2IRFG

Crystal structure of an irf-2/dna complex.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
109
structure length
109
Chain Sequence
RMRMRPWLEEQINSNTIPGLKWLNKEKKIFQIPWMHAARHGWDVEKDAPLFRNWAIHTGKHQPGIDKPDPKTWKANFRCAMNSLPDIEEVKDRSIKKGNNAFRVYRMLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an IRF-DNA complex reveals novel DNA recognition and cooperative binding to a tandem repeat of core sequences.
pubmed doi rcsb
source organism Mus musculus
molecule tags Gene regulation/dna
molecule keywords DNA (5'-D(P*AP*AP*GP*TP*GP*AP*AP*AP*GP*(5IU)P*GP*A)-3')
total genus 30
structure length 109
sequence length 109
chains with identical sequence H, I, J, K, L
ec nomenclature
pdb deposition date 1999-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00605 IRF Interferon regulatory factor transcription factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2irfG00
1W5SA 3QU6A 1KYZA 3SZTA 2IT0A 2P4WA 1U6GA 4A6DA 5FB2A 2XKPA 4G94A 3RKYA 4GGGA 2OZ6A 4D0PA 3LSTA 1P4WA 4LG0A 2DT5A 1I27A 4FX0A 5DCMB 3L00A 2BBYA 1O3QA 2EV6A 4EM2A 1J9IA 2IJLA 1DUXC 2X0LA 2GIVA 4FX4A 2KIMA 5BQTA 1V4RA 1TTYA 3E5XA 1FBUA 2XKOA 3TO6A 3WODF 3VEPA 2V79A 2RDPA 3LA3A 1QO0D 1K6OA 2E1CA 5J8CA 2Z99A 4ENKA 3HIFA 1WI9A 3F23A 1R22A 1BM9A 1J2XA 1SD4A 2MH2A 4LB6B 4HZFA 4M73A 2XAHA 3JSPA 4L18B 3LA2A 3P9CA 1XGMA 1EH8A 2HOEA 3I53A 2JPCA 1YO5C 3EYYA 4BXUA 2PFBA 4ESBA 1UB9A 5IT9K 1IXCA 3R4KA 1ULYA 1P2FA 1CGPA 2FBHA 3T8TA 1LEBA 1TQMA 2MBFA 2QWWA 4M6XA 1T98A 3WGHA 1D3YA 2PQ8A 2RVCA 1HSTA 3K9TA 3R0JA 4L5JA 2UXXA 3VB2A 1HW5A 3F72A 4L9TA 3ZMTA 3ZQ7A 2ZXJA 2A07F 5LRRA 1U5TB 4KMFA 3M1EA 3R6SA 1K79A 1QQIA 2ZKZA 5L3BA 2ACJA 4CGZA 4RGSA 2DFIA 2K86A 2K7LA 1FNNA 1G6NA 5D4RA 1FSEA 4ZYGA 2XVCA 1G3TA 1JGSA 2EFWA 2Q8KA 2BE5F 3KP4A 2K4JA 2DTRA 3K1PA 1EV7A 1SFXA 3M8EA 1KQ9A 1DPRA 3ABUA 4BQAA 5J6XA 4LLLA 2P6SA 4Z2YA 5H6QA 1OMIA 4ZH4F 3CUQB 4A0YA 1KGSA 3MFKA 1LB2A 2LNBA 3HYIA 1KYWA 1MZBA 2L4AA 2VOPA 4G8XA 2EFQA 5ERIA 2FA5A 3EDPA 3V7RA 5DEQA 4GCVA 3JTGA 2G9WA 5FO5A 5BPIA 2P8TA 2HGCA 3G73A 4M71A 4OMYA 1RZ4A 2VT3A 2JTVA 3KZZA 2LF8A 3DKWA 3KZYA 3NQOA 1C0WA 4OIRF 3Q5FA 2BEOA 2AS5F 1ZRCA 1XDUA 4ZZDA 4XRFA 2DU9A 4P9FA 2EFPA 2RKHA 1H0MA 2CFXA 3S2WA 4KN4X 2ISZA 2VXZA 3V8KA 1FSHA 4ENNA 2CGPA 1HSJA 4A12A 3ISPA 1HKQA 1OYYA 4UHTA 2Q0OA 3WE3A 3E3VA 2W24A 1BN5A 4KT5C 4IRHA 2PEXA 1IN4A 1G3SA 3J7AO 3CTAA 4ENMA 2BV6A 2IA2A 1KA8A 5JVTA 4WK8F 3F8BA 2FEZA 3IRQA 3V4GA 4HA8A 1STZA 1MDMB 3FMSA 4HLYA 1K78B 5FFZA 2L02A 1R36A 4R1HA 3JAMK 3KEQA 1KU7A 3MQ0A 1D8JA 4CDGA 2FBKA 3FHZA 3DV8A 4M72A 2CO5A 3E97A 3GEZA 3GW2A 1ZRDA 2ZO4A 1IN5A 2WWYA 1CF7B 4AIHA 2L3DA 2FE3A 5A2QZ 1IRGA 4LD5A 3FXRA 2EA2A 2VC1A 2HKXA 3LFKA 1J59A 4CXFA 4P5OA 3TDUC 3DFGA 1S6LA 2Z33A 1YW7A 4ESFA 2M30A 4NB5A 1XSVA 3BJAA 4HDVA 3KLNA 1V3FA 1TW2A 3ZMZA 3NEUA 3KP6A 4EJOA 3I4PA 4P9UA 2NNNA 3CUQA 1WSUA 4MEYF 3ML6A 3IKVA 4G7OF 2RGVA 4A0ZA 4Q4ZF 3P9KA 3NRVA 5CJ9A 1LNWA 4AWXB 2GA2A 3PQJA 3PQKA 4BH9A 3HSFA 4A5MA 2XAGA 3I59B 4G9YA 3BZ6A 3EYIA 2R7FA 3FM3A 1SD5A 1GXQA 2ESHA 3D0SA 3DQVC 5F6FA 1AWCA 1PDNC 2DBBA 2HTJA 3QAHA 4IVNA 2HYFA 1SAXA 4L9JA 1FBQA 3LQQA 4WXHA 1WKMA 2P6TA 4KMUX 4NHJA 4EVIA 1FLIA 2QQ9A 4I2OA 5HVQC 2F5FA 5CVRA 5DV5A 5E8IA 1KQ8A 3ELKA 1XMKA 4U0VA 1ON2A 4JK1X 1IXSB 5L3GA 3JTHA 3D5LA 4KUMA 4U88A 5E20A 4K2EA 5F1RA 1RI7A 3V7CA 1B9NA 4KA4A 3OV8A 1S3JA 4HDUA 1P6RA 1R1TA 4M9SA 5HLIA 4M9ZA 1ZG5A 4KIFA 1LJ9A 3BY6A 2RQPA 3ZP5A 4MHGA 2H27A 2YX4A 1H9TA 5HOOA 4KN7X 2KIFA 2O8XA 2KRFA 1YW8A 2OD5A 1DDNA 1G4DA 3CDHA 4KNYA 1U5TA 2EJRA 1H9GA 2AXLA 4MTDA 5DDGA 5EEHA 2GA1A 5JI6A 1ZLKA 1HXDA 5HDGA 4UVCA 4S05A 2KJCA 1P4XA 2GZWA 3JSOA 1FOKA 4LJZF 2E1NA 4EJWA 3ZMVA 5ILUA 5ICGA 1CF7A 1R00A 2BYVE 3RYPA 2M8EA 2IPQX 3T8RA 3BJOA 1REPC 1HW2A 1OYIA 4DQ2A 4DNCA 2K27A 2ZBKA 1MJAA 2Z3YA 1F5TA 4HBLA 5E1WA 1BC7C 2EK5A 3HUGA 5DYMA 3K69A 3ZN1A 2BGCA 2M1BA 3TKYA 1ZGJA 2MLKA 3SXYA 4RGUA 4IXAA 1UHMA 1TQIA 4HW0A 1O3SA 2JT1A 3HSEA 2QENA 1ZHFA 3KCCA 4M9XA 1XD7A 2TDXA 3MZHA 4L0ZB 4Y13A 4S04A 2YX7A 1IN8A 2G7HA 3I59A 4NQWA 1W7PB 1A04A 3WTWC 1XSXA 5HLHA 3M9AA 4MQVA 3HOSA 4HF0A 4HX8A 2JZYA 4RAZA 2UZKA 1U3EM 2CSOA 2ZFWA 5J8FA 4BYYA 4EMSA 3KETA 2XAQA 3LQRA 3L09A 2HKOA 3CJNA 1IUYA 3E6MA 2Z5UA 5JR3A 3QP6A 4B09A 3WTUC 3HRUA 3FX3A 3LAJA 3V8JA 1LDDA 1HQCA 1ZG1A 1ZG3A 5CVUA 4AIKA 3T0YA 1T0FA 3TQNA 1GVJA 1OR7A 4IF4A 4RGXA 2P7CB 3E6DA 2HTSA 4M6YA 1R1UA 3OOPA 2MC3A 3CO6C 2QBYA 3F8CA 1RUOA 3U1DA 2OAZA 4HF2A 3QRFF 1W5TA 3HOTA 1YQAA 1IZ1A 4XLNF 2CW0F 2VBYA 3B02A 5CVJA 4KIBA 5BS6A 5TJJA 4AVPA 1BI3A 1ZN2A 5D8LB 3M8FA 2HS5A 3FXQA 3T5XA 1ODDA 2ETHA 2KKOA 4A5NA 3MWMA 2XAFA 2A69F 4YIFA 1K7AA 5F64A 2E7WA 4A0XA 2ZJ2A 3FXUA 5FD5A 4QWQA 5LEKA 2IW5A 2PG4A 5LRSA 4PCQA 4ESJA 3KE2A 1S8NA 3WGIA 2R3SA 2QM3A 3DEUA 2A3SA 2XASA 5D5XB 5ICFA 3HHHA 2NS0A 3F22A 5LBQA 4O6JA 4GYGA 4HQEA 5LEJA 2STTA 3H3UA 3BPVA 5K5OA 5LLQA 4I0BA 2JPBA 2L54A 5HDKA 4G7HF 1XGOA 1MKMA 3ABTA 5D5WB 3HSRA 1FPQA 3BOQA 3J81Z 4CZZA 4LK0F 1R5GA 4RS8A 5D5UB 4TV7A 1JXSA 2RC4A 3HRMA 1F9NA 3WTSC 4FT8A 3RDIA 1FP2A 2VODA 1FYMA 4YIIA 2M5WA 2HR3A 3O3KA 1BI2A 1B4AA 3WG9A 3SQNA 2XHKA 2STWA 3HTSB 1FC3A 2ZMEB 4UV8A 2FMLA 4UXNA 3H92A 3REOA 3F3XA 3GZ5A 1RNLA 4ZYHA 5HS8A 3KP7A 2H94A 3ZMDA 1W7PD 5D5VB 1QNTA 1TBXA 4LK1F 2GXBA 3ZN0A 4BHPA 3FM5A 5DD4A 1TNSA 1XDSA 3FMQA 1HKSA 1IF1A 2H09A 1IW7F 3FMRA 1Y0UA 2OQGA 3IRRA 3E5UA 4HV5A 3CLOA 4UV9A 3BP8A 3F8MA 2FNAA 1SMYF 4P55A 5BMZA 4OU0A 1YFHA 3C3WA 4IHTA 3MAJA 2ZCWA 4B8XA 4Q47A 1LEAA 5HLGA 2OZUA 2RV8A 1FWZA 2MH9A 5E17F 1QZZA 1R1VA 4BHCA 1XSDA 1XGNA 3GXOA 4LG0B 2WC2A 3IWZA 2Y48A 1TNTA 2EB7A 1R5HA 2QUFA 3E6CC 3O6BB 3R0AA 4CYDA 2YSRA 4O3MA 2HQNA 2VN2A 3T1BA 2MD5A 2DK5A 1WWXA 2PMHA 2P5LC 4RB3C 1BI0A 2HQRA 4RB0A 2DI3A 3ULQB 5JFRA 4R8HA 4M74A 2GQQA 2GXGA 5D6FA 3DP7A 3F21A 4MTEA 1XGSA 1HKTA 4IRIA 4EGYA 1SD6A 4QLCU 3IKTA 4YFNF 1D8KA 3J81K 3GF2A 1EH6A 2FMYA 5FGMA 4I01A 1J5YA 2O61A 3IL2A 4R79A 3TDZC 4IJAA 2LSOA 4I02A 3QOPA 6PAXA 5K1YA 4PDKA 3RTRA 1S7AA 4HV6A 5CLSA 4OIQF 1HBXG 4HLXA 2PI0A 1FT9A 3K0LA 1IN6A 2DO7A 1MJ9A 4HQMA 1T6SA 4N9HA 1XCVA 3RPQA 5TRDA 2PJPA 4EJTA 1YS7A 3GZ6A 1KU2A 1OYWA 1G3WA 4CHUA 2W57A 2ELHA 5LHGA 1OKRA 1SFEA 3ECOA 1G3YA 2D45A 1MJBA 4XLPF 5LGTA 4H0EA 3WTZA 5ICCA 2HDCA 4ETSA 1UHWA 2F2EA 2WV0A 1QZYA 4O5VA 3M7GA 4Y15A 1U8RA 3RKWA 2H6CA 4HAMA 2VBXA 3GFLA 3DPTA 1NHAA 2ESNA 1U78A 4CO8A 3RI4A 3J80K 4L9NA 4ZYEA 4BAYA 2VBZA 1KU3A 3WTVC 2Q2EA 5DUIA 2PN6A 1PUEE 4U7BA 1DPUA 5DD8A 5FLXK 3C7JA 5L3FA 2O03A 1FZPB 1F4KA 4BNCA 4RB2C 5IT9Z 2A6EF 1USSA 5JHUA 4A2UA 2PMUA 4HX7A 2V1DA 3K1MA 5AIQA 2HWVA 4ON0A 3KEOA 2P5VA 3RPUA 1WRJA 2R7DA 4PGGA 2D1VA 4CICA 4IHSA 1R58A 1BJAA 3I58A 2EV5A 3CUQC 2F5DA 1J0RA 4WWCA 4A6EA 3WTYC 3WTXC 1Z1DA 4RB1A 2VE9A 3TOAA 3WU1B 5L3EA 3ECHA 3K1NA 1R23A 4UUVA 2VOOA 4GYIA 1Z6RA 2IA1A 1IN7A 1LDJA 4XSXF 5E1XA 1L0OC 3JAMZ 2DAOA 2NYXA 1WQ2A 4L0YB 2A68F 2PLYA 4Q5SF 5LGNA 5D8KB 4U0WA 3BPXA 3DPLC 2QQAA 4HYEA 4MEXF 2FXAA 4ENJA 2PBIA 4WF2A 5L3DA 3QP5A 3P9IA 2M87A 1I6XA 2J5OA 4KIGA 3K2ZA 1E2XA 1USTA 4UVAA 3BJ6A 4OINF 2CQKA 3H3ZA 1LQ1A 4LLGF 1B9MA 2KIUA 2YU3A 1HW1A 2EFOA 4KICA 1QPMA 4LGWA 4FHTA 1GXPA 3F6VA 1YW9A 4HF1A 1R7JA 1U5TC 4Y17A 1BIBA 1ZREA 2G7UA 2O0YA 2NRAC 1YIOA 5KVRA 5AONA 4XSZF 4KFCA 4I98B 1TW3A 2FF4A 3MCZA 5E1ZB 5K5RA 3MEXA 2O3FA 4YFKF 3I54A 3L2CA 1I5ZA 5L3CA 1S29A 2H6BA 2A6HF 1QBJA 3RKXA 4RGRA 1YS6A 3V7SA 2E7XA 3L7WA 3VODA 2V1XA 5BPDA 3MZYA 4ASNA 1I1GA 2OU2A 2NAZA 2W25A 4JBAA 4EJVA 2RNJA 4N9IA 3CO7C 1GHCA 2P5KA 2W84A 3GVAA 1PP7U 3C1DA 2FQ3A 1MGTA 2YPRA 2VE8A 3GX4X 1FBSA 5ILVA 1KQ0A 4L9VA 3U2RA 1JHHA 1ZAOA 2F5EA 2V9VA 3GFJA 4KDPA 3RIRA 1SD7A 1E17A 5H20A 3GO5A 1W7PA 2XAJA 1DP7P 2XGXA 2QYOA 3JW4A 2HFHA 2FU4A 2LF7A 1YLFA 2QLZA 1O3RA 3LA7A 3I5UA 2CG4A 4YFXF 1I1SA 4WX9A 1ON1A 4IPAA 3ZMSA 4LLNA 2JSCA 1FX7A 2DQRA 4AD9A 3HRSA 2VBWA 1K78A 4MGRA 3FF5A 1AOYA 2F5CA 4N0BA 3WU0A 4LFUA 4GO1A 3P7NA 4WXDA 2ZNZA 1LDKB 3F8NA 1ZRFA 3GWZA 3AAFA 5HS7A 2COMA 2FRHA 2FOKA 5E18F 4UNOA 3E5QA 3F8FA 3CUOA 3SZPA 2K02A 2OBPA 5HS9A 4EJUA 2DPUA 2IVMA 3Q9VA 3VOEA 2CWEA 3GLXA 5HDNA 3R61A 4ZYDA 1D5VA 2IP2A 3DF8A 1TLHB 3ZPLA 1T39A 1T38A 2MA3A 4OIPF 3GFMA 3I64A 3GUDA 3PFIA 3B73A 4L5IA 5DCMA 3HHGA 3WTTC 1XCBA 1XB4A 3ERED 1YYVA 4ZZLA 1XN7A 3J80Z 2EV0A 2DPDA 1ZARA 4WCGA 3W6KB 5LHIA 1T2KA 3ROUA 2OA4A 5FFXA 2M45A 1B59A 1P92A 2V6CA 1S7OA 1ONVA 1J7KA 4F7ZA 4HOBA 2FBIA 2MLGA 4EM0B 1ZLJA 3SFZA 1IXRC 2EWNA 1X3UA 1ZH5A 5CYVA 5ICEA 3E6BA 1SMTA 4PGHA 4XBFA 4OOIA 1FYKA 4I0AA 2A61A 3IWFA 4G6QA 1IAWA 2P7VB 1F1ZA 2D1HA 1UFMA 4IRGA 1O3TA 1Z7UA 1Z05A 3HRTA 5DCFA 2DQLA 2XROA 5K5QA 4YG2F 5D6EA 4MQ9F 1OPCA 2B0LA 5DUKA 3N4MA 3BROA 3C18A 2D2WA 4P96A 3QU3A 3SHFA 2ZMEA 3VFZA 5E8GA 4RAYA 3F6OA 2W85A 5D4SA 3LAPA 5CVVA 1BIAA 3I71A 4Q48A 2VT2A 1BI1A 2V1UA 1O7FA 1O7LA 3WE2A 4JQFA 4HX4A 5A2QK 3BWGA 5CVIA 3WGGA 1SFUA 1P4AA 1J75A 2DLLA 4GXOA 4UVBA 2K4BA 1Z6TA 3FWEA 4LB5A 3U9GA 2C6YA 1JHFA 2L01A 2IA0A 3TGNA 2J5PA 2YR2A 4EQQA 2Y0MA 3IHUA 2EA4A 2QQBA 5ED4A 1Z91A 1ZYRF 3KP5A 3BDDA 2CYYA 3DXJF 4I09A 2NNYA 1L3LA 4EGZA 2XRNA 3GYHX 4KYWA 3COAC 1EH7A 4EV0A 2GAUA 1MD0A 1B6AA 2HYGD 2HZTA 2A5YB 3G3ZA 2OQRA 3I0TA 2Y75A 2O6GE 3O2PE 1TQPA 1RUNA 4I7HA 5LHHA 2UWMA 3TO7A 1Q1HA 3LWFA 3RYRA 2ZNYA 2UXNA 3QPTA 2RN7A 1QGPA 4MNUA 5BOXA 5FD6A 1B1BA 1RIOH 4BHBA 1XMAA 5EEGA 4G7ZF 1LVAA 4EM1A 3W6JB 2LKPA 2VC0A 3EQLF 3KLOA 4E70A 1JE8A 2JRTA 1ZGAA 2XV4S 1BBYA 4G6DA 1W4MA 3R60A 2QZ8A 2L4MA 3N97A 1KU9A 2XIGA 1UCRA 5H6RA 1O57A 3KP2A 4PZJA 5ILSA 3HTUA 3RJPA 5KK1A 2X4HA 2DK8A 3EETA 2IRFG 1BOAA 4AIJA 3TO9A 2ADUA 4LMYA 2QVOA 1FP1D 1FY7A 4WXCA 3TOBA 2WTEA 5LGUA 1MDMA 1PP8F 1VTNC 3KP3A 2XUBA 1YTYA 2HEOA 5AIPA 1Z9CA 1U2WA 2EFNA 3ZMUA 2KJBA 2DW4A 3GFIA 2FNPA 3EUHA 2QBYB 2GWRA 3IC7A 1YG2A 4U7DA 5IT3A 2LDUA 3Q9SA 3L9FA 1FYLA 3QPHA 4U0YA 4OMZA 1BC8C 2FSWA 3V8LA 1IRFA 2ISYA 4OIOF 3FZVA 5FLXZ 2Z9OA 2VONA 3KFWX
chains in the Genus database with same CATH superfamily
1QHHD 3LL7A 1W5SA 1WHUA 3ZRGA 3QU6A 1KYZA 1A6QA 2NVYJ 4W1UA 3SZTA 3S17J 2IT0A 2H1LA 3MN2A 4BBSJ 2R92J 2HQAA 4A3JJ 2GOXB 2P4WA 1U6GA 2E1MB 4A6DA 3BTIA 5FB2A 4IZZA 4IKFA 2XKPA 4G94A 1N75A 3DKXA 3M8JA 2OZ6A 4GGGA 3RKYA 1IG7A 2KDOA 2Z16A 3BC8A 4XRSG 3CESA 4D0PA 3LSTA 1S7EA 4XLFA 1P4WA 4LG0A 3G6EI 2WY7Q 2DT5A 1I27A 4FX0A 3A2KA 5DCMB 2MGQA 4PJLA 5IY5H 3L00A 2Z2SB 2BBYA 1O3QA 2EV6A 2G0EA 1LE8B 1ETVA 4EM2A 5HNHA 1H88C 2IJLA 1J9IA 1DUXC 2CQNA 2W4SA 2VIXA 2X0LA 2GIVA 4FX4A 2KIMA 5BQTA 3SEQA 1V4RA 3V42A 1TTYA 2XGDA 1GT0C 4BE1A 3QPLA 2CRGA 3E5XA 1FBUA 2XKOA 3GTLJ 3TO6A 1X4OA 3WODF 1T95A 3VEPA 3ZOBA 2V79A 5KHDA 2K9NA 2RDPA 3LA3A 3GTKJ 4XKBA 1QO0D 1K6OA 2E1CA 2ID3A 5J8CA 2Z99A 4ENKA 2DOAA 2LFBA 2COBA 3HIFA 4DBQA 5EYRA 2DFEA 1WI9A 2CUZA 3GZNB 3ZQLA 3F23A 1FTTA 1R22A 1BM9A 1J2XA 1SD4A 4UUSA 2MH2A 1FOYA 4LB6B 4HZFA 4M73A 5HNFA 4BEHA 2XAHA 1F43A 1ZELA 3JSPA 3I3LA 1YHQI 4L18B 3LA2A 4F52A 1S5LC 3P9CA 1XGMA 1WI3A 3H5AA 2BZTA 1EH8A 2CS3A 2HOEA 2CW8A 3I53A 5GAEJ 1HC8A 2JPCA 1YO5C 3K4CA 3EYYA 4BXUA 2OJED 1VQ6I 2PFBA 3DU6A 3CJTB 3DBLB 4ESBA 2VJIA 2WB1N 1UB9A 5IT9K 1IXCA 3R4KA 1ULYA 4RMNA 2R7ZJ 1P2FA 1CGPA 2WAQA 3MVPA 2FBHA 3T8TA 4BQQA 1LEBA 2K9LA 2X6OA 1TQMA 1E3HA 2MBFA 2QWWA 4M6XA 4AVZA 4BQNA 1T98A 3WGHA 3FBIB 1D3YA 1MH4A 2PQ8A 2V1NA 3RZDJ 2RVCA 1HSTA 5EGOB 1TWHJ 3K9TA 3PNTA 3R0JA 2NVQJ 4L5JA 3I4NJ 2K5CA 2UXXA 3VB2A 1HW5A 4U87A 2E5NA 2EINH 3F72A 1G8XA 3VSKA 4L9TA 3ZMTA 3ZQ7A 2ZXJA 2A07F 3CCEI 1B8IA 1FEXA 3HPHA 1UELB 5LRRA 3MKLA 1U5TB 4XLAA 4KMFA 3M1EA 2HYJA 3R6SA 3CCRI 3S1NJ 1K79A 2ELJA 1I3QJ 1QQIA 2EIKH 1W36D 2ZKZA 5L3BA 2X1EA 4Y33A 2ACJA 4CGZA 5FRNA 2DA5A 1MSFC 4ZDPA 4RGSA 1PUFB 9ANTA 2DFIA 2HNHA 2K86A 2NVUB 2K7LA 4XQFA 1FNNA 1T08B 1G6NA 5D4RA 1FSEA 4ZYGA 2XVCA 1JGSA 1G3TA 1QPIA 2EFWA 2Q8KA 2BE5F 3KP4A 2K4JA 4CUGA 2DTRA 2E19A 3ZQQA 4ZJZA 3K1PA 3OSGA 1FIPA 2OF7A 1EV7A 1SFXA 3M8EA 5F04A 2LBFA 2EPFA 1MMDA 1KQ9A 1DPRA 3ABUA 4B44A 4BQAA 1M1EB 4BXXJ 3G71I 4BE0A 5J6XA 4LLLA 5IYDJ 2P6SA 4D7MA 2QKLB 3BR6A 4Z2YA 3SEZA 5H6QA 3WG7H 2Y0SN 1OMIA 3PIPF 2XB5A 4ZH4F 1D0ZA 3AKZA 3CUQB 4B3XA 4A0YA 5FLVA 5F1JA 3QYEA 1KGSA 3MFKA 2LNBA 1LB2A 5IOYA 2X1DA 2R93J 5GAHJ 2ZSIB 1X1DA 2HU9A 3OWTA 2L5QA 3HYIA 1IC8A 3UKGA 4C30A 1KYWA 1MZBA 2L4AA 2VOPA 4G8XA 2EFQA 3ZCOA 5ERIA 4EATA 2FA5A 4PUSA 4J00A 1GV2A 1WH5A 3EDPA 3V7RA 5DEQA 2XSDC 1MBKA 1YJWI 3H3VK 4PFOA 4GCVA 3JTGA 2G9WA 5FO5A 2H1KA 4XKVA 2R7TA 2XRLA 5BPIA 2KMUA 2P8TA 1QVTA 2F4OB 2HGCA 2CQ7A 3PO2J 2JUGA 4A69C 3G73A 4M71A 4BQOA 4OMYA 1RZ4A 2VT3A 3FK7A 3K70C 2JTVA 3KZZA 2LF8A 3CP2A 3ZQIA 2GLOA 1SVLA 4RBOA 2V4JC 4D5FA 2XC7A 2ZB9A 3DKWA 3KZYA 4XLEA 3NQOA 1C0WA 4OIRF 5GAGJ 3BLYA 3Q5FA 2BEOA 2AS5F 2CW7A 1ZRCA 1XDUA 2KP6A 2V7FA 3DBHB 2IGNA 3Q3SA 4Z6YA 4ZZDA 4XRFA 4B3AA 2DU9A 4P9FA 3MKYB 3QYFA 2EFPA 4GRIA 3PSIA 3PO3J 3TP0A 3HOZJ 2RKHA 1H0MA 4M3FA 2AQEA 3GMEA 2CFXA 3S2WA 4XKWA 1A31A 4KN4X 5C4JJ 2ISZA 3S3NA 3CF2A 2LC2A 2VXZA 3V8KA 3S16J 1FSHA 4ENNA 4UB6C 1G59A 3GLLA 2LOOA 2CGPA 1SANA 1HSJA 3QQAA 4A12A 3ISPA 1HKQA 1OYYA 2K40A 4UHTA 5GTIC 3JREA 2PX9A 2Q0OA 2WAEA 3WE3A 3E3VA 2W24A 1QA6A 2DJNA 2EZLA 4Y52J 1BN5A 4KT5C 3HOWJ 1DP3A 4IRHA 4FE7A 2PEXA 4IO9F 1IN4A 5FKMA 1G3SA 3NWTA 2WV1A 3L2QA 3J7AO 3CTAA 4ENMA 1U9OA 1U0JA 2BV6A 2IA2A 4A3BJ 1KA8A 5JVTA 3AFHA 3OYLA 2CQXA 5EG0B 4ITVA 4WK8F 2CFOA 3F8BA 2FEZA 3IRQA 5C4XJ 2UUZA 5E3MA 5FKLA 4HA8A 3V4GA 1STZA 3VWBA 1MDMB 2NS7A 3FMSA 1A5JA 4HLYA 1K78B 5FFZA 2L02A 2DODA 1R36A 5IYCJ 1T33A 2RREA 4BACA 4R1HA 1R49A 3JAMK 3KEQA 3L1PA 2E1OA 3OMYA 5EDNA 3MQ0A 5M5XJ 2L7MP 4XRSA 4CDGA 1KU7A 2FBKA 1D8JA 3FHZA 3DV8A 4M72A 2D5VA 2CO5A 3KEYA 2RQQA 3E97A 3GEZA 4A3MJ 3GW2A 1ZRDA 2ICWG 2ZO4A 3GTMJ 2WY8Q 1VQ8I 1IN5A 1D0XA 3KYDB 3RSNA 2WWYA 1CF7B 4AIHA 4LIVA 2WA0A 4QSHA 4XRMA 2L3DA 2FE3A 2AXTC 5A2QZ 3O8HA 3K4KA 1IRGA 3CDIA 4LD5A 2ZC2A 2VKDA 3BG7A 3K10A 3OYDA 2PMZA 4IX7A 4C2UA 3HGYA 3FXRA 2HVRA 2EA2A 2VC1A 2HKXA 3LFKA 1PUFA 2BVMA 1J59A 4CXFA 4A3DJ 2MC4A 4P5OA 2MD0A 2E35A 3DFGA 3TDUC 1S6LA 3DKYA 4YEJA 2Z33A 1YW7A 2W00A 4ESFA 4E7LA 3OY9A 1H89C 2M30A 2XF7A 1XSVA 4NB5A 3BJAA 4HDVA 1E3OC 2ZSHB 1D5YA 1WCMJ 3KLNA 4IHVA 1V3FA 1RKTA 1TW2A 2LBFB 3ZMZA 1MMSA 1S9HA 3NEUA 3KP6A 4EJOA 4FETA 1LFUP 1W5CC 3ASNH 3BR5A 3I4PA 3PL8A 3CMYA 4YRVA 2CQQA 1YE9A 2RNGA 4P9UA 3L2VA 1JJ6C 4HNUA 2NNNA 5K7ZA 3CUQA 1WSUA 4MEYF 3ML6A 2KIQA 3IKVA 2HXOA 3HPGA 4A3EJ 2RGVA 4A0ZA 4G7OF 4Q4ZF 2CUEA 4F55A 2YS9A 3P9KA 5M3FJ 3W6VA 3FXOA 3NRVA 3O8GA 5CJ9A 1LNWA 2JA7J 4AWXB 2GA2A 3PQJA 3LOCA 3PQKA 4BH9A 2BOLA 3HSFA 3DCFA 3SDGA 5M5WJ 4BJTA 4PK4A 5CKTA 4A5MA 1WJFA 2XAGA 3I59B 4G9YA 3HOVJ 2M4KA 3BZ6A 4BS9A 1NTCA 3EUAA 2HQ5A 3EYIA 3SZGA 2R7FA 3CC4I 1BW5A 3FM3A 1Y8QB 1SD5A 1GXQA 2ESHA 3D0SA 3DQVC 1RR8C 4MO7A 3HDDA 2KPMA 3M1CA 2VB6A 5F6FA 1AWCA 5KNLA 1PDNC 5IOZA 2DBBA 2HTJA 3QAHA 4IVNA 1X1CA 2HYFA 1SAXA 3DPUA 1FBQA 4L9JA 3LQQA 2ELKA 3VYUB 1Z3XA 4WXHA 3CCMI 3GTJJ 4EEFG 1WKMA 2P6TA 4KMUX 1D1CA 1FIAA 5E79C 4NHJA 4EVIA 1FLIA 2HOAA 3H5RA 1APLC 2QQ9A 4C2TA 1YOVB 4I2OA 1Y8RB 3BR1A 5HVQC 2F5FA 5CVRA 5DV5A 5E8IA 2VUMJ 1KQ8A 3ELKA 4UB8C 1XMKA 4U0VA 2L0KA 1ON2A 1OISA 4HNVA 4JK1X 2LK2A 4E7IA 1KZHA 1IXSB 4KITB 5L3GA 3JTHA 4GFBA 1R6RA 1OLTA 1GLNA 3D5LA 4KUMA 1DU6A 4U88A 5E20A 4K2EA 1Q1VA 1MSEC 5F1RA 1RI7A 3DTKA 3V7CA 1B9NA 5E3OA 3OV8A 4KA4A 1S3JA 4HDUA 1P6RA 3LNQA 5E3NA 4I76A 3OIPA 1N78A 1T56A 4A3LJ 1ETYA 2JA5J 1R1TA 4M9SA 1U8BA 2BY2A 5HLIA 4M9ZA 1JKPC 5FKOA 1ZG5A 4KIFA 1LJ9A 4HEA2 3BY6A 2RQPA 3ZP5A 4MHGA 2H27A 3LSGA 2ZXHA 2QCOA 3L2UA 2YX4A 1H9TA 5HOOA 4KN7X 3LSJA 2KIFA 2O8XA 3G4SI 2DOEA 1WJEA 1MMNA 2KRFA 2NOGA 2XF5A 1YW8A 2DN0A 2OD5A 1JJ8C 3CDHA 2HPMA 1DDNA 1U5TA 1G4DA 1VQ5I 4KNYA 1OCPA 3WHCA 2EJRA 1H9GA 3K7AJ 3DTEA 2AXLA 4MTDA 2KRHA 5DDGA 5EEHA 2GA1A 5JI6A 2LKSA 2ME0A 1ZLKA 1HXDA 5HDGA 1FOXA 1BOBA 2LR8A 2Y2ZA 4UVCA 5K7HA 4S05A 2KJCA 2R5YB 1P4XA 2GZWA 3JSOA 1FOKA 2PMZN 2CUJA 4LJZF 1LKXA 3ZQHA 2K9MA 2HPIA 2NS8A 2E1NA 2W7NA 4EJWA 3ZMVA 3A0HC 4NBQA 5FLMJ 5ILUA 2R5ZB 5ICGA 2IXSA 5JLWA 1CF7A 1R00A 2BYVE 3H5NA 1SFOJ 3KPHA 4N4OB 2M8EA 3RYPA 1Z77A 3PUBA 2A05A 2IPQX 3T8RA 5J47A 3BJOA 1REPC 1HW2A 3A02A 1OYIA 4DQ2A 4DNCA 2MSYA 1X2MA 4JOMA 2K27A 2ZBKA 3J7ZI 1BJZA 1D1AA 1MJAA 2Z3YA 3MZ8A 1F5TA 4HBLA 2UV1A 2KL4A 4RAFA 2I8DA 2M7BA 3HZJA 5E1WA 2W1OA 1BC7C 4II2A 2EK5A 5M5YJ 3HUGA 1ACIA 3OYIA 5DYMA 5F27A 1GV5A 3K69A 3ZN1A 4FISA 2BGCA 1IV6A 2BY3A 3PNYA 2TCTA 4YIRX 3IP4B 2M1BA 3TKYA 3ZXSA 1MNMC 1MNDA 1Z0XA 1ZGJA 2MLKA 4RLFA 2Y30A 3SXYA 4RGUA 3HOYJ 1ZQ3P 4IXAA 2LY1A 5J1YA 3ONQA 1UHMA 1TQIA 4HW0A 1O3SA 2PJRA 2JT1A 3HSEA 2QENA 2FJ1A 5M3MJ 1ZHFA 1JT6A 2VKEA 3KCCA 4M9XA 1XD7A 2L2OA 2TDXA 2A6TA 3MZHA 4L0ZB 4N4NB 4Y13A 4S04A 2YX7A 4M3GA 1IN8A 2ECCA 2G7HA 3I59A 4NQWA 1W7PB 4E7ZA 4OAYA 1A04A 2GOMA 3BZKA 3WTWC 1XSXA 3HG9A 2K3FA 4XIDA 5HLHA 4G12A 3RKQA 2R7OA 3CJQB 3M9AA 1JT0A 4MQVA 3HOSA 3ASOH 2NVXJ 4HF0A 4HX8A 2JZYA 2P81A 4RAZA 5FKNA 2QQ8A 3S32A 2UZKA 1U3EM 2CSOA 2ZFWA 4C3HJ 4E4HA 5JVGF 1A35A 5J8FA 2BY0A 4BYYA 4EMSA 3KETA 2XAQA 3OYMA 3LQRA 3A01A 3L09A 2HKOA 3CJNA 1IUYA 2DDAA 5EJCA 3BTLA 3I55I 2YU9J 3E6MA 2Z5UA 2ZJQF 3KYLA 3OR2C 4PJMA 5JR3A 4QPQA 4ZDOA 3QP6A 4B09A 3WTUC 3A0BC 1BR4A 1MBFA 3HRUA 3FX3A 3QWLA 1UAAA 3LAJA 2MABA 1N77A 4BJ5C 3V8JA 1LDDA 3E0JB 1HQCA 1ZG1A 3EPZA 2KLOA 4FE4A 1ZG3A 5CVUA 4NC8A 4C3IJ 2KHMA 3T0YA 4AIKA 3OR1C 4AU7A 3ESWB 1T0FA 1HCRA 2OUMA 4BE2A 2JMWA 3TQNA 1GVJA 1OR7A 1ETXA 3TW6A 4IF4A 4RGXA 2O9LA 2P7CB 3E6DA 1LFPA 2HTSA 2WB1A 4AM3A 4M6YA 4J19A 1R1UA 3DBRB 3OOPA 2DJIA 2MC3A 3OIQA 3CO6C 2QBYA 1TWGJ 3TP3A 1QU3A 2DOFA 3F8CA 3KX2A 1RUOA 3OS2A 3U1DA 2OAZA 4HF2A 3QRFF 1HF0A 1W5TA 2DA7A 3H9GA 3W2WA 1TT0A 3HOTA 1TZLA 1YQAA 5CPRB 1IZ1A 2VQGA 5B1BH 4XLNF 2CW0F 3ABLH 2VBYA 3FBNB 5GPCA 3B02A 5CVJA 3KZIC 2Y0SA 4ZYAA 4KIBA 5BS6A 4BDYA 5TJJA 5BNGA 3OYFA 3OSFA 4AVPA 1IDZA 1BI3A 4XORA 1V5EA 1ZN2A 5F0FA 3S93A 1K83J 2GM4A 5D8LB 3I56I 4NC6A 3M8FA 2HS5A 2XPWA 4OWRB 1T0FC 3CF5F 4E7KA 2FOWA 3FXQA 4W97A 3T5XA 1ODDA 2ETHA 2KKOA 3UNGC 4A5NA 3MWMA 2XAFA 2A69F 4YIFA 5FRMA 1K7AA 5F64A 4F3QA 2E7WA 3AL0B 4A0XA 2LMDA 2ZJ2A 3FXUA 3ZR8X 5FD5A 1WZ2A 1RRJA 1U9NA 3MKWB 4QWQA 2B9SA 5LEKA 3CD6I 3W3CA 2IW5A 2PG4A 5LRSA 3DU5A 4PCQA 4ESJA 3SDBA 3KE2A 5KAFC 1AKHA 1S8NA 3WGIA 2R3SA 2QM3A 3DEUA 3Q0VA 2HOTA 2A3SA 5HLTA 2XASA 5C44J 2DA1A 5ICFA 5D5XB 2L7FP 3DLLF 2EZKA 1P9QC 3HHHA 2NS0A 3F22A 5LBQA 4O6JA 4GYGA 4HQEA 5LEJA 2STTA 3S3MA 1YJNI 3H3UA 3BPVA 1RR7A 4PFPA 4C9YA 5LFAA 1X1BA 2HOSA 4B47A 5K5OA 5LLQA 4I0BA 2JPBA 3VPRA 4JX5A 4V2GA 2L54A 3SYTA 5HDKA 1ZK8A 4DZPA 4G7HF 3B6AA 1XGOA 1MKMA 1ETKA 3ABTA 5D5WB 1A36A 3HSRA 1FPQA 3BOQA 2CMPA 2OTLI 3J81Z 1FMVA 4A3CJ 4CZZA 1IJWC 4LK0F 1R5GA 4IHWA 4UUSB 4RS8A 1JTYA 3H35A 5D5UB 2DYRH 2EBIA 4TV7A 4UY8I 2IGMA 1JXSA 2RC4A 1HDDC 3HRMA 1F9NA 3WTSC 2DTZA 4J01A 4FT8A 4XOPA 1FP2A 3RDIA 2VODA 1FYMA 4YIIA 2JVHA 3FXKA 3VYTB 2M5WA 2RAEA 2HR3A 3O3KA 4DW6A 2HXIA 1BI2A 1B4AA 1HDPA 3CCJI 4DYCA 3WG9A 2V6EA 4XK4A 3SQNA 2XHKA 2STWA 3HTSB 1FC3A 2ZMEB 4UV8A 1MNEA 5B3SH 2FMLA 4NQWB 4XNFA 4UXNA 2M4GA 1YRNA 3C2BA 3FXLA 3I9V2 3H92A 2BY1A 5DS9A 1VQLI 2VQHA 3F3XA 3REOA 4CZCA 2F4IA 3GZ5A 4PJNA 1RNLA 4ZYHA 3HKZA 5HS8A 3KP7A 2H94A 3ZMDA 1W7PD 3OYEA 2X6WA 4KISA 3B6CA 5D5VB 4CYCA 1QNTA 3LSMA 1TBXA 4LK1F 4Y4RA 4C3JJ 2GXBA 2R4GA 3ZN0A 2L7ZA 4BHPA 4D7NA 3S1MJ 3FM5A 1JKQC 2CJJA 3D5RC 3FKJA 1TNSA 5DD4A 1JTXA 2A5WA 1RPWA 3CZ6A 1XDSA 4ZC3A 3FMQA 1FMWA 1HKSA 3NAUA 1IF1A 1Y1WJ 3PFYA 2H09A 5GPAA 1IW7F 3FMRA 1MBJA 2KQRA 2EIMH 2DT6A 2F48A 1Y0UA 4DIQA 2OQGA 3IRRA 2DCEA 1QRYA 4JX4A 3KYCB 3E5UA 3HOUJ 3HBLA 4V2FA 4HV5A 3CLOA 4FTHA 3BCAA 2Q2EB 4UV9A 1EJ9A 3BP8A 3LMMA 1IRZA 5FROA 3F8MA 2F4MB 2FNAA 2M9HA 3RPUD 1SMYF 3BTCA 4P55A 1ITYA 5BMZA 1WH7A 4OU0A 3K6GA 3S2HJ 3GTQJ 1YFHA 4B4CA 3C3WA 3S2DJ 4IHTA 3MAJA 2LRDA 2XGCA 2ZCWA 4B8XA 3K4MA 4Q47A 5DM6F 4FASD 1LEAA 3TW7A 5HLGA 2OZUA 1BR1A 2RV8A 3FISA 3PNVA 1FWZA 2MH9A 1ZGWA 3GTPJ 3RQ4A 5E17F 1QZZA 1S72I 2JQ7A 4ZTJA 1R1VA 4D1QA 1SEUA 2X1CA 1VQ7I 2F6CA 1WJAA 4BHCA 1XSDA 1W1WE 1XGNA 3GXOA 4HG2A 4LG0B 2V26A 1EKEA 3UR3C 4D5CA 1ZR2A 2WC2A 3IWZA 2HVSA 2Y48A 1TNTA 2EB7A 1R5HA 3G1MA 4V19K 4AC0A 2QUFA 1LE8A 3E6CC 3O6BB 3R0AA 5J40A 2JWTA 4CYDA 4XN0A 2YSRA 2E60A 4JP0A 3PIOF 4O3MA 2HQNA 2VN2A 3T1BA 2MD5A 2QEXI 2IS2A 1OFCX 1VI0A 2ZFUA 4DYRA 2DK5A 1WWXA 5J4VA 4A3IJ 2R7VA 4DOZA 2PMHA 4P1WA 4RB3C 1BI0A 2X9DA 2P5LC 3IH3A 1N25A 1X4PA 2HQRA 4RB0A 1VQKI 2DI3A 1XG1A 3ULQB 1TP4A 4F93B 1Y56A 3HOXJ 3TEDA 5JFRA 4AYBA 2N8GA 2OCCH 4ANJA 4R8HA 4M74A 1V55H 3GCMA 2GQQA 3HEFA 4MFDA 2GXGA 5D6FA 1K6YA 4IEJA 3DP7A 3F21A 3PJRA 4BEHB 4MTEA 4CCJA 1XGSA 3S1RJ 1HKTA 3JR9A 4IRIA 4EGYA 1SD6A 3OYGA 4QLCU 1I39A 3IKTA 4YFNF 1D8KA 3G1OA 4PJJA 2Y31A 5EEAA 2R0QC 3ZGKA 3J81K 1Y6IA 2CH0A 3GF2A 3S1QJ 5EF6A 1VQOI 1R71A 1EH6A 2FMYA 2KFDA 1WFXA 5FGMA 4I01A 2KDZA 2VLAA 1ETQA 1Z3YA 1J5YA 2O61A 5TGTA 4R79A 3IL2A 3TDZC 4IJAA 2LSOA 4ABZA 2H8RA 1BW6A 4I02A 4H4KC 2V9PA 3QOPA 2FQ4A 1W0TA 6PAXA 5K1YA 4PDKA 3RTRA 1HOMA 1S7AA 4HV6A 4RLQA 1DQUA 5CLSA 2R7SA 4OIQF 1HBXG 2QSHX 4M3DA 4HLXA 1XMXA 1Z21A 2PI0A 1FT9A 2IGOA 2WAFA 3BQZA 3K0LA 1IN6A 3EUHC 3IAM2 2DMUA 5EGOA 1T8IA 2DO7A 1MJ9A 1V5FA 4HQMA 2M2EA 1V5GA 1T6SA 1I50J 4N9HA 5B5EC 2LG4A 3CDLA 3CCSI 1XCVA 3RPQA 5TRDA 1B8IB 2PJPA 4EJTA 3VYRB 1YS7A 3HL2A 1EF4A 3X2QH 3L2RA 3SFIA 3GZ6A 1OCZH 5EG0A 4AIDA 2DFHA 5J3LA 1KU2A 1R4MB 1OYWA 4IOCF 3DLAA 3IH2A 1WPKA 3BR0A 3IAS2 1R9TJ 1YRNB 1G3WA 4CHUA 2W57A 3LSPA 1K4SA 2ELHA 4B43A 3DEWA 1UMQA 5LHGA 4Y7NJ 1OKRA 4XM3A 1SFEA 3BG6A 2BHYA 4DBRA 3ECOA 3CQZJ 3HB9A 1G3YA 4A3FJ 2TRTA 2D45A 4IOAF 1MJBA 4CYCB 4X6AJ 3LSIA 4XLPF 1AU7A 1X58A 5LGTA 4H0EA 3WTZA 5ICCA 3H9QA 4YELA 2HDCA 4ETSA 1FOWA 2K3PA 1UHWA 2F2EA 2WV0A 1QZYA 4O5VA 1Y0NA 1YIJI 3M7GA 4Y15A 2ZXWH 1U8RA 3RKWA 1WVRA 3VYSB 2H6CA 4HAMA 2VBXA 1JUMA 3GFLA 3DPTA 3E1SA 3AG1H 2JA6J 1NHAA 2ESNA 4D9JA 1U78A 3A4CA 2X48A 2KT0A 4CO8A 4KJZA 3RI4A 3J80K 4L9NA 4ZYEA 4BAYA 2VBZA 3WU2C 1KU3A 2EIJH 3WTVC 1IGNA 1OCRH 2Q2EA 5DUIA 3BZCA 2PN6A 1PUEE 4U7BA 1DPUA 3CMMA 3J7AY 5DD8A 3S8PA 5FLXK 3C7JA 1MMGA 2QF7A 5L3FA 2VJJA 3JRCA 2O03A 3H0DA 3QODA 2Y9YA 2LLKA 1FZPB 1F4KA 1MMAA 2ZJRF 4BNCA 1O4XA 1LUJB 4RB2C 5IT9Z 2A6EF 1USSA 5JHUA 4A2UA 4NNJA 4M6VA 2FD5A 2PMUA 4HX7A 2E36A 2V1DA 4QTRA 3K1MA 5AIQA 2HWVA 4ON0A 5F0HA 5HODA 1SC7A 3KEOA 2DYSH 2P5VA 1W0UA 3RPUA 1WRJA 2E1MC 4DJAA 2R7DA 4PGGA 2D1VA 4CICA 1NK2P 1G2HA 4IHSA 1UHSA 2IS4A 2DXIA 1R58A 1BJAA 4A3GJ 4IQ4A 3U1KA 3OL4A 3I58A 2EV5A 2KZVA 3CUQC 3BG3A 2F5DA 2XPUA 1J0RA 2VQLA 1PJRA 2IGKA 3PUFA 1MBGA 1TL8A 4WWCA 4A6EA 3WTYC 1BA5A 3WTXC 1Z1DA 4RB1A 2VE9A 1ENHA 3TOAA 2L9NA 3WU1B 3QYBA 2B7EA 2M0MA 3BG5A 3EUKL 3KIOA 5J1UA 4FQGA 5L3EA 2DA4A 3ECHA 3K1NA 5EZGA 1R23A 4UUVA 1VQ4I 2VOOA 4GYIA 1Z6RA 1ZTRA 5IPAA 2IA1A 1IN7A 5GTHC 1LDJA 4XSXF 5E1XA 1L0OC 3JAMZ 2DAOA 2NYXA 2WADA 1JI8A 1WQ2A 4OAZA 4L0YB 2A68F 1P7JA 1B72A 3HC7A 2PLYA 4Q5SF 3AG3H 5LGNA 2XAUA 5D8KB 4U0WA 2GBYA 3BPXA 3TBIA 4B48A 1NK3P 3TL4X 3DPLC 2QQAA 1Y39A 4HYEA 3GTOJ 2NVTJ 4CCMA 4MEXF 1DU0A 1D1BA 2FXAA 1X3WB 4ENJA 2PBIA 4WF2A 2DDBA 5L3DA 5IYBJ 2XGEA 2WAQN 1MW7A 2Y69H 3FIWA 2E2JJ 3QP5A 3P9IA 2M87A 1JKRC 1I6XA 2J5OA 3M07A 3LSHA 4F91B 4KIGA 3K2ZA 1Z7LA 4RM2A 1E2XA 4LG3A 1USTA 1CQTA 4UVAA 3FHNA 2VASA 4JYKA 3BJ6A 4OINF 5E3LA 2WBMA 1WJBA 2CQKA 4DYQA 1ZR4A 4X0GA 1HLVA 3HXLA 3H3ZA 1LQ1A 1XX5A 4LLGF 1B9MA 2KIUA 2YU3A 1HW1A 1VNDA 2JUCA 4CCLA 4BGDA 2IS6A 2HVQA 4RAGA 2P0WA 2EFOA 4KICA 3E7LA 1QPMA 1X3ZB 2YUSA 4LGWA 4FHTA 2LH9A 4C2MJ 5CQGA 1GXPA 3GTGJ 3F6VA 1HA8A 2LYCA 4PSXA 3HKZN 2MYSA 1GDTA 2IBDA 1YW9A 1IDYA 2ECBA 1R4NB 2ZXIA 4HF1A 3D1NI 2V9KA 1R7JA 3C2HA 3VSLA 4E6KG 1U5TC 4Y17A 4M3BA 2X6YA 1BIBA 4BKXA 1ZREA 2G7UA 2O0YA 2OPTA 2NRAC 1YIOA 5KVRA 5AONA 4CCOA 3IV5A 4XSZF 4KFCA 2VJ5A 4I98B 2KZGA 5IP6A 1MH3A 2H8WA 2DMPA 1TW3A 1Y1VJ 2FF4A 3MCZA 5E1ZB 5K5RA 2NOJB 3MEXA 1QHGA 2O3FA 2FUG2 1POGA 4XLHA 4YFKF 1LFBA 4CCKA 1YJ9I 3I54A 3L2CA 1I5ZA 3D5SC 5L3CA 2ZJPF 1S29A 2H6BA 2A6HF 2AQFA 4IQJA 4A93J 2E34A 4II3A 1QBJA 3RKXA 1K4TA 4RGRA 1YS6A 3V7SA 4DZJA 3HUGB 1YX5A 2X51A 2M7AA 2E7XA 3L7WA 3G2BA 4QPOA 3VODA 2DA2A 2V1XA 5BPDA 1OCCH 3MZYA 2HZDA 4ASNA 1I1GA 2OU2A 2NAZA 2W25A 3DEEA 4JBAA 4EJVA 2RNJA 4N9IA 3CO7C 4XONA 1GHCA 4PSWA 2P5KA 1W36C 2W84A 1PYVA 3GVAA 1PP7U 3C1DA 2FQ3A 2DFFA 3H1CA 3Q0WA 3JCUC 1MGTA 2YPRA 2VE8A 5C3EJ 3GX4X 1FBSA 2EZHA 5ILVA 1KQ0A 4L9VA 3U2RA 1JHHA 1ZAOA 2MW8A 2F5EA 2IAIA 2O8KA 3AG4H 3JRFA 2V9VA 3GFJA 3DTIA 1Z67A 1KONA 3RIRA 4KDPA 1SD7A 4M3EA 1E17A 4RM3A 5H20A 3J7YJ 2LY2A 3GBGA 3CP8A 3GO5A 1W7PA 2QGUA 2XAJA 2F5VA 3BT9A 5K7FA 1DP7P 1JGGA 3IUOA 4BXFA 2L9RA 2KISA 3H0GJ 2XGXA 2QYOA 2VKHA 2XDVA 1X1AA 2JJ7A 3JW4A 2HFHA 2FU4A 2I5UA 2LF7A 4MIMA 1YLFA 2JRMA 2QLZA 4AYBN 3LA7A 3L2WA 1O3RA 3TMOA 3I5UA 2CG4A 4YFXF 1I1SA 4WX9A 2W82A 1A6IA 3FK6A 4B1RA 3NWSA 1ON1A 2R7XA 1IRXA 2Y9ZA 4IPAA 3ZMSA 5B66C 4LLNA 1JUSA 2JSCA 1B72B 3OYNA 1UG2A 1FX7A 2DQRA 4AD9A 3HRSA 1SFKA 2VBWA 3BTJA 1K78A 2JK3A 4MGRA 3FF5A 1AOYA 2LD5A 2F5CA 4N0BA 3WU0A 4LFUA 2LTPA 4XR6A 1VF9A 4GO1A 3HM5A 3P7NA 1V54H 4WXDA 3OS0A 4FCYA 1YI2I 1NH3A 1VFCA 2ZNZA 1LDKB 1OCTC 3F8NA 2IS1A 5IP9J 1LPQA 1ZRFA 3AL0C 3GWZA 4CCNA 3AAFA 5HS7A 2COMA 4HPQA 2FRHA 2VQCA 2FOKA 5TISC 5E18F 4UNOA 3E5QA 3F8FA 3CUOA 3SZPA 1OR7C 1NG6A 2DMTA 4CSWA 2K02A 2OBPA 2M8GX 4JX6A 3JRBA 2R5YA 5HS9A 2B63J 4EJUA 2DPUA 1K61A 3CMEI 2IVMA 3Q9VA 1DGRM 3CCVI 2LKXA 3VOEA 1LVKA 2CWEA 4NUBA 3GLXA 5HDNA 3R61A 3CC2I 4ZYDA 4XOTA 1D5VA 2IP2A 2R5ZA 4BDZA 3DF8A 4KT6A 1TLHB 2L9VA 3ZPLA 1T39A 1I6HJ 2MA3A 1T38A 4OIPF 3GFMA 3I64A 3GUDA 3PFIA 3B73A 4UUTA 4L5IA 1TT5B 1PVEA 1NG7A 5DCMA 3HHGA 3WTTC 1XCBA 3M3YJ 1XB4A 2E2IJ 3ERED 2R7QA 1YYVA 3BR2A 4MFEA 4ZZLA 1XN7A 1WGXA 3J80Z 3CLQA 4HRIA 2EV0A 2DPDA 3OL3A 1ZARA 2MG4A 1J09A 3K4JA 4I99C 4WCGA 4A3KJ 3BG9A 3LFUA 1RETA 3PSFA 2OC6A 3HJEA 3W6KB 2DMNA 3M4OJ 5LHIA 3H36A 1T2KA 3ROUA 2OA4A 1TWCJ 5FFXA 2M45A 2FX0A 2NXNB 1B59A 1P92A 2V6CA 1AKHB 2CV0A 1QZEA 1S7OA 1ONVA 1J7KA 2I10A 4F7ZA 2O7OA 1FTZA 4HOBA 3SJMA 2FBIA 2MLGA 4EM0B 1ZLJA 2BXZA 3SFZA 4XICA 1IXRC 2EWNA 4XN3A 1VQPI 1X3UA 2XB0X 1ZH5A 2LP0A 5CYVA 3U21A 5ICEA 3JRDA 3E6BA 3CJRB 3BQYA 4HSRA 1SMTA 4PGHA 2XF6A 4XBFA 4OOIA 3OYCA 1GUUA 1TC3C 5H2FC 1OQYA 2HI3A 2BW3A 5DTDA 4I0AA 1FYKA 1IV8A 2A61A 3IWFA 4G6QA 1IAWA 3G1LA 1UJ8A 1QVUA 2P7VB 5F08A 2BVLA 1FJLA 1F1ZA 2M3AA 2D1HA 3RCOA 1UFMA 4IRGA 1O3TA 1IUFA 2JA8J 1ERDA 1Z7UA 2KRCA 1IO2A 2QA4I 4BU2A 1E0EA 1Z05A 4Y3OA 3JRGA 4PJ0C 2CV2A 1AA7A 3HRTA 5JLXA 3DWLE 5DCFA 5KCMA 2EQRA 3H9JA 2DQLA 2XROA 3K2AA 3QOEA 2BXYA 2CUFA 1I3AA 5K5QA 2BHZA 3VDXA 1VQMI 3OYHA 1JUPA 3BCBA 2XSJC 4YG2F 2LVSA 3MD2A 5D6EA 4MQ9F 1OPCA 2B0LA 5DM7F 4ZTFA 5DUKA 3A01B 3N4MA 3I4MJ 3BROA 3C18A 2D2WA 4LITA 4P96A 3ZQCA 1ETOA 2XPVA 3QU3A 3SHFA 2ZMEA 3VFZA 5E8GA 2R7WA 4RAYA 3F6OA 2ME6A 2W85A 2VPRA 5D4SA 5GADJ 2R7UA 3LAPA 5CVVA 1BIAA 3I71A 4Q48A 3CCUI 2VT2A 1BI1A 2V1UA 1TWFJ 2MFZA 3CCYA 3OS1A 1O7FA 1O7LA 3WE2A 2M0CA 4JQFA 4HX4A 5A2QK 2EH3A 3BWGA 5CVIA 3WGGA 1SFUA 3S14J 1UZCA 3JRAA 1P4AA 3PM1A 4RA2A 1F36A 1XS9A 3N05A 1J75A 2DLLA 4GXOA 4UVBA 1RC9A 2K4BA 1Z6TA 3FWEA 4LB5A 4ZDLA 3U9GA 2L9SA 1RESA 1VQNI 1SVOA 2C6YA 1JHFA 1P7IA 4DGWB 1OJLA 2L01A 2IA0A 2E5ZA 3TGNA 2J5PA 5EZHA 2YR2A 4F92B 4EQQA 2Y0MA 3WHBA 3IHUA 2EA4A 2QQBA 5ED4A 4X1EA 3JRHA 2VL8A 3F0CA 4LOCA 1Z91A 2VXDA 1ZYRF 1YX3A 3KP5A 3JRIA 4HNTA 3BDDA 4AUXA 1WJCA 5LD2C 3W2VA 2VJ4A 2CYYA 3S3OA 3DXJF 4I6ZA 1X19A 2M34A 4I09A 2NNYA 1L3LA 4GDFA 3BR3A 4CA0A 4EGZA 5KAIC 2XRNA 3GYHX 4KYWA 3COAC 1EH7A 4EV0A 4NC7A 5B1AH 2GAUA 2QSGX 1MD0A 3OOUA 5IP7J 1B6AA 2HYGD 2HZTA 3FKIJ 3G3ZA 2A5YB 1OCOH 4XLCA 2OQRA 3I0TA 2VI6A 1SVMA 2Y75A 2O6GE 3O2PE 1TQPA 2GXAA 1ZKGA 5FKKA 2AHQA 1RUNA 4I7HA 5LHHA 3FXMA 3MMYB 3FXJA 2VPLA 3TO7A 2EILH 2UWMA 5GP9A 2Q1ZB 1BL0A 5J4YA 1JKOC 1Q1HA 1D0YA 4E7JA 3LWFA 3ABMH 3ERMA 3RYRA 2ZNYA 2UXNA 3QPTA 2RN7A 3ABKH 3C2GA 1QGPA 1R5ID 2LREA 3OYAA 4MNUA 5BOXA 2JN6A 5FD6A 2IEKA 1B1BA 1AHDP 1RIOH 2EZIA 4BHBA 3CCQI 3NARA 2ID6A 1XMAA 2X6XA 5EEGA 1YITI 4G7ZF 1X2NA 1LVAA 2JVGA 4BY1J 4L5EA 4EM1A 2HDDA 2PJRB 2GIZA 3AG2H 4E7SA 3W6JB 1GVDA 2LKPA 2VC0A 3EQLF 3KLOA 4E70A 5JHFA 1JE8A 2JRTA 1ZGAA 1DGWY 2XV4S 1BBYA 4IL6C 4G6DA 1W4MA 1ETWA 3CCLI 3R60A 3HGGA 1EA3A 2QZ8A 2R7RA 3OYJA 2L4MA 1RKWA 2K9SA 2HDWA 3N97A 1KU9A 1ORKA 1BR2A 2XIGA 3K4NA 3RZOJ 1UCRA 4S0HB 2JA2A 5H6RA 4BBRJ 1O57A 2E71A 3K70D 3A1YA 2OTJI 3RQIA 3KP2A 4PZJA 5ILSA 3HTUA 3RJPA 4XL9A 1VZ0A 5KK1A 2X4HA 2DK8A 4CH7A 3EETA 2IRFG 2AO9A 2DT7B 2X85A 1BOAA 3A03A 4AIJA 1H8AC 3TO9A 1E3PA 2BW3B 5CQEA 3LSRA 4G6TB 4BL0B 2Z1DA 2ADUA 4LMYA 2OCEA 2QVOA 5F0CA 4MLOA 1FP1D 1FY7A 3P5JA 2O5RA 4WXCA 3TOBA 2WTEA 5LGUA 1UG0A 1MDMA 1PP8F 3OYKA 2E2HJ 1VTNC 2W48A 3KP3A 1SAUA 4IHYA 3S15J 2XUBA 2QSFX 1YTYA 3LSKA 3MKZA 1XPXA 2HEOA 4HSTA 1TWAJ 2DA6A 2LY9A 5AIPA 1Z9CA 4QIWN 2JSPA 5FJ8J 4E7HA 1U2WA 2VKVA 2EFNA 4BY7J 3Q0UA 3K4BA 2KJBA 3ZMUA 3QPSA 2DA3A 2DW4A 3IH4A 3GFIA 2FNPA 3EUHA 2GWRA 3F9KA 2K9QA 2OV7A 1WJ5A 2QBYB 1VQ9I 3W2AA 3IC7A 1YG2A 4BUPA 4U7DA 3ZQGA 5IT3A 4LIUA 3CC7I 3CMAI 2LDUA 2QKMB 4XKCA 1XC5A 2DMQA 4NDLA 3Q9SA 3L9FA 1FYLA 4XMYA 1WJDA 3QPHA 3K4LA 5J1RA 4U0YA 1MBHA 4OMZA 1BC8C 2FSWA 2K85A 3V8LA 1XTAA 1X1PA 3OIOA 1IRFA 2ZMEC 2ISYA 3FDYA 4BJ6C 1MIJA 4RDUA 2CU7A 3OYBA 4OIOF 2L7KA 2CV1A 3FZVA 5FLXZ 3ZQFA 4IHXA 2Z9OA 1MBEA 2VONA 3KFWX
chains in the Genus database with same CATH topology
1W5SA 3QU6A 1KYZA 3SZTA 2IT0A 2P4WA 1U6GA 4A6DA 5FB2A 2XKPA 4G94A 3RKYA 4GGGA 2OZ6A 4D0PA 3LSTA 1P4WA 4LG0A 2DT5A 1I27A 4FX0A 5DCMB 3L00A 2BBYA 1O3QA 2EV6A 4EM2A 1J9IA 2IJLA 1DUXC 2X0LA 2GIVA 4FX4A 2KIMA 5BQTA 1V4RA 1TTYA 3E5XA 1FBUA 2XKOA 3TO6A 3WODF 3VEPA 2V79A 2RDPA 3LA3A 1QO0D 1K6OA 2E1CA 5J8CA 2Z99A 4ENKA 3HIFA 1WI9A 3F23A 1R22A 1BM9A 1J2XA 1SD4A 2MH2A 4LB6B 4HZFA 4M73A 2XAHA 3JSPA 4L18B 3LA2A 3P9CA 1XGMA 1EH8A 2HOEA 3I53A 2JPCA 1YO5C 3EYYA 4BXUA 2PFBA 4ESBA 1UB9A 5IT9K 1IXCA 3R4KA 1ULYA 1P2FA 1CGPA 2FBHA 3T8TA 1LEBA 1TQMA 2MBFA 2QWWA 4M6XA 1T98A 3WGHA 1D3YA 2PQ8A 2RVCA 1HSTA 3K9TA 3R0JA 4L5JA 2UXXA 3VB2A 1HW5A 3F72A 4L9TA 3ZMTA 3ZQ7A 2ZXJA 2A07F 5LRRA 1U5TB 4KMFA 3M1EA 3R6SA 1K79A 1QQIA 2ZKZA 5L3BA 2ACJA 4CGZA 4RGSA 2DFIA 2K86A 2K7LA 1FNNA 1G6NA 5D4RA 1FSEA 4ZYGA 2XVCA 1G3TA 1JGSA 2EFWA 2Q8KA 2BE5F 3KP4A 2K4JA 2DTRA 3K1PA 1EV7A 1SFXA 3M8EA 1KQ9A 1DPRA 3ABUA 4BQAA 5J6XA 4LLLA 2P6SA 4Z2YA 5H6QA 1OMIA 4ZH4F 3CUQB 4A0YA 1KGSA 3MFKA 1LB2A 2LNBA 3HYIA 1KYWA 1MZBA 2L4AA 2VOPA 4G8XA 2EFQA 5ERIA 2FA5A 3EDPA 3V7RA 5DEQA 4GCVA 3JTGA 2G9WA 5FO5A 5BPIA 2P8TA 2HGCA 3G73A 4M71A 4OMYA 1RZ4A 2VT3A 2JTVA 3KZZA 2LF8A 3DKWA 3KZYA 3NQOA 1C0WA 4OIRF 3Q5FA 2BEOA 2AS5F 1ZRCA 1XDUA 4ZZDA 4XRFA 2DU9A 4P9FA 2EFPA 2RKHA 1H0MA 2CFXA 3S2WA 4KN4X 2ISZA 2VXZA 3V8KA 1FSHA 4ENNA 2CGPA 1HSJA 4A12A 3ISPA 1HKQA 1OYYA 4UHTA 2Q0OA 3WE3A 3E3VA 2W24A 1BN5A 4KT5C 4IRHA 2PEXA 1IN4A 1G3SA 3J7AO 3CTAA 4ENMA 2BV6A 2IA2A 1KA8A 5JVTA 4WK8F 3F8BA 2FEZA 3IRQA 3V4GA 4HA8A 1STZA 1MDMB 3FMSA 4HLYA 1K78B 5FFZA 2L02A 1R36A 4R1HA 3JAMK 3KEQA 1KU7A 3MQ0A 1D8JA 4CDGA 2FBKA 3FHZA 3DV8A 4M72A 2CO5A 3E97A 3GEZA 3GW2A 1ZRDA 2ZO4A 1IN5A 2WWYA 1CF7B 4AIHA 2L3DA 2FE3A 5A2QZ 1IRGA 4LD5A 3FXRA 2EA2A 2VC1A 2HKXA 3LFKA 1J59A 4CXFA 4P5OA 3TDUC 3DFGA 1S6LA 2Z33A 1YW7A 4ESFA 2M30A 4NB5A 1XSVA 3BJAA 4HDVA 3KLNA 1V3FA 1TW2A 3ZMZA 3NEUA 3KP6A 4EJOA 3I4PA 4P9UA 2NNNA 3CUQA 1WSUA 4MEYF 3ML6A 3IKVA 4G7OF 2RGVA 4A0ZA 4Q4ZF 3P9KA 3NRVA 5CJ9A 1LNWA 4AWXB 2GA2A 3PQJA 3PQKA 4BH9A 3HSFA 4A5MA 2XAGA 3I59B 4G9YA 3BZ6A 3EYIA 2R7FA 3FM3A 1SD5A 1GXQA 2ESHA 3D0SA 3DQVC 5F6FA 1AWCA 1PDNC 2DBBA 2HTJA 3QAHA 4IVNA 2HYFA 1SAXA 4L9JA 1FBQA 3LQQA 4WXHA 1WKMA 2P6TA 4KMUX 4NHJA 4EVIA 1FLIA 2QQ9A 4I2OA 5HVQC 2F5FA 5CVRA 5DV5A 5E8IA 1KQ8A 3ELKA 1XMKA 4U0VA 1ON2A 4JK1X 1IXSB 5L3GA 3JTHA 3D5LA 4KUMA 4U88A 5E20A 4K2EA 5F1RA 1RI7A 3V7CA 1B9NA 4KA4A 3OV8A 1S3JA 4HDUA 1P6RA 1R1TA 4M9SA 5HLIA 4M9ZA 1ZG5A 4KIFA 1LJ9A 3BY6A 2RQPA 3ZP5A 4MHGA 2H27A 2YX4A 1H9TA 5HOOA 4KN7X 2KIFA 2O8XA 2KRFA 1YW8A 2OD5A 1DDNA 1G4DA 3CDHA 4KNYA 1U5TA 2EJRA 1H9GA 2AXLA 4MTDA 5DDGA 5EEHA 2GA1A 5JI6A 1ZLKA 1HXDA 5HDGA 4UVCA 4S05A 2KJCA 1P4XA 2GZWA 3JSOA 1FOKA 4LJZF 2E1NA 4EJWA 3ZMVA 5ILUA 5ICGA 1CF7A 1R00A 2BYVE 3RYPA 2M8EA 2IPQX 3T8RA 3BJOA 1REPC 1HW2A 1OYIA 4DQ2A 4DNCA 2K27A 2ZBKA 1MJAA 2Z3YA 1F5TA 4HBLA 5E1WA 1BC7C 2EK5A 3HUGA 5DYMA 3K69A 3ZN1A 2BGCA 2M1BA 3TKYA 1ZGJA 2MLKA 3SXYA 4RGUA 4IXAA 1UHMA 1TQIA 4HW0A 1O3SA 2JT1A 3HSEA 2QENA 1ZHFA 3KCCA 4M9XA 1XD7A 2TDXA 3MZHA 4L0ZB 4Y13A 4S04A 2YX7A 1IN8A 2G7HA 3I59A 4NQWA 1W7PB 1A04A 3WTWC 1XSXA 5HLHA 3M9AA 4MQVA 3HOSA 4HF0A 4HX8A 2JZYA 4RAZA 2UZKA 1U3EM 2CSOA 2ZFWA 5J8FA 4BYYA 4EMSA 3KETA 2XAQA 3LQRA 3L09A 2HKOA 3CJNA 1IUYA 3E6MA 2Z5UA 5JR3A 3QP6A 4B09A 3WTUC 3HRUA 3FX3A 3LAJA 3V8JA 1LDDA 1HQCA 1ZG1A 1ZG3A 5CVUA 4AIKA 3T0YA 1T0FA 3TQNA 1GVJA 1OR7A 4IF4A 4RGXA 2P7CB 3E6DA 2HTSA 4M6YA 1R1UA 3OOPA 2MC3A 3CO6C 2QBYA 3F8CA 1RUOA 3U1DA 2OAZA 4HF2A 3QRFF 1W5TA 3HOTA 1YQAA 1IZ1A 4XLNF 2CW0F 2VBYA 3B02A 5CVJA 4KIBA 5BS6A 5TJJA 4AVPA 1BI3A 1ZN2A 5D8LB 3M8FA 2HS5A 3FXQA 3T5XA 1ODDA 2ETHA 2KKOA 4A5NA 3MWMA 2XAFA 2A69F 4YIFA 1K7AA 5F64A 2E7WA 4A0XA 2ZJ2A 3FXUA 5FD5A 4QWQA 5LEKA 2IW5A 2PG4A 5LRSA 4PCQA 4ESJA 3KE2A 1S8NA 3WGIA 2R3SA 2QM3A 3DEUA 2A3SA 2XASA 5D5XB 5ICFA 3HHHA 2NS0A 3F22A 5LBQA 4O6JA 4GYGA 4HQEA 5LEJA 2STTA 3H3UA 3BPVA 5K5OA 5LLQA 4I0BA 2JPBA 2L54A 5HDKA 4G7HF 1XGOA 1MKMA 3ABTA 5D5WB 3HSRA 1FPQA 3BOQA 3J81Z 4CZZA 4LK0F 1R5GA 4RS8A 5D5UB 4TV7A 1JXSA 2RC4A 3HRMA 1F9NA 3WTSC 4FT8A 3RDIA 1FP2A 2VODA 1FYMA 4YIIA 2M5WA 2HR3A 3O3KA 1BI2A 1B4AA 3WG9A 3SQNA 2XHKA 2STWA 3HTSB 1FC3A 2ZMEB 4UV8A 2FMLA 4UXNA 3H92A 3REOA 3F3XA 3GZ5A 1RNLA 4ZYHA 5HS8A 3KP7A 2H94A 3ZMDA 1W7PD 5D5VB 1QNTA 1TBXA 4LK1F 2GXBA 3ZN0A 4BHPA 3FM5A 5DD4A 1TNSA 1XDSA 3FMQA 1HKSA 1IF1A 2H09A 1IW7F 3FMRA 1Y0UA 2OQGA 3IRRA 3E5UA 4HV5A 3CLOA 4UV9A 3BP8A 3F8MA 2FNAA 1SMYF 4P55A 5BMZA 4OU0A 1YFHA 3C3WA 4IHTA 3MAJA 2ZCWA 4B8XA 4Q47A 1LEAA 5HLGA 2OZUA 2RV8A 1FWZA 2MH9A 5E17F 1QZZA 1R1VA 4BHCA 1XSDA 1XGNA 3GXOA 4LG0B 2WC2A 3IWZA 2Y48A 1TNTA 2EB7A 1R5HA 2QUFA 3E6CC 3O6BB 3R0AA 4CYDA 2YSRA 4O3MA 2HQNA 2VN2A 3T1BA 2MD5A 2DK5A 1WWXA 2PMHA 2P5LC 4RB3C 1BI0A 2HQRA 4RB0A 2DI3A 3ULQB 5JFRA 4R8HA 4M74A 2GQQA 2GXGA 5D6FA 3DP7A 3F21A 4MTEA 1XGSA 1HKTA 4IRIA 4EGYA 1SD6A 4QLCU 3IKTA 4YFNF 1D8KA 3J81K 3GF2A 1EH6A 2FMYA 5FGMA 4I01A 1J5YA 2O61A 3IL2A 4R79A 3TDZC 4IJAA 2LSOA 4I02A 3QOPA 6PAXA 5K1YA 4PDKA 3RTRA 1S7AA 4HV6A 5CLSA 4OIQF 1HBXG 4HLXA 2PI0A 1FT9A 3K0LA 1IN6A 2DO7A 1MJ9A 4HQMA 1T6SA 4N9HA 1XCVA 3RPQA 5TRDA 2PJPA 4EJTA 1YS7A 3GZ6A 1KU2A 1OYWA 1G3WA 4CHUA 2W57A 2ELHA 5LHGA 1OKRA 1SFEA 3ECOA 1G3YA 2D45A 1MJBA 4XLPF 5LGTA 4H0EA 3WTZA 5ICCA 2HDCA 4ETSA 1UHWA 2F2EA 2WV0A 1QZYA 4O5VA 3M7GA 4Y15A 1U8RA 3RKWA 2H6CA 4HAMA 2VBXA 3GFLA 3DPTA 1NHAA 2ESNA 1U78A 4CO8A 3RI4A 3J80K 4L9NA 4ZYEA 4BAYA 2VBZA 1KU3A 3WTVC 2Q2EA 5DUIA 2PN6A 1PUEE 4U7BA 1DPUA 5DD8A 5FLXK 3C7JA 5L3FA 2O03A 1FZPB 1F4KA 4BNCA 4RB2C 5IT9Z 2A6EF 1USSA 5JHUA 4A2UA 2PMUA 4HX7A 2V1DA 3K1MA 5AIQA 2HWVA 4ON0A 3KEOA 2P5VA 3RPUA 1WRJA 2R7DA 4PGGA 2D1VA 4CICA 4IHSA 1R58A 1BJAA 3I58A 2EV5A 3CUQC 2F5DA 1J0RA 4WWCA 4A6EA 3WTYC 3WTXC 1Z1DA 4RB1A 2VE9A 3TOAA 3WU1B 5L3EA 3ECHA 3K1NA 1R23A 4UUVA 2VOOA 4GYIA 1Z6RA 2IA1A 1IN7A 1LDJA 4XSXF 5E1XA 1L0OC 3JAMZ 2DAOA 2NYXA 1WQ2A 4L0YB 2A68F 2PLYA 4Q5SF 5LGNA 5D8KB 4U0WA 3BPXA 3DPLC 2QQAA 4HYEA 4MEXF 2FXAA 4ENJA 2PBIA 4WF2A 5L3DA 3QP5A 3P9IA 2M87A 1I6XA 2J5OA 4KIGA 3K2ZA 1E2XA 1USTA 4UVAA 3BJ6A 4OINF 2CQKA 3H3ZA 1LQ1A 4LLGF 1B9MA 2KIUA 2YU3A 1HW1A 2EFOA 4KICA 1QPMA 4LGWA 4FHTA 1GXPA 3F6VA 1YW9A 4HF1A 1R7JA 1U5TC 4Y17A 1BIBA 1ZREA 2G7UA 2O0YA 2NRAC 1YIOA 5KVRA 5AONA 4XSZF 4KFCA 4I98B 1TW3A 2FF4A 3MCZA 5E1ZB 5K5RA 3MEXA 2O3FA 4YFKF 3I54A 3L2CA 1I5ZA 5L3CA 1S29A 2H6BA 2A6HF 1QBJA 3RKXA 4RGRA 1YS6A 3V7SA 2E7XA 3L7WA 3VODA 2V1XA 5BPDA 3MZYA 4ASNA 1I1GA 2OU2A 2NAZA 2W25A 4JBAA 4EJVA 2RNJA 4N9IA 3CO7C 1GHCA 2P5KA 2W84A 3GVAA 1PP7U 3C1DA 2FQ3A 1MGTA 2YPRA 2VE8A 3GX4X 1FBSA 5ILVA 1KQ0A 4L9VA 3U2RA 1JHHA 1ZAOA 2F5EA 2V9VA 3GFJA 4KDPA 3RIRA 1SD7A 1E17A 5H20A 3GO5A 1W7PA 2XAJA 1DP7P 2XGXA 2QYOA 3JW4A 2HFHA 2FU4A 2LF7A 1YLFA 2QLZA 1O3RA 3LA7A 3I5UA 2CG4A 4YFXF 1I1SA 4WX9A 1ON1A 4IPAA 3ZMSA 4LLNA 2JSCA 1FX7A 2DQRA 4AD9A 3HRSA 2VBWA 1K78A 4MGRA 3FF5A 1AOYA 2F5CA 4N0BA 3WU0A 4LFUA 4GO1A 3P7NA 4WXDA 2ZNZA 1LDKB 3F8NA 1ZRFA 3GWZA 3AAFA 5HS7A 2COMA 2FRHA 2FOKA 5E18F 4UNOA 3E5QA 3F8FA 3CUOA 3SZPA 2K02A 2OBPA 5HS9A 4EJUA 2DPUA 2IVMA 3Q9VA 3VOEA 2CWEA 3GLXA 5HDNA 3R61A 4ZYDA 1D5VA 2IP2A 3DF8A 1TLHB 3ZPLA 1T39A 1T38A 2MA3A 4OIPF 3GFMA 3I64A 3GUDA 3PFIA 3B73A 4L5IA 5DCMA 3HHGA 3WTTC 1XCBA 1XB4A 3ERED 1YYVA 4ZZLA 1XN7A 3J80Z 2EV0A 2DPDA 1ZARA 4WCGA 3W6KB 5LHIA 1T2KA 3ROUA 2OA4A 5FFXA 2M45A 1B59A 1P92A 2V6CA 1S7OA 1ONVA 1J7KA 4F7ZA 4HOBA 2FBIA 2MLGA 4EM0B 1ZLJA 3SFZA 1IXRC 2EWNA 1X3UA 1ZH5A 5CYVA 5ICEA 3E6BA 1SMTA 4PGHA 4XBFA 4OOIA 1FYKA 4I0AA 2A61A 3IWFA 4G6QA 1IAWA 2P7VB 1F1ZA 2D1HA 1UFMA 4IRGA 1O3TA 1Z7UA 1Z05A 3HRTA 5DCFA 2DQLA 2XROA 5K5QA 4YG2F 5D6EA 4MQ9F 1OPCA 2B0LA 5DUKA 3N4MA 3BROA 3C18A 2D2WA 4P96A 3QU3A 3SHFA 2ZMEA 3VFZA 5E8GA 4RAYA 3F6OA 2W85A 5D4SA 3LAPA 5CVVA 1BIAA 3I71A 4Q48A 2VT2A 1BI1A 2V1UA 1O7FA 1O7LA 3WE2A 4JQFA 4HX4A 5A2QK 3BWGA 5CVIA 3WGGA 1SFUA 1P4AA 1J75A 2DLLA 4GXOA 4UVBA 2K4BA 1Z6TA 3FWEA 4LB5A 3U9GA 2C6YA 1JHFA 2L01A 2IA0A 3TGNA 2J5PA 2YR2A 4EQQA 2Y0MA 3IHUA 2EA4A 2QQBA 5ED4A 1Z91A 1ZYRF 3KP5A 3BDDA 2CYYA 3DXJF 4I09A 2NNYA 1L3LA 4EGZA 2XRNA 3GYHX 4KYWA 3COAC 1EH7A 4EV0A 2GAUA 1MD0A 1B6AA 2HYGD 2HZTA 2A5YB 3G3ZA 2OQRA 3I0TA 2Y75A 2O6GE 3O2PE 1TQPA 1RUNA 4I7HA 5LHHA 2UWMA 3TO7A 1Q1HA 3LWFA 3RYRA 2ZNYA 2UXNA 3QPTA 2RN7A 1QGPA 4MNUA 5BOXA 5FD6A 1B1BA 1RIOH 4BHBA 1XMAA 5EEGA 4G7ZF 1LVAA 4EM1A 3W6JB 2LKPA 2VC0A 3EQLF 3KLOA 4E70A 1JE8A 2JRTA 1ZGAA 2XV4S 1BBYA 4G6DA 1W4MA 3R60A 2QZ8A 2L4MA 3N97A 1KU9A 2XIGA 1UCRA 5H6RA 1O57A 3KP2A 4PZJA 5ILSA 3HTUA 3RJPA 5KK1A 2X4HA 2DK8A 3EETA 2IRFG 1BOAA 4AIJA 3TO9A 2ADUA 4LMYA 2QVOA 1FP1D 1FY7A 4WXCA 3TOBA 2WTEA 5LGUA 1MDMA 1PP8F 1VTNC 3KP3A 2XUBA 1YTYA 2HEOA 5AIPA 1Z9CA 1U2WA 2EFNA 3ZMUA 2KJBA 2DW4A 3GFIA 2FNPA 3EUHA 2QBYB 2GWRA 3IC7A 1YG2A 4U7DA 5IT3A 2LDUA 3Q9SA 3L9FA 1FYLA 3QPHA 4U0YA 4OMZA 1BC8C 2FSWA 3V8LA 1IRFA 2ISYA 4OIOF 3FZVA 5FLXZ 2Z9OA 2VONA 3KFWX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W5S A;  3QU6 A;  1KYZ A;  3SZT A;  2IT0 A;  2P4W A;  1U6G A;  4A6D A;  5FB2 A;  2XKP A;  4G94 A;  3RKY A;  4GGG A;  2OZ6 A;  4D0P A;  3LST A;  1P4W A;  4LG0 A;  2DT5 A;  1I27 A;  4FX0 A;  5DCM B;  3L00 A;  2BBY A;  1O3Q A;  2EV6 A;  4EM2 A;  1J9I A;  2IJL A;  1DUX C;  2X0L A;  2GIV A;  4FX4 A;  2KIM A;  5BQT A;  1V4R A;  1TTY A;  3E5X A;  1FBU A;  2XKO A;  3TO6 A;  3WOD F;  3VEP A;  2V79 A;  2RDP A;  3LA3 A;  1QO0 D;  1K6O A;  2E1C A;  5J8C A;  2Z99 A;  4ENK A;  3HIF A;  1WI9 A;  3F23 A;  1R22 A;  1BM9 A;  1J2X A;  1SD4 A;  2MH2 A;  4LB6 B;  4HZF A;  4M73 A;  2XAH A;  3JSP A;  4L18 B;  3LA2 A;  3P9C A;  1XGM A;  1EH8 A;  2HOE A;  3I53 A;  2JPC A;  1YO5 C;  3EYY A;  4BXU A;  2PFB A;  4ESB A;  1UB9 A;  5IT9 K;  1IXC A;  3R4K A;  1ULY A;  1P2F A;  1CGP A;  2FBH A;  3T8T A;  1LEB A;  1TQM A;  2MBF A;  2QWW A;  4M6X A;  1T98 A;  3WGH A;  1D3Y A;  2PQ8 A;  2RVC A;  1HST A;  3K9T A;  3R0J A;  4L5J A;  2UXX A;  3VB2 A;  1HW5 A;  3F72 A;  4L9T A;  3ZMT A;  3ZQ7 A;  2ZXJ A;  2A07 F;  5LRR A;  1U5T B;  4KMF A;  3M1E A;  3R6S A;  1K79 A;  1QQI A;  2ZKZ A;  5L3B A;  2ACJ A;  4CGZ A;  4RGS A;  2DFI A;  2K86 A;  2K7L A;  1FNN A;  1G6N A;  5D4R A;  1FSE A;  4ZYG A;  2XVC A;  1G3T A;  1JGS A;  2EFW A;  2Q8K A;  2BE5 F;  3KP4 A;  2K4J A;  2DTR A;  3K1P A;  1EV7 A;  1SFX A;  3M8E A;  1KQ9 A;  1DPR A;  3ABU A;  4BQA A;  5J6X A;  4LLL A;  2P6S A;  4Z2Y A;  5H6Q A;  1OMI A;  4ZH4 F;  3CUQ B;  4A0Y A;  1KGS A;  3MFK A;  1LB2 A;  2LNB A;  3HYI A;  1KYW A;  1MZB A;  2L4A A;  2VOP A;  4G8X A;  2EFQ A;  5ERI A;  2FA5 A;  3EDP A;  3V7R A;  5DEQ A;  4GCV A;  3JTG A;  2G9W A;  5FO5 A;  5BPI A;  2P8T A;  2HGC A;  3G73 A;  4M71 A;  4OMY A;  1RZ4 A;  2VT3 A;  2JTV A;  3KZZ A;  2LF8 A;  3DKW A;  3KZY A;  3NQO A;  1C0W A;  4OIR F;  3Q5F A;  2BEO A;  2AS5 F;  1ZRC A;  1XDU A;  4ZZD A;  4XRF A;  2DU9 A;  4P9F A;  2EFP A;  2RKH A;  1H0M A;  2CFX A;  3S2W A;  4KN4 X;  2ISZ A;  2VXZ A;  3V8K A;  1FSH A;  4ENN A;  2CGP A;  1HSJ A;  4A12 A;  3ISP A;  1HKQ A;  1OYY A;  4UHT A;  2Q0O A;  3WE3 A;  3E3V A;  2W24 A;  1BN5 A;  4KT5 C;  4IRH A;  2PEX A;  1IN4 A;  1G3S A;  3J7A O;  3CTA A;  4ENM A;  2BV6 A;  2IA2 A;  1KA8 A;  5JVT A;  4WK8 F;  3F8B A;  2FEZ A;  3IRQ A;  3V4G A;  4HA8 A;  1STZ A;  1MDM B;  3FMS A;  4HLY A;  1K78 B;  5FFZ A;  2L02 A;  1R36 A;  4R1H A;  3JAM K;  3KEQ A;  1KU7 A;  3MQ0 A;  1D8J A;  4CDG A;  2FBK A;  3FHZ A;  3DV8 A;  4M72 A;  2CO5 A;  3E97 A;  3GEZ A;  3GW2 A;  1ZRD A;  2ZO4 A;  1IN5 A;  2WWY A;  1CF7 B;  4AIH A;  2L3D A;  2FE3 A;  5A2Q Z;  1IRG A;  4LD5 A;  3FXR A;  2EA2 A;  2VC1 A;  2HKX A;  3LFK A;  1J59 A;  4CXF A;  4P5O A;  3TDU C;  3DFG A;  1S6L A;  2Z33 A;  1YW7 A;  4ESF A;  2M30 A;  4NB5 A;  1XSV A;  3BJA A;  4HDV A;  3KLN A;  1V3F A;  1TW2 A;  3ZMZ A;  3NEU A;  3KP6 A;  4EJO A;  3I4P A;  4P9U A;  2NNN A;  3CUQ A;  1WSU A;  4MEY F;  3ML6 A;  3IKV A;  4G7O F;  2RGV A;  4A0Z A;  4Q4Z F;  3P9K A;  3NRV A;  5CJ9 A;  1LNW A;  4AWX B;  2GA2 A;  3PQJ A;  3PQK A;  4BH9 A;  3HSF A;  4A5M A;  2XAG A;  3I59 B;  4G9Y A;  3BZ6 A;  3EYI A;  2R7F A;  3FM3 A;  1SD5 A;  1GXQ A;  2ESH A;  3D0S A;  3DQV C;  5F6F A;  1AWC A;  1PDN C;  2DBB A;  2HTJ A;  3QAH A;  4IVN A;  2HYF A;  1SAX A;  4L9J A;  1FBQ A;  3LQQ A;  4WXH A;  1WKM A;  2P6T A;  4KMU X;  4NHJ A;  4EVI A;  1FLI A;  2QQ9 A;  4I2O A;  5HVQ C;  2F5F A;  5CVR A;  5DV5 A;  5E8I A;  1KQ8 A;  3ELK A;  1XMK A;  4U0V A;  1ON2 A;  4JK1 X;  1IXS B;  5L3G A;  3JTH A;  3D5L A;  4KUM A;  4U88 A;  5E20 A;  4K2E A;  5F1R A;  1RI7 A;  3V7C A;  1B9N A;  4KA4 A;  3OV8 A;  1S3J A;  4HDU A;  1P6R A;  1R1T A;  4M9S A;  5HLI A;  4M9Z A;  1ZG5 A;  4KIF A;  1LJ9 A;  3BY6 A;  2RQP A;  3ZP5 A;  4MHG A;  2H27 A;  2YX4 A;  1H9T A;  5HOO A;  4KN7 X;  2KIF A;  2O8X A;  2KRF A;  1YW8 A;  2OD5 A;  1DDN A;  1G4D A;  3CDH A;  4KNY A;  1U5T A;  2EJR A;  1H9G A;  2AXL A;  4MTD A;  5DDG A;  5EEH A;  2GA1 A;  5JI6 A;  1ZLK A;  1HXD A;  5HDG A;  4UVC A;  4S05 A;  2KJC A;  1P4X A;  2GZW A;  3JSO A;  1FOK A;  4LJZ F;  2E1N A;  4EJW A;  3ZMV A;  5ILU A;  5ICG A;  1CF7 A;  1R00 A;  2BYV E;  3RYP A;  2M8E A;  2IPQ X;  3T8R A;  3BJO A;  1REP C;  1HW2 A;  1OYI A;  4DQ2 A;  4DNC A;  2K27 A;  2ZBK A;  1MJA A;  2Z3Y A;  1F5T A;  4HBL A;  5E1W A;  1BC7 C;  2EK5 A;  3HUG A;  5DYM A;  3K69 A;  3ZN1 A;  2BGC A;  2M1B A;  3TKY A;  1ZGJ A;  2MLK A;  3SXY A;  4RGU A;  4IXA A;  1UHM A;  1TQI A;  4HW0 A;  1O3S A;  2JT1 A;  3HSE A;  2QEN A;  1ZHF A;  3KCC A;  4M9X A;  1XD7 A;  2TDX A;  3MZH A;  4L0Z B;  4Y13 A;  4S04 A;  2YX7 A;  1IN8 A;  2G7H A;  3I59 A;  4NQW A;  1W7P B;  1A04 A;  3WTW C;  1XSX A;  5HLH A;  3M9A A;  4MQV A;  3HOS A;  4HF0 A;  4HX8 A;  2JZY A;  4RAZ A;  2UZK A;  1U3E M;  2CSO A;  2ZFW A;  5J8F A;  4BYY A;  4EMS A;  3KET A;  2XAQ A;  3LQR A;  3L09 A;  2HKO A;  3CJN A;  1IUY A;  3E6M A;  2Z5U A;  5JR3 A;  3QP6 A;  4B09 A;  3WTU C;  3HRU A;  3FX3 A;  3LAJ A;  3V8J A;  1LDD A;  1HQC A;  1ZG1 A;  1ZG3 A;  5CVU A;  4AIK A;  3T0Y A;  1T0F A;  3TQN A;  1GVJ A;  1OR7 A;  4IF4 A;  4RGX A;  2P7C B;  3E6D A;  2HTS A;  4M6Y A;  1R1U A;  3OOP A;  2MC3 A;  3CO6 C;  2QBY A;  3F8C A;  1RUO A;  3U1D A;  2OAZ A;  4HF2 A;  3QRF F;  1W5T A;  3HOT A;  1YQA A;  1IZ1 A;  4XLN F;  2CW0 F;  2VBY A;  3B02 A;  5CVJ A;  4KIB A;  5BS6 A;  5TJJ A;  4AVP A;  1BI3 A;  1ZN2 A;  5D8L B;  3M8F A;  2HS5 A;  3FXQ A;  3T5X A;  1ODD A;  2ETH A;  2KKO A;  4A5N A;  3MWM A;  2XAF A;  2A69 F;  4YIF A;  1K7A A;  5F64 A;  2E7W A;  4A0X A;  2ZJ2 A;  3FXU A;  5FD5 A;  4QWQ A;  5LEK A;  2IW5 A;  2PG4 A;  5LRS A;  4PCQ A;  4ESJ A;  3KE2 A;  1S8N A;  3WGI A;  2R3S A;  2QM3 A;  3DEU A;  2A3S A;  2XAS A;  5D5X B;  5ICF A;  3HHH A;  2NS0 A;  3F22 A;  5LBQ A;  4O6J A;  4GYG A;  4HQE A;  5LEJ A;  2STT A;  3H3U A;  3BPV A;  5K5O A;  5LLQ A;  4I0B A;  2JPB A;  2L54 A;  5HDK A;  4G7H F;  1XGO A;  1MKM A;  3ABT A;  5D5W B;  3HSR A;  1FPQ A;  3BOQ A;  3J81 Z;  4CZZ A;  4LK0 F;  1R5G A;  4RS8 A;  5D5U B;  4TV7 A;  1JXS A;  2RC4 A;  3HRM A;  1F9N A;  3WTS C;  4FT8 A;  3RDI A;  1FP2 A;  2VOD A;  1FYM A;  4YII A;  2M5W A;  2HR3 A;  3O3K A;  1BI2 A;  1B4A A;  3WG9 A;  3SQN A;  2XHK A;  2STW A;  3HTS B;  1FC3 A;  2ZME B;  4UV8 A;  2FML A;  4UXN A;  3H92 A;  3REO A;  3F3X A;  3GZ5 A;  1RNL A;  4ZYH A;  5HS8 A;  3KP7 A;  2H94 A;  3ZMD A;  1W7P D;  5D5V B;  1QNT A;  1TBX A;  4LK1 F;  2GXB A;  3ZN0 A;  4BHP A;  3FM5 A;  5DD4 A;  1TNS A;  1XDS A;  3FMQ A;  1HKS A;  1IF1 A;  2H09 A;  1IW7 F;  3FMR A;  1Y0U A;  2OQG A;  3IRR A;  3E5U A;  4HV5 A;  3CLO A;  4UV9 A;  3BP8 A;  3F8M A;  2FNA A;  1SMY F;  4P55 A;  5BMZ A;  4OU0 A;  1YFH A;  3C3W A;  4IHT A;  3MAJ A;  2ZCW A;  4B8X A;  4Q47 A;  1LEA A;  5HLG A;  2OZU A;  2RV8 A;  1FWZ A;  2MH9 A;  5E17 F;  1QZZ A;  1R1V A;  4BHC A;  1XSD A;  1XGN A;  3GXO A;  4LG0 B;  2WC2 A;  3IWZ A;  2Y48 A;  1TNT A;  2EB7 A;  1R5H A;  2QUF A;  3E6C C;  3O6B B;  3R0A A;  4CYD A;  2YSR A;  4O3M A;  2HQN A;  2VN2 A;  3T1B A;  2MD5 A;  2DK5 A;  1WWX A;  2PMH A;  2P5L C;  4RB3 C;  1BI0 A;  2HQR A;  4RB0 A;  2DI3 A;  3ULQ B;  5JFR A;  4R8H A;  4M74 A;  2GQQ A;  2GXG A;  5D6F A;  3DP7 A;  3F21 A;  4MTE A;  1XGS A;  1HKT A;  4IRI A;  4EGY A;  1SD6 A;  4QLC U;  3IKT A;  4YFN F;  1D8K A;  3J81 K;  3GF2 A;  1EH6 A;  2FMY A;  5FGM A;  4I01 A;  1J5Y A;  2O61 A;  3IL2 A;  4R79 A;  3TDZ C;  4IJA A;  2LSO A;  4I02 A;  3QOP A;  6PAX A;  5K1Y A;  4PDK A;  3RTR A;  1S7A A;  4HV6 A;  5CLS A;  4OIQ F;  1HBX G;  4HLX A;  2PI0 A;  1FT9 A;  3K0L A;  1IN6 A;  2DO7 A;  1MJ9 A;  4HQM A;  1T6S A;  4N9H A;  1XCV A;  3RPQ A;  5TRD A;  2PJP A;  4EJT A;  1YS7 A;  3GZ6 A;  1KU2 A;  1OYW A;  1G3W A;  4CHU A;  2W57 A;  2ELH A;  5LHG A;  1OKR A;  1SFE A;  3ECO A;  1G3Y A;  2D45 A;  1MJB A;  4XLP F;  5LGT A;  4H0E A;  3WTZ A;  5ICC A;  2HDC A;  4ETS A;  1UHW A;  2F2E A;  2WV0 A;  1QZY A;  4O5V A;  3M7G A;  4Y15 A;  1U8R A;  3RKW A;  2H6C A;  4HAM A;  2VBX A;  3GFL A;  3DPT A;  1NHA A;  2ESN A;  1U78 A;  4CO8 A;  3RI4 A;  3J80 K;  4L9N A;  4ZYE A;  4BAY A;  2VBZ A;  1KU3 A;  3WTV C;  2Q2E A;  5DUI A;  2PN6 A;  1PUE E;  4U7B A;  1DPU A;  5DD8 A;  5FLX K;  3C7J A;  5L3F A;  2O03 A;  1FZP B;  1F4K A;  4BNC A;  4RB2 C;  5IT9 Z;  2A6E F;  1USS A;  5JHU A;  4A2U A;  2PMU A;  4HX7 A;  2V1D A;  3K1M A;  5AIQ A;  2HWV A;  4ON0 A;  3KEO A;  2P5V A;  3RPU A;  1WRJ A;  2R7D A;  4PGG A;  2D1V A;  4CIC A;  4IHS A;  1R58 A;  1BJA A;  3I58 A;  2EV5 A;  3CUQ C;  2F5D A;  1J0R A;  4WWC A;  4A6E A;  3WTY C;  3WTX C;  1Z1D A;  4RB1 A;  2VE9 A;  3TOA A;  3WU1 B;  5L3E A;  3ECH A;  3K1N A;  1R23 A;  4UUV A;  2VOO A;  4GYI A;  1Z6R A;  2IA1 A;  1IN7 A;  1LDJ A;  4XSX F;  5E1X A;  1L0O C;  3JAM Z;  2DAO A;  2NYX A;  1WQ2 A;  4L0Y B;  2A68 F;  2PLY A;  4Q5S F;  5LGN A;  5D8K B;  4U0W A;  3BPX A;  3DPL C;  2QQA A;  4HYE A;  4MEX F;  2FXA A;  4ENJ A;  2PBI A;  4WF2 A;  5L3D A;  3QP5 A;  3P9I A;  2M87 A;  1I6X A;  2J5O A;  4KIG A;  3K2Z A;  1E2X A;  1UST A;  4UVA A;  3BJ6 A;  4OIN F;  2CQK A;  3H3Z A;  1LQ1 A;  4LLG F;  1B9M A;  2KIU A;  2YU3 A;  1HW1 A;  2EFO A;  4KIC A;  1QPM A;  4LGW A;  4FHT A;  1GXP A;  3F6V A;  1YW9 A;  4HF1 A;  1R7J A;  1U5T C;  4Y17 A;  1BIB A;  1ZRE A;  2G7U A;  2O0Y A;  2NRA C;  1YIO A;  5KVR A;  5AON A;  4XSZ F;  4KFC A;  4I98 B;  1TW3 A;  2FF4 A;  3MCZ A;  5E1Z B;  5K5R A;  3MEX A;  2O3F A;  4YFK F;  3I54 A;  3L2C A;  1I5Z A;  5L3C A;  1S29 A;  2H6B A;  2A6H F;  1QBJ A;  3RKX A;  4RGR A;  1YS6 A;  3V7S A;  2E7X A;  3L7W A;  3VOD A;  2V1X A;  5BPD A;  3MZY A;  4ASN A;  1I1G A;  2OU2 A;  2NAZ A;  2W25 A;  4JBA A;  4EJV A;  2RNJ A;  4N9I A;  3CO7 C;  1GHC A;  2P5K A;  2W84 A;  3GVA A;  1PP7 U;  3C1D A;  2FQ3 A;  1MGT A;  2YPR A;  2VE8 A;  3GX4 X;  1FBS A;  5ILV A;  1KQ0 A;  4L9V A;  3U2R A;  1JHH A;  1ZAO A;  2F5E A;  2V9V A;  3GFJ A;  4KDP A;  3RIR A;  1SD7 A;  1E17 A;  5H20 A;  3GO5 A;  1W7P A;  2XAJ A;  1DP7 P;  2XGX A;  2QYO A;  3JW4 A;  2HFH A;  2FU4 A;  2LF7 A;  1YLF A;  2QLZ A;  1O3R A;  3LA7 A;  3I5U A;  2CG4 A;  4YFX F;  1I1S A;  4WX9 A;  1ON1 A;  4IPA A;  3ZMS A;  4LLN A;  2JSC A;  1FX7 A;  2DQR A;  4AD9 A;  3HRS A;  2VBW A;  1K78 A;  4MGR A;  3FF5 A;  1AOY A;  2F5C A;  4N0B A;  3WU0 A;  4LFU A;  4GO1 A;  3P7N A;  4WXD A;  2ZNZ A;  1LDK B;  3F8N A;  1ZRF A;  3GWZ A;  3AAF A;  5HS7 A;  2COM A;  2FRH A;  2FOK A;  5E18 F;  4UNO A;  3E5Q A;  3F8F A;  3CUO A;  3SZP A;  2K02 A;  2OBP A;  5HS9 A;  4EJU A;  2DPU A;  2IVM A;  3Q9V A;  3VOE A;  2CWE A;  3GLX A;  5HDN A;  3R61 A;  4ZYD A;  1D5V A;  2IP2 A;  3DF8 A;  1TLH B;  3ZPL A;  1T39 A;  1T38 A;  2MA3 A;  4OIP F;  3GFM A;  3I64 A;  3GUD A;  3PFI A;  3B73 A;  4L5I A;  5DCM A;  3HHG A;  3WTT C;  1XCB A;  1XB4 A;  3ERE D;  1YYV A;  4ZZL A;  1XN7 A;  3J80 Z;  2EV0 A;  2DPD A;  1ZAR A;  4WCG A;  3W6K B;  5LHI A;  1T2K A;  3ROU A;  2OA4 A;  5FFX A;  2M45 A;  1B59 A;  1P92 A;  2V6C A;  1S7O A;  1ONV A;  1J7K A;  4F7Z A;  4HOB A;  2FBI A;  2MLG A;  4EM0 B;  1ZLJ A;  3SFZ A;  1IXR C;  2EWN A;  1X3U A;  1ZH5 A;  5CYV A;  5ICE A;  3E6B A;  1SMT A;  4PGH A;  4XBF A;  4OOI A;  1FYK A;  4I0A A;  2A61 A;  3IWF A;  4G6Q A;  1IAW A;  2P7V B;  1F1Z A;  2D1H A;  1UFM A;  4IRG A;  1O3T A;  1Z7U A;  1Z05 A;  3HRT A;  5DCF A;  2DQL A;  2XRO A;  5K5Q A;  4YG2 F;  5D6E A;  4MQ9 F;  1OPC A;  2B0L A;  5DUK A;  3N4M A;  3BRO A;  3C18 A;  2D2W A;  4P96 A;  3QU3 A;  3SHF A;  2ZME A;  3VFZ A;  5E8G A;  4RAY A;  3F6O A;  2W85 A;  5D4S A;  3LAP A;  5CVV A;  1BIA A;  3I71 A;  4Q48 A;  2VT2 A;  1BI1 A;  2V1U A;  1O7F A;  1O7L A;  3WE2 A;  4JQF A;  4HX4 A;  5A2Q K;  3BWG A;  5CVI A;  3WGG A;  1SFU A;  1P4A A;  1J75 A;  2DLL A;  4GXO A;  4UVB A;  2K4B A;  1Z6T A;  3FWE A;  4LB5 A;  3U9G A;  2C6Y A;  1JHF A;  2L01 A;  2IA0 A;  3TGN A;  2J5P A;  2YR2 A;  4EQQ A;  2Y0M A;  3IHU A;  2EA4 A;  2QQB A;  5ED4 A;  1Z91 A;  1ZYR F;  3KP5 A;  3BDD A;  2CYY A;  3DXJ F;  4I09 A;  2NNY A;  1L3L A;  4EGZ A;  2XRN A;  3GYH X;  4KYW A;  3COA C;  1EH7 A;  4EV0 A;  2GAU A;  1MD0 A;  1B6A A;  2HYG D;  2HZT A;  2A5Y B;  3G3Z A;  2OQR A;  3I0T A;  2Y75 A;  2O6G E;  3O2P E;  1TQP A;  1RUN A;  4I7H A;  5LHH A;  2UWM A;  3TO7 A;  1Q1H A;  3LWF A;  3RYR A;  2ZNY A;  2UXN A;  3QPT A;  2RN7 A;  1QGP A;  4MNU A;  5BOX A;  5FD6 A;  1B1B A;  1RIO H;  4BHB A;  1XMA A;  5EEG A;  4G7Z F;  1LVA A;  4EM1 A;  3W6J B;  2LKP A;  2VC0 A;  3EQL F;  3KLO A;  4E70 A;  1JE8 A;  2JRT A;  1ZGA A;  2XV4 S;  1BBY A;  4G6D A;  1W4M A;  3R60 A;  2QZ8 A;  2L4M A;  3N97 A;  1KU9 A;  2XIG A;  1UCR A;  5H6R A;  1O57 A;  3KP2 A;  4PZJ A;  5ILS A;  3HTU A;  3RJP A;  5KK1 A;  2X4H A;  2DK8 A;  3EET A;  2IRF G;  1BOA A;  4AIJ A;  3TO9 A;  2ADU A;  4LMY A;  2QVO A;  1FP1 D;  1FY7 A;  4WXC A;  3TOB A;  2WTE A;  5LGU A;  1MDM A;  1PP8 F;  1VTN C;  3KP3 A;  2XUB A;  1YTY A;  2HEO A;  5AIP A;  1Z9C A;  1U2W A;  2EFN A;  3ZMU A;  2KJB A;  2DW4 A;  3GFI A;  2FNP A;  3EUH A;  2QBY B;  2GWR A;  3IC7 A;  1YG2 A;  4U7D A;  5IT3 A;  2LDU A;  3Q9S A;  3L9F A;  1FYL A;  3QPH A;  4U0Y A;  4OMZ A;  1BC8 C;  2FSW A;  3V8L A;  1IRF A;  2ISY A;  4OIO F;  3FZV A;  5FLX Z;  2Z9O A;  2VON A;  3KFW X; 
#chains in the Genus database with same CATH topology
 1QHH D;  3LL7 A;  1W5S A;  1WHU A;  3ZRG A;  3QU6 A;  1KYZ A;  1A6Q A;  2NVY J;  4W1U A;  3SZT A;  3S17 J;  2IT0 A;  2H1L A;  3MN2 A;  4BBS J;  2R92 J;  2HQA A;  4A3J J;  2GOX B;  2P4W A;  1U6G A;  2E1M B;  4A6D A;  3BTI A;  5FB2 A;  4IZZ A;  4IKF A;  2XKP A;  4G94 A;  1N75 A;  3DKX A;  3M8J A;  2OZ6 A;  4GGG A;  3RKY A;  1IG7 A;  2KDO A;  2Z16 A;  3BC8 A;  4XRS G;  3CES A;  4D0P A;  3LST A;  1S7E A;  4XLF A;  1P4W A;  4LG0 A;  3G6E I;  2WY7 Q;  2DT5 A;  1I27 A;  4FX0 A;  3A2K A;  5DCM B;  2MGQ A;  4PJL A;  5IY5 H;  3L00 A;  2Z2S B;  2BBY A;  1O3Q A;  2EV6 A;  2G0E A;  1LE8 B;  1ETV A;  4EM2 A;  5HNH A;  1H88 C;  2IJL A;  1J9I A;  1DUX C;  2CQN A;  2W4S A;  2VIX A;  2X0L A;  2GIV A;  4FX4 A;  2KIM A;  5BQT A;  3SEQ A;  1V4R A;  3V42 A;  1TTY A;  2XGD A;  1GT0 C;  4BE1 A;  3QPL A;  2CRG A;  3E5X A;  1FBU A;  2XKO A;  3GTL J;  3TO6 A;  1X4O A;  3WOD F;  1T95 A;  3VEP A;  3ZOB A;  2V79 A;  5KHD A;  2K9N A;  2RDP A;  3LA3 A;  3GTK J;  4XKB A;  1QO0 D;  1K6O A;  2E1C A;  2ID3 A;  5J8C A;  2Z99 A;  4ENK A;  2DOA A;  2LFB A;  2COB A;  3HIF A;  4DBQ A;  5EYR A;  2DFE A;  1WI9 A;  2CUZ A;  3GZN B;  3ZQL A;  3F23 A;  1FTT A;  1R22 A;  1BM9 A;  1J2X A;  1SD4 A;  4UUS A;  2MH2 A;  1FOY A;  4LB6 B;  4HZF A;  4M73 A;  5HNF A;  4BEH A;  2XAH A;  1F43 A;  1ZEL A;  3JSP A;  3I3L A;  1YHQ I;  4L18 B;  3LA2 A;  4F52 A;  1S5L C;  3P9C A;  1XGM A;  1WI3 A;  3H5A A;  2BZT A;  1EH8 A;  2CS3 A;  2HOE A;  2CW8 A;  3I53 A;  5GAE J;  1HC8 A;  2JPC A;  1YO5 C;  3K4C A;  3EYY A;  4BXU A;  2OJE D;  1VQ6 I;  2PFB A;  3DU6 A;  3CJT B;  3DBL B;  4ESB A;  2VJI A;  2WB1 N;  1UB9 A;  5IT9 K;  1IXC A;  3R4K A;  1ULY A;  4RMN A;  2R7Z J;  1P2F A;  1CGP A;  2WAQ A;  3MVP A;  2FBH A;  3T8T A;  4BQQ A;  1LEB A;  2K9L A;  2X6O A;  1TQM A;  1E3H A;  2MBF A;  2QWW A;  4M6X A;  4AVZ A;  4BQN A;  1T98 A;  3WGH A;  3FBI B;  1D3Y A;  1MH4 A;  2PQ8 A;  2V1N A;  3RZD J;  2RVC A;  1HST A;  5EGO B;  1TWH J;  3K9T A;  3PNT A;  3R0J A;  2NVQ J;  4L5J A;  3I4N J;  2K5C A;  2UXX A;  3VB2 A;  1HW5 A;  4U87 A;  2E5N A;  2EIN H;  3F72 A;  1G8X A;  3VSK A;  4L9T A;  3ZMT A;  3ZQ7 A;  2ZXJ A;  2A07 F;  3CCE I;  1B8I A;  1FEX A;  3HPH A;  1UEL B;  5LRR A;  3MKL A;  1U5T B;  4XLA A;  4KMF A;  3M1E A;  2HYJ A;  3R6S A;  3CCR I;  3S1N J;  1K79 A;  2ELJ A;  1I3Q J;  1QQI A;  2EIK H;  1W36 D;  2ZKZ A;  5L3B A;  2X1E A;  4Y33 A;  2ACJ A;  4CGZ A;  5FRN A;  2DA5 A;  1MSF C;  4ZDP A;  4RGS A;  1PUF B;  9ANT A;  2DFI A;  2HNH A;  2K86 A;  2NVU B;  2K7L A;  4XQF A;  1FNN A;  1T08 B;  1G6N A;  5D4R A;  1FSE A;  4ZYG A;  2XVC A;  1JGS A;  1G3T A;  1QPI A;  2EFW A;  2Q8K A;  2BE5 F;  3KP4 A;  2K4J A;  4CUG A;  2DTR A;  2E19 A;  3ZQQ A;  4ZJZ A;  3K1P A;  3OSG A;  1FIP A;  2OF7 A;  1EV7 A;  1SFX A;  3M8E A;  5F04 A;  2LBF A;  2EPF A;  1MMD A;  1KQ9 A;  1DPR A;  3ABU A;  4B44 A;  4BQA A;  1M1E B;  4BXX J;  3G71 I;  4BE0 A;  5J6X A;  4LLL A;  5IYD J;  2P6S A;  4D7M A;  2QKL B;  3BR6 A;  4Z2Y A;  3SEZ A;  5H6Q A;  3WG7 H;  2Y0S N;  1OMI A;  3PIP F;  2XB5 A;  4ZH4 F;  1D0Z A;  3AKZ A;  3CUQ B;  4B3X A;  4A0Y A;  5FLV A;  5F1J A;  3QYE A;  1KGS A;  3MFK A;  2LNB A;  1LB2 A;  5IOY A;  2X1D A;  2R93 J;  5GAH J;  2ZSI B;  1X1D A;  2HU9 A;  3OWT A;  2L5Q A;  3HYI A;  1IC8 A;  3UKG A;  4C30 A;  1KYW A;  1MZB A;  2L4A A;  2VOP A;  4G8X A;  2EFQ A;  3ZCO A;  5ERI A;  4EAT A;  2FA5 A;  4PUS A;  4J00 A;  1GV2 A;  1WH5 A;  3EDP A;  3V7R A;  5DEQ A;  2XSD C;  1MBK A;  1YJW I;  3H3V K;  4PFO A;  4GCV A;  3JTG A;  2G9W A;  5FO5 A;  2H1K A;  4XKV A;  2R7T A;  2XRL A;  5BPI A;  2KMU A;  2P8T A;  1QVT A;  2F4O B;  2HGC A;  2CQ7 A;  3PO2 J;  2JUG A;  4A69 C;  3G73 A;  4M71 A;  4BQO A;  4OMY A;  1RZ4 A;  2VT3 A;  3FK7 A;  3K70 C;  2JTV A;  3KZZ A;  2LF8 A;  3CP2 A;  3ZQI A;  2GLO A;  1SVL A;  4RBO A;  2V4J C;  4D5F A;  2XC7 A;  2ZB9 A;  3DKW A;  3KZY A;  4XLE A;  3NQO A;  1C0W A;  4OIR F;  5GAG J;  3BLY A;  3Q5F A;  2BEO A;  2AS5 F;  2CW7 A;  1ZRC A;  1XDU A;  2KP6 A;  2V7F A;  3DBH B;  2IGN A;  3Q3S A;  4Z6Y A;  4ZZD A;  4XRF A;  4B3A A;  2DU9 A;  4P9F A;  3MKY B;  3QYF A;  2EFP A;  4GRI A;  3PSI A;  3PO3 J;  3TP0 A;  3HOZ J;  2RKH A;  1H0M A;  4M3F A;  2AQE A;  3GME A;  2CFX A;  3S2W A;  4XKW A;  1A31 A;  4KN4 X;  5C4J J;  2ISZ A;  3S3N A;  3CF2 A;  2LC2 A;  2VXZ A;  3V8K A;  3S16 J;  1FSH A;  4ENN A;  4UB6 C;  1G59 A;  3GLL A;  2LOO A;  2CGP A;  1SAN A;  1HSJ A;  3QQA A;  4A12 A;  3ISP A;  1HKQ A;  1OYY A;  2K40 A;  4UHT A;  5GTI C;  3JRE A;  2PX9 A;  2Q0O A;  2WAE A;  3WE3 A;  3E3V A;  2W24 A;  1QA6 A;  2DJN A;  2EZL A;  4Y52 J;  1BN5 A;  4KT5 C;  3HOW J;  1DP3 A;  4IRH A;  4FE7 A;  2PEX A;  4IO9 F;  1IN4 A;  5FKM A;  1G3S A;  3NWT A;  2WV1 A;  3L2Q A;  3J7A O;  3CTA A;  4ENM A;  1U9O A;  1U0J A;  2BV6 A;  2IA2 A;  4A3B J;  1KA8 A;  5JVT A;  3AFH A;  3OYL A;  2CQX A;  5EG0 B;  4ITV A;  4WK8 F;  2CFO A;  3F8B A;  2FEZ A;  3IRQ A;  5C4X J;  2UUZ A;  5E3M A;  5FKL A;  4HA8 A;  3V4G A;  1STZ A;  3VWB A;  1MDM B;  2NS7 A;  3FMS A;  1A5J A;  4HLY A;  1K78 B;  5FFZ A;  2L02 A;  2DOD A;  1R36 A;  5IYC J;  1T33 A;  2RRE A;  4BAC A;  4R1H A;  1R49 A;  3JAM K;  3KEQ A;  3L1P A;  2E1O A;  3OMY A;  5EDN A;  3MQ0 A;  5M5X J;  2L7M P;  4XRS A;  4CDG A;  1KU7 A;  2FBK A;  1D8J A;  3FHZ A;  3DV8 A;  4M72 A;  2D5V A;  2CO5 A;  3KEY A;  2RQQ A;  3E97 A;  3GEZ A;  4A3M J;  3GW2 A;  1ZRD A;  2ICW G;  2ZO4 A;  3GTM J;  2WY8 Q;  1VQ8 I;  1IN5 A;  1D0X A;  3KYD B;  3RSN A;  2WWY A;  1CF7 B;  4AIH A;  4LIV A;  2WA0 A;  4QSH A;  4XRM A;  2L3D A;  2FE3 A;  2AXT C;  5A2Q Z;  3O8H A;  3K4K A;  1IRG A;  3CDI A;  4LD5 A;  2ZC2 A;  2VKD A;  3BG7 A;  3K10 A;  3OYD A;  2PMZ A;  4IX7 A;  4C2U A;  3HGY A;  3FXR A;  2HVR A;  2EA2 A;  2VC1 A;  2HKX A;  3LFK A;  1PUF A;  2BVM A;  1J59 A;  4CXF A;  4A3D J;  2MC4 A;  4P5O A;  2MD0 A;  2E35 A;  3DFG A;  3TDU C;  1S6L A;  3DKY A;  4YEJ A;  2Z33 A;  1YW7 A;  2W00 A;  4ESF A;  4E7L A;  3OY9 A;  1H89 C;  2M30 A;  2XF7 A;  1XSV A;  4NB5 A;  3BJA A;  4HDV A;  1E3O C;  2ZSH B;  1D5Y A;  1WCM J;  3KLN A;  4IHV A;  1V3F A;  1RKT A;  1TW2 A;  2LBF B;  3ZMZ A;  1MMS A;  1S9H A;  3NEU A;  3KP6 A;  4EJO A;  4FET A;  1LFU P;  1W5C C;  3ASN H;  3BR5 A;  3I4P A;  3PL8 A;  3CMY A;  4YRV A;  2CQQ A;  1YE9 A;  2RNG A;  4P9U A;  3L2V A;  1JJ6 C;  4HNU A;  2NNN A;  5K7Z A;  3CUQ A;  1WSU A;  4MEY F;  3ML6 A;  2KIQ A;  3IKV A;  2HXO A;  3HPG A;  4A3E J;  2RGV A;  4A0Z A;  4G7O F;  4Q4Z F;  2CUE A;  4F55 A;  2YS9 A;  3P9K A;  5M3F J;  3W6V A;  3FXO A;  3NRV A;  3O8G A;  5CJ9 A;  1LNW A;  2JA7 J;  4AWX B;  2GA2 A;  3PQJ A;  3LOC A;  3PQK A;  4BH9 A;  2BOL A;  3HSF A;  3DCF A;  3SDG A;  5M5W J;  4BJT A;  4PK4 A;  5CKT A;  4A5M A;  1WJF A;  2XAG A;  3I59 B;  4G9Y A;  3HOV J;  2M4K A;  3BZ6 A;  4BS9 A;  1NTC A;  3EUA A;  2HQ5 A;  3EYI A;  3SZG A;  2R7F A;  3CC4 I;  1BW5 A;  3FM3 A;  1Y8Q B;  1SD5 A;  1GXQ A;  2ESH A;  3D0S A;  3DQV C;  1RR8 C;  4MO7 A;  3HDD A;  2KPM A;  3M1C A;  2VB6 A;  5F6F A;  1AWC A;  5KNL A;  1PDN C;  5IOZ A;  2DBB A;  2HTJ A;  3QAH A;  4IVN A;  1X1C A;  2HYF A;  1SAX A;  3DPU A;  1FBQ A;  4L9J A;  3LQQ A;  2ELK A;  3VYU B;  1Z3X A;  4WXH A;  3CCM I;  3GTJ J;  4EEF G;  1WKM A;  2P6T A;  4KMU X;  1D1C A;  1FIA A;  5E79 C;  4NHJ A;  4EVI A;  1FLI A;  2HOA A;  3H5R A;  1APL C;  2QQ9 A;  4C2T A;  1YOV B;  4I2O A;  1Y8R B;  3BR1 A;  5HVQ C;  2F5F A;  5CVR A;  5DV5 A;  5E8I A;  2VUM J;  1KQ8 A;  3ELK A;  4UB8 C;  1XMK A;  4U0V A;  2L0K A;  1ON2 A;  1OIS A;  4HNV A;  4JK1 X;  2LK2 A;  4E7I A;  1KZH A;  1IXS B;  4KIT B;  5L3G A;  3JTH A;  4GFB A;  1R6R A;  1OLT A;  1GLN A;  3D5L A;  4KUM A;  1DU6 A;  4U88 A;  5E20 A;  4K2E A;  1Q1V A;  1MSE C;  5F1R A;  1RI7 A;  3DTK A;  3V7C A;  1B9N A;  5E3O A;  3OV8 A;  4KA4 A;  1S3J A;  4HDU A;  1P6R A;  3LNQ A;  5E3N A;  4I76 A;  3OIP A;  1N78 A;  1T56 A;  4A3L J;  1ETY A;  2JA5 J;  1R1T A;  4M9S A;  1U8B A;  2BY2 A;  5HLI A;  4M9Z A;  1JKP C;  5FKO A;  1ZG5 A;  4KIF A;  1LJ9 A;  4HEA 2;  3BY6 A;  2RQP A;  3ZP5 A;  4MHG A;  2H27 A;  3LSG A;  2ZXH A;  2QCO A;  3L2U A;  2YX4 A;  1H9T A;  5HOO A;  4KN7 X;  3LSJ A;  2KIF A;  2O8X A;  3G4S I;  2DOE A;  1WJE A;  1MMN A;  2KRF A;  2NOG A;  2XF5 A;  1YW8 A;  2DN0 A;  2OD5 A;  1JJ8 C;  3CDH A;  2HPM A;  1DDN A;  1U5T A;  1G4D A;  1VQ5 I;  4KNY A;  1OCP A;  3WHC A;  2EJR A;  1H9G A;  3K7A J;  3DTE A;  2AXL A;  4MTD A;  2KRH A;  5DDG A;  5EEH A;  2GA1 A;  5JI6 A;  2LKS A;  2ME0 A;  1ZLK A;  1HXD A;  5HDG A;  1FOX A;  1BOB A;  2LR8 A;  2Y2Z A;  4UVC A;  5K7H A;  4S05 A;  2KJC A;  2R5Y B;  1P4X A;  2GZW A;  3JSO A;  1FOK A;  2PMZ N;  2CUJ A;  4LJZ F;  1LKX A;  3ZQH A;  2K9M A;  2HPI A;  2NS8 A;  2E1N A;  2W7N A;  4EJW A;  3ZMV A;  3A0H C;  4NBQ A;  5FLM J;  5ILU A;  2R5Z B;  5ICG A;  2IXS A;  5JLW A;  1CF7 A;  1R00 A;  2BYV E;  3H5N A;  1SFO J;  3KPH A;  4N4O B;  2M8E A;  3RYP A;  1Z77 A;  3PUB A;  2A05 A;  2IPQ X;  3T8R A;  5J47 A;  3BJO A;  1REP C;  1HW2 A;  3A02 A;  1OYI A;  4DQ2 A;  4DNC A;  2MSY A;  1X2M A;  4JOM A;  2K27 A;  2ZBK A;  3J7Z I;  1BJZ A;  1D1A A;  1MJA A;  2Z3Y A;  3MZ8 A;  1F5T A;  4HBL A;  2UV1 A;  2KL4 A;  4RAF A;  2I8D A;  2M7B A;  3HZJ A;  5E1W A;  2W1O A;  1BC7 C;  4II2 A;  2EK5 A;  5M5Y J;  3HUG A;  1ACI A;  3OYI A;  5DYM A;  5F27 A;  1GV5 A;  3K69 A;  3ZN1 A;  4FIS A;  2BGC A;  1IV6 A;  2BY3 A;  3PNY A;  2TCT A;  4YIR X;  3IP4 B;  2M1B A;  3TKY A;  3ZXS A;  1MNM C;  1MND A;  1Z0X A;  1ZGJ A;  2MLK A;  4RLF A;  2Y30 A;  3SXY A;  4RGU A;  3HOY J;  1ZQ3 P;  4IXA A;  2LY1 A;  5J1Y A;  3ONQ A;  1UHM A;  1TQI A;  4HW0 A;  1O3S A;  2PJR A;  2JT1 A;  3HSE A;  2QEN A;  2FJ1 A;  5M3M J;  1ZHF A;  1JT6 A;  2VKE A;  3KCC A;  4M9X A;  1XD7 A;  2L2O A;  2TDX A;  2A6T A;  3MZH A;  4L0Z B;  4N4N B;  4Y13 A;  4S04 A;  2YX7 A;  4M3G A;  1IN8 A;  2ECC A;  2G7H A;  3I59 A;  4NQW A;  1W7P B;  4E7Z A;  4OAY A;  1A04 A;  2GOM A;  3BZK A;  3WTW C;  1XSX A;  3HG9 A;  2K3F A;  4XID A;  5HLH A;  4G12 A;  3RKQ A;  2R7O A;  3CJQ B;  3M9A A;  1JT0 A;  4MQV A;  3HOS A;  3ASO H;  2NVX J;  4HF0 A;  4HX8 A;  2JZY A;  2P81 A;  4RAZ A;  5FKN A;  2QQ8 A;  3S32 A;  2UZK A;  1U3E M;  2CSO A;  2ZFW A;  4C3H J;  4E4H A;  5JVG F;  1A35 A;  5J8F A;  2BY0 A;  4BYY A;  4EMS A;  3KET A;  2XAQ A;  3OYM A;  3LQR A;  3A01 A;  3L09 A;  2HKO A;  3CJN A;  1IUY A;  2DDA A;  5EJC A;  3BTL A;  3I55 I;  2YU9 J;  3E6M A;  2Z5U A;  2ZJQ F;  3KYL A;  3OR2 C;  4PJM A;  5JR3 A;  4QPQ A;  4ZDO A;  3QP6 A;  4B09 A;  3WTU C;  3A0B C;  1BR4 A;  1MBF A;  3HRU A;  3FX3 A;  3QWL A;  1UAA A;  3LAJ A;  2MAB A;  1N77 A;  4BJ5 C;  3V8J A;  1LDD A;  3E0J B;  1HQC A;  1ZG1 A;  3EPZ A;  2KLO A;  4FE4 A;  1ZG3 A;  5CVU A;  4NC8 A;  4C3I J;  2KHM A;  3T0Y A;  4AIK A;  3OR1 C;  4AU7 A;  3ESW B;  1T0F A;  1HCR A;  2OUM A;  4BE2 A;  2JMW A;  3TQN A;  1GVJ A;  1OR7 A;  1ETX A;  3TW6 A;  4IF4 A;  4RGX A;  2O9L A;  2P7C B;  3E6D A;  1LFP A;  2HTS A;  2WB1 A;  4AM3 A;  4M6Y A;  4J19 A;  1R1U A;  3DBR B;  3OOP A;  2DJI A;  2MC3 A;  3OIQ A;  3CO6 C;  2QBY A;  1TWG J;  3TP3 A;  1QU3 A;  2DOF A;  3F8C A;  3KX2 A;  1RUO A;  3OS2 A;  3U1D A;  2OAZ A;  4HF2 A;  3QRF F;  1HF0 A;  1W5T A;  2DA7 A;  3H9G A;  3W2W A;  1TT0 A;  3HOT A;  1TZL A;  1YQA A;  5CPR B;  1IZ1 A;  2VQG A;  5B1B H;  4XLN F;  2CW0 F;  3ABL H;  2VBY A;  3FBN B;  5GPC A;  3B02 A;  5CVJ A;  3KZI C;  2Y0S A;  4ZYA A;  4KIB A;  5BS6 A;  4BDY A;  5TJJ A;  5BNG A;  3OYF A;  3OSF A;  4AVP A;  1IDZ A;  1BI3 A;  4XOR A;  1V5E A;  1ZN2 A;  5F0F A;  3S93 A;  1K83 J;  2GM4 A;  5D8L B;  3I56 I;  4NC6 A;  3M8F A;  2HS5 A;  2XPW A;  4OWR B;  1T0F C;  3CF5 F;  4E7K A;  2FOW A;  3FXQ A;  4W97 A;  3T5X A;  1ODD A;  2ETH A;  2KKO A;  3UNG C;  4A5N A;  3MWM A;  2XAF A;  2A69 F;  4YIF A;  5FRM A;  1K7A A;  5F64 A;  4F3Q A;  2E7W A;  3AL0 B;  4A0X A;  2LMD A;  2ZJ2 A;  3FXU A;  3ZR8 X;  5FD5 A;  1WZ2 A;  1RRJ A;  1U9N A;  3MKW B;  4QWQ A;  2B9S A;  5LEK A;  3CD6 I;  3W3C A;  2IW5 A;  2PG4 A;  5LRS A;  3DU5 A;  4PCQ A;  4ESJ A;  3SDB A;  3KE2 A;  5KAF C;  1AKH A;  1S8N A;  3WGI A;  2R3S A;  2QM3 A;  3DEU A;  3Q0V A;  2HOT A;  2A3S A;  5HLT A;  2XAS A;  5C44 J;  2DA1 A;  5ICF A;  5D5X B;  2L7F P;  3DLL F;  2EZK A;  1P9Q C;  3HHH A;  2NS0 A;  3F22 A;  5LBQ A;  4O6J A;  4GYG A;  4HQE A;  5LEJ A;  2STT A;  3S3M A;  1YJN I;  3H3U A;  3BPV A;  1RR7 A;  4PFP A;  4C9Y A;  5LFA A;  1X1B A;  2HOS A;  4B47 A;  5K5O A;  5LLQ A;  4I0B A;  2JPB A;  3VPR A;  4JX5 A;  4V2G A;  2L54 A;  3SYT A;  5HDK A;  1ZK8 A;  4DZP A;  4G7H F;  3B6A A;  1XGO A;  1MKM A;  1ETK A;  3ABT A;  5D5W B;  1A36 A;  3HSR A;  1FPQ A;  3BOQ A;  2CMP A;  2OTL I;  3J81 Z;  1FMV A;  4A3C J;  4CZZ A;  1IJW C;  4LK0 F;  1R5G A;  4IHW A;  4UUS B;  4RS8 A;  1JTY A;  3H35 A;  5D5U B;  2DYR H;  2EBI A;  4TV7 A;  4UY8 I;  2IGM A;  1JXS A;  2RC4 A;  1HDD C;  3HRM A;  1F9N A;  3WTS C;  2DTZ A;  4J01 A;  4FT8 A;  4XOP A;  1FP2 A;  3RDI A;  2VOD A;  1FYM A;  4YII A;  2JVH A;  3FXK A;  3VYT B;  2M5W A;  2RAE A;  2HR3 A;  3O3K A;  4DW6 A;  2HXI A;  1BI2 A;  1B4A A;  1HDP A;  3CCJ I;  4DYC A;  3WG9 A;  2V6E A;  4XK4 A;  3SQN A;  2XHK A;  2STW A;  3HTS B;  1FC3 A;  2ZME B;  4UV8 A;  1MNE A;  5B3S H;  2FML A;  4NQW B;  4XNF A;  4UXN A;  2M4G A;  1YRN A;  3C2B A;  3FXL A;  3I9V 2;  3H92 A;  2BY1 A;  5DS9 A;  1VQL I;  2VQH A;  3F3X A;  3REO A;  4CZC A;  2F4I A;  3GZ5 A;  4PJN A;  1RNL A;  4ZYH A;  3HKZ A;  5HS8 A;  3KP7 A;  2H94 A;  3ZMD A;  1W7P D;  3OYE A;  2X6W A;  4KIS A;  3B6C A;  5D5V B;  4CYC A;  1QNT A;  3LSM A;  1TBX A;  4LK1 F;  4Y4R A;  4C3J J;  2GXB A;  2R4G A;  3ZN0 A;  2L7Z A;  4BHP A;  4D7N A;  3S1M J;  3FM5 A;  1JKQ C;  2CJJ A;  3D5R C;  3FKJ A;  1TNS A;  5DD4 A;  1JTX A;  2A5W A;  1RPW A;  3CZ6 A;  1XDS A;  4ZC3 A;  3FMQ A;  1FMW A;  1HKS A;  3NAU A;  1IF1 A;  1Y1W J;  3PFY A;  2H09 A;  5GPA A;  1IW7 F;  3FMR A;  1MBJ A;  2KQR A;  2EIM H;  2DT6 A;  2F48 A;  1Y0U A;  4DIQ A;  2OQG A;  3IRR A;  2DCE A;  1QRY A;  4JX4 A;  3KYC B;  3E5U A;  3HOU J;  3HBL A;  4V2F A;  4HV5 A;  3CLO A;  4FTH A;  3BCA A;  2Q2E B;  4UV9 A;  1EJ9 A;  3BP8 A;  3LMM A;  1IRZ A;  5FRO A;  3F8M A;  2F4M B;  2FNA A;  2M9H A;  3RPU D;  1SMY F;  3BTC A;  4P55 A;  1ITY A;  5BMZ A;  1WH7 A;  4OU0 A;  3K6G A;  3S2H J;  3GTQ J;  1YFH A;  4B4C A;  3C3W A;  3S2D J;  4IHT A;  3MAJ A;  2LRD A;  2XGC A;  2ZCW A;  4B8X A;  3K4M A;  4Q47 A;  5DM6 F;  4FAS D;  1LEA A;  3TW7 A;  5HLG A;  2OZU A;  1BR1 A;  2RV8 A;  3FIS A;  3PNV A;  1FWZ A;  2MH9 A;  1ZGW A;  3GTP J;  3RQ4 A;  5E17 F;  1QZZ A;  1S72 I;  2JQ7 A;  4ZTJ A;  1R1V A;  4D1Q A;  1SEU A;  2X1C A;  1VQ7 I;  2F6C A;  1WJA A;  4BHC A;  1XSD A;  1W1W E;  1XGN A;  3GXO A;  4HG2 A;  4LG0 B;  2V26 A;  1EKE A;  3UR3 C;  4D5C A;  1ZR2 A;  2WC2 A;  3IWZ A;  2HVS A;  2Y48 A;  1TNT A;  2EB7 A;  1R5H A;  3G1M A;  4V19 K;  4AC0 A;  2QUF A;  1LE8 A;  3E6C C;  3O6B B;  3R0A A;  5J40 A;  2JWT A;  4CYD A;  4XN0 A;  2YSR A;  2E60 A;  4JP0 A;  3PIO F;  4O3M A;  2HQN A;  2VN2 A;  3T1B A;  2MD5 A;  2QEX I;  2IS2 A;  1OFC X;  1VI0 A;  2ZFU A;  4DYR A;  2DK5 A;  1WWX A;  5J4V A;  4A3I J;  2R7V A;  4DOZ A;  2PMH A;  4P1W A;  4RB3 C;  1BI0 A;  2X9D A;  2P5L C;  3IH3 A;  1N25 A;  1X4P A;  2HQR A;  4RB0 A;  1VQK I;  2DI3 A;  1XG1 A;  3ULQ B;  1TP4 A;  4F93 B;  1Y56 A;  3HOX J;  3TED A;  5JFR A;  4AYB A;  2N8G A;  2OCC H;  4ANJ A;  4R8H A;  4M74 A;  1V55 H;  3GCM A;  2GQQ A;  3HEF A;  4MFD A;  2GXG A;  5D6F A;  1K6Y A;  4IEJ A;  3DP7 A;  3F21 A;  3PJR A;  4BEH B;  4MTE A;  4CCJ A;  1XGS A;  3S1R J;  1HKT A;  3JR9 A;  4IRI A;  4EGY A;  1SD6 A;  3OYG A;  4QLC U;  1I39 A;  3IKT A;  4YFN F;  1D8K A;  3G1O A;  4PJJ A;  2Y31 A;  5EEA A;  2R0Q C;  3ZGK A;  3J81 K;  1Y6I A;  2CH0 A;  3GF2 A;  3S1Q J;  5EF6 A;  1VQO I;  1R71 A;  1EH6 A;  2FMY A;  2KFD A;  1WFX A;  5FGM A;  4I01 A;  2KDZ A;  2VLA A;  1ETQ A;  1Z3Y A;  1J5Y A;  2O61 A;  5TGT A;  4R79 A;  3IL2 A;  3TDZ C;  4IJA A;  2LSO A;  4ABZ A;  2H8R A;  1BW6 A;  4I02 A;  4H4K C;  2V9P A;  3QOP A;  2FQ4 A;  1W0T A;  6PAX A;  5K1Y A;  4PDK A;  3RTR A;  1HOM A;  1S7A A;  4HV6 A;  4RLQ A;  1DQU A;  5CLS A;  2R7S A;  4OIQ F;  1HBX G;  2QSH X;  4M3D A;  4HLX A;  1XMX A;  1Z21 A;  2PI0 A;  1FT9 A;  2IGO A;  2WAF A;  3BQZ A;  3K0L A;  1IN6 A;  3EUH C;  3IAM 2;  2DMU A;  5EGO A;  1T8I A;  2DO7 A;  1MJ9 A;  1V5F A;  4HQM A;  2M2E A;  1V5G A;  1T6S A;  1I50 J;  4N9H A;  5B5E C;  2LG4 A;  3CDL A;  3CCS I;  1XCV A;  3RPQ A;  5TRD A;  1B8I B;  2PJP A;  4EJT A;  3VYR B;  1YS7 A;  3HL2 A;  1EF4 A;  3X2Q H;  3L2R A;  3SFI A;  3GZ6 A;  1OCZ H;  5EG0 A;  4AID A;  2DFH A;  5J3L A;  1KU2 A;  1R4M B;  1OYW A;  4IOC F;  3DLA A;  3IH2 A;  1WPK A;  3BR0 A;  3IAS 2;  1R9T J;  1YRN B;  1G3W A;  4CHU A;  2W57 A;  3LSP A;  1K4S A;  2ELH A;  4B43 A;  3DEW A;  1UMQ A;  5LHG A;  4Y7N J;  1OKR A;  4XM3 A;  1SFE A;  3BG6 A;  2BHY A;  4DBR A;  3ECO A;  3CQZ J;  3HB9 A;  1G3Y A;  4A3F J;  2TRT A;  2D45 A;  4IOA F;  1MJB A;  4CYC B;  4X6A J;  3LSI A;  4XLP F;  1AU7 A;  1X58 A;  5LGT A;  4H0E A;  3WTZ A;  5ICC A;  3H9Q A;  4YEL A;  2HDC A;  4ETS A;  1FOW A;  2K3P A;  1UHW A;  2F2E A;  2WV0 A;  1QZY A;  4O5V A;  1Y0N A;  1YIJ I;  3M7G A;  4Y15 A;  2ZXW H;  1U8R A;  3RKW A;  1WVR A;  3VYS B;  2H6C A;  4HAM A;  2VBX A;  1JUM A;  3GFL A;  3DPT A;  3E1S A;  3AG1 H;  2JA6 J;  1NHA A;  2ESN A;  4D9J A;  1U78 A;  3A4C A;  2X48 A;  2KT0 A;  4CO8 A;  4KJZ A;  3RI4 A;  3J80 K;  4L9N A;  4ZYE A;  4BAY A;  2VBZ A;  3WU2 C;  1KU3 A;  2EIJ H;  3WTV C;  1IGN A;  1OCR H;  2Q2E A;  5DUI A;  3BZC A;  2PN6 A;  1PUE E;  4U7B A;  1DPU A;  3CMM A;  3J7A Y;  5DD8 A;  3S8P A;  5FLX K;  3C7J A;  1MMG A;  2QF7 A;  5L3F A;  2VJJ A;  3JRC A;  2O03 A;  3H0D A;  3QOD A;  2Y9Y A;  2LLK A;  1FZP B;  1F4K A;  1MMA A;  2ZJR F;  4BNC A;  1O4X A;  1LUJ B;  4RB2 C;  5IT9 Z;  2A6E F;  1USS A;  5JHU A;  4A2U A;  4NNJ A;  4M6V A;  2FD5 A;  2PMU A;  4HX7 A;  2E36 A;  2V1D A;  4QTR A;  3K1M A;  5AIQ A;  2HWV A;  4ON0 A;  5F0H A;  5HOD A;  1SC7 A;  3KEO A;  2DYS H;  2P5V A;  1W0U A;  3RPU A;  1WRJ A;  2E1M C;  4DJA A;  2R7D A;  4PGG A;  2D1V A;  4CIC A;  1NK2 P;  1G2H A;  4IHS A;  1UHS A;  2IS4 A;  2DXI A;  1R58 A;  1BJA A;  4A3G J;  4IQ4 A;  3U1K A;  3OL4 A;  3I58 A;  2EV5 A;  2KZV A;  3CUQ C;  3BG3 A;  2F5D A;  2XPU A;  1J0R A;  2VQL A;  1PJR A;  2IGK A;  3PUF A;  1MBG A;  1TL8 A;  4WWC A;  4A6E A;  3WTY C;  1BA5 A;  3WTX C;  1Z1D A;  4RB1 A;  2VE9 A;  1ENH A;  3TOA A;  2L9N A;  3WU1 B;  3QYB A;  2B7E A;  2M0M A;  3BG5 A;  3EUK L;  3KIO A;  5J1U A;  4FQG A;  5L3E A;  2DA4 A;  3ECH A;  3K1N A;  5EZG A;  1R23 A;  4UUV A;  1VQ4 I;  2VOO A;  4GYI A;  1Z6R A;  1ZTR A;  5IPA A;  2IA1 A;  1IN7 A;  5GTH C;  1LDJ A;  4XSX F;  5E1X A;  1L0O C;  3JAM Z;  2DAO A;  2NYX A;  2WAD A;  1JI8 A;  1WQ2 A;  4OAZ A;  4L0Y B;  2A68 F;  1P7J A;  1B72 A;  3HC7 A;  2PLY A;  4Q5S F;  3AG3 H;  5LGN A;  2XAU A;  5D8K B;  4U0W A;  2GBY A;  3BPX A;  3TBI A;  4B48 A;  1NK3 P;  3TL4 X;  3DPL C;  2QQA A;  1Y39 A;  4HYE A;  3GTO J;  2NVT J;  4CCM A;  4MEX F;  1DU0 A;  1D1B A;  2FXA A;  1X3W B;  4ENJ A;  2PBI A;  4WF2 A;  2DDB A;  5L3D A;  5IYB J;  2XGE A;  2WAQ N;  1MW7 A;  2Y69 H;  3FIW A;  2E2J J;  3QP5 A;  3P9I A;  2M87 A;  1JKR C;  1I6X A;  2J5O A;  3M07 A;  3LSH A;  4F91 B;  4KIG A;  3K2Z A;  1Z7L A;  4RM2 A;  1E2X A;  4LG3 A;  1UST A;  1CQT A;  4UVA A;  3FHN A;  2VAS A;  4JYK A;  3BJ6 A;  4OIN F;  5E3L A;  2WBM A;  1WJB A;  2CQK A;  4DYQ A;  1ZR4 A;  4X0G A;  1HLV A;  3HXL A;  3H3Z A;  1LQ1 A;  1XX5 A;  4LLG F;  1B9M A;  2KIU A;  2YU3 A;  1HW1 A;  1VND A;  2JUC A;  4CCL A;  4BGD A;  2IS6 A;  2HVQ A;  4RAG A;  2P0W A;  2EFO A;  4KIC A;  3E7L A;  1QPM A;  1X3Z B;  2YUS A;  4LGW A;  4FHT A;  2LH9 A;  4C2M J;  5CQG A;  1GXP A;  3GTG J;  3F6V A;  1HA8 A;  2LYC A;  4PSX A;  3HKZ N;  2MYS A;  1GDT A;  2IBD A;  1YW9 A;  1IDY A;  2ECB A;  1R4N B;  2ZXI A;  4HF1 A;  3D1N I;  2V9K A;  1R7J A;  3C2H A;  3VSL A;  4E6K G;  1U5T C;  4Y17 A;  4M3B A;  2X6Y A;  1BIB A;  4BKX A;  1ZRE A;  2G7U A;  2O0Y A;  2OPT A;  2NRA C;  1YIO A;  5KVR A;  5AON A;  4CCO A;  3IV5 A;  4XSZ F;  4KFC A;  2VJ5 A;  4I98 B;  2KZG A;  5IP6 A;  1MH3 A;  2H8W A;  2DMP A;  1TW3 A;  1Y1V J;  2FF4 A;  3MCZ A;  5E1Z B;  5K5R A;  2NOJ B;  3MEX A;  1QHG A;  2O3F A;  2FUG 2;  1POG A;  4XLH A;  4YFK F;  1LFB A;  4CCK A;  1YJ9 I;  3I54 A;  3L2C A;  1I5Z A;  3D5S C;  5L3C A;  2ZJP F;  1S29 A;  2H6B A;  2A6H F;  2AQF A;  4IQJ A;  4A93 J;  2E34 A;  4II3 A;  1QBJ A;  3RKX A;  1K4T A;  4RGR A;  1YS6 A;  3V7S A;  4DZJ A;  3HUG B;  1YX5 A;  2X51 A;  2M7A A;  2E7X A;  3L7W A;  3G2B A;  4QPO A;  3VOD A;  2DA2 A;  2V1X A;  5BPD A;  1OCC H;  3MZY A;  2HZD A;  4ASN A;  1I1G A;  2OU2 A;  2NAZ A;  2W25 A;  3DEE A;  4JBA A;  4EJV A;  2RNJ A;  4N9I A;  3CO7 C;  4XON A;  1GHC A;  4PSW A;  2P5K A;  1W36 C;  2W84 A;  1PYV A;  3GVA A;  1PP7 U;  3C1D A;  2FQ3 A;  2DFF A;  3H1C A;  3Q0W A;  3JCU C;  1MGT A;  2YPR A;  2VE8 A;  5C3E J;  3GX4 X;  1FBS A;  2EZH A;  5ILV A;  1KQ0 A;  4L9V A;  3U2R A;  1JHH A;  1ZAO A;  2MW8 A;  2F5E A;  2IAI A;  2O8K A;  3AG4 H;  3JRF A;  2V9V A;  3GFJ A;  3DTI A;  1Z67 A;  1KON A;  3RIR A;  4KDP A;  1SD7 A;  4M3E A;  1E17 A;  4RM3 A;  5H20 A;  3J7Y J;  2LY2 A;  3GBG A;  3CP8 A;  3GO5 A;  1W7P A;  2QGU A;  2XAJ A;  2F5V A;  3BT9 A;  5K7F A;  1DP7 P;  1JGG A;  3IUO A;  4BXF A;  2L9R A;  2KIS A;  3H0G J;  2XGX A;  2QYO A;  2VKH A;  2XDV A;  1X1A A;  2JJ7 A;  3JW4 A;  2HFH A;  2FU4 A;  2I5U A;  2LF7 A;  4MIM A;  1YLF A;  2JRM A;  2QLZ A;  4AYB N;  3LA7 A;  3L2W A;  1O3R A;  3TMO A;  3I5U A;  2CG4 A;  4YFX F;  1I1S A;  4WX9 A;  2W82 A;  1A6I A;  3FK6 A;  4B1R A;  3NWS A;  1ON1 A;  2R7X A;  1IRX A;  2Y9Z A;  4IPA A;  3ZMS A;  5B66 C;  4LLN A;  1JUS A;  2JSC A;  1B72 B;  3OYN A;  1UG2 A;  1FX7 A;  2DQR A;  4AD9 A;  3HRS A;  1SFK A;  2VBW A;  3BTJ A;  1K78 A;  2JK3 A;  4MGR A;  3FF5 A;  1AOY A;  2LD5 A;  2F5C A;  4N0B A;  3WU0 A;  4LFU A;  2LTP A;  4XR6 A;  1VF9 A;  4GO1 A;  3HM5 A;  3P7N A;  1V54 H;  4WXD A;  3OS0 A;  4FCY A;  1YI2 I;  1NH3 A;  1VFC A;  2ZNZ A;  1LDK B;  1OCT C;  3F8N A;  2IS1 A;  5IP9 J;  1LPQ A;  1ZRF A;  3AL0 C;  3GWZ A;  4CCN A;  3AAF A;  5HS7 A;  2COM A;  4HPQ A;  2FRH A;  2VQC A;  2FOK A;  5TIS C;  5E18 F;  4UNO A;  3E5Q A;  3F8F A;  3CUO A;  3SZP A;  1OR7 C;  1NG6 A;  2DMT A;  4CSW A;  2K02 A;  2OBP A;  2M8G X;  4JX6 A;  3JRB A;  2R5Y A;  5HS9 A;  2B63 J;  4EJU A;  2DPU A;  1K61 A;  3CME I;  2IVM A;  3Q9V A;  1DGR M;  3CCV I;  2LKX A;  3VOE A;  1LVK A;  2CWE A;  4NUB A;  3GLX A;  5HDN A;  3R61 A;  3CC2 I;  4ZYD A;  4XOT A;  1D5V A;  2IP2 A;  2R5Z A;  4BDZ A;  3DF8 A;  4KT6 A;  1TLH B;  2L9V A;  3ZPL A;  1T39 A;  1I6H J;  2MA3 A;  1T38 A;  4OIP F;  3GFM A;  3I64 A;  3GUD A;  3PFI A;  3B73 A;  4UUT A;  4L5I A;  1TT5 B;  1PVE A;  1NG7 A;  5DCM A;  3HHG A;  3WTT C;  1XCB A;  3M3Y J;  1XB4 A;  2E2I J;  3ERE D;  2R7Q A;  1YYV A;  3BR2 A;  4MFE A;  4ZZL A;  1XN7 A;  1WGX A;  3J80 Z;  3CLQ A;  4HRI A;  2EV0 A;  2DPD A;  3OL3 A;  1ZAR A;  2MG4 A;  1J09 A;  3K4J A;  4I99 C;  4WCG A;  4A3K J;  3BG9 A;  3LFU A;  1RET A;  3PSF A;  2OC6 A;  3HJE A;  3W6K B;  2DMN A;  3M4O J;  5LHI A;  3H36 A;  1T2K A;  3ROU A;  2OA4 A;  1TWC J;  5FFX A;  2M45 A;  2FX0 A;  2NXN B;  1B59 A;  1P92 A;  2V6C A;  1AKH B;  2CV0 A;  1QZE A;  1S7O A;  1ONV A;  1J7K A;  2I10 A;  4F7Z A;  2O7O A;  1FTZ A;  4HOB A;  3SJM A;  2FBI A;  2MLG A;  4EM0 B;  1ZLJ A;  2BXZ A;  3SFZ A;  4XIC A;  1IXR C;  2EWN A;  4XN3 A;  1VQP I;  1X3U A;  2XB0 X;  1ZH5 A;  2LP0 A;  5CYV A;  3U21 A;  5ICE A;  3JRD A;  3E6B A;  3CJR B;  3BQY A;  4HSR A;  1SMT A;  4PGH A;  2XF6 A;  4XBF A;  4OOI A;  3OYC A;  1GUU A;  1TC3 C;  5H2F C;  1OQY A;  2HI3 A;  2BW3 A;  5DTD A;  4I0A A;  1FYK A;  1IV8 A;  2A61 A;  3IWF A;  4G6Q A;  1IAW A;  3G1L A;  1UJ8 A;  1QVU A;  2P7V B;  5F08 A;  2BVL A;  1FJL A;  1F1Z A;  2M3A A;  2D1H A;  3RCO A;  1UFM A;  4IRG A;  1O3T A;  1IUF A;  2JA8 J;  1ERD A;  1Z7U A;  2KRC A;  1IO2 A;  2QA4 I;  4BU2 A;  1E0E A;  1Z05 A;  4Y3O A;  3JRG A;  4PJ0 C;  2CV2 A;  1AA7 A;  3HRT A;  5JLX A;  3DWL E;  5DCF A;  5KCM A;  2EQR A;  3H9J A;  2DQL A;  2XRO A;  3K2A A;  3QOE A;  2BXY A;  2CUF A;  1I3A A;  5K5Q A;  2BHZ A;  3VDX A;  1VQM I;  3OYH A;  1JUP A;  3BCB A;  2XSJ C;  4YG2 F;  2LVS A;  3MD2 A;  5D6E A;  4MQ9 F;  1OPC A;  2B0L A;  5DM7 F;  4ZTF A;  5DUK A;  3A01 B;  3N4M A;  3I4M J;  3BRO A;  3C18 A;  2D2W A;  4LIT A;  4P96 A;  3ZQC A;  1ETO A;  2XPV A;  3QU3 A;  3SHF A;  2ZME A;  3VFZ A;  5E8G A;  2R7W A;  4RAY A;  3F6O A;  2ME6 A;  2W85 A;  2VPR A;  5D4S A;  5GAD J;  2R7U A;  3LAP A;  5CVV A;  1BIA A;  3I71 A;  4Q48 A;  3CCU I;  2VT2 A;  1BI1 A;  2V1U A;  1TWF J;  2MFZ A;  3CCY A;  3OS1 A;  1O7F A;  1O7L A;  3WE2 A;  2M0C A;  4JQF A;  4HX4 A;  5A2Q K;  2EH3 A;  3BWG A;  5CVI A;  3WGG A;  1SFU A;  3S14 J;  1UZC A;  3JRA A;  1P4A A;  3PM1 A;  4RA2 A;  1F36 A;  1XS9 A;  3N05 A;  1J75 A;  2DLL A;  4GXO A;  4UVB A;  1RC9 A;  2K4B A;  1Z6T A;  3FWE A;  4LB5 A;  4ZDL A;  3U9G A;  2L9S A;  1RES A;  1VQN I;  1SVO A;  2C6Y A;  1JHF A;  1P7I A;  4DGW B;  1OJL A;  2L01 A;  2IA0 A;  2E5Z A;  3TGN A;  2J5P A;  5EZH A;  2YR2 A;  4F92 B;  4EQQ A;  2Y0M A;  3WHB A;  3IHU A;  2EA4 A;  2QQB A;  5ED4 A;  4X1E A;  3JRH A;  2VL8 A;  3F0C A;  4LOC A;  1Z91 A;  2VXD A;  1ZYR F;  1YX3 A;  3KP5 A;  3JRI A;  4HNT A;  3BDD A;  4AUX A;  1WJC A;  5LD2 C;  3W2V A;  2VJ4 A;  2CYY A;  3S3O A;  3DXJ F;  4I6Z A;  1X19 A;  2M34 A;  4I09 A;  2NNY A;  1L3L A;  4GDF A;  3BR3 A;  4CA0 A;  4EGZ A;  5KAI C;  2XRN A;  3GYH X;  4KYW A;  3COA C;  1EH7 A;  4EV0 A;  4NC7 A;  5B1A H;  2GAU A;  2QSG X;  1MD0 A;  3OOU A;  5IP7 J;  1B6A A;  2HYG D;  2HZT A;  3FKI J;  3G3Z A;  2A5Y B;  1OCO H;  4XLC A;  2OQR A;  3I0T A;  2VI6 A;  1SVM A;  2Y75 A;  2O6G E;  3O2P E;  1TQP A;  2GXA A;  1ZKG A;  5FKK A;  2AHQ A;  1RUN A;  4I7H A;  5LHH A;  3FXM A;  3MMY B;  3FXJ A;  2VPL A;  3TO7 A;  2EIL H;  2UWM A;  5GP9 A;  2Q1Z B;  1BL0 A;  5J4Y A;  1JKO C;  1Q1H A;  1D0Y A;  4E7J A;  3LWF A;  3ABM H;  3ERM A;  3RYR A;  2ZNY A;  2UXN A;  3QPT A;  2RN7 A;  3ABK H;  3C2G A;  1QGP A;  1R5I D;  2LRE A;  3OYA A;  4MNU A;  5BOX A;  2JN6 A;  5FD6 A;  2IEK A;  1B1B A;  1AHD P;  1RIO H;  2EZI A;  4BHB A;  3CCQ I;  3NAR A;  2ID6 A;  1XMA A;  2X6X A;  5EEG A;  1YIT I;  4G7Z F;  1X2N A;  1LVA A;  2JVG A;  4BY1 J;  4L5E A;  4EM1 A;  2HDD A;  2PJR B;  2GIZ A;  3AG2 H;  4E7S A;  3W6J B;  1GVD A;  2LKP A;  2VC0 A;  3EQL F;  3KLO A;  4E70 A;  5JHF A;  1JE8 A;  2JRT A;  1ZGA A;  1DGW Y;  2XV4 S;  1BBY A;  4IL6 C;  4G6D A;  1W4M A;  1ETW A;  3CCL I;  3R60 A;  3HGG A;  1EA3 A;  2QZ8 A;  2R7R A;  3OYJ A;  2L4M A;  1RKW A;  2K9S A;  2HDW A;  3N97 A;  1KU9 A;  1ORK A;  1BR2 A;  2XIG A;  3K4N A;  3RZO J;  1UCR A;  4S0H B;  2JA2 A;  5H6R A;  4BBR J;  1O57 A;  2E71 A;  3K70 D;  3A1Y A;  2OTJ I;  3RQI A;  3KP2 A;  4PZJ A;  5ILS A;  3HTU A;  3RJP A;  4XL9 A;  1VZ0 A;  5KK1 A;  2X4H A;  2DK8 A;  4CH7 A;  3EET A;  2IRF G;  2AO9 A;  2DT7 B;  2X85 A;  1BOA A;  3A03 A;  4AIJ A;  1H8A C;  3TO9 A;  1E3P A;  2BW3 B;  5CQE A;  3LSR A;  4G6T B;  4BL0 B;  2Z1D A;  2ADU A;  4LMY A;  2OCE A;  2QVO A;  5F0C A;  4MLO A;  1FP1 D;  1FY7 A;  3P5J A;  2O5R A;  4WXC A;  3TOB A;  2WTE A;  5LGU A;  1UG0 A;  1MDM A;  1PP8 F;  3OYK A;  2E2H J;  1VTN C;  2W48 A;  3KP3 A;  1SAU A;  4IHY A;  3S15 J;  2XUB A;  2QSF X;  1YTY A;  3LSK A;  3MKZ A;  1XPX A;  2HEO A;  4HST A;  1TWA J;  2DA6 A;  2LY9 A;  5AIP A;  1Z9C A;  4QIW N;  2JSP A;  5FJ8 J;  4E7H A;  1U2W A;  2VKV A;  2EFN A;  4BY7 J;  3Q0U A;  3K4B A;  2KJB A;  3ZMU A;  3QPS A;  2DA3 A;  2DW4 A;  3IH4 A;  3GFI A;  2FNP A;  3EUH A;  2GWR A;  3F9K A;  2K9Q A;  2OV7 A;  1WJ5 A;  2QBY B;  1VQ9 I;  3W2A A;  3IC7 A;  1YG2 A;  4BUP A;  4U7D A;  3ZQG A;  5IT3 A;  4LIU A;  3CC7 I;  3CMA I;  2LDU A;  2QKM B;  4XKC A;  1XC5 A;  2DMQ A;  4NDL A;  3Q9S A;  3L9F A;  1FYL A;  4XMY A;  1WJD A;  3QPH A;  3K4L A;  5J1R A;  4U0Y A;  1MBH A;  4OMZ A;  1BC8 C;  2FSW A;  2K85 A;  3V8L A;  1XTA A;  1X1P A;  3OIO A;  1IRF A;  2ZME C;  2ISY A;  3FDY A;  4BJ6 C;  1MIJ A;  4RDU A;  2CU7 A;  3OYB A;  4OIO F;  2L7K A;  2CV1 A;  3FZV A;  5FLX Z;  3ZQF A;  4IHX A;  2Z9O A;  1MBE A;  2VON A;  3KFW X; 
#chains in the Genus database with same CATH homology
 1W5S A;  3QU6 A;  1KYZ A;  3SZT A;  2IT0 A;  2P4W A;  1U6G A;  4A6D A;  5FB2 A;  2XKP A;  4G94 A;  3RKY A;  4GGG A;  2OZ6 A;  4D0P A;  3LST A;  1P4W A;  4LG0 A;  2DT5 A;  1I27 A;  4FX0 A;  5DCM B;  3L00 A;  2BBY A;  1O3Q A;  2EV6 A;  4EM2 A;  1J9I A;  2IJL A;  1DUX C;  2X0L A;  2GIV A;  4FX4 A;  2KIM A;  5BQT A;  1V4R A;  1TTY A;  3E5X A;  1FBU A;  2XKO A;  3TO6 A;  3WOD F;  3VEP A;  2V79 A;  2RDP A;  3LA3 A;  1QO0 D;  1K6O A;  2E1C A;  5J8C A;  2Z99 A;  4ENK A;  3HIF A;  1WI9 A;  3F23 A;  1R22 A;  1BM9 A;  1J2X A;  1SD4 A;  2MH2 A;  4LB6 B;  4HZF A;  4M73 A;  2XAH A;  3JSP A;  4L18 B;  3LA2 A;  3P9C A;  1XGM A;  1EH8 A;  2HOE A;  3I53 A;  2JPC A;  1YO5 C;  3EYY A;  4BXU A;  2PFB A;  4ESB A;  1UB9 A;  5IT9 K;  1IXC A;  3R4K A;  1ULY A;  1P2F A;  1CGP A;  2FBH A;  3T8T A;  1LEB A;  1TQM A;  2MBF A;  2QWW A;  4M6X A;  1T98 A;  3WGH A;  1D3Y A;  2PQ8 A;  2RVC A;  1HST A;  3K9T A;  3R0J A;  4L5J A;  2UXX A;  3VB2 A;  1HW5 A;  3F72 A;  4L9T A;  3ZMT A;  3ZQ7 A;  2ZXJ A;  2A07 F;  5LRR A;  1U5T B;  4KMF A;  3M1E A;  3R6S A;  1K79 A;  1QQI A;  2ZKZ A;  5L3B A;  2ACJ A;  4CGZ A;  4RGS A;  2DFI A;  2K86 A;  2K7L A;  1FNN A;  1G6N A;  5D4R A;  1FSE A;  4ZYG A;  2XVC A;  1G3T A;  1JGS A;  2EFW A;  2Q8K A;  2BE5 F;  3KP4 A;  2K4J A;  2DTR A;  3K1P A;  1EV7 A;  1SFX A;  3M8E A;  1KQ9 A;  1DPR A;  3ABU A;  4BQA A;  5J6X A;  4LLL A;  2P6S A;  4Z2Y A;  5H6Q A;  1OMI A;  4ZH4 F;  3CUQ B;  4A0Y A;  1KGS A;  3MFK A;  1LB2 A;  2LNB A;  3HYI A;  1KYW A;  1MZB A;  2L4A A;  2VOP A;  4G8X A;  2EFQ A;  5ERI A;  2FA5 A;  3EDP A;  3V7R A;  5DEQ A;  4GCV A;  3JTG A;  2G9W A;  5FO5 A;  5BPI A;  2P8T A;  2HGC A;  3G73 A;  4M71 A;  4OMY A;  1RZ4 A;  2VT3 A;  2JTV A;  3KZZ A;  2LF8 A;  3DKW A;  3KZY A;  3NQO A;  1C0W A;  4OIR F;  3Q5F A;  2BEO A;  2AS5 F;  1ZRC A;  1XDU A;  4ZZD A;  4XRF A;  2DU9 A;  4P9F A;  2EFP A;  2RKH A;  1H0M A;  2CFX A;  3S2W A;  4KN4 X;  2ISZ A;  2VXZ A;  3V8K A;  1FSH A;  4ENN A;  2CGP A;  1HSJ A;  4A12 A;  3ISP A;  1HKQ A;  1OYY A;  4UHT A;  2Q0O A;  3WE3 A;  3E3V A;  2W24 A;  1BN5 A;  4KT5 C;  4IRH A;  2PEX A;  1IN4 A;  1G3S A;  3J7A O;  3CTA A;  4ENM A;  2BV6 A;  2IA2 A;  1KA8 A;  5JVT A;  4WK8 F;  3F8B A;  2FEZ A;  3IRQ A;  3V4G A;  4HA8 A;  1STZ A;  1MDM B;  3FMS A;  4HLY A;  1K78 B;  5FFZ A;  2L02 A;  1R36 A;  4R1H A;  3JAM K;  3KEQ A;  1KU7 A;  3MQ0 A;  1D8J A;  4CDG A;  2FBK A;  3FHZ A;  3DV8 A;  4M72 A;  2CO5 A;  3E97 A;  3GEZ A;  3GW2 A;  1ZRD A;  2ZO4 A;  1IN5 A;  2WWY A;  1CF7 B;  4AIH A;  2L3D A;  2FE3 A;  5A2Q Z;  1IRG A;  4LD5 A;  3FXR A;  2EA2 A;  2VC1 A;  2HKX A;  3LFK A;  1J59 A;  4CXF A;  4P5O A;  3TDU C;  3DFG A;  1S6L A;  2Z33 A;  1YW7 A;  4ESF A;  2M30 A;  4NB5 A;  1XSV A;  3BJA A;  4HDV A;  3KLN A;  1V3F A;  1TW2 A;  3ZMZ A;  3NEU A;  3KP6 A;  4EJO A;  3I4P A;  4P9U A;  2NNN A;  3CUQ A;  1WSU A;  4MEY F;  3ML6 A;  3IKV A;  4G7O F;  2RGV A;  4A0Z A;  4Q4Z F;  3P9K A;  3NRV A;  5CJ9 A;  1LNW A;  4AWX B;  2GA2 A;  3PQJ A;  3PQK A;  4BH9 A;  3HSF A;  4A5M A;  2XAG A;  3I59 B;  4G9Y A;  3BZ6 A;  3EYI A;  2R7F A;  3FM3 A;  1SD5 A;  1GXQ A;  2ESH A;  3D0S A;  3DQV C;  5F6F A;  1AWC A;  1PDN C;  2DBB A;  2HTJ A;  3QAH A;  4IVN A;  2HYF A;  1SAX A;  4L9J A;  1FBQ A;  3LQQ A;  4WXH A;  1WKM A;  2P6T A;  4KMU X;  4NHJ A;  4EVI A;  1FLI A;  2QQ9 A;  4I2O A;  5HVQ C;  2F5F A;  5CVR A;  5DV5 A;  5E8I A;  1KQ8 A;  3ELK A;  1XMK A;  4U0V A;  1ON2 A;  4JK1 X;  1IXS B;  5L3G A;  3JTH A;  3D5L A;  4KUM A;  4U88 A;  5E20 A;  4K2E A;  5F1R A;  1RI7 A;  3V7C A;  1B9N A;  4KA4 A;  3OV8 A;  1S3J A;  4HDU A;  1P6R A;  1R1T A;  4M9S A;  5HLI A;  4M9Z A;  1ZG5 A;  4KIF A;  1LJ9 A;  3BY6 A;  2RQP A;  3ZP5 A;  4MHG A;  2H27 A;  2YX4 A;  1H9T A;  5HOO A;  4KN7 X;  2KIF A;  2O8X A;  2KRF A;  1YW8 A;  2OD5 A;  1DDN A;  1G4D A;  3CDH A;  4KNY A;  1U5T A;  2EJR A;  1H9G A;  2AXL A;  4MTD A;  5DDG A;  5EEH A;  2GA1 A;  5JI6 A;  1ZLK A;  1HXD A;  5HDG A;  4UVC A;  4S05 A;  2KJC A;  1P4X A;  2GZW A;  3JSO A;  1FOK A;  4LJZ F;  2E1N A;  4EJW A;  3ZMV A;  5ILU A;  5ICG A;  1CF7 A;  1R00 A;  2BYV E;  3RYP A;  2M8E A;  2IPQ X;  3T8R A;  3BJO A;  1REP C;  1HW2 A;  1OYI A;  4DQ2 A;  4DNC A;  2K27 A;  2ZBK A;  1MJA A;  2Z3Y A;  1F5T A;  4HBL A;  5E1W A;  1BC7 C;  2EK5 A;  3HUG A;  5DYM A;  3K69 A;  3ZN1 A;  2BGC A;  2M1B A;  3TKY A;  1ZGJ A;  2MLK A;  3SXY A;  4RGU A;  4IXA A;  1UHM A;  1TQI A;  4HW0 A;  1O3S A;  2JT1 A;  3HSE A;  2QEN A;  1ZHF A;  3KCC A;  4M9X A;  1XD7 A;  2TDX A;  3MZH A;  4L0Z B;  4Y13 A;  4S04 A;  2YX7 A;  1IN8 A;  2G7H A;  3I59 A;  4NQW A;  1W7P B;  1A04 A;  3WTW C;  1XSX A;  5HLH A;  3M9A A;  4MQV A;  3HOS A;  4HF0 A;  4HX8 A;  2JZY A;  4RAZ A;  2UZK A;  1U3E M;  2CSO A;  2ZFW A;  5J8F A;  4BYY A;  4EMS A;  3KET A;  2XAQ A;  3LQR A;  3L09 A;  2HKO A;  3CJN A;  1IUY A;  3E6M A;  2Z5U A;  5JR3 A;  3QP6 A;  4B09 A;  3WTU C;  3HRU A;  3FX3 A;  3LAJ A;  3V8J A;  1LDD A;  1HQC A;  1ZG1 A;  1ZG3 A;  5CVU A;  4AIK A;  3T0Y A;  1T0F A;  3TQN A;  1GVJ A;  1OR7 A;  4IF4 A;  4RGX A;  2P7C B;  3E6D A;  2HTS A;  4M6Y A;  1R1U A;  3OOP A;  2MC3 A;  3CO6 C;  2QBY A;  3F8C A;  1RUO A;  3U1D A;  2OAZ A;  4HF2 A;  3QRF F;  1W5T A;  3HOT A;  1YQA A;  1IZ1 A;  4XLN F;  2CW0 F;  2VBY A;  3B02 A;  5CVJ A;  4KIB A;  5BS6 A;  5TJJ A;  4AVP A;  1BI3 A;  1ZN2 A;  5D8L B;  3M8F A;  2HS5 A;  3FXQ A;  3T5X A;  1ODD A;  2ETH A;  2KKO A;  4A5N A;  3MWM A;  2XAF A;  2A69 F;  4YIF A;  1K7A A;  5F64 A;  2E7W A;  4A0X A;  2ZJ2 A;  3FXU A;  5FD5 A;  4QWQ A;  5LEK A;  2IW5 A;  2PG4 A;  5LRS A;  4PCQ A;  4ESJ A;  3KE2 A;  1S8N A;  3WGI A;  2R3S A;  2QM3 A;  3DEU A;  2A3S A;  2XAS A;  5D5X B;  5ICF A;  3HHH A;  2NS0 A;  3F22 A;  5LBQ A;  4O6J A;  4GYG A;  4HQE A;  5LEJ A;  2STT A;  3H3U A;  3BPV A;  5K5O A;  5LLQ A;  4I0B A;  2JPB A;  2L54 A;  5HDK A;  4G7H F;  1XGO A;  1MKM A;  3ABT A;  5D5W B;  3HSR A;  1FPQ A;  3BOQ A;  3J81 Z;  4CZZ A;  4LK0 F;  1R5G A;  4RS8 A;  5D5U B;  4TV7 A;  1JXS A;  2RC4 A;  3HRM A;  1F9N A;  3WTS C;  4FT8 A;  3RDI A;  1FP2 A;  2VOD A;  1FYM A;  4YII A;  2M5W A;  2HR3 A;  3O3K A;  1BI2 A;  1B4A A;  3WG9 A;  3SQN A;  2XHK A;  2STW A;  3HTS B;  1FC3 A;  2ZME B;  4UV8 A;  2FML A;  4UXN A;  3H92 A;  3REO A;  3F3X A;  3GZ5 A;  1RNL A;  4ZYH A;  5HS8 A;  3KP7 A;  2H94 A;  3ZMD A;  1W7P D;  5D5V B;  1QNT A;  1TBX A;  4LK1 F;  2GXB A;  3ZN0 A;  4BHP A;  3FM5 A;  5DD4 A;  1TNS A;  1XDS A;  3FMQ A;  1HKS A;  1IF1 A;  2H09 A;  1IW7 F;  3FMR A;  1Y0U A;  2OQG A;  3IRR A;  3E5U A;  4HV5 A;  3CLO A;  4UV9 A;  3BP8 A;  3F8M A;  2FNA A;  1SMY F;  4P55 A;  5BMZ A;  4OU0 A;  1YFH A;  3C3W A;  4IHT A;  3MAJ A;  2ZCW A;  4B8X A;  4Q47 A;  1LEA A;  5HLG A;  2OZU A;  2RV8 A;  1FWZ A;  2MH9 A;  5E17 F;  1QZZ A;  1R1V A;  4BHC A;  1XSD A;  1XGN A;  3GXO A;  4LG0 B;  2WC2 A;  3IWZ A;  2Y48 A;  1TNT A;  2EB7 A;  1R5H A;  2QUF A;  3E6C C;  3O6B B;  3R0A A;  4CYD A;  2YSR A;  4O3M A;  2HQN A;  2VN2 A;  3T1B A;  2MD5 A;  2DK5 A;  1WWX A;  2PMH A;  2P5L C;  4RB3 C;  1BI0 A;  2HQR A;  4RB0 A;  2DI3 A;  3ULQ B;  5JFR A;  4R8H A;  4M74 A;  2GQQ A;  2GXG A;  5D6F A;  3DP7 A;  3F21 A;  4MTE A;  1XGS A;  1HKT A;  4IRI A;  4EGY A;  1SD6 A;  4QLC U;  3IKT A;  4YFN F;  1D8K A;  3J81 K;  3GF2 A;  1EH6 A;  2FMY A;  5FGM A;  4I01 A;  1J5Y A;  2O61 A;  3IL2 A;  4R79 A;  3TDZ C;  4IJA A;  2LSO A;  4I02 A;  3QOP A;  6PAX A;  5K1Y A;  4PDK A;  3RTR A;  1S7A A;  4HV6 A;  5CLS A;  4OIQ F;  1HBX G;  4HLX A;  2PI0 A;  1FT9 A;  3K0L A;  1IN6 A;  2DO7 A;  1MJ9 A;  4HQM A;  1T6S A;  4N9H A;  1XCV A;  3RPQ A;  5TRD A;  2PJP A;  4EJT A;  1YS7 A;  3GZ6 A;  1KU2 A;  1OYW A;  1G3W A;  4CHU A;  2W57 A;  2ELH A;  5LHG A;  1OKR A;  1SFE A;  3ECO A;  1G3Y A;  2D45 A;  1MJB A;  4XLP F;  5LGT A;  4H0E A;  3WTZ A;  5ICC A;  2HDC A;  4ETS A;  1UHW A;  2F2E A;  2WV0 A;  1QZY A;  4O5V A;  3M7G A;  4Y15 A;  1U8R A;  3RKW A;  2H6C A;  4HAM A;  2VBX A;  3GFL A;  3DPT A;  1NHA A;  2ESN A;  1U78 A;  4CO8 A;  3RI4 A;  3J80 K;  4L9N A;  4ZYE A;  4BAY A;  2VBZ A;  1KU3 A;  3WTV C;  2Q2E A;  5DUI A;  2PN6 A;  1PUE E;  4U7B A;  1DPU A;  5DD8 A;  5FLX K;  3C7J A;  5L3F A;  2O03 A;  1FZP B;  1F4K A;  4BNC A;  4RB2 C;  5IT9 Z;  2A6E F;  1USS A;  5JHU A;  4A2U A;  2PMU A;  4HX7 A;  2V1D A;  3K1M A;  5AIQ A;  2HWV A;  4ON0 A;  3KEO A;  2P5V A;  3RPU A;  1WRJ A;  2R7D A;  4PGG A;  2D1V A;  4CIC A;  4IHS A;  1R58 A;  1BJA A;  3I58 A;  2EV5 A;  3CUQ C;  2F5D A;  1J0R A;  4WWC A;  4A6E A;  3WTY C;  3WTX C;  1Z1D A;  4RB1 A;  2VE9 A;  3TOA A;  3WU1 B;  5L3E A;  3ECH A;  3K1N A;  1R23 A;  4UUV A;  2VOO A;  4GYI A;  1Z6R A;  2IA1 A;  1IN7 A;  1LDJ A;  4XSX F;  5E1X A;  1L0O C;  3JAM Z;  2DAO A;  2NYX A;  1WQ2 A;  4L0Y B;  2A68 F;  2PLY A;  4Q5S F;  5LGN A;  5D8K B;  4U0W A;  3BPX A;  3DPL C;  2QQA A;  4HYE A;  4MEX F;  2FXA A;  4ENJ A;  2PBI A;  4WF2 A;  5L3D A;  3QP5 A;  3P9I A;  2M87 A;  1I6X A;  2J5O A;  4KIG A;  3K2Z A;  1E2X A;  1UST A;  4UVA A;  3BJ6 A;  4OIN F;  2CQK A;  3H3Z A;  1LQ1 A;  4LLG F;  1B9M A;  2KIU A;  2YU3 A;  1HW1 A;  2EFO A;  4KIC A;  1QPM A;  4LGW A;  4FHT A;  1GXP A;  3F6V A;  1YW9 A;  4HF1 A;  1R7J A;  1U5T C;  4Y17 A;  1BIB A;  1ZRE A;  2G7U A;  2O0Y A;  2NRA C;  1YIO A;  5KVR A;  5AON A;  4XSZ F;  4KFC A;  4I98 B;  1TW3 A;  2FF4 A;  3MCZ A;  5E1Z B;  5K5R A;  3MEX A;  2O3F A;  4YFK F;  3I54 A;  3L2C A;  1I5Z A;  5L3C A;  1S29 A;  2H6B A;  2A6H F;  1QBJ A;  3RKX A;  4RGR A;  1YS6 A;  3V7S A;  2E7X A;  3L7W A;  3VOD A;  2V1X A;  5BPD A;  3MZY A;  4ASN A;  1I1G A;  2OU2 A;  2NAZ A;  2W25 A;  4JBA A;  4EJV A;  2RNJ A;  4N9I A;  3CO7 C;  1GHC A;  2P5K A;  2W84 A;  3GVA A;  1PP7 U;  3C1D A;  2FQ3 A;  1MGT A;  2YPR A;  2VE8 A;  3GX4 X;  1FBS A;  5ILV A;  1KQ0 A;  4L9V A;  3U2R A;  1JHH A;  1ZAO A;  2F5E A;  2V9V A;  3GFJ A;  4KDP A;  3RIR A;  1SD7 A;  1E17 A;  5H20 A;  3GO5 A;  1W7P A;  2XAJ A;  1DP7 P;  2XGX A;  2QYO A;  3JW4 A;  2HFH A;  2FU4 A;  2LF7 A;  1YLF A;  2QLZ A;  1O3R A;  3LA7 A;  3I5U A;  2CG4 A;  4YFX F;  1I1S A;  4WX9 A;  1ON1 A;  4IPA A;  3ZMS A;  4LLN A;  2JSC A;  1FX7 A;  2DQR A;  4AD9 A;  3HRS A;  2VBW A;  1K78 A;  4MGR A;  3FF5 A;  1AOY A;  2F5C A;  4N0B A;  3WU0 A;  4LFU A;  4GO1 A;  3P7N A;  4WXD A;  2ZNZ A;  1LDK B;  3F8N A;  1ZRF A;  3GWZ A;  3AAF A;  5HS7 A;  2COM A;  2FRH A;  2FOK A;  5E18 F;  4UNO A;  3E5Q A;  3F8F A;  3CUO A;  3SZP A;  2K02 A;  2OBP A;  5HS9 A;  4EJU A;  2DPU A;  2IVM A;  3Q9V A;  3VOE A;  2CWE A;  3GLX A;  5HDN A;  3R61 A;  4ZYD A;  1D5V A;  2IP2 A;  3DF8 A;  1TLH B;  3ZPL A;  1T39 A;  1T38 A;  2MA3 A;  4OIP F;  3GFM A;  3I64 A;  3GUD A;  3PFI A;  3B73 A;  4L5I A;  5DCM A;  3HHG A;  3WTT C;  1XCB A;  1XB4 A;  3ERE D;  1YYV A;  4ZZL A;  1XN7 A;  3J80 Z;  2EV0 A;  2DPD A;  1ZAR A;  4WCG A;  3W6K B;  5LHI A;  1T2K A;  3ROU A;  2OA4 A;  5FFX A;  2M45 A;  1B59 A;  1P92 A;  2V6C A;  1S7O A;  1ONV A;  1J7K A;  4F7Z A;  4HOB A;  2FBI A;  2MLG A;  4EM0 B;  1ZLJ A;  3SFZ A;  1IXR C;  2EWN A;  1X3U A;  1ZH5 A;  5CYV A;  5ICE A;  3E6B A;  1SMT A;  4PGH A;  4XBF A;  4OOI A;  1FYK A;  4I0A A;  2A61 A;  3IWF A;  4G6Q A;  1IAW A;  2P7V B;  1F1Z A;  2D1H A;  1UFM A;  4IRG A;  1O3T A;  1Z7U A;  1Z05 A;  3HRT A;  5DCF A;  2DQL A;  2XRO A;  5K5Q A;  4YG2 F;  5D6E A;  4MQ9 F;  1OPC A;  2B0L A;  5DUK A;  3N4M A;  3BRO A;  3C18 A;  2D2W A;  4P96 A;  3QU3 A;  3SHF A;  2ZME A;  3VFZ A;  5E8G A;  4RAY A;  3F6O A;  2W85 A;  5D4S A;  3LAP A;  5CVV A;  1BIA A;  3I71 A;  4Q48 A;  2VT2 A;  1BI1 A;  2V1U A;  1O7F A;  1O7L A;  3WE2 A;  4JQF A;  4HX4 A;  5A2Q K;  3BWG A;  5CVI A;  3WGG A;  1SFU A;  1P4A A;  1J75 A;  2DLL A;  4GXO A;  4UVB A;  2K4B A;  1Z6T A;  3FWE A;  4LB5 A;  3U9G A;  2C6Y A;  1JHF A;  2L01 A;  2IA0 A;  3TGN A;  2J5P A;  2YR2 A;  4EQQ A;  2Y0M A;  3IHU A;  2EA4 A;  2QQB A;  5ED4 A;  1Z91 A;  1ZYR F;  3KP5 A;  3BDD A;  2CYY A;  3DXJ F;  4I09 A;  2NNY A;  1L3L A;  4EGZ A;  2XRN A;  3GYH X;  4KYW A;  3COA C;  1EH7 A;  4EV0 A;  2GAU A;  1MD0 A;  1B6A A;  2HYG D;  2HZT A;  2A5Y B;  3G3Z A;  2OQR A;  3I0T A;  2Y75 A;  2O6G E;  3O2P E;  1TQP A;  1RUN A;  4I7H A;  5LHH A;  2UWM A;  3TO7 A;  1Q1H A;  3LWF A;  3RYR A;  2ZNY A;  2UXN A;  3QPT A;  2RN7 A;  1QGP A;  4MNU A;  5BOX A;  5FD6 A;  1B1B A;  1RIO H;  4BHB A;  1XMA A;  5EEG A;  4G7Z F;  1LVA A;  4EM1 A;  3W6J B;  2LKP A;  2VC0 A;  3EQL F;  3KLO A;  4E70 A;  1JE8 A;  2JRT A;  1ZGA A;  2XV4 S;  1BBY A;  4G6D A;  1W4M A;  3R60 A;  2QZ8 A;  2L4M A;  3N97 A;  1KU9 A;  2XIG A;  1UCR A;  5H6R A;  1O57 A;  3KP2 A;  4PZJ A;  5ILS A;  3HTU A;  3RJP A;  5KK1 A;  2X4H A;  2DK8 A;  3EET A;  2IRF G;  1BOA A;  4AIJ A;  3TO9 A;  2ADU A;  4LMY A;  2QVO A;  1FP1 D;  1FY7 A;  4WXC A;  3TOB A;  2WTE A;  5LGU A;  1MDM A;  1PP8 F;  1VTN C;  3KP3 A;  2XUB A;  1YTY A;  2HEO A;  5AIP A;  1Z9C A;  1U2W A;  2EFN A;  3ZMU A;  2KJB A;  2DW4 A;  3GFI A;  2FNP A;  3EUH A;  2QBY B;  2GWR A;  3IC7 A;  1YG2 A;  4U7D A;  5IT3 A;  2LDU A;  3Q9S A;  3L9F A;  1FYL A;  3QPH A;  4U0Y A;  4OMZ A;  1BC8 C;  2FSW A;  3V8L A;  1IRF A;  2ISY A;  4OIO F;  3FZV A;  5FLX Z;  2Z9O A;  2VON A;  3KFW X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...