2IRFG

Crystal structure of an irf-2/dna complex.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
109
structure length
109
Chain Sequence
RMRMRPWLEEQINSNTIPGLKWLNKEKKIFQIPWMHAARHGWDVEKDAPLFRNWAIHTGKHQPGIDKPDPKTWKANFRCAMNSLPDIEEVKDRSIKKGNNAFRVYRMLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an IRF-DNA complex reveals novel DNA recognition and cooperative binding to a tandem repeat of core sequences.
pubmed doi rcsb
source organism Mus musculus
molecule tags Gene regulation/dna
molecule keywords DNA (5'-D(P*AP*AP*GP*TP*GP*AP*AP*AP*GP*(5IU)P*GP*A)-3')
total genus 30
structure length 109
sequence length 109
chains with identical sequence H, I, J, K, L
ec nomenclature
pdb deposition date 1999-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00605 IRF Interferon regulatory factor transcription factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2irfG00
2RNJA 3GO5A 1E2XA 2KIUA 4ENJA 2K4BA 5D5VB 1U5TB 5D4RA 3IC7A 4HV6A 3E6DA 1EH6A 2QQBA 1KYWA 2KKOA 1IZ1A 4M9XA 1MD0A 1SFXA 2EFOA 2XGXA 1TNTA 5CVUA 1O57A 4Y13A 1LJ9A 2HTSA 1S7AA 2JPBA 2JSCA 3WTXC 3WE2A 3KP4A 3KEOA 5LGUA 2E1CA 2IA1A 4OMZA 3TO6A 3FXRA 1XGMA 5J8CA 1B4AA 3CDHA 4G9YA 4WCGA 3CLOA 3U2RA 1UHMA 3RDIA 2X4HA 4A6DA 4LLGF 2HYFA 4M73A 5L3CA 4LD5A 1YS6A 2H09A 1O3SA 4KUMA 5HVQC 1IN4A 3F8FA 2HKXA 1CGPA 3DEUA 3O3KA 1IN6A 3GZ5A 4HOBA 1R5HA 1FYMA 1IN7A 2QQAA 2VE8A 4KDPA 4FX4A 3K1NA 3RKXA 2IVMA 2K27A 2HOEA 3COAC 3P9KA 4KMUX 1ZLKA 2CW0F 1DPUA 1B9NA 2HTJA 2FEZA 3GX4X 2W85A 1SD4A 4ASNA 1IN8A 3WODF 3KETA 2R7DA 2Z3YA 3H92A 1V3FA 4KNYA 4XLPF 2HDCA 4EM1A 4RAYA 3C18A 3BOQA 2OU2A 4GGGA 2M30A 1BI2A 3I59A 5DD4A 5LBQA 1S29A 1P6RA 2L4MA 4KICA 5DCMA 2E1NA 2QBYB 1R1VA 3KZYA 3QU6A 1YG2A 3K9TA 3KP6A 4RB0A 3ELKA 3I53A 4U0VA 2BV6A 2QVOA 1J2XA 2V9VA 4YFNF 5ICCA 3FXUA 3U9GA 3E3VA 3HTSB 4NHJA 3BPXA 4WXHA 2YX4A 4UVCA 4HLXA 1XDUA 3V4GA 1B1BA 1U3EM 5IT9K 1IRFA 1VTNC 5BPIA 1GVJA 5DDGA 1U8RA 2FF4A 1FP2A 5LGTA 4L5JA 4I01A 2P7VB 5LEJA 5FD5A 5AIQA 3K1PA 1O7LA 5FO5A 2LF8A 4A6EA 4G7HF 1HKTA 1KU7A 3R61A 2G9WA 4P96A 3FMRA 4OINF 3CO6C 2PI0A 2W57A 4M9SA 5FLXZ 1IAWA 4LLLA 3VOEA 3ZPLA 5D8KB 3L9FA 1J59A 5HOOA 2QBYA 4O6JA 1CF7B 2P6SA 4HX8A 3TDUC 5HDKA 1Z7UA 4UNOA 3J80Z 5FGMA 4QWQA 1XSVA 4MHGA 2XROA 5AIPA 4L9JA 1T98A 3IRRA 4XLNF 1YIOA 3GLXA 3JSPA 1HW5A 4P9FA 3MZYA 1K78A 3GXOA 2EFWA 2QM3A 4KIFA 1FPQA 2FNAA 1YW9A 1MKMA 4GYIA 1XSDA 2O6GE 2GXBA 5CVVA 2ESHA 4HDUA 2IW5A 1DP7P 3TDZC 1LDKB 2VOPA 1TBXA 4KFCA 2DPUA 5TJJA 4LB5A 1GHCA 1EV7A 1PP7U 2XAFA 2UXXA 2RQPA 3K2ZA 2QLZA 3GEZA 2VT3A 5KK1A 2K4JA 2W84A 1ZG5A 1TQIA 1TTYA 2OBPA 3I0TA 3J7AO 5HLGA 4IHTA 4G7OF 2QUFA 4DQ2A 5L3GA 1PP8F 3DPTA 5K5RA 4MNUA 4CO8A 2UWMA 6PAXA 3IRQA 1H9GA 2MBFA 2PLYA 2GIVA 3FMSA 1UB9A 4A5MA 4PGGA 1P4AA 4IHSA 2OZUA 4A0YA 5CYVA 1UFMA 2JPCA 2DPDA 4FT8A 2ISZA 3F6VA 2P6TA 4KN7X 1P92A 2EV5A 5CVRA 3T5XA 2ACJA 5DEQA 3EDPA 4GXOA 3WTYC 3I4PA 4AWXB 5JVTA 1ZREA 3J81K 2W24A 5BPDA 2D2WA 5D5UB 3DPLC 2GWRA 2CGPA 3Q9SA 4HDVA 4KMFA 4MEYF 2ZXJA 1Y0UA 2ZO4A 1USSA 3C1DA 2NYXA 3KE2A 5F6FA 5ILSA 4M6XA 4AD9A 1T2KA 3M8EA 2VBWA 4OIOF 2KJCA 3GZ6A 4LMYA 3R60A 1QBJA 1LEBA 1QZYA 2QYOA 1R1TA 3ULQB 1KU9A 1I1SA 2DU9A 1Z6RA 1TQMA 4U88A 1STZA 3CUQB 4ESFA 3MQ0A 1MZBA 4RS8A 3OV8A 4HAMA 2FSWA 2XAHA 2WTEA 2FA5A 4OU0A 1O7FA 5JHUA 2DW4A 5D8LB 3RPUA 4AIJA 4CHUA 3Q9VA 2P5KA 4WF2A 4M74A 4I0AA 1DPRA 2NNYA 1AOYA 3ECHA 1WI9A 3BZ6A 1I1GA 1L0OC 2IJLA 2EK5A 2OZ6A 1JHFA 4R79A 1OR7A 2EFPA 4RGUA 2O0YA 2JZYA 3RPQA 2KIMA 3TOBA 2AXLA 3VEPA 1MJ9A 1Z6TA 4JQFA 1EH8A 3J80K 2BGCA 3V7CA 3T8TA 2L3DA 4N9HA 1MDMB 2RKHA 2VXZA 4LFUA 4YIIA 3F3XA 4P9UA 3B02A 4Q5SF 2B0LA 2A07F 3V8LA 2FRHA 1UCRA 2ISYA 2VC1A 4E70A 1V4RA 5BQTA 4ENMA 2QWWA 4ESJA 3BY6A 1KU3A 5JFRA 3R6SA 2PQ8A 5LRSA 5D6FA 1NHAA 4MQVA 2EV6A 2R3SA 3QP5A 3WU0A 1R23A 3R0JA 2PJPA 3HRUA 2O3FA 2NAZA 4MEXF 1Z91A 3FM5A 4R8HA 5HLHA 4O5VA 3ABUA 2LKPA 3FZVA 1YW8A 3F23A 5CJ9A 5CVJA 4IXAA 3I5UA 2COMA 2FMLA 1B9MA 5FB2A 4AIHA 4DNCA 3DP7A 1BI0A 1HKQA 4M72A 3HOTA 3WTTC 5HDGA 2V1DA 3ZN0A 3T1BA 1E17A 1FY7A 2A6EF 2FBHA 2WV0A 5HS9A 1J7KA 2EV0A 4K2EA 4YG2F 2JRTA 3ZMSA 3HRTA 5K1YA 1XMKA 3F6OA 2RV8A 3W6KB 2VODA 5FLXK 1S7OA 3J81Z 3ABTA 2QZ8A 3V8KA 4ZYHA 2X0LA 1USTA 2F5DA 3DF8A 3KZZA 3SZTA 4WX9A 2A68F 5IT9Z 1LB2A 3JAMK 1IXSB 2RVCA 3NQOA 1OMIA 3G73A 2VBXA 3VFZA 5LHHA 3MEXA 3SQNA 3ZQ7A 4CZZA 5E17F 2BYVE 1HSTA 2VC0A 1BI3A 3I71A 1R58A 1FZPB 4ENNA 4G94A 5F64A 1EH7A 2K7LA 4HF2A 3RYPA 2W25A 2HEOA 1BIBA 1OPCA 3EETA 3LAJA 2Z33A 2EB7A 4OIRF 4CDGA 4G8XA 1I27A 4ZYDA 3RKYA 3EQLF 3M7GA 1T6SA 1WSUA 4KT5C 5HS8A 3KP7A 4AVPA 1TW2A 3MAJA 3HHGA 3I64A 4LJZF 4LLNA 3MZHA 3WGIA 4HV5A 5K5OA 2P4WA 4BQAA 2KIFA 3DXJF 3HSFA 4S05A 3K1MA 4Z2YA 1FYLA 3BDDA 3NRVA 1D5VA 3TQNA 2RN7A 1FBUA 2Q8KA 3LA3A 4PGHA 2PFBA 2PG4A 1MJAA 3ECOA 2YU3A 2O8XA 1Z9CA 2ZJ2A 2PMHA 5ICEA 1R7JA 1FP1D 3LFKA 2E7XA 4QLCU 4NB5A 5JI6A 2V79A 2MH9A 4U7DA 3E6MA 2WC2A 5E20A 2H94A 2OD5A 2P8TA 4Q47A 2P5VA 4KIGA 1IW7F 2RGVA 1WRJA 1U2WA 1G3TA 2M87A 1AWCA 4OOIA 4I0BA 1O3TA 4H0EA 2M1BA 1XMAA 2A69F 4I98B 2L4AA 3RJPA 2G7UA 4HQMA 2GQQA 2HR3A 4ESBA 3C7JA 1HQCA 4ON0A 1K79A 1IRGA 2K02A 1OYYA 2XAQA 1FNNA 1SAXA 2EFQA 4LG0B 2MD5A 4A0ZA 4NQWA 1ONVA 1LNWA 4HF1A 2DAOA 1ZAOA 1HSJA 3ZMTA 4RB3C 3MCZA 1UHWA 3QU3A 1ZRDA 2ZNYA 4BH9A 2EJRA 2E7WA 2IPQX 3ML6A 1ZGJA 1D3YA 1H9TA 1S6LA 3D5LA 3ROUA 1G3YA 1KA8A 3LWFA 2KRFA 4I09A 3E6CC 5FD6A 4IPAA 4KIBA 2FBKA 5DYMA 2CYYA 1ZGAA 2HGCA 2XAGA 3I58A 4HF0A 4U0WA 4G6DA 1QGPA 3V8JA 5K5QA 3GUDA 2IT0A 1G4DA 1TQPA 4UUVA 4PZJA 1FBSA 1SD7A 2A3SA 3P9CA 2VE9A 1FYKA 1XCBA 4EQQA 1BOAA 2Z99A 5EEHA 1R22A 3ZN1A 2GZWA 2A6HF 5IT3A 3HYIA 2VT2A 2A5YB 2BEOA 4BXUA 3GW2A 1BM9A 1Q1HA 2H6CA 2L54A 2L01A 5EEGA 3R0AA 4A2UA 2HQNA 1T38A 2XHKA 1ON1A 3L00A 3ZMZA 4PCQA 4GYGA 1J0RA 3LAPA 2YR2A 3KP3A 4M71A 2NS0A 4TV7A 5BS6A 1HKSA 1W4MA 2IA0A 4A5NA 4O3MA 3E5UA 1J5YA 3LA2A 4EJWA 2D1VA 3FWEA 3EYYA 2Y48A 1KU2A 3N4MA 4I02A 2VONA 2F2EA 2BE5F 1TW3A 2Y75A 1FBQA 1BJAA 2Y0MA 2ZKZA 3WTUC 5L3BA 3KLOA 3REOA 4HLYA 3E6BA 4JK1X 2CG4A 5FFXA 2FU4A 3FF5A 1RI7A 2O03A 4EJVA 2CFXA 4OMYA 3WE3A 1OYIA 3CUQC 4XBFA 3IL2A 2HQRA 4I2OA 3E5XA 3SZPA 2OAZA 3TOAA 4EJOA 4L9VA 4OIPF 3PFIA 4XSXF 3EYIA 2IRFG 4ZH4F 5LHIA 2DO7A 1T0FA 4BHPA 3D0SA 1MJBA 2HWVA 5JR3A 4AIKA 4EM2A 1WQ2A 4IF4A 2XIGA 4B8XA 2H27A 3H3UA 1BC8C 2V1UA 4U7BA 1R00A 4WWCA 4PDKA 1P4XA 2QENA 5E1ZB 4KYWA 1I6XA 2BBYA 1XSXA 1WWXA 2FNPA 4EJTA 2D1HA 3WGGA 1RIOH 1R5GA 3F8BA 5H20A 2J5OA 4MQ9F 2DK5A 2V1XA 5E8IA 3ZP5A 4CXFA 3QPHA 3LQQA 1XN7A 4LG0A 5ILUA 1LDJA 1XGOA 2RC4A 3W6JB 1ZARA 3F21A 1FWZA 2C6YA 4L0YB 1ZYRF 4XRFA 3FM3A 1P4WA 2DTRA 3LSTA 2DT5A 1FSHA 2F5CA 5LLQA 3DV8A 2FXAA 4IRIA 1BBYA 1U5TA 2DQRA 1WKMA 3R4KA 4G6QA 3GFJA 3VODA 4YIFA 5D4SA 1TNSA 3CO7C 4MTEA 4IJAA 5DV5A 4FHTA 1RZ4A 1SFUA 2OA4A 3Q5FA 1SFEA 1ZG1A 2FQ3A 2PN6A 1ZG3A 2MA3A 4BAYA 1D8JA 3GFIA 3WU1B 1XB4A 3T8RA 5D5WB 1KQ8A 3TKYA 1H0MA 2PMUA 3RTRA 2ELHA 2VBZA 3JTHA 1IN5A 5LRRA 2STWA 3OOPA 3KP5A 1LEAA 2ZNZA 3HRMA 1PDNC 2GA2A 3VB2A 4IVNA 1L3LA 1IXCA 3F8NA 1XGNA 4EMSA 1W5SA 4EGZA 1DDNA 4RGSA 5HLIA 3CTAA 1BI1A 4Y17A 3DQVC 3RKWA 1QPMA 4FX0A 4UV8A 3FX3A 2ZMEA 3GYHX 5E1WA 4UVAA 3P9IA 2CWEA 4MGRA 5CLSA 1ZHFA 1YW7A 3E5QA 5E8GA 1KYZA 1W7PA 1D8KA 1K6OA 4BHCA 3M1EA 1IF1A 1QNTA 2HZTA 1XD7A 1ZRFA 4ETSA 4EV0A 1P2FA 1PUEE 3MFKA 2XASA 1YFHA 3DFGA 3PQJA 4UXNA 1IUYA 4L5IA 3MWMA 2FBIA 3U1DA 3TGNA 1LDDA 2UZKA 1J9IA 2XKOA 2GAUA 1MGTA 3E97A 4Q4ZF 3BP8A 4WK8F 3N97A 3F8MA 3JTGA 5ILVA 2XKPA 2JTVA 1LVAA 3QAHA 1RNLA 3QOPA 2LDUA 1R36A 5D6EA 1YO5C 2K86A 3B73A 4EGYA 4ZZLA 1B59A 5J6XA 1JE8A 4ENKA 1K78B 3GFMA 2D45A 3M8FA 3L7WA 1F4KA 4EVIA 2NRAC 1U78A 1GXQA 1FC3A 1O3RA 3KFWX 2LNBA 3IKVA 4JBAA 3JSOA 1MDMA 5J8FA 1F1ZA 5LEKA 3RYRA 5AONA 3V7SA 2JT1A 3P7NA 1YTYA 2KJBA 3K69A 2F5FA 2H6BA 2M45A 4KN4X 2P5LC 2RDPA 3KP2A 5A2QK 2AS5F 5ED4A 3O2PE 2GA1A 2M8EA 5CVIA 2DBBA 3AAFA 4L9TA 1JHHA 4CYDA 4RAZA 2L02A 4CICA 4LGWA 5HS7A 2ESNA 2MLGA 5DCFA 2VBYA 2CSOA 2DFIA 2XRNA 1FX7A 2XVCA 4LK1F 2QQ9A 2FE3A 1QO0D 2UXNA 3GVAA 1FLIA 4HBLA 2O61A 4IRHA 5ICFA 1G3SA 1SMTA 3ZMUA 4I7HA 3F8CA 1YLFA 3L09A 3BWGA 1FSEA 1G6NA 1KQ0A 2WWYA 2STTA 2VOOA 5DUKA 4P55A 1OYWA 2XV4S 4HYEA 5ERIA 4P5OA 4LB6B 4BYYA 4HW0A 2Z9OA 2V6CA 3WTVC 1ON2A 1O3QA 1JGSA 2EA2A 4MTDA 3O6BB 5A2QZ 2IP2A 3QP6A 5L3DA 3CJNA 4HA8A 4HQEA 2YSRA 3ERED 5L3FA 4L9NA 3WTZA 1BN5A 2PEXA 1W5TA 3GFLA 1BC7C 2LF7A 1X3UA 4RGRA 3H3ZA 3QRFF 1YYVA 1HW1A 2DLLA 4UV9A 4EJUA 3F22A 2OQRA 3T0YA 1C0WA 3C3WA 3HSRA 5F1RA 1Z1DA 5DUIA 1K7AA 3JAMZ 2MC3A 1HW2A 2PBIA 1QZZA 1HXDA 2EWNA 4M6YA 4GCVA 1YS7A 3EUHA 3HTUA 5TRDA 2IA2A 3QPTA 1XDSA 3NEUA 1HBXG 3BJAA 1Z05A 3SXYA 5D5XB 3V7RA 4HZFA 1F9NA 4LK0F 1OKRA 2Z5UA 3KCCA 3L2CA 3WG9A 3SFZA 1FT9A 1R1UA 1QQIA 3IWFA 5HDNA 1SMYF 3IKTA 4EM0B 3IWZA 2DI3A 1W7PB 3ZMVA 3TO9A 3GF2A 2XAJA 4Y15A 2Q0OA 2EFNA 4BHBA 4L18B 2CO5A 3WTWC 2HFHA 4HX4A 2J5PA 3BPVA 5FFZA 4A0XA 3TO7A 4UVBA 3CUQA 4ZZDA 3ISPA 3M9AA 3BJOA 1YQAA 5H6QA 1IXRC 1ZN2A 3G3ZA 2VN2A 4RGXA 4GO1A 3RIRA 5BMZA 4R1HA 2YPRA 2GXGA 1ZRCA 3WGHA 1G3WA 4WXCA 1ULYA 2EA4A 4N9IA 4D0PA 4U0YA 1SD6A 2ZFWA 4ZYEA 4S04A 5E1XA 1F5TA 3JW4A 3HUGA 4YFKF 4XSZF 2TDXA 1BIAA 2ZCWA 1RUOA 5BOXA 2Q2EA 3RI4A 2DK8A 2LSOA 3BROA 3ZMDA 5L3EA 3HRSA 3I59B 2M5WA 3CUOA 4A12A 2NNNA 1SD5A 2ETHA 3KLNA 3I54A 1KGSA 3GWZA 1DUXC 2HS5A 1TLHB 2ADUA 2MH2A 1U5TC 1W7PD 3DKWA 2HYGD 2A61A 1XGSA 4RB2C 4YFXF 1RUNA 2G7HA 1S3JA 2FMYA 2ZMEB 2MLKA 5DCMB 4CGZA 1XCVA 4F7ZA 4B09A 1ODDA 3F72A 3WTSC 3K0LA 1LQ1A 3LQRA 1A04A 2XUBA 2HKOA 3SHFA 3HSEA 1ZLJA 3HOSA 4WXDA 3HIFA 3HHHA 3FMQA 2P7CB 5H6RA 2FOKA 1FOKA 2OQGA 4M9ZA 3FXQA 4BNCA 4Q48A 3IHUA 4N0BA 1U6GA 1J75A 1CF7A 4UHTA 4OIQF 1B6AA 3LA7A 3S2WA 5DD8A 4L0ZB 5LGNA 3BJ6A 3KEQA 1GXPA 5ICGA 4RB1A 1JXSA 2DQLA 3FHZA 2YX7A 1REPC 3PQKA 2R7FA 1ZH5A 2F5EA 5E18F 4IRGA 1KQ9A 4HX7A 1T39A 2ZBKA 5KVRA 4ZYGA 1S8NA 2CQKA 1I5ZA 4KA4A 5LHGA 4G7ZF
chains in the Genus database with same CATH superfamily
2X85A 2RNJA 3GO5A 1E2XA 2KIUA 4ENJA 2K4BA 5D5VB 1U5TB 2V1NA 5LFAA 3HUGB 5D4RA 1FEXA 3IC7A 2LK2A 1VI0A 1PJRA 1WJEA 4HV6A 3BG5A 3E6DA 4BJ5C 4OAYA 3S14J 1EH6A 2QQBA 1KYWA 3OYDA 2AO9A 2KKOA 1IZ1A 4M9XA 4FCYA 1IV8A 1MD0A 3LSKA 1SFXA 2EFOA 4I76A 2XGXA 1TNTA 5CVUA 2PX9A 1O57A 4Y13A 3HOXJ 1LJ9A 2HTSA 4YIRX 1S7AA 2W1OA 2NVYJ 2JPBA 2JSCA 1WVRA 2X51A 3WTXC 4C2TA 1EKEA 2KZGA 3WE2A 2E35A 3KP4A 3KEOA 5LGUA 2E1CA 2IA1A 4OMZA 2I5UA 4NC8A 3TO6A 3FXRA 1OCTC 1XGMA 4ZJZA 5J8CA 1B4AA 3K10A 3CDHA 4G9YA 4WCGA 3CLOA 3U2RA 1UHMA 3RDIA 2X4HA 3CCVI 2R7VA 2L7MP 4A6DA 2HDWA 4LLGF 2HYFA 4M73A 5L3CA 2R4GA 2KQRA 2X6OA 4LD5A 1YS6A 2H09A 2IBDA 1O3SA 3CMEI 4KUMA 5HVQC 2H1LA 3A02A 1IN4A 3F8FA 2HKXA 1B8IA 3IAS2 1CGPA 3DEUA 4AM3A 3O3KA 2VKDA 1IN6A 3GZ5A 4HOBA 1R5HA 1FYMA 1ETQA 1IN7A 2QQAA 2VE8A 4KDPA 1ZKGA 2MFZA 4FX4A 3K1NA 3RKXA 2IVMA 2K27A 2XF7A 2HOEA 3COAC 5C4JJ 3P9KA 1HA8A 3LSIA 4KMUX 1ZLKA 1S5LC 2CW0F 2X1DA 1DPUA 1B9NA 1D0ZA 2HTJA 2WV1A 2FEZA 2K3FA 3GX4X 2W85A 1B72B 1JKQC 3JRHA 1SD4A 1VQNI 4ASNA 4IZZA 1MH3A 2DMTA 1IN8A 3WODF 2CUJA 3KETA 2M4GA 2KLOA 2R7DA 2ZJRF 2Z3YA 1Y6IA 2JJ7A 3H92A 1MBGA 1V3FA 2OTLI 4KNYA 4XLPF 2HDCA 1RETA 4EM1A 4RAYA 2E71A 5IY5H 2FUG2 3C18A 3BOQA 2OU2A 1HCRA 4GGGA 2VKVA 2M30A 3I3LA 4NDLA 3OYNA 1BI2A 2KZVA 1D0XA 2JUGA 3I59A 4CCMA 1QRYA 1VFCA 5DD4A 4E6KG 5FRMA 5LBQA 4DZJA 1S29A 1P6RA 5CKTA 4RLQA 2L4MA 4KICA 5DCMA 1JUSA 2HPIA 1UMQA 2E2JJ 2E1NA 2QBYB 3MN2A 1R1VA 3BTJA 3KZYA 3QU6A 3DTEA 1YG2A 1XS9A 3K9TA 2JA5J 4AUXA 3KP6A 4RB0A 3ELKA 3I53A 2IAIA 4U0VA 2BV6A 2XDVA 2ZSIB 1OFCX 2QVOA 1J2XA 2V9VA 3LSGA 4YFNF 4BDZA 2ME6A 3K4LA 3FXUA 5ICCA 3CDLA 2DXIA 1JT6A 4BKXA 1D0YA 3U9GA 3E3VA 3OYAA 3HTSB 3RQ4A 3H0DA 4DJAA 2EZHA 3CCJI 4NHJA 2V9PA 1EF4A 5KAFC 1YX3A 3BPXA 4IOAF 4WXHA 4XOTA 2YX4A 2HYJA 4UVCA 5KNLA 4HLXA 1XDUA 1TWFJ 3V4GA 5DTDA 2YU9J 3C2BA 3P5JA 1B1BA 2B63J 1OLTA 2I10A 1U3EM 1TWHJ 1IRFA 5IT9K 1VTNC 5BPIA 3BG7A 1GVJA 3M3YJ 2EH3A 3BCAA 4QTRA 2HDDA 4IHXA 5DDGA 1U8RA 3KX2A 2FF4A 3QYFA 2Y2ZA 3MMYB 2NVTJ 1FP2A 3CCYA 1P7JA 1X58A 5LGTA 1MMDA 1ZQ3P 4L5JA 4I01A 3K70C 2P7VB 5LEJA 5FD5A 5AIQA 3K1PA 1O7LA 5FO5A 2LF8A 4A6EA 1JKPC 4G7HF 2E34A 3BTIA 1HKTA 1KU7A 3R61A 2G9WA 2V9KA 4P96A 2QSGX 3FMRA 4OINF 3CO6C 4B3XA 2PI0A 2W57A 3ERMA 4M9SA 5FLXZ 2JWTA 3ZRGA 1IAWA 4LLLA 3VOEA 3ZPLA 5D8KB 1MMGA 5FKLA 3FK6A 1QPIA 3L9FA 1J59A 5HOOA 4FASD 1LFBA 4XLFA 2EPFA 2QBYA 4O6JA 1CF7B 2P6SA 4HX8A 4M3BA 3TDUC 5HNHA 2CQ7A 5HDKA 4DYQA 2HZDA 1Z7UA 4NC6A 1X3ZB 4UNOA 2K9LA 2L0KA 1VQKI 1SEUA 3J80Z 2F4IA 2Y0SA 5FGMA 1I39A 3NWTA 2D5VA 4QWQA 1XSVA 4MHGA 2XROA 2JQ7A 2FJ1A 5AIPA 4L9JA 1IDYA 2DT7B 3CF2A 1T98A 3L2UA 1MNMC 4A3MJ 4J19A 3IRRA 4XLNF 1ZK8A 3HKZA 4JX5A 4E7SA 4HRIA 1VQMI 1YIOA 3GLXA 2L9NA 3JSPA 5JLWA 1HW5A 4P9FA 3MZYA 2KDZA 1K78A 2OF7A 4PFOA 2HOAA 4XRSG 1A35A 4DW6A 3GXOA 4S0HB 2EFWA 2QM3A 4KIFA 1FPQA 2FNAA 2E2IJ 5F08A 1YW9A 1MKMA 4GYIA 2K3PA 1I50J 1XSDA 2O6GE 3S15J 2GXBA 5CVVA 3GTOJ 3DEEA 2ESHA 2E60A 3EUHC 4HDUA 3SEQA 2IW5A 3IH3A 1DP7P 1KZHA 3TDZC 1LDKB 2Y30A 3HZJA 2VOPA 5J3LA 1FOYA 1TBXA 2LY1A 4KFCA 2BY2A 2DPUA 2BXZA 2K9QA 5TJJA 4LB5A 1GHCA 3HBLA 2NS8A 1MMNA 1EV7A 1PP7U 1X1BA 4XONA 1K6YA 3RSNA 4A3IJ 2XAFA 1SVLA 2UXXA 2RQPA 4YRVA 3W2WA 2FQ4A 3K2ZA 4BQQA 3JRBA 2QLZA 2P0WA 3GEZA 2VT3A 1A6QA 5KK1A 2K4JA 1TT5B 3DBLB 1ETYA 4XRSA 1IUFA 2W84A 1ZG5A 3BC8A 1YJ9I 1TQIA 4JYKA 3DEWA 2W48A 1TTYA 2OBPA 3I0TA 2TRTA 1T33A 5HLGA 3J7AO 4A3CJ 1R6RA 4IHTA 3RQIA 1Y8QB 4G7OF 2QUFA 4DQ2A 4BJTA 5L3GA 1PP8F 3DPTA 5K5RA 4MNUA 1ETVA 4CO8A 2UWMA 6PAXA 2LBFB 3CCEI 4E7LA 3IRQA 2R5ZA 2LG4A 3DPUA 3O8HA 1H9GA 4CH7A 3BG3A 2MBFA 2PLYA 1GV5A 3VSLA 3L2RA 3K4BA 1WGXA 2GIVA 3FMSA 3WHBA 1UB9A 4A5MA 4PGGA 3QOEA 2HU9A 2R7SA 1P4AA 3UNGC 3F9KA 1OISA 4IHSA 2OZUA 4MFDA 4OAZA 4A0YA 2L7ZA 2LKSA 2K40A 1SAUA 3DBHB 2CQXA 4V2FA 5CYVA 2BXYA 1UFMA 3DU5A 2JPCA 4FT8A 2DPDA 4IHVA 1Z7LA 2UUZA 3ZXSA 3TL4X 5M5YJ 2IS4A 1NG7A 3K4JA 2ISZA 1HC8A 2DFFA 3F6VA 2P6TA 4KN7X 1P92A 3GZNB 2EV5A 3M1CA 5GAHJ 1RR8C 5CVRA 4ZC3A 3NAUA 3T5XA 1RESA 1FMVA 2ACJA 1ETXA 5DEQA 2PJRA 3BTLA 3EDPA 4GXOA 3WTYC 2ICWG 3I4PA 2HVSA 4AWXB 5JVTA 1ZREA 3J81K 1AU7A 2W24A 3DTKA 4M6VA 5BPDA 2BZTA 2D2WA 5D5UB 3DPLC 3EUKL 2QKMB 4XN3A 3GTJJ 2GWRA 3OYMA 2CGPA 3Q9SA 4HDVA 4KMFA 4MEYF 2MGQA 2ZXJA 1Y0UA 2ZO4A 2EIMH 3WHCA 1USSA 4XIDA 3C1DA 2NYXA 2ZXIA 3KE2A 5F6FA 5ILSA 4M6XA 4AD9A 3BZCA 5GAEJ 3A01A 1HDDC 1T2KA 3M8EA 2VBWA 1ETKA 4OIOF 3GTQJ 2KJCA 3GZ6A 1BOBA 3OR1C 3R60A 4LMYA 2ZFUA 1QBJA 1QZYA 1LEBA 2QYOA 5F0CA 1R1TA 2JA2A 3ULQB 1KU9A 4KJZA 3K4CA 1I1SA 2BHZA 2DU9A 2M2EA 1Z6RA 1TQMA 4U87A 3BT9A 1Q1VA 4U88A 1STZA 2H1KA 3CUQB 2HVQA 3HXLA 2DYSH 4ESFA 2WBMA 2CUEA 4HNVA 3MQ0A 1WJ5A 4J00A 1MZBA 4RS8A 3OV8A 4HAMA 1TWGJ 5C3EJ 4F91B 2FSWA 2XAHA 2DT6A 2WTEA 2DODA 4CA0A 4ABZA 2FA5A 2R7UA 4OU0A 3FKIJ 1O7FA 2K9SA 5JHUA 2LMDA 4FE4A 2BW3B 4RAFA 4C2MJ 1XC5A 2BVLA 2DW4A 1K4TA 5GADJ 5D8LB 3CCMI 3RPUA 4B44A 4PJNA 4AIJA 4CHUA 3I56I 2CRGA 3LOCA 5B3SH 3Q9VA 2P5KA 4B4CA 2LYCA 4WF2A 4M74A 1OQYA 4AVZA 4BEHA 4I0AA 1DPRA 2NNYA 1WCMJ 1YRNB 4XKCA 4ITVA 1AOYA 4F92B 3HGYA 3GTLJ 3ECHA 1B72A 1S9HA 1WI9A 3OYEA 3BZ6A 3PIPF 2Y9ZA 1I1GA 1N25A 3VSKA 1L0OC 1MBHA 1ERDA 3TW6A 2IJLA 2EK5A 3BR6A 1CQTA 2OZ6A 1JHFA 5BNGA 5EJCA 4R79A 4A93J 1OR7A 2EFPA 3FDYA 4JOMA 4RGUA 2O0YA 3GCMA 2JZYA 3LSHA 4Y3OA 3RPQA 2KIMA 3TOBA 2AXLA 3VEPA 2WY8Q 3H35A 3TEDA 1MJ9A 3NWSA 1Z6TA 4JQFA 1EH8A 3J80K 1RC9A 2X1CA 2BGCA 2B7EA 4ZTJA 3V7CA 5FKNA 5GPCA 1MSFC 2XAUA 3A0BC 1S7EA 3T8TA 2L3DA 4N9HA 1MDMB 3ASOH 4B47A 2RKHA 2VXZA 3L2QA 4LFUA 5C44J 4YIIA 3F3XA 4BQNA 2ZXHA 4P9UA 3B02A 2HPMA 2DOEA 2K85A 4Q5SF 2HNHA 1BR2A 2B0LA 2A07F 3V8LA 2FRHA 1UCRA 3H5NA 1VQ8I 1JGGA 3S2HJ 2ISYA 2VC1A 1TP4A 4E70A 1DQUA 1Y0NA 2FOWA 5FKMA 1V4RA 5BQTA 3OYCA 4ENMA 1T0FC 2QWWA 3OYLA 1X2NA 2M34A 4ESJA 1MMSA 3BY6A 1KU3A 2ID6A 3AL0B 2K9MA 2VJ5A 3Q0WA 2NVXJ 5JFRA 3R6SA 2PQ8A 1NH3A 5LRSA 1HF0A 5D6FA 1UJ8A 4QPOA 1NHAA 4MQVA 3I4MJ 3A1YA 2EV6A 2LKXA 2N8GA 2R3SA 2GXAA 3QP5A 2NXNB 2KMUA 3WU0A 1R23A 4BBRJ 3D5RC 3R0JA 2PJPA 3HRUA 2IGNA 5F0HA 2O3FA 2NAZA 4MEXF 3CP8A 4PUSA 1E0EA 1LKXA 3BQZA 4AYBN 1Z91A 2OTJI 3HL2A 1TL8A 2V26A 4BU2A 3BR0A 3FM5A 4R8HA 1I6HJ 3S1MJ 5HLHA 4O5VA 3DLAA 3ABUA 2LKPA 3PNVA 4HG2A 4XLHA 2DA7A 2NS7A 3FZVA 1YW8A 3F23A 2O9LA 2BW3A 5CJ9A 5CVJA 3I4NJ 4IXAA 1D1CA 4A3EJ 5H2FC 4G6TB 3I5UA 2COMA 2XRLA 1GV2A 1D5YA 2FMLA 1B9MA 4V2GA 2M7AA 5FB2A 4AIHA 4DNCA 2MSYA 2XC7A 1QZEA 3DP7A 1BI0A 1HKQA 4M72A 1U8BA 4XICA 3HOTA 2KPMA 3WTTC 5HDGA 2V1DA 3ZN0A 3T1BA 2A5WA 1YIJI 3W2VA 1E17A 1FY7A 2A6EF 2FBHA 2WV0A 5HS9A 5IYBJ 1J7KA 2ELJA 4UUSB 1A36A 2EV0A 4K2EA 4YG2F 2JRTA 3ZMSA 4II2A 1IO2A 3HRTA 3F0CA 2LFBA 5K1YA 2KP6A 4CCKA 3K7AJ 5GTIC 3C2GA 4M3FA 4NNJA 2WB1N 1XMKA 3F6OA 3HGGA 2RV8A 1P7IA 2DA4A 3VYSB 3W6KB 3H0GJ 2VODA 2VASA 5FLXK 5EG0B 1S7OA 3J81Z 3ABTA 1MSEC 3ZQLA 3PUBA 5B1AH 1OCRH 4X6AJ 2QZ8A 4BY7J 3PIOF 3E1SA 4XK4A 2X6XA 3V8KA 4ZYHA 2X0LA 1IC8A 3CJRB 1USTA 2VJJA 2F5DA 3CZ6A 3DF8A 3KZZA 1MW7A 4RAGA 3SYTA 3SZTA 4WX9A 2A68F 2ZC2A 5IT9Z 3QPLA 1LB2A 2H8WA 4KT6A 3JAMK 3M8JA 1IXSB 2RVCA 5F27A 3NQOA 2PMZN 1OMIA 3G73A 2VBXA 3VFZA 5LHHA 3MEXA 3SQNA 5EZHA 3ZQ7A 1JUMA 4CZZA 5E17F 2DMNA 2QCOA 2BYVE 1HSTA 4B48A 3LSPA 1V54H 2VC0A 4HNTA 1BI3A 3S1RJ 1WFXA 4LITA 3I71A 1R58A 1FZPB 4ENNA 4G94A 5F64A 1W0UA 1EH7A 2K7LA 4HF2A 5IOYA 2XF6A 3IH2A 3RYPA 2W25A 2TCTA 1WH7A 2HEOA 3AG3H 1BIBA 1OPCA 3LSRA 2BY3A 3EETA 3I9V2 3LAJA 1V5FA 2Z33A 1X1PA 2COBA 2EB7A 4OIRF 2XPWA 1F36A 4CDGA 4HNUA 5GAGJ 1WJAA 3IAM2 4G8XA 1I27A 5E3NA 5E3OA 2LOOA 4M3EA 4ZYDA 3RKYA 4UB8C 3EQLF 1WPKA 3M7GA 4GFBA 1T6SA 1WSUA 3X2QH 1XMXA 3S2DJ 4KT5C 4X1EA 5FKOA 4CZCA 2V6EA 5JLXA 2WY7Q 2DCEA 5HS8A 3ABMH 3KP7A 3OYIA 4AVPA 1TW2A 3MAJA 3PUFA 3HHGA 3I64A 4EATA 1N77A 4LJZF 1AHDP 4LLNA 3MZHA 3WGIA 3TP0A 3DKXA 4XLEA 1YE9A 2DYRH 3H9QA 2F5VA 4HV5A 1OJLA 4YEJA 4DOZA 5K5OA 2P4WA 4BQAA 1MBKA 2KIFA 3JR9A 3DXJF 2XPVA 3HSFA 4S05A 3K1MA 4PK4A 2VQGA 4Z2YA 1FYLA 5DM6F 1A31A 5IP7J 3BDDA 3NRVA 4PSWA 3MKZA 1D5VA 4RBOA 3TQNA 1YRNA 3JRDA 2RN7A 1FBUA 2Q8KA 5J1RA 3LA3A 4PGHA 2NOGA 3ZQCA 4IL6C 1JKRC 3G1LA 2PFBA 2PG4A 1MJAA 5FKKA 1H88C 3ECOA 3PM1A 4DBRA 2YU3A 2O8XA 1Z9CA 2ZJ2A 2PMHA 3LFUA 5ICEA 4N4NB 2KIQA 2DJNA 1UELB 1R7JA 1FP1D 3LFKA 3PJRA 2E7XA 1YJNI 4OWRB 4QLCU 4NB5A 5JI6A 2V79A 3KPHA 2XB5A 3OIOA 2MH9A 4U7DA 3E6MA 1TT0A 2KISA 2WC2A 5E20A 2H94A 2CJJA 2OD5A 5EG0A 2P8TA 3HPHA 4Q47A 3DU6A 2P5VA 4GRIA 2HXOA 4KIGA 5KCMA 3SZGA 3L2VA 3QPSA 5GP9A 1WH5A 4KITB 1IW7F 1UHSA 1UZCA 2RGVA 4D5CA 3LNQA 4LIVA 1MBEA 3K6GA 1WRJA 1U2WA 2VUMJ 1G3TA 2ELKA 2M87A 1AWCA 4OOIA 2R5YB 4I0BA 1O3TA 2VJ4A 4H0EA 3M07A 5TGTA 4A69C 2CS3A 3G1OA 2M1BA 1T95A 4KISA 2X6WA 1XMAA 3VWBA 5IYCJ 1XG1A 2A69F 2JK3A 2JRMA 2JA8J 3TMOA 4I98B 3K2AA 2L4AA 3RJPA 2G7UA 1QU3A 2OCEA 4HQMA 3OYJA 1JI8A 2GQQA 2HR3A 4ESBA 3C7JA 1HQCA 3ABKH 4ON0A 1K79A 1IRGA 4HSTA 2K02A 2ECCA 3H9JA 4FISA 4XR6A 1OYYA 2XAQA 1FJLA 1FNNA 3CMYA 1SAXA 3HJEA 4ZDLA 1NK3P 2EFQA 2R92J 4LG0B 1JJ8C 3JRCA 3H36A 1SVOA 3QODA 3S3NA 4IOCF 2MD5A 4A0ZA 2AHQA 3QYBA 1ONVA 4NQWA 1QVUA 1I3AA 1LNWA 5HLTA 3UR3C 4HF1A 4A3GJ 2AQEA 2DAOA 1ZAOA 3FISA 1HSJA 1ETWA 2Y31A 3ZMTA 3J7YJ 4RB3C 3MCZA 1T8IA 1RKTA 2KRHA 4A3JJ 4XKVA 1TZLA 1UHWA 1PYVA 3QU3A 1ZRDA 2ZNYA 5EYRA 4BH9A 2EJRA 2DA5A 3C2HA 2E7WA 2K5CA 3FXLA 1VQ4I 4UUSA 2IPQX 3ML6A 5JHFA 1ZGJA 2R7OA 2DA1A 1D3YA 3GBGA 1H9TA 1S6LA 3D5LA 4BBSJ 2Z1DA 3ROUA 3JRGA 1G3YA 1KA8A 3LWFA 1U0JA 2KRFA 4I09A 3CCUI 3E6CC 2R7WA 2DJIA 2O7OA 5FD6A 1SANA 4IPAA 4KIBA 2FBKA 5DYMA 3J7AY 2CYYA 1ZGAA 4IX7A 5CQEA 2HGCA 3FHNA 4BE1A 2XAGA 3I58A 4HF0A 4U0WA 3SDBA 4G6DA 2XPUA 1QGPA 4FTHA 3V8JA 4I6ZA 5K5QA 4QIWN 3GUDA 3E7LA 1LUJB 1ITYA 3OS1A 2IT0A 1G4DA 1TQPA 2YUSA 4UUVA 3ABLH 4A3KJ 5C4XJ 5GPAA 4PZJA 4BQOA 1FBSA 1SD7A 2A3SA 3P9CA 2VE9A 3FXOA 2E36A 3D1NI 4XOPA 2JA6J 2EZIA 2I8DA 4ZDOA 3RZOJ 3OYBA 1FYKA 3U1KA 2BHYA 2E5ZA 1XCBA 1PVEA 2KT0A 4EQQA 5J4VA 2R5ZB 1BOAA 1VQPI 4BXXJ 2DA6A 5JVGF 2Z99A 4C3HJ 5EEHA 2DN0A 1R22A 3ZN1A 2GZWA 3OL4A 3BR1A 5TISC 3SDGA 4BDYA 2MW8A 1LE8B 3CDIA 1UG0A 2A6HF 5IT3A 1KONA 2VQLA 1OCCH 4BJ6C 3HYIA 2CV1A 2VT2A 2A5YB 2OJED 2BEOA 4QPQA 4BXUA 3GW2A 1BM9A 2OPTA 2ZJQF 1Z77A 1B8IB 1Q1HA 2H6CA 4PJJA 3K4MA 2L54A 3FBIB 4UY8I 1WI3A 2GOMA 1K4SA 2L01A 3BCBA 4JX4A 2PJRB 3CESA 5EEGA 3PFYA 5FROA 1FIAA 3R0AA 2NVUB 3K4NA 4A2UA 2HQNA 1T38A 2XHKA 1ON1A 3L00A 1X1CA 3ZMZA 4PCQA 2E2HJ 1WJBA 4CCLA 2A6TA 4GYGA 2PMZA 1J0RA 2R7TA 1ZTRA 1ZGWA 3LAPA 2YR2A 1MBFA 4XORA 1IGNA 3KP3A 3PL8A 4M71A 2AXTC 2DOAA 3WG7H 4AIDA 2VPLA 2XGDA 1VQ7I 2NS0A 3OSGA 4TV7A 2P81A 1R4MB 4JX6A 5BS6A 1YX5A 1HKSA 1W4MA 4IEJA 1U9NA 3CLQA 2IA0A 4A5NA 4O3MA 4BS9A 3OWTA 3E5UA 3LSMA 1J5YA 3LA2A 4D9JA 4EJWA 4CSWA 2D1VA 2M8GX 2VLAA 3FWEA 2DMQA 2IGOA 5IP9J 3EYYA 1D1AA 2Y48A 1KU2A 4DBQA 4I02A 3N4MA 3V42A 3ASNH 2VONA 2F2EA 2L5QA 2HQAA 3OIPA 5J4YA 1POGA 2QF7A 2BE5F 1TW3A 1BJZA 2Y75A 1GT0C 1FBQA 4E7KA 3G1MA 1BJAA 2Y0MA 2ZKZA 3RZDJ 2OV7A 3WTUC 2VKHA 2XGCA 4BACA 5L3BA 2EIKH 3ONQA 1IDZA 2GBYA 1JTYA 3KLOA 3REOA 5IYDJ 2EIJH 4HLYA 1BA5A 3E6BA 4G12A 2DMPA 4JK1X 2L9RA 2CG4A 3HOVJ 2VQCA 5FFXA 2FU4A 3VYUB 2KRCA 3FF5A 1RI7A 2O03A 2E1MB 4EJVA 2CFXA 4AYBA 4D7NA 3FKJA 1G8XA 1VNDA 1FTTA 3H5AA 4OMYA 2QGUA 1HDPA 3WE3A 1OYIA 3CUQC 4XBFA 5HNFA 1QVTA 3IL2A 3AG4H 1TC3C 2HQRA 2YS9A 4B43A 4I2OA 2LP0A 3E5XA 3HEFA 2WAQN 3SZPA 2OAZA 3TOAA 1ZELA 2HVRA 1YHQI 1FIPA 1ENHA 4EJOA 4L9VA 4MIMA 2M9HA 4OIPF 1Y1WJ 3PFIA 4XSXF 3EYIA 3HB9A 2IRFG 1GUUA 2WADA 4ZH4F 5LHIA 1VQOI 1LE8A 2WA0A 2DO7A 1R4NB 1T0FA 4BHPA 2KL4A 2HI3A 3D0SA 1APLC 3A4CA 1Y39A 4XLCA 1MJBA 3ZQFA 2HWVA 5JR3A 4AIKA 4EM2A 1WQ2A 4IF4A 2XIGA 3L2WA 4PJMA 4B8XA 2H27A 2IS1A 3H3UA 1BC8C 2V1UA 3HC7A 1WZ2A 2M4KA 4XNFA 4E4HA 4U7BA 2WAQA 1R00A 4WWCA 2DMUA 4PDKA 2GOXB 3ZQQA 3HDDA 5J47A 1P4XA 2QENA 5E1ZB 4KYWA 1I6XA 2AQFA 1VQLI 2BBYA 1XSXA 3BQYA 1WWXA 2ECBA 2FNPA 5EZGA 5CPRB 3OSFA 2Y9YA 4Y33A 4EJTA 3D5SC 2D1HA 3WGGA 1RIOH 1R5GA 3F8BA 3ZQGA 1YOVB 5F1JA 1HOMA 2Q2EB 5H20A 3OS0A 2J5OA 4MQ9F 4UUTA 5EF6A 3HOWJ 2DK5A 4P1WA 2V1XA 5E8IA 3ZP5A 4CXFA 3IH4A 1DP3A 3QPHA 3LQQA 1XN7A 4LG0A 3S17J 5ILUA 3CCSI 1LDJA 1V5EA 1XGOA 5KHDA 2RC4A 4D5FA 3W6JB 1ZARA 3F21A 1FWZA 2C6YA 4L0YB 3RCOA 1ZYRF 4XRFA 3FM3A 1Z3YA 1ACIA 1P4WA 3QQAA 2DTRA 3LSTA 2W4SA 2DT5A 5B1BH 1O4XA 2XF5A 4BL0B 1FSHA 3ZQIA 2HXIA 2F5CA 5LLQA 3JRAA 3DV8A 2FXAA 3OY9A 1BBYA 1U5TA 4IRIA 2DQRA 2EINH 1WKMA 3R4KA 4G6QA 3GFJA 2CU7A 4C3IJ 1TWCJ 3VODA 2X6YA 5J1UA 4YIFA 5D4SA 5B66C 5M3FJ 1TNSA 3GTGJ 4XM3A 3CO7C 3CC7I 4MTEA 2DDAA 4IJAA 5DV5A 4FHTA 1MIJA 1RZ4A 1SFUA 2OA4A 3Q5FA 1SFEA 4PSXA 1ZG1A 2FQ3A 2IEKA 2PN6A 1W36D 1A6IA 1GDTA 1ZG3A 2MA3A 3S32A 4H4KC 4BAYA 1D8JA 3GFIA 3H5RA 4Y4RA 3WU1B 2DOFA 1XB4A 3QWLA 1OCPA 3T8RA 2R93J 1E3HA 3TBIA 5D5WB 1KQ8A 3FXKA 3TKYA 5E79C 2L7KA 3HM5A 1H0MA 2CQNA 2PMUA 3RTRA 2ELHA 3J7ZI 2R7ZJ 2VBZA 3JTHA 2KHMA 4PJ0C 2DFEA 1IN5A 5LRRA 3G71I 3I55I 1WHUA 2GIZA 5DS9A 2STWA 3OOPA 3A01B 3KP5A 1LEAA 2ZNZA 4IHYA 4HPQA 4XMYA 4F93B 2LY9A 1XX5A 3HRMA 4A3FJ 3PNYA 3G4SI 1PDNC 2GA2A 2IXSA 3BG9A 1D1BA 3DKYA 3S3MA 3VB2A 1Y1VJ 4NBQA 3BTCA 4IVNA 3SFIA 3SEZA 1L3LA 1IXCA 3F8NA 1XGNA 2JA7J 1TWAJ 1W5SA 4EMSA 4CCNA 4EGZA 1DDNA 3BR2A 4RGSA 5HLIA 4CUGA 2LY2A 3CTAA 1BI1A 4Y17A 3BR3A 1LVKA 2L7FP 3DQVC 3A03A 1YITI 3S93A 3RKWA 1QPMA 2W82A 4FX0A 3FX3A 2RQQA 4UV8A 2DA2A 4XKBA 5IP6A 2ZMEA 3GYHX 2F4OB 5E1WA 1OCOH 4M3DA 4UVAA 1GLNA 2R0QC 3P9IA 2UV1A 4X0GA 2CWEA 4MGRA 5CLSA 3B6AA 1ZHFA 1YW7A 2ZB9A 3E5QA 5M5WJ 5E8GA 1KYZA 3DBRB 4NC7A 3CF5F 4B1RA 1JKOC 2JSPA 3MKLA 1W7PA 1D8KA 4BE2A 1K6OA 4BHCA 1QA6A 1X4OA 3M1EA 1IF1A 2LRDA 1QNTA 2HZTA 1XD7A 4BGDA 1G59A 4ETSA 1DGRM 4EV0A 1P2FA 1ZRFA 1PUEE 3MFKA 2LTPA 3S3OA 3WU2C 5K7FA 3LMMA 1MNDA 2XASA 1YFHA 3DFGA 3PQJA 4ZDPA 4UXNA 1JUPA 4W97A 1ORKA 1IUYA 4L5IA 2HQ5A 2VL8A 3MWMA 2FBIA 3U1DA 2QQ8A 1AA7A 4ZYAA 3JREA 2LR8A 3AG2H 3TGNA 1ETOA 1LDDA 1A5JA 2UZKA 2L9VA 2XKOA 3GTKJ 1J9IA 4L5EA 3RPUD 4LOCA 2GAUA 1MGTA 5J40A 3E97A 4Q4ZF 3BP8A 4WK8F 3N97A 3F8MA 3JTGA 4MLOA 5ILVA 1T56A 2WAEA 1VQ5I 2VKEA 2XKPA 1UAAA 2JTVA 3AFHA 2DDBA 1LVAA 3QAHA 1RNLA 3QOPA 2LDUA 2IS6A 1R36A 2F48A 5D6EA 1YO5C 2K86A 1K83J 1X19A 2W00A 3B73A 4EGYA 4ZZLA 1B59A 4LIUA 2GLOA 3KYCB 1SFKA 2F4MB 5J6XA 4IQ4A 1JE8A 3S1NJ 1H8AC 4ENKA 4F52A 1K78B 5DM7F 3GFMA 2D45A 3M8FA 2CMPA 4II3A 3L7WA 1F4KA 4EVIA 3CCRI 2NRAC 3M4OJ 3RKQA 1U78A 3ZCOA 1GXQA 4RM2A 1FC3A 1O3RA 3KFWX 2LNBA 3IKVA 4JBAA 3JSOA 1MDMA 3PNTA 5J8FA 2E19A 1F1ZA 4J01A 4E7ZA 3OOUA 3PSFA 5LEKA 1IG7A 2BY0A 3RYRA 2B9SA 5AONA 3V7SA 2JT1A 3P7NA 1YTYA 2VPRA 2IGKA 3L1PA 2KJBA 3K69A 4E7JA 1JTXA 2F5FA 2MD0A 2H6BA 2K9NA 2M45A 3TW7A 2DFHA 4KN4X 4A3DJ 1RRJA 2P5LC 2RDPA 3KP2A 5A2QK 2AS5F 5ED4A 3O2PE 2GA1A 4MFEA 2M8EA 3A0HC 2DBBA 5CVIA 3AAFA 2CFOA 1IV6A 4L9TA 1JHHA 5CQGA 4CYDA 4JP0A 5KAIC 4CCJA 4RAZA 1YI2I 2L02A 4CICA 2W7NA 2CUFA 4BE0A 4F55A 4LGWA 5HS7A 2ESNA 2MLGA 2JN6A 3PO3J 3CC2I 5DCFA 1IJWC 3OMYA 2VBYA 3OL3A 2CSOA 2LVSA 2DFIA 2CW8A 2XRNA 1FX7A 2XVCA 4LK1F 2M3AA 2QQ9A 2FE3A 4RA2A 5J1YA 1QO0D 5FRNA 2UXNA 1VQ9I 1PUFB 3AG1H 3Q3SA 3GVAA 1X1AA 1FLIA 4HBLA 2VB6A 2O61A 4IRHA 1FMWA 1P9QC 2Z2SB 5ICFA 1G3SA 1SMTA 3OYKA 3ZMUA 4I7HA 1BW5A 2ZXWH 3F8CA 1AKHA 1YLFA 2MG4A 3ZOBA 3L09A 3IV5A 3BWGA 1DU6A 1FSEA 2F6CA 3HPGA 1G6NA 1KQ0A 2WWYA 2STTA 2VOOA 5DUKA 3A2KA 4N4OB 4P55A 1OYWA 2XV4S 4HYEA 5ERIA 3LSJA 4P5OA 4B3AA 4ZTFA 1LFUP 1OR7C 4LB6B 2Q1ZB 5GTHC 3B6CA 4BYYA 3AL0C 4HW0A 2Z9OA 2V4JC 2V6CA 3WTVC 3HKZN 1ON2A 1O3QA 1W36C 3S1QJ 1JGSA 2EA2A 4MTDA 3O6BB 3PSIA 2G0EA 5A2QZ 1J09A 2IP2A 3QP6A 1T08B 2XSJC 4RLFA 5L3DA 4C2UA 3CJNA 2ID3A 1IRXA 3G2BA 4HA8A 2EBIA 3JCUC 4HQEA 2YSRA 3ZQHA 3H1CA 4CYCB 2ME0A 3ERED 1DU0A 2CUZA 4DGWB 1SVMA 2VIXA 5L3FA 1VF9A 4PFPA 2EILH 4L9NA 3VDXA 2CW7A 3DCFA 3WTZA 1BN5A 3G6EI 2GM4A 2PEXA 1W5TA 1ZR4A 1W5CC 3GFLA 3CJTB 1BC7C 2LF7A 3NARA 4E7HA 1X3UA 4C30A 4RGRA 1Z67A 3H3ZA 5F0FA 3QRFF 3MKWB 1YYVA 1HW1A 2DLLA 4UV9A 4EJUA 4DIQA 3UKGA 3F22A 2OQRA 4LG3A 4DZPA 1BR1A 3T0YA 2CQQA 4RDUA 2R7RA 1C0WA 3C3WA 3HSRA 1X1DA 4BEHB 5F1RA 4HSRA 1Z1DA 4XKWA 1K61A 3BR5A 3FK7A 5DUIA 3KIOA 1K7AA 2RNGA 3FXJA 3JAMZ 2MC3A 1HW2A 2VI6A 3S16J 2PBIA 1QZZA 4E7IA 1HXDA 4NQWB 2EWNA 4M6YA 4GCVA 1EA3A 1YS7A 1G2HA 3EUHA 3HTUA 4QSHA 4W1UA 3QYEA 5TRDA 1WJFA 1MBJA 1Y56A 2IA2A 2JUCA 3QPTA 1XDSA 3NEUA 1Z3XA 3N05A 1HBXG 2DA3A 3BJAA 3MVPA 1Z05A 3OR2C 1SFOJ 3SXYA 5D5XB 5E3LA 3V7RA 4AU7A 1QHHD 4HZFA 1F9NA 4LK0F 1V55H 2NOJB 2BVMA 2Z16A 3W3CA 1JT0A 1OKRA 4PJLA 2LREA 2O8KA 4D1QA 3OS2A 2L2OA 3CC4I 3W6VA 5M3MJ 3HOYJ 5FLMJ 2KFDA 1Z21A 2Z5UA 2E1OA 3CMAI 1MNEA 1FOXA 4IHWA 3KCCA 3L2CA 3WG9A 3SFZA 3VYRB 3OYFA 9ANTA 1FT9A 1R1UA 1QQIA 2X1EA 3IWFA 1BW6A 2VXDA 5HDNA 1PUFA 2VJIA 1SMYF 3IKTA 4EM0B 4ANJA 3IWZA 1Y8RB 4F3QA 2QSFX 2DI3A 2OUMA 1W7PB 4XRMA 3HOUJ 4C9YA 4BY1J 1DGWY 3ZMVA 1IRZA 1W1WE 3FIWA 3TO9A 4HEA2 5EGOA 1H89C 1OCZH 2L9SA 1X2MA 4C3JJ 5FLVA 3GF2A 3HOZJ 2XAJA 4UB6C 4Y15A 4BXFA 2Q0OA 3CQZJ 2EFNA 4BHBA 4L18B 2CO5A 2M0CA 3CMMA 3WTWC 2HFHA 3Q0UA 4HX4A 2J5PA 2FD5A 2MABA 4IQJA 3BPVA 5FFZA 1WJDA 2Y69H 4A0XA 1E3PA 3TO7A 2IS2A 4UVBA 3DLLF 3CUQA 1I3QJ 4ZZDA 2IGMA 5IPAA 5K7ZA 1R9TJ 1YJWI 3ISPA 3W2AA 1R49A 1RR7A 5HODA 3M9AA 2V7FA 5IOZA 2VQHA 3BZKA 1NTCA 2RAEA 3BJOA 1YQAA 2E5NA 5H6QA 3MKYB 2CH0A 3OYGA 1XPXA 4YELA 1IXRC 2X48A 2WAFA 1F43A 2LLKA 1ZN2A 5K7HA 3G3ZA 3CP2A 1JJ6C 3MD2A 2VN2A 4RGXA 1VQ6I 4GO1A 4BUPA 3RIRA 5BMZA 2XB0X 3TP3A 3AKZA 1W0TA 4R1HA 2YPRA 1BL0A 2GXGA 1ZRCA 1U9OA 2H8RA 5B5EC 1MMAA 2QA4I 2JMWA 5EDNA 4A3BJ 3WGHA 1G3WA 4WXCA 2CV2A 1ULYA 2EA4A 2OC6A 4N9IA 1SC7A 4D0PA 1M1EB 2R7QA 4U0YA 1SD6A 4GDFA 1LFPA 2ZFWA 1NK2P 1E3OC 3KZIC 4ZYEA 4S04A 5E1XA 3EUAA 1F5TA 3JW4A 3HUGA 4YFKF 4XSZF 3U21A 3KEYA 3BG6A 2LD5A 2TDXA 1BIAA 2ZCWA 4XL9A 1RUOA 4IO9F 3PO2J 3VYTB 1HLVA 4IKFA 5BOXA 2Q2EA 3RI4A 3IP4B 2DK8A 4EEFG 2QEXI 1UG2A 2LSOA 5EGOB 1QHGA 2JVHA 4CCOA 3CD6I 3BROA 1FTZA 2KDOA 3ZMDA 2BY1A 3GMEA 5L3EA 3HRSA 3LL7A 4NUBA 3I59B 2M5WA 3GLLA 3CUOA 2EZKA 4A12A 2NNNA 2BOLA 3E0JB 4MO7A 1SD5A 4RM3A 3OIQA 2ETHA 3KLNA 2M0MA 4V19K 3I54A 1LPQA 1KGSA 3GWZA 4XN0A 1DUXC 2HS5A 4M3GA 2FX0A 1TLHB 2ADUA 1R71A 2MH2A 3KYLA 1U5TC 3K4KA 3ZR8X 1W7PD 3DKWA 2EQRA 2XGEA 4XLAA 4Z6YA 4A3LJ 4Y52J 2HYGD 3OYHA 3DTIA 2A61A 2ZJPF 1XGSA 2QKLB 4RB2C 3H9GA 1XTAA 4YFXF 5LD2C 1RUNA 2G7HA 1V5GA 1AKHB 1N78A 1S3JA 5EEAA 2FMYA 3JRIA 3JRFA 3CCLI 2ZMEB 3KYDB 4FE7A 5F04A 2XSDC 2MLKA 3GTPJ 5DCMB 2NVQJ 2QSHX 4CGZA 2M7BA 3H3VK 2HOTA 1XCVA 4F7ZA 4DYCA 4CYCA 4B09A 1N75A 1ODDA 2MYSA 3F72A 2OCCH 3WTSC 3K0LA 1MH4A 1LQ1A 1R5ID 3LQRA 1A04A 2HOSA 2XUBA 2EZLA 2HKOA 3SHFA 3HSEA 1BR4A 3SJMA 1ZLJA 3HG9A 3Q0VA 3HOSA 1RKWA 4WXDA 4Y7NJ 1GVDA 3HIFA 3HHHA 1EJ9A 3K70D 3FMQA 4FQGA 3O8GA 1WJCA 4AC0A 1VZ0A 2WB1A 2CV0A 2LBFA 4XQFA 2P7CB 5H6RA 2LC2A 2FOKA 3EPZA 2RREA 1RPWA 2OQGA 1FOKA 2R7XA 4M9ZA 3FXQA 4BNCA 4Q48A 3IHUA 1S72I 2MC4A 1U6GA 4N0BA 1J75A 1CF7A 1X3WB 4FETA 4UHTA 3IUOA 2O5RA 4OIQF 1B6AA 3LA7A 2X9DA 5E3MA 3S2WA 3VPRA 4D7MA 5DD8A 3FXMA 3CJQB 4L0ZB 5LGNA 3BJ6A 4DYRA 2Y0SN 3KEQA 1GXPA 5ICGA 2A05A 3MZ8A 4RB1A 1FOWA 1JXSA 3DWLE 2DQLA 3FHZA 2YX7A 5M5XJ 3CCQI 3FBNB 3GTMJ 2JVGA 1REPC 3PQKA 2DTZA 5FJ8J 2R7FA 1ZH5A 2F5EA 5E18F 2E1MC 4IRGA 3S8PA 2ZMEC 1KQ9A 4HX7A 3BLYA 3ZGKA 1T39A 2ZSHB 2ZBKA 1Z0XA 4RMNA 5KVRA 4I99C 2R5YA 1X4PA 4ZYGA 1S8NA 2CQKA 2LH9A 1I5ZA 4KA4A 1ZR2A 5LHGA 3ESWB 1NG6A 4G7ZF
chains in the Genus database with same CATH topology
2RNJA 3GO5A 1E2XA 2KIUA 4ENJA 2K4BA 5D5VB 1U5TB 5D4RA 3IC7A 4HV6A 3E6DA 1EH6A 2QQBA 1KYWA 2KKOA 1IZ1A 4M9XA 1MD0A 1SFXA 2EFOA 2XGXA 1TNTA 5CVUA 1O57A 4Y13A 1LJ9A 2HTSA 1S7AA 2JPBA 2JSCA 3WTXC 3WE2A 3KP4A 3KEOA 5LGUA 2E1CA 2IA1A 4OMZA 3TO6A 3FXRA 1XGMA 5J8CA 1B4AA 3CDHA 4G9YA 4WCGA 3CLOA 3U2RA 1UHMA 3RDIA 2X4HA 4A6DA 4LLGF 2HYFA 4M73A 5L3CA 4LD5A 1YS6A 2H09A 1O3SA 4KUMA 5HVQC 1IN4A 3F8FA 2HKXA 1CGPA 3DEUA 3O3KA 1IN6A 3GZ5A 4HOBA 1R5HA 1FYMA 1IN7A 2QQAA 2VE8A 4KDPA 4FX4A 3K1NA 3RKXA 2IVMA 2K27A 2HOEA 3COAC 3P9KA 4KMUX 1ZLKA 2CW0F 1DPUA 1B9NA 2HTJA 2FEZA 3GX4X 2W85A 1SD4A 4ASNA 1IN8A 3WODF 3KETA 2R7DA 2Z3YA 3H92A 1V3FA 4KNYA 4XLPF 2HDCA 4EM1A 4RAYA 3C18A 3BOQA 2OU2A 4GGGA 2M30A 1BI2A 3I59A 5DD4A 5LBQA 1S29A 1P6RA 2L4MA 4KICA 5DCMA 2E1NA 2QBYB 1R1VA 3KZYA 3QU6A 1YG2A 3K9TA 3KP6A 4RB0A 3ELKA 3I53A 4U0VA 2BV6A 2QVOA 1J2XA 2V9VA 4YFNF 5ICCA 3FXUA 3U9GA 3E3VA 3HTSB 4NHJA 3BPXA 4WXHA 2YX4A 4UVCA 4HLXA 1XDUA 3V4GA 1B1BA 1U3EM 5IT9K 1IRFA 1VTNC 5BPIA 1GVJA 5DDGA 1U8RA 2FF4A 1FP2A 5LGTA 4L5JA 4I01A 2P7VB 5LEJA 5FD5A 5AIQA 3K1PA 1O7LA 5FO5A 2LF8A 4A6EA 4G7HF 1HKTA 1KU7A 3R61A 2G9WA 4P96A 3FMRA 4OINF 3CO6C 2PI0A 2W57A 4M9SA 5FLXZ 1IAWA 4LLLA 3VOEA 3ZPLA 5D8KB 3L9FA 1J59A 5HOOA 2QBYA 4O6JA 1CF7B 2P6SA 4HX8A 3TDUC 5HDKA 1Z7UA 4UNOA 3J80Z 5FGMA 4QWQA 1XSVA 4MHGA 2XROA 5AIPA 4L9JA 1T98A 3IRRA 4XLNF 1YIOA 3GLXA 3JSPA 1HW5A 4P9FA 3MZYA 1K78A 3GXOA 2EFWA 2QM3A 4KIFA 1FPQA 2FNAA 1YW9A 1MKMA 4GYIA 1XSDA 2O6GE 2GXBA 5CVVA 2ESHA 4HDUA 2IW5A 1DP7P 3TDZC 1LDKB 2VOPA 1TBXA 4KFCA 2DPUA 5TJJA 4LB5A 1GHCA 1EV7A 1PP7U 2XAFA 2UXXA 2RQPA 3K2ZA 2QLZA 3GEZA 2VT3A 5KK1A 2K4JA 2W84A 1ZG5A 1TQIA 1TTYA 2OBPA 3I0TA 3J7AO 5HLGA 4IHTA 4G7OF 2QUFA 4DQ2A 5L3GA 1PP8F 3DPTA 5K5RA 4MNUA 4CO8A 2UWMA 6PAXA 3IRQA 1H9GA 2MBFA 2PLYA 2GIVA 3FMSA 1UB9A 4A5MA 4PGGA 1P4AA 4IHSA 2OZUA 4A0YA 5CYVA 1UFMA 2JPCA 2DPDA 4FT8A 2ISZA 3F6VA 2P6TA 4KN7X 1P92A 2EV5A 5CVRA 3T5XA 2ACJA 5DEQA 3EDPA 4GXOA 3WTYC 3I4PA 4AWXB 5JVTA 1ZREA 3J81K 2W24A 5BPDA 2D2WA 5D5UB 3DPLC 2GWRA 2CGPA 3Q9SA 4HDVA 4KMFA 4MEYF 2ZXJA 1Y0UA 2ZO4A 1USSA 3C1DA 2NYXA 3KE2A 5F6FA 5ILSA 4M6XA 4AD9A 1T2KA 3M8EA 2VBWA 4OIOF 2KJCA 3GZ6A 4LMYA 3R60A 1QBJA 1LEBA 1QZYA 2QYOA 1R1TA 3ULQB 1KU9A 1I1SA 2DU9A 1Z6RA 1TQMA 4U88A 1STZA 3CUQB 4ESFA 3MQ0A 1MZBA 4RS8A 3OV8A 4HAMA 2FSWA 2XAHA 2WTEA 2FA5A 4OU0A 1O7FA 5JHUA 2DW4A 5D8LB 3RPUA 4AIJA 4CHUA 3Q9VA 2P5KA 4WF2A 4M74A 4I0AA 1DPRA 2NNYA 1AOYA 3ECHA 1WI9A 3BZ6A 1I1GA 1L0OC 2IJLA 2EK5A 2OZ6A 1JHFA 4R79A 1OR7A 2EFPA 4RGUA 2O0YA 2JZYA 3RPQA 2KIMA 3TOBA 2AXLA 3VEPA 1MJ9A 1Z6TA 4JQFA 1EH8A 3J80K 2BGCA 3V7CA 3T8TA 2L3DA 4N9HA 1MDMB 2RKHA 2VXZA 4LFUA 4YIIA 3F3XA 4P9UA 3B02A 4Q5SF 2B0LA 2A07F 3V8LA 2FRHA 1UCRA 2ISYA 2VC1A 4E70A 1V4RA 5BQTA 4ENMA 2QWWA 4ESJA 3BY6A 1KU3A 5JFRA 3R6SA 2PQ8A 5LRSA 5D6FA 1NHAA 4MQVA 2EV6A 2R3SA 3QP5A 3WU0A 1R23A 3R0JA 2PJPA 3HRUA 2O3FA 2NAZA 4MEXF 1Z91A 3FM5A 4R8HA 5HLHA 4O5VA 3ABUA 2LKPA 3FZVA 1YW8A 3F23A 5CJ9A 5CVJA 4IXAA 3I5UA 2COMA 2FMLA 1B9MA 5FB2A 4AIHA 4DNCA 3DP7A 1BI0A 1HKQA 4M72A 3HOTA 3WTTC 5HDGA 2V1DA 3ZN0A 3T1BA 1E17A 1FY7A 2A6EF 2FBHA 2WV0A 5HS9A 1J7KA 2EV0A 4K2EA 4YG2F 2JRTA 3ZMSA 3HRTA 5K1YA 1XMKA 3F6OA 2RV8A 3W6KB 2VODA 5FLXK 1S7OA 3J81Z 3ABTA 2QZ8A 3V8KA 4ZYHA 2X0LA 1USTA 2F5DA 3DF8A 3KZZA 3SZTA 4WX9A 2A68F 5IT9Z 1LB2A 3JAMK 1IXSB 2RVCA 3NQOA 1OMIA 3G73A 2VBXA 3VFZA 5LHHA 3MEXA 3SQNA 3ZQ7A 4CZZA 5E17F 2BYVE 1HSTA 2VC0A 1BI3A 3I71A 1R58A 1FZPB 4ENNA 4G94A 5F64A 1EH7A 2K7LA 4HF2A 3RYPA 2W25A 2HEOA 1BIBA 1OPCA 3EETA 3LAJA 2Z33A 2EB7A 4OIRF 4CDGA 4G8XA 1I27A 4ZYDA 3RKYA 3EQLF 3M7GA 1T6SA 1WSUA 4KT5C 5HS8A 3KP7A 4AVPA 1TW2A 3MAJA 3HHGA 3I64A 4LJZF 4LLNA 3MZHA 3WGIA 4HV5A 5K5OA 2P4WA 4BQAA 2KIFA 3DXJF 3HSFA 4S05A 3K1MA 4Z2YA 1FYLA 3BDDA 3NRVA 1D5VA 3TQNA 2RN7A 1FBUA 2Q8KA 3LA3A 4PGHA 2PFBA 2PG4A 1MJAA 3ECOA 2YU3A 2O8XA 1Z9CA 2ZJ2A 2PMHA 5ICEA 1R7JA 1FP1D 3LFKA 2E7XA 4QLCU 4NB5A 5JI6A 2V79A 2MH9A 4U7DA 3E6MA 2WC2A 5E20A 2H94A 2OD5A 2P8TA 4Q47A 2P5VA 4KIGA 1IW7F 2RGVA 1WRJA 1U2WA 1G3TA 2M87A 1AWCA 4OOIA 4I0BA 1O3TA 4H0EA 2M1BA 1XMAA 2A69F 4I98B 2L4AA 3RJPA 2G7UA 4HQMA 2GQQA 2HR3A 4ESBA 3C7JA 1HQCA 4ON0A 1K79A 1IRGA 2K02A 1OYYA 2XAQA 1FNNA 1SAXA 2EFQA 4LG0B 2MD5A 4A0ZA 4NQWA 1ONVA 1LNWA 4HF1A 2DAOA 1ZAOA 1HSJA 3ZMTA 4RB3C 3MCZA 1UHWA 3QU3A 1ZRDA 2ZNYA 4BH9A 2EJRA 2E7WA 2IPQX 3ML6A 1ZGJA 1D3YA 1H9TA 1S6LA 3D5LA 3ROUA 1G3YA 1KA8A 3LWFA 2KRFA 4I09A 3E6CC 5FD6A 4IPAA 4KIBA 2FBKA 5DYMA 2CYYA 1ZGAA 2HGCA 2XAGA 3I58A 4HF0A 4U0WA 4G6DA 1QGPA 3V8JA 5K5QA 3GUDA 2IT0A 1G4DA 1TQPA 4UUVA 4PZJA 1FBSA 1SD7A 2A3SA 3P9CA 2VE9A 1FYKA 1XCBA 4EQQA 1BOAA 2Z99A 5EEHA 1R22A 3ZN1A 2GZWA 2A6HF 5IT3A 3HYIA 2VT2A 2A5YB 2BEOA 4BXUA 3GW2A 1BM9A 1Q1HA 2H6CA 2L54A 2L01A 5EEGA 3R0AA 4A2UA 2HQNA 1T38A 2XHKA 1ON1A 3L00A 3ZMZA 4PCQA 4GYGA 1J0RA 3LAPA 2YR2A 3KP3A 4M71A 2NS0A 4TV7A 5BS6A 1HKSA 1W4MA 2IA0A 4A5NA 4O3MA 3E5UA 1J5YA 3LA2A 4EJWA 2D1VA 3FWEA 3EYYA 2Y48A 1KU2A 3N4MA 4I02A 2VONA 2F2EA 2BE5F 1TW3A 2Y75A 1FBQA 1BJAA 2Y0MA 2ZKZA 3WTUC 5L3BA 3KLOA 3REOA 4HLYA 3E6BA 4JK1X 2CG4A 5FFXA 2FU4A 3FF5A 1RI7A 2O03A 4EJVA 2CFXA 4OMYA 3WE3A 1OYIA 3CUQC 4XBFA 3IL2A 2HQRA 4I2OA 3E5XA 3SZPA 2OAZA 3TOAA 4EJOA 4L9VA 4OIPF 3PFIA 4XSXF 3EYIA 2IRFG 4ZH4F 5LHIA 2DO7A 1T0FA 4BHPA 3D0SA 1MJBA 2HWVA 5JR3A 4AIKA 4EM2A 1WQ2A 4IF4A 2XIGA 4B8XA 2H27A 3H3UA 1BC8C 2V1UA 4U7BA 1R00A 4WWCA 4PDKA 1P4XA 2QENA 5E1ZB 4KYWA 1I6XA 2BBYA 1XSXA 1WWXA 2FNPA 4EJTA 2D1HA 3WGGA 1RIOH 1R5GA 3F8BA 5H20A 2J5OA 4MQ9F 2DK5A 2V1XA 5E8IA 3ZP5A 4CXFA 3QPHA 3LQQA 1XN7A 4LG0A 5ILUA 1LDJA 1XGOA 2RC4A 3W6JB 1ZARA 3F21A 1FWZA 2C6YA 4L0YB 1ZYRF 4XRFA 3FM3A 1P4WA 2DTRA 3LSTA 2DT5A 1FSHA 2F5CA 5LLQA 3DV8A 2FXAA 4IRIA 1BBYA 1U5TA 2DQRA 1WKMA 3R4KA 4G6QA 3GFJA 3VODA 4YIFA 5D4SA 1TNSA 3CO7C 4MTEA 4IJAA 5DV5A 4FHTA 1RZ4A 1SFUA 2OA4A 3Q5FA 1SFEA 1ZG1A 2FQ3A 2PN6A 1ZG3A 2MA3A 4BAYA 1D8JA 3GFIA 3WU1B 1XB4A 3T8RA 5D5WB 1KQ8A 3TKYA 1H0MA 2PMUA 3RTRA 2ELHA 2VBZA 3JTHA 1IN5A 5LRRA 2STWA 3OOPA 3KP5A 1LEAA 2ZNZA 3HRMA 1PDNC 2GA2A 3VB2A 4IVNA 1L3LA 1IXCA 3F8NA 1XGNA 4EMSA 1W5SA 4EGZA 1DDNA 4RGSA 5HLIA 3CTAA 1BI1A 4Y17A 3DQVC 3RKWA 1QPMA 4FX0A 4UV8A 3FX3A 2ZMEA 3GYHX 5E1WA 4UVAA 3P9IA 2CWEA 4MGRA 5CLSA 1ZHFA 1YW7A 3E5QA 5E8GA 1KYZA 1W7PA 1D8KA 1K6OA 4BHCA 3M1EA 1IF1A 1QNTA 2HZTA 1XD7A 1ZRFA 4ETSA 4EV0A 1P2FA 1PUEE 3MFKA 2XASA 1YFHA 3DFGA 3PQJA 4UXNA 1IUYA 4L5IA 3MWMA 2FBIA 3U1DA 3TGNA 1LDDA 2UZKA 1J9IA 2XKOA 2GAUA 1MGTA 3E97A 4Q4ZF 3BP8A 4WK8F 3N97A 3F8MA 3JTGA 5ILVA 2XKPA 2JTVA 1LVAA 3QAHA 1RNLA 3QOPA 2LDUA 1R36A 5D6EA 1YO5C 2K86A 3B73A 4EGYA 4ZZLA 1B59A 5J6XA 1JE8A 4ENKA 1K78B 3GFMA 2D45A 3M8FA 3L7WA 1F4KA 4EVIA 2NRAC 1U78A 1GXQA 1FC3A 1O3RA 3KFWX 2LNBA 3IKVA 4JBAA 3JSOA 1MDMA 5J8FA 1F1ZA 5LEKA 3RYRA 5AONA 3V7SA 2JT1A 3P7NA 1YTYA 2KJBA 3K69A 2F5FA 2H6BA 2M45A 4KN4X 2P5LC 2RDPA 3KP2A 5A2QK 2AS5F 5ED4A 3O2PE 2GA1A 2M8EA 5CVIA 2DBBA 3AAFA 4L9TA 1JHHA 4CYDA 4RAZA 2L02A 4CICA 4LGWA 5HS7A 2ESNA 2MLGA 5DCFA 2VBYA 2CSOA 2DFIA 2XRNA 1FX7A 2XVCA 4LK1F 2QQ9A 2FE3A 1QO0D 2UXNA 3GVAA 1FLIA 4HBLA 2O61A 4IRHA 5ICFA 1G3SA 1SMTA 3ZMUA 4I7HA 3F8CA 1YLFA 3L09A 3BWGA 1FSEA 1G6NA 1KQ0A 2WWYA 2STTA 2VOOA 5DUKA 4P55A 1OYWA 2XV4S 4HYEA 5ERIA 4P5OA 4LB6B 4BYYA 4HW0A 2Z9OA 2V6CA 3WTVC 1ON2A 1O3QA 1JGSA 2EA2A 4MTDA 3O6BB 5A2QZ 2IP2A 3QP6A 5L3DA 3CJNA 4HA8A 4HQEA 2YSRA 3ERED 5L3FA 4L9NA 3WTZA 1BN5A 2PEXA 1W5TA 3GFLA 1BC7C 2LF7A 1X3UA 4RGRA 3H3ZA 3QRFF 1YYVA 1HW1A 2DLLA 4UV9A 4EJUA 3F22A 2OQRA 3T0YA 1C0WA 3C3WA 3HSRA 5F1RA 1Z1DA 5DUIA 1K7AA 3JAMZ 2MC3A 1HW2A 2PBIA 1QZZA 1HXDA 2EWNA 4M6YA 4GCVA 1YS7A 3EUHA 3HTUA 5TRDA 2IA2A 3QPTA 1XDSA 3NEUA 1HBXG 3BJAA 1Z05A 3SXYA 5D5XB 3V7RA 4HZFA 1F9NA 4LK0F 1OKRA 2Z5UA 3KCCA 3L2CA 3WG9A 3SFZA 1FT9A 1R1UA 1QQIA 3IWFA 5HDNA 1SMYF 3IKTA 4EM0B 3IWZA 2DI3A 1W7PB 3ZMVA 3TO9A 3GF2A 2XAJA 4Y15A 2Q0OA 2EFNA 4BHBA 4L18B 2CO5A 3WTWC 2HFHA 4HX4A 2J5PA 3BPVA 5FFZA 4A0XA 3TO7A 4UVBA 3CUQA 4ZZDA 3ISPA 3M9AA 3BJOA 1YQAA 5H6QA 1IXRC 1ZN2A 3G3ZA 2VN2A 4RGXA 4GO1A 3RIRA 5BMZA 4R1HA 2YPRA 2GXGA 1ZRCA 3WGHA 1G3WA 4WXCA 1ULYA 2EA4A 4N9IA 4D0PA 4U0YA 1SD6A 2ZFWA 4ZYEA 4S04A 5E1XA 1F5TA 3JW4A 3HUGA 4YFKF 4XSZF 2TDXA 1BIAA 2ZCWA 1RUOA 5BOXA 2Q2EA 3RI4A 2DK8A 2LSOA 3BROA 3ZMDA 5L3EA 3HRSA 3I59B 2M5WA 3CUOA 4A12A 2NNNA 1SD5A 2ETHA 3KLNA 3I54A 1KGSA 3GWZA 1DUXC 2HS5A 1TLHB 2ADUA 2MH2A 1U5TC 1W7PD 3DKWA 2HYGD 2A61A 1XGSA 4RB2C 4YFXF 1RUNA 2G7HA 1S3JA 2FMYA 2ZMEB 2MLKA 5DCMB 4CGZA 1XCVA 4F7ZA 4B09A 1ODDA 3F72A 3WTSC 3K0LA 1LQ1A 3LQRA 1A04A 2XUBA 2HKOA 3SHFA 3HSEA 1ZLJA 3HOSA 4WXDA 3HIFA 3HHHA 3FMQA 2P7CB 5H6RA 2FOKA 1FOKA 2OQGA 4M9ZA 3FXQA 4BNCA 4Q48A 3IHUA 4N0BA 1U6GA 1J75A 1CF7A 4UHTA 4OIQF 1B6AA 3LA7A 3S2WA 5DD8A 4L0ZB 5LGNA 3BJ6A 3KEQA 1GXPA 5ICGA 4RB1A 1JXSA 2DQLA 3FHZA 2YX7A 1REPC 3PQKA 2R7FA 1ZH5A 2F5EA 5E18F 4IRGA 1KQ9A 4HX7A 1T39A 2ZBKA 5KVRA 4ZYGA 1S8NA 2CQKA 1I5ZA 4KA4A 5LHGA 4G7ZF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RNJ A;  3GO5 A;  1E2X A;  2KIU A;  4ENJ A;  2K4B A;  5D5V B;  1U5T B;  5D4R A;  3IC7 A;  4HV6 A;  3E6D A;  1EH6 A;  2QQB A;  1KYW A;  2KKO A;  1IZ1 A;  4M9X A;  1MD0 A;  1SFX A;  2EFO A;  2XGX A;  1TNT A;  5CVU A;  1O57 A;  4Y13 A;  1LJ9 A;  2HTS A;  1S7A A;  2JPB A;  2JSC A;  3WTX C;  3WE2 A;  3KP4 A;  3KEO A;  5LGU A;  2E1C A;  2IA1 A;  4OMZ A;  3TO6 A;  3FXR A;  1XGM A;  5J8C A;  1B4A A;  3CDH A;  4G9Y A;  4WCG A;  3CLO A;  3U2R A;  1UHM A;  3RDI A;  2X4H A;  4A6D A;  4LLG F;  2HYF A;  4M73 A;  5L3C A;  4LD5 A;  1YS6 A;  2H09 A;  1O3S A;  4KUM A;  5HVQ C;  1IN4 A;  3F8F A;  2HKX A;  1CGP A;  3DEU A;  3O3K A;  1IN6 A;  3GZ5 A;  4HOB A;  1R5H A;  1FYM A;  1IN7 A;  2QQA A;  2VE8 A;  4KDP A;  4FX4 A;  3K1N A;  3RKX A;  2IVM A;  2K27 A;  2HOE A;  3COA C;  3P9K A;  4KMU X;  1ZLK A;  2CW0 F;  1DPU A;  1B9N A;  2HTJ A;  2FEZ A;  3GX4 X;  2W85 A;  1SD4 A;  4ASN A;  1IN8 A;  3WOD F;  3KET A;  2R7D A;  2Z3Y A;  3H92 A;  1V3F A;  4KNY A;  4XLP F;  2HDC A;  4EM1 A;  4RAY A;  3C18 A;  3BOQ A;  2OU2 A;  4GGG A;  2M30 A;  1BI2 A;  3I59 A;  5DD4 A;  5LBQ A;  1S29 A;  1P6R A;  2L4M A;  4KIC A;  5DCM A;  2E1N A;  2QBY B;  1R1V A;  3KZY A;  3QU6 A;  1YG2 A;  3K9T A;  3KP6 A;  4RB0 A;  3ELK A;  3I53 A;  4U0V A;  2BV6 A;  2QVO A;  1J2X A;  2V9V A;  4YFN F;  5ICC A;  3FXU A;  3U9G A;  3E3V A;  3HTS B;  4NHJ A;  3BPX A;  4WXH A;  2YX4 A;  4UVC A;  4HLX A;  1XDU A;  3V4G A;  1B1B A;  1U3E M;  5IT9 K;  1IRF A;  1VTN C;  5BPI A;  1GVJ A;  5DDG A;  1U8R A;  2FF4 A;  1FP2 A;  5LGT A;  4L5J A;  4I01 A;  2P7V B;  5LEJ A;  5FD5 A;  5AIQ A;  3K1P A;  1O7L A;  5FO5 A;  2LF8 A;  4A6E A;  4G7H F;  1HKT A;  1KU7 A;  3R61 A;  2G9W A;  4P96 A;  3FMR A;  4OIN F;  3CO6 C;  2PI0 A;  2W57 A;  4M9S A;  5FLX Z;  1IAW A;  4LLL A;  3VOE A;  3ZPL A;  5D8K B;  3L9F A;  1J59 A;  5HOO A;  2QBY A;  4O6J A;  1CF7 B;  2P6S A;  4HX8 A;  3TDU C;  5HDK A;  1Z7U A;  4UNO A;  3J80 Z;  5FGM A;  4QWQ A;  1XSV A;  4MHG A;  2XRO A;  5AIP A;  4L9J A;  1T98 A;  3IRR A;  4XLN F;  1YIO A;  3GLX A;  3JSP A;  1HW5 A;  4P9F A;  3MZY A;  1K78 A;  3GXO A;  2EFW A;  2QM3 A;  4KIF A;  1FPQ A;  2FNA A;  1YW9 A;  1MKM A;  4GYI A;  1XSD A;  2O6G E;  2GXB A;  5CVV A;  2ESH A;  4HDU A;  2IW5 A;  1DP7 P;  3TDZ C;  1LDK B;  2VOP A;  1TBX A;  4KFC A;  2DPU A;  5TJJ A;  4LB5 A;  1GHC A;  1EV7 A;  1PP7 U;  2XAF A;  2UXX A;  2RQP A;  3K2Z A;  2QLZ A;  3GEZ A;  2VT3 A;  5KK1 A;  2K4J A;  2W84 A;  1ZG5 A;  1TQI A;  1TTY A;  2OBP A;  3I0T A;  3J7A O;  5HLG A;  4IHT A;  4G7O F;  2QUF A;  4DQ2 A;  5L3G A;  1PP8 F;  3DPT A;  5K5R A;  4MNU A;  4CO8 A;  2UWM A;  6PAX A;  3IRQ A;  1H9G A;  2MBF A;  2PLY A;  2GIV A;  3FMS A;  1UB9 A;  4A5M A;  4PGG A;  1P4A A;  4IHS A;  2OZU A;  4A0Y A;  5CYV A;  1UFM A;  2JPC A;  2DPD A;  4FT8 A;  2ISZ A;  3F6V A;  2P6T A;  4KN7 X;  1P92 A;  2EV5 A;  5CVR A;  3T5X A;  2ACJ A;  5DEQ A;  3EDP A;  4GXO A;  3WTY C;  3I4P A;  4AWX B;  5JVT A;  1ZRE A;  3J81 K;  2W24 A;  5BPD A;  2D2W A;  5D5U B;  3DPL C;  2GWR A;  2CGP A;  3Q9S A;  4HDV A;  4KMF A;  4MEY F;  2ZXJ A;  1Y0U A;  2ZO4 A;  1USS A;  3C1D A;  2NYX A;  3KE2 A;  5F6F A;  5ILS A;  4M6X A;  4AD9 A;  1T2K A;  3M8E A;  2VBW A;  4OIO F;  2KJC A;  3GZ6 A;  4LMY A;  3R60 A;  1QBJ A;  1LEB A;  1QZY A;  2QYO A;  1R1T A;  3ULQ B;  1KU9 A;  1I1S A;  2DU9 A;  1Z6R A;  1TQM A;  4U88 A;  1STZ A;  3CUQ B;  4ESF A;  3MQ0 A;  1MZB A;  4RS8 A;  3OV8 A;  4HAM A;  2FSW A;  2XAH A;  2WTE A;  2FA5 A;  4OU0 A;  1O7F A;  5JHU A;  2DW4 A;  5D8L B;  3RPU A;  4AIJ A;  4CHU A;  3Q9V A;  2P5K A;  4WF2 A;  4M74 A;  4I0A A;  1DPR A;  2NNY A;  1AOY A;  3ECH A;  1WI9 A;  3BZ6 A;  1I1G A;  1L0O C;  2IJL A;  2EK5 A;  2OZ6 A;  1JHF A;  4R79 A;  1OR7 A;  2EFP A;  4RGU A;  2O0Y A;  2JZY A;  3RPQ A;  2KIM A;  3TOB A;  2AXL A;  3VEP A;  1MJ9 A;  1Z6T A;  4JQF A;  1EH8 A;  3J80 K;  2BGC A;  3V7C A;  3T8T A;  2L3D A;  4N9H A;  1MDM B;  2RKH A;  2VXZ A;  4LFU A;  4YII A;  3F3X A;  4P9U A;  3B02 A;  4Q5S F;  2B0L A;  2A07 F;  3V8L A;  2FRH A;  1UCR A;  2ISY A;  2VC1 A;  4E70 A;  1V4R A;  5BQT A;  4ENM A;  2QWW A;  4ESJ A;  3BY6 A;  1KU3 A;  5JFR A;  3R6S A;  2PQ8 A;  5LRS A;  5D6F A;  1NHA A;  4MQV A;  2EV6 A;  2R3S A;  3QP5 A;  3WU0 A;  1R23 A;  3R0J A;  2PJP A;  3HRU A;  2O3F A;  2NAZ A;  4MEX F;  1Z91 A;  3FM5 A;  4R8H A;  5HLH A;  4O5V A;  3ABU A;  2LKP A;  3FZV A;  1YW8 A;  3F23 A;  5CJ9 A;  5CVJ A;  4IXA A;  3I5U A;  2COM A;  2FML A;  1B9M A;  5FB2 A;  4AIH A;  4DNC A;  3DP7 A;  1BI0 A;  1HKQ A;  4M72 A;  3HOT A;  3WTT C;  5HDG A;  2V1D A;  3ZN0 A;  3T1B A;  1E17 A;  1FY7 A;  2A6E F;  2FBH A;  2WV0 A;  5HS9 A;  1J7K A;  2EV0 A;  4K2E A;  4YG2 F;  2JRT A;  3ZMS A;  3HRT A;  5K1Y A;  1XMK A;  3F6O A;  2RV8 A;  3W6K B;  2VOD A;  5FLX K;  1S7O A;  3J81 Z;  3ABT A;  2QZ8 A;  3V8K A;  4ZYH A;  2X0L A;  1UST A;  2F5D A;  3DF8 A;  3KZZ A;  3SZT A;  4WX9 A;  2A68 F;  5IT9 Z;  1LB2 A;  3JAM K;  1IXS B;  2RVC A;  3NQO A;  1OMI A;  3G73 A;  2VBX A;  3VFZ A;  5LHH A;  3MEX A;  3SQN A;  3ZQ7 A;  4CZZ A;  5E17 F;  2BYV E;  1HST A;  2VC0 A;  1BI3 A;  3I71 A;  1R58 A;  1FZP B;  4ENN A;  4G94 A;  5F64 A;  1EH7 A;  2K7L A;  4HF2 A;  3RYP A;  2W25 A;  2HEO A;  1BIB A;  1OPC A;  3EET A;  3LAJ A;  2Z33 A;  2EB7 A;  4OIR F;  4CDG A;  4G8X A;  1I27 A;  4ZYD A;  3RKY A;  3EQL F;  3M7G A;  1T6S A;  1WSU A;  4KT5 C;  5HS8 A;  3KP7 A;  4AVP A;  1TW2 A;  3MAJ A;  3HHG A;  3I64 A;  4LJZ F;  4LLN A;  3MZH A;  3WGI A;  4HV5 A;  5K5O A;  2P4W A;  4BQA A;  2KIF A;  3DXJ F;  3HSF A;  4S05 A;  3K1M A;  4Z2Y A;  1FYL A;  3BDD A;  3NRV A;  1D5V A;  3TQN A;  2RN7 A;  1FBU A;  2Q8K A;  3LA3 A;  4PGH A;  2PFB A;  2PG4 A;  1MJA A;  3ECO A;  2YU3 A;  2O8X A;  1Z9C A;  2ZJ2 A;  2PMH A;  5ICE A;  1R7J A;  1FP1 D;  3LFK A;  2E7X A;  4QLC U;  4NB5 A;  5JI6 A;  2V79 A;  2MH9 A;  4U7D A;  3E6M A;  2WC2 A;  5E20 A;  2H94 A;  2OD5 A;  2P8T A;  4Q47 A;  2P5V A;  4KIG A;  1IW7 F;  2RGV A;  1WRJ A;  1U2W A;  1G3T A;  2M87 A;  1AWC A;  4OOI A;  4I0B A;  1O3T A;  4H0E A;  2M1B A;  1XMA A;  2A69 F;  4I98 B;  2L4A A;  3RJP A;  2G7U A;  4HQM A;  2GQQ A;  2HR3 A;  4ESB A;  3C7J A;  1HQC A;  4ON0 A;  1K79 A;  1IRG A;  2K02 A;  1OYY A;  2XAQ A;  1FNN A;  1SAX A;  2EFQ A;  4LG0 B;  2MD5 A;  4A0Z A;  4NQW A;  1ONV A;  1LNW A;  4HF1 A;  2DAO A;  1ZAO A;  1HSJ A;  3ZMT A;  4RB3 C;  3MCZ A;  1UHW A;  3QU3 A;  1ZRD A;  2ZNY A;  4BH9 A;  2EJR A;  2E7W A;  2IPQ X;  3ML6 A;  1ZGJ A;  1D3Y A;  1H9T A;  1S6L A;  3D5L A;  3ROU A;  1G3Y A;  1KA8 A;  3LWF A;  2KRF A;  4I09 A;  3E6C C;  5FD6 A;  4IPA A;  4KIB A;  2FBK A;  5DYM A;  2CYY A;  1ZGA A;  2HGC A;  2XAG A;  3I58 A;  4HF0 A;  4U0W A;  4G6D A;  1QGP A;  3V8J A;  5K5Q A;  3GUD A;  2IT0 A;  1G4D A;  1TQP A;  4UUV A;  4PZJ A;  1FBS A;  1SD7 A;  2A3S A;  3P9C A;  2VE9 A;  1FYK A;  1XCB A;  4EQQ A;  1BOA A;  2Z99 A;  5EEH A;  1R22 A;  3ZN1 A;  2GZW A;  2A6H F;  5IT3 A;  3HYI A;  2VT2 A;  2A5Y B;  2BEO A;  4BXU A;  3GW2 A;  1BM9 A;  1Q1H A;  2H6C A;  2L54 A;  2L01 A;  5EEG A;  3R0A A;  4A2U A;  2HQN A;  1T38 A;  2XHK A;  1ON1 A;  3L00 A;  3ZMZ A;  4PCQ A;  4GYG A;  1J0R A;  3LAP A;  2YR2 A;  3KP3 A;  4M71 A;  2NS0 A;  4TV7 A;  5BS6 A;  1HKS A;  1W4M A;  2IA0 A;  4A5N A;  4O3M A;  3E5U A;  1J5Y A;  3LA2 A;  4EJW A;  2D1V A;  3FWE A;  3EYY A;  2Y48 A;  1KU2 A;  3N4M A;  4I02 A;  2VON A;  2F2E A;  2BE5 F;  1TW3 A;  2Y75 A;  1FBQ A;  1BJA A;  2Y0M A;  2ZKZ A;  3WTU C;  5L3B A;  3KLO A;  3REO A;  4HLY A;  3E6B A;  4JK1 X;  2CG4 A;  5FFX A;  2FU4 A;  3FF5 A;  1RI7 A;  2O03 A;  4EJV A;  2CFX A;  4OMY A;  3WE3 A;  1OYI A;  3CUQ C;  4XBF A;  3IL2 A;  2HQR A;  4I2O A;  3E5X A;  3SZP A;  2OAZ A;  3TOA A;  4EJO A;  4L9V A;  4OIP F;  3PFI A;  4XSX F;  3EYI A;  2IRF G;  4ZH4 F;  5LHI A;  2DO7 A;  1T0F A;  4BHP A;  3D0S A;  1MJB A;  2HWV A;  5JR3 A;  4AIK A;  4EM2 A;  1WQ2 A;  4IF4 A;  2XIG A;  4B8X A;  2H27 A;  3H3U A;  1BC8 C;  2V1U A;  4U7B A;  1R00 A;  4WWC A;  4PDK A;  1P4X A;  2QEN A;  5E1Z B;  4KYW A;  1I6X A;  2BBY A;  1XSX A;  1WWX A;  2FNP A;  4EJT A;  2D1H A;  3WGG A;  1RIO H;  1R5G A;  3F8B A;  5H20 A;  2J5O A;  4MQ9 F;  2DK5 A;  2V1X A;  5E8I A;  3ZP5 A;  4CXF A;  3QPH A;  3LQQ A;  1XN7 A;  4LG0 A;  5ILU A;  1LDJ A;  1XGO A;  2RC4 A;  3W6J B;  1ZAR A;  3F21 A;  1FWZ A;  2C6Y A;  4L0Y B;  1ZYR F;  4XRF A;  3FM3 A;  1P4W A;  2DTR A;  3LST A;  2DT5 A;  1FSH A;  2F5C A;  5LLQ A;  3DV8 A;  2FXA A;  4IRI A;  1BBY A;  1U5T A;  2DQR A;  1WKM A;  3R4K A;  4G6Q A;  3GFJ A;  3VOD A;  4YIF A;  5D4S A;  1TNS A;  3CO7 C;  4MTE A;  4IJA A;  5DV5 A;  4FHT A;  1RZ4 A;  1SFU A;  2OA4 A;  3Q5F A;  1SFE A;  1ZG1 A;  2FQ3 A;  2PN6 A;  1ZG3 A;  2MA3 A;  4BAY A;  1D8J A;  3GFI A;  3WU1 B;  1XB4 A;  3T8R A;  5D5W B;  1KQ8 A;  3TKY A;  1H0M A;  2PMU A;  3RTR A;  2ELH A;  2VBZ A;  3JTH A;  1IN5 A;  5LRR A;  2STW A;  3OOP A;  3KP5 A;  1LEA A;  2ZNZ A;  3HRM A;  1PDN C;  2GA2 A;  3VB2 A;  4IVN A;  1L3L A;  1IXC A;  3F8N A;  1XGN A;  4EMS A;  1W5S A;  4EGZ A;  1DDN A;  4RGS A;  5HLI A;  3CTA A;  1BI1 A;  4Y17 A;  3DQV C;  3RKW A;  1QPM A;  4FX0 A;  4UV8 A;  3FX3 A;  2ZME A;  3GYH X;  5E1W A;  4UVA A;  3P9I A;  2CWE A;  4MGR A;  5CLS A;  1ZHF A;  1YW7 A;  3E5Q A;  5E8G A;  1KYZ A;  1W7P A;  1D8K A;  1K6O A;  4BHC A;  3M1E A;  1IF1 A;  1QNT A;  2HZT A;  1XD7 A;  1ZRF A;  4ETS A;  4EV0 A;  1P2F A;  1PUE E;  3MFK A;  2XAS A;  1YFH A;  3DFG A;  3PQJ A;  4UXN A;  1IUY A;  4L5I A;  3MWM A;  2FBI A;  3U1D A;  3TGN A;  1LDD A;  2UZK A;  1J9I A;  2XKO A;  2GAU A;  1MGT A;  3E97 A;  4Q4Z F;  3BP8 A;  4WK8 F;  3N97 A;  3F8M A;  3JTG A;  5ILV A;  2XKP A;  2JTV A;  1LVA A;  3QAH A;  1RNL A;  3QOP A;  2LDU A;  1R36 A;  5D6E A;  1YO5 C;  2K86 A;  3B73 A;  4EGY A;  4ZZL A;  1B59 A;  5J6X A;  1JE8 A;  4ENK A;  1K78 B;  3GFM A;  2D45 A;  3M8F A;  3L7W A;  1F4K A;  4EVI A;  2NRA C;  1U78 A;  1GXQ A;  1FC3 A;  1O3R A;  3KFW X;  2LNB A;  3IKV A;  4JBA A;  3JSO A;  1MDM A;  5J8F A;  1F1Z A;  5LEK A;  3RYR A;  5AON A;  3V7S A;  2JT1 A;  3P7N A;  1YTY A;  2KJB A;  3K69 A;  2F5F A;  2H6B A;  2M45 A;  4KN4 X;  2P5L C;  2RDP A;  3KP2 A;  5A2Q K;  2AS5 F;  5ED4 A;  3O2P E;  2GA1 A;  2M8E A;  5CVI A;  2DBB A;  3AAF A;  4L9T A;  1JHH A;  4CYD A;  4RAZ A;  2L02 A;  4CIC A;  4LGW A;  5HS7 A;  2ESN A;  2MLG A;  5DCF A;  2VBY A;  2CSO A;  2DFI A;  2XRN A;  1FX7 A;  2XVC A;  4LK1 F;  2QQ9 A;  2FE3 A;  1QO0 D;  2UXN A;  3GVA A;  1FLI A;  4HBL A;  2O61 A;  4IRH A;  5ICF A;  1G3S A;  1SMT A;  3ZMU A;  4I7H A;  3F8C A;  1YLF A;  3L09 A;  3BWG A;  1FSE A;  1G6N A;  1KQ0 A;  2WWY A;  2STT A;  2VOO A;  5DUK A;  4P55 A;  1OYW A;  2XV4 S;  4HYE A;  5ERI A;  4P5O A;  4LB6 B;  4BYY A;  4HW0 A;  2Z9O A;  2V6C A;  3WTV C;  1ON2 A;  1O3Q A;  1JGS A;  2EA2 A;  4MTD A;  3O6B B;  5A2Q Z;  2IP2 A;  3QP6 A;  5L3D A;  3CJN A;  4HA8 A;  4HQE A;  2YSR A;  3ERE D;  5L3F A;  4L9N A;  3WTZ A;  1BN5 A;  2PEX A;  1W5T A;  3GFL A;  1BC7 C;  2LF7 A;  1X3U A;  4RGR A;  3H3Z A;  3QRF F;  1YYV A;  1HW1 A;  2DLL A;  4UV9 A;  4EJU A;  3F22 A;  2OQR A;  3T0Y A;  1C0W A;  3C3W A;  3HSR A;  5F1R A;  1Z1D A;  5DUI A;  1K7A A;  3JAM Z;  2MC3 A;  1HW2 A;  2PBI A;  1QZZ A;  1HXD A;  2EWN A;  4M6Y A;  4GCV A;  1YS7 A;  3EUH A;  3HTU A;  5TRD A;  2IA2 A;  3QPT A;  1XDS A;  3NEU A;  1HBX G;  3BJA A;  1Z05 A;  3SXY A;  5D5X B;  3V7R A;  4HZF A;  1F9N A;  4LK0 F;  1OKR A;  2Z5U A;  3KCC A;  3L2C A;  3WG9 A;  3SFZ A;  1FT9 A;  1R1U A;  1QQI A;  3IWF A;  5HDN A;  1SMY F;  3IKT A;  4EM0 B;  3IWZ A;  2DI3 A;  1W7P B;  3ZMV A;  3TO9 A;  3GF2 A;  2XAJ A;  4Y15 A;  2Q0O A;  2EFN A;  4BHB A;  4L18 B;  2CO5 A;  3WTW C;  2HFH A;  4HX4 A;  2J5P A;  3BPV A;  5FFZ A;  4A0X A;  3TO7 A;  4UVB A;  3CUQ A;  4ZZD A;  3ISP A;  3M9A A;  3BJO A;  1YQA A;  5H6Q A;  1IXR C;  1ZN2 A;  3G3Z A;  2VN2 A;  4RGX A;  4GO1 A;  3RIR A;  5BMZ A;  4R1H A;  2YPR A;  2GXG A;  1ZRC A;  3WGH A;  1G3W A;  4WXC A;  1ULY A;  2EA4 A;  4N9I A;  4D0P A;  4U0Y A;  1SD6 A;  2ZFW A;  4ZYE A;  4S04 A;  5E1X A;  1F5T A;  3JW4 A;  3HUG A;  4YFK F;  4XSZ F;  2TDX A;  1BIA A;  2ZCW A;  1RUO A;  5BOX A;  2Q2E A;  3RI4 A;  2DK8 A;  2LSO A;  3BRO A;  3ZMD A;  5L3E A;  3HRS A;  3I59 B;  2M5W A;  3CUO A;  4A12 A;  2NNN A;  1SD5 A;  2ETH A;  3KLN A;  3I54 A;  1KGS A;  3GWZ A;  1DUX C;  2HS5 A;  1TLH B;  2ADU A;  2MH2 A;  1U5T C;  1W7P D;  3DKW A;  2HYG D;  2A61 A;  1XGS A;  4RB2 C;  4YFX F;  1RUN A;  2G7H A;  1S3J A;  2FMY A;  2ZME B;  2MLK A;  5DCM B;  4CGZ A;  1XCV A;  4F7Z A;  4B09 A;  1ODD A;  3F72 A;  3WTS C;  3K0L A;  1LQ1 A;  3LQR A;  1A04 A;  2XUB A;  2HKO A;  3SHF A;  3HSE A;  1ZLJ A;  3HOS A;  4WXD A;  3HIF A;  3HHH A;  3FMQ A;  2P7C B;  5H6R A;  2FOK A;  1FOK A;  2OQG A;  4M9Z A;  3FXQ A;  4BNC A;  4Q48 A;  3IHU A;  4N0B A;  1U6G A;  1J75 A;  1CF7 A;  4UHT A;  4OIQ F;  1B6A A;  3LA7 A;  3S2W A;  5DD8 A;  4L0Z B;  5LGN A;  3BJ6 A;  3KEQ A;  1GXP A;  5ICG A;  4RB1 A;  1JXS A;  2DQL A;  3FHZ A;  2YX7 A;  1REP C;  3PQK A;  2R7F A;  1ZH5 A;  2F5E A;  5E18 F;  4IRG A;  1KQ9 A;  4HX7 A;  1T39 A;  2ZBK A;  5KVR A;  4ZYG A;  1S8N A;  2CQK A;  1I5Z A;  4KA4 A;  5LHG A;  4G7Z F; 
#chains in the Genus database with same CATH topology
 2X85 A;  2RNJ A;  3GO5 A;  1E2X A;  2KIU A;  4ENJ A;  2K4B A;  5D5V B;  1U5T B;  2V1N A;  5LFA A;  3HUG B;  5D4R A;  1FEX A;  3IC7 A;  2LK2 A;  1VI0 A;  1PJR A;  1WJE A;  4HV6 A;  3BG5 A;  3E6D A;  4BJ5 C;  4OAY A;  3S14 J;  1EH6 A;  2QQB A;  1KYW A;  3OYD A;  2AO9 A;  2KKO A;  1IZ1 A;  4M9X A;  4FCY A;  1IV8 A;  1MD0 A;  3LSK A;  1SFX A;  2EFO A;  4I76 A;  2XGX A;  1TNT A;  5CVU A;  2PX9 A;  1O57 A;  4Y13 A;  3HOX J;  1LJ9 A;  2HTS A;  4YIR X;  1S7A A;  2W1O A;  2NVY J;  2JPB A;  2JSC A;  1WVR A;  2X51 A;  3WTX C;  4C2T A;  1EKE A;  2KZG A;  3WE2 A;  2E35 A;  3KP4 A;  3KEO A;  5LGU A;  2E1C A;  2IA1 A;  4OMZ A;  2I5U A;  4NC8 A;  3TO6 A;  3FXR A;  1OCT C;  1XGM A;  4ZJZ A;  5J8C A;  1B4A A;  3K10 A;  3CDH A;  4G9Y A;  4WCG A;  3CLO A;  3U2R A;  1UHM A;  3RDI A;  2X4H A;  3CCV I;  2R7V A;  2L7M P;  4A6D A;  2HDW A;  4LLG F;  2HYF A;  4M73 A;  5L3C A;  2R4G A;  2KQR A;  2X6O A;  4LD5 A;  1YS6 A;  2H09 A;  2IBD A;  1O3S A;  3CME I;  4KUM A;  5HVQ C;  2H1L A;  3A02 A;  1IN4 A;  3F8F A;  2HKX A;  1B8I A;  3IAS 2;  1CGP A;  3DEU A;  4AM3 A;  3O3K A;  2VKD A;  1IN6 A;  3GZ5 A;  4HOB A;  1R5H A;  1FYM A;  1ETQ A;  1IN7 A;  2QQA A;  2VE8 A;  4KDP A;  1ZKG A;  2MFZ A;  4FX4 A;  3K1N A;  3RKX A;  2IVM A;  2K27 A;  2XF7 A;  2HOE A;  3COA C;  5C4J J;  3P9K A;  1HA8 A;  3LSI A;  4KMU X;  1ZLK A;  1S5L C;  2CW0 F;  2X1D A;  1DPU A;  1B9N A;  1D0Z A;  2HTJ A;  2WV1 A;  2FEZ A;  2K3F A;  3GX4 X;  2W85 A;  1B72 B;  1JKQ C;  3JRH A;  1SD4 A;  1VQN I;  4ASN A;  4IZZ A;  1MH3 A;  2DMT A;  1IN8 A;  3WOD F;  2CUJ A;  3KET A;  2M4G A;  2KLO A;  2R7D A;  2ZJR F;  2Z3Y A;  1Y6I A;  2JJ7 A;  3H92 A;  1MBG A;  1V3F A;  2OTL I;  4KNY A;  4XLP F;  2HDC A;  1RET A;  4EM1 A;  4RAY A;  2E71 A;  5IY5 H;  2FUG 2;  3C18 A;  3BOQ A;  2OU2 A;  1HCR A;  4GGG A;  2VKV A;  2M30 A;  3I3L A;  4NDL A;  3OYN A;  1BI2 A;  2KZV A;  1D0X A;  2JUG A;  3I59 A;  4CCM A;  1QRY A;  1VFC A;  5DD4 A;  4E6K G;  5FRM A;  5LBQ A;  4DZJ A;  1S29 A;  1P6R A;  5CKT A;  4RLQ A;  2L4M A;  4KIC A;  5DCM A;  1JUS A;  2HPI A;  1UMQ A;  2E2J J;  2E1N A;  2QBY B;  3MN2 A;  1R1V A;  3BTJ A;  3KZY A;  3QU6 A;  3DTE A;  1YG2 A;  1XS9 A;  3K9T A;  2JA5 J;  4AUX A;  3KP6 A;  4RB0 A;  3ELK A;  3I53 A;  2IAI A;  4U0V A;  2BV6 A;  2XDV A;  2ZSI B;  1OFC X;  2QVO A;  1J2X A;  2V9V A;  3LSG A;  4YFN F;  4BDZ A;  2ME6 A;  3K4L A;  3FXU A;  5ICC A;  3CDL A;  2DXI A;  1JT6 A;  4BKX A;  1D0Y A;  3U9G A;  3E3V A;  3OYA A;  3HTS B;  3RQ4 A;  3H0D A;  4DJA A;  2EZH A;  3CCJ I;  4NHJ A;  2V9P A;  1EF4 A;  5KAF C;  1YX3 A;  3BPX A;  4IOA F;  4WXH A;  4XOT A;  2YX4 A;  2HYJ A;  4UVC A;  5KNL A;  4HLX A;  1XDU A;  1TWF J;  3V4G A;  5DTD A;  2YU9 J;  3C2B A;  3P5J A;  1B1B A;  2B63 J;  1OLT A;  2I10 A;  1U3E M;  1TWH J;  1IRF A;  5IT9 K;  1VTN C;  5BPI A;  3BG7 A;  1GVJ A;  3M3Y J;  2EH3 A;  3BCA A;  4QTR A;  2HDD A;  4IHX A;  5DDG A;  1U8R A;  3KX2 A;  2FF4 A;  3QYF A;  2Y2Z A;  3MMY B;  2NVT J;  1FP2 A;  3CCY A;  1P7J A;  1X58 A;  5LGT A;  1MMD A;  1ZQ3 P;  4L5J A;  4I01 A;  3K70 C;  2P7V B;  5LEJ A;  5FD5 A;  5AIQ A;  3K1P A;  1O7L A;  5FO5 A;  2LF8 A;  4A6E A;  1JKP C;  4G7H F;  2E34 A;  3BTI A;  1HKT A;  1KU7 A;  3R61 A;  2G9W A;  2V9K A;  4P96 A;  2QSG X;  3FMR A;  4OIN F;  3CO6 C;  4B3X A;  2PI0 A;  2W57 A;  3ERM A;  4M9S A;  5FLX Z;  2JWT A;  3ZRG A;  1IAW A;  4LLL A;  3VOE A;  3ZPL A;  5D8K B;  1MMG A;  5FKL A;  3FK6 A;  1QPI A;  3L9F A;  1J59 A;  5HOO A;  4FAS D;  1LFB A;  4XLF A;  2EPF A;  2QBY A;  4O6J A;  1CF7 B;  2P6S A;  4HX8 A;  4M3B A;  3TDU C;  5HNH A;  2CQ7 A;  5HDK A;  4DYQ A;  2HZD A;  1Z7U A;  4NC6 A;  1X3Z B;  4UNO A;  2K9L A;  2L0K A;  1VQK I;  1SEU A;  3J80 Z;  2F4I A;  2Y0S A;  5FGM A;  1I39 A;  3NWT A;  2D5V A;  4QWQ A;  1XSV A;  4MHG A;  2XRO A;  2JQ7 A;  2FJ1 A;  5AIP A;  4L9J A;  1IDY A;  2DT7 B;  3CF2 A;  1T98 A;  3L2U A;  1MNM C;  4A3M J;  4J19 A;  3IRR A;  4XLN F;  1ZK8 A;  3HKZ A;  4JX5 A;  4E7S A;  4HRI A;  1VQM I;  1YIO A;  3GLX A;  2L9N A;  3JSP A;  5JLW A;  1HW5 A;  4P9F A;  3MZY A;  2KDZ A;  1K78 A;  2OF7 A;  4PFO A;  2HOA A;  4XRS G;  1A35 A;  4DW6 A;  3GXO A;  4S0H B;  2EFW A;  2QM3 A;  4KIF A;  1FPQ A;  2FNA A;  2E2I J;  5F08 A;  1YW9 A;  1MKM A;  4GYI A;  2K3P A;  1I50 J;  1XSD A;  2O6G E;  3S15 J;  2GXB A;  5CVV A;  3GTO J;  3DEE A;  2ESH A;  2E60 A;  3EUH C;  4HDU A;  3SEQ A;  2IW5 A;  3IH3 A;  1DP7 P;  1KZH A;  3TDZ C;  1LDK B;  2Y30 A;  3HZJ A;  2VOP A;  5J3L A;  1FOY A;  1TBX A;  2LY1 A;  4KFC A;  2BY2 A;  2DPU A;  2BXZ A;  2K9Q A;  5TJJ A;  4LB5 A;  1GHC A;  3HBL A;  2NS8 A;  1MMN A;  1EV7 A;  1PP7 U;  1X1B A;  4XON A;  1K6Y A;  3RSN A;  4A3I J;  2XAF A;  1SVL A;  2UXX A;  2RQP A;  4YRV A;  3W2W A;  2FQ4 A;  3K2Z A;  4BQQ A;  3JRB A;  2QLZ A;  2P0W A;  3GEZ A;  2VT3 A;  1A6Q A;  5KK1 A;  2K4J A;  1TT5 B;  3DBL B;  1ETY A;  4XRS A;  1IUF A;  2W84 A;  1ZG5 A;  3BC8 A;  1YJ9 I;  1TQI A;  4JYK A;  3DEW A;  2W48 A;  1TTY A;  2OBP A;  3I0T A;  2TRT A;  1T33 A;  5HLG A;  3J7A O;  4A3C J;  1R6R A;  4IHT A;  3RQI A;  1Y8Q B;  4G7O F;  2QUF A;  4DQ2 A;  4BJT A;  5L3G A;  1PP8 F;  3DPT A;  5K5R A;  4MNU A;  1ETV A;  4CO8 A;  2UWM A;  6PAX A;  2LBF B;  3CCE I;  4E7L A;  3IRQ A;  2R5Z A;  2LG4 A;  3DPU A;  3O8H A;  1H9G A;  4CH7 A;  3BG3 A;  2MBF A;  2PLY A;  1GV5 A;  3VSL A;  3L2R A;  3K4B A;  1WGX A;  2GIV A;  3FMS A;  3WHB A;  1UB9 A;  4A5M A;  4PGG A;  3QOE A;  2HU9 A;  2R7S A;  1P4A A;  3UNG C;  3F9K A;  1OIS A;  4IHS A;  2OZU A;  4MFD A;  4OAZ A;  4A0Y A;  2L7Z A;  2LKS A;  2K40 A;  1SAU A;  3DBH B;  2CQX A;  4V2F A;  5CYV A;  2BXY A;  1UFM A;  3DU5 A;  2JPC A;  4FT8 A;  2DPD A;  4IHV A;  1Z7L A;  2UUZ A;  3ZXS A;  3TL4 X;  5M5Y J;  2IS4 A;  1NG7 A;  3K4J A;  2ISZ A;  1HC8 A;  2DFF A;  3F6V A;  2P6T A;  4KN7 X;  1P92 A;  3GZN B;  2EV5 A;  3M1C A;  5GAH J;  1RR8 C;  5CVR A;  4ZC3 A;  3NAU A;  3T5X A;  1RES A;  1FMV A;  2ACJ A;  1ETX A;  5DEQ A;  2PJR A;  3BTL A;  3EDP A;  4GXO A;  3WTY C;  2ICW G;  3I4P A;  2HVS A;  4AWX B;  5JVT A;  1ZRE A;  3J81 K;  1AU7 A;  2W24 A;  3DTK A;  4M6V A;  5BPD A;  2BZT A;  2D2W A;  5D5U B;  3DPL C;  3EUK L;  2QKM B;  4XN3 A;  3GTJ J;  2GWR A;  3OYM A;  2CGP A;  3Q9S A;  4HDV A;  4KMF A;  4MEY F;  2MGQ A;  2ZXJ A;  1Y0U A;  2ZO4 A;  2EIM H;  3WHC A;  1USS A;  4XID A;  3C1D A;  2NYX A;  2ZXI A;  3KE2 A;  5F6F A;  5ILS A;  4M6X A;  4AD9 A;  3BZC A;  5GAE J;  3A01 A;  1HDD C;  1T2K A;  3M8E A;  2VBW A;  1ETK A;  4OIO F;  3GTQ J;  2KJC A;  3GZ6 A;  1BOB A;  3OR1 C;  3R60 A;  4LMY A;  2ZFU A;  1QBJ A;  1QZY A;  1LEB A;  2QYO A;  5F0C A;  1R1T A;  2JA2 A;  3ULQ B;  1KU9 A;  4KJZ A;  3K4C A;  1I1S A;  2BHZ A;  2DU9 A;  2M2E A;  1Z6R A;  1TQM A;  4U87 A;  3BT9 A;  1Q1V A;  4U88 A;  1STZ A;  2H1K A;  3CUQ B;  2HVQ A;  3HXL A;  2DYS H;  4ESF A;  2WBM A;  2CUE A;  4HNV A;  3MQ0 A;  1WJ5 A;  4J00 A;  1MZB A;  4RS8 A;  3OV8 A;  4HAM A;  1TWG J;  5C3E J;  4F91 B;  2FSW A;  2XAH A;  2DT6 A;  2WTE A;  2DOD A;  4CA0 A;  4ABZ A;  2FA5 A;  2R7U A;  4OU0 A;  3FKI J;  1O7F A;  2K9S A;  5JHU A;  2LMD A;  4FE4 A;  2BW3 B;  4RAF A;  4C2M J;  1XC5 A;  2BVL A;  2DW4 A;  1K4T A;  5GAD J;  5D8L B;  3CCM I;  3RPU A;  4B44 A;  4PJN A;  4AIJ A;  4CHU A;  3I56 I;  2CRG A;  3LOC A;  5B3S H;  3Q9V A;  2P5K A;  4B4C A;  2LYC A;  4WF2 A;  4M74 A;  1OQY A;  4AVZ A;  4BEH A;  4I0A A;  1DPR A;  2NNY A;  1WCM J;  1YRN B;  4XKC A;  4ITV A;  1AOY A;  4F92 B;  3HGY A;  3GTL J;  3ECH A;  1B72 A;  1S9H A;  1WI9 A;  3OYE A;  3BZ6 A;  3PIP F;  2Y9Z A;  1I1G A;  1N25 A;  3VSK A;  1L0O C;  1MBH A;  1ERD A;  3TW6 A;  2IJL A;  2EK5 A;  3BR6 A;  1CQT A;  2OZ6 A;  1JHF A;  5BNG A;  5EJC A;  4R79 A;  4A93 J;  1OR7 A;  2EFP A;  3FDY A;  4JOM A;  4RGU A;  2O0Y A;  3GCM A;  2JZY A;  3LSH A;  4Y3O A;  3RPQ A;  2KIM A;  3TOB A;  2AXL A;  3VEP A;  2WY8 Q;  3H35 A;  3TED A;  1MJ9 A;  3NWS A;  1Z6T A;  4JQF A;  1EH8 A;  3J80 K;  1RC9 A;  2X1C A;  2BGC A;  2B7E A;  4ZTJ A;  3V7C A;  5FKN A;  5GPC A;  1MSF C;  2XAU A;  3A0B C;  1S7E A;  3T8T A;  2L3D A;  4N9H A;  1MDM B;  3ASO H;  4B47 A;  2RKH A;  2VXZ A;  3L2Q A;  4LFU A;  5C44 J;  4YII A;  3F3X A;  4BQN A;  2ZXH A;  4P9U A;  3B02 A;  2HPM A;  2DOE A;  2K85 A;  4Q5S F;  2HNH A;  1BR2 A;  2B0L A;  2A07 F;  3V8L A;  2FRH A;  1UCR A;  3H5N A;  1VQ8 I;  1JGG A;  3S2H J;  2ISY A;  2VC1 A;  1TP4 A;  4E70 A;  1DQU A;  1Y0N A;  2FOW A;  5FKM A;  1V4R A;  5BQT A;  3OYC A;  4ENM A;  1T0F C;  2QWW A;  3OYL A;  1X2N A;  2M34 A;  4ESJ A;  1MMS A;  3BY6 A;  1KU3 A;  2ID6 A;  3AL0 B;  2K9M A;  2VJ5 A;  3Q0W A;  2NVX J;  5JFR A;  3R6S A;  2PQ8 A;  1NH3 A;  5LRS A;  1HF0 A;  5D6F A;  1UJ8 A;  4QPO A;  1NHA A;  4MQV A;  3I4M J;  3A1Y A;  2EV6 A;  2LKX A;  2N8G A;  2R3S A;  2GXA A;  3QP5 A;  2NXN B;  2KMU A;  3WU0 A;  1R23 A;  4BBR J;  3D5R C;  3R0J A;  2PJP A;  3HRU A;  2IGN A;  5F0H A;  2O3F A;  2NAZ A;  4MEX F;  3CP8 A;  4PUS A;  1E0E A;  1LKX A;  3BQZ A;  4AYB N;  1Z91 A;  2OTJ I;  3HL2 A;  1TL8 A;  2V26 A;  4BU2 A;  3BR0 A;  3FM5 A;  4R8H A;  1I6H J;  3S1M J;  5HLH A;  4O5V A;  3DLA A;  3ABU A;  2LKP A;  3PNV A;  4HG2 A;  4XLH A;  2DA7 A;  2NS7 A;  3FZV A;  1YW8 A;  3F23 A;  2O9L A;  2BW3 A;  5CJ9 A;  5CVJ A;  3I4N J;  4IXA A;  1D1C A;  4A3E J;  5H2F C;  4G6T B;  3I5U A;  2COM A;  2XRL A;  1GV2 A;  1D5Y A;  2FML A;  1B9M A;  4V2G A;  2M7A A;  5FB2 A;  4AIH A;  4DNC A;  2MSY A;  2XC7 A;  1QZE A;  3DP7 A;  1BI0 A;  1HKQ A;  4M72 A;  1U8B A;  4XIC A;  3HOT A;  2KPM A;  3WTT C;  5HDG A;  2V1D A;  3ZN0 A;  3T1B A;  2A5W A;  1YIJ I;  3W2V A;  1E17 A;  1FY7 A;  2A6E F;  2FBH A;  2WV0 A;  5HS9 A;  5IYB J;  1J7K A;  2ELJ A;  4UUS B;  1A36 A;  2EV0 A;  4K2E A;  4YG2 F;  2JRT A;  3ZMS A;  4II2 A;  1IO2 A;  3HRT A;  3F0C A;  2LFB A;  5K1Y A;  2KP6 A;  4CCK A;  3K7A J;  5GTI C;  3C2G A;  4M3F A;  4NNJ A;  2WB1 N;  1XMK A;  3F6O A;  3HGG A;  2RV8 A;  1P7I A;  2DA4 A;  3VYS B;  3W6K B;  3H0G J;  2VOD A;  2VAS A;  5FLX K;  5EG0 B;  1S7O A;  3J81 Z;  3ABT A;  1MSE C;  3ZQL A;  3PUB A;  5B1A H;  1OCR H;  4X6A J;  2QZ8 A;  4BY7 J;  3PIO F;  3E1S A;  4XK4 A;  2X6X A;  3V8K A;  4ZYH A;  2X0L A;  1IC8 A;  3CJR B;  1UST A;  2VJJ A;  2F5D A;  3CZ6 A;  3DF8 A;  3KZZ A;  1MW7 A;  4RAG A;  3SYT A;  3SZT A;  4WX9 A;  2A68 F;  2ZC2 A;  5IT9 Z;  3QPL A;  1LB2 A;  2H8W A;  4KT6 A;  3JAM K;  3M8J A;  1IXS B;  2RVC A;  5F27 A;  3NQO A;  2PMZ N;  1OMI A;  3G73 A;  2VBX A;  3VFZ A;  5LHH A;  3MEX A;  3SQN A;  5EZH A;  3ZQ7 A;  1JUM A;  4CZZ A;  5E17 F;  2DMN A;  2QCO A;  2BYV E;  1HST A;  4B48 A;  3LSP A;  1V54 H;  2VC0 A;  4HNT A;  1BI3 A;  3S1R J;  1WFX A;  4LIT A;  3I71 A;  1R58 A;  1FZP B;  4ENN A;  4G94 A;  5F64 A;  1W0U A;  1EH7 A;  2K7L A;  4HF2 A;  5IOY A;  2XF6 A;  3IH2 A;  3RYP A;  2W25 A;  2TCT A;  1WH7 A;  2HEO A;  3AG3 H;  1BIB A;  1OPC A;  3LSR A;  2BY3 A;  3EET A;  3I9V 2;  3LAJ A;  1V5F A;  2Z33 A;  1X1P A;  2COB A;  2EB7 A;  4OIR F;  2XPW A;  1F36 A;  4CDG A;  4HNU A;  5GAG J;  1WJA A;  3IAM 2;  4G8X A;  1I27 A;  5E3N A;  5E3O A;  2LOO A;  4M3E A;  4ZYD A;  3RKY A;  4UB8 C;  3EQL F;  1WPK A;  3M7G A;  4GFB A;  1T6S A;  1WSU A;  3X2Q H;  1XMX A;  3S2D J;  4KT5 C;  4X1E A;  5FKO A;  4CZC A;  2V6E A;  5JLX A;  2WY7 Q;  2DCE A;  5HS8 A;  3ABM H;  3KP7 A;  3OYI A;  4AVP A;  1TW2 A;  3MAJ A;  3PUF A;  3HHG A;  3I64 A;  4EAT A;  1N77 A;  4LJZ F;  1AHD P;  4LLN A;  3MZH A;  3WGI A;  3TP0 A;  3DKX A;  4XLE A;  1YE9 A;  2DYR H;  3H9Q A;  2F5V A;  4HV5 A;  1OJL A;  4YEJ A;  4DOZ A;  5K5O A;  2P4W A;  4BQA A;  1MBK A;  2KIF A;  3JR9 A;  3DXJ F;  2XPV A;  3HSF A;  4S05 A;  3K1M A;  4PK4 A;  2VQG A;  4Z2Y A;  1FYL A;  5DM6 F;  1A31 A;  5IP7 J;  3BDD A;  3NRV A;  4PSW A;  3MKZ A;  1D5V A;  4RBO A;  3TQN A;  1YRN A;  3JRD A;  2RN7 A;  1FBU A;  2Q8K A;  5J1R A;  3LA3 A;  4PGH A;  2NOG A;  3ZQC A;  4IL6 C;  1JKR C;  3G1L A;  2PFB A;  2PG4 A;  1MJA A;  5FKK A;  1H88 C;  3ECO A;  3PM1 A;  4DBR A;  2YU3 A;  2O8X A;  1Z9C A;  2ZJ2 A;  2PMH A;  3LFU A;  5ICE A;  4N4N B;  2KIQ A;  2DJN A;  1UEL B;  1R7J A;  1FP1 D;  3LFK A;  3PJR A;  2E7X A;  1YJN I;  4OWR B;  4QLC U;  4NB5 A;  5JI6 A;  2V79 A;  3KPH A;  2XB5 A;  3OIO A;  2MH9 A;  4U7D A;  3E6M A;  1TT0 A;  2KIS A;  2WC2 A;  5E20 A;  2H94 A;  2CJJ A;  2OD5 A;  5EG0 A;  2P8T A;  3HPH A;  4Q47 A;  3DU6 A;  2P5V A;  4GRI A;  2HXO A;  4KIG A;  5KCM A;  3SZG A;  3L2V A;  3QPS A;  5GP9 A;  1WH5 A;  4KIT B;  1IW7 F;  1UHS A;  1UZC A;  2RGV A;  4D5C A;  3LNQ A;  4LIV A;  1MBE A;  3K6G A;  1WRJ A;  1U2W A;  2VUM J;  1G3T A;  2ELK A;  2M87 A;  1AWC A;  4OOI A;  2R5Y B;  4I0B A;  1O3T A;  2VJ4 A;  4H0E A;  3M07 A;  5TGT A;  4A69 C;  2CS3 A;  3G1O A;  2M1B A;  1T95 A;  4KIS A;  2X6W A;  1XMA A;  3VWB A;  5IYC J;  1XG1 A;  2A69 F;  2JK3 A;  2JRM A;  2JA8 J;  3TMO A;  4I98 B;  3K2A A;  2L4A A;  3RJP A;  2G7U A;  1QU3 A;  2OCE A;  4HQM A;  3OYJ A;  1JI8 A;  2GQQ A;  2HR3 A;  4ESB A;  3C7J A;  1HQC A;  3ABK H;  4ON0 A;  1K79 A;  1IRG A;  4HST A;  2K02 A;  2ECC A;  3H9J A;  4FIS A;  4XR6 A;  1OYY A;  2XAQ A;  1FJL A;  1FNN A;  3CMY A;  1SAX A;  3HJE A;  4ZDL A;  1NK3 P;  2EFQ A;  2R92 J;  4LG0 B;  1JJ8 C;  3JRC A;  3H36 A;  1SVO A;  3QOD A;  3S3N A;  4IOC F;  2MD5 A;  4A0Z A;  2AHQ A;  3QYB A;  1ONV A;  4NQW A;  1QVU A;  1I3A A;  1LNW A;  5HLT A;  3UR3 C;  4HF1 A;  4A3G J;  2AQE A;  2DAO A;  1ZAO A;  3FIS A;  1HSJ A;  1ETW A;  2Y31 A;  3ZMT A;  3J7Y J;  4RB3 C;  3MCZ A;  1T8I A;  1RKT A;  2KRH A;  4A3J J;  4XKV A;  1TZL A;  1UHW A;  1PYV A;  3QU3 A;  1ZRD A;  2ZNY A;  5EYR A;  4BH9 A;  2EJR A;  2DA5 A;  3C2H A;  2E7W A;  2K5C A;  3FXL A;  1VQ4 I;  4UUS A;  2IPQ X;  3ML6 A;  5JHF A;  1ZGJ A;  2R7O A;  2DA1 A;  1D3Y A;  3GBG A;  1H9T A;  1S6L A;  3D5L A;  4BBS J;  2Z1D A;  3ROU A;  3JRG A;  1G3Y A;  1KA8 A;  3LWF A;  1U0J A;  2KRF A;  4I09 A;  3CCU I;  3E6C C;  2R7W A;  2DJI A;  2O7O A;  5FD6 A;  1SAN A;  4IPA A;  4KIB A;  2FBK A;  5DYM A;  3J7A Y;  2CYY A;  1ZGA A;  4IX7 A;  5CQE A;  2HGC A;  3FHN A;  4BE1 A;  2XAG A;  3I58 A;  4HF0 A;  4U0W A;  3SDB A;  4G6D A;  2XPU A;  1QGP A;  4FTH A;  3V8J A;  4I6Z A;  5K5Q A;  4QIW N;  3GUD A;  3E7L A;  1LUJ B;  1ITY A;  3OS1 A;  2IT0 A;  1G4D A;  1TQP A;  2YUS A;  4UUV A;  3ABL H;  4A3K J;  5C4X J;  5GPA A;  4PZJ A;  4BQO A;  1FBS A;  1SD7 A;  2A3S A;  3P9C A;  2VE9 A;  3FXO A;  2E36 A;  3D1N I;  4XOP A;  2JA6 J;  2EZI A;  2I8D A;  4ZDO A;  3RZO J;  3OYB A;  1FYK A;  3U1K A;  2BHY A;  2E5Z A;  1XCB A;  1PVE A;  2KT0 A;  4EQQ A;  5J4V A;  2R5Z B;  1BOA A;  1VQP I;  4BXX J;  2DA6 A;  5JVG F;  2Z99 A;  4C3H J;  5EEH A;  2DN0 A;  1R22 A;  3ZN1 A;  2GZW A;  3OL4 A;  3BR1 A;  5TIS C;  3SDG A;  4BDY A;  2MW8 A;  1LE8 B;  3CDI A;  1UG0 A;  2A6H F;  5IT3 A;  1KON A;  2VQL A;  1OCC H;  4BJ6 C;  3HYI A;  2CV1 A;  2VT2 A;  2A5Y B;  2OJE D;  2BEO A;  4QPQ A;  4BXU A;  3GW2 A;  1BM9 A;  2OPT A;  2ZJQ F;  1Z77 A;  1B8I B;  1Q1H A;  2H6C A;  4PJJ A;  3K4M A;  2L54 A;  3FBI B;  4UY8 I;  1WI3 A;  2GOM A;  1K4S A;  2L01 A;  3BCB A;  4JX4 A;  2PJR B;  3CES A;  5EEG A;  3PFY A;  5FRO A;  1FIA A;  3R0A A;  2NVU B;  3K4N A;  4A2U A;  2HQN A;  1T38 A;  2XHK A;  1ON1 A;  3L00 A;  1X1C A;  3ZMZ A;  4PCQ A;  2E2H J;  1WJB A;  4CCL A;  2A6T A;  4GYG A;  2PMZ A;  1J0R A;  2R7T A;  1ZTR A;  1ZGW A;  3LAP A;  2YR2 A;  1MBF A;  4XOR A;  1IGN A;  3KP3 A;  3PL8 A;  4M71 A;  2AXT C;  2DOA A;  3WG7 H;  4AID A;  2VPL A;  2XGD A;  1VQ7 I;  2NS0 A;  3OSG A;  4TV7 A;  2P81 A;  1R4M B;  4JX6 A;  5BS6 A;  1YX5 A;  1HKS A;  1W4M A;  4IEJ A;  1U9N A;  3CLQ A;  2IA0 A;  4A5N A;  4O3M A;  4BS9 A;  3OWT A;  3E5U A;  3LSM A;  1J5Y A;  3LA2 A;  4D9J A;  4EJW A;  4CSW A;  2D1V A;  2M8G X;  2VLA A;  3FWE A;  2DMQ A;  2IGO A;  5IP9 J;  3EYY A;  1D1A A;  2Y48 A;  1KU2 A;  4DBQ A;  4I02 A;  3N4M A;  3V42 A;  3ASN H;  2VON A;  2F2E A;  2L5Q A;  2HQA A;  3OIP A;  5J4Y A;  1POG A;  2QF7 A;  2BE5 F;  1TW3 A;  1BJZ A;  2Y75 A;  1GT0 C;  1FBQ A;  4E7K A;  3G1M A;  1BJA A;  2Y0M A;  2ZKZ A;  3RZD J;  2OV7 A;  3WTU C;  2VKH A;  2XGC A;  4BAC A;  5L3B A;  2EIK H;  3ONQ A;  1IDZ A;  2GBY A;  1JTY A;  3KLO A;  3REO A;  5IYD J;  2EIJ H;  4HLY A;  1BA5 A;  3E6B A;  4G12 A;  2DMP A;  4JK1 X;  2L9R A;  2CG4 A;  3HOV J;  2VQC A;  5FFX A;  2FU4 A;  3VYU B;  2KRC A;  3FF5 A;  1RI7 A;  2O03 A;  2E1M B;  4EJV A;  2CFX A;  4AYB A;  4D7N A;  3FKJ A;  1G8X A;  1VND A;  1FTT A;  3H5A A;  4OMY A;  2QGU A;  1HDP A;  3WE3 A;  1OYI A;  3CUQ C;  4XBF A;  5HNF A;  1QVT A;  3IL2 A;  3AG4 H;  1TC3 C;  2HQR A;  2YS9 A;  4B43 A;  4I2O A;  2LP0 A;  3E5X A;  3HEF A;  2WAQ N;  3SZP A;  2OAZ A;  3TOA A;  1ZEL A;  2HVR A;  1YHQ I;  1FIP A;  1ENH A;  4EJO A;  4L9V A;  4MIM A;  2M9H A;  4OIP F;  1Y1W J;  3PFI A;  4XSX F;  3EYI A;  3HB9 A;  2IRF G;  1GUU A;  2WAD A;  4ZH4 F;  5LHI A;  1VQO I;  1LE8 A;  2WA0 A;  2DO7 A;  1R4N B;  1T0F A;  4BHP A;  2KL4 A;  2HI3 A;  3D0S A;  1APL C;  3A4C A;  1Y39 A;  4XLC A;  1MJB A;  3ZQF A;  2HWV A;  5JR3 A;  4AIK A;  4EM2 A;  1WQ2 A;  4IF4 A;  2XIG A;  3L2W A;  4PJM A;  4B8X A;  2H27 A;  2IS1 A;  3H3U A;  1BC8 C;  2V1U A;  3HC7 A;  1WZ2 A;  2M4K A;  4XNF A;  4E4H A;  4U7B A;  2WAQ A;  1R00 A;  4WWC A;  2DMU A;  4PDK A;  2GOX B;  3ZQQ A;  3HDD A;  5J47 A;  1P4X A;  2QEN A;  5E1Z B;  4KYW A;  1I6X A;  2AQF A;  1VQL I;  2BBY A;  1XSX A;  3BQY A;  1WWX A;  2ECB A;  2FNP A;  5EZG A;  5CPR B;  3OSF A;  2Y9Y A;  4Y33 A;  4EJT A;  3D5S C;  2D1H A;  3WGG A;  1RIO H;  1R5G A;  3F8B A;  3ZQG A;  1YOV B;  5F1J A;  1HOM A;  2Q2E B;  5H20 A;  3OS0 A;  2J5O A;  4MQ9 F;  4UUT A;  5EF6 A;  3HOW J;  2DK5 A;  4P1W A;  2V1X A;  5E8I A;  3ZP5 A;  4CXF A;  3IH4 A;  1DP3 A;  3QPH A;  3LQQ A;  1XN7 A;  4LG0 A;  3S17 J;  5ILU A;  3CCS I;  1LDJ A;  1V5E A;  1XGO A;  5KHD A;  2RC4 A;  4D5F A;  3W6J B;  1ZAR A;  3F21 A;  1FWZ A;  2C6Y A;  4L0Y B;  3RCO A;  1ZYR F;  4XRF A;  3FM3 A;  1Z3Y A;  1ACI A;  1P4W A;  3QQA A;  2DTR A;  3LST A;  2W4S A;  2DT5 A;  5B1B H;  1O4X A;  2XF5 A;  4BL0 B;  1FSH A;  3ZQI A;  2HXI A;  2F5C A;  5LLQ A;  3JRA A;  3DV8 A;  2FXA A;  3OY9 A;  1BBY A;  1U5T A;  4IRI A;  2DQR A;  2EIN H;  1WKM A;  3R4K A;  4G6Q A;  3GFJ A;  2CU7 A;  4C3I J;  1TWC J;  3VOD A;  2X6Y A;  5J1U A;  4YIF A;  5D4S A;  5B66 C;  5M3F J;  1TNS A;  3GTG J;  4XM3 A;  3CO7 C;  3CC7 I;  4MTE A;  2DDA A;  4IJA A;  5DV5 A;  4FHT A;  1MIJ A;  1RZ4 A;  1SFU A;  2OA4 A;  3Q5F A;  1SFE A;  4PSX A;  1ZG1 A;  2FQ3 A;  2IEK A;  2PN6 A;  1W36 D;  1A6I A;  1GDT A;  1ZG3 A;  2MA3 A;  3S32 A;  4H4K C;  4BAY A;  1D8J A;  3GFI A;  3H5R A;  4Y4R A;  3WU1 B;  2DOF A;  1XB4 A;  3QWL A;  1OCP A;  3T8R A;  2R93 J;  1E3H A;  3TBI A;  5D5W B;  1KQ8 A;  3FXK A;  3TKY A;  5E79 C;  2L7K A;  3HM5 A;  1H0M A;  2CQN A;  2PMU A;  3RTR A;  2ELH A;  3J7Z I;  2R7Z J;  2VBZ A;  3JTH A;  2KHM A;  4PJ0 C;  2DFE A;  1IN5 A;  5LRR A;  3G71 I;  3I55 I;  1WHU A;  2GIZ A;  5DS9 A;  2STW A;  3OOP A;  3A01 B;  3KP5 A;  1LEA A;  2ZNZ A;  4IHY A;  4HPQ A;  4XMY A;  4F93 B;  2LY9 A;  1XX5 A;  3HRM A;  4A3F J;  3PNY A;  3G4S I;  1PDN C;  2GA2 A;  2IXS A;  3BG9 A;  1D1B A;  3DKY A;  3S3M A;  3VB2 A;  1Y1V J;  4NBQ A;  3BTC A;  4IVN A;  3SFI A;  3SEZ A;  1L3L A;  1IXC A;  3F8N A;  1XGN A;  2JA7 J;  1TWA J;  1W5S A;  4EMS A;  4CCN A;  4EGZ A;  1DDN A;  3BR2 A;  4RGS A;  5HLI A;  4CUG A;  2LY2 A;  3CTA A;  1BI1 A;  4Y17 A;  3BR3 A;  1LVK A;  2L7F P;  3DQV C;  3A03 A;  1YIT I;  3S93 A;  3RKW A;  1QPM A;  2W82 A;  4FX0 A;  3FX3 A;  2RQQ A;  4UV8 A;  2DA2 A;  4XKB A;  5IP6 A;  2ZME A;  3GYH X;  2F4O B;  5E1W A;  1OCO H;  4M3D A;  4UVA A;  1GLN A;  2R0Q C;  3P9I A;  2UV1 A;  4X0G A;  2CWE A;  4MGR A;  5CLS A;  3B6A A;  1ZHF A;  1YW7 A;  2ZB9 A;  3E5Q A;  5M5W J;  5E8G A;  1KYZ A;  3DBR B;  4NC7 A;  3CF5 F;  4B1R A;  1JKO C;  2JSP A;  3MKL A;  1W7P A;  1D8K A;  4BE2 A;  1K6O A;  4BHC A;  1QA6 A;  1X4O A;  3M1E A;  1IF1 A;  2LRD A;  1QNT A;  2HZT A;  1XD7 A;  4BGD A;  1G59 A;  4ETS A;  1DGR M;  4EV0 A;  1P2F A;  1ZRF A;  1PUE E;  3MFK A;  2LTP A;  3S3O A;  3WU2 C;  5K7F A;  3LMM A;  1MND A;  2XAS A;  1YFH A;  3DFG A;  3PQJ A;  4ZDP A;  4UXN A;  1JUP A;  4W97 A;  1ORK A;  1IUY A;  4L5I A;  2HQ5 A;  2VL8 A;  3MWM A;  2FBI A;  3U1D A;  2QQ8 A;  1AA7 A;  4ZYA A;  3JRE A;  2LR8 A;  3AG2 H;  3TGN A;  1ETO A;  1LDD A;  1A5J A;  2UZK A;  2L9V A;  2XKO A;  3GTK J;  1J9I A;  4L5E A;  3RPU D;  4LOC A;  2GAU A;  1MGT A;  5J40 A;  3E97 A;  4Q4Z F;  3BP8 A;  4WK8 F;  3N97 A;  3F8M A;  3JTG A;  4MLO A;  5ILV A;  1T56 A;  2WAE A;  1VQ5 I;  2VKE A;  2XKP A;  1UAA A;  2JTV A;  3AFH A;  2DDB A;  1LVA A;  3QAH A;  1RNL A;  3QOP A;  2LDU A;  2IS6 A;  1R36 A;  2F48 A;  5D6E A;  1YO5 C;  2K86 A;  1K83 J;  1X19 A;  2W00 A;  3B73 A;  4EGY A;  4ZZL A;  1B59 A;  4LIU A;  2GLO A;  3KYC B;  1SFK A;  2F4M B;  5J6X A;  4IQ4 A;  1JE8 A;  3S1N J;  1H8A C;  4ENK A;  4F52 A;  1K78 B;  5DM7 F;  3GFM A;  2D45 A;  3M8F A;  2CMP A;  4II3 A;  3L7W A;  1F4K A;  4EVI A;  3CCR I;  2NRA C;  3M4O J;  3RKQ A;  1U78 A;  3ZCO A;  1GXQ A;  4RM2 A;  1FC3 A;  1O3R A;  3KFW X;  2LNB A;  3IKV A;  4JBA A;  3JSO A;  1MDM A;  3PNT A;  5J8F A;  2E19 A;  1F1Z A;  4J01 A;  4E7Z A;  3OOU A;  3PSF A;  5LEK A;  1IG7 A;  2BY0 A;  3RYR A;  2B9S A;  5AON A;  3V7S A;  2JT1 A;  3P7N A;  1YTY A;  2VPR A;  2IGK A;  3L1P A;  2KJB A;  3K69 A;  4E7J A;  1JTX A;  2F5F A;  2MD0 A;  2H6B A;  2K9N A;  2M45 A;  3TW7 A;  2DFH A;  4KN4 X;  4A3D J;  1RRJ A;  2P5L C;  2RDP A;  3KP2 A;  5A2Q K;  2AS5 F;  5ED4 A;  3O2P E;  2GA1 A;  4MFE A;  2M8E A;  3A0H C;  2DBB A;  5CVI A;  3AAF A;  2CFO A;  1IV6 A;  4L9T A;  1JHH A;  5CQG A;  4CYD A;  4JP0 A;  5KAI C;  4CCJ A;  4RAZ A;  1YI2 I;  2L02 A;  4CIC A;  2W7N A;  2CUF A;  4BE0 A;  4F55 A;  4LGW A;  5HS7 A;  2ESN A;  2MLG A;  2JN6 A;  3PO3 J;  3CC2 I;  5DCF A;  1IJW C;  3OMY A;  2VBY A;  3OL3 A;  2CSO A;  2LVS A;  2DFI A;  2CW8 A;  2XRN A;  1FX7 A;  2XVC A;  4LK1 F;  2M3A A;  2QQ9 A;  2FE3 A;  4RA2 A;  5J1Y A;  1QO0 D;  5FRN A;  2UXN A;  1VQ9 I;  1PUF B;  3AG1 H;  3Q3S A;  3GVA A;  1X1A A;  1FLI A;  4HBL A;  2VB6 A;  2O61 A;  4IRH A;  1FMW A;  1P9Q C;  2Z2S B;  5ICF A;  1G3S A;  1SMT A;  3OYK A;  3ZMU A;  4I7H A;  1BW5 A;  2ZXW H;  3F8C A;  1AKH A;  1YLF A;  2MG4 A;  3ZOB A;  3L09 A;  3IV5 A;  3BWG A;  1DU6 A;  1FSE A;  2F6C A;  3HPG A;  1G6N A;  1KQ0 A;  2WWY A;  2STT A;  2VOO A;  5DUK A;  3A2K A;  4N4O B;  4P55 A;  1OYW A;  2XV4 S;  4HYE A;  5ERI A;  3LSJ A;  4P5O A;  4B3A A;  4ZTF A;  1LFU P;  1OR7 C;  4LB6 B;  2Q1Z B;  5GTH C;  3B6C A;  4BYY A;  3AL0 C;  4HW0 A;  2Z9O A;  2V4J C;  2V6C A;  3WTV C;  3HKZ N;  1ON2 A;  1O3Q A;  1W36 C;  3S1Q J;  1JGS A;  2EA2 A;  4MTD A;  3O6B B;  3PSI A;  2G0E A;  5A2Q Z;  1J09 A;  2IP2 A;  3QP6 A;  1T08 B;  2XSJ C;  4RLF A;  5L3D A;  4C2U A;  3CJN A;  2ID3 A;  1IRX A;  3G2B A;  4HA8 A;  2EBI A;  3JCU C;  4HQE A;  2YSR A;  3ZQH A;  3H1C A;  4CYC B;  2ME0 A;  3ERE D;  1DU0 A;  2CUZ A;  4DGW B;  1SVM A;  2VIX A;  5L3F A;  1VF9 A;  4PFP A;  2EIL H;  4L9N A;  3VDX A;  2CW7 A;  3DCF A;  3WTZ A;  1BN5 A;  3G6E I;  2GM4 A;  2PEX A;  1W5T A;  1ZR4 A;  1W5C C;  3GFL A;  3CJT B;  1BC7 C;  2LF7 A;  3NAR A;  4E7H A;  1X3U A;  4C30 A;  4RGR A;  1Z67 A;  3H3Z A;  5F0F A;  3QRF F;  3MKW B;  1YYV A;  1HW1 A;  2DLL A;  4UV9 A;  4EJU A;  4DIQ A;  3UKG A;  3F22 A;  2OQR A;  4LG3 A;  4DZP A;  1BR1 A;  3T0Y A;  2CQQ A;  4RDU A;  2R7R A;  1C0W A;  3C3W A;  3HSR A;  1X1D A;  4BEH B;  5F1R A;  4HSR A;  1Z1D A;  4XKW A;  1K61 A;  3BR5 A;  3FK7 A;  5DUI A;  3KIO A;  1K7A A;  2RNG A;  3FXJ A;  3JAM Z;  2MC3 A;  1HW2 A;  2VI6 A;  3S16 J;  2PBI A;  1QZZ A;  4E7I A;  1HXD A;  4NQW B;  2EWN A;  4M6Y A;  4GCV A;  1EA3 A;  1YS7 A;  1G2H A;  3EUH A;  3HTU A;  4QSH A;  4W1U A;  3QYE A;  5TRD A;  1WJF A;  1MBJ A;  1Y56 A;  2IA2 A;  2JUC A;  3QPT A;  1XDS A;  3NEU A;  1Z3X A;  3N05 A;  1HBX G;  2DA3 A;  3BJA A;  3MVP A;  1Z05 A;  3OR2 C;  1SFO J;  3SXY A;  5D5X B;  5E3L A;  3V7R A;  4AU7 A;  1QHH D;  4HZF A;  1F9N A;  4LK0 F;  1V55 H;  2NOJ B;  2BVM A;  2Z16 A;  3W3C A;  1JT0 A;  1OKR A;  4PJL A;  2LRE A;  2O8K A;  4D1Q A;  3OS2 A;  2L2O A;  3CC4 I;  3W6V A;  5M3M J;  3HOY J;  5FLM J;  2KFD A;  1Z21 A;  2Z5U A;  2E1O A;  3CMA I;  1MNE A;  1FOX A;  4IHW A;  3KCC A;  3L2C A;  3WG9 A;  3SFZ A;  3VYR B;  3OYF A;  9ANT A;  1FT9 A;  1R1U A;  1QQI A;  2X1E A;  3IWF A;  1BW6 A;  2VXD A;  5HDN A;  1PUF A;  2VJI A;  1SMY F;  3IKT A;  4EM0 B;  4ANJ A;  3IWZ A;  1Y8R B;  4F3Q A;  2QSF X;  2DI3 A;  2OUM A;  1W7P B;  4XRM A;  3HOU J;  4C9Y A;  4BY1 J;  1DGW Y;  3ZMV A;  1IRZ A;  1W1W E;  3FIW A;  3TO9 A;  4HEA 2;  5EGO A;  1H89 C;  1OCZ H;  2L9S A;  1X2M A;  4C3J J;  5FLV A;  3GF2 A;  3HOZ J;  2XAJ A;  4UB6 C;  4Y15 A;  4BXF A;  2Q0O A;  3CQZ J;  2EFN A;  4BHB A;  4L18 B;  2CO5 A;  2M0C A;  3CMM A;  3WTW C;  2HFH A;  3Q0U A;  4HX4 A;  2J5P A;  2FD5 A;  2MAB A;  4IQJ A;  3BPV A;  5FFZ A;  1WJD A;  2Y69 H;  4A0X A;  1E3P A;  3TO7 A;  2IS2 A;  4UVB A;  3DLL F;  3CUQ A;  1I3Q J;  4ZZD A;  2IGM A;  5IPA A;  5K7Z A;  1R9T J;  1YJW I;  3ISP A;  3W2A A;  1R49 A;  1RR7 A;  5HOD A;  3M9A A;  2V7F A;  5IOZ A;  2VQH A;  3BZK A;  1NTC A;  2RAE A;  3BJO A;  1YQA A;  2E5N A;  5H6Q A;  3MKY B;  2CH0 A;  3OYG A;  1XPX A;  4YEL A;  1IXR C;  2X48 A;  2WAF A;  1F43 A;  2LLK A;  1ZN2 A;  5K7H A;  3G3Z A;  3CP2 A;  1JJ6 C;  3MD2 A;  2VN2 A;  4RGX A;  1VQ6 I;  4GO1 A;  4BUP A;  3RIR A;  5BMZ A;  2XB0 X;  3TP3 A;  3AKZ A;  1W0T A;  4R1H A;  2YPR A;  1BL0 A;  2GXG A;  1ZRC A;  1U9O A;  2H8R A;  5B5E C;  1MMA A;  2QA4 I;  2JMW A;  5EDN A;  4A3B J;  3WGH A;  1G3W A;  4WXC A;  2CV2 A;  1ULY A;  2EA4 A;  2OC6 A;  4N9I A;  1SC7 A;  4D0P A;  1M1E B;  2R7Q A;  4U0Y A;  1SD6 A;  4GDF A;  1LFP A;  2ZFW A;  1NK2 P;  1E3O C;  3KZI C;  4ZYE A;  4S04 A;  5E1X A;  3EUA A;  1F5T A;  3JW4 A;  3HUG A;  4YFK F;  4XSZ F;  3U21 A;  3KEY A;  3BG6 A;  2LD5 A;  2TDX A;  1BIA A;  2ZCW A;  4XL9 A;  1RUO A;  4IO9 F;  3PO2 J;  3VYT B;  1HLV A;  4IKF A;  5BOX A;  2Q2E A;  3RI4 A;  3IP4 B;  2DK8 A;  4EEF G;  2QEX I;  1UG2 A;  2LSO A;  5EGO B;  1QHG A;  2JVH A;  4CCO A;  3CD6 I;  3BRO A;  1FTZ A;  2KDO A;  3ZMD A;  2BY1 A;  3GME A;  5L3E A;  3HRS A;  3LL7 A;  4NUB A;  3I59 B;  2M5W A;  3GLL A;  3CUO A;  2EZK A;  4A12 A;  2NNN A;  2BOL A;  3E0J B;  4MO7 A;  1SD5 A;  4RM3 A;  3OIQ A;  2ETH A;  3KLN A;  2M0M A;  4V19 K;  3I54 A;  1LPQ A;  1KGS A;  3GWZ A;  4XN0 A;  1DUX C;  2HS5 A;  4M3G A;  2FX0 A;  1TLH B;  2ADU A;  1R71 A;  2MH2 A;  3KYL A;  1U5T C;  3K4K A;  3ZR8 X;  1W7P D;  3DKW A;  2EQR A;  2XGE A;  4XLA A;  4Z6Y A;  4A3L J;  4Y52 J;  2HYG D;  3OYH A;  3DTI A;  2A61 A;  2ZJP F;  1XGS A;  2QKL B;  4RB2 C;  3H9G A;  1XTA A;  4YFX F;  5LD2 C;  1RUN A;  2G7H A;  1V5G A;  1AKH B;  1N78 A;  1S3J A;  5EEA A;  2FMY A;  3JRI A;  3JRF A;  3CCL I;  2ZME B;  3KYD B;  4FE7 A;  5F04 A;  2XSD C;  2MLK A;  3GTP J;  5DCM B;  2NVQ J;  2QSH X;  4CGZ A;  2M7B A;  3H3V K;  2HOT A;  1XCV A;  4F7Z A;  4DYC A;  4CYC A;  4B09 A;  1N75 A;  1ODD A;  2MYS A;  3F72 A;  2OCC H;  3WTS C;  3K0L A;  1MH4 A;  1LQ1 A;  1R5I D;  3LQR A;  1A04 A;  2HOS A;  2XUB A;  2EZL A;  2HKO A;  3SHF A;  3HSE A;  1BR4 A;  3SJM A;  1ZLJ A;  3HG9 A;  3Q0V A;  3HOS A;  1RKW A;  4WXD A;  4Y7N J;  1GVD A;  3HIF A;  3HHH A;  1EJ9 A;  3K70 D;  3FMQ A;  4FQG A;  3O8G A;  1WJC A;  4AC0 A;  1VZ0 A;  2WB1 A;  2CV0 A;  2LBF A;  4XQF A;  2P7C B;  5H6R A;  2LC2 A;  2FOK A;  3EPZ A;  2RRE A;  1RPW A;  2OQG A;  1FOK A;  2R7X A;  4M9Z A;  3FXQ A;  4BNC A;  4Q48 A;  3IHU A;  1S72 I;  2MC4 A;  1U6G A;  4N0B A;  1J75 A;  1CF7 A;  1X3W B;  4FET A;  4UHT A;  3IUO A;  2O5R A;  4OIQ F;  1B6A A;  3LA7 A;  2X9D A;  5E3M A;  3S2W A;  3VPR A;  4D7M A;  5DD8 A;  3FXM A;  3CJQ B;  4L0Z B;  5LGN A;  3BJ6 A;  4DYR A;  2Y0S N;  3KEQ A;  1GXP A;  5ICG A;  2A05 A;  3MZ8 A;  4RB1 A;  1FOW A;  1JXS A;  3DWL E;  2DQL A;  3FHZ A;  2YX7 A;  5M5X J;  3CCQ I;  3FBN B;  3GTM J;  2JVG A;  1REP C;  3PQK A;  2DTZ A;  5FJ8 J;  2R7F A;  1ZH5 A;  2F5E A;  5E18 F;  2E1M C;  4IRG A;  3S8P A;  2ZME C;  1KQ9 A;  4HX7 A;  3BLY A;  3ZGK A;  1T39 A;  2ZSH B;  2ZBK A;  1Z0X A;  4RMN A;  5KVR A;  4I99 C;  2R5Y A;  1X4P A;  4ZYG A;  1S8N A;  2CQK A;  2LH9 A;  1I5Z A;  4KA4 A;  1ZR2 A;  5LHG A;  3ESW B;  1NG6 A;  4G7Z F; 
#chains in the Genus database with same CATH homology
 2RNJ A;  3GO5 A;  1E2X A;  2KIU A;  4ENJ A;  2K4B A;  5D5V B;  1U5T B;  5D4R A;  3IC7 A;  4HV6 A;  3E6D A;  1EH6 A;  2QQB A;  1KYW A;  2KKO A;  1IZ1 A;  4M9X A;  1MD0 A;  1SFX A;  2EFO A;  2XGX A;  1TNT A;  5CVU A;  1O57 A;  4Y13 A;  1LJ9 A;  2HTS A;  1S7A A;  2JPB A;  2JSC A;  3WTX C;  3WE2 A;  3KP4 A;  3KEO A;  5LGU A;  2E1C A;  2IA1 A;  4OMZ A;  3TO6 A;  3FXR A;  1XGM A;  5J8C A;  1B4A A;  3CDH A;  4G9Y A;  4WCG A;  3CLO A;  3U2R A;  1UHM A;  3RDI A;  2X4H A;  4A6D A;  4LLG F;  2HYF A;  4M73 A;  5L3C A;  4LD5 A;  1YS6 A;  2H09 A;  1O3S A;  4KUM A;  5HVQ C;  1IN4 A;  3F8F A;  2HKX A;  1CGP A;  3DEU A;  3O3K A;  1IN6 A;  3GZ5 A;  4HOB A;  1R5H A;  1FYM A;  1IN7 A;  2QQA A;  2VE8 A;  4KDP A;  4FX4 A;  3K1N A;  3RKX A;  2IVM A;  2K27 A;  2HOE A;  3COA C;  3P9K A;  4KMU X;  1ZLK A;  2CW0 F;  1DPU A;  1B9N A;  2HTJ A;  2FEZ A;  3GX4 X;  2W85 A;  1SD4 A;  4ASN A;  1IN8 A;  3WOD F;  3KET A;  2R7D A;  2Z3Y A;  3H92 A;  1V3F A;  4KNY A;  4XLP F;  2HDC A;  4EM1 A;  4RAY A;  3C18 A;  3BOQ A;  2OU2 A;  4GGG A;  2M30 A;  1BI2 A;  3I59 A;  5DD4 A;  5LBQ A;  1S29 A;  1P6R A;  2L4M A;  4KIC A;  5DCM A;  2E1N A;  2QBY B;  1R1V A;  3KZY A;  3QU6 A;  1YG2 A;  3K9T A;  3KP6 A;  4RB0 A;  3ELK A;  3I53 A;  4U0V A;  2BV6 A;  2QVO A;  1J2X A;  2V9V A;  4YFN F;  5ICC A;  3FXU A;  3U9G A;  3E3V A;  3HTS B;  4NHJ A;  3BPX A;  4WXH A;  2YX4 A;  4UVC A;  4HLX A;  1XDU A;  3V4G A;  1B1B A;  1U3E M;  5IT9 K;  1IRF A;  1VTN C;  5BPI A;  1GVJ A;  5DDG A;  1U8R A;  2FF4 A;  1FP2 A;  5LGT A;  4L5J A;  4I01 A;  2P7V B;  5LEJ A;  5FD5 A;  5AIQ A;  3K1P A;  1O7L A;  5FO5 A;  2LF8 A;  4A6E A;  4G7H F;  1HKT A;  1KU7 A;  3R61 A;  2G9W A;  4P96 A;  3FMR A;  4OIN F;  3CO6 C;  2PI0 A;  2W57 A;  4M9S A;  5FLX Z;  1IAW A;  4LLL A;  3VOE A;  3ZPL A;  5D8K B;  3L9F A;  1J59 A;  5HOO A;  2QBY A;  4O6J A;  1CF7 B;  2P6S A;  4HX8 A;  3TDU C;  5HDK A;  1Z7U A;  4UNO A;  3J80 Z;  5FGM A;  4QWQ A;  1XSV A;  4MHG A;  2XRO A;  5AIP A;  4L9J A;  1T98 A;  3IRR A;  4XLN F;  1YIO A;  3GLX A;  3JSP A;  1HW5 A;  4P9F A;  3MZY A;  1K78 A;  3GXO A;  2EFW A;  2QM3 A;  4KIF A;  1FPQ A;  2FNA A;  1YW9 A;  1MKM A;  4GYI A;  1XSD A;  2O6G E;  2GXB A;  5CVV A;  2ESH A;  4HDU A;  2IW5 A;  1DP7 P;  3TDZ C;  1LDK B;  2VOP A;  1TBX A;  4KFC A;  2DPU A;  5TJJ A;  4LB5 A;  1GHC A;  1EV7 A;  1PP7 U;  2XAF A;  2UXX A;  2RQP A;  3K2Z A;  2QLZ A;  3GEZ A;  2VT3 A;  5KK1 A;  2K4J A;  2W84 A;  1ZG5 A;  1TQI A;  1TTY A;  2OBP A;  3I0T A;  3J7A O;  5HLG A;  4IHT A;  4G7O F;  2QUF A;  4DQ2 A;  5L3G A;  1PP8 F;  3DPT A;  5K5R A;  4MNU A;  4CO8 A;  2UWM A;  6PAX A;  3IRQ A;  1H9G A;  2MBF A;  2PLY A;  2GIV A;  3FMS A;  1UB9 A;  4A5M A;  4PGG A;  1P4A A;  4IHS A;  2OZU A;  4A0Y A;  5CYV A;  1UFM A;  2JPC A;  2DPD A;  4FT8 A;  2ISZ A;  3F6V A;  2P6T A;  4KN7 X;  1P92 A;  2EV5 A;  5CVR A;  3T5X A;  2ACJ A;  5DEQ A;  3EDP A;  4GXO A;  3WTY C;  3I4P A;  4AWX B;  5JVT A;  1ZRE A;  3J81 K;  2W24 A;  5BPD A;  2D2W A;  5D5U B;  3DPL C;  2GWR A;  2CGP A;  3Q9S A;  4HDV A;  4KMF A;  4MEY F;  2ZXJ A;  1Y0U A;  2ZO4 A;  1USS A;  3C1D A;  2NYX A;  3KE2 A;  5F6F A;  5ILS A;  4M6X A;  4AD9 A;  1T2K A;  3M8E A;  2VBW A;  4OIO F;  2KJC A;  3GZ6 A;  4LMY A;  3R60 A;  1QBJ A;  1LEB A;  1QZY A;  2QYO A;  1R1T A;  3ULQ B;  1KU9 A;  1I1S A;  2DU9 A;  1Z6R A;  1TQM A;  4U88 A;  1STZ A;  3CUQ B;  4ESF A;  3MQ0 A;  1MZB A;  4RS8 A;  3OV8 A;  4HAM A;  2FSW A;  2XAH A;  2WTE A;  2FA5 A;  4OU0 A;  1O7F A;  5JHU A;  2DW4 A;  5D8L B;  3RPU A;  4AIJ A;  4CHU A;  3Q9V A;  2P5K A;  4WF2 A;  4M74 A;  4I0A A;  1DPR A;  2NNY A;  1AOY A;  3ECH A;  1WI9 A;  3BZ6 A;  1I1G A;  1L0O C;  2IJL A;  2EK5 A;  2OZ6 A;  1JHF A;  4R79 A;  1OR7 A;  2EFP A;  4RGU A;  2O0Y A;  2JZY A;  3RPQ A;  2KIM A;  3TOB A;  2AXL A;  3VEP A;  1MJ9 A;  1Z6T A;  4JQF A;  1EH8 A;  3J80 K;  2BGC A;  3V7C A;  3T8T A;  2L3D A;  4N9H A;  1MDM B;  2RKH A;  2VXZ A;  4LFU A;  4YII A;  3F3X A;  4P9U A;  3B02 A;  4Q5S F;  2B0L A;  2A07 F;  3V8L A;  2FRH A;  1UCR A;  2ISY A;  2VC1 A;  4E70 A;  1V4R A;  5BQT A;  4ENM A;  2QWW A;  4ESJ A;  3BY6 A;  1KU3 A;  5JFR A;  3R6S A;  2PQ8 A;  5LRS A;  5D6F A;  1NHA A;  4MQV A;  2EV6 A;  2R3S A;  3QP5 A;  3WU0 A;  1R23 A;  3R0J A;  2PJP A;  3HRU A;  2O3F A;  2NAZ A;  4MEX F;  1Z91 A;  3FM5 A;  4R8H A;  5HLH A;  4O5V A;  3ABU A;  2LKP A;  3FZV A;  1YW8 A;  3F23 A;  5CJ9 A;  5CVJ A;  4IXA A;  3I5U A;  2COM A;  2FML A;  1B9M A;  5FB2 A;  4AIH A;  4DNC A;  3DP7 A;  1BI0 A;  1HKQ A;  4M72 A;  3HOT A;  3WTT C;  5HDG A;  2V1D A;  3ZN0 A;  3T1B A;  1E17 A;  1FY7 A;  2A6E F;  2FBH A;  2WV0 A;  5HS9 A;  1J7K A;  2EV0 A;  4K2E A;  4YG2 F;  2JRT A;  3ZMS A;  3HRT A;  5K1Y A;  1XMK A;  3F6O A;  2RV8 A;  3W6K B;  2VOD A;  5FLX K;  1S7O A;  3J81 Z;  3ABT A;  2QZ8 A;  3V8K A;  4ZYH A;  2X0L A;  1UST A;  2F5D A;  3DF8 A;  3KZZ A;  3SZT A;  4WX9 A;  2A68 F;  5IT9 Z;  1LB2 A;  3JAM K;  1IXS B;  2RVC A;  3NQO A;  1OMI A;  3G73 A;  2VBX A;  3VFZ A;  5LHH A;  3MEX A;  3SQN A;  3ZQ7 A;  4CZZ A;  5E17 F;  2BYV E;  1HST A;  2VC0 A;  1BI3 A;  3I71 A;  1R58 A;  1FZP B;  4ENN A;  4G94 A;  5F64 A;  1EH7 A;  2K7L A;  4HF2 A;  3RYP A;  2W25 A;  2HEO A;  1BIB A;  1OPC A;  3EET A;  3LAJ A;  2Z33 A;  2EB7 A;  4OIR F;  4CDG A;  4G8X A;  1I27 A;  4ZYD A;  3RKY A;  3EQL F;  3M7G A;  1T6S A;  1WSU A;  4KT5 C;  5HS8 A;  3KP7 A;  4AVP A;  1TW2 A;  3MAJ A;  3HHG A;  3I64 A;  4LJZ F;  4LLN A;  3MZH A;  3WGI A;  4HV5 A;  5K5O A;  2P4W A;  4BQA A;  2KIF A;  3DXJ F;  3HSF A;  4S05 A;  3K1M A;  4Z2Y A;  1FYL A;  3BDD A;  3NRV A;  1D5V A;  3TQN A;  2RN7 A;  1FBU A;  2Q8K A;  3LA3 A;  4PGH A;  2PFB A;  2PG4 A;  1MJA A;  3ECO A;  2YU3 A;  2O8X A;  1Z9C A;  2ZJ2 A;  2PMH A;  5ICE A;  1R7J A;  1FP1 D;  3LFK A;  2E7X A;  4QLC U;  4NB5 A;  5JI6 A;  2V79 A;  2MH9 A;  4U7D A;  3E6M A;  2WC2 A;  5E20 A;  2H94 A;  2OD5 A;  2P8T A;  4Q47 A;  2P5V A;  4KIG A;  1IW7 F;  2RGV A;  1WRJ A;  1U2W A;  1G3T A;  2M87 A;  1AWC A;  4OOI A;  4I0B A;  1O3T A;  4H0E A;  2M1B A;  1XMA A;  2A69 F;  4I98 B;  2L4A A;  3RJP A;  2G7U A;  4HQM A;  2GQQ A;  2HR3 A;  4ESB A;  3C7J A;  1HQC A;  4ON0 A;  1K79 A;  1IRG A;  2K02 A;  1OYY A;  2XAQ A;  1FNN A;  1SAX A;  2EFQ A;  4LG0 B;  2MD5 A;  4A0Z A;  4NQW A;  1ONV A;  1LNW A;  4HF1 A;  2DAO A;  1ZAO A;  1HSJ A;  3ZMT A;  4RB3 C;  3MCZ A;  1UHW A;  3QU3 A;  1ZRD A;  2ZNY A;  4BH9 A;  2EJR A;  2E7W A;  2IPQ X;  3ML6 A;  1ZGJ A;  1D3Y A;  1H9T A;  1S6L A;  3D5L A;  3ROU A;  1G3Y A;  1KA8 A;  3LWF A;  2KRF A;  4I09 A;  3E6C C;  5FD6 A;  4IPA A;  4KIB A;  2FBK A;  5DYM A;  2CYY A;  1ZGA A;  2HGC A;  2XAG A;  3I58 A;  4HF0 A;  4U0W A;  4G6D A;  1QGP A;  3V8J A;  5K5Q A;  3GUD A;  2IT0 A;  1G4D A;  1TQP A;  4UUV A;  4PZJ A;  1FBS A;  1SD7 A;  2A3S A;  3P9C A;  2VE9 A;  1FYK A;  1XCB A;  4EQQ A;  1BOA A;  2Z99 A;  5EEH A;  1R22 A;  3ZN1 A;  2GZW A;  2A6H F;  5IT3 A;  3HYI A;  2VT2 A;  2A5Y B;  2BEO A;  4BXU A;  3GW2 A;  1BM9 A;  1Q1H A;  2H6C A;  2L54 A;  2L01 A;  5EEG A;  3R0A A;  4A2U A;  2HQN A;  1T38 A;  2XHK A;  1ON1 A;  3L00 A;  3ZMZ A;  4PCQ A;  4GYG A;  1J0R A;  3LAP A;  2YR2 A;  3KP3 A;  4M71 A;  2NS0 A;  4TV7 A;  5BS6 A;  1HKS A;  1W4M A;  2IA0 A;  4A5N A;  4O3M A;  3E5U A;  1J5Y A;  3LA2 A;  4EJW A;  2D1V A;  3FWE A;  3EYY A;  2Y48 A;  1KU2 A;  3N4M A;  4I02 A;  2VON A;  2F2E A;  2BE5 F;  1TW3 A;  2Y75 A;  1FBQ A;  1BJA A;  2Y0M A;  2ZKZ A;  3WTU C;  5L3B A;  3KLO A;  3REO A;  4HLY A;  3E6B A;  4JK1 X;  2CG4 A;  5FFX A;  2FU4 A;  3FF5 A;  1RI7 A;  2O03 A;  4EJV A;  2CFX A;  4OMY A;  3WE3 A;  1OYI A;  3CUQ C;  4XBF A;  3IL2 A;  2HQR A;  4I2O A;  3E5X A;  3SZP A;  2OAZ A;  3TOA A;  4EJO A;  4L9V A;  4OIP F;  3PFI A;  4XSX F;  3EYI A;  2IRF G;  4ZH4 F;  5LHI A;  2DO7 A;  1T0F A;  4BHP A;  3D0S A;  1MJB A;  2HWV A;  5JR3 A;  4AIK A;  4EM2 A;  1WQ2 A;  4IF4 A;  2XIG A;  4B8X A;  2H27 A;  3H3U A;  1BC8 C;  2V1U A;  4U7B A;  1R00 A;  4WWC A;  4PDK A;  1P4X A;  2QEN A;  5E1Z B;  4KYW A;  1I6X A;  2BBY A;  1XSX A;  1WWX A;  2FNP A;  4EJT A;  2D1H A;  3WGG A;  1RIO H;  1R5G A;  3F8B A;  5H20 A;  2J5O A;  4MQ9 F;  2DK5 A;  2V1X A;  5E8I A;  3ZP5 A;  4CXF A;  3QPH A;  3LQQ A;  1XN7 A;  4LG0 A;  5ILU A;  1LDJ A;  1XGO A;  2RC4 A;  3W6J B;  1ZAR A;  3F21 A;  1FWZ A;  2C6Y A;  4L0Y B;  1ZYR F;  4XRF A;  3FM3 A;  1P4W A;  2DTR A;  3LST A;  2DT5 A;  1FSH A;  2F5C A;  5LLQ A;  3DV8 A;  2FXA A;  4IRI A;  1BBY A;  1U5T A;  2DQR A;  1WKM A;  3R4K A;  4G6Q A;  3GFJ A;  3VOD A;  4YIF A;  5D4S A;  1TNS A;  3CO7 C;  4MTE A;  4IJA A;  5DV5 A;  4FHT A;  1RZ4 A;  1SFU A;  2OA4 A;  3Q5F A;  1SFE A;  1ZG1 A;  2FQ3 A;  2PN6 A;  1ZG3 A;  2MA3 A;  4BAY A;  1D8J A;  3GFI A;  3WU1 B;  1XB4 A;  3T8R A;  5D5W B;  1KQ8 A;  3TKY A;  1H0M A;  2PMU A;  3RTR A;  2ELH A;  2VBZ A;  3JTH A;  1IN5 A;  5LRR A;  2STW A;  3OOP A;  3KP5 A;  1LEA A;  2ZNZ A;  3HRM A;  1PDN C;  2GA2 A;  3VB2 A;  4IVN A;  1L3L A;  1IXC A;  3F8N A;  1XGN A;  4EMS A;  1W5S A;  4EGZ A;  1DDN A;  4RGS A;  5HLI A;  3CTA A;  1BI1 A;  4Y17 A;  3DQV C;  3RKW A;  1QPM A;  4FX0 A;  4UV8 A;  3FX3 A;  2ZME A;  3GYH X;  5E1W A;  4UVA A;  3P9I A;  2CWE A;  4MGR A;  5CLS A;  1ZHF A;  1YW7 A;  3E5Q A;  5E8G A;  1KYZ A;  1W7P A;  1D8K A;  1K6O A;  4BHC A;  3M1E A;  1IF1 A;  1QNT A;  2HZT A;  1XD7 A;  1ZRF A;  4ETS A;  4EV0 A;  1P2F A;  1PUE E;  3MFK A;  2XAS A;  1YFH A;  3DFG A;  3PQJ A;  4UXN A;  1IUY A;  4L5I A;  3MWM A;  2FBI A;  3U1D A;  3TGN A;  1LDD A;  2UZK A;  1J9I A;  2XKO A;  2GAU A;  1MGT A;  3E97 A;  4Q4Z F;  3BP8 A;  4WK8 F;  3N97 A;  3F8M A;  3JTG A;  5ILV A;  2XKP A;  2JTV A;  1LVA A;  3QAH A;  1RNL A;  3QOP A;  2LDU A;  1R36 A;  5D6E A;  1YO5 C;  2K86 A;  3B73 A;  4EGY A;  4ZZL A;  1B59 A;  5J6X A;  1JE8 A;  4ENK A;  1K78 B;  3GFM A;  2D45 A;  3M8F A;  3L7W A;  1F4K A;  4EVI A;  2NRA C;  1U78 A;  1GXQ A;  1FC3 A;  1O3R A;  3KFW X;  2LNB A;  3IKV A;  4JBA A;  3JSO A;  1MDM A;  5J8F A;  1F1Z A;  5LEK A;  3RYR A;  5AON A;  3V7S A;  2JT1 A;  3P7N A;  1YTY A;  2KJB A;  3K69 A;  2F5F A;  2H6B A;  2M45 A;  4KN4 X;  2P5L C;  2RDP A;  3KP2 A;  5A2Q K;  2AS5 F;  5ED4 A;  3O2P E;  2GA1 A;  2M8E A;  5CVI A;  2DBB A;  3AAF A;  4L9T A;  1JHH A;  4CYD A;  4RAZ A;  2L02 A;  4CIC A;  4LGW A;  5HS7 A;  2ESN A;  2MLG A;  5DCF A;  2VBY A;  2CSO A;  2DFI A;  2XRN A;  1FX7 A;  2XVC A;  4LK1 F;  2QQ9 A;  2FE3 A;  1QO0 D;  2UXN A;  3GVA A;  1FLI A;  4HBL A;  2O61 A;  4IRH A;  5ICF A;  1G3S A;  1SMT A;  3ZMU A;  4I7H A;  3F8C A;  1YLF A;  3L09 A;  3BWG A;  1FSE A;  1G6N A;  1KQ0 A;  2WWY A;  2STT A;  2VOO A;  5DUK A;  4P55 A;  1OYW A;  2XV4 S;  4HYE A;  5ERI A;  4P5O A;  4LB6 B;  4BYY A;  4HW0 A;  2Z9O A;  2V6C A;  3WTV C;  1ON2 A;  1O3Q A;  1JGS A;  2EA2 A;  4MTD A;  3O6B B;  5A2Q Z;  2IP2 A;  3QP6 A;  5L3D A;  3CJN A;  4HA8 A;  4HQE A;  2YSR A;  3ERE D;  5L3F A;  4L9N A;  3WTZ A;  1BN5 A;  2PEX A;  1W5T A;  3GFL A;  1BC7 C;  2LF7 A;  1X3U A;  4RGR A;  3H3Z A;  3QRF F;  1YYV A;  1HW1 A;  2DLL A;  4UV9 A;  4EJU A;  3F22 A;  2OQR A;  3T0Y A;  1C0W A;  3C3W A;  3HSR A;  5F1R A;  1Z1D A;  5DUI A;  1K7A A;  3JAM Z;  2MC3 A;  1HW2 A;  2PBI A;  1QZZ A;  1HXD A;  2EWN A;  4M6Y A;  4GCV A;  1YS7 A;  3EUH A;  3HTU A;  5TRD A;  2IA2 A;  3QPT A;  1XDS A;  3NEU A;  1HBX G;  3BJA A;  1Z05 A;  3SXY A;  5D5X B;  3V7R A;  4HZF A;  1F9N A;  4LK0 F;  1OKR A;  2Z5U A;  3KCC A;  3L2C A;  3WG9 A;  3SFZ A;  1FT9 A;  1R1U A;  1QQI A;  3IWF A;  5HDN A;  1SMY F;  3IKT A;  4EM0 B;  3IWZ A;  2DI3 A;  1W7P B;  3ZMV A;  3TO9 A;  3GF2 A;  2XAJ A;  4Y15 A;  2Q0O A;  2EFN A;  4BHB A;  4L18 B;  2CO5 A;  3WTW C;  2HFH A;  4HX4 A;  2J5P A;  3BPV A;  5FFZ A;  4A0X A;  3TO7 A;  4UVB A;  3CUQ A;  4ZZD A;  3ISP A;  3M9A A;  3BJO A;  1YQA A;  5H6Q A;  1IXR C;  1ZN2 A;  3G3Z A;  2VN2 A;  4RGX A;  4GO1 A;  3RIR A;  5BMZ A;  4R1H A;  2YPR A;  2GXG A;  1ZRC A;  3WGH A;  1G3W A;  4WXC A;  1ULY A;  2EA4 A;  4N9I A;  4D0P A;  4U0Y A;  1SD6 A;  2ZFW A;  4ZYE A;  4S04 A;  5E1X A;  1F5T A;  3JW4 A;  3HUG A;  4YFK F;  4XSZ F;  2TDX A;  1BIA A;  2ZCW A;  1RUO A;  5BOX A;  2Q2E A;  3RI4 A;  2DK8 A;  2LSO A;  3BRO A;  3ZMD A;  5L3E A;  3HRS A;  3I59 B;  2M5W A;  3CUO A;  4A12 A;  2NNN A;  1SD5 A;  2ETH A;  3KLN A;  3I54 A;  1KGS A;  3GWZ A;  1DUX C;  2HS5 A;  1TLH B;  2ADU A;  2MH2 A;  1U5T C;  1W7P D;  3DKW A;  2HYG D;  2A61 A;  1XGS A;  4RB2 C;  4YFX F;  1RUN A;  2G7H A;  1S3J A;  2FMY A;  2ZME B;  2MLK A;  5DCM B;  4CGZ A;  1XCV A;  4F7Z A;  4B09 A;  1ODD A;  3F72 A;  3WTS C;  3K0L A;  1LQ1 A;  3LQR A;  1A04 A;  2XUB A;  2HKO A;  3SHF A;  3HSE A;  1ZLJ A;  3HOS A;  4WXD A;  3HIF A;  3HHH A;  3FMQ A;  2P7C B;  5H6R A;  2FOK A;  1FOK A;  2OQG A;  4M9Z A;  3FXQ A;  4BNC A;  4Q48 A;  3IHU A;  4N0B A;  1U6G A;  1J75 A;  1CF7 A;  4UHT A;  4OIQ F;  1B6A A;  3LA7 A;  3S2W A;  5DD8 A;  4L0Z B;  5LGN A;  3BJ6 A;  3KEQ A;  1GXP A;  5ICG A;  4RB1 A;  1JXS A;  2DQL A;  3FHZ A;  2YX7 A;  1REP C;  3PQK A;  2R7F A;  1ZH5 A;  2F5E A;  5E18 F;  4IRG A;  1KQ9 A;  4HX7 A;  1T39 A;  2ZBK A;  5KVR A;  4ZYG A;  1S8N A;  2CQK A;  1I5Z A;  4KA4 A;  5LHG A;  4G7Z F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...