2IRFG

Crystal structure of an irf-2/dna complex.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
109
structure length
109
Chain Sequence
RMRMRPWLEEQINSNTIPGLKWLNKEKKIFQIPWMHAARHGWDVEKDAPLFRNWAIHTGKHQPGIDKPDPKTWKANFRCAMNSLPDIEEVKDRSIKKGNNAFRVYRMLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(P*AP*AP*GP*TP*GP*AP*AP*AP*GP*(5IU)P*GP*A)-3')
publication title Crystal structure of an IRF-DNA complex reveals novel DNA recognition and cooperative binding to a tandem repeat of core sequences.
pubmed doi rcsb
source organism Mus musculus
molecule tags Gene regulation/dna
total genus 30
structure length 109
sequence length 109
chains with identical sequence H, I, J, K, L
ec nomenclature
pdb deposition date 1999-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00605 IRF Interferon regulatory factor transcription factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2irfG00
1ZG5A 1B6AA 2ZXJA 1RNLA 4ENNA 3R4KA 1CGPA 4R1HA 4RGSA 4M72A 5HVQC 4YFXF 2O03A 3M1EA 2D2WA 1FT9A 1JE8A 3DXJF 5A2QK 1PP7U 2GWRA 1I1GA 2A61A 3TOAA 4Q47A 2Y0MA 3T8TA 5BPDA 5AONA 3F3XA 1OMIA 1BI2A 2ESHA 4L9TA 4ESJA 1HKTA 2JTVA 2GXBA 1FWZA 1J75A 4CGZA 4O6JA 4BYYA 2FOKA 3E5QA 1G3TA 1F9NA 4N0BA 5K5OA 2MD5A 2Q2EA 1BC7C 2DK5A 3KFWX 5FFXA 6PAXA 1JHHA 1UHWA 3VEPA 2OZ6A 2RGVA 3WTXC 1S29A 1ON2A 4G94A 3WTYC 1OKRA 2F5CA 2KIMA 3H3UA 2QLZA 1D8KA 3WTWC 5HLHA 1MJBA 3K1NA 1HW1A 5ILUA 2YU3A 1O7FA 2FMLA 4KUMA 1E2XA 2DAOA 4I01A 5F64A 3V8JA 3WTZA 4IJAA 1FLIA 1XDUA 2KIFA 3J80Z 3HRUA 1QBJA 2H6CA 3JAMK 3C1DA 1J59A 3MEXA 3ABUA 1I27A 3COAC 3I64A 2FF4A 2CO5A 1GHCA 3WGGA 1DPUA 5HDGA 3I71A 4G7HF 2M8EA 2DFIA 1ONVA 4I7HA 3TKYA 3MZYA 3ERED 3K0LA 1IW7F 1XGMA 2JPBA 3HIFA 3FHZA 1J2XA 2FBKA 2V1DA 3FXUA 4N9IA 4FT8A 3WTTC 3P9IA 1R1VA 2H94A 3L2CA 3G3ZA 5ICEA 3MCZA 5TRDA 3N97A 3K9TA 4KMFA 3ECOA 2R7FA 2DT5A 1KA8A 4Y15A 3CJNA 5LHHA 3GW2A 3WE3A 1RUNA 4HF2A 2ADUA 2YX7A 3I59A 4S04A 1IAWA 2HOEA 2J5OA 1T0FA 5L3BA 1F4KA 2XAJA 2EA2A 1ZGAA 3DFGA 3L00A 2XUBA 2YR2A 2K4JA 2Z3YA 2OAZA 4PGHA 4ESFA 2PEXA 5K1YA 4RAZA 1V3FA 2J5PA 3V7RA 3BJ6A 4LK0F 3F6VA 3WE2A 2F5EA 1TNTA 5D5XB 1ZRCA 3ZMDA 3NRVA 2VONA 3EYYA 3J80K 3TO9A 1W5SA 4WCGA 1G4DA 2OQGA 4IVNA 1PDNC 1EV7A 4OMYA 2VODA 1FYLA 3WTVC 2EV5A 3HSFA 3JSPA 2LF8A 2X0LA 2W84A 2DQRA 2M30A 2QYOA 1DDNA 1KYZA 1L3LA 2ZMEA 1XGSA 3IKVA 2DQLA 5ERIA 3FMSA 5AIPA 1I5ZA 3GYHX 1QZZA 1TNSA 2R3SA 1UCRA 3WTUC 2EK5A 1ZLJA 4WXDA 4WF2A 3ISPA 3R60A 1O3TA 3Q9VA 1YW7A 4DNCA 1SMTA 2MA3A 5LRSA 4CHUA 2H6BA 1U3EM 2RC4A 1IZ1A 5E1WA 1KQ9A 3TDZC 3HOTA 1A04A 1R5HA 4ZYEA 2GA2A 3ZMUA 4CZZA 2IT0A 3HUGA 5L3CA 5JHUA 2NNYA 3VOEA 2OBPA 5E1ZB 2F5DA 1YTYA 3K1PA 3G73A 4KN4X 3E6DA 3WG9A 3ZQ7A 5ICGA 3V7CA 5D8LB 4NB5A 3QOPA 3V8LA 4B09A 3RDIA 1KU3A 1ODDA 1IF1A 3GWZA 5LEKA 4KN7X 4I0AA 1QO0D 1ZLKA 5J6XA 3W6JB 4AIKA 1XSDA 4I0BA 2W24A 1YLFA 2VBZA 3I59B 3N4MA 1K6OA 1J9IA 1WI9A 4OINF 2IA1A 3F8CA 3K1MA 2XVCA 3PFIA 3E5XA 1LVAA 4M6XA 3MAJA 2VC1A 5BS6A 3K2ZA 1IUYA 1R23A 4HOBA 2KJCA 1RZ4A 2L4AA 2WV0A 4G6QA 5FLXK 1YS7A 3F8FA 4Q5SF 2UWMA 3P9KA 1S7AA 5IT9K 1KQ8A 3M9AA 5FB2A 1USSA 3E5UA 3SXYA 3MWMA 1FNNA 4PZJA 4B8XA 3ML6A 1Z05A 3GLXA 2IVMA 4P5OA 1O3RA 4HW0A 1IN6A 3WGIA 4MTDA 4MEYF 4KICA 4LB5A 1XSVA 1RIOH 4FX4A 5D4SA 2M5WA 2ZBKA 2E1NA 3SQNA 2MLGA 1GVJA 1MDMA 4OIOF 1H9TA 4EJOA 1JHFA 2G7HA 2Q8KA 4IXAA 2F2EA 2B0LA 3HRTA 1MJAA 1ZG1A 2Y75A 4Q4ZF 3IWZA 3K69A 1EH8A 1D8JA 2QENA 4AWXB 4KYWA 1TLHB 1K78B 3ELKA 3WU1B 1FZPB 2XROA 2QVOA 1FOKA 1BBYA 3MQ0A 5H6RA 4JBAA 5K5QA 3I0TA 1HSTA 1BI1A 4RGXA 3LA3A 3J81K 5J8CA 1B1BA 4RS8A 2DPUA 3R61A 3SZPA 2XV4S 2HWVA 2HQRA 1D3YA 3HSRA 2HYFA 1XDSA 3E6CC 2PJPA 5TJJA 5DUIA 3L09A 4MNUA 2IW5A 4L9NA 2C6YA 2VXZA 2W57A 2BYVE 2OQRA 1MKMA 5JFRA 2X4HA 1O7LA 3SFZA 1BIBA 1W7PB 4Z2YA 2E7XA 5ICCA 3J7AO 4A5MA 1K7AA 1YQAA 5D4RA 4LLGF 5E17F 2K86A 3F6OA 1F5TA 1SFEA 3EQLF 2OD5A 2M1BA 3OV8A 3LA7A 5DEQA 3GEZA 1XGNA 2COMA 2FEZA 4CXFA 4MGRA 2FQ3A 1BI3A 4MEXF 3CLOA 3KETA 4HLXA 1Y0UA 3KP2A 3VODA 4L9VA 5DCMB 4A6DA 1MD0A 2FU4A 4ENJA 2HR3A 1LDDA 3LWFA 3BJAA 4PCQA 3ZMVA 3HHGA 3O6BB 1PUEE 1J7KA 3NQOA 1R5GA 2O0YA 5ILSA 2O3FA 5BOXA 3HSEA 3HTSB 4EM1A 3CDHA 4HLYA 1FYKA 2EV6A 3HRMA 3T1BA 3KE2A 2GA1A 1QZYA 2H27A 3RKXA 4DQ2A 4XRFA 1SD4A 2LKPA 3I54A 1O3SA 1RUOA 1U5TB 2D45A 4A6EA 4UNOA 3HYIA 2IRFG 3F8MA 5FD5A 2CSOA 1SFUA 1LEBA 2YSRA 3BP8A 1Z7UA 3SZTA 4HX4A 4XBFA 1DP7P 2KRFA 2CW0F 3R0AA 3HHHA 3RYRA 3ZN1A 2L4MA 3MZHA 1P92A 3BY6A 4BHCA 4GCVA 2EJRA 4I09A 4RB1A 1R1UA 1CF7A 1U5TC 2G9WA 1T98A 1XB4A 1E17A 3QU6A 4LJZF 1KGSA 2XRNA 4N9HA 1MZBA 3DPTA 4RGUA 5DV5A 3GFMA 2DI3A 2FNPA 1R7JA 2IPQX 3GZ6A 2IA2A 2VE9A 3QPHA 3FZVA 3DQVC 3KLNA 2HYGD 2WC2A 4A5NA 4U0WA 3FWEA 3ZMSA 1S6LA 3RJPA 1STZA 4HZFA 2P4WA 2ETHA 2DPDA 3I53A 5CVVA 4U88A 2QQAA 4ENMA 1QGPA 1TQMA 1T39A 3PQKA 1GXQA 1Z6RA 2EWNA 1FSHA 4EM2A 1YS6A 3LAJA 4BHBA 4NQWA 1IN4A 1WWXA 4XSXF 5F6FA 1C0WA 2QM3A 3RTRA 2VBXA 1BM9A 1HQCA 4YFKF 1G6NA 5EEGA 1J5YA 3M8FA 4OOIA 3LA2A 3WU0A 5K5RA 1YW9A 4PGGA 2V79A 1H9GA 3E3VA 5EEHA 4A0YA 4Q48A 3FM5A 2IJLA 1U2WA 2LNBA 2FE3A 2ISYA 4AIHA 3DPLC 3KP4A 1UHMA 4WK8F 1IXRC 1IRGA 2Z99A 2NRAC 2QBYA 3F72A 4IRHA 4OIQF 2ZFWA 4L9JA 2CGPA 5H6QA 5BMZA 1OYWA 2EFPA 1RI7A 2A5YB 3EYIA 4EQQA 1X3UA 3DP7A 4EJUA 5CLSA 4MHGA 4HDVA 3TO6A 1P4AA 4XLNF 1D5VA 3HRSA 4YFNF 3RI4A 2RKHA 4LB6B 4LG0A 4ZH4F 5HDKA 4RB2C 5HLGA 3JTHA 1ZYRF 4M71A 2HGCA 3TDUC 3W6KB 3CUQA 2PG4A 1K79A 1WRJA 2P5LC 1L0OC 4GGGA 1LDKB 2K27A 3KZZA 2VT2A 3R0JA 1YW8A 2XIGA 5L3GA 1ZRFA 4S05A 2NYXA 1O57A 4EMSA 4WX9A 3DKWA 1TTYA 3LFKA 4M9XA 2STTA 2V6CA 2DO7A 5ICFA 4KDPA 4UXNA 5D5VB 3E6BA 3GFJA 2ESNA 2PMUA 4E70A 1KU2A 5D5WB 2ZNYA 2FSWA 1HBXG 1SD6A 3ZMTA 5LHIA 5LHGA 3GF2A 5KVRA 2PLYA 4L0YB 3RKYA 2XASA 4KIBA 3ROUA 3KEQA 3LQRA 2A6HF 2GAUA 2ZNZA 2HTJA 4H0EA 4KIFA 2VBYA 3E97A 5LGTA 2BGCA 3F8NA 1KYWA 2VN2A 1R1TA 2EFQA 4UVBA 2EV0A 5F1RA 4R79A 3EUHA 1IN5A 1S8NA 1BN5A 1DUXC 1QNTA 4AVPA 1OYYA 1LDJA 3FM3A 5CYVA 2FBHA 3Q9SA 1BI0A 3O2PE 1SFXA 2CG4A 2A07F 1F1ZA 2JSCA 4MQVA 5DUKA 1KU7A 1MGTA 3RPQA 2Q0OA 2P5KA 4LD5A 2ELHA 1W5TA 4YIIA 3RPUA 4L0ZB 2DW4A 1HW5A 5DDGA 4UUVA 4OU0A 5CVJA 2TDXA 3JSOA 5DCFA 4D0PA 3OOPA 2V9VA 3I4PA 2VOOA 2L02A 3BOQA 5DYMA 2ISZA 2IP2A 2HQNA 2ZMEB 2GIVA 2W25A 2KKOA 2Z33A 4P9UA 5A2QZ 1SD5A 2AXLA 2WTEA 4XLPF 3I5UA 2K02A 1I1SA 2DLLA 2V1XA 1LEAA 5L3FA 2P7CB 3O3KA 5KK1A 3LSTA 4M9ZA 2XAQA 2XKPA 2W85A 4HYEA 3HTUA 3T5XA 3D0SA 2UXNA 3FMQA 1HSJA 1Z91A 4HV6A 5D6EA 3SHFA 2MLKA 4OIRF 2NAZA 3JTGA 5L3EA 2BEOA 4BXUA 2A69F 4CICA 1HKQA 5JR3A 3V7SA 2A3SA 2HKOA 2DU9A 4A0ZA 1SD7A 2XHKA 4BAYA 3REOA 1FC3A 1PP8F 3ECHA 5HS9A 2EA4A 2BBYA 2HEOA 4GO1A 1YIOA 2HTSA 4HBLA 1ZN2A 3KZYA 1OPCA 2JPCA 3DV8A 4EV0A 2L54A 1KU9A 2QQ9A 2EB7A 4M9SA 4HV5A 3V4GA 3CUOA 2JT1A 5HS7A 3JAMZ 3TO7A 1Z1DA 1XCVA 2O8XA 2ACJA 3GXOA 5LRRA 1P2FA 4HX7A 4HF1A 4U0YA 2VC0A 1ZHFA 1IRFA 4WWCA 2PQ8A 3IC7A 1U8RA 2RNJA 2K4BA 3FMRA 1ULYA 4QLCU 2A6EF 4IRIA 3QAHA 2PI0A 3U1DA 5CVUA 5D6FA 4I02A 1TQIA 4CO8A 1ZAOA 4M74A 4IHSA 3DEUA 3RYPA 1T38A 2E7WA 4K2EA 2KJBA 3H3ZA 2IA0A 3TGNA 3QP6A 1UFMA 2QZ8A 2XKOA 2D1HA 3BWGA 1TW3A 3B73A 5BQTA 2CWEA 4HDUA 3GFLA 2L3DA 2CYYA 3IKTA 1QPMA 4EJTA 1W4MA 3LQQA 1HKSA 4G7OF 1VTNC 4P96A 2E1CA 2OA4A 3BROA 4O3MA 2M45A 1MDMB 2MBFA 2P5VA 4Y13A 1BC8C 2DBBA 5IT3A 3CTAA 3M7GA 2FBIA 2PFBA 1DPRA 2YPRA 3CO7C 4LFUA 2FMYA 1FP1D 1J0RA 4BQAA 4G7ZF 1B9NA 4EJWA 2BV6A 2MC3A 4KFCA 1T2KA 1MJ9A 4HA8A 1P6RA 3E6MA 4ETSA 1BIAA 2RN7A 1G3YA 5LBQA 5LGUA 5ED4A 4ENKA 3QP5A 4IRGA 5DD8A 3I58A 4LK1F 3F23A 2FRHA 1BJAA 4MQ9F 4YIFA 3R6SA 1OYIA 1XMKA 5L3DA 1B59A 3GO5A 4L5IA 3KP5A 4HF0A 1LJ9A 3GX4X 4A2UA 4ASNA 2QWWA 4RB3C 2UXXA 4EJVA 4EGYA 4RGRA 5D5UB 2QUFA 1ZGJA 3HOSA 1ZRDA 4IHTA 2OU2A 4P55A 5J8FA 4U7DA 2EFWA 2G7UA 2PMHA 2R7DA 3H92A 3GZ5A 1GXPA 1QQIA 3JW4A 3U2RA 4BH9A 3U9GA 1HW2A 1ZG3A 4ON0A 4YG2F 4BHPA 2EFOA 2XAGA 1B9MA 4LLLA 4UV8A 1LB2A 4OMZA 3P9CA 2Z9OA 3C3WA 2NNNA 1FYMA 3ABTA 3KEOA 5FFZA 5HOOA 3BDDA 1G3WA 1H0MA 2LF7A 5HDNA 1G3SA 1WQ2A 2RDPA 1TW2A 5JI6A 3WTSC 4ESBA 5FGMA 2H09A 1HXDA 1AWCA 4GYIA 4LLNA 3P7NA 5CVIA 2ZO4A 2LSOA 1USTA 3KP6A 1AOYA 4AIJA 2D1VA 3RKWA 3VFZA 3ZPLA 2HDCA 1U6GA 4LMYA 1IXSB 1WKMA 4R8HA 1R00A 2MH2A 2ZJ2A 3KLOA 5D8KB 1Z9CA 4WXCA 3D5LA 2QQBA 3B02A 3L7WA 4ZYHA 1WSUA 4KA4A 1P4WA 1I6XA 2O61A 5E18F 1UB9A 1FBUA 2JRTA 2BE5F 3GVAA 2EFNA 4JQFA 5CJ9A 2HKXA 2GQQA 3TOBA 4JK1X 1CF7B 2YX4A 3IWFA 3S2WA 2MH9A 1ZARA 5DD4A 1Q1HA 1XN7A 2HFHA 2P6TA 3FF5A 4HX8A 5FLXZ 3VB2A 4O5VA 5LGNA 5LEJA 1XD7A 2JZYA 5ILVA 5IT9Z 1Z6TA 3BPXA 1S7OA 3QRFF 4Y17A 1U78A 1JXSA 4L5JA 3IHUA 5E8GA 1FX7A 3WODF 2OZUA 5LLQA 1B4AA 1K78A 1FBSA 1REPC 2CFXA 3DF8A 2FNAA 4ZYDA 4LGWA 4G9YA 2XGXA 1S3JA 3TQNA 1TBXA 3M8EA 1LNWA 3C7JA 3T8RA 1YO5C 4XSZF 5H20A 1W7PD 1NHAA 1TQPA 1XSXA 1R36A 4HAMA 3ZP5A 4ZYGA 4GYGA 2F5FA 4OIPF 4UVCA 3ZMZA 1FBQA 1KQ0A 2VOPA 1IXCA 3CO6C 4UVAA 2K7LA 4WXHA 3F22A 4ZZDA 3FXRA 3BPVA 4KMUX 4KIGA 3J81Z 1R22A 1W7PA 5JVTA 4M73A 1FY7A 2FXAA 3FXQA 2AS5F 4TV7A 4AD9A 4I2OA 3WGHA 4I98B 5E1XA 2P7VB 3GUDA 1FP2A 3KCCA 4PDKA 1XCBA 2M87A 2QBYB 2WWYA 2HS5A 2NS0A 1ZH5A 3BJOA 3GFIA 4A12A 3T0YA 1LQ1A 3NEUA 5DCMA 1IN7A 1IN8A 5E8IA 2FA5A 4RB0A 3EETA 4HQMA 3KP7A 2VT3A 4M6YA 4CYDA 5FD6A 3ZN0A 2PN6A 2RVCA 4EVIA 4RAYA 2VE8A 2ZKZA 2A68F 5FO5A 2ZCWA 1P4XA 4QWQA 3IL2A 4A0XA 3Q5FA 1EH6A 2STWA 1O3QA 4LG0B 5HS8A 4IF4A 3PQJA 4HQEA 3FX3A 4CDGA 3L9FA 3IRQA 1V4RA 1XGOA 1ZREA 4BNCA 3CUQB 4UV9A 2UZKA 1U5TA 4P9FA 3KP3A 1ON1A 4L18B 4NHJA 2KIUA 3MFKA 4U0VA 1T6SA 4IPAA 4FHTA 2Y48A 4GXOA 3CUQC 3ULQB 3AAFA 2XAHA 1R58A 4MTEA 1XMAA 2GZWA 2LDUA 1YG2A 3RIRA 4G6DA 3F8BA 5E20A 1OR7A 2XAFA 5AIQA 2PBIA 2DK8A 5BPIA 3QU3A 3BZ6A 2GXGA 4U7BA 3IRRA 4KNYA 5HLIA 3V8KA 1JGSA 3EDPA 4EGZA 1BOAA 4ZZLA 3C18A 2L01A 4UHTA 2HZTA 2Z5UA 1EH7A 1YFHA 4F7ZA 2V1UA 2RQPA 3F21A 4KT5C 4G8XA 4EM0B 1YYVA 2P8TA 2P6SA 2CQKA 2O6GE 1SMYF 1FPQA 1FSEA 2RV8A 1SAXA 3LAPA 2DTRA 5CVRA 2VBWA 4FX0A 3QPTA
chains in the Genus database with same CATH superfamily
1ZTRA 1B6AA 1ZG5A 2ZXJA 1RNLA 3SDGA 4EATA 4ENNA 3CCRI 4XRSG 3R4KA 1CGPA 4R1HA 3EPZA 4RGSA 4CYCB 2V26A 4M72A 5HVQC 3D5RC 3BG7A 4YFXF 1TP4A 1WH7A 3HGYA 2VLAA 2O03A 2E35A 2DTZA 2D2WA 3M1EA 5JLXA 1FT9A 1JE8A 3DXJF 5A2QK 1PP7U 2GWRA 1ZKGA 1I1GA 2A61A 1VF9A 1IDYA 3TOAA 4BBRJ 4Q47A 2Y0MA 3T8TA 2XF5A 5BPDA 5AONA 3F3XA 1MBGA 1SEUA 1OCOH 2RQQA 1OMIA 1BI2A 2ESHA 4M3BA 4L9TA 4ESJA 3CESA 1HKTA 4KT6A 2WY8Q 2X85A 2JTVA 4BDZA 2GXBA 4QPQA 2BW3B 4JOMA 1FWZA 2VKEA 2M2EA 1J75A 4CGZA 4PUSA 1JUMA 2OV7A 4O6JA 2OTJI 4Y52J 4LG3A 1ZQ3P 4ZTFA 4BYYA 2FOKA 3E5QA 1Y1WJ 1G3TA 3PIOF 1F9NA 2JA7J 4N0BA 5K5OA 2MD5A 2IGKA 1QU3A 2Q2EA 5M5WJ 5B1AH 1Y0NA 4C9YA 1BC7C 2DK5A 4L5EA 3KFWX 2W82A 5FFXA 6PAXA 3L2UA 2O5RA 3S15J 1JHHA 1UHWA 5EZHA 3VEPA 2OZ6A 2H1KA 2RGVA 3WTXC 1S29A 1ON2A 4BACA 4DGWB 2K9LA 4G94A 3WTYC 1OKRA 3PNVA 2L5QA 2IS1A 2DOEA 1ZR2A 1AKHB 2F5CA 2KIMA 1LE8A 2TRTA 5FRNA 3H3UA 2QLZA 1D8KA 4FETA 3WTWC 5HLHA 2Y0SN 1NTCA 1BR1A 1MJBA 3K1NA 3ZQFA 1HW1A 5ILUA 1GT0C 2YU3A 1O7FA 2FMLA 4KUMA 4MLOA 1E2XA 2DAOA 3HPHA 4I01A 5F64A 3CD6I 1T08B 4FQGA 3V8JA 3WTZA 2DA5A 4IJAA 3IUOA 2CH0A 1FLIA 2DYSH 1XDUA 2KIFA 3J80Z 1N25A 3HRUA 1QBJA 2H6CA 4DYRA 3JAMK 1WGXA 3GLLA 2KZVA 1Q1VA 4B44A 3C1DA 1J59A 2QSHX 2BZTA 2NVTJ 4MFDA 3MEXA 3ABUA 1I27A 3COAC 3I64A 3LL7A 2FF4A 2CO5A 3OYJA 1GHCA 3WGGA 1DPUA 4BU2A 2L2OA 3C2HA 4RLQA 5HDGA 3I71A 2W00A 2M8EA 4G7HF 4A3DJ 4XKWA 2DFIA 5F0FA 1ONVA 4I7HA 3TKYA 2X48A 1VQ5I 3CDIA 3MZYA 4M3GA 3ERED 3K0LA 1IW7F 4QTRA 3Q0VA 1XGMA 2JPBA 5EJCA 3JR9A 1S9HA 4Y4RA 5KCMA 3HIFA 4HNTA 3FHZA 4BDYA 2VPRA 1J2XA 2FBKA 1T8IA 2V1DA 3FXUA 4N9IA 4FT8A 1UMQA 3WTTC 2CV2A 5IP7J 3P9IA 1R1VA 1IDZA 4D5CA 1YE9A 3BR1A 2H94A 2XPWA 5K7ZA 2VUMJ 2VJ4A 3JREA 2HVRA 3L2CA 3G3ZA 1E0EA 1N78A 5ICEA 2V7FA 3MCZA 5TRDA 3N97A 5C4XJ 3K9TA 4KMFA 3S2DJ 5IYDJ 3ECOA 3NWTA 5J1YA 4D1QA 2R7FA 2DT5A 2WB1N 1BR2A 4OAYA 1MMSA 1KA8A 1R4MB 5H2FC 3KYLA 2KRCA 4Y15A 1ZK8A 3CJNA 5LHHA 3GW2A 2EH3A 2DCEA 3WE3A 3OYGA 3VWBA 3AG1H 1RUNA 3GTGJ 4QIWN 1WFXA 2OJED 5GTIC 4HF2A 4F55A 3A01B 1TT0A 4FTHA 2ADUA 1EJ9A 4RM2A 3VYSB 4YEJA 2YX7A 3I59A 4XR6A 4S04A 1IAWA 2HOEA 2J5OA 3D1NI 1T0FA 3HPGA 1R49A 3H5RA 5L3BA 5HNHA 1F4KA 2XAJA 3OIOA 3EUKL 2EA2A 2RAEA 3HZJA 3C2BA 2ECBA 3J7ZI 1ZGAA 3OS2A 5B1BH 4A3JJ 3VSKA 1K4TA 3FK7A 5M5YJ 3DFGA 3L00A 3OYNA 3GTQJ 3M1CA 4XICA 2XUBA 2YR2A 2K4JA 3H0GJ 4OAZA 5F04A 2Z3YA 2OAZA 5FKOA 4PGHA 4BQOA 4ESFA 4CCMA 2PEXA 3CCMI 2VB6A 3OYAA 2DDAA 3A03A 3BQZA 3A0BC 5K1YA 5IYCJ 2LMDA 4RAZA 1V3FA 2EZIA 2J5PA 3V7RA 2CUJA 3BJ6A 4LK0F 2BOLA 3F6VA 3WE2A 2F5EA 5F0HA 1TNTA 5D5XB 1ZRCA 2M7BA 3ZMDA 3NRVA 4G12A 3EYYA 2VONA 2JWTA 4RLFA 3J80K 1GUUA 3ABKH 3TO9A 2MYSA 2X6WA 1W5SA 4WCGA 1G4DA 2OQGA 4IVNA 1PDNC 3OS0A 1EV7A 3OYHA 4OMYA 1Y6IA 4CSWA 2VODA 2DMTA 2X1DA 1BJZA 1FYLA 3WTVC 2EV5A 1TWCJ 3HSFA 4ZDLA 1QVUA 2ME6A 1PYVA 3JSPA 1NG7A 2LF8A 3H3VK 2X0LA 2W84A 2DQRA 2E36A 2M30A 2QYOA 1DDNA 2IS2A 2EILH 3HKZN 2XC7A 1JKQC 1XS9A 2CU7A 1KYZA 2IGOA 1L3LA 2ZMEA 1YJNI 1ZGWA 3OYKA 1XGSA 3IKVA 1JGGA 2DQLA 5ERIA 1JT0A 1Z3YA 2JRMA 1MW7A 3FMSA 1RETA 5AIPA 1I5ZA 1XX5A 3RZDJ 3GYHX 3TBIA 4A3GJ 3I4NJ 1QZZA 2ID6A 1TNSA 4HG2A 4GFBA 1OCCH 3WHCA 3B6CA 2ZSHB 2R3SA 5JVGF 5E3NA 1UCRA 3VDXA 2DJNA 3WTUC 1ETXA 2EK5A 3BR6A 1V5EA 1ZLJA 2EIKH 4WXDA 1B72B 4WF2A 3ISPA 3R60A 1QHGA 2V9KA 1O3TA 1MBFA 1N77A 3Q9VA 1YW7A 4Y3OA 1U9NA 4DNCA 1SMTA 2MA3A 5LFAA 5LRSA 4CHUA 2H6BA 1U3EM 1V54H 2Y9ZA 2RC4A 1PJRA 4RAFA 1IZ1A 5E1WA 1X58A 1KQ9A 3S14J 2LLKA 3VYUB 2L7ZA 3N05A 3TDZC 3HOTA 1A04A 1PVEA 1R5HA 3OR1C 4ZYEA 4IZZA 1HLVA 2GA2A 3ZMUA 3FKIJ 5IOZA 1ERDA 3BG9A 4CZZA 2IT0A 4BGDA 4C2MJ 3HUGA 1RKTA 3RQIA 3ASOH 2VASA 5L3CA 5JHUA 4JX6A 2Y30A 2NNYA 4BXXJ 3VOEA 1MH3A 3QPSA 2OBPA 5E1ZB 2F5DA 4XLHA 1YTYA 3K1PA 3G73A 1K4SA 3OYCA 4KN4X 1ETWA 3E6DA 3WG9A 3SDBA 3ZQ7A 2WA0A 4B3XA 2R93J 5ICGA 3V7CA 1HF0A 4I76A 4NB5A 5D8LB 1W0TA 3SEZA 3H9QA 2HPMA 3QOPA 3V8LA 3BR0A 4B09A 3JRIA 4IEJA 1LVKA 1Z21A 2LRDA 2BVMA 3HBLA 3CQZJ 4CUGA 3RDIA 1K61A 1ITYA 2E2IJ 1KU3A 1MNEA 1ODDA 1X1CA 1IF1A 3GWZA 5LEKA 4EEFG 4F91B 2ZB9A 4KN7X 3BR5A 4RAGA 3PIPF 1OJLA 1HDDC 4RMNA 3TMOA 2K9NA 4FCYA 2L7FP 4I0AA 3QYEA 1QO0D 2QGUA 3WU2C 1SANA 1ZLKA 1PUFA 5HNFA 3HOYJ 5J6XA 1DQUA 1E3OC 2EZKA 3K4MA 1UG2A 3OYDA 3W6JB 4AIKA 1XSDA 1YJWI 4I0BA 2HI3A 3MZ8A 2W24A 3I9V2 1YLFA 2VBZA 3I59B 3JRGA 3RPUD 2A6TA 3N4MA 2UV1A 1K6OA 3FDYA 1J9IA 1WI9A 3HDDA 4OINF 2LOOA 3TP3A 4YIRX 2IA1A 3F8CA 1YRNB 3K1MA 3GTOJ 1D0YA 4UUSB 2BY0A 1A6IA 2XVCA 3PFIA 3E5XA 1LVAA 4M6XA 3MAJA 2VC1A 2JQ7A 3S2HJ 5BS6A 3GMEA 3K2ZA 1IUYA 1FEXA 2NS8A 3G1OA 1R23A 1X3ZB 3DBRB 2EPFA 4HOBA 2KJCA 3SEQA 2LKXA 1RZ4A 1MBHA 2L4AA 2WV0A 4W1UA 5C3EJ 3CJQB 4G6QA 5FLXK 1YS7A 3F8FA 2KL4A 4B4CA 4Q5SF 2UWMA 3UNGC 2XGCA 3P9KA 1D5YA 1S7AA 3I55I 5IT9K 1KQ8A 3M9AA 1U9OA 5FB2A 1JTYA 1USSA 3E5UA 1OCZH 3SXYA 3OYMA 3MWMA 1FNNA 4PZJA 4B8XA 3ML6A 1Z05A 2JVHA 2IVMA 3GLXA 4P5OA 1Y39A 4IHVA 1O3RA 2DODA 3K6GA 4HW0A 1IN6A 2KDZA 3RCOA 3WGIA 4MTDA 5M5XJ 4MEYF 4BE1A 2M7AA 4KICA 4LB5A 4V19K 2W7NA 4XLEA 1XSVA 3ZRGA 1RIOH 4FX4A 3BTCA 5D4SA 3LSRA 3AL0B 2ECCA 2M5WA 2ZBKA 2E1NA 1DU6A 3SQNA 1MNDA 2MLGA 1T33A 3ABMH 4ZC3A 4AU7A 1WJBA 3PSFA 1GVJA 1MDMA 4OIOF 1H9TA 2R5YB 4EJOA 2OUMA 1JHFA 2G7HA 2Q8KA 4PJLA 3HM5A 4IXAA 2F2EA 3IAS2 2M0MA 2B0LA 4LIUA 3HRTA 1MJAA 4HEA2 1ZG1A 2Y75A 4Q4ZF 3IWZA 3K69A 3UKGA 2VJ5A 3CMYA 1EH8A 2MFZA 2QENA 2A5WA 5K7FA 2E2HJ 1D8JA 3CF2A 4AWXB 1JKRC 3AL0C 4KYWA 2XSJC 1TLHB 2F48A 1K78B 3ELKA 3WU1B 2JUGA 2DFHA 2A05A 1FZPB 2XROA 1W1WE 2QVOA 1FOKA 1YI2I 4LIVA 1X1BA 1BBYA 3HL2A 3MQ0A 5H6RA 4JBAA 2LBFA 5J1RA 5K5QA 4AM3A 3I0TA 1MBEA 1HSTA 3CCUI 1BI1A 1FIPA 4S0HB 4RGXA 3LA3A 3J81K 1APLC 4BEHB 3K4NA 2E5NA 3SFIA 2AQFA 5J8CA 5K7HA 1B1BA 3M3YJ 5KHDA 4RS8A 5FLVA 2DPUA 3BTJA 3KYCB 1DGRM 5IOYA 3R61A 2NOJB 2R7QA 3E7LA 1TWGJ 3SZPA 1WJ5A 1WZ2A 2GBYA 2XV4S 2FJ1A 2HWVA 3TW7A 4C2UA 3OWTA 2HQRA 1D3YA 3HSRA 4ANJA 1R5ID 2HYFA 1XDSA 3E6CC 1YJ9I 4C3IJ 2PJPA 5TJJA 5DUIA 4AC0A 4RDUA 3L09A 3NWSA 4MNUA 2IW5A 4L9NA 4BBSJ 2WY7Q 3CCEI 2C6YA 2VL8A 2DDBA 3WG7H 1BOBA 3W6VA 3OIQA 2VIXA 2VXZA 2W57A 1KZHA 2BYVE 3OY9A 2OQRA 1MKMA 5JFRA 1A35A 2WBMA 2HPIA 2QA4I 3SZGA 2QKMB 2X4HA 1GV5A 1O7LA 3KPHA 5F0CA 3SYTA 3SFZA 1A5JA 1BIBA 1W7PB 1VQ6I 4Z2YA 2E7XA 2NS7A 2M4GA 1TT5B 5ICCA 3J7AO 4A5MA 1H88C 3PNTA 1K7AA 1YQAA 5D4RA 3ASNH 4LLGF 3LSKA 1GLNA 5E17F 2K86A 2HNHA 4DJAA 2LK2A 3ZQLA 2HYJA 3F6OA 3W3CA 2ZC2A 2WADA 1F5TA 1SFEA 3EQLF 2OD5A 2M1BA 3OV8A 3LA7A 5DEQA 2X6OA 1B8IA 2X1CA 3GEZA 1WCMJ 1XGNA 1X4OA 2COMA 2FEZA 2KHMA 3NAUA 4KJZA 5EYRA 2DT7B 4HNUA 4MGRA 4CXFA 2FQ3A 1BI3A 1LFUP 4MEXF 1WI3A 4NC8A 2DJIA 3CLOA 3KETA 1WJDA 2F4IA 4FE4A 4HLXA 2F5VA 1Y0UA 3KP2A 2BY1A 3VODA 2UUZA 2CS3A 4L9VA 1MD0A 2FU4A 5DCMB 4A6DA 2MD0A 4ENJA 3H1CA 2HR3A 2W4SA 2YS9A 3L2QA 4ZDOA 1LDDA 1TL8A 3LWFA 3HOVJ 2K5CA 3BJAA 2W48A 4PCQA 3ZMVA 3MKWB 3HHGA 2R7WA 1LUJB 3O6BB 4XKCA 1PUEE 1J7KA 4BY7J 1O4XA 3NQOA 1IRXA 1R5GA 2O0YA 3DKXA 5ILSA 2O3FA 1QZEA 4CZCA 5BOXA 1V5FA 3HSEA 3HTSB 4E7LA 5KAFC 2DN0A 1FTZA 4EM1A 3CDHA 4NUBA 4HLYA 1FYKA 2EV6A 3W2AA 3FXMA 4BKXA 2GOMA 3HRMA 1J09A 3T1BA 3CJTB 3KE2A 2GA1A 2Y31A 1QZYA 2H27A 3BCBA 4XMYA 3RKXA 4DQ2A 4XRFA 1SD4A 2HQ5A 4X6AJ 1RKWA 2RREA 1GDTA 2CQXA 2LKPA 3I54A 3MMYB 3CDLA 3QYBA 1OISA 1YOVB 2EZHA 4PJ0C 5JLWA 1O3SA 1RUOA 4C2TA 1U5TB 2D45A 1FMWA 1OCPA 3H9GA 4CCOA 4A6EA 4UNOA 3HYIA 2IRFG 3F8MA 5FD5A 4V2GA 4XN0A 2CSOA 1SFUA 2HQAA 1LEBA 2YSRA 3BP8A 4ZTJA 1Z7UA 3SZTA 4HX4A 1HDPA 4XBFA 1DP7P 3L1PA 2KRFA 2PJRB 2CW0F 1VNDA 3R0AA 3HHHA 3RYRA 3ZN1A 2L4MA 3MZHA 1YHQI 1P92A 3BY6A 4BHCA 3G1MA 4GCVA 1EF4A 1YX5A 4N4NB 5J1UA 1ORKA 3O8GA 4JX4A 2EJRA 2GXAA 2P0WA 2JMWA 4I09A 4RB1A 1WPKA 1R1UA 3IP4B 1CF7A 1U5TC 2G9WA 4XIDA 1LPQA 2LP0A 2W1OA 1T98A 1XB4A 4XM3A 2XDVA 1G59A 1E17A 3QU6A 1QVTA 5GAGJ 4LJZF 1Z77A 1WJEA 1KGSA 3X2QH 3AKZA 2XRNA 4A3CJ 4MFEA 4N9HA 1MZBA 1HCRA 3DPTA 4FISA 4RGUA 2R7VA 3DWLE 2R5ZB 4F93B 1X1DA 5DV5A 2D5VA 3GFMA 4HRIA 2DI3A 4PK4A 4ZJZA 1AA7A 4A3BJ 2FNPA 1R7JA 2QKLB 2IPQX 3GZ6A 2IA2A 4CA0A 3WHBA 2VE9A 1POGA 4PJJA 3QPHA 3FZVA 2DFEA 3W2VA 3A0HC 2Q1ZB 3DQVC 3KLNA 2HYGD 2WC2A 3HEFA 4A5NA 2X9DA 4U0WA 3FWEA 1WJCA 1AHDP 3ZMSA 4XLCA 1I6HJ 4IHWA 1OR7C 4II3A 2DA2A 1S6LA 3RJPA 1WH5A 1STZA 4HZFA 3J7YJ 1OQYA 5EDNA 2P4WA 2XRLA 2ETHA 2DPDA 3I53A 5CVVA 4U88A 2QQAA 4ENMA 1MIJA 1QGPA 1TQMA 1T39A 2KLOA 3IH2A 2F6CA 4YELA 5DTDA 3PQKA 1I50J 1GXQA 1Z6RA 1D1CA 1SVMA 2Y9YA 5HLTA 2EWNA 2V4JC 1G8XA 2M8GX 1FSHA 3PO3J 4EM2A 1K83J 1YS6A 3W2WA 3LAJA 3OL3A 4BHBA 2IGNA 3GZNB 1JT6A 3H36A 3CCLI 4NQWA 3OS1A 4NDLA 1IN4A 2LY2A 4BUPA 4XL9A 1WWXA 1MMAA 3K4KA 4BJ5C 1LFBA 2H8RA 4XSXF 4RM3A 5F6FA 3FXOA 1C0WA 2KT0A 5GP9A 2QM3A 3RTRA 1Z0XA 2VBXA 1XTAA 1BM9A 3JRAA 2PX9A 1N75A 1HQCA 1A6QA 2LVSA 5F08A 4YFKF 1WVRA 1MNMC 4D7NA 1XPXA 2VQGA 1G6NA 5EEGA 1W36C 1RRJA 1J5YA 3M8FA 4OOIA 3LA2A 2OCEA 3WU0A 5K5RA 1YW9A 4PGGA 2V79A 1H9GA 3E1SA 3JRCA 2JVGA 3OOUA 2IBDA 3E3VA 5EEHA 4A0YA 4Q48A 3FM5A 2IJLA 2E5ZA 1U2WA 2LNBA 4XLFA 3RSNA 1CQTA 2FE3A 2ISYA 3QOEA 4AIHA 3DPLC 5DM7F 3KP4A 3CCQI 1UHMA 4WK8F 1IXRC 1IRGA 3RZOJ 1FIAA 2Z99A 3HOZJ 1SFKA 1VQ8I 2TCTA 2JK3A 1XC5A 2V6EA 2ELKA 2NRAC 2QBYA 4FE7A 3F72A 4IRHA 4H4KC 3CC7I 4OIQF 2ZFWA 4L9JA 2Q2EB 2OF7A 2CGPA 5H6QA 5BMZA 2CJJA 1OYWA 2CV0A 2EFPA 1RI7A 2A5YB 4NC6A 3EYIA 3K2AA 4EQQA 2NVQJ 5J4VA 2KMUA 2VQLA 1MBKA 2BHZA 1X3UA 3DP7A 4EJUA 2BHYA 5CLSA 4MHGA 3CMAI 3PO2J 4HDVA 3TO6A 1P4AA 2M4KA 4XLNF 1LE8B 1NH3A 1SVOA 2IEKA 2MW8A 1YIJI 3OYLA 1D5VA 4MO7A 2MABA 3HRSA 3I3LA 4YFNF 3RI4A 2LTPA 2B7EA 2RKHA 3S16J 3I56I 1P9QC 4Z6YA 4HSTA 1TWFJ 3S93A 2HU9A 3HOUJ 1WJAA 3F9KA 3EUAA 4LB6B 2R4GA 2R7ZJ 3BR2A 4P1WA 5KAIC 4LG0A 3ZCOA 4XRMA 4ZH4F 2VXDA 5HDKA 3S8PA 4RB2C 1ETYA 4IO9F 5HLGA 3JTHA 1ZYRF 4JX5A 4M71A 1RR7A 2HGCA 2HXOA 3HJEA 4JYKA 3TDUC 3LSJA 3W6KB 3CUQA 3L2RA 2R92J 2PG4A 3JRFA 1K79A 1T95A 2KFDA 1JTXA 1WRJA 1ETVA 3BTLA 2ELJA 2X51A 2P5LC 1L0OC 2WV1A 4GGGA 1LDKB 2K27A 4DW6A 3KZZA 2VT2A 1VQ7I 3R0JA 4E7ZA 1YW8A 1X2MA 2XIGA 5L3GA 4E7JA 5EGOA 2VKVA 1ZRFA 1VFCA 4KITB 4S05A 2NYXA 3IAM2 1U0JA 1O57A 4EMSA 2JA5J 1G2HA 2OCCH 4WX9A 3DBHB 3JRHA 4BY1J 3DKWA 1TTYA 2DMUA 2HVQA 3LFKA 4M9XA 3A1YA 2STTA 2V6CA 2DO7A 5ICFA 3AFHA 4KDPA 4UXNA 2KIQA 5KNLA 5D5VB 3E6BA 3GFJA 3S17J 4XOPA 1IGNA 2ESNA 2PMUA 4DIQA 5CQEA 2NXNB 4E4HA 4E70A 1KU2A 5EF6A 5D5WB 3JRBA 2ZNYA 2FSWA 3QODA 1HBXG 1SD6A 3D5SC 3ZMTA 5LHIA 1FTTA 2ICWG 5J3LA 2HVSA 4M6VA 3GTLJ 5LHGA 2EINH 2CUEA 3GF2A 5KVRA 2PLYA 4L0YB 1MMGA 3RKYA 2XASA 3CMEI 3GTPJ 4KIBA 5JHFA 2K9MA 1X19A 4IOCF 3ROUA 3KEQA 3LQRA 2A6HF 2GAUA 2ZNZA 2HTJA 4PFOA 1OFCX 1X1AA 1GV2A 4H0EA 4KIFA 2VBYA 3E97A 5LGTA 2BGCA 1TWAJ 3F8NA 2LD5A 3LFUA 5GADJ 1KYWA 4DZPA 3OYIA 2VN2A 2B63J 4QPOA 3AG4H 1R1TA 2EFQA 2ZXHA 2VQHA 4UVBA 2EV0A 3Q0WA 3RKQA 5F1RA 4FASD 4R79A 4W97A 3EUHA 1IN5A 4BXFA 1S8NA 1I39A 2E2JJ 3FKJA 3K7AJ 4HSRA 4RA2A 1BN5A 2M0CA 1DUXC 1XG1A 4DBQA 3L2WA 1QNTA 4AVPA 2R7TA 2Y2ZA 2AXTC 3MKZA 1OYYA 1LDJA 3FM3A 5CYVA 2EIJH 2FBHA 3GCMA 3Q9SA 1BI0A 3O2PE 1SFXA 3BG5A 1JJ8C 4BQQA 3AG2H 3OYEA 3CCYA 3K70C 2CG4A 1X2NA 3K4LA 2A07F 1F1ZA 2JSCA 4MQVA 4UB8C 3DKYA 4A3KJ 5DUKA 1KU7A 1MGTA 3OL4A 1BA5A 3PL8A 5B3SH 3RPQA 2Q0OA 2P5KA 3BT9A 2WAFA 4LD5A 4CYCA 1KONA 1T0FC 2PMZA 3H0DA 2ELHA 3U1KA 2IS4A 1W5TA 4YIIA 3RPUA 4L0ZB 2JA2A 2DW4A 1HW5A 5DDGA 1R6RA 4UUVA 4QSHA 2ZJPF 1P7IA 5IP6A 4OU0A 2KQRA 5CVJA 4ZYAA 2HOSA 2TDXA 3TW6A 3JSOA 4ZDPA 5DCFA 3GTMJ 1EA3A 4PJMA 4D0PA 1H89C 3OOPA 3BG3A 2V9VA 3I4PA 4C3JJ 2VOOA 2K9QA 2L02A 3QPLA 3OSGA 3BOQA 5DYMA 4UY8I 2ISZA 2DOAA 1W5CC 5DM6F 2BW3A 2IP2A 1VI0A 2HQNA 2ZMEB 5FLMJ 1LKXA 2GIVA 3P5JA 2VPLA 2W25A 3C2GA 4Y33A 2KKOA 3CP2A 3VSLA 1OLTA 1HA8A 2HOAA 2Z33A 2LFBA 3HC7A 4P9UA 3DEEA 5A2QZ 1SD5A 3G4SI 2AXLA 2WTEA 3FXKA 2O7OA 4XQFA 4XLPF 2DMNA 3S3NA 2XF6A 3I5UA 2K02A 1I1SA 2DLLA 3BZKA 2V1XA 1LEAA 5L3FA 2R7XA 2P7CB 3O3KA 3S3OA 5KK1A 1TWHJ 3DEWA 2ZMEC 3LSTA 2EQRA 4M9ZA 2XAQA 2JA6J 2XKPA 2XPUA 2K40A 2W85A 5HODA 4I99C 4HYEA 1OCRH 3LSPA 2R7UA 3HTUA 3T5XA 2M3AA 3D0SA 2UXNA 3PNYA 4D7MA 3FMQA 1HSJA 1Z91A 3DCFA 4HV6A 5D6EA 3SHFA 2MLKA 4OIRF 2NAZA 3JTGA 5L3EA 3BTIA 4I6ZA 2BEOA 4UUTA 2XF7A 4A93J 4BXUA 4NNJA 2DXIA 3RQ4A 5EG0A 2A69F 3HUGB 4LOCA 3DLLF 1HOMA 1I3AA 4CICA 1HKQA 3F0CA 5M3FJ 2R7SA 5JR3A 3V7SA 1E3PA 2A3SA 2HKOA 2DU9A 4A0ZA 1X1PA 1SD7A 3CP8A 2XHKA 4V2FA 1YX3A 4BAYA 3REOA 1FC3A 1PP8F 1IG7A 2L9SA 3ECHA 5HS9A 2EA4A 2ZFUA 4IQJA 2NVYJ 1VQOI 2BBYA 2M9HA 2HEOA 4GO1A 1YIOA 2HTSA 2OPTA 4HBLA 2ME0A 1BW6A 3H5NA 1ZN2A 1SC7A 1VQPI 3KZYA 1OPCA 2JPCA 3DV8A 5IYBJ 2L54A 1KU9A 4EV0A 2QQ9A 1XMXA 2NVXJ 2EB7A 1FOWA 3CCVI 1RESA 4M9SA 2HDDA 2LG4A 4HV5A 3V4GA 2FOWA 4BQNA 3E0JB 1F43A 3CUOA 3K10A 2JT1A 5HS7A 1YITI 3JAMZ 3O8HA 1PUFB 2QSGX 3TO7A 4G6TB 2ZXWH 1IUFA 4A69C 1Z1DA 1XCVA 4AYBN 2O8XA 2WAQA 5FKKA 2ACJA 3GXOA 5LRRA 1VQ9I 2ZJRF 2EIMH 1P2FA 3BZCA 4HX7A 2L9RA 4HF1A 3DTKA 2ZJQF 1FJLA 4U0YA 3OR2C 2VC0A 1NK3P 1Y56A 1ZHFA 1IRFA 4WWCA 2XPVA 1WHUA 2XSDC 1MBJA 3MD2A 2R0QC 1QRYA 4IHXA 2PQ8A 4C30A 3VPRA 3J7AY 4MIMA 2VKHA 2K3PA 2XB0X 2HDWA 5J47A 3IC7A 1U8RA 3K4JA 4IKFA 2RNJA 3ZGKA 2F4MB 4GRIA 1SAUA 2K4BA 2QSFX 2VJJA 2X6XA 3FMRA 1ULYA 2E71A 1QHHD 5J40A 4QLCU 2Z1DA 2A6EF 4IRIA 2JUCA 3EUHC 4B1RA 4J00A 3QAHA 4B43A 2PI0A 2X1EA 3PJRA 3PSIA 3U1DA 5CVUA 3GTKJ 5D6FA 4I02A 1TQIA 4CO8A 1FOXA 1ZAOA 4M74A 4PFPA 4IHSA 2MG4A 3DEUA 2N8GA 4CCLA 3RYPA 4CCKA 1T38A 2E7WA 3A01A 2DA6A 4K2EA 1ETQA 2KJBA 4IL6C 3TL4X 2CUZA 3H3ZA 4J01A 2IA0A 3TGNA 2QQ8A 3QP6A 1UFMA 2QZ8A 2XKOA 3A4CA 2D1HA 3BWGA 1TW3A 3B73A 3TP0A 1RC9A 3PFYA 3ZQIA 4BL0B 5F1JA 5BQTA 1NG6A 2CWEA 2E34A 4OWRB 4HDUA 1MH4A 3CCJI 3GFLA 2L3DA 4PSWA 2CYYA 2AO9A 3IKTA 2NVUB 1A31A 1QPMA 1VQKI 3VYRB 4EJTA 1W4MA 2CQQA 2L7MP 1HKSA 3LQQA 2BXYA 5GPCA 4G7OF 4D9JA 1VTNC 1OCTC 4A3MJ 4P96A 2E1CA 2OA4A 3BROA 4O3MA 1D1BA 1UHSA 2BY2A 2M45A 2V9PA 1EKEA 3GTJJ 1MDMB 1E3HA 2MBFA 2P5VA 4Y13A 1BC8C 2FX0A 2DBBA 4UB6C 2LY1A 5IT3A 3CTAA 2CQNA 1Z7LA 3M7GA 2I5UA 3DLAA 3ONQA 2FBIA 2PFBA 1DPRA 2YPRA 5E79C 3CO7C 4BE0A 2KRHA 3QQAA 4F92B 1Y8RB 2KP6A 2FMYA 4LFUA 1FP1D 1J0RA 5F27A 4BQAA 4G7ZF 1B9NA 4M3DA 4EJWA 4B48A 2BV6A 2DMPA 2MC3A 2JN6A 4KFCA 1JI8A 1T2KA 2RNGA 1SFOJ 1MJ9A 3FK6A 3CC2I 4HA8A 2LBFB 1P6RA 1R4NB 3E6MA 4ETSA 4XNFA 1BIAA 2FQ4A 2RN7A 1G3YA 3FXLA 5EG0B 5LBQA 4BJTA 5LGUA 2CFOA 5ED4A 3FISA 3HGGA 4ENKA 3QP5A 2DT6A 2MSYA 4IRGA 3S1NJ 2H1LA 5DD8A 3BC8A 3I58A 4LK1F 3F23A 2FRHA 3S1QJ 1BJAA 4MQ9F 4YIFA 3R6SA 1OYIA 1XMKA 5L3DA 2CW7A 1B59A 3FIWA 3GO5A 3LSHA 3S32A 4L5IA 2Z2SB 4XKBA 3KP5A 1B72A 2R7OA 4HF0A 3CF5F 1LJ9A 3GX4X 4A2UA 2ID3A 2H8WA 3S1RJ 2I10A 4ASNA 1IV6A 5E3OA 3Q0UA 2QWWA 4RB3C 2IAIA 2PMZN 5FKNA 3ZQQA 2UXXA 4EJVA 4IHYA 3CMMA 4RGRA 2CUFA 4EGYA 3LMMA 2GM4A 4NBQA 2DMQA 5D5UB 1MMDA 4D5FA 3ABLH 4E7IA 2QUFA 3ZXSA 1ZGJA 3HOSA 1ZRDA 2EBIA 4BE2A 4IHTA 5C44J 2MC4A 4DYQA 2OU2A 4P55A 5J8FA 1F36A 4U7DA 2EFWA 4E7KA 2G7UA 2PMHA 2R7DA 3H92A 3GZ5A 3K4CA 4AIDA 1GXPA 1QQIA 3G2BA 1B8IB 3K70D 1R71A 3JW4A 3U2RA 4BH9A 3U9GA 1HW2A 3MKYB 1ZG3A 3CJRB 1VQNI 1RR8C 1D0XA 3ZQHA 2VI6A 4ON0A 4YG2F 3ZQCA 4BHPA 1VQMI 2EFOA 2XAGA 5GPAA 3IH4A 1B9MA 4LLLA 4UV8A 1LB2A 4OMZA 3AG3H 4RBOA 3P9CA 2Z9OA 4BS9A 3C3WA 1V5GA 2NNNA 3ZOBA 1FYMA 3ABTA 3KEOA 5FFZA 3MN2A 5HOOA 3OIPA 2O9LA 3KEYA 3BDDA 1G3WA 2QF7A 5FKMA 1H0MA 1Y8QB 2I8DA 2LF7A 2DYRH 5HDNA 3CCSI 1G3SA 1WQ2A 2RDPA 1TW2A 5JI6A 2L9NA 3WTSC 4ESBA 2OC6A 5FGMA 2H09A 1JJ6C 1HXDA 1AWCA 1H8AC 4GYIA 4PSXA 4LLNA 5LD2C 3OYBA 3P7NA 1S5LC 2DA4A 3JRDA 2JA8J 3ERMA 5CVIA 2ZO4A 2LSOA 4E7SA 2K3FA 1USTA 3KP6A 1FMVA 2DFFA 1AOYA 4AIJA 4NC7A 2D1VA 3RKWA 3VFZA 3ZPLA 4LITA 4CCNA 4HNVA 5FJ8J 1YRNA 2HDCA 4A3LJ 1D0ZA 4UUSA 2GLOA 1U6GA 4LMYA 4A3EJ 1IXSB 1P7JA 1WKMA 4R8HA 1R00A 2MH2A 2ZJ2A 3G1LA 3KLOA 1T56A 2LY9A 5D8KB 1Z9CA 4M3EA 3QYFA 5E3LA 5CKTA 4WXCA 2DA7A 3D5LA 4AYBA 2QQBA 2CMPA 3DU6A 3B02A 3GBGA 4JP0A 3L7WA 1TZLA 2EZLA 1TC3C 1ETOA 4ZYHA 4XORA 4A3FJ 1WSUA 4X1EA 2XGDA 1P4WA 1I6XA 1FOYA 4KA4A 2O61A 5E18F 1UB9A 1FBUA 2AHQA 2JRTA 2BE5F 1IRZA 1IO2A 2EFNA 3GVAA 4JQFA 5CJ9A 2HKXA 3Q3SA 2GQQA 2KISA 3JCUC 3TOBA 2FUG2 4JK1X 1CF7B 2E1MB 2YX4A 4XLAA 3M8JA 3FHNA 2QEXI 4M3FA 3IWFA 3S2WA 2MH9A 1ZARA 3LSIA 4DZJA 5EZGA 5DD4A 1Q1HA 1XN7A 3OMYA 2HFHA 2P6TA 1QPIA 5C4JJ 3ZR8X 2WAQN 3FF5A 1BL0A 4HX8A 5FLXZ 1MMNA 3VB2A 4O5VA 1I3QJ 3LOCA 1M1EB 2M34A 5LGNA 5LEJA 2E1MC 1DU0A 1XD7A 2JZYA 5ILVA 5IT9Z 2LYCA 5GAHJ 1Z6TA 3BPXA 2R5YA 1S7OA 4XRSA 1V55H 2XGEA 3QRFF 4Y17A 3L2VA 1U78A 1JXSA 1D1AA 3KX2A 2HOTA 2O8KA 1UZCA 2KZGA 4L5JA 3IHUA 4PJNA 2XB5A 5E8GA 2L9VA 1DGWY 1FX7A 3BCAA 2OTLI 4IQ4A 2OZUA 3LSGA 3WODF 5LLQA 1VZ0A 2L7KA 1B4AA 1K6YA 2HZDA 1K78A 3M4OJ 1FBSA 1REPC 3V42A 1UJ8A 2CFXA 4E7HA 3DF8A 2FNAA 4ZYDA 4GDFA 4LGWA 4G9YA 2XGXA 1S3JA 2HXIA 1TBXA 3TQNA 3CC4I 2MGQA 2E60A 3M8EA 1LNWA 3VYTB 3C7JA 3OYFA 1JUSA 5IY5H 3IH3A 2JJ7A 3H5AA 3T8RA 1YO5C 4BEHA 3KZIC 5FKLA 4XSZF 3FBNB 5H20A 1Z67A 4NQWB 1W7PD 1NHAA 1TQPA 1XSXA 1R36A 3HOXJ 4E6KG 2VQCA 1VQ4I 4HAMA 4BJ6C 3ZP5A 4ZYGA 4HPQA 4GYGA 2F5FA 4OIPF 1BR4A 4UVCA 3ZMZA 4Y7NJ 1FBQA 2Y0SA 5EEAA 1KQ0A 2VOPA 1IXCA 3CO6C 4UVAA 5CQGA 3FBIB 2K7LA 4WXHA 3G6EI 1X3WB 3UR3C 3F22A 4ZZDA 3FXRA 3BPVA 4KMUX 4KIGA 3J81Z 3MVPA 3HB9A 1MSFC 2CW8A 3DTIA 2Y69H 2BVLA 4N4OB 5M3MJ 2L0KA 3CLQA 1R22A 1W7PA 3K4BA 5JVTA 2IS6A 4M73A 1ENHA 1FY7A 2FXAA 3FXJA 3FXQA 2LC2A 2AS5F 4DOZA 4TV7A 1ZR4A 2COBA 4AD9A 4I2OA 3WGHA 1IV8A 2E19A 4I98B 5E1XA 2R7RA 2G0EA 2P7VB 3GUDA 1FP2A 1VQLI 3KCCA 4PDKA 1XCBA 5E3MA 2M87A 4XOTA 2QBYB 2WWYA 5CPRB 4AUXA 2GOXB 2HS5A 2VJIA 2NS0A 1ZH5A 3BJOA 3GFIA 4DYCA 4A12A 3T0YA 4IOAF 3S3MA 1LQ1A 1AU7A 3BR3A 3NEUA 5DCMA 1IN7A 1IN8A 1UG0A 3A02A 5E8IA 3NARA 1UELB 2FA5A 4RB0A 2DA3A 3EETA 1BW5A 4HQMA 3KP7A 3BG6A 1R9TJ 4XKVA 1S72I 2VT3A 4M6YA 4CYDA 2BY3A 5FD6A 3ZN0A 2PN6A 1HC8A 2RVCA 4EVIA 2GIZA 4RAYA 2VE8A 3DBLB 2ZKZA 3OSFA 1SVLA 2A68F 5FO5A 4II2A 2ZCWA 3PM1A 1P4XA 1IJWC 1MSEC 4QWQA 4ITVA 4B47A 3IL2A 4A0XA 2Z16A 3HOWJ 3Q5FA 4X0GA 1DP3A 1EH6A 2STWA 4CH7A 2LR8A 2WB1A 1O3QA 4LG0B 3H9JA 3PQJA 4IF4A 5HS8A 4XK4A 4HQEA 3I4MJ 5BNGA 3M07A 3FX3A 5B5EC 4CDGA 3L9FA 3IRQA 1V4RA 1XGOA 2ZXIA 3LSMA 1ZREA 4BNCA 1NK2P 3CUQB 3BLYA 3PUFA 4J19A 4UV9A 2UZKA 1U5TA 2F4OB 4P9FA 4XN3A 3KP3A 4A3IJ 2V1NA 1ON1A 5J4YA 4L18B 3B6AA 3U21A 4NHJA 3A2KA 1RPWA 2QCOA 1AKHA 4ABZA 4AVZA 2BXZA 2LREA 2P81A 1ZELA 2KIUA 1WJFA 3MFKA 2PJRA 5EGOB 3IV5A 5TISC 2B9SA 4U0VA 5IPAA 3KIOA 1T6SA 3PUBA 2DOFA 4IPAA 4KISA 3G71I 3DPUA 3TEDA 3MKLA 1IC8A 3SJMA 4FHTA 2Y48A 4GXOA 2CV1A 3CUQC 3ULQB 2VKDA 4B3AA 2FD5A 2KDOA 3BQYA 3ZQGA 3AAFA 2K9SA 2IXSA 3QWLA 5DS9A 4CCJA 2IGMA 1GVDA 2XAHA 5TGTA 5GAEJ 4YRVA 1R58A 4MTEA 3S1MJ 2LKSA 5GTHC 1XMAA 2GZWA 1A36A 2LDUA 1YG2A 3RIRA 2KPMA 3DU5A 4G6DA 3F8BA 2R5ZA 1JUPA 5E20A 1OR7A 2DA1A 4IX7A 1ACIA 1ETKA 2XAFA 1W0UA 5AIQA 2PBIA 2DK8A 5BPIA 3QU3A 3LNQA 5B66C 3BZ6A 2GXGA 1UAAA 4U7BA 1U8BA 2YU9J 3IRRA 4KNYA 2K85A 5FROA 2NOGA 2E1OA 2AQEA 5HLIA 3V8KA 1JGSA 3EDPA 3HXLA 4DBRA 3HKZA 4EGZA 1W36D 2CRGA 3KYDB 5IP9J 2ZSIB 9ANTA 2X6YA 1BOAA 3CZ6A 4ZZLA 1LFPA 3C18A 2WAEA 3ESWB 2L01A 5FRMA 4UHTA 3H35A 1Y1VJ 2HZTA 2Z5UA 1Z3XA 1EH7A 1S7EA 4F7ZA 1YFHA 2V1UA 2RQPA 1JKPC 4XONA 3F21A 1QA6A 4KT5C 4G8XA 4EM0B 1X4PA 1YYVA 2P8TA 2CQ7A 2YUSA 2P6SA 2CQKA 2O6GE 4U87A 1SMYF 2JSPA 1FPQA 1FSEA 2RV8A 3DTEA 4C3HJ 4F3QA 2DTRA 2XAUA 3LAPA 1SAXA 4F52A 5CVRA 2VBWA 4FX0A 3HG9A 3QPTA 2LH9A 1JKOC
chains in the Genus database with same CATH topology
1ZG5A 1B6AA 2ZXJA 1RNLA 4ENNA 3R4KA 1CGPA 4R1HA 4RGSA 4M72A 5HVQC 4YFXF 2O03A 3M1EA 2D2WA 1FT9A 1JE8A 3DXJF 5A2QK 1PP7U 2GWRA 1I1GA 2A61A 3TOAA 4Q47A 2Y0MA 3T8TA 5BPDA 5AONA 3F3XA 1OMIA 1BI2A 2ESHA 4L9TA 4ESJA 1HKTA 2JTVA 2GXBA 1FWZA 1J75A 4CGZA 4O6JA 4BYYA 2FOKA 3E5QA 1G3TA 1F9NA 4N0BA 5K5OA 2MD5A 2Q2EA 1BC7C 2DK5A 3KFWX 5FFXA 6PAXA 1JHHA 1UHWA 3VEPA 2OZ6A 2RGVA 3WTXC 1S29A 1ON2A 4G94A 3WTYC 1OKRA 2F5CA 2KIMA 3H3UA 2QLZA 1D8KA 3WTWC 5HLHA 1MJBA 3K1NA 1HW1A 5ILUA 2YU3A 1O7FA 2FMLA 4KUMA 1E2XA 2DAOA 4I01A 5F64A 3V8JA 3WTZA 4IJAA 1FLIA 1XDUA 2KIFA 3J80Z 3HRUA 1QBJA 2H6CA 3JAMK 3C1DA 1J59A 3MEXA 3ABUA 1I27A 3COAC 3I64A 2FF4A 2CO5A 1GHCA 3WGGA 1DPUA 5HDGA 3I71A 4G7HF 2M8EA 2DFIA 1ONVA 4I7HA 3TKYA 3MZYA 3ERED 3K0LA 1IW7F 1XGMA 2JPBA 3HIFA 3FHZA 1J2XA 2FBKA 2V1DA 3FXUA 4N9IA 4FT8A 3WTTC 3P9IA 1R1VA 2H94A 3L2CA 3G3ZA 5ICEA 3MCZA 5TRDA 3N97A 3K9TA 4KMFA 3ECOA 2R7FA 2DT5A 1KA8A 4Y15A 3CJNA 5LHHA 3GW2A 3WE3A 1RUNA 4HF2A 2ADUA 2YX7A 3I59A 4S04A 1IAWA 2HOEA 2J5OA 1T0FA 5L3BA 1F4KA 2XAJA 2EA2A 1ZGAA 3DFGA 3L00A 2XUBA 2YR2A 2K4JA 2Z3YA 2OAZA 4PGHA 4ESFA 2PEXA 5K1YA 4RAZA 1V3FA 2J5PA 3V7RA 3BJ6A 4LK0F 3F6VA 3WE2A 2F5EA 1TNTA 5D5XB 1ZRCA 3ZMDA 3NRVA 2VONA 3EYYA 3J80K 3TO9A 1W5SA 4WCGA 1G4DA 2OQGA 4IVNA 1PDNC 1EV7A 4OMYA 2VODA 1FYLA 3WTVC 2EV5A 3HSFA 3JSPA 2LF8A 2X0LA 2W84A 2DQRA 2M30A 2QYOA 1DDNA 1KYZA 1L3LA 2ZMEA 1XGSA 3IKVA 2DQLA 5ERIA 3FMSA 5AIPA 1I5ZA 3GYHX 1QZZA 1TNSA 2R3SA 1UCRA 3WTUC 2EK5A 1ZLJA 4WXDA 4WF2A 3ISPA 3R60A 1O3TA 3Q9VA 1YW7A 4DNCA 1SMTA 2MA3A 5LRSA 4CHUA 2H6BA 1U3EM 2RC4A 1IZ1A 5E1WA 1KQ9A 3TDZC 3HOTA 1A04A 1R5HA 4ZYEA 2GA2A 3ZMUA 4CZZA 2IT0A 3HUGA 5L3CA 5JHUA 2NNYA 3VOEA 2OBPA 5E1ZB 2F5DA 1YTYA 3K1PA 3G73A 4KN4X 3E6DA 3WG9A 3ZQ7A 5ICGA 3V7CA 5D8LB 4NB5A 3QOPA 3V8LA 4B09A 3RDIA 1KU3A 1ODDA 1IF1A 3GWZA 5LEKA 4KN7X 4I0AA 1QO0D 1ZLKA 5J6XA 3W6JB 4AIKA 1XSDA 4I0BA 2W24A 1YLFA 2VBZA 3I59B 3N4MA 1K6OA 1J9IA 1WI9A 4OINF 2IA1A 3F8CA 3K1MA 2XVCA 3PFIA 3E5XA 1LVAA 4M6XA 3MAJA 2VC1A 5BS6A 3K2ZA 1IUYA 1R23A 4HOBA 2KJCA 1RZ4A 2L4AA 2WV0A 4G6QA 5FLXK 1YS7A 3F8FA 4Q5SF 2UWMA 3P9KA 1S7AA 5IT9K 1KQ8A 3M9AA 5FB2A 1USSA 3E5UA 3SXYA 3MWMA 1FNNA 4PZJA 4B8XA 3ML6A 1Z05A 3GLXA 2IVMA 4P5OA 1O3RA 4HW0A 1IN6A 3WGIA 4MTDA 4MEYF 4KICA 4LB5A 1XSVA 1RIOH 4FX4A 5D4SA 2M5WA 2ZBKA 2E1NA 3SQNA 2MLGA 1GVJA 1MDMA 4OIOF 1H9TA 4EJOA 1JHFA 2G7HA 2Q8KA 4IXAA 2F2EA 2B0LA 3HRTA 1MJAA 1ZG1A 2Y75A 4Q4ZF 3IWZA 3K69A 1EH8A 1D8JA 2QENA 4AWXB 4KYWA 1TLHB 1K78B 3ELKA 3WU1B 1FZPB 2XROA 2QVOA 1FOKA 1BBYA 3MQ0A 5H6RA 4JBAA 5K5QA 3I0TA 1HSTA 1BI1A 4RGXA 3LA3A 3J81K 5J8CA 1B1BA 4RS8A 2DPUA 3R61A 3SZPA 2XV4S 2HWVA 2HQRA 1D3YA 3HSRA 2HYFA 1XDSA 3E6CC 2PJPA 5TJJA 5DUIA 3L09A 4MNUA 2IW5A 4L9NA 2C6YA 2VXZA 2W57A 2BYVE 2OQRA 1MKMA 5JFRA 2X4HA 1O7LA 3SFZA 1BIBA 1W7PB 4Z2YA 2E7XA 5ICCA 3J7AO 4A5MA 1K7AA 1YQAA 5D4RA 4LLGF 5E17F 2K86A 3F6OA 1F5TA 1SFEA 3EQLF 2OD5A 2M1BA 3OV8A 3LA7A 5DEQA 3GEZA 1XGNA 2COMA 2FEZA 4CXFA 4MGRA 2FQ3A 1BI3A 4MEXF 3CLOA 3KETA 4HLXA 1Y0UA 3KP2A 3VODA 4L9VA 5DCMB 4A6DA 1MD0A 2FU4A 4ENJA 2HR3A 1LDDA 3LWFA 3BJAA 4PCQA 3ZMVA 3HHGA 3O6BB 1PUEE 1J7KA 3NQOA 1R5GA 2O0YA 5ILSA 2O3FA 5BOXA 3HSEA 3HTSB 4EM1A 3CDHA 4HLYA 1FYKA 2EV6A 3HRMA 3T1BA 3KE2A 2GA1A 1QZYA 2H27A 3RKXA 4DQ2A 4XRFA 1SD4A 2LKPA 3I54A 1O3SA 1RUOA 1U5TB 2D45A 4A6EA 4UNOA 3HYIA 2IRFG 3F8MA 5FD5A 2CSOA 1SFUA 1LEBA 2YSRA 3BP8A 1Z7UA 3SZTA 4HX4A 4XBFA 1DP7P 2KRFA 2CW0F 3R0AA 3HHHA 3RYRA 3ZN1A 2L4MA 3MZHA 1P92A 3BY6A 4BHCA 4GCVA 2EJRA 4I09A 4RB1A 1R1UA 1CF7A 1U5TC 2G9WA 1T98A 1XB4A 1E17A 3QU6A 4LJZF 1KGSA 2XRNA 4N9HA 1MZBA 3DPTA 4RGUA 5DV5A 3GFMA 2DI3A 2FNPA 1R7JA 2IPQX 3GZ6A 2IA2A 2VE9A 3QPHA 3FZVA 3DQVC 3KLNA 2HYGD 2WC2A 4A5NA 4U0WA 3FWEA 3ZMSA 1S6LA 3RJPA 1STZA 4HZFA 2P4WA 2ETHA 2DPDA 3I53A 5CVVA 4U88A 2QQAA 4ENMA 1QGPA 1TQMA 1T39A 3PQKA 1GXQA 1Z6RA 2EWNA 1FSHA 4EM2A 1YS6A 3LAJA 4BHBA 4NQWA 1IN4A 1WWXA 4XSXF 5F6FA 1C0WA 2QM3A 3RTRA 2VBXA 1BM9A 1HQCA 4YFKF 1G6NA 5EEGA 1J5YA 3M8FA 4OOIA 3LA2A 3WU0A 5K5RA 1YW9A 4PGGA 2V79A 1H9GA 3E3VA 5EEHA 4A0YA 4Q48A 3FM5A 2IJLA 1U2WA 2LNBA 2FE3A 2ISYA 4AIHA 3DPLC 3KP4A 1UHMA 4WK8F 1IXRC 1IRGA 2Z99A 2NRAC 2QBYA 3F72A 4IRHA 4OIQF 2ZFWA 4L9JA 2CGPA 5H6QA 5BMZA 1OYWA 2EFPA 1RI7A 2A5YB 3EYIA 4EQQA 1X3UA 3DP7A 4EJUA 5CLSA 4MHGA 4HDVA 3TO6A 1P4AA 4XLNF 1D5VA 3HRSA 4YFNF 3RI4A 2RKHA 4LB6B 4LG0A 4ZH4F 5HDKA 4RB2C 5HLGA 3JTHA 1ZYRF 4M71A 2HGCA 3TDUC 3W6KB 3CUQA 2PG4A 1K79A 1WRJA 2P5LC 1L0OC 4GGGA 1LDKB 2K27A 3KZZA 2VT2A 3R0JA 1YW8A 2XIGA 5L3GA 1ZRFA 4S05A 2NYXA 1O57A 4EMSA 4WX9A 3DKWA 1TTYA 3LFKA 4M9XA 2STTA 2V6CA 2DO7A 5ICFA 4KDPA 4UXNA 5D5VB 3E6BA 3GFJA 2ESNA 2PMUA 4E70A 1KU2A 5D5WB 2ZNYA 2FSWA 1HBXG 1SD6A 3ZMTA 5LHIA 5LHGA 3GF2A 5KVRA 2PLYA 4L0YB 3RKYA 2XASA 4KIBA 3ROUA 3KEQA 3LQRA 2A6HF 2GAUA 2ZNZA 2HTJA 4H0EA 4KIFA 2VBYA 3E97A 5LGTA 2BGCA 3F8NA 1KYWA 2VN2A 1R1TA 2EFQA 4UVBA 2EV0A 5F1RA 4R79A 3EUHA 1IN5A 1S8NA 1BN5A 1DUXC 1QNTA 4AVPA 1OYYA 1LDJA 3FM3A 5CYVA 2FBHA 3Q9SA 1BI0A 3O2PE 1SFXA 2CG4A 2A07F 1F1ZA 2JSCA 4MQVA 5DUKA 1KU7A 1MGTA 3RPQA 2Q0OA 2P5KA 4LD5A 2ELHA 1W5TA 4YIIA 3RPUA 4L0ZB 2DW4A 1HW5A 5DDGA 4UUVA 4OU0A 5CVJA 2TDXA 3JSOA 5DCFA 4D0PA 3OOPA 2V9VA 3I4PA 2VOOA 2L02A 3BOQA 5DYMA 2ISZA 2IP2A 2HQNA 2ZMEB 2GIVA 2W25A 2KKOA 2Z33A 4P9UA 5A2QZ 1SD5A 2AXLA 2WTEA 4XLPF 3I5UA 2K02A 1I1SA 2DLLA 2V1XA 1LEAA 5L3FA 2P7CB 3O3KA 5KK1A 3LSTA 4M9ZA 2XAQA 2XKPA 2W85A 4HYEA 3HTUA 3T5XA 3D0SA 2UXNA 3FMQA 1HSJA 1Z91A 4HV6A 5D6EA 3SHFA 2MLKA 4OIRF 2NAZA 3JTGA 5L3EA 2BEOA 4BXUA 2A69F 4CICA 1HKQA 5JR3A 3V7SA 2A3SA 2HKOA 2DU9A 4A0ZA 1SD7A 2XHKA 4BAYA 3REOA 1FC3A 1PP8F 3ECHA 5HS9A 2EA4A 2BBYA 2HEOA 4GO1A 1YIOA 2HTSA 4HBLA 1ZN2A 3KZYA 1OPCA 2JPCA 3DV8A 4EV0A 2L54A 1KU9A 2QQ9A 2EB7A 4M9SA 4HV5A 3V4GA 3CUOA 2JT1A 5HS7A 3JAMZ 3TO7A 1Z1DA 1XCVA 2O8XA 2ACJA 3GXOA 5LRRA 1P2FA 4HX7A 4HF1A 4U0YA 2VC0A 1ZHFA 1IRFA 4WWCA 2PQ8A 3IC7A 1U8RA 2RNJA 2K4BA 3FMRA 1ULYA 4QLCU 2A6EF 4IRIA 3QAHA 2PI0A 3U1DA 5CVUA 5D6FA 4I02A 1TQIA 4CO8A 1ZAOA 4M74A 4IHSA 3DEUA 3RYPA 1T38A 2E7WA 4K2EA 2KJBA 3H3ZA 2IA0A 3TGNA 3QP6A 1UFMA 2QZ8A 2XKOA 2D1HA 3BWGA 1TW3A 3B73A 5BQTA 2CWEA 4HDUA 3GFLA 2L3DA 2CYYA 3IKTA 1QPMA 4EJTA 1W4MA 3LQQA 1HKSA 4G7OF 1VTNC 4P96A 2E1CA 2OA4A 3BROA 4O3MA 2M45A 1MDMB 2MBFA 2P5VA 4Y13A 1BC8C 2DBBA 5IT3A 3CTAA 3M7GA 2FBIA 2PFBA 1DPRA 2YPRA 3CO7C 4LFUA 2FMYA 1FP1D 1J0RA 4BQAA 4G7ZF 1B9NA 4EJWA 2BV6A 2MC3A 4KFCA 1T2KA 1MJ9A 4HA8A 1P6RA 3E6MA 4ETSA 1BIAA 2RN7A 1G3YA 5LBQA 5LGUA 5ED4A 4ENKA 3QP5A 4IRGA 5DD8A 3I58A 4LK1F 3F23A 2FRHA 1BJAA 4MQ9F 4YIFA 3R6SA 1OYIA 1XMKA 5L3DA 1B59A 3GO5A 4L5IA 3KP5A 4HF0A 1LJ9A 3GX4X 4A2UA 4ASNA 2QWWA 4RB3C 2UXXA 4EJVA 4EGYA 4RGRA 5D5UB 2QUFA 1ZGJA 3HOSA 1ZRDA 4IHTA 2OU2A 4P55A 5J8FA 4U7DA 2EFWA 2G7UA 2PMHA 2R7DA 3H92A 3GZ5A 1GXPA 1QQIA 3JW4A 3U2RA 4BH9A 3U9GA 1HW2A 1ZG3A 4ON0A 4YG2F 4BHPA 2EFOA 2XAGA 1B9MA 4LLLA 4UV8A 1LB2A 4OMZA 3P9CA 2Z9OA 3C3WA 2NNNA 1FYMA 3ABTA 3KEOA 5FFZA 5HOOA 3BDDA 1G3WA 1H0MA 2LF7A 5HDNA 1G3SA 1WQ2A 2RDPA 1TW2A 5JI6A 3WTSC 4ESBA 5FGMA 2H09A 1HXDA 1AWCA 4GYIA 4LLNA 3P7NA 5CVIA 2ZO4A 2LSOA 1USTA 3KP6A 1AOYA 4AIJA 2D1VA 3RKWA 3VFZA 3ZPLA 2HDCA 1U6GA 4LMYA 1IXSB 1WKMA 4R8HA 1R00A 2MH2A 2ZJ2A 3KLOA 5D8KB 1Z9CA 4WXCA 3D5LA 2QQBA 3B02A 3L7WA 4ZYHA 1WSUA 4KA4A 1P4WA 1I6XA 2O61A 5E18F 1UB9A 1FBUA 2JRTA 2BE5F 3GVAA 2EFNA 4JQFA 5CJ9A 2HKXA 2GQQA 3TOBA 4JK1X 1CF7B 2YX4A 3IWFA 3S2WA 2MH9A 1ZARA 5DD4A 1Q1HA 1XN7A 2HFHA 2P6TA 3FF5A 4HX8A 5FLXZ 3VB2A 4O5VA 5LGNA 5LEJA 1XD7A 2JZYA 5ILVA 5IT9Z 1Z6TA 3BPXA 1S7OA 3QRFF 4Y17A 1U78A 1JXSA 4L5JA 3IHUA 5E8GA 1FX7A 3WODF 2OZUA 5LLQA 1B4AA 1K78A 1FBSA 1REPC 2CFXA 3DF8A 2FNAA 4ZYDA 4LGWA 4G9YA 2XGXA 1S3JA 3TQNA 1TBXA 3M8EA 1LNWA 3C7JA 3T8RA 1YO5C 4XSZF 5H20A 1W7PD 1NHAA 1TQPA 1XSXA 1R36A 4HAMA 3ZP5A 4ZYGA 4GYGA 2F5FA 4OIPF 4UVCA 3ZMZA 1FBQA 1KQ0A 2VOPA 1IXCA 3CO6C 4UVAA 2K7LA 4WXHA 3F22A 4ZZDA 3FXRA 3BPVA 4KMUX 4KIGA 3J81Z 1R22A 1W7PA 5JVTA 4M73A 1FY7A 2FXAA 3FXQA 2AS5F 4TV7A 4AD9A 4I2OA 3WGHA 4I98B 5E1XA 2P7VB 3GUDA 1FP2A 3KCCA 4PDKA 1XCBA 2M87A 2QBYB 2WWYA 2HS5A 2NS0A 1ZH5A 3BJOA 3GFIA 4A12A 3T0YA 1LQ1A 3NEUA 5DCMA 1IN7A 1IN8A 5E8IA 2FA5A 4RB0A 3EETA 4HQMA 3KP7A 2VT3A 4M6YA 4CYDA 5FD6A 3ZN0A 2PN6A 2RVCA 4EVIA 4RAYA 2VE8A 2ZKZA 2A68F 5FO5A 2ZCWA 1P4XA 4QWQA 3IL2A 4A0XA 3Q5FA 1EH6A 2STWA 1O3QA 4LG0B 5HS8A 4IF4A 3PQJA 4HQEA 3FX3A 4CDGA 3L9FA 3IRQA 1V4RA 1XGOA 1ZREA 4BNCA 3CUQB 4UV9A 2UZKA 1U5TA 4P9FA 3KP3A 1ON1A 4L18B 4NHJA 2KIUA 3MFKA 4U0VA 1T6SA 4IPAA 4FHTA 2Y48A 4GXOA 3CUQC 3ULQB 3AAFA 2XAHA 1R58A 4MTEA 1XMAA 2GZWA 2LDUA 1YG2A 3RIRA 4G6DA 3F8BA 5E20A 1OR7A 2XAFA 5AIQA 2PBIA 2DK8A 5BPIA 3QU3A 3BZ6A 2GXGA 4U7BA 3IRRA 4KNYA 5HLIA 3V8KA 1JGSA 3EDPA 4EGZA 1BOAA 4ZZLA 3C18A 2L01A 4UHTA 2HZTA 2Z5UA 1EH7A 1YFHA 4F7ZA 2V1UA 2RQPA 3F21A 4KT5C 4G8XA 4EM0B 1YYVA 2P8TA 2P6SA 2CQKA 2O6GE 1SMYF 1FPQA 1FSEA 2RV8A 1SAXA 3LAPA 2DTRA 5CVRA 2VBWA 4FX0A 3QPTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZG5 A;  1B6A A;  2ZXJ A;  1RNL A;  4ENN A;  3R4K A;  1CGP A;  4R1H A;  4RGS A;  4M72 A;  5HVQ C;  4YFX F;  2O03 A;  3M1E A;  2D2W A;  1FT9 A;  1JE8 A;  3DXJ F;  5A2Q K;  1PP7 U;  2GWR A;  1I1G A;  2A61 A;  3TOA A;  4Q47 A;  2Y0M A;  3T8T A;  5BPD A;  5AON A;  3F3X A;  1OMI A;  1BI2 A;  2ESH A;  4L9T A;  4ESJ A;  1HKT A;  2JTV A;  2GXB A;  1FWZ A;  1J75 A;  4CGZ A;  4O6J A;  4BYY A;  2FOK A;  3E5Q A;  1G3T A;  1F9N A;  4N0B A;  5K5O A;  2MD5 A;  2Q2E A;  1BC7 C;  2DK5 A;  3KFW X;  5FFX A;  6PAX A;  1JHH A;  1UHW A;  3VEP A;  2OZ6 A;  2RGV A;  3WTX C;  1S29 A;  1ON2 A;  4G94 A;  3WTY C;  1OKR A;  2F5C A;  2KIM A;  3H3U A;  2QLZ A;  1D8K A;  3WTW C;  5HLH A;  1MJB A;  3K1N A;  1HW1 A;  5ILU A;  2YU3 A;  1O7F A;  2FML A;  4KUM A;  1E2X A;  2DAO A;  4I01 A;  5F64 A;  3V8J A;  3WTZ A;  4IJA A;  1FLI A;  1XDU A;  2KIF A;  3J80 Z;  3HRU A;  1QBJ A;  2H6C A;  3JAM K;  3C1D A;  1J59 A;  3MEX A;  3ABU A;  1I27 A;  3COA C;  3I64 A;  2FF4 A;  2CO5 A;  1GHC A;  3WGG A;  1DPU A;  5HDG A;  3I71 A;  4G7H F;  2M8E A;  2DFI A;  1ONV A;  4I7H A;  3TKY A;  3MZY A;  3ERE D;  3K0L A;  1IW7 F;  1XGM A;  2JPB A;  3HIF A;  3FHZ A;  1J2X A;  2FBK A;  2V1D A;  3FXU A;  4N9I A;  4FT8 A;  3WTT C;  3P9I A;  1R1V A;  2H94 A;  3L2C A;  3G3Z A;  5ICE A;  3MCZ A;  5TRD A;  3N97 A;  3K9T A;  4KMF A;  3ECO A;  2R7F A;  2DT5 A;  1KA8 A;  4Y15 A;  3CJN A;  5LHH A;  3GW2 A;  3WE3 A;  1RUN A;  4HF2 A;  2ADU A;  2YX7 A;  3I59 A;  4S04 A;  1IAW A;  2HOE A;  2J5O A;  1T0F A;  5L3B A;  1F4K A;  2XAJ A;  2EA2 A;  1ZGA A;  3DFG A;  3L00 A;  2XUB A;  2YR2 A;  2K4J A;  2Z3Y A;  2OAZ A;  4PGH A;  4ESF A;  2PEX A;  5K1Y A;  4RAZ A;  1V3F A;  2J5P A;  3V7R A;  3BJ6 A;  4LK0 F;  3F6V A;  3WE2 A;  2F5E A;  1TNT A;  5D5X B;  1ZRC A;  3ZMD A;  3NRV A;  2VON A;  3EYY A;  3J80 K;  3TO9 A;  1W5S A;  4WCG A;  1G4D A;  2OQG A;  4IVN A;  1PDN C;  1EV7 A;  4OMY A;  2VOD A;  1FYL A;  3WTV C;  2EV5 A;  3HSF A;  3JSP A;  2LF8 A;  2X0L A;  2W84 A;  2DQR A;  2M30 A;  2QYO A;  1DDN A;  1KYZ A;  1L3L A;  2ZME A;  1XGS A;  3IKV A;  2DQL A;  5ERI A;  3FMS A;  5AIP A;  1I5Z A;  3GYH X;  1QZZ A;  1TNS A;  2R3S A;  1UCR A;  3WTU C;  2EK5 A;  1ZLJ A;  4WXD A;  4WF2 A;  3ISP A;  3R60 A;  1O3T A;  3Q9V A;  1YW7 A;  4DNC A;  1SMT A;  2MA3 A;  5LRS A;  4CHU A;  2H6B A;  1U3E M;  2RC4 A;  1IZ1 A;  5E1W A;  1KQ9 A;  3TDZ C;  3HOT A;  1A04 A;  1R5H A;  4ZYE A;  2GA2 A;  3ZMU A;  4CZZ A;  2IT0 A;  3HUG A;  5L3C A;  5JHU A;  2NNY A;  3VOE A;  2OBP A;  5E1Z B;  2F5D A;  1YTY A;  3K1P A;  3G73 A;  4KN4 X;  3E6D A;  3WG9 A;  3ZQ7 A;  5ICG A;  3V7C A;  5D8L B;  4NB5 A;  3QOP A;  3V8L A;  4B09 A;  3RDI A;  1KU3 A;  1ODD A;  1IF1 A;  3GWZ A;  5LEK A;  4KN7 X;  4I0A A;  1QO0 D;  1ZLK A;  5J6X A;  3W6J B;  4AIK A;  1XSD A;  4I0B A;  2W24 A;  1YLF A;  2VBZ A;  3I59 B;  3N4M A;  1K6O A;  1J9I A;  1WI9 A;  4OIN F;  2IA1 A;  3F8C A;  3K1M A;  2XVC A;  3PFI A;  3E5X A;  1LVA A;  4M6X A;  3MAJ A;  2VC1 A;  5BS6 A;  3K2Z A;  1IUY A;  1R23 A;  4HOB A;  2KJC A;  1RZ4 A;  2L4A A;  2WV0 A;  4G6Q A;  5FLX K;  1YS7 A;  3F8F A;  4Q5S F;  2UWM A;  3P9K A;  1S7A A;  5IT9 K;  1KQ8 A;  3M9A A;  5FB2 A;  1USS A;  3E5U A;  3SXY A;  3MWM A;  1FNN A;  4PZJ A;  4B8X A;  3ML6 A;  1Z05 A;  3GLX A;  2IVM A;  4P5O A;  1O3R A;  4HW0 A;  1IN6 A;  3WGI A;  4MTD A;  4MEY F;  4KIC A;  4LB5 A;  1XSV A;  1RIO H;  4FX4 A;  5D4S A;  2M5W A;  2ZBK A;  2E1N A;  3SQN A;  2MLG A;  1GVJ A;  1MDM A;  4OIO F;  1H9T A;  4EJO A;  1JHF A;  2G7H A;  2Q8K A;  4IXA A;  2F2E A;  2B0L A;  3HRT A;  1MJA A;  1ZG1 A;  2Y75 A;  4Q4Z F;  3IWZ A;  3K69 A;  1EH8 A;  1D8J A;  2QEN A;  4AWX B;  4KYW A;  1TLH B;  1K78 B;  3ELK A;  3WU1 B;  1FZP B;  2XRO A;  2QVO A;  1FOK A;  1BBY A;  3MQ0 A;  5H6R A;  4JBA A;  5K5Q A;  3I0T A;  1HST A;  1BI1 A;  4RGX A;  3LA3 A;  3J81 K;  5J8C A;  1B1B A;  4RS8 A;  2DPU A;  3R61 A;  3SZP A;  2XV4 S;  2HWV A;  2HQR A;  1D3Y A;  3HSR A;  2HYF A;  1XDS A;  3E6C C;  2PJP A;  5TJJ A;  5DUI A;  3L09 A;  4MNU A;  2IW5 A;  4L9N A;  2C6Y A;  2VXZ A;  2W57 A;  2BYV E;  2OQR A;  1MKM A;  5JFR A;  2X4H A;  1O7L A;  3SFZ A;  1BIB A;  1W7P B;  4Z2Y A;  2E7X A;  5ICC A;  3J7A O;  4A5M A;  1K7A A;  1YQA A;  5D4R A;  4LLG F;  5E17 F;  2K86 A;  3F6O A;  1F5T A;  1SFE A;  3EQL F;  2OD5 A;  2M1B A;  3OV8 A;  3LA7 A;  5DEQ A;  3GEZ A;  1XGN A;  2COM A;  2FEZ A;  4CXF A;  4MGR A;  2FQ3 A;  1BI3 A;  4MEX F;  3CLO A;  3KET A;  4HLX A;  1Y0U A;  3KP2 A;  3VOD A;  4L9V A;  5DCM B;  4A6D A;  1MD0 A;  2FU4 A;  4ENJ A;  2HR3 A;  1LDD A;  3LWF A;  3BJA A;  4PCQ A;  3ZMV A;  3HHG A;  3O6B B;  1PUE E;  1J7K A;  3NQO A;  1R5G A;  2O0Y A;  5ILS A;  2O3F A;  5BOX A;  3HSE A;  3HTS B;  4EM1 A;  3CDH A;  4HLY A;  1FYK A;  2EV6 A;  3HRM A;  3T1B A;  3KE2 A;  2GA1 A;  1QZY A;  2H27 A;  3RKX A;  4DQ2 A;  4XRF A;  1SD4 A;  2LKP A;  3I54 A;  1O3S A;  1RUO A;  1U5T B;  2D45 A;  4A6E A;  4UNO A;  3HYI A;  2IRF G;  3F8M A;  5FD5 A;  2CSO A;  1SFU A;  1LEB A;  2YSR A;  3BP8 A;  1Z7U A;  3SZT A;  4HX4 A;  4XBF A;  1DP7 P;  2KRF A;  2CW0 F;  3R0A A;  3HHH A;  3RYR A;  3ZN1 A;  2L4M A;  3MZH A;  1P92 A;  3BY6 A;  4BHC A;  4GCV A;  2EJR A;  4I09 A;  4RB1 A;  1R1U A;  1CF7 A;  1U5T C;  2G9W A;  1T98 A;  1XB4 A;  1E17 A;  3QU6 A;  4LJZ F;  1KGS A;  2XRN A;  4N9H A;  1MZB A;  3DPT A;  4RGU A;  5DV5 A;  3GFM A;  2DI3 A;  2FNP A;  1R7J A;  2IPQ X;  3GZ6 A;  2IA2 A;  2VE9 A;  3QPH A;  3FZV A;  3DQV C;  3KLN A;  2HYG D;  2WC2 A;  4A5N A;  4U0W A;  3FWE A;  3ZMS A;  1S6L A;  3RJP A;  1STZ A;  4HZF A;  2P4W A;  2ETH A;  2DPD A;  3I53 A;  5CVV A;  4U88 A;  2QQA A;  4ENM A;  1QGP A;  1TQM A;  1T39 A;  3PQK A;  1GXQ A;  1Z6R A;  2EWN A;  1FSH A;  4EM2 A;  1YS6 A;  3LAJ A;  4BHB A;  4NQW A;  1IN4 A;  1WWX A;  4XSX F;  5F6F A;  1C0W A;  2QM3 A;  3RTR A;  2VBX A;  1BM9 A;  1HQC A;  4YFK F;  1G6N A;  5EEG A;  1J5Y A;  3M8F A;  4OOI A;  3LA2 A;  3WU0 A;  5K5R A;  1YW9 A;  4PGG A;  2V79 A;  1H9G A;  3E3V A;  5EEH A;  4A0Y A;  4Q48 A;  3FM5 A;  2IJL A;  1U2W A;  2LNB A;  2FE3 A;  2ISY A;  4AIH A;  3DPL C;  3KP4 A;  1UHM A;  4WK8 F;  1IXR C;  1IRG A;  2Z99 A;  2NRA C;  2QBY A;  3F72 A;  4IRH A;  4OIQ F;  2ZFW A;  4L9J A;  2CGP A;  5H6Q A;  5BMZ A;  1OYW A;  2EFP A;  1RI7 A;  2A5Y B;  3EYI A;  4EQQ A;  1X3U A;  3DP7 A;  4EJU A;  5CLS A;  4MHG A;  4HDV A;  3TO6 A;  1P4A A;  4XLN F;  1D5V A;  3HRS A;  4YFN F;  3RI4 A;  2RKH A;  4LB6 B;  4LG0 A;  4ZH4 F;  5HDK A;  4RB2 C;  5HLG A;  3JTH A;  1ZYR F;  4M71 A;  2HGC A;  3TDU C;  3W6K B;  3CUQ A;  2PG4 A;  1K79 A;  1WRJ A;  2P5L C;  1L0O C;  4GGG A;  1LDK B;  2K27 A;  3KZZ A;  2VT2 A;  3R0J A;  1YW8 A;  2XIG A;  5L3G A;  1ZRF A;  4S05 A;  2NYX A;  1O57 A;  4EMS A;  4WX9 A;  3DKW A;  1TTY A;  3LFK A;  4M9X A;  2STT A;  2V6C A;  2DO7 A;  5ICF A;  4KDP A;  4UXN A;  5D5V B;  3E6B A;  3GFJ A;  2ESN A;  2PMU A;  4E70 A;  1KU2 A;  5D5W B;  2ZNY A;  2FSW A;  1HBX G;  1SD6 A;  3ZMT A;  5LHI A;  5LHG A;  3GF2 A;  5KVR A;  2PLY A;  4L0Y B;  3RKY A;  2XAS A;  4KIB A;  3ROU A;  3KEQ A;  3LQR A;  2A6H F;  2GAU A;  2ZNZ A;  2HTJ A;  4H0E A;  4KIF A;  2VBY A;  3E97 A;  5LGT A;  2BGC A;  3F8N A;  1KYW A;  2VN2 A;  1R1T A;  2EFQ A;  4UVB A;  2EV0 A;  5F1R A;  4R79 A;  3EUH A;  1IN5 A;  1S8N A;  1BN5 A;  1DUX C;  1QNT A;  4AVP A;  1OYY A;  1LDJ A;  3FM3 A;  5CYV A;  2FBH A;  3Q9S A;  1BI0 A;  3O2P E;  1SFX A;  2CG4 A;  2A07 F;  1F1Z A;  2JSC A;  4MQV A;  5DUK A;  1KU7 A;  1MGT A;  3RPQ A;  2Q0O A;  2P5K A;  4LD5 A;  2ELH A;  1W5T A;  4YII A;  3RPU A;  4L0Z B;  2DW4 A;  1HW5 A;  5DDG A;  4UUV A;  4OU0 A;  5CVJ A;  2TDX A;  3JSO A;  5DCF A;  4D0P A;  3OOP A;  2V9V A;  3I4P A;  2VOO A;  2L02 A;  3BOQ A;  5DYM A;  2ISZ A;  2IP2 A;  2HQN A;  2ZME B;  2GIV A;  2W25 A;  2KKO A;  2Z33 A;  4P9U A;  5A2Q Z;  1SD5 A;  2AXL A;  2WTE A;  4XLP F;  3I5U A;  2K02 A;  1I1S A;  2DLL A;  2V1X A;  1LEA A;  5L3F A;  2P7C B;  3O3K A;  5KK1 A;  3LST A;  4M9Z A;  2XAQ A;  2XKP A;  2W85 A;  4HYE A;  3HTU A;  3T5X A;  3D0S A;  2UXN A;  3FMQ A;  1HSJ A;  1Z91 A;  4HV6 A;  5D6E A;  3SHF A;  2MLK A;  4OIR F;  2NAZ A;  3JTG A;  5L3E A;  2BEO A;  4BXU A;  2A69 F;  4CIC A;  1HKQ A;  5JR3 A;  3V7S A;  2A3S A;  2HKO A;  2DU9 A;  4A0Z A;  1SD7 A;  2XHK A;  4BAY A;  3REO A;  1FC3 A;  1PP8 F;  3ECH A;  5HS9 A;  2EA4 A;  2BBY A;  2HEO A;  4GO1 A;  1YIO A;  2HTS A;  4HBL A;  1ZN2 A;  3KZY A;  1OPC A;  2JPC A;  3DV8 A;  4EV0 A;  2L54 A;  1KU9 A;  2QQ9 A;  2EB7 A;  4M9S A;  4HV5 A;  3V4G A;  3CUO A;  2JT1 A;  5HS7 A;  3JAM Z;  3TO7 A;  1Z1D A;  1XCV A;  2O8X A;  2ACJ A;  3GXO A;  5LRR A;  1P2F A;  4HX7 A;  4HF1 A;  4U0Y A;  2VC0 A;  1ZHF A;  1IRF A;  4WWC A;  2PQ8 A;  3IC7 A;  1U8R A;  2RNJ A;  2K4B A;  3FMR A;  1ULY A;  4QLC U;  2A6E F;  4IRI A;  3QAH A;  2PI0 A;  3U1D A;  5CVU A;  5D6F A;  4I02 A;  1TQI A;  4CO8 A;  1ZAO A;  4M74 A;  4IHS A;  3DEU A;  3RYP A;  1T38 A;  2E7W A;  4K2E A;  2KJB A;  3H3Z A;  2IA0 A;  3TGN A;  3QP6 A;  1UFM A;  2QZ8 A;  2XKO A;  2D1H A;  3BWG A;  1TW3 A;  3B73 A;  5BQT A;  2CWE A;  4HDU A;  3GFL A;  2L3D A;  2CYY A;  3IKT A;  1QPM A;  4EJT A;  1W4M A;  3LQQ A;  1HKS A;  4G7O F;  1VTN C;  4P96 A;  2E1C A;  2OA4 A;  3BRO A;  4O3M A;  2M45 A;  1MDM B;  2MBF A;  2P5V A;  4Y13 A;  1BC8 C;  2DBB A;  5IT3 A;  3CTA A;  3M7G A;  2FBI A;  2PFB A;  1DPR A;  2YPR A;  3CO7 C;  4LFU A;  2FMY A;  1FP1 D;  1J0R A;  4BQA A;  4G7Z F;  1B9N A;  4EJW A;  2BV6 A;  2MC3 A;  4KFC A;  1T2K A;  1MJ9 A;  4HA8 A;  1P6R A;  3E6M A;  4ETS A;  1BIA A;  2RN7 A;  1G3Y A;  5LBQ A;  5LGU A;  5ED4 A;  4ENK A;  3QP5 A;  4IRG A;  5DD8 A;  3I58 A;  4LK1 F;  3F23 A;  2FRH A;  1BJA A;  4MQ9 F;  4YIF A;  3R6S A;  1OYI A;  1XMK A;  5L3D A;  1B59 A;  3GO5 A;  4L5I A;  3KP5 A;  4HF0 A;  1LJ9 A;  3GX4 X;  4A2U A;  4ASN A;  2QWW A;  4RB3 C;  2UXX A;  4EJV A;  4EGY A;  4RGR A;  5D5U B;  2QUF A;  1ZGJ A;  3HOS A;  1ZRD A;  4IHT A;  2OU2 A;  4P55 A;  5J8F A;  4U7D A;  2EFW A;  2G7U A;  2PMH A;  2R7D A;  3H92 A;  3GZ5 A;  1GXP A;  1QQI A;  3JW4 A;  3U2R A;  4BH9 A;  3U9G A;  1HW2 A;  1ZG3 A;  4ON0 A;  4YG2 F;  4BHP A;  2EFO A;  2XAG A;  1B9M A;  4LLL A;  4UV8 A;  1LB2 A;  4OMZ A;  3P9C A;  2Z9O A;  3C3W A;  2NNN A;  1FYM A;  3ABT A;  3KEO A;  5FFZ A;  5HOO A;  3BDD A;  1G3W A;  1H0M A;  2LF7 A;  5HDN A;  1G3S A;  1WQ2 A;  2RDP A;  1TW2 A;  5JI6 A;  3WTS C;  4ESB A;  5FGM A;  2H09 A;  1HXD A;  1AWC A;  4GYI A;  4LLN A;  3P7N A;  5CVI A;  2ZO4 A;  2LSO A;  1UST A;  3KP6 A;  1AOY A;  4AIJ A;  2D1V A;  3RKW A;  3VFZ A;  3ZPL A;  2HDC A;  1U6G A;  4LMY A;  1IXS B;  1WKM A;  4R8H A;  1R00 A;  2MH2 A;  2ZJ2 A;  3KLO A;  5D8K B;  1Z9C A;  4WXC A;  3D5L A;  2QQB A;  3B02 A;  3L7W A;  4ZYH A;  1WSU A;  4KA4 A;  1P4W A;  1I6X A;  2O61 A;  5E18 F;  1UB9 A;  1FBU A;  2JRT A;  2BE5 F;  3GVA A;  2EFN A;  4JQF A;  5CJ9 A;  2HKX A;  2GQQ A;  3TOB A;  4JK1 X;  1CF7 B;  2YX4 A;  3IWF A;  3S2W A;  2MH9 A;  1ZAR A;  5DD4 A;  1Q1H A;  1XN7 A;  2HFH A;  2P6T A;  3FF5 A;  4HX8 A;  5FLX Z;  3VB2 A;  4O5V A;  5LGN A;  5LEJ A;  1XD7 A;  2JZY A;  5ILV A;  5IT9 Z;  1Z6T A;  3BPX A;  1S7O A;  3QRF F;  4Y17 A;  1U78 A;  1JXS A;  4L5J A;  3IHU A;  5E8G A;  1FX7 A;  3WOD F;  2OZU A;  5LLQ A;  1B4A A;  1K78 A;  1FBS A;  1REP C;  2CFX A;  3DF8 A;  2FNA A;  4ZYD A;  4LGW A;  4G9Y A;  2XGX A;  1S3J A;  3TQN A;  1TBX A;  3M8E A;  1LNW A;  3C7J A;  3T8R A;  1YO5 C;  4XSZ F;  5H20 A;  1W7P D;  1NHA A;  1TQP A;  1XSX A;  1R36 A;  4HAM A;  3ZP5 A;  4ZYG A;  4GYG A;  2F5F A;  4OIP F;  4UVC A;  3ZMZ A;  1FBQ A;  1KQ0 A;  2VOP A;  1IXC A;  3CO6 C;  4UVA A;  2K7L A;  4WXH A;  3F22 A;  4ZZD A;  3FXR A;  3BPV A;  4KMU X;  4KIG A;  3J81 Z;  1R22 A;  1W7P A;  5JVT A;  4M73 A;  1FY7 A;  2FXA A;  3FXQ A;  2AS5 F;  4TV7 A;  4AD9 A;  4I2O A;  3WGH A;  4I98 B;  5E1X A;  2P7V B;  3GUD A;  1FP2 A;  3KCC A;  4PDK A;  1XCB A;  2M87 A;  2QBY B;  2WWY A;  2HS5 A;  2NS0 A;  1ZH5 A;  3BJO A;  3GFI A;  4A12 A;  3T0Y A;  1LQ1 A;  3NEU A;  5DCM A;  1IN7 A;  1IN8 A;  5E8I A;  2FA5 A;  4RB0 A;  3EET A;  4HQM A;  3KP7 A;  2VT3 A;  4M6Y A;  4CYD A;  5FD6 A;  3ZN0 A;  2PN6 A;  2RVC A;  4EVI A;  4RAY A;  2VE8 A;  2ZKZ A;  2A68 F;  5FO5 A;  2ZCW A;  1P4X A;  4QWQ A;  3IL2 A;  4A0X A;  3Q5F A;  1EH6 A;  2STW A;  1O3Q A;  4LG0 B;  5HS8 A;  4IF4 A;  3PQJ A;  4HQE A;  3FX3 A;  4CDG A;  3L9F A;  3IRQ A;  1V4R A;  1XGO A;  1ZRE A;  4BNC A;  3CUQ B;  4UV9 A;  2UZK A;  1U5T A;  4P9F A;  3KP3 A;  1ON1 A;  4L18 B;  4NHJ A;  2KIU A;  3MFK A;  4U0V A;  1T6S A;  4IPA A;  4FHT A;  2Y48 A;  4GXO A;  3CUQ C;  3ULQ B;  3AAF A;  2XAH A;  1R58 A;  4MTE A;  1XMA A;  2GZW A;  2LDU A;  1YG2 A;  3RIR A;  4G6D A;  3F8B A;  5E20 A;  1OR7 A;  2XAF A;  5AIQ A;  2PBI A;  2DK8 A;  5BPI A;  3QU3 A;  3BZ6 A;  2GXG A;  4U7B A;  3IRR A;  4KNY A;  5HLI A;  3V8K A;  1JGS A;  3EDP A;  4EGZ A;  1BOA A;  4ZZL A;  3C18 A;  2L01 A;  4UHT A;  2HZT A;  2Z5U A;  1EH7 A;  1YFH A;  4F7Z A;  2V1U A;  2RQP A;  3F21 A;  4KT5 C;  4G8X A;  4EM0 B;  1YYV A;  2P8T A;  2P6S A;  2CQK A;  2O6G E;  1SMY F;  1FPQ A;  1FSE A;  2RV8 A;  1SAX A;  3LAP A;  2DTR A;  5CVR A;  2VBW A;  4FX0 A;  3QPT A; 
#chains in the Genus database with same CATH topology
 1ZTR A;  1B6A A;  1ZG5 A;  2ZXJ A;  1RNL A;  3SDG A;  4EAT A;  4ENN A;  3CCR I;  4XRS G;  3R4K A;  1CGP A;  4R1H A;  3EPZ A;  4RGS A;  4CYC B;  2V26 A;  4M72 A;  5HVQ C;  3D5R C;  3BG7 A;  4YFX F;  1TP4 A;  1WH7 A;  3HGY A;  2VLA A;  2O03 A;  2E35 A;  2DTZ A;  2D2W A;  3M1E A;  5JLX A;  1FT9 A;  1JE8 A;  3DXJ F;  5A2Q K;  1PP7 U;  2GWR A;  1ZKG A;  1I1G A;  2A61 A;  1VF9 A;  1IDY A;  3TOA A;  4BBR J;  4Q47 A;  2Y0M A;  3T8T A;  2XF5 A;  5BPD A;  5AON A;  3F3X A;  1MBG A;  1SEU A;  1OCO H;  2RQQ A;  1OMI A;  1BI2 A;  2ESH A;  4M3B A;  4L9T A;  4ESJ A;  3CES A;  1HKT A;  4KT6 A;  2WY8 Q;  2X85 A;  2JTV A;  4BDZ A;  2GXB A;  4QPQ A;  2BW3 B;  4JOM A;  1FWZ A;  2VKE A;  2M2E A;  1J75 A;  4CGZ A;  4PUS A;  1JUM A;  2OV7 A;  4O6J A;  2OTJ I;  4Y52 J;  4LG3 A;  1ZQ3 P;  4ZTF A;  4BYY A;  2FOK A;  3E5Q A;  1Y1W J;  1G3T A;  3PIO F;  1F9N A;  2JA7 J;  4N0B A;  5K5O A;  2MD5 A;  2IGK A;  1QU3 A;  2Q2E A;  5M5W J;  5B1A H;  1Y0N A;  4C9Y A;  1BC7 C;  2DK5 A;  4L5E A;  3KFW X;  2W82 A;  5FFX A;  6PAX A;  3L2U A;  2O5R A;  3S15 J;  1JHH A;  1UHW A;  5EZH A;  3VEP A;  2OZ6 A;  2H1K A;  2RGV A;  3WTX C;  1S29 A;  1ON2 A;  4BAC A;  4DGW B;  2K9L A;  4G94 A;  3WTY C;  1OKR A;  3PNV A;  2L5Q A;  2IS1 A;  2DOE A;  1ZR2 A;  1AKH B;  2F5C A;  2KIM A;  1LE8 A;  2TRT A;  5FRN A;  3H3U A;  2QLZ A;  1D8K A;  4FET A;  3WTW C;  5HLH A;  2Y0S N;  1NTC A;  1BR1 A;  1MJB A;  3K1N A;  3ZQF A;  1HW1 A;  5ILU A;  1GT0 C;  2YU3 A;  1O7F A;  2FML A;  4KUM A;  4MLO A;  1E2X A;  2DAO A;  3HPH A;  4I01 A;  5F64 A;  3CD6 I;  1T08 B;  4FQG A;  3V8J A;  3WTZ A;  2DA5 A;  4IJA A;  3IUO A;  2CH0 A;  1FLI A;  2DYS H;  1XDU A;  2KIF A;  3J80 Z;  1N25 A;  3HRU A;  1QBJ A;  2H6C A;  4DYR A;  3JAM K;  1WGX A;  3GLL A;  2KZV A;  1Q1V A;  4B44 A;  3C1D A;  1J59 A;  2QSH X;  2BZT A;  2NVT J;  4MFD A;  3MEX A;  3ABU A;  1I27 A;  3COA C;  3I64 A;  3LL7 A;  2FF4 A;  2CO5 A;  3OYJ A;  1GHC A;  3WGG A;  1DPU A;  4BU2 A;  2L2O A;  3C2H A;  4RLQ A;  5HDG A;  3I71 A;  2W00 A;  2M8E A;  4G7H F;  4A3D J;  4XKW A;  2DFI A;  5F0F A;  1ONV A;  4I7H A;  3TKY A;  2X48 A;  1VQ5 I;  3CDI A;  3MZY A;  4M3G A;  3ERE D;  3K0L A;  1IW7 F;  4QTR A;  3Q0V A;  1XGM A;  2JPB A;  5EJC A;  3JR9 A;  1S9H A;  4Y4R A;  5KCM A;  3HIF A;  4HNT A;  3FHZ A;  4BDY A;  2VPR A;  1J2X A;  2FBK A;  1T8I A;  2V1D A;  3FXU A;  4N9I A;  4FT8 A;  1UMQ A;  3WTT C;  2CV2 A;  5IP7 J;  3P9I A;  1R1V A;  1IDZ A;  4D5C A;  1YE9 A;  3BR1 A;  2H94 A;  2XPW A;  5K7Z A;  2VUM J;  2VJ4 A;  3JRE A;  2HVR A;  3L2C A;  3G3Z A;  1E0E A;  1N78 A;  5ICE A;  2V7F A;  3MCZ A;  5TRD A;  3N97 A;  5C4X J;  3K9T A;  4KMF A;  3S2D J;  5IYD J;  3ECO A;  3NWT A;  5J1Y A;  4D1Q A;  2R7F A;  2DT5 A;  2WB1 N;  1BR2 A;  4OAY A;  1MMS A;  1KA8 A;  1R4M B;  5H2F C;  3KYL A;  2KRC A;  4Y15 A;  1ZK8 A;  3CJN A;  5LHH A;  3GW2 A;  2EH3 A;  2DCE A;  3WE3 A;  3OYG A;  3VWB A;  3AG1 H;  1RUN A;  3GTG J;  4QIW N;  1WFX A;  2OJE D;  5GTI C;  4HF2 A;  4F55 A;  3A01 B;  1TT0 A;  4FTH A;  2ADU A;  1EJ9 A;  4RM2 A;  3VYS B;  4YEJ A;  2YX7 A;  3I59 A;  4XR6 A;  4S04 A;  1IAW A;  2HOE A;  2J5O A;  3D1N I;  1T0F A;  3HPG A;  1R49 A;  3H5R A;  5L3B A;  5HNH A;  1F4K A;  2XAJ A;  3OIO A;  3EUK L;  2EA2 A;  2RAE A;  3HZJ A;  3C2B A;  2ECB A;  3J7Z I;  1ZGA A;  3OS2 A;  5B1B H;  4A3J J;  3VSK A;  1K4T A;  3FK7 A;  5M5Y J;  3DFG A;  3L00 A;  3OYN A;  3GTQ J;  3M1C A;  4XIC A;  2XUB A;  2YR2 A;  2K4J A;  3H0G J;  4OAZ A;  5F04 A;  2Z3Y A;  2OAZ A;  5FKO A;  4PGH A;  4BQO A;  4ESF A;  4CCM A;  2PEX A;  3CCM I;  2VB6 A;  3OYA A;  2DDA A;  3A03 A;  3BQZ A;  3A0B C;  5K1Y A;  5IYC J;  2LMD A;  4RAZ A;  1V3F A;  2EZI A;  2J5P A;  3V7R A;  2CUJ A;  3BJ6 A;  4LK0 F;  2BOL A;  3F6V A;  3WE2 A;  2F5E A;  5F0H A;  1TNT A;  5D5X B;  1ZRC A;  2M7B A;  3ZMD A;  3NRV A;  4G12 A;  3EYY A;  2VON A;  2JWT A;  4RLF A;  3J80 K;  1GUU A;  3ABK H;  3TO9 A;  2MYS A;  2X6W A;  1W5S A;  4WCG A;  1G4D A;  2OQG A;  4IVN A;  1PDN C;  3OS0 A;  1EV7 A;  3OYH A;  4OMY A;  1Y6I A;  4CSW A;  2VOD A;  2DMT A;  2X1D A;  1BJZ A;  1FYL A;  3WTV C;  2EV5 A;  1TWC J;  3HSF A;  4ZDL A;  1QVU A;  2ME6 A;  1PYV A;  3JSP A;  1NG7 A;  2LF8 A;  3H3V K;  2X0L A;  2W84 A;  2DQR A;  2E36 A;  2M30 A;  2QYO A;  1DDN A;  2IS2 A;  2EIL H;  3HKZ N;  2XC7 A;  1JKQ C;  1XS9 A;  2CU7 A;  1KYZ A;  2IGO A;  1L3L A;  2ZME A;  1YJN I;  1ZGW A;  3OYK A;  1XGS A;  3IKV A;  1JGG A;  2DQL A;  5ERI A;  1JT0 A;  1Z3Y A;  2JRM A;  1MW7 A;  3FMS A;  1RET A;  5AIP A;  1I5Z A;  1XX5 A;  3RZD J;  3GYH X;  3TBI A;  4A3G J;  3I4N J;  1QZZ A;  2ID6 A;  1TNS A;  4HG2 A;  4GFB A;  1OCC H;  3WHC A;  3B6C A;  2ZSH B;  2R3S A;  5JVG F;  5E3N A;  1UCR A;  3VDX A;  2DJN A;  3WTU C;  1ETX A;  2EK5 A;  3BR6 A;  1V5E A;  1ZLJ A;  2EIK H;  4WXD A;  1B72 B;  4WF2 A;  3ISP A;  3R60 A;  1QHG A;  2V9K A;  1O3T A;  1MBF A;  1N77 A;  3Q9V A;  1YW7 A;  4Y3O A;  1U9N A;  4DNC A;  1SMT A;  2MA3 A;  5LFA A;  5LRS A;  4CHU A;  2H6B A;  1U3E M;  1V54 H;  2Y9Z A;  2RC4 A;  1PJR A;  4RAF A;  1IZ1 A;  5E1W A;  1X58 A;  1KQ9 A;  3S14 J;  2LLK A;  3VYU B;  2L7Z A;  3N05 A;  3TDZ C;  3HOT A;  1A04 A;  1PVE A;  1R5H A;  3OR1 C;  4ZYE A;  4IZZ A;  1HLV A;  2GA2 A;  3ZMU A;  3FKI J;  5IOZ A;  1ERD A;  3BG9 A;  4CZZ A;  2IT0 A;  4BGD A;  4C2M J;  3HUG A;  1RKT A;  3RQI A;  3ASO H;  2VAS A;  5L3C A;  5JHU A;  4JX6 A;  2Y30 A;  2NNY A;  4BXX J;  3VOE A;  1MH3 A;  3QPS A;  2OBP A;  5E1Z B;  2F5D A;  4XLH A;  1YTY A;  3K1P A;  3G73 A;  1K4S A;  3OYC A;  4KN4 X;  1ETW A;  3E6D A;  3WG9 A;  3SDB A;  3ZQ7 A;  2WA0 A;  4B3X A;  2R93 J;  5ICG A;  3V7C A;  1HF0 A;  4I76 A;  4NB5 A;  5D8L B;  1W0T A;  3SEZ A;  3H9Q A;  2HPM A;  3QOP A;  3V8L A;  3BR0 A;  4B09 A;  3JRI A;  4IEJ A;  1LVK A;  1Z21 A;  2LRD A;  2BVM A;  3HBL A;  3CQZ J;  4CUG A;  3RDI A;  1K61 A;  1ITY A;  2E2I J;  1KU3 A;  1MNE A;  1ODD A;  1X1C A;  1IF1 A;  3GWZ A;  5LEK A;  4EEF G;  4F91 B;  2ZB9 A;  4KN7 X;  3BR5 A;  4RAG A;  3PIP F;  1OJL A;  1HDD C;  4RMN A;  3TMO A;  2K9N A;  4FCY A;  2L7F P;  4I0A A;  3QYE A;  1QO0 D;  2QGU A;  3WU2 C;  1SAN A;  1ZLK A;  1PUF A;  5HNF A;  3HOY J;  5J6X A;  1DQU A;  1E3O C;  2EZK A;  3K4M A;  1UG2 A;  3OYD A;  3W6J B;  4AIK A;  1XSD A;  1YJW I;  4I0B A;  2HI3 A;  3MZ8 A;  2W24 A;  3I9V 2;  1YLF A;  2VBZ A;  3I59 B;  3JRG A;  3RPU D;  2A6T A;  3N4M A;  2UV1 A;  1K6O A;  3FDY A;  1J9I A;  1WI9 A;  3HDD A;  4OIN F;  2LOO A;  3TP3 A;  4YIR X;  2IA1 A;  3F8C A;  1YRN B;  3K1M A;  3GTO J;  1D0Y A;  4UUS B;  2BY0 A;  1A6I A;  2XVC A;  3PFI A;  3E5X A;  1LVA A;  4M6X A;  3MAJ A;  2VC1 A;  2JQ7 A;  3S2H J;  5BS6 A;  3GME A;  3K2Z A;  1IUY A;  1FEX A;  2NS8 A;  3G1O A;  1R23 A;  1X3Z B;  3DBR B;  2EPF A;  4HOB A;  2KJC A;  3SEQ A;  2LKX A;  1RZ4 A;  1MBH A;  2L4A A;  2WV0 A;  4W1U A;  5C3E J;  3CJQ B;  4G6Q A;  5FLX K;  1YS7 A;  3F8F A;  2KL4 A;  4B4C A;  4Q5S F;  2UWM A;  3UNG C;  2XGC A;  3P9K A;  1D5Y A;  1S7A A;  3I55 I;  5IT9 K;  1KQ8 A;  3M9A A;  1U9O A;  5FB2 A;  1JTY A;  1USS A;  3E5U A;  1OCZ H;  3SXY A;  3OYM A;  3MWM A;  1FNN A;  4PZJ A;  4B8X A;  3ML6 A;  1Z05 A;  2JVH A;  2IVM A;  3GLX A;  4P5O A;  1Y39 A;  4IHV A;  1O3R A;  2DOD A;  3K6G A;  4HW0 A;  1IN6 A;  2KDZ A;  3RCO A;  3WGI A;  4MTD A;  5M5X J;  4MEY F;  4BE1 A;  2M7A A;  4KIC A;  4LB5 A;  4V19 K;  2W7N A;  4XLE A;  1XSV A;  3ZRG A;  1RIO H;  4FX4 A;  3BTC A;  5D4S A;  3LSR A;  3AL0 B;  2ECC A;  2M5W A;  2ZBK A;  2E1N A;  1DU6 A;  3SQN A;  1MND A;  2MLG A;  1T33 A;  3ABM H;  4ZC3 A;  4AU7 A;  1WJB A;  3PSF A;  1GVJ A;  1MDM A;  4OIO F;  1H9T A;  2R5Y B;  4EJO A;  2OUM A;  1JHF A;  2G7H A;  2Q8K A;  4PJL A;  3HM5 A;  4IXA A;  2F2E A;  3IAS 2;  2M0M A;  2B0L A;  4LIU A;  3HRT A;  1MJA A;  4HEA 2;  1ZG1 A;  2Y75 A;  4Q4Z F;  3IWZ A;  3K69 A;  3UKG A;  2VJ5 A;  3CMY A;  1EH8 A;  2MFZ A;  2QEN A;  2A5W A;  5K7F A;  2E2H J;  1D8J A;  3CF2 A;  4AWX B;  1JKR C;  3AL0 C;  4KYW A;  2XSJ C;  1TLH B;  2F48 A;  1K78 B;  3ELK A;  3WU1 B;  2JUG A;  2DFH A;  2A05 A;  1FZP B;  2XRO A;  1W1W E;  2QVO A;  1FOK A;  1YI2 I;  4LIV A;  1X1B A;  1BBY A;  3HL2 A;  3MQ0 A;  5H6R A;  4JBA A;  2LBF A;  5J1R A;  5K5Q A;  4AM3 A;  3I0T A;  1MBE A;  1HST A;  3CCU I;  1BI1 A;  1FIP A;  4S0H B;  4RGX A;  3LA3 A;  3J81 K;  1APL C;  4BEH B;  3K4N A;  2E5N A;  3SFI A;  2AQF A;  5J8C A;  5K7H A;  1B1B A;  3M3Y J;  5KHD A;  4RS8 A;  5FLV A;  2DPU A;  3BTJ A;  3KYC B;  1DGR M;  5IOY A;  3R61 A;  2NOJ B;  2R7Q A;  3E7L A;  1TWG J;  3SZP A;  1WJ5 A;  1WZ2 A;  2GBY A;  2XV4 S;  2FJ1 A;  2HWV A;  3TW7 A;  4C2U A;  3OWT A;  2HQR A;  1D3Y A;  3HSR A;  4ANJ A;  1R5I D;  2HYF A;  1XDS A;  3E6C C;  1YJ9 I;  4C3I J;  2PJP A;  5TJJ A;  5DUI A;  4AC0 A;  4RDU A;  3L09 A;  3NWS A;  4MNU A;  2IW5 A;  4L9N A;  4BBS J;  2WY7 Q;  3CCE I;  2C6Y A;  2VL8 A;  2DDB A;  3WG7 H;  1BOB A;  3W6V A;  3OIQ A;  2VIX A;  2VXZ A;  2W57 A;  1KZH A;  2BYV E;  3OY9 A;  2OQR A;  1MKM A;  5JFR A;  1A35 A;  2WBM A;  2HPI A;  2QA4 I;  3SZG A;  2QKM B;  2X4H A;  1GV5 A;  1O7L A;  3KPH A;  5F0C A;  3SYT A;  3SFZ A;  1A5J A;  1BIB A;  1W7P B;  1VQ6 I;  4Z2Y A;  2E7X A;  2NS7 A;  2M4G A;  1TT5 B;  5ICC A;  3J7A O;  4A5M A;  1H88 C;  3PNT A;  1K7A A;  1YQA A;  5D4R A;  3ASN H;  4LLG F;  3LSK A;  1GLN A;  5E17 F;  2K86 A;  2HNH A;  4DJA A;  2LK2 A;  3ZQL A;  2HYJ A;  3F6O A;  3W3C A;  2ZC2 A;  2WAD A;  1F5T A;  1SFE A;  3EQL F;  2OD5 A;  2M1B A;  3OV8 A;  3LA7 A;  5DEQ A;  2X6O A;  1B8I A;  2X1C A;  3GEZ A;  1WCM J;  1XGN A;  1X4O A;  2COM A;  2FEZ A;  2KHM A;  3NAU A;  4KJZ A;  5EYR A;  2DT7 B;  4HNU A;  4MGR A;  4CXF A;  2FQ3 A;  1BI3 A;  1LFU P;  4MEX F;  1WI3 A;  4NC8 A;  2DJI A;  3CLO A;  3KET A;  1WJD A;  2F4I A;  4FE4 A;  4HLX A;  2F5V A;  1Y0U A;  3KP2 A;  2BY1 A;  3VOD A;  2UUZ A;  2CS3 A;  4L9V A;  1MD0 A;  2FU4 A;  5DCM B;  4A6D A;  2MD0 A;  4ENJ A;  3H1C A;  2HR3 A;  2W4S A;  2YS9 A;  3L2Q A;  4ZDO A;  1LDD A;  1TL8 A;  3LWF A;  3HOV J;  2K5C A;  3BJA A;  2W48 A;  4PCQ A;  3ZMV A;  3MKW B;  3HHG A;  2R7W A;  1LUJ B;  3O6B B;  4XKC A;  1PUE E;  1J7K A;  4BY7 J;  1O4X A;  3NQO A;  1IRX A;  1R5G A;  2O0Y A;  3DKX A;  5ILS A;  2O3F A;  1QZE A;  4CZC A;  5BOX A;  1V5F A;  3HSE A;  3HTS B;  4E7L A;  5KAF C;  2DN0 A;  1FTZ A;  4EM1 A;  3CDH A;  4NUB A;  4HLY A;  1FYK A;  2EV6 A;  3W2A A;  3FXM A;  4BKX A;  2GOM A;  3HRM A;  1J09 A;  3T1B A;  3CJT B;  3KE2 A;  2GA1 A;  2Y31 A;  1QZY A;  2H27 A;  3BCB A;  4XMY A;  3RKX A;  4DQ2 A;  4XRF A;  1SD4 A;  2HQ5 A;  4X6A J;  1RKW A;  2RRE A;  1GDT A;  2CQX A;  2LKP A;  3I54 A;  3MMY B;  3CDL A;  3QYB A;  1OIS A;  1YOV B;  2EZH A;  4PJ0 C;  5JLW A;  1O3S A;  1RUO A;  4C2T A;  1U5T B;  2D45 A;  1FMW A;  1OCP A;  3H9G A;  4CCO A;  4A6E A;  4UNO A;  3HYI A;  2IRF G;  3F8M A;  5FD5 A;  4V2G A;  4XN0 A;  2CSO A;  1SFU A;  2HQA A;  1LEB A;  2YSR A;  3BP8 A;  4ZTJ A;  1Z7U A;  3SZT A;  4HX4 A;  1HDP A;  4XBF A;  1DP7 P;  3L1P A;  2KRF A;  2PJR B;  2CW0 F;  1VND A;  3R0A A;  3HHH A;  3RYR A;  3ZN1 A;  2L4M A;  3MZH A;  1YHQ I;  1P92 A;  3BY6 A;  4BHC A;  3G1M A;  4GCV A;  1EF4 A;  1YX5 A;  4N4N B;  5J1U A;  1ORK A;  3O8G A;  4JX4 A;  2EJR A;  2GXA A;  2P0W A;  2JMW A;  4I09 A;  4RB1 A;  1WPK A;  1R1U A;  3IP4 B;  1CF7 A;  1U5T C;  2G9W A;  4XID A;  1LPQ A;  2LP0 A;  2W1O A;  1T98 A;  1XB4 A;  4XM3 A;  2XDV A;  1G59 A;  1E17 A;  3QU6 A;  1QVT A;  5GAG J;  4LJZ F;  1Z77 A;  1WJE A;  1KGS A;  3X2Q H;  3AKZ A;  2XRN A;  4A3C J;  4MFE A;  4N9H A;  1MZB A;  1HCR A;  3DPT A;  4FIS A;  4RGU A;  2R7V A;  3DWL E;  2R5Z B;  4F93 B;  1X1D A;  5DV5 A;  2D5V A;  3GFM A;  4HRI A;  2DI3 A;  4PK4 A;  4ZJZ A;  1AA7 A;  4A3B J;  2FNP A;  1R7J A;  2QKL B;  2IPQ X;  3GZ6 A;  2IA2 A;  4CA0 A;  3WHB A;  2VE9 A;  1POG A;  4PJJ A;  3QPH A;  3FZV A;  2DFE A;  3W2V A;  3A0H C;  2Q1Z B;  3DQV C;  3KLN A;  2HYG D;  2WC2 A;  3HEF A;  4A5N A;  2X9D A;  4U0W A;  3FWE A;  1WJC A;  1AHD P;  3ZMS A;  4XLC A;  1I6H J;  4IHW A;  1OR7 C;  4II3 A;  2DA2 A;  1S6L A;  3RJP A;  1WH5 A;  1STZ A;  4HZF A;  3J7Y J;  1OQY A;  5EDN A;  2P4W A;  2XRL A;  2ETH A;  2DPD A;  3I53 A;  5CVV A;  4U88 A;  2QQA A;  4ENM A;  1MIJ A;  1QGP A;  1TQM A;  1T39 A;  2KLO A;  3IH2 A;  2F6C A;  4YEL A;  5DTD A;  3PQK A;  1I50 J;  1GXQ A;  1Z6R A;  1D1C A;  1SVM A;  2Y9Y A;  5HLT A;  2EWN A;  2V4J C;  1G8X A;  2M8G X;  1FSH A;  3PO3 J;  4EM2 A;  1K83 J;  1YS6 A;  3W2W A;  3LAJ A;  3OL3 A;  4BHB A;  2IGN A;  3GZN B;  1JT6 A;  3H36 A;  3CCL I;  4NQW A;  3OS1 A;  4NDL A;  1IN4 A;  2LY2 A;  4BUP A;  4XL9 A;  1WWX A;  1MMA A;  3K4K A;  4BJ5 C;  1LFB A;  2H8R A;  4XSX F;  4RM3 A;  5F6F A;  3FXO A;  1C0W A;  2KT0 A;  5GP9 A;  2QM3 A;  3RTR A;  1Z0X A;  2VBX A;  1XTA A;  1BM9 A;  3JRA A;  2PX9 A;  1N75 A;  1HQC A;  1A6Q A;  2LVS A;  5F08 A;  4YFK F;  1WVR A;  1MNM C;  4D7N A;  1XPX A;  2VQG A;  1G6N A;  5EEG A;  1W36 C;  1RRJ A;  1J5Y A;  3M8F A;  4OOI A;  3LA2 A;  2OCE A;  3WU0 A;  5K5R A;  1YW9 A;  4PGG A;  2V79 A;  1H9G A;  3E1S A;  3JRC A;  2JVG A;  3OOU A;  2IBD A;  3E3V A;  5EEH A;  4A0Y A;  4Q48 A;  3FM5 A;  2IJL A;  2E5Z A;  1U2W A;  2LNB A;  4XLF A;  3RSN A;  1CQT A;  2FE3 A;  2ISY A;  3QOE A;  4AIH A;  3DPL C;  5DM7 F;  3KP4 A;  3CCQ I;  1UHM A;  4WK8 F;  1IXR C;  1IRG A;  3RZO J;  1FIA A;  2Z99 A;  3HOZ J;  1SFK A;  1VQ8 I;  2TCT A;  2JK3 A;  1XC5 A;  2V6E A;  2ELK A;  2NRA C;  2QBY A;  4FE7 A;  3F72 A;  4IRH A;  4H4K C;  3CC7 I;  4OIQ F;  2ZFW A;  4L9J A;  2Q2E B;  2OF7 A;  2CGP A;  5H6Q A;  5BMZ A;  2CJJ A;  1OYW A;  2CV0 A;  2EFP A;  1RI7 A;  2A5Y B;  4NC6 A;  3EYI A;  3K2A A;  4EQQ A;  2NVQ J;  5J4V A;  2KMU A;  2VQL A;  1MBK A;  2BHZ A;  1X3U A;  3DP7 A;  4EJU A;  2BHY A;  5CLS A;  4MHG A;  3CMA I;  3PO2 J;  4HDV A;  3TO6 A;  1P4A A;  2M4K A;  4XLN F;  1LE8 B;  1NH3 A;  1SVO A;  2IEK A;  2MW8 A;  1YIJ I;  3OYL A;  1D5V A;  4MO7 A;  2MAB A;  3HRS A;  3I3L A;  4YFN F;  3RI4 A;  2LTP A;  2B7E A;  2RKH A;  3S16 J;  3I56 I;  1P9Q C;  4Z6Y A;  4HST A;  1TWF J;  3S93 A;  2HU9 A;  3HOU J;  1WJA A;  3F9K A;  3EUA A;  4LB6 B;  2R4G A;  2R7Z J;  3BR2 A;  4P1W A;  5KAI C;  4LG0 A;  3ZCO A;  4XRM A;  4ZH4 F;  2VXD A;  5HDK A;  3S8P A;  4RB2 C;  1ETY A;  4IO9 F;  5HLG A;  3JTH A;  1ZYR F;  4JX5 A;  4M71 A;  1RR7 A;  2HGC A;  2HXO A;  3HJE A;  4JYK A;  3TDU C;  3LSJ A;  3W6K B;  3CUQ A;  3L2R A;  2R92 J;  2PG4 A;  3JRF A;  1K79 A;  1T95 A;  2KFD A;  1JTX A;  1WRJ A;  1ETV A;  3BTL A;  2ELJ A;  2X51 A;  2P5L C;  1L0O C;  2WV1 A;  4GGG A;  1LDK B;  2K27 A;  4DW6 A;  3KZZ A;  2VT2 A;  1VQ7 I;  3R0J A;  4E7Z A;  1YW8 A;  1X2M A;  2XIG A;  5L3G A;  4E7J A;  5EGO A;  2VKV A;  1ZRF A;  1VFC A;  4KIT B;  4S05 A;  2NYX A;  3IAM 2;  1U0J A;  1O57 A;  4EMS A;  2JA5 J;  1G2H A;  2OCC H;  4WX9 A;  3DBH B;  3JRH A;  4BY1 J;  3DKW A;  1TTY A;  2DMU A;  2HVQ A;  3LFK A;  4M9X A;  3A1Y A;  2STT A;  2V6C A;  2DO7 A;  5ICF A;  3AFH A;  4KDP A;  4UXN A;  2KIQ A;  5KNL A;  5D5V B;  3E6B A;  3GFJ A;  3S17 J;  4XOP A;  1IGN A;  2ESN A;  2PMU A;  4DIQ A;  5CQE A;  2NXN B;  4E4H A;  4E70 A;  1KU2 A;  5EF6 A;  5D5W B;  3JRB A;  2ZNY A;  2FSW A;  3QOD A;  1HBX G;  1SD6 A;  3D5S C;  3ZMT A;  5LHI A;  1FTT A;  2ICW G;  5J3L A;  2HVS A;  4M6V A;  3GTL J;  5LHG A;  2EIN H;  2CUE A;  3GF2 A;  5KVR A;  2PLY A;  4L0Y B;  1MMG A;  3RKY A;  2XAS A;  3CME I;  3GTP J;  4KIB A;  5JHF A;  2K9M A;  1X19 A;  4IOC F;  3ROU A;  3KEQ A;  3LQR A;  2A6H F;  2GAU A;  2ZNZ A;  2HTJ A;  4PFO A;  1OFC X;  1X1A A;  1GV2 A;  4H0E A;  4KIF A;  2VBY A;  3E97 A;  5LGT A;  2BGC A;  1TWA J;  3F8N A;  2LD5 A;  3LFU A;  5GAD J;  1KYW A;  4DZP A;  3OYI A;  2VN2 A;  2B63 J;  4QPO A;  3AG4 H;  1R1T A;  2EFQ A;  2ZXH A;  2VQH A;  4UVB A;  2EV0 A;  3Q0W A;  3RKQ A;  5F1R A;  4FAS D;  4R79 A;  4W97 A;  3EUH A;  1IN5 A;  4BXF A;  1S8N A;  1I39 A;  2E2J J;  3FKJ A;  3K7A J;  4HSR A;  4RA2 A;  1BN5 A;  2M0C A;  1DUX C;  1XG1 A;  4DBQ A;  3L2W A;  1QNT A;  4AVP A;  2R7T A;  2Y2Z A;  2AXT C;  3MKZ A;  1OYY A;  1LDJ A;  3FM3 A;  5CYV A;  2EIJ H;  2FBH A;  3GCM A;  3Q9S A;  1BI0 A;  3O2P E;  1SFX A;  3BG5 A;  1JJ8 C;  4BQQ A;  3AG2 H;  3OYE A;  3CCY A;  3K70 C;  2CG4 A;  1X2N A;  3K4L A;  2A07 F;  1F1Z A;  2JSC A;  4MQV A;  4UB8 C;  3DKY A;  4A3K J;  5DUK A;  1KU7 A;  1MGT A;  3OL4 A;  1BA5 A;  3PL8 A;  5B3S H;  3RPQ A;  2Q0O A;  2P5K A;  3BT9 A;  2WAF A;  4LD5 A;  4CYC A;  1KON A;  1T0F C;  2PMZ A;  3H0D A;  2ELH A;  3U1K A;  2IS4 A;  1W5T A;  4YII A;  3RPU A;  4L0Z B;  2JA2 A;  2DW4 A;  1HW5 A;  5DDG A;  1R6R A;  4UUV A;  4QSH A;  2ZJP F;  1P7I A;  5IP6 A;  4OU0 A;  2KQR A;  5CVJ A;  4ZYA A;  2HOS A;  2TDX A;  3TW6 A;  3JSO A;  4ZDP A;  5DCF A;  3GTM J;  1EA3 A;  4PJM A;  4D0P A;  1H89 C;  3OOP A;  3BG3 A;  2V9V A;  3I4P A;  4C3J J;  2VOO A;  2K9Q A;  2L02 A;  3QPL A;  3OSG A;  3BOQ A;  5DYM A;  4UY8 I;  2ISZ A;  2DOA A;  1W5C C;  5DM6 F;  2BW3 A;  2IP2 A;  1VI0 A;  2HQN A;  2ZME B;  5FLM J;  1LKX A;  2GIV A;  3P5J A;  2VPL A;  2W25 A;  3C2G A;  4Y33 A;  2KKO A;  3CP2 A;  3VSL A;  1OLT A;  1HA8 A;  2HOA A;  2Z33 A;  2LFB A;  3HC7 A;  4P9U A;  3DEE A;  5A2Q Z;  1SD5 A;  3G4S I;  2AXL A;  2WTE A;  3FXK A;  2O7O A;  4XQF A;  4XLP F;  2DMN A;  3S3N A;  2XF6 A;  3I5U A;  2K02 A;  1I1S A;  2DLL A;  3BZK A;  2V1X A;  1LEA A;  5L3F A;  2R7X A;  2P7C B;  3O3K A;  3S3O A;  5KK1 A;  1TWH J;  3DEW A;  2ZME C;  3LST A;  2EQR A;  4M9Z A;  2XAQ A;  2JA6 J;  2XKP A;  2XPU A;  2K40 A;  2W85 A;  5HOD A;  4I99 C;  4HYE A;  1OCR H;  3LSP A;  2R7U A;  3HTU A;  3T5X A;  2M3A A;  3D0S A;  2UXN A;  3PNY A;  4D7M A;  3FMQ A;  1HSJ A;  1Z91 A;  3DCF A;  4HV6 A;  5D6E A;  3SHF A;  2MLK A;  4OIR F;  2NAZ A;  3JTG A;  5L3E A;  3BTI A;  4I6Z A;  2BEO A;  4UUT A;  2XF7 A;  4A93 J;  4BXU A;  4NNJ A;  2DXI A;  3RQ4 A;  5EG0 A;  2A69 F;  3HUG B;  4LOC A;  3DLL F;  1HOM A;  1I3A A;  4CIC A;  1HKQ A;  3F0C A;  5M3F J;  2R7S A;  5JR3 A;  3V7S A;  1E3P A;  2A3S A;  2HKO A;  2DU9 A;  4A0Z A;  1X1P A;  1SD7 A;  3CP8 A;  2XHK A;  4V2F A;  1YX3 A;  4BAY A;  3REO A;  1FC3 A;  1PP8 F;  1IG7 A;  2L9S A;  3ECH A;  5HS9 A;  2EA4 A;  2ZFU A;  4IQJ A;  2NVY J;  1VQO I;  2BBY A;  2M9H A;  2HEO A;  4GO1 A;  1YIO A;  2HTS A;  2OPT A;  4HBL A;  2ME0 A;  1BW6 A;  3H5N A;  1ZN2 A;  1SC7 A;  1VQP I;  3KZY A;  1OPC A;  2JPC A;  3DV8 A;  5IYB J;  2L54 A;  1KU9 A;  4EV0 A;  2QQ9 A;  1XMX A;  2NVX J;  2EB7 A;  1FOW A;  3CCV I;  1RES A;  4M9S A;  2HDD A;  2LG4 A;  4HV5 A;  3V4G A;  2FOW A;  4BQN A;  3E0J B;  1F43 A;  3CUO A;  3K10 A;  2JT1 A;  5HS7 A;  1YIT I;  3JAM Z;  3O8H A;  1PUF B;  2QSG X;  3TO7 A;  4G6T B;  2ZXW H;  1IUF A;  4A69 C;  1Z1D A;  1XCV A;  4AYB N;  2O8X A;  2WAQ A;  5FKK A;  2ACJ A;  3GXO A;  5LRR A;  1VQ9 I;  2ZJR F;  2EIM H;  1P2F A;  3BZC A;  4HX7 A;  2L9R A;  4HF1 A;  3DTK A;  2ZJQ F;  1FJL A;  4U0Y A;  3OR2 C;  2VC0 A;  1NK3 P;  1Y56 A;  1ZHF A;  1IRF A;  4WWC A;  2XPV A;  1WHU A;  2XSD C;  1MBJ A;  3MD2 A;  2R0Q C;  1QRY A;  4IHX A;  2PQ8 A;  4C30 A;  3VPR A;  3J7A Y;  4MIM A;  2VKH A;  2K3P A;  2XB0 X;  2HDW A;  5J47 A;  3IC7 A;  1U8R A;  3K4J A;  4IKF A;  2RNJ A;  3ZGK A;  2F4M B;  4GRI A;  1SAU A;  2K4B A;  2QSF X;  2VJJ A;  2X6X A;  3FMR A;  1ULY A;  2E71 A;  1QHH D;  5J40 A;  4QLC U;  2Z1D A;  2A6E F;  4IRI A;  2JUC A;  3EUH C;  4B1R A;  4J00 A;  3QAH A;  4B43 A;  2PI0 A;  2X1E A;  3PJR A;  3PSI A;  3U1D A;  5CVU A;  3GTK J;  5D6F A;  4I02 A;  1TQI A;  4CO8 A;  1FOX A;  1ZAO A;  4M74 A;  4PFP A;  4IHS A;  2MG4 A;  3DEU A;  2N8G A;  4CCL A;  3RYP A;  4CCK A;  1T38 A;  2E7W A;  3A01 A;  2DA6 A;  4K2E A;  1ETQ A;  2KJB A;  4IL6 C;  3TL4 X;  2CUZ A;  3H3Z A;  4J01 A;  2IA0 A;  3TGN A;  2QQ8 A;  3QP6 A;  1UFM A;  2QZ8 A;  2XKO A;  3A4C A;  2D1H A;  3BWG A;  1TW3 A;  3B73 A;  3TP0 A;  1RC9 A;  3PFY A;  3ZQI A;  4BL0 B;  5F1J A;  5BQT A;  1NG6 A;  2CWE A;  2E34 A;  4OWR B;  4HDU A;  1MH4 A;  3CCJ I;  3GFL A;  2L3D A;  4PSW A;  2CYY A;  2AO9 A;  3IKT A;  2NVU B;  1A31 A;  1QPM A;  1VQK I;  3VYR B;  4EJT A;  1W4M A;  2CQQ A;  2L7M P;  1HKS A;  3LQQ A;  2BXY A;  5GPC A;  4G7O F;  4D9J A;  1VTN C;  1OCT C;  4A3M J;  4P96 A;  2E1C A;  2OA4 A;  3BRO A;  4O3M A;  1D1B A;  1UHS A;  2BY2 A;  2M45 A;  2V9P A;  1EKE A;  3GTJ J;  1MDM B;  1E3H A;  2MBF A;  2P5V A;  4Y13 A;  1BC8 C;  2FX0 A;  2DBB A;  4UB6 C;  2LY1 A;  5IT3 A;  3CTA A;  2CQN A;  1Z7L A;  3M7G A;  2I5U A;  3DLA A;  3ONQ A;  2FBI A;  2PFB A;  1DPR A;  2YPR A;  5E79 C;  3CO7 C;  4BE0 A;  2KRH A;  3QQA A;  4F92 B;  1Y8R B;  2KP6 A;  2FMY A;  4LFU A;  1FP1 D;  1J0R A;  5F27 A;  4BQA A;  4G7Z F;  1B9N A;  4M3D A;  4EJW A;  4B48 A;  2BV6 A;  2DMP A;  2MC3 A;  2JN6 A;  4KFC A;  1JI8 A;  1T2K A;  2RNG A;  1SFO J;  1MJ9 A;  3FK6 A;  3CC2 I;  4HA8 A;  2LBF B;  1P6R A;  1R4N B;  3E6M A;  4ETS A;  4XNF A;  1BIA A;  2FQ4 A;  2RN7 A;  1G3Y A;  3FXL A;  5EG0 B;  5LBQ A;  4BJT A;  5LGU A;  2CFO A;  5ED4 A;  3FIS A;  3HGG A;  4ENK A;  3QP5 A;  2DT6 A;  2MSY A;  4IRG A;  3S1N J;  2H1L A;  5DD8 A;  3BC8 A;  3I58 A;  4LK1 F;  3F23 A;  2FRH A;  3S1Q J;  1BJA A;  4MQ9 F;  4YIF A;  3R6S A;  1OYI A;  1XMK A;  5L3D A;  2CW7 A;  1B59 A;  3FIW A;  3GO5 A;  3LSH A;  3S32 A;  4L5I A;  2Z2S B;  4XKB A;  3KP5 A;  1B72 A;  2R7O A;  4HF0 A;  3CF5 F;  1LJ9 A;  3GX4 X;  4A2U A;  2ID3 A;  2H8W A;  3S1R J;  2I10 A;  4ASN A;  1IV6 A;  5E3O A;  3Q0U A;  2QWW A;  4RB3 C;  2IAI A;  2PMZ N;  5FKN A;  3ZQQ A;  2UXX A;  4EJV A;  4IHY A;  3CMM A;  4RGR A;  2CUF A;  4EGY A;  3LMM A;  2GM4 A;  4NBQ A;  2DMQ A;  5D5U B;  1MMD A;  4D5F A;  3ABL H;  4E7I A;  2QUF A;  3ZXS A;  1ZGJ A;  3HOS A;  1ZRD A;  2EBI A;  4BE2 A;  4IHT A;  5C44 J;  2MC4 A;  4DYQ A;  2OU2 A;  4P55 A;  5J8F A;  1F36 A;  4U7D A;  2EFW A;  4E7K A;  2G7U A;  2PMH A;  2R7D A;  3H92 A;  3GZ5 A;  3K4C A;  4AID A;  1GXP A;  1QQI A;  3G2B A;  1B8I B;  3K70 D;  1R71 A;  3JW4 A;  3U2R A;  4BH9 A;  3U9G A;  1HW2 A;  3MKY B;  1ZG3 A;  3CJR B;  1VQN I;  1RR8 C;  1D0X A;  3ZQH A;  2VI6 A;  4ON0 A;  4YG2 F;  3ZQC A;  4BHP A;  1VQM I;  2EFO A;  2XAG A;  5GPA A;  3IH4 A;  1B9M A;  4LLL A;  4UV8 A;  1LB2 A;  4OMZ A;  3AG3 H;  4RBO A;  3P9C A;  2Z9O A;  4BS9 A;  3C3W A;  1V5G A;  2NNN A;  3ZOB A;  1FYM A;  3ABT A;  3KEO A;  5FFZ A;  3MN2 A;  5HOO A;  3OIP A;  2O9L A;  3KEY A;  3BDD A;  1G3W A;  2QF7 A;  5FKM A;  1H0M A;  1Y8Q B;  2I8D A;  2LF7 A;  2DYR H;  5HDN A;  3CCS I;  1G3S A;  1WQ2 A;  2RDP A;  1TW2 A;  5JI6 A;  2L9N A;  3WTS C;  4ESB A;  2OC6 A;  5FGM A;  2H09 A;  1JJ6 C;  1HXD A;  1AWC A;  1H8A C;  4GYI A;  4PSX A;  4LLN A;  5LD2 C;  3OYB A;  3P7N A;  1S5L C;  2DA4 A;  3JRD A;  2JA8 J;  3ERM A;  5CVI A;  2ZO4 A;  2LSO A;  4E7S A;  2K3F A;  1UST A;  3KP6 A;  1FMV A;  2DFF A;  1AOY A;  4AIJ A;  4NC7 A;  2D1V A;  3RKW A;  3VFZ A;  3ZPL A;  4LIT A;  4CCN A;  4HNV A;  5FJ8 J;  1YRN A;  2HDC A;  4A3L J;  1D0Z A;  4UUS A;  2GLO A;  1U6G A;  4LMY A;  4A3E J;  1IXS B;  1P7J A;  1WKM A;  4R8H A;  1R00 A;  2MH2 A;  2ZJ2 A;  3G1L A;  3KLO A;  1T56 A;  2LY9 A;  5D8K B;  1Z9C A;  4M3E A;  3QYF A;  5E3L A;  5CKT A;  4WXC A;  2DA7 A;  3D5L A;  4AYB A;  2QQB A;  2CMP A;  3DU6 A;  3B02 A;  3GBG A;  4JP0 A;  3L7W A;  1TZL A;  2EZL A;  1TC3 C;  1ETO A;  4ZYH A;  4XOR A;  4A3F J;  1WSU A;  4X1E A;  2XGD A;  1P4W A;  1I6X A;  1FOY A;  4KA4 A;  2O61 A;  5E18 F;  1UB9 A;  1FBU A;  2AHQ A;  2JRT A;  2BE5 F;  1IRZ A;  1IO2 A;  2EFN A;  3GVA A;  4JQF A;  5CJ9 A;  2HKX A;  3Q3S A;  2GQQ A;  2KIS A;  3JCU C;  3TOB A;  2FUG 2;  4JK1 X;  1CF7 B;  2E1M B;  2YX4 A;  4XLA A;  3M8J A;  3FHN A;  2QEX I;  4M3F A;  3IWF A;  3S2W A;  2MH9 A;  1ZAR A;  3LSI A;  4DZJ A;  5EZG A;  5DD4 A;  1Q1H A;  1XN7 A;  3OMY A;  2HFH A;  2P6T A;  1QPI A;  5C4J J;  3ZR8 X;  2WAQ N;  3FF5 A;  1BL0 A;  4HX8 A;  5FLX Z;  1MMN A;  3VB2 A;  4O5V A;  1I3Q J;  3LOC A;  1M1E B;  2M34 A;  5LGN A;  5LEJ A;  2E1M C;  1DU0 A;  1XD7 A;  2JZY A;  5ILV A;  5IT9 Z;  2LYC A;  5GAH J;  1Z6T A;  3BPX A;  2R5Y A;  1S7O A;  4XRS A;  1V55 H;  2XGE A;  3QRF F;  4Y17 A;  3L2V A;  1U78 A;  1JXS A;  1D1A A;  3KX2 A;  2HOT A;  2O8K A;  1UZC A;  2KZG A;  4L5J A;  3IHU A;  4PJN A;  2XB5 A;  5E8G A;  2L9V A;  1DGW Y;  1FX7 A;  3BCA A;  2OTL I;  4IQ4 A;  2OZU A;  3LSG A;  3WOD F;  5LLQ A;  1VZ0 A;  2L7K A;  1B4A A;  1K6Y A;  2HZD A;  1K78 A;  3M4O J;  1FBS A;  1REP C;  3V42 A;  1UJ8 A;  2CFX A;  4E7H A;  3DF8 A;  2FNA A;  4ZYD A;  4GDF A;  4LGW A;  4G9Y A;  2XGX A;  1S3J A;  2HXI A;  1TBX A;  3TQN A;  3CC4 I;  2MGQ A;  2E60 A;  3M8E A;  1LNW A;  3VYT B;  3C7J A;  3OYF A;  1JUS A;  5IY5 H;  3IH3 A;  2JJ7 A;  3H5A A;  3T8R A;  1YO5 C;  4BEH A;  3KZI C;  5FKL A;  4XSZ F;  3FBN B;  5H20 A;  1Z67 A;  4NQW B;  1W7P D;  1NHA A;  1TQP A;  1XSX A;  1R36 A;  3HOX J;  4E6K G;  2VQC A;  1VQ4 I;  4HAM A;  4BJ6 C;  3ZP5 A;  4ZYG A;  4HPQ A;  4GYG A;  2F5F A;  4OIP F;  1BR4 A;  4UVC A;  3ZMZ A;  4Y7N J;  1FBQ A;  2Y0S A;  5EEA A;  1KQ0 A;  2VOP A;  1IXC A;  3CO6 C;  4UVA A;  5CQG A;  3FBI B;  2K7L A;  4WXH A;  3G6E I;  1X3W B;  3UR3 C;  3F22 A;  4ZZD A;  3FXR A;  3BPV A;  4KMU X;  4KIG A;  3J81 Z;  3MVP A;  3HB9 A;  1MSF C;  2CW8 A;  3DTI A;  2Y69 H;  2BVL A;  4N4O B;  5M3M J;  2L0K A;  3CLQ A;  1R22 A;  1W7P A;  3K4B A;  5JVT A;  2IS6 A;  4M73 A;  1ENH A;  1FY7 A;  2FXA A;  3FXJ A;  3FXQ A;  2LC2 A;  2AS5 F;  4DOZ A;  4TV7 A;  1ZR4 A;  2COB A;  4AD9 A;  4I2O A;  3WGH A;  1IV8 A;  2E19 A;  4I98 B;  5E1X A;  2R7R A;  2G0E A;  2P7V B;  3GUD A;  1FP2 A;  1VQL I;  3KCC A;  4PDK A;  1XCB A;  5E3M A;  2M87 A;  4XOT A;  2QBY B;  2WWY A;  5CPR B;  4AUX A;  2GOX B;  2HS5 A;  2VJI A;  2NS0 A;  1ZH5 A;  3BJO A;  3GFI A;  4DYC A;  4A12 A;  3T0Y A;  4IOA F;  3S3M A;  1LQ1 A;  1AU7 A;  3BR3 A;  3NEU A;  5DCM A;  1IN7 A;  1IN8 A;  1UG0 A;  3A02 A;  5E8I A;  3NAR A;  1UEL B;  2FA5 A;  4RB0 A;  2DA3 A;  3EET A;  1BW5 A;  4HQM A;  3KP7 A;  3BG6 A;  1R9T J;  4XKV A;  1S72 I;  2VT3 A;  4M6Y A;  4CYD A;  2BY3 A;  5FD6 A;  3ZN0 A;  2PN6 A;  1HC8 A;  2RVC A;  4EVI A;  2GIZ A;  4RAY A;  2VE8 A;  3DBL B;  2ZKZ A;  3OSF A;  1SVL A;  2A68 F;  5FO5 A;  4II2 A;  2ZCW A;  3PM1 A;  1P4X A;  1IJW C;  1MSE C;  4QWQ A;  4ITV A;  4B47 A;  3IL2 A;  4A0X A;  2Z16 A;  3HOW J;  3Q5F A;  4X0G A;  1DP3 A;  1EH6 A;  2STW A;  4CH7 A;  2LR8 A;  2WB1 A;  1O3Q A;  4LG0 B;  3H9J A;  3PQJ A;  4IF4 A;  5HS8 A;  4XK4 A;  4HQE A;  3I4M J;  5BNG A;  3M07 A;  3FX3 A;  5B5E C;  4CDG A;  3L9F A;  3IRQ A;  1V4R A;  1XGO A;  2ZXI A;  3LSM A;  1ZRE A;  4BNC A;  1NK2 P;  3CUQ B;  3BLY A;  3PUF A;  4J19 A;  4UV9 A;  2UZK A;  1U5T A;  2F4O B;  4P9F A;  4XN3 A;  3KP3 A;  4A3I J;  2V1N A;  1ON1 A;  5J4Y A;  4L18 B;  3B6A A;  3U21 A;  4NHJ A;  3A2K A;  1RPW A;  2QCO A;  1AKH A;  4ABZ A;  4AVZ A;  2BXZ A;  2LRE A;  2P81 A;  1ZEL A;  2KIU A;  1WJF A;  3MFK A;  2PJR A;  5EGO B;  3IV5 A;  5TIS C;  2B9S A;  4U0V A;  5IPA A;  3KIO A;  1T6S A;  3PUB A;  2DOF A;  4IPA A;  4KIS A;  3G71 I;  3DPU A;  3TED A;  3MKL A;  1IC8 A;  3SJM A;  4FHT A;  2Y48 A;  4GXO A;  2CV1 A;  3CUQ C;  3ULQ B;  2VKD A;  4B3A A;  2FD5 A;  2KDO A;  3BQY A;  3ZQG A;  3AAF A;  2K9S A;  2IXS A;  3QWL A;  5DS9 A;  4CCJ A;  2IGM A;  1GVD A;  2XAH A;  5TGT A;  5GAE J;  4YRV A;  1R58 A;  4MTE A;  3S1M J;  2LKS A;  5GTH C;  1XMA A;  2GZW A;  1A36 A;  2LDU A;  1YG2 A;  3RIR A;  2KPM A;  3DU5 A;  4G6D A;  3F8B A;  2R5Z A;  1JUP A;  5E20 A;  1OR7 A;  2DA1 A;  4IX7 A;  1ACI A;  1ETK A;  2XAF A;  1W0U A;  5AIQ A;  2PBI A;  2DK8 A;  5BPI A;  3QU3 A;  3LNQ A;  5B66 C;  3BZ6 A;  2GXG A;  1UAA A;  4U7B A;  1U8B A;  2YU9 J;  3IRR A;  4KNY A;  2K85 A;  5FRO A;  2NOG A;  2E1O A;  2AQE A;  5HLI A;  3V8K A;  1JGS A;  3EDP A;  3HXL A;  4DBR A;  3HKZ A;  4EGZ A;  1W36 D;  2CRG A;  3KYD B;  5IP9 J;  2ZSI B;  9ANT A;  2X6Y A;  1BOA A;  3CZ6 A;  4ZZL A;  1LFP A;  3C18 A;  2WAE A;  3ESW B;  2L01 A;  5FRM A;  4UHT A;  3H35 A;  1Y1V J;  2HZT A;  2Z5U A;  1Z3X A;  1EH7 A;  1S7E A;  4F7Z A;  1YFH A;  2V1U A;  2RQP A;  1JKP C;  4XON A;  3F21 A;  1QA6 A;  4KT5 C;  4G8X A;  4EM0 B;  1X4P A;  1YYV A;  2P8T A;  2CQ7 A;  2YUS A;  2P6S A;  2CQK A;  2O6G E;  4U87 A;  1SMY F;  2JSP A;  1FPQ A;  1FSE A;  2RV8 A;  3DTE A;  4C3H J;  4F3Q A;  2DTR A;  2XAU A;  3LAP A;  1SAX A;  4F52 A;  5CVR A;  2VBW A;  4FX0 A;  3HG9 A;  3QPT A;  2LH9 A;  1JKO C; 
#chains in the Genus database with same CATH homology
 1ZG5 A;  1B6A A;  2ZXJ A;  1RNL A;  4ENN A;  3R4K A;  1CGP A;  4R1H A;  4RGS A;  4M72 A;  5HVQ C;  4YFX F;  2O03 A;  3M1E A;  2D2W A;  1FT9 A;  1JE8 A;  3DXJ F;  5A2Q K;  1PP7 U;  2GWR A;  1I1G A;  2A61 A;  3TOA A;  4Q47 A;  2Y0M A;  3T8T A;  5BPD A;  5AON A;  3F3X A;  1OMI A;  1BI2 A;  2ESH A;  4L9T A;  4ESJ A;  1HKT A;  2JTV A;  2GXB A;  1FWZ A;  1J75 A;  4CGZ A;  4O6J A;  4BYY A;  2FOK A;  3E5Q A;  1G3T A;  1F9N A;  4N0B A;  5K5O A;  2MD5 A;  2Q2E A;  1BC7 C;  2DK5 A;  3KFW X;  5FFX A;  6PAX A;  1JHH A;  1UHW A;  3VEP A;  2OZ6 A;  2RGV A;  3WTX C;  1S29 A;  1ON2 A;  4G94 A;  3WTY C;  1OKR A;  2F5C A;  2KIM A;  3H3U A;  2QLZ A;  1D8K A;  3WTW C;  5HLH A;  1MJB A;  3K1N A;  1HW1 A;  5ILU A;  2YU3 A;  1O7F A;  2FML A;  4KUM A;  1E2X A;  2DAO A;  4I01 A;  5F64 A;  3V8J A;  3WTZ A;  4IJA A;  1FLI A;  1XDU A;  2KIF A;  3J80 Z;  3HRU A;  1QBJ A;  2H6C A;  3JAM K;  3C1D A;  1J59 A;  3MEX A;  3ABU A;  1I27 A;  3COA C;  3I64 A;  2FF4 A;  2CO5 A;  1GHC A;  3WGG A;  1DPU A;  5HDG A;  3I71 A;  4G7H F;  2M8E A;  2DFI A;  1ONV A;  4I7H A;  3TKY A;  3MZY A;  3ERE D;  3K0L A;  1IW7 F;  1XGM A;  2JPB A;  3HIF A;  3FHZ A;  1J2X A;  2FBK A;  2V1D A;  3FXU A;  4N9I A;  4FT8 A;  3WTT C;  3P9I A;  1R1V A;  2H94 A;  3L2C A;  3G3Z A;  5ICE A;  3MCZ A;  5TRD A;  3N97 A;  3K9T A;  4KMF A;  3ECO A;  2R7F A;  2DT5 A;  1KA8 A;  4Y15 A;  3CJN A;  5LHH A;  3GW2 A;  3WE3 A;  1RUN A;  4HF2 A;  2ADU A;  2YX7 A;  3I59 A;  4S04 A;  1IAW A;  2HOE A;  2J5O A;  1T0F A;  5L3B A;  1F4K A;  2XAJ A;  2EA2 A;  1ZGA A;  3DFG A;  3L00 A;  2XUB A;  2YR2 A;  2K4J A;  2Z3Y A;  2OAZ A;  4PGH A;  4ESF A;  2PEX A;  5K1Y A;  4RAZ A;  1V3F A;  2J5P A;  3V7R A;  3BJ6 A;  4LK0 F;  3F6V A;  3WE2 A;  2F5E A;  1TNT A;  5D5X B;  1ZRC A;  3ZMD A;  3NRV A;  2VON A;  3EYY A;  3J80 K;  3TO9 A;  1W5S A;  4WCG A;  1G4D A;  2OQG A;  4IVN A;  1PDN C;  1EV7 A;  4OMY A;  2VOD A;  1FYL A;  3WTV C;  2EV5 A;  3HSF A;  3JSP A;  2LF8 A;  2X0L A;  2W84 A;  2DQR A;  2M30 A;  2QYO A;  1DDN A;  1KYZ A;  1L3L A;  2ZME A;  1XGS A;  3IKV A;  2DQL A;  5ERI A;  3FMS A;  5AIP A;  1I5Z A;  3GYH X;  1QZZ A;  1TNS A;  2R3S A;  1UCR A;  3WTU C;  2EK5 A;  1ZLJ A;  4WXD A;  4WF2 A;  3ISP A;  3R60 A;  1O3T A;  3Q9V A;  1YW7 A;  4DNC A;  1SMT A;  2MA3 A;  5LRS A;  4CHU A;  2H6B A;  1U3E M;  2RC4 A;  1IZ1 A;  5E1W A;  1KQ9 A;  3TDZ C;  3HOT A;  1A04 A;  1R5H A;  4ZYE A;  2GA2 A;  3ZMU A;  4CZZ A;  2IT0 A;  3HUG A;  5L3C A;  5JHU A;  2NNY A;  3VOE A;  2OBP A;  5E1Z B;  2F5D A;  1YTY A;  3K1P A;  3G73 A;  4KN4 X;  3E6D A;  3WG9 A;  3ZQ7 A;  5ICG A;  3V7C A;  5D8L B;  4NB5 A;  3QOP A;  3V8L A;  4B09 A;  3RDI A;  1KU3 A;  1ODD A;  1IF1 A;  3GWZ A;  5LEK A;  4KN7 X;  4I0A A;  1QO0 D;  1ZLK A;  5J6X A;  3W6J B;  4AIK A;  1XSD A;  4I0B A;  2W24 A;  1YLF A;  2VBZ A;  3I59 B;  3N4M A;  1K6O A;  1J9I A;  1WI9 A;  4OIN F;  2IA1 A;  3F8C A;  3K1M A;  2XVC A;  3PFI A;  3E5X A;  1LVA A;  4M6X A;  3MAJ A;  2VC1 A;  5BS6 A;  3K2Z A;  1IUY A;  1R23 A;  4HOB A;  2KJC A;  1RZ4 A;  2L4A A;  2WV0 A;  4G6Q A;  5FLX K;  1YS7 A;  3F8F A;  4Q5S F;  2UWM A;  3P9K A;  1S7A A;  5IT9 K;  1KQ8 A;  3M9A A;  5FB2 A;  1USS A;  3E5U A;  3SXY A;  3MWM A;  1FNN A;  4PZJ A;  4B8X A;  3ML6 A;  1Z05 A;  3GLX A;  2IVM A;  4P5O A;  1O3R A;  4HW0 A;  1IN6 A;  3WGI A;  4MTD A;  4MEY F;  4KIC A;  4LB5 A;  1XSV A;  1RIO H;  4FX4 A;  5D4S A;  2M5W A;  2ZBK A;  2E1N A;  3SQN A;  2MLG A;  1GVJ A;  1MDM A;  4OIO F;  1H9T A;  4EJO A;  1JHF A;  2G7H A;  2Q8K A;  4IXA A;  2F2E A;  2B0L A;  3HRT A;  1MJA A;  1ZG1 A;  2Y75 A;  4Q4Z F;  3IWZ A;  3K69 A;  1EH8 A;  1D8J A;  2QEN A;  4AWX B;  4KYW A;  1TLH B;  1K78 B;  3ELK A;  3WU1 B;  1FZP B;  2XRO A;  2QVO A;  1FOK A;  1BBY A;  3MQ0 A;  5H6R A;  4JBA A;  5K5Q A;  3I0T A;  1HST A;  1BI1 A;  4RGX A;  3LA3 A;  3J81 K;  5J8C A;  1B1B A;  4RS8 A;  2DPU A;  3R61 A;  3SZP A;  2XV4 S;  2HWV A;  2HQR A;  1D3Y A;  3HSR A;  2HYF A;  1XDS A;  3E6C C;  2PJP A;  5TJJ A;  5DUI A;  3L09 A;  4MNU A;  2IW5 A;  4L9N A;  2C6Y A;  2VXZ A;  2W57 A;  2BYV E;  2OQR A;  1MKM A;  5JFR A;  2X4H A;  1O7L A;  3SFZ A;  1BIB A;  1W7P B;  4Z2Y A;  2E7X A;  5ICC A;  3J7A O;  4A5M A;  1K7A A;  1YQA A;  5D4R A;  4LLG F;  5E17 F;  2K86 A;  3F6O A;  1F5T A;  1SFE A;  3EQL F;  2OD5 A;  2M1B A;  3OV8 A;  3LA7 A;  5DEQ A;  3GEZ A;  1XGN A;  2COM A;  2FEZ A;  4CXF A;  4MGR A;  2FQ3 A;  1BI3 A;  4MEX F;  3CLO A;  3KET A;  4HLX A;  1Y0U A;  3KP2 A;  3VOD A;  4L9V A;  5DCM B;  4A6D A;  1MD0 A;  2FU4 A;  4ENJ A;  2HR3 A;  1LDD A;  3LWF A;  3BJA A;  4PCQ A;  3ZMV A;  3HHG A;  3O6B B;  1PUE E;  1J7K A;  3NQO A;  1R5G A;  2O0Y A;  5ILS A;  2O3F A;  5BOX A;  3HSE A;  3HTS B;  4EM1 A;  3CDH A;  4HLY A;  1FYK A;  2EV6 A;  3HRM A;  3T1B A;  3KE2 A;  2GA1 A;  1QZY A;  2H27 A;  3RKX A;  4DQ2 A;  4XRF A;  1SD4 A;  2LKP A;  3I54 A;  1O3S A;  1RUO A;  1U5T B;  2D45 A;  4A6E A;  4UNO A;  3HYI A;  2IRF G;  3F8M A;  5FD5 A;  2CSO A;  1SFU A;  1LEB A;  2YSR A;  3BP8 A;  1Z7U A;  3SZT A;  4HX4 A;  4XBF A;  1DP7 P;  2KRF A;  2CW0 F;  3R0A A;  3HHH A;  3RYR A;  3ZN1 A;  2L4M A;  3MZH A;  1P92 A;  3BY6 A;  4BHC A;  4GCV A;  2EJR A;  4I09 A;  4RB1 A;  1R1U A;  1CF7 A;  1U5T C;  2G9W A;  1T98 A;  1XB4 A;  1E17 A;  3QU6 A;  4LJZ F;  1KGS A;  2XRN A;  4N9H A;  1MZB A;  3DPT A;  4RGU A;  5DV5 A;  3GFM A;  2DI3 A;  2FNP A;  1R7J A;  2IPQ X;  3GZ6 A;  2IA2 A;  2VE9 A;  3QPH A;  3FZV A;  3DQV C;  3KLN A;  2HYG D;  2WC2 A;  4A5N A;  4U0W A;  3FWE A;  3ZMS A;  1S6L A;  3RJP A;  1STZ A;  4HZF A;  2P4W A;  2ETH A;  2DPD A;  3I53 A;  5CVV A;  4U88 A;  2QQA A;  4ENM A;  1QGP A;  1TQM A;  1T39 A;  3PQK A;  1GXQ A;  1Z6R A;  2EWN A;  1FSH A;  4EM2 A;  1YS6 A;  3LAJ A;  4BHB A;  4NQW A;  1IN4 A;  1WWX A;  4XSX F;  5F6F A;  1C0W A;  2QM3 A;  3RTR A;  2VBX A;  1BM9 A;  1HQC A;  4YFK F;  1G6N A;  5EEG A;  1J5Y A;  3M8F A;  4OOI A;  3LA2 A;  3WU0 A;  5K5R A;  1YW9 A;  4PGG A;  2V79 A;  1H9G A;  3E3V A;  5EEH A;  4A0Y A;  4Q48 A;  3FM5 A;  2IJL A;  1U2W A;  2LNB A;  2FE3 A;  2ISY A;  4AIH A;  3DPL C;  3KP4 A;  1UHM A;  4WK8 F;  1IXR C;  1IRG A;  2Z99 A;  2NRA C;  2QBY A;  3F72 A;  4IRH A;  4OIQ F;  2ZFW A;  4L9J A;  2CGP A;  5H6Q A;  5BMZ A;  1OYW A;  2EFP A;  1RI7 A;  2A5Y B;  3EYI A;  4EQQ A;  1X3U A;  3DP7 A;  4EJU A;  5CLS A;  4MHG A;  4HDV A;  3TO6 A;  1P4A A;  4XLN F;  1D5V A;  3HRS A;  4YFN F;  3RI4 A;  2RKH A;  4LB6 B;  4LG0 A;  4ZH4 F;  5HDK A;  4RB2 C;  5HLG A;  3JTH A;  1ZYR F;  4M71 A;  2HGC A;  3TDU C;  3W6K B;  3CUQ A;  2PG4 A;  1K79 A;  1WRJ A;  2P5L C;  1L0O C;  4GGG A;  1LDK B;  2K27 A;  3KZZ A;  2VT2 A;  3R0J A;  1YW8 A;  2XIG A;  5L3G A;  1ZRF A;  4S05 A;  2NYX A;  1O57 A;  4EMS A;  4WX9 A;  3DKW A;  1TTY A;  3LFK A;  4M9X A;  2STT A;  2V6C A;  2DO7 A;  5ICF A;  4KDP A;  4UXN A;  5D5V B;  3E6B A;  3GFJ A;  2ESN A;  2PMU A;  4E70 A;  1KU2 A;  5D5W B;  2ZNY A;  2FSW A;  1HBX G;  1SD6 A;  3ZMT A;  5LHI A;  5LHG A;  3GF2 A;  5KVR A;  2PLY A;  4L0Y B;  3RKY A;  2XAS A;  4KIB A;  3ROU A;  3KEQ A;  3LQR A;  2A6H F;  2GAU A;  2ZNZ A;  2HTJ A;  4H0E A;  4KIF A;  2VBY A;  3E97 A;  5LGT A;  2BGC A;  3F8N A;  1KYW A;  2VN2 A;  1R1T A;  2EFQ A;  4UVB A;  2EV0 A;  5F1R A;  4R79 A;  3EUH A;  1IN5 A;  1S8N A;  1BN5 A;  1DUX C;  1QNT A;  4AVP A;  1OYY A;  1LDJ A;  3FM3 A;  5CYV A;  2FBH A;  3Q9S A;  1BI0 A;  3O2P E;  1SFX A;  2CG4 A;  2A07 F;  1F1Z A;  2JSC A;  4MQV A;  5DUK A;  1KU7 A;  1MGT A;  3RPQ A;  2Q0O A;  2P5K A;  4LD5 A;  2ELH A;  1W5T A;  4YII A;  3RPU A;  4L0Z B;  2DW4 A;  1HW5 A;  5DDG A;  4UUV A;  4OU0 A;  5CVJ A;  2TDX A;  3JSO A;  5DCF A;  4D0P A;  3OOP A;  2V9V A;  3I4P A;  2VOO A;  2L02 A;  3BOQ A;  5DYM A;  2ISZ A;  2IP2 A;  2HQN A;  2ZME B;  2GIV A;  2W25 A;  2KKO A;  2Z33 A;  4P9U A;  5A2Q Z;  1SD5 A;  2AXL A;  2WTE A;  4XLP F;  3I5U A;  2K02 A;  1I1S A;  2DLL A;  2V1X A;  1LEA A;  5L3F A;  2P7C B;  3O3K A;  5KK1 A;  3LST A;  4M9Z A;  2XAQ A;  2XKP A;  2W85 A;  4HYE A;  3HTU A;  3T5X A;  3D0S A;  2UXN A;  3FMQ A;  1HSJ A;  1Z91 A;  4HV6 A;  5D6E A;  3SHF A;  2MLK A;  4OIR F;  2NAZ A;  3JTG A;  5L3E A;  2BEO A;  4BXU A;  2A69 F;  4CIC A;  1HKQ A;  5JR3 A;  3V7S A;  2A3S A;  2HKO A;  2DU9 A;  4A0Z A;  1SD7 A;  2XHK A;  4BAY A;  3REO A;  1FC3 A;  1PP8 F;  3ECH A;  5HS9 A;  2EA4 A;  2BBY A;  2HEO A;  4GO1 A;  1YIO A;  2HTS A;  4HBL A;  1ZN2 A;  3KZY A;  1OPC A;  2JPC A;  3DV8 A;  4EV0 A;  2L54 A;  1KU9 A;  2QQ9 A;  2EB7 A;  4M9S A;  4HV5 A;  3V4G A;  3CUO A;  2JT1 A;  5HS7 A;  3JAM Z;  3TO7 A;  1Z1D A;  1XCV A;  2O8X A;  2ACJ A;  3GXO A;  5LRR A;  1P2F A;  4HX7 A;  4HF1 A;  4U0Y A;  2VC0 A;  1ZHF A;  1IRF A;  4WWC A;  2PQ8 A;  3IC7 A;  1U8R A;  2RNJ A;  2K4B A;  3FMR A;  1ULY A;  4QLC U;  2A6E F;  4IRI A;  3QAH A;  2PI0 A;  3U1D A;  5CVU A;  5D6F A;  4I02 A;  1TQI A;  4CO8 A;  1ZAO A;  4M74 A;  4IHS A;  3DEU A;  3RYP A;  1T38 A;  2E7W A;  4K2E A;  2KJB A;  3H3Z A;  2IA0 A;  3TGN A;  3QP6 A;  1UFM A;  2QZ8 A;  2XKO A;  2D1H A;  3BWG A;  1TW3 A;  3B73 A;  5BQT A;  2CWE A;  4HDU A;  3GFL A;  2L3D A;  2CYY A;  3IKT A;  1QPM A;  4EJT A;  1W4M A;  3LQQ A;  1HKS A;  4G7O F;  1VTN C;  4P96 A;  2E1C A;  2OA4 A;  3BRO A;  4O3M A;  2M45 A;  1MDM B;  2MBF A;  2P5V A;  4Y13 A;  1BC8 C;  2DBB A;  5IT3 A;  3CTA A;  3M7G A;  2FBI A;  2PFB A;  1DPR A;  2YPR A;  3CO7 C;  4LFU A;  2FMY A;  1FP1 D;  1J0R A;  4BQA A;  4G7Z F;  1B9N A;  4EJW A;  2BV6 A;  2MC3 A;  4KFC A;  1T2K A;  1MJ9 A;  4HA8 A;  1P6R A;  3E6M A;  4ETS A;  1BIA A;  2RN7 A;  1G3Y A;  5LBQ A;  5LGU A;  5ED4 A;  4ENK A;  3QP5 A;  4IRG A;  5DD8 A;  3I58 A;  4LK1 F;  3F23 A;  2FRH A;  1BJA A;  4MQ9 F;  4YIF A;  3R6S A;  1OYI A;  1XMK A;  5L3D A;  1B59 A;  3GO5 A;  4L5I A;  3KP5 A;  4HF0 A;  1LJ9 A;  3GX4 X;  4A2U A;  4ASN A;  2QWW A;  4RB3 C;  2UXX A;  4EJV A;  4EGY A;  4RGR A;  5D5U B;  2QUF A;  1ZGJ A;  3HOS A;  1ZRD A;  4IHT A;  2OU2 A;  4P55 A;  5J8F A;  4U7D A;  2EFW A;  2G7U A;  2PMH A;  2R7D A;  3H92 A;  3GZ5 A;  1GXP A;  1QQI A;  3JW4 A;  3U2R A;  4BH9 A;  3U9G A;  1HW2 A;  1ZG3 A;  4ON0 A;  4YG2 F;  4BHP A;  2EFO A;  2XAG A;  1B9M A;  4LLL A;  4UV8 A;  1LB2 A;  4OMZ A;  3P9C A;  2Z9O A;  3C3W A;  2NNN A;  1FYM A;  3ABT A;  3KEO A;  5FFZ A;  5HOO A;  3BDD A;  1G3W A;  1H0M A;  2LF7 A;  5HDN A;  1G3S A;  1WQ2 A;  2RDP A;  1TW2 A;  5JI6 A;  3WTS C;  4ESB A;  5FGM A;  2H09 A;  1HXD A;  1AWC A;  4GYI A;  4LLN A;  3P7N A;  5CVI A;  2ZO4 A;  2LSO A;  1UST A;  3KP6 A;  1AOY A;  4AIJ A;  2D1V A;  3RKW A;  3VFZ A;  3ZPL A;  2HDC A;  1U6G A;  4LMY A;  1IXS B;  1WKM A;  4R8H A;  1R00 A;  2MH2 A;  2ZJ2 A;  3KLO A;  5D8K B;  1Z9C A;  4WXC A;  3D5L A;  2QQB A;  3B02 A;  3L7W A;  4ZYH A;  1WSU A;  4KA4 A;  1P4W A;  1I6X A;  2O61 A;  5E18 F;  1UB9 A;  1FBU A;  2JRT A;  2BE5 F;  3GVA A;  2EFN A;  4JQF A;  5CJ9 A;  2HKX A;  2GQQ A;  3TOB A;  4JK1 X;  1CF7 B;  2YX4 A;  3IWF A;  3S2W A;  2MH9 A;  1ZAR A;  5DD4 A;  1Q1H A;  1XN7 A;  2HFH A;  2P6T A;  3FF5 A;  4HX8 A;  5FLX Z;  3VB2 A;  4O5V A;  5LGN A;  5LEJ A;  1XD7 A;  2JZY A;  5ILV A;  5IT9 Z;  1Z6T A;  3BPX A;  1S7O A;  3QRF F;  4Y17 A;  1U78 A;  1JXS A;  4L5J A;  3IHU A;  5E8G A;  1FX7 A;  3WOD F;  2OZU A;  5LLQ A;  1B4A A;  1K78 A;  1FBS A;  1REP C;  2CFX A;  3DF8 A;  2FNA A;  4ZYD A;  4LGW A;  4G9Y A;  2XGX A;  1S3J A;  3TQN A;  1TBX A;  3M8E A;  1LNW A;  3C7J A;  3T8R A;  1YO5 C;  4XSZ F;  5H20 A;  1W7P D;  1NHA A;  1TQP A;  1XSX A;  1R36 A;  4HAM A;  3ZP5 A;  4ZYG A;  4GYG A;  2F5F A;  4OIP F;  4UVC A;  3ZMZ A;  1FBQ A;  1KQ0 A;  2VOP A;  1IXC A;  3CO6 C;  4UVA A;  2K7L A;  4WXH A;  3F22 A;  4ZZD A;  3FXR A;  3BPV A;  4KMU X;  4KIG A;  3J81 Z;  1R22 A;  1W7P A;  5JVT A;  4M73 A;  1FY7 A;  2FXA A;  3FXQ A;  2AS5 F;  4TV7 A;  4AD9 A;  4I2O A;  3WGH A;  4I98 B;  5E1X A;  2P7V B;  3GUD A;  1FP2 A;  3KCC A;  4PDK A;  1XCB A;  2M87 A;  2QBY B;  2WWY A;  2HS5 A;  2NS0 A;  1ZH5 A;  3BJO A;  3GFI A;  4A12 A;  3T0Y A;  1LQ1 A;  3NEU A;  5DCM A;  1IN7 A;  1IN8 A;  5E8I A;  2FA5 A;  4RB0 A;  3EET A;  4HQM A;  3KP7 A;  2VT3 A;  4M6Y A;  4CYD A;  5FD6 A;  3ZN0 A;  2PN6 A;  2RVC A;  4EVI A;  4RAY A;  2VE8 A;  2ZKZ A;  2A68 F;  5FO5 A;  2ZCW A;  1P4X A;  4QWQ A;  3IL2 A;  4A0X A;  3Q5F A;  1EH6 A;  2STW A;  1O3Q A;  4LG0 B;  5HS8 A;  4IF4 A;  3PQJ A;  4HQE A;  3FX3 A;  4CDG A;  3L9F A;  3IRQ A;  1V4R A;  1XGO A;  1ZRE A;  4BNC A;  3CUQ B;  4UV9 A;  2UZK A;  1U5T A;  4P9F A;  3KP3 A;  1ON1 A;  4L18 B;  4NHJ A;  2KIU A;  3MFK A;  4U0V A;  1T6S A;  4IPA A;  4FHT A;  2Y48 A;  4GXO A;  3CUQ C;  3ULQ B;  3AAF A;  2XAH A;  1R58 A;  4MTE A;  1XMA A;  2GZW A;  2LDU A;  1YG2 A;  3RIR A;  4G6D A;  3F8B A;  5E20 A;  1OR7 A;  2XAF A;  5AIQ A;  2PBI A;  2DK8 A;  5BPI A;  3QU3 A;  3BZ6 A;  2GXG A;  4U7B A;  3IRR A;  4KNY A;  5HLI A;  3V8K A;  1JGS A;  3EDP A;  4EGZ A;  1BOA A;  4ZZL A;  3C18 A;  2L01 A;  4UHT A;  2HZT A;  2Z5U A;  1EH7 A;  1YFH A;  4F7Z A;  2V1U A;  2RQP A;  3F21 A;  4KT5 C;  4G8X A;  4EM0 B;  1YYV A;  2P8T A;  2P6S A;  2CQK A;  2O6G E;  1SMY F;  1FPQ A;  1FSE A;  2RV8 A;  1SAX A;  3LAP A;  2DTR A;  5CVR A;  2VBW A;  4FX0 A;  3QPT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...