2XAS A;  3B02 A;  4KMF A;  4ENN A;  2V9V A;  2MC3 A;  4RB1 A;  2EA2 A;  3J81 Z;  1HSJ A;  1P2F A;  3NEU A;  4ENK A;  2DW4 A;  1G3S A;  5TRD A;  2FQ3 A;  1A04 A;  2D1V A;  4Q47 A;  4EJO A;  1YW8 A;  4RAZ A;  2DI3 A;  4WK8 F;  4KN4 X;  3QAH A;  3WTV C;  1FP2 A;  3BDD A;  1XDU A;  3QU6 A;  4OOI A;  3RTR A;  4HF0 A;  4O3M A;  3JTG A;  2YU3 A;  5LHG A;  4AD9 A;  4ENJ A;  1YS7 A;  2MH2 A;  1IXS B;  1DUX C;  3WOD F;  3HOS A;  4GCV A;  1LQ1 A;  1ZRD A;  3QOP A;  2BBY A;  4NB5 A;  2L3D A;  4M6Y A;  1B9M A;  2Y75 A;  2IT0 A;  1SD7 A;  1USS A;  3LAP A;  1XMA A;  2RNJ A;  3I54 A;  1R5H A;  1YLF A;  2FML A;  2R7D A;  2VBY A;  2Z33 A;  2Z3Y A;  1FC3 A;  3E6C C;  4L5J A;  1IXR C;  4A5M A;  4N0B A;  2DTR A;  2C6Y A;  1D8K A;  2GXB A;  4LG0 A;  2MLG A;  2Z5U A;  3K1N A;  1REP C;  2P4W A;  1HW5 A;  1NHA A;  3L2C A;  2OZU A;  5A2Q Z;  2XRN A;  2TDX A;  1EH8 A;  1J5Y A;  2M30 A;  3ERE D;  4IRI A;  3J7A O;  3J80 K;  1F1Z A;  3ECH A;  2NYX A;  1R36 A;  4IXA A;  4HZF A;  4GXO A;  2QWW A;  1W5S A;  1FOK A;  2PMU A;  1G3Y A;  4HF1 A;  1W7P D;  3R4K A;  1DP7 P;  1XSX A;  5CJ9 A;  2IVM A;  4U7D A;  1SFU A;  3ZMZ A;  1R22 A;  1LDK B;  3WGG A;  5BOX A;  4LGW A;  2ZKZ A;  4ESJ A;  4IRH A;  1KA8 A;  3IC7 A;  4XBF A;  1P4X A;  4FHT A;  3IRR A;  4HF2 A;  4HLX A;  3LWF A;  2GXG A;  4RGU A;  4LB5 A;  2QEN A;  4G8X A;  2PQ8 A;  2ZNZ A;  2EFP A;  5FLX Z;  3RIR A;  4K2E A;  4E70 A;  3FWE A;  1ZRF A;  5ICE A;  2R7F A;  2GQQ A;  1FLI A;  5ERI A;  3FHZ A;  3EYI A;  3KLN A;  3C1D A;  4BAY A;  1H9G A;  3T5X A;  4M9S A;  2M45 A;  5K1Y A;  3F3X A;  3F21 A;  2W25 A;  4A2U A;  4EJV A;  4ESF A;  2QQA A;  4KIC A;  1OMI A;  2XKO A;  3R61 A;  4MNU A;  1TQP A;  4UNO A;  3ABU A;  4UV9 A;  4LLL A;  2PJP A;  5CLS A;  2E1N A;  2K7L A;  3R60 A;  2FE3 A;  5E1Z B;  3NRV A;  4EGY A;  2GAU A;  1V3F A;  3TQN A;  3KLO A;  1ZGA A;  5HLG A;  5K5R A;  3T8R A;  5DUI A;  3CUO A;  1XSD A;  3FZV A;  3FM3 A;  4M74 A;  3MFK A;  4I0B A;  1FX7 A;  1XGN A;  2CW0 F;  4ETS A;  2ELH A;  2M8E A;  3D5L A;  2HFH A;  4KIG A;  4CYD A;  2L01 A;  2BGC A;  1SMY F;  3BWG A;  4HV6 A;  2OD5 A;  1HKQ A;  1MJB A;  2G9W A;  2OQG A;  4UHT A;  1B6A A;  1YO5 C;  3DPL C;  1FT9 A;  1ZHF A;  3FM5 A;  3FXR A;  5FO5 A;  4L9V A;  2FRH A;  2FF4 A;  4HQE A;  4EV0 A;  2P5V A;  4RB3 C;  4BHB A;  1U5T A;  1HW2 A;  4OIQ F;  1Z6T A;  3EQL F;  5D5X B;  2IA1 A;  1OYY A;  1BBY A;  4KDP A;  3WGH A;  3KEQ A;  2Y48 A;  4OIN F;  5D8L B;  3E5Q A;  5J8F A;  3IRQ A;  2FNP A;  3U9G A;  3I59 A;  3KFW X;  1Q1H A;  2FOK A;  1T2K A;  3JW4 A;  4LK0 F;  1TQI A;  2RVC A;  2V1U A;  1YS6 A;  1ONV A;  1D8J A;  5ICC A;  3V8K A;  1LEA A;  2JZY A;  1WWX A;  4JK1 X;  2L4A A;  1KYW A;  2HKO A;  1ZGJ A;  1I1G A;  1F9N A;  2DK8 A;  1P6R A;  1Y0U A;  5IT9 Z;  3O2P E;  1B59 A;  1YQA A;  4S04 A;  3KET A;  5HOO A;  4HX8 A;  5CVV A;  2EV0 A;  4IPA A;  4HAM A;  2QVO A;  3LFK A;  2WC2 A;  3QP6 A;  5LBQ A;  5HS8 A;  1D5V A;  5HS7 A;  3I64 A;  3ZMV A;  1W5T A;  4CGZ A;  1TTY A;  1F4K A;  3WTT C;  3B73 A;  3CUQ C;  4ESB A;  2A61 A;  4ZZL A;  4UVB A;  2DBB A;  4U88 A;  4QLC U;  3C18 A;  1RZ4 A;  2CYY A;  3FXU A;  3T8T A;  1IXC A;  5AON A;  2O6G E;  2IW5 A;  3GVA A;  2UZK A;  4M72 A;  1GHC A;  1ZG1 A;  2OBP A;  2IRF G;  1TW2 A;  1O57 A;  1ULY A;  3DP7 A;  1BI2 A;  4I01 A;  1GXQ A;  1ZRE A;  2KJC A;  1T38 A;  2Q0O A;  4AIK A;  3GO5 A;  5LGT A;  3R0A A;  3FMS A;  2W85 A;  2IJL A;  4Q48 A;  5DCM B;  5D5W B;  3F8N A;  2V79 A;  4I7H A;  5D4S A;  1T6S A;  2YR2 A;  2UXN A;  1XCV A;  4WX9 A;  3C3W A;  4HYE A;  3DXJ F;  3KP4 A;  3P9K A;  1U8R A;  2VBW A;  4KYW A;  5CVJ A;  4KFC A;  3KE2 A;  4MHG A;  4PCQ A;  3GEZ A;  4LFU A;  2W57 A;  4L9J A;  1B9N A;  2GA1 A;  2DFI A;  4IVN A;  1O3R A;  1S6L A;  5J6X A;  2VC1 A;  2A3S A;  1RUN A;  6PAX A;  2H27 A;  1T98 A;  5LGU A;  4G7Z F;  4KMU X;  1J2X A;  3QPT A;  4YFK F;  3T0Y A;  2HS5 A;  4HQM A;  5F6F A;  3WTW C;  3TDZ C;  3KP2 A;  4LK1 F;  3HTS B;  5JHU A;  1G4D A;  2XKP A;  2QBY B;  4IHT A;  5D4R A;  2BYV E;  1I5Z A;  5TJJ A;  1HW1 A;  1JE8 A;  2O0Y A;  3SFZ A;  5LHH A;  1Z91 A;  2VC0 A;  3HRU A;  1UFM A;  2H6B A;  3DEU A;  5JI6 A;  3SZT A;  3BJ6 A;  2B0L A;  3TGN A;  4A0Z A;  4M71 A;  3OV8 A;  1YYV A;  3BRO A;  3ZPL A;  1HKS A;  4ENM A;  3JSO A;  2CO5 A;  1U6G A;  1R1T A;  1O7L A;  3C7J A;  1OYW A;  2PG4 A;  4I98 B;  4A6D A;  1BIA A;  4ZYG A;  2HQN A;  4OU0 A;  2RN7 A;  4WXD A;  2E7X A;  3HOT A;  1XCB A;  1ZH5 A;  1MJA A;  1FSH A;  1ZG5 A;  4D0P A;  3KP6 A;  4HOB A;  3SHF A;  3WTY C;  2DPD A;  3FX3 A;  2X4H A;  2VON A;  1UST A;  2VE9 A;  4M6X A;  1HXD A;  4BNC A;  1WRJ A;  3V7S A;  2R3S A;  5L3F A;  3VOE A;  2L02 A;  2CG4 A;  2KIM A;  2DT5 A;  3JSP A;  2FMY A;  1P4A A;  2IP2 A;  3N4M A;  5FGM A;  4HDU A;  3K1M A;  1VTN C;  1XGM A;  4PGH A;  4RGS A;  1BC8 C;  2MA3 A;  3RI4 A;  1HBX G;  2ZME A;  2RGV A;  2V6C A;  5LHI A;  2VOD A;  3WE3 A;  4LB6 B;  1K79 A;  4NQW A;  3IHU A;  1R23 A;  4G94 A;  2NNN A;  3TOA A;  1J59 A;  2EFW A;  1R7J A;  1KQ0 A;  4P5O A;  3K0L A;  1R00 A;  2G7H A;  1QPM A;  1C0W A;  5DCF A;  2OZ6 A;  2RDP A;  1OPC A;  4MQV A;  4GYI A;  3CDH A;  4M73 A;  3RKW A;  3M7G A;  1YW7 A;  3TO7 A;  4A12 A;  2XAF A;  5FFX A;  1J7K A;  2LDU A;  2P5K A;  2ZJ2 A;  2DU9 A;  3KP3 A;  2PFB A;  2L54 A;  2LSO A;  4MGR A;  1FZP B;  3HRS A;  3L9F A;  2A5Y B;  2ZXJ A;  4EJU A;  1SFX A;  4FX0 A;  3DQV C;  1ON1 A;  3SZP A;  2EB7 A;  1IN8 A;  2OA4 A;  3K1P A;  3KP7 A;  3O6B B;  3E5X A;  4A0Y A;  3GFJ A;  5FLX K;  3KCC A;  1IRF A;  2AS5 F;  1U5T C;  5IT3 A;  1I1S A;  1ON2 A;  4CIC A;  1AWC A;  5L3D A;  3DPT A;  1JXS A;  2BEO A;  2ZO4 A;  2HR3 A;  2JRT A;  3F72 A;  3WG9 A;  1R1U A;  1SMT A;  2VE8 A;  1BN5 A;  4AVP A;  1SAX A;  3L09 A;  2P6T A;  1Z1D A;  1MGT A;  5ILU A;  2QUF A;  2W24 A;  5K5O A;  3LQQ A;  1IN7 A;  4G7O F;  4N9H A;  1BI3 A;  3GUD A;  3RJP A;  2HTJ A;  4G7H F;  5KVR A;  3ZMS A;  3J80 Z;  5DEQ A;  4B09 A;  5BPI A;  1ZN2 A;  1FY7 A;  5HS9 A;  4R1H A;  3MWM A;  1LB2 A;  4G6Q A;  2VN2 A;  1TW3 A;  2W84 A;  1Z9C A;  4KA4 A;  4O5V A;  5D6E A;  3BP8 A;  3HIF A;  3P9C A;  4YII A;  3M1E A;  2VT3 A;  1G3T A;  4U0Y A;  4A0X A;  5J8C A;  2ISY A;  1RIO H;  1G6N A;  3GF2 A;  2MBF A;  3IWF A;  3HRM A;  3KZY A;  2EFQ A;  1O3S A;  1Z05 A;  1XDS A;  2FBI A;  2DQL A;  5KK1 A;  2D2W A;  5DD8 A;  1LNW A;  4KT5 C;  1IZ1 A;  2BE5 F;  5LEJ A;  3DKW A;  2VBZ A;  2FXA A;  2K27 A;  2K86 A;  3V7R A;  1IF1 A;  3KP5 A;  4HV5 A;  4Q4Z F;  1BI1 A;  3CUQ B;  1TNT A;  4RGX A;  4ZH4 F;  2QQB A;  2XAQ A;  1S7O A;  1LEB A;  3HTU A;  1XMK A;  2DPU A;  1B1B A;  2F2E A;  5HLI A;  1EH7 A;  1ZAO A;  2OU2 A;  5LEK A;  2KIF A;  1KQ9 A;  4AWX B;  2VXZ A;  4EQQ A;  3BZ6 A;  1P4W A;  4M9X A;  4EMS A;  2IA0 A;  3REO A;  4Y17 A;  3SQN A;  1QO0 D;  2M5W A;  1B4A A;  5HDK A;  3M8F A;  3EET A;  1R58 A;  2FU4 A;  3WTS C;  3ELK A;  1XGO A;  2M1B A;  3T1B A;  5E8G A;  2IPQ X;  1XGS A;  2F5D A;  1YG2 A;  2RQP A;  1WSU A;  2QZ8 A;  3L7W A;  1QGP A;  2E1C A;  4LG0 B;  5HLH A;  2D1H A;  3GZ6 A;  1FPQ A;  3J81 K;  2HEO A;  2EWN A;  1YW9 A;  3F8C A;  2HKX A;  5H6Q A;  1BI0 A;  2OAZ A;  2XAG A;  3W6K B;  5L3G A;  3TDU C;  2FSW A;  1MJ9 A;  1LVA A;  4R8H A;  5AIQ A;  3BPV A;  2P6S A;  1E2X A;  2EV5 A;  5F1R A;  1KU3 A;  4R79 A;  1XN7 A;  2DLL A;  3Q5F A;  4PZJ A;  4ZYH A;  1SD4 A;  2P8T A;  1U5T B;  3G73 A;  1FYM A;  4OMZ A;  4WF2 A;  1IUY A;  4JBA A;  2H94 A;  4CHU A;  3I58 A;  3O3K A;  3V8L A;  3RYP A;  1ZLJ A;  1JGS A;  2STT A;  3K69 A;  3MEX A;  3RDI A;  4QWQ A;  1KYZ A;  3RPU A;  4F7Z A;  2EFO A;  5CVI A;  4P96 A;  5LGN A;  2HGC A;  4NHJ A;  4Y15 A;  4XSZ F;  3I0T A;  3CTA A;  1KU2 A;  2QYO A;  3RPQ A;  2YSR A;  4EJT A;  5L3C A;  3LA3 A;  1IN5 A;  4PGG A;  2HWV A;  3EUH A;  2XUB A;  3RKY A;  2ZFW A;  5JFR A;  4U7B A;  2F5C A;  3WU1 B;  3CLO A;  4MEX F;  5H6R A;  4OMY A;  1FSE A;  2GA2 A;  2XGX A;  3LQR A;  4GO1 A;  1J0R A;  3I71 A;  2QBY A;  4IJA A;  4Q5S F;  3GFM A;  4EVI A;  5JR3 A;  3COA C;  3GLX A;  2VBX A;  4BQA A;  1FWZ A;  2HTS A;  2ESH A;  2FBK A;  3HYI A;  2J5P A;  4HA8 A;  2RKH A;  2LKP A;  4LLG F;  2LNB A;  1PP7 U;  3VOD A;  2DAO A;  2XAJ A;  2XIG A;  1TQM A;  3E5U A;  4WWC A;  2ESN A;  3I4P A;  1K6O A; 
#chains in the Genus database with same CATH topology
 2HOE A;  4XLN F;  3VFZ A;  1UCR A;  2ZJQ F;  3S15 J;  4GDF A;  1UHW A;  3O8G A;  4BE1 A;  2CH0 A;  5C44 J;  1N25 A;  1LVK A;  4OAZ A;  1GVD A;  1MMG A;  1S3J A;  3PM1 A;  1APL C;  1FIA A;  2FBH A;  4BUP A;  3A2K A;  2H6C A;  1U78 A;  4I76 A;  1B8I B;  4YFX F;  1O3Q A;  2CV0 A;  5K7F A;  1IRG A;  1OQY A;  4CO8 A;  4UXN A;  4XRS G;  4M3E A;  1WFX A;  3G3Z A;  4A3J J;  4E7H A;  2WWY A;  1B8I A;  1S29 A;  5EEA A;  5BMZ A;  3BPX A;  4JQF A;  2VPR A;  5JLX A;  1LDD A;  3QPH A;  1K78 A;  1S7A A;  2ECB A;  3ZN1 A;  4A6E A;  2COM A;  4S05 A;  2PMH A;  2IS6 A;  3FMQ A;  4HX7 A;  1MH3 A;  2D45 A;  2V7F A;  3VB2 A;  2EV6 A;  2CQK A;  2CW8 A;  3Q0U A;  3HSE A;  2HYF A;  3DF8 A;  4GYG A;  3WE2 A;  5GTI C;  2J5O A;  2X85 A;  3DKX A;  3X2Q H;  2HVQ A;  1U3E M;  2MGQ A;  4N9I A;  5J1U A;  3A0H C;  3TO6 A;  2JVG A;  3MZY A;  2Z99 A;  4KIB A;  4HST A;  1QZE A;  3HHG A;  4MFE A;  5J1R A;  3OL3 A;  3SYT A;  1SVO A;  4L5I A;  1HKT A;  4TV7 A;  1M1E B;  3W2A A;  4XNF A;  2XVC A;  5FD6 A;  3NWT A;  3LFU A;  3E97 A;  4CXF A;  1UHS A;  2E35 A;  1MBE A;  4DQ2 A;  1PDN C;  3OR1 C;  3L1P A;  2UUZ A;  2XSD C;  3HKZ A;  3QRF F;  3CJQ B;  1DDN A;  1W7P B;  2ZNY A;  3QU3 A;  1A6Q A;  2UV1 A;  4RB0 A;  2AHQ A;  2O8X A;  2VJJ A;  2DMQ A;  5FFZ A;  2QQ9 A;  2YS9 A;  3G1L A;  2KRF A;  4UUV A;  3OYK A;  3GW2 A;  4MQ9 F;  3F8B A;  3JRA A;  3JR9 A;  4AYB N;  2HNH A;  3PSF A;  2P5L C;  3LSM A;  4IQJ A;  3ZP5 A;  1D0Z A;  1WQ2 A;  2EZH A;  2Y0S A;  2WAQ A;  3EDP A;  1CF7 A;  3K4M A;  2O7O A;  4BQQ A;  5HDN A;  1OKR A;  1ZGW A;  5HVQ C;  1WH5 A;  4NQW B;  1SEU A;  4D1Q A;  3U21 A;  5JVT A;  2B63 J;  1BJA A;  3JTH A;  2FNA A;  1STZ A;  2EIK H;  2NAZ A;  4EM2 A;  2O3F A;  4ASN A;  2I5U A;  2JN6 A;  2K4B A;  4LOC A;  4D5C A;  4WXH A;  2XV4 S;  2LLK A;  4IHS A;  1SFO J;  2XRO A;  3BTJ A;  3OYI A;  2ID6 A;  5F04 A;  4P9F A;  2XB5 A;  1SD6 A;  1S8N A;  2UWM A;  5ICF A;  4CCO A;  3I53 A;  3RKX A;  3I59 B;  3K4N A;  5EYR A;  4WXC A;  5D6F A;  3BQY A;  3I56 I;  5DD4 A;  4MTD A;  2IA2 A;  4C2M J;  4XLC A;  1J09 A;  3RKQ A;  2PEX A;  3S2D J;  1DPR A;  3ZOB A;  1ZG3 A;  5E3N A;  4ANJ A;  2MH9 A;  1CGP A;  3WTX C;  1Y8Q B;  2X1E A;  4JP0 A;  4UV8 A;  4B8X A;  4CZC A;  4OIO F;  2DMU A;  3HSR A;  3QP5 A;  2QQ8 A;  4EM1 A;  3G2B A;  2O61 A;  1VF9 A;  2BW3 A;  4IRG A;  1SFK A;  3S1Q J;  1PP8 F;  1I6X A;  3S17 J;  3BCA A;  3BJO A;  3V7C A;  2KKO A;  2QLZ A;  1FYK A;  2A6H F;  2A6T A;  3HHH A;  5KCM A;  4ZJZ A;  2VOO A;  2L5Q A;  3H3V K;  2VT2 A;  2DN0 A;  3OS2 A;  5BPD A;  1MDM A;  1X1P A;  3ZMU A;  2VPL A;  3E6M A;  3V42 A;  2H1L A;  3N97 A;  1Z7U A;  1YIT I;  3F8M A;  2AXL A;  2ZCW A;  1MDM B;  2EK5 A;  2HPI A;  3OIO A;  3H92 A;  3LSP A;  2E1M B;  2EJR A;  3DV8 A;  3GFL A;  4U0W A;  1Y0N A;  4P9U A;  4LG3 A;  2JT1 A;  1LJ9 A;  3K4C A;  4LJZ F;  1X58 A;  3I5U A;  1RNL A;  1FP1 D;  4I02 A;  5GAH J;  3TMO A;  2MAB A;  2A69 F;  4M9Z A;  3CC7 I;  5F64 A;  2K3F A;  2K4J A;  4I2O A;  2UXX A;  2OCE A;  5DCM A;  2IGK A;  3K2Z A;  1N78 A;  1MD0 A;  2DCE A;  1HQC A;  1KGS A;  3VSK A;  2L9N A;  2ZBK A;  3RCO A;  1ODD A;  2WTE A;  4JOM A;  4C9Y A;  2OQR A;  4RGR A;  4O6J A;  3ROU A;  1UMQ A;  2F5E A;  2X6X A;  3MCZ A;  1IN4 A;  4CCK A;  2NS0 A;  4DBQ A;  4RM3 A;  2V9P A;  3CCS I;  4C3H J;  2CV1 A;  2JTV A;  1R5G A;  3BCB A;  1UHM A;  1SAU A;  2DTZ A;  2XAH A;  1QZZ A;  4L9N A;  3C2G A;  1FMV A;  3GXO A;  3E3V A;  3IKT A;  2ZSH B;  2Y2Z A;  1L0O C;  4DZJ A;  4EJW A;  3H9G A;  3FXQ A;  3M9A A;  3MZ8 A;  5B5E C;  2ADU A;  1B72 A;  2QKM B;  3DFG A;  3JRD A;  2QF7 A;  4XLF A;  4A5N A;  1TLH B;  1XB4 A;  1YFH A;  1RUO A;  2KPM A;  3ULQ B;  3L2U A;  1X2N A;  5IOZ A;  1RI7 A;  1KQ8 A;  1QVT A;  4E4H A;  2KLO A;  4A3C J;  3MZH A;  2ZME B;  1WI3 A;  3LA7 A;  3B6C A;  5HDG A;  3LST A;  1P9Q C;  1GVJ A;  3OMY A;  5B66 C;  1GXP A;  1ZLK A;  2BXY A;  2CWE A;  5DYM A;  5DM6 F;  4ON0 A;  3D5R C;  2HOA A;  1XTA A;  2CRG A;  3S14 J;  5DDG A;  1MKM A;  3OSG A;  2IAI A;  4BHC A;  1ACI A;  2ACJ A;  4KN7 X;  2MD5 A;  3G1O A;  1Z0X A;  2DK5 A;  3CME I;  1X4P A;  2FQ4 A;  1YTY A;  2IGM A;  5DTD A;  2KJB A;  3S2W A;  2X0L A;  4OIR F;  4YIF A;  3HRT A;  5LRS A;  1O3T A;  1WKM A;  3S1N J;  4ABZ A;  4LD5 A;  5LRR A;  2MLK A;  2LF8 A;  3EYY A;  5D5U B;  4A3I J;  2CQQ A;  1CF7 B;  2EZK A;  5BQT A;  2V1D A;  2QSG X;  2RC4 A;  1TWF J;  3RSN A;  2NNY A;  4KIF A;  1E3H A;  4G6D A;  4KUM A;  4Y13 A;  5E17 F;  1QZY A;  5E1W A;  1QQI A;  5IYC J;  1U8B A;  1W36 C;  2CFX A;  2LH9 A;  3BOQ A;  5GAD J;  1CQT A;  2A07 F;  1X2M A;  1AA7 A;  1X3U A;  3OWT A;  3TOB A;  4XRF A;  3OOP A;  1DU6 A;  1SFE A;  4QTR A;  2O03 A;  3BR2 A;  5ED4 A;  2R5Z B;  1FNN A;  2VQH A;  3BG3 A;  4ZC3 A;  3OIP A;  2P7C B;  3KZZ A;  2A6E F;  1A5J A;  4ZYE A;  4H0E A;  3BG7 A;  2NRA C;  2HDC A;  3ZMT A;  5FKN A;  4FX4 A;  2WY7 Q;  4LMY A;  2K02 A;  1N75 A;  3ML6 A;  2YX4 A;  2M2E A;  3CJN A;  2XHK A;  3S3O A;  4U0V A;  3PFI A;  4DBR A;  1G8X A;  1UB9 A;  1IW7 F;  3GZ5 A;  4P1W A;  1EJ9 A;  4FQG A;  3WTU C;  1UG2 A;  3DEE A;  2PI0 A;  3L2V A;  4KT6 A;  2JK3 A;  2JPC A;  1MSF C;  1X1A A;  4YFN F;  2JJ7 A;  4KNY A;  4BHP A;  2HYJ A;  5FJ8 J;  3G4S I;  4IX7 A;  4MEY F;  4EAT A;  2H8W A;  5IY5 H;  5EDN A;  1FBU A;  3CCL I;  5ILV A;  5GAG J;  1WH7 A;  2XRL A;  2DQR A;  2L7K A;  2L7F P;  3PQJ A;  3AG2 H;  3WG7 H;  1BC7 C;  5DUK A;  4HLY A;  2HDW A;  3CUQ A;  2GXA A;  1LPQ A;  4Y4R A;  5JVG F;  2HYG D;  4RLQ A;  3Q9S A;  1FBQ A;  3PQK A;  3ZMD A;  3AAF A;  1QNT A;  4WCG A;  2V9K A;  1R6R A;  4L9T A;  3WTZ A;  2F5F A;  4RA2 A;  5L3B A;  1BM9 A;  2GZW A;  1PUE E;  2JSC A;  1ZYR F;  5FKL A;  3H9J A;  4CA0 A;  5IPA A;  5F1J A;  5TIS C;  1OR7 C;  1K7A A;  1U2W A;  2AO9 A;  3CO6 C;  3JCU C;  1PJR A;  1MIJ A;  1H0M A;  4M6V A;  4M3F A;  1J9I A;  1X4O A;  4IF4 A;  2Y0M A;  4XSX F;  2YX7 A;  2JWT A;  2HQR A;  2PBI A;  4FCY A;  2DOE A;  3RZD J;  3F22 A;  4FTH A;  4IKF A;  4BBS J;  5FD5 A;  1RKT A;  2WV0 A;  1ZRC A;  3VEP A;  1KU7 A;  3ECO A;  4MTE A;  4ZZD A;  3HUG A;  4CDG A;  2LBF B;  3LAJ A;  3D0S A;  2V1N A;  4BJ6 C;  3P7N A;  4XRM A;  1QHG A;  1MMN A;  1PUF B;  5E1X A;  1JUM A;  4NC7 A;  2ZFU A;  1BOA A;  4IHW A;  1NTC A;  2Y0S N;  3TKY A;  4OIP F;  3ASO H;  1BR4 A;  4D5F A;  2VXD A;  1V4R A;  1O7F A;  2Q2E B;  2QM3 A;  5M5Y J;  1U0J A;  2H09 A;  2YPR A;  5EEH A;  2FA5 A;  3V8J A;  4BYY A;  3G71 I;  3GTO J;  3RYR A;  1HCR A;  3V4G A;  2Q2E A;  2DT7 B;  4F93 B;  3A01 A;  5D8K B;  3BTL A;  3ZRG A;  1F5T A;  5H20 A;  2F4M B;  1D3Y A;  4PSX A;  2DO7 A;  3TP0 A;  3ZQL A;  1I27 A;  4PJL A;  3O8H A;  4HX4 A;  3F9K A;  1WZ2 A;  3S3N A;  5AIP A;  3IH4 A;  1MBF A;  1T0F A;  3MAJ A;  5K5Q A;  3OYB A;  1EKE A;  3OYH A;  4I6Z A;  4Z2Y A;  3SDB A;  3A03 A;  3GCM A;  4RS8 A;  2DMP A;  2K9M A;  1A31 A;  1EH6 A;  1I3Q J;  1R1V A;  2BVL A;  4XL9 A;  3F23 A;  1QBJ A;  3KYL A;  3BY6 A;  4IHV A;  3TW7 A;  3E6B A;  4IOA F;  5DV5 A;  2R5Y A;  4BH9 A;  4DNC A;  2W1O A;  2L2O A;  2PN6 A;  2X48 A;  3S1R J;  3K10 A;  3FMR A;  4C2T A;  4ZYD A;  1TZL A;  4NBQ A;  2LY9 A;  3S8P A;  5CVU A;  1J75 A;  1NK3 P;  3IWZ A;  3VPR A;  5E8I A;  2QSH X;  3F8F A;  1W4M A;  1OCT C;  1WI9 A;  4G9Y A;  3W6J B;  5FB2 A;  5E18 F;  4E7K A;  3IKV A;  4J19 A;  2AQF A;  5CKT A;  3BTC A;  4XLP F;  3K9T A;  4DJA A;  3JRF A;  1Y39 A;  4CZZ A;  2M3A A;  4XKB A;  3U2R A;  1JT6 A;  3K4J A;  3M8E A;  2NS8 A;  2W82 A;  2NVT J;  2QA4 I;  3R0J A;  2ELJ A;  1R5I D;  1XSV A;  4Z6Y A;  2EFN A;  3M3Y J;  2CUF A;  1JTY A;  2VKH A;  4AIJ A;  2KIU A;  4OAY A;  1AKH A;  1MH4 A;  4FET A;  5F27 A;  3JRC A;  3GFI A;  4I0A A;  1TWA J;  3OYF A;  4RMN A;  2JPB A;  2GIV A;  4P55 A;  1QA6 A;  4L0Z B;  4U87 A;  5FKO A;  3ZQ7 A;  1H9T A;  2VAS A;  3ABL H;  1BIB A;  3H3Z A;  1EV7 A;  4HBL A;  2DOA A;  1TNS A;  3P5J A;  2AXT C;  3KEO A;  2DYR H;  3HOX J;  4PJJ A;  2EA4 A;  4KIT B;  4PDK A;  2FEZ A;  2L4M A;  2L7Z A;  1OCP A;  1MBG A;  3BLY A;  5ILS A;  4EM0 B;  1BW5 A;  1OR7 A;  3P9I A;  5ICG A;  1GV2 A;  4BGD A;  1G3W A;  4GGG A;  3E6D A;  4YG2 F;  4I09 A;  3CD6 I;  2L7M P;  5CVR A;  3NQO A;  2WAD A;  3U1D A;  5M3F J;  5IT9 K;  2CUZ A;  3GYH X;  2DMT A;  2HPM A;  3PL8 A;  1X19 A;  3JAM Z;  3NAR A;  2KZG A;  1L3L A;  3H36 A;  2BY2 A;  2BV6 A;  1RKW A;  2JA6 J;  1VQN I;  3BJA A;  1KU9 A;  4L0Y B;  2LTP A;  1YIO A;  3GWZ A;  2JUC A;  3OYE A;  1WJC A;  1LFU P;  2R7S A;  3HZJ A;  5B1B H;  4E7Z A;  4AIH A;  2DA3 A;  2GWR A;  3OYJ A;  3CCR I;  1LDJ A;  4L18 B;  4B43 A;  3A1Y A;  5K7H A;  5D5V B;  4Y3O A;  3CO7 C;  4AVZ A;  5L3E A;  1P92 A;  1YI2 I;  3FF5 A;  5BS6 A;  1JGG A;  4JX4 A;  3R6S A;  3F6O A;  2ETH A;  2BY3 A;  3FBI B;  1S7E A;  4UVC A;  4CCM A;  1IAW A;  2MD0 A;  5EEG A;  1IJW C;  2FJ1 A;  5CYV A;  2R7R A;  1YIJ I;  1TBX A;  2E2I J;  1H89 C;  2OPT A;  5CPR B;  4HW0 A;  5J3L A;  3WGI A;  1NH3 A;  4BXU A;  4UVA A;  2LOO A;  4RAY A;  1Z3X A;  2HZT A;  1BR2 A;  1MBJ A;  1ETW A;  2CSO A;  3SXY A;  5GP9 A;  4EGZ A;  3PO2 J;  2VL8 A;  3LA2 A;  2QEX I;  2Z9O A;  4RB2 C;  2WV1 A;  3GX4 X;  2A68 F;  1JHF A;  5F0H A;  2E7W A;  3GME A;  1SD5 A;  3DTE A;  2R4G A;  1HLV A;  3ISP A;  4V2G A;  3TO9 A;  2LKS A;  2RV8 A;  1T8I A;  1Y8R B;  4HDV A;  3B6A A;  1V5F A;  1K78 B;  2EH3 A;  5LLQ A;  3S16 J;  3WU0 A;  4XM3 A;  1D1B A;  2V1X A;  4LLN A;  1U9O A;  3KIO A;  4I99 C;  1MZB A;  1WJF A;  2LF7 A;  2G7U A;  1NG6 A;  1LE8 B;  1R9T J;  3ZXS A;  1ZAR A;  5E20 A;  2Q8K A;  3MQ0 A;  3F6V A;  3G6E I;  1IO2 A;  4IZZ A;  1DP3 A;  2M87 A;  5B1A H;  1YRN B;  3ABT A;  3CC4 I;  1DPU A;  2CGP A;  3Q9V A;  1E17 A;  2BY0 A;  1FBS A;  3AG1 H;  3BT9 A;  2XB0 X;  3AG3 H;  3DPU A;  5LFA A;  5HNH A;  3GBG A;  4MIM A;  1JKP C;  5DS9 A;  1WPK A;  1W7P A;  3IP4 B;  4FT8 A;  3IL2 A;  2DYS H;  1IN6 A;  2VOP A;  2STW A;  1JUP A;  4Y33 A;  1T39 A;  3QYB A;  3HDD A;  3H3U A;  3HSF A;  2ISZ A;  3KYD B;  2DFF A;  3GTG J;  2XF6 A;  3BR6 A;  3QQA A;  1MSE C;  2V4J C;  2P7V B;  1AOY A;  2M34 A;  3OIQ A;  3JAM K;  1IRX A;  1JHH A;  1OYI A;  4CCJ A;  5A2Q K;  1UZC A;  2M0M A;  3ZN0 A;  2CQX A;  1WCM J;  2M9H A;  3L00 A;  2FX0 A;  2CUE A;  1UAA A;  1HST A;  1FYL A;  3M8J A;  1Z6R A;  1OIS A;  4OWR B;  2PLY A;  1OCO H;  2EIM H;  1XD7 A;  2OUM A;  4NUB A;  1ZR2 A;  1T08 B;  3HL2 A;  3BZK A;  2XAS A;  3B02 A;  4KMF A;  1AKH B;  2V9V A;  2MC3 A;  4ENN A;  2JVH A;  4MFD A;  4RB1 A;  4M3D A;  4BBR J;  2RNG A;  1VQP I;  2EA2 A;  5C4X J;  1ETV A;  1Z7L A;  1HSJ A;  1P2F A;  3NEU A;  3J81 Z;  3MKY B;  4DYC A;  4ENK A;  1P7I A;  5E3O A;  1X1D A;  3M4O J;  2DW4 A;  2JQ7 A;  1G3S A;  2Y30 A;  1OCZ H;  5TRD A;  1A04 A;  2FQ3 A;  4DZP A;  3OYC A;  3FXK A;  5KAI C;  1X1C A;  1R4M B;  2D1V A;  4Q47 A;  3CCV I;  4EJO A;  1XS9 A;  1MBH A;  1YW8 A;  3ZGK A;  4RAZ A;  1VQ9 I;  2DI3 A;  4WK8 F;  4KN4 X;  3QAH A;  3JRG A;  1PVE A;  3WTV C;  3CF5 F;  1FP2 A;  3BDD A;  1XDU A;  2GOX B;  1HDD C;  3QU6 A;  4OOI A;  3RTR A;  5JLW A;  4HF0 A;  4O3M A;  1I39 A;  4FE7 A;  3JTG A;  2YU3 A;  5LHG A;  5KNL A;  4AD9 A;  4ENJ A;  3DWL E;  2FD5 A;  1IV8 A;  5E79 C;  1YS7 A;  2YU9 J;  2MH2 A;  5FRN A;  3FKI J;  3CZ6 A;  1IXS B;  1UEL B;  1DUX C;  3WOD F;  2V6E A;  2VQG A;  3M1C A;  3IH3 A;  4FIS A;  4BXX J;  3HOS A;  4GCV A;  1LQ1 A;  2EZL A;  2GLO A;  3UR3 C;  3H0G J;  2PMZ N;  4LIV A;  2K3P A;  1OLT A;  1ZRD A;  5EG0 A;  1JKR C;  3HKZ N;  3QOP A;  2BBY A;  4A3E J;  1DU0 A;  3DEW A;  3JRE A;  4BDZ A;  4NB5 A;  3DTK A;  2L3D A;  2R7O A;  4M6Y A;  1B9M A;  2Y75 A;  5EG0 B;  2IT0 A;  1FTT A;  1NK2 P;  1SD7 A;  1USS A;  2LFB A;  3LAP A;  3GTL J;  1XMA A;  4PJM A;  2RNJ A;  3I54 A;  3K6G A;  1R5H A;  1YLF A;  2FML A;  2R7D A;  1T56 A;  1WHU A;  2VBY A;  2Z33 A;  2Z3Y A;  1U9N A;  4A69 C;  1FC3 A;  3E6C C;  4L5J A;  1IXR C;  4A5M A;  4N0B A;  4PJ0 C;  4YIR X;  5HLT A;  2DTR A;  3DBR B;  2C6Y A;  1D8K A;  2GXB A;  3FIS A;  4LG0 A;  2K9S A;  2MLG A;  2Z5U A;  3K1N A;  3ZR8 X;  2ME6 A;  1REP C;  2K5C A;  3FXO A;  3MKL A;  1PUF A;  2P4W A;  3DLL F;  1H88 C;  3ASN H;  4BY7 J;  1HW5 A;  1NHA A;  3NAU A;  3HOV J;  2X6W A;  2OZU A;  3L2C A;  5A2Q Z;  2XRN A;  1OJL A;  3OL4 A;  4XKW A;  4BS9 A;  2TDX A;  1JTX A;  1EH8 A;  2NOJ B;  1QU3 A;  1J5Y A;  2M30 A;  3QPL A;  3ERE D;  4IL6 C;  4IRI A;  3J7A O;  1B72 B;  3J80 K;  1Z67 A;  2DA7 A;  1F1Z A;  4M3B A;  3ECH A;  2NYX A;  1R36 A;  4IXA A;  4HZF A;  1BJZ A;  2QWW A;  3AFH A;  4GXO A;  5M5W J;  1W5S A;  3ZCO A;  1FOX A;  1FOK A;  4XQF A;  2PMU A;  2WAF A;  3DU6 A;  4ZDP A;  1G3Y A;  3H1C A;  5FRO A;  4HF1 A;  1W7P D;  2KP6 A;  3R4K A;  3WHC A;  1DP7 P;  1XSX A;  1AU7 A;  1RET A;  2F4O B;  4UUS A;  2PJR B;  3S1M J;  5CJ9 A;  2IVM A;  4B44 A;  5K7Z A;  4XRS A;  3QPS A;  1R4N B;  1S5L C;  2F5V A;  4U7D A;  2LKX A;  1SFU A;  3FK6 A;  3ZMZ A;  1R22 A;  1LDK B;  4UUT A;  3WGG A;  3TP3 A;  5BOX A;  4LGW A;  3VWB A;  1YX5 A;  2ZKZ A;  3DBH B;  3S2H J;  2A5W A;  3H0D A;  4ESJ A;  4IRH A;  1KA8 A;  5IP7 J;  2N8G A;  3IC7 A;  4F92 B;  4HNU A;  3G1M A;  4XBF A;  4DYQ A;  1P4X A;  4MO7 A;  2RRE A;  3CCJ I;  2W4S A;  4FHT A;  3N05 A;  3IRR A;  4HF2 A;  4HLX A;  2IXS A;  2MC4 A;  5GPC A;  3LWF A;  5J4V A;  2GXG A;  2V26 A;  4A3D J;  5GTH C;  4RGU A;  4LB5 A;  2QEN A;  4G8X A;  2PQ8 A;  2ZNZ A;  3BR5 A;  4N4N B;  1GV5 A;  2BW3 B;  2EFP A;  2XGE A;  3RIR A;  5FLX Z;  2ZJP F;  3AL0 B;  4K2E A;  4X1E A;  3RZO J;  4E70 A;  3FWE A;  2BOL A;  3LSK A;  4GRI A;  4XIC A;  2BY1 A;  5FLM J;  1ZRF A;  5ICE A;  2R7F A;  3BG9 A;  4BU2 A;  2GQQ A;  1IDY A;  4KJZ A;  1FLI A;  2ICW G;  5ERI A;  5LD2 C;  4E7S A;  3FHZ A;  3EYI A;  2XPU A;  3KLN A;  3C1D A;  4BAY A;  4ZDO A;  1H9G A;  1XG1 A;  1GT0 C;  4BY1 J;  4XK4 A;  3SEQ A;  3T5X A;  1WJE A;  2XAU A;  4CH7 A;  3DCF A;  4M9S A;  2M45 A;  5K1Y A;  2GIZ A;  2W00 A;  1TP4 A;  3F3X A;  2VLA A;  3F21 A;  2W25 A;  4A2U A;  4EJV A;  4XN3 A;  1I6H J;  4ESF A;  2QQA A;  2EPF A;  4KIC A;  1OMI A;  4Y7N J;  5IYB J;  4ITV A;  2XKO A;  3R61 A;  4MNU A;  1TQP A;  4UNO A;  2ZXI A;  3I4M J;  3ABU A;  1RPW A;  3IV5 A;  2COB A;  4UV9 A;  4LLL A;  1Z3Y A;  1ETY A;  2PJP A;  2DFH A;  2I8D A;  2B7E A;  5CLS A;  4AYB A;  2E1N A;  2DA5 A;  2K7L A;  4B48 A;  3R60 A;  2L9R A;  4A3K J;  4XOT A;  1ZR4 A;  2FE3 A;  3FXM A;  1TT5 B;  2VKD A;  5E1Z B;  2W48 A;  3NRV A;  2KIS A;  4EGY A;  1XPX A;  2GAU A;  1MBK A;  1V3F A;  3AKZ A;  1W5C C;  3TQN A;  2JA8 J;  3K2A A;  3F0C A;  3KLO A;  4RM2 A;  1X3Z B;  1ZGA A;  5HLG A;  5K5R A;  4BDY A;  3T8R A;  2AQE A;  1XC5 A;  5DUI A;  3CUO A;  1XSD A;  4Y52 J;  1I50 J;  1D0X A;  2BVM A;  2M8G X;  1LUJ B;  2XF5 A;  3FM3 A;  3FZV A;  3K4L A;  4M74 A;  2WY8 Q;  3MFK A;  4I0B A;  1ZKG A;  2CU7 A;  2R7W A;  3IAS 2;  1FX7 A;  3ZQF A;  1XGN A;  4B3X A;  2CW0 F;  2DMN A;  4ETS A;  2ELH A;  2MYS A;  2GOM A;  2LY1 A;  2M8E A;  3D5L A;  3IAM 2;  3GTP J;  3LL7 A;  2HFH A;  1VZ0 A;  4KIG A;  4CYD A;  1T0F C;  2L01 A;  2ZC2 A;  2BGC A;  3PNY A;  1IG7 A;  1SMY F;  2L9S A;  3BWG A;  1TWH J;  1TC3 C;  2O5R A;  4HV6 A;  1ERD A;  2OD5 A;  4F55 A;  1MMS A;  1YJW I;  1HKQ A;  1MJB A;  3K4B A;  2G9W A;  1GDT A;  2OQG A;  5EZG A;  2RAE A;  2QCO A;  5M3M J;  4UHT A;  1B6A A;  1VQK I;  1YO5 C;  3DPL C;  3OYL A;  1FT9 A;  3TED A;  3CLQ A;  1ZHF A;  4CYC B;  3FM5 A;  3FXR A;  5FO5 A;  4L9V A;  2L9V A;  3BG6 A;  2FRH A;  2FF4 A;  4HQE A;  1FEX A;  1EF4 A;  1X3W B;  4EV0 A;  4UY8 I;  3VYS B;  2P5V A;  4B4C A;  4X0G A;  1FIP A;  4RB3 C;  4BHB A;  1U5T A;  1HW2 A;  4OIQ F;  3A01 B;  1Z6T A;  3EQL F;  5D5X B;  2IA1 A;  3CF2 A;  4PFP A;  1YHQ I;  1D1C A;  1OYY A;  4XLA A;  1HOM A;  1BBY A;  2M7B A;  4KDP A;  3WGH A;  4B3A A;  3KEQ A;  3DKY A;  2Y48 A;  4OIN F;  3W3C A;  5D8L B;  1O4X A;  4UUS B;  2K85 A;  3E5Q A;  1EA3 A;  2R5Y B;  1JJ6 C;  5J8F A;  2JMW A;  3IRQ A;  2FNP A;  2CV2 A;  3H5A A;  2OTL I;  3U9G A;  3I59 A;  3AG4 H;  3KFW X;  2X6Y A;  1Q1H A;  1MNE A;  2FOK A;  5B3S H;  3U1K A;  1T2K A;  2DA2 A;  1D0Y A;  2QGU A;  3JW4 A;  4LK0 F;  1TQI A;  2LRE A;  2RVC A;  2V1U A;  1YS6 A;  4XON A;  5C3E J;  1ONV A;  1D8J A;  5ICC A;  1VI0 A;  2GBY A;  3V8K A;  2VJ5 A;  1IC8 A;  3DLA A;  1LEA A;  2DDA A;  4UB6 C;  2JZY A;  1WWX A;  1OCC H;  4DYR A;  4JK1 X;  2R5Z A;  3HOW J;  1DGR M;  2IS2 A;  2L4A A;  1E0E A;  1KYW A;  2F48 A;  2Z1D A;  4HRI A;  1P7J A;  2HKO A;  2NS7 A;  1ZGJ A;  1I1G A;  1F9N A;  2DK8 A;  1P6R A;  1Y0U A;  4QSH A;  5IT9 Z;  3CCU I;  3O2P E;  3ZQQ A;  1B59 A;  1YQA A;  3W6V A;  2HVR A;  4S04 A;  3KET A;  2DA6 A;  5HOO A;  4HX8 A;  2TRT A;  3HEF A;  5CVV A;  3LOC A;  1ITY A;  4JX6 A;  1ETQ A;  2EV0 A;  1ORK A;  4IPA A;  2KDO A;  4HAM A;  2QVO A;  1BOB A;  3LFK A;  2WC2 A;  4AU7 A;  4F91 B;  3QP6 A;  5LBQ A;  5HS8 A;  1D5V A;  2BZT A;  3QYE A;  3PJR A;  2OF7 A;  5HS7 A;  2HXI A;  3I64 A;  3ZQI A;  3ZMV A;  1W5T A;  3E7L A;  5CQG A;  4CGZ A;  1TTY A;  1ZK8 A;  2CW7 A;  1WJD A;  1F4K A;  2IS4 A;  3WTT C;  1Y1W J;  4D7N A;  5M5X J;  3B73 A;  1LFP A;  2VJ4 A;  3CUQ C;  3PNV A;  4ESB A;  2A61 A;  4ZZL A;  2ZSI B;  2E2J J;  4UVB A;  1LFB A;  3BTI A;  2P81 A;  2DBB A;  4U88 A;  4QLC U;  3H5N A;  3C18 A;  2ELK A;  3EUA A;  3HC7 A;  4CYC A;  1RZ4 A;  2CYY A;  2NXN B;  3FXU A;  2ZXH A;  3QOE A;  3T8T A;  1IXC A;  2KT0 A;  3KPH A;  5AON A;  2O6G E;  2IW5 A;  3GVA A;  2UZK A;  4M72 A;  1GHC A;  1ZG1 A;  2OBP A;  3JRH A;  4V2F A;  4XOR A;  1KZH A;  2OCC H;  4PJN A;  2IRF G;  1TW2 A;  1O57 A;  2BXZ A;  2KRH A;  2VQC A;  1ULY A;  1Y1V J;  2NOG A;  3HOZ J;  3DP7 A;  3C2H A;  3GLL A;  5J47 A;  3HOU J;  1BI2 A;  5EGO B;  4I01 A;  1GXQ A;  1ZRE A;  2KJC A;  1YX3 A;  3MD2 A;  1OFC X;  1V5G A;  5IP9 J;  2Q0O A;  3OY9 A;  1T38 A;  3RPU D;  4AIK A;  3SFI A;  3LSR A;  1ZQ3 P;  3GO5 A;  5LGT A;  3A0B C;  5IYD J;  3R0A A;  3JRB A;  3FMS A;  2W85 A;  4ZTJ A;  2CS3 A;  3PO3 J;  2IJL A;  2E1O A;  4Q48 A;  5EJC A;  5DCM B;  5D5W B;  3F8N A;  1X1B A;  2V79 A;  3CJT B;  1PYV A;  4I7H A;  4ZDL A;  3FXJ A;  5D4S A;  1T6S A;  2YR2 A;  2UXN A;  1V54 H;  1XCV A;  2I10 A;  2DXI A;  4WX9 A;  3C3W A;  4HYE A;  3HM5 A;  3SEZ A;  2JA7 J;  3DXJ F;  3CC2 I;  4BJT A;  3KP4 A;  3P9K A;  5FLV A;  3HUG B;  1U8R A;  4HSR A;  2VBW A;  2KQR A;  3ABK H;  3TW6 A;  4KYW A;  2H1K A;  3LSJ A;  5CVJ A;  4KFC A;  3KE2 A;  4MHG A;  4PCQ A;  4AID A;  2LD5 A;  3GEZ A;  4LFU A;  3ZQH A;  1YRN A;  3GZN B;  2W57 A;  2XPW A;  4L9J A;  1B9N A;  2GA1 A;  2DFI A;  4IVN A;  3A4C A;  4BE0 A;  1O3R A;  1K83 J;  4BKX A;  2CFO A;  2IBD A;  4BQO A;  1S6L A;  5J6X A;  2VC1 A;  2A3S A;  2W7N A;  1RUN A;  6PAX A;  2H27 A;  4RAF A;  1T98 A;  4C3J J;  5LGU A;  2CQ7 A;  4G7Z F;  4FAS D;  4KMU X;  1J2X A;  3QPT A;  2IGN A;  1SVM A;  4YFK F;  3T0Y A;  2OTJ I;  2HS5 A;  4HQM A;  4C3I J;  4PK4 A;  4CCN A;  5F6F A;  1POG A;  1QPI A;  2X1C A;  3GTQ J;  2CUJ A;  3UKG A;  4DIQ A;  3WTW C;  3TDZ C;  4CSW A;  1F43 A;  3KP2 A;  2OJE D;  5GPA A;  1QHH D;  4LK1 F;  3HTS B;  1Z21 A;  2XGC A;  5JHU A;  1G4D A;  4S0H B;  2XKP A;  2QBY B;  4IHT A;  3WHB A;  5D4R A;  2BYV E;  2K9L A;  2M0C A;  1I5Z A;  4W97 A;  5TJJ A;  1HW1 A;  1JE8 A;  2O0Y A;  1GLN A;  4NC8 A;  3SFZ A;  4BEH B;  2QSF X;  5DM7 F;  3FKJ A;  5LHH A;  1Z91 A;  4B47 A;  2VC0 A;  1FOY A;  4LIT A;  3HRU A;  1UFM A;  4AUX A;  2Y69 H;  5J4Y A;  2H6B A;  1JKO C;  1YJ9 I;  4EEF G;  3DEU A;  3H35 A;  5JI6 A;  3SZT A;  3BJ6 A;  3CJR B;  3S3M A;  4X6A J;  3RQI A;  4NDL A;  2B0L A;  3TGN A;  1FJL A;  3EPZ A;  1W36 D;  1ZEL A;  4JYK A;  3E1S A;  4A0Z A;  2XSJ C;  4M71 A;  3OV8 A;  1YYV A;  3BRO A;  2Y9Y A;  2YUS A;  5JHF A;  3ZPL A;  1HKS A;  4ENM A;  1NG7 A;  3BZC A;  3JSO A;  2R7Z J;  3HB9 A;  2CO5 A;  1U6G A;  3BR0 A;  3ZQC A;  1R1T A;  3FHN A;  1O7L A;  3C7J A;  1OYW A;  2PG4 A;  4I98 B;  1WJA A;  2FOW A;  4A6D A;  2BHZ A;  1W0T A;  1BIA A;  4DW6 A;  4ZYG A;  1YOV B;  2HQN A;  1HC8 A;  4OU0 A;  2RN7 A;  1JJ8 C;  3KZI C;  4KIS A;  4WXD A;  2E7X A;  3HJE A;  1XCB A;  3HOT A;  1K4T A;  5IP6 A;  5FKM A;  1ZH5 A;  4LIU A;  1MJA A;  3VYR B;  4FE4 A;  1E3P A;  1FSH A;  1ZG5 A;  1G2H A;  1TWC J;  4D0P A;  2E5Z A;  4E7L A;  4A3L J;  3KP6 A;  4HOB A;  3H9Q A;  3SHF A;  3HBL A;  3WTY C;  2DPD A;  2XDV A;  1FMW A;  1MMD A;  2G0E A;  3FX3 A;  2X4H A;  2VON A;  1UST A;  3DTI A;  2VE9 A;  4E7J A;  1WVR A;  3CP2 A;  2K9Q A;  3DBL B;  2KL4 A;  4M6X A;  1HXD A;  4BNC A;  5EF6 A;  1WRJ A;  4A3G J;  2E60 A;  3NWS A;  4RAG A;  3W2V A;  3V7S A;  2R3S A;  2ZXW H;  5L3F A;  1MW7 A;  5J40 A;  3VOE A;  4BL0 B;  2HQA A;  2L02 A;  2CG4 A;  3GTM J;  2KIM A;  2DT5 A;  2ZJR F;  3JSP A;  2FMY A;  1P4A A;  2IP2 A;  3N4M A;  3BQZ A;  3QWL A;  5FGM A;  2CJJ A;  1VQ4 I;  4HDU A;  2DJI A;  3BR3 A;  1GUU A;  2M4K A;  2HZD A;  3K1M A;  3PIP F;  1VTN C;  3CCQ I;  5HOD A;  1XGM A;  4PGH A;  1ETX A;  2WB1 A;  4RGS A;  4XMY A;  3FIW A;  1BC8 C;  4BXF A;  1RR7 A;  3HPH A;  1FTZ A;  2MA3 A;  2EIL H;  3RI4 A;  1HBX G;  2ZME A;  4BQN A;  4BEH A;  2RGV A;  2V6C A;  5LHI A;  2VOD A;  3WE3 A;  3OYD A;  4LB6 B;  1K79 A;  4NQW A;  1IGN A;  2E2H J;  4IEJ A;  4RDU A;  3IHU A;  1R23 A;  4G94 A;  3HPG A;  2NNN A;  3TOA A;  1J59 A;  1RC9 A;  2HOT A;  3DU5 A;  1R7J A;  2EFW A;  5E3M A;  3CMA I;  4F52 A;  1LE8 A;  1K61 A;  1KQ0 A;  4P5O A;  2DFE A;  2ZME C;  2KRC A;  2MG4 A;  3K0L A;  1R00 A;  2DJN A;  2G7H A;  3CCM I;  3OYG A;  1QPM A;  1C0W A;  5DCF A;  2OZ6 A;  2KMU A;  3WU2 C;  2RDP A;  1OPC A;  1A35 A;  2IS1 A;  3TL4 X;  2DDB A;  3ERM A;  4MQV A;  3OYM A;  2XGD A;  4YRV A;  2M7A A;  4GYI A;  4E6K G;  3VYT B;  3CDH A;  4XLH A;  4M73 A;  3RKW A;  3M7G A;  1YW7 A;  3TO7 A;  4A12 A;  3J7A Y;  2DA4 A;  4B1R A;  2XAF A;  5F0F A;  5FFX A;  4AM3 A;  1VQL I;  1J7K A;  1ETK A;  2HDD A;  2LDU A;  4MLO A;  2P5K A;  2ZJ2 A;  5H2F C;  2DU9 A;  1IV6 A;  3KP3 A;  1Y56 A;  4HPQ A;  2PFB A;  2F4I A;  3FBN B;  1A6I A;  2L54 A;  2LK2 A;  2HI3 A;  3I3L A;  2LSO A;  3ABM H;  2R7V A;  4MGR A;  5BNG A;  4II2 A;  2ME0 A;  1FZP B;  3HRS A;  3L9F A;  2HVS A;  1IRZ A;  4C30 A;  3D1N I;  1W0U A;  1W1W E;  2A5Y B;  1IDZ A;  3SDG A;  2ZXJ A;  4EJU A;  4F3Q A;  1XX5 A;  5IOY A;  1SFX A;  4G6T B;  4A93 J;  1N77 A;  1S9H A;  2DA1 A;  3QOD A;  4FX0 A;  4C2U A;  3DQV C;  1ON1 A;  2QKL B;  3LSH A;  3SZP A;  1SAN A;  2EQR A;  4CUG A;  2VKE A;  2EB7 A;  2A05 A;  1IN8 A;  3HGY A;  2OA4 A;  3K1P A;  3KP7 A;  2JA2 A;  4BAC A;  3O6B B;  3E5X A;  4A0Y A;  3GFJ A;  5FLX K;  3KCC A;  1LKX A;  1IRF A;  3ZQG A;  2AS5 F;  1U5T C;  1V55 H;  5IT3 A;  1I1S A;  3S32 A;  1ON2 A;  4CIC A;  1AWC A;  4D7M A;  5L3D A;  3DPT A;  1JXS A;  2M4G A;  3EUK L;  2BEO A;  2ZO4 A;  3AL0 C;  2HR3 A;  2JRT A;  2XF7 A;  4A3F J;  4A3M J;  2R92 J;  2LVS A;  3F72 A;  3WG9 A;  2O8K A;  1R1U A;  3MMY B;  4DGW B;  2D5V A;  5CQE A;  3QYF A;  1SMT A;  2VE8 A;  4PUS A;  3HOY J;  2ZB9 A;  4H4K C;  2CQN A;  1UG0 A;  4RBO A;  4XOP A;  1BN5 A;  1JKQ C;  4AVP A;  1SAX A;  4NC6 A;  3I55 I;  2DT6 A;  2LBF A;  3L09 A;  3BC8 A;  2P6T A;  1YE9 A;  4XLE A;  1Z1D A;  1MGT A;  1VQ6 I;  5ILU A;  3M07 A;  2QUF A;  2W24 A;  5K5O A;  3K4K A;  1VQM I;  3LQQ A;  5C4J J;  2E71 A;  3D5S C;  1HF0 A;  2PX9 A;  1Y6I A;  1IN7 A;  4G7O F;  2MW8 A;  3S93 A;  3CDI A;  4N9H A;  4ZTF A;  1BI3 A;  3LNQ A;  3GUD A;  1UJ8 A;  4XKV A;  4HG2 A;  1OCR H;  2VQL A;  3RJP A;  2HTJ A;  2VI6 A;  4NNJ A;  3J7Y J;  4G7H F;  1BA5 A;  5KVR A;  3CMM A;  3GTJ J;  3ZMS A;  3KX2 A;  1ENH A;  1K4S A;  2X1D A;  3J80 Z;  4A3B J;  1G59 A;  2Z16 A;  5DEQ A;  2FUG 2;  4IQ4 A;  4UB8 C;  4B09 A;  2X9D A;  3HG9 A;  3OYN A;  2E1M C;  5BPI A;  1ZN2 A;  1T95 A;  1FY7 A;  5HS9 A;  2WA0 A;  2VUM J;  2NVU B;  4R1H A;  4HNT A;  3MWM A;  1BW6 A;  3CDL A;  1MMA A;  1LB2 A;  4G6Q A;  2VN2 A;  5J1Y A;  1TW3 A;  2W84 A;  2WB1 N;  4KA4 A;  4L5E A;  1Z9C A;  1RR8 C;  2NVY J;  4O5V A;  1S72 I;  4J01 A;  2E34 A;  2LP0 A;  3ONQ A;  5D6E A;  2Y31 A;  3BP8 A;  3HIF A;  3P9C A;  3CQZ J;  4YII A;  2X6O A;  2R7T A;  3M1E A;  2NVQ J;  2VT3 A;  1G3T A;  1I3A A;  1VND A;  2CMP A;  4V19 K;  4U0Y A;  4A0X A;  5EZH A;  2WBM A;  5J8C A;  2ISY A;  1RIO H;  1G6N A;  3GF2 A;  2MBF A;  4J00 A;  3OYA A;  2LC2 A;  2GM4 A;  3IWF A;  1JUS A;  2IGO A;  3HRM A;  5F08 A;  3KZY A;  2EFQ A;  4QIW N;  1O3S A;  1Z05 A;  1XDS A;  1ETO A;  2E19 A;  2FBI A;  2DQL A;  4ZYA A;  5KK1 A;  1SC7 A;  2D2W A;  5DD8 A;  1LNW A;  4PSW A;  4PFO A;  3CCY A;  4KT5 C;  2JUG A;  2KZV A;  1IZ1 A;  2BE5 F;  3UNG C;  5LEJ A;  3FXL A;  3ESW B;  1VQ5 I;  2EZI A;  2B9S A;  3PUF A;  1F36 A;  3OSF A;  2LG4 A;  5HNF A;  3E0J B;  1KON A;  3DKW A;  3EUH C;  2IEK A;  2VBZ A;  2FXA A;  2K27 A;  2K86 A;  4XR6 A;  2MSY A;  2VJI A;  3V7R A;  1IF1 A;  4CCL A;  3KP5 A;  4HV5 A;  1H8A C;  4Q4Z F;  3JRI A;  4JX5 A;  1BI1 A;  3CUQ B;  1TNT A;  2E5N A;  4RGX A;  4G12 A;  4ZH4 F;  2QQB A;  2XAQ A;  1S7O A;  1LEB A;  3HTU A;  1XMK A;  1DQU A;  2DPU A;  1B1B A;  2F2E A;  3K7A J;  3I9V 2;  5HLI A;  1EH7 A;  2OC6 A;  1ZAO A;  2OU2 A;  2EIJ H;  2LR8 A;  5LEK A;  2KIF A;  1TL8 A;  1KQ9 A;  4AWX B;  2VXZ A;  5E3L A;  4EQQ A;  2R7Q A;  2JSP A;  3BZ6 A;  3CES A;  3MN2 A;  1P4W A;  4M9X A;  2X51 A;  4EMS A;  3I4N J;  3SZG A;  4IO9 F;  2IA0 A;  3REO A;  4Y17 A;  2KDZ A;  4HNV A;  5FRM A;  1Q1V A;  1TT0 A;  3SQN A;  1QO0 D;  3VDX A;  2M5W A;  2WAQ N;  2HXO A;  2NVX J;  1B4A A;  5HDK A;  3L2Q A;  3M8F A;  3W2W A;  1QRY A;  4N4O B;  4XKC A;  2VB6 A;  3EET A;  3OOU A;  3HGG A;  2WAE A;  1R58 A;  2FU4 A;  3LSI A;  3WTS C;  3ELK A;  1XGO A;  3CP8 A;  3LMM A;  2M1B A;  4XN0 A;  3T1B A;  3BG5 A;  2PMZ A;  5E8G A;  2IPQ X;  1XGS A;  2XC7 A;  3LSG A;  2F6C A;  4W1U A;  2F5D A;  1YG2 A;  1BL0 A;  2RQP A;  4M3G A;  1WSU A;  2QZ8 A;  3L7W A;  1QGP A;  1R49 A;  2DOF A;  2E1C A;  4LG0 B;  5HLH A;  2D1H A;  2P0W A;  3GZ6 A;  1FPQ A;  3J81 K;  2MFZ A;  2HEO A;  2LRD A;  2EWN A;  5KAF C;  1YW9 A;  3FDY A;  1WJB A;  3F8C A;  5GAE J;  4D9J A;  2Q1Z B;  1HA8 A;  4IOC F;  3PNT A;  2HKX A;  5H6Q A;  5F0C A;  3HXL A;  3K70 D;  1BI0 A;  1FOW A;  2KIQ A;  3GTK J;  2LY2 A;  2OAZ A;  3KEY A;  1MND A;  2XAG A;  3W6K B;  1WJ5 A;  5L3G A;  4BJ5 C;  3TDU C;  2FSW A;  2R7X A;  1DGW Y;  3PFY A;  1MJ9 A;  1LVA A;  4R8H A;  5AIQ A;  3BPV A;  4HEA 2;  2P6S A;  1E2X A;  3CMY A;  4AC0 A;  3L2R A;  2EV5 A;  5F1R A;  1D5Y A;  1KU3 A;  4R79 A;  1XN7 A;  2DLL A;  2HQ5 A;  2KFD A;  4PZJ A;  3Q5F A;  4ZYH A;  5KHD A;  1SD4 A;  1AHD P;  2P8T A;  1U5T B;  2DOD A;  1E3O C;  3G73 A;  5EGO A;  1WGX A;  4QPQ A;  3MKW B;  1FYM A;  1BR1 A;  4OMZ A;  4WF2 A;  1RRJ A;  3C2B A;  1IUY A;  4JBA A;  1V5E A;  2L0K A;  3RQ4 A;  2H94 A;  1MNM C;  3I58 A;  4CHU A;  1TWG J;  3O3K A;  2K9N A;  3Q0V A;  3V8L A;  2R93 J;  2EBI A;  2HU9 A;  2OV7 A;  3RYP A;  1ZLJ A;  1JGS A;  4XID A;  2STT A;  3K69 A;  3MEX A;  3RDI A;  4QWQ A;  3A02 A;  1KYZ A;  3RPU A;  4F7Z A;  1XMX A;  4II3 A;  2EFO A;  1IUF A;  3OR2 C;  5CVI A;  3IUO A;  4P96 A;  1T33 A;  5LGN A;  2HGC A;  4NHJ A;  1SVL A;  4Y15 A;  2RQQ A;  2ECC A;  5FKK A;  4XSZ F;  4QPO A;  3I0T A;  3L2W A;  2LMD A;  3CTA A;  1KU2 A;  2QYO A;  3RPQ A;  3PIO F;  2YSR A;  4YEL A;  1JT0 A;  2JRM A;  4EJT A;  5L3C A;  2R0Q C;  1RES A;  3LA3 A;  1JI8 A;  9ANT A;  1IN5 A;  4PGG A;  2HWV A;  3EUH A;  2XUB A;  3RKY A;  2ZFW A;  5JFR A;  4U7B A;  1HDP A;  4YEJ A;  3Q0W A;  2F5C A;  3WU1 B;  2PJR A;  4GFB A;  3CLO A;  4MEX F;  3KYC B;  2EIN H;  5H6R A;  4OMY A;  1FSE A;  2GA2 A;  2KHM A;  3J7Z I;  2XGX A;  3LQR A;  2R7U A;  3PSI A;  2XPV A;  2O9L A;  2VKV A;  4GO1 A;  1K6Y A;  3FK7 A;  1J0R A;  1VQ8 I;  3I71 A;  2QBY A;  4IJA A;  4E7I A;  2HOS A;  2Y9Z A;  2K40 A;  5TGT A;  3MVP A;  4Q5S F;  1YJN I;  2VIX A;  3GFM A;  4EVI A;  5JR3 A;  3COA C;  4IHY A;  1Z77 A;  2E36 A;  3GLX A;  3TBI A;  1VQO I;  3PUB A;  1QVU A;  4DOZ A;  4RLF A;  2VBX A;  3SJM A;  1VFC A;  4BQA A;  1FWZ A;  3H5R A;  4IHX A;  3K70 C;  2HTS A;  3VSL A;  1VQ7 I;  1A36 A;  2ESH A;  2FBK A;  3HYI A;  3OS1 A;  2J5P A;  4BE2 A;  3BR1 A;  2TCT A;  4HA8 A;  3MKZ A;  2RKH A;  3Q3S A;  2LKP A;  1R71 A;  4LLG F;  2LYC A;  2LNB A;  2ID3 A;  2Z2S B;  3IH2 A;  2BHY A;  3OS0 A;  1PP7 U;  3VOD A;  2DAO A;  2H8R A;  3CCE I;  2XAJ A;  2XIG A;  1TQM A;  3E5U A;  4WWC A;  2JA5 J;  1D1A A;  2ESN A;  3VYU B;  3I4P A;  1K6O A;  1ZTR A; 
#chains in the Genus database with same CATH homology
 2HOE A;  4XLN F;  3VFZ A;  1UCR A;  1UHW A;  1S3J A;  2FBH A;  2H6C A;  1U78 A;  4YFX F;  1O3Q A;  1IRG A;  4CO8 A;  4UXN A;  3G3Z A;  2WWY A;  1S29 A;  5BMZ A;  3BPX A;  4JQF A;  1LDD A;  3QPH A;  1K78 A;  1S7A A;  4A6E A;  3ZN1 A;  2COM A;  4S05 A;  2PMH A;  3FMQ A;  4HX7 A;  2D45 A;  3VB2 A;  2EV6 A;  2CQK A;  3HSE A;  2HYF A;  3DF8 A;  4GYG A;  3WE2 A;  2J5O A;  1U3E M;  4N9I A;  3TO6 A;  3MZY A;  2Z99 A;  4KIB A;  3HHG A;  4L5I A;  1HKT A;  4TV7 A;  2XVC A;  5FD6 A;  3E97 A;  4CXF A;  4DQ2 A;  1PDN C;  3QRF F;  1DDN A;  1W7P B;  2ZNY A;  3QU3 A;  4RB0 A;  2O8X A;  5FFZ A;  2QQ9 A;  2KRF A;  4UUV A;  3GW2 A;  4MQ9 F;  3F8B A;  2P5L C;  3ZP5 A;  1WQ2 A;  3EDP A;  1CF7 A;  5HDN A;  1OKR A;  5HVQ C;  5JVT A;  1BJA A;  3JTH A;  2FNA A;  1STZ A;  2NAZ A;  4EM2 A;  2O3F A;  4ASN A;  2K4B A;  4WXH A;  2XV4 S;  4IHS A;  2XRO A;  4P9F A;  1SD6 A;  1S8N A;  2UWM A;  5ICF A;  3I53 A;  3RKX A;  3I59 B;  4WXC A;  5D6F A;  5DD4 A;  4MTD A;  2IA2 A;  2PEX A;  1DPR A;  1ZG3 A;  2MH9 A;  1CGP A;  3WTX C;  4UV8 A;  4B8X A;  3HSR A;  3QP5 A;  4EM1 A;  2O61 A;  4IRG A;  1PP8 F;  1I6X A;  3BJO A;  3V7C A;  2KKO A;  2QLZ A;  1FYK A;  2A6H F;  3HHH A;  2VOO A;  2VT2 A;  5BPD A;  1MDM A;  3ZMU A;  3E6M A;  3N97 A;  1Z7U A;  3F8M A;  2AXL A;  2ZCW A;  1MDM B;  2EK5 A;  3H92 A;  2EJR A;  3DV8 A;  3GFL A;  4U0W A;  4P9U A;  4LJZ F;  2JT1 A;  1LJ9 A;  3I5U A;  4I02 A;  1RNL A;  1FP1 D;  2A69 F;  4M9Z A;  5F64 A;  2K4J A;  4I2O A;  2UXX A;  5DCM A;  3K2Z A;  1MD0 A;  1KGS A;  1HQC A;  2ZBK A;  1ODD A;  2WTE A;  2OQR A;  4RGR A;  4O6J A;  3ROU A;  2F5E A;  3MCZ A;  1IN4 A;  2NS0 A;  2JTV A;  1R5G A;  1UHM A;  2XAH A;  1QZZ A;  4L9N A;  3GXO A;  3E3V A;  3IKT A;  1L0O C;  4EJW A;  3FXQ A;  3M9A A;  2ADU A;  3DFG A;  4A5N A;  1TLH B;  1XB4 A;  1YFH A;  1RUO A;  3ULQ B;  1RI7 A;  1KQ8 A;  3MZH A;  2ZME B;  3LA7 A;  5HDG A;  3LST A;  1GVJ A;  1GXP A;  1ZLK A;  2CWE A;  5DYM A;  4ON0 A;  5DDG A;  1MKM A;  4BHC A;  2ACJ A;  4KN7 X;  2MD5 A;  2DK5 A;  1YTY A;  2KJB A;  3S2W A;  2X0L A;  4OIR F;  4YIF A;  3HRT A;  5LRS A;  1O3T A;  1WKM A;  4LD5 A;  5LRR A;  2MLK A;  2LF8 A;  3EYY A;  5D5U B;  1CF7 B;  5BQT A;  2V1D A;  2RC4 A;  2NNY A;  4KIF A;  4G6D A;  4KUM A;  5E17 F;  4Y13 A;  1QZY A;  5E1W A;  1QQI A;  4OIO F;  2CFX A;  3BOQ A;  2A07 F;  1X3U A;  3TOB A;  4XRF A;  3OOP A;  1SFE A;  2O03 A;  5ED4 A;  1FNN A;  2P7C B;  3KZZ A;  2A6E F;  4ZYE A;  4H0E A;  2NRA C;  2HDC A;  3ZMT A;  4FX4 A;  4LMY A;  2K02 A;  3ML6 A;  2YX4 A;  3CJN A;  2XHK A;  4U0V A;  3PFI A;  1UB9 A;  1IW7 F;  3GZ5 A;  3WTU C;  2PI0 A;  2JPC A;  4YFN F;  4KNY A;  4BHP A;  4MEY F;  1FBU A;  5ILV A;  2DQR A;  3PQJ A;  1BC7 C;  5DUK A;  4HLY A;  3CUQ A;  2HYG D;  3Q9S A;  1FBQ A;  3PQK A;  3ZMD A;  3AAF A;  1QNT A;  4WCG A;  4L9T A;  3WTZ A;  2F5F A;  5L3B A;  1BM9 A;  2GZW A;  1PUE E;  2JSC A;  1ZYR F;  1K7A A;  1U2W A;  3CO6 C;  1H0M A;  1J9I A;  4IF4 A;  2Y0M A;  4XSX F;  2YX7 A;  2HQR A;  2PBI A;  3F22 A;  5FD5 A;  2WV0 A;  1ZRC A;  3VEP A;  1KU7 A;  3ECO A;  4MTE A;  4ZZD A;  3HUG A;  4CDG A;  3LAJ A;  3D0S A;  3P7N A;  5E1X A;  1BOA A;  3TKY A;  4OIP F;  1V4R A;  1O7F A;  2QM3 A;  2H09 A;  2YPR A;  5EEH A;  2FA5 A;  3V8J A;  4BYY A;  3RYR A;  3V4G A;  2Q2E A;  5D8K B;  1F5T A;  5H20 A;  1D3Y A;  2DO7 A;  1I27 A;  4HX4 A;  5AIP A;  3MAJ A;  1T0F A;  5K5Q A;  4Z2Y A;  4RS8 A;  1EH6 A;  1R1V A;  3F23 A;  1QBJ A;  3BY6 A;  3E6B A;  5DV5 A;  4BH9 A;  4DNC A;  2PN6 A;  3FMR A;  4ZYD A;  5CVU A;  1J75 A;  3IWZ A;  5E8I A;  3F8F A;  1W4M A;  1WI9 A;  4G9Y A;  3W6J B;  5FB2 A;  5E18 F;  3IKV A;  4XLP F;  3K9T A;  4CZZ A;  3U2R A;  3M8E A;  3R0J A;  1XSV A;  2EFN A;  4AIJ A;  2KIU A;  3GFI A;  4I0A A;  2JPB A;  2GIV A;  4P55 A;  4L0Z B;  3ZQ7 A;  1H9T A;  1BIB A;  3H3Z A;  1EV7 A;  4HBL A;  1TNS A;  3KEO A;  2EA4 A;  4PDK A;  2FEZ A;  2L4M A;  5ILS A;  4EM0 B;  1OR7 A;  3P9I A;  5ICG A;  1G3W A;  4GGG A;  3E6D A;  4YG2 F;  4I09 A;  5CVR A;  3U1D A;  3NQO A;  5IT9 K;  3GYH X;  3JAM Z;  1L3L A;  2BV6 A;  3BJA A;  1KU9 A;  4L0Y B;  1YIO A;  3GWZ A;  4AIH A;  2GWR A;  1LDJ A;  4L18 B;  5D5V B;  3CO7 C;  5L3E A;  1P92 A;  3FF5 A;  5BS6 A;  3R6S A;  3F6O A;  2ETH A;  4UVC A;  1IAW A;  5EEG A;  5CYV A;  1TBX A;  4HW0 A;  3WGI A;  4BXU A;  4UVA A;  4RAY A;  2HZT A;  2CSO A;  3SXY A;  4EGZ A;  3LA2 A;  2Z9O A;  4RB2 C;  3GX4 X;  2A68 F;  1JHF A;  2E7W A;  1SD5 A;  3ISP A;  3TO9 A;  2RV8 A;  4HDV A;  1K78 B;  5LLQ A;  3WU0 A;  2V1X A;  4LLN A;  1MZB A;  2LF7 A;  2G7U A;  1ZAR A;  5E20 A;  2Q8K A;  3MQ0 A;  3F6V A;  2M87 A;  3ABT A;  1DPU A;  2CGP A;  3Q9V A;  1E17 A;  1FBS A;  1W7P A;  4FT8 A;  3IL2 A;  1IN6 A;  2VOP A;  2STW A;  1T39 A;  3H3U A;  3HSF A;  2ISZ A;  2P7V B;  1AOY A;  3JAM K;  1JHH A;  5A2Q K;  1OYI A;  3ZN0 A;  3L00 A;  1HST A;  1FYL A;  1Z6R A;  2PLY A;  1XD7 A;  2XAS A;  3B02 A;  4KMF A;  4ENN A;  2V9V A;  2MC3 A;  4RB1 A;  2EA2 A;  3J81 Z;  1HSJ A;  1P2F A;  3NEU A;  4ENK A;  2DW4 A;  1G3S A;  5TRD A;  2FQ3 A;  1A04 A;  2D1V A;  4Q47 A;  4EJO A;  1YW8 A;  4RAZ A;  2DI3 A;  4WK8 F;  4KN4 X;  3QAH A;  3WTV C;  1FP2 A;  3BDD A;  1XDU A;  3QU6 A;  4OOI A;  3RTR A;  4HF0 A;  4O3M A;  3JTG A;  2YU3 A;  5LHG A;  4AD9 A;  4ENJ A;  1YS7 A;  2MH2 A;  1IXS B;  1DUX C;  3WOD F;  3HOS A;  4GCV A;  1LQ1 A;  1ZRD A;  3QOP A;  2BBY A;  4NB5 A;  2L3D A;  4M6Y A;  1B9M A;  2Y75 A;  2IT0 A;  1SD7 A;  1USS A;  3LAP A;  1XMA A;  2RNJ A;  3I54 A;  1R5H A;  1YLF A;  2FML A;  2R7D A;  2VBY A;  2Z33 A;  2Z3Y A;  1FC3 A;  3E6C C;  4L5J A;  1IXR C;  4A5M A;  4N0B A;  2DTR A;  2C6Y A;  1D8K A;  2GXB A;  4LG0 A;  2MLG A;  2Z5U A;  3K1N A;  1REP C;  2P4W A;  1HW5 A;  1NHA A;  3L2C A;  2OZU A;  5A2Q Z;  2XRN A;  2TDX A;  1EH8 A;  1J5Y A;  2M30 A;  3ERE D;  4IRI A;  3J7A O;  3J80 K;  1F1Z A;  3ECH A;  2NYX A;  1R36 A;  4IXA A;  4HZF A;  4GXO A;  2QWW A;  1W5S A;  1FOK A;  2PMU A;  1G3Y A;  4HF1 A;  1W7P D;  3R4K A;  1DP7 P;  1XSX A;  5CJ9 A;  2IVM A;  4U7D A;  1SFU A;  3ZMZ A;  1R22 A;  1LDK B;  3WGG A;  5BOX A;  4LGW A;  2ZKZ A;  4ESJ A;  4IRH A;  1KA8 A;  3IC7 A;  4XBF A;  1P4X A;  4FHT A;  3IRR A;  4HF2 A;  4HLX A;  3LWF A;  2GXG A;  4RGU A;  4LB5 A;  2QEN A;  4G8X A;  2PQ8 A;  2ZNZ A;  2EFP A;  5FLX Z;  3RIR A;  4K2E A;  4E70 A;  3FWE A;  1ZRF A;  5ICE A;  2R7F A;  2GQQ A;  1FLI A;  5ERI A;  3FHZ A;  3EYI A;  3KLN A;  3C1D A;  4BAY A;  1H9G A;  3T5X A;  4M9S A;  2M45 A;  5K1Y A;  3F3X A;  3F21 A;  2W25 A;  4A2U A;  4EJV A;  4ESF A;  2QQA A;  4KIC A;  1OMI A;  2XKO A;  3R61 A;  4MNU A;  1TQP A;  4UNO A;  3ABU A;  4UV9 A;  4LLL A;  2PJP A;  5CLS A;  2E1N A;  2K7L A;  3R60 A;  2FE3 A;  5E1Z B;  3NRV A;  4EGY A;  2GAU A;  1V3F A;  3TQN A;  3KLO A;  1ZGA A;  5HLG A;  5K5R A;  3T8R A;  5DUI A;  3CUO A;  1XSD A;  3FZV A;  3FM3 A;  4M74 A;  3MFK A;  4I0B A;  1FX7 A;  1XGN A;  2CW0 F;  4ETS A;  2ELH A;  2M8E A;  3D5L A;  2HFH A;  4KIG A;  4CYD A;  2L01 A;  2BGC A;  1SMY F;  3BWG A;  4HV6 A;  2OD5 A;  1HKQ A;  1MJB A;  2G9W A;  2OQG A;  4UHT A;  1B6A A;  1YO5 C;  3DPL C;  1FT9 A;  1ZHF A;  3FM5 A;  3FXR A;  5FO5 A;  4L9V A;  2FRH A;  2FF4 A;  4HQE A;  4EV0 A;  2P5V A;  4RB3 C;  4BHB A;  1U5T A;  1HW2 A;  4OIQ F;  1Z6T A;  3EQL F;  5D5X B;  2IA1 A;  1OYY A;  1BBY A;  4KDP A;  3WGH A;  3KEQ A;  2Y48 A;  4OIN F;  5D8L B;  3E5Q A;  5J8F A;  3IRQ A;  2FNP A;  3U9G A;  3I59 A;  3KFW X;  1Q1H A;  2FOK A;  1T2K A;  3JW4 A;  4LK0 F;  1TQI A;  2RVC A;  2V1U A;  1YS6 A;  1ONV A;  1D8J A;  5ICC A;  3V8K A;  1LEA A;  2JZY A;  1WWX A;  4JK1 X;  2L4A A;  1KYW A;  2HKO A;  1ZGJ A;  1I1G A;  1F9N A;  2DK8 A;  1P6R A;  1Y0U A;  5IT9 Z;  3O2P E;  1B59 A;  1YQA A;  4S04 A;  3KET A;  5HOO A;  4HX8 A;  5CVV A;  2EV0 A;  4IPA A;  4HAM A;  2QVO A;  3LFK A;  2WC2 A;  3QP6 A;  5LBQ A;  5HS8 A;  1D5V A;  5HS7 A;  3I64 A;  3ZMV A;  1W5T A;  4CGZ A;  1TTY A;  1F4K A;  3WTT C;  3B73 A;  3CUQ C;  4ESB A;  2A61 A;  4ZZL A;  4UVB A;  2DBB A;  4U88 A;  4QLC U;  3C18 A;  1RZ4 A;  2CYY A;  3FXU A;  3T8T A;  1IXC A;  5AON A;  2O6G E;  2IW5 A;  3GVA A;  2UZK A;  4M72 A;  1GHC A;  1ZG1 A;  2OBP A;  2IRF G;  1TW2 A;  1O57 A;  1ULY A;  3DP7 A;  1BI2 A;  4I01 A;  1GXQ A;  1ZRE A;  2KJC A;  1T38 A;  2Q0O A;  4AIK A;  3GO5 A;  5LGT A;  3R0A A;  3FMS A;  2W85 A;  2IJL A;  4Q48 A;  5DCM B;  5D5W B;  3F8N A;  2V79 A;  4I7H A;  5D4S A;  1T6S A;  2YR2 A;  2UXN A;  1XCV A;  4WX9 A;  3C3W A;  4HYE A;  3DXJ F;  3KP4 A;  3P9K A;  1U8R A;  2VBW A;  4KYW A;  5CVJ A;  4KFC A;  3KE2 A;  4MHG A;  4PCQ A;  3GEZ A;  4LFU A;  2W57 A;  4L9J A;  1B9N A;  2GA1 A;  2DFI A;  4IVN A;  1O3R A;  1S6L A;  5J6X A;  2VC1 A;  2A3S A;  1RUN A;  6PAX A;  2H27 A;  1T98 A;  5LGU A;  4G7Z F;  4KMU X;  1J2X A;  3QPT A;  4YFK F;  3T0Y A;  2HS5 A;  4HQM A;  5F6F A;  3WTW C;  3TDZ C;  3KP2 A;  4LK1 F;  3HTS B;  5JHU A;  1G4D A;  2XKP A;  2QBY B;  4IHT A;  5D4R A;  2BYV E;  1I5Z A;  5TJJ A;  1HW1 A;  1JE8 A;  2O0Y A;  3SFZ A;  5LHH A;  1Z91 A;  2VC0 A;  3HRU A;  1UFM A;  2H6B A;  3DEU A;  5JI6 A;  3SZT A;  3BJ6 A;  2B0L A;  3TGN A;  4A0Z A;  4M71 A;  3OV8 A;  1YYV A;  3BRO A;  3ZPL A;  1HKS A;  4ENM A;  3JSO A;  2CO5 A;  1U6G A;  1R1T A;  1O7L A;  3C7J A;  1OYW A;  2PG4 A;  4I98 B;  4A6D A;  1BIA A;  4ZYG A;  2HQN A;  4OU0 A;  2RN7 A;  4WXD A;  2E7X A;  3HOT A;  1XCB A;  1ZH5 A;  1MJA A;  1FSH A;  1ZG5 A;  4D0P A;  3KP6 A;  4HOB A;  3SHF A;  3WTY C;  2DPD A;  3FX3 A;  2X4H A;  2VON A;  1UST A;  2VE9 A;  4M6X A;  1HXD A;  4BNC A;  1WRJ A;  3V7S A;  2R3S A;  5L3F A;  3VOE A;  2L02 A;  2CG4 A;  2KIM A;  2DT5 A;  3JSP A;  2FMY A;  1P4A A;  2IP2 A;  3N4M A;  5FGM A;  4HDU A;  3K1M A;  1VTN C;  1XGM A;  4PGH A;  4RGS A;  1BC8 C;  2MA3 A;  3RI4 A;  1HBX G;  2ZME A;  2RGV A;  2V6C A;  5LHI A;  2VOD A;  3WE3 A;  4LB6 B;  1K79 A;  4NQW A;  3IHU A;  1R23 A;  4G94 A;  2NNN A;  3TOA A;  1J59 A;  2EFW A;  1R7J A;  1KQ0 A;  4P5O A;  3K0L A;  1R00 A;  2G7H A;  1QPM A;  1C0W A;  5DCF A;  2OZ6 A;  2RDP A;  1OPC A;  4MQV A;  4GYI A;  3CDH A;  4M73 A;  3RKW A;  3M7G A;  1YW7 A;  3TO7 A;  4A12 A;  2XAF A;  5FFX A;  1J7K A;  2LDU A;  2P5K A;  2ZJ2 A;  2DU9 A;  3KP3 A;  2PFB A;  2L54 A;  2LSO A;  4MGR A;  1FZP B;  3HRS A;  3L9F A;  2A5Y B;  2ZXJ A;  4EJU A;  1SFX A;  4FX0 A;  3DQV C;  1ON1 A;  3SZP A;  2EB7 A;  1IN8 A;  2OA4 A;  3K1P A;  3KP7 A;  3O6B B;  3E5X A;  4A0Y A;  3GFJ A;  5FLX K;  3KCC A;  1IRF A;  2AS5 F;  1U5T C;  5IT3 A;  1I1S A;  1ON2 A;  4CIC A;  1AWC A;  5L3D A;  3DPT A;  1JXS A;  2BEO A;  2ZO4 A;  2HR3 A;  2JRT A;  3F72 A;  3WG9 A;  1R1U A;  1SMT A;  2VE8 A;  1BN5 A;  4AVP A;  1SAX A;  3L09 A;  2P6T A;  1Z1D A;  1MGT A;  5ILU A;  2QUF A;  2W24 A;  5K5O A;  3LQQ A;  1IN7 A;  4G7O F;  4N9H A;  1BI3 A;  3GUD A;  3RJP A;  2HTJ A;  4G7H F;  5KVR A;  3ZMS A;  3J80 Z;  5DEQ A;  4B09 A;  5BPI A;  1ZN2 A;  1FY7 A;  5HS9 A;  4R1H A;  3MWM A;  1LB2 A;  4G6Q A;  2VN2 A;  1TW3 A;  2W84 A;  1Z9C A;  4KA4 A;  4O5V A;  5D6E A;  3BP8 A;  3HIF A;  3P9C A;  4YII A;  3M1E A;  2VT3 A;  1G3T A;  4U0Y A;  4A0X A;  5J8C A;  2ISY A;  1RIO H;  1G6N A;  3GF2 A;  2MBF A;  3IWF A;  3HRM A;  3KZY A;  2EFQ A;  1O3S A;  1Z05 A;  1XDS A;  2FBI A;  2DQL A;  5KK1 A;  2D2W A;  5DD8 A;  1LNW A;  4KT5 C;  1IZ1 A;  2BE5 F;  5LEJ A;  3DKW A;  2VBZ A;  2FXA A;  2K27 A;  2K86 A;  3V7R A;  1IF1 A;  3KP5 A;  4HV5 A;  4Q4Z F;  1BI1 A;  3CUQ B;  1TNT A;  4RGX A;  4ZH4 F;  2QQB A;  2XAQ A;  1S7O A;  1LEB A;  3HTU A;  1XMK A;  2DPU A;  1B1B A;  2F2E A;  5HLI A;  1EH7 A;  1ZAO A;  2OU2 A;  5LEK A;  2KIF A;  1KQ9 A;  4AWX B;  2VXZ A;  4EQQ A;  3BZ6 A;  1P4W A;  4M9X A;  4EMS A;  2IA0 A;  3REO A;  4Y17 A;  3SQN A;  1QO0 D;  2M5W A;  1B4A A;  5HDK A;  3M8F A;  3EET A;  1R58 A;  2FU4 A;  3WTS C;  3ELK A;  1XGO A;  2M1B A;  3T1B A;  5E8G A;  2IPQ X;  1XGS A;  2F5D A;  1YG2 A;  2RQP A;  1WSU A;  2QZ8 A;  3L7W A;  1QGP A;  2E1C A;  4LG0 B;  5HLH A;  2D1H A;  3GZ6 A;  1FPQ A;  3J81 K;  2HEO A;  2EWN A;  1YW9 A;  3F8C A;  2HKX A;  5H6Q A;  1BI0 A;  2OAZ A;  2XAG A;  3W6K B;  5L3G A;  3TDU C;  2FSW A;  1MJ9 A;  1LVA A;  4R8H A;  5AIQ A;  3BPV A;  2P6S A;  1E2X A;  2EV5 A;  5F1R A;  1KU3 A;  4R79 A;  1XN7 A;  2DLL A;  3Q5F A;  4PZJ A;  4ZYH A;  1SD4 A;  2P8T A;  1U5T B;  3G73 A;  1FYM A;  4OMZ A;  4WF2 A;  1IUY A;  4JBA A;  2H94 A;  4CHU A;  3I58 A;  3O3K A;  3V8L A;  3RYP A;  1ZLJ A;  1JGS A;  2STT A;  3K69 A;  3MEX A;  3RDI A;  4QWQ A;  1KYZ A;  3RPU A;  4F7Z A;  2EFO A;  5CVI A;  4P96 A;  5LGN A;  2HGC A;  4NHJ A;  4Y15 A;  4XSZ F;  3I0T A;  3CTA A;  1KU2 A;  2QYO A;  3RPQ A;  2YSR A;  4EJT A;  5L3C A;  3LA3 A;  1IN5 A;  4PGG A;  2HWV A;  3EUH A;  2XUB A;  3RKY A;  2ZFW A;  5JFR A;  4U7B A;  2F5C A;  3WU1 B;  3CLO A;  4MEX F;  5H6R A;  4OMY A;  1FSE A;  2GA2 A;  2XGX A;  3LQR A;  4GO1 A;  1J0R A;  3I71 A;  2QBY A;  4IJA A;  4Q5S F;  3GFM A;  4EVI A;  5JR3 A;  3COA C;  3GLX A;  2VBX A;  4BQA A;  1FWZ A;  2HTS A;  2ESH A;  2FBK A;  3HYI A;  2J5P A;  4HA8 A;  2RKH A;  2LKP A;  4LLG F;  2LNB A;  1PP7 U;  3VOD A;  2DAO A;  2XAJ A;  2XIG A;  1TQM A;  3E5U A;  4WWC A;  2ESN A;  3I4P A;  1K6O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...