2IRFG

Crystal structure of an irf-2/dna complex.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
109
structure length
109
Chain Sequence
RMRMRPWLEEQINSNTIPGLKWLNKEKKIFQIPWMHAARHGWDVEKDAPLFRNWAIHTGKHQPGIDKPDPKTWKANFRCAMNSLPDIEEVKDRSIKKGNNAFRVYRMLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation/dna
molecule keywords DNA (5'-D(P*AP*AP*GP*TP*GP*AP*AP*AP*GP*(5IU)P*GP*A)-3')
publication title Crystal structure of an IRF-DNA complex reveals novel DNA recognition and cooperative binding to a tandem repeat of core sequences.
pubmed doi rcsb
source organism Mus musculus
total genus 30
structure length 109
sequence length 109
chains with identical sequence H, I, J, K, L
ec nomenclature
pdb deposition date 1999-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00605 IRF Interferon regulatory factor transcription factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2irfG00
3R0AA 3GXOA 2RQPA 4A0ZA 4KN7X 2OQGA 5A2QK 3BJAA 1SD6A 2A3SA 1JHFA 4EJUA 1HQCA 3NQOA 4UUVA 2HKOA 1J7KA 3F8CA 3QPHA 4LLNA 1BJAA 2PFBA 5ICCA 3CO7C 3E6BA 1JGSA 2P7CB 3PQKA 3P7NA 2WC2A 2R7DA 2JRTA 4OOIA 2IP2A 3H3ZA 2UXXA 5DD8A 4HF0A 1G3YA 4EM0B 1W5SA 2V79A 1T2KA 2QBYB 1FYLA 3T8TA 1IXSB 4I2OA 2XHKA 3HHHA 3K1NA 3ZMTA 4UNOA 2FQ3A 1IAWA 2A07F 3WTXC 2CSOA 2YU3A 4ZH4F 1ZG5A 2P5KA 1J2XA 2E7XA 4HOBA 2K27A 3R4KA 1OR7A 1XDUA 2XKOA 3KFWX 5LHGA 2DK5A 3J80K 3HSRA 1ULYA 1AOYA 3CLOA 4KDPA 2EFNA 4M9SA 2LDUA 3W6KB 4Q48A 2O03A 5BQTA 3CUQC 3M1EA 3BJ6A 2EFOA 4ESJA 5DUKA 2FF4A 2ZFWA 3WGHA 5CJ9A 1OPCA 2EV6A 1LEBA 2KIMA 1IN4A 2IRFG 2DBBA 4I7HA 4G7OF 3V7SA 3RJPA 2HFHA 1D5VA 4KUMA 4Y13A 4UVCA 2Z99A 4L9NA 2G7UA 3ML6A 4UV9A 4IF4A 3KP3A 3V8JA 4HYEA 4UVBA 4XBFA 1KU3A 4OMZA 3F8NA 3D5LA 4LB6B 3F6OA 2QM3A 4YFXF 3V8KA 4G9YA 4IHTA 5CVRA 1TQPA 3FMSA 2M8EA 4EQQA 2ZO4A 3GUDA 1Z05A 3JSPA 1IUYA 1O3TA 3VOEA 3ISPA 1KGSA 2OZUA 2XUBA 3E5UA 3QPTA 4EGZA 3W6JB 4RB0A 2O3FA 4HLYA 2O61A 5LEJA 3GW2A 2OAZA 3WTYC 1O3RA 1Q1HA 4MQ9F 1RIOH 4HBLA 2DU9A 2KJBA 5KK1A 3WU0A 3KE2A 2FBKA 3I4PA 5K5RA 3DXJF 4H0EA 5JR3A 4ENJA 1G3WA 5K5QA 2P6TA 1ON1A 1XDSA 4LJZF 1KQ8A 1I5ZA 2OU2A 4ZYDA 5LLQA 3TDUC 1L3LA 3JAMK 5DUIA 4JK1X 1TW3A 4OU0A 3JTGA 3RYRA 5HDKA 2D1HA 5EEHA 1QNTA 3EUHA 2P5VA 2D2WA 2MD5A 1P6RA 2JPBA 1MDMA 3KZYA 2HS5A 2XAHA 5E8GA 2W57A 1FZPB 5HLIA 1TLHB 5LHIA 2YX4A 5K5OA 2L01A 1G3SA 3F8MA 2R7FA 4IPAA 1P4WA 4O3MA 3LA2A 4Z2YA 5ICFA 3QU3A 2EFQA 2V1UA 4RS8A 2XAJA 3F3XA 1X3UA 1DP7P 1W4MA 3KP2A 4GCVA 3ROUA 2M5WA 5CLSA 3DEUA 2PEXA 4R1HA 1LDJA 3RI4A 2V1DA 1ZARA 3O2PE 5FFZA 4HF1A 1MDMB 4AIJA 4IRIA 1TW2A 1OYIA 1XGMA 2XGXA 4AVPA 1HW1A 1FY7A 1YW8A 1J59A 4XLPF 4M74A 2HR3A 2Z5UA 4LMYA 4CHUA 1UHWA 2NAZA 3WE2A 2HDCA 4RB2C 4I98B 2A6HF 4AWXB 2MA3A 3NEUA 2R3SA 4CO8A 1CGPA 4ESBA 4WXDA 1MJAA 3SFZA 4U0YA 5LGUA 3F8BA 2JPCA 3HTSB 3WE3A 4M9ZA 3D0SA 3KP6A 5LGTA 1O57A 4B8XA 2F5FA 1ZN2A 4O6JA 3LFKA 3R60A 3MEXA 3FM5A 5ICEA 4FT8A 3FXQA 2XV4S 1UHMA 4BAYA 4CZZA 2FA5A 3KP7A 4EM2A 1A04A 4CICA 1T0FA 1E17A 3SQNA 5D4SA 4A0YA 3MZYA 2XKPA 4KN4X 3K9TA 3R0JA 3L09A 5IT9K 2GWRA 2RN7A 2DPDA 2GA2A 2HQRA 3QRFF 2KRFA 1GXPA 5L3GA 4KIFA 3E5QA 4MNUA 3ZPLA 5CVIA 2QZ8A 1EH8A 4I09A 5LRSA 1J0RA 2BBYA 2RV8A 5E18F 3TO9A 4HW0A 5ERIA 1K7AA 3U2RA 1B9MA 2M30A 1Z91A 4KMUX 1SMTA 2PMUA 2M45A 3MCZA 2Z33A 2L02A 3ZMSA 3DF8A 1S8NA 2DT5A 4YFKF 4NHJA 4NQWA 4MGRA 3S2WA 4KT5C 3HRUA 3FXRA 5LRRA 3P9CA 4ENNA 1O3QA 1HW5A 3RKXA 4WK8F 2NRAC 4GYIA 4LK0F 4Y15A 3KCCA 1ZG1A 1MJBA 4CDGA 1MKMA 2QWWA 3ZN1A 2QQAA 1U2WA 1R22A 2P4WA 2O0YA 4LG0A 4ESFA 4HV5A 1FX7A 3HIFA 3OV8A 4U88A 2HQNA 1I6XA 1SFXA 4PGGA 4WX9A 1YIOA 4RB3C 1XSDA 5JVTA 5ILUA 1IZ1A 5DV5A 3REOA 4R79A 1I27A 1PDNC 4GO1A 4AD9A 3COAC 2FMYA 4BHPA 3O6BB 2A5YB 3BPXA 4U7BA 2JZYA 1Z6RA 2UXNA 4HX7A 4EJWA 1Z6TA 3E97A 4AIHA 3IL2A 5FGMA 2ZCWA 3WTTC 4RGUA 1TQMA 5HS7A 4IXAA 4LG0B 4ENKA 3MFKA 3IRQA 2FNAA 4WXHA 1K6OA 3LA3A 4IVNA 3QP5A 1SD7A 5H20A 1RI7A 2RC4A 4BHCA 4EM1A 1BBYA 3CO6C 5KVRA 3I53A 4G6DA 1FSHA 3BROA 2D45A 3J7AO 4R8HA 3WODF 1PP8F 4AIKA 3KLNA 4KICA 2DO7A 1F5TA 2E1CA 4EJVA 2DW4A 4KNYA 4GGGA 2OD5A 1E2XA 3ZMDA 2VBWA 2EK5A 5CVJA 5CYVA 1KYWA 2VXZA 1XB4A 1S6LA 4BXUA 3WG9A 3RPQA 5H6RA 3EETA 4OIRF 4QLCU 4EMSA 3EQLF 2J5PA 4KFCA 2OQRA 1UCRA 3HYIA 2MC3A 3GVAA 3DV8A 1TNSA 1HBXG 2C6YA 2VOPA 1R1TA 2BV6A 3QP6A 1JE8A 1YW9A 3BWGA 2PG4A 3HOSA 3KEOA 1QPMA 3K1PA 1U78A 4L9TA 2ZJ2A 2OZ6A 3L00A 2VONA 1XSVA 3GFMA 1GHCA 2JSCA 5HDNA 3FX3A 5DD4A 2GQQA 1SD5A 4Q47A 4L9VA 2VOOA 4I02A 1W5TA 3TOBA 4WWCA 2QQ9A 2ISYA 2PN6A 1G4DA 2HGCA 3FXUA 1JXSA 4HDUA 4IRHA 5E20A 2CO5A 2FE3A 1HSTA 1MZBA 3DKWA 2F5CA 2YSRA 2QVOA 1DDNA 3F72A 1WKMA 2DAOA 2LSOA 2Y48A 2FU4A 5ED4A 1C0WA 2XIGA 3T1BA 1U5TB 3GFIA 2D1VA 1IN6A 4HF2A 2E7WA 2RKHA 3O3KA 4RAZA 5DCFA 5HS8A 3GFLA 5D5XB 1SAXA 3I54A 2VE8A 3V7RA 3LA7A 3TKYA 1L0OC 4CYDA 2FBHA 1Y0UA 2QYOA 1IN5A 1R36A 1XCVA 2LNBA 4L0ZB 3KZZA 5BMZA 2ISZA 2H94A 1P4XA 3T8RA 1DPUA 2ZXJA 2KKOA 1BI3A 3HUGA 5FO5A 3Q5FA 1JHHA 4LLLA 1KA8A 3IRRA 3FF5A 3Q9SA 5BOXA 5IT3A 2RNJA 1FSEA 4RGSA 2IA1A 1IN8A 1GXQA 2BE5F 5BPDA 3L9FA 5HLGA 2L4MA 4EGYA 5F6FA 1O7LA 2A61A 2DPUA 4KYWA 5FLXK 3RYPA 2H09A 1MJ9A 4ZZDA 4OIOF 1V4RA 3ZQ7A 2FSWA 1S7AA 3V8LA 1J5YA 1R5HA 5L3EA 3RDIA 1D3YA 4U0VA 4HAMA 3B02A 2FNPA 3U1DA 3K1MA 1HKSA 5LHHA 2DI3A 1YG2A 1YW7A 2W84A 1IF1A 2LKPA 3GO5A 3E3VA 5L3DA 3E6DA 3MWMA 1XGNA 5A2QZ 5D8KB 5E1XA 3GWZA 3GF2A 4KMFA 1DPRA 5AIQA 4UVAA 4OINF 3HSEA 4WF2A 2FXAA 4YIIA 4PDKA 1FNNA 2IA0A 2Z3YA 3ULQB 5LEKA 3BDDA 4HQEA 3GFJA 4FX4A 3F23A 2TDXA 2HTJA 2XAQA 1TBXA 5BS6A 4ASNA 1ZRFA 4CGZA 3QU6A 2FEZA 5HS9A 5J8FA 1ONVA 1PUEE 3I5UA 2IJLA 4MTDA 1W7PA 4ZYHA 1KQ0A 3KP4A 2K4BA 2M1BA 4MTEA 4MQVA 1U6GA 1FBSA 2K86A 1HSJA 1REPC 2HOEA 1WQ2A 3KLOA 1KQ9A 1SD4A 4UXNA 5F64A 3TO7A 1P92A 3ABTA 3PFIA 1TTYA 2LF8A 3J80Z 4BHBA 4ZYGA 1T98A 3G73A 1YFHA 1SFUA 1SMYF 1HXDA 2EA2A 2FRHA 1P2FA 3CUOA 1BIAA 1W7PB 1WI9A 2P8TA 1R00A 3FMRA 4D0PA 4A6DA 1FC3A 5JFRA 3IHUA 3IC7A 4O5VA 2V1XA 1YLFA 4BH9A 3F21A 1QZYA 2XASA 1MGTA 2WTEA 4JBAA 4N9IA 5TJJA 2E1NA 3KP5A 1KU7A 1IXRC 3F8FA 2EFWA 1IXCA 3B73A 5E17F 2QQBA 5D5UB 3TOAA 2ZMEA 1G3TA 2CQKA 1ZGAA 4I0BA 2KIUA 6PAXA 3FZVA 2K7LA 3BZ6A 1FP1D 1HKTA 4A2UA 3FM3A 1VTNC 3G3ZA 4LD5A 3RPUA 3ECHA 1F9NA 3M8EA 3OOPA 2O8XA 3T5XA 4MEXF 3CTAA 1YO5C 1ZLJA 4MEYF 4BQAA 4XLNF 2XROA 1RUOA 1BI2A 4IRGA 4M9XA 4A12A 3I58A 5ILSA 2HKXA 4U7DA 1IRFA 2JTVA 1H9TA 5CVUA 5HLHA 2STTA 2ZMEB 2P6SA 1MD0A 2XVCA 2RGVA 4LB5A 3QOPA 3N4MA 4I0AA 2WWYA 4B09A 2MH2A 2EJRA 2EWNA 1J75A 2W85A 1T39A 1IN7A 3JAMZ 1BM9A 3GLXA 4S04A 5AIPA 1I1GA 3CDHA 1D8KA 1T6SA 1XGSA 2CG4A 3ZMZA 1Z7UA 1QO0D 3P9IA 5J6XA 2DTRA 3BPVA 2G9WA 3V4GA 4G7HF 3LAJA 1LQ1A 3JTHA 1XSXA 2XRNA 4JQFA 3CJNA 1K78A 5F1RA 1KYZA 3MQ0A 1XGOA 4ON0A 2NNNA 4L18B 2EV0A 1ZH5A 2VT3A 3VB2A 3FHZA 2ETHA 2V6CA 5H6QA 1HKQA 2FMLA 3M7GA 3FWEA 4YIFA 3E5XA 3CUQA 3IWZA 1FYMA 2OA4A 1STZA 2EA4A 1LNWA 5LBQA 4ENMA 1RNLA 5E1WA 4PCQA 3TGNA 4N9HA 2A69F 2HEOA 1BI1A 3HRSA 2ZNZA 3ECOA 1IW7F 1QBJA 3HRMA 5DYMA 1K78B 1U8RA 1HW2A 3EYYA 4UHTA 1FPQA 3HOTA 4OIQF 1Z9CA 3ABUA 2JT1A 3RKWA 2MBFA 1YS7A 2GIVA 3TQNA 3BOQA 3GEZA 3I71A 2XAFA 4E70A 3WTSC 3CUQB 1PP7U 1EV7A 4GXOA 1B6AA 3E6MA 1R1VA 2O6GE 2QLZA 4G94A 4CXFA 1Z1DA 4MHGA 3LQQA 3J81Z 4M71A 1B1BA 1BI0A 2ZBKA 2P5LC 1R7JA 5BPIA 1BIBA 2K02A 3K0LA 1OKRA 4NB5A 4HV6A 1H0MA 1K79A 5D4RA 1FYKA 2F5DA 5D5VB 1QZZA 1RUNA 1U5TA 4L9JA 5FFXA 5IT9Z 3WTZA 3TDZC 1J9IA 4YFNF 3WTWC 4A6EA 4OIPF 5ILVA 4FX0A 2BYVE 4EJOA 3DP7A 3ERED 5FD5A 3F6VA 2L3DA 4HX8A 5AONA 2Q0OA 1LJ9A 5HVQC 3V7CA 4IHSA 3HHGA 4LFUA 1USSA 5E1ZB 3WU1B 1BC8C 3LWFA 1BC7C 2WV0A 2B0LA 5LGNA 2BGCA 4RB1A 1QGPA 1ZRCA 4OMYA 3M9AA 1GVJA 2AXLA 2PQ8A 4HQMA 1ODDA 3IKTA 3GZ6A 3KEQA 1YQAA 4QWQA 2GXBA 2PLYA 2M87A 2Y75A 4LGWA 1XN7A 4HLXA 3WTUC 2EV5A 1ZRDA 1XCBA 1G6NA 5DCMA 3IKVA 4LLGF 5FD6A 2HWVA 1WWXA 5JI6A 2IT0A 3ZMVA 4EJTA 2CWEA 4G7ZF 3VODA 2IVMA 1WRJA 3BJOA 2VBXA 2VC1A 3ELKA 1FOKA 4XRFA 2ACJA 2RVCA 2YX7A 1FWZA 3DPLC 2F5EA 1OYYA 1H9GA 3SXYA 2MH9A 1FT9A 2H27A 1BN5A 3U9GA 2OBPA 1ZAOA 2VBYA 1WSUA 1ON2A 2YR2A 2DFIA 2GA1A 4HA8A 5JHUA 5ICGA 2V9VA 1U5TC 5DCMB 5HOOA 2VBZA 3TO6A 1AWCA 2PBIA 1YYVA 1USTA 2CYYA 1O3SA 4HX4A 4RGXA 4WXCA 2NS0A 3K69A 3R61A 3DQVC 4U0WA 2NYXA 3RTRA 2XAGA 3ZMUA 5L3FA 3KETA 2ZNYA 1DUXC 1UB9A 4M72A 1B9NA 5J8CA 3I59A 2KIFA 5D5WB 2J5OA 1T38A 2H6CA 5L3CA 2VT2A 5D6FA 1CF7A 3K2ZA 2EB7A 5L3BA 3WTVC 4PZJA 3EYIA 4L5JA 1YS6A 1QQIA 1ZYRF 2BEOA 4KIGA 1TNTA 3BP8A 3HTUA 1ZLKA 2H6BA 2UZKA 1KU2A 4FHTA 1U3EM 2G7HA 4KA4A 5D8LB 1YTYA 3C7JA 2Z9OA 2NNYA 1LEAA 4M73A 3I59B 2CW0F 5K1YA 2X4HA 1CF7B 2VC0A 1S3JA 1UFMA 2ELHA 4RGRA 1LDDA 2GAUA 4RAYA 1ZG3A 1ZHFA 1F4KA 1R5GA 2W25A 4P55A 2VODA 1XD7A 2FOKA 4HZFA 4L5IA 1KU9A 1FP2A 1BOAA 2STWA 4F7ZA 1B4AA 4P9UA 1EH7A 4K2EA 2A68F 2IW5A 4XSZF 4ZZLA 3WGIA 2AS5F 2F2EA 1FBUA 1W7PD 1XMKA 3MZHA 1OMIA 3I0TA 4A0XA 2HYFA 3RIRA 2IPQX 4ETSA 3HSFA 2HTSA 2ADUA 3J81K 4G8XA 1V3FA 3LAPA 4Q5SF 5DEQA 3H3UA 4G6QA 2HYGD 2Y0MA 5FB2A 2VN2A 2KJCA 4BNCA 3SZTA 3VFZA 2K4JA 2DK8A 2CFXA 3ZN0A 1XMAA 3PQJA 1IRGA 5CVVA 2EFPA 2HZTA 3DPTA 5TRDA 2QUFA 1F1ZA 2GZWA 1EH6A 2CGPA 3L2CA 1D8JA 4A5NA 4EVIA 4YG2F 2X0LA 4PGHA 1TQIA 4A5MA 3MAJA 3E6CC 3FMQA 2DLLA 4P5OA 2A6EF 1ZREA 3Q9VA 2GXGA 5D6EA 4P96A 3H92A 4XSXF 3C18A 3M8FA 4L0YB 3AAFA 3P9KA 4I01A 3SZPA 5FLXZ 1LDKB 4TV7A 4ZYEA 1R1UA 3F22A 4EV0A 3NRVA 1P4AA 1S7OA 2VE9A 1ZGJA 3EDPA 4S05A 2P7VB 2LF7A 2Q2EA 3LSTA 4DQ2A 2MLGA 1B59A 3C3WA 2RDPA 2ESNA 2ESHA 3I64A 3IWFA 2FBIA 1LB2A 2L4AA 4M6XA 2QENA 2L54A 3N97A 1SFEA 4UV8A 4DNCA 3C1DA 4Y17A 3QAHA 4N0BA 3DFGA 3GZ5A 5E8IA 2W24A 4GYGA 1RZ4A 2PMHA 4HDVA 3VEPA 1NHAA 3L7WA 2UWMA 3JW4A 3HRTA 3RKYA 3ZP5A 2IA2A 1O7FA 4IJAA 2MLKA 5EEGA 2DQRA 3SHFA 3WGGA 3BY6A 4P9FA 5HDGA 4WCGA 1S29A 1OYWA 1I1SA 2COMA 2Q8KA 4BYYA 5DDGA 3GX4X 2PJPA 4LK1F 1R23A 2YPRA 4KIBA 3T0YA 3GYHX 3R6SA 4M6YA 2QBYA 2DQLA 1LVAA 3JSOA 1FLIA 1R58A 4Q4ZF 3LQRA 2ZKZA 1FBQA 2PI0A
chains in the Genus database with same CATH superfamily
1A5JA 1ETQA 3R0AA 3S3NA 2W82A 3GXOA 2RQPA 4A0ZA 4KN7X 2OQGA 1H88C 3FXJA 3RQ4A 5A2QK 4C2UA 3BJAA 5EZGA 2WBMA 1SD6A 2A3SA 2W7NA 3HEFA 1JGGA 3OR1C 2M9HA 1JHFA 4EJUA 4Y3OA 5EDNA 1HQCA 3NQOA 4NDLA 4UUVA 3ZQIA 4M3EA 2HKOA 3IH3A 1WJ5A 2LOOA 1J7KA 2DMPA 3EUAA 3F8CA 4CYCA 3CJQB 1D5YA 3QPHA 3BCBA 4LLNA 1BJAA 2PFBA 5ICCA 2VL8A 4J00A 1W0UA 1WJFA 3CO7C 4RBOA 3JRGA 2K9MA 2R7VA 3E6BA 4IL6C 2XF5A 2VIXA 1JGSA 2O7OA 4C3HJ 2P7CB 2IBDA 3PQKA 3P7NA 3K4KA 2WC2A 4XLHA 5J1YA 3OY9A 2E19A 2R7DA 3SFIA 2R7WA 3ONQA 2JRTA 1IV6A 4OOIA 1R9TJ 4XOPA 2IP2A 3H3ZA 2UXXA 2MGQA 5DD8A 3ZOBA 4HF0A 1G3YA 4EM0B 1W5SA 1WGXA 2V79A 1F43A 4PJ0C 2K9NA 5HODA 1T2KA 1Y39A 1BR2A 1LE8A 2QBYB 1A35A 1FYLA 3BR0A 3T8TA 1IXSB 3G1OA 4I2OA 3BG5A 2ZXHA 1POGA 2XHKA 3HHHA 3K1NA 3ZMTA 4UNOA 2CV0A 2FQ3A 3HOXJ 4EEFG 1IAWA 2A07F 3WTXC 3JRIA 2BHZA 2VKHA 3WU2C 2CSOA 3ERMA 1ITYA 2YU3A 2MYSA 4ZH4F 2DDAA 2VJ4A 2DMQA 1ZG5A 2P5KA 3OL3A 1J2XA 2E7XA 4HOBA 4CYCB 1R4MB 2K27A 3R4KA 4DBRA 3CCUI 4BDYA 3ZQLA 2OC6A 1OR7A 3MKLA 4KITB 1XDUA 2L5QA 5IP6A 2XKOA 3KFWX 5LHGA 2DK5A 4XQFA 3J80K 5HLTA 4DZPA 3HSRA 2LREA 1V5EA 1F36A 1ULYA 1AOYA 3CLOA 3K70D 5M5WJ 1OCTC 4KDPA 2EFNA 4M9SA 2LDUA 3CC4I 1B8IA 1VQ6I 2V9PA 1PJRA 2VJJA 3W6KB 3PL8A 4Q48A 2O03A 5BQTA 4FETA 2NVXJ 1LE8B 3CUQC 5TGTA 3M1EA 3BR2A 1G2HA 2WV1A 2ZFUA 3BJ6A 2EFOA 3K4JA 4ESJA 5DUKA 2FF4A 2ZFWA 4BE2A 3WGHA 1V5GA 1OPCA 5CJ9A 5K7ZA 2EV6A 1LEBA 1JKPC 3M1CA 2KIMA 1IN4A 2IRFG 2DBBA 4I7HA 4G7OF 4UB8C 5J1UA 2KIQA 2M7BA 3V7SA 4E7HA 2BY3A 3RJPA 4YIRX 2HFHA 1D5VA 2H1LA 1Z0XA 4XMYA 1X2MA 2LK2A 3F9KA 2JVHA 5FLMJ 1X1BA 4KUMA 4Y13A 3BG3A 2RQQA 4UVCA 2Z99A 2LY2A 4D5FA 4L9NA 2G7UA 3ML6A 4UV9A 1S72I 4IF4A 2KRCA 2M34A 3KP3A 1JJ6C 2JA8J 4II2A 2ZJRF 3CJTB 3AKZA 2QKMB 3V8JA 4HYEA 4UVBA 2DA3A 4XBFA 2A5WA 1W36D 3CDIA 5HNFA 1HDDC 1WH7A 1KU3A 2WB1N 2X9DA 4OMZA 3F8NA 4IO9F 3D5LA 4LB6B 1VQKI 3F6OA 3H3VK 2QM3A 4YFXF 1B8IB 3K70C 3V8KA 2E35A 4G9YA 4IHTA 2DTZA 4FASD 5IYBJ 5CVRA 1TQPA 1W5CC 3FMSA 1RR7A 2M8EA 3E1SA 1QHHD 4EQQA 5E79C 5KHDA 2ZO4A 3GUDA 3LNQA 1OCRH 1Z05A 3H5AA 4ZTJA 4ZC3A 3MD2A 3JSPA 1IUYA 2CRGA 1O3TA 3VOEA 4B4CA 1BA5A 3F0CA 3ISPA 3HM5A 1OFCX 5DTDA 1KGSA 3EUKL 2OZUA 3DEWA 3HC7A 2A05A 2XUBA 3E5UA 3QPTA 4EGZA 3S17J 1UELB 3J7YJ 3W6JB 3OSGA 3D5SC 2ZJPF 3S3OA 4RB0A 2DA6A 2O3FA 4HLYA 2O61A 2BXYA 5LEJA 3GW2A 2OAZA 3WTYC 1O3RA 3H0GJ 1Q1HA 4MQ9F 5DM7F 4J01A 1RIOH 2LYCA 4HBLA 2DU9A 2KJBA 5KK1A 3WU0A 3KE2A 2FBKA 3I4PA 5K5RA 3ESWB 2PMZN 4W1UA 1ETVA 3DXJF 3L2UA 3OMYA 4H0EA 3M3YJ 1S7EA 1OR7C 2X48A 1XMXA 1W36C 4BEHA 1AKHA 2CUFA 2ELJA 5JR3A 4ENJA 1G3WA 1ZTRA 2P6TA 5K5QA 2DDBA 1ON1A 2H8WA 1XDSA 4LJZF 3I56I 3UKGA 1KQ8A 1I5ZA 2OU2A 2QCOA 4ZYDA 1VFCA 5LLQA 5IP7J 3TDUC 4HNVA 2M0MA 1L3LA 3JAMK 3OYBA 5DUIA 5FROA 3GTMJ 4ZDLA 4CH7A 4JK1X 1VQNI 3JRBA 4PSWA 2B63J 5IOYA 1TW3A 3SJMA 3HPGA 2ZB9A 4OU0A 4XM3A 3RYRA 2DJNA 4AU7A 3JTGA 4UY8I 4PFPA 1D0ZA 2VJIA 5E3NA 1TWCJ 1FIPA 2LP0A 4XKVA 5HDKA 2D1HA 5EEHA 1QNTA 1OCZH 3LSRA 1QU3A 3JRDA 3MKWB 3EUHA 2BVMA 4PJLA 2P5VA 1X2NA 2D2WA 1Y8RB 5BNGA 4DYRA 2MD5A 1P6RA 1WJEA 2Y9ZA 2JPBA 1MDMA 3KZYA 2HS5A 3BR1A 2E5NA 1WJBA 2XAHA 5E8GA 4ZJZA 1ENHA 2W57A 1FZPB 3C2BA 3OYGA 5HLIA 1IO2A 1A6QA 1S5LC 1NTCA 1TLHB 5LHIA 3K4BA 5F0FA 1DU0A 4OWRB 2JQ7A 1EA3A 2YX4A 4BEHB 5K5OA 2L01A 1AKHB 1G3SA 3F8MA 2R7FA 4IPAA 3IH2A 1EKEA 1P4WA 4O3MA 1BJZA 4DW6A 1MBHA 3LA2A 1LFUP 3RSNA 2L9VA 4Z2YA 3ZQGA 2BOLA 3QU3A 5ICFA 4MO7A 3VYRB 1VQ7I 2EFQA 3H35A 2V1UA 2CQ7A 4RS8A 2XAJA 2WB1A 3F3XA 3PNVA 1X3UA 3OIOA 1DP7P 1W4MA 3KP2A 4GCVA 3ROUA 2M5WA 5CLSA 3DEUA 3S15J 2PEXA 4R1HA 2E2JJ 1LDJA 3RI4A 2OPTA 1R4NB 2RREA 2V1DA 1ZARA 3OSFA 1IRXA 3O2PE 3W2AA 5FFZA 4HF1A 3OS0A 1MDMB 1XPXA 4AIJA 4IRIA 1TW2A 1OYIA 2LC2A 1XGMA 4QSHA 2XGXA 3CCMI 4AVPA 2TRTA 2OTJI 1HW1A 1FY7A 4PJJA 4NUBA 1YW8A 1S9HA 1JKOC 2RAEA 1J59A 4XLPF 4DZJA 5FKNA 4M74A 2CMPA 2HR3A 2K9QA 1FOXA 2Z5UA 4LMYA 4CHUA 1UHWA 2NAZA 3K6GA 3WE2A 2HDCA 4RB2C 4I98B 1FEXA 3SDBA 2A6HF 4AWXB 4XKCA 2MA3A 3NEUA 2R3SA 4CO8A 1CGPA 3K4MA 4ESBA 1ZKGA 5M5YJ 4WXDA 2JA7J 5EG0B 4V19K 1MJAA 4B3XA 1YX5A 4E7IA 3SFZA 5KCMA 2PMZA 2DA1A 4U0YA 4C2MJ 5LGUA 2OJED 3F8BA 1MNEA 2JPCA 5CPRB 3OYKA 3HTSB 1ETKA 3WE3A 4M9ZA 4Y33A 5J4YA 4RLQA 3D0SA 3BZKA 3KP6A 5HNHA 4RDUA 5LGTA 2QSGX 2M2EA 2R7QA 1TT5B 1O57A 4B8XA 2F5FA 1MBFA 1YE9A 1ZN2A 5IP9J 2Y69H 5H2FC 4O6JA 3LFKA 3ABMH 3R60A 3MEXA 3FM5A 5ICEA 4FT8A 3U21A 3FXQA 1K4TA 3EUHC 2XV4S 1HCRA 1YHQI 1UHMA 2M8GX 4BAYA 5B5EC 4CZZA 2FA5A 3KP7A 4EM2A 1A04A 4CICA 4A3BJ 1T0FA 1E17A 3SQNA 4LG3A 3PFYA 5D4SA 4A0YA 5B3SH 3OR2C 3MZYA 3ABLH 3KYLA 2XKPA 4KN4X 3K9TA 3R0JA 5GAEJ 3CMEI 3JCUC 2EZIA 1RR8C 5GPCA 2VPLA 1LPQA 1E3OC 3L09A 1G8XA 1K61A 1MW7A 5IT9K 4A93J 3HOYJ 4L5EA 1SFOJ 1TP4A 2GWRA 3J7AY 2RN7A 3ZQFA 2DPDA 2GA2A 2HQRA 3QRFF 2KRFA 1GXPA 3FXLA 5L3GA 3BTJA 4KIFA 1MNDA 3K4CA 3E5QA 4MNUA 3Q0UA 3G1LA 2HDDA 2R7ZJ 2GOMA 2PJRA 2JUGA 1QZEA 3GTLJ 1FJLA 3ZPLA 4NC7A 4AIDA 5CVIA 2JN6A 2QZ8A 3UNGC 1EH8A 4I09A 5LRSA 1J0RA 3OS1A 2BBYA 2RV8A 5E18F 4E7SA 5JLWA 4U87A 2HQAA 1U8BA 3TO9A 4FQGA 3KPHA 4KJZA 4HW0A 3VSLA 3GTQJ 4N4NB 3K10A 5KNLA 5ERIA 1K7AA 4XONA 3U2RA 2R0QC 1B9MA 4Y52J 2VI6A 4RAFA 2M30A 4CCNA 4AUXA 1Z91A 4KMUX 2LKXA 3W2WA 2Y2ZA 4QPQA 4YRVA 4D7MA 3S2HJ 5J4VA 1SMTA 2PMUA 3KYCB 4ZYAA 2M45A 1GLNA 1YI2I 3MCZA 2Z33A 3BTCA 4BXXJ 2L02A 3BCAA 4JX4A 3ZMSA 2IS2A 3DF8A 4I6ZA 1S8NA 2DT5A 4YFKF 2KT0A 3ZXSA 2P81A 4XK4A 1RRJA 4NHJA 4NQWA 4MGRA 3DPUA 3AL0C 3S2WA 1TC3C 4KT5C 3HRUA 3FXRA 3CF5F 4IHWA 3FKIJ 5LRRA 2LRDA 3P9CA 4ENNA 1O3QA 2WAFA 1HW5A 3RKXA 3PSFA 3X2QH 4P1WA 1WJDA 4F93B 3BZCA 3VSKA 4WK8F 4BE1A 2NRAC 4GYIA 4LK0F 3K4LA 5K7HA 4Y15A 3KCCA 2EINH 2Z1DA 1ZR4A 2LFBA 1PVEA 1ZG1A 2KDZA 2XDVA 1MJBA 1UZCA 4CDGA 1MMGA 3NAUA 1MKMA 1RC9A 2QWWA 2IGMA 3ZN1A 2QQAA 2F4IA 1U2WA 4YELA 1R22A 2P4WA 4A69C 2QA4I 1VF9A 2DXIA 2O0YA 4LG0A 4ESFA 1QHGA 1JKRC 4HV5A 4ABZA 3I4MJ 3CDLA 3G4SI 1FX7A 1UHSA 3HIFA 3OV8A 2ZSIB 4U88A 2QF7A 3IUOA 2L2OA 1YOVB 3OYCA 2HQNA 3OS2A 1I6XA 1GDTA 1MMDA 3DTKA 1SFXA 4PGGA 4WX9A 1YIOA 4RB3C 3HOWJ 4XOTA 4NQWB 1XSDA 1YJ9I 1D1BA 3RQIA 5JVTA 5ILUA 1IZ1A 3Q0WA 1T56A 2X6YA 5DV5A 3REOA 4R79A 2VKDA 1I27A 1PDNC 4IOCF 4BKXA 2DOAA 4GO1A 4AD9A 3COAC 2FMYA 2HQ5A 3CQZJ 5E3LA 4BHPA 4HNTA 3O6BB 4BQOA 2A5YB 3IAS2 5M3FJ 1QVTA 3BPXA 4U7BA 2JZYA 1Z6RA 2UXNA 2F4OB 2DA4A 4HX7A 4EJWA 3HZJA 2M4KA 1Z6TA 2CH0A 2WY7Q 3E97A 4AIHA 3IL2A 3DU5A 5FGMA 2ZCWA 3WTTC 4RGUA 2G0EA 2HXIA 1TQMA 5HS7A 3H9GA 3M4OJ 4IXAA 4LG0B 4ENKA 3MFKA 1RETA 3PM1A 2FNAA 3IRQA 4WXHA 1K6OA 3G6EI 3LA3A 3A0HC 4IVNA 2XPUA 2DJIA 3QP5A 1SD7A 2VQGA 5H20A 1WZ2A 1RI7A 2XF7A 4BY7J 2RC4A 3CLQA 4BHCA 2V4JC 3NWSA 4EM1A 1BBYA 3CD6I 3CO6C 5KVRA 3HOUJ 2DA7A 3I53A 4G6DA 1FSHA 1X1PA 2EZLA 3IV5A 3CMAI 1ETYA 1M1EB 1N25A 3BROA 2D45A 2V7FA 3OIPA 2W1OA 3J7AO 1WJCA 2F5VA 4R8HA 3WODF 1PP8F 4AIKA 3KLNA 4KICA 2DO7A 1F5TA 2E1CA 4HEA2 2VKEA 3D5RC 4EJVA 1LFBA 2DW4A 4RAGA 2R7OA 4KNYA 2IGOA 2K5CA 4GGGA 5IY5H 2NVTJ 2AO9A 4UUTA 1TZLA 2OD5A 2R5ZB 1E2XA 3ZMDA 2VKVA 3OYJA 2VBWA 5J3LA 2EK5A 3BQZA 2LH9A 4AYBA 3CC2I 2DYRH 3J7ZI 4QIWN 4BUPA 3OYHA 3FIWA 5CVJA 4BGDA 5CYVA 2VQLA 1KYWA 3MKZA 1N75A 2VXZA 1XB4A 2QSHX 1S6LA 5C44J 2HVQA 4BXUA 3ZR8X 1IUFA 3WG9A 3RPQA 4E6KG 5H6RA 3EETA 3BG9A 4OIRF 5JLXA 4EMSA 3KYDB 4QLCU 1Y6IA 3EQLF 2DA2A 2EIJH 2J5PA 4KFCA 3A1YA 1EJ9A 1K4SA 2OQRA 2TCTA 3VYTB 1UCRA 3LSHA 3C2HA 2MC3A 3HYIA 4JYKA 1VQ4I 2XGEA 3GVAA 3HBLA 2DN0A 3DV8A 1TNSA 1HBXG 1ZQ3P 2C6YA 3U1KA 2EZKA 2VOPA 1R1TA 2BV6A 1TWHJ 1PUFA 3QP6A 1JE8A 1YW9A 1JUSA 3TP3A 3BWGA 2B7EA 2PG4A 3HOSA 2R5YA 3KEOA 2IEKA 1IC8A 4CUGA 1QPMA 2XB5A 2DCEA 2E1OA 1ETOA 2HYJA 3K1PA 3QQAA 3KEYA 2KRHA 1U78A 4L9TA 2ZJ2A 2OZ6A 5LFAA 1LVKA 3HPHA 3CCEI 3L00A 2VONA 1XSVA 2EIKH 3GFMA 3K2AA 3AG4H 1GHCA 1SVLA 2JSCA 5HDNA 1U0JA 1W0TA 4XR6A 3FX3A 2HI3A 2XPVA 2XSDC 9ANTA 5DD4A 3K7AJ 5FRNA 1MH3A 2GQQA 3JRCA 3BC8A 1SD5A 3PIPF 4Q47A 4L9VA 4CCMA 2VOOA 4II3A 4I02A 4JX6A 1W5TA 3TOBA 4WWCA 2AQFA 2QQ9A 4A3FJ 3HOZJ 1SFKA 2JA6J 2ISYA 1MIJA 2PN6A 1G4DA 3GTKJ 1A31A 2HGCA 3FXUA 4LIUA 1AHDP 1JXSA 4HDUA 3OOUA 2Y0SN 4IRHA 2CO5A 5E20A 2FE3A 3S1RJ 2VXDA 1HSTA 1ETXA 1U9OA 1MZBA 3DKWA 2F5CA 3G71I 1D1AA 3HL2A 2YSRA 2QVOA 1DDNA 1WVRA 3F72A 5CQEA 1PUFB 1WKMA 4IHVA 1JI8A 3HG9A 5FRMA 4PJMA 2DAOA 2LSOA 2R5YB 3PO2J 3CZ6A 1X1DA 2Y48A 2VPRA 2FU4A 5ED4A 1Y0NA 1C0WA 4XRSG 2XIGA 3T1BA 1U5TB 2HOAA 4D5CA 3GFIA 2D1VA 1HOMA 1IN6A 4HF2A 2E7WA 2CUZA 2RKHA 1IG7A 3O3KA 1ZK8A 4RAZA 2N8GA 2MD0A 3I3LA 1QVUA 5DCFA 3I55I 3CCLI 5HS8A 3GFLA 4NC6A 5D5XB 1SAXA 4ZDOA 2BY2A 2HU9A 3AG3H 3I54A 2VE8A 5IYCJ 3V7RA 2FD5A 3LA7A 3LOCA 3TKYA 1KONA 1L0OC 4CYDA 1BR4A 1OCPA 4GRIA 1BW5A 2FBHA 1Y0UA 2QYOA 2H1KA 5IYDJ 2KL4A 1IN5A 1R36A 1XCVA 2LNBA 4L0ZB 3FXKA 3KZZA 5BMZA 5TISC 2ISZA 2H94A 1T95A 1P4XA 1ACIA 3T8RA 5IOZA 2FUG2 3DTIA 1DPUA 2ZXJA 2KKOA 1I39A 2QSFX 1BI3A 3HUGA 5FO5A 3Q5FA 1HLVA 4RM2A 4BJ6C 3VYSB 5GTIC 2WY8Q 1JHHA 4LLLA 1KA8A 3FF5A 3Q9SA 3A01B 2R4GA 3IRRA 3P5JA 5BOXA 2LTPA 4S0HB 5LD2C 5IT3A 2RNJA 1FSEA 4RGSA 3L2QA 2IA1A 1IN8A 1GXQA 2BE5F 5BPDA 3L9FA 2I10A 5HLGA 3A02A 2L4MA 2WAQA 4N4OB 1FIAA 2IS6A 1R5ID 4EGYA 5F6FA 4RM3A 1O7LA 2A61A 2XF6A 2HPMA 2DPUA 4KYWA 5FLXK 2BY0A 3RYPA 4A3IJ 4H4KC 2H09A 1MJ9A 3CP8A 4ZZDA 4OIOF 1V4RA 2LVSA 1SAUA 4QTRA 3ZQ7A 2RNGA 2FSWA 5EZHA 1S7AA 3V8LA 2NS7A 1J5YA 4BL0B 3GMEA 2LG4A 5JVGF 3RKQA 1R5HA 1QPIA 5L3EA 3RDIA 2E34A 1IV8A 1D3YA 4U0VA 4HAMA 1DGWY 3GTGJ 3B02A 4IX7A 2FNPA 3U1DA 1RKTA 2BY1A 3OYNA 1TWGJ 2L0KA 3K1MA 1HKSA 2W00A 5LHHA 2DI3A 4IOAF 1YG2A 2GM4A 1RPWA 1TWFJ 3HUGB 1YW7A 2W84A 4Y7NJ 1SC7A 3GCMA 3CJRB 1IF1A 2LKPA 3GO5A 1V55H 3QPSA 3E3VA 1JUMA 2Z16A 1IDYA 4A3MJ 2CUEA 5L3DA 3E6DA 3A03A 1K83J 3H5RA 3MWMA 2F4MB 1XGNA 5C4XJ 2X1DA 1RESA 5A2QZ 3S32A 5D8KB 3HGGA 5E1XA 2LKSA 3GWZA 3GF2A 4KMFA 1DPRA 2ME0A 5AIQA 4UVAA 3B6AA 5B1AH 2X85A 2JUCA 1MBGA 4OINF 3HSEA 4WF2A 2ZXWH 3LSMA 2Y0SA 2FXAA 3S1QJ 3LSIA 2OUMA 4YIIA 1LKXA 2HPIA 4PDKA 2HDWA 1FNNA 3HB9A 3VYUB 2IA0A 5EG0A 2ZJQF 2Z3YA 3ULQB 5LEKA 1YRNA 1HC8A 3PIOF 3LSKA 2JSPA 3BDDA 4HQEA 3GFJA 4BDZA 4FX4A 4MLOA 3F23A 2TDXA 2HTJA 3O8GA 2YU9J 2JMWA 2XAQA 3PSIA 1UMQA 2X1EA 3OYAA 1TBXA 5BS6A 4ASNA 1ZRFA 2R93J 4CGZA 3A2KA 3QU6A 2FEZA 1I3AA 3VWBA 2MFZA 5HS9A 4LIVA 4CSWA 5J8FA 1ONVA 4ANJA 1PUEE 3I5UA 2IJLA 4MTDA 2LR8A 4E4HA 1FTTA 1J09A 2HZDA 3SDGA 1W7PA 2CFOA 2JK3A 5GADJ 4V2GA 4ZYHA 1KQ0A 3KP4A 2K4BA 2COBA 2M1BA 1P9QC 4MTEA 4MQVA 2VLAA 1U6GA 4IQJA 1CQTA 1FBSA 2K86A 1XC5A 4XICA 1HSJA 3B6CA 4FE7A 1REPC 3SEZA 2HOEA 1WQ2A 2HNHA 3KLOA 4F92B 1KQ9A 1DP3A 1SD4A 1SVOA 4UXNA 5F64A 3TO7A 1P92A 3ABTA 3PFIA 1WH5A 1TTYA 2LF8A 3I9V2 3J80Z 4BHBA 3OIQA 2JWTA 3A0BC 1YRNB 5F0CA 2KQRA 4ZYGA 2L9RA 2KHMA 1T98A 3G73A 3K4NA 1QA6A 1BR1A 1YFHA 1SFUA 3FBIB 1OISA 1SMYF 1HXDA 1V54H 2EA2A 3H0DA 2FRHA 4AM3A 4B3AA 2DOEA 3SEQA 1P2FA 2HVSA 3CUOA 1BIAA 4KISA 4XNFA 2XAUA 1W7PB 1WI9A 2P8TA 4KT6A 2XGCA 1VQ5I 1Y1VJ 2Q1ZB 1R00A 1MMAA 3FMRA 4A6DA 1FC3A 4D0PA 1H8AC 5JFRA 1DGRM 3IHUA 1SVMA 3IC7A 2CW8A 4O5VA 2V1XA 1YLFA 4BH9A 3F21A 1QZYA 2XASA 1MGTA 2WTEA 2X51A 3PUFA 3N05A 4JBAA 4N9IA 5TJJA 2E1NA 2NS8A 5E3MA 3KP5A 1MSFC 1KU7A 2CUJA 1IXRC 4C30A 3ZQCA 2ZSHB 5M5XJ 3VDXA 3F8FA 3RCOA 2EFWA 2M3AA 3DBHB 2IS4A 1IXCA 3CCJI 4X6AJ 2XC7A 3B73A 1GVDA 5E17F 2QQBA 5D5UB 1IJWC 3TOAA 2ZMEA 4E7JA 1FOYA 1G3TA 3ZCOA 2FOWA 2CQKA 4BJTA 4UUSA 5FKLA 1VQ9I 1R71A 1ZGAA 4IQ4A 1YJNI 4I0BA 3NARA 2KIUA 6PAXA 1TT0A 3FZVA 2VUMJ 2K7LA 3BZ6A 1FP1D 1T08B 2NVUB 1HKTA 4A2UA 4HNUA 3FM3A 1N78A 1VTNC 1E0EA 3G3ZA 4LD5A 2K9LA 4J19A 3RPUA 3DWLE 4XKWA 3ECHA 1F9NA 3M8EA 3OOPA 2O8XA 3T5XA 1SANA 2IAIA 4MEXF 3CTAA 1YO5C 1ZLJA 3QOEA 4MEYF 4JP0A 1IGNA 4XLNF 4BQAA 4B44A 4BY1J 2XROA 4YEJA 1RUOA 4PJNA 1U9NA 2K85A 4Y4RA 2OCEA 1BI2A 3DBRB 4IRGA 4M9XA 5CKTA 4UB6C 4A12A 3W3CA 1WHUA 3I58A 3LSGA 3H36A 2X6XA 4I99C 5ILSA 2JRMA 2EZHA 2HKXA 4U7DA 1IRFA 3OYIA 3MZ8A 1UG2A 2JTVA 1H9TA 5FLVA 4AYBN 2ECBA 5CVUA 1I50J 5HLHA 2STTA 2ZMEB 3TBIA 2P6SA 3ASOH 1MD0A 3UR3C 2XVCA 1H89C 2RGVA 4UUSB 5F27A 4LB5A 3QOPA 3L2VA 3N4MA 4I0AA 4B43A 2WWYA 4B09A 2MH2A 2EJRA 1XX5A 2EWNA 3IH4A 1NH3A 1J75A 2W85A 1T39A 3S14J 2JVGA 3DEEA 1IN7A 1Z67A 3FDYA 5C3EJ 1E3PA 3RZDJ 1ZR2A 3JAMZ 5DM6F 2GIZA 1UG0A 2CQXA 4F91B 1BM9A 1JKQC 3PNTA 3GLXA 2ICWG 3OYMA 4S04A 4CZCA 3GLLA 1KZHA 5C4JJ 1D0YA 5AIPA 1I1GA 2E36A 4IKFA 3LMMA 3CDHA 1D8KA 1T6SA 2JA2A 4IHYA 1XGSA 4BACA 2IGNA 2CG4A 1T0FC 3ZMZA 2DFHA 1Z7UA 1QO0D 3IAM2 3TL4X 1QRYA 5GTHC 3P9IA 2LD5A 3HXLA 3CESA 1VI0A 3FK7A 3L2RA 2NOJB 2L7KA 5J6XA 2O8KA 4G12A 2DTRA 3BPVA 4HRIA 2G9WA 3V4GA 5K7FA 1FOWA 4G7HF 1WCMJ 3LAJA 1LQ1A 5GAGJ 3JTHA 1XSXA 2XRNA 4JQFA 1A36A 1I6HJ 3CJNA 1K78A 5F1RA 1DU6A 2ZMEC 1KYZA 3PJRA 3MQ0A 1XGOA 5B66C 4ON0A 2NNNA 4L18B 2EV0A 1ZH5A 2VT3A 2LBFA 3OYDA 1X4PA 4RLFA 3VB2A 1PYVA 2R5ZA 3SZGA 1WPKA 3HJEA 3FHZA 2ETHA 3CC7I 1XTAA 2V6CA 5H6QA 1HKQA 2FMLA 2XB0X 3M7GA 2XGDA 2QEXI 3FWEA 1OLTA 1RKWA 3E5XA 4YIFA 2XPWA 1JTYA 3PNYA 3FISA 1YITI 4B1RA 3CUQA 3IWZA 2L7ZA 3LFUA 1FYMA 3HOVJ 1EF4A 2OA4A 2A6TA 1STZA 3LL7A 2Y31A 3TW6A 2W48A 2EA4A 1LNWA 5LBQA 1UJ8A 4ENMA 4XKBA 1RNLA 2JJ7A 5E1WA 4PCQA 4FE4A 3TGNA 4E7ZA 2FX0A 3BR5A 4N9HA 2A69F 5FKMA 2HEOA 4A3GJ 3CF2A 2FQ4A 3ZQHA 1BI1A 3HRSA 4F55A 2ZNZA 3S2DJ 1VQMI 3ECOA 4F52A 5EJCA 1IW7F 3BG6A 4FTHA 1QBJA 3HRMA 5DYMA 1K78B 1U8RA 1HW2A 1I3QJ 4C2TA 3EYYA 1AU7A 2DFFA 4UHTA 2H8RA 1OQYA 1FPQA 3DLAA 3HOTA 2LBFB 4OIQF 3HKZA 1Z9CA 2XRLA 3ABUA 2JT1A 3RKWA 2MBFA 3CMMA 1YS7A 1D1CA 5KAFC 2GIVA 3CCSI 3TQNA 3BOQA 2HOSA 1LUJB 2V9KA 1VNDA 1R49A 3GEZA 1IDZA 5CQGA 3I71A 4DGWB 2X1CA 4BBSJ 2XAFA 4E70A 3WTSC 3CUQB 1PP7U 2R7SA 2ZC2A 1EV7A 3FBNB 4GXOA 3S93A 1YX3A 3JRHA 2UV1A 2VB6A 1B6AA 3E6MA 1R1VA 4CCOA 2O6GE 2O5RA 4D9JA 2QLZA 3QYBA 2CW7A 4G94A 4CXFA 4GFBA 1Z1DA 4MHGA 3CP2A 3LQQA 2WAQN 3J81Z 4M71A 3NWTA 1B1BA 1BI0A 2ZBKA 4V2FA 2P5LC 1VQOI 1O4XA 1R7JA 1HF0A 1HDPA 4C3IJ 1OCOH 1Y8QB 1BIBA 5BPIA 2K02A 3QYEA 3K0LA 1OKRA 4NB5A 3DLLF 4HV6A 1H0MA 4GDFA 2ID6A 5EEAA 2EBIA 1K79A 5D4RA 1FYKA 2F5DA 5D5VB 1QZZA 5GPAA 1RUNA 1U5TA 4L9JA 5FFXA 3I4NJ 5IT9Z 1JT6A 3WTZA 3TDZC 1J9IA 2LY1A 3BR3A 4B47A 5FJ8J 4YFNF 3WTWC 4A6EA 4OIPF 5ILVA 4FX0A 4FISA 2BYVE 4EJOA 3DP7A 1VZ0A 3ERED 2E60A 1X58A 2BVLA 4C9YA 5FD5A 4OAZA 3F6VA 2L3DA 3ZQQA 4HX8A 4IEJA 4AC0A 3G2BA 5AONA 1B72A 2Q0OA 1GT0C 4XN3A 2K9SA 3BR6A 1LJ9A 2ME6A 5HVQC 3V7CA 2OTLI 4IHSA 3HHGA 4LFUA 1USSA 4A3LJ 5E1ZB 3WU1B 1BC8C 3E0JB 2Z2SB 4W97A 3TW7A 3LWFA 1BC7C 2WV0A 2OCCH 1MH4A 1Z7LA 1JJ8C 2E2HJ 3FK6A 4XL9A 3GZNB 2W4SA 2WAEA 2R7UA 3A01A 2B0LA 5LGNA 3BQYA 2BGCA 4RB1A 1NK2P 1DQUA 4I76A 1QGPA 1ZRCA 4OMYA 3M9AA 1GVJA 2AXLA 2DODA 4MFEA 2PQ8A 4BU2A 1MNMC 3KZIC 4HQMA 2XSJC 1ODDA 3IKTA 3GZ6A 3KEQA 1YQAA 4M3BA 4QWQA 4XRMA 2HVRA 5B1BH 2GXBA 5EF6A 2PLYA 2M87A 1HA8A 2Y75A 3M07A 4HG2A 4LGWA 5DS9A 1XN7A 3W6VA 4HLXA 3WTUC 2EV5A 1ZRDA 1XCBA 2EPFA 2AHQA 3OWTA 3QODA 1X3WB 1G6NA 5JHFA 5DCMA 4ZTFA 2F6CA 4DIQA 4XLAA 3IKVA 4LLGF 5FD6A 2M4GA 2CQNA 2IXSA 3JRFA 4A3KJ 2HWVA 1WWXA 5JI6A 1B72B 2IT0A 4JX5A 3ZMVA 4E7LA 4EJTA 3BG7A 2CWEA 4G7ZF 3VODA 2IVMA 1WRJA 3D1NI 3ASNH 2MSYA 1ERDA 2P0WA 2O9LA 3BJOA 1NG6A 3TEDA 2VBXA 2VC1A 3ELKA 1JT0A 1FOKA 2MABA 4XRFA 2ACJA 2RVCA 2YX7A 1FWZA 2DMTA 2OV7A 3DPLC 2F5EA 3IP4B 1OYYA 3DBLB 1H9GA 2KZGA 3AFHA 5KAIC 3SXYA 2MH9A 5F1JA 1FT9A 2H27A 1BN5A 3U9GA 1FMVA 2OBPA 1ZAOA 2VBYA 1NK3P 1WSUA 1ON2A 2YR2A 2BHYA 2DFIA 2GA1A 4HA8A 4PSXA 2E1MB 3QYFA 5JHUA 4JOMA 3H1CA 5ICGA 1Z21A 2V9VA 2EIMH 1U5TC 3ZGKA 1V5FA 5DCMB 3TMOA 5HOOA 2CJJA 3S3MA 2VBZA 4Z6YA 3TO6A 1AWCA 2EQRA 3WHCA 2PBIA 1YYVA 2R7TA 1USTA 2CYYA 1O3SA 4HX4A 2ECCA 1BW6A 4RGXA 2X6OA 4HSRA 4WXCA 3CCRI 2NS0A 3K69A 3R61A 3DQVC 3S1MJ 3H5NA 4XLFA 4U0WA 2NYXA 2HXOA 2KP6A 1WJAA 4XLEA 4X1EA 2XAGA 3RTRA 3ZMUA 5L3FA 2MG4A 3KETA 2CV2A 1X4OA 1ZELA 2ZNYA 2GOXB 1DUXC 2K3FA 2V6EA 4AVZA 1UB9A 4M72A 1B9NA 5J8CA 2Y30A 1BL0A 3I59A 2KIFA 3WG7H 5D5WB 2J5OA 4BS9A 1T38A 1BOBA 2H6CA 2DOFA 2VJ5A 5L3CA 2VT2A 5D6FA 1CF7A 3K2ZA 2AXTC 2NVQJ 2EB7A 5L3BA 3WTVC 4PZJA 2QKLB 1W1WE 2E1MC 1Q1VA 4IHXA 3EYIA 2FJ1A 1YS6A 4L5JA 1QQIA 1ZYRF 2BEOA 1T33A 3DKYA 4KIGA 4MFDA 3AG1H 3DTEA 5F0HA 4M3FA 3KIOA 4A3JJ 2L7FP 1TNTA 3BP8A 3HTUA 2WA0A 2DA5A 4BBRJ 4BQQA 2R7XA 1T8IA 3V42A 2I8DA 1ZLKA 2H6BA 3C2GA 2UZKA 1KU2A 2OF7A 5GAHJ 3QPLA 5J1RA 3ABKH 4FHTA 1U3EM 4BQNA 4DYCA 2I5UA 2MW8A 2D5VA 2G7HA 2CV1A 3DCFA 4KA4A 2LMDA 5D8LB 1YTYA 3C7JA 2GLOA 3M8JA 3G1MA 1P7JA 2Z9OA 3S1NJ 5FKOA 3RZOJ 2NNYA 1VQ8I 1LEAA 4M73A 3I59B 2CW0F 4G6TB 2IGKA 1MBKA 2KPMA 5K1YA 2X4HA 4DOZA 1CF7B 2DMUA 4F3QA 2VC0A 1S3JA 1UFMA 2ELHA 2M0CA 2VQCA 1LDDA 4RGRA 1VQPI 4XLCA 2GAUA 4M3GA 1MBEA 3O8HA 4RAYA 1ZG3A 2QGUA 1ZHFA 1F4KA 3PO3J 3JRAA 1R5GA 3S8PA 5J40A 1OJLA 2W25A 3DKXA 3MN2A 4P55A 2VODA 1XD7A 2FOKA 2VASA 4HZFA 4L5IA 4D1QA 1KU9A 1FP2A 1BOAA 2ID3A 2V1NA 3L2WA 3GTOJ 1Z3YA 2STWA 4FCYA 1GV5A 4F7ZA 1B4AA 4P9UA 1EH7A 4K2EA 2A68F 1G59A 1JUPA 3BTLA 2IW5A 2X6WA 4XSZF 4ZZLA 1YJWI 3FHNA 1MBJA 4RA2A 3WGIA 2AS5F 2F2EA 2L9NA 1FBUA 2VQHA 3AG2H 1W7PD 4C3JJ 1XMKA 3QWLA 1FMWA 3MZHA 1OMIA 3I0TA 4A0XA 2B9SA 2KFDA 2HYFA 2GXAA 1E3HA 2V26A 3RIRA 5F08A 2IPQX 4A3DJ 4ETSA 3HSFA 2BW3A 2NOGA 2HTSA 2ADUA 3J81K 3E7LA 4G8XA 1V3FA 3A4CA 4A3CJ 3LAPA 4Q5SF 5DEQA 4OAYA 3H3UA 4G6QA 5J47A 2HYGD 4A3EJ 4RMNA 3LSJA 2Y0MA 1MMNA 3VPRA 1R6RA 5FB2A 2VN2A 2UUZA 2KJCA 1K6YA 2PX9A 4BNCA 2K3PA 3SZTA 5M3MJ 3VFZA 1FTZA 2K4JA 2DK8A 2CFXA 3ZN0A 2NXNB 5FKKA 3AL0B 1XMAA 2M7AA 3PQJA 1IRGA 4XN0A 2L7MP 5CVVA 2EFPA 1X1CA 3OYLA 4XIDA 1VQLI 2HZTA 4ITVA 3DPTA 5TRDA 2QUFA 1F1ZA 2GZWA 3DU6A 4X0GA 1X19A 3CCVI 1EH6A 2Y9YA 3MVPA 2CGPA 3BTIA 3CMYA 1XG1A 3L2CA 2DFEA 3HDDA 1APLC 1D8JA 2F48A 4A5NA 4EVIA 1JTXA 2IS1A 2LLKA 4YG2F 3BT9A 4PK4A 2DYSH 2X0LA 1XS9A 3KX2A 4PGHA 1TQIA 4A5MA 3MAJA 3E6CC 3CCQI 4B48A 3FMQA 2DLLA 2BW3B 4P5OA 2YS9A 2A6EF 1ZREA 2CU7A 3FKJA 3Q9VA 2E71A 3HKZN 2GXGA 1X3ZB 5D6EA 4XORA 4DYQA 1UAAA 4P96A 2ZXIA 2YUSA 4DBQA 3H92A 4XSXF 3C18A 1Z3XA 4EATA 3M8FA 4L0YB 2DT7B 3AAFA 2CS3A 3OL4A 1LFPA 4E7KA 3HGYA 1TL8A 2R7RA 3P9KA 4I01A 3SZPA 3SYTA 3OYEA 2EILH 2GBYA 2KLOA 2E5ZA 5FLXZ 3L1PA 4CA0A 1LDKB 2KDOA 4TV7A 5F04A 4ZYEA 3FXOA 1R1UA 3F22A 1IRZA 5EGOA 2E2IJ 4EV0A 3NRVA 2DT6A 4NBQA 4NNJA 1GV2A 1P4AA 1S7OA 1MSEC 2VE9A 2LY9A 4XRSA 1ZGJA 3EDPA 4D7NA 4S05A 2P7VB 2LF7A 2Q2EA 3LSTA 4DQ2A 2MLGA 2BZTA 2ELKA 1B59A 1TWAJ 3C3WA 3OYFA 1OCCH 3RPUD 4CCJA 2PJRB 2RDPA 2ESNA 2ESHA 2MC4A 3I64A 3IWFA 2FBIA 1LB2A 1AA7A 2L4AA 4QPOA 4M6XA 2QENA 1WFXA 2L54A 3W2VA 3N97A 3CCYA 2KMUA 2EH3A 1SFEA 4UV8A 2CQQA 4DNCA 4DJAA 4IZZA 4LOCA 3GTJJ 1P7IA 3C1DA 4Y17A 1Z77A 3QAHA 4N0BA 3DFGA 1X1AA 3GZ5A 2W24A 5E8IA 4GYGA 4PUSA 1RZ4A 2PMHA 4PFOA 4HDVA 3VEPA 2R92J 1NHAA 2BXZA 3TP0A 3L7WA 4CCLA 4NC8A 2UWMA 3FXMA 4CCKA 1MMSA 2NVYJ 3JW4A 4M6VA 4BJ5C 3HRTA 4BXFA 1Y56A 3PUBA 3RKYA 3GBGA 3JREA 1SEUA 3ZP5A 2L9SA 2JA5J 2IA2A 5EGOB 5EYRA 3ZRGA 1O7FA 4IJAA 2K40A 2MLKA 5E3OA 5EEGA 4M3DA 2DQRA 3SHFA 3H9JA 3WGGA 2Q2EB 3BY6A 2WADA 4HPQA 4P9FA 2KZVA 4BE0A 2HOTA 5HDGA 4WCGA 1GUUA 3LSPA 1NG7A 3MKYB 1S29A 4MIMA 1ORKA 1OYWA 1N77A 3JR9A 3GTPJ 1I1SA 1WI3A 2COMA 2QQ8A 2Q8KA 4BYYA 5DDGA 3GX4X 2PJPA 4LK1F 1ETWA 1R23A 3H9QA 2AQEA 2DMNA 2YPRA 4KIBA 3S16J 3T0YA 3BLYA 3Q3SA 4LITA 3GYHX 3R6SA 2KISA 4M6YA 5IPAA 4HSTA 3MMYB 1D0XA 2QBYA 5GP9A 2DQLA 1LVAA 3JSOA 1FLIA 1Y1WJ 1R58A 4Q4ZF 1YIJI 3LQRA 3EPZA 4ZDPA 1A6IA 2ZKZA 1FBQA 3WHBA 1ZGWA 2PI0A 3Q0VA
chains in the Genus database with same CATH topology
3R0AA 3GXOA 2RQPA 4A0ZA 4KN7X 2OQGA 5A2QK 3BJAA 1SD6A 2A3SA 1JHFA 4EJUA 1HQCA 3NQOA 4UUVA 2HKOA 1J7KA 3F8CA 3QPHA 4LLNA 1BJAA 2PFBA 5ICCA 3CO7C 3E6BA 1JGSA 2P7CB 3PQKA 3P7NA 2WC2A 2R7DA 2JRTA 4OOIA 2IP2A 3H3ZA 2UXXA 5DD8A 4HF0A 1G3YA 4EM0B 1W5SA 2V79A 1T2KA 2QBYB 1FYLA 3T8TA 1IXSB 4I2OA 2XHKA 3HHHA 3K1NA 3ZMTA 4UNOA 2FQ3A 1IAWA 2A07F 3WTXC 2CSOA 2YU3A 4ZH4F 1ZG5A 2P5KA 1J2XA 2E7XA 4HOBA 2K27A 3R4KA 1OR7A 1XDUA 2XKOA 3KFWX 5LHGA 2DK5A 3J80K 3HSRA 1ULYA 1AOYA 3CLOA 4KDPA 2EFNA 4M9SA 2LDUA 3W6KB 4Q48A 2O03A 5BQTA 3CUQC 3M1EA 3BJ6A 2EFOA 4ESJA 5DUKA 2FF4A 2ZFWA 3WGHA 5CJ9A 1OPCA 2EV6A 1LEBA 2KIMA 1IN4A 2IRFG 2DBBA 4I7HA 4G7OF 3V7SA 3RJPA 2HFHA 1D5VA 4KUMA 4Y13A 4UVCA 2Z99A 4L9NA 2G7UA 3ML6A 4UV9A 4IF4A 3KP3A 3V8JA 4HYEA 4UVBA 4XBFA 1KU3A 4OMZA 3F8NA 3D5LA 4LB6B 3F6OA 2QM3A 4YFXF 3V8KA 4G9YA 4IHTA 5CVRA 1TQPA 3FMSA 2M8EA 4EQQA 2ZO4A 3GUDA 1Z05A 3JSPA 1IUYA 1O3TA 3VOEA 3ISPA 1KGSA 2OZUA 2XUBA 3E5UA 3QPTA 4EGZA 3W6JB 4RB0A 2O3FA 4HLYA 2O61A 5LEJA 3GW2A 2OAZA 3WTYC 1O3RA 1Q1HA 4MQ9F 1RIOH 4HBLA 2DU9A 2KJBA 5KK1A 3WU0A 3KE2A 2FBKA 3I4PA 5K5RA 3DXJF 4H0EA 5JR3A 4ENJA 1G3WA 5K5QA 2P6TA 1ON1A 1XDSA 4LJZF 1KQ8A 1I5ZA 2OU2A 4ZYDA 5LLQA 3TDUC 1L3LA 3JAMK 5DUIA 4JK1X 1TW3A 4OU0A 3JTGA 3RYRA 5HDKA 2D1HA 5EEHA 1QNTA 3EUHA 2P5VA 2D2WA 2MD5A 1P6RA 2JPBA 1MDMA 3KZYA 2HS5A 2XAHA 5E8GA 2W57A 1FZPB 5HLIA 1TLHB 5LHIA 2YX4A 5K5OA 2L01A 1G3SA 3F8MA 2R7FA 4IPAA 1P4WA 4O3MA 3LA2A 4Z2YA 5ICFA 3QU3A 2EFQA 2V1UA 4RS8A 2XAJA 3F3XA 1X3UA 1DP7P 1W4MA 3KP2A 4GCVA 3ROUA 2M5WA 5CLSA 3DEUA 2PEXA 4R1HA 1LDJA 3RI4A 2V1DA 1ZARA 3O2PE 5FFZA 4HF1A 1MDMB 4AIJA 4IRIA 1TW2A 1OYIA 1XGMA 2XGXA 4AVPA 1HW1A 1FY7A 1YW8A 1J59A 4XLPF 4M74A 2HR3A 2Z5UA 4LMYA 4CHUA 1UHWA 2NAZA 3WE2A 2HDCA 4RB2C 4I98B 2A6HF 4AWXB 2MA3A 3NEUA 2R3SA 4CO8A 1CGPA 4ESBA 4WXDA 1MJAA 3SFZA 4U0YA 5LGUA 3F8BA 2JPCA 3HTSB 3WE3A 4M9ZA 3D0SA 3KP6A 5LGTA 1O57A 4B8XA 2F5FA 1ZN2A 4O6JA 3LFKA 3R60A 3MEXA 3FM5A 5ICEA 4FT8A 3FXQA 2XV4S 1UHMA 4BAYA 4CZZA 2FA5A 3KP7A 4EM2A 1A04A 4CICA 1T0FA 1E17A 3SQNA 5D4SA 4A0YA 3MZYA 2XKPA 4KN4X 3K9TA 3R0JA 3L09A 5IT9K 2GWRA 2RN7A 2DPDA 2GA2A 2HQRA 3QRFF 2KRFA 1GXPA 5L3GA 4KIFA 3E5QA 4MNUA 3ZPLA 5CVIA 2QZ8A 1EH8A 4I09A 5LRSA 1J0RA 2BBYA 2RV8A 5E18F 3TO9A 4HW0A 5ERIA 1K7AA 3U2RA 1B9MA 2M30A 1Z91A 4KMUX 1SMTA 2PMUA 2M45A 3MCZA 2Z33A 2L02A 3ZMSA 3DF8A 1S8NA 2DT5A 4YFKF 4NHJA 4NQWA 4MGRA 3S2WA 4KT5C 3HRUA 3FXRA 5LRRA 3P9CA 4ENNA 1O3QA 1HW5A 3RKXA 4WK8F 2NRAC 4GYIA 4LK0F 4Y15A 3KCCA 1ZG1A 1MJBA 4CDGA 1MKMA 2QWWA 3ZN1A 2QQAA 1U2WA 1R22A 2P4WA 2O0YA 4LG0A 4ESFA 4HV5A 1FX7A 3HIFA 3OV8A 4U88A 2HQNA 1I6XA 1SFXA 4PGGA 4WX9A 1YIOA 4RB3C 1XSDA 5JVTA 5ILUA 1IZ1A 5DV5A 3REOA 4R79A 1I27A 1PDNC 4GO1A 4AD9A 3COAC 2FMYA 4BHPA 3O6BB 2A5YB 3BPXA 4U7BA 2JZYA 1Z6RA 2UXNA 4HX7A 4EJWA 1Z6TA 3E97A 4AIHA 3IL2A 5FGMA 2ZCWA 3WTTC 4RGUA 1TQMA 5HS7A 4IXAA 4LG0B 4ENKA 3MFKA 3IRQA 2FNAA 4WXHA 1K6OA 3LA3A 4IVNA 3QP5A 1SD7A 5H20A 1RI7A 2RC4A 4BHCA 4EM1A 1BBYA 3CO6C 5KVRA 3I53A 4G6DA 1FSHA 3BROA 2D45A 3J7AO 4R8HA 3WODF 1PP8F 4AIKA 3KLNA 4KICA 2DO7A 1F5TA 2E1CA 4EJVA 2DW4A 4KNYA 4GGGA 2OD5A 1E2XA 3ZMDA 2VBWA 2EK5A 5CVJA 5CYVA 1KYWA 2VXZA 1XB4A 1S6LA 4BXUA 3WG9A 3RPQA 5H6RA 3EETA 4OIRF 4QLCU 4EMSA 3EQLF 2J5PA 4KFCA 2OQRA 1UCRA 3HYIA 2MC3A 3GVAA 3DV8A 1TNSA 1HBXG 2C6YA 2VOPA 1R1TA 2BV6A 3QP6A 1JE8A 1YW9A 3BWGA 2PG4A 3HOSA 3KEOA 1QPMA 3K1PA 1U78A 4L9TA 2ZJ2A 2OZ6A 3L00A 2VONA 1XSVA 3GFMA 1GHCA 2JSCA 5HDNA 3FX3A 5DD4A 2GQQA 1SD5A 4Q47A 4L9VA 2VOOA 4I02A 1W5TA 3TOBA 4WWCA 2QQ9A 2ISYA 2PN6A 1G4DA 2HGCA 3FXUA 1JXSA 4HDUA 4IRHA 5E20A 2CO5A 2FE3A 1HSTA 1MZBA 3DKWA 2F5CA 2YSRA 2QVOA 1DDNA 3F72A 1WKMA 2DAOA 2LSOA 2Y48A 2FU4A 5ED4A 1C0WA 2XIGA 3T1BA 1U5TB 3GFIA 2D1VA 1IN6A 4HF2A 2E7WA 2RKHA 3O3KA 4RAZA 5DCFA 5HS8A 3GFLA 5D5XB 1SAXA 3I54A 2VE8A 3V7RA 3LA7A 3TKYA 1L0OC 4CYDA 2FBHA 1Y0UA 2QYOA 1IN5A 1R36A 1XCVA 2LNBA 4L0ZB 3KZZA 5BMZA 2ISZA 2H94A 1P4XA 3T8RA 1DPUA 2ZXJA 2KKOA 1BI3A 3HUGA 5FO5A 3Q5FA 1JHHA 4LLLA 1KA8A 3IRRA 3FF5A 3Q9SA 5BOXA 5IT3A 2RNJA 1FSEA 4RGSA 2IA1A 1IN8A 1GXQA 2BE5F 5BPDA 3L9FA 5HLGA 2L4MA 4EGYA 5F6FA 1O7LA 2A61A 2DPUA 4KYWA 5FLXK 3RYPA 2H09A 1MJ9A 4ZZDA 4OIOF 1V4RA 3ZQ7A 2FSWA 1S7AA 3V8LA 1J5YA 1R5HA 5L3EA 3RDIA 1D3YA 4U0VA 4HAMA 3B02A 2FNPA 3U1DA 3K1MA 1HKSA 5LHHA 2DI3A 1YG2A 1YW7A 2W84A 1IF1A 2LKPA 3GO5A 3E3VA 5L3DA 3E6DA 3MWMA 1XGNA 5A2QZ 5D8KB 5E1XA 3GWZA 3GF2A 4KMFA 1DPRA 5AIQA 4UVAA 4OINF 3HSEA 4WF2A 2FXAA 4YIIA 4PDKA 1FNNA 2IA0A 2Z3YA 3ULQB 5LEKA 3BDDA 4HQEA 3GFJA 4FX4A 3F23A 2TDXA 2HTJA 2XAQA 1TBXA 5BS6A 4ASNA 1ZRFA 4CGZA 3QU6A 2FEZA 5HS9A 5J8FA 1ONVA 1PUEE 3I5UA 2IJLA 4MTDA 1W7PA 4ZYHA 1KQ0A 3KP4A 2K4BA 2M1BA 4MTEA 4MQVA 1U6GA 1FBSA 2K86A 1HSJA 1REPC 2HOEA 1WQ2A 3KLOA 1KQ9A 1SD4A 4UXNA 5F64A 3TO7A 1P92A 3ABTA 3PFIA 1TTYA 2LF8A 3J80Z 4BHBA 4ZYGA 1T98A 3G73A 1YFHA 1SFUA 1SMYF 1HXDA 2EA2A 2FRHA 1P2FA 3CUOA 1BIAA 1W7PB 1WI9A 2P8TA 1R00A 3FMRA 4D0PA 4A6DA 1FC3A 5JFRA 3IHUA 3IC7A 4O5VA 2V1XA 1YLFA 4BH9A 3F21A 1QZYA 2XASA 1MGTA 2WTEA 4JBAA 4N9IA 5TJJA 2E1NA 3KP5A 1KU7A 1IXRC 3F8FA 2EFWA 1IXCA 3B73A 5E17F 2QQBA 5D5UB 3TOAA 2ZMEA 1G3TA 2CQKA 1ZGAA 4I0BA 2KIUA 6PAXA 3FZVA 2K7LA 3BZ6A 1FP1D 1HKTA 4A2UA 3FM3A 1VTNC 3G3ZA 4LD5A 3RPUA 3ECHA 1F9NA 3M8EA 3OOPA 2O8XA 3T5XA 4MEXF 3CTAA 1YO5C 1ZLJA 4MEYF 4BQAA 4XLNF 2XROA 1RUOA 1BI2A 4IRGA 4M9XA 4A12A 3I58A 5ILSA 2HKXA 4U7DA 1IRFA 2JTVA 1H9TA 5CVUA 5HLHA 2STTA 2ZMEB 2P6SA 1MD0A 2XVCA 2RGVA 4LB5A 3QOPA 3N4MA 4I0AA 2WWYA 4B09A 2MH2A 2EJRA 2EWNA 1J75A 2W85A 1T39A 1IN7A 3JAMZ 1BM9A 3GLXA 4S04A 5AIPA 1I1GA 3CDHA 1D8KA 1T6SA 1XGSA 2CG4A 3ZMZA 1Z7UA 1QO0D 3P9IA 5J6XA 2DTRA 3BPVA 2G9WA 3V4GA 4G7HF 3LAJA 1LQ1A 3JTHA 1XSXA 2XRNA 4JQFA 3CJNA 1K78A 5F1RA 1KYZA 3MQ0A 1XGOA 4ON0A 2NNNA 4L18B 2EV0A 1ZH5A 2VT3A 3VB2A 3FHZA 2ETHA 2V6CA 5H6QA 1HKQA 2FMLA 3M7GA 3FWEA 4YIFA 3E5XA 3CUQA 3IWZA 1FYMA 2OA4A 1STZA 2EA4A 1LNWA 5LBQA 4ENMA 1RNLA 5E1WA 4PCQA 3TGNA 4N9HA 2A69F 2HEOA 1BI1A 3HRSA 2ZNZA 3ECOA 1IW7F 1QBJA 3HRMA 5DYMA 1K78B 1U8RA 1HW2A 3EYYA 4UHTA 1FPQA 3HOTA 4OIQF 1Z9CA 3ABUA 2JT1A 3RKWA 2MBFA 1YS7A 2GIVA 3TQNA 3BOQA 3GEZA 3I71A 2XAFA 4E70A 3WTSC 3CUQB 1PP7U 1EV7A 4GXOA 1B6AA 3E6MA 1R1VA 2O6GE 2QLZA 4G94A 4CXFA 1Z1DA 4MHGA 3LQQA 3J81Z 4M71A 1B1BA 1BI0A 2ZBKA 2P5LC 1R7JA 5BPIA 1BIBA 2K02A 3K0LA 1OKRA 4NB5A 4HV6A 1H0MA 1K79A 5D4RA 1FYKA 2F5DA 5D5VB 1QZZA 1RUNA 1U5TA 4L9JA 5FFXA 5IT9Z 3WTZA 3TDZC 1J9IA 4YFNF 3WTWC 4A6EA 4OIPF 5ILVA 4FX0A 2BYVE 4EJOA 3DP7A 3ERED 5FD5A 3F6VA 2L3DA 4HX8A 5AONA 2Q0OA 1LJ9A 5HVQC 3V7CA 4IHSA 3HHGA 4LFUA 1USSA 5E1ZB 3WU1B 1BC8C 3LWFA 1BC7C 2WV0A 2B0LA 5LGNA 2BGCA 4RB1A 1QGPA 1ZRCA 4OMYA 3M9AA 1GVJA 2AXLA 2PQ8A 4HQMA 1ODDA 3IKTA 3GZ6A 3KEQA 1YQAA 4QWQA 2GXBA 2PLYA 2M87A 2Y75A 4LGWA 1XN7A 4HLXA 3WTUC 2EV5A 1ZRDA 1XCBA 1G6NA 5DCMA 3IKVA 4LLGF 5FD6A 2HWVA 1WWXA 5JI6A 2IT0A 3ZMVA 4EJTA 2CWEA 4G7ZF 3VODA 2IVMA 1WRJA 3BJOA 2VBXA 2VC1A 3ELKA 1FOKA 4XRFA 2ACJA 2RVCA 2YX7A 1FWZA 3DPLC 2F5EA 1OYYA 1H9GA 3SXYA 2MH9A 1FT9A 2H27A 1BN5A 3U9GA 2OBPA 1ZAOA 2VBYA 1WSUA 1ON2A 2YR2A 2DFIA 2GA1A 4HA8A 5JHUA 5ICGA 2V9VA 1U5TC 5DCMB 5HOOA 2VBZA 3TO6A 1AWCA 2PBIA 1YYVA 1USTA 2CYYA 1O3SA 4HX4A 4RGXA 4WXCA 2NS0A 3K69A 3R61A 3DQVC 4U0WA 2NYXA 3RTRA 2XAGA 3ZMUA 5L3FA 3KETA 2ZNYA 1DUXC 1UB9A 4M72A 1B9NA 5J8CA 3I59A 2KIFA 5D5WB 2J5OA 1T38A 2H6CA 5L3CA 2VT2A 5D6FA 1CF7A 3K2ZA 2EB7A 5L3BA 3WTVC 4PZJA 3EYIA 4L5JA 1YS6A 1QQIA 1ZYRF 2BEOA 4KIGA 1TNTA 3BP8A 3HTUA 1ZLKA 2H6BA 2UZKA 1KU2A 4FHTA 1U3EM 2G7HA 4KA4A 5D8LB 1YTYA 3C7JA 2Z9OA 2NNYA 1LEAA 4M73A 3I59B 2CW0F 5K1YA 2X4HA 1CF7B 2VC0A 1S3JA 1UFMA 2ELHA 4RGRA 1LDDA 2GAUA 4RAYA 1ZG3A 1ZHFA 1F4KA 1R5GA 2W25A 4P55A 2VODA 1XD7A 2FOKA 4HZFA 4L5IA 1KU9A 1FP2A 1BOAA 2STWA 4F7ZA 1B4AA 4P9UA 1EH7A 4K2EA 2A68F 2IW5A 4XSZF 4ZZLA 3WGIA 2AS5F 2F2EA 1FBUA 1W7PD 1XMKA 3MZHA 1OMIA 3I0TA 4A0XA 2HYFA 3RIRA 2IPQX 4ETSA 3HSFA 2HTSA 2ADUA 3J81K 4G8XA 1V3FA 3LAPA 4Q5SF 5DEQA 3H3UA 4G6QA 2HYGD 2Y0MA 5FB2A 2VN2A 2KJCA 4BNCA 3SZTA 3VFZA 2K4JA 2DK8A 2CFXA 3ZN0A 1XMAA 3PQJA 1IRGA 5CVVA 2EFPA 2HZTA 3DPTA 5TRDA 2QUFA 1F1ZA 2GZWA 1EH6A 2CGPA 3L2CA 1D8JA 4A5NA 4EVIA 4YG2F 2X0LA 4PGHA 1TQIA 4A5MA 3MAJA 3E6CC 3FMQA 2DLLA 4P5OA 2A6EF 1ZREA 3Q9VA 2GXGA 5D6EA 4P96A 3H92A 4XSXF 3C18A 3M8FA 4L0YB 3AAFA 3P9KA 4I01A 3SZPA 5FLXZ 1LDKB 4TV7A 4ZYEA 1R1UA 3F22A 4EV0A 3NRVA 1P4AA 1S7OA 2VE9A 1ZGJA 3EDPA 4S05A 2P7VB 2LF7A 2Q2EA 3LSTA 4DQ2A 2MLGA 1B59A 3C3WA 2RDPA 2ESNA 2ESHA 3I64A 3IWFA 2FBIA 1LB2A 2L4AA 4M6XA 2QENA 2L54A 3N97A 1SFEA 4UV8A 4DNCA 3C1DA 4Y17A 3QAHA 4N0BA 3DFGA 3GZ5A 5E8IA 2W24A 4GYGA 1RZ4A 2PMHA 4HDVA 3VEPA 1NHAA 3L7WA 2UWMA 3JW4A 3HRTA 3RKYA 3ZP5A 2IA2A 1O7FA 4IJAA 2MLKA 5EEGA 2DQRA 3SHFA 3WGGA 3BY6A 4P9FA 5HDGA 4WCGA 1S29A 1OYWA 1I1SA 2COMA 2Q8KA 4BYYA 5DDGA 3GX4X 2PJPA 4LK1F 1R23A 2YPRA 4KIBA 3T0YA 3GYHX 3R6SA 4M6YA 2QBYA 2DQLA 1LVAA 3JSOA 1FLIA 1R58A 4Q4ZF 3LQRA 2ZKZA 1FBQA 2PI0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R0A A;  3GXO A;  2RQP A;  4A0Z A;  4KN7 X;  2OQG A;  5A2Q K;  3BJA A;  1SD6 A;  2A3S A;  1JHF A;  4EJU A;  1HQC A;  3NQO A;  4UUV A;  2HKO A;  1J7K A;  3F8C A;  3QPH A;  4LLN A;  1BJA A;  2PFB A;  5ICC A;  3CO7 C;  3E6B A;  1JGS A;  2P7C B;  3PQK A;  3P7N A;  2WC2 A;  2R7D A;  2JRT A;  4OOI A;  2IP2 A;  3H3Z A;  2UXX A;  5DD8 A;  4HF0 A;  1G3Y A;  4EM0 B;  1W5S A;  2V79 A;  1T2K A;  2QBY B;  1FYL A;  3T8T A;  1IXS B;  4I2O A;  2XHK A;  3HHH A;  3K1N A;  3ZMT A;  4UNO A;  2FQ3 A;  1IAW A;  2A07 F;  3WTX C;  2CSO A;  2YU3 A;  4ZH4 F;  1ZG5 A;  2P5K A;  1J2X A;  2E7X A;  4HOB A;  2K27 A;  3R4K A;  1OR7 A;  1XDU A;  2XKO A;  3KFW X;  5LHG A;  2DK5 A;  3J80 K;  3HSR A;  1ULY A;  1AOY A;  3CLO A;  4KDP A;  2EFN A;  4M9S A;  2LDU A;  3W6K B;  4Q48 A;  2O03 A;  5BQT A;  3CUQ C;  3M1E A;  3BJ6 A;  2EFO A;  4ESJ A;  5DUK A;  2FF4 A;  2ZFW A;  3WGH A;  5CJ9 A;  1OPC A;  2EV6 A;  1LEB A;  2KIM A;  1IN4 A;  2IRF G;  2DBB A;  4I7H A;  4G7O F;  3V7S A;  3RJP A;  2HFH A;  1D5V A;  4KUM A;  4Y13 A;  4UVC A;  2Z99 A;  4L9N A;  2G7U A;  3ML6 A;  4UV9 A;  4IF4 A;  3KP3 A;  3V8J A;  4HYE A;  4UVB A;  4XBF A;  1KU3 A;  4OMZ A;  3F8N A;  3D5L A;  4LB6 B;  3F6O A;  2QM3 A;  4YFX F;  3V8K A;  4G9Y A;  4IHT A;  5CVR A;  1TQP A;  3FMS A;  2M8E A;  4EQQ A;  2ZO4 A;  3GUD A;  1Z05 A;  3JSP A;  1IUY A;  1O3T A;  3VOE A;  3ISP A;  1KGS A;  2OZU A;  2XUB A;  3E5U A;  3QPT A;  4EGZ A;  3W6J B;  4RB0 A;  2O3F A;  4HLY A;  2O61 A;  5LEJ A;  3GW2 A;  2OAZ A;  3WTY C;  1O3R A;  1Q1H A;  4MQ9 F;  1RIO H;  4HBL A;  2DU9 A;  2KJB A;  5KK1 A;  3WU0 A;  3KE2 A;  2FBK A;  3I4P A;  5K5R A;  3DXJ F;  4H0E A;  5JR3 A;  4ENJ A;  1G3W A;  5K5Q A;  2P6T A;  1ON1 A;  1XDS A;  4LJZ F;  1KQ8 A;  1I5Z A;  2OU2 A;  4ZYD A;  5LLQ A;  3TDU C;  1L3L A;  3JAM K;  5DUI A;  4JK1 X;  1TW3 A;  4OU0 A;  3JTG A;  3RYR A;  5HDK A;  2D1H A;  5EEH A;  1QNT A;  3EUH A;  2P5V A;  2D2W A;  2MD5 A;  1P6R A;  2JPB A;  1MDM A;  3KZY A;  2HS5 A;  2XAH A;  5E8G A;  2W57 A;  1FZP B;  5HLI A;  1TLH B;  5LHI A;  2YX4 A;  5K5O A;  2L01 A;  1G3S A;  3F8M A;  2R7F A;  4IPA A;  1P4W A;  4O3M A;  3LA2 A;  4Z2Y A;  5ICF A;  3QU3 A;  2EFQ A;  2V1U A;  4RS8 A;  2XAJ A;  3F3X A;  1X3U A;  1DP7 P;  1W4M A;  3KP2 A;  4GCV A;  3ROU A;  2M5W A;  5CLS A;  3DEU A;  2PEX A;  4R1H A;  1LDJ A;  3RI4 A;  2V1D A;  1ZAR A;  3O2P E;  5FFZ A;  4HF1 A;  1MDM B;  4AIJ A;  4IRI A;  1TW2 A;  1OYI A;  1XGM A;  2XGX A;  4AVP A;  1HW1 A;  1FY7 A;  1YW8 A;  1J59 A;  4XLP F;  4M74 A;  2HR3 A;  2Z5U A;  4LMY A;  4CHU A;  1UHW A;  2NAZ A;  3WE2 A;  2HDC A;  4RB2 C;  4I98 B;  2A6H F;  4AWX B;  2MA3 A;  3NEU A;  2R3S A;  4CO8 A;  1CGP A;  4ESB A;  4WXD A;  1MJA A;  3SFZ A;  4U0Y A;  5LGU A;  3F8B A;  2JPC A;  3HTS B;  3WE3 A;  4M9Z A;  3D0S A;  3KP6 A;  5LGT A;  1O57 A;  4B8X A;  2F5F A;  1ZN2 A;  4O6J A;  3LFK A;  3R60 A;  3MEX A;  3FM5 A;  5ICE A;  4FT8 A;  3FXQ A;  2XV4 S;  1UHM A;  4BAY A;  4CZZ A;  2FA5 A;  3KP7 A;  4EM2 A;  1A04 A;  4CIC A;  1T0F A;  1E17 A;  3SQN A;  5D4S A;  4A0Y A;  3MZY A;  2XKP A;  4KN4 X;  3K9T A;  3R0J A;  3L09 A;  5IT9 K;  2GWR A;  2RN7 A;  2DPD A;  2GA2 A;  2HQR A;  3QRF F;  2KRF A;  1GXP A;  5L3G A;  4KIF A;  3E5Q A;  4MNU A;  3ZPL A;  5CVI A;  2QZ8 A;  1EH8 A;  4I09 A;  5LRS A;  1J0R A;  2BBY A;  2RV8 A;  5E18 F;  3TO9 A;  4HW0 A;  5ERI A;  1K7A A;  3U2R A;  1B9M A;  2M30 A;  1Z91 A;  4KMU X;  1SMT A;  2PMU A;  2M45 A;  3MCZ A;  2Z33 A;  2L02 A;  3ZMS A;  3DF8 A;  1S8N A;  2DT5 A;  4YFK F;  4NHJ A;  4NQW A;  4MGR A;  3S2W A;  4KT5 C;  3HRU A;  3FXR A;  5LRR A;  3P9C A;  4ENN A;  1O3Q A;  1HW5 A;  3RKX A;  4WK8 F;  2NRA C;  4GYI A;  4LK0 F;  4Y15 A;  3KCC A;  1ZG1 A;  1MJB A;  4CDG A;  1MKM A;  2QWW A;  3ZN1 A;  2QQA A;  1U2W A;  1R22 A;  2P4W A;  2O0Y A;  4LG0 A;  4ESF A;  4HV5 A;  1FX7 A;  3HIF A;  3OV8 A;  4U88 A;  2HQN A;  1I6X A;  1SFX A;  4PGG A;  4WX9 A;  1YIO A;  4RB3 C;  1XSD A;  5JVT A;  5ILU A;  1IZ1 A;  5DV5 A;  3REO A;  4R79 A;  1I27 A;  1PDN C;  4GO1 A;  4AD9 A;  3COA C;  2FMY A;  4BHP A;  3O6B B;  2A5Y B;  3BPX A;  4U7B A;  2JZY A;  1Z6R A;  2UXN A;  4HX7 A;  4EJW A;  1Z6T A;  3E97 A;  4AIH A;  3IL2 A;  5FGM A;  2ZCW A;  3WTT C;  4RGU A;  1TQM A;  5HS7 A;  4IXA A;  4LG0 B;  4ENK A;  3MFK A;  3IRQ A;  2FNA A;  4WXH A;  1K6O A;  3LA3 A;  4IVN A;  3QP5 A;  1SD7 A;  5H20 A;  1RI7 A;  2RC4 A;  4BHC A;  4EM1 A;  1BBY A;  3CO6 C;  5KVR A;  3I53 A;  4G6D A;  1FSH A;  3BRO A;  2D45 A;  3J7A O;  4R8H A;  3WOD F;  1PP8 F;  4AIK A;  3KLN A;  4KIC A;  2DO7 A;  1F5T A;  2E1C A;  4EJV A;  2DW4 A;  4KNY A;  4GGG A;  2OD5 A;  1E2X A;  3ZMD A;  2VBW A;  2EK5 A;  5CVJ A;  5CYV A;  1KYW A;  2VXZ A;  1XB4 A;  1S6L A;  4BXU A;  3WG9 A;  3RPQ A;  5H6R A;  3EET A;  4OIR F;  4QLC U;  4EMS A;  3EQL F;  2J5P A;  4KFC A;  2OQR A;  1UCR A;  3HYI A;  2MC3 A;  3GVA A;  3DV8 A;  1TNS A;  1HBX G;  2C6Y A;  2VOP A;  1R1T A;  2BV6 A;  3QP6 A;  1JE8 A;  1YW9 A;  3BWG A;  2PG4 A;  3HOS A;  3KEO A;  1QPM A;  3K1P A;  1U78 A;  4L9T A;  2ZJ2 A;  2OZ6 A;  3L00 A;  2VON A;  1XSV A;  3GFM A;  1GHC A;  2JSC A;  5HDN A;  3FX3 A;  5DD4 A;  2GQQ A;  1SD5 A;  4Q47 A;  4L9V A;  2VOO A;  4I02 A;  1W5T A;  3TOB A;  4WWC A;  2QQ9 A;  2ISY A;  2PN6 A;  1G4D A;  2HGC A;  3FXU A;  1JXS A;  4HDU A;  4IRH A;  5E20 A;  2CO5 A;  2FE3 A;  1HST A;  1MZB A;  3DKW A;  2F5C A;  2YSR A;  2QVO A;  1DDN A;  3F72 A;  1WKM A;  2DAO A;  2LSO A;  2Y48 A;  2FU4 A;  5ED4 A;  1C0W A;  2XIG A;  3T1B A;  1U5T B;  3GFI A;  2D1V A;  1IN6 A;  4HF2 A;  2E7W A;  2RKH A;  3O3K A;  4RAZ A;  5DCF A;  5HS8 A;  3GFL A;  5D5X B;  1SAX A;  3I54 A;  2VE8 A;  3V7R A;  3LA7 A;  3TKY A;  1L0O C;  4CYD A;  2FBH A;  1Y0U A;  2QYO A;  1IN5 A;  1R36 A;  1XCV A;  2LNB A;  4L0Z B;  3KZZ A;  5BMZ A;  2ISZ A;  2H94 A;  1P4X A;  3T8R A;  1DPU A;  2ZXJ A;  2KKO A;  1BI3 A;  3HUG A;  5FO5 A;  3Q5F A;  1JHH A;  4LLL A;  1KA8 A;  3IRR A;  3FF5 A;  3Q9S A;  5BOX A;  5IT3 A;  2RNJ A;  1FSE A;  4RGS A;  2IA1 A;  1IN8 A;  1GXQ A;  2BE5 F;  5BPD A;  3L9F A;  5HLG A;  2L4M A;  4EGY A;  5F6F A;  1O7L A;  2A61 A;  2DPU A;  4KYW A;  5FLX K;  3RYP A;  2H09 A;  1MJ9 A;  4ZZD A;  4OIO F;  1V4R A;  3ZQ7 A;  2FSW A;  1S7A A;  3V8L A;  1J5Y A;  1R5H A;  5L3E A;  3RDI A;  1D3Y A;  4U0V A;  4HAM A;  3B02 A;  2FNP A;  3U1D A;  3K1M A;  1HKS A;  5LHH A;  2DI3 A;  1YG2 A;  1YW7 A;  2W84 A;  1IF1 A;  2LKP A;  3GO5 A;  3E3V A;  5L3D A;  3E6D A;  3MWM A;  1XGN A;  5A2Q Z;  5D8K B;  5E1X A;  3GWZ A;  3GF2 A;  4KMF A;  1DPR A;  5AIQ A;  4UVA A;  4OIN F;  3HSE A;  4WF2 A;  2FXA A;  4YII A;  4PDK A;  1FNN A;  2IA0 A;  2Z3Y A;  3ULQ B;  5LEK A;  3BDD A;  4HQE A;  3GFJ A;  4FX4 A;  3F23 A;  2TDX A;  2HTJ A;  2XAQ A;  1TBX A;  5BS6 A;  4ASN A;  1ZRF A;  4CGZ A;  3QU6 A;  2FEZ A;  5HS9 A;  5J8F A;  1ONV A;  1PUE E;  3I5U A;  2IJL A;  4MTD A;  1W7P A;  4ZYH A;  1KQ0 A;  3KP4 A;  2K4B A;  2M1B A;  4MTE A;  4MQV A;  1U6G A;  1FBS A;  2K86 A;  1HSJ A;  1REP C;  2HOE A;  1WQ2 A;  3KLO A;  1KQ9 A;  1SD4 A;  4UXN A;  5F64 A;  3TO7 A;  1P92 A;  3ABT A;  3PFI A;  1TTY A;  2LF8 A;  3J80 Z;  4BHB A;  4ZYG A;  1T98 A;  3G73 A;  1YFH A;  1SFU A;  1SMY F;  1HXD A;  2EA2 A;  2FRH A;  1P2F A;  3CUO A;  1BIA A;  1W7P B;  1WI9 A;  2P8T A;  1R00 A;  3FMR A;  4D0P A;  4A6D A;  1FC3 A;  5JFR A;  3IHU A;  3IC7 A;  4O5V A;  2V1X A;  1YLF A;  4BH9 A;  3F21 A;  1QZY A;  2XAS A;  1MGT A;  2WTE A;  4JBA A;  4N9I A;  5TJJ A;  2E1N A;  3KP5 A;  1KU7 A;  1IXR C;  3F8F A;  2EFW A;  1IXC A;  3B73 A;  5E17 F;  2QQB A;  5D5U B;  3TOA A;  2ZME A;  1G3T A;  2CQK A;  1ZGA A;  4I0B A;  2KIU A;  6PAX A;  3FZV A;  2K7L A;  3BZ6 A;  1FP1 D;  1HKT A;  4A2U A;  3FM3 A;  1VTN C;  3G3Z A;  4LD5 A;  3RPU A;  3ECH A;  1F9N A;  3M8E A;  3OOP A;  2O8X A;  3T5X A;  4MEX F;  3CTA A;  1YO5 C;  1ZLJ A;  4MEY F;  4BQA A;  4XLN F;  2XRO A;  1RUO A;  1BI2 A;  4IRG A;  4M9X A;  4A12 A;  3I58 A;  5ILS A;  2HKX A;  4U7D A;  1IRF A;  2JTV A;  1H9T A;  5CVU A;  5HLH A;  2STT A;  2ZME B;  2P6S A;  1MD0 A;  2XVC A;  2RGV A;  4LB5 A;  3QOP A;  3N4M A;  4I0A A;  2WWY A;  4B09 A;  2MH2 A;  2EJR A;  2EWN A;  1J75 A;  2W85 A;  1T39 A;  1IN7 A;  3JAM Z;  1BM9 A;  3GLX A;  4S04 A;  5AIP A;  1I1G A;  3CDH A;  1D8K A;  1T6S A;  1XGS A;  2CG4 A;  3ZMZ A;  1Z7U A;  1QO0 D;  3P9I A;  5J6X A;  2DTR A;  3BPV A;  2G9W A;  3V4G A;  4G7H F;  3LAJ A;  1LQ1 A;  3JTH A;  1XSX A;  2XRN A;  4JQF A;  3CJN A;  1K78 A;  5F1R A;  1KYZ A;  3MQ0 A;  1XGO A;  4ON0 A;  2NNN A;  4L18 B;  2EV0 A;  1ZH5 A;  2VT3 A;  3VB2 A;  3FHZ A;  2ETH A;  2V6C A;  5H6Q A;  1HKQ A;  2FML A;  3M7G A;  3FWE A;  4YIF A;  3E5X A;  3CUQ A;  3IWZ A;  1FYM A;  2OA4 A;  1STZ A;  2EA4 A;  1LNW A;  5LBQ A;  4ENM A;  1RNL A;  5E1W A;  4PCQ A;  3TGN A;  4N9H A;  2A69 F;  2HEO A;  1BI1 A;  3HRS A;  2ZNZ A;  3ECO A;  1IW7 F;  1QBJ A;  3HRM A;  5DYM A;  1K78 B;  1U8R A;  1HW2 A;  3EYY A;  4UHT A;  1FPQ A;  3HOT A;  4OIQ F;  1Z9C A;  3ABU A;  2JT1 A;  3RKW A;  2MBF A;  1YS7 A;  2GIV A;  3TQN A;  3BOQ A;  3GEZ A;  3I71 A;  2XAF A;  4E70 A;  3WTS C;  3CUQ B;  1PP7 U;  1EV7 A;  4GXO A;  1B6A A;  3E6M A;  1R1V A;  2O6G E;  2QLZ A;  4G94 A;  4CXF A;  1Z1D A;  4MHG A;  3LQQ A;  3J81 Z;  4M71 A;  1B1B A;  1BI0 A;  2ZBK A;  2P5L C;  1R7J A;  5BPI A;  1BIB A;  2K02 A;  3K0L A;  1OKR A;  4NB5 A;  4HV6 A;  1H0M A;  1K79 A;  5D4R A;  1FYK A;  2F5D A;  5D5V B;  1QZZ A;  1RUN A;  1U5T A;  4L9J A;  5FFX A;  5IT9 Z;  3WTZ A;  3TDZ C;  1J9I A;  4YFN F;  3WTW C;  4A6E A;  4OIP F;  5ILV A;  4FX0 A;  2BYV E;  4EJO A;  3DP7 A;  3ERE D;  5FD5 A;  3F6V A;  2L3D A;  4HX8 A;  5AON A;  2Q0O A;  1LJ9 A;  5HVQ C;  3V7C A;  4IHS A;  3HHG A;  4LFU A;  1USS A;  5E1Z B;  3WU1 B;  1BC8 C;  3LWF A;  1BC7 C;  2WV0 A;  2B0L A;  5LGN A;  2BGC A;  4RB1 A;  1QGP A;  1ZRC A;  4OMY A;  3M9A A;  1GVJ A;  2AXL A;  2PQ8 A;  4HQM A;  1ODD A;  3IKT A;  3GZ6 A;  3KEQ A;  1YQA A;  4QWQ A;  2GXB A;  2PLY A;  2M87 A;  2Y75 A;  4LGW A;  1XN7 A;  4HLX A;  3WTU C;  2EV5 A;  1ZRD A;  1XCB A;  1G6N A;  5DCM A;  3IKV A;  4LLG F;  5FD6 A;  2HWV A;  1WWX A;  5JI6 A;  2IT0 A;  3ZMV A;  4EJT A;  2CWE A;  4G7Z F;  3VOD A;  2IVM A;  1WRJ A;  3BJO A;  2VBX A;  2VC1 A;  3ELK A;  1FOK A;  4XRF A;  2ACJ A;  2RVC A;  2YX7 A;  1FWZ A;  3DPL C;  2F5E A;  1OYY A;  1H9G A;  3SXY A;  2MH9 A;  1FT9 A;  2H27 A;  1BN5 A;  3U9G A;  2OBP A;  1ZAO A;  2VBY A;  1WSU A;  1ON2 A;  2YR2 A;  2DFI A;  2GA1 A;  4HA8 A;  5JHU A;  5ICG A;  2V9V A;  1U5T C;  5DCM B;  5HOO A;  2VBZ A;  3TO6 A;  1AWC A;  2PBI A;  1YYV A;  1UST A;  2CYY A;  1O3S A;  4HX4 A;  4RGX A;  4WXC A;  2NS0 A;  3K69 A;  3R61 A;  3DQV C;  4U0W A;  2NYX A;  3RTR A;  2XAG A;  3ZMU A;  5L3F A;  3KET A;  2ZNY A;  1DUX C;  1UB9 A;  4M72 A;  1B9N A;  5J8C A;  3I59 A;  2KIF A;  5D5W B;  2J5O A;  1T38 A;  2H6C A;  5L3C A;  2VT2 A;  5D6F A;  1CF7 A;  3K2Z A;  2EB7 A;  5L3B A;  3WTV C;  4PZJ A;  3EYI A;  4L5J A;  1YS6 A;  1QQI A;  1ZYR F;  2BEO A;  4KIG A;  1TNT A;  3BP8 A;  3HTU A;  1ZLK A;  2H6B A;  2UZK A;  1KU2 A;  4FHT A;  1U3E M;  2G7H A;  4KA4 A;  5D8L B;  1YTY A;  3C7J A;  2Z9O A;  2NNY A;  1LEA A;  4M73 A;  3I59 B;  2CW0 F;  5K1Y A;  2X4H A;  1CF7 B;  2VC0 A;  1S3J A;  1UFM A;  2ELH A;  4RGR A;  1LDD A;  2GAU A;  4RAY A;  1ZG3 A;  1ZHF A;  1F4K A;  1R5G A;  2W25 A;  4P55 A;  2VOD A;  1XD7 A;  2FOK A;  4HZF A;  4L5I A;  1KU9 A;  1FP2 A;  1BOA A;  2STW A;  4F7Z A;  1B4A A;  4P9U A;  1EH7 A;  4K2E A;  2A68 F;  2IW5 A;  4XSZ F;  4ZZL A;  3WGI A;  2AS5 F;  2F2E A;  1FBU A;  1W7P D;  1XMK A;  3MZH A;  1OMI A;  3I0T A;  4A0X A;  2HYF A;  3RIR A;  2IPQ X;  4ETS A;  3HSF A;  2HTS A;  2ADU A;  3J81 K;  4G8X A;  1V3F A;  3LAP A;  4Q5S F;  5DEQ A;  3H3U A;  4G6Q A;  2HYG D;  2Y0M A;  5FB2 A;  2VN2 A;  2KJC A;  4BNC A;  3SZT A;  3VFZ A;  2K4J A;  2DK8 A;  2CFX A;  3ZN0 A;  1XMA A;  3PQJ A;  1IRG A;  5CVV A;  2EFP A;  2HZT A;  3DPT A;  5TRD A;  2QUF A;  1F1Z A;  2GZW A;  1EH6 A;  2CGP A;  3L2C A;  1D8J A;  4A5N A;  4EVI A;  4YG2 F;  2X0L A;  4PGH A;  1TQI A;  4A5M A;  3MAJ A;  3E6C C;  3FMQ A;  2DLL A;  4P5O A;  2A6E F;  1ZRE A;  3Q9V A;  2GXG A;  5D6E A;  4P96 A;  3H92 A;  4XSX F;  3C18 A;  3M8F A;  4L0Y B;  3AAF A;  3P9K A;  4I01 A;  3SZP A;  5FLX Z;  1LDK B;  4TV7 A;  4ZYE A;  1R1U A;  3F22 A;  4EV0 A;  3NRV A;  1P4A A;  1S7O A;  2VE9 A;  1ZGJ A;  3EDP A;  4S05 A;  2P7V B;  2LF7 A;  2Q2E A;  3LST A;  4DQ2 A;  2MLG A;  1B59 A;  3C3W A;  2RDP A;  2ESN A;  2ESH A;  3I64 A;  3IWF A;  2FBI A;  1LB2 A;  2L4A A;  4M6X A;  2QEN A;  2L54 A;  3N97 A;  1SFE A;  4UV8 A;  4DNC A;  3C1D A;  4Y17 A;  3QAH A;  4N0B A;  3DFG A;  3GZ5 A;  5E8I A;  2W24 A;  4GYG A;  1RZ4 A;  2PMH A;  4HDV A;  3VEP A;  1NHA A;  3L7W A;  2UWM A;  3JW4 A;  3HRT A;  3RKY A;  3ZP5 A;  2IA2 A;  1O7F A;  4IJA A;  2MLK A;  5EEG A;  2DQR A;  3SHF A;  3WGG A;  3BY6 A;  4P9F A;  5HDG A;  4WCG A;  1S29 A;  1OYW A;  1I1S A;  2COM A;  2Q8K A;  4BYY A;  5DDG A;  3GX4 X;  2PJP A;  4LK1 F;  1R23 A;  2YPR A;  4KIB A;  3T0Y A;  3GYH X;  3R6S A;  4M6Y A;  2QBY A;  2DQL A;  1LVA A;  3JSO A;  1FLI A;  1R58 A;  4Q4Z F;  3LQR A;  2ZKZ A;  1FBQ A;  2PI0 A; 
#chains in the Genus database with same CATH topology
 1A5J A;  1ETQ A;  3R0A A;  3S3N A;  2W82 A;  3GXO A;  2RQP A;  4A0Z A;  4KN7 X;  2OQG A;  1H88 C;  3FXJ A;  3RQ4 A;  5A2Q K;  4C2U A;  3BJA A;  5EZG A;  2WBM A;  1SD6 A;  2A3S A;  2W7N A;  3HEF A;  1JGG A;  3OR1 C;  2M9H A;  1JHF A;  4EJU A;  4Y3O A;  5EDN A;  1HQC A;  3NQO A;  4NDL A;  4UUV A;  3ZQI A;  4M3E A;  2HKO A;  3IH3 A;  1WJ5 A;  2LOO A;  1J7K A;  2DMP A;  3EUA A;  3F8C A;  4CYC A;  3CJQ B;  1D5Y A;  3QPH A;  3BCB A;  4LLN A;  1BJA A;  2PFB A;  5ICC A;  2VL8 A;  4J00 A;  1W0U A;  1WJF A;  3CO7 C;  4RBO A;  3JRG A;  2K9M A;  2R7V A;  3E6B A;  4IL6 C;  2XF5 A;  2VIX A;  1JGS A;  2O7O A;  4C3H J;  2P7C B;  2IBD A;  3PQK A;  3P7N A;  3K4K A;  2WC2 A;  4XLH A;  5J1Y A;  3OY9 A;  2E19 A;  2R7D A;  3SFI A;  2R7W A;  3ONQ A;  2JRT A;  1IV6 A;  4OOI A;  1R9T J;  4XOP A;  2IP2 A;  3H3Z A;  2UXX A;  2MGQ A;  5DD8 A;  3ZOB A;  4HF0 A;  1G3Y A;  4EM0 B;  1W5S A;  1WGX A;  2V79 A;  1F43 A;  4PJ0 C;  2K9N A;  5HOD A;  1T2K A;  1Y39 A;  1BR2 A;  1LE8 A;  2QBY B;  1A35 A;  1FYL A;  3BR0 A;  3T8T A;  1IXS B;  3G1O A;  4I2O A;  3BG5 A;  2ZXH A;  1POG A;  2XHK A;  3HHH A;  3K1N A;  3ZMT A;  4UNO A;  2CV0 A;  2FQ3 A;  3HOX J;  4EEF G;  1IAW A;  2A07 F;  3WTX C;  3JRI A;  2BHZ A;  2VKH A;  3WU2 C;  2CSO A;  3ERM A;  1ITY A;  2YU3 A;  2MYS A;  4ZH4 F;  2DDA A;  2VJ4 A;  2DMQ A;  1ZG5 A;  2P5K A;  3OL3 A;  1J2X A;  2E7X A;  4HOB A;  4CYC B;  1R4M B;  2K27 A;  3R4K A;  4DBR A;  3CCU I;  4BDY A;  3ZQL A;  2OC6 A;  1OR7 A;  3MKL A;  4KIT B;  1XDU A;  2L5Q A;  5IP6 A;  2XKO A;  3KFW X;  5LHG A;  2DK5 A;  4XQF A;  3J80 K;  5HLT A;  4DZP A;  3HSR A;  2LRE A;  1V5E A;  1F36 A;  1ULY A;  1AOY A;  3CLO A;  3K70 D;  5M5W J;  1OCT C;  4KDP A;  2EFN A;  4M9S A;  2LDU A;  3CC4 I;  1B8I A;  1VQ6 I;  2V9P A;  1PJR A;  2VJJ A;  3W6K B;  3PL8 A;  4Q48 A;  2O03 A;  5BQT A;  4FET A;  2NVX J;  1LE8 B;  3CUQ C;  5TGT A;  3M1E A;  3BR2 A;  1G2H A;  2WV1 A;  2ZFU A;  3BJ6 A;  2EFO A;  3K4J A;  4ESJ A;  5DUK A;  2FF4 A;  2ZFW A;  4BE2 A;  3WGH A;  1V5G A;  1OPC A;  5CJ9 A;  5K7Z A;  2EV6 A;  1LEB A;  1JKP C;  3M1C A;  2KIM A;  1IN4 A;  2IRF G;  2DBB A;  4I7H A;  4G7O F;  4UB8 C;  5J1U A;  2KIQ A;  2M7B A;  3V7S A;  4E7H A;  2BY3 A;  3RJP A;  4YIR X;  2HFH A;  1D5V A;  2H1L A;  1Z0X A;  4XMY A;  1X2M A;  2LK2 A;  3F9K A;  2JVH A;  5FLM J;  1X1B A;  4KUM A;  4Y13 A;  3BG3 A;  2RQQ A;  4UVC A;  2Z99 A;  2LY2 A;  4D5F A;  4L9N A;  2G7U A;  3ML6 A;  4UV9 A;  1S72 I;  4IF4 A;  2KRC A;  2M34 A;  3KP3 A;  1JJ6 C;  2JA8 J;  4II2 A;  2ZJR F;  3CJT B;  3AKZ A;  2QKM B;  3V8J A;  4HYE A;  4UVB A;  2DA3 A;  4XBF A;  2A5W A;  1W36 D;  3CDI A;  5HNF A;  1HDD C;  1WH7 A;  1KU3 A;  2WB1 N;  2X9D A;  4OMZ A;  3F8N A;  4IO9 F;  3D5L A;  4LB6 B;  1VQK I;  3F6O A;  3H3V K;  2QM3 A;  4YFX F;  1B8I B;  3K70 C;  3V8K A;  2E35 A;  4G9Y A;  4IHT A;  2DTZ A;  4FAS D;  5IYB J;  5CVR A;  1TQP A;  1W5C C;  3FMS A;  1RR7 A;  2M8E A;  3E1S A;  1QHH D;  4EQQ A;  5E79 C;  5KHD A;  2ZO4 A;  3GUD A;  3LNQ A;  1OCR H;  1Z05 A;  3H5A A;  4ZTJ A;  4ZC3 A;  3MD2 A;  3JSP A;  1IUY A;  2CRG A;  1O3T A;  3VOE A;  4B4C A;  1BA5 A;  3F0C A;  3ISP A;  3HM5 A;  1OFC X;  5DTD A;  1KGS A;  3EUK L;  2OZU A;  3DEW A;  3HC7 A;  2A05 A;  2XUB A;  3E5U A;  3QPT A;  4EGZ A;  3S17 J;  1UEL B;  3J7Y J;  3W6J B;  3OSG A;  3D5S C;  2ZJP F;  3S3O A;  4RB0 A;  2DA6 A;  2O3F A;  4HLY A;  2O61 A;  2BXY A;  5LEJ A;  3GW2 A;  2OAZ A;  3WTY C;  1O3R A;  3H0G J;  1Q1H A;  4MQ9 F;  5DM7 F;  4J01 A;  1RIO H;  2LYC A;  4HBL A;  2DU9 A;  2KJB A;  5KK1 A;  3WU0 A;  3KE2 A;  2FBK A;  3I4P A;  5K5R A;  3ESW B;  2PMZ N;  4W1U A;  1ETV A;  3DXJ F;  3L2U A;  3OMY A;  4H0E A;  3M3Y J;  1S7E A;  1OR7 C;  2X48 A;  1XMX A;  1W36 C;  4BEH A;  1AKH A;  2CUF A;  2ELJ A;  5JR3 A;  4ENJ A;  1G3W A;  1ZTR A;  2P6T A;  5K5Q A;  2DDB A;  1ON1 A;  2H8W A;  1XDS A;  4LJZ F;  3I56 I;  3UKG A;  1KQ8 A;  1I5Z A;  2OU2 A;  2QCO A;  4ZYD A;  1VFC A;  5LLQ A;  5IP7 J;  3TDU C;  4HNV A;  2M0M A;  1L3L A;  3JAM K;  3OYB A;  5DUI A;  5FRO A;  3GTM J;  4ZDL A;  4CH7 A;  4JK1 X;  1VQN I;  3JRB A;  4PSW A;  2B63 J;  5IOY A;  1TW3 A;  3SJM A;  3HPG A;  2ZB9 A;  4OU0 A;  4XM3 A;  3RYR A;  2DJN A;  4AU7 A;  3JTG A;  4UY8 I;  4PFP A;  1D0Z A;  2VJI A;  5E3N A;  1TWC J;  1FIP A;  2LP0 A;  4XKV A;  5HDK A;  2D1H A;  5EEH A;  1QNT A;  1OCZ H;  3LSR A;  1QU3 A;  3JRD A;  3MKW B;  3EUH A;  2BVM A;  4PJL A;  2P5V A;  1X2N A;  2D2W A;  1Y8R B;  5BNG A;  4DYR A;  2MD5 A;  1P6R A;  1WJE A;  2Y9Z A;  2JPB A;  1MDM A;  3KZY A;  2HS5 A;  3BR1 A;  2E5N A;  1WJB A;  2XAH A;  5E8G A;  4ZJZ A;  1ENH A;  2W57 A;  1FZP B;  3C2B A;  3OYG A;  5HLI A;  1IO2 A;  1A6Q A;  1S5L C;  1NTC A;  1TLH B;  5LHI A;  3K4B A;  5F0F A;  1DU0 A;  4OWR B;  2JQ7 A;  1EA3 A;  2YX4 A;  4BEH B;  5K5O A;  2L01 A;  1AKH B;  1G3S A;  3F8M A;  2R7F A;  4IPA A;  3IH2 A;  1EKE A;  1P4W A;  4O3M A;  1BJZ A;  4DW6 A;  1MBH A;  3LA2 A;  1LFU P;  3RSN A;  2L9V A;  4Z2Y A;  3ZQG A;  2BOL A;  3QU3 A;  5ICF A;  4MO7 A;  3VYR B;  1VQ7 I;  2EFQ A;  3H35 A;  2V1U A;  2CQ7 A;  4RS8 A;  2XAJ A;  2WB1 A;  3F3X A;  3PNV A;  1X3U A;  3OIO A;  1DP7 P;  1W4M A;  3KP2 A;  4GCV A;  3ROU A;  2M5W A;  5CLS A;  3DEU A;  3S15 J;  2PEX A;  4R1H A;  2E2J J;  1LDJ A;  3RI4 A;  2OPT A;  1R4N B;  2RRE A;  2V1D A;  1ZAR A;  3OSF A;  1IRX A;  3O2P E;  3W2A A;  5FFZ A;  4HF1 A;  3OS0 A;  1MDM B;  1XPX A;  4AIJ A;  4IRI A;  1TW2 A;  1OYI A;  2LC2 A;  1XGM A;  4QSH A;  2XGX A;  3CCM I;  4AVP A;  2TRT A;  2OTJ I;  1HW1 A;  1FY7 A;  4PJJ A;  4NUB A;  1YW8 A;  1S9H A;  1JKO C;  2RAE A;  1J59 A;  4XLP F;  4DZJ A;  5FKN A;  4M74 A;  2CMP A;  2HR3 A;  2K9Q A;  1FOX A;  2Z5U A;  4LMY A;  4CHU A;  1UHW A;  2NAZ A;  3K6G A;  3WE2 A;  2HDC A;  4RB2 C;  4I98 B;  1FEX A;  3SDB A;  2A6H F;  4AWX B;  4XKC A;  2MA3 A;  3NEU A;  2R3S A;  4CO8 A;  1CGP A;  3K4M A;  4ESB A;  1ZKG A;  5M5Y J;  4WXD A;  2JA7 J;  5EG0 B;  4V19 K;  1MJA A;  4B3X A;  1YX5 A;  4E7I A;  3SFZ A;  5KCM A;  2PMZ A;  2DA1 A;  4U0Y A;  4C2M J;  5LGU A;  2OJE D;  3F8B A;  1MNE A;  2JPC A;  5CPR B;  3OYK A;  3HTS B;  1ETK A;  3WE3 A;  4M9Z A;  4Y33 A;  5J4Y A;  4RLQ A;  3D0S A;  3BZK A;  3KP6 A;  5HNH A;  4RDU A;  5LGT A;  2QSG X;  2M2E A;  2R7Q A;  1TT5 B;  1O57 A;  4B8X A;  2F5F A;  1MBF A;  1YE9 A;  1ZN2 A;  5IP9 J;  2Y69 H;  5H2F C;  4O6J A;  3LFK A;  3ABM H;  3R60 A;  3MEX A;  3FM5 A;  5ICE A;  4FT8 A;  3U21 A;  3FXQ A;  1K4T A;  3EUH C;  2XV4 S;  1HCR A;  1YHQ I;  1UHM A;  2M8G X;  4BAY A;  5B5E C;  4CZZ A;  2FA5 A;  3KP7 A;  4EM2 A;  1A04 A;  4CIC A;  4A3B J;  1T0F A;  1E17 A;  3SQN A;  4LG3 A;  3PFY A;  5D4S A;  4A0Y A;  5B3S H;  3OR2 C;  3MZY A;  3ABL H;  3KYL A;  2XKP A;  4KN4 X;  3K9T A;  3R0J A;  5GAE J;  3CME I;  3JCU C;  2EZI A;  1RR8 C;  5GPC A;  2VPL A;  1LPQ A;  1E3O C;  3L09 A;  1G8X A;  1K61 A;  1MW7 A;  5IT9 K;  4A93 J;  3HOY J;  4L5E A;  1SFO J;  1TP4 A;  2GWR A;  3J7A Y;  2RN7 A;  3ZQF A;  2DPD A;  2GA2 A;  2HQR A;  3QRF F;  2KRF A;  1GXP A;  3FXL A;  5L3G A;  3BTJ A;  4KIF A;  1MND A;  3K4C A;  3E5Q A;  4MNU A;  3Q0U A;  3G1L A;  2HDD A;  2R7Z J;  2GOM A;  2PJR A;  2JUG A;  1QZE A;  3GTL J;  1FJL A;  3ZPL A;  4NC7 A;  4AID A;  5CVI A;  2JN6 A;  2QZ8 A;  3UNG C;  1EH8 A;  4I09 A;  5LRS A;  1J0R A;  3OS1 A;  2BBY A;  2RV8 A;  5E18 F;  4E7S A;  5JLW A;  4U87 A;  2HQA A;  1U8B A;  3TO9 A;  4FQG A;  3KPH A;  4KJZ A;  4HW0 A;  3VSL A;  3GTQ J;  4N4N B;  3K10 A;  5KNL A;  5ERI A;  1K7A A;  4XON A;  3U2R A;  2R0Q C;  1B9M A;  4Y52 J;  2VI6 A;  4RAF A;  2M30 A;  4CCN A;  4AUX A;  1Z91 A;  4KMU X;  2LKX A;  3W2W A;  2Y2Z A;  4QPQ A;  4YRV A;  4D7M A;  3S2H J;  5J4V A;  1SMT A;  2PMU A;  3KYC B;  4ZYA A;  2M45 A;  1GLN A;  1YI2 I;  3MCZ A;  2Z33 A;  3BTC A;  4BXX J;  2L02 A;  3BCA A;  4JX4 A;  3ZMS A;  2IS2 A;  3DF8 A;  4I6Z A;  1S8N A;  2DT5 A;  4YFK F;  2KT0 A;  3ZXS A;  2P81 A;  4XK4 A;  1RRJ A;  4NHJ A;  4NQW A;  4MGR A;  3DPU A;  3AL0 C;  3S2W A;  1TC3 C;  4KT5 C;  3HRU A;  3FXR A;  3CF5 F;  4IHW A;  3FKI J;  5LRR A;  2LRD A;  3P9C A;  4ENN A;  1O3Q A;  2WAF A;  1HW5 A;  3RKX A;  3PSF A;  3X2Q H;  4P1W A;  1WJD A;  4F93 B;  3BZC A;  3VSK A;  4WK8 F;  4BE1 A;  2NRA C;  4GYI A;  4LK0 F;  3K4L A;  5K7H A;  4Y15 A;  3KCC A;  2EIN H;  2Z1D A;  1ZR4 A;  2LFB A;  1PVE A;  1ZG1 A;  2KDZ A;  2XDV A;  1MJB A;  1UZC A;  4CDG A;  1MMG A;  3NAU A;  1MKM A;  1RC9 A;  2QWW A;  2IGM A;  3ZN1 A;  2QQA A;  2F4I A;  1U2W A;  4YEL A;  1R22 A;  2P4W A;  4A69 C;  2QA4 I;  1VF9 A;  2DXI A;  2O0Y A;  4LG0 A;  4ESF A;  1QHG A;  1JKR C;  4HV5 A;  4ABZ A;  3I4M J;  3CDL A;  3G4S I;  1FX7 A;  1UHS A;  3HIF A;  3OV8 A;  2ZSI B;  4U88 A;  2QF7 A;  3IUO A;  2L2O A;  1YOV B;  3OYC A;  2HQN A;  3OS2 A;  1I6X A;  1GDT A;  1MMD A;  3DTK A;  1SFX A;  4PGG A;  4WX9 A;  1YIO A;  4RB3 C;  3HOW J;  4XOT A;  4NQW B;  1XSD A;  1YJ9 I;  1D1B A;  3RQI A;  5JVT A;  5ILU A;  1IZ1 A;  3Q0W A;  1T56 A;  2X6Y A;  5DV5 A;  3REO A;  4R79 A;  2VKD A;  1I27 A;  1PDN C;  4IOC F;  4BKX A;  2DOA A;  4GO1 A;  4AD9 A;  3COA C;  2FMY A;  2HQ5 A;  3CQZ J;  5E3L A;  4BHP A;  4HNT A;  3O6B B;  4BQO A;  2A5Y B;  3IAS 2;  5M3F J;  1QVT A;  3BPX A;  4U7B A;  2JZY A;  1Z6R A;  2UXN A;  2F4O B;  2DA4 A;  4HX7 A;  4EJW A;  3HZJ A;  2M4K A;  1Z6T A;  2CH0 A;  2WY7 Q;  3E97 A;  4AIH A;  3IL2 A;  3DU5 A;  5FGM A;  2ZCW A;  3WTT C;  4RGU A;  2G0E A;  2HXI A;  1TQM A;  5HS7 A;  3H9G A;  3M4O J;  4IXA A;  4LG0 B;  4ENK A;  3MFK A;  1RET A;  3PM1 A;  2FNA A;  3IRQ A;  4WXH A;  1K6O A;  3G6E I;  3LA3 A;  3A0H C;  4IVN A;  2XPU A;  2DJI A;  3QP5 A;  1SD7 A;  2VQG A;  5H20 A;  1WZ2 A;  1RI7 A;  2XF7 A;  4BY7 J;  2RC4 A;  3CLQ A;  4BHC A;  2V4J C;  3NWS A;  4EM1 A;  1BBY A;  3CD6 I;  3CO6 C;  5KVR A;  3HOU J;  2DA7 A;  3I53 A;  4G6D A;  1FSH A;  1X1P A;  2EZL A;  3IV5 A;  3CMA I;  1ETY A;  1M1E B;  1N25 A;  3BRO A;  2D45 A;  2V7F A;  3OIP A;  2W1O A;  3J7A O;  1WJC A;  2F5V A;  4R8H A;  3WOD F;  1PP8 F;  4AIK A;  3KLN A;  4KIC A;  2DO7 A;  1F5T A;  2E1C A;  4HEA 2;  2VKE A;  3D5R C;  4EJV A;  1LFB A;  2DW4 A;  4RAG A;  2R7O A;  4KNY A;  2IGO A;  2K5C A;  4GGG A;  5IY5 H;  2NVT J;  2AO9 A;  4UUT A;  1TZL A;  2OD5 A;  2R5Z B;  1E2X A;  3ZMD A;  2VKV A;  3OYJ A;  2VBW A;  5J3L A;  2EK5 A;  3BQZ A;  2LH9 A;  4AYB A;  3CC2 I;  2DYR H;  3J7Z I;  4QIW N;  4BUP A;  3OYH A;  3FIW A;  5CVJ A;  4BGD A;  5CYV A;  2VQL A;  1KYW A;  3MKZ A;  1N75 A;  2VXZ A;  1XB4 A;  2QSH X;  1S6L A;  5C44 J;  2HVQ A;  4BXU A;  3ZR8 X;  1IUF A;  3WG9 A;  3RPQ A;  4E6K G;  5H6R A;  3EET A;  3BG9 A;  4OIR F;  5JLX A;  4EMS A;  3KYD B;  4QLC U;  1Y6I A;  3EQL F;  2DA2 A;  2EIJ H;  2J5P A;  4KFC A;  3A1Y A;  1EJ9 A;  1K4S A;  2OQR A;  2TCT A;  3VYT B;  1UCR A;  3LSH A;  3C2H A;  2MC3 A;  3HYI A;  4JYK A;  1VQ4 I;  2XGE A;  3GVA A;  3HBL A;  2DN0 A;  3DV8 A;  1TNS A;  1HBX G;  1ZQ3 P;  2C6Y A;  3U1K A;  2EZK A;  2VOP A;  1R1T A;  2BV6 A;  1TWH J;  1PUF A;  3QP6 A;  1JE8 A;  1YW9 A;  1JUS A;  3TP3 A;  3BWG A;  2B7E A;  2PG4 A;  3HOS A;  2R5Y A;  3KEO A;  2IEK A;  1IC8 A;  4CUG A;  1QPM A;  2XB5 A;  2DCE A;  2E1O A;  1ETO A;  2HYJ A;  3K1P A;  3QQA A;  3KEY A;  2KRH A;  1U78 A;  4L9T A;  2ZJ2 A;  2OZ6 A;  5LFA A;  1LVK A;  3HPH A;  3CCE I;  3L00 A;  2VON A;  1XSV A;  2EIK H;  3GFM A;  3K2A A;  3AG4 H;  1GHC A;  1SVL A;  2JSC A;  5HDN A;  1U0J A;  1W0T A;  4XR6 A;  3FX3 A;  2HI3 A;  2XPV A;  2XSD C;  9ANT A;  5DD4 A;  3K7A J;  5FRN A;  1MH3 A;  2GQQ A;  3JRC A;  3BC8 A;  1SD5 A;  3PIP F;  4Q47 A;  4L9V A;  4CCM A;  2VOO A;  4II3 A;  4I02 A;  4JX6 A;  1W5T A;  3TOB A;  4WWC A;  2AQF A;  2QQ9 A;  4A3F J;  3HOZ J;  1SFK A;  2JA6 J;  2ISY A;  1MIJ A;  2PN6 A;  1G4D A;  3GTK J;  1A31 A;  2HGC A;  3FXU A;  4LIU A;  1AHD P;  1JXS A;  4HDU A;  3OOU A;  2Y0S N;  4IRH A;  2CO5 A;  5E20 A;  2FE3 A;  3S1R J;  2VXD A;  1HST A;  1ETX A;  1U9O A;  1MZB A;  3DKW A;  2F5C A;  3G71 I;  1D1A A;  3HL2 A;  2YSR A;  2QVO A;  1DDN A;  1WVR A;  3F72 A;  5CQE A;  1PUF B;  1WKM A;  4IHV A;  1JI8 A;  3HG9 A;  5FRM A;  4PJM A;  2DAO A;  2LSO A;  2R5Y B;  3PO2 J;  3CZ6 A;  1X1D A;  2Y48 A;  2VPR A;  2FU4 A;  5ED4 A;  1Y0N A;  1C0W A;  4XRS G;  2XIG A;  3T1B A;  1U5T B;  2HOA A;  4D5C A;  3GFI A;  2D1V A;  1HOM A;  1IN6 A;  4HF2 A;  2E7W A;  2CUZ A;  2RKH A;  1IG7 A;  3O3K A;  1ZK8 A;  4RAZ A;  2N8G A;  2MD0 A;  3I3L A;  1QVU A;  5DCF A;  3I55 I;  3CCL I;  5HS8 A;  3GFL A;  4NC6 A;  5D5X B;  1SAX A;  4ZDO A;  2BY2 A;  2HU9 A;  3AG3 H;  3I54 A;  2VE8 A;  5IYC J;  3V7R A;  2FD5 A;  3LA7 A;  3LOC A;  3TKY A;  1KON A;  1L0O C;  4CYD A;  1BR4 A;  1OCP A;  4GRI A;  1BW5 A;  2FBH A;  1Y0U A;  2QYO A;  2H1K A;  5IYD J;  2KL4 A;  1IN5 A;  1R36 A;  1XCV A;  2LNB A;  4L0Z B;  3FXK A;  3KZZ A;  5BMZ A;  5TIS C;  2ISZ A;  2H94 A;  1T95 A;  1P4X A;  1ACI A;  3T8R A;  5IOZ A;  2FUG 2;  3DTI A;  1DPU A;  2ZXJ A;  2KKO A;  1I39 A;  2QSF X;  1BI3 A;  3HUG A;  5FO5 A;  3Q5F A;  1HLV A;  4RM2 A;  4BJ6 C;  3VYS B;  5GTI C;  2WY8 Q;  1JHH A;  4LLL A;  1KA8 A;  3FF5 A;  3Q9S A;  3A01 B;  2R4G A;  3IRR A;  3P5J A;  5BOX A;  2LTP A;  4S0H B;  5LD2 C;  5IT3 A;  2RNJ A;  1FSE A;  4RGS A;  3L2Q A;  2IA1 A;  1IN8 A;  1GXQ A;  2BE5 F;  5BPD A;  3L9F A;  2I10 A;  5HLG A;  3A02 A;  2L4M A;  2WAQ A;  4N4O B;  1FIA A;  2IS6 A;  1R5I D;  4EGY A;  5F6F A;  4RM3 A;  1O7L A;  2A61 A;  2XF6 A;  2HPM A;  2DPU A;  4KYW A;  5FLX K;  2BY0 A;  3RYP A;  4A3I J;  4H4K C;  2H09 A;  1MJ9 A;  3CP8 A;  4ZZD A;  4OIO F;  1V4R A;  2LVS A;  1SAU A;  4QTR A;  3ZQ7 A;  2RNG A;  2FSW A;  5EZH A;  1S7A A;  3V8L A;  2NS7 A;  1J5Y A;  4BL0 B;  3GME A;  2LG4 A;  5JVG F;  3RKQ A;  1R5H A;  1QPI A;  5L3E A;  3RDI A;  2E34 A;  1IV8 A;  1D3Y A;  4U0V A;  4HAM A;  1DGW Y;  3GTG J;  3B02 A;  4IX7 A;  2FNP A;  3U1D A;  1RKT A;  2BY1 A;  3OYN A;  1TWG J;  2L0K A;  3K1M A;  1HKS A;  2W00 A;  5LHH A;  2DI3 A;  4IOA F;  1YG2 A;  2GM4 A;  1RPW A;  1TWF J;  3HUG B;  1YW7 A;  2W84 A;  4Y7N J;  1SC7 A;  3GCM A;  3CJR B;  1IF1 A;  2LKP A;  3GO5 A;  1V55 H;  3QPS A;  3E3V A;  1JUM A;  2Z16 A;  1IDY A;  4A3M J;  2CUE A;  5L3D A;  3E6D A;  3A03 A;  1K83 J;  3H5R A;  3MWM A;  2F4M B;  1XGN A;  5C4X J;  2X1D A;  1RES A;  5A2Q Z;  3S32 A;  5D8K B;  3HGG A;  5E1X A;  2LKS A;  3GWZ A;  3GF2 A;  4KMF A;  1DPR A;  2ME0 A;  5AIQ A;  4UVA A;  3B6A A;  5B1A H;  2X85 A;  2JUC A;  1MBG A;  4OIN F;  3HSE A;  4WF2 A;  2ZXW H;  3LSM A;  2Y0S A;  2FXA A;  3S1Q J;  3LSI A;  2OUM A;  4YII A;  1LKX A;  2HPI A;  4PDK A;  2HDW A;  1FNN A;  3HB9 A;  3VYU B;  2IA0 A;  5EG0 A;  2ZJQ F;  2Z3Y A;  3ULQ B;  5LEK A;  1YRN A;  1HC8 A;  3PIO F;  3LSK A;  2JSP A;  3BDD A;  4HQE A;  3GFJ A;  4BDZ A;  4FX4 A;  4MLO A;  3F23 A;  2TDX A;  2HTJ A;  3O8G A;  2YU9 J;  2JMW A;  2XAQ A;  3PSI A;  1UMQ A;  2X1E A;  3OYA A;  1TBX A;  5BS6 A;  4ASN A;  1ZRF A;  2R93 J;  4CGZ A;  3A2K A;  3QU6 A;  2FEZ A;  1I3A A;  3VWB A;  2MFZ A;  5HS9 A;  4LIV A;  4CSW A;  5J8F A;  1ONV A;  4ANJ A;  1PUE E;  3I5U A;  2IJL A;  4MTD A;  2LR8 A;  4E4H A;  1FTT A;  1J09 A;  2HZD A;  3SDG A;  1W7P A;  2CFO A;  2JK3 A;  5GAD J;  4V2G A;  4ZYH A;  1KQ0 A;  3KP4 A;  2K4B A;  2COB A;  2M1B A;  1P9Q C;  4MTE A;  4MQV A;  2VLA A;  1U6G A;  4IQJ A;  1CQT A;  1FBS A;  2K86 A;  1XC5 A;  4XIC A;  1HSJ A;  3B6C A;  4FE7 A;  1REP C;  3SEZ A;  2HOE A;  1WQ2 A;  2HNH A;  3KLO A;  4F92 B;  1KQ9 A;  1DP3 A;  1SD4 A;  1SVO A;  4UXN A;  5F64 A;  3TO7 A;  1P92 A;  3ABT A;  3PFI A;  1WH5 A;  1TTY A;  2LF8 A;  3I9V 2;  3J80 Z;  4BHB A;  3OIQ A;  2JWT A;  3A0B C;  1YRN B;  5F0C A;  2KQR A;  4ZYG A;  2L9R A;  2KHM A;  1T98 A;  3G73 A;  3K4N A;  1QA6 A;  1BR1 A;  1YFH A;  1SFU A;  3FBI B;  1OIS A;  1SMY F;  1HXD A;  1V54 H;  2EA2 A;  3H0D A;  2FRH A;  4AM3 A;  4B3A A;  2DOE A;  3SEQ A;  1P2F A;  2HVS A;  3CUO A;  1BIA A;  4KIS A;  4XNF A;  2XAU A;  1W7P B;  1WI9 A;  2P8T A;  4KT6 A;  2XGC A;  1VQ5 I;  1Y1V J;  2Q1Z B;  1R00 A;  1MMA A;  3FMR A;  4A6D A;  1FC3 A;  4D0P A;  1H8A C;  5JFR A;  1DGR M;  3IHU A;  1SVM A;  3IC7 A;  2CW8 A;  4O5V A;  2V1X A;  1YLF A;  4BH9 A;  3F21 A;  1QZY A;  2XAS A;  1MGT A;  2WTE A;  2X51 A;  3PUF A;  3N05 A;  4JBA A;  4N9I A;  5TJJ A;  2E1N A;  2NS8 A;  5E3M A;  3KP5 A;  1MSF C;  1KU7 A;  2CUJ A;  1IXR C;  4C30 A;  3ZQC A;  2ZSH B;  5M5X J;  3VDX A;  3F8F A;  3RCO A;  2EFW A;  2M3A A;  3DBH B;  2IS4 A;  1IXC A;  3CCJ I;  4X6A J;  2XC7 A;  3B73 A;  1GVD A;  5E17 F;  2QQB A;  5D5U B;  1IJW C;  3TOA A;  2ZME A;  4E7J A;  1FOY A;  1G3T A;  3ZCO A;  2FOW A;  2CQK A;  4BJT A;  4UUS A;  5FKL A;  1VQ9 I;  1R71 A;  1ZGA A;  4IQ4 A;  1YJN I;  4I0B A;  3NAR A;  2KIU A;  6PAX A;  1TT0 A;  3FZV A;  2VUM J;  2K7L A;  3BZ6 A;  1FP1 D;  1T08 B;  2NVU B;  1HKT A;  4A2U A;  4HNU A;  3FM3 A;  1N78 A;  1VTN C;  1E0E A;  3G3Z A;  4LD5 A;  2K9L A;  4J19 A;  3RPU A;  3DWL E;  4XKW A;  3ECH A;  1F9N A;  3M8E A;  3OOP A;  2O8X A;  3T5X A;  1SAN A;  2IAI A;  4MEX F;  3CTA A;  1YO5 C;  1ZLJ A;  3QOE A;  4MEY F;  4JP0 A;  1IGN A;  4XLN F;  4BQA A;  4B44 A;  4BY1 J;  2XRO A;  4YEJ A;  1RUO A;  4PJN A;  1U9N A;  2K85 A;  4Y4R A;  2OCE A;  1BI2 A;  3DBR B;  4IRG A;  4M9X A;  5CKT A;  4UB6 C;  4A12 A;  3W3C A;  1WHU A;  3I58 A;  3LSG A;  3H36 A;  2X6X A;  4I99 C;  5ILS A;  2JRM A;  2EZH A;  2HKX A;  4U7D A;  1IRF A;  3OYI A;  3MZ8 A;  1UG2 A;  2JTV A;  1H9T A;  5FLV A;  4AYB N;  2ECB A;  5CVU A;  1I50 J;  5HLH A;  2STT A;  2ZME B;  3TBI A;  2P6S A;  3ASO H;  1MD0 A;  3UR3 C;  2XVC A;  1H89 C;  2RGV A;  4UUS B;  5F27 A;  4LB5 A;  3QOP A;  3L2V A;  3N4M A;  4I0A A;  4B43 A;  2WWY A;  4B09 A;  2MH2 A;  2EJR A;  1XX5 A;  2EWN A;  3IH4 A;  1NH3 A;  1J75 A;  2W85 A;  1T39 A;  3S14 J;  2JVG A;  3DEE A;  1IN7 A;  1Z67 A;  3FDY A;  5C3E J;  1E3P A;  3RZD J;  1ZR2 A;  3JAM Z;  5DM6 F;  2GIZ A;  1UG0 A;  2CQX A;  4F91 B;  1BM9 A;  1JKQ C;  3PNT A;  3GLX A;  2ICW G;  3OYM A;  4S04 A;  4CZC A;  3GLL A;  1KZH A;  5C4J J;  1D0Y A;  5AIP A;  1I1G A;  2E36 A;  4IKF A;  3LMM A;  3CDH A;  1D8K A;  1T6S A;  2JA2 A;  4IHY A;  1XGS A;  4BAC A;  2IGN A;  2CG4 A;  1T0F C;  3ZMZ A;  2DFH A;  1Z7U A;  1QO0 D;  3IAM 2;  3TL4 X;  1QRY A;  5GTH C;  3P9I A;  2LD5 A;  3HXL A;  3CES A;  1VI0 A;  3FK7 A;  3L2R A;  2NOJ B;  2L7K A;  5J6X A;  2O8K A;  4G12 A;  2DTR A;  3BPV A;  4HRI A;  2G9W A;  3V4G A;  5K7F A;  1FOW A;  4G7H F;  1WCM J;  3LAJ A;  1LQ1 A;  5GAG J;  3JTH A;  1XSX A;  2XRN A;  4JQF A;  1A36 A;  1I6H J;  3CJN A;  1K78 A;  5F1R A;  1DU6 A;  2ZME C;  1KYZ A;  3PJR A;  3MQ0 A;  1XGO A;  5B66 C;  4ON0 A;  2NNN A;  4L18 B;  2EV0 A;  1ZH5 A;  2VT3 A;  2LBF A;  3OYD A;  1X4P A;  4RLF A;  3VB2 A;  1PYV A;  2R5Z A;  3SZG A;  1WPK A;  3HJE A;  3FHZ A;  2ETH A;  3CC7 I;  1XTA A;  2V6C A;  5H6Q A;  1HKQ A;  2FML A;  2XB0 X;  3M7G A;  2XGD A;  2QEX I;  3FWE A;  1OLT A;  1RKW A;  3E5X A;  4YIF A;  2XPW A;  1JTY A;  3PNY A;  3FIS A;  1YIT I;  4B1R A;  3CUQ A;  3IWZ A;  2L7Z A;  3LFU A;  1FYM A;  3HOV J;  1EF4 A;  2OA4 A;  2A6T A;  1STZ A;  3LL7 A;  2Y31 A;  3TW6 A;  2W48 A;  2EA4 A;  1LNW A;  5LBQ A;  1UJ8 A;  4ENM A;  4XKB A;  1RNL A;  2JJ7 A;  5E1W A;  4PCQ A;  4FE4 A;  3TGN A;  4E7Z A;  2FX0 A;  3BR5 A;  4N9H A;  2A69 F;  5FKM A;  2HEO A;  4A3G J;  3CF2 A;  2FQ4 A;  3ZQH A;  1BI1 A;  3HRS A;  4F55 A;  2ZNZ A;  3S2D J;  1VQM I;  3ECO A;  4F52 A;  5EJC A;  1IW7 F;  3BG6 A;  4FTH A;  1QBJ A;  3HRM A;  5DYM A;  1K78 B;  1U8R A;  1HW2 A;  1I3Q J;  4C2T A;  3EYY A;  1AU7 A;  2DFF A;  4UHT A;  2H8R A;  1OQY A;  1FPQ A;  3DLA A;  3HOT A;  2LBF B;  4OIQ F;  3HKZ A;  1Z9C A;  2XRL A;  3ABU A;  2JT1 A;  3RKW A;  2MBF A;  3CMM A;  1YS7 A;  1D1C A;  5KAF C;  2GIV A;  3CCS I;  3TQN A;  3BOQ A;  2HOS A;  1LUJ B;  2V9K A;  1VND A;  1R49 A;  3GEZ A;  1IDZ A;  5CQG A;  3I71 A;  4DGW B;  2X1C A;  4BBS J;  2XAF A;  4E70 A;  3WTS C;  3CUQ B;  1PP7 U;  2R7S A;  2ZC2 A;  1EV7 A;  3FBN B;  4GXO A;  3S93 A;  1YX3 A;  3JRH A;  2UV1 A;  2VB6 A;  1B6A A;  3E6M A;  1R1V A;  4CCO A;  2O6G E;  2O5R A;  4D9J A;  2QLZ A;  3QYB A;  2CW7 A;  4G94 A;  4CXF A;  4GFB A;  1Z1D A;  4MHG A;  3CP2 A;  3LQQ A;  2WAQ N;  3J81 Z;  4M71 A;  3NWT A;  1B1B A;  1BI0 A;  2ZBK A;  4V2F A;  2P5L C;  1VQO I;  1O4X A;  1R7J A;  1HF0 A;  1HDP A;  4C3I J;  1OCO H;  1Y8Q B;  1BIB A;  5BPI A;  2K02 A;  3QYE A;  3K0L A;  1OKR A;  4NB5 A;  3DLL F;  4HV6 A;  1H0M A;  4GDF A;  2ID6 A;  5EEA A;  2EBI A;  1K79 A;  5D4R A;  1FYK A;  2F5D A;  5D5V B;  1QZZ A;  5GPA A;  1RUN A;  1U5T A;  4L9J A;  5FFX A;  3I4N J;  5IT9 Z;  1JT6 A;  3WTZ A;  3TDZ C;  1J9I A;  2LY1 A;  3BR3 A;  4B47 A;  5FJ8 J;  4YFN F;  3WTW C;  4A6E A;  4OIP F;  5ILV A;  4FX0 A;  4FIS A;  2BYV E;  4EJO A;  3DP7 A;  1VZ0 A;  3ERE D;  2E60 A;  1X58 A;  2BVL A;  4C9Y A;  5FD5 A;  4OAZ A;  3F6V A;  2L3D A;  3ZQQ A;  4HX8 A;  4IEJ A;  4AC0 A;  3G2B A;  5AON A;  1B72 A;  2Q0O A;  1GT0 C;  4XN3 A;  2K9S A;  3BR6 A;  1LJ9 A;  2ME6 A;  5HVQ C;  3V7C A;  2OTL I;  4IHS A;  3HHG A;  4LFU A;  1USS A;  4A3L J;  5E1Z B;  3WU1 B;  1BC8 C;  3E0J B;  2Z2S B;  4W97 A;  3TW7 A;  3LWF A;  1BC7 C;  2WV0 A;  2OCC H;  1MH4 A;  1Z7L A;  1JJ8 C;  2E2H J;  3FK6 A;  4XL9 A;  3GZN B;  2W4S A;  2WAE A;  2R7U A;  3A01 A;  2B0L A;  5LGN A;  3BQY A;  2BGC A;  4RB1 A;  1NK2 P;  1DQU A;  4I76 A;  1QGP A;  1ZRC A;  4OMY A;  3M9A A;  1GVJ A;  2AXL A;  2DOD A;  4MFE A;  2PQ8 A;  4BU2 A;  1MNM C;  3KZI C;  4HQM A;  2XSJ C;  1ODD A;  3IKT A;  3GZ6 A;  3KEQ A;  1YQA A;  4M3B A;  4QWQ A;  4XRM A;  2HVR A;  5B1B H;  2GXB A;  5EF6 A;  2PLY A;  2M87 A;  1HA8 A;  2Y75 A;  3M07 A;  4HG2 A;  4LGW A;  5DS9 A;  1XN7 A;  3W6V A;  4HLX A;  3WTU C;  2EV5 A;  1ZRD A;  1XCB A;  2EPF A;  2AHQ A;  3OWT A;  3QOD A;  1X3W B;  1G6N A;  5JHF A;  5DCM A;  4ZTF A;  2F6C A;  4DIQ A;  4XLA A;  3IKV A;  4LLG F;  5FD6 A;  2M4G A;  2CQN A;  2IXS A;  3JRF A;  4A3K J;  2HWV A;  1WWX A;  5JI6 A;  1B72 B;  2IT0 A;  4JX5 A;  3ZMV A;  4E7L A;  4EJT A;  3BG7 A;  2CWE A;  4G7Z F;  3VOD A;  2IVM A;  1WRJ A;  3D1N I;  3ASN H;  2MSY A;  1ERD A;  2P0W A;  2O9L A;  3BJO A;  1NG6 A;  3TED A;  2VBX A;  2VC1 A;  3ELK A;  1JT0 A;  1FOK A;  2MAB A;  4XRF A;  2ACJ A;  2RVC A;  2YX7 A;  1FWZ A;  2DMT A;  2OV7 A;  3DPL C;  2F5E A;  3IP4 B;  1OYY A;  3DBL B;  1H9G A;  2KZG A;  3AFH A;  5KAI C;  3SXY A;  2MH9 A;  5F1J A;  1FT9 A;  2H27 A;  1BN5 A;  3U9G A;  1FMV A;  2OBP A;  1ZAO A;  2VBY A;  1NK3 P;  1WSU A;  1ON2 A;  2YR2 A;  2BHY A;  2DFI A;  2GA1 A;  4HA8 A;  4PSX A;  2E1M B;  3QYF A;  5JHU A;  4JOM A;  3H1C A;  5ICG A;  1Z21 A;  2V9V A;  2EIM H;  1U5T C;  3ZGK A;  1V5F A;  5DCM B;  3TMO A;  5HOO A;  2CJJ A;  3S3M A;  2VBZ A;  4Z6Y A;  3TO6 A;  1AWC A;  2EQR A;  3WHC A;  2PBI A;  1YYV A;  2R7T A;  1UST A;  2CYY A;  1O3S A;  4HX4 A;  2ECC A;  1BW6 A;  4RGX A;  2X6O A;  4HSR A;  4WXC A;  3CCR I;  2NS0 A;  3K69 A;  3R61 A;  3DQV C;  3S1M J;  3H5N A;  4XLF A;  4U0W A;  2NYX A;  2HXO A;  2KP6 A;  1WJA A;  4XLE A;  4X1E A;  2XAG A;  3RTR A;  3ZMU A;  5L3F A;  2MG4 A;  3KET A;  2CV2 A;  1X4O A;  1ZEL A;  2ZNY A;  2GOX B;  1DUX C;  2K3F A;  2V6E A;  4AVZ A;  1UB9 A;  4M72 A;  1B9N A;  5J8C A;  2Y30 A;  1BL0 A;  3I59 A;  2KIF A;  3WG7 H;  5D5W B;  2J5O A;  4BS9 A;  1T38 A;  1BOB A;  2H6C A;  2DOF A;  2VJ5 A;  5L3C A;  2VT2 A;  5D6F A;  1CF7 A;  3K2Z A;  2AXT C;  2NVQ J;  2EB7 A;  5L3B A;  3WTV C;  4PZJ A;  2QKL B;  1W1W E;  2E1M C;  1Q1V A;  4IHX A;  3EYI A;  2FJ1 A;  1YS6 A;  4L5J A;  1QQI A;  1ZYR F;  2BEO A;  1T33 A;  3DKY A;  4KIG A;  4MFD A;  3AG1 H;  3DTE A;  5F0H A;  4M3F A;  3KIO A;  4A3J J;  2L7F P;  1TNT A;  3BP8 A;  3HTU A;  2WA0 A;  2DA5 A;  4BBR J;  4BQQ A;  2R7X A;  1T8I A;  3V42 A;  2I8D A;  1ZLK A;  2H6B A;  3C2G A;  2UZK A;  1KU2 A;  2OF7 A;  5GAH J;  3QPL A;  5J1R A;  3ABK H;  4FHT A;  1U3E M;  4BQN A;  4DYC A;  2I5U A;  2MW8 A;  2D5V A;  2G7H A;  2CV1 A;  3DCF A;  4KA4 A;  2LMD A;  5D8L B;  1YTY A;  3C7J A;  2GLO A;  3M8J A;  3G1M A;  1P7J A;  2Z9O A;  3S1N J;  5FKO A;  3RZO J;  2NNY A;  1VQ8 I;  1LEA A;  4M73 A;  3I59 B;  2CW0 F;  4G6T B;  2IGK A;  1MBK A;  2KPM A;  5K1Y A;  2X4H A;  4DOZ A;  1CF7 B;  2DMU A;  4F3Q A;  2VC0 A;  1S3J A;  1UFM A;  2ELH A;  2M0C A;  2VQC A;  1LDD A;  4RGR A;  1VQP I;  4XLC A;  2GAU A;  4M3G A;  1MBE A;  3O8H A;  4RAY A;  1ZG3 A;  2QGU A;  1ZHF A;  1F4K A;  3PO3 J;  3JRA A;  1R5G A;  3S8P A;  5J40 A;  1OJL A;  2W25 A;  3DKX A;  3MN2 A;  4P55 A;  2VOD A;  1XD7 A;  2FOK A;  2VAS A;  4HZF A;  4L5I A;  4D1Q A;  1KU9 A;  1FP2 A;  1BOA A;  2ID3 A;  2V1N A;  3L2W A;  3GTO J;  1Z3Y A;  2STW A;  4FCY A;  1GV5 A;  4F7Z A;  1B4A A;  4P9U A;  1EH7 A;  4K2E A;  2A68 F;  1G59 A;  1JUP A;  3BTL A;  2IW5 A;  2X6W A;  4XSZ F;  4ZZL A;  1YJW I;  3FHN A;  1MBJ A;  4RA2 A;  3WGI A;  2AS5 F;  2F2E A;  2L9N A;  1FBU A;  2VQH A;  3AG2 H;  1W7P D;  4C3J J;  1XMK A;  3QWL A;  1FMW A;  3MZH A;  1OMI A;  3I0T A;  4A0X A;  2B9S A;  2KFD A;  2HYF A;  2GXA A;  1E3H A;  2V26 A;  3RIR A;  5F08 A;  2IPQ X;  4A3D J;  4ETS A;  3HSF A;  2BW3 A;  2NOG A;  2HTS A;  2ADU A;  3J81 K;  3E7L A;  4G8X A;  1V3F A;  3A4C A;  4A3C J;  3LAP A;  4Q5S F;  5DEQ A;  4OAY A;  3H3U A;  4G6Q A;  5J47 A;  2HYG D;  4A3E J;  4RMN A;  3LSJ A;  2Y0M A;  1MMN A;  3VPR A;  1R6R A;  5FB2 A;  2VN2 A;  2UUZ A;  2KJC A;  1K6Y A;  2PX9 A;  4BNC A;  2K3P A;  3SZT A;  5M3M J;  3VFZ A;  1FTZ A;  2K4J A;  2DK8 A;  2CFX A;  3ZN0 A;  2NXN B;  5FKK A;  3AL0 B;  1XMA A;  2M7A A;  3PQJ A;  1IRG A;  4XN0 A;  2L7M P;  5CVV A;  2EFP A;  1X1C A;  3OYL A;  4XID A;  1VQL I;  2HZT A;  4ITV A;  3DPT A;  5TRD A;  2QUF A;  1F1Z A;  2GZW A;  3DU6 A;  4X0G A;  1X19 A;  3CCV I;  1EH6 A;  2Y9Y A;  3MVP A;  2CGP A;  3BTI A;  3CMY A;  1XG1 A;  3L2C A;  2DFE A;  3HDD A;  1APL C;  1D8J A;  2F48 A;  4A5N A;  4EVI A;  1JTX A;  2IS1 A;  2LLK A;  4YG2 F;  3BT9 A;  4PK4 A;  2DYS H;  2X0L A;  1XS9 A;  3KX2 A;  4PGH A;  1TQI A;  4A5M A;  3MAJ A;  3E6C C;  3CCQ I;  4B48 A;  3FMQ A;  2DLL A;  2BW3 B;  4P5O A;  2YS9 A;  2A6E F;  1ZRE A;  2CU7 A;  3FKJ A;  3Q9V A;  2E71 A;  3HKZ N;  2GXG A;  1X3Z B;  5D6E A;  4XOR A;  4DYQ A;  1UAA A;  4P96 A;  2ZXI A;  2YUS A;  4DBQ A;  3H92 A;  4XSX F;  3C18 A;  1Z3X A;  4EAT A;  3M8F A;  4L0Y B;  2DT7 B;  3AAF A;  2CS3 A;  3OL4 A;  1LFP A;  4E7K A;  3HGY A;  1TL8 A;  2R7R A;  3P9K A;  4I01 A;  3SZP A;  3SYT A;  3OYE A;  2EIL H;  2GBY A;  2KLO A;  2E5Z A;  5FLX Z;  3L1P A;  4CA0 A;  1LDK B;  2KDO A;  4TV7 A;  5F04 A;  4ZYE A;  3FXO A;  1R1U A;  3F22 A;  1IRZ A;  5EGO A;  2E2I J;  4EV0 A;  3NRV A;  2DT6 A;  4NBQ A;  4NNJ A;  1GV2 A;  1P4A A;  1S7O A;  1MSE C;  2VE9 A;  2LY9 A;  4XRS A;  1ZGJ A;  3EDP A;  4D7N A;  4S05 A;  2P7V B;  2LF7 A;  2Q2E A;  3LST A;  4DQ2 A;  2MLG A;  2BZT A;  2ELK A;  1B59 A;  1TWA J;  3C3W A;  3OYF A;  1OCC H;  3RPU D;  4CCJ A;  2PJR B;  2RDP A;  2ESN A;  2ESH A;  2MC4 A;  3I64 A;  3IWF A;  2FBI A;  1LB2 A;  1AA7 A;  2L4A A;  4QPO A;  4M6X A;  2QEN A;  1WFX A;  2L54 A;  3W2V A;  3N97 A;  3CCY A;  2KMU A;  2EH3 A;  1SFE A;  4UV8 A;  2CQQ A;  4DNC A;  4DJA A;  4IZZ A;  4LOC A;  3GTJ J;  1P7I A;  3C1D A;  4Y17 A;  1Z77 A;  3QAH A;  4N0B A;  3DFG A;  1X1A A;  3GZ5 A;  2W24 A;  5E8I A;  4GYG A;  4PUS A;  1RZ4 A;  2PMH A;  4PFO A;  4HDV A;  3VEP A;  2R92 J;  1NHA A;  2BXZ A;  3TP0 A;  3L7W A;  4CCL A;  4NC8 A;  2UWM A;  3FXM A;  4CCK A;  1MMS A;  2NVY J;  3JW4 A;  4M6V A;  4BJ5 C;  3HRT A;  4BXF A;  1Y56 A;  3PUB A;  3RKY A;  3GBG A;  3JRE A;  1SEU A;  3ZP5 A;  2L9S A;  2JA5 J;  2IA2 A;  5EGO B;  5EYR A;  3ZRG A;  1O7F A;  4IJA A;  2K40 A;  2MLK A;  5E3O A;  5EEG A;  4M3D A;  2DQR A;  3SHF A;  3H9J A;  3WGG A;  2Q2E B;  3BY6 A;  2WAD A;  4HPQ A;  4P9F A;  2KZV A;  4BE0 A;  2HOT A;  5HDG A;  4WCG A;  1GUU A;  3LSP A;  1NG7 A;  3MKY B;  1S29 A;  4MIM A;  1ORK A;  1OYW A;  1N77 A;  3JR9 A;  3GTP J;  1I1S A;  1WI3 A;  2COM A;  2QQ8 A;  2Q8K A;  4BYY A;  5DDG A;  3GX4 X;  2PJP A;  4LK1 F;  1ETW A;  1R23 A;  3H9Q A;  2AQE A;  2DMN A;  2YPR A;  4KIB A;  3S16 J;  3T0Y A;  3BLY A;  3Q3S A;  4LIT A;  3GYH X;  3R6S A;  2KIS A;  4M6Y A;  5IPA A;  4HST A;  3MMY B;  1D0X A;  2QBY A;  5GP9 A;  2DQL A;  1LVA A;  3JSO A;  1FLI A;  1Y1W J;  1R58 A;  4Q4Z F;  1YIJ I;  3LQR A;  3EPZ A;  4ZDP A;  1A6I A;  2ZKZ A;  1FBQ A;  3WHB A;  1ZGW A;  2PI0 A;  3Q0V A; 
#chains in the Genus database with same CATH homology
 3R0A A;  3GXO A;  2RQP A;  4A0Z A;  4KN7 X;  2OQG A;  5A2Q K;  3BJA A;  1SD6 A;  2A3S A;  1JHF A;  4EJU A;  1HQC A;  3NQO A;  4UUV A;  2HKO A;  1J7K A;  3F8C A;  3QPH A;  4LLN A;  1BJA A;  2PFB A;  5ICC A;  3CO7 C;  3E6B A;  1JGS A;  2P7C B;  3PQK A;  3P7N A;  2WC2 A;  2R7D A;  2JRT A;  4OOI A;  2IP2 A;  3H3Z A;  2UXX A;  5DD8 A;  4HF0 A;  1G3Y A;  4EM0 B;  1W5S A;  2V79 A;  1T2K A;  2QBY B;  1FYL A;  3T8T A;  1IXS B;  4I2O A;  2XHK A;  3HHH A;  3K1N A;  3ZMT A;  4UNO A;  2FQ3 A;  1IAW A;  2A07 F;  3WTX C;  2CSO A;  2YU3 A;  4ZH4 F;  1ZG5 A;  2P5K A;  1J2X A;  2E7X A;  4HOB A;  2K27 A;  3R4K A;  1OR7 A;  1XDU A;  2XKO A;  3KFW X;  5LHG A;  2DK5 A;  3J80 K;  3HSR A;  1ULY A;  1AOY A;  3CLO A;  4KDP A;  2EFN A;  4M9S A;  2LDU A;  3W6K B;  4Q48 A;  2O03 A;  5BQT A;  3CUQ C;  3M1E A;  3BJ6 A;  2EFO A;  4ESJ A;  5DUK A;  2FF4 A;  2ZFW A;  3WGH A;  5CJ9 A;  1OPC A;  2EV6 A;  1LEB A;  2KIM A;  1IN4 A;  2IRF G;  2DBB A;  4I7H A;  4G7O F;  3V7S A;  3RJP A;  2HFH A;  1D5V A;  4KUM A;  4Y13 A;  4UVC A;  2Z99 A;  4L9N A;  2G7U A;  3ML6 A;  4UV9 A;  4IF4 A;  3KP3 A;  3V8J A;  4HYE A;  4UVB A;  4XBF A;  1KU3 A;  4OMZ A;  3F8N A;  3D5L A;  4LB6 B;  3F6O A;  2QM3 A;  4YFX F;  3V8K A;  4G9Y A;  4IHT A;  5CVR A;  1TQP A;  3FMS A;  2M8E A;  4EQQ A;  2ZO4 A;  3GUD A;  1Z05 A;  3JSP A;  1IUY A;  1O3T A;  3VOE A;  3ISP A;  1KGS A;  2OZU A;  2XUB A;  3E5U A;  3QPT A;  4EGZ A;  3W6J B;  4RB0 A;  2O3F A;  4HLY A;  2O61 A;  5LEJ A;  3GW2 A;  2OAZ A;  3WTY C;  1O3R A;  1Q1H A;  4MQ9 F;  1RIO H;  4HBL A;  2DU9 A;  2KJB A;  5KK1 A;  3WU0 A;  3KE2 A;  2FBK A;  3I4P A;  5K5R A;  3DXJ F;  4H0E A;  5JR3 A;  4ENJ A;  1G3W A;  5K5Q A;  2P6T A;  1ON1 A;  1XDS A;  4LJZ F;  1KQ8 A;  1I5Z A;  2OU2 A;  4ZYD A;  5LLQ A;  3TDU C;  1L3L A;  3JAM K;  5DUI A;  4JK1 X;  1TW3 A;  4OU0 A;  3JTG A;  3RYR A;  5HDK A;  2D1H A;  5EEH A;  1QNT A;  3EUH A;  2P5V A;  2D2W A;  2MD5 A;  1P6R A;  2JPB A;  1MDM A;  3KZY A;  2HS5 A;  2XAH A;  5E8G A;  2W57 A;  1FZP B;  5HLI A;  1TLH B;  5LHI A;  2YX4 A;  5K5O A;  2L01 A;  1G3S A;  3F8M A;  2R7F A;  4IPA A;  1P4W A;  4O3M A;  3LA2 A;  4Z2Y A;  5ICF A;  3QU3 A;  2EFQ A;  2V1U A;  4RS8 A;  2XAJ A;  3F3X A;  1X3U A;  1DP7 P;  1W4M A;  3KP2 A;  4GCV A;  3ROU A;  2M5W A;  5CLS A;  3DEU A;  2PEX A;  4R1H A;  1LDJ A;  3RI4 A;  2V1D A;  1ZAR A;  3O2P E;  5FFZ A;  4HF1 A;  1MDM B;  4AIJ A;  4IRI A;  1TW2 A;  1OYI A;  1XGM A;  2XGX A;  4AVP A;  1HW1 A;  1FY7 A;  1YW8 A;  1J59 A;  4XLP F;  4M74 A;  2HR3 A;  2Z5U A;  4LMY A;  4CHU A;  1UHW A;  2NAZ A;  3WE2 A;  2HDC A;  4RB2 C;  4I98 B;  2A6H F;  4AWX B;  2MA3 A;  3NEU A;  2R3S A;  4CO8 A;  1CGP A;  4ESB A;  4WXD A;  1MJA A;  3SFZ A;  4U0Y A;  5LGU A;  3F8B A;  2JPC A;  3HTS B;  3WE3 A;  4M9Z A;  3D0S A;  3KP6 A;  5LGT A;  1O57 A;  4B8X A;  2F5F A;  1ZN2 A;  4O6J A;  3LFK A;  3R60 A;  3MEX A;  3FM5 A;  5ICE A;  4FT8 A;  3FXQ A;  2XV4 S;  1UHM A;  4BAY A;  4CZZ A;  2FA5 A;  3KP7 A;  4EM2 A;  1A04 A;  4CIC A;  1T0F A;  1E17 A;  3SQN A;  5D4S A;  4A0Y A;  3MZY A;  2XKP A;  4KN4 X;  3K9T A;  3R0J A;  3L09 A;  5IT9 K;  2GWR A;  2RN7 A;  2DPD A;  2GA2 A;  2HQR A;  3QRF F;  2KRF A;  1GXP A;  5L3G A;  4KIF A;  3E5Q A;  4MNU A;  3ZPL A;  5CVI A;  2QZ8 A;  1EH8 A;  4I09 A;  5LRS A;  1J0R A;  2BBY A;  2RV8 A;  5E18 F;  3TO9 A;  4HW0 A;  5ERI A;  1K7A A;  3U2R A;  1B9M A;  2M30 A;  1Z91 A;  4KMU X;  1SMT A;  2PMU A;  2M45 A;  3MCZ A;  2Z33 A;  2L02 A;  3ZMS A;  3DF8 A;  1S8N A;  2DT5 A;  4YFK F;  4NHJ A;  4NQW A;  4MGR A;  3S2W A;  4KT5 C;  3HRU A;  3FXR A;  5LRR A;  3P9C A;  4ENN A;  1O3Q A;  1HW5 A;  3RKX A;  4WK8 F;  2NRA C;  4GYI A;  4LK0 F;  4Y15 A;  3KCC A;  1ZG1 A;  1MJB A;  4CDG A;  1MKM A;  2QWW A;  3ZN1 A;  2QQA A;  1U2W A;  1R22 A;  2P4W A;  2O0Y A;  4LG0 A;  4ESF A;  4HV5 A;  1FX7 A;  3HIF A;  3OV8 A;  4U88 A;  2HQN A;  1I6X A;  1SFX A;  4PGG A;  4WX9 A;  1YIO A;  4RB3 C;  1XSD A;  5JVT A;  5ILU A;  1IZ1 A;  5DV5 A;  3REO A;  4R79 A;  1I27 A;  1PDN C;  4GO1 A;  4AD9 A;  3COA C;  2FMY A;  4BHP A;  3O6B B;  2A5Y B;  3BPX A;  4U7B A;  2JZY A;  1Z6R A;  2UXN A;  4HX7 A;  4EJW A;  1Z6T A;  3E97 A;  4AIH A;  3IL2 A;  5FGM A;  2ZCW A;  3WTT C;  4RGU A;  1TQM A;  5HS7 A;  4IXA A;  4LG0 B;  4ENK A;  3MFK A;  3IRQ A;  2FNA A;  4WXH A;  1K6O A;  3LA3 A;  4IVN A;  3QP5 A;  1SD7 A;  5H20 A;  1RI7 A;  2RC4 A;  4BHC A;  4EM1 A;  1BBY A;  3CO6 C;  5KVR A;  3I53 A;  4G6D A;  1FSH A;  3BRO A;  2D45 A;  3J7A O;  4R8H A;  3WOD F;  1PP8 F;  4AIK A;  3KLN A;  4KIC A;  2DO7 A;  1F5T A;  2E1C A;  4EJV A;  2DW4 A;  4KNY A;  4GGG A;  2OD5 A;  1E2X A;  3ZMD A;  2VBW A;  2EK5 A;  5CVJ A;  5CYV A;  1KYW A;  2VXZ A;  1XB4 A;  1S6L A;  4BXU A;  3WG9 A;  3RPQ A;  5H6R A;  3EET A;  4OIR F;  4QLC U;  4EMS A;  3EQL F;  2J5P A;  4KFC A;  2OQR A;  1UCR A;  3HYI A;  2MC3 A;  3GVA A;  3DV8 A;  1TNS A;  1HBX G;  2C6Y A;  2VOP A;  1R1T A;  2BV6 A;  3QP6 A;  1JE8 A;  1YW9 A;  3BWG A;  2PG4 A;  3HOS A;  3KEO A;  1QPM A;  3K1P A;  1U78 A;  4L9T A;  2ZJ2 A;  2OZ6 A;  3L00 A;  2VON A;  1XSV A;  3GFM A;  1GHC A;  2JSC A;  5HDN A;  3FX3 A;  5DD4 A;  2GQQ A;  1SD5 A;  4Q47 A;  4L9V A;  2VOO A;  4I02 A;  1W5T A;  3TOB A;  4WWC A;  2QQ9 A;  2ISY A;  2PN6 A;  1G4D A;  2HGC A;  3FXU A;  1JXS A;  4HDU A;  4IRH A;  5E20 A;  2CO5 A;  2FE3 A;  1HST A;  1MZB A;  3DKW A;  2F5C A;  2YSR A;  2QVO A;  1DDN A;  3F72 A;  1WKM A;  2DAO A;  2LSO A;  2Y48 A;  2FU4 A;  5ED4 A;  1C0W A;  2XIG A;  3T1B A;  1U5T B;  3GFI A;  2D1V A;  1IN6 A;  4HF2 A;  2E7W A;  2RKH A;  3O3K A;  4RAZ A;  5DCF A;  5HS8 A;  3GFL A;  5D5X B;  1SAX A;  3I54 A;  2VE8 A;  3V7R A;  3LA7 A;  3TKY A;  1L0O C;  4CYD A;  2FBH A;  1Y0U A;  2QYO A;  1IN5 A;  1R36 A;  1XCV A;  2LNB A;  4L0Z B;  3KZZ A;  5BMZ A;  2ISZ A;  2H94 A;  1P4X A;  3T8R A;  1DPU A;  2ZXJ A;  2KKO A;  1BI3 A;  3HUG A;  5FO5 A;  3Q5F A;  1JHH A;  4LLL A;  1KA8 A;  3IRR A;  3FF5 A;  3Q9S A;  5BOX A;  5IT3 A;  2RNJ A;  1FSE A;  4RGS A;  2IA1 A;  1IN8 A;  1GXQ A;  2BE5 F;  5BPD A;  3L9F A;  5HLG A;  2L4M A;  4EGY A;  5F6F A;  1O7L A;  2A61 A;  2DPU A;  4KYW A;  5FLX K;  3RYP A;  2H09 A;  1MJ9 A;  4ZZD A;  4OIO F;  1V4R A;  3ZQ7 A;  2FSW A;  1S7A A;  3V8L A;  1J5Y A;  1R5H A;  5L3E A;  3RDI A;  1D3Y A;  4U0V A;  4HAM A;  3B02 A;  2FNP A;  3U1D A;  3K1M A;  1HKS A;  5LHH A;  2DI3 A;  1YG2 A;  1YW7 A;  2W84 A;  1IF1 A;  2LKP A;  3GO5 A;  3E3V A;  5L3D A;  3E6D A;  3MWM A;  1XGN A;  5A2Q Z;  5D8K B;  5E1X A;  3GWZ A;  3GF2 A;  4KMF A;  1DPR A;  5AIQ A;  4UVA A;  4OIN F;  3HSE A;  4WF2 A;  2FXA A;  4YII A;  4PDK A;  1FNN A;  2IA0 A;  2Z3Y A;  3ULQ B;  5LEK A;  3BDD A;  4HQE A;  3GFJ A;  4FX4 A;  3F23 A;  2TDX A;  2HTJ A;  2XAQ A;  1TBX A;  5BS6 A;  4ASN A;  1ZRF A;  4CGZ A;  3QU6 A;  2FEZ A;  5HS9 A;  5J8F A;  1ONV A;  1PUE E;  3I5U A;  2IJL A;  4MTD A;  1W7P A;  4ZYH A;  1KQ0 A;  3KP4 A;  2K4B A;  2M1B A;  4MTE A;  4MQV A;  1U6G A;  1FBS A;  2K86 A;  1HSJ A;  1REP C;  2HOE A;  1WQ2 A;  3KLO A;  1KQ9 A;  1SD4 A;  4UXN A;  5F64 A;  3TO7 A;  1P92 A;  3ABT A;  3PFI A;  1TTY A;  2LF8 A;  3J80 Z;  4BHB A;  4ZYG A;  1T98 A;  3G73 A;  1YFH A;  1SFU A;  1SMY F;  1HXD A;  2EA2 A;  2FRH A;  1P2F A;  3CUO A;  1BIA A;  1W7P B;  1WI9 A;  2P8T A;  1R00 A;  3FMR A;  4D0P A;  4A6D A;  1FC3 A;  5JFR A;  3IHU A;  3IC7 A;  4O5V A;  2V1X A;  1YLF A;  4BH9 A;  3F21 A;  1QZY A;  2XAS A;  1MGT A;  2WTE A;  4JBA A;  4N9I A;  5TJJ A;  2E1N A;  3KP5 A;  1KU7 A;  1IXR C;  3F8F A;  2EFW A;  1IXC A;  3B73 A;  5E17 F;  2QQB A;  5D5U B;  3TOA A;  2ZME A;  1G3T A;  2CQK A;  1ZGA A;  4I0B A;  2KIU A;  6PAX A;  3FZV A;  2K7L A;  3BZ6 A;  1FP1 D;  1HKT A;  4A2U A;  3FM3 A;  1VTN C;  3G3Z A;  4LD5 A;  3RPU A;  3ECH A;  1F9N A;  3M8E A;  3OOP A;  2O8X A;  3T5X A;  4MEX F;  3CTA A;  1YO5 C;  1ZLJ A;  4MEY F;  4BQA A;  4XLN F;  2XRO A;  1RUO A;  1BI2 A;  4IRG A;  4M9X A;  4A12 A;  3I58 A;  5ILS A;  2HKX A;  4U7D A;  1IRF A;  2JTV A;  1H9T A;  5CVU A;  5HLH A;  2STT A;  2ZME B;  2P6S A;  1MD0 A;  2XVC A;  2RGV A;  4LB5 A;  3QOP A;  3N4M A;  4I0A A;  2WWY A;  4B09 A;  2MH2 A;  2EJR A;  2EWN A;  1J75 A;  2W85 A;  1T39 A;  1IN7 A;  3JAM Z;  1BM9 A;  3GLX A;  4S04 A;  5AIP A;  1I1G A;  3CDH A;  1D8K A;  1T6S A;  1XGS A;  2CG4 A;  3ZMZ A;  1Z7U A;  1QO0 D;  3P9I A;  5J6X A;  2DTR A;  3BPV A;  2G9W A;  3V4G A;  4G7H F;  3LAJ A;  1LQ1 A;  3JTH A;  1XSX A;  2XRN A;  4JQF A;  3CJN A;  1K78 A;  5F1R A;  1KYZ A;  3MQ0 A;  1XGO A;  4ON0 A;  2NNN A;  4L18 B;  2EV0 A;  1ZH5 A;  2VT3 A;  3VB2 A;  3FHZ A;  2ETH A;  2V6C A;  5H6Q A;  1HKQ A;  2FML A;  3M7G A;  3FWE A;  4YIF A;  3E5X A;  3CUQ A;  3IWZ A;  1FYM A;  2OA4 A;  1STZ A;  2EA4 A;  1LNW A;  5LBQ A;  4ENM A;  1RNL A;  5E1W A;  4PCQ A;  3TGN A;  4N9H A;  2A69 F;  2HEO A;  1BI1 A;  3HRS A;  2ZNZ A;  3ECO A;  1IW7 F;  1QBJ A;  3HRM A;  5DYM A;  1K78 B;  1U8R A;  1HW2 A;  3EYY A;  4UHT A;  1FPQ A;  3HOT A;  4OIQ F;  1Z9C A;  3ABU A;  2JT1 A;  3RKW A;  2MBF A;  1YS7 A;  2GIV A;  3TQN A;  3BOQ A;  3GEZ A;  3I71 A;  2XAF A;  4E70 A;  3WTS C;  3CUQ B;  1PP7 U;  1EV7 A;  4GXO A;  1B6A A;  3E6M A;  1R1V A;  2O6G E;  2QLZ A;  4G94 A;  4CXF A;  1Z1D A;  4MHG A;  3LQQ A;  3J81 Z;  4M71 A;  1B1B A;  1BI0 A;  2ZBK A;  2P5L C;  1R7J A;  5BPI A;  1BIB A;  2K02 A;  3K0L A;  1OKR A;  4NB5 A;  4HV6 A;  1H0M A;  1K79 A;  5D4R A;  1FYK A;  2F5D A;  5D5V B;  1QZZ A;  1RUN A;  1U5T A;  4L9J A;  5FFX A;  5IT9 Z;  3WTZ A;  3TDZ C;  1J9I A;  4YFN F;  3WTW C;  4A6E A;  4OIP F;  5ILV A;  4FX0 A;  2BYV E;  4EJO A;  3DP7 A;  3ERE D;  5FD5 A;  3F6V A;  2L3D A;  4HX8 A;  5AON A;  2Q0O A;  1LJ9 A;  5HVQ C;  3V7C A;  4IHS A;  3HHG A;  4LFU A;  1USS A;  5E1Z B;  3WU1 B;  1BC8 C;  3LWF A;  1BC7 C;  2WV0 A;  2B0L A;  5LGN A;  2BGC A;  4RB1 A;  1QGP A;  1ZRC A;  4OMY A;  3M9A A;  1GVJ A;  2AXL A;  2PQ8 A;  4HQM A;  1ODD A;  3IKT A;  3GZ6 A;  3KEQ A;  1YQA A;  4QWQ A;  2GXB A;  2PLY A;  2M87 A;  2Y75 A;  4LGW A;  1XN7 A;  4HLX A;  3WTU C;  2EV5 A;  1ZRD A;  1XCB A;  1G6N A;  5DCM A;  3IKV A;  4LLG F;  5FD6 A;  2HWV A;  1WWX A;  5JI6 A;  2IT0 A;  3ZMV A;  4EJT A;  2CWE A;  4G7Z F;  3VOD A;  2IVM A;  1WRJ A;  3BJO A;  2VBX A;  2VC1 A;  3ELK A;  1FOK A;  4XRF A;  2ACJ A;  2RVC A;  2YX7 A;  1FWZ A;  3DPL C;  2F5E A;  1OYY A;  1H9G A;  3SXY A;  2MH9 A;  1FT9 A;  2H27 A;  1BN5 A;  3U9G A;  2OBP A;  1ZAO A;  2VBY A;  1WSU A;  1ON2 A;  2YR2 A;  2DFI A;  2GA1 A;  4HA8 A;  5JHU A;  5ICG A;  2V9V A;  1U5T C;  5DCM B;  5HOO A;  2VBZ A;  3TO6 A;  1AWC A;  2PBI A;  1YYV A;  1UST A;  2CYY A;  1O3S A;  4HX4 A;  4RGX A;  4WXC A;  2NS0 A;  3K69 A;  3R61 A;  3DQV C;  4U0W A;  2NYX A;  3RTR A;  2XAG A;  3ZMU A;  5L3F A;  3KET A;  2ZNY A;  1DUX C;  1UB9 A;  4M72 A;  1B9N A;  5J8C A;  3I59 A;  2KIF A;  5D5W B;  2J5O A;  1T38 A;  2H6C A;  5L3C A;  2VT2 A;  5D6F A;  1CF7 A;  3K2Z A;  2EB7 A;  5L3B A;  3WTV C;  4PZJ A;  3EYI A;  4L5J A;  1YS6 A;  1QQI A;  1ZYR F;  2BEO A;  4KIG A;  1TNT A;  3BP8 A;  3HTU A;  1ZLK A;  2H6B A;  2UZK A;  1KU2 A;  4FHT A;  1U3E M;  2G7H A;  4KA4 A;  5D8L B;  1YTY A;  3C7J A;  2Z9O A;  2NNY A;  1LEA A;  4M73 A;  3I59 B;  2CW0 F;  5K1Y A;  2X4H A;  1CF7 B;  2VC0 A;  1S3J A;  1UFM A;  2ELH A;  4RGR A;  1LDD A;  2GAU A;  4RAY A;  1ZG3 A;  1ZHF A;  1F4K A;  1R5G A;  2W25 A;  4P55 A;  2VOD A;  1XD7 A;  2FOK A;  4HZF A;  4L5I A;  1KU9 A;  1FP2 A;  1BOA A;  2STW A;  4F7Z A;  1B4A A;  4P9U A;  1EH7 A;  4K2E A;  2A68 F;  2IW5 A;  4XSZ F;  4ZZL A;  3WGI A;  2AS5 F;  2F2E A;  1FBU A;  1W7P D;  1XMK A;  3MZH A;  1OMI A;  3I0T A;  4A0X A;  2HYF A;  3RIR A;  2IPQ X;  4ETS A;  3HSF A;  2HTS A;  2ADU A;  3J81 K;  4G8X A;  1V3F A;  3LAP A;  4Q5S F;  5DEQ A;  3H3U A;  4G6Q A;  2HYG D;  2Y0M A;  5FB2 A;  2VN2 A;  2KJC A;  4BNC A;  3SZT A;  3VFZ A;  2K4J A;  2DK8 A;  2CFX A;  3ZN0 A;  1XMA A;  3PQJ A;  1IRG A;  5CVV A;  2EFP A;  2HZT A;  3DPT A;  5TRD A;  2QUF A;  1F1Z A;  2GZW A;  1EH6 A;  2CGP A;  3L2C A;  1D8J A;  4A5N A;  4EVI A;  4YG2 F;  2X0L A;  4PGH A;  1TQI A;  4A5M A;  3MAJ A;  3E6C C;  3FMQ A;  2DLL A;  4P5O A;  2A6E F;  1ZRE A;  3Q9V A;  2GXG A;  5D6E A;  4P96 A;  3H92 A;  4XSX F;  3C18 A;  3M8F A;  4L0Y B;  3AAF A;  3P9K A;  4I01 A;  3SZP A;  5FLX Z;  1LDK B;  4TV7 A;  4ZYE A;  1R1U A;  3F22 A;  4EV0 A;  3NRV A;  1P4A A;  1S7O A;  2VE9 A;  1ZGJ A;  3EDP A;  4S05 A;  2P7V B;  2LF7 A;  2Q2E A;  3LST A;  4DQ2 A;  2MLG A;  1B59 A;  3C3W A;  2RDP A;  2ESN A;  2ESH A;  3I64 A;  3IWF A;  2FBI A;  1LB2 A;  2L4A A;  4M6X A;  2QEN A;  2L54 A;  3N97 A;  1SFE A;  4UV8 A;  4DNC A;  3C1D A;  4Y17 A;  3QAH A;  4N0B A;  3DFG A;  3GZ5 A;  5E8I A;  2W24 A;  4GYG A;  1RZ4 A;  2PMH A;  4HDV A;  3VEP A;  1NHA A;  3L7W A;  2UWM A;  3JW4 A;  3HRT A;  3RKY A;  3ZP5 A;  2IA2 A;  1O7F A;  4IJA A;  2MLK A;  5EEG A;  2DQR A;  3SHF A;  3WGG A;  3BY6 A;  4P9F A;  5HDG A;  4WCG A;  1S29 A;  1OYW A;  1I1S A;  2COM A;  2Q8K A;  4BYY A;  5DDG A;  3GX4 X;  2PJP A;  4LK1 F;  1R23 A;  2YPR A;  4KIB A;  3T0Y A;  3GYH X;  3R6S A;  4M6Y A;  2QBY A;  2DQL A;  1LVA A;  3JSO A;  1FLI A;  1R58 A;  4Q4Z F;  3LQR A;  2ZKZ A;  1FBQ A;  2PI0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...