2IRFG

Crystal structure of an irf-2/dna complex.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
109
structure length
109
Chain Sequence
RMRMRPWLEEQINSNTIPGLKWLNKEKKIFQIPWMHAARHGWDVEKDAPLFRNWAIHTGKHQPGIDKPDPKTWKANFRCAMNSLPDIEEVKDRSIKKGNNAFRVYRMLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(P*AP*AP*GP*TP*GP*AP*AP*AP*GP*(5IU)P*GP*A)-3')
publication title Crystal structure of an IRF-DNA complex reveals novel DNA recognition and cooperative binding to a tandem repeat of core sequences.
pubmed doi rcsb
source organism Mus musculus
molecule tags Gene regulation/dna
total genus 30
structure length 109
sequence length 109
chains with identical sequence H, I, J, K, L
ec nomenclature
pdb deposition date 1999-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00605 IRF Interferon regulatory factor transcription factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2irfG00
1BIBA 5FLXZ 2WC2A 2ZFWA 4IRHA 4MTDA 4M71A 3LQRA 1O3QA 2L3DA 3OOPA 2P5LC 2M1BA 5D8LB 1FC3A 5L3BA 4EMSA 2HYGD 2JT1A 1D5VA 1BC7C 4L9NA 3KP7A 2JPBA 3ZPLA 3RJPA 5L3CA 2O0YA 3RIRA 5DD8A 4WXHA 4WCGA 3U2RA 3QAHA 1IF1A 4BYYA 4HOBA 3HHHA 2VONA 2BYVE 1QQIA 1U8RA 3VEPA 4IF4A 3VODA 5BS6A 3HTUA 3TDZC 5FGMA 2JSCA 1TQIA 3N97A 1BC8C 1LQ1A 1H9GA 2IA0A 4I98B 1G3WA 3V7RA 3HRTA 2K4JA 4GYGA 4XBFA 3GUDA 1REPC 4O6JA 2PG4A 2O3FA 2P7CB 1WRJA 3M9AA 2HTJA 4ESBA 2CG4A 3ECOA 1HXDA 3K0LA 3RPUA 3FXUA 3LA7A 2PEXA 4LD5A 1YW7A 4ON0A 3V7SA 5J6XA 4KIFA 3F22A 1WQ2A 3FMSA 4A0XA 5LGTA 2HQRA 4G6DA 1TNTA 4YIIA 5CJ9A 1FYLA 3GFIA 3QU6A 3RKWA 4KNYA 4BH9A 3LAJA 5KK1A 3TO7A 3F8FA 3ERED 5AIPA 2PMHA 2FU4A 2ESHA 1WKMA 2VOOA 3TO6A 1ODDA 4FX0A 3LQQA 4B8XA 1OYYA 5AIQA 1R5HA 4LG0B 1DPRA 3DFGA 2LF8A 1OR7A 2K7LA 3TQNA 2QUFA 3DPTA 4XLNF 3IRQA 1K79A 2L4MA 3P7NA 2UWMA 3OV8A 2EV5A 1BN5A 1BI2A 3GFJA 3KP4A 3V8LA 2H94A 5JI6A 4N9HA 5LRSA 2FXAA 1FSEA 1P2FA 2MH9A 2QWWA 5CVRA 5D5WB 4WXCA 1J2XA 1KU3A 1R22A 2FRHA 4PZJA 3HOTA 4G7OF 1XB4A 4BHBA 3I4PA 4PGHA 1IN4A 2FMLA 5F64A 3F6OA 4Q48A 1J59A 2QBYB 1LNWA 1USTA 2OZUA 2FNPA 4HX8A 1I5ZA 4HAMA 5EEHA 5LGUA 2Z33A 1ULYA 4YG2F 3JSOA 4ZYGA 4TV7A 4WX9A 3BP8A 2QZ8A 5FD6A 3HUGA 1O57A 1J9IA 1UHMA 2IVMA 3IKVA 3EYIA 4XLPF 3IL2A 1FSHA 4WF2A 4A0ZA 1LDKB 5K5QA 1ZN2A 3ZN0A 3KP5A 2J5PA 4YFNF 2MA3A 1K7AA 5HS7A 1R1UA 1AOYA 3HSFA 3COAC 1TNSA 4G9YA 4LB5A 3EYYA 2W84A 2XKOA 1B9MA 2HTSA 2Z3YA 3FX3A 2FSWA 2DAOA 2GA1A 3FXRA 5DUKA 1T6SA 2XASA 3IWZA 4G6QA 2Q0OA 4LB6B 4R8HA 3T8TA 3I71A 4WWCA 1Z6RA 5ED4A 1FYKA 3O6BB 3EETA 1EH7A 3GXOA 2DTRA 4OU0A 3CUOA 2Y48A 1D8KA 2VT3A 4Q4ZF 2KIMA 3I53A 3R61A 1YO5C 2HEOA 1W5SA 3KLNA 4KDPA 3BJOA 2RNJA 4EGYA 2RKHA 3KETA 1IZ1A 2A5YB 3E6DA 4YIFA 4ENNA 2O61A 4O5VA 1I27A 1ZGAA 2MBFA 3WE3A 5HS8A 5ILUA 4I7HA 3DXJF 1Z05A 2H6BA 5FFXA 3SHFA 1S3JA 5A2QZ 3BOQA 4OIRF 2PFBA 4EM0B 3KLOA 1S7OA 3JW4A 2PLYA 2OU2A 3KEQA 4WK8F 3GW2A 3I54A 1SFXA 6PAXA 2H6CA 5D4RA 2QQAA 1ZHFA 1P6RA 3E6MA 2LNBA 2W25A 4HF2A 1DPUA 2HYFA 2NS0A 1BI0A 4RB0A 5L3DA 3WTYC 2GQQA 2V1UA 3R0JA 4UNOA 3RDIA 4OIQF 1B9NA 3T5XA 2BE5F 2HFHA 2STWA 2XROA 1IN5A 1JHHA 2FA5A 4JQFA 5H6QA 3ZMZA 4A2UA 4GCVA 1G3SA 4MEXF 2JRTA 3WE2A 3MWMA 1EH6A 3T8RA 3PQJA 3J81K 1GXPA 2XAHA 2ZMEA 3DV8A 3ABUA 2JZYA 2RDPA 4MNUA 1SD5A 4LJZF 1FP2A 5CVJA 4CGZA 2E1CA 2L4AA 1XMAA 4FHTA 2EA2A 1CF7B 2IP2A 1IXSB 1BJAA 4Y15A 2ZO4A 1HQCA 3QOPA 3RYPA 2QM3A 3RYRA 1QZZA 2DK5A 4CZZA 5DCMB 1PP8F 1BM9A 2VE9A 5HLIA 2G9WA 2OD5A 1MDMA 2XAJA 1YW9A 1J7KA 2EFQA 2KRFA 1BI3A 3LAPA 1F9NA 3RPQA 5CLSA 3W6KB 1IXCA 1FYMA 2O8XA 2EJRA 2EFPA 1ZRDA 1ZLJA 1P4XA 3GLXA 1XMKA 4I0BA 1W4MA 4CO8A 1G3YA 1TLHB 5DCFA 5L3EA 1MKMA 2CYYA 2DK8A 5HLHA 4RB1A 2PQ8A 1XSXA 1Z7UA 3P9CA 2Y0MA 4ETSA 4KIBA 1XSDA 5LEKA 1OYWA 3HRUA 3E5QA 3ZN1A 2HS5A 2K86A 4HV6A 4LLNA 3GZ5A 5FB2A 5K1YA 3JTGA 2DQLA 1F4KA 3EDPA 3B73A 3F8NA 3SQNA 2P5VA 2XGXA 3WTWC 3CDHA 4Q47A 4A6DA 4ESFA 2EV6A 3KP2A 2XAFA 2ESNA 2R3SA 2E7WA 4OOIA 1WWXA 4LLLA 3I5UA 5HDNA 3L9FA 3VB2A 3J81Z 4NB5A 5ILVA 2H27A 2YPRA 1E2XA 4YFXF 1XGNA 4RGSA 1LEAA 5LGNA 1ZG1A 4JK1X 4RGRA 4U7BA 2FNAA 4U0VA 3BY6A 4IXAA 1GVJA 2OBPA 3JTHA 1RNLA 2Z9OA 2F5CA 4IHTA 2QQBA 1U5TA 2H09A 2CQKA 5BMZA 1B1BA 5E8GA 4KMUX 2CO5A 5HLGA 4IRGA 2G7UA 5ICFA 1KQ8A 2DT5A 1OKRA 4G8XA 2A3SA 5BPIA 1PUEE 4EM1A 3HHGA 3DF8A 5K5RA 1ZG3A 3GFLA 3ZMSA 4HV5A 4Z2YA 5BOXA 1KU2A 4I01A 1FX7A 3FM3A 3R6SA 3WU0A 1GHCA 2Q2EA 2MC3A 2W57A 3KZYA 2HGCA 4RB3C 1XCVA 4ENJA 1HBXG 2XKPA 4EJTA 2Z5UA 2A6HF 2JPCA 3C1DA 3HYIA 1SMTA 2W85A 1HW1A 3E3VA 1G6NA 4A5MA 2PJPA 1FLIA 2COMA 1PDNC 1CGPA 2P6TA 1ZH5A 5L3FA 2DU9A 3I64A 4YFKF 3FZVA 2ZMEB 1OYIA 3S2WA 1R00A 1KGSA 5D5XB 2Q8KA 3GFMA 5IT3A 2Z99A 1J75A 1F5TA 4UVCA 1O3TA 1EV7A 2R7DA 5D6EA 2MLGA 3WTXC 3O2PE 4B09A 1OPCA 4MQVA 1QPMA 1K78B 1YTYA 4WXDA 1E17A 5F6FA 4Q5SF 1IW7F 3WODF 2V1XA 2AXLA 3H3ZA 2ZNYA 3QP5A 4M72A 4U88A 4FX4A 2PMUA 1D3YA 1TQMA 1S8NA 3KEOA 1MDMB 2HOEA 2UXNA 3FHZA 3GF2A 2D1VA 3J80K 5CVUA 3FM5A 4HLXA 3FXQA 2RV8A 5D5UB 3R0AA 4LK1F 1XGSA 1YS7A 2ELHA 1BI1A 3F6VA 4KUMA 1FNNA 3RKYA 4L9JA 3D0SA 4XSXF 2IPQX 2K02A 2QVOA 1FOKA 3VFZA 2R7FA 3R60A 3LFKA 3MCZA 4AWXB 3FWEA 3RTRA 3GEZA 3I59A 1W7PA 3K1MA 4P55A 3BWGA 4MTEA 2VE8A 3BJAA 1IN7A 2BGCA 3O3KA 1BIAA 2GIVA 3DQVC 2QYOA 3ISPA 1RUNA 5HS9A 4HX4A 1HSTA 3P9KA 2P5KA 2ETHA 4ENKA 4BHPA 4LGWA 3F23A 1O3RA 4QLCU 1MJBA 3BPXA 1LJ9A 2L02A 4UUVA 5EEGA 1O3SA 1KYWA 4U7DA 5L3GA 1ON1A 1ZARA 1C0WA 3I0TA 1W7PD 4M9XA 3FMRA 5F1RA 3V7CA 5HDGA 1OMIA 1UFMA 3RKXA 1HKQA 3REOA 2VT2A 4A0YA 1STZA 2XHKA 3MZYA 2DPUA 1AWCA 3Q9VA 1SAXA 2FE3A 2O6GE 5E1ZB 1HKTA 1J0RA 2KJCA 4ENMA 4PCQA 1U5TB 5LEJA 4HDVA 1WSUA 1LB2A 5D6FA 3HSEA 2L01A 4BHCA 2QLZA 4M6YA 2DW4A 2OZ6A 3K69A 3L7WA 1K6OA 1RUOA 2EV0A 2HQNA 2XVCA 2ISYA 1R23A 3F3XA 4UHTA 1HW2A 2VBWA 2P4WA 3SZPA 3GYHX 1FT9A 4OIPF 2X4HA 3LA2A 3J80Z 2XAGA 5D4SA 2XUBA 3DKWA 1FBQA 4K2EA 1XGMA 2OA4A 5HOOA 2GA2A 2XAQA 2LSOA 1SMYF 1MD0A 3F8BA 3L2CA 4BQAA 2OQGA 1SD7A 1R7JA 4KFCA 1S7AA 2ACJA 2ZBKA 3TO9A 3T1BA 5LRRA 2CSOA 4D0PA 4LFUA 1U5TC 1KYZA 3T0YA 4DNCA 1FPQA 1P4WA 2YX4A 3ROUA 3ECHA 1FY7A 2FEZA 2GXBA 3ZMUA 3HIFA 4GO1A 1QGPA 5LHIA 4ZYDA 3IKTA 3K1PA 1Z1DA 1BOAA 2WV0A 3CJNA 1RIOH 3G3ZA 5CVVA 3H3UA 4LG0A 4L0YB 5LLQA 2A61A 3H92A 3TOBA 3N4MA 2CW0F 3BDDA 3QRFF 3DP7A 1W5TA 2EWNA 3TDUC 2NAZA 1QBJA 4HLYA 4AIJA 2FMYA 3Q5FA 1KQ9A 2DFIA 4IPAA 5DD4A 2MLKA 3WGGA 5H20A 3MAJA 2RQPA 3U9GA 2XRNA 1B59A 1ZGJA 1Z6TA 4BXUA 3FMQA 1P92A 2VBYA 4P96A 2V9VA 2C6YA 3QU3A 1SFUA 4M74A 3LSTA 5E1XA 2HKOA 1JE8A 4N0BA 2RN7A 4U0WA 2PBIA 3CO6C 1S6LA 2DO7A 4UV8A 4I09A 2ADUA 3TGNA 4P9FA 3I59B 1W7PB 3GVAA 1NHAA 4RGXA 1FBUA 2M5WA 4L9VA 1PP7U 5CYVA 2VC0A 5ILSA 1WI9A 1T0FA 2VBZA 2RC4A 2F5FA 3EQLF 5ICGA 2D45A 1KU9A 2RVCA 4LLGF 1SFEA 3JAMK 2IRFG 2DI3A 2K27A 4EJVA 4EJOA 3KP3A 3AAFA 3KZZA 1BBYA 2XIGA 2M8EA 2YX7A 3HRSA 4EV0A 2A68F 1QO0D 3I58A 3KE2A 3WTZA 4O3MA 2J5OA 1V3FA 4MEYF 4S05A 5LHGA 1IUYA 2YR2A 3L09A 5FD5A 1R36A 4UVBA 3IRRA 1I1SA 2OAZA 4LK0F 1JHFA 3QPTA 2KKOA 5E18F 4OMZA 3CUQC 1LVAA 4CDGA 2GWRA 1IRGA 2ZCWA 3EUHA 5DV5A 3F8MA 4KYWA 3WGIA 1H9TA 2DQRA 4CHUA 2FF4A 2L54A 3C3WA 2STTA 4HX7A 1O7FA 4IVNA 4M73A 1IAWA 1Z91A 2VN2A 3KCCA 4OIOF 5HDKA 2BBYA 1Y0UA 2CGPA 1XD7A 4P5OA 1IXRC 3WU1B 4HQMA 1ZREA 4GXOA 3E5XA 2F2EA 1XSVA 4L5IA 1F1ZA 4CXFA 1V4RA 4LMYA 4N9IA 4L18B 1IRFA 3C18A 4HYEA 3KFWX 1U6GA 1YQAA 5DYMA 3WG9A 3ELKA 1Q1HA 5LHHA 2D2WA 5D8KB 4G7HF 3TKYA 4RS8A 5JVTA 3QPHA 3M7GA 1T39A 3PFIA 5LBQA 4A12A 3WTSC 4KIGA 2FQ3A 2F5DA 3E6CC 1DDNA 2HKXA 3G73A 4OINF 1USSA 4NHJA 4HF1A 3GZ6A 4G7ZF 4KN4X 2NNNA 4A5NA 3JSPA 2EK5A 4EJUA 1LDJA 2HZTA 2KIFA 4GYIA 1XCBA 3F21A 5JR3A 3BROA 4QWQA 1TW2A 2DBBA 2VXZA 4I0AA 3WTVC 5DUIA 4AD9A 3ZP5A 3JAMZ 2IW5A 3ZMDA 2FBHA 2VOPA 2P6SA 4R1HA 4U0YA 2UZKA 3E5UA 1UCRA 2ISZA 2K4BA 1L0OC 3C7JA 1ZRCA 1UHWA 3E97A 2GAUA 1P4AA 1HSJA 4IHSA 2W24A 3PQKA 3LA3A 2EB7A 3F72A 5ERIA 2LF7A 5IT9K 2VBXA 2YU3A 3E6BA 2CWEA 1YYVA 4OMYA 3BJ6A 5JHUA 2FBIA 2P8TA 3W6JB 2O03A 4Y13A 1RI7A 4KICA 1I1GA 4RAYA 5FFZA 1SD4A 5HVQC 5DDGA 3U1DA 4UXNA 1T98A 3FF5A 5K5OA 4MHGA 1A04A 5A2QK 1CF7A 3MFKA 1U78A 3WGHA 3V4GA 1U2WA 3V8JA 3KP6A 2YSRA 2NRAC 2EA4A 1ZAOA 2OQRA 4E70A 4ASNA 1EH8A 5DCMA 4I2OA 3CUQA 4ZYHA 2KIUA 3M1EA 2V79A 3K2ZA 4HDUA 4RAZA 3IC7A 4BNCA 2QENA 2WWYA 2G7HA 1TW3A 4GGGA 2MD5A 2EFWA 3NQOA 3K9TA 4I02A 1YG2A 4L0ZB 3J7AO 1XGOA 4EJWA 1L3LA 2IA2A 2A6EF 5TJJA 5AONA 3BPVA 3D5LA 4ZZLA 2BV6A 4MGRA 2DLLA 2B0LA 2PN6A 1ZRFA 4KMFA 2AS5F 1X3UA 3NEUA 1T38A 1XDUA 1MJAA 1U3EM 4AIKA 4PGGA 4DQ2A 4RB2C 3GO5A 4XSZF 5CVIA 2Y75A 3GWZA 4R79A 3IHUA 2BEOA 1TTYA 1MGTA 1XDSA 5E20A 3HSRA 1YFHA 3IWFA 2M45A 3M8FA 3L00A 1TBXA 4EQQA 1S29A 1ZYRF 4RGUA 4UVAA 3MQ0A 4KA4A 4EVIA 1R1VA 4S04A 4PDKA 4JBAA 1ON2A 5IT9Z 4HA8A 1JGSA 2DPDA 2ZNZA 1HW5A 1ZG5A 1H0MA 4H0EA 4M9ZA 1MJ9A 4UV9A 1RZ4A 5JFRA 3MEXA 2A69F 4A6EA 1KQ0A 3BZ6A 1KU7A 2HWVA 2FBKA 2KJBA 3LWFA 2A07F 1FWZA 3SZTA 2TDXA 1R58A 2M87A 1HKSA 1IN6A 4MQ9F 3ZMVA 5J8FA 3VOEA 1ZLKA 3MZHA 1D8JA 5E17F 2HDCA 5H6RA 3ULQB 3CO7C 2IT0A 1QZYA 1FBSA 2IA1A 4BAYA 1YLFA 3HRMA 3CTAA 3QP6A 4M9SA 3SFZA 2ZKZA 5ICEA 1G4DA 4AVPA 1YIOA 2CFXA 2ZJ2A 2IJLA 3NRVA 5FLXK 4XRFA 1JXSA 2NNYA 1QNTA 5J8CA 1DP7P 1T2KA 2VODA 2MH2A 1LDDA 2EFOA 5KVRA 1XN7A 3WTTC 2XV4S 4EGZA 2NYXA 4P9UA 1YW8A 2EFNA 2UXXA 5TRDA 1R1TA 1FP1D 2ZXJA 4KT5C 1G3TA 1UB9A 1TQPA 4ESJA 4HBLA 4IJAA 4Y17A 1FZPB 3K1NA 2D1HA 5E1WA 4IRIA 1LEBA 4ZYEA 4AIHA 2V6CA 5ICCA 3TOAA 1I6XA 5FO5A 1ONVA 4HW0A 1IN8A 3ML6A 4L5JA 1K78A 1YS6A 4EM2A 3ZQ7A 2GZWA 1GXQA 1DUXC 1SD6A 1VTNC 1KA8A 2V1DA 2LKPA 3DPLC 2PI0A 4ZH4F 4G94A 1B4AA 5E8IA 3F8CA 2HR3A 3B02A 2P7VB 2QBYA 3CLOA 3WTUC 2E1NA 2WTEA 4NQWA 3HOSA 3GX4X 3SXYA 2FOKA 3CUQB 4CICA 3RI4A 1J5YA 4HF0A 4ZZDA 4F7ZA 2GXGA 3Q9SA 3ABTA 2X0LA 1MZBA 3DEUA 1B6AA 4KN7X 1Z9CA 3HTSB 2JTVA 5BQTA 5D5VB 2F5EA 2QQ9A 2E7XA 3M8EA 3P9IA 4FT8A 2LDUA 2M30A 5DEQA 4CYDA 4M6XA 1R5GA 3V8KA 3R4KA 4HZFA 4L9TA 3ZMTA 1O7LA 2VC1A 5BPDA 2RGVA 4HQEA
chains in the Genus database with same CATH superfamily
2LH9A 1V5GA 5TGTA 1BIBA 5FLXZ 1HCRA 2WC2A 2IXSA 2ZFWA 3J7YJ 2FOWA 4IRHA 2P0WA 4MTDA 4M71A 4E7KA 3LQRA 2VJ5A 4E7HA 1O3QA 3IH3A 2L3DA 3OOPA 2LBFA 4LOCA 2P5LC 2M1BA 5D8LB 1FC3A 3RSNA 5L3BA 4EMSA 2HYGD 3PUBA 2JT1A 1D5VA 1BC7C 1WCMJ 4L9NA 3KP7A 2JPBA 3ZPLA 3RJPA 5K7ZA 1X3ZB 3OYAA 2L9NA 5L3CA 2O0YA 2DA4A 3VYRB 3RIRA 5DD8A 4WXHA 1MBHA 4WCGA 3U2RA 3QAHA 3DTKA 2Z1DA 1IF1A 4BYYA 5FJ8J 4HOBA 3HHHA 3KZIC 4PSXA 2VONA 5JLWA 1X1BA 2BYVE 2QSFX 1NK3P 1QQIA 4I99C 1U8RA 4ZYAA 5F04A 4IF4A 3VEPA 2LVSA 3VODA 2FX0A 3ZQQA 5BS6A 1LFUP 4JX5A 3HTUA 3TDZC 5FGMA 2JSCA 1TQIA 1X3WB 3A03A 4XOPA 1LUJB 2R93J 3N97A 4PUSA 4IQ4A 3JRCA 1BC8C 1TWAJ 1LQ1A 1TL8A 1FIAA 1H9GA 5GAEJ 2R0QC 2IA0A 1HOMA 4I98B 1G3WA 2XAUA 3V7RA 3CCUI 3OS2A 3HRTA 2K4JA 4GYGA 4XBFA 3GUDA 1T33A 1S9HA 2GXAA 4F3QA 3JREA 1REPC 4O6JA 2CMPA 4N4NB 2GOXB 1FMWA 3Q0UA 3LSIA 3TEDA 2PG4A 4ZTJA 2O3FA 1ETKA 2P7CB 2EZLA 3BTIA 4F55A 3OYHA 2WAEA 2XPUA 3JR9A 4HPQA 1PVEA 3L2WA 2GLOA 1TT0A 1YX5A 4AM3A 1WRJA 3M9AA 2HTJA 2KRCA 4ABZA 4ESBA 2NS7A 3BTJA 5C3EJ 3OYMA 2ZJQF 3HB9A 1EKEA 2KMUA 4XLAA 2CG4A 3ECOA 1HXDA 3K0LA 3RPUA 3FXUA 2QSGX 3LA7A 3C2GA 2PEXA 4LD5A 1YW7A 4ON0A 5IY5H 3V7SA 5J6XA 4KIFA 3FXJA 5HLTA 3F22A 1WQ2A 4B3XA 3FMSA 1YITI 2M4KA 5J1YA 4A0XA 4XK4A 5LGTA 2HQRA 4G6DA 1TNTA 4YIIA 5CJ9A 1FYLA 3GFIA 4XKBA 3QU6A 3RKWA 3UKGA 5GAHJ 2ZC2A 4IHXA 4KNYA 4BH9A 1V55H 4PJ0C 3LAJA 4C2TA 5KK1A 4BDYA 2ELKA 3F8FA 3TO7A 2BXYA 3ERED 3W2AA 1XTAA 3MKZA 5AIPA 3E0JB 2PMHA 4V2FA 2KDOA 4NC7A 2WB1A 3HOUJ 2HXIA 3DEEA 2FU4A 2ESHA 1WKMA 2VOOA 1WI3A 1ODDA 2DA6A 3TO6A 4HNUA 4FX0A 4BE0A 3LQQA 3LSHA 5H2FC 4B8XA 5DM6F 1OYYA 5AIQA 3HJEA 1R5HA 3RPUD 4LG0B 1DPRA 3DFGA 2MSYA 1PUFB 2R92J 2X51A 1LFPA 4D5CA 2LF8A 1T08B 1OR7A 2HYJA 3H9JA 5M3FJ 2AXTC 2K7LA 2LREA 3TQNA 2ZSHB 5IOZA 3MKYB 2QUFA 3DPTA 4XLNF 1J09A 3IRQA 1V54H 3ZQGA 1K79A 2L4MA 3A4CA 3P7NA 2UWMA 3OV8A 2EV5A 1BN5A 4HNVA 1BI2A 3GFJA 2JN6A 4AC0A 3KP4A 3V8LA 2H94A 3FHNA 1YIJI 2OF7A 1SC7A 1X4OA 2LG4A 4CCJA 3RKQA 2K40A 5JI6A 4N9HA 5LRSA 3BG5A 1UZCA 2FXAA 1FSEA 1P2FA 3G1MA 2N8GA 2MH9A 1Y6IA 1MSEC 4BUPA 2Y0SA 2QWWA 1SANA 5CVRA 4WXCA 4DYQA 5D5WB 1J2XA 1KU3A 1R22A 1XC5A 2WA0A 2FRHA 4PZJA 2X1DA 2ID3A 2IEKA 1XB4A 4BHBA 3HOTA 4G7OF 2MYSA 3I4PA 4PGHA 1IN4A 1RRJA 1HA8A 4Y7NJ 2FMLA 5F64A 5FRMA 3F6OA 4Q48A 2KISA 1FOYA 1LNWA 1J59A 2QBYB 4ANJA 2Y69H 3HKZN 1USTA 4N4OB 2DOEA 2FNPA 2CUZA 2OZUA 4HX8A 1I5ZA 4HAMA 4NQWB 5EEHA 3ZQFA 3H0GJ 5LGUA 3K70D 2Z33A 1ETXA 2D5VA 3KX2A 2GOMA 4B47A 3DU5A 1ULYA 4YG2F 3JSOA 4ZYGA 1ZR2A 1TZLA 4TV7A 4WX9A 2H8RA 3BP8A 1WPKA 2VASA 2QZ8A 2L7MP 1O4XA 3S16J 2BW3B 5EZGA 4G6TB 5FD6A 2M34A 3FKJA 3HUGA 1O57A 1J9IA 1UHMA 2IVMA 3IKVA 4MIMA 3EYIA 1G8XA 3BQZA 1H8AC 1VQ7I 1I6HJ 5JHFA 4XLPF 3IL2A 1FSHA 5CPRB 3O8GA 5E3LA 2AQFA 4WF2A 1CQTA 4A0ZA 1LDKB 5GADJ 3CMEI 3F9KA 5K5QA 1ZN2A 3ZN0A 1K4TA 3KP5A 2OTLI 2J5PA 2JA7J 4YFNF 2MA3A 1K7AA 3MVPA 5HS7A 3TW7A 1R1UA 3OYNA 1VQKI 1AOYA 2XGEA 2OV7A 3HSFA 3COAC 2ELJA 1TNSA 4G9YA 4LB5A 3EYYA 3HZJA 2W84A 2XKOA 1B9MA 2HTSA 2Z3YA 2QF7A 3FX3A 4P1WA 1VFCA 2FSWA 2DAOA 2GA1A 3FXRA 5DUKA 3DLLF 1T6SA 2XASA 3IWZA 4G6QA 2CUJA 2Q0OA 1NK2P 4LB6B 4BKXA 1JTYA 3AL0B 4R8HA 4AIDA 1OFCX 1WH5A 3I4NJ 3HXLA 3T8TA 2EZKA 1JKQC 2AO9A 2KZGA 3I71A 4WWCA 1Z6RA 5ED4A 1FYKA 3HGGA 3HEFA 3O6BB 2M2EA 3EETA 3FK7A 3EUKL 1EH7A 1I3AA 3GXOA 2DTRA 4OU0A 1IDZA 3CUOA 2NOGA 2LD5A 4AYBA 2Y48A 1D8KA 2VT3A 4RDUA 2L9SA 4Q4ZF 3P5JA 1VQ8I 3OR2C 1MNMC 3CC4I 2KIMA 1QVUA 2ME0A 3I53A 2F5VA 3K4KA 3R61A 1YO5C 2HEOA 1W5SA 1FOXA 3ASOH 3PJRA 3KLNA 4C2MJ 3DEWA 3GTGJ 4KDPA 1JJ6C 3BJOA 2RNJA 4EGYA 1Y1WJ 2RKHA 3TBIA 3HOYJ 4PFPA 3BG7A 2H8WA 3FKIJ 1IZ1A 3KETA 3DBRB 2HI3A 3PIPF 3D5RC 2X1EA 2A5YB 3E6DA 2VLAA 3FXMA 4YIFA 4NNJA 4ITVA 4ENNA 2O61A 3FK6A 2DN0A 4O5VA 1WZ2A 2VQGA 4XLCA 4A3BJ 1I27A 1X1AA 1ZGAA 2MBFA 2WV1A 1ETQA 2DA3A 3WE3A 2DODA 3CJTB 5HS8A 5B1AH 5ILUA 3IV5A 2F4OB 4I7HA 3BZCA 4JP0A 3DXJF 1Z05A 1E3HA 3AL0C 2H6BA 3K4CA 4RM2A 1OCZH 5FFXA 3SHFA 1QHGA 1S3JA 1HC8A 3A01A 5A2QZ 3K4BA 3WHCA 3BOQA 4OIRF 2G0EA 2PFBA 3CZ6A 4EM0B 1LE8A 2FUG2 1UELB 2V9PA 3KYLA 1S5LC 3KLOA 1S7OA 5E3OA 3AKZA 2VQLA 3JW4A 5GPCA 2PLYA 2OU2A 4A3CJ 3KEQA 3NWTA 4Y4RA 2V26A 3HM5A 4WK8F 3GW2A 3I54A 3OYIA 1SFXA 3HOXJ 6PAXA 2H6CA 1VQLI 3S17J 3S32A 5D4RA 1W1WE 1A36A 3M07A 2QQAA 1ZHFA 3Q0VA 4JYKA 1P6RA 3E6MA 2LNBA 2W25A 2XRLA 4HF2A 1FTTA 1DPUA 2A5WA 4PSWA 4E6KG 4JX4A 1LVKA 3CLQA 2HYFA 3J7ZI 2NS0A 1BI0A 4RB0A 5L3DA 4GRIA 3BT9A 3CCYA 3BG9A 2KIQA 3SEZA 3WTYC 2GQQA 5J4YA 2V1UA 3R0JA 4UNOA 3RDIA 1RETA 4D9JA 4XONA 4OIQF 1BR1A 1B9NA 2MGQA 2BE5F 2HFHA 3T5XA 2KPMA 2VIXA 3IP4B 2R7TA 2STWA 2HOAA 2XROA 3ZQLA 1IN5A 4KITB 1JHHA 2FA5A 2KL4A 4XN3A 4PK4A 4JQFA 1YJWI 2BY2A 2HDWA 4MO7A 4BACA 1ENHA 5H6QA 1YRNA 1T95A 2ZXIA 3ZMZA 4A2UA 4GCVA 1JUPA 2JRMA 1G3SA 1AHDP 4MEXF 2ZJRF 4DYRA 2JRTA 3WE2A 5IYBJ 1NH3A 3MWMA 4YRVA 1EH6A 3T8RA 2QA4I 3DTEA 4L5EA 3PQJA 2R5YB 4V2GA 3J81K 1GXPA 3PL8A 3DPUA 1A6IA 2XAHA 2ZMEA 2PX9A 2R7ZJ 1HDPA 5EDNA 4IL6C 3TP3A 5M5XJ 3DV8A 1R4NB 5EGOA 3A2KA 1IRZA 3ABUA 2JZYA 2Z2SB 2RDPA 2WBMA 3OIPA 3RQIA 4MNUA 3BTLA 2I10A 1AU7A 1VQNI 1JUSA 1SD5A 4LJZF 3MD2A 3PUFA 1FP2A 2UUZA 5CVJA 4CGZA 2CW8A 2E1CA 4MFEA 2L4AA 1XMAA 4FTHA 1YHQI 4FHTA 2EA2A 1CF7B 2IP2A 3BR6A 2W4SA 5FKMA 1IXSB 1ETVA 1BJAA 2VUMJ 4Y15A 5FROA 5LFAA 3N05A 2DCEA 2LY1A 3OYCA 2ZO4A 4BJTA 1HQCA 5B66C 3QOPA 2PMZA 4B3AA 3RYPA 3OYLA 1VQ6I 1V5FA 2QM3A 3RYRA 3S15J 1P7JA 2R7OA 1QZZA 2DK5A 5EJCA 1QZEA 4CZZA 3BR5A 5DCMB 1PP8F 1BM9A 2VE9A 3HUGB 5TISC 5HLIA 2G9WA 2OD5A 1W0UA 4XQFA 4XKWA 1MDMA 1OR7C 1WJCA 3HL2A 3HPHA 2XAJA 3OWTA 1YW9A 1J7KA 2EFQA 1MMGA 2KRFA 3IH2A 5J4VA 5LD2C 3LMMA 1BI3A 3LAPA 1F9NA 3RPQA 2TRTA 3LSRA 1ITYA 5CKTA 5CLSA 3W6KB 1IXCA 4D7MA 5KHDA 1FYMA 2O8XA 1D1AA 2EJRA 3MZ8A 2EFPA 1ZRDA 1ZLJA 4BEHA 1VZ0A 1P4XA 3GLXA 4HG2A 3CP8A 1XMKA 4I0BA 3CCQI 1W4MA 5EYRA 4CO8A 1G3YA 1TLHB 1UMQA 5DCFA 5L3EA 1MKMA 2CYYA 4J01A 1YOVB 2DK8A 2M7BA 5HLHA 4A3JJ 2BVMA 3K10A 4RB1A 2LKSA 1E0EA 2PQ8A 2V4JC 5DS9A 1XSXA 2W82A 1Z7UA 4CZCA 3P9CA 2Y0MA 4ETSA 2XPVA 2H1LA 3HGYA 4KIBA 1XSDA 5LEKA 3OR1C 3EUAA 1OYWA 3AFHA 3HRUA 3E5QA 3QPLA 4NDLA 5FKLA 3KYDB 2WY7Q 3ZN1A 1JJ8C 2MW8A 1H89C 2W00A 3H1CA 1UJ8A 4QPOA 4W97A 2DMTA 3WG7H 2HS5A 1ZQ3P 2R7UA 2K86A 2I5UA 4HV6A 4LLNA 3GZ5A 5FB2A 5K1YA 2LLKA 2QSHX 3JTGA 2DQLA 1F4KA 4IOAF 3IAS2 3EDPA 9ANTA 3B73A 3F8NA 3SQNA 2P5VA 3B6AA 2CUFA 2XGXA 3WTWC 5IYCJ 3CDHA 4Q47A 2F4IA 4AU7A 4A6DA 4ESFA 2EV6A 3QOEA 3NARA 3SJMA 2KHMA 3KP2A 2XAFA 4DW6A 2BY3A 3J7AY 4BY1J 2ESNA 2R3SA 4RBOA 1TWFJ 2E7WA 2Y31A 1WWXA 2XB5A 4OOIA 3HOVJ 4LLLA 3I5UA 2Z16A 5HDNA 3L9FA 3VB2A 4CA0A 3J81Z 2RAEA 4NB5A 5IOYA 5ILVA 2H27A 2YPRA 2LRDA 3U1KA 4XRSA 4RLQA 1E2XA 4YFXF 1XGNA 3M8JA 1LEAA 4RGSA 5LGNA 1ZG1A 3GTLJ 1TWHJ 2DA2A 3SYTA 4JK1X 4RGRA 2FNAA 4U7BA 2IS6A 2X6OA 3VSLA 4U0VA 1K4SA 3GTKJ 3BY6A 4IXAA 4BDZA 3GTMJ 1GVJA 2FJ1A 4DIQA 1LKXA 3CCSI 1VQ5I 2OBPA 3JTHA 1RNLA 2Z9OA 2E2HJ 3A0HC 5J47A 2F5CA 4IHTA 2QQBA 1SVLA 1U5TA 3E7LA 2K3PA 2QCOA 3OOUA 4RMNA 3A01B 1A5JA 2H09A 1LE8B 2CQKA 1UHSA 5BMZA 1B1BA 5E8GA 4KMUX 3OS1A 2CO5A 5HLGA 4IRGA 1D0XA 2G7UA 2L7FP 5ICFA 1KQ8A 2DT5A 2EIKH 1OKRA 3LNQA 4G8XA 1I50J 2A3SA 1H88C 3GTOJ 5BPIA 2QGUA 1PUEE 2H1KA 2KZVA 4EM1A 3HHGA 1QVTA 1W36C 3DF8A 5K5RA 2JVGA 3S1NJ 2NVUB 1ZG3A 4D5FA 4NBQA 2DT7B 3GFLA 3NWSA 4M3DA 3ZMSA 4HV5A 4Z2YA 5BOXA 1KU2A 3LL7A 5C4JJ 4ZJZA 3OL4A 4I01A 1HF0A 4IHYA 1FX7A 1IRXA 2DT6A 3CMMA 3FM3A 2COBA 4HSTA 3I55I 3R6SA 3WU0A 4OAYA 3MKWB 1GHCA 3I4MJ 4BQQA 2Q2EA 3ABKH 4FETA 1RESA 3LSJA 2MC3A 2W57A 2KDZA 2NOJB 4X6AJ 3KZYA 3LOCA 2HGCA 1IDYA 2V6EA 1OCTC 3CCJI 4OAZA 4RB3C 1XCVA 4ENJA 1HBXG 4IO9F 2DOAA 2XKPA 4EJTA 1MBKA 2Z5UA 4A3EJ 4A3LJ 2WADA 1VQMI 4MLOA 2NXNB 1YRNB 2E5NA 5C4XJ 2CQQA 2VB6A 2A6HF 2JPCA 3C1DA 3HYIA 4CCMA 2P81A 4CH7A 1SMTA 2R7XA 2EH3A 2VKDA 2W85A 1HW1A 2IS4A 3E3VA 1G6NA 4A5MA 3CCMI 2Y9YA 2DMQA 2PJPA 2ME6A 1FLIA 4XKCA 1P9QC 2COMA 4BY7J 1PDNC 1D0YA 2BVLA 1CGPA 1MMAA 2P6TA 3PNYA 1ZH5A 1E3PA 3GBGA 4LIUA 1QU3A 5L3FA 3JCUC 2DU9A 3I64A 1I3QJ 2RQQA 4YFKF 3JRGA 3FZVA 2ZMEB 1OYIA 3S2WA 1N25A 1R00A 2VQCA 1KGSA 5D5XB 2Q8KA 3GFMA 5IT3A 2Z99A 3BR0A 5EGOB 1J75A 1F5TA 4UY8I 4UVCA 5KAFC 1O3TA 1EV7A 2R7DA 5D6EA 1IGNA 3H9GA 3OSGA 2MLGA 3CCRI 3WTXC 3O2PE 4B09A 2LTPA 1OPCA 2OUMA 4MQVA 3ZRGA 1QPMA 2DJIA 5KAIC 2JQ7A 1IUFA 3X2QH 1K78B 1ETWA 1YTYA 4WXDA 4IQJA 2W48A 1E17A 2HXOA 1B8IA 2L9RA 4BU2A 5F6FA 4Y3OA 2HZDA 4Q5SF 3H5NA 5J1UA 2VPRA 1IW7F 3AG1H 1MBGA 3WODF 4JX6A 4A3FJ 2R7QA 2V1XA 3Q3SA 3S1RJ 3BCBA 3CC7I 2AXLA 1K83J 1MNEA 3H3ZA 1DP3A 2HPMA 2HU9A 2ZNYA 3DU6A 2QEXI 1N77A 3QP5A 4M72A 4U88A 4FX4A 3TL4X 2DOFA 2PMUA 4BS9A 3M4OJ 1D3YA 1TQMA 1Z77A 1S8NA 5JVGF 3KEOA 1MDMB 2HOEA 2UXNA 3FHZA 1N78A 2DTZA 4B4CA 4UUSA 1BW5A 3GF2A 4PFOA 3CC2I 5FLVA 2D1VA 1APLC 3DBLB 3J80K 3OL3A 1U0JA 3A1YA 3SEQA 5CVUA 4CUGA 2KQRA 3FM5A 4HLXA 4BEHB 1VF9A 2TCTA 3FXQA 2ZMEC 3JRDA 1D1CA 2RV8A 2CUEA 3QWLA 3PIOF 5D5UB 3R0AA 3PFYA 4LK1F 2XGDA 1XGSA 1YS7A 2ELHA 1BI1A 3WHBA 5DM7F 3F6VA 4KUMA 1FNNA 3RKYA 2A05A 2WAQN 1K6YA 4L9JA 5F0HA 3D0SA 2L5QA 4XSXF 4E7ZA 2IPQX 2K02A 2OJED 2QVOA 4IX7A 1BR2A 1BJZA 4LG3A 1FOKA 3VFZA 2R7FA 3R60A 3LFKA 3CDIA 1KZHA 1RKWA 3MCZA 4AWXB 3FWEA 3RTRA 2E19A 3GEZA 2X85A 3I59A 3S3OA 1W7PA 3K1MA 2VKHA 2LFBA 4DZPA 4P55A 3TW6A 2L0KA 3BC8A 2LK2A 2RREA 3AG2H 4RAFA 2X48A 2R4GA 3ERMA 3FBIB 4D1QA 4C3JJ 3BWGA 4MTEA 2VE8A 3BJAA 2XSDC 1IN7A 3OYBA 3LSKA 3ZR8X 4BQOA 1GT0C 1WJ5A 2BGCA 4IZZA 1QPIA 3HKZA 3O3KA 3OYDA 1BIAA 2GIVA 3DQVC 2QYOA 3EPZA 3ISPA 3D1NI 1ZGWA 1RUNA 1DGRM 5HS9A 2LBFB 1SFOJ 1IO2A 1HSTA 4HX4A 3P9KA 2P5KA 2IS2A 4J00A 4FISA 4C3IJ 2ETHA 4ENKA 4BHPA 4LGWA 3F23A 1O3RA 4QLCU 1MJBA 3BPXA 1LJ9A 2L02A 4UUVA 5EEGA 2KP6A 5GPAA 1O3SA 1KYWA 4U7DA 5L3GA 1ON1A 2BHZA 2JVHA 1A31A 2LR8A 1ZARA 5GTIC 3L1PA 1EJ9A 1C0WA 2VJIA 3I0TA 1W7PD 4M9XA 3L2UA 1NG6A 3FMRA 5F1RA 3GTPJ 2BY1A 1JI8A 3V7CA 1U8BA 1OCOH 5HDGA 2V1NA 3CMAI 1X19A 3ZOBA 1MW7A 3VYSB 1OMIA 1UFMA 1R49A 3AG3H 3RKXA 1HKQA 3K7AJ 1IJWC 3REOA 2VT2A 4A0YA 1STZA 2XHKA 3MZYA 2DPUA 1AWCA 3Q9VA 4NC6A 2JK3A 1T8IA 2DMPA 1SAXA 2FE3A 3HOZJ 2O6GE 4NC8A 5E1ZB 1HKTA 1J0RA 1JT6A 2KJCA 2E60A 5K7FA 4PCQA 5HNHA 1U5TB 5LEJA 5EZHA 4HDVA 4ENMA 1WSUA 4HRIA 1LB2A 5IP6A 5D6FA 3HSEA 4IEJA 2L01A 4C30A 4BHCA 4C3HJ 1RR8C 1SVMA 2QLZA 4BBRJ 3H0DA 4M6YA 1FIPA 4QTRA 1W36D 1TC3C 2DW4A 2OZ6A 1X1DA 3VDXA 2E71A 3K69A 3L7WA 1K6OA 3NAUA 1RUOA 4PJJA 3G1LA 2L9VA 3S1MJ 2EV0A 2HQNA 5GP9A 2FD5A 1GVDA 2XGCA 2YS9A 3H5AA 1YI2I 1GV2A 3S14J 2XVCA 2LMDA 4ZDPA 1BR4A 2ISYA 1R23A 1POGA 3JRIA 2I8DA 4B48A 3F3XA 1EF4A 4UHTA 1A6QA 1MBFA 1HW2A 2CQ7A 2JA6J 2VBWA 2MD0A 5GAGJ 2P4WA 2DA7A 3SZPA 3GYHX 1FT9A 4OIPF 2X4HA 2L2OA 3LA2A 3J80Z 2LP0A 2M3AA 2XAGA 5D4SA 2KRHA 2XUBA 2OC6A 3DKWA 1FBQA 4K2EA 1XGMA 2OA4A 1RC9A 4DGWB 5HOOA 3PSIA 4CSWA 4FCYA 2Q2EB 2GA2A 2XAQA 2LSOA 3K6GA 1SMYF 1MD0A 5KCMA 3QYFA 3F8BA 2HOSA 2O9LA 3L2CA 4BQAA 2OQGA 4E7JA 1SD7A 1R7JA 4KFCA 4M3EA 3G2BA 1S7AA 2ACJA 2ZBKA 3TO9A 3RCOA 3T1BA 2IGNA 4JOMA 5LRRA 2CSOA 4D0PA 1R5ID 4LFUA 1DU0A 1U5TC 1KYZA 3S3MA 2X1CA 3T0YA 4DNCA 1FPQA 1P4WA 3E1SA 2YX4A 3ROUA 3ECHA 1FY7A 3TP0A 5M5WJ 1SVOA 2FEZA 4XLFA 2GXBA 3ZMUA 3HIFA 5C44J 4GO1A 1QGPA 5LHIA 4E4HA 3FIWA 2CS3A 4ZYDA 4E7IA 2XF6A 3WU2C 2F48A 4LITA 3IKTA 2E5ZA 3K1PA 4LIVA 3HDDA 1Z1DA 1BOAA 1ERDA 2QKMB 1X2MA 2WV0A 3CJNA 1RIOH 3G3ZA 5CVVA 4XIDA 2E2JJ 3B6CA 3VSKA 3H3UA 4LG0A 4L0YB 4M6VA 5LLQA 5JLXA 2A61A 3H92A 3TOBA 3N4MA 1X4PA 1IV8A 2X9DA 3HBLA 1JKPC 2NVXJ 4Y33A 2CW0F 5F0FA 4PJMA 2LYCA 1FEXA 3BDDA 3QRFF 3DP7A 1OQYA 2F4MB 2QKLB 3DTIA 3SDBA 1W5TA 2EWNA 3TDUC 2NAZA 1QBJA 4HLYA 3PM1A 1IC8A 3UR3C 5IPAA 4YELA 4NUBA 1OCCH 1ZR4A 3G1OA 4AIJA 2FMYA 2X6WA 3G71I 2HPIA 4I76A 4DZJA 3Q5FA 1KQ9A 3CD6I 1F43A 2DFIA 4IPAA 2XC7A 1EA3A 2XDVA 3K4NA 5DD4A 2MLKA 3WGGA 3H35A 4UUSB 3KPHA 5H20A 3L2RA 4F93B 3ABLH 3MAJA 2RQPA 3FBNB 3CF5F 2ZJPF 2Y30A 1JKRC 3U9GA 2XRNA 3S8PA 3W6VA 1B59A 3DCFA 1ZGJA 1Z6TA 3GMEA 4FE4A 1Y39A 3FMQA 1P92A 2VBYA 4BXUA 3PNVA 4MFDA 2CV0A 4P96A 2V9VA 3CDLA 4BL0B 2K9MA 1DQUA 2C6YA 1JTXA 1JKOC 4XKVA 3QU3A 4B43A 3QQAA 2A6TA 1YJNI 1SFUA 4M74A 3LSTA 3TMOA 5E1XA 1GLNA 2HKOA 1JE8A 4N0BA 2RN7A 4U0WA 4X1EA 2PBIA 3ESWB 3CO6C 1S6LA 2DO7A 1P7IA 4UV8A 1D1BA 4I09A 3BG6A 2ADUA 3TGNA 4P9FA 3VYUB 2HVRA 3I59B 1W7PB 3GVAA 1NHAA 2HQAA 3CF2A 4RGXA 1Q1VA 1FBUA 2M5WA 3LFUA 4L9VA 2CH0A 5IP9J 2JA2A 5J3LA 5CYVA 1PP7U 2VC0A 1B72A 5ILSA 1WI9A 1WFXA 3FISA 1T0FA 2VBZA 2RC4A 2F5FA 3EQLF 4XLHA 5ICGA 2D45A 1QA6A 4M3BA 2VKEA 1KU9A 1OLTA 2RVCA 4LLGF 5FKOA 1SFEA 2QQ8A 3JAMK 2IRFG 2IGMA 2DI3A 1G59A 1ZKGA 3S2HJ 2K27A 5GTHC 2XB0X 4EJVA 3IH4A 2NVTJ 4EJOA 3QPSA 4CCNA 3KYCB 3KP3A 3AAFA 3KZZA 1BBYA 3ZGKA 2IGKA 5B1BH 2XIGA 2M8EA 2YX7A 3HRSA 5KNLA 4EV0A 3QYEA 2A68F 3I3LA 3OYFA 1QO0D 1X1CA 5M5YJ 3I58A 1Y0NA 3KE2A 3SDGA 3WTZA 2OCEA 2J5OA 4O3MA 1V3FA 4MEYF 4S05A 5LHGA 2CFOA 2E1OA 3PO3J 1IUYA 2R7SA 2YR2A 3L09A 5FD5A 4KISA 1R36A 4UVBA 2HVSA 1ZELA 4FE7A 2M4GA 1Y8QB 3IRRA 2OAZA 1I1SA 4LK0F 1JHFA 5EG0A 3QPTA 2KKOA 2LC2A 4J19A 2K9QA 5E18F 4OMZA 2RNGA 1Y8RB 3CUQC 1LVAA 4CDGA 1IV6A 1N75A 2GWRA 5CQGA 1IRGA 2ZCWA 3EUHA 5DV5A 3GCMA 4A3MJ 3F8MA 3I56I 3WGIA 4KYWA 3CQZJ 5F27A 5DTDA 1ORKA 1H9TA 3LSGA 2DDBA 1OCPA 4B1RA 2DQRA 4CHUA 2R5ZA 2FF4A 2L54A 2M0CA 2EINH 5IP7J 3C3WA 2O7OA 5FLMJ 2STTA 1MMDA 3PNTA 4HX7A 1R6RA 1O7FA 1TP4A 1Z3YA 3OS0A 2R7RA 3KEYA 2CU7A 4IVNA 1OJLA 4M73A 3ZQIA 4CCLA 1RR7A 1IAWA 1Z91A 3S1QJ 2ID6A 2DA1A 2VN2A 3KCCA 4OIOF 3C2HA 2MFZA 2VJJA 2KLOA 4UB8C 2VJ4A 5HDKA 2BBYA 1Y0UA 2CGPA 1XD7A 3OIOA 1VI0A 4P5OA 1IXRC 3WU1B 2K9SA 4HQMA 4XORA 1ZREA 5FRNA 1E3OC 3ZQCA 2FQ4A 3A02A 4GXOA 3E5XA 2WB1N 2F2EA 1XSVA 4L5IA 1F1ZA 4CXFA 3FXLA 1V4RA 5B5EC 4LMYA 4N9IA 4L18B 3CJRB 2GBYA 1IRFA 3C18A 4HYEA 2O8KA 3W2WA 3KFWX 1U6GA 1YQAA 5DYMA 3WG9A 3L2QA 3H9QA 3ELKA 1Q1HA 5LHHA 2D2WA 5D8KB 3TKYA 4G7HF 3H3VK 2K9LA 4M3GA 3ZCOA 1YE9A 4RS8A 2L7KA 5JVTA 3QPHA 3MKLA 3M7GA 1T39A 3PFIA 3S3NA 5LBQA 4A12A 1HDDC 4U87A 4XMYA 3QYBA 4KIGA 3WTSC 2FQ3A 1X58A 4H4KC 2LKXA 1MH3A 2F5DA 4BBSJ 2B7EA 3E6CC 2MC4A 4HNTA 1DDNA 1FTZA 3HPGA 1WGXA 2HKXA 2K5CA 2M0MA 4F52A 1Z7LA 3G73A 4DYCA 3GTQJ 4OINF 1USSA 2V9KA 2XSJC 4NHJA 4HF1A 3GZ6A 4XN0A 3BR1A 1ACIA 4IOCF 1BA5A 4G7ZF 3F0CA 4KN4X 2NNNA 4A5NA 4CYCA 2IAIA 4G12A 3JSPA 1WVRA 2EK5A 2M9HA 1GDTA 2Y0SN 2X6XA 1JT0A 1QHHD 4EJUA 1LDJA 1TT5B 2HZTA 3LSPA 3ONQA 2KIFA 4GYIA 1XCBA 3KIOA 3F21A 5JR3A 3BROA 4QWQA 4PJNA 1TW2A 2DBBA 2DYRH 2VXZA 4I0AA 3WTVC 5DUIA 3BG3A 4AD9A 3OYGA 3ZP5A 3JAMZ 2IW5A 2FBHA 3ZMDA 3JRBA 2WY8Q 1FJLA 2VOPA 2ZFUA 2P6SA 2R7WA 4E7SA 1U9OA 4R1HA 4U0YA 2UZKA 3E5UA 4Z6YA 1UCRA 1WJFA 2PJRA 3HG9A 4A69C 3C2BA 4RA2A 2JWTA 1F36A 3OSFA 3SFIA 2ISZA 2K4BA 2CJJA 1L0OC 4XR6A 3C7JA 2CRGA 1ZRCA 1UHWA 3U21A 1Y1VJ 1K61A 1AKHA 3DLAA 3E97A 2GAUA 1ZK8A 2IS1A 1P4AA 2ZB9A 1XG1A 1HSJA 4RLFA 4IHSA 2NVQJ 2W24A 3PQKA 3DBHB 4YIRX 1W0TA 3W2VA 2R5YA 3LA3A 4EEFG 2EB7A 4DBRA 3F72A 5ERIA 1JGGA 3H5RA 2LF7A 5IT9K 2VBXA 4BE2A 2YU3A 3E6BA 3S2DJ 2BOLA 2CWEA 1YYVA 2IBDA 3IAM2 4QIWN 4OMYA 3BJ6A 5JHUA 2FBIA 2P8TA 1A35A 3W6JB 1MH4A 2O03A 4Y13A 1RI7A 5E3MA 4KICA 5EEAA 1I1GA 3HOWJ 4RAYA 5FFZA 1SD4A 4IKFA 5HVQC 1OCRH 5DDGA 3OIQA 5E3NA 3U1DA 4UXNA 2HDDA 2KFDA 1T98A 3FF5A 5K5OA 4MHGA 2JA8J 1A04A 5A2QK 2JMWA 3MFKA 1CF7A 1U78A 4HSRA 3WGHA 3CP2A 3Q0WA 3V4GA 4B44A 4F91B 1WJEA 2F6CA 1U2WA 1G2HA 3CESA 3V8JA 3S93A 3KP6A 4UUTA 2ZSIB 2YSRA 2NRAC 2EA4A 4W1UA 3H36A 4XRSG 2CV2A 4AYBN 1MIJA 1ZAOA 5M3MJ 2OQRA 1Z67A 2VI6A 4E70A 1SFKA 4ASNA 5FKKA 1EH8A 3M3YJ 5DCMA 4I2OA 3CUQA 4ZYHA 2KIUA 3M1EA 4CCOA 5HODA 4A3DJ 1VQ4I 2V79A 2X6YA 3K4LA 3BZKA 3VPRA 2Y9ZA 3K2ZA 1R71A 4HDUA 4RAZA 5HNFA 4S0HB 3IC7A 4BNCA 1B72B 4BJ5C 2QENA 2WWYA 2G7HA 1TW3A 2V7FA 2MG4A 3JRFA 2E34A 4GGGA 2JUCA 2EZIA 2OCCH 2MD5A 1WJAA 4II3A 2EFWA 2EQRA 3NQOA 3K9TA 4I02A 1YG2A 2O5RA 4L0ZB 3J7AO 1XGOA 2ECBA 2VL8A 2OPTA 4EJWA 1MMNA 2W1OA 1L3LA 4XRMA 3RZDJ 2IA2A 2A6EF 5TJJA 5AONA 3BPVA 3D5LA 3GZNB 4ZZLA 4IHWA 1PJRA 2BV6A 4MGRA 2DLLA 2HOTA 2B0LA 2JJ7A 1RPWA 2PN6A 5J40A 1ZRFA 3CCVI 1VQ9I 4KMFA 2AS5F 4HEA2 2VXDA 1X3UA 2CQXA 3NEUA 4XLEA 1XPXA 4A3KJ 1T38A 1XDUA 1NG7A 1MJAA 2DMUA 3D5SC 1U3EM 4AIKA 2LY2A 4PGGA 4DQ2A 3VWBA 4YEJA 3DKYA 4RB2C 4PJLA 3OYJA 2W7NA 3GO5A 2E1MB 5EG0B 3BLYA 2YUSA 2DYSH 2HQ5A 4ZC3A 4XSZF 5CVIA 3ASNH 2Y75A 3GWZA 3AG4H 2DJNA 2WAQA 4R79A 2ZXHA 1Y56A 4BGDA 3HC7A 3IHUA 2K85A 1OISA 2ICWG 3BQYA 4E7LA 2BEOA 2R5ZB 1R4MB 1TTYA 3VYTB 1VNDA 2WAFA 2ZXWH 4F92B 1MGTA 2VKVA 1RKTA 1XDSA 2EPFA 1X2NA 3ABMH 5E20A 3HSRA 1YFHA 3IWFA 5BNGA 2M45A 3M8FA 3L00A 1T0FC 1TBXA 1Z21A 1S29A 1ZYRF 4EQQA 4FASD 4RGUA 4UVAA 3MQ0A 4KA4A 1FOWA 1GUUA 4EVIA 1Z0XA 5EF6A 1R1VA 4S04A 4PDKA 4JBAA 1ON2A 1BW6A 5IT9Z 4HA8A 1Z3XA 1JGSA 4BJ6C 2DPDA 3MMYB 2ZNZA 1UG2A 1DU6A 1NTCA 1HW5A 1ZG5A 4RM3A 1PYVA 1H0MA 4H0EA 4BE1A 2AHQA 4M9ZA 1MJ9A 4UV9A 1RZ4A 1UAAA 5JFRA 3MEXA 2A69F 1T56A 4XM3A 4A6EA 1AA7A 5F1JA 3O8HA 1KQ0A 4M3FA 3SZGA 1TWCJ 3BZ6A 1KU7A 3BR3A 2HWVA 2FBKA 2KJBA 3LWFA 2A07F 2DDAA 4IHVA 1FWZA 1SAUA 3SZTA 2EILH 2E1MC 2TDXA 1MMSA 4A3IJ 1R58A 3BTCA 2M87A 3ZQHA 1HKSA 3EUHC 4I6ZA 2VPLA 1IN6A 4MQ9F 2XF7A 3ZMVA 3UNGC 2NVYJ 3VOEA 5J8FA 3MZHA 1ZLKA 1D8JA 2E36A 1QRYA 5E17F 2HDCA 1ETOA 5H6RA 3ULQB 4D7NA 4V19K 4EATA 2Y2ZA 4XNFA 3CO7C 2CV1A 2IT0A 1QZYA 1FBSA 2IA1A 4BAYA 1YLFA 2ECCA 3BCAA 4CYCB 3HRMA 3M1CA 2R7VA 3CTAA 3QP6A 4M9SA 1LFBA 3SFZA 2XPWA 3BR2A 3I9V2 4AUXA 2ZKZA 1TWGJ 5ICEA 1G4DA 2K9NA 4AVPA 1YIOA 2CFXA 3OYEA 2ZJ2A 2VQHA 5FKNA 2IJLA 2JA5J 3NRVA 5FLXK 3A0BC 4XRFA 1JXSA 2NNYA 4KT6A 1QNTA 1YJ9I 2B63J 5J8CA 2GM4A 1DP7P 1T2KA 2PMZN 2VODA 2M7AA 2MH2A 1LDDA 1W5CC 2DFHA 2EFOA 3FXOA 3L2VA 1WHUA 2KT0A 5KVRA 2BY0A 1XN7A 2PJRB 4ZDOA 1XX5A 3WTTC 2DA5A 2XV4S 5K7HA 5J1RA 4A93J 2AQEA 3K4JA 2CW7A 1WH7A 4EGZA 1BOBA 2NYXA 4P9UA 1YW8A 3GTJJ 2EFNA 2NS8A 2UXXA 1AKHB 5TRDA 1R1TA 1XS9A 3OMYA 2EIMH 1S72I 1HLVA 1FP1D 1MNDA 2ZXJA 3G4SI 3GLLA 1MBJA 3DKXA 1B8IB 2IGOA 4KT5C 4X0GA 1PUFA 3ZXSA 1BL0A 1G3TA 4XL9A 1UB9A 2XF5A 1VQPI 2OTJI 1TQPA 4ESJA 5B3SH 4HBLA 3JRAA 3CJQB 4IJAA 4GFBA 4Y17A 2K3FA 1FZPB 3K1NA 2D1HA 5E1WA 5IYDJ 1IG7A 2UV1A 4IRIA 1LEBA 2BZTA 4ZYEA 4AIHA 3PSFA 3RZOJ 4KJZA 2V6CA 3QODA 5ICCA 4UB6C 3FXKA 3TOAA 2DXIA 1I6XA 1DGWY 5FO5A 2BHYA 1ONVA 4HW0A 1LPQA 1IN8A 3ML6A 5CQEA 2E35A 4L5JA 3CCLI 1K78A 1YS6A 4ZDLA 4EM2A 3ZQ7A 4CCKA 2GZWA 4QPQA 1GXQA 2HNHA 1DUXC 1JUMA 1SD6A 3JRHA 1VTNC 3K2AA 2JUGA 1KA8A 2V1DA 2LKPA 3DPLC 2PI0A 4ZH4F 1KONA 1M1EB 4G94A 1B4AA 5E8IA 4A3GJ 2BXZA 1WJDA 4RAGA 4FQGA 1ZTRA 2DFFA 3F8CA 2HR3A 4BXXJ 2GIZA 3B02A 1ETYA 2P7VB 2QBYA 3CLOA 3WTUC 2E1NA 1I39A 2MABA 2YU9J 2WTEA 4NQWA 3HOSA 3GX4X 3SXYA 4BXFA 1VQOI 2FOKA 1MSFC 3PO2J 2DMNA 3CUQB 1R9TJ 4QSHA 4GDFA 3RQ4A 4CICA 3RI4A 2HVQA 1J5YA 4C2UA 1SEUA 2BW3A 2EBIA 4HF0A 4ZZDA 3K70C 2CQNA 4F7ZA 2GXGA 3Q9SA 1YX3A 3ABTA 3CMYA 3W3CA 2M8GX 2X0LA 2JSPA 1MZBA 3DEUA 2EZHA 4DJAA 1MBEA 1B6AA 4KN7X 5E79C 1UG0A 1Z9CA 2DFEA 4C9YA 3K4MA 5F0CA 3HTSB 2EIJH 1V5EA 1X1PA 4BQNA 2JTVA 5BQTA 1WJBA 5D5VB 2F5EA 2QQ9A 4ZTFA 2E7XA 3M8EA 3P9IA 1D5YA 4OWRB 4FT8A 2Q1ZB 5F08A 3IUOA 2E2IJ 4DOZA 1GV5A 2LDUA 2M30A 5DEQA 1XMXA 1FMVA 3DWLE 4CYDA 4M6XA 4II2A 1R5GA 2LOOA 3V8KA 3R4KA 4AVZA 3OYKA 3V42A 4HZFA 1S7EA 3FDYA 4L9TA 3ZMTA 3OY9A 1D0ZA 2L7ZA 4DBQA 1U9NA 1O7LA 4XOTA 4XICA 4Y52J 2B9SA 3LSMA 2LY9A 2VC1A 3MN2A 3G6EI 3CCEI 5BPDA 2RGVA 4HQEA
chains in the Genus database with same CATH topology
1BIBA 5FLXZ 2WC2A 2ZFWA 4IRHA 4MTDA 4M71A 3LQRA 1O3QA 2L3DA 3OOPA 2P5LC 2M1BA 5D8LB 1FC3A 5L3BA 4EMSA 2HYGD 2JT1A 1D5VA 1BC7C 4L9NA 3KP7A 2JPBA 3ZPLA 3RJPA 5L3CA 2O0YA 3RIRA 5DD8A 4WXHA 4WCGA 3U2RA 3QAHA 1IF1A 4BYYA 4HOBA 3HHHA 2VONA 2BYVE 1QQIA 1U8RA 3VEPA 4IF4A 3VODA 5BS6A 3HTUA 3TDZC 5FGMA 2JSCA 1TQIA 3N97A 1BC8C 1LQ1A 1H9GA 2IA0A 4I98B 1G3WA 3V7RA 3HRTA 2K4JA 4GYGA 4XBFA 3GUDA 1REPC 4O6JA 2PG4A 2O3FA 2P7CB 1WRJA 3M9AA 2HTJA 4ESBA 2CG4A 3ECOA 1HXDA 3K0LA 3RPUA 3FXUA 3LA7A 2PEXA 4LD5A 1YW7A 4ON0A 3V7SA 5J6XA 4KIFA 3F22A 1WQ2A 3FMSA 4A0XA 5LGTA 2HQRA 4G6DA 1TNTA 4YIIA 5CJ9A 1FYLA 3GFIA 3QU6A 3RKWA 4KNYA 4BH9A 3LAJA 5KK1A 3TO7A 3F8FA 3ERED 5AIPA 2PMHA 2FU4A 2ESHA 1WKMA 2VOOA 3TO6A 1ODDA 4FX0A 3LQQA 4B8XA 1OYYA 5AIQA 1R5HA 4LG0B 1DPRA 3DFGA 2LF8A 1OR7A 2K7LA 3TQNA 2QUFA 3DPTA 4XLNF 3IRQA 1K79A 2L4MA 3P7NA 2UWMA 3OV8A 2EV5A 1BN5A 1BI2A 3GFJA 3KP4A 3V8LA 2H94A 5JI6A 4N9HA 5LRSA 2FXAA 1FSEA 1P2FA 2MH9A 2QWWA 5CVRA 5D5WB 4WXCA 1J2XA 1KU3A 1R22A 2FRHA 4PZJA 3HOTA 4G7OF 1XB4A 4BHBA 3I4PA 4PGHA 1IN4A 2FMLA 5F64A 3F6OA 4Q48A 1J59A 2QBYB 1LNWA 1USTA 2OZUA 2FNPA 4HX8A 1I5ZA 4HAMA 5EEHA 5LGUA 2Z33A 1ULYA 4YG2F 3JSOA 4ZYGA 4TV7A 4WX9A 3BP8A 2QZ8A 5FD6A 3HUGA 1O57A 1J9IA 1UHMA 2IVMA 3IKVA 3EYIA 4XLPF 3IL2A 1FSHA 4WF2A 4A0ZA 1LDKB 5K5QA 1ZN2A 3ZN0A 3KP5A 2J5PA 4YFNF 2MA3A 1K7AA 5HS7A 1R1UA 1AOYA 3HSFA 3COAC 1TNSA 4G9YA 4LB5A 3EYYA 2W84A 2XKOA 1B9MA 2HTSA 2Z3YA 3FX3A 2FSWA 2DAOA 2GA1A 3FXRA 5DUKA 1T6SA 2XASA 3IWZA 4G6QA 2Q0OA 4LB6B 4R8HA 3T8TA 3I71A 4WWCA 1Z6RA 5ED4A 1FYKA 3O6BB 3EETA 1EH7A 3GXOA 2DTRA 4OU0A 3CUOA 2Y48A 1D8KA 2VT3A 4Q4ZF 2KIMA 3I53A 3R61A 1YO5C 2HEOA 1W5SA 3KLNA 4KDPA 3BJOA 2RNJA 4EGYA 2RKHA 3KETA 1IZ1A 2A5YB 3E6DA 4YIFA 4ENNA 2O61A 4O5VA 1I27A 1ZGAA 2MBFA 3WE3A 5HS8A 5ILUA 4I7HA 3DXJF 1Z05A 2H6BA 5FFXA 3SHFA 1S3JA 5A2QZ 3BOQA 4OIRF 2PFBA 4EM0B 3KLOA 1S7OA 3JW4A 2PLYA 2OU2A 3KEQA 4WK8F 3GW2A 3I54A 1SFXA 6PAXA 2H6CA 5D4RA 2QQAA 1ZHFA 1P6RA 3E6MA 2LNBA 2W25A 4HF2A 1DPUA 2HYFA 2NS0A 1BI0A 4RB0A 5L3DA 3WTYC 2GQQA 2V1UA 3R0JA 4UNOA 3RDIA 4OIQF 1B9NA 3T5XA 2BE5F 2HFHA 2STWA 2XROA 1IN5A 1JHHA 2FA5A 4JQFA 5H6QA 3ZMZA 4A2UA 4GCVA 1G3SA 4MEXF 2JRTA 3WE2A 3MWMA 1EH6A 3T8RA 3PQJA 3J81K 1GXPA 2XAHA 2ZMEA 3DV8A 3ABUA 2JZYA 2RDPA 4MNUA 1SD5A 4LJZF 1FP2A 5CVJA 4CGZA 2E1CA 2L4AA 1XMAA 4FHTA 2EA2A 1CF7B 2IP2A 1IXSB 1BJAA 4Y15A 2ZO4A 1HQCA 3QOPA 3RYPA 2QM3A 3RYRA 1QZZA 2DK5A 4CZZA 5DCMB 1PP8F 1BM9A 2VE9A 5HLIA 2G9WA 2OD5A 1MDMA 2XAJA 1YW9A 1J7KA 2EFQA 2KRFA 1BI3A 3LAPA 1F9NA 3RPQA 5CLSA 3W6KB 1IXCA 1FYMA 2O8XA 2EJRA 2EFPA 1ZRDA 1ZLJA 1P4XA 3GLXA 1XMKA 4I0BA 1W4MA 4CO8A 1G3YA 1TLHB 5DCFA 5L3EA 1MKMA 2CYYA 2DK8A 5HLHA 4RB1A 2PQ8A 1XSXA 1Z7UA 3P9CA 2Y0MA 4ETSA 4KIBA 1XSDA 5LEKA 1OYWA 3HRUA 3E5QA 3ZN1A 2HS5A 2K86A 4HV6A 4LLNA 3GZ5A 5FB2A 5K1YA 3JTGA 2DQLA 1F4KA 3EDPA 3B73A 3F8NA 3SQNA 2P5VA 2XGXA 3WTWC 3CDHA 4Q47A 4A6DA 4ESFA 2EV6A 3KP2A 2XAFA 2ESNA 2R3SA 2E7WA 4OOIA 1WWXA 4LLLA 3I5UA 5HDNA 3L9FA 3VB2A 3J81Z 4NB5A 5ILVA 2H27A 2YPRA 1E2XA 4YFXF 1XGNA 4RGSA 1LEAA 5LGNA 1ZG1A 4JK1X 4RGRA 4U7BA 2FNAA 4U0VA 3BY6A 4IXAA 1GVJA 2OBPA 3JTHA 1RNLA 2Z9OA 2F5CA 4IHTA 2QQBA 1U5TA 2H09A 2CQKA 5BMZA 1B1BA 5E8GA 4KMUX 2CO5A 5HLGA 4IRGA 2G7UA 5ICFA 1KQ8A 2DT5A 1OKRA 4G8XA 2A3SA 5BPIA 1PUEE 4EM1A 3HHGA 3DF8A 5K5RA 1ZG3A 3GFLA 3ZMSA 4HV5A 4Z2YA 5BOXA 1KU2A 4I01A 1FX7A 3FM3A 3R6SA 3WU0A 1GHCA 2Q2EA 2MC3A 2W57A 3KZYA 2HGCA 4RB3C 1XCVA 4ENJA 1HBXG 2XKPA 4EJTA 2Z5UA 2A6HF 2JPCA 3C1DA 3HYIA 1SMTA 2W85A 1HW1A 3E3VA 1G6NA 4A5MA 2PJPA 1FLIA 2COMA 1PDNC 1CGPA 2P6TA 1ZH5A 5L3FA 2DU9A 3I64A 4YFKF 3FZVA 2ZMEB 1OYIA 3S2WA 1R00A 1KGSA 5D5XB 2Q8KA 3GFMA 5IT3A 2Z99A 1J75A 1F5TA 4UVCA 1O3TA 1EV7A 2R7DA 5D6EA 2MLGA 3WTXC 3O2PE 4B09A 1OPCA 4MQVA 1QPMA 1K78B 1YTYA 4WXDA 1E17A 5F6FA 4Q5SF 1IW7F 3WODF 2V1XA 2AXLA 3H3ZA 2ZNYA 3QP5A 4M72A 4U88A 4FX4A 2PMUA 1D3YA 1TQMA 1S8NA 3KEOA 1MDMB 2HOEA 2UXNA 3FHZA 3GF2A 2D1VA 3J80K 5CVUA 3FM5A 4HLXA 3FXQA 2RV8A 5D5UB 3R0AA 4LK1F 1XGSA 1YS7A 2ELHA 1BI1A 3F6VA 4KUMA 1FNNA 3RKYA 4L9JA 3D0SA 4XSXF 2IPQX 2K02A 2QVOA 1FOKA 3VFZA 2R7FA 3R60A 3LFKA 3MCZA 4AWXB 3FWEA 3RTRA 3GEZA 3I59A 1W7PA 3K1MA 4P55A 3BWGA 4MTEA 2VE8A 3BJAA 1IN7A 2BGCA 3O3KA 1BIAA 2GIVA 3DQVC 2QYOA 3ISPA 1RUNA 5HS9A 4HX4A 1HSTA 3P9KA 2P5KA 2ETHA 4ENKA 4BHPA 4LGWA 3F23A 1O3RA 4QLCU 1MJBA 3BPXA 1LJ9A 2L02A 4UUVA 5EEGA 1O3SA 1KYWA 4U7DA 5L3GA 1ON1A 1ZARA 1C0WA 3I0TA 1W7PD 4M9XA 3FMRA 5F1RA 3V7CA 5HDGA 1OMIA 1UFMA 3RKXA 1HKQA 3REOA 2VT2A 4A0YA 1STZA 2XHKA 3MZYA 2DPUA 1AWCA 3Q9VA 1SAXA 2FE3A 2O6GE 5E1ZB 1HKTA 1J0RA 2KJCA 4ENMA 4PCQA 1U5TB 5LEJA 4HDVA 1WSUA 1LB2A 5D6FA 3HSEA 2L01A 4BHCA 2QLZA 4M6YA 2DW4A 2OZ6A 3K69A 3L7WA 1K6OA 1RUOA 2EV0A 2HQNA 2XVCA 2ISYA 1R23A 3F3XA 4UHTA 1HW2A 2VBWA 2P4WA 3SZPA 3GYHX 1FT9A 4OIPF 2X4HA 3LA2A 3J80Z 2XAGA 5D4SA 2XUBA 3DKWA 1FBQA 4K2EA 1XGMA 2OA4A 5HOOA 2GA2A 2XAQA 2LSOA 1SMYF 1MD0A 3F8BA 3L2CA 4BQAA 2OQGA 1SD7A 1R7JA 4KFCA 1S7AA 2ACJA 2ZBKA 3TO9A 3T1BA 5LRRA 2CSOA 4D0PA 4LFUA 1U5TC 1KYZA 3T0YA 4DNCA 1FPQA 1P4WA 2YX4A 3ROUA 3ECHA 1FY7A 2FEZA 2GXBA 3ZMUA 3HIFA 4GO1A 1QGPA 5LHIA 4ZYDA 3IKTA 3K1PA 1Z1DA 1BOAA 2WV0A 3CJNA 1RIOH 3G3ZA 5CVVA 3H3UA 4LG0A 4L0YB 5LLQA 2A61A 3H92A 3TOBA 3N4MA 2CW0F 3BDDA 3QRFF 3DP7A 1W5TA 2EWNA 3TDUC 2NAZA 1QBJA 4HLYA 4AIJA 2FMYA 3Q5FA 1KQ9A 2DFIA 4IPAA 5DD4A 2MLKA 3WGGA 5H20A 3MAJA 2RQPA 3U9GA 2XRNA 1B59A 1ZGJA 1Z6TA 4BXUA 3FMQA 1P92A 2VBYA 4P96A 2V9VA 2C6YA 3QU3A 1SFUA 4M74A 3LSTA 5E1XA 2HKOA 1JE8A 4N0BA 2RN7A 4U0WA 2PBIA 3CO6C 1S6LA 2DO7A 4UV8A 4I09A 2ADUA 3TGNA 4P9FA 3I59B 1W7PB 3GVAA 1NHAA 4RGXA 1FBUA 2M5WA 4L9VA 1PP7U 5CYVA 2VC0A 5ILSA 1WI9A 1T0FA 2VBZA 2RC4A 2F5FA 3EQLF 5ICGA 2D45A 1KU9A 2RVCA 4LLGF 1SFEA 3JAMK 2IRFG 2DI3A 2K27A 4EJVA 4EJOA 3KP3A 3AAFA 3KZZA 1BBYA 2XIGA 2M8EA 2YX7A 3HRSA 4EV0A 2A68F 1QO0D 3I58A 3KE2A 3WTZA 4O3MA 2J5OA 1V3FA 4MEYF 4S05A 5LHGA 1IUYA 2YR2A 3L09A 5FD5A 1R36A 4UVBA 3IRRA 1I1SA 2OAZA 4LK0F 1JHFA 3QPTA 2KKOA 5E18F 4OMZA 3CUQC 1LVAA 4CDGA 2GWRA 1IRGA 2ZCWA 3EUHA 5DV5A 3F8MA 4KYWA 3WGIA 1H9TA 2DQRA 4CHUA 2FF4A 2L54A 3C3WA 2STTA 4HX7A 1O7FA 4IVNA 4M73A 1IAWA 1Z91A 2VN2A 3KCCA 4OIOF 5HDKA 2BBYA 1Y0UA 2CGPA 1XD7A 4P5OA 1IXRC 3WU1B 4HQMA 1ZREA 4GXOA 3E5XA 2F2EA 1XSVA 4L5IA 1F1ZA 4CXFA 1V4RA 4LMYA 4N9IA 4L18B 1IRFA 3C18A 4HYEA 3KFWX 1U6GA 1YQAA 5DYMA 3WG9A 3ELKA 1Q1HA 5LHHA 2D2WA 5D8KB 4G7HF 3TKYA 4RS8A 5JVTA 3QPHA 3M7GA 1T39A 3PFIA 5LBQA 4A12A 3WTSC 4KIGA 2FQ3A 2F5DA 3E6CC 1DDNA 2HKXA 3G73A 4OINF 1USSA 4NHJA 4HF1A 3GZ6A 4G7ZF 4KN4X 2NNNA 4A5NA 3JSPA 2EK5A 4EJUA 1LDJA 2HZTA 2KIFA 4GYIA 1XCBA 3F21A 5JR3A 3BROA 4QWQA 1TW2A 2DBBA 2VXZA 4I0AA 3WTVC 5DUIA 4AD9A 3ZP5A 3JAMZ 2IW5A 3ZMDA 2FBHA 2VOPA 2P6SA 4R1HA 4U0YA 2UZKA 3E5UA 1UCRA 2ISZA 2K4BA 1L0OC 3C7JA 1ZRCA 1UHWA 3E97A 2GAUA 1P4AA 1HSJA 4IHSA 2W24A 3PQKA 3LA3A 2EB7A 3F72A 5ERIA 2LF7A 5IT9K 2VBXA 2YU3A 3E6BA 2CWEA 1YYVA 4OMYA 3BJ6A 5JHUA 2FBIA 2P8TA 3W6JB 2O03A 4Y13A 1RI7A 4KICA 1I1GA 4RAYA 5FFZA 1SD4A 5HVQC 5DDGA 3U1DA 4UXNA 1T98A 3FF5A 5K5OA 4MHGA 1A04A 5A2QK 1CF7A 3MFKA 1U78A 3WGHA 3V4GA 1U2WA 3V8JA 3KP6A 2YSRA 2NRAC 2EA4A 1ZAOA 2OQRA 4E70A 4ASNA 1EH8A 5DCMA 4I2OA 3CUQA 4ZYHA 2KIUA 3M1EA 2V79A 3K2ZA 4HDUA 4RAZA 3IC7A 4BNCA 2QENA 2WWYA 2G7HA 1TW3A 4GGGA 2MD5A 2EFWA 3NQOA 3K9TA 4I02A 1YG2A 4L0ZB 3J7AO 1XGOA 4EJWA 1L3LA 2IA2A 2A6EF 5TJJA 5AONA 3BPVA 3D5LA 4ZZLA 2BV6A 4MGRA 2DLLA 2B0LA 2PN6A 1ZRFA 4KMFA 2AS5F 1X3UA 3NEUA 1T38A 1XDUA 1MJAA 1U3EM 4AIKA 4PGGA 4DQ2A 4RB2C 3GO5A 4XSZF 5CVIA 2Y75A 3GWZA 4R79A 3IHUA 2BEOA 1TTYA 1MGTA 1XDSA 5E20A 3HSRA 1YFHA 3IWFA 2M45A 3M8FA 3L00A 1TBXA 4EQQA 1S29A 1ZYRF 4RGUA 4UVAA 3MQ0A 4KA4A 4EVIA 1R1VA 4S04A 4PDKA 4JBAA 1ON2A 5IT9Z 4HA8A 1JGSA 2DPDA 2ZNZA 1HW5A 1ZG5A 1H0MA 4H0EA 4M9ZA 1MJ9A 4UV9A 1RZ4A 5JFRA 3MEXA 2A69F 4A6EA 1KQ0A 3BZ6A 1KU7A 2HWVA 2FBKA 2KJBA 3LWFA 2A07F 1FWZA 3SZTA 2TDXA 1R58A 2M87A 1HKSA 1IN6A 4MQ9F 3ZMVA 5J8FA 3VOEA 1ZLKA 3MZHA 1D8JA 5E17F 2HDCA 5H6RA 3ULQB 3CO7C 2IT0A 1QZYA 1FBSA 2IA1A 4BAYA 1YLFA 3HRMA 3CTAA 3QP6A 4M9SA 3SFZA 2ZKZA 5ICEA 1G4DA 4AVPA 1YIOA 2CFXA 2ZJ2A 2IJLA 3NRVA 5FLXK 4XRFA 1JXSA 2NNYA 1QNTA 5J8CA 1DP7P 1T2KA 2VODA 2MH2A 1LDDA 2EFOA 5KVRA 1XN7A 3WTTC 2XV4S 4EGZA 2NYXA 4P9UA 1YW8A 2EFNA 2UXXA 5TRDA 1R1TA 1FP1D 2ZXJA 4KT5C 1G3TA 1UB9A 1TQPA 4ESJA 4HBLA 4IJAA 4Y17A 1FZPB 3K1NA 2D1HA 5E1WA 4IRIA 1LEBA 4ZYEA 4AIHA 2V6CA 5ICCA 3TOAA 1I6XA 5FO5A 1ONVA 4HW0A 1IN8A 3ML6A 4L5JA 1K78A 1YS6A 4EM2A 3ZQ7A 2GZWA 1GXQA 1DUXC 1SD6A 1VTNC 1KA8A 2V1DA 2LKPA 3DPLC 2PI0A 4ZH4F 4G94A 1B4AA 5E8IA 3F8CA 2HR3A 3B02A 2P7VB 2QBYA 3CLOA 3WTUC 2E1NA 2WTEA 4NQWA 3HOSA 3GX4X 3SXYA 2FOKA 3CUQB 4CICA 3RI4A 1J5YA 4HF0A 4ZZDA 4F7ZA 2GXGA 3Q9SA 3ABTA 2X0LA 1MZBA 3DEUA 1B6AA 4KN7X 1Z9CA 3HTSB 2JTVA 5BQTA 5D5VB 2F5EA 2QQ9A 2E7XA 3M8EA 3P9IA 4FT8A 2LDUA 2M30A 5DEQA 4CYDA 4M6XA 1R5GA 3V8KA 3R4KA 4HZFA 4L9TA 3ZMTA 1O7LA 2VC1A 5BPDA 2RGVA 4HQEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BIB A;  5FLX Z;  2WC2 A;  2ZFW A;  4IRH A;  4MTD A;  4M71 A;  3LQR A;  1O3Q A;  2L3D A;  3OOP A;  2P5L C;  2M1B A;  5D8L B;  1FC3 A;  5L3B A;  4EMS A;  2HYG D;  2JT1 A;  1D5V A;  1BC7 C;  4L9N A;  3KP7 A;  2JPB A;  3ZPL A;  3RJP A;  5L3C A;  2O0Y A;  3RIR A;  5DD8 A;  4WXH A;  4WCG A;  3U2R A;  3QAH A;  1IF1 A;  4BYY A;  4HOB A;  3HHH A;  2VON A;  2BYV E;  1QQI A;  1U8R A;  3VEP A;  4IF4 A;  3VOD A;  5BS6 A;  3HTU A;  3TDZ C;  5FGM A;  2JSC A;  1TQI A;  3N97 A;  1BC8 C;  1LQ1 A;  1H9G A;  2IA0 A;  4I98 B;  1G3W A;  3V7R A;  3HRT A;  2K4J A;  4GYG A;  4XBF A;  3GUD A;  1REP C;  4O6J A;  2PG4 A;  2O3F A;  2P7C B;  1WRJ A;  3M9A A;  2HTJ A;  4ESB A;  2CG4 A;  3ECO A;  1HXD A;  3K0L A;  3RPU A;  3FXU A;  3LA7 A;  2PEX A;  4LD5 A;  1YW7 A;  4ON0 A;  3V7S A;  5J6X A;  4KIF A;  3F22 A;  1WQ2 A;  3FMS A;  4A0X A;  5LGT A;  2HQR A;  4G6D A;  1TNT A;  4YII A;  5CJ9 A;  1FYL A;  3GFI A;  3QU6 A;  3RKW A;  4KNY A;  4BH9 A;  3LAJ A;  5KK1 A;  3TO7 A;  3F8F A;  3ERE D;  5AIP A;  2PMH A;  2FU4 A;  2ESH A;  1WKM A;  2VOO A;  3TO6 A;  1ODD A;  4FX0 A;  3LQQ A;  4B8X A;  1OYY A;  5AIQ A;  1R5H A;  4LG0 B;  1DPR A;  3DFG A;  2LF8 A;  1OR7 A;  2K7L A;  3TQN A;  2QUF A;  3DPT A;  4XLN F;  3IRQ A;  1K79 A;  2L4M A;  3P7N A;  2UWM A;  3OV8 A;  2EV5 A;  1BN5 A;  1BI2 A;  3GFJ A;  3KP4 A;  3V8L A;  2H94 A;  5JI6 A;  4N9H A;  5LRS A;  2FXA A;  1FSE A;  1P2F A;  2MH9 A;  2QWW A;  5CVR A;  5D5W B;  4WXC A;  1J2X A;  1KU3 A;  1R22 A;  2FRH A;  4PZJ A;  3HOT A;  4G7O F;  1XB4 A;  4BHB A;  3I4P A;  4PGH A;  1IN4 A;  2FML A;  5F64 A;  3F6O A;  4Q48 A;  1J59 A;  2QBY B;  1LNW A;  1UST A;  2OZU A;  2FNP A;  4HX8 A;  1I5Z A;  4HAM A;  5EEH A;  5LGU A;  2Z33 A;  1ULY A;  4YG2 F;  3JSO A;  4ZYG A;  4TV7 A;  4WX9 A;  3BP8 A;  2QZ8 A;  5FD6 A;  3HUG A;  1O57 A;  1J9I A;  1UHM A;  2IVM A;  3IKV A;  3EYI A;  4XLP F;  3IL2 A;  1FSH A;  4WF2 A;  4A0Z A;  1LDK B;  5K5Q A;  1ZN2 A;  3ZN0 A;  3KP5 A;  2J5P A;  4YFN F;  2MA3 A;  1K7A A;  5HS7 A;  1R1U A;  1AOY A;  3HSF A;  3COA C;  1TNS A;  4G9Y A;  4LB5 A;  3EYY A;  2W84 A;  2XKO A;  1B9M A;  2HTS A;  2Z3Y A;  3FX3 A;  2FSW A;  2DAO A;  2GA1 A;  3FXR A;  5DUK A;  1T6S A;  2XAS A;  3IWZ A;  4G6Q A;  2Q0O A;  4LB6 B;  4R8H A;  3T8T A;  3I71 A;  4WWC A;  1Z6R A;  5ED4 A;  1FYK A;  3O6B B;  3EET A;  1EH7 A;  3GXO A;  2DTR A;  4OU0 A;  3CUO A;  2Y48 A;  1D8K A;  2VT3 A;  4Q4Z F;  2KIM A;  3I53 A;  3R61 A;  1YO5 C;  2HEO A;  1W5S A;  3KLN A;  4KDP A;  3BJO A;  2RNJ A;  4EGY A;  2RKH A;  3KET A;  1IZ1 A;  2A5Y B;  3E6D A;  4YIF A;  4ENN A;  2O61 A;  4O5V A;  1I27 A;  1ZGA A;  2MBF A;  3WE3 A;  5HS8 A;  5ILU A;  4I7H A;  3DXJ F;  1Z05 A;  2H6B A;  5FFX A;  3SHF A;  1S3J A;  5A2Q Z;  3BOQ A;  4OIR F;  2PFB A;  4EM0 B;  3KLO A;  1S7O A;  3JW4 A;  2PLY A;  2OU2 A;  3KEQ A;  4WK8 F;  3GW2 A;  3I54 A;  1SFX A;  6PAX A;  2H6C A;  5D4R A;  2QQA A;  1ZHF A;  1P6R A;  3E6M A;  2LNB A;  2W25 A;  4HF2 A;  1DPU A;  2HYF A;  2NS0 A;  1BI0 A;  4RB0 A;  5L3D A;  3WTY C;  2GQQ A;  2V1U A;  3R0J A;  4UNO A;  3RDI A;  4OIQ F;  1B9N A;  3T5X A;  2BE5 F;  2HFH A;  2STW A;  2XRO A;  1IN5 A;  1JHH A;  2FA5 A;  4JQF A;  5H6Q A;  3ZMZ A;  4A2U A;  4GCV A;  1G3S A;  4MEX F;  2JRT A;  3WE2 A;  3MWM A;  1EH6 A;  3T8R A;  3PQJ A;  3J81 K;  1GXP A;  2XAH A;  2ZME A;  3DV8 A;  3ABU A;  2JZY A;  2RDP A;  4MNU A;  1SD5 A;  4LJZ F;  1FP2 A;  5CVJ A;  4CGZ A;  2E1C A;  2L4A A;  1XMA A;  4FHT A;  2EA2 A;  1CF7 B;  2IP2 A;  1IXS B;  1BJA A;  4Y15 A;  2ZO4 A;  1HQC A;  3QOP A;  3RYP A;  2QM3 A;  3RYR A;  1QZZ A;  2DK5 A;  4CZZ A;  5DCM B;  1PP8 F;  1BM9 A;  2VE9 A;  5HLI A;  2G9W A;  2OD5 A;  1MDM A;  2XAJ A;  1YW9 A;  1J7K A;  2EFQ A;  2KRF A;  1BI3 A;  3LAP A;  1F9N A;  3RPQ A;  5CLS A;  3W6K B;  1IXC A;  1FYM A;  2O8X A;  2EJR A;  2EFP A;  1ZRD A;  1ZLJ A;  1P4X A;  3GLX A;  1XMK A;  4I0B A;  1W4M A;  4CO8 A;  1G3Y A;  1TLH B;  5DCF A;  5L3E A;  1MKM A;  2CYY A;  2DK8 A;  5HLH A;  4RB1 A;  2PQ8 A;  1XSX A;  1Z7U A;  3P9C A;  2Y0M A;  4ETS A;  4KIB A;  1XSD A;  5LEK A;  1OYW A;  3HRU A;  3E5Q A;  3ZN1 A;  2HS5 A;  2K86 A;  4HV6 A;  4LLN A;  3GZ5 A;  5FB2 A;  5K1Y A;  3JTG A;  2DQL A;  1F4K A;  3EDP A;  3B73 A;  3F8N A;  3SQN A;  2P5V A;  2XGX A;  3WTW C;  3CDH A;  4Q47 A;  4A6D A;  4ESF A;  2EV6 A;  3KP2 A;  2XAF A;  2ESN A;  2R3S A;  2E7W A;  4OOI A;  1WWX A;  4LLL A;  3I5U A;  5HDN A;  3L9F A;  3VB2 A;  3J81 Z;  4NB5 A;  5ILV A;  2H27 A;  2YPR A;  1E2X A;  4YFX F;  1XGN A;  4RGS A;  1LEA A;  5LGN A;  1ZG1 A;  4JK1 X;  4RGR A;  4U7B A;  2FNA A;  4U0V A;  3BY6 A;  4IXA A;  1GVJ A;  2OBP A;  3JTH A;  1RNL A;  2Z9O A;  2F5C A;  4IHT A;  2QQB A;  1U5T A;  2H09 A;  2CQK A;  5BMZ A;  1B1B A;  5E8G A;  4KMU X;  2CO5 A;  5HLG A;  4IRG A;  2G7U A;  5ICF A;  1KQ8 A;  2DT5 A;  1OKR A;  4G8X A;  2A3S A;  5BPI A;  1PUE E;  4EM1 A;  3HHG A;  3DF8 A;  5K5R A;  1ZG3 A;  3GFL A;  3ZMS A;  4HV5 A;  4Z2Y A;  5BOX A;  1KU2 A;  4I01 A;  1FX7 A;  3FM3 A;  3R6S A;  3WU0 A;  1GHC A;  2Q2E A;  2MC3 A;  2W57 A;  3KZY A;  2HGC A;  4RB3 C;  1XCV A;  4ENJ A;  1HBX G;  2XKP A;  4EJT A;  2Z5U A;  2A6H F;  2JPC A;  3C1D A;  3HYI A;  1SMT A;  2W85 A;  1HW1 A;  3E3V A;  1G6N A;  4A5M A;  2PJP A;  1FLI A;  2COM A;  1PDN C;  1CGP A;  2P6T A;  1ZH5 A;  5L3F A;  2DU9 A;  3I64 A;  4YFK F;  3FZV A;  2ZME B;  1OYI A;  3S2W A;  1R00 A;  1KGS A;  5D5X B;  2Q8K A;  3GFM A;  5IT3 A;  2Z99 A;  1J75 A;  1F5T A;  4UVC A;  1O3T A;  1EV7 A;  2R7D A;  5D6E A;  2MLG A;  3WTX C;  3O2P E;  4B09 A;  1OPC A;  4MQV A;  1QPM A;  1K78 B;  1YTY A;  4WXD A;  1E17 A;  5F6F A;  4Q5S F;  1IW7 F;  3WOD F;  2V1X A;  2AXL A;  3H3Z A;  2ZNY A;  3QP5 A;  4M72 A;  4U88 A;  4FX4 A;  2PMU A;  1D3Y A;  1TQM A;  1S8N A;  3KEO A;  1MDM B;  2HOE A;  2UXN A;  3FHZ A;  3GF2 A;  2D1V A;  3J80 K;  5CVU A;  3FM5 A;  4HLX A;  3FXQ A;  2RV8 A;  5D5U B;  3R0A A;  4LK1 F;  1XGS A;  1YS7 A;  2ELH A;  1BI1 A;  3F6V A;  4KUM A;  1FNN A;  3RKY A;  4L9J A;  3D0S A;  4XSX F;  2IPQ X;  2K02 A;  2QVO A;  1FOK A;  3VFZ A;  2R7F A;  3R60 A;  3LFK A;  3MCZ A;  4AWX B;  3FWE A;  3RTR A;  3GEZ A;  3I59 A;  1W7P A;  3K1M A;  4P55 A;  3BWG A;  4MTE A;  2VE8 A;  3BJA A;  1IN7 A;  2BGC A;  3O3K A;  1BIA A;  2GIV A;  3DQV C;  2QYO A;  3ISP A;  1RUN A;  5HS9 A;  4HX4 A;  1HST A;  3P9K A;  2P5K A;  2ETH A;  4ENK A;  4BHP A;  4LGW A;  3F23 A;  1O3R A;  4QLC U;  1MJB A;  3BPX A;  1LJ9 A;  2L02 A;  4UUV A;  5EEG A;  1O3S A;  1KYW A;  4U7D A;  5L3G A;  1ON1 A;  1ZAR A;  1C0W A;  3I0T A;  1W7P D;  4M9X A;  3FMR A;  5F1R A;  3V7C A;  5HDG A;  1OMI A;  1UFM A;  3RKX A;  1HKQ A;  3REO A;  2VT2 A;  4A0Y A;  1STZ A;  2XHK A;  3MZY A;  2DPU A;  1AWC A;  3Q9V A;  1SAX A;  2FE3 A;  2O6G E;  5E1Z B;  1HKT A;  1J0R A;  2KJC A;  4ENM A;  4PCQ A;  1U5T B;  5LEJ A;  4HDV A;  1WSU A;  1LB2 A;  5D6F A;  3HSE A;  2L01 A;  4BHC A;  2QLZ A;  4M6Y A;  2DW4 A;  2OZ6 A;  3K69 A;  3L7W A;  1K6O A;  1RUO A;  2EV0 A;  2HQN A;  2XVC A;  2ISY A;  1R23 A;  3F3X A;  4UHT A;  1HW2 A;  2VBW A;  2P4W A;  3SZP A;  3GYH X;  1FT9 A;  4OIP F;  2X4H A;  3LA2 A;  3J80 Z;  2XAG A;  5D4S A;  2XUB A;  3DKW A;  1FBQ A;  4K2E A;  1XGM A;  2OA4 A;  5HOO A;  2GA2 A;  2XAQ A;  2LSO A;  1SMY F;  1MD0 A;  3F8B A;  3L2C A;  4BQA A;  2OQG A;  1SD7 A;  1R7J A;  4KFC A;  1S7A A;  2ACJ A;  2ZBK A;  3TO9 A;  3T1B A;  5LRR A;  2CSO A;  4D0P A;  4LFU A;  1U5T C;  1KYZ A;  3T0Y A;  4DNC A;  1FPQ A;  1P4W A;  2YX4 A;  3ROU A;  3ECH A;  1FY7 A;  2FEZ A;  2GXB A;  3ZMU A;  3HIF A;  4GO1 A;  1QGP A;  5LHI A;  4ZYD A;  3IKT A;  3K1P A;  1Z1D A;  1BOA A;  2WV0 A;  3CJN A;  1RIO H;  3G3Z A;  5CVV A;  3H3U A;  4LG0 A;  4L0Y B;  5LLQ A;  2A61 A;  3H92 A;  3TOB A;  3N4M A;  2CW0 F;  3BDD A;  3QRF F;  3DP7 A;  1W5T A;  2EWN A;  3TDU C;  2NAZ A;  1QBJ A;  4HLY A;  4AIJ A;  2FMY A;  3Q5F A;  1KQ9 A;  2DFI A;  4IPA A;  5DD4 A;  2MLK A;  3WGG A;  5H20 A;  3MAJ A;  2RQP A;  3U9G A;  2XRN A;  1B59 A;  1ZGJ A;  1Z6T A;  4BXU A;  3FMQ A;  1P92 A;  2VBY A;  4P96 A;  2V9V A;  2C6Y A;  3QU3 A;  1SFU A;  4M74 A;  3LST A;  5E1X A;  2HKO A;  1JE8 A;  4N0B A;  2RN7 A;  4U0W A;  2PBI A;  3CO6 C;  1S6L A;  2DO7 A;  4UV8 A;  4I09 A;  2ADU A;  3TGN A;  4P9F A;  3I59 B;  1W7P B;  3GVA A;  1NHA A;  4RGX A;  1FBU A;  2M5W A;  4L9V A;  1PP7 U;  5CYV A;  2VC0 A;  5ILS A;  1WI9 A;  1T0F A;  2VBZ A;  2RC4 A;  2F5F A;  3EQL F;  5ICG A;  2D45 A;  1KU9 A;  2RVC A;  4LLG F;  1SFE A;  3JAM K;  2IRF G;  2DI3 A;  2K27 A;  4EJV A;  4EJO A;  3KP3 A;  3AAF A;  3KZZ A;  1BBY A;  2XIG A;  2M8E A;  2YX7 A;  3HRS A;  4EV0 A;  2A68 F;  1QO0 D;  3I58 A;  3KE2 A;  3WTZ A;  4O3M A;  2J5O A;  1V3F A;  4MEY F;  4S05 A;  5LHG A;  1IUY A;  2YR2 A;  3L09 A;  5FD5 A;  1R36 A;  4UVB A;  3IRR A;  1I1S A;  2OAZ A;  4LK0 F;  1JHF A;  3QPT A;  2KKO A;  5E18 F;  4OMZ A;  3CUQ C;  1LVA A;  4CDG A;  2GWR A;  1IRG A;  2ZCW A;  3EUH A;  5DV5 A;  3F8M A;  4KYW A;  3WGI A;  1H9T A;  2DQR A;  4CHU A;  2FF4 A;  2L54 A;  3C3W A;  2STT A;  4HX7 A;  1O7F A;  4IVN A;  4M73 A;  1IAW A;  1Z91 A;  2VN2 A;  3KCC A;  4OIO F;  5HDK A;  2BBY A;  1Y0U A;  2CGP A;  1XD7 A;  4P5O A;  1IXR C;  3WU1 B;  4HQM A;  1ZRE A;  4GXO A;  3E5X A;  2F2E A;  1XSV A;  4L5I A;  1F1Z A;  4CXF A;  1V4R A;  4LMY A;  4N9I A;  4L18 B;  1IRF A;  3C18 A;  4HYE A;  3KFW X;  1U6G A;  1YQA A;  5DYM A;  3WG9 A;  3ELK A;  1Q1H A;  5LHH A;  2D2W A;  5D8K B;  4G7H F;  3TKY A;  4RS8 A;  5JVT A;  3QPH A;  3M7G A;  1T39 A;  3PFI A;  5LBQ A;  4A12 A;  3WTS C;  4KIG A;  2FQ3 A;  2F5D A;  3E6C C;  1DDN A;  2HKX A;  3G73 A;  4OIN F;  1USS A;  4NHJ A;  4HF1 A;  3GZ6 A;  4G7Z F;  4KN4 X;  2NNN A;  4A5N A;  3JSP A;  2EK5 A;  4EJU A;  1LDJ A;  2HZT A;  2KIF A;  4GYI A;  1XCB A;  3F21 A;  5JR3 A;  3BRO A;  4QWQ A;  1TW2 A;  2DBB A;  2VXZ A;  4I0A A;  3WTV C;  5DUI A;  4AD9 A;  3ZP5 A;  3JAM Z;  2IW5 A;  3ZMD A;  2FBH A;  2VOP A;  2P6S A;  4R1H A;  4U0Y A;  2UZK A;  3E5U A;  1UCR A;  2ISZ A;  2K4B A;  1L0O C;  3C7J A;  1ZRC A;  1UHW A;  3E97 A;  2GAU A;  1P4A A;  1HSJ A;  4IHS A;  2W24 A;  3PQK A;  3LA3 A;  2EB7 A;  3F72 A;  5ERI A;  2LF7 A;  5IT9 K;  2VBX A;  2YU3 A;  3E6B A;  2CWE A;  1YYV A;  4OMY A;  3BJ6 A;  5JHU A;  2FBI A;  2P8T A;  3W6J B;  2O03 A;  4Y13 A;  1RI7 A;  4KIC A;  1I1G A;  4RAY A;  5FFZ A;  1SD4 A;  5HVQ C;  5DDG A;  3U1D A;  4UXN A;  1T98 A;  3FF5 A;  5K5O A;  4MHG A;  1A04 A;  5A2Q K;  1CF7 A;  3MFK A;  1U78 A;  3WGH A;  3V4G A;  1U2W A;  3V8J A;  3KP6 A;  2YSR A;  2NRA C;  2EA4 A;  1ZAO A;  2OQR A;  4E70 A;  4ASN A;  1EH8 A;  5DCM A;  4I2O A;  3CUQ A;  4ZYH A;  2KIU A;  3M1E A;  2V79 A;  3K2Z A;  4HDU A;  4RAZ A;  3IC7 A;  4BNC A;  2QEN A;  2WWY A;  2G7H A;  1TW3 A;  4GGG A;  2MD5 A;  2EFW A;  3NQO A;  3K9T A;  4I02 A;  1YG2 A;  4L0Z B;  3J7A O;  1XGO A;  4EJW A;  1L3L A;  2IA2 A;  2A6E F;  5TJJ A;  5AON A;  3BPV A;  3D5L A;  4ZZL A;  2BV6 A;  4MGR A;  2DLL A;  2B0L A;  2PN6 A;  1ZRF A;  4KMF A;  2AS5 F;  1X3U A;  3NEU A;  1T38 A;  1XDU A;  1MJA A;  1U3E M;  4AIK A;  4PGG A;  4DQ2 A;  4RB2 C;  3GO5 A;  4XSZ F;  5CVI A;  2Y75 A;  3GWZ A;  4R79 A;  3IHU A;  2BEO A;  1TTY A;  1MGT A;  1XDS A;  5E20 A;  3HSR A;  1YFH A;  3IWF A;  2M45 A;  3M8F A;  3L00 A;  1TBX A;  4EQQ A;  1S29 A;  1ZYR F;  4RGU A;  4UVA A;  3MQ0 A;  4KA4 A;  4EVI A;  1R1V A;  4S04 A;  4PDK A;  4JBA A;  1ON2 A;  5IT9 Z;  4HA8 A;  1JGS A;  2DPD A;  2ZNZ A;  1HW5 A;  1ZG5 A;  1H0M A;  4H0E A;  4M9Z A;  1MJ9 A;  4UV9 A;  1RZ4 A;  5JFR A;  3MEX A;  2A69 F;  4A6E A;  1KQ0 A;  3BZ6 A;  1KU7 A;  2HWV A;  2FBK A;  2KJB A;  3LWF A;  2A07 F;  1FWZ A;  3SZT A;  2TDX A;  1R58 A;  2M87 A;  1HKS A;  1IN6 A;  4MQ9 F;  3ZMV A;  5J8F A;  3VOE A;  1ZLK A;  3MZH A;  1D8J A;  5E17 F;  2HDC A;  5H6R A;  3ULQ B;  3CO7 C;  2IT0 A;  1QZY A;  1FBS A;  2IA1 A;  4BAY A;  1YLF A;  3HRM A;  3CTA A;  3QP6 A;  4M9S A;  3SFZ A;  2ZKZ A;  5ICE A;  1G4D A;  4AVP A;  1YIO A;  2CFX A;  2ZJ2 A;  2IJL A;  3NRV A;  5FLX K;  4XRF A;  1JXS A;  2NNY A;  1QNT A;  5J8C A;  1DP7 P;  1T2K A;  2VOD A;  2MH2 A;  1LDD A;  2EFO A;  5KVR A;  1XN7 A;  3WTT C;  2XV4 S;  4EGZ A;  2NYX A;  4P9U A;  1YW8 A;  2EFN A;  2UXX A;  5TRD A;  1R1T A;  1FP1 D;  2ZXJ A;  4KT5 C;  1G3T A;  1UB9 A;  1TQP A;  4ESJ A;  4HBL A;  4IJA A;  4Y17 A;  1FZP B;  3K1N A;  2D1H A;  5E1W A;  4IRI A;  1LEB A;  4ZYE A;  4AIH A;  2V6C A;  5ICC A;  3TOA A;  1I6X A;  5FO5 A;  1ONV A;  4HW0 A;  1IN8 A;  3ML6 A;  4L5J A;  1K78 A;  1YS6 A;  4EM2 A;  3ZQ7 A;  2GZW A;  1GXQ A;  1DUX C;  1SD6 A;  1VTN C;  1KA8 A;  2V1D A;  2LKP A;  3DPL C;  2PI0 A;  4ZH4 F;  4G94 A;  1B4A A;  5E8I A;  3F8C A;  2HR3 A;  3B02 A;  2P7V B;  2QBY A;  3CLO A;  3WTU C;  2E1N A;  2WTE A;  4NQW A;  3HOS A;  3GX4 X;  3SXY A;  2FOK A;  3CUQ B;  4CIC A;  3RI4 A;  1J5Y A;  4HF0 A;  4ZZD A;  4F7Z A;  2GXG A;  3Q9S A;  3ABT A;  2X0L A;  1MZB A;  3DEU A;  1B6A A;  4KN7 X;  1Z9C A;  3HTS B;  2JTV A;  5BQT A;  5D5V B;  2F5E A;  2QQ9 A;  2E7X A;  3M8E A;  3P9I A;  4FT8 A;  2LDU A;  2M30 A;  5DEQ A;  4CYD A;  4M6X A;  1R5G A;  3V8K A;  3R4K A;  4HZF A;  4L9T A;  3ZMT A;  1O7L A;  2VC1 A;  5BPD A;  2RGV A;  4HQE A; 
#chains in the Genus database with same CATH topology
 2LH9 A;  1V5G A;  5TGT A;  1BIB A;  5FLX Z;  1HCR A;  2WC2 A;  2IXS A;  2ZFW A;  3J7Y J;  2FOW A;  4IRH A;  2P0W A;  4MTD A;  4M71 A;  4E7K A;  3LQR A;  2VJ5 A;  4E7H A;  1O3Q A;  3IH3 A;  2L3D A;  3OOP A;  2LBF A;  4LOC A;  2P5L C;  2M1B A;  5D8L B;  1FC3 A;  3RSN A;  5L3B A;  4EMS A;  2HYG D;  3PUB A;  2JT1 A;  1D5V A;  1BC7 C;  1WCM J;  4L9N A;  3KP7 A;  2JPB A;  3ZPL A;  3RJP A;  5K7Z A;  1X3Z B;  3OYA A;  2L9N A;  5L3C A;  2O0Y A;  2DA4 A;  3VYR B;  3RIR A;  5DD8 A;  4WXH A;  1MBH A;  4WCG A;  3U2R A;  3QAH A;  3DTK A;  2Z1D A;  1IF1 A;  4BYY A;  5FJ8 J;  4HOB A;  3HHH A;  3KZI C;  4PSX A;  2VON A;  5JLW A;  1X1B A;  2BYV E;  2QSF X;  1NK3 P;  1QQI A;  4I99 C;  1U8R A;  4ZYA A;  5F04 A;  4IF4 A;  3VEP A;  2LVS A;  3VOD A;  2FX0 A;  3ZQQ A;  5BS6 A;  1LFU P;  4JX5 A;  3HTU A;  3TDZ C;  5FGM A;  2JSC A;  1TQI A;  1X3W B;  3A03 A;  4XOP A;  1LUJ B;  2R93 J;  3N97 A;  4PUS A;  4IQ4 A;  3JRC A;  1BC8 C;  1TWA J;  1LQ1 A;  1TL8 A;  1FIA A;  1H9G A;  5GAE J;  2R0Q C;  2IA0 A;  1HOM A;  4I98 B;  1G3W A;  2XAU A;  3V7R A;  3CCU I;  3OS2 A;  3HRT A;  2K4J A;  4GYG A;  4XBF A;  3GUD A;  1T33 A;  1S9H A;  2GXA A;  4F3Q A;  3JRE A;  1REP C;  4O6J A;  2CMP A;  4N4N B;  2GOX B;  1FMW A;  3Q0U A;  3LSI A;  3TED A;  2PG4 A;  4ZTJ A;  2O3F A;  1ETK A;  2P7C B;  2EZL A;  3BTI A;  4F55 A;  3OYH A;  2WAE A;  2XPU A;  3JR9 A;  4HPQ A;  1PVE A;  3L2W A;  2GLO A;  1TT0 A;  1YX5 A;  4AM3 A;  1WRJ A;  3M9A A;  2HTJ A;  2KRC A;  4ABZ A;  4ESB A;  2NS7 A;  3BTJ A;  5C3E J;  3OYM A;  2ZJQ F;  3HB9 A;  1EKE A;  2KMU A;  4XLA A;  2CG4 A;  3ECO A;  1HXD A;  3K0L A;  3RPU A;  3FXU A;  2QSG X;  3LA7 A;  3C2G A;  2PEX A;  4LD5 A;  1YW7 A;  4ON0 A;  5IY5 H;  3V7S A;  5J6X A;  4KIF A;  3FXJ A;  5HLT A;  3F22 A;  1WQ2 A;  4B3X A;  3FMS A;  1YIT I;  2M4K A;  5J1Y A;  4A0X A;  4XK4 A;  5LGT A;  2HQR A;  4G6D A;  1TNT A;  4YII A;  5CJ9 A;  1FYL A;  3GFI A;  4XKB A;  3QU6 A;  3RKW A;  3UKG A;  5GAH J;  2ZC2 A;  4IHX A;  4KNY A;  4BH9 A;  1V55 H;  4PJ0 C;  3LAJ A;  4C2T A;  5KK1 A;  4BDY A;  2ELK A;  3F8F A;  3TO7 A;  2BXY A;  3ERE D;  3W2A A;  1XTA A;  3MKZ A;  5AIP A;  3E0J B;  2PMH A;  4V2F A;  2KDO A;  4NC7 A;  2WB1 A;  3HOU J;  2HXI A;  3DEE A;  2FU4 A;  2ESH A;  1WKM A;  2VOO A;  1WI3 A;  1ODD A;  2DA6 A;  3TO6 A;  4HNU A;  4FX0 A;  4BE0 A;  3LQQ A;  3LSH A;  5H2F C;  4B8X A;  5DM6 F;  1OYY A;  5AIQ A;  3HJE A;  1R5H A;  3RPU D;  4LG0 B;  1DPR A;  3DFG A;  2MSY A;  1PUF B;  2R92 J;  2X51 A;  1LFP A;  4D5C A;  2LF8 A;  1T08 B;  1OR7 A;  2HYJ A;  3H9J A;  5M3F J;  2AXT C;  2K7L A;  2LRE A;  3TQN A;  2ZSH B;  5IOZ A;  3MKY B;  2QUF A;  3DPT A;  4XLN F;  1J09 A;  3IRQ A;  1V54 H;  3ZQG A;  1K79 A;  2L4M A;  3A4C A;  3P7N A;  2UWM A;  3OV8 A;  2EV5 A;  1BN5 A;  4HNV A;  1BI2 A;  3GFJ A;  2JN6 A;  4AC0 A;  3KP4 A;  3V8L A;  2H94 A;  3FHN A;  1YIJ I;  2OF7 A;  1SC7 A;  1X4O A;  2LG4 A;  4CCJ A;  3RKQ A;  2K40 A;  5JI6 A;  4N9H A;  5LRS A;  3BG5 A;  1UZC A;  2FXA A;  1FSE A;  1P2F A;  3G1M A;  2N8G A;  2MH9 A;  1Y6I A;  1MSE C;  4BUP A;  2Y0S A;  2QWW A;  1SAN A;  5CVR A;  4WXC A;  4DYQ A;  5D5W B;  1J2X A;  1KU3 A;  1R22 A;  1XC5 A;  2WA0 A;  2FRH A;  4PZJ A;  2X1D A;  2ID3 A;  2IEK A;  1XB4 A;  4BHB A;  3HOT A;  4G7O F;  2MYS A;  3I4P A;  4PGH A;  1IN4 A;  1RRJ A;  1HA8 A;  4Y7N J;  2FML A;  5F64 A;  5FRM A;  3F6O A;  4Q48 A;  2KIS A;  1FOY A;  1LNW A;  1J59 A;  2QBY B;  4ANJ A;  2Y69 H;  3HKZ N;  1UST A;  4N4O B;  2DOE A;  2FNP A;  2CUZ A;  2OZU A;  4HX8 A;  1I5Z A;  4HAM A;  4NQW B;  5EEH A;  3ZQF A;  3H0G J;  5LGU A;  3K70 D;  2Z33 A;  1ETX A;  2D5V A;  3KX2 A;  2GOM A;  4B47 A;  3DU5 A;  1ULY A;  4YG2 F;  3JSO A;  4ZYG A;  1ZR2 A;  1TZL A;  4TV7 A;  4WX9 A;  2H8R A;  3BP8 A;  1WPK A;  2VAS A;  2QZ8 A;  2L7M P;  1O4X A;  3S16 J;  2BW3 B;  5EZG A;  4G6T B;  5FD6 A;  2M34 A;  3FKJ A;  3HUG A;  1O57 A;  1J9I A;  1UHM A;  2IVM A;  3IKV A;  4MIM A;  3EYI A;  1G8X A;  3BQZ A;  1H8A C;  1VQ7 I;  1I6H J;  5JHF A;  4XLP F;  3IL2 A;  1FSH A;  5CPR B;  3O8G A;  5E3L A;  2AQF A;  4WF2 A;  1CQT A;  4A0Z A;  1LDK B;  5GAD J;  3CME I;  3F9K A;  5K5Q A;  1ZN2 A;  3ZN0 A;  1K4T A;  3KP5 A;  2OTL I;  2J5P A;  2JA7 J;  4YFN F;  2MA3 A;  1K7A A;  3MVP A;  5HS7 A;  3TW7 A;  1R1U A;  3OYN A;  1VQK I;  1AOY A;  2XGE A;  2OV7 A;  3HSF A;  3COA C;  2ELJ A;  1TNS A;  4G9Y A;  4LB5 A;  3EYY A;  3HZJ A;  2W84 A;  2XKO A;  1B9M A;  2HTS A;  2Z3Y A;  2QF7 A;  3FX3 A;  4P1W A;  1VFC A;  2FSW A;  2DAO A;  2GA1 A;  3FXR A;  5DUK A;  3DLL F;  1T6S A;  2XAS A;  3IWZ A;  4G6Q A;  2CUJ A;  2Q0O A;  1NK2 P;  4LB6 B;  4BKX A;  1JTY A;  3AL0 B;  4R8H A;  4AID A;  1OFC X;  1WH5 A;  3I4N J;  3HXL A;  3T8T A;  2EZK A;  1JKQ C;  2AO9 A;  2KZG A;  3I71 A;  4WWC A;  1Z6R A;  5ED4 A;  1FYK A;  3HGG A;  3HEF A;  3O6B B;  2M2E A;  3EET A;  3FK7 A;  3EUK L;  1EH7 A;  1I3A A;  3GXO A;  2DTR A;  4OU0 A;  1IDZ A;  3CUO A;  2NOG A;  2LD5 A;  4AYB A;  2Y48 A;  1D8K A;  2VT3 A;  4RDU A;  2L9S A;  4Q4Z F;  3P5J A;  1VQ8 I;  3OR2 C;  1MNM C;  3CC4 I;  2KIM A;  1QVU A;  2ME0 A;  3I53 A;  2F5V A;  3K4K A;  3R61 A;  1YO5 C;  2HEO A;  1W5S A;  1FOX A;  3ASO H;  3PJR A;  3KLN A;  4C2M J;  3DEW A;  3GTG J;  4KDP A;  1JJ6 C;  3BJO A;  2RNJ A;  4EGY A;  1Y1W J;  2RKH A;  3TBI A;  3HOY J;  4PFP A;  3BG7 A;  2H8W A;  3FKI J;  1IZ1 A;  3KET A;  3DBR B;  2HI3 A;  3PIP F;  3D5R C;  2X1E A;  2A5Y B;  3E6D A;  2VLA A;  3FXM A;  4YIF A;  4NNJ A;  4ITV A;  4ENN A;  2O61 A;  3FK6 A;  2DN0 A;  4O5V A;  1WZ2 A;  2VQG A;  4XLC A;  4A3B J;  1I27 A;  1X1A A;  1ZGA A;  2MBF A;  2WV1 A;  1ETQ A;  2DA3 A;  3WE3 A;  2DOD A;  3CJT B;  5HS8 A;  5B1A H;  5ILU A;  3IV5 A;  2F4O B;  4I7H A;  3BZC A;  4JP0 A;  3DXJ F;  1Z05 A;  1E3H A;  3AL0 C;  2H6B A;  3K4C A;  4RM2 A;  1OCZ H;  5FFX A;  3SHF A;  1QHG A;  1S3J A;  1HC8 A;  3A01 A;  5A2Q Z;  3K4B A;  3WHC A;  3BOQ A;  4OIR F;  2G0E A;  2PFB A;  3CZ6 A;  4EM0 B;  1LE8 A;  2FUG 2;  1UEL B;  2V9P A;  3KYL A;  1S5L C;  3KLO A;  1S7O A;  5E3O A;  3AKZ A;  2VQL A;  3JW4 A;  5GPC A;  2PLY A;  2OU2 A;  4A3C J;  3KEQ A;  3NWT A;  4Y4R A;  2V26 A;  3HM5 A;  4WK8 F;  3GW2 A;  3I54 A;  3OYI A;  1SFX A;  3HOX J;  6PAX A;  2H6C A;  1VQL I;  3S17 J;  3S32 A;  5D4R A;  1W1W E;  1A36 A;  3M07 A;  2QQA A;  1ZHF A;  3Q0V A;  4JYK A;  1P6R A;  3E6M A;  2LNB A;  2W25 A;  2XRL A;  4HF2 A;  1FTT A;  1DPU A;  2A5W A;  4PSW A;  4E6K G;  4JX4 A;  1LVK A;  3CLQ A;  2HYF A;  3J7Z I;  2NS0 A;  1BI0 A;  4RB0 A;  5L3D A;  4GRI A;  3BT9 A;  3CCY A;  3BG9 A;  2KIQ A;  3SEZ A;  3WTY C;  2GQQ A;  5J4Y A;  2V1U A;  3R0J A;  4UNO A;  3RDI A;  1RET A;  4D9J A;  4XON A;  4OIQ F;  1BR1 A;  1B9N A;  2MGQ A;  2BE5 F;  2HFH A;  3T5X A;  2KPM A;  2VIX A;  3IP4 B;  2R7T A;  2STW A;  2HOA A;  2XRO A;  3ZQL A;  1IN5 A;  4KIT B;  1JHH A;  2FA5 A;  2KL4 A;  4XN3 A;  4PK4 A;  4JQF A;  1YJW I;  2BY2 A;  2HDW A;  4MO7 A;  4BAC A;  1ENH A;  5H6Q A;  1YRN A;  1T95 A;  2ZXI A;  3ZMZ A;  4A2U A;  4GCV A;  1JUP A;  2JRM A;  1G3S A;  1AHD P;  4MEX F;  2ZJR F;  4DYR A;  2JRT A;  3WE2 A;  5IYB J;  1NH3 A;  3MWM A;  4YRV A;  1EH6 A;  3T8R A;  2QA4 I;  3DTE A;  4L5E A;  3PQJ A;  2R5Y B;  4V2G A;  3J81 K;  1GXP A;  3PL8 A;  3DPU A;  1A6I A;  2XAH A;  2ZME A;  2PX9 A;  2R7Z J;  1HDP A;  5EDN A;  4IL6 C;  3TP3 A;  5M5X J;  3DV8 A;  1R4N B;  5EGO A;  3A2K A;  1IRZ A;  3ABU A;  2JZY A;  2Z2S B;  2RDP A;  2WBM A;  3OIP A;  3RQI A;  4MNU A;  3BTL A;  2I10 A;  1AU7 A;  1VQN I;  1JUS A;  1SD5 A;  4LJZ F;  3MD2 A;  3PUF A;  1FP2 A;  2UUZ A;  5CVJ A;  4CGZ A;  2CW8 A;  2E1C A;  4MFE A;  2L4A A;  1XMA A;  4FTH A;  1YHQ I;  4FHT A;  2EA2 A;  1CF7 B;  2IP2 A;  3BR6 A;  2W4S A;  5FKM A;  1IXS B;  1ETV A;  1BJA A;  2VUM J;  4Y15 A;  5FRO A;  5LFA A;  3N05 A;  2DCE A;  2LY1 A;  3OYC A;  2ZO4 A;  4BJT A;  1HQC A;  5B66 C;  3QOP A;  2PMZ A;  4B3A A;  3RYP A;  3OYL A;  1VQ6 I;  1V5F A;  2QM3 A;  3RYR A;  3S15 J;  1P7J A;  2R7O A;  1QZZ A;  2DK5 A;  5EJC A;  1QZE A;  4CZZ A;  3BR5 A;  5DCM B;  1PP8 F;  1BM9 A;  2VE9 A;  3HUG B;  5TIS C;  5HLI A;  2G9W A;  2OD5 A;  1W0U A;  4XQF A;  4XKW A;  1MDM A;  1OR7 C;  1WJC A;  3HL2 A;  3HPH A;  2XAJ A;  3OWT A;  1YW9 A;  1J7K A;  2EFQ A;  1MMG A;  2KRF A;  3IH2 A;  5J4V A;  5LD2 C;  3LMM A;  1BI3 A;  3LAP A;  1F9N A;  3RPQ A;  2TRT A;  3LSR A;  1ITY A;  5CKT A;  5CLS A;  3W6K B;  1IXC A;  4D7M A;  5KHD A;  1FYM A;  2O8X A;  1D1A A;  2EJR A;  3MZ8 A;  2EFP A;  1ZRD A;  1ZLJ A;  4BEH A;  1VZ0 A;  1P4X A;  3GLX A;  4HG2 A;  3CP8 A;  1XMK A;  4I0B A;  3CCQ I;  1W4M A;  5EYR A;  4CO8 A;  1G3Y A;  1TLH B;  1UMQ A;  5DCF A;  5L3E A;  1MKM A;  2CYY A;  4J01 A;  1YOV B;  2DK8 A;  2M7B A;  5HLH A;  4A3J J;  2BVM A;  3K10 A;  4RB1 A;  2LKS A;  1E0E A;  2PQ8 A;  2V4J C;  5DS9 A;  1XSX A;  2W82 A;  1Z7U A;  4CZC A;  3P9C A;  2Y0M A;  4ETS A;  2XPV A;  2H1L A;  3HGY A;  4KIB A;  1XSD A;  5LEK A;  3OR1 C;  3EUA A;  1OYW A;  3AFH A;  3HRU A;  3E5Q A;  3QPL A;  4NDL A;  5FKL A;  3KYD B;  2WY7 Q;  3ZN1 A;  1JJ8 C;  2MW8 A;  1H89 C;  2W00 A;  3H1C A;  1UJ8 A;  4QPO A;  4W97 A;  2DMT A;  3WG7 H;  2HS5 A;  1ZQ3 P;  2R7U A;  2K86 A;  2I5U A;  4HV6 A;  4LLN A;  3GZ5 A;  5FB2 A;  5K1Y A;  2LLK A;  2QSH X;  3JTG A;  2DQL A;  1F4K A;  4IOA F;  3IAS 2;  3EDP A;  9ANT A;  3B73 A;  3F8N A;  3SQN A;  2P5V A;  3B6A A;  2CUF A;  2XGX A;  3WTW C;  5IYC J;  3CDH A;  4Q47 A;  2F4I A;  4AU7 A;  4A6D A;  4ESF A;  2EV6 A;  3QOE A;  3NAR A;  3SJM A;  2KHM A;  3KP2 A;  2XAF A;  4DW6 A;  2BY3 A;  3J7A Y;  4BY1 J;  2ESN A;  2R3S A;  4RBO A;  1TWF J;  2E7W A;  2Y31 A;  1WWX A;  2XB5 A;  4OOI A;  3HOV J;  4LLL A;  3I5U A;  2Z16 A;  5HDN A;  3L9F A;  3VB2 A;  4CA0 A;  3J81 Z;  2RAE A;  4NB5 A;  5IOY A;  5ILV A;  2H27 A;  2YPR A;  2LRD A;  3U1K A;  4XRS A;  4RLQ A;  1E2X A;  4YFX F;  1XGN A;  3M8J A;  1LEA A;  4RGS A;  5LGN A;  1ZG1 A;  3GTL J;  1TWH J;  2DA2 A;  3SYT A;  4JK1 X;  4RGR A;  2FNA A;  4U7B A;  2IS6 A;  2X6O A;  3VSL A;  4U0V A;  1K4S A;  3GTK J;  3BY6 A;  4IXA A;  4BDZ A;  3GTM J;  1GVJ A;  2FJ1 A;  4DIQ A;  1LKX A;  3CCS I;  1VQ5 I;  2OBP A;  3JTH A;  1RNL A;  2Z9O A;  2E2H J;  3A0H C;  5J47 A;  2F5C A;  4IHT A;  2QQB A;  1SVL A;  1U5T A;  3E7L A;  2K3P A;  2QCO A;  3OOU A;  4RMN A;  3A01 B;  1A5J A;  2H09 A;  1LE8 B;  2CQK A;  1UHS A;  5BMZ A;  1B1B A;  5E8G A;  4KMU X;  3OS1 A;  2CO5 A;  5HLG A;  4IRG A;  1D0X A;  2G7U A;  2L7F P;  5ICF A;  1KQ8 A;  2DT5 A;  2EIK H;  1OKR A;  3LNQ A;  4G8X A;  1I50 J;  2A3S A;  1H88 C;  3GTO J;  5BPI A;  2QGU A;  1PUE E;  2H1K A;  2KZV A;  4EM1 A;  3HHG A;  1QVT A;  1W36 C;  3DF8 A;  5K5R A;  2JVG A;  3S1N J;  2NVU B;  1ZG3 A;  4D5F A;  4NBQ A;  2DT7 B;  3GFL A;  3NWS A;  4M3D A;  3ZMS A;  4HV5 A;  4Z2Y A;  5BOX A;  1KU2 A;  3LL7 A;  5C4J J;  4ZJZ A;  3OL4 A;  4I01 A;  1HF0 A;  4IHY A;  1FX7 A;  1IRX A;  2DT6 A;  3CMM A;  3FM3 A;  2COB A;  4HST A;  3I55 I;  3R6S A;  3WU0 A;  4OAY A;  3MKW B;  1GHC A;  3I4M J;  4BQQ A;  2Q2E A;  3ABK H;  4FET A;  1RES A;  3LSJ A;  2MC3 A;  2W57 A;  2KDZ A;  2NOJ B;  4X6A J;  3KZY A;  3LOC A;  2HGC A;  1IDY A;  2V6E A;  1OCT C;  3CCJ I;  4OAZ A;  4RB3 C;  1XCV A;  4ENJ A;  1HBX G;  4IO9 F;  2DOA A;  2XKP A;  4EJT A;  1MBK A;  2Z5U A;  4A3E J;  4A3L J;  2WAD A;  1VQM I;  4MLO A;  2NXN B;  1YRN B;  2E5N A;  5C4X J;  2CQQ A;  2VB6 A;  2A6H F;  2JPC A;  3C1D A;  3HYI A;  4CCM A;  2P81 A;  4CH7 A;  1SMT A;  2R7X A;  2EH3 A;  2VKD A;  2W85 A;  1HW1 A;  2IS4 A;  3E3V A;  1G6N A;  4A5M A;  3CCM I;  2Y9Y A;  2DMQ A;  2PJP A;  2ME6 A;  1FLI A;  4XKC A;  1P9Q C;  2COM A;  4BY7 J;  1PDN C;  1D0Y A;  2BVL A;  1CGP A;  1MMA A;  2P6T A;  3PNY A;  1ZH5 A;  1E3P A;  3GBG A;  4LIU A;  1QU3 A;  5L3F A;  3JCU C;  2DU9 A;  3I64 A;  1I3Q J;  2RQQ A;  4YFK F;  3JRG A;  3FZV A;  2ZME B;  1OYI A;  3S2W A;  1N25 A;  1R00 A;  2VQC A;  1KGS A;  5D5X B;  2Q8K A;  3GFM A;  5IT3 A;  2Z99 A;  3BR0 A;  5EGO B;  1J75 A;  1F5T A;  4UY8 I;  4UVC A;  5KAF C;  1O3T A;  1EV7 A;  2R7D A;  5D6E A;  1IGN A;  3H9G A;  3OSG A;  2MLG A;  3CCR I;  3WTX C;  3O2P E;  4B09 A;  2LTP A;  1OPC A;  2OUM A;  4MQV A;  3ZRG A;  1QPM A;  2DJI A;  5KAI C;  2JQ7 A;  1IUF A;  3X2Q H;  1K78 B;  1ETW A;  1YTY A;  4WXD A;  4IQJ A;  2W48 A;  1E17 A;  2HXO A;  1B8I A;  2L9R A;  4BU2 A;  5F6F A;  4Y3O A;  2HZD A;  4Q5S F;  3H5N A;  5J1U A;  2VPR A;  1IW7 F;  3AG1 H;  1MBG A;  3WOD F;  4JX6 A;  4A3F J;  2R7Q A;  2V1X A;  3Q3S A;  3S1R J;  3BCB A;  3CC7 I;  2AXL A;  1K83 J;  1MNE A;  3H3Z A;  1DP3 A;  2HPM A;  2HU9 A;  2ZNY A;  3DU6 A;  2QEX I;  1N77 A;  3QP5 A;  4M72 A;  4U88 A;  4FX4 A;  3TL4 X;  2DOF A;  2PMU A;  4BS9 A;  3M4O J;  1D3Y A;  1TQM A;  1Z77 A;  1S8N A;  5JVG F;  3KEO A;  1MDM B;  2HOE A;  2UXN A;  3FHZ A;  1N78 A;  2DTZ A;  4B4C A;  4UUS A;  1BW5 A;  3GF2 A;  4PFO A;  3CC2 I;  5FLV A;  2D1V A;  1APL C;  3DBL B;  3J80 K;  3OL3 A;  1U0J A;  3A1Y A;  3SEQ A;  5CVU A;  4CUG A;  2KQR A;  3FM5 A;  4HLX A;  4BEH B;  1VF9 A;  2TCT A;  3FXQ A;  2ZME C;  3JRD A;  1D1C A;  2RV8 A;  2CUE A;  3QWL A;  3PIO F;  5D5U B;  3R0A A;  3PFY A;  4LK1 F;  2XGD A;  1XGS A;  1YS7 A;  2ELH A;  1BI1 A;  3WHB A;  5DM7 F;  3F6V A;  4KUM A;  1FNN A;  3RKY A;  2A05 A;  2WAQ N;  1K6Y A;  4L9J A;  5F0H A;  3D0S A;  2L5Q A;  4XSX F;  4E7Z A;  2IPQ X;  2K02 A;  2OJE D;  2QVO A;  4IX7 A;  1BR2 A;  1BJZ A;  4LG3 A;  1FOK A;  3VFZ A;  2R7F A;  3R60 A;  3LFK A;  3CDI A;  1KZH A;  1RKW A;  3MCZ A;  4AWX B;  3FWE A;  3RTR A;  2E19 A;  3GEZ A;  2X85 A;  3I59 A;  3S3O A;  1W7P A;  3K1M A;  2VKH A;  2LFB A;  4DZP A;  4P55 A;  3TW6 A;  2L0K A;  3BC8 A;  2LK2 A;  2RRE A;  3AG2 H;  4RAF A;  2X48 A;  2R4G A;  3ERM A;  3FBI B;  4D1Q A;  4C3J J;  3BWG A;  4MTE A;  2VE8 A;  3BJA A;  2XSD C;  1IN7 A;  3OYB A;  3LSK A;  3ZR8 X;  4BQO A;  1GT0 C;  1WJ5 A;  2BGC A;  4IZZ A;  1QPI A;  3HKZ A;  3O3K A;  3OYD A;  1BIA A;  2GIV A;  3DQV C;  2QYO A;  3EPZ A;  3ISP A;  3D1N I;  1ZGW A;  1RUN A;  1DGR M;  5HS9 A;  2LBF B;  1SFO J;  1IO2 A;  1HST A;  4HX4 A;  3P9K A;  2P5K A;  2IS2 A;  4J00 A;  4FIS A;  4C3I J;  2ETH A;  4ENK A;  4BHP A;  4LGW A;  3F23 A;  1O3R A;  4QLC U;  1MJB A;  3BPX A;  1LJ9 A;  2L02 A;  4UUV A;  5EEG A;  2KP6 A;  5GPA A;  1O3S A;  1KYW A;  4U7D A;  5L3G A;  1ON1 A;  2BHZ A;  2JVH A;  1A31 A;  2LR8 A;  1ZAR A;  5GTI C;  3L1P A;  1EJ9 A;  1C0W A;  2VJI A;  3I0T A;  1W7P D;  4M9X A;  3L2U A;  1NG6 A;  3FMR A;  5F1R A;  3GTP J;  2BY1 A;  1JI8 A;  3V7C A;  1U8B A;  1OCO H;  5HDG A;  2V1N A;  3CMA I;  1X19 A;  3ZOB A;  1MW7 A;  3VYS B;  1OMI A;  1UFM A;  1R49 A;  3AG3 H;  3RKX A;  1HKQ A;  3K7A J;  1IJW C;  3REO A;  2VT2 A;  4A0Y A;  1STZ A;  2XHK A;  3MZY A;  2DPU A;  1AWC A;  3Q9V A;  4NC6 A;  2JK3 A;  1T8I A;  2DMP A;  1SAX A;  2FE3 A;  3HOZ J;  2O6G E;  4NC8 A;  5E1Z B;  1HKT A;  1J0R A;  1JT6 A;  2KJC A;  2E60 A;  5K7F A;  4PCQ A;  5HNH A;  1U5T B;  5LEJ A;  5EZH A;  4HDV A;  4ENM A;  1WSU A;  4HRI A;  1LB2 A;  5IP6 A;  5D6F A;  3HSE A;  4IEJ A;  2L01 A;  4C30 A;  4BHC A;  4C3H J;  1RR8 C;  1SVM A;  2QLZ A;  4BBR J;  3H0D A;  4M6Y A;  1FIP A;  4QTR A;  1W36 D;  1TC3 C;  2DW4 A;  2OZ6 A;  1X1D A;  3VDX A;  2E71 A;  3K69 A;  3L7W A;  1K6O A;  3NAU A;  1RUO A;  4PJJ A;  3G1L A;  2L9V A;  3S1M J;  2EV0 A;  2HQN A;  5GP9 A;  2FD5 A;  1GVD A;  2XGC A;  2YS9 A;  3H5A A;  1YI2 I;  1GV2 A;  3S14 J;  2XVC A;  2LMD A;  4ZDP A;  1BR4 A;  2ISY A;  1R23 A;  1POG A;  3JRI A;  2I8D A;  4B48 A;  3F3X A;  1EF4 A;  4UHT A;  1A6Q A;  1MBF A;  1HW2 A;  2CQ7 A;  2JA6 J;  2VBW A;  2MD0 A;  5GAG J;  2P4W A;  2DA7 A;  3SZP A;  3GYH X;  1FT9 A;  4OIP F;  2X4H A;  2L2O A;  3LA2 A;  3J80 Z;  2LP0 A;  2M3A A;  2XAG A;  5D4S A;  2KRH A;  2XUB A;  2OC6 A;  3DKW A;  1FBQ A;  4K2E A;  1XGM A;  2OA4 A;  1RC9 A;  4DGW B;  5HOO A;  3PSI A;  4CSW A;  4FCY A;  2Q2E B;  2GA2 A;  2XAQ A;  2LSO A;  3K6G A;  1SMY F;  1MD0 A;  5KCM A;  3QYF A;  3F8B A;  2HOS A;  2O9L A;  3L2C A;  4BQA A;  2OQG A;  4E7J A;  1SD7 A;  1R7J A;  4KFC A;  4M3E A;  3G2B A;  1S7A A;  2ACJ A;  2ZBK A;  3TO9 A;  3RCO A;  3T1B A;  2IGN A;  4JOM A;  5LRR A;  2CSO A;  4D0P A;  1R5I D;  4LFU A;  1DU0 A;  1U5T C;  1KYZ A;  3S3M A;  2X1C A;  3T0Y A;  4DNC A;  1FPQ A;  1P4W A;  3E1S A;  2YX4 A;  3ROU A;  3ECH A;  1FY7 A;  3TP0 A;  5M5W J;  1SVO A;  2FEZ A;  4XLF A;  2GXB A;  3ZMU A;  3HIF A;  5C44 J;  4GO1 A;  1QGP A;  5LHI A;  4E4H A;  3FIW A;  2CS3 A;  4ZYD A;  4E7I A;  2XF6 A;  3WU2 C;  2F48 A;  4LIT A;  3IKT A;  2E5Z A;  3K1P A;  4LIV A;  3HDD A;  1Z1D A;  1BOA A;  1ERD A;  2QKM B;  1X2M A;  2WV0 A;  3CJN A;  1RIO H;  3G3Z A;  5CVV A;  4XID A;  2E2J J;  3B6C A;  3VSK A;  3H3U A;  4LG0 A;  4L0Y B;  4M6V A;  5LLQ A;  5JLX A;  2A61 A;  3H92 A;  3TOB A;  3N4M A;  1X4P A;  1IV8 A;  2X9D A;  3HBL A;  1JKP C;  2NVX J;  4Y33 A;  2CW0 F;  5F0F A;  4PJM A;  2LYC A;  1FEX A;  3BDD A;  3QRF F;  3DP7 A;  1OQY A;  2F4M B;  2QKL B;  3DTI A;  3SDB A;  1W5T A;  2EWN A;  3TDU C;  2NAZ A;  1QBJ A;  4HLY A;  3PM1 A;  1IC8 A;  3UR3 C;  5IPA A;  4YEL A;  4NUB A;  1OCC H;  1ZR4 A;  3G1O A;  4AIJ A;  2FMY A;  2X6W A;  3G71 I;  2HPI A;  4I76 A;  4DZJ A;  3Q5F A;  1KQ9 A;  3CD6 I;  1F43 A;  2DFI A;  4IPA A;  2XC7 A;  1EA3 A;  2XDV A;  3K4N A;  5DD4 A;  2MLK A;  3WGG A;  3H35 A;  4UUS B;  3KPH A;  5H20 A;  3L2R A;  4F93 B;  3ABL H;  3MAJ A;  2RQP A;  3FBN B;  3CF5 F;  2ZJP F;  2Y30 A;  1JKR C;  3U9G A;  2XRN A;  3S8P A;  3W6V A;  1B59 A;  3DCF A;  1ZGJ A;  1Z6T A;  3GME A;  4FE4 A;  1Y39 A;  3FMQ A;  1P92 A;  2VBY A;  4BXU A;  3PNV A;  4MFD A;  2CV0 A;  4P96 A;  2V9V A;  3CDL A;  4BL0 B;  2K9M A;  1DQU A;  2C6Y A;  1JTX A;  1JKO C;  4XKV A;  3QU3 A;  4B43 A;  3QQA A;  2A6T A;  1YJN I;  1SFU A;  4M74 A;  3LST A;  3TMO A;  5E1X A;  1GLN A;  2HKO A;  1JE8 A;  4N0B A;  2RN7 A;  4U0W A;  4X1E A;  2PBI A;  3ESW B;  3CO6 C;  1S6L A;  2DO7 A;  1P7I A;  4UV8 A;  1D1B A;  4I09 A;  3BG6 A;  2ADU A;  3TGN A;  4P9F A;  3VYU B;  2HVR A;  3I59 B;  1W7P B;  3GVA A;  1NHA A;  2HQA A;  3CF2 A;  4RGX A;  1Q1V A;  1FBU A;  2M5W A;  3LFU A;  4L9V A;  2CH0 A;  5IP9 J;  2JA2 A;  5J3L A;  5CYV A;  1PP7 U;  2VC0 A;  1B72 A;  5ILS A;  1WI9 A;  1WFX A;  3FIS A;  1T0F A;  2VBZ A;  2RC4 A;  2F5F A;  3EQL F;  4XLH A;  5ICG A;  2D45 A;  1QA6 A;  4M3B A;  2VKE A;  1KU9 A;  1OLT A;  2RVC A;  4LLG F;  5FKO A;  1SFE A;  2QQ8 A;  3JAM K;  2IRF G;  2IGM A;  2DI3 A;  1G59 A;  1ZKG A;  3S2H J;  2K27 A;  5GTH C;  2XB0 X;  4EJV A;  3IH4 A;  2NVT J;  4EJO A;  3QPS A;  4CCN A;  3KYC B;  3KP3 A;  3AAF A;  3KZZ A;  1BBY A;  3ZGK A;  2IGK A;  5B1B H;  2XIG A;  2M8E A;  2YX7 A;  3HRS A;  5KNL A;  4EV0 A;  3QYE A;  2A68 F;  3I3L A;  3OYF A;  1QO0 D;  1X1C A;  5M5Y J;  3I58 A;  1Y0N A;  3KE2 A;  3SDG A;  3WTZ A;  2OCE A;  2J5O A;  4O3M A;  1V3F A;  4MEY F;  4S05 A;  5LHG A;  2CFO A;  2E1O A;  3PO3 J;  1IUY A;  2R7S A;  2YR2 A;  3L09 A;  5FD5 A;  4KIS A;  1R36 A;  4UVB A;  2HVS A;  1ZEL A;  4FE7 A;  2M4G A;  1Y8Q B;  3IRR A;  2OAZ A;  1I1S A;  4LK0 F;  1JHF A;  5EG0 A;  3QPT A;  2KKO A;  2LC2 A;  4J19 A;  2K9Q A;  5E18 F;  4OMZ A;  2RNG A;  1Y8R B;  3CUQ C;  1LVA A;  4CDG A;  1IV6 A;  1N75 A;  2GWR A;  5CQG A;  1IRG A;  2ZCW A;  3EUH A;  5DV5 A;  3GCM A;  4A3M J;  3F8M A;  3I56 I;  3WGI A;  4KYW A;  3CQZ J;  5F27 A;  5DTD A;  1ORK A;  1H9T A;  3LSG A;  2DDB A;  1OCP A;  4B1R A;  2DQR A;  4CHU A;  2R5Z A;  2FF4 A;  2L54 A;  2M0C A;  2EIN H;  5IP7 J;  3C3W A;  2O7O A;  5FLM J;  2STT A;  1MMD A;  3PNT A;  4HX7 A;  1R6R A;  1O7F A;  1TP4 A;  1Z3Y A;  3OS0 A;  2R7R A;  3KEY A;  2CU7 A;  4IVN A;  1OJL A;  4M73 A;  3ZQI A;  4CCL A;  1RR7 A;  1IAW A;  1Z91 A;  3S1Q J;  2ID6 A;  2DA1 A;  2VN2 A;  3KCC A;  4OIO F;  3C2H A;  2MFZ A;  2VJJ A;  2KLO A;  4UB8 C;  2VJ4 A;  5HDK A;  2BBY A;  1Y0U A;  2CGP A;  1XD7 A;  3OIO A;  1VI0 A;  4P5O A;  1IXR C;  3WU1 B;  2K9S A;  4HQM A;  4XOR A;  1ZRE A;  5FRN A;  1E3O C;  3ZQC A;  2FQ4 A;  3A02 A;  4GXO A;  3E5X A;  2WB1 N;  2F2E A;  1XSV A;  4L5I A;  1F1Z A;  4CXF A;  3FXL A;  1V4R A;  5B5E C;  4LMY A;  4N9I A;  4L18 B;  3CJR B;  2GBY A;  1IRF A;  3C18 A;  4HYE A;  2O8K A;  3W2W A;  3KFW X;  1U6G A;  1YQA A;  5DYM A;  3WG9 A;  3L2Q A;  3H9Q A;  3ELK A;  1Q1H A;  5LHH A;  2D2W A;  5D8K B;  3TKY A;  4G7H F;  3H3V K;  2K9L A;  4M3G A;  3ZCO A;  1YE9 A;  4RS8 A;  2L7K A;  5JVT A;  3QPH A;  3MKL A;  3M7G A;  1T39 A;  3PFI A;  3S3N A;  5LBQ A;  4A12 A;  1HDD C;  4U87 A;  4XMY A;  3QYB A;  4KIG A;  3WTS C;  2FQ3 A;  1X58 A;  4H4K C;  2LKX A;  1MH3 A;  2F5D A;  4BBS J;  2B7E A;  3E6C C;  2MC4 A;  4HNT A;  1DDN A;  1FTZ A;  3HPG A;  1WGX A;  2HKX A;  2K5C A;  2M0M A;  4F52 A;  1Z7L A;  3G73 A;  4DYC A;  3GTQ J;  4OIN F;  1USS A;  2V9K A;  2XSJ C;  4NHJ A;  4HF1 A;  3GZ6 A;  4XN0 A;  3BR1 A;  1ACI A;  4IOC F;  1BA5 A;  4G7Z F;  3F0C A;  4KN4 X;  2NNN A;  4A5N A;  4CYC A;  2IAI A;  4G12 A;  3JSP A;  1WVR A;  2EK5 A;  2M9H A;  1GDT A;  2Y0S N;  2X6X A;  1JT0 A;  1QHH D;  4EJU A;  1LDJ A;  1TT5 B;  2HZT A;  3LSP A;  3ONQ A;  2KIF A;  4GYI A;  1XCB A;  3KIO A;  3F21 A;  5JR3 A;  3BRO A;  4QWQ A;  4PJN A;  1TW2 A;  2DBB A;  2DYR H;  2VXZ A;  4I0A A;  3WTV C;  5DUI A;  3BG3 A;  4AD9 A;  3OYG A;  3ZP5 A;  3JAM Z;  2IW5 A;  2FBH A;  3ZMD A;  3JRB A;  2WY8 Q;  1FJL A;  2VOP A;  2ZFU A;  2P6S A;  2R7W A;  4E7S A;  1U9O A;  4R1H A;  4U0Y A;  2UZK A;  3E5U A;  4Z6Y A;  1UCR A;  1WJF A;  2PJR A;  3HG9 A;  4A69 C;  3C2B A;  4RA2 A;  2JWT A;  1F36 A;  3OSF A;  3SFI A;  2ISZ A;  2K4B A;  2CJJ A;  1L0O C;  4XR6 A;  3C7J A;  2CRG A;  1ZRC A;  1UHW A;  3U21 A;  1Y1V J;  1K61 A;  1AKH A;  3DLA A;  3E97 A;  2GAU A;  1ZK8 A;  2IS1 A;  1P4A A;  2ZB9 A;  1XG1 A;  1HSJ A;  4RLF A;  4IHS A;  2NVQ J;  2W24 A;  3PQK A;  3DBH B;  4YIR X;  1W0T A;  3W2V A;  2R5Y A;  3LA3 A;  4EEF G;  2EB7 A;  4DBR A;  3F72 A;  5ERI A;  1JGG A;  3H5R A;  2LF7 A;  5IT9 K;  2VBX A;  4BE2 A;  2YU3 A;  3E6B A;  3S2D J;  2BOL A;  2CWE A;  1YYV A;  2IBD A;  3IAM 2;  4QIW N;  4OMY A;  3BJ6 A;  5JHU A;  2FBI A;  2P8T A;  1A35 A;  3W6J B;  1MH4 A;  2O03 A;  4Y13 A;  1RI7 A;  5E3M A;  4KIC A;  5EEA A;  1I1G A;  3HOW J;  4RAY A;  5FFZ A;  1SD4 A;  4IKF A;  5HVQ C;  1OCR H;  5DDG A;  3OIQ A;  5E3N A;  3U1D A;  4UXN A;  2HDD A;  2KFD A;  1T98 A;  3FF5 A;  5K5O A;  4MHG A;  2JA8 J;  1A04 A;  5A2Q K;  2JMW A;  3MFK A;  1CF7 A;  1U78 A;  4HSR A;  3WGH A;  3CP2 A;  3Q0W A;  3V4G A;  4B44 A;  4F91 B;  1WJE A;  2F6C A;  1U2W A;  1G2H A;  3CES A;  3V8J A;  3S93 A;  3KP6 A;  4UUT A;  2ZSI B;  2YSR A;  2NRA C;  2EA4 A;  4W1U A;  3H36 A;  4XRS G;  2CV2 A;  4AYB N;  1MIJ A;  1ZAO A;  5M3M J;  2OQR A;  1Z67 A;  2VI6 A;  4E70 A;  1SFK A;  4ASN A;  5FKK A;  1EH8 A;  3M3Y J;  5DCM A;  4I2O A;  3CUQ A;  4ZYH A;  2KIU A;  3M1E A;  4CCO A;  5HOD A;  4A3D J;  1VQ4 I;  2V79 A;  2X6Y A;  3K4L A;  3BZK A;  3VPR A;  2Y9Z A;  3K2Z A;  1R71 A;  4HDU A;  4RAZ A;  5HNF A;  4S0H B;  3IC7 A;  4BNC A;  1B72 B;  4BJ5 C;  2QEN A;  2WWY A;  2G7H A;  1TW3 A;  2V7F A;  2MG4 A;  3JRF A;  2E34 A;  4GGG A;  2JUC A;  2EZI A;  2OCC H;  2MD5 A;  1WJA A;  4II3 A;  2EFW A;  2EQR A;  3NQO A;  3K9T A;  4I02 A;  1YG2 A;  2O5R A;  4L0Z B;  3J7A O;  1XGO A;  2ECB A;  2VL8 A;  2OPT A;  4EJW A;  1MMN A;  2W1O A;  1L3L A;  4XRM A;  3RZD J;  2IA2 A;  2A6E F;  5TJJ A;  5AON A;  3BPV A;  3D5L A;  3GZN B;  4ZZL A;  4IHW A;  1PJR A;  2BV6 A;  4MGR A;  2DLL A;  2HOT A;  2B0L A;  2JJ7 A;  1RPW A;  2PN6 A;  5J40 A;  1ZRF A;  3CCV I;  1VQ9 I;  4KMF A;  2AS5 F;  4HEA 2;  2VXD A;  1X3U A;  2CQX A;  3NEU A;  4XLE A;  1XPX A;  4A3K J;  1T38 A;  1XDU A;  1NG7 A;  1MJA A;  2DMU A;  3D5S C;  1U3E M;  4AIK A;  2LY2 A;  4PGG A;  4DQ2 A;  3VWB A;  4YEJ A;  3DKY A;  4RB2 C;  4PJL A;  3OYJ A;  2W7N A;  3GO5 A;  2E1M B;  5EG0 B;  3BLY A;  2YUS A;  2DYS H;  2HQ5 A;  4ZC3 A;  4XSZ F;  5CVI A;  3ASN H;  2Y75 A;  3GWZ A;  3AG4 H;  2DJN A;  2WAQ A;  4R79 A;  2ZXH A;  1Y56 A;  4BGD A;  3HC7 A;  3IHU A;  2K85 A;  1OIS A;  2ICW G;  3BQY A;  4E7L A;  2BEO A;  2R5Z B;  1R4M B;  1TTY A;  3VYT B;  1VND A;  2WAF A;  2ZXW H;  4F92 B;  1MGT A;  2VKV A;  1RKT A;  1XDS A;  2EPF A;  1X2N A;  3ABM H;  5E20 A;  3HSR A;  1YFH A;  3IWF A;  5BNG A;  2M45 A;  3M8F A;  3L00 A;  1T0F C;  1TBX A;  1Z21 A;  1S29 A;  1ZYR F;  4EQQ A;  4FAS D;  4RGU A;  4UVA A;  3MQ0 A;  4KA4 A;  1FOW A;  1GUU A;  4EVI A;  1Z0X A;  5EF6 A;  1R1V A;  4S04 A;  4PDK A;  4JBA A;  1ON2 A;  1BW6 A;  5IT9 Z;  4HA8 A;  1Z3X A;  1JGS A;  4BJ6 C;  2DPD A;  3MMY B;  2ZNZ A;  1UG2 A;  1DU6 A;  1NTC A;  1HW5 A;  1ZG5 A;  4RM3 A;  1PYV A;  1H0M A;  4H0E A;  4BE1 A;  2AHQ A;  4M9Z A;  1MJ9 A;  4UV9 A;  1RZ4 A;  1UAA A;  5JFR A;  3MEX A;  2A69 F;  1T56 A;  4XM3 A;  4A6E A;  1AA7 A;  5F1J A;  3O8H A;  1KQ0 A;  4M3F A;  3SZG A;  1TWC J;  3BZ6 A;  1KU7 A;  3BR3 A;  2HWV A;  2FBK A;  2KJB A;  3LWF A;  2A07 F;  2DDA A;  4IHV A;  1FWZ A;  1SAU A;  3SZT A;  2EIL H;  2E1M C;  2TDX A;  1MMS A;  4A3I J;  1R58 A;  3BTC A;  2M87 A;  3ZQH A;  1HKS A;  3EUH C;  4I6Z A;  2VPL A;  1IN6 A;  4MQ9 F;  2XF7 A;  3ZMV A;  3UNG C;  2NVY J;  3VOE A;  5J8F A;  3MZH A;  1ZLK A;  1D8J A;  2E36 A;  1QRY A;  5E17 F;  2HDC A;  1ETO A;  5H6R A;  3ULQ B;  4D7N A;  4V19 K;  4EAT A;  2Y2Z A;  4XNF A;  3CO7 C;  2CV1 A;  2IT0 A;  1QZY A;  1FBS A;  2IA1 A;  4BAY A;  1YLF A;  2ECC A;  3BCA A;  4CYC B;  3HRM A;  3M1C A;  2R7V A;  3CTA A;  3QP6 A;  4M9S A;  1LFB A;  3SFZ A;  2XPW A;  3BR2 A;  3I9V 2;  4AUX A;  2ZKZ A;  1TWG J;  5ICE A;  1G4D A;  2K9N A;  4AVP A;  1YIO A;  2CFX A;  3OYE A;  2ZJ2 A;  2VQH A;  5FKN A;  2IJL A;  2JA5 J;  3NRV A;  5FLX K;  3A0B C;  4XRF A;  1JXS A;  2NNY A;  4KT6 A;  1QNT A;  1YJ9 I;  2B63 J;  5J8C A;  2GM4 A;  1DP7 P;  1T2K A;  2PMZ N;  2VOD A;  2M7A A;  2MH2 A;  1LDD A;  1W5C C;  2DFH A;  2EFO A;  3FXO A;  3L2V A;  1WHU A;  2KT0 A;  5KVR A;  2BY0 A;  1XN7 A;  2PJR B;  4ZDO A;  1XX5 A;  3WTT C;  2DA5 A;  2XV4 S;  5K7H A;  5J1R A;  4A93 J;  2AQE A;  3K4J A;  2CW7 A;  1WH7 A;  4EGZ A;  1BOB A;  2NYX A;  4P9U A;  1YW8 A;  3GTJ J;  2EFN A;  2NS8 A;  2UXX A;  1AKH B;  5TRD A;  1R1T A;  1XS9 A;  3OMY A;  2EIM H;  1S72 I;  1HLV A;  1FP1 D;  1MND A;  2ZXJ A;  3G4S I;  3GLL A;  1MBJ A;  3DKX A;  1B8I B;  2IGO A;  4KT5 C;  4X0G A;  1PUF A;  3ZXS A;  1BL0 A;  1G3T A;  4XL9 A;  1UB9 A;  2XF5 A;  1VQP I;  2OTJ I;  1TQP A;  4ESJ A;  5B3S H;  4HBL A;  3JRA A;  3CJQ B;  4IJA A;  4GFB A;  4Y17 A;  2K3F A;  1FZP B;  3K1N A;  2D1H A;  5E1W A;  5IYD J;  1IG7 A;  2UV1 A;  4IRI A;  1LEB A;  2BZT A;  4ZYE A;  4AIH A;  3PSF A;  3RZO J;  4KJZ A;  2V6C A;  3QOD A;  5ICC A;  4UB6 C;  3FXK A;  3TOA A;  2DXI A;  1I6X A;  1DGW Y;  5FO5 A;  2BHY A;  1ONV A;  4HW0 A;  1LPQ A;  1IN8 A;  3ML6 A;  5CQE A;  2E35 A;  4L5J A;  3CCL I;  1K78 A;  1YS6 A;  4ZDL A;  4EM2 A;  3ZQ7 A;  4CCK A;  2GZW A;  4QPQ A;  1GXQ A;  2HNH A;  1DUX C;  1JUM A;  1SD6 A;  3JRH A;  1VTN C;  3K2A A;  2JUG A;  1KA8 A;  2V1D A;  2LKP A;  3DPL C;  2PI0 A;  4ZH4 F;  1KON A;  1M1E B;  4G94 A;  1B4A A;  5E8I A;  4A3G J;  2BXZ A;  1WJD A;  4RAG A;  4FQG A;  1ZTR A;  2DFF A;  3F8C A;  2HR3 A;  4BXX J;  2GIZ A;  3B02 A;  1ETY A;  2P7V B;  2QBY A;  3CLO A;  3WTU C;  2E1N A;  1I39 A;  2MAB A;  2YU9 J;  2WTE A;  4NQW A;  3HOS A;  3GX4 X;  3SXY A;  4BXF A;  1VQO I;  2FOK A;  1MSF C;  3PO2 J;  2DMN A;  3CUQ B;  1R9T J;  4QSH A;  4GDF A;  3RQ4 A;  4CIC A;  3RI4 A;  2HVQ A;  1J5Y A;  4C2U A;  1SEU A;  2BW3 A;  2EBI A;  4HF0 A;  4ZZD A;  3K70 C;  2CQN A;  4F7Z A;  2GXG A;  3Q9S A;  1YX3 A;  3ABT A;  3CMY A;  3W3C A;  2M8G X;  2X0L A;  2JSP A;  1MZB A;  3DEU A;  2EZH A;  4DJA A;  1MBE A;  1B6A A;  4KN7 X;  5E79 C;  1UG0 A;  1Z9C A;  2DFE A;  4C9Y A;  3K4M A;  5F0C A;  3HTS B;  2EIJ H;  1V5E A;  1X1P A;  4BQN A;  2JTV A;  5BQT A;  1WJB A;  5D5V B;  2F5E A;  2QQ9 A;  4ZTF A;  2E7X A;  3M8E A;  3P9I A;  1D5Y A;  4OWR B;  4FT8 A;  2Q1Z B;  5F08 A;  3IUO A;  2E2I J;  4DOZ A;  1GV5 A;  2LDU A;  2M30 A;  5DEQ A;  1XMX A;  1FMV A;  3DWL E;  4CYD A;  4M6X A;  4II2 A;  1R5G A;  2LOO A;  3V8K A;  3R4K A;  4AVZ A;  3OYK A;  3V42 A;  4HZF A;  1S7E A;  3FDY A;  4L9T A;  3ZMT A;  3OY9 A;  1D0Z A;  2L7Z A;  4DBQ A;  1U9N A;  1O7L A;  4XOT A;  4XIC A;  4Y52 J;  2B9S A;  3LSM A;  2LY9 A;  2VC1 A;  3MN2 A;  3G6E I;  3CCE I;  5BPD A;  2RGV A;  4HQE A; 
#chains in the Genus database with same CATH homology
 1BIB A;  5FLX Z;  2WC2 A;  2ZFW A;  4IRH A;  4MTD A;  4M71 A;  3LQR A;  1O3Q A;  2L3D A;  3OOP A;  2P5L C;  2M1B A;  5D8L B;  1FC3 A;  5L3B A;  4EMS A;  2HYG D;  2JT1 A;  1D5V A;  1BC7 C;  4L9N A;  3KP7 A;  2JPB A;  3ZPL A;  3RJP A;  5L3C A;  2O0Y A;  3RIR A;  5DD8 A;  4WXH A;  4WCG A;  3U2R A;  3QAH A;  1IF1 A;  4BYY A;  4HOB A;  3HHH A;  2VON A;  2BYV E;  1QQI A;  1U8R A;  3VEP A;  4IF4 A;  3VOD A;  5BS6 A;  3HTU A;  3TDZ C;  5FGM A;  2JSC A;  1TQI A;  3N97 A;  1BC8 C;  1LQ1 A;  1H9G A;  2IA0 A;  4I98 B;  1G3W A;  3V7R A;  3HRT A;  2K4J A;  4GYG A;  4XBF A;  3GUD A;  1REP C;  4O6J A;  2PG4 A;  2O3F A;  2P7C B;  1WRJ A;  3M9A A;  2HTJ A;  4ESB A;  2CG4 A;  3ECO A;  1HXD A;  3K0L A;  3RPU A;  3FXU A;  3LA7 A;  2PEX A;  4LD5 A;  1YW7 A;  4ON0 A;  3V7S A;  5J6X A;  4KIF A;  3F22 A;  1WQ2 A;  3FMS A;  4A0X A;  5LGT A;  2HQR A;  4G6D A;  1TNT A;  4YII A;  5CJ9 A;  1FYL A;  3GFI A;  3QU6 A;  3RKW A;  4KNY A;  4BH9 A;  3LAJ A;  5KK1 A;  3TO7 A;  3F8F A;  3ERE D;  5AIP A;  2PMH A;  2FU4 A;  2ESH A;  1WKM A;  2VOO A;  3TO6 A;  1ODD A;  4FX0 A;  3LQQ A;  4B8X A;  1OYY A;  5AIQ A;  1R5H A;  4LG0 B;  1DPR A;  3DFG A;  2LF8 A;  1OR7 A;  2K7L A;  3TQN A;  2QUF A;  3DPT A;  4XLN F;  3IRQ A;  1K79 A;  2L4M A;  3P7N A;  2UWM A;  3OV8 A;  2EV5 A;  1BN5 A;  1BI2 A;  3GFJ A;  3KP4 A;  3V8L A;  2H94 A;  5JI6 A;  4N9H A;  5LRS A;  2FXA A;  1FSE A;  1P2F A;  2MH9 A;  2QWW A;  5CVR A;  5D5W B;  4WXC A;  1J2X A;  1KU3 A;  1R22 A;  2FRH A;  4PZJ A;  3HOT A;  4G7O F;  1XB4 A;  4BHB A;  3I4P A;  4PGH A;  1IN4 A;  2FML A;  5F64 A;  3F6O A;  4Q48 A;  1J59 A;  2QBY B;  1LNW A;  1UST A;  2OZU A;  2FNP A;  4HX8 A;  1I5Z A;  4HAM A;  5EEH A;  5LGU A;  2Z33 A;  1ULY A;  4YG2 F;  3JSO A;  4ZYG A;  4TV7 A;  4WX9 A;  3BP8 A;  2QZ8 A;  5FD6 A;  3HUG A;  1O57 A;  1J9I A;  1UHM A;  2IVM A;  3IKV A;  3EYI A;  4XLP F;  3IL2 A;  1FSH A;  4WF2 A;  4A0Z A;  1LDK B;  5K5Q A;  1ZN2 A;  3ZN0 A;  3KP5 A;  2J5P A;  4YFN F;  2MA3 A;  1K7A A;  5HS7 A;  1R1U A;  1AOY A;  3HSF A;  3COA C;  1TNS A;  4G9Y A;  4LB5 A;  3EYY A;  2W84 A;  2XKO A;  1B9M A;  2HTS A;  2Z3Y A;  3FX3 A;  2FSW A;  2DAO A;  2GA1 A;  3FXR A;  5DUK A;  1T6S A;  2XAS A;  3IWZ A;  4G6Q A;  2Q0O A;  4LB6 B;  4R8H A;  3T8T A;  3I71 A;  4WWC A;  1Z6R A;  5ED4 A;  1FYK A;  3O6B B;  3EET A;  1EH7 A;  3GXO A;  2DTR A;  4OU0 A;  3CUO A;  2Y48 A;  1D8K A;  2VT3 A;  4Q4Z F;  2KIM A;  3I53 A;  3R61 A;  1YO5 C;  2HEO A;  1W5S A;  3KLN A;  4KDP A;  3BJO A;  2RNJ A;  4EGY A;  2RKH A;  3KET A;  1IZ1 A;  2A5Y B;  3E6D A;  4YIF A;  4ENN A;  2O61 A;  4O5V A;  1I27 A;  1ZGA A;  2MBF A;  3WE3 A;  5HS8 A;  5ILU A;  4I7H A;  3DXJ F;  1Z05 A;  2H6B A;  5FFX A;  3SHF A;  1S3J A;  5A2Q Z;  3BOQ A;  4OIR F;  2PFB A;  4EM0 B;  3KLO A;  1S7O A;  3JW4 A;  2PLY A;  2OU2 A;  3KEQ A;  4WK8 F;  3GW2 A;  3I54 A;  1SFX A;  6PAX A;  2H6C A;  5D4R A;  2QQA A;  1ZHF A;  1P6R A;  3E6M A;  2LNB A;  2W25 A;  4HF2 A;  1DPU A;  2HYF A;  2NS0 A;  1BI0 A;  4RB0 A;  5L3D A;  3WTY C;  2GQQ A;  2V1U A;  3R0J A;  4UNO A;  3RDI A;  4OIQ F;  1B9N A;  3T5X A;  2BE5 F;  2HFH A;  2STW A;  2XRO A;  1IN5 A;  1JHH A;  2FA5 A;  4JQF A;  5H6Q A;  3ZMZ A;  4A2U A;  4GCV A;  1G3S A;  4MEX F;  2JRT A;  3WE2 A;  3MWM A;  1EH6 A;  3T8R A;  3PQJ A;  3J81 K;  1GXP A;  2XAH A;  2ZME A;  3DV8 A;  3ABU A;  2JZY A;  2RDP A;  4MNU A;  1SD5 A;  4LJZ F;  1FP2 A;  5CVJ A;  4CGZ A;  2E1C A;  2L4A A;  1XMA A;  4FHT A;  2EA2 A;  1CF7 B;  2IP2 A;  1IXS B;  1BJA A;  4Y15 A;  2ZO4 A;  1HQC A;  3QOP A;  3RYP A;  2QM3 A;  3RYR A;  1QZZ A;  2DK5 A;  4CZZ A;  5DCM B;  1PP8 F;  1BM9 A;  2VE9 A;  5HLI A;  2G9W A;  2OD5 A;  1MDM A;  2XAJ A;  1YW9 A;  1J7K A;  2EFQ A;  2KRF A;  1BI3 A;  3LAP A;  1F9N A;  3RPQ A;  5CLS A;  3W6K B;  1IXC A;  1FYM A;  2O8X A;  2EJR A;  2EFP A;  1ZRD A;  1ZLJ A;  1P4X A;  3GLX A;  1XMK A;  4I0B A;  1W4M A;  4CO8 A;  1G3Y A;  1TLH B;  5DCF A;  5L3E A;  1MKM A;  2CYY A;  2DK8 A;  5HLH A;  4RB1 A;  2PQ8 A;  1XSX A;  1Z7U A;  3P9C A;  2Y0M A;  4ETS A;  4KIB A;  1XSD A;  5LEK A;  1OYW A;  3HRU A;  3E5Q A;  3ZN1 A;  2HS5 A;  2K86 A;  4HV6 A;  4LLN A;  3GZ5 A;  5FB2 A;  5K1Y A;  3JTG A;  2DQL A;  1F4K A;  3EDP A;  3B73 A;  3F8N A;  3SQN A;  2P5V A;  2XGX A;  3WTW C;  3CDH A;  4Q47 A;  4A6D A;  4ESF A;  2EV6 A;  3KP2 A;  2XAF A;  2ESN A;  2R3S A;  2E7W A;  4OOI A;  1WWX A;  4LLL A;  3I5U A;  5HDN A;  3L9F A;  3VB2 A;  3J81 Z;  4NB5 A;  5ILV A;  2H27 A;  2YPR A;  1E2X A;  4YFX F;  1XGN A;  4RGS A;  1LEA A;  5LGN A;  1ZG1 A;  4JK1 X;  4RGR A;  4U7B A;  2FNA A;  4U0V A;  3BY6 A;  4IXA A;  1GVJ A;  2OBP A;  3JTH A;  1RNL A;  2Z9O A;  2F5C A;  4IHT A;  2QQB A;  1U5T A;  2H09 A;  2CQK A;  5BMZ A;  1B1B A;  5E8G A;  4KMU X;  2CO5 A;  5HLG A;  4IRG A;  2G7U A;  5ICF A;  1KQ8 A;  2DT5 A;  1OKR A;  4G8X A;  2A3S A;  5BPI A;  1PUE E;  4EM1 A;  3HHG A;  3DF8 A;  5K5R A;  1ZG3 A;  3GFL A;  3ZMS A;  4HV5 A;  4Z2Y A;  5BOX A;  1KU2 A;  4I01 A;  1FX7 A;  3FM3 A;  3R6S A;  3WU0 A;  1GHC A;  2Q2E A;  2MC3 A;  2W57 A;  3KZY A;  2HGC A;  4RB3 C;  1XCV A;  4ENJ A;  1HBX G;  2XKP A;  4EJT A;  2Z5U A;  2A6H F;  2JPC A;  3C1D A;  3HYI A;  1SMT A;  2W85 A;  1HW1 A;  3E3V A;  1G6N A;  4A5M A;  2PJP A;  1FLI A;  2COM A;  1PDN C;  1CGP A;  2P6T A;  1ZH5 A;  5L3F A;  2DU9 A;  3I64 A;  4YFK F;  3FZV A;  2ZME B;  1OYI A;  3S2W A;  1R00 A;  1KGS A;  5D5X B;  2Q8K A;  3GFM A;  5IT3 A;  2Z99 A;  1J75 A;  1F5T A;  4UVC A;  1O3T A;  1EV7 A;  2R7D A;  5D6E A;  2MLG A;  3WTX C;  3O2P E;  4B09 A;  1OPC A;  4MQV A;  1QPM A;  1K78 B;  1YTY A;  4WXD A;  1E17 A;  5F6F A;  4Q5S F;  1IW7 F;  3WOD F;  2V1X A;  2AXL A;  3H3Z A;  2ZNY A;  3QP5 A;  4M72 A;  4U88 A;  4FX4 A;  2PMU A;  1D3Y A;  1TQM A;  1S8N A;  3KEO A;  1MDM B;  2HOE A;  2UXN A;  3FHZ A;  3GF2 A;  2D1V A;  3J80 K;  5CVU A;  3FM5 A;  4HLX A;  3FXQ A;  2RV8 A;  5D5U B;  3R0A A;  4LK1 F;  1XGS A;  1YS7 A;  2ELH A;  1BI1 A;  3F6V A;  4KUM A;  1FNN A;  3RKY A;  4L9J A;  3D0S A;  4XSX F;  2IPQ X;  2K02 A;  2QVO A;  1FOK A;  3VFZ A;  2R7F A;  3R60 A;  3LFK A;  3MCZ A;  4AWX B;  3FWE A;  3RTR A;  3GEZ A;  3I59 A;  1W7P A;  3K1M A;  4P55 A;  3BWG A;  4MTE A;  2VE8 A;  3BJA A;  1IN7 A;  2BGC A;  3O3K A;  1BIA A;  2GIV A;  3DQV C;  2QYO A;  3ISP A;  1RUN A;  5HS9 A;  4HX4 A;  1HST A;  3P9K A;  2P5K A;  2ETH A;  4ENK A;  4BHP A;  4LGW A;  3F23 A;  1O3R A;  4QLC U;  1MJB A;  3BPX A;  1LJ9 A;  2L02 A;  4UUV A;  5EEG A;  1O3S A;  1KYW A;  4U7D A;  5L3G A;  1ON1 A;  1ZAR A;  1C0W A;  3I0T A;  1W7P D;  4M9X A;  3FMR A;  5F1R A;  3V7C A;  5HDG A;  1OMI A;  1UFM A;  3RKX A;  1HKQ A;  3REO A;  2VT2 A;  4A0Y A;  1STZ A;  2XHK A;  3MZY A;  2DPU A;  1AWC A;  3Q9V A;  1SAX A;  2FE3 A;  2O6G E;  5E1Z B;  1HKT A;  1J0R A;  2KJC A;  4ENM A;  4PCQ A;  1U5T B;  5LEJ A;  4HDV A;  1WSU A;  1LB2 A;  5D6F A;  3HSE A;  2L01 A;  4BHC A;  2QLZ A;  4M6Y A;  2DW4 A;  2OZ6 A;  3K69 A;  3L7W A;  1K6O A;  1RUO A;  2EV0 A;  2HQN A;  2XVC A;  2ISY A;  1R23 A;  3F3X A;  4UHT A;  1HW2 A;  2VBW A;  2P4W A;  3SZP A;  3GYH X;  1FT9 A;  4OIP F;  2X4H A;  3LA2 A;  3J80 Z;  2XAG A;  5D4S A;  2XUB A;  3DKW A;  1FBQ A;  4K2E A;  1XGM A;  2OA4 A;  5HOO A;  2GA2 A;  2XAQ A;  2LSO A;  1SMY F;  1MD0 A;  3F8B A;  3L2C A;  4BQA A;  2OQG A;  1SD7 A;  1R7J A;  4KFC A;  1S7A A;  2ACJ A;  2ZBK A;  3TO9 A;  3T1B A;  5LRR A;  2CSO A;  4D0P A;  4LFU A;  1U5T C;  1KYZ A;  3T0Y A;  4DNC A;  1FPQ A;  1P4W A;  2YX4 A;  3ROU A;  3ECH A;  1FY7 A;  2FEZ A;  2GXB A;  3ZMU A;  3HIF A;  4GO1 A;  1QGP A;  5LHI A;  4ZYD A;  3IKT A;  3K1P A;  1Z1D A;  1BOA A;  2WV0 A;  3CJN A;  1RIO H;  3G3Z A;  5CVV A;  3H3U A;  4LG0 A;  4L0Y B;  5LLQ A;  2A61 A;  3H92 A;  3TOB A;  3N4M A;  2CW0 F;  3BDD A;  3QRF F;  3DP7 A;  1W5T A;  2EWN A;  3TDU C;  2NAZ A;  1QBJ A;  4HLY A;  4AIJ A;  2FMY A;  3Q5F A;  1KQ9 A;  2DFI A;  4IPA A;  5DD4 A;  2MLK A;  3WGG A;  5H20 A;  3MAJ A;  2RQP A;  3U9G A;  2XRN A;  1B59 A;  1ZGJ A;  1Z6T A;  4BXU A;  3FMQ A;  1P92 A;  2VBY A;  4P96 A;  2V9V A;  2C6Y A;  3QU3 A;  1SFU A;  4M74 A;  3LST A;  5E1X A;  2HKO A;  1JE8 A;  4N0B A;  2RN7 A;  4U0W A;  2PBI A;  3CO6 C;  1S6L A;  2DO7 A;  4UV8 A;  4I09 A;  2ADU A;  3TGN A;  4P9F A;  3I59 B;  1W7P B;  3GVA A;  1NHA A;  4RGX A;  1FBU A;  2M5W A;  4L9V A;  1PP7 U;  5CYV A;  2VC0 A;  5ILS A;  1WI9 A;  1T0F A;  2VBZ A;  2RC4 A;  2F5F A;  3EQL F;  5ICG A;  2D45 A;  1KU9 A;  2RVC A;  4LLG F;  1SFE A;  3JAM K;  2IRF G;  2DI3 A;  2K27 A;  4EJV A;  4EJO A;  3KP3 A;  3AAF A;  3KZZ A;  1BBY A;  2XIG A;  2M8E A;  2YX7 A;  3HRS A;  4EV0 A;  2A68 F;  1QO0 D;  3I58 A;  3KE2 A;  3WTZ A;  4O3M A;  2J5O A;  1V3F A;  4MEY F;  4S05 A;  5LHG A;  1IUY A;  2YR2 A;  3L09 A;  5FD5 A;  1R36 A;  4UVB A;  3IRR A;  1I1S A;  2OAZ A;  4LK0 F;  1JHF A;  3QPT A;  2KKO A;  5E18 F;  4OMZ A;  3CUQ C;  1LVA A;  4CDG A;  2GWR A;  1IRG A;  2ZCW A;  3EUH A;  5DV5 A;  3F8M A;  4KYW A;  3WGI A;  1H9T A;  2DQR A;  4CHU A;  2FF4 A;  2L54 A;  3C3W A;  2STT A;  4HX7 A;  1O7F A;  4IVN A;  4M73 A;  1IAW A;  1Z91 A;  2VN2 A;  3KCC A;  4OIO F;  5HDK A;  2BBY A;  1Y0U A;  2CGP A;  1XD7 A;  4P5O A;  1IXR C;  3WU1 B;  4HQM A;  1ZRE A;  4GXO A;  3E5X A;  2F2E A;  1XSV A;  4L5I A;  1F1Z A;  4CXF A;  1V4R A;  4LMY A;  4N9I A;  4L18 B;  1IRF A;  3C18 A;  4HYE A;  3KFW X;  1U6G A;  1YQA A;  5DYM A;  3WG9 A;  3ELK A;  1Q1H A;  5LHH A;  2D2W A;  5D8K B;  4G7H F;  3TKY A;  4RS8 A;  5JVT A;  3QPH A;  3M7G A;  1T39 A;  3PFI A;  5LBQ A;  4A12 A;  3WTS C;  4KIG A;  2FQ3 A;  2F5D A;  3E6C C;  1DDN A;  2HKX A;  3G73 A;  4OIN F;  1USS A;  4NHJ A;  4HF1 A;  3GZ6 A;  4G7Z F;  4KN4 X;  2NNN A;  4A5N A;  3JSP A;  2EK5 A;  4EJU A;  1LDJ A;  2HZT A;  2KIF A;  4GYI A;  1XCB A;  3F21 A;  5JR3 A;  3BRO A;  4QWQ A;  1TW2 A;  2DBB A;  2VXZ A;  4I0A A;  3WTV C;  5DUI A;  4AD9 A;  3ZP5 A;  3JAM Z;  2IW5 A;  3ZMD A;  2FBH A;  2VOP A;  2P6S A;  4R1H A;  4U0Y A;  2UZK A;  3E5U A;  1UCR A;  2ISZ A;  2K4B A;  1L0O C;  3C7J A;  1ZRC A;  1UHW A;  3E97 A;  2GAU A;  1P4A A;  1HSJ A;  4IHS A;  2W24 A;  3PQK A;  3LA3 A;  2EB7 A;  3F72 A;  5ERI A;  2LF7 A;  5IT9 K;  2VBX A;  2YU3 A;  3E6B A;  2CWE A;  1YYV A;  4OMY A;  3BJ6 A;  5JHU A;  2FBI A;  2P8T A;  3W6J B;  2O03 A;  4Y13 A;  1RI7 A;  4KIC A;  1I1G A;  4RAY A;  5FFZ A;  1SD4 A;  5HVQ C;  5DDG A;  3U1D A;  4UXN A;  1T98 A;  3FF5 A;  5K5O A;  4MHG A;  1A04 A;  5A2Q K;  1CF7 A;  3MFK A;  1U78 A;  3WGH A;  3V4G A;  1U2W A;  3V8J A;  3KP6 A;  2YSR A;  2NRA C;  2EA4 A;  1ZAO A;  2OQR A;  4E70 A;  4ASN A;  1EH8 A;  5DCM A;  4I2O A;  3CUQ A;  4ZYH A;  2KIU A;  3M1E A;  2V79 A;  3K2Z A;  4HDU A;  4RAZ A;  3IC7 A;  4BNC A;  2QEN A;  2WWY A;  2G7H A;  1TW3 A;  4GGG A;  2MD5 A;  2EFW A;  3NQO A;  3K9T A;  4I02 A;  1YG2 A;  4L0Z B;  3J7A O;  1XGO A;  4EJW A;  1L3L A;  2IA2 A;  2A6E F;  5TJJ A;  5AON A;  3BPV A;  3D5L A;  4ZZL A;  2BV6 A;  4MGR A;  2DLL A;  2B0L A;  2PN6 A;  1ZRF A;  4KMF A;  2AS5 F;  1X3U A;  3NEU A;  1T38 A;  1XDU A;  1MJA A;  1U3E M;  4AIK A;  4PGG A;  4DQ2 A;  4RB2 C;  3GO5 A;  4XSZ F;  5CVI A;  2Y75 A;  3GWZ A;  4R79 A;  3IHU A;  2BEO A;  1TTY A;  1MGT A;  1XDS A;  5E20 A;  3HSR A;  1YFH A;  3IWF A;  2M45 A;  3M8F A;  3L00 A;  1TBX A;  4EQQ A;  1S29 A;  1ZYR F;  4RGU A;  4UVA A;  3MQ0 A;  4KA4 A;  4EVI A;  1R1V A;  4S04 A;  4PDK A;  4JBA A;  1ON2 A;  5IT9 Z;  4HA8 A;  1JGS A;  2DPD A;  2ZNZ A;  1HW5 A;  1ZG5 A;  1H0M A;  4H0E A;  4M9Z A;  1MJ9 A;  4UV9 A;  1RZ4 A;  5JFR A;  3MEX A;  2A69 F;  4A6E A;  1KQ0 A;  3BZ6 A;  1KU7 A;  2HWV A;  2FBK A;  2KJB A;  3LWF A;  2A07 F;  1FWZ A;  3SZT A;  2TDX A;  1R58 A;  2M87 A;  1HKS A;  1IN6 A;  4MQ9 F;  3ZMV A;  5J8F A;  3VOE A;  1ZLK A;  3MZH A;  1D8J A;  5E17 F;  2HDC A;  5H6R A;  3ULQ B;  3CO7 C;  2IT0 A;  1QZY A;  1FBS A;  2IA1 A;  4BAY A;  1YLF A;  3HRM A;  3CTA A;  3QP6 A;  4M9S A;  3SFZ A;  2ZKZ A;  5ICE A;  1G4D A;  4AVP A;  1YIO A;  2CFX A;  2ZJ2 A;  2IJL A;  3NRV A;  5FLX K;  4XRF A;  1JXS A;  2NNY A;  1QNT A;  5J8C A;  1DP7 P;  1T2K A;  2VOD A;  2MH2 A;  1LDD A;  2EFO A;  5KVR A;  1XN7 A;  3WTT C;  2XV4 S;  4EGZ A;  2NYX A;  4P9U A;  1YW8 A;  2EFN A;  2UXX A;  5TRD A;  1R1T A;  1FP1 D;  2ZXJ A;  4KT5 C;  1G3T A;  1UB9 A;  1TQP A;  4ESJ A;  4HBL A;  4IJA A;  4Y17 A;  1FZP B;  3K1N A;  2D1H A;  5E1W A;  4IRI A;  1LEB A;  4ZYE A;  4AIH A;  2V6C A;  5ICC A;  3TOA A;  1I6X A;  5FO5 A;  1ONV A;  4HW0 A;  1IN8 A;  3ML6 A;  4L5J A;  1K78 A;  1YS6 A;  4EM2 A;  3ZQ7 A;  2GZW A;  1GXQ A;  1DUX C;  1SD6 A;  1VTN C;  1KA8 A;  2V1D A;  2LKP A;  3DPL C;  2PI0 A;  4ZH4 F;  4G94 A;  1B4A A;  5E8I A;  3F8C A;  2HR3 A;  3B02 A;  2P7V B;  2QBY A;  3CLO A;  3WTU C;  2E1N A;  2WTE A;  4NQW A;  3HOS A;  3GX4 X;  3SXY A;  2FOK A;  3CUQ B;  4CIC A;  3RI4 A;  1J5Y A;  4HF0 A;  4ZZD A;  4F7Z A;  2GXG A;  3Q9S A;  3ABT A;  2X0L A;  1MZB A;  3DEU A;  1B6A A;  4KN7 X;  1Z9C A;  3HTS B;  2JTV A;  5BQT A;  5D5V B;  2F5E A;  2QQ9 A;  2E7X A;  3M8E A;  3P9I A;  4FT8 A;  2LDU A;  2M30 A;  5DEQ A;  4CYD A;  4M6X A;  1R5G A;  3V8K A;  3R4K A;  4HZF A;  4L9T A;  3ZMT A;  1O7L A;  2VC1 A;  5BPD A;  2RGV A;  4HQE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...